4DF7A

Crystal structure of staphylococcal nuclease variant delta+phs v23l/v99i at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4df7A00
4RKBA 4OL7A 3HEJA 1KABA 2F0MA 4K2LA 5CV5A 4N9PA 1F2YA 2F0WA 4K5VA 1NUCA 5CV9A 4EQPA 1SYEA 2F0QA 4WORA 2F0UA 4DF7A 1SNCA 1STBA 3SHLA 5IGGA 1STYA 3BDCA 1SYGA 1II3A 4QB4A 2EXZA 2RDFA 3P1HA 2HQEA 5E1FA 2F0PA 4ID6A 4IALA 3TP6A 2F0HA 2EYFA 2F0VA 5IGEA 1SYFA 3T16A 2F0TA 3TP8A 4KHVA 2EYJA 5DAUA 4EVOA 4ME5A 4NDXA 4S3SA 4KY6A 1JOOA 1A2TA 1SNPA 2F0JA 4J1MA 3V2TA 5C6AA 5M9OA 5EKKA 3SK5A 1KDAA 2O4XA 3C1FA 3MXPA 5HGTA 2F0NA 5IGDA 1EZ8A 1EY5A 3S9WA 3ERQA 5F2DA 3SR1A 2PZUA 3D4WA 3OMCA 2EYHA 4DU9A 1STGA 2SOBA 2OXPA 1EY9A 3T13A 4K8IA 2KHSA 5KGUA 1JORA 3PMFA 5C3WA 2F3VA 3SK8A 1JOQA 2EYMA 3EVQA 1SNDA 3OWFA 4MIUA 3MZ5A 4J6HA 2F0KA 1EY6A 1EY8A 1RKNA 1EY7A 4RKLA 1STAA 4N9TA 2PZWA 1IHZA 3R3OA 2OEOA 4KTAA 1KAAA 4QF4A 4R8NA 5J1ZA 3C1EA 1F2MA 2PYKA 5CC4A 4F8MA 3D8GA 1KDBA 3DHQA 4PMBA 5CV8A 1A3UA 1EYAA 3NXWA 3SK4A 4DFAA 4DGZA 2KQ3A 4IUNA 5E3FA 3NHHA 2EY5A 1JOKA 3SK6A 4PNYA 5CGKA 4TRDA 3TMEA 5C4HA 3EROA 3U9OA 3P75A 3LX0A 2F0OA 3ITPA 3E5SA 3MVVA 4K8JA 4KD4A 3BDLA 4KJOA 2F0FA 5IIFA 1EQVA 1SYCA 3QOLA 3TP5A 3NP8A 3MEHA 1U9RA 5C5MA 5I6WA 1EYCA 2NUCA 2WACA 4K5WA 3OSOA 1A3TA 4KJNA 4LAAA 2EYPA 4HTHA 3TP7A 4ZUJA 3NUCA 4QMGA 4NMZA 5IODA 4B9WA 1TQOA 2F0GA 4KV6A 4WRDA 5IGFA 1F2ZA 4NKLA 2F0SA 3DMUA 4I65A 2EY1A 5IGCA 4HMIA 5KIXA 5I6YA 5ISRA 4K5XA 3HZXA 4E6IA 1SNOA 3QB3A 3OMGA 2RKSA 4KY7A 3H6MA 5J39A 3RUZA 1TR5A 1EY0A 2EYOA 1A2UA 3D4DA 2F0DA 3MHBA 5CV6A 4K6DA 2PZTA 3NK9A 2F0EA 3QOJA 5KYIA 5I9PA 5IOCA 2F3WA 2QDBA 3EJIA 4IZ8A 5KEEA 5KYLA 1SYBA 4EQNA 1STNA 4KY5A 5EGTA 5CR3A 2EY6A 4K14A 5JAVA 5K5PA 4HMJA 1EZ6A 4EQOA 1SNMA 5I9OA 2RBMA 1EY4A 4F7XA 5C4ZA 1SNQA 5KRUA 4PMCA 2EY2A 5JOBA 1TT2A 2PQEA 4ODGA 3SXHA 5C3XA 1SYDA 5HURA 5IGBA 2PW5A 4YIJA 2EYLA 1STHA 4K2KA 2OF1A 5CV4A 4KD3A 5CV7A 2F0LA 2ENBA 2SNMA 5C5LA 1KDCA 5EKLA 3D6CA 1A3VA 4B9XA 4ZQ3A 2LKVA 5DEHA 1EYDA 4NP5A 3NQTA 2SNSA 3VA5A 1AEXA 1ENAA 1NSNS 4ZUIA 4G57A 2M00A 5NUCA 5J22A 4H7BA 2PW7A 1ENCA 2F0IA
chains in the Genus database with same CATH superfamily
1IKMA 1E2WA 3SGIA 1D5ZC 4OL7A 2JA8H 2F0MA 2E5LQ 3G6JB 4N9PA 4FXKC 2N88A 2HHHL 1NUCA 5C0XJ 3HOWH 1TWCB 2NVTB 4WORA 2F52A 1SDFA 3HOUH 2HQLA 2ZTCA 1Q46A 3NBIA 4DK1A 5E1FA 2R92B 3DM3A 4DV5L 2HIVA 1PTOC 1R4QB 4M1UB 2MUYA 2UU9L 1Q8IA 4AH6A 1CA6A 5L37A 3ONAB 4LFCQ 3A7AB 2J4XA 1HA5A 2EYHA 1GKHA 2Q8TA 5JVG3 2KHSA 1BF4A 4MIUA 1D6EC 4QQBX 1WCMG 1EY6A 4DV3L 1HXYD 2K05A 3VYSA 1H9SB 4DV2L 1CKNB 2FFKB 1DOKA 2HIXA 2VL6A 4IFDI 1C0AA 4IUTA 2IHEA 1KDBA 1XPOA 1WTHA 4UPAA 1CT1D 1B9MA 4IPCA 5E3FA 3BVZA 1JOKA 4PNYA 3U9OA 4R8NA 3ITPA 3Q8DA 4OEMB 1PFSA 4CKEA 4BY7H 1U9RA 2PMZE 2HD3A 2YTVA 5C0XH 1EYCA 2WACA 4CDFC 1J5EQ 2EYPA 1VQ9A 3KOJA 3MA2B 2WIIB 4DR6Q 5IGCA 3CCLA 2WB1B 1RF2D 4L5QA 3E9IA 3DUZA 3M85A 2KVMA 4N8FA 4DR7L 2NBFA 1DYQA 2EOTA 3Q6SA 3VR3A 5A2QL 1VF7A 4YHHQ 5IT9E 2JEAI 1I50H 3U9SA 5KYLA 2O5JC 4TVAB 1FGUA 1AW7A 4B3MQ 1EY4A 3Q0AA 2G9DA 2PQEA 5IP7H 4GN5A 1PHJA 3IL8A 4UHVA 1Y1WH 5LMNW 1WTOA 3M4OB 3M4PA 4LUZA 1SE4A 1HTLD 5KNDA 3GDEA 2K7VA 2TMPA 5JEAJ 2NZOA 2Y0SB 1PTOH 3WWVA 1X6OA 1K3RA 4AIMA 3GTJB 3T4AC 3SDZA 4JBKA 2TSSA 2AUKA 1PZKD 1WCMB 4JC0A 3S1MH 5C4JB 3RZDB 4A4IA 1SNCA 2GA4B 2VXWA 2EXZA 1Z47A 1LTSD 3CD6A 3I55A 4KLKA 5K36G 2F0PA 3A8JE 2EE1A 3CAMA 3D31A 1U4MA 1X65A 4UP9A 2PI2E 3T1HL 1EOTA 2CW0D 4NDXA 4EGVA 2L0CA 2IPKD 2Z1CA 2B2YC 1JWUD 2VB2X 5FO9B 1Q8KA 2KCMA 4DK3C 1B70B 2N78A 3RNUA 1HFGA 2K5VA 2OXPA 4R8IA 2AQ2B 3CPWA 1Y1VB 2Z8LA 3H0GG 3WOFA 1SBBB 2BE5D 3EVQA 4JI6L 3OWFA 2EJMA 1ICFB 1RKNA 3ERSX 3HFZB 4G7ZC 3J80i 3BZCA 3GO5A 3HOZB 4BWGB 2EXDA 4QF4A 1KAAA 1PRTF 3J80L 4QUFA 1YIJA 4CJ2C 3HOXG 3R2IA 2JA7B 3NHHA 2JA5G 3SK6A 2ZJRA 4LFBL 1X3QA 1YNNC 4OO1H 3PO2G 5GAEC 3AB9A 2E2IH 4NPSA 3NP8A 1RTOA 4N8X1 1IBMQ 3G6EA 2JEBI 4NMZA 4P2CB 3KF6B 3T1YQ 1PTOF 1DM0B 3STBC 1WTWA 3ICEA 5JJLA 2K75A 2VQFQ 1PFMA 1A63A 3VA7A 1AZQA 1TWHB 4IUUA 5E4WC 1L0XB 4P75A 4WJWA 2F0EA 5FJ8H 3HOYH 5I4DA 1TWCH 1YITA 3M4QA 2IW3A 3A56A 4ZLTF 2J7ZA 3CCMA 4A3LH 5KRUA 5GAGC 2R92H 2NVQB 1I3QB 4JI5Q 3OYYA 1SYDA 1FR3A 5DM73 3HOVB 1LTBD 1MIUA 1DGSA 4AYBG 1ML0D 5CV7A 2OQ0A 1E1OA 4Q0FA 4HR7B 4JVZA 3ND8A 1PH3A 4NXMQ 1CI3M 4A93G 1MD2D 1N34L 1D8LA 3CCUA 4C3HH 4G7OC 4BY1G 4ZUIA 4G57A 3PUZA 4H7BA 4KHPQ 3H0GB 1T9HA 3KF8B 3H09A 2F0WA 1CHQD 1YNXA 4HIKA 3LWUA 2Q8IB 1NE3A 4DV1L 3CCJA 1G2SA 4OIJA 1E7ZA 4OWTB 3TP6A 1XJVA 1AH9A 1UE7A 4GN3B 4HIOA 3PO2B 5GAHC 1VQFA 1JWSD 3V2TA 5HGQA 2O4XA 1S3OA 3ERQA 5M3MB 3SEBA 4A3GB 1L1OB 1UEAB 5KGUA 1JORA 3PMFA 5C3WA 3SK8A 4JI0Q 4DR3Q 3PF4A 1JOQA 3C46A 1EIYB 2QGQA 2SEBD 4RH6A 1TWFH 1QCBD 3NTHA 3O13A 4BXXH 1QVCA 5EPJA 1EYAA 4LUVA 4DGZA 1BKBA 1F9SA 2KUMA 5AFWA 2FMMA 3TDQA 3CHBD 2NN6H 3F1ZA 1T5XD 2HUGA 1BQQT 3A54A 1EFID 5I6WA 1DONA 4WJ4A 3M4OH 2KENA 2K04A 1K83B 2E75C 3CCEA 2YYZA 1R9TB 4AYBB 1YEZA 2B8GA 5ELCA 3NWSA 5IGFA 1TWGB 5I6YA 1SE3A 4A93B 4JI3Q 3QB3A 3OWEB 3GTJH 4BY1B 1RCVD 1PFNA 1HPCA 3TQYA 1LTRD 1KNAA 4IJLA 2KECA 3I4NG 1WCMH 1PA6A 2MO1A 1C8CA 3RZDH 4MHEA 4GOPA 1HZ9A 3FKIB 2O2LD 4KKSA 3PGZA 5FK9C 5JAVA 4BS9A 4LUOA 4IOCA 1D5MC 4F7XA 1VQJA 5IP9H 2Q2TA 2B2VA 4F87A 1FVIA 4L8JA 1ENFA 3I70A 3GV3A 1D5XC 4LMQD 4HIMA 1MJEA 4CJ1B 1AZPA 2ENBA 2WFWA 1MGSA 3JC66 2WAQB 1JWMD 4GKJQ 1EU4A 4NP5A 1XPRA 1RL2A 2CWPA 1UEBA 1Y1VH 2EJFC 5CBAE 4LJZC 1IBLQ 3NTIA 5BN3A 1H9RA 1VDZA 3LGJA 2WB1E 4TQUS 1HNWL 2B2TA 3HOZH 4XXEA 4DR5Q 1A0IA 3OTOL 1K9MC 1RDPD 1FD7D 1I4QA 1DJRD 1JICA 2AQ3B 1SE8A 1L1OC 2K5DA 1ZYRD 3C1FA 4JI2L 3K6OA 4X66L 2K6AA 2I07B 3E9HA 1H95A 2Y0SE 5BN5A 1NY4A 2VUMB 1GO3E 1TU2B 2PNRC 2UUBL 2RHQB 4K0KL 1CK1A 2PZWA 2I46A 2V1CC 1TWHH 1WTRA 2PYKA 4F8MA 4R4OA 1I94L 3K5MA 3I4NB 3CP0A 5C3EG 3RMHA 2CVRA 2F4VL 5D65A 4JOIA 5CGKA 1PH4A 3K80C 3EROA 4DK0A 4GKKL 1GUNA 2F0FA 3GTQB 2NVQH 1AN8A 1M4VA 2K5NA 4PQXA 2VS1A 1I3QH 3J80c 3HOVH 2DY8A 3OSOA 1OXVA 1QUQB 4HTHA 1QWYA 1XTDA 4ZUJA 4ZCKA 4DV0Q 2JA8B 1IBKL 4Q5VA 2E2HH 1VMPA 1OO9B 2R7FA 4I65A 4HMIA 2LXKA 3HOUB 2EJGC 3BYTB 1PH7A 2RKSA 3BDOA 1N33Q 2ZM6Q 1FJGQ 1HR0Q 3H0GH 4FF2A 4JYAL 3CRLC 4KKTA 3I7FA 5KYIA 3DWPA 5LL6X 1GUTA 3CXCA 1STNA 1EFWA 1QVFA 2LFNA 1SNQA 3BZDB 4ODGA 3SXHA 5C3XA 1DZ1A 3I90A 4DUYL 1PH2A 3HRZC 3PO2H 5T1IA 2QEXA 3BYYB 5LMNL 4FXDA 4FP5D 3NEMA 1CQFA 1RODA 2B3GA 1PH1A 5BR8L 2FINB 1KHIA 4A3GH 5GADC 1UE1A 2VY3A 3DLLA 1AEXA 3H15A 4LF6Q 4H0LC 1EIHA 2C35B 1K8MA 3TP7A 2UUCL 2DNCA 4MTNA 1JE5A 2A5HA 2A69D 2LXJA 5CV9A 1PH5A 3VYRA 3GTKB 1HZBA 3UI2A 3H3VI 1I6HH 1N32Q 1HNZL 4QIWB 4YY3Q 1II3A 2XVSA 3P1HA 5G3LF 4A3DG 2XN9C 1NMFA 5IY0A 1S5DD 4DR1L 1SNPA 1E3PA 1ONLA 4RCNA 2AWNA 4HJ5A 1ESRA 2BH2A 3PUYA 1NNXA 3HKZG 5F2DA 2B2UA 4FNFA 1AP0A 3RLFA 2UXBQ 1ASZA 4PZ8A 2H5XA 1K83H 3ZYYX 3PCOB 1R9TH 4IUQA 5C0XI 4K8IA 1YNJD 1PH8A 1FNVA 4GNXA 1TWGH 5CMDA 1I50B 4A93H 3CC4A 1STAA 1TKWB 4N9TA 4BY1H 1QJOA 3IRBA 3K0XA 5J1ZA 3S2HB 4GS3A 3V05A 1UE5A 2N55A 4OX9L 3CKIB 2CW0C 1LYLA 4LF4Q 2FXQA 5A2QE 3GQBA 4JI8L 4K8JA 1TXYA 3FPUB 5IIFA 3NQIA 1SFOB 3W3AA 3J81i 4JI1L 1NBWA 3UDXA 1MJCA 3J81L 2NUCA 1LM0A 1LTAD 3MXNA 3D0FA 4KJNA 4LAAA 1QB5D 2B63B 4V190 1U4PA 5IODA 4B9WA 1O80A 4MTKA 3X3NA 4R4IA 3HZXA 4OELB 2ZJQA 5DNFA 3MTSA 3N6RA 3CW2C 5CV6A 1I5FA 2PZTA 3W1BA 4KN7C 1YJWA 1HNXL 2XWBB 1YVCA 3VR2A 3TS0A 5K5PA 3H94A 5CR3A 2EY6A 1I4GA 1SNMA 5LL6S 1IYVA 4DR4Q 4RGMA 4PMCA 1TT2A 4DR2L 4HCSA 1Z7TA 4O2DA 1KLGD 5FKAC 4CDDC 1KD1C 4A3BB 3S15B 4LF7L 2SNMA 4FF1A 4C3JG 4J15A 1EQRA 4AYBE 3F2DA 1X9NA 4PZ6A 4OGQC 2AMCB 4JBJA 1ENCA 2VUMH 2DNEA 1KL9A 3L0OA 2YTXA 5CV5A 1UE6A 5JVH3 2FMCA 4LFAQ 2EVBA 3KBXA 3AMUA 1HH2P 2E8GA 1BBXC 2RSNA 3I4NH 2BA1A 4ME3A 3J80E 5EBDA 3TN2A 1CHPD 2KHJA 1XNQQ 2F0VA 1JMCA 3PUXA 3J81j 3D6WA 3GTQH 4KY6A 2AKWB 4CKCA 3FP9A 4OWXB 3SR1A 2E5LL 1P8LA 2RVLA 2JE6I 2PZUA 2PQAA 3D4WA 1CZWA 3W2DA 3HOYB 2WAQE 3R8BA 1EY8A 2D0PA 1X56A 1EY7A 2F3IA 1NR4A 4R9WA 1ASYA 1QNKA 4X6AH 4XT3B 2A6ED 4JK1C 1KRSA 1STEA 5M5YH 4A3KB 1Z6HA 1A3UA 1K8AC 4LF5Q 2I5MX 1KIXA 3K5NA 4X64Q 5IYBG 3FDTA 1VQ4A 1EQVA 4TKOB 3F2UA 1JE4A 5C5MA 3QJYA 4C3HB 2L1BA 2HCCA 1ET9A 1IL2A 5KNCA 1JJCB 2F0GA 1ESFA 3DMUA 1L0YB 3KDFB 4C3JB 4QJFA 3BG3A 4RCOA 1PFBA 3CRKC 5J39A 2P5ZX 1HZCA 3CMEA 1VQOA 2XWJB 1YHBA 5C44B 3GTKH 3TEHB 4GLVB 4JI7Q 5D3DA 1S5FD 5EGTA 1J5EL 1KQSA 2JA6G 5I9OA 3OIPA 3HKSA 2L4NA 4DR6L 3QR8A 1WD0A 1I4XA 4C1NI 1VMCA 1TY2A 5TSSA 4DV3Q 3VR4A 5ELNA 1C48A 4YHHL 1K73C 1G6PA 2R61A 1J6QA 1Q12A 1TWFB 1NAPA 3BVMA 3GV6A 4IPGA 1NSNS 4XIGS 4IPDA 2LS01 2Z9HA 5M3FG 4A3EG 3S2HH 1GXDC 2I5HA 3NTKA 5IGGA 