1AFPA

Solution structure of the antifungal protein from aspergillus giganteus. evidence for disulphide configurational isomerism
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
51
structure length
51
Chain Sequence
ATYNGKCYKKDNICKYKAQSGKTAICKCYVKKCPRDGAKCEFDSYKGKCYC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure of the antifungal protein from Aspergillus giganteus: evidence for cysteine pairing isomerism.
pubmed doi rcsb
source organism Aspergillus giganteus
molecule tags Antifungal protein
molecule keywords ANTIFUNGAL PROTEIN FROM ASPERGILLUS GIGANTEUS
total genus 6
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1994-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1afpA00
2NBFA 2MHVA 2KCNA 1AFPA 2NB0A
chains in the Genus database with same CATH superfamily
1NAPA 4CKBA 4XDXA 1Y14B 4JW0A 2B2VC 2KOLA 1HUMA 5EKKA 4JI6Q 3I73A 1SMYC 2F0JA 1U4LA 3EBEA 2VS1A 3WOEA 4R4QA 1PTOC 5T1GA 1LTSD 1OXVA 2HCIA 2K52A 2F0HA 2J0TD 2IJ0A 2PMZE 4AYBB 1WTPA 3J81i 5I6YA 3D6CA 1FD7D 5C4XG 2R92B 1G6ZA 2Q2HA 5E1FA 1SNOA 4A4IA 5ELCA 4TRDA 1S4ZA 4AH6A 4X62Q 1DOLA 1A8VA 1LTLA 4XXEA 2I0QA 2JA7H 1I3QB 2ICEC 1WI5A 4BBRB 4RGNA 4L8JA 4HJ9A 5DNFA 3I4NB 3M4PA 2KA7A 1TWCH 3CCVA 3S2DH 2EYOA 4GLAC 1C9OA 1YITA 5KEEA 3AFQA 4H7BA 4CJ2C 5I6WA 4C3HB 3DLLA 1JJGA 1I4HA 1N33L 3W1GA 1TY2A 1H9SA 4PV1C 5TSSA 3K81C 1HNWL 5K36H 1TY0A 4DR3Q 4ODGA 3R2IA 1SE2A 4DF7A 1LT4D 5A35A 4B3MQ 1GD7A 3J7AF 3RZOH 2PQEA 1PH8A 4FP5D 3WOFA 3V2TA 1IL2A 5J3BA 2AWNA 4NPSA 3K57A 4N9TA 1TQOA 2IX3A 2F0MA 4QUFA 3KF6A 2JP1A 1O7IA 1CZWA 3SXHA 2HDLA 1CHQD 5K5PA 1D8LA 3UDGA 1OO9B 3KBXA 2BDOA 4ID6A 4DV0Q 3Q6SA 2R7ZB 3A55A 3RZDB 5COYA 3GV3A 1ML0D 2EJGC 3TS2A 1B4OA 2KENA 1AZPA 3CRKC 4ZKCB 4G7OC 2E2IH 1SYCA 1YHBA 1ONLA 3STBC 4OX9Q 4DK1A 1FYCA 3U9OA 5GQOA 1IYUA 2JA5G 1JICA 2IPKD 1SNMA 1E2WA 1EYAA 1TIID 2PYKA 4H44C 2Q8RE 1HXYD 5C44B 4A3KG 4NB3A 1PV4A 1PMRA 3CPFA 4IFDH 3HOUH 5FLXc 2NVXB 3EN2A 3I4OA 1S3OA 2VY3A 3M9BA 1R9TB 3MEFA 4O42A 5D3DA 4JI4L 4FVMA 3GTOH 1PVOA 1GUNA 4LFCL 4L5RC 1X32A 1EY6A 2E2IB 2RDFA 5EJWA 2FMMA 4MTKA 5J1ZA 1K73C 4KN7C 4C3IG 5D3IB 4IURA 2JA6G 1PH6A 4IPGA 3K7AB 3NWSA 3S1RH 4DR6L 5C44H 1NMFA 1MHWC 3J81E 3OW2A 4OGQC 1O80A 4QF4A 4NXMQ 3HGBA 1HQMC 3NWTA 2F4IA 1VF7A 2IHFA 2NVXH 1A3TA 1WYDA 4A3DB 5M5WH 1EY9A 2AUJD 2JSOA 3GTOB 4N8X1 1QNKA 1F9PA 2XIWA 4DK3C 1QVGA 3G6JB 3P75A 3RLNA 1TS3A 2N3SA 4R9WA 2A19A 3I91A 3SGIA 1QNUA 1LACA 4LFCQ 2IX1A 2EXDA 1EU3A 2MUYA 2KEDA 5GROA 5JVG3 2YTYA 2PPBC 2F0TA 1PFSA 2GA4B 2P5ZX 2K5QA 3J81L 3S14B 1VS0A 3KF6B 3MEHA 4XIGS 5CV4A 1PH3A 1XNQQ 5CV8A 1FGUA 1EY0A 1QWYA 1EOTA 3MXNB 4UDUC 3VYUA 2JN4A 2WKCA 4Q5VA 5BR8Q 4LUOA 1E2VA 1KDCA 1F2LA 5CV7A 5IIFA 4KD4A 2ZJRA 1YZ6A 1RIPA 1KC8C 1DM0B 3EVQA 1EIFA 3RN2A 1ENAA 4C3IB 1ILQA 3NXWA 3M4OH 2EVBA 2IT1A 1BQQT 1VQBA 4LF7L 3VR4A 3HOZH 5D65A 4B9XA 5M3MB 2XNAC 2A69C 4M1UB 2VUMH 3GTPB 5LL6X 1EIHA 1KDAA 2H1EA 2XN9C 4CDFC 5IGBA 3OTOL 3M4YA 1HZCA 3TP7A 4QCLA 3VYTA 2F0DA 5C5LA 2O4XA 3NK9A 2WB1E 3J80L 3M4QA 1OXUA 4K6DA 2I5MX 2CQAA 5ELBA 4BY1G 4ZK9B 1MD2D 2EYLA 5ISRA 2UXCQ 4DA2A 1ENCA 1I5FA 5KYIA 4LF7Q 1I6HH 3J7ZC 1PH1A 4DUZQ 1S5BD 1K8GA 4A3KH 4DR5L 5AJ3L 1AH9A 4A3JH 1Q86C 1QUQB 2WINB 4J1MA 3LWEA 2HT1A 4YHHL 4X62L 2LKVA 2NVYB 1YJNA 2E5LQ 2Q2TA 3QG1A 2VNUD 1GUTA 2F0UA 1PRTB 1QOHA 3D3RA 1LTGD 1Y1VB 1IZ6A 4DUYQ 2RSNA 1KAAA 1RF2D 1Q3LA 2O5IC 2UU9Q 5JOBA 3NQTA 4DNTB 2UUCL 3BVMA 1EYCA 2F0GA 2UXCL 3VR3A 3RLFA 2LXKA 2PI2E 2XRQD 3BZCA 3H6MA 1DD2A 4GS3A 4A3JB 3MXUA 1MIUA 2K6AA 1K8MA 3HKZE 3DWAA 1NY4A 4P74A 3F1ZA 5EKIA 1CTMA 2BOSA 3V96A 2B2UA 2DY8A 3MXGA 3NBIA 2EY6A 3K59A 5JAVA 1II3A 1BNZA 3GO5A 1PDQA 4UP7A 4NP5A 4PMCA 4YCVA 2CQOA 2K5HA 1Y8OB 1NJIC 1XXGA 4DV3Q 1HFNA 3I55A 2K1BA 3DEOA 3SR1A 3X3NA 4Y52H 1Q8KA 1C7YA 4IUNA 5C6AA 1EY5A 5EBCA 4HSVA 4PZ6A 1ZYRD 5LMNQ 1KABA 4JCVE 4B3RL 4Q0FA 3K58A 3J7A5 4DU9A 3A8IE 3P1HA 1STBA 4OO1H 3CHBD 4NMZA 1OXTA 4XQJA 4JPBW 2B2YC 2K7VA 4DNRB 3K8AA 1GUOA 4HTHA 1PFBA 4X65L 4JVZA 4EQOA 2HD3A 1CKNB 3W1BA 1WTQA 2KCCA 2VXWA 2K32A 2B2WC 4HIDA 1SJED 3IL8A 2CFMA 1Y69U 5JJLA 2MGSA 3OYYA 2HHHQ 2OQ0A 4HEDA 3F2UA 1CKOA 4LJZC 2NWGA 1PH7A 2SDFA 1I50H 1S5ED 3ER0A 4X65Q 4B3RQ 5EGTA 2RCFA 1VQ6A 5GAHC 3PQIA 2JQOA 3I70A 3KFUA 4A3MH 1SN8A 2GVAA 4IFDJ 5E3FA 1LTRD 1WCMG 3ERSX 4JI2L 1CUKA 1A63A 2ZXOA 1DOMA 5LL6S 1D6EC 3OOCA 5BN5A 4LFAQ 4GLVB 1S5FD 2QA4A 4YY3Q 4EGVA 1SDFA 1GUGA 2CKZB 4C2MH 1PFMA 1XPOA 4GKKL 4CKEA 1CKNA 1KLGD 3DWPA 4NW2A 5A2QL 2E2JB 1F2MA 1I4XA 3L9AX 5CV9A 4HCEA 1QILA 3HEJA 3GTGH 4OEMB 2F1MA 3RUZA 3UDIA 4A3GB 4DV1L 3U58A 3NHHA 1NCVA 3HG9A 5KNCA 2ZTEA 4LF8L 1SYFA 3RD4A 5JEAJ 3I4NH 1OXXK 1F77A 4LAAA 3I4NG 2OCEA 1XPUA 4U673 4LF5L 3DEPA 3AQQA 1Y8PB 3PF5A 4YWLA 1D5XC 1Y1WG 3LWUA 2E2JH 4BBSH 1STEA 4FF4A 1T9HA 1D5MC 5IGDA 5JPNC 5C4XH 2EJFC 1TWGB 3FKIB 3BDCA 4A3IH 3BYYB 1IW7D 1E1TA 2VZAA 2Z8LA 3DUZA 1H9KA 2M00A 4A3FB 1O7ZA 4DV0L 3SK8A 3U50C 2O2LD 4OO1G 1X56A 2KCMA 2HIXA 2AMCB 4R4CA 4JI3L 5IP7H 2AQ1B 1JE5A 3R8BA 5HGTA 2F0PA 4IZ8A 4NXML 2RVLA 1SXTA 1VQ7A 4OXPA 2F3VA 2A68D 3R93A 3UE0A 3T13A 4RG1A 2RF4A 4CDEC 1C48A 1XJVA 2EYMA 1F2ZA 4JI8L 4AQYL 2DUDA 4DR4L 4P75A 3PO2H 1K0SA 1HPCA 3TSSA 2JEBI 1BBUA 1MI2A 1YNND 5H1SE 1EZ8A 1SROA 3RR5A 2I07B 4A3BG 1L0YB 1EWHA 1STHA 4K2KA 1HNXL 4UP9A 3TDQA 1YNJC 4A3EH 2YTXA 3BVGA 4K14A 4DR2L 4A3EG 1NR2A 2EOTA 3BDOA 4H13C 1EIYB 2BDNA 3ULJA 5KIXA 3PO2B 1K8OA 4JI3Q 1TVXA 2NZ1D 2F0LA 4JBKA 2UUCQ 3E9IA 5EKLA 3UI2A 3CQZH 3D8GA 4IO9A 2CH4W 4GLXA 5IP9G 1PRTD 1L0WA 1LT6D 2VQEQ 1H9JA 5IOCA 4JI8Q 5KNDA 1L2FA 5CC4A 1Q12A 2MJ8A 1SMXA 3PO3B 5CR3A 3FKIG 1HA6A 4KK7A 1U4RA 1R4PB 4MIUA 1VQAA 2H5XA 4LK1C 3ND9A 1W6KA 4XT3B 1L0XB 1TXYA 1X55A 5IYDH 1X54A 1CFMA 1CA6A 4H0LC 2DJFC 4LF4L 1NUCA 4A75A 4DAYA 2PNHA 1HZ9A 4XYOA 4JI7L 4JBJA 2F3WA 4DR5Q 5AFWA 3SE0A 3OMCA 2A5HA 1TWCB 1TWAH 3S2DB 1JB3A 4MHEA 2F0KA 1J6QA 3OSOA 2X6LA 1KRSA 1XX8A 5J39A 3S1QB 2RBMA 5FOBB 1EEID 3R3OA 4BBSG 2K33A 5J22A 4DUZL 3T53B 4X3SA 3LX0A 3K5NA 2ZJPA 2DNEA 1BO0A 2QCPX 2L5TA 3PSIA 3HOWG 4FXDA 3RZOB 2WB1G 3ICEA 5C3EG 4BBRG 2QEXA 4ZQ3A 1UUPA 1QE6A 5C5MA 1TWAB 3A7AB 4G7ZC 1RDPD 2Y0SB 1K8AC 5BN3A 1BOSA 3CCQA 1FGBD 5JEAH 2K05A 1TWHH 5HY6A 3A5UA 2AUKA 4APVA 2X6GA 2CHBD 4JI7Q 4BA2I 4IJHA 4J8QA 1K28A 3E0EA 3J80i 3RZDH 4DK6C 2B2WA 2A8VA 2IWHA 1EY4A 4K5VA 1M8AA 1ESFA 2I5LX 1U0LA 4OWTB 4A3LH 1X3GA 5JEAG 1Q81C 1JOKA 3OPOA 4KY7A 4DR1L 3J81j 2KBNA 1Z6HA 2E75C 3ONAB 5IGCA 3HOZG 5GADC 5EQ0A 4AYBE 4A3KB 4DV4Q 2EQSA 4XTCS 3FPPA 3RMHA 2F3IA 3SK5A 1ZEQX 1S5CD 3N6RA 3I4MB 3L3OC 5I2YA 4BY7H 1D7QA 1WVLA 5BN4A 5CMDA 4QL5A 3CRLC 4MTNA 5K36G 1STAA 1MSGA 2WAQG 1SE3A 1WTRA 1Y1VH 2F0SA 2K14A 5IYCG 3HOWB 4DNIA 1H9SB 1YJ9A 3KDFA 3QJYA 4ME3A 3JAMi 5M9OA 2MPMA 4DV5L 2Y0SE 4IPCA 3DM1A 3CC7A 4EQ5A 1XNRQ 4YWMA 2IX0A 3F8TA 2OQKA 5T1IA 1E0BA 1UE6A 2HQLA 4BY7B 4C3HG 3S15B 4FDBA 3PIO3 4MNOA 2Q2IA 5G3LF 3D6WA 4Z9CB 1XMQQ 5DM73 4I65A 1HZBA 5F2DA 4Y7NH 2JEAI 1K3RA 1QVFA 3GTQH 4QGUA 2WB1B 2FHTA 1VQKA 2M9VA 3PIP3 4PMWA 4OIJA 3I90A 5C3EB 3BZKA 5HGQA 1G6PA 1GXDC 2CW0D 2Z0SA 3JAME 1JQYD 2EXZA 4K0KQ 3D4DA 2SNSA 4A3DG 2EYJA 3S15H 3BG3A 4DPGA 1BR9A 2Z6KC 4RCNA 3A54A 3F2BA 1VQNA 4HMIA 2G9HD 2JA9A 4JV5L 2L12A 2QEJC 1B2TA 3TREA 3IKJA 5DLQE 3GTLH 2Z6BA 1B9MA 5IGEA 1JWMD 4XQQA 3VR6A 3T1HL 5C3EH 4DR3L 5FO7B 1B3QA 4C3IH 2FJ2A 1W3SA 1JT8A 4RH6A 1LT5D 1PLFA 3W2DA 1YNXA 1G8ZD 4LF9L 1KIXA 4K8JA 2B2TC 1HNZL 4NXNQ 4CGYB 1SNPA 5FO9B 3HOZB 1GOZA 1IYJB 5IWAL 1BVSA 1V8QA 1QB5D 3W5OA 2CW0C 4A3IG 1WTXA 1IHZA 3TRZA 1I50B 5DAUA 1MGSA 1PXUA 1J8IA 2VQFQ 3PIOA 4A3MB 2WP8J 1TS4A 1UNSA 3S1MH 1E2ZA 3TS0A 3L0OA 4JBMA 1B8AA 2Q8TA 4KKTA 1HNWQ 3BZDB 2NN6G 1I6HB 2OTLA 1CHPD 1HUNA 4JI2Q 4M8AA 1CM9A 3CC2A 1WTHA 3FDTA 2B8FA 3PO2G 3PF4A 3NTHA 1JCKB 1N34Q 4DR6Q 4A3GH 4YWKA 5M3FB 1D5ZC 2NVYH 1LO5D 1ZXTA 4LF4Q 2VQFL 1LT3D 3LGJA 2C9OA 2G9DA 5I4DA 1N36L 2B2YA 3L7ZC 3U4ZA 5LMUQ 2EY1A 5C3WA 3GTJH 1H95A 2R93H 4P73A 1GM5A 4JI6L 2QILA 1IBKL 4A93B 1IXRA 1UEAB 3PUWA 3NENA 4O0AA 2MHVA 4HJ5A 4HMJA 3C46A 2IHEA 5IT9c 