4DF7A

Crystal structure of staphylococcal nuclease variant delta+phs v23l/v99i at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4df7A00
1IHZA 2ENBA 4QF4A 5K5PA 5CR3A 4EQPA 2F0KA 4HTHA 2F0EA 5E1FA 3QB3A 1ENAA 2EYPA 3NHHA 1EY0A 1JOQA 1SYBA 2F0DA 2OXPA 4K8JA 5J1ZA 2F0GA 4DFAA 2LKVA 2PW7A 5CV6A 4F8MA 4QB4A 4K5WA 1EYDA 5HURA 3NUCA 3ITPA 5IGDA 3T13A 3EVQA 4NP5A 5IGBA 5IIFA 4KY7A 4KY6A 2PQEA 5C5LA 2F0HA 1NUCA 1U9RA 3LX0A 4KD4A 3OWFA 1SYFA 1STBA 1F2ZA 1EQVA 1SYGA 1SYDA 3PMFA 4IZ8A 2KHSA 2F0LA 2EYOA 4NKLA 4RKBA 3SXHA 5KGUA 5J22A 1STHA 3D6CA 1A3TA 1EY8A 2F0OA 3EROA 3MEHA 4KV6A 4H7BA 3T16A 3TP7A 1AEXA 3P1HA 5ISRA 4K5XA 4ZUIA 5C4ZA 4NMZA 4K8IA 2F0WA 5JOBA 1EY9A 3SK5A 1TT2A 1SYEA 3DHQA 3NP8A 3NQTA 4HMJA 5CV5A 3TMEA 2F0SA 4B9XA 3BDCA 2F0IA 2F3WA 1EY7A 2EXZA 4K2KA 5EGTA 4WRDA 3U9OA 4EQOA 5IGEA 5M9OA 2EY5A 3QOLA 4G57A 3TP5A 5I9PA 5IODA 2PZWA 1F2MA 2EYHA 4LAAA 1II3A 5KRUA 2F0MA 5CGKA 2PZTA 5CV8A 1JOOA 1STGA 2EY1A 5J39A 1EZ6A 2F0FA 2SOBA 3MXPA 1STNA 3RUZA 5C3XA 5I6WA 5CV4A 3SK6A 3D4DA 3TP6A 4J1MA 3S9WA 5DEHA 1SNQA 2KQ3A 2SNMA 3MVVA 3OMCA 3SHLA 1ENCA 1KDAA 5IGGA 5KEEA 3QOJA 4N9TA 5I9OA 1EZ8A 5CC4A 1EY5A 4IUNA 4K2LA 3E5SA 4OL7A 3EJIA 3HZXA 3SR1A 1JORA 4J6HA 1F2YA 1STYA 4HMIA 1EYCA 5HGTA 1SNMA 1RKNA 5C4HA 4RKLA 5C6AA 5JAVA 2RBMA 1SNCA 3NK9A 2PZUA 4EQNA 3P75A 5F2DA 1EY4A 2M00A 4IALA 1KDBA 4QMGA 2EYJA 4K5VA 4ZUJA 4DGZA 4KTAA 5DAUA 4DU9A 4PMCA 1SNDA 4YIJA 2RDFA 3D8GA 3OMGA 5EKKA 2WACA 5KYLA 3C1EA 3NXWA 3V2TA 5IGFA 2F0TA 3D4WA 3R3OA 5EKLA 4KY5A 1A3VA 5C3WA 4KHVA 4DF7A 5KIXA 4F7XA 4K6DA 1EYAA 4KJNA 5E3FA 5IOCA 4ODGA 2F0PA 5I6YA 1SYCA 2F0QA 1STAA 2F0JA 4MIUA 2F0VA 2QDBA 2F0NA 4KJOA 5C5MA 1NSNS 3BDLA 3C1FA 2EYFA 3MZ5A 1JOKA 3ERQA 4K14A 3TP8A 4S3SA 4ID6A 2SNSA 4R8NA 4B9WA 4N9PA 5CV7A 2OEOA 4EVOA 1KAAA 4I65A 4PNYA 3DMUA 1SNPA 2EYMA 5NUCA 2O4XA 3SK8A 2EYLA 4WORA 5CV9A 5IGCA 3MHBA 1A3UA 3SK4A 1TR5A 2F3VA 2F0UA 1TQOA 2NUCA 3H6MA 3HEJA 3OSOA 2PYKA 4PMBA 2OF1A 2EY6A 4KD3A 4ZQ3A 1KABA 2RKSA 1KDCA 2HQEA 2EY2A 4TRDA 1EY6A 1A2UA 3VA5A 2PW5A 4ME5A 1A2TA 1SNOA 4E6IA 5KYIA 4NDXA
chains in the Genus database with same CATH superfamily
1HH2P 1BDOA 4ULLA 3MXNB 2IX0A 2XWBB 3H3VH 2F0KA 1Q7YC 1ENAA 1S5DD 3CKIB 4GOPA 1QWYA 2F0DA 4B3RQ 4CDDC 4OX9Q 2PW7A 1TKWB 4F8MA 5HGQA 3ULPA 4NP5A 1RIPA 1Q81C 5ELBA 1TIID 2FJ2A 3QR8A 2D9UA 3PO2B 1I4HA 3CW2C 3H3VI 1Z6HA 2FXQA 5C44B 4JI0L 4PZ8A 4JOIA 4JW0A 2KVMA 3MEHA 5CBAE 5JEAG 4K5XA 4JI2L 1D8LA 4QGUA 1PMRA 1BOSA 4JBMA 1O7IA 3TMEA 1HZAA 2F3WA 2EXZA 4R4OA 4WRDA 1UAPA 4DV7Q 5IODA 5I9PA 3H91A 1MBYA 1F2MA 2C35B 2EY1A 4ZAIA 3I7FA 4ABNA 2X6GA 1I6HB 1HFNA 1SNQA 1KAWA 3SEBA 3OMCA 5ELFA 3SHLA 4X64Q 1G2TA 1EY5A 2PNRC 5TSSA 4EGVA 2AMCB 1PH6A 1DM0B 3MXGA 4OONA 4BY7G 1HQMC 3J81E 1RKNA 5FO7B 3K57A 1Q3LA 4RGTA 2R7ZG 4BXXH 1QCBD 2BCOA 4JI5Q 3ND9A 3D8GA 3OMGA 4IUPA 1FD7D 5LHY1 2BDNA 3HG9A 1EIYB 5E7NA 4X66Q 2ZTCA 5J3BA 2A6HD 2CW0D 1CHQD 5E4XA 3RZDH 3S14H 2IL8A 2MO0A 4UP9A 1Y8NB 1QZHA 4KJOA 3A8JE 3S15B 1CFMA 3TP8A 2PNHA 4FYDA 3E9IA 4RAUC 1RCVD 1W6KA 1IBMQ 1HPCA 2JA5G 3DM1A 1YNND 1WTRA 4LUVA 4LF6Q 4B3TL 4A3EB 1A2TA 2NVYH 3F2DA 1E2ZA 4NDXA 3ZYYX 1Q82C 1PYBA 5KNCA 2F0EA 4WJ4A 1SMYD 5JJLA 4K8JA 1O7YA 2NN6I 2R7FA 1ASYA 1EYDA 1N32L 3S16B 3SGIA 5IY0A 3WOFA 2EJGC 4LFAL 2MJ8A 2JA7H 1NUCA 4KD4A 1B7YB 3M4OB 2F0LA 4RKBA 1LYLA 2QGQA 5M5XB 5JVG3 4ZUIA 3CCMA 1EEFD 3MFYA 4GKJL 3SK5A 5JJKA 3A7LA 3BU2A 1XNQL 2BA1A 1J5EQ 1QG7A 4DUYL 1TWGH 2GN5A 3CCLA 1HHVA 4K6LA 1XX8A 1R4PB 3D4DA 2E2JH 2KA7A 3I8ZA 3OTOL 2SNMA 4IPHA 4UHVA 1H9JA 1ZEQX 1QB5D 4LFBQ 1C4QA 4YWMA 1GHKA 1SE8A 1B8AA 2Q8RE 2M9VA 4DK1A 3UE0A 4K2LA 1EFWA 5FK9C 5M5YH 4YY3L 4AYBE 3GTGB 4LF5L 2SEBD 2R3ZA 3H09A 2KECA 3B6YA 1CUKA 3DLLA 4QMGA 2ALYB 2RCFA 3DWQA 5IP9H 1HNWL 2O5JC 3R8BA 3BJUA 1GUWA 2WAQE 3EA6A 5EPJA 4WJ3M 3C2PA 3CCEA 1A3VA 2ZTDA 3KBGA 5EJWA 2WINB 5DM73 1E1OA 1BNZA 5EAYA 1STAA 3RZOH 3MAQA 3M4QA 5C3EB 4YCUA 3HOXB 3CQZH 2MUYA 1BCPD 1Q8IA 4PV1C 5CV7A 2C9OA 1LV9A 3BVZA 1FNUA 3DMUA 1E2VA 1CKNB 3AU7A 4A3CH 1IXRA 1OXXK 2AQ3B 2MFIA 4KD3A 2CCZA 2AUJD 1U0LA 2RKSA 2G9DA 1Q1BA 2JA6H 2KUMA 5KNDA 4A75A 1TWHH 3OPOA 4DPGA 1WCMH 2I0QA 3GTMH 2KEDA 2ZJPA 1L0XB 1VF5C 5CV6A 2BDOA 4DR2L 1X56A 3PUXA 2F03A 2JYOA 1D2BA 3NUCA 1L1OC 1OXVA 4JI8Q 4XQQA 4A3LH 1WOCA 1SDFA 3KYHC 5EKIA 3GDEA 2SDFA 1ICWA 4NXNL 4H7BA 1F9SA 2HDLA 2LY7A 4NMZA 2N55A 3U50C 3K6OA 4K8IA 3J81j 1NNXA 4HMJA 5M9OA 1B9MA 1MSGA 4G57A 5BN5A 3H3VC 4C3HH 1I94L 5CGKA 1STGA 5J39A 1V1QA 3PUVA 1Y1VH 3RUZA 4V190 3S2HB 5DEHA 1KDAA 1V9PA 3HOYB 2WP8J 4KKSA 1W6JA 3C3LA 1K3RA 3EJIA 3QIAA 1STYA 1R4QB 1CA6A 5C6AA 1L0WA 5IYBG 1K3BC 1X55A 5F2DA 3K5OA 3U9SA 3STBC 4DGZA 1Y1WB 3HOWH 2CH4W 3KF6A 4YIJA 3QJYA 2RDFA 3H0GB 1HR0L 5KYLA 2A68D 5BN4A 1YNJC 2F0TA 4J15A 3SVMA 4BY1G 4DR5L 2Z9HA 3T56B 3RD4A 3UI2A 1LTSD 2F0PA 2A73B 3ICEA 4QUFA 1FNWA 3HKSA 4ID6A 2HCIA 1RODA 4DR1L 3CC2A 3BZCA 1VDZA 5EQ0A 4EVOA 1KRSA 1DD2A 3S24A 3PSIA 2JXMB 4BBSG 3CHBD 2C5CA 4DV2L 3HOZG 4PG3A 2L12A 4XQNA 4P74A 5JEAH 2R93B 2IW3A 4KI0A 2ZXPA 3A8IE 4A3FB 4UAIA 2VQFL 4A3DB 4A3MG 1VQEA 2L11A 1EY0A 3LWUA 4A76A 5K36H 3M4PA 4AYBB 4QB4A 4L5QA 4ZYSA 1JT8A 4DAYB 1NMFA 5T1IA 4B3MQ 3PIO3 1YITA 3WWVA 4KKUA 4C3JG 4A3IG 2WAQG 1SLJA 4IZ8A 3PMFA 2AWOA 1YVCA 1F77A 4A3BG 1D6EC 4LMQD 5IWAQ 1A6XA 1FR3A 2R7ZH 1EIHA 5IT9L 4DK0A 4FF3A 2JA9A 3KDFB 2J4XA 1V1PA 3AQQA 2RDGA 3WOEA 2NVXB 3OOCA 3GTLB 5I6WA 5C3XA 1L1OA 2RHSB 3TP6A 2IHEA 4EX5A 4GZYC 2XRQD 4JI4L 1BUVT 1C9OA 1VCIA 2NN6G 3W1BA 3L7ZC 1EIFA 1I3QH 3BG3A 1LT3D 2K05A 1S5CD 4HMIA 1I4XA 1NAPA 4A3GG 4MZ9A 3J7ZC 3BYTB 5HGTA 4IPCA 1TWAH 2R92B 3DWPA 2JA5H 4JI7Q 4A93B 4KTAA 1VS0A 4X62L 4TSSA 1BCPC 1VQCA 1PRTD 4F7XA 1EYAA 1HA6A 5GADC 3K59A 4GNXC 1B2TA 3N6RA 2F0VA 2QDBA 3CCUA 1JCKB 2YTXA 1KTKA 2SNSA 4AQYQ 2KEEA 2VUMG 1A0IA 4IUQA 5M3MB 3I4OA 1XMOL 3U4ZA 2EYLA 5CV9A 1S40A 3MHBA 1KNEA 3HKZE 1B70B 2B2YC 1YJ9A 3SE0A 1IBLQ 3RN2A 4DAYA 4GS3A 3BZKA 3L2PA 3GTQB 4IFDI 2AQ2B 1S5FD 4DV6Q 3CC4A 4WFN3 4JI3Q 1A15A 4A3KB 1XPOA 4BWGB 1DONA 2UUAQ 4HTHA 1U4RA 2OXPA 3TDQA 4PMWA 5HURA 3A55A 4UY8C 4DR7L 4FXKC 5ELCA 1EQTA 1YEZA 2L0CA 4OWXB 1K28A 2PQEA 1RTOA 4ME3A 2HDMA 1VMPA 1X3GA 1F2ZA 3I70A 3KLRA 5FLMG 3GV3A 3SXHA 2OQKA 4XDXA 1JE5A 1N34L 4H44C 4J8QA 2VW9A 1AP0A 5GROA 3H15A 1JJCB 2VL6A 3NQTA 3CF5A 2Z0SA 3HP3A 1KLUD 1UE1A 1PV4A 1M4VA 4LAAA 2UUCQ 5IT9c 1GJXA 2L15A 4C1NK 2BH8A 3I4NG 3BZDB 3O13A 1LTRD 1B44D 2NZHA 1D5ZC 5FO9B 2GA4B 4GOPB 4DAVA 4HIMA 1S5BD 4O42A 1JORA 4RFBA 2A68C 3A7AB 1PTOC 2DN8A 2LXJA 2B2WA 3X3NA 1JJ2A 4KHPQ 1SE3A 1B53A 1SN8A 1V1OA 3W1GA 3I4MB 4JCVE 4DV4Q 4RGOS 3NSWA 3KLSX 2B8FA 4LJZC 1JQYD 2TSSA 2B2UA 1WTVA 2CWAA 2TMPA 2WB1B 3GTOH 1XJVA 4K6DA 3T1YQ 1CKMA 1JB7A 1JR0D 1X54A 2F0QA 1LT6D 4MIUA 3FKIG 5C5MA 5FO8B 3VR4A 2E2HH 3MZ5A 2NVTB 2KENA 2QEXA 1VF7A 4R8NA 3AMUA 2Z4IA 2XN9C 1VQ9A 3F2UA 1B3AA 4Q0FA 5G3LF 4DV0L 3AYHB 4R4TA 3S1RH 1KDCA 4BA1I 1EY6A 3VA5A 4ME5A 2UXCL 1N36Q 2L9HA 4B3SQ 1RJTA 2K04A 3F8TA 5E1FA 2UU9Q 3GV6A 2K4KA 4L8JA 2LKVA 5BR8Q 4HAEA 4DV5Q 4APVA 1PZKD 4X65Q 5IGDA 4DR6L 2JA8G 4RCOA 1HNZL 4K0KL 1PH4A 3I3CA 1STHA 3K0XA 3EROA 3I55A 2E2IH 3OW2A 3K81C 3LWEA 4C2MB 1QZGA 3ZJYC 2CWPA 4FF1A 2IX1A 1HCZA 5LMUQ 2JQOA 2D0OA 5IYBH 4DV3L 2K14A 4UDUC 1PH5A 3KF8A 2B3GA 2O5IC 4IO9A 1XMQL 1TS3A 3A5UA 3PO2G 5C44G 3SK6A 4RCNA 2HHHL 1XPRA 1FL0A 4BY1H 1WJJA 4O1NA 3CXCA 2DY7A 3HKZB 3KLWA 1BXTA 2Q8IB 1PHJA 3R93A 3I73A 4OL7A 3KK7A 2F4VQ 1F2YA 1CZGA 4Z9CB 4EQ5A 3S2DB 2AKWB 5LL6X 5C4HA 4RKLA 3F2BA 1PRTC 3MA2B 4BBRB 4LUOA 5JJZA 3ONAB 2DY8A 4GKKQ 2BOSA 3HRZC 2B2TA 1HNXQ 1HR0W 4BBSH 2PI2A 3HOVB 2DJFC 4Y7NH 4FXDA 1LLRD 3HOZH 3C1EA 2KCTA 1I4PA 5GAEC 1RF2D 3TN2A 5M5WB 3NTHA 3KJOA 3IRBA 1PFBA 4JYAQ 4HEDA 4A3MH 3IL8A 1JB3A 3C1FA 1TS4A 4TVAB 4DNIA 1X3FA 3HGBA 2OEOA 1H9SB 1LTLA 2XGTA 2ZXRA 2EYMA 4V0BA 4DR4L 3DWAA 5IT9E 4PQXA 3T1HQ 1SEBD 1TR5A 2F3VA 2F0UA 1TQOA 2IHFA 5EKKA 1TWCH 4C3JH 4A3IH 2QCPX 3RLNA 4LF9Q 1H9KA 3GTPH 3S1MB 2D2CC 4A3BH 4IN3A 4B3RL 4OX9L 3STBD 3A0JA 4I7ZC 1TY2A 3S1NH 2OWOA 4R4IA 5GAHC 3FHWA 1YNJD 3K80C 1MJCA 4QCLA 3BVMA 1NJIC 3L0OA 1ILPA 4NW2A 1TS5A 1HUMA 5DLQE 4G4KA 2XRSD 3EVQA 1Q12A 5C4JB 5A2QL 3FDTA 2F0HA 4A3EG 1U9RA 1JMCA 1N33Q 2NN6H 1Q1EA 1SYGA 1EQVA 2KBNA 1YHAA 4IOCA 3KLSA 4A4IA 2JP1A 1CSQA 1VQFA 4KV6A 4DV7L 5C0XI 2RA4A 4RGMA 5C4ZA 3BS1A 1DZ1A 5IYCG 4XYOA 4CGYB 1GUNA 4A3GH 3PIP3 1X9NA 3T4AC 1RL2A 3L9AX 2K5NA 1TT2A 1TWFH 4DKAC 1ESFA 2O2LD 3PO3B 2I5MX 2F0IA 4IURA 1EYGA 4IFDG 4A3JB 2EYHA 1K8GA 1FJGQ 1EL0A 4X64L 4CDEC 4CJ0B 4ALPA 5IP7G 2Z6KC 4JVZA 1CKOA 3NBHA 4C1NI 2KQ3A 3K7AH 