4DF7A

Crystal structure of staphylococcal nuclease variant delta+phs v23l/v99i at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4df7A00
4IZ8A 4R8NA 3SK5A 4K2KA 4K2LA 2OXPA 2QDBA 1EYCA 4ME5A 4N9TA 4J1MA 4QMGA 1ENAA 2KQ3A 5CV8A 5C5LA 1SNPA 5CV9A 2F0UA 3P75A 4NDXA 3SXHA 5KYIA 3E5SA 2PW7A 4B9WA 4PMCA 1EZ8A 4S3SA 3LX0A 3SK8A 3TP6A 3BDLA 1JOKA 2F0PA 2F0JA 5CC4A 1SYEA 5CV4A 5ISRA 4NP5A 1SNMA 2EY5A 5IOCA 4KY7A 1EY8A 1SYGA 1U9RA 5CR3A 2RBMA 1KDAA 2LKVA 4HMIA 3MEHA 2PW5A 3NHHA 4K5XA 3OSOA 5KYLA 1TR5A 1KDBA 4LAAA 4EQPA 1TQOA 1F2MA 1STAA 4K5WA 5KGUA 2HQEA 1AEXA 2OEOA 2RKSA 4E6IA 1EQVA 5KRUA 5IGFA 2EYJA 4QB4A 1A2UA 5CV5A 4ZQ3A 2F0WA 2F0EA 4NMZA 1SYCA 4RKBA 1EYDA 2SNSA 3T16A 5K5PA 1JOOA 1NUCA 5EGTA 2NUCA 5C4HA 3D8GA 1EY0A 3U9OA 4H7BA 4ZUIA 3SHLA 5CGKA 5IIFA 1EY4A 4HMJA 4QF4A 2EY6A 5EKKA 2SNMA 4IUNA 1TT2A 3OWFA 3VA5A 5IGDA 5KIXA 5IODA 4KY5A 5IGEA 4PMBA 4I65A 5EKLA 4F7XA 2EYFA 1II3A 3SR1A 4K8IA 2F0GA 2SOBA 5JAVA 2F0MA 1SYDA 4ID6A 3V2TA 1A3VA 2F3VA 2F0LA 3D6CA 4NKLA 2F0KA 3NK9A 2F0SA 2F0OA 2F0NA 3QB3A 3NQTA 4DU9A 5HGTA 5HURA 5E1FA 3NXWA 3C1FA 3MXPA 3SK6A 1STHA 4HTHA 4B9XA 5CV7A 3NP8A 1A3UA 5C5MA 1IHZA 3SK4A 4TRDA 3MVVA 2F0QA 2EYOA 4EQNA 5I9OA 4DFAA 3QOLA 5IGBA 1EY9A 2PQEA 4IALA 5J22A 5J1ZA 2EYHA 3TP8A 2WACA 2F0TA 4K14A 3ITPA 1KDCA 5NUCA 4KJOA 3H6MA 4K8JA 5C3XA 4KY6A 4WRDA 1RKNA 4K6DA 5DEHA 4KJNA 3EROA 5M9OA 2KHSA 2F0FA 1SNCA 4KD4A 2F0HA 2EYLA 3MZ5A 1SNQA 1STGA 4DGZA 1A2TA 5C6AA 3C1EA 3OMCA 1A3TA 4MIUA 3R3OA 1EY6A 2OF1A 3TP7A 1JORA 1SNOA 3ERQA 4YIJA 3T13A 3NUCA 3DHQA 3TP5A 5I9PA 4WORA 5KEEA 2M00A 1F2ZA 2PYKA 1KABA 1EY7A 4N9PA 2ENBA 3EJIA 3DMUA 3EVQA 3P1HA 4KTAA 5E3FA 5C3WA 5C4ZA 1EY5A 1SNDA 1NSNS 2EYMA 4G57A 2EY2A 3MHBA 5I6WA 5I6YA 2O4XA 2EY1A 4EVOA 3HEJA 3D4DA 1STBA 1STYA 4RKLA 2F0IA 5IGGA 3PMFA 2RDFA 2EYPA 4K5VA 1JOQA 1KAAA 1STNA 4KD3A 4PNYA 1EYAA 3BDCA 4F8MA 5F2DA 1EZ6A 4OL7A 5CV6A 4ODGA 5DAUA 1SYBA 4ZUJA 3RUZA 3S9WA 4DF7A 3D4WA 3HZXA 2PZWA 3OMGA 3QOJA 2F0DA 4KHVA 5IGCA 2F3WA 4J6HA 4EQOA 1F2YA 2EXZA 2PZTA 1ENCA 4KV6A 1SYFA 2F0VA 2PZUA 3TMEA 5JOBA 5J39A
chains in the Genus database with same CATH superfamily
4IZ8A 2JE6I 4N9TA 1XPRA 2OQKA 1XNQQ 1RDPD 1NNXA 4PMCA 3I70A 1EZ8A 1SAPA 2VQEL 1Y1WH 1JOKA 3DXJC 5I4DA 3NTIA 2UU9L 2MO0A 3MXUA 3H91A 1UNSA 2LKVA 3OW7A 1GKHA 2UXCL 2MP1A 4DV1L 1CUKA 1Y69U 3D0FA 5EBCA 4BBRB 4ZCKA 4JYAQ 4RKBA 4L6TB 1TWGH 2JEBI 4A3EB 2TMPA 4LF5Q 1NUCA 2VS1A 1S5DD 2R7FA 4H7BA 1BR9A 1HFGA 2L11A 3CCQA 3MA2B 4C56C 4BBSB 2ASBA 5DM73 1EWCA 2ZJPA 1GHKA 4KHPL 4U68A 4N8FA 4DAYA 3SR1A 2SOBA 3MC0B 4OELB 1C4QA 3JC66 3NELA 4DU9A 2XWBB 3R8BA 2J0TD 1L1OC 4MNOA 4IQZA 1W6KA 2EVBA 4QJFA 4B3TL 1K8OA 2RHQB 3S1QB 3HP3A 2PQEA 1VQAA 4ALPA 2NTTA 2F0TA 1RCVD 2C5CA 2A68D 1XPOA 4L8JA 3KLSX 3PCOB 3I72A 2XGTA 1Y1VH 4JVZA 4X3TA 5CBAE 3PSIA 4JBJA 2F0FA 1X6OA 2N55A 3HOVH 1EY6A 2OF1A 4OWTB 1SNOA 4LF6L 1EWHA 2PYKA 1STEA 4UDUC 3HOWB 2KCNA 1C8CA 2ENBA 1WOCA 3CCSA 3PIPA 1WYDA 2EJMA 3H0GB 3J7AV 1BUVT 1E7ZA 1PTOH 1XXGA 2ZXRA 3FEWX 4KMUC 3FRPB 5G3LD 4DN4M 1HNZL 1YVCA 4A3GH 1HCZA 4HR7B 4YCUA 1XMQL 1AH9A 1EZ6A 3I4MH 3I4OA 2R7DA 1B2TA 1Z47A 4L5QA 1HZAA 2AQ3B 2F3WA 2WKCA 4FVMA 4IPCA 4CKEA 3PUXA 4R4CA 4BY7B 3RZOB 2EE1A 1ENCA 1N8RC 1LTSD 1QUQB 4TVAB 2B2UC 3CCMA 3SXHA 1AP0A 4NDXA 3A55A 4DAPA 3NTKA 4PZ6A 3J80E 3PO2G 3G7LA 1HZCA 5IYBG 5GADC 4HJ5A 2TSSA 5ISRA 2ZXOA 3K8AA 5CV4A 1Q1EA 3DWAA 1EL0A 1KDAA 4BBRH 3HOZG 1AE2A 4ZKCB 1LTAD 4HAEA 4JI7Q 1HPCA 4A3EH 1NCVA 1PRTC 5KRUA 3Q23A 1O7IA 4RHRA 5CBEE 1TXYA 2B2TC 2NTSA 4BBSH 1PYBA 2KEEA 2NBFA 4MN3A 3TEHB 3JAMi 2B39A 5A35A 1V8QA 3KLWA 2E76C 1B70B 2XN9C 3I7FA 2Z4HA 5JVG3 5C0XH 1EQRA 4X3KA 4I65A 1X9NA 1ASZA 1SMXA 1TY0A 2UUAL 3V2TA 3ND8A 1BXTA 4R1JA 2F0LA 2ZJQA 2LSSA 1OXTA 3NQTA 1JB3A 1GUNA 3S1QH 1DCZA 4NXMQ 5LMNQ 1VQ4A 2F52A 1D5MC 1BCPC 2CKZB 2P5ZX 1SROA 4IPDA 3X3MA 2F0QA 4L5RC 3G71A 5IGBA 1L1OB 2VB2X 4FXKC 2L0CA 1MKHA 1EUJA 3KDFA 1NJIC 3PUZA 1BF4A 4K6DA 2CFMA 3TQYA 3TREA 3HOWH 5AFWA 4CHTB 1PYWD 4YCWA 3A56A 3CKIB 4YCVA 1HA6A 3URYA 3NSWA 3H0GH 1D7QA 4WORA 4N9PA 2CQOA 3BU2A 3KF8A 3H09A 4WJ3M 4DUYQ 4HCSA 1A62A 1STBA 3UDXA 2K7VA 2PQAA 4BY7H 1M4VA 3MFGA 1MHWC 3GDEA 3PGZA 3MXGA 3RZOH 4PNYA 1EYAA 5C44G 1VQCA 4L5SA 1KRSA 3NWSA 4DR5L 4JI1Q 4JI0L 1T5EA 2Z6KA 5M3MB 4NXNQ 5FKAC 2G5DA 4P73A 1HTPA 3EN2A 3CPWA 4R8NA 4IUVA 4LF8Q 3T56B 4A3MB 5HY6A 2XSCA 5KYIA 2FJ2A 2PW7A 3S1MB 5D65A 2NZHA 4DR7Q 3AQQA 2UUCL 4A3KG 4DR2Q 1M8AA 2E75C 2BCOA 3SDZA 4KK7A 5A2QL 2RBMA 3J81j 4LF4L 1DONA 1TS4A 4B08A 1WD1A 2DUDA 4QUFA 5KNCA 2OEOA 2JA6B 2LXKA 2MQHA 1WD0A 2JYOA 2B29A 3BG3A 2JN4A 5JJLA 1L0XB 1EYDA 5EGTA 4DUZL 1EY0A 1CQFA 2EIFA 3D6WA 1O78A 5EPLA 3PIP3 4QUCA 5BR8Q 3ERSX 3N52A 3VR6A 3OWFA 3I4LA 3UI2A 1LTLA 1ONLA 3C3LA 3K81C 5FLMH 2IPKD 1EIFA 3S24A 1JWSD 1A3VA 5GQOA 2NB0A 3S2DB 2IX3A 1PH5A 1SJED 2AWNA 4LUOA 1S5BD 1D1IA 5IWAL 1R9TB 3FDTA 3M85A 1RL2A 1SEBD 1EFWA 4EQ5A 4OHJA 3J81c 1Y14B 3VR3A 3Q24A 2GA4B 3T51B 2A6HD 4PMWA 3HS0C 1A8VA 1LTGD 4YWLA 3ONAB 1IL2A 3MFYA 4RFBA 3ITPA 3K0YA 4K8JA 5FO8B 2UXBL 1SSOA 5IP7H 1U4LA 1K8GA 5J3BA 4NXML 4IFDI 4CJ0B 5M9OA 5LMUQ 1SNCA 2F0HA 3D31A 1Y1WG 1STGA 1X3PA 1A2TA 1XNRL 3U4ZA 1SMYD 1XNQL 1BO0A 3S1RB 2UU9Q 4OO1H 5I9PA 2B2YC 1VQEA 1C9OA 1X3QA 3GD7A 2HCIA 4FXGC 1G8ZD 2K52A 1HFNA 4RA8A 2VW9A 4F88A 5ELOA 3RZDB 3T1YQ 3HG9A 5M3MH 4IURA 4AQYQ 4DV6L 2KCCA 2E2JB 3M7GA 3G6JB 1WCMB 3D4WA 3M9BA 4A3MH 4LF5L 3S1MH 2PPBC 3TMEA 1EYCA 5CV8A 3CP0A 3E0EA 1G291 1NTGA 1HQMC 3DWQA 4B3RQ 4B3TQ 1CKNB 2JA6H 1M90C 1LT6D 1X65A 1HQRD 1O7ZA 3CRKC 4XIGS 2PW5A 2LS01 2JXMB 4IJLA 1Y1VG 3HGBA 1GXDC 4K5WA 1CHQD 1H9JA 4H44C 1N36Q 4O2DA 1VCIA 2F0EA 3HOVG 2Q2TA 2WKDA 3M7NA 2QA4A 2JJQA 1D1KA 5A2QE 2RCNA 2D62A 3S2DH 2SNMA 1LTID 4JI3Q 2AUKA 2L5TA 1LTRD 1R9TH 4XQQA 2ICIA 1II3A 4R8IA 2F0MA 1LO5D 1UE5A 1VF5C 4NKLA 4A3GG 2A68C 2LFNA 4H02A 3I4MG 1HZ9A 3SK6A 3VYUA 4B9XA 4BA2I 3GV6A 2JK8A 1PH4A 4DK0A 3RN2A 2Z9HA 3KF6B 4H13C 3DEPA 3QWNA 5IYDH 3CMEA 1CSQA 2XVSA 4C3HB 3FPUB 5T1GA 1HH2P 4JBKA 3CC7A 3S1RH 2WAQE 1FVIA 4A93B 4QQBX 1GHJA 3K5OA 4IUTA 4FO2A 2KCMA 5C6AA 2ES2A 1S3OA 3R3OA 1ZEQX 4YIJA 1FYCA 1GUGA 4BBRG 2DY8A 3RZDH 3DMUA 2B3GA 2EYMA 2EY2A 4A3EG 2VUMB 2XIWA 1MIUA 1Q3LA 1QUQA 1U5KA 3STBD 2E2JH 1WCMH 4PQXA 5IGGA 4BBSG 1KAAA 2JQOA 4JI7L 3CAMA 4U673 5F2DA 1L2FA 3HKZE 3OMGA 1XPUA 5C0XG 2EJGC 2HQLA 1QOHA 3KK7A 1EU3A 2EXZA 2EPBA 3I56A 2HD3A 4ME5A 2NVXB 4J1MA 4QMGA 4A75A 2Q2UA 2B2WA 4ME3A 3EQLC 2WB1G 3E5SA 1WTWA 3HOXB 4GKKQ 4J15A 2IX0A 4BWGB 2NVYH 2L15A 5FLXE 2QDLA 2MJ8A 1BNZA 4X65Q 1YBYA 4KLKA 1JE4A 1SNMA 5LMNL 3KBGA 3U58A 4IO9A 1FD7D 3QG1A 2K14A 1E22A 1QVGA 1I4GA 2SDFA 1TQOA 2ZM6Q 2RKSA 3S14H 3HOWG 2E2IB 3MXNB 2SNSA 3T16A 1G6PA 3TZDA 3D8GA 3H0GG 3GTLB 3TS0A 3CXCA 4JC0A 5IT9c 4ZAIA 4QF4A 1FNWA 3PUVA 5IGDA 2Y0SB 3T4AC 1CSPA 3HKZB 1P16A 2D5DA 2MUYA 2QGQA 2F0KA 2F0SA 4BY7G 2F0NA 5BN3A 4DUYL 1SFOB 3MAQA 2VXWA 4LMQD 2AKWB 1A3UA 1G2TA 2EQSA 1WTXA 4GNXB 4A93H 2K32A 3BJUA 5DM63 2XTIA 3NENA 5LL6X 4K14A 4JI1L 2A19A 5NUCA 1TWFB 4NXNL 1K0SA 5M5XB 1J5EQ 2E5LQ 4KJNA 3I73A 1HA5A 1TVXA 3RR5A 4DR4Q 3Q0AA 4LF8L 2CWAA 1KNAA 3ZYYX 2VUMH 2JA9A 2RSOA 1X3EA 4DR2L 5GAGC 1IZ6A 1QCBD 1EWIA 1B44D 4FXDA 3MHBA 1O80A 1ENFA 3PUYA 4JI5Q 1YEZA 1STYA 1B50A 2K4KA 3H15A 2WFWA 4KD3A 3GTQB 3GTGB 2JA8H 2PI2E 1V43A 5EPKA 2KBNA 4QCLA 3M4YA 1WVLA 2SEBD 3HOXH 1EQTA 5FLMG 1O7LA 2CH4A 3SK5A 5BR8L 1LACA 3HOYB 1A63A 1LT4D 4XT3B 4YWKA 1VMPA 4MTKA 2ZTDA 2RSNA 1SYEA 1TS3A 3AB9A 1JICA 2E2DC 1SYGA 1U9RA 1LT5D 3RLOA 4LUZA 1LM0A 1AE3A 5AJ3Q 2E2IH 5FO9B 5IP7G 4V0BA 3GTLH 2HQEA 1YJWA 5M5WH 2F0WA 2IY5B 2LMCB 4LFCQ 4DV5Q 1XNRQ 2Z6BA 4RGMA 2NVQB 3FKIB 4P71A 3U9OA 1PH8A 4OO1G 1GUSA 5LMUL 1SRUA 4RGNA 2ZTEA 4LK1C 3BZCA 1SJHD 3GO5A 1K28A 4F7XA 2LXJA 4HJ9A 1RF2D 1SFOH 4ZKBB 2F0GA 1D2BA 1PZJD 2A6HC 1QJOA 3QIAA 1UUPA 3NK9A 3BVZA 5M3MG 4OIJA 5M3FB 1MGSA 1KLUD 5T1IA 1F2LA 3EIVA 1HNXQ 4DV6Q 3T1YL 4A3MG 1TWFH 4TRDA 3K57A 3VR5A 4AQYL 5M5XH 1PDQA 1EY9A 4C3JH 1HTLD 3W1BA 4QIWB 1SMYC 3P7JA 4L5TA 4CDEC 2EJFC 2FINB 1N33Q 2B2WC 4JI2Q 1CT1D 3I55A 1BBUA 2PCFB 3I3CA 1AZQA 4KD4A 1V1PA 1TS5A 2IJ0A 2JA6G 1IBKQ 2ZTCA 1NR4A 3P1HA 4KN7C 3GTQH 3J81i 3TRZA 4B3RL 1D5XC 3GTGH 4OONA 2ALYB 2BDNA 4JPBW 2WINB 3K7AB 3QR8A 1E2WA 4IUUA 4QY7A 1YZ6A 3F2BA 2A74C 3RUZA 2YU9B 4DF7A 5CYUA 1N36L 1B1ZA 4IN3A 3HOYH 4RGOS 3U4VA 4GLVB 5D3DA 2BDOA 3M4QA 3KLSA 2PZUA 3NBHA 2DJFC 1KL9A 2QDBA 4JI3L 3FPPA 4CKCA 1H9RA 2K5DA 4MHEA 1SNPA 1TWHB 2D0PA 1EFID 4CKBA 1ZXTA 4OXPA 5LL6S 5KNBA 3CC2A 4A3BB 1FGBD 2AWOA 4P74A 1JQYD 1VQPA 4WJ4A 2N49A 1G91A 5IYDG 