1HNWQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 19
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnwQ00
1KAWA 5H1SE 1OXXK 3T1HL 3S16H 4C3HH 3DM3A 1VQBA 1YJ9A 2ATWA 3H0GG 1HNXL 1O7IA 2ZJPA 1S72A 4OX9L 4IO9A 1QVCA 1TXYA 3U58A 1IL2A 4YCWA 1PV4A 3U4VA 1PVOA 1XNRL 4DUZL 3L0OA 1VQEA 2B63G 1MIUA 3ULLA 1VQMA 1JMCA 1Q7YC 4QQBX 4YWKA 2R7ZH 3TRZA 1HZCA 3Q8DA 4DV7Q 4DV1L 1MKHA 3W1GA 4LF4L 1Q8KA 4LF7L 3UDIA 5DLQE 4A3LH 4A3EG 1B8AA 1CKMA 3GTLH 3HOZH 2UXBL 3UDXA 1ASZA 3U50C 2R7DA 1NMFA 2LSSA 4R4IA 3S24A 1YHAA 5GADC 5C4JH 1PH5A 2Q2UA 4B3SQ 1N36Q 2YTVA 4NXMQ 3ICEA 1VQ6A 1EQQA 1UE7A 1EYGA 4LWCA 4DR6L 3CQZH 5C4XG 4IPHA 2HT1A 1E24A 4R4TA 2I5LX 3F8TA 4DV4Q 2YYZA 4DR5L 1GKHA 4LUZA 5LMNL 4QL5A 3CCLA 2ES2A 1L0WA 4OX9Q 1WCMH 4JI4L 3A0JA 4WJ3M 4DUYL 4GKKQ 1VQOA 4GKJQ 5BR8L 1VQ9A 4JI7Q 4XTCS 4IFDI 4B3ML 2CCZA 4DR7L 4DUZQ 2F4VL 1G6PA 1TWCH 1RIPA 1X54A 3BU2A 3KDFB 4JBWA 3TREA 2VUMG 1N32L 1B7YB 3HOUG 1XNQQ 3J7A5 4IOCA 1WYDA 2R93H 2ALYB 2XGTA 5M5YH 4A3IH 4OWTB 1IBMQ 2PQAB 1YVCA 1QVFA 4GLVB 3PO2H 3PO3G 2BA1A 4GN4B 2VQEQ 4A3MG 4A3DH 1W2BA 4A3FG 3J7ZC 4EX5A 3CCJA 4KLKA 4TQUS 2UUAQ 1B70B 3GTOH 4LF9L 2N78A 1YBYA 2B29A 1OTCA 3HOZG 4A3GG 1OXSC 4A3BG 4IPDA 4PZ6A 2NVYH 2Z6KA 3A5UA 4KHZA 3PF5A 4IFDJ 4R4CA 5LMNW 2OTLA 2RHSB 4A3JH 1S40A 4A3CH 3G71A 1KHIA 5EAYA 3LGJA 4DV5L 3HOYG 3HKSA 2E2IH 1WJJA 3S2HH 2GVBA 5GROA 4HIOA 3TEHB 5M5WH 3G4SA 3ULPA 4X65Q 3PIOA 4JI1Q 1YI2A 1N36L 2E5LQ 4LF6Q 4JI3Q 4KHPQ 3I4NG 2K52A 3CCUA 4GKKL 4GKJL 1OXVA 1JJGA 1PH1A 4B3RL 3H15A 3G6EA 4BBRH 1AE2A 2UUCL 2DGYA 1BBUA 2ZM6L 4QGUA 3PUYA 3ULJA 1NJIC 4LF7Q 1NBWA 3GTPH 1YITA 1Y1WG 3JC66 3RLFA 1BBWA 4HJ9A 1E1OA 1I50H 4L5RC 2KCTA 3PF4A 4C3IH 2BH8A 5JJLA 1PH4A 4A3KH 1P8LA 3S1MH 1L1OB 5FLXc 2VL6A 2JJQA 2NVTH 1KXLA 4TVAB 4YHHQ 4PMWA 2JA8G 2JA9A 4A3JG 2VY3A 4YCVA 2GVAA 2IT1A 4B3TQ 1YHQA 5JEAJ 1X3EA 2YV5A 3J80i 1EIYB 1VQNA 3RZDH 1I94L 5AJ3L 3S1NH 2CFMA 4LFAQ 4DR2L 2UXCQ 2I5MX 4X66L 3AFQA 3A5ZB 1VQPA 3I4NH 2RF4A 3HOWH 5JJIA 2JE6I 4DR4Q 4DK3C 5C44G 1EUJA 2D0PA 1XJVA 1QZHA 2AWOA 1SRUA 1KRSA 5GQOA 2JA5G 4K0KL 3HOYH 2UUBL 4DR3L 2E5LL 3I7FA 1WI5A 3CD6A 4IPCA 3I4MH 2MO1A 1MJCA 1X3GA 4DV2L 3KOJA 1VQJA 3CMEA 4DV6Q 1CUKA 4BY7H 2MO0A 2OQ0A 3PV0A 4GLAC 2YU9H 2JEAI 1N33Q 3AEVA 3M4QA 2EIFA 3BJUA 4JI2L 3PCOB 4O2DA 2OWOA 3M4OH 4GOPC 1I94Q 1YJWA 3GTGH 1UEBA 4PG3A 4JI0Q 1SE8A 1GM5A 3HOUH 3CC7A 5M5XH 4BXXH 3BZKA 3EBEA 1HR0L 2MNAA 4UP9A 4JV5L 4DV3L 1FJGL 2CWAA 3CXCA 4P71A 2JA5H 1OXTA 2OTJA 1YNXA 1PH7A 1VQ5A 1UWVA 1CKNA 4IPGA 5AJ3Q 5M3MH 5GAEC 5LMUL 4DR1L 3H3VH 3RNUA 1PYSB 5IWAQ 2R92G 2K75A 5C0XJ 1VS0A 1HNZQ 4OO1G 5IYDH 3J81j 4P73A 3KF6A 5IYCG 4P75A 4DV0L 2L15A 5IP9G 2C35B 2WFWA 3F2CA 4BA1I 5IY0A 1JB7A 3J81c 4MNOA 3K0XA 4AYBG 1YHBA 2NN6I 3HKZE 3UE1A 3VDYA 1N34Q 1PH2A 4AH6A 1HJPA 3CPWA 3HFZB 3NENA 4JI6Q 1HZ9A 4R4QA 1HNWQ 2ID0A 5HY6A 2NZHA 4A3GH 2RCNA 4UP8A 1X55A 3FKIG 2ZTCA 3UE0A 1XPOA 1PH3A 4JC0A 4X62Q 1CSPA 5K36G 2NN6G 1HR0W 4IOAA 4DKAC 4JOIA 2A1AA 3JAMi 4JBJA 4GOPA 1A8VA 4A3IG 1K8GA 4HJAA 3FP9A 3MEFA 4JI5L 2R93G 3NELA 1HZBA 4A3CG 1NMGA 3IRBA 3E0EA 2Q2HA 1KQSA 3HOXG 1J5EQ 1YEZA 3H0GH 1HH2P 1A62A 1TWHH 2JA6G 2QEXA 2K14A 4L5TA 5ELOA 4YWMA 3S2DH 1Z47A 3DLLA 1YIJA 3ZJYC 4LF8Q 3PGZA 3S14H 1BVSA 3CC4A 1U5KA 4J15A 4LF5L 4X6AH 3A74A 3EIVA 2VQEL 4DAYB 4BA2I 1L2FA 3WWVA 1IBKL 1MJEA 2Y0SE 2XTIA 2VS1A 4GN5A 1UE5A 2NVXH 5J3BA 3W1BA 1TWFH 1Q82C 2H5XA 2IHFA 1HNZL 2ASBA 4A75A 1A63A 1X56A 1L1OC 1VQ8A 2PI2A 3GD7A 1KL9A 1PYBA 5IP7G 3CF5A 5C44H 4UY8C 2F4VQ 3GTMH 4DV4L 4RG1A 3T1YL 2KCMA 4L5SA 3TQYA 1LYLA 3L7ZC 5IT9c 1TWGH 2Q2IA 4DR7Q 3E9IA 4GS3A 1PH8A 1VQ7A 3CMAA 1LM0A 1JE5A 5BR8Q 3PUXA 1K9MC 1X3FA 2R7ZG 2EQSA 2KENA 1NTGA 5JEAG 1V43A 2WAQG 5IP9H 1YZ6A 4LF9Q 1Y1VG 5HGQA 4WJ4A 4DUYQ 1QVGA 4ME3A 3F2DA 4HIMA 4AIMA 2VQFL 4KHPL 3I55A 1VQ4A 5ELNA 1N33L 2R92H 3AQQA 1QZGA 1VQKA 1S3OA 1UE1A 2UUCQ 1EOVA 4JCVE 4DV5Q 4DR5Q 1IBLL 1Q12A 1FVIA 1XNQL 4JBMA 4HJ7A 1KRTA 4A3DG 4X65L 4AQYQ 4NXNQ 4B3SL 1JJ2A 4IJHA 1IBML 3PO3H 4MZ9A 1N9WA 3L2PA 1Q86C 4JI4Q 4JYAQ 3AFPA 3OYYA 4LUOA 2A8VA 2F3IA 4JI6L 1W3SA 4BXXG 1IXRA 1XMOQ 1I3QH 4GNXB 3S1QH 4POFA 1K73C 2YTYA 3PUWA 1KD1C 1XNRQ 5IYDG 3K8AA 1EFWA 3CCSA 4BBSH 4YCUA 4HIDA 1Q46A 3CCQA 5LMNQ 1K0RA 1P16A 4EQ5A 1I5FA 4BY1G 1G291 4A76A 3HKZG 4JG2A 4DPGA 4ALPA 3HOWG 1Q1BA 3GTJH 1VQDA 3KFUA 1WCMG 1VQFA 1WOCA 4P74A 4GNXA 1ASYA 1VQGA 4JI7L 2UXBQ 1Y14B 3BZCA 4HIKA 3U4ZA 3UDGA 2HHHL 2CKZB 4MTNA 4OWWB 4QY7A 2Y0SG 3PSIA 1K83H 2VQFQ 2VUMH 4JYAL 3KJPA 2ZJRA 4JBKA 3KYHC 2B63H 4A93H 3M85A 3T1HQ 4NXML 3S1RH 2IHEA 4OONA 2OQKA 1Y1WH 2YTXA 2NVQH 3M7NA 5FJ8G 4NXNL 1DGSA 2KHIA 4Y7NH 3CCVA 4AQYL 4DR6Q 1BKBA 1D7QA 2Q2TA 2IX1A 4A3LG 3NBHB 5C3EG 4YY3Q 4DV1Q 3CCEA 1X6OA 4LW1A 4JI5Q 3KF6B 2ZTDA 1KIXA 1XMOL 2A19A 4LUVA 2JA8H 1IZ6A 2QGQA 5IYBH 3D31A 1XPUA 2FXQA 1IYJB 4JV5Q 2VNUD 1HZAA 1J5EL 3T1YQ 5IYCH 4LF4Q 2OCEA 2AWNA 1C9OA 3RN5A 1PH6A 1SROA 3ER0A 3E9HA 1KC8C 5IWAL 3H3VI 4XIGS 1AH9A 5E7NA 1HNWL 1V1QA 1E1TA 2HIXA 3B6YA 4P72A 3RLOA 4A3MH 5LMUQ 4GNXC 3GTQH 2WB1G 2D62A 1VQHA 4X62L 1J6QA 2VW9A 5M3FH 4DV2Q 3RN2A 3STBC 2E2JH 1HNXQ 4LFBQ 4DV3Q 4PZ7A 5IYBG 1A0IA 1AE3A 2EXDA 4B3MQ 1T9HA 2UU9L 2JA7H 3GO5A 4LNQA 1JJCB 1IBLQ 4A3BH 4A93G 1C0AA 3J80c 1VQAA 5GAHC 3CW2C 1XMQL 1IBKQ 4DR4L 5FJ8H 2B3GA 1JT8A 4X64Q 5FLMG 4IFDG 4OO1I 2Z0SA 2D0OA 2KBNA 2LXKA 4HJ8A 3K7AH 3I4MG 4LF8L 1XPRA 2UXDL 3PUVA 1K3RA 1SR3A 3F1ZA 3KJOA 4BBSG 1E22A 4LF6L 3KF8B 3OTOQ 3NEMA 4OXPA 1YJNA 2AKWB 4KI0A 2I5HA 5C4XH 4A4IA 1G51A 1Q81C 2PI2E 4GN3B 4DNIA 3RZOH 2IX0A 4DK6C 4LF5Q 3KDFA 4RMFA 1N34L 2JEBI 2F52A 4A3FH 3FHWA 3K7UC 4JI8L 2PMZE 2Z6KC 3W5OA 1CSQA 4NPSA 2E8GA 1SFOH 2HQLA 2ZTEA 1PA6A 4LFCL 3PO2G 1TWAH 3RR5A 2BA0A 3PUZA 4X64L 2JQOA 2KHJA 4YWLA 2GN5A 1X9NA 4JOIC 3M9BA 3OW2A 1VQCA 3D0FA 4APVA 1PHJA 2NZOA 1N8RC 3CC2A 1E3PA 4JI2Q 3CAMA 3I56A 4A3KG 3S17H 1EIFA 1Q1EA 2MFIA 4DV0Q 2K50A 4DR1Q 2PNHA 4DR2Q 1M1KC 2UXCL 1EQRA 2R7FA 3AYHB 4QJFA 2LXJA 4BY1H 2K5NA 2JK8A 4LFBL 1R9TH 1RL2A 5JJKA 3UDFA 4BBRG 3CCRA 4GOPB 1SMXA 3PIPA 1NE3A 3STBD 1HR0Q 2QA4A 3EN2A 2UUBQ 3MXNB 2JA7G 1K8AC 3I4OA 4B3TL 3M3YH 4OWXB 4Y52H 4DAMA 3F2BA 4K0KQ 4JI1L 3TS2A 4IJLA 3RLNA 4C2MH 2DUDA 1XMQQ 1U0LA 3J81i 1SN8A 4QIWE 5M3FG 3S15H 4B3RQ 2CWPA 1GO3E 3M4PA 3K81C 5C3EH 4DV6L 1VQLA 2E2HH 1Z9FA 3TS0A 1FJGQ 1VQIA 4C3JH 4A3EH 2UU9Q 1L1OA 1LTLA 1UE6A 2VZAA 2AMCB 4L5QA 5IE8A 1PH9A 1C7YA 1PFSA 1WFQA 3HOVH 3G48A 1QUQA 1LUZA 4FDBA 5M3MG 2BH2A 3JAMc 5C0XI 1Y1VH 4POGA 4BY7G 2N8NA 1XTDA 3ERSX 5IP7H 1CKOA 2WAQE 1X65A 3K80C 2N3SA 2ZM6Q 1SLJA 4DR3Q 4NB3A 4JI8Q 1M90C 4R4OA 4LFAL 2UXDQ 1CKNB 1N32Q 3KLWA 2ZJQA 4JI0L 4LFCQ 4O0AA 3I2ZA 3OTOL 4YY3L 3CP0A 1D8LA 4UP7A 1GVPA 2AHOB 1GD7A 1VCIA 2PQAA 4JI3L 5FLMH 3GTKH 4UPAA 3SGIA 2WB1E 5C0XG 3CPFA 2JA6H 2IY5B 3HOVG 2HIVA 1V9PA 2I0QA 2K5VA 2WP8J 3FKIH 5GAGC 3HOXH 1NY4A 1OXUA 4H02A 2K4KA 4PZ8A 4HJ5A 4GLXA 2R6GA 3CCMA 1E7ZA 2N49A 2CQOA 2MQHA 2HHHQ 1QUQB 1I6HH 4DV7L 4X66Q 1FGUA 4R1JA 2RHQB 1H95A 1EWIA 2UUAL 4AYBE 2K5HA 4YHHL 1FL0A 2V1CC 3GDEA
chains in the Genus database with same CATH superfamily
1KAWA 1BCPB 3S16H 3QJYA 1LTSD 1UAPA 3DM3A 4ZUIA 2E2DC 2ATWA 1VF7A 1S72A 3GTKB 1F2LA 4YCWA 2JA6B 1JWSD 4X3KA 1BCPC 1XNRL 2K28A 4DUZL 1RKNA 2CHBD 3L0OA 1Q7YC 4QQBX 1D2BA 2NUCA 2LS01 3DWQA 3TZDA 4DV1L 3A56A 3NBIA 1Q8KA 4CGYB 4KJOA 5C44B 3BZDB 4ZK9B 1X3QA 3GTLH 3HOZH 2UXBL 1XX8A 4C3HB 4MN3A 3U50C 2R7DA 4R4IA 5I6YA 1EIGA 1YHAA 4B3SQ 1PH5A 3ICEA 1N36Q 3MHBA 1EQQA 3RUZA 1KNEA 2PO4A 4DR6L 1PRTC 4IPHA 1E24A 4R4TA 2KECA 4MIUA 4LUZA 2SEBD 1K8MA 2ES2A 1L0WA 3NTKA 4OX9Q 4WJ3M 4GKJQ 1VQOA 1VQ9A 4XTCS 1U4LA 4B3ML 3R8BA 4R8IA 1SAPA 3SE0A 1NNXA 1W6KA 3J7A5 4FF2A 2R93H 1S5CD 2ALYB 2XGTA 4OWTB 3DHQA 2PQAB 3E5SA 1ILPA 1W2BA 2UUAQ 3HOZG 1EFID 4A3BG 2Z6KA 3A5UA 3GTJB 4K5VA 2EY1A 4R4CA 5KYIA 1IHZA 1S40A 2HCCA 3H3VI 3MC0B 3PF4A 1N36L 4JI1Q 4JI3Q 1T5EA 2K52A 4GKKL 1OXVA 3G6EA 1AE2A 1B9MA 3PUYA 3P75A 2F0TA 3ULJA 1NJIC 1I4GA 1NSNS 3K7AB 1Y1WG 1BBWA 2O2LD 2BH8A 4JPBW 1P8LA 1Q3LA 4NP5A 1L1OB 1RTNA 3P7JA 1H9SA 5FLXc 2NVTH 2DJFC 4TVAB 4ZLTF 3J80L 1CT1D 4YHHQ 5CYUA 4BY7B 4A3JG 3U9OA 3TP7A 4A3FB 1I4RA 2YV5A 4OIKA 1EIYB 1IKMA 5AJ3L 1VF5C 2CFMA 4C56C 2I5MX 3AFQA 2RF4A 2JE6I 5C44G 3H6MA 1M4VA 1ZYRC 2D0PA 1SRUA 3IL8A 2UUBL 3QWNA 4I7ZC 1KDAA 5BN3A 3BDOA 3VR2A 2R61A 3I4MH 1EY5A 1MJCA 4DV2L 3KOJA 1CM9A 2BOSA 4XQJA 2MO0A 3MXGA 4GLAC 4YIJA 2JA7B 3LX0A 2X69A 3FMCA 4IALA 4O2DA 3P20A 1JR0D 3M4OH 1F2MA 1YJWA 2B39A 1EYAA 5KNBA 4XYQA 4TKOB 1CI3M 5CBAE 3VYTA 3LWUA 3OMCA 4BXXH 1PZJD 4UP9A 1FJGL 4CJ0B 2JA5H 2O5JC 1CKNA 1LTAD 4IPGA 5HURA 5GAEC 4G7ZC 1Y8OB 2M00A 1IKLA 1VS0A 4ID6A 4QB4A 4OO1G 4IUPA 4P73A 3BDLA 3KF6A 4P75A 4DV0L 1RCVD 4XQNA 2L15A 1J9OA 3NWTA 2A74C 5IODA 1JB7A 2NZ1D 4MNOA 4AYBG 2NN6I 1D5XC 1N34Q 1PH2A 3CPWA 1HJPA 1V8QA 4JI6Q 3S14B 1A6XA 2ZTCA 3UE0A 5K36G 4X62Q 1CSPA 1F77A 1R9TB 2A1AA 3D4DA 3JAMi 4JBJA 4A3IG 1A8VA 2R93G 2F0IA 3L9AX 1F2ZA 2Q2HA 1TVXA 4HR7B 5DEHA 2PW5A 1J5EQ 1YEZA 3H0GH 1FGBD 1A62A 2EXZA 1RODA 2JA6G 3DLLA 1YIJA 3PGZA 3CC4A 2K7VA 4J15A 4CHTB 3Q24A 2QF7A 1X3PA 1L2FA 1BR9A 4O42A 1Q82C 1O80A 1TWFH 3GP7A 1EU3A 2EPBA 3K6OA 1X56A 1L1OC 3K5NA 5FO9B 4H44C 4UY8C 4ABNA 2KQ3A 4DV4L 1KAAA 5IIFA 5C4JB 1STBA 3L7ZC 5ELDA 4F87A 5KIXA 1JCKB 3HS0C 1LM0A 1PRTB 3PUXA 2KENA 2EYOA 4LF9Q 3WDNA 5EJWA 4XXEA 1U9RA 4KHPL 1WCMB 1N33L 3AQQA 4WFN3 5EBDA 4ZKBB 