3A74A 5C4XB 3HOUG 1KDBA 3FKIH 3H91A 1EFWA 3Q8DA 2VW9A 1SLJA 4YIJA 2B29A 1EY8A 4ABNA 3HOXH 4QB4A 2R93B 1SJHD 1PTOB 5JVH3 4P72A 2L1BA 1KRTA 2F4VQ 4X6AH 5EAYA 4A3FH 4A93H 4GOPA 2PZTA 1Y1WH 4LF6L 4HR7B 4S3SA 2QDBA 2K01A 3VYRA 5LMUL 1QG7A 4RHRA 4OONA 4DR7Q 4QIWB 2A6HC 2UXDL 2N49A 3VA7A 1I4GA 4DR4Q 2QF7A 3IFDA 3KLRA 2ICIA 1IBLL 3J7AV 3WDNA 4L5TA 4K6LA 1B7YB 2R7FA 4QIWE 2ATWA 4DV6L 2K50A 3BVZA 3HOYH 2UXBL 5CYUA 1O7LA 3GDEA 3GTMH 1SNCA 2K04A 1Q1EA 3K0YA 4PMBA 2KUMA 4IPHA 3H0GH 3BS1A 4KKSA 2UUAL 3IFTA 4AIMA 1FR3A 3CXCA 3A5ZB 1LTAD 1QZHA 4B3TQ 3CC4A 1XTDA 2RHQB 2JA8G 1JORA 2IW3A 4ME5A 4F8MA 3M7NA 2ZM6Q 1J5EL 3NELA 1PH2A 3Q24A 2ZJQA 2BA1A 2D9UA 3TEHB 1EQTA 3ERQA 1IBLQ 4CDCC 2LSSA 4WFN3 1MJEA 3D4RA 3ZJYC 3HOYB 4IUQA 5C4JB 4LFBL 4GN3B 2ENBA 2YTVA 1ASZA 1QUQA 4PZ7A 1HA5A 3UDXA 4R4OA 4DAPA 1DJRD 3H0GB 4A76A 3S16B 3MA2B 3CQZB 4EX5A 2LXJA 2C35B 4KHPL 4BBRH 1HH2P 4X3TA 2RCNA 2RQXA 2K4KA 1C4QA 1JWSD 1CSQA 1SE4A 1L1OC 3CCSA 3A8JE 2AWOA 4A3JG 3MFYA 1JOOA 3NSWA 2K75A 2XWBB 1Q8IA 4CDDC 5C4JH 4B3TL 4I7AA 1TS5A 2PW7A 5CORA 2D5DA 1QJOA 1P16A 3CCRA 1E22A 3E5SA 5I9PA 4DFAA 3BDLA 4A3MG 1GO3E 2KECA 5IE8A 1HRJA 5E4WC 2L55A 3NUCA 1SYBA 3D4WA 1X3FA 3OTOQ 5C0XG 3FRPB 2ID0A 4K0KL 1EU4A 1BF4A 2RKSA 2ZTDA 1FVIA 1BXTA 5L37A 4EQNA 3M7GA 4XQNA 1PTOF 2HQEA 4RAUC 4C3JH 4C1NK 1ZYRC 4BBSB 1EYGA 3KLSX 4G7HC 3QIAA 5I2XA 4A3GG 4ZCKA 1TWGH 4BS9A 2ASBA 1I3QH 4NDXA 1K3BC 3K7UC 3LNNA 1V9PA 3HKZB 5LMNL 2Z9HA 1I6VC 2A6EC 2QGQA 1X9NA 5EPKA 2KCTA 4R8IA 5E7NA 5IWAQ 4C3HH 3MWYW 4PQXA 3I7FA 2R6GA 1M90C 2F0WA 2JK8A 1VQ9A 5ELDA 1PZJD 3MHBA 2Q2UA 2PNRC 1ILPA 5GAGC 1NNXA 2RDGA 4HIOA 2E5LL 1LABA 1RTOA 2KQ3A 1WTVA 1JC7A 2TMPA 1ET9A 3TP6A 5CV5A 3QB3A 1XMQL 4GN5A 3KF8B 2IL8A 2X69A 3H3VH 4IOCA 4WJ3M 4IUTA 1B53A 1SBBB 4R1JA 2A68C 1U4PA 1CI3M 1LUZA 5GAEC 1ZKOA 4TVAB 4A3EB 2KHSA 2R92G 1H9MA 3J81c 2F0EA 3FPUB 3ULPA 3GTKB 1BCPB 4K5WA 3PV0A 1NE3A 3T56B 3G4SA 4GNXA 3C3LA 4LFAL 1ESRA 1HFGA 3MC0B 3UE1A 4BY1B 1VQCA 5ELFA 1IW7C 1PH9A 3S14H 3FVQA 3VR2A 1EL0A 3GV6A 1ENFA 2WKDA 4JI1L 4DAYB 3G6EA 2G5DA 5IP7G 4J6HA 3PO3H 4PG3A 3KJOA 4WORA 4FO2A 1E7ZA 1RD9D 1G2TA 1XNRL 5C0XI 5E4XA 3I72A 3EIVA 3GTKH 3P20A 4B3ML 1BCPD 2MP1A 2XSCA 3X3MA 2JE6I 4DV7L 4KLKA 1IYVA 4GKKQ 4GNXB 2BE5C 1MJCA 3OHXC 1AZQA 4H02A 1DZ1A 2EJMA 4BY1H 4KY5A 2A73B 1XMOL 2OEOA 3HKZG 2CWAA 1WD1A 5IP9H 1PA6A 1AE3A 3VR5A 4QUCA 4BWGB 1HJPA 5M3MH 4O1NA 2UUBQ 5HURA 2A1AA 3KYHC 1OXSC 1KD1C 1S40A 1EOVA 1FL0A 2F0QA 4I7ZC 3RLOA 3C1EA 4XT1B 1J9OA 2D2CC 5IYDG 2AKWB 1BDOA 4MN3A 3CW2C 1FNUA 1HR0W 3J80E 1B9NA 3FEWX 4V0BA 4IOAA 1YJWA 4POGA 4FYDA 2A69D 1BKBA 2MNAA 2MQHA 2L4NA 3Q0AA 3CAMA 1O7YA 5IT9L 3GD7A 2FMCA 4HJAA 2PCFB 2WV6D 1F9QA 1PZID 2A6ED 2FFKB 1A15A 4KJOA 3HKSA 4C3JG 2K5WA 4ILWA 3CD6A 4RGTA 5IY0A 3OIPA 3H94A 3TP5A 1OTCA 4B3SL 1XTCD 1RL2A 3H09A 3G48A 3IRBA 3M4OB 1Q46A 1GUWA 1D2BA 5KYLA 4N8FA 5JPMC 1TWFB 4R4IA 1WTOA 5EBDA 4A93G 4R8NA 2QW7A 2HUGA 4LW1A 4ALPA 5M5YB 1F9SA 2F0IA 2UXDQ 1JMCA 3T1HQ 1E1OA 2F4VL 1B1ZA 4K8IA 3TZDA 3K5OA 4JG2A 1LM0A 4LF6Q 1DXMA 3SEBA 1FNWA 1PFNA 1VQ8A 1H9RA 2B2UC 2D0PA 4WJ4A 4G57A 1SAPA 2K03A 2L9HA 4OIKA 1AN8A 1BBWA 1TWFH 1D1KA 2DNCA 3MTSA 1IBKQ 1HQRD 5M5XB 1VQ5A 5JJIA 3MZ5A 3DHQA 1EIGA 2NYZD 3IAYA 4TQUS 4RFBA 3U4VA 5C0XH 3J7YW 4NXNL 2K5NA 4DV2Q 2HDMA 4ZAIA 1VQEA 1IL8A 3EJIA 2UUAQ 5A2QE 1CSPA 3PIPA 1G291 3S1NB 4CKCA 1UWVA 2EYPA 1PHJA 5ELOA 1TS2A 1CKMA 1Z7TA 4Y7NB 2JA5H 2SEBD 1LV9A 4RHSA 4ZRZA 1RHPA 4HN7A 1VQJA 3S17H 4LF8Q 2VB3X 1G2SA 1SNQA 5CV6A 4FF1A 4U68A 2Z1CA 3HS0C 4GOPB 2F0NA 1U9RA 1EY7A 2PQAB 1VF5C 4X66L 4OHJA 5C4ZA 3PUVA 3QWNA 2CWPA 2DGYA 4C56C 3NPPA 2AQ3B 1PH4A 3S1NH 1JB7A 1HNXQ 1PYWD 1L1OA 1U4MA 5IYBG 4JYAQ 2XRSD 3NTIA 4ZLTF 1DGSA 1TR5A 2DN8A 4KHVA 5IODA 1EEFD 1IKLA 1TU2B 3GTMB 4DR7L 3S17B 1UAPA 2B39A 1V43A 1IBML 4X64L 1VQGA 1VQFA 1YHAA 4GKJL 1XNQL 3HOXG 1AP0A 1PRTC 2B63G 3HP3A 2L15A 1LTID 1V1PB 4JBWA 1T5EA 2ZM6L 5LMNW 2LY7A 3HRZC 4IUUA 1JR0D 3QOJA 2VQEL 4JI4Q 4UY8C 4KI0A 4DK0A 5AJ3Q 1STNA 2H4OA 2J4XA 3NBHA 4AYBG 2Q8IB 3F2DA 2R7ZG 1BBXC 3H3VI 3KF8A 2ZT9C 4C2MB 4RGOS 4EVOA 1LTTD 3AEVA 3I8ZA 3A0JA 3NTKA 1HCZA 2PZUA 1FJGL 4ZUIA 5IYBH 1DONA 4L5QA 1KL9A 3GTGB 3S16H 2NZOA 1I4PA 4LMQD 4PNYA 3B6YA 3S1MB 4HSPA 3RNUA 4A3CG 4K5XA 4WJWA 5C44G 3GP7A 3NBHB 3JAMc 1NTGA 4OWXB 3MAQA 1PRTF 4BA1I 3JAML 4X64Q 1V1PA 2E2HH 4GKJQ 3TP8A 2UXBQ 1VQLA 3KJPA 2Z6KA 4LWCA 3QR8A 2V4DA 4IFDI 1YI2A 2XTIA 1RJTA 4UHVA 5ELEA 1FJGQ 5KGUA 5M3FH 4A3CH 3U9SA 2JA7B 1CK1A 3S2HH 1EFID 1VDZA 2WFWA 3OW7A 4F87A 1DOKA 2OF1A 1F9RA 3GTJB 1TT2A 1K0RA 3JC66 1G91A 4WRDA 1YBYA 1UE7A 3CU7A 1STYA 2E2HB 2B2TA 5FLXE 2EPBA 3Q22A 5C3XA 1AFPA 4DV5Q 2F0OA 4JI5L 3PO3G 4IUVA 5DM63 2Z4HA 3TZUA 3UDFA 5ELNA 1PYBA 3WWVA 4N9PA 1M1KC 3BJUA 3H15A 4DV4L 3HOXB 4UPAA 1Q90A 3PUXA 2PO4A 4FF3A 3FMCA 4YHHQ 3NQIA 2UU9L 1KNEA 2OWOA 2AQ2B 4GNXC 4LUZA 4B9WA 2PMZB 2WIIB 4JV5Q 4JK1C 5FLXL 4RCOA 1QZGA 2L0CA 3CP0A 1AE2A 4IN3A 4DN4M 1R4QB 1LLRD 4IJLA 2LMCB 4KN4C 3M3YB 4DV7Q 1JWUD 3EA6A 1A2UA 4A3IB 1X65A 4UAIA 4KD3A 5KRUA 1HR0Q 2E2DC 3OMGA 3W3AA 3C1FA 3ZYYX 5IYCH 3KLWA 1EUJA 4KJNA 2JYOA 1I4QA 2B8GA 4ZYSA 1KLUD 2OXPA 3AB9A 3OIQA 2MO0A 3T1YL 5D14A 4TSSA 4DV3L 3HFZB 1N9WA 1YNJD 3AU7A 1SSOA 1SNDA 4X3UA 2I5HA 1V1OA 3KDFB 3CCEA 1NSNS 1R9TH 1GKHA 5CBAE 4RWSC 4YCWA 3HZXA 2FINB 1QCBD 3C2PA 1ICFB 1CT1D 3MFGA 3TQYA 1MKHA 3K7AH 3S1RB 5IT9E 3CPWA 1WD0A 4BXXG 3OWFA 1YIJA 1WTWA 4JI1Q 4A3DH 4HIKA 3VA5A 1VQ4A 4JI0L 3A8KE 2Z4IA 1A3VA 4IQZA 1NR4A 4DXGA 1PTOD 5FO8B 4CJ1B 5C4HA 1A62A 5I9OA 1XPRA 2OT2A 1N36Q 5FLMH 2R92H 3H3VC 2QDLA 3PCOB 1HNZQ 2R61A 3GQBA 4CBVA 2EE1A 4KY6A 2HHHL 1WJJA 3MXPA 3CF5A 4QJFA 2EZVA 4L5SA 2AHOB 3R2TA 1HTLD 4FXGC 1B70B 2UUBL 1HHVA 3PMFA 1GHKA 1Z9FA 4RKBA 2LS01 4HAEA 2OTJA 2TSSA 4A3BB 1N8RC 2EY5A 5M3MG 1SYGA 4J15A 3I2ZA 3VDYA 1VQMA 2EIFA 5JJZA 4DAVA 3DMUA 4CJ0B 4C3JB 2DJGC 2KEEA 1DYQA 1VQHA 4KMUC 1EZ6A 2RDHA 1VQOA 2B2VA 3V05A 2VB2X 2FXQA 2WAQB 3QO2A 1N33Q 1YNNC 4AQYQ 2WACA 4DV1Q 1I94L 3T51B 1BUVT 1D1IA 3FP9A 4CHTB 2BH2A 2BH8A 2ZTCA 4LF5Q 2E76C 1AW7A 4IALA 4GN4B 4IFDG 2NTTA 4A3BH 1VCIA 5IGGA 3ITPA 1B3AA 3S1QH 2VUMB 3STBD 1KAWA 1SMYD 2XGTA 3EQLC 1AEXA 1RCVD 2E8GA 1JJCB 2JA8B 1EYDA 4NKLA 4FF2A 1XMOQ 1X3QA 2HCCA 3CCLA 1Z47A 4OX9L 2R7ZH 2EYFA 2RHSB 1FNVA 3HOVG 3PUYA 3TN2A 2A6HD 3K6OA 3G7LA 1K9MC 2EY2A 1Y1VG 4OL7A 2CH4A 2B63B 1B50A 1I94Q 4F88A 5FJ8G 3H0GG 3AYHB 4KKUA 3D31A 3I3CA 5G3LD 4B08A 4IUPA 1TWHB 2PI2A 2ALYB 5M5YH 4LF9Q 4A3FG 1Q1BA 1GHJA 2JA8H 2E74C 3A56A 4XYQA 2N8NA 1SFOB 3HOUB 1S72A 3K0XA 2XVSA 1X3EA 1VQPA 1EQRA 5FKAC 2KCNA 1X6OA 1SE8A 1PYSB 4HJ8A 5DEHA 3PGZA 2B63H 1V1QA 4ULLA 4X3KA 4HIMA 1EQQA 3HOVH 3GTQB 1B44D 2IY5B 4FNFA 1RKNA 4JYAL 1KNAA 1SEBD 3NP8A 3E6ZX 1BCPF 4BXXH 2N88A 1KHIA 3EFXD 1ET6A 3DM3A 2XWJB 4JOIC 4QMGA 3BU2A 1SFOH 4G4KA 2V1CC 1LYLA 1T5XD 4HJ7A 4RKLA 5M5WB 4KHPQ 3I4MH 1SYEA 1YHQA 4GZYC 2K5VA 1VQDA 1XYIA 3CCMA 3E3XA 3M85A 5LHY1 4L63B 3F2CA 1UE1A 2WAQE 1GJXA 4FXKC 4LNQA 2F0VA 3S9WA 3HOVB 1QVCA 4P71A 3HOWH 1CQVA 4DV6Q 1N34L 2R7DA 4C1NI 3NE5B 4DR2Q 4QQBX 2NVTB 3SK6A 1W2BA 3SHLA 4B3SQ 3E0JA 2RSOA 3PUZA 3TMEA 2BA0A 1J5EQ 2N55A 2JA6B 2NN6H 3FHWA 2ES2A 1EWIA 2EDGA 2PZWA 1C0AA 4E6IA 4LUVA 1KQSA 3I4LA 3CCUA 1JE4A 1BCPC 1WCMH 4LFBQ 1CA5A 1YEZA 2D62A 3I4MG 5EPLA 2NTSA 2NVTH 4F7XA 5BR8L 1SR3A 4OO1I 2N78A 1A2TA 3AMUA 3MVVA 1Q82C 1C8CA 2R93G 3VYSA 1KTKA 1UE5A 2B3GA 3KOJA 2JA6H 1TKWB 5C0XJ 2O5JC 2NBFA 4DV2L 4PZ8A 2F0FA 5KNBA 1WCMB 1IKMA 3AFPA 1IBMQ 1P8LA 4JI5Q 3CMEA 4UP8A 1WFQA 3GTPH 2K5DA 3I56A 1UEBA 4V190 3EROA 3DXJC 1X3PA 3DWQA 2SNMA 3GTLB 2K28A 2R3ZA 3ND8A 1GUSA 3Q23A 2GN5A 4DGZA 1JOQA 1VMCA 2DY7A 1EWCA 1WOCA 4JOIA 3URYA 2JXMB 4X66Q 4IPDA 5FJ8H 3ULLA 1LTBD 2JA7G 2YV5A 2NN6I 5EPJA 3SVMA 1HTPA 2I46A 3RN5A 2NVQH 4KV6A 3O13A 3K5MA 1VMPA 2MO1A 1YVCA 1CZGA 4MZ9A 1I4RA 1XWEA 2A74C 2M2LA 3P7JA 4OELB 4YCUA 1HR0L 2C5CA 1A6XA 4OWWB 4HCSA 2ZXPA 3HOYG 4ZUJA 4KHZA 3S2HB 4O2DA 3T1YQ 3J80c 2D0OA 4RA8A 4DAMA 2YU9H 2BE5D 3OWEB 3K80C 2CCZA 2NVQB 2KHIA 3MXNA 1PTOH 2MFIA 1N32Q 1EQVA 5M5XH 4A3LG 2RA4A 4DUYL 3K5LA 3E9HA 3CKIB 1W6JA 1Y1WB 3SDZA 1G51A 5FLMG 2F52A 2VL6A 4DR1Q 3A7LA 3QOLA 4RMFA 4KTAA 2PW5A 1L1OB 2GVBA 2KVMA 3S24A 2YU9B 1U5KA 2NUCA 2YYZA 2KHJA 4TKOB 2BCOA 3CCJA 2JA5B 1Y8NB 1N32L 3TBIB 3T16A 4JI0Q 1MSHA 1S5DD 4DKAC 1SRUA 4DXFA 1K83H 1A3UA 3L2PA 2F03A 1E24A 1GVPA 5NUCA 5JJKA 3T4AC 1ICWA 3M3YH 4K2LA 1JJ2A 1DCZA 4JC0A 4EQPA 4BY7G 2JJQA 1O78A 3KBGA 1A0IA 3D0FA 1HZAA 1ASYA 3N52A 1MBYA 1STGA 1NMGA 3G71A 1NBWA 4YY3L 1E3PA 5M3FG 3BYTB 2CVRA 4L6TB 2L11A 1KXLA 1CQFA 5FK9C 3CMAA 1VQIA 2NZHA 2KJXA 4GOPC 4P2CB 3KLSA 1K83B 2Y0SG 4RGMA 2J7ZA 1M4VA 2VUMG 3KUPA 1RODA 2ZXRA 4R4TA 5IGFA 4ZKBB 1SYDA 5CGKA 1F2YA 2HIVA 3SK4A 3NEMA 1RTNA 2SOBA 3KK7A 2PQAA 4QY7A 1PZKD 2EYHA 4POFA 1PH5A 5CBEE 2LFNA 2QKIC 1Q7YC 2NB0A
