1AFPA

Solution structure of the antifungal protein from aspergillus giganteus. evidence for disulphide configurational isomerism
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
51
structure length
51
Chain Sequence
ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIFUNGAL PROTEIN FROM ASPERGILLUS GIGANTEUS
publication title NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism.
pubmed doi rcsb
source organism Aspergillus giganteus
molecule tags Antifungal protein
total genus 6
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1994-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1afpA00
2NBFA 2KCNA 2NB0A 2MHVA 1AFPA
chains in the Genus database with same CATH superfamily
4WRDA 1FGBD 2Z4HA 2NN6H 1QUQB 2K05A 1D5ZC 1TY0A 4ZKBB 3J81E 2ALYB 1AEXA 4A75A 2L1BA 2XWBB 3QG1A 4FXGC 2HT1A 1SYCA 1TWCH 4AQYQ 1SNPA 2KEDA 2PYKA 4IPCA 1RTNA 5LMNL 4DAMA 2EZVA 5C0XJ 1S40A 1K8GA 3TS2A 1NTGA 4R1JA 1AE2A 2K5HA 3C2PA 4OHJA 4L8JA 4L5QA 5EBCA 4AYBB 1H9SB 1X3EA 5EPJA 3DMUA 4A3IB 1WTWA 4EQNA 1JWMD 2D2CC 3BJUA 1HFNA 3PMFA 5K5PA 5LMNQ 3GTPH 2R6GA 2O5IC 1LTSD 1VQEA 3QJYA 1XMQL 1VQBA 4ZQ3A 1QVFA 2EOTA 3VYRA 2MPMA 5KRUA 3FKIG 5CV5A 3IKJA 4GOPA 4I7ZC 5A2QL 4JBJA 3HOVG 1C9OA 5JJIA 1EY4A 1LTAD 5C4JB 5C3EB 1FNWA 1YHQA 1EIFA 4ALPA 1XJVA 4JI2L 1CKNB 1Y1VB 2F0HA 1S3OA 4R8NA 1L0WA 5IGCA 2JQOA 1Y8NB 2ZTDA 3T16A 2DY7A 4JI4L 3DM1A 1WCMG 1QB5D 5CORA 1SMYC 1A63A 2I46A 1Q8IA 3EROA 3R2IA 5IP9H 3PUZA 1D5XC 1J9OA 1I94L 4FF3A 3RLFA 1YNJD 1VF7A 4A3MG 4HJAA 1ENAA 3KDFA 1YHBA 2HIXA 4KD4A 2NVTB 1AZQA 1A62A 4POGA 4A3KB 1MI2A 1LV9A 3CCMA 5IP7H 1EY0A 3W5OA 3I55A 2SDFA 1G291 2GN5A 1NMFA 4DK1A 3VR5A 4NB3A 1U0LA 3I4MG 1H9JA 4IUUA 5JVG3 1KIXA 1JOOA 3A54A 3WOFA 1CSQA 3OTOQ 4DNIA 3CF5A 1SYDA 5BN3A 3S1MB 5GAEC 2BA1A 1WI5A 1XNRQ 4DXFA 1M90C 1WTQA 2WINB 4C2MH 4A3FH 4JBKA 4IUVA 3PCOB 2OT2A 1RF2D 4NPSA 4X3TA 4IALA 1LT6D 3IFDA 1YZ6A 2UUAQ 5A2QE 3G6EA 3NQTA 3CC7A 2N78A 4ZAIA 1GKHA 2B2VC 2ZJRA 1HNXL 2VQEL 2A8VA 2DJGC 3PUYA 4C3IB 3FMCA 1WCMH 4XT3B 4B3SL 3SDZA 1ESFA 2K5NA 5CYUA 3NK9A 3J80i 1WD0A 1PH8A 3S2HH 1CKOA 3CRKC 4RHRA 1TQOA 2NVXH 1L0XB 1VQGA 4OL7A 2KCCA 4KMUC 1HNXQ 2VQEQ 2A68D 4NW2A 3AFPA 1PRTF 1STGA 2XIWA 4B3SQ 1PRTD 2F3VA 2VB3X 2WV6D 4RKLA 1O7LA 2KCTA 2K03A 3S15B 3KLWA 4WJ4A 5CBAE 5IIFA 1SE8A 1SFOH 3BDLA 2PPBC 3GO5A 3QR8A 2UUBL 2HQEA 2X69A 4OELB 3HOYH 4IUNA 2JEAI 4RKBA 2B2YC 4LF7L 1JJ2A 1QNKA 2EJFC 4CKCA 3OIQA 4O42A 4TQUS 1E7ZA 1WTVA 3DEOA 4BS9A 3MXNB 3RNUA 2NVQH 2AUKA 4A3EB 4DK3C 3CAMA 3MZ5A 3L2PA 2B63G 1WOCA 2IL8A 3K81C 4B9XA 3I56A 2R92B 1SR3A 1KLGD 2Y0SB 3H91A 4GZYC 3QIAA 5M3FG 2A6HD 1AW7A 3OPOA 4KTAA 1X54A 5FO9B 4V190 4YCUA 1D5MC 1X56A 1BCPC 3E0EA 3M9BA 2QDBA 1SDFA 1CA6A 3KOJA 4IUTA 2XWJB 4BBRG 1WYDA 3SK6A 1NNXA 3UDGA 4DV6L 3D3RA 2LKVA 1VMCA 4DK6C 1KDCA 1LTTD 3PF4A 3KJOA 2M9VA 1RTOA 2MHVA 3T1HL 1D7QA 2MQHA 2C35B 2E2IB 3NUCA 3SVMA 3K0YA 1J5EL 1BVSA 2JA5G 2E8GA 4BY1H 4L6TB 2DNCA 1OXUA 3E5SA 4DV6Q 4KN7C 4K2LA 4PZ6A 4JI8L 2O4XA 3NBHA 1PYBA 1PZID 1Z6HA 1C8CA 2F4IA 1PH3A 5KEEA 4RH6A 3O13A 2BE5C 2PZUA 4PNYA 2B2WA 1F9QA 3FP9A 2E2HB 1J5EQ 2QKIC 3NWSA 2XRSD 3WOEA 4KHPL 3A74A 3VA7A 3CCLA 2JE6I 4JI8Q 4A3FB 2RBMA 1CUKA 3ND8A 3S24A 4ODGA 4QF4A 1XMOL 1EY8A 2B2TC 4GNXA 3S1QB 2EY1A 1IKLA 2VL6A 1XPOA 2A6ED 1KDAA 4KHPQ 5CV8A 1M1KC 3RLOA 5EKLA 5BN5A 4FP5D 1WCMB 1A3UA 3DLLA 2RHSB 1X3PA 1LTBD 4PG3A 4DAYB 2IPKD 4K14A 3MHBA 3TP6A 5DM73 3S2HB 1DCZA 1Q8KA 3CCRA 2B29A 3DM3A 1EU4A 2E75C 4A3BH 1YVCA 1QVGA 1FJGL 4C3JG 5BR8L 3M4YA 1NJIC 2K7VA 1A8VA 3CCEA 3K0XA 1IXRA 1FYCA 1VQNA 1U4MA 1DM0B 2F0SA 1DYQA 1E2WA 1HUNA 4FF4A 3AU7A 1SROA 4JBMA 2ES2A 2IX1A 1TXYA 1XWEA 4KKSA 1X3FA 3J81c 5IYCG 4X65Q 1GXDC 3T13A 1EIYB 3AMUA 3I4MB 2RSNA 4YWLA 3R3OA 1S5CD 2K6AA 2M00A 1IYUA 2UXCL 5GADC 1PRTB 2K50A 3I3CA 4E6IA 3GTOH 3CCQA 1F2LA 4EQPA 3A7LA 1DZ1A 4J15A 1E24A 3U4VA 4HSPA 4IFDJ 4V0BA 1ET9A 1DGSA 1LLRD 3HG9A 2AKWB 2Q2UA 1Q3LA 3VA5A 3OMGA 2UXCQ 1EWCA 1I5FA 1GHJA 4DV2L 4LJZC 5L37A 4MNOA 1QUQA 3ERQA 4J6HA 1PFNA 5GAGC 1C4QA 2EYFA 2EYMA 2K32A 3R8BA 4DKAC 5IGDA 4BA2I 1EU3A 4DV2Q 4C3HG 4A3DG 1UUPA 3K59A 1F9SA 3X3MA 1RD9D 1H9SA 1KD1C 1E0BA 2R93H 4HJ8A 5ELDA 3SK5A 4DR1L 3PF5A 4G7HC 2J4XA 5FLXE 4FXDA 3GTGH 2YU9B 1TIID 1CQVA 2VY3A 2NTTA 3MVVA 2NN6I 3LX0A 1YNJC 5HURA 2HCIA 1PVOA 5F2DA 1BUVT 2NTSA 2MNAA 2V4DA 1SLJA 1VQKA 2QILA 4QGUA 5JEAH 3NTKA 4B9WA 1STAA 1NMGA 1VDZA 1JOQA 1S5FD 2KHIA 4GOPC 4BBSG 1MKHA 4OO1I 3AFQA 4YCWA 1JE5A 1CKNA 1GUTA 2YTXA 2PW7A 2RDHA 2B63B 1T5EA 1B50A 2GA4B 3OIPA 4X6AH 4GKKQ 1HFGA 1SEBD 5I9PA 3CPFA 1K3RA 5ELFA 1FGUA 5M3FB 2C9OA 3TRZA 3DEPA 1BBUA 2LS01 2X6GA 2I07B 1ASZA 1K28A 3W1BA 5IY0A 5CBEE 2BOSA 1CI3M 1IL8A 3I8ZA 1LABA 1NR4A 2F0VA 1DJRD 2F3WA 4BBRB 1SAPA 4I7AA 4P73A 1HA6A 5EGTA 1KRTA 2ZM6Q 1GUOA 4A3BB 2B3GA 2CH4W 5FO8B 1GOZA 2IHFA 4LAAA 3SK4A 5KNDA 3RR5A 4IOAA 1IL2A 1YNND 1LUZA 4JV5L 4DN4M 2WACA 1JE4A 3I2ZA 5IT9L 1K9MC 2JA6G 4DV1L 2IHEA 1B70B 5D65A 1AE3A 2DN8A 2O2LD 1WTXA 1PH6A 3CC4A 3BZDB 1MJEA 4A76A 1A15A 2I5MX 4JVZA 4A3GH 4IUQA 3MFYA 4ZCKA 5C3EH 4OX9L 4JV5Q 4A3LH 2PQEA 3GTOB 4KJOA 1LT3D 4PMBA 5T1IA 2RQXA 1B8AA 5I4DA 2KJXA 4P74A 4MN3A 1GUSA 5IYDG 3NWTA 3NPPA 1FNUA 5EKKA 4BY7G 4OX9Q 2F0GA 1U4PA 3MC0B 4OGQC 1FNVA 2RF4A 2PNRC 1TWFB 1C7YA 3EBEA 4G4KA 2ZXPA 3EJIA 4LMQD 2K14A 2UU9L 4YIJA 2PQAB 4Y7NH 1BQQT 3JC66 2A6HC 1EOVA 1ZYRD 1JC7A 1OO9B 5EJWA 4IZ8A 4A3KH 1TT2A 3Q24A 2QCPX 2NUCA 2HHHL 4B3RQ 3W1GA 4C3JB 1E1TA 1ZKOA 2TSSA 1QVCA 2F0MA 1D2BA 1A0IA 4Q5VA 4DR5Q 1SMXA 3Q23A 4LF5L 3F2BA 3LWUA 1VQLA 1K8OA 2CFMA 1HXYD 1ML0D 3GTLH 1F9RA 3W3AA 3DUZA 3MFGA 1DXMA 4DU9A 2K5WA 4GN4B 4QIWB 3FPUB 1PYWD 3MXNA 4MIUA 4H7BA 2HHHQ 3GTJB 3S1MH 4N9TA 1VF5C 3HZXA 1Z7TA 2D5DA 1S5DD 1PDQA 1YNXA 1KL9A 2Z9HA 4DR6Q 2PMZB 1EYGA 1B2TA 2YV5A 3A5UA 2NZOA 2DY8A 3PQIA 2RSOA 3M4QA 3JAME 1YJNA 4JI3Q 4NDXA 2Z1CA 3NSWA 1SJHD 1U5KA 4GLAC 4RMFA 3CD6A 5COYA 4C3IH 2TMPA 5I2XA 5LMNW 1EL0A 1Q81C 3F8TA 1SE3A 4G7OC 5FK9C 4F88A 2MGSA 2H4OA 2LSSA 5C4XG 1V9PA 4WORA 3HKSA 1TS4A 4H13C 1CTMA 4UP9A 1ILPA 1SYFA 1ILQA 2KQ3A 4C3HB 3J81j 4A3DB 1BXTA 2A6EC 4K2KA 1UNSA 3H6MA 3EQLC 4K0KL 1X3GA 2PI2E 3CPWA 4LFBQ 4JBWA 1RHPA 2CVRA 4K6DA 3S15H 3GTKB 3T56B 2PW5A 1EQQA 4OO1H 3ONAB 2VUMG 1SBBB 1ONLA 2BCOA 3S1NB 1HZAA 4GN5A 4K0KQ 1I4PA 1VQDA 4DV3L 2HQLA 4R4OA 4Z9CB 1VQMA 4A3EH 4CKEA 1J6QA 4P2CB 3J80E 4F8MA 2B2WC 1N36Q 1JWUD 4QB4A 4BBSB 4A3GB 1JB7A 3E0JA 2R92H 1UEAB 2KCNA 4ULLA 2K33A 4H02A 3A8IE 2XRQD 4AIMA 4DV3Q 1IYVA 1TVXA 4DR2L 1K73C 1S72A 5C0XG 4GNXC 4HIOA 3I70A 4C1NK 5HGTA 1CZWA 4DNTB 4A3JG 3FRPB 3BYTB 1BOSA 1D1KA 4DAYA 5GQOA 2ZT9C 4QL5A 3A8KE 1Q1EA 2WB1G 3GTQH 2GVBA 1IHZA 3TREA 3P1HA 3IFTA 4CHTB 1X32A 3BVZA 3G48A 2A1AA 2UXBL 4DR2Q 3I4NG 4Y7NB 2R7ZG 2EJGC 1LO5D 5G3LF 5C44G 5G3LD 1HZ9A 1T9HA 2L9HA 2MO1A 4G7ZC 1RJTA 2SOBA 2L15A 3MTSA 4PQXA 5I6YA 2E2IH 1FL0A 3OTOL 2AQ2B 4RGMA 2E2JH 2XN9C 2UXBQ 2RDGA 2KOLA 1XNRL 3M85A 2EDGA 4YWMA 2BDOA 3GTLB 2A69D 1TY2A 2KHJA 3MXPA 1RKNA 5JJZA 2JA6B 2VW9A 1SNDA 2K5QA 4N8X1 3K8AA 4K8JA 1VQJA 1O7YA 2EQSA 2PMZE 3FKIH 2UUAL 2WP8J 3OW7A 5GROA 2E2HH 1MSHA 2EYLA 3HOVH 1HNZL 2DNEA 5FLXc 2CWPA 1YITA 1JJCB 2BH8A 4IPDA 3S1QH 4QUFA 3OMCA 2F0LA 3H15A 5C0XH 3S16B 1XXGA 1JJGA 1AN8A 3OHXC 3RD4A 4EVOA 1QOHA 2IT1A 1HNZQ 1I4GA 1NR2A 2ENBA 4BY7B 2PZTA 2E5LL 1T5XD 1BO0A 2SEBD 3GV3A 3H0GG 3CP0A 4GLVB 1KDBA 2ZXOA 2FFKB 1N33L 1NAPA 4A3MH 4AYBE 1I4QA 3RN2A 4JK1C 2E5LQ 5K36G 2F0WA 1YJWA 2FXQA 5IODA 4MZ9A 4DR3L 2N88A 5DNFA 1B1ZA 1HTPA 2AQ3B 4H44C 4K6LA 3DWPA 2Z4IA 1VQ5A 1N33Q 3T51B 2E74C 1W3SA 1AP0A 3F2DA 1HQRD 2G9DA 5EAYA 3RLNA 1J8IA 3G7LA 1X6OA 3MA2B 3M7NA 1DOMA 5ELCA 3I4MH 1PTOF 1UAPA 1PTOD 4DR3Q 2LMCB 1GD7A 1YIJA 2F0PA 2ZTCA 4OONA 3M3YH 3HOZG 1Y1WG 4S3SA 1YNNC 2KCMA 2O5JC 2A5HA 4TVAB 4YHHQ 1HR0L 2B39A 2CH4A 4RAUC 3WWVA 1N34L 2ICIA 3SEBA 2GVAA 2OCEA 1I3QH 2WKCA 2WAQG 5E1FA 4XT1B 4G57A 1L1OB 2CKZB 5H1SE 3RZDB 2PZWA 1NUCA 4RGOS 3J7ZC 3FDTA 1HR0Q 3H0GH 3LWEA 1N34Q 2K75A 3UDFA 1VQHA 4FVMA 5C4XB 1STNA 4C1NI 3GTQB 3RZOH 3FHWA 