1VQKA 1GHJA 1UE1A 2UUCQ 4JCVE 1FNUA 4PV1C 4A3DG 1B2TA 4AQYQ 4B3SL 4IJHA 4QUCA 3L2PA 2B2UA 1TY0A 4JI4Q 4LUOA 3OYYA 2F3IA 3L3OC 2R93B 1IXRA 4A3IB 1A3TA 2B63B 4A93B 1CZWA 1SYFA 1QILA 1NR2A 2EY5A 2WB1B 5DNFA 3CCQA 1K0RA 1K28A 3HKZG 4DPGA 4ALPA 1ONLA 2VB2X 3KFUA 5EKIA 1VQGA 2RVLA 1LT4D 4A3JB 5M9OA 3U4ZA 4G57A 3CKIB 2HHHL 1A2TA 4RWSC 2A69C 1HHVA 3CQZB 2O5IC 1CA6A 1IL8A 1ESRA 4WRDA 4HTHA 3CCVA 4Y7NH 1BCPD 1D6EC 5C3EG 4JK1C 4JI5Q 1NR4A 4LUVA 4X3SA 4C3IG 1HZAA 2VNUD 4DXFA 2OEOA 3T1YQ 1K83B 4LF4Q 3A7LA 2F0OA 1FD7D 4ZYSA 1EEID 1PH6A 1SROA 2HIXA 2M9VA 1PLFA 2XVSA 1EQVA 3RLOA 3SHLA 3VR3A 4GNXC 3D3RA 2AUJD 2NVYB 2WACA 3DMUA 1VQHA 4DV2Q 1E2VA 2E2JH 1JORA 2EY6A 1AE3A 2UU9L 2K5WA 2EYFA 2E2IB 4LNQA 3NE5B 4A3BH 1C0AA 4S3SA 5GAHC 3CW2C 3OWFA 1IBKQ 2R3ZA 4DR4L 2F0JA 5ELCA 2B3GA 3H3VC 2LXKA 3O13A 3VYUA 2UXDL 1K3RA 4A3MB 4LF6L 3GV6A 3KF8B 1FNWA 1QE6A 4OXPA 4KI0A 1PFMA 5M3MB 5C4XH 1G51A 1SYDA 4G4KA 1BQQT 1N34L 4RHRA 3D4RA 2Z4IA 2PMZE 2G9HD 4KY5A 1AP0A 1EY4A 2F0VA 3I4NB 1EZ6A 4V0BA 1LTID 1X9NA 1PZID 2KHJA 4YWLA 2GN5A 3BS1A 4JOIC 1PHJA 3D0FA 3CC2A 4FP5D 2MFIA 3SR1A 2K50A 1GXDC 3NK9A 3V2TA 2M2LA 2DNCA 3GV3A 2AQ3B 1U4RA 1LLRD 1R9TH 5JJKA 3UDFA 3CCRA 3PIPA 3STBD 5LL6S 4XT1B 2KUMA 2F1MA 1J8IA 3I72A 4B3TL 3M3YH 1MHWC 3SK4A 3TS2A 5I9OA 4IJLA 1H9KA 1U0LA 3PQIA 2J4XA 3J81i 2CWPA 3EJIA 1CHPD 3M4PA 3K81C 4FF3A 3S17B 1EOTA 1WTXA 1VQLA 2E2HH 5J22A 1Z9FA 3TS0A 3TMEA 3G48A 1LUZA 5C0XI 1XTDA 2ZXRA 3TP8A 3WOFA 2N3SA 3I91A 2ZM6Q 1QOHA 1SLJA 4NB3A 4R4OA 5EPLA 1O7YA 3K5OA 3BVZA 4LFCQ 3KUPA 1VCIA 2PQAA 5C3EB 4RH6A 5C0XG 1SNQA 3I4LA 2HIVA 4N9TA 1V9PA 2UXBQ 2K5VA 3HOXH 1G2TA 1EYCA 1OXUA 2C9OA 5JPMC 4GLXA 2R6GA 3CCMA 1E7ZA 2N49A 2CQOA 2MQHA 3MZ5A 3M4YA 1I6HH 1BCPF 2GA4B 5KEEA 1DOKA 1XXGA 3DWPA 4IURA 4AYBE 2V1CC 4F88A 2F4IA 1ZKOA 1OXXK 1SNMA 2P5ZX 4G7OC 4IUUA 3AB9A 2ZJPA 4K8IA 4IO9A 1Z7TA 3PO3B 1PVOA 2OXPA 4J8QA 1JMCA 4YWKA 4DNRB 3UI2A 2R7ZH 2NVXB 3A8KE 5IGEA 1GUWA 2QEJC 5ELFA 3SDZA 1B8AA 2NYZD 3GTMB 1CKMA 3S16B 1TS3A 2BE5C 3UDXA 1ASZA 2IL8A 2LSSA 2Q2UA 2EDGA 2YTVA 3R2IA 1UUPA 4K6DA 4LWCA 1I4XA 5C4XG 2L0CA 2I5LX 4PMCA 4KJNA 3J7YW 5LMNL 1TS2A 2HUGA 3S1RB 4QL5A 5EKKA 4JI4L 4DUYL 2Q8RE 4GKKQ 3S9WA 1GUSA 5BR8L 1RDPD 3T4AC 3GTLB 2CQAA 3FPUB 3N6RA 4IFDI 5COYA 2ZT9C 4EQOA 1G6PA 1TWCH 1RIPA 1X54A 3KDFB 4JBWA 4ZQ3A 3NSWA 3TREA 4EGVA 2VUMG 1CK1A 4IOCA 5TSSA 1WYDA 1SE4A 1G6ZA 3PO2H 1IBMQ 1QVFA 1D5MC 4OGQC 4NDXA 4GLVB 3PO3G 2BA1A 2HDMA 2VQEQ 4BBSB 4A3DH 4A3FG 3J7ZC 4KLKA 4TQUS 2KA7A 5NUCA 1YBYA 2N78A 1S5ED 1HCZA 1JQYD 2I07B 2JP1A 1LACA 4JVZA 4BWGB 2RHSB 4ILWA 4A3CH 5EAYA 2PZUA 1LTGD 4DV5L 1K8OA 5ELEA 2E2IH 2GVBA 5GROA 4HIOA 3TEHB 2E5LQ 1YI2A 4LF6Q 3I4NG 5M5YB 3CCUA 4GKJL 1JJGA 4HAEA 4B3RL 1F9RA 5IGCA 2Q8TA 4TRDA 1NBWA 3JC66 3RLFA 4HJ9A 1I50H 4C3IH 3E6ZX 1ZXTA 3K5MA 1SJHD 4JW0A 1DOMA 1KXLA 2EYLA 2JA9A 2AQ1B 4MTKA 4FO2A 5M5WB 5JEAJ 1VQNA 2ICEC 5CC4A 1WTQA 1MSGA 1I94L 5DM73 1VQPA 3CRKC 3HOWH 2F0PA 3I73A 1LT6D 1XJVA 2AWOA 1KRSA 4ODGA 5M5XB 1W6JA 1TS4A 2WV6D 3HOYH 2RCFA 4L8JA 2F0EA 1GUGA 3NP8A 2X6GA 1TT2A 4KV6A 3CMEA 4R8NA 2YU9H 4JI2L 3EFXD 4RHSA 2OWOA 1I94Q 3GTGH 4PG3A 4JI0Q 5E3FA 1GM5A 1BBXC 3HOUH 3CC7A 1WTOA 3BZKA 1HR0L 4DV3L 3CXCA 4P71A 4TSSA 1YNXA 3K58A 1JC7A 5AJ3Q 5LMUL 3RNUA 3QIAA 3P1HA 1BO0A 1C48A 2R92G 4K2KA 3IFTA 5I9PA 2VXWA 2FJ2A 4HSVA 1G8ZD 5IP9G 3HG9A 3CRLC 5IY0A 1ICWA 3SVMA 1YHBA 3UE1A 3VDYA 4AH6A 3HFZB 3MFYA 1Y8PB 5HY6A 4A3GH 2RCNA 3FKIG 1XPOA 1PH3A 5T1GA 4IUNA 4ZCKA 2NN6G 4KTAA 1HR0W 4JOIA 2B8GA 3SK5A 4KHVA 1QNUA 4HJAA 5E4XA 2BE5D 3MEFA 3LWEA 1VMPA 4FNFA 3IRBA 3S15B 4KK7A 3HOXG 1JOQA 1Y8NB 1R4QB 1HH2P 1TWHH 2K14A 4L5TA 2O4XA 5ELOA 4LF8Q 1I4QA 1U5KA 3A74A 2PQEA 3EIVA 2VQEL 5EBCA 4LMQD 1EY6A 3VYRA 1IBKL 1RD9D 2VS1A 4J1MA 2CW0C 2E76C 3MXUA 2H5XA 5I4DA 2ASBA 1PTOF 1VQ8A 5IP7G 3CF5A 5C44H 4N8X1 4FXDA 5FKAC 3T1YL 2KCMA 4L5SA 1DM0B 4C1NK 3GQBA 2A68D 1B1ZA 2IW3A 1JE5A 1LO5D 3K57A 1K9MC 2V4DA 5JEAG 1V43A 2WAQG 5JEAH 4DFAA 5HGQA 3F2DA 4HIMA 4AIMA 4L6TB 5ELNA 1KABA 1QZGA 1EOVA 1RTOA 4DR5Q 3PMFA 4HJ7A 2L4NA 1SEBD 1IW7D 4PMBA 4X65L 1JJ2A 1IBML 4MZ9A 2RDHA 3I70A 2A8VA 2QKIC 5I2XA 4JI6L 4BXXG 2PNRC 4OIJA 1M8AA 3PUWA 1F9QA 4K5XA 5IYDG 1EFWA 1XNRQ 4A3DB 4YCUA 2I46A 1Q46A 2FMMA 4N9PA 5DM63 4JG2A 3HOWG 1HA5A 1VQDA 3GTJH 1G2SA 1WCMG 1VQFA 4PNYA 4DXGA 5D14A 1BXTA 1ASYA 4JI7L 1IYVA 3FEWX 4MHEA 4HMIA 4OWWB 4AYBB 1QWYA 2XSCA 1RHPA 4IUVA 1G91A 4JBKA 2EYMA 3KYHC 2B63H 4A93H 4LK1C 3M85A 3IAYA 4NXML 3HRZC 2IHEA 2B2TA 1QJOA 2YTXA 1Y1WH 2NVQH 3Q22A 1ICFB 1I6VC 4AQYL 1DGSA 2KHIA 1BKBA 3OW7A 1LV9A 2MPMA 1YNNC 5F2DA 3NBHB 4A3LG 1X6OA 1KIXA 1XMOL 5KNDA 2Z6BA 3ZYYX 5FLXE 2RQXA 4JV5Q 3A8IE 4KD3A 2OCEA 4OO1H 1AZPA 3HOWB 3E9HA 1EIHA 5IWAL 2D9UA 1AH9A 4QCLA 1V1QA 2L5TA 3B6YA 3H09A 3RN2A 2VW9A 1J6QA 2A6HC 3EROA 1PRTF 1A0IA 1WD0A 1JWUD 2JA7H 3GO5A 3D6CA 1IBLQ 2PCFB 1HTLD 1SFOB 2Z4HA 4RCNA 5C4ZA 1JT8A 4IFDG 4OO1I 1PDQA 2H1EA 1H9JA 2D0OA 3ND9A 4RKBA 3E0JA 4LF8L 1CZGA 3PIP3 4A3KB 3OTOQ 1WVLA 1LTBD 2E2JB 3OIQA 4A4IA 1Q81C 2EVBA 1K0SA 2C5CA 2L1BA 4DNIA 3RZOH 2BDNA 4RMFA 5JVG3 3FHWA 4JI8L 2LMCB 3H94A 1WTVA 1CSQA 3FRPB 2HQLA 5FOBB 1RF2D 4FF4A 5BN5A 2JQOA 3DM1A 3M9BA 4QMGA 1N8RC 4CDFC 1E3PA 4JI2Q 3I56A 1EY8A 4DV0Q 3MVVA 4A3GB 3KLSA 2N55A 2R7FA 2LXJA 4LFBL 1RL2A 3W2DA 1NE3A 5IGGA 2QA4A 2UUBQ 2B2YC 3MXNB 4NMZA 3I4OA 2HD3A 3IKJA 4K5WA 1GUNA 4C2MH 1SN8A 3S15H 4HCEA 2L55A 4U68A 1TWHB 3AU7A 3J7AV 1FJGQ 4A3EH 1UE6A 2DNEA 3ONAB 1PH9A 1EWCA 2AMCB 3FKIB 3HOVH 3GTPB 1JE4A 1QUQA 4FDBA 1KDCA 1PFBA 3JAMc 4POGA 4BY7G 2N8NA 5IP7H 1EY9A 4DK1A 1IW7C 4JI8Q 2UXDQ 4O0AA 4X3UA 1D8LA 1PRTD 3NXWA 4JI3L 1GVPA 3GTKH 1S5DD 2E74C 4RGTA 2QDBA 1DZ1A 3MXNA 3T16A 4GZYC 2WP8J 5GAGC 2B63G 4A93G 4H02A 4PZ8A 2K4KA 1PYWD 2F0GA 1TIID 4DV7L 2DY7A 4X66Q 1WTPA 1ILQA 4R1JA 1H95A 4DN4M 1SE2A 2K5HA 4YHHL 1FL0A 3GDEA 5H1SE 5CV5A 5A2QL 3T1HL 3HOZB 2JSOA 4C3HH 1VQBA 2JN4A 2B2TC 2MP1A 4UHVA 1SNPA 5ELBA 4CJ1B 1PV4A 3U4VA 3C1EA 1STNA 1VQEA 1MIUA 3ULLA 1VQMA 1EEFD 4O1NA 3TRZA 1HZCA 2F0HA 5CV9A 2Z1CA 3Q8DA 4DV7Q 5JJZA 1C8CA 1EU4A 4ZRZA 1MKHA 3URYA 1E2WA 4LF4L 4LF7L 5LL6X 2A6HD 4C3JG 1AEXA 5EPJA 5C5MA 5GADC 4NXMQ 4DF7A 2B8FA 2WIIB 1NAPA 3TSSA 2FINB 1QB5D 3CQZH 1FNVA 2JYOA 4DV4Q 4DR5L 2YYZA 1GKHA 3MEHA 1YNJD 3W3AA 3CCLA 1MGSA 1R4PB 5KYLA 1V1OA 2RSOA 2F4VL 3EA6A 2B2WA 1SYCA 1MI2A 3OOCA 1N32L 4C1NI 3HOUG 1XNQQ 2F3WA 1ZYRD 1I3QB 1YVCA 4FYDA 3J81E 2KHSA 3KBXA 1LTRD 3CCJA 1B70B 3GTOH 2F03A 3X3MA 1OTCA 5FK9C 1OXSC 2NVYH 3PF5A 4IFDJ 3RD4A 3S1MB 3OWEB 2OTLA 2OT2A 1KHIA 3HOYG 3HKSA 1WJJA 3S2HH 3ULPA 1E2ZA 3G4SA 4X65Q 3PIOA 2PPBC 4K14A 4QIWB 3K0YA 1PH1A 2DGYA 1BBUA 2ZM6L 3I3CA 4QGUA 1YITA 3AMUA 1E1OA 4DK0A 4L5RC 2KCTA 1VDZA 5JJLA 1HFNA 1PFNA 2Y0SB 2VL6A 5C4XB 3I4MB 3MXPA 1Y69U 2JA8G 1DONA 2B2UC 4IQZA 5I2YA 4RKLA 4YCVA 2RDGA 2GVAA 2HQEA 2IT1A 4B3TQ 2MJ8A 3J80i 4H13C 3S1NH 2EOTA 4DR2L 4CDCC 3A5ZB 3I4NH 5JJIA 4CBVA 4RGMA 4DK3C 1QZHA 5GQOA 3DEPA 2VB3X 1I50B 1ESFA 3GTQB 3NTIA 2K5DA 1MBYA 4DR3L 2E5LL 2F0DA 1WI5A 1ET9A 3CU7A 4IPCA 1X3GA 4BY7H 5CV6A 4DV6Q 1VQJA 2D5DA 5JOBA 2JEAI 5IGFA 1N33Q 2EIFA 3BJUA 5DAUA 2KCCA 1NUCA 3PCOB 4GOPC 1UEBA 1SE8A 2RSNA 3Q6SA 3EBEA 1HXYD 4JV5L 2OTJA 4QF4A 1OXTA 5FLXL 1VQ5A 1PH7A 2IX3A 1UWVA 2E2HB 2Z9HA 4HN7A 5A2QE 4LAAA 1BNZA 4DR1L 3K59A 3DXJC 1UNSA 1SMYC 5IWAQ 2XWBB 2K75A 3Q23A 5C0XJ 5IYDH 3T13A 2QILA 4BA1I 3J81c 3K0XA 4XQQA 4HEDA 4R4QA 3HEJA 2ID0A 2NZHA 4UP8A 4JC0A 3HOXB 4BY1B 4IOAA 2G5DA 3BDCA 4GOPA 1SNCA 1TQOA 4JI5L 3NELA 1HZBA 4A3CG 2F0MA 5CMDA 2F0WA 5KGUA 3E0EA 1KQSA 3IFDA 2XN9C 3S2DH 4YWMA 4KKUA 1CQFA 3ZJYC 3S14H 1YNJC 4LF5L 4X6AH 2Z8LA 5A35A 2Q8IB 3OHXC 1ENAA 3WWVA 1MJEA 1Y1VB 2F0LA 2NVXH 3X3NA 3FDTA 1DJRD 5J3BA 3MAQA 2IHFA 1F9PA 4A75A 5J1ZA 3J81L 2PI2A 1KL9A 1PYBA 3GTMH 1II3A 3V05A 3PIO3 3R2TA 4RG1A 3D8GA 3QB3A 1LYLA 3ERQA 4DR7Q 4J6HA 2F0SA 3E9IA 4GS3A 5T1IA 3CMAA 1KLUD 5AFWA 2K6AA 3T51B 2RA4A 1QG7A 4EVOA 2R7ZG 2EQSA 5FO8B 4OL7A 1NTGA 5JVH3 2ZXPA 1A15A 1A3VA 1Q8IA 2K03A 4WJ4A 1A2UA 1QVGA 1TWFB 2N88A 3I8ZA 4HSPA 3OIPA 1S3OA 4DV5Q 1IBLL 3JAML 4L63B 1XNQL 1TWCB 1KRTA 4NXNQ 4H0LC 2L12A 1HA6A 1L0YB 4JYAQ 1Q86C 3AFPA 1XMOQ 1I3QH 2CVRA 3LNNA 4GNXB 4RFBA 1K73C 3TBIB 2EYHA 4BBSH 4HIDA 4EQ5A 3GTOB 1I5FA 1G291 4Y7NB 2F0QA 3SK8A 3I90A 4P74A 1CFMA 1Y14B 3OPOA 2CKZB 1I4HA 4OELB 1KNAA 4QY7A 1BF4A 2Y0SG 2AUKA 2VQFQ 4JYAL 2A69D 4XYOA 4ULLA 3KJPA 2ZJRA 3T1HQ 2L9HA 4OONA 2LKVA 1B3AA 4HCSA 3M7NA 2HCIA 3A54A 1D7QA 2Q2TA 2IX1A 3BVMA 5C4HA 2K05A 4YY3Q 4DV1Q 5M3FB 3KF6B 2ZTDA 1WTRA 1SSOA 4XT3B 2FFKB 2EYPA 5D3IB 3D31A 1B4OA 1J5EL 2PZWA 1BDOA 4CJ2C 2QW7A 1GJXA 1C9OA 3TDQA 1UEAB 4P2CB 1AFPA 1B9NA 1KC8C 3MWYW 1MSHA 3KF8A 1E1TA 4A3MH 5LMUQ 3GTQH 4IUQA 2D62A 4Q5VA 4X62L 4X3TA 3STBC 4DV3Q 4ZAIA 1EQTA 2EXDA 4B3MQ 1LTTD 2YU9B 1JJCB 1VQAA 2KJXA 1XMQL 1PZKD 3NTHA 3GTGB 4BBRB 4X64Q 5FLMG 1S5BD 3H91A 5IGDA 2KBNA 4HJ8A 3I4MG 3HP3A 4K2LA 3K7AH 1Z6HA 2IPKD 3PUVA 1SR3A 4BBSG 1E22A 1BOSA 5CV8A 2EY2A 1YJNA 2AKWB 3NQTA 3VR6A 2I5HA 2D2CC 2QCPX 1TR5A 2PI2E 1D1KA 1PMRA 2IX0A 2EJMA 4LF5Q 2J0TD 3G6JB 4ZUJA 2F0KA 2F52A 3R93A 3K5LA 4A3FH 1STGA 3W5OA 3RZDB 4NPSA 2E8GA 1SFOH 3J7AF 1PA6A 2ZTEA 3ND8A 4LFCL 4CKCA 3PO2G 1TWAH 3PUZA 4X64L 1PTOC 2OF1A 3FPPA 4APVA 4KN7C 3S17H 2NTTA 1EIFA 2UXCL 4BY1H 2K5NA 3RZOB 4DA2A 4BBRG 4GOPB 1T5XD 4I7AA 2JA7G 3SEBA 4N8FA 1K8AC 3BYYB 2XWJB 3RLNA 2WINB 2B2VC 2DUDA 5C3XA 