1LV9A

Cxcr3 binding chemokine ip-10/cxcl10
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
63
Chain Sequence
VRCTCISISNQPVNPRSLEKEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions.
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Small inducible cytokine B10
total genus 10
structure length 63
sequence length 64
ec nomenclature
pdb deposition date 2002-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lv9A00
2HDMA 3I3CA 1O7YA 3GV6A 2Q8RE 1NAPA 2X6LA 4UAIA 5DNFA 1F9QA 4ZLTF 1WVLA 3DEOA 3MTSA 1J9OA 3HP3A 3G7LA 1PFMA 4RWSC 2K01A 4RAUC 1U4LA 4HEDA 5EPJA 4NW2A 1G91A 5D65A 1SAPA 2B2TA 3I8ZA 2B2WA 2KEEA 2KOLA 3FDTA 1LV9A 2DY7A 4HSVA 1S4ZA 2FHTA 1O80A 1ILPA 2D9UA 1E0BA 1AP0A 3IL8A 3DEPA 3D6WA 5E4WC 1PFBA 2B2VC 2K1BA 4QUCA 1HFGA 1PDQA 1QE6A 1F9RA 1QNKA 4IUPA 4IUVA 1BNZA 1XYIA 4X3SA 3R93A 1EL0A 1AZPA 3I91A 1RTOA 4OIKA 1B50A 1GUWA 2H1EA 2KEDA 2L4NA 1RHPA 2B2TC 1ILQA 5T1IA 4R9WA 1MGSA 5EPLA 5EQ0A 1G2SA 2FJ2A 5COYA 3TN2A 4CJ1B 1DONA 1NCVA 1B3AA 1ESRA 2JYOA 4OIJA 1B2TA 2BDNA 5EJWA 5CBEE 1X3QA 3TZDA 4HAEA 4ZKCB 3QO2A 4XDXA 5EKIA 2L12A 2J7ZA 1CM9A 1NR2A 5CMDA 1EIHA 1F9PA 1DZ1A 4X3TA 2N55A 1AZQA 4MN3A 2RSNA 2RA4A 1O7ZA 2MP1A 1DOKA 1ML0D 1U4MA 2B2YC 2L1BA 2JP1A 2HDLA 4U68A 4XT1B 1HA6A 1ZXTA 1B4OA 4CJ2C 2KECA 1F2LA 2B2UC 2L11A 3H91A 4O42A 1J8IA 2HUGA 1A15A 4ZK9B 1U4RA 3UI2A 2HCIA 1HFNA 2B2UA 2FINB 2IL8A 2NYZD 1U4PA 2EE1A 2M2LA 2RVLA 1G6ZA 1KNEA 3LWEA 5D14A 1MI2A 2B2YA 2SDFA 2HCCA 2X69A 2KUMA 1ICWA 2MJ8A 4QUFA 1VMPA 5AFWA 5T1GA 1HRJA 1HUNA 1Q3LA 1DOLA 1EQTA 1MSGA 4IURA 3IFDA 2MGSA 4IUUA 4DN4M 1PLFA 2L9HA 1CA5A 1JE4A 4X3UA 2EOTA 1WTXA 2X6GA 1B53A 1MSHA 3ONAB 3N52A 1XX8A 1RJTA 1DOMA 1EIGA 3GV3A 3P7JA 5JJZA 4R8IA 1M8AA 1RTNA 1G2TA 1EOTA 2DY8A 1CA6A 4LMQD 1WD0A 2N88A 2XIWA 3SVMA 1SDFA 4HCSA 1IKMA 1VMCA 1BO0A 1QG7A 4RA8A 2Q8TA 3MWYW 2K05A 4MHEA 5CBAE 5CORA 1TVXA 2B2VA 4ZAIA 4XT3B 1HUMA 1SSOA 2K04A 1JICA 2MPMA 3KUPA 1X3PA 2FFKB 2K28A 1IKLA 3Q6SA 2B2WC 3I90A 4IUTA 1WTWA 4IUQA 1NR4A 5EPKA 3F2UA 4X3KA 1WTRA 1WTPA 1X32A 2NZ1D 3KBXA 1F9SA 1WTOA 1KNAA 4ZKBB 1C8CA 1BF4A 2R3ZA 3DM1A 2FMMA 1IL8A 1BBXC 1WD1A 2VXWA 1WTVA 3FPUB 5E4XA 1HHVA 2NWGA 4CJ0B 1PFNA 2RSOA 1WTQA 2KVMA 2K03A 1RODA 2EPBA 2CVRA
chains in the Genus database with same CATH superfamily
2O5JC 1ESFA 4A3IG 1GO3E 2VQFL 2QDLA 4ZLTF 1VQNA 4EQOA 1J9OA 4HN7A 3E0EA 1E7ZA 3CCRA 1YBYA 4A3GH 4XQJA 1G91A 4QF4A 3I8ZA 2IX1A 5C3XA 2DY7A 3T1HQ 1AP0A 1A3UA 3QOLA 2PQAA 2Y0SG 2N8NA 3B6YA 1VF5C 4UHVA 1Q7YC 3I2ZA 2KHIA 4AYBB 1FGBD 1TY0A 2EJMA 4X3SA 4A93G 1I3QB 4JVZA 1AZPA 5GQOA 1GUWA 1SEBD 2WFWA 1QWYA 4JV5L 3C3LA 3S14B 3C1EA 2QA4A 1QVCA 3L9AX 2NN6G 4C3JB 1KQSA 4F88A 2L12A 2SNMA 1Y1VG 2XRSD 2LS01 2ZTCA 1CFMA 2AKWB 2B2YC 4C1NI 4AYBE 1RIPA 4TKOB 3L3OC 4DXFA 4QJFA 4MTNA 4EX5A 1BR9A 3MXNA 1FNWA 1GUGA 3Q8DA 2RDGA 2B39A 4K5VA 3HKZB 2VQEL 2F0MA 3HOYB 1L0XB 2IT1A 1B53A 4UY8C 1LT3D 2BE5D 2JEBI 4Z9CB 1I50H 1E3PA 5AJ3L 1CA6A 2JA9A 4A3MG 3GDEA 3OOCA 2JQOA 2EY5A 3SVMA 3CQZB 4P73A 3RD4A 4NXMQ 2R7ZG 1X54A 3EJIA 5I2XA 5IP7H 3MFGA 1NSNS 3RMHA 3F2DA 3OPOA 5CC4A 4P2CB 5A2QL 3HGBA 3NXWA 4B08A 3A7AB 3KBXA 3PO3H 1KNAA 4DV4Q 1BBUA 2R3ZA 2FMMA 1LTTD 1SFOH 2ZJPA 1N32L 1M90C 3DWAA 1E2VA 4DK3C 3S2HH 3K59A 3CMEA 1A0IA 1SNPA 1X3EA 1UE5A 3G4SA 3CCLA 1LT4D 1TWCB 4FP5D 4RAUC 4RHSA 1BDOA 1F2MA 1HTPA 4KD3A 3GTGB 4GKKL 1PH5A 1D5MC 3AYHB 3D0FA 2DNEA 3FDTA 1O7LA 3J80i 2D0OA 1O80A 3TZUA 1Y1WH 4LF7Q 4ALPA 3DEPA 2OF1A 2XSCA 3NSWA 4G57A 2EYPA 4O1NA 2JK8A 4RH6A 3HOUH 3EBEA 3HOZB 5CV7A 3NENA 3DWPA 3RZDH 2MNAA 1STYA 3CC2A 1BKBA 3FKIG 4E6IA 2B63G 1VQKA 1QCBD 3S1QB 1YNXA 2ZXPA 1VQHA 4A93H 2F0NA 3IKJA 4CDEC 1MBYA 3ITPA 2GVAA 1A8VA 3RZOH 1I6HH 1PRTD 3A56A 3MAQA 4IJHA 2PI2A 4IO9A 2L1BA 3STBD 3HOXG 2F1MA 2J4XA 1GVPA 4YY3L 3AMUA 2B8FA 4DR6Q 3RNUA 4JI4Q 4HIMA 2C35B 4WJ4A 1SXTA 2HCCA 5FJ8H 3AU7A 1H9JA 1X3FA 2MFIA 1MSGA 3HOXH 4JBJA 4P75A 1EYAA 1YNJD 4AYBG 4I65A 1KC8C 3OMGA 2VUMH 1JE4A 5IWAL 1Q1BA 1UE7A 5GAGC 3GV3A 4RG1A 5LHY1 3K5OA 4C2MH 1VQAA 2K05A 2UUBQ 3RZOB 4H02A 1N36L 3WOEA 4N8FA 2NBFA 1OXVA 3T13A 4DGZA 1TS2A 3PIP3 4EGVA 2NVXH 2CQAA 1E22A 4MTKA 5C4JH 4KJOA 4YCUA 5C6AA 4ODGA 2MQHA 3TP8A 3I4NH 1N33Q 2A19A 3PF5A 1C9OA 1WOCA 1I5FA 3CHBD 1KRTA 1WTQA 2EY1A 4LF4L 4UAIA 3MXUA 2NVQB 4FVMA 5IT9L 1KABA 3S1NH 4JW0A 3S1MH 2WAQG 5D65A 1QZGA 2JA7B 4A93B 4HSVA 3J81c 3D4DA 3SGIA 4KD4A 5ELFA 2EJFC 4DR3Q 4MIUA 4IPHA 4JI3Q 1KDCA 3G6JB 1A2UA 4LFBL 2F03A 1B50A 3GTLB 3TREA 3J7AF 2R7ZH 5C3WA 1MGSA 4R4IA 3NP8A 3GTPH 3SR1A 4A3MH 4JYAQ 4LF9Q 2Z0SA 3TZDA 4LF5Q 5KGUA 5FO7B 1JMCA 2Z6KC 3N6RA 1F9PA 3JC66 4HIDA 3W2DA 4JCVE 4OXPA 5CV9A 1O7IA 1TQOA 3IAYA 4U68A 1JR0D 2LSSA 3KLWA 5M5XH 1IBKL 4KKUA 3WWVA 2JA8H 1U4PA 2M2LA 1LUZA 4DR4Q 1YHBA 3NBHA 3RZDB 1Y8OB 3D31A 1QUQB 4AQYL 2JEAI 1SNOA 4UP8A 4K0KQ 3TP5A 3GTQB 1AH9A 2BOSA 1CA5A 4X3UA 2EOTA 4QB4A 1JT8A 2AWOA 5I4DA 4IQZA 3HRZC 4IN3A 2AUKA 4IOAA 3H3VI 3GTKB 1SDFA 3AQQA 4A3DH 5C4JB 3DXJC 2J0TD 2F52A 1PYSB 3EROA 1FNVA 2AQ2B 1VQFA 1X65A 4CKEA 4Y7NH 1IZ6A 2Z8LA 3M4PA 2Y0SB 4KY7A 3STBC 5GAHC 1X32A 4ME5A 2CWPA 1IHZA 3W1GA 3NQIA 1Z6HA 2OEOA 3H0GG 1WTOA 4DU9A 4U673 2I07B 1YNNC 1A3TA 1PH4A 4BY1G 1SN8A 5IODA 1BBXC 3OIQA 2VW9A 1RDPD 4A3EB 3MXPA 5J3BA 2YU9H 3K7AB 2UXDL 3NQTA 1E24A 4KMUC 4EQ5A 2EPBA 1EWHA 4LJZC 4R1JA 3S17H 1TWFH 2B3GA 4OHJA 1N33L 5K36G 4TSSA 1B70B 4C56C 4JI8Q 3S15H 2C5CA 1ENFA 3V05A 3K7UC 4FO2A 3HOVG 3L2PA 2NN6I 3A55A 1V1PA 5FK9C 4QIWE 2GN5A 3PO3B 1K9MC 1F9RA 2BH2A 3QR8A 1HZAA 2AUJD 2Z1CA 4OGQC 5M3FB 2R92H 2H5XA 3JAMi 2K75A 4R9WA 1WCMG 4JOIC 1EY4A 1HJPA 5G3LF 1GJXA 2EY2A 3DUZA 5M9OA 4HR7B 4HJAA 4LF8L 3CMAA 2WB1G 5LMNW 1IYVA 4ABNA 2NTTA 2OQ0A 5IY0A 2HDLA 1B4OA 2L11A 1J8IA 2NN6H 2HUGA 3S1RB 1G291 1HFNA 1EIFA 1EOVA 4XQNA 1MI2A 2B2YA 1UNSA 2M9VA 1BCPF 2MJ8A 3P75A 2ZJQA 1LACA 2YYZA 1IXRA 5E3FA 4GNXC 1VMPA 1HRJA 3CCQA 4IFDJ 1UUPA 1FYCA 1EQTA 5EBDA 3J81L 4TVAB 1A6XA 3K81C 2F0LA 4BA1I 4CDDC 3I4NB 4DNRB 1U9RA 3VA7A 3ONAB 5LMNL 1D1KA 4BWGB 1PRTB 1EIGA 1C0AA 3PO2B 2WINB 4LMQD 1B1ZA 1CT1D 4WJWA 1XNRL 1KL9A 3SXHA 3M3YB 1V1OA 3HOZH 4V190 3LX0A 3T1YQ 4LFCQ 5FO9B 1HNXL 2A74C 1K3BC 3TQYA 1STBA 3CPWA 3H15A 2NZ1D 5CV4A 4KN7C 5M3FH 3VYRA 3HOWG 4UP7A 1FVIA 3FPUB 4RGNA 3TBIB 2K50A 3JAME 1VDZA 2ZXRA 4HCEA 2PYKA 2JA7G 2RKSA 3ICEA 2A69C 2WIIB 1F77A 2O4XA 4DV6L 5KNDA 4DR7L 1K8OA 3TS2A 2D0PA 1CTMA 3TDQA 4IPDA 4B3ML 4JG2A 1LV9A 5EAYA 3SHLA 5IYCH 3K58A 3KDFB 1NUCA 1ASYA 1DYQA 5J39A 2K1BA 4R8NA 1IL2A 4IUPA 1BNZA 1XYIA 1FJGL 3EFXD 1M4VA 2R7ZB 1EL0A 1EEFD 1B3QA 3D6CA 2JN4A 4A3JB 4NKLA 4B3RQ 3V96A 1MJEA 3MXGA 2PZTA 4XYOA 1CM9A 1NR2A 4DV5Q 1B9NA 4LF5L 4RCNA 2N55A 2RSNA 3CRKC 5GADC 4GOPC 1CI3M 4XT1B 4X64Q 2SEBD 3A5UA 1HZBA 4PZ6A 1ZYRC 1SLJA 2A69D 4HJ8A 4QL5A 2IL8A 1IBKQ 1K3RA 4GLAC 1VQJA 1L0WA 2IJ0A 1SJHD 1D5ZC 1R4PB 1BOSA 2YTVA 2E74C 1R4QB 4JPBW 2IWHA 2VUMG 1N34Q 4PMWA 1DGSA 1TKWB 4FYDA 2JA6G 3RLNA 1G51A 1KIXA 3EVQA 4WFN3 1J5EL 4FF1A 3CCVA 4HCSA 1IKMA 1BO0A 1I4HA 1QG7A 5JPMC 3MWYW 3UE0A 1D6EC 1AFPA 1WFQA 2JA6B 1XPUA 1V9PA 3DLLA 4MNOA 1ASZA 5FOBB 1I6HB 1X3PA 1CZGA 3GTLH 3T1YL 3CCSA 1Q8IA 1STGA 3CC7A 3NTKA 3PO2G 1IBLQ 4A3KH 5C4HA 3UE1A 4PMCA 4DNTB 4M8AA 1LTLA 2VY3A 1BXTA 2KENA 2O2LD 4LFAQ 4A3JH 2KVMA 4QY7A 5L37A 3HOUB 4IFDH 2HDMA 2UXDQ 2Z6KA 5HGTA 5J22A 5CR3A 1WVLA 1S5BD 2JA7H 4LF6L 4JI5Q 4EQNA 3G7LA 2YV5A 4B9XA 4HEDA 2K5VA 1AE3A 5IGFA 3E6ZX 2R61A 4PG3A 3IL8A 1MD2D 1SYFA 1EIYB 1I4GA 1I94Q 2K7VA 1QNKA 3F8TA 3GD7A 5CGKA 4KHVA 4NXNQ 5LL6S 5LMUQ 3PIOA 1Y69U 1VQGA 1PH1A 3TEHB 2ATWA 1E1TA 2CCZA 3X3MA 2L55A 1EQQA 3CC4A 1HA5A 2K5DA 3S17B 1HH2P 2L0CA 5NUCA 4GZYC 1GUNA 1EIHA 4KTAA 5M3MB 1QJOA 4LF8Q 4LFAL 1W6KA 5FLXE 1GUOA 4JI6Q 3TS0A 2UUAQ 4DUZQ 1PZJD 2RHSB 2ICIA 5KYIA 1PH8A 4H13C 1U4RA 2ICEC 1E2WA 4ZUJA 2HHHQ 2NYZD 5C44B 5IIFA 4C3HH 1EQVA 5D14A 3BDCA 4K8IA 4G7HC 1V1QA 4X66L 1TIID 3M85A 4IURA 2MGSA 4WORA 5G3LD 3D4RA 2F0TA 3GTKH 4A3DB 2UU9Q 4PZ8A 3MC0B 3TMEA 3A0JA 4A3EH 2R7FA 1TWAH 5KYLA 4LNQA 2ZJRA 4GN3B 2PW7A 1WTWA 1FGUA 3SK8A 3VR3A 2F3VA 5EKLA 4K14A 5M3FG 4L5RC 4YY3Q 1H95A 4HJ9A 1J6QA 2QEJC 1S72A 4X66Q 4L6TB 3GV6A 3PGZA 3FPPA 4DV3Q 3FMCA 4OO1G 1K0RA 1N8RC 1U4LA 3SEBA 2JA6H 5DEHA 4DV1Q 2PZWA 4IFDI 2KOLA 5IWAQ 2PQEA 4JI5L 4A3BH 3OIPA 1STHA 4K8JA 1TWGB 1CSPA 2QILA 2B2VC 1W3SA 4QUCA 1HFGA 4HIKA 3GTOB 4YWMA 2SNSA 2UUBL 2RDFA 2LXJA 1Z47A 1I94L 5HY6A 2F3WA 3OMCA 2RQXA 1RHPA 4DXGA 1WCMB 1QB5D 2A8VA 1LTAD 4LUOA 4GNXB 1D2BA 5JJIA 5LMUL 2WACA 1K8AC 1TS3A 4DR5Q 1LO5D 3QO2A 4C1NK 1LTID 3OWFA 1E2ZA 4KHPQ 3KLSA 2L5TA 3OW7A 3GTOH 