1HNWQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnwQ00
2E2IH 2IHFA 3AQQA 1CUKA 3HKZG 4YCWA 3J7ZC 2B29A 2F52A 2NVYH 1Y1WH 1HNXQ 4DK3C 1L1OC 1EOVA 4LF7Q 4OO1I 3I7FA 1TWHH 1X54A 3HOXG 3I4OA 1VQAA 4NXML 4LUZA 5EAYA 2H5XA 4DR5Q 5E7NA 4ALPA 1SROA 1A0IA 1KHIA 1UE5A 1VQEA 4MTNA 4UP9A 4YY3L 1VQ5A 2CCZA 4DR3L 3GTOH 1V43A 3SGIA 2A19A 4YWKA 2IX1A 2UXDQ 1VQ7A 3K7UC 4GLVB 2LSSA 4DKAC 3DLLA 4A3KH 1TWCH 3CPWA 1VQ4A 4AYBE 1IBKQ 1HNWL 5IWAQ 1SR3A 4P71A 1JB7A 1KD1C 1PH7A 3KLWA 1BBWA 3JAMc 1G291 2YU9H 2PI2A 3MEFA 2CWAA 4YWLA 4A4IA 1YJ9A 1SMXA 1TWFH 2VUMG 4AYBG 1PH9A 2NN6G 4IFDJ 4H02A 1IXRA 3HOUH 3OTOL 4HJ9A 1PFSA 4AQYQ 1EUJA 1X56A 4UPAA 2OTJA 5ELOA 3LGJA 4A3FH 4DUZQ 4L5TA 2FXQA 2Z6KC 1FJGQ 3ERSX 3CQZH 1KAWA 4JI0L 4B3TL 3HFZB 3K0XA 1Y1WG 3F2DA 3U58A 3NBHB 3S15H 5IYCG 1D8LA 3K80C 2BH2A 3TREA 3Q8DA 4BY7H 4A3DH 1IZ6A 2L15A 1XPRA 5C4XG 1O7IA 3BU2A 3UDXA 3M4QA 1IL2A 1MIUA 4DR6Q 4X6AH 1JMCA 1Y1VH 3KJOA 3PUZA 1N9WA 4KHPQ 1PH6A 2NN6I 1B8AA 4IPGA 5C0XJ 3KF8B 1NMGA 4DR7L 3PUWA 3GTJH 1N33Q 4IFDG 3PO3H 1VS0A 3GDEA 4ME3A 1K8AC 3CCSA 1MJEA 1Q46A 1XMQQ 1N36L 4IO9A 4B3MQ 3AFPA 4LNQA 3I4NH 1HJPA 4EX5A 2JA5G 4DV1Q 2MO0A 2NVTH 3ULLA 2JEAI 1AH9A 3PIOA 4JI2L 1M90C 3GTPH 4OX9L 2K5NA 3PF4A 2NVQH 1RL2A 2E5LQ 2K50A 2K75A 1EIYB 2UUCL 3TRZA 4NXMQ 1J5EQ 2UU9L 4PZ6A 4HJ8A 4LUOA 1N32L 5J3BA 3JC66 3J80c 1PHJA 4P73A 4JI5L 5HGQA 4QGUA 5C0XG 3CPFA 4GLXA 1K9MC 3AEVA 4JI8Q 4A3LG 1E22A 3GTKH 1U5KA 1JE5A 1VCIA 1K0RA 4GN3B 1PH4A 5FLMG 1YITA 1OXTA 3D31A 5GQOA 2K4KA 4GNXB 4JCVE 2MNAA 1YHBA 4JI6Q 4OWWB 3H3VH 4QQBX 1X3FA 2GN5A 2WB1E 2VUMH 1VQMA 1Y1VG 3H0GG 4LF8L 1G6PA 5C3EG 5GAEC 1Z9FA 4X65Q 1GVPA 5H1SE 3GTLH 5C0XI 1VQCA 4JI7Q 2N78A 4A3BG 3E9HA 5IE8A 1TWGH 2NVXH 2WB1G 3W5OA 1EFWA 3I4NG 1K73C 2DUDA 2HT1A 1P16A 5IYDG 2KBNA 4IPCA 2ID0A 3TS2A 1WCMG 2ZM6L 4LF4L 1CKOA 3HOZG 1KRSA 2GVAA 4R4OA 3S1RH 4LFAL 3M7NA 3I56A 4LFBL 4JI3L 4BY1G 3CD6A 4YWMA 5IT9c 4DNIA 4DUYL 4KLKA 2Y0SE 3L7ZC 3M4PA 1EYGA 2UUBQ 3GTMH 1XMOL 1GO3E 1VQPA 3KYHC 1IBLL 5K36G 1Q1EA 3NENA 2R93G 1Q1BA 4HIMA 2F4VQ 3GTGH 1VQFA 3CCJA 1NMFA 1FGUA 3PV0A 1N32Q 2KCTA 1C7YA 1TXYA 4B3RL 1VQIA 3FP9A 1B70B 1J6QA 2AHOB 4P75A 3RZOH 2Y0SG 4HIKA 1QVGA 1JJ2A 3A0JA 4QJFA 1Y14B 5IP7G 1X6OA 4HJ7A 4JI4L 3B6YA 1E3PA 4JI1L 1X3EA 2Q2HA 2PI2E 3J80i 4DV6L 3RZDH 3RNUA 2HQLA 1CSPA 3PUYA 1AE3A 3TEHB 1LUZA 2B63H 2UUCQ 3M3YH 2IHEA 4DV5Q 1HR0L 1HZ9A 1QUQA 3AYHB 2N8NA 3CCMA 2HHHL 3KFUA 4JBWA 4LF5Q 3CMEA 4POGA 2HIXA 1MJCA 1KXLA 4A3EG 5M5WH 3H3VI 1Q7YC 2UXCL 5JJIA 3AFQA 5IYBH 3A74A 4GN4B 3H15A 3MXNB 4DR2L 4LF6Q 4HIDA 1JJGA 4DV4Q 4GLAC 4EQ5A 3S2HH 4A93H 2I5MX 3ICEA 2BA1A 3S16H 5LMUQ 3BZCA 4JG2A 3UE1A 4DR1L 4L5QA 2ATWA 3CC4A 3UDGA 1TWAH 2DGYA 4IPHA 1OXXK 2R6GA 4JV5L 2EIFA 4A3CH 4LFCQ 4BBSG 3FHWA 1CSQA 4DV0Q 1XNRL 4JYAL 2BH8A 2JK8A 4R4TA 1OTCA 1JJCB 5JJLA 2ZM6Q 4J15A 2D0OA 1K83H 5LMNL 2E8GA 2I5HA 3T1YL 2OWOA 4BXXH 1XNQQ 4O2DA 1S40A 4K0KL 1E1TA 3KF6B 2RCNA 3PGZA 4X62L 1XMOQ 1NJIC 1QZHA 4LF9L 2R7ZG 3J7A5 1B7YB 1NY4A 1XPUA 1EQQA 2UUAL 2A8VA 1L1OB 3HOVG 2E2HH 3M85A 4DV3L 1Q8KA 1KRTA 1I94L 5IYBG 1P8LA 2YYZA 2OTLA 1WOCA 5M3MH 1YJNA 4GKKQ 4WJ4A 4GOPA 1ASYA 2JJQA 3S24A 1LYLA 1PYSB 1OXUA 1Q12A 1PV4A 1IYJB 1A8VA 2K5HA 1YI2A 3F1ZA 4DV2Q 4A3CG 1NBWA 2HHHQ 4MNOA 4NPSA 1IBMQ 4MZ9A 3PUXA 3I2ZA 3CC2A 4A3KG 1V9PA 3K8AA 2R92H 4WJ3M 2VQEL 4YHHL 4GKJQ 4BXXG 1I6HH 4YCVA 4GOPC 3CMAA 4L5SA 3CC7A 4JBMA 1PH3A 1NE3A 5M3FH 4KI0A 3I4MH 2D0PA 1HZCA 2Q2IA 4HIOA 1S3OA 3HOUG 4RG1A 1XTDA 1AE2A 1SN8A 2QEXA 5BR8L 2UXBL 3PIPA 1Q82C 4YY3Q 4A3FG 2JA7H 1C0AA 4DR3Q 2KHJA 1YIJA 1PH5A 2VQFL 3EBEA 1MKHA 5AJ3L 5M5YH 5GROA 2QA4A 2OCEA 3ULJA 4X66L 1LTLA 3GO5A 2K14A 3T1HL 1HR0W 4BY7G 4A3DG 3T1YQ 4HJAA 1HNZL 2RHQB 5C44H 3PSIA 1KC8C 5JJKA 1PA6A 1S72A 4X64L 1BVSA 2K5VA 3TQYA 2YTXA 4Y52H 3W1BA 1R9TH 3PO3G 2AKWB 4C2MH 4DV3Q 4A3JH 2R92G 4PZ8A 4DR4L 3OTOQ 4UY8C 4B3SL 1N34L 4OONA 1W2BA 1X3GA 1Z47A 2PMZE 4DV7L 4JI0Q 4B3TQ 2YV5A 4A3MH 1SLJA 1I3QH 1UE6A 4IJLA 3I4MG 1A63A 1QZGA 4LWCA 1YZ6A 1U0LA 2ZTDA 4JBKA 4R4CA 2JA7G 3TS0A 1HNXL 2JA8H 3PO2H 4LF7L 2D62A 4C3HH 5LMNW 4DR7Q 1WI5A 3RN5A 4DR5L 5GADC 3WWVA 1N36Q 2ZJQA 2R7FA 4A76A 2UXDL 3RLNA 2N3SA 5IY0A 5C44G 2I0QA 4JI2Q 3HOWH 4OX9Q 3OW2A 3K7AH 1IBKL 1BKBA 2JE6I 2VS1A 2WP8J 4UP7A 2ALYB 3STBC 2Z0SA 5IWAL 3CCEA 3HOYH 5C4JH 1XPOA 4A3JG 2UU9Q 5GAHC 2MO1A 4OXPA 1PYBA 2PQAB 3K81C 1OXVA 4OWTB 3ULPA 1SFOH 4JI5Q 5GAGC 2VNUD 2CWPA 4PG3A 1VQ9A 5AJ3Q 4BA2I 2YTVA 4JOIA 2OQKA 5FLXc 2ZTEA 4IFDI 4AQYL 1D7QA 3T1HQ 1YHQA 4NB3A 1GD7A 2RHSB 4DUZL 4IOCA 1UWVA 1CKNB 1HNZQ 1V1QA 2ZJRA 3KF6A 2HIVA 4LF8Q 3J81i 2JA8G 1GKHA 3PO2G 5HY6A 4RMFA 1DGSA 3OYYA 2QGQA 1HZBA 3RLFA 1L1OA 1WFQA 1VQNA 4LUVA 4DR6L 1SRUA 2B3GA 3STBD 4KHPL 4NXNL 1FL0A 2LXJA 2IY5B 4B3SQ 1K3RA 4BA1I 1N33L 1VQGA 3FKIH 4JOIC 4LF4Q 1QVFA 3G4SA 4JC0A 2VL6A 1XJVA 3UDFA 4LFAQ 1XMQL 3GTQH 3HOWG 4LFBQ 1WYDA 3DM3A 4B3ML 4JI3Q 4DUYQ 1Q86C 1K8GA 2B63G 1HNWQ 4DV1L 2F3IA 1I50H 2GVBA 1IBLQ 2VZAA 4QL5A 4XIGS 5IYCH 2A1AA 1VQLA 2E5LL 4B3RQ 4GS3A 3NELA 1KL9A 4TVAB 5C4XH 1QUQB 1J5EL 1EIFA 2AWOA 4BBRH 1E1OA 3GD7A 1YJWA 4JI8L 3CCRA 1PH2A 1VQKA 4JI4Q 3S17H 1GM5A 4A93G 1QVCA 3KDFB 4JI1Q 1OXSC 2ES2A 2Z6KA 1W3SA 4L5RC 1UE1A 4DAMA 2NZOA 4JI6L 3S2DH 4DV6Q 3L0OA 5FJ8H 4IJHA 2WAQE 2JA5H 1EQRA 3D0FA 3M9BA 1HR0Q 3BZKA 2C35B 1FVIA 4A75A 4X65L 3PF5A 1M1KC 3FKIG 5JEAJ 3F2CA 2KENA 1L2FA 4XTCS 2XTIA 3CCVA 4JI7L 2UXCQ 2JA9A 3J81j 2WAQG 3G71A 4AIMA 2ZJPA 1VQ8A 4GNXA 4A3LH 4DR2Q 2YTYA 1EWIA 2BA0A 3I55A 4C3JH 5M5XH 4TQUS 2RF4A 4DR1Q 4PZ7A 5FLMH 4R1JA 2UUBL 4KHZA 3NEMA 4R4IA 2XGTA 4BBRG 3KJPA 1G51A 2F4VL 4JV5Q 1CKMA 5M3MG 3H0GH 2Q2TA 2Q2UA 4DPGA 1T9HA 1C9OA 3CP0A 5C3EH 4NXNQ 1XNRQ 4JYAQ 5JEAG 4IOAA 2CQOA 3E9IA 1YVCA 3ZJYC 1E7ZA 1VQHA 4GNXC 4A3BH 5LMNQ 3RR5A 5FJ8G 1VQDA 1KQSA 4K0KQ 1VQJA 5ELNA 4OWXB 3U4ZA 3UE0A 4X62Q 4GOPB 2IX0A 5IYDH 1JT8A 1WCMH 4LF9Q 3CCUA 3HOZH 4C3IH 4A3IH 1N8RC 3PUVA 3A5ZB 4LW1A 2UUAQ 4BY1H 2EQSA 1X55A 1LM0A 2IT1A 4YCUA 3M4OH 2OQ0A 3J81c 4DV5L 1I94Q 3G6EA 4JBJA 2R93H 1VQOA 3EN2A 4DK6C 3U50C 2AWNA 1I5FA 5IP9H 4LF5L 2PNHA 2KHIA 2VY3A 3F2BA 2MFIA 4A3GH 2V1CC 4P74A 1HZAA 5M3FG 3JAMi 1HH2P 3EIVA 1PVOA 4IPDA 4AH6A 5IP7H 4LF6L 2K52A 4DV4L 2AMCB 2N49A 1ASZA 3CXCA 3CF5A 3RN2A 3VDYA 3UDIA 5LMUL 4APVA 2NZHA 2PQAA 2JEBI 3S1NH 4HJ5A 3L2PA 2CFMA 3RLOA 1A62A 3G48A 4LFCL 2JQOA 4YHHQ 2VQEQ 1UEBA 4PMWA 3IRBA 4R4QA 4DV0L 3S14H 3CCQA 2R7DA 1CKNA 1X9NA 4A3IG 4A3EH 2JA6H 4GN5A 5DLQE 1YNXA 3PCOB 1XNQL 2I5LX 2ASBA 3U4VA 3CAMA 2EXDA 2UXBQ 5BR8Q 3BJUA 5IP9G 1RIPA 2CKZB 2ZTCA 1PH1A 2VQFQ 1Q81C 4Y7NH 4A3GG 3HOXH 4QIWE 4DAYB 4X66Q 4A3MG 1X65A 2E2JH 4BBSH 1L0WA 2VW9A 3HKSA 1SE8A 3CW2C 4FDBA 1FJGL 1WJJA 1YEZA 4GKKL 4POFA 1UE7A 4X64Q 1PH8A 1H95A 4P72A 3CCLA 3KOJA 2KCMA 2MQHA 1E24A 1KIXA 2WFWA 4DV2L 3S1QH 4DR4Q 4OO1G 3ER0A 3A5UA 2R7ZH 3HKZE 1YBYA 3W1GA 4QY7A 1N34Q 1YHAA 1VQBA 1IBML 1VQ6A 1BBUA 1NTGA 4DV7Q 3HOVH 2LXKA 3F8TA 2JA6G 3KDFA 3E0EA 3HOYG 4GKJL 4UP8A 4O0AA 3S1MH
chains in the Genus database with same CATH superfamily
2E2IH 2IHFA 3GTJB 3HKZG 2B29A 4NKLA 3SEBA 1HNXQ 2EJFC 3I7FA 2F0SA 1TWHH 2NVTB 1QG7A 1X54A 3HOXG 4LUZA 4DR5Q 2H5XA 4ALPA 1UE5A 1VQEA 4YY3L 3GTOH 4DR3L 1V43A 4S3SA 3SGIA 5D65A 4DXFA 3T16A 2IX1A 2SNMA 4DKAC 4IFDH 3FPPA 1VQ4A 4AYBE 5IWAQ 2L12A 1D5XC 1JB7A 5M5YB 1BBWA 3JAMc 1G291 4MTKA 5CGKA 2CWAA 3LWUA 4I7AA 1YJ9A 2VUMG 1TKWB 4IFDJ 4H02A 1IXRA 4P2CB 4HJ9A 4AQYQ 1X56A 4UPAA 5ELOA 5C0XH 4A3FH 4DUZQ 4NDXA 1FJGQ 2B39A 1KAWA 3CQZH 5ELBA 4A3JB 3U58A 3S15H 3L3OC 1TWGB 4RKLA 4BY7H 3TREA 3WDNA 3M4QA 1MIUA 1CI3M 4IPGA 5C0XJ 3KF8B 1QCBD 1N33Q 4IFDG 2PW5A 5CC4A 4K5XA 2X6LA 1XMQQ 4ZQ3A 1LTID 1N36L 1TIID 2JA8B 3JAME 4EX5A 2MO0A 3W3AA 1AH9A 3PIOA 1M90C 3GTPH 4OX9L 1CQFA 3PF4A 1RL2A 1W6JA 1HA5A 1EIYB 2UUCL 3K0YA 1J5EQ 4R8IA 1W6KA 1IW7D 3K7AB 1PHJA 1SE2A 5C0XG 4A3LG 2G5DA 5DAUA 4JI8Q 1F9SA 1VCIA 1K0RA 1CK1A 3E3XA 1YITA 3DWAA 2K4KA 1SFOB 4JCVE 1E2ZA 1RTOA 2GN5A 1VQMA 4OEMB 4DGZA 4LF8L 1G6PA 3E5SA 3E9HA 5IE8A 2WB1G 4L6TB 2HT1A 5IYDG 1HFNA 2KBNA 4KV6A 2ID0A 1WTWA 1WCMG 2RSNA 2A69D 3I56A 1MSHA 2WACA 3CD6A 5IT9c 4DUYL 4DNIA 1HNWL 2UUBQ 1XMOL 1GO3E 1VQPA 2F0EA 3OHXC 5K36G 5C5LA 3FDTA 1Q1BA 2B2UC 2R93G 4XYQA 1NMFA 3PV0A 1TXYA 1B70B 1J6QA 4P75A 1EIHA 1QVGA 1STGA 4QJFA 5EKLA 1Y14B 1SNMA 4HJ7A 3A56A 4JI4L 1E3PA 5C4XB 2ICIA 2Q2HA 1STAA 3TMEA 4BBRB 1I6VC 5M3MB 5CV6A 4DV6L 1SYBA 3D4RA 3TEHB 1HZ9A 3K57A 2N8NA 4JBWA 4LF5Q 2SEBD 1MJCA 4K6LA 1K8OA 2JA5B 5IT9E 5M5WH 2UXCL 4G4KA 5IYBH 3A74A 2BE5C 5EBDA 4LF6Q 1TS5A 4DV4Q 4GLAC 4EQ5A 1J9OA 1OXXK 4ILWA 1T5EA 1SNOA 5M5XB 3KK7A 2A5HA 4YIJA 1XNRL 4R4TA 1H9JA 1OTCA 2ZM6Q 4J15A 2RSOA 1QWYA 2D0OA 5FK9C 4QMGA 3NBHA 2OWOA 1Z7TA 1E1TA 3PGZA 1NJIC 1QZHA 1EQQA 2UUAL 3H3VC 2JP1A 4JVZA 3CU7A 1Q8KA 1DOMA 2K5WA 1MD2D 4K5VA 4K6DA 5DNFA 5IYBG 1Q8IA 2OTLA 4A3IB 4V190 1YJNA 1C48A 1EFID 4QCLA 1OXUA 2K04A 1PV4A 1A8VA 5FO9B 1YI2A 5ELDA 5A2QE 4DV2Q 2EY1A 1ENAA 2I07B 2M2LA 4NPSA 4A3MB 2HHHQ 4MZ9A 1CT1D 4QF4A 1SXTA 2XWBB 1V9PA 3QR8A 1XTCD 1PRTC 3MXPA 1SSOA 3TP5A 3CMAA 1BCPC 1PH3A 1H9RA 5CV4A 1HZCA 2Q2IA 1S3OA 5KIXA 1M4VA 1X3QA 1SN8A 3MXGA 4U68A 2MGSA 4WORA 5M5YH 5GROA 1LV9A 2OCEA 1KNAA 2K14A 3T1YQ 5JJZA 1V1PA 4B9XA 4PQXA 1PA6A 1S72A 1BO0A 3TQYA 3OMGA 2KQ3A 2HCIA 3W1BA 5KNDA 5I2XA 4DV3Q 4A3JH 1HUNA 2K6AA 4UY8C 4OONA 1Z47A 4BWGB 5JAVA 4CDFC 3URYA 2YV5A 1KDAA 4O42A 1SLJA 