2I46A

Crystal structure of human tpp1
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
152
structure length
152
Chain Sequence
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Adrenocortical dysplasia protein homolog
publication title The POT1-TPP1 telomere complex is a telomerase processivity factor.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2i46A00
5I2XA 2I46A 2M9VA 5I2YA
chains in the Genus database with same CATH superfamily
2K33A 4P72A 4H02A 2LFNA 2AMCB 3RD4A 1N33L 5C5MA 3A54A 1F9QA 4CJ0B 1CQVA 4U673 4PMWA 1X55A 5GAHC 5H1SE 4DUYL 4B9WA 3UDXA 4X64L 5EGTA 5KNCA 5J22A 1Q46A 2AKWB 2K5QA 4JI5Q 1ML0D 3F8TA 3W1GA 2OQ0A 1STYA 1PH4A 2YU9B 2JXMB 3J81c 2B2UC 1B1ZA 3DLLA 4OGQC 3IL8A 5C4JB 1K28A 2AQ3B 3NQIA 3A56A 3KUPA 4DF7A 2VQFL 1FNVA 4CKCA 4JI7Q 3HKZG 1TR5A 4E6IA 2IL8A 5GQOA 3I73A 3F2DA 2B63G 1X65A 2MPMA 4HIDA 5GADC 1HZAA 2G9DA 5JEAG 3WOEA 2WV6D 1U5KA 2R7ZG 4DAPA 1UEAB 4DGZA 4IN3A 1O80A 1XJVA 1CKMA 3GD7A 4A3JH 3BZKA 1VQLA 2R92G 1JWSD 4RG1A 4J6HA 5E4XA 2KHSA 2F3IA 3NTKA 3NSWA 4X65L 3I90A 2A6EC 1RL2A 2K7VA 1HCZA 2DY8A 1R9TB 1LTGD 4NXMQ 2J0TD 4IFDH 4MHEA 1SRUA 1S40A 5KYIA 1VQOA 1XX8A 4OELB 4JI3L 4GN3B 4BWGB 5IGEA 1KTKA 3HRZC 3RN2A 1S3OA 1A63A 2K5VA 3TZUA 1EUJA 4LF5L 5IP9G 2IPKD 4G7HC 1UE7A 4L5TA 3GTJH 2A73B 4X3KA 2JQOA 4DK0A 1SE4A 4FO2A 4XXEA 3M85A 1CA5A 2OXPA 2F0WA 1QOHA 4JI6Q 1H9KA 3RNUA 4X65Q 2K4KA 5C5LA 1SYCA 1QVFA 4P2CB 4AIMA 4HJ5A 4ABNA 4C2MB 4POGA 3PUYA 5C4JH 1HR0W 1HQMC 1PRTD 3VA5A 4FXKC 4G7OC 1QCBD 1X32A 1KQSA 4I65A 5ISRA 1IBKL 4DV6L 2VNUD 4MZ9A 1STBA 4JI3Q 3D8GA 3OMCA 1A3VA 1DD2A 1C8CA 1XPRA 1Y1VB 4LUZA 1TY2A 3ULLA 4LF5Q 2VW9A 3S14B 1SYEA 2JK8A 2SEBD 1QZGA 3M3YB 4FF2A 2ZJPA 2Q2UA 1J9OA 4KV6A 1R9TH 1VF7A 2FFKB 3L7ZC 1ZKOA 2HUGA 1TWGH 1PZID 4DXFA 3MC0B 1W2BA 1TWCH 3H09A 3K81C 1ET6A 2CQAA 1LM0A 2SOBA 1D1IA 1EQQA 5CV6A 3KLWA 1L0WA 3KLRA 4RMFA 1KL9A 2PMZB 3R2TA 4NKLA 2EDGA 3H91A 2ALYB 3EN2A 3CCLA 4MNOA 1SFOB 2RHQB 3KLSA 1GJXA 1CI3M 4C2MH 3RZDB 5L37A 4DFAA 1CM9A 1IW7D 2K6AA 5M5YH 1D1KA 1HXYD 3HOVG 2H5XA 2IW3A 4HIMA 5D3DA 5LMUL 3I56A 4H44C 2JA7B 3IAYA 2VB2X 3S24A 4I7AA 1VQ8A 1M90C 5E7NA 1Y1VH 2B2YC 1HZCA 4LW1A 3CC7A 4A3IB 5EPKA 1Z7TA 1WD0A 2WB1E 2UUCQ 3S14H 4A3BG 4AYBB 5KIXA 4GKJL 1TIID 1VMCA 1SYFA 2BOSA 5CV4A 5EBDA 2RKSA 2DGYA 2A69D 1IXRA 1KXLA 2K05A 3GTKB 4HAEA 1O7YA 2K01A 4PMCA 4Q5VA 5M5WB 4A3DB 1N36L 3CP0A 2ES2A 2F0VA 3VR3A 4KD3A 3RMHA 3TEHB 1B53A 4IPHA 5FJ8G 3T13A 5M3FB 1NMGA 1SMYC 4QMGA 1N8RC 1IBLQ 1VDZA 2F4IA 3FKIB 2JP1A 1LTBD 1MGSA 1KRSA 2CFMA 3CQZB 1FL0A 3S1MH 4LWCA 3NE5B 5J1ZA 2CW0D 1Y1WH 2EYFA 2NN6G 3N6RA 3TP5A 2UUAL 1DOMA 2HDMA 2LXKA 1SMXA 2Y0SB 3PMFA 4RCNA 3PIP3 4GN4B 4A3LG 3KFUA 2JA6B 2RDHA 5EKLA 2I5MX 1JJGA 1NNXA 1V9PA 2GVBA 3PO3B 4GKJQ 3HOYG 4XYOA 1TT2A 2WIIB 3CCRA 2ZXPA 1WYDA 4IUNA 5EJWA 3DWQA 2JA7H 1GO3E 1XWEA 5CGKA 1VQ4A 5KYLA 4CKBA 1DCZA 4H0LC 1EIYB 4QUFA 2BE5C 2F3WA 4HIOA 1M8AA 3U9OA 4OONA 3N52A 3ONAB 4FDBA 5TSSA 3U50C 4N8FA 1SJED 4DAMA 5I9OA 1SE8A 4XYQA 1IL2A 5M5WH 2FHTA 4DR1L 4A3DH 4GS3A 1ZEQX 1BVSA 1B9NA 4ZKBB 5FLMH 5M3FH 3HGBA 5JOBA 1PFNA 2E5LL 4LNQA 1IZ6A 1AE3A 5IGCA 4JW0A 4DV3Q 2L0CA 3LX0A 3TS2A 1JE4A 1HNXL 2B8GA 4IJLA 1W3SA 1W6KA 3VYSA 1M4VA 4XQQA 2LSSA 3HOUG 3KBXA 3PO3H 4FYDA 1UWVA 4I7ZC 3JAMi 1V1PB 5FKAC 4O42A 1DYQA 1XTCD 3RZOB 3D6CA 4IO9A 2A68C 3K59A 3J81E 2MQHA 3CW2C 4JBMA 4O2DA 3J80i 1Q7YC 1KAAA 2OTLA 2ICEC 1QVCA 1BCPB 2AWOA 1PDQA 5GROA 1GUSA 1JC7A 1A8VA 1YHQA 2E5LQ 4LF9L 1BCPC 3CRKC 5LL6S 2IX0A 3HKZE 1GHJA 3AU7A 4ZQ3A 5BN5A 4K5WA 3J81L 4EGVA 4A3EB 1HNXQ 5CV7A 4JV5L 3ND8A 4DV4L 3NBHA 2CWPA 3K8AA 1D5MC 2MP1A 3D4DA 2OWOA 3GTMB 3A8IE 2F3VA 3PO2B 4L63B 1F77A 5G3LD 1STHA 4C3IB 3C3LA 4IFDG 5DM73 3OOCA 3NHHA 3ULPA 4DAYA 1B4OA 3MZ5A 3GTOH 2F0GA 2DJFC 1L2FA 1IYUA 3SK5A 3S15H 5IP7H 1G6ZA 1JB3A 2A19A 2DNEA 2GVAA 1ASYA 2JA8H 4OL7A 1BBUA 4LF9Q 1S5BD 4IUUA 1HFNA 3T16A 1XMQL 3TZDA 2SNSA 2K32A 1SNOA 2MGSA 3PCOB 4WFN3 3VDYA 5M9OA 1Z9FA 2F0HA 1PFBA 1PHJA 4LF6L 1GUWA 3WWVA 2KHJA 2XWJB 1EFWA 1TKWB 3MXNB 4MTNA 3VA7A 4HEDA 4JV5Q 1BCPF 4PG3A 4ZUJA 4BA2I 2SNMA 1SNDA 1KDCA 5ELBA 2KQ3A 2QKIC 2UXCL 2KBNA 3HOWG 3NEMA 4DA2A 2JSOA 4QB4A 2RQXA 3GDEA 3WDNA 3DEPA 5C0XH 3J7ZC 1CHQD 4P71A 2RDFA 3A7AB 4A3CH 2IX1A 3OYYA 4A4IA 1PLFA 4CGYB 2IT1A 1Y8NB 2WFWA 2PQEA 2XVSA 5AFWA 2NWGA 1DZ1A 1B3AA 1WI5A 3K58A 1XMQQ 1NY4A 5BN3A 1SNCA 3ERSX 1JWMD 4OWWB 2PQAB 1QG7A 3ER0A 5K5PA 2RCFA 4A3GH 3BYTB 4C3JH 4C3IH 2LKVA 5IWAL 4OXPA 4KN7C 1HHVA 1JE5A 5FO8B 4R4IA 1J5EL 2UXCQ 2KOLA 1SYBA 1E1OA 3IKJA 3BDOA 2WB1G 2M9VA 4IUQA 4K5XA 2OF1A 3TDQA 3HOZH 3JAML 3NTIA 2ZXOA 4RGMA 3OW7A 3PIPA 4KD4A 1K83B 3RR5A 3S2HH 3T56B 3VR4A 1CK1A 1D5ZC 4V190 3RLNA 2F0MA 1BBXC 2L9HA 1V43A 5DM63 2PZTA 4BBRB 2K5DA 2EY5A 3OWEB 1TWAB 2B2WA 5IWAQ 5LMNQ 2IWHA 2JA5B 1VQIA 2NTTA 1XNQL 1J5EQ 2CCZA 4A3KB 1NCVA 4IUVA 4UP8A 2XSCA 1RCVD 1Y1VG 3CCMA 4JK1C 4BXXH 4L5SA 1A0IA 2WP8J 3I4OA 1F2MA 1J6QA 1F2YA 5A2QE 2I07B 2PNHA 4ZRZA 2C35B 1AZPA 4BY7B 5C44B 1HNWQ 4IUPA 2X6LA 4IALA 1EWCA 5D65A 2F0KA 2B2TA 2NN6I 1GUNA 3BJUA 5ELFA 4YY3Q 4EX5A 1PZKD 2KECA 4XT1B 4QGUA 3A5UA 2R61A 4GLXA 5IGFA 1GXDC 4DR3L 1YHAA 2I0QA 1YNJD 2E8GA 4CDEC 4LF8Q 2UUBQ 1BF4A 2A6HC 2Z6KA 5A2QL 4KKUA 2Q2HA 1PV4A 1Q1EA 1XNQQ 1RTOA 2K28A 2RVLA 1UE6A 1Y1WG 4QQBX 4IPDA 4NB3A 1K83H 4YHHL 3K7AB 3IFTA 5M5XB 1LTID 4J8QA 2VXWA 5IOCA 4NP5A 4BBRH 1VQMA 2OCEA 2TSSA 3CHBD 4LFAQ 1K3RA 2Z1CA 3T51B 1TWAH 1CA6A 4HSVA 4CDFC 4CDDC 2R93B 1HH2P 3MHBA 3S1NH 2PNRC 1IBMQ 2JA5H 4KY5A 5CC4A 2XRSD 1BDOA 2F0NA 2DN8A 3P7JA 1PYWD 4OX9L 1C4QA 3KJOA 4QJFA 1RD9D 1SNPA 2PI2E 1I5FA 5I9PA 3GV3A 4FXGC 3S17H 5IGDA 4F7XA 4BY7H 5C44H 5JVH3 4M8AA 1GUGA 3NP8A 4OO1H 5JJKA 2PW7A 5DAUA 1JORA 1CKOA 1PA6A 2L55A 4A3DG 2NVTH 2K52A 3V2TA 1FNUA 3CMEA 2UU9L 3D4RA 5FLMG 5JPNC 4GNXA 5M3FG 3G6EA 3BZCA 2A6ED 2AUKA 4JI1L 1JB7A 1UNSA 4OIJA 1U4LA 2F0UA 3D6WA 2KENA 1HR0Q 1ILPA 4TVAB 4GKKL 3W5OA 1SJHD 3K7AH 1X6OA 1N33Q 1A3UA 2B3GA 4Y52H 3MXNA 2PZWA 1K8MA 2ID0A 3UE0A 2DJGC 4KHZA 2XIWA 2B2VA 4EQNA 4FNFA 1TY0A 4JI0L 3J7A5 2TMPA 4K8IA 4FF3A 1VQGA 4DPGA 4DUYQ 4DV5L 3S16B 1VQHA 4X64Q 1PFMA 2Q2IA 4JI8L 1WJJA 3K7UC 1K73C 2WINB 1OXUA 2EPBA 2R7FA 1VQJA 2QDBA 2BDOA 2ATWA 5FO7B 1AZQA 1EOVA 2UU9Q 4K0KL 5JJLA 1PTOB 4GZYC 1SSOA 4BY1H 3PF5A 3F2CA 4IFDI 2VQFQ 4BBSB 1YEZA 5CV9A 4R4QA 3UDFA 1PTOC 4GKKQ 1JQYD 1VS0A 1HQRD 4PZ7A 1CKNB 3E0JA 1EL0A 1G6PA 3MXGA 3CCVA 2PQAA 5CMDA 3GO5A 1ENAA 1T5XD 2DY7A 4X3SA 1KAWA 2YU9H 2K14A 2L12A 1TS5A 4HSPA 1SYGA 2CQOA 5JPMC 1IHZA 1Q8IA 4HMJA 1NSNS 2PW5A 1X3PA 3TN2A 4CDCC 5IP7G 1K0RA 3G7LA 2UXDL 2JA8G 5ELOA 1WTPA 4DR5L 4CHTB 3M9BA 1V8QA 4B3RL 4YCUA 5C4XB 3ZYYX 1JJCB 5HY6A 4L5RC 5HGTA 3BVGA 3T1YL 1UE5A 2ZXRA 3OTOL 1K8AC 1D5XC 2LMCB 3I91A 2BDNA 4UDUC 4DR2L 1PTOF 1VQKA 3SK4A 4B3ML 2HIVA 3I4NB 1RTNA 1AH9A 3M7GA 3R93A 3ITPA 1O7LA 1V1OA 2A5HA 4DK3C 5LHY1 3NBHB 3G6JB 1E0BA 4CBVA 3SVMA 3I7FA 1CSQA 1YNXA 3F2BA 1JR0D 5C0XG 1PTOH 2ZJQA 1X3EA 5D14A 4A3CG 2NVYB 1TVXA 1XTDA 1I6VC 3K5OA 4DAYB 3ERQA 5KRUA 1O7ZA 1KLUD 5CBEE 2F0LA 2JYOA 4DR5Q 4P75A 1N34L 5IODA 3B6YA 3G71A 1IBKQ 2VUMB 4DV6Q 4KLKA 1X3FA 1MI2A 5M3MB 2I5LX 1P16A 5K36H 4A3GG 3UI2A 4DR2Q 1MSGA 4C3JG 1S72A 2R7DA 4C3IG 1QUQB 1LT3D 3KF8B 5CV5A 5F2DA 2UXBL 1EYDA 4APVA 1A6XA 5KNBA 4LFBL 3D0FA 2R6GA 5COYA 3L3OC 5I6WA 4A3MB 4KTAA 1WTWA 1OXSC 4DK1A 3HOZG 2HHHL 2RA4A 3SHLA 4KKTA 1CFMA 2CH4W 3CCSA 4DR6L 1VQ5A 1HA6A 1VQAA 4RHRA 1N34Q 1WTRA 1SMYD 1FJGL 2LY7A 1K8GA 4B3SL 3V05A 4YCWA 3I4NH 3QJYA 1RIPA 2NVXB 1LO5D 1B7YB 1I4XA 1I94L 3M3YH 3PF4A 2RCNA 3SEBA 1JOKA 1CZWA 1F2LA 4LJZC 1WFQA 2UXBQ 3FPPA 4GOPB 2QILA 3J81i 1K8OA 4BXXG 4HTHA 1K3BC 2JE6I 4K2LA 4KJNA 5LMUQ 4TKOB 1TQOA 2B29A 2VUMH 1F9PA 5E4WC 2K5HA 1F2ZA 4HN7A 2IJ0A 5M3MH 1VF5C 5IT9c 1FJGQ 1SFOH 3EROA 3RN5A 2BE5D 1T9HA 1KHIA 1QILA 4RGNA 3GTPB 1W6JA 5BR8L 1IKMA 3RZDH 1PXUA 3IFDA 2JEAI 2RSNA 4GLAC 3HKZB 4A3MH 1LABA 1JOOA 1GUTA 2ZTCA 4EQ5A 2N3SA 2EJFC 2RF4A 3CCUA 1N36Q 3CU7A 3DXJC 3HOXB 2Q8IB 3SK8A 4M1UB 3I4LA 