4OX9Q

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9Q00
4DR5Q 2KCTA 2ZJRA 3G48A 4HJ8A 1IXRA 1IZ6A 4L5SA 2CKZB 3BZCA 1N8RC 2D0OA 3S1QH 1XPRA 1XNRQ 3S2HH 2XGTA 1VQKA 1Q8KA 3PIPA 3KJPA 2ID0A 4JI2Q 3KDFB 2GVBA 4LF6L 3KDFA 4LF5L 2JA9A 1GM5A 4ALPA 2NZHA 4HIKA 3PUXA 1PYBA 1CSPA 4DR1L 2VUMH 3J80i 3I56A 1JMCA 5DLQE 1X3FA 4DK6C 4JI6Q 2NZOA 3PO2H 2JA5G 4IFDI 1PVOA 4A3LH 3A5UA 1A63A 1G6PA 3PSIA 1N34Q 2JEAI 1YI2A 4DR5L 5M3MH 1VQ9A 3HOZH 4OX9Q 2NN6I 1SLJA 1WYDA 1KQSA 5IT9c 3JAMi 2NVTH 3U4ZA 1PH6A 3I7FA 4X66Q 3T1HL 3ZJYC 4C2MH 2F52A 4LWCA 4J15A 1XTDA 5IE8A 2CFMA 1HNXQ 5IWAQ 2R92H 1W3SA 4A3GG 3NBHB 4DR4Q 3TS0A 1VQ5A 4EX5A 4DV7Q 1WI5A 1N34L 2QEXA 1QVGA 4POGA 3UE1A 4LFBQ 4JYAQ 1KXLA 3ULPA 4JI6L 1E24A 3CCQA 4ME3A 2Q2HA 1LTLA 1Y1VH 4OWXB 1CSQA 3G4SA 4OONA 2VNUD 3CP0A 2HIXA 4A3EG 1VQPA 2IX1A 4GS3A 3OTOQ 4B3RL 4DV7L 2DUDA 2UXBQ 1Q46A 4H02A 5BR8L 4Y7NH 1M90C 2BA0A 5IP7G 5FLMH 5C0XJ 2ASBA 2PQAA 2YTXA 1N32L 3I4MG 3PUWA 5IWAL 3M7NA 1QVCA 1VQOA 2EIFA 4IOAA 1A0IA 3F2DA 2UXCQ 4B3TL 3K7AH 3KF8B 1MJEA 1NY4A 2JA6H 4DR6L 2XTIA 1Q7YC 1IBLL 1HR0Q 1L1OA 4GOPA 4JI5L 1L1OB 4O2DA 4HIDA 1S40A 1HNZQ 1AE2A 4FDBA 5GAEC 2HHHQ 1O7IA 4A3DH 5C0XG 2AMCB 1NBWA 2Y0SE 1QVFA 1VQ4A 3HOUG 4P72A 5IYCG 1CKMA 1Z47A 2WAQE 1HJPA 3UE0A 4NXNQ 1XMOQ 1JT8A 2B63G 1E1TA 1UE7A 2JEBI 4QY7A 4LFCL 2VQFL 3S15H 4MNOA 3J81i 5LMUQ 1VQAA 2KHJA 1KC8C 1AH9A 1GKHA 1YIJA 1OXSC 4JI1Q 3CPFA 4DNIA 3E0EA 4DK3C 1I5FA 2ZM6Q 2ES2A 3MXNB 4IFDG 4WJ3M 2CCZA 3I4NH 2B3GA 4P74A 1EIFA 1OXXK 3AQQA 4DR4L 2L15A 1ASYA 1VQJA 4JI0Q 1IBML 1VQIA 2A19A 4GOPB 2HHHL 3BU2A 1BVSA 1PH1A 1Q12A 5IP9G 1Y14B 3GTMH 4APVA 2HT1A 4A3IG 1E3PA 5FJ8G 1K0RA 1IBKL 1MIUA 1PFSA 4UP8A 3TQYA 1HNWL 4DV6L 4RG1A 1K73C 4BY1G 5HGQA 3NEMA 1HR0W 1X3EA 1KHIA 4GN4B 5IP7H 5FLMG 3U50C 2OTLA 2CWPA 4GNXC 3A0JA 2UU9L 1J6QA 2FXQA 4BY7H 1E1OA 4UP7A 2IHEA 4X66L 3T1HQ 4JI7L 4R4CA 4DR3L 2WB1G 5J3BA 1JJGA 3M4OH 1E7ZA 2JA7H 1C7YA 1OTCA 5M5WH 4YCUA 4BA2I 2R7FA 3F2CA 2ALYB 4LFAQ 4DR2L 3RZOH 4IPHA 4K0KL 1K83H 4JCVE 1HZAA 3GTQH 4JG2A 2VUMG 1OXUA 2IX0A 4A4IA 3I55A 1XJVA 4X65L 4A93G 4IPCA 1A8VA 3DM3A 5GAHC 3CCRA 4L5TA 3UDIA 4JI7Q 4JI1L 4LF5Q 4DV0Q 2UU9Q 4LNQA 5LMUL 5IYBH 1MJCA 3CW2C 3S24A 4LUOA 3W5OA 1YITA 5C4XG 3CAMA 2D0PA 4HJ5A 2AKWB 3ER0A 2UXDL 1RIPA 3A5ZB 4BBSG 1EWIA 3F8TA 4A3FH 2ZTEA 2R92G 2GVAA 4A3KG 1N33L 3CXCA 4GKJL 2UXBL 2GN5A 2E8GA 5AJ3L 5C44G 1I94Q 2OQ0A 1SE8A 1UE5A 4AH6A 1HR0L 2MFIA 4PG3A 4XTCS 4A3GH 3CF5A 3RLFA 3ICEA 4DV2L 2JQOA 4MZ9A 5IY0A 1D7QA 2I5HA 1XNRL 4GKKQ 2IHFA 3S1RH 1Y1WG 1VQ8A 4DV1L 3KJOA 1E22A 4DV5Q 3VDYA 2NN6G 4GNXB 4K0KQ 4X64L 2WAQG 4OWWB 2KBNA 1V1QA 3STBC 4DV3Q 4OXPA 4LUVA 5LMNQ 1X55A 1X9NA 5AJ3Q 2UUCQ 4LFCQ 3HOYG 4LUZA 1YJWA 4GKJQ 2K52A 3U58A 4B3TQ 4JYAL 4BY7G 3BJUA 4YCWA 5C3EH 4DV4Q 1PH8A 4YWKA 4LF7Q 2R93H 2A1AA 1PV4A 2JA6G 1FL0A 4P75A 1Q1EA 3UDGA 1OXTA 3HFZB 1NJIC 1HNZL 2UUAL 1KRSA 4OWTB 3LGJA 2VY3A 3GTPH 4JBJA 3UDFA 2YV5A 1NTGA 2UUCL 3SGIA 5IYCH 4DUYL 2UUBL 2N78A 5LMNL 3I2ZA 4A3MG 2K4KA 3DLLA 2UXCL 1G51A 1K3RA 2K5HA 3HOZG 3TS2A 3AFQA 1CKOA 2D62A 4DAYB 3IRBA 5GQOA 4DPGA 1SMXA 4JV5Q 3TREA 3TEHB 4LF4L 1BKBA 4LF8L 1JB7A 4WJ4A 3TRZA 2F3IA 1VQEA 1CKNA 3OTOL 2KCMA 3GTJH 4HJ9A 2QA4A 2OCEA 4KHZA 4DR3Q 1K8AC 2K75A 1VQ7A 2K5NA 1EFWA 3RZDH 1I94L 4TVAB 3RR5A 4A3JG 4OX9L 4LF9Q 1C9OA 4UPAA 3J80c 4A3CG 4YWLA 2MO1A 4DV4L 2I0QA 3H0GH 1Q1BA 3M4PA 1Y1WH 1RL2A 5IYDH 1DGSA 4BY1H 1QUQB 4DV0L 1VQGA 1KAWA 4DV3L 1IBMQ 1QUQA 1IBLQ 4JI8Q 3HKZE 3D31A 4IPGA 4JC0A 2OQKA 4BXXG 2Z6KA 1KL9A 3RN2A 1B70B 2H5XA 3PUZA 1YBYA 1YHBA 4XIGS 1HZBA 3U4VA 1IYJB 2KHIA 2ZM6L 1EYGA 1SN8A 1UE6A 1V9PA 4POFA 4A3DG 2N8NA 5BR8Q 3KF6B 1R9TH 4B3RQ 4BA1I 2VQFQ 4HJ7A 5GAGC 4DUZL 4B3SQ 1X56A 3Q8DA 1QZGA 3KYHC 4JBWA 1P16A 1Q81C 1YVCA 2MO0A 1J5EL 3S1MH 4JOIC 2JK8A 2Q2IA 4JI8L 3PO3H 4R1JA 3AYHB 3K81C 2AHOB 4JI5Q 4UY8C 4DR7Q 1YHAA 4BBSH 1D8LA 4QGUA 3CCVA 2B29A 4LW1A 4DR6Q 1VQCA 5C4XH 1EUJA 1X54A 4BBRH 4GN5A 3FKIG 3B6YA 3HOXH 1PH7A 1K8GA 1HH2P 1KIXA 4NB3A 1PH4A 3CCEA 4X65Q 1WCMH 2OWOA 4R4TA 4DR7L 1LM0A 3PUVA 1YJ9A 2F4VQ 4PZ6A 5C44H 2JA8H 4LF9L 3STBD 1G291 4B3MQ 1OXVA 1PH5A 1IBKQ 4A3IH 5FJ8H 3EIVA 4IJLA 3FP9A 4DUYQ 3T1YL 2BH2A 4OO1G 1KRTA 2K5VA 1PH2A 3H0GG 2VS1A 2IT1A 5E7NA 1VQMA 4NPSA 1LYLA 3S14H 2UUAQ 4GNXA 1TWHH 4RMFA 2VZAA 5IYDG 4YHHL 2WFWA 4C3HH 5JEAG 5M3FG 2F4VL 2BH8A 1W2BA 4JOIA 5GADC 3HOVH 5K36G 3S1NH 2R7ZG 3F1ZA 1Q86C 2I5LX 2MNAA 1BBWA 1L1OC 4DV2Q 2DGYA 1IL2A 1TXYA 2HQLA 4NXMQ 2JA7G 3HOYH 2R93G 1YJNA 4PZ7A 4IPDA 1P8LA 3CPWA 1EQRA 1Q82C 5C3EG 2A8VA 3GTKH 3GTGH 3AFPA 3NENA 1LUZA 4IO9A 1FJGQ 1N33Q 3GO5A 3CMAA 4DAMA 3GDEA 1U5KA 1XMOL 1T9HA 5JEAJ 2K50A 5EAYA 4A93H 1NMFA 1VCIA 2I5MX 2N3SA 4A3MH 3PCOB 1C0AA 1VQNA 1XPUA 3A74A 3K7UC 1L0WA 1FJGL 3HOWG 5HY6A 1MKHA 2Q2TA 1TWGH 1GVPA 1M1KC 4X62Q 1XPOA 2PMZE 5FLXc 3T1YQ 3AEVA 3GD7A 3RNUA 1GO3E 3H15A 3S17H 2IY5B 5C4JH 4GKKL 3PF5A 2NVYH 2OTJA 5JJLA 3RLOA 3M4QA 1JJCB 4AYBE 4JI3L 1VQDA 2AWOA 4JV5L 1HNXL 1HZCA 1KD1C 3KFUA 4GLVB 4A3JH 3PIOA 3G6EA 1FGUA 1UWVA 2R6GA 2YTVA 3BZKA 1ASZA 1BBUA 2LSSA 1B7YB 4P71A 1EQQA 4IFDJ 2WP8J 4GOPC 1U0LA 4L5RC 1B8AA 3JAMc 2YYZA 4X6AH 2PI2A 4MTNA 2YTYA 4DV6Q 1QZHA 4Y52H 4KI0A 4QJFA 5ELNA 4X64Q 4YHHQ 2Q2UA 3CC4A 4KHPQ 3HKZG 3I4OA 3CCMA 1YEZA 3H3VI 3I4MH 1I3QH 3KOJA 3ULJA 3F2BA 2Z6KC 4QL5A 3NELA 1NE3A 1PH9A 2JJQA 2NVXH 1N36L 2R7ZH 2QGQA 4LFBL 1AE3A 4LF6Q 2HIVA 1WFQA 4YY3L 4O0AA 4KHPL 4QQBX 4JI2L 1WOCA 4LF4Q 4B3ML 3L7ZC 1SRUA 3CD6A 5GROA 3S16H 3L0OA 2PNHA 2JA5H 3W1GA 4YY3Q 4QIWE 4HIOA 1YHQA 3E9HA 4DUZQ 1K9MC 3PO2G 4A76A 2RHQB 4R4IA 3M85A 4HIMA 3PO3G 4A3LG 1VQHA 4KLKA 2B63H 1UE1A 2NVQH 4C3IH 4YWMA 2R7DA 5M3MG 3HOWH 1VQ6A 1CUKA 4NXNL 4LF7L 3FKIH 2ZJPA 1VQBA 4R4OA 2AWNA 2RF4A 4P73A 3RN5A 4BBRG 3HOXG 4JBKA 2K14A 2JA8G 4A75A 1NMGA 1Z9FA 4GLXA 2E5LL 4B3SL 4R4QA 2VQEL 4AIMA 1PH3A 2YU9H 1L2FA 1YNXA 1TWFH 3KF6A 4A3CH 3MEFA 4JI0L 2E2HH 2VW9A 4DV1Q 1XMQQ 3ERSX 1H95A 4PZ8A 2WB1E 3UDXA 4LF8Q 4IJHA 5M5XH 1Y1VG 4A3BH 2V1CC 1X6OA 2C35B 1N9WA 2EXDA 1I6HH 3CMEA 4A3EH 4DR2Q 2PQAB 3K8AA 3M9BA 3D0FA 3K0XA 2VQEQ 4BXXH 3HKSA 4AQYQ 5ELOA 4DKAC 3PV0A 2E2IH 2E5LQ 1N36Q 3L2PA 3KLWA 5M3FH 3S2DH 2ZTCA 5LMNW 3CCSA 3HOVG 2CQOA 5M5YH 3CC2A 1YZ6A 4PMWA 3WWVA 4JI4L 3EN2A 2LXJA 1FVIA 1HZ9A 1PYSB 3K80C 2PI2E 3GTLH 3PGZA 4GLAC 3ULLA 1HNWQ 2LXKA 3OYYA 5JJIA 1XNQL 3M3YH 3HOUH 2MQHA 4JI4Q 2ZTDA 3PF4A 2UUBQ 4IOCA 4UP9A 3E9IA 1A62A 1SR3A 3CCJA 2VL6A 1PA6A 2E2JH 4AYBG 2KENA 3H3VH 1CKNB 1XNQQ 3J81c 4EQ5A 4JI3Q 1GD7A 3G71A 3EBEA 1N32Q 1JJ2A 4OO1I 4LFAL 1I50H 4YCVA 5IYBG 4NXML 2RCNA 3RLNA 3PUYA 4C3JH 3J7A5 4HJAA 1WCMG 4DR1Q 1EOVA 3I4NG 2N49A 3FHWA 4A3FG 1VS0A 4X62L 5C0XI 4A3KH 2CWAA 2RHSB 3GTOH 2Y0SG 2EQSA 1EIYB 2BA1A 1X3GA 4DV5L 1SFOH 1PHJA 1V43A 5JJKA 1S72A 1J5EQ 3CCLA 4TQUS 3W1BA 5H1SE 3J81j 3CC7A 1TWCH 3OW2A 1S3OA 1XMQL 5IP9H 1JE5A 3JC66 2UXDQ 1X65A 4L5QA 2Z0SA 4JBMA 4GN3B 3CCUA 2ZJQA 1UEBA 4A3BG 1VQLA 2ATWA 1SROA 4AQYL 2JE6I 1VQFA 3CQZH 1WJJA 1TWAH 3J7ZC
chains in the Genus database with same CATH superfamily
4G7HC 4HJ8A 1IZ6A 2CKZB 3OOCA 3SK8A 5IT9E 2A6ED 2XGTA 3KDFB 2GVBA 1DZ1A 1II3A 2F3VA 4HIKA 1ONLA 1IYVA 4JI6Q 4CBVA 1PVOA 1A63A 1N34Q 4F8MA 4DR5L 5M3MH 4X3SA 2NN6I 5IGDA 2FHTA 1WYDA 3JAMi 3HOWB 2PZTA 2NVQB 1KAAA 2RSNA 4J15A 2CFMA 1R4QB 1AZQA 3VYRA 3NBIA 1QOHA 1H9MA 3VYSA 1NSNS 2R3ZA 1E24A 1LTLA 4OWXB 1B2TA 3G4SA 4OONA 5C4XB 1VQPA 1JR0D 2DUDA 1Y8OB 5EPKA 5DM63 2YTXA 5C44B 2HCCA 2IX3A 3F2DA 5C3WA 3TP5A 1IBLL 4KK7A 2Q8IB 1L1OA 1L1OB 1X3PA 1EIHA 1AE2A 1F9QA 3J80E 2A6HD 5FK9C 5EKLA 4P72A 4S3SA 1Z47A 1HQMC 5I2YA 1JT8A 2DY8A 2B63G 1E1TA 2ICEC 4RHSA 3VR4A 2CQAA 4MNOA 3J81i 1VQAA 3DUZA 2O4XA 1OXSC 1CI3M 4DU9A 1RDPD 2CCZA 1H9KA 1KTKA 1ASYA 3SK4A 1MHWC 1BVSA 3LWUA 3GP7A 3GTMH 2HT1A 3SHLA 1E3PA 4UP8A 5I9PA 2SNMA 2K32A 4DV6L 5IGBA 2R61A 5HGQA 2EOTA 3TDQA 4GN4B 3U50C 4UAIA 1SBBB 4CKCA 1J6QA 3TZUA 3T1HQ 4R4CA 2WB1G 5J3BA 1JJGA 5EKKA 2JA7H 4BA2I 3F2CA 5C5LA 4K0KL 4JCVE 3GTQH 4O42A 5L37A 2F0UA 1F9RA 1A8VA 1NCVA 4L5TA 1BCPD 1TWGB 2ZXOA 1A2UA 5FOBB 1SMYD 2F0QA 4DF7A 3S24A 2WB1B 2F0FA 4XQJA 3CAMA 4HJ5A 5C4JB 3A5ZB 3F8TA 4A3FH 1UUPA 2J4XA 4GKJL 3CXCA 3OSOA 2UXBL 5AJ3L 1E2ZA 4DK0A 3A8JE 4C1NK 5JVG3 3ICEA 1BBXC 5IY0A 2I5HA 2K1BA 1PYWD 3I72A 2IHFA 1BQQT 3VDYA 4IQZA 3MFYA 2WAQG 1ENCA 2LMCB 3RZDB 4DV3Q 5K36H 5E3FA 2K52A 3U58A 5EGTA 3BJUA 4YCWA 2PMZB 2A1AA 3HS0C 1PV4A 3E0JA 4P75A 2CH4W 1KRSA 1G2SA 5K5PA 5A2QL 3UDFA 2LY7A 5IYCH 5LMNL 3I2ZA 1D6EC 4RHRA 1UNSA 4DPGA 4EQOA 1SMXA 1HQRD 1VF5C 2FMCA 4WJ4A 1VQEA 1ET6A 3JAML 3H6MA 1K8AC 1SYBA 2K75A 2L0CA 3D6CA 2F0HA 1EFWA 3RZDH 2Y0SB 3QR8A 1FNUA 4HMJA 1C9OA 1MI2A 4UPAA 4DNTB 3S1QB 2MO1A 5M5XB 3V2TA 3H0GH 1EYCA 4QIWB 4CKBA 2N88A 1BF4A 3W2DA 1IBMQ 4JI8Q 3D31A 3HKZE 4BXXG 1C8CA 2Q8TA 3RN2A 3KBGA 2H5XA 2F4IA 2L1BA 3U4VA 1IYJB 4PV1C 1UE6A 1GUWA 1WD1A 2SOBA 5DEHA 4BA1I 4DUZL 4B3SQ 1X56A 1A2TA 2A74C 3EQLC 3SXHA 4C3IG 1CA6A 3S1MH 3NWSA 4JOIC 4R1JA 1FYCA 3AYHB 3IFDA 3K81C 4JI5Q 4DR7Q 2B29A 4RCOA 1R4PB 4HCEA 1V1OA 1GUGA 3J80L 2OWOA 1WCMH 5CBEE 3SK5A 4DR7L 2K5QA 2RDFA 1YJ9A 2DNCA 2JA8H 5C44H 1IW7D 1ENAA 4IUTA 3JAME 3DXJC 3VYTA 4IJLA 4WJWA 3PMFA 1M8AA 3HOUB 2AUJD 4GNXA 1TWHH 2WFWA 5C5MA 1STNA 4RAUC 2I5LX 2MNAA 1PDQA 5FLXL 3HOYH 1TXYA 1YJNA 4PZ7A 2ZXRA 1Q82C 2A8VA 3EVQA 4ZAIA 2OXPA 3H09A 3GTGH 3K5NA 4MN3A 2B2VA 4LAAA 1N33Q 4FYDA 3A8IE 4G7ZC 5JEAJ 4A3MH 