1XMQQ 3NQIA 1EL0A 4B3RQ 1GO3E 3N52A 4K6LA 4DV6L 1LT3D 5IT9E 2KCNA 3C3LA 4C3JH 1GOZA 1L1OA 1LTLA 2VZAA 1PFSA 1WFQA 4RAUC 5M3MG 2BH2A 4KY6A 1Y1VH 2TSSA 1VMCA 5C6AA 3C46A 3QR8A 1CKOA 1X65A 3MFGA 3TZUA 4UDUC 3VR4A 2MUYA 4DAVA 4DR3Q 1DD2A 1M90C 4LFAL 1TU2B 1CKNB 1N32Q 3KLWA 1CA5A 2ZJQA 3BVGA 3I2ZA 3OTOL 3E3XA 2K04A 5FLMH 5CR3A 4KMUC 3CPFA 2EZVA 1DXMA 2JA6H 4DU9A 4A3EB 2IY5B 3OMGA 1JOKA 5K5PA 4RGNA 1NY4A 2EYJA 2SDFA 1ENCA 2A6ED 2FHTA 3R3OA 3DEOA 4NKLA 2UUAL 1TS5A 1SYGA 2CWAA 4XIGS 4DGZA 3SXHA 3H0GB 5IOCA 1YJ9A 5IGBA 1H9MA 3H0GG 1HNXL 1O7IA 1HUNA 5BN4A 4OX9L 1QVCA 1TXYA 3U58A 1IL2A 4OHJA 2RDFA 1DYQA 5J39A 4IZ8A 4NW2A 4DAYA 1WTHA 1STAA 3G7LA 3W1GA 1JOOA 1JICA 2EJFC 3UDIA 5DLQE 4A3LH 4A3EG 2F0FA 2XRQD 1NMFA 3S24A 5C4JH 3F2UA 3Q0AA 1TWGB 1DCZA 5D3DA 1SNOA 2F3VA 1UE7A 2XNAC 3NBHA 2F0UA 1VQ6A 5KRUA 1EYGA 1STEA 4CKBA 2HT1A 3T53B 2KVMA 3F8TA 3U9SA 3D4WA 2R7ZB 2NTSA 1WCMH 3A0JA 4FXGC 2R92B 3RMHA 4JI7Q 5D65A 4I65A 3KLSX 2CCZA 4DR7L 4DUZQ 1LABA 3BU2A 1SDFA 1B7YB 1OO9B 3KBGA 5G3LD 5M5YH 4A3IH 3S1QB 1I4PA 2RKSA 4GN4B 5FO7B 4A3MG 4K8JA 1CQVA 3TN2A 4EX5A 5K36H 4LF9L 3A55A 2B29A 4A3GG 4IPDA 4PZ6A 2RBMA 4KHZA 1EYDA 1KLGD 3VR5A 5LMNW 4A3JH 3G71A 3LGJA 4M8AA 1XTCD 2SOBA 5M5WH 1PTOD 1K3BC 1AZQA 2VUMB 4KHPQ 1STHA 1SNDA 3PO2B 1EZ8A 1E0BA 4CKEA 3H15A 2UUCL 1SYEA 4BBRH 4KKTA 3KLRA 4LF7Q 3VYSA 3HOYB 1HQMC 1PH4A 4A3KH 2DN8A 3S1MH 1B53A 2JJQA 1QCBD 2JA8B 1WD1A 2B2VA 4PMWA 3C2PA 2VY3A 1B50A 5IT9L 5CGKA 1YHQA 1IYUA 1X3EA 4F8MA 3RZDH 2NWGA 4FF1A 1SJED 4Q0FA 4LFAQ 2UXCQ 3M4OB 1L0XB 4X66L 1XWEA 4DR4Q 1TWAB 1EUJA 1JB3A 2SNMA 4RCOA 4K0KL 4KD4A 4Z9CB 2JA5G 3MA2B 4XDXA 2E75C 5E4WC 4WJWA 3I7FA 1U4MA 3CD6A 2MO1A 1SBBB 1CUKA 2OQ0A 2EJGC 3PV0A 4U673 2BDOA 1O78A 2XIWA 3AEVA 3M4QA 4RGOS 2QDLA 3NWSA 1H9RA 2H4OA 1SE3A 1O7LA 5M5XH 2MNAA 1PTOH 2K01A 5M3MH 4WORA 2CW0D 3H3VH 5EKLA 4KKSA 1PYSB 1D5ZC 4E6IA 1HNZQ 3J81j 3OSOA 2ENBA 1FYCA 4DAPA 5KNCA 5IYCG 3MTSA 1TY2A 2C35B 2WFWA 3F2CA 2FMCA 3HKZE 2WKDA 1AN8A 1S4ZA 3NENA 1HZ9A 1HNWQ 3EQLC 1X55A 4H7BA 4DKAC 2A6EC 2A5HA 2X6LA 4HMJA 1K8GA 1KDBA 3FP9A 2IJ0A 4OEMB 1NMGA 4V190 2XRSD 1EY7A 2NBFA 1S5FD 2QEXA 2A68C 4IUTA 1Z47A 4FVMA 1EY0A 1BVSA 2B2WC 1BUVT 4DAYB 1PXUA 4BA2I 4CDDC 2WAQB 4QUFA 4B08A 2Y0SE 2XTIA 3A7AB 1QNKA 1UE5A 4GN5A 4M1UB 1HQRD 3W1BA 1HNZL 1A63A 1ET6A 3GD7A 2F4VQ 1F2YA 4ZKCB 3TQYA 2K33A 5IT9c 1CTMA 1TWGH 2Q2IA 5L37A 1PH8A 2CH4A 1VQ7A 2CH4W 5BR8Q 1X3FA 4G7HC 2B2YA 1B3QA 3V96A 1YZ6A 4DNTB 5IP9H 1Y1VG 1I6HB 5JPNC 5C3WA 4DUYQ 4ME3A 3C1FA 2VQFL 2NN6H 3I55A 1VQ4A 2AQ2B 1V1PB 2KEDA 2R92H 3D6WA 3HGBA 4PQXA 1Q12A 1FVIA 1B44D 4JBMA 2DY8A 5EQ0A 3PO3H 5CBEE 1AW7A 1N9WA 3FVQA 1W3SA 1TKWB 3S1QH 5CV7A 4POFA 2YTYA 1KD1C 3K8AA 3CCSA 2PW7A 2SNSA 5LMNQ 1P16A 3TP5A 4BY1G 1GHKA 4A76A 4R9WA 3TP6A 1Q1BA 1WOCA 4GNXA 1RJTA 3BZCA 4HIKA 3UDGA 1HPCA 3CHBD 4MTNA 3PSIA 3S2HB 1K83H 2VUMH 4F7XA 5CORA 4FXKC 1CHQD 4RA8A 3S1RH 1KTKA 2OQKA 5FJ8G 2ZXOA 3A8JE 4NXNL 3SK6A 4DR6Q 1HRJA 1GUOA 3VA5A 3CCEA 4LW1A 5ISRA 1F9SA 2A19A 2JA8H 1IZ6A 2QGQA 2TMPA 5IYBH 1XPUA 2FXQA 1IYJB 1GUTA 4A3BB 5IYCH 2J7ZA 2ICIA 3S1NB 2AWNA 3RN5A 2KOLA 3ER0A 1Y1WB 2NVQB 5E7NA 1HNWL 4P72A 3T56B 2WB1G 1YNND 5M3FH 3QG1A 1HNXQ 4LFBQ 5G3LF 2BCOA 3NHHA 4PZ7A 3VA7A 5IYBG 1T9HA 5LHY1 3KK7A 5CV4A 2PMZB 1O7ZA 3BG3A 1Q90A 3J80c 3NUCA 5C0XH 5FJ8H 1ZEQX 4KY7A 5E1FA 4EQPA 2Z0SA 1XPRA 2K32A 3F1ZA 2LY7A 3QOJA 4IN3A 3KJOA 4C3IB 5JAVA 2IWHA 1PTOB 1HFGA 3NEMA 2K1BA 5I6WA 2NVTB 2JXMB 4GN3B 4DK6C 3KDFA 2JEBI 3K7UC 2Z6KC 3HZXA 2NB0A 2MGSA 1SXTA 3M3YB 1H9SB 3RR5A 2K5QA 4C2MB 1HUMA 2BA0A 1A3UA 3OW2A 1VQCA 2L11A 2LFNA 2NZOA 2G9DA 1C4QA 3CAMA 4A3KG 1Q1EA 4DR2Q 3DWAA 1M1KC 4DR1Q 2PNHA 4UAIA 1EQRA 1ENFA 3AYHB 4QJFA 3M7GA 2KEEA 1JWMD 1EWHA 1U4PA 2JK8A 1STYA 1SYBA 3HKZB 1SMXA 1HR0Q 1X32A 3EN2A 2DJGC 5C5LA 2HDLA 3NPPA 4B9WA 4C3HG 4Y52H 4OWXB 4LJZC 4DAMA 3F2BA 4K0KQ 4JI1L 3ITPA 1LT5D 4QIWE 5M3FG 1XYIA 3HOUB 3J80E 2F0NA 3DUZA 2PZTA 2JA5B 3S2DB 4BS9A 5C3EH 1MD2D 1D1IA 1VQIA 2UU9Q 4L5QA 3JAME 1C7YA 5IE8A 1NCVA 1HTPA 2MHVA 4KN4C 1ML0D 3ERSX 2WAQE 3K80C 2WKCA 4ME5A 2PYKA 4CDEC 2A73B 5HGTA 3QOLA 5EGTA 4JI0L 1FR3A 3QO2A 4EQNA 4YY3L 3CP0A 2EE1A 4UP7A 1SMYD 1GD7A 2AHOB 4IFDH 4UPAA 3SGIA 2WB1E 3BYTB 3HOVG 4C3JB 2I0QA 3FKIH 3GTPH 3HOVB 4HJ5A 2HHHQ 1QUQB 1FGUA 1V1PA 5EPKA 2RHQB 1WTWA 1EWIA 1DOLA 3WOEA 4B9XA 3EVQA
chains in the Genus database with same CATH topology
1KAWA 5H1SE 1OXXK 3T1HL 3S16H 4C3HH 3DM3A 1VQBA 1YJ9A 2ATWA 3H0GG 1HNXL 1O7IA 2ZJPA 1S72A 4OX9L 4IO9A 1QVCA 1TXYA 3U58A 1IL2A 4YCWA 1PV4A 3U4VA 1PVOA 1XNRL 4DUZL 3L0OA 1VQEA 2B63G 1MIUA 3ULLA 1VQMA 1JMCA 1Q7YC 4QQBX 4YWKA 2R7ZH 3TRZA 1HZCA 3Q8DA 4DV7Q 4DV1L 1MKHA 3W1GA 4LF4L 1Q8KA 4LF7L 3UDIA 5DLQE 4A3LH 4A3EG 1B8AA 1CKMA 3GTLH 3HOZH 2UXBL 3UDXA 1ASZA 3U50C 2R7DA 1NMFA 2LSSA 4R4IA 3S24A 1YHAA 5GADC 5C4JH 1PH5A 2Q2UA 4B3SQ 1N36Q 2YTVA 4NXMQ 3ICEA 1VQ6A 1EQQA 1UE7A 1EYGA 4LWCA 4DR6L 3CQZH 5C4XG 4IPHA 2HT1A 1E24A 4R4TA 2I5LX 3F8TA 4DV4Q 2YYZA 4DR5L 1GKHA 4LUZA 5LMNL 4QL5A 3CCLA 2ES2A 1L0WA 4OX9Q 1WCMH 4JI4L 3A0JA 4WJ3M 4DUYL 4GKKQ 1VQOA 4GKJQ 5BR8L 1VQ9A 4JI7Q 4XTCS 4IFDI 4B3ML 2CCZA 4DR7L 4DUZQ 2F4VL 1G6PA 1TWCH 1RIPA 1X54A 3BU2A 3KDFB 4JBWA 3TREA 2VUMG 1N32L 1B7YB 3HOUG 1XNQQ 3J7A5 4IOCA 1WYDA 2R93H 2ALYB 2XGTA 5M5YH 4A3IH 4OWTB 1IBMQ 2PQAB 1YVCA 1QVFA 4GLVB 3PO2H 3PO3G 2BA1A 4GN4B 2VQEQ 4A3MG 4A3DH 1W2BA 4A3FG 3J7ZC 4EX5A 3CCJA 4KLKA 4TQUS 2UUAQ 1B70B 3GTOH 4LF9L 2N78A 1YBYA 2B29A 1OTCA 3HOZG 4A3GG 1OXSC 4A3BG 4IPDA 4PZ6A 2NVYH 2Z6KA 3A5UA 4KHZA 3PF5A 4IFDJ 4R4CA 5LMNW 2OTLA 2RHSB 4A3JH 1S40A 4A3CH 3G71A 1KHIA 5EAYA 3LGJA 4DV5L 3HOYG 3HKSA 2E2IH 1WJJA 3S2HH 2GVBA 5GROA 4HIOA 3TEHB 5M5WH 3G4SA 3ULPA 4X65Q 3PIOA 4JI1Q 1YI2A 1N36L 2E5LQ 4LF6Q 4JI3Q 4KHPQ 3I4NG 2K52A 3CCUA 4GKKL 4GKJL 1OXVA 1JJGA 1PH1A 4B3RL 3H15A 3G6EA 4BBRH 1AE2A 2UUCL 2DGYA 1BBUA 2ZM6L 4QGUA 3PUYA 3ULJA 1NJIC 4LF7Q 1NBWA 3GTPH 1YITA 1Y1WG 3JC66 3RLFA 1BBWA 4HJ9A 1E1OA 1I50H 4L5RC 2KCTA 3PF4A 4C3IH 2BH8A 5JJLA 1PH4A 4A3KH 1P8LA 3S1MH 1L1OB 5FLXc 2VL6A 2JJQA 2NVTH 1KXLA 4TVAB 4YHHQ 4PMWA 2JA8G 2JA9A 4A3JG 2VY3A 4YCVA 2GVAA 2IT1A 4B3TQ 1YHQA 5JEAJ 1X3EA 2YV5A 3J80i 1EIYB 1VQNA 3RZDH 1I94L 5AJ3L 3S1NH 2CFMA 4LFAQ 4DR2L 2UXCQ 2I5MX 4X66L 3AFQA 3A5ZB 1VQPA 3I4NH 2RF4A 3HOWH 5JJIA 2JE6I 4DR4Q 4DK3C 5C44G 1EUJA 2D0PA 1XJVA 1QZHA 2AWOA 1SRUA 1KRSA 5GQOA 2JA5G 4K0KL 3HOYH 2UUBL 4DR3L 2E5LL 3I7FA 1WI5A 3CD6A 4IPCA 3I4MH 2MO1A 1MJCA 1X3GA 4DV2L 3KOJA 1VQJA 3CMEA 4DV6Q 1CUKA 4BY7H 2MO0A 2OQ0A 3PV0A 4GLAC 2YU9H 2JEAI 1N33Q 3AEVA 3M4QA 2EIFA 3BJUA 4JI2L 3PCOB 4O2DA 2OWOA 3M4OH 4GOPC 1I94Q 1YJWA 3GTGH 1UEBA 4PG3A 4JI0Q 1SE8A 1GM5A 3HOUH 3CC7A 5M5XH 4BXXH 3BZKA 3EBEA 1HR0L 2MNAA 4UP9A 4JV5L 4DV3L 1FJGL 2CWAA 3CXCA 4P71A 2JA5H 1OXTA 2OTJA 1YNXA 1PH7A 1VQ5A 1UWVA 1CKNA 4IPGA 5AJ3Q 5M3MH 5GAEC 5LMUL 4DR1L 3H3VH 3RNUA 1PYSB 5IWAQ 2R92G 2K75A 5C0XJ 1VS0A 1HNZQ 4OO1G 5IYDH 3J81j 4P73A 3KF6A 5IYCG 4P75A 4DV0L 2L15A 5IP9G 2C35B 2WFWA 3F2CA 4BA1I 5IY0A 1JB7A 3J81c 4MNOA 3K0XA 4AYBG 1YHBA 2NN6I 3HKZE 3UE1A 3VDYA 1N34Q 1PH2A 4AH6A 1HJPA 3CPWA 3HFZB 3NENA 4JI6Q 1HZ9A 4R4QA 1HNWQ 2ID0A 5HY6A 2NZHA 4A3GH 2RCNA 4UP8A 1X55A 3FKIG 2ZTCA 3UE0A 1XPOA 1PH3A 4JC0A 4X62Q 1CSPA 5K36G 2NN6G 1HR0W 4IOAA 4DKAC 4JOIA 2A1AA 3JAMi 4JBJA 4GOPA 1A8VA 4A3IG 1K8GA 4HJAA 3FP9A 3MEFA 4JI5L 2R93G 3NELA 1HZBA 4A3CG 1NMGA 3IRBA 3E0EA 2Q2HA 1KQSA 3HOXG 1J5EQ 1YEZA 3H0GH 1HH2P 1A62A 1TWHH 2JA6G 2QEXA 2K14A 4L5TA 5ELOA 4YWMA 3S2DH 1Z47A 3DLLA 1YIJA 3ZJYC 4LF8Q 3PGZA 3S14H 1BVSA 3CC4A 1U5KA 4J15A 4LF5L 4X6AH 3A74A 3EIVA 2VQEL 4DAYB 4BA2I 1L2FA 3WWVA 1IBKL 1MJEA 2Y0SE 2XTIA 2VS1A 4GN5A 1UE5A 2NVXH 5J3BA 3W1BA 1TWFH 1Q82C 2H5XA 2IHFA 1HNZL 2ASBA 4A75A 1A63A 1X56A 1L1OC 1VQ8A 2PI2A 3GD7A 1KL9A 1PYBA 5IP7G 3CF5A 5C44H 4UY8C 2F4VQ 3GTMH 4DV4L 4RG1A 3T1YL 2KCMA 4L5SA 3TQYA 1LYLA 3L7ZC 5IT9c 1TWGH 2Q2IA 4DR7Q 3E9IA 4GS3A 1PH8A 1VQ7A 3CMAA 1LM0A 1JE5A 5BR8Q 3PUXA 1K9MC 1X3FA 2R7ZG 2EQSA 2KENA 1NTGA 5JEAG 1V43A 2WAQG 5IP9H 1YZ6A 4LF9Q 1Y1VG 5HGQA 4WJ4A 4DUYQ 1QVGA 4ME3A 3F2DA 4HIMA 4AIMA 2VQFL 4KHPL 3I55A 1VQ4A 5ELNA 1N33L 2R92H 3AQQA 1QZGA 1VQKA 1S3OA 1UE1A 2UUCQ 1EOVA 4JCVE 4DV5Q 4DR5Q 1IBLL 1Q12A 1FVIA 1XNQL 4JBMA 4HJ7A 1KRTA 4A3DG 4X65L 4AQYQ 4NXNQ 4B3SL 1JJ2A 4IJHA 1IBML 3PO3H 4MZ9A 1N9WA 3L2PA 1Q86C 4JI4Q 4JYAQ 3AFPA 3OYYA 4LUOA 2A8VA 2F3IA 4JI6L 1W3SA 4BXXG 1IXRA 1XMOQ 1I3QH 4GNXB 3S1QH 4POFA 1K73C 2YTYA 3PUWA 1KD1C 1XNRQ 5IYDG 3K8AA 1EFWA 3CCSA 4BBSH 4YCUA 4HIDA 1Q46A 3CCQA 5LMNQ 1K0RA 1P16A 4EQ5A 1I5FA 4BY1G 1G291 4A76A 3HKZG 4JG2A 4DPGA 4ALPA 3HOWG 1Q1BA 3GTJH 1VQDA 3KFUA 1WCMG 1VQFA 1WOCA 4P74A 4GNXA 1ASYA 1VQGA 4JI7L 2UXBQ 1Y14B 3BZCA 4HIKA 3U4ZA 3UDGA 2HHHL 2CKZB 4MTNA 4OWWB 4QY7A 2Y0SG 3PSIA 1K83H 2VQFQ 2VUMH 4JYAL 3KJPA 2ZJRA 4JBKA 3KYHC 2B63H 4A93H 3M85A 3T1HQ 4NXML 3S1RH 2IHEA 4OONA 2OQKA 1Y1WH 2YTXA 2NVQH 3M7NA 5FJ8G 4NXNL 1DGSA 2KHIA 4Y7NH 3CCVA 4AQYL 4DR6Q 1BKBA 1D7QA 2Q2TA 2IX1A 4A3LG 3NBHB 5C3EG 4YY3Q 4DV1Q 3CCEA 1X6OA 4LW1A 4JI5Q 3KF6B 2ZTDA 1KIXA 1XMOL 2A19A 4LUVA 2JA8H 1IZ6A 2QGQA 5IYBH 3D31A 1XPUA 2FXQA 1IYJB 4JV5Q 2VNUD 1HZAA 1J5EL 3T1YQ 5IYCH 4LF4Q 2OCEA 2AWNA 1C9OA 3RN5A 1PH6A 1SROA 3ER0A 3E9HA 1KC8C 5IWAL 3H3VI 4XIGS 1AH9A 5E7NA 1HNWL 1V1QA 1E1TA 2HIXA 3B6YA 4P72A 3RLOA 4A3MH 5LMUQ 4GNXC 3GTQH 2WB1G 2D62A 1VQHA 4X62L 1J6QA 2VW9A 5M3FH 4DV2Q 