4OX9Q

Crystal structure of the aminoglycoside resistance methyltransferase npma bound to the 30s ribosomal subunit
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Molecular recognition and modification of the 30S ribosome by the aminoglycoside-resistance methyltransferase NpmA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome/antibiotic
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ox9Q00
4IOCA 5LMNQ 4GKKL 3KYHC 4DV4L 3HOZH 2OQ0A 3HOXH 3UDFA 1GKHA 4OWTB 5J3BA 2VUMH 3ERSX 2R92G 4QJFA 3I55A 3CCLA 3U4ZA 5JJIA 1LTLA 2JEBI 3M4QA 4UY8C 1V9PA 3PF4A 4AQYL 1VQ5A 1Z47A 2C35B 5IT9c 4AH6A 3OTOL 3CD6A 1E1TA 3TEHB 4ALPA 3A5ZB 4HJ5A 3GTPH 3CAMA 2ES2A 1I94L 4OWWB 2Q2TA 1UE7A 1UE6A 1YZ6A 3PO2H 2PI2E 3S24A 2JA5H 5IP7G 4LUVA 4IPGA 2HQLA 4JI2Q 5C4XG 1SLJA 4HJ7A 5M3MG 2KCTA 3I4NH 4UP7A 5E7NA 4DV5Q 1CKNA 1UWVA 4LUZA 5IP9H 3EN2A 3A5UA 1OXSC 4DV1Q 2B63G 1WJJA 3E9HA 3CC7A 1I6HH 4DV0L 1PA6A 5LMNL 4DK6C 4BBRH 1Y1VH 3WWVA 2QGQA 5DLQE 5C3EG 1BBUA 5IE8A 2ZTEA 4BY7G 2VQFQ 4GKJL 1IYJB 4YHHQ 1PH4A 1SE8A 1ASZA 1GM5A 4DR3L 2RF4A 4DV7L 4DR5Q 1KD1C 1N32Q 3HOWH 5IWAL 5ELNA 3T1YQ 3GTGH 4JCVE 2R7DA 4A3MH 4JI7Q 4A3BG 1V1QA 4B3SQ 1GVPA 1K9MC 1I5FA 3M85A 2OTJA 4OWXB 3LGJA 2JE6I 1MJEA 2CWAA 3KDFB 4A3GH 1PH5A 3J81c 3STBC 1E22A 1N9WA 4O2DA 2VS1A 3F8TA 1PH3A 1YVCA 1K8AC 4JI2L 4A3FH 3PCOB 1YITA 4NXMQ 1QZHA 1J5EQ 3RLOA 2KHIA 3CPFA 4DPGA 4XIGS 1L1OB 4DV6L 4DV1L 1HR0L 1X9NA 1TWAH 2BA0A 1RL2A 4JI3L 2I0QA 4LF6L 3K8AA 1VQHA 3PO2G 4JYAQ 1TXYA 2JA8G 3JAMc 2ATWA 4YY3L 4X66L 4OX9Q 3HOUH 4A93H 4HJAA 2JA9A 4DKAC 5AJ3Q 4HJ8A 2K5HA 1Z9FA 3K80C 5IP9G 4GNXB 1YIJA 4DR7L 4DR2Q 3K0XA 4GOPB 2E2HH 1AE2A 5M5XH 1Q7YC 1SROA 2AWOA 3RLNA 1B8AA 1YEZA 3S17H 4LW1A 3KOJA 1U0LA 3GO5A 2NVYH 3HOWG 3BJUA 3H3VI 2F4VQ 1GD7A 3FKIH 2ZTCA 1J5EL 1I3QH 4LFBQ 1XPRA 4DNIA 5IYDG 1FJGQ 3GDEA 3W1GA 4IO9A 3CCRA 1I94Q 1XNRL 3FP9A 4P75A 2R93H 4JI4Q 1YHBA 1VQNA 4JI6L 4GKKQ 2VNUD 4DV4Q 1XTDA 2JA7H 2L15A 4LF7L 1JJCB 4JYAL 5LMUL 3BZCA 1WCMG 5IYBH 2MO0A 3NEMA 1YJWA 3M7NA 3S1RH 1O7IA 4HJ9A 3I4MH 2R7ZG 5AJ3L 1BBWA 1BVSA 3F1ZA 1W2BA 2NVTH 1PVOA 4DAMA 1E24A 3L0OA 4P72A 3VDYA 1BKBA 3MEFA 1CUKA 3I2ZA 5C4JH 1PH9A 3AQQA 2I5HA 3NBHB 4POGA 1KHIA 1OXUA 2VQEL 1EYGA 3F2BA 1VQKA 1N33L 1VQAA 1NE3A 4KHPL 1VQ7A 1Q1BA 5M3FG 1HZCA 1AH9A 2CWPA 3SGIA 4POFA 2N49A 1KIXA 3J80c 3DLLA 2UUAL 3L2PA 4LF9L 1X3GA 1X65A 1C7YA 3GTLH 4LFAQ 1OXVA 1X55A 4DV0Q 4OONA 2NZHA 3ZJYC 4JI4L 3AEVA 1QZGA 3M4PA 2CFMA 2MQHA 3K7AH 4GKJQ 4AYBG 2VL6A 2QEXA 5GAHC 4TQUS 4BY1G 1A63A 1QUQA 3UDGA 2I5LX 4DR3Q 1PFSA 4DV7Q 5JJKA 2YYZA 1PH7A 4C3HH 3U50C 5IWAQ 1AE3A 2D62A 1NY4A 1FVIA 1RIPA 1VS0A 1VQPA 3E0EA 4JI1L 4C3IH 5C0XJ 1MIUA 1J6QA 4A3EG 1JMCA 4BXXH 1QVGA 4A3JH 4YCVA 3BU2A 1L0WA 4UP9A 3CCMA 3H0GH 1IBKQ 1Q8KA 1YJNA 3AYHB 1N34L 2B3GA 3CP0A 3PO3H 3L7ZC 3I4OA 1HH2P 5FJ8G 3CC4A 4IPDA 1E7ZA 1WFQA 1Y14B 4IJHA 1S72A 3Q8DA 4AYBE 2K5NA 4K0KQ 4A4IA 3GTJH 1HZBA 5C44G 1HNWL 2F52A 2VZAA 4NXNL 1EFWA 4DV6Q 2V1CC 1SRUA 1YBYA 4IJLA 4DUYQ 1HNXL 3HOVG 1HR0Q 4LFAL 2K14A 4R4TA 4JBMA 2JJQA 4JI3Q 4LF6Q 4L5SA 2HHHL 3OYYA 4H02A 4A3CH 2Q2HA 3RZOH 1A0IA 4YY3Q 4X66Q 1N36Q 5GAGC 2HIVA 3T1HL 1YJ9A 1CSPA 1NBWA 4HIDA 2UXDL 1SR3A 2Y0SE 1JB7A 2PNHA 4LF8L 4JBKA 3GTOH 1K8GA 4DR7Q 4FDBA 3G4SA 2WP8J 2IHFA 5GAEC 2ZJRA 4EX5A 4IOAA 4YCUA 1IBKL 3HOZG 3HOXG 3MXNB 5ELOA 4R1JA 5GROA 3TREA 2VUMG 2K4KA 1VQOA 1OTCA 1U5KA 4A3KH 2YU9H 1HZAA 4LWCA 1S40A 4K0KL 4AIMA 1KQSA 1HNZL 1Q86C 4X65Q 3GTQH 3CPWA 1Y1WH 4BXXG 4A3JG 1XNRQ 4DUYL 4YWLA 4DR6Q 4DR4L 1Q46A 2IHEA 3A0JA 2OTLA 4JI6Q 3S14H 2Q2IA 1VQ6A 3UDIA 3GTMH 5C0XG 2JA5G 3PO3G 1VCIA 1KRSA 3HKZG 2MNAA 5LMUQ 2RHSB 4HIMA 4A3IH 1N36L 4LF7Q 2PI2A 1YI2A 1XMOL 4L5RC 2E5LL 1R9TH 3UE1A 3I4NG 3HFZB 3ULPA 4KLKA 4LF4L 3RR5A 3PIOA 4IPCA 1PV4A 2EXDA 3CQZH 3PUXA 4PG3A 1IBLL 5GQOA 3CXCA 1LYLA 4PZ7A 4A3LH 2K52A 3KF8B 2JQOA 2N8NA 3CCQA 3G48A 4BBRG 2VQEQ 1Y1VG 1TWFH 3PUYA 4A3CG 3KDFA 5IYCH 4BBSH 5LMNW 1N33Q 3KLWA 4KHPQ 2AMCB 1YHAA 1WYDA 2ZJPA 3RN5A 1XPUA 4GN3B 1MKHA 4IFDG 5BR8L 4UP8A 4JOIA 3S15H 3S2DH 1LM0A 4JI5Q 1G51A 1P8LA 3HKZE 4R4QA 4A3MG 4DK3C 4NB3A 4LF9Q 3CMAA 1L1OA 2UUAQ 3A74A 4X65L 4OO1G 2BH8A 3EBEA 4JG2A 2BA1A 4GN4B 2WFWA 3U4VA 1Q12A 3BZKA 4DR6L 1VQIA 1PYSB 3STBD 3D31A 5FLMH 4A3GG 2UUCL 4B3ML 1IBML 4JBJA 3CCSA 5K36G 1EQRA 2E2IH 4X62L 3S1QH 4APVA 4LF5L 1ASYA 4A3FG 2PQAB 1A8VA 1VQFA 3W5OA 4GNXA 2D0OA 1C0AA 5EAYA 2VW9A 4JI1Q 1XNQQ 3ULLA 4GOPA 2R92H 4RMFA 1Y1WG 4R4CA 2LSSA 2JK8A 2ZTDA 4YWKA 4WJ3M 2CCZA 2JA6H 2HIXA 3H3VH 1K83H 2UUBL 4LUOA 4MTNA 2NN6G 4PMWA 5JJLA 3KJPA 3ER0A 4A76A 1G291 1N34Q 4JV5Q 4QIWE 4JC0A 4PZ8A 3HOUG 2KHJA 4A93G 4GLVB 4JI5L 3KFUA 3F2CA 4B3RQ 2QA4A 4OXPA 4YCWA 5IP7H 1HNWQ 2MO1A 2DUDA 4JI8L 1A62A 1CSQA 4NXNQ 1UEBA 1LUZA 3HKSA 1OXTA 5C4XH 1HNXQ 3HOYH 3ULJA 2XGTA 2HHHQ 1VQGA 2HT1A 1TWHH 3CC2A 2K75A 1UE5A 1QVCA 3B6YA 1CKMA 3I56A 3T1HQ 2WB1E 1E3PA 1VQCA 1VQEA 1VQMA 1WI5A 2UXDQ 3FKIG 2RHQB 4QGUA 2Z6KA 2GVBA 3PIPA 4QQBX 1XNQL 4LF8Q 3AFQA 