1WJJA 4CDCC 1WTRA 1DOMA 2GN5A 2NVQH 1TIID 1PYSB 1DM0B 3OWEB 4E6IA 1PRTF 3SVMA 4AYBE 2JA7B 4NMZA 4P75A 4UAIA 3SHLA 5FK9C 2F1MA 2I5LX 1EOVA 1TT2A 1YNJD 3VA5A 5M3FH 3E6ZX 1HR0Q 1PZKD 1N34Q 1WCMG 1TU2B 1P8LA 1J6QA 4IFDH 1FJGQ 4A3JB 3R93A 2YTYA 2RVLA 3NXWA 3C1FA 3K58A 1NR2A 5CV7A 3I4NB 5E4WC 1VQ9A 3A5ZB 3OOCA 4N8X1 1YJ9A 2RA4A 2KOLA 1BCPF 4LNQA 1JWUD 3QOLA 1B9MA 1BBXC 3I2ZA 4OIKA 5ELCA 3UDIA 2E8GA 4GZYC 4HIKA 4RCOA 5C3XA 4HSVA 1ILQA 4LF7Q 4K6LA 1B3QA 5DEHA 3F2DA 3KJPA 4WJWA 3STBC 4DAMA 4JK1C 1A3TA 3GTOB 2K5VA 3GTPB 2F4VQ 4GKKL 1PTOD 3NPPA 4DXFA 3DLLA 4POGA 3S17B 1I50B 3JAML 2M00A 4X3SA 3WWVA 1PH6A 2I5HA 5DNFA 4EGVA 4X65L 3PIOA 4LFBQ 3NQIA 2IT1A 1QVCA 5FJ8H 3FVQA 1QVFA 3F2CA 4EVOA 1N32Q 2YU9H 1E2VA 2NYZD 1I6HB 3BZDB 5C3EB 1A15A 2EYPA 2F03A 1SE2A 2EZVA 4FF3A 3H3VC 1PH7A 2ZM6L 4GOPA 1CTMA 1UEAB 3NE5B 5DAUA 3HOUB 1WTHA 2ZT9C 2V4DA 4R4OA 3CF5A 1NMFA 4J6HA 1SN8A 4BA1I 1TWHH 3A8KE 1DYQA 4JI4Q 1QNKA 1SYFA 2Q8IB 2M2LA 1LTTD 2UUBQ 4P2CB 2OXPA 3TBIB 3KJOA 4A3BH 4A76A 2R7ZB 3BZKA 3FHWA 1V1OA 2HDLA 3L9AX 4A3CH 3D3RA 4YHHQ 1Q81C 2EY5A 3CCJA 4A93G 2DN8A 2ICEC 5CR3A 4CJ2C 3BYTB 3J80c 2ATWA 3E3XA 4RWSC 1VQGA 1AW7A 2JA7H 2H5XA 1JE5A 4JOIA 4A3FB 4Q5VA 1KXLA 5JJZA 5KGUA 1Q7YC 1EQVA 1QZGA 4HCEA 5I2XA 4QB4A 1XYIA 2VNUD 1E1TA 2PNHA 2VUMG 1J5EL 2E5LL 4DR4L 1KLGD 2LY7A 1KD1C 3ULLA 1AN8A 2B63B 4KN4C 4PMBA 1EYGA 1X32A 2HT1A 3I4NH 3Q22A 2N78A 3V96A 2C35B 2CWPA 2JA8G 4HN7A 4JI5L 1BQQT 3WOEA 4IUQA 1B7YB 5L37A 2EYOA 4DFAA 3I90A 1ILPA 2MO1A 1PRTB 3HOXG 1IBMQ 1VQHA 1KDCA 4M1UB 4IOCA 1ML0D 1F9SA 1GUTA 3GTPH 2O5JC 4FF4A 3S17H 1I50H 1VQFA 2KECA 5EPJA 2Z1CA 1XTCD 1SNQA 3C1EA 1VDZA 1BVSA 1I6HH 2R3ZA 1FR3A 1EY7A 1NAPA 1ICWA 1SNDA 3D4RA 3HOUH 3VR2A 3W1GA 2R93B 1BCPB 3TSSA 5AJ3L 4DNRB 1JOQA 4C1NI 2EXDA 2G9HD 2Y0SG 1I3QB 4DV0Q 4DR1Q 1O7YA 3EA6A 3PO3B 1YHAA 1ASYA 4I7AA 2V1CC 3JAME 3ULPA 5JEAH 3IL8A 2PO4A 2R7ZH 4JBMA 1YNND 3DWPA 1PLFA 4LFCL 4DV5L 2K5QA 1MSGA 2JSOA 4KV6A 4XQJA 2CCZA 2F0VA 1F9QA 1HZBA 2B2VA 1XWEA 1Q46A 4A3DB 4XTCS 2F0UA 1D8LA 4CDDC 2O2LD 4B9WA 4DA2A 1X3FA 3RMHA 1I4HA 4I7ZC 3TP6A 3SK8A 5C0XJ 4A4IA 1PH1A 2F0PA 4A3FH 1SE8A 1KNEA 4C3JG 2MNAA 1HNXL 3ZJYC 2E2HB 4OWXB 4QL5A 4CGYB 2A6ED 4FF1A 3ER0A 1KDBA 1Q86C 4PZ7A 1KQSA 1AEXA 1Z7TA 4JI6Q 1N33L 2B63H 5EBDA 2EDGA 3KLRA 4JI2L 1SYCA 4X64Q 4G4KA 1SE4A 4DAYB 3PIO3 1FL0A 2PMZE 2L55A 5CGKA 1QZHA 1YHBA 1B53A 3BVGA 1K83B 4KY5A 5C4XB 3GTKB 3DUZA 1GO3E 1H9KA 1LUZA 1LLRD 4HJ7A 1IBKL 2RF4A 2NZOA 4R9WA 5HURA 3QB3A 2F3IA 4GOPC 3MXPA 3N6RA 3RNUA 1IKLA 1VQIA 1BOSA 3SK4A 3HOYG 5I9OA 4DNTB 4IALA 5J22A 3UDFA 1EOTA 1JC7A 5GAEC 4GKJQ 1QNUA 5E4XA 2KHJA 4MZ9A 4Y7NB 2N3SA 1L0YB 4PV1C 4GLXA 2KEDA 1EIHA 2RCFA 4UP8A 3FP9A 2DY7A 1R4PB 3DEOA 2K28A 3L7ZC 4IJHA 3AEVA 2R93H 2FFKB 3CRLC 5G3LF 4KKUA 5IOCA 4HJ8A 3C2PA 2VY3A 1EY5A 1NSNS 1I3QH 2Z6KC 3AFPA 1BBWA 1Y8NB 1SXTA 3PO3H 4TQUS 4O1NA 3PMFA 4Z9CB 4HIOA 3DM1A 2GVAA 3IAYA 4H0LC 2Z8LA 3K5NA 1RIPA 3BDCA 1G2SA 5IYCG 2K1BA 3KBXA 1X56A 1S5ED 5IGCA 4GN4B 4HIMA 4L63B 3CPFA 1AZPA 4A3DH 4DPGA 1MJCA 5M3FG 1F2YA 4GS3A 1IYVA 5JOBA 5J39A 3CMAA 1VQ8A 1T5XD 4WFN3 1EU4A 2EOTA 1DXMA 4IFDG 1HR0L 4UHVA 1CKMA 4UPAA 1N34L 1X54A 4JCVE 2E2HH 1X3GA 2IX1A 1VQKA 1F9RA 3OHXC 1NBWA 3MEFA 2B8GA 1FJGL 4NP5A 1WTQA 5JJIA 3F2UA 2HDMA 4HJAA 2NN6I 3WOFA 3A7LA 4EQPA 4LAAA 1SBBB 4ZLTF 1YNJC 1MJEA 1BKBA 1T9HA 3IFTA 4RCNA 2L4NA 4DV7Q 1U4MA 1K83H 4JG2A 1SDFA 4LF7L 4XXEA 5C4XH 1KHIA 1JOOA 3GTKH 4XQNA 3CU7A 4R4TA 3AMUA 1EY4A 1I4PA 5FJ8G 2F4VL 2VL6A 2WAQB 1ZKOA 1QE6A 3J7AF 3KFUA 4ID6A 1NY4A 2A69D 3HKSA 4LFBL 1LABA 3BVMA 1N32L 1S5CD 1HHVA 3NP8A 3S1NB 3KDFB 4Y7NH 4G7OC 1RODA 3LNNA 3PV0A 3CCLA 3L0OA 3EBEA 1U4RA 4A3BG 1JWMD 1DOLA 4WRDA 1L1OA 3T1HQ 4JI4L 4A3CG 1CA5A 1MI2A 2WP8J 5JPNC 2UUBL 4XT1B 3CD6A 2EYLA 1IBLL 2Q2IA 3IKJA 2R6GA 1V9PA 3T13A 3NUCA 1IYJB 3TP5A 2CQAA 4YHHL 2JA7G 2KJXA 3EJIA 5I2YA 4OX9Q 4C3HH 1VQLA 2CHBD 2HIVA 5I6WA 2EY1A 4QGUA 3TZUA 2K03A 3UE0A 4M8AA 4OGQC 5KNDA 4F8MA 5DLQE 3I8ZA 5BN4A 2CVRA 2OTLA 1RTNA 4RAUC 1Y1WB 3GP7A 4IUPA 5EKIA 1WTVA 3S2HB 3L3OC 4EQOA 3OPOA 2IW3A 3I4NG 1TWCB 2KQ3A 3F1ZA 2D0OA 1J9OA 3TN2A 2F0JA 1H95A 3M4OB 2H1EA 1JJ2A 1CQVA 1EY8A 3MWYW 4DXGA 2B2UA 2A5HA 3M4PA 2NVXH 2R92B 5FLXc 1KC8C 4B3MQ 1STAA 4DKAC 1IBML 4UY8C 4B3SQ 5CV5A 1LV9A 4ZQ3A 5LMNW 3R2TA 3H3VI 4ZUIA 3ICEA 1E0BA 3DM3A 2VQFQ 1EIYB 1YJNA 3AU7A 2X6LA 3VYRA 3C46A 1KRTA 1UEBA 1CHPD 1WI5A 2EYFA 2MPMA 3G6EA 3J80i 1KAWA 3HOUG 5JAVA 1S4ZA 1SYDA 3S1NH 2YTVA 1PMRA 1TWAB 5HGTA 1CI3M 1DJRD 1GUWA 4CDFC 1U0LA 1PFSA 5JEAG 3HOVB 2R7ZG 1GD7A 2A73B 2DJGC 5COYA 4DV0L 4DR1L 2EYHA 3OIPA 1JJCB 3J80L 3H6MA 1HUNA 1RKNA 2BE5D 4LFAQ 4DR6Q 3MZ5A 1ET6A 4A3GB 3O13A 4A3FG 3PQIA 3TP7A 5FO7B 5KEEA 4HIDA 3DHQA 5D14A 3W3AA 1MSHA 3EVQA 1ICFB 2HHHQ 5K36H 2WB1E 1SLJA 2O4XA 1YNNC 1B9NA 4P72A 4GN3B 2B63G 3S2HH 1IKMA 1WFQA 3IRBA 3QJYA 2DNEA 4BY1B 4J8QA 1HNWQ 1YITA 1GVPA 4JI6L 1Y8PB 2YYZA 2F0DA 2K33A 4KHVA 1SR3A 1I4XA 1TWCH 4X64L 2PZTA 4Y52H 3UDGA 1PH2A 4K2KA 1PHJA 3GTJB 3M4OH 5CV9A 3P75A 2A6EC 4K0KQ 4UP7A 1NMGA 1IW7D 2R92H 3SGIA 4DR3Q 1L0WA 4DV4L 3CCUA 1DGSA 1CKOA 4A3IB 4LF9Q 3CHBD 3NHHA 3Q8DA 1TR5A 2QKIC 1CKNA 1I94Q 3CCEA 3J81L 5IGFA 4GKJL 1A2UA 3E0JA 1XMOQ 1Q12A 2WB1B 5K5PA 2KA7A 2NUCA 1UE1A 5IIFA 2R93G 2DNCA 2EY6A 3VR4A 1TWAH 1VQBA 2K5WA 4PZ8A 4BXXH 4POFA 4K8IA 1XJVA 3PO3G 1D5ZC 3L2PA 5ELBA 2OCEA 5EJWA 4IPHA 3FKIH 4LJZC 3G4SA 1E2ZA 2F4IA 4A3DG 3NWTA 3OTOQ 3K7UC 5IE8A 3TP8A 1VMCA 5IYCH 1IXRA 1CZWA 3SEBA 3VYTA 3T53B 1AFPA 3BS1A 4AH6A 1EIGA 3KF6A 1GM5A 3CCVA 4ULLA 3E9HA 3HRZC 4DV3Q 2KVMA 1UAPA 2UXDQ 1G51A 2OTJA 1K3RA 1CK1A 1LYLA 2XRQD 4BY1H 4A3LH 2RDFA 1YNXA 1Q8IA 1Q8KA 2BOSA 1ET9A 1DD2A 1Q82C 4XYQA 2I5MX 5C4XG 4OL7A 2JA5B 2B2YA 1K73C 4IPGA 4DV7L 2I46A 2FMCA 3GTJH 1VF7A 1CM9A 2K50A 5ELDA 1IYUA 1WTPA 2B8FA 4G57A 1X55A 1VQ5A 2X6GA 4YWMA 4AYBB 3K7AH 2DGYA 4ZRZA 4JV5Q 2AQ1B 4RH6A 2H4OA 3A0JA 4DV2Q 3LX0A 3A7AB 4A3IH 3S16B 4C3IB 1C48A 5CC4A 3LWEA 2RDHA 2CH4W 4C2MB 5C4JB 1C0AA 3E9IA 2J7ZA 4K5XA 3OSOA 2BH2A 1JT8A 5LHY1 2I07B 2Q8TA 1U4PA 1BDOA 3K6OA 3ULJA 1IBLQ 2A69C 2BH8A 3T1HL 1MD2D 3GTMB 1I5FA 1VQ6A 1PZID 4HMJA 2KHIA 4IUNA 3PF5A 2K5HA 3MXNA 2Z4IA 4R4QA 3RD4A 4C3HG 1YI2A 3I91A 3RN5A 5FOBB 3J81E 4OX9L 3B6YA 2Q8RE 3J7A5 2A1AA 4NPSA 1PVOA 1I6VC 2GVBA 5CMDA 1I4QA 1UE6A 5IP9H 1STHA 3J7ZC 3F8TA 5C5MA 3EFXD 1IHZA 4EQNA 2JP1A 4F87A 2RHSB 1VQ7A 3IFDA 1E1OA 3LWUA 1GUOA 1N9WA 2R61A 4KJOA 1CFMA 4GNXA 4CBVA 3J7YW 1HJPA 4A3JH 2OT2A 3ND9A 4FYDA 1OXVA 2AMCB 3KOJA 2XRSD 1GOZA 1K8AC 3MTSA 1OXXK 4X62Q 2MGSA 1ESRA 4GLAC 1VS0A 4KTAA 1QWYA 4X3UA 2Q2HA 2VZAA 4ABNA 2JA5H 1VQOA 3D4DA 1F9PA 1ZYRD 3U9SA 2IWHA 2Z0SA 2XWJB 5M5YB 3GTOH 2RQXA 4B3ML 2WAQG 4LW1A 1H9SB 4ODGA 1SYBA 5JPMC 3S9WA 4B3SL 2M9VA 2AQ2B 3AFQA 1B4OA 2NN6H 1E24A 3OW2A 2VQFL 1QG7A 1D6EC 4K2LA 3S16H 1KTKA 4C3IH 4MTNA 5C3EH 1ENAA 5IT9L 4C2MH 1S72A 5C4JH 1B3AA 1RTOA 2QILA 3CCRA 2CW0D 3X3NA 4DK3C 4YY3Q 3KYHC 1K0RA 4KY7A 3VDYA 1KIXA 4EX5A 4KKTA 1FGUA 3HKZG 1W6JA 4IOAA 2XNAC 2N88A 4IFDJ 3PF4A 1QB5D 3M3YB 4JI8Q 1JMCA 1Z6HA 2AHOB 3GTMH 2EYJA 3FMCA 3PUWA 4C1NK 5EAYA 1VQNA 4X66L 1W2BA 1C7YA 4LFAL 2QEXA 4DR6L 3A8IE 5IODA 5K36G 2D2CC 4V190 4HEDA 1S5FD 3P20A 4DNIA 4O0AA 1PV4A 2OWOA 2VQEQ 2F3VA 3D6CA 2HHHL 2F0OA 2PI2A 2QEJC 3G48A 2KENA 1M1KC 2BE5C 5H1SE 4JBWA 3LGJA 5C0XI 1HNWL 2UXCQ 5J1ZA 1JB7A 3PO2B 4DV1Q 2AUJD 4DK1A 1H9MA 5ELEA 1V1PB 2JEAI 3CQZB 5FLXL 1HXYD 2E74C 2KHSA 3HOZB 1TS2A 1V1QA 2NZ1D 5TSSA 4JYAL 4DGZA 2R92G 4K0KL 4KHPQ 2BA1A 4DV4Q 1ESFA 1KABA 3R2IA 5JVH3 5I6YA 4LWCA 5C3WA 2D9UA 5M5YH 4DR3L 3HEJA 1RD9D 4OEMB 2F0IA 4RG1A 4LF9L 1EEID 3TS2A 4G7ZC 5JJKA 1Q90A 2VB3X 1Y8OB 1I94L 1VQJA 5CV6A 2NVYB 2QW7A 3VA7A 3HZXA 3NBHB 3QOJA 2C9OA 1XMOL 3SE0A 4AIMA 5HGQA 3K5LA 1JJGA 1IW7C 4BXXG 2BA0A 1R4QB 5C5LA 3JAMc 4X6AH 1NE3A 4BS9A 1PXUA 4JOIC 4LF6Q 2PMZB 3FKIG 4DAVA 3S14B 3K5MA 1OXSC 3BDLA 3H3VH 3TDQA 3H94A 1VQMA 3M3YH 1FNVA 2N8NA 3GQBA 4HMIA 5KYLA 1LTBD 1Q1BA 3NTHA 3OTOL 3K80C 1HNZQ 4KI0A 4GNXC 1SE3A 1F2MA 5IT9E 1XMQQ 1DZ1A 1RHPA 1FNUA 5C4HA 1HRJA 4TSSA 1OTCA 3W2DA 1PRTD 4DV3L 1EQQA 4NW2A 5IGEA 5EKLA 2X69A 2UXDL 4HSPA 3BYYB 4BY1G 2FHTA 5C44B 4A3LG 1QILA 4JW0A 5CORA 3CC4A 3K59A 2IHEA 3W5OA 3PO2H 2HIXA 4HTHA 1VQDA 5IYBH 3MVVA 2QF7A 3A5UA 2HUGA 3CQZH 4PG3A 2WACA 3NEMA 1EEFD 3HOZH 4A3KB 2Y0SE 3K0XA 1PTOF 2L9HA 4LUVA 4KY6A 1BCPD 1TKWB 3Q6SA 1CZGA 3BDOA 3EROA 1IL8A 5JEAJ 3A74A 4A3IG 1OXUA 2JA8B 4MIUA 1GJXA 4JV5L 1Z9FA 4DV2L 2G9DA 2UUAQ 1F2ZA 4RHSA 1K3BC 1RJTA 5C4ZA 4ILWA 4GOPB 2WIIB 1A6XA 1F77A 4RKLA 1PFMA 3S15B 1PTOC 1STNA 2B2VC 3OIQA 5GAHC 2A8VA 1XTDA 3OYYA 4ZUJA 1YIJA 1HUMA 2J4XA 2NVTB 5D3IB 4OO1I 2O5IC 3KF8B 2YTXA 1JCKB 4FF2A 1K9MC 2FXQA 1XX8A 1PFBA 2IL8A 4ZYSA 1PH3A 2PQAB 2K04A 5IP9G 3CW2C 4FDBA 4O42A 4S3SA 1G6ZA 5M5WB 5ELNA 2KCTA 5IY0A 2YV5A 4FP5D 1TY2A 1E3PA 2K05A 3WDNA 4NB3A 3MEHA 2HCCA 1HR0W 4RGTA 4DK6C 2FMMA 1JR0D 4A3JG 4ZK9B 2ID0A 3A8JE 2NWGA 2ZXPA 4DR5Q 3AYHB 4JI0Q 1B8AA 1S40A 5C44H 5GROA 2QCPX 4XYOA 1CA6A 2OQ0A 5EKKA 2L1BA 5KIXA 4C3JB 1TWGB 5ELFA 1I4RA 1PFNA 1K8MA 3QO2A 4X62L 2JA5G 3V05A 3NBIA 2UUCQ 4G7HC 5E1FA 1MBYA 4DR7L 4R4IA 4LF4Q 4A3KH 4AYBG 4FNFA 2ZJRA 2WV6D 2NN6G 3HFZB 4KKSA 4APVA 4Q0FA 4C3IG 5C3EG 4KHZA 2K6AA 1DOKA 2KUMA 4DUZQ 4CJ1B 1WTOA 2K5NA 2B2TA 4TKOB 3VYSA 1OO9B 4XDXA 3OMCA 3U50C 1ZYRC 1Y1VB 1H9SA 1JORA 3UE1A 2IHFA 1YHQA 3ERQA 4OWWB 1J8IA 3A54A 4RMFA 1UE7A 3S15H 1W3SA 3GV3A 5E3FA 4YY3L 5IWAQ 4QIWE 2L12A 1A0IA 2K01A 5BN5A 3KUPA 2NVTH 4GN5A 4K5VA 2K75A 3RLFA 4JI8L 4X66Q 2PNRC 1PA6A 3RLNA 1PTOB 2PZWA 2MHVA 5EQ0A 5E7NA 1LT3D 2CW0C 2UXBQ 1UWVA 1PH9A 2I0QA 4UP9A 3I4MB 2MFIA 2RDGA
