5C4ZA

Crystal structure of staphylococcal nuclease variant delta+phs l25h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKHMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4zA00
3TP5A 2NUCA 4ODGA 1SNQA 3DHQA 1ENCA 3D4WA 3EJIA 5EGTA 4EQPA 5C6AA 3DMUA 3NQTA 3U9OA 5J39A 4QB4A 4KV6A 5IGCA 2F0MA 1TR5A 5CV6A 5I9OA 4OL7A 4HTHA 3E5SA 3P75A 4ZQ3A 3SK8A 5KGUA 2F0QA 5JOBA 3P1HA 1STAA 1IHZA 2RKSA 5EKKA 3NXWA 5J1ZA 5DEHA 2F0VA 2O4XA 2SNMA 4KY7A 5HGTA 1EY9A 4K5WA 5K5PA 2F0KA 4H7BA 2F0HA 1JOKA 4LAAA 4ME5A 4NKLA 2F3VA 2F0DA 3C1EA 5E3FA 1SYGA 2QDBA 1EY0A 3RUZA 3EVQA 5IODA 1A2TA 4F7XA 4TRDA 1SNMA 4DFAA 3MZ5A 4MIUA 2F0JA 3MVVA 5IGDA 1KAAA 4F8MA 1II3A 1JOOA 1EY6A 1ENAA 3OMGA 1EZ8A 2EY2A 2OXPA 5NUCA 4K6DA 4PMCA 3BDCA 1F2MA 2F0EA 2EYLA 1SNDA 3SXHA 4WRDA 4EQNA 2RBMA 2LKVA 5JAVA 2OF1A 5C3XA 5KEEA 3QOLA 1JOQA 1SYEA 3T16A 2F0OA 4K8JA 3ITPA 4R8NA 4G57A 1SNPA 3D4DA 2PZWA 1EZ6A 2F0LA 2KQ3A 4RKBA 2EYFA 1NUCA 2WACA 4DU9A 4ZUIA 1KDAA 1EY7A 2F0GA 4PNYA 4IALA 1KDBA 2F0NA 5C4ZA 5IOCA 3SK5A 2EYJA 5IIFA 3MEHA 4WORA 3HEJA 2EY6A 4B9XA 1EYCA 4NMZA 2OEOA 4ID6A 1F2YA 1STHA 4I65A 3LX0A 4ZUJA 5IGEA 3HZXA 1TT2A 4KJNA 2F0FA 1SYFA 3NHHA 5IGGA 1SNOA 4DGZA 4EQOA 1KABA 5C4HA 1U9RA 1STNA 4HMJA 1SNCA 3C1FA 5CV5A 1EY5A 2RDFA 4KJOA 4NP5A 3OWFA 4RKLA 2F0WA 5CV9A 5KRUA 5ISRA 3V2TA 5KYIA 3H6MA 5EKLA 2EY5A 1F2ZA 2SNSA 4HMIA 4YIJA 1AEXA 3PMFA 4K5XA 3EROA 4IZ8A 2EYOA 4IUNA 5CGKA 3QB3A 2F0UA 1A2UA 4K14A 5KIXA 5C5LA 2F3WA 3ERQA 3MHBA 4QMGA 2ENBA 3QOJA 5KYLA 1STGA 1EYDA 3D6CA 3NK9A 4KHVA 4QF4A 3R3OA 3SK4A 1STYA 4KY6A 4DF7A 2EYMA 2EXZA 4E6IA 3T13A 1JORA 2EY1A 2PZTA 3D8GA 5HURA 2SOBA 4PMBA 3MXPA 2M00A 2PW5A 3SHLA 5I6YA 5I6WA 3BDLA 1EY4A 1A3UA 3OSOA 5C5MA 2EYHA 1SYBA 3OMCA 5M9OA 3VA5A 5C3WA 3SK6A 4KY5A 2F0TA 2HQEA 2PZUA 4K2KA 4KTAA 3SR1A 4B9WA 1KDCA 4K2LA 4K8IA 4KD3A 1TQOA 5CV4A 3S9WA 5CV7A 4KD4A 2F0SA 2PQEA 5I9PA 2PW7A 3TP7A 1STBA 1SYDA 1NSNS 1EQVA 1EY8A 1RKNA 3TP6A 4EVOA 5J22A 2KHSA 3NUCA 2F0PA 2EYPA 2F0IA 5CV8A 4J6HA 4S3SA 5DAUA 4K5VA 5IGFA 4NDXA 5IGBA 1SYCA 4N9PA 1A3VA 4J1MA 4N9TA 2PYKA 5F2DA 5CR3A 3NP8A 3TMEA 5E1FA 3TP8A 1A3TA 5CC4A 1EYAA
chains in the Genus database with same CATH superfamily
1JC7A 1VQIA 5C6AA 3KLSA 2K03A 4QB4A 1KHIA 2EJFC 3RLFA 3F2BA 3RLNA 4A93B 2E2JH 3E5SA 4A3DG 2R93G 1STAA 1RF2D 4HR7B 2K04A 2O4XA 4X3SA 1U5KA 2VNUD 4OIKA 3GTMB 2VQEQ 1SYGA 4A3JH 2A8VA 1TWAH 3EVQA 4A4IA 4HCEA 3K81C 3T1YQ 1KAAA 2EY2A 2MGSA 2OXPA 2UUBQ 1X55A 1QNUA 3TN2A 3KFUA 2TMPA 2AMCB 4NXMQ 2KVMA 5JAVA 5G3LF 4LFAL 2RDGA 3HOUG 3MFGA 4FNFA 2F4VL 2CWAA 4HIMA 1QWYA 2EYFA 1UE7A 2CW0D 1OTCA 4A3BG 1EY7A 1G91A 3KBGA 1JT8A 2UXBQ 1IW7C 2RDHA 5D14A 4DKAC 1FD7D 5IGGA 1VDZA 5C4HA 2MUYA 2R7FA 1WTQA 1PTOH 5E7NA 3RN5A 2KA7A 4XT3B 2SNSA 2GVBA 4L5QA 3EROA 1X56A 4OHJA 3X3NA 1HA5A 4JVZA 4PG3A 3U50C 3K58A 1BBWA 3E6ZX 3X3MA 2CH4A 1WFQA 2PMZB 4HSPA 4IQZA 2UUAQ 4YWKA 5M3FH 3SK4A 2B2VA 4FXDA 5C3EB 2PZTA 2LXJA 4C3HH 4JI3Q 1I50H 4R9WA 2QKIC 1A3UA 1TWCB 2KEEA 4A3FG 2R92B 4KY5A 2I5LX 2PZUA 3CCLA 4DV2Q 4DV6L 1BUVT 5IYBH 4XQJA 3ULJA 2B2VC 2C5CA 5IP9H 1GXDC 4RCOA 2GN5A 4S3SA 3I4OA 1SMXA 2MFIA 4K6LA 1XX8A 2R7ZG 1HTLD 5EAYA 4A3LH 1NR4A 2OTJA 1EFID 5E1FA 1QE6A 5BR8Q 3OYYA 3MXGA 4U673 1RL2A 3LGJA 3FHWA 2WV6D 1U0LA 3PUZA 4LMQD 3STBC 1UE6A 1IBKL 4HTHA 3Q24A 3P75A 4NXNQ 1BVSA 2A1AA 4OX9Q 5I2XA 4BA1I 1CA5A 1E7ZA 4X3UA 3GTPB 2BDNA 3K59A 1MGSA 1Y1VH 3E0JA 3HOYG 5HY6A 1VQ6A 4DNIA 1ENFA 2Y0SG 1CKNB 2OQ0A 3I4NG 4HJAA 5M5XH 4F8MA 2V1CC 2PO4A 1CI3M 2CQOA 5A2QL 3BDCA 1F2MA 2EYLA 3C2PA 1FJGL 2RBMA 1GUOA 3NENA 2ASBA 1HA6A 2VUMH 2UXCQ 5JEAJ 4CKBA 1LYLA 1LLRD 1SYEA 4MHEA 4R8NA 3HOZG 3S16H 4DK6C 2BE5D 5FK9C 3S1NH 1CT1D 4Y7NH 5TSSA 1AE2A 2OEOA 1S5FD 2D5DA 2E2DC 4I65A 3HZXA 4HJ7A 2E2JB 4Z9CB 1Y8OB 2Z6KA 1RHPA 2B3GA 2EXDA 1VQGA 5CV9A 3O13A 2IW3A 1HNXL 3TS2A 3UDFA 3M7NA 1V8QA 1U4PA 4HCSA 1V1OA 1K8AC 1TWAB 4P75A 3LWEA 2MNAA 1EIGA 3I3CA 1EL0A 4DUYQ 1HR0Q 3M4OH 4KHVA 1YI2A 1CFMA 5JJLA 1QVGA 2Z6KC 2KECA 2Q2HA 1DOKA 2VB3X 2YU9H 3OW2A 1OO9B 3GTLB 3OHXC 4HJ5A 1KXLA 2MO1A 4DR3Q 4MN3A 1KRTA 1SYDA 1R4QB 2L11A 2R7DA 1ONLA 1DZ1A 2A5HA 1PRTF 4XDXA 5DAUA 3RNUA 1QJOA 4LF6L 4N9PA 2ZXRA 1OXSC 2PYKA 4RA8A 2DGYA 2IWHA 3JAMc 3KF6A 4DXFA 5CC4A 1HJPA 1ICWA 4MTNA 1PTOB 3D0FA 2L55A 4JG2A 3PIPA 1B50A 4EQPA 3D4WA 4FXGC 3FRPB 3CD6A 4DV3L 2NVYB 1E0BA 2SDFA 3F1ZA 3FKIB 4KHPL 1SXTA 2AQ2B 1ZYRC 4GNXA 1B4OA 1K3BC 3T53B 3VR6A 4MZ9A 4ILWA 2DNEA 3H3VH 2JA5H 4XQNA 4IUTA 2F0HA 5FLXc 4C3HB 1I50B 2PPBC 4XIGS 2HQLA 1J6QA 4F88A 3MZ5A 1SLJA 4JI4Q 3K7AH 3BYTB 2DJGC 4DNRB 1A0IA 2RCFA 4GNXC 5NUCA 2WP8J 5C3EG 4PMCA 1WTPA 4WJ3M 3W5OA 2EJGC 5LMNL 3E0EA 4CBVA 1QCBD 1HUMA 1NNXA 3GV3A 4LK1C 1SE4A 2R3ZA 3NPPA 1EQRA 3FP9A 5EQ0A 5IT9L 4R4TA 2K5DA 1I4QA 1XNRL 2KJXA 1EZ6A 2VS1A 2ZM6Q 1VMCA 1PH2A 2RSOA 4X65Q 5C4ZA 2Q2TA 3I2ZA 3M3YH 3S14H 2FHTA 1EFWA 2HDLA 1XPRA 4BA2I 1ZEQX 3VYSA 1EIFA 1RDPD 1KABA 3E9IA 5LMUL 4ZYSA 5ISRA 1K3RA 1VQ8A 4RAUC 1Y1VB 4YWMA 2XWBB 1V1QA 3HOUH 4IPDA 1B9NA 4IUNA 1MHWC 5CGKA 2JYOA 1YNJD 4DV5Q 5M5XB 4OWWB 3D6CA 4GOPA 3NK9A 1STYA 2IJ0A 1T9HA 1O7YA 4A3IH 4KN7C 2BOSA 4KMUC 3T4AC 1B9MA 3BZDB 4XTCS 2K05A 2ICEC 1ILPA 2EQSA 1KDCA 3S16B 2QDLA 4O0AA 1B8AA 3HFZB 4GOPC 3S1NB 2D0OA 2IL8A 1L0WA 4Y7NB 3NUCA 2VXWA 4QCLA 1LT3D 1IXRA 2DJFC 2N55A 3PF4A 3NBIA 4CDCC 1B3AA 4AYBE 4L5RC 2LFNA 4JBMA 3MFYA 4RGMA 4ZKCB 2XIWA 1AZPA 4FF2A 2JEAI 1V9PA 1S5CD 4CGYB 1I4RA 5E4WC 4ZCKA 1GHKA 4JI2Q 1CQFA 1QUQB 2F0QA 1O78A 2QGQA 3PO3H 2ZTCA 4C3IG 3M4OB 1I4XA 1K8GA 2OCEA 4J15A 1G2TA 1JOKA 4NW2A 5E3FA 4A3JG 2YU9B 2JN4A 2EVBA 3CPWA 4HJ8A 4DR4L 2A6HC 3HOWB 3KDFB 1MD2D 2PNRC 3BZKA 3ND8A 4JCVE 2D2CC 3M85A 2HCCA 2A68D 2YTVA 1WI5A 5IYDH 1JE4A 2OF1A 3QOLA 4G7HC 2HUGA 4DAYA 1HUNA 3VDYA 3D4DA 3DWAA 1QVFA 2KQ3A 1SMYC 1NBWA 4JI8L 4DU9A 4QGUA 3CCEA 1E22A 4PNYA 2QILA 2F1MA 4IPGA 1HRJA 1LT5D 1SBBB 1PFBA 4HJ9A 1VQCA 5FLMH 1F2YA 1ESFA 3K6OA 1KAWA 5GROA 3QJYA 1ET6A 2IHEA 4GLVB 1HNZL 3GTOH 2RF4A 1EY5A 2Q8IB 4B3TL 5KRUA 2JA5B 2OT2A 1LTLA 1PH6A 2I5HA 2A69C 4OEMB 1CHQD 1Y69U 1DCZA 3A7AB 4IZ8A 5LL6S 4ZRZA 4JI1L 4DUZQ 3HOZH 3QIAA 3KJPA 1F9SA 2F3WA 3GP7A 1EYDA 4EX5A 1UEBA 1EWHA 5M3FG 3R3OA 2L9HA 4C3HG 4I7AA 3Q23A 1LTAD 4JI5Q 3F2CA 4A3KG 3HP3A 3VA5A 1FNVA 2ZJRA 4K8IA 1N9WA 1C48A 1DOLA 4IPCA 4WFN3 1EQVA 1EY8A 4EVOA 3L2PA 4LF9Q 3MAQA 5IP9G 1IBML 4BS9A 3LNNA 1I6VC 3U4ZA 3M3YB 3HKSA 4RMFA 3GTQH 1TS3A 4RG1A 4A3LG 3J81i 4C1NI 4BY1H 1HZBA 1WTXA 1N34L 3CW2C 1GJXA 5BN4A 1GUSA 3EJIA 3HOUB 1A8VA 4LFBL 5CV6A 1XMOL 3VYRA 1CKOA 2D0PA 3I8ZA 2K01A 1BCPC 1PH8A 4EQ5A 3MA2B 1C8CA 1PDQA 4DV7Q 1D1IA 1Y1VG 4A3IB 3ICEA 5C44H 3PIP3 4NKLA 3K5MA 2B39A 5LMNW 2K4KA 2EZVA 4P71A 1SNMA 1CQVA 1QVCA 5M3MG 1PH5A 4MIUA 3I70A 1GO3E 1H9SA 5ELOA 4WJ4A 1ENAA 3JAML 4C1NK 3C3LA 3J80L 3PO2H 1VCIA 5LL6X 2RCNA 1EYGA 3A7LA 3ER0A 2B63H 1TVXA 4IUQA 2VUMG 4CDFC 4K8JA 5EBCA 1PFMA 2F52A 2J7ZA 5IYCH 2PZWA 1AW7A 1IYJB 1A62A 1E3PA 3M4YA 5COYA 1TWHH 3HOVH 2PI2E 3A54A 2EYJA 1GHJA 2M9VA 2Z8LA 3NBHA 5BN5A 3WWVA 2HHHQ 3LX0A 4EGVA 1TIID 3OTOL 4DR5Q 4FF1A 3T1HL 3PO3B 2A6ED 2Z4IA 4KJOA 4A76A 1SFOH 4HIKA 1AEXA 2BH8A 3SE0A 4CHTB 1K8OA 5EPKA 3PIOA 2F0UA 2IX1A 1CSPA 5FOBB 3A5UA 1EOTA 4E6IA 3S1RH 1XJVA 2BH2A 4OGQC 4B3RQ 4DR1L 5I6YA 1G2SA 4C2MB 3N6RA 3S2HH 4AYBG 2O2LD 2AHOB 1JE5A 2O5IC 1VQ9A 1NE3A 3G6EA 1YBYA 1VQMA 1WD0A 2O5JC 3L9AX 2F0PA 2Y0SB 1E1TA 4HSVA 2F4IA 1XMQQ 4N9TA 1DYQA 4UHVA 1RJTA 1HPCA 1YJWA 1RODA 3GTOB 1GM5A 2V4DA 5C0XH 3F2UA 3W2DA 3K5OA 4ZKBB 1K83H 5GADC 5IGCA 3W3AA 3HOZB 4CDEC 3RLOA 2JA5G 1J5EL 2R6GA 1XTDA 1FL0A 1DD2A 4PZ6A 1XPOA 4R4IA 2CQAA 1Y8PB 2I0QA 4YHHL 1Y1WG 3R8BA 2CWPA 1BKBA 2N88A 3IFDA 3I56A 1VQPA 1UE5A 4UP7A 1Q1BA 4YY3L 4MNOA 3K5NA 4DV0L 3BVMA 3V05A 3Q6SA 3VR5A 5IT9c 4HIOA 3CC7A 1PA6A 4C3IH 4ME3A 3KF8B 1LV9A 3LWUA 4BY1B 4X62L 2K5WA 1PH1A 1EUJA 1KDBA 3DUZA 1R4PB 2RVLA 1N32Q 3A8IE 3BS1A 2SEBD 4EQOA 4HMJA 3HS0C 5CV5A 4B3ML 1L1OA 1PZID 2UXDQ 1UAPA 5ELNA 5KYIA 5JJKA 5EKLA 3OPOA 5HGQA 2H4OA 4LNQA 4LF7Q 5C44B 2FXQA 3ND9A 4PQXA 3FDTA 2NWGA 4DV1Q 1C4QA 2ENBA 3CQZH 1S40A 2ZJPA 2X6GA 1I94Q 1U4RA 2G9DA 2OWOA 3PO2B 2BCOA 4A3IG 4O42A 4OO1G 5HURA 3G4SA 3DEPA 1L1OC 1X6OA 5KNDA 2B63B 1PZKD 3HRZC 1B1ZA 1W2BA 3BDOA 4P2CB 1TQOA 1R9TH 2MHVA 4UDUC 4P72A 1NSNS 1ILQA 2KHSA 3AFQA 4JBKA 3CMAA 3HOVB 2D9UA 5FKAC 1TS2A 4QIWE 4B3SQ 1VQBA 4JI7L 3FPPA 4UP8A 1A6XA 3CRKC 1I6HH 1P16A 1SFOB 1IBLQ 4GN4B 5EGTA 4A3KH 2Z0SA 3NWTA 3J7ZC 1VQJA 4HAEA 1TR5A 2G5DA 4U68A 2MQHA 4DV4Q 3PO3G 2RHQB 1FNWA 1O7LA 5EKKA 1HFGA 3I4MH 1GD7A 1S5ED 4JV5Q 3S1RB 4KY7A 4AQYQ 3I73A 1HNZQ 5A2QE 1TY0A 3A5ZB 