4G4KA 2LMCB 1PRTC 1JOQA 4O42A 1PTOD 1ENAA 3DM3A 3EQLC 2LKVA 4A3FH 2UUAL 3QB3A 1VQ7A 4XIGS 3LWEA 1LTRD 4IFDG 1ENCA 5T1GA 1BCPB 2BCOA 2EYJA 3WOFA 4RHRA 2E2DC 1PTOC 4DN4M 1BBWA 3UDXA 3T51B 3HOVB 3NWSA 2X6GA 4C2MB 1Q86C 2E2JH 4R8IA 2MUYA 4HTHA 2ZXOA 2YTYA 2KBNA 1K83H 4FNFA 3J7YW 4C3HG 4YHHL 1PXUA 1XNQL 1Y1VB 1VQBA 5ELNA 1GUTA 1HUMA 2DGYA 2Z4HA 1JICA 1VQ8A 1XXGA 4LAAA 2K5WA 1JWSD 3I90A 2VS1A 1OTCA 5EPKA 1H9MA 5I2YA 1C48A 2EQSA 2I5LX 1EU3A 5F2DA 4A3BG 3J7A5 3R2TA 3OTOQ 1EU4A 1BF4A 4AH6A 4J1MA 2R93G 3M7NA 4DV0L 4G7ZC 4B3TL 1MJCA 2HIXA 4CJ0B 1SNDA 1RKNA 1IW7D 1WJJA 1SMXA 3SK5A 3BDOA 3T1HL 3SK6A 4LF6Q 4A3DG 1UE6A 4GKKQ 1YJ9A 1R9TB 3NEMA 2XNAC 3CXCA 1SE8A 4ULLA 3C2PA 1SFOB 2B2WA 4L5SA 3ND8A 3I4NG 3S14H 1ILPA 5M5XB 1F2YA 1JWMD 1XNQQ 3KBGA 1TR5A 4J15A 4BBSH 1CUKA 4YCVA 3OHXC 3I56A 1CQVA 4OIKA 2EYHA 4DR1Q 3CRLC 2L4NA 4A3JG 1HXYD 3RR5A 2F4VQ 3CP0A 3GTGH 3K5LA 2A73B 2FJ2A 1SE4A 3KYHC 5CYUA 4OIJA 5C3EB 5IYBG 3K5NA 2VNUD 1C7YA 1QVFA 1YNND 2HD3A 3PUZA 2KJXA 4DUYL 4X3TA 1T9HA 1DOKA 2CKZB 2DUDA 4KN4C 1JJ2A 3R8BA 4X65Q 4PQXA 4EVOA 3I4MB 1CQFA 3H3VH 4O2DA 3KK7A 4JI8L 5C0XG 5GAEC 4A4IA 2ALYB 3MHBA 2ID0A 2PI2E 3ULLA 4P72A 4DV6Q 4DR7Q 2F0FA 2EIFA 3BG3A 1HNZQ 4R4TA 1XPOA 4EQPA 5FO8B 1EY5A 4XQQA 3G71A 2NB0A 2EXZA 1RJTA 1VQPA 4KY6A 4L8JA 1JORA 1EZ6A 1H9SA 2PNHA 1VMCA 2Q8TA 1CHQD 1PA6A 4KKSA 5CORA 2B2VA 3J81E 4ZAIA 1N36Q 3HOZG 4CDCC 1V43A 3VR5A 5C44H 3KUPA 1D8LA 1YEZA 3FKIH 2B63H 3QIAA 1JC7A 4BBSG 3BVGA 5I6YA 2A68C 1JQYD 3H0GB 4OWWB 1LT5D 4ILWA 4LUVA 3A54A 4X65L 1IL8A 1WD1A 3HEJA 1CZWA 3W1BA 3NTHA 2XTIA 1VQLA 1YNJC 2A5HA 2E2HH 1PFNA 4DAYB 4LF4Q 5JJZA 1SMYD 5DAUA 4KK7A 4FXGC 1HNZL 3G48A 3MVVA 5DNFA 2KHSA 1YHQA 1Z7TA 4LF7L 2K01A 1LABA 2PMZB 4IOCA 5CV6A 1LLRD 2EJGC 5IGEA 2KEEA 3NBHB 2E5LQ 2IW3A 3NELA 2F0OA 1E0BA 4DR3L 1I3QH 4Q0FA 2R93H 3J80L 3GTMB 4KV6A 5FLMG 1XNRQ 5M3MH 3PIO3 2K5HA 1STNA 1WCMH 2PNRC 3I91A 1P16A 5AJ3Q 2WAQE 3RN2A 4OL7A 3HG9A 3Q0AA 2UUCQ 4ZRZA 4OX9Q 3GTJH 5COYA 4DR1L 3S16H 1X3QA 5CV8A 2CW0D 3CU7A 4PNYA 1H9SB 2CH4A 3A8KE 3M4QA 3E3XA 5M3MG 1H9RA 3KLSX 1TY2A 1XMQL 1UAPA 1K83B 1HA6A 2P5ZX 5KNBA 1ZXTA 4IZ8A 4CJ2C 1I6VC 1F2LA 5HGQA 5IGBA 2RHQB 5JVH3 3BZCA 2JA5G 3UI2A 1G6ZA 3BJUA 3EA6A 4ZYSA 4OWTB 4NP5A 4GN5A 4OONA 3U4VA 4CGYB 5BN3A 4QUFA 1II3A 5HURA 4OELB 1YHAA 1Q3LA 2KA7A 5IYDH 1WI5A 2WP8J 3U4ZA 4BY1H 3QJYA 4Y7NB 1EFWA 2EYFA 2Z6BA 3RUZA 1YVCA 1WTXA 3KF8A 3BU2A 1FJGQ 2DY8A 4JI1Q 3ND9A 4OX9L 3E9HA 4IJLA 2G9DA 4JI7L 4P71A 2HIVA 3OWEB 4J8QA 1KRSA 4XTCS 1PTOB 4BBRH 4X62Q 4K5XA 4L63B 3HFZB 3SE0A 2YU9B 2IX0A 3E9IA 1KDBA 1VCIA 3NUCA 4LUZA 2Z9HA 3PIPA 1IKLA 3BS1A 1NR4A 1PMRA 5JEAJ 1SYEA 4ZKBB 1C8CA 2ES2A 2N3SA 2NVYH 2N78A 4X64L 1FD7D 1LTGD 2VXWA 3I70A 4DUZL 1WTVA 3KLRA 5IGDA 4A3KB 2RSOA 3U9OA 5ELOA 3RN5A 3I7FA 4H7BA 5CV5A 5IGCA 2E2HB 1EY8A 1NTGA 4RWSC 4DAVA 5E1FA 1SAPA 3M9BA 3PCOB 4O0AA 3HOWH 3FRPB 1PZID 5BN5A 3MEFA 4CDFC 5E7NA 3ER0A 3R3OA 1FR3A 5E4WC 4JI2Q 1EZ8A 1RCVD 1A2TA 1L1OB 1Y8NB 4IUVA 2EXDA 2V1CC 5K36H 2JSOA 2VB2X 2G5DA 5JVG3 2OXPA 4YIJA 2TSSA 4GLVB 1LTBD 1VS0A 5T1IA 5EPLA 3BZDB 3J80E 2B8GA 2XRQD 1K8GA 1YIJA 4QCLA 1N32Q 4N9PA 1DZ1A 3M4OB 1AZQA 2MP1A 1KAWA 4POGA 2Y0SE 2WKCA 1PHJA 2BDOA 4QGUA 2ASBA 2NVTB 2RVLA 1LT6D 2QCPX 4Q5VA 1K0SA 1PH3A 2HQEA 1SBBB 3T16A 3M3YH 1SNMA 1XPRA 1WTHA 2WB1E 3HOYH 3HOUG 3DMUA 4BXXG 5KRUA 1NNXA 4JI2L 4GLXA 1MHWC 4V0BA 2QF7A 1SJED 2L9HA 3LNNA 3J81j 4K6DA 1XX8A 2VZAA 5C4ZA 3AFPA 1TS4A 1GKHA 1A62A 1HR0L 4DV7L 5JJLA 1JCKB 1GOZA 2WKDA 1FL0A 4UP9A 4RA8A 3W5OA 3GTPB 2JA8G 4B3SL 1EY0A 3HKSA 1ZYRD 2JE6I 3Q6SA 1BUVT 3P1HA 4JC0A 4DR5L 1B7YB 1M1KC 3AFQA 4F87A 5IT9E 2L15A 4JBMA 1KLUD 5ISRA 1HHVA 2JA5B 5EQ0A 5C0XH 1DONA 2OQKA 3S1NB 1GUSA 3K7AH 1QNUA 1YZ6A 1JJCB 1PFMA 1KAAA 2CHBD 3M4YA 1LTSD 4JOIA 5TSSA 1TU2B 4DR2Q 1CKOA 5FLMH 4DV7Q 2XWBB 1X3GA 1S4ZA 2R6GA 5IT9c 2NUCA 5I6WA 4QMGA 3NHHA 4A3KG 1RL2A 4JI0L 4TQUS 4B3SQ 1NMGA 1Y1VH 1VQDA 3KFUA 2G9HD 1TWGH 2QDBA 1HPCA 1PYWD 1ZKOA 4ME3A 5DM63 3FEWX 3TRZA 4ZQ3A 2EDGA 2BDNA 3QG1A 5CBEE 2AHOB 5JPNC 4OO1I 1GD7A 3ZYYX 1VF7A 4DF7A 1AN8A 1EYGA 1DD2A 1L2FA 1HNWL 5C5MA 4DV0Q 3MA2B 3VA5A 3S1QH 1BCPD 4ZK9B 4I7AA 1CKNB 2QEXA 1SNCA 5C44G 4DV3L 3M7GA 1OXTA 4DR2L 4N9TA 2A6ED 2DJFC 1QILA 5C0XJ 4KJNA 4XXEA 2IHFA 3H6MA 4RFBA 2F0IA 4JI0Q 1FNUA 3FKIB 2B63B 3DWQA 1IYUA 1PVOA 3GTQH 3PV0A 1M8AA 1TS5A 1J5EQ 3I4MH 2EYLA 2RF4A 1Q81C 5FKAC 4RKLA 1W6JA 2MO0A 1CSQA 1GHJA 4A3IH 1HNXQ 4XT3B 4X62L 4BY7B 1SSOA 3A5ZB 1NJIC 5D3IB 4A3EG 1S5CD 4APVA 3X3NA 2R7DA 4DA2A 4JK1C 3S9WA 4DFAA 1KLGD 1AW7A 1UWVA 1EWCA 5M5YH 1VQEA 3V2TA 5IGGA 4GKJL 3NBIA 3CCMA 1SYDA 4RGOS 1O78A 1O7YA 2C9OA 1JB7A 4PV1C 4B3MQ 1KDAA 5JEAH 1NBWA 1L1OC 4BBRG 3HP3A 1CKNA 1VQ9A 4IALA 4BA2I 4DAYA 2NZOA 2PO4A 2A1AA 2FHTA 1U0LA 5C3EH 3PF4A 3D6WA 5I9OA 2UXBQ 1PFBA 4GOPB 4OEMB 2F0SA 1Q82C 5IYDG 1UEBA 3K8AA 5IP9G 3C1FA 4YHHQ 5JAVA 1JWUD 1T5EA 5H1SE 1KXLA 1RTOA 1NE3A 4LWCA 5ELDA 5IE8A 4RKBA 1ZEQX 4BBSB 4JI3L 4M1UB 1G2SA 1PTOH 4LFBQ 1TWHB 2RCNA 1B2TA 3S24A 4HAEA 1RD9D 4XDXA 4A3LG 1MKHA 2EYMA 1PTOF 1ML0D 1STEA 4A3FB 4K2LA 3OYYA 4A3GG 2I0QA 1EY9A 2NVYB 4A3BB 3VR6A 4DAMA 3NK9A 4DR6L 1P8LA 2FINB 3NE5B 2WB1B 4JI4L 1I4QA 5DLQE 4C3JG 2VQFQ 1EQRA 2AQ1B 4HIOA 1HUNA 1JB3A 2UXBL 3FVQA 5BN4A 3IFDA 2BE5C 4DK1A 1XMOL 2R93B 2UU9L 4KLKA 3HKZE 4GN4B 3KJPA 2JA8B 2WAQB 1RTNA 1K28A 1EOTA 4DKAC 1B9MA 3ULJA 2NVXB 1HR0Q 1WD0A 4DK0A 2ENBA 3U50C 1SYCA 2EZVA 4R4QA 1SR3A 1X55A 4OWXB 1S3OA 1TVXA 4H44C 2I5MX 1IW7C 3CAMA 1K8MA 1OXUA 4UDUC 1PH9A 5I9PA 3U58A 3RLFA 1I4RA 1Y1WG 4A3MB 1NMFA 2JXMB 2LXKA 1STAA 3Q22A 3A8IE 1JJGA 1H9KA 3QOJA 4HMIA 2NWGA 3H94A 4KHZA 1RODA 1ESRA 2PW5A 2F4IA 2CVRA 3I3CA 5M5WH 2Q2TA 1PH6A 1V8QA 3A7LA 3BDLA 4XYQA 1F9QA 5JJKA 1SE2A 1VQOA 4GS3A 4C3HB 3P20A 1UE1A 2CH4W 5LMNQ 1EFID 3GP7A 2NZHA 2VQEQ 1TWHH 3CW2C 2D9UA 3GQBA 2QGQA 2F3IA 3AEVA 3K0YA 1VQIA 2XN9C 3K80C 1QE6A 2DJGC 4LFCL 1DJRD 5M5YB 4IPGA 4OO1H 2H1EA 2XVSA 3URYA 2Q2UA 3S2DB 5C4XH 1VQCA 4L5TA 1L1OA 2Z4IA 1HZ9A 3UDGA 4PMBA 1S5FD 1QZHA 1CK1A 5KNCA 2I5HA 2KQ3A 2EYOA 4MN3A 1TT2A 2GVBA 1U4MA 2KCCA 5IYCG 2ZM6L 1U5KA 4DV2Q 2B2UC 2BA1A 3PSIA 4LW1A 4N8X1 1BQQT 1HNWQ 1A15A 2K4KA 3CCEA 1PFSA 1KNEA 3MFYA 2SDFA 2RCFA 4FF3A 4J6HA 2IPKD 3E0JA 1S40A 3KF8B 1D7QA 1PH2A 5IOCA 3A74A 4JBWA 3T4AC 2O5IC 2OCEA 4WRDA 1PLFA 4HJ5A 3PUXA 5BR8Q 3PO2H 1JOOA 2F0KA 4Y52H 2Q8IB 1DOMA 2NVTH 5M5WB 4BXXH 2MHVA 1EEID 3VR2A 2KCMA 2F0UA 2F0VA 4YCWA 4KKTA 3EIVA 2RBMA 3JAML 1KTKA 3TP7A 3DHQA 4TRDA 1E1OA 2CFMA 2MPMA 4DV5L 2FFKB 4G7OC 2K52A 2D62A 3OW2A 2UXCL 3OTOL 1F9SA 1YITA 1GHKA 4KI0A 4B9WA 1Z9FA 3Q23A 3DM1A 3S1RH 2XGTA 3HOXB 1XJVA 1HTLD 2ZTDA 2FXQA 1I4XA 4RGTA 1G6PA 2KCNA 4JI6L 5EJWA 1PV4A 3IFTA 3I4OA 3CKIB 1VQ4A 4GKJQ 1RF2D 3VYUA 3HS0C 4A3CH 2F0EA 4C3IH 3F2BA 5ELEA 1L0YB 4HMJA 4JBKA 3PUWA 4BS9A 4FF4A 1VQMA 4NW2A 1Y1WB 5C0XI 3J81i 3MXNB 2NVQH 3GTMH 1ONLA 3QWNA 2K5NA 1HZCA 4K2KA 4FDBA 4K6LA 1D1IA 2K5QA 3I73A 5FLXL 3TSSA 3K5MA 4JI7Q 1G8ZD 3NTIA 4R4OA 4NXML 2E8GA 1EWIA 3S15B 3S16B 4FXDA 5K5PA 4IUNA 2CQOA 2OWOA 2UXCQ 1SROA 1JOKA 1NCVA 4A3FG 2JYOA 1SMYC 2R92G 3K6OA 5KEEA 2D5DA 3AB9A 2AWNA 4DUYQ 1A63A 5EKIA 2D2CC 3U9SA 2RA4A 5IYBH 1TXYA 3HOWB 2JP1A 2R92B 3H3VC 3HOVH 2KECA 3BZKA 3CD6A 2SOBA 4POFA 2BA0A 2PPBC 1SRUA 5FLXc 2HCIA 1Q1EA 1I50B 4KY5A 3MZ5A 4X6AH 2H4OA 4C3JH 3HZXA 5FJ8G 3CCJA 3W3AA 5AFWA 1EY6A 1X6OA 2QKIC 1QVGA 1XTCD 1YI2A 4IUUA 1DM0B 3I4MG 3S2DH 3KF6A 2F0JA 2A68D 4CBVA 1Q46A 1XWEA 2A6HC 1MIUA 3OSOA 4DV1L 2CWAA 3RLOA 5ELBA 2KCTA 3PQIA 2DN8A 1KHIA 3H0GH 1X56A 2CW0C 5BR8L 3M4OH 3WDNA 3MEHA 2A6EC 1PH7A 1GM5A 3L7ZC 5CBAE 3PUVA 2JA5H 2K04A 4A75A 3CQZH 2Q2HA 3S2HB 2VUMB 2B2WC 1Q8KA 4GNXA 3CCUA 4JYAL 4B3TQ 3SDZA 2Q2IA 2IHEA 3T56B 1R9TH 1WYDA 3K57A 4L5QA 2AMCB 4PZ7A 1ET9A 2F0PA 2JJQA 4KHPL 3NPPA 2K03A 3VYSA 1SNQA 1EYDA 2Q8RE 4RGMA 4DK6C 1UEAB 4DR4L 5EBCA 5JEAG 3Q24A 1IBMQ 4BBRB 2WV6D 4CKBA 4A76A 2I46A 3ERQA 2YTXA 4AIMA 4C3IB 2E2IH 3BYTB 1ICFB 4K0KL 4A3GB 4CKCA 3NWTA 5C5LA 4BY7G 2FMCA 3JAMc 3R93A 2UUCL 2F0DA 4F7XA 3S1MB 1IYJB 2IX3A 4JV5Q 3PUYA 2B2TC 3T53B 3J7ZC 2EVBA 3F2CA 1EY7A 5IP7G 3IRBA 4B3RL 1C4QA 1YJWA 3LGJA 2J7ZA 4QIWB 3VR4A 3H09A 1X9NA 5CMDA 1S5ED 3CF5A 1DXMA 1F2ZA 1HR0W 3ZJYC 3BVZA 1D5XC 4CHTB 3LWUA 3VDYA 4A3LH 4FF2A 1OXSC 1SYBA 1HCZA 2ZTEA 3UDFA 2B2UA 4C3IG 4I7ZC 1AEXA 5ELCA 3G6EA 3BVMA 2E76C 3EN2A 3R2IA 1ICWA 3L0OA 4RCOA 5DM73 1PYBA 5IP9H 3O13A 1VQ5A 2E75C 2KHJA 5A35A 4NB3A 1JE5A 2QW7A 2E2JB 3KDFA 1HQRD 2BH8A 4NDXA 3A8JE 1N34L 3D3RA 4S3SA 2N88A 2K33A 1SYGA 2HT1A 3HOYG 1OXXK 1SE3A 1PZKD 4MHEA 4ZUIA 4IPCA 3F1ZA 3PMFA 4WJ3M 2M00A 4HSPA 2XWJB 4A3IB 4LF9L 1LYLA 4IUQA 5EKKA 3C46A 4BY7H 3SK4A 4X3KA 1BVSA 5GROA 3GTJB 3ERSX 2F0HA 1VQ6A 3D8GA 2DNCA 1Q90A 4FXKC 2VB3X 1IBLL 1A3VA 1EYCA 5E4XA 4GOPA 5D3DA 4LK1C 4R4CA 1ET6A 1NAPA 3GO5A 4AQYQ 2X6LA 3ULPA 1EUJA 3DEOA 3MTSA 1PRTF 2LFNA 5EPJA 4DPGA 3I72A 2OTLA 3J80c 3I55A 2B2TA 5C4XB 2TMPA 1IBML 1XMOQ 4RMFA 1N9WA 2PZUA 1QOHA 2K6AA 4YWLA 1PDQA 1HQMC 1K73C 1YJNA 4P74A 1CHPD 1TWAB 5C4XG 5JOBA 4A3CG 2KEDA 4NXNL 1KD1C 1XTDA 1I4PA 4NPSA 3I4LA 1ILQA 5KIXA 4CJ1B 1Q12A 3TN2A 2AQ3B 1W2BA 1B3AA 2ZT9C 2PMZE 1XMQQ 1TWCH 4ZKCB 2A6HD 1V1PB 4YWKA 3D4WA 4F8MA 3HKZG 1O7ZA 2HQLA 3TP6A 5C3EG 3KOJA 4BY1B 2V4DA 4K5WA 1OO9B 4HJ7A 3H91A 1B8AA 1NY4A 4ID6A 1B44D 2EE1A 2HHHL 4ZCKA 2X69A 2KUMA 3KF6B 3FHWA 2GA4B 4DNIA 5EGTA 1DOLA 3VYTA 2K32A 4NMZA 4JI1L 1GXDC 1MSHA 2EY6A 3N52A 2IY5B 1AE2A 3P7JA 2LY7A 1G2TA 2F0QA 2E5LL 3PO3G 4DAPA 1QUQA 3E5SA 1S5DD 2VL6A 2F4VL 2XIWA 2F0GA 4H0LC 3KJOA 3FP9A 3BYYB 2NTSA 4UPAA 2MO1A 2E2IB 1T5XD 1DCZA 1Y8PB 1BCPC 2PCFB 2K28A 4DV4L 1TWFB 4IUTA 3F2UA 1WTRA 1WTPA 1CKMA 2F0WA 2OTJA 3J7AV 2RDHA 3K0XA 3CPFA 4MZ9A 2OT2A 2K14A 5A2QE 2B29A 3UDIA 2PQAB 5LL6X 2N49A 5J1ZA 2ZM6Q 4DV2L 1Y14B 1LM0A 4QQBX
