4DR1L

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1L00
1CSQA 1FJGQ 2R93H 5IYDG 3PF5A 5GADC 1TWHH 1WI5A 2F4VQ 2IY5B 3S15H 1HR0W 3HFZB 1I6HH 4JI5Q 4GKKL 1PVOA 2KHJA 3CPFA 3F2DA 1HNZL 3HKSA 1VQLA 3TRZA 4X64L 4GLXA 1VQGA 1EUJA 2E8GA 5K36G 2B63G 4OX9L 1KAWA 4DR3Q 4JI6Q 3RZOH 5M3MG 1JJCB 4IJLA 1S72A 4LUZA 2KBNA 2JA8G 2IHEA 1Q81C 4Y7NH 3PV0A 4LFAL 1N34L 4JI0L 3S1NH 1WYDA 4LF8Q 3W1BA 1VQJA 2KCTA 2OQKA 4AQYL 4X66L 1CKOA 2D0OA 4BY7H 3S1QH 3RLOA 4LF7L 2C35B 4YY3Q 4LF9L 4C3IH 3GD7A 1IYJB 1V9PA 1CKNB 2EIFA 3SGIA 3TQYA 3KJPA 4DV5Q 1PH1A 1MKHA 3PO3H 1K9MC 1W3SA 3HOXG 1PH3A 4IO9A 4YHHL 2GVBA 2UUAL 1C9OA 2ZTEA 1G51A 5GAHC 3MXNB 5C4JH 1K73C 1FJGL 1QUQB 2R7ZH 1HNWQ 1Y1WH 2F4VL 1Y1VG 4A3CG 2UXCQ 4JI5L 4BBSH 4TQUS 2K5HA 3CCMA 4NXNL 1YNXA 1YIJA 1XPOA 5IP9H 2MFIA 2UU9Q 4A93G 2CWPA 1UE7A 1GD7A 2GN5A 4A3BG 1WCMG 4R4IA 4JOIC 1WOCA 3CP0A 4LF4Q 4A3DH 2CCZA 3JAMi 4JI6L 4YWLA 4DR3L 2Q2IA 3J80i 4YWMA 3J81i 3PF4A 4GN5A 2EXDA 4IOAA 4B3SQ 1A63A 4A3GG 2RHQB 1HR0Q 4JI4Q 3AYHB 4PG3A 4L5RC 5C0XG 4DAMA 4L5QA 2ES2A 3EBEA 1MIUA 1VQFA 3F2BA 2NN6I 4YY3L 1JJ2A 1YZ6A 2VQFQ 5LMUQ 4DV5L 2I0QA 1VQDA 4IPGA 4DK3C 3M7NA 1KQSA 2HT1A 1A62A 1EYGA 1KRSA 1L1OC 4R4QA 1VQCA 1XMOQ 4DUYQ 4A3FH 2NVXH 5C4XG 1DGSA 1HNWL 1D7QA 1V43A 4GNXB 4R1JA 3DLLA 2AWOA 4GNXC 3GTMH 3K8AA 1BKBA 5C0XJ 2UXCL 2KENA 1O7IA 2QGQA 3PUZA 2Q2TA 2UU9L 5IWAQ 4JI7L 4RG1A 1K83H 2WP8J 2Q2UA 1PHJA 4FDBA 4MNOA 2HHHL 1OXXK 1PYBA 5C3EG 4A3KG 1PH5A 2JA7G 3PCOB 3PO2H 2OTJA 1VCIA 4NB3A 1Q1BA 2UXBL 4WJ4A 2EQSA 3CCJA 3CAMA 1KL9A 1E1OA 4R4OA 5M3FH 3CXCA 1HZBA 1UE5A 2BA1A 1Q8KA 3HKZG 3K7UC 2Z6KA 2R92G 1HR0L 2PI2A 4OO1G 1VQHA 1TWGH 3AFQA 1C0AA 1HZ9A 3W5OA 5IP7G 4UP7A 1EIFA 3M3YH 3FHWA 1QVGA 2A19A 4AYBG 3F1ZA 5LMUL 1NY4A 3CC4A 4R4CA 1I3QH 1HZCA 2PMZE 4GN3B 2K5NA 4ALPA 4LFBQ 3MEFA 3S14H 4A4IA 1XMOL 2PI2E 1AH9A 2K4KA 3E0EA 2R7FA 4ME3A 3HOYG 1EFWA 2GVAA 1PA6A 3NENA 4A3JG 4DR7Q 3CC7A 1H95A 1NMGA 5LMNW 3FP9A 1NJIC 1WJJA 1FGUA 4DPGA 1U0LA 2R7DA 3HOZG 1E1TA 5IWAL 2AHOB 4BXXG 3K81C 1QZGA 2NVTH 1YHAA 3STBC 2B29A 3CCSA 5GQOA 5IT9c 1X9NA 3CD6A 4DNIA 2L15A 2KHIA 4LWCA 4JV5L 2JA5G 2YTVA 4X6AH 1PH8A 5C44H 3TS2A 3F8TA 1X56A 1SR3A 4NPSA 2E2HH 1N9WA 1K8GA 4P74A 3PGZA 3I4OA 1NE3A 4POFA 4POGA 1Z47A 1CUKA 4BBRG 3CCQA 3ULJA 3BU2A 2JA6H 2H5XA 4LFBL 1IBLL 2JEAI 5IE8A 1YJWA 2VUMH 3EN2A 5BR8Q 1BBWA 1N36Q 2BH8A 3KDFB 2A8VA 3PUYA 1TWCH 2OWOA 3I4NH 4QJFA 4YCVA 5M5WH 2Y0SG 3CC2A 4QQBX 3M4PA 4H02A 2Y0SE 1VQMA 1PH6A 4WJ3M 4DR4Q 4LUOA 5GROA 2YU9H 1EIYB 1L0WA 4KHPQ 3JAMc 2DUDA 1B70B 1JMCA 3J80c 1JE5A 1NBWA 3UDIA 3J81c 1J5EQ 4GOPB 1AE3A 3GDEA 1IBKQ 1BBUA 2K50A 3J7ZC 1M1KC 1YBYA 4JCVE 2HQLA 1I94Q 2UUBQ 4A3CH 3DM3A 2F52A 2JE6I 5LMNQ 1VS0A 3HOVH 2ID0A 4J15A 1GVPA 3M85A 3JC66 4A93H 4DR1Q 3S1RH 1JB7A 1IZ6A 1YHQA 3WWVA 4JOIA 5JJKA 1OXUA 1X3EA 4GKJQ 4PMWA 3E9HA 2VUMG 2I5MX 4OWWB 2VL6A 3OYYA 1MJEA 1CKMA 4IFDG 5BR8L 2VQEQ 1RIPA 1Q7YC 4B3RQ 1TWAH 3K0XA 3AEVA 2HIVA 4BA1I 1ASZA 2OQ0A 2VW9A 4DV1Q 3M4OH 1I5FA 4DR4L 1X3GA 1XTDA 3AFPA 4IPDA 5FLXc 4HJAA 4BY1H 4A3MH 3OTOQ 4MZ9A 4KHPL 1UE1A 3A0JA 1L1OA 4DAYB 4K0KQ 2I5HA 1IBMQ 2JEBI 1LYLA 1SE8A 5H1SE 3D0FA 1VQ4A 4X62Q 1IBKL 3ZJYC 4GNXA 5FLMH 1AE2A 4LF8L 2DGYA 1I94L 2UUBL 2I5LX 2K75A 2N3SA 3S2HH 1S3OA 3KF6A 5IYBH 2IX0A 4QGUA 3H15A 2VZAA 5LMNL 1XNQQ 3H3VI 2LSSA 4BY7G 3VDYA 3HOWH 5IYCH 1YJ9A 2ALYB 3GTOH 4PZ8A 3TREA 4A3KH 3Q8DA 2JA7H 4JBWA 5AJ3Q 4UPAA 4HJ8A 3U4VA 5JEAG 3PO3G 4GKJL 1W2BA 2A1AA 1HNXQ 1VQNA 3KFUA 2UXDQ 4JI3Q 2N78A 3NEMA 2MO1A 1L2FA 4DKAC 3CCRA 2R7ZG 5GAGC 3L7ZC 1GM5A 5GAEC 1OXSC 4GLAC 1Y1WG 2VQEL 2R92H 4P72A 3BZCA 4B3RL 4A3LH 1UEBA 5IP9G 1Q82C 5C0XI 3S1MH 3RN2A 4HJ9A 2NVQH 4UY8C 4DV2Q 1SN8A 4LF4L 3OTOL 1TXYA 4A3DG 2XTIA 3G48A 3S16H 4K0KL 2CQOA 3S24A 3S17H 1K0RA 1RL2A 4B3SL 4A75A 4JI4L 1X55A 1SRUA 3J7A5 2PQAA 3HKZE 3KLWA 1SMXA 4LW1A 4A3JH 3S2DH 2NZHA 3H0GH 4APVA 3LGJA 3STBD 4L5SA 1XNQL 5ELOA 3T1YQ 1GO3E 3D31A 2VQFL 4KHZA 4BXXH 3J81j 4DV3Q 1VQIA 4XIGS 4AYBE 1M90C 1Q46A 2FXQA 2PNHA 5AJ3L 1Q86C 1KC8C 5FJ8H 3I2ZA 4DR2Q 4DUYL 1HNXL 2K14A 4A3FG 3CCLA 4JI3L 3B6YA 2UXDL 4A3IH 2ZTDA 3E9IA 4A3EG 3PSIA 5HGQA 1QZHA 1LTLA 3I56A 3RZDH 4B3TQ 4OO1I 2D0PA 4DK6C 3RNUA 2AMCB 2JJQA 4JI1Q 4DV2L 2IT1A 4PZ7A 5DLQE 3U50C 4HIDA 4HJ7A 1VQ8A 2Q2HA 3I4MH 4DV0Q 2WB1G 3W1GA 4DV7Q 5IYDH 5JJLA 2WB1E 3GTPH 1G6PA 1VQBA 1FVIA 4R4TA 3U4ZA 4GKKQ 3PIOA 1SROA 4LF6Q 3IRBA 2ZJQA 4C3HH 4X64Q 4X65Q 2B63H 3BZKA 1P8LA 1N33Q 1YVCA 1PV4A 5JJIA 5M3MH 1X6OA 2JA8H 1SLJA 3FKIG 3CW2C 4JI8Q 4JBKA 2MQHA 4DR7L 1E3PA 1FL0A 4HJ5A 1J6QA 2JK8A 1PYSB 1YJNA 1X65A 2LXKA 3CMEA 3A5ZB 4LFCQ 1UE6A 3K80C 3RLFA 1CKNA 2ZJRA 4BA2I 4XTCS 1VQ9A 4TVAB 4B3TL 3CQZH 1XNRQ 4O2DA 2YTXA 1X3FA 3HOXH 1PH9A 1QUQA 2UUAQ 4GN4B 2ZTCA 4IJHA 4GOPC 3T1HQ 4DV7L 1EOVA 1Y1VH 2CKZB 3H3VH 4RMFA 3KOJA 4LUVA 5C44G 3KJOA 2E2IH 1LUZA 3GTKH 1G291 4NXNQ 3KF8B 3PUWA 2AKWB 5M5YH 3CF5A 4LF6L 3U58A 2AWNA 1PH4A 3HOUG 1WCMH 1R9TH 4A3BH 2ZM6Q 3ER0A 4JG2A 4MTNA 1E22A 4X65L 1IL2A 2NVYH 1N8RC 3GTGH 1K3RA 2YTYA 5M5XH 4Y52H 4UP8A 1XJVA 3GTJH 2UUCQ 1N33L 1Q12A 2KCMA 2R93G 2JA6G 4A76A 4B3MQ 1VQ7A 1KHIA 1N36L 4JI8L 4A3GH 4UP9A 3UE0A 3K7AH 1YITA 3I4NG 1YEZA 3PIPA 2K52A 4IPHA 3F2CA 1KIXA 1NMFA 4LFCL 2IX1A 4JI2Q 1HJPA 2D62A 1VQOA 2OTLA 1OXVA 3A74A 1XNRL 4JC0A 1N32L 1JT8A 1EQRA 1WFQA 1J5EL 4IPCA 4OWTB 5J3BA 5C4XH 4EX5A 2VNUD 1B8AA 4IFDJ 4L5TA 4QIWE 4OONA 3T1HL 1Y14B 1NTGA 3GTLH 4NXMQ 2NN6G 4IFDI 1CSPA 3HOVG 3EIVA 4EQ5A 4P71A 4DR1L 1OXTA 3I55A 4LNQA 4JI7Q 2N49A 5C3EH 2WFWA 3KYHC 1VQPA 2ZM6L 2HHHQ 1XPUA 4DR6Q 3NELA 3RR5A 4JBMA 3UE1A 2Z0SA 2ZJPA 3TEHB 2UXBQ 2ATWA 2UUCL 4LF5Q 4AH6A 4B3ML 2QA4A 1E7ZA 4YCWA 1EWIA 1PH2A 2WAQG 1B7YB 1E24A 5EAYA 4BBSG 2WAQE 1VQEA 5E7NA 4DR5Q 3A5UA 2CWAA 1HH2P 2QEXA 5IP7H 3CMAA 2ASBA 3PUXA 4DV1L 4HIOA 4JI2L 1BVSA 3G4SA 5IY0A 4BY1G 1I50H 4A3MG 5JEAJ 3CCEA 1HZAA 2MO0A 1A8VA 1IBML 4HIMA 1L1OB 4O0AA 4DV6Q 3AQQA 3TS0A 1XMQQ 1XPRA 4X62L 1U5KA 3HOYH 1C7YA 5FLMG 4DUZQ 1VQKA 4KLKA 2BH2A 1IXRA 4A3EH 4NXML 2E2JH 3HOZH 4C2MH 5IYBG 3KF6B 1K8AC 2F3IA 5IYCG 3HOWG 1T9HA 2E5LQ 3RN5A 2MNAA 4C3JH 4DV4Q 4DR6L 4HIKA 2JQOA 4KI0A 2JA5H 4LF5L 3CCVA 1PH7A 4JV5Q 3UDFA 2V1CC 3GTQH 1VQ5A 1Z9FA 1Q1EA 1TWFH 2LXJA 3ULLA 1VQAA 2XGTA 4DR5L 3OW2A 1YI2A 4A3LG 4JYAQ 1JJGA 3I7FA 3UDGA 3M4QA 1KD1C 3L2PA 3ERSX 3PO2G 2YV5A 4BBRH 3CCUA 4QL5A 2N8NA 4JBJA 4QY7A 3M9BA 4PZ6A 2RCNA 5M3FG 1A0IA 4P73A 1EQQA 4DV6L 3FKIH 3KDFA 1IBLQ 1XMQL 1N32Q 1UWVA 4DUZL 2Z6KC 1MJCA 2PQAB 3GO5A 3H0GG 1HNZQ 1QVFA 1VQ6A 1GKHA 3T1YL 1PFSA 2IHFA 3RLNA 3G6EA 2CFMA 4OWXB 1X54A 4DV3L 4YWKA 4OX9Q 3L0OA 2R6GA 4YCUA 3ICEA 2VY3A 2YYZA 2JA9A 1P16A 2RF4A 1S40A 2E5LL 3CPWA 1ASYA 2HIXA 4DV4L 4DR2L 1YHBA 2VS1A 3BJUA 4GOPA 5FJ8G 3PUVA 4LFAQ 2NZOA 1V1QA 3ULPA 1N34Q 1OTCA 4JI0Q 2OCEA 4IOCA 4A3IG 4GS3A 4X66Q 5ELNA 4AQYQ 4P75A 2RHSB 1SFOH 1KRTA 2B3GA 4LF7Q 3NBHB 3G71A 4JYAL 4LF9Q 1KXLA 4AIMA 5HY6A 1D8LA 3HOUH 4JI1L 4OXPA 1LM0A 1QVCA 4GLVB 4YHHQ 4DV0L 3UDXA 3I4MG 2BA0A 2K5VA
chains in the Genus database with same CATH superfamily
1CSQA 2R93H 2K01A 3SXHA 4JI5Q 1WVLA 4GKKL 2KHJA 2V4DA 3TRZA 4X64L 5KNBA 5K36G 2PZTA 4DAYA 2Y0SB 1KAWA 3C46A 3VR4A 2KBNA 2JA8G 1Q81C 4Y7NH 3PV0A 5C4HA 2MPMA 2KCTA 2A6HC 4X66L 2D0OA 2DJFC 4BY7H 1G2TA 3RLOA 2EJMA 3TN2A 4LF9L 1V9PA 1WTPA 1EFID 3BVMA 1E2ZA 1MKHA 2AQ2B 3HOXG 4DU9A 3SHLA 2LS01 1ICFB 3A54A 5GAHC 1FJGL 1HNWQ 2B2UA 3F2UA 2L1BA 4K5XA 4U68A 5IGBA 2CH4A 3T16A 4BBSH 1XPOA 1YNXA 2UU9Q 4KTAA 1STHA 2MFIA 3FPPA 2CWPA 1MHWC 1GD7A 4LMQD 5CYUA 1C8CA 1WOCA 4LF4Q 4A3DH 2HUGA 3PF4A 2RHQB 1SYDA 3GTJB 3SK6A 1HA5A 5IIFA 3EBEA 5A2QE 3NHHA 2WV6D 3QB3A 1JJ2A 1EY6A 1VQDA 3K59A 3S1QB 2M00A 5JPMC 2DN8A 2NVXH 3DEOA 1H9KA 1QOHA 3QO2A 2Z6BA 2AWOA 4GNXC 3PO3B 3LX0A 2KENA 1Z6HA 1FGBD 4RG1A 1PHJA 1HQMC 1Y1WB 3PO2H 5C3EG 1PH5A 2O4XA 2J0TD 3PCOB 5JPNC 1IW7C 4KJNA 3CXCA 3K7UC 1EYCA 2PI2A 1ML0D 2O2LD 3L3OC 2K33A 3AFQA 4IUUA 4IURA 2F0FA 1GJXA 1NY4A 4R4CA 2PMZE 2K5NA 4G7OC 5A35A 3E0EA 1U9RA 1H95A 4NMZA 5LMNW 1NJIC 1F9SA 1Z7TA 3STBC 5NUCA 5GQOA 5IT9c 1GUWA 1X9NA 3Q24A 2L15A 3S9WA 2Z4IA 1PXUA 3F8TA 1X56A 4NPSA 2E2HH 2QDLA 3PIP3 1T5XD 4POGA 4EQPA 2G9HD 3BU2A 2JA6H 2H5XA 4DAVA 2JEAI 1T5EA 1YJWA 4QQBX 2Y0SG 3CC2A 3D4RA 1VQMA 3FKIB 3S14B 1ILQA 4OIKA 1FNWA 1L0WA 3DWPA 1GUNA 1UNSA 3UDIA 3J81c 1J5EQ 1AE3A 3DM1A 5JVG3 5FOBB 1FYCA 1I94Q 2UUBQ 4A3CH 2K32A 1JOKA 3QJYA 4A93H 3I90A 4LK1C 3WWVA 4JOIA 5C44B 1X3EA 4DF7A 5JJKA 1JWMD 2KCCA 2P5ZX 4TRDA 4PMWA 5D65A 3OYYA 4CDEC 4IZ8A 4PMCA 4KJOA 1MSHA 1L0YB 5C5LA 1SYBA 4BA1I 2VW9A 3C3LA 1LTTD 1Y8PB 4A3MH 4CBVA 5M5WB 1UE1A 4K0KQ 2I5HA 3NQTA 1SE8A 5H1SE 1IBKL 3I70A 3ZJYC 1AE2A 3S2HH 3KF6A 2IX0A 4QGUA 5ELBA 2VZAA 3HOWH 3TREA 5AJ3Q 1ENAA 4UPAA 4HJ8A 3PO3G 4GKJL 2A1AA 1JORA 3NQIA 3NEMA 4Q5VA 4DKAC 1PTOD 1OXSC 4GLAC 4B08A 4DNRB 1Y1WG 3BZCA 2B2UC 4B3RL 4A3LH 1UEBA 4UY8C 1SN8A 3DHQA 4BBSB 1TXYA 3S17H 1GHJA 3M4OB 1HFGA 4A75A 1SRUA 3KLWA 4LW1A 3JAML 3H0GH 1XNQL 4R8IA 4KY6A 2VQFL 4KHZA 4BXXH 3J81j 3G6JB 3AMUA 1V1PB 3I2ZA 2K14A 2UXDL 4JI3L 5DEHA 4CJ1B 4A3IH 2JA7B 1W6JA 3K5MA 4FF4A 2Q8RE 3NBHA 5HGQA 1LTLA 1EQVA 1MD2D 3BZDB 1SYFA 1IL8A 3BVZA 2AMCB 3I4LA 2R92B 1VQ8A 3NTHA 1D5ZC 1EY5A 5JJLA 3PO2B 2NVQB 4R4TA 4HTHA 1BF4A 5C4ZA 3VYTA 4GKKQ 1SROA 4C3HH 4X64Q 2RQXA 3RMHA 1HTLD 2OXPA 3MTSA 1BBXC 1XWEA 1X6OA 2JA8H 3FKIG 2F03A 2HQEA 4HJ5A 1FL0A 3SEBA 4YIJA 1EZ6A 1PYSB 1SJED 