1STYA 3JAMi 3U4ZA 2ZXOA 4B3TQ 2R7ZG 4Y52H 4PZ7A 1V1QA 3JAML 1XNRQ 2F0HA 4DV6Q 1Q81C 4JG2A 1SFOH 1LABA 5EKKA 5IGDA 1EEFD 4ZYSA 2NN6I 3VYTA 2MO0A 2B63H 3J7AV 2F3VA 4QUCA 2EYMA 4JBWA 1SNDA 1M8AA 3MZ5A 2VW9A 3UDFA 3H91A 4R4QA 1UNSA 3B6YA 5IE8A 4PMBA 2EIFA 5GQOA 1WFQA 4C56C 3E0JA 2MQHA 1ZYRC 4QIWE 2LSSA 2NWGA 2UXCQ 2GVAA 1SR3A 1TVXA 4X65Q 1SYCA 1Y14B 1X32A 4DN4M 4HJAA 4FF4A 4Y7NB 1QILA 4XYOA 2MP1A 2IX0A 3RN5A 4A3BH 3S15H 1WYDA 2B2WA 3RZOH 1X3EA 1EQQA 3A5ZB 3S17B 2KCTA 4A3MG 2EY1A 3CC2A 1JC7A 2K1BA 1GHJA 1JJ2A 2B2VC 1A62A 4KY7A 1PYBA 2N49A 1XMOQ 2BOSA 3S24A 3J81c 5M5XB 1B4OA 5I9PA 1Q7YC 2QDBA 1IBML 1Q3LA 1CKOA 4U673 1SYBA 2BDOA 3L3OC 3L9AX 1QOHA 1J9OA 4CKBA 3T1YL 1N8RC 4AQYQ 1YHAA 2G9HD 4NXNL 2IWHA 5LMUL 2VQFL 3R2TA 1STHA 5FO8B 5IYDG 2K33A 4ZQ3A 4A76A 1J8IA 4CHTB 4GN4B 1X3PA 1GUWA 3PSIA 5J22A 2RDGA 2F0IA 3WDNA 2RQXA 3AYHB 4XQQA 4X62Q 2JN4A 4RG1A 1F2YA 4JI5L 3ZJYC 1NTGA 1NR2A 1CZGA 3SHLA 2A73B 4A3KH 4TSSA 3OW7A 2A6HD 1MBYA 1A6XA 1AFPA 1VQAA 1CFMA 2MJ8A 5IGEA 2UUAQ 4FVMA 2IL8A 4LF8Q 5DAUA 2E2HB 3K7AH 2QA4A 1D1KA 2F0NA 3ULLA 2GVBA 2V4DA 3OMCA 4H02A 4O1NA 1JQYD 3J7ZC 1EY9A 2A69C 3K8AA 4JI4L 1JCKB 3PIP3 1NMGA 1O7IA 4C3JH 1HCZA 1PVOA 4A3MB 3S16B 3AU7A 5JJKA 1IZ6A 4RMFA 2I5LX 3HG9A 3GTGH 4FYDA 4B08A 1TS2A 3HOXB 3C1EA 1F2MA 5CC4A 3A5UA 3TREA 1RIPA 1WJJA 2A19A 2RHSB 2JA5B 2KJXA 5C44H 1ET6A 4DAYA 1PH6A 2A68C 4OXPA 2E76C 4O42A 5FLXL 3I4LA 4KJOA 1XPUA 3KJOA 4JBMA 4JI0L 4DR3L 2XIWA 1O7LA 4U68A 2RA4A 2KA7A 5EBCA 3G48A 3QG1A 4UP8A 4A3IG 2KEDA 1DOLA 1BCPD 4KV6A 1F2ZA 1H9KA 4RGOS 1I6HB 4K5XA 1FNWA 1CSPA 3H6MA 5IYCG 3U58A 1QZHA 3BZKA 1EY0A 2CKZB 2VZAA 4EX5A 2IX3A 2RF4A 4KY5A 1GUGA 3V96A 2OT2A 1VQIA 2LY7A 4A3CG 1LT5D 3CMAA 3WOEA 3E6ZX 1VCIA 5IYBH 2K14A 3A74A 4K6LA 4K2KA 2OF1A 5DLQE 1E0BA 1FL0A 3KLSA 3DM1A 4RGTA 3OIQA 2KBNA 2A1AA 1VF5C 1D7QA 4HN7A 1OXXK 4RKBA 1VQGA 2JSOA 3C2PA 3KUPA 1X3GA 4HSVA 1QG7A 2K50A 1BXTA 1RJTA 2B2UC 1O7ZA 1STBA 2YTYA 5T1GA 2DGYA 3BDCA 4APVA 1UWVA 1VS0A 3P7JA 3TBIB 3HS0C 2B2YA 2ZT9C 3TRZA 2JA6H 1IXRA 1CUKA 1H9SA 1W6JA 2VB3X 1CKNA 3FRPB 4Z9CB 2F0JA 2CHBD 3P20A 3SK5A 4IUVA 1AE3A 4GLXA 4JW0A 3KYHC 4Y7NH 4MZ9A 3A8KE 1Q1BA 3J81E 3JAMc 4A3IB 1IKLA 4DR5L 3S17H 2MFIA 1KNEA 1MKHA 2F1MA 3EA6A 1L0WA 2N8NA 1IHZA 2ZTDA 1HJPA 2EPBA 3FVQA 1K0SA 5M5XH 1AE2A 3CCRA 3HOWG 5M3FH 4A3EH 3SK4A 3M4YA 1SXTA 4LWCA 3P75A 3E5SA 3SVMA 1BUVT 1K0RA 3NE5B 3QOLA 1G8ZD 1WVLA 3K7UC 4UAIA 3CQZB 2CFMA 4QMGA 1V1PA 3TZDA 1N36Q 1QE6A 3URYA 5FOBB 1SMXA 2A6EC 3ULPA 3M9BA 2PPBC 4E6IA 1HUNA 4POFA 4LF9Q 4HIDA 1TR5A 3KJPA 2EYOA 3QO2A 2F0DA 1H9JA 2L15A 3NK9A 4IURA 1WTPA 4HSPA 5K36H 4K14A 2K01A 1EZ6A 3RD4A 4DV0L 2Q2UA 2JP1A 4YWLA 3CCSA 4DV7Q 1N33L 2ZM6L 1FJGL 1HR0L 5C0XG 2D62A 3FHWA 1LO5D 2XGTA 2L12A 1ENAA 3RN2A 2VQEQ 5NUCA 2F4VQ 1LT3D 5M5YB 1OTCA 1KC8C 4A3MH 3S16H 4JV5L 1EOVA 1SYEA 2F0QA 2B39A 3HOXH 1B44D 2JA5H 3MWYW 2HQEA 2AUJD 1XX8A 1I4RA 4CDCC 1IBKQ 2JK8A 4UDUC 2M9VA 3AFPA 4LF6L 2Q2HA 3VR6A 3GTOH 3RR5A 4CGYB 1Y1WG 1EWIA 4OONA 5EPKA 2L55A 1STGA 3D3RA 1N32L 3MFGA 5IYDH 1YJ9A 2OTLA 1LT4D 1CTMA 3S1NB 3KBGA 2IJ0A 1XMQL 2Z6KA 5C3EB 4PV1C 3UE0A 1VQNA 4R4CA 3OW2A 4B3RL 2X6GA 2UXBL 3TMEA 3CC7A 1LTGD 4O0AA 3A55A 3BDLA 1ZKOA 1U4LA 3TP5A 5D14A 2NTSA 2XRSD 3VYUA 4LK1C 5JPNC 4XTCS 1SMYD 1SROA 2K5QA 4ALPA 4RGNA 5J3BA 4KK7A 4XT1B 3MEFA 2F0SA 4DNRB 4LF4L 4DUZQ 5FLXc 1DD2A 1GVPA 2O5IC 3EBEA 3RLOA 1DXMA 3E0EA 4JCVE 1TY0A 1EU3A 3QOJA 3FEWX 1UUPA 4QCLA 4EQNA 1IYJB 5JEAG 1CM9A 2RCNA 3IFTA 3K57A 2WKDA 4QY7A 2BE5C 2EY2A 5JOBA 4IOAA 4X3KA 3KF8A 4CDEC 3JAME 2PW5A 5D3IB 2EYLA 2UXDQ 1U4RA 1VQ7A 1N9WA 5CV4A 4KD3A 2R6GA 1KDCA 2BA0A 1BCPB 5IWAQ 4OX9Q 4V0BA 2K5WA 4RAUC 4A3IH 4DV4L 2CQAA 2NYZD 3J7AF 4HJ9A 1PYWD 2QCPX 1KABA 2ZXRA 1CKMA 5ELDA 2IX1A 1K28A 4DF7A 2NZ1D 5IYCH 5FJ8G 2EZVA 3PIO3 4YCWA 4A3DB 4DXGA 4NB3A 2WV6D 1XTCD 4ZKCB 3TP8A 4P74A 2EYJA 4ME5A 2OCEA 1A2TA 2QW7A 3HKZB 3RZOB 1FNUA 3MXPA 3TSSA 4RFBA 3CQZH 4IFDG 4LFAL 1PYSB 1YJNA 3AEVA 4A3JG 1GUOA 1EL0A 3GTPB 2DY7A 3NENA 1SEBD 4DAVA 1SN8A 1R4PB 2PO4A 5AJ3L 1SE2A 5CORA 1EYGA 1U0LA 1EWHA 1XNQL 3GTMB 2A6HC 3R3OA 3RLNA 4KMUC 2L9HA 1C9OA 1VQBA 3I56A 1B2TA 2ICIA 2X6LA 3TS2A 1LTLA 5ELEA 4MN3A 4OO1I 1ILPA 1MI2A 1S5ED 3SE0A 1T5EA 1S72A 1A3TA 1B3QA 4P72A 1EIFA 2NZHA 1WTVA 1RTNA 4LF5L 1TIID 1WOCA 3IKJA 1LT6D 3BVGA 1F77A 3U50C 4DKAC 4XYQA 3S14H 5JJIA 4X64L 5ELFA 2WB1G 2WKCA 4B3SQ 3UDGA 4LFCL 3IAYA 4K6DA 2F3WA 2JXMB 5GROA 2HDLA 4BXXG 3K7AB 4X3TA 4HMJA 3F2BA 3I2ZA 1Y8PB 2HHHQ 2ATWA 1BCPC 2NN6G 2ICEC 1S4ZA 3L7ZC 1B50A 2WINB 2R3ZA 5FLMG 4GOPB 1V43A 3GTGB 1EYDA 3QIAA 4DV5Q 2DUDA 4FDBA 3VA5A 4A3JB 4JI7L 2Y0SG 3E3XA 4P71A 2K28A 3VDYA 2Z0SA 1G2TA 2UU9Q 5I2YA 3HEJA 1DCZA 2ZJPA 2K5HA 3S1NH 2J0TD 2IHFA 3H3VH 2F0UA 5C3EH 1B53A 1K3BC 3PV0A 2DJFC 4FF3A 5CBEE 2KOLA 3MAQA 1HR0W 4ZAIA 2N3SA 5H1SE 2EYFA 4DV2Q 4ZRZA 4KHVA 1Q86C 1HTPA 4LW1A 4EVOA 5IP9G 1C4QA 1SRUA 1MSGA 5EQ0A 5FLXE 3Q23A 3QWNA 4GLAC 3I4MG 2B8FA 4IN3A 4DU9A 4QL5A 4B3ML 2SOBA 1X54A 4QGUA 4KI0A 2PCFB 4B3TL 1Y1VG 1XNRL 4DV6L 3KLWA 3NWTA 2OEOA 4H44C 1S5BD 1QUQA 3ER0A 3HOZG 2M2LA 2NB0A 4IUNA 4BBSG 1HUMA 2JA7G 1S40A 3F2CA 4DR7Q 2R93G 2CH4A 1V1PB 4DAPA 3IFDA 4L5RC 2IT1A 3PIPA 2F4IA 2ID0A 3OHXC 4R1JA 3T56B 3U4VA 1WTXA 2NVXB 1LTTD 1GD7A 1TWAB 3KFUA 5ISRA 5KIXA 3I4OA 3OMGA 2UXCL 1HFNA 2K32A 3D4DA 4X65L 2SDFA 2JA6B 4G7HC 4A3FG 3KLRA 2E2DC 3EJIA 3M7GA 3DWQA 3ULJA 1D2BA 3Q24A 4A3DH 4HEDA 2NTTA 1PZID 4GOPC 4ILWA 1VQEA 4G4KA 4HJ8A 3UE1A 5IGBA 3PO3G 2PI2A 2OQKA 1W2BA 3HOVG 1XMOL 1KRTA 1B9NA 2F0LA 3I73A 5EKLA 3D6CA 3EFXD 3I4MB 1CQVA 1F9QA 2SNSA 2AWOA 3T1HQ 4DXFA 3K0YA 3GTPH 5M3FB 1MHWC 4A3EB 1EQTA 1S5CD 3GTMH 3NPPA 3OPOA 4AQYL 4EQPA 4BBRG 3GTLB 3BU2A 1B7YB 3S2DB 1E1TA 2R7ZB 4YCUA 2CQOA 2FJ2A 2WP8J 4JI6Q 4RHRA 1SLJA 4IFDJ 2B2TC 4ID6A 4BBSB 4IPHA 2DJGC 2L11A 1Y8NB 5JEAH 4S3SA 1JOOA 1X3FA 5C6AA 4OHJA 2R93B 1KDAA 3S9WA 2R7DA 5HGTA 1EY5A 4X62L 2FHTA 1IW7D 3LNNA 1P16A 3T53B 2YU9B 4LFBQ 1W6KA 2ZXPA 4POGA 4GZYC 5M3MG 5M5WB 3T13A 4A3GG 4RHSA 1BCPF 4C2MB 4MNOA 4J6HA 1QZGA 3DEOA 1XWEA 4XDXA 2UUAL 1PZJD 4LF8L 1NJIC 1RHPA 2XSCA 2Z4HA 5LMUQ 2I0QA 4NXNQ 3D8GA 5CV8A 4NXML 1Q1EA 1LV9A 4DFAA 1NCVA 4A3FB 2D9UA 2A74C 4KHPL 2Q2IA 3UDIA 1KAWA 2NVTH 4GNXB 4EQ5A 4JOIC 1JJGA 5CYUA 3HKZE 3PO3B 4I7AA 2C9OA 2RCFA 3NBHA 1LACA 1VQDA 2KCCA 2B29A 3I3CA 4IFDH 3G7LA 4BA1I 4A3JH 1VQ8A 1SNOA 1PRTD 3CCQA 2NVYB 1Q90A 3NSWA 1HZAA 1BO0A 1TS3A 1F9PA 4C3IG 2OWOA 5IOCA 3MXNB 5KEEA 2K52A 1YI2A 4BBRB 1W3SA 1N34Q 3GTOB 1F9RA 1I4HA 1YBYA 4EQOA 3FKIG 2PNHA 1YNJC 1SMYC 2Z6BA 2JJQA 4JI4Q 1BVSA 5HURA 4YIJA 3MC0B 2MGSA 1FGBD 4YWKA 4DV1Q 1U5KA 2KHIA 1PTOD 2LKVA 1M90C 4CBVA 4OWWB 5C4XG 2WAQG 5IT9L 1EWCA 2X69A 2K4KA 4KHZA 3HGBA 3S1QB 1JT8A 2KEEA 4JPBW 1GM5A 5COYA 4XQJA 3GD7A 2HDMA 3LWEA 1VQPA 1SYGA 3MFYA 2BDNA 2RDFA 2Z4IA 4JI3L 4IALA 2ALYB 3PUWA 1VQ5A 1SYFA 1XYIA 3T16A 4UP7A 1PV4A 1KTKA 5M9OA 2Z6KC 3EQLC 1G6ZA 1I4PA 4FO2A 3K59A 1BDOA 3AFQA 2NVXH 5A35A 5FLMH 1TWAH 2F0KA 2AHOB 4RKLA 1GHKA 3CU7A 2VUMG 1FYCA 1HRJA 4KTAA 4FXGC 4GNXC 4I7ZC 4GKJL 4C3IB 2PQAB 2EY5A 3KDFA 2RDHA 1IBLL 5C4JH 2GN5A 3LX0A 3MVVA 3I91A 2C5CA 3MXGA 4DNTB 4A75A 1BNZA 3MXUA 4IJHA 2QDLA 3K81C 1GJXA 3TZUA 1VQLA 1C7YA 4K5WA 5E4XA 4L5TA 2KCNA 3NUCA 4R4TA 4DA2A 3J7A5 3I4MH 1PXUA 4WRDA 2JA8G 2AQ1B 1B8AA 5C4XB 3RUZA 3HOUG 2IY5B 3ND9A 3MHBA 5KNBA 3CF5A 5DM63 4WFN3 4IZ8A 2RSOA 3GTLH 3G4SA 2R7ZH 3S2DH 1HHVA 3M7NA 5ELBA 1TS5A 4IQZA 1N36L 4P73A 3N52A 5C4ZA 1UAPA 4BBSH 1HNWQ 1BBWA 2JA7H 2HCIA 3BS1A 1OXUA 1V9PA 1VQCA 4WJ3M 2R93H 1B1ZA 4LF9L 3L2PA 3OTOQ 2Q8RE 4RWSC 2A8VA 2E2JB 1QVGA 1A8VA 2YU9H 3W1GA 1EIGA 2XNAC 1YZ6A 5M5WH 4UY8C 2M00A 4L63B 4HJ7A 1HA6A 2PW7A 4C2MH 1SJHD 4K2LA 3AQQA 4JI2Q 4K5VA 5EAYA 4X66Q 4M8AA 4DV7L 1HQRD 2QKIC 4ULLA 3DWAA 4A3FH 4PMWA 3K58A 2UUBQ 4K0KQ 4BY7G 3S1RB 2PMZB 4X3SA 2VQEL 2JYOA 4J1MA 1G291 3M3YB 1QNUA 1I94Q 1JB3A 1O7YA 3KLSX 1EZ8A 3Q22A 1YNND 5EPLA 3S14B 3PO3H 1GUSA 1M1KC 4GKKQ 1VQKA 3C3LA 3T51B 5HY6A 4CJ0B 3PIOA 2D5DA 1CSQA 2F03A 2QILA 1E24A 1L2FA 3HP3A 2NVYH 3HOWB 2BCOA 3STBD 1JB7A 5JJZA 1LLRD 4BBRH 5IP7G 3I72A 1HQMC 5C4HA 2F0OA 2CWAA 4JYAQ 1WTQA 2MHVA 3KK7A 3MEHA 4JV5Q 1E2ZA 4YY3L 3PUVA 2EDGA 1F2LA 1SSOA 2EQSA 1ZXTA 1EEID 1TQOA 2DN8A 4ABNA 2B63G 4NKLA 4KN4C 4L5SA 3F8TA 2ASBA 4BA2I 4DUYQ 1DOMA 2H1EA 1IYUA 5M3MH 1H9MA 1G91A 2QF7A 5LMNQ 3KF6A 1A2UA 3S1QH 2CCZA 5BR8Q 4DNIA 1VQMA 3CCVA 1CA5A 2RBMA 2UUCQ 1GOZA 2ZTEA 3J7YW 4DUZL 4BY7B 4HAEA 1VQ6A 3A7LA 1D1IA 1BBUA 1EUJA 3K5LA 1HNZQ 4H13C 3CPFA 1XMQQ 5FO7B 5C5LA 1A3VA 4B9XA 4A3BG 3FMCA 2A68D 4L6TB 3X3MA 4B3RQ 4DR1Q 3I8ZA 1V1OA 1PRTB 2KQ3A 1PMRA 1K8GA 4LNQA 2QEJC 4KKUA 4J8QA 3DEPA 2UXDL 4OO1G 1JR0D 3D4RA 4QB4A 3GP7A 4C3IH 5BN4A 5IWAL 5IT9c 2F0TA 1Y1WB 4ZK9B 3FKIH 1PDQA 3NELA 4OIKA 1RD9D 4NW2A 4F88A 1KLUD 4ZKBB 4YWMA 4PG3A 5ELOA 1PTOB 4HCEA 3K5OA 1YHQA 2ES2A 4JI8Q 4DR4L 3VR5A 2JQOA 3W5OA 2CH4W 4DPGA 4JI1Q 4XQNA 3HOYG 2H4OA 1OXSC 1L1OA 3S1MB 5C4XH 1Y8OB 2BH8A 4IO9A 1KXLA 2D2CC 1G51A 3EIVA 3DHQA 1BOSA 3EN2A 1Z9FA 4A3LG 3G71A 3NXWA 4IUPA 3A0JA 1A15A 5G3LD 2R92G 4A3KG 1PH9A 4TRDA 4A3CH 5JPMC 1IL8A 4KD4A 3R93A 1IW7C 1XXGA 3NBHB 1BR9A 1TS4A 1X55A 1V8QA 4DV4Q 1HNXQ 5E7NA 3H3VC 1LUZA 1SJED 1ICWA 1K8OA 2MNAA 4C3HG 2E2JH 1O78A 1PLFA 1OXTA 2D0OA 4DAYB 5EKIA 4DR2Q 2XRQD 2HT1A 2YV5A 2JA9A 1SAPA 4C1NK 2VNUD 3OOCA 2B2WC 1Y69U 2E74C 1Q82C 4LF7Q 4X3UA 2G5DA 2K03A 1WD1A 5I2XA 1E2VA 2OTJA 1B3AA 2L5TA 5C44G 1ZEQX 2XTIA 2MPMA 3BJUA 1E22A 4DK6C 3PF5A 2E2IB 1WI5A 3FPPA 3S1RH 3PQIA 5LHY1 5AJ3Q 3M3YH 3A8IE 3DXJC 4B3SL 1I6VC 1PRTC 4DAMA 4YCVA 5DEHA 4RA8A 5EJWA 1VQHA 3NQTA 1ILQA 2LMCB 1MSHA 1LTID