1UE6A 1A63A 3NQTA 4RHRA 2L1BA 1HNXL 2JA8H 1RDPD 4J8QA 1WI5A 1GOZA 4DR5L 1Y1WB 4A76A 1TY0A 1QB5D 3MXNA 1F2ZA 2ICEC 3I3CA 3K7AH 2WP8J 4UP7A 5IWAL 3SE0A 3CCEA 1V1OA 4A3JG 2UU9Q 3SK5A 4CHTB 1R4PB 5GAHC 1TR5A 2PQAB 1SFOH 4CDDC 1PZJD 3E0JA 3SK6A 2YTVA 1SNCA 1SNPA 4AQYL 2J7ZA 5F2DA 1EY7A 1CTMA 4DUZL 1UWVA 2L11A 3NTIA 3FVQA 3A7LA 2HIVA 5J22A 2JA8G 4TRDA 1WTOA 3HOUB 4X3KA 4RMFA 2J4XA 1HZBA 1L0YB 3A54A 3BS1A 2B2TA 4NXNL 2IY5B 4RWSC 4B3SQ 1K3RA 4BA1I 3TSSA 1QE6A 1VQGA 1N33L 4LF4Q 1S4ZA 1O78A 1SDFA 1XMQL 4LFBQ 3H0GB 1XXGA 5C3EB 2KJXA 3MWYW 2F3IA 3S9WA 1GJXA 2VZAA 4ZUJA 2BE5D 2XVSA 1EIGA 5IYCH 1VQLA 1PTOF 4QB4A 5C4XH 1J5EL 4BBRH 2SOBA 4C3IB 3K5NA 1YJWA 4BY1B 1S5ED 4JI8L 3CCRA 1PH2A 4DNRB 2Z6KA 1UE1A 3D3RA 2O5JC 2NZOA 3L0OA 3TZDA 2JA5H 4IALA 1A2UA 3PF5A 2KCCA 1I4PA 2F0LA 2XTIA 3TP8A 1DYQA 2JA9A 3G71A 2EOTA 2ZJPA 2YTYA 1EWIA 4HMIA 2A6HD 3SK8A 3S1NB 3GTLB 4CKCA 1U4RA 3NP8A 5M5XH 4TQUS 4XQQA 3NK9A 1PLFA 4R1JA 2UUBL 4IZ8A 2FMMA 4KKSA 2B2YC 4BBRG 2A6ED 3I8ZA 5M3MG 2Q2UA 1T9HA 1C9OA 4KD3A 4IOAA 3OW7A 2CQOA 3BVGA 3E9IA 5L37A 4C56C 4V0BA 5IGEA 3TBIB 3GTGB 1PRTB 2NTTA 3KLSX 1VQDA 5NUCA 1KAAA 4OWXB 1BCPB 3HOZH 4A3IH 1N8RC 4LW1A 1BCPD 1O80A 2IT1A 4YCUA 1HHVA 3G6EA 1F2LA 4JBJA 2BDNA 1VQOA 3EN2A 4LF5L 3F2BA 1U4LA 2V1CC 3M3YB 4P74A 3EIVA 2WKCA 2MPMA 1ENFA 5CV9A 4LF6L 4RCNA 4DV4L 5AFWA 5C3XA 1ASZA 1S5CD 3K5OA 2C9OA 4XT3B 1YNND 2NZHA 2ZT9C 2F3VA 2N55A 1A62A 1FYCA 3G48A 4KD4A 2QDBA 2VQEQ 4OO1H 2CW0C 1UEBA 3CCQA 4MHEA 4A3IG 4A3EH 3A7AB 2NUCA 4GN5A 3DM1A 3GTOB 2H1EA 3HRZC 3U4VA 5CBEE 3IAYA 2ZTCA 5T1GA 3EVQA 1Q81C 4X66Q 4A3MG 1X65A 1S5DD 1DCZA 1C4QA 5J39A 3HKSA 4FDBA 2E2HB 1WJJA 4KY7A 1UE7A 4X64Q 1Q90A 3CCLA 3WOEA 4A3FB 2DNEA 3CQZB 4DV2L 2B8GA 4OO1G 3S15B 3W1GA 4QY7A 1N34Q 1YHAA 3EJIA 4BY7B 2XNAC 4DV7Q 3E0EA 3HOYG 4O0AA 5D14A 1STEA 1D5MC 3QIAA 4ME5A 4UAIA 3SDZA 3J7ZC 1CQVA 2F52A 2NVYH 2QKIC 5I4DA 1Y1WH 1L1OC 1EOVA 2QCPX 3MC0B 4LF7Q 2RDGA 5FLXE 1I6HB 1STYA 1HUMA 3H09A 5E7NA 1VQ5A 1A0IA 4MTNA 4UP9A 4TKOB 4YWKA 3I4MB 4XDXA 4CBVA 3DLLA 4A3KH 3AMUA 1UUPA 2DN8A 3SHLA 3U9OA 5M9OA 4EQNA 1BBXC 2YU9H 3TDQA 4CJ2C 1SMXA 2O5IC 1ILQA 3HOUH 2OTJA 3NUCA 1GXDC 1PFSA 3LGJA 1F9PA 1R9TB 4L5TA 5EJWA 4C2MB 2Q8IB 1Y1WG 3HS0C 2G9HD 3F2DA 1IW7C 2BH2A 3Q8DA 1XPRA 5K5PA 1O7IA 4X6AH 1IL2A 4DR6Q 1JMCA 1N9WA 3G7LA 2NN6I 1B8AA 2GA4B 1I3QB 1NMGA 3PUWA 3MTSA 2QEJC 1MJEA 4B3MQ 3AFPA 2HUGA 3PO2B 1HJPA 3DXJC 4OGQC 2PW7A 2K5NA 1BQQT 4J1MA 1H9SB 2SNSA 1T5XD 1DJRD 2E5LQ 4X3SA 4KY5A 4NXMQ 2UU9L 1BDOA 3T56B 3M7NA 4QGUA 5HGQA 2A69C 2EYPA 3CPFA 2K7VA 4GLXA 3AEVA 4LK1C 5C4JB 4GN3B 1JE5A 1PH4A 1ENCA 3VYTA 5FLMG 4FF4A 5GQOA 4JI6Q 1YHBA 3H3VH 1J8IA 2AQ1B 3H0GG 5J1ZA 2WIIB 1Y8OB 5C3EG 5I6WA 1Z9FA 1GVPA 1X3PA 1B9MA 5G3LD 2DY8A 3GTLH 1VQCA 4JI7Q 2N78A 4M8AA 4DAYA 1VF5C 3W5OA 2DUDA 1STNA 4IUUA 3TS2A 1EZ6A 4LF4L 1KRSA 2GVAA 4C3IG 5C6AA 1ICFB 4N8X1 1LTRD 4LFBL 4BY1G 2Y0SE 3L7ZC 4PMBA 2K5QA 3KYHC 4NW2A 1TVXA 4HIMA 2F4VQ 3GTGH 1N32Q 3QJYA 1D1IA 1I50B 1NR2A 4RCOA 4HIKA 3A0JA 3CRKC 5IP7G 2F0QA 2HDLA 3B6YA 4K8JA 1RKNA 3J80i 3PUYA 2LKVA 2B63H 1LUZA 3S17B 3M3YH 4ZRZA 4XXEA 4EQOA 1A6XA 3KFUA 3AYHB 4KY6A 2FFKB 2JSOA 1LACA 1IYUA 3CMEA 2E76C 4KKTA 3H15A 3MFYA 3UI2A 1CA5A 3J7AF 4A93H 3ICEA 2BA1A 1EWCA 3UE1A 2N88A 2ATWA 3R2TA 4LMQD 1TWAH 5KRUA 4IPHA 1JOOA 2EIFA 2TMPA 4B9WA 4LFCQ 4A3CH 1RTNA 2XIWA 3FHWA 4R9WA 3VR4A 2XRSD 2F0IA 3TP7A 2ZXPA 5JVH3 2E8GA 4BXXH 1A2TA 5KGUA 4J6HA 1TQOA 1TS3A 1EY0A 2R7ZG 1H9KA 1MSGA 2A8VA 1L1OB 3X3MA 2E2HH 1PFNA 4M1UB 1QNKA 1PFBA 2EY5A 4HSVA 4WJ4A 4GKKQ 3M4OB 1ASYA 2JJQA 4I65A 1LYLA 1IYJB 1XX8A 4QUFA 2K5HA 4KTAA 4A3CG 1PZID 1GHJA 1ZEQX 4HSPA 3PUXA 2MP1A 3I2ZA 2LMCB 3HG9A 1G91A 1B3QA 2VQEL 4BXXG 1I6HH 4QIWB 1LTTD 4L5SA 3MXUA 5EKKA 1NE3A 3I4MH 1JB3A 1TS2A 1AEXA 1XTDA 1C8CA 1KLGD 4A3FG 4G57A 2L55A 5AJ3L 2VB3X 2QA4A 4X66L 1SJHD 3T1HL 4BY7G 1JQYD 4FNFA 4HJAA 2CHBD 2RHQB 3ND8A 1KC8C 1WTRA 5JJKA 3T13A 4X64L 2K5VA 5A35A 4Y52H 4ODGA 4CGYB 5HURA 1R9TH 4FP5D 3I91A 3D6CA 3D4WA 4C2MH 4F88A 1N34L 2PMZE 4N9PA 4DV7L 4JI0Q 1HPCA 1O7ZA 5IGDA 1I3QH 3I4MG 5EKIA 4LWCA 3P1HA 4AYBB 1YZ6A 1JC7A 4JBKA 2E75C 3G6JB 4QUCA 3PO2H 4LF7L 1EOTA 2RDFA 3S1MB 3RN5A 4GZYC 3WWVA 2ZJQA 2QF7A 2E74C 1WTPA 1A3VA 3RLNA 4JI2Q 2JE6I 5FO8B 2ALYB 2Z0SA 1EWHA 5IODA 5C4JH 3K6OA 1TWCB 1KLUD 2MO1A 4JI5Q 1PYBA 1KNEA 3K81C 2VNUD 5GAGC 2F0UA 4JOIA 4XQNA 2K32A 2RHSB 3T51B 1CKNB 1HNZQ 3KF6A 4OIJA 3NXWA 5E3FA 3J81i 3PO2G 4C1NI 3OMCA 3FMCA 1DGSA 3OYYA 2QGQA 3RLFA 3R2IA 1WFQA 2HCCA 2P5ZX 4LUVA 1ONLA 4KHVA 4DR6L 3STBD 2HQEA 5JPNC 4A3DB 4JOIC 4RFBA 1LTAD 3GTQH 3G4SA 4JC0A 3UDFA 4LFAQ 3DM3A 1S5FD 4B3ML 4JI3Q 4G7HC 1I50H 2GVBA 3H6MA 1IBLQ 3ERQA 4QL5A 2AQ3B 2O2LD 2E5LL 3I4NB 4B3RQ 3NELA 3HP3A 1VDZA 4TVAB 3KUPA 2VB2X 2A6HC 3HOZB 2F0PA 1VQKA 3FRPB 3S17H 1ICWA 1OXSC 1W3SA 2A6EC 4JI6L 5EPKA 2B2VA 5KNCA 3VR3A 2WAQE 1EQRA 3C46A 1U9RA 1HR0Q 4A75A 3Q6SA 2WKDA 1M1KC 4DFAA 4XTCS 2Q8TA 4JI7L 1BR9A 1A3TA 1CHQD 4GNXA 1ML0D 4DR2Q 4ZAIA 1PXUA 3I55A 4IUTA 3NWSA 4DR1Q 2D9UA 2R61A 4KHZA 4R4IA 2XGTA 3EQLC 1G51A 1LABA 4A3EB 2F4VL 2Q2TA 1K3BC 1N32L 4DPGA 3CP0A 3GTMB 1YVCA 2J0TD 3NTKA 1VQHA 4GNXC 4A3BH 2EE1A 3RR5A 4RA8A 3DWPA 1YNNC 4RGTA 4X62Q 2EXZA 1JT8A 4LF9Q 1FNUA 1NAPA 3WOFA 3A5ZB 3H94A 1LM0A 2CH4W 3M4OH 2DNCA 2L5TA 1I5FA 3FEWX 4L63B 4TSSA 3RZDB 2VY3A 2MFIA 4N9TA 5I6YA 3JAMi 1HH2P 1PVOA 4AH6A 3T53B 1RJTA 1IKLA 2K52A 2N49A 2F0WA 3RN2A 3VDYA 2NZ1D 2QW7A 3SXHA 3P20A 1ZXTA 1CZGA 2NVYB 4LFCL 4YHHQ 4R4QA 1MHWC 3S14H 3MFGA 1WTQA 1EY9A 3PCOB 1ZKOA 2A68D 1EY8A 4A3KB 2EXDA 1F77A 1K83B 4K2KA 2VQFQ 2F0OA 3GP7A 4JPBW 2YU9B 3OPOA 2MHVA 3QG1A 4BBSH 1L0WA 1SE8A 1FJGL 1YEZA 4GKKL 4POFA 4FXKC 1H95A 4P72A 4RKBA 3KOJA 2KCMA 2MQHA 3V05A 2RCFA 1DOLA 1VF7A 3NBIA 1KIXA 1S5BD 2M9VA 3A5UA 3HKZE 1VQBA 1VQ6A 1NTGA 3HOVH 2RVLA 2F0VA 3A55A 2PZTA 3KDFA 3SK4A 3S1MH 1HXYD 3AQQA 1LLRD 4H13C 4XQJA 1VMCA 3AB9A 4OL7A 4IURA 2B2TC 1HFGA 3I4OA 3OIQA 5EAYA 1SROA 1KHIA 2NYZD 5ELEA 3K7UC 1IHZA 4L8JA 1TWCH 2C5CA 3CPWA 4IUQA 3QO2A 2B2WA 1SR3A 1YNJD 3M4YA 1KD1C 1SE3A 2PI2A 3RUZA 3KLRA 3MEFA 4YWLA 4O1NA 4AYBG 4MN3A 2K03A 5CBAE 5C44B 5DM63 2EY6A 1EUJA 1F2MA 3K5LA 1PTOD 2IJ0A 1Y8PB 2FXQA 2Z6KC 3ERSX 4JI0L 2R3ZA 3KLSA 3NBHB 5IYCG 1B4OA 1D8LA 3K80C 4RHSA 4A3DH 1IZ6A 2L15A 2QDLA 5C4XG 3BU2A 1B1ZA 1WTVA 3KJOA 2L9HA 3PUZA 1PH6A 5BN3A 2Z8LA 3PO3H 1K8AC 1PRTF 4LNQA 1SBBB 1B53A 1FNVA 3DWQA 3I4NH 4ZK9B 2JA5G 3HGBA 3ULLA 2JEAI 1EZ8A 4JI2L 5IOCA 4PV1C 3R93A 2NVQH 3NHHA 5I9PA 2K75A 5C3WA 1SNQA 3TRZA 4PZ6A 3BZDB 4HJ8A 3HOWB 4LUOA 5J3BA 3J80c 4IFDI 4P73A 1KDBA 4JI5L 1K9MC 4N8FA 1E22A 1X32A 2B63B 2A73B 4R8NA 1GUWA 1O7LA 2Q8RE 1EY5A 4OWWB 4GNXB 4ZKCB 4KK7A 2MNAA 1HTPA 2WB1E 3VYSA 1ESFA 3ONAB 4IQZA 2KECA 4X65Q 3C1FA 4X3UA 5H1SE 5C0XI 4A93B 3I4NG 1EFWA 1K73C 5FOBB 4IPCA 1TWAB 2ZM6L 2PQEA 3HOZG 4R4OA 4LFAL 4JI3L 4FXDA 1V1PB 1LT6D 4ZUIA 3M4PA 3GTMH 1IBLL 1RHPA 4C1NK 1Q1EA 3NENA 3J80L 3CCJA 1AFPA 2KCTA 4B3RL 1SAPA 3FP9A 2AHOB 3RZOH 1DXMA 3OIPA 2NTSA 4F87A 3MZ5A 1IKMA 3BYTB 5EQ0A 3KBXA 1I4HA 2JXMB 1D2BA 1TS4A 2PI2E 3VYRA 4PMCA 3RZDH 2HQLA 1CSPA 1AE3A 2VXWA 2UUCQ 2IHEA 1HR0L 2HHHL 3QWNA 3LX0A 4POGA 1BXTA 1KXLA 2K01A 4A3EG 1JWUD 3RD4A 1Q7YC 4I7ZC 3TP6A 3DMUA 3MXNB 4DR2L 4HIDA 2I5MX 3SVMA 2ZXOA 5LMUQ 4DR1L 4L5QA 1QILA 3N6RA 3CC4A 5JOBA 1SYGA 3PQIA 4DV0Q 2JK8A 1BNZA 1ZYRD 1JJCB 5JJLA 1EEID 1HQMC 5CYUA 1K83H 4FXGC 3T1YL 1SEBD 1XNQQ 3D4DA 4X62L 1XMOQ 4LF9L 4H7BA 3J7A5 1NY4A 2IX3A 1XPUA 2WB1B 3M85A 3KF8A 4DV3L 1D1KA 1LTSD 5CV8A 2YYZA 1WOCA 2X6GA 4JK1C 4DF7A 3CRLC 1E0BA 3BDLA 3O13A 4GOPA 4XT1B 3M7GA 1PYSB 1TY2A 3R8BA 1NBWA 1ESRA 1IBMQ 1OO9B 4HEDA 3CC2A 4A3KG 4YHHL 4GKJQ 3K5MA 1SMYD 2RDHA 4GOPC 1ET9A 2FJ2A 5COYA 1HQRD 1SYDA 5M3FH 3Q22A 2Z4IA 2D0PA 4HIOA 3HOUG 1DM0B 3GV3A 1YIJA 4JW0A 2VQFL 1PH5A 3EBEA 3TZUA 4Z9CB 3ULJA 5CV7A 1LTLA 4X3TA 1NNXA 3GO5A 1NCVA 1WVLA 1HR0W 3ZYYX 1A3UA 1I4QA 1PTOH 4WRDA 4Y7NB 5C44H 3PSIA 1LO5D 4CDCC 2YTXA 2WV6D 1FD7D 1AZQA 4PZ8A 3OTOQ 4B3SL 5JVG3 3P75A 1W2BA 1X3GA 4CJ0B 5LL6X 5C4HA 1EU4A 4B3TQ 3P7JA 4RH6A 5EPLA 4IJLA 4K2LA 1QZGA 1NUCA 3GTQB 2ZTDA 3C2PA 3TS0A 4DK1A 3PIP3 2XWJB 2D62A 2TSSA 4C3HH 1WD1A 4DR7Q 3NSWA 5GADC 1DONA 5IY0A 2I0QA 5C44G 4CKEA 5CORA 5EPJA 2PZWA 3HOWH 3OW2A 1BKBA 3STBC 4OIKA 1UNSA 3J81L 3C1EA 1IL8A 1HTLD 4OWTB 1JWMD 4PG3A 3MA2B 1VQ9A 1SJED 1D7QA 2IWHA 1YHQA 4NB3A 1GD7A 4IOCA 2ZJRA 1G6ZA 2IL8A 4ULLA 4IUNA 5HY6A 1VQNA 4DAVA 1SRUA 2EVBA 4RGNA 4RGMA 1G2SA 2KHSA 1QVFA 2VUMH 3DHQA 3HOWG 1Y1VB 1WYDA 4DU9A 1Q86C 5JPMC 2B63G 3IFTA 1KABA 4ZLTF 4G7OC 2I46A 2XN9C 4A3BB 3OSOA 4XIGS 3Q0AA 4GS3A 1KL9A 3I70A 3GD7A 2OT2A 5HGTA 4A93G 4JI1Q 2CH4A 2ES2A 4DAMA 3Q24A 4HR7B 4IJHA 3GTKB 3M9BA 4DK0A 2Y0SB 2C35B 3BZKA 4X65L 3F2CA 2KENA 1L2FA 1MI2A 3J81j 2KA7A 1VQ8A 5C4ZA 3V96A 4F7XA 4A3LH 2ENBA 1UAPA 2F0JA 2NVXB 1JICA 2F0FA 2RF4A 4PZ7A 3S14B 1HA6A 1STHA 3KJPA 3I73A 3S1RB 4JV5Q 1CKMA 3I4LA 4NXNQ 4JYAQ 3CHBD 1I4GA 1AN8A 3ZJYC 1E7ZA 4DN4M 5LMNQ 3D6WA 4K0KQ 5D3IB 5ELNA 3U4ZA 4HN7A 1FGBD 3JAML 2IX0A 4GOPB 5IYDH 1WCMH 3CCUA 1I4XA 2KCNA 2O4XA 4KJOA 4BBSB 1IYVA 1JOQA 2EQSA 1EY6A 1I94Q 5K36H 2R93H 4DK6C 3U50C 4HCEA 4FF1A 5IP9H 3V2TA 2PNHA 2KHIA 4IN3A 2JYOA 1JWSD 2A68C 1HZAA 3BVMA 4WJWA 1MGSA 1R4QB 5D3DA 4U673 3HOVB 2AMCB 3CXCA 3CF5A 3N52A 2DY7A 3UDIA 5LMUL 2B2UA 4OHJA 2PQAA 2JEBI 1F9QA 4KMUC 1JCKB 4HTHA 4HJ5A 1PMRA 3L2PA 3S2HB 2CFMA 2MUYA 