4LF7Q 4GN5A 1PYSB 2X69A 2KCNA 1ET9A 4UP8A 1I50B 1V8QA 2RCNA 1X6OA 1IYUA 1T9HA 2G9HD 4KHZA 3SR1A 3EN2A 4JI5L 4DK3C 1CQFA 2VUMH 1F2LA 2YU9B 1XTDA 2PMZE 2PZUA 4R4CA 2WKDA 1R9TH 1WD1A 4X66L 4YWLA 1O78A 2IX3A 5LMNQ 2VZAA 2EXDA 3S1QH 1H9SA 4RA8A 1X3PA 4RGNA 1QNUA 2DJGC 4TQUS 4HIDA 1M90C 1YZ6A 1D1IA 1ICFB 3ND8A 1EFID 3VA7A 2DNCA 3M3YB 3D0FA 3JAML 2IY5B 2MHVA 2I46A 1P8LA 1MHWC 1IBML 2E76C 3P20A 3K5MA 4IFDJ 4U68A 3D3RA 1MJEA 1XNRQ 1U4PA 3HS0C 4X3KA 4LF6L 1SRUA 4MNOA 2RQXA 2A1AA 1HUNA 1AN8A 2EZVA 3T51B 4BA2I 3CPFA 2MNAA 3FMCA 2EJFC 2NVQH 5FLMH 1CQVA 1TXYA 2BE5C 1GUTA 1K83B 1G291 5C3EG 3Q8DA 4QF4A 3HOXG 1SJED 2WIIB 1SE2A 3GTKH 3KF6B 1JOQA 1XXGA 4DFAA 3HOUB 2H5XA 2B63B 3E9HA 1IYVA 4O0AA 4JI1Q 3I4NH 1BF4A 5IIFA 1IZ6A 3PF4A 4MHEA 2JEBI 3PCOB 4DUZQ 2R61A 3T53B 4C3IB 5J22A 1A63A 4R4QA 1HZCA 3VYSA 1IBKQ 1J5EL 3GTJH 1PLFA 2UXDQ 5IGFA 4DAPA 3HFZB 3W3AA 4JBKA 1MSHA 5C4XB 1LTAD 4LFBL 2VNUD 4OXPA 1WVLA 1A8VA 2ATWA 3UDGA 2XTIA 5COYA 1PTOH 2AWNA 3PIOA 3FKIH 4RHSA 4LW1A 3NTIA 1QVFA 4CJ1B 1XPUA 5M3FB 5EBCA 1KLGD 2HUGA 1PYWD 3PGZA 4ZRZA 1QOHA 1A62A 2J7ZA 3K5NA 2L5TA 3I72A 3NXWA 3FP9A 5EBDA 1K8MA 3HOYG 1Y14B 4JC0A 3ERSX 4M1UB 1TS2A 2K33A 4OIKA 3CCQA 4X3UA 1AE2A 1FVIA 2ID0A 4RG1A 1V1PB 2EYFA 3JAMc 1CHPD 1GKHA 4K14A 2V4DA 4JI6Q 2VXWA 1Y1WG 3M9BA 5I2XA 2FHTA 1L1OB 1K0RA 4I65A 4G7HC 3H0GG 4FO2A 2ZM6Q 2M2LA 4JG2A 1Z47A 2GVAA 2KJXA 3H6MA 4PMBA 3S17B 3CCSA 2JA8H 1H9MA 3KFUA 2Q2TA 1PTOD 2IWHA 2Y0SB 3J7YW 2QKIC 1SAPA 4OHJA 1HRJA 4KLKA 5D65A 2MO1A 1KQSA 3AB9A 1CZWA 2E75C 3VDYA 1ML0D 1Z9FA 1PH1A 1VQAA 1YHQA 4L5TA 1YJWA 2CFMA 3UDFA 3PO2H 1JWMD 4NPSA 2PMZB 4DK6C 4XIGS 5C44H 4DAMA 3E0JA 1YNXA 2CQAA 4YHHQ 2R93G 1WTXA 1Q86C 2A8VA 4DNTB 1JWUD 4CDFC 2E5LQ 3G48A 1A3TA 4A3FG 4LF4Q 1PFNA 1K73C 3TP7A 4A3DG 3DUZA 3GO5A 2V1CC 1OXUA 1SROA 4L63B 2IJ0A 4AYBG 1VQOA 3M4YA 4K2KA 1EY7A 3U9OA 5IGEA 1IYJB 1EUJA 1Y69U 1I6HH 4NXMQ 1X3QA 3NBIA 3W5OA 1HTPA 2WB1E 1E22A 3UDXA 1F9QA 3DEPA 3AFQA 3AFPA 4HSPA 2FFKB 4IUTA 2PO4A 5AFWA 1N9WA 1H9RA 4IUNA 3HZXA 4PZ6A 2L55A 2PI2E 2KHJA 3J7A5 5HY6A 1YI2A 4BY7H 1X3EA 2OCEA 2NZOA 4XT1B 1KL9A 4RWSC 1RTNA 5C0XG 1QJOA 4I7AA 1PH3A 4JV5Q 1Y8PB 4R1JA 3ULJA 4L5SA 3IKJA 5C3WA 3S15H 1PFMA 5A2QE 3MC0B 1NR2A 1ET6A 1LTGD 5I2YA 2A74C 2R92G 3ULLA 4KMUC 2RSOA 2EQSA 2UXBQ 3RZDB 3S14B 5EPLA 1KAAA 4A93G 1IW7C 2VQEQ 3ER0A 2O4XA 4OO1I 4GN4B 4HIKA 2ICEC 4YCVA 4A3EH 4R8IA 1K0SA 1SNOA 3TREA 2QDLA 1FGBD 1KNAA 3A54A 4HJ7A 1HXYD 2Z4HA 2NVYB 4B3ML 3UE1A 4XQJA 3G6JB 3S16H 5M3MG 5C0XJ 4IFDH 1Q90A 1YBYA 2QA4A 2XNAC 3TSSA 5IP7H 5IGBA 1S5ED 3M4OH 3KUPA 1L0YB 2PQAA 4RMFA 3U58A 1GD7A 1GO3E 5IWAL 5M5XH 4A3KG 1GUOA 5IYDG 2JA7B 4ZLTF 1JICA 4LF8Q 2VB3X 3NQIA 2PPBC 4LK1C 5EGTA 3JAME 1BVSA 1SBBB 3PF5A 4R9WA 2JJQA 5AJ3Q 2MP1A 2J0TD 1JOOA 4HCEA 2SOBA 1BCPB 1NR4A 2G5DA 2I07B 1TWGB 4FF4A 4F87A 4JK1C 5FOBB 1ENCA 2ZTEA 3GTGH 5I9OA 1VQ5A 3I91A 4DV1Q 2E2JB 4P2CB 3A8KE 4JI7L 4LFCQ 4J6HA 1LO5D 1BBUA 2K5VA 1CA5A 2CQOA 3NPPA 5M5YB 2Z6BA 1LUZA 1STEA 4ZCKA 1SFOH 5LL6S 1XWEA 2RSNA 3D31A 4LWCA 4JOIC 1UWVA 4X3SA 1EIGA 1BQQT 4CHTB 4KHVA 2UUBQ 5C3EH 4AQYL 3HOXH 2K5WA 3Q6SA 1HZ9A 5I6YA 3KF8B 2ZJQA 4DXFA 1WYDA 3QWNA 4N9PA 3RZOB 3EIVA 1IBLL 3I4MG 3CQZB 1SNPA 4DR3Q 5NUCA 1DOKA 1QUQA 4DV6L 1O7ZA 4JI3L 3HEJA 3OSOA 2UUAL 3I90A 2EY6A 2WB1G 4GLXA 4GLVB 4P75A 1ZYRC 4E6IA 4CKEA 1IHZA 2ENBA 2JA6B 1C48A 1E3PA 1DCZA 5I4DA 4GN3B 4LUZA 1TWHB 3JAMi 3CD6A 1WCMB 2YTVA 4M8AA 4QJFA 3GTMB 2OTLA 4OWTB 3FRPB 3LX0A 1W2BA 2QILA 4NB3A 1RD9D 1WTWA 1QVGA 1EOTA 4B08A 5L37A 2FMMA 1AEXA 2WV6D 1PZID 2HHHQ 2UUCL 1PTOB 2F0WA 2K5QA 1EY9A 4B9XA 4GNXA 4JI0Q 3NP8A 4IQZA 1S4ZA 3F1ZA 3PUWA 4IUVA 2BE5D 4QUCA 4IJLA 2EY5A 4JI2Q 3S2HH 1VQIA 1LT4D 3QO2A 5D3IB 2ZJRA 1STNA 4C56C 2N8NA 3HOYH 4C3HB 1QE6A 3DXJC 4HJ8A 2F3IA 2K03A 1BKBA 1S3OA 2B2YA 1DOLA 1Y1VB 1WTHA 1EQQA 3D4RA 3GD7A 4KHPL 4GLAC 1IKLA 5E4WC 1WTPA 4P73A 2JSOA 2DGYA 2D0PA 4DV4L 1J9OA 2HT1A 2K75A 3NELA 1Y1WH 2H1EA 5JAVA 2RBMA 1MD2D 3H0GH 3NK9A 1VQPA 3P75A 3OWEB 1PVOA 1KDBA 4ZUJA 2HQLA 2Q8TA 5DAUA 1HQRD 1G51A 1F9PA 1SNDA 3T1YL 1LT5D 1PFSA 3CAMA 5JPNC 2N49A 3HKZG 3HOWB 3M85A 2YV5A 4IPDA 1I4RA 5E3FA 1ENFA 2MQHA 1B1ZA 1UE7A 3MFGA 1VQBA 1UE6A 2F0JA 4BBRG 4HN7A 2YTYA 3VR6A 2RF4A 1N8RC 3NBHB 3HOVG 3OYYA 2NWGA 2VS1A 1I6VC 4WORA 4KKTA 5FJ8G 3RNUA 1N36L 2NTTA 4B3SL 2R93H 1LTID 3E6ZX 4A3FH 1D5MC 2PW5A 4A3DH 2UU9L 1G2SA 3VYRA 3KJPA 2B29A 5BR8L 4DV5L 1KD1C 1YIJA 3PQIA 5K5PA 1IL2A 4X65L 1CI3M 1HJPA 1MGSA 3IFDA 4B3TQ 3CU7A 1SYBA 2F0GA 5K36G 3CRKC 4K5WA 1E7ZA 2JK8A 1O80A 1QILA 1C0AA 3AEVA 1PXUA 1N32Q 5LMUL 2K1BA 4HSVA 3P1HA 3F2CA 4OO1G 4LFAQ 4TKOB 1SYEA 3DHQA 1PRTB 2F52A 1NE3A 4HCSA 2NVXH 1I4GA 4BY7B 3GTLH 5C0XH 3QOLA 3TP5A 2R7ZB 2PZTA 1K8AC 4GKJQ 1CTMA 3TZUA 2F0FA 1XNQQ 5ELNA 2F4VL 5JEAJ 4OIJA 1MIUA 4PZ7A 3CCJA 4DUYQ 1TU2B 1Q46A 3J7AF 4GKKL 3A56A 2R92H 3PO3G 2A69D 4Q5VA 3OTOQ 1HNXL 1AH9A 1XTCD 3X3MA 1I3QB 4A3JG 4A93H 3MXNA 4CKBA 4EQNA 4YY3Q 3V96A 1E24A 4RH6A 1TWAB 4XT3B 4FDBA 3IFTA 4LF5Q 1NCVA 2Y0SE 4JYAL 2AQ1B 3RLFA 4OEMB 2NTSA 2JA5B 3V2TA 4HJ9A 5FKAC 3RLOA 1C8CA 1BBWA 1HNWQ 1SYCA 1NY4A 1JC7A 5M3MH 3T1HL 4L5RC 2NYZD 3MTSA 4MTNA 4OELB 4LF9L 3R2TA 4P72A 1D5XC 3E0EA 3J80L 2NBFA 4FF2A 1A3UA 2EE1A 2D5DA 2NUCA 3SK4A 3GTQH 1RDPD 3V05A 4HJ5A 4L6TB 2NZ1D 2AHOB 4RHRA 1D1KA 2EY2A 4A3KH 1KIXA 3G4SA 4KK7A 4JBJA 3G6EA 5IYDH 1X65A 4HIOA 4FVMA 1VQ8A 1T5EA 3U4VA 3H94A 4QIWE 2VB2X 3NHHA 3J81i 1VQKA 1N33L 2HCCA 3A5ZB 4CKCA 3VR3A 2BH2A 1WD0A 1HZBA 2N88A 2FMCA 3K7UC 1WFQA 4DR2Q 2KHSA 5BN3A 1CK1A 2A6EC 2LSSA 2K5HA 3TQYA 1IW7D 2N3SA 1FJGL 3HOUG 4YCWA 2B63G 2F0SA 5DNFA 4NXNQ 2ES2A 1Q8KA 3NTKA 1U5KA 2PZWA 3DM3A 5A35A 4LF7L 3M7NA 3L3OC 4IJHA 1SFOB 2B8GA 3MXPA 3Q0AA 1PZJD 4C3IG 5CV4A 5GQOA 3MEFA 1LM0A 3LGJA 3CMAA 1UUPA 2OT2A 3UDIA 1I94Q 2EVBA 3BYYB 2E74C 4QQBX 5CC4A 2KCMA 2R7DA 3NENA 3E5SA 3E3XA 1E0BA 1RHPA 2FINB 1K8OA 2QW7A 3R2IA 5LMNL 3I4MH 5C4XG 2EOTA 1SE4A 1SXTA 3I2ZA 1VQGA 3BVGA 4IALA 2Z1CA 2EYJA 5GAGC 1BCPF 1YHBA 3PUZA 5EKLA 2ICIA 2Q2UA 5KIXA 1WTQA 2VY3A 3FVQA 4KJNA 5IOCA 1XNRL 2NVTH 1OXTA 1VQDA 2DNEA 1U4LA 4HR7B 1HR0Q 1BBXC 3GTOB 2F0NA 4N8X1 1NSNS 4DR5Q 2PCFB 3VR2A 5M3FG 2KHIA 3Q23A 2LS01 5DM63 1C7YA 2E2HB 1E1TA 1MI2A 1VMCA 1T5XD 1L2FA 3SK8A 3W2DA 3J80c 3IAYA 1IKMA 3Q22A 4JBWA 5KRUA 1Y8OB 1OTCA 4DR1Q 3NE5B 1VQLA 3TRZA 2HQEA 4OGQC 3CP0A 1J6QA 2Z6KA 2HIXA 5FLXL 2K28A 4XYQA 1Z7TA 4DXGA 1EEID 3S1RB 1PH9A 1FYCA 5CR3A 2L4NA 4JI1L 4JPBW 3CMEA 3QB3A 4DV2Q 4KN7C 3URYA 3WDNA 3GQBA 1KRTA 1FGUA 3FPUB 3VYUA 4DNRB 4DUZL 2EIFA 1JJGA 5T1GA 2VQFQ 2CVRA 1B50A 2L1BA 2B39A 4KY7A 1IBKL 2K7VA 2Y0SG 3EFXD 2K5DA 2K6AA 1SYFA 1X32A 1SYDA 2JE6I 2UXDL 4C2MH 2EYOA 4NKLA 1AFPA 1WI5A 3D6CA 3MWYW 1IL8A 1ZXTA 3RMHA 3G71A 1O7LA 4ZKBB 2YYZA 2B2VC 1AE3A 5JOBA 2Q2HA 2E2IB 4JI8L 3TEHB 3BDCA 2H4OA 5JJIA 2HD3A 2LMCB 2A6HC 1B3QA 2CW0C 3RR5A 1ZYRD 2F0MA 1HTLD 1EZ6A 2A69C 1CKNA 1EWIA 4IPGA 1GOZA 4FNFA 3FEWX 1G91A 4N9TA 2RHQB 3S2DH 1EZ8A 4BY1B 1PTOF 1YNNC 4BBRH 1SSOA 4DA2A 1DYQA 5IE8A 4JI4Q 1M1KC 1OO9B 2PQAB 4QIWB 3HOVH 4G7ZC 4ZK9B 1DJRD 3OIPA 5JVH3 1EY4A 5FJ8H 5H1SE 1PDQA 4K5VA 2RVLA 1VQHA 4PMCA 2MPMA 2E2DC 1SMYC 5KNBA 5M5WH 1GUGA 1UEBA 2WACA 1GM5A 1VQNA 3R3OA 5JPMC 2XVSA 4BBSB 1KC8C 1HA5A 4Y7NB 2OQ0A 4QY7A 4JI6L 3HOZB 4ODGA 4X62Q 2QEJC 3KBXA 4H02A 2ZM6L 1J8IA 1JOKA 3ERQA 3D6WA 4A3MB 1DXMA 3TBIB 3TS2A 1G6ZA 2GVBA 4BXXG 1SJHD 2N78A 3S1MH 2XSCA 2F4IA 1ONLA 4DN4M 1KABA 3TZDA 1BO0A 1KHIA 1LTTD 2K50A 1UNSA 4C3JB 1TWCB 4A3IB 2WAQB 5KYIA 3CPWA 1XMOQ 1K9MC 4OO1H 3J81L 3GTPB 5FLXc 2CKZB 2B2WC 4A3BB 3MXUA 4MTKA 2EYPA 3CC7A 4KN4C 1EU3A 3NEMA 3SDZA 2JEAI 3S1NB 4YHHL 3CRLC 5C4JH 2R6GA 1D7QA 1I4QA 2E5LL 1ASZA 1TY0A 3T13A 1H95A 2BA0A 2K32A 2B2UC 4LF4L 4POGA 4CBVA 5C5LA 3OWFA 2XIWA 2A19A 2MGSA 1QNKA 2KOLA 4X3TA 1NTGA 4AIMA 4DR7Q 4Y52H 1UE5A 2F0OA 3PUYA 4CJ2C 5ISRA 3PO3H 5IYCH 4IOAA 1CSPA 4LNQA 1QVCA 4A3JH 1W3SA 4NXML 4P71A 5ELEA 3EQLC 1QUQB 2OTJA 1N34Q 4A3GB 1KXLA 3K0YA 2NB0A 1TWFB 1II3A 1B9NA 2WKCA 1LACA 4POFA 3J80E 3S9WA 1I50H 3MVVA 2JA7G 1WTOA 5KEEA 2I5HA 2XWJB 3QOJA 4G7OC 2YU9H 1EWHA 3K7AB 1VQMA 1PRTF 3GP7A 2B2VA 1EYCA 1SNMA 5D3DA 1TVXA 1NBWA 5ELOA 4JV5L 1SNCA 2M00A 3PV0A 1VQ7A 3FPPA 4MN3A 2VUMB 4DU9A 2CHBD 1R9TB 3K5LA 1CM9A 1P16A 3VR5A 1AW7A 1PH7A 1XYIA 1AZPA 3M3YH 4BS9A 3D4WA 4KY5A 3S1QB 4DF7A 2UXBL 4GNXB 3G7LA 5CBEE 2EDGA 1HFGA 1V43A 1GUSA 3K58A 3QG1A 4GOPC 2E8GA 2VQEL 1ZKOA 3BDOA 1G8ZD 4S3SA 1VQ4A 1VQJA 3NWTA 4B9WA 2QF7A 4PNYA 3CCVA 4XTCS 1BR9A 1K83H 2EJMA 3KDFA 4TRDA 5IP9G 3I4LA 2PYKA 2LXKA 2OF1A 2F1MA 5CYUA 1A2UA 2DUDA 4ZKCB 1YJNA 3A74A 4DV0Q 2NVQB 5CMDA 4YWKA 4AH6A 1S72A 3HOUH 4EQPA 2B63H 3J81c 2Z8LA 1MKHA 1JWSD 2UXCQ 5J1ZA 2B2TC 3Q24A 1UEAB 3EBEA 3OHXC 1LTBD 3ITPA 3GTKB 1PH2A 1GXDC 4F88A 3J80i 4C3IH 3N52A 4A3CG 1GHJA 4KY6A 4LF8L 4OWWB 4QL5A 3I4NB 2WFWA 1ESRA 1STBA 4ILWA 1DGSA 2IPKD 5KGUA 2JA6G 4X6AH 1EY8A 3T16A 4DR6Q 4UP7A 3KOJA 4FP5D 4U673 1PH8A 5AJ3L 1M8AA 1G6PA 4IUUA 1HNZQ 5C4XH 4K0KQ 5CV5A 1WCMG 4H13C 3GTJB 2KCCA 5G3LD 2IT1A 1U4MA 2CH4A 4EQOA 3J7AV 1VQ6A 1I5FA 3M7GA 5ELDA 5CV8A 3VYTA 4DV1L 1LABA 4A3LG 4DV3Q 1AZQA 4XXEA 2Q2IA 4J1MA 4LFCL 1ILQA 2ZT9C 5IGGA 1XMQQ 3JC66 1DOMA 1GVPA 1EQRA 2ZXOA 1E2WA 1NMGA 2JN4A 5FLXE 5LMNW 3LNNA 5M3FH 1PA6A 1SMXA 1FNVA 3FKIB 5EPKA 2K01A 5CORA 2A6ED 2I5LX 3K8AA 3I56A 2UUBL 1EWCA 4FXGC 4UPAA 4C3HG 2AUKA 3TS0A 2X6LA 1B4OA 3C46A 2A5HA 1Y1VG 4H0LC 2LFNA 3CCRA 3P7JA 3OW7A 4WJWA 1CT1D 1SR3A 4DR3L 3RN5A 1EOVA 3BDLA 4CDCC 4N8FA 1F9RA 3DEOA 5D14A 2P5ZX 3OIQA 4O2DA 3S17H 3PIPA 1EU4A 2EPBA 2RDHA 2K52A 4HJAA 3NWSA 5IGCA 3HOWG 1OXSC 1JE4A 4ZQ3A 2D62A 2ASBA 4DR4Q 2JA8B 2HIVA
