4DR1L

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1L00
2UUBL 4BA1I 3CMAA 3GTQH 5JJLA 4OX9Q 2LXJA 1VQEA 2PI2E 5GAGC 1L1OA 1S3OA 1XTDA 3K0XA 5ELOA 1GKHA 1B7YB 4JI3Q 2VY3A 3KDFA 5AJ3L 4DUYQ 2UUBQ 4L5SA 1NMGA 5C44G 3F2DA 2B3GA 4DK3C 4PZ8A 4C3HH 3CCJA 5LMNL 1MJCA 1YNXA 4JBWA 4DV6L 1X3GA 1YHAA 5EAYA 4LFCL 4YHHL 1L1OB 5AJ3Q 5IYDG 2CWPA 4JOIC 3HOZH 1BKBA 3KDFB 4YCUA 2WAQE 2NZOA 4DV6Q 1X9NA 1D8LA 3CMEA 1X3EA 1VQ6A 1GVPA 1A62A 1SN8A 4DR5L 3L2PA 4DR1L 4A3FG 1TWAH 4P72A 3PO2G 3CC4A 3CCQA 2JA7H 3Q8DA 1C0AA 1VQOA 2Z0SA 4JBJA 2K52A 4K0KL 3RN5A 2JA6H 4DPGA 1IL2A 1JMCA 3J7ZC 4A3JH 2IX0A 1WFQA 2JK8A 3PUYA 2R93H 1A63A 4JOIA 4DV3L 1PH2A 2BH8A 3RNUA 1J5EL 2E2JH 3GD7A 2JA9A 3CCVA 1HR0Q 1Q81C 1JT8A 1IYJB 3RN2A 4A3KH 1SMXA 1J5EQ 2UUAQ 2UXDQ 1XMQQ 1P16A 2R7FA 4X66L 3PUWA 4XTCS 4LF9L 1J6QA 1Q46A 2VQEQ 4A3MH 2BA0A 1R9TH 1PH1A 4JI6L 3AYHB 1S72A 3GTGH 4R1JA 1PYSB 3M4OH 4X66Q 3B6YA 2WB1E 3TRZA 4LF9Q 4LFBL 1EOVA 2IT1A 3KFUA 5IYBG 1QVFA 1H95A 1PH5A 4JV5L 4LFBQ 4LF6L 3AEVA 2ZM6L 1O7IA 5J3BA 1V43A 3AFPA 2RF4A 1SR3A 5IE8A 4DNIA 4KHPL 4JI5Q 1QZGA 1VQ8A 4UP8A 1NJIC 1L2FA 2C35B 4GOPC 3UDGA 1SFOH 1LUZA 4LNQA 2E2IH 1E7ZA 1AH9A 1KL9A 1EQQA 2VUMH 1FVIA 3CPFA 4A93G 2AWNA 2UXCL 4NXMQ 5C3EG 1HNZL 1N8RC 1A0IA 1KIXA 2NZHA 3GTPH 4HJ7A 3KJOA 4POGA 3F8TA 2ATWA 2R7DA 2UXCQ 4R4TA 4JI2L 1XNQL 4GS3A 3EBEA 4DR6Q 1K8AC 2NVYH 1C9OA 1V9PA 5IYCG 3HOWH 5IP9G 3D31A 4EQ5A 1N34L 4B3SQ 1VQIA 4DV4L 3ICEA 3TQYA 3M85A 4GKKL 1K83H 1LYLA 3W1BA 2ZJRA 3S1MH 1VQPA 4B3MQ 1N34Q 5H1SE 4DV4Q 4A3GH 1T9HA 1U0LA 2QGQA 1N32L 1UE5A 1RIPA 3JC66 4JI1Q 4GKKQ 4HJ9A 1CKNA 1HNWQ 4A3BH 3KLWA 1UEBA 2WP8J 2EIFA 3PIPA 3I4MH 4BXXG 2RHQB 2CQOA 2KBNA 1N32Q 5LMUQ 3KOJA 3GTMH 1KHIA 2K5VA 4GN3B 3GTKH 5BR8Q 1X3FA 4AIMA 2HHHL 3HOUH 1CKNB 1Q1EA 1U5KA 4BY1G 1IBLQ 2B29A 4HJ8A 1XNRL 4BA2I 4OWWB 4A3EG 2YV5A 5M5YH 2HHHQ 5JEAJ 3T1YQ 1VQFA 5DLQE 4A3CG 4FDBA 2EQSA 2CCZA 1IZ6A 4LUOA 1PA6A 1Y1VH 3I2ZA 3HOVH 4DR2Q 4APVA 2A1AA 4X65L 3I4NG 2HT1A 1D7QA 4BY7H 1HZBA 4JI7L 4DV2Q 4BBRH 3K8AA 4DV7L 1UE1A 3WWVA 4PMWA 4X65Q 5FLMG 1L0WA 1HR0W 1VQLA 3H3VH 4WJ4A 1JJCB 1N36Q 3I56A 4DV7Q 2JE6I 1PH4A 3MXNB 3TS0A 2Y0SG 2R7ZH 1Q8KA 4IOCA 3RZDH 2IHFA 2K14A 1VQAA 4QJFA 3UDIA 3PIOA 4DR7Q 4A3LH 2BA1A 2K4KA 4QIWE 4JI3L 4OONA 1Y1WH 1XMOQ 4DUYL 2HQLA 2I0QA 4DAYB 4Y7NH 3S24A 1CSQA 1YITA 4UY8C 4R4QA 1Q7YC 2K50A 2I5LX 3HKZG 5C4XH 2B63G 4JYAQ 3ER0A 1I50H 1TWHH 1NE3A 5JEAG 4XIGS 1G291 1VQJA 1FJGQ 3U4VA 3S14H 3H3VI 1XPUA 2JA7G 4R4CA 4OWXB 1CKMA 4P71A 2HIXA 2I5MX 4IPHA 5GADC 1QVGA 3NEMA 2JA6G 3TS2A 1KXLA 1RL2A 4A3JG 2E5LL 3L7ZC 3FKIG 2JEAI 1PH7A 2VL6A 4WJ3M 2I5HA 3CXCA 3U4ZA 2NN6G 5IP7H 2E5LQ 4GN4B 4LF7Q 5C4JH 1Q12A 2CKZB 2ZTEA 4A3KG 1W3SA 5M3MH 2JA5G 1MJEA 1IBML 4LWCA 3BU2A 3HOYH 1WCMH 2N78A 1HR0L 2OTLA 4BBSH 5M3FH 1KD1C 4NXNQ 4IOAA 4P73A 2RHSB 1ASZA 1IBMQ 1G51A 1BBUA 2UUAL 2UXDL 1X54A 1BBWA 1SLJA 1XMQL 5K36G 1YJWA 3W5OA 1CUKA 2VQEL 1OXXK 2R92H 3UDXA 1HZAA 1CKOA 2KCTA 4DKAC 3PUXA 4GN5A 5C44H 3J7A5 4IJHA 1YJNA 3A5ZB 2A8VA 1Q1BA 1K3RA 4X6AH 3DM3A 3GDEA 4LUVA 4JI4Q 3PCOB 2UXBQ 4LW1A 1YHQA 4KI0A 2AWOA 1BVSA 3PF4A 3M4PA 2K75A 3CCEA 2VQFQ 2VUMG 1EIFA 4JI5L 4OXPA 3LGJA 4ME3A 1IXRA 2A19A 3RLNA 3UE0A 3OTOQ 4A3FH 4B3RL 4X64Q 1GO3E 2ZTCA 2VW9A 3MEFA 2YTVA 1WYDA 1SRUA 1YEZA 1OXTA 3ZJYC 1M1KC 4JI0L 1LTLA 2MQHA 1B70B 4B3RQ 4R4IA 1B8AA 4NXML 4UP7A 4GKJQ 3GTJH 3HOWG 2MFIA 2AKWB 4A3IH 4JI0Q 3M4QA 4OWTB 2JA8H 4LF8Q 4JCVE 3ULPA 3EIVA 1CSPA 4J15A 3KF6A 2VZAA 4DR6L 5M5WH 5GAEC 1NY4A 3EN2A 1E1OA 1NMFA 1P8LA 1VQBA 2L15A 1VQ7A 2LSSA 4B3SL 4A3GG 4IFDI 3GTLH 1SE8A 5FJ8G 1EFWA 3KYHC 4LFAQ 4A3BG 2PI2A 2XTIA 4DV0Q 4B3ML 3KF6B 2UU9L 2WB1G 3BJUA 3L0OA 2F4VQ 4JI1L 1HNWL 2ASBA 1C7YA 3HOUG 5IYBH 2UU9Q 3J81c 1VQ5A 5LMUL 3J80i 4A3DG 5BR8L 2QEXA 2H5XA 3BZKA 1HJPA 4GLXA 1IBLL 3CQZH 3D0FA 3K80C 2ALYB 5ELNA 4B3TQ 3HOVG 2MNAA 3I7FA 1HNXQ 1E22A 4AYBG 3DLLA 4HIDA 3T1YL 2Q2IA 3HFZB 1PVOA 1I94Q 1E3PA 5GAHC 1XPRA 3HOXG 1GM5A 4BY7G 1LM0A 1X65A 4LF5Q 1QUQB 4IPDA 1X55A 2F3IA 3T1HL 1MKHA 4IPCA 4DR2L 3S1QH 3J80c 5C3EH 2KENA 4JI8Q 1AE2A 3BZCA 4TVAB 1EIYB 4DV1Q 1N33Q 3I4OA 4A4IA 1JB7A 4QQBX 2Q2HA 1EYGA 2NVQH 1FL0A 4DV2L 3T1HQ 1QZHA 3PO3H 4OO1I 5IWAQ 3CAMA 4A3LG 3KF8B 4UPAA 1Q86C 1TXYA 3CCLA 2OQ0A 3H0GG 1TWFH 5IP9H 2R6GA 3PUZA 1Y1WG 1N36L 1SROA 3U58A 2PQAA 3AQQA 1HZCA 1XPOA 3CC7A 1KRSA 5C4XG 4GLAC 2ZTDA 4DR7L 3E0EA 2K5NA 2NVXH 1PH3A 5C0XI 1XMOL 1WJJA 1EQRA 3S1NH 3E9HA 5JJKA 4BXXH 1XJVA 2PQAB 3I55A 2JQOA 1VQNA 4KHZA 4JYAL 3HOZG 1YI2A 1YBYA 3M9BA 2QA4A 1FJGL 3ULLA 1E24A 4R4OA 3IRBA 1Q82C 2CWAA 2OQKA 1JE5A 1HH2P 4GLVB 5E7NA 4A3EH 4IFDJ 5GQOA 1OXVA 2EXDA 1VQ9A 4YY3L 2JEBI 3K7AH 5M3MG 4X62Q 2AMCB 4LUZA 1A8VA 1K9MC 3M7NA 4LF7L 3HOYG 2Q2TA 4IO9A 2DGYA 1YIJA 2R93G 4YY3Q 4BBSG 1V1QA 1I5FA 1TWCH 1OTCA 4DR3Q 4TQUS 3U50C 3I4NH 2D0OA 1UE6A 4DUZQ 3J81j 4RG1A 1KQSA 2BH2A 2UUCQ 4YWLA 2GN5A 4C2MH 1WI5A 3CF5A 2WFWA 4IPGA 1PH9A 5FLMH 2ES2A 4NXNL 2R92G 1VQHA 3K81C 4EX5A 3JAMc 1DGSA 2V1CC 4A3MG 3GTOH 5FLXc 2N3SA 1Y14B 4L5RC 2OTJA 1VQCA 3CCMA 5GROA 2E2HH 4MNOA 5LMNQ 4MZ9A 2PNHA 3A0JA 2LXKA 2MO0A 4YHHQ 4YCVA 1UE7A 1NTGA 3F2BA 4ALPA 4DK6C 4LFCQ 1Z9FA 2B63H 4IFDG 4JI4L 4NPSA 2KHJA 2UXBL 3S15H 4HJ5A 1G6PA 1YVCA 2VQFL 1PV4A 4GNXC 4DR5Q 3F2CA 1KAWA 1PFSA 2WAQG 4NB3A 3NBHB 4DR1Q 5IYDH 3STBC 3OTOL 2K5HA 4X64L 1JJGA 3OYYA 3FKIH 1TWGH 3S2DH 4A3IG 2JA8G 4K0KQ 3HKSA 3OW2A 2PMZE 2D0PA 1GD7A 5C0XJ 1VQDA 2D62A 3PO2H 4GKJL 3CCRA 4A75A 2AHOB 4POFA 4DV3Q 3UE1A 4H02A 2JA5H 3F1ZA 3UDFA 1JJ2A 4LF8L 5JJIA 4L5TA 3CCUA 3KJPA 4A76A 4GNXA 1Z47A 4DAMA 3S1RH 3G4SA 2IX1A 3G48A 1E1TA 1OXSC 3J81i 1WOCA 4YWKA 2YYZA 3RLFA 4QGUA 1IBKL 4LFAL 4JI6Q 3CCSA 4DV0L 4DR4L 2XGTA 3TEHB 1NBWA 4GNXB 2ZJPA 2NN6I 2E8GA 3STBD 4PG3A 1S40A 1VQMA 2F4VL 1IBKQ 3TREA 2OCEA 1VS0A 3I4MG 4DR4Q 4OO1G 4JBKA 1KC8C 2RCNA 5HY6A 4RMFA 1ASYA 3RZOH 2YTXA 4JV5Q 3PSIA 4LF6Q 2ZM6Q 3PF5A 3FHWA 1EUJA 2KHIA 3SGIA 1PYBA 4AYBE 3NENA 4KHPQ 1QVCA 1N9WA 2JJQA 3ERSX 4DV5L 4HJAA 4O2DA 5C0XG 4B3TL 3G6EA 3W1GA 1HNXL 2HIVA 1QUQA 2FXQA 4HIOA 1I94L 3CP0A 4QL5A 4L5QA 1X56A 2DUDA 3K7UC 4DV5Q 3FP9A 1Y1VG 3CW2C 4LF5L 3PO3G 4JG2A 1HNZQ 5HGQA 3AFQA 4JI8L 3ULJA 1W2BA 4LF4L 1HZ9A 4JBMA 4DV1L 1N33L 4BBRG 3A74A 4GOPA 1YJ9A 4QY7A 4JI2Q 1XNQQ 3VDYA 4A93H 5IWAL 2ZJQA 1VCIA 4MTNA 4LF4Q 2CFMA 4IJLA 1OXUA 3RLOA 2MO1A 2R7ZG 3S17H 4Y52H 4GOPB 5FJ8H 2YU9H 2GVBA 5IT9c 2Y0SE 4C3IH 2N49A 3E9IA 1I6HH 1FGUA 5IYCH 2IHEA 4HIKA 1VQKA 3GO5A 1UWVA 3CC2A 5IY0A 5LMNW 4PZ6A 4HIMA 2Z6KC 1M90C 4AH6A 2KCMA 4P74A 3HKZE 4YCWA 2OWOA 3PGZA 4A3DH 2NVTH 1X6OA 1K8GA 1EWIA 3A5UA 1YZ6A 1XNRQ 2YTYA 1MIUA 4O0AA 1KRTA 3H15A 2F52A 1PH6A 1VQGA 4JC0A 1YHBA 1VQ4A 4PZ7A 3G71A 4BY1H 1K0RA 3RR5A 1K73C 3PUVA 3HOXH 1L1OC 2GVAA 4KLKA 3PV0A 5IP7G 2ID0A 4X62L 4C3JH 5M5XH 4AQYL 2Z6KA 3S16H 2VS1A 1PHJA 1PH8A 4YWMA 3S2HH 3JAMi 1I3QH 4DR3L 4JI7Q 3NELA 4A3CH 1AE3A 2VNUD 3CPWA 2Q2UA 2IY5B 4DUZL 4AQYQ 1WCMG 3CD6A 3M3YH 2UUCL 4P75A 4UP9A 5M3FG 4OX9L 2N8NA 3H0GH
chains in the Genus database with same CATH superfamily
1O80A 2UUBL 4BA1I 4CDDC 3VR3A 1EY4A 2PI2E 1VQEA 3D4WA 3U9OA 1C8CA 1L1OA 3VA7A 5ELOA 2B2TC 5AJ3L 4DUYQ 4L5SA 5C44G 1SE4A 4I7ZC 4O1NA 3T56B 3CCJA 2L1BA 5EAYA 2R7ZB 2B2WC 4I7AA 5IYDG 2CWPA 5E4XA 3LX0A 3KDFB 2WAQE 3MFYA 2K7VA 3Q23A 3O13A 4DR5L 3KLRA 3L2PA 2SNMA 1CHPD 4V0BA 2DJGC 4ZUJA 1RF2D 1DONA 1SNPA 1C0AA 4A3EB 4JBJA 5C4ZA 1KDAA 4HMJA 4IZ8A 3J7ZC 4IUPA 4X3TA 1WTVA 2KQ3A 4JOIA 1EY8A 2EY6A 3CCVA 4EQNA 1EZ6A 2UUAQ 1ESRA 2UXDQ 2R7FA 4X66L 2NUCA 4L8JA 4OELB 2EYMA 1PLFA 1S72A 4R1JA 1PYSB 3M4OH 3TRZA 3AU7A 2WB1E 3B6YA 5ELFA 4LF9Q 1HFNA 2IT1A 2EYFA 5IYBG 5HGTA 3E0JA 5IGEA 1PH5A 4IFDH 4JV5L 2B63B 5J3BA 5EPLA 1GOZA 1L2FA 4GOPC 3UDGA 4KJNA 3N52A 1E7ZA 3OW7A 1STHA 1SYDA 3CPFA 4FF1A 4A93G 3S2DB 2Z4HA 1DZ1A 1A0IA 2OEOA 3ND9A 2CH4A 3GTPH 1V8QA 1PFBA 1TKWB 4K6LA 4R4TA 1XNQL 2UXCQ 2F0IA 5IYCG 3D31A 1N34L 1Q90A 1LYLA 2ZJRA 4B3MQ 4A3GH 1U0LA 2RBMA 1HNWQ 1CKNA 1WTHA 2KOLA 1N32Q 1QNUA 2KBNA 4KD4A 4CKBA 4ULLA 1SNDA 3HOUH 2HHHL 3RZOB 4PNYA 1U5KA 2F0OA 1F77A 2B29A 2JXMB 3TBIB 2B2UC 5JEAJ 3T1YQ 2B8GA 4QB4A 4A3CG 4NMZA 1XX8A 2Q8RE 2EQSA 1LACA 3I2ZA 4DXGA 5EKLA 1H9MA 3MXNA 3TZDA 4JI7L 3K8AA 2GA4B 4L6TB 4V190 4WJ4A 1U4MA 3H3VH 2I07B 5CV7A 1N36Q 2Y0SG 4IOCA 4QJFA 3SE0A 3S17B 4H7BA 3C1FA 1Y1WH 1XMOQ 4M1UB 4C3IB 4DUYL 2I0QA 4Y7NH 1I6HB 5ELEA 1Q7YC 1EQTA 1SNQA 2K50A 3NPPA 5C4XH 1IHZA 3ER0A 3C1EA 2K5WA 5JEAG 1LTRD 3QJYA 1G291 4RWSC 2XRSD 5KYLA 1XPUA 4OWXB 4LMQD 5GADC 4P71A 4LK1C 4IPHA 1G91A 2QILA 3TS2A 5NUCA 4A3JG 3W2DA 3FKIG 2JEAI 2Q8IB 2LS01 2VL6A 1WTRA 1JWUD 1RTNA 3CXCA 3VYTA 4RH6A 1C48A 2RKSA 1STNA 1PFNA 5T1IA 1IYUA 2ZTEA 5M5XB 4FYDA 5T1GA 2JA5G 1D6EC 4LWCA 4Z9CB 3S2HB 5FK9C 1WCMH 2N78A 1I3QB 3K5OA 3FVQA 4P73A 1ASZA 1IBMQ 3M3YB 1GUGA 1BBUA 3JAML 2UUAL 2UXDL 1S5BD 1YJWA 1CUKA 5EQ0A 4K5VA 1HZAA 1CKOA 1MD2D 1FNVA 5C44H 3J7A5 1D2BA 2RCFA 3A5ZB 3W3AA 4BWGB 2V4DA 1YHQA 4KY7A 2K75A 3CCEA 1GUWA 4ME3A 3RLNA 3UE0A 3A54A 4XDXA 1IKMA 2CW0D 4RHSA 5AFWA 2XSCA 2F0TA 2MQHA 4UAIA 4B3RQ 1Z7TA 2MHVA 4R4IA 2MFIA 4A3IH 4JCVE 5DNFA 4J15A 4KJOA 3KF6A 2FMMA 4UHVA 1E1OA 1NMFA 3VYRA 4RCNA 4KV6A 1EOTA 1SE8A 1I4GA 1EFWA 2R61A 1JQYD 4B3ML 4QMGA 2C9OA 5JPNC 2F0JA 1E2ZA 3L0OA 4R8IA 2F4VQ 3FPUB 1HNWL 5IYBH 3M4OB 3CRLC 2ZXPA 1VQ5A 1STAA 4A3DG 2RVLA 4B3TQ 2EY1A 3HOVG 2MNAA 4HIDA 3T1YL 3HFZB 4FP5D 1EWHA 1E3PA 1XPRA 