1AFPA

Solution structure of the antifungal protein from aspergillus giganteus. evidence for disulphide configurational isomerism
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
51
structure length
51
Chain Sequence
ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords ANTIFUNGAL PROTEIN FROM ASPERGILLUS GIGANTEUS
publication title NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism.
pubmed doi rcsb
source organism Aspergillus giganteus
total genus 6
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1994-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1afpA00
2MHVA 2NB0A 2KCNA 2NBFA 1AFPA
chains in the Genus database with same CATH superfamily
4N8X1 2CCZA 4NXMQ 1Y8NB 1MKHA 4A3GB 3SK6A 5DNFA 4A3BH 1B1ZA 5M3FG 4KKSA 1OO9B 2Q8IB 2K05A 1V1QA 4JI2Q 3TS2A 2E2HB 4HJAA 4ID6A 1VQGA 2CQOA 4FXDA 2D0OA 2SEBD 2M9VA 2F3IA 2B63B 1F9RA 3BVMA 3E9HA 5D14A 2F3WA 3ERQA 5CYUA 4DV1L 4CGYB 3UDIA 3WOEA 4DR6L 4HIDA 4A3MG 3K6OA 5CV6A 3UE0A 1O7LA 2XTIA 5GADC 3TS0A 3HOYG 4RWSC 5IWAL 2ZXPA 5E1FA 2JA8G 2VUMH 1UEBA 3D3RA 4CJ2C 1SYBA 2F0NA 1IBLQ 5HGTA 3PV0A 4CJ0B 2F4VL 1E24A 4GKJL 1EQRA 1SYEA 4DXGA 4DUZL 1XPUA 2BCOA 1G6PA 3RR5A 2IX3A 3VA7A 2OWOA 2FJ2A 3CU7A 1II3A 2VL6A 1LT4D 1SE8A 1HTLD 4A3DG 1QUQB 4DV4Q 2XIWA 3G6EA 2YTXA 1EY6A 4FVMA 5TSSA 1KC8C 1TU2B 3L7ZC 3H0GB 4C1NK 1KNEA 2IWHA 3CXCA 3AEVA 5LMUQ 1DZ1A 4GN5A 5I2XA 2K14A 3GTOB 3HOUB 1Y69U 1SROA 5LMNL 3RZOB 2ATWA 1SE2A 3V96A 2EZVA 1Y1WB 1ONLA 4AQYL 1FR3A 5C0XG 5CV5A 1PH8A 1Q8IA 2KEEA 3GQBA 2NVQH 1HTPA 4RG1A 3CMEA 1J8IA 1UNSA 4YCWA 1MIUA 4DR5Q 3BVGA 1IBMQ 4DR4L 1K3BC 1YHBA 4F7XA 4JOIC 5M3FB 1YVCA 3D4RA 2EJMA 3S9WA 1S40A 1XNRL 5FO9B 2ICEC 3RN2A 3HOZG 2PZUA 3DUZA 5IGEA 3HG9A 3C3LA 5G3LD 1YZ6A 4RKBA 3STBC 2AMCB 5ELDA 4A3MB 1RL2A 4LK1C 1X55A 4B3TL 2Y0SE 2K7VA 2MHVA 3I91A 4A3CG 1KXLA 4KN4C 2JA8B 2M00A 1ZYRD 1SNMA 3VR3A 1EEFD 2DNEA 2JE6I 2N3SA 4BBRG 3MAQA 1QUQA 1YITA 3MWYW 1A3TA 2VB2X 3K0XA 3OW2A 2BH8A 1KD1C 3X3MA 2OF1A 4QQBX 1X3QA 2MGSA 5KGUA 1JWMD 1T9HA 3ERSX 4YWKA 4HCEA 1HR0L 1XX8A 3JAMi 3M4QA 3HOWB 1LACA 3CPFA 1KAAA 4KN7C 4I7ZC 4A3DB 5DEHA 1AN8A 5LHY1 5IT9c 1KTKA 4PG3A 4X65Q 2Q2TA 1AE2A 1B9MA 2OCEA 4QF4A 5DLQE 2GVBA 2RCFA 3E3XA 1IHZA 1CQVA 3IL8A 4LUOA 4H7BA 3AFPA 2A1AA 5IP7H 2Y0SG 1S3OA 1V1PB 4HJ7A 1BBWA 2VQFL 1ASZA 3M4OB 3SR1A 4JBWA 1CFMA 2DJFC 5E4WC 3J80i 3TRZA 4LF6L 3W2DA 3GDEA 1K73C 1VQDA 4PZ7A 1SNCA 3EJIA 5IE8A 3K5OA 4DV3Q 3K59A 3IKJA 1TIID 2NVTB 2CWAA 5D65A 3VYRA 1OXUA 1R9TB 3WOFA 2DY7A 5FO7B 3HKZE 4L8JA 2M2LA 5IGBA 4RFBA 3DLLA 3CCJA 1WTQA 2RVLA 4K0KL 2LY7A 3HOZB 1I50H 2FMCA 4R9WA 4CHTB 5EGTA 3M9BA 5CV8A 3RLNA 2ASBA 2YV5A 1KDBA 2D62A 2IX1A 3J7AF 1SDFA 1Y8OB 3GP7A 1D5ZC 3H3VH 1VMPA 3V05A 3DWPA 4IJLA 2R3ZA 2OQKA 2MUYA 4Y7NB 4BBRB 5FLXL 1DONA 3CCUA 1D5MC 3AB9A 3I4OA 1I3QB 1BNZA 2A6HC 2EY5A 2OXPA 4BY7H 3A54A 1OXVA 3E5SA 4DNRB 3SGIA 1N34Q 1SNOA 2RKSA 4OONA 2PZWA 3F2UA 3E0JA 2A74C 3PMFA 3HGBA 5ELNA 3S2DB 2B2TA 3HKZG 3GTGH 1V1PA 3MZ5A 1SN8A 4RHRA 4B08A 3D0FA 2A5HA 3EIVA 4CDCC 4DAPA 4DA2A 5T1GA 1FYCA 5AFWA 4NDXA 1EEID 3CQZB 4G7ZC 4EX5A 2QF7A 1SLJA 2HD3A 4X62Q 3S16B 2CQAA 4DV7L 3S1NB 1NR4A 1JJCB 3W1GA 2Y0SB 1BF4A 2A19A 3BZKA 4X3KA 3M7GA 2WV6D 1SJHD 2BE5C 1PFBA 3S17B 1AFPA 1EIFA 3HOYH 5C44B 1TWAH 3Q8DA 4DR1L 3K7AB 3OHXC 2JQOA 3OMCA 4NXML 1WCMH 1L1OC 3R2TA 5M3MB 3T56B 1LM0A 5KNCA 2EXZA 4K6LA 1EZ8A 5M5YH 2F4IA 2CW0D 1PH5A 4JI2L 3HS0C 3L0OA 3PGZA 4CBVA 4DK6C 1LTBD 1D1KA 2IL8A 1BBXC 4A75A 4OELB 2VNUD 2OTLA 3OWFA 1L1OB 4IN3A 1WTVA 2WB1E 1VDZA 3I4NH 4WJ3M 4IZ8A 4LUZA 3S2HB 2F0DA 1Q1BA 3DMUA 3Q23A 1IYJB 1XNQQ 3H3VI 2N8NA 4P2CB 1N9WA 1VQHA 2HT1A 2BA1A 1BCPC 3TBIB 1GVPA 1S72A 1PTOC 3UI2A 3I4MH 3NHHA 1IBLL 4ALPA 1JR0D 5JJKA 1NR2A 1O80A 1SJED 4JPBW 2GN5A 3S24A 4XDXA 3HKZB 1EYDA 3EQLC 2ZM6Q 3M4PA 1LTID 1Y8PB 3CC7A 5IGGA 1XMOL 1KNAA 1AH9A 1JWSD 1SNDA 2K5WA 3KLWA 1BCPB 1A3UA 2BH2A 4DV0Q 3X3NA 4DV4L 3CRLC 2QGQA 5I9OA 1T5XD 1FJGL 2LMCB 2EOTA 1UE1A 3AMUA 4X3UA 1J5EQ 2KENA 3HP3A 4I65A 4MHEA 1HH2P 4C3IG 4HSVA 1E1TA 3OYYA 3IFDA 1HFGA 3SVMA 1Z6HA 4JK1C 5LMUL 1RCVD 4P75A 4KI0A 3OWEB 2N78A 4DR2Q 3AU7A 2RCNA 2K4KA 1LT5D 4IUUA 1WFQA 2E2IB 5C6AA 2CVRA 4B9WA 2GVAA 1IBML 4R4CA 4WJWA 3ZYYX 1PA6A 2R93G 1XJVA 3PUYA 4DU9A 1CQFA 2PO4A 4IPHA 3Q0AA 2A68D 2EE1A 1ZEQX 2R61A 1M90C 1WYDA 5IYDG 3NQIA 2FFKB 4GOPC 2K1BA 1IYVA 4A4IA 5KYIA 3PO3B 3S15B 2V4DA 2G9DA 2NWGA 4DAYB 5JJZA 1KDAA 5E4XA 2B2VA 4DF7A 4F87A 2YTVA 5K36H 3CCSA 3C46A 5KYLA 4XTCS 1QZGA 3TP8A 4Y52H 3GTPH 4A3FH 1B9NA 2O2LD 3M3YB 3CCRA 3RZDH 4G4KA 1PDQA 3MHBA 4CJ1B 1U5KA 2TSSA 4I7AA 3GTQH 4LFAQ 5KNDA 4DPGA 2QW7A 3MXPA 1VCIA 2A69C 2F3VA 3CP0A 4QL5A 1OTCA 1TWFB 4POGA 2OT2A 5EPKA 4BA2I 1SR3A 4JI8Q 5CV4A 1K9MC 1UE5A 3HOXH 1SRUA 2JSOA 1QOHA 3HFZB 1Y1VH 5EQ0A 5IP9G 1OXTA 4C3IB 1SFOH 3M4YA 4Q0FA 4IJHA 3TSSA 5C4XG 1W2BA 5C4JB 5LL6S 4ZKCB 2PPBC 4GKKL 1XMQQ 3FKIH 2F0JA 1MD2D 2ZTDA 3HOVH 1O7ZA 3PIO3 5FLXc 2B2UC 1ET6A 1FGBD 3SDZA 4LF9Q 2YU9B 1KDCA 1PTOF 4DV3L 3E9IA 4IFDH 1VQ9A 1PH7A 2F0KA 1PFMA 4DAYA 1XWEA 2R93B 1VQIA 1PH1A 3G48A 2NN6H 1FD7D 1TKWB 2X6GA 2KECA 3ULPA 5GAHC 3HEJA 3A7AB 1VQ4A 1TXYA 2JEBI 2WINB 4DAMA 3A8KE 2FINB 4P72A 4DV2L 1CZWA 1TS2A 4C2MB 1PTOH 4F88A 1YI2A 2B63G 2CFMA 3NBIA 4YHHQ 4JI6L 2K5HA 5IYBH 2HCIA 5IYCH 3B6YA 4KMUC 1SBBB 3KJPA 4RGTA 1EQTA 1I4RA 2N88A 3PUVA 1S4ZA 2HHHQ 1YHAA 2H5XA 2LSSA 4BY1G 3GTJH 5I4DA 3I55A 3CCMA 1DOLA 1SMYC 1B2TA 3I4LA 5FLMG 1BUVT 1SMXA 3T53B 3LGJA 2R7ZH 4IPCA 1U4PA 2UXCQ 3BG3A 3SXHA 2AWNA 4C3JH 1JE5A 2JA7H 3ND9A 1X54A 4KLKA 2KHIA 1G91A 4X3TA 1DM0B 4ULLA 2UUBQ 2EPBA 1HFNA 4X62L 4A3KH 2SNSA 3N6RA 5C4XB 3GTKB 3CAMA 4DV5L 2I07B 2NVXB 3F2BA 4DFAA 3EA6A 4A76A 2E2JH 3FPUB 5BN4A 5LL6X 4AH6A 5FJ8H 1G51A 3CHBD 3K80C 1K3RA 3KOJA 2B2UA 3CCLA 4ZQ3A 4ABNA 2L55A 2Q2UA 1FNUA 4K5XA 2F0SA 1VQCA 5IGCA 3L2PA 4TQUS 2A6ED 1VQFA 2C9OA 4LF4Q 4MZ9A 2EY6A 4APVA 4PZ8A 1K83B 1WVLA 1H9JA 4IFDI 2B2YA 4JI7Q 1NJIC 5ELEA 5C0XJ 4HIKA 2KUMA 1XPOA 2NN6I 4LWCA 4HTHA 2UXDQ 2E76C 4IALA 3GD7A 1S5FD 2NVYB 2LFNA 2F0VA 3BYTB 3EN2A 3FVQA 2F0LA 2E2DC 3I70A 1STEA 4ZYSA 2IY5B 1HZCA 4BXXH 3KLSX 1TWHH 5JEAH 1ICFB 4IUTA 2NB0A 4HCSA 1RD9D 3TMEA 1O7YA 1MBYA 1ILPA 2ZT9C 2EYFA 4KK7A 4A3IG 1GM5A 1CKOA 2EYHA 2WACA 4A93H 3S1RH 5T1IA 1TWCB 4BY1B 5CGKA 1LO5D 5GROA 1VMCA 4O42A 4UP9A 2A73B 4JI3L 1I6HH 3R2IA 2UUAL 5JVG3 1H9RA 1AEXA 1EOVA 3IFTA 4MN3A 1RF2D 1U0LA 2F0WA 3T13A 4J6HA 3UDFA 1LLRD 2K50A 4JW0A 2ZM6L 3S1MH 3C2PA 1KL9A 2DY8A 3RUZA 2RA4A 1VQBA 1C9OA 2DNCA 4HEDA 3T1YQ 1PZKD 2L12A 3CCQA 5IODA 3AFQA 4DV0L 2K28A 1X3FA 3HOWG 3BVZA 3ONAB 2Z9HA 5GQOA 3TREA 4X64Q 4KKTA 1JB3A 4A3EH 1BKBA 3PO2G 4ZK9B 2BOSA 1N33L 4K8JA 2JA6G 4NXNQ 4RA8A 3ER0A 4TSSA 4OX9L 1IXRA 1FGUA 3DWAA 2NBFA 4CKEA 4DR2L 1GUWA 1HQRD 3EBEA 4PMCA 4UPAA 5C3WA 4U68A 1PFSA 2MQHA 2K5QA 1BO0A 1R4PB 3PIOA 3URYA 5IGDA 3NPPA 1EZ6A 4L5TA 4B3MQ 1EOTA 3VR5A 2K5NA 1CA5A 3G6JB 3U58A 1EUJA 4BBSH 4QUCA 4FXKC 1W3SA 1BDOA 1W6JA 3MA2B 3S14B 1RKNA 3T51B 1K0RA 3MC0B 4J8QA 2IHEA 4DKAC 3OW7A 2AHOB 4UP7A 3F1ZA 1PH4A 1STGA 2WKDA 4O1NA 1QZHA 2K5VA 2K52A 3KFUA 1GUTA 1LTSD 2C5CA 1HNZL 4DR7Q 1S5ED 2AKWB 5M5XB 4A3IB 1IYUA 3GTMB 1PYWD 1VQ5A 3D31A 1Q90A 1KRTA 1TS3A 3A8JE 2MP1A 4MTKA 1VQAA 1PV4A 4X3SA 1A15A 1C4QA 4OO1G 2F1MA 1D6EC 2PQAB 3T1HQ 5AJ3L 4PQXA 1B4OA 1VQEA 4JCVE 4LFAL 1SE3A 2XVSA 5J1ZA 1WTPA 4POFA 5BN5A 4DUYL 1VQLA 3I90A 2ZJRA 3MXNB 5JVH3 2F0GA 2D0PA 1WTXA 2PI2A 4UP8A 2K01A 3TP7A 2B2TC 3A8IE 5NUCA 4A3GH 1QWYA 1CTMA 2KOLA 3NTKA 1SYFA 1TQOA 3BDCA 2F0QA 1IBKQ 2ES2A 3RLOA 3FDTA 2CHBD 5IOCA 3PO2B 2E2HH 2JA6B 1MSGA 3STBD 5CC4A 2B63H 4FNFA 4XYQA 2F0TA 4ILWA 2VQEQ 2NTSA 5COYA 4CDFC 1VQ8A 3HKSA 4K8IA 3H6MA 2JA5G 4IO9A 4RKLA 2VW9A 5I6YA 2KHJA 3KF8B 1I94Q 1MSHA 1TS4A 5C44G 2ZTCA 2K03A 4C3HG 4PZ6A 2O4XA 1VQKA 3F2CA 4UY8C 4HJ5A 4XIGS 2F0EA 1F9QA 2KCCA 4A3JG 4RAUC 3RD4A 1DGSA 3PQIA 5EJWA 4OEMB 2G9HD 3SE0A 5M3MG 4DNTB 4KKUA 3CKIB 1CHPD 3SK5A 1LUZA 2Z0SA 5ELBA 4EQNA 2UXBL 2FMMA 4YIJA 4A3LG 1Q3LA 3FEWX 2RHSB 3ULLA 1GUGA 2HCCA 1FVIA 