3RLOA 3X3NA 3S16B 3BDOA 4PMWA 3IRBA 4ID6A 4DV0L 3D8GA 1SNDA 2K33A 5I9OA 1EQVA 5DLQE 1YNXA 1XNQL 2HDMA 2HD3A 1O7YA 2ASBA 3E6ZX 2UXBQ 5BR8Q 3BJUA 5IP9G 2PPBC 1RIPA 2CKZB 1PH1A 1WD0A 4Y7NH 2EYOA 4DAYB 3J7YW 3QB3A 2VW9A 3DEOA 2AUKA 2MJ8A 4KN7C 3BDCA 4NP5A 2WFWA 4DR4Q 1LT3D 1IBML 3DEPA 4UP8A 2NBFA 2DJGC 4HMJA 1YNJC 2NN6H 3F8TA 2D5DA 4RGOS 5IT9L 4GKJL 3IKJA 1EEFD 3GQBA 1AP0A 1V8QA 1CUKA 3PO3B 4YCWA 1NR4A 2R92B 4DK3C 4OO1I 4IUVA 1PTOC 4NXML 2WINB 1VQAA 1B44D 3MVVA 1EYDA 2NVQB 5FO7B 2CCZA 4HCSA 2K1BA 2A19A 2UXDQ 2ZXRA 4GLVB 1VQ7A 1CHPD 2LSSA 2FHTA 3T4AC 2EJGC 2Z9HA 3GV6A 1IBKQ 2PMZB 2JA7B 1QJOA 1DOKA 3TN2A 3A8JE 4P71A 1PH7A 3KLWA 3A8KE 2H4OA 2E2DC 4A4IA 1TWFH 4KJNA 1PH9A 2NN6G 1B3AA 3OTOL 5BN4A 1EL0A 4B3TL 3HFZB 2CVRA 3K0XA 2B2VC 3U9SA 3L9AX 2F0DA 3UDXA 2OF1A 1G2TA 1Y1VH 4KHPQ 5A2QL 4H44C 2BDOA 4DR7L 3GTJH 4NMZA 1VS0A 3GDEA 4ME3A 3CCSA 1Q46A 1CA6A 1L0XB 4IO9A 4ZCKA 4DV1Q 2NVTH 1JOKA 3RZOB 2AUJD 2K50A 3NTHA 3JC66 2L0CA 3HOYB 3GTKH 1U5KA 4ZYSA 2EY2A 3I72A 2PZUA 1OXTA 3D31A 1FNWA 4QQBX 1EY4A 1X3FA 1Y1VG 1EYAA 5GAEC 3OWEB 5BN5A 4A3BG 1TWGH 2NVXH 1VMPA 4K14A 1P16A 3QOLA 1B50A 2EZVA 1CKOA 3PIO3 3S1RH 1B2TA 4YWMA 4KLKA 1EYGA 2L4NA 3FKIB 4EQPA 4CDEC 1VQFA 1FGUA 2WAQB 5CV5A 1G8ZD 1C7YA 1VQIA 5FKAC 3MAQA 4Q0FA 2Y0SG 1QNUA 1JJ2A 1X6OA 5DM73 1BOSA 2V4DA 4JI1L 2LS01 1X3EA 2OEOA 3NQIA 3RNUA 1KTKA 3EFXD 4DV5Q 1ZYRC 1GUGA 4CJ1B 1QUQA 3CCMA 2RBMA 1JR0D 3S2DB 2HIXA 2CQAA 3H3VI 5JJIA 1NSNS 3AFQA 5I2YA 4FVMA 4GN4B 5KNBA 1BUVT 4FF2A 1JJGA 1HRJA 3S2HH 1GUOA 4KN4C 3S16H 3BZCA 4JG2A 3LNNA 3UDGA 3IFDA 2DGYA 1CZWA 5KYIA 4C3JB 2R6GA 4OELB 4JV5L 4BBSG 5M3FB 1CSQA 4JYAL 2BH8A 3OOCA 5LHY1 5DEHA 4UDUC 5CR3A 2D2CC 5LMNL 2I5HA 4K0KL 4EGVA 4O2DA 1S40A 3KF6B 2RCNA 1SYCA 2EDGA 2A74C 2BOSA 4ZKBB 1B7YB 3HOVG 1SMYC 1PTOB 2SDFA 1KRTA 4K5WA 1I94L 1P8LA 5C5MA 5M3MH 1LTBD 4RAUC 2Z4HA 3S24A 2B2WC 2F0MA 1Q12A 1H9SA 5E4WC 1GUNA 3F1ZA 4A3GB 2KOLA 2B2YA 4MNOA 1RD9D 1LT5D 2EYLA 3K8AA 1H9MA 1QOHA 2R92H 4WJ3M 4YCVA 1GHKA 1BCPF 2BCOA 4C3HB 3CC7A 4JBMA 1F9RA 4FO2A 4KI0A 4LJZC 1SYFA 5T1IA 4RG1A 1Y69U 1AE2A 2QEXA 2UXBL 5BR8L 1C0AA 4DNTB 3PIPA 4YY3Q 1Q82C 3NE5B 2JA7H 1PZKD 4DR3Q 2JA6B 2KHJA 4G7ZC 1MKHA 3I90A 2F0NA 3HKZB 4EVOA 1U4PA 4H0LC 5TSSA 4A3DG 4ABNA 1HNZL 3W2DA 3EA6A 1PRTD 3RMHA 3HOXB 2Z6BA 1BVSA 2B8FA 3VA5A 2E2JB 1RCVD 3PO3G 2AKWB 4DR4L 2R92G 1D5ZC 4BS9A 1MBYA 4KKUA 3S1QB 4A3MH 2R7ZB 1AW7A 1DD2A 3J80E 2VUMB 1U0LA 1CFMA 2M00A 4R4CA 2JA7G 5E4XA 3R3OA 3KBGA 4FYDA 1E2VA 5LMNW 2E2IB 1PFMA 1N36Q 2IW3A 3H91A 5IGCA 2R7FA 2UXDL 1TWHB 2N3SA 2RQXA 4OX9Q 1B9NA 1IBKL 2VS1A 3HOYH 1XPOA 1RF2D 1WTHA 4E6IA 4FF3A 4OXPA 5IGGA 1ILPA 1OXVA 2PCFB 1E2WA 3ULPA 1K0SA 2CWPA 4BA2I 1A15A 4MIUA 2EYJA 4WFN3 5AJ3Q 5ISRA 2LFNA 2OQKA 5FLXc 2ZTEA 1LTGD 3T1HQ 1TU2B 3Q23A 5IIFA 1V1QA 1STBA 2KUMA 5ELFA 4B08A 1EU3A 4LF8Q 2PO4A 1GKHA 2K05A 3FPUB 2OXPA 1BF4A 2RA4A 4XYOA 1UEAB 3ITPA 1L1OA 3BVZA 1SYEA 3QOJA 3C3LA 2PYKA 2B3GA 3VR5A 4KHPL 1FL0A 1EYCA 2LXJA 1PYWD 3FKIH 2EJMA 1XJVA 2VL6A 1I4RA 2FMCA 2PNRC 2NWGA 1II3A 1K8MA 4DUYQ 1K8GA 4DAPA 3K58A 1HNWQ 4DV1L 3VR2A 4IUPA 2A1AA 4HAEA 3K59A 1XWEA 5KYLA 5FLXL 1QUQB 1WCMB 2XSCA 1EIFA 2AWOA 3GTPB 3A8IE 1E1OA 3ND9A 4JI4Q 5JEAH 4PNYA 1GM5A 2EPBA 1QVCA 3KDFB 4L5RC 2R93B 2F0GA 3S2DH 4DV6Q 5FJ8H 3VR6A 5EBCA 3D0FA 1LT4D 2KVMA 4F8MA 1FVIA 1EQTA 5E1FA 2F0TA 3J7AV 3FKIG 5JEAJ 3CCVA 2UXCQ 2WAQG 4Q5VA 1AZPA 1ET6A 2AQ2B 2DJFC 3SR1A 4AIMA 2BA0A 4C3JH 4CKBA 2F3WA 3HEJA 3OWFA 1F2YA 5IGBA 5FLMH 3AU7A 3NEMA 1Z6HA 3DUZA 1DZ1A 3H0GH 5CMDA 1KDCA 5C3EH 2Z1CA 1XNRQ 5JEAG 3BYYB 2X69A 1RODA 3MEHA 3CKIB 3IL8A 5FJ8G 1XYIA 1KQSA 1VQJA 1HCZA 3UE0A 1K28A 5G3LF 2KEDA 4C3IH 2NB0A 4DXGA 3PUVA 4BY1H 2UUAQ 1X55A 1Y8NB 3EROA 2OQ0A 3J81c 4DV5L 3BG3A 3MHBA 2F0HA 2AWNA 4C3JG 4A3GH 5M3FG 1D6EC 1JE4A 1U4MA 2F4IA 3LWEA 5IGFA 1M8AA 3F2UA 4IPDA 5IP7H 4LAAA 2RKSA 1GUSA 5M5WB 2F0KA 4APVA 2G9DA 2K5DA 3S1NH 5LL6S 2JQOA 3NPPA 4DA2A 2R7DA 1CKNA 1X9NA 2JA6H 3J81E 2I5LX 2KEEA 2EYHA 2F03A 1PDQA 3CAMA 3HZXA 1JORA 3VYUA 4A3GG 3HOXH 4QIWE 1Q3LA 2FINB 2QILA 3VA7A 2LY7A 2E2JH 2EYMA 1GUTA 1TWFB 1SE4A 2K28A 3CW2C 2EYFA 2CW0D 3PMFA 1PH8A 5EGTA 1TT2A 4C3HG 1E24A 3S1QH 3ER0A 2R7ZH 1YBYA 3NWTA 5KEEA 4UHVA 1WTXA 2IPKD 1BBUA 5ELCA 2JN4A 2LXKA 2XRQD 4K8IA 2JA6G 1FR3A 2F1MA 1CM9A
chains in the Genus database with same CATH topology
2E2IH 2IHFA 3AQQA 1CUKA 3HKZG 4YCWA 3J7ZC 2B29A 2F52A 2NVYH 1Y1WH 1HNXQ 4DK3C 1L1OC 1EOVA 4LF7Q 4OO1I 3I7FA 1TWHH 1X54A 3HOXG 3I4OA 1VQAA 4NXML 4LUZA 5EAYA 2H5XA 4DR5Q 5E7NA 4ALPA 1SROA 1A0IA 1KHIA 1UE5A 1VQEA 4MTNA 4UP9A 4YY3L 1VQ5A 2CCZA 4DR3L 3GTOH 1V43A 3SGIA 2A19A 4YWKA 2IX1A 2UXDQ 1VQ7A 3K7UC 4GLVB 2LSSA 4DKAC 3DLLA 4A3KH 1TWCH 3CPWA 1VQ4A 4AYBE 1IBKQ 1HNWL 5IWAQ 1SR3A 4P71A 1JB7A 1KD1C 1PH7A 3KLWA 1BBWA 3JAMc 1G291 2YU9H 2PI2A 3MEFA 2CWAA 4YWLA 4A4IA 1YJ9A 1SMXA 1TWFH 2VUMG 4AYBG 1PH9A 2NN6G 4IFDJ 4H02A 1IXRA 3HOUH 3OTOL 4HJ9A 1PFSA 4AQYQ 1EUJA 1X56A 4UPAA 2OTJA 5ELOA 3LGJA 4A3FH 4DUZQ 4L5TA 2FXQA 2Z6KC 1FJGQ 3ERSX 3CQZH 1KAWA 4JI0L 4B3TL 3HFZB 3K0XA 1Y1WG 3F2DA 3U58A 3NBHB 3S15H 5IYCG 1D8LA 3K80C 2BH2A 3TREA 3Q8DA 4BY7H 4A3DH 1IZ6A 2L15A 1XPRA 5C4XG 1O7IA 3BU2A 3UDXA 3M4QA 1IL2A 1MIUA 4DR6Q 4X6AH 1JMCA 1Y1VH 3KJOA 3PUZA 1N9WA 4KHPQ 1PH6A 2NN6I 1B8AA 4IPGA 5C0XJ 3KF8B 1NMGA 4DR7L 3PUWA 3GTJH 1N33Q 4IFDG 3PO3H 1VS0A 3GDEA 4ME3A 1K8AC 3CCSA 1MJEA 1Q46A 1XMQQ 1N36L 4IO9A 4B3MQ 3AFPA 4LNQA 3I4NH 1HJPA 4EX5A 2JA5G 4DV1Q 2MO0A 2NVTH 3ULLA 2JEAI 1AH9A 3PIOA 4JI2L 1M90C 3GTPH 4OX9L 2K5NA 3PF4A 2NVQH 1RL2A 2E5LQ 2K50A 2K75A 1EIYB 2UUCL 3TRZA 4NXMQ 1J5EQ 2UU9L 4PZ6A 4HJ8A 4LUOA 1N32L 5J3BA 3JC66 3J80c 1PHJA 4P73A 4JI5L 5HGQA 4QGUA 5C0XG 3CPFA 4GLXA 1K9MC 3AEVA 4JI8Q 4A3LG 1E22A 3GTKH 1U5KA 1JE5A 1VCIA 1K0RA 4GN3B 1PH4A 5FLMG 1YITA 1OXTA 3D31A 5GQOA 2K4KA 4GNXB 4JCVE 2MNAA 1YHBA 4JI6Q 4OWWB 3H3VH 4QQBX 1X3FA 2GN5A 2WB1E 2VUMH 1VQMA 1Y1VG 3H0GG 4LF8L 1G6PA 5C3EG 5GAEC 1Z9FA 4X65Q 1GVPA 5H1SE 3GTLH 5C0XI 1VQCA 4JI7Q 2N78A 4A3BG 3E9HA 5IE8A 1TWGH 2NVXH 2WB1G 3W5OA 1EFWA 3I4NG 1K73C 2DUDA 2HT1A 1P16A 5IYDG 2KBNA 4IPCA 2ID0A 3TS2A 1WCMG 2ZM6L 4LF4L 1CKOA 3HOZG 1KRSA 2GVAA 4R4OA 3S1RH 4LFAL 3M7NA 3I56A 4LFBL 4JI3L 4BY1G 3CD6A 4YWMA 5IT9c 4DNIA 4DUYL 4KLKA 2Y0SE 3L7ZC 3M4PA 1EYGA 2UUBQ 3GTMH 1XMOL 1GO3E 1VQPA 3KYHC 1IBLL 5K36G 1Q1EA 3NENA 2R93G 1Q1BA 4HIMA 2F4VQ 3GTGH 1VQFA 3CCJA 1NMFA 1FGUA 3PV0A 1N32Q 2KCTA 1C7YA 1TXYA 4B3RL 1VQIA 3FP9A 1B70B 1J6QA 2AHOB 4P75A 3RZOH 2Y0SG 4HIKA 1QVGA 1JJ2A 3A0JA 4QJFA 1Y14B 5IP7G 1X6OA 4HJ7A 4JI4L 3B6YA 1E3PA 4JI1L 1X3EA 2Q2HA 2PI2E 3J80i 4DV6L 3RZDH 3RNUA 2HQLA 1CSPA 3PUYA 1AE3A 3TEHB 1LUZA 2B63H 2UUCQ 3M3YH 2IHEA 4DV5Q 1HR0L 1HZ9A 1QUQA 3AYHB 2N8NA 3CCMA 2HHHL 3KFUA 4JBWA 4LF5Q 3CMEA 4POGA 2HIXA 1MJCA 1KXLA 4A3EG 5M5WH 3H3VI 1Q7YC 2UXCL 5JJIA 3AFQA 5IYBH 3A74A 4GN4B 3H15A 3MXNB 4DR2L 4LF6Q 4HIDA 1JJGA 4DV4Q 4GLAC 4EQ5A 3S2HH 4A93H 2I5MX 3ICEA 2BA1A 3S16H 5LMUQ 3BZCA 4JG2A 3UE1A 4DR1L 4L5QA 2ATWA 3CC4A 3UDGA 1TWAH 2DGYA 4IPHA 1OXXK 2R6GA 4JV5L 2EIFA 4A3CH 4LFCQ 4BBSG 3FHWA 1CSQA 4DV0Q 1XNRL 4JYAL 2BH8A 2JK8A 4R4TA 1OTCA 1JJCB 5JJLA 2ZM6Q 4J15A 2D0OA 1K83H 5LMNL 2E8GA 2I5HA 3T1YL 2OWOA 4BXXH 1XNQQ 4O2DA 1S40A 4K0KL 1E1TA 3KF6B 2RCNA 3PGZA 4X62L 1XMOQ 1NJIC 1QZHA 4LF9L 2R7ZG 3J7A5 1B7YB 1NY4A 1XPUA 1EQQA 2UUAL 2A8VA 1L1OB 3HOVG 2E2HH 3M85A 4DV3L 1Q8KA 1KRTA 1I94L 5IYBG 1P8LA 2YYZA 2OTLA 1WOCA 5M3MH 1YJNA 4GKKQ 4WJ4A 4GOPA 1ASYA 2JJQA 3S24A 1LYLA 1PYSB 1OXUA 1Q12A 1PV4A 1IYJB 1A8VA 2K5HA 1YI2A 3F1ZA 4DV2Q 4A3CG 1NBWA 2HHHQ 4MNOA 4NPSA 1IBMQ 4MZ9A 3PUXA 3I2ZA 3CC2A 4A3KG 1V9PA 3K8AA 2R92H 4WJ3M 2VQEL 4YHHL 4GKJQ 4BXXG 1I6HH 4YCVA 4GOPC 3CMAA 4L5SA 3CC7A 4JBMA 1PH3A 1NE3A 5M3FH 4KI0A 3I4MH 2D0PA 1HZCA 2Q2IA 4HIOA 1S3OA 3HOUG 4RG1A 1XTDA 1AE2A 1SN8A 2QEXA 5BR8L 2UXBL 3PIPA 1Q82C 4YY3Q 4A3FG 2JA7H 1C0AA 4DR3Q 2KHJA 1YIJA 1PH5A 2VQFL 3EBEA 1MKHA 5AJ3L 5M5YH 5GROA 2QA4A 2OCEA 3ULJA 4X66L 1LTLA 3GO5A 2K14A 3T1HL 1HR0W 4BY7G 4A3DG 3T1YQ 4HJAA 1HNZL 2RHQB 5C44H 3PSIA 1KC8C 5JJKA 1PA6A 1S72A 4X64L 1BVSA 2K5VA 3TQYA 2YTXA 4Y52H 3W1BA 1R9TH 3PO3G 2AKWB 4C2MH 4DV3Q 4A3JH 2R92G 4PZ8A 4DR4L 3OTOQ 4UY8C 4B3SL 1N34L 4OONA 1W2BA 1X3GA 1Z47A 2PMZE 4DV7L 4JI0Q 4B3TQ 2YV5A 4A3MH 1SLJA 1I3QH 1UE6A 4IJLA 3I4MG 1A63A 1QZGA 4LWCA 1YZ6A 1U0LA 2ZTDA 4JBKA 4R4CA 2JA7G 3TS0A 1HNXL 2JA8H 3PO2H 4LF7L 2D62A 4C3HH 5LMNW 4DR7Q 1WI5A 3RN5A 4DR5L 5GADC 3WWVA 1N36Q 2ZJQA 2R7FA 4A76A 2UXDL 3RLNA 2N3SA 5IY0A 5C44G 2I0QA 4JI2Q 3HOWH 4OX9Q 3OW2A 3K7AH 1IBKL 1BKBA 2JE6I 2VS1A 2WP8J 4UP7A 2ALYB 3STBC 2Z0SA 5IWAL 3CCEA 3HOYH 5C4JH 1XPOA 4A3JG 2UU9Q 5GAHC 2MO1A 4OXPA 1PYBA 2PQAB 3K81C 1OXVA 4OWTB 3ULPA 1SFOH 4JI5Q 5GAGC 2VNUD 2CWPA 4PG3A 1VQ9A 5AJ3Q 4BA2I 2YTVA 4JOIA 2OQKA 5FLXc 2ZTEA 4IFDI 4AQYL 1D7QA 3T1HQ 1YHQA 4NB3A 1GD7A 2RHSB 4DUZL 4IOCA 1UWVA 1CKNB 1HNZQ 1V1QA 2ZJRA 3KF6A 2HIVA 4LF8Q 3J81i 2JA8G 1GKHA 3PO2G 5HY6A 4RMFA 1DGSA 3OYYA 2QGQA 1HZBA 3RLFA 1L1OA 1WFQA 1VQNA 4LUVA 4DR6L 1SRUA 2B3GA 3STBD 4KHPL 4NXNL 1FL0A 2LXJA 2IY5B 4B3SQ 1K3RA 4BA1I 1N33L 1VQGA 3FKIH 4JOIC 4LF4Q 1QVFA 3G4SA 4JC0A 2VL6A 1XJVA 3UDFA 4LFAQ 1XMQL 3GTQH 3HOWG 4LFBQ 1WYDA 3DM3A 4B3ML 4JI3Q 4DUYQ 1Q86C 1K8GA 2B63G 1HNWQ 4DV1L 2F3IA 1I50H 2GVBA 1IBLQ 2VZAA 4QL5A 4XIGS 5IYCH 2A1AA 1VQLA 2E5LL 4B3RQ 4GS3A 3NELA 1KL9A 4TVAB 5C4XH 1QUQB 1J5EL 1EIFA 2AWOA 