4DR1L

Crystal structure of the apo 30s ribosomal subunit from thermus thermophilus (hb8)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr1L00
3GTKH 5IYDG 1X55A 4APVA 2NN6I 3STBC 4A3KG 4OX9L 4JI7Q 3PO2H 3UDFA 4BBSH 3HOVG 2VL6A 2YTVA 1Q1EA 1I6HH 1CSQA 3OTOL 1UE6A 1VCIA 3PUXA 5AJ3Q 3VDYA 3CAMA 4P71A 4R4OA 4DKAC 1XNRL 2R93G 2AMCB 2VQEQ 4A3LG 4DV4Q 1KHIA 4X66L 2MO0A 5C0XG 1XMOL 3K81C 2VNUD 3G71A 1NJIC 3S14H 2N8NA 3CCJA 2Y0SG 3K80C 3M4QA 1VQBA 4AQYL 1Q86C 4OO1I 4X64Q 3PUYA 4NB3A 1PHJA 1Q1BA 4JI3L 1VQMA 2PQAA 3AEVA 2PQAB 1JE5A 3I56A 4A3JH 1PVOA 4LF6L 1GD7A 1FL0A 3CCUA 3S16H 2K5HA 3TRZA 2UXCQ 2BA1A 5C44H 2L15A 3U4ZA 4IOCA 2F4VQ 1JJ2A 2CWPA 3M85A 3GTQH 2I0QA 4JI2Q 3E9IA 2LXJA 1K3RA 1HNWL 2B63H 3S17H 4IPGA 5H1SE 1I3QH 4JI5Q 1VQ9A 1X9NA 4A3GG 4DAYB 1AE3A 4R4CA 3KJOA 4A3FH 1WJJA 1XNQQ 3CPFA 1S72A 4A3IH 4DUYQ 2CFMA 2K50A 3I4OA 4DV5L 1EIFA 4DV6Q 3HOXG 3ULPA 2MFIA 1IBML 4GN3B 1HNXL 2PI2E 2NZOA 5IYBH 2E8GA 3EIVA 4JC0A 3G4SA 4JBKA 3PV0A 2VQFL 3T1HL 2OQKA 1QZGA 2UXDQ 1E24A 4LFCQ 4PG3A 2F52A 3W1BA 1VQ6A 3CPWA 4GNXA 4GNXB 1EQQA 2E2HH 1XMQQ 1E1OA 4LF8Q 4DR6Q 2OCEA 4BY1G 4QQBX 1UE7A 3WWVA 1VQ8A 4LF5Q 1KC8C 4GLAC 3HKZE 1PYBA 4R4IA 1HR0L 4JG2A 4HJ9A 1I50H 2Z6KA 4BA2I 4DAMA 3K7UC 2NVQH 1JMCA 4X6AH 4DV3Q 1XPRA 4BXXH 2N3SA 4A3EH 5FJ8G 4FDBA 4IOAA 4JV5L 2NZHA 1UEBA 4J15A 3PO3G 3U50C 4DV2L 1PFSA 1CKNA 1CKNB 4BBRG 2ZTEA 3HOYH 3KJPA 1SN8A 2JA8G 1WCMH 1FJGQ 2JQOA 2H5XA 3H0GG 3A0JA 4O0AA 1N33L 3CP0A 5C0XI 4A4IA 1VQNA 2ATWA 5DLQE 4GNXC 1X3FA 2Z0SA 5C3EG 4A3JG 5IP7G 1WYDA 4B3RQ 4PZ7A 1JB7A 1W3SA 2A1AA 2VUMG 2VQEL 5JEAJ 3MEFA 1LM0A 1H95A 3PUZA 3CCVA 2Z6KC 4DR7L 4KLKA 3F1ZA 4DV7Q 2EXDA 4L5TA 4AH6A 1HZCA 2KHJA 3E9HA 3TQYA 4NXML 4A3BH 1A0IA 5J3BA 4LFBL 1G291 4A93H 2IY5B 1LTLA 3KDFA 3CW2C 3PGZA 3KOJA 4QY7A 2UUBQ 2YTYA 4HIKA 3J7A5 3S2DH 4LUOA 4NXNL 4PMWA 3H15A 3HOUG 1N34Q 1XPOA 3FP9A 4XTCS 3TEHB 3RN5A 1YHAA 2ASBA 2OTLA 1UWVA 3BU2A 4MZ9A 4IPDA 4YCUA 1KD1C 4X65Q 4C3IH 2RF4A 2WB1E 3CCSA 2JE6I 4B3SL 3AQQA 1EOVA 4EX5A 3KYHC 4IPCA 2DUDA 3T1YL 3I4MG 4KHPL 1EQRA 3UDXA 1KIXA 1K73C 2JK8A 4LF9Q 4Y52H 4JBJA 4X62L 1MKHA 1N36L 1HH2P 2MQHA 2ZTCA 3H3VH 3S1MH 3G6EA 4BA1I 2XTIA 3F2BA 2UXBL 4AIMA 5EAYA 3F8TA 4DR4L 3EBEA 1GVPA 4LF8L 4K0KQ 1X65A 2AHOB 1J5EQ 1R9TH 4DR5L 5IWAQ 2UUCQ 2HT1A 4P74A 5IP9G 3GO5A 1U5KA 3UE1A 3M7NA 4HIMA 4JBWA 4IJLA 4GLVB 4AYBG 2F3IA 1EWIA 3ULJA 5IT9c 2UUAQ 1NBWA 1FVIA 1K8GA 4Y7NH 2Q2UA 3TS2A 4IFDG 3NEMA 1PH1A 3CCQA 2AWNA 2OQ0A 4A3BG 1V43A 3M3YH 2UU9L 3J81j 3HOZH 5IYCH 4JI1Q 4LF4L 2Y0SE 2OTJA 1VQEA 4A75A 3RR5A 2OWOA 3M4PA 1VQOA 1VQHA 3PF5A 1YHQA 2WP8J 4B3MQ 1X56A 3GTGH 3G48A 3S15H 3TREA 2CKZB 2HHHL 4DR3L 2E2IH 1OXVA 1QVGA 3PIOA 3A5ZB 3S2HH 1N32Q 4DUZQ 2ES2A 1HNZQ 1CUKA 2IHEA 3I4NH 5GROA 4KHZA 5M3MH 2V1CC 3RZOH 3GTMH 3L2PA 3CXCA 2E5LQ 1TWHH 1YHBA 3PUVA 2E2JH 1Y1VH 1J6QA 1OXXK 2JA7H 3F2DA 4A3CG 2D62A 1IL2A 4H02A 4LFAQ 4YY3L 2CCZA 1JJCB 2PNHA 3GD7A 2D0OA 3I2ZA 4GN5A 5FLMG 2JEBI 3CCEA 1YVCA 3STBD 4HJ7A 1G6PA 3GDEA 1GM5A 2N49A 1P16A 4GKJL 2YU9H 3FKIG 4DV0Q 1SMXA 1GO3E 1SR3A 1A63A 5ELNA 1SRUA 4RMFA 4YCVA 5M3FH 3HFZB 1TXYA 2JA6G 2WAQE 5LMNL 3JAMi 1S40A 1AE2A 3D31A 4MNOA 5LMUQ 4A3DH 1SE8A 3CCMA 2K5VA 5E7NA 4ALPA 3CCRA 2R6GA 3PUWA 2KCTA 2JA5H 2R7ZG 3PO2G 4BBSG 4LWCA 3U58A 1YI2A 3W5OA 1C9OA 1NMFA 4DV1Q 1E1TA 5HY6A 3DM3A 4HJAA 3ULLA 3D0FA 1IBLL 2I5HA 5GAGC 1ASYA 2PI2A 1VQ7A 3PCOB 1IBKL 1OTCA 5IWAL 4BY7H 2IX1A 3GTOH 2N78A 1E3PA 1SLJA 1HZAA 3S24A 3U4VA 1OXUA 4IFDI 1D8LA 3CQZH 4JI7L 3JC66 5BR8Q 4R4TA 2C35B 3HKSA 5C4XH 2IHFA 2UUAL 4LF7Q 2R7FA 4OONA 4DPGA 1YBYA 4P75A 2VW9A 1SFOH 4JI6Q 1Z9FA 5HGQA 1VQKA 5AJ3L 5M3MG 3BZKA 4R4QA 2BH8A 1VQPA 4DV4L 1EUJA 5C44G 5LMNW 3RZDH 1Q81C 3BZCA 1VQFA 4OX9Q 1B8AA 1YNXA 2QGQA 4JOIA 4QIWE 4B3ML 1Y1WH 2ZM6Q 2VS1A 1LUZA 2KHIA 3CMAA 4JI8Q 3OTOQ 2B63G 4X64L 2JEAI 1QZHA 1D7QA 1N32L 3KDFB 1TWCH 4NPSA 1HNZL 4A3FG 3CC2A 1IZ6A 4QL5A 2R92H 2ZTDA 1XNRQ 1PH6A 3HOWH 4A3IG 1UE1A 4A3MH 1V9PA 2UXCL 1QUQA 1VQLA 1QUQB 1VQCA 2GVBA 4X66Q 1B7YB 2QEXA 1XMOQ 5IYDH 1Z47A 1AH9A 2F4VL 4A3KH 1L0WA 5IYBG 4JI2L 4AQYQ 4L5RC 3HOVH 4A3DG 1NE3A 5GADC 1NTGA 1UE5A 1YZ6A 5IE8A 4JI5L 4JI3Q 4P73A 1CKOA 1RL2A 1Y14B 4JOIC 4GN4B 5ELOA 1XNQL 4DV0L 4LF6Q 2AKWB 3ZJYC 2R93H 1VQJA 4DUYL 4DV6L 1PH5A 4A3LH 4QJFA 1WOCA 2QA4A 3JAMc 3KF8B 4YCWA 4JI0Q 3FHWA 4GKKQ 4POFA 4BXXG 5LMUL 1HNWQ 4A3EG 4O2DA 3NENA 2NVTH 4IFDJ 2UXDL 4LFCL 4DNIA 4LUZA 3OYYA 1EYGA 2B3GA 4DR6L 1HZBA 1XMQL 3HOYG 2FXQA 4LF5L 1WCMG 4HJ8A 4AYBE 1PH4A 3W1GA 5K36G 4DV5Q 4GS3A 1PH9A 5C0XJ 4POGA 3M9BA 1IBMQ 1K8AC 1X54A 1HNXQ 3GTPH 1IXRA 4GOPA 1I5FA 1KRTA 4GOPB 3PF4A 4DV3L 2ZJQA 3UE0A 2AWOA 2VQFQ 4UPAA 4C2MH 1YEZA 4TQUS 1HZ9A 1X3EA 1KL9A 1XPUA 3K8AA 3RNUA 4LF7L 1KRSA 1U0LA 1VQIA 1FJGL 4A93G 1HR0Q 1K83H 2MNAA 3HOXH 4YHHQ 3J81i 1EIYB 3AFPA 4B3RL 1SROA 3UDIA 4UY8C 3DLLA 3EN2A 2R7DA 3ERSX 4JV5Q 5GAHC 1M90C 4DV2Q 2YTXA 4GLXA 4DV7L 1I94Q 4GOPC 4B3TQ 1E22A 2ZM6L 4BY1H 1QVFA 1KAWA 4DR2Q 1QVCA 4JI8L 1L2FA 1N33Q 2HIXA 4QGUA 3TS0A 1VQ5A 1HJPA 4P72A 2HIVA 2UUBL 1NMGA 2EQSA 1BBUA 4PZ6A 3UDGA 1Q7YC 3S1RH 4A76A 1C7YA 2DGYA 5FLXc 5FJ8H 1BVSA 1N34L 4DR7Q 4JYAQ 3PO3H 2GN5A 4NXMQ 1L1OA 4BBRH 1L1OB 3NBHB 4IJHA 3E0EA 3A5UA 4X65L 1M1KC 4LFBQ 2JA8H 2R7ZH 1Q46A 3H0GH 3K0XA 3I7FA 4XIGS 2JA9A 1YJ9A 3F2CA 3PSIA 3KLWA 1KQSA 1VQDA 1C0AA 5C3EH 4NXNQ 5IP7H 1YITA 2YYZA 4JI4Q 2VUMH 1MJCA 2K52A 2Q2HA 4YWKA 3L7ZC 1OXSC 1XTDA 4OWTB 4JI0L 1CKMA 2NVXH 4GKKL 4LF9L 4YWMA 3NELA 2Q2IA 1Q12A 5JJIA 3J80i 2A19A 4L5QA 3CCLA 5M5XH 3CD6A 3CC4A 1N9WA 2VY3A 4ME3A 3RLFA 1DGSA 4LNQA 1TWFH 4B3SQ 1VQGA 3KF6A 1P8LA 3KF6B 1L1OC 2D0PA 1XJVA 4K0KL 1VQAA 2KENA 3T1YQ 5IYCG 1PA6A 1J5EL 3HOZG 3S1QH 2UUCL 2KBNA 2WFWA 2Q2TA 3GTLH 4KHPQ 1WFQA 4MTNA 3HOUH 5JJKA 1YIJA 4DK3C 1MIUA 1V1QA 1PYSB 1VQ4A 1VS0A 1T9HA 4X62Q 3CF5A 2K4KA 1N36Q 5JJLA 1ASZA 3M4OH 2ZJPA 1CSPA 2WAQG 4DR1Q 3GTJH 2B29A 4RG1A 2UXBQ 2HQLA 3RLNA 4DR4Q 3S1NH 2NVYH 3I4NG 4WJ3M 3LGJA 5IY0A 3AFQA 3IRBA 3RLOA 4DR5Q 1RIPA 4JI1L 3I4MH 4C3JH 2PMZE 3J81c 1Q82C 1A8VA 3L0OA 3Q8DA 2CWAA 1Y1VG 2VZAA 2LXKA 4YHHL 1YJNA 1TWAH 2ALYB 1N8RC 2IT1A 1PH7A 2JA7G 2K14A 3HKZG 1PH3A 2EIFA 1E7ZA 2MO1A 4OWXB 2NN6G 4DUZL 1PH8A 1I94L 3SGIA 4IPHA 4B3TL 1TWGH 2ID0A 1WI5A 4DK6C 2BA0A 2UU9Q 4DR2L 1KXLA 4LF4Q 1X3GA 2RHSB 4UP7A 5IP9H 5M3FG 4HJ5A 4IO9A 1K9MC 5GAEC 2E5LL 2RCNA 3MXNB 1MJEA 3H3VI 5GQOA 1YJWA 2HHHQ 4DR3Q 4LFAL 4JYAL 4KI0A 1B70B 2LSSA 2JA5G 3PIPA 2KCMA 1W2BA 2BH2A 5M5WH 4OWWB 4C3HH 3K7AH 1IYJB 4JBMA 1O7IA 4OO1G 4L5SA 5C4JH 1G51A 1X6OA 3RN2A 4R1JA 4UP8A 4HIDA 1Q8KA 1HR0W 3I55A 4HIOA 1NY4A 1JJGA 4BY7G 4EQ5A 2I5MX 3B6YA 3BJUA 4YY3Q 5JEAG 4JI4L 2CQOA 1PH2A 4TVAB 2ZJRA 1OXTA 2XGTA 2IX0A 2JJQA 3J7ZC 1EFWA 4GKJQ 4JCVE 5C4XG 3J80c 3OW2A 4DV1L 4WJ4A 3AYHB 4OXPA 2GVAA 3A74A 5LMNQ 2YV5A 1A62A 4LW1A 4A3CH 1JT8A 2WB1G 2RHQB 4LUVA 4YWLA 5FLMH 3T1HQ 3KFUA 4UP9A 4A3GH 3ER0A 1BBWA 5BR8L 2K5NA 1K0RA 3CMEA 4PZ8A 1Y1WG 1S3OA 3FKIH 1BKBA 4DR1L 1GKHA 1FGUA 2I5LX 2K75A 2JA6H 1IBLQ 4JI6L 1LYLA 3CC7A 2R92G 2A8VA 3HOWG 1IBKQ 4A3MG 5M5YH 3ICEA 1PV4A
chains in the Genus database with same CATH superfamily
1LTID 5IGFA 3K7AB 1E2ZA 1H9KA 3STBC 3NBIA 1HPCA 2YTVA 3OTOL 1BCPB 2KCNA 1UE6A 1VCIA 1O7ZA 5AJ3Q 4DNRB 2BOSA 4DKAC 2VQEQ 4A3LG 1KHIA 2MO0A 3VR6A 4PMBA 1NJIC 2N8NA 2F0TA 3M4QA 5E4WC 4NB3A 2K01A 4TRDA 1VQMA 2KJXA 4KD4A 4C2MB 3AEVA 4LF6L 4A3GB 2K5HA 2BA1A 1MSHA 2L15A 3HEJA 2F4VQ 2CWPA 4DXFA 2B63H 1VQ9A 4EGVA 3GTKB 1EEID 1AE3A 4NMZA 3KBXA 2ICEC 2K50A 1AN8A 3HOXG 1IBML 4HSVA 1PFBA 2NZOA 3A55A 5IYBH 1BO0A 1B9NA 1R4QB 3PV0A 3T1HL 1HUNA 1E24A 5D3IB 5EKKA 3OMGA 4J6HA 3W1BA 3K59A 4QQBX 4RCNA 3K58A 1E1OA 1XMQQ 2OCEA 1VMCA 1VQ8A 4KKUA 3V2TA 3EROA 2JA8B 4IUUA 1JMCA 4KY5A 2KEDA 2N3SA 4IOAA 1C4QA 3ZYYX 3KJPA 1SN8A 1FR3A 3L9AX 1FJGQ 3H0GG 3A0JA 1VQNA 3CP0A 1WTWA 1GHJA 5M5XB 5C3EG 1SNCA 4KV6A 2A1AA 2VUMG 2VQEL 1X32A 4DR7L 1LTSD 3NTKA 3GTLB 2EXDA 3HOUB 1FNVA 3TQYA 4LFBL 1ENCA 2EYLA 1EQVA 3BS1A 2WKDA 1LTLA 1CQVA 3KOJA 2UUBQ 2YTYA 1YNJC 4NXNL 2NVYB 1XXGA 2KVMA 4ZUJA 2B8GA 4WRDA 4XTCS 4IURA 3I4MB 4ZRZA 3Q24A 5CR3A 5A35A 1KD1C 2EZVA 4X65Q 3P1HA 3A54A 2B39A 2JE6I 1JICA 1EOVA 2F0JA 5FLXL 4C3JG 1EQRA 1TWGB 3OIPA 4IALA 3DXJC 4IUNA 4LF9Q 4Y52H 2AQ3B 1MKHA 1N36L 3F2BA 1U4LA 5EPLA 5D14A 3T13A 2AHOB 3C3LA 5IWAQ 2QDBA 2HT1A 4K5XA 4C3HB 2HUGA 4HIMA 4GLVB 5BN5A 3SHLA 1K8GA 2EE1A 3D8GA 3S2DB 4IFDG 3NEMA 1WD1A 4RGTA 2AWNA 3NQTA 1HA6A 5IGBA 4LF4L 4OL7A 3D4RA 3M4PA 2OWOA 1STAA 1UEAB 1YHQA 3GTGH 3G48A 1IKMA 1JCKB 3KUPA 4WJWA 1B1ZA 4G4KA 5CC4A 1QVGA 4C1NI 4RFBA 3A5ZB 1XYIA 3VYTA 1I4QA 5M3MH 1STYA 3D4WA 3RZOH 1S5CD 3I70A 1TWHH 5IGGA 4DAVA 2EJMA 5ELEA 1Y1VH 2F0HA 2JA6B 3SK6A 1IL2A 4H02A 3KLSA 4GN5A 1A6XA 3G7LA 5D65A 2D2CC 3NSWA 1NUCA 1CQFA 3WOFA 2X6GA 4XQJA 1SMXA 1A63A 2R3ZA 2EYHA 2NB0A 4YCVA 5BN3A 3ITPA 3JAMi 1BXTA 5LMUQ 3M3YB 1SE8A 2B2TA 3CCRA 1WTXA 3MXUA 3PO2G 4BBSG 4DV1Q 1B4OA 2XNAC 3DM3A 1ASYA 4FF4A 1VQ7A 1OTCA 5IWAL 2IX1A 3U4VA 3S24A 4IFDI 1OXUA 3GTMB 1ZYRC 2L55A 3CQZH 5CBAE 4OONA 2KUMA 4KN7C 4P75A 2B2TC 2VW9A 4JI6Q 1VQKA 5M3MG 2MUYA 2BH8A 1TY0A 2FFKB 1EOTA 3P75A 4A3FB 2YU9B 4K14A 4DV4L 4A3IB 4XDXA 3BZCA 2QGQA 1BOSA 1LUZA 2KHIA 3K57A 2ZXOA 2LMCB 1K3BC 4ILWA 4JW0A 3C46A 1D7QA 4A3DB 3KDFB 1DD2A 5CYUA 2R92H 1LLRD 2ZTDA 1XNRQ 3HOWH 1UE1A 1VQLA 1VQCA 4X66Q 3HRZC 3I73A 2RA4A 1EZ8A 4NKLA 4JI2L 4AQYQ 4L5RC 5GADC 4IQZA 2K6AA 