2JK8A 2XVSA 1EZ8A 4M8AA 5KNBA 1UE1A 1EY9A 3STBD 3T53B 4FYDA 4DF7A 4P71A 2PI2A 2KUMA 3I4LA 4NP5A 2YU9H 1ASYA 1MIUA 4N9PA 5ELNA 1IBML 4HIDA 1V8QA 4M1UB 4KN4C 2CQOA 2E2JB 2VUMB 3AEVA 2A74C 5M5XH 1KAWA 2D0OA 1G6PA 3U58A 2F0NA 2Z6BA 3OW2A 4B08A 5CGKA 4NXNQ 2JP1A 1IBMQ 4DR7Q 4UP7A 3FKIB 2CQAA 2OWOA 1B53A 2F1MA 2K28A 4C56C 3CKIB 1ENFA 3HOVB 2A73B 1QZGA 4XTCS 2B63H 5I2YA 2IW3A 2E76C 1EFID 3F1ZA 2HUGA 3D31A 5M3FH 4PMCA 3TS0A 3HOWG 4N8FA 2ZJPA 5KNCA 1VQ7A 2V1CC 1UEBA 2QGQA 3CCSA 3I90A 2PQAA 1ENCA 4A3JB 3S1RB 2JA7G 1X55A 4CDDC 1GO3E 1GJXA 2WB1B 4JPBW 3A0JA 1TS2A 1Z9FA 1YBYA 1STHA 2Z0SA 5KYIA 1MHWC 3K5LA 2CCZA 4BBRH 3PGZA 4J1MA 4KHZA 3E6ZX 3HS0C 3I4NB 4K5XA 1EQVA 2R7ZB 1STEA 4A3MB 3M4OB 3JAMc 1JCKB 1LTLA 1B3AA 3LGJA 4X65L 3CMEA 5C44B 3KJPA 3L7ZC 4FF2A 3E9IA 3ZYYX 4DA2A 1I4RA 1WFQA 2R7FA 1N9WA 4RFBA 3I4OA 3N6RA 4BXXG 1Q90A 4IJLA 4X66Q 2JA5H 2RHQB 4DV5L 1HNWL 1IW7D 2QDLA 2VXWA 2RVLA 3NENA 4UDUC 5CC4A 2IX3A 4A4IA 3A7AB 2LXJA 4LF8Q 1B44D 4QUCA 1E1OA 4XDXA 2JN4A 3M3YB 4DV5Q 1HNWQ 2Y0SE 5J1ZA 1KQSA 2FINB 2D62A 3BYYB 4CKBA 5M3MG 2MP1A 5J22A 3FEWX 1I3QB 1K8MA 4UAIA 4XQQA 1W6JA 4RCOA 1PTOB 3TP7A 1TWFH 4LUZA 4CBVA 2BA0A 2SNSA 3BS1A 4ZUIA 1SYEA 3J80c 1ICFB 3H0GB 4ME5A 1SMYD 2KEEA 1PZJD 1M8AA 1BBXC 1WTRA 1L0YB 3RZOB 1EZ6A 2K1BA 3SXHA 4HJ7A 2I0QA 1TWGB 1YEZA 4ZYSA 1XPRA 3C1EA 4C3JH 2C5CA 2DGYA 1VQAA 3TMEA 1E3PA 1FR3A 1PXUA 1WTOA 1M4VA 1EY5A 4DV0L 4IFDG 3AB9A 2ASBA 3L0OA 3FPPA 3GTJH 5IYCH 3MXUA 5IE8A 5M5XB 2VS1A 4GKKL 2VZAA 4XYOA 3NELA 1HJPA 3EIVA 4GKJQ 5C3XA 2JYOA 3P75A 1UE6A 5FJ8G 4A3IG 2WKDA 3K7UC 3HGBA 4DV0Q 1LT5D 1Y1WB 2RA4A 4DFAA 3CHBD 4DAPA 5DM63 4GS3A 3L9AX 3OOCA 4EX5A 1Z47A 1EY7A 4DNRB 2WAQB 5E3FA 2MUYA 2WB1E 3HFZB 1LACA 1MJCA 2ZM6L 3I72A 1LTGD 1P16A 3PO3G 3QB3A 1XPUA 4A3CG 2PCFB 3ITPA 2Z8LA 4XYQA 4A93G 4C3HH 4A3DH 2EY2A 3IL8A 3RUZA 1SYBA 1KXLA 5C5LA 2B8GA 1SE4A 1PH7A 2NYZD 3GTKH 2HCCA 2OQ0A 2EY5A 3KBGA 4X3UA 3NHHA 2Q8TA 1FD7D 3A5ZB 3S1NH 1HHVA 4IFDH 1EIGA 1QE6A 1Q7YC 1PV4A 2X6LA 2JA5B 2NWGA 3BG3A 2A68C 3VR3A 3H09A 4CDEC 4DV7L 1PRTC 2BH2A 2JA8G 3ICEA 3HRZC 2R7DA 3K7AB 4ABNA 1SNQA 4JI6L 1BBWA 1Q86C 5D3IB 2RCFA 5I6WA 4BBSH 5E7NA 2A19A 4DUZQ 3Q0AA 4XQJA 2XTIA 5FLMG 1STYA 3S14H 3T1YQ 4ID6A 2NVYH 4DV7Q 2F0OA 3PO2G 1RCVD 2QA4A 4KY5A 1R4QB 3U50C 4JI6Q 5A35A 1KAAA 1PLFA 4R9WA 4X64L 3HOWB 1VMPA 1K83B 1Q12A 3I73A 1Y8PB 1QILA 4HJ5A 1VQ6A 3K80C 3ULLA 3WDNA 4B3RL 2JA7B 2D9UA 3PO3H 3HOXG 1SSOA 1BCPF 1Y8OB 2JSOA 2QEXA 2AHOB 3D8GA 1BCPD 2Q2HA 1XNQQ 2G5DA 4NXML 3E9HA 1R9TH 4A93H 3DWQA 2F0DA 4DR5L 4X64Q 3I91A 5CV7A 5GAHC 1E22A 1TU2B 1SXTA 3AQQA 5C0XI 4KV6A 3J81L 3UDXA 4QY7A 1R4PB 1HH2P 5M5YB 4CGYB 4TSSA 2I5HA 1U4LA 1S5ED 1EEID 2VB2X 4LK1C 4NXMQ 3QO2A 4ZUJA 1JOKA 2NN6G 4RWSC 2PNHA 1PZKD 4DR6L 2JA6H 5C4ZA 1CK1A 5IYBG 4TRDA 3UE0A 4R4CA 3NTHA 4O2DA 2F3IA 2KVMA 3J7A5 4JI3L 2F0IA 1TS3A 1MD2D 5IT9E 1I4XA 2G9HD 4DV4L 2WAQE 3VYTA 1L1OA 1G91A 3V2TA 3GTMB 1TWAB 1K3BC 4XIGS 4XQNA 2IY5B 1WTHA 5J39A 3S16H 5M3MB 1KNEA 5IGFA 5IYDH 4JI7L 1D8LA 2JJQA 5ELOA 1H9MA 2K52A 1EYCA 2K5DA 4BY7H 1AH9A 2E2DC 3VR6A 4DV4Q 4EQ5A 4LFBL 3HKZG 1Y14B 2L0CA 3P20A 1VQCA 4PZ7A 1BF4A 2N8NA 4RHSA 4PV1C 1KNAA 2EY6A 2YYZA 3S17B 4JI7Q 1EWHA 5CV9A 2ZTEA 5JVH3 3H3VH 4R4TA 4JI1Q 5LMUL 1WVLA 3PV0A 4CDFC 3L3OC 5M9OA 2IX0A 3VDYA 5E4WC 1LYLA 5M5WB 4XXEA 4UY8C 2P5ZX 3F2UA 4KY6A 1JB3A 3ULJA 4KK7A 1CHQD 4HMJA 4K5VA 5IP9G 1EYDA 4P72A 1N36L 1K0SA 1H95A 5HY6A 5IYBH 5LMUQ 2F0EA 4R4IA 4B3MQ 3TZDA 3BU2A 1TS5A 4L5TA 3PIPA 2UUCL 3M4PA 3EFXD 1H9KA 3RMHA 3J7AF 2EJMA 5IP7G 3K5MA 4HTHA 4U68A 1NE3A 4IURA 4L5SA 2KA7A 4LW1A 1IW7C 1JORA 2R61A 4FDBA 1N32L 2OQKA 2UUCQ 5JJKA 1MBYA 3D0FA 3S14B 2NZHA 3OWEB 3SK8A 2NVYB 1UWVA 1Q82C 1G2SA 3CCUA 3RZDH 1HZCA 4ZK9B 2EE1A 4O0AA 3MEFA 2N3SA 2Q8IB 3BZKA 1QJOA 3QOLA 4QCLA 1N32Q 5IGGA 5D3DA 1HRJA 3NEMA 5AFWA 5C4XH 2LXKA 2MFIA 2EIFA 1Y69U 3J7YW 4A3FG 2KBNA 3A56A 3PO3B 4GN3B 1V1QA 1IBKL 1XMQQ 4FNFA 2KECA 1R9TB 1PH1A 1SNCA 4A93B 1C48A 1RL2A 3K5OA 3CQZB 1N8RC 3MEHA 5IGEA 4Q0FA 3UDIA 2L4NA 3X3NA 4CDCC 2LFNA 1XTDA 1QZHA 4QJFA 4QIWE 1IBKQ 2I5LX 2OTLA 2VUMH 4BA1I 3T4AC 1LTRD 4JI2Q 1BCPB 4JCVE 4KY7A 2PO4A 3B6YA 3URYA 1D6EC 1TWHB 2K5VA 1PYSB 2CHBD 4JI4Q 5D14A 3TN2A 3JAMi 2JA8B 2OXPA 1BDOA 1UE7A 1V43A 3R93A 3K5NA 1O7IA 2CW0D 3A8JE 1KRSA 1I94Q 3TEHB 3TSSA 4KD3A 4PMWA 3CCVA 3D6WA 4OWTB 3HOYG 2EYJA 3PO2B 5JJLA 1SNOA 2JXMB 3J81i 4K5WA 3CW2C 4IQZA 5EKIA 1YI2A 5E4XA 5CR3A 4OXPA 1VQ4A 1MGSA 5ISRA 4A3JH 3S1RH 2F0TA 1W6KA 1OTCA 2HD3A 1X9NA 2SNMA 2DUDA 3K58A 1QWYA 1A3VA 4IUPA 3HOXB 1CKMA 1ZEQX 3I4NH 2Q2IA 2R7ZH 5LL6S 3M4OH 2QF7A 5FO7B 3KBXA 4YWKA 4L63B 4F7XA 3G71A 5C44H 1GM5A 4EQOA 2N49A 4TKOB 5C5MA 4O1NA 3G4SA 1SNMA 3NBIA 2FHTA 3DWAA 1B3QA 4H0LC 4RGTA 1KABA 5C6AA 4ILWA 3KK7A 4DK0A 1VQPA 4HIMA 4YHHL 3N52A 5T1GA 1D1IA 1HR0W 3SHLA 1BR9A 3CXCA 2K4KA 1PH9A 1TWCB 2AUJD 2B8FA 2HIVA 4NMZA 1E2ZA 5HGQA 4GLXA 4X3KA 5JPMC 3IRBA 3TBIB 4DGZA 3Q22A 1HQMC 1JQYD 2RCNA 4RG1A 3K57A 2H5XA 1O78A 1G8ZD 1F77A 2HDMA 4KLKA 4JOIA 4HIKA 4BY1G 3S2DH 1DD2A 2QEJC 1SYGA 3GTPB 4LF6L 3KF8B 1CA5A 2ATWA 1PTOH 1JMCA 1EFWA 1V1PB 2HDLA 1KLUD 2EPBA 4JG2A 1PFMA 3Q8DA 4FXKC 3GP7A 2UUBQ 4FO2A 1OXTA 1VCIA 3TQYA 3HKZB 1K0RA 4LF6Q 1JICA 1G6ZA 4LF7Q 1B7YB 1GVPA 1HTLD 1CFMA 5EQ0A 1EEFD 1TWGH 4IOCA 5K36H 3KLSX 4IPHA 4HCSA 2XSCA 3PIOA 3EN2A 1V1OA 5DEHA 3KF6B 4BWGB 4NXNL 3J7AV 4DR7L 3CRLC 1W2BA 5KGUA 2UXDL 1LT4D 4IPGA 1C0AA 1XX8A 1ZYRC 4ZLTF 1DOLA 4FF1A 3KLSA 5FOBB 4WJ3M 1OXXK 2F0UA 1PMRA 4EGVA 4A3BG 1A6XA 4X3SA 3HOUG 3HOZH 1Y1WH 3Q6SA 3MXGA 2MJ8A 2UXDQ 3IAYA 1BNZA 4IFDI 4X62L 3CCJA 1NBWA 3CC2A 1I50H 4KJNA 1QG7A 1WJJA 1G51A 3MWYW 3TDQA 3TP5A 3T1HQ 3OWFA 1CZGA 1GUWA 1HCZA 1VQIA 2ID0A 3SGIA 2OEOA 1Q1BA 2J0TD 5EPLA 1X65A 4X62Q 3KUPA 3PUVA 4CJ1B 3GDEA 4HR7B 4MTNA 4C2MB 4KKUA 5IT9c 5ELEA 4GOPB 3H3VC 1VQ9A 3HEJA 4RA8A 2KENA 4X66L 4LF9L 1HPCA 1GHKA 3V05A 4AH6A 1VQFA 2F0QA 4IO9A 1F2ZA 1RDPD 5JEAJ 5IWAL 3D4DA 4K8IA 2B2UC 4LUOA 3RN5A 1XYIA 4IJHA 3MAQA 4P75A 4ZRZA 4OWXB 4KHVA 4LF8L 1SN8A 1WTPA 4LFCL 1XMOQ 2Q2TA 4LF9Q 2DJFC 5FLXL 4LNQA 2F0FA 2BDNA 1ZXTA 3SR1A 2NBFA 3G6JB 5IWAQ 5CV6A 1IZ6A 4JI0L 2NVXB 3K7AH 2JA9A 4OEMB 4UHVA 2R93G 1P8LA 3HOUH 3PUWA 2L5TA 3W2DA 4LFCQ 1O80A 2J7ZA 3KDFB 1YHAA 2AWOA 4PZ8A 1HA5A 2EVBA 2XNAC 1FVIA 1L2FA 1F2MA 3A55A 1MSGA 1SFOB 1SRUA 3DHQA 4JI0Q 1L1OC 4B3TL 3S2DB 1FJGQ 5JAVA 5BR8Q 1S5BD 3HOWH 3HOYB 1RODA 1K83H 3ZJYC 4F87A 3QOJA 1B4OA 1B9NA 5JEAG 5JPNC 5CMDA 2WIIB 4OIKA 4DXGA 3E3XA 1EQRA 3HKZE 4I65A 2JA7H 1OXVA 5KIXA 2NVQB 1G2TA 1NCVA 4B3TQ 2F0KA 2EYPA 2KHSA 2EYOA 4HEDA 2OF1A 3C1FA 4HSVA 3VR2A 3CMAA 1CQFA 1QCBD 2B2VA 3UI2A 3F2CA 5ELBA 1NSNS 2Z6KC 1IBLL 2AWNA 3OYYA 3NQIA 3BVMA 1YJ9A 3KLRA 4BXXH 2ICEC 4GKJL 5AJ3L 4ZKCB 1GUNA 3HP3A 2H1EA 4DPGA 1PA6A 1KTKA 2F03A 5LL6X 5KYLA 3H3VI 3EVQA 2N55A 3NP8A 3PIP3 1IBLQ 1S4ZA 1Q46A 1LTID 3ERSX 4HCEA 4HN7A 4AYBG 1PH5A 5AJ3Q 1F2YA 3U9SA 3BZCA 3HOZB 1K8AC 3D4RA 1BKBA 1IKMA 1F9PA 3ND9A 4U673 2A69C 4JW0A 3GTMH 1TWAH 2EXZA 5M3MH 4BY1B 2B2YA 1A2TA 3KFUA 1IYJB 5LHY1 4DR1Q 1I50B 1CSPA 1SJED 4POFA 4R4QA 2XGTA 2CW0C 2EYHA 3R2TA 1STBA 5C4HA 1JWSD 3UE1A 2F4VL 4A3GG 4DR4L 5C3EG 4A3LG 1I6HH 1LM0A 1XTCD 3PUXA 2L55A 3S17H 2VNUD 3SE0A 2RKSA 3U9OA 1EUJA 5NUCA 1Y1VG 3M7GA 2L11A 5FKAC 4J8QA 4UP8A 2FMCA 2F4VQ 4DR4Q 5DAUA 3P7JA 5M5WH 1VQOA 4JC0A 4DUYL 1PH2A 3H94A 1VS0A 4JI5L 5TSSA 5J3BA 1ESRA 1X3QA 2OTJA 4UPAA 4L5RC 4DUZL 1OXSC 1CHPD 5M5YH 2EXDA 2AMCB 5JOBA 1PH4A 1JR0D 3CU7A 3T1YL 4A3KG 4HJ9A 1H9RA 4DUYQ 4JI5Q 3EA6A 1U9RA 5FJ8H 5C3WA 4A3IH 3TP8A 3HOUB 4YCVA 2NZ1D 3C3LA 2MO0A 3I7FA 1AFPA 4R8IA 4CJ0B 1CM9A 3ULPA 5I9OA 2RDFA 1PTOC 2FMMA 1EYAA 2Q8RE 4WFN3 1XNQL 1DONA 2FJ2A 1CT1D 2YTVA 5EBDA 1AZPA 3KYHC 1II3A 3VYSA 4IN3A 3JAML 4MTKA 3K6OA 3V96A 3NBHB 2QW7A 5C4JH 3NXWA 5IOCA 2K01A 1PHJA 1A3TA 5IGBA 4Y52H 1B9MA 4YY3L 4A3CH 2CWAA 4DV1Q 2M2LA 2IWHA 4MHEA 4KI0A 2B2TA 1I4HA 1Y1VH 3CQZH 4RCNA 2L12A 3D6CA 4LWCA 4ME3A 3D4WA 3QWNA 1U4RA 4WJWA 3GD7A 4KKTA 1EY6A 1JT8A 2LY7A 2B2UA 1ET6A 4JYAL 1VQ8A 4C3IG 3BDCA 4GNXB 4QQBX 4YY3Q 3PSIA 4DAVA 2F0JA 3NTIA 1HUMA 3GQBA 1EOTA 4LF4L 3C46A 1TWHH 4RGNA 3STBC 2VQFL 2NVTH 4JYAQ 2WFWA 2JA8H 3GV6A 2R93B 3U4ZA 4CJ2C 2UU9Q 1GUGA 2BE5D 2D0PA 4LF4Q 3KF8A 2JEBI 3OSOA 3GTGB 3S9WA 5FLMH 4OO1G 2F52A 4APVA 3J80L 4LFAL 2VQFQ 1V1PA 1HZBA 4JOIC 3DXJC 3PO2H 4HMIA 1KHIA 4OWWB 3AYHB 1PFSA 5DLQE 3VYUA 1ICWA 1O7ZA 3BDOA 1SE2A 1TR5A 2YTYA 4JI1L 4A3EG 1A2UA 4QMGA 2AQ1B 4LF5Q 5EPKA 4LFAQ 1E2VA 3HOXH 1NY4A 2K04A 1I6HB 4OIJA 5CV4A 2R92G 2NB0A 1KC8C 4HAEA 1EQTA 2Y0SG 3NE5B 1RIPA 5BN4A 2ZXRA 4LUVA 3VR4A 3KF6A 1EIHA 3ER0A 3LNNA 2R3ZA 2ZJQA 4NKLA 1QNUA 1UE5A 3FVQA 3TZUA 1I6VC 4AQYL 4B3ML 2Z6KA 1DOKA 1TKWB 2IJ0A 1EWIA 3BVGA 3PIO3 1WD1A 1PFBA
