4OX9Q

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9Q00
2GN5A 5C4XH 1YZ6A 2UUAQ 1VQIA 3KLWA 3J81c 3D31A 3GTJH 4DK6C 1E3PA 2OTLA 1PH9A 3RLNA 2R93G 4BA2I 2DUDA 1VQ4A 2PQAA 1EOVA 4OWTB 2YTXA 4XTCS 2I5MX 2KHIA 3G48A 2MO0A 4EQ5A 3RN2A 2C35B 4JI4L 3CW2C 1QUQB 1JJCB 4OWWB 1J5EQ 1FVIA 2JA6H 2BA0A 1YI2A 3PUVA 2CCZA 1L1OB 5J3BA 3A5UA 4GLVB 4B3TQ 4A3LH 3M3YH 4JYAQ 1Q12A 1DGSA 2AHOB 1YEZA 1C9OA 2R7FA 3UDXA 5IYBG 4A3JH 3S24A 3HKZG 2HT1A 1PYSB 2JA6G 4L5TA 4HJ5A 4KHZA 2YV5A 4A3MH 1XMQQ 1C7YA 5C0XI 3JAMi 2ID0A 1L0WA 4DKAC 1QUQA 2BA1A 2PI2A 3K81C 3KDFA 4DUZL 2IY5B 3OTOL 3WWVA 1XJVA 2RHQB 4C3JH 1B8AA 4A3MG 1L1OA 1GVPA 1IBLL 1E1TA 4A3GG 1P8LA 1NJIC 4DR3Q 3HOVG 2E2IH 4LF6L 5FLXc 4P71A 1KRTA 1YNXA 4IJLA 2OQ0A 1VCIA 2A1AA 2JEAI 4C2MH 1CKMA 5AJ3Q 4DV6Q 2JA5G 5K36G 4HIOA 1K9MC 2CKZB 1UE7A 5C4JH 1HNZQ 1PH8A 2RHSB 4HJ7A 4A3DH 2H5XA 2NZHA 4LFCL 4GNXB 1NBWA 4PG3A 4BY1G 2VL6A 3CPFA 4HIKA 2A19A 3NELA 4JI5Q 4JCVE 4LF8L 2WB1E 4HIDA 4JI3Q 3CP0A 4KHPL 2UU9L 3EBEA 1OXVA 3U4VA 4IPDA 4GN3B 5GROA 4HJ9A 1S40A 1PH7A 3RZOH 1LYLA 1BVSA 4JI0Q 3AFPA 2MNAA 2DGYA 4LF7Q 3NBHB 1AE2A 1XNRQ 2CWPA 4AQYQ 4GNXA 4DR2L 3ERSX 3I56A 1PFSA 1FL0A 1VQ9A 4DR7Q 3HOYH 4LUOA 3PUZA 4EX5A 3F2CA 5IP7G 2HQLA 4POGA 4GKKQ 1K73C 4JC0A 2K75A 5HGQA 3CC7A 4DV3L 4JOIC 2IX1A 3TS0A 4JI7Q 3AEVA 4DV5L 4UPAA 5BR8L 3TRZA 3CF5A 4B3RL 1Y1VG 4X64Q 1HH2P 2EXDA 4DPGA 3K8AA 5IYCH 1XTDA 4YHHQ 4DV1Q 1PA6A 1Z9FA 3F1ZA 3FP9A 4BA1I 2UXDL 1H95A 1IZ6A 2WAQE 3I4NH 2MFIA 4NXMQ 4R4OA 1MJCA 3CCSA 3E9IA 1XNQQ 1V43A 1WCMH 1C0AA 2UXCL 1UE1A 2MO1A 3KFUA 5IY0A 3RLOA 4ME3A 4DV2Q 3HOWH 4LF9L 4LFAL 3PUYA 2VQFL 4P72A 2YYZA 3STBC 3BU2A 4A76A 3UDGA 1S72A 4NPSA 2ZM6L 1Y1WH 1E24A 1JMCA 1VQGA 1EQRA 1N9WA 1VQBA 4DV0Q 1YBYA 4GS3A 4R1JA 4DUYL 1FJGL 4L5SA 3PGZA 2Z6KC 4K0KL 3KJOA 3BZCA 1Y1WG 1EUJA 5C44H 2GVAA 2K4KA 3CAMA 1XMOQ 2F3IA 2JQOA 2VNUD 2R7DA 1R9TH 3K7UC 3S15H 4DV4Q 1VQEA 1G291 4JI2L 1VQCA 5JEAJ 4DR5Q 4IFDG 2JEBI 2QGQA 4QIWE 3PUXA 4JI8L 3ZJYC 4BBRH 4PZ6A 3W1BA 2UUCL 4LF5L 3L2PA 1QVGA 2UXBL 4L5QA 3H3VI 1EWIA 1XPRA 1SFOH 1WOCA 4UP7A 3HKZE 2LXJA 3G4SA 3CCMA 4DV7Q 3H0GH 3T1HL 4LNQA 1G6PA 4BBSH 2PMZE 5FJ8H 2E2JH 1VQ6A 2NVTH 5JJKA 2QA4A 1O7IA 4P74A 1QVCA 2HIVA 2CWAA 1TXYA 2R6GA 2Z6KA 2NN6I 3H0GG 4A4IA 2F52A 1CUKA 3ULLA 4YWKA 1AH9A 4X66Q 4GLAC 1N36Q 1CSPA 2ES2A 3JAMc 1UE6A 4OX9L 4IPHA 3PIOA 2R93H 4X65L 1IBKL 3CMAA 1CKNA 3S1RH 2VZAA 4R4QA 2K14A 2I5LX 1KL9A 2LSSA 1EQQA 1HNWL 5M3FG 2L15A 4O0AA 2E5LL 4QQBX 3CQZH 5IWAQ 4A75A 3D0FA 1I3QH 3RNUA 4GLXA 1I50H 1Q8KA 4AQYL 1L1OC 1VQAA 3OYYA 1JT8A 5GAGC 2N8NA 1QVFA 3UDFA 1X3GA 4DAMA 1N34Q 1YHQA 1TWCH 5IYBH 1M1KC 2XTIA 2AKWB 1LUZA 4GKKL 4QGUA 1K3RA 1OTCA 3PO3G 1Q1EA 2Q2HA 2NVQH 1YITA 2K50A 1I94L 5LMUQ 3GDEA 3U50C 3G6EA 3FKIH 5LMNQ 3RN5A 1D7QA 4JI1Q 1VQPA 3B6YA 4A3EG 1TWAH 4A3GH 1VQFA 5C3EG 2KBNA 3HOVH 3I4OA 5ELNA 3CCRA 5H1SE 2NVYH 3M4OH 3FKIG 1HR0Q 3F2DA 1N32Q 4DK3C 3CC2A 4FDBA 4A3FH 3PO2G 1KC8C 4JBKA 1ASZA 4A3KH 2JA5H 4X62Q 3A0JA 1EYGA 1Y14B 4GNXC 4A3FG 4NXNQ 1IL2A 4BY1H 4A3KG 1N33L 3EN2A 2E8GA 3SGIA 5M5WH 1YJWA 1A8VA 1KHIA 1YHAA 1HNXQ 4B3ML 1Q81C 1LTLA 1XMOL 3CMEA 2WFWA 5IYDG 4JBWA 1I5FA 1VQDA 2LXKA 5C0XG 3PF4A 1RIPA 5HY6A 1GO3E 1NMGA 4YY3L 3M4PA 3T1YQ 4IPGA 1XNQL 2ZJPA 3TEHB 4UY8C 3HFZB 2KCMA 3HOUG 3CXCA 1CSQA 4DR6Q 1MJEA 4YCWA 1N8RC 5IP7H 3TS2A 3FHWA 1SN8A 4GKJQ 3K0XA 4NB3A 4BY7H 4IOAA 3H15A 1X3EA 3HOZH 1B7YB 4QY7A 3CPWA 1Y1VH 1IBMQ 2UUBQ 2RF4A 1OXTA 4X66L 1XPOA 2N49A 4LF4Q 3U4ZA 3GTMH 1N36L 3M4QA 2JA9A 1SR3A 3UE0A 4TVAB 2WP8J 3J7ZC 2VQEL 4JI6Q 3HOZG 2ZJQA 1Q82C 5IP9G 2R7ZG 2UUAL 2F4VQ 1JJGA 1TWHH 1BBWA 4GOPB 1YJ9A 1GD7A 4JV5Q 4OO1I 1XPUA 2V1CC 1Q86C 5GQOA 4A3BH 3GTPH 3S1NH 1VQMA 2ASBA 1CKOA 4R4IA 4R4CA 3AFQA 2Y0SG 4A3CH 1J5EL 4A3BG 2D0OA 4A93G 4DR4Q 4GN5A 3MEFA 4IJHA 4GOPA 3I4MG 4MZ9A 2IHEA 4B3TL 4TQUS 3KF6B 4LW1A 4JYAL 4A3CG 4YWLA 2I0QA 4KLKA 1V1QA 4UP8A 3UE1A 1PH2A 4LUZA 1HZBA 1PH1A 1WI5A 3IRBA 3PF5A 3J81j 4DUZQ 1XMQL 4J15A 4IFDJ 3OTOQ 1X9NA 1VS0A 2B29A 1W2BA 4OO1G 1IBLQ 1AE3A 4AIMA 1X56A 1X3FA 1V9PA 3HOXH 5M5YH 4LF6Q 1A0IA 1HZ9A 4DR3L 3ICEA 3S2HH 2OTJA 1UEBA 3ULJA 1YVCA 4ALPA 2JA7G 4BY7G 3J80i 2ALYB 3HOXG 4OWXB 1VQJA 5GAEC 4JBMA 3AQQA 4B3SQ 3S1MH 5AJ3L 4MTNA 4DV6L 4WJ3M 4IOCA 1EIFA 1HZAA 1KRSA 1HNZL 4LFCQ 1NY4A 2BH2A 3DM3A 5M3MG 1VQ8A 2JA8G 3J7A5 2VS1A 4C3IH 3M9BA 1SLJA 3Q8DA 5M3FH 4LF8Q 4KHPQ 2A8VA 4JI5L 2UU9Q 2N3SA 1KD1C 4UP9A 1JE5A 2ZJRA 4JI3L 1BBUA 1VQKA 3M7NA 1EFWA 2YTYA 3ULPA 2HIXA 4BXXG 4LFBQ 2JJQA 2ATWA 1SRUA 4R4TA 4XIGS 4A3IH 3S14H 4JI0L 4DR2Q 4DR6L 4LF7L 1XNRL 1Q1BA 4HIMA 3PO3H 5JJIA 1NE3A 2FXQA 3S2DH 4DR7L 1KXLA 2PNHA 4A3IG 3EIVA 4POFA 1RL2A 1B70B 4DV3Q 1VQNA 2R92G 4YCUA 1LM0A 1ASYA 4DV5Q 5BR8Q 2BH8A 2NN6G 3PUWA 2PI2E 4LF4L 2B63G 4JI7L 3PIPA 3TQYA 4A3EH 1YIJA 5C3EH 4X64L 5FLMG 4YHHL 4DV1L 4LUVA 1JB7A 3S17H 1T9HA 2UXDQ 2F4VL 3GO5A 1OXUA 4KI0A 3PO2H 1E7ZA 1VQHA 3L0OA 4NXML 4JV5L 3NEMA 4DR1Q 2UXCQ 5C4XG 3I55A 1L2FA 2EQSA 3U58A 4JG2A 2KHJA 2HHHQ 2OWOA 4LF9Q 4LFAQ 2VQFQ 4DV2L 5DLQE 3VDYA 3KDFB 3S16H 2ZM6Q 1A63A 4C3HH 1QZHA 4P75A 5ELOA 1FJGQ 4DR4L 4APVA 4DUYQ 4DV0L 4K0KQ 5IYDH 1G51A 3GD7A 2EIFA 3PV0A 4A3LG 2AMCB 1VQLA 4Y52H 2VY3A 5C0XJ 1X6OA 3K7AH 1E22A 4JI2Q 1J6QA 4A3JG 3L7ZC 1PYBA 4DAYB 4DV4L 2Y0SE 5GADC 4JI8Q 4HJAA 1EIYB 3HOUH 4DR5L 4YWMA 3TREA 1PH3A 2UUCQ 1VQOA 4LF5Q 3CD6A 4LFBL 2UXBQ 3J81i 3CC4A 3S1QH 4AYBG 1SMXA 4PMWA 4AH6A 3RR5A 3T1HQ 5LMNW 5IT9c 1PH4A 1PH6A 3AYHB 4DV7L 3PSIA 1P16A 2K5VA 2N78A 4B3SL 1IXRA 1UWVA 1HZCA 4QL5A 1HR0W 1Q46A 2E2HH 4IPCA 3STBD 2D62A 5IP9H 2JK8A 2NZOA 2R7ZH 4GOPC 1D8LA 3LGJA 3GTOH 4OX9Q 3BZKA 2IX0A 4DNIA 1YJNA 2ZTCA 1U5KA 2AWNA 4X65Q 4LWCA 1OXXK 4O2DA 3CCJA 4HJ8A 1IBKQ 1VQ7A 4A3DG 2Q2UA 1MIUA 2JE6I 1KQSA 1HNWQ 2E5LQ 4H02A 3CCUA 3MXNB 5IWAL 1X54A 3CCLA 3J80c 1X55A 4A93H 4L5RC 1FGUA 4JI4Q 3I4MH 3NENA 4GN4B 1N34L 1MKHA 4Y7NH 2CFMA 4P73A 3GTLH 2D0PA 4WJ4A 2KCTA 1TWGH 3HOYG 1PHJA 4RG1A 1I94Q 2ZTDA 4MNOA 3RZDH 2IHFA 4OONA 1VQ5A 3K80C 5LMUL 2K5NA 1BKBA 3PCOB 4IO9A 1SE8A 3OW2A 5LMNL 1U0LA 1JJ2A 3F2BA 3UDIA 4JI1L 4RMFA 2VW9A 4IFDI 2Q2IA 1W3SA 2GVBA 3E9HA 5IYCG 3KOJA 1E1OA 1WYDA 2MQHA 1A62A 4DR1L 3CCVA 1HR0L 1NMFA 3HKSA 1NTGA 1Z47A 3CCEA 2HHHL 2JA7H 3G71A 4JBJA 3A5ZB 1N32L 4OXPA 3KF8B 1K0RA 3M85A 3GTGH 3KF6A 3I4NG 1PVOA 1X65A 1UE5A 1WCMG 1QZGA 4X62L 1TWFH 2WB1G 1PH5A 4JOIA 3W1GA 2ZTEA 3GTKH 1K8GA 3HOWG 3ER0A 1WFQA 4QJFA 3KJPA 1S3OA 4NXNL 5M3MH 1N33Q 2JA8H 3I7FA 4B3MQ 3RLFA 5JJLA 2KENA 1KAWA 3CCQA 1M90C 2RCNA 2YTVA 2Q2TA 3DLLA 2XGTA 5IE8A 4PZ7A 1HNXL 2NVXH 1GM5A 2K52A 3BJUA 4BXXH 1OXSC 4YY3Q 5E7NA 5M5XH 5C44G 3H3VH 1SROA 2OQKA 3JC66 2AWOA 5EAYA 5JEAG 3T1YL 3A74A 3KYHC 2OCEA 2VUMH 4PZ8A 4X6AH 2QEXA 1KIXA 2YU9H 3F8TA 1PV4A 1IYJB 4BBRG 2CQOA 1HJPA 2R92H 4GKJL 2IT1A 1CKNB 3W5OA 5GAHC 2K5HA 4YCVA 2B63H 2VUMG 2WAQG 1YHBA 1I6HH 1WJJA 1K83H 2Z0SA 3I2ZA 1Q7YC 1K8AC 5FJ8G 4BBSG 1IBML 3E0EA 2B3GA 3GTQH 2PQAB 5FLMH 4AYBE 1GKHA 2UUBL 2VQEQ 4B3RQ 4JI6L 2I5HA
chains in the Genus database with same CATH superfamily
2GN5A 1YNJD 3S16B 5C4XH 2K05A 1MSGA 2UUAQ 3QJYA 4C3HB 4CDEC 3D31A 3GTJH 5I2YA 2OXPA 2OTLA 5E1FA 2R93G 2LMCB 4A3JB 4BA2I 1BDOA 1VQ4A 2PQAA 5CV6A 2KHIA 1K8OA 1LO5D 1JJCB 2EJFC 1W6JA 2JA6H 1JOQA 5J3BA 4B3TQ 3M3YH 1Q12A 4A3JH 1DOLA 3S24A 1PYSB 3JAMi 4C56C 3P7JA 4DKAC 2PI2A 3HG9A 3K81C 3IAYA 3OTOL 2F1MA 2RHQB 3K5MA 1BXTA 1CT1D 1S5DD 1IBLL 4A3GG 2ZXOA 4Q5VA 4DXFA 2I46A 3HOVG 2E2IH 1UNSA 2E76C 4ME5A 4P71A 2L12A 2OQ0A 4C2MH 1F2YA 4HIOA 1K9MC 1UE7A 5C4JH 1PH8A 2RHSB 4HJ7A 2MP1A 4RA8A 4LFCL 4GNXB 1LTRD 2WACA 2A19A 1PRTC 4JI5Q 3I4MB 1TY0A 2WB1E 4JI3Q 1OXVA 3U4VA 1CQFA 2WKCA 1PH7A 3RZOH 1LYLA 3NBHB 4F8MA 1XNRQ 2MGSA 4ILWA 4LK1C 4ZK9B 4GNXA 4L63B 1VQ9A 1FL0A 3J7AF 2FINB 3F2CA 5IP7G 1K73C 3CC7A 2K75A 1ET9A 2RVLA 3KUPA 4KY7A 1O7ZA 3RUZA 3SEBA 1IL8A 3G7LA 4B3RL 1Y1VG 3NBHA 2EXDA 3CHBD 5IYCH 1XTDA 3CKIB 2JXMB 3GTKB 1Z9FA 2UXDL 1H95A 5M3MB 2MFIA 5C6AA 3E9IA 4NDXA 4HR7B 4HCSA 3KFUA 4LMQD 4ME3A 4LFAL 3UDGA 2VQFL 1S72A 3STBC 1G8ZD 5T1GA 1VQGA 1EQRA 1YBYA 4R1JA 2NYZD 3BZCA 3NTIA 1Y1WG 1XMOQ 1EY6A 2GVAA 2K4KA 2SEBD 2O5JC 5F2DA 3TZUA 2R7DA 3K7UC 3C1FA 2PZWA 1I4QA 1SNMA 5JEAJ 5KGUA 2LFNA 1K83B 4IFDG 2QGQA 4QIWE 1XNQQ 4BBRH 4PZ6A 2UUCL 2UXBL 3L2PA 3MAQA 1MGSA 5CYUA 1SFOH 1HA6A 3G4SA 1G6PA 3H0GH 4XQJA 4BBSH 1RF2D 2F0LA 2CWAA 1TXYA 3I4LA 1AH9A 4X66Q 4GLAC 4JW0A 1CSPA 3MXGA 4P2CB 3PIOA 3CMAA 3HKZB 3Q6SA 4R4QA 2LSSA 2I5LX 4FF1A 4IQZA 2DY8A 2E2DC 2L15A 2E5LL 1LT5D 4QQBX 4QF4A 5IWAQ 1G2TA 1HFGA 4AQYL 3OYYA 1JT8A 4A3MB 4JK1C 4G7OC 1R4QB 2DNCA 1TWCH 4GKKL 3PO3G 1DJRD 2Q2HA 3C2PA 2NVQH 2K50A 5LMUQ 3GDEA 3G6EA 1CZGA 3FKIH 3RN5A 1Q90A 4JI1Q 1TS4A 2HD3A 1VQFA 5ELNA 4FF2A 4XQQA 4OEMB 5A2QE 3F2DA 1S5ED 4FXDA 1F2MA 4A3DB 2O4XA 3CC2A 5FK9C 4FDBA 3MWYW 4E6IA 4JBKA 4RAUC 4BWGB 1D6EC 1B1ZA 1Y14B 4I65A 4BY1H 1N33L 2E8GA 1GXDC 1YNJC 5M5WH 1Y8OB 3K5LA 1YJWA 1H9SA 2N88A 3T16A 2WKDA 1I5FA 4KY6A 3HOYB 5I4DA 2I07B 3U9OA 2QILA 3PF4A 1GO3E 1NR2A 4YY3L 1F9SA 2FHTA 3HFZB 3L3OC 1F2LA 4K8IA 1KTKA 1K0SA 3A7AB 2MHVA 2F4IA 5KNDA 1RD9D 4YCWA 1SN8A 3K0XA 4NB3A 4WRDA 1WTVA 4IOAA 3H15A 1ZEQX 2UUBQ 3GTMH 2B2TC 4X3UA 4IUUA 1N36L 1SR3A 4TVAB 2WP8J 2VQEL 3HOWB 1SE3A 5IP9G 2XWJB 2R7ZG 4KK7A 1JJGA 1EY5A 4GOPB 4Z9CB 1ILPA 1PRTB 2VB2X 3OWFA 2KA7A 3S15B 2Z4IA 1DZ1A 1SNQA 3K6OA 4A3CH 1JR0D 3MFGA 3VYRA 4V0BA 2NUCA 2RDGA 4A93G 