5C4ZA

Crystal structure of staphylococcal nuclease variant delta+phs l25h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKHMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4zA00
1EY9A 5I6WA 3T16A 2F0IA 2HQEA 1EZ6A 1STYA 2EYFA 1SNCA 1SNPA 4OL7A 4HTHA 4J6HA 4WORA 4R8NA 1SNOA 3D4WA 3NXWA 3MVVA 4K5XA 1SYCA 4KV6A 3ITPA 5IGDA 1IHZA 1A2UA 1II3A 3EJIA 2EY1A 4EQNA 2SNSA 5J1ZA 3SR1A 4EQPA 3NP8A 4F7XA 3TP6A 5IGEA 1SYBA 1ENCA 3BDCA 3H6MA 3NUCA 3OMCA 4KY6A 5CV9A 4KY7A 1RKNA 5DEHA 1A3VA 5CGKA 5NUCA 3NQTA 2F0OA 1EY0A 4K6DA 4ZQ3A 4DF7A 4ID6A 4DU9A 2F3VA 5DAUA 2O4XA 1F2MA 3PMFA 1STAA 2PQEA 5C3WA 1SYGA 3LX0A 4PMCA 5J22A 3VA5A 3TMEA 4PNYA 1NUCA 1EY6A 4IZ8A 1U9RA 1JOQA 2F0SA 4S3SA 3MXPA 4N9PA 1KDAA 5CR3A 4ZUIA 5CC4A 5IGCA 4K2KA 5HGTA 2PW7A 4EQOA 2SOBA 5M9OA 4ZUJA 1STGA 1STBA 2EYLA 2OXPA 2RKSA 5C4ZA 4B9XA 1EYDA 4KTAA 5HURA 1EY4A 5I9OA 4I65A 1EY8A 3C1EA 4KY5A 5KRUA 5CV4A 2EYJA 4KJOA 4KHVA 5KYLA 4QF4A 2PZTA 2F0TA 5K5PA 3U9OA 1F2ZA 1SYEA 3SK8A 1SYDA 1TT2A 4NDXA 2F0NA 1EYCA 2EY5A 2NUCA 2EYHA 2F0JA 2OEOA 3DMUA 3P1HA 4NP5A 5ISRA 4DFAA 3SHLA 3R3OA 3EROA 4KD3A 3SK6A 3QB3A 2ENBA 2EY2A 3MZ5A 3NK9A 2F0QA 2PW5A 2RDFA 5CV6A 1TQOA 2F0DA 4PMBA 5EGTA 3T13A 3HZXA 4F8MA 2WACA 5IGFA 5I9PA 4YIJA 5C4HA 2OF1A 1KDCA 2SNMA 4J1MA 3SK5A 4E6IA 5IODA 5J39A 3D8GA 5I6YA 2RBMA 1EZ8A 5KYIA 4DGZA 3BDLA 1KAAA 1F2YA 4RKBA 4WRDA 1SNDA 4KD4A 4QB4A 4HMJA 5EKLA 2LKVA 1EY7A 5IOCA 3D6CA 3TP7A 5IIFA 3SK4A 4B9WA 2F0WA 2PYKA 2EYMA 4NMZA 2EYPA 5F2DA 5C5MA 2F0GA 4TRDA 5CV8A 4ODGA 3V2TA 4KJNA 2F0FA 3D4DA 4N9TA 1EYAA 5JAVA 3S9WA 2KQ3A 3OWFA 2F0MA 3EVQA 2F0EA 4K5WA 3TP8A 2F0LA 4HMIA 1ENAA 2M00A 5IGBA 2EYOA 2F0PA 5KGUA 2KHSA 3NHHA 1EY5A 1AEXA 5C3XA 4G57A 1A3UA 1JOOA 3OMGA 4K8JA 3QOJA 4K14A 2EXZA 5CV5A 1STHA 3RUZA 5E1FA 5KEEA 1STNA 3TP5A 2F0UA 5C5LA 1A2TA 4IALA 3MEHA 4IUNA 5KIXA 1SNQA 1SNMA 4QMGA 2F0VA 4K5VA 3E5SA 3SXHA 4K8IA 1TR5A 4K2LA 1EQVA 1KABA 2QDBA 2F3WA 1KDBA 1A3TA 2PZWA 3DHQA 4MIUA 4RKLA 4EVOA 2PZUA 4LAAA 1SYFA 1NSNS 4ME5A 3P75A 5IGGA 1JORA 5E3FA 5EKKA 3MHBA 4NKLA 5C6AA 3ERQA 3QOLA 2EY6A 3OSOA 3C1FA 5CV7A 5JOBA 4H7BA 3HEJA 1JOKA 2F0KA 2F0HA
chains in the Genus database with same CATH superfamily
3MAQA 4OXPA 2HCCA 2IWHA 3OW2A 4WORA 4R8NA 5C3EH 1XTDA 2HHHQ 1JWMD 4GZYC 5FOBB 3Q22A 1I6HH 4ZKBB 3FPPA 4DR4L 1QE6A 2LMCB 1R9TB 1ML0D 4FF1A 1S40A 1N33Q 2CH4W 4H02A 1IXRA 2AUJD 3K81C 5M3MG 4QUCA 4DV0Q 2LFNA 1JJCB 3LNNA 4FNFA 1NNXA 1NMFA 4N9PA 4ZUIA 2CFMA 3TEHB 4CDDC 4LUVA 1D1IA 1YJ9A 1IBML 2KJXA 2PNRC 4NW2A 4JI5Q 1DD2A 1VMCA 1X3EA 1WD0A 4KTAA 5HURA 3KF8B 3J81c 3UDFA 3J81L 1AH9A 2D62A 1O7IA 2R7ZB 2QEJC 2CQOA 1VCIA 3CCVA 4NDXA 2DY7A 5LMNW 3S24A 3DMUA 3T56B 1AE3A 3HOWH 2F52A 1X9NA 1X54A 3GTJB 1FL0A 4JG2A 4JOIC 1K83B 4GOPC 3PIPA 1PH2A 3G4SA 1Q86C 5FLXE 1KAAA 4RHRA 2WB1G 4OIKA 2NTTA 3TP7A 5IIFA 2EYMA 3IKJA 1ET9A 2DNCA 3DWAA 2F0FA 2C5CA 4C3HH 4B3TQ 2ZTDA 1KLUD 2DNEA 2FMCA 2LSSA 4OHJA 5M3MH 4OEMB 4C3HB 3RUZA 2Z4HA 3KF6A 1I3QH 2K6AA 4OGQC 3MEHA 1XNRQ 1X3QA 2A6EC 1PFSA 4BY7G 5KNDA 1GUNA 1ZYRD 3E5SA 2QDLA 2SEBD 2F4VQ 4K8IA 3P20A 3M85A 3CCLA 2XWBB 1PFNA 2A73B 1L1OB 1Y14B 3K8AA 1RF2D 3U50C 3I4LA 1VQ4A 4JI8Q 1KL9A 1BR9A 3AB9A 2HQEA 1ENFA 2XRSD 1VQ5A 1RTOA 1N33L 4F7XA 4IUUA 1I4GA 3NUCA 1KRTA 4KK7A 5DEHA 2L4NA 2K01A 3OPOA 3NSWA 1NMGA 3JC66 2F3VA 1JICA 1QUQB 2HIXA 1RHPA 4YY3L 3LX0A 3ONAB 2V4DA 1OXVA 1TWHH 3CCUA 4LF5Q 2HT1A 4HIOA 3FVQA 3DWPA 3BDOA 5FO8B 3HOXG 4B3TL 2JEBI 3KF8A 4K2KA 1Z7TA 3ER0A 2Q2TA 4GS3A 2WP8J 1KLGD 4IPHA 1PVOA 4KHVA 1I6HB 4A3IB 1SE2A 2BOSA 2EYHA 2YV5A 1NR2A 3FPUB 1EEFD 4JI6L 1QILA 1Y8PB 2FJ2A 4JVZA 2F0QA 2PW5A 1XX8A 3QWNA 1HQMC 1YJNA 2A19A 2KCMA 1CFMA 1BDOA 2MGSA 3D8GA 2Y0SB 1EZ8A 3BDLA 3NBHB 4RCNA 1MI2A 4RKBA 4GLVB 4A3IH 1M90C 3GTPH 3VR2A 2L0CA 3G48A 3VA7A 1Q8IA 2NVXH 2OTJA 3ND9A 5M3MB 2NTSA 4TRDA 3J7AF 2VZAA 5CBAE 4J8QA 2D0PA 3SDZA 2ZJQA 1PTOC 1TWGH 1AN8A 1UAPA 1TWHB 3R2IA 4K8JA 3GTQH 4K14A 4JK1C 1T5XD 1PH6A 4IALA 3A74A 2Q8IB 4EQ5A 4DV4L 2XNAC 3I72A 4RAUC 3CRKC 5LHY1 3NBHA 3TS2A 3ZJYC 2I5HA 3OTOL 4QUFA 4CDCC 2NN6I 4A3EG 1MIUA 1ONLA 1X3FA 4R4IA 4XYOA 1K8MA 1LT4D 1P8LA 1JOKA 1SMYC 3E9IA 1QB5D 4DAMA 1B1ZA 3PO3B 1AZPA 4FXDA 3S2HB 1RTNA 3GTGB 1SNPA 4L63B 2AHOB 2AQ2B 4XTCS 1Z9FA 2J0TD 4GN5A 3WOFA 5J1ZA 4BBSG 3WDNA 1WCMB 3KLWA 2EPBA 4DR5Q 4JI4Q 1GO3E 3NQTA 1TKWB 3K0XA 1EY0A 1YEZA 1O7ZA 3ZYYX 3AEVA 4GKKL 4DR2Q 5C4JH 1EUJA 1I50B 1Z6HA 1ASYA 5JJKA 1UWVA 4PMCA 1R9TH 3CHBD 1AW7A 4DV1L 3UDIA 5FLMH 3MXPA 3OW7A 1Y1WB 4A3FB 3D3RA 1GOZA 5JJZA 1WTVA 1JWSD 5C3EB 1Q90A 4A75A 4HCEA 4LF6Q 2VY3A 1FJGL 3CMAA 4X3SA 3GV6A 4KKUA 1EYCA 2OEOA 2E75C 4ZKCB 2K5NA 2KHIA 2KUMA 1PZID 2CCZA 1ZEQX 5M5YH 3H94A 2E2HB 1NY4A 3KJPA 1IW7C 1HHVA 3TS0A 4B08A 3PIO3 5JEAG 2KHJA 2L15A 2KEEA 5I2XA 1CKMA 2EIFA 4YCWA 1EY7A 3MXUA 1X6OA 2B3GA 3D6CA 1VS0A 1H9RA 5C5MA 3HG9A 4H44C 2Q2HA 4JI0L 2EXDA 3A0JA 3L0OA 4AQYL 4HIDA 2B8GA 5IGBA 5EPKA 3SVMA 4RG1A 3MXNB 4CJ0B 1A3UA 3RR5A 4A3BB 4P72A 3N6RA 4L5SA 1K8OA 4X3KA 4BBRG 5C5LA 5I2YA 1CI3M 4A4IA 1JR0D 2E8GA 1YITA 2UUAQ 1TR5A 2E5LQ 2JA8B 3T1HL 1XXGA 3DHQA 3H0GB 1UE5A 4IO9A 2QEXA 1WD1A 2PI2E 4A3GB 4X6AH 1DOMA 2ZXRA 1XNQQ 3VR5A 2JA9A 1CA6A 5GQOA 2E2JB 3H3VH 4LFBQ 1EWHA 4ZK9B 4FXGC 1VQNA 2SNSA 1F9RA 5JEAH 3A8KE 5JJIA 5EBDA 4KY7A 5CGKA 1EU3A 5NUCA 2OTLA 5D65A 4ZAIA 4BY1G 3A8IE 4A3MB 5C0XI 4DV1Q 1EU4A 1PRTF 1F2MA 3P7JA 3S2DB 1FR3A 4DR7L 1VQ7A 4B3ML 1MJCA 4A3MH 4JI7Q 5IT9L 1GHKA 3W2DA 5IP9H 2OQKA 4A93G 3DEPA 1W6KA 2WAQG 1EY4A 3GTKB 4DNIA 3HP3A 2KVMA 1LABA 3GTJH 1WTXA 1QNUA 1Y1WG 1MHWC 2MPMA 1Q82C 1PZJD 1TWAH 2YU9H 1I4HA 1F2ZA 2CH4A 2UUAL 2F0JA 1X3PA 4JI8L 1HFGA 2BCOA 3GTMB 2PCFB 1PTOB 2R7ZH 4ILWA 1SR3A 3K58A 1I6VC 2E76C 1WCMG 3CXCA 2HQLA 2NVTH 1Q1EA 2P5ZX 1Y69U 5EKLA 2LKVA 3HKZE 3HOUG 1QZHA 3M7GA 3KLRA 1CKNB 1IBKQ 1VQLA 1RDPD 3WWVA 3OIQA 2YTXA 1PLFA 1PRTC 1NCVA 1XMOQ 4A3EB 3HFZB 3GDEA 2UXBL 4GN4B 2Q2IA 4HMIA 4DV2Q 1B4OA 1L0YB 1B3QA 1J5EL 3A5ZB 4JI1Q 4DV7L 4C3JH 4MTKA 3I3CA 3KJOA 1BCPF 2F0UA 2K28A 1WTPA 4R9WA 2WAQB 3T1HQ 1JMCA 4TKOB 4DAVA 4DUYQ 4K5VA 2IJ0A 1RODA 1TS4A 3MTSA 4EVOA 3ULPA 3FKIG 1PRTD 2PZUA 5BR8Q 5M5YB 5EKKA 1HR0Q 5KNBA 4A3JH 3QOLA 1VQHA 4IPGA 2XVSA 2F0HA 3S15B 2B63G 3D6WA 2RDHA 1VQFA 2RSOA 4J6HA 1BUVT 4DR4Q 1HTLD 1YNJC 1N32L 1QWYA 5FO7B 4AYBB 2NBFA 4L8JA 4QIWE 4FXKC 3C2PA 5CV9A 3VDYA 1YZ6A 1VQEA 2LXJA 1A3VA 4HIMA 2VQFL 4LF9Q 4NXNL 4KHPQ 4CJ1B 1I50H 3NTHA 1XJVA 1SYGA 3V05A 4U673 1K73C 3S16B 3SE0A 3VYSA 2KCCA 4FDBA 2K75A 4I7AA 4S3SA 2NB0A 4RMFA 2KECA 4OIJA 3DEOA 1ZYRC 4A3CG 4ZLTF 1G6PA 4MNOA 1UUPA 5I9OA 5FJ8G 5CV4A 4IUVA 5DM63 4DV3Q 1R4QB 4Y7NH 2JA7G 2VW9A 4X64Q 1E2ZA 5K5PA 3A8JE 2BA1A 3D4RA 3NE5B 2JE6I 4UDUC 1VDZA 4HJ9A 1TY2A 5ELEA 5CV6A 1TWAB 3EFXD 3HZXA 1S72A 3CC2A 2R92H 5I9PA 2QCPX 2E2IH 4HSVA 1CKOA 1HUMA 3NENA 1YI2A 5FO9B 1EIYB 3HOYH 1O7LA 2F0WA 2K33A 3KYHC 5F2DA 3HRZC 2R93H 1N8RC 4ODGA 3PUVA 5T1GA 4A3JG 3S2DH 4XQQA 2B39A 1YHQA 2RF4A 1MGSA 3D31A 4P75A 2VQFQ 4LF9L 1H9KA 3J81E 1EY5A 3PUXA 1SE4A 4GN3B 2NVYH 5KEEA 4GNXB 4A3DH 4OO1G 1JT8A 3HKSA 3CCQA 4LF6L 3J81i 5M5XH 3S1RB 1FYCA 4RGTA 2WKCA 2FINB 2MO1A 1B9MA 3PF5A 5JPMC 5TSSA 4N8FA 2I46A 1V9PA 4RA8A 4DR1Q 4A3GH 4NKLA 1FVIA 3H0GH 2JA6H 4X3TA 4B3SL 4U68A 2EVBA 3CCEA 4BY7H 1FNWA 4L6TB 1EZ6A 3V96A 2K1BA 3G6EA 3BYTB 2WFWA 1D5MC 4IN3A 2B2TC 2RA4A 3NXWA 4YCUA 2E2DC 3MVVA 4A3MG 2Y0SE 3K59A 4JI2L 4BY1B 1YNXA 2UXCQ 2GVAA 2ICEC 5FJ8H 4DK1A 4G7ZC 2OWOA 3F1ZA 1TWFB 4KY6A 4ZRZA 3QJYA 3UDXA 5M3FB 2JA8G 1UE7A 1SBBB 4DNRB 4ZQ3A 3PO3G 5E7NA 4LF5L 4OONA 4XXEA 2XN9C 3PIOA 4BXXG 4PNYA 3VR6A 3BZCA 4ME3A 2RDGA 5IGCA 3U4ZA 4G4KA 4IURA 2TSSA 5G3LD 3I90A 5CORA 4ALPA 2Q8TA 2D5DA 1D6EC 4LW1A 3B6YA 1EYDA 2E5LL 3M3YH 3M4OB 4DR3L 1Y8OB 4X64L 2VNUD 3BJUA 4DK3C 2JA5B 4GLAC 1JB3A 2RCFA 5C4XG 1VF7A 4PQXA 5KYLA 4PZ8A 2E2HH 1L1OC 3J7A5 1U5KA 3C46A 2VUMB 3M4PA 2IX3A 2Z6KA 4A3BG 2K5WA 1C9OA 2MUYA 2D2CC 4WJ4A 4CDEC 1GJXA 2PMZE 3CQZH 1I4RA 3U9SA 2RDFA 2F0DA 4DR1L 2CKZB 4C2MB 2SNMA 3JAMc 2B2YA 2CWAA 4DUZL 1I3QB 4G7OC 4HCSA 4CGYB 1H9SB 4UP9A 3JAML 1VQJA 3FRPB 5ELOA 1BKBA 3NQIA 3W1BA 2WKDA 3IFTA 2XIWA 3K57A 4FO2A 5IE8A 1LO5D 3L7ZC 3V2TA 4B3MQ 1U0LA 3F2DA 2UUCL 1TY0A 1CTMA 1G91A 1ET6A 1YBYA 3WOEA 2QKIC 4K5WA 2EJMA 4GOPA 3S1MB 1ENAA 1VQBA 2NN6H 4R4TA 5C4XH 2K05A 4A3FG 4P74A 3CC4A 3KDFB 1XPRA 1DXMA 1JC7A 3S1QB 3NWSA 2EOTA 2DN8A 1STNA 4L5QA 1I4QA 2KCTA 4JOIA 4BA2I 3KFUA 3I4OA 1K83H 5AFWA 1V1QA 2NZHA 4K2LA 1D1KA 1XPOA 2FXQA 1SJED 2DY8A 2H5XA 4L5RC 1WTRA 2K50A 1O78A 2VB3X 2GA4B 1JCKB 5E3FA 4DNTB 3ERQA 1MSGA 5IP7H 2B2UC 1RJTA 5JOBA 2L12A 3HEJA 1AFPA 