4DF7A

Crystal structure of staphylococcal nuclease variant delta+phs v23l/v99i at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4df7A00
3MXPA 5CV5A 1SNCA 4B9WA 5E3FA 2LKVA 1STGA 3NK9A 4KD4A 2F0FA 2OEOA 2SNMA 3OSOA 3OWFA 4G57A 3VA5A 4N9TA 4OL7A 5CV8A 3TP8A 4DFAA 4MIUA 3EROA 4WORA 2OF1A 1EY5A 3T16A 5KYIA 1TQOA 5CR3A 2PQEA 2F0VA 5C3WA 2F0MA 5IIFA 1TR5A 2RDFA 3TP6A 5C5LA 3T13A 4EQNA 2F0PA 5CV4A 4DU9A 5NUCA 5IGDA 1A3UA 5CV6A 5C3XA 1JORA 1SYEA 1ENCA 5I9PA 1JOOA 2EYJA 2EYLA 1II3A 1TT2A 2F0QA 3C1EA 2F0UA 3MEHA 1SYGA 1A3VA 3BDLA 3D8GA 3TMEA 4K8JA 1A2UA 2SOBA 2F0EA 1EYAA 5HURA 3LX0A 4NP5A 1EY4A 1A3TA 5F2DA 4PMBA 5CGKA 5IODA 3SK6A 5KGUA 2F0HA 4KY7A 4KHVA 5DAUA 3SHLA 1KDBA 5DEHA 3TP5A 5J1ZA 2EXZA 1IHZA 1U9RA 3MZ5A 2QDBA 3C1FA 2O4XA 2F0KA 4HTHA 2EY5A 3P75A 4DGZA 4K5WA 2F0DA 3NUCA 3R3OA 1EQVA 1ENAA 3QOJA 3SK4A 1F2ZA 1EY9A 3P1HA 1EYCA 4J1MA 1SYDA 4R8NA 4IZ8A 3ERQA 3NXWA 4NMZA 5I9OA 1SNDA 4ZUIA 5M9OA 4HMJA 2KHSA 5I6WA 2F0WA 4WRDA 4YIJA 1RKNA 4KTAA 3RUZA 5CV7A 2HQEA 1F2MA 4K6DA 2PW5A 4F7XA 3QB3A 3HEJA 1AEXA 1STAA 3OMCA 3PMFA 2F0GA 4NKLA 2F0IA 4QB4A 5EKKA 1STHA 1EZ8A 1SNQA 2EYFA 1KDCA 4K14A 3TP7A 4B9XA 5K5PA 1KAAA 4ME5A 4QF4A 5EGTA 3SR1A 5IGBA 3SXHA 1JOQA 5I6YA 4E6IA 2F0JA 1NSNS 3EJIA 4IUNA 4DF7A 4KY6A 2EYMA 5JAVA 3S9WA 1EZ6A 2F0OA 2RBMA 4KV6A 3EVQA 2EYOA 4KJOA 4NDXA 4QMGA 3SK5A 5IGFA 5KEEA 2EYHA 1EY7A 1F2YA 5C6AA 3QOLA 1EYDA 5C5MA 4J6HA 4EQPA 2PYKA 1STYA 2RKSA 2SNSA 2PZWA 5CC4A 4K2LA 3MVVA 4S3SA 2ENBA 2F0NA 3NHHA 4PNYA 5KYLA 2EY6A 3ITPA 4LAAA 4ZQ3A 2EY1A 4F8MA 4K5XA 2M00A 4ODGA 1EY8A 4RKLA 3SK8A 5C4ZA 1KABA 3NP8A 3D6CA 4H7BA 5E1FA 1STBA 4I65A 5HGTA 5IGEA 3BDCA 3V2TA 2OXPA 2F3VA 2KQ3A 3H6MA 4HMIA 2EYPA 1STNA 2WACA 2F3WA 3HZXA 5JOBA 5KIXA 4EVOA 5ISRA 5CV9A 4ZUJA 1EY6A 1SNPA 1NUCA 3NQTA 3U9OA 3E5SA 4IALA 1SYFA 5IGGA 2PZUA 3OMGA 4KJNA 1EY0A 5KRUA 5J22A 4N9PA 4K8IA 4K5VA 4EQOA 4KD3A 3DHQA 2NUCA 3MHBA 1A2TA 4KY5A 1SYCA 1KDAA 2PZTA 4K2KA 5IOCA 5J39A 1SYBA 1JOKA 2PW7A 3DMUA 4PMCA 4RKBA 3D4DA 2F0LA 4TRDA 1SNMA 3D4WA 2F0TA 5EKLA 5C4HA 4ID6A 1SNOA 2F0SA 5IGCA 2EY2A
chains in the Genus database with same CATH superfamily
1JJCB 3MXPA 3ND8A 5IT9c 3FPPA 2C5CA 3STBC 5C4XB 2K5NA 2IX0A 3TBIB 2VQEQ 1E2WA 5ELBA 3CRKC 2F0VA 1I50H 1DYQA 4JV5L 2E76C 2B2UC 4JBKA 3L0OA 4LF7Q 3VYRA 1CZWA 5C3XA 3MAQA 1NR2A 1TT2A 3IKJA 3D8GA 1SFOB 1EYAA 3LX0A 1VQOA 4XQJA 2B2WC 2F0HA 4DR6Q 4BY1H 3D6WA 4C3JH 3G7LA 4DV0Q 1TVXA 1RHPA 2QGQA 2HIVA 3P7JA 1L1OC 3C46A 4DR4Q 1EQVA 2B2TC 1K3BC 3PO3G 4TQUS 3NEMA 5AFWA 5D14A 1VQ9A 1RTNA 3RUZA 3K7AH 3AYHB 4Y7NB 2R7ZB 1PYBA 4WJ3M 1X3GA 1SE2A 2Z9HA 1HRJA 4X3UA 3HOUH 3J81i 1VQEA 1QOHA 1EEFD 1K8MA 3D3RA 3I4OA 2XN9C 4KY6A 4PG3A 2X6LA 5JAVA 4OO1H 5IWAL 1ZKOA 2WV6D 1TWCB 2YTVA 1SJED 5C6AA 2F4VL 3SDZA 1LT6D 3F2DA 5LMNL 1A0IA 4BA1I 1KNEA 4JC0A 5AJ3Q 4JBMA 1CA6A 2EY6A 5IP9G 2YV5A 4ZQ3A 1HR0Q 2B2YC 4L8JA 3D6CA 4RGNA 3ICEA 5C44H 2J7ZA 3CCQA 2UXCL 2K14A 2WACA 3GD7A 3QG1A 2L1BA 2O2LD 4DK0A 1PH8A 4H13C 3Q8DA 1RL2A 2Y0SB 1XJVA 4K8IA 3PIP3 3J7ZC 2HDMA 1BCPC 1A2TA 4OEMB 4DNTB 3RZOH 1IBKQ 2F0LA 4IPDA 3J81L 1TU2B 4YHHQ 2AHOB 2B2VA 3E0EA 1FJGQ 4UDUC 1KQSA 1LTLA 1YHAA 2FMMA 2A19A 2DNCA 3A5ZB 1SBBB 5CV8A 4C2MB 3S1QB 4MIUA 1CI3M 5EBDA 3NTIA 1K83H 3EFXD 5BR8L 4F87A 1Y1WH 5NUCA 2IX3A 1ENCA 2X69A 2NZHA 4LF6Q 3GQBA 3JAME 1YITA 5C3EG 4O1NA 3J80E 4JYAQ 1U0LA 4A3FH 2UXBL 1EQTA 3S1MB 2JN4A 2VB2X 1FGUA 3RN5A 2N78A 1XMOQ 3I4MG 2N49A 4JBJA 4HJ8A 2EY5A 2JEAI 2K50A 2IX1A 1SMYD 4BBSG 1L1OB 4Q5VA 5CORA 2JA7G 5M3FG 4ZLTF 4BBRB 2D62A 3VYSA 1P8LA 1STAA 1EU4A 1H9JA 3FDTA 1HNWL 4AQYL 5ELOA 3CCUA 1DM0B 5M5WH 4UP8A 3HRZC 3S16H 2IY5B 3KLSX 4NXML 1UE6A 4H02A 4IUNA 3DEPA 3ZJYC 2PPBC 2HT1A 1EZ6A 1DOLA 2GVBA 1HPCA 3FKIB 3EVQA 4NDXA 5IGFA 1I3QH 1E3PA 4I7ZC 1Y8PB 3RNUA 3HOWG 5C4XG 1B2TA 3HOYG 3PUXA 2R92H 3S2HB 2EY1A 3M4OB 2J0TD 4JW0A 4NB3A 4AYBE 4OHJA 1BF4A 3LWEA 1YJWA 4LF8Q 4DV7L 3HOVG 4XQNA 2NVXB 1PH9A 3GTPB 5CV9A 1Q46A 4ZUJA 2CW0D 1NUCA 1B4OA 1AFPA 3DWPA 4R1JA 5KRUA 3STBD 4KHPL 2BDOA 2CWAA 3PF5A 3I72A 3AQQA 1KDAA 5KNBA 4RA8A 1BCPB 4DUZL 1LABA 2KJXA 1ZXTA 5JJKA 1VQFA 4UHVA 1DOKA 3D4WA 5A2QE 3I4NB 1I50B 1SNOA 2F0SA 1AN8A 3BG3A 4FDBA 3PQIA 2K6AA 1HNZQ 1JT8A 4JI4L 2R7ZG 1IW7C 3UI2A 3UDIA 3F2CA 3UDGA 4X66L 3Q0AA 3JAMi 4M8AA 5C4JH 1X6OA 3FHWA 4K0KL 2ALYB 3PO3H 1V1OA 1F2LA 1S40A 2JEBI 3OOCA 4EQNA 3CCEA 4JI6Q 4C3JB 1KAWA 1D1KA 5GAGC 3GTGH 1A2UA 4ZYSA 2B63G 3MC0B 5F2DA 3SK6A 4B3TL 2UUAL 4LFBQ 1WTHA 3F2BA 1YZ6A 3OHXC 5C0XJ 1M8AA 1EIHA 4A76A 3VR4A 2E2JH 1SYDA 1T5XD 3PUZA 1SNDA 4IPGA 4A3DB 1C8CA 2UUCQ 4P71A 3CMEA 1AEXA 1UEBA 4QB4A 5IP9H 1PTOC 1I4QA 4Q0FA 4P72A 4CDEC 2Z6KA 3SXHA 1I5FA 1HCZA 5EAYA 4ZKBB 3BVZA 4R4CA 3BYTB 4DF7A 1IBLQ 1N36Q 1PH5A 3PV0A 4NW2A 4H44C 3SEBA 5COYA 4EX5A 1QB5D 3S15H 2ID0A 1LACA 2PYKA 3TRZA 5KYLA 1S5CD 5C0XG 2Q2IA 1VDZA 4U673 1KABA 1F9QA 1BCPD 1L0XB 3T56B 5HGTA 2E5LL 1T5EA 2OXPA 3IFTA 3TN2A 1IKMA 3KF6B 3HKSA 3T51B 4HMIA 3S1RH 3CPWA 1AW7A 4DA2A 3NQTA 1JMCA 4PZ6A 4YWKA 2PZUA 4M1UB 1QZHA 4A3JB 3MHBA 4P73A 4JI1L 2MO0A 3RLNA 5C3EH 4TRDA 4TVAB 1YNXA 4IUTA 2RCNA 2B3GA 2EY2A 4HCSA 1Y1WB 4BBRG 4A3CG 1D1IA 2UU9Q 1CHPD 1NE3A 2MO1A 3I4MH 3I90A 3L2PA 5JPNC 5KYIA 1HA5A 1TQOA 4YWMA 4A3FB 5IIFA 4LF4L 4BBSH 1LO5D 2R93G 3TP6A 2F0PA 2JA7H 4K6LA 5M3FH 2K4KA 2XRSD 5I9PA 3PGZA 4IJHA 5A35A 2F0UA 5JEAJ 2IHEA 4K8JA 4DV0L 3FKIG 4ILWA 2RDGA 4UP7A 3TP5A 4JOIA 1U9RA 2QDBA 3HS0C 2DJGC 1E1TA 1Q7YC 5C0XI 1IZ6A 4FF4A 2RSOA 4R4QA 4FO2A 5T1IA 4FF3A 1STEA 3T1YQ 1EIFA 2KECA 5M9OA 3PO2B 1KTKA 1RKNA 3HOWH 4CGYB 5C4XH 1JE5A 1JB7A 1YEZA 3HEJA 1IBML 2CCZA 1EIYB 3HOYH 3CMAA 2XGTA 4QF4A 1PTOB 2Z6BA 1N32Q 1I3QB 1TY0A 3CF5A 1N8RC 1LV9A 2MGSA 3HOVH 3K59A 2IPKD 4UP9A 4HSVA 2F0OA 2RBMA 4JPBW 3I4NG 2KA7A 2Z4HA 3CHBD 2L11A 2VB3X 1SXTA 3CCVA 3SVMA 5C5MA 1JE4A 4EQPA 1ZYRC 1TWHH 2OQKA 2K75A 3V96A 2PCFB 1PZKD 1BDOA 1CKMA 4F8MA 1VQHA 5LMUQ 4RCOA 4L6TB 1G91A 1E0BA 2HUGA 3K5LA 3S1NB 2FMCA 2VXWA 4Y7NH 5JOBA 2R7ZH 3TS2A 5KNDA 3CC2A 2K5WA 5GAHC 1PYWD 4DV5Q 5E4XA 1ZEQX 1IBKL 5FO9B 3DHQA 1IW7D 4KK7A 1F9RA 1SYCA 4YHHL 5M5XB 1SROA 2M2LA 5I2YA 4GNXC 3K58A 3OTOQ 3W5OA 2B63H 5EKLA 1XTCD 3PO3B 2EIFA 5CV5A 3H15A 2A73B 4A3DG 3LGJA 1I4GA 1PH7A 1NCVA 5FLXc 1J5EL 3W1BA 3GTGB 3I70A 2LMCB 3L3OC 1Q81C 3CW2C 1K9MC 1HZCA 3NPPA 2TSSA 5CV6A 3I55A 1CQFA 1SYEA 3R93A 1LTGD 1WJJA 4QL5A 1A3VA 1B7YB 2QCPX 4DXFA 1S5FD 3K0XA 2IHFA 4R9WA 2IJ0A 1IHZA 3CCMA 3KFUA 2O5JC 5FLMG 4FXKC 1PTOD 4GZYC 4DGZA 4K5WA 1HQMC 1UE1A 3G48A 4LFCQ 3QOJA 4PV1C 2B2UA 2J4XA 4B3MQ 3BVGA 1TS3A 1R9TB 1WI5A 4X64Q 1MI2A 5CV7A 3N52A 3OMCA 4WJ4A 3A56A 4NKLA 2F0IA 4C2MH 5C0XH 1STHA 1EZ8A 1HNXL 3S1QH 1G8ZD 2B2WA 4DV6L 4J15A 2O5IC 2K7VA 3CQZH 4GN5A 5ELCA 4A3JG 1D8LA 4R4TA 3S15B 4IOCA 1L1OA 1DGSA 1PDQA 4FYDA 4Y52H 4QMGA 4HIKA 3KLRA 4A3BG 3OWEB 3S1MH 1F2YA 2Q2HA 3HKZE 3RLOA 2JJQA 2IW3A 4CDDC 3P20A 5CC4A 1YJ9A 1Y8OB 1VQBA 3MVVA 4S3SA 4Z9CB 2L12A 1UAPA 4LAAA 1I6VC 5D65A 1H9SB 2JSOA 2C35B 1EY8A 3TS0A 4LJZC 4B08A 2F3VA 3DM1A 2LXJA 4BBRH 1KIXA 4A3CH 5IP7G 2VW9A 1WTXA 1YVCA 5C3EB 3OPOA 2NZOA 4IALA 5EKIA 3A8IE 1KD1C 2R93H 1DZ1A 2KVMA 2Q2TA 3N6RA 1UNSA 1TWGB 2Y0SE 3WOEA 1YHQA 4UY8C 5IT9L 4XT3B 4K2KA 4POFA 3I4MB 1G2TA 3GDEA 2B2YA 1XNQL 3FKIH 5C4HA 4GNXB 1J9OA 2ZT9C 4XQQA 2P5ZX 3PO2G 1SNCA 2PMZB 4OWTB 4HIDA 1O80A 4YY3L 4PMWA 1PZID 5M3FB 3G71A 4PZ7A 3HOZG 5JJZA 1PMRA 4WORA 2PQAB 1K0RA 3K5OA 4A3LG 5IGDA 2OWOA 3NWTA 3NE5B 1NJIC 3GTQB 1WTQA 1J6QA 2AKWB 2NVXH 1SYGA 2AMCB 1U4PA 3K7UC 4QJFA 4GKJL 5M3MG 1GHJA 2L9HA 1CQVA 1T9HA 5LL6S 1SR3A 4DR7L 1N34Q 2EJGC 2D2CC 2B8GA 3HOWB 4IUPA 1GO3E 2AUKA 4BA2I 3HOYB 3AB9A 2L55A 3R8BA 3I4NH 5I9OA 5JVG3 2F0WA 4ZAIA 2PO4A 4WJWA 2X6GA 4DUYQ 3HOVB 1NBWA 2WB1B 2F1MA 5K5PA 3E9IA 1ET9A 2AQ3B 2AQ1B 2HCCA 3S24A 1ZYRD 4JI2L 4LF5L 1JWMD 1EYGA 4BS9A 1M4VA 3VA7A 1TWHB 3EJIA 4XIGS 3DUZA 3CC7A 3CCLA 5GAEC 3I7FA 1CSPA 2ZXOA 3SK5A 1TWFB 1CTMA 2KENA 1IL2A 5H1SE 1P16A 3ULLA 2D0OA 4JI5Q 2ENBA 2F0NA 3OYYA 1EQQA 4RKLA 2M00A 4OONA 2QEXA 3F1ZA 3NTHA 1VQPA 3BDCA 1W6KA 4A3DH 2WFWA 4TSSA 4JI8Q 4B3SL 1S72A 4X65L 3PCOB 4DV3Q 4EVOA 2Z0SA 3CRLC 1PTOF 2Z8LA 1HTPA 5EPKA 3W3AA 2B63B 3BU2A 1EQRA 2D9UA 1JR0D 1HZ9A 2HD3A 2VUMB 4IOAA 1E1OA 3KJPA 3KF6A 1G51A 1EOVA 1SNMA 2ATWA 3NELA 3KBXA 1LT3D 4ID6A 4L63B 3HOXB 4C3HB 1GUTA 4C3IB 1Z6HA 2KEEA 5FLMH 3T1HQ 3NK9A 2ZTEA 3FEWX 1HTLD 2PQEA 1K8OA 4QIWB 1VS0A 3CC4A 2B8FA 4I7AA 1SJHD 1Y69U 4UPAA 2HIXA 3TEHB 1A3TA 2N8NA 4POGA 4AIMA 5J1ZA 4A3JH 1LTRD 3U4VA 2F0DA 4J1MA 2KHIA 2BH8A 2DGYA 4ZUIA 1K8GA 2FXQA 1I94Q 4A3BH 2HQLA 4YIJA 3CQZB 4NPSA 