4BBRH 1E1OA 3GD7A 1YJWA 4JI8L 3CCRA 1PH2A 1VQKA 4JI4Q 3S17H 1GM5A 4A93G 1QVCA 3KDFB 4JI1Q 1OXSC 2ES2A 2Z6KA 1W3SA 4L5RC 1UE1A 4DAMA 2NZOA 4JI6L 3S2DH 4DV6Q 3L0OA 5FJ8H 4IJHA 2WAQE 2JA5H 1EQRA 3D0FA 3M9BA 1HR0Q 3BZKA 2C35B 1FVIA 4A75A 4X65L 3PF5A 1M1KC 3FKIG 5JEAJ 3F2CA 2KENA 1L2FA 4XTCS 2XTIA 3CCVA 4JI7L 2UXCQ 2JA9A 3J81j 2WAQG 3G71A 4AIMA 2ZJPA 1VQ8A 4GNXA 4A3LH 4DR2Q 2YTYA 1EWIA 2BA0A 3I55A 4C3JH 5M5XH 4TQUS 2RF4A 4DR1Q 4PZ7A 5FLMH 4R1JA 2UUBL 4KHZA 3NEMA 4R4IA 2XGTA 4BBRG 3KJPA 1G51A 2F4VL 4JV5Q 1CKMA 5M3MG 3H0GH 2Q2TA 2Q2UA 4DPGA 1T9HA 1C9OA 3CP0A 5C3EH 4NXNQ 1XNRQ 4JYAQ 5JEAG 4IOAA 2CQOA 3E9IA 1YVCA 3ZJYC 1E7ZA 1VQHA 4GNXC 4A3BH 5LMNQ 3RR5A 5FJ8G 1VQDA 1KQSA 4K0KQ 1VQJA 5ELNA 4OWXB 3U4ZA 3UE0A 4X62Q 4GOPB 2IX0A 5IYDH 1JT8A 1WCMH 4LF9Q 3CCUA 3HOZH 4C3IH 4A3IH 1N8RC 3PUVA 3A5ZB 4LW1A 2UUAQ 4BY1H 2EQSA 1X55A 1LM0A 2IT1A 4YCUA 3M4OH 2OQ0A 3J81c 4DV5L 1I94Q 3G6EA 4JBJA 2R93H 1VQOA 3EN2A 4DK6C 3U50C 2AWNA 1I5FA 5IP9H 4LF5L 2PNHA 2KHIA 2VY3A 3F2BA 2MFIA 4A3GH 2V1CC 4P74A 1HZAA 5M3FG 3JAMi 1HH2P 3EIVA 1PVOA 4IPDA 4AH6A 5IP7H 4LF6L 2K52A 4DV4L 2AMCB 2N49A 1ASZA 3CXCA 3CF5A 3RN2A 3VDYA 3UDIA 5LMUL 4APVA 2NZHA 2PQAA 2JEBI 3S1NH 4HJ5A 3L2PA 2CFMA 3RLOA 1A62A 3G48A 4LFCL 2JQOA 4YHHQ 2VQEQ 1UEBA 4PMWA 3IRBA 4R4QA 4DV0L 3S14H 3CCQA 2R7DA 1CKNA 1X9NA 4A3IG 4A3EH 2JA6H 4GN5A 5DLQE 1YNXA 3PCOB 1XNQL 2I5LX 2ASBA 3U4VA 3CAMA 2EXDA 2UXBQ 5BR8Q 3BJUA 5IP9G 1RIPA 2CKZB 2ZTCA 1PH1A 2VQFQ 1Q81C 4Y7NH 4A3GG 3HOXH 4QIWE 4DAYB 4X66Q 4A3MG 1X65A 2E2JH 4BBSH 1L0WA 2VW9A 3HKSA 1SE8A 3CW2C 4FDBA 1FJGL 1WJJA 1YEZA 4GKKL 4POFA 1UE7A 4X64Q 1PH8A 1H95A 4P72A 3CCLA 3KOJA 2KCMA 2MQHA 1E24A 1KIXA 2WFWA 4DV2L 3S1QH 4DR4Q 4OO1G 3ER0A 3A5UA 2R7ZH 3HKZE 1YBYA 3W1GA 4QY7A 1N34Q 1YHAA 1VQBA 1IBML 1VQ6A 1BBUA 1NTGA 4DV7Q 3HOVH 2LXKA 3F8TA 2JA6G 3KDFA 3E0EA 3HOYG 4GKJL 4UP8A 4O0AA 3S1MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I H;  2IHF A;  3AQQ A;  1CUK A;  3HKZ G;  4YCW A;  3J7Z C;  2B29 A;  2F52 A;  2NVY H;  1Y1W H;  1HNX Q;  4DK3 C;  1L1O C;  1EOV A;  4LF7 Q;  4OO1 I;  3I7F A;  1TWH H;  1X54 A;  3HOX G;  3I4O A;  1VQA A;  4NXM L;  4LUZ A;  5EAY A;  2H5X A;  4DR5 Q;  5E7N A;  4ALP A;  1SRO A;  1A0I A;  1KHI A;  1UE5 A;  1VQE A;  4MTN A;  4UP9 A;  4YY3 L;  1VQ5 A;  2CCZ A;  4DR3 L;  3GTO H;  1V43 A;  3SGI A;  2A19 A;  4YWK A;  2IX1 A;  2UXD Q;  1VQ7 A;  3K7U C;  4GLV B;  2LSS A;  4DKA C;  3DLL A;  4A3K H;  1TWC H;  3CPW A;  1VQ4 A;  4AYB E;  1IBK Q;  1HNW L;  5IWA Q;  1SR3 A;  4P71 A;  1JB7 A;  1KD1 C;  1PH7 A;  3KLW A;  1BBW A;  3JAM c;  1G29 1;  2YU9 H;  2PI2 A;  3MEF A;  2CWA A;  4YWL A;  4A4I A;  1YJ9 A;  1SMX A;  1TWF H;  2VUM G;  4AYB G;  1PH9 A;  2NN6 G;  4IFD J;  4H02 A;  1IXR A;  3HOU H;  3OTO L;  4HJ9 A;  1PFS A;  4AQY Q;  1EUJ A;  1X56 A;  4UPA A;  2OTJ A;  5ELO A;  3LGJ A;  4A3F H;  4DUZ Q;  4L5T A;  2FXQ A;  2Z6K C;  1FJG Q;  3ERS X;  3CQZ H;  1KAW A;  4JI0 L;  4B3T L;  3HFZ B;  3K0X A;  1Y1W G;  3F2D A;  3U58 A;  3NBH B;  3S15 H;  5IYC G;  1D8L A;  3K80 C;  2BH2 A;  3TRE A;  3Q8D A;  4BY7 H;  4A3D H;  1IZ6 A;  2L15 A;  1XPR A;  5C4X G;  1O7I A;  3BU2 A;  3UDX A;  3M4Q A;  1IL2 A;  1MIU A;  4DR6 Q;  4X6A H;  1JMC A;  1Y1V H;  3KJO A;  3PUZ A;  1N9W A;  4KHP Q;  1PH6 A;  2NN6 I;  1B8A A;  4IPG A;  5C0X J;  3KF8 B;  1NMG A;  4DR7 L;  3PUW A;  3GTJ H;  1N33 Q;  4IFD G;  3PO3 H;  1VS0 A;  3GDE A;  4ME3 A;  1K8A C;  3CCS A;  1MJE A;  1Q46 A;  1XMQ Q;  1N36 L;  4IO9 A;  4B3M Q;  3AFP A;  4LNQ A;  3I4N H;  1HJP A;  4EX5 A;  2JA5 G;  4DV1 Q;  2MO0 A;  2NVT H;  3ULL A;  2JEA I;  1AH9 A;  3PIO A;  4JI2 L;  1M90 C;  3GTP H;  4OX9 L;  2K5N A;  3PF4 A;  2NVQ H;  1RL2 A;  2E5L Q;  2K50 A;  2K75 A;  1EIY B;  2UUC L;  3TRZ A;  4NXM Q;  1J5E Q;  2UU9 L;  4PZ6 A;  4HJ8 A;  4LUO A;  1N32 L;  5J3B A;  3JC6 6;  3J80 c;  1PHJ A;  4P73 A;  4JI5 L;  5HGQ A;  4QGU A;  5C0X G;  3CPF A;  4GLX A;  1K9M C;  3AEV A;  4JI8 Q;  4A3L G;  1E22 A;  3GTK H;  1U5K A;  1JE5 A;  1VCI A;  1K0R A;  4GN3 B;  1PH4 A;  5FLM G;  1YIT A;  1OXT A;  3D31 A;  5GQO A;  2K4K A;  4GNX B;  4JCV E;  2MNA A;  1YHB A;  4JI6 Q;  4OWW B;  3H3V H;  4QQB X;  1X3F A;  2GN5 A;  2WB1 E;  2VUM H;  1VQM A;  1Y1V G;  3H0G G;  4LF8 L;  1G6P A;  5C3E G;  5GAE C;  1Z9F A;  4X65 Q;  1GVP A;  5H1S E;  3GTL H;  5C0X I;  1VQC A;  4JI7 Q;  2N78 A;  4A3B G;  3E9H A;  5IE8 A;  1TWG H;  2NVX H;  2WB1 G;  3W5O A;  1EFW A;  3I4N G;  1K73 C;  2DUD A;  2HT1 A;  1P16 A;  5IYD G;  2KBN A;  4IPC A;  2ID0 A;  3TS2 A;  1WCM G;  2ZM6 L;  4LF4 L;  1CKO A;  3HOZ G;  1KRS A;  2GVA A;  4R4O A;  3S1R H;  4LFA L;  3M7N A;  3I56 A;  4LFB L;  4JI3 L;  4BY1 G;  3CD6 A;  4YWM A;  5IT9 c;  4DNI A;  4DUY L;  4KLK A;  2Y0S E;  3L7Z C;  3M4P A;  1EYG A;  2UUB Q;  3GTM H;  1XMO L;  1GO3 E;  1VQP A;  3KYH C;  1IBL L;  5K36 G;  1Q1E A;  3NEN A;  2R93 G;  1Q1B A;  4HIM A;  2F4V Q;  3GTG H;  1VQF A;  3CCJ A;  1NMF A;  1FGU A;  3PV0 A;  1N32 Q;  2KCT A;  1C7Y A;  1TXY A;  4B3R L;  1VQI A;  3FP9 A;  1B70 B;  1J6Q A;  2AHO B;  4P75 A;  3RZO H;  2Y0S G;  4HIK A;  1QVG A;  1JJ2 A;  3A0J A;  4QJF A;  1Y14 B;  5IP7 G;  1X6O A;  4HJ7 A;  4JI4 L;  3B6Y A;  1E3P A;  4JI1 L;  1X3E A;  2Q2H A;  2PI2 E;  3J80 i;  4DV6 L;  3RZD H;  3RNU A;  2HQL A;  1CSP A;  3PUY A;  1AE3 A;  3TEH B;  1LUZ A;  2B63 H;  2UUC Q;  3M3Y H;  2IHE A;  4DV5 Q;  1HR0 L;  1HZ9 A;  1QUQ A;  3AYH B;  2N8N A;  3CCM A;  2HHH L;  3KFU A;  4JBW A;  4LF5 Q;  3CME A;  4POG A;  2HIX A;  1MJC A;  1KXL A;  4A3E G;  5M5W H;  3H3V I;  1Q7Y C;  2UXC L;  5JJI A;  3AFQ A;  5IYB H;  3A74 A;  4GN4 B;  3H15 A;  3MXN B;  4DR2 L;  4LF6 Q;  4HID A;  1JJG A;  4DV4 Q;  4GLA C;  4EQ5 A;  3S2H H;  4A93 H;  2I5M X;  3ICE A;  2BA1 A;  3S16 H;  5LMU Q;  3BZC A;  4JG2 A;  3UE1 A;  4DR1 L;  4L5Q A;  2ATW A;  3CC4 A;  3UDG A;  1TWA H;  2DGY A;  4IPH A;  1OXX K;  2R6G A;  4JV5 L;  2EIF A;  4A3C H;  4LFC Q;  4BBS G;  3FHW A;  1CSQ A;  4DV0 Q;  1XNR L;  4JYA L;  2BH8 A;  2JK8 A;  4R4T A;  1OTC A;  1JJC B;  5JJL A;  2ZM6 Q;  4J15 A;  2D0O A;  1K83 H;  5LMN L;  2E8G A;  2I5H A;  3T1Y L;  2OWO A;  4BXX H;  1XNQ Q;  4O2D A;  1S40 A;  4K0K L;  1E1T A;  3KF6 B;  2RCN A;  3PGZ A;  4X62 L;  1XMO Q;  1NJI C;  1QZH A;  4LF9 L;  2R7Z G;  3J7A 5;  1B7Y B;  1NY4 A;  1XPU A;  1EQQ A;  2UUA L;  2A8V A;  1L1O B;  3HOV G;  2E2H H;  3M85 A;  4DV3 L;  1Q8K A;  1KRT A;  1I94 L;  5IYB G;  1P8L A;  2YYZ A;  2OTL A;  1WOC A;  5M3M H;  1YJN A;  4GKK Q;  4WJ4 A;  4GOP A;  1ASY A;  2JJQ A;  3S24 A;  1LYL A;  1PYS B;  1OXU A;  1Q12 A;  1PV4 A;  1IYJ B;  1A8V A;  2K5H A;  1YI2 A;  3F1Z A;  4DV2 Q;  4A3C G;  1NBW A;  2HHH Q;  4MNO A;  4NPS A;  1IBM Q;  4MZ9 A;  3PUX A;  3I2Z A;  3CC2 A;  4A3K G;  1V9P A;  3K8A A;  2R92 H;  4WJ3 M;  2VQE L;  4YHH L;  4GKJ Q;  4BXX G;  1I6H H;  4YCV A;  4GOP C;  3CMA A;  4L5S A;  3CC7 A;  4JBM A;  1PH3 A;  1NE3 A;  5M3F H;  4KI0 A;  3I4M H;  2D0P A;  1HZC A;  2Q2I A;  4HIO A;  1S3O A;  3HOU G;  4RG1 A;  1XTD A;  1AE2 A;  1SN8 A;  2QEX A;  5BR8 L;  2UXB L;  3PIP A;  1Q82 C;  4YY3 Q;  4A3F G;  2JA7 H;  1C0A A;  4DR3 Q;  2KHJ A;  1YIJ A;  1PH5 A;  2VQF L;  3EBE A;  1MKH A;  5AJ3 L;  5M5Y H;  5GRO A;  2QA4 A;  2OCE A;  3ULJ A;  4X66 L;  1LTL A;  3GO5 A;  2K14 A;  3T1H L;  1HR0 W;  4BY7 G;  4A3D G;  3T1Y Q;  4HJA A;  1HNZ L;  2RHQ B;  5C44 H;  3PSI A;  1KC8 C;  5JJK A;  1PA6 A;  1S72 A;  4X64 L;  1BVS A;  2K5V A;  3TQY A;  2YTX A;  4Y52 H;  3W1B A;  1R9T H;  3PO3 G;  2AKW B;  4C2M H;  4DV3 Q;  4A3J H;  2R92 G;  4PZ8 A;  4DR4 L;  3OTO Q;  4UY8 C;  4B3S L;  1N34 L;  4OON A;  1W2B A;  1X3G A;  1Z47 A;  2PMZ E;  4DV7 L;  4JI0 Q;  4B3T Q;  2YV5 A;  4A3M H;  1SLJ A;  1I3Q H;  1UE6 A;  4IJL A;  3I4M G;  1A63 A;  1QZG A;  4LWC A;  1YZ6 A;  1U0L A;  2ZTD A;  4JBK A;  4R4C A;  2JA7 G;  3TS0 A;  1HNX L;  2JA8 H;  3PO2 H;  4LF7 L;  2D62 A;  4C3H H;  5LMN W;  4DR7 Q;  1WI5 A;  3RN5 A;  4DR5 L;  5GAD C;  3WWV A;  1N36 Q;  2ZJQ A;  2R7F A;  4A76 A;  2UXD L;  3RLN A;  2N3S A;  5IY0 A;  5C44 G;  2I0Q A;  4JI2 Q;  3HOW H;  4OX9 Q;  3OW2 A;  3K7A H;  1IBK L;  1BKB A;  2JE6 I;  2VS1 A;  2WP8 J;  4UP7 A;  2ALY B;  3STB C;  2Z0S A;  5IWA L;  3CCE A;  3HOY H;  5C4J H;  1XPO A;  4A3J G;  2UU9 Q;  5GAH C;  2MO1 A;  4OXP A;  1PYB A;  2PQA B;  3K81 C;  1OXV A;  4OWT B;  3ULP A;  1SFO H;  4JI5 Q;  5GAG C;  2VNU D;  2CWP A;  4PG3 A;  1VQ9 A;  5AJ3 Q;  4BA2 I;  2YTV A;  4JOI A;  2OQK A;  5FLX c;  2ZTE A;  4IFD I;  4AQY L;  1D7Q A;  3T1H Q;  1YHQ A;  4NB3 A;  1GD7 A;  2RHS B;  4DUZ L;  4IOC A;  1UWV A;  1CKN B;  1HNZ Q;  1V1Q A;  2ZJR A;  3KF6 A;  2HIV A;  4LF8 Q;  3J81 i;  2JA8 G;  1GKH A;  3PO2 G;  5HY6 A;  4RMF A;  1DGS A;  3OYY A;  2QGQ A;  1HZB A;  3RLF A;  1L1O A;  1WFQ A;  1VQN A;  4LUV A;  4DR6 L;  1SRU A;  2B3G A;  3STB D;  4KHP L;  4NXN L;  1FL0 A;  2LXJ A;  2IY5 B;  4B3S Q;  1K3R A;  4BA1 I;  1N33 L;  1VQG A;  3FKI H;  4JOI C;  4LF4 Q;  1QVF A;  3G4S A;  4JC0 A;  2VL6 A;  1XJV A;  3UDF A;  4LFA Q;  1XMQ L;  3GTQ H;  3HOW G;  4LFB Q;  1WYD A;  3DM3 A;  4B3M L;  4JI3 Q;  4DUY Q;  1Q86 C;  1K8G A;  2B63 G;  1HNW Q;  4DV1 L;  2F3I A;  1I50 H;  2GVB A;  1IBL Q;  2VZA A;  4QL5 A;  4XIG S;  5IYC H;  2A1A A;  1VQL A;  2E5L L;  4B3R Q;  