1S5BD 1TS2A 4JI2Q 1IL8A 2KBNA 1X55A 1JB7A 4K5XA 4OELB 4ULLA 2L55A 4KN7C 3EA6A 5L37A 4POFA 1FNUA 2I07B 1XMOL 2JYOA 4RCOA 4DU9A 2MFIA 3HOVB 1BBUA 4YCVA 4X65Q 3IAYA 2Z1CA 3W3AA 2F0SA 3RZDH 4V0BA 4DXGA 2PW7A 4JPBW 4CBVA 1VF5C 2NZ1D 1BBWA 4Q5VA 1PA6A 2B2WA 3ICEA 3TDQA 4LFAL 1XNRL 5C44B 3RN5A 4JBMA 1HR0L 5JVH3 4A93B 5FLMG 2UU9L 1HNWQ 4DV5Q 2XTIA 1RL2A 1Y1VH 2CW0C 3DXJC 3S14H 2K14A 3GTOH 1TS5A 3PO2G 4WFN3 3A56A 1CZWA 4R4OA 2ZT9C 1BCPB 4X3UA 3H3VI 1HTPA 1NR4A 2EDGA 2Q8RE 3TN2A 1J8IA 3H3VC 2CWPA 1SROA 1A15A 1A8VA 1QCBD 2DUDA 2A69C 3T51B 3CMEA 2VS1A 3PIP3 1KNEA 1XMQL 2ATWA 1A6XA 4P2CB 2EYPA 2F0GA 3X3MA 2JQOA 3OWFA 1HZAA 2M00A 3K5NA 2K5DA 4JCVE 1ZKOA 1HH2P 2LS01 1AEXA 3W1GA 2A6ED 5CV5A 1I4XA 4IUPA 3BU2A 3I4NG 5IYCG 1LT5D 2AQ3B 4IUNA 4HJAA 2VQEQ 2PO4A 1DYQA 3VYUA 1KD1C 3K80C 2QDBA 4ZYSA 3O13A 1VQAA 2CQAA 2GN5A 2LY7A 4LAAA 1SYFA 5IWAL 5G3LF 1NSNS 2Z4IA 4LFAQ 4FF2A 4O1NA 1X56A 2C9OA 2UU9Q 3C1FA 2UXDL 1Q81C 4QIWB 2EQSA 2JXMB 2EE1A 1Q8KA 4I7ZC 5I4DA 3TP6A 1SJHD 3H6MA 4YWLA 3EQLC 1RKNA 3E3XA 4DR7Q 4ABNA 4Y52H 1EL0A 4BBRH 1I94Q 3PMFA 4MTNA 5C3WA 2PQAB 3I4MH 1EY6A 4PG3A 5HGTA 2SOBA 1TU2B 1STBA 4H13C 3KLSX 1IBMQ 2H4OA 4I65A 2KOLA 3GD7A 4BWGB 2NN6G 3RZOH 2A68D 1YHAA 4QF4A 4DV6L 1EIFA 3U9OA 1TT2A 5EQ0A 5EPJA 2N88A 5JVG3 2N55A 2X6GA 1HNXQ 3QO2A 2O5IC 4KD3A 3SK6A 3F8TA 1IKLA 3OWEB 3FHWA 4PMBA 1E2WA 3GV3A 2WACA 2HHHL 2RHSB 1U4PA 4E6IA 2OT2A 1I4PA 2I0QA 1C4QA 3URYA 2R61A 4DPGA 1IBKL 1SNDA 1VQKA 2K04A 5IOCA 2D9UA 2PNHA 3CCRA 5COYA 3NELA 5CV8A 4KJNA 1Q46A 3QR8A 1HPCA 3K0YA 2G9HD 5M5WB 1N34Q 4IFDI 3IL8A 4M1UB 3TP8A 5IY0A 2YTYA 2D0OA 3PO2B 5LMNQ 4POGA 1HNZQ 5D3DA 1TXYA 4TQUS 3AQQA 2B29A 4RGNA 1CSQA 2BA0A 3CAMA 5C44G 4DA2A 1SNQA 2JP1A 1AP0A 1MBYA 1TVXA 2N8NA 2RVLA 1BOSA 1SAPA 3F2UA 4AYBE 4UP7A 4YWKA 2VXWA 1O7YA 5IGGA 1B2TA 1K8GA 3MXGA 3BZDB 4DV6Q 1U4RA 1NE3A 5C6AA 3K7UC 4NXML 1CZGA 3HOUH 2XSCA 1ICFB 2MO0A 4QCLA 1E2VA 2Z0SA 1PH7A 1H9JA 5JJLA 3K7AH 3J80E 4KV6A 1Q1BA 2PMZB 4JBJA 1VQIA 2R3ZA 3I8ZA 5GROA 1K0SA 4XT3B 2ZM6L 5IGEA 4FF3A 4A3IG 1ENCA 3GTLH 2NVQB 4APVA 1PHJA 4DKAC 2PQAA 3QIAA 1VQMA 4JBKA 3DM3A 4K0KL 4V190 1STAA 3MC0B 5EKIA 4IZ8A 4ZCKA 5D3IB 1ESFA 4LJZC 1YNND 3LWUA 1BXTA 3BVGA 2EYLA 4KI0A 4DV3L 2Z8LA 1RCVD 3MFGA 1WJJA 4GLXA 3ULLA 4A3KB 4DAYA 4B9XA 5A2QL 1DOLA 1TWCB 4BY1H 1P16A 4DFAA 4QQBX 1BVSA 3HOXB 1OTCA 1SMXA 4GNXA 3NK9A 1TQOA 1RIPA 1KTKA 2JA6B 3MWYW 4MN3A 5IODA 2JK8A 1N36Q 5I6YA 1G8ZD 5EAYA 4A93H 4DR6Q 2B2TA 1N9WA 5EBCA 4PV1C 3EBEA 3HOZH 1AZQA 2TMPA 3FDTA 2PYKA 1N34L 4BBSH 4X65L 1G2SA 4OWWB 4LUOA 4A3DB 1EYAA 3BZKA 4RFBA 3T53B 3S9WA 1IL2A 2NVYB 1DGSA 3RZDB 3RLFA 4DAYB 1LTID 1MJEA 3R93A 2K7VA 4LF7L 3OMGA 4DK6C 4DV0L 1UE6A 3FMCA 4J15A 2VUMG 3TP5A 3J7ZC 3PGZA 2QW7A 1W6JA 4QMGA 3IRBA 1CQVA 1RD9D 3J7YW 2RHQB 1IBLL 3CPWA 2F3WA 4DV4Q 1S5CD 1F9PA 3I4NB 1VMPA 2HD3A 4O0AA 4NB3A 3Q0AA 2MHVA 3LWEA 3OTOQ 4C1NI 5I6WA 2Z6BA 1WTOA 5GAEC 4HTHA 3D4WA 1QVCA 5IGDA 2ES2A 3A5UA 3EJIA 1G6ZA 1SFOB 1N36L 4Y7NB 2B8FA 3NP8A 2ICIA 1SYBA 2R7ZG 5C0XG 3D0FA 4JBWA 3QG1A 3NWTA 1QOHA 2QA4A 1D8LA 4KLKA 2R93G 1FNVA 2R7DA 1JOQA 3FKIB 3ND8A 2UXBQ 1IYJB 4DV2L 2VQEL 4TVAB 4O2DA 3RLOA 1K9MC 3AMUA 2YYZA 4GOPB 5CYUA 1IKMA 2XRQD 4RHSA 2L5TA 1SYDA 1QVGA 3P1HA 1GUOA 3KDFA 5LL6S 1VQGA 3H91A 3ERSX 4A3JB 2OF1A 4R4CA 1LTAD 1VQ9A 2JA6G 4UP8A 1DJRD 4IFDG 4HN7A 3CKIB 3FEWX 3RMHA 1FD7D 2QGQA 2BDOA 4QB4A 3A7LA 2A69D 3T4AC 1SMYD 4GKKQ 1LM0A 3SK4A 2JA5H 4XQJA 2L1BA 2ALYB 4XT1B 1YNJD 1E24A 3I56A 3S17H 1IW7D 5T1IA 2F0MA 1K3BC 2F0LA 2Z9HA 4NXNQ 4KHPL 4JI0Q 3FKIH 1QZGA 4BBSB 2CW0D 1W3SA 2G9DA 4IQZA 5IYBH 1CKNA 5ELDA 4DK0A 1A2TA 5IP9G 4UPAA 3E9HA 4H0LC 2RCNA 1TWFH 1UEAB 5E4WC 2B2WC 3KOJA 1EQTA 3GQBA 1EIHA 2LXKA 1J9OA 3PF4A 1VQ6A 1PH3A 4OX9L 1YIJA 1GHJA 3OSOA 2EY6A 3CCMA 2J7ZA 3CP0A 1EY9A 1XTCD 1L2FA 3NEMA 4HSPA 3NTIA 3I4NH 1SYCA 2N3SA 3JAMi 4IPDA 1HCZA 1IHZA 3BG3A 1GKHA 4HJ5A 3TREA 1KAWA 4LFCL 3CRLC 3BDCA 4AH6A 1PYBA 3GTKH 4IUTA 2AUKA 1B3AA 3S17B 2B63B 1ZXTA 4XDXA 1U9RA 3GTLB 2L11A 3CW2C 1KDAA 3TZUA 4C1NK 5DLQE 4N8X1 3RLNA 4PZ7A 1GUGA 1STGA 5LMUQ 1B9NA 2KCNA 2OCEA 2R93B 1JE5A 1V1PB 2RSNA 4YHHQ 5C0XJ 2EYJA 1HQRD 5D14A 2IW3A 4KJOA 2F03A 5GAHC 1F9SA 2PZTA 4B3RL 1UE1A 2F0NA 5ISRA 1EWIA 2NUCA 4KMUC 2AKWB 3Q6SA 2HDLA 1HJPA 1BCPD 3QB3A 3MZ5A 2B2VC 3E0JA 5EGTA 4F8MA 1PFBA 5IP7G 5C4HA 3J80i 4RWSC 3MA2B 1VQ8A 5HY6A 5KYIA 1LTRD 4DGZA 1HXYD 4GKJQ 4WRDA 1HUNA 4KD4A 2JA8H 3VYRA 5IT9E 1PZKD 4B9WA 4NMZA 4LF4Q 3PO2H 1LTSD 2F4IA 1C48A 1X32A 1BCPC 4BXXH 4RH6A 5JAVA 1WI5A 2BDNA 4UAIA 3EVQA 2FFKB 1LYLA 3NTKA 3G6JB 1E22A 2EYOA 3Q24A 3OHXC 1E1OA 3S16H 3HS0C 3PUZA 4UY8C 1HFNA 1BF4A 2HUGA 2NWGA 2Z6KC 2R7FA 4PZ6A 1G51A 1B8AA 2NVQH 1XWEA 2AWNA 2KENA 1KQSA 2AQ1B 1M1KC 4IOCA 1EQVA 4C3HG 1KABA 4DR3Q 3E6ZX 2WIIB 4RGMA 5K36G 4YHHL 1J6QA 1XYIA 2B2YC 1K3RA 4A3KG 3C3LA 5ELBA 1DOKA 1LUZA 2M2LA 5IWAQ 3W5OA 2F0KA 4JV5Q 1EQQA 1IYUA 3KK7A 1S4ZA 1SNCA 1BNZA 1SNOA 1II3A 1EIGA 5C44H 3X3NA 3RN2A 4EQPA 1SDFA 3KBXA 3STBD 5BN5A 3J81j 4LUZA 3OMCA 3HOYG 5ELCA 2QILA 4LWCA 4IFDH 3M4YA 4DXFA 3K5LA 4A3FH 1Y1WH 1DM0B 3IFDA 5J22A 4C3JB 3VA5A 1QG7A 3M7NA 1M8AA 1EYGA 3K6OA 4L5TA 1SSOA 1B53A 2OQ0A 5CR3A 2J4XA 3HOZB 3MEFA 4EX5A 5C4JB 1SEBD 4EQOA 5M9OA 2K5QA 4HIKA 5C4ZA 3L3OC 2RKSA 1LV9A 4IJHA 3C1EA 3AU7A 3M9BA 3Q8DA 2GVBA 4DAPA 3I4MG 5A2QE 2WAQE 1CHQD 4C3IH 1PH9A 1GUWA 2F1MA 3HOXH 1H9SA 4XYQA 3R3OA 2C35B 1UNSA 4Z9CB 2ENBA 4QJFA 1EQRA 2UUBL 2E74C 1HNXL 2HDMA 1OO9B 4J1MA 4YIJA 1CK1A 5EJWA 3AFQA 1XNQL 4JI3Q 4QY7A 4LF8Q 4IUQA 1F2YA 3L9AX 2YU9B 4LF4L 1LT3D 5IYBG 1U4LA 4HMJA 2XWJB 3RZOB 1WYDA 2K03A 5IYDH 1YHBA 1GUTA 2PI2A 3H09A 3TZDA 1HNZL 3GTQB 1BO0A 5KGUA 3I4MB 5C3XA 2B2VA 2EXZA 3KBGA 1STHA 2K5HA 3F2BA 1D2BA 5DM73 4OO1I 4P71A 1VQPA 1NAPA 2A8VA 3GTPB 3N52A 2JJQA 2Q2UA 3VR4A 3S14B 2E2JH 1Y1VB 2IPKD 1S5DD 1PYSB 2HIVA 1W2BA 3MFYA 2MNAA 2JSOA 4KHZA 1BBXC 4LFBL 2F0IA 3GP7A 2IT1A 3KUPA 4B3SQ 3UDGA 1YVCA 2V1CC 2FMMA 4FP5D 4WJ3M 3CPFA 1Z47A 4QL5A 2BH2A 1ASZA 3T16A 1QNKA 3F2CA 2IX1A 4A3LH 2F0OA 3A7AB 4HR7B 4K6DA 4ID6A 2B63H 3PQIA 2PQEA 3AFPA 5M5WH 3HOVH 2K52A 2HCIA 3U4VA 3L2PA 3I73A 1PH4A 5CC4A 3CC7A 1H9MA 1Y1VG 1J5EQ 4ZUJA 1EY8A 1BQQT 1PH5A 1VQCA 1CA5A 2X69A 1Y8NB 1EFID 4CHTB 1WTHA 2PPBC 3TRZA 3I2ZA 4GNXC 3SK8A 3J80L 2K4KA 1HR0W 1QJOA 4C3IB 5CBEE 3E0EA 1D5ZC 1PRTB 2H1EA 5EPLA 2IL8A 4HEDA 3GTOB 2RQXA 1WTWA 1K28A 4A3LG 4LF8L 5J39A 1A0IA 3SK5A 1O80A 2RBMA 1K0RA 2L9HA 3CCSA 2WB1B 4EGVA 4LFCQ 5FK9C 1QVFA 2M9VA 4O42A 1KIXA 4DUZQ 2CVRA 1X65A 4DR2L 1SE3A 3UE1A 5C4XB 2Y0SG 4F87A 2ZJRA 3HGBA 1TIID 3K5MA 3PUYA 4JI1L 4X62L 4DV7Q 4OWXB 1JORA 1CQFA 1G291 1XPUA 1LTLA 4P73A 2F0PA 2UUCQ 2KHSA 2A5HA 3G71A 1JOOA 2DGYA 4A3GG 1NJIC 5GADC 3H0GG 2YTVA 1KHIA 4KKSA 1EEID 1IBLQ 2WV6D 3BYYB 1YNNC 2G5DA 2ID0A 1WFQA 2ZTCA 3HOYB 1KDBA 1S5ED 3MXNA 4A76A 2F4VL 1NBWA 2DJFC 1MD2D 1V43A 2AWOA 1T5EA 3GTGH 1HZBA 1NTGA 1B7YB 2VUMH 4CJ2C 1JQYD 4OO1H 1F2LA 3S2HH 1SN8A 3PO3H 2PZWA 4GKJL 2BH8A 1S3OA 2EYFA 2N49A 4OL7A 1N32Q 1PYWD 2BE5D 4C3IG 1DCZA 1OXSC 1R4PB 4C56C 1ICWA 4IPCA 1OXXK 4AQYQ 1EFWA 4JYAL 4YY3Q 5HGQA 5DAUA 5ELFA 1WOCA 1E3PA 4JC0A 1IYVA 1VQDA 1LLRD 1KRSA 1JJGA 1NUCA 4NPSA 1TWGB 3TSSA 3S1MH 4X66Q 2DJGC 5IYDG 1X3GA 3EN2A 1ILQA 1GUSA 1E7ZA 4KY5A 1C0AA 1FGUA 2NVXB 1ESRA 2VL6A 4G7HC 1GVPA 3KLSA 1EWCA 1A62A 1TS3A 4NP5A 3SHLA 3CF5A 2WINB 5IT9c 3EROA 1KC8C 4HJ8A 1B50A 3S15H 1Q3LA 4JI6Q 1HZ9A 3CQZB 1QUQA 3S1RH 1PDQA 2K5VA 5BN4A 1UEBA 3HKZB 5JPNC 1CM9A 2AMCB 4X62Q 1CSPA 1V1OA 1E0BA 1OXUA 3M3YB 2WB1E 3BVZA 4JYAQ 5KNCA 4CKBA 4AYBG 3NHHA 4RGOS 4G57A 4HJ7A 4LMQD 2A68C 4A3EH 1DONA 1SRUA 3BS1A 2ZXPA 4KKTA 5KIXA 1SNMA 1SXTA 2O5JC 1JE4A 1HNWL 3M4QA 4XQNA 4RKLA 4OX9Q 2FHTA 5J3BA 2A6HC 4ME5A 3P75A 4AIMA 2R92G 4BA1I 1ILPA 1TWCH 4QGUA 4H7BA 3CCJA 2JA5G 1PTOH 4JI3L 3OYYA 2UXDQ 4CKEA 4R4QA 4DN4M 1AE2A 4FF4A 2ZTEA 4OWTB 3SR1A 5BN3A 1C8CA 3S1NH 2ZXOA 3S1QH 4LK1C 1FGBD 2I5MX 3NBIA 3VR3A 4DR6L 5M5XB 3RNUA 4DF7A 5DNFA 1PXUA 1U4MA 2X6LA 1KXLA 2O4XA 4DR5L 4JI4L 5FLXL 1LT6D 3Q23A 4X66L 1I94L 3H15A 3HOZG 2VB2X 3DLLA 1PV4A 2JEAI 2K32A 5AJ3L 3GO5A 4CDFC 1JWUD 3K7AB 4TSSA 5LMUL 3LGJA 1LACA 4C2MH 5A35A 2F0TA 5M3FG 3HOUB 1HA6A 3FP9A 2EY5A 1FJGQ 1SLJA 2EY2A 4IOAA 4K6LA 4C3JG 1PTOD 5IGFA 4FVMA 3OOCA 4WJWA 3CU7A 1KDCA 2ZJPA 3HOWB 2MP1A 3SGIA 3M4OH 2MJ8A 1SE8A 2I5LX 2KA7A 1F77A 3STBC 1DZ1A 2O2LD 3K5OA 1WVLA 5E4XA 2JN4A 3TQYA 4A3BH 1Q12A 1H95A 5FKAC 5M3FH 1HA5A 3I55A 3QOJA 1A63A 3PCOB 5E1FA 1SFOH 5LMNL 3HOWG 2CHBD 2ASBA 3DUZA 4R8IA 2NVTB 2F0VA 3RD4A 5AJ3Q 1E1TA 3A55A 4IFDJ 4BS9A 1KNAA 4BY7B 3TBIB 4M8AA 3T1YQ 2EJGC 2F3IA 3J7AV 3GTMH 1CHPD 3PSIA 1LTTD 4YWMA 4R1JA 1IZ6A 1M4VA 5JEAJ 4F88A 5IYCH 3UI2A 1STEA 4DV5L 4MIUA 4Q0FA 4CKCA 1PFMA 1PMRA 3J80c 3CD6A 2IHEA 1V8QA 1STYA 1Q7YC 1CT1D 1CUKA 4JV5L 3NPPA 3ITPA 1PH1A 1A2UA 2EY1A 4EQNA 2XGTA 2EZVA 1GM5A 1B70B 2SDFA 1L0XB 3ULJA 5FLXc 2IY5B 3AYHB 2N78A 2B2UA 1JJ2A 2JA7B 1LTBD 3BVMA 2BE5C 1B44D 4KN4C 2ZM6Q 1PH8A 4JI7L 1HRJA 1C7YA 2EJFC 4BBRB 1PTOF 4K0KQ 3TMEA 1K8AC 3I7FA 5K36H 1D7QA 1WTQA 1V1PA 2A1AA 2KEDA 2OXPA 1EOTA 4A3DG 5KRUA 1S5FD 3G7LA 2NZOA 1WCMH 1T9HA 2E2IB 3S1NB 1GD7A 2R92B 1G2TA 3A54A 1SYEA 3PUWA 4NXMQ 3DWQA 2A74C 2UUBQ 1HZCA 2QF7A 3T1YL 3HOVG 4HAEA 3T13A 3U58A 3UE0A 4A3KH 2UXCL 3JAME 1D5XC 1MKHA 3VYTA 1GXDC 1MSHA 1XMQQ 4IJLA 3EIVA 2NYZD 5LL6X 3R2TA 4PMWA 3I91A 1I5FA 1VQOA 4LNQA 2IX0A 3D4DA 1OXTA 4N9TA 3DM1A 5C3EG 5C0XH 2KQ3A 1L1OA 2F0EA 1L0WA 2MQHA 2R6GA 4XIGS 5H1SE 4JI5L 3HKZG 5GAGC 3SEBA 1YJWA 3R8BA 4DUYL 4LF7Q 5ELNA 4FYDA 4MZ9A 2IHFA 2A6HD 2JA7H 4JW0A 1EOVA 3KF6B 5BR8L 3PV0A 3SXHA 1LTGD 4MHEA 1A3TA 4A3CH 3OIPA 3MHBA 4B3RQ 4UHVA 1F9QA 5CV7A 3I70A 5CMDA