3RN2A 3STBC 2E2JH 1HNXQ 4LFBQ 4DV3Q 4PZ7A 5IYBG 1A0IA 1AE3A 2EXDA 4B3MQ 1T9HA 2UU9L 2JA7H 3GO5A 4LNQA 1JJCB 1IBLQ 4A3BH 4A93G 1C0AA 3J80c 1VQAA 5GAHC 3CW2C 1XMQL 1IBKQ 4DR4L 5FJ8H 2B3GA 1JT8A 4X64Q 5FLMG 4IFDG 4OO1I 2Z0SA 2D0OA 2KBNA 2LXKA 4HJ8A 3K7AH 3I4MG 4LF8L 1XPRA 2UXDL 3PUVA 1K3RA 1SR3A 3F1ZA 3KJOA 4BBSG 1E22A 4LF6L 3KF8B 3OTOQ 3NEMA 4OXPA 1YJNA 2AKWB 4KI0A 2I5HA 5C4XH 4A4IA 1G51A 1Q81C 2PI2E 4GN3B 4DNIA 3RZOH 2IX0A 4DK6C 4LF5Q 3KDFA 4RMFA 1N34L 2JEBI 2F52A 4A3FH 3FHWA 3K7UC 4JI8L 2PMZE 2Z6KC 3W5OA 1CSQA 4NPSA 2E8GA 1SFOH 2HQLA 2ZTEA 1PA6A 4LFCL 3PO2G 1TWAH 3RR5A 2BA0A 3PUZA 4X64L 2JQOA 2KHJA 4YWLA 2GN5A 1X9NA 4JOIC 3M9BA 3OW2A 1VQCA 3D0FA 4APVA 1PHJA 2NZOA 1N8RC 3CC2A 1E3PA 4JI2Q 3CAMA 3I56A 4A3KG 3S17H 1EIFA 1Q1EA 2MFIA 4DV0Q 2K50A 4DR1Q 2PNHA 4DR2Q 1M1KC 2UXCL 1EQRA 2R7FA 3AYHB 4QJFA 2LXJA 4BY1H 2K5NA 2JK8A 4LFBL 1R9TH 1RL2A 5JJKA 3UDFA 4BBRG 3CCRA 4GOPB 1SMXA 3PIPA 1NE3A 3STBD 1HR0Q 2QA4A 3EN2A 2UUBQ 3MXNB 2JA7G 1K8AC 3I4OA 4B3TL 3M3YH 4OWXB 4Y52H 4DAMA 3F2BA 4K0KQ 4JI1L 3TS2A 4IJLA 3RLNA 4C2MH 2DUDA 1XMQQ 1U0LA 3J81i 1SN8A 4QIWE 5M3FG 3S15H 4B3RQ 2CWPA 1GO3E 3M4PA 3K81C 5C3EH 4DV6L 1VQLA 2E2HH 1Z9FA 3TS0A 1FJGQ 1VQIA 4C3JH 4A3EH 2UU9Q 1L1OA 1LTLA 1UE6A 2VZAA 2AMCB 4L5QA 5IE8A 1PH9A 1C7YA 1PFSA 1WFQA 3HOVH 3G48A 1QUQA 1LUZA 4FDBA 5M3MG 2BH2A 3JAMc 5C0XI 1Y1VH 4POGA 4BY7G 2N8NA 1XTDA 3ERSX 5IP7H 1CKOA 2WAQE 1X65A 3K80C 2N3SA 2ZM6Q 1SLJA 4DR3Q 4NB3A 4JI8Q 1M90C 4R4OA 4LFAL 2UXDQ 1CKNB 1N32Q 3KLWA 2ZJQA 4JI0L 4LFCQ 4O0AA 3I2ZA 3OTOL 4YY3L 3CP0A 1D8LA 4UP7A 1GVPA 2AHOB 1GD7A 1VCIA 2PQAA 4JI3L 5FLMH 3GTKH 4UPAA 3SGIA 2WB1E 5C0XG 3CPFA 2JA6H 2IY5B 3HOVG 2HIVA 1V9PA 2I0QA 2K5VA 2WP8J 3FKIH 5GAGC 3HOXH 1NY4A 1OXUA 4H02A 2K4KA 4PZ8A 4HJ5A 4GLXA 2R6GA 3CCMA 1E7ZA 2N49A 2CQOA 2MQHA 2HHHQ 1QUQB 1I6HH 4DV7L 4X66Q 1FGUA 4R1JA 2RHQB 1H95A 1EWIA 2UUAL 4AYBE 2K5HA 4YHHL 1FL0A 2V1CC 3GDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAW A;  5H1S E;  1OXX K;  3T1H L;  3S16 H;  4C3H H;  3DM3 A;  1VQB A;  1YJ9 A;  2ATW A;  3H0G G;  1HNX L;  1O7I A;  2ZJP A;  1S72 A;  4OX9 L;  4IO9 A;  1QVC A;  1TXY A;  3U58 A;  1IL2 A;  4YCW A;  1PV4 A;  3U4V A;  1PVO A;  1XNR L;  4DUZ L;  3L0O A;  1VQE A;  2B63 G;  1MIU A;  3ULL A;  1VQM A;  1JMC A;  1Q7Y C;  4QQB X;  4YWK A;  2R7Z H;  3TRZ A;  1HZC A;  3Q8D A;  4DV7 Q;  4DV1 L;  1MKH A;  3W1G A;  4LF4 L;  1Q8K A;  4LF7 L;  3UDI A;  5DLQ E;  4A3L H;  4A3E G;  1B8A A;  1CKM A;  3GTL H;  3HOZ H;  2UXB L;  3UDX A;  1ASZ A;  3U50 C;  2R7D A;  1NMF A;  2LSS A;  4R4I A;  3S24 A;  1YHA A;  5GAD C;  5C4J H;  1PH5 A;  2Q2U A;  4B3S Q;  1N36 Q;  2YTV A;  4NXM Q;  3ICE A;  1VQ6 A;  1EQQ A;  1UE7 A;  1EYG A;  4LWC A;  4DR6 L;  3CQZ H;  5C4X G;  4IPH A;  2HT1 A;  1E24 A;  4R4T A;  2I5L X;  3F8T A;  4DV4 Q;  2YYZ A;  4DR5 L;  1GKH A;  4LUZ A;  5LMN L;  4QL5 A;  3CCL A;  2ES2 A;  1L0W A;  4OX9 Q;  1WCM H;  4JI4 L;  3A0J A;  4WJ3 M;  4DUY L;  4GKK Q;  1VQO A;  4GKJ Q;  5BR8 L;  1VQ9 A;  4JI7 Q;  4XTC S;  4IFD I;  4B3M L;  2CCZ A;  4DR7 L;  4DUZ Q;  2F4V L;  1G6P A;  1TWC H;  1RIP A;  1X54 A;  3BU2 A;  3KDF B;  4JBW A;  3TRE A;  2VUM G;  1N32 L;  1B7Y B;  3HOU G;  1XNQ Q;  3J7A 5;  4IOC A;  1WYD A;  2R93 H;  2ALY B;  2XGT A;  5M5Y H;  4A3I H;  4OWT B;  1IBM Q;  2PQA B;  1YVC A;  1QVF A;  4GLV B;  3PO2 H;  3PO3 G;  2BA1 A;  4GN4 B;  2VQE Q;  4A3M G;  4A3D H;  1W2B A;  4A3F G;  3J7Z C;  4EX5 A;  3CCJ A;  4KLK A;  4TQU S;  2UUA Q;  1B70 B;  3GTO H;  4LF9 L;  2N78 A;  1YBY A;  2B29 A;  1OTC A;  3HOZ G;  4A3G G;  1OXS C;  4A3B G;  4IPD A;  4PZ6 A;  2NVY H;  2Z6K A;  3A5U A;  4KHZ A;  3PF5 A;  4IFD J;  4R4C A;  5LMN W;  2OTL A;  2RHS B;  4A3J H;  1S40 A;  4A3C H;  3G71 A;  1KHI A;  5EAY A;  3LGJ A;  4DV5 L;  3HOY G;  3HKS A;  2E2I H;  1WJJ A;  3S2H H;  2GVB A;  5GRO A;  4HIO A;  3TEH B;  5M5W H;  3G4S A;  3ULP A;  4X65 Q;  3PIO A;  4JI1 Q;  1YI2 A;  1N36 L;  2E5L Q;  4LF6 Q;  4JI3 Q;  4KHP Q;  3I4N G;  2K52 A;  3CCU A;  4GKK L;  4GKJ L;  1OXV A;  1JJG A;  1PH1 A;  4B3R L;  3H15 A;  3G6E A;  4BBR H;  1AE2 A;  2UUC L;  2DGY A;  1BBU A;  2ZM6 L;  4QGU A;  3PUY A;  3ULJ A;  1NJI C;  4LF7 Q;  1NBW A;  3GTP H;  1YIT A;  1Y1W G;  3JC6 6;  3RLF A;  1BBW A;  4HJ9 A;  1E1O A;  1I50 H;  4L5R C;  2KCT A;  3PF4 A;  4C3I H;  2BH8 A;  5JJL A;  1PH4 A;  4A3K H;  1P8L A;  3S1M H;  1L1O B;  5FLX c;  2VL6 A;  2JJQ A;  2NVT H;  1KXL A;  4TVA B;  4YHH Q;  4PMW A;  2JA8 G;  2JA9 A;  4A3J G;  2VY3 A;  4YCV A;  2GVA A;  2IT1 A;  4B3T Q;  1YHQ A;  5JEA J;  1X3E A;  2YV5 A;  3J80 i;  1EIY B;  1VQN A;  3RZD H;  1I94 L;  5AJ3 L;  3S1N H;  2CFM A;  4LFA Q;  4DR2 L;  2UXC Q;  2I5M X;  4X66 L;  3AFQ A;  3A5Z B;  1VQP A;  3I4N H;  2RF4 A;  3HOW H;  5JJI A;  2JE6 I;  4DR4 Q;  4DK3 C;  5C44 G;  1EUJ A;  2D0P A;  1XJV A;  1QZH A;  2AWO A;  1SRU A;  1KRS A;  5GQO A;  2JA5 G;  4K0K L;  3HOY H;  2UUB L;  4DR3 L;  2E5L L;  3I7F A;  1WI5 A;  3CD6 A;  4IPC A;  3I4M H;  2MO1 A;  1MJC A;  1X3G A;  4DV2 L;  3KOJ A;  1VQJ A;  3CME A;  4DV6 Q;  1CUK A;  4BY7 H;  2MO0 A;  2OQ0 A;  3PV0 A;  4GLA C;  2YU9 H;  2JEA I;  1N33 Q;  3AEV A;  3M4Q A;  2EIF A;  3BJU A;  4JI2 L;  3PCO B;  4O2D A;  2OWO A;  3M4O H;  4GOP C;  1I94 Q;  1YJW A;  3GTG H;  1UEB A;  4PG3 A;  4JI0 Q;  1SE8 A;  1GM5 A;  3HOU H;  3CC7 A;  5M5X H;  4BXX H;  3BZK A;  3EBE A;  1HR0 L;  2MNA A;  4UP9 A;  4JV5 L;  4DV3 L;  1FJG L;  2CWA A;  3CXC A;  4P71 A;  2JA5 H;  1OXT A;  2OTJ A;  1YNX A;  1PH7 A;  1VQ5 A;  1UWV A;  1CKN A;  4IPG A;  5AJ3 Q;  5M3M H;  5GAE C;  5LMU L;  4DR1 L;  3H3V H;  3RNU A;  1PYS B;  5IWA Q;  2R92 G;  2K75 A;  5C0X J;  1VS0 A;  1HNZ Q;  4OO1 G;  5IYD H;  3J81 j;  4P73 A;  3KF6 A;  5IYC G;  4P75 A;  4DV0 L;  2L15 A;  5IP9 G;  2C35 B;  2WFW A;  3F2C A;  4BA1 I;  5IY0 A;  1JB7 A;  3J81 c;  4MNO A;  3K0X A;  4AYB G;  1YHB A;  2NN6 I;  3HKZ E;  3UE1 A;  3VDY A;  1N34 Q;  1PH2 A;  4AH6 A;  1HJP A;  3CPW A;  3HFZ B;  3NEN A;  4JI6 Q;  1HZ9 A;  4R4Q A;  1HNW Q;  2ID0 A;  5HY6 A;  2NZH A;  4A3G H;  2RCN A;  4UP8 A;  1X55 A;  3FKI G;  2ZTC A;  3UE0 A;  1XPO A;  1PH3 A;  4JC0 A;  4X62 Q;  1CSP A;  5K36 G;  2NN6 G;  1HR0 W;  4IOA A;  4DKA C;  4JOI A;  2A1A A;  3JAM i;  4JBJ A;  4GOP A;  1A8V A;  4A3I G;  1K8G A;  4HJA A;  3FP9 A;  3MEF A;  4JI5 L;  2R93 G;  3NEL A;  1HZB A;  4A3C G;  1NMG A;  3IRB A;  3E0E A;  2Q2H A;  1KQS A;  3HOX G;  1J5E Q;  1YEZ A;  3H0G H;  1HH2 P;  1A62 A;  1TWH H;  2JA6 G;  2QEX A;  2K14 A;  4L5T A;  5ELO A;  4YWM A;  3S2D H;  1Z47 A;  3DLL A;  1YIJ A;  3ZJY C;  4LF8 Q;  3PGZ A;  3S14 H;  1BVS A;  3CC4 A;  1U5K A;  4J15 A;  4LF5 L;  4X6A H;  3A74 A;  3EIV A;  2VQE L;  4DAY B;  4BA2 I;  1L2F A;  3WWV A;  1IBK L;  1MJE A;  2Y0S E;  2XTI A;  2VS1 A;  4GN5 A;  1UE5 A;  2NVX H;  5J3B A;  3W1B A;  1TWF H;  1Q82 C;  2H5X A;  2IHF A;  1HNZ L;  2ASB A;  4A75 A;  1A63 A;  1X56 A;  1L1O C;  1VQ8 A;  2PI2 A;  3GD7 A;  1KL9 A;  1PYB A;  5IP7 G;  3CF5 A;  5C44 H;  4UY8 C;  2F4V Q;  3GTM H;  4DV4 L;  4RG1 A;  3T1Y L;  2KCM A;  4L5S A;  3TQY A;  1LYL A;  3L7Z C;  5IT9 c;  1TWG H;  2Q2I A;  4DR7 Q;  3E9I A;  4GS3 A;  1PH8 A;  1VQ7 A;  3CMA A;  1LM0 A;  1JE5 A;  5BR8 Q;  3PUX A;  1K9M C;  1X3F A;  2R7Z G;  2EQS A;  2KEN A;  1NTG A;  5JEA G;  1V43 A;  2WAQ G;  5IP9 H;  1YZ6 A;  4LF9 Q;  1Y1V G;  5HGQ A;  4WJ4 A;  4DUY Q;  1QVG A;  4ME3 A;  3F2D A;  4HIM A;  4AIM A;  2VQF L;  4KHP L;  3I55 A;  1VQ4 A;  5ELN A;  1N33 L;  2R92 H;  3AQQ A;  1QZG A;  1VQK A;  1S3O A;  1UE1 A;  2UUC Q;  1EOV A;  4JCV E;  4DV5 Q;  4DR5 Q;  1IBL L;  1Q12 A;  1FVI A;  1XNQ L;  4JBM A;  4HJ7 A;  1KRT A;  4A3D G;  4X65 L;  4AQY Q;  4NXN Q;  4B3S L;  1JJ2 A;  4IJH A;  1IBM L;  3PO3 H;  4MZ9 A;  1N9W A;  3L2P A;  1Q86 C;  4JI4 Q;  4JYA Q;  3AFP A;  3OYY A;  4LUO A;  2A8V A;  2F3I A;  4JI6 L;  1W3S A;  4BXX G;  1IXR A;  1XMO Q;  1I3Q H;  4GNX B;  3S1Q H;  4POF A;  1K73 C;  2YTY A;  3PUW A;  1KD1 C;  1XNR Q;  5IYD G;  3K8A A;  1EFW A;  3CCS A;  4BBS H;  4YCU A;  4HID A;  1Q46 A;  3CCQ A;  5LMN Q;  1K0R A;  1P16 A;  4EQ5 A;  1I5F A;  4BY1 G;  1G29 1;  4A76 A;  3HKZ G;  4JG2 A;  4DPG A;  4ALP A;  3HOW G;  1Q1B A;  3GTJ H;  1VQD A;  3KFU A;  1WCM G;  1VQF A;  1WOC A;  4P74 A;  4GNX A;  1ASY A;  1VQG A;  4JI7 L;  2UXB Q;  1Y14 B;  3BZC A;  4HIK A;  3U4Z A;  3UDG A;  2HHH L;  2CKZ B;  4MTN A;  4OWW B;  4QY7 A;  2Y0S G;  3PSI A;  1K83 H;  2VQF Q;  2VUM H;  4JYA L;  3KJP A;  2ZJR A;  4JBK A;  3KYH C;  2B63 H;  4A93 H;  3M85 A;  3T1H Q;  4NXM L;  3S1R H;  2IHE A;  4OON A;  2OQK A;  1Y1W H;  2YTX A;  2NVQ H;  3M7N A;  5FJ8 G;  4NXN L;  1DGS A;  2KHI A;  4Y7N H;  3CCV A;  4AQY L;  4DR6 Q;  1BKB A;  1D7Q A;  2Q2T A;  2IX1 A;  4A3L G;  3NBH B;  5C3E G;  4YY3 Q;  4DV1 Q;  3CCE A;  1X6O A;  4LW1 A;  4JI5 Q;  3KF6 B;  2ZTD A;  1KIX A;  1XMO L;  2A19 A;  4LUV A;  2JA8 H;  1IZ6 A;  2QGQ A;  5IYB H;  3D31 A;  1XPU A;  2FXQ A;  1IYJ B;  4JV5 Q;  2VNU D;  1HZA A;  1J5E L;  3T1Y Q;  5IYC H;  4LF4 Q;  2OCE A;  2AWN A;  1C9O A;  3RN5 A;  1PH6 A;  1SRO A;  3ER0 A;  3E9H A;  1KC8 C;  5IWA L;  3H3V I;  4XIG S;  1AH9 A;  5E7N A;  1HNW L;  1V1Q A;  1E1T A;  2HIX A;  3B6Y A;  4P72 A;  3RLO A;  4A3M H;  5LMU Q;  4GNX C;  3GTQ H;  2WB1 G;  2D62 