1Q12A 3S2HB 4RGTA 1WD1A 3PUWA 1D5XC 1DJRD 1YHQA 4V0BA 2AWOA 1O7ZA 1JJ2A 5IYDG 2LKVA 4IUVA 4ULLA 2OQKA 3EN2A 2F3IA 4CJ2C 4HN7A 2F0LA 1NUCA 1ET9A 4K0KQ 1AE3A 2AUKA 4JI6Q 2LXKA 2UU9L 3VA7A 5M3MH 4ID6A 5FLMG 1AZQA 1K83B 5CMDA 1HFNA 1TT2A 3TS0A 2G9HD 4LJZC 3TRZA 3E9HA 1WYDA 1JCKB 1D8LA 4TQUS 1RIPA 1F2ZA 3I72A 2FFKB 4UP9A 1N33Q 1X9NA 4FF3A 5AFWA 3S17H 4N8FA 1Q3LA 2Q2IA 1O7IA 1TWHB 1WJJA 3WDNA 2PNHA 2EYMA 1YNJC 1XMOQ 1ML0D 3A0JA 4DR6L 1MJCA 1Z7TA 3KJOA 3SHLA 5I6WA 4DK1A 4GKKL 5AJ3L 3PIO3 1DONA 2I46A 4K2KA 4G4KA 3CCMA 1QZHA 2NVXH 4C3IB 1HQRD 1Y14B 2PW7A 2AKWB 4IFDG 1S5BD 3TP6A 5J22A 1PYBA 2HD3A 4A3JB 3I55A 4BY7G 3DEOA 3QG1A 5IGBA 2XNAC 4A3GH 1JWMD 1JB3A 4LF8L 5IWAQ 4X64Q 1XNQL 3GDEA 2UUCL 1HCZA 4BY1G 1LTRD 1MSHA 1TKWB 1JMCA 4KLKA 3CHBD 3VR4A 2NUCA 4JYAQ 3DHQA 4OONA 2X6LA 1LUZA 5C4XH 1XPUA 4LW1A 1IZ6A 1T5EA 2VQFQ 2NB0A 3CQZB 4DK0A 4JBWA 1TWGH 3VYTA 1QG7A 5DEHA 5K5PA 2RA4A 5C44G 3PQIA 1IKMA 5DM73 2F0DA 1E2VA 4DFAA 1FR3A 2NYZD 4DXGA 4G7OC 1TWFH 2C9OA 3J80c 4GLXA 1AFPA 3PO2G 1EZ8A 1TY2A 2ZTDA 4A3EG 4K6DA 1R9TB 3W1BA 2F0EA 1TS4A 5JJZA 4A3MH 2B63G 3BYYB 4WJWA 3A8JE 2H5XA 2L5TA 3P20A 3T16A 5IYCG 3VR3A 4DR1Q 5M3FB 1W3SA 1I6HB 4BBRG 3RR5A 1W6JA 2F0GA 3GTJH 2ICIA 3HOVG 2NTTA 4JK1C 2B2WA 3CCQA 3EA6A 2ATWA 3HEJA 4A3KB 1STHA 1Y1WH 1VQ5A 4KJNA 3OIPA 4JI0Q 1C7YA 1H9MA 2FJ2A 1U9RA 2WINB 3C1FA 5I2YA 5CBAE 3I4MB 1VQ4A 3K7UC 5D65A 1SE3A 5GAHC 1GOZA 4LF4L 4L63B 4DA2A 2B2WC 1SEBD 4X6AH 4IURA 4IUUA 3QOJA 2I07B 2WIIB 3MXNA 4DAVA 3AQQA 3C46A 5EPLA 4RCNA 1VQFA 3M7GA 4O1NA 4RHRA 3ULPA 1J8IA 1EQTA 3UI2A 3MXPA 3NEMA 3TZDA 2KHJA 3VYUA 1SE2A 2WKDA 3KF6B 3M9BA 4LFCL 4KD3A 3CCUA 5JPMC 4DR7L 2WFWA 4BBSG 4BXXH 1WCMH 4GNXB 2F0IA 4H02A 2LSSA 5M3MB 3J7A5 1ZKOA 4DPGA 5GAEC 4OWTB 2EDGA 3TMEA 2ZXOA 4OO1H 4X66L 3GV6A 1PRTC 5C0XG 3A74A 2VUMB 1H9KA 4LF5L 3U9OA 2IX0A 1Q86C 4UPAA 4TVAB 4X62Q 3S17B 1ASZA 2RSNA 2JA9A 3KOJA 3M4QA 3PF5A 4CJ1B 1M1KC 1K73C 4PMWA 2L15A 1L2FA 4PZ8A 4ME5A 3S2DH 2E2HH 1CHPD 1I3QH 3RUZA 3SGIA 4FO2A 3VR2A 4R4QA 4LFAQ 1HNWL 2NVXB 5DM63 2F4VQ 2KCCA 3CMEA 1YJ9A 1PTOD 1F9RA 2PQAA 5C3XA 1F9QA 1KLGD 1X32A 2UUBL 1GUGA 1K8MA 4A3GB 4QJFA 1X3GA 3IAYA 1VMPA 5JVH3 2WACA 1A63A 1KDAA 2X69A 4NXML 3CXCA 2J4XA 2B29A 3B6YA 2Q8TA 3S24A 3TEHB 5C4XB 1S3OA 3NTIA 1X54A 4GOPB 2EIFA 4DAMA 4AYBB 1EOVA 4POGA 3QR8A 1G51A 1Q1EA 2RQXA 4RKLA 2UXBL 1IL8A 1TWGB 2M2LA 1VQDA 3CAMA 2WB1E 1JB7A 3TDQA 2FMCA 1PMRA 5GQOA 4QMGA 3J7YW 3PV0A 2E75C 3PUXA 4KY6A 4DV6Q 3CCVA 4LUZA 2IHFA 4A3MB 2UUAL 1LO5D 2K33A 1Z9FA 4KTAA 1JR0D 3TZUA 5CV4A 1HHVA 3S9WA 4QUFA 4KD4A 2PQEA 2XTIA 2A74C 3PGZA 1NTGA 1BDOA 3MEFA 2VB2X 2IPKD 3HOXH 4DV2L 1IKLA 4QQBX 3K7AB 3E3XA 1Y1WB 1SROA 4IPHA 1ZXTA 4OWXB 3K0YA 1IBKQ 1EU3A 2HIVA 1QOHA 3SEBA 5IY0A 3TP8A 1EYAA 4L5TA 1U4MA 1L0YB 1TXYA 3SK8A 4CJ0B 3JAMi 3CPFA 5KGUA 3J80i 3V96A 1JWUD 1FGUA 2UU9Q 3A56A 1VF5C 5BR8L 3I4MG 4GKJL 4IFDH 2JA7H 3T1YL 1PH7A 2F0VA 4UY8C 1BR9A 2DN8A 3OW7A 4LAAA 4QY7A 4DAYB 4BY7H 4OX9L 3S14B 1A2TA 1FJGQ 3NWSA 4TRDA 4A3CH 5IGDA 2B8FA 1JJGA 1TU2B 3AU7A 3U4VA 1EY6A 3S1QH 3OMGA 4PZ7A 3CRLC 2BA1A 3J81E 1NMGA 3KLRA 5FLXE 3KK7A 3J81j 1SE8A 5T1GA 3KYHC 3BJUA 4LWCA 3H15A 2UXCL 1IYVA 2F0NA 4R4OA 4B9XA 4L5SA 1DOMA 3JC66 1HNXQ 5IP7G 1D5ZC 3DM1A 1SYFA 4RGNA 2XWJB 4A3EH 1SNCA 5J3BA 1V1PA 3EIVA 2JK8A 5EJWA 4JW0A 1PYWD 2EY5A 4YIJA 3PUYA 4LF8Q 1XNQQ 3PMFA 2QF7A 1KL9A 4AIMA 5CORA 2VW9A 2UUCQ 4NB3A 1I3QB 5DLQE 4K14A 5JPNC 3G71A 2DY8A 2DNCA 3CKIB 4BBRH 1CZWA 3D8GA 1BCPB 2AQ1B 5A35A 2CW0C 1C0AA 1CA6A 4M8AA 1GUNA 4DUYL 4IOCA 1HR0L 3OMCA 5M9OA 1ICFB 4HIDA 1KTKA 1LACA 3IRBA 1CUKA 4LF6Q 2K6AA 1RKNA 4Y52H 3I4LA 1MKHA 4RH6A 1CTMA 3MWYW 3H3VI 2LS01 4DR3L 4A75A 4A3GG 4DV3Q 4KK7A 2FMMA 3R2TA 4KHPQ 1EEID 1A15A 5C4XG 1ENCA 3RMHA 2E74C 1H9SB 2VZAA 1SMYD 1RD9D 5H1SE 2AWNA 4GN5A 4ZQ3A 3P1HA 2R92H 3G6JB 1OXVA 1V43A 3NXWA 5J1ZA 4BBSH 5HGTA 2IX3A 1X3PA 2L1BA 1EY0A 5IODA 2HT1A 1CZGA 3KUPA 5L37A 5LMNQ 1S5DD 5EKIA 3MVVA 2XN9C 2KUMA 2L12A 1MSGA 2KCTA 2WAQE 4LF4Q 1KNEA 4XXEA 1XNRQ 2YTYA 2XSCA 3NBHB 3SXHA 4WRDA 4A3MG 4EQNA 4JI4L 3RD4A 3H91A 3QO2A 1B53A 1QZGA 4M1UB 3HOXB 2A73B 2B2TA 2JA8H 3ITPA 4YCVA 2WB1G 1PFSA 3GTGH 5LMUQ 3GTPH 3FEWX 4IALA 5IOCA 2JA6G 4WORA 3RZDH 4DN4M 2ZM6L 2WAQB 3G7LA 3CC2A 4X65L 3NQIA 1D7QA 4ZAIA 3NTHA 4OO1I 4APVA 2B2TC 1KQSA 3WOFA 4C56C 2JA7B 1BBUA 3H6MA 2K52A 1SN8A 2JSOA 5JVG3 1N36L 4BY7B 1KIXA 4C3JH 1K0RA 1S4ZA 1X3EA 1A2UA 4POFA 3GTQB 1CM9A 1YNND 3ERQA 5KYLA 5M5YH 3AMUA 1SJED 1U4LA 4LF5Q 3S1QB 1M90C 4FP5D 1B44D 3ZJYC 4DF7A 2E2IH 3CC4A 2MP1A 4V190 1NMFA 4DV5L 2SOBA 4PMBA 2BE5C 1G6ZA 4O2DA 1BCPD 1B3QA 2EYHA 1GKHA 1D2BA 5C3WA 2HQEA 3TQYA 3DWPA 1BBXC 5JEAH 1G291 5D3DA 2CHBD 5CV7A 1PYSB 2Q8RE 1QNKA 1Q8KA 4BXXG 4F87A 1WCMG 5FO8B 1HNWQ 1CK1A 2EYPA 1Q7YC 1I5FA 1YJNA 3L0OA 1I4HA 1RCVD 1QB5D 3N52A 3UE1A 1VQLA 4A3EB 3OWEB 4AH6A 1AN8A 2D62A 2OTLA 3DMUA 4CKCA 3SDZA 5ELFA 3ZYYX 2JQOA 1LTID 2F0MA 3GTLH 1Q90A 4RWSC 4NPSA 2CFMA 1F9PA 5ELCA 4BBRB 2RKSA 2VY3A 4L6TB 4DR4Q 1L0XB 1EY9A 2PMZE 2IY5B 4XYQA 4JI2L 3P7JA 5ELEA 4RGOS 1UEAB 1VF7A 1DXMA 2DY7A 2F0JA 3R93A 1H9JA 2ID0A 1NY4A 1HZCA 2I5MX 1PZJD 4G7ZC 2JE6I 3CP0A 1SNDA 3OOCA 4JI8Q 1VQNA 2NVYH 1RTOA 3FKIH 1L1OB 2J0TD 1VS0A 1CKNA 4RKBA 2P5ZX 3HKZE 1K0SA 4QIWB 3AFPA 4XYOA 4LUVA 4KKSA 2Z6BA 4B3TQ 5FO7B 4ZUJA 1M4VA 2F0FA 1J9OA 1GUWA 1SNOA 1B2TA 1UE1A 1PTOF 1C9OA 4JI1Q 5C0XJ 3PUVA 4BBSB 5FJ8H 2AUJD 3ULLA 3GQBA 1P8LA 3Q22A 1HR0W 5T1IA 4YWLA 3HKZB 4GN3B 4IFDI 1KLUD 4QF4A 3J7AV 1YNXA 1O80A 4OXPA 3T13A 1BNZA 4DUZL 1WTVA 1SAPA 2KHIA 5D3IB 5IP7H 1D1KA 3BDLA 4GKJQ 3OSOA 5C5MA 1IBMQ 2JA8B 4YCWA 2NVQH 4K2LA 1HTPA 4JI5L 1B70B 2FINB 3GTGB 3GO5A 3AYHB 4ALPA 1N34Q 3HOXG 3RZDB 4ZK9B 2K14A 5CV8A 4J6HA 3KLWA 1SYCA 5KNBA 3BVZA 4LFBQ 4LF9L 2NZHA 2Q2UA 4KHZA 5EPJA 4JBJA 1UNSA 1W6KA 3D4RA 3K57A 4BWGB 2WAQG 5I9OA 4C3JB 1K9MC 2N78A 4B08A 5JOBA 1EIYB 1FGBD 4IUPA 5M5YB 1E24A 1LTGD 2HIXA 3NSWA 1Q8IA 2JA7G 2JP1A 2E2IB 3TREA 1VQEA 1OXXK 2F0KA 3H0GH 1WOCA 2K32A 4H7BA 2B2YA 4H13C 1BOSA 2MJ8A 4F7XA 1LTTD 4A3CG 2HDMA 3EBEA 4L8JA 4RHSA 2QCPX 4DV7L 1CSQA 2VL6A 2QEXA 1T5XD 3KBXA 3FMCA 3DM3A 1PH3A 3S1MH 5ELDA 4KI0A 1D5MC 4X3TA 2B2YC 3W1GA 4A93G 1OXUA 1SDFA 1EWCA 1PTOC 1IW7D 2E8GA 1PLFA 3OTOQ 1VQOA 3T1HQ 3M4PA 2YTXA 1XWEA 2MO0A 2EY6A 4DK3C 1WTRA 1Q46A 5IGEA 4UAIA 4DR2L 3NHHA 4FVMA 1YHBA 2K7VA 4IN3A 1VQAA 5IT9E 2ZJQA 3HOWH 4IOAA 2KCMA 2JJQA 3V2TA 4HMIA 2HHHL 4P74A 4K5XA 2H1EA 4DR5L 1JWSD 3QB3A 4XT1B 2JEBI 5C5LA 2A68C 1LTBD 1BXTA 3I91A 3AB9A 2EXZA 2JA6H 1I4GA 2M00A 5K36H 1PVOA 1EY4A 1SYBA 3S15H 1LT4D 2K5HA 2F0TA 4B9WA 2NBFA 1KD1C 4B3RL 3CU7A 5FO9B 5C0XI 2EOTA 3G48A 1YEZA 4R8IA 1BF4A 2ZT9C 2B8GA 1EU4A 3OIQA 3J81c 1PHJA 1F2LA 1LABA 1HXYD 1HZ9A 5IGFA 2R61A 4J1MA 2NN6H 3STBD 3DXJC 2E5LL 3F8TA 1JJCB 1FVIA 1SNQA 3H94A 1XMQL 5KNCA 1J5EQ 3UDXA 4OL7A 3URYA 4A3DH 2L4NA 3EQLC 4LUOA 2R92G 2R93H 5G3LD 1X3QA 1NJIC 1IHZA 4YHHQ 5GAGC 5BN3A 1DGSA 3D3RA 3WOEA 2F3VA 3C1EA 1QILA 1XXGA 1G8ZD 3HKZG 1G6PA 1X65A 1STEA 1AP0A 4YY3Q 5CYUA 1F77A 1JOOA 1YIJA 1N36Q 4DV0Q 2XRQD 3DLLA 2NVQB 4CDDC 3K80C 1D6EC 1VQ7A 1QUQA 4I7ZC 1Q82C 2EE1A 4IO9A 1SSOA 3Q8DA 5KEEA 1JOQA 2JA8G 4MTKA 3FPUB 1SNPA 2KOLA 3QWNA 1KC8C 4ABNA 4ZUIA 2GVAA 4A3BH 1AH9A 2EJMA 2YV5A 3KDFA 2ZXPA 4B3MQ 1EYCA 3MXNB 2ES2A 4FDBA 4DGZA 4R4CA 2VQEL 1STNA 5ELBA 4ZLTF 4NP5A 3OWFA 1OXTA 1EWIA 4RFBA 1N32L 3H0GB 1Z6HA 2Z4HA 4C3JG 3SVMA 2QW7A 1PRTB 2KCNA 2UXDL 2K5VA 1S72A 1EEFD 4LF7L 1JORA 1ESRA 1HH2P 2EY1A 2C35B 3PCOB 4PV1C 3CCRA 4DV1L 3S1MB 3RZOH 2PW5A 3T56B 1I94L 1Y8NB 3SK6A 4A3FH 5JEAG 1JQYD 2K28A 4JI7Q 3BU2A 1STBA 1M8AA 1NR2A 4HEDA 4X3KA 2NZOA 1MI2A 3L7ZC 2A6EC 5C4JH 2CH4W 1PH9A 4K5VA 4XQQA 3H3VC 1TWFB 1YITA 4FXKC 1A3VA 2R7ZH 4KKTA 5M5WH 4JOIA 4DAPA 1MBYA 1ZYRD 2L0CA 2WKCA 1BCPF 3K0XA 4GZYC 4ODGA 1PH4A 2BDOA 2XGTA 4B3SL 3NTKA 3NQTA 4N8X1 3MXUA 4C2MH 3MC0B 2NVTH 4KKUA 4JI3L 1IBLL 2JXMB 2WB1B 1XYIA 2N3SA 2PQAB 3GTJB 3HOYH 4K5WA 4JOIC 2JA6B 3IKJA 2K50A 2QDBA 4DV4L 2K75A 2ZTEA 3I4NH 1JICA 3TBIB 3S15B 4JV5L 3K5LA 2AQ3B 4AQYL 1FNUA 1KNAA 4OELB 3L3OC 3UDIA 2Z9HA 1Z47A 4H0LC 1XTCD 4QL5A 3HG9A 1EIHA 2KBNA 3U9SA 2MPMA 1SRUA 3FKIG 1MIUA 3J7AF 2QA4A 4G57A 2CVRA 4JC0A 3JAME 3J80E 2K1BA 4NXNL 5EBDA 3ERSX 2EPBA 2CCZA 3FVQA 3RN2A 4NMZA 3KLSX 1TS5A 2XVSA 2IT1A 4K0KL 3GTKH 4A3DB 4GS3A 1ASYA 4JI6L 2R93B 5IYBG 1WCMB 5FJ8G 1DM0B 1K28A 2YYZA 3GD7A 4A93H 4DR6Q 5KIXA 3MHBA 4GKKQ 1PRTD 3BZCA 1MJEA 5AJ3Q 2HCIA 1N33L 1CKMA 1WTOA 1E2ZA 3AEVA 4Q0FA 1IL2A 1YNNC 3GTMH 3T51B 3R2IA 1GVPA 5E4XA 1YHAA 1BO0A 4H44C 3UDGA 3NE5B 3TP7A 3HGBA 2KENA 3BVGA 2N49A 4A3BB 3A55A 2NZ1D 1BQQT 3BG3A 1EQQA 4GLAC 3S2DB 1HZAA 2E2HB 2PI2A 1IYUA 3A8KE 2E76C 1UUPA 1GUTA 2F03A 5LHY1 4NDXA 3D6WA 5F2DA 5CR3A 3PSIA 1A3TA 3TP5A 1RTNA 5I4DA 1PXUA 4DNTB 5J39A 1YZ6A 5IWAL 1VQHA 4KV6A 4X64L 4Q5VA 2K5QA 1Q81C 2A19A 1LTSD 1E2WA 2RHSB 4JYAL 4TKOB 3J81L 3CF5A 2SNMA 4DR2Q 3UE0A 3EFXD 2A6HD 3H0GG 2LY7A 2VQFL 5FLXL 3RZOB 1SJHD 2XRSD 3TSSA 4FF4A 1II3A 3IL8A 2K5NA 4A3FB 3K8AA 2PCFB 3I7FA 2Z1CA 5C3EH 4OIJA 2N8NA 1NCVA 3NELA 1TWCH 2NTSA 5C4JB 4JPBW 1X3FA 1V1PB 2F0OA 4P73A 3H09A 1SR3A 1E1OA 1FYCA 1N8RC 3ONAB 2Y0SE 2R7ZB 5M5WB 2B2UA 1PV4A 3SK5A 5IIFA 4J8QA 3MEHA 4KN4C 2A69D 2NN6I 3Q0AA 5JJIA 2QEJC 2NVTB 3HOWG 2RDFA 3MTSA 2BA0A 2F0WA 1LT6D 3DWQA 3KF8A 3HOYB 2B2UC 1UWVA 4JI0L 2EYOA 3CCSA 2E5LQ 1WVLA 1I4PA 1H95A 1YVCA 1NAPA 3I4NB 4IFDJ 1STGA 1KRSA 4LFCQ 1B7YB 5DNFA 3F2DA 4DR7Q 5K36G 5IE8A 4QUCA 3D31A 1WTHA 4YCUA 3U58A 1VQKA 3SR1A 3IFTA 2F0SA 5I9PA 5CBEE 4FYDA 4R1JA 4TSSA 2LMCB 1LM0A 4IJHA 1PFNA 2CKZB 4X66Q 3I90A 1H9RA 2ALYB 4CKEA 3CCJA 1HQMC 2DUDA 3GTKB 2NN6G 1WTWA 2TSSA 4IJLA 3NP8A 2GA4B 2KEDA