chains in the Genus database with same CATH topology
4IZ8A 2JE6I 4N9TA 1RDPD 4PMCA 3I70A 1EZ8A 1SAPA 1JOKA 3DXJC 5I4DA 3NTIA 3MXUA 3H91A 1UNSA 2LKVA 3OW7A 2MP1A 1Y69U 5EBCA 4BBRB 4RKBA 4L6TB 2JEBI 4A3EB 2TMPA 1NUCA 1S5DD 4H7BA 1BR9A 1HFGA 2L11A 3MA2B 4C56C 4BBSB 5DM73 1EWCA 1GHKA 4U68A 4DAYA 3SR1A 2SOBA 3MC0B 1C4QA 4DU9A 2XWBB 3R8BA 2J0TD 4IQZA 1W6KA 2EVBA 1K8OA 3S1QB 3HP3A 2PQEA 2NTTA 2F0TA 1RCVD 2C5CA 2A68D 4L8JA 3KLSX 3I72A 4X3TA 5CBAE 2F0FA 2N55A 1EY6A 2OF1A 1SNOA 1EWHA 2PYKA 1STEA 4UDUC 3HOWB 2KCNA 1C8CA 2ENBA 2EJMA 3H0GB 3J7AV 1BUVT 1PTOH 1XXGA 2ZXRA 3FEWX 4KMUC 3FRPB 5G3LD 4DN4M 1HCZA 4HR7B 1EZ6A 1B2TA 1Z47A 2AQ3B 2F3WA 2WKCA 4FVMA 4CKEA 4BY7B 3PUXA 3RZOB 2EE1A 1ENCA 1LTSD 2B2UC 3SXHA 1AP0A 4NDXA 3A55A 4DAPA 3NTKA 3J80E 3G7LA 2TSSA 5ISRA 2ZXOA 5CV4A 1Q1EA 3DWAA 1EL0A 1KDAA 4ZKCB 1LTAD 4HAEA 1HPCA 1NCVA 1PRTC 5KRUA 3Q23A 4RHRA 5CBEE 2NTSA 2B2TC 2KEEA 4MN3A 2NBFA 2B39A 5A35A 1V8QA 2E76C 2XN9C 2Z4HA 5JVG3 5C0XH 4X3KA 4I65A 1TY0A 3V2TA 3ND8A 1BXTA 2F0LA 1OXTA 3NQTA 1JB3A 1GUNA 1DCZA 1D5MC 1BCPC 3X3MA 2F0QA 5IGBA 2VB2X 4FXKC 2L0CA 3PUZA 1BF4A 4K6DA 5AFWA 4CHTB 1PYWD 3A56A 3CKIB 1HA6A 3URYA 3NSWA 4WORA 4N9PA 3KF8A 3H09A 4HCSA 1STBA 2K7VA 1M4VA 3MFGA 3MXGA 4PNYA 1EYAA 3NWSA 1T5EA 5M3MB 5FKAC 1HTPA 4R8NA 4IUVA 3T56B 4A3MB 2XSCA 5KYIA 2FJ2A 2PW7A 3S1MB 5D65A 1M8AA 2E75C 2BCOA 3SDZA 4KK7A 5A2QL 2RBMA 1DONA 1TS4A 4B08A 1WD1A 4QUFA 5KNCA 2OEOA 2JA6B 1WD0A 2JYOA 3BG3A 1L0XB 1EYDA 5EGTA 1EY0A 1CQFA 3D6WA 1O78A 5EPLA 3PIP3 4QUCA 3VR6A 3N52A 3OWFA 3I4LA 3UI2A 1ONLA 3C3LA 2IPKD 1JWSD 1A3VA 2NB0A 3S2DB 2IX3A 1SJED 2AWNA 1S5BD 1D1IA 1R9TB 3FDTA 3M85A 1SEBD 4OHJA 3VR3A 3Q24A 2GA4B 3T51B 2A6HD 4PMWA 3HS0C 1LTGD 3ONAB 3MFYA 4RFBA 3ITPA 3K0YA 4K8JA 5FO8B 1SSOA 1U4LA 4IFDI 4CJ0B 5M9OA 1SNCA 2F0HA 3D31A 1STGA 1X3PA 1A2TA 1SMYD 1BO0A 3S1RB 4OO1H 5I9PA 2B2YC 1X3QA 3GD7A 2HCIA 4FXGC 1G8ZD 1HFNA 4RA8A 4F88A 3RZDB 3HG9A 4IURA 2KCCA 2E2JB 3M7GA 3G6JB 1WCMB 3D4WA 2PPBC 3TMEA 1EYCA 5CV8A 1G291 1HQMC 3DWQA 1LT6D 1HQRD 1O7ZA 3CRKC 4XIGS 2PW5A 2LS01 2JXMB 3HGBA 1GXDC 4K5WA 1CHQD 1H9JA 4H44C 1VCIA 2F0EA 2WKDA 3M7NA 1D1KA 5A2QE 2D62A 2SNMA 1LTID 2AUKA 2L5TA 1LTRD 4XQQA 2ICIA 1II3A 4R8IA 2F0MA 1LO5D 1VF5C 4NKLA 2A68C 2LFNA 3SK6A 3VYUA 4B9XA 4BA2I 3GV6A 4DK0A 4H13C 3DEPA 3QWNA 2XVSA 4C3HB 3FPUB 5T1GA 4A93B 1GHJA 3K5OA 4IUTA 4FO2A 5C6AA 3R3OA 1ZEQX 4YIJA 1FYCA 1GUGA 2DY8A 3DMUA 2EYMA 2EY2A 2VUMB 2XIWA 1Q3LA 4PQXA 5IGGA 1KAAA 4U673 5F2DA 3OMGA 5C0XG 2EJGC 1QOHA 3KK7A 1EU3A 2EXZA 2EPBA 4ME5A 2NVXB 4J1MA 4QMGA 2B2WA 3EQLC 3E5SA 1WTWA 3HOXB 2IX0A 4BWGB 5FLXE 2MJ8A 1BNZA 1JE4A 1SNMA 3KBGA 1FD7D 3QG1A 1I4GA 2SDFA 1TQOA 2RKSA 2E2IB 2SNSA 3T16A 3TZDA 3D8GA 3GTLB 4ZAIA 4QF4A 1FNWA 3PUVA 5IGDA 2Y0SB 3T4AC 3HKZB 2D5DA 2MUYA 2F0KA 2F0SA 2F0NA 5BN3A 1SFOB 3MAQA 2VXWA 4LMQD 1A3UA 1G2TA 1WTXA 2K32A 5DM63 5LL6X 4K14A 5NUCA 1TWFB 5M5XB 4KJNA 3I73A 1HA5A 1TVXA 3Q0AA 1KNAA 3ZYYX 2RSOA 1QCBD 1B44D 4FXDA 3MHBA 1O80A 1ENFA 3PUYA 1STYA 1B50A 3GTQB 4KD3A 3GTGB 1V43A 5EPKA 4QCLA 3M4YA 1WVLA 2SEBD 1EQTA 1O7LA 3SK5A 1LACA 3HOYB 1LT4D 4XT3B 1VMPA 2RSNA 1SYEA 1TS3A 3AB9A 1JICA 2E2DC 1SYGA 1U9RA 1LT5D 5FO9B 4V0BA 2HQEA 2F0WA 2LMCB 4RGMA 2NVQB 3FKIB 3U9OA 4OO1G 1GUSA 4RGNA 4LK1C 1SJHD 3GO5A 4F7XA 1RF2D 4ZKBB 2F0GA 1D2BA 1PZJD 2A6HC 1QJOA 3QIAA 1UUPA 3NK9A 3BVZA 4OIJA 5M3FB 1MGSA 1KLUD 5T1IA 1F2LA 4TRDA 3K57A 3VR5A 1PDQA 1EY9A 1HTLD 4QIWB 1SMYC 3P7JA 2EJFC 2FINB 2B2WC 1CT1D 2PCFB 3I3CA 1AZQA 4KD4A 1V1PA 1TS5A 2IJ0A 1NR4A 3P1HA 4KN7C 1D5XC 2BDNA 2WINB 3K7AB 1E2WA 4IUUA 2A74C 3RUZA 2YU9B 4DF7A 5CYUA 1B1ZA 4IN3A 4RGOS 5D3DA 2BDOA 3KLSA 2PZUA 3NBHA 2QDBA 3FPPA 4CKCA 1H9RA 2K5DA 4MHEA 1SNPA 1TWHB 1EFID 4CKBA 1ZXTA 5LL6S 5KNBA 4A3BB 1FGBD 2AWOA 1JQYD 1G91A 1WTRA 1DOMA 1TIID 1DM0B 3OWEB 4E6IA 1PRTF 3SVMA 2JA7B 4NMZA 4UAIA 3SHLA 5FK9C 2F1MA 1TT2A 1YNJD 3VA5A 3E6ZX 1PZKD 1TU2B 4IFDH 4A3JB 3R93A 3NXWA 2RVLA 3C1FA 3K58A 1NR2A 5CV7A 3I4NB 5E4WC 3OOCA 2RA4A 2KOLA 1BCPF 1JWUD 3QOLA 1B9MA 1BBXC 4OIKA 5ELCA 4GZYC 4RCOA 5C3XA 4HSVA 1ILQA 4K6LA 5DEHA 4WJWA 4JK1C 1A3TA 3GTOB 3GTPB 1PTOD 3NPPA 4DXFA 3S17B 1I50B 3JAML 2M00A 4X3SA 5DNFA 4EGVA 3NQIA 2IT1A 3FVQA 4EVOA 1E2VA 2NYZD 1I6HB 3BZDB 5C3EB 1A15A 2EYPA 2F03A 1SE2A 2EZVA 4FF3A 3H3VC 1CTMA 1UEAB 3NE5B 5DAUA 3HOUB 2ZT9C 2V4DA 4J6HA 4BA1I 3A8KE 1DYQA 1SYFA 1QNKA 2Q8IB 2M2LA 1LTTD 4P2CB 2OXPA 3TBIB 2R7ZB 1V1OA 2HDLA 3L9AX 3D3RA 2EY5A 2DN8A 2ICEC 5CR3A 4CJ2C 3BYTB 4RWSC 1AW7A 4A3FB 4Q5VA 5JJZA 5KGUA 1EQVA 4HCEA 5I2XA 4QB4A 1XYIA 2VNUD 1KLGD 2LY7A 1AN8A 2B63B 4KN4C 4PMBA 1X32A 3Q22A 3V96A 4HN7A 1BQQT 3WOEA 4IUQA 2EYOA 4DFAA 3I90A 1ILPA 1PRTB 1KDCA 4M1UB 1ML0D 1F9SA 1GUTA 2O5JC 4FF4A 2KECA 5EPJA 2Z1CA 1XTCD 1SNQA 3C1EA 1VDZA 2R3ZA 1FR3A 1EY7A 1NAPA 1ICWA 1SNDA 3D4RA 3VR2A 2R93B 1BCPB 3TSSA 4DNRB 1JOQA 4C1NI 2G9HD 1I3QB 1O7YA 3EA6A 3PO3B 3JAME 5JEAH 3IL8A 2PO4A 1YNND 1PLFA 3DWPA 2K5QA 1MSGA 2JSOA 4KV6A 4XQJA 2F0VA 1F9QA 2B2VA 1XWEA 4A3DB 4XTCS 2F0UA 2O2LD 4B9WA 4DA2A 3RMHA 1I4HA 4I7ZC 3TP6A 3SK8A 5C0XJ 2F0PA 1KNEA 4C3JG 2E2HB 4CGYB 2A6ED 4FF1A 1KDBA 1AEXA 1Z7TA 5EBDA 2EDGA 3KLRA 1SYCA 4G4KA 1SE4A 3PIO3 5CGKA 2L55A 1B53A 3BVGA 1K83B 4KY5A 5C4XB 3GTKB 3DUZA 1H9KA 1LLRD 4R9WA 5HURA 3QB3A 3MXPA 3N6RA 1IKLA 1BOSA 3SK4A 5I9OA 4DNTB 4IALA 5J22A 1EOTA 1JC7A 1QNUA 5E4XA 4Y7NB 1L0YB 4PV1C 2KEDA 1EIHA 2DY7A 1R4PB 3DEOA 2K28A 3L7ZC 2FFKB 3CRLC 5G3LF 4KKUA 5IOCA 3C2PA 1EY5A 1NSNS 1Y8NB 1SXTA 4TQUS 4O1NA 3PMFA 4Z9CB 3DM1A 3IAYA 4H0LC 2Z8LA 3K5NA 3BDCA 1G2SA 2K1BA 3KBXA 1S5ED 5IGCA 4L63B 1AZPA 1F2YA 1IYVA 5JOBA 5J39A 1T5XD 4WFN3 1EU4A 2EOTA 1DXMA 4IFDG 2IX1A 1F9RA 3OHXC 2B8GA 4NP5A 1WTQA 3F2UA 2HDMA 2NN6I 3WOFA 3A7LA 4EQPA 4LAAA 1SBBB 4ZLTF 1YNJC 3IFTA 4RCNA 2L4NA 1U4MA 1SDFA 4XXEA 1JOOA 4XQNA 3CU7A 3AMUA 1EY4A 1I4PA 2WAQB 1ZKOA 1QE6A 4ID6A 2A69D 1LABA 3BVMA 1S5CD 1HHVA 3NP8A 3S1NB 4G7OC 1RODA 3LNNA 3PV0A 1U4RA 1JWMD 1DOLA 4WRDA 1CA5A 1MI2A 2WP8J 5JPNC 4XT1B 2EYLA 3IKJA 2R6GA 3T13A 3NUCA 3TP5A 2CQAA 2KJXA 3EJIA 5I2YA 2CHBD 5I6WA 2EY1A 3TZUA 2K03A 4M8AA 4OGQC 5KNDA 4F8MA 3I8ZA 5BN4A 2CVRA 1RTNA 4RAUC 1Y1WB 3GP7A 4IUPA 5EKIA 1WTVA 3S2HB 3L3OC 4EQOA 3OPOA 2IW3A 1TWCB 2KQ3A 1J9OA 3TN2A 2F0JA 3M4OB 2H1EA 1CQVA 1EY8A 3MWYW 4DXGA 2B2UA 2A5HA 2R92B 1STAA 5CV5A 1LV9A 4ZQ3A 3R2TA 4ZUIA 1E0BA 3AU7A 2X6LA 3VYRA 3C46A 1CHPD 2EYFA 2MPMA 5JAVA 1S4ZA 1SYDA 1PMRA 1TWAB 5HGTA 1CI3M 1DJRD 1GUWA 5JEAG 3HOVB 2A73B 5COYA 2EYHA 3OIPA 3J80L 3H6MA 1HUNA 1RKNA 2BE5D 3MZ5A 1ET6A 4A3GB 3O13A 3TP7A 5FO7B 5KEEA 3DHQA 5D14A 3W3AA 1MSHA 3EVQA 5K36H 2O4XA 1YNNC 1B9NA 1IKMA 3QJYA 2DNEA 4BY1B 4J8QA 1Y8PB 2YYZA 2F0DA 2K33A 4KHVA 1I4XA 2PZTA 4K2KA 3GTJB 5CV9A 3P75A 2A6EC 1IW7D 4A3IB 3CHBD 3NHHA 1TR5A 2QKIC 3J81L 5IGFA 1A2UA 3E0JA 1Q12A 2WB1B 5K5PA 2KA7A 2NUCA 5IIFA 2DNCA 2EY6A 3VR4A 2K5WA 4K8IA 1D5ZC 5ELBA 5EJWA 4LJZC 1E2ZA 2F4IA 3NWTA 3TP8A 1VMCA 1CZWA 3SEBA 3VYTA 3T53B 1AFPA 3BS1A 1EIGA 4ULLA 3HRZC 2KVMA 1UAPA 1CK1A 2XRQD 2RDFA 1Q8IA 2BOSA 1ET9A 1DD2A 4XYQA 4OL7A 2JA5B 2B2YA 2I46A 2FMCA 1VF7A 1CM9A 5ELDA 1IYUA 1WTPA 2B8FA 4G57A 2X6GA 4AYBB 4ZRZA 2AQ1B 4RH6A 2H4OA 3LX0A 3A7AB 3S16B 4C3IB 1C48A 5CC4A 3LWEA 2RDHA 4C2MB 5C4JB 2J7ZA 4K5XA 3OSOA 5LHY1 2I07B 2Q8TA 1U4PA 1BDOA 3K6OA 2A69C 1MD2D 3GTMB 1PZID 4HMJA 4IUNA 3MXNA 2Z4IA 3RD4A 4C3HG 3I91A 5FOBB 3J81E 2Q8RE 1I6VC 5CMDA 1I4QA 1STHA 5C5MA 3EFXD 1IHZA 4EQNA 2JP1A 4F87A 3IFDA 3LWUA 1GUOA 2R61A 4KJOA 1CFMA 4CBVA 3J7YW 2OT2A 3ND9A 4FYDA 1OXVA 2XRSD 1GOZA 3MTSA 1OXXK 