2PQAA 2WAQE 4KV6A 2Q8TA 3K5NA 4YHHL 4N9PA 2IHFA 4JYAQ 4LF5L 4LFBL 3MXNA 3A55A 2XNAC 5J3BA 4QIWB 3H0GH 3U9SA 4IURA 5I9PA 2XN9C 4YY3L 4XQJA 4PMWA 3GTOH 4KY6A 3HOUH 4IUNA 2SOBA 3RZOH 1Y1WH 1Z9FA 2EYOA 2UUCQ 2NZHA 2RBMA 2YYZA 4TVAB 2UXCL 1HUNA 1DXMA 1OXSC 1F2MA 2F0HA 5HURA 3TP6A 2UUBL 4GNXB 4HSPA 3KUPA 5CV9A 5M3FH 4E6IA 1EWHA 1CHQD 1HNXQ 4RHSA 3KF8A 4Z9CB 2L9HA 4KHPQ 4P71A 1EYGA 1UE6A 3A56A 5GAEC 2WAQG 5EPLA 1MJCA 1YBYA 2JEAI 1QB5D 5EPJA 2UU9Q 2B2WA 4DGZA 2JA5B 4LNQA 3J7YW 1VQOA 1PRTC 1NNXA 4A3MH 2HDLA 3I72A 4RCNA 1GOZA 5EKKA 1YNXA 2ZXRA 4C3HB 3J81E 4JG2A 1N32Q 2YTYA 1WTHA 2JA8H 2A6HD 1EIHA 4N9TA 1IKLA 3QJYA 4DR3Q 4XYOA 1BVSA 5I2YA 4A3JB 2R92G 2JXMB 5C3EG 4JI7L 3TQYA 1PRTB 1AZPA 2A8VA 4JI1Q 2F52A 2VY3A 3H15A 1HZBA 3A5UA 2QCPX 3Q22A 1YNJC 2UXDL 1OXXK 5C5LA 1E1OA 1A62A 3HOWH 4XT1B 2KHSA 3SEBA 4A3DH 3R93A 3D6WA 1RDPD 1LTAD 3PCOB 1M4VA 1E2VA 2J4XA 3PO3G 1IL8A 1MJEA 4OXPA 5KNBA 2B2VC 5D3DA 4IOAA 2F0MA 1PLFA 4GNXA 3LX0A 2Q2IA 2BE5D 1J6QA 3D4DA 4HMJA 3M4OH 3A0JA 4EQOA 4IUPA 1L2FA 5C0XH 2CKZB 4G7OC 4NMZA 3D6CA 4FXGC 3J81j 1EIGA 3KJOA 4HR7B 3KYHC 5E7NA 2RDFA 2NVTH 1IZ6A 4DR6Q 1Q1EA 5FO8B 3LWUA 3NELA 4LW1A 1HUMA 1R9TH 3KF6A 1KHIA 5IWAQ 1YJWA 4YCUA 3HOZH 2WAQB 1EQQA 2F0FA 1LABA 3IRBA 1EU3A 1WTWA 1KRSA 2F4VQ 5M5WB 4B3RQ 4K5WA 4K2KA 4GKJQ 4DUZQ 2CH4W 4WJ4A 5EKLA 2OEOA 4JI0Q 4A3BG 4DNIA 1SSOA 2OTJA 1CM9A 1G2SA 3OIPA 5ELOA 4A3CH 1KIXA 1JMCA 1ENCA 3T4AC 1BCPD 1ZXTA 4BBRH 4OO1H 1PTOD 4UAIA 2KBNA 2R92B 1I3QH 1JQYD 1RIPA 2D5DA 5C3EB 1BOSA 2EJFC 4JI5Q 4DR5L 1SYCA 3LNNA 4BWGB 2I0QA 4B3SQ 1A8VA 2JA9A 4WRDA 1VQ7A 2HQLA 3K5MA 1B7YB 1QE6A 3S2DH 4JC0A 5LMNQ 1UAPA 1F9PA 1JOKA 4HAEA 3Q24A 2VUMG 4ZKBB 1SNPA 2L5TA 2FHTA 1STYA 3MFYA 1NBWA 3CQZH 1EFWA 2MNAA 1GO3E 4DV6Q 3CCEA 3S16H 4DR7L 1X65A 3S1NH 1E2ZA 5CBAE 1X56A 3NTHA 4DK1A 1VQ6A 1TWGB 2B8GA 4C56C 1DOKA 1EL0A 1PRTF 1QILA 1BR9A 4NKLA 5HY6A 3U4VA 1LTGD 4NPSA 1IKMA 1N8RC 1ASYA 3S17H 4EVOA 3VR6A 1H9KA 5C44H 1UWVA 2LKVA 2K75A 3HRZC 3K7AH 5C0XI 3GTLB 4H02A 4XT3B 3QOLA 1R4QB 4OWXB 5M3MH 4CDDC 3S1QB 3NEMA 1I5FA 4X65L 3VDYA 1PH3A 1IBKL 1EY9A 3TDQA 1UUPA 2MJ8A 1CUKA 1HA6A 1LYLA 1O78A 3MXUA 3FMCA 2ZJPA 1X3PA 1QNKA 3MXGA 3CD6A 4BS9A 1U4LA 2VQEL 1STAA 3RNUA 4A3BB 2PZTA 1XTCD 3S2HH 1HR0Q 4AYBB 4RGMA 1EIYB 1EYAA 1I94L 3ICEA 4KD3A 1XPRA 2V1CC 5EBCA 1X3EA 1BCPF 2BA0A 1Q86C 3MFGA 1DD2A 3OTOQ 2NTTA 3ULJA 2K04A 4R1JA 3KLSA 1Q82C 3DM1A 3LWEA 2B2YC 2A69D 1AZQA 1HHVA 1TS5A 2VUMB 2X69A 3EVQA 1PYBA 4ZLTF 1JCKB 1GJXA 2BDOA 4TRDA 4EQPA 5CORA 1EY8A 1Z47A 4JYAL 1GHJA 3L9AX 1YJ9A 4LF8Q 5C5MA 1K8MA 1IW7C 1KLGD 3MEHA 3NENA 3U50C 4K0KQ 2PI2E 3MTSA 4HMIA 4YCVA 1X3GA 4M8AA 1N34L 2QEJC 2UUCL 5A2QE 5I6WA 2HIVA 3NSWA 1K8GA 1SXTA 4RCOA 5BR8Q 2E2IH 1P16A 2ZXOA 4IPDA 5IP7G 4TKOB 3R8BA 3QB3A 1LT6D 2ZTEA 1HNXL 4U673 2Z4HA 2NVQB 5EBDA 3QG1A 2DUDA 2Z6KA 4JBMA 1EY0A 3SHLA 2JN4A 5JJLA 3VR4A 1JE4A 3QR8A 3CRKC 2UU9L 3QO2A 1D7QA 3BYYB 3PO3H 3S15H 3P7JA 3PUZA 1SAPA 4FDBA 3KDFA 5ISRA 1S5CD 1SNQA 3PSIA 1E0BA 2QEXA 4OIJA 1RTOA 1CKMA 1TVXA 1YEZA 1X32A 4DR3L 1UE7A 2VXWA 3M3YH 1SMYD 4R8NA 3BJUA 3TZUA 4IUQA 1PVOA 3PUXA 1WJJA 4O2DA 1SE4A 4QY7A 2XGTA 3DEPA 2EVBA 1TWFH 2CH4A 4KJNA 2DJGC 1GUNA 4BY7G 4JV5Q 2KQ3A 3GO5A 1DJRD 1WTOA 3K7UC 4J1MA 4C3IH 3K8AA 4K6DA 4OL7A 1WD0A 2LXJA 2MO1A 1CA6A 4V190 4K2LA 3QIAA 3NTIA 1RJTA 1ZKOA 1XNQL 5C4JH 2ZJQA 4OGQC 1M8AA 1W6KA 3CPWA 4QB4A 4ZAIA 2IX0A 1BQQT 1E22A 1ML0D 3NXWA 2YU9H 5JPNC 1B53A 2PMZE 5IT9E 1H9MA 1G8ZD 1L0WA 4KHZA 2R93H 5JPMC 1O7IA 4KHVA 4KTAA 1VQPA 2I5MX 2EDGA 1V1OA 5ELFA 1A0IA 1FNWA 3K57A 1HA5A 4HN7A 1J5EL 5IYDH 3UDXA 3I2ZA 4IUVA 3WWVA 1JJ2A 2EYMA 1WCMG 4LMQD 1C7YA 2E74C 3H3VC 2AQ1B 2R6GA 4C2MH 2Z8LA 1QCBD 4B3RL 5FOBB 2WKCA 2X6LA 1YHQA 4P73A 2B39A 4JI0L 2D9UA 4DXFA 5IY0A 1I50B 1G6ZA 1XMOQ 2I5LX 4WORA 4FP5D 4XXEA 2B3GA 4QIWE 2QDBA 1ICWA 2H1EA 4ZCKA 5M9OA 1FJGQ 3I4NG 2D2CC 3D8GA 3JAML 1G291 1DYQA 4AIMA 4JI5L 2GA4B 5IIFA 2NZ1D 4B3SL 1M1KC 1B70B 2TMPA 3U9OA 5DM63 3TEHB 2C35B 1ZYRC 1PH9A 2EYLA 4BY7B 2RDHA 4O0AA 5DAUA 3G71A 3I4MG 2AQ3B 3P1HA 2E5LQ 5IP9H 3AYHB 3NQTA 4DV6L 3EROA 3BZDB 3QWNA 4OIKA 5C4XH 3U4ZA 1GXDC 3GTGB 4LF7Q 3GTKH 3J80L 1I4HA 1CT1D 2NVXH 1VF5C 1HJPA 2IPKD 3D4WA 4HJ9A 1U9RA 1XTDA 5JJIA 4GLXA 1L0XB 4BA1I 5CBEE 2K5DA 5E3FA 3BDOA 1EWIA 1GUOA 1WTRA 1D1IA 4OWTB 3J7ZC 1EY7A 2F0IA 3HOYB 1K83H 1H95A 3BS1A 1TWAB 4JI8L 2L1BA 4H0LC 2KJXA 4JBKA 4JI4Q 2RF4A 1NCVA 1WCMB 1X6OA 1HCZA 4K14A 1DCZA 2JYOA 2NVYH 1A6XA 1NMGA 1QNUA 1RHPA 2L0CA 4H44C 5M5YB 1VF7A 1XMQL 1TY2A 3OPOA 3OMGA 2B2WC 2PYKA 3J81L 4IFDJ 3DHQA 4LF9L 3T16A 3NUCA 4N8FA 5FKAC 2RSOA 1LV9A 3I4NB 1BXTA 3OTOL 1D2BA 1TWCH 4BY1H 2PMZB 4B9XA 5FLMH 4ZUIA 1VQJA 2SDFA 1PFNA 2K33A 3PIP3 1MGSA 1HZAA 5IGFA 5K36G 3DM3A 1WI5A 3JAME 5CR3A 4UDUC 5HGQA 5LMNW 4GKKQ 2HIXA 2L4NA 3I4MB 1PZID 2BDNA 4A3FG 1F9SA 5C4ZA 3C1FA 3TP5A 4IQZA 1NAPA 3FPPA 3BDLA 2O5IC 3FHWA 3PF4A 2PQEA 4LF8L 1KAWA 2DGYA 4CKBA 4L5QA 1K8OA 4GN4B 2J7ZA 4JOIA 1JOOA 1EQVA 3NBHB 1TY0A 1JJGA 2HHHL 3J80E 3HOXG 1I4GA 4GNXC 1NTGA 2H4OA 1Y1VG 3W5OA 1BBUA 2PNHA 3K0YA 4ZUJA 2VB3X 4DV2Q 4G7HC 1EU4A 5G3LF 1WD1A 4GLVB 4G57A 4JBJA 1FL0A 5FK9C 4IPGA 5BR8L 2KEDA 4WFN3 3M7NA 1HNWQ 4R4TA 1U4MA 1MHWC 4PV1C 3FKIG 1F77A 3R3OA 1HPCA 3Q6SA 1Q7YC 4LFCQ 5BN3A 3TN2A 3HOVG 4JI6Q 1GUSA 2RSNA 3K5LA 1TT2A 1UEAB 4EGVA 1NUCA 3PUWA 3CF5A 1H9SB 3I7FA 3S14H 1A3VA 1HQMC 4P74A 4R4IA 3J81i 4NW2A 1XYIA 4IFDG 3I8ZA 1JORA 2K6AA 1HR0W 2NN6G 5KEEA 1B8AA 3MVVA 2CW0C 1V43A 5KRUA 1I4XA 4FYDA 3AQQA 3VA5A 2EQSA 3PF5A 1Q81C 5M5XH 4A3IH 3GTMH 1JWUD 3KF6B 4KY5A 1CI3M 4RMFA 5D3IB 3DXJC 4OWWB 4XQQA 4R8IA 2E75C 4IOCA 4X6AH 3CC2A 4LF4L 2PNRC 1Y14B 1D8LA 2KA7A 3HZXA 3F2DA 1E2WA 3V2TA 4Q5VA 1HRJA 4FF1A 2RDGA 4KY7A 2JP1A 4DV5Q 3W1BA 1C0AA 5IYBG 2IJ0A 1C48A 2KCNA 5IYCG 1HZ9A 2WFWA 3NBHA 4LUVA 3N52A 1EYCA 1A2UA 2ALYB 3CMAA 4A3FB 3GTPB 4QCLA 5JEAJ 1N36Q 3RN5A 3RZDB 3BU2A 4JV5L 2EY1A 3CC4A 1TR5A 2N55A 1PHJA 4X66Q 2P5ZX 2HUGA 2L11A 3GTQB 1KABA 2LS01 2R7ZG 4DR4Q 1U4RA 5J39A 1PH2A 2NYZD 2B29A 3NWSA 4L63B 4QJFA 3PO2H 4LJZC 3FRPB 4C3JG 2JA7G 2JA6H 3JC66 1EWCA 5CMDA 1Q46A 5C3XA 3BZCA 3HOXB 3MEFA 1PRTD 1Y1VB 5GAGC 4AYBE 1SFOB 2F03A 1H9SA 4A3KG 4DN4M 3QOJA 3JAMc 1XXGA 3KBXA 3I56A 2F0UA 1JOQA 2XRQD 2JJQA 1GKHA 3O13A 2CWPA 2MO0A 1QVCA 3FKIB 2IW3A 3HOVB 3T1YL 5FJ8G 3VYTA 4DV1Q 3NK9A 2I5HA 4CDEC 3F8TA 2LXKA 1CZGA 3A7LA 1YNJD 1B44D 4X64L 1PYSB 5FLXE 4JI3Q 2UUAQ 3K81C 3L3OC 1PMRA 3KBGA 3J7AV 4NXNL 3J80c 2EJGC 3ITPA 2HQEA 4CKCA 1VQMA 1I6VC 2A68C 3H91A 3NE5B 4AYBG 5A35A 1ENAA 1I4QA 1PTOB 1PZJD 3RMHA 1CKNB 1ESFA 4PNYA 4L5RC 3C1EA 5EAYA 4Y7NH 4ME5A 1K8AC 4BXXG 2WB1G 4FO2A 4DAVA 1QG7A 5JEAG 1X9NA 4B3ML 1KLUD 4L5SA 2KCMA 2EYJA 5ELCA 1JICA 2Z6BA 1N33Q 1CSPA 2QKIC 5KIXA 3A74A 1JC7A 4A93G 1F2LA 3PIPA 3GTJB 4OX9Q 4ZRZA 5CV7A 4KJOA 3OSOA 2E5LL 3NWTA 3DEOA 1CSQA 1STBA 2JK8A 2R7ZB 2HDMA 1L1OA 2EXDA 3ND8A 3KK7A 4MIUA 4AQYQ 3SK8A 2DN8A 2Q8RE 1E3PA 1ILQA 4GLAC 4C3JB 2JA7B 4LF7L 4M1UB 3VYUA 3IAYA 4FF3A 4NB3A 1SYDA 2OQ0A 2IT1A 2MFIA 4PMBA 4ODGA 3J81c 3H94A 1DOMA 1LTLA 4L6TB 4QMGA 4A3KB 5K5PA 2JA5H 4XQNA 1D5XC 4QGUA 1XNRQ 1YNNC 5A2QL 1YIJA 4F8MA 1EFID 3DWQA 4A3EG 1MI2A 3T1HL 1ENFA 2I46A 4C3HH 2E2JB 1JT8A 2AQ2B 2XWJB 4GZYC 1PXUA 2ICIA 4LAAA 5JOBA 4A3JH 1LTTD 1STHA 1HNZQ 5JAVA 2R7DA 4B3TQ 4JI4L 1V9PA 1A63A 4GOPB 2PCFB 1SEBD 1CKNA 5L37A 2AUKA 2XSCA 2KVMA 2Z6KC 2ID0A 4A3LH 4FF2A 1L0YB 1GHKA 2N49A 3SK4A 3OIQA 1ESRA 1WOCA 2L15A 2Z4IA 5AJ3Q 3ZJYC 4BBSG 5J22A 3J7A5 2EIFA 3I73A 4DUYQ 1B50A 1J9OA 1NE3A 3GV6A 2VS1A 4GN3B 1S5DD 2AWOA 2WIIB 3FP9A 1PH6A 4ME3A 5C4HA 1AP0A 4OHJA 3A5ZB 4DK3C 1TWHB 1YNND 2WB1B 1C8CA 4C1NI 1RTNA 1S5BD 1B3QA 3VYSA 5H1SE 1SYGA 3UE1A 3I3CA 3KLRA 1G2TA 2EY2A 1F2YA 2ENBA 4OO1I 1P8LA 4A93B 1Z7TA 3E6ZX 3S1RB 1LT3D 3P20A 3KDFB 4S3SA 1F2ZA 4HIMA 2VZAA 2AUJD 4R4OA 2VQFQ 1I6HB 1STNA 2F0OA 1QVGA 2XRSD 4YWMA 5DM73 1VS0A 4LF6Q 3TZDA 3S1MB 4MTNA 2R7FA 4HJ8A 4JVZA 3GV3A 3VR2A 2QDLA 5EKIA 4YWLA 4DK0A 1QJOA 2Z1CA 4QUFA 5M5WH 4A3GG 2PW5A 3G4SA 1B3AA 4KD4A 4EQ5A 4GOPA 2MPMA 4A3EB 1IL2A 1NY4A 1QVFA 5IT9L 4HIOA 2UXBQ 2RQXA 2F0PA 2G5DA 1VQNA 4NP5A 4RGOS 1EY4A 1HNWL 3CW2C 4UHVA 1KQSA 2J0TD 2R92H 3OOCA 4LFCL 3RLFA 5C3EH 1I4PA 4MNOA 2E8GA 1AE3A 4LF5Q 1A2TA 2K32A 4LFBQ 2B8FA 3CCVA 2RHQB 2SNMA 4J15A 4YY3Q 2XWBB 1CK1A 4KHPL 3P75A 1GD7A 1HXYD 2A6EC 4R4QA 2QA4A 2NUCA 4GS3A 4BBSB 1Q12A 3H09A 3K58A 2EYPA 1V8QA 1AW7A 3G7LA 1IW7D 2PW7A 3W3AA 4FF4A 2NZOA 1T5EA 1TWGH 1N32L 3M85A 4H13C 5F2DA 1NMFA 2QILA 3UDGA 1ET9A 1FNVA 1K28A 2O5JC 1YJNA 4V0BA 2Q2HA 4DV7Q 1K0SA 2WP8J 4RGNA 3WDNA 3NP8A 4JI1L 3E0EA 1NSNS 4RH6A 3H0GG 1Q8KA 1N36L 3GTLH 2KCTA 1JB7A 1EY5A 2FXQA 4K5VA 3HOUG 1RODA 4X66L 3S1QH 1E7ZA 3EFXD 1Y1WG 1LTRD 4DR1Q