chains in the Genus database with same CATH topology
1IKMA 1E2WA 1D5ZC 4OL7A 2F0MA 3G6JB 4N9PA 4FXKC 2N88A 1NUCA 5C0XJ 2NVTB 1TWCB 4WORA 1SDFA 3NBIA 4DK1A 5E1FA 2R92B 1PTOC 1R4QB 4M1UB 2MUYA 1Q8IA 1CA6A 3ONAB 3A7AB 2J4XA 1HA5A 2EYHA 2Q8TA 5JVG3 2KHSA 1BF4A 4MIUA 1D6EC 1EY6A 1HXYD 2K05A 3VYSA 1H9SB 2FFKB 1DOKA 4IFDI 4IUTA 1KDBA 1CT1D 1B9MA 5E3FA 3BVZA 1JOKA 4PNYA 3U9OA 4R8NA 3ITPA 4CKEA 1U9RA 5C0XH 1EYCA 2WACA 2EYPA 3MA2B 2WIIB 5IGCA 2WB1B 1RF2D 3DUZA 3M85A 2KVMA 2NBFA 1DYQA 2EOTA 3Q6SA 3VR3A 5A2QL 1VF7A 5IT9E 2JEAI 3U9SA 5KYLA 2O5JC 1AW7A 1EY4A 3Q0AA 2G9DA 2PQEA 3IL8A 1WTOA 3M4OB 1SE4A 1HTLD 5KNDA 2K7VA 2TMPA 5JEAJ 2Y0SB 1PTOH 3GTJB 3T4AC 3SDZA 2TSSA 2AUKA 1PZKD 1WCMB 5C4JB 3RZDB 1SNCA 2GA4B 2VXWA 2EXZA 1Z47A 1LTSD 5K36G 2F0PA 3A8JE 2EE1A 3D31A 1U4MA 1EOTA 2CW0D 4NDXA 4EGVA 2L0CA 2IPKD 2Z1CA 2B2YC 1JWUD 2VB2X 5FO9B 1HFGA 2OXPA 4R8IA 2AQ2B 1Y1VB 2Z8LA 3WOFA 1SBBB 2BE5D 3EVQA 3OWFA 2EJMA 1RKNA 4G7ZC 3GO5A 3HOZB 4BWGB 4QF4A 1KAAA 1PRTF 3J80L 4QUFA 4CJ2C 3R2IA 2JA7B 3NHHA 3SK6A 1X3QA 1YNNC 4OO1H 3AB9A 3NP8A 1RTOA 2JEBI 4NMZA 4P2CB 1PTOF 1DM0B 1WTWA 1PFMA 3VA7A 1AZQA 1TWHB 4IUUA 5E4WC 1L0XB 4WJWA 2F0EA 5I4DA 2IW3A 3A56A 4ZLTF 2J7ZA 5KRUA 2NVQB 1I3QB 1SYDA 1FR3A 5DM73 3HOVB 1LTBD 1ML0D 5CV7A 4Q0FA 4HR7B 3ND8A 1CI3M 1MD2D 4G7OC 4ZUIA 4G57A 3PUZA 4H7BA 3H0GB 3H09A 2F0WA 1CHQD 3LWUA 2Q8IB 1G2SA 4OIJA 3TP6A 3PO2B 1JWSD 3V2TA 2O4XA 3ERQA 5M3MB 3SEBA 4A3GB 1UEAB 5KGUA 1JORA 3PMFA 5C3WA 3SK8A 1JOQA 3C46A 2SEBD 4RH6A 1QCBD 3NTHA 3O13A 5EPJA 1EYAA 4DGZA 1F9SA 2KUMA 5AFWA 2FMMA 3TDQA 3CHBD 2NN6H 1T5XD 2HUGA 1BQQT 3A54A 1EFID 5I6WA 1DONA 2K04A 1K83B 2E75C 2YYZA 1R9TB 4AYBB 2B8GA 5ELCA 3NWSA 5IGFA 1TWGB 5I6YA 1SE3A 4A93B 3QB3A 3OWEB 4BY1B 1RCVD 1PFNA 1HPCA 1LTRD 1KNAA 2KECA 1C8CA 4MHEA 3FKIB 4KKSA 2O2LD 5FK9C 5JAVA 4BS9A 1D5MC 4F7XA 2B2VA 4F87A 4L8JA 1ENFA 3I70A 3GV3A 1D5XC 4LMQD 4CJ1B 1AZPA 2ENBA 1MGSA 2WAQB 1JWMD 1EU4A 4NP5A 2EJFC 5CBAE 4LJZC 3NTIA 5BN3A 1H9RA 1VDZA 4TQUS 2B2TA 4XXEA 1RDPD 1FD7D 1I4QA 1DJRD 1JICA 2AQ3B 2K5DA 1ZYRD 3C1FA 3K6OA 2K6AA 2I07B 5BN5A 2VUMB 1TU2B 2PNRC 1CK1A 2PZWA 2I46A 1WTRA 2PYKA 4F8MA 3K5MA 3I4NB 3RMHA 2CVRA 5D65A 5CGKA 3EROA 4DK0A 1GUNA 2F0FA 3GTQB 1AN8A 1M4VA 4PQXA 2DY8A 3OSOA 1OXVA 4HTHA 1QWYA 4ZUJA 2JA8B 4Q5VA 1VMPA 1OO9B 4I65A 4HMIA 3HOUB 2EJGC 3BYTB 2RKSA 3BDOA 4FF2A 3CRLC 4KKTA 5KYIA 3DWPA 5LL6X 1GUTA 1STNA 2LFNA 1SNQA 3BZDB 4ODGA 3SXHA 5C3XA 1DZ1A 3I90A 3HRZC 5T1IA 3BYYB 4FXDA 4FP5D 1CQFA 1RODA 2FINB 1AEXA 4H0LC 1EIHA 1K8MA 3TP7A 2DNCA 2A5HA 2A69D 5CV9A 3VYRA 3GTKB 3UI2A 4QIWB 1II3A 2XVSA 3P1HA 5G3LF 2XN9C 1S5DD 1SNPA 1ONLA 4RCNA 2AWNA 1ESRA 3PUYA 5F2DA 1AP0A 2B2UA 4FNFA 3RLFA 3ZYYX 4IUQA 5C0XI 4K8IA 1YNJD 1FNVA 5CMDA 1I50B 1STAA 1TKWB 4N9TA 1QJOA 5J1ZA 3S2HB 3V05A 2N55A 3CKIB 2CW0C 5A2QE 3GQBA 4K8JA 3FPUB 5IIFA 3NQIA 1SFOB 3W3AA 3J81L 2NUCA 3MXNA 1LTAD 4KJNA 4LAAA 2B63B 1QB5D 4V190 1U4PA 5IODA 4B9WA 1O80A 3X3NA 3HZXA 5DNFA 3MTSA 3N6RA 5CV6A 2PZTA 4KN7C 2XWBB 3VR2A 5K5PA 3H94A 5CR3A 2EY6A 1I4GA 1SNMA 5LL6S 1IYVA 4RGMA 4PMCA 1TT2A 4HCSA 1Z7TA 1KLGD 5FKAC 4A3BB 3S15B 4FF1A 2SNMA 4C3JG 4OGQC 1ENCA 2DNEA 5CV5A 5JVH3 2FMCA 2EVBA 3KBXA 3AMUA 1BBXC 2RSNA 2BA1A 3J80E 5EBDA 3TN2A 1CHPD 2F0VA 3PUXA 3D6WA 4KY6A 4CKCA 3SR1A 2RVLA 2JE6I 2PZUA 3D4WA 1CZWA 3W2DA 3HOYB 3R8BA 1EY8A 1EY7A 1NR4A 4R9WA 1QNKA 4XT3B 2A6ED 4JK1C 1STEA 4A3KB 1Z6HA 1A3UA 3K5NA 3FDTA 1EQVA 4TKOB 3F2UA 1JE4A 5C5MA 3QJYA 4C3HB 2L1BA 2HCCA 1ET9A 5KNCA 2F0GA 1ESFA 3DMUA 1L0YB 4C3JB 3BG3A 4RCOA 1PFBA 3CRKC 5J39A 2XWJB 5C44B 5D3DA 1S5FD 5EGTA 5I9OA 3OIPA 2L4NA 1WD0A 1I4XA 4C1NI 1VMCA 1TY2A 5TSSA 3VR4A 1C48A 2R61A 1Q12A 1TWFB 1NAPA 3BVMA 3GV6A 4XIGS 1NSNS 2LS01 1GXDC 3NTKA 5IGGA 1STYA 2ZXOA 3JAML 2F0HA 1LABA 5EKKA 5IGDA 1EEFD 4ZYSA 2NN6I 3VYTA 3J7AV 2F3VA 4QUCA 2EYMA 4JBWA 1SNDA 1M8AA 3MZ5A 3H91A 1UNSA 4PMBA 4C56C 3E0JA 1ZYRC 2NWGA 1TVXA 1SYCA 1X32A 4DN4M 4FF4A 4Y7NB 1QILA 4XYOA 2MP1A 2IX0A 2B2WA 3S17B 2EY1A 1JC7A 2K1BA 1GHJA 2B2VC 4KY7A 2BOSA 5M5XB 1B4OA 5I9PA 2QDBA 1Q3LA 4U673 1SYBA 2BDOA 3L3OC 3L9AX 1QOHA 1J9OA 4CKBA 2G9HD 2IWHA 3R2TA 1STHA 5FO8B 2K33A 4ZQ3A 1J8IA 4CHTB 1X3PA 1GUWA 5J22A 2RDGA 2F0IA 3WDNA 2RQXA 4XQQA 1F2YA 1NR2A 1CZGA 3SHLA 2A73B 4TSSA 3OW7A 2A6HD 1MBYA 1A6XA 1AFPA 1CFMA 2MJ8A 5IGEA 4FVMA 2IL8A 5DAUA 2E2HB 1D1KA 2F0NA 2V4DA 3OMCA 4O1NA 1JQYD 1EY9A 2A69C 1JCKB 3PIP3 1HCZA 4A3MB 3S16B 3AU7A 4FYDA 3HG9A 4B08A 1TS2A 3HOXB 3C1EA 1F2MA 5CC4A 2JA5B 2KJXA 1ET6A 4DAYA 2A68C 2E76C 4O42A 5FLXL 3I4LA 4KJOA 2XIWA 1O7LA 4U68A 2RA4A 2KA7A 5EBCA 3QG1A 2KEDA 1DOLA 1BCPD 4KV6A 1F2ZA 1H9KA 4RGOS 1I6HB 4K5XA 1FNWA 3H6MA 1EY0A 2IX3A 4KY5A 1GUGA 3V96A 2OT2A 2LY7A 1LT5D 3WOEA 3E6ZX 1VCIA 4K6LA 4K2KA 2OF1A 1E0BA 3KLSA 3DM1A 4RGTA 3OIQA 1VF5C 4HN7A 1OXXK 4RKBA 2JSOA 3C2PA 3KUPA 4HSVA 1QG7A 1BXTA 1RJTA 2B2UC 1O7ZA 1STBA 5T1GA 3BDCA 3TBIB 3P7JA 3HS0C 2B2YA 2ZT9C 1H9SA 1W6JA 2VB3X 4Z9CB 3FRPB 2F0JA 2CHBD 3P20A 3SK5A 4IUVA 3A8KE 1Q1BA 3J81E 4A3IB 1IKLA 1KNEA 2F1MA 3EA6A 1IHZA 2EPBA 3FVQA 3SK4A 3M4YA 1SXTA 3P75A 3E5SA 3SVMA 1BUVT 3NE5B 3QOLA 1G8ZD 1WVLA 4UAIA 3CQZB 4QMGA 1V1PA 3TZDA 1QE6A 3URYA 5FOBB 2A6EC 2PPBC 4E6IA 1HUNA 1TR5A 2EYOA 3QO2A 2F0DA 1H9JA 3NK9A 4IURA 1WTPA 4HSPA 5K36H 4K14A 2K01A 1EZ6A 3RD4A 2JP1A 5C0XG 2D62A 1LO5D 2L12A 1ENAA 5NUCA 1LT3D 5M5YB 1SYEA 2F0QA 2B39A 1B44D 3MWYW 2HQEA 2AUJD 1XX8A 1I4RA 4UDUC 2M9VA 3VR6A 4CGYB 5EPKA 2L55A 1STGA 3D3RA 3MFGA 1LT4D 1CTMA 3S1NB 3KBGA 2IJ0A 5C3EB 4PV1C 2X6GA 3TMEA 1LTGD 3A55A 3BDLA 1ZKOA 1U4LA 3TP5A 5D14A 2NTSA 2XRSD 3VYUA 4LK1C 5JPNC 4XTCS 1SMYD 2K5QA 4RGNA 4KK7A 4XT1B 2F0SA 4DNRB 1DD2A 2O5IC 1DXMA 1TY0A 1EU3A 3QOJA 3FEWX 1UUPA 4QCLA 4EQNA 5JEAG 1CM9A 3IFTA 3K57A 2WKDA 2BE5C 2EY2A 5JOBA 4X3KA 3KF8A 3JAME 2PW5A 5D3IB 2EYLA 1U4RA 5CV4A 4KD3A 2R6GA 1KDCA 2BA0A 1BCPB 4V0BA 2K5WA 4RAUC 3J7AF 2CQAA 2NYZD 1PYWD 2QCPX 1KABA 2ZXRA 5ELDA 2IX1A 4DF7A 2NZ1D 2EZVA 3PIO3 4A3DB 4DXGA 2WV6D 1XTCD 4ZKCB 3TP8A 2EYJA 4ME5A 1A2TA 3RZOB 3HKZB 1FNUA 3MXPA 3TSSA 4RFBA 4IFDG 1GUOA 1EL0A 3GTPB 2DY7A 1SEBD 4DAVA 1R4PB 2PO4A 1SE2A 5CORA 3GTMB 1EWHA 2A6HC 3R3OA 4KMUC 2L9HA 1B2TA 2ICIA 2X6LA 5ELEA 4MN3A 4OO1I 1ILPA 1MI2A 1S5ED 3SE0A 1T5EA 1A3TA 1WTVA 1RTNA 1TIID 3IKJA 1LT6D 3BVGA 1F77A 4XYQA 5ELFA 2WKCA 3IAYA 4K6DA 2F3WA 2JXMB 2HDLA 3K7AB 4X3TA 4HMJA 1Y8PB 1BCPC 2NN6G 2ICEC 1S4ZA 3L7ZC 1B50A 2WINB 2R3ZA 1V43A 3GTGB 1EYDA 3QIAA 3VA5A 4A3JB 2K28A 1G2TA 5I2YA 3HEJA 1DCZA 2J0TD 2F0UA 1B53A 3PV0A 4FF3A 5CBEE 2KOLA 3MAQA 4ZAIA 2EYFA 4ZRZA 4KHVA 1HTPA 4EVOA 1C4QA 1MSGA 5EQ0A 5FLXE 3Q23A 3QWNA 2B8FA 4IN3A 4DU9A 2SOBA 4KI0A 2PCFB 3NWTA 2OEOA 4H44C 1S5BD 2M2LA 2NB0A 4IUNA 1HUMA 4DAPA 1V1PB 3IFDA 2IT1A 2F4IA 2ID0A 3OHXC 3T56B 1WTXA 2NVXB 1LTTD 1TWAB 5ISRA 5KIXA 3OMGA 1HFNA 2K32A 3D4DA 2SDFA 2JA6B 4G7HC 3KLRA 2E2DC 3EJIA 3M7GA 3DWQA 1D2BA 3Q24A 4HEDA 2NTTA 1PZID 4ILWA 4G4KA 5IGBA 1B9NA 2F0LA 3I73A 5EKLA 3D6CA 3EFXD 3I4MB 1CQVA 1F9QA 2SNSA 2AWOA 4DXFA 3K0YA 5M3FB 4A3EB 1EQTA 1S5CD 3NPPA 3OPOA 4EQPA 3GTLB 3S2DB 2R7ZB 2FJ2A 2WP8J 4RHRA 4IFDJ 2B2TC 4ID6A 4BBSB 2L11A 1Y8NB 5JEAH 4S3SA 1JOOA 5C6AA 4OHJA 2R93B 1KDAA 3S9WA 5HGTA 1EY5A 2FHTA 1IW7D 3LNNA 3T53B 2YU9B 1W6KA 2ZXPA 4GZYC 5M5WB 3T13A 4RHSA 1BCPF 4C2MB 4J6HA 3DEOA 1XWEA 4XDXA 1PZJD 1RHPA 2XSCA 2Z4HA 3D8GA 5CV8A 1Q1EA 1LV9A 4DFAA 1NCVA 4A3FB 2D9UA 2A74C 5CYUA 3PO3B 2C9OA 3NBHA 1LACA 2KCCA 3I3CA 4IFDH 3G7LA 4BA1I 1SNOA 1PRTD 2NVYB 1Q90A 3NSWA 1BO0A 1TS3A 1F9PA 4C3IG 5IOCA 5KEEA 4BBRB 3GTOB 1F9RA 