3I7FA 2R93G 4X6AH 4A3BH 1IZ6A 4BA2I 3S2HH 2JA7G 5C0XI 1NTGA 1V43A 1X3EA 1UE1A 2IY5B 1TWCH 2A19A 2Y0SG 4JV5L 5IYBG 3RZDH 5JEAG 2CKZB 1VQ4A 1JJ2A 1VQ9A 1XPOA 2YTVA 5IY0A 2R7FA 1OXXK 3I4MG 2A8VA 2ID0A 1PYBA 1XMQL 4B3RL 4YWMA 4B3TL 3W1BA 1HNZQ 3PSIA 4GLAC 1JJGA 4A3DH 2JA6G 4DR1L 4IFDJ 1T9HA 1Q81C 1CKOA 4QY7A 3TS0A 2H5XA 2ALYB 1KC8C 4DR4Q 4LFCQ 4GS3A 4L5TA 1TWGH 3J81i 1FL0A 1PH6A 4R4OA 2Z0SA 3AFPA 1K3RA 1VQ8A 4IFDI 3EIVA 1XMOQ 1VQDA 2E5LQ 3E9IA 4DUZQ 3J7A5 2JEAI 3CCEA 2WAQG 1KXLA 4IPHA 1X6OA 4LF4Q 2OCEA 3KF6B 2JA8H 4OO1I 1IBLQ 2ZM6L 2E8GA 3GTKH 3HOYG 2EQSA 2KENA 2I5MX 1H95A 1KRTA 1NJIC 4JI0Q 3KJOA 1P16A 2YV5A 3TS2A 1C9OA 3JAMi 3K7UC 1VQLA 1QVFA 1D8LA 4HIKA 2YTYA 3S1MH 5BR8Q 1IXRA 4EQ5A 2B29A 1I50H 1G6PA 1VQJA 1EQQA 3CCJA 4Y52H 5HGQA 4XTCS 4C2MH 2WAQE 2AHOB 2NN6I 3K81C 4L5QA 2OQKA 2EIFA 2DGYA 4JBWA 3J7ZC 3G71A 3H0GG 3PV0A 4LFCL 5IYDH 1PH8A 3RN2A 3J81j 2UUCQ 1X56A 1X3FA 4J15A 1IBMQ 4B3MQ 4X64Q 1YNXA 4C3JH 4X62Q 2UU9Q 4LF5Q 4DUZL 1PH2A 3KF6A 1WCMH 4A3DG 5HY6A 2R6GA 3PUZA 4MZ9A 1HZ9A 4UPAA 2R7ZH 3GD7A 4DV5L 2UUBQ 4KHZA 3PGZA 1SFOH 4JI0L 2UXCQ 2IX0A 3F2DA 1EIYB 4BA1I 2NZOA 5FLXc 5M5WH 3FHWA 5GADC 3U58A 3UE0A 1NMFA 3TQYA 2LXKA 1SMXA 2RCNA 3IRBA 2VQFL 4LNQA 4YHHL 2IX1A 2GVAA 3D0FA 2ASBA 4DR5L 4JI8Q 1N32L 5M3FH 1E1OA 5JEAJ 2A1AA 3T1YL 2NVQH 4WJ4A 4JOIC 1MJCA 1B70B 3UDXA 4JI7L 3H15A 4KI0A 4P73A 2D0PA 3PUWA 4B3SL 4O0AA 1L1OC 1K0RA 1Q82C 4MNOA 2K5VA 2FXQA 1K73C 4X64L 1PHJA 1VQBA 2F3IA 3NELA 4Y7NH 4R4IA 3RNUA 2UU9L 1Q1EA 2OWOA 3J80i 4A3KG 4ME3A 1S3OA 3TRZA 4GN5A 4DV2Q 4BY1H 2CQOA 3CF5A 2UXBQ 1JT8A 3JC66 2K50A 4DV3Q 2LXJA 2IT1A 1FGUA 4NPSA 4GNXC 2NVXH 4NXML 2BH2A 3OW2A 1HR0W 3S16H 1IL2A 3M3YH 4A3EH 2XTIA 4GOPC 2WB1G 2UXCL 1EIFA 3CMEA 1XJVA 4A3IG 4HIOA 1YHQA 3S1NH 3DM3A 1KL9A 3CCUA 3NENA 2Q2UA 1PH1A 1XMQQ 4DAYB 1NMGA 4P71A 2ZJQA 2MFIA 3CW2C 4B3TQ 4OX9L 2GN5A 2E2JH 5FJ8H 1B7YB 1QUQB 4P74A 3PF5A 4RG1A 4DR1Q 3ICEA 1W3SA 5M3MH 2PMZE 1EWIA 3G6EA 1SN8A 4GLXA 4AQYQ 3PUVA 4A3LG 5C44H 5M5YH 4DR2L 5IYCG 4BBSG 3OTOQ 1KAWA 2N78A 1EUJA 2B63H 3HOVH 3RLFA 2AKWB 1X54A 2PQAA 2KCMA 5C3EH 1JE5A 4BY7H 1D7QA 1WOCA 4DV2L 1N8RC 2N3SA 4QL5A 2UXBL 2KBNA 2ZM6Q 1M90C 1L2FA 4TVAB 2F4VL 1GO3E 5H1SE 4DV3L 3M4OH 2VY3A 1DGSA 4LFBL 4A75A 1HJPA 2Z6KC 1M1KC 1CKNB 1FJGL 5FLMG 3M9BA 3CCVA 4PZ6A 2AWNA 2YTXA 1EOVA
chains in the Genus database with same CATH superfamily
4CJ2C 4C2MB 1AW7A 3KYHC 5I2XA 2F0TA 3HOXH 4UHVA 2R92G 5CC4A 3GTMB 1SNPA 2JEBI 4C3JB 3NP8A 2FINB 4FXDA 4J1MA 2EYOA 4HJ5A 4KN4C 1TY2A 2PZUA 2Q2TA 1UE6A 1YZ6A 4OWWB 2R7ZB 1DZ1A 1SFOB 2F0UA 2JA5H 1TS5A 2KEEA 4IPGA 1SLJA 5M3MG 4UP7A 5M5WB 3T53B 2F3WA 3OW7A 1AZPA 3VR6A 1ENCA 3E9HA 5M3FB 4RCOA 2E75C 4DK6C 2E74C 1Y1VH 5C3EG 5DLQE 1SE8A 4DV7L 3HOWH 3K57A 5ELNA 1STHA 3I4LA 4NMZA 4JI7Q 1LTGD 1QNUA 2NWGA 1H9KA 1I5FA 2OTJA 3NQIA 1STAA 1STEA 2JE6I 1FNUA 4RGNA 3KDFB 1Q90A 3S16B 1O80A 4IALA 2VS1A 4JI2L 2DN8A 3X3MA 3S1NB 2VXWA 4NXMQ 2L11A 3EROA 3SHLA 1M4VA 1K8MA 2RSOA 3ITPA 2BA0A 3Q23A 2NN6H 3K8AA 3PO2G 4QMGA 3HOUH 4HJAA 3T51B 4DKAC 3I72A 5IP9G 5COYA 5D14A 3BYTB 4DR7L 2SEBD 2AWOA 3OMGA 3RLNA 1B8AA 3M4OB 3ND9A 4A3BB 4DAVA 1JR0D 2EYFA 2NVYH 2XWJB 1TWCB 3BJUA 3H3VI 1GOZA 4FNFA 4ZRZA 1SYFA 1J5EL 1C4QA 1XPRA 3HOZB 1BCPB 3W1GA 1CI3M 4C3JG 3AB9A 1VQNA 4JI6L 3K5MA 4EQPA 4LF7L 3BVMA 3BZCA 3NEMA 1IHZA 4HJ9A 1UEAB 2R7ZG 1W2BA 1Z7TA 5DEHA 1JB3A 3Q22A 1BKBA 5CR3A 1PH9A 2JA8B 1EYCA 4B08A 1ZXTA 2RDHA 3NXWA 4G7ZC 1Q8IA 1VQAA 1VQ7A 1Q1BA 5M3FG 2CWPA 3SGIA 1SNQA 1KIXA 2ZXPA 5BN3A 3E0JA 4LF9L 1X3GA 1X65A 3J7AV 1F2MA 2NZHA 3AEVA 1WTWA 2MHVA 4FXKC 5IT9L 3GTGB 5CMDA 3A8IE 2I5LX 1JWMD 4DV7Q 2YYZA 1A2TA 1KDBA 2D62A 1ILPA 4JI1L 4C3IH 5C0XJ 4A3GB 2B8FA 1TQOA 3IL8A 1JORA 1YJNA 5BN4A 3VYSA 4HMJA 1HH2P 5FJ8G 1XTCD 3CC4A 1E7ZA 1KTKA 2K7VA 1Q3LA 3Q8DA 4AYBE 4X3KA 4IUQA 5FO9B 3GTJH 1AFPA 1PFMA 5IGFA 1QG7A 1EFWA 4IJLA 1HNXL 1EY5A 2EYLA 4HMIA 2K14A 1JE4A 2B2TC 4L5SA 3OYYA 1FYCA 3QB3A 4H02A 5M9OA 4E6IA 5IT9E 2HIVA 1YJ9A 1JB7A 2IL8A 2BCOA 2PNHA 4JBKA 4DR7Q 1K8GA 3RUZA 3TP8A 3J7YW 1BNZA 2IHFA 4NDXA 5GAEC 4IOAA 5ELDA 3HOZG 4LMQD 5I4DA 3MXNB 1SXTA 2VUMG 5K36H 5FLXL 1VQOA 4C3HG 2KCNA 2EYMA 4A3KH 2R93B 4LWCA 5CV4A 4DNRB 4H13C 4TKOB 4ZCKA 2Y0SB 1Y8OB 4DUYL 4LK1C 2NYZD 2BE5C 3S1RB 4JI6Q 2IHEA 3A0JA 2OXPA 4MN3A 3S14H 1R4QB 3C1EA 3GTMH 3VR3A 4Q0FA 4UDUC 2SDFA 4LF7Q 2WV6D 2RHSB 1U4RA 1WTXA 5C4JB 3VYUA 1PV4A 4IPCA 4PG3A 5GQOA 4A3LH 2K52A 3CCQA 3H91A 2X69A 5NUCA 1PZID 5E4WC 2ZJPA 2AQ3B 1XPUA 3GTLB 4IFDG 5EBCA 4JI5Q 1PRTF 3HKZE 4A3MG 5FLXE 4LF9Q 1L1OA 4X65L 4F8MA 1GUGA 1F9RA 4GN4B 1Q12A 1DOKA 1SE2A 2R3ZA 3STBD 2EJFC 5FLMH 4A3GG 2UUCL 3KUPA 4B3ML 4JBJA 2EE1A 2E2IH 4APVA 2PQAB 4GNXA 3GTPB 2QDBA 1C0AA 1F9SA 3H0GB 2VW9A 4O42A 4JI1Q 4GOPA 4RMFA 1WD1A 2JA6H 2HIXA 1K83H 4FP5D 2KJXA 3ER0A 1G291 4ODGA 4G7HC 4QIWE 4JC0A 3BDLA 2XNAC 4C56C 4BBRB 2DUDA 2M2LA 3RZOB 1STYA 1HNXQ 5C4XH 4N9TA 1U4MA 2GA4B 2ZT9C 2DNEA 1BCPF 3GTOB 1W6KA 1SYDA 2WB1E 1E3PA 1VQMA 1L0XB 4DA2A 