chains in the Genus database with same CATH topology
2O5JC 1ESFA 4ZLTF 4EQOA 1J9OA 4HN7A 4XQJA 1G91A 4QF4A 3I8ZA 2IX1A 5C3XA 2DY7A 1AP0A 1A3UA 3QOLA 1VF5C 4AYBB 1FGBD 1TY0A 2EJMA 4X3SA 1I3QB 1AZPA 1GUWA 1SEBD 1QWYA 3C3LA 3S14B 3C1EA 3L9AX 2NN6G 4C3JB 4F88A 2L12A 2SNMA 2XRSD 2LS01 1CFMA 2B2YC 4C1NI 4TKOB 3L3OC 4DXFA 1BR9A 3MXNA 1FNWA 1GUGA 2RDGA 2B39A 4K5VA 3HKZB 2F0MA 3HOYB 1L0XB 2IT1A 1B53A 1LT3D 2BE5D 2JEBI 4Z9CB 1CA6A 3OOCA 2EY5A 3SVMA 3CQZB 3RD4A 3EJIA 5I2XA 3MFGA 1NSNS 3RMHA 3OPOA 5CC4A 4P2CB 5A2QL 3HGBA 3NXWA 4B08A 3A7AB 3KBXA 1KNAA 2R3ZA 2FMMA 1LTTD 3DWAA 1E2VA 3K59A 1SNPA 1LT4D 1TWCB 4FP5D 4RAUC 4RHSA 1BDOA 1F2MA 1HTPA 4KD3A 3GTGB 1D5MC 2DNEA 3FDTA 1O7LA 3TZUA 1O80A 3DEPA 2OF1A 2XSCA 3NSWA 4G57A 2EYPA 4O1NA 4RH6A 3HOZB 5CV7A 3DWPA 1STYA 4E6IA 1QCBD 3S1QB 2ZXPA 2F0NA 3IKJA 1MBYA 3ITPA 1PRTD 3A56A 3MAQA 2L1BA 2F1MA 2J4XA 3AMUA 2B8FA 1SXTA 2HCCA 3AU7A 1H9JA 1MSGA 1EYAA 1YNJD 4I65A 3OMGA 1JE4A 1Q1BA 3GV3A 5LHY1 3K5OA 2K05A 3RZOB 3WOEA 2NBFA 1OXVA 3T13A 4DGZA 1TS2A 3PIP3 4EGVA 2CQAA 4KJOA 5C6AA 4ODGA 3TP8A 3CHBD 1WTQA 2EY1A 4UAIA 3MXUA 2NVQB 4FVMA 5IT9L 1KABA 5D65A 2JA7B 4A93B 4HSVA 3D4DA 4KD4A 5ELFA 2EJFC 4MIUA 1KDCA 3G6JB 1A2UA 2F03A 1B50A 3GTLB 3J7AF 5C3WA 1MGSA 3NP8A 3SR1A 3TZDA 5KGUA 5FO7B 3N6RA 1F9PA 3W2DA 3IAYA 5CV9A 1TQOA 4U68A 1JR0D 4KKUA 1U4PA 2M2LA 3NBHA 3RZDB 1Y8OB 3D31A 2JEAI 1SNOA 3TP5A 3GTQB 2BOSA 1CA5A 4X3UA 2EOTA 4QB4A 2AWOA 5I4DA 4IQZA 3HRZC 4IN3A 2AUKA 3GTKB 1SDFA 5C4JB 3DXJC 2J0TD 3EROA 1FNVA 2AQ2B 4CKEA 2Z8LA 2Y0SB 4KY7A 1X32A 4ME5A 1IHZA 3NQIA 1Z6HA 2OEOA 1WTOA 4DU9A 4U673 2I07B 1YNNC 1A3TA 5IODA 1BBXC 3OIQA 1RDPD 4A3EB 3MXPA 3K7AB 3NQTA 4KMUC 2EPBA 1EWHA 4LJZC 4OHJA 5K36G 4TSSA 4C56C 2C5CA 1ENFA 3V05A 4FO2A 2NN6I 3A55A 1V1PA 5FK9C 3PO3B 1F9RA 5M3FB 2AUJD 4OGQC 2Z1CA 4R9WA 1EY4A 5G3LF 1GJXA 2EY2A 3DUZA 5M9OA 4HR7B 1IYVA 4ABNA 2NTTA 2HDLA 1B4OA 2L11A 1J8IA 2NN6H 2HUGA 3S1RB 1G291 1HFNA 4XQNA 1MI2A 2B2YA 1UNSA 2M9VA 1BCPF 2MJ8A 3P75A 1LACA 2YYZA 5E3FA 1VMPA 1HRJA 4IFDJ 1UUPA 1FYCA 1EQTA 5EBDA 3J81L 1A6XA 2F0LA 4BA1I 3I4NB 4DNRB 1U9RA 3VA7A 3ONAB 1D1KA 4BWGB 1EIGA 1PRTB 3PO2B 2WINB 4LMQD 1B1ZA 1CT1D 4WJWA 3SXHA 3M3YB 1V1OA 4V190 3LX0A 5FO9B 2A74C 1STBA 2NZ1D 5CV4A 4KN7C 3VYRA 3FPUB 4RGNA 3TBIB 3JAME 1VDZA 2ZXRA 4HCEA 2PYKA 2RKSA 2A69C 2WIIB 1F77A 2O4XA 5KNDA 1K8OA 1CTMA 3TDQA 1LV9A 3SHLA 3K58A 1NUCA 1DYQA 5J39A 2K1BA 4R8NA 4IUPA 1BNZA 1XYIA 3EFXD 1M4VA 2R7ZB 1EL0A 1EEFD 3D6CA 4A3JB 4NKLA 3V96A 3MXGA 2PZTA 4XYOA 1CM9A 1NR2A 1B9NA 4RCNA 2N55A 2RSNA 3CRKC 1CI3M 4XT1B 2SEBD 1ZYRC 2A69D 2IL8A 2IJ0A 1SJHD 1D5ZC 1R4PB 1BOSA 2E74C 1R4QB 2IWHA 4PMWA 1TKWB 4FYDA 3EVQA 4WFN3 4FF1A 4HCSA 1IKMA 1BO0A 1I4HA 1QG7A 5JPMC 3MWYW 1D6EC 1AFPA 2JA6B 5FOBB 1I6HB 1X3PA 1CZGA 1Q8IA 1STGA 3NTKA 5C4HA 4PMCA 4DNTB 4M8AA 1BXTA 2O2LD 2KVMA 3HOUB 4IFDH 2HDMA 5HGTA 5J22A 5CR3A 1WVLA 1S5BD 4EQNA 3G7LA 4B9XA 4HEDA 5IGFA 3E6ZX 2R61A 3IL8A 1MD2D 1SYFA 1I4GA 2K7VA 1QNKA 3GD7A 5CGKA 4KHVA 5LL6S 1Y69U 3X3MA 2L55A 1HA5A 2K5DA 3S17B 2L0CA 5NUCA 4GZYC 1GUNA 1EIHA 4KTAA 5M3MB 1QJOA 1W6KA 5FLXE 1GUOA 1PZJD 2ICIA 5KYIA 4H13C 1U4RA 2ICEC 1E2WA 4ZUJA 2NYZD 5C44B 5IIFA 1EQVA 5D14A 3BDCA 4K8IA 4G7HC 1TIID 3M85A 4IURA 2MGSA 4WORA 5G3LD 3D4RA 2F0TA 4A3DB 3MC0B 3TMEA 5KYLA 1WTWA 2PW7A 3SK8A 3VR3A 2F3VA 5EKLA 4K14A 2QEJC 4L6TB 3GV6A 3FPPA 3FMCA 4OO1G 1U4LA 3SEBA 5DEHA 2PZWA 4IFDI 2KOLA 2PQEA 3OIPA 1STHA 4K8JA 1TWGB 2QILA 2B2VC 4QUCA 1HFGA 3GTOB 2SNSA 2RDFA 1Z47A 2F3WA 3OMCA 2RQXA 1RHPA 4DXGA 1WCMB 1QB5D 1LTAD 1D2BA 2WACA 1TS3A 1LO5D 3QO2A 4C1NK 1LTID 3OWFA 1E2ZA 3KLSA 2L5TA 3OW7A 4G4KA 2LMCB 1PRTC 1JOQA 4O42A 1PTOD 1ENAA 3EQLC 2LKVA 3QB3A 4XIGS 3LWEA 1LTRD 4IFDG 1ENCA 5T1GA 1BCPB 2BCOA 2EYJA 3WOFA 4RHRA 2E2DC 1PTOC 4DN4M 3T51B 3HOVB 3NWSA 2X6GA 4C2MB 4R8IA 2MUYA 4HTHA 2ZXOA 4FNFA 3J7YW 4C3HG 1PXUA 1Y1VB 1GUTA 1HUMA 2Z4HA 1JICA 1XXGA 4LAAA 2K5WA 1JWSD 3I90A 5EPKA 1H9MA 5I2YA 1C48A 5F2DA 1EU3A 3R2TA 1BF4A 1EU4A 4J1MA 3M7NA 4G7ZC 4CJ0B 1SNDA 1RKNA 1IW7D 3SK5A 3BDOA 3SK6A 1R9TB 2XNAC 4ULLA 3C2PA 1SFOB 2B2WA 3ND8A 1ILPA 5M5XB 1F2YA 1JWMD 3KBGA 1TR5A 3OHXC 1CQVA 4OIKA 2EYHA 3CRLC 2L4NA 1HXYD 3K5LA 2A73B 2FJ2A 1SE4A 5CYUA 4OIJA 5C3EB 3K5NA 2VNUD 1YNND 3PUZA 2KJXA 4X3TA 1DOKA 4KN4C 3R8BA 4PQXA 4EVOA 3I4MB 1CQFA 3KK7A 5C0XG 3MHBA 2ID0A 2F0FA 3BG3A 4EQPA 5FO8B 1EY5A 4XQQA 2NB0A 2EXZA 1RJTA 4KY6A 4L8JA 1JORA 1EZ6A 1H9SA 1VMCA 2Q8TA 1CHQD 4KKSA 5CORA 2B2VA 3J81E 4ZAIA 1V43A 3VR5A 3KUPA 3QIAA 1JC7A 3BVGA 5I6YA 2A68C 1JQYD 3H0GB 1LT5D 4ILWA 3A54A 1IL8A 1WD1A 3HEJA 1CZWA 3NTHA 1YNJC 2A5HA 1PFNA 5JJZA 1SMYD 5DAUA 4KK7A 4FXGC 3MVVA 5DNFA 2KHSA 1Z7TA 2K01A 1LABA 2PMZB 5CV6A 1LLRD 2EJGC 5IGEA 2KEEA 2IW3A 2F0OA 1E0BA 4Q0FA 3J80L 3GTMB 4KV6A 3PIO3 2PNRC 1STNA 3I91A 4OL7A 3HG9A 3Q0AA 4ZRZA 5COYA 1X3QA 5CV8A 2CW0D 3CU7A 4PNYA 1H9SB 3A8KE 1H9RA 3KLSX 1TY2A 1UAPA 1K83B 1HA6A 5KNBA 1ZXTA 4IZ8A 4CJ2C 1I6VC 1F2LA 5IGBA 5JVH3 3UI2A 1G6ZA 4ZYSA 3EA6A 4NP5A 5BN3A 4CGYB 4QUFA 1II3A 5HURA 1Q3LA 2KA7A 2WP8J 3QJYA 4Y7NB 2EYFA 3RUZA 1WTXA 3KF8A 2DY8A 3ND9A 2G9DA 3OWEB 4J8QA 4XTCS 1PTOB 4K5XA 4L63B 3SE0A 2YU9B 2IX0A 1KDBA 1VCIA 3NUCA 1IKLA 3BS1A 1NR4A 1PMRA 5JEAJ 1SYEA 4ZKBB 1C8CA 1FD7D 1LTGD 2VXWA 3I70A 1WTVA 3KLRA 5IGDA 4A3KB 2RSOA 3U9OA 4H7BA 5CV5A 5IGCA 2E2HB 1EY8A 4RWSC 4DAVA 5E1FA 1SAPA 3FRPB 1PZID 5BN5A 3R3OA 1FR3A 5E4WC 1EZ8A 1RCVD 1A2TA 1Y8NB 4IUVA 5K36H 2JSOA 2VB2X 5JVG3 2OXPA 4YIJA 2TSSA 1LTBD 5T1IA 5EPLA 3BZDB 3J80E 2B8GA 2XRQD 4QCLA 4N9PA 1DZ1A 3M4OB 1AZQA 2MP1A 2WKCA 2BDOA 2NVTB 2RVLA 1LT6D 2QCPX 4Q5VA 2HQEA 1SBBB 3T16A 1SNMA 3DMUA 5KRUA 4V0BA 2QF7A 1SJED 2L9HA 3LNNA 4K6DA 1XX8A 5C4ZA 1TS4A 1JCKB 1GOZA 2WKDA 4RA8A 3GTPB 1EY0A 1ZYRD 2JE6I 3Q6SA 1BUVT 3P1HA 4F87A 5IT9E 1KLUD 5ISRA 1HHVA 2JA5B 5EQ0A 5C0XH 1DONA 3S1NB 1GUSA 1QNUA 1PFMA 1KAAA 2CHBD 3M4YA 1LTSD 5TSSA 1TU2B 2XWBB 1S4ZA 2R6GA 2NUCA 5I6WA 4QMGA 3NHHA 4TQUS 2G9HD 2QDBA 1HPCA 1PYWD 1ZKOA 5DM63 3FEWX 4ZQ3A 2EDGA 2BDNA 3QG1A 5CBEE 5JPNC 4OO1I 3ZYYX 1VF7A 4DF7A 1AN8A 1DD2A 5C5MA 3MA2B 3VA5A 1BCPD 4ZK9B 1SNCA 3M7GA 1OXTA 4N9TA 2A6ED 1QILA 5C0XJ 4KJNA 4XXEA 3H6MA 4RFBA 2F0IA 1FNUA 3FKIB 2B63B 3DWQA 1IYUA 3PV0A 1M8AA 1TS5A 2EYLA 5FKAC 4RKLA 1W6JA 1GHJA 4XT3B 4BY7B 1SSOA 5D3IB 1S5CD 3X3NA 4DA2A 4JK1C 3S9WA 4DFAA 1KLGD 1AW7A 1EWCA 3V2TA 5IGGA 3NBIA 1SYDA 4RGOS 1O78A 1O7YA 2C9OA 4PV1C 1KDAA 5JEAH 3HP3A 4IALA 4BA2I 4DAYA 2PO4A 2FHTA 3D6WA 5I9OA 1PFBA 2F0SA 3C1FA 5JAVA 1JWUD 1T5EA 1RTOA 5ELDA 4RKBA 1ZEQX 4BBSB 4M1UB 1G2SA 1PTOH 1TWHB 1B2TA 4HAEA 1RD9D 4XDXA 2EYMA 1PTOF 1ML0D 1STEA 4A3FB 4K2LA 1EY9A 2NVYB 4A3BB 3VR6A 3NK9A 2FINB 3NE5B 2WB1B 1I4QA 4C3JG 2AQ1B 1HUNA 1JB3A 3FVQA 5BN4A 3IFDA 2BE5C 4DK1A 2R93B 2JA8B 2WAQB 1RTNA 1EOTA 2NVXB 1B9MA 1WD0A 4DK0A 2ENBA 1SYCA 2EZVA 1TVXA 4H44C 1IW7C 1K8MA 1OXUA 4UDUC 5I9PA 3RLFA 1I4RA 4A3MB 2JXMB 1STAA 3Q22A 3A8IE 1H9KA 3QOJA 4HMIA 2NWGA 3H94A 4KHZA 1ESRA 1RODA 2PW5A 2F4IA 2CVRA 3I3CA 1V8QA 3A7LA 3BDLA 4XYQA 1F9QA 1SE2A 4C3HB 3P20A 1EFID 3GP7A 2D9UA 3GQBA 3K0YA 2XN9C 1QE6A 1DJRD 5M5YB 4OO1H 2H1EA 2XVSA 3URYA 3S2DB 2Z4IA 4PMBA 1S5FD 1CK1A 5KNCA 2KQ3A 2EYOA 4MN3A 1TT2A 1U4MA 2KCCA 2B2UC 2BA1A 1BQQT 1A15A 1KNEA 3MFYA 2SDFA 4FF3A 4J6HA 2IPKD 3E0JA 5IOCA 4JBWA 3T4AC 2O5IC 4WRDA 1PLFA 3PUXA 1JOOA 2F0KA 2Q8IB 1DOMA 5M5WB 2MHVA 