4DU9A 3DWAA 4XDXA 3R2IA 3M4PA 4KHPL 2B2WC 4FP5D 4A3IH 5ELEA 1EYGA 2Z8LA 3H3VI 4PZ6A 2OTJA 3G4SA 3PIO3 2EXZA 4UP7A 2NVXH 3I8ZA 2LS01 2L1BA 3QO2A 1IKLA 4HJ9A 2PMZE 2UUAQ 4P73A 5T1IA 1PH8A 4C3HB 1Z47A 3UDGA 1B44D 4DNTB 3CCJA 2JA5G 3GTKH 4DR4L 5BR8Q 3CCEA 1SAPA 3K80C 1O7IA 3L2PA 2XN9C 3J81j 4PNYA 2B2TC 4IPCA 2EYJA 4IFDJ 2A68D 3FDTA 5J3BA 1PVOA 1KLGD 4K5VA 4KI0A 1CKNA 3FKIH 1WTQA 1HNZL 3CQZH 3DHQA 3DUZA 1E7ZA 5C44G 4BY7G 2NZ1D 3BZDB 4OO1G 3STBC 3KK7A 3LWUA 2Z6KC 1R4QB 1WTOA 2EYOA 4R4OA 3GQBA 1BCPD 2EYMA 2F4VL 2JA6H 3MWYW 1ZXTA 3NENA 4R8IA 3GTPH 1I4HA 2PZUA 4CJ1B 4DV0L 4YWMA 3PUZA 4MTKA 4AYBE 3G48A 2F0EA 1ENCA 1AP0A 1BUVT 5IE8A 3QG1A 2EVBA 4TQUS 3U4VA 4DR1Q 1X3GA 3HEJA 1TXYA 1C9OA 1E2ZA 2Z9HA 2K5NA 3HOXH 4FF1A 3GTLB 4LF4L 2WAQB 1JWUD 3CRLC 1B50A 1HNZQ 4TRDA 4RHSA 2IHFA 5ELNA 1PMRA 2QDLA 1TS2A 1XNRL 4A3JG 1CHPD 1LV9A 2BH2A 1G2SA 1VQEA 1BQQT 1PFSA 4C3HH 2P5ZX 3A5ZB 2Y0SE 3SDZA 2E74C 2F4VQ 3KLSX 4N8X1 2QEXA 2HT1A 4QCLA 4UHVA 4WJ4A 2KCCA 4WRDA 4BY1G 3HKSA 4H13C 3S9WA 1LTRD 2V4DA 1JT8A 1S5DD 3KYHC 3PV0A 4GNXB 1GHKA 4A76A 3M4YA 3A0JA 1LYLA 2H1EA 4RFBA 4JVZA 1WTVA 5KNDA 4LF4Q 2ICIA 4GNXC 3K57A 2QCPX 4WORA 3BDLA 3CPWA 4NMZA 4FXDA 1FR3A 3P1HA 1CQFA 1L1OB 4IURA 1XNRQ 1S4ZA 1X54A 5NUCA 5C3EB 3TREA 1QUQA 1VQDA 2VS1A 3QOJA 3KF8A 1SE3A 2V1CC 4G4KA 4F8MA 1ASZA 4DV4Q 1ESFA 4B3TL 1GKHA 1A3TA 2GA4B 1BBWA 3RZOH 3Q22A 1D8LA 1EYCA 2OQKA 2B2VC 4CJ2C 1QNKA 4JPBW 3C2PA 3ZJYC 2M00A 5C0XI 4DV1L 2NB0A 3EA6A 2CKZB 3E6ZX 4R8NA 4YCVA 2HCCA 2D9UA 3RUZA 3AB9A 3TQYA 5KEEA 4HJ7A 3LWEA 1HJPA 4ALPA 4J1MA 2Z6BA 1KC8C 1KNEA 1U4MA 5FOBB 1N9WA 1X56A 4ZAIA 2Z0SA 1WCMB 4A3EH 4XQJA 4QIWB 1YJWA 3BU2A 3TP8A 4LF6Q 4QUCA 1SXTA 1E3PA 4K6DA 1PYBA 4R4CA 4DAVA 3GTMH 5IYDH 3PO2H 5LL6X 4H7BA 5C4ZA 4B3TQ 2JN4A 4GOPA 3SK6A 2KCMA 3FMCA 3DM1A 3TSSA 3T1HL 1EZ8A 1GVPA 1AN8A 1I4QA 5GAGC 1XPOA 4MN3A 3E9HA 4KN4C 4LK1C 4XT3B 5IGBA 1VQNA 1I3QB 3F2UA 3TP7A 4BA1I 3FEWX 2X6GA 4LFCL 5K36G 1Q8KA 5C3EH 2QF7A 4OWTB 4HJAA 3M4QA 1EY5A 1EYAA 1HA5A 1O78A 3CMAA 4K2KA 4G7ZC 1YVCA 3HOYB 4KHVA 3X3MA 2D5DA 3MXUA 1CSPA 4OHJA 4ZK9B 2D2CC 1EY9A 2F0OA 3VR5A 5C3XA 2DNCA 3QWNA 4A3FB 1L0XB 2K04A 1R4PB 1GD7A 1YZ6A 3QOLA 3PIOA 3CD6A 3C1FA 1A2TA 2A6HD 1EEFD 5EPJA 4KY6A 1WCMH 3DM3A 3I4NG 2CVRA 2FMMA 1G91A 3FRPB 1EY8A 2YTVA 2F0IA 1VQPA 4HR7B 4EQOA 3BS1A 1N32L 3IRBA 1I4PA 1I6HB 1VQFA 1XMOL 1UAPA 1EY6A 1U9RA 2F0QA 4UY8C 1YNNC 4IOAA 1ILQA 1AEXA 4K6LA 4RCOA 1BNZA 2SDFA 5D3IB 4RGTA 2VUMG 1I3QH 4FF4A 3UE1A 1EY0A 2NN6H 5M3MG 1Q82C 1OXVA 3TRZA 3EJIA 4OWXB 3HOUB 1EIFA 3PSIA 5IYCH 2F1MA 1XYIA 4DV2L 3UDIA 2N49A 1MJEA 3SR1A 3CF5A 1ZYRC 1Y14B 3PUWA 1PH6A 4ILWA 1KRTA 1XMOQ 4ZLTF 1PH9A 1JMCA 1FNWA 1HPCA 4A3FH 4DR3Q 2JA7G 3HZXA 1X3QA 1Z6HA 3GV6A 5E1FA 3EBEA 3E9IA 4A3KH 1H95A 5FLXc 3PUXA 4A3IG 3A55A 4LUVA 1NAPA 2VY3A 1Q81C 1E2VA 3P75A 2KEEA 5A35A 4RA8A 1KABA 1I4GA 1YJ9A 4A93B 2KCTA 1AW7A 4AYBG 3NPPA 1MJCA 4YHHQ 4OO1I 4EQPA 4UP9A 3MFYA 1F9RA 1NBWA 2YTYA 1SNQA 4JI7L 1DOKA 3Q8DA 1QNUA 1G51A 3V96A 3OW2A 2A74C 1F9SA 3CXCA 4UAIA 3I3CA 3GP7A 3H0GB 4JOIA 3FKIG 1CZGA 2R3ZA 2OEOA 3HG9A 3ICEA 1Y8OB 4OIKA 1EEID 2F0SA 3VYRA 5I6YA 4OX9Q 4IPGA 5GAEC 3D31A 4NPSA 3GTJB 3P20A 1L1OA 3BYYB 3TP6A 1OXXK 2Y0SG 2MHVA 1EY7A 3EQLC 5M5XH 1WTHA 1PTOD 1KIXA 2JA6G 3HOUH 1LUZA 4JYAL 1E22A 2ZTEA 3PO3G 4NXML 3K6OA 2KVMA 3U58A 1H9JA 2E2DC 2LXJA 4LF7L 2R93H 4X66L 3LNNA 3OHXC 4YWKA 3HOWB 1QE6A 2EE1A 3E0EA 3HOXG 1Y8PB 3R3OA 2XTIA 4JCVE 5IYBH 4RKBA 2KHIA 3CKIB 1VQBA 3URYA 5C0XJ 3FPUB 1SBBB 3M7NA 4JI1Q 4IZ8A 1LT5D 2AUJD 1WOCA 1YJNA 2NBFA 1E24A 2WKDA 1SR3A 4JI6L 4A93H 2XGTA 3MVVA 3ULJA 3A8JE 4DNRB 2F03A 1BR9A 2K03A 3NBIA 1LT6D 2EXDA 4HCSA 1RJTA 2KUMA 4C3HG 2Q8TA 2F0DA 3J7AV 3NUCA 1VCIA 4JYAQ 3OMGA 1VQ9A 4KKSA 1B2TA 2KA7A 4JI0Q 4N9PA 4NXNL 3QB3A 3BVMA 3OIPA 4DV5Q 1TWGB 2ZM6L 1PH5A 4LF7Q 2A1AA 4L5QA 4X66Q 2L11A 1TWCB 2I5HA 4JI8Q 4DXGA 3MEFA 2D62A 3A7LA 3H0GH 1MHWC 5EBCA 3ND9A 2WB1B 4K0KQ 2PCFB 3L0OA 4YIJA 3MAQA 4XIGS 3I4MB 2HD3A 3O13A 2B8FA 3M4OB 1IYVA 5IIFA 1AE2A 3LGJA 1QVGA 1VQ6A 5ELDA 1RF2D 4X6AH 2NTSA 3U4ZA 2QEJC 5BN4A 2J4XA 5DLQE 4NDXA 3S16H 3NWTA 2PI2A 5M5YB 2X69A 1PYSB 1NJIC 1FYCA 2Q8RE 2N88A 1QJOA 2EY2A 1X9NA 3F1ZA 3HOWH 5FO9B 1SLJA 1GOZA 4DNIA 2EQSA 2N55A 4NXNQ 2EYLA 1M1KC 1A15A 2ZM6Q 2CHBD 1PH1A 1P8LA 2WAQG 2O5JC 4BBSH 2E2HB 1UUPA 4AH6A 5C4HA 1B3QA 4DN4M 4XQNA 1PRTB 2UXDQ 2BH8A 3JAMc 3MXPA 1Q12A 1TWHB 1K0SA 4GLVB 2RHSB 4A3EG 1OO9B 4B3RQ 3S2DB 3X3NA 1H9SA 1LTSD 4R4TA 1PRTC 3RLFA 4X62L 2WKCA 1DM0B 3AYHB 4K8JA 3J80c 5IYDG 3J7YW 3OTOQ 3T1YQ 3C46A 3PO2G 3FP9A 2OT2A 5T1GA 1FD7D 4B3MQ 2EOTA 2KCNA 2HQLA 3JC66 4POFA 1OXTA 3NTHA 2KJXA 5C6AA 1HRJA 4ID6A 1I4RA 5HGQA 4TSSA 3I4MH 4L8JA 3S1MB 1BOSA 2UUCL 4RH6A 3M4OH 1Y1WB 3W2DA 3BDCA 2CH4A 1BKBA 5C4XH 1Y69U 2MFIA 2K5WA 4Z9CB 2AQ2B 3MFGA 5C3EG 2BCOA 2EY1A 3OSOA 1TU2B 3DMUA 4MIUA 2EZVA 3GTQB 1ICFB 2FXQA 3GTGB 3EFXD 4PV1C 1S5FD 1GUOA 4X62Q 4JC0A 3W1BA 1II3A 1SDFA 4JBWA 1PRTF 1IBLL 1SE2A 3A74A 4ZYSA 3D4WA 2Q2TA 4LFBQ 2JA9A 2NVYH 4KK7A 2E2HH 1XXGA 3QR8A 1KDAA 4LUOA 3I70A 3Q0AA 1NE3A 1LACA 5CORA 1XPUA 4KY7A 3I2ZA 1WCMG 4GOPC 1TWHH 3K5NA 2HHHQ 1EIGA 3S2DH 4O0AA 1Q90A 3WOFA 3Q6SA 4A75A 3H3VC 1IW7C 3E3XA 1PH2A 4DR6Q 2RSOA 5C3WA 3A8KE 4Y7NB 3CC2A 1NUCA 1VQ7A 4B3SQ 1YIJA 3NELA 1KDBA 1S5CD 1I94Q 1GM5A 2RDGA 4CKEA 3C1EA 3J7AF 4JI4L 3NWSA 4S3SA 2B63B 1B8AA 2C9OA 4V0BA 1EIHA 3PUVA 2B2UA 3S1RB 2F0JA 4ULLA 1HUNA 2MO0A 2PPBC 2A69C 3EIVA 1FGBD 3KF6B 2R7ZB 2K50A 2RBMA 1PH7A 3GTQH 1JICA 1EQRA 3GTGH 5IYCG 4HIKA 2R92B 4BBRG 2JJQA 3I55A 3Q23A 5CYUA 2NZHA 3AMUA 3STBD 2M2LA 1DJRD 4O1NA 3H15A 1C48A 3TMEA 1D6EC 2FMCA 4A3FG 4C1NI 1RODA 2CW0C 4DV3L 4A3KG 1NR2A 1TS3A 2E2IB 3H3VH 5I2YA 4JI4Q 1U4RA 3RLOA 1EQVA 5FLXE 1G291 4IOCA 1G8ZD 2O5IC 1HZ9A 2HCIA 2AHOB 2G5DA 1HFGA 5EAYA 1EWIA 4KHPQ 1SYDA 2G9HD 4Y7NH 3CCQA 1CTMA 3TS0A 4ZKCB 2QGQA 3AFPA 3H94A 1CT1D 2F0TA 2L4NA 3TBIB 2FJ2A 3OWFA 2D0PA 5FLXL 1RDPD 2WACA 1V1QA 1I50B 2ENBA 2FINB 1DONA 4BS9A 2MJ8A 3GTOB 1AFPA 2NYZD 1SEBD 3S15B 1WD1A 4DR4Q 2B63H 1ESRA 1PZJD 2EJMA 5FK9C 1C0AA 2EY6A 2J7ZA 4K14A 4R1JA 2JA8B 3KOJA 3OPOA 5JJIA 3S1RH 3KDFB 1HTPA 5JEAH 2N8NA 1UEBA 2ZTDA 2R7ZH 1STAA 1VMPA 1YBYA 3AFQA 4X3TA 1YITA 3NK9A 2B39A 4AQYL 3DWPA 4U68A 1JCKB 2R92H 2E2JB 5I2XA 5JAVA 2R93G 4DUZL 4WJWA 4ME5A 4Q0FA 1E2WA 3HS0C 1IL8A 4DR7L 2MO1A 3VYTA 5ELCA 5AJ3L 1E1TA 2VZAA 5IYBG 4DV0Q 1DOLA 2E2IH 2PYKA 3MA2B 2YTXA 2EYPA 1HUMA 3S1QB 2NVQB 1J8IA 4A93G 1A62A 1PH3A 2JEBI 2XNAC 4RGOS 3HP3A 1B9MA 5IP9H 2Z4HA 3KBGA 4P74A 1C7YA 1JOQA 3BVZA 4JOIC 4DV7L 4AQYQ 4A3GB 5EPLA 2AQ1B 3SGIA 4C3JB 1NMFA 1MKHA 2N78A 4RAUC 1HZBA 2F52A 3AQQA 4DUZQ 1L1OC 1I50H 1EU4A 3H0GG 4X3UA 5E3FA 1B70B 4DR7Q 1YHBA 3HOVB 2Z4IA 5AJ3Q 2BA1A 4R9WA 3HOZB 1LLRD 1T5EA 2YYZA 1QZHA 1MIUA 4N9TA 5J39A 4B08A 1LTAD 3GTLH 3S2HB 1Q3LA 4IUTA 4PMBA 1IYJB 2DUDA 1MD2D 4HCEA 3K5LA 2E2JH 2A8VA 3PQIA 1ET9A 3MTSA 1JJ2A 4A3BB 3OIQA 4DV7Q 3U9SA 4JBKA 1OTCA 1H9RA 1UE1A 3L9AX 3PGZA 4PZ8A 2B2YA 4RKLA 2QW7A 5EKIA 1SN8A 2VL6A 1MBYA 4QL5A 5EQ0A 4BBSG 1DXMA 1TWFB 3I72A 2XRQD 3S1QH 1KNAA 2NVQH 1QWYA 4F88A 2BA0A 4YWLA 5KGUA 4IQZA 4XTCS 4C56C 3BG3A 1G2TA 4DV1Q 3CAMA 4EVOA 3QIAA 4DK6C 1EOTA 3JAME 2WAQE 3K0YA 4JG2A 2IHEA 4C1NK 5LMNL 5DEHA 1Q86C 2C5CA 1DGSA 3D3RA 1SROA 4ODGA 3J80E 1KD1C 1YI2A 2L5TA 1SNMA 1D7QA 2O2LD 5G3LF 2L15A 4HMIA 2F0PA 2HQEA 4L6TB 5IY0A 4JI2L 2MNAA 4RWSC 3HOVH 5HURA 5IGGA 2ZT9C 3I4MG 2HDLA 1WVLA 1RKNA 1EY4A 3AEVA 4QF4A 4NW2A 5C4XG 3T53B 1HNWL 4PQXA 2VB3X 3T1HQ 5DNFA 1YNND 1TS4A 3KF6A 5CR3A 1STGA 3J80L 4YY3L 1STNA 2F0FA 3MEHA 1U0LA 5EKKA 3DEOA 5CBAE 3FHWA 2H4OA 2K1BA 3CC4A 3NQTA 4A3BH 2VQEL 4LFCQ 1NTGA 4ZUIA 4LF8L 2UUBL 3S1NB 1H9SB 2YV5A 2O4XA 3HFZB 3VR2A 4KMUC 1LTLA 1EWHA 1MSHA 5CV8A 3VYUA 1QB5D 4F87A 1BXTA 4UPAA 4JI2Q 2I46A 1TWFH 4G57A 4GN5A 4LMQD 5FJ8H 2IY5B 2PO4A 4B9XA 1ZYRD 2EYHA 3R8BA 3CPFA 4QY7A 5JVG3 4WJ3M 3S17B 4HJ8A 1RHPA 1A2UA 3H6MA 1D2BA 3EVQA 1WTXA 1LT4D 2K75A 4LFAL 2E76C 2CWAA 1FVIA 3W3AA 4JBJA 4LAAA 1STEA 1EQTA 2NUCA 3K0XA 2NZOA 3VR6A 3Q24A 4A3LH 4ME3A 1IBML 2NVTB 1BO0A 5IT9E 1LTTD 2VQEQ 1EFID 1EU3A 2IX3A 3T4AC 3HOYH 4QIWE 1Q1BA 1N32Q 3E5SA 1CUKA 3KJPA 5JJZA 4FVMA 4A3MG 2QA4A 4OEMB 1ICWA 1L0YB 4KJOA 1EZ6A 1HTLD 4J15A 2D0OA 2KEDA 3KDFA 2ZJRA 5JEAJ 5IT9L 1NR4A 2MUYA 2HIXA 1V1PA 2ASBA 4A3JB 4IJHA 1FGUA 5LMNW 1YNJC 2XWBB 4JI5L 2AWNA 3SXHA 1U4PA 5I4DA 3SE0A 2EIFA 1VQCA 3FVQA 4DKAC 3K5MA 1ONLA 2GN5A 4ZCKA 1S5ED 2E75C 1H9MA 3NXWA 2EJGC 1I6HH 1ENFA 1K9MC 1HR0L 4BY1B 4DV2Q