A;  1VQH A;  4X62 L;  1J6Q A;  2VW9 A;  5M3F H;  4DV2 Q;  3RN2 A;  3STB C;  2E2J H;  1HNX Q;  4LFB Q;  4DV3 Q;  4PZ7 A;  5IYB G;  1A0I A;  1AE3 A;  2EXD A;  4B3M Q;  1T9H A;  2UU9 L;  2JA7 H;  3GO5 A;  4LNQ A;  1JJC B;  1IBL Q;  4A3B H;  4A93 G;  1C0A A;  3J80 c;  1VQA A;  5GAH C;  3CW2 C;  1XMQ L;  1IBK Q;  4DR4 L;  5FJ8 H;  2B3G A;  1JT8 A;  4X64 Q;  5FLM G;  4IFD G;  4OO1 I;  2Z0S A;  2D0O A;  2KBN A;  2LXK A;  4HJ8 A;  3K7A H;  3I4M G;  4LF8 L;  1XPR A;  2UXD L;  3PUV A;  1K3R A;  1SR3 A;  3F1Z A;  3KJO A;  4BBS G;  1E22 A;  4LF6 L;  3KF8 B;  3OTO Q;  3NEM A;  4OXP A;  1YJN A;  2AKW B;  4KI0 A;  2I5H A;  5C4X H;  4A4I A;  1G51 A;  1Q81 C;  2PI2 E;  4GN3 B;  4DNI A;  3RZO H;  2IX0 A;  4DK6 C;  4LF5 Q;  3KDF A;  4RMF A;  1N34 L;  2JEB I;  2F52 A;  4A3F H;  3FHW A;  3K7U C;  4JI8 L;  2PMZ E;  2Z6K C;  3W5O A;  1CSQ A;  4NPS A;  2E8G A;  1SFO H;  2HQL A;  2ZTE A;  1PA6 A;  4LFC L;  3PO2 G;  1TWA H;  3RR5 A;  2BA0 A;  3PUZ A;  4X64 L;  2JQO A;  2KHJ A;  4YWL A;  2GN5 A;  1X9N A;  4JOI C;  3M9B A;  3OW2 A;  1VQC A;  3D0F A;  4APV A;  1PHJ A;  2NZO A;  1N8R C;  3CC2 A;  1E3P A;  4JI2 Q;  3CAM A;  3I56 A;  4A3K G;  3S17 H;  1EIF A;  1Q1E A;  2MFI A;  4DV0 Q;  2K50 A;  4DR1 Q;  2PNH A;  4DR2 Q;  1M1K C;  2UXC L;  1EQR A;  2R7F A;  3AYH B;  4QJF A;  2LXJ A;  4BY1 H;  2K5N A;  2JK8 A;  4LFB L;  1R9T H;  1RL2 A;  5JJK A;  3UDF A;  4BBR G;  3CCR A;  4GOP B;  1SMX A;  3PIP A;  1NE3 A;  3STB D;  1HR0 Q;  2QA4 A;  3EN2 A;  2UUB Q;  3MXN B;  2JA7 G;  1K8A C;  3I4O A;  4B3T L;  3M3Y H;  4OWX B;  4Y52 H;  4DAM A;  3F2B A;  4K0K Q;  4JI1 L;  3TS2 A;  4IJL A;  3RLN A;  4C2M H;  2DUD A;  1XMQ Q;  1U0L A;  3J81 i;  1SN8 A;  4QIW E;  5M3F G;  3S15 H;  4B3R Q;  2CWP A;  1GO3 E;  3M4P A;  3K81 C;  5C3E H;  4DV6 L;  1VQL A;  2E2H H;  1Z9F A;  3TS0 A;  1FJG Q;  1VQI A;  4C3J H;  4A3E H;  2UU9 Q;  1L1O A;  1LTL A;  1UE6 A;  2VZA A;  2AMC B;  4L5Q A;  5IE8 A;  1PH9 A;  1C7Y A;  1PFS A;  1WFQ A;  3HOV H;  3G48 A;  1QUQ A;  1LUZ A;  4FDB A;  5M3M G;  2BH2 A;  3JAM c;  5C0X I;  1Y1V H;  4POG A;  4BY7 G;  2N8N A;  1XTD A;  3ERS X;  5IP7 H;  1CKO A;  2WAQ E;  1X65 A;  3K80 C;  2N3S A;  2ZM6 Q;  1SLJ A;  4DR3 Q;  4NB3 A;  4JI8 Q;  1M90 C;  4R4O A;  4LFA L;  2UXD Q;  1CKN B;  1N32 Q;  3KLW A;  2ZJQ A;  4JI0 L;  4LFC Q;  4O0A A;  3I2Z A;  3OTO L;  4YY3 L;  3CP0 A;  1D8L A;  4UP7 A;  1GVP A;  2AHO B;  1GD7 A;  1VCI A;  2PQA A;  4JI3 L;  5FLM H;  3GTK H;  4UPA A;  3SGI A;  2WB1 E;  5C0X G;  3CPF A;  2JA6 H;  2IY5 B;  3HOV G;  2HIV A;  1V9P A;  2I0Q A;  2K5V A;  2WP8 J;  3FKI H;  5GAG C;  3HOX H;  1NY4 A;  1OXU A;  4H02 A;  2K4K A;  4PZ8 A;  4HJ5 A;  4GLX A;  2R6G A;  3CCM A;  1E7Z A;  2N49 A;  2CQO A;  2MQH A;  2HHH Q;  1QUQ B;  1I6H H;  4DV7 L;  4X66 Q;  1FGU A;  4R1J A;  2RHQ B;  1H95 A;  1EWI A;  2UUA L;  4AYB E;  2K5H A;  4YHH L;  1FL0 A;  2V1C C;  3GDE A; 
#chains in the Genus database with same CATH topology
 1KAW A;  1BCP B;  3S16 H;  3QJY A;  1LTS D;  1UAP A;  3DM3 A;  4ZUI A;  2E2D C;  2ATW A;  1VF7 A;  1S72 A;  3GTK B;  1F2L A;  4YCW A;  2JA6 B;  1JWS D;  4X3K A;  1BCP C;  1XNR L;  2K28 A;  4DUZ L;  1RKN A;  2CHB D;  3L0O A;  1Q7Y C;  4QQB X;  1D2B A;  2NUC A;  2LS0 1;  3DWQ A;  3TZD A;  4DV1 L;  3A56 A;  3NBI A;  1Q8K A;  4CGY B;  4KJO A;  5C44 B;  3BZD B;  4ZK9 B;  1X3Q A;  3GTL H;  3HOZ H;  2UXB L;  1XX8 A;  4C3H B;  4MN3 A;  3U50 C;  2R7D A;  4R4I A;  5I6Y A;  1EIG A;  1YHA A;  4B3S Q;  1PH5 A;  3ICE A;  1N36 Q;  3MHB A;  1EQQ A;  3RUZ A;  1KNE A;  2PO4 A;  4DR6 L;  1PRT C;  4IPH A;  1E24 A;  4R4T A;  2KEC A;  4MIU A;  4LUZ A;  2SEB D;  1K8M A;  2ES2 A;  1L0W A;  3NTK A;  4OX9 Q;  4WJ3 M;  4GKJ Q;  1VQO A;  1VQ9 A;  4XTC S;  1U4L A;  4B3M L;  3R8B A;  4R8I A;  1SAP A;  3SE0 A;  1NNX A;  1W6K A;  3J7A 5;  4FF2 A;  2R93 H;  1S5C D;  2ALY B;  2XGT A;  4OWT B;  3DHQ A;  2PQA B;  3E5S A;  1ILP A;  1W2B A;  2UUA Q;  3HOZ G;  1EFI D;  4A3B G;  2Z6K A;  3A5U A;  3GTJ B;  4K5V A;  2EY1 A;  4R4C A;  5KYI A;  1IHZ A;  1S40 A;  2HCC A;  3H3V I;  3MC0 B;  3PF4 A;  1N36 L;  4JI1 Q;  4JI3 Q;  1T5E A;  2K52 A;  4GKK L;  1OXV A;  3G6E A;  1AE2 A;  1B9M A;  3PUY A;  3P75 A;  2F0T A;  3ULJ A;  1NJI C;  1I4G A;  1NSN S;  3K7A B;  1Y1W G;  1BBW A;  2O2L D;  2BH8 A;  4JPB W;  1P8L A;  1Q3L A;  4NP5 A;  1L1O B;  1RTN A;  3P7J A;  1H9S A;  5FLX c;  2NVT H;  2DJF C;  4TVA B;  4ZLT F;  3J80 L;  1CT1 D;  4YHH Q;  5CYU A;  4BY7 B;  4A3J G;  3U9O A;  3TP7 A;  4A3F B;  1I4R A;  2YV5 A;  4OIK A;  1EIY B;  1IKM A;  5AJ3 L;  1VF5 C;  2CFM A;  4C56 C;  2I5M X;  3AFQ A;  2RF4 A;  2JE6 I;  5C44 G;  3H6M A;  1M4V A;  1ZYR C;  2D0P A;  1SRU A;  3IL8 A;  2UUB L;  3QWN A;  4I7Z C;  1KDA A;  5BN3 A;  3BDO A;  3VR2 A;  2R61 A;  3I4M H;  1EY5 A;  1MJC A;  4DV2 L;  3KOJ A;  1CM9 A;  2BOS A;  4XQJ A;  2MO0 A;  3MXG A;  4GLA C;  4YIJ A;  2JA7 B;  3LX0 A;  2X69 A;  3FMC A;  4IAL A;  4O2D A;  3P20 A;  1JR0 D;  3M4O H;  1F2M A;  1YJW A;  2B39 A;  1EYA A;  5KNB A;  4XYQ A;  4TKO B;  1CI3 M;  5CBA E;  3VYT A;  3LWU A;  3OMC A;  4BXX H;  1PZJ D;  4UP9 A;  1FJG L;  4CJ0 B;  2JA5 H;  2O5J C;  1CKN A;  1LTA D;  4IPG A;  5HUR A;  5GAE C;  4G7Z C;  1Y8O B;  2M00 A;  1IKL A;  1VS0 A;  4ID6 A;  4QB4 A;  4OO1 G;  4IUP A;  4P73 A;  3BDL A;  3KF6 A;  4P75 A;  4DV0 L;  1RCV D;  4XQN A;  2L15 A;  1J9O A;  3NWT A;  2A74 C;  5IOD A;  1JB7 A;  2NZ1 D;  4MNO A;  4AYB G;  2NN6 I;  1D5X C;  1N34 Q;  1PH2 A;  3CPW A;  1HJP A;  1V8Q A;  4JI6 Q;  3S14 B;  1A6X A;  2ZTC A;  3UE0 A;  5K36 G;  4X62 Q;  1CSP A;  1F77 A;  1R9T B;  2A1A A;  3D4D A;  3JAM i;  4JBJ A;  4A3I G;  1A8V A;  2R93 G;  2F0I A;  3L9A X;  1F2Z A;  2Q2H A;  1TVX A;  4HR7 B;  5DEH A;  2PW5 A;  1J5E Q;  1YEZ A;  3H0G H;  1FGB D;  1A62 A;  2EXZ A;  1ROD A;  2JA6 G;  3DLL A;  1YIJ A;  3PGZ A;  3CC4 A;  2K7V A;  4J15 A;  4CHT B;  3Q24 A;  2QF7 A;  1X3P A;  1L2F A;  1BR9 A;  4O42 A;  1Q82 C;  1O80 A;  1TWF H;  3GP7 A;  1EU3 A;  2EPB A;  3K6O A;  1X56 A;  1L1O C;  3K5N A;  5FO9 B;  4H44 C;  4UY8 C;  4ABN A;  2KQ3 A;  4DV4 L;  1KAA A;  5IIF A;  5C4J B;  1STB A;  3L7Z C;  5ELD A;  4F87 A;  5KIX A;  1JCK B;  3HS0 C;  1LM0 A;  1PRT B;  3PUX A;  2KEN A;  2EYO A;  4LF9 Q;  3WDN A;  5EJW A;  4XXE A;  1U9R A;  4KHP L;  1WCM B;  1N33 L;  3AQQ A;  4WFN 3;  5EBD A;  4ZKB B;  1VQK A;  1GHJ A;  1UE1 A;  2UUC Q;  4JCV E;  1FNU A;  4PV1 C;  4A3D G;  1B2T A;  4AQY Q;  4B3S L;  4IJH A;  4QUC A;  3L2P A;  2B2U A;  1TY0 A;  4JI4 Q;  4LUO A;  3OYY A;  2F3I A;  3L3O C;  2R93 B;  1IXR A;  4A3I B;  1A3T A;  2B63 B;  4A93 B;  1CZW A;  1SYF A;  1QIL A;  1NR2 A;  2EY5 A;  2WB1 B;  5DNF A;  3CCQ A;  1K0R A;  1K28 A;  3HKZ G;  4DPG A;  4ALP A;  1ONL A;  2VB2 X;  3KFU A;  5EKI A;  1VQG A;  2RVL A;  1LT4 D;  4A3J B;  5M9O A;  3U4Z A;  4G57 A;  3CKI B;  2HHH L;  1A2T A;  4RWS C;  2A69 C;  1HHV A;  3CQZ B;  2O5I C;  1CA6 A;  1IL8 A;  1ESR A;  4WRD A;  4HTH A;  3CCV A;  4Y7N H;  1BCP D;  1D6E C;  5C3E G;  4JK1 C;  4JI5 Q;  1NR4 A;  4LUV A;  4X3S A;  4C3I G;  1HZA A;  2VNU D;  4DXF A;  2OEO A;  3T1Y Q;  1K83 B;  4LF4 Q;  3A7L A;  2F0O A;  1FD7 D;  4ZYS A;  1EEI D;  1PH6 A;  1SRO A;  2HIX A;  2M9V A;  1PLF A;  2XVS A;  1EQV A;  3RLO A;  3SHL A;  3VR3 A;  4GNX C;  3D3R A;  2AUJ D;  2NVY B;  2WAC A;  3DMU A;  1VQH A;  4DV2 Q;  1E2V A;  2E2J H;  1JOR A;  2EY6 A;  1AE3 A;  2UU9 L;  2K5W A;  2EYF A;  2E2I B;  4LNQ A;  3NE5 B;  4A3B H;  1C0A A;  4S3S A;  5GAH C;  3CW2 C;  3OWF A;  1IBK Q;  2R3Z A;  4DR4 L;  2F0J A;  5ELC A;  2B3G A;  3H3V C;  2LXK A;  3O13 A;  3VYU A;  2UXD L;  1K3R A;  4A3M B;  4LF6 L;  3GV6 A;  3KF8 B;  1FNW A;  1QE6 A;  4OXP A;  4KI0 A;  1PFM A;  5M3M B;  5C4X H;  1G51 A;  1SYD A;  4G4K A;  1BQQ T;  1N34 L;  4RHR A;  3D4R A;  2Z4I A;  2PMZ E;  2G9H D;  4KY5 A;  1AP0 A;  1EY4 A;  2F0V A;  3I4N B;  1EZ6 A;  4V0B A;  1LTI D;  1X9N A;  1PZI D;  2KHJ A;  4YWL A;  2GN5 A;  3BS1 A;  4JOI C;  1PHJ A;  3D0F A;  3CC2 A;  4FP5 D;  2MFI A;  3SR1 A;  2K50 A;  1GXD C;  3NK9 A;  3V2T A;  2M2L A;  2DNC A;  3GV3 A;  2AQ3 B;  1U4R A;  1LLR D;  1R9T H;  5JJK A;  3UDF A;  3CCR A;  3PIP A;  3STB D;  5LL6 S;  4XT1 B;  2KUM A;  2F1M A;  1J8I A;  3I72 A;  4B3T L;  3M3Y H;  1MHW C;  3SK4 A;  3TS2 A;  5I9O A;  4IJL A;  1H9K A;  1U0L A;  3PQI A;  2J4X A;  3J81 i;  2CWP A;  3EJI A;  1CHP D;  3M4P A;  3K81 C;  4FF3 A;  3S17 B;  1EOT A;  1WTX A;  1VQL A;  2E2H H;  5J22 A;  1Z9F A;  3TS0 A;  3TME A;  3G48 A;  1LUZ A;  5C0X I;  1XTD A;  2ZXR A;  3TP8 A;  3WOF A;  2N3S A;  3I91 A;  2ZM6 Q;  1QOH A;  1SLJ A;  4NB3 A;  4R4O A;  5EPL A;  1O7Y A;  3K5O A;  3BVZ A;  4LFC Q;  3KUP A;  1VCI A;  2PQA A;  5C3E B;  4RH6 A;  5C0X G;  1SNQ A;  3I4L A;  2HIV A;  4N9T A;  1V9P A;  2UXB Q;  2K5V A;  3HOX H;  1G2T A;  1EYC A;  1OXU A;  2C9O A;  5JPM C;  4GLX A;  2R6G A;  3CCM A;  1E7Z A;  2N49 A;  2CQO A;  2MQH A;  3MZ5 A;  3M4Y A;  1I6H H;  1BCP F;  2GA4 B;  5KEE A;  1DOK A;  1XXG A;  3DWP A;  4IUR A;  4AYB E;  2V1C C;  4F88 A;  2F4I A;  1ZKO A;  1OXX K;  1SNM A;  2P5Z X;  4G7O C;  4IUU A;  3AB9 A;  2ZJP A;  4K8I A;  4IO9 A;  1Z7T A;  3PO3 B;  1PVO A;  2OXP A;  4J8Q A;  1JMC A;  4YWK A;  4DNR B;  3UI2 A;  2R7Z H;  2NVX B;  