1SDFA 2G5DA 1B4OA 1FJGL 1STEA 1MKHA 2Q2TA 5F2DA 1BO0A 3VYUA 1E2WA 4WFN3 3AEVA 3RNUA 2IY5B 2NVYB 3BS1A 5JJLA 3M4QA 1PRTD 2I46A 2RA4A 2AWOA 1HZCA 3KFUA 4LFBQ 1ZEQX 1FGUA 2LSSA 5E1FA 4C1NI 3A54A 4HCSA 4P71A 2WP8J 4L5RC 1AW7A 1ZKOA 2YYZA 2PI2A 1G6ZA 1LTRD 4MTNA 4JPBW 5JJZA 1QZHA 5ELNA 4YHHQ 2Q2UA 2B2UA 5DNFA 3HZXA 3PO2B 1SNDA 5C6AA 1V1PA 1A3TA 3ULJA 2Z6KC 2JJQA 3PQIA 4LFBL 4YY3L 4O0AA 3FMCA 3H0GB 3T53B 4QQBX 4ILWA 4LF4Q 2D2CC 1SRUA 1H9RA 5GROA 3SR1A 3U9OA 3CD6A 4YY3Q 3NTHA 4HIOA 1EEFD 3ZYYX 2MHVA 1JWSD 2HDLA 3PO2G 1HRJA 5G3LD 3PO3G 4KLKA 4A3JB 2NVTB 4CKEA 5FO8B 5M3MG 1CUKA 1GUNA 3I91A 4NXNL 3T56B 1TS4A 1PZID 2MP1A 3P7JA 1D1KA 2AWNA 3I8ZA 2RF4A 4P73A 3RN5A 2QW7A 1QILA 1NMGA 2E5LL 1M4VA 2VQEL 1JICA 3X3MA 2YU9H 2X6GA 4A3CH 1TWFH 3PO3B 1PFMA 3SDZA 1PLFA 1D5ZC 4C3HG 4BXXH 4AQYQ 4E6IA 2MUYA 2E2IH 2NUCA 5LMNW 1SNMA 5M5YH 4PMWA 2PPBC 3EN2A 1FVIA 3K80C 5DAUA 3GTLH 3GTQB 3ULLA 2LXKA 3I4NB 5CV4A 4DFAA 2UUBQ 3PF4A 4KD4A 4UP9A 3E9IA 1A62A 4AYBG 3S15B 1QB5D 1IL8A 4CDEC 2RKSA 3HOYB 3OMCA 3J81c 3S2HB 1GD7A 1CQFA 2L9HA 1C4QA 4LFAL 5IYBG 1RD9D 2AUKA 3FPPA 5EQ0A 1WCMG 4DR1Q 1EOVA 3I4NG 1JE4A 1VS0A 1X3QA 1X3GA 2KEEA 4DV5L 1PHJA 3ITPA 1S72A 3R2IA 4TQUS 3W1BA 5H1SE 3J81j 2UXDQ 3FKIB 3JC66 4L5QA 1O7LA 3H94A 4I7AA 1V8QA 1EL0A 5IGFA 4BY7B 5IGEA 2SDFA 1TWAH 3T16A 1IXRA 4AYBB 3BZCA 3O13A 1TS2A 2D0OA 4DNRB 3PIPA 3M7GA 1KABA 5CV5A 5BN4A 3MXPA 4LF5L 2JA9A 3C1EA 4DR1L 1CSPA 1JMCA 5DLQE 1X3FA 2F1MA 3A55A 1ILQA 3VR6A 3PO2H 4A3LH 3PSIA 3OWEB 4OIJA 1YI2A 3VA5A 1VQ9A 5IOCA 1NNXA 2KA7A 1ESRA 4X66Q 4C2MH 1K28A 1O7YA 1HNXQ 4FF3A 2K03A 3IL8A 2R92H 2J7ZA 2OT2A 3LX0A 4L8JA 1N34L 2RSOA 4POGA 3UE1A 3ULPA 2F3WA 3CCQA 2Q2HA 2HIXA 1LT3D 1SJHD 1W6KA 4MIUA 4Y7NH 1M90C 3SVMA 1J8IA 1CFMA 5IP7G 5FLMH 2PQAA 1N32L 3BDLA 5IWAL 2EIFA 1A0IA 1HUNA 4B3TL 1EQVA 2RDHA 1SSOA 4KTAA 1Q7YC 2GA4B 1RODA 2Z6BA 4JI5L 4O2DA 3GTPB 5I6YA 1HNZQ 3T13A 2JA5B 1F9PA 4A3FB 2KQ3A 2Y0SE 3MVVA 2MJ8A 5G3LF 5JPNC 3UE0A 4NXNQ 1HXYD 3TSSA 3IAYA 1KC8C 2A69D 3PIP3 3HRZC 4FXDA 5FO9B 3I4NH 4P74A 1EIFA 3QWNA 3TN2A 4DR4L 1HA5A 3OPOA 3BU2A 5IP9G 1IYUA 1BOSA 1PMRA 4A3IB 1EU3A 1K0RA 2L11A 4IUPA 1IBKL 1MIUA 1PFSA 4RKBA 5A35A 1NR4A 4NW2A 4OO1H 4A3BB 5JAVA 2P5ZX 1B53A 1PTOC 4HR7B 2CWPA 2VXWA 2EXZA 2FXQA 2EYPA 2NTSA 4DAPA 5CGKA 5M5WH 4YCUA 3C3LA 2A69C 4DR2L 1TVXA 1HZAA 4JG2A 1A3VA 2IX0A 1NAPA 3D4DA 4XT3B 2KEDA 1I4QA 1D1IA 5GAHC 3UDIA 4DV0Q 4LNQA 1WVLA 5IYBH 2JA6B 1HA6A 3CW2C 1PFNA 3W5OA 2D0PA 1EWIA 1D5XC 3PIO3 2R92G 1N33L 2TSSA 1AEXA 1TU2B 1U4MA 1I94Q 2OQ0A 1UE5A 1U4RA 2E2IB 4PG3A 4XTCS 5DM73 3RLFA 4IN3A 1EIGA 4DV2L 4MZ9A 1D7QA 4K5VA 2BOSA 1XNRL 1KDAA 2K33A 2IL8A 3P1HA 3S1RH 4DV1L 4O1NA 3KJOA 1VQ8A 5LL6S 4HSVA 4KY5A 2WACA 3J81L 1V1QA 5C4HA 1X9NA 1WTQA 2UUCQ 4JYAL 5ELDA 2RQXA 4LF7Q 1TS3A 2F0KA 2JA6G 3KLSA 1FL0A 3IKJA 1XTCD 5EJWA 4B9XA 5C0XH 1NJIC 4Y7NB 1F9SA 3A7LA 2YV5A 1NTGA 3OIQA 4DAVA 4A3MG 2KCCA 2K4KA 2LKVA 3DLLA 1G51A 1K3RA 1CKOA 4DAYB 2XRQD 3F2UA 3TEHB 1BKBA 3RZOB 3TRZA 5KEEA 2F3IA 4HJ9A 2F0MA 1HFNA 4IFDH 1SE3A 1QWYA 2KECA 3SE0A 1Y8NB 3RR5A 3E5SA 4CDFC 4A3JG 4OX9L 4CDDC 3J80c 4DV4L 1W6JA 1XWEA 1Q1BA 4R8NA 3M4PA 5I6WA 5BN5A 1DJRD 1VQGA 1KAWA 2PO4A 2JSOA 4YIJA 1GUSA 4FF4A 2Z6KA 1B70B 2CHBD 1YBYA 2HUGA 4M8AA 1TKWB 5ELBA 1HZBA 2KHIA 4POFA 5BR8Q 2WV6D 3L3OC 4OIKA 3BDCA 2DN8A 3KYHC 1KDCA 4JBWA 1P16A 3KK7A 3Q6SA 1YVCA 3G7LA 1SE2A 5C3EB 1PTOH 2Q2IA 3PO3H 4UY8C 2AHOB 1YHAA 1D8LA 4QGUA 4LW1A 1WD0A 1AN8A 5C4XH 4BBRH 2DY7A 3HOXH 1K8GA 1HH2P 4NB3A 4X65Q 2AQ2B 1LM0A 2M9VA 4PZ6A 3K5LA 3STBD 1NUCA 2B2TC 3EIVA 3FP9A 5E4XA 1EYAA 4JK1C 4OO1G 2FFKB 3KBXA 1PH2A 2XRSD 5LHY1 3H0GG 2IT1A 5E7NA 1QE6A 1ZYRC 2UUAQ 4YHHL 2F4VL 4C3HH 2BH8A 1W2BA 4JOIA 2R7ZG 3F1ZA 1Q86C 4DV2Q 1IL2A 2DGYA 4XT1B 2JA7G 4NXMQ 2O5IC 4IPDA 3CPWA 5C3EG 1GOZA 3AFPA 3KUPA 1Y1WB 1MSHA 4IO9A 3N6RA 4I7ZC 4N8FA 4DAMA 1T9HA 5EAYA 1Q3LA 2I5MX 4V190 3PCOB 1LV9A 1XPUA 3HOWG 2BE5C 1TWFB 2I07B 1CHPD 1K8MA 2EJMA 3IFTA 4ZLTF 1GVPA 3GV6A 1XPOA 4C3JG 3GD7A 1GO3E 5CC4A 3H15A 1SE4A 2NTTA 4B08A 3S9WA 1ZYRD 2ZXPA 1A15A 1SFOB 4AYBE 1VQDA 1TWAB 4JV5L 1EU4A 2KVMA 3MTSA 4GLVB 4WORA 3G6EA 5D3IB 2YTVA 1B7YB 4BBSB 4GOPC 1U0LA 3JAMc 1STHA 1RHPA 4DV6Q 3Q23A 4RGTA 5CV9A 3CC4A 4KHPQ 1DM0B 1HHVA 2K01A 3I4OA 3CCMA 4MTKA 3H3VI 3I4MH 1I3QH 3KOJA 1T5EA 5HURA 2EPBA 2MPMA 1Y69U 2QGQA 1WTXA 4LF6Q 3DWAA 5EBDA 4KHPL 4CJ2C 4JI2L 4I65A 2F0IA 3L7ZC 5IGGA 2F0DA 2WINB 1WTVA 3E9HA 3S2DB 1K9MC 3K58A 2RHQB 4R4IA 1B50A 2PCFB 5COYA 4A3LG 2Z9HA 1MD2D 2EYHA 3GTKB 4YWMA 1XXGA 1G91A 2B2VC 4K8JA 1LTID 3VA7A 5A2QE 1Z9FA 4A75A 4LMQD 4B3SL 3DHQA 3EFXD 5FLXE 1VMPA 2QF7A 1YNXA 2PW5A 2E2HH 2EY1A 1PRTC 1XMQQ 3ERSX 1DD2A 3K5OA 2C35B 1N9WA 3CMEA 4A3EH 3K8AA 3M9BA 2WAQB 3E6ZX 3K0XA 2VQEQ 4A3KB 3HKSA 3DWPA 5ELOA 3PV0A 3ERQA 2E5LQ 4XXEA 3S2DH 2ZTCA 2HCIA 2EY5A 3HOVG 2TMPA 3P75A 5I4DA 2LXJA 1EYDA 2NZ1D 2K05A 2KOLA 5CV8A 2B8GA 3PGZA 4GLAC 3OYYA 3M3YH 1B1ZA 3K0YA 3TP7A 3OMGA 1SR3A 1DXMA 1CKNB 1EZ8A 1XNQQ 1SAPA 4EQ5A 1N32Q 4HSPA 1I50H 2F0EA 3OIPA 4YCVA 3MHBA 2H4OA 3BDOA 1B9NA 4ME5A 1SYEA 3PUYA 1WCMB 3NQTA 3NUCA 2N49A 3FHWA 1A3UA 5C0XI 2Y0SG 2EQSA 1EIYB 2BA1A 2XNAC 5CBAE 1VDZA 1FD7D 1V43A 5LL6X 3CCLA 1I4RA 1U9RA 4J6HA 5IP9H 2G9HD 4GN3B 4OGQC 3CCUA 3T4AC 3VR2A 3C46A 2RBMA 3CQZH 3E3XA 1QG7A 2C9OA 4NXML 4DR5Q 2KCTA 1PRTF 2ZJRA 4ZK9B 4L5SA 1JOOA 4K5XA 3N52A 3S2HH 1XNRQ 1Q8KA 5FKAC 2ID0A 4JI2Q 1ESFA 3QOLA 4BBRB 1GM5A 4ALPA 3HOXB 3X3NA 3PUXA 1PYBA 2VUMH 4DK6C 2NZOA 2JA5G 2B2YA 1G6PA 3A5UA 2DJFC 3J7AF 3MC0B 5EPLA 3HOZH 4OX9Q 2A68D 4JVZA 3GTMB 3I7FA 1WTOA 1SNCA 3ZJYC 3D8GA 5IE8A 4KV6A 1LTSD 1SMYC 1W3SA 2BE5D 3NBHB 4DR4Q 3TS0A 1VQ5A 2C5CA 4EX5A 1WI5A 3NBHA 4DV7Q 1QVGA 4KY6A 1RKNA 4JI6L 1CT1D 4HEDA 4EGVA 1LACA 1IKMA 2VNUD 3CP0A 3EA6A 4ABNA 4A3EG 4PNYA 4GS3A 4KKSA 4DV7L 3L9AX 2UXBQ 5BR8L 2O2LD 1H9SB 2ASBA 4G7OC 2B2YC 3I4MG 1H9SA 3PUWA 1PXUA 1WTPA 3M7NA 1VQOA 1F77A 2WKDA 2RCFA 4IOAA 2UXCQ 2E2HB 4IUUA 3K7AH 1NY4A 2XTIA 3NPPA 2NVXB 4GOPA 1U4LA 5KNDA 4FDBA 4A3DH 4A3EB 4QMGA 5T1IA 5C0XG 1CZWA 4HMIA 1QVFA 1VQ4A 5IYCG 3S16B 1CKMA 1DOMA 2R92B 2EYLA 2WAQE 1XMOQ 4LFCL 4QY7A 1AH9A 1AP0A 1FGBD 2PZUA 1YIJA 4JI1Q 3CPFA 5CV7A 3NTKA 4F88A 1F2ZA 3E0EA 4DK3C 1I5FA 2ZM6Q 2ES2A 1SEBD 5CYUA 4WJ3M 5J39A 2B3GA 4XYQA 5I2XA 1KNEA 1OXXK 3AQQA 2L15A 1IBML 2A19A 2XWBB 2F0LA 3A7AB 2M2LA 4FF2A 1DCZA 1DOKA 1E2VA 1Q12A 1Y14B 2PZWA 4DXFA 4A3IG 4F87A 4FVMA 1LABA 5FJ8G 4L63B 1HNWL 3I90A 4RG1A 1K73C 1PTOF 3NEMA 2K28A 2OEOA 5IP7H 5FLMG 1HR0W 2OTLA 2UU9L 3RUZA 4GNXC 3A0JA 4BY7H 3VR5A 4X66L 3M4OH 2AQ3B 2R7FA 4IUVA 4LFAQ 4RFBA 4XYOA 2SNSA 4IPHA 4HTHA 4FNFA 2VUMG 4A3MB 4A4IA 1XJVA 2SEBD 4IPCA 2B2WC 3DM3A 4KJNA 3CCRA 4JI7Q 1V1PB 3G6JB 4LF5Q 2UU9Q 5LMUL 1YNNC 1JWUD 1MJCA 3GQBA 5M3MB 4LUOA 3J7AV 1YITA 5C4XG 1S4ZA 5JPMC 3ER0A 2UXDL 1B9MA 1UEAB 3I73A 1LTTD 3S14B 5C44G 4AH6A 1G8ZD 1SE8A 1HR0L 3D3RA 4A3GH 3CF5A 3BYYB 4RGNA 1HCZA 2JXMB 5D3DA 4GKKQ 1Y1WG 3KLRA 1E22A 2NN6G 4GNXB 4K0KQ 4X64L 4OL7A 5KIXA 4LUVA 5AJ3Q 5JEAH 4LFCQ 3HOYG 1YJWA 2F0JA 4GKJQ 1TY2A 1PTOD 1EY4A 1GJXA 3UDGA 3HFZB 4OWTB 3LGJA 1TQOA 3GTPH 4JBJA 2UUCL 4UHVA 3MXGA 2N78A 2UXCL 3R2TA 3HOZG 3AFQA 1S5FD 1CTMA 3ND9A 1B44D 4K5WA 2QEJC 3FEWX 1CKNA 3OTOL 1GXDC 2OCEA 3OWFA 4KHZA 4DR3Q 2E2DC 4Q0FA 2ICIA 1VQ7A 2K5NA 4FF1A 3HG9A 1I94L 4LF9Q 2MGSA 3ONAB 2OF1A 4YWLA 2I0QA 2J0TD 2EY6A 4CHTB 1FR3A 1Y1WH 1RL2A 5IYDH 4DV0L 1S5BD 3T51B 2NN6H 1CK1A 1QUQA 1IBLQ 4JC0A 4IPGA 1KL9A 1F2YA 3D4RA 3PUZA 2K5DA 1SYFA 4A3DG 3HGBA 2NB0A 3KF6B 1R9TH 4HN7A 3K57A 5GAGC 1TIID 2HDMA 1QZGA 3HOVB 1HFGA 1D2BA 1LO5D 3S1NB 1Q81C 1PTOB 3NSWA 1PRTB 2JK8A 4JI8L 1I4XA 4ZRZA 4BBSH 1VQCA 1EUJA 1X54A 1PH7A 3FKIG 3B6YA 1Z6HA 2L55A 1I6HB 3K6OA 4C3JB 2EE1A 5IGCA 4R4TA 3WDNA 2XN9C 3PUVA 4FO2A 2F4VQ 1G291 1PH5A 3H91A 1QNKA 2LS01 1CHQD 4DUYQ 1GUTA 2D9UA 2K5VA 4PQXA 2VS1A 1CQVA 1VQMA 4NPSA 2QDLA 3MZ5A 3S14H 1EY0A 2Z1CA 2BDNA 1C48A 4RMFA 5IIFA 5JEAG 5IODA 5GADC 1TWHB 5K36G 1UAPA 2Z4HA 4BS9A 2JA7B 2L5TA 5M5WB 3GTKH 1Z7TA 1EQRA 1GHKA 1PFBA 4N9PA 1LUZA 2XSCA 4FXKC 1FJGQ 3V05A 3GO5A 3CMAA 3GDEA 3FDTA 4M1UB 4OHJA 1NMFA 2N3SA 3BYTB 4MHEA 1C0AA 3A74A 1L0WA 4N9TA 5HY6A 1T5XD 3UI2A 3DEOA 1HPCA 1PZJD 5ELEA 1JC7A 3QJYA 3D6WA 4LJZC 4KJOA 5CR3A 3TP8A 1CZGA 5C4JH 3PF5A 5J22A 3S17B 4KMUC 2OTJA 3RLOA 3MWYW 1YNND 4KD3A 4CDCC 1HNXL 4B3RQ 1O80A 2G9DA 1ASZA 2B63B 1UWVA 2R6GA 2DNEA 3BZKA 1BBUA 1ICWA 1O78A 2RDGA 1I6VC 2EJFC 3H3VC 1STBA 2A68C 3LNNA 2H1EA 4RA8A 4H44C 4K2LA 3F2BA 3NELA 4RKLA 4IALA 1PH9A 2A5HA 1B3AA 2Q8RE 2R7ZH 1AE3A 1WFQA 2IWHA 4B3ML 4ZKBB 3S16H 4Q5VA 1E0BA 5KGUA 2PNHA 4TKOB 4ZCKA 3W1GA 1YHQA 4KY7A 1SNPA 3QB3A 1HTPA 3A8KE 4A76A 3P20A 4HIMA 1BXTA 1VQHA 2CVRA 2NVQH 1EOTA 2EYMA 3HOWH 2R7DA 4KN7C 1IW7C 2F0SA 4CJ0B 2M00A 1JQYD 3FKIH 4LF7L 2ZJPA 4R4OA 1Q90A 4EQNA 1EQTA 1BCPB 4JBKA 2K14A 4GLXA 1KNAA 2EYFA 4R4QA 3R8BA 3TMEA 2K6AA 3MEFA 4JI0L 3CKIB 2VW9A 4DV1Q 1MBYA 1WTRA 1OO9B 2WB1E 4LF8Q 2CH4A 3A56A 4A3BH 1Y1VG 1X6OA 2EXDA 3NTIA 1I6HH 2PQAB 4DXGA 5KNBA 4DKAC 2A6EC 3C2PA 1N36Q 5M3FH 4H13C 3CCSA 1I4PA 2AQ1B 2PI2E 1HNWQ 5JJIA 2F0GA 2MQHA 3GTGB 2ZTDA 3BG3A 4QCLA 5D14A 1A6XA 1PA6A 2VL6A 2E2JH 2V4DA 3H3VH 3NP8A 4TRDA 5KYLA 1GUOA 3EBEA 3WOFA 2R93B 3S1MB 3MAQA 4QUFA 1DONA 1SJED 3J7A5 4HJAA 4K6LA 4EVOA 4A3FG 4X62L 4A3KH 3GTOH 4CGYB 3NWTA 2HD3A 5JJKA 2B2TA 2JA8B 4LK1C 3CC7A 1TWCH 4XDXA 5ISRA 4PMBA 1U4PA 