1HHVA 3ZYYX 3QB3A 1XMQQ 2QA4A 2ZTDA 2FINB 4OELB 2SEBD 3MFYA 1H95A 3MXNB 4DNIA 2I5LX 4HN7A 5IGBA 1E2ZA 1BBWA 1JOQA 3M3YH 5IP7H 2ICIA 2VQFL 4LF9L 4DV2L 1K28A 3KUPA 4LWCA 4LFAQ 1KC8C 1HJPA 2NBFA 3J81j 1YNNC 3GTJB 4NXNQ 5LMNW 1PFNA 4OX9Q 4JI7L 2JK8A 2KUMA 4BWGB 4MTKA 1OO9B 4H7BA 3B6YA 1QUQA 4OGQC 4I65A 2R93B 3V2TA 3PO2H 4P2CB 3D0FA 3KYHC 4XYOA 3HOZH 3J81c 1LTSD 4ZCKA 1EY6A 1LTID 2R6GA 1MBYA 1SYFA 1PTOH 2FHTA 2K01A 4A3LH 2K52A 5IE8A 1XNRQ 4JCVE 1PH3A 2OT2A 3K5NA 1PFSA 2R7FA 4A3EH 4N8FA 2H5XA 5M3MH 2JQOA 3I91A 2MUYA 1BBXC 2E2DC 1STGA 1XXGA 3GTOB 4DV1L 1WVLA 2WB1G 2F03A 4N9TA 3EROA 1MKHA 3I2ZA 1U4RA 4G7HC 1TR5A 2V1CC 1VMPA 3DEOA 4DR1Q 4ZKCB 3K8AA 3S1NH 1CM9A 2JXMB 4GKKQ 3MEHA 4KMUC 4X6AH 2N88A 2ZM6L 4KHVA 1U4MA 1KDBA 4G7ZC 4JI3Q 3A54A 2ZJPA 4AH6A 3VR2A 3S2DB 5I2XA 3U9SA 4HTHA 5M5XH 1CT1D 2IT1A 3SGIA 3L9AX 1EYCA 1ENFA 1FVIA 2BDNA 1V43A 3J80i 1CKOA 4WRDA 1F9SA 1OXTA 5FKAC 2HQEA 5EKKA 2EYFA 5FJ8G 1S3OA 1H9KA 1VQNA 2KOLA 5FLXE 5I6YA 4JBWA 2B29A 1SE8A 1EWIA 1E22A 2NTTA 2VUMG 3TZDA 4DR3Q 2I07B 1JC7A 3E6ZX 3HOXG 1CUKA 4R4IA 2NTSA 1VQDA 4C3HG 2JA6G 1FNUA 4C3IG 2XNAC 3NBIA 1I4PA 3CXCA 4PNYA 1ICFB 3HFZB 4B3RL 4HJ9A 1ILPA 1VQIA 2L5TA 2UXDL 4RWSC 4U68A 4JK1C 1X65A 5E1FA 3DLLA 2QDLA 1R9TH 3C3LA 2EJMA 3UE0A 5KIXA 2NN6G 2YTYA 1Y1VG 1RIPA 4RMFA 3SE0A 1FNVA 3JAML 3KLSA 1H9RA 2WAQG 4KJNA 3U50C 4A3GB 3MEFA 1BO0A 3J80L 1GOZA 1H9SA 1SEBD 4LNQA 1TY2A 1ASZA 1W2BA 1UE7A 1GM5A 4JV5Q 5E7NA 3W1GA 4X62Q 3K0YA 1QE6A 2R3ZA 2OTJA 2HHHL 1LLRD 2JP1A 4ME3A 5DNFA 3TREA 3QO2A 2PI2A 2ICEC 3MXUA 2BA0A 2A6EC 4OWWB 3CAMA 2F0FA 2SNMA 4HSPA 3VA5A 1E2VA 4KHZA 3TP8A 1NY4A 2OF1A 3EA6A 5C3WA 5IYDG 2KCCA 1WCMG 1VQ7A 2EYJA 4JI0L 1B70B 3K57A 4GNXA 1N33L 3I56A 1TKWB 3BDLA 3TMEA 5BN5A 2E75C 1N34L 1EY4A 3A7LA 3CCSA 5IODA 3NENA 3ULPA 1GUNA 1G291 4A3BB 2VQEL 1TWGH 4V190 4IFDJ 2PQAA 4RFBA 5ELNA 3P75A 2WP8J 4L5SA 4MHEA 4XYQA 3NTKA 5D3DA 4LF7L 1B9NA 1DJRD 3FVQA 5JJLA 3NXWA 4DUYL 3FRPB 4QY7A 3O13A 1PXUA 1QJOA 2KHJA 3KF8B 3M3YB 1EWHA 1ML0D 1X54A 1PRTC 2A69C 2NN6I 3AU7A 1PYSB 4AYBB 4ZK9B 4DR6L 5LMNQ 1B1ZA 4HIMA 2AQ2B 1WD1A 1YNND 4KKSA 1CKNB 4DR4L 3GTQH 1MSHA 4DK6C 3HP3A 2UXCQ 1LM0A 1OXXK 1WFQA 3VR3A 2XTIA 3PSIA 3PUVA 4WFN3 1JCKB 2LSSA 3OIPA 4DV4Q 5A2QL 2NVYB 3M9BA 1MGSA 2SDFA 3HOZB 3MXGA 1GHKA 3SK8A 2R61A 4A3MB 3H94A 3WOFA 5FO7B 3AFPA 3NQIA 1A6XA 2G9DA 5J3BA 4DNRB 4KKTA 3BZDB 1STNA 2CH4A 3M7GA 1HFNA 2NZ1D 1MIUA 1VQJA 1R4QB 5JEAG 3KLWA 4A3EB 3BVMA 2PI2E 5M3MB 3OMGA 3IRBA 1XWEA 5AJ3L 4BY7G 4QGUA 1HUNA 1OXUA 3DM3A 1HR0L 1EL0A 4CJ2C 1SYBA 5BR8Q 4FNFA 1TS2A 5E4WC 2MPMA 2JE6I 1TWFH 2LS01 4DK3C 2UXBQ 5E3FA 4ALPA 1J8IA 1FNWA 2EDGA 3DWQA 5G3LF 2PMZE 1Z47A 4DFAA 1KXLA 2CVRA 1K0SA 1PHJA 4X3TA 4QUFA 4QUCA 1VQAA 4IQZA 1M1KC 3C1EA 2NVTH 1A15A 1FJGL 2N55A 1PFMA 3H3VC 2F4IA 5HURA 5FJ8H 4RGOS 1UWVA 1DXMA 3BZKA 3KDFB 2EXZA 3VYTA 3G6EA 3MZ5A 1EUJA 4HIOA 4AQYQ 1LT5D 4APVA 2M9VA 1CHQD 3GTMH 2VUMH 5DM63 4NXMQ 4IZ8A 1XMQL 3HOXH 4LF6L 1SE4A 4C3HH 2JA6H 3EQLC 1HFGA 4C3IH 3IFDA 4JYAL 1F9PA 3GO5A 2BH2A 4LW1A 1KDCA 3TP7A 1XMOL 1PRTB 1FYCA 3JC66 1G2SA 3LNNA 4A3GG 5FO8B 4EGVA 5BN4A 3QJYA 2FFKB 2NN6H 5IYBG 1Y1VH 1Q86C 4DV7Q 1D5MC 2G9HD 5KEEA 4OX9L 4CKCA 3FMCA 1QVGA 2UUBQ 2VY3A 5IYCG 1V1QA 1W6JA 3MXNA 4RG1A 4KHPQ 2BA1A 2F3IA 1A63A 3EIVA 4DUZQ 2RDHA 1GUGA 4QQBX 2XWBB 2KQ3A 1O7LA 1B3AA 5ISRA 2AWNA 1X3QA 2DUDA 1VQMA 1V9PA 3HGBA 5I4DA 1SNPA 3FPUB 4JI4Q 2K28A 2A6ED 5IYDH 1EY0A 2ZTCA 1O7IA 4X66Q 1CA5A 1M90C 2MHVA 4K0KQ 1WCMH 2Q8IB 3DMUA 1LUZA 3GV6A 4DPGA 2A68C 3ND9A 1BKBA 3H0GB 4A3KB 4XT1B 4DR5Q 4LF8L 1V1PB 5TSSA 2LKVA 3GTJH 1I4XA 2OEOA 1KNAA 2CWPA 4FP5D 4AYBG 2E2IH 2UUAQ 1XPUA 1O7YA 4IUVA 1EY5A 3J7AV 4DAYB 1WTRA 2RSNA 2RDFA 1WD0A 3QIAA 1SN8A 1RTOA 4DAPA 4KN4C 3QR8A 3X3NA 1YIJA 4QIWE 4DR2Q 2EJFC 1B3QA 3NSWA 1WTVA 3BYYB 5CGKA 1HNZL 3A7AB 2E8GA 1EOTA 5DAUA 3K81C 1VQGA 1HZAA 1Q1BA 1LTTD 1I6HB 1PVOA 1HXYD 3J7AF 2A69D 1PRTD 2F0KA 3J81E 5EJWA 1Z9FA 4A3MG 4GN4B 4JI6L 4R8NA 2CKZB 2KHSA 4ABNA 1JB3A 2KCTA 4A4IA 3GTOH 3D31A 2PW5A 4YCUA 1PFBA 4IURA 1H9MA 5CBEE 2F0GA 3AMUA 4OIJA 4A3EG 3BS1A 4LFBL 3A55A 1BQQT 5M5YH 1PH4A 1MHWC 5DM73 3RD4A 4CHTB 2F0JA 1NSNS 2E5LQ 1BNZA 2WKCA 1SMXA 5JEAH 1PH1A 4HJ7A 2UUCL 3PIOA 1TWAH 3QOLA 4BY7H 1NTGA 1STYA 2RKSA 4GLXA 3S2DH 4K2LA 2E2HB 4G7OC 4JI1Q 3TZUA 1K73C 1IXRA 2Z4IA 2DNEA 1IBLL 1VQ4A 4JG2A 5IGEA 1N36L 2XWJB 4GOPC 3GTLB 2F3WA 1WTOA 1IYUA 1FR3A 3QWNA 2FJ2A 4HR7B 2RHSB 2A6HD 1SRUA 1QNKA 2GVAA 4X62L 1VMCA 2ES2A 1X3PA 4EQOA 2KCNA 3MA2B 3VR6A 1KL9A 2ZXRA 2PZTA 4LF4Q 4O42A 4PMCA 1KLUD 1XTDA 3UDXA 2NB0A 2QEJC 3AFQA 2PNHA 3PUWA 1AH9A 2NVTB 2WIIB 1VF7A 3OSOA 4A3IB 2JA8G 3T16A 5CR3A 2F0MA 4GN3B 5CV4A 4DU9A 1Y8NB 5ELFA 1ESRA 3Q6SA 5D3IB 1JOOA 4YWLA 1II3A 3UDFA 3RR5A 3GTMB 2EPBA 3Q23A 4A93G 1DD2A 2AUJD 4MN3A 4CJ1B 1GXDC 1IBMQ 1D5XC 2UU9L 2CQAA 1QWYA 4A3GH 2JA6B 4A75A 4OXPA 4XTCS 3C1FA 4RHRA 2HDLA 1CK1A 3CPFA 1MSGA 5IYBH 3HKZB 1ENAA 2PNRC 1F2ZA 1EY9A 4KN7C 4C56C 1SDFA 3ERQA 1JQYD 1Q8KA 2EQSA 3TDQA 3X3MA 1Q8IA 2ASBA 3BJUA 2YTXA 3PF4A 5EBCA 5IYCH 2I46A 1QILA 1HA6A 4LK1C 1SNQA 1Y1VB 2L4NA 4FXGC 2ZXPA 1BUVT 3FP9A 1KAAA 1KHIA 2H4OA 3E0JA 2JA5B 2Z1CA 2KBNA 1TS4A 2WAQB 2XRQD 4UAIA 5CBAE 1QCBD 3T1YL 1NNXA 4PZ8A 3S9WA 1O7ZA 4DV4L 3H0GG 4A3KG 1ESFA 3KF8A 2EOTA 2CH4W 2RVLA 3LWUA 2JA9A 2SNSA 2BE5C 1PH2A 4KLKA 2ZJQA 1CKNA 1N32L 1GUSA 4ODGA 2KCMA 5C4ZA 3G6JB 1RCVD 1DCZA 5T1GA 3E9HA 3Q22A 3A74A 1STBA 1JJGA 5GQOA 2A68D 3U58A 1WCMB 1A8VA 3L7ZC 2QW7A 2RCFA 3MFGA 1HH2P 1PRTF 2K03A 4X3KA 4GOPB 2NVQB 1J5EQ 3RZDH 5IGGA 5EPJA 2RHQB 2A5HA 1K3RA 1AE3A 2I5MX 2NUCA 1C48A 1K8AC 3DWAA 1DOMA 5JVH3 5LMUL 4DKAC 2E2IB 4CDCC 2F0TA 3T4AC 4L5QA 4ULLA 2TMPA 1CFMA 2DY7A 5IGCA 4G4KA 3PUYA 2NVYH 4HJAA 4DV5L 4KD4A 4OL7A 1VQ6A 2K04A 2XVSA 4OIKA 2OTLA 2JYOA 4RH6A 4A3MH 3NBHB 1GVPA 1I4RA 4H0LC 1QVFA 4C1NK 2VS1A 3K5MA 4IUQA 1A3UA 1R4PB 4YCVA 1JORA 3A0JA 3DXJC 3OTOL 1XPOA 3OIQA 1NR4A 1Q82C 2SOBA 3J7YW 1BBUA 4NP5A 1AP0A 4IPHA 4GLVB 2K33A 1Y14B 1VCIA 3SHLA 1HNXQ 3H09A 2F52A 5DLQE 5HY6A 4DV6Q 3EN2A 2O4XA 3NUCA 3P1HA 2YU9B 1EU3A 1MJCA 3M4YA 4BXXG 5M5YB 1E24A 3T53B 4KTAA 1RJTA 2K32A 3PIPA 3S17H 4GLAC 3PMFA 1O78A 1X32A 3KDFA 3M7NA 1CZGA 3IAYA 4ME5A 5EGTA 5CMDA 1F77A 3H3VI 1C0AA 2MJ8A 1TWAB 4BY7B 4LFCL 4LUZA 4EQ5A 3A8KE 1EWCA 3WWVA 1XYIA 1S5DD 3OW7A 1MJEA 4B3ML 4CDFC 2A8VA 2EYMA 2ZJRA 4X64L 2UUBL 3A8JE 1MD2D 1ONLA 3AEVA 4J6HA 1GUWA 3CKIB 2PZWA 3I73A 1JWSD 3NHHA 3TSSA 3G4SA 4A3IG 1YJNA 1EIGA 1HZBA 4LUVA 2C9OA 2CHBD 1XNQQ 2B2VC 5G3LD 1PZJD 1WOCA 3H6MA 2EYPA 3CD6A 4GS3A 4YY3Q 4HCEA 2EXDA 2JA8H 3U9OA 4FXDA 1OXVA 1AE2A 1L0YB 4BY1B 1XX8A 3D4RA 4MZ9A 1HQRD 4XXEA 1PLFA 5IOCA 4DR5L 3CU7A 1B8AA 3KJOA 3HKZG 4A93H 2LFNA 1U5KA 4P75A 1JJ2A 5CYUA 3RLFA 1I4HA 4FVMA 4GKJQ 1ICWA 4J8QA 2A74C 3K7AB 3TQYA 1G6ZA 2DJFC 3OWFA 2EE1A 3HOUB 4DR7Q 2JA5G 4DAVA 4DR2L 1VQLA 5C5LA 4DN4M 1B9MA 3C2PA 1KLGD 2V4DA 2F0QA 4IPCA 4RAUC 1V1PA 2CQOA 2Y0SG 2IL8A 3CP0A 3GTKH 1Q3LA 1Q90A 1D7QA 4FF2A 4KY7A 4HAEA 1AZPA 1L2FA 4O2DA 1CSQA 4L5TA 4JI2Q 4DAYA 4LF5Q 1KRTA 1RF2D 2LY7A 3H0GH 2Q8RE 4A3KH 5K36G 1BVSA 4NMZA 4R4OA 1NMFA 4R8IA 5C44B 5I6WA 1GD7A 5KNCA 1QZGA 1JWUD 1U4LA 1TXYA 1RDPD 1ET6A 1LTBD 4V0BA 3S14H 2BE5D 1WTPA 1S5ED 3M4QA 2Q2UA 1Q1EA 4PQXA 3RZOB 1FL0A 3E3XA 4B3SQ 1OTCA 4KV6A 3UE1A 2EYOA 4X65Q 3H3VH 3I4LA 1EYDA 1XPRA 5IWAQ 1A62A 1I6HH 4HEDA 3GV3A 1RD9D 4JVZA 2I5HA 3JAMc 4CJ0B 3ITPA 1YHBA 2F4VQ 1IYJB 1TIID 3R2IA 2QKIC 3J80c 2K5HA 3RZDB 1K83B 4RGMA 4RGTA 2K5VA 3KBGA 1VQKA 1D6EC 4FF1A 2DY8A 5L37A 3U4ZA 4RHSA 3VR5A 3E5SA 4JI5L 4N9PA 1IKLA 1E7ZA 4ZRZA 4IFDG 5GROA 3D4DA 2VL6A 1X55A 4JI8L 1DONA 1V8QA 4DV3L 4B9WA 5ELDA 2RF4A 4KKUA 4X3SA 1TS5A 3K6OA 2E2HH 1Q12A 1VF5C 3R2TA 1YNJC 1QG7A 2BCOA 1PA6A 3T13A 4BXXH 1B53A 2DN8A 4CKEA 5M5WB 3S16B 4DAMA 1UEAB 3GTLH 2GA4B 3A5UA 1SAPA 5FLXL 4PMBA 5IT9E 4N8X1 4LMQD 1PV4A 3M4PA 3T1HL 2A6HC 1D5ZC 1QUQB 2XIWA 2Z6KC 4MNOA 4C1NI 1ILQA 2R92B 3Q24A 3J7A5 1SFOH 3S17B 2R7DA 2RQXA 3W2DA 2XSCA 5EQ0A 4KI0A 2VQFQ 4LF9Q 4DV2Q 1Z7TA 2EVBA 2KEDA 1F2MA 4K6DA 3H91A 4A3IH 4LUOA 2QF7A 1YBYA 4B9XA 3NWSA 4L5RC 4BY1G 4JI7Q 1FD7D 4C3JG 5FK9C 1IL8A 1HNWQ 5HGQA 4IFDI 4HJ5A 5GADC 1I94L 1PH6A 4TKOB 1X3FA 2EYHA 1EY7A 2B39A 2WKDA 4QCLA 4IN3A 3I3CA 3HOUG 4K5XA 5EPLA 5C4JB 2OCEA 2JA8B 4IO9A 1N9WA 3NP8A 1LYLA 1TWCH 2WB1E 1VQ8A 4YCWA 3MWYW 4IUUA 3OW2A 1EFID 1HUMA 1YI2A 3HZXA 2HCIA 3URYA 5ELEA 4IJLA 5JPMC 1G6PA 4LFAL 1W3SA 1JICA 4OO1G 2NYZD 4DV1Q 4A93B 3CCJA 5J22A 3MTSA 2JA5H 1WYDA 4NXNL 4K5VA 1GKHA 1WTWA 2BOSA 4XDXA 4KD3A 1L0WA 4KY5A 1NMGA 2VZAA 2PW7A 3VDYA 1HR0W 4RKBA 1C9OA 2MP1A 5LHY1 2E2JB 1B50A 1X9NA 2L15A 1SSOA 5C44G 1BCPF 4GOPA 2ZM6Q 2L0CA 2D0PA 2NWGA 4JOIC 4CBVA 5LL6X 4G57A 1GUOA 3PIO3 1GJXA 3GTKB 1XNRL 1B44D 5K36H 3VYUA 3V05A 2VNUD 3F8TA 2EYLA 1EEID 1AZQA 3BZCA 1C4QA 2F0EA 2NVQH 3ONAB 1S5BD 2CFMA 2N3SA 5KGUA 5DEHA 1ASYA 3ERSX 3NBHA 2B2TA 1BR9A 1RODA 3ULJA 3WDNA 3R3OA 4OWXB 4B3TQ 3SK4A 4DR1L 1BOSA 5JJIA 2E74C 4GKKL 3K80C 3S14B 2MQHA 4HMJA 1Y1WG 1VQCA 4DK1A 1UUPA 3S1RB 1SE3A 4F88A 2YYZA 1UE5A 4F7XA 2Q8TA 4A3FG 4OO1I 4JI3L 5FOBB 4B3RQ 1SMYC 3SR1A 1NAPA 2K5QA 2UXDQ 2MNAA 2H1EA 1D2BA 4MTNA 4E6IA 4O0AA 2WAQE 4P74A 1VQ5A 3KOJA 3RN2A 2WINB 3I8ZA 4KJOA 1BXTA 2MFIA 2AWOA 2G5DA 3RMHA 4CKBA 3EBEA 4IFDH 2LXKA 1QVCA 3F2UA 2YU9H 5BN3A 4BBSB 3BDOA 2RA4A 3KK7A 1C7YA 1LTAD 2JA7B 2A1AA 2HHHQ 2D5DA 3HG9A 2K5DA 5IY0A 4DR3L 3S2HH 4RCNA 1EFWA 1OXSC 3M4OH 3CCRA 2I0QA 3ER0A 1LT4D 2GN5A 1X56A 1QNUA 2K05A 2OQ0A 1SLJA 3IL8A 1X3EA 2K1BA 5J39A 1JOKA 2R92G 3GTPH 1YNJD 2QILA 1KRSA 3GP7A 1IYVA 1FGBD 4JI0Q 1S4ZA 3M85A 1N33Q 2CW0C 2EZVA 4K14A 4DXGA 2IWHA