3A7LA 4IJHA 4GOPA 1VMPA 3NQIA 2IHEA 4TQUS 3KF6B 3S2HB 1PH2A 1HZBA 3IRBA 2E2JB 3J81j 2NVTB 2AQ1B 3OTOQ 4HEDA 2B29A 1W2BA 1IBLQ 1AE3A 1EQVA 1LTBD 3RD4A 4AIMA 1TQOA 3P20A 4NW2A 1B9MA 5M5YH 1A0IA 1HZ9A 2PCFB 3S2HH 2OTJA 3ULJA 1YVCA 4QMGA 5C3XA 1WTQA 4BY7G 1SMYD 1GUGA 2ZXRA 3J80i 1WTOA 2R93B 1GHKA 1CTMA 3AQQA 4B3SQ 5EKKA 4DV6L 2A6HD 4WJ3M 4IOCA 1HZAA 3DWAA 1I3QB 1HNZL 4LFCQ 1NY4A 4FF3A 1EEFD 2JA8G 5JJZA 2VS1A 4C3IH 3M9BA 5FLXL 3Q8DA 1KAAA 3FRPB 3M7NA 1EFWA 3M7GA 3ULPA 2JJQA 3MHBA 4MIUA 4DR6L 2BDOA 2KUMA 1TWAB 3S2DH 4DR7L 4A3GB 3E5SA 3EIVA 3HOVB 1RL2A 5ELBA 1AP0A 1VQNA 3M4OB 4HTHA 5T1IA 2PI2E 3IFDA 4JI7L 3TQYA 4A3EH 4A3FB 1UUPA 1YIJA 4A3KB 1EL0A 4X64L 3J80L 4DV1L 3R2IA 2UXDQ 5IT9E 1LTID 1ET6A 5C4XG 4JV5L 3L0OA 4NXML 1A3UA 5E3FA 4RKLA 4XT1B 2KHJA 2OWOA 5EPLA 4LFAQ 4HMJA 2VQFQ 4IUQA 3Q22A 1QNKA 3DWQA 4P75A 5ELOA 1GUSA 5IYDH 1F9QA 1BUVT 4C3HG 1H9KA 1V8QA 3K57A 1B2TA 2K04A 1EY7A 1J6QA 4A3JG 1PZJD 1F2ZA 1Y1VB 2UUCQ 2UXBQ 1LT4D 1VQOA 1S5CD 4RCOA 3CC4A 1WTWA 4AYBG 1SMXA 4PMWA 3S1QH 5LMNW 5DAUA 2D2CC 1QILA 1PH4A 1PH6A 1HFNA 3PSIA 3PIP3 1SYEA 2QDLA 4LJZC 1TT2A 2K5VA 1HR0W 1PTOB 1UWVA 2J7ZA 1Q46A 4DAVA 3TSSA 2F0IA 1VF5C 1EIGA 1FR3A 2IX0A 2AWNA 1OXXK 1SXTA 1VQ7A 2E74C 1DYQA 2Q2UA 1XTCD 2E5LQ 3HP3A 4H02A 1NAPA 4G4KA 4L5RC 4JI4Q 2DJFC 1STNA 1NUCA 1GUOA 4P73A 1SNDA 4CKEA 1WD1A 4QUFA 1ENCA 4HSVA 3HOXB 3BYYB 4QCLA 3PCOB 3OW2A 1SE8A 5HURA 5LMNL 1H9JA 2VW9A 2IX3A 2Q2IA 5IYCG 1E1OA 1WYDA 1HR0L 1NMFA 1NTGA 1N32L 2HHHL 1EZ6A 3A5ZB 3KF8B 4IALA 1X65A 3CU7A 3X3NA 3D4DA 1RDPD 1PRTF 1TWFH 4JOIA 2L1BA 4XQNA 2F3WA 3ER0A 3KJPA 4NXNL 1N33Q 2KECA 3C46A 5JJLA 3S14B 1KAWA 1M90C 3KLSX 4FXGC 3PO3B 3K58A 5CV7A 1QOHA 3TN2A 1EIHA 3BJUA 4YY3Q 5E7NA 2NTTA 5M5XH 3X3MA 2OQKA 1LT3D 3JC66 4DAPA 3T1YL 1XWEA 3A74A 3SHLA 1O78A 4BBRG 2CQOA 1HJPA 1CKNB 4OIJA 1T5XD 1HXYD 4F7XA 5KIXA 1QG7A 1WJJA 3OHXC 5C5LA 3H6MA 3WOEA 4BBSG 2WINB 3FDTA 3DEPA 5EQ0A 1GKHA 1JE4A 2VQEQ 4ZYSA 1I4XA 2I5HA 2HUGA 1STGA 1VQIA 2B2UA 3KLWA 4C1NK 1PH9A 3RLNA 4XYQA 1SMYC 1CZWA 1EOVA 4OWTB 1LTAD 2V4DA 3Q0AA 1QB5D 1AFPA 3RN2A 3CW2C 2A6HC 4U673 2ICIA 3FVQA 2CCZA 1L1OB 1DGSA 3I90A 1C9OA 2HT1A 3QO2A 3HKZG 3TP6A 2YV5A 1HTPA 3TDQA 5IGCA 5C0XI 2ID0A 1L0WA 1RTOA 1BOSA 1Q8IA 2E2HB 3ONAB 4R8NA 4C3JH 4A3MG 1L1OA 1GVPA 2C9OA 1P8LA 2B2WA 1NJIC 2R7ZB 1C48A 3NE5B 5JVG3 3GTOB 5FLXc 2PPBC 2HQEA 3BZDB 2F0SA 1VCIA 2JEAI 1CKMA 1STHA 4DV6Q 1GUTA 4DAYA 3DMUA 4KKTA 1HNZQ 1DXMA 4L8JA 3LNNA 2EDGA 1NBWA 4PG3A 4A93B 4BY1G 4HIKA 3NELA 5M9OA 3GTLB 2G5DA 3D4WA 5J39A 4ZUIA 3K59A 4DR7Q 1PFMA 5KYLA 1SJED 2HQLA 4JC0A 4DV3L 3MTSA 3Q24A 2AQ2B 4BY7B 3I8ZA 4JI7Q 2F03A 4CDDC 5BR8L 2PW7A 3GTGB 3CF5A 4X64Q 2JP1A 3K8AA 4DV1Q 4K6DA 1G91A 2KOLA 3I4NH 2F0FA 4NXMQ 2JA8B 1MJCA 1GUWA 1HRJA 3OPOA 2EJGC 1Y8NB 2NVXB 4C1NI 1SAPA 3JAME 1RKNA 1VQBA 1LACA 1PDQA 1RODA 1RTNA 2K7VA 4IZ8A 4DUYL 4L5SA 3VYSA 3PGZA 2VUMB 3KJOA 4LAAA 2RA4A 3CAMA 4IUPA 2F3IA 2JQOA 3OOCA 1R9TH 2DN8A 2AQ3B 2L55A 4FP5D 2Q8IB 3ZJYC 3PUXA 4JI8L 4PMCA 3W1BA 4LF5L 3F2UA 3GTQB 4PV1C 1E2WA 1RCVD 1XPRA 1WOCA 4LNQA 1K28A 5FJ8H 5J22A 2R61A 1VQ6A 2QA4A 5FOBB 3GTJB 2TSSA 2F0GA 2QKIC 4K5XA 2BOSA 1SE2A 2PZTA 1E0BA 2EYFA 4WORA 1GOZA 2ES2A 1Y69U 1IHZA 1FD7D 3T4AC 4OELB 2JA6B 2VZAA 1UAPA 2K14A 4C3IG 2KEDA 3BDOA 1HNWL 3M3YB 3CQZH 1AW7A 1A6XA 4U68A 3SVMA 5GAGC 2N8NA 2AUKA 2SNSA 4AYBB 1KDAA 1YHQA 2JYOA 2RSNA 1LUZA 1I4HA 2EY6A 3NBIA 5FO8B 3HRZC 1YITA 3DXJC 2E2IB 1I94L 1SEBD 1PZID 1I4PA 5LMNQ 1FGBD 3SK6A 1IW7D 3OWEB 1D7QA 1VQPA 3J7YW 3B6YA 2KJXA 5KYIA 4A3EG 1L0XB 4C2MB 2ZT9C 5ELCA 4K8JA 1HR0Q 5C4JB 1N32Q 3OSOA 2JA5H 2K03A 3T13A 1TS3A 4A3FG 4NXNQ 4XYOA 5ELFA 4A3KG 3RZOB 3V96A 2PO4A 3EJIA 2X6GA 5IYDG 1PFBA 1RIPA 4TKOB 1NMGA 3M4PA 2CH4W 3T1YQ 1QNUA 2ZJPA 1D2BA 2EYPA 1CSQA 2XIWA 1KNEA 1X32A 1FNWA 4OHJA 2WIIB 2KCCA 1WD0A 1ZKOA 3HOZH 1B7YB 3IKJA 3BVZA 3NTKA 2RF4A 4LF4Q 3M4QA 5I9OA 3UE0A 3J7ZC 2Q8RE 3EA6A 1TWHH 4H44C 4CDCC 2WV6D 1YJ9A 4EQOA 4KV6A 3VA7A 1XPUA 1Q86C 5GQOA 2K5WA 2IWHA 3S1NH 4KKUA 4A3BH 1VQMA 2ASBA 2F0PA 1CKOA 4R4IA 4DF7A 2HCIA 2J4XA 1J5EL 1KDCA 5D14A 2D0OA 2F0VA 3J81L 4BBRB 1TS5A 4ZKBB 4DR4Q 1BO0A 1SFOB 4JYAL 5TSSA 2I0QA 3U9SA 3H0GB 4BBSB 1PH1A 3PF5A 1XMQL 4IFDJ 2ZXPA 1E2VA 2BCOA 1D5ZC 3EROA 3ZYYX 4HMIA 1X56A 1JICA 3AMUA 2L9HA 3HOXG 4OWXB 5GAEC 5A35A 2FJ2A 3MZ5A 5AJ3L 2MJ8A 1BR9A 2EY2A 3K5NA 3LWEA 1VQ8A 5M3FH 1HA5A 2EJMA 1TWCB 2N3SA 3KLRA 2ZJRA 2L11A 2HIXA 2PMZB 1SNCA 2NVQB 1SRUA 1PZKD 3QG1A 4I7ZC 4A3IH 1B53A 1D5MC 4LF7L 2Z4HA 3FKIB 2K1BA 3BVGA 1NE3A 2FXQA 3NUCA 1KXLA 1CQVA 5IGFA 4DV3Q 5BR8Q 3PIPA 4ID6A 5C3EH 3C3LA 4LUVA 1T9HA 2F0JA 2F4VL 1A2UA 4MTKA 4CDFC 4BY1B 4KI0A 3PO2H 2EYHA 2LY7A 2B8FA 4DR1Q 5M5WB 3I55A 1L2FA 4G57A 4JG2A 1ESRA 4K2KA 3MFYA 4DV2L 1FNVA 3KDFB 2DY7A 1A63A 1QZHA 5J1ZA 3GQBA 4DUYQ 1U4RA 5C0XH 1G51A 3GD7A 2EIFA 4J1MA 1VQLA 4H7BA 3J80E 1X6OA 3K7AH 1E22A 2EY1A 2RQXA 3HOUH 4JI8Q 4RH6A 4DR5L 4YWMA 3TREA 4LF5Q 1FYCA 3VYUA 2VXWA 4LFBL 3GTMB 1DM0B 1STBA 1ZXTA 1BCPD 3AB9A 4ZRZA 3H94A 1LT6D 2N78A 1A15A 1IXRA 4QL5A 1HZCA 4IPCA 1ICWA 5DM73 1IW7C 2JK8A 2NZOA 3LGJA 2F0OA 4HJ8A 4LWCA 4O2DA 2LKVA 1KQSA 4ODGA 1HNWQ 2A5HA 2K5QA 3MXNB 1A3TA 1II3A 3CCLA 4X3KA 2EYOA 5DNFA 4B08A 3NENA 3MEHA 1N34L 1MKHA 2D0PA 3I70A 2KCTA 1TWGH 5JOBA 2JA7B 1SSOA 2IJ0A 4RG1A 1I94Q 2ZTDA 4MNOA 5M5YB 4OONA 2Z9HA 3MA2B 4IO9A 1F77A 2K28A 3QWNA 2F0KA 1U0LA 1ESFA 3F2BA 1JJ2A 3VYTA 2ICEC 1QCBD 3E9HA 3DHQA 2GVBA 2DJGC 1A62A 2J0TD 3HKSA 2JA7H 3W3AA 1LV9A 4JBJA 4OXPA 3I4NG 4DK1A 1PVOA 3KF6A 4C3IB 1UE5A 5IGGA 4X62L 1EFID 1PH5A 4IUVA 3W1GA 3OMGA 1IKMA 1L0YB 1PYWD 2CVRA 3RLFA 4PMBA 3I91A 1WTRA 4NKLA 1HNXL 1TU2B 2K52A 1I4GA 3S2DB 1OXSC 3QOLA 5CV8A 5EAYA 2AWOA 2B2UC 3LWUA 4CKBA 3KYHC 2OCEA 4A3EB 2O5IC 1S4ZA 2KVMA 4X6AH 1EY9A 2QEXA 2FFKB 2QW7A 1KIXA 2YU9H 1IYJB 2R92H 2O2LD 3GV6A 4KJNA 5GAHC 2B63H 2VUMG 3HGBA 2WAQG 2Z0SA 1Q7YC 5FJ8G 3WDNA 2B3GA 4J6HA 4AYBE 2XWBB 1NR4A 1DD2A 4B3RQ 3FMCA 1CHPD 2H4OA 5ISRA 2CH4A 3J81c 5A2QL 1E3PA 1SYCA 1GJXA 5CR3A 4XTCS 3P1HA 2B2WC 3G48A 4EQ5A 1B50A 2C35B 2EYJA 2F0MA 1J5EQ 1EU4A 2X69A 1SYGA 5KNCA 2BA0A 1YI2A 2CHBD 5EPKA 2F0TA 4A3LH 3A5UA 4GLVB 3S1QB 4JYAQ 2AHOB 2R7FA 1YEZA 2NTSA 2JA6G 1LTTD 4KHZA 3R8BA 1XMQQ 1C7YA 3PQIA 2A73B 4O1NA 5CMDA 4DUZL 5G3LD 2KQ3A 1XYIA 2IY5B 3WWVA 1EY4A 2MUYA 1B8AA 2JN4A 1E1TA 3GV3A 4S3SA 1ICFB 2SDFA 4K2LA 4KTAA 1YNXA 1M4VA 5AJ3Q 2JA5G 3SE0A 3MVVA 3HEJA 1JCKB 4H0LC 3K0YA 2H5XA 2NZHA 3ERQA 1O80A 2PNRC 2QEJC 1D5XC 2VL6A 3CPFA 4K6LA 4DNTB 1QJOA 4JCVE 4LF8L 4KHPL 3CP0A 3EBEA 4IPDA 4HJ9A 2B8GA 5GROA 4IN3A 1B9NA 1S40A 3TP8A 1BVSA 3AFPA 2MNAA 2NBFA 4LF7Q 1AE2A 1NNXA 2CWPA 4AQYQ 3I56A 1KDBA 1PFSA 3KBGA 3EVQA 4CJ0B 4GKKQ 5HGQA 4WJWA 3TS0A 3AEVA 3T51B 4UPAA 1O7LA 5LL6X 3E6ZX 3J7AV 4DPGA 1PA6A 1J8IA 1TWFB 3F1ZA 5IGDA 1IZ6A 1EWCA 1BCPC 4R4OA 1PMRA 1V43A 1WCMH 1C0AA 4H13C 2UXCL 2MO1A 2NZ1D 2OT2A 4DGZA 4OL7A 3I72A 5EKLA 4DV2Q 4LF9L 3A55A 1WVLA 5EGTA 4P72A 5M5XB 4NPSA 2ZM6L 1Y1WH 3R93A 2B2TA 3NSWA 5ELDA 1VMCA 3NQTA 4QUCA 4F88A 4IFDH 5C44H 5JEAH 3KF8A 4XT3B 1VQEA 3GP7A 4JI2L 1VQCA 4EVOA 4DR5Q 4LFBQ 1OO9B 1QVGA 3NHHA 4L5QA 3H3VI 1EWIA 1CI3M 3HKZE 3T1HL 1B3AA 3VR6A 2XVSA 2PMZE 1JORA 3UI2A 4JVZA 1O7IA 1DOKA 4M1UB 4NMZA 2HIVA 2R6GA 2Z6KA 3H0GG 2NN6I 2F52A 3NWSA 3ULLA 4YWKA 2E75C 1N36Q 4ZQ3A 4OX9L 4IPHA 4X65L 2PQEA 1IBKL 1CKNA 3S1RH 1KL9A 5I2XA 5M3FG 1AN8A 2RKSA 3H09A 4K5VA 4A75A 5CC4A 4GLXA 1I50H 1VDZA 3M4YA 4CBVA 1QVFA 1N34Q 5IYBH 1M1KC 4CKCA 2AKWB 4C3JB 4QGUA 1K3RA 5CBAE 1ML0D 2EYMA 4KN7C 1NSNS 2VB3X 1B4OA 3N6RA 4B9WA 1DCZA 5CGKA 1CHQD 3V2TA 5C3EG 1PRTD 3I4OA 2NVYH 3FKIG 2XN9C 4Q0FA 3QR8A 4DK3C 4ZCKA 3PO2G 4X62Q 3A0JA 5K36H 4GNXC 1SYBA 3EN2A 5BN3A 2PZUA 1STAA 1YHAA 4B3ML 1HNXQ 1XMOL 3CMEA 1SE4A 1ENAA 4JBWA 2LXKA 5C0XG 1TS2A 2F0UA 2M2LA 3ND8A 4FF4A 4IPGA 1Q3LA 2Z1CA 1XNQL 1SYDA 4GZYC 2KCMA 3HOUG 4DR6Q 1MJEA 3DWPA 1KLGD 4PQXA 3FHWA 5EBCA 3TS2A 5NUCA 1S5BD 1X3EA 3I4NB 4QY7A 4X66L 1J9OA 3U4ZA 1STEA 3HS0C 3EQLC 4KKSA 5C3WA 2N55A 2PYKA 2L0CA 4JV5Q 3H3VC 4M8AA 3SXHA 3E0JA 2EE1A 1R9TB 3QB3A 4R4CA 2Z8LA 2Y0SG 3KK7A 4N9TA 1MBYA 4GN5A 1XXGA 4MZ9A 5IODA 5IOCA 4LW1A 4WFN3 4A3CG 4YWLA 4B9XA 2WAQB 4KLKA 1LTGD 4UP8A 2A6ED 4HCEA 4DUZQ 3IL8A 4J15A 4DFAA 3FEWX 1TIID 1VS0A 2RCFA 4KD3A 4KN4C 4N9PA 1X3FA 1V9PA 3NK9A 3Q23A 4DR3L 1BCPB 3ICEA 1UEBA 2JA7G 4HN7A 2B2YA 2ALYB 1VQJA 4JBMA 1H9RA 3S1MH 4OGQC 2HCCA 3ITPA 4MTNA 3CQZB 1EIFA 2B2VA 1KRSA 1ILQA 1AEXA 3O13A 3J7A5 1PFNA 4LF8Q 1PLFA 2A8VA 4KHPQ 1JE5A 1VQKA 1WTPA 4R4TA 4XIGS 3WOFA 4JI0L 3KBXA 3MC0B 1PTOD 2PNHA 4POFA 3OIQA 1KABA 4YCUA 2R92G 3ND9A 1ASYA 2BH8A 4EGVA 2F0EA 3PUWA 2Q8TA 2B63G 2RBMA 2JA5B 2G9HD 4R9WA 4YHHL 1M8AA 3S17H 3GO5A 2NWGA 3HZXA 5K5PA 1C4QA 1OXUA 1E7ZA 1VQHA 2UXCQ 2EQSA 2HHHQ 4CGYB 1B3QA 4LF9Q 1HCZA 1JWMD 5DLQE 3VDYA 3S16H 4KJOA 2ZM6Q 2Z6BA 4C3HH 4DV0L 2EZVA 1G6ZA 3PV0A 4A3LG 2AMCB 3T56B 2XRSD 4JI2Q 1ONLA 3VR2A 4DV4L 2A74C 4HJAA 4ABNA 3HOZB 1PH3A 3CD6A 5KEEA 3J81i 2K32A 3D8GA 1HHVA 4AH6A 3T1HQ 5IT9c 3T53B 3AYHB 4DV7L 1U4LA 4KMUC 1EZ8A 1TWHB 4B3SL 5I9PA 2D62A 2K5DA 3EFXD 1MD2D 4A3BB 3S1NB 4GOPC 4OIKA 1TKWB 4OX9Q 3BZKA 4FNFA 2ZTCA 2NB0A 4X65Q 1IBKQ 4PNYA 5CV4A 1MIUA 5CORA 4O42A 1JOKA 1KLUD 1EY0A 3CRLC 1F9PA 5EKIA 1X55A 2K01A 3JAML 3VR4A 5C4ZA 4I7AA 3I4MH 3NTHA 4WJ4A 1DOMA 1U4PA 2KCNA 1SNPA 4OO1H 3UDIA 1QWYA 4IFDI 1W3SA 4RCNA 3I73A 2MQHA 3BVMA 1Z47A 3CCEA 