chains in the Genus database with same CATH topology
2K33A 2LFNA 3RD4A 5C5MA 3A54A 1F9QA 4CJ0B 1CQVA 4U673 4PMWA 4B9WA 5EGTA 5KNCA 5J22A 2K5QA 1ML0D 1STYA 2YU9B 2JXMB 2B2UC 1B1ZA 4OGQC 3IL8A 5C4JB 2AQ3B 3NQIA 3A56A 3KUPA 4DF7A 1FNVA 4CKCA 1TR5A 4E6IA 2IL8A 3I73A 2MPMA 2G9DA 5JEAG 3WOEA 2WV6D 4DAPA 1UEAB 4DGZA 4IN3A 1O80A 3GD7A 1JWSD 4J6HA 5E4XA 2KHSA 3NTKA 3NSWA 3I90A 2A6EC 2K7VA 1HCZA 2DY8A 1R9TB 1LTGD 2J0TD 4IFDH 4MHEA 5KYIA 1XX8A 4BWGB 5IGEA 1KTKA 3HRZC 3TZUA 2IPKD 4G7HC 2A73B 4X3KA 4DK0A 1SE4A 4FO2A 4XXEA 3M85A 1CA5A 2OXPA 2F0WA 1QOHA 1H9KA 5C5LA 1SYCA 4P2CB 4ABNA 4C2MB 3PUYA 1HQMC 1PRTD 3VA5A 4FXKC 4G7OC 1QCBD 1X32A 4I65A 5ISRA 2VNUD 1STBA 3D8GA 3OMCA 1A3VA 1DD2A 1C8CA 1Y1VB 1TY2A 3S14B 1SYEA 2SEBD 3M3YB 4FF2A 1J9OA 4KV6A 1VF7A 2FFKB 3L7ZC 1ZKOA 2HUGA 1PZID 4DXFA 3MC0B 3H09A 1ET6A 2CQAA 2SOBA 1D1IA 5CV6A 3KLRA 2PMZB 3R2TA 4NKLA 2EDGA 3H91A 1SFOB 3KLSA 1GJXA 1CI3M 3RZDB 4DFAA 1CM9A 1IW7D 2K6AA 1D1KA 1HXYD 2IW3A 5D3DA 4H44C 2JA7B 3IAYA 2VB2X 4A3IB 2B2YC 5EPKA 1Z7TA 1WD0A 4AYBB 5KIXA 1TIID 1VMCA 1SYFA 2BOSA 5CV4A 5EBDA 2RKSA 2A69D 2K05A 3GTKB 4HAEA 1O7YA 2K01A 4PMCA 4Q5VA 5M5WB 4A3DB 2F0VA 3VR3A 4KD3A 3RMHA 1B53A 3T13A 5M3FB 1SMYC 4QMGA 1VDZA 2F4IA 3FKIB 2JP1A 1LTBD 1MGSA 3CQZB 3NE5B 5J1ZA 2CW0D 2EYFA 2NN6G 3N6RA 3TP5A 1DOMA 2HDMA 2Y0SB 3PMFA 4RCNA 3PIP3 2JA6B 2RDHA 5EKLA 3PO3B 4XYOA 1TT2A 2WIIB 2ZXPA 4IUNA 5EJWA 3DWQA 1XWEA 5CGKA 5KYLA 4CKBA 1DCZA 4H0LC 4QUFA 2BE5C 2F3WA 1M8AA 3U9OA 3N52A 3ONAB 5TSSA 1SJED 5I9OA 4XYQA 2FHTA 1ZEQX 1B9NA 4ZKBB 3HGBA 5JOBA 1PFNA 5IGCA 2L0CA 3LX0A 1JE4A 2B8GA 1W6KA 3VYSA 1M4VA 4XQQA 3KBXA 4FYDA 4I7ZC 1V1PB 5FKAC 4O42A 1DYQA 1XTCD 3RZOB 3D6CA 2A68C 3K59A 3J81E 1KAAA 2ICEC 1BCPB 2AWOA 1PDQA 1GUSA 1JC7A 1BCPC 3CRKC 5LL6S 2IX0A 1GHJA 3AU7A 4ZQ3A 5BN5A 4K5WA 3J81L 4EGVA 4A3EB 5CV7A 3ND8A 3NBHA 1D5MC 2MP1A 3D4DA 3GTMB 3A8IE 2F3VA 3PO2B 4L63B 1F77A 5G3LD 1STHA 4C3IB 3C3LA 4IFDG 5DM73 3OOCA 3NHHA 4DAYA 1B4OA 3MZ5A 2F0GA 1IYUA 3SK5A 1G6ZA 1JB3A 2DNEA 4OL7A 1S5BD 4IUUA 1HFNA 3T16A 3TZDA 2SNSA 2K32A 1SNOA 2MGSA 4WFN3 5M9OA 2F0HA 1GUWA 1PFBA 2XWJB 1TKWB 3VA7A 4HEDA 1BCPF 4ZUJA 4BA2I 2SNMA 1SNDA 1KDCA 5ELBA 2KQ3A 2QKIC 4DA2A 2JSOA 4QB4A 2RQXA 3WDNA 3DEPA 5C0XH 1CHQD 2RDFA 3A7AB 2IX1A 1PLFA 4CGYB 2IT1A 1Y8NB 2PQEA 2XVSA 5AFWA 2NWGA 1DZ1A 1B3AA 3K58A 5BN3A 1SNCA 1JWMD 1QG7A 5K5PA 3BYTB 2LKVA 4KN7C 1HHVA 5FO8B 2KOLA 1SYBA 3IKJA 3BDOA 2M9VA 4IUQA 4K5XA 2OF1A 3TDQA 3JAML 3NTIA 2ZXOA 4RGMA 3OW7A 4KD4A 1K83B 3T56B 3VR4A 1CK1A 1D5ZC 4V190 2F0MA 1BBXC 2L9HA 1V43A 5DM63 2PZTA 4BBRB 2K5DA 2EY5A 3OWEB 1TWAB 2B2WA 2IWHA 2JA5B 2NTTA 4A3KB 1NCVA 4IUVA 2XSCA 1RCVD 4JK1C 2WP8J 1F2MA 1F2YA 5A2QE 2I07B 4ZRZA 1AZPA 4BY7B 5C44B 4IUPA 2X6LA 4IALA 1EWCA 5D65A 2F0KA 2B2TA 2NN6I 1GUNA 5ELFA 1PZKD 2KECA 4XT1B 2R61A 5IGFA 1GXDC 1YNJD 1BF4A 2A6HC 5A2QL 4KKUA 1Q1EA 1RTOA 2K28A 2RVLA 3K7AB 3IFTA 5M5XB 1LTID 4J8QA 2VXWA 5IOCA 4NP5A 2TSSA 3CHBD 2Z1CA 3T51B 1CA6A 4HSVA 2R93B 3MHBA 2PNRC 4KY5A 5CC4A 2XRSD 1BDOA 2F0NA 2DN8A 3P7JA 1PYWD 1C4QA 1RD9D 1SNPA 5I9PA 3GV3A 4FXGC 5IGDA 4F7XA 5JVH3 4M8AA 1GUGA 3NP8A 4OO1H 2PW7A 5DAUA 1JORA 2L55A 3V2TA 1FNUA 3D4RA 5JPNC 2A6ED 2AUKA 1UNSA 4OIJA 1U4LA 2F0UA 3D6WA 1ILPA 1SJHD 1A3UA 3MXNA 2PZWA 1K8MA 2ID0A 4KHZA 2XIWA 2B2VA 4EQNA 4FNFA 1TY0A 2TMPA 4K8IA 4FF3A 3S16B 1PFMA 2WINB 1OXUA 2EPBA 2QDBA 2BDOA 5FO7B 1AZQA 1PTOB 4GZYC 1SSOA 4IFDI 4BBSB 5CV9A 1PTOC 1JQYD 1HQRD 3E0JA 1EL0A 3MXGA 5CMDA 3GO5A 1ENAA 1T5XD 2DY7A 4X3SA 2L12A 1TS5A 4HSPA 1SYGA 5JPMC 1IHZA 1Q8IA 4HMJA 1NSNS 2PW5A 1X3PA 3TN2A 3G7LA 1WTPA 4CHTB 1V8QA 5C4XB 3ZYYX 5HGTA 3BVGA 2ZXRA 1D5XC 2LMCB 3I91A 2BDNA 4UDUC 1PTOF 3SK4A 3I4NB 1RTNA 3M7GA 3R93A 3ITPA 1O7LA 1V1OA 2A5HA 5LHY1 3G6JB 1E0BA 4CBVA 3SVMA 1JR0D 5C0XG 1PTOH 5D14A 2NVYB 1TVXA 1I6VC 3K5OA 3ERQA 5KRUA 1O7ZA 1KLUD 5CBEE 2F0LA 2JYOA 5IODA 2VUMB 1MI2A 5M3MB 5K36H 3UI2A 1MSGA 4C3JG 4C3IG 1LT3D 5CV5A 5F2DA 1EYDA 1A6XA 5KNBA 2R6GA 5COYA 3L3OC 5I6WA 4A3MB 4KTAA 1WTWA 1OXSC 4DK1A 2RA4A 3SHLA 4KKTA 1CFMA 1HA6A 4RHRA 1WTRA 1SMYD 2LY7A 3V05A 3QJYA 2NVXB 1LO5D 1I4XA 3SEBA 1JOKA 1CZWA 1F2LA 4LJZC 3FPPA 2QILA 1K8OA 4HTHA 2JE6I 4K2LA 4KJNA 4TKOB 1TQOA 1F9PA 5E4WC 1F2ZA 4HN7A 2IJ0A 1VF5C 3EROA 2BE5D 1QILA 4RGNA 3GTPB 1W6JA 1IKMA 1PXUA 3IFDA 2JEAI 2RSNA 3HKZB 1LABA 1JOOA 1GUTA 2EJFC 3CU7A 3DXJC 3HOXB 2Q8IB 3SK8A 4M1UB 3I4LA 4DU9A 3DWAA 4XDXA 3R2IA 2B2WC 4FP5D 5ELEA 2Z8LA 3PIO3 2EXZA 3I8ZA 2LS01 2L1BA 3QO2A 1IKLA 5T1IA 4C3HB 1Z47A 1B44D 4DNTB 1SAPA 2XN9C 4PNYA 2B2TC 2EYJA 4IFDJ 2A68D 3FDTA 1KLGD 4K5VA 4KI0A 1WTQA 3DHQA 3DUZA 2NZ1D 3BZDB 4OO1G 3KK7A 3LWUA 1R4QB 1WTOA 2EYOA 3GQBA 1BCPD 2EYMA 3MWYW 1ZXTA 4R8IA 1I4HA 2PZUA 4CJ1B 3PUZA 2F0EA 1ENCA 1AP0A 1BUVT 3QG1A 2EVBA 4TQUS 3HEJA 1E2ZA 4FF1A 3GTLB 2WAQB 1JWUD 3CRLC 1B50A 4TRDA 4RHSA 1PMRA 1TS2A 1CHPD 1LV9A 1G2SA 1BQQT 3SDZA 2E74C 3KLSX 4QCLA 2KCCA 4WRDA 4H13C 3S9WA 1LTRD 2V4DA 1S5DD 3PV0A 1GHKA 3M4YA 2H1EA 4RFBA 1WTVA 5KNDA 2ICIA 3K57A 2QCPX 4WORA 3BDLA 4NMZA 4FXDA 1FR3A 3P1HA 1CQFA 4IURA 1S4ZA 5NUCA 5C3EB 3QOJA 3KF8A 1SE3A 4G4KA 4F8MA 1ESFA 1A3TA 2GA4B 3Q22A 1EYCA 2B2VC 4CJ2C 1QNKA 3C2PA 5C0XI 2M00A 2NB0A 3EA6A 3E6ZX 4R8NA 3RUZA 2HCCA 2D9UA 5KEEA 3AB9A 3LWEA 4J1MA 1KNEA 1U4MA 5FOBB 4ZAIA 1WCMB 4XQJA 4QIWB 3TP8A 4QUCA 1SXTA 4K6DA 4DAVA 5LL6X 4H7BA 5C4ZA 3SK6A 3FMCA 3DM1A 3TSSA 1EZ8A 1AN8A 1I4QA 4MN3A 4KN4C 4LK1C 4XT3B 5IGBA 1I3QB 3F2UA 3TP7A 4BA1I 3FEWX 2X6GA 5K36G 2QF7A 1EY5A 1EYAA 1HA5A 1O78A 4G7ZC 4K2KA 3HOYB 4KHVA 3X3MA 2D5DA 3MXUA 4OHJA 4ZK9B 2D2CC 1EY9A 3VR5A 5C3XA 2F0OA 2DNCA 3QWNA 4A3FB 1L0XB 2K04A 1R4PB 3QOLA 3C1FA 1A2TA 2A6HD 1EEFD 5EPJA 4KY6A 2CVRA 2FMMA 1G91A 3FRPB 1EY8A 2F0IA 4HR7B 4EQOA 3BS1A 1I4PA 1I6HB 1UAPA 1EY6A 1U9RA 2F0QA 1YNNC 1ILQA 1AEXA 4K6LA 4RCOA 1BNZA 2SDFA 5D3IB 4RGTA 4FF4A 1EY0A 2NN6H 1OXVA 3EJIA 3HOUB 2F1MA 1XYIA 3SR1A 1ZYRC 3PUWA 4ILWA 4ZLTF 1FNWA 1HPCA 3HZXA 1X3QA 1Z6HA 3GV6A 5E1FA 3PUXA 3A55A 1NAPA 1E2VA 3P75A 2KEEA 5A35A 4RA8A 1KABA 1I4GA 4A93B 1AW7A 3NPPA 4OO1I 4EQPA 3MFYA 1F9RA 1SNQA 1DOKA 1QNUA 3V96A 2A74C 1F9SA 4UAIA 3I3CA 3GP7A 3H0GB 1CZGA 2R3ZA 2OEOA 3HG9A 1Y8OB 4OIKA 1EEID 2F0SA 3VYRA 5I6YA 3D31A 3GTJB 3P20A 3BYYB 3TP6A 1OXXK 2MHVA 1EY7A 3EQLC 1PTOD 3K6OA 2KVMA 1H9JA 2E2DC 3LNNA 3OHXC 3HOWB 1QE6A 2EE1A 1Y8PB 3R3OA 4RKBA 3CKIB 5C0XJ 3URYA 3FPUB 1SBBB 3M7NA 4IZ8A 1LT5D 2AUJD 2NBFA 2WKDA 3MVVA 4DNRB 3A8JE 2F03A 1BR9A 2K03A 3NBIA 1LT6D 4HCSA 1RJTA 2KUMA 4C3HG 2Q8TA 2F0DA 3J7AV 3NUCA 1VCIA 3OMGA 4KKSA 1B2TA 2KA7A 4N9PA 3QB3A 3BVMA 3OIPA 1TWGB 2L11A 1TWCB 4DXGA 2D62A 3A7LA 5EBCA 3ND9A 2WB1B 2PCFB 4YIJA 3MAQA 4XIGS 3I4MB 3O13A 2B8FA 3M4OB 1IYVA 5IIFA 5ELDA 1RF2D 2NTSA 2QEJC 5BN4A 2J4XA 4NDXA 3NWTA 5M5YB 2X69A 1FYCA 2Q8RE 2N88A 1QJOA 2EY2A 5FO9B 1GOZA 2N55A 2EYLA 1A15A 2CHBD 2O5JC 2E2HB 1UUPA 5C4HA 4DN4M 4XQNA 1PRTB 3MXPA 1Q12A 1TWHB 3S2DB 1OO9B 3X3NA 1H9SA 1LTSD 1PRTC 3RLFA 2WKCA 1DM0B 4K8JA 3J7YW 3C46A 2OT2A 5T1GA 1FD7D 2EOTA 2KCNA 1OXTA 3NTHA 2KJXA 5C6AA 1HRJA 4ID6A 1I4RA 4TSSA 3S1MB 4L8JA 1BOSA 4RH6A 1Y1WB 3W2DA 3BDCA 1Y69U 2K5WA 4Z9CB 2AQ2B 3MFGA 2BCOA 2EY1A 3OSOA 1TU2B 3DMUA 4MIUA 2EZVA 3GTQB 3GTGB 3EFXD 4PV1C 1S5FD 1GUOA 1II3A 1SDFA 4JBWA 1PRTF 1SE2A 4ZYSA 3D4WA 4KK7A 1XXGA 1KDAA 3I70A 3Q0AA 1LACA 5CORA 4KY7A 3K5NA 1EIGA 1Q90A 3WOFA 3Q6SA 3H3VC 1IW7C 2RSOA 5C3WA 3A8KE 4Y7NB 1NUCA 1KDBA 1S5CD 2RDGA 4CKEA 3C1EA 3J7AF 3NWSA 4S3SA 2B63B 2C9OA 4V0BA 1EIHA 3PUVA 2B2UA 3S1RB 2F0JA 4ULLA 1HUNA 