2I46A

Crystal structure of human tpp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
b'SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenocortical dysplasia protein homolog
publication title The POT1-TPP1 telomere complex is a telomerase processivity factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2i46A00
5I2XA 2I46A 5I2YA 2M9VA
chains in the Genus database with same CATH superfamily
1TS5A 2PQEA 1H95A 1CKNA 5J22A 4JC0A 3G48A 2NVYB 4L8JA 4N9TA 3E9HA 2OTJA 1RL2A 1EIFA 1D6EC 4GKKQ 4RAUC 5CMDA 1G6ZA 3DHQA 3K81C 1UNSA 1JCKB 2B8GA 4P2CB 1D2BA 1MD2D 3HOUH 3HOWH 2CHBD 4YWMA 2R7ZG 1SNDA 1PH6A 4GN4B 4RGMA 2EJGC 2NZ1D 1FJGQ 2GA4B 1KDBA 2MNAA 3BVGA 3GV6A 3VYTA 4JVZA 2NVXB 2IX3A 4BY7H 4A3DH 2O5JC 1AW7A 3RUZA 3TMEA 3I55A 2QDLA 4C56C 1V1QA 3EJIA 4ILWA 1CSQA 3M4QA 4ME3A 4MTNA 1SNMA 1CQVA 5KNDA 3Q22A 3RZOB 3S14B 4BY1G 4TSSA 5IYBH 2NWGA 5D14A 4BS9A 1X6OA 3S17H 1L0XB 2F0VA 3PQIA 1M90C 2AQ3B 4JI3L 2BE5C 1GXDC 2PW5A 4J6HA 1YBYA 1JJGA 3I4NG 2KBNA 1AH9A 1H9SB 2I5LX 2R93H 1FYCA 2KCMA 1PRTC 3GTQB 4A3GG 1K83H 1W6JA 1WTXA 2VXWA 2BDOA 1PV4A 3SDZA 3KUPA 1SAPA 1TVXA 2FHTA 2XWJB 4H02A 3VYUA 1BBXC 1VQ9A 1EL0A 5C4XH 2I0QA 1WOCA 2JA5H 5C3XA 3TSSA 4K2LA 2L0CA 2VB3X 4A3MH 4POGA 3QG1A 3QO2A 3T13A 5LMUQ 2RSNA 3FPPA 1UE1A 3A55A 4GNXB 3HOYG 4K0KQ 1B1ZA 3ULLA 1WD1A 3T1HQ 3FKIG 4HMIA 1VQ6A 1D1IA 1DD2A 1RDPD 1BCPD 4ID6A 1ICWA 4TQUS 1LACA 1ASZA 1UE7A 4HEDA 4PV1C 5CR3A 2JA7G 5M5WB 1JT8A 1L0YB 1XJVA 4IFDH 3NQIA 4N8X1 1IL8A 1XMOL 1V8QA 4IZ8A 4BBSB 3CW2C 4YIJA 4QJFA 4POFA 4JCVE 2KJXA 3FDTA 1PA6A 2UXCL 4LF8L 1A63A 1NSNS 3KJOA 2ALYB 2PMZE 2HIXA 1IBML 1PH1A 5K36H 2F1MA 3CQZH 3H6MA 3OSOA 4A3KB 2JA6B 2G9HD 3VR2A 2MP1A 2LY7A 1OXXK 3K6OA 4JBKA 3PO3G 3KLRA 2ENBA 3M7GA 4OHJA 4LF8Q 4A3EH 1A8VA 3HP3A 4KN4C 3TRZA 1HFGA 1TY0A 3T53B 4ODGA 4BWGB 2B2TC 5FLMH 4WJ4A 2WACA 4U673 1R9TH 1D5ZC 2FFKB 1B3QA 2SEBD 4IUVA 4G7HC 4A3FB 1E22A 3D4RA 1WTQA 4R4TA 2DUDA 5GAEC 1L1OC 1AN8A 5ISRA 2JA9A 3TZUA 4JYAL 4LFCQ 4P73A 2M00A 5ELCA 1JORA 1D5XC 2PMZB 3T16A 1Y69U 2VUMG 3I91A 1XNRL 1WJJA 1VQIA 4OGQC 4UP8A 5C3EG 2A8VA 2CWAA 4HIDA 4C2MH 4F87A 3I3CA 4AYBE 4J8QA 1X65A 2RHQB 4TRDA 5M3MH 2I5MX 4R8IA 5AJ3Q 2NVTH 3M4OB 2MQHA 2NN6I 3NHHA 1TWGB 2CVRA 1JWMD 4K8JA 5LL6S 4KHVA 2H5XA 2F0IA 1WVLA 3PIO3 1XNRQ 1C8CA 2B39A 4OIKA 1S5DD 3S2DB 3O13A 1L2FA 5IODA 1NNXA 3AFQA 2IPKD 3W3AA 1SEBD 3VR3A 1RCVD 1C48A 2PPBC 1BUVT 4KJNA 5IT9L 2RCFA 3L0OA 3SR1A 2ICEC 1XX8A 2XRQD 3AQQA 2F0OA 2OXPA 1JB3A 1BNZA 1I6HB 1N33L 1RJTA 4X62L 1SMYD 4DU9A 3KJPA 2QDBA 1U5KA 2IW3A 2Q8RE 1VQOA 4JK1C 2E2IH 5ELDA 1DYQA 5A2QE 4FXKC 3EVQA 1E2ZA 4IOAA 4AYBB 4LFBL 3S9WA 3W5OA 2YV5A 5E3FA 4R9WA 1X3FA 2RQXA 5JJIA 4YCUA 1V9PA 4DV1L 4K5VA 1U9RA 4NDXA 4XYOA 1SE3A 3OIPA 4X62Q 2E74C 1YHAA 2A19A 5HGQA 1N34Q 5AFWA 3U9OA 3D3RA 4YHHL 4KLKA 1C0AA 3J80i 5IP9G 4F8MA 3V2TA 1OTCA 1YNJD 3BDCA 5C4JH 1VMPA 4IURA 3LWEA 1S5FD 1HHVA 5IYCG 1JOKA 1V1PA 4DV1Q 1KNEA 2JE6I 2TSSA 3LX0A 1A3TA 3H91A 2J4XA 3U4ZA 1B50A 5FO7B 3T1YQ 1LUZA 1LT5D 4HCSA 1YJ9A 1PTOB 5FLXc 3J80E 3GTKH 4GN3B 1IYVA 3TP8A 1R4QB 1HRJA 1STBA 4YHHQ 4XYQA 4HSPA 4GKJL 2NBFA 4LF7L 1OXUA 1CZWA 4KY5A 3K5MA 3S2DH 4P75A 2ZTDA 2RF4A 4X66L 3H0GB 3GTPB 2JEBI 2RKSA 3EA6A 1A2UA 2EXZA 4KV6A 4ZK9B 3GTJB 3ER0A 3L7ZC 1N32Q 1CHPD 4M8AA 4KHPL 4X65L 4XQNA 5E4WC 5GAGC 2DY7A 4DV4Q 2EQSA 2HCCA 1BBUA 2ZXPA 2UXBQ 5JJKA 4DR7L 4OO1I 3C2PA 2IY5B 3A8KE 1K3BC 2B63H 2UU9Q 3ICEA 3S1NB 2K05A 2ZM6L 1SNCA 2AWNA 2DJFC 2IHEA 5D65A 4PNYA 3PO2B 2UUCL 1VF5C 3K5OA 2PZUA 4X65Q 4XQJA 4R1JA 2WB1E 2CQOA 2WIIB 4LFAL 5C44G 1Q82C 3DM1A 5HURA 1QVCA 1U4PA 1H9RA 3OWFA 1Z7TA 4JW0A 1X9NA 2RDFA 1J5EQ 3L9AX 5ELFA 4YWKA 3WOEA 3A5UA 3DM3A 3U9SA 5ELOA 3K8AA 3QB3A 4BA1I 3S1RH 4A3CG 5JJZA 1RF2D 1GUGA 3KDFA 1Q81C 4XTCS 1DXMA 5C4HA 3I4MB 4DAYB 4EQNA 1YI2A 1GUOA 3M4PA 5GROA 1EY8A 1K28A 5NUCA 1YIJA 1Y1WG 3H94A 3I70A 3MC0B 3S1QB 5G3LF 3UI2A 1NAPA 4BBSG 4DV7L 4LNQA 1CHQD 4K8IA 3GTPH 3S2HH 2NZOA 1B7YB 3CPFA 4Y7NH 2O2LD 1MI2A 2B2UC 3OPOA 2WB1B 4IQZA 1WCMB 3CCEA 4JI1L 4A93H 4RH6A 1RD9D 4A3KG 1PRTB 5BN4A 3MFYA 2JSOA 2M2LA 3J81L 3MHBA 4A3BB 1G291 4HJ7A 2NVQH 3N6RA 1V1PB 3OMGA 1PH8A 4KHZA 1QB5D 1YJWA 4DR5Q 1II3A 5C0XG 4O2DA 3OTOQ 1CSPA 1XPRA 1MJEA 2AUJD 2GVBA 1FL0A 3CF5A 3MEHA 1EQRA 2IX1A 4O1NA 1T9HA 2BE5D 3NE5B 2HDLA 3NTIA 4A3FG 1A2TA 4CJ1B 4OXPA 2JA8H 2WP8J 3TEHB 1ICFB 4B3MQ 4RA8A 1P8LA 4DK3C 5BR8Q 1VQJA 3GP7A 4MTKA 1ENFA 4GS3A 2XWBB 3ONAB 4ZQ3A 3CHBD 1U4RA 5JVH3 4DUZQ 4L5RC 1K0SA 1BQQT 2A68C 4JI8L 4A4IA 3IFTA 4DV5L 5M5YB 2PW7A 5LHY1 4OX9Q 1U0LA 2CH4W 5JAVA 1EQTA 1G6PA 3NWSA 1G51A 4I7ZC 1ET6A 4DA2A 2F0SA 2LFNA 3BZCA 5C5MA 4JOIA 4OEMB 3BDOA 1I94Q 3HS0C 2R7FA 1WTOA 5FLXE 2VQEL 3C3LA 4PZ6A 4ZLTF 1YHBA 1HJPA 2R6GA 4B9XA 1D5MC 5DAUA 3AMUA 1VMCA 4A3JH 4DV5Q 5C6AA 1H9MA 1IKLA 2EY2A 1SYGA 3SXHA 1SNOA 3HOUB 3HOWB 1H9KA 4RKBA 4DNTB 1F9QA 2F0DA 1LT6D 4UP9A 3DLLA 3H09A 4LF6L 4A3BH 2IJ0A 1V1OA 5CV7A 5JEAJ 2K5NA 3P75A 3W2DA 3CCJA 1XXGA 1VQHA 1TQOA 2VQEQ 4ZAIA 1QILA 1UAPA 1J9OA 4BY7B 1L1OB 5IGCA 3HOYH 4HJ8A 2R61A 3GD7A 4L5QA 1YITA 1FNVA 2EXDA 1TY2A 3NP8A 4RHSA 5IGEA 2NN6H 1PDQA 1U4MA 3PIOA 1FNUA 1S5CD 2EY1A 1R4PB 1ML0D 1SE2A 4GNXA 1YNND 2NUCA 1QJOA 1JJ2A 4JI6Q 1HR0L 1Z6HA 2JN4A 4DR6L 3AYHB 2A6HC 4DUYL 4BXXG 1TXYA 4IUUA 4PMWA 1ZKOA 3NTHA 4A3IH 2LSSA 2R93B 2UXDL 4B9WA 1E2WA 2V4DA 5GAHC 3A7AB 2EOTA 2A6EC 2SNMA 3PO3H 5C4XB 5M9OA 4Q5VA 3TN2A 1RHPA 2JA5B 4NXNQ 3R8BA 4V0BA 4B3SQ 4IUNA 3UDFA 4A3MB 1U4LA 2LKVA 4WJ3M 3I73A 1LTAD 4B3RL 3CRLC 5KYIA 1ASYA 1T5XD 5CV6A 4CDDC 1NR2A 4H7BA 5EPJA 4C3JH 2AKWB 1BCPF 1FVIA 3A7LA 3MXNB 4IPGA 4K14A 3T56B 5IP7G 5CV9A 4DAMA 2A73B 3E3XA 4DPGA 4X6AH 1GM5A 2NYZD 1QNKA 2N88A 1E3PA 2ZJRA 1O7ZA 3FHWA 1SNPA 2PYKA 4DV3L 4X3UA 1IW7C 4J1MA 4EQPA 1JB7A 4X64L 3NEMA 1EOVA 2MGSA 1HNXL 1PH9A 2Y0SG 3PO2G 5HY6A 3PIPA 4KKSA 5DM63 5T1GA 3CQZB 4E6IA 4QB4A 5I2YA 5KRUA 2HUGA 1QE6A 1SN8A 2R92B 3I7FA 2VB2X 1WTPA 1PYWD 2I5HA 1NTGA 5LMNL 4L63B 4P71A 1M8AA 5I6WA 4B3TL 1HA6A 3PGZA 1B8AA 5IY0A 3TS0A 5ELEA 1GHKA 4A3EB 4WJWA 1ZEQX 3T4AC 4DV2L 3QIAA 2O4XA 2JQOA 3AEVA 1N8RC 3S16B 1Y8PB 2K50A 5D3IB 2OQKA 2WINB 2Z4IA 2ZTEA 3FMCA 1R9TB 1MIUA 4Z9CB 2FMCA 1S3OA 4P72A 4OO1H 5LMNQ 1TWCB 4JI3Q 2F0PA 3D0FA 1JQYD 4UAIA 2Z6KC 4HJAA 1DZ1A 2OWOA 4QCLA 1Y1VG 1K9MC 2KCCA 4C2MB 3J80c 4AQYL 3RD4A 2A69C 3IRBA 2F3VA 1EFWA 1XTCD 1WTVA 1WCMG 2BA0A 3CD6A 5M3MB 3CCVA 1IL2A 1STNA 2NVTB 2FJ2A 1GUWA 2PI2E 1QUQB 2R7DA 2PNHA 3BYTB 1EFID 3HKSA 5EAYA 5JPMC 2JEAI 5GADC 1D1KA 3GV3A 3TBIB 3STBD 2B2WC 1HZ9A 1HNZL 3WDNA 4C1NK 3HGBA 2UUBL 4O0AA 3E6ZX 1E24A 2RSOA 4IOCA 4KKUA 3M9BA 3X3NA 3CCRA 1ESFA 3Q8DA 2F0EA 4YY3L 1BOSA 1YVCA 1C4QA 3HOZH 2K75A 4L6TB 2R92H 4L5SA 1QNUA 3DXJC 2UUAL 4JBMA 1XMOQ 4A3LG 3GTOB 1I4HA 2E2IB 3I4LA 3BDLA 3ULJA 5COYA 4GOPC 1ENCA 5IYDG 4CHTB 4KY6A 1EWCA 3HOXG 2UXCQ 3I72A 1CKOA 3P1HA 3C1EA 1IBMQ 1LTLA 3LNNA 3FPUB 3G71A 3K57A 2HDMA 3S16H 1GUNA 1CQFA 1F9SA 3HRZC 5IGGA 4IFDJ 5IT9E 3GTGB 1N36L 2Z8LA 4N8FA 1AE3A 1EY9A 1BR9A 4HIMA 3NQTA 2UUAQ 3K7AH 4ZCKA 1EYAA 1LTRD 4YCWA 4WORA 1SDFA 2WAQG 2HHHL 1TWCH 2D5DA 3J7YW 5A35A 2Q2HA 2YTVA 4NKLA 1ZYRC 5C4JB 2ZXRA 4LF5L 2WKDA 2IWHA 2MHVA 4JI7L 4K5WA 2C35B 4DAPA 1AFPA 1BF4A 4Y52H 1TR5A 1K0RA 3UE0A 3KF8B 4H44C 1SROA 3HOWG 3EIVA 3P20A 3BJUA 3SE0A 4OIJA 3GTKB 4PQXA 1CFMA 1I4XA 4C3HH 1K3RA 3J81j 2PZTA 4JYAQ 1SFOH 3KF6B 2B29A 4JBJA 1PH4A 2B2VC 4KY7A 3VR5A 3CCMA 1KLUD 1VDZA 3NBHB 4BY7G 4A3DG 4BBRH 3ZYYX 5EKLA 1EZ6A 1LM0A 1TS3A 2XGTA 4DV6L 1RIPA 2KENA 3JAMi 4HMJA 2KHSA 1VQDA 1SYFA 1OO9B 2KEDA 3KYHC 3E5SA 1I5FA 4S3SA 2CWPA 2J0TD 1GVPA 1KNAA 2E75C 5DNFA 2AHOB 5IYBG 3RLFA 2OTLA 1A0IA 4KD4A 2ES2A 2C5CA 1O7IA 5IGDA 3GTOH 4DAYA 2KEEA 2NTSA 3W1GA 3MXPA 1PHJA 1OXVA 2HQEA 4DV6Q 2B63B 4EX5A 2PZWA 2CW0D 1X55A 2QGQA 3A56A 5EPKA 4HTHA 1NR4A 1KQSA 4QUCA 3LWUA 3GTGH 3RZDH 4PZ8A 5JJLA 1HCZA 1I4GA 3DUZA 1PMRA 1N33Q 2K5HA 3M4YA 5T1IA 5M3FH 4FXDA 3KBGA 5C4XG 2EY6A 1Z47A 5I6YA 1MHWC 2JA5G 2FXQA 2IL8A 2QEJC 2EYPA 4UPAA 