5AFWA 2Z0SA 3Q0AA 1B3QA 3CQZB 4A3BG 3CU7A 5NUCA 2ATWA 1SROA 2F0PA 2BCOA 3DM1A 2JE6I 1VQFA 3MFGA 1DOLA 1TR5A 4NP5A 3G48A 1EY5A 3R93A 2WKCA 4FP5D 3QG1A 1N8RC 3S1QH 1XPRA 2ZT9C 4BWGB 1VQKA 1ZXTA 4IURA 3KJPA 1EY7A 1MSGA 4LF6L 1SNQA 3KDFA 2ENBA 1RF2D 2NZHA 5E4WC 3J80i 2B39A 4F7XA 3BVMA 3I56A 4IFDI 4A93B 3NK9A 2JEAI 2EZVA 2PYKA 4HAEA 5JVH3 3BVZA 1K3BC 1SLJA 4DGZA 1KQSA 4WRDA 5IT9c 2NVTH 4G57A 3EROA 3U4ZA 1PH6A 1VF7A 3T1HL 1H9JA 4XQQA 2F52A 4LWCA 1XTDA 2F03A 4CJ1B 5IWAQ 1L0YB 3TZDA 3MA2B 4A3GG 4PMCA 1EY6A 1EY8A 4C3IB 2QEXA 5ELCA 1JOKA 4JYAQ 4C56C 3LWEA 1K0SA 2E74C 4ME3A 1Y1VH 1CSQA 1BNZA 4B3RL 2IX1A 3OTOQ 1Q46A 4H02A 2BA0A 5C0XJ 1F2MA 1SYDA 4FXGC 4B9WA 4EQPA 1QVCA 2DJGC 4RCNA 2KHSA 1G2TA 3KF8B 1BDOA 1MJEA 2JA6H 4DR6L 1HR0Q 2NYZD 1R9TB 3RD4A 2EY2A 2A73B 1S40A 3HEJA 4HIDA 1ET9A 1F2LA 5GAEC 2HHHQ 1O7IA 1TS5A 2AMCB 1NBWA 3HOUG 1JORA 2JN4A 1HJPA 1STAA 2VB3X 1UE7A 2JEBI 3S15H 2VQFL 1RCVD 5LMUQ 4QUCA 2B2WA 2KHJA 1GKHA 4OEMB 2XWJB 4DNIA 4IFDG 3MXNB 4XQNA 2K5WA 3RMHA 4K8IA 4P2CB 3CRKC 5ELFA 1VQJA 4JI0Q 4K2KA 3CRLC 1JOQA 1VQIA 4GOPB 2HHHL 1TT2A 1EY9A 1PH1A 2F0TA 5CORA 4APVA 3AMUA 4K6DA 4GZYC 4U68A 2VB2X 2E76C 3TQYA 4NMZA 2PNRC 2E75C 4X3UA 4BY1G 4R9WA 4ZYSA 1X3EA 1QCBD 1KHIA 2O5JC 1H95A 1KXLA 1E1OA 4UP7A 1KLGD 2IHEA 4G4KA 4JI7L 4DR3L 3I3CA 1E7ZA 1C7YA 1OTCA 3M3YB 2L4NA 3RZOH 2ALYB 1K83H 5KRUA 3GTLB 2EYJA 1OXUA 3MXUA 1S5DD 2FINB 4ZQ3A 3I55A 1BCPF 5T1GA 4X65L 1ML0D 4A93G 1LT6D 4JI1L 3D4WA 1SXTA 1X32A 3OHXC 3HOZB 2AKWB 1RIPA 4DA2A 4BBSG 1SYCA 1JWMD 2XVSA 2ZTEA 2XIWA 2GVAA 4A3KG 4X3TA 5C4ZA 1D5MC 2GN5A 2E8GA 2PQEA 4J8QA 4A3GB 4NKLA 2N55A 3GV3A 2MFIA 1VMCA 1I4GA 2FJ2A 5M9OA 4OELB 1RJTA 2JQOA 3EJIA 2F0VA 3TBIB 2IJ0A 4V0BA 4DV5Q 4DAYA 3KLSX 4C3HB 1KDBA 3R3OA 2NBFA 3AB9A 2KBNA 3STBC 4OWWB 4OXPA 5LMNQ 1X55A 1Q8IA 2R7ZB 2HQEA 4LUZA 1QJOA 4B3TQ 4BY7G 5C3EH 4DV4Q 1PH8A 5C3XA 4RGMA 4ID6A 4YWKA 2R93H 3DWQA 1HUMA 1LTAD 1Q1EA 3M4YA 1OXTA 1AZPA 1HNZL 2UUAL 4KKUA 2VY3A 4R8IA 3SGIA 2B2UC 4DUYL 2UUBL 5JOBA 2CW0D 2K5HA 3TS2A 5EPJA 2D62A 4JV5Q 3IRBA 5GQOA 3Q24A 1YNJC 3TREA 5TSSA 4LF4L 4LF8L 4TSSA 1JB7A 2KJXA 2KCMA 3GTJH 4Z9CB 2QA4A 4JW0A 4TVAB 3DEPA 3K5MA 4KKTA 4A3CG 3SEBA 1MGSA 1J9OA 1EWCA 1DGSA 4BY1H 1QUQB 4DV3L 1I3QB 2OQKA 5CMDA 1FNWA 1LTBD 1YHBA 4XIGS 5M5YB 4KHVA 3J7YW 3BVGA 2ZM6L 1SN8A 1EYGA 4A3DB 1V9PA 3M4OB 2N8NA 2FMMA 2Z8LA 2VQFQ 4HJ7A 4RWSC 3Q8DA 1LLRD 1XYIA 3SK6A 2MO0A 1J5EL 1I50B 3BZDB 3MEHA 1RTOA 3CCVA 1Y1VB 4DR6Q 3QOJA 4H0LC 4GN5A 2NWGA 1STGA 1AFPA 5KYIA 4DK1A 1KIXA 1PH4A 3CCEA 2EVBA 4N8X1 2X6LA 4ULLA 5BN3A 4LF9L 4K14A 1KLUD 4UDUC 4B3MQ 1WTWA 1OXVA 3NQIA 4IUNA 4A3IH 1IBKQ 5FJ8H 1LT4D 4U673 3T1YL 2BH2A 2A6HC 2L12A 1KRTA 4C2MB 2EYOA 2D5DA 1IHZA 1LYLA 5IT9L 3I4LA 5IYDG 1SNOA 2VZAA 2K04A 5M3FG 2WIIB 3AU7A 3HOVH 3S1NH 1BBWA 1L1OC 2RVLA 2HQLA 2R93G 1GHJA 1P8LA 3Q22A 3NENA 1CM9A 1XX8A 2X69A 4ZKCB 1U5KA 1XMOL 5HGTA 2K50A 4A93H 1VCIA 1TY0A 5EBCA 1VQNA 2QILA 3K7UC 3MXNA 1SYGA 3QIAA 4L6TB 2QKIC 1TWGH 1EFID 1M1KC 4X62Q 4J1MA 2EDGA 2PMZE 5FLXc 3T1YQ 2QCPX 2EJGC 3S17H 1EWHA 4GKKL 1CA5A 2NVYH 2B8FA 1JJCB 4JI3L 1S5CD 3V96A 3DMUA 5M3FB 1KD1C 4A3JH 3PIOA 1EQQA 4IFDJ 4IZ8A 4RH6A 4X3KA 4ZUIA 1B8AA 1BUVT 3GTJB 4X6AH 1ENFA 1K83B 2YTYA 4Y52H 4KI0A 3NE5B 4QJFA 4RGOS 1BCPC 4X64Q 3K59A 2KUMA 3HKZG 1EZ6A 2E2JB 1YEZA 4KN4C 2YU9B 4QL5A 3TP6A 1NE3A 2F0WA 2NVXH 1N36L 2K7VA 2HIVA 3VR3A 1WTHA 3K7AB 2JYOA 1WOCA 1Y8PB 1O7ZA 3L0OA 1STYA 2KCNA 2JA5H 4QIWE 4DUZQ 3GTOB 5KNCA 2F0OA 3HKZB 3M85A 2B63H 3FRPB 1UE1A 2Z4IA 4C3IH 1DYQA 1VQ6A 2PW7A 1VQBA 5D65A 3FVQA 5J1ZA 4BBRG 3HOXG 4ODGA 2JA8G 1JB3A 1RTNA 3U9SA 3CHBD 2QDBA 1L0XB 4QB4A 4AIMA 1PH3A 1L2FA 3KF6A 3KF8A 5EKIA 1ILPA 1JCKB 1LTGD 3HP3A 3OW7A 4PZ8A 3UDXA 4IJHA 5M5XH 1QNUA 2V1CC 4ZUJA 3NHHA 5FO7B 4DR2Q 3D0FA 5I9OA 1IKLA 1S5ED 2LFNA 2VUMB 3L2PA 3KLWA 4DN4M 3FPUB 2CQOA 3CC2A 1YZ6A 3WWVA 4JI4L 4NDXA 1I4HA 1HZ9A 1PYSB 3NXWA 3S1RB 1PZKD 2IPKD 1XNQL 3HOUH 1EEID 4JI4Q 4IOCA 3CCJA 3I70A 2KENA 3I4MB 2JP1A 2IW3A 4QF4A 1NR2A 1HTLD 4JI3Q 3G71A 1JJ2A 4OO1I 1LT5D 2RCNA 3RLNA 4IUQA 2BDOA 4C3JH 3URYA 4BY1B 1BR9A 2CWAA 2RHSB 1FNVA 5CV6A 1SFOH 4H7BA 1TWCB 1J5EQ 1K8OA 3ND8A 3J81E 1ICFB 2CW0C 3OW2A 1S3OA 1XMQL 1JE5A 1X65A 2F0NA 4JBMA 1YNJD 3WOEA 2ZJQA 1UEBA 3QO2A 1VQLA 3W3AA 4AQYL 1WJJA 3C1FA 3J7ZC
chains in the Genus database with same CATH topology
4DR5Q 2KCTA 2ZJRA 3G48A 4HJ8A 1IXRA 1IZ6A 4L5SA 2CKZB 3BZCA 1N8RC 2D0OA 3S1QH 1XPRA 1XNRQ 3S2HH 2XGTA 1VQKA 1Q8KA 3PIPA 3KJPA 2ID0A 4JI2Q 3KDFB 2GVBA 4LF6L 3KDFA 4LF5L 2JA9A 1GM5A 4ALPA 2NZHA 4HIKA 3PUXA 1PYBA 1CSPA 4DR1L 2VUMH 3J80i 3I56A 1JMCA 5DLQE 1X3FA 4DK6C 4JI6Q 2NZOA 3PO2H 2JA5G 4IFDI 1PVOA 4A3LH 3A5UA 1A63A 1G6PA 3PSIA 1N34Q 2JEAI 1YI2A 4DR5L 5M3MH 1VQ9A 3HOZH 4OX9Q 2NN6I 1SLJA 1WYDA 1KQSA 5IT9c 3JAMi 2NVTH 3U4ZA 1PH6A 3I7FA 4X66Q 3T1HL 3ZJYC 4C2MH 2F52A 4LWCA 4J15A 1XTDA 5IE8A 2CFMA 1HNXQ 5IWAQ 2R92H 1W3SA 4A3GG 3NBHB 4DR4Q 3TS0A 1VQ5A 4EX5A 4DV7Q 1WI5A 1N34L 2QEXA 1QVGA 4POGA 3UE1A 4LFBQ 4JYAQ 1KXLA 3ULPA 4JI6L 1E24A 3CCQA 4ME3A 2Q2HA 1LTLA 1Y1VH 4OWXB 1CSQA 3G4SA 4OONA 2VNUD 3CP0A 2HIXA 4A3EG 1VQPA 2IX1A 4GS3A 3OTOQ 4B3RL 4DV7L 2DUDA 2UXBQ 1Q46A 4H02A 5BR8L 4Y7NH 1M90C 2BA0A 5IP7G 5FLMH 5C0XJ 2ASBA 2PQAA 2YTXA 1N32L 3I4MG 3PUWA 5IWAL 3M7NA 1QVCA 1VQOA 2EIFA 4IOAA 1A0IA 3F2DA 2UXCQ 4B3TL 3K7AH 3KF8B 1MJEA 1NY4A 2JA6H 4DR6L 2XTIA 1Q7YC 1IBLL 1HR0Q 1L1OA 4GOPA 4JI5L 1L1OB 4O2DA 4HIDA 1S40A 1HNZQ 1AE2A 4FDBA 5GAEC 2HHHQ 1O7IA 4A3DH 5C0XG 2AMCB 1NBWA 2Y0SE 1QVFA 1VQ4A 3HOUG 4P72A 5IYCG 1CKMA 1Z47A 2WAQE 1HJPA 3UE0A 4NXNQ 1XMOQ 1JT8A 2B63G 1E1TA 1UE7A 2JEBI 4QY7A 4LFCL 2VQFL 3S15H 4MNOA 3J81i 5LMUQ 1VQAA 2KHJA 1KC8C 1AH9A 1GKHA 1YIJA 1OXSC 4JI1Q 3CPFA 4DNIA 3E0EA 4DK3C 1I5FA 2ZM6Q 2ES2A 3MXNB 4IFDG 4WJ3M 2CCZA 3I4NH 2B3GA 4P74A 1EIFA 1OXXK 3AQQA 4DR4L 2L15A 1ASYA 1VQJA 4JI0Q 1IBML 1VQIA 2A19A 4GOPB 2HHHL 3BU2A 1BVSA 1PH1A 1Q12A 5IP9G 1Y14B 3GTMH 4APVA 2HT1A 4A3IG 1E3PA 5FJ8G 1K0RA 1IBKL 1MIUA 1PFSA 4UP8A 3TQYA 1HNWL 4DV6L 4RG1A 1K73C 4BY1G 5HGQA 3NEMA 1HR0W 1X3EA 1KHIA 4GN4B 5IP7H 5FLMG 3U50C 2OTLA 2CWPA 4GNXC 3A0JA 2UU9L 1J6QA 2FXQA 4BY7H 1E1OA 4UP7A 2IHEA 4X66L 3T1HQ 4JI7L 4R4CA 4DR3L 2WB1G 5J3BA 1JJGA 3M4OH 1E7ZA 2JA7H 1C7YA 1OTCA 5M5WH 4YCUA 4BA2I 2R7FA 3F2CA 2ALYB 4LFAQ 4DR2L 3RZOH 4IPHA 4K0KL 1K83H 4JCVE 1HZAA 3GTQH 4JG2A 2VUMG 1OXUA 2IX0A 4A4IA 3I55A 1XJVA 4X65L 4A93G 4IPCA 1A8VA 3DM3A 5GAHC 3CCRA 4L5TA 3UDIA 4JI7Q 4JI1L 4LF5Q 4DV0Q 2UU9Q 4LNQA 5LMUL 5IYBH 1MJCA 3CW2C 3S24A 4LUOA 3W5OA 1YITA 5C4XG 3CAMA 2D0PA 4HJ5A 2AKWB 3ER0A 2UXDL 1RIPA 3A5ZB 4BBSG 1EWIA 3F8TA 4A3FH 2ZTEA 2R92G 2GVAA 4A3KG 1N33L 3CXCA 4GKJL 2UXBL 2GN5A 2E8GA 5AJ3L 5C44G 1I94Q 2OQ0A 1SE8A 1UE5A 4AH6A 1HR0L 2MFIA 4PG3A 4XTCS 4A3GH 3CF5A 3RLFA 3ICEA 4DV2L 2JQOA 4MZ9A 5IY0A 1D7QA 2I5HA 1XNRL 4GKKQ 2IHFA 3S1RH 1Y1WG 1VQ8A 4DV1L 3KJOA 1E22A 4DV5Q 3VDYA 2NN6G 4GNXB 4K0KQ 4X64L 2WAQG 4OWWB 2KBNA 1V1QA 3STBC 4DV3Q 4OXPA 4LUVA 5LMNQ 1X55A 1X9NA 5AJ3Q 2UUCQ 4LFCQ 3HOYG 4LUZA 1YJWA 4GKJQ 2K52A 3U58A 4B3TQ 4JYAL 4BY7G 3BJUA 4YCWA 5C3EH 4DV4Q 1PH8A 4YWKA 4LF7Q 2R93H 2A1AA 1PV4A 2JA6G 1FL0A 4P75A 1Q1EA 3UDGA 1OXTA 3HFZB 1NJIC 1HNZL 2UUAL 1KRSA 4OWTB 3LGJA 2VY3A 3GTPH 4JBJA 3UDFA 2YV5A 1NTGA 2UUCL 3SGIA 5IYCH 4DUYL 2UUBL 2N78A 5LMNL 3I2ZA 4A3MG 2K4KA 3DLLA 2UXCL 1G51A 1K3RA 2K5HA 3HOZG 3TS2A 3AFQA 1CKOA 2D62A 4DAYB 3IRBA 5GQOA 4DPGA 1SMXA 4JV5Q 3TREA 3TEHB 4LF4L 1BKBA 4LF8L 1JB7A 4WJ4A 3TRZA 2F3IA 1VQEA 1CKNA 3OTOL 2KCMA 3GTJH 4HJ9A 2QA4A 2OCEA 4KHZA 4DR3Q 1K8AC 2K75A 1VQ7A 2K5NA 1EFWA 3RZDH 1I94L 4TVAB 3RR5A 4A3JG 4OX9L 4LF9Q 1C9OA 4UPAA 3J80c 4A3CG 4YWLA 2MO1A 4DV4L 2I0QA 3H0GH 1Q1BA 3M4PA 1Y1WH 1RL2A 5IYDH 1DGSA 4BY1H 1QUQB 4DV0L 1VQGA 1KAWA 4DV3L 1IBMQ 1QUQA 1IBLQ 4JI8Q 3HKZE 3D31A 4IPGA 4JC0A 2OQKA 4BXXG 2Z6KA 1KL9A 3RN2A 1B70B 2H5XA 3PUZA 1YBYA 1YHBA 4XIGS 1HZBA 3U4VA 1IYJB 2KHIA 2ZM6L 1EYGA 1SN8A 1UE6A 1V9PA 4POFA 4A3DG 2N8NA 5BR8Q 3KF6B 1R9TH 4B3RQ 4BA1I 2VQFQ 4HJ7A 5GAGC 4DUZL 4B3SQ 1X56A 3Q8DA 1QZGA 3KYHC 4JBWA 1P16A 1Q81C 1YVCA 2MO0A 1J5EL 3S1MH 4JOIC 2JK8A 2Q2IA 4JI8L 3PO3H 4R1JA 3AYHB 3K81C 2AHOB 4JI5Q 4UY8C 4DR7Q 1YHAA 4BBSH 1D8LA 4QGUA 3CCVA 2B29A 4LW1A 4DR6Q 1VQCA 5C4XH 1EUJA 1X54A 4BBRH 4GN5A 3FKIG 3B6YA 3HOXH 1PH7A 1K8GA 1HH2P 1KIXA 4NB3A 1PH4A 3CCEA 4X65Q 1WCMH 2OWOA 4R4TA 4DR7L 1LM0A 3PUVA 1YJ9A 2F4VQ 4PZ6A 5C44H 2JA8H 4LF9L 3STBD 1G291 4B3MQ 1OXVA 1PH5A 1IBKQ 4A3IH 5FJ8H 3EIVA 4IJLA 3FP9A 4DUYQ 3T1YL 2BH2A 4OO1G 1KRTA 2K5VA 1PH2A 3H0GG 2VS1A 2IT1A 5E7NA 1VQMA 4NPSA 1LYLA 3S14H 2UUAQ 4GNXA 1TWHH 4RMFA 2VZAA 5IYDG 4YHHL 2WFWA 4C3HH 5JEAG 5M3FG 2F4VL 2BH8A 1W2BA 4JOIA 5GADC 3HOVH 5K36G 3S1NH 2R7ZG 3F1ZA 1Q86C 2I5LX 2MNAA 1BBWA 1L1OC 4DV2Q 2DGYA 1IL2A 1TXYA 2HQLA 4NXMQ 2JA7G 3HOYH 2R93G 1YJNA 4PZ7A 4IPDA 1P8LA 3CPWA 1EQRA 1Q82C 5C3EG 2A8VA 3GTKH 3GTGH 3AFPA 3NENA 1LUZA 4IO9A 1FJGQ 1N33Q 3GO5A 3CMAA 4DAMA 3GDEA 1U5KA 1XMOL 1T9HA 5JEAJ 2K50A 5EAYA 4A93H 1NMFA 1VCIA 2I5MX 2N3SA 4A3MH 3PCOB 1C0AA 1VQNA 1XPUA 3A74A 3K7UC 1L0WA 1FJGL 3HOWG 5HY6A 1MKHA 2Q2TA 1TWGH 1GVPA 1M1KC 4X62Q 1XPOA 2PMZE 5FLXc 3T1YQ 3AEVA 3GD7A 3RNUA 1GO3E 3H15A 3S17H 2IY5B 5C4JH 4GKKL 3PF5A 2NVYH 2OTJA 5JJLA 3RLOA 3M4QA 1JJCB 4AYBE 4JI3L 1VQDA 2AWOA 4JV5L 1HNXL 1HZCA 1KD1C 3KFUA 4GLVB 4A3JH 3PIOA 3G6EA 1FGUA 1UWVA 2R6GA 2YTVA 3BZKA 1ASZA 1BBUA 2LSSA 