chains in the Genus database with same CATH topology
1NAPA 4CKBA 4XDXA 2B2VC 2KOLA 1HUMA 5EKKA 3I73A 1SMYC 2F0JA 1U4LA 3WOEA 1PTOC 5T1GA 1LTSD 1OXVA 2HCIA 2F0HA 2J0TD 2IJ0A 4AYBB 1WTPA 5I6YA 3D6CA 1FD7D 1G6ZA 2R92B 5E1FA 1SNOA 5ELCA 4TRDA 1S4ZA 1DOLA 4XXEA 1I3QB 2ICEC 4BBRB 4RGNA 4L8JA 5DNFA 3I4NB 2KA7A 2EYOA 5KEEA 4H7BA 4CJ2C 5I6WA 4C3HB 1I4HA 1TY2A 1H9SA 4PV1C 5TSSA 5K36H 1TY0A 4ODGA 3R2IA 1SE2A 4DF7A 1LT4D 5A35A 3J7AF 2PQEA 4FP5D 3WOFA 3V2TA 2AWNA 3K57A 4N9TA 1TQOA 2IX3A 2F0MA 4QUFA 2JP1A 1CZWA 3SXHA 2HDLA 1CHQD 5K5PA 1OO9B 3KBXA 2BDOA 4ID6A 3Q6SA 2R7ZB 3A55A 3RZDB 5COYA 3GV3A 1ML0D 2EJGC 1B4OA 1AZPA 3CRKC 4ZKCB 4G7OC 1SYCA 1ONLA 4DK1A 1FYCA 3U9OA 1IYUA 1JICA 2IPKD 1SNMA 1E2WA 1EYAA 1TIID 2PYKA 4H44C 2Q8RE 1HXYD 5C44B 1PMRA 4IFDH 2NVXB 1R9TB 4O42A 5D3DA 4FVMA 1GUNA 1X32A 1EY6A 2E2IB 2RDFA 5EJWA 2FMMA 5J1ZA 4KN7C 4C3IG 5D3IB 4IURA 3K7AB 3NWSA 3J81E 4OGQC 1O80A 4QF4A 3HGBA 1HQMC 3NWTA 2F4IA 1VF7A 4A3DB 1A3TA 1EY9A 2AUJD 2JSOA 3GTOB 1QNKA 1F9PA 2XIWA 3G6JB 3P75A 1TS3A 4R9WA 3I91A 1QNUA 1LACA 2IX1A 1EU3A 2MUYA 2KEDA 5JVG3 2PPBC 2F0TA 2GA4B 2K5QA 3J81L 3S14B 3MEHA 4XIGS 5CV4A 5CV8A 1EY0A 1QWYA 1EOTA 4UDUC 3VYUA 2WKCA 4Q5VA 1E2VA 1KDCA 1F2LA 5CV7A 5IIFA 4KD4A 1DM0B 3EVQA 1ENAA 4C3IB 1ILQA 3NXWA 2EVBA 2IT1A 1BQQT 3VR4A 5D65A 4B9XA 5M3MB 2XNAC 2A69C 4M1UB 3GTPB 5LL6X 1EIHA 1KDAA 2H1EA 2XN9C 5IGBA 3M4YA 3TP7A 4QCLA 3VYTA 2F0DA 5C5LA 2O4XA 3NK9A 3J80L 4K6DA 1OXUA 2CQAA 5ELBA 4ZK9B 1MD2D 2EYLA 5ISRA 4DA2A 1ENCA 5KYIA 1S5BD 2WINB 4J1MA 3LWEA 2LKVA 2NVYB 2VNUD 3QG1A 1GUTA 2F0UA 1PRTB 1QOHA 1LTGD 3D3RA 1Y1VB 2RSNA 1KAAA 1RF2D 1Q3LA 2O5IC 5JOBA 3NQTA 4DNTB 3BVMA 1EYCA 2F0GA 3VR3A 3RLFA 2XRQD 3H6MA 1DD2A 4A3JB 3MXUA 2K6AA 1K8MA 3DWAA 5EKIA 1CTMA 2BOSA 3V96A 2B2UA 2DY8A 3MXGA 3NBIA 2EY6A 3K59A 5JAVA 1II3A 1BNZA 3GO5A 1PDQA 4NP5A 4PMCA 1Y8OB 1XXGA 1HFNA 2K1BA 3DEOA 3SR1A 3X3NA 4IUNA 5C6AA 1EY5A 5EBCA 4HSVA 1ZYRD 1KABA 4Q0FA 3K58A 4DU9A 3A8IE 3P1HA 1STBA 4OO1H 3CHBD 4NMZA 1OXTA 4XQJA 2B2YC 2K7VA 4DNRB 1GUOA 4HTHA 1PFBA 4EQOA 1WTQA 2KCCA 2VXWA 2K32A 2B2WC 1SJED 3IL8A 1Y69U 2MGSA 4HEDA 3F2UA 4LJZC 2NWGA 2SDFA 1S5ED 5EGTA 3I70A 4IFDJ 5E3FA 1LTRD 2ZXOA 1DOMA 5LL6S 1D6EC 3OOCA 5BN5A 1S5FD 4EGVA 1SDFA 1GUGA 1PFMA 4CKEA 1KLGD 3DWPA 4NW2A 5A2QL 2E2JB 1F2MA 1I4XA 3L9AX 5CV9A 4HCEA 1QILA 3HEJA 2F1MA 3RUZA 4A3GB 3NHHA 1NCVA 3HG9A 5KNCA 1SYFA 3RD4A 5JEAJ 1OXXK 1F77A 4LAAA 4U673 3DEPA 1Y8PB 1D5XC 3LWUA 1STEA 4FF4A 5JPNC 1D5MC 5IGDA 2EJFC 1TWGB 3FKIB 3BDCA 3BYYB 1IW7D 2Z8LA 3DUZA 1H9KA 2M00A 4A3FB 1O7ZA 3SK8A 2O2LD 4OO1G 2AQ1B 3R8BA 5HGTA 2F0PA 4IZ8A 2RVLA 1SXTA 2F3VA 2A68D 3R93A 3T13A 1C48A 2EYMA 1F2ZA 1HPCA 3TSSA 2JEBI 1MI2A 1YNND 1EZ8A 2I07B 1L0YB 1EWHA 1STHA 4K2KA 3TDQA 1YNJC 3BVGA 4K14A 1NR2A 2EOTA 3BDOA 4H13C 2BDNA 5KIXA 3PO2B 1K8OA 1TVXA 2NZ1D 2F0LA 5EKLA 3UI2A 3D8GA 1PRTD 1LT6D 1H9JA 5IOCA 5KNDA 5CC4A 1Q12A 2MJ8A 3PO3B 5CR3A 1HA6A 4KK7A 1U4RA 1R4PB 4MIUA 4LK1C 3ND9A 1W6KA 4XT3B 1L0XB 1CFMA 1CA6A 4H0LC 1NUCA 4DAYA 4XYOA 2F3WA 5AFWA 3SE0A 3OMCA 2A5HA 1TWCB 3S2DB 1JB3A 4MHEA 2F0KA 3OSOA 2X6LA 1XX8A 5J39A 3S1QB 2RBMA 5FOBB 1EEID 3R3OA 2K33A 5J22A 3T53B 4X3SA 3LX0A 3K5NA 2DNEA 1BO0A 2QCPX 2L5TA 4FXDA 3RZOB 4ZQ3A 1UUPA 1QE6A 5C5MA 1TWAB 3A7AB 4G7ZC 1RDPD 2Y0SB 5BN3A 1BOSA 1FGBD 5JEAH 2K05A 2AUKA 2X6GA 2CHBD 4BA2I 4J8QA 2B2WA 2IWHA 1EY4A 4K5VA 1M8AA 1ESFA 5JEAG 1JOKA 3OPOA 4KY7A 5IGCA 1Z6HA 2E75C 3ONAB 5EQ0A 4A3KB 4XTCS 3FPPA 3RMHA 3SK5A 1ZEQX 1S5CD 3N6RA 3I4MB 3L3OC 5I2YA 1WVLA 5BN4A 5CMDA 3CRLC 5K36G 1STAA 1MSGA 1SE3A 1WTRA 2F0SA 3HOWB 1H9SB 3QJYA 5M9OA 2MPMA 3DM1A 2IX0A 5T1IA 1E0BA 4BY7B 4C3HG 3S15B 3PIO3 5G3LF 3D6WA 4Z9CB 5DM73 4I65A 5F2DA 2JEAI 2WB1B 2FHTA 2M9VA 3PIP3 4PMWA 4OIJA 3I90A 5C3EB 1GXDC 2CW0D 3JAME 1JQYD 2EXZA 3D4DA 2SNSA 2EYJA 3BG3A 1BR9A 4RCNA 3A54A 4HMIA 2G9HD 2L12A 2QEJC 1B2TA 3IKJA 1B9MA 5IGEA 1JWMD 4XQQA 3VR6A 5FO7B 2FJ2A 4RH6A 1LT5D 1PLFA 3W2DA 1G8ZD 4K8JA 2B2TC 4CGYB 1SNPA 5FO9B 3HOZB 1GOZA 1V8QA 1QB5D 2CW0C 1WTXA 1IHZA 1I50B 5DAUA 1MGSA 1PXUA 1J8IA 4A3MB 2WP8J 1TS4A 1UNSA 1E2ZA 2Q8TA 4KKTA 3BZDB 2NN6G 1I6HB 1CHPD 1HUNA 4M8AA 1CM9A 3FDTA 2B8FA 3NTHA 1JCKB 5M3FB 1D5ZC 1LO5D 1ZXTA 1LT3D 2C9OA 2G9DA 5I4DA 2B2YA 3L7ZC 2EY1A 5C3WA 2QILA 4A93B 1UEAB 3PUWA 2MHVA 4HMJA 3C46A 5C4XB 1KDBA 3H91A 4YIJA 1EY8A 4ABNA 4QB4A 2R93B 1SJHD 1PTOB 5JVH3 2L1BA 2PZTA 4HR7B 4S3SA 2QDBA 2K01A 3VYRA 1QG7A 4RHRA 4QIWB 2A6HC 3VA7A 1I4GA 2QF7A 3IFDA 3KLRA 2ICIA 3J7AV 3WDNA 4K6LA 3BVZA 5CYUA 1O7LA 1SNCA 2K04A 1Q1EA 3K0YA 4PMBA 2KUMA 3BS1A 4KKSA 3IFTA 1FR3A 1LTAD 1JORA 2IW3A 4ME5A 4F8MA 3M7NA 3Q24A 2BA1A 2D9UA 1EQTA 3ERQA 4WFN3 3D4RA 3HOYB 4IUQA 5C4JB 2ENBA 1HA5A 4DAPA 1DJRD 3H0GB 3S16B 3MA2B 3CQZB 4X3TA 2RQXA 1C4QA 1JWSD 1SE4A 3A8JE 2AWOA 3MFYA 1JOOA 3NSWA 2XWBB 1Q8IA 1TS5A 2PW7A 5CORA 2D5DA 1QJOA 3E5SA 5I9PA 4DFAA 3BDLA 2KECA 1HRJA 5E4WC 2L55A 3NUCA 1SYBA 3D4WA 5C0XG 3FRPB 2ID0A 1EU4A 1BF4A 2RKSA 1BXTA 4EQNA 3M7GA 4XQNA 1PTOF 2HQEA 4RAUC 4C1NK 1ZYRC 4BBSB 3KLSX 4G7HC 3QIAA 5I2XA 4BS9A 4NDXA 3LNNA 3HKZB 1I6VC 2A6EC 5EPKA 4R8IA 3MWYW 4PQXA 2R6GA 2F0WA 5ELDA 1PZJD 3MHBA 2PNRC 1ILPA 2RDGA 1LABA 1RTOA 2KQ3A 1WTVA 1JC7A 2TMPA 1ET9A 3TP6A 5CV5A 3QB3A 2IL8A 2X69A 4IUTA 1B53A 1SBBB 2A68C 1U4PA 1CI3M 1ZKOA 4A3EB 2KHSA 1H9MA 2F0EA 3FPUB 3GTKB 1BCPB 4K5WA 3PV0A 3T56B 3C3LA 1ESRA 1HFGA 3MC0B 4BY1B 5ELFA 1IW7C 3FVQA 3VR2A 1EL0A 3GV6A 1ENFA 2WKDA 4J6HA 4WORA 4FO2A 1RD9D 1G2TA 5C0XI 5E4XA 3I72A 3P20A 1BCPD 2MP1A 2XSCA 3X3MA 2JE6I 1IYVA 2BE5C 3OHXC 1AZQA 1DZ1A 2EJMA 4KY5A 2A73B 2OEOA 1WD1A 3VR5A 4QUCA 4BWGB 4O1NA 5HURA 1OXSC 2F0QA 4I7ZC 3C1EA 4XT1B 1J9OA 2D2CC 1BDOA 4MN3A 1FNUA 3J80E 1B9NA 3FEWX 4V0BA 4FYDA 2A69D 2L4NA 3Q0AA 1O7YA 5IT9L 3GD7A 2FMCA 2PCFB 2WV6D 1F9QA 1PZID 2A6ED 2FFKB 1A15A 4KJOA 4C3JG 2K5WA 4ILWA 4RGTA 3OIPA 3H94A 3TP5A 1XTCD 3H09A 3M4OB 1GUWA 1D2BA 5KYLA 5JPMC 1TWFB 1WTOA 5EBDA 4R8NA 2HUGA 5M5YB 1F9SA 2F0IA 1B1ZA 4K8IA 3TZDA 3K5OA 1DXMA 3SEBA 1FNWA 1PFNA 1H9RA 2B2UC 4G57A 1SAPA 2K03A 2L9HA 4OIKA 1AN8A 1D1KA 2DNCA 3MTSA 1HQRD 5M5XB 3MZ5A 3DHQA 1EIGA 2NYZD 3IAYA 4TQUS 4RFBA 5C0XH 3J7YW 2HDMA 4ZAIA 1IL8A 3EJIA 5A2QE 1G291 3S1NB 4CKCA 2EYPA 1TS2A 1Z7TA 4Y7NB 2SEBD 1LV9A 4RHSA 4ZRZA 1RHPA 4HN7A 2VB3X 1G2SA 1SNQA 5CV6A 4FF1A 4U68A 2Z1CA 3HS0C 2F0NA 1U9RA 1EY7A 1VF5C 4OHJA 5C4ZA 3PUVA 3QWNA 4C56C 3NPPA 2AQ3B 1PYWD 1U4MA 2XRSD 3NTIA 4ZLTF 1TR5A 2DN8A 4KHVA 5IODA 1EEFD 1IKLA 1TU2B 3GTMB 3S17B 1UAPA 2B39A 1V43A 1AP0A 1PRTC 3HP3A 1LTID 1V1PB 4JBWA 1T5EA 2LY7A 3HRZC 4IUUA 1JR0D 3QOJA 4KI0A 4DK0A 1STNA 2H4OA 2J4XA 3NBHA 2Q8IB 1BBXC 3KF8A 2ZT9C 4C2MB 4RGOS 4EVOA 1LTTD 3I8ZA 3NTKA 1HCZA 2PZUA 4ZUIA 1DONA 3GTGB 1I4PA 4LMQD 4PNYA 3S1MB 4HSPA 4K5XA 4WJWA 3GP7A 3MAQA 1PRTF 4BA1I 3JAML 1V1PA 3TP8A 4IFDI 2V4DA 1RJTA 5ELEA 2JA7B 5KGUA 3U9SA 1CK1A 1EFID 1VDZA 3OW7A 4F87A 1DOKA 2OF1A 1F9RA 3GTJB 1TT2A 1G91A 4WRDA 3CU7A 1STYA 2E2HB 2B2TA 5FLXE 2EPBA 3Q22A 5C3XA 1AFPA 2F0OA 5DM63 4IUVA 3TZUA 2Z4HA 4N9PA 3HOXB 1Q90A 3PUXA 2PO4A 4FF3A 3FMCA 3NQIA 1KNEA 2AQ2B 4B9WA 2PMZB 2WIIB 4JK1C 5FLXL 4RCOA 2L0CA 4IN3A 4DN4M 1R4QB 1LLRD 2LMCB 4KN4C 3M3YB 1JWUD 3EA6A 1A2UA 4A3IB 4UAIA 4KD3A 5KRUA 2E2DC 3OMGA 3W3AA 3C1FA 3ZYYX 4KJNA 2JYOA 1I4QA 2B8GA 4ZYSA 1KLUD 