4JI5L 4P73A 4A3EB 1CKOA 1H9SA 1CT1D 1RL2A 1STEA 3J7AV 3DMUA 4JPBW 2AKWB 1PH5A 1WOCA 2EY1A 2QA4A 3KF8B 4GKKQ 5FK9C 3DHQA 5LMUL 3TSSA 4KJNA 2NVTH 4LFCL 4DNIA 4LUZA 4ZAIA 4DR6L 1JORA 4GS3A 4DK1A 3GTPH 2EY2A 1IXRA 3MAQA 4GOPB 1LTGD 2F3VA 4DV3L 2MGSA 2A5HA 2VQFQ 4Q5VA 1YEZA 1TKWB 1KL9A 2FMMA 1DM0B 2DY7A 1S5ED 1U0LA 5KNCA 1K83H 3N52A 5CORA 4YHHQ 3OHXC 1KDAA 1QNKA 4HSPA 2B2WA 4B3RL 5JJZA 3UDIA 4UY8C 3EN2A 3ERSX 1EYDA 2R93B 1AEXA 3I3CA 4DV7L 1E2VA 1KAWA 1QVCA 1XTCD 2HIXA 3VR3A 1WTQA 4P72A 1WTPA 1NMGA 1BBUA 2RSOA 3IFTA 2KCCA 3R2TA 3R8BA 3PO3H 4CJ0B 1L0XB 2B2WC 1L1OA 3NBHA 5KNDA 1WTHA 1FNWA 3K0XA 2H1EA 1QNUA 3KLWA 4QUCA 3Q22A 1HTLD 3N6RA 1C0AA 2TMPA 1YITA 4PMCA 4JI4Q 1GUTA 1MJCA 3HOZB 2CQAA 2L4NA 1XTDA 4GKKL 4ME5A 4YWMA 1F2LA 3EFXD 3S15B 3CC4A 3RLFA 1VF5C 2EY6A 4LNQA 2E2IB 4B3SQ 1FGBD 3MWYW 3A7LA 1L1OC 4K0KL 1J5EL 1EYAA 1NR2A 1PA6A 3S1QH 4KHPQ 2Q2TA 2KQ3A 5JJKA 1JB3A 1V1QA 5LHY1 3MHBA 1VS0A 1T9HA 3PIO3 4HN7A 4X62Q 5KNBA 4DU9A 3ERQA 2JA7B 5KYIA 2B29A 4RG1A 3GTJH 2UXBQ 2HQLA 3S1NH 1G6ZA 4WJ3M 3LGJA 4CKEA 1G91A 3TP5A 4JI1L 5A2QL 3J81c 1A8VA 4YHHL 2R7ZB 2CWAA 1ZEQX 1LT4D 1YJNA 5EGTA 2M2LA 2A73B 2EIFA 1E7ZA 4OWXB 1SMYC 3SGIA 3URYA 1HXYD 2UU9Q 4G7ZC 4OGQC 1X3GA 1IYVA 5IP9H 5M3FG 2EYMA 1K9MC 2RCNA 3H3VI 1YJWA 4LFAL 1BDOA 1EWHA 1M4VA 2M9VA 1F2MA 4BY7B 3LWUA 3FEWX 2JA5G 1WVLA 2LFNA 4OWWB 5C4XB 1X6OA 2NBFA 4UP8A 4HIDA 1Q8KA 2XSCA 1SJHD 4JI4L 1PH2A 5A2QE 2XGTA 2DNEA 3J7ZC 4GKJQ 4JCVE 4XYOA 1ET9A 3NHHA 4WJ4A 1UAPA 5FO9B 3KLSX 5LMNQ 4ZCKA 1ENAA 1TWCB 1K0SA 1JT8A 4YWLA 2A74C 1Y1WG 3H09A 1ENFA 1FGUA 3QOJA 5ISRA 1K8MA 3CC7A 1IBKQ 5M5YH 1S4ZA 5FKAC 4YIJA 2L0CA 5I6YA 3SEBA 1QG7A 5C4JB 4EQPA 4A3KG 4OX9L 4JI7Q 3HOVG 1Q1EA 5G3LF 1SE2A 3BDOA 3CAMA 4R4OA 2R93G 4XXEA 3K81C 3AB9A 2VNUD 3G71A 3S14H 1SNMA 5DM73 3K80C 1GOZA 1Q86C 5CV8A 3BDLA 4X64Q 3PUYA 3TBIB 1DXMA 2PQAA 4A3JH 1HQRD 3S16H 1FL0A 4XT3B 1PRTB 1JWUD 2MP1A 2Z8LA 3VA5A 5C44H 1GUSA 2KECA 4IOCA 3HOXB 3GTQH 4G57A 3E9IA 2LXJA 2XN9C 5H1SE 4DAYA 2N55A 1XNQQ 3U9SA 4DUYQ 4DV6Q 4DV5L 1EIFA 3WDNA 1VDZA 4GN3B 3T53B 1HNXL 3NXWA 3J7YW 2JP1A 1QZGA 2OQKA 2UXDQ 2F52A 4GNXB 2E2HH 2G5DA 4BY1G 1K8OA 1UE7A 4LF5Q 1J8IA 4R4IA 3HKZE 4C56C 3DEOA 3JAML 4HJ9A 2PW5A 3H0GB 4DAMA 3K7UC 4BA2I 1ICFB 4BXXH 4FDBA 2VUMB 4EQOA 3U50C 4DV2L 1CKNA 1UUPA 4BBRG 3HOYH 2NVXB 2R7ZG 2JQOA 3NTIA 4O0AA 4H44C 1KNAA 1X3FA 4A3JG 1TWFB 1WYDA 1ILPA 2IW3A 3BDCA 1CA6A 3MEHA 3I90A 4HR7B 2KHJA 4NXML 4A3BH 4V0BA 1SYFA 3AMUA 2WACA 4A93H 1TT2A 3KDFA 3CW2C 2K28A 4HIKA 3NQIA 2F0FA 3PMFA 3K5OA 5M9OA 1JOQA 1N34Q 4DAPA 1XPOA 5NUCA 2G9HD 3FP9A 3Q23A 3RN5A 2ASBA 2RKSA 1UWVA 5EJWA 5ELBA 1RJTA 1S5FD 1LO5D 5CGKA 4EX5A 1GJXA 3T1YL 2DUDA 3BYYB 1KIXA 2QDLA 2F0SA 1AW7A 3F2UA 1HH2P 2ZTCA 1EFID 3G6EA 4BA1I 2XTIA 3BG3A 3F8TA 3EBEA 2MJ8A 1B2TA 2CVRA 1R9TH 3M7GA 3GO5A 1TS5A 3M7NA 1GHKA 1EU4A 2EYFA 3R2IA 2UUAQ 3PIP3 3TP7A 2C9OA 1LT3D 1RF2D 4A3BG 1GUNA 2Z6BA 2Y0SE 4HAEA 2F0VA 4A75A 1VQOA 1F77A 5CV4A 4B3MQ 4OIKA 4DR3L 4HMJA 1IHZA 3PIOA 1HQMC 1FNUA 4X3KA 3I4NH 3BYTB 4KHZA 3L2PA 2HCIA 2E5LQ 1YHBA 2E2JH 5EPJA 2AQ1B 1EY6A 2RDHA 1J6QA 4WFN3 4A3CG 2NTSA 2D62A 4LK1C 4WORA 2CCZA 3VYSA 1A2TA 2D0OA 4K5VA 3CCEA 2DY8A 2F0KA 2NN6H 1GM5A 5DAUA 3FKIG 3A8JE 3PO2B 4BBSB 1SRUA 4RMFA 1O78A 1I6HB 1TXYA 2A68D 2J0TD 2N88A 2K5VA 5E7NA 4ALPA 1G2SA 1KLUD 2NZ1D 2R6GA 5EPKA 4LWCA 3U58A 1SDFA 4OO1H 1D2BA 4HJAA 4HCEA 1IBLL 2I5HA 2PI2A 3PCOB 1NNXA 5M3MB 3QG1A 3GTOH 1E3PA 1HZAA 3LX0A 1D8LA 3D6CA 4PQXA 5C4HA 2C35B 2C5CA 3HKSA 2IHFA 2UUAL 4LF7Q 4DPGA 2PPBC 5JAVA 1SFOH 2WINB 1Z9FA 5EKLA 1I3QB 5AJ3L 4R4QA 1SXTA 4NP5A 4RAUC 3RZDH 3QOLA 2EYJA 2LKVA 4B3ML 1YNXA 2NWGA 4JOIA 2ZM6Q 3MA2B 1PRTD 5EBDA 2B63G 2JEAI 3CKIB 4R8NA 3TN2A 1Q8IA 1L0YB 4QMGA 2F03A 4QL5A 2HD3A 2F0IA 3ND8A 1PH6A 1QUQA 4X3TA 1XMOQ 2F3WA 5IYDH 1JOKA 3QIAA 5IIFA 3CRKC 2F4VL 2SNMA 5IYBG 2NVQB 2D5DA 5LL6X 1EY0A 4JI3Q 4JOIC 1CZGA 1W6KA 3ZJYC 2WV6D 5E4XA 5C0XH 3GQBA 2HDMA 3FHWA 1SYCA 1WTOA 4X3UA 2BCOA 3T4AC 4IUTA 1HNWQ 1F9RA 3FVQA 3K5MA 1Q90A 2A6HD 3OYYA 2B3GA 3NWTA 1XMQL 4HJ8A 4AYBE 1SBBB 3M9BA 1K8AC 3C1EA 1I5FA 2ZJQA 4KD3A 4C2MH 4TQUS 3EJIA 2F0WA 1X3EA 4K5WA 3X3NA 1XPUA 3K8AA 3RNUA 3SXHA 4LF7L 1A15A 1KRSA 1FJGL 1HR0Q 2MNAA 1E0BA 1I6VC 3SDZA 2RBMA 2Q8IB 3VYUA 1EIYB 2OEOA 3I4LA 5FLXE 5GAHC 4JV5Q 1MSGA 1AFPA 1E22A 2ZM6L 1N33Q 1HJPA 1STGA 1NR4A 3HG9A 3S1MB 2NVTB 2HIVA 2UUBL 3OMCA 1SNDA 3VR2A 4EVOA 1A3VA 1C7YA 5FLXc 5FJ8H 2EOTA 3K5NA 4ODGA 3A5UA 4IJHA 1C48A 1WTVA 4X65L 2JA8H 2JA9A 1HHVA 1DYQA 4Y7NB 5IP7H 4UAIA 2K52A 1QJOA 2PCFB 3FPUB 4OWTB 1CKMA 4LF9L 1ZXTA 4C1NK 3J80i 5M5XH 3CD6A 1N9WA 4E6IA 1DGSA 2DJGC 4OIJA 2TSSA 1VQGA 3KF6B 3S2HB 1PXUA 5BN4A 1BCPD 2KBNA 3GTLH 3HOUH 1YIJA 4DK3C 1VQ4A 1LTBD 3HZXA 4J1MA 2PYKA 4DA2A 5JJLA 3M4OH 2ZJPA 2WAQG 3SE0A 4KMUC 4DR4Q 2NVYH 4DN4M 1ONLA 5DNFA 3PO3B 3AFQA 4JK1C 4XT1B 4DR5Q 1RIPA 3I4MH 2L5TA 1RD9D 4DGZA 1Q82C 2F4IA 2VZAA 1Y1VG 3WOEA 2ALYB 5M3FB 1SE3A 3HKZG 1PH3A 4XQNA 5JVH3 1PH8A 3D4DA 1TWGH 1KXLA 1EQTA 2JA5B 2VXWA 5GAEC 1KDCA 5IT9L 3MXNB 2HCCA 5GQOA 4Q0FA 2HHHQ 2CW0D 4KI0A 1B70B 3K6OA 2NTTA 2A6HC 3PIPA 2KCMA 2X69A 5CV9A 3T16A 2Z9HA 3QB3A 4C3HH 1IYJB 3FPPA 1O7IA 3NP8A 1U4PA 3GV3A 1JR0D 4R1JA 1HR0W 1PTOB 4HIOA 1NY4A 1EY8A 1X3PA 2I5MX 3BJUA 4YY3Q 1JWSD 5E1FA 2EY5A 2F0NA 2ZJRA 5FO8B 1OXTA 1STHA 1V1PA 2PZUA 4DV1L 1Y1WB 3AYHB 1EY5A 3A74A 1LT6D 1EL0A 3CU7A 2RHQB 4LUVA 4R8IA 3M4YA 1PLFA 5FLMH 5K5PA 4UP9A 5DEHA 5KGUA 1QCBD 2K5NA 1S3OA 5IT9E 4A3KB 1B9MA 4AYBB 2I5LX 2XIWA 4KKSA 5I9PA 3HOVB 4QF4A 2JA6H 4JI6L 1LYLA 2R92G 2A8VA 4DF7A 3HOWG 1Z6HA 3TDQA 3TP6A 2G9DA 2JSOA 4ULLA 4APVA 4N9TA 2CHBD 3CRLC 1CSQA 1C8CA 4DK0A 3VDYA 1XNRL 2AMCB 3IFDA 4K6LA 4X66L 1JQYD 3CCJA 2Y0SG 1KNEA 4AQYL 1VQBA 3OWFA 2LY7A 1SSOA 1JE5A 3I56A 1PVOA 1GD7A 2UXCQ 3TRZA 1SNPA 2HDLA 4OELB 1TS4A 1ILQA 2FMCA 3M85A 2I0QA 2OXPA 5CMDA 2QF7A 1K3RA 3MFYA 3S17H 2BDOA 2AQ2B 3KJOA 4A3FH 1WJJA 3T56B 1NCVA 2K5WA 4A3IH 3I4OA 4ID6A 4BY1B 2MFIA 4RA8A 4IZ8A 4HMIA 3EIVA 1MBYA 1PDQA 1DCZA 2VQFL 1VQ6A 2F1MA 3CPWA 1EQQA 1LTTD 3WWVA 1KC8C 4GLAC 4IUVA 1PYBA 4CDDC 4BBRB 1I50H 4X3SA 2Z6KA 1KTKA 1SYGA 4X6AH 3OWEB 1XPRA 4A3JB 1FD7D 4A3EH 1UEBA 2F0UA 4J15A 2CW0C 4LAAA 3PO3G 1PFSA 3L3OC 1CK1A 1DZ1A 3V96A 1WCMH 2H5XA 5K36H 2ATWA 4O42A 2Z0SA 1SNOA 4PZ7A 5JEAJ 3C1FA 1H95A 2Z6KC 3IAYA 4AH6A 1SYBA 3E9HA 1A0IA 5J3BA 2D9UA 4QY7A 3PGZA 4Z9CB 3J7A5 1B3QA 1LACA 4PMWA 3H15A 2L9HA 3V05A 3TEHB 2SOBA 2Q8RE 4IPDA 4C3IH 1HFNA 2WB1E 4B08A 3CCSA 4B3SL 1MI2A 3KYHC 4IPCA 2DNCA 3U9OA 3UDXA 4KHPL 1XX8A 1PZKD 2JK8A 4X62L 4M1UB 4P2CB 2K7VA 2UXBL 2E76C 3E6ZX 5EAYA 3FRPB 4RGMA 1GVPA 1NSNS 1X65A 4FNFA 2UUCQ 4A3BB 3GP7A 5IP9G 1U5KA 3UE1A 5DM63 3OSOA 5M5WB 5F2DA 4JBWA 4IJLA 4QCLA 5C5LA 4G7HC 4AYBG 2F3IA 1NBWA 2L12A 1DJRD 5LL6S 4PNYA 2CH4A 2I46A 3CCQA 2EJGC 1KDBA 1V43A 2UU9L 3HOZH 5IYCH 1VQHA 3PF5A 2WP8J 3S15H 3TREA 2E2IH 1OXVA 2DN8A 1PTOD 4DUZQ 2ES2A 2O4XA 1R4PB 4C3IG 2V1CC 2J7ZA 5KIXA 4CGYB 2JYOA 3FKIB 3PUVA 2JN4A 1OXXK 2JA7H 3VYRA 5I4DA 2PNHA 3MXPA 3I2ZA 1G6PA 4HJ7A 4BS9A 2WIIB 3STBD 1F9QA 1B44D 2N49A 1P16A 4GKJL 5C3XA 3TZUA 1S5DD 4OEMB 3A56A 3HFZB 5CV7A 2WAQE 2AUKA 5LMNL 5COYA 1S40A 1PMRA 1AE2A 2MPMA 4CJ1B 1EYCA 2BE5D 1C9OA 1NMFA 5HY6A 2ICIA 1V1OA 5J22A 1IBKL 4BY7H 5JEAH 1SLJA 4JI7L 3JC66 5BR8Q 4R4TA 3J80L 3R3OA 5C4XH 3E5SA 2R7FA 2M00A 1YBYA 4FO2A 2IWHA 2B63B 2QILA 1CZWA 1VQPA 1EUJA 5C44G 5LMNW 1Q81C 1CFMA 4FF1A 1RHPA 4QB4A 4JI8Q 3OTOQ 4X64L 1QZHA 4RCOA 1TWCH 3BZDB 2SNSA 3CC2A 1IZ6A 4A3MH 1V9PA 3Q6SA 4DFAA 1MGSA 3JAME 4ZKCB 1GUOA 1UE5A 3C2PA 2B2VA 1H9SB 3DEPA 5FO7B 1XNQL 5ELDA 3J80E 4LF6Q 1F2YA 1VQJA 4DUYL 1SAPA 4DV6L 4A3LH 3KF8A 3JAMc 4JI0Q 4POFA 4BXXG 1HTPA 2F0DA 3NENA 5D3DA 4IFDJ 2UXDL 2SEBD 3HOYG 2FXQA 2PNRC 4LF5L 3W1GA 1LTRD 5C0XJ 1IBMQ 1X54A 2B2VC 4GOPA 1KRTA 3FDTA 3UE0A 4RWSC 1HZ9A 2CH4W 2XVSA 1ZKOA 3QJYA 3EA6A 2RVLA 4TKOB 4UDUC 4RGNA 3NUCA 1VQIA 4A93G 1AP0A 3IKJA 3KBGA 3HOXH 1D1IA 3J81i 3EVQA 1X3QA 1SROA 3DLLA 2R7DA 4TSSA 2EYPA 2YTXA 4GLXA 4GOPC 1QVFA 4JI8L 3RMHA 1VQ5A 4FF3A 3DUZA 1FYCA 3QR8A 3VR4A 4ABNA 2EQSA 2F0QA 3UDGA 1Q7YC 3S1RH 4I7ZC 4A76A 1N34L 2B8FA 1BVSA 3ND9A 4DR7Q 4I65A 3R93A 1MHWC 1QE6A 2BE5C 4LFBQ 1L1OB 3NBHB 1DONA 3MC0B 1PFNA 2RCFA 1Q46A 3H0GH 1YJ9A 2FINB 3PSIA 4IUPA 5C3EH 3RUZA 2L1BA 4NXNQ 1F2ZA 2YYZA 2VUMH 2Z4IA 1CHQD 4YWKA 3L7ZC 4JI0L 1BNZA 2NVXH 1TS3A 3NELA 3MZ5A 2Q2IA 1RTNA 4L8JA 3SK4A 4L5QA 3GTGB 1JWMD 1V8QA 4ME3A 2K03A 1TWFH 4IUQA 2WAQB 4CDFC 5JJIA 2D0PA 2IX3A 1VQAA 5CV6A 5J39A 2WFWA 4MTNA 1WTRA 3TZDA 3RZOB 5C5MA 1PYSB 1DOKA 4U673 2XRQD 1TWHB 1I4GA 2K4KA 1N36Q 1Y1VB 2K33A 1ASZA 3H91A 4DR1Q 3HKZB 3SVMA 1LABA 3RD4A 3I4NG 2ZT9C 1WD0A 5IY0A 5T1IA 3RLOA 2F0MA 4K8IA 3HS0C 4R9WA 4C3JH 2PMZE 1U4MA 2Z1CA 1F9PA 1N8RC 4ZK9B 1IL8A 1TWAH 3UI2A 1PH7A 2IT1A 1KLGD 1T5XD 2K14A 4H0LC 2BDNA 4J8QA 2IL8A 2NN6G 1RTOA 1BUVT 3D3RA 3S9WA 2ID0A 3ONAB 5IODA 4KY6A 4LF4Q 2RHSB 4HJ5A 4IO9A 2E5LL 1ESFA 2J4XA 2IPKD 2QW7A 4CDEC 2QCPX 1SE4A 3VA7A 1JOOA 1ZYRD 4CKCA 2LSSA 4IFDH 2RSNA 1QWYA 3FMCA 1B50A 3CQZB 2P5ZX 4EQNA 1W2BA 2BH2A 4OO1G 4FVMA 3K7AH 5AFWA 4L5SA 3M4OB 1TVXA 3RN2A 1PRTF 3I55A 5IGDA 1BR9A 1PFMA 2JXMB 4EQ5A 3B6YA 5ELCA 4TVAB 3MFGA 3I8ZA 3A8KE 3W2DA 1EFWA 3OW2A 3E3XA 5KYLA 4DNTB 1B3AA 4HTHA 2YV5A 1A62A 1W6JA 1LTAD 5C3WA 2WB1G 2R92B 1AZQA 3KFUA 3HOWB 1I4RA 4V190 4A3GH 4BWGB 1HRJA 1BKBA 4DR1L 1PZID 2DJFC 2A6ED 1K28A 