1B7YB 4P71A 1EQQA 4IFDJ 2WP8J 4GOPC 1U0LA 4L5RC 1B8AA 3JAMc 2YYZA 4X6AH 2PI2A 4MTNA 2YTYA 4DV6Q 1QZHA 4Y52H 4KI0A 4QJFA 5ELNA 4X64Q 4YHHQ 2Q2UA 3CC4A 4KHPQ 3HKZG 3I4OA 3CCMA 1YEZA 3H3VI 3I4MH 1I3QH 3KOJA 3ULJA 3F2BA 2Z6KC 4QL5A 3NELA 1NE3A 1PH9A 2JJQA 2NVXH 1N36L 2R7ZH 2QGQA 4LFBL 1AE3A 4LF6Q 2HIVA 1WFQA 4YY3L 4O0AA 4KHPL 4QQBX 4JI2L 1WOCA 4LF4Q 4B3ML 3L7ZC 1SRUA 3CD6A 5GROA 3S16H 3L0OA 2PNHA 2JA5H 3W1GA 4YY3Q 4QIWE 4HIOA 1YHQA 3E9HA 4DUZQ 1K9MC 3PO2G 4A76A 2RHQB 4R4IA 3M85A 4HIMA 3PO3G 4A3LG 1VQHA 4KLKA 2B63H 1UE1A 2NVQH 4C3IH 4YWMA 2R7DA 5M3MG 3HOWH 1VQ6A 1CUKA 4NXNL 4LF7L 3FKIH 2ZJPA 1VQBA 4R4OA 2AWNA 2RF4A 4P73A 3RN5A 4BBRG 3HOXG 4JBKA 2K14A 2JA8G 4A75A 1NMGA 1Z9FA 4GLXA 2E5LL 4B3SL 4R4QA 2VQEL 4AIMA 1PH3A 2YU9H 1L2FA 1YNXA 1TWFH 3KF6A 4A3CH 3MEFA 4JI0L 2E2HH 2VW9A 4DV1Q 1XMQQ 3ERSX 1H95A 4PZ8A 2WB1E 3UDXA 4LF8Q 4IJHA 5M5XH 1Y1VG 4A3BH 2V1CC 1X6OA 2C35B 1N9WA 2EXDA 1I6HH 3CMEA 4A3EH 4DR2Q 2PQAB 3K8AA 3M9BA 3D0FA 3K0XA 2VQEQ 4BXXH 3HKSA 4AQYQ 5ELOA 4DKAC 3PV0A 2E2IH 2E5LQ 1N36Q 3L2PA 3KLWA 5M3FH 3S2DH 2ZTCA 5LMNW 3CCSA 3HOVG 2CQOA 5M5YH 3CC2A 1YZ6A 4PMWA 3WWVA 4JI4L 3EN2A 2LXJA 1FVIA 1HZ9A 1PYSB 3K80C 2PI2E 3GTLH 3PGZA 4GLAC 3ULLA 1HNWQ 2LXKA 3OYYA 5JJIA 1XNQL 3M3YH 3HOUH 2MQHA 4JI4Q 2ZTDA 3PF4A 2UUBQ 4IOCA 4UP9A 3E9IA 1A62A 1SR3A 3CCJA 2VL6A 1PA6A 2E2JH 4AYBG 2KENA 3H3VH 1CKNB 1XNQQ 3J81c 4EQ5A 4JI3Q 1GD7A 3G71A 3EBEA 1N32Q 1JJ2A 4OO1I 4LFAL 1I50H 4YCVA 5IYBG 4NXML 2RCNA 3RLNA 3PUYA 4C3JH 3J7A5 4HJAA 1WCMG 4DR1Q 1EOVA 3I4NG 2N49A 3FHWA 4A3FG 1VS0A 4X62L 5C0XI 4A3KH 2CWAA 2RHSB 3GTOH 2Y0SG 2EQSA 1EIYB 2BA1A 1X3GA 4DV5L 1SFOH 1PHJA 1V43A 5JJKA 1S72A 1J5EQ 3CCLA 4TQUS 3W1BA 5H1SE 3J81j 3CC7A 1TWCH 3OW2A 1S3OA 1XMQL 5IP9H 1JE5A 3JC66 2UXDQ 1X65A 4L5QA 2Z0SA 4JBMA 4GN3B 3CCUA 2ZJQA 1UEBA 4A3BG 1VQLA 2ATWA 1SROA 4AQYL 2JE6I 1VQFA 3CQZH 1WJJA 1TWAH 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 Q;  2KCT A;  2ZJR A;  3G48 A;  4HJ8 A;  1IXR A;  1IZ6 A;  4L5S A;  2CKZ B;  3BZC A;  1N8R C;  2D0O A;  3S1Q H;  1XPR A;  1XNR Q;  3S2H H;  2XGT A;  1VQK A;  1Q8K A;  3PIP A;  3KJP A;  2ID0 A;  4JI2 Q;  3KDF B;  2GVB A;  4LF6 L;  3KDF A;  4LF5 L;  2JA9 A;  1GM5 A;  4ALP A;  2NZH A;  4HIK A;  3PUX A;  1PYB A;  1CSP A;  4DR1 L;  2VUM H;  3J80 i;  3I56 A;  1JMC A;  5DLQ E;  1X3F A;  4DK6 C;  4JI6 Q;  2NZO A;  3PO2 H;  2JA5 G;  4IFD I;  1PVO A;  4A3L H;  3A5U A;  1A63 A;  1G6P A;  3PSI A;  1N34 Q;  2JEA I;  1YI2 A;  4DR5 L;  5M3M H;  1VQ9 A;  3HOZ H;  4OX9 Q;  2NN6 I;  1SLJ A;  1WYD A;  1KQS A;  5IT9 c;  3JAM i;  2NVT H;  3U4Z A;  1PH6 A;  3I7F A;  4X66 Q;  3T1H L;  3ZJY C;  4C2M H;  2F52 A;  4LWC A;  4J15 A;  1XTD A;  5IE8 A;  2CFM A;  1HNX Q;  5IWA Q;  2R92 H;  1W3S A;  4A3G G;  3NBH B;  4DR4 Q;  3TS0 A;  1VQ5 A;  4EX5 A;  4DV7 Q;  1WI5 A;  1N34 L;  2QEX A;  1QVG A;  4POG A;  3UE1 A;  4LFB Q;  4JYA Q;  1KXL A;  3ULP A;  4JI6 L;  1E24 A;  3CCQ A;  4ME3 A;  2Q2H A;  1LTL A;  1Y1V H;  4OWX B;  1CSQ A;  3G4S A;  4OON A;  2VNU D;  3CP0 A;  2HIX A;  4A3E G;  1VQP A;  2IX1 A;  4GS3 A;  3OTO Q;  4B3R L;  4DV7 L;  2DUD A;  2UXB Q;  1Q46 A;  4H02 A;  5BR8 L;  4Y7N H;  1M90 C;  2BA0 A;  5IP7 G;  5FLM H;  5C0X J;  2ASB A;  2PQA A;  2YTX A;  1N32 L;  3I4M G;  3PUW A;  5IWA L;  3M7N A;  1QVC A;  1VQO A;  2EIF A;  4IOA A;  1A0I A;  3F2D A;  2UXC Q;  4B3T L;  3K7A H;  3KF8 B;  1MJE A;  1NY4 A;  2JA6 H;  4DR6 L;  2XTI A;  1Q7Y C;  1IBL L;  1HR0 Q;  1L1O A;  4GOP A;  4JI5 L;  1L1O B;  4O2D A;  4HID A;  1S40 A;  1HNZ Q;  1AE2 A;  4FDB A;  5GAE C;  2HHH Q;  1O7I A;  4A3D H;  5C0X G;  2AMC B;  1NBW A;  2Y0S E;  1QVF A;  1VQ4 A;  3HOU G;  4P72 A;  5IYC G;  1CKM A;  1Z47 A;  2WAQ E;  1HJP A;  3UE0 A;  4NXN Q;  1XMO Q;  1JT8 A;  2B63 G;  1E1T A;  1UE7 A;  2JEB I;  4QY7 A;  4LFC L;  2VQF L;  3S15 H;  4MNO A;  3J81 i;  5LMU Q;  1VQA A;  2KHJ A;  1KC8 C;  1AH9 A;  1GKH A;  1YIJ A;  1OXS C;  4JI1 Q;  3CPF A;  4DNI A;  3E0E A;  4DK3 C;  1I5F A;  2ZM6 Q;  2ES2 A;  3MXN B;  4IFD G;  4WJ3 M;  2CCZ A;  3I4N H;  2B3G A;  4P74 A;  1EIF A;  1OXX K;  3AQQ A;  4DR4 L;  2L15 A;  1ASY A;  1VQJ A;  4JI0 Q;  1IBM L;  1VQI A;  2A19 A;  4GOP B;  2HHH L;  3BU2 A;  1BVS A;  1PH1 A;  1Q12 A;  5IP9 G;  1Y14 B;  3GTM H;  4APV A;  2HT1 A;  4A3I G;  1E3P A;  5FJ8 G;  1K0R A;  1IBK L;  1MIU A;  1PFS A;  4UP8 A;  3TQY A;  1HNW L;  4DV6 L;  4RG1 A;  1K73 C;  4BY1 G;  5HGQ A;  3NEM A;  1HR0 W;  1X3E A;  1KHI A;  4GN4 B;  5IP7 H;  5FLM G;  3U50 C;  2OTL A;  2CWP A;  4GNX C;  3A0J A;  2UU9 L;  1J6Q A;  2FXQ A;  4BY7 H;  1E1O A;  4UP7 A;  2IHE A;  4X66 L;  3T1H Q;  4JI7 L;  4R4C A;  4DR3 L;  2WB1 G;  5J3B A;  1JJG A;  3M4O H;  1E7Z A;  2JA7 H;  1C7Y A;  1OTC A;  5M5W H;  4YCU A;  4BA2 I;  2R7F A;  3F2C A;  2ALY B;  4LFA Q;  4DR2 L;  3RZO H;  4IPH A;  4K0K L;  1K83 H;  4JCV E;  1HZA A;  3GTQ H;  4JG2 A;  2VUM G;  1OXU A;  2IX0 A;  4A4I A;  3I55 A;  1XJV A;  4X65 L;  4A93 G;  4IPC A;  1A8V A;  3DM3 A;  5GAH C;  3CCR A;  4L5T A;  3UDI A;  4JI7 Q;  4JI1 L;  4LF5 Q;  4DV0 Q;  2UU9 Q;  4LNQ A;  5LMU L;  5IYB H;  1MJC A;  3CW2 C;  3S24 A;  4LUO A;  3W5O A;  1YIT A;  5C4X G;  3CAM A;  2D0P A;  4HJ5 A;  2AKW B;  3ER0 A;  2UXD L;  1RIP A;  3A5Z B;  4BBS G;  1EWI A;  3F8T A;  4A3F H;  2ZTE A;  2R92 G;  2GVA A;  4A3K G;  1N33 L;  3CXC A;  4GKJ L;  2UXB L;  2GN5 A;  2E8G A;  5AJ3 L;  5C44 G;  1I94 Q;  2OQ0 A;  1SE8 A;  1UE5 A;  4AH6 A;  1HR0 L;  2MFI A;  4PG3 A;  4XTC S;  4A3G H;  3CF5 A;  3RLF A;  3ICE A;  4DV2 L;  2JQO A;  4MZ9 A;  5IY0 A;  1D7Q A;  2I5H A;  1XNR L;  4GKK Q;  2IHF A;  3S1R H;  1Y1W G;  1VQ8 A;  4DV1 L;  3KJO A;  1E22 A;  4DV5 Q;  3VDY A;  2NN6 G;  4GNX B;  4K0K Q;  4X64 L;  2WAQ G;  4OWW B;  2KBN A;  1V1Q A;  3STB C;  4DV3 Q;  4OXP A;  4LUV A;  5LMN Q;  1X55 A;  1X9N A;  5AJ3 Q;  2UUC Q;  4LFC Q;  3HOY G;  4LUZ A;  1YJW A;  4GKJ Q;  2K52 A;  3U58 A;  4B3T Q;  4JYA L;  4BY7 G;  3BJU A;  4YCW A;  5C3E H;  4DV4 Q;  1PH8 A;  4YWK A;  4LF7 Q;  2R93 H;  2A1A A;  1PV4 A;  2JA6 G;  1FL0 A;  4P75 A;  1Q1E A;  3UDG A;  1OXT A;  3HFZ B;  1NJI C;  1HNZ L;  2UUA L;  1KRS A;  4OWT B;  3LGJ A;  2VY3 A;  3GTP H;  4JBJ A;  3UDF A;  2YV5 A;  1NTG A;  2UUC L;  3SGI A;  5IYC H;  4DUY L;  2UUB L;  2N78 A;  5LMN L;  3I2Z A;  4A3M G;  2K4K A;  3DLL A;  2UXC L;  1G51 A;  1K3R A;  2K5H A;  3HOZ G;  3TS2 A;  3AFQ A;  1CKO A;  2D62 A;  4DAY B;  3IRB A;  5GQO A;  4DPG A;  1SMX A;  4JV5 Q;  3TRE A;  3TEH B;  4LF4 L;  1BKB A;  4LF8 L;  1JB7 A;  4WJ4 A;  3TRZ A;  2F3I A;  1VQE A;  1CKN A;  3OTO L;  2KCM A;  3GTJ H;  4HJ9 A;  2QA4 A;  2OCE A;  4KHZ A;  4DR3 Q;  1K8A C;  2K75 A;  1VQ7 A;  2K5N A;  1EFW A;  3RZD H;  1I94 L;  4TVA B;  3RR5 A;  4A3J G;  4OX9 L;  4LF9 Q;  1C9O A;  4UPA A;  3J80 c;  4A3C G;  4YWL A;  2MO1 A;  4DV4 L;  2I0Q A;  3H0G H;  1Q1B A;  3M4P A;  1Y1W H;  1RL2 A;  5IYD H;  1DGS A;  4BY1 H;  1QUQ B;  4DV0 L;  1VQG A;  1KAW A;  4DV3 L;  1IBM Q;  1QUQ A;  1IBL Q;  4JI8 Q;  3HKZ E;  3D31 A;  4IPG A;  4JC0 A;  2OQK A;  4BXX G;  2Z6K A;  1KL9 A;  3RN2 A;  1B70 B;  2H5X A;  3PUZ A;  1YBY A;  1YHB A;  4XIG S;  1HZB A;  3U4V A;  1IYJ B;  2KHI A;  2ZM6 L;  1EYG A;  1SN8 A;  1UE6 A;  1V9P A;  4POF A;  4A3D G;  2N8N A;  5BR8 Q;  3KF6 B;  1R9T H;  4B3R Q;  4BA1 I;  2VQF Q;  4HJ7 A;  5GAG C;  4DUZ L;  4B3S Q;  1X56 A;  3Q8D A;  1QZG A;  3KYH C;  4JBW A;  1P16 A;  1Q81 C;  1YVC A;  2MO0 A;  1J5E L;  3S1M H;  4JOI C;  2JK8 A;  2Q2I A;  4JI8 L;  3PO3 H;  4R1J A;  3AYH B;  3K81 C;  2AHO B;  4JI5 Q;  4UY8 C;  4DR7 Q;  1YHA A;  4BBS H;  1D8L A;  4QGU A;  3CCV A;  2B29 A;  4LW1 A;  4DR6 Q;  1VQC A;  5C4X H;  1EUJ A;  1X54 A;  4BBR H;  4GN5 A;  3FKI G;  3B6Y A;  3HOX H;  1PH7 A;  1K8G A;  1HH2 P;  1KIX A;  4NB3 A;  1PH4 A;  3CCE A;  4X65 Q;  1WCM H;  2OWO A;  4R4T A;  4DR7 L;  1LM0 A;  3PUV A;  1YJ9 A;  2F4V Q;  4PZ6 A;  5C44 H;  2JA8 H;  4LF9 L;  3STB D;  1G29 1;  4B3M Q;  1OXV A;  1PH5 A;  1IBK Q;  4A3I H;  5FJ8 H;  3EIV A;  4IJL A;  3FP9 A;  4DUY Q;  3T1Y L;  2BH2 A;  4OO1 G;  1KRT A;  2K5V A;  1PH2 A;  3H0G G;  2VS1 A;  2IT1 A;  5E7N A;  1VQM A;  4NPS A;  1LYL A;  3S14 H;  2UUA Q;  4GNX A;  1TWH H;  4RMF A;  2VZA A;  5IYD G;  4YHH L;  2WFW A;  4C3H H;  5JEA G;  5M3F G;  2F4V L;  2BH8 A;  1W2B A;  4JOI A;  5GAD C;  3HOV H;  5K36 G;  3S1N H;  2R7Z G;  3F1Z A;  1Q86 C;  2I5L X;  2MNA A;  1BBW A;  1L1O C;  4DV2 Q;  2DGY A;  1IL2 A;  1TXY A;  2HQL A;  4NXM Q;  2JA7 G;  3HOY H;  2R93 G;  1YJN A;  4PZ7 A;  4IPD A;  1P8L A;  3CPW A;  1EQR A;  1Q82 C;  5C3E G;  2A8V A;  3GTK H;  3GTG H;  3AFP A;  3NEN A;  1LUZ A;  4IO9 A;  1FJG Q;  1N33 Q;  3GO5 A;  3CMA A;  4DAM A;  3GDE A;  1U5K A;  1XMO L;  1T9H A;  5JEA J;  2K50 A;  5EAY A;  4A93 H;  1NMF A;  1VCI A;  2I5M X;  2N3S A;  4A3M H;  3PCO B;  1C0A A;  1VQN A;  1XPU A;  3A74 A;  3K7U C;  1L0W A;  1FJG L;  3HOW G;  5HY6 A;  1MKH A;  2Q2T A;  1TWG H;  1GVP A;  1M1K C;  4X62 Q;  1XPO A;  2PMZ E;  5FLX c;  3T1Y Q;  3AEV A;  3GD7 A;  3RNU A;  1GO3 E;  3H15 A;  3S17 H;  2IY5 B;  5C4J H;  4GKK L;  3PF5 A;  2NVY H;  2OTJ A;  5JJL A;  3RLO A;  3M4Q A;  1JJC B;  4AYB E;  4JI3 L;  1VQD A;  2AWO A;  4JV5 L;  1HNX L;  1HZC A;  1KD1 C;  3KFU A;  4GLV B;  4A3J H;  3PIO A;  3G6E