5C4ZA

Crystal structure of staphylococcal nuclease variant delta+phs l25h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKHMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c4zA00
4ZQ3A 2F0QA 1SNQA 2RDFA 5CV9A 5JOBA 1NUCA 4F7XA 4K14A 5NUCA 5CV5A 1F2YA 4DU9A 4DF7A 5I9OA 1SYBA 2F0DA 2EYMA 3SR1A 4I65A 5J1ZA 4B9XA 4EQNA 2WACA 5CGKA 1STHA 2SNSA 1II3A 4ID6A 1TQOA 3PMFA 4KJOA 5E1FA 2OXPA 4EQOA 4DGZA 2PYKA 1TR5A 1STGA 5IIFA 1A2UA 1F2ZA 5IGGA 2F0EA 4EQPA 2F0FA 3OWFA 2KQ3A 3MEHA 3D4DA 3DHQA 3MHBA 3TP7A 2F0HA 1SYEA 2EYLA 2SOBA 4NP5A 4S3SA 2EY2A 4F8MA 5HGTA 2F0MA 5EKLA 2F0KA 4B9WA 4QF4A 1EYAA 1KDCA 4ZUIA 3TP6A 4NMZA 4N9PA 2EY6A 5C4ZA 2RKSA 4K5XA 2EYOA 4KY6A 2PZUA 4K5WA 4E6IA 3EJIA 5J39A 2SNMA 1ENAA 3BDCA 3NQTA 3SK8A 3TP5A 3LX0A 1EY7A 4N9TA 3SHLA 5I9PA 4KHVA 4TRDA 1KABA 1EZ8A 3OSOA 5KIXA 3R3OA 3DMUA 2PZTA 2F0IA 3TP8A 4OL7A 4K8IA 4IUNA 5KGUA 3EVQA 3HZXA 4YIJA 4IALA 2F0WA 3ERQA 4K5VA 2F3VA 3RUZA 5K5PA 5KYLA 1A2TA 4K2KA 5M9OA 1TT2A 4PMCA 5C4HA 1A3VA 4QMGA 4RKBA 3C1EA 4EVOA 5C3XA 5E3FA 3MXPA 4ODGA 4WORA 5C5LA 2PW5A 2F0GA 2NUCA 2PQEA 1EY5A 2F0TA 3NHHA 2F0JA 1AEXA 1KDAA 2ENBA 1JOKA 3NP8A 3OMGA 4KTAA 4KY5A 4KD4A 4KY7A 4QB4A 5CV6A 5CV8A 5I6YA 4J1MA 1U9RA 4KD3A 2KHSA 1SNOA 1EY4A 1IHZA 4HTHA 3T16A 5C6AA 5C3WA 2F0UA 5CV4A 5IGFA 5DAUA 3MZ5A 2EYJA 4NKLA 1SNPA 1EY0A 5IGBA 3U9OA 2HQEA 2F0SA 3ITPA 1SNMA 2PW7A 3H6MA 5KYIA 1STAA 2EYPA 1SNCA 5EKKA 5F2DA 5J22A 2EYHA 2RBMA 4G57A 1A3TA 3BDLA 1EZ6A 2EY5A 3P1HA 4LAAA 5JAVA 2EXZA 3P75A 1STBA 5I6WA 1NSNS 2F0LA 4K2LA 3NK9A 5CC4A 2M00A 3NXWA 1EY9A 1EY8A 3VA5A 5IODA 1SYFA 4WRDA 1EYDA 5C5MA 3SK4A 4ZUJA 5KEEA 2F0OA 4MIUA 4K8JA 5IGEA 5CR3A 1SYDA 4NDXA 1F2MA 4J6HA 3S9WA 3SK6A 5KRUA 3MVVA 1JOQA 1RKNA 2F0VA 1SNDA 1EY6A 1SYCA 4ME5A 3D6CA 4PMBA 2EY1A 5EGTA 2LKVA 1A3UA 1EYCA 3D8GA 2OEOA 3C1FA 3SXHA 5HURA 3D4WA 4DFAA 4HMIA 1KAAA 2OF1A 2QDBA 4PNYA 3E5SA 2F0PA 4K6DA 5ISRA 3EROA 3HEJA 3QOLA 3QB3A 4R8NA 3NUCA 4IZ8A 3TMEA 5IGDA 1JORA 1STNA 2F0NA 4KJNA 3T13A 5IGCA 4RKLA 3QOJA 3OMCA 4HMJA 5CV7A 2O4XA 1JOOA 3V2TA 4KV6A 1KDBA 1ENCA 1SYGA 5DEHA 3SK5A 2PZWA 1STYA 1EQVA 5IOCA 4H7BA 2F3WA 2EYFA
chains in the Genus database with same CATH superfamily
4FVMA 4L5RC 2MFIA 4A3FH 4IQZA 1C9OA 2RQXA 2ZT9C 4DUYL 1J8IA 2NN6H 1Y1WB 1B3AA 5BN3A 3NTKA 1A8VA 3DUZA 3S16B 3GTQB 2KJXA 1BOSA 2BE5D 3J81L 4AYBG 3GV6A 4A93B 4A3DB 3X3NA 3A54A 3K8AA 4GNXC 3HOUB 1AP0A 2A19A 5GAGC 4F8MA 2F0MA 1XPRA 1X65A 5LMUL 1I4RA 3HOXB 2IY5B 2UUCQ 4POFA 3LWUA 4XXEA 5A2QE 4DAVA 5J39A 3MA2B 3R93A 4DV7L 2AUKA 1HNWL 4HIKA 4HIMA 1SRUA 4KLKA 3S2HH 2PZTA 5IYBG 1E1OA 2F4IA 1J9OA 3EVQA 2H5XA 1CK1A 4ZKCB 3PUZA 3HKZE 4GKKQ 4BY1B 1PYSB 3KLSA 2Q2IA 1B1ZA 1G8ZD 2ZXPA 2Z6KA 3IFDA 4O1NA 5E3FA 3CCVA 2WB1G 3CP0A 2EOTA 4JI8L 4Y7NH 5IWAQ 1N33Q 1K73C 3T51B 3V96A 1IBKL 1GUTA 2QF7A 4A3MB 2K50A 2A73B 1CFMA 3BVGA 4JW0A 2VQEL 1PFMA 4LFAQ 1OXTA 1X54A 3NSWA 3U9OA 4CJ0B 3S15B 4QQBX 1S5CD 1YNNC 4DV0Q 1E22A 2ZXRA 1D6EC 4OO1G 1X3GA 3K7AB 1S5BD 2PMZB 4A3JB 5JJIA 3HOZB 4DK0A 3NK9A 4JBWA 3URYA 2KVMA 3KDFB 2FINB 1F2MA 3A56A 4JI2Q 4UAIA 3J80i 2ID0A 4KN7C 1IL2A 1W3SA 1SE2A 2XGTA 3WOEA 3UE1A 1NMGA 1N36Q 3S1RB 1GXDC 4C3IB 2E2HH 2R93G 3GD7A 1XXGA 4QUFA 1F9SA 2F0NA 3T13A 2K5WA 1B2TA 1EFWA 1G6PA 1LABA 2JYOA 4DR7Q 1SYGA 1VDZA 4OX9L 1NUCA 4F7XA 3GTKB 1HHVA 4ZAIA 4TSSA 3K5MA 1BCPD 5E1FA 1T5EA 4DV5L 4JYAQ 1PFNA 4DR3L 3I4LA 1A0IA 4L6TB 4AH6A 3OWFA 4HN7A 2SOBA 4HCSA 2CH4W 1HZCA 3DM1A 5DNFA 2MJ8A 1G6ZA 2EY6A 1UAPA 4OWWB 4AYBB 4A93G 2EYOA 1XNRQ 2RDHA 2PZUA 3N6RA 3H3VH 2SNMA 1PH6A 1N9WA 2L5TA 2OQKA 3M3YB 3K5LA 1LT5D 3VR3A 1SE8A 2A6ED 2E5LL 1KABA 2CW0D 1OXUA 5FO9B 2J0TD 2B63B 3HKZB 3D6WA 5M5YB 1NR2A 4WJWA 1G291 3RD4A 1Z9FA 4EVOA 4QMGA 1K8AC 1HZ9A 4LF7Q 3U58A 1EWCA 5LMNW 2NVQB 3T53B 3PIO3 1OXXK 2NN6I 5CORA 1AE2A 2X6GA 5T1GA 1MJCA 1U5KA 2DN8A 2B2TA 2WINB 3MZ5A 1FJGL 2QILA 5EAYA 1SNMA 2D5DA 2I5HA 5KYIA 2C35B 1G91A 4JI1Q 4JV5L 1RL2A 1CHQD 4DNIA 4FP5D 2ES2A 3PQIA 4LUVA 4DR1Q 5AJ3Q 1KXLA 1D5ZC 2LMCB 3D3RA 1WTHA 1RODA 5KRUA 1STEA 1AW7A 4BS9A 4DV4L 3TREA 5HURA 2PPBC 4AYBE 3H09A 5ELBA 4X65Q 1HR0W 4ZKBB 2Q2TA 1Z47A 3E5SA 1B9NA 2KCTA 4K6DA 4C56C 5I2YA 5FLXc 3EROA 3HEJA 3F8TA 3I73A 5C44B 4P74A 3J81c 1JOOA 1C48A 2R93H 4KHPL 2NVYB 3GP7A 3R8BA 5JEAH 1PH2A 1SNQA 4FF2A 1Y8PB 4C3IG 1ENFA 2AQ3B 4EQNA 1RF2D 1E3PA 4ABNA 2SNSA 2HCIA 5CGKA 5IP7G 4OIJA 5C3EG 3Q0AA 1O78A 3W3AA 5G3LF 4UP8A 5C44G 2KHIA 3I91A 1FVIA 2PYKA 2ATWA 2KEEA 1O7YA 4R1JA 4K0KQ 3TZDA 5ELOA 3D4DA 1JR0D 1VCIA 2AWNA 1N32L 4EX5A 2F0KA 1PLFA 3MTSA 2YU9B 3J81E 4IJLA 1HNXQ 4NXMQ 3PF5A 2K7VA 1N36L 4K5WA 2VXWA 4KK7A 1H9MA 1I6HH 2PCFB 3KF8A 4F88A 3M85A 1VQGA 1EY7A 3UDXA 4TRDA 2CWAA 2UXBQ 2EIFA 3DMUA 3TP8A 4P72A 2F0WA 3ERQA 5K5PA 2QDLA 1A2TA 3STBD 4CHTB 5HY6A 4RGNA 2MHVA 3UDIA 3A7AB 4G7OC 3MXPA 4R4TA 4IUQA 2HHHL 5CV8A 3Q23A 4RGOS 2B63G 2IT1A 3FVQA 1YHBA 1Y8NB 2Q8TA 2BE5C 2EXDA 4A3LH 4FXDA 2NZHA 1SNPA 3KF6B 2BA0A 4CKEA 1UUPA 5C0XH 5IE8A 2J7ZA 5EPJA 1WTOA 1TWFB 5ELCA 4BA2I 3P1HA 4GLAC 2AKWB 1STBA 5I6WA 1SFOH 2O5JC 2F4VL 2CKZB 1QVCA 5KNBA 1JWMD 3BZKA 2D0PA 4LW1A 1UE6A 2HIVA 4A3DG 1LTBD 3KLSX 1QE6A 4L8JA 2UXCL 3D8GA 4NW2A 3G4SA 3RN5A 1HPCA 4B3RQ 2Z9HA 4JBJA 1IL8A 4LF6Q 1VQ8A 4OXPA 2XRSD 4R8NA 1SAPA 1STNA 2VUMB 3QOJA 4JBMA 5KNDA 3SK5A 1STYA 3D0FA 3P20A 4KMUC 3D31A 3S17B 1F2YA 2JA6B 1H9RA 4ZK9B 5JEAG 5BR8L 4C3IH 1YNND 1XMQQ 3NWTA 1ESFA 1OXVA 5IIFA 1W6KA 2VL6A 1GJXA 2F0EA 5IP7H 5C3EH 2CHBD 5JEAJ 3G7LA 3IAYA 2DUDA 4NP5A 2EY2A 2DJFC 1HR0Q 5JJKA 3TP6A 2R7ZB 3GTLB 4X65L 4E6IA 2AQ1B 2FHTA 4JI4Q 3RN2A 1ENAA 2ZJQA 3CC4A 3B6YA 3NTHA 4BBRH 1KHIA 3FMCA 1FD7D 4B3SL 3L0OA 4JI8Q 4CDEC 4K2KA 1U4PA 3PUWA 2V1CC 1CKOA 4B08A 1GKHA 3VR5A 1VQCA 2N55A 4MN3A 4LF8Q 4G7HC 4QB4A 3TRZA 4PQXA 1EY4A 1K0RA 1SMXA 2NN6G 1LO5D 1F2LA 4M8AA 4A3BG 1VQHA 2B63H 4XDXA 3AB9A 5AFWA 2YTVA 1IYVA 2I46A 4OEMB 4CBVA 4RG1A 4J15A 3L3OC 4JI2L 3PIOA 1VQ4A 4L5QA 3GTOB 4MTNA 3JAME 4HSPA 2KOLA 1YHQA 4JI5L 5M5YH 2JA9A 4L5SA 3UDGA 5IP9H 4Q0FA 2UUAL 4N8FA 2K5NA 3VR4A 2MO0A 1VQIA 3PSIA 4A3DH 3A5ZB 4PNYA 2F0PA 1KAWA 3D4RA 5IGDA 4JI6L 3AMUA 4XT1B 5IYBH 4RKLA 2A6HC 2O4XA 2QCPX 1KDBA 2MP1A 4ZLTF 4QJFA 2N78A 4DK3C 4BBSH 5FK9C 1HZBA 3EFXD 1CI3M 3K58A 2DGYA 4IURA 5E7NA 1VF5C 1CKNA 3HKSA 3TQYA 3DWPA 4RAUC 4IN3A 2L1BA 1LACA 2DY7A 3JAML 1VQAA 4IOCA 4FF1A 4UPAA 1S5DD 3VYTA 1Y14B 1QNUA 3DM3A 3PMFA 5A35A 1DYQA 1CZGA 1S72A 2UXDQ 1STGA 4FO2A 5FLXE 4RWSC 5IT9c 4ALPA 3G71A 2UXDL 4B3TL 2F0FA 2JN4A 3MEHA 2MNAA 1RJTA 2CH4A 2XTIA 1DCZA 1HTPA 3U4ZA 3TDQA 4A3MG 1XYIA 2NYZD 2CCZA 4MZ9A 1BF4A 1NMFA 4JVZA 3TS0A 3KF6A 5LHY1 2VB3X 3HS0C 5IT9E 2RKSA 1VQBA 1K0SA 3MC0B 4BY7B 3KJPA 1ET9A 1YI2A 3M7NA 2EVBA 5E4XA 3I55A 1K28A 1EUJA 4FF4A 3R3OA 4DUZQ 1J5EQ 4X6AH 1TWFH 3MXUA 4KKTA 3CW2C 1XWEA 3F2CA 4ODGA 4I7ZC 1EIGA 4WORA 3SE0A 3T1HQ 3QG1A 4CJ2C 1Q81C 4DA2A 1L2FA 3T16A 1I6HB 1S40A 4CKBA 5IGFA 1PH1A 4BY7G 2R6GA 2RA4A 4XT3B 2KUMA 2F0SA 2ZJRA 3M4YA 1STAA 4OELB 5FO8B 1VMPA 3KBXA 3QO2A 2VQFQ 1WTWA 4QGUA 1HCZA 1HUMA 1VQNA 2KECA 1IW7D 2NVQH 2HDLA 3E3XA 4B3MQ 2K04A 3KLRA 3GTMB 3K6OA 3Q22A 1BVSA 4OGQC 3FKIH 4K6LA 1HQMC 5LL6X 1GHKA 3QWNA 3I8ZA 3D4WA 1DONA 1WCMB 5GAHC 3K7UC 5FOBB 4IPHA 4KHPQ 1VQPA 5IY0A 5FKAC 4IFDI 5JJZA 1TS2A 1GUOA 4KV6A 5T1IA 4IPCA 2V4DA 2LXJA 4H44C 3S14B 2F3WA 1X56A 4DV3Q 4DV1Q 2BOSA 3CQZB 3PIP3 3SR1A 4BBSG 1V1PB 4CDFC 3A8JE 2AHOB 1STHA 1X3PA 1VQ9A 3J7AF 1PZJD 1PTOB 3MXGA 1L1OC 4KJOA 3AFPA 2IW3A 2KCNA 1ML0D 3FP9A 2D62A 2RDGA 3HFZB 5FLMG 2R92G 3E0JA 1HXYD 1LTRD 4IFDJ 2WV6D 2B2VC 1DOLA 1WTQA 4X62Q 4GN4B 1YJWA 2F03A 1MGSA 1BNZA 2JQOA 4A3MH 2JXMB 4TQUS 5M5WB 1B9MA 4JI0Q 4N9TA 4JI6Q 4RMFA 5C4JH 1I94L 1GOZA 4DR7L 4IUNA 2YTXA 2BH8A 3RNUA 3AEVA 4DR4L 4PMCA 1ZYRD 5C3XA 1EIYB 1Y1VB 5C5LA 4LUOA 1JICA 4HJAA 1X3FA 1AEXA 1JC7A 4QIWE 2B2YC 3BYTB 4A76A 5DAUA 1H9SB 5FO7B 1PZKD 1JCKB 5C44H 2EDGA 4A3EB 1E2VA 5EKKA 5J22A 2CW0C 2F4VQ 4YHHL 4CDCC 4BY7H 3CMAA 1VQLA 4O42A 5LMUQ 1PA6A 1T9HA 2EXZA 1U4LA 5DM63 3J80E 1EQTA 1LT6D 5C4XG 1C8CA 3S1MH 3HGBA 2IX0A 1SSOA 2NZ1D 4X3SA 4DK1A 1U0LA 5M5XB 2PI2E 1EY6A 4NXNQ 2E5LQ 1EYCA 1SEBD 5DM73 3SXHA 4GN5A 4C3HH 4HMIA 3FKIG 1RDPD 3EQLC 2E2IB 2R61A 5IGCA 3KUPA 4C3JB 3OMCA 4V190 1SDFA 2FJ2A 4LK1C 3CKIB 1I5FA 1TWGB 3W1GA 1IBKQ 1WOCA 2L11A 1WCMG 1M8AA 4JI7Q 3C3LA 4ILWA 2OT2A 2ICEC 1A15A 4BBRB 5C0XG 3J81j 3TP7A 3M4OH 1UEAB 1H9KA 1SYEA 1B8AA 1YZ6A 3HOVH 3GO5A 5HGTA 3GV3A 1YBYA 3O13A 1FGUA 1A63A 3H3VC 4MTKA 1K8MA 2AUJD 4NMZA 1IKLA 3OTOQ 3TSSA 4RFBA 2IHEA 4LJZC 1M90C 1PDQA 5E4WC 3OOCA 4V0BA 5I9PA 4GNXB 3S14H 4OIKA 1F9QA 1QNKA 2F0IA 