1I4HA 4EQOA 1YNJC 1SMYC 5HURA 4YIJA 3MC0B 2MGSA 1FGBD 1PTOD 2LKVA 4CBVA 5IT9L 1EWCA 2X69A 4KHZA 3HGBA 3S1QB 2KEEA 5COYA 4XQJA 3GD7A 2HDMA 3LWEA 1SYGA 3MFYA 2BDNA 2RDFA 2Z4IA 4IALA 3PUWA 1SYFA 1XYIA 3T16A 1KTKA 5M9OA 3EQLC 1G6ZA 1I4PA 4FO2A 3K59A 1BDOA 5A35A 2F0KA 4RKLA 1GHKA 3CU7A 1FYCA 1HRJA 4KTAA 4FXGC 4I7ZC 4C3IB 2EY5A 2RDHA 3LX0A 3MVVA 3I91A 2C5CA 3MXGA 4DNTB 1BNZA 3MXUA 1GJXA 3TZUA 4K5WA 5E4XA 2KCNA 3NUCA 4DA2A 1PXUA 4WRDA 2AQ1B 5C4XB 3RUZA 3ND9A 3MHBA 5KNBA 5DM63 4WFN3 4IZ8A 2RSOA 1HHVA 3M7NA 5ELBA 1TS5A 4IQZA 3N52A 5C4ZA 1UAPA 2HCIA 3BS1A 1OXUA 1B1ZA 2Q8RE 4RWSC 2E2JB 1EIGA 2XNAC 2M00A 4L63B 1HA6A 2PW7A 1SJHD 4K2LA 4K5VA 4M8AA 1HQRD 2QKIC 4ULLA 3DWAA 4PMWA 3K58A 3S1RB 2PMZB 4X3SA 2JYOA 4J1MA 1G291 3M3YB 1QNUA 1JB3A 1O7YA 3KLSX 1EZ8A 3Q22A 1YNND 5EPLA 3S14B 1GUSA 3C3LA 3T51B 4CJ0B 2D5DA 2F03A 2QILA 3HP3A 3HOWB 2BCOA 5JJZA 1LLRD 3I72A 1HQMC 5C4HA 2F0OA 1WTQA 2MHVA 3KK7A 3MEHA 1E2ZA 3PUVA 2EDGA 1F2LA 1SSOA 1ZXTA 1EEID 1TQOA 2DN8A 4ABNA 4NKLA 4KN4C 4BA2I 1DOMA 2H1EA 1IYUA 1H9MA 1G91A 2QF7A 1A2UA 1CA5A 2RBMA 1GOZA 3J7YW 4BY7B 4HAEA 3A7LA 1D1IA 3K5LA 4H13C 5FO7B 5C5LA 1A3VA 4B9XA 3FMCA 2A68D 4L6TB 3X3MA 3I8ZA 1V1OA 1PRTB 2KQ3A 1PMRA 2QEJC 4KKUA 4J8QA 3DEPA 4OO1G 1JR0D 3D4RA 4QB4A 3GP7A 5BN4A 2F0TA 1Y1WB 4ZK9B 1PDQA 4OIKA 1RD9D 4NW2A 4F88A 1KLUD 4ZKBB 1PTOB 4HCEA 3K5OA 3VR5A 4XQNA 2H4OA 1OXSC 3S1MB 1Y8OB 2D2CC 3DHQA 1BOSA 3NXWA 4IUPA 1A15A 5G3LD 4TRDA 5JPMC 1IL8A 4KD4A 3R93A 1IW7C 1XXGA 1BR9A 1TS4A 1V8QA 3H3VC 1SJED 1ICWA 1K8OA 4C3HG 1O78A 1PLFA 1OXTA 5EKIA 2XRQD 1SAPA 4C1NK 2VNUD 3OOCA 2B2WC 1Y69U 2E74C 4X3UA 2K03A 1WD1A 5I2XA 1E2VA 1B3AA 2L5TA 1ZEQX 2MPMA 2E2IB 3FPPA 5LHY1 3A8IE 3DXJC 1I6VC 1PRTC 5DEHA 4RA8A 5EJWA 3NQTA 1ILQA 2LMCB 1MSHA 1LTID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKB A;  4OL7 A;  3HEJ A;  1KAB A;  2F0M A;  4K2L A;  5CV5 A;  4N9P A;  1F2Y A;  2F0W A;  4K5V A;  1NUC A;  5CV9 A;  4EQP A;  1SYE A;  2F0Q A;  4WOR A;  2F0U A;  4DF7 A;  1SNC A;  1STB A;  3SHL A;  5IGG A;  1STY A;  3BDC A;  1SYG A;  1II3 A;  4QB4 A;  2EXZ A;  2RDF A;  3P1H A;  2HQE A;  5E1F A;  2F0P A;  4ID6 A;  4IAL A;  3TP6 A;  2F0H A;  2EYF A;  2F0V A;  5IGE A;  1SYF A;  3T16 A;  2F0T A;  3TP8 A;  4KHV A;  2EYJ A;  5DAU A;  4EVO A;  4ME5 A;  4NDX A;  4S3S A;  4KY6 A;  1JOO A;  1A2T A;  1SNP A;  2F0J A;  4J1M A;  3V2T A;  5C6A A;  5M9O A;  5EKK A;  3SK5 A;  1KDA A;  2O4X A;  3C1F A;  3MXP A;  5HGT A;  2F0N A;  5IGD A;  1EZ8 A;  1EY5 A;  3S9W A;  3ERQ A;  5F2D A;  3SR1 A;  2PZU A;  3D4W A;  3OMC A;  2EYH A;  4DU9 A;  1STG A;  2SOB A;  2OXP A;  1EY9 A;  3T13 A;  4K8I A;  2KHS A;  5KGU A;  1JOR A;  3PMF A;  5C3W A;  2F3V A;  3SK8 A;  1JOQ A;  2EYM A;  3EVQ A;  1SND A;  3OWF A;  4MIU A;  3MZ5 A;  4J6H A;  2F0K A;  1EY6 A;  1EY8 A;  1RKN A;  1EY7 A;  4RKL A;  1STA A;  4N9T A;  2PZW A;  1IHZ A;  3R3O A;  2OEO A;  4KTA A;  1KAA A;  4QF4 A;  4R8N A;  5J1Z A;  3C1E A;  1F2M A;  2PYK A;  5CC4 A;  4F8M A;  3D8G A;  1KDB A;  3DHQ A;  4PMB A;  5CV8 A;  1A3U A;  1EYA A;  3NXW A;  3SK4 A;  4DFA A;  4DGZ A;  2KQ3 A;  4IUN A;  5E3F A;  3NHH A;  2EY5 A;  1JOK A;  3SK6 A;  4PNY A;  5CGK A;  4TRD A;  3TME A;  5C4H A;  3ERO A;  3U9O A;  3P75 A;  3LX0 A;  2F0O A;  3ITP A;  3E5S A;  3MVV A;  4K8J A;  4KD4 A;  3BDL A;  4KJO A;  2F0F A;  5IIF A;  1EQV A;  1SYC A;  3QOL A;  3TP5 A;  3NP8 A;  3MEH A;  1U9R A;  5C5M A;  5I6W A;  1EYC A;  2NUC A;  2WAC A;  4K5W A;  3OSO A;  1A3T A;  4KJN A;  4LAA A;  2EYP A;  4HTH A;  3TP7 A;  4ZUJ A;  3NUC A;  4QMG A;  4NMZ A;  5IOD A;  4B9W A;  1TQO A;  2F0G A;  4KV6 A;  4WRD A;  5IGF A;  1F2Z A;  4NKL A;  2F0S A;  3DMU A;  4I65 A;  2EY1 A;  5IGC A;  4HMI A;  5KIX A;  5I6Y A;  5ISR A;  4K5X A;  3HZX A;  4E6I A;  1SNO A;  3QB3 A;  3OMG A;  2RKS A;  4KY7 A;  3H6M A;  5J39 A;  3RUZ A;  1TR5 A;  1EY0 A;  2EYO A;  1A2U A;  3D4D A;  2F0D A;  3MHB A;  5CV6 A;  4K6D A;  2PZT A;  3NK9 A;  2F0E A;  3QOJ A;  5KYI A;  5I9P A;  5IOC A;  2F3W A;  2QDB A;  3EJI A;  4IZ8 A;  5KEE A;  5KYL A;  1SYB A;  4EQN A;  1STN A;  4KY5 A;  5EGT A;  5CR3 A;  2EY6 A;  4K14 A;  5JAV A;  5K5P A;  4HMJ A;  1EZ6 A;  4EQO A;  1SNM A;  5I9O A;  2RBM A;  1EY4 A;  4F7X A;  5C4Z A;  1SNQ A;  5KRU A;  4PMC A;  2EY2 A;  5JOB A;  1TT2 A;  2PQE A;  4ODG A;  3SXH A;  5C3X A;  1SYD A;  5HUR A;  5IGB A;  2PW5 A;  4YIJ A;  2EYL A;  1STH A;  4K2K A;  2OF1 A;  5CV4 A;  4KD3 A;  5CV7 A;  2F0L A;  2ENB A;  2SNM A;  5C5L A;  1KDC A;  5EKL A;  3D6C A;  1A3V A;  4B9X A;  4ZQ3 A;  2LKV A;  5DEH A;  1EYD A;  4NP5 A;  3NQT A;  2SNS A;  3VA5 A;  1AEX A;  1ENA A;  1NSN S;  4ZUI A;  4G57 A;  2M00 A;  5NUC A;  5J22 A;  4H7B A;  2PW7 A;  1ENC A;  2F0I A; 
#chains in the Genus database with same CATH topology
 1IKM A;  1E2W A;  3SGI A;  1D5Z C;  4OL7 A;  2JA8 H;  2F0M A;  2E5L Q;  3G6J B;  4N9P A;  4FXK C;  2N88 A;  2HHH L;  1NUC A;  5C0X J;  3HOW H;  1TWC B;  2NVT B;  4WOR A;  2F52 A;  1SDF A;  3HOU H;  2HQL A;  2ZTC A;  1Q46 A;  3NBI A;  4DK1 A;  5E1F A;  2R92 B;  3DM3 A;  4DV5 L;  2HIV A;  1PTO C;  1R4Q B;  4M1U B;  2MUY A;  2UU9 L;  1Q8I A;  4AH6 A;  1CA6 A;  5L37 A;  3ONA B;  4LFC Q;  3A7A B;  2J4X A;  1HA5 A;  2EYH A;  1GKH A;  2Q8T A;  5JVG 3;  2KHS A;  1BF4 A;  4MIU A;  1D6E C;  4QQB X;  1WCM G;  1EY6 A;  4DV3 L;  1HXY D;  2K05 A;  3VYS A;  1H9S B;  4DV2 L;  1CKN B;  2FFK B;  1DOK A;  2HIX A;  2VL6 A;  4IFD I;  1C0A A;  4IUT A;  2IHE A;  1KDB A;  1XPO A;  1WTH A;  4UPA A;  1CT1 D;  1B9M A;  4IPC A;  5E3F A;  3BVZ A;  1JOK A;  4PNY A;  3U9O A;  4R8N A;  3ITP A;  3Q8D A;  4OEM B;  1PFS A;  4CKE A;  4BY7 H;  1U9R A;  2PMZ E;  2HD3 A;  2YTV A;  5C0X H;  1EYC A;  2WAC A;  4CDF C;  1J5E Q;  2EYP A;  1VQ9 A;  3KOJ A;  3MA2 B;  2WII B;  4DR6 Q;  5IGC A;  3CCL A;  2WB1 B;  1RF2 D;  4L5Q A;  3E9I A;  3DUZ A;  3M85 A;  2KVM A;  4N8F A;  4DR7 L;  2NBF A;  1DYQ A;  2EOT A;  3Q6S A;  3VR3 A;  5A2Q L;  1VF7 A;  4YHH Q;  5IT9 E;  2JEA I;  1I50 H;  3U9S A;  5KYL A;  2O5J C;  4TVA B;  1FGU A;  1AW7 A;  4B3M Q;  1EY4 A;  3Q0A A;  2G9D A;  2PQE A;  5IP7 H;  4GN5 A;  1PHJ A;  3IL8 A;  4UHV A;  1Y1W H;  5LMN W;  1WTO A;  3M4O B;  3M4P A;  4LUZ A;  1SE4 A;  1HTL D;  5KND A;  3GDE A;  2K7V A;  2TMP A;  5JEA J;  2NZO A;  2Y0S B;  1PTO H;  3WWV A;  1X6O A;  1K3R A;  4AIM A;  3GTJ B;  3T4A C;  3SDZ A;  4JBK A;  2TSS A;  2AUK A;  1PZK D;  1WCM B;  4JC0 A;  3S1M H;  5C4J B;  3RZD B;  4A4I A;  1SNC A;  2GA4 B;  2VXW A;  2EXZ A;  1Z47 A;  1LTS D;  3CD6 A;  3I55 A;  4KLK A;  5K36 G;  2F0P A;  3A8J E;  2EE1 A;  3CAM A;  3D31 A;  1U4M A;  1X65 A;  4UP9 A;  2PI2 E;  3T1H L;  1EOT A;  2CW0 D;  4NDX A;  4EGV A;  2L0C A;  2IPK D;  2Z1C A;  2B2Y C;  1JWU D;  2VB2 X;  5FO9 B;  1Q8K A;  2KCM A;  4DK3 C;  1B70 B;  2N78 A;  3RNU A;  1HFG A;  2K5V A;  2OXP A;  4R8I A;  2AQ2 B;  3CPW A;  1Y1V B;  2Z8L A;  3H0G G;  3WOF A;  1SBB B;  2BE5 D;  3EVQ A;  4JI6 L;  3OWF A;  2EJM A;  1ICF B;  1RKN A;  3ERS X;  3HFZ B;  4G7Z C;  3J80 i;  3BZC A;  3GO5 A;  3HOZ B;  4BWG B;  2EXD A;  4QF4 A;  1KAA A;  1PRT F;  3J80 L;  4QUF A;  1YIJ A;  4CJ2 C;  3HOX G;  3R2I A;  2JA7 B;  3NHH A;  2JA5 G;  3SK6 A;  2ZJR A;  4LFB L;  1X3Q A;  1YNN C;  4OO1 H;  3PO2 G;  5GAE C;  3AB9 A;  2E2I H;  4NPS A;  3NP8 A;  1RTO A;  4N8X 1;  1IBM Q;  3G6E A;  2JEB I;  4NMZ A;  4P2C B;  3KF6 B;  3T1Y Q;  1PTO F;  1DM0 B;  3STB C;  1WTW A;  3ICE A;  5JJL A;  2K75 A;  2VQF Q;  1PFM A;  1A63 A;  3VA7 A;  1AZQ A;  1TWH B;  4IUU A;  5E4W C;  1L0X B;  4P75 A;  4WJW A;  2F0E A;  5FJ8 H;  3HOY H;  5I4D A;  1TWC H;  1YIT A;  3M4Q A;  2IW3 A;  3A56 A;  4ZLT F;  2J7Z A;  3CCM A;  4A3L H;  5KRU A;  5GAG C;  2R92 H;  2NVQ B;  1I3Q B;  4JI5 Q;  3OYY A;  1SYD A;  1FR3 A;  5DM7 3;  3HOV B;  1LTB D;  1MIU A;  1DGS A;  4AYB G;  1ML0 D;  5CV7 A;  2OQ0 A;  1E1O A;  4Q0F A;  4HR7 B;  4JVZ A;  3ND8 A;  1PH3 A;  4NXM Q;  1CI3 M;  4A93 G;  1MD2 D;  1N34 L;  1D8L A;  3CCU A;  4C3H H;  4G7O C;  4BY1 G;  4ZUI A;  4G57 A;  3PUZ A;  4H7B A;  4KHP Q;  3H0G B;  1T9H A;  3KF8 B;  3H09 A;  2F0W A;  1CHQ D;  1YNX A;  4HIK A;  3LWU A;  2Q8I B;  1NE3 A;  4DV1 L;  3CCJ A;  1G2S A;  4OIJ A;  1E7Z A;  4OWT B;  3TP6 A;  1XJV A;  1AH9 A;  1UE7 A;  4GN3 B;  4HIO A;  3PO2 B;  5GAH C;  1VQF A;  1JWS D;  3V2T A;  5HGQ A;  2O4X A;  1S3O A;  3ERQ A;  5M3M B;  3SEB A;  4A3G B;  1L1O B;  1UEA B;  5KGU A;  1JOR A;  3PMF A;  5C3W A;  3SK8 A;  4JI0 Q;  4DR3 Q;  3PF4 A;  