4BY7G 1RJTA 3ITPA 4FF4A 2BDOA 1AE2A 3BZCA 1N33Q 1STBA 3TP8A 4A4IA 1JB7A 2PO4A 1FL0A 2VB3X 3T1HQ 1BBXC 2F0KA 1UAPA 2F0LA 1A2UA 3CCLA 1TWFH 3MC0B 3PUZA 1N36L 4KD3A 5D14A 4F7XA 1KRSA 1TU2B 2K5NA 2F0EA 4IUTA 1XMOL 3D6CA 3S1NH 4A3GB 1XJVA 1STGA 2JQOA 1PDQA 4KHZA 1YI2A 1WTPA 3GV3A 5C5MA 4K2LA 1TS5A 4HEDA 1HCZA 2OQKA 3HOUB 1DXMA 1D5ZC 1Y8OB 1SBBB 2JEBI 5M3MG 1HPCA 1QJOA 1BUVT 3M7NA 3P1HA 5COYA 2R93G 2Z4IA 4YY3Q 4BBSG 1V1QA 1I5FA 4DR3Q 2PQEA 3U50C 4DNTB 3DXJC 3J81j 2UUCQ 4YWLA 4C2MH 1WI5A 3TMEA 1RD9D 4IPGA 2ES2A 1HTLD 1QCBD 5I9PA 1ESFA 5CYUA 4A3MG 3GTOH 2CW0C 5C3XA 1VQCA 3P20A 5GROA 3HRZC 1XYIA 2E2HH 2K6AA 2LXKA 4YHHQ 1Y1WB 4LFCQ 3F2BA 3GTQB 5LL6S 4DK6C 5FO8B 4Y7NB 4O42A 4NPSA 2KHJA 3KLSX 5JEAH 5C4XB 2QDLA 1LTBD 3S15H 3L3OC 1YNND 1UUPA 2A69D 1WTXA 1YVCA 5KRUA 4P2CB 1SNMA 3TZUA 3FKIH 1TWGH 2N88A 3HOZB 2F4IA 3MFGA 2KEEA 1GD7A 2VB2X 3PO2H 1HA5A 1VF7A 4POFA 1II3A 1AZPA 2JA5H 3UDFA 4DAMA 1EIGA 1S4ZA 2O2LD 3RLFA 5A2QE 3EVQA 3TEHB 1NBWA 3OMGA 4GNXB 4NW2A 2F4VL 1TS4A 1VQMA 3C2PA 3TREA 2OCEA 3TN2A 3I4MG 4DR4Q 1ML0D 4RMFA 5C44B 2YTXA 3PSIA 1EY9A 2ZM6Q 3PF5A 1SYCA 4QIWB 4RGTA 2F0VA 5CMDA 4KHPQ 1N9WA 2ICIA 4DV5L 4B3TL 2FXQA 1SDFA 4U673 4L5QA 2DUDA 3FP9A 1Y1VG 3R8BA 4ZQ3A 4JPBW 1HZ9A 2WAQB 1N33L 1EY5A 1SYGA 4JI2Q 3VDYA 4S3SA 1VCIA 4A3IB 3NTIA 3KUPA 4IJLA 2PPBC 1CFMA 4Y52H 5I2YA 4CKEA 3V2TA 2XVSA 5LMNW 4PZ6A 2PNRC 4A3DH 2NVTH 2RSOA 2I46A 3A5UA 2M2LA 1XNRQ 5EBCA 4O0AA 5JOBA 1VQGA 1YHBA 3P7JA 1IYVA 5IGDA 4PZ7A 5KGUA 4BY1H 1K0RA 3VR5A 1L1OC 2GVAA 5IP7G 4C3JH 3S16H 2VS1A 2G5DA 3OPOA 1HQMC 3JAMi 4DR3L 1HA6A 3TP6A 5KIXA 2UUCL 5M3FG 5J39A 1YNNC 2BCOA 3K59A 2NWGA 3CMAA 4CGYB 5JJLA 2LXJA 3VR4A 1TWFB 1LT3D 1S3OA 1XTDA 3K0XA 1EYCA 1GKHA 4JI3Q 3MVVA 5JJZA 2UUBQ 3DWAA 4PZ8A 4C3HH 1YNXA 1YHAA 4LFCL 5K5PA 4YHHL 1MGSA 5AJ3Q 3S1NB 1ZYRD 4JOIC 1BKBA 3J7YW 1X9NA 5CR3A 1D8LA 4OGQC 3CMEA 4G7OC 1GVPA 3K6OA 3NBIA 1A62A 4A3FG 1TWAH 4P72A 3MXPA 1CT1D 2IX3A 3CCQA 3Q8DA 2JA7H 3BZDB 2Z0SA 2K52A 4OIKA 2JA6H 4DPGA 1IL2A 3OHXC 1JMCA 2IX0A 1WFQA 1V1PB 2JK8A 5I4DA 2R93H 1A63A 1PH2A 5ISRA 2BH8A 4CJ1B 2E2JH 1SE3A 2MJ8A 3J7AF 1Q81C 3R2TA 1IYJB 3RN2A 5CV5A 1NUCA 2EYJA 4C2MB 5DEHA 3R2IA 2F0WA 3X3NA 1Y8NB 2LMCB 4A3MH 2B2VA 5CORA 1B9MA 3F2UA 4X66Q 5K36H 3WOFA 2E2DC 2O4XA 1U4LA 2E2HB 2WKDA 4C56C 2HQEA 2P5ZX 2ZM6L 4IALA 1O7IA 2PZUA 1JORA 1SR3A 4KHPL 4JI5Q 1QZGA 3S15B 5FO9B 1K28A 3J7AV 2C35B 3S9WA 1LUZA 2MUYA 3GP7A 1KL9A 1EQQA 2VUMH 2AWNA 1K8OA 4NXMQ 1FR3A 4DNRB 4DN4M 2NZHA 3KJOA 4POGA 3F8TA 2ATWA 2R7DA 3PO2B 4JI2L 4IUVA 4GS3A 1K8AC 4E6IA 3VR6A 3HOWH 2JA5B 3V96A 2NB0A 3ICEA 1CI3M 4GKKL 3C3LA 5E3FA 1VQPA 3S1MH 1LTTD 1N34Q 2JSOA 3JC66 1F2LA 3LWEA 2IJ0A 4C1NI 3PIP3 4A3BH 2WP8J 3I4MH 2CQOA 3GQBA 3KOJA 1ILPA 4F87A 1X3FA 3QIAA 1Q1EA 3QO2A 2F0QA 1XNRL 3QB3A 1LTID 1AFPA 4BA2I 2H4OA 1SAPA 2YV5A 3ND8A 2HHHQ 5DLQE 3H91A 4FDBA 1LV9A 2PYKA 3FPPA 1Y1VH 4APVA 1TS3A 3I4NG 1D7QA 3M7GA 1HZBA 3TSSA 3LWUA 4DV2Q 1BR9A 3VYUA 4DV7L 1ZYRC 4CHTB 1UE1A 2N55A 4EVOA 1HR0W 3MZ5A 5CV6A 1AZQA 3I56A 1FGBD 5C3EB 2JE6I 1PTOF 1XTCD 1QG7A 2F0NA 2HDMA 2IHFA 1VQAA 4DR7Q 4A3LH 3DM1A 4QIWE 4JI3L 2Z6BA 4DAYB 3S24A 1B44D 4R4QA 1I50H 1TWHH 1FJGQ 4YIJA 2NVTB 2HIXA 1QVGA 3NEMA 2E5LL 5EJWA 5IT9E 1H9SA 1W6KA 4LF7Q 5IP7H 4BY1B 5C4JH 1Q12A 2CKZB 4RGNA 4A3KG 4C3JB 1W3SA 3BU2A 2Z8LA 2OTLA 5M3FH 4IOAA 3URYA 4F8MA 1SXTA 1G51A 2A68C 2F0FA 3OIQA 1CQVA 2R92H 3UDXA 2A6HD 5JAVA 3PUXA 3FRPB 3NWSA 1K8MA 1O78A 4IQZA 5BN5A 4X6AH 3HP3A 5DM73 4LUVA 4JI4Q 4C3HB 4LW1A 3PF4A 3A8KE 1IW7D 3M4PA 3FMCA 4JI5L 1B4OA 4A3FH 1DCZA 3HKZB 1GO3E 2ZTCA 2VW9A 2YTVA 3ZJYC 4DK1A 1OXTA 3T4AC 1TWAB 1M1KC 3CRKC 1B70B 2JA7B 4NXML 1HXYD 3I3CA 4GKJQ 4WORA 1B3AA 4CDEC 2AKWB 1F9RA 2JA6B 1I4XA 4OWTB 2JA8H 1D5MC 2K05A 5JVG3 3CU7A 4KK7A 2E2JB 1NY4A 1P8LA 4KMUC 2LSSA 3U9SA 1JC7A 2AQ2B 2J4XA 5IGGA 4LFAQ 2PI2A 2B2YA 3I4LA 4DV0Q 1EEID 3NK9A 2WB1G 3E6ZX 1RTOA 4H44C 4A3MB 4IN3A 3J81c 1EWCA 2QEXA 4ME5A 4OO1H 2OF1A 2RDHA 3A7LA 4ODGA 3D0FA 2ALYB 4MTKA 3OOCA 3I7FA 1E22A 2J0TD 1GM5A 3HOXG 1LM0A 3SHLA 4IPDA 1X55A 5I6YA 3S1QH 3KF8A 2H1EA 1LTSD 4JI8Q 2VUMB 2D9UA 4TVAB 2L5TA 4DV1Q 3I4OA 2SNSA 4QQBX 1UEAB 2Q2HA 3IFTA 1EYGA 3QG1A 4DV2L 1HUMA 2NVQH 3PO3H 4J1MA 3CAMA 1B2TA 1KLUD 1S5CD 1TXYA 3L9AX 1B9NA 3KBXA 1SROA 4HSVA 4XXEA 3HOWB 3U58A 2PQAA 3AQQA 2KEDA 5CBAE 3CC7A 1XPOA 4DR7L 5IIFA 2MGSA 5C0XI 1DJRD 3S1MB 1NNXA 1EQRA 3R93A 1VQNA 3I55A 2EJGC 4A3BB 2LY7A 1FJGL 3EJIA 3NQTA 5C6AA 1JE5A 1HH2P 4CJ2C 2KECA 2EXDA 3K7AH 4X62Q 1AN8A 2AMCB 4LUZA 2EZVA 1K9MC 4LF7L 2A6HC 3HOYG 4WFN3 2DGYA 2JN4A 1TWCH 2B39A 1OTCA 3I4NH 2D0OA 3R3OA 1UE6A 2BH2A 2WFWA 1PH9A 4K14A 1IW7C 2EE1A 2QDBA 1SMYD 1VQHA 1ZKOA 4KHVA 3OMCA 1H9JA 3I72A 3J80E 3SXHA 1Y14B 1E2WA 4MNOA 2A6EC 5DAUA 5LMNQ 2K01A 3X3MA 2E75C 3MTSA 1EQVA 4JI4L 1KNAA 1A6XA 2SOBA 2PW7A 1I50B 1TWHB 3QOJA 3F2CA 5IYDH 4NB3A 3NBHB 3STBC 2K5HA 1JJGA 3NE5B 4DFAA 4U68A 3BDOA 1B1ZA 5IODA 4K0KQ 3IKJA 5C0XJ 1VQDA 3K5NA 4GKJL 1Q3LA 3A8JE 1PZID 2AHOB 4RKLA 3CKIB 4DV3Q 2EYLA 4H02A 3F1ZA 5C4JB 1JJ2A 2K28A 4A76A 4DA2A 1VDZA 1Z47A 1GJXA 3S1RH 1L0YB 2IX1A 4LFAL 2YYZA 3H09A 3D8GA 3MA2B 4DV0L 2NN6I 3I90A 1EU3A 2R92B 5E4WC 1TY0A 3JAME 2XWJB 1PYBA 5FLXE 4HAEA 3BYTB 3ERSX 1NSNS 5C0XG 1W6JA 2K33A 5G3LF 1QUQA 5KNBA 2WV6D 4QL5A 1X56A 4A3FB 4DV5Q 2EYOA 4HCEA 4JK1C 4JI8L 1IKLA 4LF4L 4JBMA 4DV1L 3KK7A 4GOPA 4EQOA 4QY7A 4A93H 2K5QA 2ZJQA 1A3TA 2JA8B 2JP1A 1OXUA 1I4HA 2R7ZG 1DM0B 3GTPB 5IT9c 2MPMA 3E9IA 1SNCA 5IYCH 2IHEA 3BG3A 1PTOH 3MXUA 2KCCA 1UWVA 3CC2A 4HIMA 4P74A 3HKZE 2ENBA 3PGZA 1FYCA 1SYBA 4J6HA 2YTYA 1SMYC 4R8NA 1VQ4A 1YNJD 1K0SA 4FXKC 3G71A 4XYOA 1K73C 3HOXH 1HFGA 1SJHD 4X62L 4RAUC 3E5SA 1PXUA 2Z6KA 2PW5A 1PHJA 4YWMA 3A56A 3UI2A 4RHRA 4A3CH 3S1QB 2KA7A 2F03A 3MEHA 3D4RA 3I73A 4OX9L 1KDBA 2NVQB 3PO3B 1EY6A 3NTHA 1OXSC 1GUTA 5EGTA 1D5XC 1SYEA 2RDFA 2VY3A 4KN7C 3KDFA 3F2DA 2B3GA 4DK3C 1LO5D 5LMNL 4JBWA 4DV6L 1L1OB 1SJED 1ET6A 2SDFA 1SN8A 5EPKA 1QNKA 5A2QL 3CC4A 1H9SB 2B2VC 5D3DA 4K0KL 2L0CA 4I65A 4A3JH 3K7AB 3PUYA 2L55A 4DV3L 1J5EL 1TWCB 2L4NA 3HS0C 1HR0Q 1JT8A 4ZLTF 1GUOA 3KBGA 1PMRA 1XMQQ 1P16A 3PUWA 4Q0FA 1J6QA 2VQEQ 1R9TH 1T5EA 1PH1A 1WCMB 3GTGH 5LHY1 4LFBL 1EOVA 3KFUA 1CZGA 3ONAB 1QVFA 4JW0A 3C46A 1H95A 4ZCKA 4ID6A 3G6JB 4DNIA 3E3XA 4UP8A 1B3QA 1NJIC 4CKCA 1SFOH 4LNQA 2E2IH 1AH9A 4TSSA 1RODA 1RCVD 4KN4C 1FVIA 1KTKA 1STEA 1ENCA 3FDTA 3P75A 4K8IA 3BDLA 3EBEA 2XWBB 4C3IG 2NVYH 1C9OA 1V9PA 4X3SA 5IP9G 4B3SQ 2K03A 4DV4L 1QE6A 3TQYA 5C4HA 1K83H 3S1RB 1YNJC 5KEEA 1T9HA 3K58A 2QGQA 4QUFA 4JI1Q 4GKKQ 4HJ9A 3KLWA 1UEBA 4TRDA 4OIJA 4F88A 2RHQB 3J81L 3BVZA 5LMUQ 2OXPA 1KHIA 4GN3B 3GTKH 2L11A 4AIMA 2G9HD 1CKNB 4HJ8A 1BXTA 2BOSA 1EEFD 2BE5C 4OWWB 1JWMD 4PMBA 5C0XH 5FOBB 5M5YH 3N6RA 2A73B 1V1OA 3Q22A 2CCZA 1MSHA 4LUOA 1D1IA 5ELDA 3HOVH 4RGMA 3RD4A 4K6DA 4XQJA 2A1AA 4X65L 2HT1A 4BY7H 2DY7A 4G7ZC 1Y69U 5FLMG 1L0WA 1VQLA 4A93B 1LT6D 4DV7Q 1NR2A 1PH4A 4HN7A 1SSOA 2FFKB 3MXNB 3TS0A 1Q8KA 2R7ZH 2F0UA 1R4QB 2K14A 3UDIA 4ZKBB 4IUUA 2BA1A 4OONA 2EY5A 1ICWA 1JCKB 1YITA 4UY8C 2FINB 1PTOD 4JYAQ 1PTOB 2K5DA 1NE3A 4XIGS 3H3VI 1JR0D 5E1FA 2X6LA 1F9SA 1CKMA 2X6GA 2I5MX 1KXLA 1HQRD 1RL2A 3CHBD 3DWPA 4WJ3M 1F2YA 2I5HA 3SK4A 4QCLA 2WACA 2E5LQ 1TT2A 3HOXB 2CHBD 1ET9A 5M3MH 4ILWA 1VMCA 1MJEA 1DD2A 1E0BA 2CQAA 1HR0L 4BBSH 1KD1C 3QOLA 2RHSB 2FMCA 3I91A 1G6ZA 1XMQL 1SLJA 3DEOA 1CTMA 4OHJA 4ZUIA 1LABA 2VQEL 1OXXK 1U4RA 1STYA 4ABNA 1DYQA 4GN5A 4IJHA 3VYSA 1GHKA 1Q1BA 1K3RA 3GDEA 2Y0SB 1F9QA 2C5CA 3Q24A 3GTOB 3T53B 1ONLA 2AWOA 1BVSA 3I8ZA 4RKBA 1HRJA 1EIFA 1JB3A 1IXRA 1BNZA 4X64Q 2IPKD 4NDXA 1WYDA 1YEZA 2B2YC 4KTAA 3HGBA 4JI0L 1J8IA 2A68D 3NP8A 4UP7A 2NYZD 3GTJH 1UNSA 2XNAC 1TVXA 4A3JB 3M4QA 3FKIB 3PMFA 1JICA 1TWGB 2QEJC 3ULPA 1CSPA 1PRTF 2VZAA 2AUKA 4PMCA 1I4RA 1VQ7A 1XXGA 4HTHA 4A3GG 1VQBA 2L15A 4HCSA 4B3SL 2IWHA 1HUNA 3GTLH 4DGZA 3K5LA 3HZXA 2NZ1D 3KF6B 1JWSD 3VR2A 2UU9L 5J22A 4JI1L 1KLGD 3HOUG 3GTGB 4DF7A 3G7LA 5LMUL 1ICFB 3OIPA 1OO9B 2H5XA 3SDZA 5EBDA 4GLXA 3K80C 2DN8A 1FNWA 3BDCA 1EIHA 4OL7A 4AYBG 4K5WA 2Q2IA 1WD0A 5GAHC 1QUQB 5HURA 2E2IB 1MKHA 2KENA 3Q6SA 2PCFB 1PTOC 1G8ZD 1QZHA 5BN3A 1B53A 5IWAQ 2KHSA 3V05A 2L12A 2OQ0A 3H0GG 5IP9H 1Y1WG 2R6GA 2Z9HA 1BF4A 2NVYB 5ELCA 1M8AA 5IT9L 5C4XG 4GLAC 3IL8A 1SE2A 1BDOA 1K83B 2NVXH 1Z6HA 1J9OA 1F2MA 1WJJA 3PIO3 5JJKA 2Z1CA 4NKLA 4JYAL 5IGBA 3HOZG 2HUGA 3M9BA 1E24A 4R4OA 1GUNA 1G2SA 1HHVA 2QF7A 1OXVA 5D3IB 4A3DB 5M5YB 1A8VA 1CK1A 3A7AB 2Q2TA 1YIJA 2K1BA 3EA6A 4TQUS 3HOVB 4DUZQ 4TKOB 1WTQA 2GN5A 4KKUA 4BY7B 3WOEA 1MI2A 5FLMH 2DJFC 1TQOA 3S16B 2A74C 4EX5A 2AUJD 2DNCA 2V1CC 4ZYSA 5EPJA 2OTJA 4L5RC 2EJFC 5I2XA 4MZ9A 2MO0A 1WVLA 1A3VA 1NTGA 3OSOA 2HCCA 1Z9FA 2E74C 1TY2A 2IL8A 1G6PA 5LL6X 1PV4A 4X3UA 2KUMA 4DR1Q 1KAWA 2WAQG 4X64L 3OYYA 4A3IG 4PQXA 5IGFA 3OW2A 2D0PA 5C5LA 3CCRA 2LFNA 3MHBA 3UE1A 2A6ED 1I6VC 4L5TA 5M3MB 3KJPA 4GNXA 2R93B 1WTWA 4BBSB 5FO7B 3J81i 1IBKL 4JI6Q 3CCSA 4KKTA 4M8AA 3RMHA 3BVGA 1LLRD 2ZJPA 3STBD 1S40A 4PG3A 2CH4W 1KC8C 4FXDA 1ASYA 4RGOS 1PZKD 2TMPA 1MHWC 4LF6Q 3EROA 3QWNA 4L63B 2KHIA 3SGIA 2JJQA 2L9HA 4O2DA 1CZWA 3K7UC 1TR5A 4J8QA 3CW2C 1HNZQ 5HGQA 3AFQA 4DAPA 1RHPA 4EGVA 1W2BA 1JOOA 2RSNA 4BBRG 3A74A 1YJ9A 5G3LD 3GTJB 1RKNA 5IWAL 4MTNA 4LF4Q 2HCIA 3RLOA 2MO1A 5CV4A 4DAVA 2YU9H 1FNUA 2Y0SE 3GTLB 4IURA 1GUSA 2KJXA 1O7ZA 1VQKA 5IOCA 1R4PB 2Z6KC 4AH6A 2KCMA 4YCWA 