4I7ZC 3HRZC 1B3QA 4XDXA 3AFQA 2R93G 4OHJA 1EWCA 4A3BH 2YU9B 2JA7G 1X3EA 1SNCA 2IY5B 3DXJC 1L0YB 1TWCH 5J1ZA 2Y0SG 1PZJD 4JV5L 1KLUD 2A6HC 4CKBA 2CKZB 1XPOA 5IY0A 5EKIA 2R7FA 1OXXK 1ZKOA 4RKLA 5AFWA 5EPKA 1GJXA 4JPBW 1XMQL 1UNSA 4B3RL 4B3TL 1ET9A 3R93A 2H4OA 1CKOA 3X3NA 3TS0A 2BOSA 3NTIA 1HUNA 4R4OA 3DMUA 4KKSA 1F9QA 1K3RA 1BOSA 3EIVA 2KOLA 3TZDA 1EEID 2JEAI 1GUSA 3J81L 2K33A 1X6OA 2JA8H 2KUMA 4ILWA 5G3LD 3S15B 1KRTA 1MD2D 2O5JC 1C9OA 3N6RA 2H1EA 1EWHA 1VQLA 1D8LA 4HIKA 1QVFA 2K6AA 2B29A 4OEMB 1BF4A 1A6XA 1CHQD 2ZXOA 3CCJA 2F0NA 4Y52H 3S1QB 4M1UB 3NSWA 2DGYA 3BVZA 3H0GG 5IYDH 1JCKB 3RN2A 5J39A 2UUCQ 4B3MQ 1HQMC 4MIUA 1ICWA 2UU9Q 2AQ1B 3KF6A 1EY0A 1M8AA 2ICEC 3OIQA 1SNOA 3J81E 4UPAA 4DV5L 3SE0A 1FR3A 2VB3X 5E1FA 1SYGA 3F2DA 1JWUD 1MSHA 3CKIB 4YIJA 3FHWA 5ELCA 1SYBA 2R61A 3TQYA 2VQFL 2IX1A 1CK1A 4LNQA 5EQ0A 5F2DA 1N32L 2QEJC 5JEAJ 4R8IA 1Y8PB 2Q8IB 5E4XA 2AQ2B 2D0PA 4B3SL 2EY5A 1Q82C 1S5BD 1K73C 1PHJA 2F1MA 3NELA 1IW7D 1Q1EA 2OWOA 2A6ED 3J80i 4HCSA 2OEOA 1S3OA 2A73B 3S2HB 5ELFA 4BY1H 3MA2B 3CF5A 2UXBQ 1S5CD 1JT8A 4P2CB 2JP1A 1FGUA 3OW2A 3M3YH 1PLFA 4K14A 3NENA 1XMQQ 1CZGA 1NMGA 3GV6A 2F0PA 4B3TQ 1TWGB 2GN5A 3PF5A 2ENBA 3URYA 2PMZE 1SN8A 2P5ZX 4KN7C 1BCPC 2PO4A 1EQVA 4B9XA 2N78A 2B63H 1YNJC 2EXZA 1JE5A 4KJNA 4BY7H 1D7QA 1N8RC 4QL5A 2CH4W 3M7GA 1M90C 3S1MB 4IUVA 4FF4A 1LT5D 1EZ8A 2Z6KC 1CKNB 1TR5A 3TS2A 2PW5A 4OELB 2DY7A 2AWNA 4PZ6A 5IGGA 2Z4IA 4IOCA 4DFAA 3DWAA 4DV4L 2B2VC 2OQ0A 3LX0A 5C4ZA 1H9RA 1B53A 3CCLA 4A3IB 2A69C 5I9OA 1V1PA 3PF4A 2Q8RE 1VQ5A 2C35B 1BDOA 1WTVA 3A5ZB 3GTPH 5CBAE 2ES2A 1G8ZD 3FEWX 3S24A 5C0XH 1CT1D 4KKUA 5IGEA 2HQLA 2BDNA 4KV6A 3IFDA 2KCTA 3D6WA 3I4NH 4DV5Q 2L4NA 3EN2A 1EEFD 3A5UA 4DV1Q 2F0FA 3VR5A 4IURA 2NBFA 1YNNC 4BBRH 2F0MA 3P75A 4GKJL 3K0YA 2VQFQ 2CQAA 1VDZA 1PH4A 1ASZA 1N32Q 4IUTA 1CZWA 5CV7A 5I6WA 3BDOA 4Y7NB 4I7AA 4B3SQ 2QDLA 2E76C 1PTOD 4OWXB 3LGJA 3LNNA 1I4GA 1WTHA 2NTSA 2CWAA 3BYYB 1PH5A 1E22A 4A3EB 4DK0A 1RD9D 3F8TA 1QZHA 3RD4A 1DONA 2X6GA 2KHIA 1U4PA 4HTHA 5LL6S 4HEDA 1ML0D 1L1OB 3SR1A 1QOHA 2EPBA 1ENFA 1RL2A 5FO8B 1B1ZA 2MJ8A 4ZKCB 2B2UA 5M3MB 1EIHA 5C44B 5M5YB 2EYJA 4KY7A 3K58A 4X66L 5IOCA 4A93H 1LTRD 2PQEA 3NK9A 1IL8A 4HJ8A 2K5HA 1Z9FA 4GNXB 3KK7A 5C3EB 3K0XA 4GOPB 1AE2A 5M5XH 1SROA 3E3XA 2LFNA 2NTTA 4ZUJA 1U0LA 2A68D 3GO5A 3HOWG 2Z9HA 1GD7A 3H6MA 3D8GA 3QOLA 1XNRL 4OIJA 4P75A 4RGOS 4DV4Q 2VNUD 1D1KA 4MHEA 4KK7A 1QJOA 5LMUL 3LWEA 3MXUA 5IYBH 4DXFA 1YJWA 2RBMA 1O7IA 2EZVA 1BVSA 3MFYA 2NVTH 1PVOA 1E24A 4QUFA 3PO2B 5EKLA 2F0VA 3NBHB 1V1OA 1VQKA 4KHPL 3A55A 3PQIA 2EYHA 1AH9A 3J80c 3DLLA 2UUAL 2K32A 1IKLA 1C7YA 3ONAB 4L8JA 1HA6A 5C6AA 5CV5A 4HCEA 4DAYA 2MQHA 4GKJQ 2VL6A 2QEXA 5GAHC 2XN9C 1QUQA 4RFBA 1SMYD 2K01A 1AE3A 1DXMA 3TZUA 1RIPA 1FVIA 4XT1B 1I4RA 1MIUA 4A3EG 1ZYRD 2X6LA 1SJED 2B2YA 4YCVA 4A3JH 3BU2A 1L0WA 2TSSA 4UP9A 3CCMA 1O7YA 4A3FB 3KBXA 1N34L 1K3BC 1NCVA 1X3QA 3PO3H 3I4OA 4IJHA 1S72A 4KMUC 3V2TA 2K5NA 2RQXA 4K0KQ 1HZBA 5C44G 4ZKBB 2VZAA 3TMEA 4NXNL 3LWUA 1YBYA 3H94A 4F87A 4R4TA 5FO7B 4JBMA 2JJQA 3ERQA 1AEXA 2HHHL 1H9SA 5C3WA 1A0IA 2E2HB 1JOKA 4X66Q 1G6ZA 5KNCA 3T1HL 3FPUB 1CSPA 1NBWA 4HIDA 2Y0SE 2MUYA 4LF8L 1A2UA 4U68A 2ZJRA 5FK9C 1D5ZC 1XXGA 4DN4M 4YCUA 5A2QL 3MXPA 1WTPA 3FKIB 2JSOA 1I3QB 5ELOA 3NTHA 2LKVA 1AZQA 1U5KA 4RH6A 1HZAA 1KQSA 1HNZL 1Y1WH 4EQOA 1XNRQ 2CW0C 2E2JB 1QILA 1WVLA 2K5DA 4DR6Q 3I4MB 2KQ3A 5FOBB 3I8ZA 1VQ6A 3EA6A 1KRSA 4A3IH 2MNAA 4DF7A 5LMUQ 2PI2A 1YI2A 4KD4A 4LAAA 1LT3D 4LF4L 3RR5A 2EXDA 3CQZH 3CHBD 3CXCA 1LYLA 3KF8B 3G48A 3PUYA 1TWFH 4BBSH 1B2TA 4S3SA 2EJMA 3KLWA 4KHPQ 5A35A 5A2QE 1LLRD 2DY8A 4H7BA 4IUUA 1PXUA 4UP8A 3S2DH 1JC7A 4Q5VA 1P8LA 4R4QA 4NB3A 3K7AB 2UUAQ 3A74A 5EBDA 5I2YA 2VUMB 3EBEA 2BA1A 4WRDA 4C3HB 1VQIA 1PYSB 5IIFA 4XYQA 3OSOA 4ID6A 2L55A 5K36G 1EQRA 3DEOA 1LV9A 3NE5B 4X62L 5JEAH 4MTKA 4LF5L 1ASYA 4A3FG 1A8VA 1VQFA 3W5OA 3WDNA 5EAYA 1XNQQ 2R92H 5IODA 2LSSA 4YWKA 4WJ3M 4FO2A 5K5PA 2UUBL 1SDFA 4PMWA 4ZLTF 5JJLA 4F88A 5KYIA 3KJPA 1N34Q 1ZYRC 2KHJA 1D5XC 5JJZA 4GLVB 4JI5L 3KFUA 2QA4A 4OXPA 1CSQA 4NXNQ 2G5DA 1I4QA 1OXTA 4XXEA 3HOYH 1B44D 3ULJA 3K59A 1V1PB 2HHHQ 3T13A 4A3MB 1CA5A 1QWYA 4CKEA 3CC2A 1QVCA 3B6YA 3T1HQ 1CTMA 3I56A 3NBIA 3S9WA 3FKIG 3QOJA 3V96A 2EVBA 4LF8Q 2F03A 1NR2A 4X6AH 2J0TD 1IZ6A 4DNTB 2F0EA 1ILQA 3NUCA 1E2WA 4N9PA 1VQ9A 4FYDA 3I4MG 1BUVT 1TWAB 2ID0A 4IZ8A 2L9HA 1HNZQ 4GLAC 4A3DH 3O13A 2JA6G 1DJRD 1Q81C 3E5SA 4QY7A 2H5XA 4GS3A 2QF7A 3J81i 2Z0SA 3GP7A 1II3A 1S5FD 4DUZQ 3J7A5 3CCEA 2WAQG 3S17B 2K28A 4LF4Q 3DUZA 1CFMA 2E8GA 2B2TA 2EQSA 2I5MX 1JOQA 4FF2A 4JI0Q 1NJIC 2XIWA 1TVXA 2N55A 3MVVA 1GUOA 2YTYA 1SYCA 1G2TA 4EQ5A 1LTID 5C4HA 1I50H 3KLSX 3JAML 1EQQA 2O5IC 2FHTA 2JA7B 1STBA 5HGQA 4C2MH 1TS4A 2AHOB 2NN6I 2PPBC 3J7ZC 2IX3A 2F0LA 1PH8A 4WJWA 4J15A 2F0KA 4X64Q 1YNXA 4C3JH 4X62Q 4PMBA 4LF5Q 1EL0A 5HGTA 4NP5A 3A7AB 3TDQA 4OIKA 2R7ZH 2O2LD 3GD7A 3QJYA 2UUBQ 4KHZA 4EVOA 1SFOH 1X32A 4KKTA 2RSNA 4BWGB 2OF1A 1GUWA 1HCZA 