3I72A 1IW7D 3GTKH 5IYDG 1X55A 2NN6I 1EU3A 5CV5A 1SEBD 1TR5A 2WKCA 3PO2H 3UDFA 4BBSH 3SK8A 2O5IC 1QB5D 2VL6A 5HGTA 1I6HH 1YNND 4ZLTF 5JPNC 4GZYC 2Y0SB 4JVZA 1XWEA 2E75C 2A68C 2OT2A 3PUXA 4P71A 1S5BD 1H9JA 2MHVA 4F88A 4DV4Q 3MVVA 1XMOL 5C0XG 1U4RA 2HQEA 3OIQA 5L37A 1I4HA 3GTPB 4OO1I 3BVMA 1ICWA 4K6DA 2Q8TA 5I2XA 3PQIA 1PHJA 1Q1BA 4JI3L 1IYUA 2PQAB 4HCSA 3CCUA 4I7AA 2K32A 1K83B 3U4ZA 1JJ2A 3QO2A 4JI2Q 1HNWL 4G7OC 4IPGA 4JI5Q 1I3QH 1X9NA 4A3GG 4DAYB 4NW2A 4R4CA 2F0GA 1U9RA 3CPFA 4N8X1 1S72A 1D5ZC 2CFMA 4FP5D 2K04A 3ULPA 2E74C 3NPPA 1EIGA 2PI2E 3W3AA 1UNSA 2VB2X 2E8GA 3OOCA 4O1NA 4JC0A 3G4SA 1PRTC 4JBKA 5I6WA 4LFCQ 4PG3A 3H6MA 3X3MA 4GNXA 2QEJC 4DR6Q 4LMQD 4LF8Q 3K0YA 2L11A 2PQEA 1HR0L 4JG2A 1G2TA 2NVQH 4DXGA 4KJOA 4DV3Q 1GXDC 3O13A 2ENBA 5FJ8G 4JV5L 2NZHA 1BCPF 2RQXA 1NAPA 2LS01 5CBEE 1CKNB 2ZTEA 2JA8G 1N33L 1E2WA 4A4IA 2PMZB 5C0XI 5DLQE 3S17B 4MN3A 4GNXC 1AZPA 5IP7G 4B3RQ 1JB7A 1W3SA 3MEFA 1LM0A 3PUZA 4FXKC 3CCVA 3S1QB 4KLKA 3F1ZA 1ESRA 4DV7Q 4L5TA 1HZCA 4CDCC 5IGEA 1G291 1KABA 2IY5B 1CHPD 1VMPA 3KLRA 3GTJB 3S2DH 4LUOA 3S1NB 3GV6A 1RCVD 2NYZD 3OW7A 1M8AA 3HOUG 5EQ0A 2I07B 4MIUA 1I50B 1YHAA 2SDFA 5JVG3 2OTLA 3BU2A 4MZ9A 4YCUA 1RDPD 4ZQ3A 2RF4A 4QUFA 4UHVA 2XRSD 2XWBB 1SMYD 1H9RA 1PZJD 1SNQA 1Z7TA 5KEEA 3AQQA 2A6EC 3I4MG 2FHTA 2EJFC 1IW7C 1WCMB 1K73C 2O5JC 4CKBA 1HA5A 4JBJA 1LT5D 2MQHA 5E3FA 3H3VH 5TSSA 1YNNC 3S1MH 4AIMA 3DWAA 2K1BA 4DR4L 2AUJD 4LF8L 4K0KQ 4F7XA 1J5EQ 1Y69U 1RKNA 4DR5L 2KA7A 4P74A 5J1ZA 4OHJA 1D5MC 1EZ6A 1F9SA 3TP8A 4KKTA 1EWIA 3ULJA 5IT9c 1FVIA 2FJ2A 4KK7A 4Y7NH 2Q2UA 3TS2A 1PH1A 1GUGA 2OQ0A 3M3YH 3J81j 4C3HG 4JI1Q 1I4XA 1VQEA 2OTJA 3RR5A 4K2LA 4C3IB 1SYDA 2X6LA 1X56A 3BVZA 3G6JB 4M8AA 2KOLA 4XYQA 1HCZA 2CKZB 2HHHL 4MTKA 3S2HH 1N32Q 4ZUIA 1HNZQ 1CUKA 2IHEA 3IL8A 5GROA 4N9PA 1BCPC 3J81L 3GTMH 3CXCA 3F2DA 4LFAQ 1STNA 4YY3L 1JJCB 3GD7A 5FLMG 1QILA 2JEBI 5M5YB 1YVCA 3GDEA 2YU9H 4DV0Q 4FXDA 1GO3E 1SR3A 5ELNA 4RHRA 2EVBA 3D6WA 5M3FH 4LJZC 2JA6G 1Q3LA 3TMEA 2PZWA 3D31A 4MNOA 4A3DH 2O2LD 3CCMA 2ZXRA 4F8MA 4CBVA 1O80A 1J9OA 1Y8OB 1ML0D 2KCTA 3PUWA 4B9WA 2JA5H 1YI2A 3W5OA 3S14B 1E1TA 2GA4B 5C4ZA 1SJED 3KK7A 3ULLA 1B53A 3D0FA 5GAGC 1KAAA 5EKIA 1RODA 1EY4A 1D5XC 2K5QA 2N78A 3E0JA 3J81E 3S16B 1DOMA 1G8ZD 5C44B 1A3TA 2PO4A 3DM1A 4K2KA 1A2UA 3GTQB 1PTOH 5HGQA 1CM9A 2B2UA 1Y8PB 3BZKA 3HGBA 2PW7A 3SR1A 1D6EC 2NUCA 1VQFA 4OX9Q 1B8AA 3K5LA 4QIWE 1Y1WH 5ELFA 2VS1A 3CMAA 5IOCA 1CA5A 1N32L 4NPSA 1BBXC 1HNZL 4A3FG 5T1GA 3DWQA 2E2HB 3NWSA 4A3IG 2UXCL 3CHBD 1QUQB 3NTHA 2GVBA 1I4PA 1B7YB 4F87A 2QEXA 2F0OA 1Z47A 1AH9A 1SYEA 5JPMC 1TQOA 2B2UC 4A3KH 1L0WA 3HOVH 4A3DG 1DOLA 1NE3A 1NTGA 1QOHA 1YZ6A 4XQQA 5IE8A 5HURA 4KTAA 1Y14B 4GN4B 4L63B 5ELOA 1II3A 4DV0L 2R93H 3HOYB 4FXGC 4QJFA 2F0PA 4N8FA 4YCWA 2EDGA 4RKLA 3HP3A 4A3EG 4O2DA 2OF1A 5I2YA 1EYGA 2K5DA 4RKBA 1HZBA 4HEDA 4FYDA 1WCMG 1A3UA 1HUMA 2EXZA 3A8IE 1PH4A 4DV5Q 5K36G 4S3SA 1IKLA 1PH9A 4POGA 2E2DC 4A93B 1HNXQ 2F0EA 5G3LD 3P20A 1BQQT 1HFGA 3PF4A 2AWOA 1PYWD 1EEFD 4A3MB 4UPAA 2KEEA 2R61A 4KHVA 2K05A 3AFPA 3NK9A 2ZXPA 5I9OA 1M90C 4DV2Q 3QWNA 1I94Q 3J7AF 4B3TQ 1EWCA 1Y8NB 4BY1H 1GUWA 2KHSA 4DR2Q 1L2FA 4QGUA 3TS0A 4U68A 5IGCA 3DWPA 2A69D 4ZKBB 3LWEA 1TU2B 4PZ6A 4RH6A 3OPOA 2DGYA 1R9TB 4JYAQ 1TIID 4RGOS 5KRUA 1CI3M 2GN5A 2QKIC 3VR5A 4NXMQ 4BBRH 1CTMA 3E0EA 1M1KC 4FF2A 2XWJB 2R7ZH 3I7FA 4XIGS 1EY9A 3F2CA 4CJ2C 1KQSA 1O7YA 1VQDA 1PTOF 3H3VC 2Q2HA 1OXSC 3AU7A 1Q12A 2A19A 2EPBA 3CCLA 2VY3A 3KF6A 1P8LA 1XJVA 2KENA 3T1YQ 3HOZG 5IYCG 3I4NB 2UUCL 5EBCA 1TS2A 1WFQA 1MIUA 1T5EA 4ZYSA 1STBA 1D1KA 3CF5A 2E2JB 1CSPA 2H4OA 3S1RB 1OO9B 3RLNA 5FOBB 3IRBA 1EIHA 4K8JA 1EY7A 3Q8DA 3L0OA 2LXKA 4MHEA 2JA7G 4NDXA 2V4DA 5C3EB 2MO1A 3H94A 2B2YA 4DUZL 2F0LA 1I94L 4IPHA 4B3TL 4H13C 1MD2D 1WI5A 4DK6C 2BA0A 4KN4C 4DR2L 3T51B 4H7BA 4UP7A 2EYOA 3MTSA 1JC7A 5JOBA 3NE5B 4QIWB 3MXNA 2Z4HA 1MJEA 1VF7A 3A7AB 4DR3Q 4JYAL 3I91A 4L6TB 3GTOB 1ET6A 1H9MA 4IN3A 5M5WH 1TY2A 1LV9A 4JBMA 2IJ0A 5C4JH 1G51A 2B2YC 3BVGA 3Q0AA 1SFOB 4CHTB 5C6AA 1JJGA 4BY7G 5JEAG 4PV1C 2CQOA 2RDFA 2WB1B 4C3JB 3RZDB 2IX0A 1V1PB 2JJQA 1JE4A 5C4XG 1O7LA 1TWAB 3J80c 4OXPA 4KY7A 2GVAA 1YNJD 3P7JA 4LW1A 4A3CH 3MXGA 3SK5A 3T1HQ 4RHSA 1PTOC 2VB3X 3ER0A 1BBWA 5BR8L 2RDGA 1K0RA 3CMEA 4PZ8A 3FKIH 3EQLC 1GKHA 3LNNA 2K75A 1IBLQ 2A69C 4B9XA 2PZTA 1BF4A 4A3MG 3ICEA 1PV4A
chains in the Genus database with same CATH topology
3GTKH 5IYDG 1X55A 4APVA 2NN6I 3STBC 4A3KG 4OX9L 4JI7Q 3PO2H 3UDFA 4BBSH 3HOVG 2VL6A 2YTVA 1Q1EA 1I6HH 1CSQA 3OTOL 1UE6A 1VCIA 3PUXA 5AJ3Q 3VDYA 3CAMA 4P71A 4R4OA 4DKAC 1XNRL 2R93G 2AMCB 2VQEQ 4A3LG 4DV4Q 1KHIA 4X66L 2MO0A 5C0XG 1XMOL 3K81C 2VNUD 3G71A 1NJIC 3S14H 2N8NA 3CCJA 2Y0SG 3K80C 3M4QA 1VQBA 4AQYL 1Q86C 4OO1I 4X64Q 3PUYA 4NB3A 1PHJA 1Q1BA 4JI3L 1VQMA 2PQAA 3AEVA 2PQAB 1JE5A 3I56A 4A3JH 1PVOA 4LF6L 1GD7A 1FL0A 3CCUA 3S16H 2K5HA 3TRZA 2UXCQ 2BA1A 5C44H 2L15A 3U4ZA 4IOCA 2F4VQ 1JJ2A 2CWPA 3M85A 3GTQH 2I0QA 4JI2Q 3E9IA 2LXJA 1K3RA 1HNWL 2B63H 3S17H 4IPGA 5H1SE 1I3QH 4JI5Q 1VQ9A 1X9NA 4A3GG 4DAYB 1AE3A 4R4CA 3KJOA 4A3FH 1WJJA 1XNQQ 3CPFA 1S72A 4A3IH 4DUYQ 2CFMA 2K50A 3I4OA 4DV5L 1EIFA 4DV6Q 3HOXG 3ULPA 2MFIA 1IBML 4GN3B 1HNXL 2PI2E 2NZOA 5IYBH 2E8GA 3EIVA 4JC0A 3G4SA 4JBKA 3PV0A 2VQFL 3T1HL 2OQKA 1QZGA 2UXDQ 1E24A 4LFCQ 4PG3A 2F52A 3W1BA 1VQ6A 3CPWA 4GNXA 4GNXB 1EQQA 2E2HH 1XMQQ 1E1OA 4LF8Q 4DR6Q 2OCEA 4BY1G 4QQBX 1UE7A 3WWVA 1VQ8A 4LF5Q 1KC8C 4GLAC 3HKZE 1PYBA 4R4IA 1HR0L 4JG2A 4HJ9A 1I50H 2Z6KA 4BA2I 4DAMA 3K7UC 2NVQH 1JMCA 4X6AH 4DV3Q 1XPRA 4BXXH 2N3SA 4A3EH 5FJ8G 4FDBA 4IOAA 4JV5L 2NZHA 1UEBA 4J15A 3PO3G 3U50C 4DV2L 1PFSA 1CKNA 1CKNB 4BBRG 2ZTEA 3HOYH 3KJPA 1SN8A 2JA8G 1WCMH 1FJGQ 2JQOA 2H5XA 3H0GG 3A0JA 4O0AA 1N33L 3CP0A 5C0XI 4A4IA 1VQNA 2ATWA 5DLQE 4GNXC 1X3FA 2Z0SA 5C3EG 4A3JG 5IP7G 1WYDA 4B3RQ 4PZ7A 1JB7A 1W3SA 2A1AA 2VUMG 2VQEL 5JEAJ 3MEFA 1LM0A 1H95A 3PUZA 3CCVA 2Z6KC 4DR7L 4KLKA 3F1ZA 4DV7Q 2EXDA 4L5TA 4AH6A 1HZCA 2KHJA 3E9HA 3TQYA 4NXML 4A3BH 1A0IA 5J3BA 4LFBL 1G291 4A93H 2IY5B 1LTLA 3KDFA 3CW2C 3PGZA 3KOJA 4QY7A 2UUBQ 2YTYA 4HIKA 3J7A5 3S2DH 4LUOA 4NXNL 4PMWA 3H15A 3HOUG 1N34Q 1XPOA 3FP9A 4XTCS 3TEHB 3RN5A 1YHAA 2ASBA 2OTLA 1UWVA 3BU2A 4MZ9A 4IPDA 4YCUA 1KD1C 4X65Q 4C3IH 2RF4A 2WB1E 3CCSA 2JE6I 4B3SL 3AQQA 1EOVA 4EX5A 3KYHC 4IPCA 2DUDA 3T1YL 3I4MG 4KHPL 1EQRA 3UDXA 1KIXA 1K73C 2JK8A 4LF9Q 4Y52H 4JBJA 4X62L 1MKHA 1N36L 1HH2P 2MQHA 2ZTCA 3H3VH 3S1MH 3G6EA 4BA1I 2XTIA 3F2BA 2UXBL 4AIMA 5EAYA 3F8TA 4DR4L 3EBEA 1GVPA 4LF8L 4K0KQ 1X65A 2AHOB 1J5EQ 1R9TH 4DR5L 5IWAQ 2UUCQ 2HT1A 4P74A 5IP9G 3GO5A 1U5KA 3UE1A 3M7NA 4HIMA 4JBWA 4IJLA 4GLVB 4AYBG 2F3IA 1EWIA 3ULJA 5IT9c 2UUAQ 1NBWA 1FVIA 1K8GA 4Y7NH 2Q2UA 3TS2A 4IFDG 3NEMA 1PH1A 3CCQA 2AWNA 2OQ0A 4A3BG 1V43A 3M3YH 2UU9L 3J81j 3HOZH 5IYCH 4JI1Q 4LF4L 2Y0SE 2OTJA 1VQEA 4A75A 3RR5A 2OWOA 3M4PA 1VQOA 1VQHA 3PF5A 1YHQA 2WP8J 4B3MQ 1X56A 3GTGH 3G48A 3S15H 3TREA 2CKZB 2HHHL 4DR3L 2E2IH 1OXVA 1QVGA 3PIOA 3A5ZB 3S2HH 1N32Q 4DUZQ 2ES2A 1HNZQ 1CUKA 2IHEA 3I4NH 5GROA 4KHZA 5M3MH 2V1CC 3RZOH 3GTMH 3L2PA 3CXCA 2E5LQ 1TWHH 1YHBA 3PUVA 2E2JH 1Y1VH 1J6QA 1OXXK 2JA7H 3F2DA 4A3CG 2D62A 1IL2A 4H02A 4LFAQ 4YY3L 2CCZA 1JJCB 2PNHA 3GD7A 2D0OA 3I2ZA 4GN5A 5FLMG 2JEBI 3CCEA 1YVCA 3STBD 4HJ7A 1G6PA 3GDEA 1GM5A 2N49A 1P16A 4GKJL 2YU9H 3FKIG 4DV0Q 1SMXA 1GO3E 1SR3A 1A63A 5ELNA 1SRUA 4RMFA 4YCVA 5M3FH 3HFZB 1TXYA 2JA6G 2WAQE 5LMNL 3JAMi 1S40A 1AE2A 3D31A 4MNOA 5LMUQ 4A3DH 1SE8A 3CCMA 2K5VA 5E7NA 4ALPA 3CCRA 2R6GA 3PUWA 2KCTA 2JA5H 2R7ZG 3PO2G 4BBSG 4LWCA 3U58A 1YI2A 3W5OA 1C9OA 1NMFA 4DV1Q 1E1TA 5HY6A 3DM3A 4HJAA 3ULLA 3D0FA 1IBLL 2I5HA 5GAGC 1ASYA 2PI2A 1VQ7A 3PCOB 1IBKL 1OTCA 5IWAL 4BY7H 2IX1A 3GTOH 2N78A 1E3PA 1SLJA 1HZAA 3S24A 3U4VA 1OXUA 4IFDI 1D8LA 3CQZH 4JI7L 3JC66 5BR8Q 4R4TA 2C35B 3HKSA 5C4XH 2IHFA 2UUAL 4LF7Q 2R7FA 4OONA 4DPGA 1YBYA 4P75A 2VW9A 1SFOH 4JI6Q 1Z9FA 5HGQA 1VQKA 5AJ3L 5M3MG 3BZKA 4R4QA 2BH8A 1VQPA 4DV4L 1EUJA 5C44G 5LMNW 3RZDH 1Q81C 3BZCA 1VQFA 4OX9Q 1B8AA 1YNXA 2QGQA 4JOIA 4QIWE 4B3ML 1Y1WH 2ZM6Q 2VS1A 1LUZA 2KHIA 3CMAA 4JI8Q 3OTOQ 2B63G 4X64L 2JEAI 1QZHA 1D7QA 1N32L 3KDFB 1TWCH 4NPSA 1HNZL 4A3FG 3CC2A 1IZ6A 4QL5A 2R92H 2ZTDA 1XNRQ 1PH6A 3HOWH 4A3IG 1UE1A 4A3MH 1V9PA 2UXCL 1QUQA 1VQLA 1QUQB 1VQCA 2GVBA 4X66Q 1B7YB 2QEXA 1XMOQ 5IYDH 1Z47A 1AH9A 2F4VL 4A3KH 1L0WA 5IYBG 4JI2L 4AQYQ 4L5RC 3HOVH 4A3DG 1NE3A 5GADC 1NTGA 1UE5A 1YZ6A 5IE8A 4JI5L 4JI3Q 4P73A 1CKOA 1RL2A 1Y14B 4JOIC 4GN4B 5ELOA 1XNQL 4DV0L 4LF6Q 2AKWB 3ZJYC 2R93H 1VQJA 4DUYL 4DV6L 1PH5A 4A3LH 4QJFA 1WOCA 2QA4A 3JAMc 3KF8B 4YCWA 4JI0Q 3FHWA 4GKKQ 4POFA 4BXXG 5LMUL 1HNWQ 4A3EG 4O2DA 3NENA 2NVTH 4IFDJ 2UXDL 4LFCL 4DNIA 4LUZA 3OYYA 1EYGA 2B3GA 4DR6L 1HZBA 1XMQL 3HOYG 2FXQA 4LF5L 1WCMG 4HJ8A 4AYBE 1PH4A 3W1GA 5K36G 4DV5Q 4GS3A 1PH9A 5C0XJ 4POGA 3M9BA 1IBMQ 1K8AC 1X54A 1HNXQ 3GTPH 1IXRA 4GOPA 1I5FA 1KRTA 4GOPB 3PF4A 4DV3L 2ZJQA 3UE0A 2AWOA 2VQFQ 4UPAA 4C2MH 1YEZA 4TQUS 1HZ9A 1X3EA 1KL9A 1XPUA 3K8AA 3RNUA 4LF7L 1KRSA 1U0LA 1VQIA 1FJGL 4A93G 1HR0Q 1K83H 2MNAA 3HOXH 4YHHQ 3J81i 1EIYB 3AFPA 4B3RL 1SROA 3UDIA 4UY8C 3DLLA 3EN2A 2R7DA 3ERSX 4JV5Q 5GAHC 1M90C 4DV2Q 2YTXA 4GLXA 4DV7L 1I94Q 4GOPC 4B3TQ 1E22A 2ZM6L 4BY1H 1QVFA 1KAWA 4DR2Q 1QVCA 4JI8L 1L2FA 1N33Q 2HIXA 4QGUA 3TS0A 1VQ5A 1HJPA 4P72A 2HIVA 2UUBL 1NMGA 2EQSA 1BBUA 4PZ6A 3UDGA 1Q7YC 3S1RH 4A76A 1C7YA 