2MGSA 1ESRA 4KTAA 1QWYA 4X3UA 4ABNA 3D4DA 1F9PA 3U9SA 1ZYRD 2IWHA 2XWJB 5M5YB 2RQXA 1H9SB 4ODGA 1SYBA 5JPMC 3S9WA 2M9VA 2AQ2B 1B4OA 2NN6H 1QG7A 1D6EC 4K2LA 1KTKA 1ENAA 5IT9L 1B3AA 1RTOA 2QILA 2CW0D 3X3NA 4KY7A 4KKTA 1W6JA 2XNAC 2N88A 4IFDJ 1QB5D 3M3YB 1Z6HA 2EYJA 3FMCA 3PUWA 4C1NK 3A8IE 5IODA 5K36G 2D2CC 4V190 4HEDA 1S5FD 3P20A 2F3VA 3D6CA 2F0OA 2QEJC 2BE5C 4JBWA 5C0XI 5J1ZA 3PO2B 2AUJD 4DK1A 1H9MA 5ELEA 1V1PB 2JEAI 3CQZB 5FLXL 1HXYD 2E74C 2KHSA 3HOZB 1TS2A 2NZ1D 5TSSA 4DGZA 2BA1A 1ESFA 1KABA 3R2IA 5JVH3 5I6YA 5C3WA 2D9UA 3HEJA 1RD9D 2F0IA 1EEID 4G7ZC 1Q90A 2VB3X 1Y8OB 5CV6A 2NVYB 3VA7A 3HZXA 3QOJA 2C9OA 3SE0A 3K5LA 1IW7C 2BA0A 1R4QB 5C5LA 4BS9A 1PXUA 2PMZB 4DAVA 3S14B 3K5MA 1OXSC 3BDLA 3TDQA 3H94A 1FNVA 3GQBA 4HMIA 5KYLA 1LTBD 1Q1BA 3NTHA 4KI0A 1SE3A 1F2MA 5IT9E 1DZ1A 1RHPA 1FNUA 5C4HA 1HRJA 4TSSA 3W2DA 1PRTD 4NW2A 5IGEA 5EKLA 2X69A 4HSPA 3BYYB 5C44B 2FHTA 1QILA 5CORA 3K59A 4HTHA 3MVVA 2QF7A 2HUGA 2WACA 1EEFD 4A3KB 1PTOF 2L9HA 4KY6A 1BCPD 1TKWB 3Q6SA 1CZGA 3BDOA 3EROA 1IL8A 5JEAJ 1OXUA 2JA8B 4MIUA 1GJXA 2G9DA 1F2ZA 4RHSA 1RJTA 5C4ZA 4ILWA 2WIIB 1A6XA 1F77A 4RKLA 1PFMA 3S15B 1PTOC 1STNA 2B2VC 3OIQA 4ZUJA 1HUMA 2J4XA 2NVTB 5D3IB 4OO1I 2O5IC 1JCKB 4FF2A 1XX8A 1PFBA 2IL8A 4ZYSA 2K04A 4O42A 4S3SA 1G6ZA 5M5WB 4FP5D 1TY2A 2K05A 3WDNA 3MEHA 2HCCA 4RGTA 2FMMA 1JR0D 4ZK9B 2ID0A 3A8JE 2NWGA 2ZXPA 2QCPX 4XYOA 1CA6A 5EKKA 2L1BA 5KIXA 4C3JB 1TWGB 5ELFA 1I4RA 1PFNA 1K8MA 3QO2A 3V05A 3NBIA 4G7HC 5E1FA 1MBYA 4FNFA 2WV6D 2NN6G 4KKSA 4Q0FA 4C3IG 4KHZA 2K6AA 1DOKA 2KUMA 4CJ1B 1WTOA 2B2TA 4TKOB 3VYSA 1OO9B 4XDXA 3OMCA 1ZYRC 1Y1VB 1H9SA 1JORA 3ERQA 1J8IA 3A54A 3GV3A 5E3FA 2L12A 2K01A 5BN5A 3KUPA 4K5VA 3RLFA 2PNRC 1PTOB 2PZWA 2MHVA 5EQ0A 1LT3D 2CW0C 3J7AF 3I4MB 2RDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IZ8 A;  4R8N A;  3SK5 A;  4K2K A;  4K2L A;  2OXP A;  2QDB A;  1EYC A;  4ME5 A;  4N9T A;  4J1M A;  4QMG A;  1ENA A;  2KQ3 A;  5CV8 A;  5C5L A;  1SNP A;  5CV9 A;  2F0U A;  3P75 A;  4NDX A;  3SXH A;  5KYI A;  3E5S A;  2PW7 A;  4B9W A;  4PMC A;  1EZ8 A;  4S3S A;  3LX0 A;  3SK8 A;  3TP6 A;  3BDL A;  1JOK A;  2F0P A;  2F0J A;  5CC4 A;  1SYE A;  5CV4 A;  5ISR A;  4NP5 A;  1SNM A;  2EY5 A;  5IOC A;  4KY7 A;  1EY8 A;  1SYG A;  1U9R A;  5CR3 A;  2RBM A;  1KDA A;  2LKV A;  4HMI A;  3MEH A;  2PW5 A;  3NHH A;  4K5X A;  3OSO A;  5KYL A;  1TR5 A;  1KDB A;  4LAA A;  4EQP A;  1TQO A;  1F2M A;  1STA A;  4K5W A;  5KGU A;  2HQE A;  1AEX A;  2OEO A;  2RKS A;  4E6I A;  1EQV A;  5KRU A;  5IGF A;  2EYJ A;  4QB4 A;  1A2U A;  5CV5 A;  4ZQ3 A;  2F0W A;  2F0E A;  4NMZ A;  1SYC A;  4RKB A;  1EYD A;  2SNS A;  3T16 A;  5K5P A;  1JOO A;  1NUC A;  5EGT A;  2NUC A;  5C4H A;  3D8G A;  1EY0 A;  3U9O A;  4H7B A;  4ZUI A;  3SHL A;  5CGK A;  5IIF A;  1EY4 A;  4HMJ A;  4QF4 A;  2EY6 A;  5EKK A;  2SNM A;  4IUN A;  1TT2 A;  3OWF A;  3VA5 A;  5IGD A;  5KIX A;  5IOD A;  4KY5 A;  5IGE A;  4PMB A;  4I65 A;  5EKL A;  4F7X A;  2EYF A;  1II3 A;  3SR1 A;  4K8I A;  2F0G A;  2SOB A;  5JAV A;  2F0M A;  1SYD A;  4ID6 A;  3V2T A;  1A3V A;  2F3V A;  2F0L A;  3D6C A;  4NKL A;  2F0K A;  3NK9 A;  2F0S A;  2F0O A;  2F0N A;  3QB3 A;  3NQT A;  4DU9 A;  5HGT A;  5HUR A;  5E1F A;  3NXW A;  3C1F A;  3MXP A;  3SK6 A;  1STH A;  4HTH A;  4B9X A;  5CV7 A;  3NP8 A;  1A3U A;  5C5M A;  1IHZ A;  3SK4 A;  4TRD A;  3MVV A;  2F0Q A;  2EYO A;  4EQN A;  5I9O A;  4DFA A;  3QOL A;  5IGB A;  1EY9 A;  2PQE A;  4IAL A;  5J22 A;  5J1Z A;  2EYH A;  3TP8 A;  2WAC A;  2F0T A;  4K14 A;  3ITP A;  1KDC A;  5NUC A;  4KJO A;  3H6M A;  4K8J A;  5C3X A;  4KY6 A;  4WRD A;  1RKN A;  4K6D A;  5DEH A;  4KJN A;  3ERO A;  5M9O A;  2KHS A;  2F0F A;  1SNC A;  4KD4 A;  2F0H A;  2EYL A;  3MZ5 A;  1SNQ A;  1STG A;  4DGZ A;  1A2T A;  5C6A A;  3C1E A;  3OMC A;  1A3T A;  4MIU A;  3R3O A;  1EY6 A;  2OF1 A;  3TP7 A;  1JOR A;  1SNO A;  3ERQ A;  4YIJ A;  3T13 A;  3NUC A;  3DHQ A;  3TP5 A;  5I9P A;  4WOR A;  5KEE A;  2M00 A;  1F2Z A;  2PYK A;  1KAB A;  1EY7 A;  4N9P A;  2ENB A;  3EJI A;  3DMU A;  3EVQ A;  3P1H A;  4KTA A;  5E3F A;  5C3W A;  5C4Z A;  1EY5 A;  1SND A;  1NSN S;  2EYM A;  4G57 A;  2EY2 A;  3MHB A;  5I6W A;  5I6Y A;  2O4X A;  2EY1 A;  4EVO A;  3HEJ A;  3D4D A;  1STB A;  1STY A;  4RKL A;  2F0I A;  5IGG A;  3PMF A;  2RDF A;  2EYP A;  4K5V A;  1JOQ A;  1KAA A;  1STN A;  4KD3 A;  4PNY A;  1EYA A;  3BDC A;  4F8M A;  5F2D A;  1EZ6 A;  4OL7 A;  5CV6 A;  4ODG A;  5DAU A;  1SYB A;  4ZUJ A;  3RUZ A;  3S9W A;  4DF7 A;  3D4W A;  3HZX A;  2PZW A;  3OMG A;  3QOJ A;  2F0D A;  4KHV A;  5IGC A;  2F3W A;  4J6H A;  4EQO A;  1F2Y A;  2EXZ A;  2PZT A;  1ENC A;  4KV6 A;  1SYF A;  2F0V A;  2PZU A;  3TME A;  5JOB A;  5J39 A; 
#chains in the Genus database with same CATH topology
 4IZ8 A;  2JE6 I;  4N9T A;  1XPR A;  2OQK A;  1XNQ Q;  1RDP D;  1NNX A;  4PMC A;  3I70 A;  1EZ8 A;  1SAP A;  2VQE L;  1Y1W H;  1JOK A;  3DXJ C;  5I4D A;  3NTI A;  2UU9 L;  2MO0 A;  3MXU A;  3H91 A;  1UNS A;  2LKV A;  3OW7 A;  1GKH A;  2UXC L;  2MP1 A;  4DV1 L;  1CUK A;  1Y69 U;  3D0F A;  5EBC A;  4BBR B;  4ZCK A;  4JYA Q;  4RKB A;  4L6T B;  1TWG H;  2JEB I;  4A3E B;  2TMP A;  4LF5 Q;  1NUC A;  2VS1 A;  1S5D D;  2R7F A;  4H7B A;  1BR9 A;  1HFG A;  2L11 A;  3CCQ A;  3MA2 B;  4C56 C;  4BBS B;  2ASB A;  5DM7 3;  1EWC A;  2ZJP A;  1GHK A;  4KHP L;  4U68 A;  4N8F A;  4DAY A;  3SR1 A;  2SOB A;  3MC0 B;  4OEL B;  1C4Q A;  3JC6 6;  3NEL A;  4DU9 A;  2XWB B;  3R8B A;  2J0T D;  1L1O C;  4MNO A;  4IQZ A;  1W6K A;  2EVB A;  4QJF A;  4B3T L;  1K8O A;  2RHQ B;  3S1Q B;  3HP3 A;  2PQE A;  1VQA A;  4ALP A;  2NTT A;  2F0T A;  1RCV D;  2C5C A;  2A68 D;  1XPO A;  4L8J A;  3KLS X;  3PCO B;  3I72 A;  2XGT A;  1Y1V H;  4JVZ A;  4X3T A;  5CBA E;  3PSI A;  4JBJ A;  2F0F A;  1X6O A;  2N55 A;  3HOV H;  1EY6 A;  2OF1 A;  4OWT B;  1SNO A;  4LF6 L;  1EWH A;  2PYK A;  1STE A;  4UDU C;  3HOW B;  2KCN A;  1C8C A;  2ENB A;  1WOC A;  3CCS A;  3PIP A;  1WYD A;  2EJM A;  3H0G B;  3J7A V;  1BUV T;  1E7Z A;  1PTO H;  1XXG A;  2ZXR A;  3FEW X;  4KMU C;  3FRP B;  5G3L D;  4DN4 M;  1HNZ L;  1YVC A;  4A3G H;  1HCZ A;  4HR7 B;  4YCU A;  1XMQ L;  1AH9 A;  1EZ6 A;  3I4M H;  3I4O A;  2R7D A;  1B2T A;  1Z47 A;  4L5Q A;  1HZA A;  2AQ3 B;  2F3W A;  2WKC A;  4FVM A;  4IPC A;  4CKE A;  3PUX A;  4R4C A;  4BY7 B;  3RZO B;  2EE1 A;  1ENC A;  1N8R C;  1LTS D;  1QUQ B;  4TVA B;  2B2U C;  3CCM A;  3SXH A;  1AP0 A;  4NDX A;  3A55 A;  4DAP A;  3NTK A;  4PZ6 A;  3J80 E;  3PO2 G;  3G7L A;  1HZC A;  5IYB G;  5GAD C;  4HJ5 A;  2TSS A;  5ISR A;  2ZXO A;  3K8A A;  5CV4 A;  1Q1E A;  3DWA A;  1EL0 A;  1KDA A;  4BBR H;  3HOZ G;  1AE2 A;  4ZKC B;  1LTA D;  4HAE A;  4JI7 Q;  1HPC A;  4A3E H;  1NCV A;  1PRT C;  5KRU A;  3Q23 A;  1O7I A;  4RHR A;  5CBE E;  1TXY A;  2B2T C;  2NTS A;  4BBS H;  1PYB A;  2KEE A;  2NBF A;  4MN3 A;  3TEH B;  3JAM i;  2B39 A;  5A35 A;  1V8Q A;  3KLW A;  2E76 C;  1B70 B;  2XN9 C;  3I7F A;  2Z4H A;  5JVG 3;  5C0X H;  1EQR A;  4X3K A;  4I65 A;  1X9N A;  1ASZ A;  1SMX A;  1TY0 A;  2UUA L;  3V2T A;  3ND8 A;  1BXT A;  4R1J A;  2F0L A;  2ZJQ A;  2LSS A;  1OXT A;  3NQT A;  1JB3 A;  1GUN A;  3S1Q H;  1DCZ A;  4NXM Q;  5LMN Q;  1VQ4 A;  2F52 A;  1D5M C;  1BCP C;  2CKZ B;  2P5Z X;  1SRO A;  4IPD A;  3X3M A;  2F0Q A;  4L5R C;  3G71 A;  5IGB A;  1L1O B;  2VB2 X;  4FXK C;  2L0C A;  1MKH A;  1EUJ A;  3KDF A;  1NJI C;  3PUZ A;  1BF4 A;  4K6D A;  2CFM A;  3TQY A;  3TRE A;  3HOW H;  5AFW A;  4CHT B;  1PYW D;  4YCW A;  3A56 A;  3CKI B;  4YCV A;  1HA6 A;  3URY A;  3NSW A;  3H0G H;  1D7Q A;  4WOR A;  4N9P A;  2CQO A;  3BU2 A;  3KF8 A;  3H09 A;  4WJ3 M;  4DUY Q;  4HCS A;  1A62 A;  1STB A;  3UDX A;  2K7V A;  2PQA A;  4BY7 H;  1M4V A;  3MFG A;  1MHW C;  3GDE A;  3PGZ A;  3MXG A;  3RZO H;  4PNY A;  1EYA A;  5C44 G;  1VQC A;  4L5S A;  1KRS A;  3NWS A;  4DR5 L;  4JI1 Q;  4JI0 L;  1T5E A;  2Z6K A;  5M3M B;  4NXN Q;  5FKA C;  2G5D A;  4P73 A;  1HTP A;  3EN2 A;  3CPW A;  4R8N A;  4IUV A;  4LF8 Q;  3T56 B;  4A3M B;  5HY6 A;  2XSC A;  5KYI A;  2FJ2 A;  2PW7 A;  3S1M B;  5D65 A;  2NZH A;  4DR7 Q;  3AQQ A;  2UUC L;  4A3K G;  4DR2 Q;  1M8A A;  2E75 C;  2BCO A;  3SDZ A;  4KK7 A;  5A2Q L;  2RBM A;  3J81 j;  4LF4 L;  1DON A;  1TS4 A;  4B08 A;  1WD1 A;  2DUD A;  4QUF A;  5KNC A;  2OEO A;  2JA6 B;  2LXK A;  2MQH A;  1WD0 A;  2JYO A;  2B29 A;  3BG3 A;  2JN4 A;  5JJL A;  1L0X B;  1EYD A;  5EGT A;  4DUZ L;  1EY0 A;  1CQF A;  