chains in the Genus database with same CATH topology
4WRDA 1FGBD 2Z4HA 2NN6H 2K05A 1D5ZC 1TY0A 4ZKBB 3J81E 1AEXA 2L1BA 2XWBB 3QG1A 4FXGC 1SYCA 2EZVA 5M5YB 1SNPA 2KEDA 2PYKA 1RTNA 5C0XJ 3C2PA 4OHJA 4L8JA 5EBCA 4AYBB 1H9SB 5EPJA 3DMUA 4A3IB 1WTWA 4EQNA 1JWMD 2D2CC 1HFNA 3PMFA 5K5PA 2R6GA 2O5IC 1LTSD 3QJYA 4ZQ3A 2EOTA 3VYRA 2MPMA 5KRUA 5CV5A 3IKJA 4I7ZC 5A2QL 1EY4A 1LTAD 5C4JB 5C3EB 1FNWA 2F0HA 1Y1VB 4R8NA 5IGCA 1Y8NB 3T16A 2DY7A 3DM1A 1QB5D 5CORA 1SMYC 2I46A 1Q8IA 3EROA 3R2IA 3PUZA 1D5XC 1J9OA 4FF3A 3RLFA 1YNJD 1VF7A 1ENAA 4KD4A 2NVTB 1AZQA 4A3KB 1MI2A 1LV9A 1EY0A 2SDFA 1G291 4DK1A 3VR5A 1H9JA 4IUUA 5JVG3 1JOOA 3A54A 3WOFA 1SYDA 5BN3A 3S1MB 2BA1A 4DXFA 1WTQA 2WINB 4IUVA 2OT2A 1RF2D 4X3TA 4IALA 1LT6D 3IFDA 5A2QE 3NQTA 4ZAIA 2B2VC 3PUYA 4C3IB 3FMCA 4XT3B 3SDZA 1ESFA 5CYUA 3NK9A 1WD0A 3CRKC 4RHRA 1TQOA 1L0XB 4OL7A 2KCCA 4KMUC 2A68D 4NW2A 1PRTF 1STGA 2XIWA 1PRTD 2F3VA 2VB3X 2WV6D 4RKLA 1O7LA 2K03A 3S15B 5CBAE 5IIFA 3BDLA 2PPBC 3GO5A 2HQEA 2X69A 4IUNA 2JEAI 4RKBA 2B2YC 1QNKA 2EJFC 4CKCA 3OIQA 4O42A 4TQUS 1WTVA 3DEOA 4BS9A 2AUKA 4A3EB 3MZ5A 2IL8A 4B9XA 2R92B 1KLGD 2Y0SB 3H91A 4GZYC 3QIAA 2A6HD 1AW7A 3OPOA 4KTAA 5FO9B 4V190 1D5MC 1BCPC 2QDBA 1SDFA 1CA6A 4IUTA 2XWJB 3SK6A 3D3RA 2LKVA 1VMCA 1KDCA 1LTTD 2M9VA 1RTOA 2MHVA 2E2IB 3NUCA 3SVMA 3K0YA 4L6TB 2DNCA 1OXUA 3E5SA 4KN7C 4K2LA 2O4XA 3NBHA 1PZID 1Z6HA 1C8CA 2F4IA 5KEEA 4RH6A 3O13A 2BE5C 2PZUA 4PNYA 2B2WA 1F9QA 2E2HB 2QKIC 3NWSA 2XRSD 3WOEA 3VA7A 2JE6I 4A3FB 2RBMA 3ND8A 4ODGA 4QF4A 1EY8A 2B2TC 3S1QB 2EY1A 1IKLA 2A6ED 1KDAA 5CV8A 5EKLA 5BN5A 4FP5D 1WCMB 1A3UA 1X3PA 1LTBD 2IPKD 4K14A 3MHBA 3TP6A 5DM73 3S2HB 1DCZA 1EU4A 2E75C 4C3JG 3M4YA 2K7VA 1FYCA 1U4MA 1DM0B 2F0SA 1DYQA 1E2WA 1HUNA 4FF4A 3AU7A 2IX1A 1XWEA 4KKSA 1GXDC 3T13A 3AMUA 3I4MB 2RSNA 3R3OA 1S5CD 2K6AA 2M00A 1IYUA 1PRTB 3I3CA 4E6IA 1F2LA 4EQPA 3A7LA 1DZ1A 4HSPA 4IFDJ 4V0BA 1ET9A 1LLRD 3HG9A 1Q3LA 3VA5A 3OMGA 1EWCA 1GHJA 4LJZC 3ERQA 4J6HA 1PFNA 1C4QA 2EYFA 2EYMA 2K32A 3R8BA 5IGDA 4BA2I 1EU3A 4C3HG 1UUPA 3K59A 1F9SA 3X3MA 1RD9D 1H9SA 1E0BA 5ELDA 3SK5A 4G7HC 2J4XA 5FLXE 4FXDA 2YU9B 1TIID 1CQVA 2NTTA 3MVVA 2NN6I 3LX0A 1YNJC 5HURA 2HCIA 5F2DA 1BUVT 2NTSA 2V4DA 2QILA 5JEAH 3NTKA 4B9WA 1STAA 1VDZA 1JOQA 1S5FD 4OO1I 1GUTA 2PW7A 2RDHA 2B63B 1T5EA 1B50A 2GA4B 3OIPA 1HFGA 1SEBD 5I9PA 5ELFA 5M3FB 2C9OA 3DEPA 2LS01 2X6GA 2I07B 5CBEE 2BOSA 1CI3M 1IL8A 3I8ZA 1LABA 1NR4A 2F0VA 1DJRD 2F3WA 4BBRB 1SAPA 1HA6A 5EGTA 1GUOA 4A3BB 5FO8B 1GOZA 4LAAA 3SK4A 5KNDA 1YNND 4DN4M 2WACA 1JE4A 5IT9L 5D65A 2DN8A 2O2LD 1WTXA 3BZDB 1A15A 4IUQA 3MFYA 2PQEA 3GTOB 4KJOA 1LT3D 4PMBA 5T1IA 2RQXA 5I4DA 2KJXA 4MN3A 1GUSA 3NWTA 3NPPA 1FNUA 5EKKA 2F0GA 1U4PA 3MC0B 4OGQC 1FNVA 2PNRC 1TWFB 4G4KA 2ZXPA 3EJIA 4LMQD 4YIJA 1BQQT 2A6HC 1ZYRD 1JC7A 1OO9B 5EJWA 4IZ8A 1TT2A 3Q24A 2QCPX 2NUCA 4C3JB 1ZKOA 2TSSA 2F0MA 1D2BA 4Q5VA 3Q23A 3LWUA 1K8OA 1HXYD 1ML0D 1F9RA 3W3AA 3DUZA 3MFGA 1DXMA 4DU9A 2K5WA 4QIWB 3FPUB 1PYWD 3MXNA 4MIUA 4H7BA 3GTJB 4N9TA 1VF5C 3HZXA 1Z7TA 2D5DA 1S5DD 1PDQA 2PMZB 1B2TA 2DY8A 2RSOA 3JAME 4NDXA 2Z1CA 3NSWA 1SJHD 5COYA 2TMPA 5I2XA 1EL0A 4G7OC 1SE3A 5FK9C 4F88A 2MGSA 2H4OA 4WORA 1TS4A 4H13C 1CTMA 1ILPA 1SYFA 1ILQA 2KQ3A 4C3HB 4A3DB 1BXTA 2A6EC 4K2KA 1UNSA 3H6MA 3EQLC 4JBWA 1RHPA 2CVRA 4K6DA 3GTKB 3T56B 2PW5A 4OO1H 3ONAB 1SBBB 1ONLA 2BCOA 3S1NB 1I4PA 4Z9CB 4CKEA 4P2CB 3J80E 4F8MA 2B2WC 1JWUD 4QB4A 4BBSB 4A3GB 3E0JA 1UEAB 2KCNA 4ULLA 2K33A 3A8IE 2XRQD 1IYVA 1TVXA 5C0XG 3I70A 4C1NK 5HGTA 1CZWA 4DNTB 3FRPB 3BYTB 1BOSA 1D1KA 4DAYA 2ZT9C 3A8KE 1Q1EA 1IHZA 3P1HA 3IFTA 4CHTB 1X32A 3BVZA 4Y7NB 2EJGC 1LO5D 5G3LF 5G3LD 2L9HA 4G7ZC 1RJTA 2SOBA 3MTSA 4PQXA 5I6YA 2AQ2B 4RGMA 2XN9C 2RDGA 2KOLA 3M85A 2EDGA 2BDOA 3GTLB 2A69D 1TY2A 3MXPA 1RKNA 5JJZA 2JA6B 1SNDA 2K5QA 4K8JA 1O7YA 2WP8J 3OW7A 1MSHA 2EYLA 2DNEA 4QUFA 3OMCA 2F0LA 5C0XH 3S16B 1XXGA 1AN8A 3OHXC 3RD4A 4EVOA 1QOHA 2IT1A 1I4GA 1NR2A 2ENBA 4BY7B 2PZTA 1T5XD 1BO0A 2SEBD 3GV3A 1KDBA 2ZXOA 2FFKB 1NAPA 1I4QA 4JK1C 5K36G 2F0WA 5IODA 2N88A 5DNFA 1B1ZA 1HTPA 2AQ3B 4H44C 4K6LA 3DWPA 2Z4IA 3T51B 2E74C 1AP0A 1HQRD 2G9DA 1J8IA 3G7LA 3MA2B 3M7NA 1DOMA 5ELCA 1PTOF 1UAPA 1PTOD 2LMCB 2F0PA 4S3SA 1YNNC 2O5JC 2A5HA 2B39A 4RAUC 2ICIA 3SEBA 2WKCA 5E1FA 4XT1B 4G57A 3RZDB 2PZWA 1NUCA 4RGOS 3FDTA 3LWEA 4FVMA 5C4XB 1STNA 4C1NI 3GTQB 2XVSA 1EZ8A 4M8AA 5KNBA 1EY9A 3T53B 4FYDA 4DF7A 2KUMA 3I4LA 4NP5A 4N9PA 1V8QA 4M1UB 4KN4C 2E2JB 2VUMB 2A74C 2F0NA 4B08A 5CGKA 2JP1A 3FKIB 2CQAA 1B53A 2F1MA 2K28A 4C56C 3CKIB 1ENFA 3HOVB 2A73B 4XTCS 5I2YA 2IW3A 2E76C 1EFID 2HUGA 3D31A 4PMCA 5KNCA 3I90A 1ENCA 4A3JB 3S1RB 1GJXA 2WB1B 1TS2A 1STHA 5KYIA 3K5LA 4J1MA 4KHZA 3E6ZX 3HS0C 3I4NB 4K5XA 1EQVA 2R7ZB 1STEA 4A3MB 3M4OB 1JCKB 1B3AA 5C44B 3L7ZC 4FF2A 3ZYYX 4DA2A 1I4RA 4RFBA 3N6RA 1Q90A 1IW7D 2VXWA 2RVLA 5CC4A 4UDUC 2IX3A 3A7AB 1B44D 4QUCA 4XDXA 3M3YB 5J1ZA 2FINB 2D62A 3BYYB 4CKBA 2MP1A 5J22A 3FEWX 1I3QB 1K8MA 4UAIA 4XQQA 1W6JA 4RCOA 1PTOB 3TP7A 4CBVA 2BA0A 2SNSA 3BS1A 4ZUIA 1SYEA 3H0GB 4ME5A 1SMYD 2KEEA 1PZJD 1M8AA 1BBXC 1WTRA 1L0YB 3RZOB 1EZ6A 2K1BA 3SXHA 1TWGB 4ZYSA 3C1EA 2C5CA 3TMEA 1FR3A 1PXUA 1WTOA 1M4VA 1EY5A 4IFDG 3AB9A 3FPPA 3MXUA 5M5XB 4XYOA 5C3XA 2JYOA 3P75A 2WKDA 3HGBA 1LT5D 1Y1WB 2RA4A 4DFAA 3CHBD 4DAPA 5DM63 3L9AX 3OOCA 1Z47A 1EY7A 4DNRB 2WAQB 5E3FA 2MUYA 1LACA 3I72A 1LTGD 3QB3A 2PCFB 3ITPA 2Z8LA 4XYQA 2EY2A 3IL8A 3RUZA 1SYBA 5C5LA 2B8GA 1SE4A 2NYZD 2HCCA 2EY5A 3KBGA 4X3UA 3NHHA 2Q8TA 1FD7D 1HHVA 4IFDH 1EIGA 1QE6A 2X6LA 2JA5B 2NWGA 3BG3A 2A68C 3VR3A 3H09A 1PRTC 3HRZC 3K7AB 4ABNA 1SNQA 5D3IB 5I6WA 3Q0AA 4XQJA 1STYA 4ID6A 2F0OA 1RCVD 4KY5A 1R4QB 5A35A 1KAAA 1PLFA 4R9WA 3HOWB 1VMPA 1K83B 1Q12A 3I73A 1Y8PB 1QILA 3WDNA 2JA7B 2D9UA 1SSOA 1BCPF 1Y8OB 2JSOA 3D8GA 1BCPD 3DWQA 2F0DA 3I91A 5CV7A 1TU2B 1SXTA 5C0XI 4KV6A 3J81L 1R4PB 4CGYB 4TSSA 1U4LA 1S5ED 1EEID 2VB2X 4LK1C 3QO2A 4ZUJA 1JOKA 2NN6G 4RWSC 1PZKD 5C4ZA 1CK1A 4TRDA 3NTHA 2KVMA 2F0IA 1TS3A 1MD2D 5IT9E 1I4XA 2G9HD 3VYTA 1G91A 3V2TA 3GTMB 1TWAB 4XIGS 4XQNA 5J39A 5M3MB 1KNEA 5IGFA 1H9MA 1EYCA 2K5DA 2E2DC 3VR6A 2L0CA 3P20A 1BF4A 4RHSA 4PV1C 1KNAA 2EY6A 2YYZA 3S17B 1EWHA 5CV9A 5JVH3 1WVLA 3PV0A 3L3OC 5M9OA 2IX0A 5E4WC 5M5WB 4XXEA 3F2UA 4KY6A 1JB3A 4KK7A 1CHQD 4HMJA 4K5VA 1EYDA 2F0EA 3TZDA 1TS5A 3EFXD 1H9KA 3RMHA 3J7AF 2EJMA 3K5MA 4HTHA 4U68A 4IURA 2KA7A 1IW7C 1JORA 2R61A 1MBYA 3S14B 3OWEB 3SK8A 2NVYB 1G2SA 4ZK9B 2EE1A 2Q8IB 1QJOA 3QOLA 4QCLA 5IGGA 5D3DA 1HRJA 5AFWA 1Y69U 3J7YW 3A56A 3PO3B 4FNFA 2KECA 1R9TB 1SNCA 4A93B 1C48A 3K5OA 3CQZB 3MEHA 5IGEA 4Q0FA 2L4NA 3X3NA 2LFNA 4BA1I 3T4AC 1LTRD 1BCPB 4KY7A 2PO4A 3URYA 1D6EC 1TWHB 2CHBD 5D14A 3TN2A 2JA8B 2OXPA 1BDOA 1V43A 3R93A 3K5NA 2CW0D 3A8JE 3TSSA 4KD3A 4PMWA 3D6WA 2EYJA 3PO2B 1SNOA 2JXMB 4K5WA 4IQZA 5EKIA 5E4XA 5CR3A 1MGSA 5ISRA 2F0TA 1W6KA 2SNMA 3K58A 1QWYA 1A3VA 4IUPA 3HOXB 1ZEQX 5LL6S 2QF7A 5FO7B 3KBXA 4L63B 4F7XA 4EQOA 4TKOB 5C5MA 4O1NA 1SNMA 3NBIA 2FHTA 3DWAA 4H0LC 4RGTA 1KABA 5C6AA 4ILWA 3KK7A 4DK0A 3N52A 5T1GA 1D1IA 3SHLA 1BR9A 1TWCB 2AUJD 2B8FA 4NMZA 1E2ZA 4X3KA 5JPMC 3TBIB 4DGZA 3Q22A 1HQMC 1JQYD 3K57A 1O78A 1G8ZD 1F77A 2HDMA 1DD2A 2QEJC 1SYGA 3GTPB 1CA5A 1PTOH 1V1PB 2HDLA 1KLUD 2EPBA 1PFMA 4FXKC 3GP7A 4FO2A 1OXTA 1VCIA 3HKZB 1G6ZA 1JICA 1HTLD 1CFMA 5EQ0A 1EEFD 5K36H 3KLSX 4HCSA 