chains in the Genus database with same CATH topology
3MXPA 3ND8A 3FPPA 2C5CA 5C4XB 2IX0A 3TBIB 1E2WA 5ELBA 3CRKC 2F0VA 1DYQA 2E76C 2B2UC 3VYRA 1CZWA 5C3XA 3MAQA 1NR2A 1TT2A 3IKJA 3D8GA 1SFOB 1EYAA 3LX0A 4XQJA 2B2WC 2F0HA 3D6WA 3G7LA 1TVXA 1RHPA 3P7JA 3C46A 1EQVA 2B2TC 4TQUS 5AFWA 5D14A 1RTNA 3RUZA 4Y7NB 2R7ZB 1SE2A 1HRJA 4X3UA 1QOHA 1EEFD 1K8MA 3D3RA 2XN9C 4KY6A 2X6LA 5JAVA 4OO1H 1ZKOA 2WV6D 1TWCB 5C6AA 1SJED 3SDZA 1LT6D 4BA1I 1KNEA 1CA6A 2EY6A 4ZQ3A 2B2YC 4L8JA 3D6CA 4RGNA 2J7ZA 2WACA 3GD7A 3QG1A 2L1BA 2O2LD 4DK0A 4H13C 2Y0SB 4K8IA 3PIP3 2HDMA 1BCPC 1A2TA 4DNTB 2F0LA 3J81L 1TU2B 2B2VA 4UDUC 2FMMA 2DNCA 1SBBB 5CV8A 4C2MB 3S1QB 4MIUA 1CI3M 5EBDA 3NTIA 3EFXD 4F87A 5NUCA 2IX3A 1ENCA 2X69A 3GQBA 3JAME 4O1NA 3J80E 1EQTA 3S1MB 2VB2X 2EY5A 2JEAI 2IX1A 1SMYD 4Q5VA 5CORA 4ZLTF 4BBRB 2D62A 3VYSA 1STAA 1EU4A 1H9JA 3FDTA 1DM0B 3HRZC 3KLSX 4IUNA 3DEPA 2PPBC 1EZ6A 1DOLA 1HPCA 3FKIB 3EVQA 4NDXA 5IGFA 4I7ZC 1Y8PB 1B2TA 3PUXA 3S2HB 2EY1A 3M4OB 2J0TD 4OHJA 1BF4A 3LWEA 4XQNA 2NVXB 3GTPB 5CV9A 4ZUJA 2CW0D 1NUCA 1B4OA 1AFPA 3DWPA 5KRUA 2BDOA 3I72A 1KDAA 5KNBA 4RA8A 1BCPB 1LABA 2KJXA 1ZXTA 1DOKA 3D4WA 5A2QE 3I4NB 1I50B 1SNOA 2F0SA 1AN8A 3BG3A 2K6AA 1IW7C 3UI2A 3Q0AA 4M8AA 1V1OA 1F2LA 2JEBI 3OOCA 4EQNA 4C3JB 1D1KA 1A2UA 4ZYSA 3MC0B 5F2DA 3SK6A 3OHXC 5C0XJ 1M8AA 1EIHA 3VR4A 1SYDA 1T5XD 3PUZA 1SNDA 4A3DB 1C8CA 1AEXA 4QB4A 1PTOC 1I4QA 4Q0FA 3SXHA 1HCZA 4ZKBB 3BVZA 3BYTB 4DF7A 3PV0A 4NW2A 4H44C 3SEBA 5COYA 1QB5D 2ID0A 1LACA 2PYKA 5KYLA 1S5CD 5C0XG 1VDZA 4U673 1KABA 1F9QA 1BCPD 1L0XB 3T56B 5HGTA 1T5EA 2OXPA 3IFTA 3TN2A 1IKMA 3T51B 4HMIA 1AW7A 4DA2A 3NQTA 2PZUA 4M1UB 4A3JB 3MHBA 4TRDA 4IUTA 2EY2A 4HCSA 1Y1WB 1D1IA 1CHPD 3I90A 5JPNC 5KYIA 1HA5A 1TQOA 4A3FB 5IIFA 1LO5D 3TP6A 2F0PA 4K6LA 2XRSD 5I9PA 5A35A 2F0UA 5JEAJ 4K8JA 4ILWA 2RDGA 3TP5A 1U9RA 2QDBA 3HS0C 5C0XI 4FF4A 2RSOA 4FF3A 4FO2A 5T1IA 1STEA 2KECA 5M9OA 3PO2B 1KTKA 1RKNA 4CGYB 3HEJA 4QF4A 1PTOB 1I3QB 1TY0A 1LV9A 2MGSA 3K59A 2IPKD 4HSVA 2F0OA 2RBMA 2KA7A 2Z4HA 3CHBD 2L11A 2VB3X 1SXTA 3SVMA 5C5MA 1JE4A 4EQPA 1ZYRC 3V96A 2PCFB 1PZKD 1BDOA 4F8MA 4RCOA 4L6TB 1G91A 1E0BA 2HUGA 3K5LA 3S1NB 2FMCA 2VXWA 5JOBA 5KNDA 2K5WA 1PYWD 5E4XA 1ZEQX 5FO9B 1IW7D 3DHQA 4KK7A 1F9RA 1SYCA 5M5XB 2M2LA 5I2YA 3K58A 5EKLA 1XTCD 3PO3B 5CV5A 2A73B 1I4GA 1NCVA 3GTGB 3I70A 2LMCB 3L3OC 3NPPA 2TSSA 5CV6A 1CQFA 1SYEA 3R93A 1LTGD 1A3VA 2QCPX 4DXFA 1S5FD 4R9WA 2IJ0A 1IHZA 2O5JC 4FXKC 1PTOD 4GZYC 4DGZA 4K5WA 1HQMC 3QOJA 4PV1C 2B2UA 2J4XA 3BVGA 1TS3A 1R9TB 1MI2A 5CV7A 3N52A 3OMCA 3A56A 4NKLA 2F0IA 5C0XH 1STHA 1EZ8A 1G8ZD 2B2WA 2O5IC 2K7VA 5ELCA 3S15B 1PDQA 4FYDA 4QMGA 3KLRA 3OWEB 1F2YA 2IW3A 3P20A 5CC4A 1Y8OB 3MVVA 4S3SA 4Z9CB 2L12A 1UAPA 4LAAA 1I6VC 5D65A 1H9SB 2JSOA 1EY8A 4LJZC 4B08A 2F3VA 3DM1A 1WTXA 5C3EB 3OPOA 4IALA 5EKIA 3A8IE 1DZ1A 2KVMA 3N6RA 1UNSA 1TWGB 3WOEA 5IT9L 4XT3B 4K2KA 3I4MB 1G2TA 2B2YA 5C4HA 1J9OA 2ZT9C 4XQQA 1SNCA 2PMZB 1O80A 4PMWA 1PZID 5M3FB 5JJZA 1PMRA 4WORA 3K5OA 5IGDA 3NWTA 3NE5B 3GTQB 1WTQA 1SYGA 1U4PA 1GHJA 2L9HA 1CQVA 5LL6S 2EJGC 2D2CC 2B8GA 3HOWB 4IUPA 2AUKA 4BA2I 3HOYB 3AB9A 2L55A 3R8BA 5I9OA 5JVG3 2F0WA 4ZAIA 2PO4A 4WJWA 2X6GA 3HOVB 2WB1B 2F1MA 5K5PA 1ET9A 2AQ3B 2AQ1B 2HCCA 1ZYRD 1JWMD 4BS9A 1M4VA 3VA7A 1TWHB 3EJIA 4XIGS 3DUZA 2ZXOA 3SK5A 1TWFB 1CTMA 2ENBA 2F0NA 4RKLA 2M00A 3NTHA 3BDCA 1W6KA 4TSSA 4EVOA 3CRLC 1PTOF 2Z8LA 1HTPA 5EPKA 3W3AA 2B63B 2D9UA 1JR0D 2VUMB 1SNMA 3KBXA 1LT3D 4ID6A 4L63B 3HOXB 4C3HB 1GUTA 4C3IB 1Z6HA 2KEEA 3NK9A 3FEWX 1HTLD 2PQEA 1K8OA 4QIWB 2B8FA 1SJHD 1Y69U 1A3TA 5J1ZA 1LTRD 2F0DA 4J1MA 4ZUIA 4YIJA 3CQZB 1HHVA 3ZYYX 3QB3A 2FINB 2SEBD 3MFYA 4HN7A 5IGBA 1E2ZA 1JOQA 2ICIA 3KUPA 2NBFA 1YNNC 3GTJB 1PFNA 2KUMA 4BWGB 1OO9B 4H7BA 4OGQC 4I65A 2R93B 3V2TA 4P2CB 4XYOA 1LTSD 1EY6A 1LTID 2R6GA 1MBYA 1SYFA 1PTOH 2FHTA 2K01A 2OT2A 3K5NA 3I91A 2IWHA 2MUYA 1BBXC 2E2DC 1STGA 1XXGA 3GTOB 1WVLA 2F03A 4N9TA 3EROA 1U4RA 4G7HC 1TR5A 1VMPA 3DEOA 4ZKCB 1CM9A 2JXMB 3MEHA 4KMUC 2N88A 4KHVA 1U4MA 1KDBA 4G7ZC 3A54A 3VR2A 3S2DB 5I2XA 3U9SA 4HTHA 1CT1D 2IT1A 3L9AX 1EYCA 1ENFA 2BDNA 1V43A 4WRDA 1F9SA 1OXTA 5FKAC 2HQEA 5EKKA 2EYFA 1H9KA 2KOLA 5FLXE 5I6YA 4JBWA 2NTTA 3TZDA 2I07B 1JC7A 3E6ZX 2NTSA 4C3HG 1FNUA 4C3IG 2XNAC 3NBIA 1I4PA 4PNYA 1ILPA 2L5TA 4RWSC 4U68A 4JK1C 5E1FA 3C3LA 2EJMA 5KIXA 2NN6G 3SE0A 1FNVA 3JAML 3KLSA 1H9RA 4KJNA 4A3GB 1BO0A 3J80L 1GOZA 1SEBD 1H9SA 1TY2A 3K0YA 1QE6A 2R3ZA 1LLRD 2JP1A 5DNFA 3QO2A 2ICEC 3MXUA 2BA0A 2A6EC 2F0FA 2SNMA 4HSPA 3VA5A 1E2VA 4KHZA 3TP8A 2OF1A 3EA6A 5C3WA 2KCCA 2EYJA 3K57A 1TKWB 3BDLA 3TMEA 5BN5A 2E75C 1EY4A 3A7LA 5IODA 1GUNA 1G291 4A3BB 4V190 4IFDJ 4RFBA 3P75A 2WP8J 4MHEA 4XYQA 3NTKA 5D3DA 1B9NA 1DJRD 3FVQA 3NXWA 3FRPB 3O13A 1PXUA 1QJOA 3M3YB 1EWHA 1ML0D 2A69C 1PRTC 2NN6I 4ZK9B 3AU7A 4AYBB 1B1ZA 2AQ2B 1WD1A 1YNND 4KKSA 1MSHA 3HP3A 1OXXK 3VR3A 3PUVA 4WFN3 1JCKB 3OIPA 5A2QL 2NVYB 1MGSA 2SDFA 3HOZB 3MXGA 1GHKA 3SK8A 2R61A 4A3MB 3H94A 3WOFA 5FO7B 3NQIA 1A6XA 2G9DA 4DNRB 4KKTA 3BZDB 1STNA 3M7GA 1HFNA 2NZ1D 1R4QB 5JEAG 4A3EB 3BVMA 5M3MB 3OMGA 1XWEA 1HUNA 1OXUA 1EL0A 4CJ2C 1SYBA 4FNFA 1TS2A 5E4WC 2MPMA 2JE6I 2LS01 5E3FA 1J8IA 1FNWA 2EDGA 3DWQA 5G3LF 1Z47A 4DFAA 2CVRA 4X3TA 4QUFA 4QUCA 4IQZA 3C1EA 1A15A 2N55A 1PFMA 3H3VC 2F4IA 5HURA 4RGOS 1DXMA 2EXZA 3VYTA 3MZ5A 1LT5D 2M9VA 1CHQD 5DM63 4IZ8A 1SE4A 3EQLC 1HFGA 3IFDA 1F9PA 3GO5A 1KDCA 3TP7A 1PRTB 1FYCA 1G2SA 3LNNA 5FO8B 4EGVA 5BN4A 3QJYA 2FFKB 2NN6H 1D5MC 2G9HD 5KEEA 4CKCA 3FMCA 1W6JA 3MXNA 2BA1A 2RDHA 1GUGA 2XWBB 2KQ3A 1O7LA 1B3AA 5ISRA 2AWNA 1X3QA 3HGBA 5I4DA 1SNPA 3FPUB 2K28A 2A6ED 1EY0A 1CA5A 2MHVA 2Q8IB 3DMUA 3GV6A 2A68C 3ND9A 3H0GB 4A3KB 4XT1B 1V1PB 5TSSA 2LKVA 1I4XA 2OEOA 1KNAA 4FP5D 1O7YA 4IUVA 1EY5A 3J7AV 1WTRA 2RSNA 2RDFA 1WD0A 3QIAA 1RTOA 4DAPA 4KN4C 3X3NA 2EJFC 3NSWA 1WTVA 3BYYB 5CGKA 3A7AB 1EOTA 5DAUA 1Q1BA 1LTTD 1I6HB 1HXYD 3J7AF 2A69D 1PRTD 2F0KA 3J81E 5EJWA 4R8NA 2KHSA 4ABNA 1JB3A 3D31A 2PW5A 1PFBA 4IURA 1H9MA 5CBEE 2F0GA 3AMUA 4OIJA 3BS1A 3A55A 1BQQT 5DM73 3RD4A 4CHTB 2F0JA 1NSNS 1BNZA 2WKCA 5JEAH 3QOLA 1STYA 2RKSA 4K2LA 2E2HB 4G7OC 3TZUA 2Z4IA 2DNEA 5IGEA 2XWJB 3GTLB 2F3WA 1WTOA 1IYUA 1FR3A 3QWNA 2FJ2A 4HR7B 2A6HD 1QNKA 1VMCA 1X3PA 4EQOA 2KCNA 3MA2B 3VR6A 2ZXRA 2PZTA 4O42A 4PMCA 1KLUD 2NB0A 2QEJC 3PUWA 2NVTB 2WIIB 1VF7A 3OSOA 4A3IB 3T16A 5CR3A 2F0MA 5CV4A 4DU9A 1Y8NB 5ELFA 1ESRA 3Q6SA 5D3IB 1JOOA 1II3A 3GTMB 2EPBA 3Q23A 1DD2A 2AUJD 4MN3A 4CJ1B 1GXDC 1D5XC 2CQAA 1QWYA 2JA6B 4XTCS 3C1FA 4RHRA 2HDLA 1CK1A 1MSGA 1ENAA 3HKZB 2PNRC 1F2ZA 1EY9A 4KN7C 4C56C 1SDFA 3ERQA 1JQYD 3TDQA 3X3MA 1Q8IA 5EBCA 2I46A 1QILA 1HA6A 4LK1C 1SNQA 1Y1VB 2L4NA 4FXGC 2ZXPA 1BUVT 1KAAA 2H4OA 3E0JA 2JA5B 2Z1CA 1TS4A 2WAQB 2XRQD 4UAIA 5CBAE 1QCBD 3S9WA 1O7ZA 1ESFA 3KF8A 2EOTA 2RVLA 3LWUA 2SNSA 2BE5C 1GUSA 4ODGA 5C4ZA 3G6JB 1RCVD 1DCZA 5T1GA 3Q22A 1STBA 2A68D 1WCMB 3L7ZC 3MFGA 1PRTF 4X3KA 2K03A 2NVQB 5IGGA 5EPJA 2A5HA 2NUCA 1C48A 3DWAA 1DOMA 5JVH3 2E2IB 2F0TA 3T4AC 4ULLA 2TMPA 1CFMA 2DY7A 5IGCA 4G4KA 3PUYA 4KD4A 4OL7A 2K04A 2XVSA 4OIKA 2JYOA 4RH6A 1I4RA 4H0LC 4C1NK 3K5MA 4IUQA 1A3UA 1R4PB 1JORA 3DXJC 3OIQA 1NR4A 2SOBA 3J7YW 4NP5A 1AP0A 2K33A 1VCIA 3SHLA 3H09A 2O4XA 3NUCA 3P1HA 2YU9B 1EU3A 3M4YA 5M5YB 3T53B 4KTAA 1RJTA 2K32A 3PMFA 1O78A 1X32A 3M7NA 1CZGA 3IAYA 4ME5A 5EGTA 5CMDA 1F77A 2MJ8A 1TWAB 4BY7B 3A8KE 1EWCA 1XYIA 1S5DD 3OW7A 2EYMA 3A8JE 1MD2D 1ONLA 4J6HA 1GUWA 3CKIB 2PZWA 3I73A 1JWSD 3NHHA 3TSSA 1EIGA 2C9OA 2CHBD 2B2VC 5G3LD 1PZJD 3H6MA 2EYPA 4HCEA 3U9OA 4FXDA 1OXVA 1L0YB 4BY1B 1XX8A 3D4RA 1HQRD 4XXEA 1PLFA 5IOCA 3CU7A 2LFNA 5CYUA 1I4HA 4FVMA 1ICWA 4J8QA 2A74C 3K7AB 1G6ZA 3OWFA 2EE1A 3HOUB 4DAVA 5C5LA 4DN4M 1B9MA 3C2PA 1KLGD 2V4DA 2F0QA 4RAUC 1V1PA 2IL8A 1Q3LA 1Q90A 4FF2A 4KY7A 4HAEA 1AZPA 4DAYA 1RF2D 2LY7A 2Q8RE 5K36G 4NMZA 4R8IA 5C44B 5I6WA 5KNCA 1JWUD 1U4LA 1RDPD 1ET6A 1LTBD 4V0BA 2BE5D 1WTPA 1S5ED 1Q1EA 4PQXA 3RZOB 4KV6A 2EYOA 3I4LA 1EYDA 4HEDA 3GV3A 1RD9D 4CJ0B 3ITPA 1TIID 3R2IA 2QKIC 3RZDB 1K83B 4RGMA 4RGTA 3KBGA 1D6EC 4FF1A 2DY8A 4RHSA 3VR5A 3E5SA 4N9PA 1IKLA 4ZRZA 4IFDG 3D4DA 1DONA 1V8QA 4B9WA 5ELDA 4KKUA 4X3SA 1TS5A 3K6OA 1Q12A 1VF5C 3R2TA 1YNJC 1QG7A 2BCOA 3T13A 1B53A 2DN8A 4CKEA 5M5WB 3S16B 1UEAB 2GA4B 1SAPA 5FLXL 4PMBA 5IT9E 4LMQD 2A6HC 1D5ZC 2XIWA 4C1NI 1ILQA 2R92B 3Q24A 3S17B 2RQXA 3W2DA 2XSCA 5EQ0A 4KI0A 1Z7TA 2EVBA 2KEDA 1F2MA 4K6DA 3H91A 2QF7A 4B9XA 3NWSA 1FD7D 4C3JG 5FK9C 1IL8A 4IFDI 4TKOB 2EYHA 1EY7A 2B39A 2WKDA 4QCLA 4IN3A 3I3CA 4K5XA 5EPLA 5C4JB 2JA8B 3NP8A 3MWYW 4IUUA 1EFID 1HUMA 3HZXA 2HCIA 3URYA 5ELEA 5JPMC 1JICA 4OO1G 2NYZD 4A93B 5J22A 3MTSA 1WTWA 4K5VA 2BOSA 4XDXA 4KD3A 4KY5A 2PW7A 4RKBA 2MP1A 5LHY1 2E2JB 1B50A 1SSOA 1BCPF 2L0CA 2NWGA 4CBVA 5LL6X 4G57A 1GUOA 3PIO3 1GJXA 3GTKB 1B44D 5K36H 3VYUA 3V05A 2VNUD 2EYLA 1EEID 1AZQA 1C4QA 2F0EA 3ONAB 1S5BD 5KGUA 5DEHA 3NBHA 2B2TA 1BR9A 1RODA 3WDNA 3R3OA 3SK4A 1BOSA 2E74C 3S14B 4HMJA 4DK1A 1UUPA 3S1RB 1SE3A 4F88A 2YYZA 4F7XA 2Q8TA 4OO1I 5FOBB 1SMYC 3SR1A 1NAPA 2K5QA 2H1EA 1D2BA 4E6IA 2WINB 3I8ZA 4KJOA 1BXTA 2AWOA 3RMHA 4CKBA 4IFDH 3F2UA 4BBSB 5BN3A 3BDOA 2RA4A 3KK7A 1LTAD 2JA7B 2D5DA 3HG9A 2K5DA 4RCNA 1OXSC 1LT4D 1QNUA 2K05A 3IL8A 2K1BA 5J39A 1JOKA 1YNJD 2QILA 3GP7A 1IYVA 1FGBD 1S4ZA 3M85A 2CW0C 2EZVA 4K14A 4DXGA 3RLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXP A;  5CV5 A;  1SNC A;  4B9W A;  5E3F A;  2LKV A;  1STG A;  3NK9 A;  4KD4 A;  2F0F A;  2OEO A;  2SNM A;  3OSO A;  3OWF A;  4G57 A;  3VA5 A;  4N9T A;  4OL7 A;  5CV8 A;  3TP8 A;  4DFA A;  4MIU A;  3ERO A;  4WOR A;  2OF1 A;  1EY5 A;  3T16 A;  5KYI A;  1TQO A;  5CR3 A;  2PQE A;  2F0V A;  5C3W A;  2F0M A;  5IIF A;  1TR5 A;  2RDF A;  3TP6 A;  5C5L A;  3T13 A;  4EQN A;  2F0P A;  5CV4 A;  4DU9 A;  5NUC A;  5IGD A;  1A3U A;  5CV6 A;  5C3X A;  1JOR A;  1SYE A;  1ENC A;  5I9P A;  1JOO A;  2EYJ A;  2EYL A;  1II3 A;  1TT2 A;  2F0Q A;  3C1E A;  2F0U A;  3MEH A;  1SYG A;  1A3V A;  3BDL A;  3D8G A;  3TME A;  4K8J A;  1A2U A;  2SOB A;  2F0E A;  1EYA A;  5HUR A;  3LX0 A;  4NP5 A;  1EY4 A;  1A3T A;  5F2D A;  4PMB A;  5CGK A;  5IOD A;  3SK6 A;  5KGU A;  2F0H A;  4KY7 A;  4KHV A;  5DAU A;  3SHL A;  1KDB A;  5DEH A;  3TP5 A;  5J1Z A;  2EXZ A;  1IHZ A;  1U9R A;  3MZ5 A;  2QDB A;  3C1F A;  2O4X A;  2F0K A;  4HTH A;  2EY5 A;  3P75 A;  4DGZ A;  4K5W A;  2F0D A;  3NUC A;  3R3O A;  1EQV A;  1ENA A;  3QOJ A;  3SK4 A;  1F2Z A;  1EY9 A;  3P1H A;  1EYC A;  4J1M A;  1SYD A;  4R8N A;  4IZ8 A;  3ERQ A;  3NXW A;  4NMZ A;  5I9O A;  1SND A;  4ZUI A;  5M9O A;  4HMJ A;  2KHS A;  5I6W A;  2F0W A;  4WRD A;  4YIJ A;  1RKN A;  4KTA A;  3RUZ A;  5CV7 A;  2HQE A;  1F2M A;  4K6D A;  2PW5 A;  4F7X A;  3QB3 A;  3HEJ A;  1AEX A;  1STA A;  3OMC A;  3PMF A;  2F0G A;  4NKL A;  2F0I A;  4QB4 A;  5EKK A;  1STH A;  1EZ8 A;  1SNQ A;  2EYF A;  1KDC A;  4K14 A;  3TP7 A;  4B9X A;  5K5P A;  1KAA A;  4ME5 A;  4QF4 A;  5EGT A;  3SR1 A;  5IGB A;  3SXH A;  1JOQ A;  5I6Y A;  4E6I A;  2F0J A;  1NSN S;  3EJI A;  4IUN A;  4DF7 A;  4KY6 A;  2EYM A;  5JAV A;  3S9W A;  1EZ6 A;  2F0O A;  2RBM A;  4KV6 A;  3EVQ A;  2EYO A;  4KJO A;  4NDX A;  4QMG A;  3SK5 A;  5IGF A;  5KEE A;  2EYH A;  1EY7 A;  1F2Y A;  5C6A A;  3QOL A;  1EYD A;  5C5M A;  4J6H A;  4EQP A;  2PYK A;  1STY A;  2RKS A;  2SNS A;  2PZW A;  5CC4 A;  4K2L A;  3MVV A;  4S3S A;  2ENB A;  2F0N A;  3NHH A;  4PNY A;  5KYL A;  2EY6 A;  3ITP A;  4LAA A;  4ZQ3 A;  2EY1 A;  4F8M A;  4K5X A;  2M00 A;  4ODG A;  1EY8 A;  4RKL A;  3SK8 A;  5C4Z A;  1KAB A;  3NP8 A;  3D6C A;  4H7B A;  5E1F A;  1STB A;  4I65 A;  5HGT A;  5IGE A;  3BDC A;  3V2T A;  2OXP A;  2F3V A;  2KQ3 A;  3H6M A;  4HMI A;  2EYP A;  1STN A;  2WAC A;  2F3W A;  3HZX A;  5JOB A;  5KIX A;  4EVO A;  5ISR A;  5CV9 A;  4ZUJ A;  1EY6 A;  1SNP A;  1NUC A;  3NQT A;  3U9O A;  3E5S A;  4IAL A;  1SYF A;  5IGG A;  2PZU A;  3OMG A;  4KJN A;  1EY0 A;  5KRU A;  5J22 A;  4N9P A;  4K8I A;  4K5V A;  4EQO A;  4KD3 A;  3DHQ A;  2NUC A;  3MHB A;  1A2T A;  4KY5 A;  1SYC A;  1KDA A;  2PZT A;  4K2K A;  5IOC A;  5J39 A;  1SYB A;  1JOK A;  2PW7 A;  3DMU A;  4PMC A;  4RKB A;  3D4D A;  2F0L A;  4TRD A;  1SNM A;  3D4W A;  2F0T A;  5EKL A;  5C4H A;  4ID6 A;  1SNO A;  2F0S A;  5IGC A;  2EY2 A; 
#chains in the Genus database with same CATH topology
 1JJC B;  3MXP A;  3ND8 A;  5IT9 c;  3FPP A;  2C5C A;  3STB C;  5C4X B;  2K5N A;  2IX0 A;  3TBI B;  2VQE Q;  1E2W A;  5ELB A;  3CRK C;  2F0V A;  1I50 H;  1DYQ A;  4JV5 L;  2E76 C;  2B2U C;  4JBK A;  3L0O A;  4LF7 Q;  3VYR A;  1CZW A;  5C3X A;  3MAQ A;  1NR2 A;  1TT2 A;  3IKJ A;  3D8G A;  1SFO B;  1EYA A;  3LX0 A;  1VQO A;  4XQJ A;  2B2W C;  2F0H A;  4DR6 Q;  4BY1 H;  3D6W A;  4C3J H;  3G7L A;  4DV0 Q;  1TVX A;  1RHP A;  2QGQ A;  2HIV A;  3P7J A;  1L1O C;  3C46 A;  4DR4 Q;  1EQV A;  2B2T C;  1K3B C;  3PO3 G;  4TQU S;  3NEM A;  5AFW A;  5D14 A;  1VQ9 A;  1RTN A;  3RUZ A;  3K7A H;  3AYH B;  4Y7N B;  2R7Z B;  1PYB A;  4WJ3 M;  1X3G A;  1SE2 A;  2Z9H A;  1HRJ A;  4X3U A;  3HOU H;  3J81 i;  1VQE A;  1QOH A;  1EEF D;  1K8M A;  3D3R A;  3I4O A;  2XN9 C;  4KY6 A;  4PG3 A;  2X6L A;  5JAV A;  4OO1 H;  5IWA L;  1ZKO A;  2WV6 D;  1TWC B;  2YTV A;  1SJE D;  5C6A A;  2F4V L;  3SDZ A;  1LT6 D;  3F2D A;  5LMN L;  1A0I A;  4BA1 I;  1KNE A;  4JC0 A;  5AJ3 Q;  4JBM A;  1CA6 A;  2EY6 A;  5IP9 G;  2YV5 A;  4ZQ3 A;  1HR0 Q;  2B2Y C;  4L8J A;  3D6C A;  4RGN A;  3ICE A;  5C44 H;  2J7Z A;  3CCQ A;  2UXC L;  2K14 A;  2WAC A;  3GD7 A;  3QG1 A;  2L1B A;  2O2L D;  4DK0 A;  1PH8 A;  4H13 C;  3Q8D A;  1RL2 A;  2Y0S B;  1XJV A;  4K8I A;  3PIP 3;  3J7Z C;  2HDM A;  1BCP C;  1A2T A;  4OEM B;  4DNT B;  3RZO H;  1IBK Q;  2F0L A;  4IPD A;  3J81 L;  1TU2 B;  4YHH Q;  2AHO B;  2B2V A;  3E0E A;  1FJG Q;  4UDU C;  1KQS A;  1LTL A;  1YHA A;  2FMM A;  2A19 A;  2DNC A;  3A5Z B;  1SBB B;  5CV8 A;  4C2M B;  3S1Q B;  4MIU A;  1CI3 M;  5EBD A;  3NTI A;  1K83 H;  3EFX D;  5BR8 L;  4F87 A;  1Y1W H;  5NUC A;  2IX3 A;  1ENC A;  2X69 A;  2NZH A;  4LF6 Q;  3GQB A;  3JAM E;  1YIT A;  5C3E G;  4O1N A;  3J80 E;  4JYA Q;  1U0L A;  4A3F H;  2UXB L;  1EQT A;  3S1M B;  2JN4 A;  2VB2 X;  1FGU A;  3RN5 A;  2N78 A;  1XMO Q;  3I4M G;  2N49 A;  4JBJ A;  4HJ8 A;  2EY5 A;  2JEA I;  2K50 A;  2IX1 A;  1SMY D;  4BBS G;  1L1O B;  4Q5V A;  5COR A;  2JA7 G;  5M3F G;  4ZLT F;  4BBR B;  2D62 A;  3VYS A;  1P8L A;  1STA A;  1EU4 A;  1H9J A;  3FDT A;  1HNW L;  4AQY L;  5ELO A;  3CCU A;  1DM0 B;  5M5W H;  4UP8 A;  3HRZ C;  3S16 H;  2IY5 B;  3KLS X;  4NXM L;  1UE6 A;  4H02 A;  4IUN A;  3DEP A;  3ZJY C;  2PPB C;  2HT1 A;  1EZ6 A;  1DOL A;  2GVB A;  1HPC A;  3FKI B;  3EVQ A;  4NDX A;  5IGF A;  1I3Q H;  1E3P A;  4I7Z C;  1Y8P B;  3RNU A;  3HOW G;  5C4X G;  1B2T A;  3HOY G;  3PUX A;  2R92 H;  3S2H B;  2EY1 A;  3M4O B;  2J0T D;  4JW0 A;  4NB3 A;  4AYB E;  4OHJ A;  1BF4 A;  3LWE A;  1YJW A;  4LF8 Q;  4DV7 L;  3HOV G;  4XQN A;  2NVX B;  1PH9 A;  3GTP B;  5CV9 A;  1Q46 A;  4ZUJ A;  2CW0 D;  1NUC A;  1B4O A;  1AFP A;  3DWP A;  4R1J A;  5KRU A;  3STB D;  4KHP L;  2BDO A;  2CWA A;  3PF5 A;  3I72 A;  3AQQ A;  1KDA A;  5KNB A;  4RA8 A;  1BCP B;  4DUZ L;  1LAB A;  2KJX A;  1ZXT A;  5JJK A;  1VQF A;  4UHV A;  1DOK A;  3D4W A;  5A2Q E;  3I4N B;  1I50 B;  1SNO A;  2F0S A;  1AN8 A;  3BG3 A;  4FDB A;  3PQI A;  2K6A A;  1HNZ Q;  1JT8 A;  4JI4 L;  2R7Z G;  1IW7 C;  3UI2 A;  3UDI A;  3F2C A;  3UDG A;  4X66 L;  3Q0A A;  3JAM i;  4M8A A;  5C4J H;  1X6O A;  3FHW A;  4K0K L;  2ALY B;  3PO3 H;  1V1O A;  1F2L A;  1S40 A;  2JEB I;  3OOC A;  4EQN A;  3CCE A;  4JI6 Q;  4C3J B;  1KAW A;  1D1K A;  5GAG C;  3GTG H;  1A2U A;  4ZYS A;  2B63 G;  3MC0 B;  5F2D A;  3SK6 A;  4B3T L;  2UUA L;  4LFB Q;  1WTH A;  3F2B A;  1YZ6 A;  3OHX C;  5C0X J;  1M8A A;  1EIH A;  4A76 A;  3VR4 A;  2E2J H;  1SYD A;  1T5X D;  3PUZ A;  1SND A;  4IPG A;  4A3D B;  1C8C A;  2UUC Q;  4P71 A;  3CME A;  1AEX A;  1UEB A;  4QB4 A;  5IP9 H;  1PTO C;  1I4Q A;  4Q0F A;  4P72 A;  4CDE C;  