1MI2A 3H91A 1H9MA 5EJWA 1WCMG 5M3FB 1QZGA 2WB1G 2AUJD 2F0WA 3GTKH 1K8GA 5BN5A 1TR5A 1S3OA 5M3MH 3R3OA 1GUNA 5HGTA 4A3IB 4B3MQ 2KENA 3CCQA 2Q2TA 2RCNA 2XGTA 5IE8A 2L4NA 1GM5A 4XDXA 2BDNA 4BXXH 2P5ZX 1CA6A 1VF7A 5C44G 5CBEE 3H3VH 5JEAG 2QF7A 3MXUA 1SJHD 4DNRB 1HUMA 3F8TA 3TP7A 5C3EB 4GKJL 2IT1A 1U9RA 3W5OA 4BS9A 1I6VC 2NN6H 2CW0D 1KNAA 3RMHA 1YHBA 2X6LA 1SYFA 1K83H 3DM1A 3I2ZA 1K8AC 3PO2B 1BCPF 2A6EC 1FNUA 3E0EA 1IBML 1IKLA 1CK1A 5FLMH 4JI6L 1YZ6A 5FLXE 4UAIA 2KEEA 1BQQT 4DK6C 2OEOA 2DUDA 1V1OA 2YTXA 2I5MX 2MO0A 1BF4A 3K7AB 1IYVA 4JI4L 1QUQB 4OWWB 1TVXA 3SR1A 3HOUB 1FVIA 1EYDA 1K3BC 4RGMA 3PUVA 1JWUD 1XX8A 3UDXA 2XRQD 5IYBG 4L6TB 4L5TA 4HJ5A 4A3MH 5I6WA 2F0NA 1QUQA 2BA1A 3KDFA 1SNOA 2JSOA 3D3RA 4ZLTF 1XJVA 1SDFA 1HUNA 1H9SB 5CV5A 4DR3Q 1PTOC 2MPMA 4UHVA 4LF6L 3QIAA 4C3JG 1KRTA 4IJLA 2A1AA 1STYA 4X3SA 5K36G 2CKZB 2D9UA 3TP5A 4A3DH 2Y0SB 4HIDA 2UU9L 1EU3A 1TWGB 2RSOA 4GN3B 5D3DA 4X3TA 5E4WC 2GA4B 4JI0Q 2DGYA 3OIPA 4DXGA 4DR2L 3ERSX 5CV9A 1HQMC 3HOYH 4LUOA 3PUZA 4EX5A 2DNEA 4POGA 3D4RA 2IX1A 4JOIC 5AFWA 4DV5L 5KRUA 3TRZA 3VA5A 2HDLA 3MXNA 1BBXC 1HH2P 4UDUC 4YHHQ 1X3QA 4BA1I 3FP9A 2BE5D 2WAQE 5LL6S 3CCSA 1K8MA 1Z7TA 1UE1A 5IY0A 2IW3A 3RLOA 3HOWH 3PUYA 1EY8A 2YYZA 3BU2A 4A76A 1EOTA 2B39A 1E24A 1JMCA 1N9WA 2F0HA 4DV0Q 4GS3A 1FJGL 1RHPA 2Z6KC 4FXKC 4K0KL 2YU9B 2D5DA 1EUJA 2L5TA 2EVBA 2R92B 2VNUD 3FPUB 1T5EA 3S15H 2B63B 4ZKCB 4DV4Q 1G291 2JEBI 2K33A 4CJ1B 3BDLA 5EPJA 5C4HA 4UP7A 1O7YA 3BYTB 2LXJA 5G3LF 3CCMA 4DV7Q 2QDBA 2E2JH 2SOBA 1LABA 2NVTH 5JJKA 3BDCA 1EEID 3KLSA 4P74A 1QVCA 1TY2A 4FO2A 2EPBA 1EYAA 4A4IA 3A8JE 5C5MA 1CUKA 3BS1A 1B44D 4DU9A 3JAMc 5FO9B 1UE6A 3LX0A 2XNAC 2R93H 4ZAIA 1F9RA 1EQQA 3NPPA 4O0AA 3S9WA 3D0FA 1I3QH 5L37A 3RNUA 1Q8KA 1YNND 1L1OC 1VQAA 3QOJA 2LS01 4KD4A 3UDFA 1JC7A 1X3GA 4MHEA 1ZYRD 4DAMA 3A54A 5I6YA 2XTIA 2SNMA 3E3XA 1OTCA 1Q1EA 3U50C 3NWTA 1DONA 2KHSA 1TWAH 1QE6A 4A3GH 3SK8A 2A69D 2KBNA 2K6AA 3HOVH 3CCRA 5H1SE 5EBDA 3M4OH 3TMEA 1GHJA 2OF1A 5IGBA 4A3FH 2CW0C 1KC8C 1ASZA 4A3KH 3SK5A 1MSHA 1EYGA 1EQTA 1IL2A 3PIO3 3SGIA 1A8VA 1KHIA 2M00A 1Q81C 1LTLA 1Y8PB 4QB4A 5COYA 2WFWA 1VQDA 2TMPA 5HY6A 3OMCA 1EYCA 2M9VA 3TEHB 4UY8C 4RGTA 3CXCA 4GKJQ 4FYDA 1N8RC 4RFBA 5IP7H 1BNZA 4RHRA 4G7ZC 5DM63 2EXZA 3CPWA 2IL8A 1IBMQ 1Y1VH 1A2TA 1WCMB 1OXTA 3GTPB 2F3VA 2N49A 2WB1B 1XPOA 3AU7A 2JA9A 4JI6Q 4G7HC 3A56A 3HOZG 2F0QA 2QCPX 2ZJQA 4TSSA 3MXPA 1Q82C 1Y1WB 2UUAL 2F4VQ 1BBWA 1PTOH 1A3VA 1GD7A 5DEHA 2EYLA 4OO1I 1CA5A 4KY5A 4XXEA 2V1CC 5C44B 3GTPH 4JPBW 5JPMC 3AFQA 1X3PA 4A3BG 4RGNA 2B2YC 1PXUA 3MEFA 3DUZA 3I4MG 4EQNA 4B3TL 2A68D 1G2SA 1MHWC 3DEOA 2B2VC 1V1QA 4NP5A 5D65A 3UE1A 3IFTA 4LUZA 1WI5A 4RHSA 2HDMA 1JB3A 3PMFA 1X9NA 1CM9A 3URYA 4OO1G 1D1IA 3HOXH 4CHTB 4K14A 4LF6Q 1C8CA 4R8IA 4ALPA 3V05A 3S1RB 3FPPA 1JQYD 5FKAC 4FVMA 1I50B 2BH2A 4F87A 3DM3A 5M3MG 4QIWB 2BE5C 2IPKD 1SLJA 5IT9L 4K5WA 4JI5L 2UU9Q 3TZDA 1KD1C 4UP9A 5KNBA 4JI3L 1BBUA 4EQPA 2YTYA 4BXXG 2ATWA 4YIJA 3S14H 1E2ZA 4DR2Q 5D3IB 1XNRL 1Q1BA 4HIMA 2FMCA 3PO3H 5JJIA 1WTXA 2RDFA 2G9DA 4A3IG 1D1KA 1B70B 2NVYB 1HTLD 1LM0A 4DN4M 4DV5Q 2NN6G 4LF4L 4RGOS 5FO7B 1I4RA 1CFMA 3OW7A 5JAVA 4N8X1 5FLMG 1JB7A 4IUTA 3VR3A 4J8QA 3N52A 3NEMA 3I3CA 3U58A 1LLRD 4TRDA 5IIFA 1FJGQ 4DR4L 4APVA 2FMMA 3L9AX 4K0KQ 4ULLA 4MN3A 4Y52H 2VY3A 5C0XJ 3L7ZC 1PYBA 4DAYB 3D6WA 2Y0SE 3TBIB 5GADC 1EIYB 1YNNC 2R3ZA 1ZYRC 3RR5A 1SBBB 1P16A 1ENFA 1UEAB 1IYUA 2E2HH 3STBD 5IP9H 1EWHA 4N8FA 5ELEA 4DA2A 2R7ZH 3NXWA 1D8LA 3GTOH 2A69C 5JPNC 4DNIA 3P75A 1JWSD 1YJNA 1U5KA 5E4XA 4A3DG 3CCJA 4Y7NB 2JE6I 1LTSD 5LHY1 4HAEA 3RZDB 3CCUA 1U4MA 5IWAL 3SDZA 1X54A 3J80c 1Z6HA 3C1EA 4A93H 2PW5A 1FGUA 5BN4A 4GN4B 1AZPA 4Y7NH 2CFMA 3GTLH 5IGEA 1R4PB 3HOYG 2XSCA 1PHJA 3RZDH 3CRKC 2IHFA 1VQ5A 1PTOF 3K80C 5LMUL 2K5NA 1BKBA 1HPCA 3A8IE 3W2DA 4JI1L 4RMFA 4IUNA 3S1MB 4RWSC 3SK4A 3KOJA 4DR1L 4HSPA 3CCVA 3VR5A 4BY7H 4CJ2C 2ENBA 1JOOA 3G6JB 3G71A 1K0RA 3M85A 3GTGH 4ZUJA 1HQRD 2ZTEA 3HOWG 1WFQA 3NP8A 4QJFA 2JA8H 3I7FA 1NCVA 3J81E 3R2TA 2YTVA 3DLLA 2EY5A 3K5OA 4PZ7A 2NVXH 1WTHA 1I6HB 4V190 2EOTA 1SROA 2C5CA 2VUMH 4PZ8A 4DK0A 1V1PB 1W6KA 1PV4A 5C4XB 3A8KE 3BG3A 4KHVA 3S17B 1S5FD 2K5HA 4YCVA 4RKBA 1I6HH 2A68C 5JVH3 2CQAA 1RJTA 1AZQA 3GTQH 2H1EA 2PQAB 2RDHA 2UUBL 3D6CA 4IURA 2F0DA 1V1PA
chains in the Genus database with same CATH topology
2GN5A 5C4XH 1YZ6A 2UUAQ 1VQIA 3KLWA 3J81c 3D31A 3GTJH 4DK6C 1E3PA 2OTLA 1PH9A 3RLNA 2R93G 4BA2I 2DUDA 1VQ4A 2PQAA 1EOVA 4OWTB 2YTXA 4XTCS 2I5MX 2KHIA 3G48A 2MO0A 4EQ5A 3RN2A 2C35B 4JI4L 3CW2C 1QUQB 1JJCB 4OWWB 1J5EQ 1FVIA 2JA6H 2BA0A 1YI2A 3PUVA 2CCZA 1L1OB 5J3BA 3A5UA 4GLVB 4B3TQ 4A3LH 3M3YH 4JYAQ 1Q12A 1DGSA 2AHOB 1YEZA 1C9OA 2R7FA 3UDXA 5IYBG 4A3JH 3S24A 3HKZG 2HT1A 1PYSB 2JA6G 4L5TA 4HJ5A 4KHZA 2YV5A 4A3MH 1XMQQ 1C7YA 5C0XI 3JAMi 2ID0A 1L0WA 4DKAC 1QUQA 2BA1A 2PI2A 3K81C 3KDFA 4DUZL 2IY5B 3OTOL 3WWVA 1XJVA 2RHQB 4C3JH 1B8AA 4A3MG 1L1OA 1GVPA 1IBLL 1E1TA 4A3GG 1P8LA 1NJIC 4DR3Q 3HOVG 2E2IH 4LF6L 5FLXc 4P71A 1KRTA 1YNXA 4IJLA 2OQ0A 1VCIA 2A1AA 2JEAI 4C2MH 1CKMA 5AJ3Q 4DV6Q 2JA5G 5K36G 4HIOA 1K9MC 2CKZB 1UE7A 5C4JH 1HNZQ 1PH8A 2RHSB 4HJ7A 4A3DH 2H5XA 2NZHA 4LFCL 4GNXB 1NBWA 4PG3A 4BY1G 2VL6A 3CPFA 4HIKA 2A19A 3NELA 4JI5Q 4JCVE 4LF8L 2WB1E 4HIDA 4JI3Q 3CP0A 4KHPL 2UU9L 3EBEA 1OXVA 3U4VA 4IPDA 4GN3B 5GROA 4HJ9A 1S40A 1PH7A 3RZOH 1LYLA 1BVSA 4JI0Q 3AFPA 2MNAA 2DGYA 4LF7Q 3NBHB 1AE2A 1XNRQ 2CWPA 4AQYQ 4GNXA 4DR2L 3ERSX 3I56A 1PFSA 1FL0A 1VQ9A 4DR7Q 3HOYH 4LUOA 3PUZA 4EX5A 3F2CA 5IP7G 2HQLA 4POGA 4GKKQ 1K73C 4JC0A 2K75A 5HGQA 3CC7A 4DV3L 4JOIC 2IX1A 3TS0A 4JI7Q 3AEVA 4DV5L 4UPAA 5BR8L 3TRZA 3CF5A 4B3RL 1Y1VG 4X64Q 1HH2P 2EXDA 4DPGA 3K8AA 5IYCH 1XTDA 4YHHQ 4DV1Q 1PA6A 1Z9FA 3F1ZA 3FP9A 4BA1I 2UXDL 1H95A 1IZ6A 2WAQE 3I4NH 2MFIA 4NXMQ 4R4OA 1MJCA 3CCSA 3E9IA 1XNQQ 1V43A 1WCMH 1C0AA 2UXCL 1UE1A 2MO1A 3KFUA 5IY0A 3RLOA 4ME3A 4DV2Q 3HOWH 4LF9L 4LFAL 3PUYA 2VQFL 4P72A 2YYZA 3STBC 3BU2A 4A76A 3UDGA 1S72A 4NPSA 2ZM6L 1Y1WH 1E24A 1JMCA 1VQGA 1EQRA 1N9WA 1VQBA 4DV0Q 1YBYA 4GS3A 4R1JA 4DUYL 1FJGL 4L5SA 3PGZA 2Z6KC 4K0KL 3KJOA 3BZCA 1Y1WG 1EUJA 5C44H 2GVAA 2K4KA 3CAMA 1XMOQ 2F3IA 2JQOA 2VNUD 2R7DA 1R9TH 3K7UC 3S15H 4DV4Q 1VQEA 1G291 4JI2L 1VQCA 5JEAJ 4DR5Q 4IFDG 2JEBI 2QGQA 4QIWE 3PUXA 4JI8L 3ZJYC 4BBRH 4PZ6A 3W1BA 2UUCL 4LF5L 3L2PA 1QVGA 2UXBL 4L5QA 3H3VI 1EWIA 1XPRA 1SFOH 1WOCA 4UP7A 3HKZE 2LXJA 3G4SA 3CCMA 4DV7Q 3H0GH 3T1HL 4LNQA 1G6PA 4BBSH 2PMZE 5FJ8H 2E2JH 1VQ6A 2NVTH 5JJKA 2QA4A 1O7IA 4P74A 1QVCA 2HIVA 2CWAA 1TXYA 2R6GA 2Z6KA 2NN6I 3H0GG 4A4IA 2F52A 1CUKA 3ULLA 4YWKA 1AH9A 4X66Q 4GLAC 1N36Q 1CSPA 2ES2A 3JAMc 1UE6A 4OX9L 4IPHA 3PIOA 2R93H 4X65L 1IBKL 3CMAA 1CKNA 3S1RH 2VZAA 4R4QA 2K14A 2I5LX 1KL9A 2LSSA 1EQQA 1HNWL 5M3FG 2L15A 4O0AA 2E5LL 4QQBX 3CQZH 5IWAQ 4A75A 3D0FA 1I3QH 3RNUA 4GLXA 1I50H 1Q8KA 4AQYL 1L1OC 1VQAA 3OYYA 1JT8A 5GAGC 2N8NA 1QVFA 3UDFA 1X3GA 4DAMA 1N34Q 1YHQA 1TWCH 5IYBH 1M1KC 2XTIA 2AKWB 1LUZA 4GKKL 4QGUA 1K3RA 1OTCA 3PO3G 1Q1EA 2Q2HA 2NVQH 1YITA 2K50A 1I94L 5LMUQ 3GDEA 3U50C 3G6EA 3FKIH 5LMNQ 3RN5A 1D7QA 4JI1Q 1VQPA 3B6YA 4A3EG 1TWAH 4A3GH 1VQFA 5C3EG 2KBNA 3HOVH 3I4OA 5ELNA 3CCRA 5H1SE 2NVYH 3M4OH 3FKIG 1HR0Q 3F2DA 1N32Q 4DK3C 3CC2A 4FDBA 4A3FH 3PO2G 1KC8C 4JBKA 1ASZA 4A3KH 2JA5H 4X62Q 3A0JA 1EYGA 1Y14B 4GNXC 4A3FG 4NXNQ 1IL2A 4BY1H 4A3KG 1N33L 3EN2A 2E8GA 3SGIA 5M5WH 1YJWA 1A8VA 1KHIA 1YHAA 1HNXQ 4B3ML 1Q81C 1LTLA 1XMOL 3CMEA 2WFWA 5IYDG 4JBWA 1I5FA 1VQDA 2LXKA 5C0XG 3PF4A 1RIPA 5HY6A 1GO3E 1NMGA 4YY3L 3M4PA 3T1YQ 4IPGA 1XNQL 2ZJPA 3TEHB 4UY8C 3HFZB 2KCMA 3HOUG 3CXCA 1CSQA 4DR6Q 1MJEA 4YCWA 1N8RC 5IP7H 3TS2A 3FHWA 1SN8A 4GKJQ 3K0XA 4NB3A 4BY7H 4IOAA 3H15A 1X3EA 3HOZH 1B7YB 4QY7A 3CPWA 1Y1VH 1IBMQ 2UUBQ 2RF4A 1OXTA 4X66L 1XPOA 2N49A 4LF4Q 3U4ZA 3GTMH 1N36L 3M4QA 2JA9A 1SR3A 3UE0A 4TVAB 2WP8J 3J7ZC 2VQEL 4JI6Q 3HOZG 2ZJQA 1Q82C 5IP9G 2R7ZG 2UUAL 2F4VQ 1JJGA 1TWHH 1BBWA 4GOPB 1YJ9A 1GD7A 4JV5Q 4OO1I 1XPUA 2V1CC 1Q86C 5GQOA 4A3BH 3GTPH 3S1NH 1VQMA 2ASBA 1CKOA 4R4IA 4R4CA 3AFQA 2Y0SG 4A3CH 1J5EL 4A3BG 2D0OA 4A93G 4DR4Q 4GN5A 3MEFA 4IJHA 4GOPA 3I4MG 4MZ9A 2IHEA 4B3TL 4TQUS 3KF6B 4LW1A 4JYAL 4A3CG 4YWLA 2I0QA 4KLKA 1V1QA 4UP8A 3UE1A 1PH2A 4LUZA 1HZBA 1PH1A 1WI5A 3IRBA 3PF5A 3J81j 4DUZQ 1XMQL 4J15A 4IFDJ 3OTOQ 1X9NA 1VS0A 2B29A 1W2BA 4OO1G 1IBLQ 1AE3A 4AIMA 1X56A 1X3FA 1V9PA 3HOXH 5M5YH 4LF6Q 1A0IA 1HZ9A 4DR3L 3ICEA 3S2HH 2OTJA 1UEBA 3ULJA 1YVCA 4ALPA 2JA7G 4BY7G 3J80i 2ALYB 3HOXG 4OWXB 1VQJA 5GAEC 4JBMA 3AQQA 4B3SQ 3S1MH 5AJ3L 4MTNA 4DV6L 4WJ3M 4IOCA 1EIFA 1HZAA 1KRSA 1HNZL 4LFCQ 1NY4A 2BH2A 3DM3A 5M3MG 1VQ8A 2JA8G 3J7A5 2VS1A 4C3IH 3M9BA 1SLJA 3Q8DA 5M3FH 4LF8Q 4KHPQ 2A8VA 4JI5L 2UU9Q 2N3SA 1KD1C 4UP9A 1JE5A 2ZJRA 4JI3L 1BBUA 1VQKA 3M7NA 1EFWA 2YTYA 3ULPA 2HIXA 4BXXG 4LFBQ 2JJQA 2ATWA 1SRUA 4R4TA 4XIGS 4A3IH 3S14H 4JI0L 4DR2Q 4DR6L 4LF7L 1XNRL 1Q1BA 4HIMA 3PO3H 5JJIA 1NE3A 2FXQA 3S2DH 4DR7L 1KXLA 2PNHA 4A3IG 3EIVA 4POFA 1RL2A 1B70B 4DV3Q 1VQNA 2R92G 4YCUA 1LM0A 1ASYA 4DV5Q 5BR8Q 2BH8A 2NN6G 3PUWA 2PI2E 4LF4L 2B63G 4JI7L 3PIPA 3TQYA 4A3EH 1YIJA 5C3EH 4X64L 5FLMG 4YHHL 4DV1L 4LUVA 1JB7A 3S17H 1T9HA 2UXDQ 2F4VL 3GO5A 1OXUA 4KI0A 3PO2H 1E7ZA 1VQHA 3L0OA 4NXML 4JV5L 3NEMA 4DR1Q 2UXCQ 5C4XG 3I55A 1L2FA 2EQSA 3U58A 4JG2A 2KHJA 2HHHQ 2OWOA 4LF9Q 4LFAQ 2VQFQ 4DV2L 5DLQE 3VDYA 3KDFB 3S16H 2ZM6Q 1A63A 4C3HH 1QZHA 