2XSCA 1V1OA 5DEHA 4BWGB 3J7AV 3CRLC 5KGUA 1LT4D 1XX8A 1ZYRC 4ZLTF 1DOLA 4FF1A 3KLSA 5FOBB 1OXXK 2F0UA 1PMRA 4EGVA 1A6XA 4X3SA 3Q6SA 3MXGA 2MJ8A 3IAYA 1BNZA 4IFDI 4KJNA 1QG7A 3MWYW 3TDQA 3TP5A 3OWFA 1CZGA 1GUWA 1HCZA 2ID0A 2OEOA 1Q1BA 2J0TD 5EPLA 3KUPA 3PUVA 4CJ1B 4HR7B 4C2MB 4KKUA 5ELEA 3H3VC 3HEJA 4RA8A 1HPCA 1GHKA 3V05A 2F0QA 1F2ZA 1RDPD 5JEAJ 3D4DA 4K8IA 2B2UC 1XYIA 3MAQA 4ZRZA 4KHVA 1WTPA 5FLXL 2F0FA 2BDNA 1ZXTA 3SR1A 2NBFA 3G6JB 5CV6A 2NVXB 3PUWA 2L5TA 3W2DA 1O80A 2J7ZA 2AWOA 1HA5A 2EVBA 2XNAC 1F2MA 3A55A 1MSGA 1SFOB 3DHQA 3S2DB 5JAVA 1S5BD 3HOYB 1RODA 4F87A 3QOJA 1B4OA 1B9NA 5JEAG 5JPNC 5CMDA 2WIIB 4OIKA 4DXGA 4I65A 1OXVA 5KIXA 2NVQB 1G2TA 1NCVA 2F0KA 2EYPA 2KHSA 2EYOA 4HEDA 2OF1A 3C1FA 4HSVA 3VR2A 1CQFA 1QCBD 2B2VA 3UI2A 5ELBA 1NSNS 2AWNA 3NQIA 3BVMA 3KLRA 2ICEC 4ZKCB 1GUNA 3HP3A 2H1EA 1KTKA 2F03A 5LL6X 5KYLA 3EVQA 2N55A 3NP8A 3PIP3 1S4ZA 4HCEA 1LTID 4HN7A 1F2YA 3U9SA 3HOZB 3D4RA 1IKMA 1F9PA 3ND9A 4U673 2A69C 2EXZA 4BY1B 2B2YA 1A2TA 5LHY1 1I50B 1SJED 2CW0C 2EYHA 3R2TA 1STBA 5C4HA 1JWSD 1XTCD 3PUXA 2L55A 2VNUD 3SE0A 2RKSA 3U9OA 5NUCA 3M7GA 2L11A 5FKAC 4J8QA 2FMCA 5DAUA 3P7JA 3H94A 5TSSA 1ESRA 1X3QA 1OXSC 1CHPD 5JOBA 1JR0D 3CU7A 1H9RA 3EA6A 1U9RA 5C3WA 3TP8A 3HOUB 2NZ1D 3C3LA 1AFPA 4R8IA 4CJ0B 1CM9A 5I9OA 2RDFA 1PTOC 2FMMA 1EYAA 2Q8RE 4WFN3 1DONA 2FJ2A 1CT1D 5EBDA 1AZPA 1II3A 3VYSA 4IN3A 3JAML 3K6OA 3V96A 3NXWA 5IOCA 2K01A 1A3TA 5IGBA 1B9MA 2M2LA 2IWHA 4MHEA 4KI0A 2B2TA 1I4HA 4RCNA 2L12A 3D6CA 3D4WA 3QWNA 1U4RA 4WJWA 3GD7A 4KKTA 1EY6A 2LY7A 2B2UA 1ET6A 4C3IG 3BDCA 4DAVA 2F0JA 3NTIA 1HUMA 3GQBA 1EOTA 3C46A 4RGNA 3GV6A 2R93B 4CJ2C 1GUGA 2BE5D 3KF8A 2JEBI 3OSOA 3GTGB 3S9WA 4OO1G 3J80L 1V1PA 3DXJC 4HMIA 3VYUA 1ICWA 1O7ZA 3BDOA 1SE2A 1TR5A 1A2UA 4QMGA 2AQ1B 5EPKA 1E2VA 2K04A 1I6HB 4OIJA 5CV4A 2NB0A 4HAEA 1EQTA 3NE5B 5BN4A 2ZXRA 3VR4A 1EIHA 3LNNA 2R3ZA 4NKLA 1QNUA 3FVQA 3TZUA 1I6VC 1DOKA 1TKWB 2IJ0A 3BVGA 3PIO3 1WD1A 1PFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBF A;  2KCN A;  2NB0 A;  2MHV A;  1AFP A; 
#chains in the Genus database with same CATH topology
 4WRD A;  1FGB D;  2Z4H A;  2NN6 H;  1QUQ B;  2K05 A;  1D5Z C;  1TY0 A;  4ZKB B;  3J81 E;  2ALY B;  1AEX A;  4A75 A;  2L1B A;  2XWB B;  3QG1 A;  4FXG C;  2HT1 A;  1SYC A;  1TWC H;  4AQY Q;  1SNP A;  2KED A;  2PYK A;  4IPC A;  1RTN A;  5LMN L;  4DAM A;  2EZV A;  5C0X J;  1S40 A;  1K8G A;  3TS2 A;  1NTG A;  4R1J A;  1AE2 A;  2K5H A;  3C2P A;  4OHJ A;  4L8J A;  4L5Q A;  5EBC A;  4AYB B;  1H9S B;  1X3E A;  5EPJ A;  3DMU A;  4A3I B;  1WTW A;  4EQN A;  1JWM D;  2D2C C;  3BJU A;  1HFN A;  3PMF A;  5K5P A;  5LMN Q;  3GTP H;  2R6G A;  2O5I C;  1LTS D;  1VQE A;  3QJY A;  1XMQ L;  1VQB A;  4ZQ3 A;  1QVF A;  2EOT A;  3VYR A;  2MPM A;  5KRU A;  3FKI G;  5CV5 A;  3IKJ A;  4GOP A;  4I7Z C;  5A2Q L;  4JBJ A;  3HOV G;  1C9O A;  5JJI A;  1EY4 A;  1LTA D;  5C4J B;  5C3E B;  1FNW A;  1YHQ A;  1EIF A;  4ALP A;  1XJV A;  4JI2 L;  1CKN B;  1Y1V B;  2F0H A;  1S3O A;  4R8N A;  1L0W A;  5IGC A;  2JQO A;  1Y8N B;  2ZTD A;  3T16 A;  2DY7 A;  4JI4 L;  3DM1 A;  1WCM G;  1QB5 D;  5COR A;  1SMY C;  1A63 A;  2I46 A;  1Q8I A;  3ERO A;  3R2I A;  5IP9 H;  3PUZ A;  1D5X C;  1J9O A;  1I94 L;  4FF3 A;  3RLF A;  1YNJ D;  1VF7 A;  4A3M G;  4HJA A;  1ENA A;  3KDF A;  1YHB A;  2HIX A;  4KD4 A;  2NVT B;  1AZQ A;  1A62 A;  4POG A;  4A3K B;  1MI2 A;  1LV9 A;  3CCM A;  5IP7 H;  1EY0 A;  3W5O A;  3I55 A;  2SDF A;  1G29 1;  2GN5 A;  1NMF A;  4DK1 A;  3VR5 A;  4NB3 A;  1U0L A;  3I4M G;  1H9J A;  4IUU A;  5JVG 3;  1KIX A;  1JOO A;  3A54 A;  3WOF A;  1CSQ A;  3OTO Q;  4DNI A;  3CF5 A;  1SYD A;  5BN3 A;  3S1M B;  5GAE C;  2BA1 A;  1WI5 A;  1XNR Q;  4DXF A;  1M90 C;  1WTQ A;  2WIN B;  4C2M H;  4A3F H;  4JBK A;  4IUV A;  3PCO B;  2OT2 A;  1RF2 D;  4NPS A;  4X3T A;  4IAL A;  1LT6 D;  3IFD A;  1YZ6 A;  2UUA Q;  5A2Q E;  3G6E A;  3NQT A;  3CC7 A;  2N78 A;  4ZAI A;  1GKH A;  2B2V C;  2ZJR A;  1HNX L;  2VQE L;  2A8V A;  2DJG C;  3PUY A;  4C3I B;  3FMC A;  1WCM H;  4XT3 B;  4B3S L;  3SDZ A;  1ESF A;  2K5N A;  5CYU A;  3NK9 A;  3J80 i;  1WD0 A;  1PH8 A;  3S2H H;  1CKO A;  3CRK C;  4RHR A;  1TQO A;  2NVX H;  1L0X B;  1VQG A;  4OL7 A;  2KCC A;  4KMU C;  1HNX Q;  2VQE Q;  2A68 D;  4NW2 A;  3AFP A;  1PRT F;  1STG A;  2XIW A;  4B3S Q;  1PRT D;  2F3V A;  2VB3 X;  2WV6 D;  4RKL A;  1O7L A;  2KCT A;  2K03 A;  3S15 B;  3KLW A;  4WJ4 A;  5CBA E;  5IIF A;  1SE8 A;  1SFO H;  3BDL A;  2PPB C;  3GO5 A;  3QR8 A;  2UUB L;  2HQE A;  2X69 A;  4OEL B;  3HOY H;  4IUN A;  2JEA I;  4RKB A;  2B2Y C;  4LF7 L;  1JJ2 A;  1QNK A;  2EJF C;  4CKC A;  3OIQ A;  4O42 A;  4TQU S;  1E7Z A;  1WTV A;  3DEO A;  4BS9 A;  3MXN B;  3RNU A;  2NVQ H;  2AUK A;  4A3E B;  4DK3 C;  3CAM A;  3MZ5 A;  3L2P A;  2B63 G;  1WOC A;  2IL8 A;  3K81 C;  4B9X A;  3I56 A;  2R92 B;  1SR3 A;  1KLG D;  2Y0S B;  3H91 A;  4GZY C;  3QIA A;  5M3F G;  2A6H D;  1AW7 A;  3OPO A;  4KTA A;  1X54 A;  5FO9 B;  4V19 0;  4YCU A;  1D5M C;  1X56 A;  1BCP C;  3E0E A;  3M9B A;  2QDB A;  1SDF A;  1CA6 A;  3KOJ A;  4IUT A;  2XWJ B;  4BBR G;  1WYD A;  3SK6 A;  1NNX A;  3UDG A;  4DV6 L;  3D3R A;  2LKV A;  1VMC A;  4DK6 C;  1KDC A;  1LTT D;  3PF4 A;  3KJO A;  2M9V A;  1RTO A;  2MHV A;  3T1H L;  1D7Q A;  2MQH A;  2C35 B;  2E2I B;  3NUC A;  3SVM A;  3K0Y A;  1J5E L;  1BVS A;  2JA5 G;  2E8G A;  4BY1 H;  4L6T B;  2DNC A;  1OXU A;  3E5S A;  4DV6 Q;  4KN7 C;  4K2L A;  4PZ6 A;  4JI8 L;  2O4X A;  3NBH A;  1PYB A;  1PZI D;  1Z6H A;  1C8C A;  2F4I A;  1PH3 A;  5KEE A;  4RH6 A;  3O13 A;  2BE5 C;  2PZU A;  4PNY A;  2B2W A;  1F9Q A;  3FP9 A;  2E2H B;  1J5E Q;  2QKI C;  3NWS A;  2XRS D;  3WOE A;  4KHP L;  3A74 A;  3VA7 A;  3CCL A;  2JE6 I;  4JI8 Q;  4A3F B;  2RBM A;  1CUK A;  3ND8 A;  3S24 A;  4ODG A;  4QF4 A;  1XMO L;  1EY8 A;  2B2T C;  4GNX A;  3S1Q B;  2EY1 A;  1IKL A;  2VL6 A;  1XPO A;  2A6E D;  1KDA A;  4KHP Q;  5CV8 A;  1M1K C;  3RLO A;  5EKL A;  5BN5 A;  4FP5 D;  1WCM B;  1A3U A;  3DLL A;  2RHS B;  1X3P A;  1LTB D;  4PG3 A;  4DAY B;  2IPK D;  4K14 A;  3MHB A;  3TP6 A;  5DM7 3;  3S2H B;  1DCZ A;  1Q8K A;  3CCR A;  2B29 A;  3DM3 A;  1EU4 A;  2E75 C;  4A3B H;  1YVC A;  1QVG A;  1FJG L;  4C3J G;  5BR8 L;  3M4Y A;  1NJI C;  2K7V A;  1A8V A;  3CCE A;  3K0X A;  1IXR A;  1FYC A;  1VQN A;  1U4M A;  1DM0 B;  2F0S A;  1DYQ A;  1E2W A;  1HUN A;  4FF4 A;  3AU7 A;  1SRO A;  4JBM A;  2ES2 A;  2IX1 A;  1TXY A;  1XWE A;  4KKS A;  1X3F A;  3J81 c;  5IYC G;  4X65 Q;  1GXD C;  3T13 A;  1EIY B;  3AMU A;  3I4M B;  2RSN A;  4YWL A;  3R3O A;  1S5C D;  2K6A A;  2M00 A;  1IYU A;  2UXC L;  5GAD C;  1PRT B;  2K50 A;  3I3C A;  4E6I A;  3GTO H;  3CCQ A;  1F2L A;  4EQP A;  3A7L A;  1DZ1 A;  4J15 A;  1E24 A;  3U4V A;  4HSP A;  4IFD J;  4V0B A;  1ET9 A;  1DGS A;  1LLR D;  3HG9 A;  2AKW B;  2Q2U A;  1Q3L A;  3VA5 A;  3OMG A;  2UXC Q;  1EWC A;  1I5F A;  1GHJ A;  4DV2 L;  4LJZ C;  5L37 A;  4MNO A;  1QUQ A;  3ERQ A;  4J6H A;  1PFN A;  5GAG C;  1C4Q A;  2EYF A;  2EYM A;  2K32 A;  3R8B A;  4DKA C;  5IGD A;  4BA2 I;  1EU3 A;  4DV2 Q;  4C3H G;  4A3D G;  1UUP A;  3K59 A;  1F9S A;  3X3M A;  1RD9 D;  1H9S A;  1KD1 C;  1E0B A;  2R93 H;  4HJ8 A;  5ELD A;  3SK5 A;  4DR1 L;  3PF5 A;  4G7H C;  2J4X A;  5FLX E;  4FXD A;  3GTG H;  2YU9 B;  1TII D;  1CQV A;  2VY3 A;  2NTT A;  3MVV A;  2NN6 I;  3LX0 A;  1YNJ C;  5HUR A;  2HCI A;  1PVO A;  5F2D A;  1BUV T;  2NTS A;  2MNA A;  2V4D A;  1SLJ A;  1VQK A;  2QIL A;  4QGU A;  5JEA H;  3NTK A;  4B9W A;  1STA A;  1NMG A;  1VDZ A;  1JOQ A;  1S5F D;  2KHI A;  4GOP C;  4BBS G;  1MKH A;  4OO1 I;  3AFQ A;  4YCW A;  1JE5 A;  1CKN A;  1GUT A;  2YTX A;  2PW7 A;  2RDH A;  2B63 B;  1T5E A;  1B50 A;  2GA4 B;  3OIP A;  4X6A H;  4GKK Q;  1HFG A;  1SEB D;  5I9P A;  3CPF A;  1K3R A;  5ELF A;  1FGU A;  5M3F B;  2C9O A;  3TRZ A;  3DEP A;  1BBU A;  2LS0 1;  2X6G A;  2I07 B;  1ASZ A;  1K28 A;  3W1B