2G9DA 3SK8A 5M5WH 5FLXc 5GADC 1EZ6A 2FJ2A 2QKIC 1HPCA 1NMFA 4V0BA 2LXKA 1SMXA 2EOTA 3IRBA 2J7ZA 2PNRC 4LJZC 2ASBA 5M3FH 1E1OA 1SNMA 1TWHB 4KHVA 3JAME 1B70B 1KNEA 3UDXA 3H15A 4P73A 3PUWA 1J8IA 4O0AA 1L1OC 1EYDA 4TRDA 4MNOA 2FXQA 2F3IA 2UU9L 3MWYW 1C8CA 1RKNA 2B39A 3RZDB 4DV3Q 1G91A 4NPSA 4GNXC 1JOOA 3S16H 3V05A 1MBYA 1IL2A 2XTIA 4GOPC 2PYKA 3EQLC 1EIFA 3CMEA 3S1NH 1IKMA 4DAYB 3W3AA 2E2JH 5FJ8H 1QUQB 1LABA 3HEJA 4AQYQ 4K6LA 4DR2L 5IYCG 3OTOQ 3TP5A 1PRTD 2AKWB 1X54A 2KCMA 3GTKB 3QO2A 1PTOB 2F0QA 1D1IA 2N3SA 2UXBL 3MTSA 3I3CA 1L2FA 1HUMA 4TVAB 2F4VL 1K0SA 1GO3E 1EFID 1HTPA 3M4OH 2HQEA 1X3PA 1SE3A 1SYEA 3DEPA 3K5NA 2CHBD 3M9BA 1I94L 3G4SA 3GTQB 1B9NA 1EY9A 1B9MA 5LMNQ 1DOLA 4GKKL 3T16A 5G3LF 3HOZH 2XRQD 4PNYA 1H9SB 1GKHA 4OWTB 1GXDC 2VUMH 3ERSX 4QJFA 5JJIA 5T1GA 5CYUA 3M4QA 4UY8C 1V9PA 1S5DD 2RDFA 1MHWC 2F3VA 1E1TA 3SK4A 1WCMB 3TEHB 4ALPA 4QUCA 1MI2A 5KYLA 1VF5C 2L12A 2DJGC 2K5QA 2Q8TA 5IP7G 2KVMA 1S5ED 5E7NA 3SXHA 4DXGA 2B63G 1WJJA 3CC7A 4DV0L 1E2ZA 2NVQB 4G57A 2DJFC 2IJ0A 2JYOA 3WWVA 1BBUA 4BY7G 2WINB 3R2IA 1U9RA 2QCPX 3D4RA 4DR3L 2RF4A 3GQBA 3FMCA 5IWAL 3GTGH 5J22A 2R7DA 4A3MH 3C46A 3ZYYX 1V1QA 1T5EA 1GVPA 1RCVD 1AN8A 3M85A 3FPPA 1T5XD 2NVXB 5DM63 4A3GH 3M4YA 3EVQA 3J81c 3STBC 1RTOA 1O7LA 1I4PA 1RDPD 4O2DA 3PCOB 3DHQA 4QF4A 3RLOA 4XQNA 3CPFA 3SK5A 4DPGA 2L1BA 4DV1L 1JICA 5BN5A 1LTAD 1TWAH 4LF6L 1KAAA 4KY5A 3SK6A 1O78A 1TXYA 2ATWA 2JA9A 5AJ3Q 4HR7B 1YIJA 5E3FA 1R4PB 2F0HA 2SOBA 4DR2Q 4RAUC 5ELEA 5JPNC 2KEDA 1YEZA 3S17H 2ICIA 3KOJA 4CBVA 4JVZA 4FF1A 4JK1C 2F4VQ 3G7LA 4DNIA 3GDEA 1I94Q 2PW7A 5D3DA 2R93H 5IGCA 1CQFA 4JI4Q 2EY6A 4GKKQ 1V8QA 2RDGA 4C1NK 1XTDA 2JA7H 2L15A 1JJCB 1WCMG 2F0WA 2M00A 3S1RH 3EFXD 1BBWA 4V190 5JOBA 3MFGA 2BDOA 5C4JH 1TT2A 2B2WA 3MHBA 2I5HA 1D6EC 4POGA 1KHIA 1OXUA 1EYGA 2CVRA 3SDZA 1Z6HA 2WACA 4Z9CB 4FVMA 4OGQC 2HCIA 4B9WA 4POFA 2N49A 3Q0AA 1Y1VB 2G9HD 1TKWB 1H9MA 2HDLA 2MP1A 3GTLH 4LFAQ 4DV0Q 4ZK9B 3HOWB 4ZQ3A 3M4PA 2CFMA 5EGTA 4AYBG 1W6JA 4TQUS 1A63A 4DR3Q 1PFSA 1KNAA 1PH7A 5IWAQ 2AUJD 2I0QA 1VQPA 1WD0A 3E0EA 1J6QA 4BXXH 1EQTA 5KNDA 1HFGA 3BS1A 3H0GH 1IBKQ 1WFQA 1Y14B 4A4IA 2F52A 1HHVA 1JQYD 1LTTD 3MC0B 3OMCA 2V1CC 1B4OA 3HOVG 3HOUB 4LF6Q 2Z8LA 4A3CH 2V4DA 3RZOH 5IGBA 2KCCA 1N36Q 5GAGC 1EY8A 3D4DA 4U673 2UXDL 1SR3A 2C9OA 3GTOH 4OO1H 4ZYSA 2XRSD 2NVYB 4EX5A 4IN3A 4EGVA 1RF2D 3HOXG 4R1JA 5GROA 1EY7A 3TREA 3HP3A 2FMMA 4KD3A 1OTCA 2F0SA 2YU9H 1IW7C 4K0KL 1S40A 1QNKA 2A6EC 3CRLC 3GTQH 1Q86C 1K28A 4A3JG 2JN4A 4YWLA 5CV6A 1Q46A 2Q2IA 3UDIA 1SNDA 2JA5G 3PO3G 1VCIA 3HKZG 2NB0A 2PZWA 1XMOL 1DYQA 3UE1A 2B2UC 1BQQT 2D2CC 3E6ZX 1ZEQX 3HFZB 1PYWD 1STGA 3ULPA 4KLKA 2NZ1D 4L6TB 5C3XA 3PIOA 3PUXA 2K05A 2N8NA 1Y1VG 1NR4A 5LMNW 4ME5A 2AMCB 1YHAA 2M9VA 3RN5A 4GN3B 1MKHA 4PMCA 4JOIA 3S15H 4DK3C 4K2LA 3U4VA 2WFWA 4DR6L 3BZKA 3D31A 3CCSA 4RHRA 3K5OA 3VYRA 3S1QH 1BR9A 4KY6A 5CORA 1D5MC 2DNCA 4GZYC 3ULLA 2PZTA 1Y1WG 3NPPA 2CCZA 2FFKB 3QG1A 3H3VH 4MTNA 2NN6G 2QILA 5ELBA 2RCFA 2MPMA 3GTJB 1H9JA 1VMCA 4PZ8A 3HOUG 1FGBD 4XQQA 1I6HB 2LS01 3F2CA 2F0OA 1J9OA 3R3OA 1KABA 1UUPA 1A62A 3HKSA 4DGZA 2K03A 3U9OA 2E2DC 4K5WA 1NSNS 2K75A 3BVGA 1VQCA 4XT3B 2UXDQ 4R8NA 1ESFA 1HA5A 2RHQB 2GVBA 4QGUA 4QQBX 1XNQL 4CDDC 3I7FA 4BA2I 3S2HH 5C0XI 1NTGA 1V43A 2O4XA 1NNXA 2A19A 1MGSA 2B2YC 5JEAG 1VQ4A 1JJ2A 1S4ZA 3WOFA 5KIXA 1LTBD 1PTOC 3CU7A 2SNSA 5C5LA 4RGMA 3S14B 3W1BA 1SJHD 3NTKA 3NHHA 4IFDJ 1T9HA 4LFCQ 4L5TA 1ICFB 1TWGH 2JXMB 1FL0A 1PH6A 1VQ8A 3R2TA 2OT2A 1RJTA 1XMOQ 1VQDA 1KXLA 4IPHA 3MZ5A 2OCEA 3KF6B 4OO1I 5KNBA 3OIPA 2ZM6L 1D2BA 3HOYG 2KENA 4H44C 1H95A 2CH4A 1P16A 1RODA 3JAMi 5JVG3 3K7UC 3S1MH 1NAPA 1B3AA 1BBXC 3TN2A 1DM0B 2EJGC 4C3IG 1A3UA 3MEHA 5CBEE 4XTCS 2A68C 2E2IB 1TS2A 1DOMA 2OQKA 3G71A 1CM9A 1ET6A 3J81j 5L37A 1X3FA 1WTRA 3K5LA 3I73A 1GUTA 2XSCA 2JA6B 1K83B 1PRTB 4DUZL 4PQXA 3TP6A 1DCZA 5C5MA 1CHPD 4A3DG 5HY6A 2R6GA 3HGBA 4MZ9A 4RKBA 3PGZA 4JI0L 2WAQB 2UXCQ 2IX0A 2NZOA 5C4XB 3H3VC 3UE0A 2PCFB 3IFTA 4YHHL 2GVAA 4DR5L 2Z4HA 1SEBD 3T1YL 1NUCA 4KI0A 4X64L 4Y7NH 2XVSA 4A3KG 2D9UA 2VB2X 3TRZA 4GN5A 4H0LC 4DV2Q 2A74C 2BE5D 3JC66 1SMYC 4I65A 2IT1A 2BH2A 1A3VA 2F0DA 4A3EH 1EYAA 1XJVA 5CV8A 1K8OA 3Q24A 2Q2UA 1PH1A 4P71A 3KLRA 3P20A 4OX9L 4RG1A 1W3SA 5M3MH 4A3LG 1EWIA 3G6EA 5C44H 5M5YH 4FF3A 2B8GA 1KAWA 1EUJA 1LT6D 3L9AX 5C3EH 5JPMC 1WOCA 2KBNA 2ZM6Q 4DV3L 2FMCA 4LFBL 4A75A 1FJGL 4CDFC 5FLMG 1PFNA 3CCVA 4R9WA 4CDEC 1BXTA 1Y69U 5EPLA 4ZAIA 3UDFA 3D6CA 1F77A 5J3BA 3I55A 3U4ZA 1LTLA 3OWEB 4AQYL 4BS9A 1R9TB 1HFNA 1Z47A 4XYOA 3NQTA 5IT9c 4AH6A 3OTOL 3CD6A 4CHTB 4K5XA 3CAMA 1UE7A 3HG9A 4IUNA 3PO2H 2PI2E 2SNMA 1EY4A 4LUVA 3G6JB 4JI2Q 5C4XG 4HJ7A 1C48A 2KHSA 1CKNA 1UWVA 4LUZA 5IP9H 1F2LA 1OXSC 2WKCA 1I6HH 1PA6A 5LMNL 2NUCA 1I6VC 2QGQA 2HCCA 5IE8A 1GHJA 2ZTEA 1IYJB 4YHHQ 1IYVA 1GM5A 4DR5Q 3BDCA 1KD1C 3T1YQ 1F2YA 3SVMA 4JCVE 4A3BG 3A54A 1LT4D 1A3TA 2A6HD 1K9MC 4BY1B 4CKCA 2K1BA 1HTLD 3OPOA 4F7XA 1MJEA 3M3YB 1N9WA 3TBIB 1PH3A 1YVCA 1K8AC 