1YJNA 3CMEA 1PRTB 5ELFA 2CW0C 1CKNA 5ELEA 1PFBA 3HOXH 1PH9A 1OO9B 3MXNA 2XRQD 3C1EA 3UI2A 3MFGA 4K8IA 3K6OA 4GN4B 3RZDB 4KK7A 3LWEA 2CKZB 4M1UB 2QEJC 2CH4W 1SEBD 4RMFA 5C44G 3I4MB 4IUTA 3QOLA 3J7YW 1QCBD 3PUWA 3CF5A 3P1HA 3U58A 3HOUG 1PH4A 2ZM6Q 3ER0A 2E2HB 2NVYH 2RKSA 1BCPB 1N33L 4JVZA 2B2YC 3QWNA 2DNEA 2R93G 1TS3A 3K5LA 3ND9A 4B3MQ 1N36L 2F3VA 1CTMA 1RF2D 3MFYA 1JB3A 3K7AH 1YEZA 3PIPA 4IPHA 3VA5A 3D6CA 1NMFA 2IX1A 4RGNA 1CFMA 4CDCC 1B9MA 1WFQA 3TZDA 2HDLA 5J3BA 3JAME 4L5TA 1NTGA 1C4QA 1SE2A 5IT9L 1RDPD 1I4HA 2BOSA 1IYVA 3EIVA 4G4KA 1CT1D 3T13A 1OXTA 2F0UA 5C3EH 2WFWA 2XSCA 1S5ED 3RR5A 1F2LA 2D5DA 3PMFA 2R61A 2QA4A 1E7ZA 1R9TB 4XYQA 2ICIA 4LJZC 2WAQG 1PFMA 1E24A 5EAYA 4BBSG 1VQEA 3SVMA 3ERQA 3A5UA 2QEXA 4HR7B 4KY5A 4F87A 5JEAJ 2XWJB 1EYAA 1IBML 2BE5D 1Q8IA 4X62L 1C7YA 1VQKA 2A5HA 2K5QA 3J81L 4A3EH 5IYBG 1Y8OB 1RHPA 2JP1A 4S3SA 1DJRD 2WINB 2F3IA 1T9HA 3PIO3 3GTLB 3RN5A 4DR6L 1KAAA 1AFPA 2KJXA 3LNNA 1PH7A 3UDFA 4UAIA 1Z9FA 1KABA 4FF2A 1QNUA 2KVMA 3ULLA 2ENBA 3I7FA 3PO2G 2YV5A 3CCUA 4QL5A 2N8NA 4JBJA 4IALA 3M9BA 2EY6A 2L9HA 1A0IA 4P73A 4DV6L 3KDFA 4DAPA 5CV4A 1G8ZD 4AYBB 4HCSA 3D3RA 1UWVA 4DUZL 5EKKA 1HNZQ 3GO5A 1QVFA 1AN8A 3L0OA 4YCUA 1WTVA 4DR2L 3BJUA 5FJ8G 4XQQA 4LFAQ 1N34Q 3ULPA 3K57A 2VB2X 4C3JB 5T1GA 4OHJA 2RHSB 2K5WA 4AIMA 1CZGA 3BYYB 1HQRD 1QNKA 5T1IA 3I4MG 1MBYA 3EFXD 3PF5A 5GADC 2F4VQ 2IY5B 4BBRB 3HFZB 4K6LA 1I6HH 5BN4A 2G9DA 1K8OA 3F2DA 2AUJD 1HPCA 1R4PB 1VQGA 1IKMA 4OX9L 5BN5A 5LHY1 4JI6Q 4DR3Q 1JJCB 1BUVT 4HSVA 2B2WA 2OEOA 3W1BA 1VQJA 5CBEE 1DCZA 2OQKA 4AQYL 1TVXA 1CKOA 3H6MA 3S1QH 4LF7L 2C35B 2EIFA 2OF1A 1V1OA 1I6VC 3PO3H 1K9MC 4ODGA 1PDQA 2GVBA 1C9OA 2ZTEA 4PQXA 1QUQB 4LAAA 1ZXTA 1A2UA 1Y1WH 2LY7A 4A3CG 2UXCQ 4TQUS 2K5HA 4A93G 4KKTA 3A55A 2GN5A 1TWHB 3S15B 2H1EA 2EYLA 2Q2IA 3J80i 1A63A 2EXDA 1HR0Q 2A6EC 3RZOB 2F0TA 3F2BA 2L5TA 2NN6I 4YY3L 1WTRA 3V2TA 2VQFQ 3S1NB 4DV5L 4IPGA 5COYA 1PMRA 5EBCA 4R4QA 1VQCA 1A3VA 3LWUA 4UHVA 1LABA 4GNXB 4R1JA 1RCVD 1BKBA 1M4VA 4X3SA 5C0XJ 2QGQA 3GP7A 5IWAQ 4JI7L 2R7ZB 2G5DA 3MWYW 2HHHL 1OXXK 1PYBA 2EYJA 1VCIA 1PLFA 1FD7D 1E1OA 1G2SA 2SNMA 4ZCKA 1FNUA 1FR3A 1Q8KA 2A73B 1BQQT 5C3XA 3NWSA 3MXGA 1C0AA 1HZ9A 5IP7G 1EIFA 5A2QL 3FHWA 2A19A 4AYBG 3F1ZA 2EJGC 5LMUL 5EKLA 2K04A 3MEFA 3S14H 1XMOL 2IWHA 1SYCA 4DK1A 1F2ZA 1STAA 1TS4A 1CA5A 3FP9A 4J8QA 1FGUA 4DPGA 4A3FB 4I7ZC 3GV6A 2AHOB 4BXXG 2CHBD 3SK4A 1TS2A 4A3EB 5HGTA 4ZK9B 3VR5A 4C3JG 3CD6A 1FNVA 5IGDA 4LWCA 2BDOA 1NCVA 4X6AH 4RWSC 1PH8A 5C44H 1SE3A 3KF8A 2NBFA 5CR3A 3X3MA 5M3FB 2IJ0A 1NE3A 5C6AA 1Z47A 4BBRG 3PQIA 3CCQA 3ULJA 1TWGB 1SYGA 2PW5A 1F2MA 4KHVA 5FO7B 4LFBL 5KNDA 3OW7A 2B2TC 5IE8A 4F7XA 5BR8Q 2HCCA 1BBWA 1N36Q 2K5DA 2EZVA 3PUYA 1II3A 4QJFA 5M5WH 3A56A 1WD0A 4RH6A 1PH6A 4MN3A 4C3HG 4LUOA 3DWQA 3I73A 3JAMc 2IPKD 5KYIA 4GOPB 1KDBA 1BBUA 3J7ZC 2NVTB 1M1KC 1YBYA 2AQ1B 2HQLA 3DM3A 2JE6I 3C1FA 1VS0A 3M85A 1JB7A 1IZ6A 1YHQA 1TT2A 1GUTA 1A15A 1OXUA 2I07B 2I5MX 2NB0A 1EU4A 2PPBC 1NR4A 4RKBA 3QR8A 1ESFA 2TSSA 1MSGA 2VQEQ 2RSOA 4FXDA 3KLSA 3M4OH 4DR4L 1I6HB 2B2VA 4HJAA 4IPDA 1DONA 3OTOQ 4KHPL 1L1OA 3A0JA 4DAYB 5EBDA 1IBMQ 5L37A 3U9OA 4X62Q 4TSSA 5C5MA 2F0PA 5EQ0A 2DGYA 2K75A 2B2WC 4ZAIA 5IYBH 5LMNL 2LSSA 1UUPA 3NXWA 2JA7H 1TY0A 2BCOA 1YNNC 3IL8A 3HOVB 5JEAG 1W2BA 4CKEA 2RCFA 4HSPA 1VQNA 4K6DA 2R7ZG 5GAGC 3IFDA 2F0HA 1H9MA 3TP5A 2R92H 4M8AA 4KN7C 4JW0A 1LTRD 1JWUD 4K5VA 5IP9G 5DAUA 1Q82C 5I9OA 3RN2A 2NVQH 1LT6D 4DV2Q 5DM73 2IX3A 4QUCA 1W6KA 1SNPA 5C3WA 3KBXA 2CQOA 2F4IA 3BDLA 1CI3M 1K0RA 1RL2A 3K5OA 2Q8TA 2C9OA 4JI4L 4BY1B 2CQAA 1SMXA 4A3JH 3V05A 3VYUA 3GQBA 4APVA 1ET9A 1I4XA 3LGJA 4G57A 2C5CA 2I46A 1O7LA 4XIGS 4AYBE 2PZWA 3EVQA 1Q86C 5JOBA 1KC8C 5FJ8H 4DR2Q 2EYOA 1HNXL 4A3FG 3B6YA 3I91A 3N6RA 3MA2B 4HMJA 3E9IA 4A3EG 3PSIA 1QZHA 4XXEA 5D14A 3RZDH 4ZRZA 4OO1I 1G6ZA 2K6AA 3RNUA 4HJ7A 2IT1A 1EY8A 4PZ7A 3U50C 3I4MH 1SE4A 1X32A 4C1NK 2L55A 2WB1E 1G6PA 1FVIA 3OMGA 3S16B 1EY7A 4CDDC 4LF6Q 1DZ1A 1HUNA 4U673 1HHVA 3BZKA 3OIQA 1P8LA 2DY7A 1YVCA 1PV4A 1GUSA 3HEJA 4KKUA 3CW2C 2EJFC 2K28A 4JPBW 3ZYYX 3MC0B 5E4WC 4ZUJA 2MQHA 4JBKA 1DD2A 1J6QA 3DUZA 1JOOA 1IHZA 4N8FA 1RTOA 3K80C 2ZJRA 2PCFB 4XTCS 1VQ9A 4QF4A 4B3TL 5EKIA 4GOPC 4DV7L 4FF3A 1VF7A 1F77A 1JOQA 1NUCA 1AW7A 3GTKH 1LUZA 3MVVA 1R9TH 1NAPA 3T56B 4JG2A 1E22A 4X65L 1K3RA 3CU7A 4Y52H 2Z4HA 1XJVA 2UUCQ 3NE5B 2KCMA 1XX8A 4A76A 2NWGA 1A6XA 1KHIA 1ENFA 4JI8L 2H4OA 2B63B 5LL6X 4UP9A 2A69C 5FO9B 1YITA 3F2CA 1SMYD 4LFCL 3HP3A 2OTLA 1OXVA 1G91A 1XNRL 4JK1C 1U4MA 2EYHA 1DOLA 3EJIA 1B8AA 4EX5A 4IFDJ 4QIWE 3T1HL 1SNCA 1Y14B 3GTLH 1STYA 4NXMQ 1LACA 2NN6G 4IFDI 1ZYRD 1CSPA 1LT5D 2JN4A 3HOVG 4DR1L 4X3TA 4JI7Q 2N49A 1HUMA 5K5PA 1VMPA 1EIHA 2HHHQ 4JBMA 2Z0SA 3GV3A 3NSWA 4EGVA 2F0QA 1HFNA 4CKCA 3BS1A 4A3BB 4YCWA 1EWIA 1A3TA 1WTWA 4C1NI 2RDFA 1HXYD 2ASBA 5IP7H 4DV1L 4HIOA 4JI2L 4XT3B 1BVSA 5IY0A 4BY1G 4XQJA 2M2LA 1HRJA 1S4ZA 1PFNA 2X6GA 1XMQQ 5EJWA 3BVGA 1XPRA 2BH2A 1ZKOA 4RGMA 5C4XB 3M7GA 3KF6B 5CORA 4EVOA 1ZEQX 1PZID 1NNXA 4C3JH 4DV4Q 3K58A 4H13C 4LF5L 3CCVA 1EL0A 2V1CC 4K2LA 2LXJA 4JYAQ 4DR5L 1JJGA 2JSOA 1KD1C 3UDGA 3ERSX 4BBRH 1SSOA 5CV8A 4QY7A 3NPPA 4HCEA 4PZ6A 3BG3A 2RCNA 2NTSA 1EQQA 4XYOA 4V190 1D5MC 3NUCA 2IHFA 2JYOA 4A3JB 2JA9A 1S40A 2RF4A 2E5LL 2KEEA 1SDFA 4OELB 1HCZA 3CPWA 1YHBA 2VS1A 3ITPA 3SR1A 4I7AA 2SNSA 1KDCA 4IOCA 1VF5C 2XIWA 4X66Q 1WTXA 1KRTA 4B9XA 3NBHB 4LF9Q 2EXZA 5HY6A 4JI1L 5I6YA 4OXPA 1LM0A 4X3UA 2VB3X 4DV0L 1TWFB 1M90C 1FJGQ 1SNOA 5IYDG 1TWHH 1WI5A 2FHTA 4RKLA 3WOEA 5M9OA 1HR0W 3S15H 5CV7A 1LLRD 4QCLA 1H9SA 3CPFA 3TDQA 3HKSA 1ESRA 1O7ZA 1VQLA 1EUJA 2E8GA 3IKJA 3SE0A 2B63G 5KYLA 3RZOH 2PNRC 2F0DA 1RD9D 4IJLA 1S72A 4LUZA 2L11A 1EWCA 2IHEA 3A8JE 4JI0L 3S1NH 1SNDA 2K03A 1LTBD 3KLSX 4PNYA 1LTSD 3GD7A 1IYJB 3TQYA 1CKNB 5JEAH 1W3SA 4YHHL 3AB9A 2UUAL 5C4JH 1K73C 3MXNB 2R7ZH 2Z1CA 3FEWX 2LMCB 3D8GA 1IKLA 4JI5L 2VUMB 4RAUC 5KRUA 5IP9H 4I65A 2KOLA 4ZLTF 3TSSA 4A3BG 2LFNA 4R4IA 4JOIC 3GTKB 3CP0A 2CCZA 3TP6A 4FO2A 1Q90A 4IN3A 4YWLA 4YWMA 5FKAC 4E6IA 3J81i 4IOAA 2F0GA 4JI4Q 4PG3A 4L5RC 4L5QA 2ES2A 1MIUA 3A8IE 5J1ZA 1JICA 3URYA 4GZYC 4L63B 4DK3C 4HEDA 1KQSA 1A62A 5KEEA 1KRSA 1PRTF 4A3FH 5C4XG 1DGSA 3R2TA 4C3IB 4K14A 1HNWL 4L6TB 1GHKA 1DYQA 3GTMH 3K8AA 3PUZA 2Q2TA 2UU9L 2Q2UA 2WP8J 1O78A 4MNOA 4ME5A 2JA7G 2OTJA 2EE1A 2UXBL 3CCJA 3CAMA 1DOKA 5IODA 1KL9A 5M3FH 1B3QA 1YNJD 4R4OA 1HZBA 1UE5A 5D3DA 4OIJA 2R92G 2Z6KA 2SDFA 2E74C 2MGSA 4OO1G 1VQHA 1TWGH 1BCPF 1PTOB 1JCKB 3EROA 2KEDA 3W5OA 1Y8NB 5FK9C 4IUVA 4UP7A 3M3YH 1RTNA 3TMEA 3NP8A 3CC4A 4HMIA 4ALPA 4A4IA 2PI2E 3HRZC 2FMMA 1AH9A 3VA7A 2R7FA 1LO5D 1EFWA 1PA6A 3NENA 2ZXPA 4A3JG 3CC7A 4WORA 1Q3LA 4CGYB 1U0LA 2R7DA 5KNCA 1E1TA 3K81C 2NVTH 4NP5A 4QUFA 1X3PA 3OIPA 4ID6A 4DNIA 3D4WA 1NR2A 1CHQD 4JV5L 1K83B 2X69A 4K8JA 3R3OA 1K8MA 5IGGA 1SR3A 1N9WA 2DNCA 2WB1B 4N9TA 3WDNA 1S5BD 3I4OA 4R9WA 1ET6A 1CUKA 2MJ8A 3D6WA 1VDZA 4FXKC 1LV9A 3MEHA 1IBLL 3KDFB 2OWOA 2EVBA 1JQYD 1I3QB 3MZ5A 3M4PA 1D1KA 4H02A 4OEMB 4QMGA 3MXUA 4WJ3M 3K0YA 5GROA 5EPJA 1J8IA 1BO0A 1B70B 1JMCA 1L0XB 4K5WA 3A7AB 5EPKA 5ELDA 1IBKQ 1K3BC 3GDEA 2K50A 4JCVE 2PYKA 2NN6H 2F52A 3HOVH 2QDBA 4J15A 1AEXA 1GVPA 3JC66 4CJ0B 4DR1Q 3HGBA 3KBGA 4BWGB 4RCNA 4GKJQ 2VUMG 4OWWB 1CKMA 5DM63 4EQOA 4IFDG 2Q8IB 1RIPA 1AZPA 4B3RQ 5C0XH 3K0XA 3AEVA 2EY1A 2WIIB 2OQ0A 2MUYA 4DV1Q 1X3GA 1I4RA 4CDFC 4BY1H 1B3AA 1TWCB 5CGKA 3I4NB 4MZ9A 1GUOA 2RBMA 3NWTA 1LYLA 4V0BA 3E6ZX 2YU9B 4LF8L 4GNXA 1QG7A 1I94L 2UUBL 1S3OA 4QIWB 3H15A 1XYIA 1XNQQ 3SK8A 3H3VI 1YJ9A 1KNAA 3EQLC 4PZ8A 4A3KH 1JWSD 3Q8DA 1U4LA 2L0CA 2ZXOA 4MHEA 2AQ3B 4UDUC 2D2CC 3U4VA 3KFUA 2UXDQ 4JI3Q 3S1RB 1RJTA 3CCRA 1L2FA 5E4XA 1TY2A 2FINB 3VR2A 4P72A 2XWBB 5C4JB 4H7BA 2EOTA 5C0XI 1ZYRC 2IL8A 4RGTA 2WKCA 1U4PA 1TWAB 2X6LA 3FRPB 2XTIA 3S16H 4K0KL 1E2VA 4B3SL 1X55A 3J7A5 2PW7A 2PQAA 2NZHA 1B50A 1PTOC 3J80L 1PZKD 1TS5A 5ELOA 3D31A 2F0IA 2FXQA 2PNHA 5AJ3L 4DUYL 2K05A 3G7LA 3CCLA 4XQNA 1KNEA 1QWYA 3GTOB 2ZTDA 3VYRA 2F0NA 4IQZA 1VMCA 2Z9HA 2AUKA 3I56A 2K1BA 3SK5A 2J4XA 2JJQA 2EPBA 4JI1Q 5DLQE 3GTMB 2KECA 4DV0Q 2WB1G 3S1MB 1BXTA 2F0OA 5IYDH 5FLXL 5JVH3 1VQBA 1BNZA 3U4ZA 5ISRA 2CW0D 5J39A 2EYPA 1F2YA 3PIOA 2QKIC 2ZJQA 1EU3A 1H9RA 1BDOA 2B63H 1S5FD 3S2DB 1N33Q 2F0LA 3R93A 2FFKB 1SLJA 3M3YB 2F0SA 4OL7A 4DR7L 1E3PA 4IUPA 1X65A 2LXKA 3A5ZB 1M8AA 1LT3D 3RLFA 4BA2I 1MI2A 3I3CA 3RD4A 1JE4A 3Q23A 2FMCA 2UUAQ 4IJHA 2ZTCA 3FPUB 1EOVA 5CC4A 3KOJA 4DGZA 2EY5A 2E2DC 3KF8B 2AKWB 4A3BH 1CQFA 3I8ZA 4MTNA 3GTPB 4ZQ3A 4IUNA 2YTYA 4UP8A 1Q12A 5EPLA 2WACA 4CHTB 1KDAA 2A74C 1VQ7A 2XRSD 3I4NG 1EZ8A 3M4YA 4KKSA 5M3MB 1HJPA 2D62A 1VQOA 3A74A 1B4OA 2ZXRA 1IYUA 1XXGA 3R8BA 1EQRA 3V96A 4IPCA 5C4XH 2VNUD 2FJ2A 4OONA 4XT1B 3CQZB 3J80E 1ENCA 3T4AC 4EQ5A 4P71A 1KTKA 3NK9A 3I55A 1Y1VB 4F8MA 5I9PA 2ZM6L 1XPUA 4DR6Q 2ZJPA 2E2IB 3TEHB 2EDGA 3E3XA 2UXBQ 5G3LF 5M5YB 4AH6A 4B3ML 1WCMB 5IGFA 4DXFA 1PH2A 4CJ2C 3GTGB 1B7YB 4OO1H 5M5XB 2EYMA 1PYWD 2CWAA 3CMAA 4RCOA 4TKOB 4ZKBB 4A3GB 1RKNA 2BDNA 1HZAA 2HDMA 2MO0A 4N9PA 1S5DD 4EQNA 5FLXE 1BOSA 1L1OB 4DV6Q 1S5CD 4ZYSA 5FO8B 5FLMG 4DUZQ 4KLKA 2NTTA 2MHVA 3OMCA 1K8AC 1WTQA 5IYCG 4P2CB 2RA4A 2MNAA 1C48A 5TSSA 1TKWB 2JQOA 1STEA 4KI0A 3QOJA 4MTKA 5JJZA 4JV5Q 2BE5C 2VXWA 4A3KB 1VQ5A 1NSNS 1B9NA 1Q1EA 1TWFH 1YI2A 1VQAA 2DY8A 2QCPX 3HKZB 5ELCA 1CQVA 4C56C 4Q0FA 4B9WA 3A7LA 5M3FG 