4P75A 5ELOA 1FJGQ 4DR4L 4APVA 4DUYQ 4DV0L 4K0KQ 5IYDH 1G51A 3GD7A 2EIFA 3PV0A 4A3LG 2AMCB 1VQLA 4Y52H 2VY3A 5C0XJ 1X6OA 3K7AH 1E22A 4JI2Q 1J6QA 4A3JG 3L7ZC 1PYBA 4DAYB 4DV4L 2Y0SE 5GADC 4JI8Q 4HJAA 1EIYB 3HOUH 4DR5L 4YWMA 3TREA 1PH3A 2UUCQ 1VQOA 4LF5Q 3CD6A 4LFBL 2UXBQ 3J81i 3CC4A 3S1QH 4AYBG 1SMXA 4PMWA 4AH6A 3RR5A 3T1HQ 5LMNW 5IT9c 1PH4A 1PH6A 3AYHB 4DV7L 3PSIA 1P16A 2K5VA 2N78A 4B3SL 1IXRA 1UWVA 1HZCA 4QL5A 1HR0W 1Q46A 2E2HH 4IPCA 3STBD 2D62A 5IP9H 2JK8A 2NZOA 2R7ZH 4GOPC 1D8LA 3LGJA 3GTOH 4OX9Q 3BZKA 2IX0A 4DNIA 1YJNA 2ZTCA 1U5KA 2AWNA 4X65Q 4LWCA 1OXXK 4O2DA 3CCJA 4HJ8A 1IBKQ 1VQ7A 4A3DG 2Q2UA 1MIUA 2JE6I 1KQSA 1HNWQ 2E5LQ 4H02A 3CCUA 3MXNB 5IWAL 1X54A 3CCLA 3J80c 1X55A 4A93H 4L5RC 1FGUA 4JI4Q 3I4MH 3NENA 4GN4B 1N34L 1MKHA 4Y7NH 2CFMA 4P73A 3GTLH 2D0PA 4WJ4A 2KCTA 1TWGH 3HOYG 1PHJA 4RG1A 1I94Q 2ZTDA 4MNOA 3RZDH 2IHFA 4OONA 1VQ5A 3K80C 5LMUL 2K5NA 1BKBA 3PCOB 4IO9A 1SE8A 3OW2A 5LMNL 1U0LA 1JJ2A 3F2BA 3UDIA 4JI1L 4RMFA 2VW9A 4IFDI 2Q2IA 1W3SA 2GVBA 3E9HA 5IYCG 3KOJA 1E1OA 1WYDA 2MQHA 1A62A 4DR1L 3CCVA 1HR0L 1NMFA 3HKSA 1NTGA 1Z47A 3CCEA 2HHHL 2JA7H 3G71A 4JBJA 3A5ZB 1N32L 4OXPA 3KF8B 1K0RA 3M85A 3GTGH 3KF6A 3I4NG 1PVOA 1X65A 1UE5A 1WCMG 1QZGA 4X62L 1TWFH 2WB1G 1PH5A 4JOIA 3W1GA 2ZTEA 3GTKH 1K8GA 3HOWG 3ER0A 1WFQA 4QJFA 3KJPA 1S3OA 4NXNL 5M3MH 1N33Q 2JA8H 3I7FA 4B3MQ 3RLFA 5JJLA 2KENA 1KAWA 3CCQA 1M90C 2RCNA 2YTVA 2Q2TA 3DLLA 2XGTA 5IE8A 4PZ7A 1HNXL 2NVXH 1GM5A 2K52A 3BJUA 4BXXH 1OXSC 4YY3Q 5E7NA 5M5XH 5C44G 3H3VH 1SROA 2OQKA 3JC66 2AWOA 5EAYA 5JEAG 3T1YL 3A74A 3KYHC 2OCEA 2VUMH 4PZ8A 4X6AH 2QEXA 1KIXA 2YU9H 3F8TA 1PV4A 1IYJB 4BBRG 2CQOA 1HJPA 2R92H 4GKJL 2IT1A 1CKNB 3W5OA 5GAHC 2K5HA 4YCVA 2B63H 2VUMG 2WAQG 1YHBA 1I6HH 1WJJA 1K83H 2Z0SA 3I2ZA 1Q7YC 1K8AC 5FJ8G 4BBSG 1IBML 3E0EA 2B3GA 3GTQH 2PQAB 5FLMH 4AYBE 1GKHA 2UUBL 2VQEQ 4B3RQ 4JI6L 2I5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GN5 A;  5C4X H;  1YZ6 A;  2UUA Q;  1VQI A;  3KLW A;  3J81 c;  3D31 A;  3GTJ H;  4DK6 C;  1E3P A;  2OTL A;  1PH9 A;  3RLN A;  2R93 G;  4BA2 I;  2DUD A;  1VQ4 A;  2PQA A;  1EOV A;  4OWT B;  2YTX A;  4XTC S;  2I5M X;  2KHI A;  3G48 A;  2MO0 A;  4EQ5 A;  3RN2 A;  2C35 B;  4JI4 L;  3CW2 C;  1QUQ B;  1JJC B;  4OWW B;  1J5E Q;  1FVI A;  2JA6 H;  2BA0 A;  1YI2 A;  3PUV A;  2CCZ A;  1L1O B;  5J3B A;  3A5U A;  4GLV B;  4B3T Q;  4A3L H;  3M3Y H;  4JYA Q;  1Q12 A;  1DGS A;  2AHO B;  1YEZ A;  1C9O A;  2R7F A;  3UDX A;  5IYB G;  4A3J H;  3S24 A;  3HKZ G;  2HT1 A;  1PYS B;  2JA6 G;  4L5T A;  4HJ5 A;  4KHZ A;  2YV5 A;  4A3M H;  1XMQ Q;  1C7Y A;  5C0X I;  3JAM i;  2ID0 A;  1L0W A;  4DKA C;  1QUQ A;  2BA1 A;  2PI2 A;  3K81 C;  3KDF A;  4DUZ L;  2IY5 B;  3OTO L;  3WWV A;  1XJV A;  2RHQ B;  4C3J H;  1B8A A;  4A3M G;  1L1O A;  1GVP A;  1IBL L;  1E1T A;  4A3G G;  1P8L A;  1NJI C;  4DR3 Q;  3HOV G;  2E2I H;  4LF6 L;  5FLX c;  4P71 A;  1KRT A;  1YNX A;  4IJL A;  2OQ0 A;  1VCI A;  2A1A A;  2JEA I;  4C2M H;  1CKM A;  5AJ3 Q;  4DV6 Q;  2JA5 G;  5K36 G;  4HIO A;  1K9M C;  2CKZ B;  1UE7 A;  5C4J H;  1HNZ Q;  1PH8 A;  2RHS B;  4HJ7 A;  4A3D H;  2H5X A;  2NZH A;  4LFC L;  4GNX B;  1NBW A;  4PG3 A;  4BY1 G;  2VL6 A;  3CPF A;  4HIK A;  2A19 A;  3NEL A;  4JI5 Q;  4JCV E;  4LF8 L;  2WB1 E;  4HID A;  4JI3 Q;  3CP0 A;  4KHP L;  2UU9 L;  3EBE A;  1OXV A;  3U4V A;  4IPD A;  4GN3 B;  5GRO A;  4HJ9 A;  1S40 A;  1PH7 A;  3RZO H;  1LYL A;  1BVS A;  4JI0 Q;  3AFP A;  2MNA A;  2DGY A;  4LF7 Q;  3NBH B;  1AE2 A;  1XNR Q;  2CWP A;  4AQY Q;  4GNX A;  4DR2 L;  3ERS X;  3I56 A;  1PFS A;  1FL0 A;  1VQ9 A;  4DR7 Q;  3HOY H;  4LUO A;  3PUZ A;  4EX5 A;  3F2C A;  5IP7 G;  2HQL A;  4POG A;  4GKK Q;  1K73 C;  4JC0 A;  2K75 A;  5HGQ A;  3CC7 A;  4DV3 L;  4JOI C;  2IX1 A;  3TS0 A;  4JI7 Q;  3AEV A;  4DV5 L;  4UPA A;  5BR8 L;  3TRZ A;  3CF5 A;  4B3R L;  1Y1V G;  4X64 Q;  1HH2 P;  2EXD A;  4DPG A;  3K8A A;  5IYC H;  1XTD A;  4YHH Q;  4DV1 Q;  1PA6 A;  1Z9F A;  3F1Z A;  3FP9 A;  4BA1 I;  2UXD L;  1H95 A;  1IZ6 A;  2WAQ E;  3I4N H;  2MFI A;  4NXM Q;  4R4O A;  1MJC A;  3CCS A;  3E9I A;  1XNQ Q;  1V43 A;  1WCM H;  1C0A A;  2UXC L;  1UE1 A;  2MO1 A;  3KFU A;  5IY0 A;  3RLO A;  4ME3 A;  4DV2 Q;  3HOW H;  4LF9 L;  4LFA L;  3PUY A;  2VQF L;  4P72 A;  2YYZ A;  3STB C;  3BU2 A;  4A76 A;  3UDG A;  1S72 A;  4NPS A;  2ZM6 L;  1Y1W H;  1E24 A;  1JMC A;  1VQG A;  1EQR A;  1N9W A;  1VQB A;  4DV0 Q;  1YBY A;  4GS3 A;  4R1J A;  4DUY L;  1FJG L;  4L5S A;  3PGZ A;  2Z6K C;  4K0K L;  3KJO A;  3BZC A;  1Y1W G;  1EUJ A;  5C44 H;  2GVA A;  2K4K A;  3CAM A;  1XMO Q;  2F3I A;  2JQO A;  2VNU D;  2R7D A;  1R9T H;  3K7U C;  3S15 H;  4DV4 Q;  1VQE A;  1G29 1;  4JI2 L;  1VQC A;  5JEA J;  4DR5 Q;  4IFD G;  2JEB I;  2QGQ A;  4QIW E;  3PUX A;  4JI8 L;  3ZJY C;  4BBR H;  4PZ6 A;  3W1B A;  2UUC L;  4LF5 L;  3L2P A;  1QVG A;  2UXB L;  4L5Q A;  3H3V I;  1EWI A;  1XPR A;  1SFO H;  1WOC A;  4UP7 A;  3HKZ E;  2LXJ A;  3G4S A;  3CCM A;  4DV7 Q;  3H0G H;  3T1H L;  4LNQ A;  1G6P A;  4BBS H;  2PMZ E;  5FJ8 H;  2E2J H;  1VQ6 A;  2NVT H;  5JJK A;  2QA4 A;  1O7I A;  4P74 A;  1QVC A;  2HIV A;  2CWA A;  1TXY A;  2R6G A;  2Z6K A;  2NN6 I;  3H0G G;  4A4I A;  2F52 A;  1CUK A;  3ULL A;  4YWK A;  1AH9 A;  4X66 Q;  4GLA C;  1N36 Q;  1CSP A;  2ES2 A;  3JAM c;  1UE6 A;  4OX9 L;  4IPH A;  3PIO A;  2R93 H;  4X65 L;  1IBK L;  3CMA A;  1CKN A;  3S1R H;  2VZA A;  4R4Q A;  2K14 A;  2I5L X;  1KL9 A;  2LSS A;  1EQQ A;  1HNW L;  5M3F G;  2L15 A;  4O0A A;  2E5L L;  4QQB X;  3CQZ H;  5IWA Q;  4A75 A;  3D0F A;  1I3Q H;  3RNU A;  4GLX A;  1I50 H;  1Q8K A;  4AQY L;  1L1O C;  1VQA A;  3OYY A;  1JT8 A;  5GAG C;  2N8N A;  1QVF A;  3UDF A;  1X3G A;  4DAM A;  1N34 Q;  1YHQ A;  1TWC H;  5IYB H;  1M1K C;  2XTI A;  2AKW B;  1LUZ A;  4GKK L;  4QGU A;  1K3R A;  1OTC A;  3PO3 G;  1Q1E A;  2Q2H A;  2NVQ H;  1YIT A;  2K50 A;  1I94 L;  5LMU Q;  3GDE A;  3U50 C;  3G6E A;  3FKI H;  5LMN Q;  3RN5 A;  1D7Q A;  4JI1 Q;  1VQP A;  3B6Y A;  4A3E G;  1TWA H;  4A3G H;  1VQF A;  5C3E G;  2KBN A;  3HOV H;  3I4O A;  5ELN A;  3CCR A;  5H1S E;  2NVY H;  3M4O H;  3FKI G;  1HR0 Q;  3F2D A;  1N32 Q;  4DK3 C;  3CC2 A;  4FDB A;  4A3F H;  3PO2 G;  1KC8 C;  4JBK A;  1ASZ A;  4A3K H;  2JA5 H;  4X62 Q;  3A0J A;  1EYG A;  1Y14 B;  4GNX C;  4A3F G;  4NXN Q;  1IL2 A;  4BY1 H;  4A3K G;  1N33 L;  3EN2 A;  2E8G A;  3SGI A;  5M5W H;  1YJW A;  1A8V A;  1KHI A;  1YHA A;  1HNX Q;  4B3M L;  1Q81 C;  1LTL A;  1XMO L;  3CME A;  2WFW A;  5IYD G;  4JBW A;  1I5F A;  1VQD A;  2LXK A;  5C0X G;  3PF4 A;  1RIP A;  5HY6 A;  1GO3 E;  1NMG A;  4YY3 L;  3M4P A;  3T1Y Q;  4IPG A;  1XNQ L;  2ZJP A;  3TEH B;  4UY8 C;  3HFZ B;  2KCM A;  3HOU G;  3CXC A;  1CSQ A;  4DR6 Q;  1MJE A;  4YCW A;  1N8R C;  5IP7 H;  3TS2 A;  3FHW A;  1SN8 A;  4GKJ Q;  3K0X A;  4NB3 A;  4BY7 H;  4IOA A;  3H15 A;  1X3E A;  3HOZ H;  1B7Y B;  4QY7 A;  3CPW A;  1Y1V H;  1IBM Q;  2UUB Q;  2RF4 A;  1OXT A;  4X66 L;  1XPO A;  2N49 A;  4LF4 Q;  3U4Z A;  3GTM H;  1N36 L;  3M4Q A;  2JA9 A;  1SR3 A;  3UE0 A;  4TVA B;  2WP8 J;  3J7Z C;  2VQE L;  4JI6 Q;  3HOZ G;  2ZJQ A;  1Q82 C;  5IP9 G;  2R7Z G;  2UUA L;  2F4V Q;  1JJG A;  1TWH H;  1BBW A;  4GOP B;  1YJ9 A;  1GD7 A;  4JV5 Q;  4OO1 I;  1XPU A;  2V1C C;  1Q86 C;  5GQO A;  4A3B H;  3GTP H;  3S1N H;  1VQM A;  2ASB A;  1CKO A;  4R4I A;  4R4C A;  3AFQ A;  2Y0S G;  4A3C H;  1J5E L;  4A3B G;  2D0O A;  4A93 G;  4DR4 Q;  4GN5 A;  3MEF A;  4IJH A;  4GOP A;  3I4M G;  4MZ9 A;  2IHE A;  4B3T L;  4TQU S;  3KF6 B;  4LW1 A;  4JYA L;  4A3C G;  4YWL A;  2I0Q A;  4KLK A;  1V1Q A;  4UP8 A;  3UE1 A;  1PH2 A;  4LUZ A;  1HZB A;  1PH1 A;  1WI5 A;  3IRB A;  3PF5 A;  3J81 j;  4DUZ Q;  1XMQ L;  4J15 A;  4IFD J;  3OTO Q;  1X9N A;  1VS0 A;  2B29 A;  1W2B A;  4OO1 G;  1IBL Q;  1AE3 A;  4AIM A;  1X56 A;  1X3F A;  1V9P A;  3HOX H;  5M5Y H;  4LF6 Q;  1A0I A;  1HZ9 A;  4DR3 L;  3ICE A;  3S2H H;  2OTJ A;  1UEB A;  3ULJ A;  1YVC A;  4ALP A;  2JA7 G;  4BY7 G;  3J80 i;  2ALY B;  3HOX G;  4OWX B;  1VQJ A;  5GAE C;  4JBM A;  3AQQ A;  4B3S Q;  3S1M H;  5AJ3 L;  4MTN A;  4DV6 L;  4WJ3 M;  4IOC A;  1EIF A;  1HZA A;  1KRS A;  1HNZ L;  4LFC Q;  1NY4 A;  2BH2 A;  3DM3 A;  5M3M G;  1VQ8 A;  2JA8 G;  3J7A 5;  2VS1 A;  4C3I H;  3M9B A;  1SLJ A;  3Q8D A;  5M3F H;  4LF8 Q;  4KHP Q;  2A8V A;  4JI5 L;  2UU9 Q;  2N3S A;  1KD1 C;  4UP9 A;  1JE5 A;  2ZJR A;  4JI3 L;  1BBU A;  1VQK A;  3M7N A;  1EFW A;  2YTY A;  3ULP A;  2HIX A;  4BXX G;  4LFB Q;  2JJQ A;  2ATW A;  1SRU A;  4R4T A;  4XIG S;  4A3I H;  3S14 H;  4JI0 L;  4DR2 Q;  4DR6 L;  4LF7 L;  1XNR L;  1Q1B A;  4HIM A;  3PO3 H;  5JJI A;  1NE3 A;  2FXQ A;  3S2D H;  4DR7 L;  1KXL A;  2PNH A;  4A3I G;  3EIV A;  4POF A;  1RL2 A;  1B70 B;  4DV3 Q;  1VQN A;  2R92 G;  4YCU A;  1LM0 A;  1ASY A;  4DV5 Q;  5BR8 Q;  2BH8 A;  2NN6 G;  3PUW A;  2PI2 E;  4LF4 L;  2B63 G;  4JI7 L;  3PIP A;  3TQY A;  4A3E H;  1YIJ A;  5C3E H;  4X64 L;  5FLM G;  4YHH L;  4DV1 L;  4LUV A;  1JB7 A;  3S17 H;  1T9H A;  2UXD Q;  2F4V L;  3GO5 A;  1OXU A;  4KI0 A;  3PO2 H;  1E7Z A;  1VQH A;  3L0O A;  4NXM L;  4JV5 L;  3NEM A;  4DR1 Q;  2UXC Q;  5C4X G;  3I55 A;  1L2F A;  2EQS A;  3U58 A;  4JG2 A;  2KHJ A;  2HHH Q;  2OWO A;  4LF9 Q;  4LFA Q;  2VQF