chains in the Genus database with same CATH topology
1Y8NB 4A3GB 3SK6A 5DNFA 1B1ZA 4KKSA 1OO9B 2Q8IB 2K05A 2E2HB 4ID6A 4FXDA 2SEBD 2M9VA 2B63B 1F9RA 3BVMA 5D14A 2F3WA 3ERQA 5CYUA 4CGYB 3WOEA 3K6OA 5CV6A 1O7LA 4RWSC 2ZXPA 5E1FA 3D3RA 4CJ2C 1SYBA 2F0NA 5HGTA 3PV0A 4CJ0B 1SYEA 4DXGA 2BCOA 2IX3A 3VA7A 2FJ2A 3CU7A 1II3A 1LT4D 1HTLD 2XIWA 1EY6A 4FVMA 5TSSA 1TU2B 3L7ZC 3H0GB 4C1NK 1KNEA 2IWHA 1DZ1A 5I2XA 3GTOB 3HOUB 1Y69U 3RZOB 1SE2A 3V96A 2EZVA 1Y1WB 1ONLA 1FR3A 5C0XG 5CV5A 1Q8IA 2KEEA 3GQBA 1HTPA 1J8IA 1UNSA 3BVGA 5M3FB 4F7XA 3D4RA 2EJMA 3S9WA 5FO9B 2ICEC 2PZUA 3DUZA 5IGEA 3HG9A 3C3LA 5G3LD 4RKBA 5ELDA 4A3MB 4LK1C 2K7VA 2MHVA 3I91A 4KN4C 2JA8B 2M00A 1ZYRD 1SNMA 3VR3A 1EEFD 2DNEA 2JE6I 3MAQA 3MWYW 1A3TA 2VB2X 3X3MA 2OF1A 1X3QA 2MGSA 5KGUA 1JWMD 4HCEA 1XX8A 3HOWB 1LACA 1KAAA 4KN7C 4I7ZC 4A3DB 5DEHA 1AN8A 5LHY1 1KTKA 1B9MA 4QF4A 1IHZA 1CQVA 3IL8A 4H7BA 1V1PB 3M4OB 3SR1A 4JBWA 1CFMA 5E4WC 3W2DA 1SNCA 3EJIA 3K5OA 3K59A 3IKJA 1TIID 2NVTB 5D65A 3VYRA 1OXUA 1R9TB 3WOFA 2DY7A 5FO7B 4L8JA 2M2LA 5IGBA 4RFBA 1WTQA 2RVLA 2LY7A 3HOZB 2FMCA 4R9WA 4CHTB 5EGTA 5CV8A 1KDBA 2D62A 2IX1A 3J7AF 1SDFA 1Y8OB 3GP7A 1D5ZC 1VMPA 3V05A 3DWPA 2R3ZA 2MUYA 4Y7NB 4BBRB 5FLXL 1DONA 1D5MC 3AB9A 1I3QB 1BNZA 2A6HC 2EY5A 2OXPA 3A54A 1OXVA 3E5SA 4DNRB 1SNOA 2RKSA 2PZWA 3F2UA 3E0JA 2A74C 3PMFA 3HGBA 3S2DB 2B2TA 1V1PA 3MZ5A 4RHRA 4B08A 2A5HA 4DAPA 4DA2A 5T1GA 1FYCA 5AFWA 4NDXA 1EEID 3CQZB 4G7ZC 2QF7A 3S16B 2CQAA 3S1NB 1NR4A 2Y0SB 1BF4A 4X3KA 3M7GA 2WV6D 1SJHD 2BE5C 1PFBA 3S17B 1AFPA 5C44B 3K7AB 3OHXC 3OMCA 3R2TA 5M3MB 3T56B 5KNCA 2EXZA 4K6LA 1EZ8A 2F4IA 2CW0D 3HS0C 4CBVA 1LTBD 1D1KA 2IL8A 1BBXC 2VNUD 3OWFA 4IN3A 1WTVA 1VDZA 4IZ8A 3S2HB 2F0DA 1Q1BA 3DMUA 3Q23A 4P2CB 2BA1A 1BCPC 3TBIB 1PTOC 3UI2A 3NHHA 1JR0D 1NR2A 1O80A 1SJED 4XDXA 3HKZB 1EYDA 3EQLC 1LTID 1Y8PB 5IGGA 1KNAA 1JWSD 1SNDA 2K5WA 1BCPB 1A3UA 3X3NA 3CRLC 5I9OA 1T5XD 2LMCB 2EOTA 3AMUA 4X3UA 3HP3A 4I65A 4MHEA 4C3IG 4HSVA 3IFDA 1HFGA 3SVMA 1Z6HA 4JK1C 1RCVD 4KI0A 3OWEB 3AU7A 1LT5D 4IUUA 2E2IB 5C6AA 2CVRA 4B9WA 4WJWA 3ZYYX 3PUYA 4DU9A 1CQFA 2PO4A 3Q0AA 2A68D 2EE1A 1ZEQX 2R61A 3NQIA 2FFKB 2K1BA 1IYVA 5KYIA 3PO3B 3S15B 2V4DA 2G9DA 2NWGA 5JJZA 1KDAA 5E4XA 2B2VA 4DF7A 4F87A 5K36H 3C46A 5KYLA 4XTCS 3TP8A 1B9NA 2O2LD 3M3YB 4G4KA 1PDQA 3MHBA 4CJ1B 2TSSA 5KNDA 3MXPA 1VCIA 2A69C 2F3VA 1TWFB 2OT2A 5EPKA 4BA2I 5CV4A 2JSOA 1QOHA 5EQ0A 1OXTA 4C3IB 3M4YA 4Q0FA 3TSSA 5C4JB 5LL6S 4ZKCB 2PPBC 2F0JA 1MD2D 1O7ZA 3PIO3 2B2UC 1ET6A 1FGBD 3SDZA 2YU9B 1KDCA 1PTOF 4IFDH 2F0KA 1PFMA 4DAYA 1XWEA 2R93B 2NN6H 1FD7D 1TKWB 2X6GA 2KECA 3HEJA 3A7AB 2WINB 2JEBI 3A8KE 2FINB 1CZWA 1TS2A 4C2MB 1PTOH 4F88A 3NBIA 2HCIA 4KMUC 1SBBB 4RGTA 1EQTA 1I4RA 2N88A 3PUVA 1S4ZA 5I4DA 1DOLA 1SMYC 1B2TA 3I4LA 1BUVT 3T53B 1U4PA 3BG3A 3SXHA 2AWNA 3ND9A 1G91A 4X3TA 1DM0B 4ULLA 2EPBA 1HFNA 2SNSA 3N6RA 5C4XB 3GTKB 2I07B 2NVXB 4DFAA 3EA6A 3FPUB 5BN4A 5LL6X 3CHBD 2B2UA 4ZQ3A 4ABNA 2L55A 1FNUA 4K5XA 2F0SA 5IGCA 4TQUS 2A6ED 2C9OA 2EY6A 1K83B 1WVLA 1H9JA 4IFDI 2B2YA 5ELEA 5C0XJ 2KUMA 2NN6I 4HTHA 2E76C 4IALA 3GD7A 1S5FD 2NVYB 2LFNA 2F0VA 3BYTB 3FVQA 2F0LA 2E2DC 3I70A 1STEA 4ZYSA 3KLSX 5JEAH 4IUTA 2NB0A 4HCSA 1RD9D 3TMEA 1O7YA 1MBYA 1ILPA 2ZT9C 2EYFA 4KK7A 2EYHA 2WACA 5T1IA 1TWCB 4BY1B 5CGKA 1LO5D 1VMCA 4O42A 2A73B 3R2IA 5JVG3 1H9RA 1AEXA 3IFTA 4MN3A 1RF2D 2F0WA 3T13A 4J6HA 1LLRD 3C2PA 2DY8A 3RUZA 2RA4A 2DNCA 4HEDA 1PZKD 2L12A 5IODA 2K28A 3BVZA 3ONAB 4KKTA 1JB3A 4ZK9B 2BOSA 4K8JA 4RA8A 4TSSA 3DWAA 2NBFA 4CKEA 1GUWA 1HQRD 4PMCA 5C3WA 4U68A 2K5QA 1BO0A 1R4PB 3URYA 5IGDA 3NPPA 1EZ6A 1EOTA 3VR5A 1CA5A 3G6JB 4QUCA 4FXKC 1BDOA 1W6JA 3MA2B 3S14B 1RKNA 3T51B 3MC0B 4J8QA 3OW7A 1STGA 2WKDA 4O1NA 1GUTA 1LTSD 2C5CA 1S5ED 5M5XB 4A3IB 1IYUA 3GTMB 1PYWD 3D31A 1Q90A 1TS3A 3A8JE 2MP1A 4X3SA 1A15A 1C4QA 4OO1G 2F1MA 1D6EC 4PQXA 1B4OA 1SE3A 2XVSA 5J1ZA 1WTPA 5BN5A 3I90A 5JVH3 2F0GA 1WTXA 2K01A 3TP7A 2B2TC 3A8IE 5NUCA 1QWYA 1CTMA 2KOLA 3NTKA 1SYFA 1TQOA 3BDCA 2F0QA 3FDTA 2CHBD 5IOCA 3PO2B 2JA6B 1MSGA 5CC4A 4FNFA 4XYQA 2F0TA 4ILWA 2NTSA 5COYA 4K8IA 3H6MA 4RKLA 5I6YA 1MSHA 1TS4A 2K03A 4C3HG 2O4XA 4XIGS 2F0EA 1F9QA 2KCCA 4RAUC 3RD4A 5EJWA 2G9HD 3SE0A 4DNTB 4KKUA 3CKIB 1CHPD 3SK5A 5ELBA 4EQNA 2FMMA 4YIJA 1Q3LA 3FEWX 1GUGA 2HCCA 4KV6A 2Q8TA 3K5NA 4N9PA 3MXNA 3A55A 2XNAC 4QIWB 3U9SA 4IURA 5I9PA 2XN9C 4XQJA 4PMWA 4KY6A 4IUNA 2SOBA 2EYOA 2RBMA 2YYZA 1HUNA 1DXMA 1OXSC 1F2MA 2F0HA 5HURA 3TP6A 4HSPA 3KUPA 5CV9A 4E6IA 1EWHA 1CHQD 4RHSA 3KF8A 4Z9CB 2L9HA 3A56A 5EPLA 2JEAI 1QB5D 5EPJA 2B2WA 4DGZA 2JA5B 3J7YW 1PRTC 2HDLA 3I72A 4RCNA 1GOZA 5EKKA 2ZXRA 4C3HB 3J81E 2A6HD 1EIHA 4N9TA 1IKLA 3QJYA 4XYOA 4A3JB 5I2YA 2JXMB 1PRTB 1AZPA 2QCPX 3Q22A 1YNJC 1OXXK 5C5LA 4XT1B 2KHSA 3SEBA 3R93A 3D6WA 1RDPD 1LTAD 1M4VA 1E2VA 2J4XA 1IL8A 5KNBA 2B2VC 5D3DA 2F0MA 1PLFA 3LX0A 2BE5D 3D4DA 4HMJA 4EQOA 4IUPA 5C0XH 4G7OC 4NMZA 3D6CA 4FXGC 1EIGA 4HR7B 2RDFA 1Q1EA 5FO8B 3LWUA 1HUMA 2WAQB 2F0FA 1LABA 1EU3A 1WTWA 5M5WB 4K5WA 4K2KA 5EKLA 2OEOA 1SSOA 1CM9A 1G2SA 3OIPA 1ENCA 3T4AC 1BCPD 1ZXTA 4OO1H 1PTOD 4UAIA 2R92B 1JQYD 2D5DA 5C3EB 1BOSA 2EJFC 1SYCA 3LNNA 4BWGB 4WRDA 3K5MA 1QE6A 1UAPA 1F9PA 1JOKA 4HAEA 3Q24A 4ZKBB 1SNPA 2L5TA 2FHTA 1STYA 3MFYA 1E2ZA 5CBAE 3NTHA 4DK1A 1TWGB 2B8GA 4C56C 1DOKA 1EL0A 1PRTF 1QILA 1BR9A 4NKLA 1LTGD 1IKMA 4EVOA 3VR6A 1H9KA 2LKVA 3HRZC 5C0XI 3GTLB 4XT3B 3QOLA 1R4QB 3S1QB 1EY9A 3TDQA 1UUPA 2MJ8A 1HA6A 1O78A 3MXUA 3FMCA 1X3PA 1QNKA 3MXGA 4BS9A 1U4LA 1STAA 4A3BB 2PZTA 1XTCD 4AYBB 4RGMA 1EYAA 4KD3A 5EBCA 1BCPF 2BA0A 3MFGA 1DD2A 2NTTA 2K04A 3KLSA 3DM1A 3LWEA 2B2YC 2A69D 1AZQA 1HHVA 1TS5A 2VUMB 2X69A 3EVQA 4ZLTF 1GJXA 1JCKB 2BDOA 4TRDA 4EQPA 5CORA 1EY8A 1Z47A 1GHJA 3L9AX 5C5MA 1K8MA 1IW7C 1KLGD 3MEHA 3MTSA 4HMIA 4M8AA 2QEJC 5A2QE 5I6WA 3NSWA 1SXTA 4RCOA 2ZXOA 4TKOB 3R8BA 3QB3A 1LT6D 4U673 2Z4HA 2NVQB 5EBDA 3QG1A 1EY0A 3SHLA 3VR4A 1JE4A 3CRKC 3QO2A 3BYYB 3P7JA 3PUZA 1SAPA 5ISRA 1S5CD 1SNQA 1E0BA 4OIJA 1RTOA 1TVXA 1X32A 2VXWA 1SMYD 4R8NA 3TZUA 4IUQA 3PUXA 1SE4A 3DEPA 2EVBA 4KJNA 1GUNA 2KQ3A 3GO5A 1DJRD 1WTOA 4J1MA 4K6DA 4OL7A 1WD0A 1CA6A 4V190 4K2LA 3QIAA 3NTIA 1RJTA 1ZKOA 4OGQC 1M8AA 1W6KA 4QB4A 4ZAIA 2IX0A 1BQQT 1ML0D 3NXWA 5JPNC 1B53A 5IT9E 1H9MA 1G8ZD 4KHZA 5JPMC 4KHVA 4KTAA 2EDGA 1V1OA 5ELFA 1FNWA 3K57A 1HA5A 4HN7A 4IUVA 2EYMA 4LMQD 2E74C 3H3VC 2AQ1B 2R6GA 2Z8LA 1QCBD 5FOBB 2WKCA 2X6LA 2B39A 2D9UA 4DXFA 1I50B 1G6ZA 4WORA 4FP5D 4XXEA 2QDBA 1ICWA 2H1EA 5M9OA 2D2CC 3D8GA 3JAML 1G291 1DYQA 2GA4B 5IIFA 2NZ1D 2TMPA 3U9OA 5DM63 1ZYRC 2EYLA 4BY7B 2RDHA 5DAUA 2AQ3B 3P1HA 3NQTA 3EROA 3BZDB 3QWNA 4OIKA 1GXDC 3GTGB 3J80L 1I4HA 1CT1D 1VF5C 2IPKD 3D4WA 1U9RA 1L0XB 4BA1I 5CBEE 2K5DA 5E3FA 3BDOA 1GUOA 1WTRA 1D1IA 1EY7A 2F0IA 3HOYB 3BS1A 1TWAB 2L1BA 4H0LC 2KJXA 1NCVA 1WCMB 1HCZA 4K14A 1DCZA 2JYOA 1A6XA 1QNUA 1RHPA 2L0CA 4H44C 5M5YB 1VF7A 1TY2A 3OPOA 3OMGA 2B2WC 2PYKA 3J81L 4IFDJ 3DHQA 3T16A 3NUCA 5FKAC 2RSOA 1LV9A 3I4NB 1BXTA 1D2BA 2PMZB 4B9XA 4ZUIA 2SDFA 1PFNA 2K33A 3PIP3 1MGSA 5IGFA 5K36G 3JAME 5CR3A 4UDUC 2L4NA 3I4MB 1PZID 2BDNA 1F9SA 5C4ZA 3C1FA 3TP5A 4IQZA 1NAPA 3FPPA 3BDLA 2O5IC 2PQEA 4CKBA 1K8OA 2J7ZA 1JOOA 1EQVA 1TY0A 3J80E 1I4GA 2H4OA 3K0YA 4ZUJA 2VB3X 4G7HC 1EU4A 5G3LF 1WD1A 4G57A 5FK9C 2KEDA 4WFN3 3M7NA 1U4MA 4PV1C 1F77A 3R3OA 1HPCA 3Q6SA 5BN3A 3TN2A 1GUSA 