1STGA 1IBLQ 1CHPD 5DNFA 1PRTD 1I50B 1YNJC 1MJCA 2O5IC 2HD3A 1GKHA 3T1YL 4DK0A 3G6EA 4G7ZC 2CFMA 1JC7A 4OWXB 4DV3L 3HOYB 4YWKA 4OX9Q 2R6GA 3ICEA 2YYZA 5KGUA 1P16A 1ASYA 2F3WA 4H0LC 1PZJD 3HOZB 1CK1A 4C2MB 2E2JB 1H9JA 3PUVA 5I2XA 3QG1A 2OCEA 1LTGD 1O80A 1LTID 4GS3A 4AQYQ 3TBIB 4LF7Q 2B3GA 3MAQA 1KXLA 2JA5B 3MHBA 1BCPD 3GTQB 4Z9CB 3I72A 2B2YA 1QVCA 4GLVB 2VUMH 2K5VA 2QW7A 2B39A 4IFDH 1D6EC 2QILA 2LKVA 1PVOA 4R8NA 1HNZL 4GLXA 1SXTA 4HAEA 3Q6SA 5M3MG 1JR0D 3W3AA 3HG9A 1N34L 4LFAL 1WYDA 4LF8Q 3CRKC 5CBAE 1F9QA 1GXDC 4YY3Q 4C3IH 3KJPA 3SGIA 1J9OA 2N88A 4DV5Q 2B8FA 1PH1A 1PH3A 2KA7A 4IO9A 3NTKA 2A68D 1SFOB 1G51A 4FNFA 2A6ED 3HOUB 2F4VL 1Y1VG 4HN7A 1O7YA 4NXNL 3CCMA 1YIJA 2R93B 1UE7A 1STNA 2K7VA 1WCMG 1QB5D 3FVQA 3H3VC 1EEFD 3JAMi 1PTOH 4DR3L 4JI6L 2KHSA 4GN5A 4B3SQ 4A3GG 3AYHB 1E2WA 5C0XG 1MGSA 4DAMA 1VQFA 2O5JC 2SEBD 4Y7NB 1YZ6A 5LMUQ 2I0QA 1V1PA 2B2VC 3M7NA 2HT1A 1EYGA 1SJHD 1L1OC 1XMOQ 4BY7B 4DUYQ 3K5NA 1D1IA 1D7QA 1V43A 3DLLA 1QILA 5JAVA 2F0JA 2UXCL 1LTAD 1O7IA 3DMUA 1UAPA 2SOBA 1K83H 5I6WA 4FDBA 1EQTA 4A3KG 2RVLA 4PMBA 2WAQB 4NB3A 1Q1BA 4WJ4A 2EQSA 4DFAA 5E1FA 2BA1A 5BN3A 3HKZG 1HR0L 4A3DB 2KUMA 3KK7A 1TU2B 3OWEB 1QVGA 1SBBB 5I2YA 1I3QH 1HZCA 4GN3B 3CKIB 4LFBQ 1WTHA 1D5XC 2OT2A 3O13A 1ICWA 4DN4M 2K4KA 4RA8A 3HOYG 4ME3A 1RODA 2GVAA 4DR7Q 5LL6S 1A2TA 1NMGA 1WJJA 4FP5D 3HOZG 4KD3A 2NVXB 5E3FA 2N55A 5IWAL 1QZGA 1YHAA 2B29A 3CCSA 2KHIA 2JA5G 2YTVA 3TS2A 4OGQC 2WKDA 1K8GA 4P74A 3IFTA 3PGZA 4POFA 3DWAA 5HURA 5K36H 3A8KE 3OOCA 3RUZA 4ULLA 3N52A 3ND8A 2R3ZA 3EN2A 2A6HD 2BH8A 2A8VA 1N32L 1TWCH 3I4NH 4YCVA 2Y0SE 3WOFA 2RDGA 4DR4Q 4KY7A 2YU9H 1EIYB 4KHPQ 1DOMA 2DUDA 3J7AF 3J80c 1JE5A 1NBWA 3J7AV 1EY9A 4N8X1 2XN9C 5LMNQ 2ID0A 1TIID 3S1RH 2KQ3A 2F1MA 2PQEA 3DXJC 3E9HA 2JXMB 1SNQA 2VL6A 1MJEA 2XVSA 2D9UA 5BR8L 1Q7YC 4ZUIA 1TWAH 3OSOA 2HIVA 5CV6A 2JA6B 3KUPA 1ASZA 1H9SB 3DEPA 1I5FA 1YNND 1XTDA 3AFPA 1V8QA 3P75A 5FLXc 4NDXA 2JEBI 5IOCA 2ZT9C 3D0FA 1VQ4A 5FLMH 4XDXA 2I5LX 4O42A 1F9PA 2N3SA 3BYTB 4BY7G 3VDYA 5IYCH 1WTOA 1IW7D 2ALYB 3GTOH 1B2TA 4JBWA 5I4DA 1ILPA 1HNXQ 4A93B 1K28A 2N78A 2MO1A 3L7ZC 1GM5A 1I4QA 5GAEC 2EY2A 2VQEL 4DA2A 1EIGA 3S1MH 3E5SA 2ICEC 4HJ9A 3L9AX 4LF4L 3SDZA 1TR5A 3OTOL 4A3DG 3G48A 1HTPA 3S24A 1GUGA 3KLRA 2L4NA 3HKZE 4A3MB 3S2DH 3STBD 4L5SA 2F0WA 3T1YQ 1GO3E 4DV3Q 5KIXA 2RSNA 1I4PA 1VQIA 4K2KA 1Q46A 1DM0B 3S2HB 2QF7A 1EWHA 3H91A 1KLGD 1CA6A 3HOWB 5G3LD 3H09A 1HA6A 4FYDA 4B3TQ 2D0PA 2DJGC 4DK6C 3U9SA 4DV2L 4HIDA 4MIUA 2Q2HA 2F0VA 3AU7A 2B2TA 2NZ1D 3W1GA 4F88A 4DV7Q 2RDHA 3GTPH 2PMZB 3TZUA 2E75C 5F2DA 4FF1A 1EEID 3IRBA 1XTCD 3EA6A 3NBIA 3S17B 4X65Q 5J22A 5JJIA 5M3MH 2NYZD 3H0GB 4JI8Q 3CHBD 3T53B 3X3NA 4ILWA 2JK8A 5D3IB 2E76C 4LFCQ 3OHXC 1PRTC 1UE6A 3VR6A 5CV9A 4G7HC 1D2BA 4TVAB 3CQZH 1XNRQ 4O2DA 4A3IB 2YTXA 1X3FA 2B8GA 4L8JA 1QUQA 4WJWA 2J7ZA 3T1HQ 2A69D 5IT9E 1Y1VH 3H3VH 4LUVA 3KJOA 1R4QB 2E2IH 1G291 4NXNQ 1EY0A 3FMCA 5M5YH 1SYEA 2F0KA 4LF6L 2AWNA 1WCMH 1IL2A 1N8RC 3GTGH 1ONLA 5M5XH 3Q0AA 1BCPC 3W2DA 4WRDA 3GTJH 2JA6G 1SAPA 1PTOF 4O1NA 1QJOA 4C3HB 4A3GH 3H94A 3UE0A 2MP1A 2K52A 3MXPA 5CMDA 3CRLC 1KIXA 4ZKCB 3VR3A 2JA8B 4KMUC 1AP0A 4JI2Q 4PV1C 2TMPA 4NW2A 2KCNA 4JC0A 3FDTA 1LT4D 3ONAB 1A3UA 1JT8A 1J5EL 4IUQA 4OWTB 2CVRA 2NUCA 2PO4A 3J81E 1B53A 3HOXB 3R2IA 1X3QA 5IGCA 3HS0C 2IW3A 4C3IG 4LNQA 3BDCA 1SMYC 3KYHC 1VQPA 3NELA 1CM9A 1I4GA 3UE1A 2M9VA 2ATWA 2UUCL 1U4RA 4LF5Q 1Y69U 2XNAC 4RGOS 4WFN3 3BDOA 2A68C 2NVYB 3E0JA 4KV6A 2WAQE 5E7NA 4DR5Q 1BR9A 1HH2P 3PUXA 4KD4A 3G4SA 1QE6A 1I50H 3K7AB 4A3MG 3CCEA 3TP8A 1A8VA 4HIMA 4O0AA 3AQQA 3TS0A 3VYSA 3HOYH 1U5KA 1EOTA 1AZQA 4BS9A 1EY4A 3NTIA 1IXRA 4NXML 3QIAA 2E2JH 3HOZH 4C2MH 1DXMA 4FVMA 4J1MA 3HOWG 5EGTA 2E5LQ 2F0EA 4HIKA 4RHSA 3Q22A 4RHRA 1TQOA 2PZUA 2JA5H 1UEAB 3GTQH 5C3EB 5AFWA 5CV5A 1KLUD 3OW2A 2XGTA 4KN4C 4A3LG 2L12A 3M4QA 1F9RA 3L2PA 1STBA 4H44C 4QB4A 3P7JA 4DXGA 3FKIH 3IAYA 1XMQL 1WD1A 1N32Q 2EYFA 4NKLA 2Z8LA 2Z6KC 4J6HA 2PQAB 3T51B 1VQ6A 3H0GG 1PFSA 3RLNA 1B1ZA 3P20A 4RFBA 1X54A 1B44D 1K0SA 2VY3A 4DNTB 3OPOA 2HIXA 4DV4L 1CZWA 4GOPA 3HZXA 4CKBA 3TP7A 1EYDA 2HCIA 4FXGC 1SNMA 1V1QA 2NZOA 1OTCA 4JI0Q 1E0BA 3OWFA 4A3IG 5ELNA 4ABNA 4P75A 5IGEA 1SFOH 2GA4B 3G71A 4JYAL 1GOZA 1D8LA 3HOUH 4X3KA 2F0MA 4YHHQ 3C2PA 3UDXA 2BA0A 3D4DA
chains in the Genus database with same CATH topology
1CSQA 1FJGQ 2R93H 5IYDG 3PF5A 5GADC 1TWHH 1WI5A 2F4VQ 2IY5B 3S15H 1HR0W 3HFZB 1I6HH 4JI5Q 4GKKL 1PVOA 2KHJA 3CPFA 3F2DA 1HNZL 3HKSA 1VQLA 3TRZA 4X64L 4GLXA 1VQGA 1EUJA 2E8GA 5K36G 2B63G 4OX9L 1KAWA 4DR3Q 4JI6Q 3RZOH 5M3MG 1JJCB 4IJLA 1S72A 4LUZA 2KBNA 2JA8G 2IHEA 1Q81C 4Y7NH 3PV0A 4LFAL 1N34L 4JI0L 3S1NH 1WYDA 4LF8Q 3W1BA 1VQJA 2KCTA 2OQKA 4AQYL 4X66L 1CKOA 2D0OA 4BY7H 3S1QH 3RLOA 4LF7L 2C35B 4YY3Q 4LF9L 4C3IH 3GD7A 1IYJB 1V9PA 1CKNB 2EIFA 3SGIA 3TQYA 3KJPA 4DV5Q 1PH1A 1MKHA 3PO3H 1K9MC 1W3SA 3HOXG 1PH3A 4IO9A 4YHHL 2GVBA 2UUAL 1C9OA 2ZTEA 1G51A 5GAHC 3MXNB 5C4JH 1K73C 1FJGL 1QUQB 2R7ZH 1HNWQ 1Y1WH 2F4VL 1Y1VG 4A3CG 2UXCQ 4JI5L 4BBSH 4TQUS 2K5HA 3CCMA 4NXNL 1YNXA 1YIJA 1XPOA 5IP9H 2MFIA 2UU9Q 4A93G 2CWPA 1UE7A 1GD7A 2GN5A 4A3BG 1WCMG 4R4IA 4JOIC 1WOCA 3CP0A 4LF4Q 4A3DH 2CCZA 3JAMi 4JI6L 4YWLA 4DR3L 2Q2IA 3J80i 4YWMA 3J81i 3PF4A 4GN5A 2EXDA 4IOAA 4B3SQ 1A63A 4A3GG 2RHQB 1HR0Q 4JI4Q 3AYHB 4PG3A 4L5RC 5C0XG 4DAMA 4L5QA 2ES2A 3EBEA 1MIUA 1VQFA 3F2BA 2NN6I 4YY3L 1JJ2A 1YZ6A 2VQFQ 5LMUQ 4DV5L 2I0QA 1VQDA 4IPGA 4DK3C 3M7NA 1KQSA 2HT1A 1A62A 1EYGA 1KRSA 1L1OC 4R4QA 1VQCA 1XMOQ 4DUYQ 4A3FH 2NVXH 5C4XG 1DGSA 1HNWL 1D7QA 1V43A 4GNXB 4R1JA 3DLLA 2AWOA 4GNXC 3GTMH 3K8AA 1BKBA 5C0XJ 2UXCL 2KENA 1O7IA 2QGQA 3PUZA 2Q2TA 2UU9L 5IWAQ 4JI7L 4RG1A 1K83H 2WP8J 2Q2UA 1PHJA 4FDBA 4MNOA 2HHHL 1OXXK 1PYBA 5C3EG 4A3KG 1PH5A 2JA7G 3PCOB 3PO2H 2OTJA 1VCIA 4NB3A 1Q1BA 2UXBL 4WJ4A 2EQSA 3CCJA 3CAMA 1KL9A 1E1OA 4R4OA 5M3FH 3CXCA 1HZBA 1UE5A 2BA1A 1Q8KA 3HKZG 3K7UC 2Z6KA 2R92G 1HR0L 2PI2A 4OO1G 1VQHA 1TWGH 3AFQA 1C0AA 1HZ9A 3W5OA 5IP7G 4UP7A 1EIFA 3M3YH 3FHWA 1QVGA 2A19A 4AYBG 3F1ZA 5LMUL 1NY4A 3CC4A 4R4CA 1I3QH 1HZCA 2PMZE 4GN3B 2K5NA 4ALPA 4LFBQ 3MEFA 3S14H 4A4IA 1XMOL 2PI2E 1AH9A 2K4KA 3E0EA 2R7FA 4ME3A 3HOYG 1EFWA 2GVAA 1PA6A 3NENA 4A3JG 4DR7Q 3CC7A 1H95A 1NMGA 5LMNW 3FP9A 1NJIC 1WJJA 1FGUA 4DPGA 1U0LA 2R7DA 3HOZG 1E1TA 5IWAL 2AHOB 4BXXG 3K81C 1QZGA 2NVTH 1YHAA 3STBC 2B29A 3CCSA 5GQOA 5IT9c 1X9NA 3CD6A 4DNIA 2L15A 2KHIA 4LWCA 4JV5L 2JA5G 2YTVA 4X6AH 1PH8A 5C44H 3TS2A 3F8TA 1X56A 1SR3A 4NPSA 2E2HH 1N9WA 1K8GA 4P74A 3PGZA 3I4OA 1NE3A 4POFA 4POGA 1Z47A 1CUKA 4BBRG 3CCQA 3ULJA 3BU2A 2JA6H 2H5XA 4LFBL 1IBLL 2JEAI 5IE8A 1YJWA 2VUMH 3EN2A 5BR8Q 1BBWA 1N36Q 2BH8A 3KDFB 2A8VA 3PUYA 1TWCH 2OWOA 3I4NH 4QJFA 4YCVA 5M5WH 2Y0SG 3CC2A 4QQBX 3M4PA 4H02A 2Y0SE 1VQMA 1PH6A 4WJ3M 4DR4Q 4LUOA 5GROA 2YU9H 1EIYB 1L0WA 4KHPQ 3JAMc 2DUDA 1B70B 1JMCA 3J80c 1JE5A 1NBWA 3UDIA 3J81c 1J5EQ 4GOPB 1AE3A 3GDEA 1IBKQ 1BBUA 2K50A 3J7ZC 1M1KC 1YBYA 4JCVE 2HQLA 1I94Q 2UUBQ 4A3CH 3DM3A 2F52A 2JE6I 5LMNQ 1VS0A 3HOVH 2ID0A 4J15A 1GVPA 3M85A 3JC66 4A93H 4DR1Q 3S1RH 1JB7A 1IZ6A 1YHQA 3WWVA 4JOIA 5JJKA 1OXUA 1X3EA 4GKJQ 4PMWA 3E9HA 2VUMG 2I5MX 4OWWB 2VL6A 3OYYA 1MJEA 1CKMA 4IFDG 5BR8L 2VQEQ 1RIPA 1Q7YC 4B3RQ 1TWAH 3K0XA 3AEVA 2HIVA 4BA1I 1ASZA 2OQ0A 2VW9A 4DV1Q 3M4OH 1I5FA 4DR4L 1X3GA 1XTDA 3AFPA 4IPDA 5FLXc 4HJAA 4BY1H 4A3MH 3OTOQ 4MZ9A 4KHPL 1UE1A 3A0JA 1L1OA 4DAYB 4K0KQ 2I5HA 1IBMQ 2JEBI 1LYLA 1SE8A 5H1SE 3D0FA 1VQ4A 4X62Q 1IBKL 3ZJYC 4GNXA 5FLMH 1AE2A 4LF8L 2DGYA 1I94L 2UUBL 2I5LX 2K75A 2N3SA 3S2HH 1S3OA 3KF6A 5IYBH 2IX0A 4QGUA 3H15A 2VZAA 5LMNL 1XNQQ 3H3VI 2LSSA 4BY7G 3VDYA 3HOWH 5IYCH 1YJ9A 2ALYB 3GTOH 4PZ8A 3TREA 4A3KH 3Q8DA 2JA7H 4JBWA 5AJ3Q 4UPAA 4HJ8A 3U4VA 5JEAG 3PO3G 4GKJL 1W2BA 2A1AA 1HNXQ 1VQNA 3KFUA 2UXDQ 4JI3Q 2N78A 3NEMA 2MO1A 1L2FA 4DKAC 3CCRA 2R7ZG 5GAGC 3L7ZC 1GM5A 5GAEC 1OXSC 4GLAC 1Y1WG 2VQEL 2R92H 4P72A 3BZCA 4B3RL 4A3LH 1UEBA 5IP9G 1Q82C 5C0XI 3S1MH 3RN2A 4HJ9A 2NVQH 4UY8C 4DV2Q 1SN8A 4LF4L 3OTOL 1TXYA 4A3DG 2XTIA 3G48A 3S16H 4K0KL 2CQOA 3S24A 3S17H 1K0RA 1RL2A 4B3SL 4A75A 4JI4L 1X55A 1SRUA 3J7A5 2PQAA 3HKZE 3KLWA 1SMXA 4LW1A 4A3JH 3S2DH 2NZHA 3H0GH 4APVA 3LGJA 3STBD 4L5SA 1XNQL 5ELOA 3T1YQ 1GO3E 3D31A 2VQFL 4KHZA 4BXXH 3J81j 4DV3Q 1VQIA 4XIGS 4AYBE 1M90C 1Q46A 2FXQA 2PNHA 5AJ3L 1Q86C 1KC8C 5FJ8H 3I2ZA 4DR2Q 4DUYL 1HNXL 2K14A 4A3FG 3CCLA 4JI3L 3B6YA 2UXDL 4A3IH 2ZTDA 3E9IA 4A3EG 3PSIA 5HGQA 1QZHA 1LTLA 3I56A 3RZDH 4B3TQ 4OO1I 2D0PA 4DK6C 3RNUA 2AMCB 2JJQA 4JI1Q 4DV2L 2IT1A 4PZ7A 5DLQE 3U50C 4HIDA 4HJ7A 1VQ8A 2Q2HA 3I4MH 4DV0Q 2WB1G 3W1GA 4DV7Q 5IYDH 5JJLA 2WB1E 3GTPH 1G6PA 1VQBA 1FVIA 4R4TA 3U4ZA 4GKKQ 3PIOA 1SROA 4LF6Q 3IRBA 2ZJQA 4C3HH 4X64Q 4X65Q 2B63H 3BZKA 1P8LA 1N33Q 1YVCA 1PV4A 5JJIA 5M3MH 1X6OA 2JA8H 1SLJA 3FKIG 3CW2C 4JI8Q 4JBKA 2MQHA 4DR7L 1E3PA 1FL0A 4HJ5A 1J6QA 2JK8A 1PYSB 1YJNA 1X65A 2LXKA 3CMEA 3A5ZB 4LFCQ 1UE6A 3K80C 3RLFA 1CKNA 2ZJRA 4BA2I 4XTCS 1VQ9A 4TVAB 4B3TL 3CQZH 1XNRQ 4O2DA 2YTXA 1X3FA 3HOXH 1PH9A 1QUQA 2UUAQ 4GN4B 2ZTCA 4IJHA 4GOPC 3T1HQ 4DV7L 1EOVA 1Y1VH 2CKZB 3H3VH 4RMFA 3KOJA 4LUVA 5C44G 3KJOA 2E2IH 1LUZA 3GTKH 1G291 4NXNQ 3KF8B 3PUWA 2AKWB 5M5YH 3CF5A 4LF6L 3U58A 2AWNA 1PH4A 3HOUG 1WCMH 1R9TH 4A3BH 2ZM6Q 3ER0A 4JG2A 4MTNA 1E22A 4X65L 1IL2A 2NVYH 1N8RC 3GTGH 1K3RA 2YTYA 5M5XH 4Y52H 4UP8A 1XJVA 3GTJH 2UUCQ 1N33L 1Q12A 2KCMA 