4XT1B 1LTID 2E5LL 4LFBQ 2NB0A 1LTSD 3GTLH 5EBCA 3S1RB 3DWAA 1EEFD 5FJ8H 4JI2L 2RDHA 3R93A 2AUKA 1TWAH 2E76C 2KOLA 1G2SA 1VQLA 4ZYSA 2ASBA 1F2YA 1EY5A 1STYA 4EQ5A 1HPCA 3HOVB 2F0LA 2PNRC 3BZDB 1BBWA 1EIHA 3VR4A 2L55A 3I2ZA 2RBMA 5KGUA 4RFBA 3T51B 3NBIA 2F4IA 3AU7A 3JAML 1JOQA 4JI2Q 1I3QH 4K2KA 2DY8A 2VS1A 3S2HB 4JOIC 1EZ8A 4Y7NB 1YEZA 1Q90A 5IGBA 1LT3D 2XN9C 1SMXA 4LUZA 4DK1A 3PCOB 3SK4A 4A93B 4FF1A 1K8OA 4LF4L 1STAA 3F2BA 4QQBX 1HZAA 1VQ4A 2BDNA 1M4VA 1DM0B 5LMNW 4O42A 2HD3A 3MVVA 3K58A 5E1FA 4GKJQ 5I9PA 2NVQB 1PTOD 2Z1CA 3URYA 3G6EA 1BCPC 4LF7Q 3J81i 1C7YA 4JV5L 2XIWA 4A3EG 4G7ZC 4DGZA 4X66Q 1EQVA 4JPBW 2AMCB 1CTMA 1MBYA 4LF9L 1LTTD 5I2XA 2K5WA 3MAQA 3D4WA 4KD3A 5FLMG 4R4CA 1LTGD 2A6HD 2L9HA 2D0PA 2K01A 4KHPQ 3GDEA 1FGBD 1OXTA 3J81E 4C3IH 2JA8B 4MHEA 1XPOA 4DR7Q 4ZRZA 3SK8A 4RG1A 2DGYA 2Z6BA 4FYDA 2B2TA 4JI5L 2EJFC 2JXMB 2ZM6Q 1STHA 3MWYW 4LAAA 2EVBA 3CCQA 1EYDA 1F77A 2UUCQ 3NPPA 3QWNA 3ND9A 4IN3A 1L1OA 3IL8A 1Q86C 1SE4A 3HOVH 1HTLD 2K52A 3K5LA 5IWAL 4LK1C 1F2LA 4LFAQ 2E2HH 1EYCA 1PH3A 4K6LA 3HEJA 4CBVA 1KRTA 1QZGA 2FINB 1JWSD 1A6XA 2B2YC 2MO0A 4A3GB 1CT1D 4Q0FA 2Z4HA 4K6DA 2IX0A 4IPHA 4A3JB 1VS0A 1B4OA 2F0GA 2JA6G 3HG9A 1MSHA 2O5IC 1KC8C 1PH2A 2CKZB 5FO9B 1PH7A 1SRUA 1F9RA 2MJ8A 3IKJA 5K5PA 3E0EA 1KAAA 4M1UB 4DV7Q 1Y8OB 2X6LA 1F2ZA 1TWFH 1EU4A 3K80C 3HOYB 3RN2A 3UDXA 4ZUJA 3A8IE 1KD1C 4QIWE 1WFQA 4OWWB 4JI1Q 3I4OA 1I4QA 4FXGC 1SYBA 3QOJA 3WOFA 4MZ9A 1B9NA 2K6AA 1HH2P 2NTTA 2R7ZH 4DR3L 1K8AC 2RCNA 5ELNA 2F0FA 4F7XA 1PRTD 3OHXC 1EY4A 3B6YA 2MPMA 2LXJA 3MXNA 4CDEC 3FRPB 2OEOA 1AEXA 3PUZA 4A3IB 1XMQL 1SMYC 3SK5A 1IBLL 3MFGA 1STGA 4G4KA 1GHJA 1CKMA 5JPNC 1GKHA 1K8GA 1GJXA 2E2JB 2QW7A 4K5XA 4OWTB 2F0KA 4OWXB 4NW2A 4BY1H 3SK6A 2L4NA 3KLWA 2E8GA 2EPBA 3PO3B 1J8IA 2XNAC 5KNCA 1MJCA 4DAVA 1SYEA 1F9PA 3A54A 4UDUC 3I4NH 4QIWB 3K0XA 4FVMA 1JE4A 1IBLQ 1EY7A 5EBDA 1LYLA 4GOPB 4A3GH 2Q2TA 4DF7A 2K5VA 2VQFL 4JI8Q 4C3JB 3VA7A 4B08A 4JI4L 4QL5A 1FGUA 5C5LA 2YTXA 2SOBA 3IAYA 1UE6A 1YNJC 2ZT9C 4KJOA 2F0NA 1NMGA 5EKKA 3K59A 1WTHA 3BYYB 3GTMH 2JK8A 3DWPA 2Z0SA 1KHIA 3CPWA 1JC7A 4OL7A 3S24A 5E4XA 1PFSA 5C3EB 1BKBA 3F2CA 3QOLA 2B63G 4H13C 3ND8A 4AYBG 5KEEA 1H9JA 5C0XI 3FKIH 4JI4Q 1S5ED 1TWHH 1Q1BA 3RMHA 4AH6A 1EQQA 1NMFA 1EWHA 1VQNA 3NSWA 1HUMA 1P16A 4APVA 2JA7H 2J7ZA 4RHRA 4LF6Q 4NXML 4FF4A 4DV0L 1QVFA 3TS2A 3OWEB 4X3SA 4CKCA 4UY8C 4ULLA 1D8LA 2EY5A 1HTPA 1S4ZA 5JOBA 3GO5A 1QUQA 3D4DA 3KLSX 5BN5A 3SVMA 1VQMA 1KAWA 5IT9c 2YYZA 1B70B 4YCVA 2K32A 1NY4A 1Q12A 3DMUA 1E1OA 4HIKA 5TSSA 1W6KA 2QKIC 3K7UC 3PUYA 3VR6A 1B44D 2YU9B 3D31A 1CA5A 2D2CC 1K73C 4NXMQ 1A3VA 2E2JH 3EBEA 4CDFC 3FVQA 1QWYA 4MNOA 3LGJA 1HR0Q 4IJHA 4DR6Q 3H3VI 4KKTA 1O7LA 4DXFA 3TDQA 2QILA 1XNQL 4NMZA 4NPSA 4P74A 3UDGA 3C1FA 3MEFA 4CKBA 4DUYQ 1VQEA 1M1KC 1WI5A 1LV9A 1VQAA 2M9VA 3MXUA 1STEA 4JG2A 2UXDQ 2K04A 3H0GG 4GKKL 4QY7A 1PFNA 4A93G 1D7QA 5CORA 5CV8A 4JBWA 4PMBA 3CU7A 2F4VL 4RMFA 4QGUA 2SNSA 1EU3A 1O78A 2WKCA 2PI2A 2F3WA 3KBXA 2SDFA 4DXGA 2KQ3A 4A75A 1FJGL 2F0UA 1LLRD 3OYYA 2VL6A 5C4ZA 2K5DA 3Q23A 2VUMH 2L11A 5CGKA 1IZ6A 2B2UA 1S5BD 2V1CC 1QVGA 4B3RQ 5C3EH 2F0HA 1I4RA 1LTBD 3U4VA 3VA5A 3U50C 1UEBA 4GLVB 5M5XH 1QZHA 1PVOA 2OT2A 2P5ZX 3CP0A 5J1ZA 2F4VQ 1E0BA 2KUMA 3JAMc 3HOZB 2D62A 3EQLC 3M3YH 1VQ7A 1NCVA 1PFBA 2JA8G 3HKZE 1DONA 3M85A 4HCEA 5EQ0A 4DV3Q 3KF8A 1SR3A 4I65A 1DOMA 4X64Q 4BA2I 2CH4A 3ZJYC 4ME5A 1Q8IA 2KHJA 3NK9A 1HNXQ 3PF5A 2PQAB 2BH8A 2AQ2B 4ZKBB 2G5DA 3KF6A 1IKMA 5FK9C 5JEAG 1FNWA 1HNWL 1DCZA 2HQLA 2YU9H 2I46A 3FP9A 2X69A 3NBHA 1Y14B 4IUPA 3I4MG 1PYSB 1EIGA 1JWUD 2EYHA 2N55A 4DNIA 3K7AB 1X3GA 4FNFA 4J15A 4B3TQ 1HUNA 1SSOA 2K03A 1CUKA 1Q7YC 3BVMA 3MTSA 2KVMA 3S1MH 4DV2Q 5CV4A 1I6VC 3OW7A 5LMUL 3QR8A 2AWOA 2DN8A 1BCPB 1ONLA 4RCNA 1FD7D 2MO1A 1PZID 4CJ2C 4K0KL 1HNWQ 2Q8IB 3T1HL 4A3JG 3NENA 1LABA 4ZUIA 1PYBA 2CCZA 2XRSD 3ERSX 2WB1G 3HKZB 2Q2IA 1L0WA 1CA6A 3P7JA 1E7ZA 5C44B 2GN5A 1ILQA 1X3PA 3CCLA 1B53A 4C3HB 1NE3A 3TP7A 4A3BG 4GLAC 1JICA 3RR5A 1SFOB 5IP9H 2QF7A 1O7YA 1UUPA 2NVYH 1PH5A 2KCTA 4FP5D 1X56A 4R8NA 4QMGA 4BBRB 2DJGC 5FO8B 3RLNA 5IYCH 4AQYQ 3G4SA 4XDXA 2PCFB 1HZBA 3BU2A 1WTWA 4QUFA 5CBEE 3F2DA 1B9MA 2NN6G 2LXKA 2JJQA 3PUWA 2F0TA 3WWVA 1Y1WB 1IYUA 1QOHA 4ZKCB 3KK7A 3CCSA 1Q1EA 3SGIA 2NVXH 1HNZQ 3V05A 5HGTA 5EJWA 2D9UA 2UUBQ 4UHVA 4A3IG 4MIUA 2B8FA 3CC4A 2LMCB 4OONA 3J81c 3A8JE 2EYJA 3NELA 3QJYA 1JR0D 1XPUA 4YY3Q 3PMFA 2VZAA 1MKHA 1CKNB 3RZDB 3RZOH 3VYRA 3D8GA 3DEPA 1HZCA 3OOCA 4RGTA 3ULPA 3S14H 3VDYA 2K7VA 4XT3B 2ZJQA 5M3FB 2H4OA 4GLXA 3NTKA 1CZGA 3N52A 4LFCL 2EDGA 5EPLA 1SJHD 3X3MA 4CJ0B 2VY3A 3GTLB 1YNNC 2WFWA 4U68A 1BDOA 3TQYA 3Q6SA 3GTQH 3ITPA 4EGVA 1DOLA 5H1SE 2GVAA 1EY6A 3CAMA 1AZQA 1TWAB 4JI0L 4C3JG 2ZJPA 1N36Q 2EYOA 5AJ3L 3EROA 1KABA 3R3OA 4ABNA 4AIMA 3HOUG 2Z9HA 5C44H 3VYSA 5FOBB 2HHHQ 5I9OA 3HFZB 2EYMA 1VQPA 2B3GA 3S15B 5KNBA 3GQBA 4RCOA 4LF5Q 1EIYB 1I3QB 4JI7Q 4A3CH 4LW1A 2XTIA 4JI0Q 1A3UA 1KLGD 3OIQA 3TP6A 2MFIA 3TP5A 4XXEA 2OF1A 1Q46A 1VQCA 4HAEA 3CC2A 1MSGA 3FEWX 4EQOA 4DR4L 3PV0A 4IUQA 3RNUA 3KFUA 1Y1WH 1HR0W 2MUYA 5M5WH 1PTOF 1WTRA 4BBSH 1KL9A 3CMEA 2E2DC 1S72A 2KECA 3JAME 3HZXA 4KMUC 2JP1A 3BG3A 3MXGA 3AFPA 2R93G 5FKAC 1AP0A 3CRKC 4CDCC 4A3KH 2JA6H 4DR4Q 2KCNA 4C3IB 1TU2B 2F0JA 2F3IA 2N78A 5CBAE 4OO1G 5L37A 1N34L 2OCEA 1A62A 2A68D 5IIFA 4CGYB 1TS4A 4X3KA 4HJ5A 2K28A 4MN3A 1SBBB 2JYOA 5C0XH 4A3MG 2QCPX 1Z9FA 3PSIA 1PZJD 4A3FH 3T1YL 2TMPA 5J39A 2A5HA 4DR1L 2F52A 4DK0A 2DNEA 4LUVA 4LUOA 1W2BA 1K8MA 2E2HB 2Z6KA 1YJNA 1RODA 4DN4M 4PMCA 3U58A 2RA4A 1Y8NB 4RGNA 2QEXA 4IFDG 2G9DA 3G7LA 5D3DA 3H15A 1SYCA 1J6QA 2E5LQ 2C9OA 4ALPA 3S15H 1CM9A 3I8ZA 4DKAC 1W3SA 1KDAA 5DEHA 1X32A 1HA5A 5IGFA 1KDCA 2Y0SE 4N9PA 4WRDA 2BA1A 5K36G 3M4OH 1N32L 2EIFA 3CCUA 2YTYA 4RGOS 4DR1Q 1F2MA 3V96A 1TWGH 3D6CA 3H3VH 2B2WA 4F88A 3HOZG 5C0XJ 4IO9A 2R92G 3PIP3 3J7A5 2D0OA 4OELB 1HQMC 4DV4L 5A2QL 1IBKL 2A1AA 1SJED 4FF3A 2UXBL 2HT1A 1UEAB 4HN7A 4R4QA 3PUVA 1GO3E 3EFXD 2LS01 1TWFB 5CYUA 2OQ0A 1CI3M 5EKIA 4DR2L 2Q8TA 4TKOB 2AQ1B 1MGSA 2UU9L 1HFNA 1VQBA 3BZKA 4X3TA 1GUTA 1X3QA 4G57A 4KN7C 3F2UA 3EN2A 2L1BA 2EE1A 3STBC 4TVAB 4LF4Q 1SE8A 3OW2A 2R7ZB 1I6HH 3D6WA 4GOPA 2VW9A 1B3AA 1PRTF 1IXRA 1IBKQ 1KIXA 1VQFA 3A5ZB 4IALA 3PF4A 4KI0A 1NBWA 4JV5Q 3TZDA 4GNXC 4DR2Q 3NXWA 3BVZA 1KRSA 1J5EL 5BN3A 4XIGS 2Y0SB 2A6ED 3F8TA 4LF9Q 4GZYC 3UE1A 1QCBD 3R2TA 4RKLA 3KOJA 5EGTA 1RTOA 1EEID 2EJMA 4WFN3 5KYLA 3R2IA 1DGSA 2ATWA 3HKZG 5M3MG 4R4OA 4BY1B 3J80L 3J7AF 1I50B 1Q3LA 1HXYD 3L3OC 2ZXOA 3CC7A 1GUSA 3G6JB 4C3HG 3BS1A 1FR3A 2NZHA 2Q2UA 4GN5A 1UWVA 4DK6C 4IFDI 1EWIA 4BXXH 1EUJA 4JI5Q 1X54A 3I4NB 3CKIB 4UP7A 4BBRG 5ELBA 1HQRD 3E9IA 4KTAA 1QG7A 2F03A 1O80A 1OXSC 4R4IA 4I7AA 1YHQA 1NUCA 3L2PA 4IUTA 1DOKA 1BXTA 2N8NA 1IW7D 1T5EA 2F0QA 2XSCA 3MZ5A 1X3EA 1LT4D 1PTOH 5IWAQ 1TKWB 1IYJB 3CMAA 2B2VA 2L5TA 1XWEA 3GTMB 2X6GA 2IT1A 1PFMA 2A74C 5KIXA 3I90A 1XTDA 4HR7B 2IHFA 1PLFA 4DR5L 4FF2A 3H0GH 1BVSA 1Y1VB 1BO0A 4DNRB 3JC66 2N49A 3OTOL 1VF7A 3FKIB 4QF4A 3GTJH 2BCOA 1TS2A 1YZ6A 1TWHB 4YWLA 5CV5A 4HJ9A 2EZVA 5IP7H 1JJCB 2JA7B 4IPDA 5M3FG 4B3ML 2EYLA 1TIID 3CXCA 5GQOA 2ZTCA 3SHLA 4C1NI 5BR8L 2RVLA 2WAQE 1ENAA 2EYFA 1I4PA 3S1NH 2BOSA 1DJRD 3J7ZC 2N3SA 5FJ8G 3PO2H 1Q8KA 4DUZL 3H3VC 1ILPA 4NB3A 4DR3Q 1KXLA 2XVSA 2CW0C 3I56A 1KTKA 4OX9L 1I50H 2HCIA 4A76A 4L5TA 2A69D 1EYGA 3C46A 5DLQE 3HOXB 2QA4A 1VQKA 1I94L 1SNQA 1XMQQ 5E7NA 2K5QA 2KA7A 5JEAH 1SYDA 4XQQA 3UDIA 1B2TA 2K4KA 3TREA 4IPCA 3I4MH 4G7OC 2I07B 2FMMA 3OMCA 3IFDA 2PQAA 3A74A 2RHSB 1WD0A 2WAQB 3MA2B 4KK7A 3S1QH 3NUCA 4LWCA 5G3LD 5F2DA 2VUMB 1G8ZD 2RDGA 2K14A 2BH2A 4RWSC 5IE8A 3K5NA 3M7NA 5C3WA 1C9OA 1EY0A 1Y1VH 3RLOA 1G2TA 2VQFQ 4PG3A 1G91A 5M5XB 1WCMH 3RN5A 1H9SA 1ET9A 1ZXTA 2K1BA 4HIOA 3KLSA 1PZKD 3M3YB 1A15A 4C3IG 1XYIA 2F0MA 5DM73 4JI6L 2HIVA 2VNUD 2WV6D 3KDFB 4PZ7A 4H0LC 3J7AV 4A3DB 2CFMA 4HSVA 3DWQA 1VQ5A 1GD7A 4DFAA 2K33A 4NP5A 3W1BA 2F0WA 3Q24A 1AZPA 1IHZA 1PTOC 4EVOA 1WYDA 2DNCA 5CC4A 3Q0AA 3K0YA 1VCIA 1EOTA 1UE5A 1RTNA 1ZYRD 1PXUA 3A0JA 3HOVG 1TT2A 4V190 4DV0Q 1JE5A 2ID0A 4A3LH 1AE2A 1E1TA 1JOOA 3S17B 5IOCA 3PUXA 1GOZA 1S40A 3NWTA 2PO4A 5JVG3 5IYDH 1YNXA 1VQGA 4NXNL 1ESRA 5I4DA 4B3SL 4FO2A 3HOXH 1NJIC 5FLXL 1V43A 1SXTA 2ICIA 3SEBA 4LJZC 3S1MB 4LMQD 1E2VA 2KHIA 1K83B 1CK1A 2L12A 5J3BA 1VQ8A 4FDBA 1JMCA 4IJLA 4CKEA 5M5YH 1RKNA 1N9WA 2R3ZA 2H1EA 3F1ZA 3AB9A 1SLJA 3E0JA 2L15A 2CQAA 2B2YA 1LO5D 3DEOA 3ERQA 5LL6X 1XNQQ