A;  1FGU A;  1UWV A;  2R6G A;  2YTV A;  3BZK A;  1ASZ A;  1BBU A;  2LSS A;  1B7Y B;  4P71 A;  1EQQ A;  4IFD J;  2WP8 J;  4GOP C;  1U0L A;  4L5R C;  1B8A A;  3JAM c;  2YYZ A;  4X6A H;  2PI2 A;  4MTN A;  2YTY A;  4DV6 Q;  1QZH A;  4Y52 H;  4KI0 A;  4QJF A;  5ELN A;  4X64 Q;  4YHH Q;  2Q2U A;  3CC4 A;  4KHP Q;  3HKZ G;  3I4O A;  3CCM A;  1YEZ A;  3H3V I;  3I4M H;  1I3Q H;  3KOJ A;  3ULJ A;  3F2B A;  2Z6K C;  4QL5 A;  3NEL A;  1NE3 A;  1PH9 A;  2JJQ A;  2NVX H;  1N36 L;  2R7Z H;  2QGQ A;  4LFB L;  1AE3 A;  4LF6 Q;  2HIV A;  1WFQ A;  4YY3 L;  4O0A A;  4KHP L;  4QQB X;  4JI2 L;  1WOC A;  4LF4 Q;  4B3M L;  3L7Z C;  1SRU A;  3CD6 A;  5GRO A;  3S16 H;  3L0O A;  2PNH A;  2JA5 H;  3W1G A;  4YY3 Q;  4QIW E;  4HIO A;  1YHQ A;  3E9H A;  4DUZ Q;  1K9M C;  3PO2 G;  4A76 A;  2RHQ B;  4R4I A;  3M85 A;  4HIM A;  3PO3 G;  4A3L G;  1VQH A;  4KLK A;  2B63 H;  1UE1 A;  2NVQ H;  4C3I H;  4YWM A;  2R7D A;  5M3M G;  3HOW H;  1VQ6 A;  1CUK A;  4NXN L;  4LF7 L;  3FKI H;  2ZJP A;  1VQB A;  4R4O A;  2AWN A;  2RF4 A;  4P73 A;  3RN5 A;  4BBR G;  3HOX G;  4JBK A;  2K14 A;  2JA8 G;  4A75 A;  1NMG A;  1Z9F A;  4GLX A;  2E5L L;  4B3S L;  4R4Q A;  2VQE L;  4AIM A;  1PH3 A;  2YU9 H;  1L2F A;  1YNX A;  1TWF H;  3KF6 A;  4A3C H;  3MEF A;  4JI0 L;  2E2H H;  2VW9 A;  4DV1 Q;  1XMQ Q;  3ERS X;  1H95 A;  4PZ8 A;  2WB1 E;  3UDX A;  4LF8 Q;  4IJH A;  5M5X H;  1Y1V G;  4A3B H;  2V1C C;  1X6O A;  2C35 B;  1N9W A;  2EXD A;  1I6H H;  3CME A;  4A3E H;  4DR2 Q;  2PQA B;  3K8A A;  3M9B A;  3D0F A;  3K0X A;  2VQE Q;  4BXX H;  3HKS A;  4AQY Q;  5ELO A;  4DKA C;  3PV0 A;  2E2I H;  2E5L Q;  1N36 Q;  3L2P A;  3KLW A;  5M3F H;  3S2D H;  2ZTC A;  5LMN W;  3CCS A;  3HOV G;  2CQO A;  5M5Y H;  3CC2 A;  1YZ6 A;  4PMW A;  3WWV A;  4JI4 L;  3EN2 A;  2LXJ A;  1FVI A;  1HZ9 A;  1PYS B;  3K80 C;  2PI2 E;  3GTL H;  3PGZ A;  4GLA C;  3ULL A;  1HNW Q;  2LXK A;  3OYY A;  5JJI A;  1XNQ L;  3M3Y H;  3HOU H;  2MQH A;  4JI4 Q;  2ZTD A;  3PF4 A;  2UUB Q;  4IOC A;  4UP9 A;  3E9I A;  1A62 A;  1SR3 A;  3CCJ A;  2VL6 A;  1PA6 A;  2E2J H;  4AYB G;  2KEN A;  3H3V H;  1CKN B;  1XNQ Q;  3J81 c;  4EQ5 A;  4JI3 Q;  1GD7 A;  3G71 A;  3EBE A;  1N32 Q;  1JJ2 A;  4OO1 I;  4LFA L;  1I50 H;  4YCV A;  5IYB G;  4NXM L;  2RCN A;  3RLN A;  3PUY A;  4C3J H;  3J7A 5;  4HJA A;  1WCM G;  4DR1 Q;  1EOV A;  3I4N G;  2N49 A;  3FHW A;  4A3F G;  1VS0 A;  4X62 L;  5C0X I;  4A3K H;  2CWA A;  2RHS B;  3GTO H;  2Y0S G;  2EQS A;  1EIY B;  2BA1 A;  1X3G A;  4DV5 L;  1SFO H;  1PHJ A;  1V43 A;  5JJK A;  1S72 A;  1J5E Q;  3CCL A;  4TQU S;  3W1B A;  5H1S E;  3J81 j;  3CC7 A;  1TWC H;  3OW2 A;  1S3O A;  1XMQ L;  5IP9 H;  1JE5 A;  3JC6 6;  2UXD Q;  1X65 A;  4L5Q A;  2Z0S A;  4JBM A;  4GN3 B;  3CCU A;  2ZJQ A;  1UEB A;  4A3B G;  1VQL A;  2ATW A;  1SRO A;  4AQY L;  2JE6 I;  1VQF A;  3CQZ H;  1WJJ A;  1TWA H;  3J7Z C; 
#chains in the Genus database with same CATH topology
 4G7H C;  4HJ8 A;  1IZ6 A;  2CKZ B;  3OOC A;  3SK8 A;  5IT9 E;  2A6E D;  2XGT A;  3KDF B;  2GVB A;  1DZ1 A;  1II3 A;  2F3V A;  4HIK A;  1ONL A;  1IYV A;  4JI6 Q;  4CBV A;  1PVO A;  1A63 A;  1N34 Q;  4F8M A;  4DR5 L;  5M3M H;  4X3S A;  2NN6 I;  5IGD A;  2FHT A;  1WYD A;  3JAM i;  3HOW B;  2PZT A;  2NVQ B;  1KAA A;  2RSN A;  4J15 A;  2CFM A;  1R4Q B;  1AZQ A;  3VYR A;  3NBI A;  1QOH A;  1H9M A;  3VYS A;  1NSN S;  2R3Z A;  1E24 A;  1LTL A;  4OWX B;  1B2T A;  3G4S A;  4OON A;  5C4X B;  1VQP A;  1JR0 D;  2DUD A;  1Y8O B;  5EPK A;  5DM6 3;  2YTX A;  5C44 B;  2HCC A;  2IX3 A;  3F2D A;  5C3W A;  3TP5 A;  1IBL L;  4KK7 A;  2Q8I B;  1L1O A;  1L1O B;  1X3P A;  1EIH A;  1AE2 A;  1F9Q A;  3J80 E;  2A6H D;  5FK9 C;  5EKL A;  4P72 A;  4S3S A;  1Z47 A;  1HQM C;  5I2Y A;  1JT8 A;  2DY8 A;  2B63 G;  1E1T A;  2ICE C;  4RHS A;  3VR4 A;  2CQA A;  4MNO A;  3J81 i;  1VQA A;  3DUZ A;  2O4X A;  1OXS C;  1CI3 M;  4DU9 A;  1RDP D;  2CCZ A;  1H9K A;  1KTK A;  1ASY A;  3SK4 A;  1MHW C;  1BVS A;  3LWU A;  3GP7 A;  3GTM H;  2HT1 A;  3SHL A;  1E3P A;  4UP8 A;  5I9P A;  2SNM A;  2K32 A;  4DV6 L;  5IGB A;  2R61 A;  5HGQ A;  2EOT A;  3TDQ A;  4GN4 B;  3U50 C;  4UAI A;  1SBB B;  4CKC A;  1J6Q A;  3TZU A;  3T1H Q;  4R4C A;  2WB1 G;  5J3B A;  1JJG A;  5EKK A;  2JA7 H;  4BA2 I;  3F2C A;  5C5L A;  4K0K L;  4JCV E;  3GTQ H;  4O42 A;  5L37 A;  2F0U A;  1F9R A;  1A8V A;  1NCV A;  4L5T A;  1BCP D;  1TWG B;  2ZXO A;  1A2U A;  5FOB B;  1SMY D;  2F0Q A;  4DF7 A;  3S24 A;  2WB1 B;  2F0F A;  4XQJ A;  3CAM A;  4HJ5 A;  5C4J B;  3A5Z B;  3F8T A;  4A3F H;  1UUP A;  2J4X A;  4GKJ L;  3CXC A;  3OSO A;  2UXB L;  5AJ3 L;  1E2Z A;  4DK0 A;  3A8J E;  4C1N K;  5JVG 3;  3ICE A;  1BBX C;  5IY0 A;  2I5H A;  2K1B A;  1PYW D;  3I72 A;  2IHF A;  1BQQ T;  3VDY A;  4IQZ A;  3MFY A;  2WAQ G;  1ENC A;  2LMC B;  3RZD B;  4DV3 Q;  5K36 H;  5E3F A;  2K52 A;  3U58 A;  5EGT A;  3BJU A;  4YCW A;  2PMZ B;  2A1A A;  3HS0 C;  1PV4 A;  3E0J A;  4P75 A;  2CH4 W;  1KRS A;  1G2S A;  5K5P A;  5A2Q L;  3UDF A;  2LY7 A;  5IYC H;  5LMN L;  3I2Z A;  1D6E C;  4RHR A;  1UNS A;  4DPG A;  4EQO A;  1SMX A;  1HQR D;  1VF5 C;  2FMC A;  4WJ4 A;  1VQE A;  1ET6 A;  3JAM L;  3H6M A;  1K8A C;  1SYB A;  2K75 A;  2L0C A;  3D6C A;  2F0H A;  1EFW A;  3RZD H;  2Y0S B;  3QR8 A;  1FNU A;  4HMJ A;  1C9O A;  1MI2 A;  4UPA A;  4DNT B;  3S1Q B;  2MO1 A;  5M5X B;  3V2T A;  3H0G H;  1EYC A;  4QIW B;  4CKB A;  2N88 A;  1BF4 A;  3W2D A;  1IBM Q;  4JI8 Q;  3D31 A;  3HKZ E;  4BXX G;  1C8C A;  2Q8T A;  3RN2 A;  3KBG A;  2H5X A;  2F4I A;  2L1B A;  3U4V A;  1IYJ B;  4PV1 C;  1UE6 A;  1GUW A;  1WD1 A;  2SOB A;  5DEH A;  4BA1 I;  4DUZ L;  4B3S Q;  1X56 A;  1A2T A;  2A74 C;  3EQL C;  3SXH A;  4C3I G;  1CA6 A;  3S1M H;  3NWS A;  4JOI C;  4R1J A;  1FYC A;  3AYH B;  3IFD A;  3K81 C;  4JI5 Q;  4DR7 Q;  2B29 A;  4RCO A;  1R4P B;  4HCE A;  1V1O A;  1GUG A;  3J80 L;  2OWO A;  1WCM H;  5CBE E;  3SK5 A;  4DR7 L;  2K5Q A;  2RDF A;  1YJ9 A;  2DNC A;  2JA8 H;  5C44 H;  1IW7 D;  1ENA A;  4IUT A;  3JAM E;  3DXJ C;  3VYT A;  4IJL A;  4WJW A;  3PMF A;  1M8A A;  3HOU B;  2AUJ D;  4GNX A;  1TWH H;  2WFW A;  5C5M A;  1STN A;  4RAU C;  2I5L X;  2MNA A;  1PDQ A;  5FLX L;  3HOY H;  1TXY A;  1YJN A;  4PZ7 A;  2ZXR A;  1Q82 C;  2A8V A;  3EVQ A;  4ZAI A;  2OXP A;  3H09 A;  3GTG H;  3K5N A;  4MN3 A;  2B2V A;  4LAA A;  1N33 Q;  4FYD A;  3A8I E;  4G7Z C;  5JEA J;  4A3M H;  1SDF A;  2G5D A;  1B4O A;  1FJG L;  1STE A;  1MKH A;  2Q2T A;  5F2D A;  1BO0 A;  3VYU A;  1E2W A;  4WFN 3;  3AEV A;  3RNU A;  2IY5 B;  2NVY B;  3BS1 A;  5JJL A;  3M4Q A;  1PRT D;  2I46 A;  2RA4 A;  2AWO A;  1HZC A;  3KFU A;  4LFB Q;  1ZEQ X;  1FGU A;  2LSS A;  5E1F A;  4C1N I;  3A54 A;  4HCS A;  4P71 A;  2WP8 J;  4L5R C;  1AW7 A;  1ZKO A;  2YYZ A;  2PI2 A;  1G6Z A;  1LTR D;  4MTN A;  4JPB W;  5JJZ A;  1QZH A;  5ELN A;  4YHH Q;  2Q2U A;  2B2U A;  5DNF A;  3HZX A;  3PO2 B;  1SND A;  5C6A A;  1V1P A;  1A3T A;  3ULJ A;  2Z6K C;  2JJQ A;  3PQI A;  4LFB L;  4YY3 L;  4O0A A;  3FMC A;  3H0G B;  3T53 B;  4QQB X;  4ILW A;  4LF4 Q;  2D2C C;  1SRU A;  1H9R A;  5GRO A;  3SR1 A;  3U9O A;  3CD6 A;  4YY3 Q;  3NTH A;  4HIO A;  1EEF D;  3ZYY X;  2MHV A;  1JWS D;  2HDL A;  3PO2 G;  1HRJ A;  5G3L D;  3PO3 G;  4KLK A;  4A3J B;  2NVT B;  4CKE A;  5FO8 B;  5M3M G;  1CUK A;  1GUN A;  3I91 A;  4NXN L;  3T56 B;  1TS4 A;  1PZI D;  2MP1 A;  3P7J A;  1D1K A;  2AWN A;  3I8Z A;  2RF4 A;  4P73 A;  3RN5 A;  2QW7 A;  1QIL A;  1NMG A;  2E5L L;  1M4V A;  2VQE L;  1JIC A;  3X3M A;  2YU9 H;  2X6G A;  4A3C H;  1TWF H;  3PO3 B;  1PFM A;  3SDZ A;  1PLF A;  1D5Z C;  4C3H G;  4BXX H;  4AQY Q;  4E6I A;  2MUY A;  2E2I H;  2NUC A;  5LMN W;  1SNM A;  5M5Y H;  4PMW A;  2PPB C;  3EN2 A;  1FVI A;  3K80 C;  5DAU A;  3GTL H;  3GTQ B;  3ULL A;  2LXK A;  3I4N B;  5CV4 A;  4DFA A;  2UUB Q;  3PF4 A;  4KD4 A;  4UP9 A;  3E9I A;  1A62 A;  4AYB G;  3S15 B;  1QB5 D;  1IL8 A;  4CDE C;  2RKS A;  3HOY B;  3OMC A;  3J81 c;  3S2H B;  1GD7 A;  1CQF A;  2L9H A;  1C4Q A;  4LFA L;  5IYB G;  1RD9 D;  2AUK A;  3FPP A;  5EQ0 A;  1WCM G;  4DR1 Q;  1EOV A;  3I4N G;  1JE4 A;  1VS0 A;  1X3Q A;  1X3G A;  2KEE A;  4DV5 L;  1PHJ A;  3ITP A;  1S72 A;  3R2I A;  4TQU S;  3W1B A;  5H1S E;  3J81 j;  2UXD Q;  3FKI B;  3JC6 6;  4L5Q A;  1O7L A;  3H94 A;  4I7A A;  1V8Q A;  1EL0 A;  5IGF A;  4BY7 B;  5IGE A;  2SDF A;  1TWA H;  3T16 A;  1IXR A;  4AYB B;  3BZC A;  3O13 A;  1TS2 A;  2D0O A;  4DNR B;  3PIP A;  3M7G A;  1KAB A;  5CV5 A;  5BN4 A;  3MXP A;  4LF5 L;  2JA9 A;  3C1E A;  4DR1 L;  1CSP A;  1JMC A;  5DLQ E;  1X3F A;  2F1M A;  3A55 A;  1ILQ A;  3VR6 A;  3PO2 H;  4A3L H;  3PSI A;  3OWE B;  4OIJ A;  1YI2 A;  3VA5 A;  1VQ9 A;  5IOC A;  1NNX A;  2KA7 A;  1ESR A;  4X66 Q;  4C2M H;  1K28 A;  1O7Y A;  1HNX Q;  4FF3 A;  2K03 A;  3IL8 A;  2R92 H;  2J7Z A;  2OT2 A;  3LX0 A;  4L8J A;  1N34 L;  2RSO A;  4POG A;  3UE1 A;  3ULP A;  2F3W A;  3CCQ A;  2Q2H A;  2HIX A;  1LT3 D;  1SJH D;  1W6K A;  4MIU A;  4Y7N H;  1M90 C;  3SVM A;  1J8I A;  1CFM A;  5IP7 G;  5FLM H;  2PQA A;  1N32 L;  3BDL A;  5IWA L;  2EIF A;  1A0I A;  1HUN A;  4B3T L;  1EQV A;  2RDH A;  1SSO A;  4KTA A;  1Q7Y C;  2GA4 B;  1ROD A;  2Z6B A;  4JI5 L;  4O2D A;  3GTP B;  5I6Y A;  