2DGYA 5FLXc 5FJ8H 1BVSA 1N34L 4DR7Q 4JYAQ 3PO3H 2GN5A 4NXMQ 1L1OA 4BBRH 1L1OB 3NBHB 4IJHA 3E0EA 3A5UA 4X65L 1M1KC 4LFBQ 2JA8H 2R7ZH 1Q46A 3H0GH 3K0XA 3I7FA 4XIGS 2JA9A 1YJ9A 3F2CA 3PSIA 3KLWA 1KQSA 1VQDA 1C0AA 5C3EH 4NXNQ 5IP7H 1YITA 2YYZA 4JI4Q 2VUMH 1MJCA 2K52A 2Q2HA 4YWKA 3L7ZC 1OXSC 1XTDA 4OWTB 4JI0L 1CKMA 2NVXH 4GKKL 4LF9L 4YWMA 3NELA 2Q2IA 1Q12A 5JJIA 3J80i 2A19A 4L5QA 3CCLA 5M5XH 3CD6A 3CC4A 1N9WA 2VY3A 4ME3A 3RLFA 1DGSA 4LNQA 1TWFH 4B3SQ 1VQGA 3KF6A 1P8LA 3KF6B 1L1OC 2D0PA 1XJVA 4K0KL 1VQAA 2KENA 3T1YQ 5IYCG 1PA6A 1J5EL 3HOZG 3S1QH 2UUCL 2KBNA 2WFWA 2Q2TA 3GTLH 4KHPQ 1WFQA 4MTNA 3HOUH 5JJKA 1YIJA 4DK3C 1MIUA 1V1QA 1PYSB 1VQ4A 1VS0A 1T9HA 4X62Q 3CF5A 2K4KA 1N36Q 5JJLA 1ASZA 3M4OH 2ZJPA 1CSPA 2WAQG 4DR1Q 3GTJH 2B29A 4RG1A 2UXBQ 2HQLA 3RLNA 4DR4Q 3S1NH 2NVYH 3I4NG 4WJ3M 3LGJA 5IY0A 3AFQA 3IRBA 3RLOA 4DR5Q 1RIPA 4JI1L 3I4MH 4C3JH 2PMZE 3J81c 1Q82C 1A8VA 3L0OA 3Q8DA 2CWAA 1Y1VG 2VZAA 2LXKA 4YHHL 1YJNA 1TWAH 2ALYB 1N8RC 2IT1A 1PH7A 2JA7G 2K14A 3HKZG 1PH3A 2EIFA 1E7ZA 2MO1A 4OWXB 2NN6G 4DUZL 1PH8A 1I94L 3SGIA 4IPHA 4B3TL 1TWGH 2ID0A 1WI5A 4DK6C 2BA0A 2UU9Q 4DR2L 1KXLA 4LF4Q 1X3GA 2RHSB 4UP7A 5IP9H 5M3FG 4HJ5A 4IO9A 1K9MC 5GAEC 2E5LL 2RCNA 3MXNB 1MJEA 3H3VI 5GQOA 1YJWA 2HHHQ 4DR3Q 4LFAL 4JYAL 4KI0A 1B70B 2LSSA 2JA5G 3PIPA 2KCMA 1W2BA 2BH2A 5M5WH 4OWWB 4C3HH 3K7AH 1IYJB 4JBMA 1O7IA 4OO1G 4L5SA 5C4JH 1G51A 1X6OA 3RN2A 4R1JA 4UP8A 4HIDA 1Q8KA 1HR0W 3I55A 4HIOA 1NY4A 1JJGA 4BY7G 4EQ5A 2I5MX 3B6YA 3BJUA 4YY3Q 5JEAG 4JI4L 2CQOA 1PH2A 4TVAB 2ZJRA 1OXTA 2XGTA 2IX0A 2JJQA 3J7ZC 1EFWA 4GKJQ 4JCVE 5C4XG 3J80c 3OW2A 4DV1L 4WJ4A 3AYHB 4OXPA 2GVAA 3A74A 5LMNQ 2YV5A 1A62A 4LW1A 4A3CH 1JT8A 2WB1G 2RHQB 4LUVA 4YWLA 5FLMH 3T1HQ 3KFUA 4UP9A 4A3GH 3ER0A 1BBWA 5BR8L 2K5NA 1K0RA 3CMEA 4PZ8A 1Y1WG 1S3OA 3FKIH 1BKBA 4DR1L 1GKHA 1FGUA 2I5LX 2K75A 2JA6H 1IBLQ 4JI6L 1LYLA 3CC7A 2R92G 2A8VA 3HOWG 1IBKQ 4A3MG 5M5YH 3ICEA 1PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK H;  5IYD G;  1X55 A;  4APV A;  2NN6 I;  3STB C;  4A3K G;  4OX9 L;  4JI7 Q;  3PO2 H;  3UDF A;  4BBS H;  3HOV G;  2VL6 A;  2YTV A;  1Q1E A;  1I6H H;  1CSQ A;  3OTO L;  1UE6 A;  1VCI A;  3PUX A;  5AJ3 Q;  3VDY A;  3CAM A;  4P71 A;  4R4O A;  4DKA C;  1XNR L;  2R93 G;  2AMC B;  2VQE Q;  4A3L G;  4DV4 Q;  1KHI A;  4X66 L;  2MO0 A;  5C0X G;  1XMO L;  3K81 C;  2VNU D;  3G71 A;  1NJI C;  3S14 H;  2N8N A;  3CCJ A;  2Y0S G;  3K80 C;  3M4Q A;  1VQB A;  4AQY L;  1Q86 C;  4OO1 I;  4X64 Q;  3PUY A;  4NB3 A;  1PHJ A;  1Q1B A;  4JI3 L;  1VQM A;  2PQA A;  3AEV A;  2PQA B;  1JE5 A;  3I56 A;  4A3J H;  1PVO A;  4LF6 L;  1GD7 A;  1FL0 A;  3CCU A;  3S16 H;  2K5H A;  3TRZ A;  2UXC Q;  2BA1 A;  5C44 H;  2L15 A;  3U4Z A;  4IOC A;  2F4V Q;  1JJ2 A;  2CWP A;  3M85 A;  3GTQ H;  2I0Q A;  4JI2 Q;  3E9I A;  2LXJ A;  1K3R A;  1HNW L;  2B63 H;  3S17 H;  4IPG A;  5H1S E;  1I3Q H;  4JI5 Q;  1VQ9 A;  1X9N A;  4A3G G;  4DAY B;  1AE3 A;  4R4C A;  3KJO A;  4A3F H;  1WJJ A;  1XNQ Q;  3CPF A;  1S72 A;  4A3I H;  4DUY Q;  2CFM A;  2K50 A;  3I4O A;  4DV5 L;  1EIF A;  4DV6 Q;  3HOX G;  3ULP A;  2MFI A;  1IBM L;  4GN3 B;  1HNX L;  2PI2 E;  2NZO A;  5IYB H;  2E8G A;  3EIV A;  4JC0 A;  3G4S A;  4JBK A;  3PV0 A;  2VQF L;  3T1H L;  2OQK A;  1QZG A;  2UXD Q;  1E24 A;  4LFC Q;  4PG3 A;  2F52 A;  3W1B A;  1VQ6 A;  3CPW A;  4GNX A;  4GNX B;  1EQQ A;  2E2H H;  1XMQ Q;  1E1O A;  4LF8 Q;  4DR6 Q;  2OCE A;  4BY1 G;  4QQB X;  1UE7 A;  3WWV A;  1VQ8 A;  4LF5 Q;  1KC8 C;  4GLA C;  3HKZ E;  1PYB A;  4R4I A;  1HR0 L;  4JG2 A;  4HJ9 A;  1I50 H;  2Z6K A;  4BA2 I;  4DAM A;  3K7U C;  2NVQ H;  1JMC A;  4X6A H;  4DV3 Q;  1XPR A;  4BXX H;  2N3S A;  4A3E H;  5FJ8 G;  4FDB A;  4IOA A;  4JV5 L;  2NZH A;  1UEB A;  4J15 A;  3PO3 G;  3U50 C;  4DV2 L;  1PFS A;  1CKN A;  1CKN B;  4BBR G;  2ZTE A;  3HOY H;  3KJP A;  1SN8 A;  2JA8 G;  1WCM H;  1FJG Q;  2JQO A;  2H5X A;  3H0G G;  3A0J A;  4O0A A;  1N33 L;  3CP0 A;  5C0X I;  4A4I A;  1VQN A;  2ATW A;  5DLQ E;  4GNX C;  1X3F A;  2Z0S A;  5C3E G;  4A3J G;  5IP7 G;  1WYD A;  4B3R Q;  4PZ7 A;  1JB7 A;  1W3S A;  2A1A A;  2VUM G;  2VQE L;  5JEA J;  3MEF A;  1LM0 A;  1H95 A;  3PUZ A;  3CCV A;  2Z6K C;  4DR7 L;  4KLK A;  3F1Z A;  4DV7 Q;  2EXD A;  4L5T A;  4AH6 A;  1HZC A;  2KHJ A;  3E9H A;  3TQY A;  4NXM L;  4A3B H;  1A0I A;  5J3B A;  4LFB L;  1G29 1;  4A93 H;  2IY5 B;  1LTL A;  3KDF A;  3CW2 C;  3PGZ A;  3KOJ A;  4QY7 A;  2UUB Q;  2YTY A;  4HIK A;  3J7A 5;  3S2D H;  4LUO A;  4NXN L;  4PMW A;  3H15 A;  3HOU G;  1N34 Q;  1XPO A;  3FP9 A;  4XTC S;  3TEH B;  3RN5 A;  1YHA A;  2ASB A;  2OTL A;  1UWV A;  3BU2 A;  4MZ9 A;  4IPD A;  4YCU A;  1KD1 C;  4X65 Q;  4C3I H;  2RF4 A;  2WB1 E;  3CCS A;  2JE6 I;  4B3S L;  3AQQ A;  1EOV A;  4EX5 A;  3KYH C;  4IPC A;  2DUD A;  3T1Y L;  3I4M G;  4KHP L;  1EQR A;  3UDX A;  1KIX A;  1K73 C;  2JK8 A;  4LF9 Q;  4Y52 H;  4JBJ A;  4X62 L;  1MKH A;  1N36 L;  1HH2 P;  2MQH A;  2ZTC A;  3H3V H;  3S1M H;  3G6E A;  4BA1 I;  2XTI A;  3F2B A;  2UXB L;  4AIM A;  5EAY A;  3F8T A;  4DR4 L;  3EBE A;  1GVP A;  4LF8 L;  4K0K Q;  1X65 A;  2AHO B;  1J5E Q;  1R9T H;  4DR5 L;  5IWA Q;  2UUC Q;  2HT1 A;  4P74 A;  5IP9 G;  3GO5 A;  1U5K A;  3UE1 A;  3M7N A;  4HIM A;  4JBW A;  4IJL A;  4GLV B;  4AYB G;  2F3I A;  1EWI A;  3ULJ A;  5IT9 c;  2UUA Q;  1NBW A;  1FVI A;  1K8G A;  4Y7N H;  2Q2U A;  3TS2 A;  4IFD G;  3NEM A;  1PH1 A;  3CCQ A;  2AWN A;  2OQ0 A;  4A3B G;  1V43 A;  3M3Y H;  2UU9 L;  3J81 j;  3HOZ H;  5IYC H;  4JI1 Q;  4LF4 L;  2Y0S E;  2OTJ A;  1VQE A;  4A75 A;  3RR5 A;  2OWO A;  3M4P A;  1VQO A;  1VQH A;  3PF5 A;  1YHQ A;  2WP8 J;  4B3M Q;  1X56 A;  3GTG H;  3G48 A;  3S15 H;  3TRE A;  2CKZ B;  2HHH L;  4DR3 L;  2E2I H;  1OXV A;  1QVG A;  3PIO A;  3A5Z B;  3S2H H;  1N32 Q;  4DUZ Q;  2ES2 A;  1HNZ Q;  1CUK A;  2IHE A;  3I4N H;  5GRO A;  4KHZ A;  5M3M H;  2V1C C;  3RZO H;  3GTM H;  3L2P A;  3CXC A;  2E5L Q;  1TWH H;  1YHB A;  3PUV A;  2E2J H;  1Y1V H;  1J6Q A;  1OXX K;  2JA7 H;  3F2D A;  4A3C G;  2D62 A;  1IL2 A;  4H02 A;  4LFA Q;  4YY3 L;  2CCZ A;  1JJC B;  2PNH A;  3GD7 A;  2D0O A;  3I2Z A;  4GN5 A;  5FLM G;  2JEB I;  3CCE A;  1YVC A;  3STB D;  4HJ7 A;  1G6P A;  3GDE A;  1GM5 A;  2N49 A;  1P16 A;  4GKJ L;  2YU9 H;  3FKI G;  4DV0 Q;  1SMX A;  1GO3 E;  1SR3 A;  1A63 A;  5ELN A;  1SRU A;  4RMF A;  4YCV A;  5M3F H;  3HFZ B;  1TXY A;  2JA6 G;  2WAQ E;  5LMN L;  3JAM i;  1S40 A;  1AE2 A;  3D31 A;  4MNO A;  5LMU Q;  4A3D H;  1SE8 A;  3CCM A;  2K5V A;  5E7N A;  4ALP A;  3CCR A;  2R6G A;  3PUW A;  2KCT A;  2JA5 H;  2R7Z G;  3PO2 G;  4BBS G;  4LWC A;  3U58 A;  1YI2 A;  3W5O A;  1C9O A;  1NMF A;  4DV1 Q;  1E1T A;  5HY6 A;  3DM3 A;  4HJA A;  3ULL A;  3D0F A;  1IBL L;  2I5H A;  5GAG C;  1ASY A;  2PI2 A;  1VQ7 A;  3PCO B;  1IBK L;  1OTC A;  5IWA L;  4BY7 H;  2IX1 A;  3GTO H;  2N78 A;  1E3P A;  1SLJ A;  1HZA A;  3S24 A;  3U4V A;  1OXU A;  4IFD I;  1D8L A;  3CQZ H;  4JI7 L;  3JC6 6;  5BR8 Q;  4R4T A;  2C35 B;  3HKS A;  5C4X H;  2IHF A;  2UUA L;  4LF7 Q;  2R7F A;  4OON A;  4DPG A;  1YBY A;  4P75 A;  2VW9 A;  1SFO H;  4JI6 Q;  1Z9F A;  5HGQ A;  1VQK A;  5AJ3 L;  5M3M G;  3BZK A;  4R4Q A;  2BH8 A;  1VQP A;  4DV4 L;  1EUJ A;  5C44 G;  5LMN W;  3RZD H;  1Q81 C;  3BZC A;  1VQF A;  4OX9 Q;  1B8A A;  1YNX A;  2QGQ A;  4JOI A;  4QIW E;  4B3M L;  1Y1W H;  2ZM6 Q;  2VS1 A;  1LUZ A;  2KHI A;  3CMA A;  4JI8 Q;  3OTO Q;  2B63 G;  4X64 L;  2JEA I;  1QZH A;  1D7Q A;  1N32 L;  3KDF B;  1TWC H;  4NPS A;  1HNZ L;  4A3F G;  3CC2 A;  1IZ6 A;  4QL5 A;  2R92 H;  2ZTD A;  1XNR Q;  1PH6 A;  3HOW H;  4A3I G;  1UE1 A;  4A3M H;  1V9P A;  2UXC L;  1QUQ A;  1VQL A;  1QUQ B;  1VQC A;  2GVB A;  4X66 Q;  1B7Y B;  2QEX A;  1XMO Q;  5IYD H;  1Z47 A;  1AH9 A;  2F4V L;  4A3K H;  1L0W A;  5IYB G;  4JI2 L;  4AQY Q;  4L5R C;  3HOV H;  4A3D G;  1NE3 A;  5GAD C;  1NTG A;  1UE5 A;  1YZ6 A;  5IE8 A;  4JI5 L;  4JI3 Q;  4P73 A;  1CKO A;  1RL2 A;  1Y14 B;  4JOI C;  4GN4 B;  5ELO A;  1XNQ L;  4DV0 L;  4LF6 Q;  2AKW B;  3ZJY C;  2R93 H;  1VQJ A;  4DUY L;  4DV6 L;  1PH5 A;  4A3L H;  4QJF A;  1WOC A;  2QA4 A;  3JAM c;  3KF8 B;  4YCW A;  4JI0 Q;  3FHW A;  4GKK Q;  4POF A;  4BXX G;  5LMU L;  1HNW Q;  4A3E G;  4O2D A;  3NEN A;  2NVT H;  4IFD J;  2UXD L;  4LFC L;  4DNI A;  4LUZ A;  3OYY A;  1EYG A;  2B3G A;  4DR6 L;  1HZB A;  1XMQ L;  3HOY G;  2FXQ A;  4LF5 L;  1WCM G;  4HJ8 A;  4AYB E;  1PH4 A;  3W1G A;  5K36 G;  4DV5 Q;  4GS3 A;  1PH9 A;  5C0X J;  4POG A;  3M9B A;  1IBM Q;  1K8A C;  1X54 A;  1HNX Q;  3GTP H;  1IXR A;  4GOP A;  1I5F A;  1KRT A;  4GOP B;  3PF4 A;  4DV3 L;  2ZJQ A;  3UE0 A;  2AWO A;  2VQF Q;  4UPA A;  4C2M H;  1YEZ A;  4TQU S;  1HZ9 A;  1X3E A;  1KL9 A;  1XPU A;  3K8A A;  3RNU A;  4LF7 L;  1KRS A;  1U0L A;  1VQI A;  1FJG L;  4A93 G;  1HR0 Q;  1K83 H;  2MNA A;  3HOX H;  4YHH Q;  3J81 i;  1EIY B;  3AFP A;  4B3R L;  1SRO A;  3UDI A;  4UY8 C;  3DLL A;  3EN2 A;  2R7D A;  3ERS X;  4JV5 Q;  5GAH C;  1M90 C;  4DV2 Q;  2YTX A;  4GLX A;  4DV7 L;  1I94 Q;  4GOP C;  4B3T Q;  1E22 A;  2ZM6 L;  4BY1 H;  1QVF A;  1KAW A;  4DR2 Q;  1QVC A;  4JI8 L;  1L2F A;  1N33 Q;  2HIX A;  4QGU A;  3TS0 A;  1VQ5 A;  1HJP A;  4P72 A;  2HIV A;  2UUB L;  1NMG A;  2EQS A;  1BBU A;  4PZ6 A;  