Q;  4DV2 L;  5DLQ E;  3VDY A;  3KDF B;  3S16 H;  2ZM6 Q;  1A63 A;  4C3H H;  1QZH A;  4P75 A;  5ELO A;  1FJG Q;  4DR4 L;  4APV A;  4DUY Q;  4DV0 L;  4K0K Q;  5IYD H;  1G51 A;  3GD7 A;  2EIF A;  3PV0 A;  4A3L G;  2AMC B;  1VQL A;  4Y52 H;  2VY3 A;  5C0X J;  1X6O A;  3K7A H;  1E22 A;  4JI2 Q;  1J6Q A;  4A3J G;  3L7Z C;  1PYB A;  4DAY B;  4DV4 L;  2Y0S E;  5GAD C;  4JI8 Q;  4HJA A;  1EIY B;  3HOU H;  4DR5 L;  4YWM A;  3TRE A;  1PH3 A;  2UUC Q;  1VQO A;  4LF5 Q;  3CD6 A;  4LFB L;  2UXB Q;  3J81 i;  3CC4 A;  3S1Q H;  4AYB G;  1SMX A;  4PMW A;  4AH6 A;  3RR5 A;  3T1H Q;  5LMN W;  5IT9 c;  1PH4 A;  1PH6 A;  3AYH B;  4DV7 L;  3PSI A;  1P16 A;  2K5V A;  2N78 A;  4B3S L;  1IXR A;  1UWV A;  1HZC A;  4QL5 A;  1HR0 W;  1Q46 A;  2E2H H;  4IPC A;  3STB D;  2D62 A;  5IP9 H;  2JK8 A;  2NZO A;  2R7Z H;  4GOP C;  1D8L A;  3LGJ A;  3GTO H;  4OX9 Q;  3BZK A;  2IX0 A;  4DNI A;  1YJN A;  2ZTC A;  1U5K A;  2AWN A;  4X65 Q;  4LWC A;  1OXX K;  4O2D A;  3CCJ A;  4HJ8 A;  1IBK Q;  1VQ7 A;  4A3D G;  2Q2U A;  1MIU A;  2JE6 I;  1KQS A;  1HNW Q;  2E5L Q;  4H02 A;  3CCU A;  3MXN B;  5IWA L;  1X54 A;  3CCL A;  3J80 c;  1X55 A;  4A93 H;  4L5R C;  1FGU A;  4JI4 Q;  3I4M H;  3NEN A;  4GN4 B;  1N34 L;  1MKH A;  4Y7N H;  2CFM A;  4P73 A;  3GTL H;  2D0P A;  4WJ4 A;  2KCT A;  1TWG H;  3HOY G;  1PHJ A;  4RG1 A;  1I94 Q;  2ZTD A;  4MNO A;  3RZD H;  2IHF A;  4OON A;  1VQ5 A;  3K80 C;  5LMU L;  2K5N A;  1BKB A;  3PCO B;  4IO9 A;  1SE8 A;  3OW2 A;  5LMN L;  1U0L A;  1JJ2 A;  3F2B A;  3UDI A;  4JI1 L;  4RMF A;  2VW9 A;  4IFD I;  2Q2I A;  1W3S A;  2GVB A;  3E9H A;  5IYC G;  3KOJ A;  1E1O A;  1WYD A;  2MQH A;  1A62 A;  4DR1 L;  3CCV A;  1HR0 L;  1NMF A;  3HKS A;  1NTG A;  1Z47 A;  3CCE A;  2HHH L;  2JA7 H;  3G71 A;  4JBJ A;  3A5Z B;  1N32 L;  4OXP A;  3KF8 B;  1K0R A;  3M85 A;  3GTG H;  3KF6 A;  3I4N G;  1PVO A;  1X65 A;  1UE5 A;  1WCM G;  1QZG A;  4X62 L;  1TWF H;  2WB1 G;  1PH5 A;  4JOI A;  3W1G A;  2ZTE A;  3GTK H;  1K8G A;  3HOW G;  3ER0 A;  1WFQ A;  4QJF A;  3KJP A;  1S3O A;  4NXN L;  5M3M H;  1N33 Q;  2JA8 H;  3I7F A;  4B3M Q;  3RLF A;  5JJL A;  2KEN A;  1KAW A;  3CCQ A;  1M90 C;  2RCN A;  2YTV A;  2Q2T A;  3DLL A;  2XGT A;  5IE8 A;  4PZ7 A;  1HNX L;  2NVX H;  1GM5 A;  2K52 A;  3BJU A;  4BXX H;  1OXS C;  4YY3 Q;  5E7N A;  5M5X H;  5C44 G;  3H3V H;  1SRO A;  2OQK A;  3JC6 6;  2AWO A;  5EAY A;  5JEA G;  3T1Y L;  3A74 A;  3KYH C;  2OCE A;  2VUM H;  4PZ8 A;  4X6A H;  2QEX A;  1KIX A;  2YU9 H;  3F8T A;  1PV4 A;  1IYJ B;  4BBR G;  2CQO A;  1HJP A;  2R92 H;  4GKJ L;  2IT1 A;  1CKN B;  3W5O A;  5GAH C;  2K5H A;  4YCV A;  2B63 H;  2VUM G;  2WAQ G;  1YHB A;  1I6H H;  1WJJ A;  1K83 H;  2Z0S A;  3I2Z A;  1Q7Y C;  1K8A C;  5FJ8 G;  4BBS G;  1IBM L;  3E0E A;  2B3G A;  3GTQ H;  2PQA B;  5FLM H;  4AYB E;  1GKH A;  2UUB L;  2VQE Q;  4B3R Q;  4JI6 L;  2I5H A; 
#chains in the Genus database with same CATH topology
 2GN5 A;  1YNJ D;  3S16 B;  5C4X H;  2K05 A;  1MSG A;  2UUA Q;  3QJY A;  4C3H B;  4CDE C;  3D31 A;  3GTJ H;  5I2Y A;  2OXP A;  2OTL A;  5E1F A;  2R93 G;  2LMC B;  4A3J B;  4BA2 I;  1BDO A;  1VQ4 A;  2PQA A;  5CV6 A;  2KHI A;  1K8O A;  1LO5 D;  1JJC B;  2EJF C;  1W6J A;  2JA6 H;  1JOQ A;  5J3B A;  4B3T Q;  3M3Y H;  1Q12 A;  4A3J H;  1DOL A;  3S24 A;  1PYS B;  3JAM i;  4C56 C;  3P7J A;  4DKA C;  2PI2 A;  3HG9 A;  3K81 C;  3IAY A;  3OTO L;  2F1M A;  2RHQ B;  3K5M A;  1BXT A;  1CT1 D;  1S5D D;  1IBL L;  4A3G G;  2ZXO A;  4Q5V A;  4DXF A;  2I46 A;  3HOV G;  2E2I H;  1UNS A;  2E76 C;  4ME5 A;  4P71 A;  2L12 A;  2OQ0 A;  4C2M H;  1F2Y A;  4HIO A;  1K9M C;  1UE7 A;  5C4J H;  1PH8 A;  2RHS B;  4HJ7 A;  2MP1 A;  4RA8 A;  4LFC L;  4GNX B;  1LTR D;  2WAC A;  2A19 A;  1PRT C;  4JI5 Q;  3I4M B;  1TY0 A;  2WB1 E;  4JI3 Q;  1OXV A;  3U4V A;  1CQF A;  2WKC A;  1PH7 A;  3RZO H;  1LYL A;  3NBH B;  4F8M A;  1XNR Q;  2MGS A;  4ILW A;  4LK1 C;  4ZK9 B;  4GNX A;  4L63 B;  1VQ9 A;  1FL0 A;  3J7A F;  2FIN B;  3F2C A;  5IP7 G;  1K73 C;  3CC7 A;  2K75 A;  1ET9 A;  2RVL A;  3KUP A;  4KY7 A;  1O7Z A;  3RUZ A;  3SEB A;  1IL8 A;  3G7L A;  4B3R L;  1Y1V G;  3NBH A;  2EXD A;  3CHB D;  5IYC H;  1XTD A;  3CKI B;  2JXM B;  3GTK B;  1Z9F A;  2UXD L;  1H95 A;  5M3M B;  2MFI A;  5C6A A;  3E9I A;  4NDX A;  4HR7 B;  4HCS A;  3KFU A;  4LMQ D;  4ME3 A;  4LFA L;  3UDG A;  2VQF L;  1S72 A;  3STB C;  1G8Z D;  5T1G A;  1VQG A;  1EQR A;  1YBY A;  4R1J A;  2NYZ D;  3BZC A;  3NTI A;  1Y1W G;  1XMO Q;  1EY6 A;  2GVA A;  2K4K A;  2SEB D;  2O5J C;  5F2D A;  3TZU A;  2R7D A;  3K7U C;  3C1F A;  2PZW A;  1I4Q A;  1SNM A;  5JEA J;  5KGU A;  2LFN A;  1K83 B;  4IFD G;  2QGQ A;  4QIW E;  1XNQ Q;  4BBR H;  4PZ6 A;  2UUC L;  2UXB L;  3L2P A;  3MAQ A;  1MGS A;  5CYU A;  1SFO H;  1HA6 A;  3G4S A;  1G6P A;  3H0G H;  4XQJ A;  4BBS H;  1RF2 D;  2F0L A;  2CWA A;  1TXY A;  3I4L A;  1AH9 A;  4X66 Q;  4GLA C;  4JW0 A;  1CSP A;  3MXG A;  4P2C B;  3PIO A;  3CMA A;  3HKZ B;  3Q6S A;  4R4Q A;  2LSS A;  2I5L X;  4FF1 A;  4IQZ A;  2DY8 A;  2E2D C;  2L15 A;  2E5L L;  1LT5 D;  4QQB X;  4QF4 A;  5IWA Q;  1G2T A;  1HFG A;  4AQY L;  3OYY A;  1JT8 A;  4A3M B;  4JK1 C;  4G7O C;  1R4Q B;  2DNC A;  1TWC H;  4GKK L;  3PO3 G;  1DJR D;  2Q2H A;  3C2P A;  2NVQ H;  2K50 A;  5LMU Q;  3GDE A;  3G6E A;  1CZG A;  3FKI H;  3RN5 A;  1Q90 A;  4JI1 Q;  1TS4 A;  2HD3 A;  1VQF A;  5ELN A;  4FF2 A;  4XQQ A;  4OEM B;  5A2Q E;  3F2D A;  1S5E D;  4FXD A;  1F2M A;  4A3D B;  2O4X A;  3CC2 A;  5FK9 C;  4FDB A;  3MWY W;  4E6I A;  4JBK A;  4RAU C;  4BWG B;  1D6E C;  1B1Z A;  1Y14 B;  4I65 A;  4BY1 H;  1N33 L;  2E8G A;  1GXD C;  1YNJ C;  5M5W H;  1Y8O B;  3K5L A;  1YJW A;  1H9S A;  2N88 A;  3T16 A;  2WKD A;  1I5F A;  4KY6 A;  3HOY B;  5I4D A;  2I07 B;  3U9O A;  2QIL A;  3PF4 A;  1GO3 E;  1NR2 A;  4YY3 L;  1F9S A;  2FHT A;  3HFZ B;  3L3O C;  1F2L A;  4K8I A;  1KTK A;  1K0S A;  3A7A B;  2MHV A;  2F4I A;  5KND A;  1RD9 D;  4YCW A;  1SN8 A;  3K0X A;  4NB3 A;  4WRD A;  1WTV A;  4IOA A;  3H15 A;  1ZEQ X;  2UUB Q;  3GTM H;  2B2T C;  4X3U A;  4IUU A;  1N36 L;  1SR3 A;  4TVA B;  2WP8 J;  2VQE L;  3HOW B;  1SE3 A;  5IP9 G;  2XWJ B;  2R7Z G;  4KK7 A;  1JJG A;  1EY5 A;  4GOP B;  4Z9C B;  1ILP A;  1PRT B;  2VB2 X;  3OWF A;  2KA7 A;  3S15 B;  2Z4I A;  1DZ1 A;  1SNQ A;  3K6O A;  4A3C H;  1JR0 D;  3MFG A;  3VYR A;  4V0B A;  2NUC A;  2RDG A;  4A93 G;  3A7L A;  4IJH A;  4GOP A;  1VMP A;  3NQI A;  2IHE A;  4TQU S;  3KF6 B;  3S2H B;  1PH2 A;  1HZB A;  3IRB A;  2E2J B;  3J81 j;  2NVT B;  2AQ1 B;  3OTO Q;  4HED A;  2B29 A;  1W2B A;  1IBL Q;  1AE3 A;  1EQV A;  1LTB D;  3RD4 A;  4AIM A;  1TQO A;  3P20 A;  4NW2 A;  1B9M A;  5M5Y H;  1A0I A;  1HZ9 A;  2PCF B;  3S2H H;  2OTJ A;  3ULJ A;  1YVC A;  4QMG A;  5C3X A;  1WTQ A;  4BY7 G;  1SMY D;  1GUG A;  2ZXR A;  3J80 i;  1WTO A;  2R93 B;  1GHK A;  1CTM A;  3AQQ A;  4B3S Q;  5EKK A;  4DV6 L;  2A6H D;  4WJ3 M;  4IOC A;  1HZA A;  3DWA A;  1I3Q B;  1HNZ L;  4LFC Q;  1NY4 A;  4FF3 A;  1EEF D;  2JA8 G;  5JJZ A;  2VS1 A;  4C3I H;  3M9B A;  5FLX L;  3Q8D A;  1KAA A;  3FRP B;  3M7N A;  1EFW A;  3M7G A;  3ULP A;  2JJQ A;  3MHB A;  4MIU A;  4DR6 L;  2BDO A;  2KUM A;  1TWA B;  3S2D H;  4DR7 L;  4A3G B;  3E5S A;  3EIV A;  3HOV B;  1RL2 A;  5ELB A;  1AP0 A;  1VQN A;  3M4O B;  4HTH A;  5T1I A;  2PI2 E;  3IFD A;  4JI7 L;  3TQY A;  4A3E H;  4A3F B;  1UUP A;  1YIJ A;  4A3K B;  1EL0 A;  4X64 L;  3J80 L;  4DV1 L;  3R2I A;  2UXD Q;  5IT9 E;  1LTI D;  1ET6 A;  5C4X G;  4JV5 L;  3L0O A;  4NXM L;  1A3U A;  5E3F A;  4RKL A;  4XT1 B;  2KHJ A;  2OWO A;  5EPL A;  4LFA Q;  4HMJ A;  2VQF Q;  4IUQ A;  3Q22 A;  1QNK A;  3DWQ A;  4P75 A;  5ELO A;  1GUS A;  5IYD H;  1F9Q A;  1BUV T;  4C3H G;  1H9K A;  1V8Q A;  3K57 A;  1B2T A;  2K04 A;  1EY7 A;  1J6Q A;  4A3J G;  1PZJ D;  1F2Z A;  1Y1V B;  2UUC Q;  2UXB Q;  1LT4 D;  1VQO A;  1S5C D;  4RCO A;  3CC4 A;  1WTW A;  4AYB G;  1SMX A;  4PMW A;  3S1Q H;  5LMN W;  5DAU A;  2D2C C;  1QIL A;  1PH4 A;  1PH6 A;  1HFN A;  3PSI A;  3PIP 3;  1SYE A;  2QDL A;  4LJZ C;  1TT2 A;  2K5V A;  1HR0 W;  1PTO B;  1UWV A;  2J7Z A;  1Q46 A;  4DAV A;  3TSS A;  2F0I A;  1VF5 C;  1EIG A;  1FR3 A;  2IX0 A;  2AWN A;  1OXX K;  1SXT A;  1VQ7 A;  2E74 C;  1DYQ A;  2Q2U A;  1XTC D;  2E5L Q;  3HP3 A;  4H02 A;  1NAP A;  4G4K A;  4L5R C;  4JI4 Q;  2DJF C;  1STN A;  1NUC A;  1GUO A;  4P73 A;  1SND A;  4CKE A;  1WD1 A;  4QUF A;  1ENC A;  4HSV A;  3HOX B;  3BYY B;  4QCL A;  3PCO B;  3OW2 A;  1SE8 A;  5HUR A;  5LMN L;  1H9J A;  2VW9 A;  2IX3 A;  2Q2I A;  5IYC G;  1E1O A;  1WYD A;  1HR0 L;  1NMF A;  1NTG A;  1N32 L;  2HHH L;  1EZ6 A;  3A5Z B;  3KF8 B;  4IAL A;  1X65 A;  3CU7 A;  3X3N A;  3D4D A;  1RDP D;  1PRT F;  1TWF H;  4JOI A;  2L1B A;  4XQN A;  2F3W A;  3ER0 A;  3KJP A;  4NXN L;  1N33 Q;  2KEC A;  3C46 A;  5JJL A;  3S14 B;  1KAW A;  1M90 C;  3KLS X;  4FXG C;  3PO3 B;  3K58 A;  5CV7 A;  1QOH A;  3TN2 A;  1EIH A;  3BJU A;  4YY3 Q;  5E7N A;  2NTT A;  5M5X H;  3X3M A;  2OQK A;  1LT3 D;  3JC6 6;  4DAP A;  3T1Y L;  1XWE A;  3A74 A;  3SHL A;  1O78 A;  4BBR G;  2CQO A;  1HJP A;  1CKN B;  4OIJ A;  1T5X D;  1HXY D;  4F7X A;  5KIX A;  1QG7 A;  1WJJ A;  3OHX C;  5C5L A;  3H6M A;  3WOE A;  