2OXPA 3AB9A 3OIQA 5D14A 4TSSA 1YNJD 3AU7A 1SSOA 1SNDA 4X3UA 1V1OA 1NSNS 5CBAE 4RWSC 3HZXA 2FINB 1QCBD 3C2PA 1CT1D 3MFGA 3S1RB 5IT9E 1WD0A 3OWFA 1WTWA 3VA5A 3A8KE 2Z4IA 1A3VA 4IQZA 1NR4A 4DXGA 1PTOD 5FO8B 4CJ1B 5C4HA 5I9OA 2OT2A 3H3VC 2R61A 3GQBA 4CBVA 2EE1A 4KY6A 3MXPA 2EZVA 3R2TA 1HTLD 4FXGC 1HHVA 3PMFA 1GHKA 4RKBA 2LS01 4HAEA 2TSSA 4A3BB 2EY5A 1SYGA 5JJZA 4DAVA 3DMUA 4CJ0B 4C3JB 2KEEA 1DYQA 4KMUC 1EZ6A 2RDHA 2B2VA 3V05A 2VB2X 2WAQB 3QO2A 1YNNC 2WACA 3T51B 1BUVT 1D1IA 4CHTB 2E76C 1AW7A 4IALA 4IFDG 2NTTA 1VCIA 5IGGA 3ITPA 1B3AA 2VUMB 1SMYD 3EQLC 1AEXA 1RCVD 2JA8B 4FF2A 1EYDA 4NKLA 1X3QA 2HCCA 1Z47A 2EYFA 1FNVA 3PUYA 3TN2A 2A6HD 3K6OA 3G7LA 2EY2A 4OL7A 2B63B 1B50A 4F88A 4KKUA 3D31A 3I3CA 5G3LD 4B08A 4IUPA 1TWHB 1Q1BA 1GHJA 2E74C 3A56A 4XYQA 1SFOB 3HOUB 2XVSA 5FKAC 2KCNA 5DEHA 4ULLA 4X3KA 3GTQB 1B44D 4FNFA 1RKNA 1KNAA 1SEBD 3NP8A 3E6ZX 1BCPF 2N88A 3EFXD 1ET6A 2XWJB 4QMGA 4G4KA 1T5XD 4RKLA 5M5WB 1SYEA 4GZYC 1XYIA 3M85A 5LHY1 4L63B 1GJXA 4FXKC 2F0VA 3S9WA 3HOVB 1CQVA 4C1NI 3NE5B 2NVTB 3SK6A 3SHLA 3E0JA 2RSOA 3PUZA 3TMEA 2BA0A 2N55A 2JA6B 2NN6H 2EDGA 2PZWA 4E6IA 3I4LA 1JE4A 1BCPC 1CA5A 2D62A 5EPLA 2NTSA 4F7XA 4OO1I 1A2TA 3AMUA 3MVVA 1C8CA 3VYSA 1KTKA 1TKWB 5C0XJ 2O5JC 2NBFA 2F0FA 5KNBA 1WCMB 1IKMA 2K5DA 4V190 3EROA 3DXJC 1X3PA 3DWQA 2SNMA 3GTLB 2K28A 2R3ZA 3ND8A 1GUSA 3Q23A 4DGZA 1JOQA 1VMCA 2DY7A 1EWCA 3URYA 2JXMB 1LTBD 2NN6I 5EPJA 3SVMA 1HTPA 2I46A 4KV6A 3O13A 3K5MA 1VMPA 1CZGA 1I4RA 1XWEA 2A74C 2M2LA 3P7JA 2C5CA 1A6XA 4HCSA 2ZXPA 4ZUJA 4KHZA 3S2HB 4RA8A 2BE5D 3OWEB 2NVQB 3MXNA 1PTOH 1EQVA 2RA4A 3K5LA 3CKIB 1W6JA 1Y1WB 3SDZA 3A7LA 3QOLA 4KTAA 2PW5A 2KVMA 2YU9B 2NUCA 2YYZA 4TKOB 2BCOA 2JA5B 1Y8NB 3TBIB 3T16A 1MSHA 1S5DD 4DXFA 1A3UA 2F03A 5NUCA 3T4AC 1ICWA 4K2LA 1DCZA 4EQPA 3KBGA 1O78A 3N52A 1MBYA 1STGA 3BYTB 2CVRA 4L6TB 2L11A 1CQFA 5FK9C 2KJXA 4P2CB 3KLSA 1K83B 4RGMA 2J7ZA 1M4VA 3KUPA 1RODA 2ZXRA 5IGFA 4ZKBB 1SYDA 5CGKA 1F2YA 3SK4A 1RTNA 2SOBA 3KK7A 1PZKD 2EYHA 5CBEE 2LFNA 2QKIC 2NB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBF A;  2MHV A;  2KCN A;  1AFP A;  2NB0 A; 
#chains in the Genus database with same CATH topology
 1NAP A;  4CKB A;  4XDX A;  1Y14 B;  4JW0 A;  2B2V C;  2KOL A;  1HUM A;  5EKK A;  4JI6 Q;  3I73 A;  1SMY C;  2F0J A;  1U4L A;  3EBE A;  2VS1 A;  3WOE A;  4R4Q A;  1PTO C;  5T1G A;  1LTS D;  1OXV A;  2HCI A;  2K52 A;  2F0H A;  2J0T D;  2IJ0 A;  2PMZ E;  4AYB B;  1WTP A;  3J81 i;  5I6Y A;  3D6C A;  1FD7 D;  5C4X G;  2R92 B;  1G6Z A;  2Q2H A;  5E1F A;  1SNO A;  4A4I A;  5ELC A;  4TRD A;  1S4Z A;  4AH6 A;  4X62 Q;  1DOL A;  1A8V A;  1LTL A;  4XXE A;  2I0Q A;  2JA7 H;  1I3Q B;  2ICE C;  1WI5 A;  4BBR B;  4RGN A;  4L8J A;  4HJ9 A;  5DNF A;  3I4N B;  3M4P A;  2KA7 A;  1TWC H;  3CCV A;  3S2D H;  2EYO A;  4GLA C;  1C9O A;  1YIT A;  5KEE A;  3AFQ A;  4H7B A;  4CJ2 C;  5I6W A;  4C3H B;  3DLL A;  1JJG A;  1I4H A;  1N33 L;  3W1G A;  1TY2 A;  1H9S A;  4PV1 C;  5TSS A;  3K81 C;  1HNW L;  5K36 H;  1TY0 A;  4DR3 Q;  4ODG A;  3R2I A;  1SE2 A;  4DF7 A;  1LT4 D;  5A35 A;  4B3M Q;  1GD7 A;  3J7A F;  3RZO H;  2PQE A;  1PH8 A;  4FP5 D;  3WOF A;  3V2T A;  1IL2 A;  5J3B A;  2AWN A;  4NPS A;  3K57 A;  4N9T A;  1TQO A;  2IX3 A;  2F0M A;  4QUF A;  3KF6 A;  2JP1 A;  1O7I A;  1CZW A;  3SXH A;  2HDL A;  1CHQ D;  5K5P A;  1D8L A;  3UDG A;  1OO9 B;  3KBX A;  2BDO A;  4ID6 A;  4DV0 Q;  3Q6S A;  2R7Z B;  3A55 A;  3RZD B;  5COY A;  3GV3 A;  1ML0 D;  2EJG C;  3TS2 A;  1B4O A;  2KEN A;  1AZP A;  3CRK C;  4ZKC B;  4G7O C;  2E2I H;  1SYC A;  1YHB A;  1ONL A;  3STB C;  4OX9 Q;  4DK1 A;  1FYC A;  3U9O A;  5GQO A;  1IYU A;  2JA5 G;  1JIC A;  2IPK D;  1SNM A;  1E2W A;  1EYA A;  1TII D;  2PYK A;  4H44 C;  2Q8R E;  1HXY D;  5C44 B;  4A3K G;  4NB3 A;  1PV4 A;  1PMR A;  3CPF A;  4IFD H;  3HOU H;  5FLX c;  2NVX B;  3EN2 A;  3I4O A;  1S3O A;  2VY3 A;  3M9B A;  1R9T B;  3MEF A;  4O42 A;  5D3D A;  4JI4 L;  4FVM A;  3GTO H;  1PVO A;  1GUN A;  4LFC L;  4L5R C;  1X32 A;  1EY6 A;  2E2I B;  2RDF A;  5EJW A;  2FMM A;  4MTK A;  5J1Z A;  1K73 C;  4KN7 C;  4C3I G;  5D3I B;  4IUR A;  2JA6 G;  1PH6 A;  4IPG A;  3K7A B;  3NWS A;  3S1R H;  4DR6 L;  5C44 H;  1NMF A;  1MHW C;  3J81 E;  3OW2 A;  4OGQ C;  1O80 A;  4QF4 A;  4NXM Q;  3HGB A;  1HQM C;  3NWT A;  2F4I A;  1VF7 A;  2IHF A;  2NVX H;  1A3T A;  1WYD A;  4A3D B;  5M5W H;  1EY9 A;  2AUJ D;  2JSO A;  3GTO B;  4N8X 1;  1QNK A;  1F9P A;  2XIW A;  4DK3 C;  1QVG A;  3G6J B;  3P75 A;  3RLN A;  1TS3 A;  2N3S A;  4R9W A;  2A19 A;  3I91 A;  3SGI A;  1QNU A;  1LAC A;  4LFC Q;  2IX1 A;  2EXD A;  1EU3 A;  2MUY A;  2KED A;  5GRO A;  5JVG 3;  2YTY A;  2PPB C;  2F0T A;  1PFS A;  2GA4 B;  2P5Z X;  2K5Q A;  3J81 L;  3S14 B;  1VS0 A;  3KF6 B;  3MEH A;  4XIG S;  5CV4 A;  1PH3 A;  1XNQ Q;  5CV8 A;  1FGU A;  1EY0 A;  1QWY A;  1EOT A;  3MXN B;  4UDU C;  3VYU A;  2JN4 A;  2WKC A;  4Q5V A;  5BR8 Q;  4LUO A;  1E2V A;  1KDC A;  1F2L A;  5CV7 A;  5IIF A;  4KD4 A;  2ZJR A;  1YZ6 A;  1RIP A;  1KC8 C;  1DM0 B;  3EVQ A;  1EIF A;  3RN2 A;  1ENA A;  4C3I B;  1ILQ A;  3NXW A;  3M4O H;  2EVB A;  2IT1 A;  1BQQ T;  1VQB A;  4LF7 L;  3VR4 A;  3HOZ H;  5D65 A;  4B9X A;  5M3M B;  2XNA C;  2A69 C;  4M1U B;  2VUM H;  3GTP B;  5LL6 X;  1EIH A;  1KDA A;  2H1E A;  2XN9 C;  4CDF C;  5IGB A;  3OTO L;  3M4Y A;  1HZC A;  3TP7 A;  4QCL A;  3VYT A;  2F0D A;  5C5L A;  2O4X A;  3NK9 A;  2WB1 E;  3J80 L;  3M4Q A;  1OXU A;  4K6D A;  2I5M X;  2CQA A;  5ELB A;  4BY1 G;  4ZK9 B;  1MD2 D;  2EYL A;  5ISR A;  2UXC Q;  4DA2 A;  1ENC A;  1I5F A;  5KYI A;  4LF7 Q;  1I6H H;  3J7Z C;  1PH1 A;  4DUZ Q;  1S5B D;  1K8G A;  4A3K H;  4DR5 L;  5AJ3 L;  1AH9 A;  4A3J H;  1Q86 C;  1QUQ B;  2WIN B;  4J1M A;  3LWE A;  2HT1 A;  4YHH L;  4X62 L;  2LKV A;  2NVY B;  1YJN A;  2E5L Q;  2Q2T A;  3QG1 A;  2VNU D;  1GUT A;  2F0U A;  1PRT B;  1QOH A;  3D3R A;  1LTG D;  1Y1V B;  1IZ6 A;  4DUY Q;  2RSN A;  1KAA A;  1RF2 D;  1Q3L A;  2O5I C;  2UU9 Q;  5JOB A;  3NQT A;  4DNT B;  2UUC L;  3BVM A;  1EYC A;  2F0G A;  2UXC L;  3VR3 A;  3RLF A;  2LXK A;  2PI2 E;  2XRQ D;  3BZC A;  3H6M A;  1DD2 A;  4GS3 A;  4A3J B;  3MXU A;  1MIU A;  2K6A A;  1K8M A;  3HKZ E;  3DWA A;  1NY4 A;  4P74 A;  3F1Z A;  5EKI A;  1CTM A;  2BOS A;  3V96 A;  2B2U A;  2DY8 A;  3MXG A;  3NBI A;  2EY6 A;  3K59 A;  5JAV A;  1II3 A;  1BNZ A;  3GO5 A;  1PDQ A;  4UP7 A;  4NP5 A;  4PMC A;  4YCV A;  2CQO A;  2K5H A;  1Y8O B;  1NJI C;  1XXG A;  4DV3 Q;  1HFN A;  3I55 A;  2K1B A;  3DEO A;  3SR1 A;  3X3N A;  4Y52 H;  1Q8K A;  1C7Y A;  4IUN A;  5C6A A;  1EY5 A;  5EBC A;  4HSV A;  4PZ6 A;  1ZYR D;  5LMN Q;  1KAB A;  4JCV E;  4B3R L;  4Q0F A;  3K58 A;  3J7A 5;  4DU9 A;  3A8I E;  3P1H A;  1STB A;  4OO1 H;  3CHB D;  4NMZ A;  1OXT A;  4XQJ A;  4JPB W;  2B2Y C;  2K7V A;  4DNR B;  3K8A A;  1GUO A;  4HTH A;  1PFB A;  4X65 L;  4JVZ A;  4EQO A;  2HD3 A;  1CKN B;  3W1B A;  1WTQ A;  2KCC A;  2VXW A;  2K32 A;  2B2W C;  4HID A;  1SJE D;  3IL8 A;  2CFM A;  1Y69 U;  5JJL A;  2MGS A;  3OYY A;  2HHH Q;  2OQ0 A;  4HED A;  3F2U A;  1CKO A;  4LJZ C;  2NWG A;  1PH7 A;  2SDF A;  1I50 H;  1S5E D;  3ER0 A;  4X65 Q;  4B3R Q;  5EGT A;  2RCF A;  1VQ6 A;  5GAH C;  3PQI A;  2JQO A;  3I70 A;  3KFU A;  4A3M H;  1SN8 A;  2GVA A;  4IFD J;  5E3F A;  1LTR D;  1WCM G;  3ERS X;  4JI2 L;  1CUK A;  1A63 A;  2ZXO A;  1DOM A;  5LL6 S;  1D6E C;  3OOC A;  5BN5 A;  4LFA Q;  4GLV B;  1S5F D;  2QA4 A;  4YY3 Q;  4EGV A;  1SDF A;  1GUG A;  2CKZ B;  4C2M H;  1PFM A;  1XPO A;  4GKK L;  4CKE A;  1CKN A;  1KLG D;  3DWP A;  4NW2 A;  5A2Q L;  2E2J B;  1F2M A;  1I4X A;  3L9A X;  5CV9 A;  4HCE A;  1QIL A;  3HEJ A;  3GTG H;  4OEM B;  2F1M A;  3RUZ A;  3UDI A;  4A3G B;  4DV1 L;  3U58 A;  3NHH A;  1NCV A;  3HG9 A;  5KNC A;  2ZTE A;  4LF8 L;  1SYF A;  3RD4 A;  5JEA J;  3I4N H;  1OXX K;  1F77 A;  4LAA A;  3I4N G;  2OCE A;  1XPU A;  4U67 3;  4LF5 L;  3DEP A;  3AQQ A;  1Y8P B;  3PF5 