2PPBC 2A69C 1FGBD 2R7ZB 2RBMA 1JICA 2R92B 3Q23A 5CYUA 3AMUA 2M2LA 1DJRD 4O1NA 1C48A 3TMEA 1D6EC 2FMCA 4C1NI 1RODA 2CW0C 1NR2A 1TS3A 2E2IB 5I2YA 1U4RA 1EQVA 5FLXE 1G291 1G8ZD 2O5IC 2HCIA 1HFGA 1SYDA 2G9HD 1CTMA 4ZKCB 3H94A 1CT1D 2F0TA 2L4NA 3TBIB 2FJ2A 3OWFA 5FLXL 1RDPD 2WACA 1I50B 2ENBA 2FINB 1DONA 4BS9A 2MJ8A 3GTOB 1AFPA 2NYZD 1SEBD 3S15B 1WD1A 1ESRA 1PZJD 2EJMA 5FK9C 2EY6A 2J7ZA 4K14A 2JA8B 3OPOA 1HTPA 5JEAH 1STAA 1VMPA 4X3TA 3NK9A 2B39A 3DWPA 4U68A 1JCKB 2E2JB 5I2XA 5JAVA 4WJWA 4ME5A 4Q0FA 1E2WA 3HS0C 1IL8A 3VYTA 5ELCA 1DOLA 2PYKA 3MA2B 2EYPA 1HUMA 3S1QB 2NVQB 1J8IA 2JEBI 2XNAC 4RGOS 3HP3A 1B9MA 2Z4HA 3KBGA 1JOQA 3BVZA 4A3GB 5EPLA 2AQ1B 4C3JB 4RAUC 1EU4A 4X3UA 5E3FA 3HOVB 2Z4IA 2BA1A 4R9WA 3HOZB 1LLRD 1T5EA 2YYZA 4N9TA 5J39A 4B08A 1LTAD 3S2HB 1Q3LA 4IUTA 4PMBA 1MD2D 4HCEA 3K5LA 1ET9A 3MTSA 4A3BB 3OIQA 3U9SA 1H9RA 3L9AX 4RKLA 2B2YA 5EKIA 1MBYA 5EQ0A 1DXMA 1TWFB 3I72A 2XRQD 1KNAA 1QWYA 4F88A 2BA0A 5KGUA 4IQZA 4XTCS 4C56C 3BG3A 1G2TA 4EVOA 3QIAA 1EOTA 3JAME 3K0YA 4C1NK 5DEHA 2C5CA 3D3RA 4ODGA 3J80E 2L5TA 1SNMA 2O2LD 5G3LF 4HMIA 2F0PA 2HQEA 4L6TB 4RWSC 5HURA 5IGGA 2ZT9C 2HDLA 1WVLA 1RKNA 1EY4A 4QF4A 4NW2A 3T53B 4PQXA 2VB3X 5DNFA 1YNND 1TS4A 5CR3A 1STGA 3J80L 1STNA 2F0FA 3MEHA 5EKKA 3DEOA 5CBAE 2H4OA 2K1BA 3NQTA 4ZUIA 3S1NB 1H9SB 2O4XA 3VR2A 4KMUC 1EWHA 1MSHA 5CV8A 3VYUA 1QB5D 4F87A 1BXTA 2I46A 4G57A 4LMQD 2PO4A 4B9XA 1ZYRD 2EYHA 3R8BA 5JVG3 3S17B 1RHPA 1A2UA 3H6MA 1D2BA 3EVQA 1WTXA 1LT4D 2E76C 3W3AA 4LAAA 1STEA 1EQTA 2NUCA 3Q24A 3VR6A 2NVTB 1BO0A 5IT9E 1LTTD 1EFID 1EU3A 2IX3A 3T4AC 1Q1BA 3E5SA 5JJZA 4FVMA 1ICWA 1L0YB 4KJOA 1EZ6A 1HTLD 2KEDA 5JEAJ 5IT9L 1NR4A 2MUYA 1V1PA 4A3JB 1YNJC 2XWBB 3SXHA 2AWNA 1U4PA 5I4DA 3SE0A 3FVQA 3K5MA 1ONLA 1S5ED 2E75C 1H9MA 3NXWA 2EJGC 1ENFA 4BY1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2X A;  2I46 A;  2M9V A;  5I2Y A; 
#chains in the Genus database with same CATH topology
 2K33 A;  4P72 A;  4H02 A;  2LFN A;  2AMC B;  3RD4 A;  1N33 L;  5C5M A;  3A54 A;  1F9Q A;  4CJ0 B;  1CQV A;  4U67 3;  4PMW A;  1X55 A;  5GAH C;  5H1S E;  4DUY L;  4B9W A;  3UDX A;  4X64 L;  5EGT A;  5KNC A;  5J22 A;  1Q46 A;  2AKW B;  2K5Q A;  4JI5 Q;  1ML0 D;  3F8T A;  3W1G A;  2OQ0 A;  1STY A;  1PH4 A;  2YU9 B;  2JXM B;  3J81 c;  2B2U C;  1B1Z A;  3DLL A;  4OGQ C;  3IL8 A;  5C4J B;  1K28 A;  2AQ3 B;  3NQI A;  3A56 A;  3KUP A;  4DF7 A;  2VQF L;  1FNV A;  4CKC A;  4JI7 Q;  3HKZ G;  1TR5 A;  4E6I A;  2IL8 A;  5GQO A;  3I73 A;  3F2D A;  2B63 G;  1X65 A;  2MPM A;  4HID A;  5GAD C;  1HZA A;  2G9D A;  5JEA G;  3WOE A;  2WV6 D;  1U5K A;  2R7Z G;  4DAP A;  1UEA B;  4DGZ A;  4IN3 A;  1O80 A;  1XJV A;  1CKM A;  3GD7 A;  4A3J H;  3BZK A;  1VQL A;  2R92 G;  1JWS D;  4RG1 A;  4J6H A;  5E4X A;  2KHS A;  2F3I A;  3NTK A;  3NSW A;  4X65 L;  3I90 A;  2A6E C;  1RL2 A;  2K7V A;  1HCZ A;  2DY8 A;  1R9T B;  1LTG D;  4NXM Q;  2J0T D;  4IFD H;  4MHE A;  1SRU A;  1S40 A;  5KYI A;  1VQO A;  1XX8 A;  4OEL B;  4JI3 L;  4GN3 B;  4BWG B;  5IGE A;  1KTK A;  3HRZ C;  3RN2 A;  1S3O A;  1A63 A;  2K5V A;  3TZU A;  1EUJ A;  4LF5 L;  5IP9 G;  2IPK D;  4G7H C;  1UE7 A;  4L5T A;  3GTJ H;  2A73 B;  4X3K A;  2JQO A;  4DK0 A;  1SE4 A;  4FO2 A;  4XXE A;  3M85 A;  1CA5 A;  2OXP A;  2F0W A;  1QOH A;  4JI6 Q;  1H9K A;  3RNU A;  4X65 Q;  2K4K A;  5C5L A;  1SYC A;  1QVF A;  4P2C B;  4AIM A;  4HJ5 A;  4ABN A;  4C2M B;  4POG A;  3PUY A;  5C4J H;  1HR0 W;  1HQM C;  1PRT D;  3VA5 A;  4FXK C;  4G7O C;  1QCB D;  1X32 A;  1KQS A;  4I65 A;  5ISR A;  1IBK L;  4DV6 L;  2VNU D;  4MZ9 A;  1STB A;  4JI3 Q;  3D8G A;  3OMC A;  1A3V A;  1DD2 A;  1C8C A;  1XPR A;  1Y1V B;  4LUZ A;  1TY2 A;  3ULL A;  4LF5 Q;  2VW9 A;  3S14 B;  1SYE A;  2JK8 A;  2SEB D;  1QZG A;  3M3Y B;  4FF2 A;  2ZJP A;  2Q2U A;  1J9O A;  4KV6 A;  1R9T H;  1VF7 A;  2FFK B;  3L7Z C;  1ZKO A;  2HUG A;  1TWG H;  1PZI D;  4DXF A;  3MC0 B;  1W2B A;  1TWC H;  3H09 A;  3K81 C;  1ET6 A;  2CQA A;  1LM0 A;  2SOB A;  1D1I A;  1EQQ A;  5CV6 A;  3KLW A;  1L0W A;  3KLR A;  4RMF A;  1KL9 A;  2PMZ B;  3R2T A;  4NKL A;  2EDG A;  3H91 A;  2ALY B;  3EN2 A;  3CCL A;  4MNO A;  1SFO B;  2RHQ B;  3KLS A;  1GJX A;  1CI3 M;  4C2M H;  3RZD B;  5L37 A;  4DFA A;  1CM9 A;  1IW7 D;  2K6A A;  5M5Y H;  1D1K A;  1HXY D;  3HOV G;  2H5X A;  2IW3 A;  4HIM A;  5D3D A;  5LMU L;  3I56 A;  4H44 C;  2JA7 B;  3IAY A;  2VB2 X;  3S24 A;  4I7A A;  1VQ8 A;  1M90 C;  5E7N A;  1Y1V H;  2B2Y C;  1HZC A;  4LW1 A;  3CC7 A;  4A3I B;  5EPK A;  1Z7T A;  1WD0 A;  2WB1 E;  2UUC Q;  3S14 H;  4A3B G;  4AYB B;  5KIX A;  4GKJ L;  1TII D;  1VMC A;  1SYF A;  2BOS A;  5CV4 A;  5EBD A;  2RKS A;  2DGY A;  2A69 D;  1IXR A;  1KXL A;  2K05 A;  3GTK B;  4HAE A;  1O7Y A;  2K01 A;  4PMC A;  4Q5V A;  5M5W B;  4A3D B;  1N36 L;  3CP0 A;  2ES2 A;  2F0V A;  3VR3 A;  4KD3 A;  3RMH A;  3TEH B;  1B53 A;  4IPH A;  5FJ8 G;  3T13 A;  5M3F B;  1NMG A;  1SMY C;  4QMG A;  1N8R C;  1IBL Q;  1VDZ A;  2F4I A;  3FKI B;  2JP1 A;  1LTB D;  1MGS A;  1KRS A;  2CFM A;  3CQZ B;  1FL0 A;  3S1M H;  4LWC A;  3NE5 B;  5J1Z A;  2CW0 D;  1Y1W H;  2EYF A;  2NN6 G;  3N6R A;  3TP5 A;  2UUA L;  1DOM A;  2HDM A;  2LXK A;  1SMX A;  2Y0S B;  3PMF A;  4RCN A;  3PIP 3;  4GN4 B;  4A3L G;  3KFU A;  2JA6 B;  2RDH A;  5EKL A;  2I5M X;  1JJG A;  1NNX A;  1V9P A;  2GVB A;  3PO3 B;  4GKJ Q;  3HOY G;  4XYO A;  1TT2 A;  2WII B;  3CCR A;  2ZXP A;  1WYD A;  4IUN A;  5EJW A;  3DWQ A;  2JA7 H;  1GO3 E;  1XWE A;  5CGK A;  1VQ4 A;  5KYL A;  4CKB A;  1DCZ A;  4H0L C;  1EIY B;  4QUF A;  2BE5 C;  2F3W A;  4HIO A;  1M8A A;  3U9O A;  4OON A;  3N52 A;  3ONA B;  4FDB A;  5TSS A;  3U50 C;  4N8F A;  1SJE D;  4DAM A;  5I9O A;  1SE8 A;  4XYQ A;  1IL2 A;  5M5W H;  2FHT A;  4DR1 L;  4A3D H;  4GS3 A;  1ZEQ X;  1BVS A;  1B9N A;  4ZKB B;  5FLM H;  5M3F H;  3HGB A;  5JOB A;  1PFN A;  2E5L L;  4LNQ A;  1IZ6 A;  1AE3 A;  5IGC A;  4JW0 A;  4DV3 Q;  2L0C A;  3LX0 A;  3TS2 A;  1JE4 A;  1HNX L;  2B8G A;  4IJL A;  1W3S A;  1W6K A;  3VYS A;  1M4V A;  4XQQ A;  2LSS A;  3HOU G;  3KBX A;  3PO3 H;  4FYD A;  1UWV A;  4I7Z C;  3JAM i;  1V1P B;  5FKA C;  4O42 A;  1DYQ A;  1XTC D;  3RZO B;  3D6C A;  4IO9 A;  2A68 C;  3K59 A;  3J81 E;  2MQH A;  3CW2 C;  4JBM A;  4O2D A;  3J80 i;  1Q7Y C;  1KAA A;  2OTL A;  2ICE C;  1QVC A;  1BCP B;  2AWO A;  1PDQ A;  5GRO A;  1GUS A;  1JC7 A;  1A8V A;  1YHQ A;  2E5L Q;  4LF9 L;  1BCP C;  3CRK C;  5LL6 S;  2IX0 A;  3HKZ E;  1GHJ A;  3AU7 A;  4ZQ3 A;  5BN5 A;  4K5W A;  3J81 L;  4EGV A;  4A3E B;  1HNX Q;  5CV7 A;  4JV5 L;  3ND8 A;  4DV4 L;  3NBH A;  2CWP A;  3K8A A;  1D5M C;  2MP1 A;  3D4D A;  2OWO A;  3GTM B;  3A8I E;  2F3V A;  3PO2 B;  4L63 B;  1F77 A;  5G3L D;  1STH A;  4C3I B;  3C3L A;  4IFD G;  5DM7 3;  3OOC A;  3NHH A;  3ULP A;  4DAY A;  1B4O A;  3MZ5 A;  3GTO H;  2F0G A;  2DJF C;  1L2F A;  1IYU A;  3SK5 A;  3S15 H;  5IP7 H;  1G6Z A;  1JB3 A;  2A19 A;  2DNE A;  2GVA A;  1ASY A;  2JA8 H;  4OL7 A;  1BBU A;  4LF9 Q;  1S5B D;  4IUU A;  1HFN A;  3T16 A;  1XMQ L;  3TZD A;  2SNS A;  2K32 A;  1SNO A;  2MGS A;  3PCO B;  4WFN 3;  3VDY A;  5M9O A;  1Z9F A;  2F0H A;  1PFB A;  1PHJ A;  4LF6 L;  1GUW A;  3WWV A;  2KHJ A;  2XWJ B;  1EFW A;  1TKW B;  3MXN B;  4MTN A;  3VA7 A;  4HED A;  4JV5 Q;  1BCP F;  4PG3 A;  4ZUJ A;  4BA2 I;  2SNM A;  1SND A;  1KDC A;  5ELB A;  2KQ3 A;  2QKI C;  2UXC L;  2KBN A;  3HOW G;  3NEM A;  4DA2 A;  2JSO A;  4QB4 A;  2RQX A;  3GDE A;  3WDN A;  3DEP A;  5C0X H;  3J7Z C;  1CHQ D;  4P71 A;  2RDF A;  3A7A B;  4A3C H;  2IX1 A;  3OYY A;  4A4I A;  1PLF A;  4CGY B;  2IT1 A;  1Y8N B;  2WFW A;  2PQE A;  2XVS A;  5AFW A;  2NWG A;  1DZ1 A;  1B3A A;  1WI5 A;  3K58 A;  1XMQ Q;  1NY4 A;  5BN3 A;  1SNC A;  3ERS X;  1JWM D;  4OWW B;  2PQA B;  1QG7 A;  3ER0 A;  5K5P A;  2RCF A;  4A3G H;  3BYT B;  4C3J H;  4C3I H;  2LKV A;  5IWA L;  4OXP A;  4KN7 C;  1HHV A;  1JE5 A;  