1LV9A

Cxcr3 binding chemokine ip-10/cxcl10
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
64
structure length
63
Chain Sequence
VRCTCISISNQPVNPRSLEKEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Small inducible cytokine B10
publication title The CXCR3 binding chemokine IP-10/CXCL10: structure and receptor interactions.
pubmed doi rcsb
total genus 10
structure length 63
sequence length 64
ec nomenclature
pdb deposition date 2002-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lv9A00
5E4XA 1DOLA 2RSOA 1WTWA 4HSVA 1DOMA 2L11A 2HDMA 1RHPA 4MHEA 4QUFA 1NCVA 5CORA 4NW2A 3TN2A 5DNFA 4IUPA 1LV9A 1NAPA 1RTOA 5JJZA 3I8ZA 2CVRA 1PFBA 3DEPA 2KUMA 4ZK9B 1SAPA 2X69A 1G91A 5CMDA 2VXWA 5T1GA 4HCSA 2KEDA 1CM9A 2DY7A 2NZ1D 2SDFA 5E4WC 2RSNA 1VMCA 2XIWA 1TVXA 2K01A 4RA8A 2K28A 2KEEA 1ILQA 1WD1A 1ML0D 2R3ZA 1Q3LA 1U4MA 1EQTA 1JE4A 1WTPA 1U4RA 2B2UC 4R8IA 2N55A 1AP0A 1DONA 4LMQD 4IURA 5CBAE 2L12A 4X3SA 2HDLA 1WTOA 1HA6A 2B2WA 1HUMA 1AZQA 1O7YA 3I90A 5AFWA 3TZDA 1S4ZA 4OIKA 5EPKA 4RWSC 2K04A 4RAUC 1A15A 4ZLTF 2B2YC 4X3UA 1BF4A 2FJ2A 1IKMA 1PLFA 1BNZA 1F9SA 2M2LA 4HEDA 4DN4M 1HFNA 3G7LA 2IL8A 4ZKCB 5CBEE 1F2LA 1ICWA 1U4PA 3DEOA 1HUNA 3UI2A 3SVMA 2NYZD 1ILPA 1HHVA 1M8AA 5T1IA 1PFNA 5EQ0A 2J7ZA 2EOTA 2FMMA 2B2WC 1BO0A 4X3TA 1F9PA 2HCCA 2MJ8A 3MWYW 4HAEA 1HRJA 4ZAIA 2FINB 4QUCA 2HUGA 2B2VA 1VMPA 1KNAA 1JICA 1WD0A 2B2TA 2KOLA 1G6ZA 2DY8A 1QG7A 3Q6SA 2BDNA 3ONAB 1EIHA 3IFDA 1B50A 1O7ZA 1HFGA 4XDXA 2D9UA 1U4LA 1G2SA 1MSHA 4MN3A 1MSGA 1EOTA 1MI2A 1B53A 1XYIA 2JYOA 1GUWA 4UAIA 3R93A 5D65A 1CA6A 2K03A 1WTRA 1B2TA 1PDQA 2H1EA 3GV6A 4IUUA 1B3AA 2X6GA 5EJWA 2B2VC 1IL8A 2B2TC 1SDFA 2L1BA 5EPLA 1KNEA 1SSOA 1NR4A 4OIJA 3MTSA 1DZ1A 2RVLA 5EPJA 1X32A 3I3CA 2KECA 1RTNA 2KVMA 1F9RA 1WVLA 5EKIA 3P7JA 1MGSA 1EIGA 1ESRA 3KUPA 1WTXA 1RJTA 4CJ0B 2L4NA 1WTVA 2X6LA 1O80A 2FHTA 1EL0A 3IL8A 1XX8A 2HCIA 4IUQA 4R9WA 2B2UA 3LWEA 1X3QA 1QE6A 1RODA 2MP1A 4U68A 1C8CA 1ZXTA 2L9HA 3D6WA 3FPUB 3HP3A 3QO2A 2RA4A 1J8IA 3H91A 4XT1B 1G2TA 3DM1A 4ZKBB 2EE1A 1NR2A 1E0BA 1AZPA 3N52A 1F9QA 4CJ2C 2N88A 1X3PA 2B2YA 1DOKA 2EPBA 2Q8RE 4IUVA 3I91A 3KBXA 2JP1A 4IUTA 4X3KA 1IKLA 1CA5A 2MPMA 1J9OA 2Q8TA 3FDTA 2FFKB 4CJ1B 3GV3A 3F2UA 2K1BA 2MGSA 2NWGA 4XT3B 1WTQA 1PFMA 5D14A 4O42A 1BBXC 1B4OA 5COYA 2K05A 1QNKA
chains in the Genus database with same CATH superfamily
2DN8A 3MFYA 4QGUA 2NVTB 2L11A 2UXDQ 2KHJA 5ELOA 1A8VA 4PMCA 1IBKQ 2F0NA 3V2TA 5JJZA 3T1HQ 2TMPA 2E74C 2RBMA 1N36Q 3WWVA 4N8FA 3ULJA 3EIVA 4PMBA 3GP7A 1V43A 3NPPA 4RKBA 5T1GA 3F2DA 2XWJB 1SYEA 5IP9H 1Y1VH 1TS5A 4OELB 2D0OA 4KY6A 1ML0D 1Q3LA 1JWMD 5M3FB 4POGA 2TSSA 1M90C 1FR3A 1C48A 5I4DA 3F2CA 3T1YL 5BN4A 3PO2H 2L12A 2R93H 1TWAB 4K5WA 2E5LL 4R8NA 2B2WA 3KLWA 2VS1A 3WDNA 3CF5A 4A3CG 1X54A 4X3UA 2VUMB 3ULLA 1IKMA 3EVQA 2LS01 4BBRB 1EFID 1SYDA 1M8AA 3STBD 5M5WH 1KAAA 2MO0A 3GTLH 2HHHL 2FMMA 3LX0A 5H1SE 3HKZE 4HAEA 4QUCA 3O13A 1JC7A 1BBUA 2F3VA 4LUZA 4GN4B 1E22A 3IFDA 3U4VA 4QIWB 1I6HB 2WB1E 3KJOA 2ZJPA 4NXMQ 1VF5C 2ZXPA 3RD4A 3HOUB 2CWAA 3HOXG 1B3AA 1PH9A 4B08A 4K6LA 1KIXA 3CC2A 1SDFA 1XXGA 2E2HB 2K50A 1JCKB 3HOVH 3TZUA 4DR6L 2CWPA 2KVMA 1CI3M 3FHWA 1CQFA 3KUPA 2E2JB 3EA6A 1W6JA 1VQPA 4IPDA 4APVA 4OWWB 4IUQA 4R9WA 1ONLA 4XQQA 1QVGA 3GTOH 2K5QA 1C8CA 3RLOA 1R9TB 1KXLA 4IZ8A 3J80L 3VDYA 2F3IA 1AZPA 1G8ZD 2YU9H 5JVG3 1A2UA 4CJ2C 3NQTA 2CFMA 3TP7A 4IPGA 4DUZL 5FLMH 2MPMA 1Q82C 2F0UA 2K1BA 1WTQA 1UUPA 3HOYG 4DU9A 3H0GH 3Q24A 2LKVA 5IGBA 1SNCA 1LV9A 1NAPA 4DV3L 1WI5A 3UE0A 1EZ8A 2VQFL 5LL6X 2QILA 5IYCH 1EY7A 1G91A 1LTAD 1GUSA 2SDFA 1VQFA 2NZ1D 5E4WC 1VQ6A 1XNQL 4CKCA 4GOPA 3M3YH 2RDFA 1A63A 1QJOA 2R7ZH 4GOPB 4C3IG 1QCBD 1TY2A 3OMCA 4K5VA 3QB3A 3CPFA 4OHJA 1B9NA 4FP5D 2NN6I 4DAVA 1NTGA 2F03A 5JAVA 5KGUA 3ULPA 2MO1A 1BNZA 1ENCA 4JOIA 5CBEE 4DV3Q 4F87A 4BXXG 4UY8C 2VQFQ 2QGQA 3HEJA 1HA5A 5CYUA 3FPPA 1TWHB 2RHSB 2HCCA 3ITPA 1XNQQ 4OO1H 4P72A 2CW0D 1GD7A 2PZWA 2H4OA 5A35A 3S1NH 2JA8G 3J7YW 4JI4L 1O7ZA 4LF6Q 3PF4A 1JOOA 3NTIA 3HOWG 4UPAA 2A68C 2WAQB 5IGEA 5ELBA 5M5XH 3I4LA 3DM3A 4KN4C 1JWUD 5EJWA 2R61A 4BY1G 2B2VC 2A1AA 4A3GH 2IT1A 1HNZL 3PO3H 4QQBX 4HSPA 4RMFA 5I9OA 2VQEL 5KEEA 3I55A 1ESRA 3JAML 2K7VA 5K36G 5M3MB 4ZCKA 1N33L 1MJCA 1S40A 2ZT9C 4ME3A 4N9TA 1LUZA 4NMZA 2A8VA 4JI4Q 4JI1L 1KDCA 2NVYB 1E0BA 1SNQA 3C1FA 4RGMA 1I4PA 5HY6A 1YI2A 2NVXB 5IYDH 5DLQE 2JP1A 3RLNA 2E76C 3FDTA 4HN7A 3F2UA 3EBEA 1YHAA 2XN9C 1SJHD 4JCVE 4M8AA 1IBML 2R6GA 5E4XA 3VR6A 2VQEQ 3P1HA 1Q8IA 4IFDG 1RHPA 4DF7A 4OO1I 1I4RA 1NMGA 3HRZC 3AB9A 4CDEC 1U0LA 3IFTA 2JA6G 4DAYA 4L63B 4RFBA 1PRTD 3C46A 2C35B 4DAYB 1Q7YC 5I2XA 4PZ8A 4PZ6A 1IYVA 2EYOA 3HS0C 4KKTA 5HGTA 1LTRD 1U9RA 3TQYA 4LF7L 5GAGC 2A69D 1Y1WB 5IGDA 4RH6A 1IBMQ 4UDUC 1I4QA 5CV7A 1BR9A 1XPUA 3TZDA 2YV5A 1D5MC 2LMCB 2K04A 1EIFA 2A73B 1PLFA 2EY5A 2VUMH 2PZTA 3A5UA 2K32A 1HUNA 2PW5A 2PMZE 4BBRH 3J80E 1PFNA 3UDFA 1VQGA 2KQ3A 1STBA 2B2WC 3I4NH 2K6AA 1JE5A 1NMFA 3U58A 1D7QA 4XXEA 3SK5A 4A3LG 2D0PA 5IIFA 3FKIB 3GTQH 3CRKC 4LF7Q 4RGOS 3SEBA 3I4MB 1X9NA 1IHZA 5D65A 3D4RA 4DR4L 4LFCL 1CA6A 4A3IG 4EGVA 1I94L 3HOUH 5CV6A 4KI0A 2Y0SE 1LO5D 1SSOA 2IHFA 1Z6HA 4OIJA 2E2HH 1CFMA 5FLXL 4A3EB 2EYPA 4R4CA 1WCMH 4IJHA 2EY6A 2EYMA 1BBWA 2OWOA 2E2JH 1YHQA 1TIID 1OXVA 2IY5B 1HTPA 4IOCA 2CH4W 4K14A 2MP1A 2F0GA 1R4PB 2PZUA 2RA4A 5KYIA 4A3BG 1V9PA 2EE1A 2AMCB 3GTJB 5K5PA 1I94Q 4A3DB 1KHIA 2Q8TA 3VYSA 4A3FG 4TSSA 1DOMA 2EYHA 2VW9A 4DV5L 4LF8L 3BYYB 1IYJB 1TU2B 2EYJA 5ELNA 3CC4A 5BR8Q 2CVRA 1PMRA 2KHSA 3SK6A 3HOYH 5CMDA 2F1MA 1KDBA 2KEDA 1N8RC 4MIUA 2XIWA 2B63B 1RD9D 2HT1A 1EY9A 1WFQA 1PH4A 5F2DA 2HIVA 3A54A 2YTYA 5C44B 4GKKL 1VCIA 1V1OA 2HD3A 4LNQA 3A74A 4PNYA 2PNHA 1SNPA 5IP9G 2E2IH 4UHVA 1Y1VG 3JAME 2ICEC 3AYHB 4RAUC 4DV5Q 2B2YC 1PTOF 1HQMC 5KIXA 4GOPC 1F9SA 1U4PA 3ICEA 3PO2G 2R93G 1SNMA 1HHVA 3T13A 5J3BA 3ERQA 3BJUA 4JI3Q 5AJ3L 1BO0A 1LT5D 5CR3A 2O5JC 1VMPA 5BN3A 4DV2L 3K7UC 1WD0A 1GUTA 5ISRA 3Q6SA 4WJ4A 1QVCA 4JOIC 1KDAA 4GKKQ 1TQOA 4JI8L 5CC4A 1P8LA 4JC0A 3KJPA 5IP7H 1P16A 5J1ZA 2KCTA 3VYRA 4OXPA 4IUUA 5D3DA 3RN5A 5I6YA 4LF9Q 1IL8A 2JA8H 1UEBA 3ZJYC 1ESFA 4RKLA 3HOZB 1HJPA 1SR3A 2Q2IA 2OT2A 4R1JA 2ICIA 5LMUQ 3IKJA 3RZDB 1F2YA 2G9HD 3RZOB 4AQYL 4BY7B 3HOVG 3M85A 1MIUA 2E75C 5BN5A 4Q5VA 2XTIA 4TVAB 5C4XG 3NBHA 3MC0B 4B9WA 5K36H 1YVCA 1X3PA 4IUVA 2NVXH 3NBHB 1XTDA 4PZ7A 2JA5B 1TWGB 2CHBD 4DV0L 1PH1A 2NWGA 2BE5C 1B4OA 4A4IA 1T5EA 1SE2A 1B1ZA 3TSSA 3CCJA 2XRQD 1NCVA 4B9XA 4AYBB 1VQ5A 4A76A 4RGNA 5C6AA 1HXYD 1L0XB 3TS0A 3QOLA 3G71A 1EY0A 2PI2E 3H0GG 2IHEA 3PIPA 3UDGA 4V190 1CQVA 4LF5Q 3S1RB 4F88A 1ENAA 2UU9L 4ZRZA 3G4SA 1D2BA 4CKBA 4DNTB 3NHHA 4I7ZC 4R4OA 5FLXE 4WJWA 1DONA 2JA9A 2C5CA 3I90A 1MKHA 1E2WA 2QDBA 5GAHC 5IODA 2UXCL 1T9HA 3PQIA 3QOJA 3K7AH 2R7ZG 2ASBA 1HPCA 1X65A 4H7BA 3CPWA 2IPKD 4JV5L 4Y7NB 2IWHA 1IYUA 2NBFA 4RGTA 4X3TA 3DXJC 1SYCA 3VR5A 1HRJA 4UP7A 1KNAA 3I2ZA 3OSOA 2NUCA 3J7AV 2QF7A 2Z8LA 1HNXQ 1EIHA 3GTPB 2F0HA 3V05A 2LXKA 1I50B 1SXTA 5KRUA 1B53A 1MJEA 2MFIA 1LT6D 3NUCA 3I4MH 5IY0A 4OO1G 1EZ6A 5GQOA 1EYAA 3U9SA 1WTRA 1PDQA 4C3HH 4A3LH 4A93G 1SMYC 1STNA 5CV4A 2ES2A 5KNCA 1HZBA 1UE5A 3J7ZC 2A74C 4Q0FA 4A3EH 3KF8A 1WTXA 3S17B 1D5ZC 3L7ZC 2XRSD 3BDCA 3AMUA 3KF8B 3W1BA 4A3GG 1OXXK 1STYA 2RKSA 3PO3G 3S2DH 3UDXA 1JJ2A 4YCWA 3D6WA 2PQAA 4O2DA 3T16A 1L0YB 3MEFA 4FO2A 4KTAA 5JOBA 2PQAB 1LTLA 4K8JA 1CT1D 1DOKA 3K81C 2F0LA 3NTKA 4L8JA 3D3RA 4JI6L 1TT2A 2EJFC 3RUZA 1X6OA 1ZEQX 2EXDA 4O42A 3AU7A 4ZK9B 4HJAA 4YIJA 2RSOA 4ID6A 2BE5D 2JA7G 3SGIA 5IYDG 5DNFA 1GUGA 1PTOB 3OOCA 4KLKA 2N3SA 2PPBC 2RDHA 5IT9c 4LF4L 2NTTA 4DUYL 5IYBG 3Q22A 2ZJRA 2G9DA 1VDZA 1VMCA 4YCVA 2B63H 3M9BA 5EKKA 5C0XI 1U4MA 4GZYC 1JE4A 4K8IA 4DGZA 1SN8A 3J7AF 2R92B 1L1OA 4DNRB 1CKOA 1Y8OB 4H02A 3M4PA 1Z9FA 3QWNA 3CCMA 2RHQB 1L1OB 1S4ZA 2AHOB 1RIPA 3Q0AA 1KQSA 5M3FG 2KJXA 2HIXA 5FO8B 1D8LA 1ET9A 4DV6L 1UE6A 1FYCA 2WACA 2EVBA 1GOZA 1RCVD 2J7ZA 4RCNA 3HKZB 1F9PA 3MWYW 2C9OA 4JI2L 4KD4A 2VUMG 3S9WA 5C0XJ 3LWUA 3ONAB 2D5DA 4BBRG 4YCUA 4EQPA 2WB1B 1EEFD 4KKSA 4WRDA 1EOTA 1KAWA 1MI2A 1VQJA 4JI7L 4GNXA 4UAIA 1GUWA 3I4NG 3R93A 2F0JA 1AH9A 4E6IA 1GM5A 1I4XA 2O2LD 1GXDC 5JVH3 4GNXB 1K8MA 2X6GA 1K9MC 1VQMA 2F0TA 2EIFA 4TQUS 3P75A 4DV6Q 2WP8J 4WFN3 4IQZA 1EIGA 3KLSX 2HQEA 1PH3A 4CDFC 4BWGB 3HOUG 5D3IB 1SBBB 3IL8A 4JI2Q 3RZDH 3FVQA 3RZOH 3CCQA 3T1YQ 2E5LQ 1WCMG 3P20A 2BA1A 2RDGA 4X65L 4POFA 4CKEA 1ASYA 3H09A 1Q86C 1UAPA 3I70A 5CV9A 2ZJQA 5C4XH 2HHHQ 2NN6H 1HZ9A 2HDMA 3E9HA 3J81L 4KJOA 4MHEA 1DJRD 1EWIA 3VR3A 3TN2A 5CV8A 2EYLA 1RTOA 3KLRA 