chains in the Genus database with same CATH topology
3MAQA 2HCCA 2IWHA 4WORA 4R8NA 1JWMD 4GZYC 5FOBB 3Q22A 4ZKBB 3FPPA 1QE6A 2LMCB 1R9TB 1ML0D 4FF1A 2AUJD 4QUCA 2LFNA 3LNNA 4FNFA 4N9PA 4ZUIA 1D1IA 2KJXA 2PNRC 4NW2A 1DD2A 1VMCA 1WD0A 4KTAA 5HURA 3J81L 2D62A 2R7ZB 2QEJC 1VCIA 4NDXA 2DY7A 3DMUA 3T56B 3GTJB 1K83B 5FLXE 1KAAA 4RHRA 4OIKA 2NTTA 3TP7A 5IIFA 2EYMA 3IKJA 1ET9A 2DNCA 3DWAA 2F0FA 2C5CA 1KLUD 2DNEA 2FMCA 4OHJA 4C3HB 3RUZA 2Z4HA 2K6AA 4OGQC 3MEHA 1X3QA 2A6EC 5KNDA 1GUNA 1ZYRD 3E5SA 2SEBD 4K8IA 3P20A 3M85A 2XWBB 1PFNA 2A73B 1RF2D 3I4LA 1BR9A 3AB9A 2HQEA 1ENFA 2XRSD 1RTOA 4F7XA 4IUUA 1I4GA 3NUCA 4KK7A 5DEHA 2L4NA 2K01A 3OPOA 3NSWA 2F3VA 1JICA 1RHPA 3LX0A 3ONAB 2V4DA 1OXVA 3FVQA 3DWPA 3BDOA 5FO8B 2JEBI 3KF8A 4K2KA 1Z7TA 2WP8J 1KLGD 4KHVA 1I6HB 4A3IB 1SE2A 2BOSA 2EYHA 1NR2A 3FPUB 1EEFD 1QILA 1Y8PB 2FJ2A 2F0QA 2PW5A 1XX8A 3QWNA 1HQMC 1CFMA 1BDOA 2MGSA 3D8GA 2Y0SB 1EZ8A 3BDLA 4RCNA 1MI2A 4RKBA 3VR2A 2L0CA 3VA7A 1Q8IA 3ND9A 5M3MB 2NTSA 4TRDA 3J7AF 5CBAE 4J8QA 3SDZA 1PTOC 1AN8A 1UAPA 1TWHB 3R2IA 4K8JA 4K14A 4JK1C 1T5XD 4IALA 2Q8IB 2XNAC 3I72A 4RAUC 3CRKC 5LHY1 3NBHA 4QUFA 2NN6I 1ONLA 4XYOA 1K8MA 1LT4D 1SMYC 1JOKA 3PO3B 1QB5D 4FXDA 1B1ZA 3S2HB 1AZPA 1RTNA 3GTGB 1SNPA 4L63B 2AQ2B 4XTCS 2J0TD 3WOFA 5J1ZA 3WDNA 1WCMB 2EPBA 1TKWB 3ZYYX 3NQTA 1EY0A 1O7ZA 1I50B 1Z6HA 4PMCA 3CHBD 1AW7A 3MXPA 3OW7A 1Y1WB 4A3FB 3D3RA 1GOZA 5JJZA 1WTVA 1JWSD 5C3EB 1Q90A 4HCEA 4X3SA 3GV6A 4KKUA 1EYCA 2OEOA 2E75C 4ZKCB 2KUMA 1PZID 1ZEQX 3H94A 2E2HB 1IW7C 1HHVA 4B08A 3PIO3 5JEAG 2KEEA 5I2XA 1EY7A 3MXUA 3D6CA 1H9RA 5C5MA 3HG9A 4H44C 2B8GA 5IGBA 5EPKA 3SVMA 4CJ0B 1A3UA 4A3BB 3N6RA 1K8OA 4X3KA 5C5LA 5I2YA 1CI3M 1JR0D 1TR5A 2JA8B 1XXGA 3DHQA 3H0GB 1WD1A 4A3GB 1DOMA 2ZXRA 3VR5A 1CA6A 2E2JB 1EWHA 4ZK9B 4FXGC 2SNSA 1F9RA 5JEAH 3A8KE 5EBDA 4KY7A 5CGKA 1EU3A 5NUCA 5D65A 4ZAIA 4A3MB 3A8IE 5C0XI 1EU4A 1F2MA 1PRTF 3P7JA 3S2DB 1FR3A 5IT9L 1GHKA 3W2DA 3DEPA 1W6KA 1EY4A 3GTKB 3HP3A 2KVMA 1LABA 1WTXA 1QNUA 2MPMA 1PZJD 1I4HA 1F2ZA 2F0JA 1X3PA 1HFGA 2BCOA 3GTMB 2PCFB 1PTOB 4ILWA 3K58A 1I6VC 2E76C 1Q1EA 1Y69U 5EKLA 2LKVA 3M7GA 3KLRA 1RDPD 3OIQA 1PLFA 1PRTC 1NCVA 4A3EB 4HMIA 1B4OA 1L0YB 3I3CA 1BCPF 2F0UA 2K28A 1WTPA 4R9WA 2WAQB 4TKOB 4DAVA 4K5VA 2IJ0A 1RODA 1TS4A 3MTSA 4EVOA 1PRTD 2PZUA 5M5YB 5EKKA 5KNBA 3QOLA 2XVSA 2F0HA 3S15B 3D6WA 2RDHA 2RSOA 4J6HA 1BUVT 1HTLD 1YNJC 1QWYA 5FO7B 4AYBB 2NBFA 4L8JA 4FXKC 3C2PA 5CV9A 1A3VA 4CJ1B 3NTHA 1SYGA 3V05A 4U673 3S16B 3SE0A 3VYSA 2KCCA 4S3SA 2NB0A 2KECA 4OIJA 3DEOA 1ZYRC 4ZLTF 1UUPA 5I9OA 5CV4A 4IUVA 5DM63 1R4QB 1E2ZA 5K5PA 3A8JE 2BA1A 3D4RA 3NE5B 2JE6I 4UDUC 1VDZA 1TY2A 5ELEA 5CV6A 1TWAB 3EFXD 3HZXA 5I9PA 2QCPX 4HSVA 1HUMA 5FO9B 1O7LA 2F0WA 2K33A 5F2DA 3HRZC 4ODGA 3PUVA 5T1GA 4XQQA 2B39A 1MGSA 3D31A 1H9KA 3J81E 1EY5A 3PUXA 1SE4A 5KEEA 4OO1G 3S1RB 1FYCA 4RGTA 2WKCA 2FINB 1B9MA 5JPMC 5TSSA 2I46A 4RA8A 4NKLA 4X3TA 4U68A 2EVBA 1FNWA 4L6TB 1EZ6A 3V96A 2K1BA 3BYTB 1D5MC 4IN3A 2B2TC 2RA4A 3NXWA 4BY1B 2E2DC 3MVVA 3K59A 2ICEC 4G7ZC 4DK1A 1TWFB 4KY6A 4ZRZA 3QJYA 5M3FB 1SBBB 4DNRB 4ZQ3A 4XXEA 2XN9C 4PNYA 3VR6A 2RDGA 5IGCA 4G4KA 4IURA 2TSSA 5G3LD 3I90A 5CORA 2Q8TA 2D5DA 1D6EC 1EYDA 3M4OB 1Y8OB 2VNUD 2JA5B 1JB3A 1VF7A 4PQXA 5KYLA 3C46A 2VUMB 2IX3A 2K5WA 2MUYA 2D2CC 1GJXA 1I4RA 3U9SA 2RDFA 2F0DA 4C2MB 2SNMA 2B2YA 1I3QB 4G7OC 4HCSA 4CGYB 1H9SB 3JAML 3FRPB 3NQIA 2WKDA 3IFTA 2XIWA 3K57A 4FO2A 1LO5D 3L7ZC 3V2TA 1TY0A 1CTMA 1G91A 1ET6A 3WOEA 2QKIC 4K5WA 2EJMA 3S1MB 1ENAA 2NN6H 2K05A 3S1QB 1DXMA 1JC7A 3NWSA 2EOTA 2DN8A 1STNA 1I4QA 4BA2I 5AFWA 4K2LA 1D1KA 1SJED 2DY8A 1WTRA 1O78A 2VB3X 2GA4B 1JCKB 5E3FA 4DNTB 3ERQA 1MSGA 2B2UC 1RJTA 5JOBA 2L12A 3HEJA 1AFPA 1S5BD 1TS2A 1IL8A 4K5XA 4ULLA 2L55A 4KN7C 3EA6A 1FNUA 2I07B 2JYOA 4RCOA 4DU9A 3HOVB 3IAYA 2Z1CA 3W3AA 2F0SA 4V0BA 4DXGA 2PW7A 4CBVA 1VF5C 2NZ1D 4Q5VA 2B2WA 3TDQA 5C44B 5JVH3 4A93B 2CW0C 3DXJC 1TS5A 4WFN3 3A56A 1CZWA 2ZT9C 1BCPB 4X3UA 1HTPA 1NR4A 2EDGA 2Q8RE 3TN2A 1J8IA 3H3VC 1A15A 1QCBD 2A69C 3T51B 3PIP3 1KNEA 1A6XA 4P2CB 2EYPA 2F0GA 3X3MA 3OWFA 2M00A 3K5NA 2K5DA 1ZKOA 2LS01 1AEXA 2A6ED 5CV5A 1I4XA 4IUPA 1LT5D 2AQ3B 4IUNA 2PO4A 1DYQA 3VYUA 2QDBA 4ZYSA 3O13A 2CQAA 2LY7A 4LAAA 1SYFA 5G3LF 1NSNS 2Z4IA 4FF2A 4O1NA 2C9OA 3C1FA 4QIWB 2JXMB 2EE1A 4I7ZC 5I4DA 3TP6A 1SJHD 3H6MA 3EQLC 1RKNA 4ABNA 1EL0A 3PMFA 5C3WA 1EY6A 5HGTA 2SOBA 1TU2B 1STBA 4H13C 3KLSX 2H4OA 4I65A 2KOLA 3GD7A 4BWGB 2NN6G 2A68D 4QF4A 3U9OA 1TT2A 5EQ0A 5EPJA 2N88A 5JVG3 2N55A 2X6GA 3QO2A 2O5IC 4KD3A 3SK6A 1IKLA 3OWEB 4PMBA 1E2WA 3GV3A 2WACA 1U4PA 4E6IA 2OT2A 1I4PA 1C4QA 3URYA 2R61A 1SNDA 2K04A 5IOCA 2D9UA 5COYA 5CV8A 4KJNA 1HPCA 3K0YA 5M5WB 2G9HD 4IFDI 3IL8A 4M1UB 3TP8A 3PO2B 5D3DA 4TQUS 4RGNA 2BA0A 4DA2A 1SNQA 2JP1A 1AP0A 1MBYA 1TVXA 2RVLA 1BOSA 1SAPA 3F2UA 2VXWA 1O7YA 5IGGA 1B2TA 3MXGA 3BZDB 1U4RA 5C6AA 1CZGA 2XSCA 4QCLA 1E2VA 1H9JA 3J80E 4KV6A 1Q1BA 2PMZB 2R3ZA 3I8ZA 4XT3B 5IGEA 4FF3A 1ENCA 2NVQB 3QIAA 4V190 1STAA 3MC0B 5EKIA 4IZ8A 5D3IB 1ESFA 4LJZC 1YNND 3LWUA 1BXTA 3BVGA 2EYLA 4KI0A 2Z8LA 1RCVD 3MFGA 4A3KB 4DAYA 4B9XA 5A2QL 1DOLA 1TWCB 4DFAA 3HOXB 3NK9A 1TQOA 1KTKA 2JA6B 3MWYW 4MN3A 5IODA 5I6YA 1G8ZD 2B2TA 5EBCA 4PV1C 1AZQA 2TMPA 3FDTA 2PYKA 1G2SA 4A3DB 1EYAA 4RFBA 3T53B 3S9WA 2NVYB 3RZDB 3RLFA 1LTID 3R93A 2K7VA 3OMGA 3FMCA 3TP5A 1W6JA 4QMGA 1CQVA 1RD9D 3J7YW 2F3WA 1S5CD 1F9PA 3I4NB 1VMPA 3Q0AA 2MHVA 3LWEA 4C1NI 5I6WA 1WTOA 4HTHA 3D4WA 5IGDA 3EJIA 1G6ZA 1SFOB 4Y7NB 2B8FA 3NP8A 2ICIA 1SYBA 5C0XG 4JBWA 3QG1A 3NWTA 1QOHA 1FNVA 1JOQA 3FKIB 3ND8A 3AMUA 2YYZA 5CYUA 1IKMA 2XRQD 4RHSA 2L5TA 1SYDA 3P1HA 1GUOA 5LL6S 3H91A 4A3JB 2OF1A 1LTAD 4IFDG 1DJRD 4HN7A 3CKIB 3FEWX 3RMHA 1FD7D 2BDOA 4QB4A 3A7LA 2A69D 3T4AC 1SMYD 3SK4A 4XQJA 2L1BA 4XT1B 1YNJD 1IW7D 5T1IA 2F0MA 2F0LA 4BBSB 2CW0D 2G9DA 4IQZA 5ELDA 4DK0A 1A2TA 4H0LC 1UEAB 5E4WC 2B2WC 1EQTA 3GQBA 1EIHA 1J9OA 1GHJA 2EY6A 3OSOA 2J7ZA 1EY9A 1XTCD 4HSPA 3NTIA 1SYCA 1HCZA 1IHZA 3BG3A 3CRLC 3BDCA 4IUTA 2AUKA 1B3AA 3S17B 2B63B 1ZXTA 4XDXA 1U9RA 3GTLB 2L11A 1KDAA 3TZUA 4C1NK 1GUGA 1STGA 1B9NA 2KCNA 2R93B 1V1PB 2RSNA 5C0XJ 2EYJA 1HQRD 5D14A 2IW3A 4KJOA 2F03A 1F9SA 2PZTA 2F0NA 5ISRA 2NUCA 4KMUC 3Q6SA 2HDLA 1BCPD 3QB3A 3MZ5A 2B2VC 3E0JA 5EGTA 4F8MA 1PFBA 5C4HA 4RWSC 3MA2B 5KYIA 1LTRD 4DGZA 1HXYD 4WRDA 1HUNA 4KD4A 3VYRA 5IT9E 1PZKD 4B9WA 4NMZA 1LTSD 2F4IA 1C48A 1X32A 1BCPC 4RH6A 5JAVA 2BDNA 4UAIA 3EVQA 2FFKB 3NTKA 3G6JB 2EYOA 3Q24A 3OHXC 3HS0C 3PUZA 1HFNA 1BF4A 2HUGA 2NWGA 1XWEA 2AWNA 2AQ1B 1EQVA 4C3HG 1KABA 3E6ZX 2WIIB 4RGMA 5K36G 1XYIA 2B2YC 3C3LA 5ELBA 1DOKA 2M2LA 2F0KA 1IYUA 3KK7A 1S4ZA 1SNCA 1BNZA 1SNOA 1II3A 1EIGA 3X3NA 4EQPA 1SDFA 3KBXA 5BN5A 3OMCA 5ELCA 2QILA 4IFDH 3M4YA 4DXFA 3K5LA 1DM0B 3IFDA 5J22A 4C3JB 3VA5A 1QG7A 3M7NA 1M8AA 3K6OA 1SSOA 1B53A 5CR3A 2J4XA 3HOZB 5C4JB 1SEBD 4EQOA 5M9OA 2K5QA 5C4ZA 3L3OC 2RKSA 1LV9A 3C1EA 3AU7A 4DAPA 5A2QE 1CHQD 1GUWA 2F1MA 1H9SA 4XYQA 3R3OA 1UNSA 4Z9CB 2ENBA 2E74C 2HDMA 1OO9B 4J1MA 4YIJA 1CK1A 5EJWA 4IUQA 1F2YA 3L9AX 2YU9B 1LT3D 1U4LA 4HMJA 2XWJB 3RZOB 2K03A 1GUTA 3H09A 3TZDA 3GTQB 1BO0A 5KGUA 3I4MB 5C3XA 2B2VA 2EXZA 3KBGA 1STHA 1D2BA 5DM73 4OO1I 1NAPA 3GTPB 3N52A 3VR4A 3S14B 1Y1VB 2IPKD 1S5DD 3MFYA 2JSOA 4KHZA 1BBXC 2F0IA 3GP7A 2IT1A 3KUPA 2FMMA 4FP5D 1Z47A 3T16A 1QNKA 2IX1A 2F0OA 3A7AB 4HR7B 4K6DA 4ID6A 2PQEA 2HCIA 3I73A 5CC4A 1H9MA 4ZUJA 1EY8A 1BQQT 1CA5A 2X69A 1Y8NB 1EFID 4CHTB 2PPBC 3SK8A 3J80L 1QJOA 4C3IB 5CBEE 1D5ZC 1PRTB 2H1EA 5EPLA 