4G7HC 3FEWX 3WDNA 1NR4A 1YZ6A 2JYOA 3H15A 1EYDA 2F52A 1PH6A 3I4MB 3J80L 3DUZA 4XQQA 4KY5A 2RQXA 2ID0A 3EFXD 1ZXTA 1LTGD 4AQYL 2VXWA 3DEPA 4R9WA 1GXDC 1PH8A 3AMUA 4FXGC 2EDGA 2VNUD 3NELA 3NWTA 1AE3A 2RDGA 1S5DD 4DUZL 1PFMA 1I4QA 4DXFA 5EKIA 4P75A 1Y1VB 2N8NA 3H0GH 1D1KA 2IW3A 2ZXRA 1QWYA 3GTQH 4OX9Q 5GAGC 3A55A 2NBFA 1B7YB 5KNDA 1NMGA 4X3KA 1KDCA 2NVXB 1MJCA 1X3GA 1F9PA 1RDPD 4FF2A 1O7LA 2F3WA 3HOZH 1AEXA 2DNEA 2EYHA 4YCUA 2NZOA 4DV6Q 1I4PA 1X3EA 1VQ6A 4ZK9B 4DR1L 1V1PA 3TDQA 3PO2G 2B2TA 1H9RA 4CDCC 1VQOA 3T13A 3SEBA 3H6MA 5KNCA 3RN5A 4KKSA 4WRDA 3A8IE 2B2WA 4B9XA 1L0XB 3RNUA 4N8FA 1G2TA 3GD7A 2JA9A 4RA8A 5FLXL 4A3KH 1SMXA 1K3BC 1J5EQ 1CQFA 4BS9A 4XYQA 2J7ZA 4XTCS 4LF9L 1Q46A 3NQIA 2BA0A 1X3QA 4JI6L 3AYHB 5EKKA 5M3FB 1CM9A 4IUQA 4LFBQ 1Y8PB 4LF6L 3AEVA 2EPBA 1V43A 3AFPA 4MIUA 2RF4A 3BVMA 3SR1A 5IE8A 1VQ8A 2B8FA 1TIID 4RCOA 3VA5A 2UXCL 5C3EG 1HNZL 1N8RC 1KIXA 1NCVA 4HJ7A 1DOKA 1A3UA 3NHHA 3BS1A 3D4DA 4DR6Q 4QF4A 2EXZA 4EQ5A 1VQIA 3M85A 1JOQA 3W1BA 3H94A 4GZYC 5H1SE 4DV4Q 1N32L 2SEBD 1MBYA 1UE5A 1RIPA 3EQLC 3IAYA 3NTKA 4BXXG 4HR7B 3PIPA 2EIFA 1PYWD 2M00A 3GTMH 2K5VA 5BR8Q 2XN9C 2HD3A 4BY1G 1IBLQ 4C3JG 1U9RA 4K2KA 4A3EG 1VQFA 3M4YA 3DHQA 2F3VA 4MN3A 1IZ6A 1PA6A 1BOSA 4DR2Q 4WJWA 2M9VA 4HSPA 2EYPA 4BBRH 3WWVA 5DM63 4PMWA 4X65Q 2PMZB 2B2UA 1JJCB 5IGCA 5A35A 4DAYA 1CA6A 3IFDA 3D6WA 3TP7A 4C3HG 3RZDH 3PIOA 1GHJA 2BE5D 4ZAIA 2YU9B 2NTSA 2K4KA 1IL8A 2HQLA 4CBVA 1CSQA 2PZTA 2B63G 2I5LX 3HKZG 1F2ZA 1QB5D 1VQJA 3NXWA 3U4VA 1CHQD 3S14H 3QR8A 2JA7G 4R4CA 1DOMA 1Q8IA 5M9OA 2JA6G 5CGKA 3L7ZC 3MXGA 5L37A 1PH7A 4H13C 3T51B 1LTAD 3U4ZA 4AYBB 2NN6G 4EQPA 4GN4B 2F0MA 1KAAA 2F0GA 5JPMC 1NAPA 1HTPA 1O7YA 4LAAA 1IBML 3SK6A 1SEBD 3HOYH 1KNEA 5CC4A 4NXNQ 2AQ1B 1BCPD 5K36G 1X54A 1BBWA 3K5MA 1BCPB 2D5DA 3I4NB 3W5OA 2FJ2A 3H0GB 1EYAA 1FD7D 2OT2A 3NUCA 2KCTA 2D2CC 4DKAC 1LT5D 1YJNA 2CVRA 2A8VA 1ENFA 3DM3A 1AP0A 2E76C 3PCOB 2UXBQ 3NSWA 4KI0A 4JVZA 2VQFQ 2VUMG 1H9KA 4OXPA 2Q8TA 3LGJA 2DY8A 2A19A 3OTOQ 4B3RL 4N8X1 2KVMA 3MEFA 1SRUA 4ZRZA 1LTLA 5I9OA 1M4VA 1B8AA 1EU4A 2LKVA 3K0YA 4MHEA 3HOWG 4JI0Q 1B50A 4LF8Q 3SVMA 3MWYW 3EIVA 3BYYB 4DR6L 2QCPX 3D3RA 3K57A 2XIWA 2O5IC 5M5WH 3OWFA 3EN2A 5GAEC 1MSGA 4IFDI 1EZ8A 5FJ8G 4PV1C 5F2DA 1SYFA 4A3BG 3KYHC 4A3KB 2XTIA 4LJZC 3ZYYX 3BJUA 2EVBA 4K8JA 4DK0A 1PRTD 1PRTB 1C7YA 2ASBA 1EY7A 4KY6A 4ZKCB 2UU9Q 1A15A 2AQ3B 2RA4A 3J80i 1KABA 5BR8L 3BZKA 1HJPA 1IBLL 3CQZH 1X3PA 1ILQA 4N9TA 5ELNA 2WKCA 1C4QA 5JVH3 2R3ZA 1HNXQ 3DLLA 1PVOA 1I94Q 1ZEQX 2TSSA 1X65A 4LF5Q 5CV8A 2X69A 2F3IA 3T1HL 4G4KA 4IPCA 4DR2L 3J80c 1E2VA 3PQIA 1S5FD 4XT1B 3RUZA 5C3EH 1EIYB 2G9DA 4NP5A 4OO1I 2XRQD 4A3LG 3KF8B 4UPAA 1Q86C 2QKIC 5TSSA 3Q0AA 1HZCA 3SK8A 2ZTDA 3I70A 3E0EA 1PH3A 3TP5A 3AB9A 3E9HA 2HDLA 4G57A 4BXXH 4HMIA 2PQAB 4FF3A 3HG9A 4H0LC 1YBYA 3H3VC 2QA4A 5BN4A 3ULLA 4B08A 2WB1B 3GTMB 2ZT9C 2F0PA 3IRBA 1Q82C 2CWAA 4FO2A 1WTOA 5E7NA 4GLVB 3MAQA 1BCPC 4A3EH 4IFDJ 5GQOA 1LT4D 1VQ9A 4YY3L 3J81E 2A5HA 4IO9A 2WIIB 2A69C 4RG1A 1KQSA 1BCPF 4DU9A 3CF5A 4N9PA 4QUCA 4BBRB 4NXNL 2R92G 4C1NK 3KLSA 4XT3B 5D65A 1CA5A 2F0HA 3K81C 3JAMc 1DGSA 1TS2A 5FLXc 2N3SA 1X32A 5FKAC 3CCMA 3RZDB 4RFBA 1U4PA 2PNHA 3A0JA 4ALPA 4YCVA 1UE7A 2B63H 5I6WA 3NBHA 4IFDG 3T16A 2UXBL 2O5JC 3DMUA 3ERQA 4HJ5A 2VQFL 2EY2A 4GNXC 4DR5Q 3S14B 1PFSA 3OTOL 1WD1A 2EJMA 5C3WA 3S2DH 2JA8G 3HKSA 3LNNA 2PMZE 2NN6H 1PRTC 2D62A 4A75A 4LF8L 5JJIA 2PZWA 3CCUA 1QOHA 2WINB 3G4SA 3HOYB 1JOKA 3G48A 1E1TA 1WOCA 2NTTA 4YWKA 5CBEE 4QGUA 4DR4L 1EY0A 2XGTA 2ICEC 4UDUC 2E8GA 4FNFA 1IBKQ 1VMPA 4CJ0B 1VS0A 4OO1G 1S5ED 5CV9A 5KYIA 2RCNA 4OEMB 4JBKA 5HY6A 3RZOH 4JV5Q 2FHTA 2F1MA 4IUNA 1R9TB 4B9WA 3FHWA 1EUJA 4Q5VA 4AYBE 3NENA 1XWEA 1QVCA 3HEJA 4HJAA 3G6EA 3W1GA 1HNXL 1JE4A 2HIVA 4HIOA 1I94L 3CP0A 4LF5L 3PO3G 1AW7A 1VF5C 4JG2A 2F0DA 3ULJA 1SFOB 1XNQQ 2ZXOA 3GV6A 3OWEB 2MP1A 1SNOA 1PZJD 2CFMA 4CDFC 3S17H 4GOPB 5FJ8H 5M5WB 2GVBA 2EOTA 4K5XA 1A2TA 4C3IH 2N49A 1I6HH 1FGUA 4HIKA 3GO5A 1EFID 5IY0A 1M90C 4XQNA 3DWQA 2OWOA 5J1ZA 2F0SA 1X6OA 1K8GA 1EWIA 2KCNA 1ENAA 1DOLA 1MIUA 1KRTA 4JC0A 3CQZB 2QW7A 3GTKB 3RR5A 3PUVA 4KLKA 3PV0A 2BDNA 5M5XH 4FVMA 1T5XD 1BQQT 3S2HH 5ELBA 1I3QH 4JI7Q 3CPWA 2Q2UA 2K04A 2IY5B 1EL0A 4AQYQ 1WCMG 1BO0A 3CD6A 3M3YH 4UP9A 3SK5A 2K32A 1QILA
chains in the Genus database with same CATH topology
2UUBL 4BA1I 3CMAA 3GTQH 5JJLA 4OX9Q 2LXJA 1VQEA 2PI2E 5GAGC 1L1OA 1S3OA 1XTDA 3K0XA 5ELOA 1GKHA 1B7YB 4JI3Q 2VY3A 3KDFA 5AJ3L 4DUYQ 2UUBQ 4L5SA 1NMGA 5C44G 3F2DA 2B3GA 4DK3C 4PZ8A 4C3HH 3CCJA 5LMNL 1MJCA 1YNXA 4JBWA 4DV6L 1X3GA 1YHAA 5EAYA 4LFCL 4YHHL 1L1OB 5AJ3Q 5IYDG 2CWPA 4JOIC 3HOZH 1BKBA 3KDFB 4YCUA 2WAQE 2NZOA 4DV6Q 1X9NA 1D8LA 3CMEA 1X3EA 1VQ6A 1GVPA 1A62A 1SN8A 4DR5L 3L2PA 4DR1L 4A3FG 1TWAH 4P72A 3PO2G 3CC4A 3CCQA 2JA7H 3Q8DA 1C0AA 1VQOA 2Z0SA 4JBJA 2K52A 4K0KL 3RN5A 2JA6H 4DPGA 1IL2A 1JMCA 3J7ZC 4A3JH 2IX0A 1WFQA 2JK8A 3PUYA 2R93H 1A63A 4JOIA 4DV3L 1PH2A 2BH8A 3RNUA 1J5EL 2E2JH 3GD7A 2JA9A 3CCVA 1HR0Q 1Q81C 1JT8A 1IYJB 3RN2A 4A3KH 1SMXA 1J5EQ 2UUAQ 2UXDQ 1XMQQ 1P16A 2R7FA 4X66L 3PUWA 4XTCS 4LF9L 1J6QA 1Q46A 2VQEQ 4A3MH 2BA0A 1R9TH 1PH1A 4JI6L 3AYHB 1S72A 3GTGH 4R1JA 1PYSB 3M4OH 4X66Q 3B6YA 2WB1E 3TRZA 4LF9Q 4LFBL 1EOVA 2IT1A 3KFUA 5IYBG 1QVFA 1H95A 1PH5A 4JV5L 4LFBQ 4LF6L 3AEVA 2ZM6L 1O7IA 5J3BA 1V43A 3AFPA 2RF4A 1SR3A 5IE8A 4DNIA 4KHPL 4JI5Q 1QZGA 1VQ8A 4UP8A 1NJIC 1L2FA 2C35B 4GOPC 3UDGA 1SFOH 1LUZA 4LNQA 2E2IH 1E7ZA 1AH9A 1KL9A 1EQQA 2VUMH 1FVIA 3CPFA 4A93G 2AWNA 2UXCL 4NXMQ 5C3EG 1HNZL 1N8RC 1A0IA 1KIXA 2NZHA 3GTPH 4HJ7A 3KJOA 4POGA 3F8TA 2ATWA 2R7DA 2UXCQ 4R4TA 4JI2L 1XNQL 4GS3A 3EBEA 4DR6Q 1K8AC 2NVYH 1C9OA 1V9PA 5IYCG 3HOWH 5IP9G 3D31A 4EQ5A 1N34L 4B3SQ 1VQIA 4DV4L 3ICEA 3TQYA 3M85A 4GKKL 1K83H 1LYLA 3W1BA 2ZJRA 3S1MH 1VQPA 4B3MQ 1N34Q 5H1SE 4DV4Q 4A3GH 1T9HA 1U0LA 2QGQA 1N32L 1UE5A 1RIPA 3JC66 4JI1Q 4GKKQ 4HJ9A 1CKNA 1HNWQ 4A3BH 3KLWA 1UEBA 2WP8J 2EIFA 3PIPA 3I4MH 4BXXG 2RHQB 2CQOA 2KBNA 1N32Q 5LMUQ 3KOJA 3GTMH 1KHIA 2K5VA 4GN3B 3GTKH 5BR8Q 1X3FA 4AIMA 2HHHL 3HOUH 1CKNB 1Q1EA 1U5KA 4BY1G 1IBLQ 2B29A 4HJ8A 1XNRL 4BA2I 4OWWB 4A3EG 2YV5A 5M5YH 2HHHQ 5JEAJ 3T1YQ 1VQFA 5DLQE 4A3CG 4FDBA 2EQSA 2CCZA 1IZ6A 4LUOA 1PA6A 1Y1VH 3I2ZA 3HOVH 4DR2Q 4APVA 2A1AA 4X65L 3I4NG 2HT1A 1D7QA 4BY7H 1HZBA 4JI7L 4DV2Q 4BBRH 3K8AA 4DV7L 1UE1A 3WWVA 4PMWA 4X65Q 5FLMG 1L0WA 1HR0W 1VQLA 3H3VH 4WJ4A 1JJCB 1N36Q 3I56A 4DV7Q 2JE6I 1PH4A 3MXNB 3TS0A 2Y0SG 2R7ZH 1Q8KA 4IOCA 3RZDH 2IHFA 2K14A 1VQAA 4QJFA 3UDIA 3PIOA 4DR7Q 4A3LH 2BA1A 2K4KA 4QIWE 4JI3L 4OONA 1Y1WH 1XMOQ 4DUYL 2HQLA 2I0QA 4DAYB 4Y7NH 3S24A 1CSQA 1YITA 4UY8C 4R4QA 1Q7YC 2K50A 2I5LX 3HKZG 5C4XH 2B63G 4JYAQ 3ER0A 1I50H 1TWHH 1NE3A 5JEAG 4XIGS 1G291 1VQJA 1FJGQ 3U4VA 3S14H 3H3VI 1XPUA 2JA7G 4R4CA 4OWXB 1CKMA 4P71A 2HIXA 2I5MX 4IPHA 5GADC 1QVGA 3NEMA 2JA6G 3TS2A 1KXLA 1RL2A 4A3JG 2E5LL 3L7ZC 3FKIG 2JEAI 1PH7A 2VL6A 4WJ3M 2I5HA 3CXCA 3U4ZA 2NN6G 5IP7H 2E5LQ 4GN4B 4LF7Q 5C4JH 1Q12A 2CKZB 2ZTEA 4A3KG 1W3SA 5M3MH 2JA5G 1MJEA 1IBML 4LWCA 3BU2A 3HOYH 1WCMH 2N78A 1HR0L 2OTLA 4BBSH 5M3FH 1KD1C 4NXNQ 4IOAA 4P73A 2RHSB 1ASZA 1IBMQ 1G51A 1BBUA 2UUAL 2UXDL 1X54A 1BBWA 1SLJA 1XMQL 5K36G 1YJWA 3W5OA 1CUKA 2VQEL 1OXXK 2R92H 3UDXA 1HZAA 1CKOA 2KCTA 4DKAC 3PUXA 4GN5A 5C44H 3J7A5 4IJHA 1YJNA 3A5ZB 2A8VA 1Q1BA 1K3RA 4X6AH 3DM3A 3GDEA 4LUVA 4JI4Q 3PCOB 2UXBQ 4LW1A 1YHQA 4KI0A 2AWOA 1BVSA 3PF4A 3M4PA 2K75A 3CCEA 2VQFQ 2VUMG 1EIFA 4JI5L 4OXPA 3LGJA 4ME3A 1IXRA 2A19A 3RLNA 3UE0A 3OTOQ 4A3FH 4B3RL 4X64Q 1GO3E 2ZTCA 2VW9A 3MEFA 2YTVA 1WYDA 1SRUA 1YEZA 1OXTA 3ZJYC 1M1KC 4JI0L 1LTLA 2MQHA 1B70B 4B3RQ 4R4IA 1B8AA 4NXML 4UP7A 4GKJQ 3GTJH 3HOWG 2MFIA 2AKWB 4A3IH 4JI0Q 3M4QA 4OWTB 2JA8H 4LF8Q 4JCVE 3ULPA 3EIVA 1CSPA 4J15A 3KF6A 2VZAA 4DR6L 5M5WH 5GAEC 1NY4A 3EN2A 1E1OA 1NMFA 1P8LA 1VQBA 2L15A 1VQ7A 2LSSA 4B3SL 4A3GG 4IFDI 3GTLH 1SE8A 5FJ8G 1EFWA 3KYHC 4LFAQ 4A3BG 2PI2A 2XTIA 4DV0Q 4B3ML 3KF6B 2UU9L 2WB1G 3BJUA 3L0OA 2F4VQ 4JI1L 1HNWL 2ASBA 1C7YA 3HOUG 5IYBH 2UU9Q 3J81c 1VQ5A 5LMUL 3J80i 4A3DG 5BR8L 2QEXA 2H5XA 3BZKA 1HJPA 4GLXA 1IBLL 3CQZH 3D0FA 3K80C 2ALYB 5ELNA 4B3TQ 3HOVG 2MNAA 3I7FA 1HNXQ 1E22A 4AYBG 3DLLA 4HIDA 3T1YL 2Q2IA 3HFZB 1PVOA 1I94Q 1E3PA 5GAHC 1XPRA 3HOXG 1GM5A 4BY7G 1LM0A 1X65A 4LF5Q 1QUQB 4IPDA 1X55A 2F3IA 3T1HL 1MKHA 4IPCA 4DR2L 3S1QH 3J80c 5C3EH 2KENA 4JI8Q 1AE2A 3BZCA 4TVAB 1EIYB 4DV1Q 1N33Q 3I4OA 4A4IA 1JB7A 4QQBX 2Q2HA 1EYGA 2NVQH 1FL0A 4DV2L 3T1HQ 1QZHA 3PO3H 4OO1I 5IWAQ 3CAMA 4A3LG 3KF8B 4UPAA 1Q86C 1TXYA 3CCLA 2OQ0A 3H0GG 1TWFH 5IP9H 2R6GA 3PUZA 1Y1WG 1N36L 1SROA 3U58A 2PQAA 3AQQA 1HZCA 1XPOA 3CC7A 1KRSA 5C4XG 4GLAC 2ZTDA 4DR7L 3E0EA 2K5NA 2NVXH 1PH3A 5C0XI 1XMOL 1WJJA 1EQRA 3S1NH 3E9HA 5JJKA 4BXXH 1XJVA 2PQAB 3I55A 2JQOA 1VQNA 4KHZA 4JYAL 3HOZG 1YI2A 1YBYA 3M9BA 2QA4A 1FJGL 3ULLA 1E24A 4R4OA 3IRBA 1Q82C 2CWAA 2OQKA 1JE5A 1HH2P 4GLVB 5E7NA 4A3EH 4IFDJ 5GQOA 1OXVA 2EXDA 1VQ9A 4YY3L 2JEBI 3K7AH 5M3MG 4X62Q 2AMCB 4LUZA 1A8VA 1K9MC 3M7NA 4LF7L 3HOYG 2Q2TA 4IO9A 2DGYA 1YIJA 2R93G 4YY3Q 4BBSG 1V1QA 1I5FA 1TWCH 1OTCA 4DR3Q 4TQUS 3U50C 3I4NH 2D0OA 1UE6A 4DUZQ 3J81j 4RG1A 1KQSA 2BH2A 2UUCQ 4YWLA 2GN5A 4C2MH 1WI5A 3CF5A 2WFWA 4IPGA 1PH9A 5FLMH 2ES2A 4NXNL 2R92G 1VQHA 3K81C 4EX5A 3JAMc 1DGSA 2V1CC 4A3MG 3GTOH 5FLXc 2N3SA 1Y14B 4L5RC 2OTJA 1VQCA 3CCMA 5GROA 2E2HH 4MNOA 5LMNQ 4MZ9A 