4FF3A 3VYRA 5EQ0A 2B2TC 1Q7YC 1TT2A 5IWAL 1KRSA 1I50B 2IX1A 4JI3Q 4HIDA 3S2HB 3NHHA 4ZRZA 2VQEQ 3FKIB 4KTAA 2P5ZX 4KD4A 1I3QH 1TWCB 2KHSA 1FR3A 2PNRC 3H91A 1RTNA 1FYCA 1XPOA 1HNZL 3ER0A 2EYJA 5C4JB 3J7AV 1SJHD 1UEBA 4HJ5A 4J8QA 4CDDC 4BXXH 2L15A 1DM0B 3RLFA 4AIMA 1D1KA 1Q8KA 3EIVA 1YJNA 2GN5A 3TBIB 4NXML 2B8GA 3MAQA 4C3HB 3VA5A 2CQAA 1KNEA 2NTTA 3RZDB 2HT1A 3KJOA 1AZQA 1JOQA 4L5TA 2O2LD 4NPSA 3HOWG 3PUXA 1IKMA 2ZTEA 2JA5B 1CT1D 2K5VA 1SBBB 3I3CA 5EKIA 2PO4A 2X6LA 3VR2A 1LTGD 2YV5A 4Q5VA 1IYUA 1Q1BA 1FNUA 2JJQA 4Z9CB 1PTOC 3K81C 1QVFA 1W2BA 5GAEC 1QILA 4DAPA 1XNQL 4HMJA 3GTQH 3S1NB 1IBLQ 2Z0SA 2A68C 1NY4A 1EQVA 4DN4M 3PO3G 4LAAA 2EJGC 4JOIA 3GTOH 3GTMH 1H9JA 4I65A 3OW2A 2ALYB 4B9XA 1JMCA 2WACA 4OHJA 2JE6I 3KDFA 4JV5Q 3PCOB 1ICWA 2HDMA 4CKCA 4A3BH 1MKHA 2JEAI 1NAPA 4DR5L 1TY0A 2K5QA 1CKNB 3EBEA 1I50H 1WTRA 1R9TH 2XN9C 3CC7A 4KY6A 4RHSA 3L2PA 3SDZA 4DAMA 3NBIA 4G4KA 1K8OA 4R4QA 4RH6A 1Q86C 1B3QA 3NQTA 1X6OA 5IP9G 1EZ8A 1CSQA 4LF5L 4PMWA 1CUKA 3CQZH 5KGUA 3OWEB 1D1IA 3T1HL 4A3JH 3M3YH 3R2TA 1PTOH 2A6EC 1TS5A 3RZOH 3PUVA 1HFGA 5LMNQ 3RZDH 3S2DH 3U4VA 2KHJA 2PQEA 1EY5A 4WFN3 5EPLA 3DEPA 1JOKA 1CSPA 3CD6A 4J1MA 3HOVB 1DXMA 4DV0L 4DUYQ 3S1QB 1EYGA 2K1BA 4NKLA 3GTJH 1LTTD 3MFYA 1GVPA 2IWHA 2NVTH 4GN3B 1FNVA 3NTIA 1QG7A 4FXKC 5M5WH 1LUZA 1TWGH 1WYDA 5IODA 2RHQB 2D0OA 3KOJA 3ZJYC 5KEEA 1ASYA 5ELDA 3A8KE 5CBEE 1MSGA 4J6HA 2ZTDA 4HSVA 5EKLA 5HGQA 1MD2D 1VQJA 2Y0SE 4A3KG 3NEMA 2JA6G 1CHPD 4GZYC 3GTJB 1ILPA 1PH4A 3HOWH 2M2LA 3NENA 3CCUA 2EPBA 3HP3A 4LFCQ 1D8LA 4P2CB 4YY3L 1SROA 4IFDH 4PV1C 4DV3L 2BDOA 1LT4D 2Q2UA 3LWEA 1YVCA 3VYUA 5DLQE 1UE1A 4DF7A 1SYBA 2B2VA 3PO3H 3ULPA 1EU3A 1WD0A 1PXUA 1K3BC 3L9AX 4O0AA 1Q82C 1B70B 4R8IA 1ZXTA 3K0XA 4EQPA 3NE5B 4JOIC 2B3GA 2HQLA 4N8X1 1EWHA 1AN8A 3BYYB 4DXGA 2A69C 4X64Q 3KFUA 1KTKA 4QF4A 4LF4Q 4DR2L 4X66Q 1VS0A 1MHWC 3F2DA 1OTCA 1F77A 3CHBD 1IBMQ 3WOFA 5JVG3 2KCMA 1OXSC 4LFBQ 4PZ7A 1UNSA 3CCLA 1IYJB 1RTOA 2ZM6L 2D2CC 1KIXA 1KLUD 4K5VA 1S5FD 1EEID 1N34Q 1IW7C 4RGTA 1MIUA 1JB3A 4UP9A 4XQNA 3S1RH 1L0WA 1K83H 4POGA 4HJ7A 1X32A 1KDAA 3OMGA 1AFPA 4KY7A 1NE3A 1BKBA 2B39A 1HA6A 1PVOA 3PIPA 1QUQA 2FMCA 4HJ8A 1LTID 1U4MA 4YHHQ 4UHVA 3ITPA 1H95A 3BJUA 4DPGA 1SNCA 3H94A 1KC8C 5JAVA 2EY5A 2KENA 3BVZA 4LF9L 5D3DA 1HUNA 1NSNS 4K2LA 3OIPA 5FLMH 1DOKA 1TVXA 2R92H 2NTSA 1SJED 4GOPC 4FYDA 4XQQA 3GDEA 4A3EH 1KNAA 1BUVT 1PRTF 1SYCA 3ND9A 4A3IG 1PHJA 3PO3B 1YEZA 3RLNA 2A68D 2N3SA 3Q6SA 2A69D 2KA7A 5CBAE 3F2BA 1EOVA 1TS4A 3NUCA 4IZ8A 1PH8A 4KJNA 2F3IA 2JA6H 1SE4A 3VR6A 4PG3A 3JAMi 1N33L 3N52A 4GNXA 1JB7A 2RSOA 3J81i 2H4OA 4DV2Q 5NUCA 4OONA 4G7ZC 1PH7A 2MQHA 4DU9A 5CMDA 3OPOA 3T1YQ 2VUMH 4A75A 2OWOA 4IPGA 5CYUA 3ND8A 1TR5A 4YCVA 3K5NA 1F2ZA 1MI2A 2HUGA 1S3OA 1XMQL 4JC0A 2F0HA 4IO9A 3S1NH 3M4PA 3DWQA 4YWKA 1XMOQ 1PTOF 1S4ZA 3OIQA 4UP7A 3A74A 5C4XH 3IRBA 4K5XA 4H0LC 3M4OB 1QZGA 4C3HG 4YY3Q 5EBCA 2UUBQ 4K8IA 4YIJA 2JSOA 4IALA 5JPNC 1PMRA 1YNJC 5C4HA 1BO0A 2IPKD 4PZ8A 2HHHQ 4R4IA 1VQKA 1QB5D 1KQSA 2PW5A 4R9WA 1XX8A 4P75A 1R9TB 4KY5A 2G5DA 2Y0SG 1EIFA 4ULLA 2I0QA 2LS01 1Z6HA 2RVLA 5GROA 4BY1H 4RCOA 3NWSA 4HCEA 1WCMH 1YHAA 1BDOA 2N8NA 1HH2P 2E2IH 4KN4C 1JJGA 2RBMA 2L0CA 4O2DA 3P75A 2BDNA 1DJRD 4K0KL 1EY8A 1LLRD 3T56B 2L4NA 1P8LA 1NTGA 3HOVG 1QWYA 3PV0A 3BVMA 4YCWA 1GUWA 1BCPC 3S9WA 3GTPB 4APVA 1V1QA 1V43A 3VYSA 4ME5A 1I94Q 3KK7A 1EU4A 1I4QA 3HRZC 3SVMA 4DUZL 1J5EL 5TSSA 4CJ1B 4DFAA 2ZM6Q 2A8VA 4A3EG 1DOMA 1EOTA 1EWIA 4A3IH 1IBLL 2K01A 2K5HA 3JC66 2F52A 4YWMA 5C3EB 3WWVA 3S16H 4R4OA 5EPKA 1GUGA 2JA5H 1BCPB 2I5LX 1JWUD 4AQYL 2QGQA 2PNHA 1W6JA 3J7YW 3U50C 3K59A 1GO3E 4M1UB 2EYMA 2NZOA 5I4DA 3QJYA 1BCPF 4OO1I 2HIXA 2K4KA 1B4OA 5JPMC 4DAYB 2EE1A 1TS3A 1WTVA 3I4NB 3DXJC 4BXXG 4JCVE 2E76C 1KLGD 5JJLA 2VB2X 2K33A 1F9RA 3K57A 3H15A 2JA8G 3W5OA 5J3BA 4DNRB 1EYAA 1K83B 4C2MB 2IX3A 4Y7NB 3U9SA 2KBNA 1JWSD 1HFNA 2XVSA 2VW9A 3EN2A 1TWCH 1Y1VG 3OW7A 3BDCA 2ASBA 3SHLA 3TS2A 5K36H 5JVH3 4HR7B 4GKKL 5KIXA 4C1NK 1BXTA 1E2ZA 1PFSA 2Y0SB 4B3RL 3M4QA 4OL7A 1HNWQ 1GHJA 2SDFA 3K0YA 3T4AC 4ME3A 2Z4HA 4DV2L 1BBWA 1PH5A 2M9VA 5M3MB 4DK6C 2RSNA 2F0GA 4EGVA 2LXKA 1B7YB 5M5XH 1A62A 4LF7L 3H3VI 3EA6A 5I6YA 1E7ZA 2R7ZG 4QIWB 1IHZA 2OCEA 3K5OA 2NVYH 2G9HD 3PO2B 5M3MH 1E1TA 2QEJC 3CRKC 1C0AA 2YYZA 2QEXA 3S17H 1XMOL 2JK8A 3BDOA 1KD1C 2TSSA 1HQRD 3I56A 3CC2A 1ASZA 2CVRA 4ZUJA 4MIUA 4K8JA 3FRPB 1NCVA 4DR1L 1WD1A 1SNDA 4DV6L 5EJWA 1GUSA 2OEOA 3BZDB 1A6XA 2UUCL 4WJ4A 1B50A 2OF1A 2QDBA 2YU9H 3HOYB 3FEWX 3QOLA 2B2WA 2L12A 1VF7A 2L9HA 1DZ1A 3CMEA 3I4NH 3KLWA 2Z8LA 4JI3L 2IL8A 2MPMA 1SMYD 5D3IB 2NBFA 1AH9A 4HEDA 4OX9Q 4B3SQ 4A3JG 1VQ5A 1ZYRC 4ZQ3A 2J4XA 5KNCA 2XIWA 1G51A 1TWHB 5JOBA 1MSHA 2JA5G 2K5DA 2OQ0A 2HD3A 4LWCA 2F0DA 1XJVA 3BG3A 5J1ZA 3I4MH 3R2IA 2R93B 1II3A 4Y52H 1EEFD 3FDTA 1FL0A 2OXPA 2E8GA 4X64L 3K80C 2XWBB 4HJ9A 4A3IB 2QW7A 1D5MC 3ULLA 5GQOA 1LYLA 1X3EA 1SN8A 1S5ED 4UY8C 4X66L 1CA5A 1TIID 1X9NA 1TWHH 2R7FA 3ONAB 5L37A 1Q90A 4HIOA 4XQJA 3ERSX 2JA8H 3EJIA 1E0BA 3K7AH 1Q1EA 1NJIC 4P71A 1HNXL 2VZAA 4KHVA 1Y8OB 1HA5A 4A3KH 3VDYA 1LT3D 1BBXC 4JI0L 3NQIA 2WAQB 3I7FA 1R4QB 5K36G 3C1EA 2AMCB 3CCSA 3I90A 2JA7B 4IFDG 4KI0A 2K28A 3CAMA 2E74C 5EBDA 1V9PA 2B2UA 2ENBA 4X3KA 5ELFA 1CQFA 1BQQT 4IUPA 1SMYC 1PH3A 3S1MB 1EY0A 2Q8IB 2A5HA 3H6MA 2R7ZH 4FNFA 1XPUA 3C46A 2EJFC 2EYPA 2EYHA 4CGYB 1A3TA 1EZ6A 1AE3A 5FJ8G 3DEOA 2H1EA 5C5MA 1LTAD 3H0GB 1BR9A 3I70A 5IYDG 1RKNA 3HOUH 2K52A 3D6CA 4A3GG 1TKWB 3C1FA 4U673 3V05A 2ZXOA 1C7YA 2K32A 1AZPA 3PUYA 1O7LA 3G48A 2QKIC 1EIHA 4LF6L 4QL5A 2MUYA 3SGIA 4XTCS 1H9SA 4LF8L 5ELEA 2EYFA 1DGSA 2SEBD 3F2UA 2F0QA 1I4PA 3GTPH 2JP1A 1CTMA 5IYCG 1SE3A 2X69A 3L7ZC 4ZCKA 4MHEA 5I9OA 3UI2A 1PV4A 3A8IE 3J80c 1L1OA 4ID6A 3TN2A 4RGMA 4TVAB 4A3KB 4DGZA 1A2UA 1BBUA 4OWXB 5IGGA 1D2BA 2KQ3A 3HOYG 4DR6L 3MHBA 2RF4A 4A4IA 5M3FH 3DWAA 4HAEA 3ICEA 1YNXA 4C3JG 2FMMA 2UU9Q 3NBHA 4RCNA 3M9BA 2E2DC 3RLOA 4NB3A 4ZUIA 4DV6Q 1D5XC 2WB1B 2RHSB 1HR0L 1K3RA 3RMHA 2E75C 2JA7G 3OTOL 3FPPA 1HRJA 1XNQQ 4LFCL 1JJCB 2D9UA 2YTYA 3MXNB 4LMQD 1PTOD 2NVXH 2CFMA 1K8GA 2UXBL 1PRTD 5M9OA 3PO2G 1XTCD 1A3VA 1HZAA 4RKBA 1UE7A 1G2SA 5FLXL 2R92B 4FXGC 1PH9A 1TY2A 3PGZA 2C5CA 2NUCA 2Q2HA 4QUCA 2F0TA 3GQBA 2PMZE 3A7LA 1HNZQ 2A74C 3FPUB 1ILQA 4IUUA 1ZKOA 2IJ0A 4DV1L 2VUMG 1FNWA 3G6EA 3TEHB 5D14A 3CF5A 4DR5Q 3DLLA 1YJ9A 2OTLA 4IPDA 3GTKH 3BDLA 2KCCA 4KKUA 2WAQG 2PQAA 3GTGH 2LSSA 2F0LA 1Y1WG 3FHWA 2OTJA 1EYDA 1N8RC 1IBML 2F0OA 1PYWD 4DAYA 2R3ZA 4LFBL 2XSCA 1VQ6A 2GVAA 2EY1A 1A3UA 3GTGB 1ESRA 2TMPA 1SFOB 4JI5Q 1JT8A 4WJ3M 3CXCA 4GKJL 2VS1A 3G6JB 3KBGA 2WKCA 1T5XD 1JORA 2BA1A 4BWGB 1PRTB 4AQYQ 3I72A 2WP8J 4DKAC 2B29A 5IOCA 4H7BA 2B2YA 4A3CG 3CRLC 1QJOA 4BA1I 2ZJPA 1D7QA 2RDFA 3CCMA 5C4XB 4K14A 3GTLH 5CV5A 1YITA 3J7A5 3HG9A 3LNNA 4YCUA 3BS1A 2NB0A 4BY1G 1LTSD 1PRTC 4EQOA 5BN5A 2EQSA 4IUVA 4OO1H 5BR8Q 1O7IA 3HOWB 4JG2A 3QIAA 2QA4A 3AFQA 4MNOA 2EYLA 3CCQA 1WI5A 3MXNA 4B9WA 4JK1C 5IT9L 5GADC 4JI1L 1KDCA 3HOYH 4A3BB 5AJ3L 4UDUC 4C3JH 1JJ2A 2Z1CA 1Y69U 3MEFA 4LF5Q 2I5MX 3SK8A 3TP5A 4IOAA 1NBWA 2ZTCA 3CU7A 4DV4Q 3CPWA 2DNEA 4DV7Q 2O5IC 4YWLA 1QUQB 2LFNA 1I3QB 1E2WA 2GVBA 1EFID 2F3VA 3AU7A 2VY3A 2XRQD 4XYQA 2RCFA 2K75A 2PQAB 3KF8B 4LUZA 3E9IA 3NP8A 5C0XJ 4GOPB 4GLXA 1SLJA 4KD3A 4HTHA 3J7ZC 1QZHA 5C3WA 1YIJA 1KL9A 4DNTB 3NBHB 3RZOB 2DY8A 4X3UA 5F2DA 2Z4IA 3W1BA 2UU9L 3KYHC 3Q8DA 3QR8A 4PZ6A 3I4OA 2WFWA 3NPPA 2M00A 2EZVA 1EQQA 4A93H 3SK4A 3SEBA 2B8FA 4A3FB 2UUAQ 1Y1WH 3ULJA 2LKVA 1GUNA 1Y1VH 1EQRA 1KAAA 1VQDA 5H1SE 2N49A 1N34L 3AQQA 2K14A 1OO9B 1O80A 3TMEA 3J80L 2VNUD 3H0GG 3WDNA 1SR3A 1TXYA 3MFGA 3V2TA 4H13C 1DD2A 3NELA 2NWGA 3RR5A 1ENCA 1KRTA 4IUTA 3UDFA 4C2MH 4C1NI 5CV9A 3HOXH 1L0YB 3A5UA 2BCOA 4A3CH 4TKOB 2Z6KC 2Q8RE 1TQOA 5LL6S 1WVLA 5ELNA 1RIPA 4RA8A 2K6AA 4LF9Q 3TZUA 5M3MG 4P73A 4LF4L 1CKMA 1HJPA 1Q12A 2F1MA 5BN4A 4DR2Q 1Q3LA 3E6ZX 3BU2A 1VMCA 1RHPA 4U68A 1QOHA 3OYYA 1X55A 5C4ZA 3S2DB 1P16A 3UE0A 1L0XB 3IFTA 3HOZH 4L63B 1XNRL 3X3MA 1MJEA 1M1KC 2B2UC 3I2ZA 3OSOA 3S24A 3S15H 1I4XA 3LGJA 3M7GA 4H02A 2WAQE 1VQMA 2I07B 3RUZA 5KYLA 3I4NG 1R4PB 4DR4Q 1C4QA 1IZ6A 1MBYA 2CQOA 3W2DA 2B2WC 1TWAB 4ZYSA 2F0JA 3P7JA 5M3FB 2WIIB 5C6AA 1NNXA 1JQYD 2F0UA 3E9HA 2N88A 1G2TA 1B53A 3I4MG 4OWTB 2EJMA 2E2HB 5IGBA 1J6QA 2XWJB 2DNCA 1RD9D 2R7DA 2HCCA 1WTPA 4G57A 1LTLA 1FJGQ 1I4HA 1CA6A 1TU2B 1JE4A 3HKZG 5D65A 1V1PA 5A2QL 2JEBI 4B3ML 5CC4A 3NXWA 1EY9A 2CWPA 1VQ7A 4WRDA 1Q46A 4XIGS 1ICFB 5CR3A 5IGEA 3SK6A 3F1ZA 2NVXB 1UE5A 1U4RA 1JE5A 2C9OA 4NXNL 2AWOA 4JI4L 5I2XA 3CCJA 4JBKA 2G9DA 3I4MB 4A3FG 3AYHB 3CCEA 1YNJD 1O7ZA 1K9MC 1I6VC 3H0GH 1X3QA 3A55A 3Q24A 1LV9A 1CQVA 1SXTA 2ICIA 2MGSA 4IJHA 4A3LG 4QCLA 4F87A 4JPBW 3HOXG 4A3GB 3T1YL 4JI7L 4DR6Q 2L55A 3IL8A 4LFAL 4R4CA 3DHQA 1VQFA 3PF4A 1CZWA 4S3SA 4KKSA 4XYOA 4DXFA 4X62L 1E24A 1V8QA 1VQOA 3CPFA 2WB1E 4X3TA 1PFBA 1XTDA 5FJ8H 2VQFL 1WFQA 4N9PA 1TWAH 1I4GA 1N32Q 5COYA 3VA7A 5IYDH 1B44D 3OHXC 1F9PA 2NVTB 3HOUG 2PI2A 4A3GH 3LX0A 4BBSB 3E0EA 1ET6A 1LM0A 1V1OA 1QVGA 3HOZG 3HZXA 1QCBD 4FDBA 1WJJA 1PZID 2UUBL 2KEDA 5G3LD 2AQ2B 2GA4B 2RCNA 3A0JA 3JAMc 3BZCA 5CV6A 3IKJA 2DJGC 1U9RA 5IYCH 1SNOA 1RCVD 5C0XI 5CV4A 2MO1A 2A1AA 2K03A 4RHRA 3ZYYX 2BH2A 1Q8IA 2HQEA 2PW7A 2A6HD 1GM5A 4DV5Q 4JYAL 2K05A 1NR4A 4DR3Q 2E2JH 4B3TQ 5M3FG 1SYFA 1PYBA 3CCRA 4GLVB 3C2PA 1CM9A 1M4VA 4LNQA 1SYDA 4NDXA 4QY7A 3MVVA 2F0VA 4GS3A 4PMBA 4GKJQ 1UWVA 5EGTA 4KHZA 2FFKB 1ZEQX 2E2JB 1GD7A 3MWYW 4BBRG 2JA7H 2UXCQ 2FXQA 5ISRA 1VQEA 1Z7TA 2Z6BA 2WKDA 2XNAC 1WTXA 1ONLA 3QB3A 2LY7A 4I7AA 1HTLD 1L1OB 4GOPA 1FGBD 2IHFA 2JA8B 5CV7A 5LMNL 3S1QH 1IXRA 3STBC 2PZWA 1EL0A 4EQ5A 3PO2H 5DEHA