chains in the Genus database with same CATH topology
1JC7A 5C6AA 3KLSA 2K03A 4QB4A 2EJFC 3RLFA 4A93B 3E5SA 1STAA 1RF2D 4HR7B 2K04A 2O4XA 4X3SA 2VNUD 4OIKA 3GTMB 1SYGA 3EVQA 4HCEA 1KAAA 2EY2A 2MGSA 2OXPA 1QNUA 3TN2A 2TMPA 2KVMA 5JAVA 5G3LF 2RDGA 3MFGA 4FNFA 1QWYA 2EYFA 2CW0D 1EY7A 1G91A 3KBGA 1IW7C 2RDHA 5D14A 1FD7D 5IGGA 1VDZA 5C4HA 2MUYA 1WTQA 1PTOH 2KA7A 4XT3B 2SNSA 3EROA 4OHJA 3X3NA 1HA5A 3K58A 3E6ZX 3X3MA 2PMZB 4HSPA 4IQZA 3SK4A 2B2VA 4FXDA 5C3EB 2PZTA 4R9WA 2QKIC 1A3UA 1TWCB 2KEEA 2R92B 4KY5A 2PZUA 1BUVT 4XQJA 2B2VC 2C5CA 1GXDC 4RCOA 4S3SA 4K6LA 1XX8A 1HTLD 1NR4A 1EFID 5E1FA 1QE6A 3MXGA 4U673 3PUZA 2WV6D 4LMQD 4HTHA 3Q24A 3P75A 5I2XA 4BA1I 1CA5A 4X3UA 3GTPB 2BDNA 3K59A 1MGSA 3E0JA 1ENFA 4F8MA 2PO4A 1CI3M 5A2QL 3BDCA 1F2MA 2EYLA 3C2PA 2RBMA 1GUOA 1HA6A 5JEAJ 4CKBA 1LLRD 1SYEA 4MHEA 4R8NA 2BE5D 5FK9C 1CT1D 5TSSA 2OEOA 1S5FD 2D5DA 2E2DC 4I65A 3HZXA 2E2JB 4Z9CB 1Y8OB 1RHPA 5CV9A 3O13A 2IW3A 3M7NA 1V8QA 1U4PA 4HCSA 1V1OA 1TWAB 3LWEA 1EIGA 3I3CA 1EL0A 4KHVA 1CFMA 2KECA 1DOKA 2VB3X 1OO9B 3GTLB 3OHXC 4MN3A 1SYDA 1R4QB 2L11A 1ONLA 1DZ1A 2A5HA 1PRTF 4XDXA 5DAUA 1QJOA 4N9PA 2ZXRA 1OXSC 2PYKA 4RA8A 2IWHA 4DXFA 5CC4A 1ICWA 1PTOB 2L55A 1B50A 4EQPA 3D4WA 4FXGC 3FRPB 2NVYB 1E0BA 2SDFA 3FKIB 1SXTA 2AQ2B 1ZYRC 1B4OA 3T53B 3VR6A 4ILWA 2DNEA 4XQNA 4IUTA 2F0HA 4C3HB 1I50B 2PPBC 4XIGS 4F88A 3MZ5A 3BYTB 4DNRB 5NUCA 2WP8J 1WTPA 4PMCA 2EJGC 4CBVA 1QCBD 1HUMA 3GV3A 4LK1C 1SE4A 2R3ZA 3NPPA 5EQ0A 5IT9L 2K5DA 1I4QA 2KJXA 1EZ6A 1VMCA 2RSOA 5C4ZA 2FHTA 4BA2I 2HDLA 1ZEQX 3VYSA 1RDPD 1KABA 4ZYSA 5ISRA 4RAUC 1Y1VB 2XWBB 1B9NA 4IUNA 5CGKA 2JYOA 1YNJD 5M5XB 3D6CA 3NK9A 1STYA 2IJ0A 1O7YA 4KN7C 2BOSA 4KMUC 3T4AC 1B9MA 3BZDB 4XTCS 2K05A 2ICEC 1ILPA 1KDCA 3S16B 3S1NB 2IL8A 4Y7NB 3NUCA 2VXWA 4QCLA 1LT3D 2N55A 3NBIA 1B3AA 2LFNA 3MFYA 4RGMA 4ZKCB 2XIWA 1AZPA 4FF2A 2JEAI 1S5CD 4CGYB 1I4RA 5E4WC 1GHKA 1CQFA 2F0QA 1O78A 4C3IG 3M4OB 1I4XA 1G2TA 1JOKA 4NW2A 5E3FA 2YU9B 2EVBA 2A6HC 3HOWB 1MD2D 2PNRC 3ND8A 2D2CC 3M85A 2HCCA 2A68D 1JE4A 2OF1A 3QOLA 4G7HC 2HUGA 4DAYA 1HUNA 3D4DA 3DWAA 2KQ3A 1SMYC 4DU9A 4PNYA 2QILA 2F1MA 1HRJA 1LT5D 1SBBB 1PFBA 1F2YA 1ESFA 3K6OA 3QJYA 1ET6A 1EY5A 2Q8IB 5KRUA 2JA5B 2OT2A 2A69C 1CHQD 1Y69U 1DCZA 3A7AB 4IZ8A 5LL6S 4ZRZA 3QIAA 1F9SA 2F3WA 3GP7A 1EYDA 1EWHA 3R3OA 2L9HA 4C3HG 3Q23A 1LTAD 3HP3A 3VA5A 1FNVA 4K8IA 1C48A 1DOLA 4WFN3 1EQVA 1EY8A 4EVOA 3MAQA 4BS9A 3LNNA 1I6VC 3M3YB 1TS3A 4C1NI 1WTXA 1GJXA 5BN4A 1GUSA 3EJIA 3HOUB 5CV6A 3VYRA 3I8ZA 2K01A 1BCPC 3MA2B 1C8CA 1PDQA 1D1IA 4A3IB 3PIP3 4NKLA 3K5MA 2B39A 2EZVA 1SNMA 1CQVA 4MIUA 3I70A 1H9SA 1ENAA 3JAML 4C1NK 3C3LA 3J80L 1VCIA 5LL6X 3A7LA 1TVXA 4IUQA 4K8JA 5EBCA 1PFMA 2J7ZA 2PZWA 1AW7A 3M4YA 5COYA 3A54A 2EYJA 1GHJA 2M9VA 2Z8LA 3NBHA 5BN5A 3LX0A 4EGVA 1TIID 4FF1A 3PO3B 2A6ED 2Z4IA 4KJOA 1AEXA 3SE0A 4CHTB 1K8OA 5EPKA 2F0UA 2IX1A 5FOBB 1EOTA 4E6IA 4OGQC 5I6YA 1G2SA 4C2MB 3N6RA 2O2LD 2O5IC 1WD0A 2O5JC 3L9AX 2F0PA 2Y0SB 4HSVA 2F4IA 4N9TA 1DYQA 1RJTA 1HPCA 1RODA 3GTOB 2V4DA 5C0XH 3F2UA 3W2DA 3K5OA 4ZKBB 5IGCA 3W3AA 3HOZB 2R6GA 1DD2A 2CQAA 1Y8PB 3R8BA 3IFDA 2N88A 1Q1BA 3K5NA 3BVMA 3V05A 3Q6SA 3VR5A 1LV9A 3LWUA 4BY1B 2K5WA 1KDBA 3DUZA 1R4PB 2RVLA 3A8IE 3BS1A 2SEBD 4EQOA 4HMJA 3HS0C 5CV5A 1PZID 1UAPA 5KYIA 5EKLA 3OPOA 2H4OA 5C44B 3ND9A 4PQXA 3FDTA 2NWGA 1C4QA 2ENBA 2X6GA 1U4RA 2G9DA 3PO2B 2BCOA 4O42A 4OO1G 5HURA 3DEPA 5KNDA 2B63B 1PZKD 3HRZC 1B1ZA 3BDOA 4P2CB 1TQOA 2MHVA 4UDUC 1NSNS 1ILQA 2KHSA 3HOVB 2D9UA 5FKAC 1TS2A 3FPPA 1A6XA 3CRKC 1SFOB 5EGTA 3NWTA 4HAEA 1TR5A 4U68A 1FNWA 1O7LA 5EKKA 1HFGA 1S5ED 3S1RB 4KY7A 3I73A 5A2QE 1TY0A 1Q12A 3S2HB 4RGTA 1WD1A 3PUWA 1D5XC 1DJRD 4V0BA 2AWOA 1O7ZA 2LKVA 4IUVA 4ULLA 4CJ2C 4HN7A 2F0LA 1NUCA 1ET9A 2AUKA 3VA7A 4ID6A 1AZQA 1HFNA 1K83B 5CMDA 1TT2A 2G9HD 4LJZC 1JCKB 4TQUS 1F2ZA 3I72A 2FFKB 4FF3A 5AFWA 1Q3LA 1TWHB 3WDNA 2EYMA 1YNJC 1ML0D 1Z7TA 3SHLA 5I6WA 4DK1A 3PIO3 1DONA 2I46A 4K2KA 4G4KA 4C3IB 1HQRD 2PW7A 4IFDG 1S5BD 3TP6A 5J22A 4A3JB 3DEOA 3QG1A 5IGBA 2XNAC 1JWMD 1JB3A 1HCZA 1LTRD 1MSHA 1TKWB 3CHBD 3VR4A 2NUCA 3DHQA 2X6LA 1T5EA 2NB0A 3CQZB 4DK0A 4JBWA 3VYTA 1QG7A 5DEHA 5K5PA 2RA4A 1IKMA 5DM73 2F0DA 1E2VA 4DFAA 1FR3A 2NYZD 4DXGA 4G7OC 2C9OA 1AFPA 1EZ8A 1TY2A 4K6DA 1R9TB 2F0EA 1TS4A 5JJZA 3BYYB 4WJWA 3A8JE 2L5TA 3P20A 3T16A 3VR3A 5M3FB 1I6HB 1W6JA 2F0GA 2ICIA 2NTTA 4JK1C 2B2WA 3EA6A 3HEJA 4A3KB 1STHA 4KJNA 3OIPA 1H9MA 2FJ2A 1U9RA 2WINB 3C1FA 5I2YA 5CBAE 3I4MB 5D65A 1SE3A 1GOZA 4L63B 4DA2A 2B2WC 1SEBD 4IURA 4IUUA 3QOJA 2I07B 2WIIB 3MXNA 4DAVA 3C46A 5EPLA 4RCNA 3M7GA 4O1NA 4RHRA 1J8IA 1EQTA 3UI2A 3MXPA 3TZDA 3VYUA 1SE2A 2WKDA 4KD3A 5JPMC 2F0IA 5M3MB 1ZKOA 2EDGA 3TMEA 2ZXOA 4OO1H 3GV6A 1PRTC 5C0XG 2VUMB 1H9KA 3U9OA 2IX0A 3S17B 2RSNA 4CJ1B 4PMWA 4ME5A 1CHPD 3RUZA 4FO2A 3VR2A 2NVXB 5DM63 2KCCA 1PTOD 1F9RA 5C3XA 1F9QA 1KLGD 1X32A 1GUGA 1K8MA 4A3GB 3IAYA 1VMPA 5JVH3 2WACA 1KDAA 2X69A 2J4XA 2Q8TA 5C4XB 3NTIA 4AYBB 1Q1EA 2RQXA 4RKLA 1IL8A 1TWGB 2M2LA 3TDQA 2FMCA 1PMRA 3J7YW 4QMGA 3PV0A 2E75C 3PUXA 4KY6A 4A3MB 1LO5D 2K33A 4KTAA 1JR0D 3TZUA 5CV4A 1HHVA 3S9WA 4QUFA 4KD4A 2PQEA 2A74C 1BDOA 2VB2X 2IPKD 1IKLA 3K7AB 1Y1WB 1ZXTA 3K0YA 1EU3A 1QOHA 3SEBA 3TP8A 1EYAA 1U4MA 1L0YB 3SK8A 4CJ0B 5KGUA 3V96A 1JWUD 3A56A 1VF5C 4IFDH 2F0VA 1BR9A 2DN8A 3OW7A 4LAAA 3S14B 1A2TA 3NWSA 4TRDA 5IGDA 2B8FA 1TU2B 3AU7A 1EY6A 3OMGA 3CRLC 2BA1A 3J81E 3KLRA 5FLXE 3KK7A 5T1GA 1IYVA 2F0NA 4B9XA 1DOMA 1D5ZC 3DM1A 1SYFA 4RGNA 2XWJB 1SNCA 1V1PA 5EJWA 1PYWD 2EY5A 4YIJA 3PUYA 3PMFA 2QF7A 5CORA 1I3QB 4K14A 5JPNC 2DY8A 2DNCA 3CKIB 1CZWA 3D8GA 1BCPB 2AQ1B 5A35A 2CW0C 1CA6A 4M8AA 1GUNA 3OMCA 5M9OA 1KTKA 1LACA 2K6AA 1RKNA 3I4LA 4RH6A 1CTMA 3MWYW 2LS01 4KK7A 2FMMA 3R2TA 1EEID 1A15A 1ENCA 3RMHA 2E74C 1H9SB 1SMYD 1RD9D 2AWNA 4ZQ3A 3P1HA 3G6JB 1OXVA 1V43A 3NXWA 5J1ZA 5HGTA 2IX3A 1X3PA 2L1BA 1EY0A 5IODA 1CZGA 3KUPA 1S5DD 5EKIA 3MVVA 2XN9C 2KUMA 2L12A 1MSGA 1KNEA 4XXEA 2XSCA 3SXHA 4WRDA 4EQNA 3RD4A 3H91A 3QO2A 1B53A 4M1UB 3HOXB 2A73B 2B2TA 3ITPA 3FEWX 4IALA 5IOCA 4WORA 4DN4M 2WAQB 3G7LA 3NQIA 4ZAIA 3NTHA 4OO1I 2B2TC 3WOFA 4C56C 2JA7B 3H6MA 2JSOA 5JVG3 4BY7B 1S4ZA 3GTQB 1A2UA 1CM9A 1YNND 3ERQA 5KYLA 3AMUA 1SJED 1U4LA 3S1QB 4FP5D 1B44D 4DF7A 4V190 2MP1A 2SOBA 4PMBA 2BE5C 1G6ZA 1BCPD 2EYHA 1D2BA 5C3WA 2HQEA 3DWPA 1BBXC 5JEAH 1G291 5D3DA 2CHBD 5CV7A 2Q8RE 1QNKA 4F87A 5FO8B 1CK1A 2EYPA 1I4HA 1RCVD 1QB5D 3N52A 4A3EB 3OWEB 1AN8A 2D62A 3DMUA 4CKCA 3SDZA 5ELFA 3ZYYX 1LTID 2F0MA 1Q90A 4RWSC 1F9PA 5ELCA 4BBRB 2RKSA 4L6TB 1L0XB 1EY9A 4XYQA 3P7JA 5ELEA 4RGOS 1UEAB 1VF7A 1DXMA 2DY7A 2F0JA 3R93A 1H9JA 2ID0A 1PZJD 4G7ZC 2JE6I 1SNDA 3OOCA 1RTOA 2J0TD 4RKBA 4QIWB 4XYOA 4KKSA 5FO7B 4ZUJA 1M4VA 2F0FA 1J9OA 1GUWA 1SNOA 1B2TA 1PTOF 5C0XJ 3PUVA 4BBSB 2AUJD 3GQBA 3Q22A 5T1IA 3HKZB 4IFDI 1KLUD 4QF4A 3J7AV 1O80A 3T13A 1BNZA 1WTVA 1SAPA 5D3IB 1D1KA 3BDLA 3OSOA 5C5MA 2JA8B 4K2LA 1HTPA 2FINB 3GTGB 3GO5A 3RZDB 4ZK9B 5CV8A 4J6HA 1SYCA 5KNBA 3BVZA 4KHZA 5EPJA 1UNSA 1W6KA 3D4RA 3K57A 4BWGB 5I9OA 4C3JB 4B08A 5JOBA 1FGBD 4IUPA 5M5YB 1LTGD 3NSWA 1Q8IA 2JP1A 2E2IB 1OXXK 2F0KA 4H7BA 2K32A 2B2YA 4H13C 1BOSA 2MJ8A 4F7XA 1LTTD 2HDMA 4RHSA 4L8JA 2QCPX 1T5XD 3KBXA 3FMCA 5ELDA 4KI0A 1D5MC 4X3TA 2B2YC 1OXUA 1SDFA 1EWCA 1PTOC 1IW7D 1PLFA 1XWEA 2EY6A 1WTRA 5IGEA 4UAIA 3NHHA 4FVMA 4IN3A 2K7VA 5IT9E 3V2TA 4HMIA 4K5XA 2H1EA 1JWSD 3QB3A 4XT1B 2JEBI 5C5LA 2A68C 1LTBD 1BXTA 3I91A 3AB9A 2EXZA 1I4GA 2M00A 5K36H 1EY4A 1SYBA 1LT4D 2F0TA 4B9WA 2NBFA 