2PNHA 3A0JA 2LXKA 2MO0A 4YHHQ 4YCVA 1UE7A 1NTGA 3F2BA 4ALPA 4DK6C 4LFCQ 1Z9FA 2B63H 4IFDG 4JI4L 4NPSA 2KHJA 2UXBL 3S15H 4HJ5A 1G6PA 1YVCA 2VQFL 1PV4A 4GNXC 4DR5Q 3F2CA 1KAWA 1PFSA 2WAQG 4NB3A 3NBHB 4DR1Q 5IYDH 3STBC 3OTOL 2K5HA 4X64L 1JJGA 3OYYA 3FKIH 1TWGH 3S2DH 4A3IG 2JA8G 4K0KQ 3HKSA 3OW2A 2PMZE 2D0PA 1GD7A 5C0XJ 1VQDA 2D62A 3PO2H 4GKJL 3CCRA 4A75A 2AHOB 4POFA 4DV3Q 3UE1A 4H02A 2JA5H 3F1ZA 3UDFA 1JJ2A 4LF8L 5JJIA 4L5TA 3CCUA 3KJPA 4A76A 4GNXA 1Z47A 4DAMA 3S1RH 3G4SA 2IX1A 3G48A 1E1TA 1OXSC 3J81i 1WOCA 4YWKA 2YYZA 3RLFA 4QGUA 1IBKL 4LFAL 4JI6Q 3CCSA 4DV0L 4DR4L 2XGTA 3TEHB 1NBWA 4GNXB 2ZJPA 2NN6I 2E8GA 3STBD 4PG3A 1S40A 1VQMA 2F4VL 1IBKQ 3TREA 2OCEA 1VS0A 3I4MG 4DR4Q 4OO1G 4JBKA 1KC8C 2RCNA 5HY6A 4RMFA 1ASYA 3RZOH 2YTXA 4JV5Q 3PSIA 4LF6Q 2ZM6Q 3PF5A 3FHWA 1EUJA 2KHIA 3SGIA 1PYBA 4AYBE 3NENA 4KHPQ 1QVCA 1N9WA 2JJQA 3ERSX 4DV5L 4HJAA 4O2DA 5C0XG 4B3TL 3G6EA 3W1GA 1HNXL 2HIVA 1QUQA 2FXQA 4HIOA 1I94L 3CP0A 4QL5A 4L5QA 1X56A 2DUDA 3K7UC 4DV5Q 3FP9A 1Y1VG 3CW2C 4LF5L 3PO3G 4JG2A 1HNZQ 5HGQA 3AFQA 4JI8L 3ULJA 1W2BA 4LF4L 1HZ9A 4JBMA 4DV1L 1N33L 4BBRG 3A74A 4GOPA 1YJ9A 4QY7A 4JI2Q 1XNQQ 3VDYA 4A93H 5IWAL 2ZJQA 1VCIA 4MTNA 4LF4Q 2CFMA 4IJLA 1OXUA 3RLOA 2MO1A 2R7ZG 3S17H 4Y52H 4GOPB 5FJ8H 2YU9H 2GVBA 5IT9c 2Y0SE 4C3IH 2N49A 3E9IA 1I6HH 1FGUA 5IYCH 2IHEA 4HIKA 1VQKA 3GO5A 1UWVA 3CC2A 5IY0A 5LMNW 4PZ6A 4HIMA 2Z6KC 1M90C 4AH6A 2KCMA 4P74A 3HKZE 4YCWA 2OWOA 3PGZA 4A3DH 2NVTH 1X6OA 1K8GA 1EWIA 3A5UA 1YZ6A 1XNRQ 2YTYA 1MIUA 4O0AA 1KRTA 3H15A 2F52A 1PH6A 1VQGA 4JC0A 1YHBA 1VQ4A 4PZ7A 3G71A 4BY1H 1K0RA 3RR5A 1K73C 3PUVA 3HOXH 1L1OC 2GVAA 4KLKA 3PV0A 5IP7G 2ID0A 4X62L 4C3JH 5M5XH 4AQYL 2Z6KA 3S16H 2VS1A 1PHJA 1PH8A 4YWMA 3S2HH 3JAMi 1I3QH 4DR3L 4JI7Q 3NELA 4A3CH 1AE3A 2VNUD 3CPWA 2Q2UA 2IY5B 4DUZL 4AQYQ 1WCMG 3CD6A 3M3YH 2UUCL 4P75A 4UP9A 5M3FG 4OX9L 2N8NA 3H0GH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB L;  4BA1 I;  3CMA A;  3GTQ H;  5JJL A;  4OX9 Q;  2LXJ A;  1VQE A;  2PI2 E;  5GAG C;  1L1O A;  1S3O A;  1XTD A;  3K0X A;  5ELO A;  1GKH A;  1B7Y B;  4JI3 Q;  2VY3 A;  3KDF A;  5AJ3 L;  4DUY Q;  2UUB Q;  4L5S A;  1NMG A;  5C44 G;  3F2D A;  2B3G A;  4DK3 C;  4PZ8 A;  4C3H H;  3CCJ A;  5LMN L;  1MJC A;  1YNX A;  4JBW A;  4DV6 L;  1X3G A;  1YHA A;  5EAY A;  4LFC L;  4YHH L;  1L1O B;  5AJ3 Q;  5IYD G;  2CWP A;  4JOI C;  3HOZ H;  1BKB A;  3KDF B;  4YCU A;  2WAQ E;  2NZO A;  4DV6 Q;  1X9N A;  1D8L A;  3CME A;  1X3E A;  1VQ6 A;  1GVP A;  1A62 A;  1SN8 A;  4DR5 L;  3L2P A;  4DR1 L;  4A3F G;  1TWA H;  4P72 A;  3PO2 G;  3CC4 A;  3CCQ A;  2JA7 H;  3Q8D A;  1C0A A;  1VQO A;  2Z0S A;  4JBJ A;  2K52 A;  4K0K L;  3RN5 A;  2JA6 H;  4DPG A;  1IL2 A;  1JMC A;  3J7Z C;  4A3J H;  2IX0 A;  1WFQ A;  2JK8 A;  3PUY A;  2R93 H;  1A63 A;  4JOI A;  4DV3 L;  1PH2 A;  2BH8 A;  3RNU A;  1J5E L;  2E2J H;  3GD7 A;  2JA9 A;  3CCV A;  1HR0 Q;  1Q81 C;  1JT8 A;  1IYJ B;  3RN2 A;  4A3K H;  1SMX A;  1J5E Q;  2UUA Q;  2UXD Q;  1XMQ Q;  1P16 A;  2R7F A;  4X66 L;  3PUW A;  4XTC S;  4LF9 L;  1J6Q A;  1Q46 A;  2VQE Q;  4A3M H;  2BA0 A;  1R9T H;  1PH1 A;  4JI6 L;  3AYH B;  1S72 A;  3GTG H;  4R1J A;  1PYS B;  3M4O H;  4X66 Q;  3B6Y A;  2WB1 E;  3TRZ A;  4LF9 Q;  4LFB L;  1EOV A;  2IT1 A;  3KFU A;  5IYB G;  1QVF A;  1H95 A;  1PH5 A;  4JV5 L;  4LFB Q;  4LF6 L;  3AEV A;  2ZM6 L;  1O7I A;  5J3B A;  1V43 A;  3AFP A;  2RF4 A;  1SR3 A;  5IE8 A;  4DNI A;  4KHP L;  4JI5 Q;  1QZG A;  1VQ8 A;  4UP8 A;  1NJI C;  1L2F A;  2C35 B;  4GOP C;  3UDG A;  1SFO H;  1LUZ A;  4LNQ A;  2E2I H;  1E7Z A;  1AH9 A;  1KL9 A;  1EQQ A;  2VUM H;  1FVI A;  3CPF A;  4A93 G;  2AWN A;  2UXC L;  4NXM Q;  5C3E G;  1HNZ L;  1N8R C;  1A0I A;  1KIX A;  2NZH A;  3GTP H;  4HJ7 A;  3KJO A;  4POG A;  3F8T A;  2ATW A;  2R7D A;  2UXC Q;  4R4T A;  4JI2 L;  1XNQ L;  4GS3 A;  3EBE A;  4DR6 Q;  1K8A C;  2NVY H;  1C9O A;  1V9P A;  5IYC G;  3HOW H;  5IP9 G;  3D31 A;  4EQ5 A;  1N34 L;  4B3S Q;  1VQI A;  4DV4 L;  3ICE A;  3TQY A;  3M85 A;  4GKK L;  1K83 H;  1LYL A;  3W1B A;  2ZJR A;  3S1M H;  1VQP A;  4B3M Q;  1N34 Q;  5H1S E;  4DV4 Q;  4A3G H;  1T9H A;  1U0L A;  2QGQ A;  1N32 L;  1UE5 A;  1RIP A;  3JC6 6;  4JI1 Q;  4GKK Q;  4HJ9 A;  1CKN A;  1HNW Q;  4A3B H;  3KLW A;  1UEB A;  2WP8 J;  2EIF A;  3PIP A;  3I4M H;  4BXX G;  2RHQ B;  2CQO A;  2KBN A;  1N32 Q;  5LMU Q;  3KOJ A;  3GTM H;  1KHI A;  2K5V A;  4GN3 B;  3GTK H;  5BR8 Q;  1X3F A;  4AIM A;  2HHH L;  3HOU H;  1CKN B;  1Q1E A;  1U5K A;  4BY1 G;  1IBL Q;  2B29 A;  4HJ8 A;  1XNR L;  4BA2 I;  4OWW B;  4A3E G;  2YV5 A;  5M5Y H;  2HHH Q;  5JEA J;  3T1Y Q;  1VQF A;  5DLQ E;  4A3C G;  4FDB A;  2EQS A;  2CCZ A;  1IZ6 A;  4LUO A;  1PA6 A;  1Y1V H;  3I2Z A;  3HOV H;  4DR2 Q;  4APV A;  2A1A A;  4X65 L;  3I4N G;  2HT1 A;  1D7Q A;  4BY7 H;  1HZB A;  4JI7 L;  4DV2 Q;  4BBR H;  3K8A A;  4DV7 L;  1UE1 A;  3WWV A;  4PMW A;  4X65 Q;  5FLM G;  1L0W A;  1HR0 W;  1VQL A;  3H3V H;  4WJ4 A;  1JJC B;  1N36 Q;  3I56 A;  4DV7 Q;  2JE6 I;  1PH4 A;  3MXN B;  3TS0 A;  2Y0S G;  2R7Z H;  1Q8K A;  4IOC A;  3RZD H;  2IHF A;  2K14 A;  1VQA A;  4QJF A;  3UDI A;  3PIO A;  4DR7 Q;  4A3L H;  2BA1 A;  2K4K A;  4QIW E;  4JI3 L;  4OON A;  1Y1W H;  1XMO Q;  4DUY L;  2HQL A;  2I0Q A;  4DAY B;  4Y7N H;  3S24 A;  1CSQ A;  1YIT A;  4UY8 C;  4R4Q A;  1Q7Y C;  2K50 A;  2I5L X;  3HKZ G;  5C4X H;  2B63 G;  4JYA Q;  3ER0 A;  1I50 H;  1TWH H;  1NE3 A;  5JEA G;  4XIG S;  1G29 1;  1VQJ A;  1FJG Q;  3U4V A;  3S14 H;  3H3V I;  1XPU A;  2JA7 G;  4R4C A;  4OWX B;  1CKM A;  4P71 A;  2HIX A;  2I5M X;  4IPH A;  5GAD C;  1QVG A;  3NEM A;  2JA6 G;  3TS2 A;  1KXL A;  1RL2 A;  4A3J G;  2E5L L;  3L7Z C;  3FKI G;  2JEA I;  1PH7 A;  2VL6 A;  4WJ3 M;  2I5H A;  3CXC A;  3U4Z A;  2NN6 G;  5IP7 H;  2E5L Q;  4GN4 B;  4LF7 Q;  5C4J H;  1Q12 A;  2CKZ B;  2ZTE A;  4A3K G;  1W3S A;  5M3M H;  2JA5 G;  1MJE A;  1IBM L;  4LWC A;  3BU2 A;  3HOY H;  1WCM H;  2N78 A;  1HR0 L;  2OTL A;  4BBS H;  5M3F H;  1KD1 C;  4NXN Q;  4IOA A;  4P73 A;  2RHS B;  1ASZ A;  1IBM Q;  1G51 A;  1BBU A;  2UUA L;  2UXD L;  1X54 A;  1BBW A;  1SLJ A;  1XMQ L;  5K36 G;  1YJW A;  3W5O A;  1CUK A;  2VQE L;  1OXX K;  2R92 H;  3UDX A;  1HZA A;  1CKO A;  2KCT A;  4DKA C;  3PUX A;  4GN5 A;  5C44 H;  3J7A 5;  4IJH A;  1YJN A;  3A5Z B;  2A8V A;  1Q1B A;  1K3R A;  4X6A H;  3DM3 A;  3GDE A;  4LUV A;  4JI4 Q;  3PCO B;  2UXB Q;  4LW1 A;  1YHQ A;  4KI0 A;  2AWO A;  1BVS A;  3PF4 A;  3M4P A;  2K75 A;  3CCE A;  2VQF Q;  2VUM G;  1EIF A;  4JI5 L;  4OXP A;  3LGJ A;  4ME3 A;  1IXR A;  2A19 A;  3RLN A;  3UE0 A;  3OTO Q;  4A3F H;  4B3R L;  4X64 Q;  1GO3 E;  2ZTC A;  2VW9 A;  3MEF A;  2YTV A;  1WYD A;  1SRU A;  1YEZ A;  1OXT A;  3ZJY C;  1M1K C;  4JI0 L;  1LTL A;  2MQH A;  1B70 B;  4B3R Q;  4R4I A;  1B8A A;  4NXM L;  4UP7 A;  4GKJ Q;  3GTJ H;  3HOW G;  2MFI A;  2AKW B;  4A3I H;  4JI0 Q;  3M4Q A;  4OWT B;  2JA8 H;  4LF8 Q;  4JCV E;  3ULP A;  3EIV A;  1CSP A;  4J15 A;  3KF6 A;  2VZA A;  4DR6 L;  5M5W H;  5GAE C;  1NY4 A;  3EN2 A;  1E1O A;  1NMF A;  1P8L A;  1VQB A;  2L15 A;  1VQ7 A;  2LSS A;  4B3S L;  4A3G G;  4IFD I;  3GTL H;  1SE8 A;  5FJ8 G;  1EFW A;  3KYH C;  4LFA Q;  4A3B G;  2PI2 A;  2XTI A;  4DV0 Q;  4B3M L;  3KF6 B;  2UU9 L;  2WB1 G;  3BJU A;  3L0O A;  2F4V Q;  4JI1 L;  1HNW L;  2ASB A;  1C7Y A;  3HOU G;  5IYB H;  2UU9 Q;  3J81 c;  1VQ5 A;  5LMU L;  3J80 i;  4A3D G;  5BR8 L;  2QEX A;  2H5X A;  3BZK A;  1HJP A;  4GLX A;  1IBL L;  3CQZ H;  3D0F A;  3K80 C;  2ALY B;  5ELN A;  4B3T Q;  3HOV G;  2MNA A;  3I7F A;  1HNX Q;  1E22 A;  4AYB G;  3DLL A;  4HID A;  3T1Y L;  2Q2I A;  3HFZ B;  1PVO A;  1I94 Q;  1E3P A;  5GAH C;  1XPR A;  3HOX G;  1GM5 A;  4BY7 G;  1LM0 A;  1X65 A;  4LF5 Q;  1QUQ B;  4IPD A;  1X55 A;  2F3I A;  3T1H L;  1MKH A;  4IPC A;  4DR2 L;  3S1Q H;  3J80 c;  5C3E H;  2KEN A;  4JI8 Q;  1AE2 A;  3BZC A;  4TVA B;  1EIY B;  4DV1 Q;  1N33 Q;  3I4O A;  4A4I A;  1JB7 A;  4QQB X;  2Q2H A;  1EYG A;  2NVQ H;  1FL0 A;  4DV2 L;  3T1H Q;  1QZH A;  3PO3 H;  4OO1 I;  5IWA Q;  3CAM A;  4A3L G;  3KF8 B;  4UPA A;  1Q86 C;  1TXY A;  3CCL A;  2OQ0 A;  3H0G G;  1TWF H;  5IP9 H;  2R6G A;  3PUZ A;  1Y1W G;  1N36 L;  1SRO A;  3U58 A;  2PQA A;  3AQQ A;  1HZC A;  1XPO A;  3CC7 A;  1KRS A;  5C4X G;  4GLA C;  2ZTD A;  4DR7 L;  3E0E A;  2K5N A;  2NVX H;  1PH3 A;  5C0X I;  1XMO L;  1WJJ A;  1EQR A;  3S1N H;  3E9H A;  5JJK A;  4BXX H;  1XJV A;  2PQA B;  3I55 A;  2JQO A;  1VQN A;  4KHZ A;  4JYA L;  3HOZ G;  1YI2 A;  1YBY A;  3M9B A;  2QA4 A;  1FJG L;  3ULL A;  1E24 A;  4R4O A;  3IRB A;  1Q82 C;  2CWA A;  2OQK A;  1JE5 A;  1HH2 P;  4GLV B;  5E7N A;  4A3E H;  4IFD J;  5GQO A;  1OXV A;  2EXD A;  1VQ9 A;  4YY3 L;  2JEB I;  3K7A H;  5M3M G;  4X62 Q;  2AMC B;  4LUZ A;  1A8V A;  1K9M C;  3M7N A;  4LF7 L;  3HOY G;  2Q2T A;  4IO9 A;  2DGY A;  1YIJ A;  2R93 G;  4YY3 Q;  4BBS G;  1V1Q A;  1I5F A;  1TWC H;  1OTC A;  4DR3 Q;  4TQU S;  3U50 C;  3I4N H;  2D0O A;  1UE6 A;  4DUZ Q;  3J81 j;  4RG1 A;  1KQS A;  2BH2 A;  2UUC Q;  4YWL A;  2GN5 A;  4C2M H;  1WI5 A;  3CF5 A;  2WFW A;  4IPG A;  1PH9 A;  5FLM H;  2ES2 A;  4NXN L;  2R92 G;  1VQH A;  3K81 C;  4EX5 A;  3JAM c;  1DGS A;  2V1C C;  4A3M G;  3GTO H;  5FLX c;  2N3S A;  1Y14 B;  