1TWCB 1XNRL 1MD2D 1H9KA 4C3JH 5ELEA 2KHIA 5FO7B 5C4JB 2K01A 4JI0L 5NUCA 4X65Q 2Z1CA 3S1RH 3QIAA 2AUJD 3NEMA 1U4RA 3A8IE 2N55A 4AIMA 4H0LC 4DR6Q 3OMGA 2GN5A 2OQ0A 2B8GA 1IZ6A 3OW2A 4OIKA 5FJ8G 2I0QA 2JK8A 1EYGA 4KY7A 5IE8A 3AFQA 1B44D 1PVOA 1VQAA 4DR5L 2N49A 1K83H 4FDBA 1W6KA 4TRDA 1XNRQ 3MXGA 4AH6A 2ENBA 5EQ0A 5LL6S 2D62A 2ZM6L 1JWSD 3EROA 1NUCA 3PMFA 4BA2I 4B3ML 3TMEA 4DUZQ 1RDPD 2DJFC 4LFBL 4GLVB 1R4QB 3BYTB 1D6EC 4C1NK 3C3LA 3GTGB 1TR5A 2ZTCA 3GTPH 4IPCA 2AQ2B 3PUVA 3X3NA 3K6OA 4MN3A 5JJLA 2ALYB 3VA7A 3I72A 1VQNA 1K3BC 1A62A 4OWTB 2H1EA 5G3LF 3RLFA 3N6RA 1Q90A 1GO3E 1SE8A 1KNEA 1AE2A 4L6TB 5IP7G 3ER0A 4DR3L 1N32L 2WAQG 1VQKA 1RJTA 4CJ0B 2EYFA 3S17H 4A93H 1LT4D 4PV1C 1EYDA 4EQ5A 4YHHL 1AN8A 4JI5L 4KHVA 3CMEA 2F0VA 2FXQA 2IW3A 4ILWA 3S24A 4C3IB 1V1QA 4WJ3M 5HGQA 1N34L 3S2HB 1XJVA 2WFWA 5C4HA 4QL5A 2FFKB 1STHA 2EQSA 1HCZA 1UNSA 1KTKA 1VQEA 2RQXA 4QMGA 1WTWA 3PIO3 3BG3A 4DR3Q 2OXPA 2OQKA 1ZYRC 5LMNL 3NENA 3QR8A 1PTOH 3I8ZA 3DWQA 1PH6A 4YHHQ 1H9JA 1SYFA 2Q8IB 4JI5Q 4DK1A 1Q1BA 2K5HA 1A0IA 1LACA 2Z6KA 2JA7H 1VQHA 2RSNA 3A5ZB 2K28A 1YNNC 1PTOC 2KCMA 5C3WA 2B39A 4DV7L 2F0EA 4DR1L 4MZ9A 3I73A 2GVAA 4A3MB 1HNZQ 4J15A 4R8IA 1KRSA 1NJIC 2VNUD 4L5RC 5IYBH 2NVTH 4HR7B 1VF7A 1VQCA 5EPKA 2A6HC 1A15A 2LY7A 2WAQE 4QF4A 1N33Q 4C1NI 3TDQA 3S1QB 1IBLL 1CKNA 2IL8A 1ENFA 2NYZD 1SE4A 4JI1Q 2CCZA 1CKNB 4BBSB 2OCEA 1BCPB 1Y1WG 1L1OC 4FNFA 2FINB 2Z4HA 3M7NA 5M3FH 1YIJA 2N78A 4FYDA 1ET6A 3BU2A 2QKIC 4DR1Q 1E2ZA 3K5OA 4WORA 1F2MA 2IX1A 1TWAH 1Z47A 1XMOL 4BS9A 2JYOA 3J81E 2F4VL 3MAQA 2Q2HA 4FF4A 3S1MB 2Y0SB 2CH4A 1IBLQ 3SE0A 3MTSA 2J4XA 3K59A 5KYLA 1M1KC 3W3AA 2CQOA 1I4GA 3I4MG 3F1ZA 4GNXC 1QZHA 2L4NA 1H9SA 5IGCA 4C3HG 5C0XG 3GTMB 1Z7TA 3K5MA 1QWYA 1JB3A 2B2UA 1H9SB 1JJCB 3ERSX 1SE3A 2Z9HA 1JR0D 1T5XD 1I6HH 1J8IA 1JORA 1C4QA 3RNUA 4A3EG 4JK1C 2BDOA 2A68D 1AFPA 4GKJL 3K8AA 3HFZB 1A6XA 3KBXA 3UDIA 1TS3A 1J9OA 3GV3A 1LM0A 1QNKA 4JBKA 5COYA 4FVMA 4KV6A 4HSVA 1DGSA 4GN5A 4R4IA 5IOCA 1YNJC 3I56A 4FF2A 3DLLA 4A3DG 1EFWA 1B9MA 1FGUA 3MXPA 3ZYYX 1R9TH 1SAPA 2I07B 3KYHC 1TWFB 5FKAC 1JJGA 3NELA 2DY7A 1Y69U 4DR4Q 2QDLA 4LFCQ 5M5YB 2KEEA 3BZCA 2F0FA 1H95A 4A3IB 1GUOA 1E1OA 3GD7A 1TS4A 3X3MA 1HA6A 1CZGA 5DM63 1C7YA 1GHJA 4RHSA 1AEXA 2B63G 1CSPA 2D2CC 2YTXA 1FNWA 2QW7A 4UP8A 4PQXA 5C3EB 4DXGA 3DUZA 3NK9A 2EY1A 4CHTB 3G48A 1GHKA 2EOTA 4OL7A 5FJ8H 1G6PA 1ASZA 4G7ZC 1QG7A 1EEID 4X62L 2B29A 3G6JB 1D1IA 1EY4A 3H6MA 4K6DA 3GTGH 1QZGA 3FMCA 1CSQA 2CQAA 4LF8Q 3AEVA 1Q8KA 1VQIA 3OWEB 2UUCL 3D8GA 4KD3A 4KHPL 3BS1A 1PH2A 5ELFA 1NR4A 2LFNA 4X66L 4KMUC 2KECA 1TWHH 1MGSA 1YEZA 1N9WA 4JVZA 1EY5A 3DWPA 3K80C 1VQ4A 1X3QA 4X62Q 4CBVA 1L0WA 3HOZG 3CCLA 2QA4A 1TS2A 2UUBL 4IUTA 4GLAC 2F3WA 2UUCQ 4KHPQ 4G7HC 1JMCA 2F0PA 2NVQB 3CAMA 2VZAA 4KJNA 5FO9B 5D14A 3QG1A 4HIOA 1EQTA 1Y8NB 5EKIA 1BBXC 1EY8A 4PG3A 3M4YA 2QEJC 5AJ3Q 5EKLA 1UWVA 2MUYA 5M3MH 3L3OC 2PI2A 4DV2Q 2E8GA 3J80c 3C2PA 3GTKB 2BCOA 2XWBB 2JA5G 2EDGA 4R4QA 4QB4A 2DGYA 2XGTA 4JI8Q 1BXTA 1FNUA 5M5WB 2NVYH 2NN6G 3TP6A 2ZXRA 4NDXA 3K57A 2LXJA 3H3VH 1XPOA 1HTLD 1TVXA 4FXKC 1EIYB 4AYBG 1CZWA 4CDDC 5I9PA 4DV4L 1LTSD 1CKMA 1F77A 1II3A 2XSCA 2QEXA 4C3JG 2JE6I 5CBAE 1Q81C 1X3FA 3H3VC 3CW2C 4MNOA 4KN7C 4RWSC 3PCOB 1QOHA 4AQYQ 1XMQL 4ZKCB 3E3XA 1XPRA 1LTBD 3HOVB 1Q1EA 3CKIB 3H94A 4BBSH 4LK1C 4HMIA 1LYLA 2GVBA 3NP8A 2MJ8A 4JBJA 2HUGA 3CXCA 1ZKOA 3CU7A 4HJ8A 4DV0Q 1I4HA 1OXSC 4CDCC 1BCPC 3I7FA 4Z9CB 2D9UA 5HURA 1Y1WH 3PUZA 3CCSA 2K5NA 3A8KE 4C2MB 1PA6A 3CC7A 2F0MA 2DUDA 3AFPA 3SHLA 1STGA 3KFUA 3R2IA 1XMQQ 5EGTA 1K73C 1WOCA 4MTKA 1PRTB 1X32A 1F9RA 1J5EL 5CGKA 1KLUD 3H3VI 4LWCA 3S15B 1MHWC 2UU9Q 5E3FA 4AYBE 1BQQT 2JQOA 3GO5A 5IGFA 1WYDA 4K0KL 1RODA 3FKIH 1DD2A 3D4WA 2L9HA 3KF6A 3H91A 3A56A 2CKZB 1E24A 4GS3A 3KF6B 3Q23A 1Y8PB 3MZ5A 4J6HA 5C0XH 1BOSA 2EPBA 2UXCQ 4ME5A 1X55A 2I46A 2PQEA 2R7ZB 4JV5Q 3WOEA 1RKNA 4A3JB 1D1KA 5ELCA 2F0KA 3PF5A 3SR1A 1A3TA 3K0YA 1K8AC 4QUFA 1YJ9A 3NBIA 4LAAA 1S5ED 3STBC 1NSNS 1TWFH 3AQQA 3GTJH 1S5CD 4IFDI 1W3SA 4A3DH 1AE3A 2ZTEA 4EVOA 3HKSA 1WTPA 3S1NB 1AP0A 1HZAA 1YZ6A 1GJXA 3TREA 2F4IA 1SFOB 1VQBA 1O7YA 2RF4A 3MHBA 1K8GA 5M5XB 1EY6A 5KNBA 1OO9B 2F0WA 4HMJA 5JJIA 2BA0A 4A3GB 3ND9A 3UI2A 5C3EH 1E1TA 1S5FD 1ILPA 3HGBA 4K5XA 3CHBD 2UXBL 4DFAA 4G4KA 5A2QL 1YJNA 2UXDL 1LLRD 5DM73 4JI6Q 3W5OA 4IFDJ 2EZVA 1EYCA 5C44H 3WOFA 2RCNA 1B50A 1N36L 3KDFA 1U4LA 1O7IA 4A3KB 2KBNA 3MXUA 1XYIA 3HKZG 3KDFB 3SXHA 3EFXD 2ZTDA 1K8OA 3KLSA 2WB1G 3OTOL 4LF4Q 4DUYQ 1WVLA 1EU4A 2UXBQ 1O7LA 3KOJA 1QNUA 1U5KA 1WTVA 1S72A 1C0AA 2JSOA 2SEBD 1PHJA 1IL2A 3TP5A 1SNOA 3KBGA 1VQ7A 3HP3A 3NQIA 4L5QA 1G2TA 2YTVA 3FEWX 3J81i 2SNSA 4RG1A 1F9QA 5FLXc 2NTSA 4B3RL 1E3PA 1IKLA 2I5HA 2I5MX 2ZXOA 3BDOA 1SLJA 1UE7A 1VQ9A 1SMYD 3J80i 1BCPF 2NVQH 2MGSA 1EQVA 1LT3D 3HOZH 1EWCA 3E6ZX 3OTOQ 1QVFA 1TY0A 2B8FA 5EBCA 4R4TA 4NXML 2OTJA 1PV4A 4BY7H 3GTKH 1HR0L 1BVSA 4N9PA 2X69A 3A55A 3OIQA 4F7XA 4JI7Q 3L0OA 2R7FA 5JEAJ 3U50C 4HCSA 3SK8A 1LTID 1VQLA 3I4NB 2CW0C 4OX9L 2EY2A 4XYQA 1WD1A 2WKDA 3PV0A 4B3RQ 2JA5H 1TWGH 2JEAI 5DAUA 3CD6A 5C4ZA 3GTQB 3BZKA 1EQQA 2KCNA 2B3GA 5AFWA 2KENA 1NNXA 3CP0A 3A7AB 4LJZC 2PO4A 1BF4A 2FJ2A 4H44C 2O5IC 2M2LA 5ELDA 2LSSA 1UEAB 4JG2A 2IX3A 1HR0Q 3NWTA 1FD7D 3DHQA 3M7GA 1G291 1SEBD 1WCMB 2JXMB 4IO9A 4EQOA 1JT8A 3HOXB 2PNRC 2XNAC 4QJFA 4OX9Q 1C9OA 1Y14B 2B2TA 2KOLA 2DY8A 3NXWA 4KK7A 3BDLA 5G3LD 2Z6BA 2NZHA 4QIWE 4XDXA 5GAEC 4C2MH 4NB3A 4YWKA 3H15A 1VS0A 1HH2P 3GV6A 4DK6C 1D5XC 4Y7NH 3I3CA 3W2DA 4F8MA 2G5DA 1SYBA 3P7JA 3T56B 1DM0B 2F0SA 2A5HA 4O1NA 4P75A 4JI0Q 2K5VA 4KKUA 3S15H 1DCZA 4IN3A 1XX8A 2HCIA 1NBWA 2DNCA 1PRTC 1ZXTA 3K5LA 1CK1A 1OTCA 4XT1B 3K58A 3HOYB 1I50H 3JAMi 1NR2A 4EX5A 2BH8A 2JN4A 2N88A 2B2YA 2Q8RE 1M4VA 1YJWA 3T4AC 4DR5Q 4CJ1B 3S16B 2A69C 4XT3B 4DXFA 1PFMA 4LF6L 1E7ZA 1FJGL 5JPMC 4A3JH 2ZM6Q 4DAPA 5A2QE 2E2IB 4B3MQ 2R7DA 5CORA 4P2CB 4LFBQ 4GN3B 1NY4A 4FF1A 1PXUA 4DK0A 2VXWA 1E2VA 1KABA 1S5DD 3HZXA 1J6QA 5M3MG 4B3TL 4JBWA 2JJQA 4UP9A 1IW7C 3NTHA 2R3ZA 1PYBA 3OHXC 1LTGD 3CQZB 2Q2TA 4LMQD 1KD1C 4X3SA 2YYZA 4JBMA 3TRZA 3VR4A 1FJGQ 1N32Q 1IXRA 1SFOH 2F0QA 3CMAA 2F52A 3BVZA 3EJIA 3OPOA 3OYYA 4ULLA 4A3MG 3G7LA 1I3QB 3NWSA 2K33A 3DEOA 2JA8B 4QCLA 3SVMA 2AWOA 5T1IA 4YWLA 1N34Q 3HOWB 2OF1A 2VB2X 1FL0A 1LABA 4B3TQ 4ZAIA 3R3OA 2BH2A 1XTCD 4BY1B 4IUNA 2BDNA 2R92H 4LUVA 4CGYB 4BBSG 1G2SA 1SYGA 4C56C 4OONA 3IAYA 4A3KH 1YBYA 4J1MA 2DJGC 3S14B 4ZYSA 5LMNQ 2PMZB 4XYOA 4BA1I 2PYKA 2RVLA 4S3SA 4L5TA 3L9AX 2KA7A 3NSWA 1HR0W 4ODGA 2K4KA 4DV7Q 1EL0A 3CCEA 3J81j 4HCEA 2Y0SG 3A0JA 2J0TD 4U68A 4ALPA 1HNWL 3K5NA 4N8X1 3DM1A 1JB7A 1WJJA 4IJLA 1EQRA 5J39A 4LUOA 1AW7A 2Z0SA 3I91A 1SMXA 3F2BA 5IT9L 1BDOA 3FKIG 3MVVA 4HJ5A 2JA6B 1BKBA 3U4ZA 2F0DA 3TBIB 1WTHA 3BVMA 2QCPX 4ZKBB 4NPSA 3RN2A 4IPHA 1KLGD 4IALA 4B3SL 1PZKD 3D6CA 4NW2A 2WIIB 3K7AB 2AUKA 1JOKA 1LTTD 4OWXB 1PH7A 3OW7A 3DEPA 2IX0A 2KUMA 3Q8DA 5FOBB 3L2PA 5IWAL 1XMOQ 1HNWQ 2L0CA 2F4VQ 3TEHB 5I6WA 4HIKA 4A3CH 2K5WA 5J22A 3D31A 1O78A 3G6EA 1ILQA 4H13C 1VQ8A 1PRTF 1IW7D 3GDEA 1EU3A 3PGZA 3PIP3 3C1EA 1WTOA 1AZQA 3JC66 5JJKA 2SOBA 3MFGA 4B3SQ 4ZLTF 4DV1L 4ZQ3A 4TKOB 1HQRD 4GLXA 1X3GA 4C3HB 1ZYRD 1TWCH 1DXMA 1ICWA 5JEAG 2XVSA 1H9MA 4ZUIA 4U673 4Y52H 1S3OA 3SDZA 5IWAQ 2EJMA 2K52A 3EQLC 3LGJA 5C4JH 1K0SA 4RCOA 4GKJQ 1H9RA 5GADC 3OIPA 1JICA 3HOXH 1YNND 1PTOD 3BVGA 1PZJD 3PSIA 5C3EG 5BR8L 3S2DB 2MHVA 4JYAL 1HFGA 1MSHA 3EN2A 1MSGA 1VQOA 2VY3A 4KY5A 2V1CC 2AWNA 4DV1Q 2A6HD 1A2TA 1CUKA 1SRUA 4EQNA 5C44G 2WINB 2L1BA 2B2TC 3D4DA 1B70B 4A3BB 4HIMA 1RTNA 3M4QA 5GROA 2A6EC 3I4OA 4JPBW 3T51B 1B8AA 3MA2B 1RL2A 2X6LA 4YY3L 2GA4B 3M4OB 3NE5B 1SJED 1NE3A 1QE6A 3FPUB 4A3FB 4JYAQ 1KC8C 3MXNA 1W2BA 3KK7A 4JI3L 1JQYD 1PZID 2KCCA 2PW7A 3PIOA 4A75A 3MXNB 1CHQD 3HG9A 1CA5A 5EBDA 3BZDB 1RF2D 1L2FA 3GQBA 4P74A 5E1FA 3FRPB 3S16H 2H5XA 2K14A 2K75A 5LMNW 1DOLA 3MEHA 2L5TA 3CCUA 1CTMA 3VYTA 3E5SA 4K2KA 4IUPA 4X64L 5C3XA 4YY3Q 1A3VA 4LF9L 1QUQA 1PFBA 4K2LA 1F2ZA 1K0RA 4C3IH 1QUQB 3S2HH 1EOVA 1FGBD 5M9OA 3CCVA 1Y1VB 4RA8A 4DK3C 1UE1A 3VR2A 1YNXA 4PMWA 5LHY1 1A3UA 4IOAA 5LMUL 4OEMB 1STAA 4P71A 4BY7G 3J81c 4X66Q 3CQZH 3PO2B 2MQHA 4BXXH 2R93B 4IURA 3VYUA 4ABNA 3QJYA 4HTHA 5I2YA 4G57A 3TS2A 1B7YB 1X3EA 3URYA 1QILA 3UE1A 1YNJD 4X64Q 3TP8A 2O4XA 1X56A 1I3QH 5DEHA 2E2DC 3J7A5 3GTLB 3OWFA 1V8QA 2DNEA 1GUNA 3F8TA 3HOWH 3D0FA 5L37A 2UUBQ 1BUVT 4XQJA 1I5FA 2M00A 5IT9E 3A8JE 4A3MH 1G6ZA 4KHZA 3VA5A 4BY1H 4ZUJA 5EAYA 4NKLA 3T53B 2AQ1B 1OXTA 2Z6KC 4DR7L 1JOQA 1K28A 2EXZA 2RCFA 2V4DA 3S14H 1EUJA 1PYSB 4LF5L 2SNMA 1B2TA 3S1QH 4XQNA 2WV6D 5TSSA 2VB3X 5EPLA 3W1GA 5EPJA 5KNDA 4DR2L 1PH8A 4L5SA 5C4XB 2HQLA 1STEA 2A6ED 4DV4Q 2L55A 2PCFB 1O80A 4DNIA 3GTOB 1S5BD 1V1PA 3CRLC 3DMUA 5FLMG 3LWEA 1XWEA 3V96A 2P5ZX 1I6VC 2AKWB 1V1PB 1PYWD 4LFAL 2F0IA 2IJ0A 2WKCA 4C3JB 3FP9A 2YU9B 4FXDA 1KL9A 4IFDH 4XTCS 4DR7Q 2N8NA 3E9IA 2OTLA 4X3KA 1DYQA 3S1MH 1KRTA 1YITA 4X6AH 3A7LA 1TKWB 1HNXL 5E7NA 3U9OA 3E0EA 2JA6H 5IYCG 2K05A 3H0GB 4M1UB 4YWMA 4DR2Q 1MBYA 1PH5A 1TXYA 3PUYA 3GTMH 3B6YA 4V0BA 4DAMA 5CV5A 4FXGC 4I65A 3K0XA 3IRBA 1OXUA 1K83B 4A3JG 4HJ9A 4LFAQ 5C5MA 1CM9A 2ATWA 4LW1A 1QB5D 3M3YB 1FNVA 2OEOA 3DWAA 3JAMc 2B2UC 2Q2UA 1Q46A 3R8BA 4G7OC 5C5LA 2HDLA 3ND8A 3RR5A 4MTNA 5JPNC 1J5EQ 1HUMA 1VQDA 4NP5A 4FF3A 1SROA 1HZCA 2Z4IA 2NB0A 4XIGS 4HEDA 4DN4M 1HFNA 4DA2A 4HJ7A 2A19A 4K0KQ 1F2LA 3CCRA 1CHPD 1GKHA 2ID0A 3PUXA 1FVIA 1YHBA 2UUAL 1ICFB 5FK9C 4NXNL 5M5YH 4I7AA 4QY7A 2B2VA 2JEBI 2M9VA 4A3IH 4A93B 3PUWA 5JEAH 4O0AA 5IGGA 2AQ3B 4RHRA 1EWHA 2EJGC 2K03A 4JW0A 1GVPA 3PO3B 4P73A 2F0OA 4J8QA 2R92G 2K5DA 1DZ1A 4DKAC 1K3RA 4A3BH 4A3KG 3R2TA 2UUAQ 1Q12A 2L15A 4NXNQ 1IBKL 1B3QA 2FHTA 3RMHA 3T1HL 3E0JA 1SNDA 3M4OH 2BOSA 2FMCA 3QO2A 1PFSA 4A3FH 1BCPD 4DPGA 3N52A 2JA7B 2VL6A 2I5LX 4OGQC 4HIDA 2MNAA 2NZOA 3SK4A 1G51A 3LNNA