1EEID 3VR2A 2F0UA 2F0VA 4KKTA 3JAML 2RBMA 1KTKA 3TP7A 3DHQA 4TRDA 2MPMA 2FFKB 4G7OC 2D62A 1F9SA 1GHKA 4KI0A 4B9WA 3Q23A 3DM1A 3HOXB 1HTLD 1I4XA 4RGTA 2KCNA 5EJWA 3IFTA 3CKIB 1RF2D 3VYUA 3HS0C 2F0EA 5ELEA 1L0YB 4HMJA 3PUWA 4BS9A 4FF4A 4NW2A 1Y1WB 5C0XI 1ONLA 3QWNA 4K2KA 4K6LA 1D1IA 2K5QA 3I73A 5FLXL 3TSSA 3K5MA 1G8ZD 3NTIA 3S15B 3S16B 4FXDA 5K5PA 4IUNA 1JOKA 1NCVA 2JYOA 1SMYC 3K6OA 5KEEA 2D5DA 3AB9A 2AWNA 5EKIA 2D2CC 3U9SA 2RA4A 3HOWB 2JP1A 2R92B 3H3VC 2KECA 2SOBA 2BA0A 2PPBC 2HCIA 1I50B 1Q1EA 4KY5A 3MZ5A 2H4OA 3HZXA 3W3AA 5AFWA 1EY6A 2QKIC 1XTCD 4IUUA 1DM0B 2F0JA 2A68D 4CBVA 1XWEA 2A6HC 3OSOA 5ELBA 2DN8A 2CW0C 3WDNA 3MEHA 2A6EC 3L7ZC 5CBAE 3PUVA 2K04A 3S2HB 2VUMB 2B2WC 3SDZA 3T56B 3K57A 1ET9A 2F0PA 3NPPA 2K03A 3VYSA 1SNQA 1EYDA 2Q8RE 4RGMA 1UEAB 5EBCA 5JEAG 3Q24A 4BBRB 2WV6D 4CKBA 2I46A 3ERQA 4C3IB 3BYTB 4A3GB 4CKCA 3NWTA 5C5LA 2FMCA 3R93A 2F0DA 4F7XA 3S1MB 2IX3A 3PUYA 2B2TC 3T53B 2EVBA 1EY7A 1C4QA 2J7ZA 4QIWB 3VR4A 3H09A 5CMDA 1S5ED 1DXMA 1F2ZA 3BVZA 1D5XC 4CHTB 3LWUA 4FF2A 1OXSC 1SYBA 1HCZA 2B2UA 4C3IG 4I7ZC 1AEXA 5ELCA 3BVMA 2E76C 3R2IA 1ICWA 4RCOA 5DM73 3O13A 2E75C 5A35A 2E2JB 1HQRD 4NDXA 3A8JE 3D3RA 4S3SA 2N88A 2K33A 1SYGA 1OXXK 1SE3A 1PZKD 4MHEA 4ZUIA 3PMFA 2M00A 4HSPA 2XWJB 4A3IB 4IUQA 5EKKA 3C46A 3SK4A 4X3KA 3GTJB 2F0HA 3D8GA 2DNCA 1Q90A 4FXKC 2VB3X 1A3VA 1EYCA 5E4XA 5D3DA 4LK1C 1ET6A 1NAPA 3GO5A 2X6LA 3DEOA 3MTSA 1PRTF 2LFNA 5EPJA 3I72A 2B2TA 5C4XB 2TMPA 2PZUA 1QOHA 2K6AA 1PDQA 1HQMC 1CHPD 1TWAB 5JOBA 2KEDA 1I4PA 5KIXA 3I4LA 1ILQA 4CJ1B 1Q12A 3TN2A 2AQ3B 1B3AA 2ZT9C 4ZKCB 2A6HD 1V1PB 3D4WA 4F8MA 1O7ZA 3TP6A 4BY1B 2V4DA 4K5WA 1OO9B 3H91A 4ID6A 1B44D 2EE1A 2X69A 2KUMA 2GA4B 5EGTA 1DOLA 3VYTA 2K32A 4NMZA 1GXDC 1MSHA 2EY6A 3N52A 3P7JA 2LY7A 1G2TA 2F0QA 4DAPA 3E5SA 1S5DD 2XIWA 2F0GA 4H0LC 3BYYB 2NTSA 2E2IB 1T5XD 1DCZA 1Y8PB 1BCPC 2PCFB 2K28A 1TWFB 4IUTA 3F2UA 1WTRA 1WTPA 2F0WA 3J7AV 2RDHA 2OT2A 5A2QE 5LL6X 5J1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDM A;  3I3C A;  1O7Y A;  3GV6 A;  2Q8R E;  1NAP A;  2X6L A;  4UAI A;  5DNF A;  1F9Q A;  4ZLT F;  1WVL A;  3DEO A;  3MTS A;  1J9O A;  3HP3 A;  3G7L A;  1PFM A;  4RWS C;  2K01 A;  4RAU C;  1U4L A;  4HED A;  5EPJ A;  4NW2 A;  1G91 A;  5D65 A;  1SAP A;  2B2T A;  3I8Z A;  2B2W A;  2KEE A;  2KOL A;  3FDT A;  1LV9 A;  2DY7 A;  4HSV A;  1S4Z A;  2FHT A;  1O80 A;  1ILP A;  2D9U A;  1E0B A;  1AP0 A;  3IL8 A;  3DEP A;  3D6W A;  5E4W C;  1PFB A;  2B2V C;  2K1B A;  4QUC A;  1HFG A;  1PDQ A;  1QE6 A;  1F9R A;  1QNK A;  4IUP A;  4IUV A;  1BNZ A;  1XYI A;  4X3S A;  3R93 A;  1EL0 A;  1AZP A;  3I91 A;  1RTO A;  4OIK A;  1B50 A;  1GUW A;  2H1E A;  2KED A;  2L4N A;  1RHP A;  2B2T C;  1ILQ A;  5T1I A;  4R9W A;  1MGS A;  5EPL A;  5EQ0 A;  1G2S A;  2FJ2 A;  5COY A;  3TN2 A;  4CJ1 B;  1DON A;  1NCV A;  1B3A A;  1ESR A;  2JYO A;  4OIJ A;  1B2T A;  2BDN A;  5EJW A;  5CBE E;  1X3Q A;  3TZD A;  4HAE A;  4ZKC B;  3QO2 A;  4XDX A;  5EKI A;  2L12 A;  2J7Z A;  1CM9 A;  1NR2 A;  5CMD A;  1EIH A;  1F9P A;  1DZ1 A;  4X3T A;  2N55 A;  1AZQ A;  4MN3 A;  2RSN A;  2RA4 A;  1O7Z A;  2MP1 A;  1DOK A;  1ML0 D;  1U4M A;  2B2Y C;  2L1B A;  2JP1 A;  2HDL A;  4U68 A;  4XT1 B;  1HA6 A;  1ZXT A;  1B4O A;  4CJ2 C;  2KEC A;  1F2L A;  2B2U C;  2L11 A;  3H91 A;  4O42 A;  1J8I A;  2HUG A;  1A15 A;  4ZK9 B;  1U4R A;  3UI2 A;  2HCI A;  1HFN A;  2B2U A;  2FIN B;  2IL8 A;  2NYZ D;  1U4P A;  2EE1 A;  2M2L A;  2RVL A;  1G6Z A;  1KNE A;  3LWE A;  5D14 A;  1MI2 A;  2B2Y A;  2SDF A;  2HCC A;  2X69 A;  2KUM A;  1ICW A;  2MJ8 A;  4QUF A;  1VMP A;  5AFW A;  5T1G A;  1HRJ A;  1HUN A;  1Q3L A;  1DOL A;  1EQT A;  1MSG A;  4IUR A;  3IFD A;  2MGS A;  4IUU A;  4DN4 M;  1PLF A;  2L9H A;  1CA5 A;  1JE4 A;  4X3U A;  2EOT A;  1WTX A;  2X6G A;  1B53 A;  1MSH A;  3ONA B;  3N52 A;  1XX8 A;  1RJT A;  1DOM A;  1EIG A;  3GV3 A;  3P7J A;  5JJZ A;  4R8I A;  1M8A A;  1RTN A;  1G2T A;  1EOT A;  2DY8 A;  1CA6 A;  4LMQ D;  1WD0 A;  2N88 A;  2XIW A;  3SVM A;  1SDF A;  4HCS A;  1IKM A;  1VMC A;  1BO0 A;  1QG7 A;  4RA8 A;  2Q8T A;  3MWY W;  2K05 A;  4MHE A;  5CBA E;  5COR A;  1TVX A;  2B2V A;  4ZAI A;  4XT3 B;  1HUM A;  1SSO A;  2K04 A;  1JIC A;  2MPM A;  3KUP A;  1X3P A;  2FFK B;  2K28 A;  1IKL A;  3Q6S A;  2B2W C;  3I90 A;  4IUT A;  1WTW A;  4IUQ A;  1NR4 A;  5EPK A;  3F2U A;  4X3K A;  1WTR A;  1WTP A;  1X32 A;  2NZ1 D;  3KBX A;  1F9S A;  1WTO A;  1KNA A;  4ZKB B;  1C8C A;  1BF4 A;  2R3Z A;  3DM1 A;  2FMM A;  1IL8 A;  1BBX C;  1WD1 A;  2VXW A;  1WTV A;  3FPU B;  5E4X A;  1HHV A;  2NWG A;  4CJ0 B;  1PFN A;  2RSO A;  1WTQ A;  2KVM A;  2K03 A;  1ROD A;  2EPB A;  2CVR A; 
#chains in the Genus database with same CATH topology
 2O5J C;  1ESF A;  4A3I G;  1GO3 E;  2VQF L;  2QDL A;  4ZLT F;  1VQN A;  4EQO A;  1J9O A;  4HN7 A;  3E0E A;  1E7Z A;  3CCR A;  1YBY A;  4A3G H;  4XQJ A;  1G91 A;  4QF4 A;  3I8Z A;  2IX1 A;  5C3X A;  2DY7 A;  3T1H Q;  1AP0 A;  1A3U A;  3QOL A;  2PQA A;  2Y0S G;  2N8N A;  3B6Y A;  1VF5 C;  4UHV A;  1Q7Y C;  3I2Z A;  2KHI A;  4AYB B;  1FGB D;  1TY0 A;  2EJM A;  4X3S A;  4A93 G;  1I3Q B;  4JVZ A;  1AZP A;  5GQO A;  1GUW A;  1SEB D;  2WFW A;  1QWY A;  4JV5 L;  3C3L A;  3S14 B;  3C1E A;  2QA4 A;  1QVC A;  3L9A X;  2NN6 G;  4C3J B;  1KQS A;  4F88 A;  2L12 A;  2SNM A;  1Y1V G;  2XRS D;  2LS0 1;  2ZTC A;  1CFM A;  2AKW B;  2B2Y C;  4C1N I;  4AYB E;  1RIP A;  4TKO B;  3L3O C;  4DXF A;  4QJF A;  4MTN A;  4EX5 A;  1BR9 A;  3MXN A;  1FNW A;  1GUG A;  3Q8D A;  2RDG A;  2B39 A;  4K5V A;  3HKZ B;  2VQE L;  2F0M A;  3HOY B;  1L0X B;  2IT1 A;  1B53 A;  4UY8 C;  1LT3 D;  2BE5 D;  2JEB I;  4Z9C B;  1I50 H;  1E3P A;  5AJ3 L;  1CA6 A;  2JA9 A;  4A3M G;  3GDE A;  3OOC A;  2JQO A;  2EY5 A;  3SVM A;  3CQZ B;  4P73 A;  3RD4 A;  4NXM Q;  2R7Z G;  1X54 A;  3EJI A;  5I2X A;  5IP7 H;  3MFG A;  1NSN S;  3RMH A;  3F2D A;  3OPO A;  5CC4 A;  4P2C B;  5A2Q L;  3HGB A;  3NXW A;  4B08 A;  3A7A B;  3KBX A;  3PO3 H;  1KNA A;  4DV4 Q;  1BBU A;  2R3Z A;  2FMM A;  1LTT D;  1SFO H;  2ZJP A;  1N32 L;  1M90 C;  3DWA A;  1E2V A;  4DK3 C;  3S2H H;  3K59 A;  3CME A;  1A0I A;  1SNP A;  1X3E A;  1UE5 A;  3G4S A;  3CCL A;  1LT4 D;  1TWC B;  4FP5 D;  4RAU C;  4RHS A;  1BDO A;  1F2M A;  1HTP A;  4KD3 A;  3GTG B;  4GKK L;  1PH5 A;  1D5M C;  3AYH B;  3D0F A;  2DNE A;  3FDT A;  1O7L A;  3J80 i;  2D0O A;  1O80 A;  3TZU A;  1Y1W H;  4LF7 Q;  4ALP A;  3DEP A;  2OF1 A;  2XSC A;  3NSW A;  4G57 A;  2EYP A;  4O1N A;  2JK8 A;  4RH6 A;  3HOU H;  3EBE A;  3HOZ B;  5CV7 A;  3NEN A;  3DWP A;  3RZD H;  2MNA A;  1STY A;  3CC2 A;  1BKB A;  3FKI G;  4E6I A;  2B63 G;  1VQK A;  1QCB D;  3S1Q B;  1YNX A;  2ZXP A;  1VQH A;  4A93 H;  2F0N A;  3IKJ A;  4CDE C;  1MBY A;  3ITP A;  2GVA A;  1A8V A;  3RZO H;  1I6H H;  1PRT D;  3A56 A;  3MAQ A;  4IJH A;  2PI2 A;  4IO9 A;  2L1B A;  3STB D;  3HOX G;  2F1M A;  2J4X A;  1GVP A;  4YY3 L;  3AMU A;  2B8F A;  4DR6 Q;  3RNU A;  4JI4 Q;  4HIM A;  2C35 B;  4WJ4 A;  1SXT A;  2HCC A;  5FJ8 H;  3AU7 A;  1H9J A;  1X3F A;  2MFI A;  1MSG A;  3HOX H;  4JBJ A;  4P75 A;  1EYA A;  1YNJ D;  4AYB G;  4I65 A;  1KC8 C;  3OMG A;  2VUM H;  1JE4 A;  5IWA L;  1Q1B A;  1UE7 A;  5GAG C;  3GV3 A;  4RG1 A;  5LHY 1;  3K5O A;  4C2M H;  1VQA A;  2K05 A;  2UUB Q;  3RZO B;  4H02 A;  1N36 L;  3WOE A;  4N8F A;  2NBF A;  1OXV A;  3T13 A;  4DGZ A;  1TS2 A;  3PIP 3;  4EGV A;  2NVX H;  2CQA A;  1E22 A;  4MTK A;  5C4J H;  4KJO A;  4YCU A;  5C6A A;  4ODG A;  2MQH A;  3TP8 A;  3I4N H;  1N33 Q;  2A19 A;  3PF5 A;  1C9O A;  1WOC A;  1I5F A;  3CHB D;  1KRT A;  1WTQ A;  2EY1 A;  4LF4 L;  4UAI A;  3MXU A;  2NVQ B;  4FVM A;  5IT9 L;  1KAB A;  3S1N H;  4JW0 A;  3S1M H;  2WAQ G;  5D65 A;  1QZG A;  2JA7 B;  4A93 B;  4HSV A;  3J81 c;  3D4D A;  3SGI A;  4KD4 A;  5ELF A;  2EJF C;  4DR3 Q;  4MIU A;  4IPH A;  4JI3 Q;  1KDC A;  3G6J B;  1A2U A;  4LFB L;  2F03 A;  1B50 A;  3GTL B;  3TRE A;  3J7A F;  2R7Z H;  5C3W A;  1MGS A;  4R4I A;  3NP8 A;  3GTP H;  3SR1 A;  4A3M H;  4JYA Q;  4LF9 Q;  2Z0S A;  3TZD A;  4LF5 Q;  5KGU A;  5FO7 B;  1JMC A;  2Z6K C;  3N6R A;  1F9P A;  3JC6 6;  4HID A;  3W2D A;  4JCV E;  4OXP A;  5CV9 A;  1O7I A;  1TQO A;  3IAY A;  4U68 A;  1JR0 D;  2LSS A;  3KLW A;  5M5X H;  1IBK L;  4KKU A;  3WWV A;  2JA8 H;  1U4P A;  2M2L A;  1LUZ A;  4DR4 Q;  1YHB A;  3NBH A;  3RZD B;  1Y8O B;  3D31 A;  1QUQ B;  4AQY L;  2JEA I;  1SNO A;  4UP8 A;  4K0K Q;  3TP5 A;  3GTQ B;  1AH9 A;  2BOS A;  1CA5 A;  4X3U A;  2EOT A;  4QB4 A;  1JT8 A;  2AWO A;  5I4D A;  4IQZ A;  3HRZ C;  4IN3 A;  2AUK A;  4IOA A;  3H3V I;  3GTK B;  1SDF A;  3AQQ A;  4A3D H;  5C4J B;  3DXJ C;  2J0T D;  2F52 A;  1PYS B;  3ERO A;  1FNV A;  2AQ2 B;  1VQF A;  1X65 A;  4CKE A;  4Y7N H;  1IZ6 A;  2Z8L A;  3M4P A;  2Y0S B;  4KY7 A;  3STB C;  5GAH C;  1X32 A;  4ME5 A;  2CWP A;  1IHZ A;  3W1G A;  3NQI A;  1Z6H A;  2OEO A;  3H0G G;  1WTO A;  4DU9 A;  4U67 3;  2I07 B;  1YNN C;  1A3T A;  1PH4 A;  4BY1 G;  1SN8 A;  5IOD A;  1BBX C;  3OIQ A;  2VW9 A;  1RDP D;  4A3E B;  3MXP A;  5J3B A;  2YU9 H;  3K7A B;  2UXD L;  3NQT A;  1E24 A;  4KMU C;  4EQ5 A;  2EPB A;  1EWH A;  4LJZ C;  4R1J A;  3S17 H;  1TWF H;  2B3G A;  4OHJ A;  1N33 L;  5K36 G;  4TSS A;  1B70 B;  4C56 C;  4JI8 Q;  3S15 H;  2C5C A;  1ENF A;  3V05 A;  3K7U C;  4FO2 A;  3HOV G;  3L2P A;  2NN6 I;  3A55 A;  1V1P A;  5FK9 C;  4QIW E;  2GN5 A;  3PO3 B;  1K9M C;  1F9R A;  2BH2 A;  3QR8 A;  1HZA A;  2AUJ D;  2Z1C A;  4OGQ C;  5M3F B;  2R92 H;  2H5X A;  3JAM i;  2K75 A;  4R9W A;  1WCM G;  4JOI C;  1EY4 A;  1HJP A;  5G3L F;  1GJX A;  2EY2 A;  3DUZ A;  5M9O A;  4HR7 B;  4HJA A;  4LF8 L;  3CMA A;  2WB1 G;  5LMN W;  1IYV A;  4ABN A;  2NTT A;  2OQ0 A;  5IY0 A;  2HDL A;  1B4O A;  2L11 A;  1J8I A;  2NN6 H;  2HUG A;  3S1R B;  1G29 1;  1HFN A;  1EIF A;  1EOV A;  4XQN A;  1MI2 A;  2B2Y A;  1UNS A;  2M9V A;  1BCP F;  2MJ8 A;  3P75 A;  2ZJQ A;  1LAC A;  2YYZ A;  1IXR A;  5E3F A;  4GNX C;  1VMP A;  1HRJ A;  3CCQ A;  4IFD J;  1UUP A;  1FYC A;  1EQT A;  5EBD A;  3J81 L;  4TVA B;  1A6X A;  3K81 C;  2F0L A;  4BA1 I;  4CDD C;  3I4N B;  4DNR B;  1U9R A;  3VA7 A;  3ONA B;  5LMN L;  1D1K A;  4BWG B;  1PRT B;  1EIG A;  1C0A A;  3PO2 B;  2WIN B;  4LMQ D;  1B1Z A;  1CT1 D;  4WJW A;  1XNR L;  1KL9 A;  3SXH A;  3M3Y B;  1V1O A;  3HOZ H;  4V19 0;  3LX0 A;  3T1Y Q;  4LFC Q;  5FO9 B;  1HNX L;  2A74 C;  1K3B C;  3TQY A;  1STB A;  3CPW A;  3H15 A;  2NZ1 D;  5CV4 A;  4KN7 C;  5M3F H;  3VYR A;  3HOW G;  4UP7 A;  1FVI A;  3FPU B;  4RGN A;  3TBI B;  2K50 A;  3JAM E;  1VDZ A;  2ZXR A;  4HCE A;  2PYK A;  2JA7 G;  2RKS A;  3ICE A;  2A69 C;  2WII B;  1F77 A;  2O4X A;  4DV6 L;  5KND A;  4DR7 L;  1K8O A;  3TS2 A;  2D0P A;  1CTM A;  3TDQ A;  4IPD A;  4B3M L;  4JG2 A;  1LV9 A;  5EAY A;  3SHL A;  5IYC H;  3K58 A;  3KDF B;  1NUC A;  1ASY A;  1DYQ A;  5J39 A;  2K1B A;  4R8N A;  1IL2 A;  4IUP A;  1BNZ A;  1XYI A;  1FJG L;  3EFX D;  1M4V A;  2R7Z B;  1EL0 A;  1EEF D;  1B3Q A;  3D6C A;  2JN4 A;  4A3J B;  4NKL A;  4B3R Q;  3V96 A;  1MJE A;  3MXG A;  2PZT A;  4XYO A;  1CM9 A;  1NR2 A;  4DV5 Q;  1B9N A;  4LF5 L;  4RCN A;  2N55 A;  2RSN A;  3CRK C;  5GAD C;  4GOP C;  1CI3 M;  4XT1 B;  4X64 Q;  2SEB D;  3A5U A;  1HZB A;  4PZ6 A;  1ZYR C;  1SLJ A;  2A69 D;  4HJ8 A;  4QL5 A;  2IL8 A;  1IBK Q;  1K3R A;  4GLA C;  1VQJ A;  1L0W A;  2IJ0 A;  1SJH D;  1D5Z C;  1R4P B;  1BOS A;  2YTV A;  2E74 C;  1R4Q B;  4JPB W;  2IWH A;  2VUM G;  1N34 Q;  4PMW A;  1DGS A;  1TKW B;  4FYD A;  2JA6 G;  3RLN A;  1G51 A;  1KIX A;  3EVQ A;  4WFN 3;  1J5E L;  4FF1 A;  3CCV A;  4HCS A;  1IKM A;  1BO0 A;  1I4H A;  1QG7 A;  5JPM C;  3MWY W;  3UE0 A;  1D6E C;  1AFP A;  1WFQ A;  2JA6 B;  1XPU A;  1V9P A;  3DLL A;  4MNO A;  1ASZ A;  5FOB B;  1I6H B;  1X3P A;  1CZG A;  3GTL H;  3T1Y L;  3CCS A;  1Q8I A;  1STG A;  3CC7 A;  3NTK A;  3PO2 G;  1IBL Q;  4A3K H;  5C4H A;  3UE1 A;  4PMC A;  4DNT B;  4M8A A;  1LTL A;  2VY3 A;  1BXT A;  2KEN A;  2O2L D;  4LFA Q;  4A3J H;  2KVM A;  4QY7 A;  5L37 A;  3HOU B;  4IFD H;  2HDM A;  2UXD Q;  2Z6K A;  5HGT A;  5J22 A;  5CR3 A;  1WVL A;  1S5B D;  2JA7 H;  4LF6 L;  4JI5 Q;  4EQN A;  3G7L A;  2YV5 A;  4B9X A;  4HED A;  2K5V A;  1AE3 A;  5IGF A;  3E6Z X;  2R61 A;  4PG3 A;  3IL8 A;  1MD2 D;  1SYF A;  1EIY B;  1I4G A;  1I94 Q;  2K7V A;  1QNK A;  3F8T A;  3GD7 A;  5CGK A;  4KHV A;  4NXN Q;  5LL6 S;  5LMU Q;  3PIO A;  1Y69 U;  1VQG A;  1PH1 A;  3TEH B;  2ATW A;  1E1T A;  2CCZ A;  3X3M A;  2L55 A;  1EQQ A;  3CC4 A;  1HA5 A;  2K5D A;  3S17 B;  1HH2 P;  2L0C A;  5NUC A;  4GZY C;  1GUN A;  1EIH A;  4KTA A;  5M3M B;  1QJO A;  4LF8 Q;  4LFA L;  1W6K A;  5FLX E;  1GUO A;  4JI6 Q;  3TS0 A;  2UUA Q;  4DUZ Q;  1PZJ D;  2RHS B;  2ICI A;  5KYI A;  1PH8 A;  4H13 C;  1U4R A;  2ICE C;  1E2W A;  4ZUJ A;  2HHH Q;  2NYZ D;  5C44 B;  5IIF A;  4C3H H;  1EQV A;  5D14 A;  3BDC A;  4K8I A;  4G7H C;  1V1Q A;  4X66 L;  1TII D;  3M85 A;  4IUR A;  2MGS A;  4WOR A;  5G3L D;  3D4R A;  2F0T A;  3GTK H;  4A3D B;  2UU9 Q;  4PZ8 A;  3MC0 B;  3TME A;  3A0J A;  4A3E H;  2R7F A;  1TWA H;  5KYL A;  4LNQ A;  2ZJR A;  4GN3 B;  2PW7 A;  1WTW A;  1FGU A;  3SK8 A;  3VR3 A;  2F3V A;  5EKL A;  4K14 A;  5M3F G;  4L5R C;  4YY3 Q;  1H95 A;  4HJ9 A;  1J6Q A;  2QEJ C;  1S72 A;  4X66 Q;  4L6T B;  3GV6 A;  3PGZ A;  3FPP A;  4DV3 Q;  3FMC A;  4OO1 G;  1K0R A;  1N8R C;  1U4L A;  3SEB A;  2JA6 H;  5DEH A;  4DV1 Q;  2PZW A;  4IFD I;  2KOL A;  5IWA Q;  2PQE A;  4JI5 L;  4A3B H;  3OIP A;  1STH A;  4K8J A;  1TWG B;  1CSP A;  2QIL A;  2B2V C;  1W3S A;  4QUC A;  1HFG A;  4HIK A;  3GTO B;  4YWM A;  2SNS A;  2UUB L;  2RDF A;  2LXJ A;  1Z47 A;  1I94 L;  5HY6 A;  2F3W A;  3OMC A;  2RQX A;  1RHP A;  4DXG A;  1WCM B;  1QB5 D;  2A8V A;  1LTA D;  4LUO A;  4GNX B;  1D2B A;  5JJI A;  5LMU L;  2WAC A;  1K8A C;  1TS3 A;  4DR5 Q;  1LO5 D;  3QO2 A;  4C1N K;  1LTI D;  3OWF A;  1E2Z A;  4KHP Q;  3KLS A;  2L5T A;  3OW7 A;  3GTO H;  4G4K A;  2LMC B;  1PRT C;  1JOQ A;  4O42 A;  1PTO D;  1ENA A;  3DM3 A;  3EQL C;  2LKV A;  4A3F H;  2UUA L;  3QB3 A;  1VQ7 A;  4XIG S;  3LWE A;  1LTR D;  4IFD G;  1ENC A;  5T1G A;  1BCP B;  2BCO A;  2EYJ A;  3WOF A;  4RHR A;  2E2D C;  1PTO C;  4DN4 M;  1BBW A;  3UDX A;  3T51 B;  3HOV B;  3NWS A;  2X6G A;  4C2M B;  1Q86 C;  2E2J H;  4R8I A;  2MUY A;  4HTH A;  2ZXO A;  2YTY A;  2KBN A;  1K83 H;  4FNF A;  3J7Y W;  4C3H G;  4YHH L;  1PXU A;  1XNQ L;  1Y1V B;  1VQB A;  5ELN A;  1GUT A;  1HUM A;  2DGY A;  2Z4H A;  1JIC A;  1VQ8 A;  1XXG A;  4LAA A;  2K5W A;  1JWS D;  3I90 A;  2VS1 A;  1OTC A;  5EPK A;  1H9M A;  5I2Y A;  1C48 A;  2EQS A;  2I5L X;  1EU3 A;  5F2D A;  4A3B G;  3J7A 5;  3R2T A;  3OTO Q;  1EU4 A;  1BF4 A;  4AH6 A;  4J1M A;  2R93 G;  3M7N A;  4DV0 L;  4G7Z C;  4B3T L;  1MJC A;  2HIX A;  4CJ0 B;  1SND A;  1RKN A;  1IW7 D;  1WJJ A;  1SMX A;  3SK5 A;  3BDO A;  3T1H L;  3SK6 A;  4LF6 Q;  4A3D G;  1UE6 A;  4GKK Q;  1YJ9 A;  1R9T B;  3NEM A;  2XNA C;  3CXC A;  1SE8 A;  4ULL A;  3C2P A;  1SFO B;  2B2W A;  4L5S A;  3ND8 A;  3I4N G;  3S14 H;  1ILP A;  5M5X B;  1F2Y A;  1JWM D;  1XNQ Q;  3KBG A;  1TR5 A;  4J15 A;  4BBS H;  1CUK A;  4YCV A;  3OHX C;  3I56 A;  1CQV A;  4OIK A;  2EYH A;  4DR1 Q;  3CRL C;  2L4N A;  4A3J G;  1HXY D;  3RR5 A;  2F4V Q;  3CP0 A;  3GTG H;  3K5L A;  2A73 B;  2FJ2 A;  1SE4 A;  3KYH C;  5CYU A;  4OIJ A;  5C3E B;  5IYB G;  3K5N A;  2VNU D;  1C7Y A;  1QVF A;  1YNN D;  2HD3 A;  3PUZ A;  2KJX A;  4DUY L;  4X3T A;  1T9H A;  1DOK A;  2CKZ B;  2DUD A;  4KN4 C;  1JJ2 A;  3R8B A;  4X65 Q;  4PQX A;  4EVO A;  3I4M B;  1CQF A;  3H3V H;  4O2D A;  3KK7 A;  4JI8 L;  5C0X G;  5GAE C;  4A4I A;  2ALY B;  3MHB A;  2ID0 A;  2PI2 E;  3ULL A;  4P72 A;  4DV6 Q;  4DR7 Q;  2F0F A;  2EIF A;  3BG3 A;  1HNZ Q;  4R4T A;  1XPO A;  4EQP A;  5FO8 B;  1EY5 A;  4XQQ A;  3G71 A;  2NB0 A;  2EXZ A;  1RJT A;  1VQP A;  4KY6 A;  4L8J A;  1JOR A;  1EZ6 A;  1H9S A;  2PNH A;  1VMC A;  2Q8T A;  1CHQ D;  1PA6 A;  4KKS A;  5COR A;  2B2V A;  3J81 E;  4ZAI A;  1N36 Q;  3HOZ G;  4CDC C;  1V43 A;  3VR5 A;  5C44 H;  3KUP A;  1D8L A;  1YEZ A;  3FKI H;  2B63 H;  3QIA A;  1JC7 A;  4BBS G;  3BVG A;  5I6Y A;  2A68 C;  1JQY D;  3H0G B;  4OWW B;  1LT5 D;  4ILW A;  4LUV A;  3A54 A;  4X65 L;  1IL8 A;  1WD1 A;  3HEJ A;  1CZW A;  3W1B A;  3NTH A;  2XTI A;  1VQL A;  1YNJ C;  2A5H A;  2E2H H;  1PFN A;  4DAY B;  4LF4 Q;  5JJZ A;  1SMY D;  5DAU A;  4KK7 A;  4FXG C;  1HNZ L;  3G48 A;  3MVV A;  5DNF A;  2KHS A;  1YHQ A;  1Z7T A;  4LF7 L;  2K01 A;  1LAB A;  2PMZ B;  4IOC A;  5CV6 A;  1LLR D;  2EJG C;  5IGE A;  2KEE A;  3NBH B;  2E5L Q;  2IW3 A;  3NEL A;  2F0O A;  1E0B A;  4DR3 L;  1I3Q H;  4Q0F A;  2R93 H;  3J80 L;  3GTM B;  4KV6 A;  5FLM G;  1XNR Q;  5M3M H;  3PIO 3;  2K5H A;  1STN A;  1WCM H;  2PNR C;  3I91 A;  1P16 A;  5AJ3 Q;  2WAQ E;  3RN2 A;  4OL7 A;  3HG9 A;  3Q0A A;  2UUC Q;  4ZRZ A;  4OX9 Q;  