3A8K E;  5IGE A;  1GUW A;  2QEJ C;  5ELF A;  3SDZ A;  1B8A A;  2NYZ D;  3GTM B;  1CKM A;  3S16 B;  1TS3 A;  2BE5 C;  3UDX A;  1ASZ A;  2IL8 A;  2LSS A;  2Q2U A;  2EDG A;  2YTV A;  3R2I A;  1UUP A;  4K6D A;  4LWC A;  1I4X A;  5C4X G;  2L0C A;  2I5L X;  4PMC A;  4KJN A;  3J7Y W;  5LMN L;  1TS2 A;  2HUG A;  3S1R B;  4QL5 A;  5EKK A;  4JI4 L;  4DUY L;  2Q8R E;  4GKK Q;  3S9W A;  1GUS A;  5BR8 L;  1RDP D;  3T4A C;  3GTL B;  2CQA A;  3FPU B;  3N6R A;  4IFD I;  5COY A;  2ZT9 C;  4EQO A;  1G6P A;  1TWC H;  1RIP A;  1X54 A;  3KDF B;  4JBW A;  4ZQ3 A;  3NSW A;  3TRE A;  4EGV A;  2VUM G;  1CK1 A;  4IOC A;  5TSS A;  1WYD A;  1SE4 A;  1G6Z A;  3PO2 H;  1IBM Q;  1QVF A;  1D5M C;  4OGQ C;  4NDX A;  4GLV B;  3PO3 G;  2BA1 A;  2HDM A;  2VQE Q;  4BBS B;  4A3D H;  4A3F G;  3J7Z C;  4KLK A;  4TQU S;  2KA7 A;  5NUC A;  1YBY A;  2N78 A;  1S5E D;  1HCZ A;  1JQY D;  2I07 B;  2JP1 A;  1LAC A;  4JVZ A;  4BWG B;  2RHS B;  4ILW A;  4A3C H;  5EAY A;  2PZU A;  1LTG D;  4DV5 L;  1K8O A;  5ELE A;  2E2I H;  2GVB A;  5GRO A;  4HIO A;  3TEH B;  2E5L Q;  1YI2 A;  4LF6 Q;  3I4N G;  5M5Y B;  3CCU A;  4GKJ L;  1JJG A;  4HAE A;  4B3R L;  1F9R A;  5IGC A;  2Q8T A;  4TRD A;  1NBW A;  3JC6 6;  3RLF A;  4HJ9 A;  1I50 H;  4C3I H;  3E6Z X;  1ZXT A;  3K5M A;  1SJH D;  4JW0 A;  1DOM A;  1KXL A;  2EYL A;  2JA9 A;  2AQ1 B;  4MTK A;  4FO2 A;  5M5W B;  5JEA J;  1VQN A;  2ICE C;  5CC4 A;  1WTQ A;  1MSG A;  1I94 L;  5DM7 3;  1VQP A;  3CRK C;  3HOW H;  2F0P A;  3I73 A;  1LT6 D;  1XJV A;  2AWO A;  1KRS A;  4ODG A;  5M5X B;  1W6J A;  1TS4 A;  2WV6 D;  3HOY H;  2RCF A;  4L8J A;  2F0E A;  1GUG A;  3NP8 A;  2X6G A;  1TT2 A;  4KV6 A;  3CME A;  4R8N A;  2YU9 H;  4JI2 L;  3EFX D;  4RHS A;  2OWO A;  1I94 Q;  3GTG H;  4PG3 A;  4JI0 Q;  5E3F A;  1GM5 A;  1BBX C;  3HOU H;  3CC7 A;  1WTO A;  3BZK A;  1HR0 L;  4DV3 L;  3CXC A;  4P71 A;  4TSS A;  1YNX A;  3K58 A;  1JC7 A;  5AJ3 Q;  5LMU L;  3RNU A;  3QIA A;  3P1H A;  1BO0 A;  1C48 A;  2R92 G;  4K2K A;  3IFT A;  5I9P A;  2VXW A;  2FJ2 A;  4HSV A;  1G8Z D;  5IP9 G;  3HG9 A;  3CRL C;  5IY0 A;  1ICW A;  3SVM A;  1YHB A;  3UE1 A;  3VDY A;  4AH6 A;  3HFZ B;  3MFY A;  1Y8P B;  5HY6 A;  4A3G H;  2RCN A;  3FKI G;  1XPO A;  1PH3 A;  5T1G A;  4IUN A;  4ZCK A;  2NN6 G;  4KTA A;  1HR0 W;  4JOI A;  2B8G A;  3SK5 A;  4KHV A;  1QNU A;  4HJA A;  5E4X A;  2BE5 D;  3MEF A;  3LWE A;  1VMP A;  4FNF A;  3IRB A;  3S15 B;  4KK7 A;  3HOX G;  1JOQ A;  1Y8N B;  1R4Q B;  1HH2 P;  1TWH H;  2K14 A;  4L5T A;  2O4X A;  5ELO A;  4LF8 Q;  1I4Q A;  1U5K A;  3A74 A;  2PQE A;  3EIV A;  2VQE L;  5EBC A;  4LMQ D;  1EY6 A;  3VYR A;  1IBK L;  1RD9 D;  2VS1 A;  4J1M A;  2CW0 C;  2E76 C;  3MXU A;  2H5X A;  5I4D A;  2ASB A;  1PTO F;  1VQ8 A;  5IP7 G;  3CF5 A;  5C44 H;  4N8X 1;  4FXD A;  5FKA C;  3T1Y L;  2KCM A;  4L5S A;  1DM0 B;  4C1N K;  3GQB A;  2A68 D;  1B1Z A;  2IW3 A;  1JE5 A;  1LO5 D;  3K57 A;  1K9M C;  2V4D A;  5JEA G;  1V43 A;  2WAQ G;  5JEA H;  4DFA A;  5HGQ A;  3F2D A;  4HIM A;  4AIM A;  4L6T B;  5ELN A;  1KAB A;  1QZG A;  1EOV A;  1RTO A;  4DR5 Q;  3PMF A;  4HJ7 A;  2L4N A;  1SEB D;  1IW7 D;  4PMB A;  4X65 L;  1JJ2 A;  1IBM L;  4MZ9 A;  2RDH A;  3I70 A;  2A8V A;  2QKI C;  5I2X A;  4JI6 L;  4BXX G;  2PNR C;  4OIJ A;  1M8A A;  3PUW A;  1F9Q A;  4K5X A;  5IYD G;  1EFW A;  1XNR Q;  4A3D B;  4YCU A;  2I46 A;  1Q46 A;  2FMM A;  4N9P A;  5DM6 3;  4JG2 A;  3HOW G;  1HA5 A;  1VQD A;  3GTJ H;  1G2S A;  1WCM G;  1VQF A;  4PNY A;  4DXG A;  5D14 A;  1BXT A;  1ASY A;  4JI7 L;  1IYV A;  3FEW X;  4MHE A;  4HMI A;  4OWW B;  4AYB B;  1QWY A;  2XSC A;  1RHP A;  4IUV A;  1G91 A;  4JBK A;  2EYM A;  3KYH C;  2B63 H;  4A93 H;  4LK1 C;  3M85 A;  3IAY A;  4NXM L;  3HRZ C;  2IHE A;  2B2T A;  1QJO A;  2YTX A;  1Y1W H;  2NVQ H;  3Q22 A;  1ICF B;  1I6V C;  4AQY L;  1DGS A;  2KHI A;  1BKB A;  3OW7 A;  1LV9 A;  2MPM A;  1YNN C;  5F2D A;  3NBH B;  4A3L G;  1X6O A;  1KIX A;  1XMO L;  5KND A;  2Z6B A;  3ZYY X;  5FLX E;  2RQX A;  4JV5 Q;  3A8I E;  4KD3 A;  2OCE A;  4OO1 H;  1AZP A;  3HOW B;  3E9H A;  1EIH A;  5IWA L;  2D9U A;  1AH9 A;  4QCL A;  1V1Q A;  2L5T A;  3B6Y A;  3H09 A;  3RN2 A;  2VW9 A;  1J6Q A;  2A6H C;  3ERO A;  1PRT F;  1A0I A;  1WD0 A;  1JWU D;  2JA7 H;  3GO5 A;  3D6C A;  1IBL Q;  2PCF B;  1HTL D;  1SFO B;  2Z4H A;  4RCN A;  5C4Z A;  1JT8 A;  4IFD G;  4OO1 I;  1PDQ A;  2H1E A;  1H9J A;  2D0O A;  3ND9 A;  4RKB A;  3E0J A;  4LF8 L;  1CZG A;  3PIP 3;  4A3K B;  3OTO Q;  1WVL A;  1LTB D;  2E2J B;  3OIQ A;  4A4I A;  1Q81 C;  2EVB A;  1K0S A;  2C5C A;  2L1B A;  4DNI A;  3RZO H;  2BDN A;  4RMF A;  5JVG 3;  3FHW A;  4JI8 L;  2LMC B;  3H94 A;  1WTV A;  1CSQ A;  3FRP B;  2HQL A;  5FOB B;  1RF2 D;  4FF4 A;  5BN5 A;  2JQO A;  3DM1 A;  3M9B A;  4QMG A;  1N8R C;  4CDF C;  1E3P A;  4JI2 Q;  3I56 A;  1EY8 A;  4DV0 Q;  3MVV A;  4A3G B;  3KLS A;  2N55 A;  2R7F A;  2LXJ A;  4LFB L;  1RL2 A;  3W2D A;  1NE3 A;  5IGG A;  2QA4 A;  2UUB Q;  2B2Y C;  3MXN B;  4NMZ A;  3I4O A;  2HD3 A;  3IKJ A;  4K5W A;  1GUN A;  4C2M H;  1SN8 A;  3S15 H;  4HCE A;  2L55 A;  4U68 A;  1TWH B;  3AU7 A;  3J7A V;  1FJG Q;  4A3E H;  1UE6 A;  2DNE A;  3ONA B;  1PH9 A;  1EWC A;  2AMC B;  3FKI B;  3HOV H;  3GTP B;  1JE4 A;  1QUQ A;  4FDB A;  1KDC A;  1PFB A;  3JAM c;  4POG A;  4BY7 G;  2N8N A;  5IP7 H;  1EY9 A;  4DK1 A;  1IW7 C;  4JI8 Q;  2UXD Q;  4O0A A;  4X3U A;  1D8L A;  1PRT D;  3NXW A;  4JI3 L;  1GVP A;  3GTK H;  1S5D D;  2E74 C;  4RGT A;  2QDB A;  1DZ1 A;  3MXN A;  3T16 A;  4GZY C;  2WP8 J;  5GAG C;  2B63 G;  4A93 G;  4H02 A;  4PZ8 A;  2K4K A;  1PYW D;  2F0G A;  1TII D;  4DV7 L;  2DY7 A;  4X66 Q;  1WTP A;  1ILQ A;  4R1J A;  1H95 A;  4DN4 M;  1SE2 A;  2K5H A;  4YHH L;  1FL0 A;  3GDE A;  5H1S E;  5CV5 A;  5A2Q L;  3T1H L;  3HOZ B;  2JSO A;  4C3H H;  1VQB A;  2JN4 A;  2B2T C;  2MP1 A;  4UHV A;  1SNP A;  5ELB A;  4CJ1 B;  1PV4 A;  3U4V A;  3C1E A;  1STN A;  1VQE A;  1MIU A;  3ULL A;  1VQM A;  1EEF D;  4O1N A;  3TRZ A;  1HZC A;  2F0H A;  5CV9 A;  2Z1C A;  3Q8D A;  4DV7 Q;  5JJZ A;  1C8C A;  1EU4 A;  4ZRZ A;  1MKH A;  3URY A;  1E2W A;  4LF4 L;  4LF7 L;  5LL6 X;  2A6H D;  4C3J G;  1AEX A;  5EPJ A;  5C5M A;  5GAD C;  4NXM Q;  4DF7 A;  2B8F A;  2WII B;  1NAP A;  3TSS A;  2FIN B;  1QB5 D;  3CQZ H;  1FNV A;  2JYO A;  4DV4 Q;  4DR5 L;  2YYZ A;  1GKH A;  3MEH A;  1YNJ D;  3W3A A;  3CCL A;  1MGS A;  1R4P B;  5KYL A;  1V1O A;  2RSO A;  2F4V L;  3EA6 A;  2B2W A;  1SYC A;  1MI2 A;  3OOC A;  1N32 L;  4C1N I;  3HOU G;  1XNQ Q;  2F3W A;  1ZYR D;  1I3Q B;  1YVC A;  4FYD A;  3J81 E;  2KHS A;  3KBX A;  1LTR D;  3CCJ A;  1B70 B;  3GTO H;  2F03 A;  3X3M A;  1OTC A;  5FK9 C;  1OXS C;  2NVY H;  3PF5 A;  4IFD J;  3RD4 A;  3S1M B;  3OWE B;  2OTL A;  2OT2 A;  1KHI A;  3HOY G;  3HKS A;  1WJJ A;  3S2H H;  3ULP A;  1E2Z A;  3G4S A;  4X65 Q;  3PIO A;  2PPB C;  4K14 A;  4QIW B;  3K0Y A;  1PH1 A;  2DGY A;  1BBU A;  2ZM6 L;  3I3C A;  4QGU A;  1YIT A;  3AMU A;  1E1O A;  4DK0 A;  4L5R C;  2KCT A;  1VDZ A;  5JJL A;  1HFN A;  1PFN A;  2Y0S B;  2VL6 A;  5C4X B;  3I4M B;  3MXP A;  1Y69 U;  2JA8 G;  1DON A;  2B2U C;  4IQZ A;  5I2Y A;  4RKL A;  4YCV A;  2RDG A;  2GVA A;  2HQE A;  2IT1 A;  4B3T Q;  2MJ8 A;  3J80 i;  4H13 C;  3S1N H;  2EOT A;  4DR2 L;  4CDC C;  3A5Z B;  3I4N H;  5JJI A;  4CBV A;  4RGM A;  4DK3 C;  1QZH A;  5GQO A;  3DEP A;  2VB3 X;  1I50 B;  1ESF A;  3GTQ B;  3NTI A;  2K5D A;  1MBY A;  4DR3 L;  2E5L L;  2F0D A;  1WI5 A;  1ET9 A;  3CU7 A;  4IPC A;  1X3G A;  4BY7 H;  5CV6 A;  4DV6 Q;  1VQJ A;  2D5D A;  5JOB A;  2JEA I;  5IGF A;  1N33 Q;  2EIF A;  3BJU A;  5DAU A;  2KCC A;  1NUC A;  3PCO B;  4GOP C;  1UEB A;  1SE8 A;  2RSN A;  3Q6S A;  3EBE A;  1HXY D;  4JV5 L;  2OTJ A;  4QF4 A;  1OXT A;  5FLX L;  1VQ5 A;  1PH7 A;  2IX3 A;  1UWV A;  2E2H B;  2Z9H A;  4HN7 A;  5A2Q E;  4LAA A;  1BNZ A;  4DR1 L;  3K59 A;  3DXJ C;  1UNS A;  1SMY C;  5IWA Q;  2XWB B;  2K75 A;  3Q23 A;  5C0X J;  5IYD H;  3T13 A;  2QIL A;  4BA1 I;  3J81 c;  3K0X A;  4XQQ A;  4HED A;  4R4Q A;  3HEJ A;  2ID0 A;  2NZH A;  4UP8 A;  4JC0 A;  3HOX B;  4BY1 B;  4IOA A;  2G5D A;  3BDC A;  4GOP A;  1SNC A;  1TQO A;  4JI5 L;  3NEL A;  1HZB A;  4A3C G;  2F0M A;  5CMD A;  2F0W A;  5KGU A;  3E0E A;  1KQS A;  3IFD A;  2XN9 C;  3S2D H;  4YWM A;  4KKU A;  1CQF A;  3ZJY C;  3S14 H;  1YNJ C;  4LF5 L;  4X6A H;  2Z8L A;  5A35 A;  2Q8I B;  3OHX C;  1ENA A;  3WWV A;  1MJE A;  1Y1V B;  2F0L A;  2NVX H;  3X3N A;  3FDT A;  1DJR D;  5J3B A;  3MAQ A;  2IHF A;  1F9P A;  4A75 A;  5J1Z A;  3J81 L;  2PI2 A;  1KL9 A;  1PYB A;  3GTM H;  1II3 A;  3V05 A;  3PIO 3;  3R2T A;  4RG1 A;  3D8G A;  3QB3 A;  1LYL A;  3ERQ A;  4DR7 Q;  4J6H A;  2F0S A;  3E9I A;  4GS3 A;  5T1I A;  3CMA A;  1KLU D;  5AFW A;  2K6A A;  3T51 B;  2RA4 A;  1QG7 A;  4EVO A;  2R7Z G;  2EQS A;  5FO8 B;  4OL7 A;  1NTG A;  5JVH 3;  2ZXP A;  1A15 A;  1A3V A;  1Q8I A;  2K03 A;  4WJ4 A;  1A2U A;  1QVG A;  1TWF B;  2N88 A;  3I8Z A;  4HSP A;  3OIP A;  1S3O A;  4DV5 Q;  1IBL L;  3JAM L;  4L63 B;  1XNQ L;  1TWC B;  1KRT A;  4NXN Q;  4H0L C;  2L12 A;  1HA6 A;  1L0Y B;  4JYA Q;  1Q86 C;  3AFP A;  1XMO Q;  1I3Q H;  2CVR A;  3LNN A;  4GNX B;  4RFB A;  1K73 C;  3TBI B;  2EYH A;  4BBS H;  