1JOQ A;  3C46 A;  1EIY B;  2QGQ A;  2SEB D;  4RH6 A;  1TWF H;  1QCB D;  3NTH A;  3O13 A;  4BXX H;  1QVC A;  5EPJ A;  1EYA A;  4LUV A;  4DGZ A;  1BKB A;  1F9S A;  2KUM A;  5AFW A;  2FMM A;  3TDQ A;  3CHB D;  2NN6 H;  3F1Z A;  1T5X D;  2HUG A;  1BQQ T;  3A54 A;  1EFI D;  5I6W A;  1DON A;  4WJ4 A;  3M4O H;  2KEN A;  2K04 A;  1K83 B;  2E75 C;  3CCE A;  2YYZ A;  1R9T B;  4AYB B;  1YEZ A;  2B8G A;  5ELC A;  3NWS A;  5IGF A;  1TWG B;  5I6Y A;  1SE3 A;  4A93 B;  4JI3 Q;  3QB3 A;  3OWE B;  3GTJ H;  4BY1 B;  1RCV D;  1PFN A;  1HPC A;  3TQY A;  1LTR D;  1KNA A;  4IJL A;  2KEC A;  3I4N G;  1WCM H;  1PA6 A;  2MO1 A;  1C8C A;  3RZD H;  4MHE A;  4GOP A;  1HZ9 A;  3FKI B;  2O2L D;  4KKS A;  3PGZ A;  5FK9 C;  5JAV A;  4BS9 A;  4LUO A;  4IOC A;  1D5M C;  4F7X A;  1VQJ A;  5IP9 H;  2Q2T A;  2B2V A;  4F87 A;  1FVI A;  4L8J A;  1ENF A;  3I70 A;  3GV3 A;  1D5X C;  4LMQ D;  4HIM A;  1MJE A;  4CJ1 B;  1AZP A;  2ENB A;  2WFW A;  1MGS A;  3JC6 6;  2WAQ B;  1JWM D;  4GKJ Q;  1EU4 A;  4NP5 A;  1XPR A;  1RL2 A;  2CWP A;  1UEB A;  1Y1V H;  2EJF C;  5CBA E;  4LJZ C;  1IBL Q;  3NTI A;  5BN3 A;  1H9R A;  1VDZ A;  3LGJ A;  2WB1 E;  4TQU S;  1HNW L;  2B2T A;  3HOZ H;  4XXE A;  4DR5 Q;  1A0I A;  3OTO L;  1K9M C;  1RDP D;  1FD7 D;  1I4Q A;  1DJR D;  1JIC A;  2AQ3 B;  1SE8 A;  1L1O C;  2K5D A;  1ZYR D;  3C1F A;  4JI2 L;  3K6O A;  4X66 L;  2K6A A;  2I07 B;  3E9H A;  1H95 A;  2Y0S E;  5BN5 A;  1NY4 A;  2VUM B;  1GO3 E;  1TU2 B;  2PNR C;  2UUB L;  2RHQ B;  4K0K L;  1CK1 A;  2PZW A;  2I46 A;  2V1C C;  1TWH H;  1WTR A;  2PYK A;  4F8M A;  4R4O A;  1I94 L;  3K5M A;  3I4N B;  3CP0 A;  5C3E G;  3RMH A;  2CVR A;  2F4V L;  5D65 A;  4JOI A;  5CGK A;  1PH4 A;  3K80 C;  3ERO A;  4DK0 A;  4GKK L;  1GUN A;  2F0F A;  3GTQ B;  2NVQ H;  1AN8 A;  1M4V A;  2K5N A;  4PQX A;  2VS1 A;  1I3Q H;  3J80 c;  3HOV H;  2DY8 A;  3OSO A;  1OXV A;  1QUQ B;  4HTH A;  1QWY A;  1XTD A;  4ZUJ A;  4ZCK A;  4DV0 Q;  2JA8 B;  1IBK L;  4Q5V A;  2E2H H;  1VMP A;  1OO9 B;  2R7F A;  4I65 A;  4HMI A;  2LXK A;  3HOU B;  2EJG C;  3BYT B;  1PH7 A;  2RKS A;  3BDO A;  1N33 Q;  2ZM6 Q;  1FJG Q;  1HR0 Q;  3H0G H;  4FF2 A;  4JYA L;  3CRL C;  4KKT A;  3I7F A;  5KYI A;  3DWP A;  5LL6 X;  1GUT A;  3CXC A;  1STN A;  1EFW A;  1QVF A;  2LFN A;  1SNQ A;  3BZD B;  4ODG A;  3SXH A;  5C3X A;  1DZ1 A;  3I90 A;  4DUY L;  1PH2 A;  3HRZ C;  3PO2 H;  5T1I A;  2QEX A;  3BYY B;  5LMN L;  4FXD A;  4FP5 D;  3NEM A;  1CQF A;  1ROD A;  2B3G A;  1PH1 A;  5BR8 L;  2FIN B;  1KHI A;  4A3G H;  5GAD C;  1UE1 A;  2VY3 A;  3DLL A;  1AEX A;  3H15 A;  4LF6 Q;  4H0L C;  1EIH A;  2C35 B;  1K8M A;  3TP7 A;  2UUC L;  2DNC A;  4MTN A;  1JE5 A;  2A5H A;  2A69 D;  2LXJ A;  5CV9 A;  1PH5 A;  3VYR A;  3GTK B;  1HZB A;  3UI2 A;  3H3V I;  1I6H H;  1N32 Q;  1HNZ L;  4QIW B;  4YY3 Q;  1II3 A;  2XVS A;  3P1H A;  5G3L F;  4A3D G;  2XN9 C;  1NMF A;  5IY0 A;  1S5D D;  4DR1 L;  1SNP A;  1E3P A;  1ONL A;  4RCN A;  2AWN A;  4HJ5 A;  1ESR A;  2BH2 A;  3PUY A;  1NNX A;  3HKZ G;  5F2D A;  2B2U A;  4FNF A;  1AP0 A;  3RLF A;  2UXB Q;  1ASZ A;  4PZ8 A;  2H5X A;  1K83 H;  3ZYY X;  3PCO B;  1R9T H;  4IUQ A;  5C0X I;  4K8I A;  1YNJ D;  1PH8 A;  1FNV A;  4GNX A;  1TWG H;  5CMD A;  1I50 B;  4A93 H;  3CC4 A;  1STA A;  1TKW B;  4N9T A;  4BY1 H;  1QJO A;  3IRB A;  3K0X A;  5J1Z A;  3S2H B;  4GS3 A;  3V05 A;  1UE5 A;  2N55 A;  4OX9 L;  3CKI B;  2CW0 C;  1LYL A;  4LF4 Q;  2FXQ A;  5A2Q E;  3GQB A;  4JI8 L;  4K8J A;  1TXY A;  3FPU B;  5IIF A;  3NQI A;  1SFO B;  3W3A A;  3J81 i;  4JI1 L;  1NBW A;  3UDX A;  1MJC A;  3J81 L;  2NUC A;  1LM0 A;  1LTA D;  3MXN A;  3D0F A;  4KJN A;  4LAA A;  1QB5 D;  2B63 B;  4V19 0;  1U4P A;  5IOD A;  4B9W A;  1O80 A;  4MTK A;  3X3N A;  4R4I A;  3HZX A;  4OEL B;  2ZJQ A;  5DNF A;  3MTS A;  3N6R A;  3CW2 C;  5CV6 A;  1I5F A;  2PZT A;  3W1B A;  4KN7 C;  1YJW A;  1HNX L;  2XWB B;  1YVC A;  3VR2 A;  3TS0 A;  5K5P A;  3H94 A;  5CR3 A;  2EY6 A;  1I4G A;  1SNM A;  5LL6 S;  1IYV A;  4DR4 Q;  4RGM A;  4PMC A;  1TT2 A;  4DR2 L;  4HCS A;  1Z7T A;  4O2D A;  1KLG D;  5FKA C;  4CDD C;  1KD1 C;  4A3B B;  3S15 B;  4LF7 L;  2SNM A;  4FF1 A;  4C3J G;  4J15 A;  1EQR A;  4AYB E;  3F2D A;  1X9N A;  4PZ6 A;  4OGQ C;  2AMC B;  4JBJ A;  1ENC A;  2VUM H;  2DNE A;  1KL9 A;  3L0O A;  2YTX A;  5CV5 A;  1UE6 A;  5JVH 3;  2FMC A;  4LFA Q;  2EVB A;  3KBX A;  3AMU A;  1HH2 P;  2E8G A;  1BBX C;  2RSN A;  3I4N H;  2BA1 A;  4ME3 A;  3J80 E;  5EBD A;  3TN2 A;  1CHP D;  2KHJ A;  1XNQ Q;  2F0V A;  1JMC A;  3PUX A;  3J81 j;  3D6W A;  3GTQ H;  4KY6 A;  2AKW B;  4CKC A;  3FP9 A;  4OWX B;  3SR1 A;  2E5L L;  1P8L A;  2RVL A;  2JE6 I;  2PZU A;  2PQA A;  3D4W A;  1CZW A;  3W2D A;  3HOY B;  2WAQ E;  3R8B A;  1EY8 A;  2D0P A;  1X56 A;  1EY7 A;  2F3I A;  1NR4 A;  4R9W A;  1ASY A;  1QNK A;  4X6A H;  4XT3 B;  2A6E D;  4JK1 C;  1KRS A;  1STE A;  5M5Y H;  4A3K B;  1Z6H A;  1A3U A;  1K8A C;  4LF5 Q;  2I5M X;  1KIX A;  3K5N A;  4X64 Q;  5IYB G;  3FDT A;  1VQ4 A;  1EQV A;  4TKO B;  3F2U A;  1JE4 A;  5C5M A;  3QJY A;  4C3H B;  2L1B A;  2HCC A;  1ET9 A;  1IL2 A;  5KNC A;  1JJC B;  2F0G A;  1ESF A;  3DMU A;  1L0Y B;  3KDF B;  4C3J B;  4QJF A;  3BG3 A;  4RCO A;  1PFB A;  3CRK C;  5J39 A;  2P5Z X;  1HZC A;  3CME A;  1VQO A;  2XWJ B;  1YHB A;  5C44 B;  3GTK H;  3TEH B;  4GLV B;  4JI7 Q;  5D3D A;  1S5F D;  5EGT A;  1J5E L;  1KQS A;  2JA6 G;  5I9O A;  3OIP A;  3HKS A;  2L4N A;  4DR6 L;  3QR8 A;  1WD0 A;  1I4X A;  4C1N I;  1VMC A;  1TY2 A;  5TSS A;  4DV3 Q;  3VR4 A;  5ELN A;  1C48 A;  4YHH L;  1K73 C;  1G6P A;  2R61 A;  1J6Q A;  1Q12 A;  1TWF B;  1NAP A;  3BVM A;  3GV6 A;  4IPG A;  1NSN S;  4XIG S;  4IPD A;  2LS0 1;  2Z9H A;  5M3F G;  4A3E G;  3S2H H;  1GXD C;  2I5H A;  3NTK A;  5IGG A;  1STY A;  3JAM i;  3U4Z A;  2ZXO A;  4B3T Q;  2R7Z G;  4Y52 H;  4PZ7 A;  1V1Q A;  3JAM L;  1XNR Q;  2F0H A;  4DV6 Q;  1Q81 C;  4JG2 A;  1SFO H;  1LAB A;  5EKK A;  5IGD A;  1EEF D;  4ZYS A;  2NN6 I;  3VYT A;  2MO0 A;  2B63 H;  3J7A V;  2F3V A;  4QUC A;  2EYM A;  4JBW A;  1SND A;  1M8A A;  3MZ5 A;  2VW9 A;  3UDF A;  3H91 A;  4R4Q A;  1UNS A;  3B6Y A;  5IE8 A;  4PMB A;  2EIF A;  5GQO A;  1WFQ A;  4C56 C;  3E0J A;  2MQH A;  1ZYR C;  4QIW E;  2LSS A;  2NWG A;  2UXC Q;  2GVA A;  1SR3 A;  1TVX A;  4X65 Q;  1SYC A;  1Y14 B;  1X32 A;  4DN4 M;  4HJA A;  4FF4 A;  4Y7N B;  1QIL A;  4XYO A;  2MP1 A;  2IX0 A;  3RN5 A;  4A3B H;  3S15 H;  1WYD A;  2B2W A;  3RZO H;  1X3E A;  1EQQ A;  3A5Z B;  3S17 B;  2KCT A;  4A3M G;  2EY1 A;  3CC2 A;  1JC7 A;  2K1B A;  1GHJ A;  1JJ2 A;  2B2V C;  1A62 A;  4KY7 A;  1PYB A;  2N49 A;  1XMO Q;  2BOS A;  3S24 A;  3J81 c;  5M5X B;  1B4O A;  5I9P A;  1Q7Y C;  2QDB A;  1IBM L;  1Q3L A;  1CKO A;  4U67 3;  1SYB A;  2BDO A;  3L3O C;  3L9A X;  1QOH A;  1J9O A;  4CKB A;  3T1Y L;  1N8R C;  4AQY Q;  1YHA A;  2G9H D;  4NXN L;  2IWH A;  5LMU L;  2VQF L;  3R2T A;  1STH A;  5FO8 B;  5IYD G;  2K33 A;  4ZQ3 A;  4A76 A;  1J8I A;  4CHT B;  4GN4 B;  1X3P A;  1GUW A;  3PSI A;  5J22 A;  2RDG A;  2F0I A;  3WDN A;  2RQX A;  3AYH B;  4XQQ A;  4X62 Q;  2JN4 A;  4RG1 A;  1F2Y A;  4JI5 L;  3ZJY C;  1NTG A;  1NR2 A;  1CZG A;  3SHL A;  2A73 B;  4A3K H;  4TSS A;  3OW7 A;  2A6H D;  1MBY A;  1A6X A;  1AFP A;  1VQA A;  1CFM A;  2MJ8 A;  5IGE A;  2UUA Q;  4FVM A;  2IL8 A;  4LF8 Q;  5DAU A;  2E2H B;  3K7A H;  2QA4 A;  1D1K A;  2F0N A;  3ULL A;  2GVB A;  2V4D A;  3OMC A;  4H02 A;  4O1N A;  1JQY D;  3J7Z C;  1EY9 A;  2A69 C;  3K8A A;  4JI4 L;  1JCK B;  3PIP 3;  1NMG A;  1O7I A;  4C3J H;  1HCZ A;  1PVO A;  4A3M B;  3S16 B;  3AU7 A;  5JJK A;  1IZ6 A;  4RMF A;  2I5L X;  3HG9 A;  3GTG H;  4FYD A;  4B08 A;  1TS2 A;  3HOX B;  3C1E A;  1F2M A;  5CC4 A;  3A5U A;  3TRE A;  1RIP A;  1WJJ A;  2A19 A;  2RHS B;  2JA5 B;  2KJX A;  5C44 H;  1ET6 A;  4DAY A;  1PH6 A;  2A68 C;  4OXP A;  2E76 C;  4O42 A;  5FLX L;  3I4L A;  4KJO A;  1XPU A;  3KJO A;  4JBM A;  4JI0 L;  4DR3 L;  2XIW A;  1O7L A;  4U68 A;  2RA4 A;  2KA7 A;  5EBC A;  3G48 A;  3QG1 A;  4UP8 A;  4A3I G;  2KED A;  1DOL A;  1BCP D;  4KV6 A;  1F2Z A;  1H9K A;  4RGO S;  1I6H B;  4K5X A;  1FNW A;  1CSP A;  3H6M A;  5IYC G;  3U58 A;  1QZH A;  3BZK A;  1EY0 A;  2CKZ B;  2VZA A;  4EX5 A;  2IX3 A;  2RF4 A;  4KY5 A;  1GUG A;  3V96 A;  2OT2 A;  1VQI A;  2LY7 A;  4A3C G;  1LT5 D;  3CMA A;  3WOE A;  3E6Z X;  1VCI A;  5IYB H;  2K14 A;  3A74 A;  4K6L A;  4K2K A;  2OF1 A;  5DLQ E;  1E0B