5FO8 B;  4R4I A;  1J5E L;  2UXC Q;  2KOL A;  1SYB A;  1E1O A;  3IKJ A;  3BDO A;  2WB1 G;  2M9V A;  4IUQ A;  4K5X A;  2OF1 A;  3TDQ A;  3HOZ H;  3JAM L;  3NTI A;  2ZXO A;  4RGM A;  3OW7 A;  3PIP A;  4KD4 A;  1K83 B;  3RR5 A;  3S2H H;  3T56 B;  3VR4 A;  1CK1 A;  1D5Z C;  4V19 0;  3RLN A;  2F0M A;  1BBX C;  2L9H A;  1V43 A;  5DM6 3;  2PZT A;  4BBR B;  2K5D A;  2EY5 A;  3OWE B;  1TWA B;  2B2W A;  5IWA Q;  5LMN Q;  2IWH A;  2JA5 B;  1VQI A;  2NTT A;  1XNQ L;  1J5E Q;  2CCZ A;  4A3K B;  1NCV A;  4IUV A;  4UP8 A;  2XSC A;  1RCV D;  1Y1V G;  3CCM A;  4JK1 C;  4BXX H;  4L5S A;  1A0I A;  2WP8 J;  3I4O A;  1F2M A;  1J6Q A;  1F2Y A;  5A2Q E;  2I07 B;  2PNH A;  4ZRZ A;  2C35 B;  1AZP A;  4BY7 B;  5C44 B;  1HNW Q;  4IUP A;  2X6L A;  4IAL A;  1EWC A;  5D65 A;  2F0K A;  2B2T A;  2NN6 I;  1GUN A;  3BJU A;  5ELF A;  4YY3 Q;  4EX5 A;  1PZK D;  2KEC A;  4XT1 B;  4QGU A;  3A5U A;  2R61 A;  4GLX A;  5IGF A;  1GXD C;  4DR3 L;  1YHA A;  2I0Q A;  1YNJ D;  2E8G A;  4CDE C;  4LF8 Q;  2UUB Q;  1BF4 A;  2A6H C;  2Z6K A;  5A2Q L;  4KKU A;  2Q2H A;  1PV4 A;  1Q1E A;  1XNQ Q;  1RTO A;  2K28 A;  2RVL A;  1UE6 A;  1Y1W G;  4QQB X;  4IPD A;  4NB3 A;  1K83 H;  4YHH L;  3K7A B;  3IFT A;  5M5X B;  1LTI D;  4J8Q A;  2VXW A;  5IOC A;  4NP5 A;  4BBR H;  1VQM A;  2OCE A;  2TSS A;  3CHB D;  4LFA Q;  1K3R A;  2Z1C A;  3T51 B;  1TWA H;  1CA6 A;  4HSV A;  4CDF C;  4CDD C;  2R93 B;  1HH2 P;  3MHB A;  3S1N H;  2PNR C;  1IBM Q;  2JA5 H;  4KY5 A;  5CC4 A;  2XRS D;  1BDO A;  2F0N A;  2DN8 A;  3P7J A;  1PYW D;  4OX9 L;  1C4Q A;  3KJO A;  4QJF A;  1RD9 D;  1SNP A;  2PI2 E;  1I5F A;  5I9P A;  3GV3 A;  4FXG C;  3S17 H;  5IGD A;  4F7X A;  4BY7 H;  5C44 H;  5JVH 3;  4M8A A;  1GUG A;  3NP8 A;  4OO1 H;  5JJK A;  2PW7 A;  5DAU A;  1JOR A;  1CKO A;  1PA6 A;  2L55 A;  4A3D G;  2NVT H;  2K52 A;  3V2T A;  1FNU A;  3CME A;  2UU9 L;  3D4R A;  5FLM G;  5JPN C;  4GNX A;  5M3F G;  3G6E A;  3BZC A;  2A6E D;  2AUK A;  4JI1 L;  1JB7 A;  1UNS A;  4OIJ A;  1U4L A;  2F0U A;  3D6W A;  2KEN A;  1HR0 Q;  1ILP A;  4TVA B;  4GKK L;  3W5O A;  1SJH D;  3K7A H;  1X6O A;  1N33 Q;  1A3U A;  2B3G A;  4Y52 H;  3MXN A;  2PZW A;  1K8M A;  2ID0 A;  3UE0 A;  2DJG C;  4KHZ A;  2XIW A;  2B2V A;  4EQN A;  4FNF A;  1TY0 A;  4JI0 L;  3J7A 5;  2TMP A;  4K8I A;  4FF3 A;  1VQG A;  4DPG A;  4DUY Q;  4DV5 L;  3S16 B;  1VQH A;  4X64 Q;  1PFM A;  2Q2I A;  4JI8 L;  1WJJ A;  3K7U C;  1K73 C;  2WIN B;  1OXU A;  2EPB A;  2R7F A;  1VQJ A;  2QDB A;  2BDO A;  2ATW A;  5FO7 B;  1AZQ A;  1EOV A;  2UU9 Q;  4K0K L;  5JJL A;  1PTO B;  4GZY C;  1SSO A;  4BY1 H;  3PF5 A;  3F2C A;  4IFD I;  2VQF Q;  4BBS B;  1YEZ A;  5CV9 A;  4R4Q A;  3UDF A;  1PTO C;  4GKK Q;  1JQY D;  1VS0 A;  1HQR D;  4PZ7 A;  1CKN B;  3E0J A;  1EL0 A;  1G6P A;  3MXG A;  3CCV A;  2PQA A;  5CMD A;  3GO5 A;  1ENA A;  1T5X D;  2DY7 A;  4X3S A;  1KAW A;  2YU9 H;  2K14 A;  2L12 A;  1TS5 A;  4HSP A;  1SYG A;  2CQO A;  5JPM C;  1IHZ A;  1Q8I A;  4HMJ A;  1NSN S;  2PW5 A;  1X3P A;  3TN2 A;  4CDC C;  5IP7 G;  1K0R A;  3G7L A;  2UXD L;  2JA8 G;  5ELO A;  1WTP A;  4DR5 L;  4CHT B;  3M9B A;  1V8Q A;  4B3R L;  4YCU A;  5C4X B;  3ZYY X;  1JJC B;  5HY6 A;  4L5R C;  5HGT A;  3BVG A;  3T1Y L;  1UE5 A;  2ZXR A;  3OTO L;  1K8A C;  1D5X C;  2LMC B;  3I91 A;  2BDN A;  4UDU C;  4DR2 L;  1PTO F;  1VQK A;  3SK4 A;  4B3M L;  2HIV A;  3I4N B;  1RTN A;  1AH9 A;  3M7G A;  3R93 A;  3ITP A;  1O7L A;  1V1O A;  2A5H A;  4DK3 C;  5LHY 1;  3NBH B;  3G6J B;  1E0B A;  4CBV A;  3SVM A;  3I7F A;  1CSQ A;  1YNX A;  3F2B A;  1JR0 D;  5C0X G;  1PTO H;  2ZJQ A;  1X3E A;  5D14 A;  4A3C G;  2NVY B;  1TVX A;  1XTD A;  1I6V C;  3K5O A;  4DAY B;  3ERQ A;  5KRU A;  1O7Z A;  1KLU D;  5CBE E;  2F0L A;  2JYO A;  4DR5 Q;  4P75 A;  1N34 L;  5IOD A;  3B6Y A;  3G71 A;  1IBK Q;  2VUM B;  4DV6 Q;  4KLK A;  1X3F A;  1MI2 A;  5M3M B;  2I5L X;  1P16 A;  5K36 H;  4A3G G;  3UI2 A;  4DR2 Q;  1MSG A;  4C3J G;  1S72 A;  2R7D A;  4C3I G;  1QUQ B;  1LT3 D;  3KF8 B;  5CV5 A;  5F2D A;  2UXB L;  1EYD A;  4APV A;  1A6X A;  5KNB A;  4LFB L;  3D0F A;  2R6G A;  5COY A;  3L3O C;  5I6W A;  4A3M B;  4KTA A;  1WTW A;  1OXS C;  4DK1 A;  3HOZ G;  2HHH L;  2RA4 A;  3SHL A;  4KKT A;  1CFM A;  2CH4 W;  3CCS A;  4DR6 L;  1VQ5 A;  1HA6 A;  1VQA A;  4RHR A;  1N34 Q;  1WTR A;  1SMY D;  1FJG L;  2LY7 A;  1K8G A;  4B3S L;  3V05 A;  4YCW A;  3I4N H;  3QJY A;  1RIP A;  2NVX B;  1LO5 D;  1B7Y B;  1I4X A;  1I94 L;  3M3Y H;  3PF4 A;  2RCN A;  3SEB A;  1JOK A;  1CZW A;  1F2L A;  4LJZ C;  1WFQ A;  2UXB Q;  3FPP A;  4GOP B;  2QIL A;  3J81 i;  1K8O A;  4BXX G;  4HTH A;  1K3B C;  2JE6 I;  4K2L A;  4KJN A;  5LMU Q;  4TKO B;  1TQO A;  2B29 A;  2VUM H;  1F9P A;  5E4W C;  2K5H A;  1F2Z A;  4HN7 A;  2IJ0 A;  5M3M H;  1VF5 C;  5IT9 c;  1FJG Q;  1SFO H;  3ERO A;  3RN5 A;  2BE5 D;  1T9H A;  1KHI A;  1QIL A;  4RGN A;  3GTP B;  1W6J A;  5BR8 L;  1IKM A;  3RZD H;  1PXU A;  3IFD A;  2JEA I;  2RSN A;  4GLA C;  3HKZ B;  4A3M H;  1LAB A;  1JOO A;  1GUT A;  2ZTC A;  4EQ5 A;  2N3S A;  2EJF C;  2RF4 A;  3CCU A;  1N36 Q;  3CU7 A;  3DXJ C;  3HOX B;  2Q8I B;  3SK8 A;  4M1U B;  3I4L A;  4DU9 A;  3DWA A;  4XDX A;  3R2I A;  3M4P A;  4KHP L;  2B2W C;  4FP5 D;  4A3I H;  5ELE A;  1EYG A;  2Z8L A;  3H3V I;  4PZ6 A;  2OTJ A;  3G4S A;  3PIO 3;  2EXZ A;  4UP7 A;  2NVX H;  3I8Z A;  2LS0 1;  2L1B A;  3QO2 A;  1IKL A;  4HJ9 A;  2PMZ E;  2UUA Q;  4P73 A;  5T1I A;  1PH8 A;  4C3H B;  1Z47 A;  3UDG A;  1B44 D;  4DNT B;  3CCJ A;  2JA5 G;  3GTK H;  4DR4 L;  5BR8 Q;  3CCE A;  1SAP A;  3K80 C;  1O7I A;  3L2P A;  2XN9 C;  3J81 j;  4PNY A;  2B2T C;  4IPC A;  2EYJ A;  4IFD J;  2A68 D;  3FDT A;  5J3B A;  1PVO A;  1KLG D;  4K5V A;  4KI0 A;  1CKN A;  3FKI H;  1WTQ A;  1HNZ L;  3CQZ H;  3DHQ A;  3DUZ A;  1E7Z A;  5C44 G;  4BY7 G;  2NZ1 D;  3BZD B;  4OO1 G;  3STB C;  3KK7 A;  3LWU A;  2Z6K C;  1R4Q B;  1WTO A;  2EYO A;  4R4O A;  3GQB A;  1BCP D;  2EYM A;  2F4V L;  2JA6 H;  3MWY W;  1ZXT A;  3NEN A;  4R8I A;  3GTP H;  1I4H A;  2PZU A;  4CJ1 B;  4DV0 L;  4YWM A;  3PUZ A;  4MTK A;  4AYB E;  3G48 A;  2F0E A;  1ENC A;  1AP0 A;  1BUV T;  5IE8 A;  3QG1 A;  2EVB A;  4TQU S;  3U4V A;  4DR1 Q;  1X3G A;  3HEJ A;  1TXY A;  1C9O A;  1E2Z A;  2Z9H A;  2K5N A;  3HOX H;  4FF1 A;  3GTL B;  4LF4 L;  2WAQ B;  1JWU D;  3CRL C;  1B50 A;  1HNZ Q;  4TRD A;  4RHS A;  2IHF A;  5ELN A;  1PMR A;  2QDL A;  1TS2 A;  1XNR L;  4A3J G;  1CHP D;  1LV9 A;  2BH2 A;  1G2S A;  1VQE A;  1BQQ T;  1PFS A;  4C3H H;  2P5Z X;  3A5Z B;  2Y0S E;  3SDZ A;  2E74 C;  2F4V Q;  3KLS X;  4N8X 1;  2QEX A;  2HT1 A;  4QCL A;  4UHV A;  4WJ4 A;  2KCC A;  4WRD A;  4BY1 G;  3HKS A;  4H13 C;  3S9W A;  1LTR D;  2V4D A;  1JT8 A;  1S5D D;  3KYH C;  3PV0 A;  4GNX B;  1GHK A;  4A76 A;  3M4Y A;  3A0J A;  1LYL A;  2H1E A;  4RFB A;  4JVZ A;  1WTV A;  5KND A;  4LF4 Q;  2ICI A;  4GNX C;  3K57 A;  2QCP X;  4WOR A;  3BDL A;  3CPW A;  4NMZ A;  4FXD A;  1FR3 A;  3P1H A;  1CQF A;  1L1O B;  4IUR A;  1XNR Q;  1S4Z A;  1X54 A;  5NUC A;  5C3E B;  3TRE A;  1QUQ A;  1VQD A;  2VS1 A;  3QOJ A;  3KF8 A;  1SE3 A;  2V1C C;  4G4K A;  4F8M A;  1ASZ A;  4DV4 Q;  1ESF A;  4B3T L;  1GKH A;  1A3T A;  2GA4 B;  1BBW A;  3RZO H;  3Q22 A;  1D8L A;  1EYC A;  2OQK A;  2B2V C;  4CJ2 C;  1QNK A;  4JPB W;  3C2P A;  3ZJY C;  2M00 A;  5C0X I;  4DV1 L;  2NB0 A;  3EA6 A;  2CKZ B;  3E6Z X;  4R8N A;  4YCV A;  2HCC A;  2D9U A;  3RUZ A;  3AB9 A;  3TQY A;  5KEE A;  4HJ7 A;  3LWE A;  1HJP A;  4ALP A;  4J1M A;  2Z6B A;  1KC8 C;  1KNE A;  1U4M A;  5FOB B;  1N9W A;  1X56 A;  4ZAI A;  2Z0S A;  1WCM B;  4A3E H;  4XQJ A;  4QIW B;  1YJW A;  3BU2 A;  3TP8 A;  4LF6 Q;  4QUC A;  1SXT A;  1E3P A;  4K6D A;  1PYB A;  4R4C A;  4DAV A;  3GTM H;  5IYD H;  3PO2 H;  5LL6 X;  4H7B A;  5C4Z A;  4B3T Q;  2JN4 A;  4GOP A;  3SK6 A;  2KCM A;  3FMC A;  3DM1 A;  3TSS A;  3T1H