3GTJ H;  5COY A;  4DR1 L;  3S16 H;  1X3Q A;  5CV8 A;  2CW0 D;  3CU7 A;  4PNY A;  1H9S B;  2CH4 A;  3A8K E;  3M4Q A;  3E3X A;  5M3M G;  1H9R A;  3KLS X;  1TY2 A;  1XMQ L;  1UAP A;  1K83 B;  1HA6 A;  2P5Z X;  5KNB A;  1ZXT A;  4IZ8 A;  4CJ2 C;  1I6V C;  1F2L A;  5HGQ A;  5IGB A;  2RHQ B;  5JVH 3;  3BZC A;  2JA5 G;  3UI2 A;  1G6Z A;  3BJU A;  3EA6 A;  4ZYS A;  4OWT B;  4NP5 A;  4GN5 A;  4OON A;  3U4V A;  4CGY B;  5BN3 A;  4QUF A;  1II3 A;  5HUR A;  4OEL B;  1YHA A;  1Q3L A;  2KA7 A;  5IYD H;  1WI5 A;  2WP8 J;  3U4Z A;  4BY1 H;  3QJY A;  4Y7N B;  1EFW A;  2EYF A;  2Z6B A;  3RUZ A;  1YVC A;  1WTX A;  3KF8 A;  3BU2 A;  1FJG Q;  2DY8 A;  4JI1 Q;  3ND9 A;  4OX9 L;  3E9H A;  4IJL A;  2G9D A;  4JI7 L;  4P71 A;  2HIV A;  3OWE B;  4J8Q A;  1KRS A;  4XTC S;  1PTO B;  4BBR H;  4X62 Q;  4K5X A;  4L63 B;  3HFZ B;  3SE0 A;  2YU9 B;  2IX0 A;  3E9I A;  1KDB A;  1VCI A;  3NUC A;  4LUZ A;  2Z9H A;  3PIP A;  1IKL A;  3BS1 A;  1NR4 A;  1PMR A;  5JEA J;  1SYE A;  4ZKB B;  1C8C A;  2ES2 A;  2N3S A;  2NVY H;  2N78 A;  4X64 L;  1FD7 D;  1LTG D;  2VXW A;  3I70 A;  4DUZ L;  1WTV A;  3KLR A;  5IGD A;  4A3K B;  2RSO A;  3U9O A;  5ELO A;  3RN5 A;  3I7F A;  4H7B A;  5CV5 A;  5IGC A;  2E2H B;  1EY8 A;  1NTG A;  4RWS C;  4DAV A;  5E1F A;  1SAP A;  3M9B A;  3PCO B;  4O0A A;  3HOW H;  3FRP B;  1PZI D;  5BN5 A;  3MEF A;  4CDF C;  5E7N A;  3ER0 A;  3R3O A;  1FR3 A;  5E4W C;  4JI2 Q;  1EZ8 A;  1RCV D;  1A2T A;  1L1O B;  1Y8N B;  4IUV A;  2EXD A;  2V1C C;  5K36 H;  2JSO A;  2VB2 X;  2G5D A;  5JVG 3;  2OXP A;  4YIJ A;  2TSS A;  4GLV B;  1LTB D;  1VS0 A;  5T1I A;  5EPL A;  3BZD B;  3J80 E;  2B8G A;  2XRQ D;  1K8G A;  1YIJ A;  4QCL A;  1N32 Q;  4N9P A;  1DZ1 A;  3M4O B;  1AZQ A;  2MP1 A;  1KAW A;  4POG A;  2Y0S E;  2WKC A;  1PHJ A;  2BDO A;  4QGU A;  2ASB A;  2NVT B;  2RVL A;  1LT6 D;  2QCP X;  4Q5V A;  1K0S A;  1PH3 A;  2HQE A;  1SBB B;  3T16 A;  3M3Y H;  1SNM A;  1XPR A;  1WTH A;  2WB1 E;  3HOY H;  3HOU G;  3DMU A;  4BXX G;  5KRU A;  1NNX A;  4JI2 L;  4GLX A;  1MHW C;  4V0B A;  2QF7 A;  1SJE D;  2L9H A;  3LNN A;  3J81 j;  4K6D A;  1XX8 A;  2VZA A;  5C4Z A;  3AFP A;  1TS4 A;  1GKH A;  1A62 A;  1HR0 L;  4DV7 L;  5JJL A;  1JCK B;  1GOZ A;  2WKD A;  1FL0 A;  4UP9 A;  4RA8 A;  3W5O A;  3GTP B;  2JA8 G;  4B3S L;  1EY0 A;  3HKS A;  1ZYR D;  2JE6 I;  3Q6S A;  1BUV T;  3P1H A;  4JC0 A;  4DR5 L;  1B7Y B;  1M1K C;  3AFQ A;  4F87 A;  5IT9 E;  2L15 A;  4JBM A;  1KLU D;  5ISR A;  1HHV A;  2JA5 B;  5EQ0 A;  5C0X H;  1DON A;  2OQK A;  3S1N B;  1GUS A;  3K7A H;  1QNU A;  1YZ6 A;  1JJC B;  1PFM A;  1KAA A;  2CHB D;  3M4Y A;  1LTS D;  4JOI A;  5TSS A;  1TU2 B;  4DR2 Q;  1CKO A;  5FLM H;  4DV7 Q;  2XWB B;  1X3G A;  1S4Z A;  2R6G A;  5IT9 c;  2NUC A;  5I6W A;  4QMG A;  3NHH A;  4A3K G;  1RL2 A;  4JI0 L;  4TQU S;  4B3S Q;  1NMG A;  1Y1V H;  1VQD A;  3KFU A;  2G9H D;  1TWG H;  2QDB A;  1HPC A;  1PYW D;  1ZKO A;  4ME3 A;  5DM6 3;  3FEW X;  3TRZ A;  4ZQ3 A;  2EDG A;  2BDN A;  3QG1 A;  5CBE E;  2AHO B;  5JPN C;  4OO1 I;  1GD7 A;  3ZYY X;  1VF7 A;  4DF7 A;  1AN8 A;  1EYG A;  1DD2 A;  1L2F A;  1HNW L;  5C5M A;  4DV0 Q;  3MA2 B;  3VA5 A;  3S1Q H;  1BCP D;  4ZK9 B;  4I7A A;  1CKN B;  2QEX A;  1SNC A;  5C44 G;  4DV3 L;  3M7G A;  1OXT A;  4DR2 L;  4N9T A;  2A6E D;  2DJF C;  1QIL A;  5C0X J;  4KJN A;  4XXE A;  2IHF A;  3H6M A;  4RFB A;  2F0I A;  4JI0 Q;  1FNU A;  3FKI B;  2B63 B;  3DWQ A;  1IYU A;  1PVO A;  3GTQ H;  3PV0 A;  1M8A A;  1TS5 A;  1J5E Q;  3I4M H;  2EYL A;  2RF4 A;  1Q81 C;  5FKA C;  4RKL A;  1W6J A;  2MO0 A;  1CSQ A;  1GHJ A;  4A3I H;  1HNX Q;  4XT3 B;  4X62 L;  4BY7 B;  1SSO A;  3A5Z B;  1NJI C;  5D3I B;  4A3E G;  1S5C D;  4APV A;  3X3N A;  2R7D A;  4DA2 A;  4JK1 C;  3S9W A;  4DFA A;  1KLG D;  1AW7 A;  1UWV A;  1EWC A;  5M5Y H;  1VQE A;  3V2T A;  5IGG A;  4GKJ L;  3NBI A;  3CCM A;  1SYD A;  4RGO S;  1O78 A;  1O7Y A;  2C9O A;  1JB7 A;  4PV1 C;  4B3M Q;  1KDA A;  5JEA H;  1NBW A;  1L1O C;  4BBR G;  3HP3 A;  1CKN A;  1VQ9 A;  4IAL A;  4BA2 I;  4DAY A;  2NZO A;  2PO4 A;  2A1A A;  2FHT A;  1U0L A;  5C3E H;  3PF4 A;  3D6W A;  5I9O A;  2UXB Q;  1PFB A;  4GOP B;  4OEM B;  2F0S A;  1Q82 C;  5IYD G;  1UEB A;  3K8A A;  5IP9 G;  3C1F A;  4YHH Q;  5JAV A;  1JWU D;  1T5E A;  5H1S E;  1KXL A;  1RTO A;  1NE3 A;  4LWC A;  5ELD A;  5IE8 A;  4RKB A;  1ZEQ X;  4BBS B;  4JI3 L;  4M1U B;  1G2S A;  1PTO H;  4LFB Q;  1TWH B;  2RCN A;  1B2T A;  3S24 A;  4HAE A;  1RD9 D;  4XDX A;  4A3L G;  1MKH A;  2EYM A;  1PTO F;  1ML0 D;  1STE A;  4A3F B;  4K2L A;  3OYY A;  4A3G G;  2I0Q A;  1EY9 A;  2NVY B;  4A3B B;  3VR6 A;  4DAM A;  3NK9 A;  4DR6 L;  1P8L A;  2FIN B;  3NE5 B;  2WB1 B;  4JI4 L;  1I4Q A;  5DLQ E;  4C3J G;  2VQF Q;  1EQR A;  2AQ1 B;  4HIO A;  1HUN A;  1JB3 A;  2UXB L;  3FVQ A;  5BN4 A;  3IFD A;  2BE5 C;  4DK1 A;  1XMO L;  2R93 B;  2UU9 L;  4KLK A;  3HKZ E;  4GN4 B;  3KJP A;  2JA8 B;  2WAQ B;  1RTN A;  1K28 A;  1EOT A;  4DKA C;  1B9M A;  3ULJ A;  2NVX B;  1HR0 Q;  1WD0 A;  4DK0 A;  2ENB A;  3U50 C;  1SYC A;  2EZV A;  4R4Q A;  1SR3 A;  1X55 A;  4OWX B;  1S3O A;  1TVX A;  4H44 C;  2I5M X;  1IW7 C;  3CAM A;  1K8M A;  1OXU A;  4UDU C;  1PH9 A;  5I9P A;  3U58 A;  3RLF A;  1I4R A;  1Y1W G;  4A3M B;  1NMF A;  2JXM B;  2LXK A;  1STA A;  3Q22 A;  3A8I E;  1JJG A;  1H9K A;  3QOJ A;  4HMI A;  2NWG A;  3H94 A;  4KHZ A;  1ROD A;  1ESR A;  2PW5 A;  2F4I A;  2CVR A;  3I3C A;  5M5W H;  2Q2T A;  1PH6 A;  1V8Q A;  3A7L A;  3BDL A;  4XYQ A;  1F9Q A;  5JJK A;  1SE2 A;  1VQO A;  4GS3 A;  4C3H B;  3P20 A;  1UE1 A;  2CH4 W;  5LMN Q;  1EFI D;  3GP7 A;  2NZH A;  2VQE Q;  1TWH H;  3CW2 C;  2D9U A;  3GQB A;  2QGQ A;  2F3I A;  3AEV A;  3K0Y A;  1VQI A;  2XN9 C;  3K80 C;  1QE6 A;  2DJG C;  4LFC L;  1DJR D;  5M5Y B;  4IPG A;  4OO1 H;  2H1E A;  2XVS A;  3URY A;  2Q2U A;  3S2D B;  5C4X H;  1VQC A;  4L5T A;  1L1O A;  2Z4I A;  1HZ9 A;  3UDG A;  4PMB A;  1S5F D;  1QZH A;  1CK1 A;  5KNC A;  2I5H A;  2KQ3 A;  2EYO A;  4MN3 A;  1TT2 A;  2GVB A;  1U4M A;  2KCC A;  5IYC G;  2ZM6 L;  1U5K A;  4DV2 Q;  2B2U C;  2BA1 A;  3PSI A;  4LW1 A;  4N8X 1;  1BQQ T;  1HNW Q;  1A15 A;  2K4K A;  3CCE A;  1PFS A;  1KNE A;  3MFY A;  2SDF A;  2RCF A;  4FF3 A;  4J6H A;  2IPK D;  3E0J A;  1S40 A;  3KF8 B;  1D7Q A;  1PH2 A;  5IOC A;  3A74 A;  4JBW A;  3T4A C;  2O5I C;  2OCE A;  4WRD A;  1PLF A;  4HJ5 A;  3PUX A;  5BR8 Q;  3PO2 H;  1JOO A;  2F0K A;  4Y52 H;  2Q8I B;  1DOM A;  2NVT H;  5M5W B;  4BXX H;  2MHV A;  1EEI D;  3VR2 A;  2KCM A;  2F0U A;  2F0V A;  4YCW A;  4KKT A;  3EIV A;  2RBM A;  3JAM L;  1KTK A;  3TP7 A;  3DHQ A;  4TRD A;  1E1O A;  2CFM A;  2MPM A;  4DV5 L;  2FFK B;  4G7O C;  2K52 A;  2D62 A;  3OW2 A;  2UXC L;  3OTO L;  1F9S A;  1YIT A;  1GHK A;  4KI0 A;  4B9W A;  1Z9F A;  3Q23 A;  3DM1 A;  3S1R H;  2XGT A;  3HOX B;  1XJV A;  1HTL D;  2ZTD A;  2FXQ A;  1I4X A;  4RGT A;  1G6P A;  2KCN A;  4JI6 L;  5EJW A;  1PV4 A;  3IFT A;  3I4O A;  3CKI B;  1VQ4 A;  4GKJ Q;  1RF2 D;  3VYU A;  3HS0 C;  4A3C H;  2F0E A;  4C3I H;  3F2B A;  5ELE A;  1L0Y B;  4HMJ A;  4JBK A;  3PUW A;  4BS9 A;  4FF4 A;  1VQM A;  4NW2 A;  1Y1W B;  5C0X I;  3J81 i;  3MXN B;  2NVQ H;  3GTM H;  1ONL A;  3QWN A;  2K5N A;  1HZC A;  4K2K A;  4FDB A;  4K6L A;  1D1I A;  2K5Q A;  3I73 A;  5FLX L;  3TSS A;  3K5M A;  4JI7 Q;  1G8Z D;  3NTI A;  4R4O A;  4NXM L;  2E8G A;  1EWI A;  3S15 B;  3S16 B;  4FXD A;  5K5P A;  4IUN A;  2CQO A;  2OWO A;  2UXC Q;  1SRO A;  1JOK A;  1NCV A;  4A3F G;  2JYO A;  1SMY C;  2R92 G;  3K6O A;  5KEE A;  2D5D A;  3AB9 A;  2AWN A;  4DUY Q;  1A63 A;  5EKI A;  2D2C C;  3U9S A;  2RA4 A;  5IYB H;  1TXY A;  3HOW B;  2JP1 A;  2R92 B;  3H3V C;  3HOV H;  2KEC A;  3BZK A;  3CD6 A;  2SOB A;  4POF A;  2BA0 A;  2PPB C;  1SRU A;  5FLX c;  2HCI A;  1Q1E A;  1I50 B;  4KY5 A;  3MZ5 A;  4X6A H;  2H4O A;  4C3J H;  3HZX A;  5FJ8 G;  3CCJ A;  3W3A A;  5AFW A;  1EY6 A;  1X6O A;  2QKI C;  1QVG A;  1XTC D;  1YI2 A;  4IUU A;  1DM0 B;  3I4M G;  3S2D H;  3KF6 A;  2F0J A;  2A68 D;  4CBV A;  1Q46 A;  1XWE A;  2A6H C;  1MIU A;  3OSO A;  4DV1 L;  2CWA A;  3RLO A;  5ELB A;  2KCT A;  3PQI A;  2DN8 A;  1KHI A;  3H0G H;  1X56 A;  2CW0 C;  5BR8 L;  3M4O H;  3WDN A;  3MEH A;  2A6E C;  1PH7 A;  1GM5 A;  3L7Z C;  5CBA E;  3PUV A;  2JA5 H;  2K04 A;  4A75 A;  3CQZ H;  2Q2H A;  3S2H B;  2VUM B;  2B2W C;  1Q8K A;  4GNX A;  3CCU A;  4JYA L;  4B3T Q;  3SDZ A;  2Q2I A;  