4A3FH 4QB4A 1YITA 1J5EQ 3A8JE 1WTOA 4XIGS 4HSVA 4DV6L 4C1NI 5T1IA 3A56A 1HR0L 1X9NA 1FNWA 4JI3L 1VQHA 1KDAA 2JA8G 3JAMc 4YY3L 4OX9Q 1HQRD 2B63B 1QE6A 2I07B 4HSPA 5KEEA 1VMPA 3K80C 2J4XA 4BY7B 2E2HH 3W2DA 1Q7YC 5I6YA 1XX8A 4LW1A 2EY1A 3I90A 3VR2A 1MSGA 1RTNA 1EU4A 1AP0A 4TSSA 3FKIH 2ZTCA 1I3QH 4LFBQ 3KLSA 5IYDG 1FJGQ 2LMCB 3DM1A 3CCRA 4IO9A 3UI2A 3A8KE 5D3IB 1YHBA 4DK1A 3FRPB 2IWHA 1VF7A 4JYAL 1FD7D 2MO0A 3M7NA 3I4MH 4EQNA 5AJ3L 3F1ZA 4DAMA 3L0OA 4P72A 3VDYA 3MEFA 1CUKA 3I2ZA 3AQQA 1EIGA 2VQEL 3I4NB 2RVLA 3F2BA 1N33L 1NE3A 3MXGA 4RWSC 2EYPA 3HZXA 3AU7A 1HZCA 2AUKA 2LY7A 3FVQA 3L2PA 4L63B 1OXVA 1X55A 4OONA 4DAPA 3ZJYC 4JI4L 4K2KA 1QZGA 4KJOA 4WORA 1I4XA 3K7AH 4RCNA 4BY1G 3UDGA 3D4WA 2F0JA 3CRKC 5JJKA 4C3HH 3U50C 1NY4A 1VS0A 1CA6A 1JMCA 3MAQA 1U4LA 4WFN3 5I9PA 1QVGA 3NBHA 3NWTA 1Q8KA 3AYHB 2B3GA 3CP0A 3L7ZC 3T4AC 4IPDA 3VA7A 4FXGC 1ONLA 1BCPD 4ULLA 3IAYA 2IW3A 1HNWL 1ENAA 4DV6Q 1YNJD 1SRUA 4DUYQ 3BZDB 4K8JA 1HR0Q 4LFAL 4A93B 2WKDA 4JI3Q 4J8QA 3FDTA 2Q2HA 3HS0C 3QWNA 4G7OC 4YY3Q 5M5XB 3OHXC 4IFDH 2Z1CA 5JAVA 3GV3A 3Q6SA 4AYBB 4ZUIA 4FDBA 2F0IA 2WP8J 3BG3A 3H09A 3ND8A 1IBKL 3A7LA 1WTQA 2K4KA 2A69D 3TP7A 2K04A 4AIMA 4CDCC 3N52A 4X65Q 3CPWA 4X3SA 4BXXG 4PV1C 2KA7A 4DR4L 2K5WA 4NW2A 4JW0A 2OTLA 2NVTB 5C0XG 4HIMA 4JYAQ 1N36L 4IQZA 4NKLA 2HD3A 2E5LL 1R9TH 4L5RC 3HOVB 3I4NG 3D3RA 5DM73 1Y8NB 1IBLL 4G4KA 5JVH3 1YNND 4PZ7A 2JQOA 1TS3A 4BBRG 1QB5D 3T56B 4CJ0B 2VQEQ 4A3CG 3KDFA 5IYCH 1N33Q 4K5VA 1WYDA 3F2UA 5BR8L 1PRTC 4UAIA 1LM0A 1PFBA 1G51A 4CJ1B 1RHPA 2XWBB 2L5TA 3OOCA 3CMAA 1A15A 2MGSA 4OO1G 3HOXB 1ESRA 3SEBA 5FKAC 2BH8A 4JG2A 3C2PA 2D5DA 3J7AF 2A5HA 1IBML 4HN7A 4A3JB 4ABNA 1EY6A 2D0OA 2TMPA 4R4CA 2JK8A 2Z6BA 2ZTDA 3PO3B 3HKZB 2JA5B 3KF8A 4LUOA 1LTSD 4A76A 3KBGA 4JV5Q 4N8FA 2B2WC 4A93G 1SBBB 3OWFA 3DWPA 4J6HA 4B3RQ 1IYUA 2ZXRA 4YCWA 5IP7H 1HNWQ 2MO1A 1HXYD 4JI8L 1UEBA 1LUZA 1PDQA 3K6OA 2XGTA 4KTAA 3RMHA 1PZKD 1GHKA 2F4IA 1VQGA 3R8BA 1FNVA 2HT1A 1TWHH 1UE5A 1CKMA 3NWSA 4K6DA 1VQEA 1WI5A 4QIWB 3PIPA 2Z6KA 2C5CA 3VR4A 3PIP3 1SAPA 5EKKA 3P1HA 4X3TA 2B2VA 2EY2A 1UE1A 1DD2A 5IYBG 3RZDH 1Y1WB 2L0CA 2YTVA 4RA8A 2A8VA 1PYBA 1CQVA 4YWMA 1PTOF 2HUGA 3PSIA 2WB1B 1JJGA 1TY0A 4DR1L 4RHSA 1XYIA 1KC8C 2ALYB 3EJIA 4DR4Q 1E0BA 4RGTA 3IKJA 1E2VA 1QCBD 3AFPA 3CQZB 4IFDI 2E5LQ 3E9IA 5KRUA 4HAEA 1TWFB 3L3OC 4OL7A 4BBSB 5EJWA 1IBLQ 3GTKH 5ISRA 1PTOH 2I46A 3S2DB 3KJOA 2YV5A 1SE4A 2F0GA 2QW7A 5BR8Q 1IXRA 3C1FA 1G6PA 1EU3A 1G2SA 1VQJA 2EDGA 2WIIB 3DWQA 5LHY1 2WAQE 1O7ZA 3K81C 4L5QA 2EIFA 4JBWA 3PV0A 4LFCL 1X56A 1IBMQ 1B50A 1GUNA 2R92B 3AMUA 1HRJA 3PMFA 1PMRA 5IGDA 2IPKD 5LL6X 4XQJA 1PH2A 1WCMH 3PUZA 4CGYB 3VA5A 1HZ9A 3PIO3 4K8IA 2RA4A 3MXNA 5DNFA 3TSSA 1EIYB 4BA1I 1TU2B 3U58A 3HOYB 2RCNA 1SSOA 4O1NA 5HURA 3D0FA 1KDCA 1STNA 4JI8Q 2NVQH 2A1AA 4WJ4A 4JOIC 1LACA 4N8X1 1MJCA 5DAUA 4JI7L 1LO5D 2N88A 1EOTA 1K0RA 4C3IB 2K5VA 5CV9A 1TIID 1VQBA 3RNUA 4R4IA 4ME3A 2CQOA 2CW0D 1OO9B 4DU9A 2K50A 2RKSA 3J80L 2LXJA 4NXML 2KECA 2NVXH 1F9PA 1HR0W 1XWEA 5CGKA 2WB1G 2UXCL 4A3IG 4HIOA 1YHQA 4A3DB 3DM3A 1KL9A 3CCUA 3I70A 2ZJQA 2MFIA 3CW2C 1B7YB 1F2ZA 4P74A 4IUPA 4DR1Q 3ICEA 5KGUA 1BO0A 4GLXA 3PUVA 4BBSG 3HOVH 5TSSA 3QIAA 5EPJA 3RLFA 2PQAA 3C3LA 4QCLA 3P7JA 5D65A 1KLGD 1JWSD 4DV2L 3VYTA 3WOEA 3QR8A 2PMZB 5H1SE 2VY3A 4X3UA 1DGSA 1UAPA 1HJPA 4A3KB 1M1KC 1I50B 3J80E 1I4HA 2HDMA 3I91A 3FP9A 4M8AA 2YTXA 1EOVA 3U9SA
chains in the Genus database with same CATH topology
4IOCA 5LMNQ 4GKKL 3KYHC 4DV4L 3HOZH 2OQ0A 3HOXH 3UDFA 1GKHA 4OWTB 5J3BA 2VUMH 3ERSX 2R92G 4QJFA 3I55A 3CCLA 3U4ZA 5JJIA 1LTLA 2JEBI 3M4QA 4UY8C 1V9PA 3PF4A 4AQYL 1VQ5A 1Z47A 2C35B 5IT9c 4AH6A 3OTOL 3CD6A 1E1TA 3TEHB 4ALPA 3A5ZB 4HJ5A 3GTPH 3CAMA 2ES2A 1I94L 4OWWB 2Q2TA 1UE7A 1UE6A 1YZ6A 3PO2H 2PI2E 3S24A 2JA5H 5IP7G 4LUVA 4IPGA 2HQLA 4JI2Q 5C4XG 1SLJA 4HJ7A 5M3MG 2KCTA 3I4NH 4UP7A 5E7NA 4DV5Q 1CKNA 1UWVA 4LUZA 5IP9H 3EN2A 3A5UA 1OXSC 4DV1Q 2B63G 1WJJA 3E9HA 3CC7A 1I6HH 4DV0L 1PA6A 5LMNL 4DK6C 4BBRH 1Y1VH 3WWVA 2QGQA 5DLQE 5C3EG 1BBUA 5IE8A 2ZTEA 4BY7G 2VQFQ 4GKJL 1IYJB 4YHHQ 1PH4A 1SE8A 1ASZA 1GM5A 4DR3L 2RF4A 4DV7L 4DR5Q 1KD1C 1N32Q 3HOWH 5IWAL 5ELNA 3T1YQ 3GTGH 4JCVE 2R7DA 4A3MH 4JI7Q 4A3BG 1V1QA 4B3SQ 1GVPA 1K9MC 1I5FA 3M85A 2OTJA 4OWXB 3LGJA 2JE6I 1MJEA 2CWAA 3KDFB 4A3GH 1PH5A 3J81c 3STBC 1E22A 1N9WA 4O2DA 2VS1A 3F8TA 1PH3A 1YVCA 1K8AC 4JI2L 4A3FH 3PCOB 1YITA 4NXMQ 1QZHA 1J5EQ 3RLOA 2KHIA 3CPFA 4DPGA 4XIGS 1L1OB 4DV6L 4DV1L 1HR0L 1X9NA 1TWAH 2BA0A 1RL2A 4JI3L 2I0QA 4LF6L 3K8AA 1VQHA 3PO2G 4JYAQ 1TXYA 2JA8G 3JAMc 2ATWA 4YY3L 4X66L 4OX9Q 3HOUH 4A93H 4HJAA 2JA9A 4DKAC 5AJ3Q 4HJ8A 2K5HA 1Z9FA 3K80C 5IP9G 4GNXB 1YIJA 4DR7L 4DR2Q 3K0XA 4GOPB 2E2HH 1AE2A 5M5XH 1Q7YC 1SROA 2AWOA 3RLNA 1B8AA 1YEZA 3S17H 4LW1A 3KOJA 1U0LA 3GO5A 2NVYH 3HOWG 3BJUA 3H3VI 2F4VQ 1GD7A 3FKIH 2ZTCA 1J5EL 1I3QH 4LFBQ 1XPRA 4DNIA 5IYDG 1FJGQ 3GDEA 3W1GA 4IO9A 3CCRA 1I94Q 1XNRL 3FP9A 4P75A 2R93H 4JI4Q 1YHBA 1VQNA 4JI6L 4GKKQ 2VNUD 