L;  1EZ8 A;  1GVP A;  1AN8 A;  1I4Q A;  5GAG C;  1XPO A;  4MN3 A;  3E9H A;  4KN4 C;  4LK1 C;  4XT3 B;  5IGB A;  1VQN A;  1I3Q B;  3F2U A;  3TP7 A;  4BA1 I;  3FEW X;  2X6G A;  4LFC L;  5K36 G;  1Q8K A;  5C3E H;  2QF7 A;  4OWT B;  4HJA A;  3M4Q A;  1EY5 A;  1EYA A;  1HA5 A;  1O78 A;  3CMA A;  4K2K A;  4G7Z C;  1YVC A;  3HOY B;  4KHV A;  3X3M A;  2D5D A;  3MXU A;  1CSP A;  4OHJ A;  4ZK9 B;  2D2C C;  1EY9 A;  2F0O A;  3VR5 A;  5C3X A;  2DNC A;  3QWN A;  4A3F B;  1L0X B;  2K04 A;  1R4P B;  1GD7 A;  1YZ6 A;  3QOL A;  3PIO A;  3CD6 A;  3C1F A;  1A2T A;  2A6H D;  1EEF D;  5EPJ A;  4KY6 A;  1WCM H;  3DM3 A;  3I4N G;  2CVR A;  2FMM A;  1G91 A;  3FRP B;  1EY8 A;  2YTV A;  2F0I A;  1VQP A;  4HR7 B;  4EQO A;  3BS1 A;  1N32 L;  3IRB A;  1I4P A;  1I6H B;  1VQF A;  1XMO L;  1UAP A;  1EY6 A;  1U9R A;  2F0Q A;  4UY8 C;  1YNN C;  4IOA A;  1ILQ A;  1AEX A;  4K6L A;  4RCO A;  1BNZ A;  2SDF A;  5D3I B;  4RGT A;  2VUM G;  1I3Q H;  4FF4 A;  3UE1 A;  1EY0 A;  2NN6 H;  5M3M G;  1Q82 C;  1OXV A;  3TRZ A;  3EJI A;  4OWX B;  3HOU B;  1EIF A;  3PSI A;  5IYC H;  2F1M A;  1XYI A;  4DV2 L;  3UDI A;  2N49 A;  1MJE A;  3SR1 A;  3CF5 A;  1ZYR C;  1Y14 B;  3PUW A;  1PH6 A;  4ILW A;  1KRT A;  1XMO Q;  4ZLT F;  1PH9 A;  1JMC A;  1FNW A;  1HPC A;  4A3F H;  4DR3 Q;  2JA7 G;  3HZX A;  1X3Q A;  1Z6H A;  3GV6 A;  5E1F A;  3EBE A;  3E9I A;  4A3K H;  1H95 A;  5FLX c;  3PUX A;  4A3I G;  3A55 A;  4LUV A;  1NAP A;  2VY3 A;  1Q81 C;  1E2V A;  3P75 A;  2KEE A;  5A35 A;  4RA8 A;  1KAB A;  1I4G A;  1YJ9 A;  4A93 B;  2KCT A;  1AW7 A;  4AYB G;  3NPP A;  1MJC A;  4YHH Q;  4OO1 I;  4EQP A;  4UP9 A;  3MFY A;  1F9R A;  1NBW A;  2YTY A;  1SNQ A;  4JI7 L;  1DOK A;  3Q8D A;  1QNU A;  1G51 A;  3V96 A;  3OW2 A;  2A74 C;  1F9S A;  3CXC A;  4UAI A;  3I3C A;  3GP7 A;  3H0G B;  4JOI A;  3FKI G;  1CZG A;  2R3Z A;  2OEO A;  3HG9 A;  3ICE A;  1Y8O B;  4OIK A;  1EEI D;  2F0S A;  3VYR A;  5I6Y A;  4OX9 Q;  4IPG A;  5GAE C;  3D31 A;  4NPS A;  3GTJ B;  3P20 A;  1L1O A;  3BYY B;  3TP6 A;  1OXX K;  2Y0S G;  2MHV A;  1EY7 A;  3EQL C;  5M5X H;  1WTH A;  1PTO D;  1KIX A;  2JA6 G;  3HOU H;  1LUZ A;  4JYA L;  1E22 A;  2ZTE A;  3PO3 G;  4NXM L;  3K6O A;  2KVM A;  3U58 A;  1H9J A;  2E2D C;  2LXJ A;  4LF7 L;  2R93 H;  4X66 L;  3LNN A;  3OHX C;  4YWK A;  3HOW B;  1QE6 A;  2EE1 A;  3E0E A;  3HOX G;  1Y8P B;  3R3O A;  2XTI A;  4JCV E;  5IYB H;  4RKB A;  2KHI A;  3CKI B;  1VQB A;  3URY A;  5C0X J;  3FPU B;  1SBB B;  3M7N A;  4JI1 Q;  4IZ8 A;  1LT5 D;  2AUJ D;  1WOC A;  1YJN A;  2NBF A;  1E24 A;  2WKD A;  1SR3 A;  4JI6 L;  4A93 H;  2XGT A;  3MVV A;  3ULJ A;  3A8J E;  4DNR B;  2F03 A;  1BR9 A;  2K03 A;  3NBI A;  1LT6 D;  2EXD A;  4HCS A;  1RJT A;  2KUM A;  4C3H G;  2Q8T A;  2F0D A;  3J7A V;  3NUC A;  1VCI A;  4JYA Q;  3OMG A;  1VQ9 A;  4KKS A;  1B2T A;  2KA7 A;  4JI0 Q;  4N9P A;  4NXN L;  3QB3 A;  3BVM A;  3OIP A;  4DV5 Q;  1TWG B;  2ZM6 L;  1PH5 A;  4LF7 Q;  2A1A A;  4L5Q A;  4X66 Q;  2L11 A;  1TWC B;  2I5H A;  4JI8 Q;  4DXG A;  3MEF A;  2D62 A;  3A7L A;  3H0G H;  1MHW C;  5EBC A;  3ND9 A;  2WB1 B;  4K0K Q;  2PCF B;  3L0O A;  4YIJ A;  3MAQ A;  4XIG S;  3I4M B;  2HD3 A;  3O13 A;  2B8F A;  3M4O B;  1IYV A;  5IIF A;  1AE2 A;  3LGJ A;  1QVG A;  1VQ6 A;  5ELD A;  1RF2 D;  4X6A H;  2NTS A;  3U4Z A;  2QEJ C;  5BN4 A;  2J4X A;  5DLQ E;  4NDX A;  3S16 H;  3NWT A;  2PI2 A;  5M5Y B;  2X69 A;  1PYS B;  1NJI C;  1FYC A;  2Q8R E;  2N88 A;  1QJO A;  2EY2 A;  1X9N A;  3F1Z A;  3HOW H;  5FO9 B;  1SLJ A;  1GOZ A;  4DNI A;  2EQS A;  2N55 A;  4NXN Q;  2EYL A;  1M1K C;  1A15 A;  2ZM6 Q;  2CHB D;  1PH1 A;  1P8L A;  2WAQ G;  2O5J C;  4BBS H;  2E2H B;  1UUP A;  4AH6 A;  5C4H A;  1B3Q A;  4DN4 M;  4XQN A;  1PRT B;  2UXD Q;  2BH8 A;  3JAM c;  3MXP A;  1Q12 A;  1TWH B;  1K0S A;  4GLV B;  2RHS B;  4A3E G;  1OO9 B;  4B3R Q;  3S2D B;  3X3N A;  1H9S A;  1LTS D;  4R4T A;  1PRT C;  3RLF A;  4X62 L;  2WKC A;  1DM0 B;  3AYH B;  4K8J A;  3J80 c;  5IYD G;  3J7Y W;  3OTO Q;  3T1Y Q;  3C46 A;  3PO2 G;  3FP9 A;  2OT2 A;  5T1G A;  1FD7 D;  4B3M Q;  2EOT A;  2KCN A;  2HQL A;  3JC6 6;  4POF A;  1OXT A;  3NTH A;  2KJX A;  5C6A A;  1HRJ A;  4ID6 A;  1I4R A;  5HGQ A;  4TSS A;  3I4M H;  4L8J A;  3S1M B;  1BOS A;  2UUC L;  4RH6 A;  3M4O H;  1Y1W B;  3W2D A;  3BDC A;  2CH4 A;  1BKB A;  5C4X H;  1Y69 U;  2MFI A;  2K5W A;  4Z9C B;  2AQ2 B;  3MFG A;  5C3E G;  2BCO A;  2EY1 A;  3OSO A;  1TU2 B;  3DMU A;  4MIU A;  2EZV A;  3GTQ B;  1ICF B;  2FXQ A;  3GTG B;  3EFX D;  4PV1 C;  1S5F D;  1GUO A;  4X62 Q;  4JC0 A;  3W1B A;  1II3 A;  1SDF A;  4JBW A;  1PRT F;  1IBL L;  1SE2 A;  3A74 A;  4ZYS A;  3D4W A;  2Q2T A;  4LFB Q;  2JA9 A;  2NVY H;  4KK7 A;  2E2H H;  1XXG A;  3QR8 A;  1KDA A;  4LUO A;  3I70 A;  3Q0A A;  1NE3 A;  1LAC A;  5COR A;  1XPU A;  4KY7 A;  3I2Z A;  1WCM G;  4GOP C;  1TWH H;  3K5N A;  2HHH Q;  1EIG A;  3S2D H;  4O0A A;  1Q90 A;  3WOF A;  3Q6S A;  4A75 A;  3H3V C;  1IW7 C;  3E3X A;  1PH2 A;  4DR6 Q;  2RSO A;  5C3W A;  3A8K E;  4Y7N B;  3CC2 A;  1NUC A;  1VQ7 A;  4B3S Q;  1YIJ A;  3NEL A;  1KDB A;  1S5C D;  1I94 Q;  1GM5 A;  2RDG A;  4CKE A;  3C1E A;  3J7A F;  4JI4 L;  3NWS A;  4S3S A;  2B63 B;  1B8A A;  2C9O A;  4V0B A;  1EIH A;  3PUV A;  2B2U A;  3S1R B;  2F0J A;  4ULL A;  1HUN A;  2MO0 A;  2PPB C;  2A69 C;  3EIV A;  1FGB D;  3KF6 B;  2R7Z B;  2K50 A;  2RBM A;  1PH7 A;  3GTQ H;  1JIC A;  1EQR A;  3GTG H;  5IYC G;  4HIK A;  2R92 B;  4BBR G;  2JJQ A;  3I55 A;  3Q23 A;  5CYU A;  2NZH A;  3AMU A;  3STB D;  2M2L A;  1DJR D;  4O1N A;  3H15 A;  1C48 A;  3TME A;  1D6E C;  2FMC A;  4A3F G;  4C1N I;  1ROD A;  2CW0 C;  4DV3 L;  4A3K G;  1NR2 A;  1TS3 A;  2E2I B;  3H3V H;  5I2Y A;  4JI4 Q;  1U4R A;  3RLO A;  1EQV A;  5FLX E;  1G29 1;  4IOC A;  1G8Z D;  2O5I C;  1HZ9 A;  2HCI A;  2AHO B;  2G5D A;  1HFG A;  5EAY A;  1EWI A;  4KHP Q;  1SYD A;  2G9H D;  4Y7N H;  3CCQ A;  1CTM A;  3TS0 A;  4ZKC B;  2QGQ A;  3AFP A;  3H94 A;  1CT1 D;  2F0T A;  2L4N A;  3TBI B;  2FJ2 A;  3OWF A;  2D0P A;  5FLX L;  1RDP D;  2WAC A;  1V1Q A;  1I50 B;  2ENB A;  2FIN B;  1DON A;  4BS9 A;  2MJ8 A;  3GTO B;  1AFP A;  2NYZ D;  1SEB D;  3S15 B;  1WD1 A;  4DR4 Q;  2B63 H;  1ESR A;  1PZJ D;  2EJM A;  5FK9 C;  1C0A A;  2EY6 A;  2J7Z A;  4K14 A;  4R1J A;  2JA8 B;  3KOJ A;  3OPO A;  5JJI A;  3S1R H;  3KDF B;  1HTP A;  5JEA H;  2N8N A;  1UEB A;  2ZTD A;  2R7Z H;  1STA A;  1VMP A;  1YBY A;  3AFQ A;  4X3T A;  1YIT A;  3NK9 A;  2B39 A;  4AQY L;  3DWP A;  4U68 A;  1JCK B;  2R92 H;  2E2J B;  5I2X A;  5JAV A;  2R93 G;  4DUZ L;  4WJW A;  4ME5 A;  4Q0F A;  1E2W A;  3HS0 C;  1IL8 A;  4DR7 L;  2MO1 A;  3VYT A;  5ELC A;  5AJ3 L;  1E1T A;  2VZA A;  5IYB G;  4DV0 Q;  1DOL A;  2E2I H;  2PYK A;  3MA2 B;  2YTX A;  2EYP A;  1HUM A;  3S1Q B;  2NVQ B;  1J8I A;  4A93 G;  1A62 A;  1PH3 A;  2JEB I;  2XNA C;  4RGO S;  3HP3 A;  1B9M A;  5IP9 H;  2Z4H A;  3KBG A;  4P74 A;  1C7Y A;  1JOQ A;  3BVZ A;  4JOI C;  4DV7 L;  4AQY Q;  4A3G B;  5EPL A;  2AQ1 B;  3SGI A;  4C3J B;  1NMF A;  1MKH A;  2N78 A;  4RAU C;  1HZB A;  2F52 A;  3AQQ A;  4DUZ Q;  1L1O C;  1I50 H;  1EU4 A;  3H0G G;  4X3U A;  5E3F A;  1B70 B;  4DR7 Q;  1YHB A;  3HOV B;  2Z4I A;  5AJ3 Q;  2BA1 A;  4R9W A;  3HOZ B;  1LLR D;  1T5E A;  2YYZ A;  1QZH A;  1MIU A;  4N9T A;  5J39 A;  4B08 A;  1LTA D;  3GTL H;  3S2H B;  1Q3L A;  4IUT A;  4PMB A;  1IYJ B;  2DUD A;  1MD2 D;  4HCE A;  3K5L A;  2E2J H;  2A8V A;  3PQI A;  1ET9 A;  3MTS A;  1JJ2 A;  4A3B B;  3OIQ A;  4DV7 Q;  3U9S A;  4JBK A;  1OTC A;  1H9R A;  1UE1 A;  3L9A X;  3PGZ A;  4PZ8 A;  2B2Y A;  4RKL A;  2QW7 A;  5EKI A;  1SN8 A;  2VL6 A;  1MBY A;  4QL5 A;  5EQ0 A;  4BBS G;  1DXM A;  1TWF B;  3I72 A;  2XRQ D;  3S1Q H;  1KNA A;  2NVQ H;  1QWY A;  4F88 A;  2BA0 A;  4YWL A;  5KGU A;  4IQZ A;  4XTC S;  4C56 C;  3BG3 A;  1G2T A;  4DV1 Q;  3CAM A;  4EVO A;  3QIA