chains in the Genus database with same CATH topology
1BDOA 4ULLA 2IX0A 2XWBB 2F0KA 1ENAA 1S5DD 3CKIB 1QWYA 2F0DA 2PW7A 1TKWB 4F8MA 4NP5A 5ELBA 1TIID 2FJ2A 2D9UA 3PO2B 1I4HA 1Z6HA 5C44B 2KVMA 3MEHA 5CBAE 5JEAG 4K5XA 1PMRA 1BOSA 3TMEA 2F3WA 2EXZA 4WRDA 1UAPA 5IODA 5I9PA 3H91A 1MBYA 1F2MA 2EY1A 4ZAIA 4ABNA 2X6GA 1I6HB 1HFNA 1SNQA 3SEBA 3OMCA 5ELFA 3SHLA 1G2TA 1EY5A 2PNRC 5TSSA 4EGVA 1DM0B 3MXGA 1HQMC 3J81E 1RKNA 5FO7B 3K57A 1Q3LA 4RGTA 1QCBD 2BCOA 3ND9A 3D8GA 3OMGA 4IUPA 1FD7D 5LHY1 2BDNA 3HG9A 2A6HD 2CW0D 1CHQD 5E4XA 2IL8A 3S15B 1Y8NB 4KJOA 3A8JE 1CFMA 3TP8A 4FYDA 4RAUC 1RCVD 1W6KA 1HPCA 3DM1A 1YNND 1WTRA 4A3EB 1A2TA 1E2ZA 4NDXA 3ZYYX 5KNCA 2F0EA 1SMYD 4K8JA 1O7YA 2NN6I 1EYDA 3S16B 3WOFA 2EJGC 2MJ8A 1NUCA 4KD4A 3M4OB 2F0LA 4RKBA 5M5XB 5JVG3 4ZUIA 1EEFD 3MFYA 3SK5A 3A7LA 2BA1A 1QG7A 1HHVA 4K6LA 1XX8A 1R4PB 3D4DA 2KA7A 3I8ZA 2SNMA 1H9JA 1ZEQX 1QB5D 1C4QA 1GHKA 2Q8RE 4DK1A 2M9VA 4K2LA 5FK9C 3GTGB 2SEBD 2R3ZA 3H09A 2KECA 4QMGA 3DWQA 2O5JC 3R8BA 1GUWA 3EA6A 5EPJA 3C2PA 1A3VA 3KBGA 5EJWA 2WINB 5DM73 1BNZA 1STAA 3MAQA 5C3EB 3HOXB 2MUYA 1BCPD 1Q8IA 4PV1C 5CV7A 2C9OA 1LV9A 3BVZA 1FNUA 3DMUA 1E2VA 3AU7A 1OXXK 2AQ3B 4KD3A 2AUJD 2RKSA 2G9DA 1Q1BA 2KUMA 5KNDA 3OPOA 2KEDA 1L0XB 1VF5C 5CV6A 2BDOA 3PUXA 2F03A 2JYOA 1D2BA 3NUCA 1OXVA 4XQQA 1SDFA 5EKIA 2SDFA 1ICWA 4H7BA 1F9SA 2HDLA 2LY7A 4NMZA 2N55A 3K6OA 4K8IA 4HMJA 5M9OA 1B9MA 1MSGA 4G57A 5BN5A 3H3VC 5CGKA 1STGA 5J39A 3PUVA 3RUZA 4V190 3S2HB 5DEHA 1KDAA 3HOYB 2WP8J 4KKSA 1W6JA 3C3LA 3EJIA 3QIAA 1STYA 1R4QB 1CA6A 5C6AA 5F2DA 3K5OA 3U9SA 4DGZA 1Y1WB 4YIJA 3QJYA 2RDFA 3H0GB 5KYLA 2A68D 5BN4A 1YNJC 2F0TA 3SVMA 3T56B 3RD4A 3UI2A 1LTSD 2F0PA 2A73B 4QUFA 1FNWA 4ID6A 2HCIA 1RODA 1VDZA 5EQ0A 4EVOA 1DD2A 2JXMB 3CHBD 2C5CA 2L12A 4XQNA 5JEAH 2R93B 2IW3A 4KI0A 2ZXPA 3A8IE 4A3FB 4UAIA 4A3DB 2L11A 1EY0A 3LWUA 5K36H 4AYBB 4QB4A 4ZYSA 5T1IA 3PIO3 4KKUA 4C3JG 4IZ8A 3PMFA 2AWOA 1F77A 1D6EC 4LMQD 1A6XA 1FR3A 1EIHA 5IT9L 4DK0A 4FF3A 2J4XA 1V1PA 2RDGA 3WOEA 2NVXB 3OOCA 3GTLB 5I6WA 5C3XA 3TP6A 4GZYC 2XRQD 1BUVT 1VCIA 2NN6G 3L7ZC 3BG3A 1LT3D 2K05A 1S5CD 4HMIA 1I4XA 1NAPA 3BYTB 5HGTA 2R92B 3DWPA 4A93B 4KTAA 4TSSA 1BCPC 1PRTD 4F7XA 1EYAA 1HA6A 3K59A 1B2TA 3N6RA 2F0VA 2QDBA 1JCKB 1KTKA 2SNSA 2KEEA 4IUQA 5M3MB 2EYLA 5CV9A 3MHBA 1KNEA 2B2YC 3SE0A 4DAYA 3GTQB 4IFDI 2AQ2B 1S5FD 4WFN3 1DONA 1A15A 4A3KB 4BWGB 4HTHA 1U4RA 2OXPA 3TDQA 4PMWA 5HURA 3A55A 4FXKC 5ELCA 1EQTA 2L0CA 2PQEA 1RTOA 2HDMA 1VMPA 1F2ZA 3I70A 3KLRA 3GV3A 3SXHA 4XDXA 4H44C 4J8QA 1AP0A 3NQTA 3HP3A 1KLUD 1M4VA 4LAAA 1GJXA 4C1NK 3BZDB 3O13A 1LTRD 1B44D 1D5ZC 5FO9B 2GA4B 4DAVA 1S5BD 4O42A 1JORA 4RFBA 2A68C 3A7AB 1PTOC 2DN8A 2B2WA 3X3NA 1SE3A 1B53A 1V1OA 3I4MB 4RGOS 3NSWA 3KLSX 2B8FA 4LJZC 1JQYD 2TSSA 2B2UA 1WTVA 2TMPA 2WB1B 4K6DA 1JR0D 2F0QA 1LT6D 4MIUA 5C5MA 5FO8B 3VR4A 3MZ5A 2NVTB 1VF7A 4R8NA 3AMUA 2Z4IA 2XN9C 3F2UA 1B3AA 4Q0FA 5G3LF 1KDCA 4BA1I 1EY6A 3VA5A 4ME5A 2L9HA 1RJTA 2K04A 5E1FA 3GV6A 4L8JA 2LKVA 4HAEA 1PZKD 5IGDA 4RCOA 3I3CA 1STHA 3EROA 3LWEA 4C2MB 4FF1A 2IX1A 1HCZA 4UDUC 3KF8A 2O5IC 1TS3A 3SK6A 4RCNA 4O1NA 2DY7A 3HKZB 1BXTA 2Q8IB 3R93A 3I73A 4OL7A 3KK7A 1F2YA 1CZGA 4Z9CB 3S2DB 5LL6X 5C4HA 4RKLA 1PRTC 3MA2B 4BBRB 5JJZA 3ONAB 2DY8A 2BOSA 3HRZC 2B2TA 3HOVB 4FXDA 1LLRD 3C1EA 1I4PA 1RF2D 3TN2A 5M5WB 3NTHA 1PFBA 4HEDA 3IL8A 1JB3A 3C1FA 1TS4A 3HGBA 2OEOA 1H9SB 2ZXRA 2EYMA 4V0BA 3DWAA 5IT9E 4PQXA 1SEBD 5EKKA 1TR5A 2F3VA 2F0UA 1TQOA 2QCPX 1H9KA 3S1MB 2D2CC 4IN3A 4I7ZC 1TY2A 1YNJD 4QCLA 3BVMA 1ILPA 4NW2A 1TS5A 1HUMA 4G4KA 2XRSD 3EVQA 1Q12A 5C4JB 5A2QL 3FDTA 2F0HA 1U9RA 2NN6H 1Q1EA 1SYGA 1EQVA 3KLSA 2JP1A 4KV6A 5C0XI 2RA4A 4RGMA 5C4ZA 3BS1A 1DZ1A 4XYOA 4CGYB 1GUNA 3PIP3 3T4AC 3L9AX 1TT2A 1ESFA 2O2LD 3PO3B 2F0IA 4IURA 4IFDG 4A3JB 2EYHA 1EL0A 4CJ0B 3NBHA 4C1NI 2KQ3A 2X69A 2KCNA 1ET9A 1I50B 1V8QA 1IYUA 2G9HD 4KHZA 3SR1A 1CQFA 1F2LA 2YU9B 2PZUA 2WKDA 1WD1A 1O78A 2IX3A 1H9SA 4RA8A 1X3PA 4RGNA 1QNUA 4TQUS 1D1IA 3ND8A 1EFID 3VA7A 2DNCA 3M3YB 3JAML 2MHVA 2I46A 2E76C 3P20A 3K5MA 4IFDJ 4U68A 3D3RA 1U4PA 3HS0C 4X3KA 2RQXA 1HUNA 1AN8A 2EZVA 3T51B 4BA2I 3FMCA 2EJFC 1CQVA 2BE5C 1GUTA 1K83B 1G291 4QF4A 1SJED 2WIIB 1SE2A 1JOQA 1XXGA 4DFAA 3HOUB 2B63B 1IYVA 1BF4A 5IIFA 4MHEA 2JEBI 2R61A 3T53B 4C3IB 5J22A 3VYSA 1PLFA 5IGFA 4DAPA 3W3AA 1MSHA 5C4XB 1LTAD 2VNUD 1WVLA 5COYA 1PTOH 2AWNA 4RHSA 3NTIA 4CJ1B 5M3FB 5EBCA 1KLGD 2HUGA 1PYWD 4ZRZA 1QOHA 2J7ZA 3K5NA 2L5TA 3I72A 3NXWA 5EBDA 1K8MA 4M1UB 1TS2A 2K33A 4OIKA 4X3UA 2ID0A 1V1PB 2EYFA 1CHPD 4K14A 2V4DA 2VXWA 5I2XA 4G7HC 2FHTA 4I65A 4FO2A 2M2LA 1Z47A 2KJXA 3H6MA 4PMBA 3S17B 1H9MA 1PTOD 2IWHA 2Y0SB 3J7YW 2QKIC 1SAPA 4OHJA 1HRJA 5D65A 3AB9A 1CZWA 2E75C 1ML0D 1JWMD 2PMZB 4XIGS 3E0JA 2CQAA 1WTXA 4DNTB 1JWUD 1A3TA 1PFNA 3TP7A 3DUZA 3GO5A 1OXUA 4L63B 2IJ0A 3M4YA 4K2KA 1EY7A 3U9OA 5IGEA 1Y69U 1X3QA 3NBIA 1HTPA 1F9QA 3DEPA 4HSPA 2FFKB 4IUTA 2PO4A 5AFWA 1H9RA 4IUNA 3HZXA 2L55A 4XT1B 4RWSC 1RTNA 5C0XG 1QJOA 1Y8PB 3IKJA 5C3WA 1PFMA 5A2QE 3MC0B 1NR2A 1ET6A 1LTGD 5I2YA 2A74C 4KMUC 2RSOA 3RZDB 3S14B 5EPLA 1KAAA 1IW7C 2O4XA 4OO1I 2ICEC 4R8IA 1SNOA 1FGBD 1KNAA 3A54A 1HXYD 2Z4HA 2NVYB 4XQJA 3G6JB 5C0XJ 4IFDH 1Q90A 2XNAC 3TSSA 5IGBA 1S5ED 3KUPA 1L0YB 1GUOA 2JA7B 4ZLTF 1JICA 2VB3X 3NQIA 2PPBC 4LK1C 5EGTA 3JAME 1SBBB 4R9WA 2MP1A 2J0TD 1JOOA 4HCEA 2SOBA 1BCPB 1NR4A 2I07B 1TWGB 4FF4A 4F87A 4JK1C 5FOBB 1ENCA 5I9OA 3I91A 2E2JB 4P2CB 3A8KE 4J6HA 1LO5D 1CA5A 3NPPA 5M5YB 1STEA 5LL6S 1XWEA 2RSNA 3D31A 4X3SA 1EIGA 1BQQT 4CHTB 4KHVA 2K5WA 3Q6SA 5I6YA 4DXFA 3QWNA 4N9PA 3RZOB 3CQZB 1SNPA 5NUCA 1DOKA 1O7ZA 3HEJA 3OSOA 3I90A 2EY6A 1ZYRC 4E6IA 4CKEA 1IHZA 2ENBA 2JA6B 1C48A 1DCZA 5I4DA 1TWHB 1WCMB 4M8AA 3GTMB 3FRPB 3LX0A 2QILA 1RD9D 1WTWA 1EOTA 4B08A 2FMMA 1AEXA 2WV6D 1PZID 1PTOB 2F0WA 2K5QA 1EY9A 4B9XA 3NP8A 4IQZA 1S4ZA 3PUWA 4IUVA 2BE5D 4QUCA 2EY5A 5D3IB 1LT4D 3QO2A 1STNA 4C56C 4C3HB 1QE6A 3DXJC 2K03A 2B2YA 1DOLA 1Y1VB 3D4RA 3GD7A 1IKLA 5E4WC 1WTPA 2JSOA 1J9OA 2H1EA 5JAVA 2RBMA 1MD2D 3NK9A 3P75A 3OWEB 1KDBA 4ZUJA 2Q8TA 5DAUA 1HQRD 1SNDA 1F9PA 1LT5D 5JPNC 3HOWB 3M85A 1I4RA 5E3FA 1ENFA 1B1ZA 3MFGA 2F0JA 4HN7A 3VR6A 2NWGA 4WORA 1I6VC 4KKTA 2NTTA 1LTID 3E6ZX 1D5MC 2PW5A 1G2SA 3VYRA 5K5PA 1CI3M 1MGSA 3IFDA 3CU7A 1SYBA 2F0GA 5K36G 3CRKC 4K5WA 1O80A 1QILA 1PXUA 2K1BA 4HSVA 3P1HA 4OO1G 4TKOB 1SYEA 3DHQA 1PRTB 4HCSA 1I4GA 4BY7B 5C0XH 3QOLA 3TP5A 2R7ZB 2PZTA 1CTMA 3TZUA 2F0FA 5JEAJ 4OIJA 1TU2B 3J7AF 3A56A 2A69D 4Q5VA 1XTCD 3X3MA 1I3QB 3MXNA 4CKBA 4EQNA 3V96A 4RH6A 1TWAB 4XT3B 3IFTA 1NCVA 2AQ1B 3RLFA 2NTSA 2JA5B 3V2TA 5FKAC 1C8CA 1SYCA 1JC7A 2NYZD 3MTSA 3R2TA 1D5XC 3J80L 2NBFA 4FF2A 1A3UA 2EE1A 2D5DA 2NUCA 3SK4A 1RDPD 3V05A 4L6TB 2NZ1D 4RHRA 1D1KA 2EY2A 4KK7A 4FVMA 1T5EA 3H94A 2VB2X 3NHHA 2HCCA 4CKCA 3VR3A 1WD0A 2N88A 2FMCA 2KHSA 5BN3A 1CK1A 2A6EC 1IW7D 2F0SA 5DNFA 3NTKA 2PZWA 3M7NA 5A35A 3L3OC 1SFOB 2B8GA 3MXPA 3Q0AA 1PZJD 4C3IG 5CV4A 1UUPA 2OT2A 2EVBA 3BYYB 2E74C 5CC4A 3E5SA 1E0BA 1RHPA 2FINB 1K8OA 3R2IA 2EOTA 1SE4A 1SXTA 3BVGA 4IALA 2Z1CA 2EYJA 1BCPF 3PUZA 5EKLA 2ICIA 5KIXA 1WTQA 3FVQA 4KJNA 5IOCA 1OXTA 2DNEA 1U4LA 4HR7B 1BBXC 3GTOB 2F0NA 1NSNS 2PCFB 3VR2A 3Q23A 2LS01 5DM63 2E2HB 1MI2A 1VMCA 1T5XD 3SK8A 3W2DA 3IAYA 1IKMA 3Q22A 4JBWA 5KRUA 1Y8OB 3NE5B 2HQEA 4OGQC 5FLXL 2K28A 4XYQA 1Z7TA 4DXGA 1EEID 3S1RB 1FYCA 5CR3A 2L4NA 3QB3A 4KN7C 3URYA 3WDNA 3GQBA 3FPUB 3VYUA 4DNRB 5T1GA 2CVRA 1B50A 2L1BA 2B39A 4KY7A 2K7VA 3EFXD 2K5DA 2K6AA 1SYFA 1X32A 1SYDA 2JE6I 2EYOA 4NKLA 1AFPA 3D6CA 