3UDG A;  1Q7Y C;  3S1R H;  4A76 A;  1C7Y A;  2DGY A;  5FLX c;  5FJ8 H;  1BVS A;  1N34 L;  4DR7 Q;  4JYA Q;  3PO3 H;  2GN5 A;  4NXM Q;  1L1O A;  4BBR H;  1L1O B;  3NBH B;  4IJH A;  3E0E A;  3A5U A;  4X65 L;  1M1K C;  4LFB Q;  2JA8 H;  2R7Z H;  1Q46 A;  3H0G H;  3K0X A;  3I7F A;  4XIG S;  2JA9 A;  1YJ9 A;  3F2C A;  3PSI A;  3KLW A;  1KQS A;  1VQD A;  1C0A A;  5C3E H;  4NXN Q;  5IP7 H;  1YIT A;  2YYZ A;  4JI4 Q;  2VUM H;  1MJC A;  2K52 A;  2Q2H A;  4YWK A;  3L7Z C;  1OXS C;  1XTD A;  4OWT B;  4JI0 L;  1CKM A;  2NVX H;  4GKK L;  4LF9 L;  4YWM A;  3NEL A;  2Q2I A;  1Q12 A;  5JJI A;  3J80 i;  2A19 A;  4L5Q A;  3CCL A;  5M5X H;  3CD6 A;  3CC4 A;  1N9W A;  2VY3 A;  4ME3 A;  3RLF A;  1DGS A;  4LNQ A;  1TWF H;  4B3S Q;  1VQG A;  3KF6 A;  1P8L A;  3KF6 B;  1L1O C;  2D0P A;  1XJV A;  4K0K L;  1VQA A;  2KEN A;  3T1Y Q;  5IYC G;  1PA6 A;  1J5E L;  3HOZ G;  3S1Q H;  2UUC L;  2KBN A;  2WFW A;  2Q2T A;  3GTL H;  4KHP Q;  1WFQ A;  4MTN A;  3HOU H;  5JJK A;  1YIJ A;  4DK3 C;  1MIU A;  1V1Q A;  1PYS B;  1VQ4 A;  1VS0 A;  1T9H A;  4X62 Q;  3CF5 A;  2K4K A;  1N36 Q;  5JJL A;  1ASZ A;  3M4O H;  2ZJP A;  1CSP A;  2WAQ G;  4DR1 Q;  3GTJ H;  2B29 A;  4RG1 A;  2UXB Q;  2HQL A;  3RLN A;  4DR4 Q;  3S1N H;  2NVY H;  3I4N G;  4WJ3 M;  3LGJ A;  5IY0 A;  3AFQ A;  3IRB A;  3RLO A;  4DR5 Q;  1RIP A;  4JI1 L;  3I4M H;  4C3J H;  2PMZ E;  3J81 c;  1Q82 C;  1A8V A;  3L0O A;  3Q8D A;  2CWA A;  1Y1V G;  2VZA A;  2LXK A;  4YHH L;  1YJN A;  1TWA H;  2ALY B;  1N8R C;  2IT1 A;  1PH7 A;  2JA7 G;  2K14 A;  3HKZ G;  1PH3 A;  2EIF A;  1E7Z A;  2MO1 A;  4OWX B;  2NN6 G;  4DUZ L;  1PH8 A;  1I94 L;  3SGI A;  4IPH A;  4B3T L;  1TWG H;  2ID0 A;  1WI5 A;  4DK6 C;  2BA0 A;  2UU9 Q;  4DR2 L;  1KXL A;  4LF4 Q;  1X3G A;  2RHS B;  4UP7 A;  5IP9 H;  5M3F G;  4HJ5 A;  4IO9 A;  1K9M C;  5GAE C;  2E5L L;  2RCN A;  3MXN B;  1MJE A;  3H3V I;  5GQO A;  1YJW A;  2HHH Q;  4DR3 Q;  4LFA L;  4JYA L;  4KI0 A;  1B70 B;  2LSS A;  2JA5 G;  3PIP A;  2KCM A;  1W2B A;  2BH2 A;  5M5W H;  4OWW B;  4C3H H;  3K7A H;  1IYJ B;  4JBM A;  1O7I A;  4OO1 G;  4L5S A;  5C4J H;  1G51 A;  1X6O A;  3RN2 A;  4R1J A;  4UP8 A;  4HID A;  1Q8K A;  1HR0 W;  3I55 A;  4HIO A;  1NY4 A;  1JJG A;  4BY7 G;  4EQ5 A;  2I5M X;  3B6Y A;  3BJU A;  4YY3 Q;  5JEA G;  4JI4 L;  2CQO A;  1PH2 A;  4TVA B;  2ZJR A;  1OXT A;  2XGT A;  2IX0 A;  2JJQ A;  3J7Z C;  1EFW A;  4GKJ Q;  4JCV E;  5C4X G;  3J80 c;  3OW2 A;  4DV1 L;  4WJ4 A;  3AYH B;  4OXP A;  2GVA A;  3A74 A;  5LMN Q;  2YV5 A;  1A62 A;  4LW1 A;  4A3C H;  1JT8 A;  2WB1 G;  2RHQ B;  4LUV A;  4YWL A;  5FLM H;  3T1H Q;  3KFU A;  4UP9 A;  4A3G H;  3ER0 A;  1BBW A;  5BR8 L;  2K5N A;  1K0R A;  3CME A;  4PZ8 A;  1Y1W G;  1S3O A;  3FKI H;  1BKB A;  4DR1 L;  1GKH A;  1FGU A;  2I5L X;  2K75 A;  2JA6 H;  1IBL Q;  4JI6 L;  1LYL A;  3CC7 A;  2R92 G;  2A8V A;  3HOW G;  1IBK Q;  4A3M G;  5M5Y H;  3ICE A;  1PV4 A; 
#chains in the Genus database with same CATH topology
 1LTI D;  5IGF A;  3K7A B;  1E2Z A;  1H9K A;  3STB C;  3NBI A;  1HPC A;  2YTV A;  3OTO L;  1BCP B;  2KCN A;  1UE6 A;  1VCI A;  1O7Z A;  5AJ3 Q;  4DNR B;  2BOS A;  4DKA C;  2VQE Q;  4A3L G;  1KHI A;  2MO0 A;  3VR6 A;  4PMB A;  1NJI C;  2N8N A;  2F0T A;  3M4Q A;  5E4W C;  4NB3 A;  2K01 A;  4TRD A;  1VQM A;  2KJX A;  4KD4 A;  4C2M B;  3AEV A;  4LF6 L;  4A3G B;  2K5H A;  2BA1 A;  1MSH A;  2L15 A;  3HEJ A;  2F4V Q;  2CWP A;  4DXF A;  2B63 H;  1VQ9 A;  4EGV A;  3GTK B;  1EEI D;  1AE3 A;  4NMZ A;  3KBX A;  2ICE C;  2K50 A;  1AN8 A;  3HOX G;  1IBM L;  4HSV A;  1PFB A;  2NZO A;  3A55 A;  5IYB H;  1BO0 A;  1B9N A;  1R4Q B;  3PV0 A;  3T1H L;  1HUN A;  1E24 A;  5D3I B;  5EKK A;  3OMG A;  4J6H A;  3W1B A;  3K59 A;  4QQB X;  4RCN A;  3K58 A;  1E1O A;  1XMQ Q;  2OCE A;  1VMC A;  1VQ8 A;  4KKU A;  3V2T A;  3ERO A;  2JA8 B;  4IUU A;  1JMC A;  4KY5 A;  2KED A;  2N3S A;  4IOA A;  1C4Q A;  3ZYY X;  3KJP A;  1SN8 A;  1FR3 A;  3L9A X;  1FJG Q;  3H0G G;  3A0J A;  1VQN A;  3CP0 A;  1WTW A;  1GHJ A;  5M5X B;  5C3E G;  1SNC A;  4KV6 A;  2A1A A;  2VUM G;  2VQE L;  1X32 A;  4DR7 L;  1LTS D;  3NTK A;  3GTL B;  2EXD A;  3HOU B;  1FNV A;  3TQY A;  4LFB L;  1ENC A;  2EYL A;  1EQV A;  3BS1 A;  2WKD A;  1LTL A;  1CQV A;  3KOJ A;  2UUB Q;  2YTY A;  1YNJ C;  4NXN L;  2NVY B;  1XXG A;  2KVM A;  4ZUJ A;  2B8G A;  4WRD A;  4XTC S;  4IUR A;  3I4M B;  4ZRZ A;  3Q24 A;  5CR3 A;  5A35 A;  1KD1 C;  2EZV A;  4X65 Q;  3P1H A;  3A54 A;  2B39 A;  2JE6 I;  1JIC A;  1EOV A;  2F0J A;  5FLX L;  4C3J G;  1EQR A;  1TWG B;  3OIP A;  4IAL A;  3DXJ C;  4IUN A;  4LF9 Q;  4Y52 H;  2AQ3 B;  1MKH A;  1N36 L;  3F2B A;  1U4L A;  5EPL A;  5D14 A;  3T13 A;  2AHO B;  3C3L A;  5IWA Q;  2QDB A;  2HT1 A;  4K5X A;  4C3H B;  2HUG A;  4HIM A;  4GLV B;  5BN5 A;  3SHL A;  1K8G A;  2EE1 A;  3D8G A;  3S2D B;  4IFD G;  3NEM A;  1WD1 A;  4RGT A;  2AWN A;  3NQT A;  1HA6 A;  5IGB A;  4LF4 L;  4OL7 A;  3D4R A;  3M4P A;  2OWO A;  1STA A;  1UEA B;  1YHQ A;  3GTG H;  3G48 A;  1IKM A;  1JCK B;  3KUP A;  4WJW A;  1B1Z A;  4G4K A;  5CC4 A;  1QVG A;  4C1N I;  4RFB A;  3A5Z B;  1XYI A;  3VYT A;  1I4Q A;  5M3M H;  1STY A;  3D4W A;  3RZO H;  1S5C D;  3I70 A;  1TWH H;  5IGG A;  4DAV A;  2EJM A;  5ELE A;  1Y1V H;  2F0H A;  2JA6 B;  3SK6 A;  1IL2 A;  4H02 A;  3KLS A;  4GN5 A;  1A6X A;  3G7L A;  5D65 A;  2D2C C;  3NSW A;  1NUC A;  1CQF A;  3WOF A;  2X6G A;  4XQJ A;  1SMX A;  1A63 A;  2R3Z A;  2EYH A;  2NB0 A;  4YCV A;  5BN3 A;  3ITP A;  3JAM i;  1BXT A;  5LMU Q;  3M3Y B;  1SE8 A;  2B2T A;  3CCR A;  1WTX A;  3MXU A;  3PO2 G;  4BBS G;  4DV1 Q;  1B4O A;  2XNA C;  3DM3 A;  1ASY A;  4FF4 A;  1VQ7 A;  1OTC A;  5IWA L;  2IX1 A;  3U4V A;  3S24 A;  4IFD I;  1OXU A;  3GTM B;  1ZYR C;  2L55 A;  3CQZ H;  5CBA E;  4OON A;  2KUM A;  4KN7 C;  4P75 A;  2B2T C;  2VW9 A;  4JI6 Q;  1VQK A;  5M3M G;  2MUY A;  2BH8 A;  1TY0 A;  2FFK B;  1EOT A;  3P75 A;  4A3F B;  2YU9 B;  4K14 A;  4DV4 L;  4A3I B;  4XDX A;  3BZC A;  2QGQ A;  1BOS A;  1LUZ A;  2KHI A;  3K57 A;  2ZXO A;  2LMC B;  1K3B C;  4ILW A;  4JW0 A;  3C46 A;  1D7Q A;  4A3D B;  3KDF B;  1DD2 A;  5CYU A;  2R92 H;  1LLR D;  2ZTD A;  1XNR Q;  3HOW H;  1UE1 A;  1VQL A;  1VQC A;  4X66 Q;  3HRZ C;  3I73 A;  2RA4 A;  1EZ8 A;  4NKL A;  4JI2 L;  4AQY Q;  4L5R C;  5GAD C;  4IQZ A;  2K6A A;  4JI5 L;  4P73 A;  4A3E B;  1CKO A;  1H9S A;  1CT1 D;  1RL2 A;  1STE A;  3J7A V;  3DMU A;  4JPB W;  2AKW B;  1PH5 A;  1WOC A;  2EY1 A;  2QA4 A;  3KF8 B;  4GKK Q;  5FK9 C;  3DHQ A;  5LMU L;  3TSS A;  4KJN A;  2NVT H;  4LFC L;  4DNI A;  4LUZ A;  4ZAI A;  4DR6 L;  1JOR A;  4GS3 A;  4DK1 A;  3GTP H;  2EY2 A;  1IXR A;  3MAQ A;  4GOP B;  1LTG D;  2F3V A;  4DV3 L;  2MGS A;  2A5H A;  2VQF Q;  4Q5V A;  1YEZ A;  1TKW B;  1KL9 A;  2FMM A;  1DM0 B;  2DY7 A;  1S5E D;  1U0L A;  5KNC A;  1K83 H;  3N52 A;  5COR A;  4YHH Q;  3OHX C;  1KDA A;  1QNK A;  4HSP A;  2B2W A;  4B3R L;  5JJZ A;  3UDI A;  4UY8 C;  3EN2 A;  3ERS X;  1EYD A;  2R93 B;  1AEX A;  3I3C A;  4DV7 L;  1E2V A;  1KAW A;  1QVC A;  1XTC D;  2HIX A;  3VR3 A;  1WTQ A;  4P72 A;  1WTP A;  1NMG A;  1BBU A;  2RSO A;  3IFT A;  2KCC A;  3R2T A;  3R8B A;  3PO3 H;  4CJ0 B;  1L0X B;  2B2W C;  1L1O A;  3NBH A;  5KND A;  1WTH A;  1FNW A;  3K0X A;  2H1E A;  1QNU A;  3KLW A;  4QUC A;  3Q22 A;  1HTL D;  3N6R A;  1C0A A;  2TMP A;  1YIT A;  4PMC A;  4JI4 Q;  1GUT A;  1MJC A;  3HOZ B;  2CQA A;  2L4N A;  1XTD A;  4GKK L;  4ME5 A;  4YWM A;  1F2L A;  3EFX D;  3S15 B;  3CC4 A;  3RLF A;  1VF5 C;  2EY6 A;  4LNQ A;  2E2I B;  4B3S Q;  1FGB D;  3MWY W;  3A7L A;  1L1O C;  4K0K L;  1J5E L;  1EYA A;  1NR2 A;  1PA6 A;  3S1Q H;  4KHP Q;  2Q2T A;  2KQ3 A;  5JJK A;  1JB3 A;  1V1Q A;  5LHY 1;  3MHB A;  1VS0 A;  1T9H A;  3PIO 3;  4HN7 A;  4X62 Q;  5KNB A;  4DU9 A;  3ERQ A;  2JA7 B;  5KYI A;  2B29 A;  4RG1 A;  3GTJ H;  2UXB Q;  2HQL A;  3S1N H;  1G6Z A;  4WJ3 M;  3LGJ A;  4CKE A;  1G91 A;  3TP5 A;  4JI1 L;  5A2Q L;  3J81 c;  1A8V A;  4YHH L;  2R7Z B;  2CWA A;  1ZEQ X;  1LT4 D;  1YJN A;  5EGT A;  2M2L A;  2A73 B;  2EIF A;  1E7Z A;  4OWX B;  1SMY C;  3SGI A;  3URY A;  1HXY D;  2UU9 Q;  4G7Z C;  4OGQ C;  1X3G A;  1IYV A;  5IP9 H;  5M3F G;  2EYM A;  1K9M C;  2RCN A;  3H3V I;  1YJW A;  4LFA L;  1BDO A;  1EWH A;  1M4V A;  2M9V A;  1F2M A;  4BY7 B;  3LWU A;  3FEW X;  2JA5 G;  1WVL A;  2LFN A;  4OWW B;  5C4X B;  1X6O A;  2NBF A;  4UP8 A;  4HID A;  1Q8K A;  2XSC A;  1SJH D;  4JI4 L;  1PH2 A;  5A2Q E;  2XGT A;  2DNE A;  3J7Z C;  4GKJ Q;  4JCV E;  4XYO A;  1ET9 A;  3NHH A;  4WJ4 A;  1UAP A;  5FO9 B;  3KLS X;  5LMN Q;  4ZCK A;  1ENA A;  1TWC B;  1K0S A;  1JT8 A;  4YWL A;  2A74 C;  1Y1W G;  3H09 A;  1ENF A;  1FGU A;  3QOJ A;  5ISR A;  1K8M A;  3CC7 A;  1IBK Q;  5M5Y H;  1S4Z A;  5FKA C;  4YIJ A;  2L0C A;  5I6Y A;  3SEB A;  1QG7 A;  5C4J B;  4EQP A;  4A3K G;  4OX9 L;  4JI7 Q;  3HOV G;  1Q1E A;  5G3L F;  1SE2 A;  3BDO A;  3CAM A;  4R4O A;  2R93 G;  4XXE A;  3K81 C;  3AB9 A;  2VNU D;  3G71 A;  3S14 H;  1SNM A;  5DM7 3;  3K80 C;  1GOZ A;  1Q86 C;  5CV8 A;  3BDL A;  4X64 Q;  3PUY A;  3TBI B;  1DXM A;  2PQA A;  4A3J H;  1HQR D;  3S16 H;  1FL0 A;  4XT3 B;  1PRT B;  1JWU D;  2MP1 A;  2Z8L A;  3VA5 A;  5C44 H;  1GUS A;  2KEC A;  4IOC