2EIF A;  3D6W A;  1O78 A;  5EPL A;  3PIP 3;  4QUC A;  5BR8 Q;  3ERS X;  3N52 A;  3VR6 A;  3OWF A;  3I4L A;  3UI2 A;  1LTL A;  1ONL A;  3C3L A;  3K81 C;  5FLM H;  2IPK D;  1EIF A;  3S24 A;  1JWS D;  1A3V A;  5GQO A;  2NB0 A;  3S2D B;  2IX3 A;  1PH5 A;  1SJE D;  2AWN A;  4LUO A;  1S5B D;  1D1I A;  5IWA L;  1R9T B;  3FDT A;  3M85 A;  1RL2 A;  1SEB D;  1EFW A;  4EQ5 A;  4OHJ A;  3J81 c;  1Y14 B;  3VR3 A;  3Q24 A;  2GA4 B;  3T51 B;  2A6H D;  4PMW A;  3HS0 C;  1A8V A;  1LTG D;  4YWL A;  3ONA B;  1IL2 A;  3MFY A;  4RFB A;  3ITP A;  3K0Y A;  4K8J A;  5FO8 B;  2UXB L;  1SSO A;  5IP7 H;  1U4L A;  1K8G A;  5J3B A;  4NXM L;  4IFD I;  4CJ0 B;  5M9O A;  5LMU Q;  1SNC A;  2F0H A;  3D31 A;  1Y1W G;  1STG A;  1X3P A;  1A2T A;  1XNR L;  3U4Z A;  1SMY D;  1XNQ L;  1BO0 A;  3S1R B;  2UU9 Q;  4OO1 H;  5I9P A;  2B2Y C;  1VQE A;  1C9O A;  1X3Q A;  3GD7 A;  2HCI A;  4FXG C;  1G8Z D;  2K52 A;  1HFN A;  4RA8 A;  2VW9 A;  4F88 A;  5ELO A;  3RZD B;  3T1Y Q;  3HG9 A;  5M3M H;  4IUR A;  4AQY Q;  4DV6 L;  2KCC A;  2E2J B;  3M7G A;  3G6J B;  1WCM B;  3D4W A;  3M9B A;  4A3M H;  4LF5 L;  3S1M H;  2PPB C;  3TME A;  1EYC A;  5CV8 A;  3CP0 A;  3E0E A;  1G29 1;  1NTG A;  1HQM C;  3DWQ A;  4B3R Q;  4B3T Q;  1CKN B;  2JA6 H;  1M90 C;  1LT6 D;  1X65 A;  1HQR D;  1O7Z A;  3CRK C;  4XIG S;  2PW5 A;  2LS0 1;  2JXM B;  4IJL A;  1Y1V G;  3HGB A;  1GXD C;  4K5W A;  1CHQ D;  1H9J A;  4H44 C;  1N36 Q;  4O2D A;  1VCI A;  2F0E A;  3HOV G;  2Q2T A;  2WKD A;  3M7N A;  2QA4 A;  2JJQ A;  1D1K A;  5A2Q E;  2RCN A;  2D62 A;  3S2D H;  2SNM A;  1LTI D;  4JI3 Q;  2AUK A;  2L5T A;  1LTR D;  1R9T H;  4XQQ A;  2ICI A;  1II3 A;  4R8I A;  2F0M A;  1LO5 D;  1UE5 A;  1VF5 C;  4NKL A;  4A3G G;  2A68 C;  2LFN A;  4H02 A;  3I4M G;  1HZ9 A;  3SK6 A;  3VYU A;  4B9X A;  4BA2 I;  3GV6 A;  2JK8 A;  1PH4 A;  4DK0 A;  3RN2 A;  2Z9H A;  3KF6 B;  4H13 C;  3DEP A;  3QWN A;  5IYD H;  3CME A;  1CSQ A;  2XVS A;  4C3H B;  3FPU B;  5T1G A;  1HH2 P;  4JBK A;  3CC7 A;  3S1R H;  2WAQ E;  1FVI A;  4A93 B;  4QQB X;  1GHJ A;  3K5O A;  4IUT A;  4FO2 A;  2KCM A;  5C6A A;  2ES2 A;  1S3O A;  3R3O A;  1ZEQ X;  4YIJ A;  1FYC A;  1GUG A;  4BBR G;  2DY8 A;  3RZD H;  3DMU A;  2B3G A;  2EYM A;  2EY2 A;  4A3E G;  2VUM B;  2XIW A;  1MIU A;  1Q3L A;  1QUQ A;  1U5K A;  3STB D;  2E2J H;  1WCM H;  4PQX A;  5IGG A;  4BBS G;  1KAA A;  2JQO A;  4JI7 L;  3CAM A;  4U67 3;  5F2D A;  1L2F A;  3HKZ E;  3OMG A;  1XPU A;  5C0X G;  2EJG C;  2HQL A;  1QOH A;  3KK7 A;  1EU3 A;  2EXZ A;  2EPB A;  3I56 A;  2HD3 A;  4ME5 A;  2NVX B;  4J1M A;  4QMG A;  4A75 A;  2Q2U A;  2B2W A;  4ME3 A;  3EQL C;  2WB1 G;  3E5S A;  1WTW A;  3HOX B;  4GKK Q;  4J15 A;  2IX0 A;  4BWG B;  2NVY H;  2L15 A;  5FLX E;  2QDL A;  2MJ8 A;  1BNZ A;  4X65 Q;  1YBY A;  4KLK A;  1JE4 A;  1SNM A;  5LMN L;  3KBG A;  3U58 A;  4IO9 A;  1FD7 D;  3QG1 A;  2K14 A;  1E22 A;  1QVG A;  1I4G A;  2SDF A;  1TQO A;  2ZM6 Q;  2RKS A;  3S14 H;  3HOW G;  2E2I B;  3MXN B;  2SNS A;  3T16 A;  1G6P A;  3TZD A;  3D8G A;  3H0G G;  3GTL B;  3TS0 A;  3CXC A;  4JC0 A;  5IT9 c;  4ZAI A;  4QF4 A;  1FNW A;  3PUV A;  5IGD A;  2Y0S B;  3T4A C;  1CSP A;  3HKZ B;  1P16 A;  2D5D A;  2MUY A;  2QGQ A;  2F0K A;  2F0S A;  4BY7 G;  2F0N A;  5BN3 A;  4DUY L;  1SFO B;  3MAQ A;  2VXW A;  4LMQ D;  2AKW B;  1A3U A;  1G2T A;  2EQS A;  1WTX A;  4GNX B;  4A93 H;  2K32 A;  3BJU A;  5DM6 3;  2XTI A;  3NEN A;  5LL6 X;  4K14 A;  4JI1 L;  2A19 A;  5NUC A;  1TWF B;  4NXN L;  1K0S A;  5M5X B;  1J5E Q;  2E5L Q;  4KJN A;  3I73 A;  1HA5 A;  1TVX A;  3RR5 A;  4DR4 Q;  3Q0A A;  4LF8 L;  2CWA A;  1KNA A;  3ZYY X;  2VUM H;  2JA9 A;  2RSO A;  1X3E A;  4DR2 L;  5GAG C;  1IZ6 A;  1QCB D;  1EWI A;  1B44 D;  4FXD A;  3MHB A;  1O80 A;  1ENF A;  3PUY A;  4JI5 Q;  1YEZ A;  1STY A;  1B50 A;  2K4K A;  3H15 A;  2WFW A;  4KD3 A;  3GTQ B;  3GTG B;  2JA8 H;  2PI2 E;  1V43 A;  5EPK A;  2KBN A;  4QCL A;  3M4Y A;  1WVL A;  2SEB D;  3HOX H;  1EQT A;  5FLM G;  1O7L A;  2CH4 A;  3SK5 A;  5BR8 L;  1LAC A;  3HOY B;  1A63 A;  1LT4 D;  4XT3 B;  4YWK A;  1VMP A;  4MTK A;  2ZTD A;  2RSN A;  1SYE A;  1TS3 A;  3AB9 A;  1JIC A;  2E2D C;  1SYG A;  1U9R A;  1LT5 D;  3RLO A;  4LUZ A;  1LM0 A;  1AE3 A;  5AJ3 Q;  2E2I H;  5FO9 B;  5IP7 G;  4V0B A;  3GTL H;  2HQE A;  1YJW A;  5M5W H;  2F0W A;  2IY5 B;  2LMC B;  4LFC Q;  4DV5 Q;  1XNR Q;  2Z6B A;  4RGM A;  2NVQ B;  3FKI B;  4P71 A;  3U9O A;  1PH8 A;  4OO1 G;  1GUS A;  5LMU L;  1SRU A;  4RGN A;  2ZTE A;  4LK1 C;  3BZC A;  1SJH D;  3GO5 A;  1K28 A;  4F7X A;  2LXJ A;  4HJ9 A;  1RF2 D;  1SFO H;  4ZKB B;  2F0G A;  1D2B A;  1PZJ D;  2A6H C;  1QJO A;  3QIA A;  1UUP A;  3NK9 A;  3BVZ A;  5M3M G;  4OIJ A;  5M3F B;  1MGS A;  1KLU D;  5T1I A;  1F2L A;  3EIV A;  1HNX Q;  4DV6 Q;  3T1Y L;  4A3M G;  1TWF H;  4TRD A;  3K57 A;  3VR5 A;  4AQY L;  5M5X H;  1PDQ A;  1EY9 A;  4C3J H;  1HTL D;  3W1B A;  4QIW B;  1SMY C;  3P7J A;  4L5T A;  4CDE C;  2EJF C;  2FIN B;  1N33 Q;  2B2W C;  4JI2 Q;  1CT1 D;  3I55 A;  1BBU A;  2PCF B;  3I3C A;  1AZQ A;  4KD4 A;  1V1P A;  1TS5 A;  2IJ0 A;  2JA6 G;  1IBK Q;  2ZTC A;  1NR4 A;  3P1H A;  4KN7 C;  3GTQ H;  3J81 i;  3TRZ A;  4B3R L;  1D5X C;  3GTG H;  4OON A;  2ALY B;  2BDN A;  4JPB W;  2WIN B;  3K7A B;  3QR8 A;  1E2W A;  4IUU A;  4QY7 A;  1YZ6 A;  3F2B A;  2A74 C;  3RUZ A;  2YU9 B;  4DF7 A;  5CYU A;  1N36 L;  1B1Z A;  4IN3 A;  3HOY H;  4RGO S;  3U4V A;  4GLV B;  5D3D A;  2BDO A;  3M4Q A;  3KLS A;  2PZU A;  3NBH A;  2DJF C;  1KL9 A;  2QDB A;  4JI3 L;  3FPP A;  4CKC A;  1H9R A;  2K5D A;  4MHE A;  1SNP A;  1TWH B;  2D0P A;  1EFI D;  4CKB A;  1ZXT A;  4OXP A;  5LL6 S;  5KNB A;  3CC2 A;  4A3B B;  1FGB D;  2AWO A;  4P74 A;  1JQY D;  1VQP A;  4WJ4 A;  2N49 A;  1G91 A;  5IYD G;  1WJJ A;  4CDC C;  1WTR A;  1DOM A;  2GN5 A;  2NVQ H;  1TII D;  1PYS B;  1DM0 B;  3OWE B;  4E6I A;  1PRT F;  3SVM A;  4AYB E;  2JA7 B;  4NMZ A;  4P75 A;  4UAI A;  3SHL A;  5FK9 C;  2F1M A;  2I5L X;  1EOV A;  1TT2 A;  1YNJ D;  3VA5 A;  5M3F H;  3E6Z X;  1HR0 Q;  1PZK D;  1N34 Q;  1WCM G;  1TU2 B;  1P8L A;  1J6Q A;  4IFD H;  1FJG Q;  4A3J B;  3R93 A;  2YTY A;  2RVL A;  3NXW A;  3C1F A;  3K58 A;  1NR2 A;  5CV7 A;  3I4N B;  5E4W C;  1VQ9 A;  3A5Z B;  3OOC A;  4N8X 1;  1YJ9 A;  2RA4 A;  2KOL A;  1BCP F;  4LNQ A;  1JWU D;  3QOL A;  1B9M A;  1BBX C;  3I2Z A;  4OIK A;  5ELC A;  3UDI A;  2E8G A;  4GZY C;  4HIK A;  4RCO A;  5C3X A;  4HSV A;  1ILQ A;  4LF7 Q;  4K6L A;  1B3Q A;  5DEH A;  3F2D A;  3KJP A;  4WJW A;  3STB C;  4DAM A;  4JK1 C;  1A3T A;  3GTO B;  2K5V A;  3GTP B;  2F4V Q;  4GKK L;  1PTO D;  3NPP A;  4DXF A;  3DLL A;  4POG A;  3S17 B;  1I50 B;  3JAM L;  2M00 A;  4X3S A;  3WWV A;  1PH6 A;  2I5H A;  5DNF A;  4EGV A;  4X65 L;  3PIO A;  4LFB Q;  3NQI A;  2IT1 A;  1QVC A;  5FJ8 H;  3FVQ A;  1QVF A;  3F2C A;  4EVO A;  1N32 Q;  2YU9 H;  1E2V A;  2NYZ D;  1I6H B;  3BZD B;  5C3E B;  1A15 A;  2EYP A;  2F03 A;  1SE2 A;  2EZV A;  4FF3 A;  3H3V C;  1PH7 A;  2ZM6 L;  4GOP A;  1CTM A;  1UEA B;  3NE5 B;  5DAU A;  3HOU B;  1WTH A;  2ZT9 C;  2V4D A;  4R4O A;  3CF5 A;  1NMF A;  4J6H A;  1SN8 A;  4BA1 I;  1TWH H;  3A8K E;  1DYQ A;  4JI4 Q;  1QNK A;  1SYF A;  2Q8I B;  2M2L A;  1LTT D;  2UUB Q;  4P2C B;  2OXP A;  3TBI B;  3KJO A;  4A3B H;  4A76 A;  2R7Z B;  3BZK A;  3FHW A;  1V1O A;  2HDL A;  3L9A X;  4A3C H;  3D3R A;  4YHH Q;  1Q81 C;  2EY5 A;  3CCJ A;  4A93 G;  2DN8 A;  2ICE C;  5CR3 A;  4CJ2 C;  3BYT B;  3J80 c;  2ATW A;  3E3X A;  4RWS C;  1VQG A;  1AW7 A;  2JA7 H;  2H5X A;  1JE5 A;  4JOI A;  4A3F B;  4Q5V A;  1KXL A;  5JJZ A;  5KGU A;  1Q7Y C;  1EQV A;  1QZG A;  4HCE A;  5I2X A;  4QB4 A;  1XYI A;  2VNU D;  1E1T A;  2PNH A;  2VUM G;  1J5E L;  2E5L L;  4DR4 L;  1KLG D;  2LY7 A;  1KD1 C;  3ULL A;  1AN8 A;  2B63 B;  4KN4 C;  4PMB A;  1EYG A;  1X32 A;  2HT1 A;  3I4N H;  3Q22 A;  2N78 A;  3V96 A;  2C35 B;  2CWP A;  2JA8 G;  4HN7 A;  4JI5 L;  1BQQ T;  3WOE A;  4IUQ A;  1B7Y B;  5L37 A;  2EYO A;  4DFA A;  3I90 A;  1ILP A;  2MO1 A;  1PRT B;  3HOX G;  1IBM Q;  1VQH A;  1KDC A;  4M1U B;  4IOC A;  1ML0 D;  1F9S A;  1GUT A;  3GTP H;  2O5J C;  4FF4 A;  3S17 H;  1I50 H;  1VQF A;  2KEC A;  5EPJ A;  2Z1C A;  1XTC D;  1SNQ A;  3C1E A;  1VDZ A;  1BVS A;  1I6H H;  2R3Z A;  1FR3 A;  1EY7 A;  1NAP A;  1ICW A;  1SND A;  3D4R A;  3HOU H;  3VR2 A;  3W1G A;  2R93 B;  1BCP B;  3TSS A;  5AJ3 L;  4DNR B;  1JOQ A;  4C1N I;  2EXD A;  2G9H D;  2Y0S