2R93G 2JA6G 4A76A 4B3MQ 1VQ7A 1KHIA 1N36L 4JI8L 4A3GH 4UP9A 3UE0A 3K7AH 1YITA 3I4NG 1YEZA 3PIPA 2K52A 4IPHA 3F2CA 1KIXA 1NMFA 4LFCL 2IX1A 4JI2Q 1HJPA 2D62A 1VQOA 2OTLA 1OXVA 3A74A 1XNRL 4JC0A 1N32L 1JT8A 1EQRA 1WFQA 1J5EL 4IPCA 4OWTB 5J3BA 5C4XH 4EX5A 2VNUD 1B8AA 4IFDJ 4L5TA 4QIWE 4OONA 3T1HL 1Y14B 1NTGA 3GTLH 4NXMQ 2NN6G 4IFDI 1CSPA 3HOVG 3EIVA 4EQ5A 4P71A 4DR1L 1OXTA 3I55A 4LNQA 4JI7Q 2N49A 5C3EH 2WFWA 3KYHC 1VQPA 2ZM6L 2HHHQ 1XPUA 4DR6Q 3NELA 3RR5A 4JBMA 3UE1A 2Z0SA 2ZJPA 3TEHB 2UXBQ 2ATWA 2UUCL 4LF5Q 4AH6A 4B3ML 2QA4A 1E7ZA 4YCWA 1EWIA 1PH2A 2WAQG 1B7YB 1E24A 5EAYA 4BBSG 2WAQE 1VQEA 5E7NA 4DR5Q 3A5UA 2CWAA 1HH2P 2QEXA 5IP7H 3CMAA 2ASBA 3PUXA 4DV1L 4HIOA 4JI2L 1BVSA 3G4SA 5IY0A 4BY1G 1I50H 4A3MG 5JEAJ 3CCEA 1HZAA 2MO0A 1A8VA 1IBML 4HIMA 1L1OB 4O0AA 4DV6Q 3AQQA 3TS0A 1XMQQ 1XPRA 4X62L 1U5KA 3HOYH 1C7YA 5FLMG 4DUZQ 1VQKA 4KLKA 2BH2A 1IXRA 4A3EH 4NXML 2E2JH 3HOZH 4C2MH 5IYBG 3KF6B 1K8AC 2F3IA 5IYCG 3HOWG 1T9HA 2E5LQ 3RN5A 2MNAA 4C3JH 4DV4Q 4DR6L 4HIKA 2JQOA 4KI0A 2JA5H 4LF5L 3CCVA 1PH7A 4JV5Q 3UDFA 2V1CC 3GTQH 1VQ5A 1Z9FA 1Q1EA 1TWFH 2LXJA 3ULLA 1VQAA 2XGTA 4DR5L 3OW2A 1YI2A 4A3LG 4JYAQ 1JJGA 3I7FA 3UDGA 3M4QA 1KD1C 3L2PA 3ERSX 3PO2G 2YV5A 4BBRH 3CCUA 4QL5A 2N8NA 4JBJA 4QY7A 3M9BA 4PZ6A 2RCNA 5M3FG 1A0IA 4P73A 1EQQA 4DV6L 3FKIH 3KDFA 1IBLQ 1XMQL 1N32Q 1UWVA 4DUZL 2Z6KC 1MJCA 2PQAB 3GO5A 3H0GG 1HNZQ 1QVFA 1VQ6A 1GKHA 3T1YL 1PFSA 2IHFA 3RLNA 3G6EA 2CFMA 4OWXB 1X54A 4DV3L 4YWKA 4OX9Q 3L0OA 2R6GA 4YCUA 3ICEA 2VY3A 2YYZA 2JA9A 1P16A 2RF4A 1S40A 2E5LL 3CPWA 1ASYA 2HIXA 4DV4L 4DR2L 1YHBA 2VS1A 3BJUA 4GOPA 5FJ8G 3PUVA 4LFAQ 2NZOA 1V1QA 3ULPA 1N34Q 1OTCA 4JI0Q 2OCEA 4IOCA 4A3IG 4GS3A 4X66Q 5ELNA 4AQYQ 4P75A 2RHSB 1SFOH 1KRTA 2B3GA 4LF7Q 3NBHB 3G71A 4JYAL 4LF9Q 1KXLA 4AIMA 5HY6A 1D8LA 3HOUH 4JI1L 4OXPA 1LM0A 1QVCA 4GLVB 4YHHQ 4DV0L 3UDXA 3I4MG 2BA0A 2K5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSQ A;  1FJG Q;  2R93 H;  5IYD G;  3PF5 A;  5GAD C;  1TWH H;  1WI5 A;  2F4V Q;  2IY5 B;  3S15 H;  1HR0 W;  3HFZ B;  1I6H H;  4JI5 Q;  4GKK L;  1PVO A;  2KHJ A;  3CPF A;  3F2D A;  1HNZ L;  3HKS A;  1VQL A;  3TRZ A;  4X64 L;  4GLX A;  1VQG A;  1EUJ A;  2E8G A;  5K36 G;  2B63 G;  4OX9 L;  1KAW A;  4DR3 Q;  4JI6 Q;  3RZO H;  5M3M G;  1JJC B;  4IJL A;  1S72 A;  4LUZ A;  2KBN A;  2JA8 G;  2IHE A;  1Q81 C;  4Y7N H;  3PV0 A;  4LFA L;  1N34 L;  4JI0 L;  3S1N H;  1WYD A;  4LF8 Q;  3W1B A;  1VQJ A;  2KCT A;  2OQK A;  4AQY L;  4X66 L;  1CKO A;  2D0O A;  4BY7 H;  3S1Q H;  3RLO A;  4LF7 L;  2C35 B;  4YY3 Q;  4LF9 L;  4C3I H;  3GD7 A;  1IYJ B;  1V9P A;  1CKN B;  2EIF A;  3SGI A;  3TQY A;  3KJP A;  4DV5 Q;  1PH1 A;  1MKH A;  3PO3 H;  1K9M C;  1W3S A;  3HOX G;  1PH3 A;  4IO9 A;  4YHH L;  2GVB A;  2UUA L;  1C9O A;  2ZTE A;  1G51 A;  5GAH C;  3MXN B;  5C4J H;  1K73 C;  1FJG L;  1QUQ B;  2R7Z H;  1HNW Q;  1Y1W H;  2F4V L;  1Y1V G;  4A3C G;  2UXC Q;  4JI5 L;  4BBS H;  4TQU S;  2K5H A;  3CCM A;  4NXN L;  1YNX A;  1YIJ A;  1XPO A;  5IP9 H;  2MFI A;  2UU9 Q;  4A93 G;  2CWP A;  1UE7 A;  1GD7 A;  2GN5 A;  4A3B G;  1WCM G;  4R4I A;  4JOI C;  1WOC A;  3CP0 A;  4LF4 Q;  4A3D H;  2CCZ A;  3JAM i;  4JI6 L;  4YWL A;  4DR3 L;  2Q2I A;  3J80 i;  4YWM A;  3J81 i;  3PF4 A;  4GN5 A;  2EXD A;  4IOA A;  4B3S Q;  1A63 A;  4A3G G;  2RHQ B;  1HR0 Q;  4JI4 Q;  3AYH B;  4PG3 A;  4L5R C;  5C0X G;  4DAM A;  4L5Q A;  2ES2 A;  3EBE A;  1MIU A;  1VQF A;  3F2B A;  2NN6 I;  4YY3 L;  1JJ2 A;  1YZ6 A;  2VQF Q;  5LMU Q;  4DV5 L;  2I0Q A;  1VQD A;  4IPG A;  4DK3 C;  3M7N A;  1KQS A;  2HT1 A;  1A62 A;  1EYG A;  1KRS A;  1L1O C;  4R4Q A;  1VQC A;  1XMO Q;  4DUY Q;  4A3F H;  2NVX H;  5C4X G;  1DGS A;  1HNW L;  1D7Q A;  1V43 A;  4GNX B;  4R1J A;  3DLL A;  2AWO A;  4GNX C;  3GTM H;  3K8A A;  1BKB A;  5C0X J;  2UXC L;  2KEN A;  1O7I A;  2QGQ A;  3PUZ A;  2Q2T A;  2UU9 L;  5IWA Q;  4JI7 L;  4RG1 A;  1K83 H;  2WP8 J;  2Q2U A;  1PHJ A;  4FDB A;  4MNO A;  2HHH L;  1OXX K;  1PYB A;  5C3E G;  4A3K G;  1PH5 A;  2JA7 G;  3PCO B;  3PO2 H;  2OTJ A;  1VCI A;  4NB3 A;  1Q1B A;  2UXB L;  4WJ4 A;  2EQS A;  3CCJ A;  3CAM A;  1KL9 A;  1E1O A;  4R4O A;  5M3F H;  3CXC A;  1HZB A;  1UE5 A;  2BA1 A;  1Q8K A;  3HKZ G;  3K7U C;  2Z6K A;  2R92 G;  1HR0 L;  2PI2 A;  4OO1 G;  1VQH A;  1TWG H;  3AFQ A;  1C0A A;  1HZ9 A;  3W5O A;  5IP7 G;  4UP7 A;  1EIF A;  3M3Y H;  3FHW A;  1QVG A;  2A19 A;  4AYB G;  3F1Z A;  5LMU L;  1NY4 A;  3CC4 A;  4R4C A;  1I3Q H;  1HZC A;  2PMZ E;  4GN3 B;  2K5N A;  4ALP A;  4LFB Q;  3MEF A;  3S14 H;  4A4I A;  1XMO L;  2PI2 E;  1AH9 A;  2K4K A;  3E0E A;  2R7F A;  4ME3 A;  3HOY G;  1EFW A;  2GVA A;  1PA6 A;  3NEN A;  4A3J G;  4DR7 Q;  3CC7 A;  1H95 A;  1NMG A;  5LMN W;  3FP9 A;  1NJI C;  1WJJ A;  1FGU A;  4DPG A;  1U0L A;  2R7D A;  3HOZ G;  1E1T A;  5IWA L;  2AHO B;  4BXX G;  3K81 C;  1QZG A;  2NVT H;  1YHA A;  3STB C;  2B29 A;  3CCS A;  5GQO A;  5IT9 c;  1X9N A;  3CD6 A;  4DNI A;  2L15 A;  2KHI A;  4LWC A;  4JV5 L;  2JA5 G;  2YTV A;  4X6A H;  1PH8 A;  5C44 H;  3TS2 A;  3F8T A;  1X56 A;  1SR3 A;  4NPS A;  2E2H H;  1N9W A;  1K8G A;  4P74 A;  3PGZ A;  3I4O A;  1NE3 A;  4POF A;  4POG A;  1Z47 A;  1CUK A;  4BBR G;  3CCQ A;  3ULJ A;  3BU2 A;  2JA6 H;  2H5X A;  4LFB L;  1IBL L;  2JEA I;  5IE8 A;  1YJW A;  2VUM H;  3EN2 A;  5BR8 Q;  1BBW A;  1N36 Q;  2BH8 A;  3KDF B;  2A8V A;  3PUY A;  1TWC H;  2OWO A;  3I4N H;  4QJF A;  4YCV A;  5M5W H;  2Y0S G;  3CC2 A;  4QQB X;  3M4P A;  4H02 A;  2Y0S E;  1VQM A;  1PH6 A;  4WJ3 M;  4DR4 Q;  4LUO A;  5GRO A;  2YU9 H;  1EIY B;  1L0W A;  4KHP Q;  3JAM c;  2DUD A;  1B70 B;  1JMC A;  3J80 c;  1JE5 A;  1NBW A;  3UDI A;  3J81 c;  1J5E Q;  4GOP B;  1AE3 A;  3GDE A;  1IBK Q;  1BBU A;  2K50 A;  3J7Z C;  1M1K C;  1YBY A;  4JCV E;  2HQL A;  1I94 Q;  2UUB Q;  4A3C H;  3DM3 A;  2F52 A;  2JE6 I;  5LMN Q;  1VS0 A;  3HOV H;  2ID0 A;  4J15 A;  1GVP A;  3M85 A;  3JC6 6;  4A93 H;  4DR1 Q;  3S1R H;  1JB7 A;  1IZ6 A;  1YHQ A;  3WWV A;  4JOI A;  5JJK A;  1OXU A;  1X3E A;  4GKJ Q;  4PMW A;  3E9H A;  2VUM G;  2I5M X;  4OWW B;  2VL6 A;  3OYY A;  1MJE A;  1CKM A;  4IFD G;  5BR8 L;  2VQE Q;  1RIP A;  1Q7Y C;  4B3R Q;  1TWA H;  3K0X A;  3AEV A;  2HIV A;  4BA1 I;  1ASZ A;  2OQ0 A;  2VW9 A;  4DV1 Q;  3M4O H;  1I5F A;  4DR4 L;  1X3G A;  1XTD A;  3AFP A;  4IPD A;  5FLX c;  4HJA A;  4BY1 H;  4A3M H;  3OTO Q;  4MZ9 A;  4KHP L;  1UE1 A;  3A0J A;  1L1O A;  4DAY B;  4K0K Q;  2I5H A;  1IBM Q;  2JEB I;  1LYL A;  1SE8 A;  5H1S E;  3D0F A;  1VQ4 A;  4X62 Q;  1IBK L;  3ZJY C;  4GNX A;  5FLM H;  1AE2 A;  4LF8 L;  2DGY A;  1I94 L;  2UUB L;  2I5L X;  2K75 A;  2N3S A;  3S2H H;  1S3O A;  3KF6 A;  5IYB H;  2IX0 A;  4QGU A;  3H15 A;  2VZA A;  5LMN L;  1XNQ Q;  3H3V I;  2LSS A;  4BY7 G;  3VDY A;  3HOW H;  5IYC H;  1YJ9 A;  2ALY B;  3GTO H;  4PZ8 A;  3TRE A;  4A3K H;  3Q8D A;  2JA7 H;  4JBW A;  5AJ3 Q;  4UPA A;  4HJ8 A;  3U4V A;  5JEA G;  3PO3 G;  4GKJ L;  1W2B A;  2A1A A;  1HNX Q;  1VQN A;  3KFU A;  2UXD Q;  4JI3 Q;  2N78 A;  3NEM A;  2MO1 A;  1L2F A;  4DKA C;  3CCR A;  2R7Z G;  5GAG C;  3L7Z C;  1GM5 A;  5GAE C;  1OXS C;  4GLA C;  1Y1W G;  2VQE L;  2R92 H;  4P72 A;  3BZC A;  4B3R L;  4A3L H;  1UEB A;  5IP9 G;  1Q82 C;  5C0X I;  3S1M H;  3RN2 A;  4HJ9 A;  2NVQ H;  4UY8 C;  4DV2 Q;  1SN8 A;  4LF4 L;  3OTO L;  1TXY A;  4A3D G;  2XTI A;  3G48 A;  3S16 H;  4K0K L;  2CQO A;  3S24 A;  3S17 H;  1K0R A;  1RL2 A;  4B3S L;  4A75 A;  4JI4 L;  1X55 A;  1SRU A;  3J7A 5;  2PQA A;  3HKZ E;  3KLW A;  1SMX A;  4LW1 A;  4A3J H;  3S2D H;  2NZH A;  3H0G H;  4APV A;  3LGJ A;  3STB D;  4L5S A;  1XNQ L;  5ELO A;  3T1Y Q;  1GO3 E;  3D31 A;  2VQF L;  4KHZ A;  4BXX H;  3J81 j;  4DV3 Q;  1VQI A;  4XIG S;  4AYB E;  1M90 C;  1Q46 A;  2FXQ A;  2PNH A;  5AJ3 L;  1Q86 C;  1KC8 C;  5FJ8 H;  3I2Z A;  4DR2 Q;  4DUY L;  1HNX L;  2K14 A;  4A3F G;  3CCL A;  4JI3 L;  3B6Y A;  2UXD L;  4A3I H;  2ZTD A;  3E9I A;  4A3E G;  3PSI A;  5HGQ A;  1QZH A;  1LTL A;  3I56 A;  3RZD H;  4B3T Q;  4OO1 I;  2D0P A;  4DK6 C;  3RNU A;  2AMC B;  2JJQ A;  4JI1 Q;  4DV2 L;  2IT1 A;  4PZ7 A;  5DLQ E;  3U50 C;  4HID A;  4HJ7 A;  1VQ8 A;  2Q2H A;  3I4M H;  4DV0 Q;  2WB1 G;  3W1G A;  4DV7 Q;  5IYD H;  5JJL A;  2WB1 E;  3GTP H;  1G6P A;  1VQB A;  1FVI A;  4R4T A;  3U4Z A;  4GKK Q;  3PIO A;  1SRO A;  4LF6 Q;  3IRB A;  2ZJQ A;  4C3H H;  4X64 Q;  4X65 Q;  2B63 H;  3BZK A;  1P8L A;  1N33 Q;  1YVC A;  1PV4 A;  5JJI A;  5M3M H;  1X6O A;  2JA8 H;  1SLJ A;  3FKI G;  3CW2 C;  4JI8 Q;  4JBK A;  2MQH A;  4DR7 L;  1E3P A;  1FL0 A;  4HJ5 A;  1J6Q A;  2JK8 A;  1PYS B;  1YJN A;  1X65 A;  2LXK A;  3CME A;  3A5Z B;  4LFC Q;  1UE6 A;  3K80 C;  3RLF A;  1CKN A;  2ZJR A;  4BA2 I;  4XTC S;  1VQ9 A;  4TVA B;  4B3T L;  3CQZ H;  1XNR Q;  4O2D A;  2YTX A;  1X3F A;  3HOX H;  1PH9 A;  1QUQ A;  2UUA Q;  4GN4 B;  2ZTC A;  4IJH A;  4GOP C;  3T1H Q;  4DV7 L;  1EOV A;  1Y1V H;  2CKZ B;  3H3V H;  4RMF A;  3KOJ A;  4LUV A;  5C44 G;  3KJO A;  2E2I H;  1LUZ A;  3GTK H;  1G29 1;  4NXN Q;  3KF8 B;  3PUW A;  2AKW B;  5M5Y H;  3CF5 A;  4LF6 L;  3U58 A;  2AWN A;  1PH4 A;  3HOU G;  1WCM H;  1R9T H;  4A3B H;  2ZM6 Q;  3ER0 A;  4JG2 A;  4MTN A;  1E22 A;  4X65 L;  1IL2 A;  2NVY H;  1N8R C;  3GTG H;  1K3R A;  2YTY