A;  3HOX B;  3GTQ H;  4G57 A;  3E9I A;  2LXJ A;  2XN9 C;  5H1S E;  4DAY A;  2N55 A;  1XNQ Q;  3U9S A;  4DUY Q;  4DV6 Q;  4DV5 L;  1EIF A;  3WDN A;  1VDZ A;  4GN3 B;  3T53 B;  1HNX L;  3NXW A;  3J7Y W;  2JP1 A;  1QZG A;  2OQK A;  2UXD Q;  2F52 A;  4GNX B;  2E2H H;  2G5D A;  4BY1 G;  1K8O A;  1UE7 A;  4LF5 Q;  1J8I A;  4R4I A;  3HKZ E;  4C56 C;  3DEO A;  3JAM L;  4HJ9 A;  2PW5 A;  3H0G B;  4DAM A;  3K7U C;  4BA2 I;  1ICF B;  4BXX H;  4FDB A;  2VUM B;  4EQO A;  3U50 C;  4DV2 L;  1CKN A;  1UUP A;  4BBR G;  3HOY H;  2NVX B;  2R7Z G;  2JQO A;  3NTI A;  4O0A A;  4H44 C;  1KNA A;  1X3F A;  4A3J G;  1TWF B;  1WYD A;  1ILP A;  2IW3 A;  3BDC A;  1CA6 A;  3MEH A;  3I90 A;  4HR7 B;  2KHJ A;  4NXM L;  4A3B H;  4V0B A;  1SYF A;  3AMU A;  2WAC A;  4A93 H;  1TT2 A;  3KDF A;  3CW2 C;  2K28 A;  4HIK A;  3NQI A;  2F0F A;  3PMF A;  3K5O A;  5M9O A;  1JOQ A;  1N34 Q;  4DAP A;  1XPO A;  5NUC A;  2G9H D;  3FP9 A;  3Q23 A;  3RN5 A;  2ASB A;  2RKS A;  1UWV A;  5EJW A;  5ELB A;  1RJT A;  1S5F D;  1LO5 D;  5CGK A;  4EX5 A;  1GJX A;  3T1Y L;  2DUD A;  3BYY B;  1KIX A;  2QDL A;  2F0S A;  1AW7 A;  3F2U A;  1HH2 P;  2ZTC A;  1EFI D;  3G6E A;  4BA1 I;  2XTI A;  3BG3 A;  3F8T A;  3EBE A;  2MJ8 A;  1B2T A;  2CVR A;  1R9T H;  3M7G A;  3GO5 A;  1TS5 A;  3M7N A;  1GHK A;  1EU4 A;  2EYF A;  3R2I A;  2UUA Q;  3PIP 3;  3TP7 A;  2C9O A;  1LT3 D;  1RF2 D;  4A3B G;  1GUN A;  2Z6B A;  2Y0S E;  4HAE A;  2F0V A;  4A75 A;  1VQO A;  1F77 A;  5CV4 A;  4B3M Q;  4OIK A;  4DR3 L;  4HMJ A;  1IHZ A;  3PIO A;  1HQM C;  1FNU A;  4X3K A;  3I4N H;  3BYT B;  4KHZ A;  3L2P A;  2HCI A;  2E5L Q;  1YHB A;  2E2J H;  5EPJ A;  2AQ1 B;  1EY6 A;  2RDH A;  1J6Q A;  4WFN 3;  4A3C G;  2NTS A;  2D62 A;  4LK1 C;  4WOR A;  2CCZ A;  3VYS A;  1A2T A;  2D0O A;  4K5V A;  3CCE A;  2DY8 A;  2F0K A;  2NN6 H;  1GM5 A;  5DAU A;  3FKI G;  3A8J E;  3PO2 B;  4BBS B;  1SRU A;  4RMF A;  1O78 A;  1I6H B;  1TXY A;  2A68 D;  2J0T D;  2N88 A;  2K5V A;  5E7N A;  4ALP A;  1G2S A;  1KLU D;  2NZ1 D;  2R6G A;  5EPK A;  4LWC A;  3U58 A;  1SDF A;  4OO1 H;  1D2B A;  4HJA A;  4HCE A;  1IBL L;  2I5H A;  2PI2 A;  3PCO B;  1NNX A;  5M3M B;  3QG1 A;  3GTO H;  1E3P A;  1HZA A;  3LX0 A;  1D8L A;  3D6C A;  4PQX A;  5C4H A;  2C35 B;  2C5C A;  3HKS A;  2IHF A;  2UUA L;  4LF7 Q;  4DPG A;  2PPB C;  5JAV A;  1SFO H;  2WIN B;  1Z9F A;  5EKL A;  1I3Q B;  5AJ3 L;  4R4Q A;  1SXT A;  4NP5 A;  4RAU C;  3RZD H;  3QOL A;  2EYJ A;  2LKV A;  4B3M L;  1YNX A;  2NWG A;  4JOI A;  2ZM6 Q;  3MA2 B;  1PRT D;  5EBD A;  2B63 G;  2JEA I;  3CKI B;  4R8N A;  3TN2 A;  1Q8I A;  1L0Y B;  4QMG A;  2F03 A;  4QL5 A;  2HD3 A;  2F0I A;  3ND8 A;  1PH6 A;  1QUQ A;  4X3T A;  1XMO Q;  2F3W A;  5IYD H;  1JOK A;  3QIA A;  5IIF A;  3CRK C;  2F4V L;  2SNM A;  5IYB G;  2NVQ B;  2D5D A;  5LL6 X;  1EY0 A;  4JI3 Q;  4JOI C;  1CZG A;  1W6K A;  3ZJY C;  2WV6 D;  5E4X A;  5C0X H;  3GQB A;  2HDM A;  3FHW A;  1SYC A;  1WTO A;  4X3U A;  2BCO A;  3T4A C;  4IUT A;  1HNW Q;  1F9R A;  3FVQ A;  3K5M A;  1Q90 A;  2A6H D;  3OYY A;  2B3G A;  3NWT A;  1XMQ L;  4HJ8 A;  4AYB E;  1SBB B;  3M9B A;  1K8A C;  3C1E A;  1I5F A;  2ZJQ A;  4KD3 A;  4C2M H;  4TQU S;  3EJI A;  2F0W A;  1X3E A;  4K5W A;  3X3N A;  1XPU A;  3K8A A;  3RNU A;  3SXH A;  4LF7 L;  1A15 A;  1KRS A;  1FJG L;  1HR0 Q;  2MNA A;  1E0B A;  1I6V C;  3SDZ A;  2RBM A;  2Q8I B;  3VYU A;  1EIY B;  2OEO A;  3I4L A;  5FLX E;  5GAH C;  4JV5 Q;  1MSG A;  1AFP A;  1E22 A;  2ZM6 L;  1N33 Q;  1HJP A;  1STG A;  1NR4 A;  3HG9 A;  3S1M B;  2NVT B;  2HIV A;  2UUB L;  3OMC A;  1SND A;  3VR2 A;  4EVO A;  1A3V A;  1C7Y A;  5FLX c;  5FJ8 H;  2EOT A;  3K5N A;  4ODG A;  3A5U A;  4IJH A;  1C48 A;  1WTV A;  4X65 L;  2JA8 H;  2JA9 A;  1HHV A;  1DYQ A;  4Y7N B;  5IP7 H;  4UAI A;  2K52 A;  1QJO A;  2PCF B;  3FPU B;  4OWT B;  1CKM A;  4LF9 L;  1ZXT A;  4C1N K;  3J80 i;  5M5X H;  3CD6 A;  1N9W A;  4E6I A;  1DGS A;  2DJG C;  4OIJ A;  2TSS A;  1VQG A;  3KF6 B;  3S2H B;  1PXU A;  5BN4 A;  1BCP D;  2KBN A;  3GTL H;  3HOU H;  1YIJ A;  4DK3 C;  1VQ4 A;  1LTB D;  3HZX A;  4J1M A;  2PYK A;  4DA2 A;  5JJL A;  3M4O H;  2ZJP A;  2WAQ G;  3SE0 A;  4KMU C;  4DR4 Q;  2NVY H;  4DN4 M;  1ONL A;  5DNF A;  3PO3 B;  3AFQ A;  4JK1 C;  4XT1 B;  4DR5 Q;  1RIP A;  3I4M H;  2L5T A;  1RD9 D;  4DGZ A;  1Q82 C;  2F4I A;  2VZA A;  1Y1V G;  3WOE A;  2ALY B;  5M3F B;  1SE3 A;  3HKZ G;  1PH3 A;  4XQN A;  5JVH 3;  1PH8 A;  3D4D A;  1TWG H;  1KXL A;  1EQT A;  2JA5 B;  2VXW A;  5GAE C;  1KDC A;  5IT9 L;  3MXN B;  2HCC A;  5GQO A;  4Q0F A;  2HHH Q;  2CW0 D;  4KI0 A;  1B70 B;  3K6O A;  2NTT A;  2A6H C;  3PIP A;  2KCM A;  2X69 A;  5CV9 A;  3T16 A;  2Z9H A;  3QB3 A;  4C3H H;  1IYJ B;  3FPP A;  1O7I A;  3NP8 A;  1U4P A;  3GV3 A;  1JR0 D;  4R1J A;  1HR0 W;  1PTO B;  4HIO A;  1NY4 A;  1EY8 A;  1X3P A;  2I5M X;  3BJU A;  4YY3 Q;  1JWS D;  5E1F A;  2EY5 A;  2F0N A;  2ZJR A;  5FO8 B;  1OXT A;  1STH A;  1V1P A;  2PZU A;  4DV1 L;  1Y1W B;  3AYH B;  1EY5 A;  3A74 A;  1LT6 D;  1EL0 A;  3CU7 A;  2RHQ B;  4LUV A;  4R8I A;  3M4Y A;  1PLF A;  5FLM H;  5K5P A;  4UP9 A;  5DEH A;  5KGU A;  1QCB D;  2K5N A;  1S3O A;  5IT9 E;  4A3K B;  1B9M A;  4AYB B;  2I5L X;  2XIW A;  4KKS A;  5I9P A;  3HOV B;  4QF4 A;  2JA6 H;  4JI6 L;  1LYL A;  2R92 G;  2A8V A;  4DF7 A;  3HOW G;  1Z6H A;  3TDQ A;  3TP6 A;  2G9D A;  2JSO A;  4ULL A;  4APV A;  4N9T A;  2CHB D;  3CRL C;  1CSQ A;  1C8C A;  4DK0 A;  3VDY A;  1XNR L;  2AMC B;  3IFD A;  4K6L A;  4X66 L;  1JQY D;  3CCJ A;  2Y0S G;  1KNE A;  4AQY L;  1VQB A;  3OWF A;  2LY7 A;  1SSO A;  1JE5 A;  3I56 A;  1PVO A;  1GD7 A;  2UXC Q;  3TRZ A;  1SNP A;  2HDL A;  4OEL B;  1TS4 A;  1ILQ A;  2FMC A;  3M85 A;  2I0Q A;  2OXP A;  5CMD A;  2QF7 A;  1K3R A;  3MFY A;  3S17 H;  2BDO A;  2AQ2 B;  3KJO A;  4A3F H;  1WJJ A;  3T56 B;  1NCV A;  2K5W A;  4A3I H;  3I4O A;  4ID6 A;  4BY1 B;  2MFI A;  4RA8 A;  4IZ8 A;  4HMI A;  3EIV A;  1MBY A;  1PDQ A;  1DCZ A;  2VQF L;  1VQ6 A;  2F1M A;  3CPW A;  1EQQ A;  1LTT D;  3WWV A;  1KC8 C;  4GLA C;  4IUV A;  1PYB A;  4CDD C;  4BBR B;  1I50 H;  4X3S A;  2Z6K A;  1KTK A;  1SYG A;  4X6A H;  3OWE B;  1XPR A;  4A3J B;  1FD7 D;  4A3E H;  1UEB A;  2F0U A;  4J15 A;  2CW0 C;  4LAA A;  3PO3 G;  1PFS A;  3L3O C;  1CK1 A;  1DZ1 A;  3V96 A;  1WCM H;  2H5X A;  5K36 H;  2ATW A;  4O42 A;  2Z0S A;  1SNO A;  4PZ7 A;  5JEA J;  3C1F A;  1H95 A;  2Z6K C;  3IAY A;  4AH6 A;  1SYB A;  3E9H A;  1A0I A;  5J3B A;  2D9U A;  4QY7 A;  3PGZ A;  4Z9C B;  3J7A 5;  1B3Q A;  1LAC A;  4PMW A;  3H15 A;  2L9H A;  3V05 A;  3TEH B;  2SOB A;  2Q8R E;  4IPD A;  4C3I H;  1HFN A;  2WB1 E;  4B08 A;  3CCS A;  4B3S L;  1MI2 A;  3KYH C;  4IPC A;  2DNC A;  3U9O A;  3UDX A;  4KHP L;  1XX8 A;  1PZK D;  2JK8 A;  4X62 L;  4M1U B;  4P2C B;  2K7V A;  2UXB L;  2E76 C;  3E6Z X;  5EAY A;  3FRP B;  4RGM A;  1GVP A;  1NSN S;  1X65 A;  4FNF A;  2UUC Q;  4A3B B;  3GP7 A;  5IP9 G;  1U5K A;  3UE1 A;  5DM6 3;  3OSO A;  5M5W B;  5F2D A;  4JBW A;  4IJL A;  4QCL A;  5C5L A;  4G7H C;  4AYB G;  2F3I A;  1NBW A;  2L12 A;  1DJR D;  5LL6 S;  4PNY A;  2CH4 A;  2I46 A;  3CCQ A;  2EJG C;  1KDB A;  1V43 A;  2UU9 L;  3HOZ H;  5IYC H;  1VQH A;  3PF5 A;  2WP8 J;  3S15 H;  3TRE A;  2E2I H;  1OXV A;  2DN8 A;  1PTO D;  4DUZ Q;  2ES2 A;  2O4X A;  1R4P B;  4C3I G;  2V1C C;  2J7Z A;  5KIX A;  4CGY B;  2JYO A;  3FKI B;  3PUV A;  2JN4 A;  1OXX K;  2JA7 H;  3VYR A;  5I4D A;  2PNH A;  3MXP A;  3I2Z A;  1G6P A;  4HJ7 A;  4BS9 A;  2WII B;  3STB D;  1F9Q A;  1B44 D;  2N49 A;  1P16 A;  4GKJ L;  5C3X A;  3TZU A;  1S5D D;  4OEM B;  3A56 A;  3HFZ B;  5CV7 A;  2WAQ E;  2AUK A;  5LMN L;  5COY A;  1S40 A;  1PMR A;  1AE2 A;  2MPM A;  4CJ1 B;  1EYC A;  2BE5 D;  1C9O A;  1NMF A;  5HY6 A;  2ICI A;  1V1O A;  5J22 A;  1IBK L;  4BY7 H;  5JEA H;  1SLJ A;  4JI7 L;  3JC6 6;  5BR8 Q;  4R4T A;  3J80 L;  3R3O A;  5C4X H;  3E5S A;  2R7F A;  2M00 A;  1YBY A;  4FO2 A;  2IWH A;  2B63 B;  2QIL A;  1CZW A;  1VQP A;  1EUJ A;  5C44 G;  5LMN W;  1Q81 C;  1CFM A;  4FF1 A;  1RHP A;  4QB4 A;  4JI8 Q;  3OTO Q;  4X64 L;  1QZH A;  4RCO A;  1TWC H;  3BZD B;  2SNS A;  3CC2 A;  1IZ6 A;  4A3M H;  1V9P A;  3Q6S A;  4DFA A;  1MGS A;  3JAM E;  4ZKC B;  1GUO A;  1UE5 A;  3C2P A;  2B2V A;  1H9S B;  3DEP A;  5FO7 B;  1XNQ L;  5ELD A;  3J80 E;  4LF6 Q;  1F2Y A;  1VQJ A;  4DUY L;  1SAP A;  4DV6 L;  4A3L H;  3KF8 A;  3JAM c;  4JI0 Q;  4POF A;  4BXX G;  1HTP A;  2F0D A;  3NEN A;  5D3D A;  4IFD J;  2UXD L;  2SEB D;  3HOY G;  2FXQ A;  2PNR C;  4LF5 L;  3W1G A;  1LTR D;  5C0X J;  1IBM Q;  1X54 A;  2B2V C;  4GOP A;  1KRT A;  3FDT A;  3UE0 A;  4RWS C;  1HZ9 A;  2CH4 W;  2XVS A;  1ZKO A;  3QJY A;  3EA6 A;  2RVL A;  4TKO B;  4UDU C;  4RGN A;  3NUC A;  1VQI A;  4A93 G;  1AP0 A;  3IKJ A;  3KBG A;  3HOX H;  1D1I A;  3J81 i;  3EVQ A;  1X3Q A;  1SRO A;  3DLL A;  2R7D A;  4TSS A;  2EYP A;  2YTX A;  4GLX A;  4GOP C;  1QVF A;  4JI8 L;  3RMH A;  1VQ5 A;  4FF3 A;  3DUZ A;  1FYC A;  3QR8 A;  3VR4 A;  4ABN A;  2EQS A;  2F0Q A;  3UDG A;  1Q7Y C;  3S1R H;  4I7Z C;  4A76 A;  1N34 L;  2B8F A;  1BVS A;  3ND9 A;  4DR7 Q;  4I65 A;  3R93 A;  1MHW C;  1QE6 A;  2BE5 C;  4LFB Q;  1L1O B;  3NBH B;  1DON A;  3MC0 B;  1PFN A;  2RCF A;  1Q46 