G;  1I3Q B;  4DV0 Q;  4DR1 Q;  1O7Y A;  3EA6 A;  3PO3 B;  1YHA A;  1ASY A;  4I7A A;  2V1C C;  3JAM E;  3ULP A;  5JEA H;  3IL8 A;  2PO4 A;  2R7Z H;  4JBM A;  1YNN D;  3DWP A;  1PLF A;  4LFC L;  4DV5 L;  2K5Q A;  1MSG A;  2JSO A;  4KV6 A;  4XQJ A;  2CCZ A;  2F0V A;  1F9Q A;  1HZB A;  2B2V A;  1XWE A;  1Q46 A;  4A3D B;  4XTC S;  2F0U A;  1D8L A;  4CDD C;  2O2L D;  4B9W A;  4DA2 A;  1X3F A;  3RMH A;  1I4H A;  4I7Z C;  3TP6 A;  3SK8 A;  5C0X J;  4A4I A;  1PH1 A;  2F0P A;  4A3F H;  1SE8 A;  1KNE A;  4C3J G;  2MNA A;  1HNX L;  3ZJY C;  2E2H B;  4OWX B;  4QL5 A;  4CGY B;  2A6E D;  4FF1 A;  3ER0 A;  1KDB A;  1Q86 C;  4PZ7 A;  1KQS A;  1AEX A;  1Z7T A;  4JI6 Q;  1N33 L;  2B63 H;  5EBD A;  2EDG A;  3KLR A;  4JI2 L;  1SYC A;  4X64 Q;  4G4K A;  1SE4 A;  4DAY B;  3PIO 3;  1FL0 A;  2PMZ E;  2L55 A;  5CGK A;  1QZH A;  1YHB A;  1B53 A;  3BVG A;  1K83 B;  4KY5 A;  5C4X B;  3GTK B;  3DUZ A;  1GO3 E;  1H9K A;  1LUZ A;  1LLR D;  4HJ7 A;  1IBK L;  2RF4 A;  2NZO A;  4R9W A;  5HUR A;  3QB3 A;  2F3I A;  4GOP C;  3MXP A;  3N6R A;  3RNU A;  1IKL A;  1VQI A;  1BOS A;  3SK4 A;  3HOY G;  5I9O A;  4DNT B;  4IAL A;  5J22 A;  3UDF A;  1EOT A;  1JC7 A;  5GAE C;  4GKJ Q;  1QNU A;  5E4X A;  2KHJ A;  4MZ9 A;  4Y7N B;  2N3S A;  1L0Y B;  4PV1 C;  4GLX A;  2KED A;  1EIH A;  2RCF A;  4UP8 A;  3FP9 A;  2DY7 A;  1R4P B;  3DEO A;  2K28 A;  3L7Z C;  4IJH A;  3AEV A;  2R93 H;  2FFK B;  3CRL C;  5G3L F;  4KKU A;  5IOC A;  4HJ8 A;  3C2P A;  2VY3 A;  1EY5 A;  1NSN S;  1I3Q H;  2Z6K C;  3AFP A;  1BBW A;  1Y8N B;  1SXT A;  3PO3 H;  4TQU S;  4O1N A;  3PMF A;  4Z9C B;  4HIO A;  3DM1 A;  2GVA A;  3IAY A;  4H0L C;  2Z8L A;  3K5N A;  1RIP A;  3BDC A;  1G2S A;  5IYC G;  2K1B A;  3KBX A;  1X56 A;  1S5E D;  5IGC A;  4GN4 B;  4HIM A;  4L63 B;  3CPF A;  1AZP A;  4A3D H;  4DPG A;  1MJC A;  5M3F G;  1F2Y A;  4GS3 A;  1IYV A;  5JOB A;  5J39 A;  3CMA A;  1VQ8 A;  1T5X D;  4WFN 3;  1EU4 A;  2EOT A;  1DXM A;  4IFD G;  1HR0 L;  4UHV A;  1CKM A;  4UPA A;  1N34 L;  1X54 A;  4JCV E;  2E2H H;  1X3G A;  2IX1 A;  1VQK A;  1F9R A;  3OHX C;  1NBW A;  3MEF A;  2B8G A;  1FJG L;  4NP5 A;  1WTQ A;  5JJI A;  3F2U A;  2HDM A;  4HJA A;  2NN6 I;  3WOF A;  3A7L A;  4EQP A;  4LAA A;  1SBB B;  4ZLT F;  1YNJ C;  1MJE A;  1BKB A;  1T9H A;  3IFT A;  4RCN A;  2L4N A;  4DV7 Q;  1U4M A;  1K83 H;  4JG2 A;  1SDF A;  4LF7 L;  4XXE A;  5C4X H;  1KHI A;  1JOO A;  3GTK H;  4XQN A;  3CU7 A;  4R4T A;  3AMU A;  1EY4 A;  1I4P A;  5FJ8 G;  2F4V L;  2VL6 A;  2WAQ B;  1ZKO A;  1QE6 A;  3J7A F;  3KFU A;  4ID6 A;  1NY4 A;  2A69 D;  3HKS A;  4LFB L;  1LAB A;  3BVM A;  1N32 L;  1S5C D;  1HHV A;  3NP8 A;  3S1N B;  3KDF B;  4Y7N H;  4G7O C;  1ROD A;  3LNN A;  3PV0 A;  3CCL A;  3L0O A;  3EBE A;  1U4R A;  4A3B G;  1JWM D;  1DOL A;  4WRD A;  1L1O A;  3T1H Q;  4JI4 L;  4A3C G;  1CA5 A;  1MI2 A;  2WP8 J;  5JPN C;  2UUB L;  4XT1 B;  3CD6 A;  2EYL A;  1IBL L;  2Q2I A;  3IKJ A;  2R6G A;  1V9P A;  3T13 A;  3NUC A;  1IYJ B;  3TP5 A;  2CQA A;  4YHH L;  2JA7 G;  2KJX A;  3EJI A;  5I2Y A;  4OX9 Q;  4C3H H;  1VQL A;  2CHB D;  2HIV A;  5I6W A;  2EY1 A;  4QGU A;  3TZU A;  2K03 A;  3UE0 A;  4M8A A;  4OGQ C;  5KND A;  4F8M A;  5DLQ E;  3I8Z A;  5BN4 A;  2CVR A;  2OTL A;  1RTN A;  4RAU C;  1Y1W B;  3GP7 A;  4IUP A;  5EKI A;  1WTV A;  3S2H B;  3L3O C;  4EQO A;  3OPO A;  2IW3 A;  3I4N G;  1TWC B;  2KQ3 A;  3F1Z A;  2D0O A;  1J9O A;  3TN2 A;  2F0J A;  1H95 A;  3M4O B;  2H1E A;  1JJ2 A;  1CQV A;  1EY8 A;  3MWY W;  4DXG A;  2B2U A;  2A5H A;  3M4P A;  2NVX H;  2R92 B;  5FLX c;  1KC8 C;  4B3M Q;  1STA A;  4DKA C;  1IBM L;  4UY8 C;  4B3S Q;  5CV5 A;  1LV9 A;  4ZQ3 A;  5LMN W;  3R2T A;  3H3V I;  4ZUI A;  3ICE A;  1E0B A;  3DM3 A;  2VQF Q;  1EIY B;  1YJN A;  3AU7 A;  2X6L A;  3VYR A;  3C46 A;  1KRT A;  1UEB A;  1CHP D;  1WI5 A;  2EYF A;  2MPM A;  3G6E A;  3J80 i;  1KAW A;  3HOU G;  5JAV A;  1S4Z A;  1SYD A;  3S1N H;  2YTV A;  1PMR A;  1TWA B;  5HGT A;  1CI3 M;  1DJR D;  1GUW A;  4CDF C;  1U0L A;  1PFS A;  5JEA G;  3HOV B;  2R7Z G;  1GD7 A;  2A73 B;  2DJG C;  5COY A;  4DV0 L;  4DR1 L;  2EYH A;  3OIP A;  1JJC B;  3J80 L;  3H6M A;  1HUN A;  1RKN A;  2BE5 D;  4LFA Q;  4DR6 Q;  3MZ5 A;  1ET6 A;  4A3G B;  3O13 A;  4A3F G;  3PQI A;  3TP7 A;  5FO7 B;  5KEE A;  4HID A;  3DHQ A;  5D14 A;  3W3A A;  1MSH A;  3EVQ A;  1ICF B;  2HHH Q;  5K36 H;  2WB1 E;  1SLJ A;  2O4X A;  1YNN C;  1B9N A;  4P72 A;  4GN3 B;  2B63 G;  3S2H H;  1IKM A;  1WFQ A;  3IRB A;  3QJY A;  2DNE A;  4BY1 B;  4J8Q A;  1HNW Q;  1YIT A;  1GVP A;  4JI6 L;  1Y8P B;  2YYZ A;  2F0D A;  2K33 A;  4KHV A;  1SR3 A;  1I4X A;  1TWC H;  4X64 L;  2PZT A;  4Y52 H;  3UDG A;  1PH2 A;  4K2K A;  1PHJ A;  3GTJ B;  3M4O H;  5CV9 A;  3P75 A;  2A6E C;  4K0K Q;  4UP7 A;  1NMG A;  1IW7 D;  2R92 H;  3SGI A;  4DR3 Q;  1L0W A;  4DV4 L;  3CCU A;  1DGS A;  1CKO A;  4A3I B;  4LF9 Q;  3CHB D;  3NHH A;  3Q8D A;  1TR5 A;  2QKI C;  1CKN A;  1I94 Q;  3CCE A;  3J81 L;  5IGF A;  4GKJ L;  1A2U A;  3E0J A;  1XMO Q;  1Q12 A;  2WB1 B;  5K5P A;  2KA7 A;  2NUC A;  1UE1 A;  5IIF A;  2R93 G;  2DNC A;  2EY6 A;  3VR4 A;  1TWA H;  1VQB A;  2K5W A;  4PZ8 A;  4BXX H;  4POF A;  4K8I A;  1XJV A;  3PO3 G;  1D5Z C;  3L2P A;  5ELB A;  2OCE A;  5EJW A;  4IPH A;  3FKI H;  4LJZ C;  3G4S A;  1E2Z A;  2F4I A;  4A3D G;  3NWT A;  3OTO Q;  3K7U C;  5IE8 A;  3TP8 A;  1VMC A;  5IYC H;  1IXR A;  1CZW A;  3SEB A;  3VYT A;  3T53 B;  1AFP A;  3BS1 A;  4AH6 A;  1EIG A;  3KF6 A;  1GM5 A;  3CCV A;  4ULL A;  3E9H A;  3HRZ C;  4DV3 Q;  2KVM A;  1UAP A;  2UXD Q;  1G51 A;  2OTJ A;  1K3R A;  1CK1 A;  1LYL A;  2XRQ D;  4BY1 H;  4A3L H;  2RDF A;  1YNX A;  1Q8I A;  1Q8K A;  2BOS A;  1ET9 A;  1DD2 A;  1Q82 C;  4XYQ A;  2I5M X;  5C4X G;  4OL7 A;  2JA5 B;  2B2Y A;  1K73 C;  4IPG A;  4DV7 L;  2I46 A;  2FMC A;  3GTJ H;  1VF7 A;  1CM9 A;  2K50 A;  5ELD A;  1IYU A;  1WTP A;  2B8F A;  4G57 A;  1X55 A;  1VQ5 A;  2X6G A;  4YWM A;  4AYB B;  3K7A H;  2DGY A;  4ZRZ A;  4JV5 Q;  2AQ1 B;  4RH6 A;  2H4O A;  3A0J A;  4DV2 Q;  3LX0 A;  3A7A B;  4A3I H;  3S16 B;  4C3I B;  1C48 A;  5CC4 A;  3LWE A;  2RDH A;  2CH4 W;  4C2M B;  5C4J B;  1C0A A;  3E9I A;  2J7Z A;  4K5X A;  3OSO A;  2BH2 A;  1JT8 A;  5LHY 1;  2I07 B;  2Q8T A;  1U4P A;  1BDO A;  3K6O A;  3ULJ A;  1IBL Q;  2A69 C;  2BH8 A;  3T1H L;  1MD2 D;  3GTM B;  1I5F A;  1VQ6 A;  1PZI D;  4HMJ A;  2KHI A;  4IUN A;  3PF5 A;  2K5H A;  3MXN A;  2Z4I A;  4R4Q A;  3RD4 A;  4C3H G;  1YI2 A;  3I91 A;  3RN5 A;  5FOB B;  3J81 E;  4OX9 L;  3B6Y A;  2Q8R E;  3J7A 5;  2A1A A;  4NPS A;  1PVO A;  1I6V C;  2GVB A;  5CMD A;  1I4Q A;  1UE6 A;  5IP9 H;  1STH A;  3J7Z C;  3F8T A;  5C5M A;  3EFX D;  1IHZ A;  4EQN A;  2JP1 A;  4F87 A;  2RHS B;  1VQ7 A;  3IFD A;  1E1O A;  3LWU A;  1GUO A;  1N9W A;  2R61 A;  4KJO A;  1CFM A;  4GNX A;  4CBV A;  3J7Y W;  1HJP A;  4A3J H;  2OT2 A;  3ND9 A;  4FYD A;  1OXV A;  2AMC B;  3KOJ A;  2XRS D;  1GOZ A;  1K8A C;  3MTS A;  1OXX K;  4X62 Q;  2MGS A;  1ESR A;  4GLA C;  1VS0 A;  4KTA A;  1QWY A;  4X3U A;  2Q2H A;  2VZA A;  4ABN A;  2JA5 H;  1VQO A;  3D4D A;  1F9P A;  1ZYR D;  3U9S A;  2IWH A;  2Z0S A;  2XWJ B;  5M5Y B;  3GTO H;  2RQX A;  4B3M L;  2WAQ G;  4LW1 A;  1H9S B;  4ODG A;  1SYB A;  5JPM C;  3S9W A;  4B3S L;  2M9V A;  2AQ2 B;  3AFQ A;  1B4O A;  2NN6 H;  1E24 A;  3OW2 A;  2VQF L;  1QG7 A;  1D6E C;  4K2L A;  3S16 H;  1KTK A;  4C3I H;  4MTN A;  5C3E H;  1ENA A;  5IT9 L;  4C2M H;  1S72 A;  5C4J H;  1B3A A;  1RTO A;  2QIL A;  3CCR A;  2CW0 D;  3X3N A;  4DK3 C;  4YY3 Q;  3KYH C;  1K0R A;  4KY7 A;  3VDY A;  1KIX A;  4EX5 A;  4KKT A;  1FGU A;  3HKZ G;  1W6J A;  4IOA A;  2XNA C;  2N88 A;  4IFD J;  3PF4 A;  1QB5 D;  3M3Y B;  4JI8 Q;  1JMC A;  1Z6H A;  2AHO B;  3GTM H;  2EYJ A;  3FMC A;  3PUW A;  4C1N K;  5EAY A;  1VQN A;  4X66 L;  1W2B A;  1C7Y A;  4LFA L;  2QEX A;  4DR6 L;  3A8I E;  5IOD A;  5K36 G;  2D2C C;  4V19 0;  4HED A;  1S5F D;  3P20 A;  4DNI A;  4O0A A;  1PV4 A;  2OWO A;  2VQE Q;  2F3V A;  3D6C A;  2HHH L;  2F0O A;  2PI2 A;  2QEJ C;  3G48 A;  2KEN A;  1M1K C;  2BE5 C;  5H1S E;  4JBW A;  3LGJ A;  5C0X I;  1HNW L;  2UXC Q;  5J1Z A;  1JB7 A;  3PO2 B;  4DV1 Q;  2AUJ D;  4DK1 A;  1H9M A;  5ELE A;  1V1P B;  2JEA I;  3CQZ B;  5FLX L;  1HXY D;  2E74 C;  2KHS A;  3HOZ B;  1TS2 A;  1V1Q A;  2NZ1 D;  5TSS A;  4JYA L;  4DGZ A;  2R92 G;  4K0K L;  4KHP Q;  2BA1 A;  4DV4 Q;  1ESF A;  1KAB A;  3R2I A;  5JVH 