4GS3 A;  3NEL A;  1KL9 A;  4TVA B;  5C4X H;  1QUQ B;  1J5E L;  1EIF A;  2AWO A;  4BBR H;  1E1O A;  3GD7 A;  1YJW A;  4JI8 L;  3CCR A;  1PH2 A;  1VQK A;  4JI4 Q;  3S17 H;  1GM5 A;  4A93 G;  1QVC A;  3KDF B;  4JI1 Q;  1OXS C;  2ES2 A;  2Z6K A;  1W3S A;  4L5R C;  1UE1 A;  4DAM A;  2NZO A;  4JI6 L;  3S2D H;  4DV6 Q;  3L0O A;  5FJ8 H;  4IJH A;  2WAQ E;  2JA5 H;  1EQR A;  3D0F A;  3M9B A;  1HR0 Q;  3BZK A;  2C35 B;  1FVI A;  4A75 A;  4X65 L;  3PF5 A;  1M1K C;  3FKI G;  5JEA J;  3F2C A;  2KEN A;  1L2F A;  4XTC S;  2XTI A;  3CCV A;  4JI7 L;  2UXC Q;  2JA9 A;  3J81 j;  2WAQ G;  3G71 A;  4AIM A;  2ZJP A;  1VQ8 A;  4GNX A;  4A3L H;  4DR2 Q;  2YTY A;  1EWI A;  2BA0 A;  3I55 A;  4C3J H;  5M5X H;  4TQU S;  2RF4 A;  4DR1 Q;  4PZ7 A;  5FLM H;  4R1J A;  2UUB L;  4KHZ A;  3NEM A;  4R4I A;  2XGT A;  4BBR G;  3KJP A;  1G51 A;  2F4V L;  4JV5 Q;  1CKM A;  5M3M G;  3H0G H;  2Q2T A;  2Q2U A;  4DPG A;  1T9H A;  1C9O A;  3CP0 A;  5C3E H;  4NXN Q;  1XNR Q;  4JYA Q;  5JEA G;  4IOA A;  2CQO A;  3E9I A;  1YVC A;  3ZJY C;  1E7Z A;  1VQH A;  4GNX C;  4A3B H;  5LMN Q;  3RR5 A;  5FJ8 G;  1VQD A;  1KQS A;  4K0K Q;  1VQJ A;  5ELN A;  4OWX B;  3U4Z A;  3UE0 A;  4X62 Q;  4GOP B;  2IX0 A;  5IYD H;  1JT8 A;  1WCM H;  4LF9 Q;  3CCU A;  3HOZ H;  4C3I H;  4A3I H;  1N8R C;  3PUV A;  3A5Z B;  4LW1 A;  2UUA Q;  4BY1 H;  2EQS A;  1X55 A;  1LM0 A;  2IT1 A;  4YCU A;  3M4O H;  2OQ0 A;  3J81 c;  4DV5 L;  1I94 Q;  3G6E A;  4JBJ A;  2R93 H;  1VQO A;  3EN2 A;  4DK6 C;  3U50 C;  2AWN A;  1I5F A;  5IP9 H;  4LF5 L;  2PNH A;  2KHI A;  2VY3 A;  3F2B A;  2MFI A;  4A3G H;  2V1C C;  4P74 A;  1HZA A;  5M3F G;  3JAM i;  1HH2 P;  3EIV A;  1PVO A;  4IPD A;  4AH6 A;  5IP7 H;  4LF6 L;  2K52 A;  4DV4 L;  2AMC B;  2N49 A;  1ASZ A;  3CXC A;  3CF5 A;  3RN2 A;  3VDY A;  3UDI A;  5LMU L;  4APV A;  2NZH A;  2PQA A;  2JEB I;  3S1N H;  4HJ5 A;  3L2P A;  2CFM A;  3RLO A;  1A62 A;  3G48 A;  4LFC L;  2JQO A;  4YHH Q;  2VQE Q;  1UEB A;  4PMW A;  3IRB A;  4R4Q A;  4DV0 L;  3S14 H;  3CCQ A;  2R7D A;  1CKN A;  1X9N A;  4A3I G;  4A3E H;  2JA6 H;  4GN5 A;  5DLQ E;  1YNX A;  3PCO B;  1XNQ L;  2I5L X;  2ASB A;  3U4V A;  3CAM A;  2EXD A;  2UXB Q;  5BR8 Q;  3BJU A;  5IP9 G;  1RIP A;  2CKZ B;  2ZTC A;  1PH1 A;  2VQF Q;  1Q81 C;  4Y7N H;  4A3G G;  3HOX H;  4QIW E;  4DAY B;  4X66 Q;  4A3M G;  1X65 A;  2E2J H;  4BBS H;  1L0W A;  2VW9 A;  3HKS A;  1SE8 A;  3CW2 C;  4FDB A;  1FJG L;  1WJJ A;  1YEZ A;  4GKK L;  4POF A;  1UE7 A;  4X64 Q;  1PH8 A;  1H95 A;  4P72 A;  3CCL A;  3KOJ A;  2KCM A;  2MQH A;  1E24 A;  1KIX A;  2WFW A;  4DV2 L;  3S1Q H;  4DR4 Q;  4OO1 G;  3ER0 A;  3A5U A;  2R7Z H;  3HKZ E;  1YBY A;  3W1G A;  4QY7 A;  1N34 Q;  1YHA A;  1VQB A;  1IBM L;  1VQ6 A;  1BBU A;  1NTG A;  4DV7 Q;  3HOV H;  2LXK A;  3F8T A;  2JA6 G;  3KDF A;  3E0E A;  3HOY G;  4GKJ L;  4UP8 A;  4O0A A;  3S1M H; 
#chains in the Genus database with same CATH topology
 2E2I H;  2IHF A;  3GTJ B;  3HKZ G;  2B29 A;  4NKL A;  3SEB A;  1HNX Q;  2EJF C;  3I7F A;  2F0S A;  1TWH H;  2NVT B;  1QG7 A;  1X54 A;  3HOX G;  4LUZ A;  4DR5 Q;  2H5X A;  4ALP A;  1UE5 A;  1VQE A;  4YY3 L;  3GTO H;  4DR3 L;  1V43 A;  4S3S A;  3SGI A;  5D65 A;  4DXF A;  3T16 A;  2IX1 A;  2SNM A;  4DKA C;  4IFD H;  3FPP A;  1VQ4 A;  4AYB E;  5IWA Q;  2L12 A;  1D5X C;  1JB7 A;  5M5Y B;  1BBW A;  3JAM c;  1G29 1;  4MTK A;  5CGK A;  2CWA A;  3LWU A;  4I7A A;  1YJ9 A;  2VUM G;  1TKW B;  4IFD J;  4H02 A;  1IXR A;  4P2C B;  4HJ9 A;  4AQY Q;  1X56 A;  4UPA A;  5ELO A;  5C0X H;  4A3F H;  4DUZ Q;  4NDX A;  1FJG Q;  2B39 A;  1KAW A;  3CQZ H;  5ELB A;  4A3J B;  3U58 A;  3S15 H;  3L3O C;  1TWG B;  4RKL A;  4BY7 H;  3TRE A;  3WDN A;  3M4Q A;  1MIU A;  1CI3 M;  4IPG A;  5C0X J;  3KF8 B;  1QCB D;  1N33 Q;  4IFD G;  2PW5 A;  5CC4 A;  4K5X A;  2X6L A;  1XMQ Q;  4ZQ3 A;  1LTI D;  1N36 L;  1TII D;  2JA8 B;  3JAM E;  4EX5 A;  2MO0 A;  3W3A A;  1AH9 A;  3PIO A;  1M90 C;  3GTP H;  4OX9 L;  1CQF A;  3PF4 A;  1RL2 A;  1W6J A;  1HA5 A;  1EIY B;  2UUC L;  3K0Y A;  1J5E Q;  4R8I A;  1W6K A;  1IW7 D;  3K7A B;  1PHJ A;  1SE2 A;  5C0X G;  4A3L G;  2G5D A;  5DAU A;  4JI8 Q;  1F9S A;  1VCI A;  1K0R A;  1CK1 A;  3E3X A;  1YIT A;  3DWA A;  2K4K A;  1SFO B;  4JCV E;  1E2Z A;  1RTO A;  2GN5 A;  1VQM A;  4OEM B;  4DGZ A;  4LF8 L;  1G6P A;  3E5S A;  3E9H A;  5IE8 A;  2WB1 G;  4L6T B;  2HT1 A;  5IYD G;  1HFN A;  2KBN A;  4KV6 A;  2ID0 A;  1WTW A;  1WCM G;  2RSN A;  2A69 D;  3I56 A;  1MSH A;  2WAC A;  3CD6 A;  5IT9 c;  4DUY L;  4DNI A;  1HNW L;  2UUB Q;  1XMO L;  1GO3 E;  1VQP A;  2F0E A;  3OHX C;  5K36 G;  5C5L A;  3FDT A;  1Q1B A;  2B2U C;  2R93 G;  4XYQ A;  1NMF A;  3PV0 A;  1TXY A;  1B70 B;  1J6Q A;  4P75 A;  1EIH A;  1QVG A;  1STG A;  4QJF A;  5EKL A;  1Y14 B;  1SNM A;  4HJ7 A;  3A56 A;  4JI4 L;  1E3P A;  5C4X B;  2ICI A;  2Q2H A;  1STA A;  3TME A;  4BBR B;  1I6V C;  5M3M B;  5CV6 A;  4DV6 L;  1SYB A;  3D4R A;  3TEH B;  1HZ9 A;  3K57 A;  2N8N A;  4JBW A;  4LF5 Q;  2SEB D;  1MJC A;  4K6L A;  1K8O A;  2JA5 B;  5IT9 E;  5M5W H;  2UXC L;  4G4K A;  5IYB H;  3A74 A;  2BE5 C;  5EBD A;  4LF6 Q;  1TS5 A;  4DV4 Q;  4GLA C;  4EQ5 A;  1J9O A;  1OXX K;  4ILW A;  1T5E A;  1SNO A;  5M5X B;  3KK7 A;  2A5H A;  4YIJ A;  1XNR L;  4R4T A;  1H9J A;  1OTC A;  2ZM6 Q;  4J15 A;  2RSO A;  1QWY A;  2D0O A;  5FK9 C;  4QMG A;  3NBH A;  2OWO A;  1Z7T A;  1E1T A;  3PGZ A;  1NJI C;  1QZH A;  1EQQ A;  2UUA L;  3H3V C;  2JP1 A;  4JVZ A;  3CU7 A;  1Q8K A;  1DOM A;  2K5W A;  1MD2 D;  4K5V A;  4K6D A;  5DNF A;  5IYB G;  1Q8I A;  2OTL A;  4A3I B;  4V19 0;  1YJN A;  1C48 A;  1EFI D;  4QCL A;  1OXU A;  2K04 A;  1PV4 A;  1A8V A;  5FO9 B;  1YI2 A;  5ELD A;  5A2Q E;  4DV2 Q;  2EY1 A;  1ENA A;  2I07 B;  2M2L A;  4NPS A;  4A3M B;  2HHH Q;  4MZ9 A;  1CT1 D;  4QF4 A;  1SXT A;  2XWB B;  1V9P A;  3QR8 A;  1XTC D;  1PRT C;  3MXP A;  1SSO A;  3TP5 A;  3CMA A;  1BCP C;  1PH3 A;  1H9R A;  5CV4 A;  1HZC A;  2Q2I A;  1S3O A;  5KIX A;  1M4V A;  1X3Q A;  1SN8 A;  3MXG A;  4U68 A;  2MGS A;  4WOR A;  5M5Y H;  5GRO A;  1LV9 A;  2OCE A;  1KNA A;  2K14 A;  3T1Y Q;  5JJZ A;  1V1P A;  4B9X A;  4PQX A;  1PA6 A;  1S72 A;  1BO0 A;  3TQY A;  3OMG A;  2KQ3 A;  2HCI A;  3W1B A;  5KND A;  5I2X A;  4DV3 Q;  4A3J H;  1HUN A;  2K6A A;  4UY8 C;  4OON A;  1Z47 A;  4BWG B;  5JAV A;  4CDF C;  3URY A;  2YV5 A;  1KDA A;  4O42 A;  1SLJ A;  1UE6 A;  1A63 A;  3NQT A;  4RHR A;  2L1B A;  1HNX L;  2JA8 H;  1RDP D;  4J8Q A;  1WI5 A;  1GOZ A;  4DR5 L;  1Y1W B;  4A76 A;  1TY0 A;  1QB5 D;  3MXN A;  1F2Z A;  2ICE C;  3I3C A;  3K7A H;  2WP8 J;  4UP7 A;  5IWA L;  3SE0 A;  3CCE A;  1V1O A;  4A3J G;  2UU9 Q;  3SK5 A;  4CHT B;  1R4P B;  5GAH C;  1TR5 A;  2PQA B;  1SFO H;  4CDD C;  1PZJ D;  3E0J A;  3SK6 A;  2YTV A;  1SNC A;  1SNP A;  4AQY L;  2J7Z A;  5F2D A;  1EY7 A;  1CTM A;  4DUZ L;  1UWV A;  2L11 A;  3NTI A;  3FVQ A;  3A7L A;  2HIV A;  5J22 A;  2JA8 G;  4TRD A;  1WTO A;  3HOU B;  4X3K A;  4RMF A;  2J4X A;  1HZB A;  1L0Y B;  3A54 A;  3BS1 A;  2B2T A;  4NXN L;  2IY5 B;  4RWS C;  4B3S Q;  1K3R A;  4BA1 I;  3TSS A;  1QE6 A;  1VQG A;  1N33 L;  4LF4 Q;  1S4Z A;  1O78 A;  1SDF A;  1XMQ L;  4LFB Q;  3H0G B;  1XXG A;  5C3E B;  2KJX A;  3MWY W;  2F3I A;  3S9W A;  1GJX A;  2VZA A;  4ZUJ A;  2BE5 D;  2XVS A;  1EIG A;  5IYC H;  1VQL A;  1PTO F;  4QB4 A;  5C4X H;  1J5E L;  4BBR H;  2SOB A;  4C3I B;  3K5N A;  1YJW A;  4BY1 B;  1S5E D;  4JI8 L;  3CCR A;  1PH2 A;  4DNR B;  2Z6K A;  1UE1 A;  3D3R A;  2O5J C;  2NZO A;  3L0O A;  3TZD A;  2JA5 H;  4IAL A;  1A2U A;  3PF5 A;  2KCC A;  1I4P A;  2F0L A;  2XTI A;  3TP8 A;  1DYQ A;  2JA9 A;  3G71 A;  2EOT A;  2ZJP A;  2YTY A;  1EWI A;  4HMI A;  2A6H D;  3SK8 A;  3S1N B;  3GTL B;  4CKC A;  1U4R A;  3NP8 A;  5M5X H;  4TQU S;  4XQQ A;  3NK9 A;  1PLF A;  4R1J A;  2UUB L;  4IZ8 A;  2FMM A;  4KKS A;  2B2Y C;  4BBR G;  2A6E D;  3I8Z A;  5M3M G;  2Q2U A;  1T9H A;  1C9O A;  4KD3 A;  4IOA A;  3OW7 A;  2CQO A;  3BVG A;  3E9I A;  5L37 A;  4C56 C;  4V0B A;  5IGE A;  3TBI B;  3GTG B;  1PRT B;  2NTT A;  3KLS X;  1VQD A;  5NUC A;  1KAA A;  4OWX B;  1BCP B;  3HOZ H;  4A3I H;  1N8R C;  4LW1 A;  1BCP D;  1O80 A;  2IT1 A;  4YCU A;  1HHV A;  3G6E A;  1F2L A;  4JBJ A;  2BDN A;  1VQO A;  3EN2 A;  4LF5 L;  3F2B A;  1U4L A;  2V1C C;  3M3Y B;  4P74 A;  3EIV A;  2WKC A;  2MPM A;  1ENF A;  5CV9 A;  4LF6 L;  4RCN A;  4DV4 L;  5AFW A;  5C3X A;  1ASZ A;  1S5C D;  3K5O A;  2C9O A;  4XT3 B;  1YNN D;  2NZH A;  2ZT9 C;  2F3V A;  2N55 A;  1A62 A;  1FYC A;  3G48 A;  4KD4 A;  2QDB A;  2VQE Q;  4OO1 H;  2CW0 C;  1UEB A;  3CCQ A;  4MHE A;  4A3I G;  4A3E H;  3A7A B;  2NUC A;  4GN5 A;  3DM1 A;  3GTO B;  2H1E A;  3HRZ C;  3U4V A;  5CBE E;  3IAY A;  2ZTC A;  5T1G A;  3EVQ A;  1Q81 C;  4X66 Q;  4A3M G;  1X65 A;  1S5D D;  1DCZ A;  1C4Q A;  5J39 A;  3HKS A;  4FDB A;  2E2H B;  1WJJ A;  4KY7 A;  1UE7 A;  4X64 Q;  1Q90 A;  3CCL A;  3WOE A;  4A3F B;  2DNE A;  3CQZ B;  4DV2 L;  2B8G A;  4OO1 G;  3S15 B;  3W1G A;  4QY7 A;  1N34 Q;  1YHA A;  3EJI A;  4BY7 B;  2XNA C;  4DV7 Q;  3E0E A;  3HOY G;  4O0A A;  5D14 A;  1STE A;  1D5M C;  3QIA A;  4ME5 A;  4UAI A;  3SDZ A;  3J7Z C;  1CQV A;  2F52 A;  2NVY H;  2QKI C;  5I4D A;  