A;  5IY0 A;  5CBE E;  2BOS A;  1CI3 M;  1IL8 A;  3I8Z A;  1LAB A;  1NR4 A;  2F0V A;  1DJR D;  2F3W A;  4BBR B;  1SAP A;  4I7A A;  4P73 A;  1HA6 A;  5EGT A;  1KRT A;  2ZM6 Q;  1GUO A;  4A3B B;  2B3G A;  2CH4 W;  5FO8 B;  1GOZ A;  2IHF A;  4LAA A;  3SK4 A;  5KND A;  3RR5 A;  4IOA A;  1IL2 A;  1YNN D;  1LUZ A;  4JV5 L;  4DN4 M;  2WAC A;  1JE4 A;  3I2Z A;  5IT9 L;  1K9M C;  2JA6 G;  4DV1 L;  2IHE A;  1B70 B;  5D65 A;  1AE3 A;  2DN8 A;  2O2L D;  1WTX A;  1PH6 A;  3CC4 A;  3BZD B;  1MJE A;  4A76 A;  1A15 A;  2I5M X;  4JVZ A;  4A3G H;  4IUQ A;  3MFY A;  4ZCK A;  5C3E H;  4OX9 L;  4JV5 Q;  4A3L H;  2PQE A;  3GTO B;  4KJO A;  1LT3 D;  4PMB A;  5T1I A;  2RQX A;  1B8A A;  5I4D A;  2KJX A;  4P74 A;  4MN3 A;  1GUS A;  5IYD G;  3NWT A;  3NPP A;  1FNU A;  5EKK A;  4BY7 G;  4OX9 Q;  2F0G A;  1U4P A;  3MC0 B;  4OGQ C;  1FNV A;  2RF4 A;  2PNR C;  1TWF B;  1C7Y A;  3EBE A;  4G4K A;  2ZXP A;  3EJI A;  4LMQ D;  2K14 A;  2UU9 L;  4YIJ A;  2PQA B;  4Y7N H;  1BQQ T;  3JC6 6;  2A6H C;  1EOV A;  1ZYR D;  1JC7 A;  1OO9 B;  5EJW A;  4IZ8 A;  4A3K H;  1TT2 A;  3Q24 A;  2QCP X;  2NUC A;  2HHH L;  4B3R Q;  3W1G A;  4C3J B;  1E1T A;  1ZKO A;  2TSS A;  1QVC A;  2F0M A;  1D2B A;  1A0I A;  4Q5V A;  4DR5 Q;  1SMX A;  3Q23 A;  4LF5 L;  3F2B A;  3LWU A;  1VQL A;  1K8O A;  2CFM A;  1HXY D;  1ML0 D;  3GTL H;  1F9R A;  3W3A A;  3DUZ A;  3MFG A;  1DXM A;  4DU9 A;  2K5W A;  4GN4 B;  4QIW B;  3FPU B;  1PYW D;  3MXN A;  4MIU A;  4H7B A;  2HHH Q;  3GTJ B;  3S1M H;  4N9T A;  1VF5 C;  3HZX A;  1Z7T A;  2D5D A;  1S5D D;  1PDQ A;  1YNX A;  1KL9 A;  2Z9H A;  4DR6 Q;  2PMZ B;  1EYG A;  1B2T A;  2YV5 A;  3A5U A;  2NZO A;  2DY8 A;  3PQI A;  2RSO A;  3M4Q A;  3JAM E;  1YJN A;  4JI3 Q;  4NDX A;  2Z1C A;  3NSW A;  1SJH D;  1U5K A;  4GLA C;  4RMF A;  3CD6 A;  5COY A;  4C3I H;  2TMP A;  5I2X A;  5LMN W;  1EL0 A;  1Q81 C;  3F8T A;  1SE3 A;  4G7O C;  5FK9 C;  4F88 A;  2MGS A;  2H4O A;  2LSS A;  5C4X G;  1V9P A;  4WOR A;  3HKS A;  1TS4 A;  4H13 C;  1CTM A;  4UP9 A;  1ILP A;  1SYF A;  1ILQ A;  2KQ3 A;  4C3H B;  3J81 j;  4A3D B;  1BXT A;  2A6E C;  4K2K A;  1UNS A;  3H6M A;  3EQL C;  4K0K L;  1X3G A;  2PI2 E;  3CPW A;  4LFB Q;  4JBW A;  1RHP A;  2CVR A;  4K6D A;  3S15 H;  3GTK B;  3T56 B;  2PW5 A;  1EQQ A;  4OO1 H;  3ONA B;  2VUM G;  1SBB B;  1ONL A;  2BCO A;  3S1N B;  1HZA A;  4GN5 A;  4K0K Q;  1I4P A;  1VQD A;  4DV3 L;  2HQL A;  4R4O A;  4Z9C B;  1VQM A;  4A3E H;  4CKE A;  1J6Q A;  4P2C B;  3J80 E;  4F8M A;  2B2W C;  1N36 Q;  1JWU D;  4QB4 A;  4BBS B;  4A3G B;  1JB7 A;  3E0J A;  2R92 H;  1UEA B;  2KCN A;  4ULL A;  2K33 A;  4H02 A;  3A8I E;  2XRQ D;  4AIM A;  4DV3 Q;  1IYV A;  1TVX A;  4DR2 L;  1K73 C;  1S72 A;  5C0X G;  4GNX C;  4HIO A;  3I70 A;  4C1N K;  5HGT A;  1CZW A;  4DNT B;  4A3J G;  3FRP B;  3BYT B;  1BOS A;  1D1K A;  4DAY A;  5GQO A;  2ZT9 C;  4QL5 A;  3A8K E;  1Q1E A;  2WB1 G;  3GTQ H;  2GVB A;  1IHZ A;  3TRE A;  3P1H A;  3IFT A;  4CHT B;  1X32 A;  3BVZ A;  3G48 A;  2A1A A;  2UXB L;  4DR2 Q;  3I4N G;  4Y7N B;  2R7Z G;  2EJG C;  1LO5 D;  5G3L F;  5C44 G;  5G3L D;  1HZ9 A;  1T9H A;  2L9H A;  2MO1 A;  4G7Z C;  1RJT A;  2SOB A;  2L15 A;  3MTS A;  4PQX A;  5I6Y A;  2E2I H;  1FL0 A;  3OTO L;  2AQ2 B;  4RGM A;  2E2J H;  2XN9 C;  2UXB Q;  2RDG A;  2KOL A;  1XNR L;  3M85 A;  2EDG A;  4YWM A;  2BDO A;  3GTL B;  2A69 D;  1TY2 A;  2KHJ A;  3MXP A;  1RKN A;  5JJZ A;  2JA6 B;  2VW9 A;  1SND A;  2K5Q A;  4N8X 1;  3K8A A;  4K8J A;  1VQJ A;  1O7Y A;  2EQS A;  2PMZ E;  3FKI H;  2UUA L;  2WP8 J;  3OW7 A;  5GRO A;  2E2H H;  1MSH A;  2EYL A;  3HOV H;  1HNZ L;  2DNE A;  5FLX c;  2CWP A;  1YIT A;  1JJC B;  2BH8 A;  4IPD A;  3S1Q H;  4QUF A;  3OMC A;  2F0L A;  3H15 A;  5C0X H;  3S16 B;  1XXG A;  1JJG A;  1AN8 A;  3OHX C;  3RD4 A;  4EVO A;  1QOH A;  2IT1 A;  1HNZ Q;  1I4G A;  1NR2 A;  2ENB A;  4BY7 B;  2PZT A;  2E5L L;  1T5X D;  1BO0 A;  2SEB D;  3GV3 A;  3H0G G;  3CP0 A;  4GLV B;  1KDB A;  2ZXO A;  2FFK B;  1N33 L;  1NAP A;  4A3M H;  4AYB E;  1I4Q A;  3RN2 A;  4JK1 C;  2E5L Q;  5K36 G;  2F0W A;  1YJW A;  2FXQ A;  5IOD A;  4MZ9 A;  4DR3 L;  2N88 A;  5DNF A;  1B1Z A;  1HTP A;  2AQ3 B;  4H44 C;  4K6L A;  3DWP A;  2Z4I A;  1VQ5 A;  1N33 Q;  3T51 B;  2E74 C;  1W3S A;  1AP0 A;  3F2D A;  1HQR D;  2G9D A;  5EAY A;  3RLN A;  1J8I A;  3G7L A;  1X6O A;  3MA2 B;  3M7N A;  1DOM A;  5ELC A;  3I4M H;  1PTO F;  1UAP A;  1PTO D;  4DR3 Q;  2LMC B;  1GD7 A;  1YIJ A;  2F0P A;  2ZTC A;  4OON A;  3M3Y H;  3HOZ G;  1Y1W G;  4S3S A;  1YNN C;  2KCM A;  2O5J C;  2A5H A;  4TVA B;  4YHH Q;  1HR0 L;  2B39 A;  2CH4 A;  4RAU C;  3WWV A;  1N34 L;  2ICI A;  3SEB A;  2GVA A;  2OCE A;  1I3Q H;  2WKC A;  2WAQ G;  5E1F A;  4XT1 B;  4G57 A;  1L1O B;  2CKZ B;  5H1S E;  3RZD B;  2PZW A;  1NUC A;  4RGO S;  3J7Z C;  3FDT A;  1HR0 Q;  3H0G H;  3LWE A;  1N34 Q;  2K75 A;  3UDF A;  1VQH A;  4FVM A;  5C4X B;  1STN A;  4C1N I;  3GTQ B;  3RZO H;  3FHW A;  2JK8 A;  2XVS A;  1EZ8 A;  4M8A A;  5KNB A;  1UE1 A;  1EY9 A;  3STB D;  3T53 B;  4FYD A;  4DF7 A;  4P71 A;  2PI2 A;  2KUM A;  3I4L A;  4NP5 A;  2YU9 H;  1ASY A;  1MIU A;  4N9P A;  5ELN A;  1IBM L;  4HID A;  1V8Q A;  4M1U B;  4KN4 C;  2CQO A;  2E2J B;  2VUM B;  3AEV A;  2A74 C;  5M5X H;  1KAW A;  2D0O A;  1G6P A;  3U58 A;  2F0N A;  2Z6B A;  3OW2 A;  4B08 A;  5CGK A;  4NXN Q;  2JP1 A;  1IBM Q;  4DR7 Q;  4UP7 A;  3FKI B;  2CQA A;  2OWO A;  1B53 A;  2F1M A;  2K28 A;  4C56 C;  3CKI B;  1ENF A;  3HOV B;  2A73 B;  1QZG A;  4XTC S;  2B63 H;  5I2Y A;  2IW3 A;  2E76 C;  1EFI D;  3F1Z A;  2HUG A;  3D31 A;  5M3F H;  4PMC A;  3TS0 A;  3HOW G;  4N8F A;  2ZJP A;  5KNC A;  1VQ7 A;  2V1C C;  1UEB A;  2QGQ A;  3CCS A;  3I90 A;  2PQA A;  1ENC A;  4A3J B;  3S1R B;  2JA7 G;  1X55 A;  4CDD C;  1GO3 E;  1GJX A;  2WB1 B;  4JPB W;  3A0J A;  1TS2 A;  1Z9F A;  1YBY A;  1STH A;  2Z0S A;  5KYI A;  1MHW C;  3K5L A;  2CCZ A;  4BBR H;  3PGZ A;  4J1M A;  4KHZ A;  3E6Z X;  3HS0 C;  3I4N B;  4K5X A;  1EQV A;  2R7Z B;  1STE A;  4A3M B;  3M4O B;  3JAM c;  1JCK B;  1LTL A;  1B3A A;  3LGJ A;  4X65 L;  3CME A;  5C44 B;  3KJP A;  3L7Z C;  4FF2 A;  3E9I A;  3ZYY X;  4DA2 A;  1I4R A;  1WFQ A;  2R7F A;  1N9W A;  4RFB A;  3I4O A;  3N6R A;  4BXX G;  1Q90 A;  4IJL A;  4X66 Q;  2JA5 H;  2RHQ B;  4DV5 L;  1HNW L;  1IW7 D;  2QDL A;  2VXW A;  2RVL A;  3NEN A;  4UDU C;  5CC4 A;  2IX3 A;  4A4I A;  3A7A B;  2LXJ A;  4LF8 Q;  1B44 D;  4QUC A;  1E1O A;  4XDX A;  2JN4 A;  3M3Y B;  4DV5 Q;  1HNW Q;  2Y0S E;  5J1Z A;  1KQS A;  2FIN B;  2D62 A;  3BYY B;  4CKB A;  5M3M G;  2MP1 A;  5J22 A;  3FEW X;  1I3Q B;  1K8M A;  4UAI A;  4XQQ A;  1W6J A;  4RCO A;  1PTO B;  3TP7 A;  1TWF H;  4LUZ A;  4CBV A;  2BA0 A;  2SNS A;  3BS1 A;  4ZUI A;  1SYE A;  3J80 c;  1ICF B;  3H0G B;  4ME5 A;  1SMY D;  2KEE A;  1PZJ D;  1M8A A;  1BBX C;  1WTR A;  1L0Y B;  3RZO B;  1EZ6 A;  2K1B A;  3SXH A;  4HJ7 A;  2I0Q A;  1TWG B;  1YEZ A;  4ZYS A;  1XPR A;  3C1E A;  4C3J H;  2C5C A;  2DGY A;  1VQA A;  3TME A;  1E3P A;  1FR3 A;  1PXU A;  1WTO A;  1M4V A;  1EY5 A;  4DV0 L;  4IFD G;  3AB9 A;  2ASB A;  3L0O A;  3FPP A;  3GTJ H;  5IYC H;  3MXU A;  5IE8 A;  5M5X B;  2VS1 A;  4GKK L;  2VZA A;  4XYO A;  3NEL A;  1HJP A;  3EIV A;  4GKJ Q;  5C3X A;  2JYO A;  3P75 A;  1UE6 A;  5FJ8 G;  4A3I G;  2WKD A;  3K7U C;  3HGB A;  4DV0 Q;  1LT5 D;  1Y1W B;  2RA4 A;  4DFA A;  3CHB D;  4DAP A;  5DM6 3;  4GS3 A;  3L9A X;  3OOC A;  4EX5 A;  1Z47 A;  1EY7 A;  4DNR B;  2WAQ B;  5E3F A;  2MUY A;  2WB1 E;  3HFZ B;  1LAC A;  1MJC A;  2ZM6 L;  3I72 A;  1LTG D;  1P16 A;  3PO3 G;  3QB3 A;  1XPU A;  4A3C G;  2PCF B;  3ITP A;  2Z8L A;  4XYQ A;  4A93 G;  4C3H H;  4A3D H;  2EY2 A;  3IL8 A;  3RUZ A;  1SYB A;  1KXL A;  5C5L A;  2B8G A;  1SE4 A;  1PH7 A;  2NYZ D;  3GTK H;  2HCC A;  2OQ0 A;  2EY5 A;  3KBG A;  4X3U A;  3NHH A;  2Q8T A;  1FD7 D;  3A5Z B;  3S1N H;  1HHV A;  4IFD H;  1EIG A;  