4L5R C;  2OTJ A;  1VQC A;  3CCM A;  5GRO A;  2E2H H;  4MNO A;  5LMN Q;  4MZ9 A;  2PNH A;  3A0J A;  2LXK A;  2MO0 A;  4YHH Q;  4YCV A;  1UE7 A;  1NTG A;  3F2B A;  4ALP A;  4DK6 C;  4LFC Q;  1Z9F A;  2B63 H;  4IFD G;  4JI4 L;  4NPS A;  2KHJ A;  2UXB L;  3S15 H;  4HJ5 A;  1G6P A;  1YVC A;  2VQF L;  1PV4 A;  4GNX C;  4DR5 Q;  3F2C A;  1KAW A;  1PFS A;  2WAQ G;  4NB3 A;  3NBH B;  4DR1 Q;  5IYD H;  3STB C;  3OTO L;  2K5H A;  4X64 L;  1JJG A;  3OYY A;  3FKI H;  1TWG H;  3S2D H;  4A3I G;  2JA8 G;  4K0K Q;  3HKS A;  3OW2 A;  2PMZ E;  2D0P A;  1GD7 A;  5C0X J;  1VQD A;  2D62 A;  3PO2 H;  4GKJ L;  3CCR A;  4A75 A;  2AHO B;  4POF A;  4DV3 Q;  3UE1 A;  4H02 A;  2JA5 H;  3F1Z A;  3UDF A;  1JJ2 A;  4LF8 L;  5JJI A;  4L5T A;  3CCU A;  3KJP A;  4A76 A;  4GNX A;  1Z47 A;  4DAM A;  3S1R H;  3G4S A;  2IX1 A;  3G48 A;  1E1T A;  1OXS C;  3J81 i;  1WOC A;  4YWK A;  2YYZ A;  3RLF A;  4QGU A;  1IBK L;  4LFA L;  4JI6 Q;  3CCS A;  4DV0 L;  4DR4 L;  2XGT A;  3TEH B;  1NBW A;  4GNX B;  2ZJP A;  2NN6 I;  2E8G A;  3STB D;  4PG3 A;  1S40 A;  1VQM A;  2F4V L;  1IBK Q;  3TRE A;  2OCE A;  1VS0 A;  3I4M G;  4DR4 Q;  4OO1 G;  4JBK A;  1KC8 C;  2RCN A;  5HY6 A;  4RMF A;  1ASY A;  3RZO H;  2YTX A;  4JV5 Q;  3PSI A;  4LF6 Q;  2ZM6 Q;  3PF5 A;  3FHW A;  1EUJ A;  2KHI A;  3SGI A;  1PYB A;  4AYB E;  3NEN A;  4KHP Q;  1QVC A;  1N9W A;  2JJQ A;  3ERS X;  4DV5 L;  4HJA A;  4O2D A;  5C0X G;  4B3T L;  3G6E A;  3W1G A;  1HNX L;  2HIV A;  1QUQ A;  2FXQ A;  4HIO A;  1I94 L;  3CP0 A;  4QL5 A;  4L5Q A;  1X56 A;  2DUD A;  3K7U C;  4DV5 Q;  3FP9 A;  1Y1V G;  3CW2 C;  4LF5 L;  3PO3 G;  4JG2 A;  1HNZ Q;  5HGQ A;  3AFQ A;  4JI8 L;  3ULJ A;  1W2B A;  4LF4 L;  1HZ9 A;  4JBM A;  4DV1 L;  1N33 L;  4BBR G;  3A74 A;  4GOP A;  1YJ9 A;  4QY7 A;  4JI2 Q;  1XNQ Q;  3VDY A;  4A93 H;  5IWA L;  2ZJQ A;  1VCI A;  4MTN A;  4LF4 Q;  2CFM A;  4IJL A;  1OXU A;  3RLO A;  2MO1 A;  2R7Z G;  3S17 H;  4Y52 H;  4GOP B;  5FJ8 H;  2YU9 H;  2GVB A;  5IT9 c;  2Y0S E;  4C3I H;  2N49 A;  3E9I A;  1I6H H;  1FGU A;  5IYC H;  2IHE A;  4HIK A;  1VQK A;  3GO5 A;  1UWV A;  3CC2 A;  5IY0 A;  5LMN W;  4PZ6 A;  4HIM A;  2Z6K C;  1M90 C;  4AH6 A;  2KCM A;  4P74 A;  3HKZ E;  4YCW A;  2OWO A;  3PGZ A;  4A3D H;  2NVT H;  1X6O A;  1K8G A;  1EWI A;  3A5U A;  1YZ6 A;  1XNR Q;  2YTY A;  1MIU A;  4O0A A;  1KRT A;  3H15 A;  2F52 A;  1PH6 A;  1VQG A;  4JC0 A;  1YHB A;  1VQ4 A;  4PZ7 A;  3G71 A;  4BY1 H;  1K0R A;  3RR5 A;  1K73 C;  3PUV A;  3HOX H;  1L1O C;  2GVA A;  4KLK A;  3PV0 A;  5IP7 G;  2ID0 A;  4X62 L;  4C3J H;  5M5X H;  4AQY L;  2Z6K A;  3S16 H;  2VS1 A;  1PHJ A;  1PH8 A;  4YWM A;  3S2H H;  3JAM i;  1I3Q H;  4DR3 L;  4JI7 Q;  3NEL A;  4A3C H;  1AE3 A;  2VNU D;  3CPW A;  2Q2U A;  2IY5 B;  4DUZ L;  4AQY Q;  1WCM G;  3CD6 A;  3M3Y H;  2UUC L;  4P75 A;  4UP9 A;  5M3F G;  4OX9 L;  2N8N A;  3H0G H; 
#chains in the Genus database with same CATH topology
 1O80 A;  2UUB L;  4BA1 I;  4CDD C;  3VR3 A;  1EY4 A;  2PI2 E;  1VQE A;  3D4W A;  3U9O A;  1C8C A;  1L1O A;  3VA7 A;  5ELO A;  2B2T C;  5AJ3 L;  4DUY Q;  4L5S A;  5C44 G;  1SE4 A;  4I7Z C;  4O1N A;  3T56 B;  3CCJ A;  2L1B A;  5EAY A;  2R7Z B;  2B2W C;  4I7A A;  5IYD G;  2CWP A;  5E4X A;  3LX0 A;  3KDF B;  2WAQ E;  3MFY A;  2K7V A;  3Q23 A;  3O13 A;  4DR5 L;  3KLR A;  3L2P A;  2SNM A;  1CHP D;  4V0B A;  2DJG C;  4ZUJ A;  1RF2 D;  1DON A;  1SNP A;  1C0A A;  4A3E B;  4JBJ A;  5C4Z A;  1KDA A;  4HMJ A;  4IZ8 A;  3J7Z C;  4IUP A;  4X3T A;  1WTV A;  2KQ3 A;  4JOI A;  1EY8 A;  2EY6 A;  3CCV A;  4EQN A;  1EZ6 A;  2UUA Q;  1ESR A;  2UXD Q;  2R7F A;  4X66 L;  2NUC A;  4L8J A;  4OEL B;  2EYM A;  1PLF A;  1S72 A;  4R1J A;  1PYS B;  3M4O H;  3TRZ A;  3AU7 A;  2WB1 E;  3B6Y A;  5ELF A;  4LF9 Q;  1HFN A;  2IT1 A;  2EYF A;  5IYB G;  5HGT A;  3E0J A;  5IGE A;  1PH5 A;  4IFD H;  4JV5 L;  2B63 B;  5J3B A;  5EPL A;  1GOZ A;  1L2F A;  4GOP C;  3UDG A;  4KJN A;  3N52 A;  1E7Z A;  3OW7 A;  1STH A;  1SYD A;  3CPF A;  4FF1 A;  4A93 G;  3S2D B;  2Z4H A;  1DZ1 A;  1A0I A;  2OEO A;  3ND9 A;  2CH4 A;  3GTP H;  1V8Q A;  1PFB A;  1TKW B;  4K6L A;  4R4T A;  1XNQ L;  2UXC Q;  2F0I A;  5IYC G;  3D31 A;  1N34 L;  1Q90 A;  1LYL A;  2ZJR A;  4B3M Q;  4A3G H;  1U0L A;  2RBM A;  1HNW Q;  1CKN A;  1WTH A;  2KOL A;  1N32 Q;  1QNU A;  2KBN A;  4KD4 A;  4CKB A;  4ULL A;  1SND A;  3HOU H;  2HHH L;  3RZO B;  4PNY A;  1U5K A;  2F0O A;  1F77 A;  2B29 A;  2JXM B;  3TBI B;  2B2U C;  5JEA J;  3T1Y Q;  2B8G A;  4QB4 A;  4A3C G;  4NMZ A;  1XX8 A;  2Q8R E;  2EQS A;  1LAC A;  3I2Z A;  4DXG A;  5EKL A;  1H9M A;  3MXN A;  3TZD A;  4JI7 L;  3K8A A;  2GA4 B;  4L6T B;  4V19 0;  4WJ4 A;  1U4M A;  3H3V H;  2I07 B;  5CV7 A;  1N36 Q;  2Y0S G;  4IOC A;  4QJF A;  3SE0 A;  3S17 B;  4H7B A;  3C1F A;  1Y1W H;  1XMO Q;  4M1U B;  4C3I B;  4DUY L;  2I0Q A;  4Y7N H;  1I6H B;  5ELE A;  1Q7Y C;  1EQT A;  1SNQ A;  2K50 A;  3NPP A;  5C4X H;  1IHZ A;  3ER0 A;  3C1E A;  2K5W A;  5JEA G;  1LTR D;  3QJY A;  1G29 1;  4RWS C;  2XRS D;  5KYL A;  1XPU A;  4OWX B;  4LMQ D;  5GAD C;  4P71 A;  4LK1 C;  4IPH A;  1G91 A;  2QIL A;  3TS2 A;  5NUC A;  4A3J G;  3W2D A;  3FKI G;  2JEA I;  2Q8I B;  2LS0 1;  2VL6 A;  1WTR A;  1JWU D;  1RTN A;  3CXC A;  3VYT A;  4RH6 A;  1C48 A;  2RKS A;  1STN A;  1PFN A;  5T1I A;  1IYU A;  2ZTE A;  5M5X B;  4FYD A;  5T1G A;  2JA5 G;  1D6E C;  4LWC A;  4Z9C B;  3S2H B;  5FK9 C;  1WCM H;  2N78 A;  1I3Q B;  3K5O A;  3FVQ A;  4P73 A;  1ASZ A;  1IBM Q;  3M3Y B;  1GUG A;  1BBU A;  3JAM L;  2UUA L;  2UXD L;  1S5B D;  1YJW A;  1CUK A;  5EQ0 A;  4K5V A;  1HZA A;  1CKO A;  1MD2 D;  1FNV A;  5C44 H;  3J7A 5;  1D2B A;  2RCF A;  3A5Z B;  3W3A A;  4BWG B;  2V4D A;  1YHQ A;  4KY7 A;  2K75 A;  3CCE A;  1GUW A;  4ME3 A;  3RLN A;  3UE0 A;  3A54 A;  4XDX A;  1IKM A;  2CW0 D;  4RHS A;  5AFW A;  2XSC A;  2F0T A;  2MQH A;  4UAI A;  4B3R Q;  1Z7T A;  2MHV A;  4R4I A;  2MFI A;  4A3I H;  4JCV E;  5DNF A;  4J15 A;  4KJO A;  3KF6 A;  2FMM A;  4UHV A;  1E1O A;  1NMF A;  3VYR A;  4RCN A;  4KV6 A;  1EOT A;  1SE8 A;  1I4G A;  1EFW A;  2R61 A;  1JQY D;  4B3M L;  4QMG A;  2C9O A;  5JPN C;  2F0J A;  1E2Z A;  3L0O A;  4R8I A;  2F4V Q;  3FPU B;  1HNW L;  5IYB H;  3M4O B;  3CRL C;  2ZXP A;  1VQ5 A;  1STA A;  4A3D G;  2RVL A;  4B3T Q;  2EY1 A;  3HOV G;  2MNA A;  4HID A;  3T1Y L;  3HFZ B;  4FP5 D;  1EWH A;  1E3P A;  1XPR A;  4BY7 G;  1RJT A;  3ITP A;  4FF4 A;  2BDO A;  1AE2 A;  3BZC A;  1N33 Q;  1STB A;  3TP8 A;  4A4I A;  1JB7 A;  2PO4 A;  1FL0 A;  2VB3 X;  3T1H Q;  1BBX C;  2F0K A;  1UAP A;  2F0L A;  1A2U A;  3CCL A;  1TWF H;  3MC0 B;  3PUZ A;  1N36 L;  4KD3 A;  5D14 A;  4F7X A;  1KRS A;  1TU2 B;  2K5N A;  2F0E A;  4IUT A;  1XMO L;  3D6C A;  3S1N H;  4A3G B;  1XJV A;  1STG A;  2JQO A;  1PDQ A;  4KHZ A;  1YI2 A;  1WTP A;  3GV3 A;  5C5M A;  4K2L A;  1TS5 A;  4HED A;  1HCZ A;  2OQK A;  3HOU B;  1DXM A;  1D5Z C;  1Y8O B;  1SBB B;  2JEB I;  5M3M G;  1HPC A;  1QJO A;  1BUV T;  3M7N A;  3P1H A;  5COY A;  2R93 G;  2Z4I A;  4YY3 Q;  4BBS G;  1V1Q A;  1I5F A;  4DR3 Q;  2PQE A;  3U50 C;  4DNT B;  3DXJ C;  3J81 j;  2UUC Q;  4YWL A;  4C2M H;  1WI5 A;  3TME A;  1RD9 D;  4IPG A;  2ES2 A;  1HTL D;  1QCB D;  5I9P A;  1ESF A;  5CYU A;  4A3M G;  3GTO H;  2CW0 C;  5C3X A;  1VQC A;  3P20 A;  5GRO A;  3HRZ C;  1XYI A;  2E2H H;  2K6A A;  2LXK A;  4YHH Q;  1Y1W B;  4LFC Q;  3F2B A;  3GTQ B;  5LL6 S;  4DK6 C;  5FO8 B;  4Y7N B;  4O42 A;  4NPS A;  2KHJ A;  3KLS X;  5JEA H;  5C4X B;  2QDL A;  1LTB D;  3S15 H;  3L3O C;  1YNN D;  1UUP A;  2A69 D;  1WTX A;  1YVC A;  5KRU A;  4P2C B;  1SNM A;  3TZU A;  3FKI H;  1TWG H;  2N88 A;  3HOZ B;  2F4I A;  3MFG A;  2KEE A;  1GD7 A;  2VB2 X;  3PO2 H;  1HA5 A;  1VF7 A;  4POF A;  1II3 A;  1AZP A;  2JA5 H;  3UDF A;  4DAM A;  1EIG A;  1S4Z A;  2O2L D;  3RLF A;  5A2Q E;  3EVQ A;  3TEH B;  1NBW A;  3OMG A;  4GNX B;  4NW2 A;  2F4V L;  1TS4 A;  1VQM A;  3C2P A;  3TRE A;  2OCE A;  3TN2 A;  3I4M G;  4DR4 Q;  1ML0 D;  4RMF A;  5C44 B;  2YTX A;  3PSI A;  1EY9 A;  2ZM6 Q;  3PF5 A;  1SYC A;  4QIW B;  4RGT A;  2F0V A;  5CMD A;  4KHP Q;  1N9W A;  2ICI A;  4DV5 L;  4B3T L;  2FXQ A;  1SDF A;  4U67 3;  4L5Q A;  2DUD A;  3FP9 A;  1Y1V G;  3R8B A;  4ZQ3 A;  4JPB W;  1HZ9 A;  2WAQ B;  1N33 L;  1EY5 A;  1SYG A;  4JI2 Q;  3VDY A;  4S3S A;  1VCI A;  4A3I B;  3NTI A;  3KUP A;  4IJL A;  2PPB C;  1CFM A;  4Y52 H;  5I2Y A;  4CKE A;  3V2T A;  2XVS A;  5LMN W;  4PZ6 A;  2PNR C;  4A3D H;  2NVT H;  2RSO A;  2I46 A;  3A5U A;  2M2L A;  1XNR Q;  5EBC A;  4O0A A;  5JOB A;  1VQG A;  1YHB A;  3P7J A;  1IYV A;  5IGD A;  4PZ7 A;  5KGU A;  4BY1 H;  1K0R A;  3VR5 A;  1L1O C;  2GVA A;  5IP7 G;  4C3J H;  3S16 H;  2VS1 A;  2G5D A;  3OPO A;  1HQM C;  3JAM i;  4DR3 L;  1HA6 A;  3TP6 A;  5KIX A;  2UUC L;  5M3F G;  5J39 A;  1YNN C;  2BCO A;  3K59 A;  2NWG A;  3CMA A;  4CGY B;  5JJL A;  2LXJ A;  3VR4 A;  1TWF B;  1LT3 D;  1S3O A;  1XTD A;  3K0X A;  1EYC A;  1GKH A;  4JI3 Q;  3MVV A;  5JJZ A;  2UUB Q;  3DWA A;  4PZ8 A;  4C3H H;  1YNX A;  1YHA A;  4LFC L;  5K5P A;  4YHH L;  1MGS A;  5AJ3 Q;  3S1N B;  1ZYR D;  4JOI C;  1BKB A;  3J7Y W;  1X9N A;  5CR3 A;  1D8L A;  4OGQ C;  3CME A;  4G7O C;  1GVP A;  3K6O A;  3NBI