4BBS G;  2WIN B;  3FDT A;  3DEP A;  5EQ0 A;  1GKH A;  1JE4 A;  2VQE Q;  4ZYS A;  1I4X A;  2I5H A;  2HUG A;  1STG A;  1VQI A;  2B2U A;  3KLW A;  4C1N K;  1PH9 A;  3RLN A;  4XYQ A;  1SMY C;  1CZW A;  1EOV A;  4OWT B;  1LTA D;  2V4D A;  3Q0A A;  1QB5 D;  1AFP A;  3RN2 A;  3CW2 C;  2A6H C;  4U67 3;  2ICI A;  3FVQ A;  2CCZ A;  1L1O B;  1DGS A;  3I90 A;  1C9O A;  2HT1 A;  3QO2 A;  3HKZ G;  3TP6 A;  2YV5 A;  1HTP A;  3TDQ A;  5IGC A;  5C0X I;  2ID0 A;  1L0W A;  1RTO A;  1BOS A;  1Q8I A;  2E2H B;  3ONA B;  4R8N A;  4C3J H;  4A3M G;  1L1O A;  1GVP A;  2C9O A;  1P8L A;  2B2W A;  1NJI C;  2R7Z B;  1C48 A;  3NE5 B;  5JVG 3;  3GTO B;  5FLX c;  2PPB C;  2HQE A;  3BZD B;  2F0S A;  1VCI A;  2JEA I;  1CKM A;  1STH A;  4DV6 Q;  1GUT A;  4DAY A;  3DMU A;  4KKT A;  1HNZ Q;  1DXM A;  4L8J A;  3LNN A;  2EDG A;  1NBW A;  4PG3 A;  4A93 B;  4BY1 G;  4HIK A;  3NEL A;  5M9O A;  3GTL B;  2G5D A;  3D4W A;  5J39 A;  4ZUI A;  3K59 A;  4DR7 Q;  1PFM A;  5KYL A;  1SJE D;  2HQL A;  4JC0 A;  4DV3 L;  3MTS A;  3Q24 A;  2AQ2 B;  4BY7 B;  3I8Z A;  4JI7 Q;  2F03 A;  4CDD C;  5BR8 L;  2PW7 A;  3GTG B;  3CF5 A;  4X64 Q;  2JP1 A;  3K8A A;  4DV1 Q;  4K6D A;  1G91 A;  2KOL A;  3I4N H;  2F0F A;  4NXM Q;  2JA8 B;  1MJC A;  1GUW A;  1HRJ A;  3OPO A;  2EJG C;  1Y8N B;  2NVX B;  4C1N I;  1SAP A;  3JAM E;  1RKN A;  1VQB A;  1LAC A;  1PDQ A;  1ROD A;  1RTN A;  2K7V A;  4IZ8 A;  4DUY L;  4L5S A;  3VYS A;  3PGZ A;  2VUM B;  3KJO A;  4LAA A;  2RA4 A;  3CAM A;  4IUP A;  2F3I A;  2JQO A;  3OOC A;  1R9T H;  2DN8 A;  2AQ3 B;  2L55 A;  4FP5 D;  2Q8I B;  3ZJY C;  3PUX A;  4JI8 L;  4PMC A;  3W1B A;  4LF5 L;  3F2U A;  3GTQ B;  4PV1 C;  1E2W A;  1RCV D;  1XPR A;  1WOC A;  4LNQ A;  1K28 A;  5FJ8 H;  5J22 A;  2R61 A;  1VQ6 A;  2QA4 A;  5FOB B;  3GTJ B;  2TSS A;  2F0G A;  2QKI C;  4K5X A;  2BOS A;  1SE2 A;  2PZT A;  1E0B A;  2EYF A;  4WOR A;  1GOZ A;  2ES2 A;  1Y69 U;  1IHZ A;  1FD7 D;  3T4A C;  4OEL B;  2JA6 B;  2VZA A;  1UAP A;  2K14 A;  4C3I G;  2KED A;  3BDO A;  1HNW L;  3M3Y B;  3CQZ H;  1AW7 A;  1A6X A;  4U68 A;  3SVM A;  5GAG C;  2N8N A;  2AUK A;  2SNS A;  4AYB B;  1KDA A;  1YHQ A;  2JYO A;  2RSN A;  1LUZ A;  1I4H A;  2EY6 A;  3NBI A;  5FO8 B;  3HRZ C;  1YIT A;  3DXJ C;  2E2I B;  1I94 L;  1SEB D;  1PZI D;  1I4P A;  5LMN Q;  1FGB D;  3SK6 A;  1IW7 D;  3OWE B;  1D7Q A;  1VQP A;  3J7Y W;  3B6Y A;  2KJX A;  5KYI A;  4A3E G;  1L0X B;  4C2M B;  2ZT9 C;  5ELC A;  4K8J A;  1HR0 Q;  5C4J B;  1N32 Q;  3OSO A;  2JA5 H;  2K03 A;  3T13 A;  1TS3 A;  4A3F G;  4NXN Q;  4XYO A;  5ELF A;  4A3K G;  3RZO B;  3V96 A;  2PO4 A;  3EJI A;  2X6G A;  5IYD G;  1PFB A;  1RIP A;  4TKO B;  1NMG A;  3M4P A;  2CH4 W;  3T1Y Q;  1QNU A;  2ZJP A;  1D2B A;  2EYP A;  1CSQ A;  2XIW A;  1KNE A;  1X32 A;  1FNW A;  4OHJ A;  2WII B;  2KCC A;  1WD0 A;  1ZKO A;  3HOZ H;  1B7Y B;  3IKJ A;  3BVZ A;  3NTK A;  2RF4 A;  4LF4 Q;  3M4Q A;  5I9O A;  3UE0 A;  3J7Z C;  2Q8R E;  3EA6 A;  1TWH H;  4H44 C;  4CDC C;  2WV6 D;  1YJ9 A;  4EQO A;  4KV6 A;  3VA7 A;  1XPU A;  1Q86 C;  5GQO A;  2K5W A;  2IWH A;  3S1N H;  4KKU A;  4A3B H;  1VQM A;  2ASB A;  2F0P A;  1CKO A;  4R4I A;  4DF7 A;  2HCI A;  2J4X A;  1J5E L;  1KDC A;  5D14 A;  2D0O A;  2F0V A;  3J81 L;  4BBR B;  1TS5 A;  4ZKB B;  4DR4 Q;  1BO0 A;  1SFO B;  4JYA L;  5TSS A;  2I0Q A;  3U9S A;  3H0G B;  4BBS B;  1PH1 A;  3PF5 A;  1XMQ L;  4IFD J;  2ZXP A;  1E2V A;  2BCO A;  1D5Z C;  3ERO A;  3ZYY X;  4HMI A;  1X56 A;  1JIC A;  3AMU A;  2L9H A;  3HOX G;  4OWX B;  5GAE C;  5A35 A;  2FJ2 A;  3MZ5 A;  5AJ3 L;  2MJ8 A;  1BR9 A;  2EY2 A;  3K5N A;  3LWE A;  1VQ8 A;  5M3F H;  1HA5 A;  2EJM A;  1TWC B;  2N3S A;  3KLR A;  2ZJR A;  2L11 A;  2HIX A;  2PMZ B;  1SNC A;  2NVQ B;  1SRU A;  1PZK D;  3QG1 A;  4I7Z C;  4A3I H;  1B53 A;  1D5M C;  4LF7 L;  2Z4H A;  3FKI B;  2K1B A;  3BVG A;  1NE3 A;  2FXQ A;  3NUC A;  1KXL A;  1CQV A;  5IGF A;  4DV3 Q;  5BR8 Q;  3PIP A;  4ID6 A;  5C3E H;  3C3L A;  4LUV A;  1T9H A;  2F0J A;  2F4V L;  1A2U A;  4MTK A;  4CDF C;  4BY1 B;  4KI0 A;  3PO2 H;  2EYH A;  2LY7 A;  2B8F A;  4DR1 Q;  5M5W B;  3I55 A;  1L2F A;  4G57 A;  4JG2 A;  1ESR A;  4K2K A;  3MFY A;  4DV2 L;  1FNV A;  3KDF B;  2DY7 A;  1A63 A;  1QZH A;  5J1Z A;  3GQB A;  4DUY Q;  1U4R A;  5C0X H;  1G51 A;  3GD7 A;  2EIF A;  4J1M A;  1VQL A;  4H7B A;  3J80 E;  1X6O A;  3K7A H;  1E22 A;  2EY1 A;  2RQX A;  3HOU H;  4JI8 Q;  4RH6 A;  4DR5 L;  4YWM A;  3TRE A;  4LF5 Q;  1FYC A;  3VYU A;  2VXW A;  4LFB L;  3GTM B;  1DM0 B;  1STB A;  1ZXT A;  1BCP D;  3AB9 A;  4ZRZ A;  3H94 A;  1LT6 D;  2N78 A;  1A15 A;  1IXR A;  4QL5 A;  1HZC A;  4IPC A;  1ICW A;  5DM7 3;  1IW7 C;  2JK8 A;  2NZO A;  3LGJ A;  2F0O A;  4HJ8 A;  4LWC A;  4O2D A;  2LKV A;  1KQS A;  4ODG A;  1HNW Q;  2A5H A;  2K5Q A;  3MXN B;  1A3T A;  1II3 A;  3CCL A;  4X3K A;  2EYO A;  5DNF A;  4B08 A;  3NEN A;  3MEH A;  1N34 L;  1MKH A;  2D0P A;  3I70 A;  2KCT A;  1TWG H;  5JOB A;  2JA7 B;  1SSO A;  2IJ0 A;  4RG1 A;  1I94 Q;  2ZTD A;  4MNO A;  5M5Y B;  4OON A;  2Z9H A;  3MA2 B;  4IO9 A;  1F77 A;  2K28 A;  3QWN A;  2F0K A;  1U0L A;  1ESF A;  3F2B A;  1JJ2 A;  3VYT A;  2ICE C;  1QCB D;  3E9H A;  3DHQ A;  2GVB A;  2DJG C;  1A62 A;  2J0T D;  3HKS A;  2JA7 H;  3W3A A;  1LV9 A;  4JBJ A;  4OXP A;  3I4N G;  4DK1 A;  1PVO A;  3KF6 A;  4C3I B;  1UE5 A;  5IGG A;  4X62 L;  1EFI D;  1PH5 A;  4IUV A;  3W1G A;  3OMG A;  1IKM A;  1L0Y B;  1PYW D;  2CVR A;  3RLF A;  4PMB A;  3I91 A;  1WTR A;  4NKL A;  1HNX L;  1TU2 B;  2K52 A;  1I4G A;  3S2D B;  1OXS C;  3QOL A;  5CV8 A;  5EAY A;  2AWO A;  2B2U C;  3LWU A;  4CKB A;  3KYH C;  2OCE A;  4A3E B;  2O5I C;  1S4Z A;  2KVM A;  4X6A H;  1EY9 A;  2QEX A;  2FFK B;  2QW7 A;  1KIX A;  2YU9 H;  1IYJ B;  2R92 H;  2O2L D;  3GV6 A;  4KJN A;  5GAH C;  2B63 H;  2VUM G;  3HGB A;  2WAQ G;  2Z0S A;  1Q7Y C;  5FJ8 G;  3WDN A;  2B3G A;  4J6H A;  4AYB E;  2XWB B;  1NR4 A;  1DD2 A;  4B3R Q;  3FMC A;  1CHP D;  2H4O A;  5ISR A;  2CH4 A;  3J81 c;  5A2Q L;  1E3P A;  1SYC A;  1GJX A;  5CR3 A;  4XTC S;  3P1H A;  2B2W C;  3G48 A;  4EQ5 A;  1B50 A;  2C35 B;  2EYJ A;  2F0M A;  1J5E Q;  1EU4 A;  2X69 A;  1SYG A;  5KNC A;  2BA0 A;  1YI2 A;  2CHB D;  5EPK A;  2F0T A;  4A3L H;  3A5U A;  4GLV B;  3S1Q B;  4JYA Q;  2AHO B;  2R7F A;  1YEZ A;  2NTS A;  2JA6 G;  1LTT D;  4KHZ A;  3R8B A;  1XMQ Q;  1C7Y A;  3PQI A;  2A73 B;  4O1N A;  5CMD A;  4DUZ L;  5G3L D;  2KQ3 A;  1XYI A;  2IY5 B;  3WWV A;  1EY4 A;  2MUY A;  1B8A A;  2JN4 A;  1E1T A;  3GV3 A;  4S3S A;  1ICF B;  2SDF A;  4K2L A;  4KTA A;  1YNX A;  1M4V A;  5AJ3 Q;  2JA5 G;  3SE0 A;  3MVV A;  3HEJ A;  1JCK B;  4H0L C;  3K0Y A;  2H5X A;  2NZH A;  3ERQ A;  1O80 A;  2PNR C;  2QEJ C;  1D5X C;  2VL6 A;  3CPF A;  4K6L A;  4DNT B;  1QJO A;  4JCV E;  4LF8 L;  4KHP L;  3CP0 A;  3EBE A;  4IPD A;  4HJ9 A;  2B8G A;  5GRO A;  4IN3 A;  1B9N A;  1S40 A;  3TP8 A;  1BVS A;  3AFP A;  2MNA A;  2NBF A;  4LF7 Q;  1AE2 A;  1NNX A;  2CWP A;  4AQY Q;  3I56 A;  1KDB A;  1PFS A;  3KBG A;  3EVQ A;  4CJ0 B;  4GKK Q;  5HGQ A;  4WJW A;  3TS0 A;  3AEV A;  3T51 B;  4UPA A;  1O7L A;  5LL6 X;  3E6Z X;  3J7A V;  4DPG A;  1PA6 A;  1J8I A;  1TWF B;  3F1Z A;  5IGD A;  1IZ6 A;  1EWC A;  1BCP C;  4R4O A;  1PMR A;  1V43 A;  1WCM H;  1C0A A;  4H13 C;  2UXC L;  2MO1 A;  2NZ1 D;  2OT2 A;  4DGZ A;  4OL7 A;  3I72 A;  5EKL A;  4DV2 Q;  4LF9 L;  3A55 A;  1WVL A;  5EGT A;  4P72 A;  5M5X B;  4NPS A;  2ZM6 L;  1Y1W H;  3R93 A;  2B2T A;  3NSW A;  5ELD A;  1VMC A;  3NQT A;  4QUC A;  4F88 A;  4IFD H;  5C44 H;  5JEA H;  3KF8 A;  4XT3 B;  1VQE A;  3GP7 A;  4JI2 L;  1VQC A;  4EVO A;  4DR5 Q;  4LFB Q;  1OO9 B;  1QVG A;  3NHH A;  4L5Q A;  3H3V I;  1EWI A;  1CI3 M;  3HKZ E;  3T1H L;  1B3A A;  3VR6 A;  2XVS A;  2PMZ E;  1JOR A;  3UI2 A;  4JVZ A;  1O7I A;  1DOK A;  4M1U B;  4NMZ A;  2HIV A;  2R6G A;  2Z6K A;  3H0G G;  2NN6 I;  2F52 A;  3NWS A;  3ULL A;  4YWK A;  2E75 C;  1N36 Q;  4ZQ3 A;  4OX9 L;  4IPH A;  4X65 L;  2PQE A;  1IBK L;  1CKN A;  3S1R H;  1KL9 A;  5I2X A;  5M3F G;  1AN8 A;  2RKS A;  3H09 A;  4K5V A;  4A75 A;  5CC4 A;  4GLX A;  1I50 H;  1VDZ A;  3M4Y A;  4CBV A;  1QVF A;  1N34 Q;  5IYB H;  1M1K C;  4CKC A;  2AKW B;  4C3J B;  4QGU A;  1K3R A;  5CBA E;  1ML0 D;  2EYM A;  4KN7 C;  1NSN S;  2VB3 X;  1B4O A;  3N6R A;  4B9W A;  1DCZ A;  5CGK A;  1CHQ D;  3V2T A;  5C3E G;  1PRT D;  3I4O A;  2NVY H;  3FKI G;  2XN9 C;  4Q0F A;  3QR8 A;  4DK3 C;  4ZCK A;  3PO2 G;  4X62 Q;  3A0J A;  5K36 H;  4GNX C;  1SYB A;  3EN2 A;  5BN3 A;  2PZU A;  1STA A;  1YHA A;  4B3M L;  1HNX Q;  1XMO L;  3CME A;  1SE4 A;  1ENA A;  4JBW A;  2LXK A;  5C0X G;  1TS2 A;  2F0U A;  2M2L A;  3ND8 A;  4FF4 A;  4IPG A;  1Q3L A;  2Z1C A;  1XNQ L;  1SYD A;  4GZY C;  2KCM A;  3HOU G;  4DR6 Q;  1MJE A;  3DWP A;  1KLG D;  4PQX A;  3FHW A;  5EBC A;  3TS2 A;  5NUC A;  1S5B D;  1X3E A;  3I4N B;  4QY7 A;  4X66 L;  1J9O A;  3U4Z A;  1STE A;  3HS0 C;  3EQL C;  4KKS A;  5C3W A;  2N55 A;  2PYK A;  2L0C A;  4JV5 Q;  3H3V C;  4M8A A;  3SXH A;  3E0J A;  2EE1 A;  1R9T B;  3QB3 A;  4R4C A;  2Z8L A;  2Y0S G;  3KK7 A;  4N9T A;  1MBY A;  4GN5 A;  1XXG A;  4MZ9 A;  5IOD A;  5IOC A;  4LW1 A;  4WFN 3;  4A3C G;  4YWL A;  4B9X A;  2WAQ B;  4KLK