1QE6 A;  1Q7Y C;  1PV4 A;  2X6L A;  2JA5 B;  2NWG A;  3BG3 A;  2A68 C;  3VR3 A;  3H09 A;  4CDE C;  4DV7 L;  1PRT C;  2BH2 A;  2JA8 G;  3ICE A;  3HRZ C;  2R7D A;  3K7A B;  4ABN A;  1SNQ A;  4JI6 L;  1BBW A;  1Q86 C;  5D3I B;  2RCF A;  5I6W A;  4BBS H;  5E7N A;  2A19 A;  4DUZ Q;  3Q0A A;  4XQJ A;  2XTI A;  5FLM G;  1STY A;  3S14 H;  3T1Y Q;  4ID6 A;  2NVY H;  4DV7 Q;  2F0O A;  3PO2 G;  1RCV D;  2QA4 A;  4KY5 A;  1R4Q B;  3U50 C;  4JI6 Q;  5A35 A;  1KAA A;  1PLF A;  4R9W A;  4X64 L;  3HOW B;  1VMP A;  1K83 B;  1Q12 A;  3I73 A;  1Y8P B;  1QIL A;  4HJ5 A;  1VQ6 A;  3K80 C;  3ULL A;  3WDN A;  4B3R L;  2JA7 B;  2D9U A;  3PO3 H;  3HOX G;  1SSO A;  1BCP F;  1Y8O B;  2JSO A;  2QEX A;  2AHO B;  3D8G A;  1BCP D;  2Q2H A;  1XNQ Q;  2G5D A;  4NXM L;  3E9H A;  1R9T H;  4A93 H;  3DWQ A;  2F0D A;  4DR5 L;  4X64 Q;  3I91 A;  5CV7 A;  5GAH C;  1E22 A;  1TU2 B;  1SXT A;  3AQQ A;  5C0X I;  4KV6 A;  3J81 L;  3UDX A;  4QY7 A;  1R4P B;  1HH2 P;  5M5Y B;  4CGY B;  4TSS A;  2I5H A;  1U4L A;  1S5E D;  1EEI D;  2VB2 X;  4LK1 C;  4NXM Q;  3QO2 A;  4ZUJ A;  1JOK A;  2NN6 G;  4RWS C;  2PNH A;  1PZK D;  4DR6 L;  2JA6 H;  5C4Z A;  1CK1 A;  5IYB G;  4TRD A;  3UE0 A;  4R4C A;  3NTH A;  4O2D A;  2F3I A;  2KVM A;  3J7A 5;  4JI3 L;  2F0I A;  1TS3 A;  1MD2 D;  5IT9 E;  1I4X A;  2G9H D;  4DV4 L;  2WAQ E;  3VYT A;  1L1O A;  1G91 A;  3V2T A;  3GTM B;  1TWA B;  1K3B C;  4XIG S;  4XQN A;  2IY5 B;  1WTH A;  5J39 A;  3S16 H;  5M3M B;  1KNE A;  5IGF A;  5IYD H;  4JI7 L;  1D8L A;  2JJQ A;  5ELO A;  1H9M A;  2K52 A;  1EYC A;  2K5D A;  4BY7 H;  1AH9 A;  2E2D C;  3VR6 A;  4DV4 Q;  4EQ5 A;  4LFB L;  3HKZ G;  1Y14 B;  2L0C A;  3P20 A;  1VQC A;  4PZ7 A;  1BF4 A;  2N8N A;  4RHS A;  4PV1 C;  1KNA A;  2EY6 A;  2YYZ A;  3S17 B;  4JI7 Q;  1EWH A;  5CV9 A;  2ZTE A;  5JVH 3;  3H3V H;  4R4T A;  4JI1 Q;  5LMU L;  1WVL A;  3PV0 A;  4CDF C;  3L3O C;  5M9O A;  2IX0 A;  3VDY A;  5E4W C;  1LYL A;  5M5W B;  4XXE A;  4UY8 C;  2P5Z X;  3F2U A;  4KY6 A;  1JB3 A;  3ULJ A;  4KK7 A;  1CHQ D;  4HMJ A;  4K5V A;  5IP9 G;  1EYD A;  4P72 A;  1N36 L;  1K0S A;  1H95 A;  5HY6 A;  5IYB H;  5LMU Q;  2F0E A;  4R4I A;  4B3M Q;  3TZD A;  3BU2 A;  1TS5 A;  4L5T A;  3PIP A;  2UUC L;  3M4P A;  3EFX D;  1H9K A;  3RMH A;  3J7A F;  2EJM A;  5IP7 G;  3K5M A;  4HTH A;  4U68 A;  1NE3 A;  4IUR A;  4L5S A;  2KA7 A;  4LW1 A;  1IW7 C;  1JOR A;  2R61 A;  4FDB A;  1N32 L;  2OQK A;  2UUC Q;  5JJK A;  1MBY A;  3D0F A;  3S14 B;  2NZH A;  3OWE B;  3SK8 A;  2NVY B;  1UWV A;  1Q82 C;  1G2S A;  3CCU A;  3RZD H;  1HZC A;  4ZK9 B;  2EE1 A;  4O0A A;  3MEF A;  2N3S A;  2Q8I B;  3BZK A;  1QJO A;  3QOL A;  4QCL A;  1N32 Q;  5IGG A;  5D3D A;  1HRJ A;  3NEM A;  5AFW A;  5C4X H;  2LXK A;  2MFI A;  2EIF A;  1Y69 U;  3J7Y W;  4A3F G;  2KBN A;  3A56 A;  3PO3 B;  4GN3 B;  1V1Q A;  1IBK L;  1XMQ Q;  4FNF A;  2KEC A;  1R9T B;  1PH1 A;  1SNC A;  4A93 B;  1C48 A;  1RL2 A;  3K5O A;  3CQZ B;  1N8R C;  3MEH A;  5IGE A;  4Q0F A;  3UDI A;  2L4N A;  3X3N A;  4CDC C;  2LFN A;  1XTD A;  1QZH A;  4QJF A;  4QIW E;  1IBK Q;  2I5L X;  2OTL A;  2VUM H;  4BA1 I;  3T4A C;  1LTR D;  4JI2 Q;  1BCP B;  4JCV E;  4KY7 A;  2PO4 A;  3B6Y A;  3URY A;  1D6E C;  1TWH B;  2K5V A;  1PYS B;  2CHB D;  4JI4 Q;  5D14 A;  3TN2 A;  3JAM i;  2JA8 B;  2OXP A;  1BDO A;  1UE7 A;  1V43 A;  3R93 A;  3K5N A;  1O7I A;  2CW0 D;  3A8J E;  1KRS A;  1I94 Q;  3TEH B;  3TSS A;  4KD3 A;  4PMW A;  3CCV A;  3D6W A;  4OWT B;  3HOY G;  2EYJ A;  3PO2 B;  5JJL A;  1SNO A;  2JXM B;  3J81 i;  4K5W A;  3CW2 C;  4IQZ A;  5EKI A;  1YI2 A;  5E4X A;  5CR3 A;  4OXP A;  1VQ4 A;  1MGS A;  5ISR A;  4A3J H;  3S1R H;  2F0T A;  1W6K A;  1OTC A;  2HD3 A;  1X9N A;  2SNM A;  2DUD A;  3K58 A;  1QWY A;  1A3V A;  4IUP A;  3HOX B;  1CKM A;  1ZEQ X;  3I4N H;  2Q2I A;  2R7Z H;  5LL6 S;  3M4O H;  2QF7 A;  5FO7 B;  3KBX A;  4YWK A;  4L63 B;  4F7X A;  3G71 A;  5C44 H;  1GM5 A;  4EQO A;  2N49 A;  4TKO B;  5C5M A;  4O1N A;  3G4S A;  1SNM A;  3NBI A;  2FHT A;  3DWA A;  1B3Q A;  4H0L C;  4RGT A;  1KAB A;  5C6A A;  4ILW A;  3KK7 A;  4DK0 A;  1VQP A;  4HIM A;  4YHH L;  3N52 A;  5T1G A;  1D1I A;  1HR0 W;  3SHL A;  1BR9 A;  3CXC A;  2K4K A;  1PH9 A;  1TWC B;  2AUJ D;  2B8F A;  2HIV A;  4NMZ A;  1E2Z A;  5HGQ A;  4GLX A;  4X3K A;  5JPM C;  3IRB A;  3TBI B;  4DGZ A;  3Q22 A;  1HQM C;  1JQY D;  2RCN A;  4RG1 A;  3K57 A;  2H5X A;  1O78 A;  1G8Z D;  1F77 A;  2HDM A;  4KLK A;  4JOI A;  4HIK A;  4BY1 G;  3S2D H;  1DD2 A;  2QEJ C;  1SYG A;  3GTP B;  4LF6 L;  3KF8 B;  1CA5 A;  2ATW A;  1PTO H;  1JMC A;  1EFW A;  1V1P B;  2HDL A;  1KLU D;  2EPB A;  4JG2 A;  1PFM A;  3Q8D A;  4FXK C;  3GP7 A;  2UUB Q;  4FO2 A;  1OXT A;  1VCI A;  3TQY A;  3HKZ B;  1K0R A;  4LF6 Q;  1JIC A;  1G6Z A;  4LF7 Q;  1B7Y B;  1GVP A;  1HTL D;  1CFM A;  5EQ0 A;  1EEF D;  1TWG H;  4IOC A;  5K36 H;  3KLS X;  4IPH A;  4HCS A;  2XSC A;  3PIO A;  3EN2 A;  1V1O A;  5DEH A;  3KF6 B;  4BWG B;  4NXN L;  3J7A V;  4DR7 L;  3CRL C;  1W2B A;  5KGU A;  2UXD L;  1LT4 D;  4IPG A;  1C0A A;  1XX8 A;  1ZYR C;  4ZLT F;  1DOL A;  4FF1 A;  3KLS A;  5FOB B;  4WJ3 M;  1OXX K;  2F0U A;  1PMR A;  4EGV A;  4A3B G;  1A6X A;  4X3S A;  3HOU G;  3HOZ H;  1Y1W H;  3Q6S A;  3MXG A;  2MJ8 A;  2UXD Q;  3IAY A;  1BNZ A;  4IFD I;  4X62 L;  3CCJ A;  1NBW A;  3CC2 A;  1I50 H;  4KJN A;  1QG7 A;  1WJJ A;  1G51 A;  3MWY W;  3TDQ A;  3TP5 A;  3T1H Q;  3OWF A;  1CZG A;  1GUW A;  1HCZ A;  1VQI A;  2ID0 A;  3SGI A;  2OEO A;  1Q1B A;  2J0T D;  5EPL A;  1X65 A;  4X62 Q;  3KUP A;  3PUV A;  4CJ1 B;  3GDE A;  4HR7 B;  4MTN A;  4C2M B;  4KKU A;  5IT9 c;  5ELE A;  4GOP B;  3H3V C;  1VQ9 A;  3HEJ A;  4RA8 A;  2KEN A;  4X66 L;  4LF9 L;  1HPC A;  1GHK A;  3V05 A;  4AH6 A;  1VQF A;  2F0Q A;  4IO9 A;  1F2Z A;  1RDP D;  5JEA J;  5IWA L;  3D4D A;  4K8I A;  2B2U C;  4LUO A;  3RN5 A;  1XYI A;  4IJH A;  3MAQ A;  4P75 A;  4ZRZ A;  4OWX B;  4KHV A;  4LF8 L;  1SN8 A;  1WTP A;  4LFC L;  1XMO Q;  2Q2T A;  4LF9 Q;  2DJF C;  5FLX L;  4LNQ A;  2F0F A;  2BDN A;  1ZXT A;  3SR1 A;  2NBF A;  3G6J B;  5IWA Q;  5CV6 A;  1IZ6 A;  4JI0 L;  2NVX B;  3K7A H;  2JA9 A;  4OEM B;  4UHV A;  2R93 G;  1P8L A;  3HOU H;  3PUW A;  2L5T A;  3W2D A;  4LFC Q;  1O80 A;  2J7Z A;  3KDF B;  1YHA A;  2AWO A;  4PZ8 A;  1HA5 A;  2EVB A;  2XNA C;  1FVI A;  1L2F A;  1F2M A;  3A55 A;  1MSG A;  1SFO B;  1SRU A;  3DHQ A;  4JI0 Q;  1L1O C;  4B3T L;  3S2D B;  1FJG Q;  5JAV A;  5BR8 Q;  1S5B D;  3HOW H;  3HOY B;  1ROD A;  1K83 H;  3ZJY C;  4F87 A;  3QOJ A;  1B4O A;  1B9N A;  5JEA G;  5JPN C;  5CMD A;  2WII B;  4OIK A;  4DXG A;  3E3X A;  1EQR A;  3HKZ E;  4I65 A;  2JA7 H;  1OXV A;  5KIX A;  2NVQ B;  1G2T A;  1NCV A;  4B3T Q;  2F0K A;  2EYP A;  2KHS A;  2EYO A;  4HED A;  2OF1 A;  3C1F A;  4HSV A;  3VR2 A;  3CMA A;  1CQF A;  1QCB D;  2B2V A;  3UI2 A;  3F2C A;  5ELB A;  1NSN S;  2Z6K C;  1IBL L;  2AWN A;  3OYY A;  3NQI A;  3BVM A;  1YJ9 A;  3KLR A;  4BXX H;  2ICE C;  4GKJ L;  5AJ3 L;  4ZKC B;  1GUN A;  3HP3 A;  2H1E A;  4DPG A;  1PA6 A;  1KTK A;  2F03 A;  5LL6 X;  5KYL A;  3H3V I;  3EVQ A;  2N55 A;  3NP8 A;  3PIP 3;  1IBL Q;  1S4Z A;  1Q46 A;  1LTI D;  3ERS X;  4HCE A;  4HN7 A;  4AYB G;  1PH5 A;  5AJ3 Q;  1F2Y A;  3U9S A;  3BZC A;  3HOZ B;  1K8A C;  3D4R A;  1BKB A;  1IKM A;  1F9P A;  3ND9 A;  4U67 3;  2A69 C;  4JW0 A;  3GTM H;  1TWA H;  2EXZ A;  5M3M H;  4BY1 B;  2B2Y A;  1A2T A;  3KFU A;  1IYJ B;  5LHY 1;  4DR1 Q;  1I50 B;  1CSP A;  1SJE D;  4POF A;  4R4Q A;  2XGT A;  2CW0 C;  2EYH A;  3R2T A;  1STB A;  5C4H A;  1JWS D;  3UE1 A;  2F4V L;  4A3G G;  4DR4 L;  5C3E G;  4A3L G;  1I6H H;  1LM0 A;  1XTC D;  3PUX A;  2L55 A;  3S17 H;  2VNU D;  3SE0 A;  2RKS A;  3U9O A;  1EUJ A;  5NUC A;  1Y1V G;  3M7G A;  2L11 A;  5FKA C;  4J8Q A;  4UP8 A;  2FMC A;  2F4V Q;  4DR4 Q;  5DAU A;  3P7J A;  5M5W H;  1VQO A;  4JC0 A;  4DUY L;  1PH2 A;  3H94 A;  1VS0 A;  