A;  4YWL A;  1D5X C;  1Y1W G;  3LWU A;  2E2J H;  4BBS H;  1STE A;  4FF4 A;  1T9H A;  1D5M C;  5IGD A;  5JPN C;  5C4X H;  2EJF C;  1TWG B;  3FKI B;  3BDC A;  4A3I H;  3BYY B;  1IW7 D;  1E1T A;  2VZA A;  2Z8L A;  3DUZ A;  1H9K A;  2M00 A;  4A3F B;  1O7Z A;  4DV0 L;  3SK8 A;  3U50 C;  2O2L D;  4OO1 G;  1X56 A;  2KCM A;  2HIX A;  2AMC B;  4R4C A;  4JI3 L;  5IP7 H;  2AQ1 B;  1JE5 A;  3R8B A;  5HGT A;  2F0P A;  4IZ8 A;  4NXM L;  2RVL A;  1SXT A;  1VQ7 A;  4OXP A;  2F3V A;  2A68 D;  3R93 A;  3UE0 A;  3T13 A;  4RG1 A;  2RF4 A;  4CDE C;  1C48 A;  1XJV A;  2EYM A;  1F2Z A;  4JI8 L;  4AQY L;  2DUD A;  4DR4 L;  4P75 A;  3PO2 H;  1K0S A;  1HPC A;  3TSS A;  2JEB I;  1BBU A;  1MI2 A;  1YNN D;  5H1S E;  1EZ8 A;  1SRO A;  3RR5 A;  2I07 B;  4A3B G;  1L0Y B;  1EWH A;  1STH A;  4K2K A;  1HNX L;  4UP9 A;  3TDQ A;  1YNJ C;  4A3E H;  2YTX A;  3BVG A;  4K14 A;  4DR2 L;  4A3E G;  1NR2 A;  2EOT A;  3BDO A;  4H13 C;  1EIY B;  2BDN A;  3ULJ A;  5KIX A;  3PO2 B;  1K8O A;  4JI3 Q;  1TVX A;  2NZ1 D;  2F0L A;  4JBK A;  2UUC Q;  3E9I A;  5EKL A;  3UI2 A;  3CQZ H;  3D8G A;  4IO9 A;  2CH4 W;  4GLX A;  5IP9 G;  1PRT D;  1L0W A;  1LT6 D;  2VQE Q;  1H9J A;  5IOC A;  4JI8 Q;  5KND A;  1L2F A;  5CC4 A;  1Q12 A;  2MJ8 A;  1SMX A;  3PO3 B;  5CR3 A;  3FKI G;  1HA6 A;  4KK7 A;  1U4R A;  1R4P B;  4MIU A;  1VQA A;  2H5X A;  4LK1 C;  3ND9 A;  1W6K A;  4XT3 B;  1L0X B;  1TXY A;  1X55 A;  5IYD H;  1X54 A;  1CFM A;  1CA6 A;  4H0L C;  2DJF C;  4LF4 L;  1NUC A;  4A75 A;  4DAY A;  2PNH A;  1HZ9 A;  4XYO A;  4JI7 L;  4JBJ A;  2F3W A;  4DR5 Q;  5AFW A;  3SE0 A;  3OMC A;  2A5H A;  1TWC B;  1TWA H;  3S2D B;  1JB3 A;  4MHE A;  2F0K A;  1J6Q A;  3OSO A;  2X6L A;  1KRS A;  1XX8 A;  5J39 A;  3S1Q B;  2RBM A;  5FOB B;  1EEI D;  3R3O A;  4BBS G;  2K33 A;  5J22 A;  4DUZ L;  3T53 B;  4X3S A;  3LX0 A;  3K5N A;  2ZJP A;  2DNE A;  1BO0 A;  2QCP X;  2L5T A;  3PSI A;  3HOW G;  4FXD A;  3RZO B;  2WB1 G;  3ICE A;  5C3E G;  4BBR G;  2QEX A;  4ZQ3 A;  1UUP A;  1QE6 A;  5C5M A;  1TWA B;  3A7A B;  4G7Z C;  1RDP D;  2Y0S B;  1K8A C;  5BN3 A;  1BOS A;  3CCQ A;  1FGB D;  5JEA H;  2K05 A;  1TWH H;  5HY6 A;  3A5U A;  2AUK A;  4APV A;  2X6G A;  2CHB D;  4JI7 Q;  4BA2 I;  4IJH A;  4J8Q A;  1K28 A;  3E0E A;  3J80 i;  3RZD H;  4DK6 C;  2B2W A;  2A8V A;  2IWH A;  1EY4 A;  4K5V A;  1M8A A;  1ESF A;  2I5L X;  1U0L A;  4OWT B;  4A3L H;  1X3G A;  5JEA G;  1Q81 C;  1JOK A;  3OPO A;  4KY7 A;  4DR1 L;  3J81 j;  2KBN A;  1Z6H A;  2E75 C;  3ONA B;  5IGC A;  3HOZ G;  5GAD C;  5EQ0 A;  4AYB E;  4A3K B;  4DV4 Q;  2EQS A;  4XTC S;  3FPP A;  3RMH A;  2F3I A;  3SK5 A;  1ZEQ X;  1S5C D;  3N6R A;  3I4M B;  3L3O C;  5I2Y A;  4BY7 H;  1D7Q A;  1WVL A;  5BN4 A;  5CMD A;  4QL5 A;  3CRL C;  4MTN A;  5K36 G;  1STA A;  1MSG A;  2WAQ G;  1SE3 A;  1WTR A;  1Y1V H;  2F0S A;  2K14 A;  5IYC G;  3HOW B;  4DNI A;  1H9S B;  1YJ9 A;  3KDF A;  3QJY A;  4ME3 A;  3JAM i;  5M9O A;  2MPM A;  4DV5 L;  2Y0S E;  4IPC A;  3DM1 A;  3CC7 A;  4EQ5 A;  1XNR Q;  4YWM A;  2IX0 A;  3F8T A;  2OQK A;  5T1I A;  1E0B A;  1UE6 A;  2HQL A;  4BY7 B;  4C3H G;  3S15 B;  4FDB A;  3PIO 3;  4MNO A;  2Q2I A;  5G3L F;  3D6W A;  4Z9C B;  1XMQ Q;  5DM7 3;  4I65 A;  1HZB A;  5F2D A;  4Y7N H;  2JEA I;  1K3R A;  1QVF A;  3GTQ H;  4QGU A;  2WB1 B;  2FHT A;  1VQK A;  2M9V A;  3PIP 3;  4PMW A;  4OIJ A;  3I90 A;  5C3E B;  3BZK A;  5HGQ A;  1G6P A;  1GXD C;  2CW0 D;  2Z0S A;  3JAM E;  1JQY D;  2EXZ A;  4K0K Q;  3D4D A;  2SNS A;  4A3D G;  2EYJ A;  3S15 H;  3BG3 A;  4DPG A;  1BR9 A;  2Z6K C;  4RCN A;  3A54 A;  3F2B A;  1VQN A;  4HMI A;  2G9H D;  2JA9 A;  4JV5 L;  2L12 A;  2QEJ C;  1B2T A;  3TRE A;  3IKJ A;  5DLQ E;  3GTL H;  2Z6B A;  1B9M A;  5IGE A;  1JWM D;  4XQQ A;  3VR6 A;  3T1H L;  5C3E H;  4DR3 L;  5FO7 B;  1B3Q A;  4C3I H;  2FJ2 A;  1W3S A;  1JT8 A;  4RH6 A;  1LT5 D;  1PLF A;  3W2D A;  1YNX A;  1G8Z D;  4LF9 L;  1KIX A;  4K8J A;  2B2T C;  1HNZ L;  4NXN Q;  4CGY B;  1SNP A;  5FO9 B;  3HOZ B;  1GOZ A;  1IYJ B;  5IWA L;  1BVS A;  1V8Q A;  1QB5 D;  3W5O A;  2CW0 C;  4A3I G;  1WTX A;  1IHZ A;  3TRZ A;  1I50 B;  5DAU A;  1MGS A;  1PXU A;  1J8I A;  2VQF Q;  3PIO A;  4A3M B;  2WP8 J;  1TS4 A;  1UNS A;  3S1M H;  1E2Z A;  3TS0 A;  3L0O A;  4JBM A;  1B8A A;  2Q8T A;  4KKT A;  1HNW Q;  3BZD B;  2NN6 G;  1I6H B;  2OTL A;  1CHP D;  1HUN A;  4JI2 Q;  4M8A A;  1CM9 A;  3CC2 A;  1WTH A;  3FDT A;  2B8F A;  3PO2 G;  3PF4 A;  3NTH A;  1JCK B;  1N34 Q;  4DR6 Q;  4A3G H;  4YWK A;  5M3F B;  1D5Z C;  2NVY H;  1LO5 D;  1ZXT A;  4LF4 Q;  2VQF L;  1LT3 D;  3LGJ A;  2C9O A;  2G9D A;  5I4D A;  1N36 L;  2B2Y A;  3L7Z C;  3U4Z A;  5LMU Q;  2EY1 A;  5C3W A;  3GTJ H;  1H95 A;  2R93 H;  4P73 A;  1GM5 A;  4JI6 L;  2QIL A;  1IBK L;  4A93 B;  1IXR A;  1UEA B;  3PUW A;  3NEN A;  4O0A A;  2MHV A;  4HJ5 A;  4HMJ A;  3C46 A;  2IHE A;  5IT9 c;  3A74 A;  5C4X B;  3HOU G;  1KDB A;  3FKI H;  3H91 A;  1EFW A;  3Q8D A;  2VW9 A;  1SLJ A;  4YIJ A;  2B29 A;  1EY8 A;  4ABN A;  3HOX H;  4QB4 A;  2R93 B;  1SJH D;  1PTO B;  5JVH 3;  4P72 A;  2L1B A;  1KRT A;  2F4V Q;  4X6A H;  5EAY A;  4A3F H;  4A93 H;  4GOP A;  2PZT A;  1Y1W H;  4LF6 L;  4HR7 B;  4S3S A;  2QDB A;  2K01 A;  3VYR A;  5LMU L;  1QG7 A;  4RHR A;  4OON A;  4DR7 Q;  4QIW B;  2A6H C;  2UXD L;  2N49 A;  3VA7 A;  1I4G A;  4DR4 Q;  2QF7 A;  3IFD A;  3KLR A;  2ICI A;  1IBL L;  3J7A V;  3WDN A;  4L5T A;  4K6L A;  1B7Y B;  2R7F A;  4QIW E;  2ATW A;  4DV6 L;  2K50 A;  3BVZ A;  3HOY H;  2UXB L;  5CYU A;  1O7L A;  3GDE A;  3GTM H;  1SNC A;  2K04 A;  1Q1E A;  3K0Y A;  4PMB A;  2KUM A;  4IPH A;  3H0G H;  3BS1 A;  4KKS A;  2UUA L;  3IFT A;  4AIM A;  1FR3 A;  3CXC A;  3A5Z B;  1LTA D;  1QZH A;  4B3T Q;  3CC4 A;  1XTD A;  2RHQ B;  2JA8 G;  1JOR A;  2IW3 A;  4ME5 A;  4F8M A;  3M7N A;  2ZM6 Q;  1J5E L;  3NEL A;  1PH2 A;  3Q24 A;  2ZJQ A;  2BA1 A;  2D9U A;  3TEH B;  1EQT A;  3ERQ A;  1IBL Q;  4CDC C;  2LSS A;  4WFN 3;  1MJE A;  3D4R A;  3ZJY C;  3HOY B;  4IUQ A;  5C4J B;  4LFB L;  4GN3 B;  2ENB A;  2YTV A;  1ASZ A;  1QUQ A;  4PZ7 A;  1HA5 A;  3UDX A;  4R4O A;  4DAP A;  1DJR D;  3H0G B;  4A76 A;  3S16 B;  3MA2 B;  3CQZ B;  4EX5 A;  2LXJ A;  2C35 B;  4KHP L;  4BBR H;  1HH2 P;  4X3T A;  2RCN A;  2RQX A;  2K4K A;  1C4Q A;  1JWS D;  1CSQ A;  1SE4 A;  1L1O C;  3CCS A;  3A8J E;  2AWO A;  4A3J G;  3MFY A;  1JOO A;  3NSW A;  2K75 A;  2XWB B;  1Q8I A;  4CDD C;  5C4J H;  4B3T L;  4I7A A;  1TS5 A;  2PW7 A;  5COR A;  2D5D A;  1QJO A;  1P16 A;  3CCR A;  1E22 A;  3E5S A;  5I9P A;  4DFA A;  3BDL A;  4A3M G;  1GO3 E;  2KEC A;  5IE8 A;  1HRJ A;  5E4W C;  2L55 A;  3NUC A;  1SYB A;  3D4W A;  1X3F A;  3OTO Q;  5C0X G;  3FRP B;  2ID0 A;  4K0K L;  1EU4 A;  1BF4 A;  2RKS A;  2ZTD A;  1FVI A;  1BXT A;  5L37 A;  4EQN A;  3M7G A;  4XQN A;  1PTO F;  2HQE A;  4RAU C;  4C3J H;  4C1N K;  1ZYR C;  4BBS B;  1EYG A;  3KLS X;  4G7H C;  3QIA A;  5I2X A;  4A3G G;  4ZCK A;  1TWG H;  4BS9 A;  2ASB A;  1I3Q H;  4NDX A;  1K3B C;  3K7U C;  3LNN A;  1V9P A;  3HKZ B;  5LMN L;  2Z9H A;  1I6V C;  2A6E C;  2QGQ A;  1X9N A;  5EPK A;  2KCT A;  4R8I A;  5E7N A;  5IWA Q;  4C3H H;  3MWY W;  4PQX A;  3I7F A;  2R6G A;  1M90 C;  2F0W A;  2JK8 A;  1VQ9 A;  5ELD A;  1PZJ D;  3MHB A;  2Q2U A;  2PNR C;  1ILP A;  5GAG C;  1NNX A;  2RDG A;  4HIO A;  2E5L L;  1LAB A;  1RTO A;  2KQ3 A;  1WTV A;  1JC7 A;  2TMP A;  1ET9 A;  3TP6 A;  5CV5 A;  3QB3 A;  1XMQ L;  4GN5 A;  3KF8 B;  2IL8 A;  2X69 A;  3H3V H;  4IOC A;  4WJ3 M;  4IUT A;  1B53 A;  1SBB B;  4R1J A;  2A68 C;  1U4P A;  1CI3 M;  1LUZ A;  5GAE C;  1ZKO A;  4TVA B;  4A3E B;  2KHS A;  2R92 G;  1H9M A;  3J81 c;  2F0E A;  3FPU B;  3ULP A;  3GTK B;  1BCP B;  4K5W A;  3PV0 A;  1NE3 A;  3T56 B;  3G4S A;  4GNX A;  3C3L A;  4LFA L;  1ESR A;  1HFG A;  3MC0 B;  3UE1 A;  4BY1 B;  1VQC A;  5ELF A;  1IW7 C;  1PH9 A;  3S14 H;  3FVQ A;  3VR2 A;  1EL0 A;  3GV6 A;  1ENF A;  2WKD A;  