3;  5I6Y A;  4LWC A;  5C3W A;  2D9U A;  5M5Y H;  4DR3 L;  3HEJ A;  1RD9 D;  4OEM B;  2F0I A;  4RG1 A;  4LF9 L;  1EEI D;  3TS2 A;  4G7Z C;  5JJK A;  1Q90 A;  2VB3 X;  1Y8O B;  1I94 L;  1VQJ A;  5CV6 A;  2NVY B;  2QW7 A;  3VA7 A;  3HZX A;  3NBH B;  3QOJ A;  2C9O A;  1XMO L;  3SE0 A;  4AIM A;  5HGQ A;  3K5L A;  1JJG A;  1IW7 C;  4BXX G;  2BA0 A;  1R4Q B;  5C5L A;  3JAM c;  4X6A H;  1NE3 A;  4BS9 A;  1PXU A;  4JOI C;  4LF6 Q;  2PMZ B;  3FKI G;  4DAV A;  3S14 B;  3K5M A;  1OXS C;  3BDL A;  3H3V H;  3TDQ A;  3H94 A;  1VQM A;  3M3Y H;  1FNV A;  2N8N A;  3GQB A;  4HMI A;  5KYL A;  1LTB D;  1Q1B A;  3NTH A;  3OTO L;  3K80 C;  1HNZ Q;  4KI0 A;  4GNX C;  1SE3 A;  1F2M A;  5IT9 E;  1XMQ Q;  1DZ1 A;  1RHP A;  1FNU A;  5C4H A;  1HRJ A;  4TSS A;  1OTC A;  3W2D A;  1PRT D;  4DV3 L;  1EQQ A;  4NW2 A;  5IGE A;  5EKL A;  2X69 A;  2UXD L;  4HSP A;  3BYY B;  4BY1 G;  2FHT A;  5C44 B;  4A3L G;  1QIL A;  4JW0 A;  5COR A;  3CC4 A;  3K59 A;  2IHE A;  3W5O A;  3PO2 H;  2HIX A;  4HTH A;  1VQD A;  5IYB H;  3MVV A;  2QF7 A;  3A5U A;  2HUG A;  3CQZ H;  4PG3 A;  2WAC A;  3NEM A;  1EEF D;  3HOZ H;  4A3K B;  2Y0S E;  3K0X A;  1PTO F;  2L9H A;  4LUV A;  4KY6 A;  1BCP D;  1TKW B;  3Q6S A;  1CZG A;  3BDO A;  3ERO A;  1IL8 A;  5JEA J;  3A74 A;  4A3I G;  1OXU A;  2JA8 B;  4MIU A;  1GJX A;  4JV5 L;  1Z9F A;  4DV2 L;  2G9D A;  2UUA Q;  1F2Z A;  4RHS A;  1K3B C;  1RJT A;  5C4Z A;  4ILW A;  4GOP B;  2WII B;  1A6X A;  1F77 A;  4RKL A;  1PFM A;  3S15 B;  1PTO C;  1STN A;  2B2V C;  3OIQ A;  5GAH C;  2A8V A;  1XTD A;  3OYY A;  4ZUJ A;  1YIJ A;  1HUM A;  2J4X A;  2NVT B;  5D3I B;  4OO1 I;  2O5I C;  3KF8 B;  2YTX A;  1JCK B;  4FF2 A;  1K9M C;  2FXQ A;  1XX8 A;  1PFB A;  2IL8 A;  4ZYS A;  1PH3 A;  2PQA B;  2K04 A;  5IP9 G;  3CW2 C;  4FDB A;  4O42 A;  4S3S A;  1G6Z A;  5M5W B;  5ELN A;  2KCT A;  5IY0 A;  2YV5 A;  4FP5 D;  1TY2 A;  1E3P A;  2K05 A;  3WDN A;  4NB3 A;  3MEH A;  2HCC A;  1HR0 W;  4RGT A;  4DK6 C;  2FMM A;  1JR0 D;  4A3J G;  4ZK9 B;  2ID0 A;  3A8J E;  2NWG A;  2ZXP A;  4DR5 Q;  3AYH B;  4JI0 Q;  1B8A A;  1S40 A;  5C44 H;  5GRO A;  2QCP X;  4XYO A;  1CA6 A;  2OQ0 A;  5EKK A;  2L1B A;  5KIX A;  4C3J B;  1TWG B;  5ELF A;  1I4R A;  1PFN A;  1K8M A;  3QO2 A;  4X62 L;  2JA5 G;  3V05 A;  3NBI A;  2UUC Q;  4G7H C;  5E1F A;  1MBY A;  4DR7 L;  4R4I A;  4LF4 Q;  4A3K H;  4AYB G;  4FNF A;  2ZJR A;  2WV6 D;  2NN6 G;  3HFZ B;  4KKS A;  4APV A;  4Q0F A;  4C3I G;  5C3E G;  4KHZ A;  2K6A A;  1DOK A;  2KUM A;  4DUZ Q;  4CJ1 B;  1WTO A;  2K5N A;  2B2T A;  4TKO B;  3VYS A;  1OO9 B;  4XDX A;  3OMC A;  3U50 C;  1ZYR C;  1Y1V B;  1H9S A;  1JOR A;  3UE1 A;  2IHF A;  1YHQ A;  3ERQ A;  4OWW B;  1J8I A;  3A54 A;  4RMF A;  1UE7 A;  3S15 H;  1W3S A;  3GV3 A;  5E3F A;  4YY3 L;  5IWA Q;  4QIW E;  2L12 A;  1A0I A;  2K01 A;  5BN5 A;  3KUP A;  2NVT H;  4GN5 A;  4K5V A;  2K75 A;  3RLF A;  4JI8 L;  4X66 Q;  2PNR C;  1PA6 A;  3RLN A;  1PTO B;  2PZW A;  2MHV A;  5EQ0 A;  5E7N A;  1LT3 D;  2CW0 C;  2UXB Q;  1UWV A;  1PH9 A;  2I0Q A;  4UP9 A;  3I4M B;  2MFI A;  2RDG A; 
#chains in the Genus database with same CATH homology
 4IZ8 A;  2JE6 I;  4N9T A;  1RDP D;  4PMC A;  3I70 A;  1EZ8 A;  1SAP A;  1JOK A;  3DXJ C;  5I4D A;  3NTI A;  3MXU A;  3H91 A;  1UNS A;  2LKV A;  3OW7 A;  2MP1 A;  1Y69 U;  5EBC A;  4BBR B;  4RKB A;  4L6T B;  2JEB I;  4A3E B;  2TMP A;  1NUC A;  1S5D D;  4H7B A;  1BR9 A;  1HFG A;  2L11 A;  3MA2 B;  4C56 C;  4BBS B;  5DM7 3;  1EWC A;  1GHK A;  4U68 A;  4DAY A;  3SR1 A;  2SOB A;  3MC0 B;  1C4Q A;  4DU9 A;  2XWB B;  3R8B A;  2J0T D;  4IQZ A;  1W6K A;  2EVB A;  1K8O A;  3S1Q B;  3HP3 A;  2PQE A;  2NTT A;  2F0T A;  1RCV D;  2C5C A;  2A68 D;  4L8J A;  3KLS X;  3I72 A;  4X3T A;  5CBA E;  2F0F A;  2N55 A;  1EY6 A;  2OF1 A;  1SNO A;  1EWH A;  2PYK A;  1STE A;  4UDU C;  3HOW B;  2KCN A;  1C8C A;  2ENB A;  2EJM A;  3H0G B;  3J7A V;  1BUV T;  1PTO H;  1XXG A;  2ZXR A;  3FEW X;  4KMU C;  3FRP B;  5G3L D;  4DN4 M;  1HCZ A;  4HR7 B;  1EZ6 A;  1B2T A;  1Z47 A;  2AQ3 B;  2F3W A;  2WKC A;  4FVM A;  4CKE A;  4BY7 B;  3PUX A;  3RZO B;  2EE1 A;  1ENC A;  1LTS D;  2B2U C;  3SXH A;  1AP0 A;  4NDX A;  3A55 A;  4DAP A;  3NTK A;  3J80 E;  3G7L A;  2TSS A;  5ISR A;  2ZXO A;  5CV4 A;  1Q1E A;  3DWA A;  1EL0 A;  1KDA A;  4ZKC B;  1LTA D;  4HAE A;  1HPC A;  1NCV A;  1PRT C;  5KRU A;  3Q23 A;  4RHR A;  5CBE E;  2NTS A;  2B2T C;  2KEE A;  4MN3 A;  2NBF A;  2B39 A;  5A35 A;  1V8Q A;  2E76 C;  2XN9 C;  2Z4H A;  5JVG 3;  5C0X H;  4X3K A;  4I65 A;  1TY0 A;  3V2T A;  3ND8 A;  1BXT A;  2F0L A;  1OXT A;  3NQT A;  1JB3 A;  1GUN A;  1DCZ A;  1D5M C;  1BCP C;  3X3M A;  2F0Q A;  5IGB A;  2VB2 X;  4FXK C;  2L0C A;  3PUZ A;  1BF4 A;  4K6D A;  5AFW A;  4CHT B;  1PYW D;  3A56 A;  3CKI B;  1HA6 A;  3URY A;  3NSW A;  4WOR A;  4N9P A;  3KF8 A;  3H09 A;  4HCS A;  1STB A;  2K7V A;  1M4V A;  3MFG A;  3MXG A;  4PNY A;  1EYA A;  3NWS A;  1T5E A;  5M3M B;  5FKA C;  1HTP A;  4R8N A;  4IUV A;  3T56 B;  4A3M B;  2XSC A;  5KYI A;  2FJ2 A;  2PW7 A;  3S1M B;  5D65 A;  1M8A A;  2E75 C;  2BCO A;  3SDZ A;  4KK7 A;  5A2Q L;  2RBM A;  1DON A;  1TS4 A;  4B08 A;  1WD1 A;  4QUF A;  5KNC A;  2OEO A;  2JA6 B;  1WD0 A;  2JYO A;  3BG3 A;  1L0X B;  1EYD A;  5EGT A;  1EY0 A;  1CQF A;  3D6W A;  1O78 A;  5EPL A;  3PIP 3;  4QUC A;  3VR6 A;  3N52 A;  3OWF A;  3I4L A;  3UI2 A;  1ONL A;  3C3L A;  2IPK D;  1JWS D;  1A3V A;  2NB0 A;  3S2D B;  2IX3 A;  1SJE D;  2AWN A;  1S5B D;  1D1I A;  1R9T B;  3FDT A;  3M85 A;  1SEB D;  4OHJ A;  3VR3 A;  3Q24 A;  2GA4 B;  3T51 B;  2A6H D;  4PMW A;  3HS0 C;  1LTG D;  3ONA B;  3MFY A;  4RFB A;  3ITP A;  3K0Y A;  4K8J A;  5FO8 B;  1SSO A;  1U4L A;  4IFD I;  4CJ0 B;  5M9O A;  1SNC A;  2F0H A;  3D31 A;  1STG A;  1X3P A;  1A2T A;  1SMY D;  1BO0 A;  3S1R B;  4OO1 H;  5I9P A;  2B2Y C;  1X3Q A;  3GD7 A;  2HCI A;  4FXG C;  1G8Z D;  1HFN A;  4RA8 A;  4F88 A;  3RZD B;  3HG9 A;  4IUR A;  2KCC A;  2E2J B;  3M7G A;  3G6J B;  1WCM B;  3D4W A;  2PPB C;  3TME A;  1EYC A;  5CV8 A;  1G29 1;  1HQM C;  3DWQ A;  1LT6 D;  1HQR D;  1O7Z A;  3CRK C;  4XIG S;  2PW5 A;  2LS0 1;  2JXM B;  3HGB A;  1GXD C;  4K5W A;  1CHQ D;  1H9J A;  4H44 C;  1VCI A;  2F0E A;  2WKD A;  3M7N A;  1D1K A;  5A2Q E;  2D62 A;  2SNM A;  1LTI D;  2AUK A;  2L5T A;  1LTR D;  4XQQ A;  2ICI A;  1II3 A;  4R8I A;  2F0M A;  1LO5 D;  1VF5 C;  4NKL A;  2A68 C;  2LFN A;  3SK6 A;  3VYU A;  4B9X A;  4BA2 I;  3GV6 A;  4DK0 A;  4H13 C;  3DEP A;  3QWN A;  2XVS A;  4C3H B;  3FPU B;  5T1G A;  4A93 B;  1GHJ A;  3K5O A;  4IUT A;  4FO2 A;  5C6A A;  3R3O A;  1ZEQ X;  4YIJ A;  1FYC A;  1GUG A;  2DY8 A;  3DMU A;  2EYM A;  2EY2 A;  2VUM B;  2XIW A;  1Q3L A;  4PQX A;  5IGG A;  1KAA A;  4U67 3;  5F2D A;  3OMG A;  5C0X G;  2EJG C;  1QOH A;  3KK7 A;  1EU3 A;  2EXZ A;  2EPB A;  4ME5 A;  2NVX B;  4J1M A;  4QMG A;  2B2W A;  3EQL C;  3E5S A;  1WTW A;  3HOX B;  2IX0 A;  4BWG B;  5FLX E;  2MJ8 A;  1BNZ A;  1JE4 A;  1SNM A;  3KBG A;  1FD7 D;  3QG1 A;  1I4G A;  2SDF A;  1TQO A;  2RKS A;  2E2I B;  2SNS A;  3T16 A;  3TZD A;  3D8G A;  3GTL B;  4ZAI A;  4QF4 A;  1FNW A;  3PUV A;  5IGD A;  2Y0S B;  3T4A C;  3HKZ B;  2D5D A;  2MUY A;  2F0K A;  2F0S A;  2F0N A;  5BN3 A;  1SFO B;  3MAQ A;  2VXW A;  4LMQ D;  1A3U A;  1G2T A;  1WTX A;  2K32 A;  5DM6 3;  5LL6 X;  4K14 A;  5NUC A;  1TWF B;  5M5X B;  4KJN A;  3I73 A;  1HA5 A;  1TVX A;  3Q0A A;  1KNA A;  3ZYY X;  2RSO A;  1QCB D;  1B44 D;  4FXD A;  3MHB A;  1O80 A;  1ENF A;  3PUY A;  1STY A;  1B50 A;  3GTQ B;  4KD3 A;  3GTG B;  1V43 A;  5EPK A;  4QCL A;  3M4Y A;  1WVL A;  2SEB D;  1EQT A;  1O7L A;  3SK5 A;  1LAC A;  3HOY B;  1LT4 D;  4XT3 B;  1VMP A;  2RSN A;  1SYE A;  1TS3 A;  3AB9 A;  1JIC A;  2E2D C;  1SYG A;  1U9R A;  1LT5 D;  5FO9 B;  4V0B A;  2HQE A;  2F0W A;  2LMC B;  4RGM A;  2NVQ B;  3FKI B;  3U9O A;  4OO1 G;  1GUS A;  4RGN A;  4LK1 C;  1SJH D;  3GO5 A;  4F7X A;  1RF2 D;  4ZKB B;  2F0G A;  1D2B A;  1PZJ D;  2A6H C;  1QJO A;  3QIA A;  1UUP A;  3NK9 A;  3BVZ A;  4OIJ A;  5M3F B;  1MGS A;  1KLU D;  5T1I A;  1F2L A;  4TRD A;  3K57 A;  3VR5 A;  1PDQ A;  1EY9 A;  1HTL D;  4QIW B;  1SMY C;  3P7J A;  2EJF C;  2FIN B;  2B2W C;  1CT1 D;  2PCF B;  3I3C A;  1AZQ A;  4KD4 A;  1V1P A;  1TS5 A;  2IJ0 A;  1NR4 A;  3P1H A;  4KN7 C;  1D5X C;  2BDN A;  2WIN B;  3K7A B;  1E2W A;  4IUU A;  2A74 C;  3RUZ A;  2YU9 B;  4DF7 A;  5CYU A;  1B1Z A;  4IN3 A;  