4JI5 L;  5TSS A;  5J3B A;  1ESR A;  1X3Q A;  2OTJ A;  4UPA A;  4L5R C;  4DUZ L;  1OXS C;  1CHP D;  5M5Y H;  2EXD A;  2AMC B;  5JOB A;  1PH4 A;  1JR0 D;  3CU7 A;  3T1Y L;  4A3K G;  4HJ9 A;  1H9R A;  4DUY Q;  4JI5 Q;  3EA6 A;  1U9R A;  5FJ8 H;  5C3W A;  4A3I H;  3TP8 A;  3HOU B;  4YCV A;  2NZ1 D;  3C3L A;  2MO0 A;  3I7F A;  1AFP A;  4R8I A;  4CJ0 B;  1CM9 A;  3ULP A;  5I9O A;  2RDF A;  1PTO C;  2FMM A;  1EYA A;  2Q8R E;  4WFN 3;  1XNQ L;  1DON A;  2FJ2 A;  1CT1 D;  2YTV A;  5EBD A;  1AZP A;  3KYH C;  1II3 A;  3VYS A;  4IN3 A;  3JAM L;  4MTK A;  3K6O A;  3V96 A;  3NBH B;  2QW7 A;  5C4J H;  3NXW A;  5IOC A;  2K01 A;  1PHJ A;  1A3T A;  5IGB A;  4Y52 H;  1B9M A;  4YY3 L;  4A3C H;  2CWA A;  4DV1 Q;  2M2L A;  2IWH A;  4MHE A;  4KI0 A;  2B2T A;  1I4H A;  1Y1V H;  3CQZ H;  4RCN A;  2L12 A;  3D6C A;  4LWC A;  4ME3 A;  3D4W A;  3QWN A;  1U4R A;  4WJW A;  3GD7 A;  4KKT A;  1EY6 A;  1JT8 A;  2LY7 A;  2B2U A;  1ET6 A;  4JYA L;  1VQ8 A;  4C3I G;  3BDC A;  4GNX B;  4QQB X;  4YY3 Q;  3PSI A;  4DAV A;  2F0J A;  3NTI A;  1HUM A;  3GQB A;  1EOT A;  4LF4 L;  3C46 A;  1TWH H;  4RGN A;  3STB C;  2VQF L;  2NVT H;  4JYA Q;  2WFW A;  2JA8 H;  3GV6 A;  2R93 B;  3U4Z A;  4CJ2 C;  2UU9 Q;  1GUG A;  2BE5 D;  2D0P A;  4LF4 Q;  3KF8 A;  2JEB I;  3OSO A;  3GTG B;  3S9W A;  5FLM H;  4OO1 G;  2F52 A;  4APV A;  3J80 L;  4LFA L;  2VQF Q;  1V1P A;  1HZB A;  4JOI C;  3DXJ C;  3PO2 H;  4HMI A;  1KHI A;  4OWW B;  3AYH B;  1PFS A;  5DLQ E;  3VYU A;  1ICW A;  1O7Z A;  3BDO A;  1SE2 A;  1TR5 A;  2YTY A;  4JI1 L;  4A3E G;  1A2U A;  4QMG A;  2AQ1 B;  4LF5 Q;  5EPK A;  4LFA Q;  1E2V A;  3HOX H;  1NY4 A;  2K04 A;  1I6H B;  4OIJ A;  5CV4 A;  2R92 G;  2NB0 A;  1KC8 C;  4HAE A;  1EQT A;  2Y0S G;  3NE5 B;  1RIP A;  5BN4 A;  2ZXR A;  4LUV A;  3VR4 A;  3KF6 A;  1EIH A;  3ER0 A;  3LNN A;  2R3Z A;  2ZJQ A;  4NKL A;  1QNU A;  1UE5 A;  3FVQ A;  3TZU A;  1I6V C;  4AQY L;  4B3M L;  2Z6K A;  1DOK A;  1TKW B;  2IJ0 A;  1EWI A;  3BVG A;  3PIO 3;  1WD1 A;  1PFB A; 
#chains in the Genus database with same CATH homology
 4WRD A;  1FGB D;  2Z4H A;  2NN6 H;  2K05 A;  1D5Z C;  1TY0 A;  4ZKB B;  3J81 E;  1AEX A;  2L1B A;  2XWB B;  3QG1 A;  4FXG C;  1SYC A;  2EZV A;  5M5Y B;  1SNP A;  2KED A;  2PYK A;  1RTN A;  5C0X J;  3C2P A;  4OHJ A;  4L8J A;  5EBC A;  4AYB B;  1H9S B;  5EPJ A;  3DMU A;  4A3I B;  1WTW A;  4EQN A;  1JWM D;  2D2C C;  1HFN A;  3PMF A;  5K5P A;  2R6G A;  2O5I C;  1LTS D;  3QJY A;  4ZQ3 A;  2EOT A;  3VYR A;  2MPM A;  5KRU A;  5CV5 A;  3IKJ A;  4I7Z C;  5A2Q L;  1EY4 A;  1LTA D;  5C4J B;  5C3E B;  1FNW A;  2F0H A;  1Y1V B;  4R8N A;  5IGC A;  1Y8N B;  3T16 A;  2DY7 A;  3DM1 A;  1QB5 D;  5COR A;  1SMY C;  2I46 A;  1Q8I A;  3ERO A;  3R2I A;  3PUZ A;  1D5X C;  1J9O A;  4FF3 A;  3RLF A;  1YNJ D;  1VF7 A;  1ENA A;  4KD4 A;  2NVT B;  1AZQ A;  4A3K B;  1MI2 A;  1LV9 A;  1EY0 A;  2SDF A;  1G29 1;  4DK1 A;  3VR5 A;  1H9J A;  4IUU A;  5JVG 3;  1JOO A;  3A54 A;  3WOF A;  1SYD A;  5BN3 A;  3S1M B;  2BA1 A;  4DXF A;  1WTQ A;  2WIN B;  4IUV A;  2OT2 A;  1RF2 D;  4X3T A;  4IAL A;  1LT6 D;  3IFD A;  5A2Q E;  3NQT A;  4ZAI A;  2B2V C;  3PUY A;  4C3I B;  3FMC A;  4XT3 B;  3SDZ A;  1ESF A;  5CYU A;  3NK9 A;  1WD0 A;  3CRK C;  4RHR A;  1TQO A;  1L0X B;  4OL7 A;  2KCC A;  4KMU C;  2A68 D;  4NW2 A;  1PRT F;  1STG A;  2XIW A;  1PRT D;  2F3V A;  2VB3 X;  2WV6 D;  4RKL A;  1O7L A;  2K03 A;  3S15 B;  5CBA E;  5IIF A;  3BDL A;  2PPB C;  3GO5 A;  2HQE A;  2X69 A;  4IUN A;  2JEA I;  4RKB A;  2B2Y C;  1QNK A;  2EJF C;  4CKC A;  3OIQ A;  4O42 A;  4TQU S;  1WTV A;  3DEO A;  4BS9 A;  2AUK A;  4A3E B;  3MZ5 A;  2IL8 A;  4B9X A;  2R92 B;  1KLG D;  2Y0S B;  3H91 A;  4GZY C;  3QIA A;  2A6H D;  1AW7 A;  3OPO A;  4KTA A;  5FO9 B;  4V19 0;  1D5M C;  1BCP C;  2QDB A;  1SDF A;  1CA6 A;  4IUT A;  2XWJ B;  3SK6 A;  3D3R A;  2LKV A;  1VMC A;  1KDC A;  1LTT D;  2M9V A;  1RTO A;  2MHV A;  2E2I B;  3NUC A;  3SVM A;  3K0Y A;  4L6T B;  2DNC A;  1OXU A;  3E5S A;  4KN7 C;  4K2L A;  2O4X A;  3NBH A;  1PZI D;  1Z6H A;  1C8C A;  2F4I A;  5KEE A;  4RH6 A;  3O13 A;  2BE5 C;  2PZU A;  4PNY A;  2B2W A;  1F9Q A;  2E2H B;  2QKI C;  3NWS A;  2XRS D;  3WOE A;  3VA7 A;  2JE6 I;  4A3F B;  2RBM A;  3ND8 A;  4ODG A;  4QF4 A;  1EY8 A;  2B2T C;  3S1Q B;  2EY1 A;  1IKL A;  2A6E D;  1KDA A;  5CV8 A;  5EKL A;  5BN5 A;  4FP5 D;  1WCM B;  1A3U A;  1X3P A;  1LTB D;  2IPK D;  4K14 A;  3MHB A;  3TP6 A;  5DM7 3;  3S2H B;  1DCZ A;  1EU4 A;  2E75 C;  4C3J G;  3M4Y A;  2K7V A;  1FYC A;  1U4M A;  1DM0 B;  2F0S A;  1DYQ A;  1E2W A;  1HUN A;  4FF4 A;  3AU7 A;  2IX1 A;  1XWE A;  4KKS A;  1GXD C;  3T13 A;  3AMU A;  3I4M B;  2RSN A;  3R3O A;  1S5C D;  2K6A A;  2M00 A;  1IYU A;  1PRT B;  3I3C A;  4E6I A;  1F2L A;  4EQP A;  3A7L A;  1DZ1 A;  4HSP A;  4IFD J;  4V0B A;  1ET9 A;  1LLR D;  3HG9 A;  1Q3L A;  3VA5 A;  3OMG A;  1EWC A;  1GHJ A;  4LJZ C;  3ERQ A;  4J6H A;  1PFN A;  1C4Q A;  2EYF A;  2EYM A;  2K32 A;  3R8B A;  5IGD A;  4BA2 I;  1EU3 A;  4C3H G;  1UUP A;  3K59 A;  1F9S A;  3X3M A;  1RD9 D;  1H9S A;  1E0B A;  5ELD A;  3SK5 A;  4G7H C;  2J4X A;  5FLX E;  4FXD A;  2YU9 B;  1TII D;  1CQV A;  2NTT A;  3MVV A;  2NN6 I;  3LX0 A;  1YNJ C;  5HUR A;  2HCI A;  5F2D A;  1BUV T;  2NTS A;  2V4D A;  2QIL A;  5JEA H;  3NTK A;  4B9W A;  1STA A;  1VDZ A;  1JOQ A;  1S5F D;  4OO1 I;  1GUT A;  2PW7 A;  2RDH A;  2B63 B;  1T5E A;  1B50 A;  2GA4 B;  3OIP A;  1HFG A;  1SEB D;  5I9P A;  5ELF A;  5M3F B;  2C9O A;  3DEP A;  2LS0 1;  2X6G A;  2I07 B;  5CBE E;  2BOS A;  1CI3 M;  1IL8 A;  3I8Z A;  1LAB A;  1NR4 A;  2F0V A;  1DJR D;  2F3W A;  4BBR B;  1SAP A;  1HA6 A;  5EGT A;  1GUO A;  4A3B B;  5FO8 B;  1GOZ A;  4LAA A;  3SK4 A;  5KND A;  1YNN D;  4DN4 M;  2WAC A;  1JE4 A;  5IT9 L;  5D65 A;  2DN8 A;  2O2L D;  1WTX A;  3BZD B;  1A15 A;  4IUQ A;  3MFY A;  2PQE A;  3GTO B;  4KJO A;  1LT3 D;  4PMB A;  5T1I A;  2RQX A;  5I4D A;  2KJX A;  4MN3 A;  1GUS A;  3NWT A;  3NPP A;  1FNU A;  5EKK A;  2F0G A;  1U4P A;  3MC0 B;  4OGQ C;  1FNV A;  2PNR C;  1TWF B;  4G4K A;  2ZXP A;  3EJI A;  4LMQ D;  4YIJ A;  1BQQ T;  2A6H C;  1ZYR D;  1JC7 A;  1OO9 B;  5EJW A;  4IZ8 A;  1TT2 A;  3Q24 A;  2QCP X;  2NUC A;  4C3J B;  1ZKO A;  2TSS A;  2F0M A;  1D2B A;  4Q5V A;  3Q23 A;  3LWU A;  1K8O A;  1HXY D;  1ML0 D;  1F9R A;  3W3A A;  3DUZ A;  3MFG A;  1DXM A;  4DU9 A;  2K5W A;  4QIW B;  3FPU B;  1PYW D;  3MXN A;  4MIU A;  4H7B A;  3GTJ B;  4N9T A;  1VF5 C;  3HZX A;  1Z7T A;  2D5D A;  1S5D D;  1PDQ A;  2PMZ B;  1B2T A;  2DY8 A;  2RSO A;  3JAM E;  4NDX A;  2Z1C A;  3NSW A;  1SJH D;  5COY A;  2TMP A;  5I2X A;  1EL0 A;  4G7O C;  1SE3 A;  5FK9 C;  4F88 A;  2MGS A;  2H4O A;  4WOR A;  1TS4 A;  4H13 C;  1CTM A;  1ILP A;  1SYF A;  1ILQ A;  2KQ3 A;  4C3H B;  4A3D B;  1BXT A;  2A6E C;  4K2K A;  1UNS A;  3H6M A;  3EQL C;  4JBW A;  1RHP A;  2CVR A;  4K6D A;  3GTK B;  3T56 B;  2PW5 A;  4OO1 H;  3ONA B;  1SBB B;  1ONL A;  2BCO A;  3S1N B;  1I4P A;  4Z9C B;  4CKE A;  4P2C B;  3J80 E;  4F8M A;  2B2W C;  1JWU D;  4QB4 A;  4BBS B;  4A3G B;  3E0J A;  1UEA B;  2KCN A;  4ULL A;  2K33 A;  3A8I E;  2XRQ D;  1IYV A;  1TVX A;  5C0X G;  3I70 A;  4C1N K;  5HGT A;  1CZW A;  4DNT B;  3FRP B;  3BYT B;  1BOS A;  1D1K A;  4DAY A;  2ZT9 C;  3A8K E;  1Q1E A;  1IHZ A;  3P1H A;  3IFT A;  4CHT B;  1X32 A;  3BVZ A;  4Y7N B;  2EJG C;  1LO5 D;  5G3L F;  5G3L D;  2L9H A;  4G7Z C;  1RJT A;  2SOB A;  3MTS A;  4PQX A;  5I6Y A;  2AQ2 B;  4RGM A;  2XN9 C;  2RDG A;  2KOL A;  3M85 A;  2EDG A;  2BDO A;  3GTL B;  2A69 D;  1TY2 A;  3MXP A;  1RKN A;  5JJZ A;  2JA6 B;  1SND A;  2K5Q A;  4K8J A;  1O7Y A;  2WP8 J;  3OW7 A;  1MSH A;  2EYL A;  2DNE A;  4QUF A;  3OMC A;  2F0L A;  5C0X H;  3S16 B;  1XXG A;  1AN8 A;  3OHX C;  3RD4 A;  4EVO A;  1QOH A;  2IT1 A;  1I4G A;  1NR2 A;  2ENB A;  4BY7 B;  2PZT A;  1T5X D;  1BO0 A;  2SEB D;  3GV3 A;  