A;  3H0G H;  1YJ9 A;  2FIN B;  3PSI A;  4IUP A;  5C3E H;  3RUZ A;  2L1B A;  4NXN Q;  1F2Z A;  2YYZ A;  2VUM H;  2Z4I A;  1CHQ D;  4YWK A;  3L7Z C;  4JI0 L;  1BNZ A;  2NVX H;  1TS3 A;  3NEL A;  3MZ5 A;  2Q2I A;  1RTN A;  4L8J A;  3SK4 A;  4L5Q A;  3GTG B;  1JWM D;  1V8Q A;  4ME3 A;  2K03 A;  1TWF H;  4IUQ A;  2WAQ B;  4CDF C;  5JJI A;  2D0P A;  2IX3 A;  1VQA A;  5CV6 A;  5J39 A;  2WFW A;  4MTN A;  1WTR A;  3TZD A;  3RZO B;  5C5M A;  1PYS B;  1DOK A;  4U67 3;  2XRQ D;  1TWH B;  1I4G A;  2K4K A;  1N36 Q;  1Y1V B;  2K33 A;  1ASZ A;  3H91 A;  4DR1 Q;  3HKZ B;  3SVM A;  1LAB A;  3RD4 A;  3I4N G;  2ZT9 C;  1WD0 A;  5IY0 A;  5T1I A;  3RLO A;  2F0M A;  4K8I A;  3HS0 C;  4R9W A;  4C3J H;  2PMZ E;  1U4M A;  2Z1C A;  1F9P A;  1N8R C;  4ZK9 B;  1IL8 A;  1TWA H;  3UI2 A;  1PH7 A;  2IT1 A;  1KLG D;  1T5X D;  2K14 A;  4H0L C;  2BDN A;  4J8Q A;  2IL8 A;  2NN6 G;  1RTO A;  1BUV T;  3D3R A;  3S9W A;  2ID0 A;  3ONA B;  5IOD A;  4KY6 A;  4LF4 Q;  2RHS B;  4HJ5 A;  4IO9 A;  2E5L L;  1ESF A;  2J4X A;  2IPK D;  2QW7 A;  4CDE C;  2QCP X;  1SE4 A;  3VA7 A;  1JOO A;  1ZYR D;  4CKC A;  2LSS A;  4IFD H;  2RSN A;  1QWY A;  3FMC A;  1B50 A;  3CQZ B;  2P5Z X;  4EQN A;  1W2B A;  2BH2 A;  4OO1 G;  4FVM A;  3K7A H;  5AFW A;  4L5S A;  3M4O B;  1TVX A;  3RN2 A;  1PRT F;  3I55 A;  5IGD A;  1BR9 A;  1PFM A;  2JXM B;  4EQ5 A;  3B6Y A;  5ELC A;  4TVA B;  3MFG A;  3I8Z A;  3A8K E;  3W2D A;  1EFW A;  3OW2 A;  3E3X A;  5KYL A;  4DNT B;  1B3A A;  4HTH A;  2YV5 A;  1A62 A;  1W6J A;  1LTA D;  5C3W A;  2WB1 G;  2R92 B;  1AZQ A;  3KFU A;  3HOW B;  1I4R A;  4V19 0;  4A3G H;  4BWG B;  1HRJ A;  1BKB A;  4DR1 L;  1PZI D;  2DJF C;  2A6E D;  1K28 A;  3I72 A;  1IW7 D;  3GTK H;  5IYD G;  1X55 A;  2NN6 I;  1EU3 A;  5CV5 A;  1SEB D;  1TR5 A;  2WKC A;  3PO2 H;  3UDF A;  4BBS H;  3SK8 A;  2O5I C;  1QB5 D;  2VL6 A;  5HGT A;  1I6H H;  1YNN D;  4ZLT F;  5JPN C;  4GZY C;  2Y0S B;  4JVZ A;  1XWE A;  2E75 C;  2A68 C;  2OT2 A;  3PUX A;  4P71 A;  1S5B D;  1H9J A;  2MHV A;  4F88 A;  4DV4 Q;  3MVV A;  1XMO L;  5C0X G;  1U4R A;  2HQE A;  3OIQ A;  5L37 A;  1I4H A;  3GTP B;  4OO1 I;  3BVM A;  1ICW A;  4K6D A;  2Q8T A;  5I2X A;  3PQI A;  1PHJ A;  1Q1B A;  4JI3 L;  1IYU A;  2PQA B;  4HCS A;  3CCU A;  4I7A A;  2K32 A;  1K83 B;  3U4Z A;  1JJ2 A;  3QO2 A;  4JI2 Q;  1HNW L;  4G7O C;  4IPG A;  4JI5 Q;  1I3Q H;  1X9N A;  4A3G G;  4DAY B;  4NW2 A;  4R4C A;  2F0G A;  1U9R A;  3CPF A;  4N8X 1;  1S72 A;  1D5Z C;  2CFM A;  4FP5 D;  2K04 A;  3ULP A;  2E74 C;  3NPP A;  1EIG A;  2PI2 E;  3W3A A;  1UNS A;  2VB2 X;  2E8G A;  3OOC A;  4O1N A;  4JC0 A;  3G4S A;  1PRT C;  4JBK A;  5I6W A;  4LFC Q;  4PG3 A;  3H6M A;  3X3M A;  4GNX A;  2QEJ C;  4DR6 Q;  4LMQ D;  4LF8 Q;  3K0Y A;  2L11 A;  2PQE A;  1HR0 L;  4JG2 A;  1G2T A;  2NVQ H;  4DXG A;  4KJO A;  4DV3 Q;  1GXD C;  3O13 A;  2ENB A;  5FJ8 G;  4JV5 L;  2NZH A;  1BCP F;  2RQX A;  1NAP A;  2LS0 1;  5CBE E;  1CKN B;  2ZTE A;  2JA8 G;  1N33 L;  1E2W A;  4A4I A;  2PMZ B;  5C0X I;  5DLQ E;  3S17 B;  4MN3 A;  4GNX C;  1AZP A;  5IP7 G;  4B3R Q;  1JB7 A;  1W3S A;  3MEF A;  1LM0 A;  3PUZ A;  4FXK C;  3CCV A;  3S1Q B;  4KLK A;  3F1Z A;  1ESR A;  4DV7 Q;  4L5T A;  1HZC A;  4CDC C;  5IGE A;  1G29 1;  1KAB A;  2IY5 B;  1CHP D;  1VMP A;  3KLR A;  3GTJ B;  3S2D H;  4LUO A;  3S1N B;  3GV6 A;  1RCV D;  2NYZ D;  3OW7 A;  1M8A A;  3HOU G;  5EQ0 A;  2I07 B;  4MIU A;  1I50 B;  1YHA A;  2SDF A;  5JVG 3;  2OTL A;  3BU2 A;  4MZ9 A;  4YCU A;  1RDP D;  4ZQ3 A;  2RF4 A;  4QUF A;  4UHV A;  2XRS D;  2XWB B;  1SMY D;  1H9R A;  1PZJ D;  1SNQ A;  1Z7T A;  5KEE A;  3AQQ A;  2A6E C;  3I4M G;  2FHT A;  2EJF C;  1IW7 C;  1WCM B;  1K73 C;  2O5J C;  4CKB A;  1HA5 A;  4JBJ A;  1LT5 D;  2MQH A;  5E3F A;  3H3V H;  5TSS A;  1YNN C;  3S1M H;  4AIM A;  3DWA A;  2K1B A;  4DR4 L;  2AUJ D;  4LF8 L;  4K0K Q;  4F7X A;  1J5E Q;  1Y69 U;  1RKN A;  4DR5 L;  2KA7 A;  4P74 A;  5J1Z A;  4OHJ A;  1D5M C;  1EZ6 A;  1F9S A;  3TP8 A;  4KKT A;  1EWI A;  3ULJ A;  5IT9 c;  1FVI A;  2FJ2 A;  4KK7 A;  4Y7N H;  2Q2U A;  3TS2 A;  1PH1 A;  1GUG A;  2OQ0 A;  3M3Y H;  3J81 j;  4C3H G;  4JI1 Q;  1I4X A;  1VQE A;  2OTJ A;  3RR5 A;  4K2L A;  4C3I B;  1SYD A;  2X6L A;  1X56 A;  3BVZ A;  3G6J B;  4M8A A;  2KOL A;  4XYQ A;  1HCZ A;  2CKZ B;  2HHH L;  4MTK A;  3S2H H;  1N32 Q;  4ZUI A;  1HNZ Q;  1CUK A;  2IHE A;  3IL8 A;  5GRO A;  4N9P A;  1BCP C;  3J81 L;  3GTM H;  3CXC A;  3F2D A;  4LFA Q;  1STN A;  4YY3 L;  1JJC B;  3GD7 A;  5FLM G;  1QIL A;  2JEB I;  5M5Y B;  1YVC A;  3GDE A;  2YU9 H;  4DV0 Q;  4FXD A;  1GO3 E;  1SR3 A;  5ELN A;  4RHR A;  2EVB A;  3D6W A;  5M3F H;  4LJZ C;  2JA6 G;  1Q3L A;  3TME A;  2PZW A;  3D31 A;  4MNO A;  4A3D H;  2O2L D;  3CCM A;  2ZXR A;  4F8M A;  4CBV A;  1O80 A;  1J9O A;  1Y8O B;  1ML0 D;  2KCT A;  3PUW A;  4B9W A;  2JA5 H;  1YI2 A;  3W5O A;  3S14 B;  1E1T A;  2GA4 B;  5C4Z A;  1SJE D;  3KK7 A;  3ULL A;  1B53 A;  3D0F A;  5GAG C;  1KAA A;  5EKI A;  1ROD A;  1EY4 A;  1D5X C;  2K5Q A;  2N78 A;  3E0J A;  3J81 E;  3S16 B;  1DOM A;  1G8Z D;  5C44 B;  1A3T A;  2PO4 A;  3DM1 A;  4K2K A;  1A2U A;  3GTQ B;  1PTO H;  5HGQ A;  1CM9 A;  2B2U A;  1Y8P B;  3BZK A;  3HGB A;  2PW7 A;  3SR1 A;  1D6E C;  2NUC A;  1VQF A;  4OX9 Q;  1B8A A;  3K5L A;  4QIW E;  1Y1W H;  5ELF A;  2VS1 A;  3CMA A;  5IOC A;  1CA5 A;  1N32 L;  4NPS A;  1BBX C;  1HNZ L;  4A3F G;  5T1G A;  3DWQ A;  2E2H B;  3NWS A;  4A3I G;  2UXC L;  3CHB D;  1QUQ B;  3NTH A;  2GVB A;  1I4P A;  1B7Y B;  4F87 A;  2QEX A;  2F0O A;  1Z47 A;  1AH9 A;  1SYE A;  5JPM C;  1TQO A;  2B2U C;  4A3K H;  1L0W A;  3HOV H;  4A3D G;  1DOL A;  1NE3 A;  1NTG A;  1QOH A;  1YZ6 A;  4XQQ A;  5IE8 A;  5HUR A;  4KTA A;  1Y14 B;  4GN4 B;  4L63 B;  5ELO A;  1II3 A;  4DV0 L;  2R93 H;  3HOY B;  4FXG C;  4QJF A;  2F0P A;  4N8F A;  4YCW A;  2EDG A;  4RKL A;  3HP3 A;  4A3E G;  4O2D A;  2OF1 A;  5I2Y A;  1EYG A;  2K5D A;  4RKB A;  1HZB A;  4HED A;  4FYD A;  1WCM G;  1A3U A;  1HUM A;  2EXZ A;  3A8I E;  1PH4 A;  4DV5 Q;  5K36 G;  4S3S A;  1IKL A;  1PH9 A;  4POG A;  2E2D C;  4A93 B;  1HNX Q;  2F0E A;  5G3L D;  3P20 A;  1BQQ T;  1HFG A;  3PF4 A;  2AWO A;  1PYW D;  1EEF D;  4A3M B;  4UPA A;  2KEE A;  2R61 A;  4KHV A;  2K05 A;  3AFP A;  3NK9 A;  2ZXP A;  5I9O A;  1M90 C;  4DV2 Q;  3QWN A;  1I94 Q;  3J7A F;  4B3T Q;  1EWC A;  1Y8N B;  4BY1 H;  1GUW A;  2KHS A;  4DR2 Q;  1L2F A;  4QGU A;  3TS0 A;  4U68 A;  5IGC A;  3DWP A;  2A69 D;  4ZKB B;  3LWE A;  1TU2 B;  4PZ6 A;  4RH6 A;  3OPO A;  2DGY A;  1R9T B;  4JYA Q;  1TII D;  4RGO S;  5KRU A;  1CI3 M;  2GN5 A;  2QKI C;  3VR5 A;  4NXM Q;  4BBR H;  1CTM A;  3E0E A;  1M1K C;  4FF2 A;  2XWJ B;  2R7Z H;  3I7F A;  4XIG S;  1EY9 A;  3F2C A;  4CJ2 C;  1KQS A;  1O7Y A;  1VQD A;  1PTO F;  3H3V C;  2Q2H A;  1OXS C;  3AU7 A;  1Q12 A;  2A19 A;  2EPB A;  3CCL A;  2VY3 A;  3KF6 A;  1P8L A;  1XJV A;  2KEN A;  3T1Y Q;  3HOZ G;  5IYC G;  3I4N B;  2UUC L;  5EBC A;  1TS2 A;  1WFQ A;  1MIU A;  1T5E A;  4ZYS A;  1STB A;  1D1K A;  3CF5 A;  2E2J B;  1CSP A;  2H4O A;  3S1R B;  1OO9 B;  3RLN A;  5FOB B;  3IRB A;  1EIH A;  4K8J A;  1EY7 A;  3Q8D A;  3L0O A;  2LXK A;  4MHE A;  2JA7 G;  4NDX A;  2V4D A;  5C3E B;  2MO1 A;  3H94 A;  2B2Y A;  4DUZ L;  2F0L A;  1I94 L;  4IPH A;  4B3T L;  4H13 C;  1MD2 D;  1WI5 A;  4DK6 C;  2BA0 A;  4KN4 C;  4DR2 L;  3T51 B;  4H7B A;  4UP7 A;  2EYO A;  3MTS A;  1JC7 A;  5JOB A;  3NE5 B;  4QIW B;  3MXN A;  2Z4H A;  1MJE A;  1VF7 A;  3A7A B;  4DR3 Q;  4JYA L;  3I91 A;  4L6T B;  3GTO B;  1ET6 A;  1H9M A;  4IN3 A;  5M5W H;  1TY2 A;  1LV9 A;  4JBM A;  2IJ0 A;  5C4J H;  1G51 A;  2B2Y C;  3BVG A;  3Q0A A;  1SFO B;  4CHT B;  5C6A A;  1JJG A;  4BY7 G;  5JEA G;  4PV1 C;  2CQO A;  2RDF A;  2WB1 B;  4C3J B;  3RZD B;  2IX0 A;  1V1P B;  2JJQ A;  1JE4 A;  5C4X G;  1O7L A;  1TWA B;  3J80 c;  4OXP A;  4KY7 A;  2GVA A;  1YNJ D;  3P7J A;  4LW1 A;  4A3C H;  3MXG A;  3SK5 A;  3T1H Q;  4RHS A;  1PTO C;  2VB3 X;  3ER0 A;  1BBW A;  5BR8 L;  2RDG A;  1K0R A;  3CME A;  4PZ8 A;  3FKI H;  3EQL C;  1GKH A;  3LNN A;  2K75 A;  1IBL Q;  2A69 C;  4B9X A;  2PZT A;  1BF4 A;  4A3M G;  3ICE A;  1PV4 A; 
#chains in the Genus database with same CATH homology