3MWYW 1IL8A 1ZXTA 3RMHA 1O7LA 4ZKBB 2YYZA 2B2VC 5JOBA 2E2IB 3BDCA 2H4OA 2LMCB 2A6HC 2CW0C 1ZYRD 2F0MA 1HTLD 1EZ6A 2A69C 1GOZA 4FNFA 3FEWX 1G91A 4N9TA 1EZ8A 4BY1B 1PTOF 1YNNC 1SSOA 4DA2A 1DYQA 1OO9B 4QIWB 4G7ZC 4ZK9B 1DJRD 3OIPA 5JVH3 1EY4A 1PDQA 4K5VA 2RVLA 4PMCA 2MPMA 2E2DC 1SMYC 5KNBA 1GUGA 2WACA 3R3OA 5JPMC 2XVSA 4BBSB 1HA5A 4Y7NB 3HOZB 4ODGA 2QEJC 3KBXA 1J8IA 1JOKA 3ERQA 3D6WA 4A3MB 1DXMA 3TBIB 1G6ZA 1SJHD 2XSCA 2F4IA 1ONLA 4DN4M 1KABA 3TZDA 1BO0A 1LTTD 1UNSA 4C3JB 1TWCB 4A3IB 2WAQB 5KYIA 4OO1H 3J81L 3GTPB 2B2WC 4A3BB 3MXUA 2EYPA 4KN4C 1EU3A 3SDZA 2JEAI 3S1NB 3CRLC 2R6GA 1I4QA 1TY0A 3T13A 2BA0A 2K32A 2B2UC 4CBVA 5C5LA 3OWFA 2XIWA 2MGSA 1QNKA 2KOLA 4X3TA 2F0OA 3PUYA 4CJ2C 5ISRA 5ELEA 3EQLC 4A3GB 3K0YA 2NB0A 1TWFB 1II3A 1B9NA 2WKCA 1LACA 3J80E 3S9WA 3MVVA 1WTOA 5KEEA 2XWJB 3QOJA 4G7OC 1EWHA 3K7AB 1PRTF 3GP7A 2B2VA 1EYCA 1SNMA 5D3DA 1TVXA 1SNCA 2M00A 3PV0A 3FPPA 4MN3A 2VUMB 4DU9A 2CHBD 1R9TB 3K5LA 1CM9A 3VR5A 1AW7A 1XYIA 1AZPA 4BS9A 3D4WA 4KY5A 3S1QB 4DF7A 3G7LA 5CBEE 2EDGA 1HFGA 1V43A 1GUSA 3K58A 3QG1A 1ZKOA 3BDOA 1G8ZD 4S3SA 3NWTA 4B9WA 2QF7A 4PNYA 4XTCS 1BR9A 2EJMA 4TRDA 3I4LA 2PYKA 2OF1A 2F1MA 5CYUA 1A2UA 4ZKCB 2NVQB 5CMDA 4EQPA 2Z8LA 1JWSD 5J1ZA 2B2TC 3Q24A 1UEAB 3OHXC 1LTBD 3ITPA 3GTKB 1GXDC 4F88A 3N52A 1GHJA 4KY6A 3I4NB 1ESRA 1STBA 4ILWA 2IPKD 5KGUA 1EY8A 3T16A 4U673 4FP5D 1M8AA 4IUUA 5CV5A 4H13C 3GTJB 2KCCA 5G3LD 2IT1A 1U4MA 4EQOA 3J7AV 3M7GA 5ELDA 5CV8A 3VYTA 1LABA 1AZQA 4XXEA 4J1MA 1ILQA 2ZT9C 5IGGA 1DOMA 2ZXOA 1E2WA 5FLXE 3LNNA 1FNVA 3FKIB 5EPKA 2K01A 5CORA 2A6ED 1EWCA 4FXGC 4C3HG 2AUKA 2X6LA 1B4OA 3C46A 2A5HA 4H0LC 2LFNA 3P7JA 3OW7A 4WJWA 1CT1D 3BDLA 1F9RA 3DEOA 5D14A 3OIQA 1EU4A 2EPBA 2RDHA 3NWSA 5IGCA 1OXSC 1JE4A 4ZQ3A 2D62A 2JA8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  2ENB A;  4QF4 A;  5K5P A;  5CR3 A;  4EQP A;  2F0K A;  4HTH A;  2F0E A;  5E1F A;  3QB3 A;  1ENA A;  2EYP A;  3NHH A;  1EY0 A;  1JOQ A;  1SYB A;  2F0D A;  2OXP A;  4K8J A;  5J1Z A;  2F0G A;  4DFA A;  2LKV A;  2PW7 A;  5CV6 A;  4F8M A;  4QB4 A;  4K5W A;  1EYD A;  5HUR A;  3NUC A;  3ITP A;  5IGD A;  3T13 A;  3EVQ A;  4NP5 A;  5IGB A;  5IIF A;  4KY7 A;  4KY6 A;  2PQE A;  5C5L A;  2F0H A;  1NUC A;  1U9R A;  3LX0 A;  4KD4 A;  3OWF A;  1SYF A;  1STB A;  1F2Z A;  1EQV A;  1SYG A;  1SYD A;  3PMF A;  4IZ8 A;  2KHS A;  2F0L A;  2EYO A;  4NKL A;  4RKB A;  3SXH A;  5KGU A;  5J22 A;  1STH A;  3D6C A;  1A3T A;  1EY8 A;  2F0O A;  3ERO A;  3MEH A;  4KV6 A;  4H7B A;  3T16 A;  3TP7 A;  1AEX A;  3P1H A;  5ISR A;  4K5X A;  4ZUI A;  5C4Z A;  4NMZ A;  4K8I A;  2F0W A;  5JOB A;  1EY9 A;  3SK5 A;  1TT2 A;  1SYE A;  3DHQ A;  3NP8 A;  3NQT A;  4HMJ A;  5CV5 A;  3TME A;  2F0S A;  4B9X A;  3BDC A;  2F0I A;  2F3W A;  1EY7 A;  2EXZ A;  4K2K A;  5EGT A;  4WRD A;  3U9O A;  4EQO A;  5IGE A;  5M9O A;  2EY5 A;  3QOL A;  4G57 A;  3TP5 A;  5I9P A;  5IOD A;  2PZW A;  1F2M A;  2EYH A;  4LAA A;  1II3 A;  5KRU A;  2F0M A;  5CGK A;  2PZT A;  5CV8 A;  1JOO A;  1STG A;  2EY1 A;  5J39 A;  1EZ6 A;  2F0F A;  2SOB A;  3MXP A;  1STN A;  3RUZ A;  5C3X A;  5I6W A;  5CV4 A;  3SK6 A;  3D4D A;  3TP6 A;  4J1M A;  3S9W A;  5DEH A;  1SNQ A;  2KQ3 A;  2SNM A;  3MVV A;  3OMC A;  3SHL A;  1ENC A;  1KDA A;  5IGG A;  5KEE A;  3QOJ A;  4N9T A;  5I9O A;  1EZ8 A;  5CC4 A;  1EY5 A;  4IUN A;  4K2L A;  3E5S A;  4OL7 A;  3EJI A;  3HZX A;  3SR1 A;  1JOR A;  4J6H A;  1F2Y A;  1STY A;  4HMI A;  1EYC A;  5HGT A;  1SNM A;  1RKN A;  5C4H A;  4RKL A;  5C6A A;  5JAV A;  2RBM A;  1SNC A;  3NK9 A;  2PZU A;  4EQN A;  3P75 A;  5F2D A;  1EY4 A;  2M00 A;  4IAL A;  1KDB A;  4QMG A;  2EYJ A;  4K5V A;  4ZUJ A;  4DGZ A;  4KTA A;  5DAU A;  4DU9 A;  4PMC A;  1SND A;  4YIJ A;  2RDF A;  3D8G A;  3OMG A;  5EKK A;  2WAC A;  5KYL A;  3C1E A;  3NXW A;  3V2T A;  5IGF A;  2F0T A;  3D4W A;  3R3O A;  5EKL A;  4KY5 A;  1A3V A;  5C3W A;  4KHV A;  4DF7 A;  5KIX A;  4F7X A;  4K6D A;  1EYA A;  4KJN A;  5E3F A;  5IOC A;  4ODG A;  2F0P A;  5I6Y A;  1SYC A;  2F0Q A;  1STA A;  2F0J A;  4MIU A;  2F0V A;  2QDB A;  2F0N A;  4KJO A;  5C5M A;  1NSN S;  3BDL A;  3C1F A;  2EYF A;  3MZ5 A;  1JOK A;  3ERQ A;  4K14 A;  3TP8 A;  4S3S A;  4ID6 A;  2SNS A;  4R8N A;  4B9W A;  4N9P A;  5CV7 A;  2OEO A;  4EVO A;  1KAA A;  4I65 A;  4PNY A;  3DMU A;  1SNP A;  2EYM A;  5NUC A;  2O4X A;  3SK8 A;  2EYL A;  4WOR A;  5CV9 A;  5IGC A;  3MHB A;  1A3U A;  3SK4 A;  1TR5 A;  2F3V A;  2F0U A;  1TQO A;  2NUC A;  3H6M A;  3HEJ A;  3OSO A;  2PYK A;  4PMB A;  2OF1 A;  2EY6 A;  4KD3 A;  4ZQ3 A;  1KAB A;  2RKS A;  1KDC A;  2HQE A;  2EY2 A;  4TRD A;  1EY6 A;  1A2U A;  3VA5 A;  2PW5 A;  4ME5 A;  1A2T A;  1SNO A;  4E6I A;  5KYI A;  4NDX A; 
#chains in the Genus database with same CATH topology
 1HH2 P;  1BDO A;  4ULL A;  3MXN B;  2IX0 A;  2XWB B;  3H3V H;  2F0K A;  1Q7Y C;  1ENA A;  1S5D D;  3CKI B;  4GOP A;  1QWY A;  2F0D A;  4B3R Q;  4CDD C;  4OX9 Q;  2PW7 A;  1TKW B;  4F8M A;  5HGQ A;  3ULP A;  4NP5 A;  1RIP A;  1Q81 C;  5ELB A;  1TII D;  2FJ2 A;  3QR8 A;  2D9U A;  3PO2 B;  1I4H A;  3CW2 C;  3H3V I;  1Z6H A;  2FXQ A;  5C44 B;  4JI0 L;  4PZ8 A;  4JOI A;  4JW0 A;  2KVM A;  3MEH A;  5CBA E;  5JEA G;  4K5X A;  4JI2 L;  1D8L A;  4QGU A;  1PMR A;  1BOS A;  4JBM A;  1O7I A;  3TME A;  1HZA A;  2F3W A;  2EXZ A;  4R4O A;  4WRD A;  1UAP A;  4DV7 Q;  5IOD A;  5I9P A;  3H91 A;  1MBY A;  1F2M A;  2C35 B;  2EY1 A;  4ZAI A;  3I7F A;  4ABN A;  2X6G A;  1I6H B;  1HFN A;  1SNQ A;  1KAW A;  3SEB A;  3OMC A;  5ELF A;  3SHL A;  4X64 Q;  1G2T A;  1EY5 A;  2PNR C;  5TSS A;  4EGV A;  2AMC B;  1PH6 A;  1DM0 B;  3MXG A;  4OON A;  4BY7 G;  1HQM C;  3J81 E;  1RKN A;  5FO7 B;  3K57 A;  1Q3L A;  4RGT A;  2R7Z G;  4BXX H;  1QCB D;  2BCO A;  4JI5 Q;  3ND9 A;  3D8G A;  3OMG A;  4IUP A;  1FD7 D;  5LHY 1;  2BDN A;  3HG9 A;  1EIY B;  5E7N A;  4X66 Q;  2ZTC A;  5J3B A;  2A6H D;  2CW0 D;  1CHQ D;  5E4X A;  3RZD H;  3S14 H;  2IL8 A;  2MO0 A;  4UP9 A;  1Y8N B;  1QZH A;  4KJO A;  3A8J E;  3S15 B;  1CFM A;  3TP8 A;  2PNH A;  4FYD A;  3E9I A;  4RAU C;  1RCV D;  1W6K A;  1IBM Q;  1HPC A;  2JA5 G;  3DM1 A;  1YNN D;  1WTR A;  4LUV A;  4LF6 Q;  4B3T L;  4A3E B;  1A2T A;  2NVY H;  3F2D A;  1E2Z A;  4NDX A;  3ZYY X;  1Q82 C;  1PYB A;  5KNC A;  2F0E A;  4WJ4 A;  1SMY D;  5JJL A;  4K8J A;  1O7Y A;  2NN6 I;  2R7F A;  1ASY A;  1EYD A;  1N32 L;  3S16 B;  3SGI A;  5IY0 A;  3WOF A;  2EJG C;  4LFA L;  2MJ8 A;  2JA7 H;  1NUC A;  4KD4 A;  1B7Y B;  3M4O B;  2F0L A;  4RKB A;  1LYL A;  2QGQ A;  5M5X B;  5JVG 3;  4ZUI A;  3CCM A;  1EEF D;  3MFY A;  4GKJ L;  3SK5 A;  5JJK A;  3A7L A;  3BU2 A;  1XNQ L;  2BA1 A;  1J5E Q;  1QG7 A;  4DUY L;  1TWG H;  2GN5 A;  3CCL A;  1HHV A;  4K6L A;  1XX8 A;  1R4P B;  3D4D A;  2E2J H;  2KA7 A;  3I8Z A;  3OTO L;  2SNM A;  4IPH A;  4UHV A;  1H9J A;  1ZEQ X;  1QB5 D;  4LFB Q;  1C4Q A;  4YWM A;  1GHK A;  1SE8 A;  1B8A A;  2Q8R E;  2M9V A;  4DK1 A;  3UE0 A;  4K2L A;  1EFW A;  5FK9 C;  5M5Y H;  4YY3 L;  4AYB E;  3GTG B;  4LF5 L;  2SEB D;  2R3Z A;  3H09 A;  2KEC A;  3B6Y A;  1CUK A;  3DLL A;  4QMG A;  2ALY B;  2RCF A;  3DWQ A;  5IP9 H;  1HNW L;  2O5J C;  3R8B A;  3BJU A;  1GUW A;  2WAQ E;  3EA6 A;  5EPJ A;  4WJ3 M;  3C2P A;  3CCE A;  1A3V A;  2ZTD A;  3KBG A;  5EJW A;  2WIN B;  5DM7 3;  1E1O A;  1BNZ A;  5EAY A;  1STA A;  3RZO H;  3MAQ A;  3M4Q A;  5C3E B;  4YCU A;  3HOX B;  3CQZ H;  2MUY A;  1BCP D;  1Q8I A;  4PV1 C;  5CV7 A;  2C9O A;  1LV9 A;  3BVZ A;  1FNU A;  3DMU A;  1E2V A;  1CKN B;  3AU7 A;  4A3C H;  1IXR A;  1OXX K;  2AQ3 B;  2MFI A;  4KD3 A;  2CCZ A;  2AUJ D;  1U0L A;  2RKS A;  2G9D A;  1Q1B A;  2JA6 H;  2KUM A;  5KND A;  4A75 A;  1TWH H;  3OPO A;  4DPG A;  1WCM H;  2I0Q A;  3GTM H;  2KED A;  2ZJP A;  1L0X B;  1VF5 C;  5CV6 A;  2BDO A;  4DR2 L;  1X56 A;  3PUX A;  2F03 A;  2JYO A;  1D2B A;  3NUC A;  1L1O C;  1OXV A;  4JI8 Q;  4XQQ A;  4A3L H;  1WOC A;  1SDF A;  3KYH C;  5EKI A;  3GDE A;  2SDF A;  1ICW A;  4NXN L;  4H7B A;  1F9S A;  2HDL A;  2LY7 A;  4NMZ A;  2N55 A;  3U50 C;  3K6O A;  4K8I A;  3J81 j;  1NNX A;  4HMJ A;  5M9O A;  1B9M A;  1MSG A;  4G57 A;  5BN5 A;  3H3V C;  4C3H H;  1I94 L;  5CGK A;  1STG A;  5J39 A;  1V1Q A;  3PUV A;  1Y1V H;  3RUZ A;  4V19 0;  3S2H B;  5DEH A;  1KDA A;  1V9P A;  3HOY B;  2WP8 J;  4KKS A;  1W6J A;  3C3L A;  1K3R A;  3EJI A;  3QIA A;  1STY A;  1R4Q B;  1CA6 A;  5C6A A;  1L0W A;  5IYB G;  1K3B C;  1X55 A;  5F2D A;  3K5O A;  