A;  1FL0 A;  3KLS A;  3DM1 A;  4RGT A;  3OIQ A;  2KBN A;  2A1A A;  1VF5 C;  1D7Q A;  4HN7 A;  1OXX K;  4RKB A;  1VQG A;  2JSO A;  3C2P A;  3KUP A;  1X3G A;  4HSV A;  1QG7 A;  2K50 A;  1BXT A;  1RJT A;  2B2U C;  1O7Z A;  1STB A;  2YTY A;  5T1G A;  2DGY A;  3BDC A;  4APV A;  1UWV A;  1VS0 A;  3P7J A;  3TBI B;  3HS0 C;  2B2Y A;  2ZT9 C;  3TRZ A;  2JA6 H;  1IXR A;  1CUK A;  1H9S A;  1W6J A;  2VB3 X;  1CKN A;  3FRP B;  4Z9C B;  2F0J A;  2CHB D;  3P20 A;  3SK5 A;  4IUV A;  1AE3 A;  4GLX A;  4JW0 A;  3KYH C;  4Y7N H;  4MZ9 A;  3A8K E;  1Q1B A;  3J81 E;  3JAM c;  4A3I B;  1IKL A;  4DR5 L;  3S17 H;  2MFI A;  1KNE A;  1MKH A;  2F1M A;  3EA6 A;  1L0W A;  2N8N A;  1IHZ A;  2ZTD A;  1HJP A;  2EPB A;  3FVQ A;  1K0S A;  5M5X H;  1AE2 A;  3CCR A;  3HOW G;  5M3F H;  4A3E H;  3SK4 A;  3M4Y A;  1SXT A;  4LWC A;  3P75 A;  3E5S A;  3SVM A;  1BUV T;  1K0R A;  3NE5 B;  3QOL A;  1G8Z D;  1WVL A;  3K7U C;  4UAI A;  3CQZ B;  2CFM A;  4QMG A;  1V1P A;  3TZD A;  1N36 Q;  1QE6 A;  3URY A;  5FOB B;  1SMX A;  2A6E C;  3ULP A;  3M9B A;  2PPB C;  4E6I A;  1HUN A;  4POF A;  4LF9 Q;  4HID A;  1TR5 A;  3KJP A;  2EYO A;  3QO2 A;  2F0D A;  1H9J A;  2L15 A;  3NK9 A;  4IUR A;  1WTP A;  4HSP A;  5K36 H;  4K14 A;  2K01 A;  1EZ6 A;  3RD4 A;  4DV0 L;  2Q2U A;  2JP1 A;  4YWL A;  3CCS A;  4DV7 Q;  1N33 L;  2ZM6 L;  1FJG L;  1HR0 L;  5C0X G;  2D62 A;  3FHW A;  1LO5 D;  2XGT A;  2L12 A;  1ENA A;  3RN2 A;  2VQE Q;  5NUC A;  2F4V Q;  1LT3 D;  5M5Y B;  1OTC A;  1KC8 C;  4A3M H;  3S16 H;  4JV5 L;  1EOV A;  1SYE A;  2F0Q A;  2B39 A;  3HOX H;  1B44 D;  2JA5 H;  3MWY W;  2HQE A;  2AUJ D;  1XX8 A;  1I4R A;  4CDC C;  1IBK Q;  2JK8 A;  4UDU C;  2M9V A;  3AFP A;  4LF6 L;  2Q2H A;  3VR6 A;  3GTO H;  3RR5 A;  4CGY B;  1Y1W G;  1EWI A;  4OON A;  5EPK A;  2L55 A;  1STG A;  3D3R A;  1N32 L;  3MFG A;  5IYD H;  1YJ9 A;  2OTL A;  1LT4 D;  1CTM A;  3S1N B;  3KBG A;  2IJ0 A;  1XMQ L;  2Z6K A;  5C3E B;  4PV1 C;  3UE0 A;  1VQN A;  4R4C A;  3OW2 A;  4B3R L;  2X6G A;  2UXB L;  3TME A;  3CC7 A;  1LTG D;  4O0A A;  3A55 A;  3BDL A;  1ZKO A;  1U4L A;  3TP5 A;  5D14 A;  2NTS A;  2XRS D;  3VYU A;  4LK1 C;  5JPN C;  4XTC S;  1SMY D;  1SRO A;  2K5Q A;  4ALP A;  4RGN A;  5J3B A;  4KK7 A;  4XT1 B;  3MEF A;  2F0S A;  4DNR B;  4LF4 L;  4DUZ Q;  5FLX c;  1DD2 A;  1GVP A;  2O5I C;  3EBE A;  3RLO A;  1DXM A;  3E0E A;  4JCV E;  1TY0 A;  1EU3 A;  3QOJ A;  3FEW X;  1UUP A;  4QCL A;  4EQN A;  1IYJ B;  5JEA G;  1CM9 A;  2RCN A;  3IFT A;  3K57 A;  2WKD A;  4QY7 A;  2BE5 C;  2EY2 A;  5JOB A;  4IOA A;  4X3K A;  3KF8 A;  4CDE C;  3JAM E;  2PW5 A;  5D3I B;  2EYL A;  2UXD Q;  1U4R A;  1VQ7 A;  1N9W A;  5CV4 A;  4KD3 A;  2R6G A;  1KDC A;  2BA0 A;  1BCP B;  5IWA Q;  4OX9 Q;  4V0B A;  2K5W A;  4RAU C;  4A3I H;  4DV4 L;  2CQA A;  2NYZ D;  3J7A F;  4HJ9 A;  1PYW D;  2QCP X;  1KAB A;  2ZXR A;  1CKM A;  5ELD A;  2IX1 A;  1K28 A;  4DF7 A;  2NZ1 D;  5IYC H;  5FJ8 G;  2EZV A;  3PIO 3;  4YCW A;  4A3D B;  4DXG A;  4NB3 A;  2WV6 D;  1XTC D;  4ZKC B;  3TP8 A;  4P74 A;  2EYJ A;  4ME5 A;  2OCE A;  1A2T A;  2QW7 A;  3HKZ B;  3RZO B;  1FNU A;  3MXP A;  3TSS A;  4RFB A;  3CQZ H;  4IFD G;  4LFA L;  1PYS B;  1YJN A;  3AEV A;  4A3J G;  1GUO A;  1EL0 A;  3GTP B;  2DY7 A;  3NEN A;  1SEB D;  4DAV A;  1SN8 A;  1R4P B;  2PO4 A;  5AJ3 L;  1SE2 A;  5COR A;  1EYG A;  1U0L A;  1EWH A;  1XNQ L;  3GTM B;  2A6H C;  3R3O A;  3RLN A;  4KMU C;  2L9H A;  1C9O A;  1VQB A;  3I56 A;  1B2T A;  2ICI A;  2X6L A;  3TS2 A;  1LTL A;  5ELE A;  4MN3 A;  4OO1 I;  1ILP A;  1MI2 A;  1S5E D;  3SE0 A;  1T5E A;  1S72 A;  1A3T A;  1B3Q A;  4P72 A;  1EIF A;  2NZH A;  1WTV A;  1RTN A;  4LF5 L;  1TII D;  1WOC A;  3IKJ A;  1LT6 D;  3BVG A;  1F77 A;  3U50 C;  4DKA C;  4XYQ A;  3S14 H;  5JJI A;  4X64 L;  5ELF A;  2WB1 G;  2WKC A;  4B3S Q;  3UDG A;  4LFC L;  3IAY A;  4K6D A;  2F3W A;  2JXM B;  5GRO A;  2HDL A;  4BXX G;  3K7A B;  4X3T A;  4HMJ A;  3F2B A;  3I2Z A;  1Y8P B;  2HHH Q;  2ATW A;  1BCP C;  2NN6 G;  2ICE C;  1S4Z A;  3L7Z C;  1B50 A;  2WIN B;  2R3Z A;  5FLM G;  4GOP B;  1V43 A;  3GTG B;  1EYD A;  3QIA A;  4DV5 Q;  2DUD A;  4FDB A;  3VA5 A;  4A3J B;  4JI7 L;  2Y0S G;  3E3X A;  4P71 A;  2K28 A;  3VDY A;  2Z0S A;  1G2T A;  2UU9 Q;  5I2Y A;  3HEJ A;  1DCZ A;  2ZJP A;  2K5H A;  3S1N H;  2J0T D;  2IHF A;  3H3V H;  2F0U A;  5C3E H;  1B53 A;  1K3B C;  3PV0 A;  2DJF C;  4FF3 A;  5CBE E;  2KOL A;  3MAQ A;  1HR0 W;  4ZAI A;  2N3S A;  5H1S E;  2EYF A;  4DV2 Q;  4ZRZ A;  4KHV A;  1Q86 C;  1HTP A;  4LW1 A;  4EVO A;  5IP9 G;  1C4Q A;  1SRU A;  1MSG A;  5EQ0 A;  5FLX E;  3Q23 A;  3QWN A;  4GLA C;  3I4M G;  2B8F A;  4IN3 A;  4DU9 A;  4QL5 A;  4B3M L;  2SOB A;  1X54 A;  4QGU A;  4KI0 A;  2PCF B;  4B3T L;  1Y1V G;  1XNR L;  4DV6 L;  3KLW A;  3NWT A;  2OEO A;  4H44 C;  1S5B D;  1QUQ A;  3ER0 A;  3HOZ G;  2M2L A;  2NB0 A;  4IUN A;  4BBS G;  1HUM A;  2JA7 G;  1S40 A;  3F2C A;  4DR7 Q;  2R93 G;  2CH4 A;  1V1P B;  4DAP A;  3IFD A;  4L5R C;  2IT1 A;  3PIP A;  2F4I A;  2ID0 A;  3OHX C;  4R1J A;  3T56 B;  3U4V A;  1WTX A;  2NVX B;  1LTT D;  1GD7 A;  1TWA B;  3KFU A;  5ISR A;  5KIX A;  3I4O A;  3OMG A;  2UXC L;  1HFN A;  2K32 A;  3D4D A;  4X65 L;  2SDF A;  2JA6 B;  4G7H C;  4A3F G;  3KLR A;  2E2D C;  3EJI A;  3M7G A;  3DWQ A;  3ULJ A;  1D2B A;  3Q24 A;  4A3D H;  4HED A;  2NTT A;  1PZI D;  4GOP C;  4ILW A;  1VQE A;  4G4K A;  4HJ8 A;  3UE1 A;  5IGB A;  3PO3 G;  2PI2 A;  2OQK A;  1W2B A;  3HOV G;  1XMO L;  1KRT A;  1B9N A;  2F0L A;  3I73 A;  5EKL A;  3D6C A;  3EFX D;  3I4M B;  1CQV A;  1F9Q A;  2SNS A;  2AWO A;  3T1H Q;  4DXF A;  3K0Y A;  3GTP H;  5M3F B;  1MHW C;  4A3E B;  1EQT A;  1S5C D;  3GTM H;  3NPP A;  3OPO A;  4AQY L;  4EQP A;  4BBR G;  3GTL B;  3BU2 A;  1B7Y B;  3S2D B;  1E1T A;  2R7Z B;  4YCU A;  2CQO A;  2FJ2 A;  2WP8 J;  4JI6 Q;  4RHR A;  1SLJ A;  4IFD J;  2B2T C;  4ID6 A;  4BBS B;  4IPH A;  2DJG C;  2L11 A;  1Y8N B;  5JEA H;  4S3S A;  1JOO A;  1X3F A;  5C6A A;  4OHJ A;  2R93 B;  1KDA A;  3S9W A;  2R7D A;  5HGT A;  1EY5 A;  4X62 L;  2FHT A;  1IW7 D;  3LNN A;  1P16 A;  3T53 B;  2YU9 B;  4LFB Q;  1W6K A;  2ZXP A;  4POG A;  4GZY C;  5M3M G;  5M5W B;  3T13 A;  4A3G G;  4RHS A;  1BCP F;  4C2M B;  4MNO A;  4J6H A;  1QZG A;  3DEO A;  1XWE A;  4XDX A;  2UUA L;  1PZJ D;  4LF8 L;  1NJI C;  1RHP A;  2XSC A;  2Z4H A;  5LMU Q;  2I0Q A;  4NXN Q;  3D8G A;  5CV8 A;  4NXM L;  1Q1E A;  1LV9 A;  4DFA A;  1NCV A;  4A3F B;  2D9U A;  2A74 C;  4KHP L;  2Q2I A;  3UDI A;  1KAW A;  2NVT H;  4GNX B;  4EQ5 A;  4JOI C;  1JJG A;  5CYU A;  3HKZ E;  3PO3 B;  4I7A A;  2C9O A;  2RCF A;  3NBH A;  1LAC A;  1VQD A;  2KCC A;  2B29 A;  3I3C A;  4IFD H;  3G7L A;  4BA1 I;  4A3J H;  1VQ8 A;  1SNO A;  1PRT D;  3CCQ A;  2NVY B;  1Q90 A;  3NSW A;  1HZA A;  1BO0 A;  1TS3 A;  1F9P A;  4C3I G;  2OWO A;  5IOC A;  3MXN B;  5KEE A;  2K52 A;  1YI2 A;  4BBR B;  1W3S A;  1N34 Q;  3GTO B;  1F9R A;  1I4H A;  1YBY A;  4EQO A;  3FKI G;  2PNH A;  1YNJ C;  1SMY C;  2Z6B A;  2JJQ A;  4JI4 Q;  1BVS A;  5HUR A;  4YIJ A;  3MC0 B;  2MGS A;  1FGB D;  4YWK A;  4DV1 Q;  1U5K A;  2KHI A;  1PTO D;  2LKV A;  1M90 C;  4CBV A;  4OWW B;  5C4X G;  2WAQ G;  5IT9 L;  1EWC A;  2X69 A;  2K4K A;  4KHZ A;  3HGB A;  3S1Q B;  1JT8 A;  2KEE A;  4JPB W;  1GM5 A;  5COY A;  4XQJ A;  3GD7 A;  2HDM A;  3LWE A;  1VQP A;  1SYG A;  3MFY A;  2BDN A;  2RDF A;  2Z4I A;  4JI3 L;  4IAL A;  2ALY B;  3PUW A;  1VQ5 A;  1SYF A;  1XYI A;  3T16 A;  4UP7 A;  1PV4 A;  1KTK A;  5M9O A;  2Z6K C;  3EQL C;  1G6Z A;  1I4P A;  4FO2 A;  3K59 A;  1BDO A;  3AFQ A;  2NVX H;  5A35 A;  5FLM H;  1TWA H;  2F0K A;  2AHO B;  4RKL A;  1GHK A;  3CU7 A;  2VUM G;  1FYC A;  1HRJ A;  4KTA A;  4FXG C;  4GNX C;  4I7Z C;  4GKJ L;  4C3I B;  2PQA B;  2EY5 A;  3KDF A;  2RDH A;  1IBL L;  5C4J H;  2GN5 A;  3LX0 A;  3MVV A;  3I91 A;  2C5C A;  3MXG A;  4DNT B;  4A75 A;  1BNZ A;  3MXU A;  4IJH A;  2QDL A;  3K81 C;  1GJX A;  3TZU A;  1VQL A;  1C7Y A;  4K5W A;  5E4X A;  4L5T A;  2KCN A;  3NUC A;  4R4T A;  4DA2 A;  3J7A 5;  3I4M H;  1PXU A;  4WRD A;  2JA8 G;  2AQ1 B;  1B8A A;  5C4X B;  3RUZ A;  3HOU G;  2IY5 B;  3ND9 A;  3MHB A;  5KNB A;  3CF5 A;  5DM6 3;  4WFN 3;  4IZ8 A;  2RSO A;  3GTL H;  3G4S A;  2R7Z H;  3S2D H;  1HHV A;  3M7N A;  5ELB A;  1TS5 A;  4IQZ A;  1N36 L;  4P73 A;  3N52 A;  5C4Z A;  1UAP A;  4BBS H;  1HNW Q;  1BBW A;  2JA7 H;  2HCI A;  3BS1 A;  1OXU A;  1V9P A;  1VQC A;  4WJ3 M;  2R93 H;  1B1Z A;  4LF9 L;  3L2P A;  3OTO Q;  2Q8R E;  4RWS C;  2A8V A;  2E2J B;  1QVG A;  1A8V A;  2YU9 H;  3W1G A;  1EIG A;  2XNA C;  1YZ6 A;  5M5W H;  4UY8 C;  2M00 A;  4L63 B;  4HJ7 A;  1HA6 A;  2PW7 A;  4C2M H;  1SJH D;  4K2L A;  3AQQ A;  4JI2 Q;  4K5V A;  5EAY A;  4X66 Q;  4M8A A;  4DV7 L;  1HQR D;  2QKI C;  4ULL A;  3DWA A;  4A3F H;  4PMW A;  3K58 A;  2UUB Q;  4K0K Q;  4BY7 G;  3S1R B;  2PMZ B;  4X3S A;  2VQE L;  2JYO A;  4J1M A;  1G29 1;  3M3Y B;  1QNU A;  1I94 Q;  1JB3 A;  1O7Y A;  3KLS X;  1EZ8 A;  3Q22 A;  1YNN D;  5EPL A;  3S14 B;  3PO3 H;  1GUS A;  1M1K C;  4GKK Q;  1VQK A;  3C3L A;  3T51 B;  5HY6 A;  4CJ0 B;  3PIO A;  2D5D A;  1CSQ A;  2F03 A;  2QIL A;  1E24 A;  1L2F A;  3HP3 A;  2NVY H;  3HOW B;  2BCO A;  3STB D;  1JB7 A;  5JJZ A;  1LLR D;  4BBR H;  5IP7 G;  3I72 A;  1HQM C;  5C4H A;  2F0O A;  2CWA A;  4JYA Q;  1WTQ A;  2MHV A;  3KK7 A;  3MEH A;  4JV5 Q;  1E2Z A;  4YY3 L;  3PUV A;  2EDG A;  1F2L A;  1SSO A;  2EQS A;  1ZXT A;  1EEI D;  1TQO A;  2DN8 A;  4ABN A;  2B63 G;  4NKL A;  4KN4 C;  4L5S A;  3F8T A;  2ASB A;  4BA2 I;  4DUY Q;  1DOM A;  2H1E A;  1IYU A;  5M3M H;  1H9M A;  1G91 A;  2QF7 A;  5LMN Q;  3KF6 A;  1A2U A;  3S1Q H;  2CCZ A;  5BR8 Q;  4DNI A;  1VQM A;  3CCV A;  1CA5 A;  2RBM A;  2UUC Q;  1GOZ A;  2ZTE A;  3J7Y W;  4DUZ L;  4BY7 B;  4HAE A;  1VQ6 A;  3A7L A;  1D1I A;  1BBU A;  1EUJ A;  3K5L A;  1HNZ Q;  4H13 C;  3CPF A;  1XMQ Q;  5FO7 B;  5C5L A;  1A3V A;  4B9X A;  4A3B G;  3FMC A;  2A68 D;  4L6T B;  3X3M A;  4B3R Q;  4DR1 Q;  3I8Z A;  1V1O A;  1PRT B;  2KQ3 A;  1PMR A;  1K8G A;  4LNQ A;  2QEJ C;  4KKU A;  4J8Q A;  3DEP A;  2UXD L;  4OO1 G;  1JR0 D;  3D4R A;  4QB4 A;  3GP7 A;  4C3I H;  5BN4 A;  5IWA L;  5IT9 c;  2F0T A;  1Y1W B;  4ZK9 B;  3FKI H;  1PDQ A;  3NEL A;  4OIK A;  1RD9 D;  4NW2 A;  4F88 A;  1KLU D;  4ZKB B;  4YWM A;  4PG3 A;  5ELO A;  1PTO B;  4HCE A;  3K5O A;  1YHQ A;  2ES2 A;  4JI8 Q;  4DR4 L;  3VR5 A;  2JQO A;  3W5O A;  2CH4 W;  4DPG A;  4JI1 Q;  4XQN A;  3HOY G;  2H4O A;  1OXS C;  1L1O A;  3S1M B;  5C4X H;  1Y8O B;  2BH8 A;  4IO9 A;  1KXL A;  2D2C C;  1G51 A;  3EIV A;  3DHQ A;  1BOS A;  3EN2 A;  1Z9F A;  4A3L G;  3G71 A;  3NXW A;  4IUP A;  3A0J A;  1A15 A;  5G3L D;  2R92 G;  4A3K G;  1PH9 A;  4TRD A;  4A3C H;  5JPM C;  1IL8 A;  4KD4 A;  3R93 A;  1IW7 C;  1XXG A;  3NBH B;  1BR9 A;  1TS4 A;  1X55 A;  1V8Q A;  4DV4 Q;  1HNX Q;  5E7N A;  3H3V C;  1LUZ A;  1SJE D;  1ICW A;  1K8O A;  2MNA A;  4C3H G;  2E2J H;  1O78 A;  1PLF A;  1OXT A;  2D0O A;  4DAY B;  5EKI A;  4DR2 Q;  2XRQ D;  2HT1 A;  2YV5 A;  2JA9 A;  1SAP A;  4C1N K;  2VNU D;  3OOC A;  2B2W C;  1Y69 U;  2E74 C;  1Q82 C;  4LF7 Q;  4X3U A;  2G5D A;  2K03 A;  1WD1 A;  5I2X A;  1E2V A;  2OTJ A;  1B3A A;  2L5T A;  5C44 G;  1ZEQ X;  2XTI A;  2MPM A;  3BJU A;  1E22 A;  4DK6 C;  3PF5 A;  2E2I B;  1WI5 A;  3FPP A;  3S1R H;  3PQI A;  5LHY 1;  5AJ3 Q;  3M3Y H;  3A8I E;  3DXJ C;  4B3S L;  1I6V C;  1PRT C;  4DAM A;  4YCV A;  5DEH A;  4RA8 A;  5EJW A;  1VQH A;  3NQT A;  1ILQ A;  2LMC B;  1MSH A;  1LTI D; 
#chains in the Genus database with same CATH homology
 1IKM A;  1E2W A;  1D5Z C;  4OL7 A;  2F0M A;  3G6J B;  4N9P A;  4FXK C;  2N88 A;  1NUC A;  5C0X J;  2NVT B;  1TWC B;  4WOR A;  1SDF A;  3NBI A;  4DK1 A;  5E1F A;  2R92 B;  1PTO C;  1R4Q B;  4M1U B;  2MUY A;  1Q8I A;  1CA6 A;  3ONA B;  3A7A B;  2J4X A;  1HA5 A;  2EYH A;  2Q8T A;  5JVG 3;  2KHS A;  1BF4 A;  4MIU A;  1D6E C;  1EY6 A;  1HXY D;  2K05 A;  3VYS A;  1H9S B;  2FFK B;  1DOK A;  4IFD I;  4IUT A;  1KDB A;  1CT1 D;  1B9M A;  5E3F A;  3BVZ A;  1JOK A;  4PNY A;  3U9O A;  4R8N A;  3ITP A;  4CKE A;  1U9R A;  5C0X H;  1EYC A;  2WAC A;  2EYP A;  3MA2 B;  2WII B;  5IGC A;  2WB1 B;  1RF2 D;  3DUZ A;  3M85 A;  2KVM A;  2NBF A;  1DYQ A;  2EOT A;  3Q6S A;  3VR3 A;  5A2Q L;  1VF7 A;  5IT9 E;  2JEA I;  3U9S A;  5KYL A;  2O5J C;  1AW7 A;  1EY4 A;  3Q0A A;  2G9D A;  2PQE A;  3IL8 A;  1WTO A;  3M4O B;  1SE4 A;  1HTL D;  5KND A;  2K7V A;  2TMP A;  5JEA J;  2Y0S B;  1PTO H;  3GTJ B;  3T4A C;  3SDZ A;  2TSS A;  2AUK A;  1PZK D;  1WCM B;  5C4J B;  3RZD B;  1SNC A;  2GA4 B;  2VXW A;  2EXZ A;  1Z47 A;  1LTS D;  5K36 G;  2F0P A;  3A8J E;  2EE1 A;  3D31 A;  1U4M A;  1EOT A;  2CW0 D;  4NDX A;  4EGV A;  2L0C A;  2IPK D;  2Z1C A;  2B2Y C;  1JWU D;  2VB2 X;  5FO9 B;  1HFG A;  2OXP A;  4R8I A;  2AQ2 B;  1Y1V B;  2Z8L A;  3WOF A;  1SBB B;  2BE5 D;  3EVQ A;  3OWF A;  2EJM A;  1RKN A;  4G7Z C;  3GO5 A;  3HOZ B;  4BWG B;  4QF4 A;  1KAA A;  1PRT F;  3J80 L;  4QUF A;  4CJ2 C;  3R2I A;  2JA7 B;  3NHH A;  3SK6 A;  1X3Q A;  1YNN C;  4OO1 H;  3AB9 A;  3NP8 A;  1RTO A;  2JEB I;  4NMZ A;  4P2C B;  1PTO F;  1DM0 B;  1WTW A;  1PFM A;  3VA7 A;  1AZQ A;  1TWH B;  4IUU A;  5E4W C;  1L0X B;  4WJW A;  2F0E A;  5I4D A;  2IW3 A;  3A56 A;  4ZLT F;  2J7Z A;  5KRU A;  2NVQ B;  1I3Q B;  1SYD A;  1FR3 A;  5DM7 3;  3HOV B;  1LTB D;  1ML0 D;  5CV7 A;  4Q0F A;  4HR7 B;  3ND8 A;  1CI3 M;  1MD2 D;  4G7O C;  4ZUI A;  4G57 A;  3PUZ A;  4H7B A;  3H0G B;  3H09 A;  2F0W A;  1CHQ D;  3LWU A;  2Q8I B;  1G2S A;  4OIJ A;  3TP6 A;  3PO2 B;  1JWS D;  3V2T A;  2O4X A;  3ERQ A;  5M3M B;  3SEB A;  4A3G B;  1UEA B;  5KGU A;  1JOR A;  3PMF A;  5C3W A;  3SK8 A;  1JOQ A;  3C46 A;  2SEB D;  4RH6 A;  1QCB D;  3NTH A;  3O13 A;  5EPJ A;  1EYA A;  4DGZ A;  1F9S A;  2KUM A;  5AFW A;  2FMM A;  3TDQ A;  3CHB D;  2NN6 H;  1T5X D;  2HUG A;  1BQQ T;  3A54 A;  1EFI D;  5I6W A;  1DON A;  2K04 A;  1K83 B;  2E75 C;  2YYZ A;  1R9T B;  4AYB B;  2B8G A;  5ELC A;  3NWS A;  5IGF A;  1TWG B;  5I6Y A;  1SE3 A;  4A93 B;  3QB3 A;  3OWE B;  4BY1 B;  1RCV D;  1PFN A;  1HPC A;  1LTR D;  1KNA A;  2KEC A;  1C8C A;  4MHE A;  3FKI B;  4KKS A;  2O2L D;  5FK9 C;  5JAV A;  4BS9 A;  1D5M C;  4F7X A;  2B2V A;  4F87 A;  4L8J A;  1ENF A;  3I70 A;  3GV3 A;  1D5X C;  4LMQ D;  4CJ1 B;  1AZP A;  2ENB A;  1MGS A;  2WAQ B;  1JWM D;  1EU4 A;  4NP5 A;  2EJF C;  5CBA E;  4LJZ C;  3NTI A;  5BN3 A;  1H9R A;  1VDZ A;  4TQU S;  2B2T A;  4XXE A;  1RDP D;  1FD7 D;  1I4Q A;  1DJR D;  1JIC A;  2AQ3 B;  2K5D A;  1ZYR D;  3C1F A;  3K6O A;  2K6A A;  2I07 B;  5BN5 A;  2VUM B;  1TU2 B;  2PNR C;  1CK1 A;  2PZW A;  2I46 A;  1WTR A;  2PYK A;  4F8M A;  3K5M A;  3I4N B;  3RMH A;  2CVR A;  5D65 A;  5CGK A;  3ERO A;  4DK0 A;  1GUN A;  2F0F A;  3GTQ B;  1AN8 A;  1M4V A;  4PQX A;  2DY8 A;  3OSO A;  1OXV A;  4HTH A;  1QWY A;  4ZUJ A;  2JA8 B;  4Q5V A;  1VMP A;  1OO9 B;  4I65 A;  4HMI A;  3HOU B;  2EJG C;  3BYT B;  2RKS A;  3BDO A;  4FF2 A;  3CRL C;  4KKT A;  5KYI A;  3DWP A;  5LL6 X;  1GUT A;  1STN A;  2LFN A;  1SNQ A;  3BZD B;  4ODG A;  3SXH A;  5C3X A;  1DZ1 A;  3I90 A;  3HRZ C;  5T1I A;  3BYY B;  4FXD A;  4FP5 D;  1CQF A;  1ROD A;  2FIN B;  1AEX A;  4H0L C;  1EIH A;  1K8M A;  3TP7 A;  2DNC A;  2A5H A;  2A69 D;  5CV9 A;  3VYR A;  3GTK B;  3UI2 A;  4QIW B;  1II3 A;  2XVS A;  3P1H A;  5G3L F;  2XN9 C;  1S5D D;  1SNP A;  1ONL A;  4RCN A;  2AWN A;  1ESR A;  3PUY A;  5F2D A;  1AP0 A;  2B2U A;  4FNF A;  3RLF A;  3ZYY X;  4IUQ A;  5C0X I;  4K8I A;  1YNJ D;  1FNV A;  5CMD A;  1I50 B;  1STA A;  1TKW B;  4N9T A;  1QJO A;  5J1Z A;  3S2H B;  3V05 A;  2N55 A;  3CKI B;  2CW0 C;  5A2Q E;  3GQB A;  4K8J A;  3FPU B;  5IIF A;  3NQI A;  1SFO B;  3W3A A;  3J81 L;  2NUC A;  3MXN A;  1LTA D;  4KJN A;  4LAA A;  2B63 B;  1QB5 D;  4V19 0;  1U4P A;  5IOD A;  4B9W A;  1O80 A;  3X3N A;  3HZX A;  5DNF A;  3MTS A;  3N6R A;  5CV6 A;  2PZT A;  4KN7 C;  2XWB B;  3VR2 A;  5K5P A;  3H94 A;  5CR3 A;  2EY6 A;  1I4G A;  1SNM A;  5LL6 S;  1IYV A;  4RGM A;  4PMC A;  1TT2 A;  4HCS A;  1Z7T A;  1KLG D;  5FKA C;  4A3B B;  3S15 B;  4FF1 A;  2SNM A;  4C3J G;  4OGQ C;  1ENC A;  2DNE A;  5CV5 A;  5JVH 3;  2FMC A;  2EVB A;  3KBX A;  3AMU A;  1BBX C;  2RSN A;  2BA1 A;  3J80 E;  5EBD A;  3TN2 A;  1CHP D;  2F0V A;  3PUX A;  3D6W A;  4KY6 A;  4CKC A;  3SR1 A;  2RVL A;  2JE6 I;  2PZU A;  3D4W A;  1CZW A;  3W2D A;  3HOY B;  3R8B A;  1EY8 A;  1EY7 A;  1NR4 A;  4R9W A;  1QNK A;  4XT3 B;  2A6E D;  4JK1 C;  1STE A;  4A3K B;  1Z6H A;  1A3U A;  3K5N A;  3FDT A;  1EQV A;  4TKO B;  3F2U A;  1JE4 A;  5C5M A;  3QJY A;  4C3H B;  2L1B A;  2HCC A;  1ET9 A;  5KNC A;  2F0G A;  1ESF A;  3DMU A;  1L0Y B;  4C3J B;  3BG3 A;  4RCO A;  1PFB A;  3CRK C;  5J39 A;  2XWJ B;  5C44 B;  5D3D A;  1S5F D;  5EGT A;  5I9O A;  3OIP A;  2L4N A;  1WD0 A;  1I4X A;  