A;  4DK6 C;  1EOT A;  3JAM E;  2WAQ E;  3K0Y A;  4JG2 A;  2IHE A;  4C1N K;  5LMN L;  5DEH A;  1Q86 C;  2C5C A;  1DGS A;  3D3R A;  1SRO A;  4ODG A;  3J80 E;  1KD1 C;  1YI2 A;  2L5T A;  1SNM A;  1D7Q A;  2O2L D;  5G3L F;  2L15 A;  4HMI A;  2F0P A;  2HQE A;  4L6T B;  5IY0 A;  4JI2 L;  2MNA A;  4RWS C;  3HOV H;  5HUR A;  5IGG A;  2ZT9 C;  3I4M G;  2HDL A;  1WVL A;  1RKN A;  1EY4 A;  3AEV A;  4QF4 A;  4NW2 A;  5C4X G;  3T53 B;  1HNW L;  4PQX A;  2VB3 X;  3T1H Q;  5DNF A;  1YNN D;  1TS4 A;  3KF6 A;  5CR3 A;  1STG A;  3J80 L;  4YY3 L;  1STN A;  2F0F A;  3MEH A;  1U0L A;  5EKK A;  3DEO A;  5CBA E;  3FHW A;  2H4O A;  2K1B A;  3CC4 A;  3NQT A;  4A3B H;  2VQE L;  4LFC Q;  1NTG A;  4ZUI A;  4LF8 L;  2UUB L;  3S1N B;  1H9S B;  2YV5 A;  2O4X A;  3HFZ B;  3VR2 A;  4KMU C;  1LTL A;  1EWH A;  1MSH A;  5CV8 A;  3VYU A;  1QB5 D;  4F87 A;  1BXT A;  4UPA A;  4JI2 Q;  2I46 A;  1TWF H;  4G57 A;  4GN5 A;  4LMQ D;  5FJ8 H;  2IY5 B;  2PO4 A;  4B9X A;  1ZYR D;  2EYH A;  3R8B A;  3CPF A;  4QY7 A;  5JVG 3;  4WJ3 M;  3S17 B;  4HJ8 A;  1RHP A;  1A2U A;  3H6M A;  1D2B A;  3EVQ A;  1WTX A;  1LT4 D;  2K75 A;  4LFA L;  2E76 C;  2CWA A;  1FVI A;  3W3A A;  4JBJ A;  4LAA A;  1STE A;  1EQT A;  2NUC A;  3K0X A;  2NZO A;  3VR6 A;  3Q24 A;  4A3L H;  4ME3 A;  1IBM L;  2NVT B;  1BO0 A;  5IT9 E;  1LTT D;  2VQE Q;  1EFI D;  1EU3 A;  2IX3 A;  3T4A C;  3HOY H;  4QIW E;  1Q1B A;  1N32 Q;  3E5S A;  1CUK A;  3KJP A;  5JJZ A;  4FVM A;  4A3M G;  2QA4 A;  4OEM B;  1ICW A;  1L0Y B;  4KJO A;  1EZ6 A;  1HTL D;  4J15 A;  2D0O A;  2KED A;  3KDF A;  2ZJR A;  5JEA J;  5IT9 L;  1NR4 A;  2MUY A;  2HIX A;  1V1P A;  2ASB A;  4A3J B;  4IJH A;  1FGU A;  5LMN W;  1YNJ C;  2XWB B;  4JI5 L;  2AWN A;  3SXH A;  1U4P A;  5I4D A;  3SE0 A;  2EIF A;  1VQC A;  3FVQ A;  4DKA C;  3K5M A;  1ONL A;  2GN5 A;  4ZCK A;  1S5E D;  2E75 C;  1H9M A;  3NXW A;  2EJG C;  1I6H H;  1ENF A;  1K9M C;  1HR0 L;  4BY1 B;  4DV2 Q; 
#chains in the Genus database with same CATH homology
 2K33 A;  2LFN A;  3RD4 A;  5C5M A;  3A54 A;  1F9Q A;  4CJ0 B;  1CQV A;  4U67 3;  4PMW A;  4B9W A;  5EGT A;  5KNC A;  5J22 A;  2K5Q A;  1ML0 D;  1STY A;  2YU9 B;  2JXM B;  2B2U C;  1B1Z A;  4OGQ C;  3IL8 A;  5C4J B;  2AQ3 B;  3NQI A;  3A56 A;  3KUP A;  4DF7 A;  1FNV A;  4CKC A;  1TR5 A;  4E6I A;  2IL8 A;  3I73 A;  2MPM A;  2G9D A;  5JEA G;  3WOE A;  2WV6 D;  4DAP A;  1UEA B;  4DGZ A;  4IN3 A;  1O80 A;  3GD7 A;  1JWS D;  4J6H A;  5E4X A;  2KHS A;  3NTK A;  3NSW A;  3I90 A;  2A6E C;  2K7V A;  1HCZ A;  2DY8 A;  1R9T B;  1LTG D;  2J0T D;  4IFD H;  4MHE A;  5KYI A;  1XX8 A;  4BWG B;  5IGE A;  1KTK A;  3HRZ C;  3TZU A;  2IPK D;  4G7H C;  2A73 B;  4X3K A;  4DK0 A;  1SE4 A;  4FO2 A;  4XXE A;  3M85 A;  1CA5 A;  2OXP A;  2F0W A;  1QOH A;  1H9K A;  5C5L A;  1SYC A;  4P2C B;  4ABN A;  4C2M B;  3PUY A;  1HQM C;  1PRT D;  3VA5 A;  4FXK C;  4G7O C;  1QCB D;  1X32 A;  4I65 A;  5ISR A;  2VNU D;  1STB A;  3D8G A;  3OMC A;  1A3V A;  1DD2 A;  1C8C A;  1Y1V B;  1TY2 A;  3S14 B;  1SYE A;  2SEB D;  3M3Y B;  4FF2 A;  1J9O A;  4KV6 A;  1VF7 A;  2FFK B;  3L7Z C;  1ZKO A;  2HUG A;  1PZI D;  4DXF A;  3MC0 B;  3H09 A;  1ET6 A;  2CQA A;  2SOB A;  1D1I A;  5CV6 A;  3KLR A;  2PMZ B;  3R2T A;  4NKL A;  2EDG A;  3H91 A;  1SFO B;  3KLS A;  1GJX A;  1CI3 M;  3RZD B;  4DFA A;  1CM9 A;  1IW7 D;  2K6A A;  1D1K A;  1HXY D;  2IW3 A;  5D3D A;  4H44 C;  2JA7 B;  3IAY A;  2VB2 X;  4A3I B;  2B2Y C;  5EPK A;  1Z7T A;  1WD0 A;  4AYB B;  5KIX A;  1TII D;  1VMC A;  1SYF A;  2BOS A;  5CV4 A;  5EBD A;  2RKS A;  2A69 D;  2K05 A;  3GTK B;  4HAE A;  1O7Y A;  2K01 A;  4PMC A;  4Q5V A;  5M5W B;  4A3D B;  2F0V A;  3VR3 A;  4KD3 A;  3RMH A;  1B53 A;  3T13 A;  5M3F B;  1SMY C;  4QMG A;  1VDZ A;  2F4I A;  3FKI B;  2JP1 A;  1LTB D;  1MGS A;  3CQZ B;  3NE5 B;  5J1Z A;  2CW0 D;  2EYF A;  2NN6 G;  3N6R A;  3TP5 A;  1DOM A;  2HDM A;  2Y0S B;  3PMF A;  4RCN A;  3PIP 3;  2JA6 B;  2RDH A;  5EKL A;  3PO3 B;  4XYO A;  1TT2 A;  2WII B;  2ZXP A;  4IUN A;  5EJW A;  3DWQ A;  1XWE A;  5CGK A;  5KYL A;  4CKB A;  1DCZ A;  4H0L C;  4QUF A;  2BE5 C;  2F3W A;  1M8A A;  3U9O A;  3N52 A;  3ONA B;  5TSS A;  1SJE D;  5I9O A;  4XYQ A;  2FHT A;  1ZEQ X;  1B9N A;  4ZKB B;  3HGB A;  5JOB A;  1PFN A;  5IGC A;  2L0C A;  3LX0 A;  1JE4 A;  2B8G A;  1W6K A;  3VYS A;  1M4V A;  4XQQ A;  3KBX A;  4FYD A;  4I7Z C;  1V1P B;  5FKA C;  4O42 A;  1DYQ A;  1XTC D;  3RZO B;  3D6C A;  2A68 C;  3K59 A;  3J81 E;  1KAA A;  2ICE C;  1BCP B;  2AWO A;  1PDQ A;  1GUS A;  1JC7 A;  1BCP C;  3CRK C;  5LL6 S;  2IX0 A;  1GHJ A;  3AU7 A;  4ZQ3 A;  5BN5 A;  4K5W A;  3J81 L;  4EGV A;  4A3E B;  5CV7 A;  3ND8 A;  3NBH A;  1D5M C;  2MP1 A;  3D4D A;  3GTM B;  3A8I E;  2F3V A;  3PO2 B;  4L63 B;  1F77 A;  5G3L D;  1STH A;  4C3I B;  3C3L A;  4IFD G;  5DM7 3;  3OOC A;  3NHH A;  4DAY A;  1B4O A;  3MZ5 A;  2F0G A;  1IYU A;  3SK5 A;  1G6Z A;  1JB3 A;  2DNE A;  4OL7 A;  1S5B D;  4IUU A;  1HFN A;  3T16 A;  3TZD A;  2SNS A;  2K32 A;  1SNO A;  2MGS A;  4WFN 3;  5M9O A;  2F0H A;  1GUW A;  1PFB A;  2XWJ B;  1TKW B;  3VA7 A;  4HED A;  1BCP F;  4ZUJ A;  4BA2 I;  2SNM A;  1SND A;  1KDC A;  5ELB A;  2KQ3 A;  2QKI C;  4DA2 A;  2JSO A;  4QB4 A;  2RQX A;  3WDN A;  3DEP A;  5C0X H;  1CHQ D;  2RDF A;  3A7A B;  2IX1 A;  1PLF A;  4CGY B;  2IT1 A;  1Y8N B;  2PQE A;  2XVS A;  5AFW A;  2NWG A;  1DZ1 A;  1B3A A;  3K58 A;  5BN3 A;  1SNC A;  1JWM D;  1QG7 A;  5K5P A;  3BYT B;  2LKV A;  4KN7 C;  1HHV A;  5FO8 B;  2KOL A;  1SYB A;  3IKJ A;  3BDO A;  2M9V A;  4IUQ A;  4K5X A;  2OF1 A;  3TDQ A;  3JAM L;  3NTI A;  2ZXO A;  4RGM A;  3OW7 A;  4KD4 A;  1K83 B;  3T56 B;  3VR4 A;  1CK1 A;  1D5Z C;  4V19 0;  2F0M A;  1BBX C;  2L9H A;  1V43 A;  5DM6 3;  2PZT A;  4BBR B;  2K5D A;  2EY5 A;  3OWE B;  1TWA B;  2B2W A;  2IWH A;  2JA5 B;  2NTT A;  4A3K B;  1NCV A;  4IUV A;  2XSC A;  1RCV D;  4JK1 C;  2WP8 J;  1F2M A;  1F2Y A;  5A2Q E;  2I07 B;  4ZRZ A;  1AZP A;  4BY7 B;  5C44 B;  4IUP A;  2X6L A;  4IAL A;  1EWC A;  5D65 A;  2F0K A;  2B2T A;  2NN6 I;  1GUN A;  5ELF A;  1PZK D;  2KEC A;  4XT1 B;  2R61 A;  5IGF A;  1GXD C;  1YNJ D;  1BF4 A;  2A6H C;  5A2Q L;  4KKU A;  1Q1E A;  1RTO A;  2K28 A;  2RVL A;  3K7A B;  3IFT A;  5M5X B;  1LTI D;  4J8Q A;  2VXW A;  5IOC A;  4NP5 A;  2TSS A;  3CHB D;  2Z1C A;  3T51 B;  1CA6 A;  4HSV A;  2R93 B;  3MHB A;  2PNR C;  4KY5 A;  5CC4 A;  2XRS D;  1BDO A;  2F0N A;  2DN8 A;  3P7J A;  1PYW D;  1C4Q A;  1RD9 D;  1SNP A;  5I9P A;  3GV3 A;  4FXG C;  5IGD A;  4F7X A;  5JVH 3;  4M8A A;  1GUG A;  3NP8 A;  4OO1 H;  2PW7 A;  5DAU A;  1JOR A;  2L55 A;  3V2T A;  1FNU A;  3D4R A;  5JPN C;  2A6E D;  2AUK A;  1UNS A;  4OIJ A;  1U4L A;  2F0U A;  3D6W A;  1ILP A;  1SJH D;  1A3U A;  3MXN A;  2PZW A;  1K8M A;  2ID0 A;  4KHZ A;  2XIW A;  2B2V A;  4EQN A;  4FNF A;  1TY0 A;  2TMP A;  4K8I A;  4FF3 A;  3S16 B;  1PFM A;  2WIN B;  1OXU A;  2EPB A;  2QDB A;  2BDO A;  5FO7 B;  1AZQ A;  1PTO B;  4GZY C;  1SSO A;  4IFD I;  4BBS B;  5CV9 A;  1PTO C;  1JQY D;  1HQR D;  3E0J A;  1EL0 A;  3MXG A;  5CMD A;  3GO5 A;  1ENA A;  1T5X D;  2DY7 A;  4X3S A;  2L12 A;  1TS5 A;  4HSP A;  1SYG A;  5JPM C;  1IHZ A;  1Q8I A;  4HMJ A;  1NSN S;  2PW5 A;  1X3P A;  3TN2 A;  3G7L A;  1WTP A;  4CHT B;  1V8Q A;  5C4X B;  3ZYY X;  5HGT A;  3BVG A;  2ZXR A;  1D5X C;  2LMC B;  3I91 A;  2BDN A;  4UDU C;  1PTO F;  3SK4 A;  3I4N B;  1RTN A;  3M7G A;  3R93 A;  3ITP A;  1O7L A;  1V1O A;  2A5H A;  5LHY 1;  3G6J B;  1E0B A;  4CBV A;  3SVM A;  1JR0 D;  5C0X G;  1PTO H;  5D14 A;  2NVY B;  1TVX A;  1I6V C;  3K5O A;  3ERQ A;  5KRU A;  1O7Z A;  1KLU D;  5CBE E;  2F0L A;  2JYO A;  5IOD A;  2VUM B;  1MI2 A;  5M3M B;  5K36 H;  3UI2 A;  1MSG A;  4C3J G;  4C3I G;  1LT3 D;  5CV5 A;  5F2D A;  1EYD A;  1A6X A;  5KNB A;  2R6G A;  5COY A;  3L3O C;  5I6W A;  4A3M B;  4KTA A;  1WTW A;  