A;  1LTG D;  4UP8 A;  2A6E D;  4HCE A;  4DUZ Q;  3IL8 A;  4J15 A;  4DFA A;  3FEW X;  1TII D;  1VS0 A;  2RCF A;  4KD3 A;  4KN4 C;  4N9P A;  1X3F A;  1V9P A;  3NK9 A;  3Q23 A;  4DR3 L;  1BCP B;  3ICE A;  1UEB A;  2JA7 G;  4HN7 A;  2B2Y A;  2ALY B;  1VQJ A;  4JBM A;  1H9R A;  3S1M H;  4OGQ C;  2HCC A;  3ITP A;  4MTN A;  3CQZ B;  1EIF A;  2B2V A;  1KRS A;  1ILQ A;  1AEX A;  3O13 A;  3J7A 5;  1PFN A;  4LF8 Q;  1PLF A;  2A8V A;  4KHP Q;  1JE5 A;  1VQK A;  1WTP A;  4R4T A;  4XIG S;  3WOF A;  4JI0 L;  3KBX A;  3MC0 B;  1PTO D;  2PNH A;  4POF A;  3OIQ A;  1KAB A;  4YCU A;  2R92 G;  3ND9 A;  1ASY A;  2BH8 A;  4EGV A;  2F0E A;  3PUW A;  2Q8T A;  2B63 G;  2RBM A;  2JA5 B;  2G9H D;  4R9W A;  4YHH L;  1M8A A;  3S17 H;  3GO5 A;  2NWG A;  3HZX A;  5K5P A;  1C4Q A;  1OXU A;  1E7Z A;  1VQH A;  2UXC Q;  2EQS A;  2HHH Q;  4CGY B;  1B3Q A;  4LF9 Q;  1HCZ A;  1JWM D;  5DLQ E;  3VDY A;  3S16 H;  4KJO A;  2ZM6 Q;  2Z6B A;  4C3H H;  4DV0 L;  2EZV A;  1G6Z A;  3PV0 A;  4A3L G;  2AMC B;  3T56 B;  2XRS D;  4JI2 Q;  1ONL A;  3VR2 A;  4DV4 L;  2A74 C;  4HJA A;  4ABN A;  3HOZ B;  1PH3 A;  3CD6 A;  5KEE A;  3J81 i;  2K32 A;  3D8G A;  1HHV A;  4AH6 A;  3T1H Q;  5IT9 c;  3T53 B;  3AYH B;  4DV7 L;  1U4L A;  4KMU C;  1EZ8 A;  1TWH B;  4B3S L;  5I9P A;  2D62 A;  2K5D A;  3EFX D;  1MD2 D;  4A3B B;  3S1N B;  4GOP C;  4OIK A;  1TKW B;  4OX9 Q;  3BZK A;  4FNF A;  2ZTC A;  2NB0 A;  4X65 Q;  1IBK Q;  4PNY A;  5CV4 A;  1MIU A;  5COR A;  4O42 A;  1JOK A;  1KLU D;  1EY0 A;  3CRL C;  1F9P A;  5EKI A;  1X55 A;  2K01 A;  3JAM L;  3VR4 A;  5C4Z A;  4I7A A;  3I4M H;  3NTH A;  4WJ4 A;  1DOM A;  1U4P A;  2KCN A;  1SNP A;  4OO1 H;  3UDI A;  1QWY A;  4IFD I;  1W3S A;  4RCN A;  3I73 A;  2MQH A;  3BVM A;  1Z47 A;  3CCE A;  1MI2 A;  3H91 A;  1H9M A;  5EJW A;  1WCM G;  5M3F B;  1QZG A;  2WB1 G;  2AUJ D;  2F0W A;  3GTK H;  1K8G A;  5BN5 A;  1TR5 A;  1S3O A;  5M3M H;  3R3O A;  1GUN A;  5HGT A;  4A3I B;  4B3M Q;  2KEN A;  3CCQ A;  2Q2T A;  2RCN A;  2XGT A;  5IE8 A;  2L4N A;  1GM5 A;  4XDX A;  2BDN A;  4BXX H;  2P5Z X;  1CA6 A;  1VF7 A;  5C44 G;  5CBE E;  3H3V H;  5JEA G;  2QF7 A;  3MXU A;  1SJH D;  4DNR B;  1HUM A;  3F8T A;  3TP7 A;  5C3E B;  4GKJ L;  2IT1 A;  1U9R A;  3W5O A;  4BS9 A;  1I6V C;  2NN6 H;  2CW0 D;  1KNA A;  3RMH A;  1YHB A;  2X6L A;  1SYF A;  1K83 H;  3DM1 A;  3I2Z A;  1K8A C;  3PO2 B;  1BCP F;  2A6E C;  1FNU A;  3E0E A;  1IBM L;  1IKL A;  1CK1 A;  5FLM H;  4JI6 L;  1YZ6 A;  5FLX E;  4UAI A;  2KEE A;  1BQQ T;  4DK6 C;  2OEO A;  2DUD A;  1V1O A;  2YTX A;  2I5M X;  2MO0 A;  1BF4 A;  3K7A B;  1IYV A;  4JI4 L;  1QUQ B;  4OWW B;  1TVX A;  3SR1 A;  3HOU B;  1FVI A;  1EYD A;  1K3B C;  4RGM A;  3PUV A;  1JWU D;  1XX8 A;  3UDX A;  2XRQ D;  5IYB G;  4L6T B;  4L5T A;  4HJ5 A;  4A3M H;  5I6W A;  2F0N A;  1QUQ A;  2BA1 A;  3KDF A;  1SNO A;  2JSO A;  3D3R A;  4ZLT F;  1XJV A;  1SDF A;  1HUN A;  1H9S B;  5CV5 A;  4DR3 Q;  1PTO C;  2MPM A;  4UHV A;  4LF6 L;  3QIA A;  4C3J G;  1KRT A;  4IJL A;  2A1A A;  1STY A;  4X3S A;  5K36 G;  2CKZ B;  2D9U A;  3TP5 A;  4A3D H;  2Y0S B;  4HID A;  2UU9 L;  1EU3 A;  1TWG B;  2RSO A;  4GN3 B;  5D3D A;  4X3T A;  5E4W C;  2GA4 B;  4JI0 Q;  2DGY A;  3OIP A;  4DXG A;  4DR2 L;  3ERS X;  5CV9 A;  1HQM C;  3HOY H;  4LUO A;  3PUZ A;  4EX5 A;  2DNE A;  4POG A;  3D4R A;  2IX1 A;  4JOI C;  5AFW A;  4DV5 L;  5KRU A;  3TRZ A;  3VA5 A;  2HDL A;  3MXN A;  1BBX C;  1HH2 P;  4UDU C;  4YHH Q;  1X3Q A;  4BA1 I;  3FP9 A;  2BE5 D;  2WAQ E;  5LL6 S;  3CCS A;  1K8M A;  1Z7T A;  1UE1 A;  5IY0 A;  2IW3 A;  3RLO A;  3HOW H;  3PUY A;  1EY8 A;  2YYZ A;  3BU2 A;  4A76 A;  1EOT A;  2B39 A;  1E24 A;  1JMC A;  1N9W A;  2F0H A;  4DV0 Q;  4GS3 A;  1FJG L;  1RHP A;  2Z6K C;  4FXK C;  4K0K L;  2YU9 B;  2D5D A;  1EUJ A;  2L5T A;  2EVB A;  2R92 B;  2VNU D;  3FPU B;  1T5E A;  3S15 H;  2B63 B;  4ZKC B;  4DV4 Q;  1G29 1;  2JEB I;  2K33 A;  4CJ1 B;  3BDL A;  5EPJ A;  5C4H A;  4UP7 A;  1O7Y A;  3BYT B;  2LXJ A;  5G3L F;  3CCM A;  4DV7 Q;  2QDB A;  2E2J H;  2SOB A;  1LAB A;  2NVT H;  5JJK A;  3BDC A;  1EEI D;  3KLS A;  4P74 A;  1QVC A;  1TY2 A;  4FO2 A;  2EPB A;  1EYA A;  4A4I A;  3A8J E;  5C5M A;  1CUK A;  3BS1 A;  1B44 D;  4DU9 A;  3JAM c;  5FO9 B;  1UE6 A;  3LX0 A;  2XNA C;  2R93 H;  4ZAI A;  1F9R A;  1EQQ A;  3NPP A;  4O0A A;  3S9W A;  3D0F A;  1I3Q H;  5L37 A;  3RNU A;  1Q8K A;  1YNN D;  1L1O C;  1VQA A;  3QOJ A;  2LS0 1;  4KD4 A;  3UDF A;  1JC7 A;  1X3G A;  4MHE A;  1ZYR D;  4DAM A;  3A54 A;  5I6Y A;  2XTI A;  2SNM A;  3E3X A;  1OTC A;  1Q1E A;  3U50 C;  3NWT A;  1DON A;  2KHS A;  1TWA H;  1QE6 A;  4A3G H;  3SK8 A;  2A69 D;  2KBN A;  2K6A A;  3HOV H;  3CCR A;  5H1S E;  5EBD A;  3M4O H;  3TME A;  1GHJ A;  2OF1 A;  5IGB A;  4A3F H;  2CW0 C;  1KC8 C;  1ASZ A;  4A3K H;  3SK5 A;  1MSH A;  1EYG A;  1EQT A;  1IL2 A;  3PIO 3;  3SGI A;  1A8V A;  1KHI A;  2M00 A;  1Q81 C;  1LTL A;  1Y8P B;  4QB4 A;  5COY A;  2WFW A;  1VQD A;  2TMP A;  5HY6 A;  3OMC A;  1EYC A;  2M9V A;  3TEH B;  4UY8 C;  4RGT A;  3CXC A;  4GKJ Q;  4FYD A;  1N8R C;  4RFB A;  5IP7 H;  1BNZ A;  4RHR A;  4G7Z C;  5DM6 3;  2EXZ A;  3CPW A;  2IL8 A;  1IBM Q;  1Y1V H;  1A2T A;  1WCM B;  1OXT A;  3GTP B;  2F3V A;  2N49 A;  2WB1 B;  1XPO A;  3AU7 A;  2JA9 A;  4JI6 Q;  4G7H C;  3A56 A;  3HOZ G;  2F0Q A;  2QCP X;  2ZJQ A;  4TSS A;  3MXP A;  1Q82 C;  1Y1W B;  2UUA L;  2F4V Q;  1BBW A;  1PTO H;  1A3V A;  1GD7 A;  5DEH A;  2EYL A;  4OO1 I;  1CA5 A;  4KY5 A;  4XXE A;  2V1C C;  5C44 B;  3GTP H;  4JPB W;  5JPM C;  3AFQ A;  1X3P A;  4A3B G;  4RGN A;  2B2Y C;  1PXU A;  3MEF A;  3DUZ A;  3I4M G;  4EQN A;  4B3T L;  2A68 D;  1G2S A;  1MHW C;  3DEO A;  2B2V C;  1V1Q A;  4NP5 A;  5D65 A;  3UE1 A;  3IFT A;  4LUZ A;  1WI5 A;  4RHS A;  2HDM A;  1JB3 A;  3PMF A;  1X9N A;  1CM9 A;  3URY A;  4OO1 G;  1D1I A;  3HOX H;  4CHT B;  4K14 A;  4LF6 Q;  1C8C A;  4R8I A;  4ALP A;  3V05 A;  3S1R B;  3FPP A;  1JQY D;  5FKA C;  4FVM A;  1I50 B;  2BH2 A;  4F87 A;  3DM3 A;  5M3M G;  4QIW B;  2BE5 C;  2IPK D;  1SLJ A;  5IT9 L;  4K5W A;  4JI5 L;  2UU9 Q;  3TZD A;  1KD1 C;  4UP9 A;  5KNB A;  4JI3 L;  1BBU A;  4EQP A;  2YTY A;  4BXX G;  2ATW A;  4YIJ A;  3S14 H;  1E2Z A;  4DR2 Q;  5D3I B;  1XNR L;  1Q1B A;  4HIM A;  2FMC A;  3PO3 H;  5JJI A;  1WTX A;  2RDF A;  2G9D A;  4A3I G;  1D1K A;  1B70 B;  2NVY B;  1HTL D;  1LM0 A;  4DN4 M;  4DV5 Q;  2NN6 G;  4LF4 L;  4RGO S;  5FO7 B;  1I4R A;  1CFM A;  3OW7 A;  5JAV A;  4N8X 1;  5FLM G;  1JB7 A;  4IUT A;  3VR3 A;  4J8Q A;  3N52 A;  3NEM A;  3I3C A;  3U58 A;  1LLR D;  4TRD A;  5IIF A;  1FJG Q;  4DR4 L;  4APV A;  2FMM A;  3L9A X;  4K0K Q;  4ULL A;  4MN3 A;  4Y52 H;  2VY3 A;  5C0X J;  3L7Z C;  1PYB A;  4DAY B;  3D6W A;  2Y0S E;  3TBI B;  5GAD C;  1EIY B;  1YNN C;  2R3Z A;  1ZYR C;  3RR5 A;  1SBB B;  1P16 A;  1ENF A;  1UEA B;  1IYU A;  2E2H H;  3STB D;  5IP9 H;  1EWH A;  4N8F A;  5ELE A;  4DA2 A;  2R7Z H;  3NXW A;  1D8L A;  3GTO H;  2A69 C;  5JPN C;  4DNI A;  3P75 A;  1JWS D;  1YJN A;  1U5K A;  5E4X A;  4A3D G;  3CCJ A;  4Y7N B;  2JE6 I;  1LTS D;  5LHY 1;  4HAE A;  3RZD B;  3CCU A;  1U4M A;  5IWA L;  3SDZ A;  1X54 A;  3J80 c;  1Z6H A;  3C1E A;  4A93 H;  2PW5 A;  1FGU A;  5BN4 A;  4GN4 B;  1AZP A;  4Y7N H;  2CFM A;  3GTL H;  5IGE A;  1R4P B;  3HOY G;  2XSC A;  1PHJ A;  3RZD H;  3CRK C;  2IHF A;  1VQ5 A;  1PTO F;  3K80 C;  5LMU L;  2K5N A;  1BKB A;  1HPC A;  3A8I E;  3W2D A;  4JI1 L;  4RMF A;  4IUN A;  3S1M B;  4RWS C;  3SK4 A;  3KOJ A;  4DR1 L;  4HSP A;  3CCV A;  3VR5 A;  4BY7 H;  4CJ2 C;  2ENB A;  1JOO A;  3G6J B;  3G71 A;  1K0R A;  3M85 A;  3GTG H;  4ZUJ A;  1HQR D;  2ZTE A;  3HOW G;  1WFQ A;  3NP8 A;  4QJF A;  2JA8 H;  3I7F A;  1NCV A;  3J81 E;  3R2T A;  2YTV A;  3DLL A;  2EY5 A;  3K5O A;  4PZ7 A;  2NVX H;  1WTH A;  1I6H B;  4V19 0;  2EOT A;  1SRO A;  2C5C A;  2VUM H;  4PZ8 A;  4DK0 A;  1V1P B;  1W6K A;  1PV4 A;  5C4X B;  3A8K E;  3BG3 A;  4KHV A;  3S17 B;  1S5F D;  2K5H A;  4YCV A;  4RKB A;  1I6H H;  2A68 C;  5JVH 3;  2CQA A;  1RJT A;  1AZQ A;  3GTQ H;  2H1E A;  2PQA B;  2RDH A;  2UUB L;  3D6C A;  4IUR A;  2F0D A;  1V1P A; 
#chains in the Genus database with same CATH homology