4HID A;  4EQ5 A;  3GTO B;  1I5F A;  1G29 1;  4Y7N B;  2F0Q A;  3SK8 A;  3I90 A;  4P74 A;  1CFM A;  1Y14 B;  3OPO A;  2CKZ B;  1I4H A;  4OEL B;  1KNA A;  4QY7 A;  1BF4 A;  2Y0S G;  2AUK A;  2VQF Q;  4JYA L;  2A69 D;  4XYO A;  4ULL A;  3KJP A;  2ZJR A;  3T1H Q;  2L9H A;  4OON A;  2LKV A;  1B3A A;  4HCS A;  3M7N A;  2HCI A;  3A54 A;  1D7Q A;  2Q2T A;  2IX1 A;  3BVM A;  5C4H A;  2K05 A;  4YY3 Q;  4DV1 Q;  5M3F B;  3KF6 B;  2ZTD A;  1WTR A;  1SSO A;  4XT3 B;  2FFK B;  2EYP A;  5D3I B;  3D31 A;  1B4O A;  1J5E L;  2PZW A;  1BDO A;  4CJ2 C;  2QW7 A;  1GJX A;  1C9O A;  3TDQ A;  1UEA B;  4P2C B;  1AFP A;  1B9N A;  1KC8 C;  3MWY W;  1MSH A;  3KF8 A;  1E1T A;  4A3M H;  5LMU Q;  3GTQ H;  4IUQ A;  2D62 A;  4Q5V A;  4X62 L;  4X3T A;  3STB C;  4DV3 Q;  4ZAI A;  1EQT A;  2EXD A;  4B3M Q;  1LTT D;  2YU9 B;  1JJC B;  1VQA A;  2KJX A;  1XMQ L;  1PZK D;  3NTH A;  3GTG B;  4BBR B;  4X64 Q;  5FLM G;  1S5B D;  3H91 A;  5IGD A;  2KBN A;  4HJ8 A;  3I4M G;  3HP3 A;  4K2L A;  3K7A H;  1Z6H A;  2IPK D;  3PUV A;  1SR3 A;  4BBS G;  1E22 A;  1BOS A;  5CV8 A;  2EY2 A;  1YJN A;  2AKW B;  3NQT A;  3VR6 A;  2I5H A;  2D2C C;  2QCP X;  1TR5 A;  2PI2 E;  1D1K A;  1PMR A;  2IX0 A;  2EJM A;  4LF5 Q;  2J0T D;  3G6J B;  4ZUJ A;  2F0K A;  2F52 A;  3R93 A;  3K5L A;  4A3F H;  1STG A;  3W5O A;  3RZD B;  4NPS A;  2E8G A;  1SFO H;  3J7A F;  1PA6 A;  2ZTE A;  3ND8 A;  4LFC L;  4CKC A;  3PO2 G;  1TWA H;  3PUZ A;  4X64 L;  1PTO C;  2OF1 A;  3FPP A;  4APV A;  4KN7 C;  3S17 H;  2NTT A;  1EIF A;  2UXC L;  4BY1 H;  2K5N A;  3RZO B;  4DA2 A;  4BBR G;  4GOP B;  1T5X D;  4I7A A;  2JA7 G;  3SEB A;  4N8F A;  1K8A C;  3BYY B;  2XWJ B;  3RLN A;  2WIN B;  2B2V C;  2DUD A;  5C3X A;  1XMQ Q;  3NQI A;  1EL0 A;  4B3R Q;  1GO3 E;  3N52 A;  4K6L A;  4DV6 L;  1LT3 D;  5IT9 E;  2KCN A;  3C3L A;  4C3J H;  1GOZ A;  1L1O A;  1LTL A;  2VZA A;  1PFS A;  1WFQ A;  4RAU C;  5M3M G;  2BH2 A;  4KY6 A;  1Y1V H;  2TSS A;  1VMC A;  5C6A A;  3C46 A;  3QR8 A;  1CKO A;  1X65 A;  3MFG A;  3TZU A;  4UDU C;  3VR4 A;  2MUY A;  4DAV A;  4DR3 Q;  1DD2 A;  1M90 C;  4LFA L;  1TU2 B;  1CKN B;  1N32 Q;  3KLW A;  1CA5 A;  2ZJQ A;  3BVG A;  3I2Z A;  3OTO L;  3E3X A;  2K04 A;  5FLM H;  5CR3 A;  4KMU C;  3CPF A;  2EZV A;  1DXM A;  2JA6 H;  4DU9 A;  4A3E B;  2IY5 B;  3OMG A;  1JOK A;  5K5P A;  4RGN A;  1NY4 A;  2EYJ A;  2SDF A;  1ENC A;  2A6E D;  2FHT A;  3R3O A;  3DEO A;  4NKL A;  2UUA L;  1TS5 A;  1SYG A;  2CWA A;  4XIG S;  4DGZ A;  3SXH A;  3H0G B;  5IOC A;  1YJ9 A;  5IGB A;  1H9M A;  3H0G G;  1HNX L;  1O7I A;  1HUN A;  5BN4 A;  4OX9 L;  1QVC A;  1TXY A;  3U58 A;  1IL2 A;  4OHJ A;  2RDF A;  1DYQ A;  5J39 A;  4IZ8 A;  4NW2 A;  4DAY A;  1WTH A;  1STA A;  3G7L A;  3W1G A;  1JOO A;  1JIC A;  2EJF C;  3UDI A;  5DLQ E;  4A3L H;  4A3E G;  2F0F A;  2XRQ D;  1NMF A;  3S24 A;  5C4J H;  3F2U A;  3Q0A A;  1TWG B;  1DCZ A;  5D3D A;  1SNO A;  2F3V A;  1UE7 A;  2XNA C;  3NBH A;  2F0U A;  1VQ6 A;  5KRU A;  1EYG A;  1STE A;  4CKB A;  2HT1 A;  3T53 B;  2KVM A;  3F8T A;  3U9S A;  3D4W A;  2R7Z B;  2NTS A;  1WCM H;  3A0J A;  4FXG C;  2R92 B;  3RMH A;  4JI7 Q;  5D65 A;  4I65 A;  3KLS X;  2CCZ A;  4DR7 L;  4DUZ Q;  1LAB A;  3BU2 A;  1SDF A;  1B7Y B;  1OO9 B;  3KBG A;  5G3L D;  5M5Y H;  4A3I H;  3S1Q B;  1I4P A;  2RKS A;  4GN4 B;  5FO7 B;  4A3M G;  4K8J A;  1CQV A;  3TN2 A;  4EX5 A;  5K36 H;  4LF9 L;  3A55 A;  2B29 A;  4A3G G;  4IPD A;  4PZ6 A;  2RBM A;  4KHZ A;  1EYD A;  1KLG D;  3VR5 A;  5LMN W;  4A3J H;  3G71 A;  3LGJ A;  4M8A A;  1XTC D;  2SOB A;  5M5W H;  1PTO D;  1K3B C;  1AZQ A;  2VUM B;  4KHP Q;  1STH A;  1SND A;  3PO2 B;  1EZ8 A;  1E0B A;  4CKE A;  3H15 A;  2UUC L;  1SYE A;  4BBR H;  4KKT A;  3KLR A;  4LF7 Q;  3VYS A;  3HOY B;  1HQM C;  1PH4 A;  4A3K H;  2DN8 A;  3S1M H;  1B53 A;  2JJQ A;  1QCB D;  2JA8 B;  1WD1 A;  2B2V A;  4PMW A;  3C2P A;  2VY3 A;  1B50 A;  5IT9 L;  5CGK A;  1YHQ A;  1IYU A;  1X3E A;  4F8M A;  3RZD H;  2NWG A;  4FF1 A;  1SJE D;  4Q0F A;  4LFA Q;  2UXC Q;  3M4O B;  1L0X B;  4X66 L;  1XWE A;  4DR4 Q;  1TWA B;  1EUJ A;  1JB3 A;  2SNM A;  4RCO A;  4K0K L;  4KD4 A;  4Z9C B;  2JA5 G;  3MA2 B;  4XDX A;  2E75 C;  5E4W C;  4WJW A;  3I7F A;  1U4M A;  3CD6 A;  2MO1 A;  1SBB B;  1CUK A;  2OQ0 A;  2EJG C;  3PV0 A;  4U67 3;  2BDO A;  1O78 A;  2XIW A;  3AEV A;  3M4Q A;  4RGO S;  2QDL A;  3NWS A;  1H9R A;  2H4O A;  1SE3 A;  1O7L A;  5M5X H;  2MNA A;  1PTO H;  2K01 A;  5M3M H;  4WOR A;  2CW0 D;  3H3V H;  5EKL A;  4KKS A;  1PYS B;  1D5Z C;  4E6I A;  1HNZ Q;  3J81 j;  3OSO A;  2ENB A;  1FYC A;  4DAP A;  5KNC A;  5IYC G;  3MTS A;  1TY2 A;  2C35 B;  2WFW A;  3F2C A;  2FMC A;  3HKZ E;  2WKD A;  1AN8 A;  1S4Z A;  3NEN A;  1HZ9 A;  1HNW Q;  3EQL C;  1X55 A;  4H7B A;  4DKA C;  2A6E C;  2A5H A;  2X6L A;  4HMJ A;  1K8G A;  1KDB A;  3FP9 A;  2IJ0 A;  4OEM B;  1NMG A;  4V19 0;  2XRS D;  1EY7 A;  2NBF A;  1S5F D;  2QEX A;  2A68 C;  4IUT A;  1Z47 A;  4FVM A;  1EY0 A;  1BVS A;  2B2W C;  1BUV T;  4DAY B;  1PXU A;  4BA2 I;  4CDD C;  2WAQ B;  4QUF A;  4B08 A;  2Y0S E;  2XTI A;  3A7A B;  1QNK A;  1UE5 A;  4GN5 A;  4M1U B;  1HQR D;  3W1B A;  1HNZ L;  1A63 A;  1ET6 A;  3GD7 A;  2F4V Q;  1F2Y A;  4ZKC B;  3TQY A;  2K33 A;  5IT9 c;  1CTM A;  1TWG H;  2Q2I A;  5L37 A;  1PH8 A;  2CH4 A;  1VQ7 A;  2CH4 W;  5BR8 Q;  1X3F A;  4G7H C;  2B2Y A;  1B3Q A;  3V96 A;  1YZ6 A;  4DNT B;  5IP9 H;  1Y1V G;  1I6H B;  5JPN C;  5C3W A;  4DUY Q;  4ME3 A;  3C1F A;  2VQF L;  2NN6 H;  3I55 A;  1VQ4 A;  2AQ2 B;  1V1P B;  2KED A;  2R92 H;  3D6W A;  3HGB A;  4PQX A;  1Q12 A;  1FVI A;  1B44 D;  4JBM A;  2DY8 A;  5EQ0 A;  3PO3 H;  5CBE E;  1AW7 A;  1N9W A;  3FVQ A;  1W3S A;  1TKW B;  3S1Q H;  5CV7 A;  4POF A;  2YTY A;  1KD1 C;  3K8A A;  3CCS A;  2PW7 A;  2SNS A;  5LMN Q;  1P16 A;  3TP5 A;  4BY1 G;  1GHK A;  4A76 A;  4R9W A;  3TP6 A;  1Q1B A;  1WOC A;  4GNX A;  1RJT A;  3BZC A;  4HIK A;  3UDG A;  1HPC A;  3CHB D;  4MTN A;  3PSI A;  3S2H B;  1K83 H;  2VUM H;  4F7X A;  5COR A;  4FXK C;  1CHQ D;  4RA8 A;  3S1R H;  1KTK A;  2OQK A;  5FJ8 G;  2ZXO A;  3A8J E;  4NXN L;  3SK6 A;  4DR6 Q;  1HRJ A;  1GUO A;  3VA5 A;  3CCE A;  4LW1 A;  5ISR A;  1F9S A;  2A19 A;  2JA8 H;  1IZ6 A;  2QGQ A;  2TMP A;  5IYB H;  1XPU A;  2FXQ A;  1IYJ B;  1GUT A;  4A3B B;  5IYC H;  2J7Z A;  2ICI A;  3S1N B;  2AWN A;  3RN5 A;  2KOL A;  3ER0 A;  1Y1W B;  2NVQ B;  5E7N A;  1HNW L;  4P72 A;  3T56 B;  2WB1 G;  1YNN D;  5M3F H;  3QG1 A;  1HNX Q;  4LFB Q;  5G3L F;  2BCO A;  3NHH A;  4PZ7 A;  3VA7 A;  5IYB G;  1T9H A;  5LHY 1;  3KK7 A;  5CV4 A;  2PMZ B;  1O7Z A;  3BG3 A;  1Q90 A;  3J80 c;  3NUC A;  5C0X H;  5FJ8 H;  1ZEQ X;  4KY7 A;  5E1F A;  4EQP A;  2Z0S A;  1XPR A;  2K32 A;  3F1Z A;  2LY7 A;  3QOJ A;  4IN3 A;  3KJO A;  4C3I B;  5JAV A;  2IWH A;  1PTO B;  1HFG A;  3NEM A;  2K1B A;  5I6W A;  2NVT B;  2JXM B;  4GN3 B;  4DK6 C;  3KDF A;  2JEB I;  3K7U C;  2Z6K C;  3HZX A;  2NB0 A;  2MGS A;  1SXT A;  3M3Y B;  1H9S B;  3RR5 A;  2K5Q A;  4C2M B;  1HUM A;  2BA0 A;  1A3U A;  3OW2 A;  1VQC A;  2L11 A;  2LFN A;  2NZO A;  2G9D A;  1C4Q A;  3CAM A;  4A3K G;  1Q1E A;  4DR2 Q;  3DWA A;  1M1K C;  4DR1 Q;  2PNH A;  4UAI A;  1EQR A;  1ENF A;  3AYH B;  4QJF A;  3M7G A;  2KEE A;  1JWM D;  1EWH A;  1U4P A;  2JK8 A;  1STY A;  1SYB A;  3HKZ B;  1SMX A;  1HR0 Q;  1X32 A;  3EN2 A;  2DJG C;  5C5L A;  2HDL A;  3NPP A;  4B9W A;  4C3H G;  4Y52 H;  4OWX B;  4LJZ C;  4DAM A;  3F2B A;  4K0K Q;  4JI1 L;  3ITP A;  1LT5 D;  4QIW E;  5M3F G;  1XYI A;  3HOU B;  3J80 E;  2F0N A;  3DUZ A;  2PZT A;  2JA5 B;  3S2D B;  4BS9 A;  5C3E H;  1MD2 D;  1D1I A;  1VQI A;  2UU9 Q;  4L5Q A;  3JAM E;  1C7Y A;  5IE8 A;  1NCV A;  1HTP A;  2MHV A;  4KN4 C;  1ML0 D;  3ERS X;  2WAQ E;  3K80 C;  2WKC A;  4ME5 A;  2PYK A;  4CDE C;  2A73 B;  5HGT A;  3QOL A;  5EGT A;  4JI0 L;  1FR3 A;  3QO2 A;  4EQN A;  4YY3 L;  3CP0 A;  2EE1 A;  4UP7 A;  1SMY D;  1GD7 A;  2AHO B;  4IFD H;  4UPA A;  3SGI A;  2WB1 E;  3BYT B;  3HOV G;  4C3J B;  2I0Q A;  3FKI H;  3GTP H;  3HOV B;  4HJ5 A;  2HHH Q;  1QUQ B;  1FGU A;  1V1P A;  5EPK A;  2RHQ B;  1WTW A;  1EWI A;  1DOL A;  3WOE A;  4B9X A;  3EVQ A; 
#chains in the Genus database with same CATH homology