A;  1A62 A;  4A3F G;  1TWA H;  4P72 A;  3MXP A;  1CT1 D;  2IX3 A;  3CCQ A;  3Q8D A;  2JA7 H;  3BZD B;  2Z0S A;  2K52 A;  4OIK A;  2JA6 H;  4DPG A;  1IL2 A;  3OHX C;  1JMC A;  2IX0 A;  1WFQ A;  1V1P B;  2JK8 A;  5I4D A;  2R93 H;  1A63 A;  1PH2 A;  5ISR A;  2BH8 A;  4CJ1 B;  2E2J H;  1SE3 A;  2MJ8 A;  3J7A F;  1Q81 C;  3R2T A;  1IYJ B;  3RN2 A;  5CV5 A;  1NUC A;  2EYJ A;  4C2M B;  5DEH A;  3R2I A;  2F0W A;  3X3N A;  1Y8N B;  2LMC B;  4A3M H;  2B2V A;  5COR A;  1B9M A;  3F2U A;  4X66 Q;  5K36 H;  3WOF A;  2E2D C;  2O4X A;  1U4L A;  2E2H B;  2WKD A;  4C56 C;  2HQE A;  2P5Z X;  2ZM6 L;  4IAL A;  1O7I A;  2PZU A;  1JOR A;  1SR3 A;  4KHP L;  4JI5 Q;  1QZG A;  3S15 B;  5FO9 B;  1K28 A;  3J7A V;  2C35 B;  3S9W A;  1LUZ A;  2MUY A;  3GP7 A;  1KL9 A;  1EQQ A;  2VUM H;  2AWN A;  1K8O A;  4NXM Q;  1FR3 A;  4DNR B;  4DN4 M;  2NZH A;  3KJO A;  4POG A;  3F8T A;  2ATW A;  2R7D A;  3PO2 B;  4JI2 L;  4IUV A;  4GS3 A;  1K8A C;  4E6I A;  3VR6 A;  3HOW H;  2JA5 B;  3V96 A;  2NB0 A;  3ICE A;  1CI3 M;  4GKK L;  3C3L A;  5E3F A;  1VQP A;  3S1M H;  1LTT D;  1N34 Q;  2JSO A;  3JC6 6;  1F2L A;  3LWE A;  2IJ0 A;  4C1N I;  3PIP 3;  4A3B H;  2WP8 J;  3I4M H;  2CQO A;  3GQB A;  3KOJ A;  1ILP A;  4F87 A;  1X3F A;  3QIA A;  1Q1E A;  3QO2 A;  2F0Q A;  1XNR L;  3QB3 A;  1LTI D;  1AFP A;  4BA2 I;  2H4O A;  1SAP A;  2YV5 A;  3ND8 A;  2HHH Q;  5DLQ E;  3H91 A;  4FDB A;  1LV9 A;  2PYK A;  3FPP A;  1Y1V H;  4APV A;  1TS3 A;  3I4N G;  1D7Q A;  3M7G A;  1HZB A;  3TSS A;  3LWU A;  4DV2 Q;  1BR9 A;  3VYU A;  4DV7 L;  1ZYR C;  4CHT B;  1UE1 A;  2N55 A;  4EVO A;  1HR0 W;  3MZ5 A;  5CV6 A;  1AZQ A;  3I56 A;  1FGB D;  5C3E B;  2JE6 I;  1PTO F;  1XTC D;  1QG7 A;  2F0N A;  2HDM A;  2IHF A;  1VQA A;  4DR7 Q;  4A3L H;  3DM1 A;  4QIW E;  4JI3 L;  2Z6B A;  4DAY B;  3S24 A;  1B44 D;  4R4Q A;  1I50 H;  1TWH H;  1FJG Q;  4YIJ A;  2NVT B;  2HIX A;  1QVG A;  3NEM A;  2E5L L;  5EJW A;  5IT9 E;  1H9S A;  1W6K A;  4LF7 Q;  5IP7 H;  4BY1 B;  5C4J H;  1Q12 A;  2CKZ B;  4RGN A;  4A3K G;  4C3J B;  1W3S A;  3BU2 A;  2Z8L A;  2OTL A;  5M3F H;  4IOA A;  3URY A;  4F8M A;  1SXT A;  1G51 A;  2A68 C;  2F0F A;  3OIQ A;  1CQV A;  2R92 H;  3UDX A;  2A6H D;  5JAV A;  3PUX A;  3FRP B;  3NWS A;  1K8M A;  1O78 A;  4IQZ A;  5BN5 A;  4X6A H;  3HP3 A;  5DM7 3;  4LUV A;  4JI4 Q;  4C3H B;  4LW1 A;  3PF4 A;  3A8K E;  1IW7 D;  3M4P A;  3FMC A;  4JI5 L;  1B4O A;  4A3F H;  1DCZ A;  3HKZ B;  1GO3 E;  2ZTC A;  2VW9 A;  2YTV A;  3ZJY C;  4DK1 A;  1OXT A;  3T4A C;  1TWA B;  1M1K C;  3CRK C;  1B70 B;  2JA7 B;  4NXM L;  1HXY D;  3I3C A;  4GKJ Q;  4WOR A;  1B3A A;  4CDE C;  2AKW B;  1F9R A;  2JA6 B;  1I4X A;  4OWT B;  2JA8 H;  1D5M C;  2K05 A;  5JVG 3;  3CU7 A;  4KK7 A;  2E2J B;  1NY4 A;  1P8L A;  4KMU C;  2LSS A;  3U9S A;  1JC7 A;  2AQ2 B;  2J4X A;  5IGG A;  4LFA Q;  2PI2 A;  2B2Y A;  3I4L A;  4DV0 Q;  1EEI D;  3NK9 A;  2WB1 G;  3E6Z X;  1RTO A;  4H44 C;  4A3M B;  4IN3 A;  3J81 c;  1EWC A;  2QEX A;  4ME5 A;  4OO1 H;  2OF1 A;  2RDH A;  3A7L A;  4ODG A;  3D0F A;  2ALY B;  4MTK A;  3OOC A;  3I7F A;  1E22 A;  2J0T D;  1GM5 A;  3HOX G;  1LM0 A;  3SHL A;  4IPD A;  1X55 A;  5I6Y A;  3S1Q H;  3KF8 A;  2H1E A;  1LTS D;  4JI8 Q;  2VUM B;  2D9U A;  4TVA B;  2L5T A;  4DV1 Q;  3I4O A;  2SNS A;  4QQB X;  1UEA B;  2Q2H A;  3IFT A;  1EYG A;  3QG1 A;  4DV2 L;  1HUM A;  2NVQ H;  3PO3 H;  4J1M A;  3CAM A;  1B2T A;  1KLU D;  1S5C D;  1TXY A;  3L9A X;  1B9N A;  3KBX A;  1SRO A;  4HSV A;  4XXE A;  3HOW B;  3U58 A;  2PQA A;  3AQQ A;  2KED A;  5CBA E;  3CC7 A;  1XPO A;  4DR7 L;  5IIF A;  2MGS A;  5C0X I;  1DJR D;  3S1M B;  1NNX A;  1EQR A;  3R93 A;  1VQN A;  3I55 A;  2EJG C;  4A3B B;  2LY7 A;  1FJG L;  3EJI A;  3NQT A;  5C6A A;  1JE5 A;  1HH2 P;  4CJ2 C;  2KEC A;  2EXD A;  3K7A H;  4X62 Q;  1AN8 A;  2AMC B;  4LUZ A;  2EZV A;  1K9M C;  4LF7 L;  2A6H C;  3HOY G;  4WFN 3;  2DGY A;  2JN4 A;  1TWC H;  2B39 A;  1OTC A;  3I4N H;  2D0O A;  3R3O A;  1UE6 A;  2BH2 A;  2WFW A;  1PH9 A;  4K14 A;  1IW7 C;  2EE1 A;  2QDB A;  1SMY D;  1VQH A;  1ZKO A;  4KHV A;  3OMC A;  1H9J A;  3I72 A;  3J80 E;  3SXH A;  1Y14 B;  1E2W A;  4MNO A;  2A6E C;  5DAU A;  5LMN Q;  2K01 A;  3X3M A;  2E75 C;  3MTS A;  1EQV A;  4JI4 L;  1KNA A;  1A6X A;  2SOB A;  2PW7 A;  1I50 B;  1TWH B;  3QOJ A;  3F2C A;  5IYD H;  4NB3 A;  3NBH B;  3STB C;  2K5H A;  1JJG A;  3NE5 B;  4DFA A;  4U68 A;  3BDO A;  1B1Z A;  5IOD A;  4K0K Q;  3IKJ A;  5C0X J;  1VQD A;  3K5N A;  4GKJ L;  1Q3L A;  3A8J E;  1PZI D;  2AHO B;  4RKL A;  3CKI B;  4DV3 Q;  2EYL A;  4H02 A;  3F1Z A;  5C4J B;  1JJ2 A;  2K28 A;  4A76 A;  4DA2 A;  1VDZ A;  1Z47 A;  1GJX A;  3S1R H;  1L0Y B;  2IX1 A;  4LFA L;  2YYZ A;  3H09 A;  3D8G A;  3MA2 B;  4DV0 L;  2NN6 I;  3I90 A;  1EU3 A;  2R92 B;  5E4W C;  1TY0 A;  3JAM E;  2XWJ B;  1PYB A;  5FLX E;  4HAE A;  3BYT B;  3ERS X;  1NSN S;  5C0X G;  1W6J A;  2K33 A;  5G3L F;  1QUQ A;  5KNB A;  2WV6 D;  4QL5 A;  1X56 A;  4A3F B;  4DV5 Q;  2EYO A;  4HCE A;  4JK1 C;  4JI8 L;  1IKL A;  4LF4 L;  4JBM A;  4DV1 L;  3KK7 A;  4GOP A;  4EQO A;  4QY7 A;  4A93 H;  2K5Q A;  2ZJQ A;  1A3T A;  2JA8 B;  2JP1 A;  1OXU A;  1I4H A;  2R7Z G;  1DM0 B;  3GTP B;  5IT9 c;  2MPM A;  3E9I A;  1SNC A;  5IYC H;  2IHE A;  3BG3 A;  1PTO H;  3MXU A;  2KCC A;  1UWV A;  3CC2 A;  4HIM A;  4P74 A;  3HKZ E;  2ENB A;  3PGZ A;  1FYC A;  1SYB A;  4J6H A;  2YTY A;  1SMY C;  4R8N A;  1VQ4 A;  1YNJ D;  1K0S A;  4FXK C;  3G71 A;  4XYO A;  1K73 C;  3HOX H;  1HFG A;  1SJH D;  4X62 L;  4RAU C;  3E5S A;  1PXU A;  2Z6K A;  2PW5 A;  1PHJ A;  4YWM A;  3A56 A;  3UI2 A;  4RHR A;  4A3C H;  3S1Q B;  2KA7 A;  2F03 A;  3MEH A;  3D4R A;  3I73 A;  4OX9 L;  1KDB A;  2NVQ B;  3PO3 B;  1EY6 A;  3NTH A;  1OXS C;  1GUT A;  5EGT A;  1D5X C;  1SYE A;  2RDF A;  2VY3 A;  4KN7 C;  3KDF A;  3F2D A;  2B3G A;  4DK3 C;  1LO5 D;  5LMN L;  4JBW A;  4DV6 L;  1L1O B;  1SJE D;  1ET6 A;  2SDF A;  1SN8 A;  5EPK A;  1QNK A;  5A2Q L;  3CC4 A;  1H9S B;  2B2V C;  5D3D A;  4K0K L;  2L0C A;  4I65 A;  4A3J H;  3K7A B;  3PUY A;  2L55 A;  4DV3 L;  1J5E L;  1TWC B;  2L4N A;  3HS0 C;  1HR0 Q;  1JT8 A;  4ZLT F;  1GUO A;  3KBG A;  1PMR A;  1XMQ Q;  1P16 A;  3PUW A;  4Q0F A;  1J6Q A;  2VQE Q;  1R9T H;  1T5E A;  1PH1 A;  1WCM B;  3GTG H;  5LHY 1;  4LFB L;  1EOV A;  3KFU A;  1CZG A;  3ONA B;  1QVF A;  4JW0 A;  3C46 A;  1H95 A;  4ZCK A;  4ID6 A;  3G6J B;  4DNI A;  3E3X A;  4UP8 A;  1B3Q A;  1NJI C;  4CKC A;  1SFO H;  4LNQ A;  2E2I H;  1AH9 A;  4TSS A;  1ROD A;  1RCV D;  4KN4 C;  1FVI A;  1KTK A;  1STE A;  1ENC A;  3FDT A;  3P75 A;  4K8I A;  3BDL A;  3EBE A;  2XWB B;  4C3I G;  2NVY H;  1C9O A;  1V9P A;  4X3S A;  5IP9 G;  4B3S Q;  2K03 A;  4DV4 L;  1QE6 A;  3TQY A;  5C4H A;  1K83 H;  3S1R B;  1YNJ C;  5KEE A;  1T9H A;  3K58 A;  2QGQ A;  4QUF A;  4JI1 Q;  4GKK Q;  4HJ9 A;  3KLW A;  1UEB A;  4TRD A;  4OIJ A;  4F88 A;  2RHQ B;  3J81 L;  3BVZ A;  5LMU Q;  2OXP A;  1KHI A;  4GN3 B;  3GTK H;  2L11 A;  4AIM A;  2G9H D;  1CKN B;  4HJ8 A;  1BXT A;  2BOS A;  1EEF D;  2BE5 C;  4OWW B;  1JWM D;  4PMB A;  5C0X H;  5FOB B;  5M5Y H;  3N6R A;  2A73 B;  1V1O A;  3Q22 A;  2CCZ A;  1MSH A;  4LUO A;  1D1I A;  5ELD A;  3HOV H;  4RGM A;  3RD4 A;  4K6D A;  4XQJ A;  2A1A A;  4X65 L;  2HT1 A;  4BY7 H;  2DY7 A;  4G7Z C;  1Y69 U;  5FLM G;  1L0W A;  1VQL A;  4A93 B;  1LT6 D;  4DV7 Q;  1NR2 A;  1PH4 A;  4HN7 A;  1SSO A;  2FFK B;  3MXN B;  3TS0 A;  1Q8K A;  2R7Z H;  2F0U A;  1R4Q B;  2K14 A;  3UDI A;  4ZKB B;  4IUU A;  2BA1 A;  4OON A;  2EY5 A;  1ICW A;  1JCK B;  1YIT A;  4UY8 C;  2FIN B;  1PTO D;  4JYA Q;  1PTO B;  2K5D A;  1NE3 A;  4XIG S;  3H3V I;  1JR0 D;  5E1F A;  2X6L A;  1F9S A;  1CKM A;  2X6G A;  2I5M X;  1KXL A;  1HQR D;  1RL2 A;  3CHB D;  3DWP A;  4WJ3 M;  1F2Y A;  2I5H A;  3SK4 A;  4QCL A;  2WAC A;  2E5L Q;  1TT2 A;  3HOX B;  2CHB D;  1ET9 A;  5M3M H;  4ILW A;  1VMC A;  1MJE A;  1DD2 A;  1E0B A;  2CQA A;  1HR0 L;  4BBS H;  1KD1 C;  3QOL A;  2RHS B;  2FMC A;  3I91 A;  1G6Z A;  1XMQ L;  1SLJ A;  3DEO A;  1CTM A;  4OHJ A;  4ZUI A;  1LAB A;  2VQE L;  1OXX K;  1U4R A;  1STY A;  4ABN A;  1DYQ A;  4GN5 A;  4IJH A;  3VYS A;  1GHK A;  1Q1B A;  1K3R A;  3GDE A;  2Y0S B;  1F9Q A;  2C5C A;  3Q24 A;  3GTO B;  3T53 B;  1ONL A;  2AWO A;  1BVS A;  3I8Z A;  4RKB A;  1HRJ A;  1EIF A;  1JB3 A;  1IXR A;  1BNZ A;  4X64 Q;  2IPK D;  4NDX A;  1WYD A;  1YEZ A;  2B2Y C;  4KTA A;  3HGB A;  4JI0 L;  1J8I A;  2A68 D;  3NP8 A;  4UP7 A;  2NYZ D;  3GTJ H;  1UNS A;  2XNA C;  1TVX A;  4A3J B;  3M4Q A;  3FKI B;  3PMF A;  1JIC A;  1TWG B;  2QEJ C;  3ULP A;  1CSP A;  1PRT F;  2VZA A;  2AUK A;  4PMC A;  1I4R A;  1VQ7 A;  1XXG A;  4HTH A;  4A3G G;  1VQB A;  2L15 A;  4HCS A;  4B3S L;  2IWH A;  1HUN A;  3GTL H;  4DGZ A;  3K5L A;  3HZX A;  2NZ1 D;  3KF6 B;  1JWS D;  3VR2 A;  2UU9 L;  5J22 A;  4JI1 L;  1KLG D;  3HOU G;  3GTG B;  4DF7 A;  3G7L A;  5LMU L;  1ICF B;  3OIP A;  1OO9 B;  2H5X A;  3SDZ A;  5EBD A;  4GLX A;  3K80 C;  2DN8 A;  1FNW A;  3BDC A;  1EIH A;  4OL7 A;  4AYB G;  4K5W A;  2Q2I A;  1WD0 A;  5GAH C;  1QUQ B;  5HUR A;  2E2I B;  1MKH A;  2KEN A;  3Q6S A;  2PCF B;  1PTO C;  1G8Z D;  1QZH A;  5BN3 A;  1B53 A;  5IWA Q;  2KHS A;  