chains in the Genus database with same CATH topology
4FVMA 4IQZA 2RQXA 2ZT9C 1J8IA 2NN6H 1Y1WB 1B3AA 5BN3A 3NTKA 3DUZA 3S16B 3GTQB 2KJXA 1BOSA 2BE5D 3J81L 4A93B 3GV6A 4A3DB 3X3NA 3A54A 3HOUB 1AP0A 4F8MA 2F0MA 1I4RA 3HOXB 3LWUA 4XXEA 5A2QE 4DAVA 5J39A 3MA2B 3R93A 2AUKA 2PZTA 2F4IA 1J9OA 3EVQA 1CK1A 4ZKCB 3PUZA 4BY1B 3KLSA 2ZXPA 1B1ZA 1G8ZD 3IFDA 4O1NA 5E3FA 2EOTA 3T51B 3V96A 1GUTA 2QF7A 4A3MB 2A73B 1CFMA 3BVGA 1PFMA 1OXTA 3NSWA 3U9OA 4CJ0B 3S15B 1S5CD 1YNNC 2ZXRA 1D6EC 4OO1G 3K7AB 1S5BD 2PMZB 4A3JB 3HOZB 4DK0A 3NK9A 4JBWA 3URYA 2KVMA 2FINB 1F2MA 3A56A 4UAIA 2ID0A 4KN7C 1SE2A 3WOEA 3S1RB 1GXDC 4C3IB 3GD7A 1XXGA 4QUFA 1F9SA 2F0NA 3T13A 2K5WA 1B2TA 1LABA 2JYOA 1SYGA 1VDZA 1NUCA 4F7XA 3GTKB 1HHVA 4ZAIA 4TSSA 3K5MA 1BCPD 5E1FA 1T5EA 1PFNA 3I4LA 4L6TB 3OWFA 4HN7A 2SOBA 4HCSA 3DM1A 5DNFA 2MJ8A 1G6ZA 2EY6A 1UAPA 4AYBB 2EYOA 2RDHA 2PZUA 3N6RA 2SNMA 3M3YB 2L5TA 3K5LA 1LT5D 3VR3A 2A6ED 1KABA 2CW0D 1OXUA 5FO9B 2J0TD 2B63B 3HKZB 3D6WA 5M5YB 1NR2A 4WJWA 1G291 3RD4A 4EVOA 4QMGA 1EWCA 2NVQB 3T53B 3PIO3 1OXXK 2NN6I 5CORA 2X6GA 5T1GA 2DN8A 2B2TA 2WINB 3MZ5A 2QILA 1SNMA 2D5DA 5KYIA 1G91A 1CHQD 4FP5D 1D5ZC 2LMCB 3D3RA 1RODA 5KRUA 1STEA 1AW7A 4BS9A 5HURA 2PPBC 3H09A 5ELBA 4ZKBB 1Z47A 3E5SA 1B9NA 4K6DA 4C56C 5I2YA 3EROA 3HEJA 3I73A 5C44B 1JOOA 1C48A 2NVYB 3GP7A 3R8BA 5JEAH 1SNQA 4FF2A 1Y8PB 4C3IG 1ENFA 2AQ3B 4EQNA 1RF2D 4ABNA 2SNSA 2HCIA 3Q0AA 5CGKA 4OIJA 1O78A 3W3AA 5G3LF 3I91A 2PYKA 2KEEA 1O7YA 3TZDA 3D4DA 1JR0D 1VCIA 2AWNA 2F0KA 1PLFA 3MTSA 2YU9B 3J81E 2K7VA 4K5WA 2VXWA 4KK7A 1H9MA 2PCFB 3KF8A 4F88A 3M85A 1EY7A 4TRDA 3DMUA 3TP8A 2F0WA 3ERQA 5K5PA 1A2TA 4CHTB 4RGNA 2MHVA 3A7AB 4G7OC 3MXPA 4IUQA 5CV8A 3Q23A 4RGOS 2IT1A 3FVQA 2Q8TA 1Y8NB 2BE5C 4FXDA 1SNPA 2BA0A 4CKEA 1UUPA 5C0XH 2J7ZA 5EPJA 1WTOA 1TWFB 5ELCA 4BA2I 3P1HA 1STBA 5I6WA 2O5JC 5KNBA 1JWMD 1LTBD 3KLSX 1QE6A 4L8JA 3D8GA 4NW2A 1HPCA 1IL8A 2XRSD 4R8NA 1SAPA 1STNA 2VUMB 3QOJA 5KNDA 3SK5A 1STYA 3P20A 4KMUC 3D31A 3S17B 1F2YA 2JA6B 1H9RA 4ZK9B 5JEAG 1YNND 3NWTA 1ESFA 1OXVA 5IIFA 1W6KA 1GJXA 2F0EA 2CHBD 5JEAJ 3G7LA 3IAYA 4NP5A 2EY2A 3TP6A 2R7ZB 3GTLB 4E6IA 2AQ1B 2FHTA 1ENAA 3NTHA 3FMCA 1FD7D 4K2KA 1U4PA 3PUWA 4B08A 3VR5A 2N55A 4MN3A 4G7HC 4QB4A 4PQXA 1EY4A 2NN6G 1LO5D 1F2LA 4M8AA 4XDXA 3AB9A 5AFWA 1IYVA 2I46A 4CBVA 3L3OC 3GTOB 3JAME 4HSPA 2KOLA 4Q0FA 3VR4A 4PNYA 2F0PA 3D4RA 5IGDA 3AMUA 4XT1B 4RKLA 2A6HC 2O4XA 2QCPX 1KDBA 2MP1A 4ZLTF 5FK9C 3EFXD 1CI3M 3K58A 4IURA 1VF5C 3DWPA 4RAUC 4IN3A 2L1BA 1LACA 2DY7A 3JAML 4FF1A 1S5DD 3VYTA 1QNUA 3PMFA 5A35A 1DYQA 1CZGA 1STGA 4FO2A 5FLXE 4RWSC 2F0FA 3MEHA 1RJTA 1DCZA 1HTPA 3TDQA 1XYIA 2NYZD 1BF4A 5LHY1 2VB3X 3HS0C 5IT9E 2RKSA 3MC0B 4BY7B 1ET9A 3M7NA 2EVBA 5E4XA 4FF4A 3R3OA 3MXUA 4KKTA 1XWEA 4ODGA 4I7ZC 1EIGA 4WORA 3SE0A 3QG1A 4CJ2C 4DA2A 3T16A 1I6HB 4CKBA 5IGFA 2R6GA 2RA4A 4XT3B 2KUMA 2F0SA 3M4YA 1STAA 5FO8B 1VMPA 3KBXA 3QO2A 1WTWA 1HCZA 1HUMA 2KECA 1IW7D 2HDLA 2K04A 3KLRA 3GTMB 3K6OA 3Q22A 4OGQC 4K6LA 1HQMC 5LL6X 1GHKA 3QWNA 3I8ZA 3D4WA 1DONA 1WCMB 5FOBB 5FKAC 4IFDI 5JJZA 1TS2A 1GUOA 4KV6A 5T1IA 2V4DA 4H44C 3S14B 2F3WA 2BOSA 3CQZB 3PIP3 3SR1A 1V1PB 3A8JE 1STHA 1X3PA 3J7AF 1PZJD 1PTOB 3MXGA 4KJOA 2IW3A 2KCNA 1ML0D 2D62A 2RDGA 3E0JA 1HXYD 1LTRD 4IFDJ 2WV6D 2B2VC 1DOLA 1WTQA 2F03A 1MGSA 1BNZA 2JXMB 4TQUS 5M5WB 1B9MA 4N9TA 1GOZA 4IUNA 4PMCA 1ZYRD 5C3XA 1Y1VB 5C5LA 1JICA 1AEXA 1JC7A 2B2YC 3BYTB 5DAUA 1H9SB 5FO7B 1PZKD 1JCKB 2EDGA 4A3EB 1E2VA 5EKKA 5J22A 2CW0C 4O42A 2EXZA 5DM63 1U4LA 3J80E 1EQTA 1LT6D 1C8CA 3HGBA 2IX0A 1SSOA 2NZ1D 4X3SA 4DK1A 5M5XB 1EY6A 1EYCA 1SEBD 5DM73 3SXHA 4HMIA 1RDPD 3EQLC 2E2IB 2R61A 5IGCA 3KUPA 4C3JB 3OMCA 4V190 1SDFA 2FJ2A 4LK1C 3CKIB 1TWGB 2L11A 1M8AA 3C3LA 4ILWA 2OT2A 2ICEC 1A15A 4BBRB 5C0XG 3TP7A 1UEAB 1H9KA 1SYEA 3GO5A 5HGTA 3GV3A 3O13A 3H3VC 1K8MA 2AUJD 4NMZA 1IKLA 3TSSA 4RFBA 4LJZC 1PDQA 5E4WC 3OOCA 4V0BA 5I9PA 4OIKA 1F9QA 1QNKA 2F0IA 4FF3A 3VYRA 5EQ0A 2B2TC 1TT2A 1I50B 2IX1A 3S2HB 3NHHA 4ZRZA 3FKIB 4KTAA 4KD4A 1TWCB 2KHSA 1FR3A 2PNRC 1RTNA 3H91A 1FYCA 2EYJA 5C4JB 3J7AV 1SJHD 4J8QA 1DM0B 3RLFA 1D1KA 3TBIB 2B8GA 3MAQA 4C3HB 3VA5A 2CQAA 1KNEA 2NTTA 3RZDB 1AZQA 1JOQA 2O2LD 3PUXA 1IKMA 2JA5B 1CT1D 1SBBB 3I3CA 5EKIA 2PO4A 2X6LA 3VR2A 1LTGD 4Q5VA 4Z9CB 1IYUA 1Q1BA 1FNUA 1PTOC 1QILA 4DAPA 4HMJA 3S1NB 2A68C 1EQVA 4DN4M 4LAAA 2EJGC 1H9JA 4I65A 4B9XA 2WACA 4OHJA 2JE6I 1ICWA 2HDMA 4CKCA 2JEAI 1NAPA 1TY0A 2K5QA 1WTRA 2XN9C 4KY6A 4RHSA 3SDZA 1K8OA 3NBIA 4G4KA 4RH6A 3NQTA 1EZ8A 4PMWA 5KGUA 3OWEB 1D1IA 3R2TA 1PTOH 2A6EC 1TS5A 3PUVA 1HFGA 4WFN3 2PQEA 1EY5A 5EPLA 3DEPA 1JOKA 4J1MA 3HOVB 1DXMA 3S1QB 2K1BA 4NKLA 1LTTD 3MFYA 2IWHA 1FNVA 3NTIA 1QG7A 4FXKC 5IODA 5KEEA 5ELDA 3A8KE 5CBEE 1MSGA 4J6HA 4HSVA 5EKLA 1MD2D 1CHPD 4GZYC 3GTJB 1ILPA 2M2LA 2EPBA 3HP3A 4P2CB 4IFDH 4PV1C 2BDOA 1LT4D 3LWEA 3VYUA 4DF7A 1SYBA 2B2VA 1EU3A 1WD0A 1PXUA 3L9AX 4R8IA 1ZXTA 4EQPA 3NE5B 1EWHA 1AN8A 3BYYB 4DXGA 2A69C 1KTKA 4QF4A 1F77A 3CHBD 3WOFA 5JVG3 1OXSC 1UNSA 1RTOA 2D2CC 1KLUD 4K5VA 1S5FD 1EEID 1IW7C 4RGTA 1JB3A 4XQNA 1X32A 1KDAA 3OMGA 1AFPA 4KY7A 2B39A 1HA6A 2FMCA 1LTID 1U4MA 3ITPA 1SNCA 3H94A 5JAVA 2EY5A 3BVZA 5D3DA 1HUNA 1NSNS 4K2LA 3OIPA 1DOKA 1TVXA 2NTSA 1SJED 4FYDA 4XQQA 1KNAA 1BUVT 1PRTF 1SYCA 3ND9A 3PO3B 2A68D 3Q6SA 2A69D 2KA7A 5CBAE 1TS4A 3NUCA 4IZ8A 4KJNA 1SE4A 3VR6A 3N52A 2RSOA 2H4OA 5NUCA 4G7ZC 5CMDA 4DU9A 3OPOA 5CYUA 3ND8A 1TR5A 3K5NA 1F2ZA 1MI2A 2HUGA 2F0HA 3DWQA 1PTOF 1S4ZA 3OIQA 4K5XA 4H0LC 3M4OB 4C3HG 5EBCA 4K8IA 4YIJA 2JSOA 4IALA 5JPNC 1PMRA 1YNJC 5C4HA 1BO0A 2IPKD 1QB5D 2PW5A 4R9WA 1XX8A 1R9TB 4KY5A 4ULLA 2LS01 1Z6HA 2RVLA 4RCOA 3NWSA 4HCEA 1BDOA 4KN4C 2RBMA 2L0CA 3P75A 2BDNA 1DJRD 1EY8A 1LLRD 3T56B 2L4NA 1QWYA 3PV0A 3BVMA 1GUWA 1BCPC 3S9WA 3GTPB 1V43A 3VYSA 4ME5A 3KK7A 1EU4A 1I4QA 3HRZC 3SVMA 5TSSA 4CJ1B 4DFAA 1DOMA 1EOTA 2K01A 5C3EB 5EPKA 1GUGA 1BCPB 1JWUD 1W6JA 3J7YW 3K59A 4M1UB 2EYMA 5I4DA 3QJYA 1BCPF 4OO1I 1B4OA 5JPMC 2EE1A 1TS3A 1WTVA 3I4NB 3DXJC 2E76C 1KLGD 2VB2X 2K33A 1F9RA 3K57A 4DNRB 1EYAA 1K83B 4C2MB 2IX3A 4Y7NB 3U9SA 1JWSD 1HFNA 2XVSA 3OW7A 3BDCA 3SHLA 5K36H 5JVH3 4HR7B 5KIXA 4C1NK 1BXTA 1E2ZA 2Y0SB 4OL7A 1GHJA 2SDFA 3K0YA 3T4AC 2Z4HA 2M9VA 5M3MB 2RSNA 2F0GA 4EGVA 3EA6A 5I6YA 4QIWB 1IHZA 3K5OA 2G9HD 3PO2B 2QEJC 3CRKC 2YYZA 3BDOA 2TSSA 1HQRD 2CVRA 4ZUJA 4MIUA 4K8JA 3FRPB 1NCVA 1WD1A 1SNDA 5EJWA 1GUSA 2OEOA 3BZDB 1A6XA 1B50A 2OF1A 2QDBA 3HOYB 2B2WA 3FEWX 3QOLA 2L12A 1VF7A 2L9HA 1DZ1A 2Z8LA 2IL8A 2MPMA 1SMYD 5D3IB 2NBFA 4HEDA 1ZYRC 5KNCA 2J4XA 4ZQ3A 2XIWA 1TWHB 5JOBA 1MSHA 2K5DA 2F0DA 3BG3A 5J1ZA 3R2IA 2R93B 1II3A 1EEFD 3FDTA 2OXPA 2XWBB 4A3IB 1D5MC 1S5ED 1CA5A 1TIID 3ONAB 1Q90A 4XQJA 3EJIA 1E0BA 1Q1EA 4KHVA 1Y8OB 1HA5A 1LT3D 1BBXC 3NQIA 2WAQB 1R4QB 5K36G 3C1EA 3I90A 2JA7B 4IFDG 4KI0A 2K28A 2E74C 5EBDA 2B2UA 2ENBA 4X3KA 5ELFA 1CQFA 1BQQT 4IUPA 1SMYC 3S1MB 1EY0A 2Q8IB 2A5HA 3H6MA 4FNFA 3C46A 2EJFC 2EYPA 2EYHA 4CGYB 1A3TA 1EZ6A 3DEOA 2H1EA 5C5MA 1LTAD 3H0GB 1BR9A 3I70A 1RKNA 3D6CA 1TKWB 3C1FA 4U673 3V05A 2ZXOA 2K32A 1AZPA 3PUYA 1O7LA 2QKIC 1EIHA 2MUYA 4XTCS 1H9SA 5ELEA 2EYFA 2SEBD 3F2UA 2F0QA 1I4PA 2JP1A 1CTMA 1SE3A 2X69A 3L7ZC 5I9OA 4MHEA 3UI2A 3A8IE 4ID6A 3TN2A 4RGMA 4A3KB 4DGZA 1A2UA 5IGGA 1D2BA 2KQ3A 3MHBA 3DWAA 4HAEA 4C3JG 2FMMA 3NBHA 4RCNA 2E2DC 4ZUIA 1D5XC 2WB1B 3RMHA 2E75C 3FPPA 1HRJA 2D9UA 4LMQD 1PTOD 1PRTD 5M9OA 1XTCD 1A3VA 4RKBA 5FLXL 1G2SA 2R92B 4FXGC 1TY2A 2C5CA 2NUCA 4QUCA 2F0TA 3GQBA 3A7LA 2A74C 3FPUB 