2IHE A;  3T56 B;  1R9T H;  1WYD A;  3K57 A;  4L5Q A;  2AMC B;  4PZ7 A;  1ET9 A;  2F0P A;  2JJQ A;  4KHP L;  3NPP A;  2K03 A;  3VYS A;  1SNQ A;  1EYD A;  2Q8R E;  4RGM A;  4DK6 C;  1UEA B;  4DR4 L;  5EBC A;  5JEA G;  3Q24 A;  1IBM Q;  4BBR B;  2WV6 D;  4CKB A;  4A76 A;  2I46 A;  3ERQ A;  2YTX A;  4AIM A;  4C3I B;  2E2I H;  3BYT B;  1ICF B;  4K0K L;  4A3G B;  4CKC A;  3NWT A;  5C5L A;  4BY7 G;  2FMC A;  3JAM c;  3R93 A;  2UUC L;  2F0D A;  4F7X A;  3S1M B;  1IYJ B;  2IX3 A;  4JV5 Q;  3PUY A;  2B2T C;  3T53 B;  3J7Z C;  2EVB A;  3F2C A;  1EY7 A;  5IP7 G;  3IRB A;  4B3R L;  1C4Q A;  1YJW A;  3LGJ A;  2J7Z A;  4QIW B;  3VR4 A;  3H09 A;  1X9N A;  5CMD A;  1S5E D;  3CF5 A;  1DXM A;  1F2Z A;  1HR0 W;  3ZJY C;  3BVZ A;  1D5X C;  4CHT B;  3LWU A;  3VDY A;  4A3L H;  4FF2 A;  1OXS C;  1SYB A;  1HCZ A;  2ZTE A;  3UDF A;  2B2U A;  4C3I G;  4I7Z C;  1AEX A;  5ELC A;  3G6E A;  3BVM A;  2E76 C;  3EN2 A;  3R2I A;  1ICW A;  3L0O A;  4RCO A;  5DM7 3;  1PYB A;  5IP9 H;  3O13 A;  1VQ5 A;  2E75 C;  2KHJ A;  5A35 A;  4NB3 A;  1JE5 A;  2QW7 A;  2E2J B;  3KDF A;  1HQR D;  2BH8 A;  4NDX A;  3A8J E;  1N34 L;  3D3R A;  4S3S A;  2N88 A;  2K33 A;  1SYG A;  2HT1 A;  3HOY G;  1OXX K;  1SE3 A;  1PZK D;  4MHE A;  4ZUI A;  4IPC A;  3F1Z A;  3PMF A;  4WJ3 M;  2M00 A;  4HSP A;  2XWJ B;  4A3I B;  4LF9 L;  1LYL A;  4IUQ A;  5EKK A;  3C46 A;  4BY7 H;  3SK4 A;  4X3K A;  1BVS A;  5GRO A;  3GTJ B;  3ERS X;  2F0H A;  1VQ6 A;  3D8G A;  2DNC A;  1Q90 A;  4FXK C;  2VB3 X;  1IBL L;  1A3V A;  1EYC A;  5E4X A;  4GOP A;  5D3D A;  4LK1 C;  4R4C A;  1ET6 A;  1NAP A;  3GO5 A;  4AQY Q;  2X6L A;  3ULP A;  1EUJ A;  3DEO A;  3MTS A;  1PRT F;  2LFN A;  5EPJ A;  4DPG A;  3I72 A;  2OTL A;  3J80 c;  3I55 A;  2B2T A;  5C4X B;  2TMP A;  1IBM L;  1XMO Q;  4RMF A;  1N9W A;  2PZU A;  1QOH A;  2K6A A;  4YWL A;  1PDQ A;  1HQM C;  1K73 C;  1YJN A;  4P74 A;  1CHP D;  1TWA B;  5C4X G;  5JOB A;  4A3C G;  2KED A;  4NXN L;  1KD1 C;  1XTD A;  1I4P A;  4NPS A;  3I4L A;  1ILQ A;  5KIX A;  4CJ1 B;  1Q12 A;  3TN2 A;  2AQ3 B;  1W2B A;  1B3A A;  2ZT9 C;  2PMZ E;  1XMQ Q;  1TWC H;  4ZKC B;  2A6H D;  1V1P B;  4YWK A;  3D4W A;  4F8M A;  3HKZ G;  1O7Z A;  2HQL A;  3TP6 A;  5C3E G;  3KOJ A;  4BY1 B;  2V4D A;  4K5W A;  1OO9 B;  4HJ7 A;  3H91 A;  1B8A A;  1NY4 A;  4ID6 A;  1B44 D;  2EE1 A;  2HHH L;  4ZCK A;  2X69 A;  2KUM A;  3KF6 B;  3FHW A;  2GA4 B;  4DNI A;  5EGT A;  1DOL A;  3VYT A;  2K32 A;  4NMZ A;  4JI1 L;  1GXD C;  1MSH A;  2EY6 A;  3N52 A;  2IY5 B;  1AE2 A;  3P7J A;  2LY7 A;  1G2T A;  2F0Q A;  2E5L L;  3PO3 G;  4DAP A;  1QUQ A;  3E5S A;  1S5D D;  2VL6 A;  2F4V L;  2XIW A;  2F0G A;  4H0L C;  3KJO A;  3FP9 A;  3BYY B;  2NTS A;  4UPA A;  2MO1 A;  2E2I B;  1T5X D;  1DCZ A;  1Y8P B;  1BCP C;  2PCF B;  2K28 A;  4DV4 L;  1TWF B;  4IUT A;  3F2U A;  1WTR A;  1WTP A;  1CKM A;  2F0W A;  2OTJ A;  3J7A V;  2RDH A;  3K0X A;  3CPF A;  4MZ9 A;  2OT2 A;  2K14 A;  5A2Q E;  2B29 A;  3UDI A;  2PQA B;  5LL6 X;  2N49 A;  5J1Z A;  2ZM6 Q;  4DV2 L;  1Y14 B;  1LM0 A;  4QQB X; 
#chains in the Genus database with same CATH homology
 2O5J C;  1ESF A;  4ZLT F;  4EQO A;  1J9O A;  4HN7 A;  4XQJ A;  1G91 A;  4QF4 A;  3I8Z A;  2IX1 A;  5C3X A;  2DY7 A;  1AP0 A;  1A3U A;  3QOL A;  1VF5 C;  4AYB B;  1FGB D;  1TY0 A;  2EJM A;  4X3S A;  1I3Q B;  1AZP A;  1GUW A;  1SEB D;  1QWY A;  3C3L A;  3S14 B;  3C1E A;  3L9A X;  2NN6 G;  4C3J B;  4F88 A;  2L12 A;  2SNM A;  2XRS D;  2LS0 1;  1CFM A;  2B2Y C;  4C1N I;  4TKO B;  3L3O C;  4DXF A;  1BR9 A;  3MXN A;  1FNW A;  1GUG A;  2RDG A;  2B39 A;  4K5V A;  3HKZ B;  2F0M A;  3HOY B;  1L0X B;  2IT1 A;  1B53 A;  1LT3 D;  2BE5 D;  2JEB I;  4Z9C B;  1CA6 A;  3OOC A;  2EY5 A;  3SVM A;  3CQZ B;  3RD4 A;  3EJI A;  5I2X A;  3MFG A;  1NSN S;  3RMH A;  3OPO A;  5CC4 A;  4P2C B;  5A2Q L;  3HGB A;  3NXW A;  4B08 A;  3A7A B;  3KBX A;  1KNA A;  2R3Z A;  2FMM A;  1LTT D;  3DWA A;  1E2V A;  3K59 A;  1SNP A;  1LT4 D;  1TWC B;  4FP5 D;  4RAU C;  4RHS A;  1BDO A;  1F2M A;  1HTP A;  4KD3 A;  3GTG B;  1D5M C;  2DNE A;  3FDT A;  1O7L A;  3TZU A;  1O80 A;  3DEP A;  2OF1 A;  2XSC A;  3NSW A;  4G57 A;  2EYP A;  4O1N A;  4RH6 A;  3HOZ B;  5CV7 A;  3DWP A;  1STY A;  4E6I A;  1QCB D;  3S1Q B;  2ZXP A;  2F0N A;  3IKJ A;  1MBY A;  3ITP A;  1PRT D;  3A56 A;  3MAQ A;  2L1B A;  2F1M A;  2J4X A;  3AMU A;  2B8F A;  1SXT A;  2HCC A;  3AU7 A;  1H9J A;  1MSG A;  1EYA A;  1YNJ D;  4I65 A;  3OMG A;  1JE4 A;  1Q1B A;  3GV3 A;  5LHY 1;  3K5O A;  2K05 A;  3RZO B;  3WOE A;  2NBF A;  1OXV A;  3T13 A;  4DGZ A;  1TS2 A;  3PIP 3;  4EGV A;  2CQA A;  4KJO A;  5C6A A;  4ODG A;  3TP8 A;  3CHB D;  1WTQ A;  2EY1 A;  4UAI A;  3MXU A;  2NVQ B;  4FVM A;  5IT9 L;  1KAB A;  5D65 A;  2JA7 B;  4A93 B;  4HSV A;  3D4D A;  4KD4 A;  5ELF A;  2EJF C;  4MIU A;  1KDC A;  3G6J B;  1A2U A;  2F03 A;  1B50 A;  3GTL B;  3J7A F;  5C3W A;  1MGS A;  3NP8 A;  3SR1 A;  3TZD A;  5KGU A;  5FO7 B;  3N6R A;  1F9P A;  3W2D A;  3IAY A;  5CV9 A;  1TQO A;  4U68 A;  1JR0 D;  4KKU A;  1U4P A;  2M2L A;  3NBH A;  3RZD B;  1Y8O B;  3D31 A;  2JEA I;  1SNO A;  3TP5 A;  3GTQ B;  2BOS A;  1CA5 A;  4X3U A;  2EOT A;  4QB4 A;  2AWO A;  5I4D A;  4IQZ A;  3HRZ C;  4IN3 A;  2AUK A;  3GTK B;  1SDF A;  5C4J B;  3DXJ C;  2J0T D;  3ERO A;  1FNV A;  2AQ2 B;  4CKE A;  2Z8L A;  2Y0S B;  4KY7 A;  1X32 A;  4ME5 A;  1IHZ A;  3NQI A;  1Z6H A;  2OEO A;  1WTO A;  4DU9 A;  4U67 3;  2I07 B;  1YNN C;  1A3T A;  5IOD A;  1BBX C;  3OIQ A;  1RDP D;  4A3E B;  3MXP A;  3K7A B;  3NQT A;  4KMU C;  2EPB A;  1EWH A;  4LJZ C;  4OHJ A;  5K36 G;  4TSS A;  4C56 C;  2C5C A;  1ENF A;  3V05 A;  4FO2 A;  2NN6 I;  3A55 A;  1V1P A;  5FK9 C;  3PO3 B;  1F9R A;  5M3F B;  2AUJ D;  4OGQ C;  2Z1C A;  4R9W A;  1EY4 A;  5G3L F;  1GJX A;  2EY2 A;  3DUZ A;  5M9O A;  4HR7 B;  1IYV A;  4ABN A;  2NTT A;  2HDL A;  1B4O A;  2L11 A;  1J8I A;  2NN6 H;  2HUG A;  3S1R B;  1G29 1;  1HFN A;  4XQN A;  1MI2 A;  2B2Y A;  1UNS A;  2M9V A;  1BCP F;  2MJ8 A;  3P75 A;  1LAC A;  2YYZ A;  5E3F A;  1VMP A;  1HRJ A;  4IFD J;  1UUP A;  1FYC A;  1EQT A;  5EBD A;  3J81 L;  1A6X A;  2F0L A;  4BA1 I;  3I4N B;  4DNR B;  1U9R A;  3VA7 A;  3ONA B;  1D1K A;  4BWG B;  1EIG A;  1PRT B;  3PO2 B;  2WIN B;  4LMQ D;  1B1Z A;  1CT1 D;  4WJW A;  3SXH A;  3M3Y B;  1V1O A;  4V19 0;  3LX0 A;  5FO9 B;  2A74 C;  1STB A;  2NZ1 D;  5CV4 A;  4KN7 C;  3VYR A;  3FPU B;  4RGN A;  3TBI B;  3JAM E;  1VDZ A;  2ZXR A;  4HCE A;  2PYK A;  2RKS A;  2A69 C;  2WII B;  1F77 A;  2O4X A;  5KND A;  1K8O A;  1CTM A;  3TDQ A;  1LV9 A;  3SHL A;  3K58 A;  1NUC A;  1DYQ A;  5J39 A;  2K1B A;  4R8N A;  4IUP A;  1BNZ A;  1XYI A;  3EFX D;  1M4V A;  2R7Z B;  1EL0 A;  1EEF D;  3D6C A;  4A3J B;  4NKL A;  3V96 A;  3MXG A;  2PZT A;  4XYO A;  1CM9 A;  1NR2 A;  1B9N A;  4RCN A;  2N55 A;  2RSN A;  3CRK C;  1CI3 M;  4XT1 B;  2SEB D;  1ZYR C;  2A69 D;  2IL8 A;  2IJ0 A;  1SJH D;  1D5Z C;  1R4P B;  1BOS A;  2E74 C;  1R4Q B;  2IWH A;  4PMW A;  1TKW B;  4FYD A;  3EVQ A;  4WFN 3;  4FF1 A;  4HCS A;  1IKM A;  1BO0 A;  1I4H A;  1QG7 A;  5JPM C;  3MWY W;  1D6E C;  1AFP A;  2JA6 B;  5FOB B;  1I6H B;  1X3P A;  1CZG A;  1Q8I A;  1STG A;  3NTK A;  5C4H A;  4PMC A;  4DNT B;  4M8A A;  1BXT A;  2O2L D;  2KVM A;  3HOU B;  4IFD H;  2HDM A;  5HGT A;  5J22 A;  5CR3 A;  1WVL A;  1S5B D;  4EQN A;  3G7L A;  4B9X A;  4HED A;  5IGF A;  3E6Z X;  2R61 A;  3IL8 A;  1MD2 D;  1SYF A;  1I4G A;  2K7V A;  1QNK A;  3GD7 A;  5CGK A;  4KHV A;  5LL6 S;  1Y69 U;  3X3M A;  2L55 A;  1HA5 A;  2K5D A;  3S17 B;  2L0C A;  5NUC A;  4GZY C;  1GUN A;  1EIH A;  4KTA A;  5M3M B;  1QJO A;  1W6K A;  5FLX E;  1GUO A;  1PZJ D;  2ICI A;  5KYI A;  4H13 C;  1U4R A;  2ICE C;  1E2W A;  4ZUJ A;  2NYZ D;  5C44 B;  5IIF A;  1EQV A;  5D14 A;  3BDC A;  4K8I A;  4G7H C;  1TII D;  3M85 A;  4IUR A;  2MGS A;  4WOR A;  5G3L D;  3D4R A;  2F0T A;  4A3D B;  3MC0 B;  3TME A;  5KYL A;  1WTW A;  2PW7 A;  3SK8 A;  3VR3 A;  2F3V A;  5EKL A;  4K14 A;  2QEJ C;  4L6T B;  3GV6 A;  3FPP A;  3FMC A;  4OO1 G;  1U4L A;  3SEB A;  5DEH A;  2PZW A;  4IFD I;  2KOL A;  2PQE A;  3OIP A;  1STH A;  4K8J A;  1TWG B;  2QIL A;  2B2V C;  4QUC A;  1HFG A;  3GTO B;  2SNS A;  2RDF A;  1Z47 A;  2F3W A;  3OMC A;  2RQX A;  1RHP A;  4DXG A;  1WCM B;  1QB5 D;  1LTA D;  1D2B A;  2WAC A;  1TS3 A;  1LO5 D;  3QO2 A;  4C1N K;  1LTI D;  3OWF A;  1E2Z A;  3KLS A;  2L5T A;  3OW7 A;  4G4K