chains in the Genus database with same CATH topology
1TS5A 2PQEA 5J22A 2NVYB 4L8JA 4N9TA 1D6EC 4RAUC 5CMDA 1G6ZA 3DHQA 1UNSA 1JCKB 2B8GA 4P2CB 1D2BA 1MD2D 2CHBD 1SNDA 4RGMA 2EJGC 2NZ1D 2GA4B 1KDBA 3BVGA 3GV6A 3VYTA 2NVXB 2IX3A 2O5JC 1AW7A 3RUZA 3TMEA 4C56C 3EJIA 4ILWA 1SNMA 1CQVA 5KNDA 3Q22A 3RZOB 3S14B 4TSSA 2NWGA 5D14A 4BS9A 1L0XB 2F0VA 2AQ3B 2BE5C 1GXDC 2PW5A 4J6HA 1H9SB 1FYCA 1PRTC 3GTQB 1W6JA 1WTXA 2VXWA 2BDOA 3SDZA 3KUPA 1SAPA 1TVXA 2FHTA 2XWJB 3VYUA 1BBXC 1EL0A 5C3XA 3TSSA 4K2LA 2L0CA 2VB3X 3QG1A 3QO2A 3T13A 2RSNA 3FPPA 3A55A 1B1ZA 1WD1A 4HMIA 1DD2A 1D1IA 1RDPD 1BCPD 4ID6A 1ICWA 4TQUS 1LACA 4HEDA 4PV1C 5CR3A 5M5WB 1L0YB 4IFDH 3NQIA 1IL8A 1V8QA 4IZ8A 4BBSB 4YIJA 2KJXA 3FDTA 1NSNS 5K36H 2F1MA 3H6MA 3OSOA 4A3KB 2JA6B 2G9HD 3VR2A 2MP1A 2LY7A 1OXXK 3K6OA 3KLRA 2ENBA 3M7GA 4OHJA 3HP3A 4KN4C 1HFGA 1TY0A 3T53B 4ODGA 4BWGB 2B2TC 2WACA 4U673 1D5ZC 2FFKB 2SEBD 4IUVA 4G7HC 4A3FB 3D4RA 1WTQA 1AN8A 5ISRA 3TZUA 2M00A 5ELCA 1JORA 1D5XC 2PMZB 3T16A 1Y69U 3I91A 4OGQC 4F87A 3I3CA 4J8QA 4TRDA 4R8IA 3M4OB 2NN6I 3NHHA 1TWGB 2CVRA 1JWMD 4K8JA 5LL6S 4KHVA 2F0IA 1WVLA 3PIO3 1C8CA 2B39A 4OIKA 1S5DD 3S2DB 3O13A 5IODA 2IPKD 3W3AA 1SEBD 3VR3A 1RCVD 1C48A 2PPBC 1BUVT 4KJNA 5IT9L 3SR1A 2ICEC 1XX8A 2XRQD 2F0OA 2OXPA 1JB3A 1BNZA 1I6HB 1RJTA 1SMYD 4DU9A 2QDBA 2IW3A 2Q8RE 4JK1C 5ELDA 1DYQA 5A2QE 4FXKC 1E2ZA 3EVQA 4AYBB 3S9WA 5E3FA 4R9WA 2RQXA 4K5VA 1U9RA 4NDXA 4XYOA 1SE3A 3OIPA 2E74C 5AFWA 3U9OA 3D3RA 4F8MA 3V2TA 1YNJD 3BDCA 1VMPA 4IURA 3LWEA 1S5FD 1HHVA 1JOKA 1V1PA 1KNEA 2JE6I 2TSSA 3LX0A 1A3TA 3H91A 2J4XA 1B50A 5FO7B 1LT5D 4HCSA 1PTOB 3J80E 1IYVA 3TP8A 1R4QB 1HRJA 1STBA 4XYQA 4HSPA 2NBFA 1OXUA 1CZWA 4KY5A 3K5MA 3GTPB 3H0GB 2JEBI 2RKSA 3EA6A 1A2UA 2EXZA 4KV6A 4ZK9B 3GTJB 3L7ZC 1CHPD 4M8AA 4XQNA 5E4WC 2DY7A 2HCCA 2ZXPA 4OO1I 3C2PA 3A8KE 3S1NB 2K05A 1SNCA 2AWNA 5D65A 4PNYA 3PO2B 1VF5C 3K5OA 2PZUA 4XQJA 2WIIB 3DM1A 5HURA 1U4PA 1H9RA 3OWFA 1Z7TA 2RDFA 3L9AX 5ELFA 3WOEA 3U9SA 3QB3A 4BA1I 5JJZA 1RF2D 1GUGA 4XTCS 1DXMA 5C4HA 3I4MB 4EQNA 1GUOA 1EY8A 5NUCA 3H94A 3I70A 3MC0B 3S1QB 5G3LF 3UI2A 1NAPA 1CHQD 4K8IA 2O2LD 1MI2A 2B2UC 3OPOA 2WB1B 4IQZA 1WCMB 4RH6A 1RD9D 1PRTB 5BN4A 3MFYA 2JSOA 2M2LA 3J81L 3MHBA 4A3BB 1G291 3N6RA 1V1PB 3OMGA 4KHZA 1QB5D 1II3A 5C0XG 2AUJD 3MEHA 2IX1A 4O1NA 2BE5D 3NE5B 2HDLA 3NTIA 1A2TA 4CJ1B 2WP8J 4RA8A 3GP7A 1ENFA 2XWBB 3ONAB 4ZQ3A 3CHBD 1U4RA 5JVH3 1BQQT 2A68C 3IFTA 5M5YB 2PW7A 5LHY1 5JAVA 1EQTA 3NWSA 4I7ZC 1ET6A 4DA2A 2F0SA 2LFNA 5C5MA 3BDOA 3HS0C 1WTOA 5FLXE 3C3LA 4ZLTF 4B9XA 2R6GA 1D5MC 5DAUA 3AMUA 1VMCA 5C6AA 1H9MA 1IKLA 2EY2A 1SYGA 3SXHA 1SNOA 3HOUB 3HOWB 1H9KA 4RKBA 4DNTB 1F9QA 2F0DA 1LT6D 3H09A 2IJ0A 1V1OA 5CV7A 5JEAJ 3P75A 3W2DA 1XXGA 1TQOA 4ZAIA 1QILA 1UAPA 1J9OA 4BY7B 5IGCA 2R61A 3GD7A 1FNVA 3NP8A 1TY2A 4RHSA 5IGEA 2NN6H 1PDQA 1U4MA 1FNUA 1S5CD 2EY1A 1R4PB 1ML0D 1SE2A 1YNND 2NUCA 1QJOA 1Z6HA 2A6HC 4IUUA 4PMWA 1ZKOA 3NTHA 2R93B 4B9WA 1E2WA 2V4DA 3A7AB 2EOTA 2A6EC 2SNMA 5C4XB 5M9OA 4Q5VA 3TN2A 1RHPA 2JA5B 3R8BA 4V0BA 4IUNA 4A3MB 1U4LA 2LKVA 3I73A 1LTAD 3CRLC 5KYIA 1T5XD 5CV6A 1NR2A 4H7BA 5EPJA 1BCPF 3A7LA 4K14A 3T56B 5CV9A 2A73B 2NYZD 1QNKA 2N88A 1O7ZA 1SNPA 2PYKA 4X3UA 1IW7C 4J1MA 4EQPA 2MGSA 4KKSA 5DM63 5T1GA 3CQZB 4E6IA 4QB4A 5I2YA 5KRUA 2HUGA 1QE6A 2R92B 2VB2X 1WTPA 1PYWD 4L63B 1M8AA 5I6WA 1HA6A 5ELEA 1GHKA 4A3EB 4WJWA 1ZEQX 3T4AC 3QIAA 2O4XA 3S16B 1Y8PB 5D3IB 2WINB 2Z4IA 3FMCA 1R9TB 4Z9CB 2FMCA 4OO1H 1TWCB 2F0PA 4UAIA 1JQYD 1DZ1A 4QCLA 4C2MB 2KCCA 3RD4A 2A69C 2F3VA 1XTCD 1WTVA 2BA0A 5M3MB 1STNA 2NVTB 2FJ2A 1GUWA 3BYTB 1EFID 5JPMC 2JEAI 1D1KA 3GV3A 3TBIB 2B2WC 3WDNA 4C1NK 3HGBA 3E6ZX 2RSOA 4KKUA 3X3NA 1ESFA 2F0EA 1BOSA 1C4QA 4L6TB 1QNUA 3DXJC 3GTOB 1I4HA 2E2IB 3I4LA 3BDLA 5COYA 1ENCA 4CHTB 4KY6A 1EWCA 3I72A 3P1HA 3C1EA 3LNNA 3FPUB 3K57A 2HDMA 1GUNA 1CQFA 1F9SA 3HRZC 5IGGA 4IFDJ 5IT9E 3GTGB 2Z8LA 1EY9A 1BR9A 3NQTA 1EYAA 1LTRD 4WORA 1SDFA 2D5DA 3J7YW 5A35A 4NKLA 1ZYRC 5C4JB 2ZXRA 2WKDA 2IWHA 2MHVA 4K5WA 4DAPA 1AFPA 1BF4A 1TR5A 4H44C 3P20A 3SE0A 4OIJA 3GTKB 4PQXA 1CFMA 1I4XA 2PZTA 2B2VC 4KY7A 3VR5A 1KLUD 1VDZA 3ZYYX 5EKLA 1EZ6A 1TS3A 4HMJA 2KHSA 2KEDA 1SYFA 1OO9B 3E5SA 4S3SA 2J0TD 1KNAA 5DNFA 2E75C 3RLFA 4KD4A 2C5CA 5IGDA 4DAYA 2KEEA 2NTSA 3MXPA 1OXVA 2HQEA 2B63B 2PZWA 2CW0D 3A56A 5EPKA 4HTHA 1NR4A 4QUCA 3LWUA 1HCZA 1I4GA 3DUZA 1PMRA 3M4YA 5T1IA 4FXDA 3KBGA 2EY6A 1Z47A 5I6YA 2IL8A 2QEJC 2EYPA 4XT1B 1LTID 2NB0A 1LTSD 5EBCA 3S1RB 3DWAA 1EEFD 2RDHA 3R93A 2AUKA 2E76C 2KOLA 1G2SA 4ZYSA 1F2YA 1EY5A 1STYA 1HPCA 3HOVB 2F0LA 2PNRC 3BZDB 1EIHA 3VR4A 2L55A 2RBMA 5KGUA 4RFBA 3T51B 3NBIA 2F4IA 3AU7A 3JAML 1JOQA 4K2KA 2DY8A 3S2HB 1EZ8A 4Y7NB 5IGBA 1Q90A 1LT3D 2XN9C 4DK1A 1K8OA 3SK4A 4A93B 4FF1A 1STAA 2BDNA 1M4VA 1DM0B 4O42A 3MVVA 3K58A 5E1FA 5I9PA 2NVQB 1PTOD 2Z1CA 3URYA 1BCPC 2XIWA 4G7ZC 4DGZA 1EQVA 1CTMA 1MBYA 1LTTD 5I2XA 2K5WA 3MAQA 3D4WA 4KD3A 1LTGD 2A6HD 2L9HA 2K01A 1FGBD 1OXTA 3J81E 2JA8B 4MHEA 4ZRZA 3SK8A 4FYDA 2B2TA 2EJFC 2JXMB 1STHA 3MWYW 4LAAA 2EVBA 1EYDA 1F77A 3NPPA 3QWNA 3ND9A 4IN3A 3IL8A 1SE4A 1HTLD 3K5LA 4LK1C 1F2LA 1EYCA 4K6LA 3HEJA 4CBVA 2FINB 1JWSD 1A6XA 2B2YC 4A3GB 1CT1D 4Q0FA 2Z4HA 4K6DA 2IX0A 4A3JB 1B4OA 2F0GA 3HG9A 1MSHA 2O5IC 5FO9B 1F9RA 2MJ8A 3IKJA 5K5PA 4M1UB 1KAAA 1Y8OB 2X6LA 1F2ZA 1EU4A 3HOYB 4ZUJA 3A8IE 1I4QA 4FXGC 1SYBA 3QOJA 3WOFA 1B9NA 2K6AA 2NTTA 2F0FA 4F7XA 1PRTD 3OHXC 1EY4A 2MPMA 3MXNA 3FRPB 2OEOA 1AEXA 3PUZA 4A3IB 1SMYC 3SK5A 3MFGA 1STGA 4G4KA 1GHJA 5JPNC 1GJXA 2E2JB 4K5XA 2F0KA 4NW2A 3SK6A 2L4NA 2EPBA 3PO3B 1J8IA 2XNAC 5KNCA 4DAVA 1SYEA 1F9PA 3A54A 4UDUC 4QIWB 4FVMA 1JE4A 1EY7A 5EBDA 4DF7A 4C3JB 3VA7A 4B08A 5C5LA 2SOBA 3IAYA 1YNJC 2ZT9C 4KJOA 2F0NA 5EKKA 3K59A 3BYYB 3DWPA 1JC7A 4OL7A 5E4XA 5C3EB 3QOLA 4H13C 3ND8A 5KEEA 1H9JA 5C0XI 1S5ED 1Q1BA 3RMHA 1EWHA 3NSWA 1HUMA 2J7ZA 4RHRA 4FF4A 3OWEB 4X3SA 4CKCA 4ULLA 2EY5A 1HTPA 1S4ZA 5JOBA 3GO5A 3KLSX 3D4DA 3SVMA 5BN5A 2YYZA 2K32A 1Q12A 3DMUA 5TSSA 1W6KA 2QKIC 3PUYA 3VR6A 1B44D 2YU9B 3D31A 1CA5A 2D2CC 1A3VA 3FVQA 1QWYA 4KKTA 1O7LA 4DXFA 3TDQA 2QILA 4NMZA 3C1FA 4CKBA 1LV9A 2M9VA 3MXUA 1STEA 2K04A 1PFNA 5CORA 5CV8A 4JBWA 4PMBA 3CU7A 2SNSA 1EU3A 1O78A 2WKCA 2F3WA 3KBXA 2SDFA 4DXGA 2KQ3A 2F0UA 1LLRD 5C4ZA 2K5DA 3Q23A 2L11A 5CGKA 2B2UA 1S5BD 2F0HA 1I4RA 1LTBD 3VA5A 2OT2A 5J1ZA 1E0BA 2KUMA 3HOZB 2D62A 3EQLC 1NCVA 1PFBA 1DONA 3M85A 4HCEA 5EQ0A 3KF8A 4I65A 1DOMA 4BA2I 4ME5A 1Q8IA 3NK9A 2AQ2B 4ZKBB 1IKMA 5FK9C 5JEAG 1FNWA 1DCZA 2I46A 3NBHA 2X69A 4IUPA 1EIGA 1JWUD 2EYHA 2N55A 3K7AB 4FNFA 1HUNA 1SSOA 2K03A 3BVMA 3MTSA 2KVMA 5CV4A 1I6VC 3OW7A 2AWOA 2DN8A 1BCPB 1ONLA 4RCNA 1FD7D 4CJ2C 1PZID 2Q8IB 1LABA 4ZUIA 2XRSD 3HKZB 1CA6A 3P7JA 5C44B 1ILQA 1X3PA 1B53A 4C3HB 3TP7A 1JICA 1SFOB 2QF7A 1O7YA 1UUPA 4FP5D 4R8NA 4QMGA 4BBRB 5FO8B 4XDXA 2PCFB 1WTWA 4QUFA 5CBEE 1B9MA 2NN6G 3PUWA 2F0TA 1Y1WB 1IYUA 1QOHA 4ZKCB 3KK7A 1Q1EA 3V05A 5HGTA 5EJWA 2D9UA 4MIUA 2B8FA 2LMCB 3A8JE 2EYJA 3QJYA 1JR0D 3PMFA 3RZDB 3VYRA 3D8GA 3DEPA 3OOCA 4RGTA 2K7VA 4XT3B 5M3FB 2H4OA 3NTKA 1CZGA 3N52A 2EDGA 5EPLA 1SJHD 3X3MA 4CJ0B 3GTLB 1YNNC 4U68A 1BDOA 3Q6SA 3ITPA 4EGVA 1DOLA 1EY6A 1AZQA 1TWAB 4C3JG 2EYOA 3EROA 1KABA 3R3OA 4ABNA 3VYSA 5FOBB 5I9OA 2EYMA 3S15B 5KNBA 3GQBA 4RCOA 1I3QB 1A3UA 1KLGD 3OIQA 3TP6A 3TP5A 4XXEA 2OF1A 4HAEA 1MSGA 3FEWX 4EQOA 3PV0A 4IUQA 2MUYA 1PTOF 1WTRA 2E2DC 2KECA 3JAME 3HZXA 4KMUC 2JP1A 3BG3A 3MXGA 5FKAC 1AP0A 3CRKC 2KCNA 4C3IB 1TU2B 2F0JA 5CBAE 4OO1G 2A68D 5IIFA 4CGYB 1TS4A 4X3KA 2K28A 