3U9S A;  3STB C;  4DGZ A;  1Y1W B;  3HOW H;  2CH4 W;  3KF6 A;  4YIJ A;  3QJY A;  2RDF A;  3H0G B;  1HR0 L;  5KYL A;  2A68 D;  5BN4 A;  1YNJ C;  2F0T A;  4J15 A;  3SVM A;  4BY1 G;  4DR5 L;  2Z9H A;  3T56 B;  3RD4 A;  3UI2 A;  1LTS D;  2F0P A;  2A73 B;  3ICE A;  4QUF A;  1FNW A;  3HKS A;  4ID6 A;  2HCI A;  1ROD A;  4DR1 L;  3CC2 A;  3BZC A;  1VDZ A;  5EQ0 A;  4EVO A;  1KRS A;  1DD2 A;  3S24 A;  3PSI A;  2JXM B;  4BBS G;  3CHB D;  2C5C A;  4DV2 L;  3HOZ G;  4PG3 A;  2L12 A;  4XQN A;  4P74 A;  5JEA H;  2R93 B;  2IW3 A;  4KI0 A;  2ZXP A;  3A8I E;  4A3F B;  4UAI A;  2VQF L;  4A3D B;  4A3M G;  1VQE A;  2L11 A;  1EY0 A;  3LWU A;  4A76 A;  5K36 H;  3M4P A;  4AYB B;  4QB4 A;  4L5Q A;  4ZYS A;  1JT8 A;  4DAY B;  1NMF A;  5T1I A;  4B3M Q;  3PIO 3;  1YIT A;  3WWV A;  4KKU A;  4C3J G;  4A3I G;  2WAQ G;  1SLJ A;  4IZ8 A;  3PMF A;  2AWO A;  1YVC A;  1F77 A;  4A3B G;  1D6E C;  4LMQ D;  5IWA Q;  1A6X A;  1FR3 A;  2R7Z H;  1EIH A;  5IT9 L;  4DK0 A;  4FF3 A;  2JA9 A;  3KDF B;  2J4X A;  1V1P A;  3AQQ A;  2RDG A;  3WOE A;  2NVX B;  3OOC A;  3GTL B;  5I6W A;  5C3X A;  1L1O A;  2RHS B;  3TP6 A;  2IHE A;  4EX5 A;  4GZY C;  2XRQ D;  4JI4 L;  1BUV T;  1C9O A;  1VCI A;  2NN6 G;  3W1B A;  3L7Z C;  1EIF A;  1I3Q H;  3BG3 A;  1LT3 D;  2K05 A;  1S5C D;  4HMI A;  1I4X A;  1NAP A;  4A3G G;  4MZ9 A;  3J7Z C;  3BYT B;  5HGT A;  4IPC A;  1TWA H;  2R92 B;  3DWP A;  2JA5 H;  4JI7 Q;  4A93 B;  4KTA A;  1VS0 A;  4X62 L;  4TSS A;  1BCP C;  1VQC A;  1PRT D;  4F7X A;  1EYA A;  1HA6 A;  5GAD C;  3K59 A;  4GNX C;  1B2T A;  3N6R A;  2F0V A;  2QDB A;  3CCU A;  1JCK B;  2YTX A;  1KTK A;  2SNS A;  4AQY Q;  2KEE A;  2VUM G;  1A0I A;  4IUQ A;  5M3M B;  3I4O A;  1XMO L;  3U4Z A;  2EYL A;  5CV9 A;  1S40 A;  3MHB A;  1KNE A;  3HKZ E;  1B70 B;  2B2Y C;  1YJ9 A;  3SE0 A;  1IBL Q;  3RN2 A;  4DAY A;  4GS3 A;  3BZK A;  3L2P A;  3GTQ B;  4IFD I;  2AQ2 B;  1S5F D;  4DV6 Q;  3CC4 A;  4WFN 3;  4JI3 Q;  1A15 A;  4A3K B;  1XPO A;  4BWG B;  1DON A;  2UUA Q;  4HTH A;  1U4R A;  2OXP A;  3TDQ A;  4PMW A;  5HUR A;  3A55 A;  4UY8 C;  4DR7 L;  4FXK C;  5ELC A;  1EQT A;  1YEZ A;  2L0C A;  4OWX B;  1K28 A;  2PQE A;  1RTO A;  4ME3 A;  2HDM A;  1VMP A;  1X3G A;  1F2Z A;  3I70 A;  3KLR A;  5FLM G;  3GV3 A;  3SXH A;  2OQK A;  4XDX A;  1JE5 A;  1N34 L;  4H44 C;  4J8Q A;  2VW9 A;  1AP0 A;  5GRO A;  3H15 A;  1JJC B;  2VL6 A;  3NQT A;  3CF5 A;  2Z0S A;  3HP3 A;  1KLU D;  1UE1 A;  1PV4 A;  1M4V A;  4LAA A;  2UUC Q;  5IT9 c;  1GJX A;  2L15 A;  4C1N K;  2BH8 A;  3I4N G;  3BZD B;  3O13 A;  1LTR D;  1B44 D;  2NZH A;  1D5Z C;  5FO9 B;  2GA4 B;  4GOP B;  4DAV A;  4HIM A;  1S5B D;  4O42 A;  1JOR A;  4RFB A;  2A68 C;  3A7A B;  1PTO C;  2DN8 A;  2LXJ A;  2B2W A;  3X3N A;  1JJ2 A;  4KHP Q;  1SE3 A;  1B53 A;  1SN8 A;  1V1O A;  3W1G A;  3I4M B;  4JCV E;  4DV4 Q;  4RGO S;  3NSW A;  3KLS X;  2B8F A;  4LJZ C;  1JQY D;  2TSS A;  2B2U A;  1WTV A;  2CWA A;  2TMP A;  2WB1 B;  3GTO H;  1XJV A;  4K6D A;  3T1Y Q;  1CKM A;  1JB7 A;  1JR0 D;  1X54 A;  2F0Q A;  1LT6 D;  4MIU A;  3FKI G;  5C5M A;  5FO8 B;  3VR4 A;  2E2H H;  3MZ5 A;  2NVT B;  2KEN A;  2QEX A;  1VF7 A;  4R8N A;  3AMU A;  2Z4I A;  2XN9 C;  1VQ9 A;  3F2U A;  1B3A A;  4Q0F A;  5G3L F;  4DV0 L;  3AYH B;  4R4T A;  3S1R H;  1KDC A;  4BA1 I;  1EY6 A;  3VA5 A;  4ME5 A;  2UXC L;  1N36 Q;  2L9H A;  4B3S Q;  1RJT A;  2K04 A;  3F8T A;  5E1F A;  2UU9 Q;  3GV6 A;  2K4K A;  4L8J A;  2LKV A;  5BR8 Q;  4HAE A;  4DV5 Q;  4APV A;  1PZK D;  4X65 Q;  5IGD A;  4DR6 L;  2JA8 G;  4RCO A;  1HNZ L;  4K0K L;  1PH4 A;  3I3C A;  1STH A;  3K0X A;  3ERO A;  3I55 A;  2E2I H;  3OW2 A;  3K81 C;  3LWE A;  4C2M B;  1QZG A;  3ZJY C;  2CWP A;  4FF1 A;  2IX1 A;  1HCZ A;  5LMU Q;  2JQO A;  2D0O A;  5IYB H;  4DV3 L;  2K14 A;  4UDU C;  1PH5 A;  3KF8 A;  2B3G A;  2O5I C;  4IO9 A;  1XMQ L;  1TS3 A;  3A5U A;  3PO2 G;  5C44 G;  3SK6 A;  4RCN A;  2HHH L;  1XPR A;  1FL0 A;  4BY1 H;  1WJJ A;  4O1N A;  3CXC A;  2DY7 A;  3HKZ B;  3KLW A;  1BXT A;  2Q8I B;  1PHJ A;  3R93 A;  3I73 A;  4OL7 A;  3KK7 A;  2F4V Q;  1F2Y A;  1CZG A;  4Z9C B;  4EQ5 A;  3S2D B;  2AKW B;  5LL6 X;  5C4H A;  4RKL A;  3F2B A;  1PRT C;  3MA2 B;  4BBR B;  4LUO A;  5JJZ A;  3ONA B;  2DY8 A;  4GKK Q;  2BOS A;  3HRZ C;  2B2T A;  1HNX Q;  1HR0 W;  4BBS H;  2PI2 A;  3HOV B;  2DJF C;  4Y7N H;  4FXD A;  1LLR D;  3HOZ H;  3C1E A;  2KCT A;  1I4P A;  5GAE C;  1RF2 D;  3TN2 A;  5M5W B;  3NTH A;  3KJO A;  3IRB A;  1PFB A;  4JYA Q;  4HED A;  4A3M H;  3IL8 A;  1JB3 A;  3C1F A;  1TS4 A;  4TVA B;  4DNI A;  1X3F A;  3HGB A;  2OEO A;  1H9S B;  1LTL A;  2XGT A;  2ZXR A;  2EYM A;  4V0B A;  4DR4 L;  3DWA A;  5IT9 E;  4PQX A;  3T1H Q;  1SEB D;  1TR5 A;  2F3V A;  2F0U A;  1TQO A;  2IHF A;  5EKK A;  1TWC H;  4C3J H;  4A3I H;  2QCP X;  3RLN A;  4LF9 Q;  1H9K A;  3GTP H;  3S1M B;  2D2C C;  4A3B H;  4IN3 A;  4B3R L;  4OX9 L;  3STB D;  3A0J A;  4I7Z C;  1TY2 A;  3S1N H;  2OWO A;  4R4I A;  5GAH C;  3FHW A;  1YNJ D;  3K80 C;  1MJC A;  4QCL A;  3BVM A;  1NJI C;  3L0O A;  1ILP A;  4NW2 A;  1TS5 A;  1HUM A;  5DLQ E;  4G4K A;  2XRS D;  3EVQ A;  1Q12 A;  5C4J B;  5A2Q L;  3FDT A;  2F0H A;  4A3E G;  1U9R A;  1JMC A;  1N33 Q;  2NN6 H;  1Q1E A;  1SYG A;  1EQV A;  2KBN A;  1YHA A;  4IOC A;  3KLS A;  4A4I A;  2JP1 A;  1CSQ A;  1VQF A;  4KV6 A;  4DV7 L;  5C0X I;  2RA4 A;  4RGM A;  5C4Z A;  3BS1 A;  1DZ1 A;  5IYC G;  4XYO A;  4CGY B;  1GUN A;  4A3G H;  3PIP 3;  1X9N A;  3T4A C;  1RL2 A;  3L9A X;  2K5N A;  1TT2 A;  1TWF H;  4DKA C;  1ESF A;  2O2L D;  3PO3 B;  2I5M X;  2F0I A;  4IUR A;  1EYG A;  4IFD G;  4A3J B;  2EYH A;  1K8G A;  1FJG Q;  1EL0 A;  4X64 L;  4CDE C;  4CJ0 B;  4ALP A;  5IP7 G;  2Z6K C;  4JVZ A;  1CKO A;  3NBH A;  4C1N I;  2KQ3 A;  3K7A H;  4LF7 Q;  4GN5 A;  1PYS B;  2X69 A;  2KCN A;  1ET9 A;  4UP8 A;  1I50 B;  1V8Q A;  2RCN A;  1X6O A;  1IYU A;  1T9H A;  2G9H D;  4KHZ A;  3SR1 A;  3EN2 A;  4JI5 L;  4DK3 C;  1CQF A;  2VUM H;  1F2L A;  2YU9 B;  1XTD A;  2PMZ E;  2PZU A;  4R4C A;  2WKD A;  1R9T H;  1WD1 A;  4X66 L;  4YWL A;  1O78 A;  2IX3 A;  5LMN Q;  2VZA A;  2EXD A;  3S1Q H;  1H9S A;  4RA8 A;  1X3P A;  4RGN A;  1QNU A;  2DJG C;  4TQU S;  4HID A;  1M90 C;  1YZ6 A;  1D1I A;  1ICF B;  3ND8 A;  1EFI D;  3VA7 A;  2DNC A;  3M3Y B;  3D0F A;  3JAM L;  2IY5 B;  2MHV A;  2I46 A;  1P8L A;  1MHW C;  1IBM L;  2E76 C;  3P20 A;  3K5M A;  4IFD J;  4U68 A;  3D3R A;  1MJE A;  1XNR Q;  1U4P A;  3HS0 C;  4X3K A;  4LF6 L;  1SRU A;  4MNO A;  2RQX A;  2A1A A;  1HUN A;  1AN8 A;  2EZV A;  3T51 B;  4BA2 I;  3CPF A;  2MNA A;  3FMC A;  2EJF C;  2NVQ H;  5FLM H;  1CQV A;  1TXY A;  2BE5 C;  1GUT A;  1K83 B;  1G29 1;  5C3E G;  3Q8D A;  4QF4 A;  3HOX G;  1SJE D;  2WII B;  1SE2 A;  3GTK H;  3KF6 B;  1JOQ A;  1XXG A;  4DFA A;  3HOU B;  2H5X A;  2B63 B;  3E9H A;  1IYV A;  4O0A A;  4JI1 Q;  3I4N H;  1BF4 A;  5IIF A;  1IZ6 A;  3PF4 A;  4MHE A;  2JEB I;  3PCO B;  4DUZ Q;  2R61 A;  3T53 B;  4C3I B;  5J22 A;  1A63 A;  4R4Q A;  1HZC A;  3VYS A;  1IBK Q;  1J5E L;  3GTJ H;  1PLF A;  2UXD Q;  5IGF A;  4DAP A;  3HFZ B;  3W3A A;  4JBK A;  1MSH A;  5C4X B;  1LTA D;  4LFB L;  2VNU D;  4OXP A;  1WVL A;  1A8V A;  2ATW A;  3UDG A;  2XTI A;  5COY A;  1PTO H;  2AWN A;  3PIO A;  3FKI H;  4RHS A;  4LW1 A;  3NTI A;  1QVF A;  4CJ1 B;  1XPU A;  5M3F B;  5EBC A;  1KLG D;  2HUG A;  1PYW D;  3PGZ A;  4ZRZ A;  1QOH A;  1A62 A;  2J7Z A;  3K5N A;  2L5T A;  3I72 A;  3NXW A;  3FP9 A;  5EBD A;  1K8M A;  3HOY G;  1Y14 B;  4JC0 A;  3ERS X;  4M1U B;  1TS2 A;  2K33 A;  4OIK A;  3CCQ A;  4X3U A;  1AE2 A;  1FVI A;  2ID0 A;  4RG1 A;  1V1P B;  2EYF A;  3JAM c;  1CHP D;  1GKH A;  4K14 A;  2V4D A;  4JI6 Q;  2VXW A;  1Y1W G;  3M9B A;  5I2X A;  2FHT A;  1L1O B;  1K0R A;  4I65 A;  4G7H C;  3H0G G;  4FO2 A;  2ZM6 Q;  2M2L A;  4JG2 A;  1Z47 A;  2GVA A;  2KJX A;  3H6M A;  4PMB A;  3S17 B;  3CCS A;  2JA8 H;  1H9M A;  3KFU A;  2Q2T A;  1PTO D;  2IWH A;  2Y0S B;  3J7Y W;  2QKI C;  1SAP A;  4OHJ A;  1HRJ A;  4KLK A;  5D65 A;  2MO1 A;  1KQS A;  3AB9 A;  1CZW A;  2E75 C;  3VDY A;  1ML0 D;  1Z9F A;  1PH1 A;  1VQA A;  1YHQ A;  4L5T A;  1YJW A;  2CFM A;  3UDF A;  3PO2 H;  1JWM D;  4NPS A;  2PMZ B;  4DK6 C;  4XIG S;  5C44 H;  4DAM A;  3E0J A;  1YNX A;  2CQA A;  4YHH Q;  2R93 G;  1WTX A;  1Q86 C;  2A8V A;  4DNT B;  1JWU D;  4CDF C;  2E5L Q;  3G48 A;  1A3T A;  4A3F G;  4LF4 Q;  1PFN A;  1K73 C;  3TP7 A;  4A3D G;  3DUZ A;  3GO5 