2IL8A 4HEDA 3GTOB 2RQXA 1WTWA 5J39A 3SK5A 1O80A 2RBMA 2L9HA 2WB1B 4EGVA 5FK9C 2M9VA 4O42A 2CVRA 1SE3A 5C4XB 4F87A 3HGBA 1TIID 3K5MA 3PUYA 1JORA 1CQFA 1G291 2F0PA 2KHSA 2A5HA 1JOOA 4KKSA 1EEID 2WV6D 3BYYB 1YNNC 2ID0A 3HOYB 1KDBA 1S5ED 3MXNA 1MD2D 1V43A 2AWOA 1T5EA 4CJ2C 1JQYD 4OO1H 1F2LA 2PZWA 2EYFA 4OL7A 1PYWD 2BE5D 4C3IG 1DCZA 1OXSC 1R4PB 4C56C 1ICWA 1OXXK 5DAUA 5ELFA 1IYVA 1LLRD 1NUCA 1TWGB 3TSSA 1ILQA 1GUSA 4KY5A 2NVXB 1ESRA 4G7HC 3KLSA 1EWCA 1TS3A 4NP5A 3SHLA 2WINB 3EROA 1B50A 1Q3LA 3CQZB 1PDQA 5BN4A 3HKZB 5JPNC 1CM9A 1V1OA 1E0BA 1OXUA 3M3YB 3BVZA 5KNCA 4CKBA 3NHHA 4RGOS 4G57A 4LMQD 2A68C 1DONA 3BS1A 2ZXPA 4KKTA 5KIXA 1SNMA 1SXTA 2O5JC 1JE4A 4XQNA 4RKLA 2FHTA 2A6HC 4ME5A 3P75A 4BA1I 1ILPA 4H7BA 1PTOH 4CKEA 4DN4M 4FF4A 3SR1A 5BN3A 1C8CA 2ZXOA 1FGBD 4LK1C 3NBIA 3VR3A 5M5XB 4DF7A 5DNFA 1PXUA 1U4MA 2X6LA 2O4XA 5FLXL 1LT6D 3Q23A 2VB2X 2JEAI 2K32A 3GO5A 1JWUD 3K7AB 4TSSA 1LACA 5A35A 2F0TA 3HOUB 1HA6A 2EY5A 2EY2A 4K6LA 4C3JG 1PTOD 5IGFA 4FVMA 3OOCA 4WJWA 3CU7A 1KDCA 3HOWB 2MP1A 2MJ8A 2KA7A 1F77A 1DZ1A 2O2LD 3K5OA 1WVLA 5E4XA 1Q12A 5FKAC 1HA5A 3QOJA 5E1FA 2CHBD 3DUZA 4R8IA 2NVTB 2F0VA 3RD4A 3A55A 4IFDJ 4BS9A 1KNAA 4BY7B 3TBIB 4M8AA 2EJGC 3J7AV 1CHPD 1LTTD 1M4VA 5JEAJ 4F88A 3UI2A 1STEA 4MIUA 4Q0FA 4CKCA 1PFMA 1PMRA 1V8QA 1STYA 1CT1D 3NPPA 3ITPA 1A2UA 2EY1A 4EQNA 2EZVA 2SDFA 1L0XB 2JA7B 2B2UA 1LTBD 3BVMA 2BE5C 1B44D 4KN4C 1HRJA 2EJFC 4BBRB 1PTOF 3TMEA 5K36H 1WTQA 1V1PA 2KEDA 2OXPA 1EOTA 5KRUA 1S5FD 3G7LA 2E2IB 3S1NB 2R92B 1G2TA 3A54A 1SYEA 3PUWA 3DWQA 2A74C 2QF7A 4HAEA 3T13A 3JAME 1D5XC 3VYTA 1GXDC 1MSHA 2NYZD 5LL6X 3R2TA 4PMWA 3I91A 2IX0A 3D4DA 1OXTA 4N9TA 3DM1A 5C0XH 2KQ3A 2F0EA 2R6GA 4XIGS 3SEBA 3R8BA 4FYDA 2A6HD 3PV0A 3SXHA 1LTGD 4MHEA 1A3TA 3OIPA 3MHBA 1F9QA 5CV7A 3I70A 5CMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY9 A;  5I6W A;  3T16 A;  2F0I A;  2HQE A;  1EZ6 A;  1STY A;  2EYF A;  1SNC A;  1SNP A;  4OL7 A;  4HTH A;  4J6H A;  4WOR A;  4R8N A;  1SNO A;  3D4W A;  3NXW A;  3MVV A;  4K5X A;  1SYC A;  4KV6 A;  3ITP A;  5IGD A;  1IHZ A;  1A2U A;  1II3 A;  3EJI A;  2EY1 A;  4EQN A;  2SNS A;  5J1Z A;  3SR1 A;  4EQP A;  3NP8 A;  4F7X A;  3TP6 A;  5IGE A;  1SYB A;  1ENC A;  3BDC A;  3H6M A;  3NUC A;  3OMC A;  4KY6 A;  5CV9 A;  4KY7 A;  1RKN A;  5DEH A;  1A3V A;  5CGK A;  5NUC A;  3NQT A;  2F0O A;  1EY0 A;  4K6D A;  4ZQ3 A;  4DF7 A;  4ID6 A;  4DU9 A;  2F3V A;  5DAU A;  2O4X A;  1F2M A;  3PMF A;  1STA A;  2PQE A;  5C3W A;  1SYG A;  3LX0 A;  4PMC A;  5J22 A;  3VA5 A;  3TME A;  4PNY A;  1NUC A;  1EY6 A;  4IZ8 A;  1U9R A;  1JOQ A;  2F0S A;  4S3S A;  3MXP A;  4N9P A;  1KDA A;  5CR3 A;  4ZUI A;  5CC4 A;  5IGC A;  4K2K A;  5HGT A;  2PW7 A;  4EQO A;  2SOB A;  5M9O A;  4ZUJ A;  1STG A;  1STB A;  2EYL A;  2OXP A;  2RKS A;  5C4Z A;  4B9X A;  1EYD A;  4KTA A;  5HUR A;  1EY4 A;  5I9O A;  4I65 A;  1EY8 A;  3C1E A;  4KY5 A;  5KRU A;  5CV4 A;  2EYJ A;  4KJO A;  4KHV A;  5KYL A;  4QF4 A;  2PZT A;  2F0T A;  5K5P A;  3U9O A;  1F2Z A;  1SYE A;  3SK8 A;  1SYD A;  1TT2 A;  4NDX A;  2F0N A;  1EYC A;  2EY5 A;  2NUC A;  2EYH A;  2F0J A;  2OEO A;  3DMU A;  3P1H A;  4NP5 A;  5ISR A;  4DFA A;  3SHL A;  3R3O A;  3ERO A;  4KD3 A;  3SK6 A;  3QB3 A;  2ENB A;  2EY2 A;  3MZ5 A;  3NK9 A;  2F0Q A;  2PW5 A;  2RDF A;  5CV6 A;  1TQO A;  2F0D A;  4PMB A;  5EGT A;  3T13 A;  3HZX A;  4F8M A;  2WAC A;  5IGF A;  5I9P A;  4YIJ A;  5C4H A;  2OF1 A;  1KDC A;  2SNM A;  4J1M A;  3SK5 A;  4E6I A;  5IOD A;  5J39 A;  3D8G A;  5I6Y A;  2RBM A;  1EZ8 A;  5KYI A;  4DGZ A;  3BDL A;  1KAA A;  1F2Y A;  4RKB A;  4WRD A;  1SND A;  4KD4 A;  4QB4 A;  4HMJ A;  5EKL A;  2LKV A;  1EY7 A;  5IOC A;  3D6C A;  3TP7 A;  5IIF A;  3SK4 A;  4B9W A;  2F0W A;  2PYK A;  2EYM A;  4NMZ A;  2EYP A;  5F2D A;  5C5M A;  2F0G A;  4TRD A;  5CV8 A;  4ODG A;  3V2T A;  4KJN A;  2F0F A;  3D4D A;  4N9T A;  1EYA A;  5JAV A;  3S9W A;  2KQ3 A;  3OWF A;  2F0M A;  3EVQ A;  2F0E A;  4K5W A;  3TP8 A;  2F0L A;  4HMI A;  1ENA A;  2M00 A;  5IGB A;  2EYO A;  2F0P A;  5KGU A;  2KHS A;  3NHH A;  1EY5 A;  1AEX A;  5C3X A;  4G57 A;  1A3U A;  1JOO A;  3OMG A;  4K8J A;  3QOJ A;  4K14 A;  2EXZ A;  5CV5 A;  1STH A;  3RUZ A;  5E1F A;  5KEE A;  1STN A;  3TP5 A;  2F0U A;  5C5L A;  1A2T A;  4IAL A;  3MEH A;  4IUN A;  5KIX A;  1SNQ A;  1SNM A;  4QMG A;  2F0V A;  4K5V A;  3E5S A;  3SXH A;  4K8I A;  1TR5 A;  4K2L A;  1EQV A;  1KAB A;  2QDB A;  2F3W A;  1KDB A;  1A3T A;  2PZW A;  3DHQ A;  4MIU A;  4RKL A;  4EVO A;  2PZU A;  4LAA A;  1SYF A;  1NSN S;  4ME5 A;  3P75 A;  5IGG A;  1JOR A;  5E3F A;  5EKK A;  3MHB A;  4NKL A;  5C6A A;  3ERQ A;  3QOL A;  2EY6 A;  3OSO A;  3C1F A;  5CV7 A;  5JOB A;  4H7B A;  3HEJ A;  1JOK A;  2F0K A;  2F0H A; 
#chains in the Genus database with same CATH topology
 3MAQ A;  4OXP A;  2HCC A;  2IWH A;  3OW2 A;  4WOR A;  4R8N A;  5C3E H;  1XTD A;  2HHH Q;  1JWM D;  4GZY C;  5FOB B;  3Q22 A;  1I6H H;  4ZKB B;  3FPP A;  4DR4 L;  1QE6 A;  2LMC B;  1R9T B;  1ML0 D;  4FF1 A;  1S40 A;  1N33 Q;  2CH4 W;  4H02 A;  1IXR A;  2AUJ D;  3K81 C;  5M3M G;  4QUC A;  4DV0 Q;  2LFN A;  1JJC B;  3LNN A;  4FNF A;  1NNX A;  1NMF A;  4N9P A;  4ZUI A;  2CFM A;  3TEH B;  4CDD C;  4LUV A;  1D1I A;  1YJ9 A;  1IBM L;  2KJX A;  2PNR C;  4NW2 A;  4JI5 Q;  1DD2 A;  1VMC A;  1X3E A;  1WD0 A;  4KTA A;  5HUR A;  3KF8 B;  3J81 c;  3UDF A;  3J81 L;  1AH9 A;  2D62 A;  1O7I A;  2R7Z B;  2QEJ C;  2CQO A;  1VCI A;  3CCV A;  4NDX A;  2DY7 A;  5LMN W;  3S24 A;  3DMU A;  3T56 B;  1AE3 A;  3HOW H;  2F52 A;  1X9N A;  1X54 A;  3GTJ B;  1FL0 A;  4JG2 A;  4JOI C;  1K83 B;  4GOP C;  3PIP A;  1PH2 A;  3G4S A;  1Q86 C;  5FLX E;  1KAA A;  4RHR A;  2WB1 G;  4OIK A;  2NTT A;  3TP7 A;  5IIF A;  2EYM A;  3IKJ A;  1ET9 A;  2DNC A;  3DWA A;  2F0F A;  2C5C A;  4C3H H;  4B3T Q;  2ZTD A;  1KLU D;  2DNE A;  2FMC A;  2LSS A;  4OHJ A;  5M3M H;  4OEM B;  4C3H B;  3RUZ A;  2Z4H A;  3KF6 A;  1I3Q H;  2K6A A;  4OGQ C;  3MEH A;  1XNR Q;  1X3Q A;  2A6E C;  1PFS A;  4BY7 G;  5KND A;  1GUN A;  1ZYR D;  3E5S A;  2QDL A;  2SEB D;  2F4V Q;  4K8I A;  3P20 A;  3M85 A;  3CCL A;  2XWB B;  1PFN A;  2A73 B;  1L1O B;  1Y14 B;  3K8A A;  1RF2 D;  3U50 C;  3I4L A;  1VQ4 A;  4JI8 Q;  1KL9 A;  1BR9 A;  3AB9 A;  2HQE A;  1ENF A;  2XRS D;  1VQ5 A;  1RTO A;  1N33 L;  4F7X A;  4IUU A;  1I4G A;  3NUC A;  1KRT A;  4KK7 A;  5DEH A;  2L4N A;  2K01 A;  3OPO A;  3NSW A;  1NMG A;  3JC6 6;  2F3V A;  1JIC A;  1QUQ B;  2HIX A;  1RHP A;  4YY3 L;  3LX0 A;  3ONA B;  2V4D A;  1OXV A;  1TWH H;  3CCU A;  4LF5 Q;  2HT1 A;  4HIO A;  3FVQ A;  3DWP A;  3BDO A;  5FO8 B;  3HOX G;  4B3T L;  2JEB I;  3KF8 A;  4K2K A;  1Z7T A;  3ER0 A;  2Q2T A;  4GS3 A;  2WP8 J;  1KLG D;  4IPH A;  1PVO A;  4KHV A;  1I6H B;  4A3I B;  1SE2 A;  2BOS A;  2EYH A;  2YV5 A;  1NR2 A;  3FPU B;  1EEF D;  4JI6 L;  1QIL A;  1Y8P B;  2FJ2 A;  4JVZ A;  2F0Q A;  2PW5 A;  1XX8 A;  3QWN A;  1HQM C;  1YJN A;  2A19 A;  2KCM A;  1CFM A;  1BDO A;  2MGS A;  3D8G A;  2Y0S B;  1EZ8 A;  3BDL A;  3NBH B;  4RCN A;  1MI2 A;  4RKB A;  4GLV B;  4A3I H;  1M90 C;  3GTP H;  3VR2 A;  2L0C A;  3G48 A;  3VA7 A;  1Q8I A;  2NVX H;  2OTJ A;  3ND9 A;  5M3M B;  2NTS A;  4TRD A;  3J7A F;  2VZA A;  5CBA E;  4J8Q A;  2D0P A;  3SDZ A;  2ZJQ A;  1PTO C;  1TWG H;  1AN8 A;  1UAP A;  1TWH B;  3R2I A;  4K8J A;  3GTQ H;  4K14 A;  4JK1 C;  1T5X D;  1PH6 A;  4IAL A;  3A74 A;  2Q8I B;  4EQ5 A;  4DV4 L;  2XNA C;  3I72 A;  4RAU C;  3CRK C;  5LHY 1;  3NBH A;  3TS2 A;  3ZJY C;  2I5H A;  3OTO L;  4QUF A;  4CDC C;  2NN6 I;  4A3E G;  1MIU A;  1ONL A;  1X3F A;  4R4I A;  4XYO A;  1K8M A;  1LT4 D;  1P8L A;  1JOK A;  1SMY C;  3E9I A;  1QB5 D;  4DAM A;  1B1Z A;  3PO3 B;  1AZP A;  4FXD A;  3S2H B;  1RTN A;  3GTG B;  1SNP A;  4L63 B;  2AHO B;  2AQ2 B;  4XTC S;  1Z9F A;  2J0T D;  4GN5 A;  3WOF A;  5J1Z A;  4BBS G;  3WDN A;  1WCM B;  3KLW A;  2EPB A;  4DR5 Q;  4JI4 Q;  1GO3 E;  3NQT A;  1TKW B;  3K0X A;  1EY0 A;  1YEZ A;  1O7Z A;  3ZYY X;  3AEV A;  4GKK L;  4DR2 Q;  5C4J H;  1EUJ A;  1I50 B;  1Z6H A;  1ASY A;  5JJK A;  1UWV A;  4PMC A;  1R9T H;  3CHB D;  1AW7 A;  4DV1 L;  3UDI A;  5FLM H;  3MXP A;  3OW7 A;  1Y1W B;  4A3F B;  3D3R A;  1GOZ A;  5JJZ A;  1WTV A;  1JWS D;  5C3E B;  1Q90 A;  4A75 A;  4HCE A;  4LF6 Q;  2VY3 A;  1FJG L;  3CMA A;  4X3S A;  3GV6 A;  4KKU A;  1EYC A;  2OEO A;  2E75 C;  4ZKC B;  2K5N A;  2KHI A;  2KUM A;  1PZI D;  2CCZ A;  1ZEQ X;  5M5Y H;  3H94 A;  2E2H