3CU7A 5FO9B 5C0XI 2EOTA 4R8IA 1BF4A 2ZT9C 2B8GA 1EU4A 3OIQA 1F2LA 1LABA 1HXYD 5IGFA 2R61A 4J1MA 2NN6H 3DXJC 1SNQA 3H94A 5KNCA 4OL7A 3URYA 2L4NA 3EQLC 5G3LD 1X3QA 1IHZA 5BN3A 3D3RA 3WOEA 2F3VA 3C1EA 1QILA 1XXGA 1G8ZD 1STEA 1AP0A 5CYUA 1F77A 1JOOA 2XRQD 2NVQB 1D6EC 4I7ZC 2EE1A 1SSOA 5KEEA 1JOQA 3FPUB 1SNPA 2KOLA 3QWNA 4ABNA 4ZUIA 2EJMA 2ZXPA 1EYCA 4DGZA 1STNA 5ELBA 4ZLTF 4NP5A 3OWFA 1OXTA 4RFBA 3H0GB 1Z6HA 2Z4HA 4C3JG 3SVMA 1PRTB 2KCNA 1EEFD 1JORA 1ESRA 2EY1A 4PV1C 3S1MB 2PW5A 3T56B 1Y8NB 3SK6A 5JEAG 1JQYD 2K28A 1STBA 1M8AA 1NR2A 4HEDA 4X3KA 1MI2A 3L7ZC 2A6EC 4K5VA 4XQQA 3H3VC 1TWFB 4FXKC 1A3VA 4KKTA 4DAPA 1MBYA 1ZYRD 2L0CA 2WKCA 1BCPF 4GZYC 4ODGA 2BDOA 3NTKA 3NQTA 3MXUA 3MC0B 4KKUA 2JXMB 2WB1B 1XYIA 3GTJB 4K5WA 2JA6B 3IKJA 2QDBA 1JICA 3TBIB 3S15B 3K5LA 2AQ3B 1FNUA 1KNAA 3L3OC 1Z47A 4H0LC 1XTCD 3HG9A 1EIHA 3U9SA 2MPMA 3J7AF 4G57A 2CVRA 3JAME 3J80E 2K1BA 5EBDA 2EPBA 3FVQA 4NMZA 3KLSX 1TS5A 2XVSA 2IT1A 4A3DB 2R93B 1WCMB 1DM0B 2YYZA 3GD7A 5KIXA 3MHBA 1PRTD 2HCIA 1WTOA 1E2ZA 4Q0FA 1YNNC 3T51B 3R2IA 5E4XA 1BO0A 4H44C 3NE5B 3TP7A 3HGBA 3BVGA 4A3BB 3A55A 2NZ1D 1BQQT 3BG3A 3S2DB 2E2HB 1IYUA 3A8KE 2E76C 1UUPA 1GUTA 2F03A 5LHY1 4NDXA 3D6WA 5F2DA 5CR3A 1A3TA 3TP5A 1RTNA 5I4DA 1PXUA 4DNTB 5J39A 4KV6A 4Q5VA 2K5QA 1LTSD 1E2WA 4TKOB 3J81L 2SNMA 3EFXD 2A6HD 2LY7A 5FLXL 3RZOB 1SJHD 2XRSD 3TSSA 4FF4A 1II3A 3IL8A 4A3FB 2PCFB 2Z1CA 4OIJA 1NCVA 2NTSA 5C4JB 1V1PB 2F0OA 3H09A 1FYCA 3ONAB 2R7ZB 5M5WB 2B2UA 3SK5A 5IIFA 4J8QA 3MEHA 4KN4C 2A69D 2NN6I 3Q0AA 2QEJC 2NVTB 2RDFA 3MTSA 2BA0A 2F0WA 1LT6D 3DWQA 3KF8A 3HOYB 2B2UC 2EYOA 1WVLA 1I4PA 1NAPA 3I4NB 4IFDJ 1STGA 5DNFA 5K36G 4QUCA 3D31A 3SR1A 3IFTA 2F0SA 5I9PA 5CBEE 4FYDA 4TSSA 2LMCB 1PFNA 3I90A 1H9RA 4CKEA 1HQMC 3GTKB 2NN6G 1WTWA 2TSSA 3NP8A 2GA4B 2KEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP5 A;  2NUC A;  4ODG A;  1SNQ A;  3DHQ A;  1ENC A;  3D4W A;  3EJI A;  5EGT A;  4EQP A;  5C6A A;  3DMU A;  3NQT A;  3U9O A;  5J39 A;  4QB4 A;  4KV6 A;  5IGC A;  2F0M A;  1TR5 A;  5CV6 A;  5I9O A;  4OL7 A;  4HTH A;  3E5S A;  3P75 A;  4ZQ3 A;  3SK8 A;  5KGU A;  2F0Q A;  5JOB A;  3P1H A;  1STA A;  1IHZ A;  2RKS A;  5EKK A;  3NXW A;  5J1Z A;  5DEH A;  2F0V A;  2O4X A;  2SNM A;  4KY7 A;  5HGT A;  1EY9 A;  4K5W A;  5K5P A;  2F0K A;  4H7B A;  2F0H A;  1JOK A;  4LAA A;  4ME5 A;  4NKL A;  2F3V A;  2F0D A;  3C1E A;  5E3F A;  1SYG A;  2QDB A;  1EY0 A;  3RUZ A;  3EVQ A;  5IOD A;  1A2T A;  4F7X A;  4TRD A;  1SNM A;  4DFA A;  3MZ5 A;  4MIU A;  2F0J A;  3MVV A;  5IGD A;  1KAA A;  4F8M A;  1II3 A;  1JOO A;  1EY6 A;  1ENA A;  3OMG A;  1EZ8 A;  2EY2 A;  2OXP A;  5NUC A;  4K6D A;  4PMC A;  3BDC A;  1F2M A;  2F0E A;  2EYL A;  1SND A;  3SXH A;  4WRD A;  4EQN A;  2RBM A;  2LKV A;  5JAV A;  2OF1 A;  5C3X A;  5KEE A;  3QOL A;  1JOQ A;  1SYE A;  3T16 A;  2F0O A;  4K8J A;  3ITP A;  4R8N A;  4G57 A;  1SNP A;  3D4D A;  2PZW A;  1EZ6 A;  2F0L A;  2KQ3 A;  4RKB A;  2EYF A;  1NUC A;  2WAC A;  4DU9 A;  4ZUI A;  1KDA A;  1EY7 A;  2F0G A;  4PNY A;  4IAL A;  1KDB A;  2F0N A;  5C4Z A;  5IOC A;  3SK5 A;  2EYJ A;  5IIF A;  3MEH A;  4WOR A;  3HEJ A;  2EY6 A;  4B9X A;  1EYC A;  4NMZ A;  2OEO A;  4ID6 A;  1F2Y A;  1STH A;  4I65 A;  3LX0 A;  4ZUJ A;  5IGE A;  3HZX A;  1TT2 A;  4KJN A;  2F0F A;  1SYF A;  3NHH A;  5IGG A;  1SNO A;  4DGZ A;  4EQO A;  1KAB A;  5C4H A;  1U9R A;  1STN A;  4HMJ A;  1SNC A;  3C1F A;  5CV5 A;  1EY5 A;  2RDF A;  4KJO A;  4NP5 A;  3OWF A;  4RKL A;  2F0W A;  5CV9 A;  5KRU A;  5ISR A;  3V2T A;  5KYI A;  3H6M A;  5EKL A;  2EY5 A;  1F2Z A;  2SNS A;  4HMI A;  4YIJ A;  1AEX A;  3PMF A;  4K5X A;  3ERO A;  4IZ8 A;  2EYO A;  4IUN A;  5CGK A;  3QB3 A;  2F0U A;  1A2U A;  4K14 A;  5KIX A;  5C5L A;  2F3W A;  3ERQ A;  3MHB A;  4QMG A;  2ENB A;  3QOJ A;  5KYL A;  1STG A;  1EYD A;  3D6C A;  3NK9 A;  4KHV A;  4QF4 A;  3R3O A;  3SK4 A;  1STY A;  4KY6 A;  4DF7 A;  2EYM A;  2EXZ A;  4E6I A;  3T13 A;  1JOR A;  2EY1 A;  2PZT A;  3D8G A;  5HUR A;  2SOB A;  4PMB A;  3MXP A;  2M00 A;  2PW5 A;  3SHL A;  5I6Y A;  5I6W A;  3BDL A;  1EY4 A;  1A3U A;  3OSO A;  5C5M A;  2EYH A;  1SYB A;  3OMC A;  5M9O A;  3VA5 A;  5C3W A;  3SK6 A;  4KY5 A;  2F0T A;  2HQE A;  2PZU A;  4K2K A;  4KTA A;  3SR1 A;  4B9W A;  1KDC A;  4K2L A;  4K8I A;  4KD3 A;  1TQO A;  5CV4 A;  3S9W A;  5CV7 A;  4KD4 A;  2F0S A;  2PQE A;  5I9P A;  2PW7 A;  3TP7 A;  1STB A;  1SYD A;  1NSN S;  1EQV A;  1EY8 A;  1RKN A;  3TP6 A;  4EVO A;  5J22 A;  2KHS A;  3NUC A;  2F0P A;  2EYP A;  2F0I A;  5CV8 A;  4J6H A;  4S3S A;  5DAU A;  4K5V A;  5IGF A;  4NDX A;  5IGB A;  1SYC A;  4N9P A;  1A3V A;  4J1M A;  4N9T A;  2PYK A;  5F2D A;  5CR3 A;  3NP8 A;  3TME A;  5E1F A;  3TP8 A;  1A3T A;  5CC4 A;  1EYA A; 
#chains in the Genus database with same CATH topology
 1JC7 A;  1VQI A;  5C6A A;  3KLS A;  2K03 A;  4QB4 A;  1KHI A;  2EJF C;  3RLF A;  3F2B A;  3RLN A;  4A93 B;  2E2J H;  3E5S A;  4A3D G;  2R93 G;  1STA A;  1RF2 D;  4HR7 B;  2K04 A;  2O4X A;  4X3S A;  1U5K A;  2VNU D;  4OIK A;  3GTM B;  2VQE Q;  1SYG A;  4A3J H;  2A8V A;  1TWA H;  3EVQ A;  4A4I A;  4HCE A;  3K81 C;  3T1Y Q;  1KAA A;  2EY2 A;  2MGS A;  2OXP A;  2UUB Q;  1X55 A;  1QNU A;  3TN2 A;  3KFU A;  2TMP A;  2AMC B;  4NXM Q;  2KVM A;  5JAV A;  5G3L F;  4LFA L;  2RDG A;  3HOU G;  3MFG A;  4FNF A;  2F4V L;  2CWA A;  4HIM A;  1QWY A;  2EYF A;  1UE7 A;  2CW0 D;  1OTC A;  4A3B G;  1EY7 A;  1G91 A;  3KBG A;  1JT8 A;  2UXB Q;  1IW7 C;  2RDH A;  5D14 A;  4DKA C;  1FD7 D;  5IGG A;  1VDZ A;  5C4H A;  2MUY A;  2R7F A;  1WTQ A;  1PTO H;  5E7N A;  3RN5 A;  2KA7 A;  4XT3 B;  2SNS A;  2GVB A;  4L5Q A;  3ERO A;  1X56 A;  4OHJ A;  3X3N A;  1HA5 A;  4JVZ A;  4PG3 A;  3U50 C;  3K58 A;  1BBW A;  3E6Z X;  3X3M A;  2CH4 A;  1WFQ A;  2PMZ B;  4HSP A;  4IQZ A;  2UUA Q;  4YWK A;  5M3F H;  3SK4 A;  2B2V A;  4FXD A;  5C3E B;  2PZT A;  2LXJ A;  4C3H H;  4JI3 Q;  1I50 H;  4R9W A;  2QKI C;  1A3U A;  1TWC B;  2KEE A;  4A3F G;  2R92 B;  4KY5 A;  2I5L X;  2PZU A;  3CCL A;  4DV2 Q;  4DV6 L;  1BUV T;  5IYB H;  4XQJ A;  3ULJ A;  2B2V C;  2C5C A;  5IP9 H;  1GXD C;  4RCO A;  2GN5 A;  4S3S A;  3I4O A;  1SMX A;  2MFI A;  4K6L A;  1XX8 A;  2R7Z G;  1HTL D;  5EAY A;  4A3L H;  1NR4 A;  2OTJ A;  1EFI D;  5E1F A;  1QE6 A;  5BR8 Q;  3OYY A;  3MXG A;  4U67 3;  1RL2 A;  3LGJ A;  3FHW A;  2WV6 D;  1U0L A;  3PUZ A;  4LMQ D;  3STB C;  1UE6 A;  1IBK L;  4HTH A;  3Q24 A;  3P75 A;  4NXN Q;  1BVS A;  2A1A A;  4OX9 Q;  5I2X A;  4BA1 I;  1CA5 A;  1E7Z A;  4X3U A;  3GTP B;  2BDN A;  3K59 A;  1MGS A;  1Y1V H;  3E0J A;  3HOY G;  5HY6 A;  1VQ6 A;  4DNI A;  1ENF A;  2Y0S G;  1CKN B;  2OQ0 A;  3I4N G;  4HJA A;  5M5X H;  4F8M A;  2V1C C;  2PO4 A;  1CI3 M;  2CQO A;  5A2Q L;  3BDC A;  1F2M A;  2EYL A;  3C2P A;  1FJG L;  2RBM A;  1GUO A;  3NEN A;  2ASB A;  1HA6 A;  2VUM H;  2UXC Q;  5JEA J;  4CKB A;  1LYL A;  1LLR D;  1SYE A;  4MHE A;  4R8N A;  3HOZ G;  3S16 H;  4DK6 C;  2BE5 D;  5FK9 C;  3S1N H;  1CT1 D;  4Y7N H;  5TSS A;  1AE2 A;  2OEO A;  1S5F D;  2D5D A;  2E2D C;  4I65 A;  3HZX A;  4HJ7 A;  2E2J B;  4Z9C B;  1Y8O B;  2Z6K A;  1RHP A;  2B3G A;  2EXD A;  1VQG A;  5CV9 A;  3O13 A;  2IW3 A;  1HNX L;  3TS2 A;  3UDF A;  3M7N A;  1V8Q A;  1U4P A;  4HCS A;  1V1O A;  1K8A C;  1TWA B;  4P75 A;  3LWE A;  2MNA A;  1EIG A;  3I3C A;  1EL0 A;  4DUY Q;  1HR0 Q;  3M4O H;  4KHV A;  1YI2 A;  1CFM A;  5JJL A;  1QVG A;  2Z6K C;  2KEC A;  2Q2H A;  1DOK A;  2VB3 X;  2YU9 H;  3OW2 A;  1OO9 B;  3GTL B;  3OHX C;  4HJ5 A;  1KXL A;  2MO1 A;  4DR3 Q;  4MN3 A;  1KRT A;  1SYD A;  1R4Q B;  2L11 A;  2R7D A;  1ONL A;  1DZ1 A;  2A5H A;  1PRT F;  4XDX A;  5DAU A;  3RNU A;  1QJO A;  4LF6 L;  4N9P A;  2ZXR A;  1OXS C;  2PYK A;  4RA8 A;  2DGY A;  2IWH A;  3JAM c;  3KF6 A;  4DXF A;  5CC4 A;  1HJP A;  1ICW A;  4MTN A;  1PTO B;  3D0F A;  2L55 A;  4JG2 A;  3PIP A;  1B50 A;  4EQP A;  3D4W A;  4FXG C;  3FRP B;  3CD6 A;  4DV3 L;  2NVY B;  1E0B A;  2SDF A;  3F1Z A;  3FKI B;  4KHP L;  1SXT A;  2AQ2 B;  1ZYR C;  4GNX A;  1B4O A;  1K3B C;  3T53 B;  3VR6 A;  4MZ9 A;  4ILW A;  2DNE A;  3H3V H;  2JA5 H;  4XQN A;  4IUT A;  2F0H A;  5FLX c;  4C3H B;  1I50 B;  2PPB C;  4XIG S;  2HQL A;  1J6Q A;  4F88 A;  3MZ5 A;  1SLJ A;  4JI4 Q;  3K7A H;  3BYT B;  2DJG C;  4DNR B;  1A0I A;  2RCF A;  4GNX C;  5NUC A;  2WP8 J;  5C3E G;  4PMC A;  1WTP A;  4WJ3 M;  3W5O A;  2EJG C;  5LMN L;  3E0E A;  4CBV A;  1QCB D;  1HUM A;  1NNX A;  3GV3 A;  4LK1 