4DV4Q 1XTDA 2JA7H 2L15A 4LF7L 1JJCB 4JYAL 5LMUL 3BZCA 1WCMG 5IYBH 2MO0A 3NEMA 1YJWA 3M7NA 3S1RH 1O7IA 4HJ9A 3I4MH 2R7ZG 5AJ3L 1BBWA 1BVSA 3F1ZA 1W2BA 2NVTH 1PVOA 4DAMA 1E24A 3L0OA 4P72A 3VDYA 1BKBA 3MEFA 1CUKA 3I2ZA 5C4JH 1PH9A 3AQQA 2I5HA 3NBHB 4POGA 1KHIA 1OXUA 2VQEL 1EYGA 3F2BA 1VQKA 1N33L 1VQAA 1NE3A 4KHPL 1VQ7A 1Q1BA 5M3FG 1HZCA 1AH9A 2CWPA 3SGIA 4POFA 2N49A 1KIXA 3J80c 3DLLA 2UUAL 3L2PA 4LF9L 1X3GA 1X65A 1C7YA 3GTLH 4LFAQ 1OXVA 1X55A 4DV0Q 4OONA 2NZHA 3ZJYC 4JI4L 3AEVA 1QZGA 3M4PA 2CFMA 2MQHA 3K7AH 4GKJQ 4AYBG 2VL6A 2QEXA 5GAHC 4TQUS 4BY1G 1A63A 1QUQA 3UDGA 2I5LX 4DR3Q 1PFSA 4DV7Q 5JJKA 2YYZA 1PH7A 4C3HH 3U50C 5IWAQ 1AE3A 2D62A 1NY4A 1FVIA 1RIPA 1VS0A 1VQPA 3E0EA 4JI1L 4C3IH 5C0XJ 1MIUA 1J6QA 4A3EG 1JMCA 4BXXH 1QVGA 4A3JH 4YCVA 3BU2A 1L0WA 4UP9A 3CCMA 3H0GH 1IBKQ 1Q8KA 1YJNA 3AYHB 1N34L 2B3GA 3CP0A 3PO3H 3L7ZC 3I4OA 1HH2P 5FJ8G 3CC4A 4IPDA 1E7ZA 1WFQA 1Y14B 4IJHA 1S72A 3Q8DA 4AYBE 2K5NA 4K0KQ 4A4IA 3GTJH 1HZBA 5C44G 1HNWL 2F52A 2VZAA 4NXNL 1EFWA 4DV6Q 2V1CC 1SRUA 1YBYA 4IJLA 4DUYQ 1HNXL 3HOVG 1HR0Q 4LFAL 2K14A 4R4TA 4JBMA 2JJQA 4JI3Q 4LF6Q 4L5SA 2HHHL 3OYYA 4H02A 4A3CH 2Q2HA 3RZOH 1A0IA 4YY3Q 4X66Q 1N36Q 5GAGC 2HIVA 3T1HL 1YJ9A 1CSPA 1NBWA 4HIDA 2UXDL 1SR3A 2Y0SE 1JB7A 2PNHA 4LF8L 4JBKA 3GTOH 1K8GA 4DR7Q 4FDBA 3G4SA 2WP8J 2IHFA 5GAEC 2ZJRA 4EX5A 4IOAA 4YCUA 1IBKL 3HOZG 3HOXG 3MXNB 5ELOA 4R1JA 5GROA 3TREA 2VUMG 2K4KA 1VQOA 1OTCA 1U5KA 4A3KH 2YU9H 1HZAA 4LWCA 1S40A 4K0KL 4AIMA 1KQSA 1HNZL 1Q86C 4X65Q 3GTQH 3CPWA 1Y1WH 4BXXG 4A3JG 1XNRQ 4DUYL 4YWLA 4DR6Q 4DR4L 1Q46A 2IHEA 3A0JA 2OTLA 4JI6Q 3S14H 2Q2IA 1VQ6A 3UDIA 3GTMH 5C0XG 2JA5G 3PO3G 1VCIA 1KRSA 3HKZG 2MNAA 5LMUQ 2RHSB 4HIMA 4A3IH 1N36L 4LF7Q 2PI2A 1YI2A 1XMOL 4L5RC 2E5LL 1R9TH 3UE1A 3I4NG 3HFZB 3ULPA 4KLKA 4LF4L 3RR5A 3PIOA 4IPCA 1PV4A 2EXDA 3CQZH 3PUXA 4PG3A 1IBLL 5GQOA 3CXCA 1LYLA 4PZ7A 4A3LH 2K52A 3KF8B 2JQOA 2N8NA 3CCQA 3G48A 4BBRG 2VQEQ 1Y1VG 1TWFH 3PUYA 4A3CG 3KDFA 5IYCH 4BBSH 5LMNW 1N33Q 3KLWA 4KHPQ 2AMCB 1YHAA 1WYDA 2ZJPA 3RN5A 1XPUA 4GN3B 1MKHA 4IFDG 5BR8L 4UP8A 4JOIA 3S15H 3S2DH 1LM0A 4JI5Q 1G51A 1P8LA 3HKZE 4R4QA 4A3MG 4DK3C 4NB3A 4LF9Q 3CMAA 1L1OA 2UUAQ 3A74A 4X65L 4OO1G 2BH8A 3EBEA 4JG2A 2BA1A 4GN4B 2WFWA 3U4VA 1Q12A 3BZKA 4DR6L 1VQIA 1PYSB 3STBD 3D31A 5FLMH 4A3GG 2UUCL 4B3ML 1IBML 4JBJA 3CCSA 5K36G 1EQRA 2E2IH 4X62L 3S1QH 4APVA 4LF5L 1ASYA 4A3FG 2PQAB 1A8VA 1VQFA 3W5OA 4GNXA 2D0OA 1C0AA 5EAYA 2VW9A 4JI1Q 1XNQQ 3ULLA 4GOPA 2R92H 4RMFA 1Y1WG 4R4CA 2LSSA 2JK8A 2ZTDA 4YWKA 4WJ3M 2CCZA 2JA6H 2HIXA 3H3VH 1K83H 2UUBL 4LUOA 4MTNA 2NN6G 4PMWA 5JJLA 3KJPA 3ER0A 4A76A 1G291 1N34Q 4JV5Q 4QIWE 4JC0A 4PZ8A 3HOUG 2KHJA 4A93G 4GLVB 4JI5L 3KFUA 3F2CA 4B3RQ 2QA4A 4OXPA 4YCWA 5IP7H 1HNWQ 2MO1A 2DUDA 4JI8L 1A62A 1CSQA 4NXNQ 1UEBA 1LUZA 3HKSA 1OXTA 5C4XH 1HNXQ 3HOYH 3ULJA 2XGTA 2HHHQ 1VQGA 2HT1A 1TWHH 3CC2A 2K75A 1UE5A 1QVCA 3B6YA 1CKMA 3I56A 3T1HQ 2WB1E 1E3PA 1VQCA 1VQEA 1VQMA 1WI5A 2UXDQ 3FKIG 2RHQB 4QGUA 2Z6KA 2GVBA 3PIPA 4QQBX 1XNQL 4LF8Q 3AFQA 3I7FA 2R93G 4X6AH 4A3BH 1IZ6A 4BA2I 3S2HH 2JA7G 5C0XI 1NTGA 1V43A 1X3EA 1UE1A 2IY5B 1TWCH 2A19A 2Y0SG 4JV5L 5IYBG 3RZDH 5JEAG 2CKZB 1VQ4A 1JJ2A 1VQ9A 1XPOA 2YTVA 5IY0A 2R7FA 1OXXK 3I4MG 2A8VA 2ID0A 1PYBA 1XMQL 4B3RL 4YWMA 4B3TL 3W1BA 1HNZQ 3PSIA 4GLAC 1JJGA 4A3DH 2JA6G 4DR1L 4IFDJ 1T9HA 1Q81C 1CKOA 4QY7A 3TS0A 2H5XA 2ALYB 1KC8C 4DR4Q 4LFCQ 4GS3A 4L5TA 1TWGH 3J81i 1FL0A 1PH6A 4R4OA 2Z0SA 3AFPA 1K3RA 1VQ8A 4IFDI 3EIVA 1XMOQ 1VQDA 2E5LQ 3E9IA 4DUZQ 3J7A5 2JEAI 3CCEA 2WAQG 1KXLA 4IPHA 1X6OA 4LF4Q 2OCEA 3KF6B 2JA8H 4OO1I 1IBLQ 2ZM6L 2E8GA 3GTKH 3HOYG 2EQSA 2KENA 2I5MX 1H95A 1KRTA 1NJIC 4JI0Q 3KJOA 1P16A 2YV5A 3TS2A 1C9OA 3JAMi 3K7UC 1VQLA 1QVFA 1D8LA 4HIKA 2YTYA 3S1MH 5BR8Q 1IXRA 4EQ5A 2B29A 1I50H 1G6PA 1VQJA 1EQQA 3CCJA 4Y52H 5HGQA 4XTCS 4C2MH 2WAQE 2AHOB 2NN6I 3K81C 4L5QA 2OQKA 2EIFA 2DGYA 4JBWA 3J7ZC 3G71A 3H0GG 3PV0A 4LFCL 5IYDH 1PH8A 3RN2A 3J81j 2UUCQ 1X56A 1X3FA 4J15A 1IBMQ 4B3MQ 4X64Q 1YNXA 4C3JH 4X62Q 2UU9Q 4LF5Q 4DUZL 1PH2A 3KF6A 1WCMH 4A3DG 5HY6A 2R6GA 3PUZA 4MZ9A 1HZ9A 4UPAA 2R7ZH 3GD7A 4DV5L 2UUBQ 4KHZA 3PGZA 1SFOH 4JI0L 2UXCQ 2IX0A 3F2DA 1EIYB 4BA1I 2NZOA 5FLXc 5M5WH 3FHWA 5GADC 3U58A 3UE0A 1NMFA 3TQYA 2LXKA 1SMXA 2RCNA 3IRBA 2VQFL 4LNQA 4YHHL 2IX1A 2GVAA 3D0FA 2ASBA 4DR5L 4JI8Q 1N32L 5M3FH 1E1OA 5JEAJ 2A1AA 3T1YL 2NVQH 4WJ4A 4JOIC 1MJCA 1B70B 3UDXA 4JI7L 3H15A 4KI0A 4P73A 2D0PA 3PUWA 4B3SL 4O0AA 1L1OC 1K0RA 1Q82C 4MNOA 2K5VA 2FXQA 1K73C 4X64L 1PHJA 1VQBA 2F3IA 3NELA 4Y7NH 4R4IA 3RNUA 2UU9L 1Q1EA 2OWOA 3J80i 4A3KG 4ME3A 1S3OA 3TRZA 4GN5A 4DV2Q 4BY1H 2CQOA 3CF5A 2UXBQ 1JT8A 3JC66 2K50A 4DV3Q 2LXJA 2IT1A 1FGUA 4NPSA 4GNXC 2NVXH 4NXML 2BH2A 3OW2A 1HR0W 3S16H 1IL2A 3M3YH 4A3EH 2XTIA 4GOPC 2WB1G 2UXCL 1EIFA 3CMEA 1XJVA 4A3IG 4HIOA 1YHQA 3S1NH 3DM3A 1KL9A 3CCUA 3NENA 2Q2UA 1PH1A 1XMQQ 4DAYB 1NMGA 4P71A 2ZJQA 2MFIA 3CW2C 4B3TQ 4OX9L 2GN5A 2E2JH 5FJ8H 1B7YB 1QUQB 4P74A 3PF5A 4RG1A 4DR1Q 3ICEA 1W3SA 