A;  5M5X H;  4Y52 H;  4UP8 A;  1XJV A;  3GTJ H;  2UUC Q;  1N33 L;  1Q12 A;  2KCM A;  2R93 G;  2JA6 G;  4A76 A;  4B3M Q;  1VQ7 A;  1KHI A;  1N36 L;  4JI8 L;  4A3G H;  4UP9 A;  3UE0 A;  3K7A H;  1YIT A;  3I4N G;  1YEZ A;  3PIP A;  2K52 A;  4IPH A;  3F2C A;  1KIX A;  1NMF A;  4LFC L;  2IX1 A;  4JI2 Q;  1HJP A;  2D62 A;  1VQO A;  2OTL A;  1OXV A;  3A74 A;  1XNR L;  4JC0 A;  1N32 L;  1JT8 A;  1EQR A;  1WFQ A;  1J5E L;  4IPC A;  4OWT B;  5J3B A;  5C4X H;  4EX5 A;  2VNU D;  1B8A A;  4IFD J;  4L5T A;  4QIW E;  4OON A;  3T1H L;  1Y14 B;  1NTG A;  3GTL H;  4NXM Q;  2NN6 G;  4IFD I;  1CSP A;  3HOV G;  3EIV A;  4EQ5 A;  4P71 A;  4DR1 L;  1OXT A;  3I55 A;  4LNQ A;  4JI7 Q;  2N49 A;  5C3E H;  2WFW A;  3KYH C;  1VQP A;  2ZM6 L;  2HHH Q;  1XPU A;  4DR6 Q;  3NEL A;  3RR5 A;  4JBM A;  3UE1 A;  2Z0S A;  2ZJP A;  3TEH B;  2UXB Q;  2ATW A;  2UUC L;  4LF5 Q;  4AH6 A;  4B3M L;  2QA4 A;  1E7Z A;  4YCW A;  1EWI A;  1PH2 A;  2WAQ G;  1B7Y B;  1E24 A;  5EAY A;  4BBS G;  2WAQ E;  1VQE A;  5E7N A;  4DR5 Q;  3A5U A;  2CWA A;  1HH2 P;  2QEX A;  5IP7 H;  3CMA A;  2ASB A;  3PUX A;  4DV1 L;  4HIO A;  4JI2 L;  1BVS A;  3G4S A;  5IY0 A;  4BY1 G;  1I50 H;  4A3M G;  5JEA J;  3CCE A;  1HZA A;  2MO0 A;  1A8V A;  1IBM L;  4HIM A;  1L1O B;  4O0A A;  4DV6 Q;  3AQQ A;  3TS0 A;  1XMQ Q;  1XPR A;  4X62 L;  1U5K A;  3HOY H;  1C7Y A;  5FLM G;  4DUZ Q;  1VQK A;  4KLK A;  2BH2 A;  1IXR A;  4A3E H;  4NXM L;  2E2J H;  3HOZ H;  4C2M H;  5IYB G;  3KF6 B;  1K8A C;  2F3I A;  5IYC G;  3HOW G;  1T9H A;  2E5L Q;  3RN5 A;  2MNA A;  4C3J H;  4DV4 Q;  4DR6 L;  4HIK A;  2JQO A;  4KI0 A;  2JA5 H;  4LF5 L;  3CCV A;  1PH7 A;  4JV5 Q;  3UDF A;  2V1C C;  3GTQ H;  1VQ5 A;  1Z9F A;  1Q1E A;  1TWF H;  2LXJ A;  3ULL A;  1VQA A;  2XGT A;  4DR5 L;  3OW2 A;  1YI2 A;  4A3L G;  4JYA Q;  1JJG A;  3I7F A;  3UDG A;  3M4Q A;  1KD1 C;  3L2P A;  3ERS X;  3PO2 G;  2YV5 A;  4BBR H;  3CCU A;  4QL5 A;  2N8N A;  4JBJ A;  4QY7 A;  3M9B A;  4PZ6 A;  2RCN A;  5M3F G;  1A0I A;  4P73 A;  1EQQ A;  4DV6 L;  3FKI H;  3KDF A;  1IBL Q;  1XMQ L;  1N32 Q;  1UWV A;  4DUZ L;  2Z6K C;  1MJC A;  2PQA B;  3GO5 A;  3H0G G;  1HNZ Q;  1QVF A;  1VQ6 A;  1GKH A;  3T1Y L;  1PFS A;  2IHF A;  3RLN A;  3G6E A;  2CFM A;  4OWX B;  1X54 A;  4DV3 L;  4YWK A;  4OX9 Q;  3L0O A;  2R6G A;  4YCU A;  3ICE A;  2VY3 A;  2YYZ A;  2JA9 A;  1P16 A;  2RF4 A;  1S40 A;  2E5L L;  3CPW A;  1ASY A;  2HIX A;  4DV4 L;  4DR2 L;  1YHB A;  2VS1 A;  3BJU A;  4GOP A;  5FJ8 G;  3PUV A;  4LFA Q;  2NZO A;  1V1Q A;  3ULP A;  1N34 Q;  1OTC A;  4JI0 Q;  2OCE A;  4IOC A;  4A3I G;  4GS3 A;  4X66 Q;  5ELN A;  4AQY Q;  4P75 A;  2RHS B;  1SFO H;  1KRT A;  2B3G A;  4LF7 Q;  3NBH B;  3G71 A;  4JYA L;  4LF9 Q;  1KXL A;  4AIM A;  5HY6 A;  1D8L A;  3HOU H;  4JI1 L;  4OXP A;  1LM0 A;  1QVC A;  4GLV B;  4YHH Q;  4DV0 L;  3UDX A;  3I4M G;  2BA0 A;  2K5V A; 
#chains in the Genus database with same CATH topology
 1CSQ A;  2R93 H;  2K01 A;  3SXH A;  4JI5 Q;  1WVL A;  4GKK L;  2KHJ A;  2V4D A;  3TRZ A;  4X64 L;  5KNB A;  5K36 G;  2PZT A;  4DAY A;  2Y0S B;  1KAW A;  3C46 A;  3VR4 A;  2KBN A;  2JA8 G;  1Q81 C;  4Y7N H;  3PV0 A;  5C4H A;  2MPM A;  2KCT A;  2A6H C;  4X66 L;  2D0O A;  2DJF C;  4BY7 H;  1G2T A;  3RLO A;  2EJM A;  3TN2 A;  4LF9 L;  1V9P A;  1WTP A;  1EFI D;  3BVM A;  1E2Z A;  1MKH A;  2AQ2 B;  3HOX G;  4DU9 A;  3SHL A;  2LS0 1;  1ICF B;  3A54 A;  5GAH C;  1FJG L;  1HNW Q;  2B2U A;  3F2U A;  2L1B A;  4K5X A;  4U68 A;  5IGB A;  2CH4 A;  3T16 A;  4BBS H;  1XPO A;  1YNX A;  2UU9 Q;  4KTA A;  1STH A;  2MFI A;  3FPP A;  2CWP A;  1MHW C;  1GD7 A;  4LMQ D;  5CYU A;  1C8C A;  1WOC A;  4LF4 Q;  4A3D H;  2HUG A;  3PF4 A;  2RHQ B;  1SYD A;  3GTJ B;  3SK6 A;  1HA5 A;  5IIF A;  3EBE A;  5A2Q E;  3NHH A;  2WV6 D;  3QB3 A;  1JJ2 A;  1EY6 A;  1VQD A;  3K59 A;  3S1Q B;  2M00 A;  5JPM C;  2DN8 A;  2NVX H;  3DEO A;  1H9K A;  1QOH A;  3QO2 A;  2Z6B A;  2AWO A;  4GNX C;  3PO3 B;  3LX0 A;  2KEN A;  1Z6H A;  1FGB D;  4RG1 A;  1PHJ A;  1HQM C;  1Y1W B;  3PO2 H;  5C3E G;  1PH5 A;  2O4X A;  2J0T D;  3PCO B;  5JPN C;  1IW7 C;  4KJN A;  3CXC A;  3K7U C;  1EYC A;  2PI2 A;  1ML0 D;  2O2L D;  3L3O C;  2K33 A;  3AFQ A;  4IUU A;  4IUR A;  2F0F A;  1GJX A;  1NY4 A;  4R4C A;  2PMZ E;  2K5N A;  4G7O C;  5A35 A;  3E0E A;  1U9R A;  1H95 A;  4NMZ A;  5LMN W;  1NJI C;  1F9S A;  1Z7T A;  3STB C;  5NUC A;  5GQO A;  5IT9 c;  1GUW A;  1X9N A;  3Q24 A;  2L15 A;  3S9W A;  2Z4I A;  1PXU A;  3F8T A;  1X56 A;  4NPS A;  2E2H H;  2QDL A;  3PIP 3;  1T5X D;  4POG A;  4EQP A;  2G9H D;  3BU2 A;  2JA6 H;  2H5X A;  4DAV A;  2JEA I;  1T5E A;  1YJW A;  4QQB X;  2Y0S G;  3CC2 A;  3D4R A;  1VQM A;  3FKI B;  3S14 B;  1ILQ A;  4OIK A;  1FNW A;  1L0W A;  3DWP A;  1GUN A;  1UNS A;  3UDI A;  3J81 c;  1J5E Q;  1AE3 A;  3DM1 A;  5JVG 3;  5FOB B;  1FYC A;  1I94 Q;  2UUB Q;  4A3C H;  2K32 A;  1JOK A;  3QJY A;  4A93 H;  3I90 A;  4LK1 C;  3WWV A;  4JOI A;  5C44 B;  1X3E A;  4DF7 A;  5JJK A;  1JWM D;  2KCC A;  2P5Z X;  4TRD A;  4PMW A;  5D65 A;  3OYY A;  4CDE C;  4IZ8 A;  4PMC A;  4KJO A;  1MSH A;  1L0Y B;  5C5L A;  1SYB A;  4BA1 I;  2VW9 A;  3C3L A;  1LTT D;  1Y8P B;  4A3M H;  4CBV A;  5M5W B;  1UE1 A;  4K0K Q;  2I5H A;  3NQT A;  1SE8 A;  5H1S E;  1IBK L;  3I70 A;  3ZJY C;  1AE2 A;  3S2H H;  3KF6 A;  2IX0 A;  4QGU A;  5ELB A;  2VZA A;  3HOW H;  3TRE A;  5AJ3 Q;  1ENA A;  4UPA A;  4HJ8 A;  3PO3 G;  4GKJ L;  2A1A A;  1JOR A;  3NQI A;  3NEM A;  4Q5V A;  4DKA C;  1PTO D;  1OXS C;  4GLA C;  4B08 A;  4DNR B;  1Y1W G;  3BZC A;  2B2U C;  4B3R L;  4A3L H;  1UEB A;  4UY8 C;  1SN8 A;  3DHQ A;  4BBS B;  1TXY A;  3S17 H;  1GHJ A;  3M4O B;  1HFG A;  4A75 A;  1SRU A;  3KLW A;  4LW1 A;  3JAM L;  3H0G H;  1XNQ L;  4R8I A;  4KY6 A;  2VQF L;  4KHZ A;  4BXX H;  3J81 j;  3G6J B;  3AMU A;  1V1P B;  3I2Z A;  2K14 A;  2UXD L;  4JI3 L;  5DEH A;  4CJ1 B;  4A3I H;  2JA7 B;  1W6J A;  3K5M A;  4FF4 A;  2Q8R E;  3NBH A;  5HGQ A;  1LTL A;  1EQV A;  1MD2 D;  3BZD B;  1SYF A;  1IL8 A;  3BVZ A;  2AMC B;  3I4L A;  2R92 B;  1VQ8 A;  3NTH A;  1D5Z C;  1EY5 A;  5JJL A;  3PO2 B;  2NVQ B;  4R4T A;  4HTH A;  1BF4 A;  5C4Z A;  3VYT A;  4GKK Q;  1SRO A;  4C3H H;  4X64 Q;  2RQX A;  3RMH A;  1HTL D;  2OXP A;  3MTS A;  1BBX C;  1XWE A;  1X6O A;  2JA8 H;  3FKI G;  2F03 A;  2HQE A;  4HJ5 A;  1FL0 A;  3SEB A;  4YIJ A;  1EZ6 A;  1PYS B;  1SJE D;  1YJN A;  3CME A;  1PRT B;  5ELF A;  2CW0 C;  1CKN A;  5ELE A;  1PFB A;  3HOX H;  1PH9 A;  1OO9 B;  3MXN A;  2XRQ D;  3C1E A;  3UI2 A;  3MFG A;  4K8I A;  3K6O A;  4GN4 B;  3RZD B;  4KK7 A;  3LWE A;  2CKZ B;  4M1U B;  2QEJ C;  2CH4 W;  1SEB D;  4RMF A;  5C44 G;  3I4M B;  4IUT A;  3QOL A;  3J7Y W;  1QCB D;  3PUW A;  3CF5 A;  3P1H A;  3U58 A;  3HOU G;  1PH4 A;  2ZM6 Q;  3ER0 A;  2E2H B;  2NVY H;  2RKS A;  1BCP B;  1N33 L;  4JVZ A;  2B2Y C;  3QWN A;  2DNE A;  2R93 G;  1TS3 A;  3K5L A;  3ND9 A;  4B3M Q;  1N36 L;  2F3V A;  1CTM A;  1RF2 D;  3MFY A;  1JB3 A;  3K7A H;  1YEZ A;  3PIP A;  4IPH A;  3VA5 A;  3D6C A;  1NMF A;  2IX1 A;  4RGN A;  1CFM A;  4CDC C;  1B9M A;  1WFQ A;  3TZD A;  2HDL A;  5J3B A;  3JAM E;  4L5T A;  1NTG A;  1C4Q A;  1SE2 A;  5IT9 L;  1RDP D;  1I4H A;  2BOS A;  1IYV A;  3EIV A;  4G4K A;  1CT1 D;  3T13 A;  1OXT A;  2F0U A;  5C3E H;  2WFW A;  2XSC A;  1S5E D;  3RR5 A;  1F2L A;  2D5D A;  3PMF A;  2R61 A;  2QA4 A;  1E7Z A;  1R9T B;  4XYQ A;  2ICI A;  4LJZ C;  2WAQ G;  1PFM A;  1E24 A;  5EAY A;  4BBS G;  1VQE A;  3SVM A;  3ERQ A;  3A5U A;  2QEX A;  4HR7 B;  4KY5 A;  4F87 A;  5JEA J;  2XWJ B;  1EYA A;  1IBM L;  2BE5 D;  1Q8I A;  4X62 L;  1C7Y A;  1VQK A;  2A5H A;  2K5Q A;  3J81 L;  4A3E H;  5IYB G;  1Y8O B;  1RHP A;  2JP1 A;  4S3S A;  1DJR D;  2WIN B;  2F3I A;  1T9H A;  3PIO 3;  3GTL B;  3RN5 A;  4DR6 L;  1KAA A;  1AFP A;  2KJX A;  3LNN A;  1PH7 A;  3UDF A;  4UAI A;  1Z9F A;  1KAB A;  4FF2 A;  1QNU A;  2KVM A;  3ULL A;  2ENB A;  3I7F A;  3PO2 G;  2YV5 A;  3CCU A;  4QL5 A;  2N8N A;  4JBJ A;  4IAL A;  3M9B A;  2EY6 A;  2L9H A;  1A0I A;  4P73 A;  4DV6 L;  3KDF A;  4DAP A;  5CV4 A;  1G8Z D;  4AYB B;  4HCS A;  3D3R A;  1UWV A;  4DUZ L;  5EKK A;  1HNZ Q;  3GO5 A;  1QVF A;  1AN8 A;  3L0O A;  4YCU A;  1WTV A;  4DR2 L;  3BJU A;  5FJ8 G;  4XQQ A;  4LFA Q;  1N34 Q;  3ULP A;  3K57 A;  2VB2 X;  4C3J B;  5T1G A;  4OHJ A;  2RHS B;  2K5W A;  4AIM A;  1CZG A;  3BYY B;  1HQR D;  1QNK A;  5T1I A;  3I4M G;  1MBY A;  3EFX D;  3PF5 A;  5GAD C;  2F4V Q;  2IY5 B;  4BBR B;  3HFZ B;  4K6L A;  1I6H H;  5BN4 A;  2G9D A;  1K8O A;  3F2D A;  2AUJ D;  1HPC A;  1R4P B;  1VQG A;  1IKM A;  4OX9 L;  5BN5 A;  5LHY 1;  4JI6 Q;  4DR3 Q;  1JJC B;  1BUV T;  4HSV A;  2B2W A;  2OEO A;  3W1B A;  1VQJ A;  5CBE E;  1DCZ A;  2OQK A;  4AQY L;  1TVX A;  1CKO A;  3H6M A;  3S1Q H;  4LF7 L;  2C35 B;  2EIF A;  2OF1 A;  1V1O A;  1I6V C;  3PO3 H;  1K9M C;  4ODG A;  1PDQ A;  2GVB A;  1C9O A;  2ZTE A;  4PQX A;  1QUQ B;  4LAA A;  1ZXT A;  1A2U A;  1Y1W H;  2LY7 A;  4A3C G;  2UXC Q;  4TQU S;  2K5H A;  4A93 G;  4KKT A;  3A55 A;  2GN5 A;  1TWH B;  3S15 B;  2H1E A;  2EYL A;  2Q2I A;  3J80 i;  1A63 A;  2EXD A;  1HR0 Q;  2A6E C;  3RZO B;  2F0T A;  3F2B A;  2L5T A;  2NN6 I;  4YY3 L;  1WTR A;  3V2T A;  