B;  1NY4 A;  3KJP A;  1IW7 C;  1HHV A;  3TS0 A;  4B08 A;  3PIO 3;  5JEA G;  2KHJ A;  2L15 A;  2KEE A;  5I2X A;  1CKM A;  2EIF A;  4YCW A;  1EY7 A;  3MXU A;  1X6O A;  2B3G A;  3D6C A;  1VS0 A;  1H9R A;  5C5M A;  3HG9 A;  4H44 C;  2Q2H A;  4JI0 L;  2EXD A;  3A0J A;  3L0O A;  4AQY L;  4HID A;  2B8G A;  5IGB A;  5EPK A;  3SVM A;  4RG1 A;  3MXN B;  4CJ0 B;  1A3U A;  3RR5 A;  4A3B B;  4P72 A;  3N6R A;  4L5S A;  1K8O A;  4X3K A;  4BBR G;  5C5L A;  5I2Y A;  1CI3 M;  4A4I A;  1JR0 D;  2E8G A;  1YIT A;  2UUA Q;  1TR5 A;  2E5L Q;  2JA8 B;  3T1H L;  1XXG A;  3DHQ A;  3H0G B;  1UE5 A;  4IO9 A;  2QEX A;  1WD1 A;  2PI2 E;  4A3G B;  4X6A H;  1DOM A;  2ZXR A;  1XNQ Q;  3VR5 A;  2JA9 A;  1CA6 A;  5GQO A;  2E2J B;  3H3V H;  4LFB Q;  1EWH A;  4ZK9 B;  4FXG C;  1VQN A;  2SNS A;  1F9R A;  5JEA H;  3A8K E;  5JJI A;  5EBD A;  4KY7 A;  5CGK A;  1EU3 A;  5NUC A;  2OTL A;  5D65 A;  4ZAI A;  4BY1 G;  3A8I E;  4A3M B;  5C0X I;  4DV1 Q;  1EU4 A;  1PRT F;  1F2M A;  3P7J A;  3S2D B;  1FR3 A;  4DR7 L;  1VQ7 A;  4B3M L;  1MJC A;  4A3M H;  4JI7 Q;  5IT9 L;  1GHK A;  3W2D A;  5IP9 H;  2OQK A;  4A93 G;  3DEP A;  1W6K A;  2WAQ G;  1EY4 A;  3GTK B;  4DNI A;  3HP3 A;  2KVM A;  1LAB A;  3GTJ H;  1WTX A;  1QNU A;  1Y1W G;  1MHW C;  2MPM A;  1Q82 C;  1PZJ D;  1TWA H;  2YU9 H;  1I4H A;  1F2Z A;  2CH4 A;  2UUA L;  2F0J A;  1X3P A;  4JI8 L;  1HFG A;  2BCO A;  3GTM B;  2PCF B;  1PTO B;  2R7Z H;  4ILW A;  1SR3 A;  3K58 A;  1I6V C;  2E76 C;  1WCM G;  3CXC A;  2HQL A;  2NVT H;  1Q1E A;  2P5Z X;  1Y69 U;  5EKL A;  2LKV A;  3HKZ E;  3HOU G;  1QZH A;  3M7G A;  3KLR A;  1CKN B;  1IBK Q;  1VQL A;  1RDP D;  3WWV A;  3OIQ A;  2YTX A;  1PLF A;  1PRT C;  1NCV A;  1XMO Q;  4A3E B;  3HFZ B;  3GDE A;  2UXB L;  4GN4 B;  2Q2I A;  4HMI A;  4DV2 Q;  1B4O A;  1L0Y B;  1B3Q A;  1J5E L;  3A5Z B;  4JI1 Q;  4DV7 L;  4C3J H;  4MTK A;  3I3C A;  3KJO A;  1BCP F;  2F0U A;  2K28 A;  1WTP A;  4R9W A;  2WAQ B;  3T1H Q;  1JMC A;  4TKO B;  4DAV A;  4DUY Q;  4K5V A;  2IJ0 A;  1ROD A;  1TS4 A;  3MTS A;  4EVO A;  3ULP A;  3FKI G;  1PRT D;  2PZU A;  5BR8 Q;  5M5Y B;  5EKK A;  1HR0 Q;  5KNB A;  4A3J H;  3QOL A;  1VQH A;  4IPG A;  2XVS A;  2F0H A;  3S15 B;  2B63 G;  3D6W A;  2RDH A;  1VQF A;  2RSO A;  4J6H A;  1BUV T;  4DR4 Q;  1HTL D;  1YNJ C;  1N32 L;  1QWY A;  5FO7 B;  4AYB B;  2NBF A;  4L8J A;  4QIW E;  4FXK C;  3C2P A;  5CV9 A;  3VDY A;  1YZ6 A;  1VQE A;  2LXJ A;  1A3V A;  4HIM A;  2VQF L;  4LF9 Q;  4NXN L;  4KHP Q;  4CJ1 B;  1I50 H;  3NTH A;  1XJV A;  1SYG A;  3V05 A;  4U67 3;  1K73 C;  3S16 B;  3SE0 A;  3VYS A;  2KCC A;  4FDB A;  2K75 A;  4I7A A;  4S3S A;  2NB0 A;  4RMF A;  2KEC A;  4OIJ A;  3DEO A;  1ZYR C;  4A3C G;  4ZLT F;  1G6P A;  4MNO A;  1UUP A;  5I9O A;  5FJ8 G;  5CV4 A;  4IUV A;  5DM6 3;  4DV3 Q;  1R4Q B;  4Y7N H;  2JA7 G;  2VW9 A;  4X64 Q;  1E2Z A;  5K5P A;  3A8J E;  2BA1 A;  3D4R A;  3NE5 B;  2JE6 I;  4UDU C;  1VDZ A;  4HJ9 A;  1TY2 A;  5ELE A;  5CV6 A;  1TWA B;  3EFX D;  3HZX A;  1S72 A;  3CC2 A;  2R92 H;  5I9P A;  2QCP X;  2E2I H;  4HSV A;  1CKO A;  1HUM A;  3NEN A;  1YI2 A;  5FO9 B;  1EIY B;  3HOY H;  1O7L A;  2F0W A;  2K33 A;  3KYH C;  5F2D A;  3HRZ C;  2R93 H;  1N8R C;  4ODG A;  3PUV A;  5T1G A;  4A3J G;  3S2D H;  4XQQ A;  2B39 A;  1YHQ A;  2RF4 A;  1MGS A;  3D31 A;  4P75 A;  2VQF Q;  4LF9 L;  1H9K A;  3J81 E;  1EY5 A;  3PUX A;  1SE4 A;  4GN3 B;  2NVY H;  5KEE A;  4GNX B;  4A3D H;  4OO1 G;  1JT8 A;  3HKS A;  3CCQ A;  4LF6 L;  3J81 i;  5M5X H;  3S1R B;  1FYC A;  4RGT A;  2WKC A;  2FIN B;  2MO1 A;  1B9M A;  3PF5 A;  5JPM C;  5TSS A;  4N8F A;  2I46 A;  1V9P A;  4RA8 A;  4DR1 Q;  4A3G H;  4NKL A;  1FVI A;  3H0G H;  2JA6 H;  4X3T A;  4B3S L;  4U68 A;  2EVB A;  3CCE A;  4BY7 H;  1FNW A;  4L6T B;  1EZ6 A;  3V96 A;  2K1B A;  3G6E A;  3BYT B;  2WFW A;  1D5M C;  4IN3 A;  2B2T C;  2RA4 A;  3NXW A;  4YCU A;  2E2D C;  3MVV A;  4A3M G;  2Y0S E;  3K59 A;  4JI2 L;  4BY1 B;  1YNX A;  2UXC Q;  2GVA A;  2ICE C;  5FJ8 H;  4DK1 A;  4G7Z C;  2OWO A;  3F1Z A;  1TWF B;  4KY6 A;  4ZRZ A;  3QJY A;  3UDX A;  5M3F B;  2JA8 G;  1UE7 A;  1SBB B;  4DNR B;  4ZQ3 A;  3PO3 G;  5E7N A;  4LF5 L;  4OON A;  4XXE A;  2XN9 C;  3PIO A;  4BXX G;  4PNY A;  3VR6 A;  3BZC A;  4ME3 A;  2RDG A;  5IGC A;  3U4Z A;  4G4K A;  4IUR A;  2TSS A;  5G3L D;  3I90 A;  5COR A;  4ALP A;  2Q8T A;  2D5D A;  1D6E C;  4LW1 A;  3B6Y A;  1EYD A;  2E5L L;  3M3Y H;  3M4O B;  4DR3 L;  1Y8O B;  4X64 L;  2VNU D;  3BJU A;  4DK3 C;  2JA5 B;  4GLA C;  1JB3 A;  2RCF A;  5C4X G;  1VF7 A;  4PQX A;  5KYL A;  4PZ8 A;  2E2H H;  1L1O C;  3J7A 5;  1U5K A;  3C46 A;  2VUM B;  3M4P A;  2IX3 A;  2Z6K A;  4A3B G;  2K5W A;  1C9O A;  2MUY A;  2D2C C;  4WJ4 A;  4CDE C;  1GJX A;  2PMZ E;  3CQZ H;  1I4R A;  3U9S A;  2RDF A;  2F0D A;  4DR1 L;  2CKZ B;  4C2M B;  2SNM A;  3JAM c;  2B2Y A;  2CWA A;  4DUZ L;  1I3Q B;  4G7O C;  4HCS A;  4CGY B;  1H9S B;  4UP9 A;  3JAM L;  1VQJ A;  3FRP B;  5ELO A;  1BKB A;  3NQI A;  3W1B A;  2WKD A;  3IFT A;  2XIW A;  3K57 A;  4FO2 A;  5IE8 A;  1LO5 D;  3L7Z C;  3V2T A;  4B3M Q;  1U0L A;  3F2D A;  2UUC L;  1TY0 A;  1CTM A;  1G91 A;  1ET6 A;  1YBY A;  3WOE A;  2QKI C;  4K5W A;  2EJM A;  4GOP A;  3S1M B;  1ENA A;  1VQB A;  2NN6 H;  4R4T A;  5C4X H;  2K05 A;  4A3F G;  4P74 A;  3CC4 A;  3KDF B;  1XPR A;  1DXM A;  1JC7 A;  3S1Q B;  3NWS A;  2EOT A;  2DN8 A;  1STN A;  4L5Q A;  1I4Q A;  2KCT A;  4JOI A;  4BA2 I;  3KFU A;  3I4O A;  1K83 H;  5AFW A;  1V1Q A;  2NZH A;  4K2L A;  1D1K A;  1XPO A;  2FXQ A;  1SJE D;  2DY8 A;  2H5X A;  4L5R C;  1WTR A;  2K50 A;  1O78 A;  2VB3 X;  2GA4 B;  1JCK B;  5E3F A;  4DNT B;  3ERQ A;  1MSG A;  5IP7 H;  2B2U C;  1RJT A;  5JOB A;  2L12 A;  3HEJ A;  1AFP A;  1S5B D;  1TS2 A;  4JI2 Q;  1IL8 A;  2KBN A;  1X55 A;  1JB7 A;  4K5X A;  4OEL B;  4ULL A;  2L55 A;  4KN7 C;  3EA6 A;  5L37 A;  4POF A;  1FNU A;  2I07 B;  1XMO L;  2JYO A;  4RCO A;  4DU9 A;  2MFI A;  3HOV B;  1BBU A;  4YCV A;  4X65 Q;  3IAY A;  2Z1C A;  3W3A A;  2F0S A;  3RZD H;  4V0B A;  4DXG A;  2PW7 A;  4JPB W;  4CBV A;  1VF5 C;  2NZ1 D;  1BBW A;  4Q5V A;  1PA6 A;  2B2W A;  3ICE A;  3TDQ A;  4LFA L;  1XNR L;  5C44 B;  3RN5 A;  4JBM A;  1HR0 L;  5JVH 3;  4A93 B;  5FLM G;  2UU9 L;  1HNW Q;  4DV5 Q;  2XTI A;  1RL2 A;  1Y1V H;  2CW0 C;  3DXJ C;  3S14 H;  2K14 A;  3GTO H;  1TS5 A;  3PO2 G;  4WFN 3;  3A56 A;  1CZW A;  4R4O A;  2ZT9 C;  1BCP B;  4X3U A;  3H3V I;  1HTP A;  1NR4 A;  2EDG A;  2Q8R E;  3TN2 A;  1J8I A;  3H3V C;  2CWP A;  1SRO A;  1A15 A;  1A8V A;  1QCB D;  2DUD A;  2A69 C;  3T51 B;  3CME A;  2VS1 A;  3PIP 3;  1KNE A;  1XMQ L;  2ATW A;  1A6X A;  4P2C B;  2EYP A;  2F0G A;  3X3M A;  2JQO A;  3OWF A;  1HZA A;  2M00 A;  3K5N A;  2K5D A;  4JCV E;  1ZKO A;  1HH2 P;  2LS0 1;  1AEX A;  3W1G A;  2A6E D;  5CV5 A;  1I4X A;  4IUP A;  3BU2 A;  3I4N G;  5IYC G;  1LT5 D;  2AQ3 B;  4IUN A;  4HJA A;  2VQE Q;  2PO4 A;  1DYQ A;  3VYU A;  1KD1 C;  3K80 C;  2QDB A;  4ZYS A;  3O13 A;  1VQA A;  2CQA A;  2GN5 A;  2LY7 A;  4LAA A;  1SYF A;  5IWA L;  5G3L F;  1NSN S;  2Z4I A;  4LFA Q;  4FF2 A;  4O1N A;  1X56 A;  2C9O A;  2UU9 Q;  3C1F A;  2UXD L;  1Q81 C;  4QIW B;  2EQS A;  2JXM B;  2EE1 A;  1Q8K A;  4I7Z C;  5I4D A;  3TP6 A;  1SJH D;  3H6M A;  4YWL A;  3EQL C;  1RKN A;  3E3X A;  4DR7 Q;  4ABN A;  4Y52 H;  1EL0 A;  4BBR H;  1I94 Q;  3PMF A;  4MTN A;  5C3W A;  2PQA B;  3I4M H;  1EY6 A;  4PG3 A;  5HGT A;  2SOB A;  1TU2 B;  1STB A;  4H13 C;  3KLS X;  1IBM Q;  2H4O A;  4I65 A;  2KOL A;  3GD7 A;  4BWG B;  2NN6 G;  3RZO H;  2A68 D;  1YHA A;  4QF4 A;  4DV6 L;  1EIF A;  3U9O A;  1TT2 A;  5EQ0 A;  5EPJ A;  2N88 A;  5JVG 3;  2N55 A;  2X6G A;  1HNX Q;  3QO2 A;  2O5I C;  4KD3 A;  3SK6 A;  3F8T A;  1IKL A;  3OWE B;  3FHW A;  4PMB A;  1E2W A;  3GV3 A;  2WAC A;  2HHH L;  2RHS B;  1U4P A;  4E6I A;  2OT2 A;  1I4P A;  2I0Q A;  1C4Q A;  3URY A;  2R61 A;  4DPG A;  1IBK L;  1SND A;  1VQK A;  2K04 A;  5IOC A;  2D9U A;  2PNH A;  3CCR A;  5COY A;  3NEL A;  5CV8 A;  4KJN A;  1Q46 A;  3QR8 A;  1HPC A;  3K0Y A;  2G9H D;  5M5W B;  1N34 Q;  4IFD I;  3IL8 A;  4M1U B;  3TP8 A;  5IY0 A;  2YTY A;  2D0O A;  3PO2 B;  5LMN Q;  4POG A;  1HNZ Q;  5D3D A;  1TXY A;  4TQU S;  3AQQ A;  2B29 A;  4RGN A;  1CSQ A;  2BA0 A;  3CAM A;  5C44 G;  4DA2 A;  1SNQ A;  2JP1 A;  1AP0 A;  1MBY A;  1TVX A;  2N8N A;  2RVL A;  1BOS A;  1SAP A;  3F2U A;  4AYB E;  4UP7 A;  4YWK A;  2VXW A;  1O7Y A;  5IGG A;  1B2T