A;  2V1C C;  1OXU A;  1SRO A;  4L63 B;  2IJ0 A;  4AYB G;  1VQO A;  3M4Y A;  4K2K A;  1EY7 A;  3U9O A;  5IGE A;  1IYJ B;  1EUJ A;  1Y69 U;  1I6H H;  4NXM Q;  1X3Q A;  3NBI A;  3W5O A;  1HTP A;  2WB1 E;  1E22 A;  3UDX A;  1F9Q A;  3DEP A;  3AFQ A;  3AFP A;  4HSP A;  2FFK B;  4IUT A;  2PO4 A;  5AFW A;  1N9W A;  1H9R A;  4IUN A;  3HZX A;  4PZ6 A;  2L55 A;  2PI2 E;  2KHJ A;  3J7A 5;  5HY6 A;  1YI2 A;  4BY7 H;  1X3E A;  2OCE A;  2NZO A;  4XT1 B;  1KL9 A;  4RWS C;  1RTN A;  5C0X G;  1QJO A;  4I7A A;  1PH3 A;  4JV5 Q;  1Y8P B;  4R1J A;  3ULJ A;  4L5S A;  3IKJ A;  5C3W A;  3S15 H;  1PFM A;  5A2Q E;  3MC0 B;  1NR2 A;  1ET6 A;  1LTG D;  5I2Y A;  2A74 C;  2R92 G;  3ULL A;  4KMU C;  2RSO A;  2EQS A;  2UXB Q;  3RZD B;  3S14 B;  5EPL A;  1KAA A;  4A93 G;  1IW7 C;  2VQE Q;  3ER0 A;  2O4X A;  4OO1 I;  4GN4 B;  4HIK A;  2ICE C;  4YCV A;  4A3E H;  4R8I A;  1K0S A;  1SNO A;  3TRE A;  2QDL A;  1FGB D;  1KNA A;  3A54 A;  4HJ7 A;  1HXY D;  2Z4H A;  2NVY B;  4B3M L;  3UE1 A;  4XQJ A;  3G6J B;  3S16 H;  5M3M G;  5C0X J;  4IFD H;  1Q90 A;  1YBY A;  2QA4 A;  2XNA C;  3TSS A;  5IP7 H;  5IGB A;  1S5E D;  3M4O H;  3KUP A;  1L0Y B;  2PQA A;  4RMF A;  3U58 A;  1GD7 A;  1GO3 E;  5IWA L;  5M5X H;  4A3K G;  1GUO A;  5IYD G;  2JA7 B;  4ZLT F;  1JIC A;  4LF8 Q;  2VB3 X;  3NQI A;  2PPB C;  4LK1 C;  5EGT A;  3JAM E;  1BVS A;  1SBB B;  3PF5 A;  4R9W A;  2JJQ A;  5AJ3 Q;  2MP1 A;  2J0T D;  1JOO A;  4HCE A;  2SOB A;  1BCP B;  1NR4 A;  2G5D A;  2I07 B;  1TWG B;  4FF4 A;  4F87 A;  4JK1 C;  5FOB B;  1ENC A;  2ZTE A;  3GTG H;  5I9O A;  1VQ5 A;  3I91 A;  4DV1 Q;  2E2J B;  4P2C B;  3A8K E;  4JI7 L;  4LFC Q;  4J6H A;  1LO5 D;  1BBU A;  2K5V A;  1CA5 A;  2CQO A;  3NPP A;  5M5Y B;  2Z6B A;  1LUZ A;  1STE A;  4ZCK A;  1SFO H;  5LL6 S;  1XWE A;  2RSN A;  3D31 A;  4LWC A;  4JOI C;  1UWV A;  4X3S A;  1EIG A;  1BQQ T;  4CHT B;  4KHV A;  2UUB Q;  5C3E H;  4AQY L;  3HOX H;  2K5W A;  3Q6S A;  1HZ9 A;  5I6Y A;  3KF8 B;  2ZJQ A;  4DXF A;  1WYD A;  3QWN A;  4N9P A;  3RZO B;  3EIV A;  1IBL L;  3I4M G;  3CQZ B;  1SNP A;  4DR3 Q;  5NUC A;  1DOK A;  1QUQ A;  4DV6 L;  1O7Z A;  4JI3 L;  3HEJ A;  3OSO A;  2UUA L;  3I90 A;  2EY6 A;  2WB1 G;  4GLX A;  4GLV B;  4P75 A;  1ZYR C;  4E6I A;  4CKE A;  1IHZ A;  2ENB A;  2JA6 B;  1C48 A;  1E3P A;  1DCZ A;  5I4D A;  4GN3 B;  4LUZ A;  1TWH B;  3JAM i;  3CD6 A;  1WCM B;  2YTV A;  4M8A A;  4QJF A;  3GTM B;  2OTL A;  4OWT B;  3FRP B;  3LX0 A;  1W2B A;  2QIL A;  4NB3 A;  1RD9 D;  1WTW A;  1QVG A;  1EOT A;  4B08 A;  5L37 A;  2FMM A;  1AEX A;  2WV6 D;  1PZI D;  2HHH Q;  2UUC L;  1PTO B;  2F0W A;  2K5Q A;  1EY9 A;  4B9X A;  4GNX A;  4JI0 Q;  3NP8 A;  4IQZ A;  1S4Z A;  3F1Z A;  3PUW A;  4IUV A;  2BE5 D;  4QUC A;  4IJL A;  2EY5 A;  4JI2 Q;  3S2H H;  1VQI A;  1LT4 D;  3QO2 A;  5D3I B;  2ZJR A;  1STN A;  4C56 C;  2N8N A;  3HOY H;  4C3H B;  1QE6 A;  3DXJ C;  4HJ8 A;  2F3I A;  2K03 A;  1BKB A;  1S3O A;  2B2Y A;  1DOL A;  1Y1V B;  1WTH A;  1EQQ A;  3D4R A;  3GD7 A;  4KHP L;  4GLA C;  1IKL A;  5E4W C;  1WTP A;  4P73 A;  2JSO A;  2DGY A;  2D0P A;  4DV4 L;  1J9O A;  2HT1 A;  2K75 A;  3NEL A;  1Y1W H;  2H1E A;  5JAV A;  2RBM A;  1MD2 D;  3H0G H;  3NK9 A;  1VQP A;  3P75 A;  3OWE B;  1PVO A;  1KDB A;  4ZUJ A;  2HQL A;  2Q8T A;  5DAU A;  1HQR D;  1G51 A;  1F9P A;  1SND A;  3T1Y L;  1LT5 D;  1PFS A;  3CAM A;  5JPN C;  2N49 A;  3HKZ G;  3HOW B;  3M85 A;  2YV5 A;  4IPD A;  1I4R A;  5E3F A;  1ENF A;  2MQH A;  1B1Z A;  1UE7 A;  3MFG A;  1VQB A;  1UE6 A;  2F0J A;  4BBR G;  4HN7 A;  2YTY A;  3VR6 A;  2RF4 A;  1N8R C;  3NBH B;  3HOV G;  3OYY A;  2NWG A;  2VS1 A;  1I6V C;  4WOR A;  4KKT A;  5FJ8 G;  3RNU A;  1N36 L;  2NTT A;  4B3S L;  2R93 H;  1LTI D;  3E6Z X;  4A3F H;  1D5M C;  2PW5 A;  4A3D H;  2UU9 L;  1G2S A;  3VYR A;  3KJP A;  2B29 A;  5BR8 L;  4DV5 L;  1KD1 C;  1YIJ A;  3PQI A;  5K5P A;  1IL2 A;  4X65 L;  1CI3 M;  1HJP A;  1MGS A;  3IFD A;  4B3T Q;  3CU7 A;  1SYB A;  2F0G A;  5K36 G;  3CRK C;  4K5W A;  1E7Z A;  2JK8 A;  1O80 A;  1QIL A;  1C0A A;  3AEV A;  1PXU A;  1N32 Q;  5LMU L;  2K1B A;  4HSV A;  3P1H A;  3F2C A;  4OO1 G;  4LFA Q;  4TKO B;  1SYE A;  3DHQ A;  1PRT B;  2F52 A;  1NE3 A;  4HCS A;  2NVX H;  1I4G A;  4BY7 B;  3GTL H;  5C0X H;  3QOL A;  3TP5 A;  2R7Z B;  2PZT A;  1K8A C;  4GKJ Q;  1CTM A;  3TZU A;  2F0F A;  1XNQ Q;  5ELN A;  2F4V L;  5JEA J;  4OIJ A;  1MIU A;  4PZ7 A;  3CCJ A;  4DUY Q;  1TU2 B;  1Q46 A;  3J7A F;  4GKK L;  3A56 A;  2R92 H;  3PO3 G;  2A69 D;  4Q5V A;  3OTO Q;  1HNX L;  1AH9 A;  1XTC D;  3X3M A;  1I3Q B;  4A3J G;  4A93 H;  3MXN A;  4CKB A;  4EQN A;  4YY3 Q;  3V96 A;  1E24 A;  4RH6 A;  1TWA B;  4XT3 B;  4FDB A;  3IFT A;  4LF5 Q;  1NCV A;  2Y0S E;  4JYA L;  2AQ1 B;  3RLF A;  4OEM B;  2NTS A;  2JA5 B;  3V2T A;  4HJ9 A;  5FKA C;  3RLO A;  1C8C A;  1BBW A;  1HNW Q;  1SYC A;  1NY4 A;  1JC7 A;  5M3M H;  3T1H L;  4L5R C;  2NYZ D;  3MTS A;  4MTN A;  4OEL B;  4LF9 L;  3R2T A;  4P72 A;  1D5X C;  3E0E A;  3J80 L;  2NBF A;  4FF2 A;  1A3U A;  2EE1 A;  2D5D A;  2NUC A;  3SK4 A;  3GTQ H;  1RDP D;  3V05 A;  4HJ5 A;  4L6T B;  2NZ1 D;  2AHO B;  4RHR A;  1D1K A;  2EY2 A;  4A3K H;  1KIX A;  3G4S A;  4KK7 A;  4JBJ A;  3G6E A;  5IYD H;  1X65 A;  4HIO A;  4FVM A;  1VQ8 A;  1T5E A;  3U4V A;  3H94 A;  4QIW E;  2VB2 X;  3NHH A;  3J81 i;  1VQK A;  1N33 L;  2HCC A;  3A5Z B;  4CKC A;  3VR3 A;  2BH2 A;  1WD0 A;  1HZB A;  2N88 A;  2FMC A;  3K7U C;  1WFQ A;  4DR2 Q;  2KHS A;  5BN3 A;  1CK1 A;  2A6E C;  2LSS A;  2K5H A;  3TQY A;  1IW7 D;  2N3S A;  1FJG L;  3HOU G;  4YCW A;  2B63 G;  2F0S A;  5DNF A;  4NXN Q;  2ES2 A;  1Q8K A;  3NTK A;  1U5K A;  2PZW A;  3DM3 A;  5A35 A;  4LF7 L;  3M7N A;  3L3O C;  4IJH A;  1SFO B;  2B8G A;  3MXP A;  3Q0A A;  1PZJ D;  4C3I G;  5CV4 A;  5GQO A;  3MEF A;  1LM0 A;  3LGJ A;  3CMA A;  1UUP A;  2OT2 A;  3UDI A;  1I94 Q;  2EVB A;  3BYY B;  2E74 C;  4QQB X;  5CC4 A;  2KCM A;  2R7D A;  3NEN A;  3E5S A;  3E3X A;  1E0B A;  1RHP A;  2FIN B;  1K8O A;  2QW7 A;  3R2I A;  5LMN L;  3I4M H;  5C4X G;  2EOT A;  1SE4 A;  1SXT A;  3I2Z A;  1VQG A;  3BVG A;  4IAL A;  2Z1C A;  2EYJ A;  5GAG C;  1BCP F;  1YHB A;  3PUZ A;  5EKL A;  2ICI A;  2Q2U A;  5KIX A;  1WTQ A;  2VY3 A;  3FVQ A;  4KJN A;  5IOC A;  1XNR L;  2NVT H;  1OXT A;  1VQD A;  2DNE A;  1U4L A;  4HR7 B;  1HR0 Q;  1BBX C;  3GTO B;  2F0N A;  4N8X 1;  1NSN S;  4DR5 Q;  2PCF B;  3VR2 A;  5M3F G;  2KHI A;  3Q23 A;  2LS0 1;  5DM6 3;  1C7Y A;  2E2H B;  1E1T A;  1MI2 A;  1VMC A;  1T5X D;  1L2F A;  3SK8 A;  3W2D A;  3J80 c;  3IAY A;  1IKM A;  3Q22 A;  4JBW A;  5KRU A;  1Y8O B;  1OTC A;  4DR1 Q;  3NE5 B;  1VQL A;  3TRZ A;  2HQE A;  4OGQ C;  3CP0 A;  1J6Q A;  2Z6K A;  2HIX A;  5FLX L;  2K28 A;  4XYQ A;  1Z7T A;  4DXG A;  1EEI D;  3S1R B;  1PH9 A;  1FYC A;  5CR3 A;  2L4N A;  4JI1 L;  4JPB W;  3CME A;  3QB3 A;  4DV2 Q;  4KN7 C;  3URY A;  3WDN A;  3GQB A;  1KRT A;  1FGU A;  3FPU B;  3VYU A;  4DNR B;  4DUZ L;  2EIF A;  1JJG A;  5T1G A;  2VQF Q;  2CVR A;  1B50 A;  2L1B A;  2B39 A;  4KY7 A;  1IBK L;  2K7V A;  2Y0S G;  3EFX D;  2K5D A;  2K6A A;  1SYF A;  1X32 A;  1SYD A;  2JE6 I;  2UXD L;  4C2M H;  2EYO A;  4NKL A;  1AFP A;  1WI5 A;  3D6C A;  3MWY W;  1IL8 A;  1ZXT A;  3RMH A;  3G71 A;  1O7L A;  4ZKB B;  2YYZ A;  2B2V C;  1AE3 A;  5JOB A;  2Q2H A;  2E2I B;  4JI8 L;  3TEH B;  3BDC A;  2H4O A;  5JJI A;  2HD3 A;  2LMC B;  2A6H C;  1B3Q A;  2CW0 C;  3RR5 A;  1ZYR D;  2F0M A;  1HTL D;  1EZ6 A;  2A69 C;  1CKN A;  1EWI A;  4IPG A;  1GOZ A;  4FNF A;  3FEW X;  1G91 A;  4N9T A;  2RHQ B;  3S2D H;  1EZ8 A;  4BY1 B;  1PTO F;  1YNN C;  4BBR H;  1SSO A;  4DA2 A;  1DYQ A;  5IE8 A;  4JI4 Q;  1M1K C;  1OO9 B;  2PQA B;  4QIW B;  3HOV H;  4G7Z C;  4ZK9 B;  1DJR D;  3OIP A;  5JVH 3;  1EY4 A;  5FJ8 H;  5H1S E;  1PDQ A;  4K5V A;  2RVL A;  1VQH A;  4PMC A;  2MPM A;  2E2D C;  1SMY C;  5KNB A;  5M5W H;  1GUG A;  1UEB A;  2WAC A;  1GM5 A;  1VQN A;  3R3O A;  5JPM C;  2XVS A;  4BBS B;  1KC8 C;  1HA5 A;  4Y7N B;  2OQ0 A;  4QY7 A;  4JI6 L;  3HOZ B;  4ODG A;  4X62 Q;  2QEJ C;  3KBX A;  4H02 A;  2ZM6 L;  1J8I A;  1JOK A;  3ERQ A;  3D6W A;  4A3M B;  1DXM A;  3TBI B;  3TS2 A;  1G6Z A;  2GVB A;  4BXX G;  1SJH D;  2N78 A;  3S1M H;  2XSC A;  2F4I A;  1ONL A;  4DN4 M;  1KAB A;  3TZD A;  1BO0 A;  1KHI A;  1LTT D;  2K50 A;  1UNS A;  4C3J B;  1TWC B;  4A3I B;  2WAQ B;  5KYI A;  3CPW A;  1XMO Q;  1K9M C;  4OO1 H;  3J81 L;  3GTP B;  