2RSNA 3K5LA 1TT2A 1UEAB 4EGVA 1NUCA 3PUWA 1H9SB 1A3VA 1HQMC 4NW2A 1XYIA 4IFDG 3I8ZA 1JORA 2K6AA 2NN6G 5KEEA 3MVVA 2CW0C 1V43A 5KRUA 1I4XA 4FYDA 3VA5A 1JWUD 5D3IB 4KY5A 1CI3M 3DXJC 4XQQA 4R8IA 2E75C 2PNRC 2KA7A 3HZXA 1E2WA 3V2TA 4Q5VA 1HRJA 4FF1A 2RDGA 4KY7A 2JP1A 2IJ0A 1C48A 2KCNA 3NBHA 3N52A 1EYCA 1A2UA 4QCLA 3GTPB 4A3FB 5JEAJ 3RZDB 2EY1A 1TR5A 2N55A 2HUGA 2L11A 3GTQB 1KABA 2LS01 1U4RA 5J39A 2NYZD 3NWSA 4L63B 4LJZC 3FRPB 4C3JG 1EWCA 5CMDA 5C3XA 3HOXB 1PRTD 1Y1VB 1SFOB 2F03A 1H9SA 4DN4M 3QOJA 1XXGA 3KBXA 2F0UA 1JOQA 2XRQD 3O13A 3FKIB 2IW3A 3HOVB 3VYTA 3NK9A 1CZGA 3A7LA 1YNJD 1B44D 5FLXE 3L3OC 1PMRA 3KBGA 3J7AV 2EJGC 3ITPA 2HQEA 4CKCA 1I6VC 2A68C 3H91A 3NE5B 5A35A 1ENAA 1I4QA 1PTOB 1PZJD 3RMHA 1ESFA 4PNYA 3C1EA 4ME5A 4FO2A 4DAVA 1QG7A 5JEAG 1KLUD 2EYJA 5ELCA 1JICA 2QKIC 5KIXA 1JC7A 1F2LA 3GTJB 4ZRZA 5CV7A 4KJOA 3OSOA 3NWTA 3DEOA 1STBA 2R7ZB 2HDMA 3ND8A 3KK7A 4MIUA 3SK8A 2DN8A 2Q8RE 1ILQA 4C3JB 2JA7B 4M1UB 3VYUA 3IAYA 4FF3A 1SYDA 2IT1A 4PMBA 4ODGA 3H94A 1DOMA 4L6TB 4QMGA 4A3KB 5K5PA 4XQNA 1D5XC 1YNNC 5A2QL 4F8MA 1EFID 3DWQA 1MI2A 1ENFA 2I46A 2E2JB 2AQ2B 2XWJB 4GZYC 1PXUA 2ICIA 4LAAA 5JOBA 1LTTD 1STHA 5JAVA 2PCFB 1SEBD 2AUKA 2XSCA 2KVMA 2ID0A 4FF2A 1L0YB 1GHKA 3SK4A 3OIQA 1ESRA 2Z4IA 5J22A 3I73A 1B50A 1J9OA 3GV6A 1S5DD 2AWOA 2WIIB 5C4HA 1AP0A 4OHJA 1TWHB 1YNND 2WB1B 1C8CA 4C1NI 1RTNA 1S5BD 3VYSA 1SYGA 3I3CA 3KLRA 1G2TA 2EY2A 1F2YA 2ENBA 4OO1I 4A93B 1Z7TA 3E6ZX 3S1RB 1LT3D 3P20A 4S3SA 1F2ZA 2AUJD 1I6HB 1STNA 2F0OA 2XRSD 5DM73 3TZDA 3S1MB 3GV3A 3VR2A 5EKIA 4DK0A 1QJOA 2Z1CA 4QUFA 2PW5A 1B3AA 4KD4A 2MPMA 4A3EB 5IT9L 2RQXA 2F0PA 4NP5A 4RGOS 1EY4A 2J0TD 3OOCA 3RLFA 1I4PA 1A2TA 2K32A 2B8FA 2SNMA 2XWBB 1CK1A 3P75A 1HXYD 2A6EC 2NUCA 4BBSB 1Q12A 3H09A 3K58A 2EYPA 1V8QA 1AW7A 3G7LA 1IW7D 2PW7A 3W3AA 4FF4A 1T5EA 3M85A 4H13C 5F2DA 2QILA 1ET9A 1FNVA 2O5JC 4V0BA 2WP8J 4RGNA 3WDNA 3NP8A 1NSNS 4RH6A 1EY5A 4K5VA 1RODA 3EFXD 1LTRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHV A;  2NB0 A;  2KCN A;  2NBF A;  1AFP A; 
#chains in the Genus database with same CATH topology
 4N8X 1;  2CCZ A;  4NXM Q;  1Y8N B;  1MKH A;  4A3G B;  3SK6 A;  5DNF A;  4A3B H;  1B1Z A;  5M3F G;  4KKS A;  1OO9 B;  2Q8I B;  2K05 A;  1V1Q A;  4JI2 Q;  3TS2 A;  2E2H B;  4HJA A;  4ID6 A;  1VQG A;  2CQO A;  4FXD A;  2D0O A;  2SEB D;  2M9V A;  2F3I A;  2B63 B;  1F9R A;  3BVM A;  3E9H A;  5D14 A;  2F3W A;  3ERQ A;  5CYU A;  4DV1 L;  4CGY B;  3UDI A;  3WOE A;  4DR6 L;  4HID A;  4A3M G;  3K6O A;  5CV6 A;  3UE0 A;  1O7L A;  2XTI A;  5GAD C;  3TS0 A;  3HOY G;  4RWS C;  5IWA L;  2ZXP A;  5E1F A;  2JA8 G;  2VUM H;  1UEB A;  3D3R A;  4CJ2 C;  1SYB A;  2F0N A;  1IBL Q;  5HGT A;  3PV0 A;  4CJ0 B;  2F4V L;  1E24 A;  4GKJ L;  1EQR A;  1SYE A;  4DXG A;  4DUZ L;  1XPU A;  2BCO A;  1G6P A;  3RR5 A;  2IX3 A;  3VA7 A;  2OWO A;  2FJ2 A;  3CU7 A;  1II3 A;  2VL6 A;  1LT4 D;  1SE8 A;  1HTL D;  4A3D G;  1QUQ B;  4DV4 Q;  2XIW A;  3G6E A;  2YTX A;  1EY6 A;  4FVM A;  5TSS A;  1KC8 C;  1TU2 B;  3L7Z C;  3H0G B;  4C1N K;  1KNE A;  2IWH A;  3CXC A;  3AEV A;  5LMU Q;  1DZ1 A;  4GN5 A;  5I2X A;  2K14 A;  3GTO B;  3HOU B;  1Y69 U;  1SRO A;  5LMN L;  3RZO B;  2ATW A;  1SE2 A;  3V96 A;  2EZV A;  1Y1W B;  1ONL A;  4AQY L;  1FR3 A;  5C0X G;  5CV5 A;  1PH8 A;  1Q8I A;  2KEE A;  3GQB A;  2NVQ H;  1HTP A;  4RG1 A;  3CME A;  1J8I A;  1UNS A;  4YCW A;  1MIU A;  4DR5 Q;  3BVG A;  1IBM Q;  4DR4 L;  1K3B C;  1YHB A;  4F7X A;  4JOI C;  5M3F B;  1YVC A;  3D4R A;  2EJM A;  3S9W A;  1S40 A;  1XNR L;  5FO9 B;  2ICE C;  3RN2 A;  3HOZ G;  2PZU A;  3DUZ A;  5IGE A;  3HG9 A;  3C3L A;  5G3L D;  1YZ6 A;  4RKB A;  3STB C;  2AMC B;  5ELD A;  4A3M B;  1RL2 A;  4LK1 C;  1X55 A;  4B3T L;  2Y0S E;  2K7V A;  2MHV A;  3I91 A;  4A3C G;  1KXL A;  4KN4 C;  2JA8 B;  2M00 A;  1ZYR D;  1SNM A;  3VR3 A;  1EEF D;  2DNE A;  2JE6 I;  2N3S A;  4BBR G;  3MAQ A;  1QUQ A;  1YIT A;  3MWY W;  1A3T A;  2VB2 X;  3K0X A;  3OW2 A;  2BH8 A;  1KD1 C;  3X3M A;  2OF1 A;  4QQB X;  1X3Q A;  2MGS A;  5KGU A;  1JWM D;  1T9H A;  3ERS X;  4YWK A;  4HCE A;  1HR0 L;  1XX8 A;  3JAM i;  3M4Q A;  3HOW B;  1LAC A;  3CPF A;  1KAA A;  4KN7 C;  4I7Z C;  4A3D B;  5DEH A;  1AN8 A;  5LHY 1;  5IT9 c;  1KTK A;  4PG3 A;  4X65 Q;  2Q2T A;  1AE2 A;  1B9M A;  2OCE A;  4QF4 A;  5DLQ E;  2GVB A;  2RCF A;  3E3X A;  1IHZ A;  1CQV A;  3IL8 A;  4LUO A;  4H7B A;  3AFP A;  2A1A A;  5IP7 H;  2Y0S G;  1S3O A;  1V1P B;  4HJ7 A;  1BBW A;  2VQF L;  1ASZ A;  3M4O B;  3SR1 A;  4JBW A;  1CFM A;  2DJF C;  5E4W C;  3J80 i;  3TRZ A;  4LF6 L;  3W2D A;  3GDE A;  1K73 C;  1VQD A;  4PZ7 A;  1SNC A;  3EJI A;  5IE8 A;  3K5O A;  4DV3 Q;  3K59 A;  3IKJ A;  1TII D;  2NVT B;  2CWA A;  5D65 A;  3VYR A;  1OXU A;  1R9T B;  3WOF A;  2DY7 A;  5FO7 B;  3HKZ E;  4L8J A;  2M2L A;  5IGB A;  4RFB A;  3DLL A;  3CCJ A;  1WTQ A;  2RVL A;  4K0K L;  2LY7 A;  3HOZ B;  1I50 H;  2FMC A;  4R9W A;  4CHT B;  5EGT A;  3M9B A;  5CV8 A;  3RLN A;  2ASB A;  2YV5 A;  1KDB A;  2D62 A;  2IX1 A;  3J7A F;  1SDF A;  1Y8O B;  3GP7 A;  1D5Z C;  3H3V H;  1VMP A;  3V05 A;  3DWP A;  4IJL A;  2R3Z A;  2OQK A;  2MUY A;  4Y7N B;  4BBR B;  5FLX L;  1DON A;  3CCU A;  1D5M C;  3AB9 A;  3I4O A;  1I3Q B;  1BNZ A;  2A6H C;  2EY5 A;  2OXP A;  4BY7 H;  3A54 A;  1OXV A;  3E5S A;  4DNR B;  3SGI A;  1N34 Q;  1SNO A;  2RKS A;  4OON A;  2PZW A;  3F2U A;  3E0J A;  2A74 C;  3PMF A;  3HGB A;  5ELN A;  3S2D B;  2B2T A;  3HKZ G;  3GTG H;  1V1P A;  3MZ5 A;  1SN8 A;  4RHR A;  4B08 A;  3D0F A;  2A5H A;  3EIV A;  4CDC C;  4DAP A;  4DA2 A;  5T1G A;  1FYC A;  5AFW A;  4NDX A;  1EEI D;  3CQZ B;  4G7Z C;  4EX5 A;  2QF7 A;  1SLJ A;  2HD3 A;  4X62 Q;  3S16 B;  2CQA A;  4DV7 L;  3S1N B;  1NR4 A;  1JJC B;  3W1G A;  2Y0S B;  1BF4 A;  2A19 A;  3BZK A;  4X3K A;  3M7G A;  2WV6 D;  1SJH D;  2BE5 C;  1PFB A;  3S17 B;  1AFP A;  1EIF A;  3HOY H;  5C44 B;  1TWA H;  3Q8D A;  4DR1 L;  3K7A B;  3OHX C;  2JQO A;  3OMC A;  4NXM L;  1WCM H;  1L1O C;  3R2T A;  5M3M B;  3T56 B;  1LM0 A;  5KNC A;  2EXZ A;  4K6L A;  1EZ8 A;  5M5Y H;  2F4I A;  2CW0 D;  1PH5 A;  4JI2 L;  3HS0 C;  3L0O A;  3PGZ A;  4CBV A;  4DK6 C;  1LTB D;  1D1K A;  2IL8 A;  1BBX C;  4A75 A;  4OEL B;  2VNU D;  2OTL A;  3OWF A;  1L1O B;  4IN3 A;  1WTV A;  2WB1 E;  1VDZ A;  3I4N H;  4WJ3 M;  4IZ8 A;  4LUZ A;  3S2H B;  2F0D A;  1Q1B A;  3DMU A;  3Q23 A;  1IYJ B;  1XNQ Q;  3H3V I;  2N8N A;  4P2C B;  1N9W A;  1VQH A;  2HT1 A;  2BA1 A;  1BCP C;  3TBI B;  1GVP A;  1S72 A;  1PTO C;  3UI2 A;  3I4M H;  3NHH A;  1IBL L;  4ALP A;  1JR0 D;  5JJK A;  1NR2 A;  1O80 A;  1SJE D;  4JPB W;  2GN5 A;  3S24 A;  4XDX A;  3HKZ B;  1EYD A;  3EQL C;  2ZM6 Q;  3M4P A;  1LTI D;  1Y8P B;  3CC7 A;  5IGG A;  1XMO L;  1KNA A;  1AH9 A;  1JWS D;  1SND A;  2K5W A;  3KLW A;  1BCP B;  1A3U A;  2BH2 A;  4DV0 Q;  3X3N A;  4DV4 L;  3CRL C;  2QGQ A;  5I9O A;  1T5X D;  1FJG L;  2LMC B;  2EOT A;  1UE1 A;  3AMU A;  4X3U A;  1J5E Q;  2KEN A;  3HP3 A;  4I65 A;  4MHE A;  1HH2 P;  4C3I G;  4HSV A;  1E1T A;  3OYY A;  3IFD A;  1HFG A;  3SVM A;  1Z6H A;  4JK1 C;  5LMU L;  1RCV D;  4P75 A;  4KI0 A;  3OWE B;  2N78 A;  4DR2 Q;  3AU7 A;  2RCN A;  2K4K A;  1LT5 D;  4IUU A;  1WFQ A;  2E2I B;  5C6A A;  2CVR A;  4B9W A;  2GVA A;  1IBM L;  4R4C A;  4WJW A;  3ZYY X;  1PA6 A;  2R93 G;  1XJV A;  3PUY A;  4DU9 A;  1CQF A;  2PO4 A;  4IPH A;  3Q0A A;  2A68 D;  2EE1 A;  1ZEQ X;  2R61 A;  1M90 C;  1WYD A;  5IYD G;  3NQI A;  2FFK B;  4GOP C;  2K1B A;  1IYV A;  4A4I A;  5KYI A;  3PO3 B;  3S15 B;  2V4D A;  2G9D A;  2NWG A;  4DAY B;  5JJZ A;  1KDA A;  5E4X A;  2B2V A;  4DF7 A;  4F87 A;  2YTV A;  5K36 H;  3CCS A;  3C46 A;  5KYL A;  4XTC S;  1QZG A;  3TP8 A;  4Y52 H;  3GTP H;  4A3F H;  1B9N A;  2O2L D;  3M3Y B;  3CCR A;  3RZD H;  4G4K A;  1PDQ A;  3MHB A;  4CJ1 B;  1U5K A;  2TSS A;  4I7A A;  3GTQ H;  4LFA Q;  5KND A;  4DPG A;  2QW7 A;  3MXP A;  1VCI A;  2A69 C;  