3V05 A;  2L12 A;  2OQ0 A;  3H0G G;  5IP9 H;  1Y1W G;  2R6G A;  2Z9H A;  1BF4 A;  2NVY B;  5ELC A;  1M8A A;  5IT9 L;  5C4X G;  4GLA C;  3IL8 A;  1SE2 A;  1BDO A;  1K83 B;  2NVX H;  1Z6H A;  1J9O A;  1F2M A;  1WJJ A;  3PIO 3;  5JJK A;  2Z1C A;  4NKL A;  4JYA L;  5IGB A;  3HOZ G;  2HUG A;  3M9B A;  1E24 A;  4R4O A;  1GUN A;  1G2S A;  1HHV A;  2QF7 A;  1OXV A;  5D3I B;  4A3D B;  5M5Y B;  1A8V A;  1CK1 A;  3A7A B;  2Q2T A;  1YIJ A;  2K1B A;  3EA6 A;  4TQU S;  3HOV B;  4DUZ Q;  4TKO B;  1WTQ A;  2GN5 A;  4KKU A;  4BY7 B;  3WOE A;  1MI2 A;  5FLM H;  2DJF C;  1TQO A;  3S16 B;  2A74 C;  4EX5 A;  2AUJ D;  2DNC A;  2V1C C;  4ZYS A;  5EPJ A;  2OTJ A;  4L5R C;  2EJF C;  5I2X A;  4MZ9 A;  2MO0 A;  1WVL A;  1A3V A;  1NTG A;  3OSO A;  2HCC A;  1Z9F A;  2E74 C;  1TY2 A;  2IL8 A;  1G6P A;  5LL6 X;  1PV4 A;  4X3U A;  2KUM A;  4DR1 Q;  1KAW A;  2WAQ G;  4X64 L;  3OYY A;  4A3I G;  4PQX A;  5IGF A;  3OW2 A;  2D0P A;  5C5L A;  3CCR A;  2LFN A;  3MHB A;  3UE1 A;  2A6E D;  1I6V C;  4L5T A;  5M3M B;  3KJP A;  4GNX A;  2R93 B;  1WTW A;  4BBS B;  5FO7 B;  3J81 i;  1IBK L;  4JI6 Q;  3CCS A;  4KKT A;  4M8A A;  3RMH A;  3BVG A;  1LLR D;  2ZJP A;  3STB D;  1S40 A;  4PG3 A;  2CH4 W;  1KC8 C;  4FXD A;  1ASY A;  4RGO S;  1PZK D;  2TMP A;  1MHW C;  4LF6 Q;  3ERO A;  3QWN A;  4L63 B;  2KHI A;  3SGI A;  2JJQ A;  2L9H A;  4O2D A;  1CZW A;  3K7U C;  1TR5 A;  4J8Q A;  3CW2 C;  1HNZ Q;  5HGQ A;  3AFQ A;  4DAP A;  1RHP A;  4EGV A;  1W2B A;  1JOO A;  2RSN A;  4BBR G;  3A74 A;  1YJ9 A;  5G3L D;  3GTJ B;  1RKN A;  5IWA L;  4MTN A;  4LF4 Q;  2HCI A;  3RLO A;  2MO1 A;  5CV4 A;  4DAV A;  2YU9 H;  1FNU A;  2Y0S E;  3GTL B;  4IUR A;  1GUS A;  2KJX A;  1O7Z A;  1VQK A;  5IOC A;  1R4P B;  2Z6K C;  4AH6 A;  2KCM A;  4YCW A;  4G7H C;  3FEW X;  3WDN A;  1NR4 A;  1YZ6 A;  2JYO A;  3H15 A;  1EYD A;  2F52 A;  1PH6 A;  3I4M B;  3J80 L;  3DUZ A;  4XQQ A;  4KY5 A;  2RQX A;  2ID0 A;  3EFX D;  1ZXT A;  1LTG D;  4AQY L;  2VXW A;  3DEP A;  4R9W A;  1GXD C;  1PH8 A;  3AMU A;  4FXG C;  2EDG A;  2VNU D;  3NEL A;  3NWT A;  1AE3 A;  2RDG A;  1S5D D;  4DUZ L;  1PFM A;  1I4Q A;  4DXF A;  5EKI A;  4P75 A;  1Y1V B;  2N8N A;  3H0G H;  1D1K A;  2IW3 A;  2ZXR A;  1QWY A;  3GTQ H;  4OX9 Q;  5GAG C;  3A55 A;  2NBF A;  1B7Y B;  5KND A;  1NMG A;  4X3K A;  1KDC A;  2NVX B;  1MJC A;  1X3G A;  1F9P A;  1RDP D;  4FF2 A;  1O7L A;  2F3W A;  3HOZ H;  1AEX A;  2DNE A;  2EYH A;  4YCU A;  2NZO A;  4DV6 Q;  1I4P A;  1X3E A;  1VQ6 A;  4ZK9 B;  4DR1 L;  1V1P A;  3TDQ A;  3PO2 G;  2B2T A;  1H9R A;  4CDC C;  1VQO A;  3T13 A;  3SEB A;  3H6M A;  5KNC A;  3RN5 A;  4KKS A;  4WRD A;  3A8I E;  2B2W A;  4B9X A;  1L0X B;  3RNU A;  4N8F A;  1G2T A;  3GD7 A;  2JA9 A;  4RA8 A;  5FLX L;  4A3K H;  1SMX A;  1K3B C;  1J5E Q;  1CQF A;  4BS9 A;  4XYQ A;  2J7Z A;  4XTC S;  4LF9 L;  1Q46 A;  3NQI A;  2BA0 A;  1X3Q A;  4JI6 L;  3AYH B;  5EKK A;  5M3F B;  1CM9 A;  4IUQ A;  4LFB Q;  1Y8P B;  4LF6 L;  3AEV A;  2EPB A;  1V43 A;  3AFP A;  4MIU A;  2RF4 A;  3BVM A;  3SR1 A;  5IE8 A;  1VQ8 A;  2B8F A;  1TII D;  4RCO A;  3VA5 A;  2UXC L;  5C3E G;  1HNZ L;  1N8R C;  1KIX A;  1NCV A;  4HJ7 A;  1DOK A;  1A3U A;  3NHH A;  3BS1 A;  3D4D A;  4DR6 Q;  4QF4 A;  2EXZ A;  4EQ5 A;  1VQI A;  3M85 A;  1JOQ A;  3W1B A;  3H94 A;  4GZY C;  5H1S E;  4DV4 Q;  1N32 L;  2SEB D;  1MBY A;  1UE5 A;  1RIP A;  3EQL C;  3IAY A;  3NTK A;  4BXX G;  4HR7 B;  3PIP A;  2EIF A;  1PYW D;  2M00 A;  3GTM H;  2K5V A;  5BR8 Q;  2XN9 C;  2HD3 A;  4BY1 G;  1IBL Q;  4C3J G;  1U9R A;  4K2K A;  4A3E G;  1VQF A;  3M4Y A;  3DHQ A;  2F3V A;  4MN3 A;  1IZ6 A;  1PA6 A;  1BOS A;  4DR2 Q;  4WJW A;  2M9V A;  4HSP A;  2EYP A;  4BBR H;  3WWV A;  5DM6 3;  4PMW A;  4X65 Q;  2PMZ B;  2B2U A;  1JJC B;  5IGC A;  5A35 A;  4DAY A;  1CA6 A;  3IFD A;  3D6W A;  3TP7 A;  4C3H G;  3RZD H;  3PIO A;  1GHJ A;  2BE5 D;  4ZAI A;  2YU9 B;  2NTS A;  2K4K A;  1IL8 A;  2HQL A;  4CBV A;  1CSQ A;  2PZT A;  2B63 G;  2I5L X;  3HKZ G;  1F2Z A;  1QB5 D;  1VQJ A;  3NXW A;  3U4V A;  1CHQ D;  3S14 H;  3QR8 A;  2JA7 G;  4R4C A;  1DOM A;  1Q8I A;  5M9O A;  2JA6 G;  5CGK A;  3L7Z C;  3MXG A;  5L37 A;  1PH7 A;  4H13 C;  3T51 B;  1LTA D;  3U4Z A;  4AYB B;  2NN6 G;  4EQP A;  4GN4 B;  2F0M A;  1KAA A;  2F0G A;  5JPM C;  1NAP A;  1HTP A;  1O7Y A;  4LAA A;  1IBM L;  3SK6 A;  1SEB D;  3HOY H;  1KNE A;  5CC4 A;  4NXN Q;  2AQ1 B;  1BCP D;  5K36 G;  1X54 A;  1BBW A;  3K5M A;  1BCP B;  2D5D A;  3I4N B;  3W5O A;  2FJ2 A;  3H0G B;  1EYA A;  1FD7 D;  2OT2 A;  3NUC A;  2KCT A;  2D2C C;  4DKA C;  1LT5 D;  1YJN A;  2CVR A;  2A8V A;  1ENF A;  3DM3 A;  1AP0 A;  2E76 C;  3PCO B;  2UXB Q;  3NSW A;  4KI0 A;  4JVZ A;  2VQF Q;  2VUM G;  1H9K A;  4OXP A;  2Q8T A;  3LGJ A;  2DY8 A;  2A19 A;  3OTO Q;  4B3R L;  4N8X 1;  2KVM A;  3MEF A;  1SRU A;  4ZRZ A;  1LTL A;  5I9O A;  1M4V A;  1B8A A;  1EU4 A;  2LKV A;  3K0Y A;  4MHE A;  3HOW G;  4JI0 Q;  1B50 A;  4LF8 Q;  3SVM A;  3MWY W;  3EIV A;  3BYY B;  4DR6 L;  2QCP X;  3D3R A;  3K57 A;  2XIW A;  2O5I C;  5M5W H;  3OWF A;  3EN2 A;  5GAE C;  1MSG A;  4IFD I;  1EZ8 A;  5FJ8 G;  4PV1 C;  5F2D A;  1SYF A;  4A3B G;  3KYH C;  4A3K B;  2XTI A;  4LJZ C;  3ZYY X;  3BJU A;  2EVB A;  4K8J A;  4DK0 A;  1PRT D;  1PRT B;  1C7Y A;  2ASB A;  1EY7 A;  4KY6 A;  4ZKC B;  2UU9 Q;  1A15 A;  2AQ3 B;  2RA4 A;  3J80 i;  1KAB A;  5BR8 L;  3BZK A;  1HJP A;  1IBL L;  3CQZ H;  1X3P A;  1ILQ A;  4N9T A;  5ELN A;  2WKC A;  1C4Q A;  5JVH 3;  2R3Z A;  1HNX Q;  3DLL A;  1PVO A;  1I94 Q;  1ZEQ X;  2TSS A;  1X65 A;  4LF5 Q;  5CV8 A;  2X69 A;  2F3I A;  3T1H L;  4G4K A;  4IPC A;  4DR2 L;  3J80 c;  1E2V A;  3PQI A;  1S5F D;  4XT1 B;  3RUZ A;  5C3E H;  1EIY B;  2G9D A;  4NP5 A;  4OO1 I;  2XRQ D;  4A3L G;  3KF8 B;  4UPA A;  1Q86 C;  2QKI C;  5TSS A;  3Q0A A;  1HZC A;  3SK8 A;  2ZTD A;  3I70 A;  3E0E A;  1PH3 A;  3TP5 A;  3AB9 A;  3E9H A;  2HDL A;  4G57 A;  4BXX H;  4HMI A;  2PQA B;  4FF3 A;  3HG9 A;  4H0L C;  1YBY A;  3H3V C;  2QA4 A;  5BN4 A;  3ULL A;  4B08 A;  2WB1 B;  3GTM B;  2ZT9 C;  2F0P A;  3IRB A;  1Q82 C;  2CWA A;  4FO2 A;  1WTO A;  5E7N A;  4GLV B;  3MAQ A;  1BCP C;  4A3E H;  4IFD J;  5GQO A;  1LT4 D;  1VQ9 A;  4YY3 L;  3J81 E;  2A5H A;  4IO9 A;  2WII B;  2A69 C;  4RG1 A;  1KQS A;  1BCP F;  4DU9 A;  3CF5 A;  4N9P A;  4QUC A;  4BBR B;  4NXN L;  2R92 G;  4C1N K;  3KLS A;  4XT3 B;  5D65 A;  1CA5 A;  2F0H A;  3K81 C;  3JAM c;  1DGS A;  1TS2 A;  5FLX c;  2N3S A;  1X32 A;  5FKA C;  3CCM A;  3RZD B;  4RFB A;  1U4P A;  2PNH A;  3A0J A;  4ALP A;  4YCV A;  1UE7 A;  2B63 H;  5I6W A;  3NBH A;  4IFD G;  3T16 A;  2UXB L;  2O5J C;  3DMU A;  3ERQ A;  4HJ5 A;  2VQF L;  2EY2 A;  4GNX C;  4DR5 Q;  3S14 B;  1PFS A;  3OTO L;  1WD1 A;  2EJM A;  5C3W A;  3S2D H;  2JA8 G;  3HKS A;  3LNN A;  2PMZ E;  2NN6 H;  1PRT C;  2D62 A;  4A75 A;  4LF8 L;  5JJI A;  2PZW A;  3CCU A;  1QOH A;  2WIN B;  3G4S A;  3HOY B;  1JOK A;  3G48 A;  1E1T A;  1WOC A;  2NTT A;  4YWK A;  5CBE E;  4QGU A;  4DR4 L;  1EY0 A;  2XGT A;  2ICE C;  4UDU C;  2E8G A;  4FNF A;  1IBK Q;  1VMP A;  4CJ0 B;  1VS0 A;  4OO1 G;  1S5E D;  5CV9 A;  5KYI A;  2RCN A;  4OEM B;  4JBK A;  5HY6 A;  3RZO H;  4JV5 Q;  2FHT A;  2F1M A;  4IUN A;  1R9T B;  4B9W A;  3FHW A;  1EUJ A;  4Q5V A;  4AYB E;  3NEN A;  1XWE A;  1QVC A;  3HEJ A;  4HJA A;  3G6E A;  3W1G A;  1HNX L;  1JE4 A;  2HIV A;  4HIO A;  1I94 L;  3CP0 A;  4LF5 L;  3PO3 G;  1AW7 A;  1VF5 C;  4JG2 A;  2F0D A;  3ULJ A;  1SFO B;  1XNQ Q;  2ZXO A;  3GV6 A;  3OWE B;  2MP1 A;  1SNO A;  1PZJ D;  2CFM A;  4CDF C;  3S17 H;  4GOP B;  5FJ8 H;  5M5W B;  2GVB A;  2EOT A;  4K5X A;  1A2T A;  4C3I H;  2N49 A;  1I6H H;  1FGU A;  4HIK A;  3GO5 A;  1EFI D;  5IY0 A;  1M90 C;  4XQN A;  3DWQ A;  2OWO A;  5J1Z A;  2F0S A;  1X6O A;  1K8G A;  1EWI A;  2KCN A;  1ENA A;  1DOL A;  1MIU A;  1KRT A;  4JC0 A;  3CQZ B;  2QW7 A;  3GTK B;  3RR5 A;  3PUV A;  4KLK A;  3PV0 A;  2BDN A;  5M5X H;  4FVM A;  1T5X D;  1BQQ T;  3S2H H;  5ELB A;  1I3Q H;  4JI7 Q;  3CPW A;  2Q2U A;  2K04 A;  2IY5 B;  1EL0 A;  4AQY Q;  1WCM G;  1BO0 A;  3CD6 A;  3M3Y H;  4UP9 A;  3SK5 A;  2K32 A;  1QIL A; 
#chains in the Genus database with same CATH homology