1Y1W H;  1L1O C;  1EOV A;  2QCP X;  3MC0 B;  4LF7 Q;  2RDG A;  5FLX E;  1I6H B;  1STY A;  1HUM A;  3H09 A;  5E7N A;  1VQ5 A;  1A0I A;  4MTN A;  4UP9 A;  4TKO B;  4YWK A;  3I4M B;  4XDX A;  4CBV A;  3DLL A;  4A3K H;  3AMU A;  1UUP A;  2DN8 A;  3SHL A;  3U9O A;  5M9O A;  4EQN A;  1BBX C;  2YU9 H;  3TDQ A;  4CJ2 C;  1SMX A;  2O5I C;  1ILQ A;  3HOU H;  2OTJ A;  3NUC A;  1GXD C;  1PFS A;  3LGJ A;  1F9P A;  1R9T B;  4L5T A;  5EJW A;  4C2M B;  2Q8I B;  1Y1W G;  3HS0 C;  2G9H D;  3F2D A;  1IW7 C;  2BH2 A;  3Q8D A;  1XPR A;  5K5P A;  1O7I A;  4X6A H;  1IL2 A;  4DR6 Q;  1JMC A;  1N9W A;  3G7L A;  2NN6 I;  1B8A A;  2GA4 B;  1I3Q B;  1NMG A;  3PUW A;  3MTS A;  2QEJ C;  1MJE A;  4B3M Q;  3AFP A;  2HUG A;  3PO2 B;  1HJP A;  3DXJ C;  4OGQ C;  2PW7 A;  2K5N A;  1BQQ T;  4J1M A;  1H9S B;  2SNS A;  1T5X D;  1DJR D;  2E5L Q;  4X3S A;  4KY5 A;  4NXM Q;  2UU9 L;  1BDO A;  3T56 B;  3M7N A;  4QGU A;  5HGQ A;  2A69 C;  2EYP A;  3CPF A;  2K7V A;  4GLX A;  3AEV A;  4LK1 C;  5C4J B;  4GN3 B;  1JE5 A;  1PH4 A;  1ENC A;  3VYT A;  5FLM G;  4FF4 A;  5GQO A;  4JI6 Q;  1YHB A;  3H3V H;  1J8I A;  2AQ1 B;  3H0G G;  5J1Z A;  2WII B;  1Y8O B;  5C3E G;  5I6W A;  1Z9F A;  1GVP A;  1X3P A;  1B9M A;  5G3L D;  2DY8 A;  3GTL H;  1VQC A;  4JI7 Q;  2N78 A;  4M8A A;  4DAY A;  1VF5 C;  3W5O A;  2DUD A;  1STN A;  4IUU A;  3TS2 A;  1EZ6 A;  4LF4 L;  1KRS A;  2GVA A;  4C3I G;  5C6A A;  1ICF B;  4N8X 1;  1LTR D;  4LFB L;  4BY1 G;  2Y0S E;  3L7Z C;  4PMB A;  2K5Q A;  3KYH C;  4NW2 A;  1TVX A;  4HIM A;  2F4V Q;  3GTG H;  1N32 Q;  3QJY A;  1D1I A;  1I50 B;  1NR2 A;  4RCO A;  4HIK A;  3A0J A;  3CRK C;  5IP7 G;  2F0Q A;  2HDL A;  3B6Y A;  4K8J A;  1RKN A;  3J80 i;  3PUY A;  2LKV A;  2B63 H;  1LUZ A;  3S17 B;  3M3Y H;  4ZRZ A;  4XXE A;  4EQO A;  1A6X A;  3KFU A;  3AYH B;  4KY6 A;  2FFK B;  2JSO A;  1LAC A;  1IYU A;  3CME A;  2E76 C;  4KKT A;  3H15 A;  3MFY A;  3UI2 A;  1CA5 A;  3J7A F;  4A93 H;  3ICE A;  2BA1 A;  1EWC A;  3UE1 A;  2N88 A;  2ATW A;  3R2T A;  4LMQ D;  1TWA H;  5KRU A;  4IPH A;  1JOO A;  2EIF A;  2TMP A;  4B9W A;  4LFC Q;  4A3C H;  1RTN A;  2XIW A;  3FHW A;  4R9W A;  3VR4 A;  2XRS D;  2F0I A;  3TP7 A;  2ZXP A;  5JVH 3;  2E8G A;  4BXX H;  1A2T A;  5KGU A;  4J6H A;  1TQO A;  1TS3 A;  1EY0 A;  2R7Z G;  1H9K A;  1MSG A;  2A8V A;  1L1O B;  3X3M A;  2E2H H;  1PFN A;  4M1U B;  1QNK A;  1PFB A;  2EY5 A;  4HSV A;  4WJ4 A;  4GKK Q;  3M4O B;  1ASY A;  2JJQ A;  4I65 A;  1LYL A;  1IYJ B;  1XX8 A;  4QUF A;  2K5H A;  4KTA A;  4A3C G;  1PZI D;  1GHJ A;  1ZEQ X;  4HSP A;  3PUX A;  2MP1 A;  3I2Z A;  2LMC B;  3HG9 A;  1G91 A;  1B3Q A;  2VQE L;  4BXX G;  1I6H H;  4QIW B;  1LTT D;  4L5S A;  3MXU A;  5EKK A;  1NE3 A;  3I4M H;  1JB3 A;  1TS2 A;  1AEX A;  1XTD A;  1C8C A;  1KLG D;  4A3F G;  4G57 A;  2L55 A;  5AJ3 L;  2VB3 X;  2QA4 A;  4X66 L;  1SJH D;  3T1H L;  4BY7 G;  1JQY D;  4FNF A;  4HJA A;  2CHB D;  2RHQ B;  3ND8 A;  1KC8 C;  1WTR A;  5JJK A;  3T13 A;  4X64 L;  2K5V A;  5A35 A;  4Y52 H;  4ODG A;  4CGY B;  5HUR A;  1R9T H;  4FP5 D;  3I91 A;  3D6C A;  3D4W A;  4C2M H;  4F88 A;  1N34 L;  2PMZ E;  4N9P A;  4DV7 L;  4JI0 Q;  1HPC A;  1O7Z A;  5IGD A;  1I3Q H;  3I4M G;  5EKI A;  4LWC A;  3P1H A;  4AYB B;  1YZ6 A;  1JC7 A;  4JBK A;  2E75 C;  3G6J B;  4QUC A;  3PO2 H;  4LF7 L;  1EOT A;  2RDF A;  3S1M B;  3RN5 A;  4GZY C;  3WWV A;  2ZJQ A;  2QF7 A;  2E74 C;  1WTP A;  1A3V A;  3RLN A;  4JI2 Q;  2JE6 I;  5FO8 B;  2ALY B;  2Z0S A;  1EWH A;  5IOD A;  5C4J H;  3K6O A;  1TWC B;  1KLU D;  2MO1 A;  4JI5 Q;  1PYB A;  1KNE A;  3K81 C;  2VNU D;  5GAG C;  2F0U A;  4JOI A;  4XQN A;  2K32 A;  2RHS B;  3T51 B;  1CKN B;  1HNZ Q;  3KF6 A;  4OIJ A;  3NXW A;  5E3F A;  3J81 i;  3PO2 G;  4C1N I;  3OMC A;  3FMC A;  1DGS A;  3OYY A;  2QGQ A;  3RLF A;  3R2I A;  1WFQ A;  2HCC A;  2P5Z X;  4LUV A;  1ONL A;  4KHV A;  4DR6 L;  3STB D;  2HQE A;  5JPN C;  4A3D B;  4JOI C;  4RFB A;  1LTA D;  3GTQ H;  3G4S A;  4JC0 A;  3UDF A;  4LFA Q;  3DM3 A;  1S5F D;  4B3M L;  4JI3 Q;  4G7H C;  1I50 H;  2GVB A;  3H6M A;  1IBL Q;  3ERQ A;  4QL5 A;  2AQ3 B;  2O2L D;  2E5L L;  3I4N B;  4B3R Q;  3NEL A;  3HP3 A;  1VDZ A;  4TVA B;  3KUP A;  2VB2 X;  2A6H C;  3HOZ B;  2F0P A;  1VQK A;  3FRP B;  3S17 H;  1ICW A;  1OXS C;  1W3S A;  2A6E C;  4JI6 L;  5EPK A;  2B2V A;  5KNC A;  3VR3 A;  2WAQ E;  1EQR A;  3C46 A;  1U9R A;  1HR0 Q;  4A75 A;  3Q6S A;  2WKD A;  1M1K C;  4DFA A;  4XTC S;  2Q8T A;  4JI7 L;  1BR9 A;  1A3T A;  1CHQ D;  4GNX A;  1ML0 D;  4DR2 Q;  4ZAI A;  1PXU A;  3I55 A;  4IUT A;  3NWS A;  4DR1 Q;  2D9U A;  2R61 A;  4KHZ A;  4R4I A;  2XGT A;  3EQL C;  1G51 A;  1LAB A;  4A3E B;  2F4V L;  2Q2T A;  1K3B C;  1N32 L;  4DPG A;  3CP0 A;  3GTM B;  1YVC A;  2J0T D;  3NTK A;  1VQH A;  4GNX C;  4A3B H;  2EE1 A;  3RR5 A;  4RA8 A;  3DWP A;  1YNN C;  4RGT A;  4X62 Q;  2EXZ A;  1JT8 A;  4LF9 Q;  1FNU A;  1NAP A;  3WOF A;  3A5Z B;  3H94 A;  1LM0 A;  2CH4 W;  3M4O H;  2DNC A;  2L5T A;  1I5F A;  3FEW X;  4L63 B;  4TSS A;  3RZD B;  2VY3 A;  2MFI A;  4N9T A;  5I6Y A;  3JAM i;  1HH2 P;  1PVO A;  4AH6 A;  3T53 B;  1RJT A;  1IKL A;  2K52 A;  2N49 A;  2F0W A;  3RN2 A;  3VDY A;  2NZ1 D;  2QW7 A;  3SXH A;  3P20 A;  1ZXT A;  1CZG A;  2NVY B;  4LFC L;  4YHH Q;  4R4Q A;  1MHW C;  3S14 H;  3MFG A;  1WTQ A;  1EY9 A;  3PCO B;  1ZKO A;  2A68 D;  1EY8 A;  4A3K B;  2EXD A;  1F77 A;  1K83 B;  4K2K A;  2VQF Q;  2F0O A;  3GP7 A;  4JPB W;  2YU9 B;  3OPO A;  2MHV A;  3QG1 A;  4BBS H;  1L0W A;  1SE8 A;  1FJG L;  1YEZ A;  4GKK L;  4POF A;  4FXK C;  1H95 A;  4P72 A;  4RKB A;  3KOJ A;  2KCM A;  2MQH A;  3V05 A;  2RCF A;  1DOL A;  1VF7 A;  3NBI A;  1KIX A;  1S5B D;  2M9V A;  3A5U A;  3HKZ E;  1VQB A;  1VQ6 A;  1NTG A;  3HOV H;  2RVL A;  2F0V A;  3A55 A;  2PZT A;  3KDF A;  3SK4 A;  3S1M H;  1HXY D;  3AQQ A;  1LLR D;  4H13 C;  4XQJ A;  1VMC A;  3AB9 A;  4OL7 A;  4IUR A;  2B2T C;  1HFG A;  3I4O A;  3OIQ A;  5EAY A;  1SRO A;  1KHI A;  2NYZ D;  5ELE A;  3K7U C;  1IHZ A;  4L8J A;  1TWC H;  2C5C A;  3CPW A;  4IUQ A;  3QO2 A;  2B2W A;  1SR3 A;  1YNJ D;  3M4Y A;  1KD1 C;  1SE3 A;  2PI2 A;  3RUZ A;  3KLR A;  3MEF A;  4YWL A;  4O1N A;  4AYB G;  4MN3 A;  2K03 A;  5CBA E;  5C44 B;  5DM6 3;  2EY6 A;  1EUJ A;  1F2M A;  3K5L A;  1PTO D;  2IJ0 A;  1Y8P B;  2FXQ A;  2Z6K C;  3ERS X;  4JI0 L;  2R3Z A;  3KLS A;  3NBH B;  5IYC G;  1B4O A;  1D8L A;  3K80 C;  4RHS A;  4A3D H;  1IZ6 A;  2L15 A;  2QDL A;  5C4X G;  3BU2 A;  1B1Z A;  1WTV A;  3KJO A;  2L9H A;  3PUZ A;  1PH6 A;  5BN3 A;  2Z8L A;  3PO3 H;  1K8A C;  1PRT F;  4LNQ A;  1SBB B;  1B53 A;  1FNV A;  3DWQ A;  3I4N H;  4ZK9 B;  2JA5 G;  3HGB A;  3ULL A;  2JEA I;  1EZ8 A;  4JI2 L;  5IOC A;  4PV1 C;  3R93 A;  2NVQ H;  3NHH A;  5I9P A;  2K75 A;  5C3W A;  1SNQ A;  3TRZ A;  4PZ6 A;  3BZD B;  4HJ8 A;  3HOW B;  4LUO A;  5J3B A;  3J80 c;  4IFD I;  4P73 A;  1KDB A;  4JI5 L;  1K9M C;  4N8F A;  1E22 A;  1X32 A;  2B63 B;  2A73 B;  4R8N A;  1GUW A;  1O7L A;  2Q8R E;  1EY5 A;  4OWW B;  4GNX B;  4ZKC B;  4KK7 A;  2MNA A;  1HTP A;  2WB1 E;  3VYS A;  1ESF A;  3ONA B;  4IQZ A;  2KEC A;  4X65 Q;  3C1F A;  4X3U A;  5H1S E;  5C0X I;  4A93 B;  3I4N G;  1EFW A;  1K73 C;  5FOB B;  4IPC A;  1TWA B;  2ZM6 L;  2PQE A;  3HOZ G;  4R4O A;  4LFA L;  4JI3 L;  4FXD A;  1V1P B;  1LT6 D;  4ZUI A;  3M4P A;  3GTM H;  1IBL L;  1RHP A;  4C1N K;  1Q1E A;  3NEN A;  3J80 L;  3CCJ A;  1AFP A;  2KCT A;  4B3R L;  1SAP A;  3FP9 A;  2AHO B;  3RZO H;  1DXM A;  3OIP A;  2NTS A;  4F87 A;  3MZ5 A;  1IKM A;  3BYT B;  5EQ0 A;  3KBX A;  1I4H A;  2JXM B;  1D2B A;  1TS4 A;  2PI2 E;  3VYR A;  4PMC A;  3RZD H;  2HQL A;  1CSP A;  1AE3 A;  2VXW A;  2UUC Q;  2IHE A;  1HR0 L;  2HHH L;  3QWN A;  3LX0 A;  4POG A;  1BXT A;  1KXL A;  2K01 A;  4A3E G;  1JWU D;  3RD4 A;  1Q7Y C;  4I7Z C;  3TP6 A;  3DMU A;  3MXN B;  4DR2 L;  4HID A;  2I5M X;  3SVM A;  2ZXO A;  5LMU Q;  4DR1 L;  4L5Q A;  1QIL A;  3N6R A;  3CC4 A;  5JOB A;  1SYG A;  3PQI A;  4DV0 Q;  2JK8 A;  1BNZ A;  1ZYR D;  1JJC B;  5JJL A;  1EEI D;  1HQM C;  5CYU A;  1K83 H;  4FXG C;  3T1Y L;  1SEB D;  1XNQ Q;  3D4D A;  4X62 L;  1XMO Q;  4LF9 L;  4H7B A;  3J7A 5;  1NY4 A;  2IX3 A;  1XPU A;  2WB1 B;  3M85 A;  3KF8 A;  4DV3 L;  1D1K A;  1LTS D;  5CV8 A;  2YYZ A;  1WOC A;  2X6G A;  4JK1 C;  4DF7 A;  3CRL C;  1E0B A;  3BDL A;  3O13 A;  4GOP A;  4XT1 B;  3M7G A;  1PYS B;  1TY2 A;  3R8B A;  1NBW A;  1ESR A;  1IBM Q;  1OO9 B;  4HED A;  3CC2 A;  4A3K G;  4YHH L;  4GKJ Q;  3K5M A;  1SMY D;  2RDH A;  4GOP C;  1ET9 A;  2FJ2 A;  5COY A;  1HQR D;  1SYD A;  5M3F H;  3Q22 A;  2Z4I A;  2D0P A;  4HIO A;  3HOU G;  1DM0 B;  3GV3 A;  1YIJ A;  4JW0 A;  2VQF L;  1PH5 A;  3EBE A;  3TZU A;  4Z9C B;  3ULJ A;  5CV7 A;  1LTL A;  4X3T A;  1NNX A;  3GO5 A;  1NCV A;  1WVL A;  1HR0 W;  3ZYY X;  1A3U A;  1I4Q A;  1PTO H;  4WRD A;  4Y7N B;  5C44 H;  3PSI A;  1LO5 D;  4CDC C;  2YTX A;  2WV6 D;  1FD7 D;  1AZQ A;  4PZ8 A;  3OTO Q;  4B3S L;  5JVG 3;  3P75 A;  1W2B A;  1X3G A;  4CJ0 B;  5LL6 X;  5C4H A;  1EU4 A;  4B3T Q;  3P7J A;  4RH6 A;  5EPL A;  4IJL A;  4K2L A;  1QZG A;  1NUC A;  3GTQ B;  2ZTD A;  3C2P A;  3TS0 A;  4DK1 A;  3PIP 3;  2XWJ B;  2D62 A;  2TSS A;  4C3H H;  1WD1 A;  4DR7 Q;  3NSW