1HNZ Q;  3T13 A;  2JA5 B;  1F9P A;  4A3F B;  2KQ3 A;  2Y0S E;  3MVV A;  2MJ8 A;  5G3L F;  5JPN C;  3UE0 A;  4NXN Q;  1HXY D;  3TSS A;  3IAY A;  1KC8 C;  2A69 D;  3PIP 3;  3HRZ C;  4FXD A;  5FO9 B;  3I4N H;  4P74 A;  1EIF A;  3QWN A;  3TN2 A;  4DR4 L;  1HA5 A;  3OPO A;  3BU2 A;  5IP9 G;  1IYU A;  1BOS A;  1PMR A;  4A3I B;  1EU3 A;  1K0R A;  2L11 A;  4IUP A;  1IBK L;  1MIU A;  1PFS A;  4RKB A;  5A35 A;  1NR4 A;  4NW2 A;  4OO1 H;  4A3B B;  5JAV A;  2P5Z X;  1B53 A;  1PTO C;  4HR7 B;  2CWP A;  2VXW A;  2EXZ A;  2FXQ A;  2EYP A;  2NTS A;  4DAP A;  5CGK A;  5M5W H;  4YCU A;  3C3L A;  2A69 C;  4DR2 L;  1TVX A;  1HZA A;  4JG2 A;  1A3V A;  2IX0 A;  1NAP A;  3D4D A;  4XT3 B;  2KED A;  1I4Q A;  1D1I A;  5GAH C;  3UDI A;  4DV0 Q;  4LNQ A;  1WVL A;  5IYB H;  2JA6 B;  1HA6 A;  3CW2 C;  1PFN A;  3W5O A;  2D0P A;  1EWI A;  1D5X C;  3PIO 3;  2R92 G;  1N33 L;  2TSS A;  1AEX A;  1TU2 B;  1U4M A;  1I94 Q;  2OQ0 A;  1UE5 A;  1U4R A;  2E2I B;  4PG3 A;  4XTC S;  5DM7 3;  3RLF A;  4IN3 A;  1EIG A;  4DV2 L;  4MZ9 A;  1D7Q A;  4K5V A;  2BOS A;  1XNR L;  1KDA A;  2K33 A;  2IL8 A;  3P1H A;  3S1R H;  4DV1 L;  4O1N A;  3KJO A;  1VQ8 A;  5LL6 S;  4HSV A;  4KY5 A;  2WAC A;  3J81 L;  1V1Q A;  5C4H A;  1X9N A;  1WTQ A;  2UUC Q;  4JYA L;  5ELD A;  2RQX A;  4LF7 Q;  1TS3 A;  2F0K A;  2JA6 G;  3KLS A;  1FL0 A;  3IKJ A;  1XTC D;  5EJW A;  4B9X A;  5C0X H;  1NJI C;  4Y7N B;  1F9S A;  3A7L A;  2YV5 A;  1NTG A;  3OIQ A;  4DAV A;  4A3M G;  2KCC A;  2K4K A;  2LKV A;  3DLL A;  1G51 A;  1K3R A;  1CKO A;  4DAY B;  2XRQ D;  3F2U A;  3TEH B;  1BKB A;  3RZO B;  3TRZ A;  5KEE A;  2F3I A;  4HJ9 A;  2F0M A;  1HFN A;  4IFD H;  1SE3 A;  1QWY A;  2KEC A;  3SE0 A;  1Y8N B;  3RR5 A;  3E5S A;  4CDF C;  4A3J G;  4OX9 L;  4CDD C;  3J80 c;  4DV4 L;  1W6J A;  1XWE A;  1Q1B A;  4R8N A;  3M4P A;  5I6W A;  5BN5 A;  1DJR D;  1VQG A;  1KAW A;  2PO4 A;  2JSO A;  4YIJ A;  1GUS A;  4FF4 A;  2Z6K A;  1B70 B;  2CHB D;  1YBY A;  2HUG A;  4M8A A;  1TKW B;  5ELB A;  1HZB A;  2KHI A;  4POF A;  5BR8 Q;  2WV6 D;  3L3O C;  4OIK A;  3BDC A;  2DN8 A;  3KYH C;  1KDC A;  4JBW A;  1P16 A;  3KK7 A;  3Q6S A;  1YVC A;  3G7L A;  1SE2 A;  5C3E B;  1PTO H;  2Q2I A;  3PO3 H;  4UY8 C;  2AHO B;  1YHA A;  1D8L A;  4QGU A;  4LW1 A;  1WD0 A;  1AN8 A;  5C4X H;  4BBR H;  2DY7 A;  3HOX H;  1K8G A;  1HH2 P;  4NB3 A;  4X65 Q;  2AQ2 B;  1LM0 A;  2M9V A;  4PZ6 A;  3K5L A;  3STB D;  1NUC A;  2B2T C;  3EIV A;  3FP9 A;  5E4X A;  1EYA A;  4JK1 C;  4OO1 G;  2FFK B;  3KBX A;  1PH2 A;  2XRS D;  5LHY 1;  3H0G G;  2IT1 A;  5E7N A;  1QE6 A;  1ZYR C;  2UUA Q;  4YHH L;  2F4V L;  4C3H H;  2BH8 A;  1W2B A;  4JOI A;  2R7Z G;  3F1Z A;  1Q86 C;  4DV2 Q;  1IL2 A;  2DGY A;  4XT1 B;  2JA7 G;  4NXM Q;  2O5I C;  4IPD A;  3CPW A;  5C3E G;  1GOZ A;  3AFP A;  3KUP A;  1Y1W B;  1MSH A;  4IO9 A;  3N6R A;  4I7Z C;  4N8F A;  4DAM A;  1T9H A;  5EAY A;  1Q3L A;  2I5M X;  4V19 0;  3PCO B;  1LV9 A;  1XPU A;  3HOW G;  2BE5 C;  1TWF B;  2I07 B;  1CHP D;  1K8M A;  2EJM A;  3IFT A;  4ZLT F;  1GVP A;  3GV6 A;  1XPO A;  4C3J G;  3GD7 A;  1GO3 E;  5CC4 A;  3H15 A;  1SE4 A;  2NTT A;  4B08 A;  3S9W A;  1ZYR D;  2ZXP A;  1A15 A;  1SFO B;  4AYB E;  1VQD A;  1TWA B;  4JV5 L;  1EU4 A;  2KVM A;  3MTS A;  4GLV B;  4WOR A;  3G6E A;  5D3I B;  2YTV A;  1B7Y B;  4BBS B;  4GOP C;  1U0L A;  3JAM c;  1STH A;  1RHP A;  4DV6 Q;  3Q23 A;  4RGT A;  5CV9 A;  3CC4 A;  4KHP Q;  1DM0 B;  1HHV A;  2K01 A;  3I4O A;  3CCM A;  4MTK A;  3H3V I;  3I4M H;  1I3Q H;  3KOJ A;  1T5E A;  5HUR A;  2EPB A;  2MPM A;  1Y69 U;  2QGQ A;  1WTX A;  4LF6 Q;  3DWA A;  5EBD A;  4KHP L;  4CJ2 C;  4JI2 L;  4I65 A;  2F0I A;  3L7Z C;  5IGG A;  2F0D A;  2WIN B;  1WTV A;  3E9H A;  3S2D B;  1K9M C;  3K58 A;  2RHQ B;  4R4I A;  1B50 A;  2PCF B;  5COY A;  4A3L G;  2Z9H A;  1MD2 D;  2EYH A;  3GTK B;  4YWM A;  1XXG A;  1G91 A;  2B2V C;  4K8J A;  1LTI D;  3VA7 A;  5A2Q E;  1Z9F A;  4A75 A;  4LMQ D;  4B3S L;  3DHQ A;  3EFX D;  5FLX E;  1VMP A;  2QF7 A;  1YNX A;  2PW5 A;  2E2H H;  2EY1 A;  1PRT C;  1XMQ Q;  3ERS X;  1DD2 A;  3K5O A;  2C35 B;  1N9W A;  3CME A;  4A3E H;  3K8A A;  3M9B A;  2WAQ B;  3E6Z X;  3K0X A;  2VQE Q;  4A3K B;  3HKS A;  3DWP A;  5ELO A;  3PV0 A;  3ERQ A;  2E5L Q;  4XXE A;  3S2D H;  2ZTC A;  2HCI A;  2EY5 A;  3HOV G;  2TMP A;  3P75 A;  5I4D A;  2LXJ A;  1EYD A;  2NZ1 D;  2K05 A;  2KOL A;  5CV8 A;  2B8G A;  3PGZ A;  4GLA C;  3OYY A;  3M3Y H;  1B1Z A;  3K0Y A;  3TP7 A;  3OMG A;  1SR3 A;  1DXM A;  1CKN B;  1EZ8 A;  1XNQ Q;  1SAP A;  4EQ5 A;  1N32 Q;  4HSP A;  1I50 H;  2F0E A;  3OIP A;  4YCV A;  3MHB A;  2H4O A;  3BDO A;  1B9N A;  4ME5 A;  1SYE A;  3PUY A;  1WCM B;  3NQT A;  3NUC A;  2N49 A;  3FHW A;  1A3U A;  5C0X I;  2Y0S G;  2EQS A;  1EIY B;  2BA1 A;  2XNA C;  5CBA E;  1VDZ A;  1FD7 D;  1V43 A;  5LL6 X;  3CCL A;  1I4R A;  1U9R A;  4J6H A;  5IP9 H;  2G9H D;  4GN3 B;  4OGQ C;  3CCU A;  3T4A C;  3VR2 A;  3C46 A;  2RBM A;  3CQZ H;  3E3X A;  1QG7 A;  2C9O A;  4NXM L;  4DR5 Q;  2KCT A;  1PRT F;  2ZJR A;  4ZK9 B;  4L5S A;  1JOO A;  4K5X A;  3N52 A;  3S2H H;  1XNR Q;  1Q8K A;  5FKA C;  2ID0 A;  4JI2 Q;  1ESF A;  3QOL A;  4BBR B;  1GM5 A;  4ALP A;  3HOX B;  3X3N A;  3PUX A;  1PYB A;  2VUM H;  4DK6 C;  2NZO A;  2JA5 G;  2B2Y A;  1G6P A;  3A5U A;  2DJF C;  3J7A F;  3MC0 B;  5EPL A;  3HOZ H;  4OX9 Q;  2A68 D;  4JVZ A;  3GTM B;  3I7F A;  1WTO A;  1SNC A;  3ZJY C;  3D8G A;  5IE8 A;  4KV6 A;  1LTS D;  1SMY C;  1W3S A;  2BE5 D;  3NBH B;  4DR4 Q;  3TS0 A;  1VQ5 A;  2C5C A;  4EX5 A;  1WI5 A;  3NBH A;  4DV7 Q;  1QVG A;  4KY6 A;  1RKN A;  4JI6 L;  1CT1 D;  4HED A;  4EGV A;  1LAC A;  1IKM A;  2VNU D;  3CP0 A;  3EA6 A;  4ABN A;  4A3E G;  4PNY A;  4GS3 A;  4KKS A;  4DV7 L;  3L9A X;  2UXB Q;  5BR8 L;  2O2L D;  1H9S B;  2ASB A;  4G7O C;  2B2Y C;  3I4M G;  1H9S A;  3PUW A;  1PXU A;  1WTP A;  3M7N A;  1VQO A;  1F77 A;  2WKD A;  2RCF A;  4IOA A;  2UXC Q;  2E2H B;  4IUU A;  3K7A H;  1NY4 A;  2XTI A;  3NPP A;  2NVX B;  4GOP A;  1U4L A;  5KND A;  4FDB A;  4A3D H;  4A3E B;  4QMG A;  5T1I A;  5C0X G;  1CZW A;  4HMI A;  1QVF A;  1VQ4 A;  5IYC G;  3S16 B;  1CKM A;  1DOM A;  2R92 B;  2EYL A;  2WAQ E;  1XMO Q;  4LFC L;  4QY7 A;  1AH9 A;  1AP0 A;  1FGB D;  2PZU A;  1YIJ A;  4JI1 Q;  3CPF A;  5CV7 A;  3NTK A;  4F88 A;  1F2Z A;  3E0E A;  4DK3 C;  1I5F A;  2ZM6 Q;  2ES2 A;  1SEB D;  5CYU A;  4WJ3 M;  5J39 A;  2B3G A;  4XYQ A;  5I2X A;  1KNE A;  1OXX K;  3AQQ A;  2L15 A;  1IBM L;  2A19 A;  2XWB B;  2F0L A;  3A7A B;  2M2L A;  4FF2 A;  1DCZ A;  1DOK A;  1E2V A;  1Q12 A;  1Y14 B;  2PZW A;  4DXF A;  4A3I G;  4F87 A;  4FVM A;  1LAB A;  5FJ8 G;  4L63 B;  1HNW L;  3I90 A;  4RG1 A;  1K73 C;  1PTO F;  3NEM A;  2K28 A;  2OEO A;  5IP7 H;  5FLM G;  1HR0 W;  2OTL A;  2UU9 L;  3RUZ A;  4GNX C;  3A0J A;  4BY7 H;  3VR5 A;  4X66 L;  3M4O H;  2AQ3 B;  2R7F A;  4IUV A;  4LFA Q;  4RFB A;  4XYO A;  2SNS A;  4IPH A;  4HTH A;  4FNF A;  2VUM G;  4A3M B;  4A4I A;  1XJV A;  2SEB D;  4IPC A;  2B2W C;  3DM3 A;  4KJN A;  3CCR A;  4JI7 Q;  1V1P B;  3G6J B;  4LF5 Q;  2UU9 Q;  5LMU L;  1YNN C;  1JWU D;  1MJC A;  3GQB A;  5M3M B;  4LUO A;  3J7A V;  1YIT A;  5C4X G;  1S4Z A;  5JPM C;  3ER0 A;  2UXD L;  1B9M A;  1UEA B;  3I73 A;  1LTT D;  3S14 B;  5C44 G;  4AH6 A;  1G8Z D;  1SE8 A;  1HR0 L;  3D3R A;  4A3G H;  3CF5 A;  3BYY B;  4RGN A;  1HCZ A;  2JXM B;  5D3D A;  4GKK Q;  1Y1W G;  3KLR A;  1E22 A;  2NN6 G;  4GNX B;  4K0K Q;  4X64 L;  4OL7 A;  5KIX A;  4LUV A;  5AJ3 Q;  5JEA H;  4LFC Q;  3HOY G;  1YJW A;  2F0J A;  4GKJ Q;  1TY2 A;  1PTO D;  1EY4 A;  1GJX A;  3UDG A;  3HFZ B;  4OWT B;  3LGJ A;  1TQO A;  3GTP H;  4JBJ A;  2UUC L;  4UHV A;  3MXG A;  2N78 A;  2UXC L;  3R2T A;  3HOZ G;  3AFQ A;  1S5F D;  1CTM A;  3ND9 A;  1B44 D;  4K5W A;  2QEJ C;  3FEW X;  1CKN A;  3OTO L;  1GXD C;  2OCE A;  3OWF A;  4KHZ A;  4DR3 Q;  2E2D C;  4Q0F A;  2ICI A;  1VQ7 A;  2K5N A;  4FF1 A;  3HG9 A;  1I94 L;  4LF9 Q;  2MGS A;  3ONA B;  2OF1 A;  4YWL A;  2I0Q A;  2J0T D;  2EY6 A;  4CHT B;  1FR3 A;  1Y1W H;  1RL2 A;  5IYD H;  4DV0 L;  1S5B D;  3T51 B;  2NN6 H;  1CK1 A;  1QUQ A;  1IBL Q;  4JC0 A;  4IPG A;  1KL9 A;  1F2Y A;  3D4R A;  3PUZ A;  2K5D A;  1SYF A;  4A3D G;  3HGB A;  2NB0 A;  3KF6 B;  1R9T H;  4HN7 A;  3K57 A;  5GAG C;  1TII D;  2HDM A;  1QZG A;  3HOV B;  1HFG A;  1D2B A;  1LO5 D;  3S1N B;  1Q81 C;  1PTO B;  3NSW A;  1PRT B;  2JK8 A;  4JI8 L;  1I4X A;  4ZRZ A;  4BBS H;  1VQC A;  1EUJ A;  1X54 A;  1PH7 A;  3FKI G;  3B6Y A;  1Z6H A;  2L55 A;  1I6H B;  3K6O A;  4C3J B;  2EE1 A;  5IGC A;  4R4T A;  3WDN A;  2XN9 C;  3PUV A;  4FO2 A;  2F4V Q;  1G29 1;  1PH5 A;  3H91 A;  1QNK A;  2LS0 1;  1CHQ D;  4DUY Q;  1GUT A;  2D9U A;  2K5V A;  4PQX A;  2VS1 A;  1CQV A;  1VQM A;  4NPS A;  2QDL A;  3MZ5 A;  3S14 H;  1EY0 A;  2Z1C A;  2BDN A;  1C48 A;  4RMF A;  5IIF A;  5JEA G;  5IOD A;  5GAD C;  1TWH B;  5K36 G;  1UAP A;  2Z4H A;  4BS9 A;  2JA7 B;  2L5T A;  5M5W B;  3GTK H;  1Z7T A;  1EQR A;  1GHK A;  1PFB A;  4N9P A;  1LUZ A;  2XSC A;  4FXK C;  1FJG Q;  3V05 A;  3GO5 A;  3CMA A;  3GDE A;  3FDT A;  4M1U B;  4OHJ A;  1NMF A;  2N3S A;  3BYT B;  4MHE A;  1C0A A;  3A74 A;  1L0W A;  4N9T A;  5HY6 A;  1T5X D;  3UI2 