1KDB A;  2ZXO A;  2FFK B;  1NAP A;  1I4Q A;  4JK1 C;  5K36 G;  2F0W A;  5IOD A;  2N88 A;  5DNF A;  1B1Z A;  1HTP A;  2AQ3 B;  4H44 C;  4K6L A;  3DWP A;  2Z4I A;  3T51 B;  2E74 C;  1AP0 A;  1HQR D;  2G9D A;  1J8I A;  3G7L A;  3MA2 B;  3M7N A;  1DOM A;  5ELC A;  1PTO F;  1UAP A;  1PTO D;  2LMC B;  2F0P A;  4S3S A;  1YNN C;  2O5J C;  2A5H A;  2B39 A;  4RAU C;  2ICI A;  3SEB A;  2WKC A;  5E1F A;  4XT1 B;  4G57 A;  3RZD B;  2PZW A;  1NUC A;  4RGO S;  3FDT A;  3LWE A;  4FVM A;  5C4X B;  1STN A;  4C1N I;  3GTQ B;  2XVS A;  1EZ8 A;  4M8A A;  5KNB A;  1EY9 A;  3T53 B;  4FYD A;  4DF7 A;  2KUM A;  3I4L A;  4NP5 A;  4N9P A;  1V8Q A;  4M1U B;  4KN4 C;  2E2J B;  2VUM B;  2A74 C;  2F0N A;  4B08 A;  5CGK A;  2JP1 A;  3FKI B;  2CQA A;  1B53 A;  2F1M A;  2K28 A;  4C56 C;  3CKI B;  1ENF A;  3HOV B;  2A73 B;  4XTC S;  5I2Y A;  2IW3 A;  2E76 C;  1EFI D;  2HUG A;  3D31 A;  4PMC A;  5KNC A;  3I90 A;  1ENC A;  4A3J B;  3S1R B;  1GJX A;  2WB1 B;  1TS2 A;  1STH A;  5KYI A;  3K5L A;  4J1M A;  4KHZ A;  3E6Z X;  3HS0 C;  3I4N B;  4K5X A;  1EQV A;  2R7Z B;  1STE A;  4A3M B;  3M4O B;  1JCK B;  1B3A A;  5C44 B;  3L7Z C;  4FF2 A;  3ZYY X;  4DA2 A;  1I4R A;  4RFB A;  3N6R A;  1Q90 A;  1IW7 D;  2VXW A;  2RVL A;  5CC4 A;  4UDU C;  2IX3 A;  3A7A B;  1B44 D;  4QUC A;  4XDX A;  3M3Y B;  5J1Z A;  2FIN B;  2D62 A;  3BYY B;  4CKB A;  2MP1 A;  5J22 A;  3FEW X;  1I3Q B;  1K8M A;  4UAI A;  4XQQ A;  1W6J A;  4RCO A;  1PTO B;  3TP7 A;  4CBV A;  2BA0 A;  2SNS A;  3BS1 A;  4ZUI A;  1SYE A;  3H0G B;  4ME5 A;  1SMY D;  2KEE A;  1PZJ D;  1M8A A;  1BBX C;  1WTR A;  1L0Y B;  3RZO B;  1EZ6 A;  2K1B A;  3SXH A;  1TWG B;  4ZYS A;  3C1E A;  2C5C A;  3TME A;  1FR3 A;  1PXU A;  1WTO A;  1M4V A;  1EY5 A;  4IFD G;  3AB9 A;  3FPP A;  3MXU A;  5M5X B;  4XYO A;  5C3X A;  2JYO A;  3P75 A;  2WKD A;  3HGB A;  1LT5 D;  1Y1W B;  2RA4 A;  4DFA A;  3CHB D;  4DAP A;  5DM6 3;  3L9A X;  3OOC A;  1Z47 A;  1EY7 A;  4DNR B;  2WAQ B;  5E3F A;  2MUY A;  1LAC A;  3I72 A;  1LTG D;  3QB3 A;  2PCF B;  3ITP A;  2Z8L A;  4XYQ A;  2EY2 A;  3IL8 A;  3RUZ A;  1SYB A;  5C5L A;  2B8G A;  1SE4 A;  2NYZ D;  2HCC A;  2EY5 A;  3KBG A;  4X3U A;  3NHH A;  2Q8T A;  1FD7 D;  1HHV A;  4IFD H;  1EIG A;  1QE6 A;  2X6L A;  2JA5 B;  2NWG A;  3BG3 A;  2A68 C;  3VR3 A;  3H09 A;  1PRT C;  3HRZ C;  3K7A B;  4ABN A;  1SNQ A;  5D3I B;  5I6W A;  3Q0A A;  4XQJ A;  1STY A;  4ID6 A;  2F0O A;  1RCV D;  4KY5 A;  1R4Q B;  5A35 A;  1KAA A;  1PLF A;  4R9W A;  3HOW B;  1VMP A;  1K83 B;  1Q12 A;  3I73 A;  1Y8P B;  1QIL A;  3WDN A;  2JA7 B;  2D9U A;  1SSO A;  1BCP F;  1Y8O B;  2JSO A;  3D8G A;  1BCP D;  3DWQ A;  2F0D A;  3I91 A;  5CV7 A;  1TU2 B;  1SXT A;  5C0X I;  4KV6 A;  3J81 L;  1R4P B;  4CGY B;  4TSS A;  1U4L A;  1S5E D;  1EEI D;  2VB2 X;  4LK1 C;  3QO2 A;  4ZUJ A;  1JOK A;  2NN6 G;  4RWS C;  1PZK D;  5C4Z A;  1CK1 A;  4TRD A;  3NTH A;  2KVM A;  2F0I A;  1TS3 A;  1MD2 D;  5IT9 E;  1I4X A;  2G9H D;  3VYT A;  1G91 A;  3V2T A;  3GTM B;  1TWA B;  4XIG S;  4XQN A;  5J39 A;  5M3M B;  1KNE A;  5IGF A;  1H9M A;  1EYC A;  2K5D A;  2E2D C;  3VR6 A;  2L0C A;  3P20 A;  1BF4 A;  4RHS A;  4PV1 C;  1KNA A;  2EY6 A;  2YYZ A;  3S17 B;  1EWH A;  5CV9 A;  5JVH 3;  1WVL A;  3PV0 A;  3L3O C;  5M9O A;  2IX0 A;  5E4W C;  5M5W B;  4XXE A;  3F2U A;  4KY6 A;  1JB3 A;  4KK7 A;  1CHQ D;  4HMJ A;  4K5V A;  1EYD A;  2F0E A;  3TZD A;  1TS5 A;  3EFX D;  1H9K A;  3RMH A;  3J7A F;  2EJM A;  3K5M A;  4HTH A;  4U68 A;  4IUR A;  2KA7 A;  1IW7 C;  1JOR A;  2R61 A;  1MBY A;  3S14 B;  3OWE B;  3SK8 A;  2NVY B;  1G2S A;  4ZK9 B;  2EE1 A;  2Q8I B;  1QJO A;  3QOL A;  4QCL A;  5IGG A;  5D3D A;  1HRJ A;  5AFW A;  1Y69 U;  3J7Y W;  3A56 A;  3PO3 B;  4FNF A;  2KEC A;  1R9T B;  1SNC A;  4A93 B;  1C48 A;  3K5O A;  3CQZ B;  3MEH A;  5IGE A;  4Q0F A;  2L4N A;  3X3N A;  2LFN A;  4BA1 I;  3T4A C;  1LTR D;  1BCP B;  4KY7 A;  2PO4 A;  3URY A;  1D6E C;  1TWH B;  2CHB D;  5D14 A;  3TN2 A;  2JA8 B;  2OXP A;  1BDO A;  1V43 A;  3R93 A;  3K5N A;  2CW0 D;  3A8J E;  3TSS A;  4KD3 A;  4PMW A;  3D6W A;  2EYJ A;  3PO2 B;  1SNO A;  2JXM B;  4K5W A;  4IQZ A;  5EKI A;  5E4X A;  5CR3 A;  1MGS A;  5ISR A;  2F0T A;  1W6K A;  2SNM A;  3K58 A;  1QWY A;  1A3V A;  4IUP A;  3HOX B;  1ZEQ X;  5LL6 S;  2QF7 A;  5FO7 B;  3KBX A;  4L63 B;  4F7X A;  4EQO A;  4TKO B;  5C5M A;  4O1N A;  1SNM A;  3NBI A;  2FHT A;  3DWA A;  4H0L C;  4RGT A;  1KAB A;  5C6A A;  4ILW A;  3KK7 A;  4DK0 A;  3N52 A;  5T1G A;  1D1I A;  3SHL A;  1BR9 A;  1TWC B;  2AUJ D;  2B8F A;  4NMZ A;  1E2Z A;  4X3K A;  5JPM C;  3TBI B;  4DGZ A;  3Q22 A;  1HQM C;  1JQY D;  3K57 A;  1O78 A;  1G8Z D;  1F77 A;  2HDM A;  1DD2 A;  2QEJ C;  1SYG A;  3GTP B;  1CA5 A;  1PTO H;  1V1P B;  2HDL A;  1KLU D;  2EPB A;  1PFM A;  4FXK C;  3GP7 A;  4FO2 A;  1OXT A;  1VCI A;  3HKZ B;  1G6Z A;  1JIC A;  1HTL D;  1CFM A;  5EQ0 A;  1EEF D;  5K36 H;  3KLS X;  4HCS A;  2XSC A;  1V1O A;  5DEH A;  4BWG B;  3J7A V;  3CRL C;  5KGU A;  1LT4 D;  1XX8 A;  1ZYR C;  4ZLT F;  1DOL A;  4FF1 A;  3KLS A;  5FOB B;  1OXX K;  2F0U A;  1PMR A;  4EGV A;  1A6X A;  4X3S A;  3Q6S A;  3MXG A;  2MJ8 A;  3IAY A;  1BNZ A;  4IFD I;  4KJN A;  1QG7 A;  3MWY W;  3TDQ A;  3TP5 A;  3OWF A;  1CZG A;  1GUW A;  1HCZ A;  2ID0 A;  2OEO A;  1Q1B A;  2J0T D;  5EPL A;  3KUP A;  3PUV A;  4CJ1 B;  4HR7 B;  4C2M B;  4KKU A;  5ELE A;  3H3V C;  3HEJ A;  4RA8 A;  1HPC A;  1GHK A;  3V05 A;  2F0Q A;  1F2Z A;  1RDP D;  5JEA J;  3D4D A;  4K8I A;  2B2U C;  1XYI A;  3MAQ A;  4ZRZ A;  4KHV A;  1WTP A;  5FLX L;  2F0F A;  2BDN A;  1ZXT A;  3SR1 A;  2NBF A;  3G6J B;  5CV6 A;  2NVX B;  3PUW A;  2L5T A;  3W2D A;  1O80 A;  2J7Z A;  2AWO A;  1HA5 A;  2EVB A;  2XNA C;  1F2M A;  3A55 A;  1MSG A;  1SFO B;  3DHQ A;  3S2D B;  5JAV A;  1S5B D;  3HOY B;  1ROD A;  4F87 A;  3QOJ A;  1B4O A;  1B9N A;  5JEA G;  5JPN C;  5CMD A;  2WII B;  4OIK A;  4DXG A;  4I65 A;  1OXV A;  5KIX A;  2NVQ B;  1G2T A;  1NCV A;  2F0K A;  2EYP A;  2KHS A;  2EYO A;  4HED A;  2OF1 A;  3C1F A;  4HSV A;  3VR2 A;  1CQF A;  1QCB D;  2B2V A;  3UI2 A;  5ELB A;  1NSN S;  2AWN A;  3NQI A;  3BVM A;  3KLR A;  2ICE C;  4ZKC B;  1GUN A;  3HP3 A;  2H1E A;  1KTK A;  2F03 A;  5LL6 X;  5KYL A;  3EVQ A;  2N55 A;  3NP8 A;  3PIP 3;  1S4Z A;  4HCE A;  1LTI D;  4HN7 A;  1F2Y A;  3U9S A;  3HOZ B;  3D4R A;  1IKM A;  1F9P A;  3ND9 A;  4U67 3;  2A69 C;  2EXZ A;  4BY1 B;  2B2Y A;  1A2T A;  5LHY 1;  1I50 B;  1SJE D;  2CW0 C;  2EYH A;  3R2T A;  1STB A;  5C4H A;  1JWS D;  1XTC D;  3PUX A;  2L55 A;  2VNU D;  3SE0 A;  2RKS A;  3U9O A;  5NUC A;  3M7G A;  2L11 A;  5FKA C;  4J8Q A;  2FMC A;  5DAU A;  3P7J A;  3H94 A;  5TSS A;  1ESR A;  1X3Q A;  1OXS C;  1CHP D;  5JOB A;  1JR0 D;  3CU7 A;  1H9R A;  3EA6 A;  1U9R A;  5C3W A;  3TP8 A;  3HOU B;  2NZ1 D;  3C3L A;  1AFP A;  4R8I A;  4CJ0 B;  1CM9 A;  5I9O A;  2RDF A;  1PTO C;  2FMM A;  1EYA A;  2Q8R E;  4WFN 3;  1DON A;  2FJ2 A;  1CT1 D;  5EBD A;  1AZP A;  1II3 A;  3VYS A;  4IN3 A;  3JAM L;  3K6O A;  3V96 A;  3NXW A;  5IOC A;  2K01 A;  1A3T A;  5IGB A;  1B9M A;  2M2L A;  2IWH A;  4MHE A;  4KI0 A;  2B2T A;  1I4H A;  4RCN A;  2L12 A;  3D6C A;  3D4W A;  3QWN A;  1U4R A;  4WJW A;  3GD7 A;  4KKT A;  1EY6 A;  2LY7 A;  2B2U A;  1ET6 A;  4C3I G;  3BDC A;  4DAV A;  2F0J A;  3NTI A;  1HUM A;  3GQB A;  1EOT A;  3C46 A;  4RGN A;  3GV6 A;  2R93 B;  4CJ2 C;  1GUG A;  2BE5 D;  3KF8 A;  2JEB I;  3OSO A;  3GTG B;  3S9W A;  4OO1 G;  3J80 L;  1V1P A;  3DXJ C;  4HMI A;  3VYU A;  1ICW A;  1O7Z A;  3BDO A;  1SE2 A;  1TR5 A;  1A2U A;  4QMG A;  2AQ1 B;  5EPK A;  1E2V A;  2K04 A;  1I6H B;  4OIJ A;  5CV4 A;  2NB0 A;  4HAE A;  1EQT A;  3NE5 B;  5BN4 A;  2ZXR A;  3VR4 A;  1EIH A;  3LNN A;  2R3Z A;  4NKL A;  1QNU A;  3FVQ A;  3TZU A;  1I6V C;  1DOK A;  1TKW B;  2IJ0 A;  3BVG A;  3PIO 3;  1WD1 A;  1PFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...