A;  5GAD C;  1DON A;  5IY0 A;  2I0Q A;  5C44 G;  4CKE A;  5COR A;  5EPJ A;  2PZW A;  3HOW H;  3OW2 A;  1BKB A;  3STB C;  4OIK A;  1UNS A;  3J81 L;  3C1E A;  1IL8 A;  1HTL D;  4OWT B;  1JWM D;  4PG3 A;  3MA2 B;  1VQ9 A;  1SJE D;  1D7Q A;  2IWH A;  1YHQ A;  4NB3 A;  1GD7 A;  4IOC A;  2ZJR A;  1G6Z A;  2IL8 A;  4ULL A;  4IUN A;  5HY6 A;  1VQN A;  4DAV A;  1SRU A;  2EVB A;  4RGN A;  4RGM A;  1G2S A;  2KHS A;  1QVF A;  2VUM H;  3DHQ A;  3HOW G;  1Y1V B;  1WYD A;  4DU9 A;  1Q86 C;  5JPM C;  2B63 G;  3IFT A;  1KAB A;  4ZLT F;  4G7O C;  2I46 A;  2XN9 C;  4A3B B;  3OSO A;  4XIG S;  3Q0A A;  4GS3 A;  1KL9 A;  3I70 A;  3GD7 A;  2OT2 A;  5HGT A;  4A93 G;  4JI1 Q;  2CH4 A;  2ES2 A;  4DAM A;  3Q24 A;  4HR7 B;  4IJH A;  3GTK B;  3M9B A;  4DK0 A;  2Y0S B;  2C35 B;  3BZK A;  4X65 L;  3F2C A;  2KEN A;  1L2F A;  1MI2 A;  3J81 j;  2KA7 A;  1VQ8 A;  5C4Z A;  3V96 A;  4F7X A;  4A3L H;  2ENB A;  1UAP A;  2F0J A;  2NVX B;  1JIC A;  2F0F A;  2RF4 A;  4PZ7 A;  3S14 B;  1HA6 A;  1STH A;  3KJP A;  3I73 A;  3S1R B;  4JV5 Q;  1CKM A;  3I4L A;  4NXN Q;  4JYA Q;  3CHB D;  1I4G A;  1AN8 A;  3ZJY C;  1E7Z A;  4DN4 M;  5LMN Q;  3D6W A;  4K0K Q;  5D3I B;  5ELN A;  3U4Z A;  4HN7 A;  1FGB D;  3JAM L;  2IX0 A;  4GOP B;  5IYD H;  1WCM H;  3CCU A;  1I4X A;  2KCN A;  2O4X A;  4KJO A;  4BBS B;  1IYV A;  1JOQ A;  2EQS A;  1EY6 A;  1I94 Q;  5K36 H;  2R93 H;  4DK6 C;  3U50 C;  4HCE A;  4FF1 A;  5IP9 H;  3V2T A;  2PNH A;  2KHI A;  4IN3 A;  2JYO A;  1JWS D;  2A68 C;  1HZA A;  3BVM A;  4WJW A;  1MGS A;  1R4Q B;  5D3D A;  4U67 3;  3HOV B;  2AMC B;  3CXC A;  3CF5 A;  3N52 A;  2DY7 A;  3UDI A;  5LMU L;  2B2U A;  4OHJ A;  2PQA A;  2JEB I;  1F9Q A;  4KMU C;  1JCK B;  4HTH A;  4HJ5 A;  1PMR A;  3L2P A;  3S2H B;  2CFM A;  2MUY A;  3RLO A;  3X3N A;  3S16 B;  3BDO A;  4PMW A;  3IRB A;  4ID6 A;  4DV0 L;  3D8G A;  1SND A;  2K33 A;  5I9O A;  1EQV A;  5DLQ E;  1YNX A;  1XNQ L;  2HDM A;  2HD3 A;  1O7Y A;  2ASB A;  3E6Z X;  2UXB Q;  5BR8 Q;  3BJU A;  5IP9 G;  2PPB C;  1RIP A;  2CKZ B;  1PH1 A;  1WD0 A;  4Y7N H;  2EYO A;  4DAY B;  3J7Y W;  3QB3 A;  2VW9 A;  3DEO A;  2AUK A;  2MJ8 A;  4KN7 C;  3BDC A;  4NP5 A;  2WFW A;  4DR4 Q;  1LT3 D;  1IBM L;  3DEP A;  4UP8 A;  2NBF A;  2DJG C;  4HMJ A;  1YNJ C;  2NN6 H;  3F8T A;  2D5D A;  4RGO S;  5IT9 L;  4GKJ L;  3IKJ A;  1EEF D;  3GQB A;  1AP0 A;  1V8Q A;  1CUK A;  3PO3 B;  4YCW A;  1NR4 A;  2R92 B;  4DK3 C;  4OO1 I;  4IUV A;  1PTO C;  4NXM L;  2WIN B;  1VQA A;  1B44 D;  3MVV A;  1EYD A;  2NVQ B;  5FO7 B;  2CCZ A;  4HCS A;  2K1B A;  2A19 A;  2UXD Q;  2ZXR A;  4GLV B;  1VQ7 A;  1CHP D;  2LSS A;  2FHT A;  3T4A C;  2EJG C;  2Z9H A;  3GV6 A;  1IBK Q;  2PMZ B;  2JA7 B;  1QJO A;  1DOK A;  3TN2 A;  3A8J E;  4P71 A;  1PH7 A;  3KLW A;  3A8K E;  2H4O A;  2E2D C;  4A4I A;  1TWF H;  4KJN A;  1PH9 A;  2NN6 G;  1B3A A;  3OTO L;  5BN4 A;  1EL0 A;  4B3T L;  3HFZ B;  2CVR A;  3K0X A;  2B2V C;  3U9S A;  3L9A X;  2F0D A;  3UDX A;  2OF1 A;  1G2T A;  1Y1V H;  4KHP Q;  5A2Q L;  4H44 C;  2BDO A;  4DR7 L;  3GTJ H;  4NMZ A;  1VS0 A;  3GDE A;  4ME3 A;  3CCS A;  1Q46 A;  1CA6 A;  1L0X B;  4IO9 A;  4ZCK A;  4DV1 Q;  2NVT H;  1JOK A;  3RZO B;  2AUJ D;  2K50 A;  3NTH A;  3JC6 6;  2L0C A;  3HOY B;  3GTK H;  1U5K A;  4ZYS A;  2EY2 A;  3I72 A;  2PZU A;  1OXT A;  3D31 A;  1FNW A;  4QQB X;  1EY4 A;  1X3F A;  1Y1V G;  1EYA A;  5GAE C;  3OWE B;  5BN5 A;  4A3B G;  1TWG H;  2NVX H;  1VMP A;  4K14 A;  1P16 A;  3QOL A;  1B50 A;  2EZV A;  1CKO A;  3PIO 3;  3S1R H;  1B2T A;  4YWM A;  4KLK A;  1EYG A;  2L4N A;  3FKI B;  4EQP A;  4CDE C;  1VQF A;  1FGU A;  2WAQ B;  5CV5 A;  1G8Z D;  1C7Y A;  1VQI A;  5FKA C;  3MAQ A;  4Q0F A;  2Y0S G;  1QNU A;  1JJ2 A;  1X6O A;  5DM7 3;  1BOS A;  2V4D A;  4JI1 L;  2LS0 1;  1X3E A;  2OEO A;  3NQI A;  3RNU A;  1KTK A;  3EFX D;  4DV5 Q;  1ZYR C;  1GUG A;  4CJ1 B;  1QUQ A;  3CCM A;  2RBM A;  1JR0 D;  3S2D B;  2HIX A;  2CQA A;  3H3V I;  5JJI A;  1NSN S;  3AFQ A;  5I2Y A;  4FVM A;  4GN4 B;  5KNB A;  1BUV T;  4FF2 A;  1JJG A;  1HRJ A;  3S2H H;  1GUO A;  4KN4 C;  3S16 H;  3BZC A;  4JG2 A;  3LNN A;  3UDG A;  3IFD A;  2DGY A;  1CZW A;  5KYI A;  4C3J B;  2R6G A;  4OEL B;  4JV5 L;  4BBS G;  5M3F B;  1CSQ A;  4JYA L;  2BH8 A;  3OOC A;  5LHY 1;  5DEH A;  4UDU C;  5CR3 A;  2D2C C;  5LMN L;  2I5H A;  4K0K L;  4EGV A;  4O2D A;  1S40 A;  3KF6 B;  2RCN A;  1SYC A;  2EDG A;  2A74 C;  2BOS A;  4ZKB B;  1B7Y B;  3HOV G;  1SMY C;  1PTO B;  2SDF A;  1KRT A;  4K5W A;  1I94 L;  1P8L A;  5C5M A;  5M3M H;  1LTB D;  4RAU C;  2Z4H A;  3S24 A;  2B2W C;  2F0M A;  1Q12 A;  1H9S A;  5E4W C;  1GUN A;  3F1Z A;  4A3G B;  2KOL A;  2B2Y A;  4MNO A;  1RD9 D;  1LT5 D;  2EYL A;  3K8A A;  1H9M A;  1QOH A;  2R92 H;  4WJ3 M;  4YCV A;  1GHK A;  1BCP F;  2BCO A;  4C3H B;  3CC7 A;  4JBM A;  1F9R A;  4FO2 A;  4KI0 A;  4LJZ C;  1SYF A;  5T1I A;  4RG1 A;  1Y69 U;  1AE2 A;  2QEX A;  2UXB L;  5BR8 L;  1C0A A;  4DNT B;  3PIP A;  4YY3 Q;  1Q82 C;  3NE5 B;  2JA7 H;  1PZK D;  4DR3 Q;  2JA6 B;  2KHJ A;  4G7Z C;  1MKH A;  3I90 A;  2F0N A;  3HKZ B;  4EVO A;  1U4P A;  4H0L C;  5TSS A;  4A3D G;  4ABN A;  1HNZ L;  3W2D A;  3EA6 A;  1PRT D;  3RMH A;  3HOX B;  2Z6B A;  1BVS A;  2B8F A;  3VA5 A;  2E2J B;  1RCV D;  3PO3 G;  2AKW B;  4DR4 L;  2R92 G;  1D5Z C;  4BS9 A;  1MBY A;  4KKU A;  3S1Q B;  4A3M H;  2R7Z B;  1AW7 A;  1DD2 A;  3J80 E;  2VUM B;  1U0L A;  1CFM A;  2M00 A;  4R4C A;  2JA7 G;  5E4X A;  3R3O A;  3KBG A;  4FYD A;  1E2V A;  5LMN W;  2E2I B;  1PFM A;  1N36 Q;  2IW3 A;  3H91 A;  5IGC A;  2R7F A;  2UXD L;  1TWH B;  2N3S A;  2RQX A;  4OX9 Q;  1B9N A;  1IBK L;  2VS1 A;  3HOY H;  1XPO A;  1RF2 D;  1WTH A;  4E6I A;  4FF3 A;  4OXP A;  5IGG A;  1ILP A;  1OXV A;  2PCF B;  1E2W A;  3ULP A;  1K0S A;  2CWP A;  4BA2 I;  1A15 A;  4MIU A;  2EYJ A;  4WFN 3;  5AJ3 Q;  5ISR A;  2LFN A;  2OQK A;  5FLX c;  2ZTE A;  1LTG D;  3T1H Q;  1TU2 B;  3Q23 A;  5IIF A;  1V1Q A;  1STB A;  2KUM A;  5ELF A;  4B08 A;  1EU3 A;  4LF8 Q;  2PO4 A;  1GKH A;  2K05 A;  3FPU B;  2OXP A;  1BF4 A;  2RA4 A;  4XYO A;  1UEA B;  3ITP A;  1L1O A;  3BVZ A;  1SYE A;  3QOJ A;  3C3L A;  2PYK A;  2B3G A;  3VR5 A;  4KHP L;  1FL0 A;  1EYC A;  2LXJ A;  1PYW D;  3FKI H;  2EJM A;  1XJV A;  2VL6 A;  1I4R A;  2FMC A;  2PNR C;  2NWG A;  1II3 A;  1K8M A;  4DUY Q;  1K8G A;  4DAP A;  3K58 A;  1HNW Q;  4DV1 L;  3VR2 A;  4IUP A;  2A1A A;  4HAE A;  3K59 A;  1XWE A;  5KYL A;  5FLX L;  1QUQ B;  1WCM B;  2XSC A;  1EIF A;  2AWO A;  3GTP B;  3A8I E;  1E1O A;  3ND9 A;  4JI4 Q;  5JEA H;  4PNY A;  1GM5 A;  2EPB A;  1QVC A;  3KDF B;  4L5R C;  2R93 B;  2F0G A;  3S2D H;  4DV6 Q;  5FJ8 H;  3VR6 A;  5EBC A;  3D0F A;  1LT4 D;  2KVM A;  4F8M A;  1FVI A;  1EQT A;  5E1F A;  2F0T A;  3J7A V;  3FKI G;  5JEA J;  3CCV A;  2UXC Q;  2WAQ G;  4Q5V A;  1AZP A;  1ET6 A;  2AQ2 B;  2DJF C;  3SR1 A;  4AIM A;  2BA0 A;  4C3J H;  4CKB A;  2F3W A;  3HEJ A;  3OWF A;  1F2Y A;  5IGB A;  5FLM H;  3AU7 A;  3NEM A;  1Z6H A;  3DUZ A;  1DZ1 A;  3H0G H;  5CMD A;  1KDC A;  5C3E H;  2Z1C A;  1XNR Q;  5JEA G;  3BYY B;  2X69 A;  1ROD A;  3MEH A;  3CKI B;  3IL8 A;  5FJ8 G;  1XYI A;  1KQS A;  1VQJ A;  1HCZ A;  3UE0 A;  1K28 A;  5G3L F;  2KED A;  4C3I H;  2NB0 A;  4DXG A;  3PUV A;  4BY1 H;  2UUA Q;  1X55 A;  1Y8N B;  3ERO A;  2OQ0 A;  3J81 c;  4DV5 L;  3BG3 A;  3MHB A;  2F0H A;  2AWN A;  4C3J G;  4A3G H;  5M3F G;  1D6E C;  1JE4 A;  1U4M A;  2F4I A;  3LWE A;  5IGF A;  1M8A A;  3F2U A;  4IPD A;  5IP7 H;  4LAA A;  2RKS A;  1GUS A;  5M5W B;  2F0K A;  4APV A;  2G9D A;  2K5D A;  3S1N H;  5LL6 S;  2JQO A;  3NPP A;  4DA2 A;  2R7D A;  1CKN A;  1X9N A;  2JA6 H;  3J81 E;  2I5L X;  2KEE A;  2EYH A;  2F03 A;  1PDQ A;  3CAM A;  3HZX A;  1JOR A;  3VYU A;  4A3G G;  3HOX H;  4QIW E;  1Q3L A;  2FIN B;  2QIL A;  3VA7 A;  2LY7 A;  2E2J H;  2EYM A;  1GUT A;  1TWF B;  1SE4 A;  2K28 A;  3CW2 C;  2EYF A;  2CW0 D;  3PMF A;  1PH8 A;  5EGT A;  1TT2 A;  4C3H G;  1E24 A;  3S1Q H;  3ER0 A;  2R7Z H;  1YBY A;  3NWT A;  5KEE A;  4UHV A;  1WTX A;  2IPK D;  1BBU A;  5ELC A;  2JN4 A;  2LXK A;  2XRQ D;  4K8I A;  2JA6 G;  1FR3 A;  2F1M A;  1CM9 A; 
#chains in the Genus database with same CATH homology