1ILQA 4IUUA 1ZKOA 2IJ0A 1FNWA 5D14A 3BDLA 2KCCA 4KKUA 2F0LA 1EYDA 2F0OA 1PYWD 4DAYA 2R3ZA 2XSCA 2EY1A 1A3UA 3GTGB 1ESRA 2TMPA 1SFOB 3G6JB 3KBGA 2WKCA 1T5XD 1JORA 2BA1A 4BWGB 1PRTB 3I72A 2WP8J 5IOCA 4H7BA 2B2YA 3CRLC 1QJOA 4BA1I 2RDFA 5C4XB 4K14A 5CV5A 3HG9A 3LNNA 3BS1A 2NB0A 1LTSD 1PRTC 4EQOA 5BN5A 4IUVA 4OO1H 3HOWB 3QIAA 2EYLA 3MXNA 4B9WA 4JK1C 5IT9L 1KDCA 4A3BB 4UDUC 2Z1CA 1Y69U 3SK8A 3TP5A 3CU7A 2DNEA 2O5IC 2LFNA 1I3QB 1E2WA 1EFID 2F3VA 3AU7A 2XRQD 4XYQA 3NP8A 5C0XJ 4KD3A 4HTHA 5C3WA 4DNTB 3RZOB 2DY8A 4X3UA 5F2DA 2Z4IA 3NPPA 2M00A 2EZVA 3SK4A 3SEBA 2B8FA 4A3FB 2LKVA 1GUNA 1KAAA 1OO9B 1O80A 3TMEA 3J80L 2VNUD 3WDNA 3MFGA 3V2TA 4H13C 1DD2A 2NWGA 1ENCA 4IUTA 4C1NI 5CV9A 1L0YB 2BCOA 4TKOB 2Q8RE 1TQOA 5LL6S 1WVLA 4RA8A 2K6AA 3TZUA 1Q12A 2F1MA 5BN4A 1Q3LA 3E6ZX 1VMCA 1RHPA 4U68A 1QOHA 5C4ZA 3S2DB 1L0XB 3IFTA 4L63B 3X3MA 2B2UC 3OSOA 1I4XA 3M7GA 2I07B 3RUZA 5KYLA 1R4PB 1C4QA 1MBYA 3W2DA 2B2WC 1TWAB 4ZYSA 2F0JA 3P7JA 5M3FB 2WIIB 5C6AA 1JQYD 2F0UA 2N88A 1G2TA 1B53A 2EJMA 2E2HB 5IGBA 2XWJB 2DNCA 1RD9D 2HCCA 1WTPA 4G57A 1I4HA 1CA6A 1TU2B 1JE4A 5D65A 1V1PA 5A2QL 2JEBI 5CC4A 3NXWA 1EY9A 4WRDA 4XIGS 5IGEA 5CR3A 3SK6A 2NVXB 1U4RA 2C9OA 2AWOA 5I2XA 2G9DA 3I4MB 1YNJD 1O7ZA 1I6VC 1X3QA 3A55A 3Q24A 1LV9A 1CQVA 1SXTA 2ICIA 2MGSA 4QCLA 4F87A 4A3GB 2L55A 3IL8A 3DHQA 1CZWA 4S3SA 4KKSA 4XYOA 4DXFA 1V8QA 4X3TA 1PFBA 4N9PA 1I4GA 5COYA 3VA7A 1B44D 3OHXC 1F9PA 2NVTB 3LX0A 4BBSB 1ET6A 1V1OA 3HZXA 1QCBD 1PZID 2KEDA 5G3LD 2AQ2B 2GA4B 5CV6A 3IKJA 1U9RA 1SNOA 1RCVD 5C0XI 5CV4A 2K03A 4RHRA 3ZYYX 1Q8IA 2HQEA 2PW7A 2A6HD 2K05A 1NR4A 1SYFA 3C2PA 1CM9A 1M4VA 1SYDA 4NDXA 3MVVA 2F0VA 4PMBA 5EGTA 4KHZA 2FFKB 1ZEQX 2E2JB 3MWYW 5ISRA 1Z7TA 1WTXA 2WKDA 2XNAC 1ONLA 3QB3A 2LY7A 1HTLD 1FGBD 2JA8B 5CV7A 2PZWA 1EL0A 5DEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZQ3 A;  2F0Q A;  1SNQ A;  2RDF A;  5CV9 A;  5JOB A;  1NUC A;  4F7X A;  4K14 A;  5NUC A;  5CV5 A;  1F2Y A;  4DU9 A;  4DF7 A;  5I9O A;  1SYB A;  2F0D A;  2EYM A;  3SR1 A;  4I65 A;  5J1Z A;  4B9X A;  4EQN A;  2WAC A;  5CGK A;  1STH A;  2SNS A;  1II3 A;  4ID6 A;  1TQO A;  3PMF A;  4KJO A;  5E1F A;  2OXP A;  4EQO A;  4DGZ A;  2PYK A;  1TR5 A;  1STG A;  5IIF A;  1A2U A;  1F2Z A;  5IGG A;  2F0E A;  4EQP A;  2F0F A;  3OWF A;  2KQ3 A;  3MEH A;  3D4D A;  3DHQ A;  3MHB A;  3TP7 A;  2F0H A;  1SYE A;  2EYL A;  2SOB A;  4NP5 A;  4S3S A;  2EY2 A;  4F8M A;  5HGT A;  2F0M A;  5EKL A;  2F0K A;  4B9W A;  4QF4 A;  1EYA A;  1KDC A;  4ZUI A;  3TP6 A;  4NMZ A;  4N9P A;  2EY6 A;  5C4Z A;  2RKS A;  4K5X A;  2EYO A;  4KY6 A;  2PZU A;  4K5W A;  4E6I A;  3EJI A;  5J39 A;  2SNM A;  1ENA A;  3BDC A;  3NQT A;  3SK8 A;  3TP5 A;  3LX0 A;  1EY7 A;  4N9T A;  3SHL A;  5I9P A;  4KHV A;  4TRD A;  1KAB A;  1EZ8 A;  3OSO A;  5KIX A;  3R3O A;  3DMU A;  2PZT A;  2F0I A;  3TP8 A;  4OL7 A;  4K8I A;  4IUN A;  5KGU A;  3EVQ A;  3HZX A;  4YIJ A;  4IAL A;  2F0W A;  3ERQ A;  4K5V A;  2F3V A;  3RUZ A;  5K5P A;  5KYL A;  1A2T A;  4K2K A;  5M9O A;  1TT2 A;  4PMC A;  5C4H A;  1A3V A;  4QMG A;  4RKB A;  3C1E A;  4EVO A;  5C3X A;  5E3F A;  3MXP A;  4ODG A;  4WOR A;  5C5L A;  2PW5 A;  2F0G A;  2NUC A;  2PQE A;  1EY5 A;  2F0T A;  3NHH A;  2F0J A;  1AEX A;  1KDA A;  2ENB A;  1JOK A;  3NP8 A;  3OMG A;  4KTA A;  4KY5 A;  4KD4 A;  4KY7 A;  4QB4 A;  5CV6 A;  5CV8 A;  5I6Y A;  4J1M A;  1U9R A;  4KD3 A;  2KHS A;  1SNO A;  1EY4 A;  1IHZ A;  4HTH A;  3T16 A;  5C6A A;  5C3W A;  2F0U A;  5CV4 A;  5IGF A;  5DAU A;  3MZ5 A;  2EYJ A;  4NKL A;  1SNP A;  1EY0 A;  5IGB A;  3U9O A;  2HQE A;  2F0S A;  3ITP A;  1SNM A;  2PW7 A;  3H6M A;  5KYI A;  1STA A;  2EYP A;  1SNC A;  5EKK A;  5F2D A;  5J22 A;  2EYH A;  2RBM A;  4G57 A;  1A3T A;  3BDL A;  1EZ6 A;  2EY5 A;  3P1H A;  4LAA A;  5JAV A;  2EXZ A;  3P75 A;  1STB A;  5I6W A;  1NSN S;  2F0L A;  4K2L A;  3NK9 A;  5CC4 A;  2M00 A;  3NXW A;  1EY9 A;  1EY8 A;  3VA5 A;  5IOD A;  1SYF A;  4WRD A;  1EYD A;  5C5M A;  3SK4 A;  4ZUJ A;  5KEE A;  2F0O A;  4MIU A;  4K8J A;  5IGE A;  5CR3 A;  1SYD A;  4NDX A;  1F2M A;  4J6H A;  3S9W A;  3SK6 A;  5KRU A;  3MVV A;  1JOQ A;  1RKN A;  2F0V A;  1SND A;  1EY6 A;  1SYC A;  4ME5 A;  3D6C A;  4PMB A;  2EY1 A;  5EGT A;  2LKV A;  1A3U A;  1EYC A;  3D8G A;  2OEO A;  3C1F A;  3SXH A;  5HUR A;  3D4W A;  4DFA A;  4HMI A;  1KAA A;  2OF1 A;  2QDB A;  4PNY A;  3E5S A;  2F0P A;  4K6D A;  5ISR A;  3ERO A;  3HEJ A;  3QOL A;  3QB3 A;  4R8N A;  3NUC A;  4IZ8 A;  3TME A;  5IGD A;  1JOR A;  1STN A;  2F0N A;  4KJN A;  3T13 A;  5IGC A;  4RKL A;  3QOJ A;  3OMC A;  4HMJ A;  5CV7 A;  2O4X A;  1JOO A;  3V2T A;  4KV6 A;  1KDB A;  1ENC A;  1SYG A;  5DEH A;  3SK5 A;  2PZW A;  1STY A;  1EQV A;  5IOC A;  4H7B A;  2F3W A;  2EYF A; 
#chains in the Genus database with same CATH topology
 4FVM A;  4L5R C;  2MFI A;  4A3F H;  4IQZ A;  1C9O A;  2RQX A;  2ZT9 C;  4DUY L;  1J8I A;  2NN6 H;  1Y1W B;  1B3A A;  5BN3 A;  3NTK A;  1A8V A;  3DUZ A;  3S16 B;  3GTQ B;  2KJX A;  1BOS A;  2BE5 D;  3J81 L;  4AYB G;  3GV6 A;  4A93 B;  4A3D B;  3X3N A;  3A54 A;  3K8A A;  4GNX C;  3HOU B;  1AP0 A;  2A19 A;  5GAG C;  4F8M A;  2F0M A;  1XPR A;  1X65 A;  5LMU L;  1I4R A;  3HOX B;  2IY5 B;  2UUC Q;  4POF A;  3LWU A;  4XXE A;  5A2Q E;  4DAV A;  5J39 A;  3MA2 B;  3R93 A;  4DV7 L;  2AUK A;  1HNW L;  4HIK A;  4HIM A;  1SRU A;  4KLK A;  3S2H H;  2PZT A;  5IYB G;  1E1O A;  2F4I A;  1J9O A;  3EVQ A;  2H5X A;  1CK1 A;  4ZKC B;  3PUZ A;  3HKZ E;  4GKK Q;  4BY1 B;  1PYS B;  3KLS A;  2Q2I A;  1B1Z A;  1G8Z D;  2ZXP A;  2Z6K A;  3IFD A;  4O1N A;  5E3F A;  3CCV A;  2WB1 G;  3CP0 A;  2EOT A;  4JI8 L;  4Y7N H;  5IWA Q;  1N33 Q;  1K73 C;  3T51 B;  3V96 A;  1IBK L;  1GUT A;  2QF7 A;  4A3M B;  2K50 A;  2A73 B;  1CFM A;  3BVG A;  4JW0 A;  2VQE L;  1PFM A;  4LFA Q;  1OXT A;  1X54 A;  3NSW A;  3U9O A;  4CJ0 B;  3S15 B;  4QQB X;  1S5C D;  1YNN C;  4DV0 Q;  1E22 A;  2ZXR A;  1D6E C;  4OO1 G;  1X3G A;  3K7A B;  1S5B D;  2PMZ B;  4A3J B;  5JJI A;  3HOZ B;  4DK0 A;  3NK9 A;  4JBW A;  3URY A;  2KVM A;  3KDF B;  2FIN B;  1F2M A;  3A56 A;  4JI2 Q;  4UAI A;  3J80 i;  2ID0 A;  4KN7 C;  1IL2 A;  1W3S A;  1SE2 A;  2XGT A;  3WOE A;  3UE1 A;  1NMG A;  1N36 Q;  3S1R B;  1GXD C;  4C3I B;  2E2H H;  2R93 G;  3GD7 A;  1XXG A;  4QUF A;  1F9S A;  2F0N A;  3T13 A;  2K5W A;  1B2T A;  1EFW A;  1G6P A;  1LAB A;  2JYO A;  4DR7 Q;  1SYG A;  1VDZ A;  4OX9 L;  1NUC A;  4F7X A;  3GTK B;  1HHV A;  4ZAI A;  4TSS A;  3K5M A;  1BCP D;  5E1F A;  1T5E A;  4DV5 L;  4JYA Q;  1PFN A;  4DR3 L;  3I4L A;  1A0I A;  4L6T B;  4AH6 A;  3OWF A;  4HN7 A;  2SOB A;  4HCS A;  2CH4 W;  1HZC A;  3DM1 A;  5DNF A;  2MJ8 A;  1G6Z A;  2EY6 A;  1UAP A;  4OWW B;  4AYB B;  4A93 G;  2EYO A;  1XNR Q;  2RDH A;  2PZU A;  3N6R A;  3H3V H;  2SNM A;  1PH6 A;  1N9W A;  2L5T A;  2OQK A;  3M3Y B;  3K5L A;  1LT5 D;  3VR3 A;  1SE8 A;  2A6E D;  2E5L L;  1KAB A;  2CW0 D;  1OXU A;  5FO9 B;  2J0T D;  2B63 B;  3HKZ B;  3D6W A;  5M5Y B;  1NR2 A;  4WJW A;  1G29 1;  3RD4 A;  1Z9F A;  4EVO A;  4QMG A;  1K8A C;  1HZ9 A;  4LF7 Q;  3U58 A;  1EWC A;  5LMN W;  2NVQ B;  3T53 B;  3PIO 3;  1OXX K;  2NN6 I;  5COR A;  1AE2 A;  2X6G A;  5T1G A;  1MJC A;  1U5K A;  2DN8 A;  2B2T A;  2WIN B;  3MZ5 A;  1FJG L;  2QIL A;  5EAY A;  1SNM A;  2D5D A;  2I5H A;  5KYI A;  2C35 B;  1G91 A;  4JI1 Q;  4JV5 L;  1RL2 A;  1CHQ D;  4DNI A;  4FP5 D;  2ES2 A;  3PQI A;  4LUV A;  4DR1 Q;  5AJ3 Q;  1KXL A;  1D5Z C;  2LMC B;  3D3R A;  1WTH A;  1ROD A;  5KRU A;  1STE A;  1AW7 A;  4BS9 A;  4DV4 L;  3TRE A;  5HUR A;  2PPB C;  4AYB E;  3H09 A;  5ELB A;  4X65 Q;  1HR0 W;  4ZKB B;  2Q2T A;  1Z47 A;  3E5S A;  1B9N A;  2KCT A;  4K6D A;  4C56 C;  5I2Y A;  5FLX c;  3ERO A;  3HEJ A;  3F8T A;  3I73 A;  5C44 B;  4P74 A;  3J81 c;  1JOO A;  1C48 A;  2R93 H;  4KHP L;  2NVY B;  3GP7 A;  3R8B A;  5JEA H;  1PH2 A;  1SNQ A;  4FF2 A;  1Y8P B;  4C3I G;  1ENF A;  2AQ3 B;  4EQN A;  1RF2 D;  1E3P A;  4ABN A;  2SNS A;  2HCI A;  5CGK A;  5IP7 G;  4OIJ A;  5C3E G;  3Q0A A;  1O78 A;  3W3A A;  5G3L F;  4UP8 A;  5C44 G;  2KHI A;  3I91 A;  1FVI A;  2PYK A;  2ATW A;  2KEE A;  1O7Y A;  4R1J A;  4K0K Q;  3TZD A;  5ELO A;  3D4D A;  1JR0 D;  1VCI A;  2AWN A;  1N32 L;  4EX5 A;  2F0K A;  1PLF A;  3MTS A;  2YU9 B;  3J81 E;  4IJL A;  1HNX Q;  4NXM Q;  3PF5 A;  2K7V A;  1N36 L;  4K5W A;  2VXW A;  4KK7 A;  1H9M A;  1I6H H;  2PCF B;  3KF8 A;  4F88 A;  3M85 A;  1VQG A;  1EY7 A;  3UDX A;  4TRD A;  