C;  1SE4 A;  2R3Z A;  3NPP A;  1EQR A;  3FP9 A;  5EQ0 A;  5IT9 L;  4R4T A;  2K5D A;  1I4Q A;  1XNR L;  2KJX A;  1EZ6 A;  2VS1 A;  2ZM6 Q;  1VMC A;  1PH2 A;  2RSO A;  4X65 Q;  5C4Z A;  2Q2T A;  3I2Z A;  3M3Y H;  3S14 H;  2FHT A;  1EFW A;  2HDL A;  1XPR A;  4BA2 I;  1ZEQ X;  3VYS A;  1EIF A;  1RDP D;  1KAB A;  3E9I A;  5LMU L;  4ZYS A;  5ISR A;  1K3R A;  1VQ8 A;  4RAU C;  1Y1V B;  4YWM A;  2XWB B;  1V1Q A;  3HOU H;  4IPD A;  1B9N A;  4IUN A;  1MHW C;  5CGK A;  2JYO A;  1YNJ D;  4DV5 Q;  5M5X B;  4OWW B;  3D6C A;  4GOP A;  3NK9 A;  1STY A;  2IJ0 A;  1T9H A;  1O7Y A;  4A3I H;  4KN7 C;  2BOS A;  4KMU C;  3T4A C;  1B9M A;  3BZD B;  4XTC S;  2K05 A;  2ICE C;  1ILP A;  2EQS A;  1KDC A;  3S16 B;  2QDL A;  4O0A A;  1B8A A;  3HFZ B;  4GOP C;  3S1N B;  2D0O A;  2IL8 A;  1L0W A;  4Y7N B;  3NUC A;  2VXW A;  4QCL A;  1LT3 D;  1IXR A;  2DJF C;  2N55 A;  3PF4 A;  3NBI A;  4CDC C;  1B3A A;  4AYB E;  4L5R C;  2LFN A;  4JBM A;  3MFY A;  4RGM A;  4ZKC B;  2XIW A;  1AZP A;  4FF2 A;  2JEA I;  1V9P A;  1S5C D;  4CGY B;  1I4R A;  5E4W C;  4ZCK A;  1GHK A;  4JI2 Q;  1CQF A;  1QUQ B;  2F0Q A;  1O78 A;  2QGQ A;  3PO3 H;  2ZTC A;  4C3I G;  3M4O B;  1I4X A;  1K8G A;  2OCE A;  4J15 A;  1G2T A;  1JOK A;  4NW2 A;  5E3F A;  4A3J G;  2YU9 B;  2JN4 A;  2EVB A;  3CPW A;  4HJ8 A;  4DR4 L;  2A6H C;  3HOW B;  3KDF B;  1MD2 D;  2PNR C;  3BZK A;  3ND8 A;  4JCV E;  2D2C C;  3M85 A;  2HCC A;  2A68 D;  2YTV A;  1WI5 A;  5IYD H;  1JE4 A;  2OF1 A;  3QOL A;  4G7H C;  2HUG A;  4DAY A;  1HUN A;  3VDY A;  3D4D A;  3DWA A;  1QVF A;  2KQ3 A;  1SMY C;  1NBW A;  4JI8 L;  4DU9 A;  4QGU A;  3CCE A;  1E22 A;  4PNY A;  2QIL A;  2F1M A;  4IPG A;  1HRJ A;  1LT5 D;  1SBB B;  1PFB A;  4HJ9 A;  1VQC A;  5FLM H;  1F2Y A;  1ESF A;  3K6O A;  1KAW A;  5GRO A;  3QJY A;  1ET6 A;  2IHE A;  4GLV B;  1HNZ L;  3GTO H;  2RF4 A;  1EY5 A;  2Q8I B;  4B3T L;  5KRU A;  2JA5 B;  2OT2 A;  1LTL A;  1PH6 A;  2I5H A;  2A69 C;  4OEM B;  1CHQ D;  1Y69 U;  1DCZ A;  3A7A B;  4IZ8 A;  5LL6 S;  4ZRZ A;  4JI1 L;  4DUZ Q;  3HOZ H;  3QIA A;  3KJP A;  1F9S A;  2F3W A;  3GP7 A;  1EYD A;  4EX5 A;  1UEB A;  1EWH A;  5M3F G;  3R3O A;  2L9H A;  4C3H G;  4I7A A;  3Q23 A;  1LTA D;  4JI5 Q;  3F2C A;  4A3K G;  3HP3 A;  3VA5 A;  1FNV A;  2ZJR A;  4K8I A;  1N9W A;  1C48 A;  1DOL A;  4IPC A;  4WFN 3;  1EQV A;  1EY8 A;  4EVO A;  3L2P A;  4LF9 Q;  3MAQ A;  5IP9 G;  1IBM L;  4BS9 A;  3LNN A;  1I6V C;  3U4Z A;  3M3Y B;  3HKS A;  4RMF A;  3GTQ H;  1TS3 A;  4RG1 A;  4A3L G;  3J81 i;  4C1N I;  4BY1 H;  1HZB A;  1WTX A;  1N34 L;  3CW2 C;  1GJX A;  5BN4 A;  1GUS A;  3EJI A;  3HOU B;  1A8V A;  4LFB L;  5CV6 A;  1XMO L;  3VYR A;  1CKO A;  2D0P A;  3I8Z A;  2K01 A;  1BCP C;  1PH8 A;  4EQ5 A;  3MA2 B;  1C8C A;  1PDQ A;  4DV7 Q;  1D1I A;  1Y1V G;  4A3I B;  3ICE A;  5C44 H;  3PIP 3;  4NKL A;  3K5M A;  2B39 A;  5LMN W;  2K4K A;  2EZV A;  4P71 A;  1SNM A;  1CQV A;  1QVC A;  5M3M G;  1PH5 A;  4MIU A;  3I70 A;  1GO3 E;  1H9S A;  5ELO A;  4WJ4 A;  1ENA A;  3JAM L;  4C1N K;  3C3L A;  3J80 L;  3PO2 H;  1VCI A;  5LL6 X;  2RCN A;  1EYG A;  3A7L A;  3ER0 A;  2B63 H;  1TVX A;  4IUQ A;  2VUM G;  4CDF C;  4K8J A;  5EBC A;  1PFM A;  2F52 A;  2J7Z A;  5IYC H;  2PZW A;  1AW7 A;  1IYJ B;  1A62 A;  1E3P A;  3M4Y A;  5COY A;  1TWH H;  3HOV H;  2PI2 E;  3A54 A;  2EYJ A;  1GHJ A;  2M9V A;  2Z8L A;  3NBH A;  5BN5 A;  3WWV A;  2HHH Q;  3LX0 A;  4EGV A;  1TII D;  3OTO L;  4DR5 Q;  4FF1 A;  3T1H L;  3PO3 B;  2A6E D;  2Z4I A;  4KJO A;  4A76 A;  1SFO H;  4HIK A;  1AEX A;  2BH8 A;  3SE0 A;  4CHT B;  1K8O A;  5EPK A;  3PIO A;  2F0U A;  2IX1 A;  1CSP A;  5FOB B;  3A5U A;  1EOT A;  4E6I A;  3S1R H;  1XJV A;  2BH2 A;  4OGQ C;  4B3R Q;  4DR1 L;  5I6Y A;  1G2S A;  4C2M B;  3N6R A;  3S2H H;  4AYB G;  2O2L D;  2AHO B;  1JE5 A;  2O5I C;  1VQ9 A;  1NE3 A;  3G6E A;  1YBY A;  1VQM A;  1WD0 A;  2O5J C;  3L9A X;  2F0P A;  2Y0S B;  1E1T A;  4HSV A;  2F4I A;  1XMQ Q;  4N9T A;  1DYQ A;  4UHV A;  1RJT A;  1HPC A;  1YJW A;  1ROD A;  3GTO B;  1GM5 A;  2V4D A;  5C0X H;  3F2U A;  3W2D A;  3K5O A;  4ZKB B;  1K83 H;  5GAD C;  5IGC A;  3W3A A;  3HOZ B;  4CDE C;  3RLO A;  2JA5 G;  1J5E L;  2R6G A;  1XTD A;  1FL0 A;  1DD2 A;  4PZ6 A;  1XPO A;  4R4I A;  2CQA A;  1Y8P B;  2I0Q A;  4YHH L;  1Y1W G;  3R8B A;  2CWP A;  1BKB A;  2N88 A;  3IFD A;  3I56 A;  1VQP A;  1UE5 A;  4UP7 A;  1Q1B A;  4YY3 L;  4MNO A;  3K5N A;  4DV0 L;  3BVM A;  3V05 A;  3Q6S A;  3VR5 A;  5IT9 c;  4HIO A;  3CC7 A;  1PA6 A;  4C3I H;  4ME3 A;  3KF8 B;  1LV9 A;  3LWU A;  4BY1 B;  4X62 L;  2K5W A;  1PH1 A;  1EUJ A;  1KDB A;  3DUZ A;  1R4P B;  2RVL A;  1N32 Q;  3A8I E;  3BS1 A;  2SEB D;  4EQO A;  4HMJ A;  3HS0 C;  5CV5 A;  4B3M L;  1L1O A;  1PZI D;  2UXD Q;  1UAP A;  5ELN A;  5KYI A;  5JJK A;  5EKL A;  3OPO A;  5HGQ A;  2H4O A;  4LNQ A;  4LF7 Q;  5C44 B;  2FXQ A;  3ND9 A;  4PQX A;  3FDT A;  2NWG A;  4DV1 Q;  1C4Q A;  2ENB A;  3CQZ H;  1S40 A;  2ZJP A;  2X6G A;  1I94 Q;  1U4R A;  2G9D A;  2OWO A;  3PO2 B;  2BCO A;  4A3I G;  4O42 A;  4OO1 G;  5HUR A;  3G4S A;  3DEP A;  1L1O C;  1X6O A;  5KND A;  2B63 B;  1PZK D;  3HRZ C;  1B1Z A;  1W2B A;  3BDO A;  4P2C B;  1TQO A;  1R9T H;  2MHV A;  4UDU C;  4P72 A;  1NSN S;  1ILQ A;  2KHS A;  3AFQ A;  4JBK A;  3CMA A;  3HOV B;  2D9U A;  5FKA C;  1TS2 A;  4QIW E;  4B3S Q;  1VQB A;  4JI7 L;  3FPP A;  4UP8 A;  1A6X A;  3CRK C;  1I6H H;  1P16 A;  1SFO B;  1IBL Q;  4GN4 B;  5EGT A;  4A3K H;  2Z0S A;  3NWT A;  3J7Z C;  1VQJ A;  4HAE A;  1TR5 A;  2G5D A;  4U68 A;  2MQH A;  4DV4 Q;  3PO3 G;  2RHQ B;  1FNW A;  1O7L A;  5EKK A;  1HFG A;  3I4M H;  1GD7 A;  1S5E D;  4JV5 Q;  3S1R B;  4KY7 A;  4AQY Q;  3I73 A;  1HNZ Q;  5A2Q E;  1TY0 A;  3A5Z B;  1Q12 A;  3S2H B;  4RGT A;  1WD1 A;  3PUW A;  1D5X C;  1DJR D;  1YHQ A;  4V0B A;  2AWO A;  1O7Z A;  1JJ2 A;  5IYD G;  2LKV A;  4IUV A;  4ULL A;  2OQK A;  3EN2 A;  2F3I A;  4CJ2 C;  4HN7 A;  2F0L A;  1NUC A;  1ET9 A;  4K0K Q;  1AE3 A;  2AUK A;  4JI6 Q;  2LXK A;  2UU9 L;  3VA7 A;  5M3M H;  4ID6 A;  5FLM G;  1AZQ A;  1K83 B;  5CMD A;  1HFN A;  1TT2 A;  3TS0 A;  2G9H D;  4LJZ C;  3TRZ A;  3E9H A;  1WYD A;  1JCK B;  1D8L A;  4TQU S;  1RIP A;  1F2Z A;  3I72 A;  2FFK B;  4UP9 A;  1N33 Q;  1X9N A;  4FF3 A;  5AFW A;  3S17 H;  4N8F A;  1Q3L A;  2Q2I A;  1O7I A;  1TWH B;  1WJJ A;  3WDN A;  2PNH A;  2EYM A;  1YNJ C;  1XMO Q;  1ML0 D;  3A0J A;  4DR6 L;  1MJC A;  1Z7T A;  3KJO A;  3SHL A;  5I6W A;  4DK1 A;  4GKK L;  5AJ3 L;  3PIO 3;  1DON A;  2I46 A;  4K2K A;  4G4K A;  3CCM A;  1QZH A;  2NVX H;  4C3I B;  1HQR D;  1Y14 B;  2PW7 A;  2AKW B;  4IFD G;  1S5B D;  3TP6 A;  5J22 A;  1PYB A;  2HD3 A;  4A3J B;  3I55 A;  4BY7 G;  3DEO A;  3QG1 A;  5IGB A;  2XNA C;  4A3G H;  1JWM D;  1JB3 A;  4LF8 L;  5IWA Q;  4X64 Q;  1XNQ L;  3GDE A;  2UUC L;  1HCZ A;  4BY1 G;  1LTR D;  1MSH A;  1TKW B;  1JMC A;  4KLK A;  3CHB D;  3VR4 A;  2NUC A;  4JYA Q;  3DHQ A;  4OON A;  2X6L A;  1LUZ A;  5C4X H;  1XPU A;  4LW1 A;  1IZ6 A;  1T5E A;  2VQF Q;  2NB0 A;  3CQZ B;  4DK0 A;  4JBW A;  1TWG H;  3VYT A;  1QG7 A;  5DEH A;  5K5P A;  2RA4 A;  5C44 G;  3PQI A;  1IKM A;  5DM7 3;  2F0D A;  1E2V A;  4DFA A;  1FR3 A;  2NYZ D;  4DXG A;  4G7O C;  1TWF H;  2C9O A;  3J80 c;  4GLX A;  1AFP A;  3PO2 G;  1EZ8 A;  1TY2 A;  2ZTD A;  4A3E G;  4K6D A;  1R9T B;  3W1B A;  2F0E A;  1TS4 A;  5JJZ A;  4A3M H;  2B63 G;  3BYY B;  4WJW A;  3A8J E;  2H5X A;  2L5T A;  3P20 A;  3T16 A;  5IYC G;  3VR3 A;  4DR1 Q;  5M3F B;  1W3S A;  1I6H B;  4BBR G;  3RR5 A;  1W6J A;  2F0G A;  3GTJ H;  2ICI A;  3HOV G;  2NTT A;  4JK1 C;  2B2W A;  3CCQ A;  3EA6 A;  2ATW A;  3HEJ A;  4A3K B;  1STH A;  1Y1W H;  1VQ5 A;  4KJN A;  3OIP A;  4JI0 Q;  1C7Y A;  1H9M A;  2FJ2 A;  1U9R A;  2WIN B;  3C1F A;  5I2Y A;  5CBA E;  3I4M B;  1VQ4 A;  3K7U C;  5D65 A;  1SE3 A;  5GAH C;  1GOZ A;  4LF4 L;  4L63 B;  4DA2 A;  2B2W C;  1SEB D;  4X6A H;  4IUR A;  4IUU A;  3QOJ A;  2I07 B;  2WII B;  3MXN A;  4DAV A;  3AQQ A;  3C46 A;  5EPL A;  4RCN A;  1VQF A;  3M7G A;  4O1N A;  4RHR A;  3ULP A;  1J8I A;  1EQT A;  3UI2 A;  3MXP A;  3NEM A;  3TZD A;  2KHJ A;  3VYU A;  1SE2 A;  2WKD A;  3KF6 B;  3M9B A;  4LFC L;  4KD3 A;  3CCU A;  5JPM C;  4DR7 L;  2WFW A;  4BBS G;  4BXX H;  1WCM H;  4GNX B;  2F0I A;  4H02 A;  2LSS A;  5M3M B;  3J7A 5;  1ZKO A;  4DPG A;  5GAE C;  4OWT B;  2EDG A;  3TME A;  2ZXO A;  4OO1 H;  4X66 L;  3GV6 A;  1PRT C;  5C0X G;  3A74 A;  2VUM