A;  1K8G A;  3MXG A;  3BZD B;  4DV6 Q;  1U4R A;  1NE3 A;  5C6A A;  3K7U C;  4NXM L;  1CZG A;  3HOU H;  2XSC A;  1ICF B;  2MO0 A;  4QCL A;  1E2V A;  2Z0S A;  1PH7 A;  1H9J A;  5JJL A;  3K7A H;  3J80 E;  4KV6 A;  1Q1B A;  2PMZ B;  4JBJ A;  1VQI A;  2R3Z A;  3I8Z A;  5GRO A;  1K0S A;  4XT3 B;  2ZM6 L;  5IGE A;  4FF3 A;  4A3I G;  1ENC A;  3GTL H;  2NVQ B;  4APV A;  1PHJ A;  4DKA C;  2PQA A;  3QIA A;  1VQM A;  4JBK A;  3DM3 A;  4K0K L;  4V19 0;  1STA A;  3MC0 B;  5EKI A;  4IZ8 A;  4ZCK A;  5D3I B;  1ESF A;  4LJZ C;  1YNN D;  3LWU A;  1BXT A;  3BVG A;  2EYL A;  4KI0 A;  4DV3 L;  2Z8L A;  1RCV D;  3MFG A;  1WJJ A;  4GLX A;  3ULL A;  4A3K B;  4DAY A;  4B9X A;  5A2Q L;  1DOL A;  1TWC B;  4BY1 H;  1P16 A;  4DFA A;  4QQB X;  1BVS A;  3HOX B;  1OTC A;  1SMX A;  4GNX A;  3NK9 A;  1TQO A;  1RIP A;  1KTK A;  2JA6 B;  3MWY W;  4MN3 A;  5IOD A;  2JK8 A;  1N36 Q;  5I6Y A;  1G8Z D;  5EAY A;  4A93 H;  4DR6 Q;  2B2T A;  1N9W A;  5EBC A;  4PV1 C;  3EBE A;  3HOZ H;  1AZQ A;  2TMP A;  3FDT A;  2PYK A;  1N34 L;  4BBS H;  4X65 L;  1G2S A;  4OWW B;  4LUO A;  4A3D B;  1EYA A;  3BZK A;  4RFB A;  3T53 B;  3S9W A;  1IL2 A;  2NVY B;  1DGS A;  3RZD B;  3RLF A;  4DAY B;  1LTI D;  1MJE A;  3R93 A;  2K7V A;  4LF7 L;  3OMG A;  4DK6 C;  4DV0 L;  1UE6 A;  3FMC A;  4J15 A;  2VUM G;  3TP5 A;  3J7Z C;  3PGZ A;  2QW7 A;  1W6J A;  4QMG A;  3IRB A;  1CQV A;  1RD9 D;  3J7Y W;  2RHQ B;  1IBL L;  3CPW A;  2F3W A;  4DV4 Q;  1S5C D;  1F9P A;  3I4N B;  1VMP A;  2HD3 A;  4O0A A;  4NB3 A;  3Q0A A;  2MHV A;  3LWE A;  3OTO Q;  4C1N I;  5I6W A;  2Z6B A;  1WTO A;  5GAE C;  4HTH A;  3D4W A;  1QVC A;  5IGD A;  2ES2 A;  3A5U A;  3EJI A;  1G6Z A;  1SFO B;  1N36 L;  4Y7N B;  2B8F A;  3NP8 A;  2ICI A;  1SYB A;  2R7Z G;  5C0X G;  3D0F A;  4JBW A;  3QG1 A;  3NWT A;  1QOH A;  2QA4 A;  1D8L A;  4KLK A;  2R93 G;  1FNV A;  2R7D A;  1JOQ A;  3FKI B;  3ND8 A;  2UXB Q;  1IYJ B;  4DV2 L;  2VQE L;  4TVA B;  4O2D A;  3RLO A;  1K9M C;  3AMU A;  2YYZ A;  4GOP B;  5CYU A;  1IKM A;  2XRQ D;  4RHS A;  2L5T A;  1SYD A;  1QVG A;  3P1H A;  1GUO A;  3KDF A;  5LL6 S;  1VQG A;  3H91 A;  3ERS X;  4A3J B;  2OF1 A;  4R4C A;  1LTA D;  1VQ9 A;  2JA6 G;  4UP8 A;  1DJR D;  4IFD G;  4HN7 A;  3CKI B;  3FEW X;  3RMH A;  1FD7 D;  2QGQ A;  2BDO A;  4QB4 A;  3A7L A;  2A69 D;  3T4A C;  1SMY D;  4GKK Q;  1LM0 A;  3SK4 A;  2JA5 H;  4XQJ A;  2L1B A;  2ALY B;  4XT1 B;  1YNJ D;  1E24 A;  3I56 A;  3S17 H;  1IW7 D;  5T1I A;  2F0M A;  1K3B C;  2F0L A;  2Z9H A;  4NXN Q;  4KHP L;  4JI0 Q;  3FKI H;  1QZG A;  4BBS B;  2CW0 D;  1W3S A;  2G9D A;  4IQZ A;  5IYB H;  1CKN A;  5ELD A;  4DK0 A;  1A2T A;  5IP9 G;  4UPA A;  3E9H A;  4H0L C;  2RCN A;  1TWF H;  1UEA B;  5E4W C;  2B2W C;  3KOJ A;  1EQT A;  3GQB A;  1EIH A;  2LXK A;  1J9O A;  3PF4 A;  1VQ6 A;  1PH3 A;  4OX9 L;  1YIJ A;  1GHJ A;  3OSO A;  2EY6 A;  3CCM A;  2J7Z A;  3CP0 A;  1EY9 A;  1XTC D;  1L2F A;  3NEM A;  4HSP A;  3NTI A;  3I4N H;  1SYC A;  2N3S A;  3JAM i;  4IPD A;  1HCZ A;  1IHZ A;  3BG3 A;  1GKH A;  4HJ5 A;  3TRE A;  1KAW A;  4LFC L;  3CRL C;  3BDC A;  4AH6 A;  1PYB A;  3GTK H;  4IUT A;  2AUK A;  1B3A A;  3S17 B;  2B63 B;  1ZXT A;  4XDX A;  1U9R A;  3GTL B;  2L11 A;  3CW2 C;  1KDA A;  3TZU A;  4C1N K;  5DLQ E;  4N8X 1;  3RLN A;  4PZ7 A;  1GUG A;  1STG A;  5LMU Q;  1B9N A;  2KCN A;  2OCE A;  2R93 B;  1JE5 A;  1V1P B;  2RSN A;  4YHH Q;  5C0X J;  2EYJ A;  1HQR D;  5D14 A;  2IW3 A;  4KJO A;  2F03 A;  5GAH C;  1F9S A;  2PZT A;  4B3R L;  1UE1 A;  2F0N A;  5ISR A;  1EWI A;  2NUC A;  4KMU C;  2AKW B;  3Q6S A;  2HDL A;  1HJP A;  1BCP D;  3QB3 A;  3MZ5 A;  2B2V C;  3E0J A;  5EGT A;  4F8M A;  1PFB A;  5IP7 G;  5C4H A;  3J80 i;  4RWS C;  3MA2 B;  1VQ8 A;  5HY6 A;  5KYI A;  1LTR D;  4DGZ A;  1HXY D;  4GKJ Q;  4WRD A;  1HUN A;  4KD4 A;  2JA8 H;  3VYR A;  5IT9 E;  1PZK D;  4B9W A;  4NMZ A;  4LF4 Q;  3PO2 H;  1LTS D;  2F4I A;  1C48 A;  1X32 A;  1BCP C;  4BXX H;  4RH6 A;  5JAV A;  1WI5 A;  2BDN A;  4UAI A;  3EVQ A;  2FFK B;  1LYL A;  3NTK A;  3G6J B;  1E22 A;  2EYO A;  3Q24 A;  3OHX C;  1E1O A;  3S16 H;  3HS0 C;  3PUZ A;  4UY8 C;  1HFN A;  1BF4 A;  2HUG A;  2NWG A;  2Z6K C;  2R7F A;  4PZ6 A;  1G51 A;  1B8A A;  2NVQ H;  1XWE A;  2AWN A;  2KEN A;  1KQS A;  2AQ1 B;  1M1K C;  4IOC A;  1EQV A;  4C3H G;  1KAB A;  4DR3 Q;  3E6Z X;  2WII B;  4RGM A;  5K36 G;  4YHH L;  1J6Q A;  1XYI A;  2B2Y C;  1K3R A;  4A3K G;  3C3L A;  5ELB A;  1DOK A;  1LUZ A;  2M2L A;  5IWA Q;  3W5O A;  2F0K A;  4JV5 Q;  1EQQ A;  1IYU A;  3KK7 A;  1S4Z A;  1SNC A;  1BNZ A;  1SNO A;  1II3 A;  1EIG A;  5C44 H;  3X3N A;  3RN2 A;  4EQP A;  1SDF A;  3KBX A;  3STB D;  5BN5 A;  3J81 j;  4LUZ A;  3OMC A;  3HOY G;  5ELC A;  2QIL A;  4LWC A;  4IFD H;  3M4Y A;  4DXF A;  3K5L A;  4A3F H;  1Y1W H;  1DM0 B;  3IFD A;  5J22 A;  4C3J B;  3VA5 A;  1QG7 A;  3M7N A;  1M8A A;  1EYG A;  3K6O A;  4L5T A;  1SSO A;  1B53 A;  2OQ0 A;  5CR3 A;  2J4X A;  3HOZ B;  3MEF A;  4EX5 A;  5C4J B;  1SEB D;  4EQO A;  5M9O A;  2K5Q A;  4HIK A;  5C4Z A;  3L3O C;  2RKS A;  1LV9 A;  4IJH A;  3C1E A;  3AU7 A;  3M9B A;  3Q8D A;  2GVB A;  4DAP A;  3I4M G;  5A2Q E;  2WAQ E;  1CHQ D;  4C3I H;  1PH9 A;  1GUW A;  2F1M A;  3HOX H;  1H9S A;  4XYQ A;  3R3O A;  2C35 B;  1UNS A;  4Z9C B;  2ENB A;  4QJF A;  1EQR A;  2UUB L;  2E74 C;  1HNX L;  2HDM A;  1OO9 B;  4J1M A;  4YIJ A;  1CK1 A;  5EJW A;  3AFQ A;  1XNQ L;  4JI3 Q;  4QY7 A;  4LF8 Q;  4IUQ A;  1F2Y A;  3L9A X;  2YU9 B;  4LF4 L;  1LT3 D;  5IYB G;  1U4L A;  4HMJ A;  2XWJ B;  3RZO B;  1WYD A;  2K03 A;  5IYD H;  1YHB A;  1GUT A;  2PI2 A;  3H09 A;  3TZD A;  1HNZ L;  3GTQ B;  1BO0 A;  5KGU A;  3I4M B;  5C3X A;  2B2V A;  2EXZ A;  3KBG A;  1STH A;  2K5H A;  3F2B A;  1D2B A;  5DM7 3;  4OO1 I;  4P71 A;  1VQP A;  1NAP A;  2A8V A;  3GTP B;  3N52 A;  2JJQ A;  2Q2U A;  3VR4 A;  3S14 B;  2E2J H;  1Y1V B;  2IPK D;  1S5D D;  1PYS B;  2HIV A;  1W2B A;  3MFY A;  2MNA A;  2JSO A;  4KHZ A;  1BBX C;  4LFB L;  2F0I A;  3GP7 A;  2IT1 A;  3KUP A;  4B3S Q;  3UDG A;  1YVC A;  2V1C C;  2FMM A;  4FP5 D;  4WJ3 M;  3CPF A;  1Z47 A;  4QL5 A;  2BH2 A;  1ASZ A;  3T16 A;  1QNK A;  3F2C A;  2IX1 A;  4A3L H;  2F0O A;  3A7A B;  4HR7 B;  4K6D A;  4ID6 A;  2B63 H;  3PQI A;  2PQE A;  3AFP A;  5M5W H;  3HOV H;  2K52 A;  2HCI A;  3U4V A;  3L2P A;  3I73 A;  1PH4 A;  5CC4 A;  3CC7 A;  1H9M A;  1Y1V G;  1J5E Q;  4ZUJ A;  1EY8 A;  1BQQ T;  1PH5 A;  1VQC A;  1CA5 A;  2X69 A;  1Y8N B;  1EFI D;  4CHT B;  1WTH A;  2PPB C;  3TRZ A;  3I2Z A;  4GNX C;  3SK8 A;  3J80 L;  2K4K A;  1HR0 W;  1QJO A;  4C3I B;  5CBE E;  3E0E A;  1D5Z C;  1PRT B;  2H1E A;  5EPL A;  2IL8 A;  4HED A;  3GTO B;  2RQX A;  1WTW A;  1K28 A;  4A3L G;  4LF8 L;  5J39 A;  1A0I A;  3SK5 A;  1O80 A;  2RBM A;  1K0R A;  2L9H A;  3CCS A;  2WB1 B;  4EGV A;  4LFC Q;  5FK9 C;  1QVF A;  2M9V A;  4O42 A;  1KIX A;  4DUZ Q;  2CVR A;  1X65 A;  4DR2 L;  1SE3 A;  3UE1 A;  5C4X B;  2Y0S G;  4F87 A;  2ZJR A;  3HGB A;  1TII D;  3K5M A;  3PUY A;  4JI1 L;  4X62 L;  4DV7 Q;  4OWX B;  1JOR A;  1CQF A;  1G29 1;  1XPU A;  1LTL A;  4P73 A;  2F0P A;  2UUC Q;  2KHS A;  2A5H A;  3G71 A;  1JOO A;  2DGY A;  4A3G G;  1NJI C;  5GAD C;  3H0G G;  2YTV A;  1KHI A;  4KKS A;  1EEI D;  1IBL Q;  2WV6 D;  3BYY B;  1YNN C;  2G5D A;  2ID0 A;  1WFQ A;  2ZTC A;  3HOY B;  1KDB A;  1S5E D;  3MXN A;  4A76 A;  2F4V L;  1NBW A;  2DJF C;  1MD2 D;  1V43 A;  2AWO A;  1T5E A;  3GTG H;  1HZB A;  1NTG A;  1B7Y B;  2VUM H;  4CJ2 C;  1JQY D;  4OO1 H;  1F2L A;  3S2H H;  1SN8 A;  3PO3 H;  2PZW A;  4GKJ L;  2BH8 A;  1S3O A;  2EYF A;  2N49 A;  4OL7 A;  1N32 Q;  1PYW D;  2BE5 D;  4C3I G;  1DCZ A;  1OXS C;  1R4P B;  4C56 C;  1ICW A;  4IPC A;  1OXX K;  4AQY Q;  1EFW A;  4JYA L;  4YY3 Q;  5HGQ A;  5DAU A;  5ELF A;  1WOC A;  1E3P A;  4JC0 A;  1IYV A;  1VQD A;  1LLR D;  1KRS A;  1JJG A;  1NUC A;  4NPS A;  1TWG B;  3TSS A;  3S1M H;  4X66 Q;  2DJG C;  5IYD G;  1X3G A;  3EN2 A;  1ILQ A;  1GUS A;  1E7Z A;  4KY5 A;  1C0A A;  1FGU A;  2NVX B;  1ESR A;  2VL6 A;  4G7H C;  1GVP A;  3KLS A;  1EWC A;  1A62 A;  1TS3 A;  4NP5 A;  3SHL A;  3CF5 A;  2WIN B;  5IT9 c;  3ERO A;  1KC8 C;  4HJ8 A;  1B50 A;  3S15 H;  1Q3L A;  4JI6 Q;  1HZ9 A;  3CQZ B;  1QUQ A;  3S1R H;  1PDQ A;  2K5V A;  5BN4 A;  1UEB A;  3HKZ B;  5JPN C;  1CM9 A;  2AMC B;  4X62 Q;  1CSP A;  1V1O A;  1E0B A;  1OXU A;  3M3Y B;  2WB1 E;  3BVZ A;  4JYA Q;  5KNC A;  4CKB A;  4AYB G;  3NHH A;  4RGO