2CWA A;  2UXB Q;  2EIF A;  3DMU A;  3TP8 A;  4P72 A;  2F0W A;  3ERQ A;  5K5P A;  2QDL A;  1A2T A;  3STB D;  4CHT B;  5HY6 A;  4RGN A;  2MHV A;  3UDI A;  3A7A B;  4G7O C;  3MXP A;  4R4T A;  4IUQ A;  2HHH L;  5CV8 A;  3Q23 A;  4RGO S;  2B63 G;  2IT1 A;  3FVQ A;  1YHB A;  1Y8N B;  2Q8T A;  2BE5 C;  2EXD A;  4A3L H;  4FXD A;  2NZH A;  1SNP A;  3KF6 B;  2BA0 A;  4CKE A;  1UUP A;  5C0X H;  5IE8 A;  2J7Z A;  5EPJ A;  1WTO A;  1TWF B;  5ELC A;  4BA2 I;  3P1H A;  4GLA C;  2AKW B;  1STB A;  5I6W A;  1SFO H;  2O5J C;  2F4V L;  2CKZ B;  1QVC A;  5KNB A;  1JWM D;  3BZK A;  2D0P A;  4LW1 A;  1UE6 A;  2HIV A;  4A3D G;  1LTB D;  3KLS X;  1QE6 A;  4L8J A;  2UXC L;  3D8G A;  4NW2 A;  3G4S A;  3RN5 A;  1HPC A;  4B3R Q;  2Z9H A;  4JBJ A;  1IL8 A;  4LF6 Q;  1VQ8 A;  4OXP A;  2XRS D;  4R8N A;  1SAP A;  1STN A;  2VUM B;  3QOJ A;  4JBM A;  5KND A;  3SK5 A;  1STY A;  3D0F A;  3P20 A;  4KMU C;  3D31 A;  3S17 B;  1F2Y A;  2JA6 B;  1H9R A;  4ZK9 B;  5JEA G;  5BR8 L;  4C3I H;  1YNN D;  1XMQ Q;  3NWT A;  1ESF A;  1OXV A;  5IIF A;  1W6K A;  2VL6 A;  1GJX A;  2F0E A;  5IP7 H;  5C3E H;  2CHB D;  5JEA J;  3G7L A;  3IAY A;  2DUD A;  4NP5 A;  2EY2 A;  2DJF C;  1HR0 Q;  5JJK A;  3TP6 A;  2R7Z B;  3GTL B;  4X65 L;  4E6I A;  2AQ1 B;  2FHT A;  4JI4 Q;  3RN2 A;  1ENA A;  2ZJQ A;  3CC4 A;  3B6Y A;  3NTH A;  4BBR H;  1KHI A;  3FMC A;  1FD7 D;  4B3S L;  3L0O A;  4JI8 Q;  4CDE C;  4K2K A;  1U4P A;  3PUW A;  2V1C C;  1CKO A;  4B08 A;  1GKH A;  3VR5 A;  1VQC A;  2N55 A;  4MN3 A;  4LF8 Q;  4G7H C;  4QB4 A;  3TRZ A;  4PQX A;  1EY4 A;  1K0R A;  1SMX A;  2NN6 G;  1LO5 D;  1F2L A;  4M8A A;  4A3B G;  1VQH A;  2B63 H;  4XDX A;  3AB9 A;  5AFW A;  2YTV A;  1IYV A;  2I46 A;  4OEM B;  4CBV A;  4RG1 A;  4J15 A;  3L3O C;  4JI2 L;  3PIO A;  1VQ4 A;  4L5Q A;  3GTO B;  4MTN A;  3JAM E;  4HSP A;  2KOL A;  1YHQ A;  4JI5 L;  5M5Y H;  2JA9 A;  4L5S A;  3UDG A;  5IP9 H;  4Q0F A;  2UUA L;  4N8F A;  2K5N A;  3VR4 A;  2MO0 A;  1VQI A;  3PSI A;  4A3D H;  3A5Z B;  4PNY A;  2F0P A;  1KAW A;  3D4R A;  5IGD A;  4JI6 L;  3AMU A;  4XT1 B;  5IYB H;  4RKL A;  2A6H C;  2O4X A;  2QCP X;  1KDB A;  2MP1 A;  4ZLT F;  4QJF A;  2N78 A;  4DK3 C;  4BBS H;  5FK9 C;  1HZB A;  3EFX D;  1CI3 M;  3K58 A;  2DGY A;  4IUR A;  5E7N A;  1VF5 C;  1CKN A;  3HKS A;  3TQY A;  3DWP A;  4RAU C;  4IN3 A;  2L1B A;  1LAC A;  2DY7 A;  3JAM L;  1VQA A;  4IOC A;  4FF1 A;  4UPA A;  1S5D D;  3VYT A;  1Y14 B;  1QNU A;  3DM3 A;  3PMF A;  5A35 A;  1DYQ A;  1CZG A;  1S72 A;  2UXD Q;  1STG A;  4FO2 A;  5FLX E;  4RWS C;  5IT9 c;  4ALP A;  3G71 A;  2UXD L;  4B3T L;  2F0F A;  2JN4 A;  3MEH A;  2MNA A;  1RJT A;  2CH4 A;  2XTI A;  1DCZ A;  1HTP A;  3U4Z A;  3TDQ A;  4A3M G;  1XYI A;  2NYZ D;  2CCZ A;  4MZ9 A;  1BF4 A;  1NMF A;  4JVZ A;  3TS0 A;  3KF6 A;  5LHY 1;  2VB3 X;  3HS0 C;  5IT9 E;  2RKS A;  1VQB A;  1K0S A;  3MC0 B;  4BY7 B;  3KJP A;  1ET9 A;  1YI2 A;  3M7N A;  2EVB A;  5E4X A;  3I55 A;  1K28 A;  1EUJ A;  4FF4 A;  3R3O A;  4DUZ Q;  1J5E Q;  4X6A H;  1TWF H;  3MXU A;  4KKT A;  3CW2 C;  1XWE A;  3F2C A;  4ODG A;  4I7Z C;  1EIG A;  4WOR A;  3SE0 A;  3T1H Q;  3QG1 A;  4CJ2 C;  1Q81 C;  4DA2 A;  1L2F A;  3T16 A;  1I6H B;  1S40 A;  4CKB A;  5IGF A;  1PH1 A;  4BY7 G;  2R6G A;  2RA4 A;  4XT3 B;  2KUM A;  2F0S A;  2ZJR A;  3M4Y A;  1STA A;  4OEL B;  5FO8 B;  1VMP A;  3KBX A;  3QO2 A;  2VQF Q;  1WTW A;  4QGU A;  1HCZ A;  1HUM A;  1VQN A;  2KEC A;  1IW7 D;  2NVQ H;  2HDL A;  3E3X A;  4B3M Q;  2K04 A;  3KLR A;  3GTM B;  3K6O A;  3Q22 A;  1BVS A;  4OGQ C;  3FKI H;  4K6L A;  1HQM C;  5LL6 X;  1GHK A;  3QWN A;  3I8Z A;  3D4W A;  1DON A;  1WCM B;  5GAH C;  3K7U C;  5FOB B;  4IPH A;  4KHP Q;  1VQP A;  5IY0 A;  5FKA C;  4IFD I;  5JJZ A;  1TS2 A;  1GUO A;  4KV6 A;  5T1I A;  4IPC A;  2V4D A;  2LXJ A;  4H44 C;  3S14 B;  2F3W A;  1X56 A;  4DV3 Q;  4DV1 Q;  2BOS A;  3CQZ B;  3PIP 3;  3SR1 A;  4BBS G;  1V1P B;  4CDF C;  3A8J E;  2AHO B;  1STH A;  1X3P A;  1VQ9 A;  3J7A F;  1PZJ D;  1PTO B;  3MXG A;  1L1O C;  4KJO A;  3AFP A;  2IW3 A;  2KCN A;  1ML0 D;  3FP9 A;  2D62 A;  2RDG A;  3HFZ B;  5FLM G;  2R92 G;  3E0J A;  1HXY D;  1LTR D;  4IFD J;  2WV6 D;  2B2V C;  1DOL A;  1WTQ A;  4X62 Q;  4GN4 B;  1YJW A;  2F03 A;  1MGS A;  1BNZ A;  2JQO A;  4A3M H;  2JXM B;  4TQU S;  5M5W B;  1B9M A;  4JI0 Q;  4N9T A;  4JI6 Q;  4RMF A;  5C4J H;  1I94 L;  1GOZ A;  4DR7 L;  4IUN A;  2YTX A;  2BH8 A;  3RNU A;  3AEV A;  4DR4 L;  4PMC A;  1ZYR D;  5C3X A;  1EIY B;  1Y1V B;  5C5L A;  4LUO A;  1JIC A;  4HJA A;  1X3F A;  1AEX A;  1JC7 A;  4QIW E;  2B2Y C;  3BYT B;  4A76 A;  5DAU A;  1H9S B;  5FO7 B;  1PZK D;  1JCK B;  5C44 H;  2EDG A;  4A3E B;  1E2V A;  5EKK A;  5J22 A;  2CW0 C;  2F4V Q;  4YHH L;  4CDC C;  4BY7 H;  3CMA A;  1VQL A;  4O42 A;  5LMU Q;  1PA6 A;  1T9H A;  2EXZ A;  1U4L A;  5DM6 3;  3J80 E;  1EQT A;  1LT6 D;  5C4X G;  1C8C A;  3S1M H;  3HGB A;  2IX0 A;  1SSO A;  2NZ1 D;  4X3S A;  4DK1 A;  1U0L A;  5M5X B;  2PI2 E;  1EY6 A;  4NXN Q;  2E5L Q;  1EYC A;  1SEB D;  5DM7 3;  3SXH A;  4GN5 A;  4C3H H;  4HMI A;  3FKI G;  1RDP D;  3EQL C;  2E2I B;  2R61 A;  5IGC A;  3KUP A;  4C3J B;  3OMC A;  4V19 0;  1SDF A;  2FJ2 A;  4LK1 C;  3CKI B;  1I5F A;  1TWG B;  3W1G A;  1IBK Q;  1WOC A;  2L11 A;  1WCM G;  1M8A A;  4JI7 Q;  3C3L A;  4ILW A;  2OT2 A;  2ICE C;  1A15 A;  4BBR B;  5C0X G;  3J81 j;  3TP7 A;  3M4O H;  1UEA B;  1H9K A;  1SYE A;  1B8A A;  1YZ6 A;  3HOV H;  3GO5 A;  5HGT A;  3GV3 A;  1YBY A;  3O13 A;  1FGU A;  1A63 A;  3H3V C;  4MTK A;  1K8M A;  2AUJ D;  4NMZ A;  1IKL A;  3OTO Q;  3TSS A;  4RFB A;  2IHE A;  4LJZ C;  1M90 C;  1PDQ A;  5E4W C;  3OOC A;  4V0B A;  5I9P A;  4GNX B;  3S14 H;  4OIK A;  1F9Q A;  1QNK A;  2F0I A;  4FF3 A;  3VYR A;  5EQ0 A;  2B2T C;  1Q7Y C;  1TT2 A;  5IWA L;  1KRS A;  1I50 B;  2IX1 A;  4JI3 Q;  4HID A;  3S2H B;  3NHH A;  4ZRZ A;  2VQE Q;  3FKI B;  4KTA A;  2P5Z X;  4KD4 A;  1I3Q H;  1TWC B;  2KHS A;  1FR3 A;  2PNR C;  3H91 A;  1RTN A;  1FYC A;  1XPO A;  1HNZ L;  3ER0 A;  2EYJ A;  5C4J B;  3J7A V;  1SJH D;  1UEB A;  4HJ5 A;  4J8Q A;  4CDD C;  4BXX H;  2L15 A;  1DM0 B;  3RLF A;  4AIM A;  1D1K A;  1Q8K A;  3EIV A;  1YJN A;  2GN5 A;  3TBI B;  4NXM L;  2B8G A;  3MAQ A;  4C3H B;  3VA5 A;  2CQA A;  1KNE A;  2NTT A;  3RZD B;  2HT1 A;  3KJO A;  1AZQ A;  1JOQ A;  4L5T A;  2O2L D;  4NPS A;  3HOW G;  3PUX A;  1IKM A;  2ZTE A;  2JA5 B;  1CT1 D;  2K5V A;  1SBB B;  3I3C A;  5EKI A;  2PO4 A;  2X6L A;  3VR2 A;  1LTG D;  2YV5 A;  4Q5V A;  1IYU A;  1Q1B A;  1FNU A;  2JJQ A;  4Z9C B;  1PTO C;  3K81 C;  1QVF A;  1W2B A;  5GAE C;  1QIL A;  4DAP A;  1XNQ L;  4HMJ A;  3GTQ H;  3S1N B;  1IBL Q;  2Z0S A;  2A68 C;  1NY4 A;  1EQV A;  4DN4 M;  3PO3 G;  4LAA A;  2EJG C;  4JOI A;  3GTO H;  3GTM H;  1H9J A;  4I65 A;  3OW2 A;  2ALY B;  4B9X A;  1JMC A;  2WAC A;  4OHJ A;  2JE6 I;  3KDF A;  4JV5 Q;  3PCO B;  1ICW A;  2HDM A;  4CKC A;  4A3B H;  1MKH A;  2JEA I;  1NAP A;  4DR5 L;  1TY0 A;  2K5Q A;  1CKN B;  3EBE A;  1I50 H;  1WTR A;  1R9T H;  2XN9 C;  3CC7 A;  4KY6 A;  4RHS A;  3L2P A;  3SDZ A;  4DAM A;  3NBI A;  4G4K A;  1K8O A;  4R4Q A;  4RH6 A;  1Q86 C;  1B3Q A;  3NQT A;  1X6O A;  5IP9 G;  1EZ8 A;  1CSQ A;  4LF5 L;  4PMW A;  1CUK A;  3CQZ H;  5KGU A;  3OWE B;  1D1I A;  3T1H L;  4A3J H;  3M3Y H;  3R2T A;  1PTO H;  2A6E C;  1TS5 A;  3RZO H;  3PUV A;  1HFG A;  5LMN Q;  3RZD H;  3S2D H;  3U4V A;  2KHJ A;  2PQE A;  1EY5 A;  4WFN 3;  5EPL A;  3DEP A;  1JOK A;  1CSP A;  3CD6 A;  4J1M A;  3HOV B;  1DXM A;  4DV0 L;  4DUY Q;  3S1Q B;  1EYG A;  2K1B A;  4NKL A;  3GTJ H;  1LTT D;  3MFY A;  1GVP A;  2IWH A;  2NVT H;  4GN3 B;  1FNV A;  3NTI A;  1QG7 A;  4FXK C;  5M5W H;  1LUZ A;  1TWG H;  1WYD A;  5IOD A;  2RHQ B;  2D0O A;  3KOJ A;  3ZJY C;  5KEE A;  1ASY A;  5ELD A;  3A8K E;  5CBE E;  1MSG A;  4J6H A;  2ZTD A;  4HSV A;  5EKL A;  5HGQ A;  1MD2 D;  1VQJ A;  2Y0S E;  4A3K G;  3NEM A;  2JA6 G;  1CHP D;  4GZY C;  3GTJ B;  1ILP A;  1PH4 A;  3HOW H;  2M2L A;  3NEN A;  3CCU A;  2EPB A;  3HP3 A;  4LFC Q;  1D8L A;  4P2C B;  4YY3 L;  1SRO A;  4IFD H;  4PV1 C;  4DV3 L;  2BDO A;  1LT4 D;  2Q2U A;  3LWE A;  1YVC A;  3VYU A;  5DLQ E;  1UE1 A;  4DF7 A;  1SYB A;  2B2V A;  3PO3 H;  3ULP A;  1EU3 A;  1WD0 A;  1PXU A;  1K3B C;  3L9A X;  4O0A A;  1Q82 C;  1B70 B;  4R8I A;  1ZXT A;  3K0X A;  4EQP A;  3NE5 B;  4JOI C;  2B3G A;  2HQL A;  4N8X 1;  1EWH A;  1AN8 A;  3BYY B;  4DXG A;  2A69 C;  4X64 