4C1N I;  1VMC A;  1TY2 A;  5TSS A;  3VR4 A;  1C48 A;  2R61 A;  1Q12 A;  1TWF B;  1NAP A;  3BVM A;  3GV6 A;  4XIG S;  1NSN S;  2LS0 1;  1GXD C;  3NTK A;  5IGG A;  1STY A;  2ZXO A;  3JAM L;  2F0H A;  1LAB A;  5EKK A;  5IGD A;  1EEF D;  4ZYS A;  2NN6 I;  3VYT A;  3J7A V;  2F3V A;  4QUC A;  2EYM A;  4JBW A;  1SND A;  1M8A A;  3MZ5 A;  3H91 A;  1UNS A;  4PMB A;  4C56 C;  3E0J A;  1ZYR C;  2NWG A;  1TVX A;  1SYC A;  1X32 A;  4DN4 M;  4FF4 A;  4Y7N B;  1QIL A;  4XYO A;  2MP1 A;  2IX0 A;  2B2W A;  3S17 B;  2EY1 A;  1JC7 A;  2K1B A;  1GHJ A;  2B2V C;  4KY7 A;  2BOS A;  5M5X B;  1B4O A;  5I9P A;  2QDB A;  1Q3L A;  4U67 3;  1SYB A;  2BDO A;  3L3O C;  3L9A X;  1QOH A;  1J9O A;  4CKB A;  2G9H D;  2IWH A;  3R2T A;  1STH A;  5FO8 B;  2K33 A;  4ZQ3 A;  1J8I A;  4CHT B;  1X3P A;  1GUW A;  5J22 A;  2RDG A;  2F0I A;  3WDN A;  2RQX A;  4XQQ A;  1F2Y A;  1NR2 A;  1CZG A;  3SHL A;  2A73 B;  4TSS A;  3OW7 A;  2A6H D;  1MBY A;  1A6X A;  1AFP A;  1CFM A;  2MJ8 A;  5IGE A;  4FVM A;  2IL8 A;  5DAU A;  2E2H B;  1D1K A;  2F0N A;  2V4D A;  3OMC A;  4O1N A;  1JQY D;  1EY9 A;  2A69 C;  1JCK B;  3PIP 3;  1HCZ A;  4A3M B;  3S16 B;  3AU7 A;  4FYD A;  3HG9 A;  4B08 A;  1TS2 A;  3HOX B;  3C1E A;  1F2M A;  5CC4 A;  2JA5 B;  2KJX A;  1ET6 A;  4DAY A;  2A68 C;  2E76 C;  4O42 A;  5FLX L;  3I4L A;  4KJO A;  2XIW A;  1O7L A;  4U68 A;  2RA4 A;  2KA7 A;  5EBC A;  3QG1 A;  2KED A;  1DOL A;  1BCP D;  4KV6 A;  1F2Z A;  1H9K A;  4RGO S;  1I6H B;  4K5X A;  1FNW A;  3H6M A;  1EY0 A;  2IX3 A;  4KY5 A;  1GUG A;  3V96 A;  2OT2 A;  2LY7 A;  1LT5 D;  3WOE A;  3E6Z X;  1VCI A;  4K6L A;  4K2K A;  2OF1 A;  1E0B A;  3KLS A;  3DM1 A;  4RGT A;  3OIQ A;  1VF5 C;  4HN7 A;  1OXX K;  4RKB A;  2JSO A;  3C2P A;  3KUP A;  4HSV A;  1QG7 A;  1BXT A;  1RJT A;  2B2U C;  1O7Z A;  1STB A;  5T1G A;  3BDC A;  3TBI B;  3P7J A;  3HS0 C;  2B2Y A;  2ZT9 C;  1H9S A;  1W6J A;  2VB3 X;  4Z9C B;  3FRP B;  2F0J A;  2CHB D;  3P20 A;  3SK5 A;  4IUV A;  3A8K E;  1Q1B A;  3J81 E;  4A3I B;  1IKL A;  1KNE A;  2F1M A;  3EA6 A;  1IHZ A;  2EPB A;  3FVQ A;  3SK4 A;  3M4Y A;  1SXT A;  3P75 A;  3E5S A;  3SVM A;  1BUV T;  3NE5 B;  3QOL A;  1G8Z D;  1WVL A;  4UAI A;  3CQZ B;  4QMG A;  1V1P A;  3TZD A;  1QE6 A;  3URY A;  5FOB B;  2A6E C;  2PPB C;  4E6I A;  1HUN A;  1TR5 A;  2EYO A;  3QO2 A;  2F0D A;  1H9J A;  3NK9 A;  4IUR A;  1WTP A;  4HSP A;  5K36 H;  4K14 A;  2K01 A;  1EZ6 A;  3RD4 A;  2JP1 A;  5C0X G;  2D62 A;  1LO5 D;  2L12 A;  1ENA A;  5NUC A;  1LT3 D;  5M5Y B;  1SYE A;  2F0Q A;  2B39 A;  1B44 D;  3MWY W;  2HQE A;  2AUJ D;  1XX8 A;  1I4R A;  4UDU C;  2M9V A;  3VR6 A;  4CGY B;  5EPK A;  2L55 A;  1STG A;  3D3R A;  3MFG A;  1LT4 D;  1CTM A;  3S1N B;  3KBG A;  2IJ0 A;  5C3E B;  4PV1 C;  2X6G A;  3TME A;  1LTG D;  3A55 A;  3BDL A;  1ZKO A;  1U4L A;  3TP5 A;  5D14 A;  2NTS A;  2XRS D;  3VYU A;  4LK1 C;  5JPN C;  4XTC S;  1SMY D;  2K5Q A;  4RGN A;  4KK7 A;  4XT1 B;  2F0S A;  4DNR B;  1DD2 A;  2O5I C;  1DXM A;  1TY0 A;  1EU3 A;  3QOJ A;  3FEW X;  1UUP A;  4QCL A;  4EQN A;  5JEA G;  1CM9 A;  3IFT A;  3K57 A;  2WKD A;  2BE5 C;  2EY2 A;  5JOB A;  4X3K A;  3KF8 A;  3JAM E;  2PW5 A;  5D3I B;  2EYL A;  1U4R A;  5CV4 A;  4KD3 A;  2R6G A;  1KDC A;  2BA0 A;  1BCP B;  4V0B A;  2K5W A;  4RAU C;  3J7A F;  2CQA A;  2NYZ D;  1PYW D;  2QCP X;  1KAB A;  2ZXR A;  5ELD A;  2IX1 A;  4DF7 A;  2NZ1 D;  2EZV A;  3PIO 3;  4A3D B;  4DXG A;  2WV6 D;  1XTC D;  4ZKC B;  3TP8 A;  2EYJ A;  4ME5 A;  1A2T A;  3RZO B;  3HKZ B;  1FNU A;  3MXP A;  3TSS A;  4RFB A;  4IFD G;  1GUO A;  1EL0 A;  3GTP B;  2DY7 A;  1SEB D;  4DAV A;  1R4P B;  2PO4 A;  1SE2 A;  5COR A;  3GTM B;  1EWH A;  2A6H C;  3R3O A;  4KMU C;  2L9H A;  1B2T A;  2ICI A;  2X6L A;  5ELE A;  4MN3 A;  4OO1 I;  1ILP A;  1MI2 A;  1S5E D;  3SE0 A;  1T5E A;  1A3T A;  1WTV A;  1RTN A;  1TII D;  3IKJ A;  1LT6 D;  3BVG A;  1F77 A;  4XYQ A;  5ELF A;  2WKC A;  3IAY A;  4K6D A;  2F3W A;  2JXM B;  2HDL A;  3K7A B;  4X3T A;  4HMJ A;  1Y8P B;  1BCP C;  2NN6 G;  2ICE C;  1S4Z A;  3L7Z C;  1B50 A;  2WIN B;  2R3Z A;  1V43 A;  3GTG B;  1EYD A;  3QIA A;  3VA5 A;  4A3J B;  2K28 A;  1G2T A;  5I2Y A;  3HEJ A;  1DCZ A;  2J0T D;  2F0U A;  1B53 A;  3PV0 A;  4FF3 A;  5CBE E;  2KOL A;  3MAQ A;  4ZAI A;  2EYF A;  4ZRZ A;  4KHV A;  1HTP A;  4EVO A;  1C4Q A;  1MSG A;  5EQ0 A;  5FLX E;  3Q23 A;  3QWN A;  2B8F A;  4IN3 A;  4DU9 A;  2SOB A;  4KI0 A;  2PCF B;  3NWT A;  2OEO A;  4H44 C;  1S5B D;  2M2L A;  2NB0 A;  4IUN A;  1HUM A;  4DAP A;  1V1P B;  3IFD A;  2IT1 A;  2F4I A;  2ID0 A;  3OHX C;  3T56 B;  1WTX A;  2NVX B;  1LTT D;  1TWA B;  5ISR A;  5KIX A;  3OMG A;  1HFN A;  2K32 A;  3D4D A;  2SDF A;  2JA6 B;  4G7H C;  3KLR A;  2E2D C;  3EJI A;  3M7G A;  3DWQ A;  1D2B A;  3Q24 A;  4HED A;  2NTT A;  1PZI D;  4ILW A;  4G4K A;  5IGB A;  1B9N A;  2F0L A;  3I73 A;  5EKL A;  3D6C A;  3EFX D;  3I4M B;  1CQV A;  1F9Q A;  2SNS A;  2AWO A;  4DXF A;  3K0Y A;  5M3F B;  4A3E B;  1EQT A;  1S5C D;  3NPP A;  3OPO A;  4EQP A;  3GTL B;  3S2D B;  2R7Z B;  2FJ2 A;  2WP8 J;  4RHR A;  4IFD J;  2B2T C;  4ID6 A;  4BBS B;  2L11 A;  1Y8N B;  5JEA H;  4S3S A;  1JOO A;  5C6A A;  4OHJ A;  2R93 B;  1KDA A;  3S9W A;  5HGT A;  1EY5 A;  2FHT A;  1IW7 D;  3LNN A;  3T53 B;  2YU9 B;  1W6K A;  2ZXP A;  4GZY C;  5M5W B;  3T13 A;  4RHS A;  1BCP F;  4C2M B;  4J6H A;  3DEO A;  1XWE A;  4XDX A;  1PZJ D;  1RHP A;  2XSC A;  2Z4H A;  3D8G A;  5CV8 A;  1Q1E A;  1LV9 A;  4DFA A;  1NCV A;  4A3F B;  2D9U A;  2A74 C;  5CYU A;  3PO3 B;  2C9O A;  3NBH A;  1LAC A;  2KCC A;  3I3C A;  4IFD H;  3G7L A;  4BA1 I;  1SNO A;  1PRT D;  2NVY B;  1Q90 A;  3NSW A;  1BO0 A;  1TS3 A;  1F9P A;  4C3I G;  5IOC A;  5KEE A;  4BBR B;  3GTO B;  1F9R A;  1I4H A;  4EQO A;  1YNJ C;  1SMY C;  5HUR A;  4YIJ A;  3MC0 B;  2MGS A;  1FGB D;  1PTO D;  2LKV A;  4CBV A;  5IT9 L;  1EWC A;  2X69 A;  4KHZ A;  3HGB A;  3S1Q B;  2KEE A;  5COY A;  4XQJ A;  3GD7 A;  2HDM A;  3LWE A;  1SYG A;  3MFY A;  2BDN A;  2RDF A;  2Z4I A;  4IAL A;  3PUW A;  1SYF A;  1XYI A;  3T16 A;  1KTK A;  5M9O A;  3EQL C;  1G6Z A;  1I4P A;  4FO2 A;  3K59 A;  1BDO A;  5A35 A;  2F0K A;  4RKL A;  1GHK A;  3CU7 A;  1FYC A;  1HRJ A;  4KTA A;  4FXG C;  4I7Z C;  4C3I B;  2EY5 A;  2RDH A;  3LX0 A;  3MVV A;  3I91 A;  2C5C A;  3MXG A;  4DNT B;  1BNZ A;  3MXU A;  1GJX A;  3TZU A;  4K5W A;  5E4X A;  2KCN A;  3NUC A;  4DA2 A;  1PXU A;  4WRD A;  2AQ1 B;  5C4X B;  3RUZ A;  3ND9 A;  3MHB A;  5KNB A;  5DM6 3;  4WFN 3;  4IZ8 A;  2RSO A;  1HHV A;  3M7N A;  5ELB A;  1TS5 A;  4IQZ A;  3N52 A;  5C4Z A;  1UAP A;  2HCI A;  3BS1 A;  1OXU A;  1B1Z A;  2Q8R E;  4RWS C;  2E2J B;  1EIG A;  2XNA C;  2M00 A;  4L63 B;  1HA6 A;  2PW7 A;  1SJH D;  4K2L A;  4K5V A;  4M8A A;  1HQR D;  2QKI C;  4ULL A;  3DWA A;  4PMW A;  3K58 A;  3S1R B;  2PMZ B;  4X3S A;  2JYO A;  4J1M A;  1G29 1;  3M3Y B;  1QNU A;  1JB3 A;  1O7Y A;  3KLS X;  1EZ8 A;  3Q22 A;  1YNN D;  5EPL A;  3S14 B;  1GUS A;  3C3L A;  3T51 B;  4CJ0 B;  2D5D A;  2F03 A;  2QIL A;  3HP3 A;  3HOW B;  2BCO A;  5JJZ A;  1LLR D;  3I72 A;  1HQM C;  5C4H A;  2F0O A;  1WTQ A;  2MHV A;  3KK7 A;  3MEH A;  1E2Z A;  3PUV A;  2EDG A;  1F2L A;  1SSO A;  1ZXT A;  1EEI D;  1TQO A;  2DN8 A;  4ABN A;  4NKL A;  4KN4 C;  4BA2 I;  1DOM A;  2H1E A;  1IYU A;  1H9M A;  1G91 A;  2QF7 A;  1A2U A;  1CA5 A;  2RBM A;  1GOZ A;  3J7Y W;  4BY7 B;  4HAE A;  3A7L A;  1D1I A;  3K5L A;  4H13 C;  5FO7 B;  5C5L A;  1A3V A;  4B9X A;  3FMC A;  2A68 D;  4L6T B;  3X3M A;  3I8Z A;  1V1O A;  1PRT B;  2KQ3 A;  1PMR A;  2QEJ C;  4KKU A;  4J8Q A;  3DEP A;  4OO1 G;  1JR0 D;  3D4R A;  4QB4 A;  3GP7 A;  5BN4 A;  2F0T A;  1Y1W B;  4ZK9 B;  1PDQ A;  4OIK A;  1RD9 D;  4NW2 A;  4F88 A;  1KLU D;  4ZKB B;  1PTO B;  4HCE A;  3K5O A;  3VR5 A;  4XQN A;  2H4O A;  1OXS C;  3S1M B;  1Y8O B;  2D2C C;  3DHQ A;  1BOS A;  3NXW A;  4IUP A;  1A15 A;  5G3L D;  4TRD A;  5JPM C;  1IL8 A;  4KD4 A;  3R93 A;  1IW7 C;  1XXG A;  1BR9 A;  1TS4 A;  1V8Q A;  3H3V C;  1SJE D;  1ICW A;  1K8O A;  4C3H G;  1O78 A;  1PLF A;  1OXT A;  5EKI A;  2XRQ D;  1SAP A;  4C1N K;  2VNU D;  3OOC A;  2B2W C;  1Y69 U;  2E74 C;  4X3U A;  2K03 A;  1WD1 A;  5I2X A;  1E2V A;  1B3A A;  2L5T A;  1ZEQ X;  2MPM A;  2E2I B;  3FPP A;  5LHY 1;  3A8I E;  3DXJ C;  1I6V C;  1PRT C;  5DEH A;  4RA8 A;  5EJW A;  3NQT A;  1ILQ A;  2LMC B;  1MSH A;  1LTI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...