4JI1 L;  4DAY B;  3G6E A;  2G5D A;  5IP7 G;  4J6H A;  3PO3 H;  4PG3 A;  3KJO A;  4WOR A;  4FO2 A;  1E7Z A;  1RD9 D;  1G2T A;  1XNR L;  5C0X I;  5E4X A;  3I72 A;  3EIV A;  3GTK H;  3P20 A;  4B3M L;  1BCP D;  2MP1 A;  2XSC A;  3X3M A;  2JE6 I;  4DV7 L;  4KLK A;  1IYV A;  4GKK Q;  4GNX B;  2BE5 C;  1MJC A;  3OHX C;  1AZQ A;  4H02 A;  1DZ1 A;  2EJM A;  4BY1 H;  4KY5 A;  2A73 B;  1XMO L;  2OEO A;  3HKZ G;  2CWA A;  1WD1 A;  5IP9 H;  1PA6 A;  1AE3 A;  3VR5 A;  4QUC A;  4BWG B;  1HJP A;  5M3M H;  4O1N A;  2UUB Q;  5HUR A;  2A1A A;  3KYH C;  1OXS C;  1KD1 C;  1S40 A;  1EOV A;  1FL0 A;  2F0Q A;  4I7Z C;  3RLO A;  3C1E A;  4XT1 B;  1J9O A;  2D2C C;  5IYD G;  2AKW B;  1BDO A;  4MN3 A;  3CW2 C;  1FNU A;  1HR0 W;  3J80 E;  1B9N A;  3FEW X;  4V0B A;  4IOA A;  1YJW A;  4POG A;  4FYD A;  2A69 D;  1BKB A;  2MNA A;  2MQH A;  2L4N A;  3Q0A A;  3CAM A;  1O7Y A;  5IT9 L;  3GD7 A;  2FMC A;  4HJA A;  2PCF B;  2WV6 D;  1F9Q A;  1PZI D;  2A6E D;  2FFK B;  1A15 A;  4KJO A;  3HKS A;  4C3J G;  2K5W A;  4ILW A;  3CD6 A;  4RGT A;  5IY0 A;  3OIP A;  3H94 A;  3TP5 A;  1OTC A;  4B3S L;  1XTC D;  1RL2 A;  3H09 A;  3G48 A;  3IRB A;  3M4O B;  1Q46 A;  1GUW A;  1D2B A;  5KYL A;  4N8F A;  5JPM C;  1TWF B;  4R4I A;  1WTO A;  5EBD A;  4A93 G;  4R8N A;  2QW7 A;  2HUG A;  4LW1 A;  4ALP A;  5M5Y B;  1F9S A;  2F0I A;  2UXD Q;  1JMC A;  3T1H Q;  1E1O A;  2F4V L;  1B1Z A;  4K8I A;  3TZD A;  3K5O A;  4JG2 A;  1LM0 A;  4LF6 Q;  1DXM A;  3SEB A;  1FNW A;  1PFN A;  1VQ8 A;  1H9R A;  2B2U C;  2D0P A;  4WJ4 A;  4G57 A;  1SAP A;  2K03 A;  2L9H A;  4OIK A;  1AN8 A;  1BBW A;  1TWF H;  1D1K A;  2DNC A;  3MTS A;  1IBK Q;  1HQR D;  5M5X B;  1VQ5 A;  5JJI A;  3MZ5 A;  3DHQ A;  1EIG A;  2NYZ D;  3IAY A;  4TQU S;  4RFB A;  3U4V A;  5C0X H;  3J7Y W;  4NXN L;  2K5N A;  4DV2 Q;  2HDM A;  4ZAI A;  1VQE A;  1IL8 A;  3EJI A;  2UUA Q;  5A2Q E;  1CSP A;  3PIP A;  1G29 1;  3S1N B;  4CKC A;  1UWV A;  2EYP A;  1PHJ A;  5ELO A;  1TS2 A;  1CKM A;  1Z7T A;  4Y7N B;  2JA5 H;  2SEB D;  1LV9 A;  4RHS A;  4ZRZ A;  1RHP A;  4HN7 A;  1VQJ A;  3S17 H;  4LF8 Q;  2VB3 X;  1G2S A;  1SNQ A;  5CV6 A;  4FF1 A;  4U68 A;  2Z1C A;  3HS0 C;  4GOP B;  2F0N A;  1U9R A;  1EY7 A;  2PQA B;  1VF5 C;  4X66 L;  4OHJ A;  5C4Z A;  3PUV A;  3QWN A;  2CWP A;  2DGY A;  4C56 C;  3NPP A;  2AQ3 B;  1PH4 A;  3S1N H;  1JB7 A;  1HNX Q;  1PYW D;  1L1O A;  1U4M A;  5IYB G;  4JYA Q;  2XRS D;  3NTI A;  4ZLT F;  1DGS A;  1TR5 A;  2DN8 A;  4KHV A;  5IOD A;  1EEF D;  1IKL A;  1TU2 B;  3GTM B;  4DR7 L;  3S17 B;  1UAP A;  2B39 A;  1V43 A;  1IBM L;  4X64 L;  1VQG A;  1VQF A;  1YHA A;  4GKJ L;  1XNQ L;  3HOX G;  1AP0 A;  1PRT C;  2B63 G;  3HP3 A;  2L15 A;  1LTI D;  1V1P B;  4JBW A;  1T5E A;  2ZM6 L;  5LMN W;  2LY7 A;  3HRZ C;  4IUU A;  1JR0 D;  3QOJ A;  2VQE L;  4JI4 Q;  4UY8 C;  4KI0 A;  4DK0 A;  5AJ3 Q;  1STN A;  2H4O A;  2J4X A;  3NBH A;  4AYB G;  2Q8I B;  3F2D A;  2R7Z G;  1BBX C;  3H3V I;  3KF8 A;  2ZT9 C;  4C2M B;  4RGO S;  4EVO A;  1LTT D;  3AEV A;  3I8Z A;  3A0J A;  3NTK A;  1HCZ A;  2PZU A;  1FJG L;  4ZUI A;  5IYB H;  1DON A;  4L5Q A;  1KL9 A;  3GTG B;  3S16 H;  2NZO A;  1I4P A;  4LMQ D;  4PNY A;  3B6Y A;  3S1M B;  4HSP A;  3RNU A;  4A3C G;  4K5X A;  4WJW A;  5C44 G;  3GP7 A;  3NBH B;  3JAM c;  1NTG A;  4OWX B;  3MAQ A;  1PRT F;  4BA1 I;  3JAM L;  4X64 Q;  1V1P A;  2E2H H;  4GKJ Q;  3TP8 A;  2UXB Q;  1VQL A;  3KJP A;  2Z6K A;  4LWC A;  3QR8 A;  2V4D A;  4IFD I;  1YI2 A;  2XTI A;  1RJT A;  4UHV A;  5ELE A;  1FJG Q;  5KGU A;  5M3F H;  4A3C H;  3U9S A;  2JA7 B;  1CK1 A;  3S2H H;  1EFI D;  1VDZ A;  2WFW A;  3OW7 A;  4F87 A;  1DOK A;  2OF1 A;  1F9R A;  3GTJ B;  1TT2 A;  1K0R A;  3JC6 6;  1G91 A;  4WRD A;  1YBY A;  1UE7 A;  3CU7 A;  1STY A;  2E2H B;  2B2T A;  5FLX E;  2EPB A;  3Q22 A;  5C3X A;  1AFP A;  4DV5 Q;  2F0O A;  4JI5 L;  3PO3 G;  4IUV A;  5DM6 3;  2Z4H A;  3TZU A;  3UDF A;  5ELN A;  1PYB A;  3WWV A;  4N9P A;  1M1K C;  3BJU A;  3H15 A;  4DV4 L;  3HOX B;  4UPA A;  1Q90 A;  3PUX A;  2PO4 A;  4FF3 A;  3FMC A;  4YHH Q;  3NQI A;  2UU9 L;  1KNE A;  2OWO A;  2AQ2 B;  4GNX C;  4LUZ A;  4B9W A;  2PMZ B;  2WII B;  4JV5 Q;  4JK1 C;  5FLX L;  4RCO A;  1QZG A;  2L0C A;  3CP0 A;  1AE2 A;  4IN3 A;  4DN4 M;  1R4Q B;  1LLR D;  4IJL A;  2LMC B;  4KN4 C;  3M3Y B;  4DV7 Q;  1JWU D;  3EA6 A;  1A2U A;  4A3I B;  1X65 A;  4UAI A;  4KD3 A;  5KRU A;  1HR0 Q;  2E2D C;  3OMG A;  3W3A A;  3C1F A;  3ZYY X;  5IYC H;  3KLW A;  1EUJ A;  4KJN A;  2JYO A;  1I4Q A;  2B8G A;  4ZYS A;  1KLU D;  2OXP A;  3AB9 A;  3OIQ A;  2MO0 A;  3T1Y L;  5D14 A;  4TSS A;  4DV3 L;  3HFZ B;  1N9W A;  1YNJ D;  3AU7 A;  1SSO A;  1SND A;  4X3U A;  2I5H A;  1V1O A;  3KDF B;  3CCE A;  1NSN S;  1R9T H;  1GKH A;  5CBA E;  4RWS C;  4YCW A;  3HZX A;  2FIN B;  1QCB D;  3C2P A;  1ICF B;  1CT1 D;  3MFG A;  3TQY A;  1MKH A;  3K7A H;  3S1R B;  5IT9 E;  3CPW A;  1WD0 A;  4BXX G;  3OWF A;  1YIJ A;  1WTW A;  4JI1 Q;  4A3D H;  4HIK A;  3VA5 A;  1VQ4 A;  4JI0 L;  3A8K E;  2Z4I A;  1A3V A;  4IQZ A;  1NR4 A;  4DXG A;  1PTO D;  5FO8 B;  4CJ1 B;  5C4H A;  1A62 A;  5I9O A;  1XPR A;  2OT2 A;  1N36 Q;  5FLM H;  2R92 H;  3H3V C;  2QDL A;  3PCO B;  1HNZ Q;  2R61 A;  3GQB A;  4CBV A;  2EE1 A;  4KY6 A;  2HHH L;  1WJJ A;  3MXP A;  3CF5 A;  4QJF A;  2EZV A;  4L5S A;  2AHO B;  3R2T A;  1HTL D;  4FXG C;  1B70 B;  2UUB L;  1HHV A;  3PMF A;  1GHK A;  1Z9F A;  4RKB A;  2LS0 1;  4HAE A;  2OTJ A;  2TSS A;  4A3B B;  1N8R C;  2EY5 A;  5M3M G;  1SYG A;  4J15 A;  3I2Z A;  3VDY A;  1VQM A;  2EIF A;  5JJZ A;  4DAV A;  3DMU A;  4CJ0 B;  4C3J B;  2DJG C;  2KEE A;  1DYQ A;  1VQH A;  4KMU C;  1EZ6 A;  2RDH A;  1VQO A;  2B2V A;  3V05 A;  2VB2 X;  2FXQ A;  2WAQ B;  3QO2 A;  1N33 Q;  1YNN C;  4AQY Q;  2WAC A;  4DV1 Q;  1I94 L;  3T51 B;  1BUV T;  1D1I A;  3FP9 A;  4CHT B;  2BH2 A;  2BH8 A;  2ZTC A;  4LF5 Q;  2E76 C;  1AW7 A;  4IAL A;  4GN4 B;  4IFD G;  2NTT A;  4A3B H;  1VCI A;  5IGG A;  3ITP A;  1B3A A;  3S1Q H;  2VUM B;  3STB D;  1KAW A;  1SMY D;  2XGT A;  3EQL C;  1AEX A;  1RCV D;  2E8G A;  1JJC B;  2JA8 B;  1EYD A;  4NKL A;  4FF2 A;  1XMO Q;  1X3Q A;  2HCC A;  3CCL A;  1Z47 A;  4OX9 L;  2R7Z H;  2EYF A;  2RHS B;  1FNV A;  3HOV G;  3PUY A;  3TN2 A;  2A6H D;  3K6O A;  3G7L A;  1K9M C;  2EY2 A;  1Y1V G;  4OL7 A;  2CH4 A;  2B63 B;  1B50 A;  1I94 Q;  4F88 A;  5FJ8 G;  3H0G G;  3AYH B;  4KKU A;  3D31 A;  3I3C A;  5G3L D;  4B08 A;  4IUP A;  1TWH B;  2PI2 A;  2ALY B;  5M5Y H;  4LF9 Q;  4A3F G;  1Q1B A;  1GHJ A;  2JA8 H;  2E74 C;  3A56 A;  4XYQ A;  2N8N A;  1SFO B;  3HOU B;  1S72 A;  3K0X A;  2XVS A;  1X3E A;  1VQP A;  1EQR A;  5FKA C;  2KCN A;  1X6O A;  1SE8 A;  1PYS B;  4HJ8 A;  5DEH A;  3PGZ A;  2B63 H;  1V1Q A;  4ULL A;  4X3K A;  4HIM A;  1EQQ A;  3HOV H;  3GTQ B;  1B44 D;  2IY5 B;  4FNF A;  1RKN A;  4JYA L;  1KNA A;  1SEB D;  3NP8 A;  3E6Z X;  1BCP F;  4BXX H;  2N88 A;  1KHI A;  3EFX D;  1ET6 A;  3DM3 A;  2XWJ B;  4JOI C;  4QMG A;  3BU2 A;  1SFO H;  4G4K A;  2V1C C;  1LYL A;  1T5X D;  4HJ7 A;  4RKL A;  5M5W B;  4KHP Q;  3I4M H;  1SYE A;  1YHQ A;  4GZY C;  2K5V A;  1VQD A;  1XYI A;  3CCM A;  3E3X A;  3M85 A;  5LHY 1;  4L63 B;  3F2C A;  1UE1 A;  2WAQ E;  1GJX A;  4FXK C;  4LNQ A;  2F0V A;  3S9W A;  3HOV B;  1QVC A;  4P71 A;  3HOW H;  1CQV A;  4DV6 Q;  1N34 L;  2R7D A;  4C1N I;  3NE5 B;  4DR2 Q;  4QQB X;  2NVT B;  3SK6 A;  1W2B A;  3SHL A;  4B3S Q;  3E0J A;  2RSO A;  3PUZ A;  3TME A;  2BA0 A;  1J5E Q;  2N55 A;  2JA6 B;  2NN6 H;  3FHW A;  2ES2 A;  1EWI A;  2EDG A;  2PZW A;  1C0A A;  4E6I A;  4LUV A;  1KQS A;  3I4L A;  3CCU A;  1JE4 A;  1BCP C;  1WCM H;  4LFB Q;  1CA5 A;  1YEZ A;  2D62 A;  3I4M G;  5EPL A;  2NTS A;  2NVT H;  4F7X A;  5BR8 L;  1SR3 A;  4OO1 I;  2N78 A;  1A2T A;  3AMU A;  3MVV A;  1Q82 C;  1C8C A;  2R93 G;  3VYS A;  1KTK A;  1UE5 A;  2B3G A;  3KOJ A;  2JA6 H;  1TKW B;  5C0X J;  2O5J C;  2NBF A;  4DV2 