Q;  3KFU A;  1KTK A;  4QF4 A;  4LF4 Q;  4DR2 L;  4X66 Q;  1VS0 A;  1MHW C;  3F2D A;  1OTC A;  1F77 A;  3CHB D;  1IBM Q;  3WOF A;  5JVG 3;  2KCM A;  1OXS C;  4LFB Q;  4PZ7 A;  1UNS A;  3CCL A;  1IYJ B;  1RTO A;  2ZM6 L;  2D2C C;  1KIX A;  1KLU D;  4K5V A;  1S5F D;  1EEI D;  1N34 Q;  1IW7 C;  4RGT A;  1MIU A;  1JB3 A;  4UP9 A;  4XQN A;  3S1R H;  1L0W A;  1K83 H;  4POG A;  4HJ7 A;  1X32 A;  1KDA A;  3OMG A;  1AFP A;  4KY7 A;  1NE3 A;  1BKB A;  2B39 A;  1HA6 A;  1PVO A;  3PIP A;  1QUQ A;  2FMC A;  4HJ8 A;  1LTI D;  1U4M A;  4YHH Q;  4UHV A;  3ITP A;  1H95 A;  3BJU A;  4DPG A;  1SNC A;  3H94 A;  1KC8 C;  5JAV A;  2EY5 A;  2KEN A;  3BVZ A;  4LF9 L;  5D3D A;  1HUN A;  1NSN S;  4K2L A;  3OIP A;  5FLM H;  1DOK A;  1TVX A;  2R92 H;  2NTS A;  1SJE D;  4GOP C;  4FYD A;  4XQQ A;  3GDE A;  4A3E H;  1KNA A;  1BUV T;  1PRT F;  1SYC A;  3ND9 A;  4A3I G;  1PHJ A;  3PO3 B;  1YEZ A;  3RLN A;  2A68 D;  2N3S A;  3Q6S A;  2A69 D;  2KA7 A;  5CBA E;  3F2B A;  1EOV A;  1TS4 A;  3NUC A;  4IZ8 A;  1PH8 A;  4KJN A;  2F3I A;  2JA6 H;  1SE4 A;  3VR6 A;  4PG3 A;  3JAM i;  1N33 L;  3N52 A;  4GNX A;  1JB7 A;  2RSO A;  3J81 i;  2H4O A;  4DV2 Q;  5NUC A;  4OON A;  4G7Z C;  1PH7 A;  2MQH A;  4DU9 A;  5CMD A;  3OPO A;  3T1Y Q;  2VUM H;  4A75 A;  2OWO A;  4IPG A;  5CYU A;  3ND8 A;  1TR5 A;  4YCV A;  3K5N A;  1F2Z A;  1MI2 A;  2HUG A;  1S3O A;  1XMQ L;  4JC0 A;  2F0H A;  4IO9 A;  3S1N H;  3M4P A;  3DWQ A;  4YWK A;  1XMO Q;  1PTO F;  1S4Z A;  3OIQ A;  4UP7 A;  3A74 A;  5C4X H;  3IRB A;  4K5X A;  4H0L C;  3M4O B;  1QZG A;  4C3H G;  4YY3 Q;  5EBC A;  2UUB Q;  4K8I A;  4YIJ A;  2JSO A;  4IAL A;  5JPN C;  1PMR A;  1YNJ C;  5C4H A;  1BO0 A;  2IPK D;  4PZ8 A;  2HHH Q;  4R4I A;  1VQK A;  1QB5 D;  1KQS A;  2PW5 A;  4R9W A;  1XX8 A;  4P75 A;  1R9T B;  4KY5 A;  2G5D A;  2Y0S G;  1EIF A;  4ULL A;  2I0Q A;  2LS0 1;  1Z6H A;  2RVL A;  5GRO A;  4BY1 H;  4RCO A;  3NWS A;  4HCE A;  1WCM H;  1YHA A;  1BDO A;  2N8N A;  1HH2 P;  2E2I H;  4KN4 C;  1JJG A;  2RBM A;  2L0C A;  4O2D A;  3P75 A;  2BDN A;  1DJR D;  4K0K L;  1EY8 A;  1LLR D;  3T56 B;  2L4N A;  1P8L A;  1NTG A;  3HOV G;  1QWY A;  3PV0 A;  3BVM A;  4YCW A;  1GUW A;  1BCP C;  3S9W A;  3GTP B;  4APV A;  1V1Q A;  1V43 A;  3VYS A;  4ME5 A;  1I94 Q;  3KK7 A;  1EU4 A;  1I4Q A;  3HRZ C;  3SVM A;  4DUZ L;  1J5E L;  5TSS A;  4CJ1 B;  4DFA A;  2ZM6 Q;  2A8V A;  4A3E G;  1DOM A;  1EOT A;  1EWI A;  4A3I H;  1IBL L;  2K01 A;  2K5H A;  3JC6 6;  2F52 A;  4YWM A;  5C3E B;  3WWV A;  3S16 H;  4R4O A;  5EPK A;  1GUG A;  2JA5 H;  1BCP B;  2I5L X;  1JWU D;  4AQY L;  2QGQ A;  2PNH A;  1W6J A;  3J7Y W;  3U50 C;  3K59 A;  1GO3 E;  4M1U B;  2EYM A;  2NZO A;  5I4D A;  3QJY A;  1BCP F;  4OO1 I;  2HIX A;  2K4K A;  1B4O A;  5JPM C;  4DAY B;  2EE1 A;  1TS3 A;  1WTV A;  3I4N B;  3DXJ C;  4BXX G;  4JCV E;  2E76 C;  1KLG D;  5JJL A;  2VB2 X;  2K33 A;  1F9R A;  3K57 A;  3H15 A;  2JA8 G;  3W5O A;  5J3B A;  4DNR B;  1EYA A;  1K83 B;  4C2M B;  2IX3 A;  4Y7N B;  3U9S A;  2KBN A;  1JWS D;  1HFN A;  2XVS A;  2VW9 A;  3EN2 A;  1TWC H;  1Y1V G;  3OW7 A;  3BDC A;  2ASB A;  3SHL A;  3TS2 A;  5K36 H;  5JVH 3;  4HR7 B;  4GKK L;  5KIX A;  4C1N K;  1BXT A;  1E2Z A;  1PFS A;  2Y0S B;  4B3R L;  3M4Q A;  4OL7 A;  1HNW Q;  1GHJ A;  2SDF A;  3K0Y A;  3T4A C;  4ME3 A;  2Z4H A;  4DV2 L;  1BBW A;  1PH5 A;  2M9V A;  5M3M B;  4DK6 C;  2RSN A;  2F0G A;  4EGV A;  2LXK A;  1B7Y B;  5M5X H;  1A62 A;  4LF7 L;  3H3V I;  3EA6 A;  5I6Y A;  1E7Z A;  2R7Z G;  4QIW B;  1IHZ A;  2OCE A;  3K5O A;  2NVY H;  2G9H D;  3PO2 B;  5M3M H;  1E1T A;  2QEJ C;  3CRK C;  1C0A A;  2YYZ A;  2QEX A;  3S17 H;  1XMO L;  2JK8 A;  3BDO A;  1KD1 C;  2TSS A;  1HQR D;  3I56 A;  3CC2 A;  1ASZ A;  2CVR A;  4ZUJ A;  4MIU A;  4K8J A;  3FRP B;  1NCV A;  4DR1 L;  1WD1 A;  1SND A;  4DV6 L;  5EJW A;  1GUS A;  2OEO A;  3BZD B;  1A6X A;  2UUC L;  4WJ4 A;  1B50 A;  2OF1 A;  2QDB A;  2YU9 H;  3HOY B;  3FEW X;  3QOL A;  2B2W A;  2L12 A;  1VF7 A;  2L9H A;  1DZ1 A;  3CME A;  3I4N H;  3KLW A;  2Z8L A;  4JI3 L;  2IL8 A;  2MPM A;  1SMY D;  5D3I B;  2NBF A;  1AH9 A;  4HED A;  4OX9 Q;  4B3S Q;  4A3J G;  1VQ5 A;  1ZYR C;  4ZQ3 A;  2J4X A;  5KNC A;  2XIW A;  1G51 A;  1TWH B;  5JOB A;  1MSH A;  2JA5 G;  2K5D A;  2OQ0 A;  2HD3 A;  4LWC A;  2F0D A;  1XJV A;  3BG3 A;  5J1Z A;  3I4M H;  3R2I A;  2R93 B;  1II3 A;  4Y52 H;  1EEF D;  3FDT A;  1FL0 A;  2OXP A;  2E8G A;  4X64 L;  3K80 C;  2XWB B;  4HJ9 A;  4A3I B;  2QW7 A;  1D5M C;  3ULL A;  5GQO A;  1LYL A;  1X3E A;  1SN8 A;  1S5E D;  4UY8 C;  4X66 L;  1CA5 A;  1TII D;  1X9N A;  1TWH H;  2R7F A;  3ONA B;  5L37 A;  1Q90 A;  4HIO A;  4XQJ A;  3ERS X;  2JA8 H;  3EJI A;  1E0B A;  3K7A H;  1Q1E A;  1NJI C;  4P71 A;  1HNX L;  2VZA A;  4KHV A;  1Y8O B;  1HA5 A;  4A3K H;  3VDY A;  1LT3 D;  1BBX C;  4JI0 L;  3NQI A;  2WAQ B;  3I7F A;  1R4Q B;  5K36 G;  3C1E A;  2AMC B;  3CCS A;  3I90 A;  2JA7 B;  4IFD G;  4KI0 A;  2K28 A;  3CAM A;  2E74 C;  5EBD A;  1V9P A;  2B2U A;  2ENB A;  4X3K A;  5ELF A;  1CQF A;  1BQQ T;  4IUP A;  1SMY C;  1PH3 A;  3S1M B;  1EY0 A;  2Q8I B;  2A5H A;  3H6M A;  2R7Z H;  4FNF A;  1XPU A;  3C46 A;  2EJF C;  2EYP A;  2EYH A;  4CGY B;  1A3T A;  1EZ6 A;  1AE3 A;  5FJ8 G;  3DEO A;  2H1E A;  5C5M A;  1LTA D;  3H0G B;  1BR9 A;  3I70 A;  5IYD G;  1RKN A;  3HOU H;  2K52 A;  3D6C A;  4A3G G;  1TKW B;  3C1F A;  4U67 3;  3V05 A;  2ZXO A;  1C7Y A;  2K32 A;  1AZP A;  3PUY A;  1O7L A;  3G48 A;  2QKI C;  1EIH A;  4LF6 L;  4QL5 A;  2MUY A;  3SGI A;  4XTC S;  1H9S A;  4LF8 L;  5ELE A;  2EYF A;  1DGS A;  2SEB D;  3F2U A;  2F0Q A;  1I4P A;  3GTP H;  2JP1 A;  1CTM A;  5IYC G;  1SE3 A;  2X69 A;  3L7Z C;  4ZCK A;  4MHE A;  5I9O A;  3UI2 A;  1PV4 A;  3A8I E;  3J80 c;  1L1O A;  4ID6 A;  3TN2 A;  4RGM A;  4TVA B;  4A3K B;  4DGZ A;  1A2U A;  1BBU A;  4OWX B;  5IGG A;  1D2B A;  2KQ3 A;  3HOY G;  4DR6 L;  3MHB A;  2RF4 A;  4A4I A;  5M3F H;  3DWA A;  4HAE A;  3ICE A;  1YNX A;  4C3J G;  2FMM A;  2UU9 Q;  3NBH A;  4RCN A;  3M9B A;  2E2D C;  3RLO A;  4NB3 A;  4ZUI A;  4DV6 Q;  1D5X C;  2WB1 B;  2RHS B;  1HR0 L;  1K3R A;  3RMH A;  2E75 C;  2JA7 G;  3OTO L;  3FPP A;  1HRJ A;  1XNQ Q;  4LFC L;  1JJC B;  2D9U A;  2YTY A;  3MXN B;  4LMQ D;  1PTO D;  2NVX H;  2CFM A;  1K8G A;  2UXB L;  1PRT D;  5M9O A;  3PO2 G;  1XTC D;  1A3V A;  1HZA A;  4RKB A;  1UE7 A;  1G2S A;  5FLX L;  2R92 B;  4FXG C;  1PH9 A;  1TY2 A;  3PGZ A;  2C5C A;  2NUC A;  2Q2H A;  4QUC A;  2F0T A;  3GQB A;  2PMZ E;  3A7L A;  1HNZ Q;  2A74 C;  3FPU B;  1ILQ A;  4IUU A;  1ZKO A;  2IJ0 A;  4DV1 L;  2VUM G;  1FNW A;  3G6E A;  3TEH B;  5D14 A;  3CF5 A;  4DR5 Q;  3DLL A;  1YJ9 A;  2OTL A;  4IPD A;  3GTK H;  3BDL A;  2KCC A;  4KKU A;  2WAQ G;  2PQA A;  3GTG H;  2LSS A;  2F0L A;  1Y1W G;  3FHW A;  2OTJ A;  1EYD A;  1N8R C;  1IBM L;  2F0O A;  1PYW D;  4DAY A;  2R3Z A;  4LFB L;  2XSC A;  1VQ6 A;  2GVA A;  2EY1 A;  1A3U A;  3GTG B;  1ESR A;  2TMP A;  1SFO B;  4JI5 Q;  1JT8 A;  4WJ3 M;  3CXC A;  4GKJ L;  2VS1 A;  3G6J B;  3KBG A;  2WKC A;  1T5X D;  1JOR A;  2BA1 A;  4BWG B;  1PRT B;  4AQY Q;  3I72 A;  2WP8 J;  4DKA C;  2B29 A;  5IOC A;  4H7B A;  2B2Y A;  4A3C G;  3CRL C;  1QJO A;  4BA1 I;  2ZJP A;  1D7Q A;  2RDF A;  3CCM A;  5C4X B;  4K14 A;  3GTL H;  5CV5 A;  1YIT A;  3J7A 5;  3HG9 A;  3LNN A;  4YCU A;  3BS1 A;  2NB0 A;  4BY1 G;  1LTS D;  1PRT C;  4EQO A;  5BN5 A;  2EQS A;  4IUV A;  4OO1 H;  5BR8 Q;  1O7I A;  3HOW B;  4JG2 A;  3QIA A;  2QA4 A;  3AFQ A;  4MNO A;  2EYL A;  3CCQ A;  1WI5 A;  3MXN A;  4B9W A;  4JK1 C;  5IT9 L;  5GAD C;  4JI1 L;  1KDC A;  3HOY H;  4A3B B;  5AJ3 L;  4UDU C;  4C3J H;  1JJ2 A;  2Z1C A;  1Y69 U;  3MEF A;  4LF5 Q;  2I5M X;  3SK8 A;  3TP5 A;  4IOA A;  1NBW A;  2ZTC A;  3CU7 A;  4DV4 Q;  3CPW A;  2DNE A;  4DV7 Q;  2O5I C;  4YWL A;  1QUQ B;  2LFN A;  1I3Q B;  1E2W A;  2GVB A;  1EFI D;  2F3V A;  3AU7 A;  2VY3 A;  2XRQ D;  4XYQ A;  2RCF A;  2K75 A;  2PQA B;  3KF8 B;  4LUZ A;  3E9I A;  3NP8 A;  5C0X J;  4GOP B;  4GLX A;  1SLJ A;  4KD3 A;  4HTH A;  3J7Z C;  1QZH A;  5C3W A;  1YIJ A;  1KL9 A;  4DNT B;  3NBH B;  3RZO B;  2DY8 A;  4X3U A;  5F2D A;  2Z4I A;  3W1B A;  2UU9 L;  3KYH C;  3Q8D A;  3QR8 A;  4PZ6 A;  3I4O A;  2WFW A;  3NPP A;  2M00 A;  2EZV A;  1EQQ A;  4A93 H;  3SK4 A;  3SEB A;  2B8F A;  4A3F B;  2UUA Q;  1Y1W H;  3ULJ A;  2LKV A;  1GUN A;  1Y1V H;  1EQR A;  1KAA A;  1VQD A;  5H1S E;  2N49 A;  1N34 L;  3AQQ A;  2K14 A;  1OO9 B;  1O80 A;  3TME A;  3J80 L;  2VNU D;  3H0G G;  3WDN A;  1SR3 A;  1TXY A;  3MFG A;  3V2T A;  4H13 C;  1DD2 A;  3NEL A;  2NWG A;  3RR5 A;  1ENC A;  1KRT A;  4IUT A;  3UDF A;  4C2M H;  4C1N I;  5CV9 A;  3HOX H;  1L0Y B;  3A5U A;  2BCO A;  4A3C H;  4TKO B;  2Z6K C;  2Q8R E;  1TQO A;  5LL6 S;  1WVL A;  5ELN A;  1RIP A;  4RA8 A;  2K6A A;  4LF9 Q;  3TZU A;  5M3M G;  4P73 A;  4LF4 L;  1CKM A;  1HJP A;  1Q12 A;  2F1M A;  5BN4 A;  4DR2 Q;  1Q3L A;  3E6Z X;  3BU2 A;  1VMC A;  1RHP A;  4U68 A;  1QOH A;  3OYY A;  1X55 A;  5C4Z A;  3S2D B;  1P16 A;  3UE0 A;  1L0X B;  3IFT A;  3HOZ H;  4L63 B;  1XNR L;  3X3M A;  1MJE A;  1M1K C;  2B2U C;  3I2Z A;  3OSO A;  3S24 A;  3S15 H;  1I4X A;  3LGJ A;  3M7G A;  4H02 A;  2WAQ E;  1VQM A;  2I07 B;  3RUZ A;  5KYL A;  3I4N G;  1R4P B;  4DR4 Q;  1C4Q A;  1IZ6 A;  1MBY A;  2CQO A;  3W2D A;  2B2W C;  1TWA B;  4ZYS A;  2F0J A;  3P7J A;  5M3F B;  2WII B;  5C6A A;  1NNX A;  1JQY D;  2F0U A;  3E9H A;  2N88 A;  1G2T A;  1B53 A;  3I4M G;  4OWT B;  2EJM A;  2E2H B;  5IGB A;  1J6Q A;  2XWJ B;  2DNC A;  1RD9 D;  2R7D A;  2HCC A;  1WTP A;  4G57 A;  1LTL A;  1FJG Q;  1I4H A;  1CA6 A;  1TU2 B;  1JE4 A;  3HKZ G;  5D65 A;  1V1P A;  5A2Q L;  2JEB I;  4B3M L;  5CC4 A;  3NXW A;  1EY9 A;  2CWP A;  1VQ7 A;  4WRD A;  1Q46 A;  4XIG S;  1ICF B;  5CR3 A;  5IGE A;  3SK6 A;  3F1Z A;  2NVX B;  1UE5 A;  1U4R A;  1JE5 A;  2C9O A;  4NXN L;  2AWO A;  4JI4 L;  5I2X A;  3CCJ A;  4JBK A;  2G9D A;  3I4M B;  4A3F G;  3AYH B;  3CCE A;  1YNJ D;  1O7Z A;  1K9M C;  1I6V C;  3H0G H;  1X3Q A;  3A55 A;  3Q24 A;  1LV9 A;  1CQV A;  1SXT A;  2ICI A;  2MGS A;  4IJH A;  4A3L G;  4QCL A;  4F87 A;  4JPB W;  3HOX G;  4A3G B;  3T1Y L;  4JI7 L;  4DR6 Q;  2L55 A;  3IL8 A;  4LFA L;  4R4C A;  3DHQ A;  1VQF A;  3PF4 A;  1CZW A;  4S3S A;  4KKS A;  4XYO A;  4DXF A;  4X62 L;  1E24 A;  1V8Q A;  1VQO A;  3CPF A;  2WB1 E;  4X3T A;  1PFB A;  1XTD A;  5FJ8 H;  2VQF L;  1WFQ A;  4N9P A;  1TWA H;  1I4G A;  1N32 Q;  5COY A;  3VA7 A;  5IYD H;  1B44 D;  3OHX C;  1F9P A;  2NVT B;  3HOU G;  2PI2 A;  4A3G H;  3LX0 A;  4BBS B;  3E0E A;  1ET6 A;  1LM0 A;  1V1O A;  1QVG A;  3HOZ G;  3HZX A;  1QCB D;  4FDB A;  1WJJ A;  1PZI D;  2UUB L;  2KED A;  5G3L D;  2AQ2 B;  2GA4 B;  2RCN A;  3A0J A;  3JAM c;  3BZC A;  5CV6 A;  3IKJ A;  2DJG C;  1U9R A;  5IYC H;  1SNO A;  1RCV D;  5C0X I;  5CV4 A;  2MO1 A;  2A1A A;  2K03 A;  4RHR A;  3ZYY X;  2BH2 A;  1Q8I A;  2HQE A;  2PW7 A;  2A6H D;  1GM5 A;  4DV5 Q;  4JYA L;  2K05 A;  1NR4 A;  4DR3 Q;  2E2J H;  4B3T Q;  5M3F G;  1SYF A;  1PYB A;  3CCR A;  4GLV B;  3C2P A;  1CM9 A;  1M4V A;  4LNQ A;  1SYD A;  4NDX A;  4QY7 A;  3MVV A;  2F0V A;  4GS3 A;  4PMB A;  4GKJ Q;  1UWV A;  5EGT A;  4KHZ A;  2FFK B;  1ZEQ X;  2E2J B;  1GD7 A;  3MWY W;  4BBR G;  2JA7 H;  2UXC Q;  2FXQ A;  5ISR A;  1VQE A;  1Z7T A;  2Z6B A;  2WKD A;  2XNA C;  1WTX A;  1ONL A;  3QB3 A;  2LY7 A;  4I7A A;  1HTL D;  1L1O B;  4GOP A;  1FGB D;  2IHF A;  2JA8 B;  5CV7 A;  5LMN L;  3S1Q H;  1IXR A;  3STB C;  2PZW A;  1EL0 A;  4EQ5 A;  3PO2 H;  5DEH A; 
#chains in the Genus database with same CATH homology
 4FVM A;  4IQZ A;  2RQX A;  2ZT9 C;  1J8I A;  2NN6 H;  1Y1W B;  1B3A A;  5BN3 A;  3NTK A;  3DUZ A;  3S16 B;  3GTQ B;  2KJX A;  1BOS A;  2BE5 D;  3J81 L;  4A93 B;  3GV6 A;  4A3D B;  3X3N A;  3A54 A;  3HOU B;  1AP0 A;  4F8M A;  2F0M A;  1I4R A;  3HOX B;  3LWU A;  4XXE A;  5A2Q E;  4DAV A;  5J39 A;  3MA2 B;  3R93 A;  2AUK A;  2PZT A;  2F4I A;  1J9O A;  3EVQ A;  1CK1 A;  4ZKC B;  3PUZ A;  4BY1 B;  3KLS A;  2ZXP A;  1B1Z A;  1G8Z D;  3IFD A;  4O1N A;  5E3F A;  2EOT A;  3T51 B;  3V96 A;  1GUT A;  2QF7 A;  4A3M B;  2A73 B;  1CFM A;  3BVG A;  1PFM A;  1OXT A;  3NSW A;  3U9O A;  4CJ0 B;  3S15 B;  1S5C D;  1YNN C;  2ZXR A;  1D6E C;  4OO1 G;  3K7A B;  1S5B D;  2PMZ B;  4A3J B;  3HOZ B;  4DK0 A;  3NK9 A;  4JBW A;  3URY A;  2KVM A;  2FIN B;  1F2M A;  3A56 A;  4UAI A;  2ID0 A;  4KN7 C;  1SE2 A;  3WOE A;  3S1R B;  1GXD C;  4C3I B;  3GD7 A;  1XXG A;  4QUF A;  1F9S A;  2F0N A;  3T13 A;  2K5W A;  1B2T A;  1LAB A;  2JYO A;  1SYG A;  1VDZ A;  1NUC A;  4F7X A;  3GTK B;  1HHV A;  4ZAI A;  4TSS A;  3K5M A;  1BCP D;  5E1F A;  1T5E A;  1PFN A;  3I4L A;  4L6T B;  3OWF A;  4HN7 A;  2SOB A;  4HCS A;  3DM1 A;  5DNF A;  2MJ8 A;  1G6Z A;  2EY6 A;  1UAP A;  4AYB B;  2EYO A;  2RDH A;  2PZU A;  3N6R A;  2SNM A;  3M3Y B;  2L5T A;  3K5L A;  1LT5 D;  3VR3 A;  2A6E D;  1KAB A;  2CW0 D;  1OXU A;  5FO9 B;  2J0T D;  2B63 B;  3HKZ B;  3D6W A;  5M5Y B;  1NR2 A;  4WJW A;  1G29 1;  3RD4 A;  4EVO A;  4QMG A;  1EWC A;  2NVQ B;  3T53 B;  3PIO 3;  1OXX K;  2NN6 I;  5COR A;  2X6G A;  5T1G A;  2DN8 A;  2B2T A;  2WIN B;  3MZ5 A;  2QIL A;  1SNM A;  2D5D A;  5KYI A;  1G91 A;  1CHQ D;  4FP5 D;  1D5Z C;  2LMC B;  3D3R A;  1ROD A;  5KRU A;  1STE A;  1AW7 A;  4BS9 A;  5HUR A;  2PPB C;  3H09 A;  5ELB A;  4ZKB B;  1Z47 A;  3E5S A;  1B9N A;  4K6D A;  4C56 C;  5I2Y A;  3ERO A;  3HEJ A;  3I73 A;  5C44 B;  1JOO A;  1C48 A;  2NVY B;  3GP7 A;  3R8B A;  5JEA H;  1SNQ A;  4FF2 A;  1Y8P B;  4C3I G;  1ENF A;  2AQ3 B;  4EQN A;  1RF2 D;  4ABN A;  2SNS A;  2HCI A;  3Q0A A;  5CGK A;  4OIJ A;  1O78 A;  3W3A A;  5G3L F;  3I91 A;  2PYK A;  2KEE A;  1O7Y A;  3TZD A;  3D4D A;  1JR0 D;  1VCI A;  2AWN A;  2F0K A;  1PLF A;  3MTS A;  2YU9 B;  3J81 E;  2K7V A;  4K5W A;  2VXW A;  4KK7 A;  1H9M A;  2PCF B;  3KF8 A;  4F88 A;  3M85 A;  1EY7 A;  4TRD A;  3DMU A;  3TP8 A;  2F0W A;  3ERQ A;  5K5P A;  1A2T A;  4CHT B;  4RGN A;  2MHV A;  3A7A B;  4G7O C;  3MXP A;  4IUQ A;  5CV8 A;  3Q23 A;  4RGO S;  2IT1 A;  3FVQ A;  2Q8T A;  1Y8N B;  2BE5 C;  4FXD A;  1SNP A;  2BA0 A;  4CKE A;  1UUP A;  5C0X H;  2J7Z A;  5EPJ A;  1WTO A;  1TWF B;  5ELC A;  4BA2 I;  3P1H A;  1STB A;  5I6W A;  2O5J C;  5KNB A;  1JWM D;  1LTB D;  3KLS X;  1QE6 A;  4L8J A;  3D8G A;  4NW2 A;  1HPC A;  1IL8 A;  2XRS D;  4R8N A;  1SAP A;  1STN A;  2VUM B;  3QOJ A;  5KND A;  3SK5 A;  1STY A;  3P20 A;  4KMU C;  3D31 A;  3S17 B;  1F2Y A;  2JA6 B;  1H9R A;  4ZK9 B;  5JEA G;  1YNN D;  3NWT A;  1ESF A;  1OXV A;  5IIF A;  1W6K A;  1GJX A;  2F0E A;  2CHB D;  5JEA J;  3G7L A;  3IAY A;  4NP5 A;  2EY2 A;  3TP6 A;  2R7Z B;  3GTL B;  4E6I A;  2AQ1 B;  2FHT A;  1ENA A;  3NTH A;  3FMC A;  1FD7 D;  4K2K A;  1U4P A;  3PUW A;  4B08 A;  3VR5 A;  2N55 A;  4MN3 A;  4G7H C;  4QB4 A;  4PQX A;  1EY4 A;  2NN6 G;  1LO5 D;  1F2L A;  4M8A A;  4XDX A;  3AB9 A;  5AFW A;  1IYV A;  2I46 A;  4CBV A;  3L3O C;  3GTO B;  3JAM E;  4HSP A;  2KOL A;  4Q0F A;  3VR4 A;  4PNY A;  2F0P A;  3D4R A;  5IGD A;  3AMU A;  4XT1 B;  4RKL A;  2A6H C;  2O4X A;  2QCP X;  1KDB A;  2MP1 A;  4ZLT F;  5FK9 C;  3EFX D;  1CI3 M;  3K58 A;  4IUR A;  1VF5 C;  3DWP A;  4RAU C;  4IN3 A;  2L1B A;  1LAC A;  2DY7 A;  3JAM L;  4FF1 A;  1S5D D;  3VYT A;  1QNU A;  3PMF A;  5A35 A;  1DYQ A;  1CZG A;  1STG A;  4FO2 A;  5FLX E;  4RWS C;  2F0F A;  3MEH A;  1RJT A;  1DCZ A;  1HTP A;  3TDQ A;  1XYI A;  2NYZ D;  1BF4 A;  5LHY 1;  2VB3 X;  3HS0 C;  5IT9 E;  2RKS A;  3MC0 B;  4BY7 B;  1ET9 A;  3M7N A;  2EVB A;  5E4X A;  4FF4 A;  3R3O A;  3MXU A;  4KKT A;  1XWE A;  4ODG A;  4I7Z C;  1EIG A;  4WOR A;  3SE0 A;  3QG1 A;  4CJ2 C;  4DA2 A;  3T16 A;  1I6H B;  4CKB A;  5IGF A;  2R6G A;  2RA4 A;  4XT3 B;  2KUM A;  2F0S A;  3M4Y A;  1STA A;  5FO8 B;  1VMP A;  3KBX A;  3QO2 A;  1WTW A;  1HCZ A;  1HUM A;  2KEC A;  1IW7 D;  2HDL A;  2K04 A;  3KLR A;  3GTM B;  3K6O A;  3Q22 A;  4OGQ C;  4K6L A;  1HQM C;  5LL6 X;  1GHK A;  3QWN A;  3I8Z A;  3D4W A;  1DON A;  1WCM B;  5FOB B;  5FKA C;  4IFD I;  5JJZ A;  1TS2 A;  1GUO A;  4KV6 A;  5T1I A;  2V4D A;  4H44 C;  3S14 B;  2F3W A;  2BOS A;  3CQZ B;  3PIP 3;  3SR1 A;  1V1P B;  3A8J E;  1STH A;  1X3P A;  3J7A F;  1PZJ D;  1PTO B;  3MXG A;  4KJO A;  2IW3 A;  2KCN A;  1ML0 D;  2D62 A;  2RDG A;  3E0J A;  1HXY D;  1LTR D;  4IFD J;  2WV6 D;  2B2V C;  1DOL A;  1WTQ A;  2F03 A;  1MGS A;  1BNZ A;  2JXM B;  4TQU S;  5M5W B;  1B9M A;  4N9T A;  1GOZ A;  4IUN A;  4PMC A;  1ZYR D;  5C3X A;  1Y1V B;  5C5L A;  1JIC A;  1AEX A;  1JC7 A;  2B2Y C;  3BYT B;  5DAU A;  1H9S B;  5FO7 B;  1PZK D;  1JCK B;  2EDG A;  4A3E B;  1E2V A;  5EKK A;  5J22 A;  2CW0 C;  4O42 A;  2EXZ A;  5DM6 3;  1U4L A;  3J80 E;  1EQT A;  1LT6 D;  1C8C A;  3HGB A;  2IX0 A;  1SSO A;  2NZ1 D;  4X3S A;  4DK1 A;  5M5X B;  1EY6 A;  1EYC A;  1SEB D;  5DM7 3;  3SXH A;  4HMI