 2UUB L;  4BA1 I;  3CMA A;  3GTQ H;  5JJL A;  4OX9 Q;  2LXJ A;  1VQE A;  2PI2 E;  5GAG C;  1L1O A;  1S3O A;  1XTD A;  3K0X A;  5ELO A;  1GKH A;  1B7Y B;  4JI3 Q;  2VY3 A;  3KDF A;  5AJ3 L;  4DUY Q;  2UUB Q;  4L5S A;  1NMG A;  5C44 G;  3F2D A;  2B3G A;  4DK3 C;  4PZ8 A;  4C3H H;  3CCJ A;  5LMN L;  1MJC A;  1YNX A;  4JBW A;  4DV6 L;  1X3G A;  1YHA A;  5EAY A;  4LFC L;  4YHH L;  1L1O B;  5AJ3 Q;  5IYD G;  2CWP A;  4JOI C;  3HOZ H;  1BKB A;  3KDF B;  4YCU A;  2WAQ E;  2NZO A;  4DV6 Q;  1X9N A;  1D8L A;  3CME A;  1X3E A;  1VQ6 A;  1GVP A;  1A62 A;  1SN8 A;  4DR5 L;  3L2P A;  4DR1 L;  4A3F G;  1TWA H;  4P72 A;  3PO2 G;  3CC4 A;  3CCQ A;  2JA7 H;  3Q8D A;  1C0A A;  1VQO A;  2Z0S A;  4JBJ A;  2K52 A;  4K0K L;  3RN5 A;  2JA6 H;  4DPG A;  1IL2 A;  1JMC A;  3J7Z C;  4A3J H;  2IX0 A;  1WFQ A;  2JK8 A;  3PUY A;  2R93 H;  1A63 A;  4JOI A;  4DV3 L;  1PH2 A;  2BH8 A;  3RNU A;  1J5E L;  2E2J H;  3GD7 A;  2JA9 A;  3CCV A;  1HR0 Q;  1Q81 C;  1JT8 A;  1IYJ B;  3RN2 A;  4A3K H;  1SMX A;  1J5E Q;  2UUA Q;  2UXD Q;  1XMQ Q;  1P16 A;  2R7F A;  4X66 L;  3PUW A;  4XTC S;  4LF9 L;  1J6Q A;  1Q46 A;  2VQE Q;  4A3M H;  2BA0 A;  1R9T H;  1PH1 A;  4JI6 L;  3AYH B;  1S72 A;  3GTG H;  4R1J A;  1PYS B;  3M4O H;  4X66 Q;  3B6Y A;  2WB1 E;  3TRZ A;  4LF9 Q;  4LFB L;  1EOV A;  2IT1 A;  3KFU A;  5IYB G;  1QVF A;  1H95 A;  1PH5 A;  4JV5 L;  4LFB Q;  4LF6 L;  3AEV A;  2ZM6 L;  1O7I A;  5J3B A;  1V43 A;  3AFP A;  2RF4 A;  1SR3 A;  5IE8 A;  4DNI A;  4KHP L;  4JI5 Q;  1QZG A;  1VQ8 A;  4UP8 A;  1NJI C;  1L2F A;  2C35 B;  4GOP C;  3UDG A;  1SFO H;  1LUZ A;  4LNQ A;  2E2I H;  1E7Z A;  1AH9 A;  1KL9 A;  1EQQ A;  2VUM H;  1FVI A;  3CPF A;  4A93 G;  2AWN A;  2UXC L;  4NXM Q;  5C3E G;  1HNZ L;  1N8R C;  1A0I A;  1KIX A;  2NZH A;  3GTP H;  4HJ7 A;  3KJO A;  4POG A;  3F8T A;  2ATW A;  2R7D A;  2UXC Q;  4R4T A;  4JI2 L;  1XNQ L;  4GS3 A;  3EBE A;  4DR6 Q;  1K8A C;  2NVY H;  1C9O A;  1V9P A;  5IYC G;  3HOW H;  5IP9 G;  3D31 A;  4EQ5 A;  1N34 L;  4B3S Q;  1VQI A;  4DV4 L;  3ICE A;  3TQY A;  3M85 A;  4GKK L;  1K83 H;  1LYL A;  3W1B A;  2ZJR A;  3S1M H;  1VQP A;  4B3M Q;  1N34 Q;  5H1S E;  4DV4 Q;  4A3G H;  1T9H A;  1U0L A;  2QGQ A;  1N32 L;  1UE5 A;  1RIP A;  3JC6 6;  4JI1 Q;  4GKK Q;  4HJ9 A;  1CKN A;  1HNW Q;  4A3B H;  3KLW A;  1UEB A;  2WP8 J;  2EIF A;  3PIP A;  3I4M H;  4BXX G;  2RHQ B;  2CQO A;  2KBN A;  1N32 Q;  5LMU Q;  3KOJ A;  3GTM H;  1KHI A;  2K5V A;  4GN3 B;  3GTK H;  5BR8 Q;  1X3F A;  4AIM A;  2HHH L;  3HOU H;  1CKN B;  1Q1E A;  1U5K A;  4BY1 G;  1IBL Q;  2B29 A;  4HJ8 A;  1XNR L;  4BA2 I;  4OWW B;  4A3E G;  2YV5 A;  5M5Y H;  2HHH Q;  5JEA J;  3T1Y Q;  1VQF A;  5DLQ E;  4A3C G;  4FDB A;  2EQS A;  2CCZ A;  1IZ6 A;  4LUO A;  1PA6 A;  1Y1V H;  3I2Z A;  3HOV H;  4DR2 Q;  4APV A;  2A1A A;  4X65 L;  3I4N G;  2HT1 A;  1D7Q A;  4BY7 H;  1HZB A;  4JI7 L;  4DV2 Q;  4BBR H;  3K8A A;  4DV7 L;  1UE1 A;  3WWV A;  4PMW A;  4X65 Q;  5FLM G;  1L0W A;  1HR0 W;  1VQL A;  3H3V H;  4WJ4 A;  1JJC B;  1N36 Q;  3I56 A;  4DV7 Q;  2JE6 I;  1PH4 A;  3MXN B;  3TS0 A;  2Y0S G;  2R7Z H;  1Q8K A;  4IOC A;  3RZD H;  2IHF A;  2K14 A;  1VQA A;  4QJF A;  3UDI A;  3PIO A;  4DR7 Q;  4A3L H;  2BA1 A;  2K4K A;  4QIW E;  4JI3 L;  4OON A;  1Y1W H;  1XMO Q;  4DUY L;  2HQL A;  2I0Q A;  4DAY B;  4Y7N H;  3S24 A;  1CSQ A;  1YIT A;  4UY8 C;  4R4Q A;  1Q7Y C;  2K50 A;  2I5L X;  3HKZ G;  5C4X H;  2B63 G;  4JYA Q;  3ER0 A;  1I50 H;  1TWH H;  1NE3 A;  5JEA G;  4XIG S;  1G29 1;  1VQJ A;  1FJG Q;  3U4V A;  3S14 H;  3H3V I;  1XPU A;  2JA7 G;  4R4C A;  4OWX B;  1CKM A;  4P71 A;  2HIX A;  2I5M X;  4IPH A;  5GAD C;  1QVG A;  3NEM A;  2JA6 G;  3TS2 A;  1KXL A;  1RL2 A;  4A3J G;  2E5L L;  3L7Z C;  3FKI G;  2JEA I;  1PH7 A;  2VL6 A;  4WJ3 M;  2I5H A;  3CXC A;  3U4Z A;  2NN6 G;  5IP7 H;  2E5L Q;  4GN4 B;  4LF7 Q;  5C4J H;  1Q12 A;  2CKZ B;  2ZTE A;  4A3K G;  1W3S A;  5M3M H;  2JA5 G;  1MJE A;  1IBM L;  4LWC A;  3BU2 A;  3HOY H;  1WCM H;  2N78 A;  1HR0 L;  2OTL A;  4BBS H;  5M3F H;  1KD1 C;  4NXN Q;  4IOA A;  4P73 A;  2RHS B;  1ASZ A;  1IBM Q;  1G51 A;  1BBU A;  2UUA L;  2UXD L;  1X54 A;  1BBW A;  1SLJ A;  1XMQ L;  5K36 G;  1YJW A;  3W5O A;  1CUK A;  2VQE L;  1OXX K;  2R92 H;  3UDX A;  1HZA A;  1CKO A;  2KCT A;  4DKA C;  3PUX A;  4GN5 A;  5C44 H;  3J7A 5;  4IJH A;  1YJN A;  3A5Z B;  2A8V A;  1Q1B A;  1K3R A;  4X6A H;  3DM3 A;  3GDE A;  4LUV A;  4JI4 Q;  3PCO B;  2UXB Q;  4LW1 A;  1YHQ A;  4KI0 A;  2AWO A;  1BVS A;  3PF4 A;  3M4P A;  2K75 A;  3CCE A;  2VQF Q;  2VUM G;  1EIF A;  4JI5 L;  4OXP A;  3LGJ A;  4ME3 A;  1IXR A;  2A19 A;  3RLN A;  3UE0 A;  3OTO Q;  4A3F H;  4B3R L;  4X64 Q;  1GO3 E;  2ZTC A;  2VW9 A;  3MEF A;  2YTV A;  1WYD A;  1SRU A;  1YEZ A;  1OXT A;  3ZJY C;  1M1K C;  4JI0 L;  1LTL A;  2MQH A;  1B70 B;  4B3R Q;  4R4I A;  1B8A A;  4NXM L;  4UP7 A;  4GKJ Q;  3GTJ H;  3HOW G;  2MFI A;  2AKW B;  4A3I H;  4JI0 Q;  3M4Q A;  4OWT B;  2JA8 H;  4LF8 Q;  4JCV E;  3ULP A;  3EIV A;  1CSP A;  4J15 A;  3KF6 A;  2VZA A;  4DR6 L;  5M5W H;  5GAE C;  1NY4 A;  3EN2 A;  1E1O A;  1NMF A;  1P8L A;  1VQB A;  2L15 A;  1VQ7 A;  2LSS A;  4B3S L;  4A3G G;  4IFD I;  3GTL H;  1SE8 A;  5FJ8 G;  1EFW A;  3KYH C;  4LFA Q;  4A3B G;  2PI2 A;  2XTI A;  4DV0 Q;  4B3M L;  3KF6 B;  2UU9 L;  2WB1 G;  3BJU A;  3L0O A;  2F4V Q;  4JI1 L;  1HNW L;  2ASB A;  1C7Y A;  3HOU G;  5IYB H;  2UU9 Q;  3J81 c;  1VQ5 A;  5LMU L;  3J80 i;  4A3D G;  5BR8 L;  2QEX A;  2H5X A;  3BZK A;  1HJP A;  4GLX A;  1IBL L;  3CQZ H;  3D0F A;  3K80 C;  2ALY B;  5ELN A;  4B3T Q;  3HOV G;  2MNA A;  3I7F A;  1HNX Q;  1E22 A;  4AYB G;  3DLL A;  4HID A;  3T1Y L;  2Q2I A;  3HFZ B;  1PVO A;  1I94 Q;  1E3P A;  5GAH C;  1XPR A;  3HOX G;  1GM5 A;  4BY7 G;  1LM0 A;  1X65 A;  4LF5 Q;  1QUQ B;  4IPD A;  1X55 A;  2F3I A;  3T1H L;  1MKH A;  4IPC A;  4DR2 L;  3S1Q H;  3J80 c;  5C3E H;  2KEN A;  4JI8 Q;  1AE2 A;  3BZC A;  4TVA B;  1EIY B;  4DV1 Q;  1N33 Q;  3I4O A;  4A4I A;  1JB7 A;  4QQB X;  2Q2H A;  1EYG A;  2NVQ H;  1FL0 A;  4DV2 L;  3T1H Q;  1QZH A;  3PO3 H;  4OO1 I;  5IWA Q;  3CAM A;  4A3L G;  3KF8 B;  4UPA A;  1Q86 C;  1TXY A;  3CCL A;  2OQ0 A;  3H0G G;  1TWF H;  5IP9 H;  2R6G A;  3PUZ A;  1Y1W G;  1N36 L;  1SRO A;  3U58 A;  2PQA A;  3AQQ A;  1HZC A;  1XPO A;  3CC7 A;  1KRS A;  5C4X G;  4GLA C;  2ZTD A;  4DR7 L;  3E0E A;  2K5N A;  2NVX H;  1PH3 A;  5C0X I;  1XMO L;  1WJJ A;  1EQR A;  3S1N H;  3E9H A;  5JJK A;  4BXX H;  1XJV A;  2PQA B;  3I55 A;  2JQO A;  1VQN A;  4KHZ A;  4JYA L;  3HOZ G;  1YI2 A;  1YBY A;  3M9B A;  2QA4 A;  1FJG L;  3ULL A;  1E24 A;  4R4O A;  3IRB A;  1Q82 C;  2CWA A;  2OQK A;  1JE5 A;  1HH2 P;  4GLV B;  5E7N A;  4A3E H;  4IFD J;  5GQO A;  1OXV A;  2EXD A;  1VQ9 A;  4YY3 L;  2JEB I;  3K7A H;  5M3M G;  4X62 Q;  2AMC B;  4LUZ A;  1A8V A;  1K9M C;  3M7N A;  4LF7 L;  3HOY G;  2Q2T A;  4IO9 A;  2DGY A;  1YIJ A;  2R93 G;  4YY3 Q;  4BBS G;  1V1Q A;  1I5F A;  1TWC H;  1OTC A;  4DR3 Q;  4TQU S;  3U50 C;  3I4N H;  2D0O A;  1UE6 A;  4DUZ Q;  3J81 j;  4RG1 A;  1KQS A;  2BH2 A;  2UUC Q;  4YWL A;  2GN5 A;  4C2M H;  1WI5 A;  3CF5 A;  2WFW A;  4IPG A;  1PH9 A;  5FLM H;  2ES2 A;  4NXN L;  2R92 G;  1VQH A;  3K81 C;  4EX5 A;  3JAM c;  1DGS A;  2V1C C;  4A3M G;  3GTO H;  5FLX c;  2N3S A;  1Y14 B;  4L5R C;  2OTJ A;  1VQC A;  3CCM A;  5GRO A;  2E2H H;  4MNO A;  5LMN Q;  4MZ9 A;  2PNH A;  3A0J A;  2LXK A;  2MO0 A;  4YHH Q;  4YCV A;  1UE7 A;  1NTG A;  3F2B A;  4ALP A;  4DK6 C;  4LFC Q;  1Z9F A;  2B63 H;  4IFD G;  4JI4 L;  4NPS A;  2KHJ A;  2UXB L;  3S15 H;  4HJ5 A;  1G6P A;  1YVC A;  2VQF L;  1PV4 A;  4GNX C;  4DR5 Q;  3F2C A;  1KAW A;  1PFS A;  2WAQ G;  4NB3 A;  3NBH B;  4DR1 Q;  5IYD H;  3STB C;  3OTO L;  2K5H A;  4X64 L;  1JJG A;  3OYY A;  3FKI H;  1TWG H;  3S2D H;  4A3I G;  2JA8 G;  4K0K Q;  3HKS A;  3OW2 A;  2PMZ E;  2D0P A;  1GD7 A;  5C0X J;  1VQD A;  2D62 A;  3PO2 H;  4GKJ L;  3CCR A;  4A75 A;  2AHO B;  4POF A;  4DV3 Q;  3UE1 A;  4H02 A;  2JA5 H;  3F1Z A;  3UDF A;  1JJ2 A;  4LF8 L;  5JJI A;  4L5T A;  3CCU A;  3KJP A;  4A76 A;  4GNX A;  1Z47 A;  4DAM A;  3S1R H;  3G4S A;  2IX1 A;  3G48 A;  1E1T A;  1OXS C;  3J81 i;  1WOC A;  4YWK A;  2YYZ A;  3RLF A;  4QGU A;  1IBK L;  4LFA L;  4JI6 Q;  3CCS A;  4DV0 L;  4DR4 L;  2XGT A;  3TEH B;  1NBW A;  4GNX B;  2ZJP A;  2NN6 I;  2E8G A;  3STB D;  4PG3 A;  1S40 A;  1VQM A;  2F4V L;  1IBK Q;  3TRE A;  2OCE A;  1VS0 A;  3I4M G;  4DR4 Q;  4OO1 G;  4JBK A;  1KC8 C;  2RCN A;  5HY6 A;  4RMF A;  1ASY A;  3RZO H;  2YTX A;  4JV5 Q;  3PSI A;  4LF6 Q;  2ZM6 Q;  3PF5 A;  3FHW A;  1EUJ A;  2KHI A;  3SGI A;  1PYB A;  4AYB E;  3NEN A;  4KHP Q;  1QVC A;  1N9W A;  2JJQ A;  3ERS X;  4DV5 L;  4HJA A;  4O2D A;  5C0X G;  4B3T L;  3G6E A;  3W1G A;  1HNX L;  2HIV A;  1QUQ A;  2FXQ A;  4HIO A;  1I94 L;  3CP0 A;  4QL5 A;  4L5Q A;  1X56 A;  2DUD A;  3K7U C;  4DV5 Q;  3FP9 A;  1Y1V G;  3CW2 C;  4LF5 L;  3PO3 G;  4JG2 A;  1HNZ Q;  5HGQ A;  3AFQ A;  4JI8 L;  3ULJ A;  1W2B A;  4LF4 L;  1HZ9 A;  4JBM A;  4DV1 L;  1N33 L;  4BBR G;  3A74 A;  4GOP A;  1YJ9 A;  4QY7 A;  4JI2 Q;  1XNQ Q;  3VDY A;  4A93 H;  5IWA L;  2ZJQ A;  1VCI A;  4MTN A;  4LF4 Q;  2CFM A;  4IJL A;  1OXU A;  3RLO A;  2MO1 A;  2R7Z G;  3S17 H;  4Y52 H;  4GOP B;  5FJ8 H;  2YU9 H;  2GVB A;  5IT9 c;  2Y0S E;  4C3I H;  2N49 A;  3E9I A;  1I6H H;  1FGU A;  5IYC H;  2IHE A;  4HIK A;  1VQK A;  3GO5 A;  1UWV A;  3CC2 A;  5IY0 A;  5LMN W;  4PZ6 A;  4HIM A;  2Z6K C;  1M90 C;  4AH6 A;  2KCM A;  4P74 A;  3HKZ E;  4YCW A;  2OWO A;  3PGZ A;  4A3D H;  2NVT H;  1X6O A;  1K8G A;  1EWI A;  3A5U A;  1YZ6 A;  1XNR Q;  2YTY A;  1MIU A;  4O0A A;  1KRT A;  3H15 A;  2F52 A;  1PH6 A;  1VQG A;  4JC0 A;  1YHB A;  1VQ4 A;  4PZ7 A;  3G71 A;  4BY1 H;  1K0R A;  3RR5 A;  1K73 C;  3PUV A;  3HOX H;  1L1O C;  2GVA A;  4KLK A;  3PV0 A;  5IP7 G;  2ID0 A;  4X62 L;  4C3J H;  5M5X H;  4AQY L;  2Z6K A;  3S16 H;  2VS1 A;  1PHJ A;  1PH8 A;  4YWM A;  3S2H H;  3JAM i;  1I3Q H;  4DR3 L;  4JI7 Q;  3NEL A;  4A3C H;  1AE3 A;  2VNU D;  3CPW A;  2Q2U A;  2IY5 B;  4DUZ L;  4AQY Q;  1WCM G;  3CD6 A;  3M3Y H;  2UUC L;  4P75 A;  4UP9 A;  5M3F G;  4OX9 L;  2N8N A;  3H0G H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...