S;  4G57 A;  4HJ7 A;  4LMQ D;  2A68 C;  4A3E H;  1DON A;  1SRU A;  3BS1 A;  2ZXP A;  4KKT A;  5KIX A;  1SNM A;  1SXT A;  2O5J C;  1JE4 A;  1HNW L;  3M4Q A;  4XQN A;  4RKL A;  4OX9 Q;  2FHT A;  5J3B A;  2A6H C;  4ME5 A;  3P75 A;  4AIM A;  2R92 G;  4BA1 I;  1ILP A;  1TWC H;  4QGU A;  4H7B A;  3CCJ A;  2JA5 G;  1PTO H;  4JI3 L;  3OYY A;  2UXD Q;  4CKE A;  4R4Q A;  4DN4 M;  1AE2 A;  4FF4 A;  2ZTE A;  4OWT B;  3SR1 A;  5BN3 A;  1C8C A;  3S1N H;  2ZXO A;  3S1Q H;  4LK1 C;  1FGB D;  2I5M X;  3NBI A;  3VR3 A;  4DR6 L;  5M5X B;  3RNU A;  4DF7 A;  5DNF A;  1PXU A;  1U4M A;  2X6L A;  1KXL A;  2O4X A;  4DR5 L;  4JI4 L;  5FLX L;  1LT6 D;  3Q23 A;  4X66 L;  1I94 L;  3H15 A;  3HOZ G;  2VB2 X;  3DLL A;  1PV4 A;  2JEA I;  2K32 A;  5AJ3 L;  3GO5 A;  4CDF C;  1JWU D;  3K7A B;  4TSS A;  5LMU L;  3LGJ A;  1LAC A;  4C2M H;  5A35 A;  2F0T A;  5M3F G;  3HOU B;  1HA6 A;  3FP9 A;  2EY5 A;  1FJG Q;  1SLJ A;  2EY2 A;  4IOA A;  4K6L A;  4C3J G;  1PTO D;  5IGF A;  4FVM A;  3OOC A;  4WJW A;  3CU7 A;  1KDC A;  2ZJP A;  3HOW B;  2MP1 A;  3SGI A;  3M4O H;  2MJ8 A;  1SE8 A;  2I5L X;  2KA7 A;  1F77 A;  3STB C;  1DZ1 A;  2O2L D;  3K5O A;  1WVL A;  5E4X A;  2JN4 A;  3TQY A;  4A3B H;  1Q12 A;  1H95 A;  5FKA C;  5M3F H;  1HA5 A;  3I55 A;  3QOJ A;  1A63 A;  3PCO B;  5E1F A;  1SFO H;  5LMN L;  3HOW G;  2CHB D;  2ASB A;  3DUZ A;  4R8I A;  2NVT B;  2F0V A;  3RD4 A;  5AJ3 Q;  1E1T A;  3A55 A;  4IFD J;  4BS9 A;  1KNA A;  4BY7 B;  3TBI B;  4M8A A;  3T1Y Q;  2EJG C;  2F3I A;  3J7A V;  3GTM H;  1CHP D;  3PSI A;  1LTT D;  4YWM A;  4R1J A;  1IZ6 A;  1M4V A;  5JEA J;  4F88 A;  5IYC H;  3UI2 A;  1STE A;  4DV5 L;  4MIU A;  4Q0F A;  4CKC A;  1PFM A;  1PMR A;  3J80 c;  3CD6 A;  2IHE A;  1V8Q A;  1STY A;  1Q7Y C;  1CT1 D;  1CUK A;  4JV5 L;  3NPP A;  3ITP A;  1PH1 A;  1A2U A;  2EY1 A;  4EQN A;  2XGT A;  2EZV A;  1GM5 A;  1B70 B;  2SDF A;  1L0X B;  3ULJ A;  5FLX c;  2IY5 B;  3AYH B;  2N78 A;  2B2U A;  1JJ2 A;  2JA7 B;  1LTB D;  3BVM A;  2BE5 C;  1B44 D;  4KN4 C;  2ZM6 Q;  1PH8 A;  4JI7 L;  1HRJ A;  1C7Y A;  2EJF C;  4BBR B;  1PTO F;  4K0K Q;  3TME A;  1K8A C;  3I7F A;  5K36 H;  1D7Q A;  1WTQ A;  1V1P A;  2A1A A;  2KED A;  2OXP A;  1EOT A;  4A3D G;  5KRU A;  1S5F D;  3G7L A;  2NZO A;  1WCM H;  1T9H A;  2E2I B;  3S1N B;  1GD7 A;  2R92 B;  1G2T A;  3A54 A;  1SYE A;  3PUW A;  4NXM Q;  3DWQ A;  2A74 C;  2UUB Q;  1HZC A;  2QF7 A;  3T1Y L;  3HOV G;  4HAE A;  3T13 A;  3U58 A;  3UE0 A;  4A3K H;  2UXC L;  3JAM E;  1D5X C;  1MKH A;  3VYT A;  1GXD C;  1MSH A;  1XMQ Q;  4IJL A;  3EIV A;  2NYZ D;  5LL6 X;  3R2T A;  4PMW A;  3I91 A;  1I5F A;  1VQO A;  4LNQ A;  2IX0 A;  3D4D A;  1OXT A;  4N9T A;  3DM1 A;  5C3E G;  5C0X H;  2KQ3 A;  1L1O A;  2F0E A;  1L0W A;  2MQH A;  2R6G A;  4XIG S;  5H1S E;  4JI5 L;  3HKZ G;  5GAG C;  3SEB A;  1YJW A;  3R8B A;  4DUY L;  4LF7 Q;  5ELN A;  4FYD A;  4MZ9 A;  2IHF A;  2A6H D;  2JA7 H;  4JW0 A;  1EOV A;  3KF6 B;  5BR8 L;  3PV0 A;  3SXH A;  1LTG D;  4MHE A;  1A3T A;  4A3C H;  3OIP A;  3MHB A;  4B3R Q;  4UHV A;  1F9Q A;  5CV7 A;  3I70 A;  5CMD A; 
#chains in the Genus database with same CATH homology
 3MAQ A;  2HCC A;  2IWH A;  4WOR A;  4R8N A;  1JWM D;  4GZY C;  5FOB B;  3Q22 A;  4ZKB B;  3FPP A;  1QE6 A;  2LMC B;  1R9T B;  1ML0 D;  4FF1 A;  2AUJ D;  4QUC A;  2LFN A;  3LNN A;  4FNF A;  4N9P A;  4ZUI A;  1D1I A;  2KJX A;  2PNR C;  4NW2 A;  1DD2 A;  1VMC A;  1WD0 A;  4KTA A;  5HUR A;  3J81 L;  2D62 A;  2R7Z B;  2QEJ C;  1VCI A;  4NDX A;  2DY7 A;  3DMU A;  3T56 B;  3GTJ B;  1K83 B;  5FLX E;  1KAA A;  4RHR A;  4OIK A;  2NTT A;  3TP7 A;  5IIF A;  2EYM A;  3IKJ A;  1ET9 A;  2DNC A;  3DWA A;  2F0F A;  2C5C A;  1KLU D;  2DNE A;  2FMC A;  4OHJ A;  4C3H B;  3RUZ A;  2Z4H A;  2K6A A;  4OGQ C;  3MEH A;  1X3Q A;  2A6E C;  5KND A;  1GUN A;  1ZYR D;  3E5S A;  2SEB D;  4K8I A;  3P20 A;  3M85 A;  2XWB B;  1PFN A;  2A73 B;  1RF2 D;  3I4L A;  1BR9 A;  3AB9 A;  2HQE A;  1ENF A;  2XRS D;  1RTO A;  4F7X A;  4IUU A;  1I4G A;  3NUC A;  4KK7 A;  5DEH A;  2L4N A;  2K01 A;  3OPO A;  3NSW A;  2F3V A;  1JIC A;  1RHP A;  3LX0 A;  3ONA B;  2V4D A;  1OXV A;  3FVQ A;  3DWP A;  3BDO A;  5FO8 B;  2JEB I;  3KF8 A;  4K2K A;  1Z7T A;  2WP8 J;  1KLG D;  4KHV A;  1I6H B;  4A3I B;  1SE2 A;  2BOS A;  2EYH A;  1NR2 A;  3FPU B;  1EEF D;  1QIL A;  1Y8P B;  2FJ2 A;  2F0Q A;  2PW5 A;  1XX8 A;  3QWN A;  1HQM C;  1CFM A;  1BDO A;  2MGS A;  3D8G A;  2Y0S B;  1EZ8 A;  3BDL A;  4RCN A;  1MI2 A;  4RKB A;  3VR2 A;  2L0C A;  3VA7 A;  1Q8I A;  3ND9 A;  5M3M B;  2NTS A;  4TRD A;  3J7A F;  5CBA E;  4J8Q A;  3SDZ A;  1PTO C;  1AN8 A;  1UAP A;  1TWH B;  3R2I A;  4K8J A;  4K14 A;  4JK1 C;  1T5X D;  4IAL A;  2Q8I B;  2XNA C;  3I72 A;  4RAU C;  3CRK C;  5LHY 1;  3NBH A;  4QUF A;  2NN6 I;  1ONL A;  4XYO A;  1K8M A;  1LT4 D;  1SMY C;  1JOK A;  3PO3 B;  1QB5 D;  4FXD A;  1B1Z A;  3S2H B;  1AZP A;  1RTN A;  3GTG B;  1SNP A;  4L63 B;  2AQ2 B;  4XTC S;  2J0T D;  3WOF A;  5J1Z A;  3WDN A;  1WCM B;  2EPB A;  1TKW B;  3ZYY X;  3NQT A;  1EY0 A;  1O7Z A;  1I50 B;  1Z6H A;  4PMC A;  3CHB D;  1AW7 A;  3MXP A;  3OW7 A;  1Y1W B;  4A3F B;  3D3R A;  1GOZ A;  5JJZ A;  1WTV A;  1JWS D;  5C3E B;  1Q90 A;  4HCE A;  4X3S A;  3GV6 A;  4KKU A;  1EYC A;  2OEO A;  2E75 C;  4ZKC B;  2KUM A;  1PZI D;  1ZEQ X;  3H94 A;  2E2H B;  1IW7 C;  1HHV A;  4B08 A;  3PIO 3;  5JEA G;  2KEE A;  5I2X A;  1EY7 A;  3MXU A;  3D6C A;  1H9R A;  5C5M A;  3HG9 A;  4H44 C;  2B8G A;  5IGB A;  5EPK A;  3SVM A;  4CJ0 B;  1A3U A;  4A3B B;  3N6R A;  1K8O A;  4X3K A;  5C5L A;  5I2Y A;  1CI3 M;  1JR0 D;  1TR5 A;  2JA8 B;  1XXG A;  3DHQ A;  3H0G B;  1WD1 A;  4A3G B;  1DOM A;  2ZXR A;  3VR5 A;  1CA6 A;  2E2J B;  1EWH A;  4ZK9 B;  4FXG C;  2SNS A;  1F9R A;  5JEA H;  3A8K E;  5EBD A;  4KY7 A;  5CGK A;  1EU3 A;  5NUC A;  5D65 A;  4ZAI A;  4A3M B;  3A8I E;  5C0X I;  1EU4 A;  1F2M A;  1PRT F;  3P7J A;  3S2D B;  1FR3 A;  5IT9 L;  1GHK A;  3W2D A;  3DEP A;  1W6K A;  1EY4 A;  3GTK B;  3HP3 A;  2KVM A;  1LAB A;  1WTX A;  1QNU A;  2MPM A;  1PZJ D;  1I4H A;  1F2Z A;  2F0J A;  1X3P A;  1HFG A;  2BCO A;  3GTM B;  2PCF B;  1PTO B;  4ILW A;  3K58 A;  1I6V C;  2E76 C;  1Q1E A;  1Y69 U;  5EKL A;  2LKV A;  3M7G A;  3KLR A;  1RDP D;  3OIQ A;  1PLF A;  1PRT C;  1NCV A;  4A3E B;  4HMI A;  1B4O A;  1L0Y B;  3I3C A;  1BCP F;  2F0U A;  2K28 A;  1WTP A;  4R9W A;  2WAQ B;  4TKO B;  4DAV A;  4K5V A;  2IJ0 A;  1ROD A;  1TS4 A;  3MTS A;  4EVO A;  1PRT D;  2PZU A;  5M5Y B;  5EKK A;  5KNB A;  3QOL A;  2XVS A;  2F0H A;  3S15 B;  3D6W A;  2RDH A;  2RSO A;  4J6H A;  1BUV T;  1HTL D;  1YNJ C;  1QWY A;  5FO7 B;  4AYB B;  2NBF A;  4L8J A;  4FXK C;  3C2P A;  5CV9 A;  1A3V A;  4CJ1 B;  3NTH A;  1SYG A;  3V05 A;  4U67 3;  3S16 B;  3SE0 A;  3VYS A;  2KCC A;  4S3S A;  2NB0 A;  2KEC A;  4OIJ A;  3DEO A;  1ZYR C;  4ZLT F;  1UUP A;  5I9O A;  5CV4 A;  4IUV A;  5DM6 3;  1R4Q B;  1E2Z A;  5K5P A;  3A8J E;  2BA1 A;  3D4R A;  3NE5 B;  2JE6 I;  4UDU C;  1VDZ A;  1TY2 A;  5ELE A;  5CV6 A;  1TWA B;  3EFX D;  3HZX A;  5I9P A;  2QCP X;  4HSV A;  1HUM A;  5FO9 B;  1O7L A;  2F0W A;  2K33 A;  5F2D A;  3HRZ C;  4ODG A;  3PUV A;  5T1G A;  4XQQ A;  2B39 A;  1MGS A;  3D31 A;  1H9K A;  3J81 E;  1EY5 A;  3PUX A;  1SE4 A;  5KEE A;  4OO1 G;  3S1R B;  1FYC A;  4RGT A;  2WKC A;  2FIN B;  1B9M A;  5JPM C;  5TSS A;  2I46 A;  4RA8 A;  4NKL A;  4X3T A;  4U68 A;  2EVB A;  1FNW A;  4L6T B;  1EZ6 A;  3V96 A;  2K1B A;  3BYT B;  1D5M C;  4IN3 A;  2B2T C;  2RA4 A;  3NXW A;  4BY1 B;  2E2D C;  3MVV A;  3K59 A;  2ICE C;  4G7Z C;  4DK1 A;  1TWF B;  4KY6 A;  4ZRZ A;  3QJY A;  5M3F B;  1SBB B;  4DNR B;  4ZQ3 A;  4XXE A;  2XN9 C;  4PNY A;  3VR6 A;  2RDG A;  5IGC A;  4G4K A;  4IUR A;  2TSS A;  5G3L D;  3I90 A;  5COR A;  2Q8T A;  2D5D A;  1D6E C;  1EYD A;  3M4O B;  1Y8O B;  2VNU D;  2JA5 B;  1JB3 A;  1VF7 A;  4PQX A;  5KYL A;  3C46 A;  2VUM B;  2IX3 A;  2K5W A;  2MUY A;  2D2C C;  1GJX A;  1I4R A;  3U9S A;  2RDF A;  2F0D A;  4C2M B;  2SNM A;  2B2Y A;  1I3Q B;  4G7O C;  4HCS A;  4CGY B;  1H9S B;  3JAM L;  3FRP B;  3NQI A;  2WKD A;  3IFT A;  2XIW A;  3K57 A;  4FO2 A;  1LO5 D;  3L7Z C;  3V2T A;  1TY0 A;  1CTM A;  1G91 A;  1ET6 A;  3WOE A;  2QKI C;  4K5W A;  2EJM A;  3S1M B;  1ENA A;  2NN6 H;  2K05 A;  3S1Q B;  1DXM A;  1JC7 A;  3NWS A;  2EOT A;  2DN8 A;  1STN A;  1I4Q A;  4BA2 I;  5AFW A;  4K2L A;  1D1K A;  1SJE D;  2DY8 A;  1WTR A;  1O78 