chains in the Genus database with same CATH topology
2DN8A 3MFYA 2NVTB 2L11A 4PMCA 2F0NA 3V2TA 5JJZA 2TMPA 2E74C 2RBMA 4PMBA 3GP7A 1V43A 3NPPA 4RKBA 5T1GA 2XWJB 1SYEA 1TS5A 4KY6A 1ML0D 1Q3LA 1JWMD 5M3FB 2TSSA 1FR3A 1C48A 5I4DA 5BN4A 2L12A 1TWAB 4K5WA 4R8NA 2B2WA 3WDNA 4X3UA 2VUMB 1IKMA 3EVQA 2LS01 4BBRB 1EFID 1SYDA 1M8AA 1KAAA 2FMMA 3LX0A 4HAEA 4QUCA 3O13A 1JC7A 2F3VA 3IFDA 4QIWB 1I6HB 1VF5C 2ZXPA 3RD4A 3HOUB 1B3AA 4B08A 4K6LA 1SDFA 1XXGA 2E2HB 1JCKB 3TZUA 2KVMA 1CI3M 1CQFA 3KUPA 2E2JB 3EA6A 1W6JA 4IUQA 4R9WA 1ONLA 4XQQA 2K5QA 1C8CA 1R9TB 4IZ8A 3J80L 1AZPA 1G8ZD 5JVG3 1A2UA 4CJ2C 3NQTA 3TP7A 2MPMA 2F0UA 2K1BA 1WTQA 1UUPA 4DU9A 3Q24A 2LKVA 5IGBA 1SNCA 1LV9A 1NAPA 1EZ8A 5LL6X 2QILA 1EY7A 1G91A 1LTAD 1GUSA 2SDFA 2NZ1D 5E4WC 4CKCA 2RDFA 1QJOA 4C3IG 1QCBD 1TY2A 3OMCA 4K5VA 3QB3A 4OHJA 1B9NA 4FP5D 2NN6I 4DAVA 2F03A 5JAVA 5KGUA 1BNZA 1ENCA 5CBEE 4F87A 3HEJA 1HA5A 5CYUA 3FPPA 1TWHB 2HCCA 3ITPA 4OO1H 2CW0D 2PZWA 2H4OA 5A35A 3J7YW 1O7ZA 1JOOA 3NTIA 2A68C 2WAQB 5IGEA 5ELBA 3I4LA 4KN4C 1JWUD 5EJWA 2R61A 2B2VC 2IT1A 4HSPA 5I9OA 5KEEA 1ESRA 3JAML 2K7VA 5K36G 5M3MB 2ZT9C 4N9TA 4NMZA 1KDCA 2NVYB 1E0BA 1SNQA 3C1FA 4RGMA 1I4PA 2NVXB 2JP1A 2E76C 3FDTA 4HN7A 3F2UA 2XN9C 1SJHD 4M8AA 2R6GA 5E4XA 3VR6A 3P1HA 1Q8IA 4IFDG 1RHPA 4DF7A 4OO1I 1I4RA 3HRZC 3AB9A 3IFTA 4DAYA 4L63B 4RFBA 1PRTD 3C46A 5I2XA 1IYVA 2EYOA 3HS0C 4KKTA 5HGTA 1LTRD 1U9RA 2A69D 1Y1WB 5IGDA 4RH6A 4UDUC 1I4QA 5CV7A 1BR9A 3TZDA 1D5MC 2LMCB 2K04A 2A73B 1PLFA 2EY5A 2PZTA 2K32A 1HUNA 2PW5A 3J80E 1PFNA 2KQ3A 1STBA 2B2WC 2K6AA 4XXEA 3SK5A 5IIFA 3FKIB 3CRKC 4RGOS 3SEBA 3I4MB 1IHZA 5D65A 3D4RA 1CA6A 4EGVA 5CV6A 4KI0A 1LO5D 1SSOA 1Z6HA 4OIJA 1CFMA 5FLXL 4A3EB 2EYPA 2EY6A 2EYMA 1TIID 1OXVA 1HTPA 4K14A 2MP1A 2F0GA 1R4PB 2PZUA 2RA4A 5KYIA 2EE1A 3GTJB 5K5PA 4A3DB 2Q8TA 3VYSA 4TSSA 1DOMA 2EYHA 3BYYB 1TU2B 2EYJA 2CVRA 1PMRA 2KHSA 3SK6A 5CMDA 2F1MA 1KDBA 2KEDA 4MIUA 2XIWA 2B63B 1RD9D 1EY9A 5F2DA 3A54A 5C44B 1VCIA 1V1OA 4PNYA 1SNPA 3JAME 2ICEC 4RAUC 2B2YC 1PTOF 1HQMC 5KIXA 1F9SA 1U4PA 1HHVA 1SNMA 3T13A 3ERQA 1BO0A 1LT5D 5CR3A 2O5JC 1VMPA 5BN3A 1WD0A 1GUTA 5ISRA 3Q6SA 1KDAA 1TQOA 5CC4A 5J1ZA 3VYRA 4IUUA 5D3DA 5I6YA 1IL8A 1ESFA 4RKLA 3HOZB 2OT2A 2ICIA 3IKJA 3RZDB 1F2YA 2G9HD 3RZOB 4BY7B 3M85A 2E75C 5BN5A 4Q5VA 3NBHA 3MC0B 4B9WA 5K36H 1X3PA 4IUVA 2JA5B 1TWGB 2CHBD 2NWGA 2BE5C 1B4OA 1T5EA 1SE2A 1B1ZA 3TSSA 2XRQD 1NCVA 4B9XA 4AYBB 4RGNA 5C6AA 1HXYD 1L0XB 3QOLA 1EY0A 4V190 1CQVA 3S1RB 4F88A 1ENAA 4ZRZA 1D2BA 4CKBA 4DNTB 3NHHA 4I7ZC 5FLXE 1DONA 4WJWA 2C5CA 3I90A 1E2WA 2QDBA 5IODA 3QOJA 1HPCA 4H7BA 2IPKD 4Y7NB 2IWHA 1IYUA 2NBFA 4RGTA 4X3TA 3DXJC 1SYCA 3VR5A 1HRJA 1KNAA 3OSOA 2NUCA 3J7AV 2QF7A 2Z8LA 1EIHA 3GTPB 2F0HA 3V05A 1I50B 1SXTA 5KRUA 1B53A 1LT6D 3NUCA 4OO1G 1EZ6A 1EYAA 3U9SA 1WTRA 1PDQA 1SMYC 1STNA 5CV4A 5KNCA 2A74C 4Q0FA 3KF8A 1WTXA 3S17B 1D5ZC 3L7ZC 2XRSD 3BDCA 3AMUA 1OXXK 1STYA 2RKSA 3D6WA 3T16A 1L0YB 4FO2A 4KTAA 5JOBA 4K8JA 1CT1D 1DOKA 2F0LA 3NTKA 4L8JA 3D3RA 1TT2A 2EJFC 3RUZA 1ZEQX 4O42A 3AU7A 4ZK9B 4YIJA 2RSOA 4ID6A 2BE5D 5DNFA 1GUGA 1PTOB 3OOCA 2PPBC 2RDHA 2NTTA 3Q22A 2G9DA 1VDZA 1VMCA 5C0XI 5EKKA 1U4MA 4GZYC 1JE4A 4K8IA 4DGZA 3J7AF 2R92B 4DNRB 1Y8OB 3QWNA 1S4ZA 3Q0AA 2KJXA 5FO8B 1ET9A 1FYCA 2WACA 2EVBA 1GOZA 1RCVD 2J7ZA 4RCNA 3HKZB 1F9PA 3MWYW 2C9OA 4KD4A 3S9WA 5C0XJ 3LWUA 3ONAB 2D5DA 4EQPA 2WB1B 1EEFD 4KKSA 4WRDA 1EOTA 1MI2A 1GUWA 4UAIA 3R93A 2F0JA 4E6IA 1I4XA 2O2LD 1GXDC 5JVH3 1K8MA 2X6GA 2F0TA 4TQUS 3P75A 2WP8J 4WFN3 4IQZA 1EIGA 3KLSX 2HQEA 4BWGB 5D3IB 1SBBB 3IL8A 3FVQA 3P20A 2BA1A 2RDGA 4CKEA 3H09A 1UAPA 3I70A 5CV9A 2NN6H 2HDMA 3J81L 4KJOA 4MHEA 1DJRD 3VR3A 3TN2A 5CV8A 2EYLA 1RTOA 3KLRA 1TWCB 1MD2D 1H9KA 5ELEA 5FO7B 5C4JB 2K01A 5NUCA 2Z1CA 3QIAA 2AUJD 1U4RA 3A8IE 2N55A 4H0LC 3OMGA 2B8GA 4OIKA 4KY7A 1B44D 1W6KA 4TRDA 3MXGA 2ENBA 5EQ0A 5LL6S 2D62A 1JWSD 3EROA 1NUCA 3PMFA 4BA2I 3TMEA 1RDPD 1R4QB 3BYTB 1D6EC 4C1NK 3C3LA 3GTGB 1TR5A 2AQ2B 3PUVA 3X3NA 3K6OA 4MN3A 3VA7A 3I72A 2H1EA 5G3LF 3RLFA 3N6RA 1Q90A 1KNEA 4L6TB 1RJTA 4CJ0B 2EYFA 1LT4D 4PV1C 1EYDA 1AN8A 4KHVA 2F0VA 2IW3A 4C3IB 4ILWA 3S2HB 5C4HA 2FFKB 1STHA 1HCZA 1UNSA 1KTKA 2RQXA 4QMGA 1WTWA 3PIO3 3BG3A 2OXPA 1ZYRC 1PTOH 3I8ZA 3DWQA 1H9JA 1SYFA 2Q8IB 4DK1A 1Q1BA 1LACA 2RSNA 2K28A 1YNNC 1PTOC 5C3WA 2B39A 2F0EA 4A3MB 3I73A 4R8IA 2VNUD 4HR7B 1VF7A 5EPKA 2A6HC 1A15A 2LY7A 4QF4A 4C1NI 3TDQA 3S1QB 2IL8A 1ENFA 2NYZD 1SE4A 4BBSB 1BCPB 4FNFA 2FINB 2Z4HA 3M7NA 4FYDA 1ET6A 2QKIC 1E2ZA 3K5OA 4WORA 1F2MA 2IX1A 1Z47A 4BS9A 2JYOA 3J81E 3MAQA 4FF4A 3S1MB 2Y0SB 3SE0A 3MTSA 2J4XA 3K59A 5KYLA 3W3AA 1I4GA 2L4NA 1H9SA 5IGCA 4C3HG 5C0XG 3GTMB 1Z7TA 3K5MA 1QWYA 1JB3A 2B2UA 1H9SB 1SE3A 1JR0D 1T5XD 1J8IA 1JORA 1C4QA 4JK1C 2BDOA 2A68D 1AFPA 1A6XA 3KBXA 1TS3A 1J9OA 3GV3A 1QNKA 5COYA 4FVMA 4KV6A 4HSVA 5IOCA 1YNJC 4FF2A 1B9MA 3MXPA 3ZYYX 1SAPA 2I07B 1TWFB 5FKAC 2DY7A 1Y69U 5M5YB 2KEEA 2F0FA 4A3IB 1GUOA 3GD7A 1TS4A 3X3MA 1HA6A 1CZGA 5DM63 1GHJA 4RHSA 1AEXA 2D2CC 1FNWA 4PQXA 5C3EB 4DXGA 3DUZA 3NK9A 2EY1A 4CHTB 1GHKA 2EOTA 4OL7A 4G7ZC 1QG7A 1EEID 3G6JB 1D1IA 1EY4A 3H6MA 4K6DA 3FMCA 2CQAA 3OWEB 3D8GA 4KD3A 3BS1A 5ELFA 1NR4A 2LFNA 4KMUC 2KECA 1MGSA 1EY5A 3DWPA 1X3QA 4CBVA 1TS2A 4IUTA 2F3WA 2NVQB 4G7HC 2F0PA 4KJNA 5FO9B 5D14A 3QG1A 1BBXC 1EQTA 1Y8NB 5EKIA 1EY8A 3M4YA 2QEJC 5EKLA 2MUYA 3L3OC 3C2PA 3GTKB 2BCOA 2XWBB 2EDGA 4QB4A 1BXTA 1FNUA 5M5WB 2NN6G 3TP6A 2ZXRA 4NDXA 3K57A 1HTLD 1TVXA 4FXKC 1CZWA 5I9PA 1LTSD 1F77A 1II3A 2XSCA 4C3JG 2JE6I 5CBAE 3H3VC 4KN7C 4RWSC 1QOHA 4ZKCB 1LTBD 3HOVB 1Q1EA 3CKIB 3H94A 4LK1C 4HMIA 3NP8A 2MJ8A 2HUGA 1ZKOA 3CU7A 1I4HA 1OXSC 1BCPC 4Z9CB 2D9UA 5HURA 3PUZA 3A8KE 4C2MB 2F0MA 3SHLA 1STGA 3R2IA 5EGTA 1PRTB 1X32A 1F9RA 5CGKA 1KLUD 3S15B 5E3FA 1BQQT 5IGFA 3GO5A 1RODA 1DD2A 3D4WA 2L9HA 3H91A 3A56A 3Q23A 1Y8PB 3MZ5A 4J6HA 5C0XH 1BOSA 2EPBA 4ME5A 2I46A 2PQEA 2R7ZB 3WOEA 1RKNA 4A3JB 1D1KA 5ELCA 2F0KA 3SR1A 1A3TA 3K0YA 4QUFA 3NBIA 4LAAA 1S5ED 1NSNS 1S5CD 4IFDI 4EVOA 1WTPA 3S1NB 1AP0A 1GJXA 2F4IA 1SFOB 1O7YA 3MHBA 5M5XB 1EY6A 5KNBA 1OO9B 2F0WA 4HMJA 2BA0A 4A3GB 3ND9A 3UI2A 1S5FD 1ILPA 3HGBA 4K5XA 3CHBD 4DFAA 4G4KA 5A2QL 1LLRD 5DM73 4IFDJ 2EZVA 1EYCA 3WOFA 1B50A 1U4LA 4A3KB 3MXUA 1XYIA 3SXHA 3EFXD 1K8OA 3KLSA 1WVLA 1EU4A 1O7LA 1QNUA 1WTVA 2JSOA 2SEBD 3TP5A 1SNOA 3KBGA 3HP3A 3NQIA 1G2TA 3FEWX 2SNSA 1F9QA 2NTSA 2ZXOA 1IKLA 3BDOA 1SMYD 1BCPF 2MGSA 1EQVA 1LT3D 1EWCA 3E6ZX 1TY0A 2B8FA 5EBCA 4N9PA 2X69A 3A55A 3OIQA 4F7XA 5JEAJ 4HCSA 3SK8A 1LTID 3I4NB 2CW0C 2EY2A 4XYQA 1WD1A 2WKDA 3PV0A 2JEAI 5DAUA 5C4ZA 3GTQB 2KCNA 5AFWA 3A7AB 4LJZC 2PO4A 1BF4A 2FJ2A 4H44C 2O5IC 2M2LA 5ELDA 1UEAB 2IX3A 3NWTA 1FD7D 3DHQA 3M7GA 1G291 1SEBD 1WCMB 2JXMB 4EQOA 3HOXB 2PNRC 2XNAC 2B2TA 2KOLA 3NXWA 2DY8A 4KK7A 3BDLA 5G3LD 4XDXA 3GV6A 1D5XC 3I3CA 3W2DA 4F8MA 1SYBA 3P7JA 3T56B 1DM0B 2F0SA 2A5HA 4O1NA 4KKUA 1DCZA 4IN3A 1XX8A 2HCIA 2DNCA 1PRTC 1ZXTA 3K5LA 1CK1A 3HOYB 4XT1B 3K58A 1NR2A 2N88A 2B2YA 2Q8RE 1M4VA 3T4AC 4CJ1B 3S16B 2A69C 4XT3B 4DXFA 1PFMA 5JPMC 4DAPA 5A2QE 2E2IB 5CORA 4P2CB 4FF1A 1PXUA 4DK0A 2VXWA 1E2VA 1KABA 1S5DD 3HZXA 4JBWA 1IW7C 3NTHA 2R3ZA 3OHXC 1LTGD 3CQZB 4LMQD 4X3SA 2YYZA 3VR4A 2F0QA 3BVZA 3EJIA 3OPOA 4ULLA 3G7LA 1I3QB 3NWSA 2K33A 3DEOA 2JA8B 4QCLA 3SVMA 2AWOA 5T1IA 3HOWB 2OF1A 2VB2X 1LABA 4ZAIA 3R3OA 1XTCD 4BY1B 4IUNA 2BDNA 4CGYB 1G2SA 1SYGA 4C56C 3IAYA 4J1MA 3S14B 4ZYSA 2PMZB 4XYOA 4BA1I 2PYKA 2RVLA 4S3SA 3L9AX 2KA7A 3NSWA 4ODGA 1EL0A 4HCEA 2J0TD 4U68A 3K5NA 3DM1A 5J39A 1AW7A 3I91A 5IT9L 1BDOA 3MVVA 2JA6B 2F0DA 3TBIB 3BVMA 2QCPX 4ZKBB 1KLGD 4IALA 1PZKD 3D6CA 4NW2A 2WIIB 3K7AB 2AUKA 1JOKA 1LTTD 3OW7A 3DEPA 2IX0A 2KUMA 5FOBB 2L0CA 5I6WA 2K5WA 5J22A 3D31A 1O78A 1ILQA 4H13C 1PRTF 1IW7D 1EU3A 3PIP3 3C1EA 1WTOA 1AZQA 2SOBA 3MFGA 4ZLTF 4ZQ3A 4TKOB 1HQRD 4C3HB 1ZYRD 1DXMA 1ICWA 5JEAG 2XVSA 1H9MA 4ZUIA 4U673 3SDZA 2EJMA 3EQLC 4RCOA 1H9RA 3OIPA 1JICA 1YNND 1PTOD 3BVGA 1PZJD 3S2DB 2MHVA 1HFGA 1MSHA 1MSGA 4KY5A 2AWNA 2A6HD 1A2TA 4EQNA 2WINB 2L1BA 2B2TC 3D4DA 4A3BB 1RTNA 2A6EC 3T51B 3MA2B 2X6LA 2GA4B 3M4OB 3NE5B 1SJED 1QE6A 3FPUB 4A3FB 3MXNA 3KK7A 1JQYD 1PZID 2KCCA 2PW7A 1CHQD 3HG9A 1CA5A 5EBDA 3BZDB 1RF2D 3GQBA 5E1FA 3FRPB 1DOLA 3MEHA 2L5TA 1CTMA 3VYTA 3E5SA 4K2KA 4IUPA 5C3XA 1A3VA 1PFBA 4K2LA 1F2ZA 1FGBD 5M9OA 1Y1VB 4RA8A 3VR2A 4PMWA 5LHY1 1A3UA 1STAA 3PO2B 2R93B 4IURA 3VYUA 4ABNA 3QJYA 4HTHA 5I2YA 4G57A 3URYA 1QILA 1YNJD 3TP8A 2O4XA 5DEHA 2E2DC 3GTLB 3OWFA 1V8QA 2DNEA 1GUNA 1BUVT 4XQJA 2M00A 5IT9E 3A8JE 1G6ZA 4KHZA 3VA5A 4ZUJA 4NKLA 3T53B 2AQ1B 1OXTA 1JOQA 2EXZA 2V4DA 2SNMA 1B2TA 4XQNA 2WV6D 5TSSA 2VB3X 5EPLA 5EPJA 5KNDA 5C4XB 1STEA 2A6ED 2L55A 2PCFB 1O80A 3GTOB 1S5BD 1V1PA 3CRLC 3DMUA 3LWEA 1XWEA 3V96A 1I6VC 1V1PB 1PYWD 2F0IA 2IJ0A 2WKCA 4C3JB 2YU9B 4FXDA 4IFDH 4XTCS 4X3KA 1DYQA 3A7LA 1TKWB 3U9OA 2K05A 3H0GB 4M1UB 1MBYA 3PUYA 4V0BA 5CV5A 4FXGC 4I65A 1OXUA 1K83B 5C5MA 1CM9A 1QB5D 3M3YB 1FNVA 2OEOA 3DWAA 2B2UC 3R8BA 4G7OC 5C5LA 2HDLA 3ND8A 5JPNC 1HUMA 4NP5A 4FF3A 2Z4IA 2NB0A 4XIGS 4HEDA 4DN4M 1HFNA 4DA2A 1F2LA 1CHPD 2ID0A 3PUXA 5FK9C 2B2VA 2JEBI 2M9VA 4A93B 3PUWA 5JEAH 5IGGA 2AQ3B 4RHRA 1EWHA 2EJGC 2K03A 3PO3B 2F0OA 4J8QA 2K5DA 1DZ1A 3R2TA 1Q12A 2FHTA 3RMHA 3E0JA 1SNDA 2BOSA 2FMCA 3QO2A 1BCPD 3N52A 2JA7B 4OGQC 3SK4A 3LNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4X A;  1DOL A;  2RSO A;  1WTW A;  4HSV A;  1DOM A;  2L11 A;  2HDM A;  1RHP A;  4MHE A;  4QUF A;  1NCV A;  5COR A;  4NW2 A;  3TN2 A;  5DNF A;  4IUP A;  1LV9 A;  1NAP A;  1RTO A;  5JJZ A;  3I8Z A;  2CVR A;  1PFB A;  3DEP A;  2KUM A;  4ZK9 B;  1SAP A;  2X69 A;  1G91 A;  5CMD A;  2VXW A;  5T1G A;  4HCS A;  2KED A;  1CM9 A;  2DY7 A;  2NZ1 D;  2SDF A;  5E4W C;  2RSN A;  1VMC A;  2XIW A;  1TVX A;  2K01 A;  4RA8 A;  2K28 A;  2KEE A;  1ILQ A;  1WD1 A;  1ML0 D;  2R3Z A;  1Q3L A;  1U4M A;  1EQT A;  1JE4 A;  1WTP A;  1U4R A;  2B2U C;  4R8I A;  2N55 A;  1AP0 A;  1DON A;  4LMQ D;  4IUR A;  5CBA E;  2L12 A;  4X3S A;  2HDL A;  1WTO A;  1HA6 A;  2B2W A;  1HUM A;  1AZQ A;  1O7Y A;  3I90 A;  5AFW A;  3TZD A;  1S4Z A;  4OIK A;  5EPK A;  4RWS C;  2K04 A;  4RAU C;  1A15 A;  4ZLT F;  2B2Y C;  4X3U A;  1BF4 A;  2FJ2 A;  1IKM A;  1PLF A;  1BNZ A;  1F9S A;  2M2L A;  4HED A;  4DN4 M;  1HFN A;  3G7L A;  2IL8 A;  4ZKC B;  5CBE E;  1F2L A;  1ICW A;  1U4P A;  3DEO A;  1HUN A;  3UI2 A;  3SVM A;  2NYZ D;  1ILP A;  1HHV A;  1M8A A;  5T1I A;  1PFN A;  5EQ0 A;  2J7Z A;  2EOT A;  2FMM A;  2B2W C;  1BO0 A;  4X3T A;  1F9P A;  2HCC A;  2MJ8 A;  3MWY W;  4HAE A;  1HRJ A;  4ZAI A;  2FIN B;  4QUC A;  2HUG A;  2B2V A;  1VMP A;  1KNA A;  1JIC A;  1WD0 A;  2B2T A;  2KOL A;  1G6Z A;  2DY8 A;  1QG7 A;  3Q6S A;  2BDN A;  3ONA B;  1EIH A;  3IFD A;  1B50 A;  1O7Z A;  1HFG A;  4XDX A;  2D9U A;  1U4L A;  1G2S A;  1MSH A;  4MN3 A;  1MSG A;  1EOT A;  1MI2 A;  1B53 A;  1XYI A;  2JYO A;  1GUW A;  4UAI A;  3R93 A;  5D65 A;  1CA6 A;  2K03 A;  1WTR A;  1B2T A;  1PDQ A;  2H1E A;  3GV6 A;  4IUU A;  1B3A A;  2X6G A;  5EJW A;  2B2V C;  1IL8 A;  2B2T C;  1SDF A;  2L1B A;  5EPL A;  1KNE A;  1SSO A;  1NR4 A;  4OIJ A;  3MTS A;  1DZ1 A;  2RVL A;  5EPJ A;  1X32 A;  3I3C A;  2KEC A;  1RTN A;  2KVM A;  1F9R A;  1WVL A;  5EKI A;  3P7J A;  1MGS A;  1EIG A;  1ESR A;  3KUP A;  1WTX A;  1RJT A;  4CJ0 B;  2L4N A;  1WTV A;  2X6L A;  1O80 A;  2FHT A;  1EL0 A;  3IL8 A;  1XX8 A;  2HCI A;  4IUQ A;  4R9W A;  2B2U A;  3LWE A;  1X3Q A;  1QE6 A;  1ROD A;  2MP1 A;  4U68 A;  1C8C A;  1ZXT A;  2L9H A;  3D6W A;  3FPU B;  3HP3 A;  3QO2 A;  2RA4 A;  1J8I A;  3H91 A;  4XT1 B;  1G2T A;  3DM1 A;  4ZKB B;  2EE1 A;  1NR2 A;  1E0B A;  1AZP A;  3N52 A;  1F9Q A;  4CJ2 C;  2N88 A;  1X3P A;  2B2Y A;  1DOK A;  2EPB A;  2Q8R E;  4IUV A;  3I91 A;  3KBX A;  2JP1 A;  4IUT A;  4X3K A;  1IKL A;  1CA5 A;  2MPM A;  1J9O A;  2Q8T A;  3FDT A;  2FFK B;  4CJ1 B;  3GV3 A;  3F2U A;  2K1B A;  2MGS A;  2NWG A;  4XT3 B;  1WTQ A;  1PFM A;  5D14 A;  4O42 A;  1BBX C;  1B4O A;  5COY A;  2K05 A;  1QNK A; 
#chains in the Genus database with same CATH topology
 2DN8 A;  3MFY A;  4QGU A;  2NVT B;  2L11 A;  2UXD Q;  2KHJ A;  5ELO A;  1A8V A;  4PMC A;  1IBK Q;  2F0N A;  3V2T A;  5JJZ A;  3T1H Q;  2TMP A;  2E74 C;  2RBM A;  1N36 Q;  3WWV A;  4N8F A;  3ULJ A;  3EIV A;  4PMB A;  3GP7 A;  1V43 A;  3NPP A;  4RKB A;  5T1G A;  3F2D A;  2XWJ B;  1SYE A;  5IP9 H;  1Y1V H;  1TS5 A;  4OEL B;  2D0O A;  4KY6 A;  1ML0 D;  1Q3L A;  1JWM D;  5M3F B;  4POG A;  2TSS A;  1M90 C;  1FR3 A;  1C48 A;  5I4D A;  3F2C A;  3T1Y L;  5BN4 A;  3PO2 H;  2L12 A;  2R93 H;  1TWA B;  4K5W A;  2E5L L;  4R8N A;  2B2W A;  3KLW A;  2VS1 A;  3WDN A;  3CF5 A;  4A3C G;  1X54 A;  4X3U A;  2VUM B;  3ULL A;  1IKM A;  3EVQ A;  2LS0 1;  4BBR B;  1EFI D;  1SYD A;  1M8A A;  3STB D;  5M5W H;  1KAA A;  2MO0 A;  3GTL H;  2HHH L;  2FMM A;  3LX0 A;  5H1S E;  3HKZ E;  4HAE A;  4QUC A;  3O13 A;  1JC7 A;  1BBU A;  2F3V A;  4LUZ A;  4GN4 B;  1E22 A;  3IFD A;  3U4V A;  4QIW B;  1I6H B;  2WB1 E;  3KJO A;  2ZJP A;  4NXM Q;  1VF5 C;  2ZXP A;  3RD4 A;  3HOU B;  2CWA A;  3HOX G;  1B3A A;  1PH9 A;  4B08 A;  4K6L A;  1KIX A;  3CC2 A;  1SDF A;  1XXG A;  2E2H B;  2K50 A;  1JCK B;  3HOV H;  3TZU A;  4DR6 L;  2CWP A;  2KVM A;  1CI3 M;  3FHW A;  1CQF A;  3KUP A;  2E2J B;  3EA6 A;  1W6J A;  1VQP A;  4IPD A;  4APV A;  4OWW B;  4IUQ A;  4R9W A;  1ONL A;  4XQQ A;  1QVG A;  3GTO H;  2K5Q A;  1C8C A;  3RLO A;  1R9T B;  1KXL A;  4IZ8 A;  3J80 L;  3VDY A;  2F3I A;  1AZP A;  1G8Z D;  2YU9 H;  5JVG 3;  1A2U A;  4CJ2 C;  3NQT A;  2CFM A;  3TP7 A;  4IPG A;  4DUZ L;  5FLM H;  2MPM A;  1Q82 C;  2F0U A;  2K1B A;  1WTQ A;  1UUP A;  3HOY G;  4DU9 A;  3H0G H;  3Q24 A;  2LKV A;  5IGB A;  1SNC A;  1LV9 A;  1NAP A;  4DV3 L;  1WI5 A;  3UE0 A;  1EZ8 A;  2VQF L;  5LL6 X;  2QIL A;  5IYC H;  1EY7 A;  1G91 A;  1LTA D;  1GUS A;  2SDF A;  1VQF A;  2NZ1 D;  5E4W C;  1VQ6 A;  1XNQ L;  4CKC A;  4GOP A;  3M3Y H;  2RDF A;  1A63 A;  1QJO A;  2R7Z H;  4GOP B;  4C3I G;  1QCB D;  1TY2 A;  3OMC A;  4K5V A;  3QB3 A;  3CPF A;  4OHJ A;  1B9N A;  4FP5 D;  2NN6 I;  4DAV A;  1NTG A;  2F03 A;  5JAV A;  5KGU A;  3ULP A;  2MO1 A;  1BNZ A;  1ENC A;  4JOI A;  5CBE E;  4DV3 Q;  4F87 A;  4BXX G;  4UY8 C;  2VQF Q;  2QGQ A;  3HEJ A;  1HA5 A;  5CYU A;  3FPP A;  1TWH B;  2RHS B;  2HCC A;  3ITP A;  1XNQ Q;  4OO1 H;  4P72 A;  2CW0 D;  1GD7 A;  2PZW A;  2H4O A;  5A35 A;  3S1N H;  2JA8 G;  3J7Y W;  4JI4 L;  1O7Z A;  4LF6 Q;  3PF4 A;  1JOO A;  3NTI A;  3HOW G;  4UPA A;  2A68 C;  2WAQ B;  5IGE A;  5ELB A;  5M5X H;  3I4L A;  3DM3 A;  4KN4 C;  1JWU D;  5EJW A;  2R61 A;  4BY1 G;  2B2V C;  2A1A A;  4A3G H;  2IT1 A;  1HNZ L;  3PO3 H;  4QQB X;  4HSP A;  4RMF A;  5I9O A;  2VQE L;  5KEE A;  3I55 A;  1ESR A;  3JAM L;  2K7V A;  5K36 G;  5M3M B;  4ZCK A;  1N33 L;  1MJC A;  1S40 A;  2ZT9 C;  4ME3 A;  4N9T A;  1LUZ A;  4NMZ A;  2A8V A;  4JI4 Q;  4JI1 L;  1KDC A;  2NVY B;  1E0B A;  1SNQ A;  3C1F A;  4RGM A;  1I4P A;  5HY6 A;  1YI2 A;  2NVX B;  5IYD H;  5DLQ E;  2JP1 A;  3RLN A;  2E76 C;  3FDT A;  4HN7 A;  3F2U A;  3EBE A;  1YHA A;  2XN9 C;  1SJH D;  4JCV E;  4M8A A;  1IBM L;  2R6G A;  5E4X A;  3VR6 A;  2VQE Q;  3P1H A;  1Q8I A;  4IFD G;  1RHP A;  4DF7 A;  4OO1 I;  1I4R A;  1NMG A;  3HRZ C;  3AB9 A;  4CDE C;  1U0L A;  3IFT A;  2JA6 G;  4DAY A;  4L63 B;  4RFB A;  1PRT D;  3C46 A;  2C35 B;  4DAY B;  1Q7Y C;  5I2X A;  4PZ8 A;  4PZ6 A;  1IYV A;  2EYO A;  3HS0 C;  4KKT A;  5HGT A;  1LTR D;  1U9R A;  3TQY A;  4LF7 L;  5GAG C;  2A69 D;  1Y1W B;  5IGD A;  4RH6 A;  1IBM Q;  4UDU C;  1I4Q A;  5CV7 A;  1BR9 A;  1XPU A;  3TZD A;  2YV5 A;  1D5M C;  2LMC B;  2K04 A;  1EIF A;  2A73 B;  1PLF A;  2EY5 A;  2VUM H;  2PZT A;  3A5U A;  2K32 A;  1HUN A;  2PW5 A;  2PMZ E;  4BBR H;  3J80 E;  1PFN A;  3UDF A;  1VQG A;  2KQ3 A;  1STB A;  2B2W C;  3I4N H;  2K6A A;  1JE5 A;  1NMF A;  3U58 A;  1D7Q A;  4XXE A;  3SK5 A;  4A3L G;  2D0P A;  5IIF A;  3FKI B;  3GTQ H;  3CRK C;  4LF7 Q;  4RGO S;  3SEB A;  3I4M B;  1X9N A;  1IHZ A;  5D65 A;  3D4R A;  4DR4 L;  4LFC L;  1CA6 A;  4A3I G;  4EGV A;  1I94 L;  3HOU H;  5CV6 A;  4KI0 A;  2Y0S E;  1LO5 D;  1SSO A;  2IHF A;  1Z6H A;  4OIJ A;  2E2H H;  1CFM A;  5FLX L;  4A3E B;  2EYP A;  4R4C A;  1WCM H;  4IJH A;  2EY6 A;  2EYM A;  1BBW A;  2OWO A;  2E2J H;  1YHQ A;  1TII D;  1OXV A;  2IY5 B;  1HTP A;  4IOC A;  2CH4 W;  4K14 A;  2MP1 A;  2F0G A;  1R4P B;  2PZU A;  2RA4 A;  5KYI A;  4A3B G;  1V9P A;  2EE1 A;  2AMC B;  3GTJ B;  5K5P A;  1I94 Q;  4A3D B;  1KHI A;  2Q8T A;  3VYS A;  4A3F G;  4TSS A;  1DOM A;  2EYH A;  2VW9 A;  4DV5 L;  4LF8 L;  3BYY B;  1IYJ B;  1TU2 B;  2EYJ A;  5ELN A;  3CC4 A;  5BR8 Q;  2CVR A;  1PMR A;  2KHS A;  3SK6 A;  3HOY H;  5CMD A;  2F1M A;  1KDB A;  2KED A;  1N8R C;  4MIU A;  2XIW A;  2B63 B;  1RD9 D;  2HT1 A;  1EY9 A;  1WFQ A;  1PH4 A;  5F2D A;  2HIV A;  3A54 A;  2YTY A;  5C44 B;  4GKK L;  1VCI A;  1V1O A;  2HD3 A;  4LNQ A;  3A74 A;  4PNY A;  2PNH A;  1SNP A;  5IP9 G;  2E2I H;  4UHV A;  1Y1V G;  3JAM E;  2ICE C;  3AYH B;  4RAU C;  4DV5 Q;  2B2Y C;  1PTO F;  1HQM C;  5KIX A;  4GOP C;  1F9S A;  1U4P A;  3ICE A;  3PO2 G;  2R93 G;  1SNM A;  1HHV A;  3T13 A;  5J3B A;  3ERQ A;  3BJU A;  4JI3 Q;  5AJ3 L;  1BO0 A;  1LT5 D;  5CR3 A;  2O5J C;  1VMP A;  5BN3 A;  4DV2 L;  3K7U C;  1WD0 A;  1GUT A;  5ISR A;  3Q6S A;  4WJ4 A;  1QVC A;  4JOI C;  1KDA A;  4GKK Q;  1TQO A;  4JI8 L;  5CC4 A;  1P8L A;  4JC0 A;  3KJP A;  5IP7 H;  1P16 A;  5J1Z A;  2KCT A;  3VYR A;  4OXP A;  4IUU A;  5D3D A;  3RN5 A;  5I6Y A;  4LF9 Q;  1IL8 A;  2JA8 H;  1UEB A;  3ZJY C;  1ESF A;  4RKL A;  3HOZ B;  1HJP A;  1SR3 A;  2Q2I A;  2OT2 A;  4R1J A;  2ICI A;  5LMU Q;  3IKJ A;  3RZD B;  1F2Y A;  2G9H D;  3RZO B;  4AQY L;  4BY7 B;  3HOV G;  3M85 A;  1MIU A;  2E75 C;  5BN5 A;  4Q5V A;  2XTI A;  4TVA B;  5C4X G;  3NBH A;  3MC0 B;  4B9W A;  5K36 H;  1YVC A;  1X3P A;  4IUV A;  2NVX H;  3NBH B;  1XTD A;  4PZ7 A;  2JA5 B;  1TWG B;  2CHB D;  4DV0 L;  1PH1 A;  2NWG A;  2BE5 C;  1B4O A;  4A4I A;  1T5E A;  1SE2 A;  1B1Z A;  3TSS A;  3CCJ A;  2XRQ D;  1NCV A;  4B9X A;  4AYB B;  1VQ5 A;  4A76 A;  4RGN A;  5C6A A;  1HXY D;  1L0X B;  3TS0 A;  3QOL A;  3G71 A;  1EY0 A;  2PI2 E;  3H0G G;  2IHE A;  3PIP A;  3UDG A;  4V19 0;  1CQV A;  4LF5 Q;  3S1R B;  4F88 A;  1ENA A;  2UU9 L;  4ZRZ A;  3G4S A;  1D2B A;  4CKB A;  4DNT B;  3NHH A;  4I7Z C;  4R4O A;  5FLX E;  4WJW A;  1DON A;  2JA9 A;  2C5C A;  3I90 A;  1MKH A;  1E2W A;  2QDB A;  5GAH C;  5IOD A;  2UXC L;  1T9H A;  3PQI A;  3QOJ A;  3K7A H;  2R7Z G;  2ASB A;  1HPC A;  1X65 A;  4H7B A;  3CPW A;  2IPK D;  4JV5 L;  4Y7N B;  2IWH A;  1IYU A;  2NBF A;  4RGT A;  4X3T A;  3DXJ C;  1SYC A;  3VR5 A;  1HRJ A;  4UP7 A;  1KNA A;  3I2Z A;  3OSO A;  2NUC A;  3J7A V;  2QF7 A;  2Z8L A;  1HNX Q;  1EIH A;  3GTP B;  2F0H A;  3V05 A;  2LXK A;  1I50 B;  1SXT A;  5KRU A;  1B53 A;  1MJE A;  2MFI A;  1LT6 D;  3NUC A;  3I4M H;  5IY0 A;  4OO1 G;  1EZ6 A;  5GQO A;  1EYA A;  3U9S A;  1WTR A;  1PDQ A;  4C3H H;  4A3L H;  4A93 G;  1SMY C;  1STN A;  5CV4 A;  2ES2 A;  5KNC A;  1HZB A;  1UE5 A;  3J7Z C;  2A74 C;  4Q0F A;  4A3E H;  3KF8 A;  1WTX A;  3S17 B;  1D5Z C;  3L7Z C;  2XRS D;  3BDC A;  3AMU A;  3KF8 B;  3W1B A;  4A3G G;  1OXX K;  1STY A;  2RKS A;  3PO3 G;  3S2D H;  3UDX A;  1JJ2 A;  4YCW A;  3D6W A;  2PQA A;  4O2D A;  3T16 A;  1L0Y B;  3MEF A;  4FO2 A;  4KTA A;  5JOB A;  2PQA B;  1LTL A;  4K8J A;  1CT1 D;  1DOK A;  3K81 C;  2F0L A;  3NTK A;  4L8J A;  3D3R A;  4JI6 L;  1TT2 A;  2EJF C;  3RUZ A;  1X6O A;  1ZEQ X;  2EXD A;  4O42 A;  3AU7 A;  4ZK9 B;  4HJA A;  4YIJ A;  2RSO A;  4ID6 A;  2BE5 D;  2JA7 G;  3SGI A;  5IYD G;  5DNF A;  1GUG A;  1PTO B;  3OOC A;  4KLK A;  2N3S A;  2PPB C;  2RDH A;  5IT9 c;  4LF4 L;  2NTT A;  4DUY L;  5IYB G;  3Q22 A;  2ZJR A;  2G9D A;  1VDZ A;  1VMC A;  4YCV A;  2B63 H;  3M9B A;  5EKK A;  5C0X I;  1U4M A;  4GZY C;  1JE4 A;  4K8I A;  4DGZ A;  1SN8 A;  3J7A F;  2R92 B;  1L1O A;  4DNR B;  1CKO A;  1Y8O B;  4H02 A;  3M4P A;  1Z9F A;  3QWN A;  3CCM A;  2RHQ B;  1L1O B;  1S4Z A;  2AHO B;  1RIP A;  3Q0A A;  1KQS A;  5M3F G;  2KJX A;  2HIX A;  5FO8 B;  1D8L A;  1ET9 A;  4DV6 L;  1UE6 A;  1FYC A;  2WAC A;  2EVB A;  1GOZ A;  1RCV D;  2J7Z A;  4RCN A;  3HKZ B;  1F9P A;  3MWY W;  2C9O A;  4JI2 L;  4KD4 A;  2VUM G;  3S9W A;  5C0X J;  3LWU A;  3ONA B;  2D5D A;  4BBR G;  4YCU A;  4EQP A;  2WB1 B;  1EEF D;  4KKS A;  4WRD A;  1EOT A;  1KAW A;  1MI2 A;  1VQJ A;  4JI7 L;  4GNX A;  4UAI A;  1GUW A;  3I4N G;  3R93 A;  2F0J A;  1AH9 A;  4E6I A;  1GM5 A;  1I4X A;  2O2L D;  1GXD C;  5JVH 3;  4GNX B;  1K8M A;  2X6G A;  1K9M C;  1VQM A;  2F0T A;  2EIF A;  4TQU S;  3P75 A;  4DV6 Q;  2WP8 J;  4WFN 3;  4IQZ A;  1EIG A;  3KLS X;  2HQE A;  1PH3 A;  4CDF C;  4BWG B;  3HOU G;  5D3I B;  1SBB B;  3IL8 A;  4JI2 Q;  3RZD H;  3FVQ A;  3RZO H;  3CCQ A;  3T1Y Q;  2E5L Q;  1WCM G;  3P20 A;  2BA1 A;  2RDG A;  4X65 L;  4POF A;  4CKE A;  1ASY A;  3H09 A;  1Q86 C;  1UAP A;  3I70 A;  5CV9 A;  2ZJQ A;  5C4X H;  2HHH Q;  2NN6 H;  1HZ9 A;  2HDM A;  3E9H A;  3J81 L;  4KJO A;  4MHE A;  1DJR D;  1EWI A;  3VR3 A;  3TN2 A;  5CV8 A;  2EYL A;  1RTO A;  3KLR A;  1TWC B;  1XNR L;  1MD2 D;  1H9K A;  4C3J H;  5ELE A;  2KHI A;  5FO7 B;  5C4J B;  2K01 A;  4JI0 L;  5NUC A;  4X65 Q;  2Z1C A;  3S1R H;  3QIA A;  2AUJ D;  3NEM A;  1U4R A;  3A8I E;  2N55 A;  4AIM A;  4H0L C;  4DR6 Q;  3OMG A;  2GN5 A;  2OQ0 A;  2B8G A;  1IZ6 A;  3OW2 A;  4OIK A;  5FJ8 G;  2I0Q A;  2JK8 A;  1EYG A;  4KY7 A;  5IE8 A;  3AFQ A;  1B44 D;  1PVO A;  1VQA A;  4DR5 L;  2N49 A;  1K83 H;  4FDB A;  1W6K A;  4TRD A;  1XNR Q;  3MXG A;  4AH6 A;  2ENB A;  5EQ0 A;  5LL6 S;  2D62 A;  2ZM6 L;  1JWS D;  3ERO A;  1NUC A;  3PMF A;  4BA2 I;  4B3M L;  3TME A;  4DUZ Q;  1RDP D;  2DJF C;  4LFB L;  4GLV B;  1R4Q B;  3BYT B;  1D6E C;  4C1N K;  3C3L A;  3GTG B;  1TR5 A;  2ZTC A;  3GTP H;  4IPC A;  2AQ2 B;  3PUV A;  3X3N A;  3K6O A;  4MN3 A;  5JJL A;  2ALY B;  3VA7 A;  3I72 A;  1VQN A;  1K3B C;  1A62 A;  4OWT B;  2H1E A;  5G3L F;  3RLF A;  3N6R A;  1Q90 A;  1GO3 E;  1SE8 A;  1KNE A;  1AE2 A;  4L6T B;  5IP7 G;  3ER0 A;  4DR3 L;  1N32 L;  2WAQ G;  1VQK A;  1RJT A;  4CJ0 B;  2EYF A;  3S17 H;  4A93 H;  1LT4 D;  4PV1 C;  1EYD A;  4EQ5 A;  4YHH L;  1AN8 A;  4JI5 L;  4KHV A;  3CME A;  2F0V A;  2FXQ A;  2IW3 A;  4ILW A;  3S24 A;  4C3I B;  1V1Q A;  4WJ3 M;  5HGQ A;  1N34 L;  3S2H B;  1XJV A;  2WFW A;  5C4H A;  4QL5 A;  2FFK B;  1STH A;  2EQS A;  1HCZ A;  1UNS A;  1KTK A;  1VQE A;  2RQX A;  4QMG A;  1WTW A;  3PIO 3;  3BG3 A;  4DR3 Q;  2OXP A;  2OQK A;  1ZYR C;  5LMN L;  3NEN A;  3QR8 A;  1PTO H;  3I8Z A;  3DWQ A;  1PH6 A;  4YHH Q;  1H9J A;  1SYF A;  2Q8I B;  4JI5 Q;  4DK1 A;  1Q1B A;  2K5H A;  1A0I A;  1LAC A;  2Z6K A;  2JA7 H;  1VQH A;  2RSN A;  3A5Z B;  2K28 A;  1YNN C;  1PTO C;  2KCM A;  5C3W A;  2B39 A;  4DV7 L;  2F0E A;  4DR1 L;  4MZ9 A;  3I73 A;  2GVA A;  4A3M B;  1HNZ Q;  4J15 A;  4R8I A;  1KRS A;  1NJI C;  2VNU D;  4L5R C;  5IYB H;  2NVT H;  4HR7 B;  1VF7 A;  1VQC A;  5EPK A;  2A6H C;  1A15 A;  2LY7 A;  2WAQ E;  4QF4 A;  1N33 Q;  4C1N I;  3TDQ A;  3S1Q B;  1IBL L;  1CKN A;  2IL8 A;  1ENF A;  2NYZ D;  1SE4 A;  4JI1 Q;  2CCZ A;  1CKN B;  4BBS B;  2OCE A;  1BCP B;  1Y1W G;  1L1O C;  4FNF A;  2FIN B;  2Z4H A;  3M7N A;  5M3F H;  1YIJ A;  2N78 A;  4FYD A;  1ET6 A;  3BU2 A;  2QKI C;  4DR1 Q;  1E2Z A;  3K5O A;  4WOR A;  1F2M A;  2IX1 A;  1TWA H;  1Z47 A;  1XMO L;  4BS9 A;  2JYO A;  3J81 E;  2F4V L;  3MAQ A;  2Q2H A;  4FF4 A;  3S1M B;  2Y0S B;  2CH4 A;  1IBL Q;  3SE0 A;  3MTS A;  2J4X A;  3K59 A;  5KYL A;  1M1K C;  3W3A A;  2CQO A;  1I4G A;  3I4M G;  3F1Z A;  4GNX C;  1QZH A;  2L4N A;  1H9S A;  5IGC A;  4C3H G;  5C0X G;  3GTM B;  1Z7T A;  3K5M A;  1QWY A;  1JB3 A;  2B2U A;  1H9S B;  1JJC B;  3ERS X;  1SE3 A;  2Z9H A;  1JR0 D;  1T5X D;  1I6H H;  1J8I A;  1JOR A;  1C4Q A;  3RNU A;  4A3E G;  4JK1 C;  2BDO A;  2A68 D;  1AFP A;  4GKJ L;  3K8A A;  3HFZ B;  1A6X A;  3KBX A;  3UDI A;  1TS3 A;  1J9O A;  3GV3 A;  1LM0 A;  1QNK A;  4JBK A;  5COY A;  4FVM A;  4KV6 A;  4HSV A;  1DGS A;  4GN5 A;  4R4I A;  5IOC A;  1YNJ C;  3I56 A;  4FF2 A;  3DLL A;  