A;  3DEO A;  1HPC A;  1PZJ D;  5ELE A;  1JC7 A;  3QJY A;  3D6W A;  4LJZ C;  4KJO A;  5CR3 A;  3TP8 A;  1CZG A;  5C4J H;  3PF5 A;  5J22 A;  3S17 B;  4KMU C;  2OTJ A;  3RLO A;  3MWY W;  1YNN D;  4KD3 A;  4CDC C;  1HNX L;  4B3R Q;  1O80 A;  2G9D A;  1ASZ A;  2B63 B;  1UWV A;  2R6G A;  2DNE A;  3BZK A;  1BBU A;  1ICW A;  1O78 A;  2RDG A;  1I6V C;  2EJF C;  3H3V C;  1STB A;  2A68 C;  3LNN A;  2H1E A;  4RA8 A;  4H44 C;  4K2L A;  3F2B A;  3NEL A;  4RKL A;  4IAL A;  1PH9 A;  2A5H A;  1B3A A;  2Q8R E;  2R7Z H;  1AE3 A;  1WFQ A;  2IWH A;  4B3M L;  4ZKB B;  3S16 H;  4Q5V A;  1E0B A;  5KGU A;  2PNH A;  4TKO B;  4ZCK A;  3W1G A;  1YHQ A;  4KY7 A;  1SNP A;  3QB3 A;  1HTP A;  3A8K E;  4A76 A;  3P20 A;  4HIM A;  1BXT A;  1VQH A;  2CVR A;  2NVQ H;  1EOT A;  2EYM A;  3HOW H;  2R7D A;  4KN7 C;  1IW7 C;  2F0S A;  4CJ0 B;  2M00 A;  1JQY D;  3FKI H;  4LF7 L;  2ZJP A;  4R4O A;  1Q90 A;  4EQN A;  1EQT A;  1BCP B;  4JBK A;  2K14 A;  4GLX A;  1KNA A;  2EYF A;  4R4Q A;  3R8B A;  3TME A;  2K6A A;  3MEF A;  4JI0 L;  3CKI B;  2VW9 A;  4DV1 Q;  1MBY A;  1WTR A;  1OO9 B;  2WB1 E;  4LF8 Q;  2CH4 A;  3A56 A;  4A3B H;  1Y1V G;  1X6O A;  2EXD A;  3NTI A;  1I6H H;  2PQA B;  4DXG A;  5KNB A;  4DKA C;  2A6E C;  3C2P A;  1N36 Q;  5M3F H;  4H13 C;  3CCS A;  1I4P A;  2AQ1 B;  2PI2 E;  1HNW Q;  5JJI A;  2F0G A;  2MQH A;  3GTG B;  2ZTD A;  3BG3 A;  4QCL A;  5D14 A;  1A6X A;  1PA6 A;  2VL6 A;  2E2J H;  2V4D A;  3H3V H;  3NP8 A;  4TRD A;  5KYL A;  1GUO A;  3EBE A;  3WOF A;  2R93 B;  3S1M B;  3MAQ A;  4QUF A;  1DON A;  1SJE D;  3J7A 5;  4HJA A;  4K6L A;  4EVO A;  4A3F G;  4X62 L;  4A3K H;  3GTO H;  4CGY B;  3NWT A;  2HD3 A;  5JJK A;  2B2T A;  2JA8 B;  4LK1 C;  3CC7 A;  1TWC H;  4XDX A;  5ISR A;  4PMB A;  1U4P A;  5AFW A;  2Z0S A;  3Q0A A;  1B3Q A;  3CQZ B;  4A3B G;  3CU7 A;  5NUC A;  2ATW A;  1SRO A;  2F0P A;  2BCO A;  3DM1 A;  2JE6 I;  1VQF A;  3MFG A;  1DOL A;  1TR5 A;  4NP5 A;  3G48 A;  1EY5 A;  3R93 A;  2WKC A;  4FP5 D;  3QG1 A;  1N8R C;  3S1Q H;  1XPR A;  2ZT9 C;  4BWG B;  1VQK A;  1ZXT A;  4IUR A;  3KJP A;  1EY7 A;  1MSG A;  4LF6 L;  1SNQ A;  3KDF A;  2ENB A;  1RF2 D;  2NZH A;  5E4W C;  3J80 i;  2B39 A;  4F7X A;  3BVM A;  3I56 A;  4IFD I;  4A93 B;  3NK9 A;  2JEA I;  2EZV A;  2PYK A;  4HAE A;  5JVH 3;  3BVZ A;  1K3B C;  1SLJ A;  4DGZ A;  1KQS A;  4WRD A;  5IT9 c;  2NVT H;  4G57 A;  3ERO A;  3U4Z A;  1PH6 A;  1VF7 A;  3T1H L;  1H9J A;  4XQQ A;  2F52 A;  4LWC A;  1XTD A;  2F03 A;  4CJ1 B;  5IWA Q;  1L0Y B;  3TZD A;  3MA2 B;  4A3G G;  4PMC A;  1EY6 A;  1EY8 A;  4C3I B;  2QEX A;  5ELC A;  1JOK A;  4JYA Q;  4C56 C;  3LWE A;  1K0S A;  2E74 C;  4ME3 A;  1Y1V H;  1CSQ A;  1BNZ A;  4B3R L;  2IX1 A;  3OTO Q;  1Q46 A;  4H02 A;  2BA0 A;  5C0X J;  1F2M A;  1SYD A;  4FXG C;  4B9W A;  4EQP A;  1QVC A;  2DJG C;  4RCN A;  2KHS A;  1G2T A;  3KF8 B;  1BDO A;  1MJE A;  2JA6 H;  4DR6 L;  1HR0 Q;  2NYZ D;  1R9T B;  3RD4 A;  2EY2 A;  2A73 B;  1S40 A;  3HEJ A;  4HID A;  1ET9 A;  1F2L A;  5GAE C;  2HHH Q;  1O7I A;  1TS5 A;  2AMC B;  1NBW A;  3HOU G;  1JOR A;  2JN4 A;  1HJP A;  1STA A;  2VB3 X;  1UE7 A;  2JEB I;  3S15 H;  2VQF L;  1RCV D;  5LMU Q;  4QUC A;  2B2W A;  2KHJ A;  1GKH A;  4OEM B;  2XWJ B;  4DNI A;  4IFD G;  3MXN B;  4XQN A;  2K5W A;  3RMH A;  4K8I A;  4P2C B;  3CRK C;  5ELF A;  1VQJ A;  4JI0 Q;  4K2K A;  3CRL C;  1JOQ A;  1VQI A;  4GOP B;  2HHH L;  1TT2 A;  1EY9 A;  1PH1 A;  2F0T A;  5COR A;  4APV A;  3AMU A;  4K6D A;  4GZY C;  4U68 A;  2VB2 X;  2E76 C;  3TQY A;  4NMZ A;  2PNR C;  2E75 C;  4X3U A;  4BY1 G;  4R9W A;  4ZYS A;  1X3E A;  1QCB D;  1KHI A;  2O5J C;  1H95 A;  1KXL A;  1E1O A;  4UP7 A;  1KLG D;  2IHE A;  4G4K A;  4JI7 L;  4DR3 L;  3I3C A;  1E7Z A;  1C7Y A;  1OTC A;  3M3Y B;  2L4N A;  3RZO H;  2ALY B;  1K83 H;  5KRU A;  3GTL B;  2EYJ A;  1OXU A;  3MXU A;  1S5D D;  2FIN B;  4ZQ3 A;  3I55 A;  1BCP F;  5T1G A;  4X65 L;  1ML0 D;  4A93 G;  1LT6 D;  4JI1 L;  3D4W A;  1SXT A;  1X32 A;  3OHX C;  3HOZ B;  2AKW B;  1RIP A;  4DA2 A;  4BBS G;  1SYC A;  1JWM D;  2XVS A;  2ZTE A;  2XIW A;  2GVA A;  4A3K G;  4X3T A;  5C4Z A;  1D5M C;  2GN5 A;  2E8G A;  2PQE A;  4J8Q A;  4A3G B;  4NKL A;  2N55 A;  3GV3 A;  2MFI A;  1VMC A;  1I4G A;  2FJ2 A;  5M9O A;  4OEL B;  1RJT A;  2JQO A;  3EJI A;  2F0V A;  3TBI B;  2IJ0 A;  4V0B A;  4DV5 Q;  4DAY A;  3KLS X;  4C3H B;  1KDB A;  3R3O A;  2NBF A;  3AB9 A;  2KBN A;  3STB C;  4OWW B;  4OXP A;  5LMN Q;  1X55 A;  1Q8I A;  2R7Z B;  2HQE A;  4LUZ A;  1QJO A;  4B3T Q;  4BY7 G;  5C3E H;  4DV4 Q;  1PH8 A;  5C3X A;  4RGM A;  4ID6 A;  4YWK A;  2R93 H;  3DWQ A;  1HUM A;  1LTA D;  1Q1E A;  3M4Y A;  1OXT A;  1AZP A;  1HNZ L;  2UUA L;  4KKU A;  2VY3 A;  4R8I A;  3SGI A;  2B2U C;  4DUY L;  2UUB L;  5JOB A;  2CW0 D;  2K5H A;  3TS2 A;  5EPJ A;  2D62 A;  4JV5 Q;  3IRB A;  5GQO A;  3Q24 A;  1YNJ C;  3TRE A;  5TSS A;  4LF4 L;  4LF8 L;  4TSS A;  1JB7 A;  2KJX A;  2KCM A;  3GTJ H;  4Z9C B;  2QA4 A;  4JW0 A;  4TVA B;  3DEP A;  3K5M A;  4KKT A;  4A3C G;  3SEB A;  1MGS A;  1J9O A;  1EWC A;  1DGS A;  4BY1 H;  1QUQ B;  4DV3 L;  1I3Q B;  2OQK A;  5CMD A;  1FNW A;  1LTB D;  1YHB A;  4XIG S;  5M5Y B;  4KHV A;  3J7Y W;  3BVG A;  2ZM6 L;  1SN8 A;  1EYG A;  4A3D B;  1V9P A;  3M4O B;  2N8N A;  2FMM A;  2Z8L A;  2VQF Q;  4HJ7 A;  4RWS C;  3Q8D A;  1LLR D;  1XYI A;  3SK6 A;  2MO0 A;  1J5E L;  1I50 B;  3BZD B;  3MEH A;  1RTO A;  3CCV A;  1Y1V B;  4DR6 Q;  3QOJ A;  4H0L C;  4GN5 A;  2NWG A;  1STG A;  1AFP A;  5KYI A;  4DK1 A;  1KIX A;  1PH4 A;  3CCE A;  2EVB A;  4N8X 1;  2X6L A;  4ULL A;  5BN3 A;  4LF9 L;  4K14 A;  1KLU D;  4UDU C;  4B3M Q;  1WTW A;  1OXV A;  3NQI A;  4IUN A;  4A3I H;  1IBK Q;  5FJ8 H;  1LT4 D;  4U67 3;  3T1Y L;  2BH2 A;  2A6H C;  2L12 A;  1KRT A;  4C2M B;  2EYO A;  2D5D A;  1IHZ A;  1LYL A;  5IT9 L;  3I4L A;  5IYD G;  1SNO A;  2VZA A;  2K04 A;  5M3F G;  2WII B;  3AU7 A;  3HOV H;  3S1N H;  1BBW A;  1L1O C;  2RVL A;  2HQL A;  2R93 G;  1GHJ A;  1P8L A;  3Q22 A;  3NEN A;  1CM9 A;  1XX8 A;  2X69 A;  4ZKC B;  1U5K A;  1XMO L;  5HGT A;  2K50 A;  4A93 H;  1VCI A;  1TY0 A;  5EBC A;  1VQN A;  2QIL A;  3K7U C;  3MXN A;  1SYG A;  3QIA A;  4L6T B;  2QKI C;  1TWG H;  1EFI D;  1M1K C;  4X62 Q;  4J1M A;  2EDG A;  2PMZ E;  5FLX c;  3T1Y Q;  2QCP X;  2EJG C;  3S17 H;  1EWH A;  4GKK L;  1CA5 A;  2NVY H;  2B8F A;  1JJC B;  4JI3 L;  1S5C D;  3V96 A;  3DMU A;  5M3F B;  1KD1 C;  4A3J H;  3PIO A;  1EQQ A;  4IFD J;  4IZ8 A;  4RH6 A;  4X3K A;  4ZUI A;  1B8A A;  1BUV T;  3GTJ B;  4X6A H;  1ENF A;  1K83 B;  2YTY A;  4Y52 H;  4KI0 A;  3NE5 B;  4QJF A;  4RGO S;  1BCP C;  4X64 Q;  3K59 A;  2KUM A;  3HKZ G;  1EZ6 A;  2E2J B;  1YEZ A;  4KN4 C;  2YU9 B;  4QL5 A;  3TP6 A;  1NE3 A;  2F0W A;  2NVX H;  1N36 L;  2K7V A;  2HIV A;  3VR3 A;  1WTH A;  3K7A B;  2JYO A;  1WOC A;  1Y8P B;  1O7Z A;  3L0O A;  1STY A;  2KCN A;  2JA5 H;  4QIW E;  4DUZ Q;  3GTO B;  5KNC A;  2F0O A;  3HKZ B;  3M85 A;  2B63 H;  3FRP B;  1UE1 A;  2Z4I A;  4C3I H;  1DYQ A;  1VQ6 A;  2PW7 A;  1VQB A;  5D65 A;  3FVQ A;  5J1Z A;  4BBR G;  3HOX G;  4ODG A;  2JA8 G;  1JB3 A;  1RTN A;  3U9S A;  3CHB D;  2QDB A;  1L0X B;  4QB4 A;  4AIM A;  1PH3 A;  1L2F A;  3KF6 A;  3KF8 A;  5EKI A;  1ILP A;  1JCK B;  1LTG D;  3HP3 A;  3OW7 A;  4PZ8 A;  3UDX A;  4IJH A;  5M5X H;  1QNU A;  2V1C C;  4ZUJ A;  3NHH A;  5FO7 B;  4DR2 Q;  3D0F A;  5I9O A;  1IKL A;  1S5E D;  2LFN A;  2VUM B;  3L2P A;  3KLW A;  4DN4 M;  3FPU B;  2CQO A;  3CC2 A;  1YZ6 A;  3WWV A;  4JI4 L;  4NDX A;  1I4H A;  1HZ9 A;  1PYS B;  3NXW A;  3S1R B;  1PZK D;  2IPK D;  1XNQ L;  3HOU H;  1EEI D;  4JI4 Q;  4IOC A;  3CCJ A;  3I70 A;  2KEN A;  3I4M B;  2JP1 A;  2IW3 A;  4QF4 A;  1NR2 A;  1HTL D;  4JI3 Q;  3G71 A;  1JJ2 A;  4OO1 I;  1LT5 D;  2RCN A;  3RLN A;  4IUQ A;  2BDO A;  4C3J H;  3URY A;  4BY1 B;  1BR9 A;  2CWA A;  2RHS B;  1FNV A;  5CV6 A;  1SFO H;  4H7B A;  1TWC B;  1J5E Q;  1K8O A;  3ND8 A;  3J81 E;  1ICF B;  2CW0 C;  3OW2 A;  1S3O A;  1XMQ L;  1JE5 A;  1X65 A;  2F0N A;  4JBM A;  1YNJ D;  3WOE A;  2ZJQ A;  1UEB A;  3QO2 A;  1VQL A;  3W3A A;  4AQY L;  1WJJ A;  3C1F A;  3J7Z C; 
#chains in the Genus database with same CATH homology