 2GN5 A;  5C4X H;  1YZ6 A;  2UUA Q;  1VQI A;  3KLW A;  3J81 c;  3D31 A;  3GTJ H;  4DK6 C;  1E3P A;  2OTL A;  1PH9 A;  3RLN A;  2R93 G;  4BA2 I;  2DUD A;  1VQ4 A;  2PQA A;  1EOV A;  4OWT B;  2YTX A;  4XTC S;  2I5M X;  2KHI A;  3G48 A;  2MO0 A;  4EQ5 A;  3RN2 A;  2C35 B;  4JI4 L;  3CW2 C;  1QUQ B;  1JJC B;  4OWW B;  1J5E Q;  1FVI A;  2JA6 H;  2BA0 A;  1YI2 A;  3PUV A;  2CCZ A;  1L1O B;  5J3B A;  3A5U A;  4GLV B;  4B3T Q;  4A3L H;  3M3Y H;  4JYA Q;  1Q12 A;  1DGS A;  2AHO B;  1YEZ A;  1C9O A;  2R7F A;  3UDX A;  5IYB G;  4A3J H;  3S24 A;  3HKZ G;  2HT1 A;  1PYS B;  2JA6 G;  4L5T A;  4HJ5 A;  4KHZ A;  2YV5 A;  4A3M H;  1XMQ Q;  1C7Y A;  5C0X I;  3JAM i;  2ID0 A;  1L0W A;  4DKA C;  1QUQ A;  2BA1 A;  2PI2 A;  3K81 C;  3KDF A;  4DUZ L;  2IY5 B;  3OTO L;  3WWV A;  1XJV A;  2RHQ B;  4C3J H;  1B8A A;  4A3M G;  1L1O A;  1GVP A;  1IBL L;  1E1T A;  4A3G G;  1P8L A;  1NJI C;  4DR3 Q;  3HOV G;  2E2I H;  4LF6 L;  5FLX c;  4P71 A;  1KRT A;  1YNX A;  4IJL A;  2OQ0 A;  1VCI A;  2A1A A;  2JEA I;  4C2M H;  1CKM A;  5AJ3 Q;  4DV6 Q;  2JA5 G;  5K36 G;  4HIO A;  1K9M C;  2CKZ B;  1UE7 A;  5C4J H;  1HNZ Q;  1PH8 A;  2RHS B;  4HJ7 A;  4A3D H;  2H5X A;  2NZH A;  4LFC L;  4GNX B;  1NBW A;  4PG3 A;  4BY1 G;  2VL6 A;  3CPF A;  4HIK A;  2A19 A;  3NEL A;  4JI5 Q;  4JCV E;  4LF8 L;  2WB1 E;  4HID A;  4JI3 Q;  3CP0 A;  4KHP L;  2UU9 L;  3EBE A;  1OXV A;  3U4V A;  4IPD A;  4GN3 B;  5GRO A;  4HJ9 A;  1S40 A;  1PH7 A;  3RZO H;  1LYL A;  1BVS A;  4JI0 Q;  3AFP A;  2MNA A;  2DGY A;  4LF7 Q;  3NBH B;  1AE2 A;  1XNR Q;  2CWP A;  4AQY Q;  4GNX A;  4DR2 L;  3ERS X;  3I56 A;  1PFS A;  1FL0 A;  1VQ9 A;  4DR7 Q;  3HOY H;  4LUO A;  3PUZ A;  4EX5 A;  3F2C A;  5IP7 G;  2HQL A;  4POG A;  4GKK Q;  1K73 C;  4JC0 A;  2K75 A;  5HGQ A;  3CC7 A;  4DV3 L;  4JOI C;  2IX1 A;  3TS0 A;  4JI7 Q;  3AEV A;  4DV5 L;  4UPA A;  5BR8 L;  3TRZ A;  3CF5 A;  4B3R L;  1Y1V G;  4X64 Q;  1HH2 P;  2EXD A;  4DPG A;  3K8A A;  5IYC H;  1XTD A;  4YHH Q;  4DV1 Q;  1PA6 A;  1Z9F A;  3F1Z A;  3FP9 A;  4BA1 I;  2UXD L;  1H95 A;  1IZ6 A;  2WAQ E;  3I4N H;  2MFI A;  4NXM Q;  4R4O A;  1MJC A;  3CCS A;  3E9I A;  1XNQ Q;  1V43 A;  1WCM H;  1C0A A;  2UXC L;  1UE1 A;  2MO1 A;  3KFU A;  5IY0 A;  3RLO A;  4ME3 A;  4DV2 Q;  3HOW H;  4LF9 L;  4LFA L;  3PUY A;  2VQF L;  4P72 A;  2YYZ A;  3STB C;  3BU2 A;  4A76 A;  3UDG A;  1S72 A;  4NPS A;  2ZM6 L;  1Y1W H;  1E24 A;  1JMC A;  1VQG A;  1EQR A;  1N9W A;  1VQB A;  4DV0 Q;  1YBY A;  4GS3 A;  4R1J A;  4DUY L;  1FJG L;  4L5S A;  3PGZ A;  2Z6K C;  4K0K L;  3KJO A;  3BZC A;  1Y1W G;  1EUJ A;  5C44 H;  2GVA A;  2K4K A;  3CAM A;  1XMO Q;  2F3I A;  2JQO A;  2VNU D;  2R7D A;  1R9T H;  3K7U C;  3S15 H;  4DV4 Q;  1VQE A;  1G29 1;  4JI2 L;  1VQC A;  5JEA J;  4DR5 Q;  4IFD G;  2JEB I;  2QGQ A;  4QIW E;  3PUX A;  4JI8 L;  3ZJY C;  4BBR H;  4PZ6 A;  3W1B A;  2UUC L;  4LF5 L;  3L2P A;  1QVG A;  2UXB L;  4L5Q A;  3H3V I;  1EWI A;  1XPR A;  1SFO H;  1WOC A;  4UP7 A;  3HKZ E;  2LXJ A;  3G4S A;  3CCM A;  4DV7 Q;  3H0G H;  3T1H L;  4LNQ A;  1G6P A;  4BBS H;  2PMZ E;  5FJ8 H;  2E2J H;  1VQ6 A;  2NVT H;  5JJK A;  2QA4 A;  1O7I A;  4P74 A;  1QVC A;  2HIV A;  2CWA A;  1TXY A;  2R6G A;  2Z6K A;  2NN6 I;  3H0G G;  4A4I A;  2F52 A;  1CUK A;  3ULL A;  4YWK A;  1AH9 A;  4X66 Q;  4GLA C;  1N36 Q;  1CSP A;  2ES2 A;  3JAM c;  1UE6 A;  4OX9 L;  4IPH A;  3PIO A;  2R93 H;  4X65 L;  1IBK L;  3CMA A;  1CKN A;  3S1R H;  2VZA A;  4R4Q A;  2K14 A;  2I5L X;  1KL9 A;  2LSS A;  1EQQ A;  1HNW L;  5M3F G;  2L15 A;  4O0A A;  2E5L L;  4QQB X;  3CQZ H;  5IWA Q;  4A75 A;  3D0F A;  1I3Q H;  3RNU A;  4GLX A;  1I50 H;  1Q8K A;  4AQY L;  1L1O C;  1VQA A;  3OYY A;  1JT8 A;  5GAG C;  2N8N A;  1QVF A;  3UDF A;  1X3G A;  4DAM A;  1N34 Q;  1YHQ A;  1TWC H;  5IYB H;  1M1K C;  2XTI A;  2AKW B;  1LUZ A;  4GKK L;  4QGU A;  1K3R A;  1OTC A;  3PO3 G;  1Q1E A;  2Q2H A;  2NVQ H;  1YIT A;  2K50 A;  1I94 L;  5LMU Q;  3GDE A;  3U50 C;  3G6E A;  3FKI H;  5LMN Q;  3RN5 A;  1D7Q A;  4JI1 Q;  1VQP A;  3B6Y A;  4A3E G;  1TWA H;  4A3G H;  1VQF A;  5C3E G;  2KBN A;  3HOV H;  3I4O A;  5ELN A;  3CCR A;  5H1S E;  2NVY H;  3M4O H;  3FKI G;  1HR0 Q;  3F2D A;  1N32 Q;  4DK3 C;  3CC2 A;  4FDB A;  4A3F H;  3PO2 G;  1KC8 C;  4JBK A;  1ASZ A;  4A3K H;  2JA5 H;  4X62 Q;  3A0J A;  1EYG A;  1Y14 B;  4GNX C;  4A3F G;  4NXN Q;  1IL2 A;  4BY1 H;  4A3K G;  1N33 L;  3EN2 A;  2E8G A;  3SGI A;  5M5W H;  1YJW A;  1A8V A;  1KHI A;  1YHA A;  1HNX Q;  4B3M L;  1Q81 C;  1LTL A;  1XMO L;  3CME A;  2WFW A;  5IYD G;  4JBW A;  1I5F A;  1VQD A;  2LXK A;  5C0X G;  3PF4 A;  1RIP A;  5HY6 A;  1GO3 E;  1NMG A;  4YY3 L;  3M4P A;  3T1Y Q;  4IPG A;  1XNQ L;  2ZJP A;  3TEH B;  4UY8 C;  3HFZ B;  2KCM A;  3HOU G;  3CXC A;  1CSQ A;  4DR6 Q;  1MJE A;  4YCW A;  1N8R C;  5IP7 H;  3TS2 A;  3FHW A;  1SN8 A;  4GKJ Q;  3K0X A;  4NB3 A;  4BY7 H;  4IOA A;  3H15 A;  1X3E A;  3HOZ H;  1B7Y B;  4QY7 A;  3CPW A;  1Y1V H;  1IBM Q;  2UUB Q;  2RF4 A;  1OXT A;  4X66 L;  1XPO A;  2N49 A;  4LF4 Q;  3U4Z A;  3GTM H;  1N36 L;  3M4Q A;  2JA9 A;  1SR3 A;  3UE0 A;  4TVA B;  2WP8 J;  3J7Z C;  2VQE L;  4JI6 Q;  3HOZ G;  2ZJQ A;  1Q82 C;  5IP9 G;  2R7Z G;  2UUA L;  2F4V Q;  1JJG A;  1TWH H;  1BBW A;  4GOP B;  1YJ9 A;  1GD7 A;  4JV5 Q;  4OO1 I;  1XPU A;  2V1C C;  1Q86 C;  5GQO A;  4A3B H;  3GTP H;  3S1N H;  1VQM A;  2ASB A;  1CKO A;  4R4I A;  4R4C A;  3AFQ A;  2Y0S G;  4A3C H;  1J5E L;  4A3B G;  2D0O A;  4A93 G;  4DR4 Q;  4GN5 A;  3MEF A;  4IJH A;  4GOP A;  3I4M G;  4MZ9 A;  2IHE A;  4B3T L;  4TQU S;  3KF6 B;  4LW1 A;  4JYA L;  4A3C G;  4YWL A;  2I0Q A;  4KLK A;  1V1Q A;  4UP8 A;  3UE1 A;  1PH2 A;  4LUZ A;  1HZB A;  1PH1 A;  1WI5 A;  3IRB A;  3PF5 A;  3J81 j;  4DUZ Q;  1XMQ L;  4J15 A;  4IFD J;  3OTO Q;  1X9N A;  1VS0 A;  2B29 A;  1W2B A;  4OO1 G;  1IBL Q;  1AE3 A;  4AIM A;  1X56 A;  1X3F A;  1V9P A;  3HOX H;  5M5Y H;  4LF6 Q;  1A0I A;  1HZ9 A;  4DR3 L;  3ICE A;  3S2H H;  2OTJ A;  1UEB A;  3ULJ A;  1YVC A;  4ALP A;  2JA7 G;  4BY7 G;  3J80 i;  2ALY B;  3HOX G;  4OWX B;  1VQJ A;  5GAE C;  4JBM A;  3AQQ A;  4B3S Q;  3S1M H;  5AJ3 L;  4MTN A;  4DV6 L;  4WJ3 M;  4IOC A;  1EIF A;  1HZA A;  1KRS A;  1HNZ L;  4LFC Q;  1NY4 A;  2BH2 A;  3DM3 A;  5M3M G;  1VQ8 A;  2JA8 G;  3J7A 5;  2VS1 A;  4C3I H;  3M9B A;  1SLJ A;  3Q8D A;  5M3F H;  4LF8 Q;  4KHP Q;  2A8V A;  4JI5 L;  2UU9 Q;  2N3S A;  1KD1 C;  4UP9 A;  1JE5 A;  2ZJR A;  4JI3 L;  1BBU A;  1VQK A;  3M7N A;  1EFW A;  2YTY A;  3ULP A;  2HIX A;  4BXX G;  4LFB Q;  2JJQ A;  2ATW A;  1SRU A;  4R4T A;  4XIG S;  4A3I H;  3S14 H;  4JI0 L;  4DR2 Q;  4DR6 L;  4LF7 L;  1XNR L;  1Q1B A;  4HIM A;  3PO3 H;  5JJI A;  1NE3 A;  2FXQ A;  3S2D H;  4DR7 L;  1KXL A;  2PNH A;  4A3I G;  3EIV A;  4POF A;  1RL2 A;  1B70 B;  4DV3 Q;  1VQN A;  2R92 G;  4YCU A;  1LM0 A;  1ASY A;  4DV5 Q;  5BR8 Q;  2BH8 A;  2NN6 G;  3PUW A;  2PI2 E;  4LF4 L;  2B63 G;  4JI7 L;  3PIP A;  3TQY A;  4A3E H;  1YIJ A;  5C3E H;  4X64 L;  5FLM G;  4YHH L;  4DV1 L;  4LUV A;  1JB7 A;  3S17 H;  1T9H A;  2UXD Q;  2F4V L;  3GO5 A;  1OXU A;  4KI0 A;  3PO2 H;  1E7Z A;  1VQH A;  3L0O A;  4NXM L;  4JV5 L;  3NEM A;  4DR1 Q;  2UXC Q;  5C4X G;  3I55 A;  1L2F A;  2EQS A;  3U58 A;  4JG2 A;  2KHJ A;  2HHH Q;  2OWO A;  4LF9 Q;  4LFA Q;  2VQF Q;  4DV2 L;  5DLQ E;  3VDY A;  3KDF B;  3S16 H;  2ZM6 Q;  1A63 A;  4C3H H;  1QZH A;  4P75 A;  5ELO A;  1FJG Q;  4DR4 L;  4APV A;  4DUY Q;  4DV0 L;  4K0K Q;  5IYD H;  1G51 A;  3GD7 A;  2EIF A;  3PV0 A;  4A3L G;  2AMC B;  1VQL A;  4Y52 H;  2VY3 A;  5C0X J;  1X6O A;  3K7A H;  1E22 A;  4JI2 Q;  1J6Q A;  4A3J G;  3L7Z C;  1PYB A;  4DAY B;  4DV4 L;  2Y0S E;  5GAD C;  4JI8 Q;  4HJA A;  1EIY B;  3HOU H;  4DR5 L;  4YWM A;  3TRE A;  1PH3 A;  2UUC Q;  1VQO A;  4LF5 Q;  3CD6 A;  4LFB L;  2UXB Q;  3J81 i;  3CC4 A;  3S1Q H;  4AYB G;  1SMX A;  4PMW A;  4AH6 A;  3RR5 A;  3T1H Q;  5LMN W;  5IT9 c;  1PH4 A;  1PH6 A;  3AYH B;  4DV7 L;  3PSI A;  1P16 A;  2K5V A;  2N78 A;  4B3S L;  1IXR A;  1UWV A;  1HZC A;  4QL5 A;  1HR0 W;  1Q46 A;  2E2H H;  4IPC A;  3STB D;  2D62 A;  5IP9 H;  2JK8 A;  2NZO A;  2R7Z H;  4GOP C;  1D8L A;  3LGJ A;  3GTO H;  4OX9 Q;  3BZK A;  2IX0 A;  4DNI A;  1YJN A;  2ZTC A;  1U5K A;  2AWN A;  4X65 Q;  4LWC A;  1OXX K;  4O2D A;  3CCJ A;  4HJ8 A;  1IBK Q;  1VQ7 A;  4A3D G;  2Q2U A;  1MIU A;  2JE6 I;  1KQS A;  1HNW Q;  2E5L Q;  4H02 A;  3CCU A;  3MXN B;  5IWA L;  1X54 A;  3CCL A;  3J80 c;  1X55 A;  4A93 H;  4L5R C;  1FGU A;  4JI4 Q;  3I4M H;  3NEN A;  4GN4 B;  1N34 L;  1MKH A;  4Y7N H;  2CFM A;  4P73 A;  3GTL H;  2D0P A;  4WJ4 A;  2KCT A;  1TWG H;  3HOY G;  1PHJ A;  4RG1 A;  1I94 Q;  2ZTD A;  4MNO A;  3RZD H;  2IHF A;  4OON A;  1VQ5 A;  3K80 C;  5LMU L;  2K5N A;  1BKB A;  3PCO B;  4IO9 A;  1SE8 A;  3OW2 A;  5LMN L;  1U0L A;  1JJ2 A;  3F2B A;  3UDI A;  4JI1 L;  4RMF A;  2VW9 A;  4IFD I;  2Q2I A;  1W3S A;  2GVB A;  3E9H A;  5IYC G;  3KOJ A;  1E1O A;  1WYD A;  2MQH A;  1A62 A;  4DR1 L;  3CCV A;  1HR0 L;  1NMF A;  3HKS A;  1NTG A;  1Z47 A;  3CCE A;  2HHH L;  2JA7 H;  3G71 A;  4JBJ A;  3A5Z B;  1N32 L;  4OXP A;  3KF8 B;  1K0R A;  3M85 A;  3GTG H;  3KF6 A;  3I4N G;  1PVO A;  1X65 A;  1UE5 A;  1WCM G;  1QZG A;  4X62 L;  1TWF H;  2WB1 G;  1PH5 A;  4JOI A;  3W1G A;  2ZTE A;  3GTK H;  1K8G A;  3HOW G;  3ER0 A;  1WFQ A;  4QJF A;  3KJP A;  1S3O A;  4NXN L;  5M3M H;  1N33 Q;  2JA8 H;  3I7F A;  4B3M Q;  3RLF A;  5JJL A;  2KEN A;  1KAW A;  3CCQ A;  1M90 C;  2RCN A;  2YTV A;  2Q2T A;  3DLL A;  2XGT A;  5IE8 A;  4PZ7 A;  1HNX L;  2NVX H;  1GM5 A;  2K52 A;  3BJU A;  4BXX H;  1OXS C;  4YY3 Q;  5E7N A;  5M5X H;  5C44 G;  3H3V H;  1SRO A;  2OQK A;  3JC6 6;  2AWO A;  5EAY A;  5JEA G;  3T1Y L;  3A74 A;  3KYH C;  2OCE A;  2VUM H;  4PZ8 A;  4X6A H;  2QEX A;  1KIX A;  2YU9 H;  3F8T A;  1PV4 A;  1IYJ B;  4BBR G;  2CQO A;  1HJP A;  2R92 H;  4GKJ L;  2IT1 A;  1CKN B;  3W5O A;  5GAH C;  2K5H A;  4YCV A;  2B63 H;  2VUM G;  2WAQ G;  1YHB A;  1I6H H;  1WJJ A;  1K83 H;  2Z0S A;  3I2Z A;  1Q7Y C;  1K8A C;  5FJ8 G;  4BBS G;  1IBM L;  3E0E A;  2B3G A;  3GTQ H;  2PQA B;  5FLM H;  4AYB E;  1GKH A;  2UUB L;  2VQE Q;  4B3R Q;  4JI6 L;  2I5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...