4A3D G;  1EFW A;  1B9M A;  1FGU A;  3MXP A;  3ZYY X;  1R9T H;  1SAP A;  2I07 B;  3KYH C;  1TWF B;  5FKA C;  1JJG A;  3NEL A;  2DY7 A;  1Y69 U;  4DR4 Q;  2QDL A;  4LFC Q;  5M5Y B;  2KEE A;  3BZC A;  2F0F A;  1H95 A;  4A3I B;  1GUO A;  1E1O A;  3GD7 A;  1TS4 A;  3X3M A;  1HA6 A;  1CZG A;  5DM6 3;  1C7Y A;  1GHJ A;  4RHS A;  1AEX A;  2B63 G;  1CSP A;  2D2C C;  2YTX A;  1FNW A;  2QW7 A;  4UP8 A;  4PQX A;  5C3E B;  4DXG A;  3DUZ A;  3NK9 A;  2EY1 A;  4CHT B;  3G48 A;  1GHK A;  2EOT A;  4OL7 A;  5FJ8 H;  1G6P A;  1ASZ A;  4G7Z C;  1QG7 A;  1EEI D;  4X62 L;  2B29 A;  3G6J B;  1D1I A;  1EY4 A;  3H6M A;  4K6D A;  3GTG H;  1QZG A;  3FMC A;  1CSQ A;  2CQA A;  4LF8 Q;  3AEV A;  1Q8K A;  1VQI A;  3OWE B;  2UUC L;  3D8G A;  4KD3 A;  4KHP L;  3BS1 A;  1PH2 A;  5ELF A;  1NR4 A;  2LFN A;  4X66 L;  4KMU C;  2KEC A;  1TWH H;  1MGS A;  1YEZ A;  1N9W A;  4JVZ A;  1EY5 A;  3DWP A;  3K80 C;  1VQ4 A;  1X3Q A;  4X62 Q;  4CBV A;  1L0W A;  3HOZ G;  3CCL A;  2QA4 A;  1TS2 A;  2UUB L;  4IUT A;  4GLA C;  2F3W A;  2UUC Q;  4KHP Q;  4G7H C;  1JMC A;  2F0P A;  2NVQ B;  3CAM A;  2VZA A;  4KJN A;  5FO9 B;  5D14 A;  3QG1 A;  4HIO A;  1EQT A;  1Y8N B;  5EKI A;  1BBX C;  1EY8 A;  4PG3 A;  3M4Y A;  2QEJ C;  5AJ3 Q;  5EKL A;  1UWV A;  2MUY A;  5M3M H;  3L3O C;  2PI2 A;  4DV2 Q;  2E8G A;  3J80 c;  3C2P A;  3GTK B;  2BCO A;  2XWB B;  2JA5 G;  2EDG A;  4R4Q A;  4QB4 A;  2DGY A;  2XGT A;  4JI8 Q;  1BXT A;  1FNU A;  5M5W B;  2NVY H;  2NN6 G;  3TP6 A;  2ZXR A;  4NDX A;  3K57 A;  2LXJ A;  3H3V H;  1XPO A;  1HTL D;  1TVX A;  4FXK C;  1EIY B;  4AYB G;  1CZW A;  4CDD C;  5I9P A;  4DV4 L;  1LTS D;  1CKM A;  1F77 A;  1II3 A;  2XSC A;  2QEX A;  4C3J G;  2JE6 I;  5CBA E;  1Q81 C;  1X3F A;  3H3V C;  3CW2 C;  4MNO A;  4KN7 C;  4RWS C;  3PCO B;  1QOH A;  4AQY Q;  1XMQ L;  4ZKC B;  3E3X A;  1XPR A;  1LTB D;  3HOV B;  1Q1E A;  3CKI B;  3H94 A;  4BBS H;  4LK1 C;  4HMI A;  1LYL A;  2GVB A;  3NP8 A;  2MJ8 A;  4JBJ A;  2HUG A;  3CXC A;  1ZKO A;  3CU7 A;  4HJ8 A;  4DV0 Q;  1I4H A;  1OXS C;  4CDC C;  1BCP C;  3I7F A;  4Z9C B;  2D9U A;  5HUR A;  1Y1W H;  3PUZ A;  3CCS A;  2K5N A;  3A8K E;  4C2M B;  1PA6 A;  3CC7 A;  2F0M A;  2DUD A;  3AFP A;  3SHL A;  1STG A;  3KFU A;  3R2I A;  1XMQ Q;  5EGT A;  1K73 C;  1WOC A;  4MTK A;  1PRT B;  1X32 A;  1F9R A;  1J5E L;  5CGK A;  1KLU D;  3H3V I;  4LWC A;  3S15 B;  1MHW C;  2UU9 Q;  5E3F A;  4AYB E;  1BQQ T;  2JQO A;  3GO5 A;  5IGF A;  1WYD A;  4K0K L;  1ROD A;  3FKI H;  1DD2 A;  3D4W A;  2L9H A;  3KF6 A;  3H91 A;  3A56 A;  2CKZ B;  1E24 A;  4GS3 A;  3KF6 B;  3Q23 A;  1Y8P B;  3MZ5 A;  4J6H A;  5C0X H;  1BOS A;  2EPB A;  2UXC Q;  4ME5 A;  1X55 A;  2I46 A;  2PQE A;  2R7Z B;  4JV5 Q;  3WOE A;  1RKN A;  4A3J B;  1D1K A;  5ELC A;  2F0K A;  3PF5 A;  3SR1 A;  1A3T A;  3K0Y A;  1K8A C;  4QUF A;  1YJ9 A;  3NBI A;  4LAA A;  1S5E D;  3STB C;  1NSN S;  1TWF H;  3AQQ A;  3GTJ H;  1S5C D;  4IFD I;  1W3S A;  4A3D H;  1AE3 A;  2ZTE A;  4EVO A;  3HKS A;  1WTP A;  3S1N B;  1AP0 A;  1HZA A;  1YZ6 A;  1GJX A;  3TRE A;  2F4I A;  1SFO B;  1VQB A;  1O7Y A;  2RF4 A;  3MHB A;  1K8G A;  5M5X B;  1EY6 A;  5KNB A;  1OO9 B;  2F0W A;  4HMJ A;  5JJI A;  2BA0 A;  4A3G B;  3ND9 A;  3UI2 A;  5C3E H;  1E1T A;  1S5F D;  1ILP A;  3HGB A;  4K5X A;  3CHB D;  2UXB L;  4DFA A;  4G4K A;  5A2Q L;  1YJN A;  2UXD L;  1LLR D;  5DM7 3;  4JI6 Q;  3W5O A;  4IFD J;  2EZV A;  1EYC A;  5C44 H;  3WOF A;  2RCN A;  1B50 A;  1N36 L;  3KDF A;  1U4L A;  1O7I A;  4A3K B;  2KBN A;  3MXU A;  1XYI A;  3HKZ G;  3KDF B;  3SXH A;  3EFX D;  2ZTD A;  1K8O A;  3KLS A;  2WB1 G;  3OTO L;  4LF4 Q;  4DUY Q;  1WVL A;  1EU4 A;  2UXB Q;  1O7L A;  3KOJ A;  1QNU A;  1U5K A;  1WTV A;  1S72 A;  1C0A A;  2JSO A;  2SEB D;  1PHJ A;  1IL2 A;  3TP5 A;  1SNO A;  3KBG A;  1VQ7 A;  3HP3 A;  3NQI A;  4L5Q A;  1G2T A;  2YTV A;  3FEW X;  3J81 i;  2SNS A;  4RG1 A;  1F9Q A;  5FLX c;  2NTS A;  4B3R L;  1E3P A;  1IKL A;  2I5H A;  2I5M X;  2ZXO A;  3BDO A;  1SLJ A;  1UE7 A;  1VQ9 A;  1SMY D;  3J80 i;  1BCP F;  2NVQ H;  2MGS A;  1EQV A;  1LT3 D;  3HOZ H;  1EWC A;  3E6Z X;  3OTO Q;  1QVF A;  1TY0 A;  2B8F A;  5EBC A;  4R4T A;  4NXM L;  2OTJ A;  1PV4 A;  4BY7 H;  3GTK H;  1HR0 L;  1BVS A;  4N9P A;  2X69 A;  3A55 A;  3OIQ A;  4F7X A;  4JI7 Q;  3L0O A;  2R7F A;  5JEA J;  3U50 C;  4HCS A;  3SK8 A;  1LTI D;  1VQL A;  3I4N B;  2CW0 C;  4OX9 L;  2EY2 A;  4XYQ A;  1WD1 A;  2WKD A;  3PV0 A;  4B3R Q;  2JA5 H;  1TWG H;  2JEA I;  5DAU A;  3CD6 A;  5C4Z A;  3GTQ B;  3BZK A;  1EQQ A;  2KCN A;  2B3G A;  5AFW A;  2KEN A;  1NNX A;  3CP0 A;  3A7A B;  4LJZ C;  2PO4 A;  1BF4 A;  2FJ2 A;  4H44 C;  2O5I C;  2M2L A;  5ELD A;  2LSS A;  1UEA B;  4JG2 A;  2IX3 A;  1HR0 Q;  3NWT A;  1FD7 D;  3DHQ A;  3M7G A;  1G29 1;  1SEB D;  1WCM B;  2JXM B;  4IO9 A;  4EQO A;  1JT8 A;  3HOX B;  2PNR C;  2XNA C;  4QJF A;  4OX9 Q;  1C9O A;  1Y14 B;  2B2T A;  2KOL A;  2DY8 A;  3NXW A;  4KK7 A;  3BDL A;  5G3L D;  2Z6B A;  2NZH A;  4QIW E;  4XDX A;  5GAE C;  4C2M H;  4NB3 A;  4YWK A;  3H15 A;  1VS0 A;  1HH2 P;  3GV6 A;  4DK6 C;  1D5X C;  4Y7N H;  3I3C A;  3W2D A;  4F8M A;  2G5D A;  1SYB A;  3P7J A;  3T56 B;  1DM0 B;  2F0S A;  2A5H A;  4O1N A;  4P75 A;  4JI0 Q;  2K5V A;  4KKU A;  3S15 H;  1DCZ A;  4IN3 A;  1XX8 A;  2HCI A;  1NBW A;  2DNC A;  1PRT C;  1ZXT A;  3K5L A;  1CK1 A;  1OTC A;  4XT1 B;  3K58 A;  3HOY B;  1I50 H;  3JAM i;  1NR2 A;  4EX5 A;  2BH8 A;  2JN4 A;  2N88 A;  2B2Y A;  2Q8R E;  1M4V A;  1YJW A;  3T4A C;  4DR5 Q;  4CJ1 B;  3S16 B;  2A69 C;  4XT3 B;  4DXF A;  1PFM A;  4LF6 L;  1E7Z A;  1FJG L;  5JPM C;  4A3J H;  2ZM6 Q;  4DAP A;  5A2Q E;  2E2I B;  4B3M Q;  2R7D A;  5COR A;  4P2C B;  4LFB Q;  4GN3 B;  1NY4 A;  4FF1 A;  1PXU A;  4DK0 A;  2VXW A;  1E2V A;  1KAB A;  1S5D D;  3HZX A;  1J6Q A;  5M3M G;  4B3T L;  4JBW A;  2JJQ A;  4UP9 A;  1IW7 C;  3NTH A;  2R3Z A;  1PYB A;  3OHX C;  1LTG D;  3CQZ B;  2Q2T A;  4LMQ D;  1KD1 C;  4X3S A;  2YYZ A;  4JBM A;  3TRZ A;  3VR4 A;  1FJG Q;  1N32 Q;  1IXR A;  1SFO H;  2F0Q A;  3CMA A;  2F52 A;  3BVZ A;  3EJI A;  3OPO A;  3OYY A;  4ULL A;  4A3M G;  3G7L A;  1I3Q B;  3NWS A;  2K33 A;  3DEO A;  2JA8 B;  4QCL A;  3SVM A;  2AWO A;  5T1I A;  4YWL A;  1N34 Q;  3HOW B;  2OF1 A;  2VB2 X;  1FL0 A;  1LAB A;  4B3T Q;  4ZAI A;  3R3O A;  2BH2 A;  1XTC D;  4BY1 B;  4IUN A;  2BDN A;  2R92 H;  4LUV A;  4CGY B;  4BBS G;  1G2S A;  1SYG A;  4C56 C;  4OON A;  3IAY A;  4A3K H;  1YBY A;  4J1M A;  2DJG C;  3S14 B;  4ZYS A;  5LMN Q;  2PMZ B;  4XYO A;  4BA1 I;  2PYK A;  2RVL A;  4S3S A;  4L5T A;  3L9A X;  2KA7 A;  3NSW A;  1HR0 W;  4ODG A;  2K4K A;  4DV7 Q;  1EL0 A;  3CCE A;  3J81 j;  4HCE A;  2Y0S G;  3A0J A;  2J0T D;  4U68 A;  4ALP A;  1HNW L;  3K5N A;  4N8X 1;  3DM1 A;  1JB7 A;  1WJJ A;  4IJL A;  1EQR A;  5J39 A;  4LUO A;  1AW7 A;  2Z0S A;  3I91 A;  1SMX A;  3F2B A;  5IT9 L;  1BDO A;  3FKI G;  3MVV A;  4HJ5 A;  2JA6 B;  1BKB A;  3U4Z A;  2F0D A;  3TBI B;  1WTH A;  3BVM A;  2QCP X;  4ZKB B;  4NPS A;  3RN2 A;  4IPH A;  1KLG D;  4IAL A;  4B3S L;  1PZK D;  3D6C A;  4NW2 A;  2WII B;  3K7A B;  2AUK A;  1JOK A;  1LTT D;  4OWX B;  1PH7 A;  3OW7 A;  3DEP A;  2IX0 A;  2KUM A;  3Q8D A;  5FOB B;  3L2P A;  5IWA L;  1XMO Q;  1HNW Q;  2L0C A;  2F4V Q;  3TEH B;  5I6W A;  4HIK A;  4A3C H;  2K5W A;  5J22 A;  3D31 A;  1O78 A;  3G6E A;  1ILQ A;  4H13 C;  1VQ8 A;  1PRT F;  1IW7 D;  3GDE A;  1EU3 A;  3PGZ A;  3PIP 3;  3C1E A;  1WTO A;  1AZQ A;  3JC6 6;  5JJK A;  2SOB A;  3MFG A;  4B3S Q;  4ZLT F;  4DV1 L;  4ZQ3 A;  4TKO B;  1HQR D;  4GLX A;  1X3G A;  4C3H B;  1ZYR D;  1TWC H;  1DXM A;  1ICW A;  5JEA G;  2XVS A;  1H9M A;  4ZUI A;  4U67 3;  4Y52 H;  1S3O A;  3SDZ A;  5IWA Q;  2EJM A;  2K52 A;  3EQL C;  3LGJ A;  5C4J H;  1K0S A;  4RCO A;  4GKJ Q;  1H9R A;  5GAD C;  3OIP A;  1JIC A;  3HOX H;  1YNN D;  1PTO D;  3BVG A;  1PZJ D;  3PSI A;  5C3E G;  5BR8 L;  3S2D B;  2MHV A;  4JYA L;  1HFG A;  1MSH A;  3EN2 A;  1MSG A;  1VQO A;  2VY3 A;  4KY5 A;  2V1C C;  2AWN A;  4DV1 Q;  2A6H D;  1A2T A;  1CUK A;  1SRU A;  4EQN A;  5C44 G;  2WIN B;  2L1B A;  2B2T C;  3D4D A;  1B70 B;  4A3B B;  4HIM A;  1RTN A;  3M4Q A;  5GRO A;  2A6E C;  3I4O A;  4JPB W;  3T51 B;  1B8A A;  3MA2 B;  1RL2 A;  2X6L A;  4YY3 L;  2GA4 B;  3M4O B;  3NE5 B;  1SJE D;  1NE3 A;  1QE6 A;  3FPU B;  4A3F B;  4JYA Q;  1KC8 C;  3MXN A;  1W2B A;  3KK7 A;  4JI3 L;  1JQY D;  1PZI D;  2KCC A;  2PW7 A;  