2VQF Q;  3S1N B;  4DV5 L;  4IPG A;  5COY A;  1PMR A;  5EBC A;  4R4Q A;  1VQC A;  1A3V A;  3LWU A;  4UHV A;  1LAB A;  4GNX B;  4R1J A;  1RCV D;  1BKB A;  1M4V A;  4X3S A;  5C0X J;  2QGQ A;  3GP7 A;  5IWA Q;  4JI7 L;  2R7Z B;  2G5D A;  3MWY W;  2HHH L;  1OXX K;  1PYB A;  2EYJ A;  1VCI A;  1PLF A;  1FD7 D;  1E1O A;  1G2S A;  2SNM A;  4ZCK A;  1FNU A;  1FR3 A;  1Q8K A;  2A73 B;  1BQQ T;  5C3X A;  3NWS A;  3MXG A;  1C0A A;  1HZ9 A;  5IP7 G;  1EIF A;  5A2Q L;  3FHW A;  2A19 A;  4AYB G;  3F1Z A;  2EJG C;  5LMU L;  5EKL A;  2K04 A;  3MEF A;  3S14 H;  1XMO L;  2IWH A;  1SYC A;  4DK1 A;  1F2Z A;  1STA A;  1TS4 A;  1CA5 A;  3FP9 A;  4J8Q A;  1FGU A;  4DPG A;  4A3F B;  4I7Z C;  3GV6 A;  2AHO B;  4BXX G;  2CHB D;  3SK4 A;  1TS2 A;  4A3E B;  5HGT A;  4ZK9 B;  3VR5 A;  4C3J G;  3CD6 A;  1FNV A;  5IGD A;  4LWC A;  2BDO A;  1NCV A;  4X6A H;  4RWS C;  1PH8 A;  5C44 H;  1SE3 A;  3KF8 A;  2NBF A;  5CR3 A;  3X3M A;  5M3F B;  2IJ0 A;  1NE3 A;  5C6A A;  1Z47 A;  4BBR G;  3PQI A;  3CCQ A;  3ULJ A;  1TWG B;  1SYG A;  2PW5 A;  1F2M A;  4KHV A;  5FO7 B;  4LFB L;  5KND A;  3OW7 A;  2B2T C;  5IE8 A;  4F7X A;  5BR8 Q;  2HCC A;  1BBW A;  1N36 Q;  2K5D A;  2EZV A;  3PUY A;  1II3 A;  4QJF A;  5M5W H;  3A56 A;  1WD0 A;  4RH6 A;  1PH6 A;  4MN3 A;  4C3H G;  4LUO A;  3DWQ A;  3I73 A;  3JAM c;  2IPK D;  5KYI A;  4GOP B;  1KDB A;  1BBU A;  3J7Z C;  2NVT B;  1M1K C;  1YBY A;  2AQ1 B;  2HQL A;  3DM3 A;  2JE6 I;  3C1F A;  1VS0 A;  3M85 A;  1JB7 A;  1IZ6 A;  1YHQ A;  1TT2 A;  1GUT A;  1A15 A;  1OXU A;  2I07 B;  2I5M X;  2NB0 A;  1EU4 A;  2PPB C;  1NR4 A;  4RKB A;  3QR8 A;  1ESF A;  2TSS A;  1MSG A;  2VQE Q;  2RSO A;  4FXD A;  3KLS A;  3M4O H;  4DR4 L;  1I6H B;  2B2V A;  4HJA A;  4IPD A;  1DON A;  3OTO Q;  4KHP L;  1L1O A;  3A0J A;  4DAY B;  5EBD A;  1IBM Q;  5L37 A;  3U9O A;  4X62 Q;  4TSS A;  5C5M A;  2F0P A;  5EQ0 A;  2DGY A;  2K75 A;  2B2W C;  4ZAI A;  5IYB H;  5LMN L;  2LSS A;  1UUP A;  3NXW A;  2JA7 H;  1TY0 A;  2BCO A;  1YNN C;  3IL8 A;  3HOV B;  5JEA G;  1W2B A;  4CKE A;  2RCF A;  4HSP A;  1VQN A;  4K6D A;  2R7Z G;  5GAG C;  3IFD A;  2F0H A;  1H9M A;  3TP5 A;  2R92 H;  4M8A A;  4KN7 C;  4JW0 A;  1LTR D;  1JWU D;  4K5V A;  5IP9 G;  5DAU A;  1Q82 C;  5I9O A;  3RN2 A;  2NVQ H;  1LT6 D;  4DV2 Q;  5DM7 3;  2IX3 A;  4QUC A;  1W6K A;  1SNP A;  5C3W A;  3KBX A;  2CQO A;  2F4I A;  3BDL A;  1CI3 M;  1K0R A;  1RL2 A;  3K5O A;  2Q8T A;  2C9O A;  4JI4 L;  4BY1 B;  2CQA A;  1SMX A;  4A3J H;  3V05 A;  3VYU A;  3GQB A;  4APV A;  1ET9 A;  1I4X A;  3LGJ A;  4G57 A;  2C5C A;  2I46 A;  1O7L A;  4XIG S;  4AYB E;  2PZW A;  3EVQ A;  1Q86 C;  5JOB A;  1KC8 C;  5FJ8 H;  4DR2 Q;  2EYO A;  1HNX L;  4A3F G;  3B6Y A;  3I91 A;  3N6R A;  3MA2 B;  4HMJ A;  3E9I A;  4A3E G;  3PSI A;  1QZH A;  4XXE A;  5D14 A;  3RZD H;  4ZRZ A;  4OO1 I;  1G6Z A;  2K6A A;  3RNU A;  4HJ7 A;  2IT1 A;  1EY8 A;  4PZ7 A;  3U50 C;  3I4M H;  1SE4 A;  1X32 A;  4C1N K;  2L55 A;  2WB1 E;  1G6P A;  1FVI A;  3OMG A;  3S16 B;  1EY7 A;  4CDD C;  4LF6 Q;  1DZ1 A;  1HUN A;  4U67 3;  1HHV A;  3BZK A;  3OIQ A;  1P8L A;  2DY7 A;  1YVC A;  1PV4 A;  1GUS A;  3HEJ A;  4KKU A;  3CW2 C;  2EJF C;  2K28 A;  4JPB W;  3ZYY X;  3MC0 B;  5E4W C;  4ZUJ A;  2MQH A;  4JBK A;  1DD2 A;  1J6Q A;  3DUZ A;  1JOO A;  1IHZ A;  4N8F A;  1RTO A;  3K80 C;  2ZJR A;  2PCF B;  4XTC S;  1VQ9 A;  4QF4 A;  4B3T L;  5EKI A;  4GOP C;  4DV7 L;  4FF3 A;  1VF7 A;  1F77 A;  1JOQ A;  1NUC A;  1AW7 A;  3GTK H;  1LUZ A;  3MVV A;  1R9T H;  1NAP A;  3T56 B;  4JG2 A;  1E22 A;  4X65 L;  1K3R A;  3CU7 A;  4Y52 H;  2Z4H A;  1XJV A;  2UUC Q;  3NE5 B;  2KCM A;  1XX8 A;  4A76 A;  2NWG A;  1A6X A;  1KHI A;  1ENF A;  4JI8 L;  2H4O A;  2B63 B;  5LL6 X;  4UP9 A;  2A69 C;  5FO9 B;  1YIT A;  3F2C A;  1SMY D;  4LFC L;  3HP3 A;  2OTL A;  1OXV A;  1G91 A;  1XNR L;  4JK1 C;  1U4M A;  2EYH A;  1DOL A;  3EJI A;  1B8A A;  4EX5 A;  4IFD J;  4QIW E;  3T1H L;  1SNC A;  1Y14 B;  3GTL H;  1STY A;  4NXM Q;  1LAC A;  2NN6 G;  4IFD I;  1ZYR D;  1CSP A;  1LT5 D;  2JN4 A;  3HOV G;  4DR1 L;  4X3T A;  4JI7 Q;  2N49 A;  1HUM A;  5K5P A;  1VMP A;  1EIH A;  2HHH Q;  4JBM A;  2Z0S A;  3GV3 A;  3NSW A;  4EGV A;  2F0Q A;  1HFN A;  4CKC A;  3BS1 A;  4A3B B;  4YCW A;  1EWI A;  1A3T A;  1WTW A;  4C1N I;  2RDF A;  1HXY D;  2ASB A;  5IP7 H;  4DV1 L;  4HIO A;  4JI2 L;  4XT3 B;  1BVS A;  5IY0 A;  4BY1 G;  4XQJ A;  2M2L A;  1HRJ A;  1S4Z A;  1PFN A;  2X6G A;  1XMQ Q;  5EJW A;  3BVG A;  1XPR A;  2BH2 A;  1ZKO A;  4RGM A;  5C4X B;  3M7G A;  3KF6 B;  5COR A;  4EVO A;  1ZEQ X;  1PZI D;  1NNX A;  4C3J H;  4DV4 Q;  3K58 A;  4H13 C;  4LF5 L;  3CCV A;  1EL0 A;  2V1C C;  4K2L A;  2LXJ A;  4JYA Q;  4DR5 L;  1JJG A;  2JSO A;  1KD1 C;  3UDG A;  3ERS X;  4BBR H;  1SSO A;  5CV8 A;  4QY7 A;  3NPP A;  4HCE A;  4PZ6 A;  3BG3 A;  2RCN A;  2NTS A;  1EQQ A;  4XYO A;  4V19 0;  1D5M C;  3NUC A;  2IHF A;  2JYO A;  4A3J B;  2JA9 A;  1S40 A;  2RF4 A;  2E5L L;  2KEE A;  1SDF A;  4OEL B;  1HCZ A;  3CPW A;  1YHB A;  2VS1 A;  3ITP A;  3SR1 A;  4I7A A;  2SNS A;  1KDC A;  4IOC A;  1VF5 C;  2XIW A;  4X66 Q;  1WTX A;  1KRT A;  4B9X A;  3NBH B;  4LF9 Q;  2EXZ A;  5HY6 A;  4JI1 L;  5I6Y A;  4OXP A;  1LM0 A;  4X3U A;  2VB3 X;  4DV0 L;  1TWF B;  1M90 C;  1FJG Q;  1SNO A;  5IYD G;  1TWH H;  1WI5 A;  2FHT A;  4RKL A;  3WOE A;  5M9O A;  1HR0 W;  3S15 H;  5CV7 A;  1LLR D;  4QCL A;  1H9S A;  3CPF A;  3TDQ A;  3HKS A;  1ESR A;  1O7Z A;  1VQL A;  1EUJ A;  2E8G A;  3IKJ A;  3SE0 A;  2B63 G;  5KYL A;  3RZO H;  2PNR C;  2F0D A;  1RD9 D;  4IJL A;  1S72 A;  4LUZ A;  2L11 A;  1EWC A;  2IHE A;  3A8J E;  4JI0 L;  3S1N H;  1SND A;  2K03 A;  1LTB D;  3KLS X;  4PNY A;  1LTS D;  3GD7 A;  1IYJ B;  3TQY A;  1CKN B;  5JEA H;  1W3S A;  4YHH L;  3AB9 A;  2UUA L;  5C4J H;  1K73 C;  3MXN B;  2R7Z H;  2Z1C A;  3FEW X;  2LMC B;  3D8G A;  1IKL A;  4JI5 L;  2VUM B;  4RAU C;  5KRU A;  5IP9 H;  4I65 A;  2KOL A;  4ZLT F;  3TSS A;  4A3B G;  2LFN A;  4R4I A;  4JOI C;  3GTK B;  3CP0 A;  2CCZ A;  3TP6 A;  4FO2 A;  1Q90 A;  4IN3 A;  4YWL A;  4YWM A;  5FKA C;  4E6I A;  3J81 i;  4IOA A;  2F0G A;  4JI4 Q;  4PG3 A;  4L5R C;  4L5Q A;  2ES2 A;  1MIU A;  3A8I E;  5J1Z A;  1JIC A;  3URY A;  4GZY C;  4L63 B;  4DK3 C;  4HED A;  1KQS A;  1A62 A;  5KEE A;  1KRS A;  1PRT F;  4A3F H;  5C4X G;  1DGS A;  3R2T A;  4C3I B;  4K14 A;  1HNW L;  4L6T B;  1GHK A;  1DYQ A;  3GTM H;  3K8A A;  3PUZ A;  2Q2T A;  2UU9 L;  2Q2U A;  2WP8 J;  1O78 A;  4MNO A;  4ME5 A;  2JA7 G;  2OTJ A;  2EE1 A;  2UXB L;  3CCJ A;  3CAM A;  1DOK A;  5IOD A;  1KL9 A;  5M3F H;  1B3Q A;  1YNJ D;  4R4O A;  1HZB A;  1UE5 A;  5D3D A;  4OIJ A;  2R92 G;  2Z6K A;  2SDF A;  2E74 C;  2MGS A;  4OO1 G;  1VQH A;  1TWG H;  1BCP F;  1PTO B;  1JCK B;  3ERO A;  2KED A;  3W5O A;  1Y8N B;  5FK9 C;  4IUV A;  4UP7 A;  3M3Y H;  1RTN A;  3TME A;  3NP8 A;  3CC4 A;  4HMI A;  4ALP A;  4A4I A;  2PI2 E;  3HRZ C;  2FMM A;  1AH9 A;  3VA7 A;  2R7F A;  1LO5 D;  1EFW A;  1PA6 A;  3NEN A;  2ZXP A;  4A3J G;  3CC7 A;  4WOR A;  1Q3L A;  4CGY B;  1U0L A;  2R7D A;  5KNC A;  1E1T A;  3K81 C;  2NVT H;  4NP5 A;  4QUF A;  1X3P A;  3OIP A;  4ID6 A;  4DNI A;  3D4W A;  1NR2 A;  1CHQ D;  4JV5 L;  1K83 B;  2X69 A;  4K8J A;  3R3O A;  1K8M A;  5IGG A;  1SR3 A;  1N9W A;  2DNC A;  2WB1 B;  4N9T A;  3WDN A;  1S5B D;  3I4O A;  4R9W A;  1ET6 A;  1CUK A;  2MJ8 A;  3D6W A;  1VDZ A;  4FXK C;  1LV9 A;  3MEH A;  1IBL L;  3KDF B;  2OWO A;  2EVB A;  1JQY D;  1I3Q B;  3MZ5 A;  3M4P A;  1D1K A;  4H02 A;  4OEM B;  4QMG A;  3MXU A;  4WJ3 M;  3K0Y A;  5GRO A;  5EPJ A;  1J8I A;  1BO0 A;  1B70 B;  1JMC A;  1L0X B;  4K5W A;  3A7A B;  5EPK A;  5ELD A;  1IBK Q;  1K3B C;  3GDE A;  2K50 A;  4JCV E;  2PYK A;  2NN6 H;  2F52 A;  3HOV H;  2QDB A;  4J15 A;  1AEX A;  1GVP A;  3JC6 6;  4CJ0 B;  4DR1 Q;  3HGB A;  3KBG A;  4BWG B;  4RCN A;  4GKJ Q;  2VUM G;  4OWW B;  1CKM A;  5DM6 3;  4EQO A;  4IFD G;  2Q8I B;  1RIP A;  1AZP A;  4B3R Q;  5C0X H;  3K0X A;  3AEV A;  2EY1 A;  2WII B;  2OQ0 A;  2MUY A;  4DV1 Q;  1X3G A;  1I4R A;  4CDF C;  4BY1 H;  1B3A A;  1TWC B;  5CGK A;  3I4N B;  4MZ9 A;  1GUO A;  2RBM A;  3NWT A;  1LYL A;  4V0B A;  3E6Z X;  2YU9 B;  4LF8 L;  4GNX A;  1QG7 A;  1I94 L;  2UUB L;  1S3O A;  4QIW B;  3H15 A;  1XYI A;  1XNQ Q;  3SK8 A;  3H3V I;  1YJ9 A;  1KNA A;  3EQL C;  4PZ8 A;  4A3K H;  1JWS D;  3Q8D A;  1U4L A;  2L0C A;  2ZXO A;  4MHE A;  2AQ3 B;  4UDU C;  2D2C C;  3U4V A;  3KFU A;  2UXD Q;  4JI3 Q;  3S1R B;  1RJT A;  3CCR A;  1L2F A;  5E4X A;  1TY2 A;  2FIN B;  3VR2 A;  4P72 A;  2XWB B;  5C4J B;  4H7B A;  2EOT A;  5C0X I;  1ZYR C;  2IL8 A;  4RGT A;  2WKC A;  1U4P A;  1TWA B;  2X6L A;  3FRP B;  2XTI A;  3S16 H;  4K0K L;  1E2V A;  4B3S L;  1X55 A;  3J7A 5;  2PW7 A;  2PQA A;  2NZH A;  1B50 A;  1PTO C;  3J80 L;  1PZK D;  1TS5 A;  5ELO A;  3D31 A;  2F0I A;  2FXQ A;  2PNH A;  5AJ3 L;  4DUY L;  2K05 A;  3G7L A;  3CCL A;  4XQN A;  1KNE A;  1QWY A;  3GTO B;  2ZTD A;  3VYR A;  2F0N A;  4IQZ A;  1VMC A;  2Z9H A;  2AUK A;  3I56 A;  2K1B A;  3SK5 A;  2J4X A;  2JJQ A;  2EPB A;  4JI1 Q;  5DLQ E;  3GTM B;  2KEC A;  4DV0 Q;  2WB1 G;  3S1M B;  1BXT A;  2F0O A;  5IYD H;  5FLX L;  5JVH 3;  1VQB A;  1BNZ A;  3U4Z