 3GTK H;  5IYD G;  1X55 A;  4APV A;  2NN6 I;  3STB C;  4A3K G;  4OX9 L;  4JI7 Q;  3PO2 H;  3UDF A;  4BBS H;  3HOV G;  2VL6 A;  2YTV A;  1Q1E A;  1I6H H;  1CSQ A;  3OTO L;  1UE6 A;  1VCI A;  3PUX A;  5AJ3 Q;  3VDY A;  3CAM A;  4P71 A;  4R4O A;  4DKA C;  1XNR L;  2R93 G;  2AMC B;  2VQE Q;  4A3L G;  4DV4 Q;  1KHI A;  4X66 L;  2MO0 A;  5C0X G;  1XMO L;  3K81 C;  2VNU D;  3G71 A;  1NJI C;  3S14 H;  2N8N A;  3CCJ A;  2Y0S G;  3K80 C;  3M4Q A;  1VQB A;  4AQY L;  1Q86 C;  4OO1 I;  4X64 Q;  3PUY A;  4NB3 A;  1PHJ A;  1Q1B A;  4JI3 L;  1VQM A;  2PQA A;  3AEV A;  2PQA B;  1JE5 A;  3I56 A;  4A3J H;  1PVO A;  4LF6 L;  1GD7 A;  1FL0 A;  3CCU A;  3S16 H;  2K5H A;  3TRZ A;  2UXC Q;  2BA1 A;  5C44 H;  2L15 A;  3U4Z A;  4IOC A;  2F4V Q;  1JJ2 A;  2CWP A;  3M85 A;  3GTQ H;  2I0Q A;  4JI2 Q;  3E9I A;  2LXJ A;  1K3R A;  1HNW L;  2B63 H;  3S17 H;  4IPG A;  5H1S E;  1I3Q H;  4JI5 Q;  1VQ9 A;  1X9N A;  4A3G G;  4DAY B;  1AE3 A;  4R4C A;  3KJO A;  4A3F H;  1WJJ A;  1XNQ Q;  3CPF A;  1S72 A;  4A3I H;  4DUY Q;  2CFM A;  2K50 A;  3I4O A;  4DV5 L;  1EIF A;  4DV6 Q;  3HOX G;  3ULP A;  2MFI A;  1IBM L;  4GN3 B;  1HNX L;  2PI2 E;  2NZO A;  5IYB H;  2E8G A;  3EIV A;  4JC0 A;  3G4S A;  4JBK A;  3PV0 A;  2VQF L;  3T1H L;  2OQK A;  1QZG A;  2UXD Q;  1E24 A;  4LFC Q;  4PG3 A;  2F52 A;  3W1B A;  1VQ6 A;  3CPW A;  4GNX A;  4GNX B;  1EQQ A;  2E2H H;  1XMQ Q;  1E1O A;  4LF8 Q;  4DR6 Q;  2OCE A;  4BY1 G;  4QQB X;  1UE7 A;  3WWV A;  1VQ8 A;  4LF5 Q;  1KC8 C;  4GLA C;  3HKZ E;  1PYB A;  4R4I A;  1HR0 L;  4JG2 A;  4HJ9 A;  1I50 H;  2Z6K A;  4BA2 I;  4DAM A;  3K7U C;  2NVQ H;  1JMC A;  4X6A H;  4DV3 Q;  1XPR A;  4BXX H;  2N3S A;  4A3E H;  5FJ8 G;  4FDB A;  4IOA A;  4JV5 L;  2NZH A;  1UEB A;  4J15 A;  3PO3 G;  3U50 C;  4DV2 L;  1PFS A;  1CKN A;  1CKN B;  4BBR G;  2ZTE A;  3HOY H;  3KJP A;  1SN8 A;  2JA8 G;  1WCM H;  1FJG Q;  2JQO A;  2H5X A;  3H0G G;  3A0J A;  4O0A A;  1N33 L;  3CP0 A;  5C0X I;  4A4I A;  1VQN A;  2ATW A;  5DLQ E;  4GNX C;  1X3F A;  2Z0S A;  5C3E G;  4A3J G;  5IP7 G;  1WYD A;  4B3R Q;  4PZ7 A;  1JB7 A;  1W3S A;  2A1A A;  2VUM G;  2VQE L;  5JEA J;  3MEF A;  1LM0 A;  1H95 A;  3PUZ A;  3CCV A;  2Z6K C;  4DR7 L;  4KLK A;  3F1Z A;  4DV7 Q;  2EXD A;  4L5T A;  4AH6 A;  1HZC A;  2KHJ A;  3E9H A;  3TQY A;  4NXM L;  4A3B H;  1A0I A;  5J3B A;  4LFB L;  1G29 1;  4A93 H;  2IY5 B;  1LTL A;  3KDF A;  3CW2 C;  3PGZ A;  3KOJ A;  4QY7 A;  2UUB Q;  2YTY A;  4HIK A;  3J7A 5;  3S2D H;  4LUO A;  4NXN L;  4PMW A;  3H15 A;  3HOU G;  1N34 Q;  1XPO A;  3FP9 A;  4XTC S;  3TEH B;  3RN5 A;  1YHA A;  2ASB A;  2OTL A;  1UWV A;  3BU2 A;  4MZ9 A;  4IPD A;  4YCU A;  1KD1 C;  4X65 Q;  4C3I H;  2RF4 A;  2WB1 E;  3CCS A;  2JE6 I;  4B3S L;  3AQQ A;  1EOV A;  4EX5 A;  3KYH C;  4IPC A;  2DUD A;  3T1Y L;  3I4M G;  4KHP L;  1EQR A;  3UDX A;  1KIX A;  1K73 C;  2JK8 A;  4LF9 Q;  4Y52 H;  4JBJ A;  4X62 L;  1MKH A;  1N36 L;  1HH2 P;  2MQH A;  2ZTC A;  3H3V H;  3S1M H;  3G6E A;  4BA1 I;  2XTI A;  3F2B A;  2UXB L;  4AIM A;  5EAY A;  3F8T A;  4DR4 L;  3EBE A;  1GVP A;  4LF8 L;  4K0K Q;  1X65 A;  2AHO B;  1J5E Q;  1R9T H;  4DR5 L;  5IWA Q;  2UUC Q;  2HT1 A;  4P74 A;  5IP9 G;  3GO5 A;  1U5K A;  3UE1 A;  3M7N A;  4HIM A;  4JBW A;  4IJL A;  4GLV B;  4AYB G;  2F3I A;  1EWI A;  3ULJ A;  5IT9 c;  2UUA Q;  1NBW A;  1FVI A;  1K8G A;  4Y7N H;  2Q2U A;  3TS2 A;  4IFD G;  3NEM A;  1PH1 A;  3CCQ A;  2AWN A;  2OQ0 A;  4A3B G;  1V43 A;  3M3Y H;  2UU9 L;  3J81 j;  3HOZ H;  5IYC H;  4JI1 Q;  4LF4 L;  2Y0S E;  2OTJ A;  1VQE A;  4A75 A;  3RR5 A;  2OWO A;  3M4P A;  1VQO A;  1VQH A;  3PF5 A;  1YHQ A;  2WP8 J;  4B3M Q;  1X56 A;  3GTG H;  3G48 A;  3S15 H;  3TRE A;  2CKZ B;  2HHH L;  4DR3 L;  2E2I H;  1OXV A;  1QVG A;  3PIO A;  3A5Z B;  3S2H H;  1N32 Q;  4DUZ Q;  2ES2 A;  1HNZ Q;  1CUK A;  2IHE A;  3I4N H;  5GRO A;  4KHZ A;  5M3M H;  2V1C C;  3RZO H;  3GTM H;  3L2P A;  3CXC A;  2E5L Q;  1TWH H;  1YHB A;  3PUV A;  2E2J H;  1Y1V H;  1J6Q A;  1OXX K;  2JA7 H;  3F2D A;  4A3C G;  2D62 A;  1IL2 A;  4H02 A;  4LFA Q;  4YY3 L;  2CCZ A;  1JJC B;  2PNH A;  3GD7 A;  2D0O A;  3I2Z A;  4GN5 A;  5FLM G;  2JEB I;  3CCE A;  1YVC A;  3STB D;  4HJ7 A;  1G6P A;  3GDE A;  1GM5 A;  2N49 A;  1P16 A;  4GKJ L;  2YU9 H;  3FKI G;  4DV0 Q;  1SMX A;  1GO3 E;  1SR3 A;  1A63 A;  5ELN A;  1SRU A;  4RMF A;  4YCV A;  5M3F H;  3HFZ B;  1TXY A;  2JA6 G;  2WAQ E;  5LMN L;  3JAM i;  1S40 A;  1AE2 A;  3D31 A;  4MNO A;  5LMU Q;  4A3D H;  1SE8 A;  3CCM A;  2K5V A;  5E7N A;  4ALP A;  3CCR A;  2R6G A;  3PUW A;  2KCT A;  2JA5 H;  2R7Z G;  3PO2 G;  4BBS G;  4LWC A;  3U58 A;  1YI2 A;  3W5O A;  1C9O A;  1NMF A;  4DV1 Q;  1E1T A;  5HY6 A;  3DM3 A;  4HJA A;  3ULL A;  3D0F A;  1IBL L;  2I5H A;  5GAG C;  1ASY A;  2PI2 A;  1VQ7 A;  3PCO B;  1IBK L;  1OTC A;  5IWA L;  4BY7 H;  2IX1 A;  3GTO H;  2N78 A;  1E3P A;  1SLJ A;  1HZA A;  3S24 A;  3U4V A;  1OXU A;  4IFD I;  1D8L A;  3CQZ H;  4JI7 L;  3JC6 6;  5BR8 Q;  4R4T A;  2C35 B;  3HKS A;  5C4X H;  2IHF A;  2UUA L;  4LF7 Q;  2R7F A;  4OON A;  4DPG A;  1YBY A;  4P75 A;  2VW9 A;  1SFO H;  4JI6 Q;  1Z9F A;  5HGQ A;  1VQK A;  5AJ3 L;  5M3M G;  3BZK A;  4R4Q A;  2BH8 A;  1VQP A;  4DV4 L;  1EUJ A;  5C44 G;  5LMN W;  3RZD H;  1Q81 C;  3BZC A;  1VQF A;  4OX9 Q;  1B8A A;  1YNX A;  2QGQ A;  4JOI A;  4QIW E;  4B3M L;  1Y1W H;  2ZM6 Q;  2VS1 A;  1LUZ A;  2KHI A;  3CMA A;  4JI8 Q;  3OTO Q;  2B63 G;  4X64 L;  2JEA I;  1QZH A;  1D7Q A;  1N32 L;  3KDF B;  1TWC H;  4NPS A;  1HNZ L;  4A3F G;  3CC2 A;  1IZ6 A;  4QL5 A;  2R92 H;  2ZTD A;  1XNR Q;  1PH6 A;  3HOW H;  4A3I G;  1UE1 A;  4A3M H;  1V9P A;  2UXC L;  1QUQ A;  1VQL A;  1QUQ B;  1VQC A;  2GVB A;  4X66 Q;  1B7Y B;  2QEX A;  1XMO Q;  5IYD H;  1Z47 A;  1AH9 A;  2F4V L;  4A3K H;  1L0W A;  5IYB G;  4JI2 L;  4AQY Q;  4L5R C;  3HOV H;  4A3D G;  1NE3 A;  5GAD C;  1NTG A;  1UE5 A;  1YZ6 A;  5IE8 A;  4JI5 L;  4JI3 Q;  4P73 A;  1CKO A;  1RL2 A;  1Y14 B;  4JOI C;  4GN4 B;  5ELO A;  1XNQ L;  4DV0 L;  4LF6 Q;  2AKW B;  3ZJY C;  2R93 H;  1VQJ A;  4DUY L;  4DV6 L;  1PH5 A;  4A3L H;  4QJF A;  1WOC A;  2QA4 A;  3JAM c;  3KF8 B;  4YCW A;  4JI0 Q;  3FHW A;  4GKK Q;  4POF A;  4BXX G;  5LMU L;  1HNW Q;  4A3E G;  4O2D A;  3NEN A;  2NVT H;  4IFD J;  2UXD L;  4LFC L;  4DNI A;  4LUZ A;  3OYY A;  1EYG A;  2B3G A;  4DR6 L;  1HZB A;  1XMQ L;  3HOY G;  2FXQ A;  4LF5 L;  1WCM G;  4HJ8 A;  4AYB E;  1PH4 A;  3W1G A;  5K36 G;  4DV5 Q;  4GS3 A;  1PH9 A;  5C0X J;  4POG A;  3M9B A;  1IBM Q;  1K8A C;  1X54 A;  1HNX Q;  3GTP H;  1IXR A;  4GOP A;  1I5F A;  1KRT A;  4GOP B;  3PF4 A;  4DV3 L;  2ZJQ A;  3UE0 A;  2AWO A;  2VQF Q;  4UPA A;  4C2M H;  1YEZ A;  4TQU S;  1HZ9 A;  1X3E A;  1KL9 A;  1XPU A;  3K8A A;  3RNU A;  4LF7 L;  1KRS A;  1U0L A;  1VQI A;  1FJG L;  4A93 G;  1HR0 Q;  1K83 H;  2MNA A;  3HOX H;  4YHH Q;  3J81 i;  1EIY B;  3AFP A;  4B3R L;  1SRO A;  3UDI A;  4UY8 C;  3DLL A;  3EN2 A;  2R7D A;  3ERS X;  4JV5 Q;  5GAH C;  1M90 C;  4DV2 Q;  2YTX A;  4GLX A;  4DV7 L;  1I94 Q;  4GOP C;  4B3T Q;  1E22 A;  2ZM6 L;  4BY1 H;  1QVF A;  1KAW A;  4DR2 Q;  1QVC A;  4JI8 L;  1L2F A;  1N33 Q;  2HIX A;  4QGU A;  3TS0 A;  1VQ5 A;  1HJP A;  4P72 A;  2HIV A;  2UUB L;  1NMG A;  2EQS A;  1BBU A;  4PZ6 A;  3UDG A;  1Q7Y C;  3S1R H;  4A76 A;  1C7Y A;  2DGY A;  5FLX c;  5FJ8 H;  1BVS A;  1N34 L;  4DR7 Q;  4JYA Q;  3PO3 H;  2GN5 A;  4NXM Q;  1L1O A;  4BBR H;  1L1O B;  3NBH B;  4IJH A;  3E0E A;  3A5U A;  4X65 L;  1M1K C;  4LFB Q;  2JA8 H;  2R7Z H;  1Q46 A;  3H0G H;  3K0X A;  3I7F A;  4XIG S;  2JA9 A;  1YJ9 A;  3F2C A;  3PSI A;  3KLW A;  1KQS A;  1VQD A;  1C0A A;  5C3E H;  4NXN Q;  5IP7 H;  1YIT A;  2YYZ A;  4JI4 Q;  2VUM H;  1MJC A;  2K52 A;  2Q2H A;  4YWK A;  3L7Z C;  1OXS C;  1XTD A;  4OWT B;  4JI0 L;  1CKM A;  2NVX H;  4GKK L;  4LF9 L;  4YWM A;  3NEL A;  2Q2I A;  1Q12 A;  5JJI A;  3J80 i;  2A19 A;  4L5Q A;  3CCL A;  5M5X H;  3CD6 A;  3CC4 A;  1N9W A;  2VY3 A;  4ME3 A;  3RLF A;  1DGS A;  4LNQ A;  1TWF H;  4B3S Q;  1VQG A;  3KF6 A;  1P8L A;  3KF6 B;  1L1O C;  2D0P A;  1XJV A;  4K0K L;  1VQA A;  2KEN A;  3T1Y Q;  5IYC G;  1PA6 A;  1J5E L;  3HOZ G;  3S1Q H;  2UUC L;  2KBN A;  2WFW A;  2Q2T A;  3GTL H;  4KHP Q;  1WFQ A;  4MTN A;  3HOU H;  5JJK A;  1YIJ A;  4DK3 C;  1MIU A;  1V1Q A;  1PYS B;  1VQ4 A;  1VS0 A;  1T9H A;  4X62 Q;  3CF5 A;  2K4K A;  1N36 Q;  5JJL A;  1ASZ A;  3M4O H;  2ZJP A;  1CSP A;  2WAQ G;  4DR1 Q;  3GTJ H;  2B29 A;  4RG1 A;  2UXB Q;  2HQL A;  3RLN A;  4DR4 Q;  3S1N H;  2NVY H;  3I4N G;  4WJ3 M;  3LGJ A;  5IY0 A;  3AFQ A;  3IRB A;  3RLO A;  4DR5 Q;  1RIP A;  4JI1 L;  3I4M H;  4C3J H;  2PMZ E;  3J81 c;  1Q82 C;  1A8V A;  3L0O A;  3Q8D A;  2CWA A;  1Y1V G;  2VZA A;  2LXK A;  4YHH L;  1YJN A;  1TWA H;  2ALY B;  1N8R C;  2IT1 A;  1PH7 A;  2JA7 G;  2K14 A;  3HKZ G;  1PH3 A;  2EIF A;  1E7Z A;  2MO1 A;  4OWX B;  2NN6 G;  4DUZ L;  1PH8 A;  1I94 L;  3SGI A;  4IPH A;  4B3T L;  1TWG H;  2ID0 A;  1WI5 A;  4DK6 C;  2BA0 A;  2UU9 Q;  4DR2 L;  1KXL A;  4LF4 Q;  1X3G A;  2RHS B;  4UP7 A;  5IP9 H;  5M3F G;  4HJ5 A;  4IO9 A;  1K9M C;  5GAE C;  2E5L L;  2RCN A;  3MXN B;  1MJE A;  3H3V I;  5GQO A;  1YJW A;  2HHH Q;  4DR3 Q;  4LFA L;  4JYA L;  4KI0 A;  1B70 B;  2LSS A;  2JA5 G;  3PIP A;  2KCM A;  1W2B A;  2BH2 A;  5M5W H;  4OWW B;  4C3H H;  3K7A H;  1IYJ B;  4JBM A;  1O7I A;  4OO1 G;  4L5S A;  5C4J H;  1G51 A;  1X6O A;  3RN2 A;  4R1J A;  4UP8 A;  4HID A;  1Q8K A;  1HR0 W;  3I55 A;  4HIO A;  1NY4 A;  1JJG A;  4BY7 G;  4EQ5 A;  2I5M X;  3B6Y A;  3BJU A;  4YY3 Q;  5JEA G;  4JI4 L;  2CQO A;  1PH2 A;  4TVA B;  2ZJR A;  1OXT A;  2XGT A;  2IX0 A;  2JJQ A;  3J7Z C;  1EFW A;  4GKJ Q;  4JCV E;  5C4X G;  3J80 c;  3OW2 A;  4DV1 L;  4WJ4 A;  3AYH B;  4OXP A;  2GVA A;  3A74 A;  5LMN Q;  2YV5 A;  1A62 A;  4LW1 A;  4A3C H;  1JT8 A;  2WB1 G;  2RHQ B;  4LUV A;  4YWL A;  5FLM H;  3T1H Q;  3KFU A;  4UP9 A;  4A3G H;  3ER0 A;  1BBW A;  5BR8 L;  2K5N A;  1K0R A;  3CME A;  4PZ8 A;  1Y1W G;  1S3O A;  3FKI H;  1BKB A;  4DR1 L;  1GKH A;  1FGU A;  2I5L X;  2K75 A;  2JA6 H;  1IBL Q;  4JI6 L;  1LYL A;  3CC7 A;  2R92 G;  2A8V A;  3HOW G;  1IBK Q;  4A3M G;  5M5Y H;  3ICE A;  1PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...