3PIO A;  4A75 A;  3MXN B;  1CHQ D;  3HG9 A;  1CA5 A;  5EBD A;  3BZD B;  1RF2 D;  1L2F A;  3GQB A;  4P74 A;  5E1F A;  3FRP B;  3S16 H;  2H5X A;  2K14 A;  2K75 A;  5LMN W;  1DOL A;  3MEH A;  2L5T A;  3CCU A;  1CTM A;  3VYT A;  3E5S A;  4K2K A;  4IUP A;  4X64 L;  5C3X A;  4YY3 Q;  1A3V A;  4LF9 L;  1QUQ A;  1PFB A;  4K2L A;  1F2Z A;  1K0R A;  4C3I H;  1QUQ B;  3S2H H;  1EOV A;  1FGB D;  5M9O A;  3CCV A;  1Y1V B;  4RA8 A;  4DK3 C;  1UE1 A;  3VR2 A;  1YNX A;  4PMW A;  5LHY 1;  1A3U A;  4IOA A;  5LMU L;  4OEM B;  1STA A;  4P71 A;  4BY7 G;  3J81 c;  4X66 Q;  3CQZ H;  3PO2 B;  2MQH A;  4BXX H;  2R93 B;  4IUR A;  3VYU A;  4ABN A;  3QJY A;  4HTH A;  5I2Y A;  4G57 A;  3TS2 A;  1B7Y B;  1X3E A;  3URY A;  1QIL A;  3UE1 A;  1YNJ D;  4X64 Q;  3TP8 A;  2O4X A;  1X56 A;  1I3Q H;  5DEH A;  2E2D C;  3J7A 5;  3GTL B;  3OWF A;  1V8Q A;  2DNE A;  1GUN A;  3F8T A;  3HOW H;  3D0F A;  5L37 A;  2UUB Q;  1BUV T;  4XQJ A;  1I5F A;  2M00 A;  5IT9 E;  3A8J E;  4A3M H;  1G6Z A;  4KHZ A;  3VA5 A;  4BY1 H;  4ZUJ A;  5EAY A;  4NKL A;  3T53 B;  2AQ1 B;  1OXT A;  2Z6K C;  4DR7 L;  1JOQ A;  1K28 A;  2EXZ A;  2RCF A;  2V4D A;  3S14 H;  1EUJ A;  1PYS B;  4LF5 L;  2SNM A;  1B2T A;  3S1Q H;  4XQN A;  2WV6 D;  5TSS A;  2VB3 X;  5EPL A;  3W1G A;  5EPJ A;  5KND A;  4DR2 L;  1PH8 A;  4L5S A;  5C4X B;  2HQL A;  1STE A;  2A6E D;  4DV4 Q;  2L55 A;  2PCF B;  1O80 A;  4DNI A;  3GTO B;  1S5B D;  1V1P A;  3CRL C;  3DMU A;  5FLM G;  3LWE A;  1XWE A;  3V96 A;  2P5Z X;  1I6V C;  2AKW B;  1V1P B;  1PYW D;  4LFA L;  2F0I A;  2IJ0 A;  2WKC A;  4C3J B;  3FP9 A;  2YU9 B;  4FXD A;  1KL9 A;  4IFD H;  4XTC S;  4DR7 Q;  2N8N A;  3E9I A;  2OTL A;  4X3K A;  1DYQ A;  3S1M H;  1KRT A;  1YIT A;  4X6A H;  3A7L A;  1TKW B;  1HNX L;  5E7N A;  3U9O A;  3E0E A;  2JA6 H;  5IYC G;  2K05 A;  3H0G B;  4M1U B;  4YWM A;  4DR2 Q;  1MBY A;  1PH5 A;  1TXY A;  3PUY A;  3GTM H;  3B6Y A;  4V0B A;  4DAM A;  5CV5 A;  4FXG C;  4I65 A;  3K0X A;  3IRB A;  1OXU A;  1K83 B;  4A3J G;  4HJ9 A;  4LFA Q;  5C5M A;  1CM9 A;  2ATW A;  4LW1 A;  1QB5 D;  3M3Y B;  1FNV A;  2OEO A;  3DWA A;  3JAM c;  2B2U C;  2Q2U A;  1Q46 A;  3R8B A;  4G7O C;  5C5L A;  2HDL A;  3ND8 A;  3RR5 A;  4MTN A;  5JPN C;  1J5E Q;  1HUM A;  1VQD A;  4NP5 A;  4FF3 A;  1SRO A;  1HZC A;  2Z4I A;  2NB0 A;  4XIG S;  4HED A;  4DN4 M;  1HFN A;  4DA2 A;  4HJ7 A;  2A19 A;  4K0K Q;  1F2L A;  3CCR A;  1CHP D;  1GKH A;  2ID0 A;  3PUX A;  1FVI A;  1YHB A;  2UUA L;  1ICF B;  5FK9 C;  4NXN L;  5M5Y H;  4I7A A;  4QY7 A;  2B2V A;  2JEB I;  2M9V A;  4A3I H;  4A93 B;  3PUW A;  5JEA H;  4O0A A;  5IGG A;  2AQ3 B;  4RHR A;  1EWH A;  2EJG C;  2K03 A;  4JW0 A;  1GVP A;  3PO3 B;  4P73 A;  2F0O A;  4J8Q A;  2R92 G;  2K5D A;  1DZ1 A;  4DKA C;  1K3R A;  4A3B H;  4A3K G;  3R2T A;  2UUA Q;  1Q12 A;  2L15 A;  4NXN Q;  1IBK L;  1B3Q A;  2FHT A;  3RMH A;  3T1H L;  3E0J A;  1SND A;  3M4O H;  2BOS A;  2FMC A;  3QO2 A;  1PFS A;  4A3F H;  1BCP D;  4DPG A;  3N52 A;  2JA7 B;  2VL6 A;  2I5L X;  4OGQ C;  4HID A;  2MNA A;  2NZO A;  3SK4 A;  1G51 A;  3LNN A; 
#chains in the Genus database with same CATH homology
 2DN8 A;  3MFY A;  2NVT B;  2L11 A;  4PMC A;  2F0N A;  3V2T A;  5JJZ A;  2TMP A;  2E74 C;  2RBM A;  4PMB A;  3GP7 A;  1V43 A;  3NPP A;  4RKB A;  5T1G A;  2XWJ B;  1SYE A;  1TS5 A;  4KY6 A;  1ML0 D;  1Q3L A;  1JWM D;  5M3F B;  2TSS A;  1FR3 A;  1C48 A;  5I4D A;  5BN4 A;  2L12 A;  1TWA B;  4K5W A;  4R8N A;  2B2W A;  3WDN A;  4X3U A;  2VUM B;  1IKM A;  3EVQ A;  2LS0 1;  4BBR B;  1EFI D;  1SYD A;  1M8A A;  1KAA A;  2FMM A;  3LX0 A;  4HAE A;  4QUC A;  3O13 A;  1JC7 A;  2F3V A;  3IFD A;  4QIW B;  1I6H B;  1VF5 C;  2ZXP A;  3RD4 A;  3HOU B;  1B3A A;  4B08 A;  4K6L A;  1SDF A;  1XXG A;  2E2H B;  1JCK B;  3TZU A;  2KVM A;  1CI3 M;  1CQF A;  3KUP A;  2E2J B;  3EA6 A;  1W6J A;  4IUQ A;  4R9W A;  1ONL A;  4XQQ A;  2K5Q A;  1C8C A;  1R9T B;  4IZ8 A;  3J80 L;  1AZP A;  1G8Z D;  5JVG 3;  1A2U A;  4CJ2 C;  3NQT A;  3TP7 A;  2MPM A;  2F0U A;  2K1B A;  1WTQ A;  1UUP A;  4DU9 A;  3Q24 A;  2LKV A;  5IGB A;  1SNC A;  1LV9 A;  1NAP A;  1EZ8 A;  5LL6 X;  2QIL A;  1EY7 A;  1G91 A;  1LTA D;  1GUS A;  2SDF A;  2NZ1 D;  5E4W C;  4CKC A;  2RDF A;  1QJO A;  4C3I G;  1QCB D;  1TY2 A;  3OMC A;  4K5V A;  3QB3 A;  4OHJ A;  1B9N A;  4FP5 D;  2NN6 I;  4DAV A;  2F03 A;  5JAV A;  5KGU A;  1BNZ A;  1ENC A;  5CBE E;  4F87 A;  3HEJ A;  1HA5 A;  5CYU A;  3FPP A;  1TWH B;  2HCC A;  3ITP A;  4OO1 H;  2CW0 D;  2PZW A;  2H4O A;  5A35 A;  3J7Y W;  1O7Z A;  1JOO A;  3NTI A;  2A68 C;  2WAQ B;  5IGE A;  5ELB A;  3I4L A;  4KN4 C;  1JWU D;  5EJW A;  2R61 A;  2B2V C;  2IT1 A;  4HSP A;  5I9O A;  5KEE A;  1ESR A;  3JAM L;  2K7V A;  5K36 G;  5M3M B;  2ZT9 C;  4N9T A;  4NMZ A;  1KDC A;  2NVY B;  1E0B A;  1SNQ A;  3C1F A;  4RGM A;  1I4P A;  2NVX B;  2JP1 A;  2E76 C;  3FDT A;  4HN7 A;  3F2U A;  2XN9 C;  1SJH D;  4M8A A;  2R6G A;  5E4X A;  3VR6 A;  3P1H A;  1Q8I A;  4IFD G;  1RHP A;  4DF7 A;  4OO1 I;  1I4R A;  3HRZ C;  3AB9 A;  3IFT A;  4DAY A;  4L63 B;  4RFB A;  1PRT D;  3C46 A;  5I2X A;  1IYV A;  2EYO A;  3HS0 C;  4KKT A;  5HGT A;  1LTR D;  1U9R A;  2A69 D;  1Y1W B;  5IGD A;  4RH6 A;  4UDU C;  1I4Q A;  5CV7 A;  1BR9 A;  3TZD A;  1D5M C;  2LMC B;  2K04 A;  2A73 B;  1PLF A;  2EY5 A;  2PZT A;  2K32 A;  1HUN A;  2PW5 A;  3J80 E;  1PFN A;  2KQ3 A;  1STB A;  2B2W C;  2K6A A;  4XXE A;  3SK5 A;  5IIF A;  3FKI B;  3CRK C;  4RGO S;  3SEB A;  3I4M B;  1IHZ A;  5D65 A;  3D4R A;  1CA6 A;  4EGV A;  5CV6 A;  4KI0 A;  1LO5 D;  1SSO A;  1Z6H A;  4OIJ A;  1CFM A;  5FLX L;  4A3E B;  2EYP A;  2EY6 A;  2EYM A;  1TII D;  1OXV A;  1HTP A;  4K14 A;  2MP1 A;  2F0G A;  1R4P B;  2PZU A;  2RA4 A;  5KYI A;  2EE1 A;  3GTJ B;  5K5P A;  4A3D B;  2Q8T A;  3VYS A;  4TSS A;  1DOM A;  2EYH A;  3BYY B;  1TU2 B;  2EYJ A;  2CVR A;  1PMR A;  2KHS A;  3SK6 A;  5CMD A;  2F1M A;  1KDB A;  2KED A;  4MIU A;  2XIW A;  2B63 B;  1RD9 D;  1EY9 A;  5F2D A;  3A54 A;  5C44 B;  1VCI A;  1V1O A;  4PNY A;  1SNP A;  3JAM E;  2ICE C;  4RAU C;  2B2Y C;  1PTO F;  1HQM C;  5KIX A;  1F9S A;  1U4P A;  1HHV A;  1SNM A;  3T13 A;  3ERQ A;  1BO0 A;  1LT5 D;  5CR3 A;  2O5J C;  1VMP A;  5BN3 A;  1WD0 A;  1GUT A;  5ISR A;  3Q6S A;  1KDA A;  1TQO A;  5CC4 A;  5J1Z A;  3VYR A;  4IUU A;  5D3D A;  5I6Y A;  1IL8 A;  1ESF A;  4RKL A;  3HOZ B;  2OT2 A;  2ICI A;  3IKJ A;  3RZD B;  1F2Y A;  2G9H D;  3RZO B;  4BY7 B;  3M85 A;  2E75 C;  5BN5 A;  4Q5V A;  3NBH A;  3MC0 B;  4B9W A;  5K36 H;  1X3P A;  4IUV A;  2JA5 B;  1TWG B;  2CHB D;  2NWG A;  2BE5 C;  1B4O A;  1T5E A;  1SE2 A;  1B1Z A;  3TSS A;  2XRQ D;  1NCV A;  4B9X A;  4AYB B;  4RGN A;  5C6A A;  1HXY D;  1L0X B;  3QOL A;  1EY0 A;  4V19 0;  1CQV A;  3S1R B;  4F88 A;  1ENA A;  4ZRZ A;  1D2B A;  4CKB A;  4DNT B;  3NHH A;  4I7Z C;  5FLX E;  1DON A;  4WJW A;  2C5C A;  3I90 A;  1E2W A;  2QDB A;  5IOD A;  3QOJ A;  1HPC A;  4H7B A;  2IPK D;  4Y7N B;  2IWH A;  1IYU A;  2NBF A;  4RGT A;  4X3T A;  3DXJ C;  1SYC A;  3VR5 A;  1HRJ A;  1KNA A;  3OSO A;  2NUC A;  3J7A V;  2QF7 A;  2Z8L A;  1EIH A;  3GTP B;  2F0H A;  3V05 A;  1I50 B;  1SXT A;  5KRU A;  1B53 A;  1LT6 D;  3NUC A;  4OO1 G;  1EZ6 A;  1EYA A;  3U9S A;  1WTR A;  1PDQ A;  1SMY C;  1STN A;  5CV4 A;  5KNC A;  2A74 C;  4Q0F A;  3KF8 A;  1WTX A;  3S17 B;  1D5Z C;  3L7Z C;  2XRS D;  3BDC A;  3AMU A;  1OXX K;  1STY A;  2RKS A;  3D6W A;  3T16 A;  1L0Y B;  4FO2 A;  4KTA A;  5JOB A;  4K8J A;  1CT1 D;  1DOK A;  2F0L A;  3NTK A;  4L8J A;  3D3R A;  1TT2 A;  2EJF C;  3RUZ A;  1ZEQ X;  4O42 A;  3AU7 A;  4ZK9 B;  4YIJ A;  2RSO A;  4ID6 A;  2BE5 D;  5DNF A;  1GUG A;  1PTO B;  3OOC A;  2PPB C;  2RDH A;  2NTT A;  3Q22 A;  2G9D A;  1VDZ A;  1VMC A;  5C0X I;  5EKK A;  1U4M A;  4GZY C;  1JE4 A;  4K8I A;  4DGZ A;  3J7A F;  2R92 B;  4DNR B;  1Y8O B;  3QWN A;  1S4Z A;  3Q0A A;  2KJX A;  5FO8 B;  1ET9 A;  1FYC A;  2WAC A;  2EVB A;  1GOZ A;  1RCV D;  2J7Z A;  4RCN A;  3HKZ B;  1F9P A;  3MWY W;  2C9O A;  4KD4 A;  3S9W A;  5C0X J;  3LWU A;  3ONA B;  2D5D A;  4EQP A;  2WB1 B;  1EEF D;  4KKS A;  4WRD A;  1EOT A;  1MI2 A;  1GUW A;  4UAI A;  3R93 A;  2F0J A;  4E6I A;  1I4X A;  2O2L D;  1GXD C;  5JVH 3;  1K8M A;  2X6G A;  2F0T A;  4TQU S;  3P75 A;  2WP8 J;  4WFN 3;  4IQZ A;  1EIG A;  3KLS X;  2HQE A;  4BWG B;  5D3I B;  1SBB B;  3IL8 A;  3FVQ A;  3P20 A;  2BA1 A;  2RDG A;  4CKE A;  3H09 A;  1UAP A;  3I70 A;  