1OXS C;  4DK1 A;  2RA4 A;  3SHL A;  4KKT A;  1CFM A;  1HA6 A;  4RHR A;  1WTR A;  1SMY D;  2LY7 A;  3V05 A;  3QJY A;  2NVX B;  1LO5 D;  1I4X A;  3SEB A;  1JOK A;  1CZW A;  1F2L A;  4LJZ C;  3FPP A;  2QIL A;  1K8O A;  4HTH A;  2JE6 I;  4K2L A;  4KJN A;  4TKO B;  1TQO A;  1F9P A;  5E4W C;  1F2Z A;  4HN7 A;  2IJ0 A;  1VF5 C;  3ERO A;  2BE5 D;  1QIL A;  4RGN A;  3GTP B;  1W6J A;  1IKM A;  1PXU A;  3IFD A;  2JEA I;  2RSN A;  3HKZ B;  1LAB A;  1JOO A;  1GUT A;  2EJF C;  3CU7 A;  3DXJ C;  3HOX B;  2Q8I B;  3SK8 A;  4M1U B;  3I4L A;  4DU9 A;  3DWA A;  4XDX A;  3R2I A;  2B2W C;  4FP5 D;  5ELE A;  2Z8L A;  3PIO 3;  2EXZ A;  3I8Z A;  2LS0 1;  2L1B A;  3QO2 A;  1IKL A;  5T1I A;  4C3H B;  1Z47 A;  1B44 D;  4DNT B;  1SAP A;  2XN9 C;  4PNY A;  2B2T C;  2EYJ A;  4IFD J;  2A68 D;  3FDT A;  1KLG D;  4K5V A;  4KI0 A;  1WTQ A;  3DHQ A;  3DUZ A;  2NZ1 D;  3BZD B;  4OO1 G;  3KK7 A;  3LWU A;  1R4Q B;  1WTO A;  2EYO A;  3GQB A;  1BCP D;  2EYM A;  3MWY W;  1ZXT A;  4R8I A;  1I4H A;  2PZU A;  4CJ1 B;  3PUZ A;  2F0E A;  1ENC A;  1AP0 A;  1BUV T;  3QG1 A;  2EVB A;  4TQU S;  3HEJ A;  1E2Z A;  4FF1 A;  3GTL B;  2WAQ B;  1JWU D;  3CRL C;  1B50 A;  4TRD A;  4RHS A;  1PMR A;  1TS2 A;  1CHP D;  1LV9 A;  1G2S A;  1BQQ T;  3SDZ A;  2E74 C;  3KLS X;  4QCL A;  2KCC A;  4WRD A;  4H13 C;  3S9W A;  1LTR D;  2V4D A;  1S5D D;  3PV0 A;  1GHK A;  3M4Y A;  2H1E A;  4RFB A;  1WTV A;  5KND A;  2ICI A;  3K57 A;  2QCP X;  4WOR A;  3BDL A;  4NMZ A;  4FXD A;  1FR3 A;  3P1H A;  1CQF A;  4IUR A;  1S4Z A;  5NUC A;  5C3E B;  3QOJ A;  3KF8 A;  1SE3 A;  4G4K A;  4F8M A;  1ESF A;  1A3T A;  2GA4 B;  3Q22 A;  1EYC A;  2B2V C;  4CJ2 C;  1QNK A;  3C2P A;  5C0X I;  2M00 A;  2NB0 A;  3EA6 A;  3E6Z X;  4R8N A;  3RUZ A;  2HCC A;  2D9U A;  5KEE A;  3AB9 A;  3LWE A;  4J1M A;  1KNE A;  1U4M A;  5FOB B;  4ZAI A;  1WCM B;  4XQJ A;  4QIW B;  3TP8 A;  4QUC A;  1SXT A;  4K6D A;  4DAV A;  5LL6 X;  4H7B A;  5C4Z A;  3SK6 A;  3FMC A;  3DM1 A;  3TSS A;  1EZ8 A;  1AN8 A;  1I4Q A;  4MN3 A;  4KN4 C;  4LK1 C;  4XT3 B;  5IGB A;  1I3Q B;  3F2U A;  3TP7 A;  4BA1 I;  3FEW X;  2X6G A;  5K36 G;  2QF7 A;  1EY5 A;  1EYA A;  1HA5 A;  1O78 A;  4G7Z C;  4K2K A;  3HOY B;  4KHV A;  3X3M A;  2D5D A;  3MXU A;  4OHJ A;  4ZK9 B;  2D2C C;  1EY9 A;  3VR5 A;  5C3X A;  2F0O A;  2DNC A;  3QWN A;  4A3F B;  1L0X B;  2K04 A;  1R4P B;  3QOL A;  3C1F A;  1A2T A;  2A6H D;  1EEF D;  5EPJ A;  4KY6 A;  2CVR A;  2FMM A;  1G91 A;  3FRP B;  1EY8 A;  2F0I A;  4HR7 B;  4EQO A;  3BS1 A;  1I4P A;  1I6H B;  1UAP A;  1EY6 A;  1U9R A;  2F0Q A;  1YNN C;  1ILQ A;  1AEX A;  4K6L A;  4RCO A;  1BNZ A;  2SDF A;  5D3I B;  4RGT A;  4FF4 A;  1EY0 A;  2NN6 H;  1OXV A;  3EJI A;  3HOU B;  2F1M A;  1XYI A;  3SR1 A;  1ZYR C;  3PUW A;  4ILW A;  4ZLT F;  1FNW A;  1HPC A;  3HZX A;  1X3Q A;  1Z6H A;  3GV6 A;  5E1F A;  3PUX A;  3A55 A;  1NAP A;  1E2V A;  3P75 A;  2KEE A;  5A35 A;  4RA8 A;  1KAB A;  1I4G A;  4A93 B;  1AW7 A;  3NPP A;  4OO1 I;  4EQP A;  3MFY A;  1F9R A;  1SNQ A;  1DOK A;  1QNU A;  3V96 A;  2A74 C;  1F9S A;  4UAI A;  3I3C A;  3GP7 A;  3H0G B;  1CZG A;  2R3Z A;  2OEO A;  3HG9 A;  1Y8O B;  4OIK A;  1EEI D;  2F0S A;  3VYR A;  5I6Y A;  3D31 A;  3GTJ B;  3P20 A;  3BYY B;  3TP6 A;  1OXX K;  2MHV A;  1EY7 A;  3EQL C;  1PTO D;  3K6O A;  2KVM A;  1H9J A;  2E2D C;  3LNN A;  3OHX C;  3HOW B;  1QE6 A;  2EE1 A;  1Y8P B;  3R3O A;  4RKB A;  3CKI B;  5C0X J;  3URY A;  3FPU B;  1SBB B;  3M7N A;  4IZ8 A;  1LT5 D;  2AUJ D;  2NBF A;  2WKD A;  3MVV A;  4DNR B;  3A8J E;  2F03 A;  1BR9 A;  2K03 A;  3NBI A;  1LT6 D;  4HCS A;  1RJT A;  2KUM A;  4C3H G;  2Q8T A;  2F0D A;  3J7A V;  3NUC A;  1VCI A;  3OMG A;  4KKS A;  1B2T A;  2KA7 A;  4N9P A;  3QB3 A;  3BVM A;  3OIP A;  1TWG B;  2L11 A;  1TWC B;  4DXG A;  2D62 A;  3A7L A;  5EBC A;  3ND9 A;  2WB1 B;  2PCF B;  4YIJ A;  3MAQ A;  4XIG S;  3I4M B;  3O13 A;  2B8F A;  3M4O B;  1IYV A;  5IIF A;  5ELD A;  1RF2 D;  2NTS A;  2QEJ C;  5BN4 A;  2J4X A;  4NDX A;  3NWT A;  5M5Y B;  2X69 A;  1FYC A;  2Q8R E;  2N88 A;  1QJO A;  2EY2 A;  5FO9 B;  1GOZ A;  2N55 A;  2EYL A;  1A15 A;  2CHB D;  2O5J C;  2E2H B;  1UUP A;  5C4H A;  4DN4 M;  4XQN A;  1PRT B;  3MXP A;  1Q12 A;  1TWH B;  3S2D B;  1OO9 B;  3X3N A;  1H9S A;  1LTS D;  1PRT C;  3RLF A;  2WKC A;  1DM0 B;  4K8J A;  3J7Y W;  3C46 A;  2OT2 A;  5T1G A;  1FD7 D;  2EOT A;  2KCN A;  1OXT A;  3NTH A;  2KJX A;  5C6A A;  1HRJ A;  4ID6 A;  1I4R A;  4TSS A;  3S1M B;  4L8J A;  1BOS A;  4RH6 A;  1Y1W B;  3W2D A;  3BDC A;  1Y69 U;  2K5W A;  4Z9C B;  2AQ2 B;  3MFG A;  2BCO A;  2EY1 A;  3OSO A;  1TU2 B;  3DMU A;  4MIU A;  2EZV A;  3GTQ B;  3GTG B;  3EFX D;  4PV1 C;  1S5F D;  1GUO A;  1II3 A;  1SDF A;  4JBW A;  1PRT F;  1SE2 A;  4ZYS A;  3D4W A;  4KK7 A;  1XXG A;  1KDA A;  3I70 A;  3Q0A A;  1LAC A;  5COR A;  4KY7 A;  3K5N A;  1EIG A;  1Q90 A;  3WOF A;  3Q6S A;  3H3V C;  1IW7 C;  2RSO A;  5C3W A;  3A8K E;  4Y7N B;  1NUC A;  1KDB A;  1S5C D;  2RDG A;  4CKE A;  3C1E A;  3J7A F;  3NWS A;  4S3S A;  2B63 B;  2C9O A;  4V0B A;  1EIH A;  3PUV A;  2B2U A;  3S1R B;  2F0J A;  4ULL A;  1HUN A;  2PPB C;  2A69 C;  1FGB D;  2R7Z B;  2RBM A;  1JIC A;  2R92 B;  3Q23 A;  5CYU A;  3AMU A;  2M2L A;  1DJR D;  4O1N A;  1C48 A;  3TME A;  1D6E C;  2FMC A;  4C1N I;  1ROD A;  2CW0 C;  1NR2 A;  1TS3 A;  2E2I B;  5I2Y A;  1U4R A;  1EQV A;  5FLX E;  1G29 1;  1G8Z D;  2O5I C;  2HCI A;  1HFG A;  1SYD A;  2G9H D;  1CTM A;  4ZKC B;  3H94 A;  1CT1 D;  2F0T A;  2L4N A;  3TBI B;  2FJ2 A;  3OWF A;  5FLX L;  1RDP D;  2WAC A;  1I50 B;  2ENB A;  2FIN B;  1DON A;  4BS9 A;  2MJ8 A;  3GTO B;  1AFP A;  2NYZ D;  1SEB D;  3S15 B;  1WD1 A;  1ESR A;  1PZJ D;  2EJM A;  5FK9 C;  2EY6 A;  2J7Z A;  4K14 A;  2JA8 B;  3OPO A;  1HTP A;  5JEA H;  1STA A;  1VMP A;  4X3T A;  3NK9 A;  2B39 A;  3DWP A;  4U68 A;  1JCK B;  2E2J B;  5I2X A;  5JAV A;  4WJW A;  4ME5 A;  4Q0F A;  1E2W A;  3HS0 C;  1IL8 A;  3VYT A;  5ELC A;  1DOL A;  2PYK A;  3MA2 B;  2EYP A;  1HUM A;  3S1Q B;  2NVQ B;  1J8I A;  2JEB I;  2XNA C;  4RGO S;  3HP3 A;  1B9M A;  2Z4H A;  3KBG A;  1JOQ A;  3BVZ A;  4A3G B;  5EPL A;  2AQ1 B;  4C3J B;  4RAU C;  1EU4 A;  4X3U A;  5E3F A;  3HOV B;  2Z4I A;  2BA1 A;  4R9W A;  3HOZ B;  1LLR D;  1T5E A;  2YYZ A;  4N9T A;  5J39 A;  4B08 A;  1LTA D;  3S2H B;  1Q3L A;  4IUT A;  4PMB A;  1MD2 D;  4HCE A;  3K5L A;  1ET9 A;  3MTS A;  4A3B B;  3OIQ A;  3U9S A;  1H9R A;  3L9A X;  4RKL A;  2B2Y A;  5EKI A;  1MBY A;  5EQ0 A;  1DXM A;  1TWF B;  3I72 A;  2XRQ D;  1KNA A;  1QWY A;  4F88 A;  2BA0 A;  5KGU A;  4IQZ A;  4XTC S;  4C56 C;  3BG3 A;  1G2T A;  4EVO A;  3QIA A;  1EOT A;  3JAM E;  3K0Y A;  4C1N K;  5DEH A;  2C5C A;  3D3R A;  4ODG A;  3J80 E;  2L5T A;  1SNM A;  2O2L D;  5G3L F;  4HMI A;  2F0P A;  2HQE A;  4L6T B;  4RWS C;  5HUR A;  5IGG A;  2ZT9 C;  2HDL A;  1WVL A;  1RKN A;  1EY4 A;  4QF4 A;  4NW2 A;  3T53 B;  4PQX A;  2VB3 X;  5DNF A;  1YNN D;  1TS4 A;  5CR3 A;  1STG A;  3J80 L;  1STN A;  2F0F A;  3MEH A;  5EKK A;  3DEO A;  5CBA E;  2H4O A;  2K1B A;  3NQT A;  4ZUI A;  3S1N B;  1H9S B;  2O4X A;  3VR2 A;  4KMU C;  1EWH A;  1MSH A;  5CV8 A;  3VYU A;  1QB5 D;  4F87 A;  1BXT A;  2I46 A;  4G57 A;  4LMQ D;  2PO4 A;  4B9X A;  1ZYR D;  2EYH A;  3R8B A;  5JVG 3;  3S17 B;  1RHP A;  1A2U A;  3H6M A;  1D2B A;  3EVQ A;  1WTX A;  1LT4 D;  2E76 C;  3W3A A;  4LAA A;  1STE A;  1EQT A;  2NUC A;  3Q24 A;  3VR6 A;  2NVT B;  1BO0 A;  5IT9 E;  1LTT D;  1EFI D;  1EU3 A;  2IX3 A;  3T4A C;  1Q1B A;  3E5S A;  5JJZ A;  4FVM A;  1ICW A;  1L0Y B;  4KJO A;  1EZ6 A;  1HTL D;  2KED A;  5JEA J;  5IT9 L;  1NR4 A;  2MUY A;  1V1P A;  4A3J B;  1YNJ C;  2XWB B;  3SXH A;  2AWN A;  1U4P A;  5I4D A;  3SE0 A;  3FVQ A;  3K5M A;  1ONL A;  1S5E D;  2E75 C;  1H9M A;  3NXW A;  2EJG C;  1ENF A;  4BY1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...