2F3V A;  3CP0 A;  4QL5 A;  1OTC A;  1TWF B;  4POG A;  2OT2 A;  5EPK A;  4BA2 I;  1SR3 A;  4JI8 Q;  5CV4 A;  1K9M C;  1UE5 A;  3HOX H;  1SRU A;  2JSO A;  1QOH A;  3HFZ B;  1Y1V H;  5EQ0 A;  5IP9 G;  1OXT A;  4C3I B;  1SFO H;  3M4Y A;  4Q0F A;  4IJH A;  3TSS A;  5C4X G;  1W2B A;  5C4J B;  5LL6 S;  4ZKC B;  2PPB C;  4GKK L;  1XMQ Q;  3FKI H;  2F0J A;  1MD2 D;  2ZTD A;  3HOV H;  1O7Z A;  3PIO 3;  5FLX c;  2B2U C;  1ET6 A;  1FGB D;  3SDZ A;  4LF9 Q;  2YU9 B;  1KDC A;  1PTO F;  4DV3 L;  3E9I A;  4IFD H;  1VQ9 A;  1PH7 A;  2F0K A;  1PFM A;  4DAY A;  1XWE A;  2R93 B;  1VQI A;  1PH1 A;  3G48 A;  2NN6 H;  1FD7 D;  1TKW B;  2X6G A;  2KEC A;  3ULP A;  5GAH C;  3HEJ A;  3A7A B;  1VQ4 A;  1TXY A;  2JEB I;  2WIN B;  4DAM A;  3A8K E;  2FIN B;  4P72 A;  4DV2 L;  1CZW A;  1TS2 A;  4C2M B;  1PTO H;  4F88 A;  1YI2 A;  2B63 G;  2CFM A;  3NBI A;  4YHH Q;  4JI6 L;  2K5H A;  5IYB H;  2HCI A;  5IYC H;  3B6Y A;  4KMU C;  1SBB B;  3KJP A;  4RGT A;  1EQT A;  1I4R A;  2N88 A;  3PUV A;  1S4Z A;  2HHH Q;  1YHA A;  2H5X A;  2LSS A;  4BY1 G;  3GTJ H;  5I4D A;  3I55 A;  3CCM A;  1DOL A;  1SMY C;  1B2T A;  3I4L A;  5FLM G;  1BUV T;  1SMX A;  3T53 B;  3LGJ A;  2R7Z H;  4IPC A;  1U4P A;  2UXC Q;  3BG3 A;  3SXH A;  2AWN A;  4C3J H;  1JE5 A;  2JA7 H;  3ND9 A;  1X54 A;  4KLK A;  2KHI A;  1G91 A;  4X3T A;  1DM0 B;  4ULL A;  2UUB Q;  2EPB A;  1HFN A;  4X62 L;  4A3K H;  2SNS A;  3N6R A;  5C4X B;  3GTK B;  3CAM A;  4DV5 L;  2I07 B;  2NVX B;  3F2B A;  4DFA A;  3EA6 A;  4A76 A;  2E2J H;  3FPU B;  5BN4 A;  5LL6 X;  4AH6 A;  5FJ8 H;  1G51 A;  3CHB D;  3K80 C;  1K3R A;  3KOJ A;  2B2U A;  3CCL A;  4ZQ3 A;  4ABN A;  2L55 A;  2Q2U A;  1FNU A;  4K5X A;  2F0S A;  1VQC A;  5IGC A;  3L2P A;  4TQU S;  2A6E D;  1VQF A;  2C9O A;  4LF4 Q;  4MZ9 A;  2EY6 A;  4APV A;  4PZ8 A;  1K83 B;  1WVL A;  1H9J A;  4IFD I;  2B2Y A;  4JI7 Q;  1NJI C;  5ELE A;  5C0X J;  4HIK A;  2KUM A;  1XPO A;  2NN6 I;  4LWC A;  4HTH A;  2UXD Q;  2E76 C;  4IAL A;  3GD7 A;  1S5F D;  2NVY B;  2LFN A;  2F0V A;  3BYT B;  3EN2 A;  3FVQ A;  2F0L A;  2E2D C;  3I70 A;  1STE A;  4ZYS A;  2IY5 B;  1HZC A;  4BXX H;  3KLS X;  1TWH H;  5JEA H;  1ICF B;  4IUT A;  2NB0 A;  4HCS A;  1RD9 D;  3TME A;  1O7Y A;  1MBY A;  1ILP A;  2ZT9 C;  2EYF A;  4KK7 A;  4A3I G;  1GM5 A;  1CKO A;  2EYH A;  2WAC A;  4A93 H;  3S1R H;  5T1I A;  1TWC B;  4BY1 B;  5CGK A;  1LO5 D;  5GRO A;  1VMC A;  4O42 A;  4UP9 A;  2A73 B;  4JI3 L;  1I6H H;  3R2I A;  2UUA L;  5JVG 3;  1H9R A;  1AEX A;  1EOV A;  3IFT A;  4MN3 A;  1RF2 D;  1U0L A;  2F0W A;  3T13 A;  4J6H A;  3UDF A;  1LLR D;  2K50 A;  4JW0 A;  2ZM6 L;  3S1M H;  3C2P A;  1KL9 A;  2DY8 A;  3RUZ A;  2RA4 A;  1VQB A;  1C9O A;  2DNC A;  4HED A;  3T1Y Q;  1PZK D;  2L12 A;  3CCQ A;  5IOD A;  3AFQ A;  4DV0 L;  2K28 A;  1X3F A;  3HOW G;  3BVZ A;  3ONA B;  2Z9H A;  5GQO A;  3TRE A;  4X64 Q;  4KKT A;  1JB3 A;  4A3E H;  1BKB A;  3PO2 G;  4ZK9 B;  2BOS A;  1N33 L;  4K8J A;  2JA6 G;  4NXN Q;  4RA8 A;  3ER0 A;  4TSS A;  4OX9 L;  1IXR A;  1FGU A;  3DWA A;  2NBF A;  4CKE A;  4DR2 L;  1GUW A;  1HQR D;  3EBE A;  4PMC A;  4UPA A;  5C3W A;  4U68 A;  1PFS A;  2MQH A;  2K5Q A;  1BO0 A;  1R4P B;  3PIO A;  3URY A;  5IGD A;  3NPP A;  1EZ6 A;  4L5T A;  4B3M Q;  1EOT A;  3VR5 A;  2K5N A;  1CA5 A;  3G6J B;  3U58 A;  1EUJ A;  4BBS H;  4QUC A;  4FXK C;  1W3S A;  1BDO A;  1W6J A;  3MA2 B;  3S14 B;  1RKN A;  3T51 B;  1K0R A;  3MC0 B;  4J8Q A;  2IHE A;  4DKA C;  3OW7 A;  2AHO B;  4UP7 A;  3F1Z A;  1PH4 A;  1STG A;  2WKD A;  4O1N A;  1QZH A;  2K5V A;  2K52 A;  3KFU A;  1GUT A;  1LTS D;  2C5C A;  1HNZ L;  4DR7 Q;  1S5E D;  2AKW B;  5M5X B;  4A3I B;  1IYU A;  3GTM B;  1PYW D;  1VQ5 A;  3D31 A;  1Q90 A;  1KRT A;  1TS3 A;  3A8J E;  2MP1 A;  4MTK A;  1VQA A;  1PV4 A;  4X3S A;  1A15 A;  1C4Q A;  4OO1 G;  2F1M A;  1D6E C;  2PQA B;  3T1H Q;  5AJ3 L;  4PQX A;  1B4O A;  1VQE A;  4JCV E;  4LFA L;  1SE3 A;  2XVS A;  5J1Z A;  1WTP A;  4POF A;  5BN5 A;  4DUY L;  1VQL A;  3I90 A;  2ZJR A;  3MXN B;  5JVH 3;  2F0G A;  2D0P A;  1WTX A;  2PI2 A;  4UP8 A;  2K01 A;  3TP7 A;  2B2T C;  3A8I E;  5NUC A;  4A3G H;  1QWY A;  1CTM A;  2KOL A;  3NTK A;  1SYF A;  1TQO A;  3BDC A;  2F0Q A;  1IBK Q;  2ES2 A;  3RLO A;  3FDT A;  2CHB D;  5IOC A;  3PO2 B;  2E2H H;  2JA6 B;  1MSG A;  3STB D;  5CC4 A;  2B63 H;  4FNF A;  4XYQ A;  2F0T A;  4ILW A;  2VQE Q;  2NTS A;  5COY A;  4CDF C;  1VQ8 A;  3HKS A;  4K8I A;  3H6M A;  2JA5 G;  4IO9 A;  4RKL A;  2VW9 A;  5I6Y A;  2KHJ A;  3KF8 B;  1I94 Q;  1MSH A;  1TS4 A;  5C44 G;  2ZTC A;  2K03 A;  4C3H G;  4PZ6 A;  2O4X A;  1VQK A;  3F2C A;  4UY8 C;  4HJ5 A;  4XIG S;  2F0E A;  1F9Q A;  2KCC A;  4A3J G;  4RAU C;  3RD4 A;  1DGS A;  3PQI A;  5EJW A;  4OEM B;  2G9H D;  3SE0 A;  5M3M G;  4DNT B;  4KKU A;  3CKI B;  1CHP D;  3SK5 A;  1LUZ A;  2Z0S A;  5ELB A;  4EQN A;  2UXB L;  2FMM A;  4YIJ A;  4A3L G;  1Q3L A;  3FEW X;  2RHS B;  3ULL A;  1GUG A;  2HCC A;  1FVI A;  2PQA A;  2WAQ E;  4KV6 A;  2Q8T A;  3K5N A;  4YHH L;  4N9P A;  2IHF A;  4JYA Q;  4LF5 L;  4LFB L;  3MXN A;  3A55 A;  2XNA C;  5J3B A;  4QIW B;  3H0G H;  3U9S A;  4IUR A;  5I9P A;  2XN9 C;  4YY3 L;  4XQJ A;  4PMW A;  3GTO H;  4KY6 A;  3HOU H;  4IUN A;  2SOB A;  3RZO H;  1Y1W H;  1Z9F A;  2EYO A;  2UUC Q;  2NZH A;  2RBM A;  2YYZ A;  4TVA B;  2UXC L;  1HUN A;  1DXM A;  1OXS C;  1F2M A;  2F0H A;  5HUR A;  3TP6 A;  2UUB L;  4GNX B;  4HSP A;  3KUP A;  5CV9 A;  5M3F H;  4E6I A;  1EWH A;  1CHQ D;  1HNX Q;  4RHS A;  3KF8 A;  4Z9C B;  2L9H A;  4KHP Q;  4P71 A;  1EYG A;  1UE6 A;  3A56 A;  5GAE C;  2WAQ G;  5EPL A;  1MJC A;  1YBY A;  2JEA I;  1QB5 D;  5EPJ A;  2UU9 Q;  2B2W A;  4DGZ A;  2JA5 B;  4LNQ A;  3J7Y W;  1VQO A;  1PRT C;  1NNX A;  4A3M H;  2HDL A;  3I72 A;  4RCN A;  1GOZ A;  5EKK A;  1YNX A;  2ZXR A;  4C3H B;  3J81 E;  4JG2 A;  1N32 Q;  2YTY A;  1WTH A;  2JA8 H;  2A6H D;  1EIH A;  4N9T A;  1IKL A;  3QJY A;  4DR3 Q;  4XYO A;  1BVS A;  5I2Y A;  4A3J B;  2R92 G;  2JXM B;  5C3E G;  4JI7 L;  3TQY A;  1PRT B;  1AZP A;  2A8V A;  4JI1 Q;  2F52 A;  2VY3 A;  3H15 A;  1HZB A;  3A5U A;  2QCP X;  3Q22 A;  1YNJ C;  2UXD L;  1OXX K;  5C5L A;  1E1O A;  1A62 A;  3HOW H;  4XT1 B;  2KHS A;  3SEB A;  4A3D H;  3R93 A;  3D6W A;  1RDP D;  1LTA D;  3PCO B;  1M4V A;  1E2V A;  2J4X A;  3PO3 G;  1IL8 A;  1MJE A;  4OXP A;  5KNB A;  2B2V C;  5D3D A;  4IOA A;  2F0M A;  1PLF A;  4GNX A;  3LX0 A;  2Q2I A;  2BE5 D;  1J6Q A;  3D4D A;  4HMJ A;  3M4O H;  3A0J A;  4EQO A;  4IUP A;  1L2F A;  5C0X H;  2CKZ B;  4G7O C;  4NMZ A;  3D6C A;  4FXG C;  3J81 j;  1EIG A;  3KJO A;  4HR7 B;  3KYH C;  5E7N A;  2RDF A;  2NVT H;  1IZ6 A;  4DR6 Q;  1Q1E A;  5FO8 B;  3LWU A;  3NEL A;  4LW1 A;  1HUM A;  1R9T H;  3KF6 A;  1KHI A;  5IWA Q;  1YJW A;  4YCU A;  3HOZ H;  2WAQ B;  1EQQ A;  2F0F A;  1LAB A;  3IRB A;  1EU3 A;  1WTW A;  1KRS A;  2F4V Q;  5M5W B;  4B3R Q;  4K5W A;  4K2K A;  4GKJ Q;  4DUZ Q;  2CH4 W;  4WJ4 A;  5EKL A;  2OEO A;  4JI0 Q;  4A3B G;  4DNI A;  1SSO A;  2OTJ A;  1CM9 A;  1G2S A;  3OIP A;  5ELO A;  4A3C H;  1KIX A;  1JMC A;  1ENC A;  3T4A C;  1BCP D;  1ZXT A;  4BBR H;  4OO1 H;  1PTO D;  4UAI A;  2KBN A;  2R92 B;  1I3Q H;  1JQY D;  1RIP A;  2D5D A;  5C3E B;  1BOS A;  2EJF C;  4JI5 Q;  4DR5 L;  1SYC A;  3LNN A;  4BWG B;  2I0Q A;  4B3S Q;  1A8V A;  2JA9 A;  4WRD A;  1VQ7 A;  2HQL A;  3K5M A;  1B7Y B;  1QE6 A;  3S2D H;  4JC0 A;  5LMN Q;  1UAP A;  1F9P A;  1JOK A;  4HAE A;  3Q24 A;  2VUM G;  4ZKB B;  1SNP A;  2L5T A;  2FHT A;  1STY A;  3MFY A;  1NBW A;  3CQZ H;  1EFW A;  2MNA A;  1GO3 E;  4DV6 Q;  3CCE A;  3S16 H;  4DR7 L;  1X65 A;  3S1N H;  1E2Z A;  5CBA E;  1X56 A;  3NTH A;  4DK1 A;  1VQ6 A;  1TWG B;  2B8G A;  4C56 C;  1DOK A;  1EL0 A;  1PRT F;  1QIL A;  1BR9 A;  4NKL A;  5HY6 A;  3U4V A;  1LTG D;  4NPS A;  1IKM A;  1N8R C;  1ASY A;  3S17 H;  4EVO A;  3VR6 A;  1H9K A;  5C44 H;  1UWV A;  