 2E2I H;  2IHF A;  3AQQ A;  1CUK A;  3HKZ G;  4YCW A;  3J7Z C;  2B29 A;  2F52 A;  2NVY H;  1Y1W H;  1HNX Q;  4DK3 C;  1L1O C;  1EOV A;  4LF7 Q;  4OO1 I;  3I7F A;  1TWH H;  1X54 A;  3HOX G;  3I4O A;  1VQA A;  4NXM L;  4LUZ A;  5EAY A;  2H5X A;  4DR5 Q;  5E7N A;  4ALP A;  1SRO A;  1A0I A;  1KHI A;  1UE5 A;  1VQE A;  4MTN A;  4UP9 A;  4YY3 L;  1VQ5 A;  2CCZ A;  4DR3 L;  3GTO H;  1V43 A;  3SGI A;  2A19 A;  4YWK A;  2IX1 A;  2UXD Q;  1VQ7 A;  3K7U C;  4GLV B;  2LSS A;  4DKA C;  3DLL A;  4A3K H;  1TWC H;  3CPW A;  1VQ4 A;  4AYB E;  1IBK Q;  1HNW L;  5IWA Q;  1SR3 A;  4P71 A;  1JB7 A;  1KD1 C;  1PH7 A;  3KLW A;  1BBW A;  3JAM c;  1G29 1;  2YU9 H;  2PI2 A;  3MEF A;  2CWA A;  4YWL A;  4A4I A;  1YJ9 A;  1SMX A;  1TWF H;  2VUM G;  4AYB G;  1PH9 A;  2NN6 G;  4IFD J;  4H02 A;  1IXR A;  3HOU H;  3OTO L;  4HJ9 A;  1PFS A;  4AQY Q;  1EUJ A;  1X56 A;  4UPA A;  2OTJ A;  5ELO A;  3LGJ A;  4A3F H;  4DUZ Q;  4L5T A;  2FXQ A;  2Z6K C;  1FJG Q;  3ERS X;  3CQZ H;  1KAW A;  4JI0 L;  4B3T L;  3HFZ B;  3K0X A;  1Y1W G;  3F2D A;  3U58 A;  3NBH B;  3S15 H;  5IYC G;  1D8L A;  3K80 C;  2BH2 A;  3TRE A;  3Q8D A;  4BY7 H;  4A3D H;  1IZ6 A;  2L15 A;  1XPR A;  5C4X G;  1O7I A;  3BU2 A;  3UDX A;  3M4Q A;  1IL2 A;  1MIU A;  4DR6 Q;  4X6A H;  1JMC A;  1Y1V H;  3KJO A;  3PUZ A;  1N9W A;  4KHP Q;  1PH6 A;  2NN6 I;  1B8A A;  4IPG A;  5C0X J;  3KF8 B;  1NMG A;  4DR7 L;  3PUW A;  3GTJ H;  1N33 Q;  4IFD G;  3PO3 H;  1VS0 A;  3GDE A;  4ME3 A;  1K8A C;  3CCS A;  1MJE A;  1Q46 A;  1XMQ Q;  1N36 L;  4IO9 A;  4B3M Q;  3AFP A;  4LNQ A;  3I4N H;  1HJP A;  4EX5 A;  2JA5 G;  4DV1 Q;  2MO0 A;  2NVT H;  3ULL A;  2JEA I;  1AH9 A;  3PIO A;  4JI2 L;  1M90 C;  3GTP H;  4OX9 L;  2K5N A;  3PF4 A;  2NVQ H;  1RL2 A;  2E5L Q;  2K50 A;  2K75 A;  1EIY B;  2UUC L;  3TRZ A;  4NXM Q;  1J5E Q;  2UU9 L;  4PZ6 A;  4HJ8 A;  4LUO A;  1N32 L;  5J3B A;  3JC6 6;  3J80 c;  1PHJ A;  4P73 A;  4JI5 L;  5HGQ A;  4QGU A;  5C0X G;  3CPF A;  4GLX A;  1K9M C;  3AEV A;  4JI8 Q;  4A3L G;  1E22 A;  3GTK H;  1U5K A;  1JE5 A;  1VCI A;  1K0R A;  4GN3 B;  1PH4 A;  5FLM G;  1YIT A;  1OXT A;  3D31 A;  5GQO A;  2K4K A;  4GNX B;  4JCV E;  2MNA A;  1YHB A;  4JI6 Q;  4OWW B;  3H3V H;  4QQB X;  1X3F A;  2GN5 A;  2WB1 E;  2VUM H;  1VQM A;  1Y1V G;  3H0G G;  4LF8 L;  1G6P A;  5C3E G;  5GAE C;  1Z9F A;  4X65 Q;  1GVP A;  5H1S E;  3GTL H;  5C0X I;  1VQC A;  4JI7 Q;  2N78 A;  4A3B G;  3E9H A;  5IE8 A;  1TWG H;  2NVX H;  2WB1 G;  3W5O A;  1EFW A;  3I4N G;  1K73 C;  2DUD A;  2HT1 A;  1P16 A;  5IYD G;  2KBN A;  4IPC A;  2ID0 A;  3TS2 A;  1WCM G;  2ZM6 L;  4LF4 L;  1CKO A;  3HOZ G;  1KRS A;  2GVA A;  4R4O A;  3S1R H;  4LFA L;  3M7N A;  3I56 A;  4LFB L;  4JI3 L;  4BY1 G;  3CD6 A;  4YWM A;  5IT9 c;  4DNI A;  4DUY L;  4KLK A;  2Y0S E;  3L7Z C;  3M4P A;  1EYG A;  2UUB Q;  3GTM H;  1XMO L;  1GO3 E;  1VQP A;  3KYH C;  1IBL L;  5K36 G;  1Q1E A;  3NEN A;  2R93 G;  1Q1B A;  4HIM A;  2F4V Q;  3GTG H;  1VQF A;  3CCJ A;  1NMF A;  1FGU A;  3PV0 A;  1N32 Q;  2KCT A;  1C7Y A;  1TXY A;  4B3R L;  1VQI A;  3FP9 A;  1B70 B;  1J6Q A;  2AHO B;  4P75 A;  3RZO H;  2Y0S G;  4HIK A;  1QVG A;  1JJ2 A;  3A0J A;  4QJF A;  1Y14 B;  5IP7 G;  1X6O A;  4HJ7 A;  4JI4 L;  3B6Y A;  1E3P A;  4JI1 L;  1X3E A;  2Q2H A;  2PI2 E;  3J80 i;  4DV6 L;  3RZD H;  3RNU A;  2HQL A;  1CSP A;  3PUY A;  1AE3 A;  3TEH B;  1LUZ A;  2B63 H;  2UUC Q;  3M3Y H;  2IHE A;  4DV5 Q;  1HR0 L;  1HZ9 A;  1QUQ A;  3AYH B;  2N8N A;  3CCM A;  2HHH L;  3KFU A;  4JBW A;  4LF5 Q;  3CME A;  4POG A;  2HIX A;  1MJC A;  1KXL A;  4A3E G;  5M5W H;  3H3V I;  1Q7Y C;  2UXC L;  5JJI A;  3AFQ A;  5IYB H;  3A74 A;  4GN4 B;  3H15 A;  3MXN B;  4DR2 L;  4LF6 Q;  4HID A;  1JJG A;  4DV4 Q;  4GLA C;  4EQ5 A;  3S2H H;  4A93 H;  2I5M X;  3ICE A;  2BA1 A;  3S16 H;  5LMU Q;  3BZC A;  4JG2 A;  3UE1 A;  4DR1 L;  4L5Q A;  2ATW A;  3CC4 A;  3UDG A;  1TWA H;  2DGY A;  4IPH A;  1OXX K;  2R6G A;  4JV5 L;  2EIF A;  4A3C H;  4LFC Q;  4BBS G;  3FHW A;  1CSQ A;  4DV0 Q;  1XNR L;  4JYA L;  2BH8 A;  2JK8 A;  4R4T A;  1OTC A;  1JJC B;  5JJL A;  2ZM6 Q;  4J15 A;  2D0O A;  1K83 H;  5LMN L;  2E8G A;  2I5H A;  3T1Y L;  2OWO A;  4BXX H;  1XNQ Q;  4O2D A;  1S40 A;  4K0K L;  1E1T A;  3KF6 B;  2RCN A;  3PGZ A;  4X62 L;  1XMO Q;  1NJI C;  1QZH A;  4LF9 L;  2R7Z G;  3J7A 5;  1B7Y B;  1NY4 A;  1XPU A;  1EQQ A;  2UUA L;  2A8V A;  1L1O B;  3HOV G;  2E2H H;  3M85 A;  4DV3 L;  1Q8K A;  1KRT A;  1I94 L;  5IYB G;  1P8L A;  2YYZ A;  2OTL A;  1WOC A;  5M3M H;  1YJN A;  4GKK Q;  4WJ4 A;  4GOP A;  1ASY A;  2JJQ A;  3S24 A;  1LYL A;  1PYS B;  1OXU A;  1Q12 A;  1PV4 A;  1IYJ B;  1A8V A;  2K5H A;  1YI2 A;  3F1Z A;  4DV2 Q;  4A3C G;  1NBW A;  2HHH Q;  4MNO A;  4NPS A;  1IBM Q;  4MZ9 A;  3PUX A;  3I2Z A;  3CC2 A;  4A3K G;  1V9P A;  3K8A A;  2R92 H;  4WJ3 M;  2VQE L;  4YHH L;  4GKJ Q;  4BXX G;  1I6H H;  4YCV A;  4GOP C;  3CMA A;  4L5S A;  3CC7 A;  4JBM A;  1PH3 A;  1NE3 A;  5M3F H;  4KI0 A;  3I4M H;  2D0P A;  1HZC A;  2Q2I A;  4HIO A;  1S3O A;  3HOU G;  4RG1 A;  1XTD A;  1AE2 A;  1SN8 A;  2QEX A;  5BR8 L;  2UXB L;  3PIP A;  1Q82 C;  4YY3 Q;  4A3F G;  2JA7 H;  1C0A A;  4DR3 Q;  2KHJ A;  1YIJ A;  1PH5 A;  2VQF L;  3EBE A;  1MKH A;  5AJ3 L;  5M5Y H;  5GRO A;  2QA4 A;  2OCE A;  3ULJ A;  4X66 L;  1LTL A;  3GO5 A;  2K14 A;  3T1H L;  1HR0 W;  4BY7 G;  4A3D G;  3T1Y Q;  4HJA A;  1HNZ L;  2RHQ B;  5C44 H;  3PSI A;  1KC8 C;  5JJK A;  1PA6 A;  1S72 A;  4X64 L;  1BVS A;  2K5V A;  3TQY A;  2YTX A;  4Y52 H;  3W1B A;  1R9T H;  3PO3 G;  2AKW B;  4C2M H;  4DV3 Q;  4A3J H;  2R92 G;  4PZ8 A;  4DR4 L;  3OTO Q;  4UY8 C;  4B3S L;  1N34 L;  4OON A;  1W2B A;  1X3G A;  1Z47 A;  2PMZ E;  4DV7 L;  4JI0 Q;  4B3T Q;  2YV5 A;  4A3M H;  1SLJ A;  1I3Q H;  1UE6 A;  4IJL A;  3I4M G;  1A63 A;  1QZG A;  4LWC A;  1YZ6 A;  1U0L A;  2ZTD A;  4JBK A;  4R4C A;  2JA7 G;  3TS0 A;  1HNX L;  2JA8 H;  3PO2 H;  4LF7 L;  2D62 A;  4C3H H;  5LMN W;  4DR7 Q;  1WI5 A;  3RN5 A;  4DR5 L;  5GAD C;  3WWV A;  1N36 Q;  2ZJQ A;  2R7F A;  4A76 A;  2UXD L;  3RLN A;  2N3S A;  5IY0 A;  5C44 G;  2I0Q A;  4JI2 Q;  3HOW H;  4OX9 Q;  3OW2 A;  3K7A H;  1IBK L;  1BKB A;  2JE6 I;  2VS1 A;  2WP8 J;  4UP7 A;  2ALY B;  3STB C;  2Z0S A;  5IWA L;  3CCE A;  3HOY H;  5C4J H;  1XPO A;  4A3J G;  2UU9 Q;  5GAH C;  2MO1 A;  4OXP A;  1PYB A;  2PQA B;  3K81 C;  1OXV A;  4OWT B;  3ULP A;  1SFO H;  4JI5 Q;  5GAG C;  2VNU D;  2CWP A;  4PG3 A;  1VQ9 A;  5AJ3 Q;  4BA2 I;  2YTV A;  4JOI A;  2OQK A;  5FLX c;  2ZTE A;  4IFD I;  4AQY L;  1D7Q A;  3T1H Q;  1YHQ A;  4NB3 A;  1GD7 A;  2RHS B;  4DUZ L;  4IOC A;  1UWV A;  1CKN B;  1HNZ Q;  1V1Q A;  2ZJR A;  3KF6 A;  2HIV A;  4LF8 Q;  3J81 i;  2JA8 G;  1GKH A;  3PO2 G;  5HY6 A;  4RMF A;  1DGS A;  3OYY A;  2QGQ A;  1HZB A;  3RLF A;  1L1O A;  1WFQ A;  1VQN A;  4LUV A;  4DR6 L;  1SRU A;  2B3G A;  3STB D;  4KHP L;  4NXN L;  1FL0 A;  2LXJ A;  2IY5 B;  4B3S Q;  1K3R A;  4BA1 I;  1N33 L;  1VQG A;  3FKI H;  4JOI C;  4LF4 Q;  1QVF A;  3G4S A;  4JC0 A;  2VL6 A;  1XJV A;  3UDF A;  4LFA Q;  1XMQ L;  3GTQ H;  3HOW G;  4LFB Q;  1WYD A;  3DM3 A;  4B3M L;  4JI3 Q;  4DUY Q;  1Q86 C;  1K8G A;  2B63 G;  1HNW Q;  4DV1 L;  2F3I A;  1I50 H;  2GVB A;  1IBL Q;  2VZA A;  4QL5 A;  4XIG S;  5IYC H;  2A1A A;  1VQL A;  2E5L L;  4B3R Q;  4GS3 A;  3NEL A;  1KL9 A;  4TVA B;  5C4X H;  1QUQ B;  1J5E L;  1EIF A;  2AWO A;  4BBR H;  1E1O A;  3GD7 A;  1YJW A;  4JI8 L;  3CCR A;  1PH2 A;  1VQK A;  4JI4 Q;  3S17 H;  1GM5 A;  4A93 G;  1QVC A;  3KDF B;  4JI1 Q;  1OXS C;  2ES2 A;  2Z6K A;  1W3S A;  4L5R C;  1UE1 A;  4DAM A;  2NZO A;  4JI6 L;  3S2D H;  4DV6 Q;  3L0O A;  5FJ8 H;  4IJH A;  2WAQ E;  2JA5 H;  1EQR A;  3D0F A;  3M9B A;  1HR0 Q;  3BZK A;  2C35 B;  1FVI A;  4A75 A;  4X65 L;  3PF5 A;  1M1K C;  3FKI G;  5JEA J;  3F2C A;  2KEN A;  1L2F A;  4XTC S;  2XTI A;  3CCV A;  4JI7 L;  2UXC Q;  2JA9 A;  3J81 j;  2WAQ G;  3G71 A;  4AIM A;  2ZJP A;  1VQ8 A;  4GNX A;  4A3L H;  4DR2 Q;  2YTY A;  1EWI A;  2BA0 A;  3I55 A;  4C3J H;  5M5X H;  4TQU S;  2RF4 A;  4DR1 Q;  4PZ7 A;  5FLM H;  4R1J A;  2UUB L;  4KHZ A;  3NEM A;  4R4I A;  2XGT A;  4BBR G;  3KJP A;  1G51 A;  2F4V L;  4JV5 Q;  1CKM A;  5M3M G;  3H0G H;  2Q2T A;  2Q2U A;  4DPG A;  1T9H A;  1C9O A;  3CP0 A;  5C3E H;  4NXN Q;  1XNR Q;  4JYA Q;  5JEA G;  4IOA A;  2CQO A;  3E9I A;  1YVC A;  3ZJY C;  1E7Z A;  1VQH A;  4GNX C;  4A3B H;  5LMN Q;  3RR5 A;  5FJ8 G;  1VQD A;  1KQS A;  4K0K Q;  1VQJ A;  5ELN A;  4OWX B;  3U4Z A;  3UE0 A;  4X62 Q;  4GOP B;  2IX0 A;  5IYD H;  1JT8 A;  1WCM H;  4LF9 Q;  3CCU A;  3HOZ H;  4C3I H;  4A3I H;  1N8R C;  3PUV A;  3A5Z B;  4LW1 A;  2UUA Q;  4BY1 H;  2EQS A;  1X55 A;  1LM0 A;  2IT1 A;  4YCU A;  3M4O H;  2OQ0 A;  3J81 c;  4DV5 L;  1I94 Q;  3G6E A;  4JBJ A;  2R93 H;  1VQO A;  3EN2 A;  4DK6 C;  3U50 C;  2AWN A;  1I5F A;  5IP9 H;  4LF5 L;  2PNH A;  2KHI A;  2VY3 A;  3F2B A;  2MFI A;  4A3G H;  2V1C C;  4P74 A;  1HZA A;  5M3F G;  3JAM i;  1HH2 P;  3EIV A;  1PVO A;  4IPD A;  4AH6 A;  5IP7 H;  4LF6 L;  2K52 A;  4DV4 L;  2AMC B;  2N49 A;  1ASZ A;  3CXC A;  3CF5 A;  3RN2 A;  3VDY A;  3UDI A;  5LMU L;  4APV A;  2NZH A;  2PQA A;  2JEB I;  3S1N H;  4HJ5 A;  3L2P A;  2CFM A;  3RLO A;  1A62 A;  3G48 A;  4LFC L;  2JQO A;  4YHH Q;  2VQE Q;  1UEB A;  4PMW A;  3IRB A;  4R4Q A;  4DV0 L;  3S14 H;  3CCQ A;  2R7D A;  1CKN A;  1X9N A;  4A3I G;  4A3E H;  2JA6 H;  4GN5 A;  5DLQ E;  1YNX A;  3PCO B;  1XNQ L;  2I5L X;  2ASB A;  3U4V A;  3CAM A;  2EXD A;  2UXB Q;  5BR8 Q;  3BJU A;  5IP9 G;  1RIP A;  2CKZ B;  2ZTC A;  1PH1 A;  2VQF Q;  1Q81 C;  4Y7N H;  4A3G G;  3HOX H;  4QIW E;  4DAY B;  4X66 Q;  4A3M G;  1X65 A;  2E2J H;  4BBS H;  1L0W A;  2VW9 A;  3HKS A;  1SE8 A;  3CW2 C;  4FDB A;  1FJG L;  1WJJ A;  1YEZ A;  4GKK L;  4POF A;  1UE7 A;  4X64 Q;  1PH8 A;  1H95 A;  4P72 A;  3CCL A;  3KOJ A;  2KCM A;  2MQH A;  1E24 A;  1KIX A;  2WFW A;  4DV2 L;  3S1Q H;  4DR4 Q;  4OO1 G;  3ER0 A;  3A5U A;  2R7Z H;  3HKZ E;  1YBY A;  3W1G A;  4QY7 A;  1N34 Q;  1YHA A;  1VQB A;  1IBM L;  1VQ6 A;  1BBU A;  1NTG A;  4DV7 Q;  3HOV H;  2LXK A;  3F8T A;  2JA6 G;  3KDF A;  3E0E A;  3HOY G;  4GKJ L;  4UP8 A;  4O0A A;  3S1M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...