2Z6K A;  3SXH A;  1I5F A;  1HCZ A;  5EAY A;  4ZKB B;  3BVZ A;  4R4C A;  3BYT B;  4DF7 A;  1IBL Q;  1N36 Q;  1PH5 A;  3PV0 A;  4NW2 A;  4H44 C;  3SEB A;  5COY A;  4EX5 A;  1QB5 D;  3S15 H;  2ID0 A;  1LAC A;  2PYK A;  3TRZ A;  5KYL A;  1S5C D;  5C0X G;  2Q2I A;  1VDZ A;  4U67 3;  1KAB A;  1F9Q A;  1BCP D;  1L0X B;  3T56 B;  5HGT A;  2E5L L;  1T5E A;  2OXP A;  3IFT A;  3TN2 A;  1IKM A;  3KF6 B;  3HKS A;  3T51 B;  4HMI A;  3S1R H;  3CPW A;  1AW7 A;  4DA2 A;  3NQT A;  1JMC A;  4PZ6 A;  4YWK A;  2PZU A;  4M1U B;  1QZH A;  4A3J B;  3MHB A;  4P73 A;  4JI1 L;  2MO0 A;  3RLN A;  5C3E H;  4TRD A;  4TVA B;  1YNX A;  4IUT A;  2RCN A;  2B3G A;  2EY2 A;  4HCS A;  1Y1W B;  4BBR G;  4A3C G;  1D1I A;  2UU9 Q;  1CHP D;  1NE3 A;  2MO1 A;  3I4M H;  3I90 A;  3L2P A;  5JPN C;  5KYI A;  1HA5 A;  1TQO A;  4YWM A;  4A3F B;  5IIF A;  4LF4 L;  4BBS H;  1LO5 D;  2R93 G;  3TP6 A;  2F0P A;  2JA7 H;  4K6L A;  5M3F H;  2K4K A;  2XRS D;  5I9P A;  3PGZ A;  4IJH A;  5A35 A;  2F0U A;  5JEA J;  2IHE A;  4K8J A;  4DV0 L;  3FKI G;  4ILW A;  2RDG A;  4UP7 A;  3TP5 A;  4JOI A;  1U9R A;  2QDB A;  3HS0 C;  2DJG C;  1E1T A;  1Q7Y C;  5C0X I;  1IZ6 A;  4FF4 A;  2RSO A;  4R4Q A;  4FO2 A;  5T1I A;  4FF3 A;  1STE A;  3T1Y Q;  1EIF A;  2KEC A;  5M9O A;  3PO2 B;  1KTK A;  1RKN A;  3HOW H;  4CGY B;  5C4X H;  1JE5 A;  1JB7 A;  1YEZ A;  3HEJ A;  1IBM L;  2CCZ A;  1EIY B;  3HOY H;  3CMA A;  2XGT A;  4QF4 A;  1PTO B;  2Z6B A;  1N32 Q;  1I3Q B;  1TY0 A;  3CF5 A;  1N8R C;  1LV9 A;  2MGS A;  3HOV H;  3K59 A;  2IPK D;  4UP9 A;  4HSV A;  2F0O A;  2RBM A;  4JPB W;  3I4N G;  2KA7 A;  2Z4H A;  3CHB D;  2L11 A;  2VB3 X;  1SXT A;  3CCV A;  3SVM A;  5C5M A;  1JE4 A;  4EQP A;  1ZYR C;  1TWH H;  2OQK A;  2K75 A;  3V96 A;  2PCF B;  1PZK D;  1BDO A;  1CKM A;  4F8M A;  1VQH A;  5LMU Q;  4RCO A;  4L6T B;  1G91 A;  1E0B A;  2HUG A;  3K5L A;  3S1N B;  2FMC A;  2VXW A;  4Y7N H;  5JOB A;  2R7Z H;  3TS2 A;  5KND A;  3CC2 A;  2K5W A;  5GAH C;  1PYW D;  4DV5 Q;  5E4X A;  1ZEQ X;  1IBK L;  5FO9 B;  3DHQ A;  1IW7 D;  4KK7 A;  1F9R A;  1SYC A;  4YHH L;  5M5X B;  1SRO A;  2M2L A;  5I2Y A;  4GNX C;  3K58 A;  3OTO Q;  3W5O A;  2B63 H;  5EKL A;  1XTC D;  3PO3 B;  2EIF A;  5CV5 A;  3H15 A;  2A73 B;  4A3D G;  3LGJ A;  1I4G A;  1PH7 A;  1NCV A;  5FLX c;  1J5E L;  3W1B A;  3GTG B;  3I70 A;  2LMC B;  3L3O C;  1Q81 C;  3CW2 C;  1K9M C;  1HZC A;  3NPP A;  2TSS A;  5CV6 A;  3I55 A;  1CQF A;  1SYE A;  3R93 A;  1LTG D;  1WJJ A;  4QL5 A;  1A3V A;  1B7Y B;  2QCP X;  4DXF A;  1S5F D;  3K0X A;  2IHF A;  4R9W A;  2IJ0 A;  1IHZ A;  3CCM A;  3KFU A;  2O5J C;  5FLM G;  4FXK C;  1PTO D;  4GZY C;  4DGZ A;  4K5W A;  1HQM C;  1UE1 A;  3G48 A;  4LFC Q;  3QOJ A;  4PV1 C;  2B2U A;  2J4X A;  4B3M Q;  3BVG A;  1TS3 A;  1R9T B;  1WI5 A;  4X64 Q;  1MI2 A;  5CV7 A;  3N52 A;  3OMC A;  4WJ4 A;  3A56 A;  4NKL A;  2F0I A;  4C2M H;  5C0X H;  1STH A;  1EZ8 A;  1HNX L;  3S1Q H;  1G8Z D;  2B2W A;  4DV6 L;  4J15 A;  2O5I C;  2K7V A;  3CQZ H;  4GN5 A;  5ELC A;  4A3J G;  1D8L A;  4R4T A;  3S15 B;  4IOC A;  1L1O A;  1DGS A;  1PDQ A;  4FYD A;  4Y52 H;  4QMG A;  4HIK A;  3KLR A;  4A3B G;  3OWE B;  3S1M H;  1F2Y A;  2Q2H A;  3HKZ E;  3RLO A;  2JJQ A;  2IW3 A;  4CDD C;  3P20 A;  5CC4 A;  1YJ9 A;  1Y8O B;  1VQB A;  3MVV A;  4S3S A;  4Z9C B;  2L12 A;  1UAP A;  4LAA A;  1I6V C;  5D65 A;  1H9S B;  2JSO A;  2C35 B;  1EY8 A;  3TS0 A;  4LJZ C;  4B08 A;  2F3V A;  3DM1 A;  2LXJ A;  4BBR H;  1KIX A;  4A3C H;  5IP7 G;  2VW9 A;  1WTX A;  1YVC A;  5C3E B;  3OPO A;  2NZO A;  4IAL A;  5EKI A;  3A8I E;  1KD1 C;  2R93 H;  1DZ1 A;  2KVM A;  2Q2T A;  3N6R A;  1UNS A;  1TWG B;  2Y0S E;  3WOE A;  1YHQ A;  4UY8 C;  5IT9 L;  4XT3 B;  4K2K A;  4POF A;  3I4M B;  1G2T A;  3GDE A;  2B2Y A;  1XNQ L;  3FKI H;  5C4H A;  4GNX B;  1J9O A;  2ZT9 C;  4XQQ A;  2P5Z X;  3PO2 G;  1SNC A;  2PMZ B;  4OWT B;  4HID A;  1O80 A;  4YY3 L;  4PMW A;  1PZI D;  5M3F B;  3G71 A;  4PZ7 A;  3HOZ G;  5JJZ A;  1PMR A;  4WOR A;  2PQA B;  1K0R A;  3K5O A;  4A3L G;  5IGD A;  2OWO A;  3NWT A;  3NE5 B;  1NJI C;  3GTQ B;  1WTQ A;  1J6Q A;  2AKW B;  2NVX H;  1SYG A;  2AMC B;  1U4P A;  3K7U C;  4QJF A;  4GKJ L;  5M3M G;  1GHJ A;  2L9H A;  1CQV A;  1T9H A;  5LL6 S;  1SR3 A;  4DR7 L;  1N34 Q;  2EJG C;  2D2C C;  2B8G A;  3HOW B;  4IUP A;  1GO3 E;  2AUK A;  4BA2 I;  3HOY B;  3AB9 A;  2L55 A;  3R8B A;  3I4N H;  5I9O A;  5JVG 3;  2F0W A;  4ZAI A;  2PO4 A;  4WJW A;  2X6G A;  4DUY Q;  3HOV B;  1NBW A;  2WB1 B;  2F1M A;  5K5P A;  3E9I A;  1ET9 A;  2AQ3 B;  2AQ1 B;  2HCC A;  3S24 A;  1ZYR D;  4JI2 L;  4LF5 L;  1JWM D;  1EYG A;  4BS9 A;  1M4V A;  3VA7 A;  1TWH B;  3EJI A;  4XIG S;  3DUZ A;  3CC7 A;  3CCL A;  5GAE C;  3I7F A;  1CSP A;  2ZXO A;  3SK5 A;  1TWF B;  1CTM A;  2KEN A;  1IL2 A;  5H1S E;  1P16 A;  3ULL A;  2D0O A;  4JI5 Q;  2ENB A;  2F0N A;  3OYY A;  1EQQ A;  4RKL A;  2M00 A;  4OON A;  2QEX A;  3F1Z A;  3NTH A;  1VQP A;  3BDC A;  1W6K A;  4A3D H;  2WFW A;  4TSS A;  4JI8 Q;  4B3S L;  1S72 A;  4X65 L;  3PCO B;  4DV3 Q;  4EVO A;  2Z0S A;  3CRL C;  1PTO F;  2Z8L A;  1HTP A;  5EPK A;  3W3A A;  2B63 B;  3BU2 A;  1EQR A;  2D9U A;  1JR0 D;  1HZ9 A;  2HD3 A;  2VUM B;  4IOA A;  1E1O A;  3KJP A;  3KF6 A;  1G51 A;  1EOV A;  1SNM A;  2ATW A;  3NEL A;  3KBX A;  1LT3 D;  4ID6 A;  4L63 B;  3HOX B;  4C3H B;  1GUT A;  4C3I B;  1Z6H A;  2KEE A;  5FLM H;  3T1H Q;  3NK9 A;  2ZTE A;  3FEW X;  1HTL D;  2PQE A;  1K8O A;  4QIW B;  1VS0 A;  3CC4 A;  2B8F A;  4I7A A;  1SJH D;  1Y69 U;  4UPA A;  2HIX A;  3TEH B;  1A3T A;  2N8N A;  4POG A;  4AIM A;  5J1Z A;  4A3J H;  1LTR D;  3U4V A;  2F0D A;  4J1M A;  2KHI A;  2BH8 A;  2DGY A;  4ZUI A;  1K8G A;  2FXQ A;  1I94 Q;  4A3B H;  2HQL A;  4YIJ A;  3CQZ B;  4NPS A;  1HHV A;  3ZYY X;  3QB3 A;  1XMQ Q;  2QA4 A;  2ZTD A;  2FIN B;  4OEL B;  2SEB D;  3MFY A;  1H95 A;  3MXN B;  4DNI A;  2I5L X;  4HN7 A;  5IGB A;  1E2Z A;  1BBW A;  1JOQ A;  3M3Y H;  5IP7 H;  2ICI A;  2VQF L;  4LF9 L;  4DV2 L;  1K28 A;  3KUP A;  4LWC A;  4LFA Q;  1KC8 C;  1HJP A;  2NBF A;  3J81 j;  1YNN C;  3GTJ B;  4NXN Q;  5LMN W;  1PFN A;  4OX9 Q;  4JI7 L;  2JK8 A;  2KUM A;  4BWG B;  4MTK A;  1OO9 B;  4H7B A;  3B6Y A;  1QUQ A;  4OGQ C;  4I65 A;  2R93 B;  3V2T A;  3PO2 H;  4P2C B;  3D0F A;  3KYH C;  4XYO A;  3HOZ H;  3J81 c;  1LTS D;  4ZCK A;  1EY6 A;  1LTI D;  2R6G A;  1MBY A;  1SYF A;  1PTO H;  2FHT A;  2K01 A;  4A3L H;  2K52 A;  5IE8 A;  1XNR Q;  4JCV E;  1PH3 A;  2OT2 A;  3K5N A;  1PFS A;  2R7F A;  4A3E H;  4N8F A;  2H5X A;  5M3M H;  2JQO A;  3I91 A;  2MUY A;  1BBX C;  2E2D C;  1STG A;  1XXG A;  3GTO B;  4DV1 L;  1WVL A;  2WB1 G;  2F03 A;  4N9T A;  3ERO A;  1MKH A;  3I2Z A;  1U4R A;  4G7H C;  1TR5 A;  2V1C C;  1VMP A;  3DEO A;  4DR1 Q;  4ZKC B;  3K8A A;  3S1N H;  1CM9 A;  2JXM B;  4GKK Q;  3MEH A;  4KMU C;  4X6A H;  2N88 A;  2ZM6 L;  4KHV A;  1U4M A;  1KDB A;  4G7Z C;  4JI3 Q;  3A54 A;  2ZJP A;  4AH6 A;  3VR2 A;  3S2D B;  5I2X A;  3U9S A;  4HTH A;  5M5X H;  1CT1 D;  2IT1 A;  3SGI A;  3L9A X;  1EYC A;  1ENF A;  1FVI A;  2BDN A;  1V43 A;  3J80 i;  1CKO A;  4WRD A;  1F9S A;  1OXT A;  5FKA C;  2HQE A;  5EKK A;  2EYF A;  5FJ8 G;  1S3O A;  1H9K A;  1VQN A;  2KOL A;  5FLX E;  5I6Y A;  4JBW A;  2B29 A;  1SE8 A;  1EWI A;  1E22 A;  2NTT A;  2VUM G;  3TZD A;  4DR3 Q;  2I07 B;  1JC7 A;  3E6Z X;  3HOX G;  1CUK A;  4R4I A;  2NTS A;  1VQD A;  4C3H G;  2JA6 G;  1FNU A;  4C3I G;  2XNA C;  3NBI A;  1I4P A;  3CXC A;  4PNY A;  1ICF B;  3HFZ B;  4B3R L;  4HJ9 A;  1ILP A;  1VQI A;  2L5T A;  2UXD L;  4RWS C;  4U68 A;  4JK1 C;  1X65 A;  5E1F A;  3DLL A;  2QDL A;  1R9T H;  3C3L A;  2EJM A;  3UE0 A;  5KIX A;  2NN6 G;  2YTY A;  1Y1V G;  1RIP A;  4RMF A;  3SE0 A;  1FNV A;  3JAM L;  3KLS A;  1H9R A;  2WAQ G;  4KJN A;  3U50 C;  4A3G B;  3MEF A;  1BO0 A;  3J80 L;  1GOZ A;  1H9S A;  1SEB D;  4LNQ A;  1TY2 A;  1ASZ A;  1W2B A;  1UE7 A;  1GM5 A;  4JV5 Q;  5E7N A;  3W1G A;  4X62 Q;  3K0Y A;  1QE6 A;  2R3Z A;  2OTJ A;  2HHH L;  1LLR D;  2JP1 A;  4ME3 A;  5DNF A;  3TRE A;  3QO2 A;  2PI2 A;  2ICE C;  3MXU A;  2BA0 A;  2A6E C;  4OWW B;  3CAM A;  2F0F A;  2SNM A;  4HSP A;  3VA5 A;  1E2V A;  4KHZ A;  3TP8 A;  1NY4 A;  2OF1 A;  3EA6 A;  5C3W A;  5IYD G;  2KCC A;  1WCM G;  1VQ7 A;  2EYJ A;  4JI0 L;  1B70 B;  3K57 A;  4GNX A;  1N33 L;  3I56 A;  1TKW B;  3BDL A;  3TME A;  5BN5 A;  2E75 C;  1N34 L;  1EY4 A;  3A7L A;  3CCS A;  5IOD A;  3NEN