L;  4PZ8 A;  2F0F A;  5KNB A;  1WCM B;  1IKM A;  3AFP A;  1IBM Q;  1P8L A;  4JI5 Q;  3CME A;  4UP8 A;  1WFQ A;  3GTP H;  2K5D A;  3I56 A;  1UEB A;  4V19 0;  3ERO A;  3DXJ C;  1X3P A;  3DWQ A;  2SNM A;  3GTL B;  2K28 A;  2R3Z A;  3ND8 A;  1GUS A;  3Q23 A;  2GN5 A;  4DGZ A;  1JOQ A;  1VMC A;  2DY7 A;  1EWC A;  1WOC A;  4JOI A;  3URY A;  2JXM B;  4X66 Q;  4IPD A;  5FJ8 H;  3ULL A;  1LTB D;  2JA7 G;  2YV5 A;  2NN6 I;  5EPJ A;  3SVM A;  1HTP A;  2I46 A;  3RN5 A;  2NVQ H;  4KV6 A;  3O13 A;  3K5M A;  1VMP A;  2MO1 A;  1YVC A;  1CZG A;  4MZ9 A;  1I4R A;  1XWE A;  2A74 C;  2M2L A;  3P7J A;  4OEL B;  4YCU A;  1HR0 L;  2C5C A;  1A6X A;  4OWW B;  4HCS A;  2ZXP A;  3HOY G;  4ZUJ A;  4KHZ A;  3S2H B;  4O2D A;  3T1Y Q;  3J80 c;  2D0O A;  4RA8 A;  4DAM A;  2YU9 H;  2BE5 D;  3OWE B;  3K80 C;  2CCZ A;  2NVQ B;  2KHI A;  3MXN A;  1PTO H;  2MFI A;  1N32 Q;  1EQV A;  5M5X H;  4A3L G;  2RA4 A;  4DUY L;  3K5L A;  3E9H A;  3CKI B;  1W6J A;  1Y1W B;  3SDZ A;  1G51 A;  5FLM G;  2F52 A;  2VL6 A;  4DR1 Q;  3A7L A;  3QOL A;  4RMF A;  4KTA A;  2PW5 A;  1L1O B;  2GVB A;  2KVM A;  3S24 A;  2YU9 B;  1U5K A;  2NUC A;  2YYZ A;  2KHJ A;  4TKO B;  2BCO A;  3CCJ A;  2JA5 B;  1Y8N B;  1N32 L;  3TBI B;  3T16 A;  4JI0 Q;  1MSH A;  1S5D D;  4DKA C;  1SRU A;  4DXF A;  1K83 H;  1A3U A;  3L2P A;  2F03 A;  1E24 A;  1GVP A;  5NUC A;  5JJK A;  3T4A C;  1ICW A;  3M3Y H;  4K2L A;  1JJ2 A;  1DCZ A;  4JC0 A;  4EQP A;  4BY7 G;  2JJQ A;  1O78 A;  3KBG A;  1A0I A;  3D0F A;  1HZA A;  1ASY A;  3N52 A;  1MBY A;  1STG A;  1NMG A;  3G71 A;  1NBW A;  4YY3 L;  1E3P A;  5M3F G;  3BYT B;  2CVR A;  4L6T B;  2L11 A;  1KXL A;  1CQF A;  5FK9 C;  3CMA A;  1VQI A;  2NZH A;  2KJX A;  4GOP C;  4P2C B;  3KLS A;  1K83 B;  2Y0S G;  4RGM A;  2J7Z A;  1M4V A;  2VUM G;  3KUP A;  1ROD A;  2ZXR A;  4R4T A;  5IGF A;  4ZKB B;  1SYD A;  5CGK A;  1F2Y A;  2HIV A;  3SK4 A;  3NEM A;  1RTN A;  2SOB A;  3KK7 A;  2PQA A;  4QY7 A;  1PZK D;  2EYH A;  4POF A;  1PH5 A;  5CBE E;  2LFN A;  2QKI C;  1Q7Y C;  2NB0 A; 
#chains in the Genus database with same CATH homology
 1NAP A;  4CKB A;  4XDX A;  2B2V C;  2KOL A;  1HUM A;  5EKK A;  3I73 A;  1SMY C;  2F0J A;  1U4L A;  3WOE A;  1PTO C;  5T1G A;  1LTS D;  1OXV A;  2HCI A;  2F0H A;  2J0T D;  2IJ0 A;  4AYB B;  1WTP A;  5I6Y A;  3D6C A;  1FD7 D;  1G6Z A;  2R92 B;  5E1F A;  1SNO A;  5ELC A;  4TRD A;  1S4Z A;  1DOL A;  4XXE A;  1I3Q B;  2ICE C;  4BBR B;  4RGN A;  4L8J A;  5DNF A;  3I4N B;  2KA7 A;  2EYO A;  5KEE A;  4H7B A;  4CJ2 C;  5I6W A;  4C3H B;  1I4H A;  1TY2 A;  1H9S A;  4PV1 C;  5TSS A;  5K36 H;  1TY0 A;  4ODG A;  3R2I A;  1SE2 A;  4DF7 A;  1LT4 D;  5A35 A;  3J7A F;  2PQE A;  4FP5 D;  3WOF A;  3V2T A;  2AWN A;  3K57 A;  4N9T A;  1TQO A;  2IX3 A;  2F0M A;  4QUF A;  2JP1 A;  1CZW A;  3SXH A;  2HDL A;  1CHQ D;  5K5P A;  1OO9 B;  3KBX A;  2BDO A;  4ID6 A;  3Q6S A;  2R7Z B;  3A55 A;  3RZD B;  5COY A;  3GV3 A;  1ML0 D;  2EJG C;  1B4O A;  1AZP A;  3CRK C;  4ZKC B;  4G7O C;  1SYC A;  1ONL A;  4DK1 A;  1FYC A;  3U9O A;  1IYU A;  1JIC A;  2IPK D;  1SNM A;  1E2W A;  1EYA A;  1TII D;  2PYK A;  4H44 C;  2Q8R E;  1HXY D;  5C44 B;  1PMR A;  4IFD H;  2NVX B;  1R9T B;  4O42 A;  5D3D A;  4FVM A;  1GUN A;  1X32 A;  1EY6 A;  2E2I B;  2RDF A;  5EJW A;  2FMM A;  5J1Z A;  4KN7 C;  4C3I G;  5D3I B;  4IUR A;  3K7A B;  3NWS A;  3J81 E;  4OGQ C;  1O80 A;  4QF4 A;  3HGB A;  1HQM C;  3NWT A;  2F4I A;  1VF7 A;  4A3D B;  1A3T A;  1EY9 A;  2AUJ D;  2JSO A;  3GTO B;  1QNK A;  1F9P A;  2XIW A;  3G6J B;  3P75 A;  1TS3 A;  4R9W A;  3I91 A;  1QNU A;  1LAC A;  2IX1 A;  1EU3 A;  2MUY A;  2KED A;  5JVG 3;  2PPB C;  2F0T A;  2GA4 B;  2K5Q A;  3J81 L;  3S14 B;  3MEH A;  4XIG S;  5CV4 A;  5CV8 A;  1EY0 A;  1QWY A;  1EOT A;  4UDU C;  3VYU A;  2WKC A;  4Q5V A;  1E2V A;  1KDC A;  1F2L A;  5CV7 A;  5IIF A;  4KD4 A;  1DM0 B;  3EVQ A;  1ENA A;  4C3I B;  1ILQ A;  3NXW A;  2EVB A;  2IT1 A;  1BQQ T;  3VR4 A;  5D65 A;  4B9X A;  5M3M B;  2XNA C;  2A69 C;  4M1U B;  3GTP B;  5LL6 X;  1EIH A;  1KDA A;  2H1E A;  2XN9 C;  5IGB A;  3M4Y A;  3TP7 A;  4QCL A;  3VYT A;  2F0D A;  5C5L A;  2O4X A;  3NK9 A;  3J80 L;  4K6D A;  1OXU A;  2CQA A;  5ELB A;  4ZK9 B;  1MD2 D;  2EYL A;  5ISR A;  4DA2 A;  1ENC A;  5KYI A;  1S5B D;  2WIN B;  4J1M A;  3LWE A;  2LKV A;  2NVY B;  2VNU D;  3QG1 A;  1GUT A;  2F0U A;  1PRT B;  1QOH A;  1LTG D;  3D3R A;  1Y1V B;  2RSN A;  1KAA A;  1RF2 D;  1Q3L A;  2O5I C;  5JOB A;  3NQT A;  4DNT B;  3BVM A;  1EYC A;  2F0G A;  3VR3 A;  3RLF A;  2XRQ D;  3H6M A;  1DD2 A;  4A3J B;  3MXU A;  2K6A A;  1K8M A;  3DWA A;  5EKI A;  1CTM A;  2BOS A;  3V96 A;  2B2U A;  2DY8 A;  3MXG A;  3NBI A;  2EY6 A;  3K59 A;  5JAV A;  1II3 A;  1BNZ A;  3GO5 A;  1PDQ A;  4NP5 A;  4PMC A;  1Y8O B;  1XXG A;  1HFN A;  2K1B A;  3DEO A;  3SR1 A;  3X3N A;  4IUN A;  5C6A A;  1EY5 A;  5EBC A;  4HSV A;  1ZYR D;  1KAB A;  4Q0F A;  3K58 A;  4DU9 A;  3A8I E;  3P1H A;  1STB A;  4OO1 H;  3CHB D;  4NMZ A;  1OXT A;  4XQJ A;  2B2Y C;  2K7V A;  4DNR B;  1GUO A;  4HTH A;  1PFB A;  4EQO A;  1WTQ A;  2KCC A;  2VXW A;  2K32 A;  2B2W C;  1SJE D;  3IL8 A;  1Y69 U;  2MGS A;  4HED A;  3F2U A;  4LJZ C;  2NWG A;  2SDF A;  1S5E D;  5EGT A;  3I70 A;  4IFD J;  5E3F A;  1LTR D;  2ZXO A;  1DOM A;  5LL6 S;  1D6E C;  3OOC A;  5BN5 A;  1S5F D;  4EGV A;  1SDF A;  1GUG A;  1PFM A;  4CKE A;  1KLG D;  3DWP A;  4NW2 A;  5A2Q L;  2E2J B;  1F2M A;  1I4X A;  3L9A X;  5CV9 A;  4HCE A;  1QIL A;  3HEJ A;  2F1M A;  3RUZ A;  4A3G B;  3NHH A;  1NCV A;  3HG9 A;  5KNC A;  1SYF A;  3RD4 A;  5JEA J;  1OXX K;  1F77 A;  4LAA A;  4U67 3;  3DEP A;  1Y8P B;  1D5X C;  3LWU A;  1STE A;  4FF4 A;  5JPN C;  1D5M C;  5IGD A;  2EJF C;  1TWG B;  3FKI B;  3BDC A;  3BYY B;  1IW7 D;  2Z8L A;  3DUZ A;  1H9K A;  2M00 A;  4A3F B;  1O7Z A;  3SK8 A;  2O2L D;  4OO1 G;  2AQ1 B;  3R8B A;  5HGT A;  2F0P A;  4IZ8 A;  2RVL A;  1SXT A;  2F3V A;  2A68 D;  3R93 A;  3T13 A;  1C48 A;  2EYM A;  1F2Z A;  1HPC A;  3TSS A;  2JEB I;  1MI2 A;  1YNN D;  1EZ8 A;  2I07 B;  1L0Y B;  1EWH A;  1STH A;  4K2K A;  3TDQ A;  1YNJ C;  3BVG A;  4K14 A;  1NR2 A;  2EOT A;  3BDO A;  4H13 C;  2BDN A;  5KIX A;  3PO2 B;  1K8O A;  1TVX A;  2NZ1 D;  2F0L A;  5EKL A;  3UI2 A;  3D8G A;  1PRT D;  1LT6 D;  1H9J A;  5IOC A;  5KND A;  5CC4 A;  1Q12 A;  2MJ8 A;  3PO3 B;  5CR3 A;  1HA6 A;  4KK7 A;  1U4R A;  1R4P B;  4MIU A;  4LK1 C;  3ND9 A;  1W6K A;  4XT3 B;  1L0X B;  1CFM A;  1CA6 A;  4H0L C;  1NUC A;  4DAY A;  4XYO A;  2F3W A;  5AFW A;  3SE0 A;  3OMC A;  2A5H A;  1TWC B;  3S2D B;  1JB3 A;  4MHE A;  2F0K A;  3OSO A;  2X6L A;  1XX8 A;  5J39 A;  3S1Q B;  2RBM A;  5FOB B;  1EEI D;  3R3O A;  2K33 A;  5J22 A;  3T53 B;  4X3S A;  3LX0 A;  3K5N A;  2DNE A;  1BO0 A;  2QCP X;  2L5T A;  4FXD A;  3RZO B;  4ZQ3 A;  1UUP A;  1QE6 A;  5C5M A;  1TWA B;  3A7A B;  4G7Z C;  1RDP D;  2Y0S B;  5BN3 A;  1BOS A;  1FGB D;  5JEA H;  2K05 A;  2AUK A;  2X6G A;  2CHB D;  4BA2 I;  4J8Q A;  2B2W A;  2IWH A;  1EY4 A;  4K5V A;  1M8A A;  1ESF A;  5JEA G;  1JOK A;  3OPO A;  4KY7 A;  5IGC A;  1Z6H A;  2E75 C;  3ONA B;  5EQ0 A;  4A3K B;  4XTC S;  3FPP A;  3RMH A;  3SK5 A;  1ZEQ X;  1S5C D;  3N6R A;  3I4M B;  3L3O C;  5I2Y A;  1WVL A;  5BN4 A;  5CMD A;  3CRL C;  5K36 G;  1STA A;  1MSG A;  1SE3 A;  1WTR A;  2F0S A;  3HOW B;  1H9S B;  3QJY A;  5M9O A;  2MPM A;  3DM1 A;  2IX0 A;  5T1I A;  1E0B A;  4BY7 B;  4C3H G;  3S15 B;  3PIO 3;  5G3L F;  3D6W A;  4Z9C B;  5DM7 3;  4I65 A;  5F2D A;  2JEA I;  2WB1 B;  2FHT A;  2M9V A;  3PIP 3;  4PMW A;  4OIJ A;  3I90 A;  5C3E B;  1GXD C;  2CW0 D;  3JAM E;  1JQY D;  2EXZ A;  3D4D A;  2SNS A;  2EYJ A;  3BG3 A;  1BR9 A;  4RCN A;  3A54 A;  4HMI A;  2G9H D;  2L12 A;  2QEJ C;  1B2T A;  3IKJ A;  1B9M A;  5IGE A;  1JWM D;  4XQQ A;  3VR6 A;  5FO7 B;  2FJ2 A;  4RH6 A;  1LT5 D;  1PLF A;  3W2D A;  1G8Z D;  4K8J A;  2B2T C;  4CGY B;  1SNP A;  