4RGO S;  5D3D A;  2BDO A;  3KLS A;  2PZU A;  3NBH A;  2QDB A;  3FPP A;  4CKC A;  1H9R A;  2K5D A;  4MHE A;  1SNP A;  1TWH B;  1EFI D;  4CKB A;  1ZXT A;  5LL6 S;  5KNB A;  4A3B B;  1FGB D;  2AWO A;  1JQY D;  1G91 A;  1WTR A;  1DOM A;  1TII D;  1DM0 B;  3OWE B;  4E6I A;  1PRT F;  3SVM A;  2JA7 B;  4NMZ A;  4UAI A;  3SHL A;  5FK9 C;  2F1M A;  1TT2 A;  1YNJ D;  3VA5 A;  3E6Z X;  1PZK D;  1TU2 B;  4IFD H;  4A3J B;  3R93 A;  3NXW A;  2RVL A;  3C1F A;  3K58 A;  1NR2 A;  5CV7 A;  3I4N B;  5E4W C;  3OOC A;  2RA4 A;  2KOL A;  1BCP F;  1JWU D;  3QOL A;  1B9M A;  1BBX C;  4OIK A;  5ELC A;  4GZY C;  4RCO A;  5C3X A;  4HSV A;  1ILQ A;  4K6L A;  5DEH A;  4WJW A;  4JK1 C;  1A3T A;  3GTO B;  3GTP B;  1PTO D;  3NPP A;  4DXF A;  3S17 B;  1I50 B;  3JAM L;  2M00 A;  4X3S A;  5DNF A;  4EGV A;  3NQI A;  2IT1 A;  3FVQ A;  4EVO A;  1E2V A;  2NYZ D;  1I6H B;  3BZD B;  5C3E B;  1A15 A;  2EYP A;  2F03 A;  1SE2 A;  2EZV A;  4FF3 A;  3H3V C;  1CTM A;  1UEA B;  3NE5 B;  5DAU A;  3HOU B;  2ZT9 C;  2V4D A;  4J6H A;  4BA1 I;  3A8K E;  1DYQ A;  1SYF A;  1QNK A;  2Q8I B;  2M2L A;  1LTT D;  4P2C B;  2OXP A;  3TBI B;  2R7Z B;  1V1O A;  2HDL A;  3L9A X;  3D3R A;  2EY5 A;  2DN8 A;  2ICE C;  5CR3 A;  4CJ2 C;  3BYT B;  4RWS C;  1AW7 A;  4A3F B;  4Q5V A;  5JJZ A;  5KGU A;  1EQV A;  4HCE A;  5I2X A;  4QB4 A;  1XYI A;  2VNU D;  1KLG D;  2LY7 A;  1AN8 A;  2B63 B;  4KN4 C;  4PMB A;  1X32 A;  3Q22 A;  3V96 A;  4HN7 A;  1BQQ T;  3WOE A;  4IUQ A;  2EYO A;  4DFA A;  3I90 A;  1ILP A;  1PRT B;  1KDC A;  4M1U B;  1ML0 D;  1F9S A;  1GUT A;  2O5J C;  4FF4 A;  2KEC A;  5EPJ A;  2Z1C A;  1XTC D;  1SNQ A;  3C1E A;  1VDZ A;  2R3Z A;  1FR3 A;  1EY7 A;  1NAP A;  1ICW A;  1SND A;  3D4R A;  3VR2 A;  2R93 B;  1BCP B;  3TSS A;  4DNR B;  1JOQ A;  4C1N I;  2G9H D;  1I3Q B;  1O7Y A;  3EA6 A;  3PO3 B;  3JAM E;  5JEA H;  3IL8 A;  2PO4 A;  1YNN D;  1PLF A;  3DWP A;  2K5Q A;  1MSG A;  2JSO A;  4KV6 A;  4XQJ A;  2F0V A;  1F9Q A;  2B2V A;  1XWE A;  4A3D B;  4XTC S;  2F0U A;  2O2L D;  4B9W A;  4DA2 A;  3RMH A;  1I4H A;  4I7Z C;  3TP6 A;  3SK8 A;  5C0X J;  2F0P A;  1KNE A;  4C3J G;  2E2H B;  4CGY B;  2A6E D;  4FF1 A;  1KDB A;  1AEX A;  1Z7T A;  5EBD A;  2EDG A;  3KLR A;  1SYC A;  4G4K A;  1SE4 A;  3PIO 3;  5CGK A;  2L55 A;  1B53 A;  3BVG A;  1K83 B;  4KY5 A;  5C4X B;  3GTK B;  3DUZ A;  1H9K A;  1LLR D;  4R9W A;  5HUR A;  3QB3 A;  3MXP A;  3N6R A;  1IKL A;  1BOS A;  3SK4 A;  5I9O A;  4DNT B;  4IAL A;  5J22 A;  1EOT A;  1JC7 A;  1QNU A;  5E4X A;  4Y7N B;  1L0Y B;  4PV1 C;  2KED A;  1EIH A;  2DY7 A;  1R4P B;  3DEO A;  2K28 A;  3L7Z C;  2FFK B;  3CRL C;  5G3L F;  4KKU A;  5IOC A;  3C2P A;  1EY5 A;  1NSN S;  1Y8N B;  1SXT A;  4TQU S;  4O1N A;  3PMF A;  4Z9C B;  3DM1 A;  3IAY A;  4H0L C;  2Z8L A;  3K5N A;  3BDC A;  1G2S A;  2K1B A;  3KBX A;  1S5E D;  5IGC A;  4L63 B;  1AZP A;  1F2Y A;  1IYV A;  5JOB A;  5J39 A;  1T5X D;  4WFN 3;  1EU4 A;  2EOT A;  1DXM A;  4IFD G;  2IX1 A;  1F9R A;  3OHX C;  2B8G A;  4NP5 A;  1WTQ A;  3F2U A;  2HDM A;  2NN6 I;  3WOF A;  3A7L A;  4EQP A;  4LAA A;  1SBB B;  4ZLT F;  1YNJ C;  3IFT A;  4RCN A;  2L4N A;  1U4M A;  1SDF A;  4XXE A;  1JOO A;  4XQN A;  3CU7 A;  3AMU A;  1EY4 A;  1I4P A;  2WAQ B;  1ZKO A;  1QE6 A;  4ID6 A;  2A69 D;  1LAB A;  3BVM A;  1S5C D;  1HHV A;  3NP8 A;  3S1N B;  4G7O C;  1ROD A;  3LNN A;  3PV0 A;  1U4R A;  1JWM D;  1DOL A;  4WRD A;  1CA5 A;  1MI2 A;  2WP8 J;  5JPN C;  4XT1 B;  2EYL A;  3IKJ A;  2R6G A;  3T13 A;  3NUC A;  3TP5 A;  2CQA A;  2KJX A;  3EJI A;  5I2Y A;  2CHB D;  5I6W A;  2EY1 A;  3TZU A;  2K03 A;  4M8A A;  4OGQ C;  5KND A;  4F8M A;  3I8Z A;  5BN4 A;  2CVR A;  1RTN A;  4RAU C;  1Y1W B;  3GP7 A;  4IUP A;  5EKI A;  1WTV A;  3S2H B;  3L3O C;  4EQO A;  3OPO A;  2IW3 A;  1TWC B;  2KQ3 A;  1J9O A;  3TN2 A;  2F0J A;  3M4O B;  2H1E A;  1CQV A;  1EY8 A;  3MWY W;  4DXG A;  2B2U A;  2A5H A;  2R92 B;  1STA A;  5CV5 A;  1LV9 A;  4ZQ3 A;  3R2T A;  4ZUI A;  1E0B A;  3AU7 A;  2X6L A;  3VYR A;  3C46 A;  1CHP D;  2EYF A;  2MPM A;  5JAV A;  1S4Z A;  1SYD A;  1PMR A;  1TWA B;  5HGT A;  1CI3 M;  1DJR D;  1GUW A;  5JEA G;  3HOV B;  2A73 B;  5COY A;  2EYH A;  3OIP A;  3J80 L;  3H6M A;  1HUN A;  1RKN A;  2BE5 D;  3MZ5 A;  1ET6 A;  4A3G B;  3O13 A;  3TP7 A;  5FO7 B;  5KEE A;  3DHQ A;  5D14 A;  3W3A A;  1MSH A;  3EVQ A;  5K36 H;  2O4X A;  1YNN C;  1B9N A;  1IKM A;  3QJY A;  2DNE A;  4BY1 B;  4J8Q A;  1Y8P B;  2YYZ A;  2F0D A;  2K33 A;  4KHV A;  1I4X A;  2PZT A;  4K2K A;  3GTJ B;  5CV9 A;  3P75 A;  2A6E C;  1IW7 D;  4A3I B;  3CHB D;  3NHH A;  1TR5 A;  2QKI C;  3J81 L;  5IGF A;  1A2U A;  3E0J A;  1Q12 A;  2WB1 B;  5K5P A;  2KA7 A;  2NUC A;  5IIF A;  2DNC A;  2EY6 A;  3VR4 A;  2K5W A;  4K8I A;  1D5Z C;  5ELB A;  5EJW A;  4LJZ C;  1E2Z A;  2F4I A;  3NWT A;  3TP8 A;  1VMC A;  1CZW A;  3SEB A;  3VYT A;  3T53 B;  1AFP A;  3BS1 A;  1EIG A;  4ULL A;  3HRZ C;  2KVM A;  1UAP A;  1CK1 A;  2XRQ D;  2RDF A;  1Q8I A;  2BOS A;  1ET9 A;  1DD2 A;  4XYQ A;  4OL7 A;  2JA5 B;  2B2Y A;  2I46 A;  2FMC A;  1VF7 A;  1CM9 A;  5ELD A;  1IYU A;  1WTP A;  2B8F A;  4G57 A;  2X6G A;  4AYB B;  4ZRZ A;  2AQ1 B;  4RH6 A;  2H4O A;  3LX0 A;  3A7A B;  3S16 B;  4C3I B;  1C48 A;  5CC4 A;  3LWE A;  2RDH A;  4C2M B;  5C4J B;  2J7Z A;  4K5X A;  3OSO A;  5LHY 1;  2I07 B;  2Q8T A;  1U4P A;  1BDO A;  3K6O A;  2A69 C;  1MD2 D;  3GTM B;  1PZI D;  4HMJ A;  4IUN A;  3MXN A;  2Z4I A;  3RD4 A;  4C3H G;  3I91 A;  5FOB B;  3J81 E;  2Q8R E;  1I6V C;  5CMD A;  1I4Q A;  1STH A;  5C5M A;  3EFX D;  1IHZ A;  4EQN A;  2JP1 A;  4F87 A;  3IFD A;  3LWU A;  1GUO A;  2R61 A;  4KJO A;  1CFM A;  4CBV A;  3J7Y W;  2OT2 A;  3ND9 A;  4FYD A;  1OXV A;  2XRS D;  1GOZ A;  3MTS A;  1OXX K;  2MGS A;  1ESR A;  4KTA A;  1QWY A;  4X3U A;  4ABN A;  3D4D A;  1F9P A;  3U9S A;  1ZYR D;  2IWH A;  2XWJ B;  5M5Y B;  2RQX A;  1H9S B;  4ODG A;  1SYB A;  5JPM C;  3S9W A;  2M9V A;  2AQ2 B;  1B4O A;  2NN6 H;  1QG7 A;  1D6E C;  4K2L A;  1KTK A;  1ENA A;  5IT9 L;  1B3A A;  1RTO A;  2QIL A;  2CW0 D;  3X3N A;  4KY7 A;  4KKT A;  1W6J A;  2XNA C;  2N88 A;  4IFD J;  1QB5 D;  3M3Y B;  1Z6H A;  2EYJ A;  3FMC A;  3PUW A;  4C1N K;  3A8I E;  5IOD A;  5K36 G;  2D2C C;  4V19 0;  4HED A;  1S5F D;  3P20 A;  2F3V A;  3D6C A;  2F0O A;  2QEJ C;  2BE5 C;  4JBW A;  5C0X I;  5J1Z A;  3PO2 B;  2AUJ D;  4DK1 A;  1H9M A;  5ELE A;  1V1P B;  2JEA I;  3CQZ B;  5FLX L;  1HXY D;  2E74 C;  2KHS A;  3HOZ B;  1TS2 A;  2NZ1 D;  5TSS A;  4DGZ A;  2BA1 A;  1ESF A;  1KAB A;  3R2I A;  5JVH 3;  5I6Y A;  5C3W A;  2D9U A;  3HEJ A;  1RD9 D;  2F0I A;  1EEI D;  4G7Z C;  1Q90 A;  2VB3 X;  1Y8O B;  5CV6 A;  2NVY B;  3VA7 A;  3HZX A;  3QOJ A;  2C9O A;  3SE0 A;  3K5L A;  1IW7 C;  2BA0 A;  1R4Q B;  5C5L A;  4BS9 A;  1PXU A;  2PMZ B;  4DAV A;  3S14 B;  3K5M A;  1OXS C;  3BDL A;  3TDQ A;  3H94 A;  1FNV A;  3GQB A;  4HMI A;  5KYL A;  1LTB D;  1Q1B A;  3NTH A;  4KI0 A;  1SE3 A;  1F2M A;  5IT9 E;  1DZ1 A;  1RHP A;  1FNU A;  5C4H A;  1HRJ A;  4TSS A;  3W2D A;  1PRT D;  4NW2 A;  5IGE A;  5EKL A;  2X69 A;  4HSP A;  3BYY B;  5C44 B;  2FHT A;  1QIL A;  5COR A;  3K59 A;  4HTH A;  3MVV A;  2QF7 A;  2HUG A;  2WAC A;  1EEF D;  4A3K B;  1PTO F;  2L9H A;  4KY6 A;  1BCP D;  1TKW B;  3Q6S A;  1CZG A;  3BDO A;  3ERO A;  1IL8 A;  5JEA J;  1OXU A;  2JA8 B;  4MIU A;  1GJX A;  2G9D A;  1F2Z A;  4RHS A;  1RJT A;  5C4Z A;  4ILW A;  2WII B;  1A6X A;  1F77 A;  4RKL A;  1PFM A;  3S15 B;  1PTO C;  1STN A;  2B2V C;  3OIQ A;  4ZUJ A;  1HUM A;  2J4X A;  2NVT B;  5D3I B;  4OO1 I;  2O5I C;  1JCK B;  4FF2 A;  1XX8 A;  1PFB A;  2IL8 A;  4ZYS A;  2K04 A;  4O42 A;  4S3S A;  1G6Z A;  5M5W B;  4FP5 D;  1TY2 A;  2K05 A;  3WDN A;  3MEH A;  2HCC A;  4RGT A;  2FMM A;  1JR0 D;  4ZK9 B;  2ID0 A;  3A8J E;  2NWG A;  2ZXP A;  2QCP X;  4XYO A;  1CA6 A;  5EKK A;  2L1B A;  5KIX A;  4C3J B;  1TWG B;  5ELF A;  1I4R A;  1PFN A;  1K8M A;  3QO2 A;  3V05 A;  3NBI A;  4G7H C;  5E1F A;  1MBY A;  4FNF A;  2WV6 D;  2NN6 G;  4KKS A;  4Q0F A;  4C3I G;  4KHZ A;  2K6A A;  1DOK A;  2KUM A;  4CJ1 B;  1WTO A;  2B2T A;  4TKO B;  3VYS A;  1OO9 B;  4XDX A;  3OMC A;  1ZYR C;  1Y1V B;  1H9S A;  1JOR A;  3ERQ A;  1J8I A;  3A54 A;  3GV3 A;  5E3F A;  2L12 A;  2K01 A;  5BN5 A;  3KUP A;  4K5V A;  3RLF A;  2PNR C;  1PTO B;  2PZW A;  2MHV A;  5EQ0 A;  1LT3 D;  2CW0 C;  3J7A F;  3I4M B;  2RDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...