A;  3ULP A;  1GUN A;  1G29 1;  4A3B B;  2VQE L;  1TWG H;  4V19 0;  4IFD J;  2PQA A;  4RFB A;  5ELN A;  3P75 A;  2WP8 J;  4L5S A;  4MHE A;  4XYQ A;  3NTK A;  5D3D A;  4LF7 L;  1B9N A;  1DJR D;  3FVQ A;  5JJL A;  3NXW A;  4DUY L;  3FRP B;  4QY7 A;  3O13 A;  1PXU A;  1QJO A;  2KHJ A;  3KF8 B;  3M3Y B;  1EWH A;  1ML0 D;  1X54 A;  1PRT C;  2A69 C;  2NN6 I;  3AU7 A;  1PYS B;  4AYB B;  4ZK9 B;  4DR6 L;  5LMN Q;  1B1Z A;  4HIM A;  2AQ2 B;  1WD1 A;  1YNN D;  4KKS A;  1CKN B;  4DR4 L;  3GTQ H;  1MSH A;  4DK6 C;  3HP3 A;  2UXC Q;  1LM0 A;  1OXX K;  1WFQ A;  3VR3 A;  2XTI A;  3PSI A;  3PUV A;  4WFN 3;  1JCK B;  2LSS A;  3OIP A;  4DV4 Q;  5A2Q L;  2NVY B;  3M9B A;  1MGS A;  2SDF A;  3HOZ B;  3MXG A;  1GHK A;  3SK8 A;  2R61 A;  4A3M B;  3H94 A;  3WOF A;  5FO7 B;  3AFP A;  3NQI A;  1A6X A;  2G9D A;  5J3B A;  4DNR B;  4KKT A;  3BZD B;  1STN A;  2CH4 A;  3M7G A;  1HFN A;  2NZ1 D;  1MIU A;  1VQJ A;  1R4Q B;  5JEA G;  3KLW A;  4A3E B;  3BVM A;  2PI2 E;  5M3M B;  3OMG A;  3IRB A;  1XWE A;  5AJ3 L;  4BY7 G;  4QGU A;  1HUN A;  1OXU A;  3DM3 A;  1HR0 L;  1EL0 A;  4CJ2 C;  1SYB A;  5BR8 Q;  4FNF A;  1TS2 A;  5E4W C;  2MPM A;  2JE6 I;  1TWF H;  2LS0 1;  4DK3 C;  2UXB Q;  5E3F A;  4ALP A;  1J8I A;  1FNW A;  2EDG A;  3DWQ A;  5G3L F;  2PMZ E;  1Z47 A;  4DFA A;  1KXL A;  2CVR A;  1K0S A;  1PHJ A;  4X3T A;  4QUF A;  4QUC A;  1VQA A;  4IQZ A;  1M1K C;  3C1E A;  2NVT H;  1A15 A;  1FJG L;  2N55 A;  1PFM A;  3H3V C;  2F4I A;  5HUR A;  5FJ8 H;  4RGO S;  1UWV A;  1DXM A;  3BZK A;  3KDF B;  2EXZ A;  3VYT A;  3G6E A;  3MZ5 A;  1EUJ A;  4HIO A;  4AQY Q;  1LT5 D;  4APV A;  2M9V A;  1CHQ D;  3GTM H;  2VUM H;  5DM6 3;  4NXM Q;  4IZ8 A;  1XMQ L;  3HOX H;  4LF6 L;  1SE4 A;  4C3H H;  2JA6 H;  3EQL C;  1HFG A;  4C3I H;  3IFD A;  4JYA L;  1F9P A;  3GO5 A;  2BH2 A;  4LW1 A;  1KDC A;  3TP7 A;  1XMO L;  1PRT B;  1FYC A;  3JC6 6;  1G2S A;  3LNN A;  4A3G G;  5FO8 B;  4EGV A;  5BN4 A;  3QJY A;  2FFK B;  2NN6 H;  5IYB G;  1Y1V H;  1Q86 C;  4DV7 Q;  1D5M C;  2G9H D;  5KEE A;  4OX9 L;  4CKC A;  3FMC A;  1QVG A;  2UUB Q;  2VY3 A;  5IYC G;  1V1Q A;  1W6J A;  3MXN A;  4RG1 A;  4KHP Q;  2BA1 A;  2F3I A;  1A63 A;  3EIV A;  4DUZ Q;  2RDH A;  1GUG A;  4QQB X;  2XWB B;  2KQ3 A;  1O7L A;  1B3A A;  5ISR A;  2AWN A;  1X3Q A;  2DUD A;  1VQM A;  1V9P A;  3HGB A;  5I4D A;  1SNP A;  3FPU B;  4JI4 Q;  2K28 A;  2A6E D;  5IYD H;  1EY0 A;  2ZTC A;  1O7I A;  4X66 Q;  1CA5 A;  1M90 C;  2MHV A;  4K0K Q;  1WCM H;  2Q8I B;  3DMU A;  1LUZ A;  3GV6 A;  4DPG A;  2A68 C;  3ND9 A;  1BKB A;  3H0G B;  4A3K B;  4XT1 B;  4DR5 Q;  4LF8 L;  1V1P B;  5TSS A;  2LKV A;  3GTJ H;  1I4X A;  2OEO A;  1KNA A;  2CWP A;  4FP5 D;  4AYB G;  2E2I H;  2UUA Q;  1XPU A;  1O7Y A;  4IUV A;  1EY5 A;  3J7A V;  4DAY B;  1WTR A;  2RSN A;  2RDF A;  1WD0 A;  3QIA A;  1SN8 A;  1RTO A;  4DAP A;  4KN4 C;  3QR8 A;  3X3N A;  1YIJ A;  4QIW E;  4DR2 Q;  2EJF C;  1B3Q A;  3NSW A;  1WTV A;  3BYY B;  5CGK A;  1HNZ L;  3A7A B;  2E8G A;  1EOT A;  5DAU A;  3K81 C;  1VQG A;  1HZA A;  1Q1B A;  1LTT D;  1I6H B;  1PVO A;  1HXY D;  3J7A F;  2A69 D;  1PRT D;  2F0K A;  3J81 E;  5EJW A;  1Z9F A;  4A3M G;  4GN4 B;  4JI6 L;  4R8N A;  2CKZ B;  2KHS A;  4ABN A;  1JB3 A;  2KCT A;  4A4I A;  3GTO H;  3D31 A;  2PW5 A;  4YCU A;  1PFB A;  4IUR A;  1H9M A;  5CBE E;  2F0G A;  3AMU A;  4OIJ A;  4A3E G;  3BS1 A;  4LFB L;  3A55 A;  1BQQ T;  5M5Y H;  1PH4 A;  1MHW C;  5DM7 3;  3RD4 A;  4CHT B;  2F0J A;  1NSN S;  2E5L Q;  1BNZ A;  2WKC A;  1SMX A;  5JEA H;  1PH1 A;  4HJ7 A;  2UUC L;  3PIO A;  1TWA H;  3QOL A;  4BY7 H;  1NTG A;  1STY A;  2RKS A;  4GLX A;  3S2D H;  4K2L A;  2E2H B;  4G7O C;  4JI1 Q;  3TZU A;  1K73 C;  1IXR A;  2Z4I A;  2DNE A;  1IBL L;  1VQ4 A;  4JG2 A;  5IGE A;  1N36 L;  2XWJ B;  4GOP C;  3GTL B;  2F3W A;  1WTO A;  1IYU A;  1FR3 A;  3QWN A;  2FJ2 A;  4HR7 B;  2RHS B;  2A6H D;  1SRU A;  1QNK A;  2GVA A;  4X62 L;  1VMC A;  2ES2 A;  1X3P A;  4EQO A;  2KCN A;  3MA2 B;  3VR6 A;  1KL9 A;  2ZXR A;  2PZT A;  4LF4 Q;  4O42 A;  4PMC A;  1KLU D;  1XTD A;  3UDX A;  2NB0 A;  2QEJ C;  3AFQ A;  2PNH A;  3PUW A;  1AH9 A;  2NVT B;  2WII B;  1VF7 A;  3OSO A;  4A3I B;  2JA8 G;  3T16 A;  5CR3 A;  2F0M A;  4GN3 B;  5CV4 A;  4DU9 A;  1Y8N B;  5ELF A;  1ESR A;  3Q6S A;  5D3I B;  1JOO A;  4YWL A;  1II3 A;  3UDF A;  3RR5 A;  3GTM B;  2EPB A;  3Q23 A;  4A93 G;  1DD2 A;  2AUJ D;  4MN3 A;  4CJ1 B;  1GXD C;  1IBM Q;  1D5X C;  2UU9 L;  2CQA A;  1QWY A;  4A3G H;  2JA6 B;  4A75 A;  4OXP A;  4XTC S;  3C1F A;  4RHR A;  2HDL A;  1CK1 A;  3CPF A;  1MSG A;  5IYB H;  3HKZ B;  1ENA A;  2PNR C;  1F2Z A;  1EY9 A;  4KN7 C;  4C56 C;  1SDF A;  3ERQ A;  1JQY D;  1Q8K A;  2EQS A;  3TDQ A;  3X3M A;  1Q8I A;  2ASB A;  3BJU A;  2YTX A;  3PF4 A;  5EBC A;  5IYC H;  2I46 A;  1QIL A;  1HA6 A;  4LK1 C;  1SNQ A;  1Y1V B;  2L4N A;  4FXG C;  2ZXP A;  1BUV T;  3FP9 A;  1KAA A;  1KHI A;  2H4O A;  3E0J A;  2JA5 B;  2Z1C A;  2KBN A;  1TS4 A;  2WAQ B;  2XRQ D;  4UAI A;  5CBA E;  1QCB D;  3T1Y L;  1NNX A;  4PZ8 A;  3S9W A;  1O7Z A;  4DV4 L;  3H0G G;  4A3K G;  1ESF A;  3KF8 A;  2EOT A;  2CH4 W;  2RVL A;  3LWU A;  2JA9 A;  2SNS A;  2BE5 C;  1PH2 A;  4KLK A;  2ZJQ A;  1CKN A;  1N32 L;  1GUS A;  4ODG A;  2KCM A;  5C4Z A;  3G6J B;  1RCV D;  1DCZ A;  5T1G A;  3E9H A;  3Q22 A;  3A74 A;  1STB A;  1JJG A;  5GQO A;  2A68 D;  3U58 A;  1WCM B;  1A8V A;  3L7Z C;  2QW7 A;  2RCF A;  3MFG A;  1HH2 P;  1PRT F;  2K03 A;  4X3K A;  4GOP B;  2NVQ B;  1J5E Q;  3RZD H;  5IGG A;  5EPJ A;  2RHQ B;  2A5H A;  1K3R A;  1AE3 A;  2I5M X;  2NUC A;  1C48 A;  1K8A C;  3DWA A;  1DOM A;  5JVH 3;  5LMU L;  4DKA C;  2E2I B;  4CDC C;  2F0T A;  3T4A C;  4L5Q A;  4ULL A;  2TMP A;  1CFM A;  2DY7 A;  5IGC A;  4G4K A;  3PUY A;  2NVY H;  4HJA A;  4DV5 L;  4KD4 A;  4OL7 A;  1VQ6 A;  2K04 A;  2XVS A;  4OIK A;  2OTL A;  2JYO A;  4RH6 A;  4A3M H;  3NBH B;  1GVP A;  1I4R A;  4H0L C;  1QVF A;  4C1N K;  2VS1 A;  3K5M A;  4IUQ A;  1A3U A;  1R4P B;  4YCV A;  1JOR A;  3A0J A;  3DXJ C;  3OTO L;  1XPO A;  3OIQ A;  1NR4 A;  1Q82 C;  2SOB A;  3J7Y W;  1BBU A;  4NP5 A;  1AP0 A;  4IPH A;  4GLV B;  2K33 A;  1Y14 B;  1VCI A;  3SHL A;  1HNX Q;  3H09 A;  2F52 A;  5DLQ E;  5HY6 A;  4DV6 Q;  3EN2 A;  2O4X A;  3NUC A;  3P1H A;  2YU9 B;  1EU3 A;  1MJC A;  3M4Y A;  4BXX G;  5M5Y B;  1E24 A;  3T53 B;  4KTA A;  1RJT A;  2K32 A;  3PIP A;  3S17 H;  4GLA C;  3PMF A;  1O78 A;  1X32 A;  3KDF A;  3M7N A;  1CZG A;  3IAY A;  4ME5 A;  5EGT A;  5CMD A;  1F77 A;  3H3V I;  1C0A A;  2MJ8 A;  1TWA B;  4BY7 B;  4LFC L;  4LUZ A;  4EQ5 A;  3A8K E;  1EWC A;  3WWV A;  1XYI A;  1S5D D;  3OW7 A;  1MJE A;  4B3M L;  4CDF C;  2A8V A;  2EYM A;  2ZJR A;  4X64 L;  2UUB L;  3A8J E;  1MD2 D;  1ONL A;  3AEV A;  4J6H A;  1GUW A;  3CKI B;  2PZW A;  3I73 A;  1JWS D;  3NHH A;  3TSS A;  3G4S A;  4A3I G;  1YJN A;  1EIG A;  1HZB A;  4LUV A;  2C9O A;  2CHB D;  1XNQ Q;  2B2V C;  5G3L D;  1PZJ D;  1WOC A;  3H6M A;  2EYP A;  3CD6 A;  4GS3 A;  4YY3 Q;  4HCE A;  2EXD A;  2JA8 H;  3U9O A;  4FXD A;  1OXV A;  1AE2 A;  1L0Y B;  4BY1 B;  1XX8 A;  3D4R A;  4MZ9 A;  1HQR D;  4XXE A;  1PLF A;  5IOC A;  4DR5 L;  3CU7 A;  1B8A A;  3KJO A;  3HKZ G;  4A93 H;  2LFN A;  1U5K A;  4P75 A;  1JJ2 A;  5CYU A;  3RLF A;  1I4H A;  4FVM A;  4GKJ Q;  1ICW A;  4J8Q A;  2A74 C;  3K7A B;  3TQY A;  1G6Z A;  2DJF C;  3OWF A;  2EE1 A;  3HOU B;  4DR7 Q;  2JA5 G;  4DAV A;  4DR2 L;  1VQL A;  5C5L A;  4DN4 M;  1B9M A;  3C2P A;  1KLG D;  2V4D A;  2F0Q A;  4IPC A;  4RAU C;  1V1P A;  2CQO A;  2Y0S G;  2IL8 A;  3CP0 A;  3GTK H;  1Q3L A;  1Q90 A;  1D7Q A;  4FF2 A;  4KY7 A;  4HAE A;  1AZP A;  1L2F A;  4O2D A;  1CSQ A;  4L5T A;  4JI2 Q;  4DAY A;  4LF5 Q;  1KRT A;  1RF2 D;  2LY7 A;  3H0G H;  2Q8R E;  4A3K H;  5K36 G;  1BVS A;  4NMZ A;  4R4O A;  1NMF A;  4R8I A;  5C44 B;  5I6W A;  1GD7 A;  5KNC A;  1QZG A;  1JWU D;  1U4L A;  1TXY A;  1RDP D;  1ET6 A;  1LTB D;  4V0B A;  3S14 H;  2BE5 D;  1WTP A;  1S5E D;  3M4Q A;  2Q2U A;  1Q1E A;  4PQX A;  3RZO B;  1FL0 A;  3E3X A;  4B3S Q;  1OTC A;  4KV6 A;  3UE1 A;  2EYO A;  4X65 Q;  3H3V H;  3I4L A;  1EYD A;  1XPR A;  5IWA Q;  1A62 A;  1I6H H;  4HED A;  3GV3 A;  1RD9 D;  4JVZ A;  2I5H A;  3JAM c;  4CJ0 B;  3ITP A;  1YHB A;  2F4V Q;  1IYJ B;  1TII D;  3R2I A;  2QKI C;  3J80 c;  2K5H A;  3RZD B;  1K83 B;  4RGM A;  4RGT A;  2K5V A;  3KBG A;  1VQK A;  1D6E C;  4FF1 A;  2DY8 A;  5L37 A;  3U4Z A;  