4MN3A 1SBBB 2JYOA 5C0XH 2QCPX 1PZJD 2TMPA 5J39A 2A5HA 4DK0A 2DNEA 1K8MA 2E2HB 1RODA 4DN4M 4PMCA 2RA4A 1Y8NB 4RGNA 4IFDG 2G9DA 3G7LA 5D3DA 1SYCA 2C9OA 1CM9A 3I8ZA 1KDAA 5DEHA 1X32A 1HA5A 5IGFA 1KDCA 4N9PA 4WRDA 2BA1A 5K36G 4RGOS 1F2MA 3V96A 3D6CA 2B2WA 4F88A 5C0XJ 3PIP3 1HQMC 5A2QL 1SJED 4FF3A 1UEAB 4HN7A 3PUVA 3EFXD 2LS01 1TWFB 5CYUA 1CI3M 5EKIA 2Q8TA 4TKOB 2AQ1B 1MGSA 1HFNA 4X3TA 1GUTA 1X3QA 4G57A 4KN7C 3F2UA 2L1BA 2EE1A 2R7ZB 3D6WA 1B3AA 1PRTF 4IALA 4KI0A 3TZDA 3NXWA 3BVZA 5BN3A 4XIGS 2Y0SB 2A6ED 4GZYC 1QCBD 3R2TA 4RKLA 5EGTA 1RTOA 1EEID 2EJMA 4WFN3 5KYLA 3R2IA 4BY1B 3J80L 3J7AF 1I50B 1Q3LA 1HXYD 3L3OC 2ZXOA 1GUSA 3G6JB 4C3HG 3BS1A 1FR3A 4IFDI 3I4NB 3CKIB 5ELBA 1HQRD 4KTAA 1QG7A 2F03A 1O80A 1OXSC 1NUCA 4IUTA 1DOKA 1BXTA 1IW7D 1T5EA 2F0QA 2XSCA 3MZ5A 1LT4D 1PTOH 1TKWB 2B2VA 2L5TA 1XWEA 3GTMB 2X6GA 2IT1A 1PFMA 2A74C 5KIXA 3I90A 4HR7B 1PLFA 4FF2A 1Y1VB 4DNRB 1BO0A 1VF7A 3FKIB 4QF4A 2BCOA 1TS2A 1TWHB 5CV5A 2EZVA 2JA7B 2EYLA 1TIID 3SHLA 4C1NI 2RVLA 1ENAA 2EYFA 1I4PA 2BOSA 1DJRD 3H3VC 1ILPA 2XVSA 2CW0C 1KTKA 2HCIA 2A69D 3C46A 3HOXB 1SNQA 2K5QA 2KA7A 5JEAH 1SYDA 4XQQA 1B2TA 4G7OC 2I07B 2FMMA 3OMCA 3IFDA 1WD0A 2WAQB 3MA2B 4KK7A 3NUCA 5G3LD 5F2DA 2VUMB 1G8ZD 2RDGA 4RWSC 3M7NA 3K5NA 5C3WA 1EY0A 1G2TA 1G91A 5M5XB 1H9SA 1ET9A 1ZXTA 2K1BA 3KLSA 1PZKD 3M3YB 1A15A 4C3IG 1XYIA 2F0MA 5DM73 2VNUD 2WV6D 4H0LC 3J7AV 4A3DB 4HSVA 3DWQA 4DFAA 2K33A 4NP5A 3Q24A 2F0WA 1AZPA 1IHZA 1PTOC 4EVOA 2DNCA 5CC4A 3Q0AA 3K0YA 1VCIA 1EOTA 1RTNA 1ZYRD 1PXUA 1TT2A 4V190 2ID0A 1JOOA 3S17B 5IOCA 3PUXA 1GOZA 3NWTA 2PO4A 5JVG3 1ESRA 5I4DA 4FO2A 5FLXL 1V43A 1SXTA 2ICIA 3SEBA 4LJZC 3S1MB 4LMQD 1E2VA 1K83B 1CK1A 2L12A 4CKEA 1RKNA 2R3ZA 2H1EA 3AB9A 3E0JA 2CQAA 2B2YA 1LO5D 3DEOA 3ERQA 5LL6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2X A;  2I46 A;  5I2Y A;  2M9V A; 
#chains in the Genus database with same CATH topology
 1TS5 A;  2PQE A;  1H95 A;  1CKN A;  5J22 A;  4JC0 A;  3G48 A;  2NVY B;  4L8J A;  4N9T A;  3E9H A;  2OTJ A;  1RL2 A;  1EIF A;  1D6E C;  4GKK Q;  4RAU C;  5CMD A;  1G6Z A;  3DHQ A;  3K81 C;  1UNS A;  1JCK B;  2B8G A;  4P2C B;  1D2B A;  1MD2 D;  3HOU H;  3HOW H;  2CHB D;  4YWM A;  2R7Z G;  1SND A;  1PH6 A;  4GN4 B;  4RGM A;  2EJG C;  2NZ1 D;  1FJG Q;  2GA4 B;  1KDB A;  2MNA A;  3BVG A;  3GV6 A;  3VYT A;  4JVZ A;  2NVX B;  2IX3 A;  4BY7 H;  4A3D H;  2O5J C;  1AW7 A;  3RUZ A;  3TME A;  3I55 A;  2QDL A;  4C56 C;  1V1Q A;  3EJI A;  4ILW A;  1CSQ A;  3M4Q A;  4ME3 A;  4MTN A;  1SNM A;  1CQV A;  5KND A;  3Q22 A;  3RZO B;  3S14 B;  4BY1 G;  4TSS A;  5IYB H;  2NWG A;  5D14 A;  4BS9 A;  1X6O A;  3S17 H;  1L0X B;  2F0V A;  3PQI A;  1M90 C;  2AQ3 B;  4JI3 L;  2BE5 C;  1GXD C;  2PW5 A;  4J6H A;  1YBY A;  1JJG A;  3I4N G;  2KBN A;  1AH9 A;  1H9S B;  2I5L X;  2R93 H;  1FYC A;  2KCM A;  1PRT C;  3GTQ B;  4A3G G;  1K83 H;  1W6J A;  1WTX A;  2VXW A;  2BDO A;  1PV4 A;  3SDZ A;  3KUP A;  1SAP A;  1TVX A;  2FHT A;  2XWJ B;  4H02 A;  3VYU A;  1BBX C;  1VQ9 A;  1EL0 A;  5C4X H;  2I0Q A;  1WOC A;  2JA5 H;  5C3X A;  3TSS A;  4K2L A;  2L0C A;  2VB3 X;  4A3M H;  4POG A;  3QG1 A;  3QO2 A;  3T13 A;  5LMU Q;  2RSN A;  3FPP A;  1UE1 A;  3A55 A;  4GNX B;  3HOY G;  4K0K Q;  1B1Z A;  3ULL A;  1WD1 A;  3T1H Q;  3FKI G;  4HMI A;  1VQ6 A;  1D1I A;  1DD2 A;  1RDP D;  1BCP D;  4ID6 A;  1ICW A;  4TQU S;  1LAC A;  1ASZ A;  1UE7 A;  4HED A;  4PV1 C;  5CR3 A;  2JA7 G;  5M5W B;  1JT8 A;  1L0Y B;  1XJV A;  4IFD H;  3NQI A;  4N8X 1;  1IL8 A;  1XMO L;  1V8Q A;  4IZ8 A;  4BBS B;  3CW2 C;  4YIJ A;  4QJF A;  4POF A;  4JCV E;  2KJX A;  3FDT A;  1PA6 A;  2UXC L;  4LF8 L;  1A63 A;  1NSN S;  3KJO A;  2ALY B;  2PMZ E;  2HIX A;  1IBM L;  1PH1 A;  5K36 H;  2F1M A;  3CQZ H;  3H6M A;  3OSO A;  4A3K B;  2JA6 B;  2G9H D;  3VR2 A;  2MP1 A;  2LY7 A;  1OXX K;  3K6O A;  4JBK A;  3PO3 G;  3KLR A;  2ENB A;  3M7G A;  4OHJ A;  4LF8 Q;  4A3E H;  1A8V A;  3HP3 A;  4KN4 C;  3TRZ A;  1HFG A;  1TY0 A;  3T53 B;  4ODG A;  4BWG B;  2B2T C;  5FLM H;  4WJ4 A;  2WAC A;  4U67 3;  1R9T H;  1D5Z C;  2FFK B;  1B3Q A;  2SEB D;  4IUV A;  4G7H C;  4A3F B;  1E22 A;  3D4R A;  1WTQ A;  4R4T A;  2DUD A;  5GAE C;  1L1O C;  1AN8 A;  5ISR A;  2JA9 A;  3TZU A;  4JYA L;  4LFC Q;  4P73 A;  2M00 A;  5ELC A;  1JOR A;  1D5X C;  2PMZ B;  3T16 A;  1Y69 U;  2VUM G;  3I91 A;  1XNR L;  1WJJ A;  1VQI A;  4OGQ C;  4UP8 A;  5C3E G;  2A8V A;  2CWA A;  4HID A;  4C2M H;  4F87 A;  3I3C A;  4AYB E;  4J8Q A;  1X65 A;  2RHQ B;  4TRD A;  5M3M H;  2I5M X;  4R8I A;  5AJ3 Q;  2NVT H;  3M4O B;  2MQH A;  2NN6 I;  3NHH A;  1TWG B;  2CVR A;  1JWM D;  4K8J A;  5LL6 S;  4KHV A;  2H5X A;  2F0I A;  1WVL A;  3PIO 3;  1XNR Q;  1C8C A;  2B39 A;  4OIK A;  1S5D D;  3S2D B;  3O13 A;  1L2F A;  5IOD A;  1NNX A;  3AFQ A;  2IPK D;  3W3A A;  1SEB D;  3VR3 A;  1RCV D;  1C48 A;  2PPB C;  1BUV T;  4KJN A;  5IT9 L;  2RCF A;  3L0O A;  3SR1 A;  2ICE C;  1XX8 A;  2XRQ D;  3AQQ A;  2F0O A;  2OXP A;  1JB3 A;  1BNZ A;  1I6H B;  1N33 L;  1RJT A;  4X62 L;  1SMY D;  4DU9 A;  3KJP A;  2QDB A;  1U5K A;  2IW3 A;  2Q8R E;  1VQO A;  4JK1 C;  2E2I H;  5ELD A;  1DYQ A;  5A2Q E;  4FXK C;  3EVQ A;  1E2Z A;  4IOA A;  4AYB B;  4LFB L;  3S9W A;  3W5O A;  2YV5 A;  5E3F A;  4R9W A;  1X3F A;  2RQX A;  5JJI A;  4YCU A;  1V9P A;  4DV1 L;  4K5V A;  1U9R A;  4NDX A;  4XYO A;  1SE3 A;  3OIP A;  4X62 Q;  2E74 C;  1YHA A;  2A19 A;  5HGQ A;  1N34 Q;  5AFW A;  3U9O A;  3D3R A;  4YHH L;  4KLK A;  1C0A A;  3J80 i;  5IP9 G;  4F8M A;  3V2T A;  1OTC A;  1YNJ D;  3BDC A;  5C4J H;  1VMP A;  4IUR A;  3LWE A;  1S5F D;  1HHV A;  5IYC G;  1JOK A;  1V1P A;  4DV1 Q;  1KNE A;  2JE6 I;  2TSS A;  3LX0 A;  1A3T A;  3H91 A;  2J4X A;  3U4Z A;  1B50 A;  5FO7 B;  3T1Y Q;  1LUZ A;  1LT5 D;  4HCS A;  1YJ9 A;  1PTO B;  5FLX c;  3J80 E;  3GTK H;  4GN3 B;  1IYV A;  3TP8 A;  1R4Q B;  1HRJ A;  1STB A;  4YHH Q;  4XYQ A;  4HSP A;  4GKJ L;  2NBF A;  4LF7 L;  1OXU A;  1CZW A;  4KY5 A;  3K5M A;  3S2D H;  4P75 A;  2ZTD A;  2RF4 A;  4X66 L;  3H0G B;  3GTP B;  2JEB I;  2RKS A;  3EA6 A;  1A2U A;  2EXZ A;  4KV6 A;  4ZK9 B;  3GTJ B;  3ER0 A;  3L7Z C;  1N32 Q;  1CHP D;  4M8A A;  4KHP L;  4X65 L;  4XQN A;  5E4W C;  5GAG C;  2DY7 A;  4DV4 Q;  2EQS A;  2HCC A;  1BBU A;  2ZXP A;  2UXB Q;  5JJK A;  4DR7 L;  4OO1 I;  3C2P A;  2IY5 B;  3A8K E;  1K3B C;  2B63 H;  2UU9 Q;  3ICE A;  3S1N B;  2K05 A;  2ZM6 L;  1SNC A;  2AWN A;  2DJF C;  2IHE A;  5D65 A;  4PNY A;  3PO2 B;  2UUC L;  1VF5 C;  3K5O A;  2PZU A;  4X65 Q;  4XQJ A;  4R1J A;  2WB1 E;  2CQO A;  2WII B;  4LFA L;  5C44 G;  1Q82 C;  3DM1 A;  5HUR A;  1QVC A;  1U4P A;  1H9R A;  3OWF A;  1Z7T A;  4JW0 A;  1X9N A;  2RDF A;  1J5E Q;  3L9A X;  5ELF A;  4YWK A;  3WOE A;  3A5U A;  3DM3 A;  3U9S A;  5ELO A;  3K8A A;  3QB3 A;  4BA1 I;  3S1R H;  4A3C G;  5JJZ A;  1RF2 D;  1GUG A;  3KDF A;  1Q81 C;  4XTC S;  1DXM A;  5C4H A;  3I4M B;  4DAY B;  4EQN A;  1YI2 A;  1GUO A;  3M4P A;  5GRO A;  1EY8 A;  1K28 A;  5NUC A;  1YIJ A;  1Y1W G;  3H94 A;  3I70 A;  3MC0 B;  3S1Q B;  5G3L F;  3UI2 A;  1NAP A;  4BBS G;  4DV7 L;  4LNQ A;  1CHQ D;  4K8I A;  3GTP H;  3S2H H;  2NZO A;  1B7Y B;  3CPF A;  4Y7N H;  2O2L D;  1MI2 A;  2B2U C;  3OPO A;  2WB1 B;  4IQZ A;  1WCM B;  3CCE A;  4JI1 L;  4A93 H;  4RH6 A;  1RD9 D;  4A3K G;  1PRT B;  5BN4 A;  3MFY A;  2JSO A;  2M2L A;  3J81 L;  3MHB A;  4A3B B;  1G29 1;  4HJ7 A;  2NVQ H;  3N6R A;  1V1P B;  3OMG A;  1PH8 A;  4KHZ A;  1QB5 D;  1YJW A;  4DR5 Q;  1II3 A;  5C0X G;  4O2D A;  3OTO Q;  1CSP A;  1XPR A;  1MJE A;  2AUJ D;  2GVB A;  1FL0 A;  3CF5 A;  3MEH A;  1EQR A;  2IX1 A;  4O1N A;  1T9H A;  2BE5 D;  3NE5 B;  2HDL A;  3NTI A;  4A3F G;  1A2T A;  4CJ1 B;  4OXP A;  2JA8 H;  2WP8 J;  3TEH B;  1ICF B;  4B3M Q;  4RA8 A;  1P8L A;  4DK3 C;  5BR8 Q;  1VQJ A;  3GP7 A;  4MTK A;  1ENF A;  4GS3 A;  2XWB B;  3ONA B;  4ZQ3 A;  3CHB D;  1U4R