2LKV A;  2K75 A;  3HRZ C;  3K7A H;  5C0X I;  3GTL B;  4H02 A;  4XT3 B;  3QOL A;  1R4Q B;  4OWX B;  5M3M H;  4CDD C;  3S1Q B;  3NEM A;  1I5F A;  4X65 L;  3VDY A;  1PH3 A;  1IBK L;  1EY9 A;  3TDQ A;  1UUP A;  2MJ8 A;  1CUK A;  1HA6 A;  1LYL A;  1O78 A;  3MXU A;  3FMC A;  2ZJP A;  1X3P A;  1QNK A;  3MXG A;  3CD6 A;  4BS9 A;  1U4L A;  2VQE L;  1STA A;  3RNU A;  4A3B B;  2PZT A;  1XTC D;  3S2H H;  1HR0 Q;  4AYB B;  4RGM A;  1EIY B;  1EYA A;  1I94 L;  3ICE A;  4KD3 A;  1XPR A;  2V1C C;  5EBC A;  1X3E A;  1BCP F;  2BA0 A;  1Q86 C;  3MFG A;  1DD2 A;  3OTO Q;  2NTT A;  3ULJ A;  2K04 A;  4R1J A;  3KLS A;  1Q82 C;  3DM1 A;  3LWE A;  2B2Y C;  2A69 D;  1AZQ A;  1HHV A;  1TS5 A;  2VUM B;  2X69 A;  3EVQ A;  1PYB A;  4ZLT F;  1JCK B;  1GJX A;  2BDO A;  4TRD A;  4EQP A;  5COR A;  1EY8 A;  1Z47 A;  4JYA L;  1GHJ A;  3L9A X;  1YJ9 A;  4LF8 Q;  5C5M A;  1K8M A;  1IW7 C;  1KLG D;  3MEH A;  3NEN A;  3U50 C;  4K0K Q;  2PI2 E;  3MTS A;  4HMI A;  4YCV A;  1X3G A;  4M8A A;  1N34 L;  2QEJ C;  2UUC L;  5A2Q E;  5I6W A;  2HIV A;  3NSW A;  1K8G A;  1SXT A;  4RCO A;  5BR8 Q;  2E2I H;  1P16 A;  2ZXO A;  4IPD A;  5IP7 G;  4TKO B;  3R8B A;  3QB3 A;  1LT6 D;  2ZTE A;  1HNX L;  4U67 3;  2Z4H A;  2NVQ B;  5EBD A;  3QG1 A;  2DUD A;  2Z6K A;  4JBM A;  1EY0 A;  3SHL A;  2JN4 A;  5JJL A;  3VR4 A;  1JE4 A;  3QR8 A;  3CRK C;  2UU9 L;  3QO2 A;  1D7Q A;  3BYY B;  3PO3 H;  3S15 H;  3P7J A;  3PUZ A;  1SAP A;  4FDB A;  3KDF A;  5ISR A;  1S5C D;  1SNQ A;  3PSI A;  1E0B A;  2QEX A;  4OIJ A;  1RTO A;  1CKM A;  1TVX A;  1YEZ A;  1X32 A;  4DR3 L;  1UE7 A;  2VXW A;  3M3Y H;  1SMY D;  4R8N A;  3BJU A;  3TZU A;  4IUQ A;  1PVO A;  3PUX A;  1WJJ A;  4O2D A;  1SE4 A;  4QY7 A;  2XGT A;  3DEP A;  2EVB A;  1TWF H;  2CH4 A;  4KJN A;  2DJG C;  1GUN A;  4BY7 G;  4JV5 Q;  2KQ3 A;  3GO5 A;  1DJR D;  1WTO A;  3K7U C;  4J1M A;  4C3I H;  3K8A A;  4K6D A;  4OL7 A;  1WD0 A;  2LXJ A;  2MO1 A;  1CA6 A;  4V19 0;  4K2L A;  3QIA A;  3NTI A;  1RJT A;  1ZKO A;  1XNQ L;  5C4J H;  2ZJQ A;  4OGQ C;  1M8A A;  1W6K A;  3CPW A;  4QB4 A;  4ZAI A;  2IX0 A;  1BQQ T;  1E22 A;  1ML0 D;  3NXW A;  2YU9 H;  5JPN C;  1B53 A;  2PMZ E;  5IT9 E;  1H9M A;  1G8Z D;  1L0W A;  4KHZ A;  2R93 H;  5JPM C;  1O7I A;  4KHV A;  4KTA A;  1VQP A;  2I5M X;  2EDG A;  1V1O A;  5ELF A;  1A0I A;  1FNW A;  3K57 A;  1HA5 A;  4HN7 A;  1J5E L;  5IYD H;  3UDX A;  3I2Z A;  4IUV A;  3WWV A;  1JJ2 A;  2EYM A;  1WCM G;  4LMQ D;  1C7Y A;  2E74 C;  3H3V C;  2AQ1 B;  2R6G A;  4C2M H;  2Z8L A;  1QCB D;  4B3R L;  5FOB B;  2WKC A;  2X6L A;  1YHQ A;  4P73 A;  2B39 A;  4JI0 L;  2D9U A;  4DXF A;  5IY0 A;  1I50 B;  1G6Z A;  1XMO Q;  2I5L X;  4WOR A;  4FP5 D;  4XXE A;  2B3G A;  4QIW E;  2QDB A;  1ICW A;  2H1E A;  4ZCK A;  5M9O A;  1FJG Q;  3I4N G;  2D2C C;  3D8G A;  3JAM L;  1G29 1;  1DYQ A;  4AIM A;  4JI5 L;  2GA4 B;  5IIF A;  2NZ1 D;  4B3S L;  1M1K C;  1B70 B;  2TMP A;  3U9O A;  5DM6 3;  3TEH B;  2C35 B;  1ZYR C;  1PH9 A;  2EYL A;  4BY7 B;  2RDH A;  4O0A A;  5DAU A;  3G71 A;  3I4M G;  2AQ3 B;  3P1H A;  2E5L Q;  5IP9 H;  3AYH B;  3NQT A;  4DV6 L;  3ERO A;  3BZD B;  3QWN A;  4OIK A;  5C4X H;  3U4Z A;  1GXD C;  3GTG B;  4LF7 Q;  3GTK H;  3J80 L;  1I4H A;  1CT1 D;  2NVX H;  1VF5 C;  1HJP A;  2IPK D;  3D4W A;  4HJ9 A;  1U9R A;  1XTD A;  5JJI A;  4GLX A;  1L0X B;  4BA1 I;  5CBE E;  2K5D A;  5E3F A;  3BDO A;  1EWI A;  1GUO A;  1WTR A;  1D1I A;  4OWT B;  3J7Z C;  1EY7 A;  2F0I A;  3HOY B;  1K83 H;  1H95 A;  3BS1 A;  1TWA B;  4JI8 L;  2L1B A;  4H0L C;  2KJX A;  4JBK A;  4JI4 Q;  2RF4 A;  1NCV A;  1WCM B;  1X6O A;  1HCZ A;  4K14 A;  1DCZ A;  2JYO A;  2NVY H;  1A6X A;  1NMG A;  1QNU A;  1RHP A;  2L0C A;  4H44 C;  5M5Y B;  1VF7 A;  1XMQ L;  1TY2 A;  3OPO A;  3OMG A;  2B2W C;  2PYK A;  3J81 L;  4IFD J;  3DHQ A;  4LF9 L;  3T16 A;  3NUC A;  4N8F A;  5FKA C;  2RSO A;  1LV9 A;  3I4N B;  1BXT A;  3OTO L;  1D2B A;  1TWC H;  4BY1 H;  2PMZ B;  4B9X A;  5FLM H;  4ZUI A;  1VQJ A;  2SDF A;  1PFN A;  2K33 A;  3PIP 3;  1MGS A;  1HZA A;  5IGF A;  5K36 G;  3DM3 A;  1WI5 A;  3JAM E;  5CR3 A;  4UDU C;  5HGQ A;  5LMN W;  4GKK Q;  2HIX A;  2L4N A;  3I4M B;  1PZI D;  2BDN A;  4A3F G;  1F9S A;  5C4Z A;  3C1F A;  3TP5 A;  4IQZ A;  1NAP A;  3FPP A;  3BDL A;  2O5I C;  3FHW A;  3PF4 A;  2PQE A;  4LF8 L;  1KAW A;  2DGY A;  4CKB A;  4L5Q A;  1K8O A;  4GN4 B;  2J7Z A;  4JOI A;  1JOO A;  1EQV A;  3NBH B;  1TY0 A;  1JJG A;  2HHH L;  3J80 E;  3HOX G;  1I4G A;  4GNX C;  1NTG A;  2H4O A;  1Y1V G;  3W5O A;  1BBU A;  2PNH A;  3K0Y A;  4ZUJ A;  2VB3 X;  4DV2 Q;  4G7H C;  1EU4 A;  5G3L F;  1WD1 A;  4GLV B;  4G57 A;  4JBJ A;  1FL0 A;  5FK9 C;  4IPG A;  5BR8 L;  2KED A;  4WFN 3;  3M7N A;  1HNW Q;  4R4T A;  1U4M A;  1MHW C;  4PV1 C;  3FKI G;  1F77 A;  3R3O A;  1HPC A;  3Q6S A;  1Q7Y C;  4LFC Q;  5BN3 A;  3TN2 A;  3HOV G;  4JI6 Q;  1GUS A;  2RSN A;  3K5L A;  1TT2 A;  1UEA B;  4EGV A;  1NUC A;  3PUW A;  3CF5 A;  1H9S B;  3I7F A;  3S14 H;  1A3V A;  1HQM C;  4P74 A;  4R4I A;  3J81 i;  4NW2 A;  1XYI A;  4IFD G;  3I8Z A;  1JOR A;  2K6A A;  1HR0 W;  2NN6 G;  5KEE A;  1B8A A;  3MVV A;  2CW0 C;  1V43 A;  5KRU A;  1I4X A;  4FYD A;  3AQQ A;  3VA5 A;  2EQS A;  3PF5 A;  1Q81 C;  5M5X H;  4A3I H;  3GTM H;  1JWU D;  3KF6 B;  4KY5 A;  1CI3 M;  4RMF A;  5D3I B;  3DXJ C;  4OWW B;  4XQQ A;  4R8I A;  2E75 C;  4IOC A;  4X6A H;  3CC2 A;  4LF4 L;  2PNR C;  1Y14 B;  1D8L A;  2KA7 A;  3HZX A;  3F2D A;  1E2W A;  3V2T A;  4Q5V A;  1HRJ A;  4FF1 A;  2RDG A;  4KY7 A;  2JP1 A;  4DV5 Q;  3W1B A;  1C0A A;  5IYB G;  2IJ0 A;  1C48 A;  2KCN A;  5IYC G;  1HZ9 A;  2WFW A;  3NBH A;  4LUV A;  3N52 A;  1EYC A;  1A2U A;  2ALY B;  3CMA A;  4A3F B;  3GTP B;  4QCL A;  5JEA J;  1N36 Q;  3RN5 A;  3RZD B;  3BU2 A;  4JV5 L;  2EY1 A;  3CC4 A;  1TR5 A;  2N55 A;  1PHJ A;  4X66 Q;  2P5Z X;  2HUG A;  2L11 A;  3GTQ B;  1KAB A;  2LS0 1;  2R7Z G;  4DR4 Q;  1U4R A;  5J39 A;  1PH2 A;  2NYZ D;  2B29 A;  3NWS A;  4L63 B;  4QJF A;  3PO2 H;  4LJZ C;  3FRP B;  4C3J G;  2JA7 G;  2JA6 H;  3JC6 6;  1EWC A;  5CMD A;  1Q46 A;  5C3X A;  3BZC A;  3HOX B;  3MEF A;  1PRT D;  1Y1V B;  5GAG C;  4AYB E;  1SFO B;  2F03 A;  1H9S A;  4A3K G;  4DN4 M;  3QOJ A;  3JAM c;  1XXG A;  3KBX A;  3I56 A;  2F0U A;  1JOQ A;  2XRQ D;  2JJQ A;  1GKH A;  3O13 A;  2CWP A;  2MO0 A;  1QVC A;  3FKI B;  2IW3 A;  3HOV B;  3T1Y L;  5FJ8 G;  3VYT A;  4DV1 Q;  3NK9 A;  2I5H A;  4CDE C;  3F8T A;  2LXK A;  1CZG A;  3A7L A;  1YNJ D;  1B44 D;  4X64 L;  1PYS B;  5FLX E;  4JI3 Q;  2UUA Q;  3K81 C;  3L3O C;  1PMR A;  3KBG A;  3J7A V;  4NXN L;  3J80 c;  2EJG C;  3ITP A;  2HQE A;  4CKC A;  1VQM A;  1I6V C;  2A68 C;  3H91 A;  3NE5 B;  4AYB G;  5A35 A;  1ENA A;  1I4Q A;  1PTO B;  1PZJ D;  3RMH A;  1CKN B;  1ESF A;  4PNY A;  4L5R C;  3C1E A;  5EAY A;  4Y7N H;  4ME5 A;  1K8A C;  4BXX G;  2WB1 G;  4FO2 A;  4DAV A;  1QG7 A;  5JEA G;  1X9N A;  4B3M L;  1KLU D;  4L5S A;  2KCM A;  2EYJ A;  5ELC A;  1JIC A;  2Z6B A;  1N33 Q;  1CSP A;  2QKI C;  5KIX A;  3A74 A;  1JC7 A;  4A93 G;  1F2L A;  3PIP A;  3GTJ B;  4OX9 Q;  4ZRZ A;  5CV7 A;  4KJO A;  3OSO A;  2E5L L;  3NWT A;  3DEO A;  1CSQ A;  1STB A;  2JK8 A;  2R7Z B;  2HDM A;  1L1O A;  2EXD A;  3ND8 A;  3KK7 A;  4MIU A;  4AQY Q;  3SK8 A;  2DN8 A;  2Q8R E;  1E3P A;  1ILQ A;  4GLA C;  4C3J B;  2JA7 B;  4LF7 L;  4M1U B;  3VYU A;  3IAY A;  4FF3 A;  4NB3 A;  1SYD A;  2OQ0 A;  2IT1 A;  2MFI A;  4PMB A;  4ODG A;  3J81 c;  3H94 A;  1DOM A;  1LTL A;  4L6T B;  4QMG A;  4A3K B;  5K5P A;  2JA5 H;  4XQN A;  1D5X C;  4QGU A;  1XNR Q;  1YNN C;  5A2Q L;  1YIJ A;  4F8M A;  1EFI D;  3DWQ A;  4A3E G;  1MI2 A;  3T1H L;  1ENF A;  2I46 A;  4C3H H;  2E2J B;  1JT8 A;  2AQ2 B;  2XWJ B;  4GZY C;  1PXU A;  2ICI A;  4LAA A;  5JOB A;  4A3J H;  1LTT D;  1STH A;  1HNZ Q;  5JAV A;  2R7D A;  4B3T Q;  4JI4 L;  1V9P A;  1A63 A;  4GOP B;  2PCF B;  1SEB D;  1CKN A;  5L37 A;  