A;  5ISR A;  2CW0 D;  5J39 A;  2EYP A;  1F2Y A;  3PIO A;  2QKI C;  2ZJQ A;  1EU3 A;  1H9R A;  1BDO A;  2B63 H;  1S5F D;  3S2D B;  1N33 Q;  2F0L A;  3R93 A;  2FFK B;  1SLJ A;  3M3Y B;  2F0S A;  4OL7 A;  4DR7 L;  1E3P A;  4IUP A;  1X65 A;  2LXK A;  3A5Z B;  1M8A A;  1LT3 D;  3RLF A;  4BA2 I;  1MI2 A;  3I3C A;  3RD4 A;  1JE4 A;  3Q23 A;  2FMC A;  2UUA Q;  4IJH A;  2ZTC A;  3FPU B;  1EOV A;  5CC4 A;  3KOJ A;  4DGZ A;  2EY5 A;  2E2D C;  3KF8 B;  2AKW B;  4A3B H;  1CQF A;  3I8Z A;  4MTN A;  3GTP B;  4ZQ3 A;  4IUN A;  2YTY A;  4UP8 A;  1Q12 A;  5EPL A;  2WAC A;  4CHT B;  1KDA A;  2A74 C;  1VQ7 A;  2XRS D;  3I4N G;  1EZ8 A;  3M4Y A;  4KKS A;  5M3M B;  1HJP A;  2D62 A;  1VQO A;  3A74 A;  1B4O A;  2ZXR A;  1IYU A;  1XXG A;  3R8B A;  1EQR A;  3V96 A;  4IPC A;  5C4X H;  2VNU D;  2FJ2 A;  4OON A;  4XT1 B;  3CQZ B;  3J80 E;  1ENC A;  3T4A C;  4EQ5 A;  4P71 A;  1KTK A;  3NK9 A;  3I55 A;  1Y1V B;  4F8M A;  5I9P A;  2ZM6 L;  1XPU A;  4DR6 Q;  2ZJP A;  2E2I B;  3TEH B;  2EDG A;  3E3X A;  2UXB Q;  5G3L F;  5M5Y B;  4AH6 A;  4B3M L;  1WCM B;  5IGF A;  4DXF A;  1PH2 A;  4CJ2 C;  3GTG B;  1B7Y B;  4OO1 H;  5M5X B;  2EYM A;  1PYW D;  2CWA A;  3CMA A;  4RCO A;  4TKO B;  4ZKB B;  4A3G B;  1RKN A;  2BDN A;  1HZA A;  2HDM A;  2MO0 A;  4N9P A;  1S5D D;  4EQN A;  5FLX E;  1BOS A;  1L1O B;  4DV6 Q;  1S5C D;  4ZYS A;  5FO8 B;  5FLM G;  4DUZ Q;  4KLK A;  2NTT A;  2MHV A;  3OMC A;  1K8A C;  1WTQ A;  5IYC G;  4P2C B;  2RA4 A;  2MNA A;  1C48 A;  5TSS A;  1TKW B;  2JQO A;  1STE A;  4KI0 A;  3QOJ A;  4MTK A;  5JJZ A;  4JV5 Q;  2BE5 C;  2VXW A;  4A3K B;  1VQ5 A;  1NSN S;  1B9N A;  1Q1E A;  1TWF H;  1YI2 A;  1VQA A;  2DY8 A;  2QCP X;  3HKZ B;  5ELC A;  1CQV A;  4C56 C;  4Q0F A;  4B9W A;  3A7L A;  5M3F G;  1STG A;  1IBL Q;  1CHP D;  5DNF A;  1PRT D;  1I50 B;  1YNJ C;  1MJC A;  2O5I C;  2HD3 A;  1GKH A;  3T1Y L;  4DK0 A;  3G6E A;  4G7Z C;  2CFM A;  1JC7 A;  4OWX B;  4DV3 L;  3HOY B;  4YWK A;  4OX9 Q;  2R6G A;  3ICE A;  2YYZ A;  5KGU A;  1P16 A;  1ASY A;  2F3W A;  4H0L C;  1PZJ D;  3HOZ B;  1CK1 A;  4C2M B;  2E2J B;  1H9J A;  3PUV A;  5I2X A;  3QG1 A;  2OCE A;  1LTG D;  1O80 A;  1LTI D;  4GS3 A;  4AQY Q;  3TBI B;  4LF7 Q;  2B3G A;  3MAQ A;  1KXL A;  2JA5 B;  3MHB A;  1BCP D;  3GTQ B;  4Z9C B;  3I72 A;  2B2Y A;  1QVC A;  4GLV B;  2VUM H;  2K5V A;  2QW7 A;  2B39 A;  4IFD H;  1D6E C;  2QIL A;  2LKV A;  1PVO A;  4R8N A;  1HNZ L;  4GLX A;  1SXT A;  4HAE A;  3Q6S A;  5M3M G;  1JR0 D;  3W3A A;  3HG9 A;  1N34 L;  4LFA L;  1WYD A;  4LF8 Q;  3CRK C;  5CBA E;  1F9Q A;  1GXD C;  4YY3 Q;  4C3I H;  3KJP A;  3SGI A;  1J9O A;  2N88 A;  4DV5 Q;  2B8F A;  1PH1 A;  1PH3 A;  2KA7 A;  4IO9 A;  3NTK A;  2A68 D;  1SFO B;  1G51 A;  4FNF A;  2A6E D;  3HOU B;  2F4V L;  1Y1V G;  4HN7 A;  1O7Y A;  4NXN L;  3CCM A;  1YIJ A;  2R93 B;  1UE7 A;  1STN A;  2K7V A;  1WCM G;  1QB5 D;  3FVQ A;  3H3V C;  1EEF D;  3JAM i;  1PTO H;  4DR3 L;  4JI6 L;  2KHS A;  4GN5 A;  4B3S Q;  4A3G G;  3AYH B;  1E2W A;  5C0X G;  1MGS A;  4DAM A;  1VQF A;  2O5J C;  2SEB D;  4Y7N B;  1YZ6 A;  5LMU Q;  2I0Q A;  1V1P A;  2B2V C;  3M7N A;  2HT1 A;  1EYG A;  1SJH D;  1L1O C;  1XMO Q;  4BY7 B;  4DUY Q;  3K5N A;  1D1I A;  1D7Q A;  1V43 A;  3DLL A;  1QIL A;  5JAV A;  2F0J A;  2UXC L;  1LTA D;  1O7I A;  3DMU A;  1UAP A;  2SOB A;  1K83 H;  5I6W A;  4FDB A;  1EQT A;  4A3K G;  2RVL A;  4PMB A;  2WAQ B;  4NB3 A;  1Q1B A;  4WJ4 A;  2EQS A;  4DFA A;  5E1F A;  2BA1 A;  5BN3 A;  3HKZ G;  1HR0 L;  4A3D B;  2KUM A;  3KK7 A;  1TU2 B;  3OWE B;  1QVG A;  1SBB B;  5I2Y A;  1I3Q H;  1HZC A;  4GN3 B;  3CKI B;  4LFB Q;  1WTH A;  1D5X C;  2OT2 A;  3O13 A;  1ICW A;  4DN4 M;  2K4K A;  4RA8 A;  3HOY G;  4ME3 A;  1ROD A;  2GVA A;  4DR7 Q;  5LL6 S;  1A2T A;  1NMG A;  1WJJ A;  4FP5 D;  3HOZ G;  4KD3 A;  2NVX B;  5E3F A;  2N55 A;  5IWA L;  1QZG A;  1YHA A;  2B29 A;  3CCS A;  2KHI A;  2JA5 G;  2YTV A;  3TS2 A;  4OGQ C;  2WKD A;  1K8G A;  4P74 A;  3IFT A;  3PGZ A;  4POF A;  3DWA A;  5HUR A;  5K36 H;  3A8K E;  3OOC A;  3RUZ A;  4ULL A;  3N52 A;  3ND8 A;  2R3Z A;  3EN2 A;  2A6H D;  2BH8 A;  2A8V A;  1N32 L;  1TWC H;  3I4N H;  4YCV A;  2Y0S E;  3WOF A;  2RDG A;  4DR4 Q;  4KY7 A;  2YU9 H;  1EIY B;  4KHP Q;  1DOM A;  2DUD A;  3J7A F;  3J80 c;  1JE5 A;  1NBW A;  3J7A V;  1EY9 A;  4N8X 1;  2XN9 C;  5LMN Q;  2ID0 A;  1TII D;  3S1R H;  2KQ3 A;  2F1M A;  2PQE A;  3DXJ C;  3E9H A;  2JXM B;  1SNQ A;  2VL6 A;  1MJE A;  2XVS A;  2D9U A;  5BR8 L;  1Q7Y C;  4ZUI A;  1TWA H;  3OSO A;  2HIV A;  5CV6 A;  2JA6 B;  3KUP A;  1ASZ A;  1H9S B;  3DEP A;  1I5F A;  1YNN D;  1XTD A;  3AFP A;  1V8Q A;  3P75 A;  5FLX c;  4NDX A;  2JEB I;  5IOC A;  2ZT9 C;  3D0F A;  1VQ4 A;  5FLM H;  4XDX A;  2I5L X;  4O42 A;  1F9P A;  2N3S A;  3BYT B;  4BY7 G;  3VDY A;  5IYC H;  1WTO A;  1IW7 D;  2ALY B;  3GTO H;  1B2T A;  4JBW A;  5I4D A;  1ILP A;  1HNX Q;  4A93 B;  1K28 A;  2N78 A;  2MO1 A;  3L7Z C;  1GM5 A;  1I4Q A;  5GAE C;  2EY2 A;  2VQE L;  4DA2 A;  1EIG A;  3S1M H;  3E5S A;  2ICE C;  4HJ9 A;  3L9A X;  4LF4 L;  3SDZ A;  1TR5 A;  3OTO L;  4A3D G;  3G48 A;  1HTP A;  3S24 A;  1GUG A;  3KLR A;  2L4N A;  3HKZ E;  4A3M B;  3S2D H;  3STB D;  4L5S A;  2F0W A;  3T1Y Q;  1GO3 E;  4DV3 Q;  5KIX A;  2RSN A;  1I4P A;  1VQI A;  4K2K A;  1Q46 A;  1DM0 B;  3S2H B;  2QF7 A;  1EWH A;  3H91 A;  1KLG D;  1CA6 A;  3HOW B;  5G3L D;  3H09 A;  1HA6 A;  4FYD A;  4B3T Q;  2D0P A;  2DJG C;  4DK6 C;  3U9S A;  4DV2 L;  4HID A;  4MIU A;  2Q2H A;  2F0V A;  3AU7 A;  2B2T A;  2NZ1 D;  3W1G A;  4F88 A;  4DV7 Q;  2RDH A;  3GTP H;  2PMZ B;  3TZU A;  2E75 C;  5F2D A;  4FF1 A;  1EEI D;  3IRB A;  1XTC D;  3EA6 A;  3NBI A;  3S17 B;  4X65 Q;  5J22 A;  5JJI A;  5M3M H;  2NYZ D;  3H0G B;  4JI8 Q;  3CHB D;  3T53 B;  3X3N A;  4ILW A;  2JK8 A;  5D3I B;  2E76 C;  4LFC Q;  3OHX C;  1PRT C;  1UE6 A;  3VR6 A;  5CV9 A;  4G7H C;  1D2B A;  4TVA B;  3CQZ H;  1XNR Q;  4O2D A;  4A3I B;  2YTX A;  1X3F A;  2B8G A;  4L8J A;  1QUQ A;  4WJW A;  2J7Z A;  3T1H Q;  2A69 D;  5IT9 E;  1Y1V H;  3H3V H;  4LUV A;  3KJO A;  1R4Q B;  2E2I H;  1G29 1;  4NXN Q;  1EY0 A;  3FMC A;  5M5Y H;  1SYE A;  2F0K A;  4LF6 L;  2AWN A;  1WCM H;  1IL2 A;  1N8R C;  3GTG H;  1ONL A;  5M5X H;  3Q0A A;  1BCP C;  3W2D A;  4WRD A;  3GTJ H;  2JA6 G;  1SAP A;  1PTO F;  4O1N A;  1QJO A;  4C3H B;  4A3G H;  3H94 A;  3UE0 A;  2MP1 A;  2K52 A;  3MXP A;  5CMD A;  3CRL C;  1KIX A;  4ZKC B;  3VR3 A;  2JA8 B;  4KMU C;  1AP0 A;  4JI2 Q;  4PV1 C;  2TMP A;  4NW2 A;  2KCN A;  4JC0 A;  3FDT A;  1LT4 D;  3ONA B;  1A3U A;  1JT8 A;  1J5E L;  4IUQ A;  4OWT B;  2CVR A;  2NUC A;  2PO4 A;  3J81 E;  1B53 A;  3HOX B;  3R2I A;  1X3Q A;  5IGC A;  3HS0 C;  2IW3 A;  4C3I G;  4LNQ A;  3BDC A;  1SMY C;  3KYH C;  1VQP A;  3NEL A;  1CM9 A;  1I4G A;  3UE1 A;  2M9V A;  2ATW A;  2UUC L;  1U4R A;  4LF5 Q;  1Y69 U;  2XNA C;  4RGO S;  4WFN 3;  3BDO A;  2A68 C;  2NVY B;  3E0J A;  4KV6 A;  2WAQ E;  5E7N A;  4DR5 Q;  1BR9 A;  1HH2 P;  3PUX A;  4KD4 A;  3G4S A;  1QE6 A;  1I50 H;  3K7A B;  4A3M G;  3CCE A;  3TP8 A;  1A8V A;  4HIM A;  4O0A A;  3AQQ A;  3TS0 A;  3VYS A;  3HOY H;  1U5K A;  1EOT A;  1AZQ A;  4BS9 A;  1EY4 A;  3NTI A;  1IXR A;  4NXM L;  3QIA A;  2E2J H;  3HOZ H;  4C2M H;  1DXM A;  4FVM A;  4J1M A;  3HOW G;  5EGT A;  2E5L Q;  2F0E A;  4HIK A;  4RHS A;  3Q22 A;  4RHR A;  1TQO A;  2PZU A;  2JA5 H;  1UEA B;  3GTQ H;  5C3E B;  5AFW A;  5CV5 A;  1KLU D;  3OW2 A;  2XGT A;  4KN4 C;  4A3L G;  2L12 A;  3M4Q A;  1F9R A;  3L2P A;  1STB A;  4H44 C;  4QB4 A;  3P7J A;  4DXG A;  3FKI H;  3IAY A;  1XMQ L;  1WD1 A;  1N32 Q;  2EYF A;  4NKL A;  2Z8L A;  2Z6K C;  4J6H A;  2PQA B;  3T51 B;  1VQ6 A;  3H0G G;  1PFS A;  3RLN A;  1B1Z A;  3P20 A;  4RFB A;  1X54 A;  1B44 D;  1K0S A;  2VY3 A;  4DNT B;  3OPO A;  2HIX A;  4DV4 L;  1CZW A;  4GOP A;  3HZX A;  4CKB A;  3TP7 A;  1EYD A;  2HCI A;  4FXG C;  1SNM A;  1V1Q A;  2NZO A;  1OTC A;  4JI0 Q;  1E0B A;  3OWF A;  4A3I G;  5ELN A;  4ABN A;  4P75 A;  5IGE A;  1SFO H;  2GA4 B;  3G71 A;  4JYA L;  1GOZ A;  1D8L A;  3HOU H;  4X3K A;  2F0M A;  4YHH Q;  3C2P A;  3UDX A;  2BA0 A;  3D4D A; 
#chains in the Genus database with same CATH homology