 1KAW A;  5H1S E;  1OXX K;  3T1H L;  3S16 H;  4C3H H;  3DM3 A;  1VQB A;  1YJ9 A;  2ATW A;  3H0G G;  1HNX L;  1O7I A;  2ZJP A;  1S72 A;  4OX9 L;  4IO9 A;  1QVC A;  1TXY A;  3U58 A;  1IL2 A;  4YCW A;  1PV4 A;  3U4V A;  1PVO A;  1XNR L;  4DUZ L;  3L0O A;  1VQE A;  2B63 G;  1MIU A;  3ULL A;  1VQM A;  1JMC A;  1Q7Y C;  4QQB X;  4YWK A;  2R7Z H;  3TRZ A;  1HZC A;  3Q8D A;  4DV7 Q;  4DV1 L;  1MKH A;  3W1G A;  4LF4 L;  1Q8K A;  4LF7 L;  3UDI A;  5DLQ E;  4A3L H;  4A3E G;  1B8A A;  1CKM A;  3GTL H;  3HOZ H;  2UXB L;  3UDX A;  1ASZ A;  3U50 C;  2R7D A;  1NMF A;  2LSS A;  4R4I A;  3S24 A;  1YHA A;  5GAD C;  5C4J H;  1PH5 A;  2Q2U A;  4B3S Q;  1N36 Q;  2YTV A;  4NXM Q;  3ICE A;  1VQ6 A;  1EQQ A;  1UE7 A;  1EYG A;  4LWC A;  4DR6 L;  3CQZ H;  5C4X G;  4IPH A;  2HT1 A;  1E24 A;  4R4T A;  2I5L X;  3F8T A;  4DV4 Q;  2YYZ A;  4DR5 L;  1GKH A;  4LUZ A;  5LMN L;  4QL5 A;  3CCL A;  2ES2 A;  1L0W A;  4OX9 Q;  1WCM H;  4JI4 L;  3A0J A;  4WJ3 M;  4DUY L;  4GKK Q;  1VQO A;  4GKJ Q;  5BR8 L;  1VQ9 A;  4JI7 Q;  4XTC S;  4IFD I;  4B3M L;  2CCZ A;  4DR7 L;  4DUZ Q;  2F4V L;  1G6P A;  1TWC H;  1RIP A;  1X54 A;  3BU2 A;  3KDF B;  4JBW A;  3TRE A;  2VUM G;  1N32 L;  1B7Y B;  3HOU G;  1XNQ Q;  3J7A 5;  4IOC A;  1WYD A;  2R93 H;  2ALY B;  2XGT A;  5M5Y H;  4A3I H;  4OWT B;  1IBM Q;  2PQA B;  1YVC A;  1QVF A;  4GLV B;  3PO2 H;  3PO3 G;  2BA1 A;  4GN4 B;  2VQE Q;  4A3M G;  4A3D H;  1W2B A;  4A3F G;  3J7Z C;  4EX5 A;  3CCJ A;  4KLK A;  4TQU S;  2UUA Q;  1B70 B;  3GTO H;  4LF9 L;  2N78 A;  1YBY A;  2B29 A;  1OTC A;  3HOZ G;  4A3G G;  1OXS C;  4A3B G;  4IPD A;  4PZ6 A;  2NVY H;  2Z6K A;  3A5U A;  4KHZ A;  3PF5 A;  4IFD J;  4R4C A;  5LMN W;  2OTL A;  2RHS B;  4A3J H;  1S40 A;  4A3C H;  3G71 A;  1KHI A;  5EAY A;  3LGJ A;  4DV5 L;  3HOY G;  3HKS A;  2E2I H;  1WJJ A;  3S2H H;  2GVB A;  5GRO A;  4HIO A;  3TEH B;  5M5W H;  3G4S A;  3ULP A;  4X65 Q;  3PIO A;  4JI1 Q;  1YI2 A;  1N36 L;  2E5L Q;  4LF6 Q;  4JI3 Q;  4KHP Q;  3I4N G;  2K52 A;  3CCU A;  4GKK L;  4GKJ L;  1OXV A;  1JJG A;  1PH1 A;  4B3R L;  3H15 A;  3G6E A;  4BBR H;  1AE2 A;  2UUC L;  2DGY A;  1BBU A;  2ZM6 L;  4QGU A;  3PUY A;  3ULJ A;  1NJI C;  4LF7 Q;  1NBW A;  3GTP H;  1YIT A;  1Y1W G;  3JC6 6;  3RLF A;  1BBW A;  4HJ9 A;  1E1O A;  1I50 H;  4L5R C;  2KCT A;  3PF4 A;  4C3I H;  2BH8 A;  5JJL A;  1PH4 A;  4A3K H;  1P8L A;  3S1M H;  1L1O B;  5FLX c;  2VL6 A;  2JJQ A;  2NVT H;  1KXL A;  4TVA B;  4YHH Q;  4PMW A;  2JA8 G;  2JA9 A;  4A3J G;  2VY3 A;  4YCV A;  2GVA A;  2IT1 A;  4B3T Q;  1YHQ A;  5JEA J;  1X3E A;  2YV5 A;  3J80 i;  1EIY B;  1VQN A;  3RZD H;  1I94 L;  5AJ3 L;  3S1N H;  2CFM A;  4LFA Q;  4DR2 L;  2UXC Q;  2I5M X;  4X66 L;  3AFQ A;  3A5Z B;  1VQP A;  3I4N H;  2RF4 A;  3HOW H;  5JJI A;  2JE6 I;  4DR4 Q;  4DK3 C;  5C44 G;  1EUJ A;  2D0P A;  1XJV A;  1QZH A;  2AWO A;  1SRU A;  1KRS A;  5GQO A;  2JA5 G;  4K0K L;  3HOY H;  2UUB L;  4DR3 L;  2E5L L;  3I7F A;  1WI5 A;  3CD6 A;  4IPC A;  3I4M H;  2MO1 A;  1MJC A;  1X3G A;  4DV2 L;  3KOJ A;  1VQJ A;  3CME A;  4DV6 Q;  1CUK A;  4BY7 H;  2MO0 A;  2OQ0 A;  3PV0 A;  4GLA C;  2YU9 H;  2JEA I;  1N33 Q;  3AEV A;  3M4Q A;  2EIF A;  3BJU A;  4JI2 L;  3PCO B;  4O2D A;  2OWO A;  3M4O H;  4GOP C;  1I94 Q;  1YJW A;  3GTG H;  1UEB A;  4PG3 A;  4JI0 Q;  1SE8 A;  1GM5 A;  3HOU H;  3CC7 A;  5M5X H;  4BXX H;  3BZK A;  3EBE A;  1HR0 L;  2MNA A;  4UP9 A;  4JV5 L;  4DV3 L;  1FJG L;  2CWA A;  3CXC A;  4P71 A;  2JA5 H;  1OXT A;  2OTJ A;  1YNX A;  1PH7 A;  1VQ5 A;  1UWV A;  1CKN A;  4IPG A;  5AJ3 Q;  5M3M H;  5GAE C;  5LMU L;  4DR1 L;  3H3V H;  3RNU A;  1PYS B;  5IWA Q;  2R92 G;  2K75 A;  5C0X J;  1VS0 A;  1HNZ Q;  4OO1 G;  5IYD H;  3J81 j;  4P73 A;  3KF6 A;  5IYC G;  4P75 A;  4DV0 L;  2L15 A;  5IP9 G;  2C35 B;  2WFW A;  3F2C A;  4BA1 I;  5IY0 A;  1JB7 A;  3J81 c;  4MNO A;  3K0X A;  4AYB G;  1YHB A;  2NN6 I;  3HKZ E;  3UE1 A;  3VDY A;  1N34 Q;  1PH2 A;  4AH6 A;  1HJP A;  3CPW A;  3HFZ B;  3NEN A;  4JI6 Q;  1HZ9 A;  4R4Q A;  1HNW Q;  2ID0 A;  5HY6 A;  2NZH A;  4A3G H;  2RCN A;  4UP8 A;  1X55 A;  3FKI G;  2ZTC A;  3UE0 A;  1XPO A;  1PH3 A;  4JC0 A;  4X62 Q;  1CSP A;  5K36 G;  2NN6 G;  1HR0 W;  4IOA A;  4DKA C;  4JOI A;  2A1A A;  3JAM i;  4JBJ A;  4GOP A;  1A8V A;  4A3I G;  1K8G A;  4HJA A;  3FP9 A;  3MEF A;  4JI5 L;  2R93 G;  3NEL A;  1HZB A;  4A3C G;  1NMG A;  3IRB A;  3E0E A;  2Q2H A;  1KQS A;  3HOX G;  1J5E Q;  1YEZ A;  3H0G H;  1HH2 P;  1A62 A;  1TWH H;  2JA6 G;  2QEX A;  2K14 A;  4L5T A;  5ELO A;  4YWM A;  3S2D H;  1Z47 A;  3DLL A;  1YIJ A;  3ZJY C;  4LF8 Q;  3PGZ A;  3S14 H;  1BVS A;  3CC4 A;  1U5K A;  4J15 A;  4LF5 L;  4X6A H;  3A74 A;  3EIV A;  2VQE L;  4DAY B;  4BA2 I;  1L2F A;  3WWV A;  1IBK L;  1MJE A;  2Y0S E;  2XTI A;  2VS1 A;  4GN5 A;  1UE5 A;  2NVX H;  5J3B A;  3W1B A;  1TWF H;  1Q82 C;  2H5X A;  2IHF A;  1HNZ L;  2ASB A;  4A75 A;  1A63 A;  1X56 A;  1L1O C;  1VQ8 A;  2PI2 A;  3GD7 A;  1KL9 A;  1PYB A;  5IP7 G;  3CF5 A;  5C44 H;  4UY8 C;  2F4V Q;  3GTM H;  4DV4 L;  4RG1 A;  3T1Y L;  2KCM A;  4L5S A;  3TQY A;  1LYL A;  3L7Z C;  5IT9 c;  1TWG H;  2Q2I A;  4DR7 Q;  3E9I A;  4GS3 A;  1PH8 A;  1VQ7 A;  3CMA A;  1LM0 A;  1JE5 A;  5BR8 Q;  3PUX A;  1K9M C;  1X3F A;  2R7Z G;  2EQS A;  2KEN A;  1NTG A;  5JEA G;  1V43 A;  2WAQ G;  5IP9 H;  1YZ6 A;  4LF9 Q;  1Y1V G;  5HGQ A;  4WJ4 A;  4DUY Q;  1QVG A;  4ME3 A;  3F2D A;  4HIM A;  4AIM A;  2VQF L;  4KHP L;  3I55 A;  1VQ4 A;  5ELN A;  1N33 L;  2R92 H;  3AQQ A;  1QZG A;  1VQK A;  1S3O A;  1UE1 A;  2UUC Q;  1EOV A;  4JCV E;  4DV5 Q;  4DR5 Q;  1IBL L;  1Q12 A;  1FVI A;  1XNQ L;  4JBM A;  4HJ7 A;  1KRT A;  4A3D G;  4X65 L;  4AQY Q;  4NXN Q;  4B3S L;  1JJ2 A;  4IJH A;  1IBM L;  3PO3 H;  4MZ9 A;  1N9W A;  3L2P A;  1Q86 C;  4JI4 Q;  4JYA Q;  3AFP A;  3OYY A;  4LUO A;  2A8V A;  2F3I A;  4JI6 L;  1W3S A;  4BXX G;  1IXR A;  1XMO Q;  1I3Q H;  4GNX B;  3S1Q H;  4POF A;  1K73 C;  2YTY A;  3PUW A;  1KD1 C;  1XNR Q;  5IYD G;  3K8A A;  1EFW A;  3CCS A;  4BBS H;  4YCU A;  4HID A;  1Q46 A;  3CCQ A;  5LMN Q;  1K0R A;  1P16 A;  4EQ5 A;  1I5F A;  4BY1 G;  1G29 1;  4A76 A;  3HKZ G;  4JG2 A;  4DPG A;  4ALP A;  3HOW G;  1Q1B A;  3GTJ H;  1VQD A;  3KFU A;  1WCM G;  1VQF A;  1WOC A;  4P74 A;  4GNX A;  1ASY A;  1VQG A;  4JI7 L;  2UXB Q;  1Y14 B;  3BZC A;  4HIK A;  3U4Z A;  3UDG A;  2HHH L;  2CKZ B;  4MTN A;  4OWW B;  4QY7 A;  2Y0S G;  3PSI A;  1K83 H;  2VQF Q;  2VUM H;  4JYA L;  3KJP A;  2ZJR A;  4JBK A;  3KYH C;  2B63 H;  4A93 H;  3M85 A;  3T1H Q;  4NXM L;  3S1R H;  2IHE A;  4OON A;  2OQK A;  1Y1W H;  2YTX A;  2NVQ H;  3M7N A;  5FJ8 G;  4NXN L;  1DGS A;  2KHI A;  4Y7N H;  3CCV A;  4AQY L;  4DR6 Q;  1BKB A;  1D7Q A;  2Q2T A;  2IX1 A;  4A3L G;  3NBH B;  5C3E G;  4YY3 Q;  4DV1 Q;  3CCE A;  1X6O A;  4LW1 A;  4JI5 Q;  3KF6 B;  2ZTD A;  1KIX A;  1XMO L;  2A19 A;  4LUV A;  2JA8 H;  1IZ6 A;  2QGQ A;  5IYB H;  3D31 A;  1XPU A;  2FXQ A;  1IYJ B;  4JV5 Q;  2VNU D;  1HZA A;  1J5E L;  3T1Y Q;  5IYC H;  4LF4 Q;  2OCE A;  2AWN A;  1C9O A;  3RN5 A;  1PH6 A;  1SRO A;  3ER0 A;  3E9H A;  1KC8 C;  5IWA L;  3H3V I;  4XIG S;  1AH9 A;  5E7N A;  1HNW L;  1V1Q A;  1E1T A;  2HIX A;  3B6Y A;  4P72 A;  3RLO A;  4A3M H;  5LMU Q;  4GNX C;  3GTQ H;  2WB1 G;  2D62 A;  1VQH A;  4X62 L;  1J6Q A;  2VW9 A;  5M3F H;  4DV2 Q;  3RN2 A;  3STB C;  2E2J H;  1HNX Q;  4LFB Q;  4DV3 Q;  4PZ7 A;  5IYB G;  1A0I A;  1AE3 A;  2EXD A;  4B3M Q;  1T9H A;  2UU9 L;  2JA7 H;  3GO5 A;  4LNQ A;  1JJC B;  1IBL Q;  4A3B H;  4A93 G;  1C0A A;  3J80 c;  1VQA A;  5GAH C;  3CW2 C;  1XMQ L;  1IBK Q;  4DR4 L;  5FJ8 H;  2B3G A;  1JT8 A;  4X64 Q;  5FLM G;  4IFD G;  4OO1 I;  2Z0S A;  2D0O A;  2KBN A;  2LXK A;  4HJ8 A;  3K7A H;  3I4M G;  4LF8 L;  1XPR A;  2UXD L;  3PUV A;  1K3R A;  1SR3 A;  3F1Z A;  3KJO A;  4BBS G;  1E22 A;  4LF6 L;  3KF8 B;  3OTO Q;  3NEM A;  4OXP A;  1YJN A;  2AKW B;  4KI0 A;  2I5H A;  5C4X H;  4A4I A;  1G51 A;  1Q81 C;  2PI2 E;  4GN3 B;  4DNI A;  3RZO H;  2IX0 A;  4DK6 C;  4LF5 Q;  3KDF A;  4RMF A;  1N34 L;  2JEB I;  2F52 A;  4A3F H;  3FHW A;  3K7U C;  4JI8 L;  2PMZ E;  2Z6K C;  3W5O A;  1CSQ A;  4NPS A;  2E8G A;  1SFO H;  2HQL A;  2ZTE A;  1PA6 A;  4LFC L;  3PO2 G;  1TWA H;  3RR5 A;  2BA0 A;  3PUZ A;  4X64 L;  2JQO A;  2KHJ A;  4YWL A;  2GN5 A;  1X9N A;  4JOI C;  3M9B A;  3OW2 A;  1VQC A;  3D0F A;  4APV A;  1PHJ A;  2NZO A;  1N8R C;  3CC2 A;  1E3P A;  4JI2 Q;  3CAM A;  3I56 A;  4A3K G;  3S17 H;  1EIF A;  1Q1E A;  2MFI A;  4DV0 Q;  2K50 A;  4DR1 Q;  2PNH A;  4DR2 Q;  1M1K C;  2UXC L;  1EQR A;  2R7F A;  3AYH B;  4QJF A;  2LXJ A;  4BY1 H;  2K5N A;  2JK8 A;  4LFB L;  1R9T H;  1RL2 A;  5JJK A;  3UDF A;  4BBR G;  3CCR A;  4GOP B;  1SMX A;  3PIP A;  1NE3 A;  3STB D;  1HR0 Q;  2QA4 A;  3EN2 A;  2UUB Q;  3MXN B;  2JA7 G;  1K8A C;  3I4O A;  4B3T L;  3M3Y H;  4OWX B;  4Y52 H;  4DAM A;  3F2B A;  4K0K Q;  4JI1 L;  3TS2 A;  4IJL A;  3RLN A;  4C2M H;  2DUD A;  1XMQ Q;  1U0L A;  3J81 i;  1SN8 A;  4QIW E;  5M3F G;  3S15 H;  4B3R Q;  2CWP A;  1GO3 E;  3M4P A;  3K81 C;  5C3E H;  4DV6 L;  1VQL A;  2E2H H;  1Z9F A;  3TS0 A;  1FJG Q;  1VQI A;  4C3J H;  4A3E H;  2UU9 Q;  1L1O A;  1LTL A;  1UE6 A;  2VZA A;  2AMC B;  4L5Q A;  5IE8 A;  1PH9 A;  1C7Y A;  1PFS A;  1WFQ A;  3HOV H;  3G48 A;  1QUQ A;  1LUZ A;  4FDB A;  5M3M G;  2BH2 A;  3JAM c;  5C0X I;  1Y1V H;  4POG A;  4BY7 G;  2N8N A;  1XTD A;  3ERS X;  5IP7 H;  1CKO A;  2WAQ E;  1X65 A;  3K80 C;  2N3S A;  2ZM6 Q;  1SLJ A;  4DR3 Q;  4NB3 A;  4JI8 Q;  1M90 C;  4R4O A;  4LFA L;  2UXD Q;  1CKN B;  1N32 Q;  3KLW A;  2ZJQ A;  4JI0 L;  4LFC Q;  4O0A A;  3I2Z A;  3OTO L;  4YY3 L;  3CP0 A;  1D8L A;  4UP7 A;  1GVP A;  2AHO B;  1GD7 A;  1VCI A;  2PQA A;  4JI3 L;  5FLM H;  3GTK H;  4UPA A;  3SGI A;  2WB1 E;  5C0X G;  3CPF A;  2JA6 H;  2IY5 B;  3HOV G;  2HIV A;  1V9P A;  2I0Q A;  2K5V A;  2WP8 J;  3FKI H;  5GAG C;  3HOX H;  1NY4 A;  1OXU A;  4H02 A;  2K4K A;  4PZ8 A;  4HJ5 A;  4GLX A;  2R6G A;  3CCM A;  1E7Z A;  2N49 A;  2CQO A;  2MQH A;  2HHH Q;  1QUQ B;  1I6H H;  4DV7 L;  4X66 Q;  1FGU A;  4R1J A;  2RHQ B;  1H95 A;  1EWI A;  2UUA L;  4AYB E;  2K5H A;  4YHH L;  1FL0 A;  2V1C C;  3GDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...