5CV9 A;  2NN6 H;  2HDM A;  3J81 L;  4KJO A;  4MHE A;  1DJR D;  3VR3 A;  3TN2 A;  5CV8 A;  2EYL A;  1RTO A;  3KLR A;  1TWC B;  1MD2 D;  1H9K A;  5ELE A;  5FO7 B;  5C4J B;  2K01 A;  5NUC A;  2Z1C A;  3QIA A;  2AUJ D;  1U4R A;  3A8I E;  2N55 A;  4H0L C;  3OMG A;  2B8G A;  4OIK A;  4KY7 A;  1B44 D;  1W6K A;  4TRD A;  3MXG A;  2ENB A;  5EQ0 A;  5LL6 S;  2D62 A;  1JWS D;  3ERO A;  1NUC A;  3PMF A;  4BA2 I;  3TME A;  1RDP D;  1R4Q B;  3BYT B;  1D6E C;  4C1N K;  3C3L A;  3GTG B;  1TR5 A;  2AQ2 B;  3PUV A;  3X3N A;  3K6O A;  4MN3 A;  3VA7 A;  3I72 A;  2H1E A;  5G3L F;  3RLF A;  3N6R A;  1Q90 A;  1KNE A;  4L6T B;  1RJT A;  4CJ0 B;  2EYF A;  1LT4 D;  4PV1 C;  1EYD A;  1AN8 A;  4KHV A;  2F0V A;  2IW3 A;  4C3I B;  4ILW A;  3S2H B;  5C4H A;  2FFK B;  1STH A;  1HCZ A;  1UNS A;  1KTK A;  2RQX A;  4QMG A;  1WTW A;  3PIO 3;  3BG3 A;  2OXP A;  1ZYR C;  1PTO H;  3I8Z A;  3DWQ A;  1H9J A;  1SYF A;  2Q8I B;  4DK1 A;  1Q1B A;  1LAC A;  2RSN A;  2K28 A;  1YNN C;  1PTO C;  5C3W A;  2B39 A;  2F0E A;  4A3M B;  3I73 A;  4R8I A;  2VNU D;  4HR7 B;  1VF7 A;  5EPK A;  2A6H C;  1A15 A;  2LY7 A;  4QF4 A;  4C1N I;  3TDQ A;  3S1Q B;  2IL8 A;  1ENF A;  2NYZ D;  1SE4 A;  4BBS B;  1BCP B;  4FNF A;  2FIN B;  2Z4H A;  3M7N A;  4FYD A;  1ET6 A;  2QKI C;  1E2Z A;  3K5O A;  4WOR A;  1F2M A;  2IX1 A;  1Z47 A;  4BS9 A;  2JYO A;  3J81 E;  3MAQ A;  4FF4 A;  3S1M B;  2Y0S B;  3SE0 A;  3MTS A;  2J4X A;  3K59 A;  5KYL A;  3W3A A;  1I4G A;  2L4N A;  1H9S A;  5IGC A;  4C3H G;  5C0X G;  3GTM B;  1Z7T A;  3K5M A;  1QWY A;  1JB3 A;  2B2U A;  1H9S B;  1SE3 A;  1JR0 D;  1T5X D;  1J8I A;  1JOR A;  1C4Q A;  4JK1 C;  2BDO A;  2A68 D;  1AFP A;  1A6X A;  3KBX A;  1TS3 A;  1J9O A;  3GV3 A;  1QNK A;  5COY A;  4FVM A;  4KV6 A;  4HSV A;  5IOC A;  1YNJ C;  4FF2 A;  1B9M A;  3MXP A;  3ZYY X;  1SAP A;  2I07 B;  1TWF B;  5FKA C;  2DY7 A;  1Y69 U;  5M5Y B;  2KEE A;  2F0F A;  4A3I B;  1GUO A;  3GD7 A;  1TS4 A;  3X3M A;  1HA6 A;  1CZG A;  5DM6 3;  1GHJ A;  4RHS A;  1AEX A;  2D2C C;  1FNW A;  4PQX A;  5C3E B;  4DXG A;  3DUZ A;  3NK9 A;  2EY1 A;  4CHT B;  1GHK A;  2EOT A;  4OL7 A;  4G7Z C;  1QG7 A;  1EEI D;  3G6J B;  1D1I A;  1EY4 A;  3H6M A;  4K6D A;  3FMC A;  2CQA A;  3OWE B;  3D8G A;  4KD3 A;  3BS1 A;  5ELF A;  1NR4 A;  2LFN A;  4KMU C;  2KEC A;  1MGS A;  1EY5 A;  3DWP A;  1X3Q A;  4CBV A;  1TS2 A;  4IUT A;  2F3W A;  2NVQ B;  4G7H C;  2F0P A;  4KJN A;  5FO9 B;  5D14 A;  3QG1 A;  1BBX C;  1EQT A;  1Y8N B;  5EKI A;  1EY8 A;  3M4Y A;  2QEJ C;  5EKL A;  2MUY A;  3L3O C;  3C2P A;  3GTK B;  2BCO A;  2XWB B;  2EDG A;  4QB4 A;  1BXT A;  1FNU A;  5M5W B;  2NN6 G;  3TP6 A;  2ZXR A;  4NDX A;  3K57 A;  1HTL D;  1TVX A;  4FXK C;  1CZW A;  5I9P A;  1LTS D;  1F77 A;  1II3 A;  2XSC A;  4C3J G;  2JE6 I;  5CBA E;  3H3V C;  4KN7 C;  4RWS C;  1QOH A;  4ZKC B;  1LTB D;  3HOV B;  1Q1E A;  3CKI B;  3H94 A;  4LK1 C;  4HMI A;  3NP8 A;  2MJ8 A;  2HUG A;  1ZKO A;  3CU7 A;  1I4H A;  1OXS C;  1BCP C;  4Z9C B;  2D9U A;  5HUR A;  3PUZ A;  3A8K E;  4C2M B;  2F0M A;  3SHL A;  1STG A;  3R2I A;  5EGT A;  1PRT B;  1X32 A;  1F9R A;  5CGK A;  1KLU D;  3S15 B;  5E3F A;  1BQQ T;  5IGF A;  3GO5 A;  1ROD A;  1DD2 A;  3D4W A;  2L9H A;  3H91 A;  3A56 A;  3Q23 A;  1Y8P B;  3MZ5 A;  4J6H A;  5C0X H;  1BOS A;  2EPB A;  4ME5 A;  2I46 A;  2PQE A;  2R7Z B;  3WOE A;  1RKN A;  4A3J B;  1D1K A;  5ELC A;  2F0K A;  3SR1 A;  1A3T A;  3K0Y A;  4QUF A;  3NBI A;  4LAA A;  1S5E D;  1NSN S;  1S5C D;  4IFD I;  4EVO A;  1WTP A;  3S1N B;  1AP0 A;  1GJX A;  2F4I A;  1SFO B;  1O7Y A;  3MHB A;  5M5X B;  1EY6 A;  5KNB A;  1OO9 B;  2F0W A;  4HMJ A;  2BA0 A;  4A3G B;  3ND9 A;  3UI2 A;  1S5F D;  1ILP A;  3HGB A;  4K5X A;  3CHB D;  4DFA A;  4G4K A;  5A2Q L;  1LLR D;  5DM7 3;  4IFD J;  2EZV A;  1EYC A;  3WOF A;  1B50 A;  1U4L A;  4A3K B;  3MXU A;  1XYI A;  3SXH A;  3EFX D;  1K8O A;  3KLS A;  1WVL A;  1EU4 A;  1O7L A;  1QNU A;  1WTV A;  2JSO A;  2SEB D;  3TP5 A;  1SNO A;  3KBG A;  3HP3 A;  3NQI A;  1G2T A;  3FEW X;  2SNS A;  1F9Q A;  2NTS A;  2ZXO A;  1IKL A;  3BDO A;  1SMY D;  1BCP F;  2MGS A;  1EQV A;  1LT3 D;  1EWC A;  3E6Z X;  1TY0 A;  2B8F A;  5EBC A;  4N9P A;  2X69 A;  3A55 A;  3OIQ A;  4F7X A;  5JEA J;  4HCS A;  3SK8 A;  1LTI D;  3I4N B;  2CW0 C;  2EY2 A;  4XYQ A;  1WD1 A;  2WKD A;  3PV0 A;  2JEA I;  5DAU A;  5C4Z A;  3GTQ B;  2KCN A;  5AFW A;  3A7A B;  4LJZ C;  2PO4 A;  1BF4 A;  2FJ2 A;  4H44 C;  2O5I C;  2M2L A;  5ELD A;  1UEA B;  2IX3 A;  3NWT A;  1FD7 D;  3DHQ A;  3M7G A;  1G29 1;  1SEB D;  1WCM B;  2JXM B;  4EQO A;  3HOX B;  2PNR C;  2XNA C;  2B2T A;  2KOL A;  3NXW A;  2DY8 A;  4KK7 A;  3BDL A;  5G3L D;  4XDX A;  3GV6 A;  1D5X C;  3I3C A;  3W2D A;  4F8M A;  1SYB A;  3P7J A;  3T56 B;  1DM0 B;  2F0S A;  2A5H A;  4O1N A;  4KKU A;  1DCZ A;  4IN3 A;  1XX8 A;  2HCI A;  2DNC A;  1PRT C;  1ZXT A;  3K5L A;  1CK1 A;  3HOY B;  4XT1 B;  3K58 A;  1NR2 A;  2N88 A;  2B2Y A;  2Q8R E;  1M4V A;  3T4A C;  4CJ1 B;  3S16 B;  2A69 C;  4XT3 B;  4DXF A;  1PFM A;  5JPM C;  4DAP A;  5A2Q E;  2E2I B;  5COR A;  4P2C B;  4FF1 A;  1PXU A;  4DK0 A;  2VXW A;  1E2V A;  1KAB A;  1S5D D;  3HZX A;  4JBW A;  1IW7 C;  3NTH A;  2R3Z A;  3OHX C;  1LTG D;  3CQZ B;  4LMQ D;  4X3S A;  2YYZ A;  3VR4 A;  2F0Q A;  3BVZ A;  3EJI A;  3OPO A;  4ULL A;  3G7L A;  1I3Q B;  3NWS A;  2K33 A;  3DEO A;  2JA8 B;  4QCL A;  3SVM A;  2AWO A;  5T1I A;  3HOW B;  2OF1 A;  2VB2 X;  1LAB A;  4ZAI A;  3R3O A;  1XTC D;  4BY1 B;  4IUN A;  2BDN A;  4CGY B;  1G2S A;  1SYG A;  4C56 C;  3IAY A;  4J1M A;  3S14 B;  4ZYS A;  2PMZ B;  4XYO A;  4BA1 I;  2PYK A;  2RVL A;  4S3S A;  3L9A X;  2KA7 A;  3NSW A;  4ODG A;  1EL0 A;  4HCE A;  2J0T D;  4U68 A;  3K5N A;  3DM1 A;  5J39 A;  1AW7 A;  3I91 A;  5IT9 L;  1BDO A;  3MVV A;  2JA6 B;  2F0D A;  3TBI B;  3BVM A;  2QCP X;  4ZKB B;  1KLG D;  4IAL A;  1PZK D;  3D6C A;  4NW2 A;  2WII B;  3K7A B;  2AUK A;  1JOK A;  1LTT D;  3OW7 A;  3DEP A;  2IX0 A;  2KUM A;  5FOB B;  2L0C A;  5I6W A;  2K5W A;  5J22 A;  3D31 A;  1O78 A;  1ILQ A;  4H13 C;  1PRT F;  1IW7 D;  1EU3 A;  3PIP 3;  3C1E A;  1WTO A;  1AZQ A;  2SOB A;  3MFG A;  4ZLT F;  4ZQ3 A;  4TKO B;  1HQR D;  4C3H B;  1ZYR D;  1DXM A;  1ICW A;  5JEA G;  2XVS A;  1H9M A;  4ZUI A;  4U67 3;  3SDZ A;  2EJM A;  3EQL C;  4RCO A;  1H9R A;  3OIP A;  1JIC A;  1YNN D;  1PTO D;  3BVG A;  1PZJ D;  3S2D B;  2MHV A;  1HFG A;  1MSH A;  1MSG A;  4KY5 A;  2AWN A;  2A6H D;  1A2T A;  4EQN A;  2WIN B;  2L1B A;  2B2T C;  3D4D A;  4A3B B;  1RTN A;  2A6E C;  3T51 B;  3MA2 B;  2X6L A;  2GA4 B;  3M4O B;  3NE5 B;  1SJE D;  1QE6 A;  3FPU B;  4A3F B;  3MXN A;  3KK7 A;  1JQY D;  1PZI D;  2KCC A;  2PW7 A;  1CHQ D;  3HG9 A;  1CA5 A;  5EBD A;  3BZD B;  1RF2 D;  3GQB A;  5E1F A;  3FRP B;  1DOL A;  3MEH A;  2L5T A;  1CTM A;  3VYT A;  3E5S A;  4K2K A;  4IUP A;  5C3X A;  1A3V A;  1PFB A;  4K2L A;  1F2Z A;  1FGB D;  5M9O A;  1Y1V B;  4RA8 A;  3VR2 A;  4PMW A;  5LHY 1;  1A3U A;  1STA A;  3PO2 B;  2R93 B;  4IUR A;  3VYU A;  4ABN A;  3QJY A;  4HTH A;  5I2Y A;  4G57 A;  3URY A;  1QIL A;  1YNJ D;  3TP8 A;  2O4X A;  5DEH A;  2E2D C;  3GTL B;  3OWF A;  1V8Q A;  2DNE A;  1GUN A;  1BUV T;  4XQJ A;  2M00 A;  5IT9 E;  3A8J E;  1G6Z A;  4KHZ A;  3VA5 A;  4ZUJ A;  4NKL A;  3T53 B;  2AQ1 B;  1OXT A;  1JOQ A;  2EXZ A;  2V4D A;  2SNM A;  1B2T A;  4XQN A;  2WV6 D;  5TSS A;  2VB3 X;  5EPL A;  5EPJ A;  5KND A;  5C4X B;  1STE A;  2A6E D;  2L55 A;  2PCF B;  1O80 A;  3GTO B;  1S5B D;  1V1P A;  3CRL C;  3DMU A;  3LWE A;  1XWE A;  3V96 A;  1I6V C;  1V1P B;  1PYW D;  2F0I A;  2IJ0 A;  2WKC A;  4C3J B;  2YU9 B;  4FXD A;  4IFD H;  4XTC S;  4X3K A;  1DYQ A;  3A7L A;  1TKW B;  3U9O A;  2K05 A;  3H0G B;  4M1U B;  1MBY A;  3PUY A;  4V0B A;  5CV5 A;  4FXG C;  4I65 A;  1OXU A;  1K83 B;  5C5M A;  1CM9 A;  1QB5 D;  3M3Y B;  1FNV A;  2OEO A;  3DWA A;  2B2U C;  3R8B A;  4G7O C;  5C5L A;  2HDL A;  3ND8 A;  5JPN C;  1HUM A;  4NP5 A;  4FF3 A;  2Z4I A;  2NB0 A;  4XIG S;  4HED A;  4DN4 M;  1HFN A;  4DA2 A;  1F2L A;  1CHP D;  2ID0 A;  3PUX A;  5FK9 C;  2B2V A;  2JEB I;  2M9V A;  4A93 B;  3PUW A;  5JEA H;  5IGG A;  2AQ3 B;  4RHR A;  1EWH A;  2EJG C;  2K03 A;  3PO3 B;  2F0O A;  4J8Q A;  2K5D A;  1DZ1 A;  3R2T A;  1Q12 A;  2FHT A;  3RMH A;  3E0J A;  1SND A;  2BOS A;  2FMC A;  3QO2 A;  1BCP D;  3N52 A;  2JA7 B;  4OGQ C;  3SK4 A;  3LNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...