B;  1H9K A;  4LF5 L;  3U9O A;  2IX0 A;  1Q86 C;  4UPA A;  4TVA B;  4X62 Q;  3S17 B;  1ASZ A;  2RSN A;  2JA9 A;  3KOJ A;  3M4Q A;  3PF5 A;  4CJ1 B;  1M1K C;  1K73 C;  4PMW A;  2L15 A;  1L2F A;  4PZ8 A;  4ME5 A;  3S2D H;  2E2H H;  1CHP D;  1I3Q H;  3RUZ A;  3SGI A;  4FO2 A;  3VR2 A;  4R4Q A;  4LFA Q;  1HNW L;  2NVX B;  5DM6 3;  2F4V Q;  2KCC A;  3CME A;  1YJ9 A;  1PTO D;  1F9R A;  2PQA A;  5C3X A;  1F9Q A;  1KLG D;  1X32 A;  2UUB L;  1GUG A;  1K8M A;  4A3G B;  4QJF A;  1X3G A;  3IAY A;  1VMP A;  5JVH 3;  2WAC A;  1A63 A;  1KDA A;  2X69 A;  4NXM L;  3CXC A;  2J4X A;  2B29 A;  3B6Y A;  2Q8T A;  3S24 A;  3TEH B;  5C4X B;  1S3O A;  3NTI A;  1X54 A;  4GOP B;  2EIF A;  4DAM A;  4AYB B;  1EOV A;  4POG A;  3QR8 A;  1G51 A;  1Q1E A;  2RQX A;  4RKL A;  2UXB L;  1IL8 A;  1TWG B;  2M2L A;  1VQD A;  3CAM A;  2WB1 E;  1JB7 A;  3TDQ A;  2FMC A;  1PMR A;  5GQO A;  4QMG A;  3J7Y W;  3PV0 A;  2E75 C;  3PUX A;  4KY6 A;  4DV6 Q;  3CCV A;  4LUZ A;  2IHF A;  4A3M B;  2UUA L;  1LO5 D;  2K33 A;  1Z9F A;  4KTA A;  1JR0 D;  3TZU A;  5CV4 A;  1HHV A;  3S9W A;  4QUF A;  4KD4 A;  2PQE A;  2XTI A;  2A74 C;  3PGZ A;  1NTG A;  1BDO A;  3MEF A;  2VB2 X;  2IPK D;  3HOX H;  4DV2 L;  1IKL A;  4QQB X;  3K7A B;  3E3X A;  1Y1W B;  1SRO A;  4IPH A;  1ZXT A;  4OWX B;  3K0Y A;  1IBK Q;  1EU3 A;  2HIV A;  1QOH A;  3SEB A;  5IY0 A;  3TP8 A;  1EYA A;  4L5T A;  1U4M A;  1L0Y B;  1TXY A;  3SK8 A;  4CJ0 B;  3JAM i;  3CPF A;  5KGU A;  3J80 i;  3V96 A;  1JWU D;  1FGU A;  2UU9 Q;  3A56 A;  1VF5 C;  5BR8 L;  3I4M G;  4GKJ L;  4IFD H;  2JA7 H;  3T1Y L;  1PH7 A;  2F0V A;  4UY8 C;  1BR9 A;  2DN8 A;  3OW7 A;  4LAA A;  4QY7 A;  4DAY B;  4BY7 H;  4OX9 L;  3S14 B;  1A2T A;  1FJG Q;  3NWS A;  4TRD A;  4A3C H;  5IGD A;  2B8F A;  1JJG A;  1TU2 B;  3AU7 A;  3U4V A;  1EY6 A;  3S1Q H;  3OMG A;  4PZ7 A;  3CRL C;  2BA1 A;  3J81 E;  1NMG A;  3KLR A;  5FLX E;  3KK7 A;  3J81 j;  1SE8 A;  5T1G A;  3KYH C;  3BJU A;  4LWC A;  3H15 A;  2UXC L;  1IYV A;  2F0N A;  4R4O A;  4B9X A;  4L5S A;  1DOM A;  3JC6 6;  1HNX Q;  5IP7 G;  1D5Z C;  3DM1 A;  1SYF A;  4RGN A;  2XWJ B;  4A3E H;  1SNC A;  5J3B A;  1V1P A;  3EIV A;  2JK8 A;  5EJW A;  4JW0 A;  1PYW D;  2EY5 A;  4YIJ A;  3PUY A;  4LF8 Q;  1XNQ Q;  3PMF A;  2QF7 A;  1KL9 A;  4AIM A;  5COR A;  2VW9 A;  2UUC Q;  4NB3 A;  1I3Q B;  5DLQ E;  4K14 A;  5JPN C;  3G71 A;  2DY8 A;  2DNC A;  3CKI B;  4BBR H;  1CZW A;  3D8G A;  1BCP B;  2AQ1 B;  5A35 A;  2CW0 C;  1C0A A;  1CA6 A;  4M8A A;  1GUN A;  4DUY L;  4IOC A;  1HR0 L;  3OMC A;  5M9O A;  1ICF B;  4HID A;  1KTK A;  1LAC A;  3IRB A;  1CUK A;  4LF6 Q;  2K6A A;  1RKN A;  4Y52 H;  3I4L A;  1MKH A;  4RH6 A;  1CTM A;  3MWY W;  3H3V I;  2LS0 1;  4DR3 L;  4A75 A;  4A3G G;  4DV3 Q;  4KK7 A;  2FMM A;  3R2T A;  4KHP Q;  1EEI D;  1A15 A;  5C4X G;  1ENC A;  3RMH A;  2E74 C;  1H9S B;  2VZA A;  1SMY D;  1RD9 D;  5H1S E;  2AWN A;  4GN5 A;  4ZQ3 A;  3P1H A;  2R92 H;  3G6J B;  1OXV A;  1V43 A;  3NXW A;  5J1Z A;  4BBS H;  5HGT A;  2IX3 A;  1X3P A;  2L1B A;  1EY0 A;  5IOD A;  2HT1 A;  1CZG A;  3KUP A;  5L37 A;  5LMN Q;  1S5D D;  5EKI A;  3MVV A;  2XN9 C;  2KUM A;  2L12 A;  1MSG A;  2KCT A;  2WAQ E;  4LF4 Q;  1KNE A;  4XXE A;  1XNR Q;  2YTY A;  2XSC A;  3NBH B;  3SXH A;  4WRD A;  4A3M G;  4EQN A;  4JI4 L;  3RD4 A;  3H91 A;  3QO2 A;  1B53 A;  1QZG A;  4M1U B;  3HOX B;  2A73 B;  2B2T A;  2JA8 H;  3ITP A;  4YCV A;  2WB1 G;  1PFS A;  3GTG H;  5LMU Q;  3GTP H;  3FEW X;  4IAL A;  5IOC A;  2JA6 G;  4WOR A;  3RZD H;  4DN4 M;  2ZM6 L;  2WAQ B;  3G7L A;  3CC2 A;  4X65 L;  3NQI A;  1D7Q A;  4ZAI A;  3NTH A;  4OO1 I;  4APV A;  2B2T C;  1KQS A;  3WOF A;  4C56 C;  2JA7 B;  1BBU A;  3H6M A;  2K52 A;  1SN8 A;  2JSO A;  5JVG 3;  1N36 L;  4BY7 B;  1KIX A;  4C3J H;  1K0R A;  1S4Z A;  1X3E A;  1A2U A;  4POF A;  3GTQ B;  1CM9 A;  1YNN D;  3ERQ A;  5KYL A;  5M5Y H;  3AMU A;  1SJE D;  1U4L A;  4LF5 Q;  3S1Q B;  1M90 C;  4FP5 D;  1B44 D;  3ZJY C;  4DF7 A;  2E2I H;  3CC4 A;  2MP1 A;  4V19 0;  1NMF A;  4DV5 L;  2SOB A;  4PMB A;  2BE5 C;  1G6Z A;  4O2D A;  1BCP D;  1B3Q A;  2EYH A;  1GKH A;  1D2B A;  5C3W A;  2HQE A;  3TQY A;  3DWP A;  1BBX C;  5JEA H;  1G29 1;  5D3D A;  2CHB D;  5CV7 A;  1PYS B;  2Q8R E;  1QNK A;  1Q8K A;  4BXX G;  4F87 A;  1WCM G;  5FO8 B;  1HNW Q;  1CK1 A;  2EYP A;  1Q7Y C;  1I5F A;  1YJN A;  3L0O A;  1I4H A;  1RCV D;  1QB5 D;  3N52 A;  3UE1 A;  1VQL A;  4A3E B;  3OWE B;  4AH6 A;  1AN8 A;  2D62 A;  2OTL A;  3DMU A;  4CKC A;  3SDZ A;  5ELF A;  3ZYY X;  2JQO A;  1LTI D;  2F0M A;  3GTL H;  1Q90 A;  4RWS C;  4NPS A;  2CFM A;  1F9P A;  5ELC A;  4BBR B;  2RKS A;  2VY3 A;  4L6T B;  4DR4 Q;  1L0X B;  1EY9 A;  2PMZ E;  2IY5 B;  4XYQ A;  4JI2 L;  3P7J A;  5ELE A;  4RGO S;  1UEA B;  1VF7 A;  1DXM A;  2DY7 A;  2F0J A;  3R93 A;  1H9J A;  2ID0 A;  1NY4 A;  1HZC A;  2I5M X;  1PZJ D;  4G7Z C;  2JE6 I;  3CP0 A;  1SND A;  3OOC A;  4JI8 Q;  1VQN A;  2NVY H;  1RTO A;  3FKI H;  1L1O B;  2J0T D;  1VS0 A;  1CKN A;  4RKB A;  2P5Z X;  3HKZ E;  1K0S A;  4QIW B;  3AFP A;  4XYO A;  4LUV A;  4KKS A;  2Z6B A;  4B3T Q;  5FO7 B;  4ZUJ A;  1M4V A;  2F0F A;  1J9O A;  1GUW A;  1SNO A;  1B2T A;  1UE1 A;  1PTO F;  1C9O A;  4JI1 Q;  5C0X J;  3PUV A;  4BBS B;  5FJ8 H;  2AUJ D;  3ULL A;  3GQB A;  1P8L A;  3Q22 A;  1HR0 W;  5T1I A;  4YWL A;  3HKZ B;  4GN3 B;  4IFD I;  1KLU D;  4QF4 A;  3J7A V;  1YNX A;  1O80 A;  4OXP A;  3T13 A;  1BNZ A;  4DUZ L;  1WTV A;  1SAP A;  2KHI A;  5D3I B;  5IP7 H;  1D1K A;  3BDL A;  4GKJ Q;  3OSO A;  5C5M A;  1IBM Q;  2JA8 B;  4YCW A;  2NVQ H;  4K2L A;  1HTP A;  4JI5 L;  1B70 B;  2FIN B;  3GTG B;  3GO5 A;  3AYH B;  4ALP A;  1N34 Q;  3HOX G;  3RZD B;  4ZK9 B;  2K14 A;  5CV8 A;  4J6H A;  3KLW A;  1SYC A;  5KNB A;  3BVZ A;  4LFB Q;  4LF9 L;  2NZH A;  2Q2U A;  4KHZ A;  5EPJ A;  4JBJ A;  1UNS A;  1W6K A;  3D4R A;  3K57 A;  4BWG B;  2WAQ G;  5I9O A;  4C3J B;  1K9M C;  2N78 A;  4B08 A;  5JOB A;  1EIY B;  1FGB D;  4IUP A;  5M5Y B;  1E24 A;  1LTG D;  2HIX A;  3NSW A;  1Q8I A;  2JA7 G;  2JP1 A;  2E2I B;  3TRE A;  1VQE A;  1OXX K;  2F0K A;  3H0G H;  1WOC A;  2K32 A;  4H7B A;  2B2Y A;  4H13 C;  1BOS A;  2MJ8 A;  4F7X A;  1LTT D;  4A3C G;  2HDM A;  3EBE A;  4L8J A;  4RHS A;  2QCP X;  4DV7 L;  1CSQ A;  2VL6 A;  2QEX A;  1T5X D;  3KBX A;  3FMC A;  3DM3 A;  1PH3 A;  3S1M H;  5ELD A;  4KI0 A;  1D5M C;  4X3T A;  2B2Y C;  3W1G A;  4A93 G;  1OXU A;  1SDF A;  1EWC A;  1PTO C;  1IW7 D;  2E8G A;  1PLF A;  3OTO Q;  1VQO A;  3T1H Q;  3M4P A;  2YTX A;  1XWE A;  2MO0 A;  2EY6 A;  4DK3 C;  1WTR A;  1Q46 A;  5IGE A;  4UAI A;  4DR2 L;  3NHH A;  4FVM A;  1YHB A;  2K7V A;  4IN3 A;  1VQA A;  5IT9 E;  2ZJQ A;  3HOW H;  4IOA A;  2KCM A;  2JJQ A;  3V2T A;  4HMI A;  2HHH L;  4P74 A;  4K5X A;  2H1E A;  4DR5 L;  1JWS D;  3QB3 A;  4XT1 B;  2JEB I;  5C5L A;  2A68 C;  1LTB D;  1BXT A;  3I91 A;  3AB9 A;  2EXZ A;  2JA6 H;  1I4G A;  2M00 A;  5K36 H;  1PVO A;  1EY4 A;  1SYB A;  3S15 H;  1LT4 D;  2K5H A;  2F0T A;  4B9W A;  2NBF A;  1KD1 C;  4B3R L;  3CU7 A;  5FO9 B;  5C0X I;  2EOT A;  3G48 A;  1YEZ A;  4R8I A;  1BF4 A;  2ZT9 C;  2B8G A;  1EU4 A;  3OIQ A;  3J81 c;  1PHJ A;  1F2L A;  1LAB A;  1HXY D;  1HZ9 A;  5IGF A;  2R61 A;  4J1M A;  2NN6 H;  3STB D;  3DXJ C;  2E5L L;  3F8T A;  1JJC B;  1FVI A;  1SNQ A;  3H94 A;  1XMQ L;  5KNC A;  1J5E Q;  3UDX A;  4OL7 A;  3URY A;  4A3D H;  2L4N A;  3EQL C;  4LUO A;  2R92 G;  2R93 H;  5G3L D;  1X3Q A;  1NJI C;  1IHZ A;  4YHH Q;  5GAG C;  5BN3 A;  1DGS A;  3D3R A;  3WOE A;  2F3V A;  3C1E A;  1QIL A;  1XXG A;  1G8Z D;  3HKZ G;  1G6P A;  1X65 A;  1STE A;  1AP0 A;  4YY3 Q;  5CYU A;  1F77 A;  1JOO A;  1YIJ A;  1N36 Q;  4DV0 Q;  2XRQ D;  3DLL A;  2NVQ B;  4CDD C;  3K80 C;  1D6E C;  1VQ7 A;  1QUQ A;  4I7Z C;  1Q82 C;  2EE1 A;  4IO9 A;  1SSO A;  3Q8D A;  5KEE A;  1JOQ A;  2JA8 G;  4MTK A;  3FPU B;  1SNP A;  2KOL A;  3QWN A;  1KC8 C;  4ABN A;  4ZUI A;  2GVA A;  4A3B H;  1AH9 A;  2EJM A;  2YV5 A;  3KDF A;  2ZXP A;  4B3M Q;  1EYC A;  3MXN B;  2ES2 A;  4FDB A;  4DGZ A;  4R4C A;  2VQE L;  1STN A;  5ELB A;  4ZLT F;  4NP5 A;  3OWF A;  1OXT A;  1EWI A;  4RFB A;  1N32 L;  3H0G B;  1Z6H A;  2Z4H A;  4C3J G;  3SVM A;  2QW7 A;  1PRT B;  2KCN A;  2UXD L;  2K5V A;  1S72 A;  1EEF D;  4LF7 L;  1JOR A;  1ESR A;  1HH2 P;  2EY1 A;  2C35 B;  3PCO B;  4PV1 C;  3CCR A;  4DV1 L;  3S1M B;  3RZO H;  2PW5 A;  3T56 B;  1I94 L;  1Y8N B;  3SK6 A;  4A3F H;  5JEA