A;  5JVH 3;  4DUZ Q;  4L5R C;  1K0S A;  1BQQ T;  2A68 C;  4JI8 L;  4A4I A;  3IFT A;  4DV5 L;  5M5Y B;  2PW7 A;  5LHY 1;  4OX9 Q;  1U0L A;  2CH4 W;  5JAV A;  1EQT A;  1G6P A;  3NWS A;  1G51 A;  4I7Z C;  1ET6 A;  4DA2 A;  2F0S A;  2LFN A;  3BZC A;  5C5M A;  4JOI A;  4OEM B;  3BDO A;  1I94 Q;  3HS0 C;  2R7F A;  1WTO A;  5FLX E;  2VQE L;  3C3L A;  4PZ6 A;  4ZLT F;  1YHB A;  1HJP A;  2R6G A;  4B9X A;  1D5M C;  5DAU A;  3AMU A;  1VMC A;  4A3J H;  4DV5 Q;  5C6A A;  1H9M A;  1IKL A;  2EY2 A;  1SYG A;  3SXH A;  1SNO A;  3HOU B;  3HOW B;  1H9K A;  4RKB A;  4DNT B;  1F9Q A;  2F0D A;  1LT6 D;  4UP9 A;  3DLL A;  3H09 A;  4LF6 L;  4A3B H;  2IJ0 A;  1V1O A;  5CV7 A;  5JEA J;  2K5N A;  3P75 A;  3W2D A;  3CCJ A;  1XXG A;  1VQH A;  1TQO A;  2VQE Q;  4ZAI A;  1QIL A;  1UAP A;  1J9O A;  4BY7 B;  1L1O B;  5IGC A;  3HOY H;  4HJ8 A;  2R61 A;  3GD7 A;  4L5Q A;  1YIT A;  1FNV A;  2EXD A;  1TY2 A;  3NP8 A;  4RHS A;  5IGE A;  2NN6 H;  1PDQ A;  1U4M A;  3PIO A;  1FNU A;  1S5C D;  2EY1 A;  1R4P B;  1ML0 D;  1SE2 A;  4GNX A;  1YNN D;  2NUC A;  1QJO A;  1JJ2 A;  4JI6 Q;  1HR0 L;  1Z6H A;  2JN4 A;  4DR6 L;  3AYH B;  2A6H C;  4DUY L;  4BXX G;  1TXY A;  4IUU A;  4PMW A;  1ZKO A;  3NTH A;  4A3I H;  2LSS A;  2R93 B;  2UXD L;  4B9W A;  1E2W A;  2V4D A;  5GAH C;  3A7A B;  2EOT A;  2A6E C;  2SNM A;  3PO3 H;  5C4X B;  5M9O A;  4Q5V A;  3TN2 A;  1RHP A;  2JA5 B;  4NXN Q;  3R8B A;  4V0B A;  4B3S Q;  4IUN A;  3UDF A;  4A3M B;  1U4L A;  2LKV A;  4WJ3 M;  3I73 A;  1LTA D;  4B3R L;  3CRL C;  5KYI A;  1ASY A;  1T5X D;  5CV6 A;  4CDD C;  1NR2 A;  4H7B A;  5EPJ A;  4C3J H;  2AKW B;  1BCP F;  1FVI A;  3A7L A;  3MXN B;  4IPG A;  4K14 A;  3T56 B;  5IP7 G;  5CV9 A;  4DAM A;  2A73 B;  3E3X A;  4DPG A;  4X6A H;  1GM5 A;  2NYZ D;  1QNK A;  2N88 A;  1E3P A;  2ZJR A;  1O7Z A;  3FHW A;  1SNP A;  2PYK A;  4DV3 L;  4X3U A;  1IW7 C;  4J1M A;  4EQP A;  1JB7 A;  4X64 L;  3NEM A;  1EOV A;  2MGS A;  1HNX L;  1PH9 A;  2Y0S G;  3PO2 G;  5HY6 A;  3PIP A;  4KKS A;  5DM6 3;  5T1G A;  3CQZ B;  4E6I A;  4QB4 A;  5I2Y A;  5KRU A;  2HUG A;  1QE6 A;  1SN8 A;  2R92 B;  3I7F A;  2VB2 X;  1WTP A;  1PYW D;  2I5H A;  1NTG A;  5LMN L;  4L63 B;  4P71 A;  1M8A A;  5I6W A;  4B3T L;  1HA6 A;  3PGZ A;  1B8A A;  5IY0 A;  3TS0 A;  5ELE A;  1GHK A;  4A3E B;  4WJW A;  1ZEQ X;  3T4A C;  4DV2 L;  3QIA A;  2O4X A;  2JQO A;  3AEV A;  1N8R C;  3S16 B;  1Y8P B;  2K50 A;  5D3I B;  2OQK A;  2WIN B;  2Z4I A;  2ZTE A;  3FMC A;  1R9T B;  1MIU A;  4Z9C B;  2FMC A;  1S3O A;  4P72 A;  4OO1 H;  5LMN Q;  1TWC B;  4JI3 Q;  2F0P A;  3D0F A;  1JQY D;  4UAI A;  2Z6K C;  4HJA A;  1DZ1 A;  2OWO A;  4QCL A;  1Y1V G;  1K9M C;  2KCC A;  4C2M B;  3J80 c;  4AQY L;  3RD4 A;  2A69 C;  3IRB A;  2F3V A;  1EFW A;  1XTC D;  1WTV A;  1WCM G;  2BA0 A;  3CD6 A;  5M3M B;  3CCV A;  1IL2 A;  1STN A;  2NVT B;  2FJ2 A;  1GUW A;  2PI2 E;  1QUQ B;  2R7D A;  2PNH A;  3BYT B;  1EFI D;  3HKS A;  5EAY A;  5JPM C;  2JEA I;  5GAD C;  1D1K A;  3GV3 A;  3TBI B;  3STB D;  2B2W C;  1HZ9 A;  1HNZ L;  3WDN A;  4C1N K;  3HGB A;  2UUB L;  4O0A A;  3E6Z X;  1E24 A;  2RSO A;  4IOC A;  4KKU A;  3M9B A;  3X3N A;  3CCR A;  1ESF A;  3Q8D A;  2F0E A;  4YY3 L;  1BOS A;  1YVC A;  1C4Q A;  3HOZ H;  2K75 A;  4L6T B;  2R92 H;  4L5S A;  1QNU A;  3DXJ C;  2UUA L;  4JBM A;  1XMO Q;  4A3L G;  3GTO B;  1I4H A;  2E2I B;  3I4L A;  3BDL A;  3ULJ A;  5COY A;  4GOP C;  1ENC A;  5IYD G;  4CHT B;  4KY6 A;  1EWC A;  3HOX G;  2UXC Q;  3I72 A;  1CKO A;  3P1H A;  3C1E A;  1IBM Q;  1LTL A;  3LNN A;  3FPU B;  3G71 A;  3K57 A;  2HDM A;  3S16 H;  1GUN A;  1CQF A;  1F9S A;  3HRZ C;  5IGG A;  4IFD J;  5IT9 E;  3GTG B;  1N36 L;  2Z8L A;  4N8F A;  1AE3 A;  1EY9 A;  1BR9 A;  4HIM A;  3NQT A;  2UUA Q;  3K7A H;  4ZCK A;  1EYA A;  1LTR D;  4YCW A;  4WOR A;  1SDF A;  2WAQ G;  2HHH L;  1TWC H;  2D5D A;  3J7Y W;  5A35 A;  2Q2H A;  2YTV A;  4NKL A;  1ZYR C;  5C4J B;  2ZXR A;  4LF5 L;  2WKD A;  2IWH A;  2MHV A;  4JI7 L;  4K5W A;  2C35 B;  4DAP A;  1AFP A;  1BF4 A;  4Y52 H;  1TR5 A;  1K0R A;  3UE0 A;  3KF8 B;  4H44 C;  1SRO A;  3HOW G;  3EIV A;  3P20 A;  3BJU A;  3SE0 A;  4OIJ A;  3GTK B;  4PQX A;  1CFM A;  1I4X A;  4C3H H;  1K3R A;  3J81 j;  2PZT A;  4JYA Q;  1SFO H;  3KF6 B;  2B29 A;  4JBJ A;  1PH4 A;  2B2V C;  4KY7 A;  3VR5 A;  3CCM A;  1KLU D;  1VDZ A;  3NBH B;  4BY7 G;  4A3D G;  4BBR H;  3ZYY X;  5EKL A;  1EZ6 A;  1LM0 A;  1TS3 A;  2XGT A;  4DV6 L;  1RIP A;  2KEN A;  3JAM i;  4HMJ A;  2KHS A;  1VQD A;  1SYF A;  1OO9 B;  2KED A;  3KYH C;  3E5S A;  1I5F A;  4S3S A;  2CWP A;  2J0T D;  1GVP A;  1KNA A;  2E75 C;  5DNF A;  2AHO B;  5IYB G;  3RLF A;  2OTL A;  1A0I A;  4KD4 A;  2ES2 A;  2C5C A;  1O7I A;  5IGD A;  3GTO H;  4DAY A;  2KEE A;  2NTS A;  3W1G A;  3MXP A;  1PHJ A;  1OXV A;  2HQE A;  4DV6 Q;  2B63 B;  4EX5 A;  2PZW A;  2CW0 D;  1X55 A;  2QGQ A;  3A56 A;  5EPK A;  4HTH A;  1NR4 A;  1KQS A;  4QUC A;  3LWU A;  3GTG H;  3RZD H;  4PZ8 A;  5JJL A;  1HCZ A;  1I4G A;  3DUZ A;  1PMR A;  1N33 Q;  2K5H A;  3M4Y A;  5T1I A;  5M3F H;  4FXD A;  3KBG A;  5C4X G;  2EY6 A;  1Z47 A;  5I6Y A;  1MHW C;  2JA5 G;  2FXQ A;  2IL8 A;  2QEJ C;  2EYP A;  4UPA A;  4XT1 B;  1LTI D;  2E5L L;  4LFB Q;  2NB0 A;  1LTS D;  3GTL H;  5EBC A;  3S1R B;  3DWA A;  1EEF D;  5FJ8 H;  4JI2 L;  2RDH A;  3R93 A;  2AUK A;  1TWA H;  2E76 C;  2KOL A;  1G2S A;  1VQL A;  4ZYS A;  2ASB A;  1F2Y A;  1EY5 A;  1STY A;  4EQ5 A;  1HPC A;  3HOV B;  2F0L A;  2PNR C;  3BZD B;  1BBW A;  1EIH A;  3VR4 A;  2L55 A;  3I2Z A;  2RBM A;  5KGU A;  4RFB A;  3T51 B;  3NBI A;  2F4I A;  3AU7 A;  3JAM L;  1JOQ A;  4JI2 Q;  1I3Q H;  4K2K A;  2DY8 A;  2VS1 A;  3S2H B;  4JOI C;  1EZ8 A;  4Y7N B;  1YEZ A;  1Q90 A;  5IGB A;  1LT3 D;  2XN9 C;  1SMX A;  4LUZ A;  4DK1 A;  3PCO B;  3SK4 A;  4A93 B;  4FF1 A;  1K8O A;  4LF4 L;  1STA A;  3F2B A;  4QQB X;  1HZA A;  1VQ4 A;  2BDN A;  1M4V A;  1DM0 B;  5LMN W;  4O42 A;  2HD3 A;  3MVV A;  3K58 A;  5E1F A;  4GKJ Q;  5I9P A;  2NVQ B;  1PTO D;  2Z1C A;  3URY A;  3G6E A;  1BCP C;  4LF7 Q;  3J81 i;  1C7Y A;  4JV5 L;  2XIW A;  4A3E G;  4G7Z C;  4DGZ A;  4X66 Q;  1EQV A;  4JPB W;  2AMC B;  1CTM A;  1MBY A;  4LF9 L;  1LTT D;  5I2X A;  2K5W A;  3MAQ A;  3D4W A;  4KD3 A;  5FLM G;  4R4C A;  1LTG D;  2A6H D;  2L9H A;  2D0P A;  2K01 A;  4KHP Q;  3GDE A;  1FGB D;  1OXT A;  3J81 E;  4C3I H;  2JA8 B;  4MHE A;  1XPO A;  4DR7 Q;  4ZRZ A;  3SK8 A;  4RG1 A;  2DGY A;  2Z6B A;  4FYD A;  2B2T A;  4JI5 L;  2EJF C;  2JXM B;  2ZM6 Q;  1STH A;  3MWY W;  4LAA A;  2EVB A;  3CCQ A;  1EYD A;  1F77 A;  2UUC Q;  3NPP A;  3QWN A;  3ND9 A;  4IN3 A;  1L1O A;  3IL8 A;  1Q86 C;  1SE4 A;  3HOV H;  1HTL D;  2K52 A;  3K5L A;  5IWA L;  4LK1 C;  1F2L A;  4LFA Q;  2E2H H;  1EYC A;  1PH3 A;  4K6L A;  3HEJ A;  4CBV A;  1KRT A;  1QZG A;  2FIN B;  1JWS D;  1A6X A;  2B2Y C;  2MO0 A;  4A3G B;  1CT1 D;  4Q0F A;  2Z4H A;  4K6D A;  2IX0 A;  4IPH A;  4A3J B;  1VS0 A;  1B4O A;  2F0G A;  2JA6 G;  3HG9 A;  1MSH A;  2O5I C;  1KC8 C;  1PH2 A;  2CKZ B;  5FO9 B;  1PH7 A;  1SRU A;  1F9R A;  2MJ8 A;  3IKJ A;  5K5P A;  3E0E A;  1KAA A;  4M1U B;  4DV7 Q;  1Y8O B;  2X6L A;  1F2Z A;  1TWF H;  1EU4 A;  3K80 C;  3HOY B;  3RN2 A;  3UDX A;  4ZUJ A;  3A8I E;  1KD1 C;  4QIW E;  1WFQ A;  4OWW B;  4JI1 Q;  3I4O A;  1I4Q A;  4FXG C;  1SYB A;  3QOJ A;  3WOF A;  4MZ9 A;  1B9N A;  2K6A A;  1HH2 P;  2NTT A;  2R7Z H;  4DR3 L;  1K8A C;  2RCN A;  5ELN A;  2F0F A;  4F7X A;  1PRT D;  3OHX C;  1EY4 A;  3B6Y A;  2MPM A;  2LXJ A;  3MXN A;  4CDE C;  3FRP B;  2OEO A;  1AEX A;  3PUZ A;  4A3I B;  1XMQ L;  1SMY C;  3SK5 A;  1IBL L;  3MFG A;  1STG A;  4G4K A;  1GHJ A;  1CKM A;  5JPN C;  1GKH A;  1K8G A;  1GJX A;  2E2J B;  2QW7 A;  4K5X A;  4OWT B;  2F0K A;  4OWX B;  4NW2 A;  4BY1 H;  3SK6 A;  2L4N A;  3KLW A;  2E8G A;  2EPB A;  3PO3 B;  1J8I A;  2XNA C;  5KNC