4RHS A;  3VR5 A;  3E5S A;  4JI5 L;  4N9P A;  1IKL A;  1E7Z A;  4ZRZ A;  4IFD G;  5GRO A;  3D4D A;  2VL6 A;  1X55 A;  4JI8 L;  1DON A;  1V8Q A;  4DV3 L;  4B9W A;  5ELD A;  2RF4 A;  4KKU A;  4X3S A;  1TS5 A;  3K6O A;  2E2H H;  1Q12 A;  1VF5 C;  3R2T A;  1YNJ C;  1QG7 A;  2BCO A;  1PA6 A;  3T13 A;  4BXX H;  1B53 A;  2DN8 A;  4CKE A;  5M5W B;  3S16 B;  4DAM A;  1UEA B;  3GTL H;  2GA4 B;  3A5U A;  1SAP A;  5FLX L;  4PMB A;  5IT9 E;  4N8X 1;  4LMQ D;  1PV4 A;  3M4P A;  3T1H L;  2A6H C;  1D5Z C;  1QUQ B;  2XIW A;  2Z6K C;  4MNO A;  4C1N I;  1ILQ A;  2R92 B;  3Q24 A;  3J7A 5;  1SFO H;  3S17 B;  2R7D A;  2RQX A;  3W2D A;  2XSC A;  5EQ0 A;  4KI0 A;  2VQF Q;  4LF9 Q;  4DV2 Q;  1Z7T A;  2EVB A;  2KED A;  1F2M A;  4K6D A;  3H91 A;  4A3I H;  4LUO A;  2QF7 A;  1YBY A;  4B9X A;  3NWS A;  4L5R C;  4BY1 G;  4JI7 Q;  1FD7 D;  4C3J G;  5FK9 C;  1IL8 A;  1HNW Q;  5HGQ A;  4IFD I;  4HJ5 A;  5GAD C;  1I94 L;  1PH6 A;  4TKO B;  1X3F A;  2EYH A;  1EY7 A;  2B39 A;  2WKD A;  4QCL A;  4IN3 A;  3I3C A;  3HOU G;  4K5X A;  5EPL A;  5C4J B;  2OCE A;  2JA8 B;  4IO9 A;  1N9W A;  3NP8 A;  1LYL A;  1TWC H;  2WB1 E;  1VQ8 A;  4YCW A;  3MWY W;  4IUU A;  3OW2 A;  1EFI D;  1HUM A;  1YI2 A;  3HZX A;  2HCI A;  3URY A;  5ELE A;  4IJL A;  5JPM C;  1G6P A;  4LFA L;  1W3S A;  1JIC A;  4OO1 G;  2NYZ D;  4DV1 Q;  4A93 B;  3CCJ A;  5J22 A;  3MTS A;  2JA5 H;  1WYD A;  4NXN L;  4K5V A;  1GKH A;  1WTW A;  2BOS A;  4XDX A;  4KD3 A;  1L0W A;  4KY5 A;  1NMG A;  2VZA A;  2PW7 A;  3VDY A;  1HR0 W;  4RKB A;  1C9O A;  2MP1 A;  5LHY 1;  2E2J B;  1B50 A;  1X9N A;  2L15 A;  1SSO A;  5C44 G;  1BCP F;  4GOP A;  2ZM6 Q;  2L0C A;  2D0P A;  2NWG A;  4JOI C;  4CBV A;  5LL6 X;  4G57 A;  1GUO A;  3PIO 3;  1GJX A;  3GTK B;  1XNR L;  1B44 D;  5K36 H;  3VYU A;  3V05 A;  2VNU D;  3F8T A;  2EYL A;  1EEI D;  1AZQ A;  3BZC A;  1C4Q A;  2F0E A;  2NVQ H;  3ONA B;  1S5B D;  2CFM A;  2N3S A;  5KGU A;  5DEH A;  1ASY A;  3ERS X;  3NBH A;  2B2T A;  1BR9 A;  1ROD A;  3ULJ A;  3WDN A;  3R3O A;  4OWX B;  4B3T Q;  3SK4 A;  4DR1 L;  1BOS A;  5JJI A;  2E74 C;  4GKK L;  3K80 C;  3S14 B;  2MQH A;  4HMJ A;  1Y1W G;  1VQC A;  4DK1 A;  1UUP A;  3S1R B;  1SE3 A;  4F88 A;  2YYZ A;  1UE5 A;  4F7X A;  2Q8T A;  4A3F G;  4OO1 I;  4JI3 L;  5FOB B;  4B3R Q;  1SMY C;  3SR1 A;  1NAP A;  2K5Q A;  2UXD Q;  2MNA A;  2H1E A;  1D2B A;  4MTN A;  4E6I A;  4O0A A;  2WAQ E;  4P74 A;  1VQ5 A;  3KOJ A;  3RN2 A;  2WIN B;  3I8Z A;  4KJO A;  1BXT A;  2MFI A;  2AWO A;  2G5D A;  3RMH A;  4CKB A;  3EBE A;  4IFD H;  2LXK A;  1QVC A;  3F2U A;  2YU9 H;  5BN3 A;  4BBS B;  3BDO A;  2RA4 A;  3KK7 A;  1C7Y A;  1LTA D;  2JA7 B;  2A1A A;  2HHH Q;  2D5D A;  3HG9 A;  2K5D A;  5IY0 A;  4DR3 L;  3S2H H;  4RCN A;  1EFW A;  1OXS C;  3M4O H;  3CCR A;  2I0Q A;  3ER0 A;  1LT4 D;  2GN5 A;  1X56 A;  1QNU A;  2K05 A;  2OQ0 A;  1SLJ A;  3IL8 A;  1X3E A;  2K1B A;  5J39 A;  1JOK A;  2R92 G;  3GTP H;  1YNJ D;  2QIL A;  1KRS A;  3GP7 A;  1IYV A;  1FGB D;  4JI0 Q;  1S4Z A;  3M85 A;  1N33 Q;  2CW0 C;  2EZV A;  4K14 A;  4DXG A;  2IWH A; 
#chains in the Genus database with same CATH homology
 3MXP A;  3ND8 A;  3FPP A;  2C5C A;  5C4X B;  2IX0 A;  3TBI B;  1E2W A;  5ELB A;  3CRK C;  2F0V A;  1DYQ A;  2E76 C;  2B2U C;  3VYR A;  1CZW A;  5C3X A;  3MAQ A;  1NR2 A;  1TT2 A;  3IKJ A;  3D8G A;  1SFO B;  1EYA A;  3LX0 A;  4XQJ A;  2B2W C;  2F0H A;  3D6W A;  3G7L A;  1TVX A;  1RHP A;  3P7J A;  3C46 A;  1EQV A;  2B2T C;  4TQU S;  5AFW A;  5D14 A;  1RTN A;  3RUZ A;  4Y7N B;  2R7Z B;  1SE2 A;  1HRJ A;  4X3U A;  1QOH A;  1EEF D;  1K8M A;  3D3R A;  2XN9 C;  4KY6 A;  2X6L A;  5JAV A;  4OO1 H;  1ZKO A;  2WV6 D;  1TWC B;  5C6A A;  1SJE D;  3SDZ A;  1LT6 D;  4BA1 I;  1KNE A;  1CA6 A;  2EY6 A;  4ZQ3 A;  2B2Y C;  4L8J A;  3D6C A;  4RGN A;  2J7Z A;  2WAC A;  3GD7 A;  3QG1 A;  2L1B A;  2O2L D;  4DK0 A;  4H13 C;  2Y0S B;  4K8I A;  3PIP 3;  2HDM A;  1BCP C;  1A2T A;  4DNT B;  2F0L A;  3J81 L;  1TU2 B;  2B2V A;  4UDU C;  2FMM A;  2DNC A;  1SBB B;  5CV8 A;  4C2M B;  3S1Q B;  4MIU A;  1CI3 M;  5EBD A;  3NTI A;  3EFX D;  4F87 A;  5NUC A;  2IX3 A;  1ENC A;  2X69 A;  3GQB A;  3JAM E;  4O1N A;  3J80 E;  1EQT A;  3S1M B;  2VB2 X;  2EY5 A;  2JEA I;  2IX1 A;  1SMY D;  4Q5V A;  5COR A;  4ZLT F;  4BBR B;  2D62 A;  3VYS A;  1STA A;  1EU4 A;  1H9J A;  3FDT A;  1DM0 B;  3HRZ C;  3KLS X;  4IUN A;  3DEP A;  2PPB C;  1EZ6 A;  1DOL A;  1HPC A;  3FKI B;  3EVQ A;  4NDX A;  5IGF A;  4I7Z C;  1Y8P B;  1B2T A;  3PUX A;  3S2H B;  2EY1 A;  3M4O B;  2J0T D;  4OHJ A;  1BF4 A;  3LWE A;  4XQN A;  2NVX B;  3GTP B;  5CV9 A;  4ZUJ A;  2CW0 D;  1NUC A;  1B4O A;  1AFP A;  3DWP A;  5KRU A;  2BDO A;  3I72 A;  1KDA A;  5KNB A;  4RA8 A;  1BCP B;  1LAB A;  2KJX A;  1ZXT A;  1DOK A;  3D4W A;  5A2Q E;  3I4N B;  1I50 B;  1SNO A;  2F0S A;  1AN8 A;  3BG3 A;  2K6A A;  1IW7 C;  3UI2 A;  3Q0A A;  4M8A A;  1V1O A;  1F2L A;  2JEB I;  3OOC A;  4EQN A;  4C3J B;  1D1K A;  1A2U A;  4ZYS A;  3MC0 B;  5F2D A;  3SK6 A;  3OHX C;  5C0X J;  1M8A A;  1EIH A;  3VR4 A;  1SYD A;  1T5X D;  3PUZ A;  1SND A;  4A3D B;  1C8C A;  1AEX A;  4QB4 A;  1PTO C;  1I4Q A;  4Q0F A;  3SXH A;  1HCZ A;  4ZKB B;  3BVZ A;  3BYT B;  4DF7 A;  3PV0 A;  4NW2 A;  4H44 C;  3SEB A;  5COY A;  1QB5 D;  2ID0 A;  1LAC A;  2PYK A;  5KYL A;  1S5C D;  5C0X G;  1VDZ A;  4U67 3;  1KAB A;  1F9Q A;  1BCP D;  1L0X B;  3T56 B;  5HGT A;  1T5E A;  2OXP A;  3IFT A;  3TN2 A;  1IKM A;  3T51 B;  4HMI A;  1AW7 A;  4DA2 A;  3NQT A;  2PZU A;  4M1U B;  4A3J B;  3MHB A;  4TRD A;  4IUT A;  2EY2 A;  4HCS A;  1Y1W B;  1D1I A;  1CHP D;  3I90 A;  5JPN C;  5KYI A;  1HA5 A;  1TQO A;  4A3F B;  5IIF A;  1LO5 D;  3TP6 A;  2F0P A;  4K6L A;  2XRS D;  5I9P A;  5A35 A;  2F0U A;  5JEA J;  4K8J A;  4ILW A;  2RDG A;  3TP5 A;  1U9R A;  2QDB A;  3HS0 C;  5C0X I;  4FF4 A;  2RSO A;  4FF3 A;  4FO2 A;  5T1I A;  1STE A;  2KEC A;  5M9O A;  3PO2 B;  1KTK A;  1RKN A;  4CGY B;  3HEJ A;  4QF4 A;  1PTO B;  1I3Q B;  1TY0 A;  1LV9 A;  2MGS A;  3K59 A;  2IPK D;  4HSV A;  2F0O A;  2RBM A;  2KA7 A;  2Z4H A;  3CHB D;  2L11 A;  2VB3 X;  1SXT A;  3SVM A;  5C5M A;  1JE4 A;  4EQP A;  1ZYR C;  3V96 A;  2PCF B;  1PZK D;  1BDO A;  4F8M A;  4RCO A;  4L6T B;  1G91 A;  1E0B A;  2HUG A;  3K5L A;  3S1N B;  2FMC A;  2VXW A;  5JOB A;  5KND A;  2K5W A;  1PYW D;  5E4X A;  1ZEQ X;  5FO9 B;  1IW7 D;  3DHQ A;  4KK7 A;  1F9R A;  1SYC A;  5M5X B;  2M2L A;  5I2Y A;  3K58 A;  5EKL A;  1XTC D;  3PO3 B;  5CV5 A;  2A73 B;  1I4G A;  1NCV A;  3GTG B;  3I70 A;  2LMC B;  3L3O C;  3NPP A;  2TSS A;  5CV6 A;  1CQF A;  1SYE A;  3R93 A;  1LTG D;  1A3V A;  2QCP X;  4DXF A;  1S5F D;  4R9W A;  2IJ0 A;  1IHZ A;  2O5J C;  4FXK C;  1PTO D;  4GZY C;  4DGZ A;  4K5W A;  1HQM C;  3QOJ A;  4PV1 C;  2B2U A;  2J4X A;  3BVG A;  1TS3 A;  1R9T B;  1MI2 A;  5CV7 A;  3N52 A;  3OMC A;  3A56 A;  4NKL A;  2F0I A;  5C0X H;  1STH A;  1EZ8 A;  1G8Z D;  2B2W A;  2O5I C;  2K7V A;  5ELC A;  3S15 B;  1PDQ A;  4FYD A;  4QMG A;  3KLR A;  3OWE B;  1F2Y A;  2IW3 A;  3P20 A;  5CC4 A;  1Y8O B;  3MVV A;  4S3S A;  4Z9C B;  2L12 A;  1UAP A;  4LAA A;  1I6V C;  5D65 A;  1H9S B;  2JSO A;  1EY8 A;  4LJZ C;  4B08 A;  2F3V A;  3DM1 A;  1WTX A;  5C3E B;  3OPO A;  4IAL A;  5EKI A;  3A8I E;  1DZ1 A;  2KVM A;  3N6R A;  1UNS A;  1TWG B;  3WOE A;  5IT9 L;  4XT3 B;  4K2K A;  3I4M B;  1G2T A;  2B2Y A;  5C4H A;  1J9O A;  2ZT9 C;  4XQQ A;  1SNC A;  2PMZ B;  1O80 A;  4PMW A;  1PZI D;  5M3F B;  5JJZ A;  1PMR A;  4WOR A;  3K5O A;  5IGD A;  3NWT A;  3NE5 B;  3GTQ B;  1WTQ A;  1SYG A;  1U4P A;  1GHJ A;  2L9H A;  1CQV A;  5LL6 S;  2EJG C;  2D2C C;  2B8G A;  3HOW B;  4IUP A;  2AUK A;  4BA2 I;  3HOY B;  3AB9 A;  2L55 A;  3R8B A;  5I9O A;  5JVG 3;  2F0W A;  4ZAI A;  2PO4 A;  4WJW A;  2X6G A;  3HOV B;  2WB1 B;  2F1M A;  5K5P A;  1ET9 A;  2AQ3 B;  2AQ1 B;  2HCC A;  1ZYR D;  1JWM D;  4BS9 A;  1M4V A;  3VA7 A;  1TWH B;  3EJI A;  4XIG S;  3DUZ A;  2ZXO A;  3SK5 A;  1TWF B;  1CTM A;  2ENB A;  2F0N A;  4RKL A;  2M00 A;  3NTH A;  3BDC A;  1W6K A;  4TSS A;  4EVO A;  3CRL C;  1PTO F;  2Z8L A;  1HTP A;  5EPK A;  3W3A A;  2B63 B;  2D9U A;  1JR0 D;  2VUM B;  1SNM A;  3KBX A;  1LT3 D;  4ID6 A;  4L63 B;  3HOX B;  4C3H B;  1GUT A;  4C3I B;  1Z6H A;  2KEE A;  3NK9 A;  3FEW X;  1HTL D;  2PQE A;  1K8O A;  4QIW B;  2B8F A;  1SJH D;  1Y69 U;  1A3T A;  5J1Z A;  1LTR D;  2F0D A;  4J1M A;  4ZUI A;  4YIJ A;  3CQZ B;  