 4DR5 Q;  2KCT A;  2ZJR A;  3G48 A;  4HJ8 A;  1IXR A;  1IZ6 A;  4L5S A;  2CKZ B;  3BZC A;  1N8R C;  2D0O A;  3S1Q H;  1XPR A;  1XNR Q;  3S2H H;  2XGT A;  1VQK A;  1Q8K A;  3PIP A;  3KJP A;  2ID0 A;  4JI2 Q;  3KDF B;  2GVB A;  4LF6 L;  3KDF A;  4LF5 L;  2JA9 A;  1GM5 A;  4ALP A;  2NZH A;  4HIK A;  3PUX A;  1PYB A;  1CSP A;  4DR1 L;  2VUM H;  3J80 i;  3I56 A;  1JMC A;  5DLQ E;  1X3F A;  4DK6 C;  4JI6 Q;  2NZO A;  3PO2 H;  2JA5 G;  4IFD I;  1PVO A;  4A3L H;  3A5U A;  1A63 A;  1G6P A;  3PSI A;  1N34 Q;  2JEA I;  1YI2 A;  4DR5 L;  5M3M H;  1VQ9 A;  3HOZ H;  4OX9 Q;  2NN6 I;  1SLJ A;  1WYD A;  1KQS A;  5IT9 c;  3JAM i;  2NVT H;  3U4Z A;  1PH6 A;  3I7F A;  4X66 Q;  3T1H L;  3ZJY C;  4C2M H;  2F52 A;  4LWC A;  4J15 A;  1XTD A;  5IE8 A;  2CFM A;  1HNX Q;  5IWA Q;  2R92 H;  1W3S A;  4A3G G;  3NBH B;  4DR4 Q;  3TS0 A;  1VQ5 A;  4EX5 A;  4DV7 Q;  1WI5 A;  1N34 L;  2QEX A;  1QVG A;  4POG A;  3UE1 A;  4LFB Q;  4JYA Q;  1KXL A;  3ULP A;  4JI6 L;  1E24 A;  3CCQ A;  4ME3 A;  2Q2H A;  1LTL A;  1Y1V H;  4OWX B;  1CSQ A;  3G4S A;  4OON A;  2VNU D;  3CP0 A;  2HIX A;  4A3E G;  1VQP A;  2IX1 A;  4GS3 A;  3OTO Q;  4B3R L;  4DV7 L;  2DUD A;  2UXB Q;  1Q46 A;  4H02 A;  5BR8 L;  4Y7N H;  1M90 C;  2BA0 A;  5IP7 G;  5FLM H;  5C0X J;  2ASB A;  2PQA A;  2YTX A;  1N32 L;  3I4M G;  3PUW A;  5IWA L;  3M7N A;  1QVC A;  1VQO A;  2EIF A;  4IOA A;  1A0I A;  3F2D A;  2UXC Q;  4B3T L;  3K7A H;  3KF8 B;  1MJE A;  1NY4 A;  2JA6 H;  4DR6 L;  2XTI A;  1Q7Y C;  1IBL L;  1HR0 Q;  1L1O A;  4GOP A;  4JI5 L;  1L1O B;  4O2D A;  4HID A;  1S40 A;  1HNZ Q;  1AE2 A;  4FDB A;  5GAE C;  2HHH Q;  1O7I A;  4A3D H;  5C0X G;  2AMC B;  1NBW A;  2Y0S E;  1QVF A;  1VQ4 A;  3HOU G;  4P72 A;  5IYC G;  1CKM A;  1Z47 A;  2WAQ E;  1HJP A;  3UE0 A;  4NXN Q;  1XMO Q;  1JT8 A;  2B63 G;  1E1T A;  1UE7 A;  2JEB I;  4QY7 A;  4LFC L;  2VQF L;  3S15 H;  4MNO A;  3J81 i;  5LMU Q;  1VQA A;  2KHJ A;  1KC8 C;  1AH9 A;  1GKH A;  1YIJ A;  1OXS C;  4JI1 Q;  3CPF A;  4DNI A;  3E0E A;  4DK3 C;  1I5F A;  2ZM6 Q;  2ES2 A;  3MXN B;  4IFD G;  4WJ3 M;  2CCZ A;  3I4N H;  2B3G A;  4P74 A;  1EIF A;  1OXX K;  3AQQ A;  4DR4 L;  2L15 A;  1ASY A;  1VQJ A;  4JI0 Q;  1IBM L;  1VQI A;  2A19 A;  4GOP B;  2HHH L;  3BU2 A;  1BVS A;  1PH1 A;  1Q12 A;  5IP9 G;  1Y14 B;  3GTM H;  4APV A;  2HT1 A;  4A3I G;  1E3P A;  5FJ8 G;  1K0R A;  1IBK L;  1MIU A;  1PFS A;  4UP8 A;  3TQY A;  1HNW L;  4DV6 L;  4RG1 A;  1K73 C;  4BY1 G;  5HGQ A;  3NEM A;  1HR0 W;  1X3E A;  1KHI A;  4GN4 B;  5IP7 H;  5FLM G;  3U50 C;  2OTL A;  2CWP A;  4GNX C;  3A0J A;  2UU9 L;  1J6Q A;  2FXQ A;  4BY7 H;  1E1O A;  4UP7 A;  2IHE A;  4X66 L;  3T1H Q;  4JI7 L;  4R4C A;  4DR3 L;  2WB1 G;  5J3B A;  1JJG A;  3M4O H;  1E7Z A;  2JA7 H;  1C7Y A;  1OTC A;  5M5W H;  4YCU A;  4BA2 I;  2R7F A;  3F2C A;  2ALY B;  4LFA Q;  4DR2 L;  3RZO H;  4IPH A;  4K0K L;  1K83 H;  4JCV E;  1HZA A;  3GTQ H;  4JG2 A;  2VUM G;  1OXU A;  2IX0 A;  4A4I A;  3I55 A;  1XJV A;  4X65 L;  4A93 G;  4IPC A;  1A8V A;  3DM3 A;  5GAH C;  3CCR A;  4L5T A;  3UDI A;  4JI7 Q;  4JI1 L;  4LF5 Q;  4DV0 Q;  2UU9 Q;  4LNQ A;  5LMU L;  5IYB H;  1MJC A;  3CW2 C;  3S24 A;  4LUO A;  3W5O A;  1YIT A;  5C4X G;  3CAM A;  2D0P A;  4HJ5 A;  2AKW B;  3ER0 A;  2UXD L;  1RIP A;  3A5Z B;  4BBS G;  1EWI A;  3F8T A;  4A3F H;  2ZTE A;  2R92 G;  2GVA A;  4A3K G;  1N33 L;  3CXC A;  4GKJ L;  2UXB L;  2GN5 A;  2E8G A;  5AJ3 L;  5C44 G;  1I94 Q;  2OQ0 A;  1SE8 A;  1UE5 A;  4AH6 A;  1HR0 L;  2MFI A;  4PG3 A;  4XTC S;  4A3G H;  3CF5 A;  3RLF A;  3ICE A;  4DV2 L;  2JQO A;  4MZ9 A;  5IY0 A;  1D7Q A;  2I5H A;  1XNR L;  4GKK Q;  2IHF A;  3S1R H;  1Y1W G;  1VQ8 A;  4DV1 L;  3KJO A;  1E22 A;  4DV5 Q;  3VDY A;  2NN6 G;  4GNX B;  4K0K Q;  4X64 L;  2WAQ G;  4OWW B;  2KBN A;  1V1Q A;  3STB C;  4DV3 Q;  4OXP A;  4LUV A;  5LMN Q;  1X55 A;  1X9N A;  5AJ3 Q;  2UUC Q;  4LFC Q;  3HOY G;  4LUZ A;  1YJW A;  4GKJ Q;  2K52 A;  3U58 A;  4B3T Q;  4JYA L;  4BY7 G;  3BJU A;  4YCW A;  5C3E H;  4DV4 Q;  1PH8 A;  4YWK A;  4LF7 Q;  2R93 H;  2A1A A;  1PV4 A;  2JA6 G;  1FL0 A;  4P75 A;  1Q1E A;  3UDG A;  1OXT A;  3HFZ B;  1NJI C;  1HNZ L;  2UUA L;  1KRS A;  4OWT B;  3LGJ A;  2VY3 A;  3GTP H;  4JBJ A;  3UDF A;  2YV5 A;  1NTG A;  2UUC L;  3SGI A;  5IYC H;  4DUY L;  2UUB L;  2N78 A;  5LMN L;  3I2Z A;  4A3M G;  2K4K A;  3DLL A;  2UXC L;  1G51 A;  1K3R A;  2K5H A;  3HOZ G;  3TS2 A;  3AFQ A;  1CKO A;  2D62 A;  4DAY B;  3IRB A;  5GQO A;  4DPG A;  1SMX A;  4JV5 Q;  3TRE A;  3TEH B;  4LF4 L;  1BKB A;  4LF8 L;  1JB7 A;  4WJ4 A;  3TRZ A;  2F3I A;  1VQE A;  1CKN A;  3OTO L;  2KCM A;  3GTJ H;  4HJ9 A;  2QA4 A;  2OCE A;  4KHZ A;  4DR3 Q;  1K8A C;  2K75 A;  1VQ7 A;  2K5N A;  1EFW A;  3RZD H;  1I94 L;  4TVA B;  3RR5 A;  4A3J G;  4OX9 L;  4LF9 Q;  1C9O A;  4UPA A;  3J80 c;  4A3C G;  4YWL A;  2MO1 A;  4DV4 L;  2I0Q A;  3H0G H;  1Q1B A;  3M4P A;  1Y1W H;  1RL2 A;  5IYD H;  1DGS A;  4BY1 H;  1QUQ B;  4DV0 L;  1VQG A;  1KAW A;  4DV3 L;  1IBM Q;  1QUQ A;  1IBL Q;  4JI8 Q;  3HKZ E;  3D31 A;  4IPG A;  4JC0 A;  2OQK A;  4BXX G;  2Z6K A;  1KL9 A;  3RN2 A;  1B70 B;  2H5X A;  3PUZ A;  1YBY A;  1YHB A;  4XIG S;  1HZB A;  3U4V A;  1IYJ B;  2KHI A;  2ZM6 L;  1EYG A;  1SN8 A;  1UE6 A;  1V9P A;  4POF A;  4A3D G;  2N8N A;  5BR8 Q;  3KF6 B;  1R9T H;  4B3R Q;  4BA1 I;  2VQF Q;  4HJ7 A;  5GAG C;  4DUZ L;  4B3S Q;  1X56 A;  3Q8D A;  1QZG A;  3KYH C;  4JBW A;  1P16 A;  1Q81 C;  1YVC A;  2MO0 A;  1J5E L;  3S1M H;  4JOI C;  2JK8 A;  2Q2I A;  4JI8 L;  3PO3 H;  4R1J A;  3AYH B;  3K81 C;  2AHO B;  4JI5 Q;  4UY8 C;  4DR7 Q;  1YHA A;  4BBS H;  1D8L A;  4QGU A;  3CCV A;  2B29 A;  4LW1 A;  4DR6 Q;  1VQC A;  5C4X H;  1EUJ A;  1X54 A;  4BBR H;  4GN5 A;  3FKI G;  3B6Y A;  3HOX H;  1PH7 A;  1K8G A;  1HH2 P;  1KIX A;  4NB3 A;  1PH4 A;  3CCE A;  4X65 Q;  1WCM H;  2OWO A;  4R4T A;  4DR7 L;  1LM0 A;  3PUV A;  1YJ9 A;  2F4V Q;  4PZ6 A;  5C44 H;  2JA8 H;  4LF9 L;  3STB D;  1G29 1;  4B3M Q;  1OXV A;  1PH5 A;  1IBK Q;  4A3I H;  5FJ8 H;  3EIV A;  4IJL A;  3FP9 A;  4DUY Q;  3T1Y L;  2BH2 A;  4OO1 G;  1KRT A;  2K5V A;  1PH2 A;  3H0G G;  2VS1 A;  2IT1 A;  5E7N A;  1VQM A;  4NPS A;  1LYL A;  3S14 H;  2UUA Q;  4GNX A;  1TWH H;  4RMF A;  2VZA A;  5IYD G;  4YHH L;  2WFW A;  4C3H H;  5JEA G;  5M3F G;  2F4V L;  2BH8 A;  1W2B A;  4JOI A;  5GAD C;  3HOV H;  5K36 G;  3S1N H;  2R7Z G;  3F1Z A;  1Q86 C;  2I5L X;  2MNA A;  1BBW A;  1L1O C;  4DV2 Q;  2DGY A;  1IL2 A;  1TXY A;  2HQL A;  4NXM Q;  2JA7 G;  3HOY H;  2R93 G;  1YJN A;  4PZ7 A;  4IPD A;  1P8L A;  3CPW A;  1EQR A;  1Q82 C;  5C3E G;  2A8V A;  3GTK H;  3GTG H;  3AFP A;  3NEN A;  1LUZ A;  4IO9 A;  1FJG Q;  1N33 Q;  3GO5 A;  3CMA A;  4DAM A;  3GDE A;  1U5K A;  1XMO L;  1T9H A;  5JEA J;  2K50 A;  5EAY A;  4A93 H;  1NMF A;  1VCI A;  2I5M X;  2N3S A;  4A3M H;  3PCO B;  1C0A A;  1VQN A;  1XPU A;  3A74 A;  3K7U C;  1L0W A;  1FJG L;  3HOW G;  5HY6 A;  1MKH A;  2Q2T A;  1TWG H;  1GVP A;  1M1K C;  4X62 Q;  1XPO A;  2PMZ E;  5FLX c;  3T1Y Q;  3AEV A;  3GD7 A;  3RNU A;  1GO3 E;  3H15 A;  3S17 H;  2IY5 B;  5C4J H;  4GKK L;  3PF5 A;  2NVY H;  2OTJ A;  5JJL A;  3RLO A;  3M4Q A;  1JJC B;  4AYB E;  4JI3 L;  1VQD A;  2AWO A;  4JV5 L;  1HNX L;  1HZC A;  1KD1 C;  3KFU A;  4GLV B;  4A3J H;  3PIO A;  3G6E A;  1FGU A;  1UWV A;  2R6G A;  2YTV A;  3BZK A;  1ASZ A;  1BBU A;  2LSS A;  1B7Y B;  4P71 A;  1EQQ A;  4IFD J;  2WP8 J;  4GOP C;  1U0L A;  4L5R C;  1B8A A;  3JAM c;  2YYZ A;  4X6A H;  2PI2 A;  4MTN A;  2YTY A;  4DV6 Q;  1QZH A;  4Y52 H;  4KI0 A;  4QJF A;  5ELN A;  4X64 Q;  4YHH Q;  2Q2U A;  3CC4 A;  4KHP Q;  3HKZ G;  3I4O A;  3CCM A;  1YEZ A;  3H3V I;  3I4M H;  1I3Q H;  3KOJ A;  3ULJ A;  3F2B A;  2Z6K C;  4QL5 A;  3NEL A;  1NE3 A;  1PH9 A;  2JJQ A;  2NVX H;  1N36 L;  2R7Z H;  2QGQ A;  4LFB L;  1AE3 A;  4LF6 Q;  2HIV A;  1WFQ A;  4YY3 L;  4O0A A;  4KHP L;  4QQB X;  4JI2 L;  1WOC A;  4LF4 Q;  4B3M L;  3L7Z C;  1SRU A;  3CD6 A;  5GRO A;  3S16 H;  3L0O A;  2PNH A;  2JA5 H;  3W1G A;  4YY3 Q;  4QIW E;  4HIO A;  1YHQ A;  3E9H A;  4DUZ Q;  1K9M C;  3PO2 G;  4A76 A;  2RHQ B;  4R4I A;  3M85 A;  4HIM A;  3PO3 G;  4A3L G;  1VQH A;  4KLK A;  2B63 H;  1UE1 A;  2NVQ H;  4C3I H;  4YWM A;  2R7D A;  5M3M G;  3HOW H;  1VQ6 A;  1CUK A;  4NXN L;  4LF7 L;  3FKI H;  2ZJP A;  1VQB A;  4R4O A;  2AWN A;  2RF4 A;  4P73 A;  3RN5 A;  4BBR G;  3HOX G;  4JBK A;  2K14 A;  2JA8 G;  4A75 A;  1NMG A;  1Z9F A;  4GLX A;  2E5L L;  4B3S L;  4R4Q A;  2VQE L;  4AIM A;  1PH3 A;  2YU9 H;  1L2F A;  1YNX A;  1TWF H;  3KF6 A;  4A3C H;  3MEF A;  4JI0 L;  2E2H H;  2VW9 A;  4DV1 Q;  1XMQ Q;  3ERS X;  1H95 A;  4PZ8 A;  2WB1 E;  3UDX A;  4LF8 Q;  4IJH A;  5M5X H;  1Y1V G;  4A3B H;  2V1C C;  1X6O A;  2C35 B;  1N9W A;  2EXD A;  1I6H H;  3CME A;  4A3E H;  4DR2 Q;  2PQA B;  3K8A A;  3M9B A;  3D0F A;  3K0X A;  2VQE Q;  4BXX H;  3HKS A;  4AQY Q;  5ELO A;  4DKA C;  3PV0 A;  2E2I H;  2E5L Q;  1N36 Q;  3L2P A;  3KLW A;  5M3F H;  3S2D H;  2ZTC A;  5LMN W;  3CCS A;  3HOV G;  2CQO A;  5M5Y H;  3CC2 A;  1YZ6 A;  4PMW A;  3WWV A;  4JI4 L;  3EN2 A;  2LXJ A;  1FVI A;  1HZ9 A;  1PYS B;  3K80 C;  2PI2 E;  3GTL H;  3PGZ A;  4GLA C;  3ULL A;  1HNW Q;  2LXK A;  3OYY A;  5JJI A;  1XNQ L;  3M3Y H;  3HOU H;  2MQH A;  4JI4 Q;  2ZTD A;  3PF4 A;  2UUB Q;  4IOC A;  4UP9 A;  3E9I A;  1A62 A;  1SR3 A;  3CCJ A;  2VL6 A;  1PA6 A;  2E2J H;  4AYB G;  2KEN A;  3H3V H;  1CKN B;  1XNQ Q;  3J81 c;  4EQ5 A;  4JI3 Q;  1GD7 A;  3G71 A;  3EBE A;  1N32 Q;  1JJ2 A;  4OO1 I;  4LFA L;  1I50 H;  4YCV A;  5IYB G;  4NXM L;  2RCN A;  3RLN A;  3PUY A;  4C3J H;  3J7A 5;  4HJA A;  1WCM G;  4DR1 Q;  1EOV A;  3I4N G;  2N49 A;  3FHW A;  4A3F G;  1VS0 A;  4X62 L;  5C0X I;  4A3K H;  2CWA A;  2RHS B;  3GTO H;  2Y0S G;  2EQS A;  1EIY B;  2BA1 A;  1X3G A;  4DV5 L;  1SFO H;  1PHJ A;  1V43 A;  5JJK A;  1S72 A;  1J5E Q;  3CCL A;  4TQU S;  3W1B A;  5H1S E;  3J81 j;  3CC7 A;  1TWC H;  3OW2 A;  1S3O A;  1XMQ L;  5IP9 H;  1JE5 A;  3JC6 6;  2UXD Q;  1X65 A;  4L5Q A;  2Z0S A;  4JBM A;  4GN3 B;  3CCU A;  2ZJQ A;  1UEB A;  4A3B G;  1VQL A;  2ATW A;  1SRO A;  4AQY L;  2JE6 I;  1VQF A;  3CQZ H;  1WJJ A;  1TWA H;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...