A;  1MJC A;  4DAV A;  1SYE A;  1F9P A;  3A54 A;  4UDU C;  3I4N H;  4QIW B;  3K0X A;  4FVM A;  1JE4 A;  1IBL Q;  1EY7 A;  5EBD A;  1LYL A;  4GOP B;  4A3G H;  2Q2T A;  4DF7 A;  2K5V A;  2VQF L;  4JI8 Q;  4C3J B;  3VA7 A;  4B08 A;  4JI4 L;  4QL5 A;  1FGU A;  5C5L A;  2YTX A;  2SOB A;  3IAY A;  1UE6 A;  1YNJ C;  2ZT9 C;  4KJO A;  2F0N A;  1NMG A;  5EKK A;  3K59 A;  1WTH A;  3BYY B;  3GTM H;  2JK8 A;  3DWP A;  2Z0S A;  1KHI A;  3CPW A;  1JC7 A;  4OL7 A;  3S24 A;  5E4X A;  1PFS A;  5C3E B;  1BKB A;  3F2C A;  3QOL A;  2B63 G;  4H13 C;  3ND8 A;  4AYB G;  5KEE A;  1H9J A;  5C0X I;  3FKI H;  4JI4 Q;  1S5E D;  1TWH H;  1Q1B A;  3RMH A;  4AH6 A;  1EQQ A;  1NMF A;  1EWH A;  1VQN A;  3NSW A;  1HUM A;  1P16 A;  4APV A;  2JA7 H;  2J7Z A;  4RHR A;  4LF6 Q;  4NXM L;  4FF4 A;  4DV0 L;  1QVF A;  3TS2 A;  3OWE B;  4X3S A;  4CKC A;  4UY8 C;  4ULL A;  1D8L A;  2EY5 A;  1HTP A;  1S4Z A;  5JOB A;  3GO5 A;  1QUQ A;  3D4D A;  3KLS X;  5BN5 A;  3SVM A;  1VQM A;  1KAW A;  5IT9 c;  2YYZ A;  1B70 B;  4YCV A;  2K32 A;  1NY4 A;  1Q12 A;  3DMU A;  1E1O A;  4HIK A;  5TSS A;  1W6K A;  2QKI C;  3K7U C;  3PUY A;  3VR6 A;  1B44 D;  2YU9 B;  3D31 A;  1CA5 A;  2D2C C;  1K73 C;  4NXM Q;  1A3V A;  2E2J H;  3EBE A;  4CDF C;  3FVQ A;  1QWY A;  4MNO A;  3LGJ A;  1HR0 Q;  4IJH A;  4DR6 Q;  3H3V I;  4KKT A;  1O7L A;  4DXF A;  3TDQ A;  2QIL A;  1XNQ L;  4NMZ A;  4NPS A;  4P74 A;  3UDG A;  3C1F A;  3MEF A;  4CKB A;  4DUY Q;  1VQE A;  1M1K C;  1WI5 A;  1LV9 A;  1VQA A;  2M9V A;  3MXU A;  1STE A;  4JG2 A;  2UXD Q;  2K04 A;  3H0G G;  4GKK L;  4QY7 A;  1PFN A;  4A93 G;  1D7Q A;  5COR A;  5CV8 A;  4JBW A;  4PMB A;  3CU7 A;  2F4V L;  4RMF A;  4QGU A;  2SNS A;  1EU3 A;  1O78 A;  2WKC A;  2PI2 A;  2F3W A;  3KBX A;  2SDF A;  4DXG A;  2KQ3 A;  4A75 A;  1FJG L;  2F0U A;  1LLR D;  3OYY A;  2VL6 A;  5C4Z A;  2K5D A;  3Q23 A;  2VUM H;  2L11 A;  5CGK A;  1IZ6 A;  2B2U A;  1S5B D;  2V1C C;  1QVG A;  4B3R Q;  5C3E H;  2F0H A;  1I4R A;  1LTB D;  3U4V A;  3VA5 A;  3U50 C;  1UEB A;  4GLV B;  5M5X H;  1QZH A;  1PVO A;  2OT2 A;  2P5Z X;  3CP0 A;  5J1Z A;  2F4V Q;  1E0B A;  2KUM A;  3JAM c;  3HOZ B;  2D62 A;  3EQL C;  3M3Y H;  1VQ7 A;  1NCV A;  1PFB A;  2JA8 G;  3HKZ E;  1DON A;  3M85 A;  4HCE A;  5EQ0 A;  4DV3 Q;  3KF8 A;  1SR3 A;  4I65 A;  1DOM A;  4X64 Q;  4BA2 I;  2CH4 A;  3ZJY C;  4ME5 A;  1Q8I A;  2KHJ A;  3NK9 A;  1HNX Q;  3PF5 A;  2PQA B;  2BH8 A;  2AQ2 B;  4ZKB B;  2G5D A;  3KF6 A;  1IKM A;  5FK9 C;  5JEA G;  1FNW A;  1HNW L;  1DCZ A;  2HQL A;  2YU9 H;  2I46 A;  3FP9 A;  2X69 A;  3NBH A;  1Y14 B;  4IUP A;  3I4M G;  1PYS B;  1EIG A;  1JWU D;  2EYH A;  2N55 A;  4DNI A;  3K7A B;  1X3G A;  4FNF A;  4J15 A;  4B3T Q;  1HUN A;  1SSO A;  2K03 A;  1CUK A;  1Q7Y C;  3BVM A;  3MTS A;  2KVM A;  3S1M H;  4DV2 Q;  5CV4 A;  1I6V C;  3OW7 A;  5LMU L;  3QR8 A;  2AWO A;  2DN8 A;  1BCP B;  1ONL A;  4RCN A;  1FD7 D;  2MO1 A;  1PZI D;  4CJ2 C;  4K0K L;  1HNW Q;  2Q8I B;  3T1H L;  4A3J G;  3NEN A;  1LAB A;  4ZUI A;  1PYB A;  2CCZ A;  2XRS D;  3ERS X;  2WB1 G;  3HKZ B;  2Q2I A;  1L0W A;  1CA6 A;  3P7J A;  1E7Z A;  5C44 B;  2GN5 A;  1ILQ A;  1X3P A;  3CCL A;  1B53 A;  4C3H B;  1NE3 A;  3TP7 A;  4A3B G;  4GLA C;  1JIC A;  3RR5 A;  1SFO B;  5IP9 H;  2QF7 A;  1O7Y A;  1UUP A;  2NVY H;  1PH5 A;  2KCT A;  4FP5 D;  1X56 A;  4R8N A;  4QMG A;  4BBR B;  2DJG C;  5FO8 B;  3RLN A;  5IYC H;  4AQY Q;  3G4S A;  4XDX A;  2PCF B;  1HZB A;  3BU2 A;  1WTW A;  4QUF A;  5CBE E;  3F2D A;  1B9M A;  2NN6 G;  2LXK A;  2JJQ A;  3PUW A;  2F0T A;  3WWV A;  1Y1W B;  1IYU A;  1QOH A;  4ZKC B;  3KK7 A;  3CCS A;  1Q1E A;  3SGI A;  2NVX H;  1HNZ Q;  3V05 A;  5HGT A;  5EJW A;  2D9U A;  2UUB Q;  4UHV A;  4A3I G;  4MIU A;  2B8F A;  3CC4 A;  2LMC B;  4OON A;  3J81 c;  3A8J E;  2EYJ A;  3NEL A;  3QJY A;  1JR0 D;  1XPU A;  4YY3 Q;  3PMF A;  2VZA A;  1MKH A;  1CKN B;  3RZD B;  3RZO H;  3VYR A;  3D8G A;  3DEP A;  1HZC A;  3OOC A;  4RGT A;  3ULP A;  3S14 H;  3VDY A;  2K7V A;  4XT3 B;  2ZJQ A;  5M3F B;  2H4O A;  4GLX A;  3NTK A;  1CZG A;  3N52 A;  4LFC L;  2EDG A;  5EPL A;  1SJH D;  3X3M A;  4CJ0 B;  2VY3 A;  3GTL B;  1YNN C;  2WFW A;  4U68 A;  1BDO A;  3TQY A;  3Q6S A;  3GTQ H;  3ITP A;  4EGV A;  1DOL A;  5H1S E;  2GVA A;  1EY6 A;  3CAM A;  1AZQ A;  1TWA B;  4JI0 L;  4C3J G;  2ZJP A;  1N36 Q;  2EYO A;  5AJ3 L;  3ERO A;  1KAB A;  3R3O A;  4ABN A;  4AIM A;  3HOU G;  2Z9H A;  5C44 H;  3VYS A;  5FOB B;  2HHH Q;  5I9O A;  3HFZ B;  2EYM A;  1VQP A;  2B3G A;  3S15 B;  5KNB A;  3GQB A;  4RCO A;  4LF5 Q;  1EIY B;  1I3Q B;  4JI7 Q;  4A3C H;  4LW1 A;  2XTI A;  4JI0 Q;  1A3U A;  1KLG D;  3OIQ A;  3TP6 A;  2MFI A;  3TP5 A;  4XXE A;  2OF1 A;  1Q46 A;  1VQC A;  4HAE A;  3CC2 A;  1MSG A;  3FEW X;  4EQO A;  4DR4 L;  3PV0 A;  4IUQ A;  3RNU A;  3KFU A;  1Y1W H;  1HR0 W;  2MUY A;  5M5W H;  1PTO F;  1WTR A;  4BBS H;  1KL9 A;  3CME A;  2E2D C;  1S72 A;  2KEC A;  3JAM E;  3HZX A;  4KMU C;  2JP1 A;  3BG3 A;  3MXG A;  3AFP A;  2R93 G;  5FKA C;  1AP0 A;  3CRK C;  4CDC C;  4A3K H;  2JA6 H;  4DR4 Q;  2KCN A;  4C3I B;  1TU2 B;  2F0J A;  2F3I A;  2N78 A;  5CBA E;  4OO1 G;  5L37 A;  1N34 L;  2OCE A;  1A62 A;  2A68 D;  5IIF A;  4CGY B;  1TS4 A;  4X3K A;  4HJ5 A;  2K28 A;  4MN3 A;  1SBB B;  2JYO A;  5C0X H;  4A3M G;  2QCP X;  1Z9F A;  3PSI A;  1PZJ D;  4A3F H;  3T1Y L;  2TMP A;  5J39 A;  2A5H A;  4DR1 L;  2F52 A;  4DK0 A;  2DNE A;  4LUV A;  4LUO A;  1W2B A;  1K8M A;  2E2H B;  2Z6K A;  1YJN A;  1ROD A;  4DN4 M;  4PMC A;  3U58 A;  2RA4 A;  1Y8N B;  4RGN A;  2QEX A;  4IFD G;  2G9D A;  3G7L A;  5D3D A;  3H15 A;  1SYC A;  1J6Q A;  2E5L Q;  2C9O A;  4ALP A;  3S15 H;  1CM9 A;  3I8Z A;  4DKA C;  1W3S A;  1KDA A;  5DEH A;  1X32 A;  1HA5 A;  5IGF A;  1KDC A;  2Y0S E;  4N9P A;  4WRD A;  2BA1 A;  5K36 G;  3M4O H;  1N32 L;  2EIF A;  3CCU A;  2YTY A;  4RGO S;  4DR1 Q;  1F2M A;  3V96 A;  1TWG H;  3D6C A;  3H3V H;  2B2W A;  4F88 A;  3HOZ G;  5C0X J;  4IO9 A;  2R92 G;  3PIP 3;  3J7A 5;  2D0O A;  4OEL B;  1HQM C;  4DV4 L;  5A2Q L;  1IBK L;  2A1A A;  1SJE D;  4FF3 A;  2UXB L;  2HT1 A;  1UEA B;  4HN7 A;  4R4Q A;  3PUV A;  1GO3 E;  3EFX D;  2LS0 1;  1TWF B;  5CYU A;  2OQ0 A;  1CI3 M;  5EKI A;  4DR2 L;  2Q8T A;  4TKO B;  2AQ1 B;  1MGS A;  2UU9 L;  1HFN A;  1VQB A;  3BZK A;  4X3T A;  1GUT A;  1X3Q A;  4G57 A;  4KN7 C;  3F2U A;  3EN2 A;  2L1B A;  2EE1 A;  3STB C;  4TVA B;  4LF4 Q;  1SE8 A;  3OW2 A;  2R7Z B;  1I6H H;  3D6W A;  4GOP A;  2VW9 A;  1B3A A;  1PRT F;  1IXR A;  1IBK Q;  1KIX A;  1VQF A;  3A5Z B;  4IAL A;  3PF4 A;  4KI0 A;  1NBW A;  4JV5 Q;  3TZD A;  4GNX C;  4DR2 Q;  3NXW A;  3BVZ A;  1KRS A;  1J5E L;  5BN3 A;  4XIG S;  2Y0S B;  2A6E D;  3F8T A;  4LF9 Q;  4GZY C;  3UE1 A;  1QCB D;  3R2T A;  4RKL A;  3KOJ A;  5EGT A;  1RTO A;  1EEI D;  2EJM A;  4WFN 3;  5KYL A;  3R2I A;  1DGS A;  2ATW A;  3HKZ G;  5M3M G;  4R4O A;  4BY1 B;  3J80 L;  3J7A F;  1I50 B;  1Q3L A;  1HXY D;  3L3O C;  2ZXO A;  3CC7 A;  1GUS A;  3G6J B;  4C3H G;  3BS1 A;  1FR3 A;  2NZH A;  2Q2U A;  4GN5 A;  1UWV A;  4DK6 C;  4IFD I;  1EWI A;  4BXX H;  1EUJ A;  4JI5 Q;  1X54 A;  3I4N B;  3CKI B;  4UP7 A;  4BBR G;  5ELB A;  1HQR D;  3E9I A;  4KTA A;  1QG7 A;  2F03 A;  1O80 A;  1OXS C;  4R4I A;  4I7A A;  1YHQ A;  1NUC A;  3L2P A;  4IUT A;  1DOK A;  1BXT A;  2N8N A;  1IW7 D;  1T5E A;  2F0Q A;  2XSC A;  3MZ5 A;  1X3E A;  1LT4 D;  1PTO H;  5IWA Q;  1TKW B;  1IYJ B;  3CMA A;  2B2V A;  2L5T A;  1XWE A;  3GTM B;  2X6G A;  2IT1 A;  1PFM A;  2A74 C;  5KIX A;  3I90 A;  1XTD A;  4HR7 B;  2IHF A;  1PLF A;  4DR5 L;  4FF2 A;  3H0G H;  1BVS A;  1Y1V B;  1BO0 A;  4DNR B;  3JC6 6;  2N49 A;  3OTO L;  1VF7 A;  3FKI B;  4QF4 A;  3GTJ H;  2BCO A;  1TS2 A;  1YZ6 A;  1TWH B;  4YWL A;  5CV5 A;  4HJ9 A;  2EZV A;  5IP7 H;  1JJC B;  2JA7 B;  4IPD A;  5M3F G;  4B3M L;  2EYL A;  1TII D;  3CXC