5FLX c;  2CKZ B;  2B2W C;  4A3B B;  3MXU A;  4MTK A;  2EYP A;  3CC7 A;  4KN4 C;  1EU3 A;  3NEM A;  3SDZ A;  2JEA I;  3S1N B;  4YHH L;  3CRL C;  5C4J H;  2R6G A;  1D7Q A;  1I4Q A;  2E5L L;  1ASZ A;  1TY0 A;  3T13 A;  1H95 A;  2BA0 A;  2K32 A;  2B2U C;  4LF4 L;  4POG A;  4CBV A;  5C5L A;  3OWF A;  2XIW A;  2A19 A;  2MGS A;  1QNK A;  2KOL A;  4X3T A;  1NTG A;  4AIM A;  4DR7 Q;  4Y52 H;  1UE5 A;  2F0O A;  3PUY A;  4CJ2 C;  5ISR A;  3PO3 H;  5IYC H;  4IOA A;  1CSP A;  4LNQ A;  1QVC A;  4A3J H;  1W3S A;  4NXM L;  4P71 A;  5ELE A;  3EQL C;  1QUQ B;  2OTJ A;  1N34 Q;  4A3G B;  1KXL A;  3K0Y A;  2NB0 A;  1TWF B;  1II3 A;  1B9N A;  2WKC A;  1LAC A;  4POF A;  3J80 E;  3S9W A;  1I50 H;  3MVV A;  2JA7 G;  1WTO A;  5KEE A;  2I5H A;  2XWJ B;  3QOJ A;  4G7O C;  2YU9 H;  1EWH A;  3K7A B;  1VQM A;  1PRT F;  3GP7 A;  2B2V A;  1EYC A;  1SNM A;  5D3D A;  1TVX A;  1NBW A;  5ELO A;  4JV5 L;  1SNC A;  2M00 A;  3PV0 A;  1VQ7 A;  3FPP A;  4MN3 A;  2VUM B;  4DU9 A;  2CHB D;  1R9T B;  3K5L A;  1CM9 A;  1P16 A;  3VR5 A;  1AW7 A;  1PH7 A;  1XYI A;  1AZP A;  3M3Y H;  4BS9 A;  3D4W A;  4KY5 A;  3S1Q B;  4DF7 A;  2UXB L;  4GNX B;  3G7L A;  5CBE E;  2EDG A;  1HFG A;  1V43 A;  1GUS A;  3K58 A;  3QG1 A;  4GOP C;  2E8G A;  2VQE L;  1ZKO A;  3BDO A;  1G8Z D;  4S3S A;  1VQ4 A;  1VQJ A;  3NWT A;  4B9W A;  2QF7 A;  4PNY A;  3CCV A;  4XTC S;  1BR9 A;  1K83 H;  2EJM A;  3KDF A;  4TRD A;  5IP9 G;  3I4L A;  2PYK A;  2LXK A;  2OF1 A;  2F1M A;  5CYU A;  1A2U A;  2DUD A;  4ZKC B;  1YJN A;  3A74 A;  4DV0 Q;  2NVQ B;  5CMD A;  4YWK A;  4AH6 A;  1S72 A;  3HOU H;  4EQP A;  2B63 H;  3J81 c;  2Z8L A;  1MKH A;  1JWS D;  2UXC Q;  5J1Z A;  2B2T C;  3Q24 A;  1UEA B;  3EBE A;  3OHX C;  1LTB D;  3ITP A;  3GTK B;  1PH2 A;  1GXD C;  4F88 A;  3J80 i;  4C3I H;  3N52 A;  4A3C G;  1GHJ A;  4KY6 A;  4LF8 L;  4OWW B;  4QL5 A;  3I4N B;  2WFW A;  1ESR A;  1STB A;  4ILW A;  1DGS A;  2IPK D;  5KGU A;  2JA6 G;  4X6A H;  1EY8 A;  3T16 A;  4DR6 Q;  4UP7 A;  3KOJ A;  4FP5 D;  4U67 3;  1PH8 A;  5AJ3 L;  1M8A A;  1G6P A;  4IUU A;  1HNZ Q;  5C4X H;  4K0K Q;  5CV5 A;  1WCM G;  4H13 C;  3GTJ B;  2KCC A;  5G3L D;  2IT1 A;  1U4M A;  2CH4 A;  4EQO A;  3J7A V;  1VQ6 A;  1I5F A;  3M7G A;  5ELD A;  5CV8 A;  3VYT A;  4DV1 L;  1LAB A;  4A3L G;  4DV3 Q;  1AZQ A;  4XXE A;  2Q2I A;  4J1M A;  4LFC L;  1ILQ A;  2ZT9 C;  5IGG A;  1XMQ Q;  3JC6 6;  1DOM A;  1GVP A;  1EQR A;  2ZXO A;  1E2W A;  1NMG A;  2JN4 A;  5FLX E;  5LMN W;  3LNN A;  5M3F H;  1PA6 A;  1SMX A;  1FNV A;  3FKI B;  5EPK A;  2K01 A;  5COR A;  2A6E D;  2I5L X;  3K8A A;  3I56 A;  2UUB L;  1EWC A;  4FXG C;  4UPA A;  4C3H G;  2AUK A;  3TS0 A;  2X6L A;  1B4O A;  3C46 A;  2A5H A;  1Y1V G;  4H0L C;  2LFN A;  3CCR A;  3P7J A;  3OW7 A;  4WJW A;  1CT1 D;  1SR3 A;  4DR3 L;  3RN5 A;  1EOV A;  3BDL A;  4CDC C;  4N8F A;  1F9R A;  3DEO A;  5D14 A;  2P5Z X;  3OIQ A;  4O2D A;  3S17 H;  3PIP A;  1EU4 A;  2EPB A;  2RDH A;  2K52 A;  4HJA A;  3NWS A;  5IGC A;  3HOW G;  1OXS C;  1JE4 A;  4ZQ3 A;  2D62 A;  2ASB A;  4DR4 Q;  2JA8 B;  2HIV A; 
#chains in the Genus database with same CATH homology
 1BDO A;  4ULL A;  2IX0 A;  2XWB B;  2F0K A;  1ENA A;  1S5D D;  3CKI B;  1QWY A;  2F0D A;  2PW7 A;  1TKW B;  4F8M A;  4NP5 A;  5ELB A;  1TII D;  2FJ2 A;  2D9U A;  3PO2 B;  1I4H A;  1Z6H A;  5C44 B;  2KVM A;  3MEH A;  5CBA E;  5JEA G;  4K5X A;  1PMR A;  1BOS A;  3TME A;  2F3W A;  2EXZ A;  4WRD A;  1UAP A;  5IOD A;  5I9P A;  3H91 A;  1MBY A;  1F2M A;  2EY1 A;  4ZAI A;  4ABN A;  2X6G A;  1I6H B;  1HFN A;  1SNQ A;  3SEB A;  3OMC A;  5ELF A;  3SHL A;  1G2T A;  1EY5 A;  2PNR C;  5TSS A;  4EGV A;  1DM0 B;  3MXG A;  1HQM C;  3J81 E;  1RKN A;  5FO7 B;  3K57 A;  1Q3L A;  4RGT A;  1QCB D;  2BCO A;  3ND9 A;  3D8G A;  3OMG A;  4IUP A;  1FD7 D;  5LHY 1;  2BDN A;  3HG9 A;  2A6H D;  2CW0 D;  1CHQ D;  5E4X A;  2IL8 A;  3S15 B;  1Y8N B;  4KJO A;  3A8J E;  1CFM A;  3TP8 A;  4FYD A;  4RAU C;  1RCV D;  1W6K A;  1HPC A;  3DM1 A;  1YNN D;  1WTR A;  4A3E B;  1A2T A;  1E2Z A;  4NDX A;  3ZYY X;  5KNC A;  2F0E A;  1SMY D;  4K8J A;  1O7Y A;  2NN6 I;  1EYD A;  3S16 B;  3WOF A;  2EJG C;  2MJ8 A;  1NUC A;  4KD4 A;  3M4O B;  2F0L A;  4RKB A;  5M5X B;  5JVG 3;  4ZUI A;  1EEF D;  3MFY A;  3SK5 A;  3A7L A;  2BA1 A;  1QG7 A;  1HHV A;  4K6L A;  1XX8 A;  1R4P B;  3D4D A;  2KA7 A;  3I8Z A;  2SNM A;  1H9J A;  1ZEQ X;  1QB5 D;  1C4Q A;  1GHK A;  2Q8R E;  4DK1 A;  2M9V A;  4K2L A;  5FK9 C;  3GTG B;  2SEB D;  2R3Z A;  3H09 A;  2KEC A;  4QMG A;  3DWQ A;  2O5J C;  3R8B A;  1GUW A;  3EA6 A;  5EPJ A;  3C2P A;  1A3V A;  3KBG A;  5EJW A;  2WIN B;  5DM7 3;  1BNZ A;  1STA A;  3MAQ A;  5C3E B;  3HOX B;  2MUY A;  1BCP D;  1Q8I A;  4PV1 C;  5CV7 A;  2C9O A;  1LV9 A;  3BVZ A;  1FNU A;  3DMU A;  1E2V A;  3AU7 A;  1OXX K;  2AQ3 B;  4KD3 A;  2AUJ D;  2RKS A;  2G9D A;  1Q1B A;  2KUM A;  5KND A;  3OPO A;  2KED A;  1L0X B;  1VF5 C;  5CV6 A;  2BDO A;  3PUX A;  2F03 A;  2JYO A;  1D2B A;  3NUC A;  1OXV A;  4XQQ A;  1SDF A;  5EKI A;  2SDF A;  1ICW A;  4H7B A;  1F9S A;  2HDL A;  2LY7 A;  4NMZ A;  2N55 A;  3K6O A;  4K8I A;  4HMJ A;  5M9O A;  1B9M A;  1MSG A;  4G57 A;  5BN5 A;  3H3V C;  5CGK A;  1STG A;  5J39 A;  3PUV A;  3RUZ A;  4V19 0;  3S2H B;  5DEH A;  1KDA A;  3HOY B;  2WP8 J;  4KKS A;  1W6J A;  3C3L A;  3EJI A;  3QIA A;  1STY A;  1R4Q B;  1CA6 A;  5C6A A;  5F2D A;  3K5O A;  3U9S A;  4DGZ A;  1Y1W B;  4YIJ A;  3QJY A;  2RDF A;  3H0G B;  5KYL A;  2A68 D;  5BN4 A;  1YNJ C;  2F0T A;  3SVM A;  3T56 B;  3RD4 A;  3UI2 A;  1LTS D;  2F0P A;  2A73 B;  4QUF A;  1FNW A;  4ID6 A;  2HCI A;  1ROD A;  1VDZ A;  5EQ0 A;  4EVO A;  1DD2 A;  2JXM B;  3CHB D;  2C5C A;  2L12 A;  4XQN A;  5JEA H;  2R93 B;  2IW3 A;  4KI0 A;  2ZXP A;  3A8I E;  4A3F B;  4UAI A;  4A3D B;  2L11 A;  1EY0 A;  3LWU A;  5K36 H;  4AYB B;  4QB4 A;  4ZYS A;  5T1I A;  3PIO 3;  4KKU A;  4C3J G;  4IZ8 A;  3PMF A;  2AWO A;  1F77 A;  1D6E C;  4LMQ D;  1A6X A;  1FR3 A;  1EIH A;  5IT9 L;  4DK0 A;  4FF3 A;  2J4X A;  1V1P A;  2RDG A;  3WOE A;  2NVX B;  3OOC A;  3GTL B;  5I6W A;  5C3X A;  3TP6 A;  4GZY C;  2XRQ D;  1BUV T;  1VCI A;  2NN6 G;  3L7Z C;  3BG3 A;  1LT3 D;  2K05 A;  1S5C D;  4HMI A;  1I4X A;  1NAP A;  3BYT B;  5HGT A;  2R92 B;  3DWP A;  4A93 B;  4KTA A;  4TSS A;  1BCP C;  1PRT D;  4F7X A;  1EYA A;  1HA6 A;  3K59 A;  1B2T A;  3N6R A;  2F0V A;  2QDB A;  1JCK B;  1KTK A;  2SNS A;  2KEE A;  4IUQ A;  5M3M B;  2EYL A;  5CV9 A;  3MHB A;  1KNE A;  2B2Y C;  3SE0 A;  4DAY A;  3GTQ B;  4IFD I;  2AQ2 B;  1S5F D;  4WFN 3;  1DON A;  1A15 A;  4A3K B;  4BWG B;  4HTH A;  1U4R A;  2OXP A;  3TDQ A;  4PMW A;  5HUR A;  3A55 A;  4FXK C;  5ELC A;  1EQT A;  2L0C A;  2PQE A;  1RTO A;  2HDM A;  1VMP A;  1F2Z A;  3I70 A;  3KLR A;  3GV3 A;  3SXH A;  4XDX A;  4H44 C;  4J8Q A;  1AP0 A;  3NQT A;  3HP3 A;  1KLU D;  1M4V A;  4LAA A;  1GJX A;  4C1N K;  3BZD B;  3O13 A;  1LTR D;  1B44 D;  1D5Z C;  5FO9 B;  2GA4 B;  4DAV A;  1S5B D;  4O42 A;  1JOR A;  4RFB A;  2A68 C;  3A7A B;  1PTO C;  2DN8 A;  2B2W A;  3X3N A;  1SE3 A;  1B53 A;  1V1O A;  3I4M B;  4RGO S;  3NSW A;  3KLS X;  2B8F A;  4LJZ C;  1JQY D;  2TSS A;  2B2U A;  1WTV A;  2TMP A;  2WB1 B;  4K6D A;  1JR0 D;  2F0Q A;  1LT6 D;  4MIU A;  5C5M A;  5FO8 B;  3VR4 A;  3MZ5 A;  2NVT B;  1VF7 A;  4R8N A;  3AMU A;  2Z4I A;  2XN9 C;  3F2U A;  1B3A A;  4Q0F A;  5G3L F;  1KDC A;  4BA1 I;  1EY6 A;  3VA5 A;  4ME5 A;  2L9H A;  1RJT A;  2K04 A;  5E1F A;  3GV6 A;  4L8J A;  2LKV A;  4HAE A;  1PZK D;  5IGD A;  4RCO A;  3I3C A;  1STH A;  3ERO A;  3LWE A;  4C2M B;  4FF1 A;  2IX1 A;  1HCZ A;  4UDU C;  3KF8 A;  2O5I C;  1TS3 A;  3SK6 A;  4RCN A;  4O1N A;  2DY7 A;  3HKZ B;  1BXT A;  2Q8I B;  3R93 A;  3I73 A;  4OL7 A;  3KK7 A;  1F2Y A;  1CZG A;  4Z9C B;  3S2D B;  5LL6 X;  5C4H A;  4RKL A;  1PRT C;  3MA2 B;  4BBR B;  5JJZ A;  3ONA B;  2DY8 A;  2BOS A;  3HRZ C;  2B2T A;  3HOV B;  4FXD A;  1LLR D;  3C1E A;  1I4P A;  1RF2 D;  3TN2 A;  5M5W B;  3NTH A;  1PFB A;  4HED A;  3IL8 A;  1JB3 A;  3C1F A;  1TS4 A;  3HGB A;  2OEO A;  1H9S B;  2ZXR A;  2EYM A;  4V0B A;  3DWA A;  5IT9 E;  4PQX A;  1SEB D;  5EKK A;  1TR5 A;  2F3V A;  2F0U A;  1TQO A;  2QCP X;  1H9K A;  3S1M B;  2D2C C;  4IN3 A;  4I7Z C;  1TY2 A;  1YNJ D;  4QCL A;  3BVM A;  1ILP A;  4NW2 A;  1TS5 A;  1HUM A;  4G4K A;  2XRS D;  3EVQ A;  1Q12 A;  5C4J B;  5A2Q L;  3FDT A;  2F0H A;  1U9R A;  2NN6 H;  1Q1E A;  