 1CSQ A;  1FJG Q;  2R93 H;  5IYD G;  3PF5 A;  5GAD C;  1TWH H;  1WI5 A;  2F4V Q;  2IY5 B;  3S15 H;  1HR0 W;  3HFZ B;  1I6H H;  4JI5 Q;  4GKK L;  1PVO A;  2KHJ A;  3CPF A;  3F2D A;  1HNZ L;  3HKS A;  1VQL A;  3TRZ A;  4X64 L;  4GLX A;  1VQG A;  1EUJ A;  2E8G A;  5K36 G;  2B63 G;  4OX9 L;  1KAW A;  4DR3 Q;  4JI6 Q;  3RZO H;  5M3M G;  1JJC B;  4IJL A;  1S72 A;  4LUZ A;  2KBN A;  2JA8 G;  2IHE A;  1Q81 C;  4Y7N H;  3PV0 A;  4LFA L;  1N34 L;  4JI0 L;  3S1N H;  1WYD A;  4LF8 Q;  3W1B A;  1VQJ A;  2KCT A;  2OQK A;  4AQY L;  4X66 L;  1CKO A;  2D0O A;  4BY7 H;  3S1Q H;  3RLO A;  4LF7 L;  2C35 B;  4YY3 Q;  4LF9 L;  4C3I H;  3GD7 A;  1IYJ B;  1V9P A;  1CKN B;  2EIF A;  3SGI A;  3TQY A;  3KJP A;  4DV5 Q;  1PH1 A;  1MKH A;  3PO3 H;  1K9M C;  1W3S A;  3HOX G;  1PH3 A;  4IO9 A;  4YHH L;  2GVB A;  2UUA L;  1C9O A;  2ZTE A;  1G51 A;  5GAH C;  3MXN B;  5C4J H;  1K73 C;  1FJG L;  1QUQ B;  2R7Z H;  1HNW Q;  1Y1W H;  2F4V L;  1Y1V G;  4A3C G;  2UXC Q;  4JI5 L;  4BBS H;  4TQU S;  2K5H A;  3CCM A;  4NXN L;  1YNX A;  1YIJ A;  1XPO A;  5IP9 H;  2MFI A;  2UU9 Q;  4A93 G;  2CWP A;  1UE7 A;  1GD7 A;  2GN5 A;  4A3B G;  1WCM G;  4R4I A;  4JOI C;  1WOC A;  3CP0 A;  4LF4 Q;  4A3D H;  2CCZ A;  3JAM i;  4JI6 L;  4YWL A;  4DR3 L;  2Q2I A;  3J80 i;  4YWM A;  3J81 i;  3PF4 A;  4GN5 A;  2EXD A;  4IOA A;  4B3S Q;  1A63 A;  4A3G G;  2RHQ B;  1HR0 Q;  4JI4 Q;  3AYH B;  4PG3 A;  4L5R C;  5C0X G;  4DAM A;  4L5Q A;  2ES2 A;  3EBE A;  1MIU A;  1VQF A;  3F2B A;  2NN6 I;  4YY3 L;  1JJ2 A;  1YZ6 A;  2VQF Q;  5LMU Q;  4DV5 L;  2I0Q A;  1VQD A;  4IPG A;  4DK3 C;  3M7N A;  1KQS A;  2HT1 A;  1A62 A;  1EYG A;  1KRS A;  1L1O C;  4R4Q A;  1VQC A;  1XMO Q;  4DUY Q;  4A3F H;  2NVX H;  5C4X G;  1DGS A;  1HNW L;  1D7Q A;  1V43 A;  4GNX B;  4R1J A;  3DLL A;  2AWO A;  4GNX C;  3GTM H;  3K8A A;  1BKB A;  5C0X J;  2UXC L;  2KEN A;  1O7I A;  2QGQ A;  3PUZ A;  2Q2T A;  2UU9 L;  5IWA Q;  4JI7 L;  4RG1 A;  1K83 H;  2WP8 J;  2Q2U A;  1PHJ A;  4FDB A;  4MNO A;  2HHH L;  1OXX K;  1PYB A;  5C3E G;  4A3K G;  1PH5 A;  2JA7 G;  3PCO B;  3PO2 H;  2OTJ A;  1VCI A;  4NB3 A;  1Q1B A;  2UXB L;  4WJ4 A;  2EQS A;  3CCJ A;  3CAM A;  1KL9 A;  1E1O A;  4R4O A;  5M3F H;  3CXC A;  1HZB A;  1UE5 A;  2BA1 A;  1Q8K A;  3HKZ G;  3K7U C;  2Z6K A;  2R92 G;  1HR0 L;  2PI2 A;  4OO1 G;  1VQH A;  1TWG H;  3AFQ A;  1C0A A;  1HZ9 A;  3W5O A;  5IP7 G;  4UP7 A;  1EIF A;  3M3Y H;  3FHW A;  1QVG A;  2A19 A;  4AYB G;  3F1Z A;  5LMU L;  1NY4 A;  3CC4 A;  4R4C A;  1I3Q H;  1HZC A;  2PMZ E;  4GN3 B;  2K5N A;  4ALP A;  4LFB Q;  3MEF A;  3S14 H;  4A4I A;  1XMO L;  2PI2 E;  1AH9 A;  2K4K A;  3E0E A;  2R7F A;  4ME3 A;  3HOY G;  1EFW A;  2GVA A;  1PA6 A;  3NEN A;  4A3J G;  4DR7 Q;  3CC7 A;  1H95 A;  1NMG A;  5LMN W;  3FP9 A;  1NJI C;  1WJJ A;  1FGU A;  4DPG A;  1U0L A;  2R7D A;  3HOZ G;  1E1T A;  5IWA L;  2AHO B;  4BXX G;  3K81 C;  1QZG A;  2NVT H;  1YHA A;  3STB C;  2B29 A;  3CCS A;  5GQO A;  5IT9 c;  1X9N A;  3CD6 A;  4DNI A;  2L15 A;  2KHI A;  4LWC A;  4JV5 L;  2JA5 G;  2YTV A;  4X6A H;  1PH8 A;  5C44 H;  3TS2 A;  3F8T A;  1X56 A;  1SR3 A;  4NPS A;  2E2H H;  1N9W A;  1K8G A;  4P74 A;  3PGZ A;  3I4O A;  1NE3 A;  4POF A;  4POG A;  1Z47 A;  1CUK A;  4BBR G;  3CCQ A;  3ULJ A;  3BU2 A;  2JA6 H;  2H5X A;  4LFB L;  1IBL L;  2JEA I;  5IE8 A;  1YJW A;  2VUM H;  3EN2 A;  5BR8 Q;  1BBW A;  1N36 Q;  2BH8 A;  3KDF B;  2A8V A;  3PUY A;  1TWC H;  2OWO A;  3I4N H;  4QJF A;  4YCV A;  5M5W H;  2Y0S G;  3CC2 A;  4QQB X;  3M4P A;  4H02 A;  2Y0S E;  1VQM A;  1PH6 A;  4WJ3 M;  4DR4 Q;  4LUO A;  5GRO A;  2YU9 H;  1EIY B;  1L0W A;  4KHP Q;  3JAM c;  2DUD A;  1B70 B;  1JMC A;  3J80 c;  1JE5 A;  1NBW A;  3UDI A;  3J81 c;  1J5E Q;  4GOP B;  1AE3 A;  3GDE A;  1IBK Q;  1BBU A;  2K50 A;  3J7Z C;  1M1K C;  1YBY A;  4JCV E;  2HQL A;  1I94 Q;  2UUB Q;  4A3C H;  3DM3 A;  2F52 A;  2JE6 I;  5LMN Q;  1VS0 A;  3HOV H;  2ID0 A;  4J15 A;  1GVP A;  3M85 A;  3JC6 6;  4A93 H;  4DR1 Q;  3S1R H;  1JB7 A;  1IZ6 A;  1YHQ A;  3WWV A;  4JOI A;  5JJK A;  1OXU A;  1X3E A;  4GKJ Q;  4PMW A;  3E9H A;  2VUM G;  2I5M X;  4OWW B;  2VL6 A;  3OYY A;  1MJE A;  1CKM A;  4IFD G;  5BR8 L;  2VQE Q;  1RIP A;  1Q7Y C;  4B3R Q;  1TWA H;  3K0X A;  3AEV A;  2HIV A;  4BA1 I;  1ASZ A;  2OQ0 A;  2VW9 A;  4DV1 Q;  3M4O H;  1I5F A;  4DR4 L;  1X3G A;  1XTD A;  3AFP A;  4IPD A;  5FLX c;  4HJA A;  4BY1 H;  4A3M H;  3OTO Q;  4MZ9 A;  4KHP L;  1UE1 A;  3A0J A;  1L1O A;  4DAY B;  4K0K Q;  2I5H A;  1IBM Q;  2JEB I;  1LYL A;  1SE8 A;  5H1S E;  3D0F A;  1VQ4 A;  4X62 Q;  1IBK L;  3ZJY C;  4GNX A;  5FLM H;  1AE2 A;  4LF8 L;  2DGY A;  1I94 L;  2UUB L;  2I5L X;  2K75 A;  2N3S A;  3S2H H;  1S3O A;  3KF6 A;  5IYB H;  2IX0 A;  4QGU A;  3H15 A;  2VZA A;  5LMN L;  1XNQ Q;  3H3V I;  2LSS A;  4BY7 G;  3VDY A;  3HOW H;  5IYC H;  1YJ9 A;  2ALY B;  3GTO H;  4PZ8 A;  3TRE A;  4A3K H;  3Q8D A;  2JA7 H;  4JBW A;  5AJ3 Q;  4UPA A;  4HJ8 A;  3U4V A;  5JEA G;  3PO3 G;  4GKJ L;  1W2B A;  2A1A A;  1HNX Q;  1VQN A;  3KFU A;  2UXD Q;  4JI3 Q;  2N78 A;  3NEM A;  2MO1 A;  1L2F A;  4DKA C;  3CCR A;  2R7Z G;  5GAG C;  3L7Z C;  1GM5 A;  5GAE C;  1OXS C;  4GLA C;  1Y1W G;  2VQE L;  2R92 H;  4P72 A;  3BZC A;  4B3R L;  4A3L H;  1UEB A;  5IP9 G;  1Q82 C;  5C0X I;  3S1M H;  3RN2 A;  4HJ9 A;  2NVQ H;  4UY8 C;  4DV2 Q;  1SN8 A;  4LF4 L;  3OTO L;  1TXY A;  4A3D G;  2XTI A;  3G48 A;  3S16 H;  4K0K L;  2CQO A;  3S24 A;  3S17 H;  1K0R A;  1RL2 A;  4B3S L;  4A75 A;  4JI4 L;  1X55 A;  1SRU A;  3J7A 5;  2PQA A;  3HKZ E;  3KLW A;  1SMX A;  4LW1 A;  4A3J H;  3S2D H;  2NZH A;  3H0G H;  4APV A;  3LGJ A;  3STB D;  4L5S A;  1XNQ L;  5ELO A;  3T1Y Q;  1GO3 E;  3D31 A;  2VQF L;  4KHZ A;  4BXX H;  3J81 j;  4DV3 Q;  1VQI A;  4XIG S;  4AYB E;  1M90 C;  1Q46 A;  2FXQ A;  2PNH A;  5AJ3 L;  1Q86 C;  1KC8 C;  5FJ8 H;  3I2Z A;  4DR2 Q;  4DUY L;  1HNX L;  2K14 A;  4A3F G;  3CCL A;  4JI3 L;  3B6Y A;  2UXD L;  4A3I H;  2ZTD A;  3E9I A;  4A3E G;  3PSI A;  5HGQ A;  1QZH A;  1LTL A;  3I56 A;  3RZD H;  4B3T Q;  4OO1 I;  2D0P A;  4DK6 C;  3RNU A;  2AMC B;  2JJQ A;  4JI1 Q;  4DV2 L;  2IT1 A;  4PZ7 A;  5DLQ E;  3U50 C;  4HID A;  4HJ7 A;  1VQ8 A;  2Q2H A;  3I4M H;  4DV0 Q;  2WB1 G;  3W1G A;  4DV7 Q;  5IYD H;  5JJL A;  2WB1 E;  3GTP H;  1G6P A;  1VQB A;  1FVI A;  4R4T A;  3U4Z A;  4GKK Q;  3PIO A;  1SRO A;  4LF6 Q;  3IRB A;  2ZJQ A;  4C3H H;  4X64 Q;  4X65 Q;  2B63 H;  3BZK A;  1P8L A;  1N33 Q;  1YVC A;  1PV4 A;  5JJI A;  5M3M H;  1X6O A;  2JA8 H;  1SLJ A;  3FKI G;  3CW2 C;  4JI8 Q;  4JBK A;  2MQH A;  4DR7 L;  1E3P A;  1FL0 A;  4HJ5 A;  1J6Q A;  2JK8 A;  1PYS B;  1YJN A;  1X65 A;  2LXK A;  3CME A;  3A5Z B;  4LFC Q;  1UE6 A;  3K80 C;  3RLF A;  1CKN A;  2ZJR A;  4BA2 I;  4XTC S;  1VQ9 A;  4TVA B;  4B3T L;  3CQZ H;  1XNR Q;  4O2D A;  2YTX A;  1X3F A;  3HOX H;  1PH9 A;  1QUQ A;  2UUA Q;  4GN4 B;  2ZTC A;  4IJH A;  4GOP C;  3T1H Q;  4DV7 L;  1EOV A;  1Y1V H;  2CKZ B;  3H3V H;  4RMF A;  3KOJ A;  4LUV A;  5C44 G;  3KJO A;  2E2I H;  1LUZ A;  3GTK H;  1G29 1;  4NXN Q;  3KF8 B;  3PUW A;  2AKW B;  5M5Y H;  3CF5 A;  4LF6 L;  3U58 A;  2AWN A;  1PH4 A;  3HOU G;  1WCM H;  1R9T H;  4A3B H;  2ZM6 Q;  3ER0 A;  4JG2 A;  4MTN A;  1E22 A;  4X65 L;  1IL2 A;  2NVY H;  1N8R C;  3GTG H;  1K3R A;  2YTY A;  5M5X H;  4Y52 H;  4UP8 A;  1XJV A;  3GTJ H;  2UUC Q;  1N33 L;  1Q12 A;  2KCM A;  2R93 G;  2JA6 G;  4A76 A;  4B3M Q;  1VQ7 A;  1KHI A;  1N36 L;  4JI8 L;  4A3G H;  4UP9 A;  3UE0 A;  3K7A H;  1YIT A;  3I4N G;  1YEZ A;  3PIP A;  2K52 A;  4IPH A;  3F2C A;  1KIX A;  1NMF A;  4LFC L;  2IX1 A;  4JI2 Q;  1HJP A;  2D62 A;  1VQO A;  2OTL A;  1OXV A;  3A74 A;  1XNR L;  4JC0 A;  1N32 L;  1JT8 A;  1EQR A;  1WFQ A;  1J5E L;  4IPC A;  4OWT B;  5J3B A;  5C4X H;  4EX5 A;  2VNU D;  1B8A A;  4IFD J;  4L5T A;  4QIW E;  4OON A;  3T1H L;  1Y14 B;  1NTG A;  3GTL H;  4NXM Q;  2NN6 G;  4IFD I;  1CSP A;  3HOV G;  3EIV A;  4EQ5 A;  4P71 A;  4DR1 L;  1OXT A;  3I55 A;  4LNQ A;  4JI7 Q;  2N49 A;  5C3E H;  2WFW A;  3KYH C;  1VQP A;  2ZM6 L;  2HHH Q;  1XPU A;  4DR6 Q;  3NEL A;  3RR5 A;  4JBM A;  3UE1 A;  2Z0S A;  2ZJP A;  3TEH B;  2UXB Q;  2ATW A;  2UUC L;  4LF5 Q;  4AH6 A;  4B3M L;  2QA4 A;  1E7Z A;  4YCW A;  1EWI A;  1PH2 A;  2WAQ G;  1B7Y B;  1E24 A;  5EAY A;  4BBS G;  2WAQ E;  1VQE A;  5E7N A;  4DR5 Q;  3A5U A;  2CWA A;  1HH2 P;  2QEX A;  5IP7 H;  3CMA A;  2ASB A;  3PUX A;  4DV1 L;  4HIO A;  4JI2 L;  1BVS A;  3G4S A;  5IY0 A;  4BY1 G;  1I50 H;  4A3M G;  5JEA J;  3CCE A;  1HZA A;  2MO0 A;  1A8V A;  1IBM L;  4HIM A;  1L1O B;  4O0A A;  4DV6 Q;  3AQQ A;  3TS0 A;  1XMQ Q;  1XPR A;  4X62 L;  1U5K A;  3HOY H;  1C7Y A;  5FLM G;  4DUZ Q;  1VQK A;  4KLK A;  2BH2 A;  1IXR A;  4A3E H;  4NXM L;  2E2J H;  3HOZ H;  4C2M H;  5IYB G;  3KF6 B;  1K8A C;  2F3I A;  5IYC G;  3HOW G;  1T9H A;  2E5L Q;  3RN5 A;  2MNA A;  4C3J H;  4DV4 Q;  4DR6 L;  4HIK A;  2JQO A;  4KI0 A;  2JA5 H;  4LF5 L;  3CCV A;  1PH7 A;  4JV5 Q;  3UDF A;  2V1C C;  3GTQ H;  1VQ5 A;  1Z9F A;  1Q1E A;  1TWF H;  2LXJ A;  3ULL A;  1VQA A;  2XGT A;  4DR5 L;  3OW2 A;  1YI2 A;  4A3L G;  4JYA Q;  1JJG A;  3I7F A;  3UDG A;  3M4Q A;  1KD1 C;  3L2P A;  3ERS X;  3PO2 G;  2YV5 A;  4BBR H;  3CCU A;  4QL5 A;  2N8N A;  4JBJ A;  4QY7 A;  3M9B A;  4PZ6 A;  2RCN A;  5M3F G;  1A0I A;  4P73 A;  1EQQ A;  4DV6 L;  3FKI H;  3KDF A;  1IBL Q;  1XMQ L;  1N32 Q;  1UWV A;  4DUZ L;  2Z6K C;  1MJC A;  2PQA B;  3GO5 A;  3H0G G;  1HNZ Q;  1QVF A;  1VQ6 A;  1GKH A;  3T1Y L;  1PFS A;  2IHF A;  3RLN A;  3G6E A;  2CFM A;  4OWX B;  1X54 A;  4DV3 L;  4YWK A;  4OX9 Q;  3L0O A;  2R6G A;  4YCU A;  3ICE A;  2VY3 A;  2YYZ A;  2JA9 A;  1P16 A;  2RF4 A;  1S40 A;  2E5L L;  3CPW A;  1ASY A;  2HIX A;  4DV4 L;  4DR2 L;  1YHB A;  2VS1 A;  3BJU A;  4GOP A;  5FJ8 G;  3PUV A;  4LFA Q;  2NZO A;  1V1Q A;  3ULP A;  1N34 Q;  1OTC A;  4JI0 Q;  2OCE A;  4IOC A;  4A3I G;  4GS3 A;  4X66 Q;  5ELN A;  4AQY Q;  4P75 A;  2RHS B;  1SFO H;  1KRT A;  2B3G A;  4LF7 Q;  3NBH B;  3G71 A;  4JYA L;  4LF9 Q;  1KXL A;  4AIM A;  5HY6 A;  1D8L A;  3HOU H;  4JI1 L;  4OXP A;  1LM0 A;  1QVC A;  4GLV B;  4YHH Q;  4DV0 L;  3UDX A;  3I4M G;  2BA0 A;  2K5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...