1HHV A;  3ZYY X;  3QB3 A;  2FIN B;  2SEB D;  3MFY A;  4HN7 A;  5IGB A;  1E2Z A;  1JOQ A;  2ICI A;  3KUP A;  2NBF A;  1YNN C;  3GTJ B;  1PFN A;  2KUM A;  4BWG B;  1OO9 B;  4H7B A;  4OGQ C;  4I65 A;  2R93 B;  3V2T A;  4P2C B;  4XYO A;  1LTS D;  1EY6 A;  1LTI D;  2R6G A;  1MBY A;  1SYF A;  1PTO H;  2FHT A;  2K01 A;  2OT2 A;  3K5N A;  3I91 A;  2IWH A;  2MUY A;  1BBX C;  2E2D C;  1STG A;  1XXG A;  3GTO B;  1WVL A;  2F03 A;  4N9T A;  3ERO A;  1U4R A;  4G7H C;  1TR5 A;  1VMP A;  3DEO A;  4ZKC B;  1CM9 A;  2JXM B;  3MEH A;  4KMU C;  2N88 A;  4KHV A;  1U4M A;  1KDB A;  4G7Z C;  3A54 A;  3VR2 A;  3S2D B;  5I2X A;  3U9S A;  4HTH A;  1CT1 D;  2IT1 A;  3L9A X;  1EYC A;  1ENF A;  2BDN A;  1V43 A;  4WRD A;  1F9S A;  1OXT A;  5FKA C;  2HQE A;  5EKK A;  2EYF A;  1H9K A;  2KOL A;  5FLX E;  5I6Y A;  4JBW A;  2NTT A;  3TZD A;  2I07 B;  1JC7 A;  3E6Z X;  2NTS A;  4C3H G;  1FNU A;  4C3I G;  2XNA C;  3NBI A;  1I4P A;  4PNY A;  1ILP A;  2L5T A;  4RWS C;  4U68 A;  4JK1 C;  5E1F A;  3C3L A;  2EJM A;  5KIX A;  2NN6 G;  3SE0 A;  1FNV A;  3JAM L;  3KLS A;  1H9R A;  4KJN A;  4A3G B;  1BO0 A;  3J80 L;  1GOZ A;  1SEB D;  1H9S A;  1TY2 A;  3K0Y A;  1QE6 A;  2R3Z A;  1LLR D;  2JP1 A;  5DNF A;  3QO2 A;  2ICE C;  3MXU A;  2BA0 A;  2A6E C;  2F0F A;  2SNM A;  4HSP A;  3VA5 A;  1E2V A;  4KHZ A;  3TP8 A;  2OF1 A;  3EA6 A;  5C3W A;  2KCC A;  2EYJ A;  3K57 A;  1TKW B;  3BDL A;  3TME A;  5BN5 A;  2E75 C;  1EY4 A;  3A7L A;  5IOD A;  1GUN A;  1G29 1;  4A3B B;  4V19 0;  4IFD J;  4RFB A;  3P75 A;  2WP8 J;  4MHE A;  4XYQ A;  3NTK A;  5D3D A;  1B9N A;  1DJR D;  3FVQ A;  3NXW A;  3FRP B;  3O13 A;  1PXU A;  1QJO A;  3M3Y B;  1EWH A;  1ML0 D;  2A69 C;  1PRT C;  2NN6 I;  4ZK9 B;  3AU7 A;  4AYB B;  1B1Z A;  2AQ2 B;  1WD1 A;  1YNN D;  4KKS A;  1MSH A;  3HP3 A;  1OXX K;  3VR3 A;  3PUV A;  4WFN 3;  1JCK B;  3OIP A;  5A2Q L;  2NVY B;  1MGS A;  2SDF A;  3HOZ B;  3MXG A;  1GHK A;  3SK8 A;  2R61 A;  4A3M B;  3H94 A;  3WOF A;  5FO7 B;  3NQI A;  1A6X A;  2G9D A;  4DNR B;  4KKT A;  3BZD B;  1STN A;  3M7G A;  1HFN A;  2NZ1 D;  1R4Q B;  5JEA G;  4A3E B;  3BVM A;  5M3M B;  3OMG A;  1XWE A;  1HUN A;  1OXU A;  1EL0 A;  4CJ2 C;  1SYB A;  4FNF A;  1TS2 A;  5E4W C;  2MPM A;  2JE6 I;  2LS0 1;  5E3F A;  1J8I A;  1FNW A;  2EDG A;  3DWQ A;  5G3L F;  1Z47 A;  4DFA A;  2CVR A;  4X3T A;  4QUF A;  4QUC A;  4IQZ A;  3C1E A;  1A15 A;  2N55 A;  1PFM A;  3H3V C;  2F4I A;  5HUR A;  4RGO S;  1DXM A;  2EXZ A;  3VYT A;  3MZ5 A;  1LT5 D;  2M9V A;  1CHQ D;  5DM6 3;  4IZ8 A;  1SE4 A;  3EQL C;  1HFG A;  3IFD A;  1F9P A;  3GO5 A;  1KDC A;  3TP7 A;  1PRT B;  1FYC A;  1G2S A;  3LNN A;  5FO8 B;  4EGV A;  5BN4 A;  3QJY A;  2FFK B;  2NN6 H;  1D5M C;  2G9H D;  5KEE A;  4CKC A;  3FMC A;  1W6J A;  3MXN A;  2BA1 A;  2RDH A;  1GUG A;  2XWB B;  2KQ3 A;  1O7L A;  1B3A A;  5ISR A;  2AWN A;  1X3Q A;  3HGB A;  5I4D A;  1SNP A;  3FPU B;  2K28 A;  2A6E D;  1EY0 A;  1CA5 A;  2MHV A;  2Q8I B;  3DMU A;  3GV6 A;  2A68 C;  3ND9 A;  3H0G B;  4A3K B;  4XT1 B;  1V1P B;  5TSS A;  2LKV A;  1I4X A;  2OEO A;  1KNA A;  4FP5 D;  1O7Y A;  4IUV A;  1EY5 A;  3J7A V;  1WTR A;  2RSN A;  2RDF A;  1WD0 A;  3QIA A;  1RTO A;  4DAP A;  4KN4 C;  3X3N A;  2EJF C;  3NSW A;  1WTV A;  3BYY B;  5CGK A;  3A7A B;  1EOT A;  5DAU A;  1Q1B A;  1LTT D;  1I6H B;  1HXY D;  3J7A F;  2A69 D;  1PRT D;  2F0K A;  3J81 E;  5EJW A;  4R8N A;  2KHS A;  4ABN A;  1JB3 A;  3D31 A;  2PW5 A;  1PFB A;  4IUR A;  1H9M A;  5CBE E;  2F0G A;  3AMU A;  4OIJ A;  3BS1 A;  3A55 A;  1BQQ T;  5DM7 3;  3RD4 A;  4CHT B;  2F0J A;  1NSN S;  1BNZ A;  2WKC A;  5JEA H;  3QOL A;  1STY A;  2RKS A;  4K2L A;  2E2H B;  4G7O C;  3TZU A;  2Z4I A;  2DNE A;  5IGE A;  2XWJ B;  3GTL B;  2F3W A;  1WTO A;  1IYU A;  1FR3 A;  3QWN A;  2FJ2 A;  4HR7 B;  2A6H D;  1QNK A;  1VMC A;  1X3P A;  4EQO A;  2KCN A;  3MA2 B;  3VR6 A;  2ZXR A;  2PZT A;  4O42 A;  4PMC A;  1KLU D;  2NB0 A;  2QEJ C;  3PUW A;  2NVT B;  2WII B;  1VF7 A;  3OSO A;  4A3I B;  3T16 A;  5CR3 A;  2F0M A;  5CV4 A;  4DU9 A;  1Y8N B;  5ELF A;  1ESR A;  3Q6S A;  5D3I B;  1JOO A;  1II3 A;  3GTM B;  2EPB A;  3Q23 A;  1DD2 A;  2AUJ D;  4MN3 A;  4CJ1 B;  1GXD C;  1D5X C;  2CQA A;  1QWY A;  2JA6 B;  4XTC S;  3C1F A;  4RHR A;  2HDL A;  1CK1 A;  1MSG A;  1ENA A;  3HKZ B;  2PNR C;  1F2Z A;  1EY9 A;  4KN7 C;  4C56 C;  1SDF A;  3ERQ A;  1JQY D;  3TDQ A;  3X3M A;  1Q8I A;  5EBC A;  2I46 A;  1QIL A;  1HA6 A;  4LK1 C;  1SNQ A;  1Y1V B;  2L4N A;  4FXG C;  2ZXP A;  1BUV T;  1KAA A;  2H4O A;  3E0J A;  2JA5 B;  2Z1C A;  1TS4 A;  2WAQ B;  2XRQ D;  4UAI A;  5CBA E;  1QCB D;  3S9W A;  1O7Z A;  1ESF A;  3KF8 A;  2EOT A;  2RVL A;  3LWU A;  2SNS A;  2BE5 C;  1GUS A;  4ODG A;  5C4Z A;  3G6J B;  1RCV D;  1DCZ A;  5T1G A;  3Q22 A;  1STB A;  2A68 D;  1WCM B;  3L7Z C;  3MFG A;  1PRT F;  4X3K A;  2K03 A;  2NVQ B;  5IGG A;  5EPJ A;  2A5H A;  2NUC A;  1C48 A;  3DWA A;  1DOM A;  5JVH 3;  2E2I B;  2F0T A;  3T4A C;  4ULL A;  2TMP A;  1CFM A;  2DY7 A;  5IGC A;  4G4K A;  3PUY A;  4KD4 A;  4OL7 A;  2K04 A;  2XVS A;  4OIK A;  2JYO A;  4RH6 A;  1I4R A;  4H0L C;  4C1N K;  3K5M A;  4IUQ A;  1A3U A;  1R4P B;  1JOR A;  3DXJ C;  3OIQ A;  1NR4 A;  2SOB A;  3J7Y W;  4NP5 A;  1AP0 A;  2K33 A;  1VCI A;  3SHL A;  3H09 A;  2O4X A;  3NUC A;  3P1H A;  2YU9 B;  1EU3 A;  3M4Y A;  5M5Y B;  3T53 B;  4KTA A;  1RJT A;  2K32 A;  3PMF A;  1O78 A;  1X32 A;  3M7N A;  1CZG A;  3IAY A;  4ME5 A;  5EGT A;  5CMD A;  1F77 A;  2MJ8 A;  1TWA B;  4BY7 B;  3A8K E;  1EWC A;  1XYI A;  1S5D D;  3OW7 A;  2EYM A;  3A8J E;  1MD2 D;  1ONL A;  4J6H A;  1GUW A;  3CKI B;  2PZW A;  3I73 A;  1JWS D;  3NHH A;  3TSS A;  1EIG A;  2C9O A;  2CHB D;  2B2V C;  5G3L D;  1PZJ D;  3H6M A;  2EYP A;  4HCE A;  3U9O A;  4FXD A;  1OXV A;  1L0Y B;  4BY1 B;  1XX8 A;  3D4R A;  1HQR D;  4XXE A;  1PLF A;  5IOC A;  3CU7 A;  2LFN A;  5CYU A;  1I4H A;  4FVM A;  1ICW A;  4J8Q A;  2A74 C;  3K7A B;  1G6Z A;  3OWF A;  2EE1 A;  3HOU B;  4DAV A;  5C5L A;  4DN4 M;  1B9M A;  3C2P A;  1KLG D;  2V4D A;  2F0Q A;  4RAU C;  1V1P A;  2IL8 A;  1Q3L A;  1Q90 A;  4FF2 A;  4KY7 A;  4HAE A;  1AZP A;  4DAY A;  1RF2 D;  2LY7 A;  2Q8R E;  5K36 G;  4NMZ A;  4R8I A;  5C44 B;  5I6W A;  5KNC A;  1JWU D;  1U4L A;  1RDP D;  1ET6 A;  1LTB D;  4V0B A;  2BE5 D;  1WTP A;  1S5E D;  1Q1E A;  4PQX A;  3RZO B;  4KV6 A;  2EYO A;  3I4L A;  1EYD A;  4HED A;  3GV3 A;  1RD9 D;  4CJ0 B;  3ITP A;  1TII D;  3R2I A;  2QKI C;  3RZD B;  1K83 B;  4RGM A;  4RGT A;  3KBG A;  1D6E C;  4FF1 A;  2DY8 A;  4RHS A;  3VR5 A;  3E5S A;  4N9P A;  1IKL A;  4ZRZ A;  4IFD G;  3D4D A;  1DON A;  1V8Q A;  4B9W A;  5ELD A;  4KKU A;  4X3S A;  1TS5 A;  3K6O A;  1Q12 A;  1VF5 C;  3R2T A;  1YNJ C;  1QG7 A;  2BCO A;  3T13 A;  1B53 A;  2DN8 A;  4CKE A;  5M5W B;  3S16 B;  1UEA B;  2GA4 B;  1SAP A;  5FLX L;  4PMB A;  5IT9 E;  4LMQ D;  2A6H C;  1D5Z C;  2XIW A;  4C1N I;  1ILQ A;  2R92 B;  3Q24 A;  3S17 B;  2RQX A;  3W2D A;  2XSC A;  5EQ0 A;  4KI0 A;  1Z7T A;  2EVB A;  2KED A;  1F2M A;  4K6D A;  3H91 A;  2QF7 A;  4B9X A;  3NWS A;  1FD7 D;  4C3J G;  5FK9 C;  1IL8 A;  4IFD I;  4TKO B;  2EYH A;  1EY7 A;  2B39 A;  2WKD A;  4QCL A;  4IN3 A;  3I3C A;  4K5X A;  5EPL A;  5C4J B;  2JA8 B;  3NP8 A;  3MWY W;  4IUU A;  1EFI D;  1HUM A;  3HZX A;  2HCI A;  3URY A;  5ELE A;  5JPM C;  1JIC A;  4OO1 G;  2NYZ D;  4A93 B;  5J22 A;  3MTS A;  1WTW A;  4K5V A;  2BOS A;  4XDX A;  4KD3 A;  4KY5 A;  2PW7 A;  4RKB A;  2MP1 A;  5LHY 1;  2E2J B;  1B50 A;  1SSO A;  1BCP F;  2L0C A;  2NWG A;  4CBV A;  5LL6 X;  4G57 A;  1GUO A;  3PIO 3;  1GJX A;  3GTK B;  1B44 D;  5K36 H;  3VYU A;  3V05 A;  2VNU D;  2EYL A;  1EEI D;  1AZQ A;  1C4Q A;  2F0E A;  3ONA B;  1S5B D;  5KGU A;  5DEH A;  3NBH A;  2B2T A;  1BR9 A;  1ROD A;  3WDN A;  3R3O A;  3SK4 A;  1BOS A;  2E74 C;  3S14 B;  4HMJ A;  4DK1 A;  1UUP A;  3S1R B;  1SE3 A;  4F88 A;  2YYZ A;  4F7X A;  2Q8T A;  4OO1 I;  5FOB B;  1SMY C;  3SR1 A;  1NAP A;  2K5Q A;  2H1E A;  1D2B A;  4E6I A;  2WIN B;  3I8Z A;  4KJO A;  1BXT A;  2AWO A;  3RMH A;  4CKB A;  4IFD H;  3F2U A;  4BBS B;  5BN3 A;  3BDO A;  2RA4 A;  3KK7 A;  1LTA D;  2JA7 B;  2D5D A;  3HG9 A;  2K5D A;  4RCN A;  1OXS C;  1LT4 D;  1QNU A;  2K05 A;  3IL8 A;  2K1B A;  5J39 A;  1JOK A;  1YNJ D;  2QIL A;  3GP7 A;  1IYV A;  1FGB D;  1S4Z A;  3M85 A;  2CW0 C;  2EZV A;  4K14 A;  4DXG A;  3RLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...