A;  5GQO A;  2ZTC A;  3SHL A;  4C1N I;  5BR8 L;  2RVL A;  2WAQ E;  1ENA A;  2EYF A;  1I4P A;  3S1N H;  2BOS A;  1DJR D;  3J7Z C;  2N3S A;  5FJ8 G;  3PO2 H;  1Q8K A;  4DUZ L;  3H3V C;  1ILP A;  4NB3 A;  4DR3 Q;  1KXL A;  2XVS A;  2CW0 C;  3I56 A;  1KTK A;  4OX9 L;  1I50 H;  2HCI A;  4A76 A;  4L5T A;  2A69 D;  1EYG A;  3C46 A;  5DLQ E;  3HOX B;  2QA4 A;  1VQK A;  1I94 L;  1SNQ A;  1XMQ Q;  5E7N A;  2K5Q A;  2KA7 A;  5JEA H;  1SYD A;  4XQQ A;  3UDI A;  1B2T A;  2K4K A;  3TRE A;  4IPC A;  3I4M H;  4G7O C;  2I07 B;  2FMM A;  3OMC A;  3IFD A;  2PQA A;  3A74 A;  2RHS B;  1WD0 A;  2WAQ B;  3MA2 B;  4KK7 A;  3S1Q H;  3NUC A;  4LWC A;  5G3L D;  5F2D A;  2VUM B;  1G8Z D;  2RDG A;  2K14 A;  2BH2 A;  4RWS C;  5IE8 A;  3K5N A;  3M7N A;  5C3W A;  1C9O A;  1EY0 A;  1Y1V H;  3RLO A;  1G2T A;  2VQF Q;  4PG3 A;  1G91 A;  5M5X B;  1WCM H;  3RN5 A;  1H9S A;  1ET9 A;  1ZXT A;  2K1B A;  4HIO A;  3KLS A;  1PZK D;  3M3Y B;  1A15 A;  4C3I G;  1XYI A;  2F0M A;  5DM7 3;  4JI6 L;  2HIV A;  2VNU D;  2WV6 D;  3KDF B;  4PZ7 A;  4H0L C;  3J7A V;  4A3D B;  2CFM A;  4HSV A;  3DWQ A;  1VQ5 A;  1GD7 A;  4DFA A;  2K33 A;  4NP5 A;  3W1B A;  2F0W A;  3Q24 A;  1AZP A;  1IHZ A;  1PTO C;  4EVO A;  1WYD A;  2DNC A;  5CC4 A;  3Q0A A;  3K0Y A;  1VCI A;  1EOT A;  1UE5 A;  1RTN A;  1ZYR D;  1PXU A;  3A0J A;  3HOV G;  1TT2 A;  4V19 0;  4DV0 Q;  1JE5 A;  2ID0 A;  4A3L H;  1AE2 A;  1E1T A;  1JOO A;  3S17 B;  5IOC A;  3PUX A;  1GOZ A;  1S40 A;  3NWT A;  2PO4 A;  5JVG 3;  5IYD H;  1YNX A;  1VQG A;  4NXN L;  1ESR A;  5I4D A;  4B3S L;  4FO2 A;  3HOX H;  1NJI C;  5FLX L;  1V43 A;  1SXT A;  2ICI A;  3SEB A;  4LJZ C;  3S1M B;  4LMQ D;  1E2V A;  2KHI A;  1K83 B;  1CK1 A;  2L12 A;  5J3B A;  1VQ8 A;  4FDB A;  1JMC A;  4IJL A;  4CKE A;  5M5Y H;  1RKN A;  1N9W A;  2R3Z A;  2H1E A;  3F1Z A;  3AB9 A;  1SLJ A;  3E0J A;  2L15 A;  2CQA A;  2B2Y A;  1LO5 D;  3DEO A;  3ERQ A;  5LL6 X;  1XNQ Q; 
#chains in the Genus database with same CATH homology
 1TS5 A;  2PQE A;  5J22 A;  2NVY B;  4L8J A;  4N9T A;  1D6E C;  4RAU C;  5CMD A;  1G6Z A;  3DHQ A;  1UNS A;  1JCK B;  2B8G A;  4P2C B;  1D2B A;  1MD2 D;  2CHB D;  1SND A;  4RGM A;  2EJG C;  2NZ1 D;  2GA4 B;  1KDB A;  3BVG A;  3GV6 A;  3VYT A;  2NVX B;  2IX3 A;  2O5J C;  1AW7 A;  3RUZ A;  3TME A;  4C56 C;  3EJI A;  4ILW A;  1SNM A;  1CQV A;  5KND A;  3Q22 A;  3RZO B;  3S14 B;  4TSS A;  2NWG A;  5D14 A;  4BS9 A;  1L0X B;  2F0V A;  2AQ3 B;  2BE5 C;  1GXD C;  2PW5 A;  4J6H A;  1H9S B;  1FYC A;  1PRT C;  3GTQ B;  1W6J A;  1WTX A;  2VXW A;  2BDO A;  3SDZ A;  3KUP A;  1SAP A;  1TVX A;  2FHT A;  2XWJ B;  3VYU A;  1BBX C;  1EL0 A;  5C3X A;  3TSS A;  4K2L A;  2L0C A;  2VB3 X;  3QG1 A;  3QO2 A;  3T13 A;  2RSN A;  3FPP A;  3A55 A;  1B1Z A;  1WD1 A;  4HMI A;  1DD2 A;  1D1I A;  1RDP D;  1BCP D;  4ID6 A;  1ICW A;  4TQU S;  1LAC A;  4HED A;  4PV1 C;  5CR3 A;  5M5W B;  1L0Y B;  4IFD H;  3NQI A;  1IL8 A;  1V8Q A;  4IZ8 A;  4BBS B;  4YIJ A;  2KJX A;  3FDT A;  1NSN S;  5K36 H;  2F1M A;  3H6M A;  3OSO A;  4A3K B;  2JA6 B;  2G9H D;  3VR2 A;  2MP1 A;  2LY7 A;  1OXX K;  3K6O A;  3KLR A;  2ENB A;  3M7G A;  4OHJ A;  3HP3 A;  4KN4 C;  1HFG A;  1TY0 A;  3T53 B;  4ODG A;  4BWG B;  2B2T C;  2WAC A;  4U67 3;  1D5Z C;  2FFK B;  2SEB D;  4IUV A;  4G7H C;  4A3F B;  3D4R A;  1WTQ A;  1AN8 A;  5ISR A;  3TZU A;  2M00 A;  5ELC A;  1JOR A;  1D5X C;  2PMZ B;  3T16 A;  1Y69 U;  3I91 A;  4OGQ C;  4F87 A;  3I3C A;  4J8Q A;  4TRD A;  4R8I A;  3M4O B;  2NN6 I;  3NHH A;  1TWG B;  2CVR A;  1JWM D;  4K8J A;  5LL6 S;  4KHV A;  2F0I A;  1WVL A;  3PIO 3;  1C8C A;  2B39 A;  4OIK A;  1S5D D;  3S2D B;  3O13 A;  5IOD A;  2IPK D;  3W3A A;  1SEB D;  3VR3 A;  1RCV D;  1C48 A;  2PPB C;  1BUV T;  4KJN A;  5IT9 L;  3SR1 A;  2ICE C;  1XX8 A;  2XRQ D;  2F0O A;  2OXP A;  1JB3 A;  1BNZ A;  1I6H B;  1RJT A;  1SMY D;  4DU9 A;  2QDB A;  2IW3 A;  2Q8R E;  4JK1 C;  5ELD A;  1DYQ A;  5A2Q E;  4FXK C;  1E2Z A;  3EVQ A;  4AYB B;  3S9W A;  5E3F A;  4R9W A;  2RQX A;  4K5V A;  1U9R A;  4NDX A;  4XYO A;  1SE3 A;  3OIP A;  2E74 C;  5AFW A;  3U9O A;  3D3R A;  4F8M A;  3V2T A;  1YNJ D;  3BDC A;  1VMP A;  4IUR A;  3LWE A;  1S5F D;  1HHV A;  1JOK A;  1V1P A;  1KNE A;  2JE6 I;  2TSS A;  3LX0 A;  1A3T A;  3H91 A;  2J4X A;  1B50 A;  5FO7 B;  1LT5 D;  4HCS A;  1PTO B;  3J80 E;  1IYV A;  3TP8 A;  1R4Q B;  1HRJ A;  1STB A;  4XYQ A;  4HSP A;  2NBF A;  1OXU A;  1CZW A;  4KY5 A;  3K5M A;  3GTP B;  3H0G B;  2JEB I;  2RKS A;  3EA6 A;  1A2U A;  2EXZ A;  4KV6 A;  4ZK9 B;  3GTJ B;  3L7Z C;  1CHP D;  4M8A A;  4XQN A;  5E4W C;  2DY7 A;  2HCC A;  2ZXP A;  4OO1 I;  3C2P A;  3A8K E;  3S1N B;  2K05 A;  1SNC A;  2AWN A;  5D65 A;  4PNY A;  3PO2 B;  1VF5 C;  3K5O A;  2PZU A;  4XQJ A;  2WII B;  3DM1 A;  5HUR A;  1U4P A;  1H9R A;  3OWF A;  1Z7T A;  2RDF A;  3L9A X;  5ELF A;  3WOE A;  3U9S A;  3QB3 A;  4BA1 I;  5JJZ A;  1RF2 D;  1GUG A;  4XTC S;  1DXM A;  5C4H A;  3I4M B;  4EQN A;  1GUO A;  1EY8 A;  5NUC A;  3H94 A;  3I70 A;  3MC0 B;  3S1Q B;  5G3L F;  3UI2 A;  1NAP A;  1CHQ D;  4K8I A;  2O2L D;  1MI2 A;  2B2U C;  3OPO A;  2WB1 B;  4IQZ A;  1WCM B;  4RH6 A;  1RD9 D;  1PRT B;  5BN4 A;  3MFY A;  2JSO A;  2M2L A;  3J81 L;  3MHB A;  4A3B B;  1G29 1;  3N6R A;  1V1P B;  3OMG A;  4KHZ A;  1QB5 D;  1II3 A;  5C0X G;  2AUJ D;  3MEH A;  2IX1 A;  4O1N A;  2BE5 D;  3NE5 B;  2HDL A;  3NTI A;  1A2T A;  4CJ1 B;  2WP8 J;  4RA8 A;  3GP7 A;  1ENF A;  2XWB B;  3ONA B;  4ZQ3 A;  3CHB D;  1U4R A;  5JVH 3;  1BQQ T;  2A68 C;  3IFT A;  5M5Y B;  2PW7 A;  5LHY 1;  5JAV A;  1EQT A;  3NWS A;  4I7Z C;  1ET6 A;  4DA2 A;  2F0S A;  2LFN A;  5C5M A;  3BDO A;  3HS0 C;  1WTO A;  5FLX E;  3C3L A;  4ZLT F;  4B9X A;  2R6G A;  1D5M C;  5DAU A;  3AMU A;  1VMC A;  5C6A A;  1H9M A;  1IKL A;  2EY2 A;  1SYG A;  3SXH A;  1SNO A;  3HOU B;  3HOW B;  1H9K A;  4RKB A;  4DNT B;  1F9Q A;  2F0D A;  1LT6 D;  3H09 A;  2IJ0 A;  1V1O A;  5CV7 A;  5JEA J;  3P75 A;  3W2D A;  1XXG A;  1TQO A;  4ZAI A;  1QIL A;  1UAP A;  1J9O A;  4BY7 B;  5IGC A;  2R61 A;  3GD7 A;  1FNV A;  3NP8 A;  1TY2 A;  4RHS A;  5IGE A;  2NN6 H;  1PDQ A;  1U4M A;  1FNU A;  1S5C D;  2EY1 A;  1R4P B;  1ML0 D;  1SE2 A;  1YNN D;  2NUC A;  1QJO A;  1Z6H A;  2A6H C;  4IUU A;  4PMW A;  1ZKO A;  3NTH A;  2R93 B;  4B9W A;  1E2W A;  2V4D A;  3A7A B;  2EOT A;  2A6E C;  2SNM A;  5C4X B;  5M9O A;  4Q5V A;  3TN2 A;  1RHP A;  2JA5 B;  3R8B A;  4V0B A;  4IUN A;  4A3M B;  1U4L A;  2LKV A;  3I73 A;  1LTA D;  3CRL C;  5KYI A;  1T5X D;  5CV6 A;  1NR2 A;  4H7B A;  5EPJ A;  1BCP F;  3A7L A;  4K14 A;  3T56 B;  5CV9 A;  2A73 B;  2NYZ D;  1QNK A;  2N88 A;  1O7Z A;  1SNP A;  2PYK A;  4X3U A;  1IW7 C;  4J1M A;  4EQP A;  2MGS A;  4KKS A;  5DM6 3;  5T1G A;  3CQZ B;  4E6I A;  4QB4 A;  5I2Y A;  5KRU A;  2HUG A;  1QE6 A;  2R92 B;  2VB2 X;  1WTP A;  1PYW D;  4L63 B;  1M8A A;  5I6W A;  1HA6 A;  5ELE A;  1GHK A;  4A3E B;  4WJW A;  1ZEQ X;  3T4A C;  3QIA A;  2O4X A;  3S16 B;  1Y8P B;  5D3I B;  2WIN B;  2Z4I A;  3FMC A;  1R9T B;  4Z9C B;  2FMC A;  4OO1 H;  1TWC B;  2F0P A;  4UAI A;  1JQY D;  1DZ1 A;  4QCL A;  4C2M B;  2KCC A;  3RD4 A;  2A69 C;  2F3V A;  1XTC D;  1WTV A;  2BA0 A;  5M3M B;  1STN A;  2NVT B;  2FJ2 A;  1GUW A;  3BYT B;  1EFI D;  5JPM C;  2JEA I;  1D1K A;  3GV3 A;  3TBI B;  2B2W C;  3WDN A;  4C1N K;  3HGB A;  3E6Z X;  2RSO A;  4KKU A;  3X3N A;  1ESF A;  2F0E A;  1BOS A;  1C4Q A;  4L6T B;  1QNU A;  3DXJ C;  3GTO B;  1I4H A;  2E2I B;  3I4L A;  3BDL A;  5COY A;  1ENC A;  4CHT B;  4KY6 A;  1EWC A;  3I72 A;  3P1H A;  3C1E A;  3LNN A;  3FPU B;  3K57 A;  2HDM A;  1GUN A;  1CQF A;  1F9S A;  3HRZ C;  5IGG A;  4IFD J;  5IT9 E;  3GTG B;  2Z8L A;  1EY9 A;  1BR9 A;  3NQT A;  1EYA A;  1LTR D;  4WOR A;  1SDF A;  2D5D A;  3J7Y W;  5A35 A;  4NKL A;  1ZYR C;  5C4J B;  2ZXR A;  2WKD A;  2IWH A;  2MHV A;  4K5W