2AUK A;  2XSC A;  2KVM A;  2Z6K C;  2ID0 A;  4A3L H;  4FF2 A;  1L0Y B;  1GHK A;  2N49 A;  3SK4 A;  3OIQ A;  1ESR A;  1WOC A;  2L15 A;  2Z4I A;  5AJ3 Q;  3ZJY C;  4BBS G;  5J22 A;  3J7A 5;  2EIF A;  3I73 A;  4DUY Q;  1B50 A;  1J9O A;  1NE3 A;  3GV6 A;  2VS1 A;  4GN3 B;  1S5D D;  2AWO A;  2WII B;  3FP9 A;  1PH6 A;  4ME3 A;  5C4H A;  1AP0 A;  4OHJ A;  3A5Z B;  4DK3 C;  1TWH B;  1YNN D;  2WB1 B;  1C8C A;  4C1N I;  1RTN A;  1S5B D;  1B3Q A;  3VYS A;  5H1S E;  1SYG A;  3UE1 A;  3I3C A;  3KLR A;  1G2T A;  2EY2 A;  1F2Y A;  2ENB A;  4OO1 I;  1P8L A;  4A93 B;  1Z7T A;  3E6Z X;  3S1R B;  1LT3 D;  3P20 A;  3KDF B;  4S3S A;  1F2Z A;  4HIM A;  2VZA A;  2AUJ D;  4R4O A;  2VQF Q;  1I6H B;  1STN A;  2F0O A;  1QVG A;  2XRS D;  4YWM A;  5DM7 3;  1VS0 A;  4LF6 Q;  3TZD A;  3S1M B;  4MTN A;  2R7F A;  4HJ8 A;  4JVZ A;  3GV3 A;  3VR2 A;  2QDL A;  5EKI A;  4YWL A;  4DK0 A;  1QJO A;  2Z1C A;  4QUF A;  5M5W H;  4A3G G;  2PW5 A;  3G4S A;  1B3A A;  4KD4 A;  4EQ5 A;  4GOP A;  2MPM A;  4A3E B;  1IL2 A;  1NY4 A;  1QVF A;  5IT9 L;  4HIO A;  2UXB Q;  2RQX A;  2F0P A;  2G5D A;  1VQN A;  4NP5 A;  4RGO S;  1EY4 A;  1HNW L;  3CW2 C;  4UHV A;  1KQS A;  2J0T D;  2R92 H;  3OOC A;  4LFC L;  3RLF A;  5C3E H;  1I4P A;  4MNO A;  2E8G A;  1AE3 A;  4LF5 Q;  1A2T A;  2K32 A;  4LFB Q;  2B8F A;  3CCV A;  2RHQ B;  2SNM A;  4J15 A;  4YY3 Q;  2XWB B;  1CK1 A;  4KHP L;  3P75 A;  1GD7 A;  1HXY D;  2A6E C;  4R4Q A;  2QA4 A;  2NUC A;  4GS3 A;  4BBS B;  1Q12 A;  3H09 A;  3K58 A;  2EYP A;  1V8Q A;  1AW7 A;  3G7L A;  1IW7 D;  2PW7 A;  3W3A A;  4FF4 A;  2NZO A;  1T5E A;  1TWG H;  1N32 L;  3M85 A;  4H13 C;  5F2D A;  1NMF A;  2QIL A;  3UDG A;  1ET9 A;  1FNV A;  1K28 A;  2O5J C;  1YJN A;  4V0B A;  2Q2H A;  4DV7 Q;  1K0S A;  2WP8 J;  4RGN A;  3WDN A;  3NP8 A;  4JI1 L;  3E0E A;  1NSN S;  4RH6 A;  3H0G G;  1Q8K A;  1N36 L;  3GTL H;  2KCT A;  1JB7 A;  1EY5 A;  2FXQ A;  4K5V A;  3HOU G;  1ROD A;  4X66 L;  3S1Q H;  1E7Z A;  3EFX D;  1Y1W G;  1LTR D;  4DR1 Q; 
#chains in the Genus database with same CATH homology
 1Y8N B;  4A3G B;  3SK6 A;  5DNF A;  1B1Z A;  4KKS A;  1OO9 B;  2Q8I B;  2K05 A;  2E2H B;  4ID6 A;  4FXD A;  2SEB D;  2M9V A;  2B63 B;  1F9R A;  3BVM A;  5D14 A;  2F3W A;  3ERQ A;  5CYU A;  4CGY B;  3WOE A;  3K6O A;  5CV6 A;  1O7L A;  4RWS C;  2ZXP A;  5E1F A;  3D3R A;  4CJ2 C;  1SYB A;  2F0N A;  5HGT A;  3PV0 A;  4CJ0 B;  1SYE A;  4DXG A;  2BCO A;  2IX3 A;  3VA7 A;  2FJ2 A;  3CU7 A;  1II3 A;  1LT4 D;  1HTL D;  2XIW A;  1EY6 A;  4FVM A;  5TSS A;  1TU2 B;  3L7Z C;  3H0G B;  4C1N K;  1KNE A;  2IWH A;  1DZ1 A;  5I2X A;  3GTO B;  3HOU B;  1Y69 U;  3RZO B;  1SE2 A;  3V96 A;  2EZV A;  1Y1W B;  1ONL A;  1FR3 A;  5C0X G;  5CV5 A;  1Q8I A;  2KEE A;  3GQB A;  1HTP A;  1J8I A;  1UNS A;  3BVG A;  5M3F B;  4F7X A;  3D4R A;  2EJM A;  3S9W A;  5FO9 B;  2ICE C;  2PZU A;  3DUZ A;  5IGE A;  3HG9 A;  3C3L A;  5G3L D;  4RKB A;  5ELD A;  4A3M B;  4LK1 C;  2K7V A;  2MHV A;  3I91 A;  4KN4 C;  2JA8 B;  2M00 A;  1ZYR D;  1SNM A;  3VR3 A;  1EEF D;  2DNE A;  2JE6 I;  3MAQ A;  3MWY W;  1A3T A;  2VB2 X;  3X3M A;  2OF1 A;  1X3Q A;  2MGS A;  5KGU A;  1JWM D;  4HCE A;  1XX8 A;  3HOW B;  1LAC A;  1KAA A;  4KN7 C;  4I7Z C;  4A3D B;  5DEH A;  1AN8 A;  5LHY 1;  1KTK A;  1B9M A;  4QF4 A;  1IHZ A;  1CQV A;  3IL8 A;  4H7B A;  1V1P B;  3M4O B;  3SR1 A;  4JBW A;  1CFM A;  5E4W C;  3W2D A;  1SNC A;  3EJI A;  3K5O A;  3K59 A;  3IKJ A;  1TII D;  2NVT B;  5D65 A;  3VYR A;  1OXU A;  1R9T B;  3WOF A;  2DY7 A;  5FO7 B;  4L8J A;  2M2L A;  5IGB A;  4RFB A;  1WTQ A;  2RVL A;  2LY7 A;  3HOZ B;  2FMC A;  4R9W A;  4CHT B;  5EGT A;  5CV8 A;  1KDB A;  2D62 A;  2IX1 A;  3J7A F;  1SDF A;  1Y8O B;  3GP7 A;  1D5Z C;  1VMP A;  3V05 A;  3DWP A;  2R3Z A;  2MUY A;  4Y7N B;  4BBR B;  5FLX L;  1DON A;  1D5M C;  3AB9 A;  1I3Q B;  1BNZ A;  2A6H C;  2EY5 A;  2OXP A;  3A54 A;  1OXV A;  3E5S A;  4DNR B;  1SNO A;  2RKS A;  2PZW A;  3F2U A;  3E0J A;  2A74 C;  3PMF A;  3HGB A;  3S2D B;  2B2T A;  1V1P A;  3MZ5 A;  4RHR A;  4B08 A;  2A5H A;  4DAP A;  4DA2 A;  5T1G A;  1FYC A;  5AFW A;  4NDX A;  1EEI D;  3CQZ B;  4G7Z C;  2QF7 A;  3S16 B;  2CQA A;  3S1N B;  1NR4 A;  2Y0S B;  1BF4 A;  4X3K A;  3M7G A;  2WV6 D;  1SJH D;  2BE5 C;  1PFB A;  3S17 B;  1AFP A;  5C44 B;  3K7A B;  3OHX C;  3OMC A;  3R2T A;  5M3M B;  3T56 B;  5KNC A;  2EXZ A;  4K6L A;  1EZ8 A;  2F4I A;  2CW0 D;  3HS0 C;  4CBV A;  1LTB D;  1D1K A;  2IL8 A;  1BBX C;  2VNU D;  3OWF A;  4IN3 A;  1WTV A;  1VDZ A;  4IZ8 A;  3S2H B;  2F0D A;  1Q1B A;  3DMU A;  3Q23 A;  4P2C B;  2BA1 A;  1BCP C;  3TBI B;  1PTO C;  3UI2 A;  3NHH A;  1JR0 D;  1NR2 A;  1O80 A;  1SJE D;  4XDX A;  3HKZ B;  1EYD A;  3EQL C;  1LTI D;  1Y8P B;  5IGG A;  1KNA A;  1JWS D;  1SND A;  2K5W A;  1BCP B;  1A3U A;  3X3N A;  3CRL C;  5I9O A;  1T5X D;  2LMC B;  2EOT A;  3AMU A;  4X3U A;  3HP3 A;  4I65 A;  4MHE A;  4C3I G;  4HSV A;  3IFD A;  1HFG A;  3SVM A;  1Z6H A;  4JK1 C;  1RCV D;  4KI0 A;  3OWE B;  3AU7 A;  1LT5 D;  4IUU A;  2E2I B;  5C6A A;  2CVR A;  4B9W A;  4WJW A;  3ZYY X;  3PUY A;  4DU9 A;  1CQF A;  2PO4 A;  3Q0A A;  2A68 D;  2EE1 A;  1ZEQ X;  2R61 A;  3NQI A;  2FFK B;  2K1B A;  1IYV A;  5KYI A;  3PO3 B;  3S15 B;  2V4D A;  2G9D A;  2NWG A;  5JJZ A;  1KDA A;  5E4X A;  2B2V A;  4DF7 A;  4F87 A;  5K36 H;  3C46 A;  5KYL A;  4XTC S;  3TP8 A;  1B9N A;  2O2L D;  3M3Y B;  4G4K A;  1PDQ A;  3MHB A;  4CJ1 B;  2TSS A;  5KND A;  3MXP A;  1VCI A;  2A69 C;  2F3V A;  1TWF B;  2OT2 A;  5EPK A;  4BA2 I;  5CV4 A;  2JSO A;  1QOH A;  5EQ0 A;  1OXT A;  4C3I B;  3M4Y A;  4Q0F A;  3TSS A;  5C4J B;  5LL6 S;  4ZKC B;  2PPB C;  2F0J A;  1MD2 D;  1O7Z A;  3PIO 3;  2B2U C;  1ET6 A;  1FGB D;  3SDZ A;  2YU9 B;  1KDC A;  1PTO F;  4IFD H;  2F0K A;  1PFM A;  4DAY A;  1XWE A;  2R93 B;  2NN6 H;  1FD7 D;  1TKW B;  2X6G A;  2KEC A;  3HEJ A;  3A7A B;  2WIN B;  2JEB I;  3A8K E;  2FIN B;  1CZW A;  1TS2 A;  4C2M B;  1PTO H;  4F88 A;  3NBI A;  2HCI A;  4KMU C;  1SBB B;  4RGT A;  1EQT A;  1I4R A;  2N88 A;  3PUV A;  1S4Z A;  5I4D A;  1DOL A;  1SMY C;  1B2T A;  3I4L A;  1BUV T;  3T53 B;  1U4P A;  3BG3 A;  3SXH A;  2AWN A;  3ND9 A;  1G91 A;  4X3T A;  1DM0 B;  4ULL A;  2EPB A;  1HFN A;  2SNS A;  3N6R A;  5C4X B;  3GTK B;  2I07 B;  2NVX B;  4DFA A;  3EA6 A;  3FPU B;  5BN4 A;  5LL6 X;  3CHB D;  2B2U A;  4ZQ3 A;  4ABN A;  2L55 A;  1FNU A;  4K5X A;  2F0S A;  5IGC A;  4TQU S;  2A6E D;  2C9O A;  2EY6 A;  1K83 B;  1WVL A;  1H9J A;  4IFD I;  2B2Y A;  5ELE A;  5C0X J;  2KUM A;  2NN6 I;  4HTH A;  2E76 C;  4IAL A;  3GD7 A;  1S5F D;  2NVY B;  2LFN A;  2F0V A;  3BYT B;  3FVQ A;  2F0L A;  2E2D C;  3I70 A;  1STE A;  4ZYS A;  3KLS X;  5JEA H;  4IUT A;  2NB0 A;  4HCS A;  1RD9 D;  3TME A;  1O7Y A;  1MBY A;  1ILP A;  2ZT9 C;  2EYF A;  4KK7 A;  2EYH A;  2WAC A;  5T1I A;  1TWC B;  4BY1 B;  5CGK A;  1LO5 D;  1VMC A;  4O42 A;  2A73 B;  3R2I A;  5JVG 3;  1H9R A;  1AEX A;  3IFT A;  4MN3 A;  1RF2 D;  2F0W A;  3T13 A;  4J6H A;  1LLR D;  3C2P A;  2DY8 A;  3RUZ A;  2RA4 A;  2DNC A;  4HED A;  1PZK D;  2L12 A;  5IOD A;  2K28 A;  3BVZ A;  3ONA B;  4KKT A;  1JB3 A;  4ZK9 B;  2BOS A;  4K8J A;  4RA8 A;  4TSS A;  3DWA A;  2NBF A;  4CKE A;  1GUW A;  1HQR D;  4PMC A;  5C3W A;  4U68 A;  2K5Q A;  1BO0 A;  1R4P B;  3URY A;  5IGD A;  3NPP A;  1EZ6 A;  1EOT A;  3VR5 A;  1CA5 A;  3G6J B;  4QUC A;  4FXK C;  1BDO A;  1W6J A;  3MA2 B;  3S14 B;  1RKN A;  3T51 B;  3MC0 B;  4J8Q A;  3OW7 A;  1STG A;  2WKD A;  4O1N A;  1GUT A;  1LTS D;  2C5C A;  1S5E D;  5M5X B;  4A3I B;  1IYU A;  3GTM B;  1PYW D;  3D31 A;  1Q90 A;  1TS3 A;  3A8J E;  2MP1 A;  4X3S A;  1A15 A;  1C4Q A;  4OO1 G;  2F1M A;  1D6E C;  4PQX A;  1B4O A;  1SE3 A;  2XVS A;  5J1Z A;  1WTP A;  5BN5 A;  3I90 A;  5JVH 3;  2F0G A;  1WTX A;  2K01 A;  3TP7 A;  2B2T C;  3A8I E;  5NUC A;  1QWY A;  1CTM A;  2KOL A;  3NTK A;  1SYF A;  1TQO