5M3MH 2PMZE 1EWIA 3G6EA 1SN8A 4GLXA 4AQYQ 3PUVA 4A3LG 5C44H 5M5YH 4DR2L 5IYCG 4BBSG 3OTOQ 1KAWA 2N78A 1EUJA 2B63H 3HOVH 3RLFA 2AKWB 1X54A 2PQAA 2KCMA 5C3EH 1JE5A 4BY7H 1D7QA 1WOCA 4DV2L 1N8RC 2N3SA 4QL5A 2UXBL 2KBNA 2ZM6Q 1M90C 1L2FA 4TVAB 2F4VL 1GO3E 5H1SE 4DV3L 3M4OH 2VY3A 1DGSA 4LFBL 4A75A 1HJPA 2Z6KC 1M1KC 1CKNB 1FJGL 5FLMG 3M9BA 3CCVA 4PZ6A 2AWNA 2YTXA 1EOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IOC A;  5LMN Q;  4GKK L;  3KYH C;  4DV4 L;  3HOZ H;  2OQ0 A;  3HOX H;  3UDF A;  1GKH A;  4OWT B;  5J3B A;  2VUM H;  3ERS X;  2R92 G;  4QJF A;  3I55 A;  3CCL A;  3U4Z A;  5JJI A;  1LTL A;  2JEB I;  3M4Q A;  4UY8 C;  1V9P A;  3PF4 A;  4AQY L;  1VQ5 A;  1Z47 A;  2C35 B;  5IT9 c;  4AH6 A;  3OTO L;  3CD6 A;  1E1T A;  3TEH B;  4ALP A;  3A5Z B;  4HJ5 A;  3GTP H;  3CAM A;  2ES2 A;  1I94 L;  4OWW B;  2Q2T A;  1UE7 A;  1UE6 A;  1YZ6 A;  3PO2 H;  2PI2 E;  3S24 A;  2JA5 H;  5IP7 G;  4LUV A;  4IPG A;  2HQL A;  4JI2 Q;  5C4X G;  1SLJ A;  4HJ7 A;  5M3M G;  2KCT A;  3I4N H;  4UP7 A;  5E7N A;  4DV5 Q;  1CKN A;  1UWV A;  4LUZ A;  5IP9 H;  3EN2 A;  3A5U A;  1OXS C;  4DV1 Q;  2B63 G;  1WJJ A;  3E9H A;  3CC7 A;  1I6H H;  4DV0 L;  1PA6 A;  5LMN L;  4DK6 C;  4BBR H;  1Y1V H;  3WWV A;  2QGQ A;  5DLQ E;  5C3E G;  1BBU A;  5IE8 A;  2ZTE A;  4BY7 G;  2VQF Q;  4GKJ L;  1IYJ B;  4YHH Q;  1PH4 A;  1SE8 A;  1ASZ A;  1GM5 A;  4DR3 L;  2RF4 A;  4DV7 L;  4DR5 Q;  1KD1 C;  1N32 Q;  3HOW H;  5IWA L;  5ELN A;  3T1Y Q;  3GTG H;  4JCV E;  2R7D A;  4A3M H;  4JI7 Q;  4A3B G;  1V1Q A;  4B3S Q;  1GVP A;  1K9M C;  1I5F A;  3M85 A;  2OTJ A;  4OWX B;  3LGJ A;  2JE6 I;  1MJE A;  2CWA A;  3KDF B;  4A3G H;  1PH5 A;  3J81 c;  3STB C;  1E22 A;  1N9W A;  4O2D A;  2VS1 A;  3F8T A;  1PH3 A;  1YVC A;  1K8A C;  4JI2 L;  4A3F H;  3PCO B;  1YIT A;  4NXM Q;  1QZH A;  1J5E Q;  3RLO A;  2KHI A;  3CPF A;  4DPG A;  4XIG S;  1L1O B;  4DV6 L;  4DV1 L;  1HR0 L;  1X9N A;  1TWA H;  2BA0 A;  1RL2 A;  4JI3 L;  2I0Q A;  4LF6 L;  3K8A A;  1VQH A;  3PO2 G;  4JYA Q;  1TXY A;  2JA8 G;  3JAM c;  2ATW A;  4YY3 L;  4X66 L;  4OX9 Q;  3HOU H;  4A93 H;  4HJA A;  2JA9 A;  4DKA C;  5AJ3 Q;  4HJ8 A;  2K5H A;  1Z9F A;  3K80 C;  5IP9 G;  4GNX B;  1YIJ A;  4DR7 L;  4DR2 Q;  3K0X A;  4GOP B;  2E2H H;  1AE2 A;  5M5X H;  1Q7Y C;  1SRO A;  2AWO A;  3RLN A;  1B8A A;  1YEZ A;  3S17 H;  4LW1 A;  3KOJ A;  1U0L A;  3GO5 A;  2NVY H;  3HOW G;  3BJU A;  3H3V I;  2F4V Q;  1GD7 A;  3FKI H;  2ZTC A;  1J5E L;  1I3Q H;  4LFB Q;  1XPR A;  4DNI A;  5IYD G;  1FJG Q;  3GDE A;  3W1G A;  4IO9 A;  3CCR A;  1I94 Q;  1XNR L;  3FP9 A;  4P75 A;  2R93 H;  4JI4 Q;  1YHB A;  1VQN A;  4JI6 L;  4GKK Q;  2VNU D;  4DV4 Q;  1XTD A;  2JA7 H;  2L15 A;  4LF7 L;  1JJC B;  4JYA L;  5LMU L;  3BZC A;  1WCM G;  5IYB H;  2MO0 A;  3NEM A;  1YJW A;  3M7N A;  3S1R H;  1O7I A;  4HJ9 A;  3I4M H;  2R7Z G;  5AJ3 L;  1BBW A;  1BVS A;  3F1Z A;  1W2B A;  2NVT H;  1PVO A;  4DAM A;  1E24 A;  3L0O A;  4P72 A;  3VDY A;  1BKB A;  3MEF A;  1CUK A;  3I2Z A;  5C4J H;  1PH9 A;  3AQQ A;  2I5H A;  3NBH B;  4POG A;  1KHI A;  1OXU A;  2VQE L;  1EYG A;  3F2B A;  1VQK A;  1N33 L;  1VQA A;  1NE3 A;  4KHP L;  1VQ7 A;  1Q1B A;  5M3F G;  1HZC A;  1AH9 A;  2CWP A;  3SGI A;  4POF A;  2N49 A;  1KIX A;  3J80 c;  3DLL A;  2UUA L;  3L2P A;  4LF9 L;  1X3G A;  1X65 A;  1C7Y A;  3GTL H;  4LFA Q;  1OXV A;  1X55 A;  4DV0 Q;  4OON A;  2NZH A;  3ZJY C;  4JI4 L;  3AEV A;  1QZG A;  3M4P A;  2CFM A;  2MQH A;  3K7A H;  4GKJ Q;  4AYB G;  2VL6 A;  2QEX A;  5GAH C;  4TQU S;  4BY1 G;  1A63 A;  1QUQ A;  3UDG A;  2I5L X;  4DR3 Q;  1PFS A;  4DV7 Q;  5JJK A;  2YYZ A;  1PH7 A;  4C3H H;  3U50 C;  5IWA Q;  1AE3 A;  2D62 A;  1NY4 A;  1FVI A;  1RIP A;  1VS0 A;  1VQP A;  3E0E A;  4JI1 L;  4C3I H;  5C0X J;  1MIU A;  1J6Q A;  4A3E G;  1JMC A;  4BXX H;  1QVG A;  4A3J H;  4YCV A;  3BU2 A;  1L0W A;  4UP9 A;  3CCM A;  3H0G H;  1IBK Q;  1Q8K A;  1YJN A;  3AYH B;  1N34 L;  2B3G A;  3CP0 A;  3PO3 H;  3L7Z C;  3I4O A;  1HH2 P;  5FJ8 G;  3CC4 A;  4IPD A;  1E7Z A;  1WFQ A;  1Y14 B;  4IJH A;  1S72 A;  3Q8D A;  4AYB E;  2K5N A;  4K0K Q;  4A4I A;  3GTJ H;  1HZB A;  5C44 G;  1HNW L;  2F52 A;  2VZA A;  4NXN L;  1EFW A;  4DV6 Q;  2V1C C;  1SRU A;  1YBY A;  4IJL A;  4DUY Q;  1HNX L;  3HOV G;  1HR0 Q;  4LFA L;  2K14 A;  4R4T A;  4JBM A;  2JJQ A;  4JI3 Q;  4LF6 Q;  4L5S A;  2HHH L;  3OYY A;  4H02 A;  4A3C H;  2Q2H A;  3RZO H;  1A0I A;  4YY3 Q;  4X66 Q;  1N36 Q;  5GAG C;  2HIV A;  3T1H L;  1YJ9 A;  1CSP A;  1NBW A;  4HID A;  2UXD L;  1SR3 A;  2Y0S E;  1JB7 A;  2PNH A;  4LF8 L;  4JBK A;  3GTO H;  1K8G A;  4DR7 Q;  4FDB A;  3G4S A;  2WP8 J;  2IHF A;  5GAE C;  2ZJR A;  4EX5 A;  4IOA A;  4YCU A;  1IBK L;  3HOZ G;  3HOX G;  3MXN B;  5ELO A;  4R1J A;  5GRO A;  3TRE A;  2VUM G;  2K4K A;  1VQO A;  1OTC A;  1U5K A;  4A3K H;  2YU9 H;  1HZA A;  4LWC A;  1S40 A;  4K0K L;  4AIM A;  1KQS A;  1HNZ L;  1Q86 C;  