A;  1RDP D;  3EQL C;  2E2I B;  2R61 A;  5IGC A;  3KUP A;  4C3J B;  3OMC A;  4V19 0;  1SDF A;  2FJ2 A;  4LK1 C;  3CKI B;  1TWG B;  2L11 A;  1M8A A;  3C3L A;  4ILW A;  2OT2 A;  2ICE C;  1A15 A;  4BBR B;  5C0X G;  3TP7 A;  1UEA B;  1H9K A;  1SYE A;  3GO5 A;  5HGT A;  3GV3 A;  3O13 A;  3H3V C;  1K8M A;  2AUJ D;  4NMZ A;  1IKL A;  3TSS A;  4RFB A;  4LJZ C;  1PDQ A;  5E4W C;  3OOC A;  4V0B A;  5I9P A;  4OIK A;  1F9Q A;  1QNK A;  2F0I A;  4FF3 A;  3VYR A;  5EQ0 A;  2B2T C;  1TT2 A;  1I50 B;  2IX1 A;  3S2H B;  3NHH A;  4ZRZ A;  3FKI B;  4KTA A;  4KD4 A;  1TWC B;  2KHS A;  1FR3 A;  2PNR C;  1RTN A;  3H91 A;  1FYC A;  2EYJ A;  5C4J B;  3J7A V;  1SJH D;  4J8Q A;  1DM0 B;  3RLF A;  1D1K A;  3TBI B;  2B8G A;  3MAQ A;  4C3H B;  3VA5 A;  2CQA A;  1KNE A;  2NTT A;  3RZD B;  1AZQ A;  1JOQ A;  2O2L D;  3PUX A;  1IKM A;  2JA5 B;  1CT1 D;  1SBB B;  3I3C A;  5EKI A;  2PO4 A;  2X6L A;  3VR2 A;  1LTG D;  4Q5V A;  4Z9C B;  1IYU A;  1Q1B A;  1FNU A;  1PTO C;  1QIL A;  4DAP A;  4HMJ A;  3S1N B;  2A68 C;  1EQV A;  4DN4 M;  4LAA A;  2EJG C;  1H9J A;  4I65 A;  4B9X A;  2WAC A;  4OHJ A;  2JE6 I;  1ICW A;  2HDM A;  4CKC A;  2JEA I;  1NAP A;  1TY0 A;  2K5Q A;  1WTR A;  2XN9 C;  4KY6 A;  4RHS A;  3SDZ A;  1K8O A;  3NBI A;  4G4K A;  4RH6 A;  3NQT A;  1EZ8 A;  4PMW A;  5KGU A;  3OWE B;  1D1I A;  3R2T A;  1PTO H;  2A6E C;  1TS5 A;  3PUV A;  1HFG A;  4WFN 3;  2PQE A;  1EY5 A;  5EPL A;  3DEP A;  1JOK A;  4J1M A;  3HOV B;  1DXM A;  3S1Q B;  2K1B A;  4NKL A;  1LTT D;  3MFY A;  2IWH A;  1FNV A;  3NTI A;  1QG7 A;  4FXK C;  5IOD A;  5KEE A;  5ELD A;  3A8K E;  5CBE E;  1MSG A;  4J6H A;  4HSV A;  5EKL A;  1MD2 D;  1CHP D;  4GZY C;  3GTJ B;  1ILP A;  2M2L A;  2EPB A;  3HP3 A;  4P2C B;  4IFD H;  4PV1 C;  2BDO A;  1LT4 D;  3LWE A;  3VYU A;  4DF7 A;  1SYB A;  2B2V A;  1EU3 A;  1WD0 A;  1PXU A;  3L9A X;  4R8I A;  1ZXT A;  4EQP A;  3NE5 B;  1EWH A;  1AN8 A;  3BYY B;  4DXG A;  2A69 C;  1KTK A;  4QF4 A;  1F77 A;  3CHB D;  3WOF A;  5JVG 3;  1OXS C;  1UNS A;  1RTO A;  2D2C C;  1KLU D;  4K5V A;  1S5F D;  1EEI D;  1IW7 C;  4RGT A;  1JB3 A;  4XQN A;  1X32 A;  1KDA A;  3OMG A;  1AFP A;  4KY7 A;  2B39 A;  1HA6 A;  2FMC A;  1LTI D;  1U4M A;  3ITP A;  1SNC A;  3H94 A;  5JAV A;  2EY5 A;  3BVZ A;  5D3D A;  1HUN A;  1NSN S;  4K2L A;  3OIP A;  1DOK A;  1TVX A;  2NTS A;  1SJE D;  4FYD A;  4XQQ A;  1KNA A;  1BUV T;  1PRT F;  1SYC A;  3ND9 A;  3PO3 B;  2A68 D;  3Q6S A;  2A69 D;  2KA7 A;  5CBA E;  1TS4 A;  3NUC A;  4IZ8 A;  4KJN A;  1SE4 A;  3VR6 A;  3N52 A;  2RSO A;  2H4O A;  5NUC A;  4G7Z C;  5CMD A;  4DU9 A;  3OPO A;  5CYU A;  3ND8 A;  1TR5 A;  3K5N A;  1F2Z A;  1MI2 A;  2HUG A;  2F0H A;  3DWQ A;  1PTO F;  1S4Z A;  3OIQ A;  4K5X A;  4H0L C;  3M4O B;  4C3H G;  5EBC A;  4K8I A;  4YIJ A;  2JSO A;  4IAL A;  5JPN C;  1PMR A;  1YNJ C;  5C4H A;  1BO0 A;  2IPK D;  1QB5 D;  2PW5 A;  4R9W A;  1XX8 A;  1R9T B;  4KY5 A;  4ULL A;  2LS0 1;  1Z6H A;  2RVL A;  4RCO A;  3NWS A;  4HCE A;  1BDO A;  4KN4 C;  2RBM A;  2L0C A;  3P75 A;  2BDN A;  1DJR D;  1EY8 A;  1LLR D;  3T56 B;  2L4N A;  1QWY A;  3PV0 A;  3BVM A;  1GUW A;  1BCP C;  3S9W A;  3GTP B;  1V43 A;  3VYS A;  4ME5 A;  3KK7 A;  1EU4 A;  1I4Q A;  3HRZ C;  3SVM A;  5TSS A;  4CJ1 B;  4DFA A;  1DOM A;  1EOT A;  2K01 A;  5C3E B;  5EPK A;  1GUG A;  1BCP B;  1JWU D;  1W6J A;  3J7Y W;  3K59 A;  4M1U B;  2EYM A;  5I4D A;  3QJY A;  1BCP F;  4OO1 I;  1B4O A;  5JPM C;  2EE1 A;  1TS3 A;  1WTV A;  3I4N B;  3DXJ C;  2E76 C;  1KLG D;  2VB2 X;  2K33 A;  1F9R A;  3K57 A;  4DNR B;  1EYA A;  1K83 B;  4C2M B;  2IX3 A;  4Y7N B;  3U9S A;  1JWS D;  1HFN A;  2XVS A;  3OW7 A;  3BDC A;  3SHL A;  5K36 H;  5JVH 3;  4HR7 B;  5KIX A;  4C1N K;  1BXT A;  1E2Z A;  2Y0S B;  4OL7 A;  1GHJ A;  2SDF A;  3K0Y A;  3T4A C;  2Z4H A;  2M9V A;  5M3M B;  2RSN A;  2F0G A;  4EGV A;  3EA6 A;  5I6Y A;  4QIW B;  1IHZ A;  3K5O A;  2G9H D;  3PO2 B;  2QEJ C;  3CRK C;  2YYZ A;  3BDO A;  2TSS A;  1HQR D;  2CVR A;  4ZUJ A;  4MIU A;  4K8J A;  3FRP B;  1NCV A;  1WD1 A;  1SND A;  5EJW A;  1GUS A;  2OEO A;  3BZD B;  1A6X A;  1B50 A;  2OF1 A;  2QDB A;  3HOY B;  2B2W A;  3FEW X;  3QOL A;  2L12 A;  1VF7 A;  2L9H A;  1DZ1 A;  2Z8L A;  2IL8 A;  2MPM A;  1SMY D;  5D3I B;  2NBF A;  4HED A;  1ZYR C;  5KNC A;  2J4X A;  4ZQ3 A;  2XIW A;  1TWH B;  5JOB A;  1MSH A;  2K5D A;  2F0D A;  3BG3 A;  5J1Z A;  3R2I A;  2R93 B;  1II3 A;  1EEF D;  3FDT A;  2OXP A;  2XWB B;  4A3I B;  1D5M C;  1S5E D;  1CA5 A;  1TII D;  3ONA B;  1Q90 A;  4XQJ A;  3EJI A;  1E0B A;  1Q1E A;  4KHV A;  1Y8O B;  1HA5 A;  1LT3 D;  1BBX C;  3NQI A;  2WAQ B;  1R4Q B;  5K36 G;  3C1E A;  3I90 A;  2JA7 B;  4IFD G;  4KI0 A;  2K28 A;  2E74 C;  5EBD A;  2B2U A;  2ENB A;  4X3K A;  5ELF A;  1CQF A;  1BQQ T;  4IUP A;  1SMY C;  3S1M B;  1EY0 A;  2Q8I B;  2A5H A;  3H6M A;  4FNF A;  3C46 A;  2EJF C;  2EYP A;  2EYH A;  4CGY B;  1A3T A;  1EZ6 A;  3DEO A;  2H1E A;  5C5M A;  1LTA D;  3H0G B;  1BR9 A;  3I70 A;  1RKN A;  3D6C A;  1TKW B;  3C1F A;  4U67 3;  3V05 A;  2ZXO A;  2K32 A;  1AZP A;  3PUY A;  1O7L A;  2QKI C;  1EIH A;  2MUY A;  4XTC S;  1H9S A;  5ELE A;  2EYF A;  2SEB D;  3F2U A;  2F0Q A;  1I4P A;  2JP1 A;  1CTM A;  1SE3 A;  2X69 A;  3L7Z C;  5I9O A;  4MHE A;  3UI2 A;  3A8I E;  4ID6 A;  3TN2 A;  4RGM A;  4A3K B;  4DGZ A;  1A2U A;  5IGG A;  1D2B A;  2KQ3 A;  3MHB A;  3DWA A;  4HAE A;  4C3J G;  2FMM A;  3NBH A;  4RCN A;  2E2D C;  4ZUI A;  1D5X C;  2WB1 B;  3RMH A;  2E75 C;  3FPP A;  1HRJ A;  2D9U A;  4LMQ D;  1PTO D;  1PRT D;  5M9O A;  1XTC D;  1A3V A;  4RKB A;  5FLX L;  1G2S A;  2R92 B;  4FXG C;  1TY2 A;  2C5C A;  2NUC A;  4QUC A;  2F0T A;  3GQB A;  3A7L A;  2A74 C;  3FPU B;  1ILQ A;  4IUU A;  1ZKO A;  2IJ0 A;  1FNW A;  5D14 A;  3BDL A;  2KCC A;  4KKU A;  2F0L A;  1EYD A;  2F0O A;  1PYW D;  4DAY A;  2R3Z A;  2XSC A;  2EY1 A;  1A3U A;  3GTG B;  1ESR A;  2TMP A;  1SFO B;  3G6J B;  3KBG A;  2WKC A;  1T5X D;  1JOR A;  2BA1 A;  4BWG B;  1PRT B;  3I72 A;  2WP8 J;  5IOC A;  4H7B A;  2B2Y A;  3CRL C;  1QJO A;  4BA1 I;  2RDF A;  5C4X B;  4K14 A;  5CV5 A;  3HG9 A;  3LNN A;  3BS1 A;  2NB0 A;  1LTS D;  1PRT C;  4EQO A;  5BN5 A;  4IUV A;  4OO1 H;  3HOW B;  3QIA A;  2EYL A;  3MXN A;  4B9W A;  4JK1 C;  5IT9 L;  1KDC A;  4A3B B;  4UDU C;  2Z1C A;  1Y69 U;  3SK8 A;  3TP5 A;  3CU7 A;  2DNE A;  2O5I C;  2LFN A;  1I3Q B;  1E2W A;  1EFI D;  2F3V A;  3AU7 A;  2XRQ D;  4XYQ A;  3NP8 A;  5C0X J;  4KD3 A;  4HTH A;  5C3W A;  4DNT B;  3RZO B;  2DY8 A;  4X3U A;  5F2D A;  2Z4I A;  3NPP A;  2M00 A;  2EZV A;  3SK4 A;  3SEB A;  2B8F A;  4A3F B;  2LKV A;  1GUN A;  1KAA A;  1OO9 B;  1O80 A;  3TME A;  3J80 L;  2VNU D;  3WDN A;  3MFG A;  3V2T A;  4H13 C;  1DD2 A;  2NWG A;  1ENC A;  4IUT A;  4C1N I;  5CV9 A;  1L0Y B;  2BCO A;  4TKO B;  2Q8R E;  1TQO A;  5LL6 S;  1WVL A;  4RA8 A;  2K6A A;  3TZU A;  1Q12 A;  2F1M A;  5BN4 A;  1Q3L A;  3E6Z X;  1VMC A;  1RHP A;  4U68 A;  1QOH A;  5C4Z A;  3S2D B;  1L0X B;  3IFT A;  4L63 B;  3X3M A;  2B2U C;  3OSO A;  1I4X A;  3M7G A;  2I07 B;  3RUZ A;  5KYL A;  1R4P B;  1C4Q A;  1MBY A;  3W2D A;  2B2W C;  1TWA B;  4ZYS A;  2F0J A;  3P7J A;  5M3F B;  2WII B;  5C6A A;  1JQY D;  2F0U A;  2N88 A;  1G2T A;  1B53 A;  2EJM A;  2E2H B;  5IGB A;  2XWJ B;  2DNC A;  1RD9 D;  2HCC A;  1WTP A;  4G57 A;  1I4H A;  1CA6 A;  1TU2 B;  1JE4 A;  5D65 A;  1V1P A;  5A2Q L;  2JEB I;  5CC4 A;  3NXW A;  1EY9 A;  4WRD A;  4XIG S;  5IGE A;  5CR3 A;  3SK6 A;  2NVX B;  1U4R A;  2C9O A;  2AWO A;  5I2X A;  2G9D A;  3I4M B;  1YNJ D;  1O7Z A;  1I6V C;  1X3Q A;  3A55 A;  3Q24 A;  1LV9 A;  1CQV A;  1SXT A;  2ICI A;  2MGS A;  4QCL A;  4F87 A;  4A3G B;  2L55 A;  3IL8 A;  3DHQ A;  1CZW A;  4S3S A;  4KKS A;  4XYO A;  4DXF A;  1V8Q A;  4X3T A;  1PFB A;  4N9P A;  1I4G A;  5COY A;  3VA7 A;  1B44 D;  3OHX C;  1F9P A;  2NVT B;  3LX0 A;  4BBS B;  1ET6 A;  1V1O A;  3HZX A;  1QCB D;  1PZI D;  2KED A;  5G3L D;  2AQ2 B;  2GA4 B;  5CV6 A;  3IKJ A;  1U9R A;  1SNO A;  1RCV D;  5C0X I;  5CV4 A;  2K03 A;  4RHR A;  3ZYY X;  1Q8I A;  2HQE A;  2PW7 A;  2A6H D;  2K05 A;  1NR4 A;  1SYF A;  3C2P A;  1CM9 A;  1M4V A;  1SYD A;  4NDX A;  3MVV A;  2F0V A;  4PMB A;  5EGT A;  4KHZ A;  2FFK B;  1ZEQ X;  2E2J B;  3MWY W;  5ISR A;  1Z7T A;  1WTX A;  2WKD A;  2XNA C;  1ONL A;  3QB3 A;  2LY7 A;  1HTL D;  1FGB D;  2JA8 B;  5CV7 A;  2PZW A;  1EL0 A;  5DEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...