A;  2VB3 X;  2GA4 B;  1JCK B;  5E3F A;  4DNT B;  3ERQ A;  1MSG A;  2B2U C;  1RJT A;  5JOB A;  2L12 A;  3HEJ A;  1AFP A;  1S5B D;  1TS2 A;  1IL8 A;  4K5X A;  4ULL A;  2L55 A;  4KN7 C;  3EA6 A;  1FNU A;  2I07 B;  2JYO A;  4RCO A;  4DU9 A;  3HOV B;  3IAY A;  2Z1C A;  3W3A A;  2F0S A;  4V0B A;  4DXG A;  2PW7 A;  4CBV A;  1VF5 C;  2NZ1 D;  4Q5V A;  2B2W A;  3TDQ A;  5C44 B;  5JVH 3;  4A93 B;  2CW0 C;  3DXJ C;  1TS5 A;  4WFN 3;  3A56 A;  1CZW A;  2ZT9 C;  1BCP B;  4X3U A;  1HTP A;  1NR4 A;  2EDG A;  2Q8R E;  3TN2 A;  1J8I A;  3H3V C;  1A15 A;  1QCB D;  2A69 C;  3T51 B;  3PIP 3;  1KNE A;  1A6X A;  4P2C B;  2EYP A;  2F0G A;  3X3M A;  3OWF A;  2M00 A;  3K5N A;  2K5D A;  1ZKO A;  2LS0 1;  1AEX A;  2A6E D;  5CV5 A;  1I4X A;  4IUP A;  1LT5 D;  2AQ3 B;  4IUN A;  2PO4 A;  1DYQ A;  3VYU A;  2QDB A;  4ZYS A;  3O13 A;  2CQA A;  2LY7 A;  4LAA A;  1SYF A;  5G3L F;  1NSN S;  2Z4I A;  4FF2 A;  4O1N A;  2C9O A;  3C1F A;  4QIW B;  2JXM B;  2EE1 A;  4I7Z C;  5I4D A;  3TP6 A;  1SJH D;  3H6M A;  3EQL C;  1RKN A;  4ABN A;  1EL0 A;  3PMF A;  5C3W A;  1EY6 A;  5HGT A;  2SOB A;  1TU2 B;  1STB A;  4H13 C;  3KLS X;  2H4O A;  4I65 A;  2KOL A;  3GD7 A;  4BWG B;  2NN6 G;  2A68 D;  4QF4 A;  3U9O A;  1TT2 A;  5EQ0 A;  5EPJ A;  2N88 A;  5JVG 3;  2N55 A;  2X6G A;  3QO2 A;  2O5I C;  4KD3 A;  3SK6 A;  1IKL A;  3OWE B;  4PMB A;  1E2W A;  3GV3 A;  2WAC A;  1U4P A;  4E6I A;  2OT2 A;  1I4P A;  1C4Q A;  3URY A;  2R61 A;  1SND A;  2K04 A;  5IOC A;  2D9U A;  5COY A;  5CV8 A;  4KJN A;  1HPC A;  3K0Y A;  5M5W B;  2G9H D;  4IFD I;  3IL8 A;  4M1U B;  3TP8 A;  3PO2 B;  5D3D A;  4TQU S;  4RGN A;  2BA0 A;  4DA2 A;  1SNQ A;  2JP1 A;  1AP0 A;  1MBY A;  1TVX A;  2RVL A;  1BOS A;  1SAP A;  3F2U A;  2VXW A;  1O7Y A;  5IGG A;  1B2T A;  3MXG A;  3BZD B;  1U4R A;  5C6A A;  1CZG A;  2XSC A;  4QCL A;  1E2V A;  1H9J A;  3J80 E;  4KV6 A;  1Q1B A;  2PMZ B;  2R3Z A;  3I8Z A;  4XT3 B;  5IGE A;  4FF3 A;  1ENC A;  2NVQ B;  3QIA A;  4V19 0;  1STA A;  3MC0 B;  5EKI A;  4IZ8 A;  5D3I B;  1ESF A;  4LJZ C;  1YNN D;  3LWU A;  1BXT A;  3BVG A;  2EYL A;  4KI0 A;  2Z8L A;  1RCV D;  3MFG A;  4A3K B;  4DAY A;  4B9X A;  5A2Q L;  1DOL A;  1TWC B;  4DFA A;  3HOX B;  3NK9 A;  1TQO A;  1KTK A;  2JA6 B;  3MWY W;  4MN3 A;  5IOD A;  5I6Y A;  1G8Z D;  2B2T A;  5EBC A;  4PV1 C;  1AZQ A;  2TMP A;  3FDT A;  2PYK A;  1G2S A;  4A3D B;  1EYA A;  4RFB A;  3T53 B;  3S9W A;  2NVY B;  3RZD B;  3RLF A;  1LTI D;  3R93 A;  2K7V A;  3OMG A;  3FMC A;  3TP5 A;  1W6J A;  4QMG A;  1CQV A;  1RD9 D;  3J7Y W;  2F3W A;  1S5C D;  1F9P A;  3I4N B;  1VMP A;  3Q0A A;  2MHV A;  3LWE A;  4C1N I;  5I6W A;  1WTO A;  4HTH A;  3D4W A;  5IGD A;  3EJI A;  1G6Z A;  1SFO B;  4Y7N B;  2B8F A;  3NP8 A;  2ICI A;  1SYB A;  5C0X G;  4JBW A;  3QG1 A;  3NWT A;  1QOH A;  1FNV A;  1JOQ A;  3FKI B;  3ND8 A;  3AMU A;  2YYZ A;  5CYU A;  1IKM A;  2XRQ D;  4RHS A;  2L5T A;  1SYD A;  3P1H A;  1GUO A;  5LL6 S;  3H91 A;  4A3J B;  2OF1 A;  1LTA D;  4IFD G;  1DJR D;  4HN7 A;  3CKI B;  3FEW X;  3RMH A;  1FD7 D;  2BDO A;  4QB4 A;  3A7L A;  2A69 D;  3T4A C;  1SMY D;  3SK4 A;  4XQJ A;  2L1B A;  4XT1 B;  1YNJ D;  1IW7 D;  5T1I A;  2F0M A;  2F0L A;  4BBS B;  2CW0 D;  2G9D A;  4IQZ A;  5ELD A;  4DK0 A;  1A2T A;  4H0L C;  1UEA B;  5E4W C;  2B2W C;  1EQT A;  3GQB A;  1EIH A;  1J9O A;  1GHJ A;  2EY6 A;  3OSO A;  2J7Z A;  1EY9 A;  1XTC D;  4HSP A;  3NTI A;  1SYC A;  1HCZ A;  1IHZ A;  3BG3 A;  3CRL C;  3BDC A;  4IUT A;  2AUK A;  1B3A A;  3S17 B;  2B63 B;  1ZXT A;  4XDX A;  1U9R A;  3GTL B;  2L11 A;  1KDA A;  3TZU A;  4C1N K;  1GUG A;  1STG A;  1B9N A;  2KCN A;  2R93 B;  1V1P B;  2RSN A;  5C0X J;  2EYJ A;  1HQR D;  5D14 A;  2IW3 A;  4KJO A;  2F03 A;  1F9S A;  2PZT A;  2F0N A;  5ISR A;  2NUC A;  4KMU C;  3Q6S A;  2HDL A;  1BCP D;  3QB3 A;  3MZ5 A;  2B2V C;  3E0J A;  5EGT A;  4F8M A;  1PFB A;  5C4H A;  4RWS C;  3MA2 B;  5KYI A;  1LTR D;  4DGZ A;  1HXY D;  4WRD A;  1HUN A;  4KD4 A;  3VYR A;  5IT9 E;  1PZK D;  4B9W A;  4NMZ A;  1LTS D;  2F4I A;  1C48 A;  1X32 A;  1BCP C;  4RH6 A;  5JAV A;  2BDN A;  4UAI A;  3EVQ A;  2FFK B;  3NTK A;  3G6J B;  2EYO A;  3Q24 A;  3OHX C;  3HS0 C;  3PUZ A;  1HFN A;  1BF4 A;  2HUG A;  2NWG A;  1XWE A;  2AWN A;  2AQ1 B;  1EQV A;  4C3H G;  1KAB A;  3E6Z X;  2WII B;  4RGM A;  5K36 G;  1XYI A;  2B2Y C;  3C3L A;  5ELB A;  1DOK A;  2M2L A;  2F0K A;  1IYU A;  3KK7 A;  1S4Z A;  1SNC A;  1BNZ A;  1SNO A;  1II3 A;  1EIG A;  3X3N A;  4EQP A;  1SDF A;  3KBX A;  5BN5 A;  3OMC A;  5ELC A;  2QIL A;  4IFD H;  3M4Y A;  4DXF A;  3K5L A;  1DM0 B;  3IFD A;  5J22 A;  4C3J B;  3VA5 A;  1QG7 A;  3M7N A;  1M8A A;  3K6O A;  1SSO A;  1B53 A;  5CR3 A;  2J4X A;  3HOZ B;  5C4J B;  1SEB D;  4EQO A;  5M9O A;  2K5Q A;  5C4Z A;  3L3O C;  2RKS A;  1LV9 A;  3C1E A;  3AU7 A;  4DAP A;  5A2Q E;  1CHQ D;  1GUW A;  2F1M A;  1H9S A;  4XYQ A;  3R3O A;  1UNS A;  4Z9C B;  2ENB A;  2E74 C;  2HDM A;  1OO9 B;  4J1M A;  4YIJ A;  1CK1 A;  5EJW A;  4IUQ A;  1F2Y A;  3L9A X;  2YU9 B;  1LT3 D;  1U4L A;  4HMJ A;  2XWJ B;  3RZO B;  2K03 A;  1GUT A;  3H09 A;  3TZD A;  3GTQ B;  1BO0 A;  5KGU A;  3I4M B;  5C3X A;  2B2V A;  2EXZ A;  3KBG A;  1STH A;  1D2B A;  5DM7 3;  4OO1 I;  1NAP A;  3GTP B;  3N52 A;  3VR4 A;  3S14 B;  1Y1V B;  2IPK D;  1S5D D;  3MFY A;  2JSO A;  4KHZ A;  1BBX C;  2F0I A;  3GP7 A;  2IT1 A;  3KUP A;  2FMM A;  4FP5 D;  1Z47 A;  3T16 A;  1QNK A;  2IX1 A;  2F0O A;  3A7A B;  4HR7 B;  4K6D A;  4ID6 A;  2PQE A;  2HCI A;  3I73 A;  5CC4 A;  1H9M A;  4ZUJ A;  1EY8 A;  1BQQ T;  1CA5 A;  2X69 A;  1Y8N B;  1EFI D;  4CHT B;  2PPB C;  3SK8 A;  3J80 L;  1QJO A;  4C3I B;  5CBE E;  1D5Z C;  1PRT B;  2H1E A;  5EPL A;  2IL8 A;  4HED A;  3GTO B;  2RQX A;  1WTW A;  5J39 A;  3SK5 A;  1O80 A;  2RBM A;  2L9H A;  2WB1 B;  4EGV A;  5FK9 C;  2M9V A;  4O42 A;  2CVR A;  1SE3 A;  5C4X B;  4F87 A;  3HGB A;  1TII D;  3K5M A;  3PUY A;  1JOR A;  1CQF A;  1G29 1;  2F0P A;  2KHS A;  2A5H A;  1JOO A;  4KKS A;  1EEI D;  2WV6 D;  3BYY B;  1YNN C;  2ID0 A;  3HOY B;  1KDB A;  1S5E D;  3MXN A;  1MD2 D;  1V43 A;  2AWO A;  1T5E A;  4CJ2 C;  1JQY D;  4OO1 H;  1F2L A;  2PZW A;  2EYF A;  4OL7 A;  1PYW D;  2BE5 D;  4C3I G;  1DCZ A;  1OXS C;  1R4P B;  4C56 C;  1ICW A;  1OXX K;  5DAU A;  5ELF A;  1IYV A;  1LLR D;  1NUC A;  1TWG B;  3TSS A;  1ILQ A;  1GUS A;  4KY5 A;  2NVX B;  1ESR A;  4G7H C;  3KLS A;  1EWC A;  1TS3 A;  4NP5 A;  3SHL A;  2WIN B;  3ERO A;  1B50 A;  1Q3L A;  3CQZ B;  1PDQ A;  5BN4 A;  3HKZ B;  5JPN C;  1CM9 A;  1V1O A;  1E0B A;  1OXU A;  3M3Y B;  3BVZ A;  5KNC A;  4CKB A;  3NHH A;  4RGO S;  4G57 A;  4LMQ D;  2A68 C;  1DON A;  3BS1 A;  2ZXP A;  4KKT A;  5KIX A;  1SNM A;  1SXT A;  2O5J C;  1JE4 A;  4XQN A;  4RKL A;  2FHT A;  2A6H C;  4ME5 A;  3P75 A;  4BA1 I;  1ILP A;  4H7B A;  1PTO H;  4CKE A;  4DN4 M;  4FF4 A;  3SR1 A;  5BN3 A;  1C8C A;  2ZXO A;  1FGB D;  4LK1 C;  3NBI A;  3VR3 A;  5M5X B;  4DF7 A;  5DNF A;  1PXU A;  1U4M A;  2X6L A;  2O4X A;  5FLX L;  1LT6 D;  3Q23 A;  2VB2 X;  2JEA I;  2K32 A;  3GO5 A;  1JWU D;  3K7A B;  4TSS A;  1LAC A;  5A35 A;  2F0T A;  3HOU B;  1HA6 A;  2EY5 A;  2EY2 A;  4K6L A;  4C3J G;  1PTO D;  5IGF A;  4FVM A;  3OOC A;  4WJW A;  3CU7 A;  1KDC A;  3HOW B;  2MP1 A;  2MJ8 A;  2KA7 A;  1F77 A;  1DZ1 A;  2O2L D;  3K5O A;  1WVL A;  5E4X A;  1Q12 A;  5FKA C;  1HA5 A;  3QOJ A;  5E1F A;  2CHB D;  3DUZ A;  4R8I A;  2NVT B;  2F0V A;  3RD4 A;  3A55 A;  4IFD J;  4BS9 A;  1KNA A;  4BY7 B;  3TBI B;  4M8A A;  2EJG C;  3J7A V;  1CHP D;  1LTT D;  1M4V A;  5JEA J;  4F88 A;  3UI2 A;  1STE A;  4MIU A;  4Q0F A;  4CKC A;  1PFM A;  1PMR A;  1V8Q A;  1STY A;  1CT1 D;  3NPP A;  3ITP A;  1A2U A;  2EY1 A;  4EQN A;  2EZV A;  2SDF A;  1L0X B;  2JA7 B;  2B2U A;  1LTB D;  3BVM A;  2BE5 C;  1B44 D;  4KN4 C;  1HRJ A;  2EJF C;  4BBR B;  1PTO F;  3TME A;  5K36 H;  1WTQ A;  1V1P A;  2KED A;  2OXP A;  1EOT A;  5KRU A;  1S5F D;  3G7L A;  2E2I B;  3S1N B;  2R92 B;  1G2T A;  3A54 A;  1SYE A;  3PUW A;  3DWQ A;  2A74 C;  2QF7 A;  4HAE A;  3T13 A;  3JAM E;  1D5X C;  3VYT A;  1GXD C;  1MSH A;  2NYZ D;  5LL6 X;  3R2T A;  4PMW A;  3I91 A;  2IX0 A;  3D4D A;  1OXT A;  4N9T A;  3DM1 A;  5C0X H;  2KQ3 A;  2F0E A;  2R6G A;  4XIG S;  3SEB A;  3R8B A;  4FYD A;  2A6H D;  3PV0 A;  3SXH A;  1LTG D;  4MHE A;  1A3T A;  3OIP A;  3MHB A;  1F9Q A;  5CV7 A;  3I70 A;  5CMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...