1SYG A;  1EQV A;  3KLS A;  2JP1 A;  4KV6 A;  5C0X I;  2RA4 A;  4RGM A;  5C4Z A;  3BS1 A;  1DZ1 A;  4XYO A;  4CGY B;  1GUN A;  3PIP 3;  3T4A C;  3L9A X;  1TT2 A;  1ESF A;  2O2L D;  3PO3 B;  2F0I A;  4IUR A;  4IFD G;  4A3J B;  2EYH A;  1EL0 A;  4CJ0 B;  3NBH A;  4C1N I;  2KQ3 A;  2X69 A;  2KCN A;  1ET9 A;  1I50 B;  1V8Q A;  1IYU A;  2G9H D;  4KHZ A;  3SR1 A;  1CQF A;  1F2L A;  2YU9 B;  2PZU A;  2WKD A;  1WD1 A;  1O78 A;  2IX3 A;  1H9S A;  4RA8 A;  1X3P A;  4RGN A;  1QNU A;  4TQU S;  1D1I A;  3ND8 A;  1EFI D;  3VA7 A;  2DNC A;  3M3Y B;  3JAM L;  2MHV A;  2I46 A;  2E76 C;  3P20 A;  3K5M A;  4IFD J;  4U68 A;  3D3R A;  1U4P A;  3HS0 C;  4X3K A;  2RQX A;  1HUN A;  1AN8 A;  2EZV A;  3T51 B;  4BA2 I;  3FMC A;  2EJF C;  1CQV A;  2BE5 C;  1GUT A;  1K83 B;  1G29 1;  4QF4 A;  1SJE D;  2WII B;  1SE2 A;  1JOQ A;  1XXG A;  4DFA A;  3HOU B;  2B63 B;  1IYV A;  1BF4 A;  5IIF A;  4MHE A;  2JEB I;  2R61 A;  3T53 B;  4C3I B;  5J22 A;  3VYS A;  1PLF A;  5IGF A;  4DAP A;  3W3A A;  1MSH A;  5C4X B;  1LTA D;  2VNU D;  1WVL A;  5COY A;  1PTO H;  2AWN A;  4RHS A;  3NTI A;  4CJ1 B;  5M3F B;  5EBC A;  1KLG D;  2HUG A;  1PYW D;  4ZRZ A;  1QOH A;  2J7Z A;  3K5N A;  2L5T A;  3I72 A;  3NXW A;  5EBD A;  1K8M A;  4M1U B;  1TS2 A;  2K33 A;  4OIK A;  4X3U A;  2ID0 A;  1V1P B;  2EYF A;  1CHP D;  4K14 A;  2V4D A;  2VXW A;  5I2X A;  4G7H C;  2FHT A;  4I65 A;  4FO2 A;  2M2L A;  1Z47 A;  2KJX A;  3H6M A;  4PMB A;  3S17 B;  1H9M A;  1PTO D;  2IWH A;  2Y0S B;  3J7Y W;  2QKI C;  1SAP A;  4OHJ A;  1HRJ A;  5D65 A;  3AB9 A;  1CZW A;  2E75 C;  1ML0 D;  1JWM D;  2PMZ B;  4XIG S;  3E0J A;  2CQA A;  1WTX A;  4DNT B;  1JWU D;  1A3T A;  1PFN A;  3TP7 A;  3DUZ A;  3GO5 A;  1OXU A;  4L63 B;  2IJ0 A;  3M4Y A;  4K2K A;  1EY7 A;  3U9O A;  5IGE A;  1Y69 U;  1X3Q A;  3NBI A;  1HTP A;  1F9Q A;  3DEP A;  4HSP A;  2FFK B;  4IUT A;  2PO4 A;  5AFW A;  1H9R A;  4IUN A;  3HZX A;  2L55 A;  4XT1 B;  4RWS C;  1RTN A;  5C0X G;  1QJO A;  1Y8P B;  3IKJ A;  5C3W A;  1PFM A;  5A2Q E;  3MC0 B;  1NR2 A;  1ET6 A;  1LTG D;  5I2Y A;  2A74 C;  4KMU C;  2RSO A;  3RZD B;  3S14 B;  5EPL A;  1KAA A;  1IW7 C;  2O4X A;  4OO1 I;  2ICE C;  4R8I A;  1SNO A;  1FGB D;  1KNA A;  3A54 A;  1HXY D;  2Z4H A;  2NVY B;  4XQJ A;  3G6J B;  5C0X J;  4IFD H;  1Q90 A;  2XNA C;  3TSS A;  5IGB A;  1S5E D;  3KUP A;  1L0Y B;  1GUO A;  2JA7 B;  4ZLT F;  1JIC A;  2VB3 X;  3NQI A;  2PPB C;  4LK1 C;  5EGT A;  3JAM E;  1SBB B;  4R9W A;  2MP1 A;  2J0T D;  1JOO A;  4HCE A;  2SOB A;  1BCP B;  1NR4 A;  2I07 B;  1TWG B;  4FF4 A;  4F87 A;  4JK1 C;  5FOB B;  1ENC A;  5I9O A;  3I91 A;  2E2J B;  4P2C B;  3A8K E;  4J6H A;  1LO5 D;  1CA5 A;  3NPP A;  5M5Y B;  1STE A;  5LL6 S;  1XWE A;  2RSN A;  3D31 A;  4X3S A;  1EIG A;  1BQQ T;  4CHT B;  4KHV A;  2K5W A;  3Q6S A;  5I6Y A;  4DXF A;  3QWN A;  4N9P A;  3RZO B;  3CQZ B;  1SNP A;  5NUC A;  1DOK A;  1O7Z A;  3HEJ A;  3OSO A;  3I90 A;  2EY6 A;  1ZYR C;  4E6I A;  4CKE A;  1IHZ A;  2ENB A;  2JA6 B;  1C48 A;  1DCZ A;  5I4D A;  1TWH B;  1WCM B;  4M8A A;  3GTM B;  3FRP B;  3LX0 A;  2QIL A;  1RD9 D;  1WTW A;  1EOT A;  4B08 A;  2FMM A;  1AEX A;  2WV6 D;  1PZI D;  1PTO B;  2F0W A;  2K5Q A;  1EY9 A;  4B9X A;  3NP8 A;  4IQZ A;  1S4Z A;  3PUW A;  4IUV A;  2BE5 D;  4QUC A;  2EY5 A;  5D3I B;  1LT4 D;  3QO2 A;  1STN A;  4C56 C;  4C3H B;  1QE6 A;  3DXJ C;  2K03 A;  2B2Y A;  1DOL A;  1Y1V B;  3D4R A;  3GD7 A;  1IKL A;  5E4W C;  1WTP A;  2JSO A;  1J9O A;  2H1E A;  5JAV A;  2RBM A;  1MD2 D;  3NK9 A;  3P75 A;  3OWE B;  1KDB A;  4ZUJ A;  2Q8T A;  5DAU A;  1HQR D;  1SND A;  1F9P A;  1LT5 D;  5JPN C;  3HOW B;  3M85 A;  1I4R A;  5E3F A;  1ENF A;  1B1Z A;  3MFG A;  2F0J A;  4HN7 A;  3VR6 A;  2NWG A;  4WOR A;  1I6V C;  4KKT A;  2NTT A;  1LTI D;  3E6Z X;  1D5M C;  2PW5 A;  1G2S A;  3VYR A;  5K5P A;  1CI3 M;  1MGS A;  3IFD A;  3CU7 A;  1SYB A;  2F0G A;  5K36 G;  3CRK C;  4K5W A;  1O80 A;  1QIL A;  1PXU A;  2K1B A;  4HSV A;  3P1H A;  4OO1 G;  4TKO B;  1SYE A;  3DHQ A;  1PRT B;  4HCS A;  1I4G A;  4BY7 B;  5C0X H;  3QOL A;  3TP5 A;  2R7Z B;  2PZT A;  1CTM A;  3TZU A;  2F0F A;  5JEA J;  4OIJ A;  1TU2 B;  3J7A F;  3A56 A;  2A69 D;  4Q5V A;  1XTC D;  3X3M A;  1I3Q B;  3MXN A;  4CKB A;  4EQN A;  3V96 A;  4RH6 A;  1TWA B;  4XT3 B;  3IFT A;  1NCV A;  2AQ1 B;  3RLF A;  2NTS A;  2JA5 B;  3V2T A;  5FKA C;  1C8C A;  1SYC A;  1JC7 A;  2NYZ D;  3MTS A;  3R2T A;  1D5X C;  3J80 L;  2NBF A;  4FF2 A;  1A3U A;  2EE1 A;  2D5D A;  2NUC A;  3SK4 A;  1RDP D;  3V05 A;  4L6T B;  2NZ1 D;  4RHR A;  1D1K A;  2EY2 A;  4KK7 A;  4FVM A;  1T5E A;  3H94 A;  2VB2 X;  3NHH A;  2HCC A;  4CKC A;  3VR3 A;  1WD0 A;  2N88 A;  2FMC A;  2KHS A;  5BN3 A;  1CK1 A;  2A6E C;  1IW7 D;  2F0S A;  5DNF A;  3NTK A;  2PZW A;  3M7N A;  5A35 A;  3L3O C;  1SFO B;  2B8G A;  3MXP A;  3Q0A A;  1PZJ D;  4C3I G;  5CV4 A;  1UUP A;  2OT2 A;  2EVB A;  3BYY B;  2E74 C;  5CC4 A;  3E5S A;  1E0B A;  1RHP A;  2FIN B;  1K8O A;  3R2I A;  2EOT A;  1SE4 A;  1SXT A;  3BVG A;  4IAL A;  2Z1C A;  2EYJ A;  1BCP F;  3PUZ A;  5EKL A;  2ICI A;  5KIX A;  1WTQ A;  3FVQ A;  4KJN A;  5IOC A;  1OXT A;  2DNE A;  1U4L A;  4HR7 B;  1BBX C;  3GTO B;  2F0N A;  1NSN S;  2PCF B;  3VR2 A;  3Q23 A;  2LS0 1;  5DM6 3;  2E2H B;  1MI2 A;  1VMC A;  1T5X D;  3SK8 A;  3W2D A;  3IAY A;  1IKM A;  3Q22 A;  4JBW A;  5KRU A;  1Y8O B;  3NE5 B;  2HQE A;  4OGQ C;  5FLX L;  2K28 A;  4XYQ A;  1Z7T A;  4DXG A;  1EEI D;  3S1R B;  1FYC A;  5CR3 A;  2L4N A;  3QB3 A;  4KN7 C;  3URY A;  3WDN A;  3GQB A;  3FPU B;  3VYU A;  4DNR B;  5T1G A;  2CVR A;  1B50 A;  2L1B A;  2B39 A;  4KY7 A;  2K7V A;  3EFX D;  2K5D A;  2K6A A;  1SYF A;  1X32 A;  1SYD A;  2JE6 I;  2EYO A;  4NKL A;  1AFP A;  3D6C A;  3MWY W;  1IL8 A;  1ZXT A;  3RMH A;  1O7L A;  4ZKB B;  2YYZ A;  2B2V C;  5JOB A;  2E2I B;  3BDC A;  2H4O A;  2LMC B;  2A6H C;  2CW0 C;  1ZYR D;  2F0M A;  1HTL D;  1EZ6 A;  2A69 C;  1GOZ A;  4FNF A;  3FEW X;  1G91 A;  4N9T A;  1EZ8 A;  4BY1 B;  1PTO F;  1YNN C;  1SSO A;  4DA2 A;  1DYQ A;  1OO9 B;  4QIW B;  4G7Z C;  4ZK9 B;  1DJR D;  3OIP A;  5JVH 3;  1EY4 A;  1PDQ A;  4K5V A;  2RVL A;  4PMC A;  2MPM A;  2E2D C;  1SMY C;  5KNB A;  1GUG A;  2WAC A;  3R3O A;  5JPM C;  2XVS A;  4BBS B;  1HA5 A;  4Y7N B;  3HOZ B;  4ODG A;  2QEJ C;  3KBX A;  1J8I A;  1JOK A;  3ERQ A;  3D6W A;  4A3M B;  1DXM A;  3TBI B;  1G6Z A;  1SJH D;  2XSC A;  2F4I A;  1ONL A;  4DN4 M;  1KAB A;  3TZD A;  1BO0 A;  1LTT D;  1UNS A;  4C3J B;  1TWC B;  4A3I B;  2WAQ B;  5KYI A;  4OO1 H;  3J81 L;  3GTP B;  2B2W C;  4A3B B;  3MXU A;  2EYP A;  4KN4 C;  1EU3 A;  3SDZ A;  2JEA I;  3S1N B;  3CRL C;  2R6G A;  1I4Q A;  1TY0 A;  3T13 A;  2BA0 A;  2K32 A;  2B2U C;  4CBV A;  5C5L A;  3OWF A;  2XIW A;  2MGS A;  1QNK A;  2KOL A;  4X3T A;  2F0O A;  3PUY A;  4CJ2 C;  5ISR A;  5ELE A;  3EQL C;  4A3G B;  3K0Y A;  2NB0 A;  1TWF B;  1II3 A;  1B9N A;  2WKC A;  1LAC A;  3J80 E;  3S9W A;  3MVV A;  1WTO A;  5KEE A;  2XWJ B;  3QOJ A;  4G7O C;  1EWH A;  3K7A B;  1PRT F;  3GP7 A;  2B2V A;  1EYC A;  1SNM A;  5D3D A;  1TVX A;  1SNC A;  2M00 A;  3PV0 A;  3FPP A;  4MN3 A;  2VUM B;  4DU9 A;  2CHB D;  1R9T B;  3K5L A;  1CM9 A;  3VR5 A;  1AW7 A;  1XYI A;  1AZP A;  4BS9 A;  3D4W A;  4KY5 A;  3S1Q B;  4DF7 A;  3G7L A;  5CBE E;  2EDG A;  1HFG A;  1V43 A;  1GUS A;  3K58 A;  3QG1 A;  1ZKO A;  3BDO A;  1G8Z D;  4S3S A;  3NWT A;  4B9W A;  2QF7 A;  4PNY A;  4XTC S;  1BR9 A;  2EJM A;  4TRD A;  3I4L A;  2PYK A;  2OF1 A;  2F1M A;  5CYU A;  1A2U A;  4ZKC B;  2NVQ B;  5CMD A;  4EQP A;  2Z8L A;  1JWS D;  5J1Z A;  2B2T C;  3Q24 A;  1UEA B;  3OHX C;  1LTB D;  3ITP A;  3GTK B;  1GXD C;  4F88 A;  3N52 A;  1GHJ A;  4KY6 A;  3I4N B;  1ESR A;  1STB A;  4ILW A;  2IPK D;  5KGU A;  1EY8 A;  3T16 A;  4U67 3;  4FP5 D;  1M8A A;  4IUU A;  5CV5 A;  4H13 C;  3GTJ B;  2KCC A;  5G3L D;  2IT1 A;  1U4M A;  4EQO A;  3J7A V;  3M7G A;  5ELD A;  5CV8 A;  3VYT A;  1LAB A;  1AZQ A;  4XXE A;  4J1M A;  1ILQ A;  2ZT9 C;  5IGG A;  1DOM A;  2ZXO A;  1E2W A;  5FLX E;  3LNN A;  1FNV A;  3FKI B;  5EPK A;  2K01 A;  5COR A;  2A6E D;  1EWC A;  4FXG C;  4C3H G;  2AUK A;  2X6L A;  1B4O A;  3C46 A;  2A5H A;  4H0L C;  2LFN A;  3P7J A;  3OW7 A;  4WJW A;  1CT1 D;  3BDL A;  1F9R A;  3DEO A;  5D14 A;  3OIQ A;  1EU4 A;  2EPB A;  2RDH A;  3NWS A;  5IGC A;  1OXS C;  1JE4 A;  4ZQ3 A;  2D62 A;  2JA8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...