A;  2LMC B;  1PRT C;  1JOQ A;  4O42 A;  1PTO D;  1ENA A;  3EQL C;  2LKV A;  3QB3 A;  4XIG S;  3LWE A;  1LTR D;  4IFD G;  1ENC A;  5T1G A;  1BCP B;  2BCO A;  2EYJ A;  3WOF A;  4RHR A;  2E2D C;  1PTO C;  4DN4 M;  3T51 B;  3HOV B;  3NWS A;  2X6G A;  4C2M B;  4R8I A;  2MUY A;  4HTH A;  2ZXO A;  4FNF A;  3J7Y W;  4C3H G;  1PXU A;  1Y1V B;  1GUT A;  1HUM A;  2Z4H A;  1JIC A;  1XXG A;  4LAA A;  2K5W A;  1JWS D;  3I90 A;  5EPK A;  1H9M A;  5I2Y A;  1C48 A;  5F2D A;  1EU3 A;  3R2T A;  1BF4 A;  1EU4 A;  4J1M A;  3M7N A;  4G7Z C;  4CJ0 B;  1SND A;  1RKN A;  1IW7 D;  3SK5 A;  3BDO A;  3SK6 A;  1R9T B;  2XNA C;  4ULL A;  3C2P A;  1SFO B;  2B2W A;  3ND8 A;  1ILP A;  5M5X B;  1F2Y A;  1JWM D;  3KBG A;  1TR5 A;  3OHX C;  1CQV A;  4OIK A;  2EYH A;  3CRL C;  2L4N A;  1HXY D;  3K5L A;  2A73 B;  2FJ2 A;  1SE4 A;  5CYU A;  4OIJ A;  5C3E B;  3K5N A;  2VNU D;  1YNN D;  3PUZ A;  2KJX A;  4X3T A;  1DOK A;  4KN4 C;  3R8B A;  4PQX A;  4EVO A;  3I4M B;  1CQF A;  3KK7 A;  5C0X G;  3MHB A;  2ID0 A;  2F0F A;  3BG3 A;  4EQP A;  5FO8 B;  1EY5 A;  4XQQ A;  2NB0 A;  2EXZ A;  1RJT A;  4KY6 A;  4L8J A;  1JOR A;  1EZ6 A;  1H9S A;  1VMC A;  2Q8T A;  1CHQ D;  4KKS A;  5COR A;  2B2V A;  3J81 E;  4ZAI A;  1V43 A;  3VR5 A;  3KUP A;  3QIA A;  1JC7 A;  3BVG A;  5I6Y A;  2A68 C;  1JQY D;  3H0G B;  1LT5 D;  4ILW A;  3A54 A;  1IL8 A;  1WD1 A;  3HEJ A;  1CZW A;  3NTH A;  1YNJ C;  2A5H A;  1PFN A;  5JJZ A;  1SMY D;  5DAU A;  4KK7 A;  4FXG C;  3MVV A;  5DNF A;  2KHS A;  1Z7T A;  2K01 A;  1LAB A;  2PMZ B;  5CV6 A;  1LLR D;  2EJG C;  5IGE A;  2KEE A;  2IW3 A;  2F0O A;  1E0B A;  4Q0F A;  3J80 L;  3GTM B;  4KV6 A;  3PIO 3;  2PNR C;  1STN A;  3I91 A;  4OL7 A;  3HG9 A;  3Q0A A;  4ZRZ A;  5COY A;  1X3Q A;  5CV8 A;  2CW0 D;  3CU7 A;  4PNY A;  1H9S B;  3A8K E;  1H9R A;  3KLS X;  1TY2 A;  1UAP A;  1K83 B;  1HA6 A;  5KNB A;  1ZXT A;  4IZ8 A;  4CJ2 C;  1I6V C;  1F2L A;  5IGB A;  5JVH 3;  3UI2 A;  1G6Z A;  4ZYS A;  3EA6 A;  4NP5 A;  5BN3 A;  4CGY B;  4QUF A;  1II3 A;  5HUR A;  1Q3L A;  2KA7 A;  2WP8 J;  3QJY A;  4Y7N B;  2EYF A;  3RUZ A;  1WTX A;  3KF8 A;  2DY8 A;  3ND9 A;  2G9D A;  3OWE B;  4J8Q A;  4XTC S;  1PTO B;  4K5X A;  4L63 B;  3SE0 A;  2YU9 B;  2IX0 A;  1KDB A;  1VCI A;  3NUC A;  1IKL A;  3BS1 A;  1NR4 A;  1PMR A;  5JEA J;  1SYE A;  4ZKB B;  1C8C A;  1FD7 D;  1LTG D;  2VXW A;  3I70 A;  1WTV A;  3KLR A;  5IGD A;  4A3K B;  2RSO A;  3U9O A;  4H7B A;  5CV5 A;  5IGC A;  2E2H B;  1EY8 A;  4RWS C;  4DAV A;  5E1F A;  1SAP A;  3FRP B;  1PZI D;  5BN5 A;  3R3O A;  1FR3 A;  5E4W C;  1EZ8 A;  1RCV D;  1A2T A;  1Y8N B;  4IUV A;  5K36 H;  2JSO A;  2VB2 X;  5JVG 3;  2OXP A;  4YIJ A;  2TSS A;  1LTB D;  5T1I A;  5EPL A;  3BZD B;  3J80 E;  2B8G A;  2XRQ D;  4QCL A;  4N9P A;  1DZ1 A;  3M4O B;  1AZQ A;  2MP1 A;  2WKC A;  2BDO A;  2NVT B;  2RVL A;  1LT6 D;  2QCP X;  4Q5V A;  2HQE A;  1SBB B;  3T16 A;  1SNM A;  3DMU A;  5KRU A;  4V0B A;  2QF7 A;  1SJE D;  2L9H A;  3LNN A;  4K6D A;  1XX8 A;  5C4Z A;  1TS4 A;  1JCK B;  1GOZ A;  2WKD A;  4RA8 A;  3GTP B;  1EY0 A;  1ZYR D;  2JE6 I;  3Q6S A;  1BUV T;  3P1H A;  4F87 A;  5IT9 E;  1KLU D;  5ISR A;  1HHV A;  2JA5 B;  5EQ0 A;  5C0X H;  1DON A;  3S1N B;  1GUS A;  1QNU A;  1PFM A;  1KAA A;  2CHB D;  3M4Y A;  1LTS D;  5TSS A;  1TU2 B;  2XWB B;  1S4Z A;  2R6G A;  2NUC A;  5I6W A;  4QMG A;  3NHH A;  4TQU S;  2G9H D;  2QDB A;  1HPC A;  1PYW D;  1ZKO A;  5DM6 3;  3FEW X;  4ZQ3 A;  2EDG A;  2BDN A;  3QG1 A;  5CBE E;  5JPN C;  4OO1 I;  3ZYY X;  1VF7 A;  4DF7 A;  1AN8 A;  1DD2 A;  5C5M A;  3MA2 B;  3VA5 A;  1BCP D;  4ZK9 B;  1SNC A;  3M7G A;  1OXT A;  4N9T A;  2A6E D;  1QIL A;  5C0X J;  4KJN A;  4XXE A;  3H6M A;  4RFB A;  2F0I A;  1FNU A;  3FKI B;  2B63 B;  3DWQ A;  1IYU A;  3PV0 A;  1M8A A;  1TS5 A;  2EYL A;  5FKA C;  4RKL A;  1W6J A;  1GHJ A;  4XT3 B;  4BY7 B;  1SSO A;  5D3I B;  1S5C D;  3X3N A;  4DA2 A;  4JK1 C;  3S9W A;  4DFA A;  1KLG D;  1AW7 A;  1EWC A;  3V2T A;  5IGG A;  3NBI A;  1SYD A;  4RGO S;  1O78 A;  1O7Y A;  2C9O A;  4PV1 C;  1KDA A;  5JEA H;  3HP3 A;  4IAL A;  4BA2 I;  4DAY A;  2PO4 A;  2FHT A;  3D6W A;  5I9O A;  1PFB A;  2F0S A;  3C1F A;  5JAV A;  1JWU D;  1T5E A;  1RTO A;  5ELD A;  4RKB A;  1ZEQ X;  4BBS B;  4M1U B;  1G2S A;  1PTO H;  1TWH B;  1B2T A;  4HAE A;  1RD9 D;  4XDX A;  2EYM A;  1PTO F;  1ML0 D;  1STE A;  4A3F B;  4K2L A;  1EY9 A;  2NVY B;  4A3B B;  3VR6 A;  3NK9 A;  2FIN B;  3NE5 B;  2WB1 B;  1I4Q A;  4C3J G;  2AQ1 B;  1HUN A;  1JB3 A;  3FVQ A;  5BN4 A;  3IFD A;  2BE5 C;  4DK1 A;  2R93 B;  2JA8 B;  2WAQ B;  1RTN A;  1EOT A;  2NVX B;  1B9M A;  1WD0 A;  4DK0 A;  2ENB A;  1SYC A;  2EZV A;  1TVX A;  4H44 C;  1IW7 C;  1K8M A;  1OXU A;  4UDU C;  5I9P A;  3RLF A;  1I4R A;  4A3M B;  2JXM B;  1STA A;  3Q22 A;  3A8I E;  1H9K A;  3QOJ A;  4HMI A;  2NWG A;  3H94 A;  4KHZ A;  1ESR A;  1ROD A;  2PW5 A;  2F4I A;  2CVR A;  3I3C A;  1V8Q A;  3A7L A;  3BDL A;  4XYQ A;  1F9Q A;  1SE2 A;  4C3H B;  3P20 A;  1EFI D;  3GP7 A;  2D9U A;  3GQB A;  3K0Y A;  2XN9 C;  1QE6 A;  1DJR D;  5M5Y B;  4OO1 H;  2H1E A;  2XVS A;  3URY A;  3S2D B;  2Z4I A;  4PMB A;  1S5F D;  1CK1 A;  5KNC A;  2KQ3 A;  2EYO A;  4MN3 A;  1TT2 A;  1U4M A;  2KCC A;  2B2U C;  2BA1 A;  1BQQ T;  1A15 A;  1KNE A;  3MFY A;  2SDF A;  4FF3 A;  4J6H A;  2IPK D;  3E0J A;  5IOC A;  4JBW A;  3T4A C;  2O5I C;  4WRD A;  1PLF A;  3PUX A;  1JOO A;  2F0K A;  2Q8I B;  1DOM A;  5M5W B;  2MHV A;  1EEI D;  3VR2 A;  2F0U A;  2F0V A;  4KKT A;  3JAM L;  2RBM A;  1KTK A;  3TP7 A;  3DHQ A;  4TRD A;  2MPM A;  2FFK B;  4G7O C;  2D62 A;  1F9S A;  1GHK A;  4KI0 A;  4B9W A;  3Q23 A;  3DM1 A;  3HOX B;  1HTL D;  1I4X A;  4RGT A;  2KCN A;  5EJW A;  3IFT A;  3CKI B;  1RF2 D;  3VYU A;  3HS0 C;  2F0E A;  5ELE A;  1L0Y B;  4HMJ A;  3PUW A;  4BS9 A;  4FF4 A;  4NW2 A;  1Y1W B;  5C0X I;  1ONL A;  3QWN A;  4K2K A;  4K6L A;  1D1I A;  2K5Q A;  3I73 A;  5FLX L;  3TSS A;  3K5M A;  1G8Z D;  3NTI A;  3S15 B;  3S16 B;  4FXD A;  5K5P A;  4IUN A;  1JOK A;  1NCV A;  2JYO A;  1SMY C;  3K6O A;  5KEE A;  2D5D A;  3AB9 A;  2AWN A;  5EKI A;  2D2C C;  3U9S A;  2RA4 A;  3HOW B;  2JP1 A;  2R92 B;  3H3V C;  2KEC A;  2SOB A;  2BA0 A;  2PPB C;  2HCI A;  1I50 B;  1Q1E A;  4KY5 A;  3MZ5 A;  2H4O A;  3HZX A;  3W3A A;  5AFW A;  1EY6 A;  2QKI C;  1XTC D;  4IUU A;  1DM0 B;  2F0J A;  2A68 D;  4CBV A;  1XWE A;  2A6H C;  3OSO A;  5ELB A;  2DN8 A;  2CW0 C;  3WDN A;  3MEH A;  2A6E C;  3L7Z C;  5CBA E;  3PUV A;  2K04 A;  3S2H B;  2VUM B;  2B2W C;  3SDZ A;  3T56 B;  3K57 A;  1ET9 A;  2F0P A;  3NPP A;  2K03 A;  3VYS A;  1SNQ A;  1EYD A;  2Q8R E;  4RGM A;  1UEA B;  5EBC A;  5JEA G;  3Q24 A;  4BBR B;  2WV6 D;  4CKB A;  2I46 A;  3ERQ A;  4C3I B;  3BYT B;  4A3G B;  4CKC A;  3NWT A;  5C5L A;  2FMC A;  3R93 A;  2F0D A;  4F7X A;  3S1M B;  2IX3 A;  3PUY A;  2B2T C;  3T53 B;  2EVB A;  1EY7 A;  1C4Q A;  2J7Z A;  4QIW B;  3VR4 A;  3H09 A;  5CMD A;  1S5E D;  1DXM A;  1F2Z A;  3BVZ A;  1D5X C;  4CHT B;  3LWU A;  4FF2 A;  1OXS C;  1SYB A;  1HCZ A;  2B2U A;  4C3I G;  4I7Z C;  1AEX A;  5ELC A;  3BVM A;  2E76 C;  3R2I A;  1ICW A;  4RCO A;  5DM7 3;  3O13 A;  2E75 C;  5A35 A;  2E2J B;  1HQR D;  4NDX A;  3A8J E;  3D3R A;  4S3S A;  2N88 A;  2K33 A;  1SYG A;  1OXX K;  1SE3 A;  1PZK D;  4MHE A;  4ZUI A;  3PMF A;  2M00 A;  4HSP A;  2XWJ B;  4A3I B;  4IUQ A;  5EKK A;  3C46 A;  3SK4 A;  4X3K A;  3GTJ B;  2F0H A;  3D8G A;  2DNC A;  1Q90 A;  4FXK C;  2VB3 X;  1A3V A;  1EYC A;  5E4X A;  5D3D A;  4LK1 C;  1ET6 A;  1NAP A;  3GO5 A;  2X6L A;  3DEO A;  3MTS A;  1PRT F;  2LFN A;  5EPJ A;  3I72 A;  2B2T A;  5C4X B;  2TMP A;  2PZU A;  1QOH A;  2K6A A;  1PDQ A;  1HQM C;  1CHP D;  1TWA B;  5JOB A;  2KED A;  1I4P A;  5KIX A;  3I4L A;  1ILQ A;  4CJ1 B;  1Q12 A;  3TN2 A;  2AQ3 B;  1B3A A;  2ZT9 C;  4ZKC B;  2A6H D;  1V1P B;  3D4W A;  4F8M A;  1O7Z A;  3TP6 A;  4BY1 B;  2V4D A;  4K5W A;  1OO9 B;  3H91 A;  4ID6 A;  1B44 D;  2EE1 A;  2X69 A;  2KUM A;  2GA4 B;  5EGT A;  1DOL A;  3VYT A;  2K32 A;  4NMZ A;  1GXD C;  1MSH A;  2EY6 A;  3N52 A;  3P7J A;  2LY7 A;  1G2T A;  2F0Q A;  4DAP A;  3E5S A;  1S5D D;  2XIW A;  2F0G A;  4H0L C;  3BYY B;  2NTS A;  2E2I B;  1T5X D;  1DCZ A;  1Y8P B;  1BCP C;  2PCF B;  2K28 A;  1TWF B;  4IUT A;  3F2U A;  1WTR A;  1WTP A;  2F0W A;  3J7A V;  2RDH A;  2OT2 A;  5A2Q E;  5LL6 X;  5J1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...