5FO9 B;  3HOZ B;  1GOZ A;  1V8Q A;  1QB5 D;  2CW0 C;  1WTX A;  1IHZ A;  1I50 B;  5DAU A;  1MGS A;  1PXU A;  1J8I A;  4A3M B;  2WP8 J;  1TS4 A;  1UNS A;  1E2Z A;  2Q8T A;  4KKT A;  3BZD B;  2NN6 G;  1I6H B;  1CHP D;  1HUN A;  4M8A A;  1CM9 A;  3FDT A;  2B8F A;  3NTH A;  1JCK B;  5M3F B;  1D5Z C;  1LO5 D;  1ZXT A;  1LT3 D;  2C9O A;  2G9D A;  5I4D A;  2B2Y A;  3L7Z C;  2EY1 A;  5C3W A;  2QIL A;  4A93 B;  1UEA B;  3PUW A;  2MHV A;  4HMJ A;  3C46 A;  5C4X B;  1KDB A;  3H91 A;  4YIJ A;  1EY8 A;  4ABN A;  4QB4 A;  2R93 B;  1SJH D;  1PTO B;  5JVH 3;  2L1B A;  2PZT A;  4HR7 B;  4S3S A;  2QDB A;  2K01 A;  3VYR A;  1QG7 A;  4RHR A;  4QIW B;  2A6H C;  3VA7 A;  1I4G A;  2QF7 A;  3IFD A;  3KLR A;  2ICI A;  3J7A V;  3WDN A;  4K6L A;  3BVZ A;  5CYU A;  1O7L A;  1SNC A;  2K04 A;  1Q1E A;  3K0Y A;  4PMB A;  2KUM A;  3BS1 A;  4KKS A;  3IFT A;  1FR3 A;  1LTA D;  1JOR A;  2IW3 A;  4ME5 A;  4F8M A;  3M7N A;  3Q24 A;  2BA1 A;  2D9U A;  1EQT A;  3ERQ A;  4WFN 3;  3D4R A;  3HOY B;  4IUQ A;  5C4J B;  2ENB A;  1HA5 A;  4DAP A;  1DJR D;  3H0G B;  3S16 B;  3MA2 B;  3CQZ B;  4X3T A;  2RQX A;  1C4Q A;  1JWS D;  1SE4 A;  3A8J E;  2AWO A;  3MFY A;  1JOO A;  3NSW A;  2XWB B;  1Q8I A;  1TS5 A;  2PW7 A;  5COR A;  2D5D A;  1QJO A;  3E5S A;  5I9P A;  4DFA A;  3BDL A;  2KEC A;  1HRJ A;  5E4W C;  2L55 A;  3NUC A;  1SYB A;  3D4W A;  5C0X G;  3FRP B;  2ID0 A;  1EU4 A;  1BF4 A;  2RKS A;  1BXT A;  4EQN A;  3M7G A;  4XQN A;  1PTO F;  2HQE A;  4RAU C;  4C1N K;  1ZYR C;  4BBS B;  3KLS X;  4G7H C;  3QIA A;  5I2X A;  4BS9 A;  4NDX A;  3LNN A;  3HKZ B;  1I6V C;  2A6E C;  5EPK A;  4R8I A;  3MWY W;  4PQX A;  2R6G A;  2F0W A;  5ELD A;  1PZJ D;  3MHB A;  2PNR C;  1ILP A;  2RDG A;  1LAB A;  1RTO A;  2KQ3 A;  1WTV A;  1JC7 A;  2TMP A;  1ET9 A;  3TP6 A;  5CV5 A;  3QB3 A;  2IL8 A;  2X69 A;  4IUT A;  1B53 A;  1SBB B;  2A68 C;  1U4P A;  1CI3 M;  1ZKO A;  4A3E B;  2KHS A;  1H9M A;  2F0E A;  3FPU B;  3GTK B;  1BCP B;  4K5W A;  3PV0 A;  3T56 B;  3C3L A;  1ESR A;  1HFG A;  3MC0 B;  4BY1 B;  5ELF A;  1IW7 C;  3FVQ A;  3VR2 A;  1EL0 A;  3GV6 A;  1ENF A;  2WKD A;  4J6H A;  4WOR A;  4FO2 A;  1RD9 D;  1G2T A;  5C0X I;  5E4X A;  3I72 A;  3P20 A;  1BCP D;  2MP1 A;  2XSC A;  3X3M A;  2JE6 I;  1IYV A;  2BE5 C;  3OHX C;  1AZQ A;  1DZ1 A;  2EJM A;  4KY5 A;  2A73 B;  2OEO A;  1WD1 A;  3VR5 A;  4QUC A;  4BWG B;  4O1N A;  5HUR A;  1OXS C;  2F0Q A;  4I7Z C;  3C1E A;  4XT1 B;  1J9O A;  2D2C C;  1BDO A;  4MN3 A;  1FNU A;  3J80 E;  1B9N A;  3FEW X;  4V0B A;  4FYD A;  2A69 D;  2L4N A;  3Q0A A;  1O7Y A;  5IT9 L;  3GD7 A;  2FMC A;  2PCF B;  2WV6 D;  1F9Q A;  1PZI D;  2A6E D;  2FFK B;  1A15 A;  4KJO A;  4C3J G;  2K5W A;  4ILW A;  4RGT A;  3OIP A;  3H94 A;  3TP5 A;  1XTC D;  3H09 A;  3M4O B;  1GUW A;  1D2B A;  5KYL A;  5JPM C;  1TWF B;  1WTO A;  5EBD A;  4R8N A;  2HUG A;  5M5Y B;  1F9S A;  2F0I A;  1B1Z A;  4K8I A;  3TZD A;  3K5O A;  1DXM A;  3SEB A;  1FNW A;  1PFN A;  1H9R A;  2B2U C;  4G57 A;  1SAP A;  2K03 A;  2L9H A;  4OIK A;  1AN8 A;  1D1K A;  2DNC A;  3MTS A;  1HQR D;  5M5X B;  3MZ5 A;  3DHQ A;  1EIG A;  2NYZ D;  3IAY A;  4TQU S;  4RFB A;  5C0X H;  3J7Y W;  2HDM A;  4ZAI A;  1IL8 A;  3EJI A;  5A2Q E;  1G29 1;  3S1N B;  4CKC A;  2EYP A;  1TS2 A;  1Z7T A;  4Y7N B;  2SEB D;  1LV9 A;  4RHS A;  4ZRZ A;  1RHP A;  4HN7 A;  2VB3 X;  1G2S A;  1SNQ A;  5CV6 A;  4FF1 A;  4U68 A;  2Z1C A;  3HS0 C;  2F0N A;  1U9R A;  1EY7 A;  1VF5 C;  4OHJ A;  5C4Z A;  3PUV A;  3QWN A;  4C56 C;  3NPP A;  2AQ3 B;  1PYW D;  1U4M A;  2XRS D;  3NTI A;  4ZLT F;  1TR5 A;  2DN8 A;  4KHV A;  5IOD A;  1EEF D;  1IKL A;  1TU2 B;  3GTM B;  3S17 B;  1UAP A;  2B39 A;  1V43 A;  1AP0 A;  1PRT C;  3HP3 A;  1LTI D;  1V1P B;  4JBW A;  1T5E A;  2LY7 A;  3HRZ C;  4IUU A;  1JR0 D;  3QOJ A;  4KI0 A;  4DK0 A;  1STN A;  2H4O A;  2J4X A;  3NBH A;  2Q8I B;  1BBX C;  3KF8 A;  2ZT9 C;  4C2M B;  4RGO S;  4EVO A;  1LTT D;  3I8Z A;  3NTK A;  1HCZ A;  2PZU A;  4ZUI A;  1DON A;  3GTG B;  1I4P A;  4LMQ D;  4PNY A;  3S1M B;  4HSP A;  4K5X A;  4WJW A;  3GP7 A;  3MAQ A;  1PRT F;  4BA1 I;  3JAM L;  1V1P A;  3TP8 A;  4IFD I;  2V4D A;  1RJT A;  5ELE A;  2JA7 B;  5KGU A;  3U9S A;  1CK1 A;  1EFI D;  1VDZ A;  3OW7 A;  4F87 A;  1DOK A;  2OF1 A;  1F9R A;  3GTJ B;  1TT2 A;  1G91 A;  4WRD A;  3CU7 A;  1STY A;  2E2H B;  2B2T A;  5FLX E;  2EPB A;  3Q22 A;  5C3X A;  1AFP A;  2F0O A;  5DM6 3;  4IUV A;  3TZU A;  2Z4H A;  4N9P A;  3HOX B;  1Q90 A;  3PUX A;  2PO4 A;  4FF3 A;  3FMC A;  3NQI A;  1KNE A;  2AQ2 B;  4B9W A;  2PMZ B;  2WII B;  4JK1 C;  5FLX L;  4RCO A;  2L0C A;  4IN3 A;  4DN4 M;  1R4Q B;  1LLR D;  2LMC B;  4KN4 C;  3M3Y B;  1JWU D;  3EA6 A;  1A2U A;  4A3I B;  4UAI A;  4KD3 A;  5KRU A;  2E2D C;  3OMG A;  3W3A A;  3C1F A;  3ZYY X;  4KJN A;  2JYO A;  1I4Q A;  2B8G A;  4ZYS A;  1KLU D;  2OXP A;  3AB9 A;  3OIQ A;  5D14 A;  4TSS A;  1YNJ D;  3AU7 A;  1SSO A;  1SND A;  4X3U A;  1V1O A;  1NSN S;  5CBA E;  4RWS C;  3HZX A;  2FIN B;  1QCB D;  3C2P A;  1CT1 D;  3MFG A;  3S1R B;  5IT9 E;  1WD0 A;  3OWF A;  1WTW A;  3VA5 A;  3A8K E;  2Z4I A;  1A3V A;  4IQZ A;  1NR4 A;  4DXG A;  1PTO D;  5FO8 B;  4CJ1 B;  5C4H A;  5I9O A;  2OT2 A;  3H3V C;  2R61 A;  3GQB A;  4CBV A;  2EE1 A;  4KY6 A;  3MXP A;  2EZV A;  3R2T A;  1HTL D;  4FXG C;  1HHV A;  3PMF A;  1GHK A;  4RKB A;  2LS0 1;  4HAE A;  2TSS A;  4A3B B;  2EY5 A;  1SYG A;  5JJZ A;  4DAV A;  3DMU A;  4CJ0 B;  4C3J B;  2KEE A;  1DYQ A;  4KMU C;  1EZ6 A;  2RDH A;  2B2V A;  3V05 A;  2VB2 X;  2WAQ B;  3QO2 A;  1YNN C;  2WAC A;  3T51 B;  1BUV T;  1D1I A;  4CHT B;  2E76 C;  1AW7 A;  4IAL A;  4IFD G;  2NTT A;  1VCI A;  5IGG A;  3ITP A;  1B3A A;  2VUM B;  1SMY D;  3EQL C;  1AEX A;  1RCV D;  2JA8 B;  4FF2 A;  1EYD A;  4NKL A;  1X3Q A;  2HCC A;  1Z47 A;  2EYF A;  1FNV A;  3PUY A;  3TN2 A;  2A6H D;  3K6O A;  3G7L A;  2EY2 A;  4OL7 A;  2B63 B;  1B50 A;  4F88 A;  4KKU A;  3D31 A;  3I3C A;  5G3L D;  4B08 A;  4IUP A;  1TWH B;  1Q1B A;  1GHJ A;  2E74 C;  3A56 A;  4XYQ A;  1SFO B;  3HOU B;  2XVS A;  5FKA C;  2KCN A;  5DEH A;  4ULL A;  4X3K A;  3GTQ B;  1B44 D;  4FNF A;  1RKN A;  1KNA A;  1SEB D;  3NP8 A;  3E6Z X;  1BCP F;  2N88 A;  3EFX D;  1ET6 A;  2XWJ B;  4QMG A;  4G4K A;  1T5X D;  4RKL A;  5M5W B;  1SYE A;  4GZY C;  1XYI A;  3M85 A;  5LHY 1;  4L63 B;  1GJX A;  4FXK C;  2F0V A;  3S9W A;  3HOV B;  1CQV A;  4C1N I;  3NE5 B;  2NVT B;  3SK6 A;  3SHL A;  3E0J A;  2RSO A;  3PUZ A;  3TME A;  2BA0 A;  2N55 A;  2JA6 B;  2NN6 H;  2EDG A;  2PZW A;  4E6I A;  3I4L A;  1JE4 A;  1BCP C;  1CA5 A;  2D62 A;  5EPL A;  2NTS A;  4F7X A;  4OO1 I;  1A2T A;  3AMU A;  3MVV A;  1C8C A;  3VYS A;  1KTK A;  1TKW B;  5C0X J;  2O5J C;  2NBF A;  2F0F A;  5KNB A;  1WCM B;  1IKM A;  2K5D A;  4V19 0;  3ERO A;  3DXJ C;  1X3P A;  3DWQ A;  2SNM A;  3GTL B;  2K28 A;  2R3Z A;  3ND8 A;  1GUS A;  3Q23 A;  4DGZ A;  1JOQ A;  1VMC A;  2DY7 A;  1EWC A;  3URY A;  2JXM B;  1LTB D;  2NN6 I;  5EPJ A;  3SVM A;  1HTP A;  2I46 A;  4KV6 A;  3O13 A;  3K5M A;  1VMP A;  1CZG A;  1I4R A;  1XWE A;  2A74 C;  2M2L A;  3P7J A;  2C5C A;  1A6X A;  4HCS A;  2ZXP A;  4ZUJ A;  4KHZ A;  3S2H B;  4RA8 A;  2BE5 D;  3OWE B;  2NVQ B;  3MXN A;  1PTO H;  1EQV A;  2RA4 A;  3K5L A;  3CKI B;  1W6J A;  1Y1W B;  3SDZ A;  3A7L A;  3QOL A;  4KTA A;  2PW5 A;  2KVM A;  2YU9 B;  2NUC A;  2YYZ A;  4TKO B;  2BCO A;  2JA5 B;  1Y8N B;  3TBI B;  3T16 A;  1MSH A;  1S5D D;  4DXF A;  1A3U A;  2F03 A;  5NUC A;  3T4A C;  1ICW A;  4K2L A;  1DCZ A;  4EQP A;  3KBG A;  1O78 A;  3N52 A;  1MBY A;  1STG A;  3BYT B;  2CVR A;  4L6T B;  2L11 A;  1CQF A;  5FK9 C;  2KJX A;  4P2C B;  3KLS A;  1K83 B;  4RGM A;  2J7Z A;  1M4V A;  3KUP A;  1ROD A;  2ZXR A;  5IGF A;  4ZKB B;  1SYD A;  5CGK A;  1F2Y A;  3SK4 A;  1RTN A;  2SOB A;  3KK7 A;  1PZK D;  2EYH A;  5CBE E;  2LFN A;  2QKI C;  2NB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...