A;  4DAP A;  1AFP A;  1BF4 A;  1TR5 A;  4H44 C;  3P20 A;  3SE0 A;  4OIJ A;  3GTK B;  4PQX A;  1CFM A;  1I4X A;  2PZT A;  2B2V C;  4KY7 A;  3VR5 A;  1KLU D;  1VDZ A;  3ZYY X;  5EKL A;  1EZ6 A;  1TS3 A;  4HMJ A;  2KHS A;  2KED A;  1SYF A;  1OO9 B;  3E5S A;  4S3S A;  2J0T D;  1KNA A;  5DNF A;  2E75 C;  3RLF A;  4KD4 A;  2C5C A;  5IGD A;  4DAY A;  2KEE A;  2NTS A;  3MXP A;  1OXV A;  2HQE A;  2B63 B;  2PZW A;  2CW0 D;  3A56 A;  5EPK A;  4HTH A;  1NR4 A;  4QUC A;  3LWU A;  1HCZ A;  1I4G A;  3DUZ A;  1PMR A;  3M4Y A;  5T1I A;  4FXD A;  3KBG A;  2EY6 A;  1Z47 A;  5I6Y A;  2IL8 A;  2QEJ C;  2EYP A;  4XT1 B;  1LTI D;  2NB0 A;  1LTS D;  5EBC A;  3S1R B;  3DWA A;  1EEF D;  2RDH A;  3R93 A;  2AUK A;  2E76 C;  2KOL A;  1G2S A;  4ZYS A;  1F2Y A;  1EY5 A;  1STY A;  1HPC A;  3HOV B;  2F0L A;  2PNR C;  3BZD B;  1EIH A;  3VR4 A;  2L55 A;  2RBM A;  5KGU A;  4RFB A;  3T51 B;  3NBI A;  2F4I A;  3AU7 A;  3JAM L;  1JOQ A;  4K2K A;  2DY8 A;  3S2H B;  1EZ8 A;  4Y7N B;  5IGB A;  1Q90 A;  1LT3 D;  2XN9 C;  4DK1 A;  1K8O A;  3SK4 A;  4A93 B;  4FF1 A;  1STA A;  2BDN A;  1M4V A;  1DM0 B;  4O42 A;  3MVV A;  3K58 A;  5E1F A;  5I9P A;  2NVQ B;  1PTO D;  2Z1C A;  3URY A;  1BCP C;  2XIW A;  4G7Z C;  4DGZ A;  1EQV A;  1CTM A;  1MBY A;  1LTT D;  5I2X A;  2K5W A;  3MAQ A;  3D4W A;  4KD3 A;  1LTG D;  2A6H D;  2L9H A;  2K01 A;  1FGB D;  1OXT A;  3J81 E;  2JA8 B;  4MHE A;  4ZRZ A;  3SK8 A;  4FYD A;  2B2T A;  2EJF C;  2JXM B;  1STH A;  3MWY W;  4LAA A;  2EVB A;  1EYD A;  1F77 A;  3NPP A;  3QWN A;  3ND9 A;  4IN3 A;  3IL8 A;  1SE4 A;  1HTL D;  3K5L A;  4LK1 C;  1F2L A;  1EYC A;  4K6L A;  3HEJ A;  4CBV A;  2FIN B;  1JWS D;  1A6X A;  2B2Y C;  4A3G B;  1CT1 D;  4Q0F A;  2Z4H A;  4K6D A;  2IX0 A;  4A3J B;  1B4O A;  2F0G A;  3HG9 A;  1MSH A;  2O5I C;  5FO9 B;  1F9R A;  2MJ8 A;  3IKJ A;  5K5P A;  4M1U B;  1KAA A;  1Y8O B;  2X6L A;  1F2Z A;  1EU4 A;  3HOY B;  4ZUJ A;  3A8I E;  1I4Q A;  4FXG C;  1SYB A;  3QOJ A;  3WOF A;  1B9N A;  2K6A A;  2NTT A;  2F0F A;  4F7X A;  1PRT D;  3OHX C;  1EY4 A;  2MPM A;  3MXN A;  3FRP B;  2OEO A;  1AEX A;  3PUZ A;  4A3I B;  1SMY C;  3SK5 A;  3MFG A;  1STG A;  4G4K A;  1GHJ A;  5JPN C;  1GJX A;  2E2J B;  4K5X A;  2F0K A;  4NW2 A;  3SK6 A;  2L4N A;  2EPB A;  3PO3 B;  1J8I A;  2XNA C;  5KNC A;  4DAV A;  1SYE A;  1F9P A;  3A54 A;  4UDU C;  4QIW B;  4FVM A;  1JE4 A;  1EY7 A;  5EBD A;  4DF7 A;  4C3J B;  3VA7 A;  4B08 A;  5C5L A;  2SOB A;  3IAY A;  1YNJ C;  2ZT9 C;  4KJO A;  2F0N A;  5EKK A;  3K59 A;  3BYY B;  3DWP A;  1JC7 A;  4OL7 A;  5E4X A;  5C3E B;  3QOL A;  4H13 C;  3ND8 A;  5KEE A;  1H9J A;  5C0X I;  1S5E D;  1Q1B A;  3RMH A;  1EWH A;  3NSW A;  1HUM A;  2J7Z A;  4RHR A;  4FF4 A;  3OWE B;  4X3S A;  4CKC A;  4ULL A;  2EY5 A;  1HTP A;  1S4Z A;  5JOB A;  3GO5 A;  3KLS X;  3D4D A;  3SVM A;  5BN5 A;  2YYZ A;  2K32 A;  1Q12 A;  3DMU A;  5TSS A;  1W6K A;  2QKI C;  3PUY A;  3VR6 A;  1B44 D;  2YU9 B;  3D31 A;  1CA5 A;  2D2C C;  1A3V A;  3FVQ A;  1QWY A;  4KKT A;  1O7L A;  4DXF A;  3TDQ A;  2QIL A;  4NMZ A;  3C1F A;  4CKB A;  1LV9 A;  2M9V A;  3MXU A;  1STE A;  2K04 A;  1PFN A;  5COR A;  5CV8 A;  4JBW A;  4PMB A;  3CU7 A;  2SNS A;  1EU3 A;  1O78 A;  2WKC A;  2F3W A;  3KBX A;  2SDF A;  4DXG A;  2KQ3 A;  2F0U A;  1LLR D;  5C4Z A;  2K5D A;  3Q23 A;  2L11 A;  5CGK A;  2B2U A;  1S5B D;  2F0H A;  1I4R A;  1LTB D;  3VA5 A;  2OT2 A;  5J1Z A;  1E0B A;  2KUM A;  3HOZ B;  2D62 A;  3EQL C;  1NCV A;  1PFB A;  1DON A;  3M85 A;  4HCE A;  5EQ0 A;  3KF8 A;  4I65 A;  1DOM A;  4BA2 I;  4ME5 A;  1Q8I A;  3NK9 A;  2AQ2 B;  4ZKB B;  1IKM A;  5FK9 C;  5JEA G;  1FNW A;  1DCZ A;  2I46 A;  3NBH A;  2X69 A;  4IUP A;  1EIG A;  1JWU D;  2EYH A;  2N55 A;  3K7A B;  4FNF A;  1HUN A;  1SSO A;  2K03 A;  3BVM A;  3MTS A;  2KVM A;  5CV4 A;  1I6V C;  3OW7 A;  2AWO A;  2DN8 A;  1BCP B;  1ONL A;  4RCN A;  1FD7 D;  4CJ2 C;  1PZI D;  2Q8I B;  1LAB A;  4ZUI A;  2XRS D;  3HKZ B;  1CA6 A;  3P7J A;  5C44 B;  1ILQ A;  1X3P A;  1B53 A;  4C3H B;  3TP7 A;  1JIC A;  1SFO B;  2QF7 A;  1O7Y A;  1UUP A;  4FP5 D;  4R8N A;  4QMG A;  4BBR B;  5FO8 B;  4XDX A;  2PCF B;  1WTW A;  4QUF A;  5CBE E;  1B9M A;  2NN6 G;  3PUW A;  2F0T A;  1Y1W B;  1IYU A;  1QOH A;  4ZKC B;  3KK7 A;  1Q1E A;  3V05 A;  5HGT A;  5EJW A;  2D9U A;  4MIU A;  2B8F A;  2LMC B;  3A8J E;  2EYJ A;  3QJY A;  1JR0 D;  3PMF A;  3RZD B;  3VYR A;  3D8G A;  3DEP A;  3OOC A;  4RGT A;  2K7V A;  4XT3 B;  5M3F B;  2H4O A;  3NTK A;  1CZG A;  3N52 A;  2EDG A;  5EPL A;  1SJH D;  3X3M A;  4CJ0 B;  3GTL B;  1YNN C;  4U68 A;  1BDO A;  3Q6S A;  3ITP A;  4EGV A;  1DOL A;  1EY6 A;  1AZQ A;  1TWA B;  4C3J G;  2EYO A;  3ERO A;  1KAB A;  3R3O A;  4ABN A;  3VYS A;  5FOB B;  5I9O A;  2EYM A;  3S15 B;  5KNB A;  3GQB A;  4RCO A;  1I3Q B;  1A3U A;  1KLG D;  3OIQ A;  3TP6 A;  3TP5 A;  4XXE A;  2OF1 A;  4HAE A;  1MSG A;  3FEW X;  4EQO A;  3PV0 A;  4IUQ A;  2MUY A;  1PTO F;  1WTR A;  2E2D C;  2KEC A;  3JAM E;  3HZX A;  4KMU C;  2JP1 A;  3BG3 A;  3MXG A;  5FKA C;  1AP0 A;  3CRK C;  2KCN A;  4C3I B;  1TU2 B;  2F0J A;  5CBA E;  4OO1 G;  2A68 D;  5IIF A;  4CGY B;  1TS4 A;  4X3K A;  2K28 A;  4MN3 A;  1SBB B;  2JYO A;  5C0X H;  2QCP X;  1PZJ D;  2TMP A;  5J39 A;  2A5H A;  4DK0 A;  2DNE A;  1K8M A;  2E2H B;  1ROD A;  4DN4 M;  4PMC A;  2RA4 A;  1Y8N B;  4RGN A;  4IFD G;  2G9D A;  3G7L A;  5D3D A;  1SYC A;  2C9O A;  1CM9 A;  3I8Z A;  1KDA A;  5DEH A;  1X32 A;  1HA5 A;  5IGF A;  1KDC A;  4N9P A;  4WRD A;  2BA1 A;  5K36 G;  4RGO S;  1F2M A;  3V96 A;  3D6C A;  2B2W A;  4F88 A;  5C0X J;  3PIP 3;  1HQM C;  5A2Q L;  1SJE D;  4FF3 A;  1UEA B;  4HN7 A;  3PUV A;  3EFX D;  2LS0 1;  1TWF B;  5CYU A;  1CI3 M;  5EKI A;  2Q8T A;  4TKO B;  2AQ1 B;  1MGS A;  1HFN A;  4X3T A;  1GUT A;  1X3Q A;  4G57 A;  4KN7 C;  3F2U A;  2L1B A;  2EE1 A;  2R7Z B;  3D6W A;  1B3A A;  1PRT F;  4IAL A;  4KI0 A;  3TZD A;  3NXW A;  3BVZ A;  5BN3 A;  4XIG S;  2Y0S B;  2A6E D;  4GZY C;  1QCB D;  3R2T A;  4RKL A;  5EGT A;  1RTO A;  1EEI D;  2EJM A;  4WFN 3;  5KYL A;  3R2I A;  4BY1 B;  3J80 L;  3J7A F;  1I50 B;  1Q3L A;  1HXY D;  3L3O C;  2ZXO A;  1GUS A;  3G6J B;  4C3H G;  3BS1 A;  1FR3 A;  4IFD I;  3I4N B;  3CKI B;  5ELB A;  1HQR D;  4KTA A;  1QG7 A;  2F03 A;  1O80 A;  1OXS C;  1NUC A;  4IUT A;  1DOK A;  1BXT A;  1IW7 D;  1T5E A;  2F0Q A;  2XSC A;  3MZ5 A;  1LT4 D;  1PTO H;  1TKW B;  2B2V A;  2L5T A;  1XWE A;  3GTM B;  2X6G A;  2IT1 A;  1PFM A;  2A74 C;  5KIX A;  3I90 A;  4HR7 B;  1PLF A;  4FF2 A;  1Y1V B;  4DNR B;  1BO0 A;  1VF7 A;  3FKI B;  4QF4 A;  2BCO A;  1TS2 A;  1TWH B;  5CV5 A;  2EZV A;  2JA7 B;  2EYL A;  1TII D;  3SHL A;  4C1N I;  2RVL A;  1ENA A;  2EYF A;  1I4P A;  2BOS A;  1DJR D;  3H3V C;  1ILP A;  2XVS A;  2CW0 C;  1KTK A;  2HCI A;  2A69 D;  3C46 A;  3HOX B;  1SNQ A;  2K5Q A;  2KA7 A;  5JEA H;  1SYD A;  4XQQ A;  1B2T A;  4G7O C;  2I07 B;  2FMM A;  3OMC A;  3IFD A;  1WD0 A;  2WAQ B;  3MA2 B;  4KK7 A;  3NUC A;  5G3L D;  5F2D A;  2VUM B;  1G8Z D;  2RDG A;  4RWS C;  3M7N A;  3K5N A;  5C3W A;  1EY0 A;  1G2T A;  1G91 A;  5M5X B;  1H9S A;  1ET9 A;  1ZXT A;  2K1B A;  3KLS A;  1PZK D;  3M3Y B;  1A15 A;  4C3I G;  1XYI A;  2F0M A;  5DM7 3;  2VNU D;  2WV6 D;  4H0L C;  3J7A V;  4A3D B;  4HSV A;  3DWQ A;  4DFA A;  2K33 A;  4NP5 A;  3Q24 A;  2F0W A;  1AZP A;  1IHZ A;  1PTO C;  4EVO A;  2DNC A;  5CC4 A;  3Q0A A;  3K0Y A;  1VCI A;  1EOT A;  1RTN A;  1ZYR D;  1PXU A;  1TT2 A;  4V19 0;  2ID0 A;  1JOO A;  3S17 B;  5IOC A;  3PUX A;  1GOZ A;  3NWT A;  2PO4 A;  5JVG 3;  1ESR A;  5I4D A;  4FO2 A;  5FLX L;  1V43 A;  1SXT A;  2ICI A;  3SEB A;  4LJZ C;  3S1M B;  4LMQ D;  1E2V A;  1K83 B;  1CK1 A;  2L12 A;  4CKE A;  1RKN A;  2R3Z A;  2H1E A;  3AB9 A;  3E0J A;  2CQA A;  2B2Y A;  1LO5 D;  3DEO A;  3ERQ A;  5LL6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...