G;  1JQY D;  2K28 A;  4JI7 Q;  3BU2 A;  1STB A;  1M8A A;  1NR2 A;  4HED A;  4X3K A;  2NZO A;  1MI2 A;  3L7Z C;  2A6E C;  5C4J H;  2CH4 W;  1PH9 A;  4K5V A;  4XQQ A;  3H3V C;  1TWF B;  1YIT A;  4FXK C;  1A3V A;  2R7Z H;  4KKT A;  5M5W H;  4JOI A;  4DAP A;  1MBY A;  1ZYR D;  2L0C A;  2WKC A;  1BCP F;  3K0X A;  4GZY C;  4ODG A;  1PH4 A;  2BDO A;  2XGT A;  4B3S L;  3NTK A;  3NQT A;  4N8X 1;  3MXU A;  4C2M H;  3MC0 B;  2NVT H;  4KKU A;  4JI3 L;  1IBL L;  2JXM B;  2WB1 B;  1XYI A;  2N3S A;  2PQA B;  3GTJ B;  3HOY H;  4K5W A;  4JOI C;  2JA6 B;  3IKJ A;  2K50 A;  2QDB A;  4DV4 L;  2K75 A;  2ZTE A;  3I4N H;  1JIC A;  3TBI B;  3S15 B;  4JV5 L;  3K5L A;  2AQ3 B;  4AQY L;  1FNU A;  1KNA A;  4OEL B;  3L3O C;  3UDI A;  2Z9H A;  1Z47 A;  4H0L C;  1XTC D;  4QL5 A;  3HG9 A;  1EIH A;  2KBN A;  3U9S A;  2MPM A;  1SRU A;  3FKI G;  1MIU A;  3J7A F;  2QA4 A;  4G57 A;  2CVR A;  4JC0 A;  3JAM E;  3J80 E;  2K1B A;  4NXN L;  5EBD A;  3ERS X;  2EPB A;  2CCZ A;  3FVQ A;  3RN2 A;  4NMZ A;  3KLS X;  1TS5 A;  2XVS A;  2IT1 A;  4K0K L;  3GTK H;  4A3D B;  4GS3 A;  1ASY A;  4JI6 L;  2R93 B;  5IYB G;  1WCM B;  5FJ8 G;  1DM0 B;  1K28 A;  2YYZ A;  3GD7 A;  4A93 H;  4DR6 Q;  5KIX A;  3MHB A;  4GKK Q;  1PRT D;  3BZC A;  1MJE A;  5AJ3 Q;  2HCI A;  1N33 L;  1CKM A;  1WTO A;  1E2Z A;  3AEV A;  4Q0F A;  1IL2 A;  1YNN C;  3GTM H;  3T51 B;  3R2I A;  1GVP A;  5E4X A;  1YHA A;  1BO0 A;  4H44 C;  3UDG A;  3NE5 B;  3TP7 A;  3HGB A;  2KEN A;  3BVG A;  2N49 A;  4A3B B;  3A55 A;  2NZ1 D;  1BQQ T;  3BG3 A;  1EQQ A;  4GLA C;  3S2D B;  1HZA A;  2E2H B;  2PI2 A;  1IYU A;  3A8K E;  2E76 C;  1UUP A;  1GUT A;  2F03 A;  5LHY 1;  4NDX A;  3D6W A;  5F2D A;  5CR3 A;  3PSI A;  1A3T A;  3TP5 A;  1RTN A;  5I4D A;  1PXU A;  4DNT B;  5J39 A;  1YZ6 A;  5IWA L;  1VQH A;  4KV6 A;  4X64 L;  4Q5V A;  2K5Q A;  1Q81 C;  2A19 A;  1LTS D;  1E2W A;  2RHS B;  4JYA L;  4TKO B;  3J81 L;  3CF5 A;  2SNM A;  4DR2 Q;  3UE0 A;  3EFX D;  2A6H D;  3H0G G;  2LY7 A;  2VQF L;  5FLX L;  3RZO B;  1SJH D;  2XRS D;  3TSS A;  4FF4 A;  1II3 A;  3IL8 A;  2K5N A;  4A3F B;  3K8A A;  2PCF B;  3I7F A;  2Z1C A;  5C3E H;  4OIJ A;  2N8N A;  1NCV A;  3NEL A;  1TWC H;  2NTS A;  5C4J B;  4JPB W;  1X3F A;  1V1P B;  2F0O A;  4P73 A;  3H09 A;  1SR3 A;  1E1O A;  1FYC A;  1N8R C;  3ONA B;  2Y0S E;  2R7Z B;  5M5W B;  2B2U A;  1PV4 A;  3SK5 A;  5IIF A;  4J8Q A;  3MEH A;  4KN4 C;  2A69 D;  2NN6 I;  3Q0A A;  5JJI A;  2QEJ C;  2NVT B;  3HOW G;  2RDF A;  3MTS A;  2BA0 A;  2F0W A;  1LT6 D;  3DWQ A;  3KF8 A;  3HOY B;  2B2U C;  1UWV A;  4JI0 L;  2EYO A;  3CCS A;  2E5L Q;  1WVL A;  1I4P A;  1H95 A;  1YVC A;  1NAP A;  3I4N B;  4IFD J;  1STG A;  1KRS A;  4LFC Q;  1B7Y B;  5DNF A;  3F2D A;  4DR7 Q;  5K36 G;  5IE8 A;  4QUC A;  3D31 A;  1WTH A;  4YCU A;  3U58 A;  1VQK A;  3SR1 A;  3IFT A;  2F0S A;  5I9P A;  5CBE E;  4FYD A;  4R1J A;  4TSS A;  2LMC B;  1LM0 A;  4IJH A;  1PFN A;  2CKZ B;  4X66 Q;  3I90 A;  1H9R A;  2ALY B;  4CKE A;  3CCJ A;  1HQM C;  2DUD A;  3GTK B;  2NN6 G;  1WTW A;  2TSS A;  4IJL A;  3NP8 A;  2GA4 B;  2KED A; 
#chains in the Genus database with same CATH homology
 1JC7 A;  5C6A A;  3KLS A;  2K03 A;  4QB4 A;  2EJF C;  3RLF A;  4A93 B;  3E5S A;  1STA A;  1RF2 D;  4HR7 B;  2K04 A;  2O4X A;  4X3S A;  2VNU D;  4OIK A;  3GTM B;  1SYG A;  3EVQ A;  4HCE A;  1KAA A;  2EY2 A;  2MGS A;  2OXP A;  1QNU A;  3TN2 A;  2TMP A;  2KVM A;  5JAV A;  5G3L F;  2RDG A;  3MFG A;  4FNF A;  1QWY A;  2EYF A;  2CW0 D;  1EY7 A;  1G91 A;  3KBG A;  1IW7 C;  2RDH A;  5D14 A;  1FD7 D;  5IGG A;  1VDZ A;  5C4H A;  2MUY A;  1WTQ A;  1PTO H;  2KA7 A;  4XT3 B;  2SNS A;  3ERO A;  4OHJ A;  3X3N A;  1HA5 A;  3K58 A;  3E6Z X;  3X3M A;  2PMZ B;  4HSP A;  4IQZ A;  3SK4 A;  2B2V A;  4FXD A;  5C3E B;  2PZT A;  4R9W A;  2QKI C;  1A3U A;  1TWC B;  2KEE A;  2R92 B;  4KY5 A;  2PZU A;  1BUV T;  4XQJ A;  2B2V C;  2C5C A;  1GXD C;  4RCO A;  4S3S A;  4K6L A;  1XX8 A;  1HTL D;  1NR4 A;  1EFI D;  5E1F A;  1QE6 A;  3MXG A;  4U67 3;  3PUZ A;  2WV6 D;  4LMQ D;  4HTH A;  3Q24 A;  3P75 A;  5I2X A;  4BA1 I;  1CA5 A;  4X3U A;  3GTP B;  2BDN A;  3K59 A;  1MGS A;  3E0J A;  1ENF A;  4F8M A;  2PO4 A;  1CI3 M;  5A2Q L;  3BDC A;  1F2M A;  2EYL A;  3C2P A;  2RBM A;  1GUO A;  1HA6 A;  5JEA J;  4CKB A;  1LLR D;  1SYE A;  4MHE A;  4R8N A;  2BE5 D;  5FK9 C;  1CT1 D;  5TSS A;  2OEO A;  1S5F D;  2D5D A;  2E2D C;  4I65 A;  3HZX A;  2E2J B;  4Z9C B;  1Y8O B;  1RHP A;  5CV9 A;  3O13 A;  2IW3 A;  3M7N A;  1V8Q A;  1U4P A;  4HCS A;  1V1O A;  1TWA B;  3LWE A;  1EIG A;  3I3C A;  1EL0 A;  4KHV A;  1CFM A;  2KEC A;  1DOK A;  2VB3 X;  1OO9 B;  3GTL B;  3OHX C;  4MN3 A;  1SYD A;  1R4Q B;  2L11 A;  1ONL A;  1DZ1 A;  2A5H A;  1PRT F;  4XDX A;  5DAU A;  1QJO A;  4N9P A;  2ZXR A;  1OXS C;  2PYK A;  4RA8 A;  2IWH A;  4DXF A;  5CC4 A;  1ICW A;  1PTO B;  2L55 A;  1B50 A;  4EQP A;  3D4W A;  4FXG C;  3FRP B;  2NVY B;  1E0B A;  2SDF A;  3FKI B;  1SXT A;  2AQ2 B;  1ZYR C;  1B4O A;  3T53 B;  3VR6 A;  4ILW A;  2DNE A;  4XQN A;  4IUT A;  2F0H A;  4C3H B;  1I50 B;  2PPB C;  4XIG S;  4F88 A;  3MZ5 A;  3BYT B;  4DNR B;  5NUC A;  2WP8 J;  1WTP A;  4PMC A;  2EJG C;  4CBV A;  1QCB D;  1HUM A;  3GV3 A;  4LK1 C;  1SE4 A;  2R3Z A;  3NPP A;  5EQ0 A;  5IT9 L;  2K5D A;  1I4Q A;  2KJX A;  1EZ6 A;  1VMC A;  2RSO A;  5C4Z A;  2FHT A;  4BA2 I;  2HDL A;  1ZEQ X;  3VYS A;  1RDP D;  1KAB A;  4ZYS A;  5ISR A;  4RAU C;  1Y1V B;  2XWB B;  1B9N A;  4IUN A;  5CGK A;  2JYO A;  1YNJ D;  5M5X B;  3D6C A;  3NK9 A;  1STY A;  2IJ0 A;  1O7Y A;  4KN7 C;  2BOS A;  4KMU C;  3T4A C;  1B9M A;  3BZD B;  4XTC S;  2K05 A;  2ICE C;  1ILP A;  1KDC A;  3S16 B;  3S1N B;  2IL8 A;  4Y7N B;  3NUC A;  2VXW A;  4QCL A;  1LT3 D;  2N55 A;  3NBI A;  1B3A A;  2LFN A;  3MFY A;  4RGM A;  4ZKC B;  2XIW A;  1AZP A;  4FF2 A;  2JEA I;  1S5C D;  4CGY B;  1I4R A;  5E4W C;  1GHK A;  1CQF A;  2F0Q A;  1O78 A;  4C3I G;  3M4O B;  1I4X A;  1G2T A;  1JOK A;  4NW2 A;  5E3F A;  2YU9 B;  2EVB A;  2A6H C;  3HOW B;  1MD2 D;  2PNR C;  3ND8 A;  2D2C C;  3M85 A;  2HCC A;  2A68 D;  1JE4 A;  2OF1 A;  3QOL A;  4G7H C;  2HUG A;  4DAY A;  1HUN A;  3D4D A;  3DWA A;  2KQ3 A;  1SMY C;  4DU9 A;  4PNY A;  2QIL A;  2F1M A;  1HRJ A;  1LT5 D;  1SBB B;  1PFB A;  1F2Y A;  1ESF A;  3K6O A;  3QJY A;  1ET6 A;  1EY5 A;  2Q8I B;  5KRU A;  2JA5 B;  2OT2 A;  2A69 C;  1CHQ D;  1Y69 U;  1DCZ A;  3A7A B;  4IZ8 A;  5LL6 S;  4ZRZ A;  3QIA A;  1F9S A;  2F3W A;  3GP7 A;  1EYD A;  1EWH A;  3R3O A;  2L9H A;  4C3H G;  3Q23 A;  1LTA D;  3HP3 A;  3VA5 A;  1FNV A;  4K8I A;  1C48 A;  1DOL A;  4WFN 3;  1EQV A;  1EY8 A;  4EVO A;  3MAQ A;  4BS9 A;  3LNN A;  1I6V C;  3M3Y B;  1TS3 A;  4C1N I;  1WTX A;  1GJX A;  5BN4 A;  1GUS A;  3EJI A;  3HOU B;  5CV6 A;  3VYR A;  3I8Z A;  2K01 A;  1BCP C;  3MA2 B;  1C8C A;  1PDQ A;  1D1I A;  4A3I B;  3PIP 3;  4NKL A;  3K5M A;  2B39 A;  2EZV A;  1SNM A;  1CQV A;  4MIU A;  3I70 A;  1H9S A;  1ENA A;  3JAM L;  4C1N K;  3C3L A;  3J80 L;  1VCI A;  5LL6 X;  3A7L A;  1TVX A;  4IUQ A;  4K8J A;  5EBC A;  1PFM A;  2J7Z A;  2PZW A;  1AW7 A;  3M4Y A;  5COY A;  3A54 A;  2EYJ A;  1GHJ A;  2M9V A;  2Z8L A;  3NBH A;  5BN5 A;  3LX0 A;  4EGV A;  1TII D;  4FF1 A;  3PO3 B;  2A6E D;  2Z4I A;  4KJO A;  1AEX A;  3SE0 A;  4CHT B;  1K8O A;  5EPK A;  2F0U A;  2IX1 A;  5FOB B;  1EOT A;  4E6I A;  4OGQ C;  5I6Y A;  1G2S A;  4C2M B;  3N6R A;  2O2L D;  2O5I C;  1WD0 A;  2O5J C;  3L9A X;  2F0P A;  2Y0S B;  4HSV A;  2F4I A;  4N9T A;  1DYQ A;  1RJT A;  1HPC A;  1ROD A;  3GTO B;  2V4D A;  5C0X H;  3F2U A;  3W2D A;  3K5O A;  4ZKB B;  5IGC A;  3W3A A;  3HOZ B;  2R6G A;  1DD2 A;  2CQA A;  1Y8P B;  3R8B A;  3IFD A;  2N88 A;  1Q1B A;  3K5N A;  3BVM A;  3V05 A;  3Q6S A;  3VR5 A;  1LV9 A;  3LWU A;  4BY1 B;  2K5W A;  1KDB A;  3DUZ A;  1R4P B;  2RVL A;  3A8I E;  3BS1 A;  2SEB D;  4EQO A;  4HMJ A;  3HS0 C;  5CV5 A;  1PZI D;  1UAP A;  5KYI A;  5EKL A;  3OPO A;  2H4O A;  5C44 B;  3ND9 A;  4PQX A;  3FDT A;  2NWG A;  1C4Q A;  2ENB A;  2X6G A;  1U4R A;  2G9D A;  3PO2 B;  2BCO A;  4O42 A;  4OO1 G;  5HUR A;  3DEP A;  5KND A;  2B63 B;  1PZK D;  3HRZ C;  1B1Z A;  3BDO A;  4P2C B;  1TQO A;  2MHV A;  4UDU C;  1NSN S;  1ILQ A;  2KHS A;  3HOV B;  2D9U A;  5FKA C;  1TS2 A;  3FPP A;  1A6X A;  3CRK C;  1SFO B;  5EGT A;  3NWT A;  4HAE A;  1TR5 A;  4U68 A;  1FNW A;  1O7L A;  5EKK A;  1HFG A;  1S5E D;  3S1R B;  4KY7 A;  3I73 A;  5A2Q