A;  3BDC A;  2F0Q A;  3FDT A;  2CHB D;  5IOC A;  3PO2 B;  2JA6 B;  1MSG A;  5CC4 A;  4FNF A;  4XYQ A;  2F0T A;  4ILW A;  2NTS A;  5COY A;  4K8I A;  3H6M A;  4RKL A;  5I6Y A;  1MSH A;  1TS4 A;  2K03 A;  4C3H G;  2O4X A;  4XIG S;  2F0E A;  1F9Q A;  2KCC A;  4RAU C;  3RD4 A;  5EJW A;  2G9H D;  3SE0 A;  4DNT B;  4KKU A;  3CKI B;  1CHP D;  3SK5 A;  5ELB A;  4EQN A;  2FMM A;  4YIJ A;  1Q3L A;  3FEW X;  1GUG A;  2HCC A;  4KV6 A;  2Q8T A;  3K5N A;  4N9P A;  3MXN A;  3A55 A;  2XNA C;  4QIW B;  3U9S A;  4IUR A;  5I9P A;  2XN9 C;  4XQJ A;  4PMW A;  4KY6 A;  4IUN A;  2SOB A;  2EYO A;  2RBM A;  2YYZ A;  1HUN A;  1DXM A;  1OXS C;  1F2M A;  2F0H A;  5HUR A;  3TP6 A;  4HSP A;  3KUP A;  5CV9 A;  4E6I A;  1EWH A;  1CHQ D;  4RHS A;  3KF8 A;  4Z9C B;  2L9H A;  3A56 A;  5EPL A;  2JEA I;  1QB5 D;  5EPJ A;  2B2W A;  4DGZ A;  2JA5 B;  3J7Y W;  1PRT C;  2HDL A;  3I72 A;  4RCN A;  1GOZ A;  5EKK A;  2ZXR A;  4C3H B;  3J81 E;  2A6H D;  1EIH A;  4N9T A;  1IKL A;  3QJY A;  4XYO A;  4A3J B;  5I2Y A;  2JXM B;  1PRT B;  1AZP A;  2QCP X;  3Q22 A;  1YNJ C;  1OXX K;  5C5L A;  4XT1 B;  2KHS A;  3SEB A;  3R93 A;  3D6W A;  1RDP D;  1LTA D;  1M4V A;  1E2V A;  2J4X A;  1IL8 A;  5KNB A;  2B2V C;  5D3D A;  2F0M A;  1PLF A;  3LX0 A;  2BE5 D;  3D4D A;  4HMJ A;  4EQO A;  4IUP A;  5C0X H;  4G7O C;  4NMZ A;  3D6C A;  4FXG C;  1EIG A;  4HR7 B;  2RDF A;  1Q1E A;  5FO8 B;  3LWU A;  1HUM A;  2WAQ B;  2F0F A;  1LAB A;  1EU3 A;  1WTW A;  5M5W B;  4K5W A;  4K2K A;  5EKL A;  2OEO A;  1SSO A;  1CM9 A;  1G2S A;  3OIP A;  1ENC A;  3T4A C;  1BCP D;  1ZXT A;  4OO1 H;  1PTO D;  4UAI A;  2R92 B;  1JQY D;  2D5D A;  5C3E B;  1BOS A;  2EJF C;  1SYC A;  3LNN A;  4BWG B;  4WRD A;  3K5M A;  1QE6 A;  1UAP A;  1F9P A;  1JOK A;  4HAE A;  3Q24 A;  4ZKB B;  1SNP A;  2L5T A;  2FHT A;  1STY A;  3MFY A;  1E2Z A;  5CBA E;  3NTH A;  4DK1 A;  1TWG B;  2B8G A;  4C56 C;  1DOK A;  1EL0 A;  1PRT F;  1QIL A;  1BR9 A;  4NKL A;  1LTG D;  1IKM A;  4EVO A;  3VR6 A;  1H9K A;  2LKV A;  3HRZ C;  5C0X I;  3GTL B;  4XT3 B;  3QOL A;  1R4Q B;  3S1Q B;  1EY9 A;  3TDQ A;  1UUP A;  2MJ8 A;  1HA6 A;  1O78 A;  3MXU A;  3FMC A;  1X3P A;  1QNK A;  3MXG A;  4BS9 A;  1U4L A;  1STA A;  4A3B B;  2PZT A;  1XTC D;  4AYB B;  4RGM A;  1EYA A;  4KD3 A;  5EBC A;  1BCP F;  2BA0 A;  3MFG A;  1DD2 A;  2NTT A;  2K04 A;  3KLS A;  3DM1 A;  3LWE A;  2B2Y C;  2A69 D;  1AZQ A;  1HHV A;  1TS5 A;  2VUM B;  2X69 A;  3EVQ A;  4ZLT F;  1GJX A;  1JCK B;  2BDO A;  4TRD A;  4EQP A;  5COR A;  1EY8 A;  1Z47 A;  1GHJ A;  3L9A X;  5C5M A;  1K8M A;  1IW7 C;  1KLG D;  3MEH A;  3MTS A;  4HMI A;  4M8A A;  2QEJ C;  5A2Q E;  5I6W A;  3NSW A;  1SXT A;  4RCO A;  2ZXO A;  4TKO B;  3R8B A;  3QB3 A;  1LT6 D;  4U67 3;  2Z4H A;  2NVQ B;  5EBD A;  3QG1 A;  1EY0 A;  3SHL A;  3VR4 A;  1JE4 A;  3CRK C;  3QO2 A;  3BYY B;  3P7J A;  3PUZ A;  1SAP A;  5ISR A;  1S5C D;  1SNQ A;  1E0B A;  4OIJ A;  1RTO A;  1TVX A;  1X32 A;  2VXW A;  1SMY D;  4R8N A;  3TZU A;  4IUQ A;  3PUX A;  1SE4 A;  3DEP A;  2EVB A;  4KJN A;  1GUN A;  2KQ3 A;  3GO5 A;  1DJR D;  1WTO A;  4J1M A;  4K6D A;  4OL7 A;  1WD0 A;  1CA6 A;  4V19 0;  4K2L A;  3QIA A;  3NTI A;  1RJT A;  1ZKO A;  4OGQ C;  1M8A A;  1W6K A;  4QB4 A;  4ZAI A;  2IX0 A;  1BQQ T;  1ML0 D;  3NXW A;  5JPN C;  1B53 A;  5IT9 E;  1H9M A;  1G8Z D;  4KHZ A;  5JPM C;  4KHV A;  4KTA A;  2EDG A;  1V1O A;  5ELF A;  1FNW A;  3K57 A;  1HA5 A;  4HN7 A;  4IUV A;  2EYM A;  4LMQ D;  2E74 C;  3H3V C;  2AQ1 B;  2R6G A;  2Z8L A;  1QCB D;  5FOB B;  2WKC A;  2X6L A;  2B39 A;  2D9U A;  4DXF A;  1I50 B;  1G6Z A;  4WOR A;  4FP5 D;  4XXE A;  2QDB A;  1ICW A;  2H1E A;  5M9O A;  2D2C C;  3D8G A;  3JAM L;  1G29 1;  1DYQ A;  2GA4 B;  5IIF A;  2NZ1 D;  2TMP A;  3U9O A;  5DM6 3;  1ZYR C;  2EYL A;  4BY7 B;  2RDH A;  5DAU A;  2AQ3 B;  3P1H A;  3NQT A;  3ERO A;  3BZD B;  3QWN A;  4OIK A;  1GXD C;  3GTG B;  3J80 L;  1I4H A;  1CT1 D;  1VF5 C;  2IPK D;  3D4W A;  1U9R A;  1L0X B;  4BA1 I;  5CBE E;  2K5D A;  5E3F A;  3BDO A;  1GUO A;  1WTR A;  1D1I A;  1EY7 A;  2F0I A;  3HOY B;  3BS1 A;  1TWA B;  2L1B A;  4H0L C;  2KJX A;  1NCV A;  1WCM B;  1HCZ A;  4K14 A;  1DCZ A;  2JYO A;  1A6X A;  1QNU A;  1RHP A;  2L0C A;  4H44 C;  5M5Y B;  1VF7 A;  1TY2 A;  3OPO A;  3OMG A;  2B2W C;  2PYK A;  3J81 L;  4IFD J;  3DHQ A;  3T16 A;  3NUC A;  5FKA C;  2RSO A;  1LV9 A;  3I4N B;  1BXT A;  1D2B A;  2PMZ B;  4B9X A;  4ZUI A;  2SDF A;  1PFN A;  2K33 A;  3PIP 3;  1MGS A;  5IGF A;  5K36 G;  3JAM E;  5CR3 A;  4UDU C;  2L4N A;  3I4M B;  1PZI D;  2BDN A;  1F9S A;  5C4Z A;  3C1F A;  3TP5 A;  4IQZ A;  1NAP A;  3FPP A;  3BDL A;  2O5I C;  2PQE A;  4CKB A;  1K8O A;  2J7Z A;  1JOO A;  1EQV A;  1TY0 A;  3J80 E;  1I4G A;  2H4O A;  3K0Y A;  4ZUJ A;  2VB3 X;  4G7H C;  1EU4 A;  5G3L F;  1WD1 A;  4G57 A;  5FK9 C;  2KED A;  4WFN 3;  3M7N A;  1U4M A;  4PV1 C;  1F77 A;  3R3O A;  1HPC A;  3Q6S A;  5BN3 A;  3TN2 A;  1GUS A;  2RSN A;  3K5L A;  1TT2 A;  1UEA B;  4EGV A;  1NUC A;  3PUW A;  1H9S B;  1A3V A;  1HQM C;  4NW2 A;  1XYI A;  4IFD G;  3I8Z A;  1JOR A;  2K6A A;  2NN6 G;  5KEE A;  3MVV A;  2CW0 C;  1V43 A;  5KRU A;  1I4X A;  4FYD A;  3VA5 A;  1JWU D;  5D3I B;  4KY5 A;  1CI3 M;  3DXJ C;  4XQQ A;  4R8I A;  2E75 C;  2PNR C;  2KA7 A;  3HZX A;  1E2W A;  3V2T A;  4Q5V A;  1HRJ A;  4FF1 A;  2RDG A;  4KY7 A;  2JP1 A;  2IJ0 A;  1C48 A;  2KCN A;  3NBH A;  3N52 A;  1EYC A;  1A2U A;  4QCL A;  3GTP B;  4A3F B;  5JEA J;  3RZD B;  2EY1 A;  1TR5 A;  2N55 A;  2HUG A;  2L11 A;  3GTQ B;  1KAB A;  2LS0 1;  1U4R A;  5J39 A;  2NYZ D;  3NWS A;  4L63 B;  4LJZ C;  3FRP B;  4C3J G;  1EWC A;  5CMD A;  5C3X A;  3HOX B;  1PRT D;  1Y1V B;  1SFO B;  2F03 A;  1H9S A;  4DN4 M;  3QOJ A;  1XXG A;  3KBX A;  2F0U A;  1JOQ A;  2XRQ D;  3O13 A;  3FKI B;  2IW3 A;  3HOV B;  3VYT A;  3NK9 A;  1CZG A;  3A7L A;  1YNJ D;  1B44 D;  5FLX E;  3L3O C;  1PMR A;  3KBG A;  3J7A V;  2EJG C;  3ITP A;  2HQE A;  4CKC A;  1I6V C;  2A68 C;  3H91 A;  3NE5 B;  5A35 A;  1ENA A;  1I4Q A;  1PTO B;  1PZJ D;  3RMH A;  1ESF A;  4PNY A;  3C1E A;  4ME5 A;  4FO2 A;  4DAV A;  1QG7 A;  5JEA G;  1KLU D;  2EYJ A;  5ELC A;  1JIC A;  2QKI C;  5KIX A;  1JC7 A;  1F2L A;  3GTJ B;  4ZRZ A;  5CV7 A;  4KJO A;  3OSO A;  3NWT A;  3DEO A;  1STB A;  2R7Z B;  2HDM A;  3ND8 A;  3KK7 A;  4MIU A;  3SK8 A;  2DN8 A;  2Q8R E;  1ILQ A;  4C3J B;  2JA7 B;  4M1U B;  3VYU A;  3IAY A;  4FF3 A;  1SYD A;  2IT1 A;  4PMB A;  4ODG A;  3H94 A;  1DOM A;  4L6T B;  4QMG A;  4A3K B;  5K5P A;  4XQN A;  1D5X C;  1YNN C;  5A2Q L;  4F8M A;  1EFI D;  3DWQ A;  1MI2 A;  1ENF A;  2I46 A;  2E2J B;  2AQ2 B;  2XWJ B;  4GZY C;  1PXU A;  2ICI A;  4LAA A;  5JOB A;  1LTT D;  1STH A;  5JAV A;  2PCF B;  1SEB D;  2AUK A;  2XSC A;  2KVM A;  2ID0 A;  4FF2 A;  1L0Y B;  1GHK A;  3SK4 A;  3OIQ A;  1ESR A;  2Z4I A;  5J22 A;  3I73 A;  1B50 A;  1J9O A;  3GV6 A;  1S5D D;  2AWO A;  2WII B;  5C4H A;  1AP0 A;  4OHJ A;  1TWH B;  1YNN D;  2WB1 B;  1C8C A;  4C1N I;  1RTN A;  1S5B D;  3VYS A;  1SYG A;  3I3C A;  3KLR A;  1G2T A;  2EY2 A;  1F2Y A;  2ENB A;  4OO1 I;  4A93 B;  1Z7T A;  3E6Z X;  3S1R B;  1LT3 D;  3P20 A;  4S3S A;  1F2Z A;  2AUJ D;  1I6H B;  1STN A;  2F0O A;  2XRS D;  5DM7 3;  3TZD A;  3S1M B;  3GV3 A;  3VR2 A;  5EKI A;  4DK0 A;  1QJO A;  2Z1C A;  4QUF A;  2PW5 A;  1B3A A;  4KD4 A;  2MPM A;  4A3E B;  5IT9 L;  2RQX A;  2F0P A;  4NP5 A;  4RGO S;  1EY4 A;  2J0T D;  3OOC A;  3RLF A;  1I4P A;  1A2T A;  2K32 A;  2B8F A;  2SNM A;  2XWB B;  1CK1 A;  3P75 A;  1HXY D;  2A6E C;  2NUC A;  4BBS B;  1Q12 A;  3H09 A;  3K58 A;  2EYP A;  1V8Q A;  1AW7 A;  3G7L A;  1IW7 D;  2PW7 A;  3W3A A;  4FF4 A;  1T5E A;  3M85 A;  4H13 C;  5F2D A;  2QIL A;  1ET9 A;  1FNV A;  2O5J C;  4V0B A;  2WP8 J;  4RGN A;  3WDN A;  3NP8 A;  1NSN S;  4RH6 A;  1EY5 A;  4K5V A;  1ROD A;  3EFX D;  1LTR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...