E;  1TY0 A;  1Q12 A;  3S2H B;  4RGT A;  1WD1 A;  3PUW A;  1D5X C;  1DJR D;  4V0B A;  2AWO A;  1O7Z A;  2LKV A;  4IUV A;  4ULL A;  4CJ2 C;  4HN7 A;  2F0L A;  1NUC A;  1ET9 A;  2AUK A;  3VA7 A;  4ID6 A;  1AZQ A;  1HFN A;  1K83 B;  5CMD A;  1TT2 A;  2G9H D;  4LJZ C;  1JCK B;  4TQU S;  1F2Z A;  3I72 A;  2FFK B;  4FF3 A;  5AFW A;  1Q3L A;  1TWH B;  3WDN A;  2EYM A;  1YNJ C;  1ML0 D;  1Z7T A;  3SHL A;  5I6W A;  4DK1 A;  3PIO 3;  1DON A;  2I46 A;  4K2K A;  4G4K A;  4C3I B;  1HQR D;  2PW7 A;  4IFD G;  1S5B D;  3TP6 A;  5J22 A;  4A3J B;  3DEO A;  3QG1 A;  5IGB A;  2XNA C;  1JWM D;  1JB3 A;  1HCZ A;  1LTR D;  1MSH A;  1TKW B;  3CHB D;  3VR4 A;  2NUC A;  3DHQ A;  2X6L A;  1T5E A;  2NB0 A;  3CQZ B;  4DK0 A;  4JBW A;  3VYT A;  1QG7 A;  5DEH A;  5K5P A;  2RA4 A;  1IKM A;  5DM7 3;  2F0D A;  1E2V A;  4DFA A;  1FR3 A;  2NYZ D;  4DXG A;  4G7O C;  2C9O A;  1AFP A;  1EZ8 A;  1TY2 A;  4K6D A;  1R9T B;  2F0E A;  1TS4 A;  5JJZ A;  3BYY B;  4WJW A;  3A8J E;  2L5T A;  3P20 A;  3T16 A;  3VR3 A;  5M3F B;  1I6H B;  1W6J A;  2F0G A;  2ICI A;  2NTT A;  4JK1 C;  2B2W A;  3EA6 A;  3HEJ A;  4A3K B;  1STH A;  4KJN A;  3OIP A;  1H9M A;  2FJ2 A;  1U9R A;  2WIN B;  3C1F A;  5I2Y A;  5CBA E;  3I4M B;  5D65 A;  1SE3 A;  1GOZ A;  4L63 B;  4DA2 A;  2B2W C;  1SEB D;  4IUR A;  4IUU A;  3QOJ A;  2I07 B;  2WII B;  3MXN A;  4DAV A;  3C46 A;  5EPL A;  4RCN A;  3M7G A;  4O1N A;  4RHR A;  1J8I A;  1EQT A;  3UI2 A;  3MXP A;  3TZD A;  3VYU A;  1SE2 A;  2WKD A;  4KD3 A;  5JPM C;  2F0I A;  5M3M B;  1ZKO A;  2EDG A;  3TME A;  2ZXO A;  4OO1 H;  3GV6 A;  1PRT C;  5C0X G;  2VUM B;  1H9K A;  3U9O A;  2IX0 A;  3S17 B;  2RSN A;  4CJ1 B;  4PMW A;  4ME5 A;  1CHP D;  3RUZ A;  4FO2 A;  3VR2 A;  2NVX B;  5DM6 3;  2KCC A;  1PTO D;  1F9R A;  5C3X A;  1F9Q A;  1KLG D;  1X32 A;  1GUG A;  1K8M A;  4A3G B;  3IAY A;  1VMP A;  5JVH 3;  2WAC A;  1KDA A;  2X69 A;  2J4X A;  2Q8T A;  5C4X B;  3NTI A;  4AYB B;  1Q1E A;  2RQX A;  4RKL A;  1IL8 A;  1TWG B;  2M2L A;  3TDQ A;  2FMC A;  1PMR A;  3J7Y W;  4QMG A;  3PV0 A;  2E75 C;  3PUX A;  4KY6 A;  4A3M B;  1LO5 D;  2K33 A;  4KTA A;  1JR0 D;  3TZU A;  5CV4 A;  1HHV A;  3S9W A;  4QUF A;  4KD4 A;  2PQE A;  2A74 C;  1BDO A;  2VB2 X;  2IPK D;  1IKL A;  3K7A B;  1Y1W B;  1ZXT A;  3K0Y A;  1EU3 A;  1QOH A;  3SEB A;  3TP8 A;  1EYA A;  1U4M A;  1L0Y B;  3SK8 A;  4CJ0 B;  5KGU A;  3V96 A;  1JWU D;  3A56 A;  1VF5 C;  4IFD H;  2F0V A;  1BR9 A;  2DN8 A;  3OW7 A;  4LAA A;  3S14 B;  1A2T A;  3NWS A;  4TRD A;  5IGD A;  2B8F A;  1TU2 B;  3AU7 A;  1EY6 A;  3OMG A;  3CRL C;  2BA1 A;  3J81 E;  3KLR A;  5FLX E;  3KK7 A;  5T1G A;  1IYV A;  2F0N A;  4B9X A;  1DOM A;  1D5Z C;  3DM1 A;  1SYF A;  4RGN A;  2XWJ B;  1SNC A;  1V1P A;  5EJW A;  1PYW D;  2EY5 A;  4YIJ A;  3PUY A;  3PMF A;  2QF7 A;  5COR A;  1I3Q B;  4K14 A;  5JPN C;  2DY8 A;  2DNC A;  3CKI B;  1CZW A;  3D8G A;  1BCP B;  2AQ1 B;  5A35 A;  2CW0 C;  1CA6 A;  4M8A A;  1GUN A;  3OMC A;  5M9O A;  1KTK A;  1LAC A;  2K6A A;  1RKN A;  3I4L A;  4RH6 A;  1CTM A;  3MWY W;  2LS0 1;  4KK7 A;  2FMM A;  3R2T A;  1EEI D;  1A15 A;  1ENC A;  3RMH A;  2E74 C;  1H9S B;  1SMY D;  1RD9 D;  2AWN A;  4ZQ3 A;  3P1H A;  3G6J B;  1OXV A;  1V43 A;  3NXW A;  5J1Z A;  5HGT A;  2IX3 A;  1X3P A;  2L1B A;  1EY0 A;  5IOD A;  1CZG A;  3KUP A;  1S5D D;  5EKI A;  3MVV A;  2XN9 C;  2KUM A;  2L12 A;  1MSG A;  1KNE A;  4XXE A;  2XSC A;  3SXH A;  4WRD A;  4EQN A;  3RD4 A;  3H91 A;  3QO2 A;  1B53 A;  4M1U B;  3HOX B;  2A73 B;  2B2T A;  3ITP A;  3FEW X;  4IAL A;  5IOC A;  4WOR A;  4DN4 M;  2WAQ B;  3G7L A;  3NQI A;  4ZAI A;  3NTH A;  4OO1 I;  2B2T C;  3WOF A;  4C56 C;  2JA7 B;  3H6M A;  2JSO A;  5JVG 3;  4BY7 B;  1S4Z A;  3GTQ B;  1A2U A;  1CM9 A;  1YNN D;  3ERQ A;  5KYL A;  3AMU A;  1SJE D;  1U4L A;  3S1Q B;  4FP5 D;  1B44 D;  4DF7 A;  4V19 0;  2MP1 A;  2SOB A;  4PMB A;  2BE5 C;  1G6Z A;  1BCP D;  2EYH A;  1D2B A;  5C3W A;  2HQE A;  3DWP A;  1BBX C;  5JEA H;  1G29 1;  5D3D A;  2CHB D;  5CV7 A;  2Q8R E;  1QNK A;  4F87 A;  5FO8 B;  1CK1 A;  2EYP A;  1I4H A;  1RCV D;  1QB5 D;  3N52 A;  4A3E B;  3OWE B;  1AN8 A;  2D62 A;  3DMU A;  4CKC A;  3SDZ A;  5ELF A;  3ZYY X;  1LTI D;  2F0M A;  1Q90 A;  4RWS C;  1F9P A;  5ELC A;  4BBR B;  2RKS A;  4L6T B;  1L0X B;  1EY9 A;  4XYQ A;  3P7J A;  5ELE A;  4RGO S;  1UEA B;  1VF7 A;  1DXM A;  2DY7 A;  2F0J A;  3R93 A;  1H9J A;  2ID0 A;  1PZJ D;  4G7Z C;  2JE6 I;  1SND A;  3OOC A;  1RTO A;  2J0T D;  4RKB A;  4QIW B;  4XYO A;  4KKS A;  5FO7 B;  4ZUJ A;  1M4V A;  2F0F A;  1J9O A;  1GUW A;  1SNO A;  1B2T A;  1PTO F;  5C0X J;  3PUV A;  4BBS B;  2AUJ D;  3GQB A;  3Q22 A;  5T1I A;  3HKZ B;  4IFD I;  1KLU D;  4QF4 A;  3J7A V;  1O80 A;  3T13 A;  1BNZ A;  1WTV A;  1SAP A;  5D3I B;  1D1K A;  3BDL A;  3OSO A;  5C5M A;  2JA8 B;  4K2L A;  1HTP A;  2FIN B;  3GTG B;  3GO5 A;  3RZD B;  4ZK9 B;  5CV8 A;  4J6H A;  1SYC A;  5KNB A;  3BVZ A;  4KHZ A;  5EPJ A;  1UNS A;  1W6K A;  3D4R A;  3K57 A;  4BWG B;  5I9O A;  4C3J B;  4B08 A;  5JOB A;  1FGB D;  4IUP A;  5M5Y B;  1LTG D;  3NSW A;  1Q8I A;  2JP1 A;  2E2I B;  1OXX K;  2F0K A;  4H7B A;  2K32 A;  2B2Y A;  4H13 C;  1BOS A;  2MJ8 A;  4F7X A;  1LTT D;  2HDM A;  4RHS A;  4L8J A;  2QCP X;  1T5X D;  3KBX A;  3FMC A;  5ELD A;  4KI0 A;  1D5M C;  4X3T A;  2B2Y C;  1OXU A;  1SDF A;  1EWC A;  1PTO C;  1IW7 D;  1PLF A;  1XWE A;  2EY6 A;  1WTR A;  5IGE A;  4UAI A;  3NHH A;  4FVM A;  4IN3 A;  2K7V A;  5IT9 E;  3V2T A;  4HMI A;  4K5X A;  2H1E A;  1JWS D;  3QB3 A;  4XT1 B;  2JEB I;  5C5L A;  2A68 C;  1LTB D;  1BXT A;  3I91 A;  3AB9 A;  2EXZ A;  1I4G A;  2M00 A;  5K36 H;  1EY4 A;  1SYB A;  1LT4 D;  2F0T A;  4B9W A;  2NBF A;  3CU7 A;  5FO9 B;  5C0X I;  2EOT A;  4R8I A;  1BF4 A;  2ZT9 C;  2B8G A;  1EU4 A;  3OIQ A;  1F2L A;  1LAB A;  1HXY D;  5IGF A;  2R61 A;  4J1M A;  2NN6 H;  3DXJ C;  1SNQ A;  3H94 A;  5KNC A;  4OL7 A;  3URY A;  2L4N A;  3EQL C;  5G3L D;  1X3Q A;  1IHZ A;  5BN3 A;  3D3R A;  3WOE A;  2F3V A;  3C1E A;  1QIL A;  1XXG A;  1G8Z D;  1STE A;  1AP0 A;  5CYU A;  1F77 A;  1JOO A;  2XRQ D;  2NVQ B;  1D6E C;  4I7Z C;  2EE1 A;  1SSO A;  5KEE A;  1JOQ A;  3FPU B;  1SNP A;  2KOL A;  3QWN A;  4ABN A;  4ZUI A;  2EJM A;  2ZXP A;  1EYC A;  4DGZ A;  1STN A;  5ELB A;  4ZLT F;  4NP5 A;  3OWF A;  1OXT A;  4RFB A;  3H0G B;  1Z6H A;  2Z4H A;  4C3J G;  3SVM A;  1PRT B;  2KCN A;  1EEF D;  1JOR A;  1ESR A;  2EY1 A;  4PV1 C;  3S1M B;  2PW5 A;  3T56 B;  1Y8N B;  3SK6 A;  5JEA G;  1JQY D;  2K28 A;  1STB A;  1M8A A;  1NR2 A;  4HED A;  4X3K A;  1MI2 A;  3L7Z C;  2A6E C;  4K5V A;  4XQQ A;  3H3V C;  1TWF B;  4FXK C;  1A3V A;  4KKT A;  4DAP A;  1MBY A;  1ZYR D;  2L0C A;  2WKC A;  1BCP F;  4GZY C;  4ODG A;  2BDO A;  3NTK A;  3NQT A;  3MXU A;  3MC0 B;  4KKU A;  2JXM B;  2WB1 B;  1XYI A;  3GTJ B;  4K5W A;  2JA6 B;  3IKJ A;  2QDB A;  1JIC A;  3TBI B;  3S15 B;  3K5L A;  2AQ3 B;  1FNU A;  1KNA A;  3L3O C;  1Z47 A;  4H0L C;  1XTC D;  3HG9 A;  1EIH A;  3U9S A;  2MPM A;  3J7A F;  4G57 A;  2CVR A;  3JAM E;  3J80 E;  2K1B A;  5EBD A;  2EPB A;  3FVQ A;  4NMZ A;  3KLS X;  1TS5 A;  2XVS A;  2IT1 A;  4A3D B;  2R93 B;  1WCM B;  1DM0 B;  2YYZ A;  3GD7 A;  5KIX A;  3MHB A;  1PRT D;  2HCI A;  1WTO A;  1E2Z A;  4Q0F A;  1YNN C;  3T51 B;  3R2I A;  5E4X A;  1BO0 A;  4H44 C;  3NE5 B;  3TP7 A;  3HGB A;  3BVG A;  4A3B B;  3A55 A;  2NZ1 D;  1BQQ T;  3BG3 A;  3S2D B;  2E2H B;  1IYU A;  3A8K E;  2E76 C;  1UUP A;  1GUT A;  2F03 A;  5LHY 1;  4NDX A;  3D6W A;  5F2D A;  5CR3 A;  1A3T A;  3TP5 A;  1RTN A;  5I4D A;  1PXU A;  4DNT B;  5J39 A;  4KV6 A;  4Q5V A;  2K5Q A;  1LTS D;  1E2W A;  4TKO B;  3J81 L;  2SNM A;  3EFX D;  2A6H D;  2LY7 A;  5FLX L;  3RZO B;  1SJH D;  2XRS D;  3TSS A;  4FF4 A;  1II3 A;  3IL8 A;  4A3F B;  2PCF B;  2Z1C A;  4OIJ A;  1NCV A;  2NTS A;  5C4J B;  1V1P B;  2F0O A;  3H09 A;  1FYC A;  3ONA B;  2R7Z B;  5M5W B;  2B2U A;  3SK5 A;  5IIF A;  4J8Q A;  3MEH A;  4KN4 C;  2A69 D;  2NN6 I;  3Q0A A;  2QEJ C;  2NVT B;  2RDF A;  3MTS A;  2BA0 A;  2F0W A;  1LT6 D;  3DWQ A;  3KF8 A;  3HOY B;  2B2U C;  2EYO A;  1WVL A;  1I4P A;  1NAP A;  3I4N B;  4IFD J;  1STG A;  5DNF A;  5K36 G;  4QUC A;  3D31 A;  3SR1 A;  3IFT A;  2F0S A;  5I9P A;  5CBE E;  4FYD A;  4TSS A;  2LMC B;  1PFN A;  3I90 A;  1H9R A;  4CKE A;  1HQM C;  3GTK B;  2NN6 G;  1WTW A;  2TSS A;  3NP8 A;  2GA4 B;  2KED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...