4X65 Q;  3GTQ H;  3CPW A;  1Y1W H;  4BXX G;  4A3J G;  1XNR Q;  4DUY L;  4YWL A;  4DR6 Q;  4DR4 L;  1Q46 A;  2IHE A;  3A0J A;  2OTL A;  4JI6 Q;  3S14 H;  2Q2I A;  1VQ6 A;  3UDI A;  3GTM H;  5C0X G;  2JA5 G;  3PO3 G;  1VCI A;  1KRS A;  3HKZ G;  2MNA A;  5LMU Q;  2RHS B;  4HIM A;  4A3I H;  1N36 L;  4LF7 Q;  2PI2 A;  1YI2 A;  1XMO L;  4L5R C;  2E5L L;  1R9T H;  3UE1 A;  3I4N G;  3HFZ B;  3ULP A;  4KLK A;  4LF4 L;  3RR5 A;  3PIO A;  4IPC A;  1PV4 A;  2EXD A;  3CQZ H;  3PUX A;  4PG3 A;  1IBL L;  5GQO A;  3CXC A;  1LYL A;  4PZ7 A;  4A3L H;  2K52 A;  3KF8 B;  2JQO A;  2N8N A;  3CCQ A;  3G48 A;  4BBR G;  2VQE Q;  1Y1V G;  1TWF H;  3PUY A;  4A3C G;  3KDF A;  5IYC H;  4BBS H;  5LMN W;  1N33 Q;  3KLW A;  4KHP Q;  2AMC B;  1YHA A;  1WYD A;  2ZJP A;  3RN5 A;  1XPU A;  4GN3 B;  1MKH A;  4IFD G;  5BR8 L;  4UP8 A;  4JOI A;  3S15 H;  3S2D H;  1LM0 A;  4JI5 Q;  1G51 A;  1P8L A;  3HKZ E;  4R4Q A;  4A3M G;  4DK3 C;  4NB3 A;  4LF9 Q;  3CMA A;  1L1O A;  2UUA Q;  3A74 A;  4X65 L;  4OO1 G;  2BH8 A;  3EBE A;  4JG2 A;  2BA1 A;  4GN4 B;  2WFW A;  3U4V A;  1Q12 A;  3BZK A;  4DR6 L;  1VQI A;  1PYS B;  3STB D;  3D31 A;  5FLM H;  4A3G G;  2UUC L;  4B3M L;  1IBM L;  4JBJ A;  3CCS A;  5K36 G;  1EQR A;  2E2I H;  4X62 L;  3S1Q H;  4APV A;  4LF5 L;  1ASY A;  4A3F G;  2PQA B;  1A8V A;  1VQF A;  3W5O A;  4GNX A;  2D0O A;  1C0A A;  5EAY A;  2VW9 A;  4JI1 Q;  1XNQ Q;  3ULL A;  4GOP A;  2R92 H;  4RMF A;  1Y1W G;  4R4C A;  2LSS A;  2JK8 A;  2ZTD A;  4YWK A;  4WJ3 M;  2CCZ A;  2JA6 H;  2HIX A;  3H3V H;  1K83 H;  2UUB L;  4LUO A;  4MTN A;  2NN6 G;  4PMW A;  5JJL A;  3KJP A;  3ER0 A;  4A76 A;  1G29 1;  1N34 Q;  4JV5 Q;  4QIW E;  4JC0 A;  4PZ8 A;  3HOU G;  2KHJ A;  4A93 G;  4GLV B;  4JI5 L;  3KFU A;  3F2C A;  4B3R Q;  2QA4 A;  4OXP A;  4YCW A;  5IP7 H;  1HNW Q;  2MO1 A;  2DUD A;  4JI8 L;  1A62 A;  1CSQ A;  4NXN Q;  1UEB A;  1LUZ A;  3HKS A;  1OXT A;  5C4X H;  1HNX Q;  3HOY H;  3ULJ A;  2XGT A;  2HHH Q;  1VQG A;  2HT1 A;  1TWH H;  3CC2 A;  2K75 A;  1UE5 A;  1QVC A;  3B6Y A;  1CKM A;  3I56 A;  3T1H Q;  2WB1 E;  1E3P A;  1VQC A;  1VQE A;  1VQM A;  1WI5 A;  2UXD Q;  3FKI G;  2RHQ B;  4QGU A;  2Z6K A;  2GVB A;  3PIP A;  4QQB X;  1XNQ L;  4LF8 Q;  3AFQ A;  3I7F A;  2R93 G;  4X6A H;  4A3B H;  1IZ6 A;  4BA2 I;  3S2H H;  2JA7 G;  5C0X I;  1NTG A;  1V43 A;  1X3E A;  1UE1 A;  2IY5 B;  1TWC H;  2A19 A;  2Y0S G;  4JV5 L;  5IYB G;  3RZD H;  5JEA G;  2CKZ B;  1VQ4 A;  1JJ2 A;  1VQ9 A;  1XPO A;  2YTV A;  5IY0 A;  2R7F A;  1OXX K;  3I4M G;  2A8V A;  2ID0 A;  1PYB A;  1XMQ L;  4B3R L;  4YWM A;  4B3T L;  3W1B A;  1HNZ Q;  3PSI A;  4GLA C;  1JJG A;  4A3D H;  2JA6 G;  4DR1 L;  4IFD J;  1T9H A;  1Q81 C;  1CKO A;  4QY7 A;  3TS0 A;  2H5X A;  2ALY B;  1KC8 C;  4DR4 Q;  4LFC Q;  4GS3 A;  4L5T A;  1TWG H;  3J81 i;  1FL0 A;  1PH6 A;  4R4O A;  2Z0S A;  3AFP A;  1K3R A;  1VQ8 A;  4IFD I;  3EIV A;  1XMO Q;  1VQD A;  2E5L Q;  3E9I A;  4DUZ Q;  3J7A 5;  2JEA I;  3CCE A;  2WAQ G;  1KXL A;  4IPH A;  1X6O A;  4LF4 Q;  2OCE A;  3KF6 B;  2JA8 H;  4OO1 I;  1IBL Q;  2ZM6 L;  2E8G A;  3GTK H;  3HOY G;  2EQS A;  2KEN A;  2I5M X;  1H95 A;  1KRT A;  1NJI C;  4JI0 Q;  3KJO A;  1P16 A;  2YV5 A;  3TS2 A;  1C9O A;  3JAM i;  3K7U C;  1VQL A;  1QVF A;  1D8L A;  4HIK A;  2YTY A;  3S1M H;  5BR8 Q;  1IXR A;  4EQ5 A;  2B29 A;  1I50 H;  1G6P A;  1VQJ A;  1EQQ A;  3CCJ A;  4Y52 H;  5HGQ A;  4XTC S;  4C2M H;  2WAQ E;  2AHO B;  2NN6 I;  3K81 C;  4L5Q A;  2OQK A;  2EIF A;  2DGY A;  4JBW A;  3J7Z C;  3G71 A;  3H0G G;  3PV0 A;  4LFC L;  5IYD H;  1PH8 A;  3RN2 A;  3J81 j;  2UUC Q;  1X56 A;  1X3F A;  4J15 A;  1IBM Q;  4B3M Q;  4X64 Q;  1YNX A;  4C3J H;  4X62 Q;  2UU9 Q;  4LF5 Q;  4DUZ L;  1PH2 A;  3KF6 A;  1WCM H;  4A3D G;  5HY6 A;  2R6G A;  3PUZ A;  4MZ9 A;  1HZ9 A;  4UPA A;  2R7Z H;  3GD7 A;  4DV5 L;  2UUB Q;  4KHZ A;  3PGZ A;  1SFO H;  4JI0 L;  2UXC Q;  2IX0 A;  3F2D A;  1EIY B;  4BA1 I;  2NZO A;  5FLX c;  5M5W H;  3FHW A;  5GAD C;  3U58 A;  3UE0 A;  1NMF A;  3TQY A;  2LXK A;  1SMX A;  2RCN A;  3IRB A;  2VQF L;  4LNQ A;  4YHH L;  2IX1 A;  2GVA A;  3D0F A;  2ASB A;  4DR5 L;  4JI8 Q;  1N32 L;  5M3F H;  1E1O A;  5JEA J;  2A1A A;  3T1Y L;  2NVQ H;  4WJ4 A;  4JOI C;  1MJC A;  1B70 B;  3UDX A;  4JI7 L;  3H15 A;  4KI0 A;  4P73 A;  2D0P A;  3PUW A;  4B3S L;  4O0A A;  1L1O C;  1K0R A;  1Q82 C;  4MNO A;  2K5V A;  2FXQ A;  1K73 C;  4X64 L;  1PHJ A;  1VQB A;  2F3I A;  3NEL A;  4Y7N H;  4R4I A;  3RNU A;  2UU9 L;  1Q1E A;  2OWO A;  3J80 i;  4A3K G;  4ME3 A;  1S3O A;  3TRZ A;  4GN5 A;  4DV2 Q;  4BY1 H;  2CQO A;  3CF5 A;  2UXB Q;  1JT8 A;  3JC6 6;  2K50 A;  4DV3 Q;  2LXJ A;  2IT1 A;  1FGU A;  4NPS A;  4GNX C;  2NVX H;  4NXM L;  2BH2 A;  3OW2 A;  1HR0 W;  3S16 H;  1IL2 A;  3M3Y H;  4A3E H;  2XTI A;  4GOP C;  2WB1 G;  2UXC L;  1EIF A;  3CME A;  1XJV A;  4A3I G;  4HIO A;  1YHQ A;  3S1N H;  3DM3 A;  1KL9 A;  3CCU A;  3NEN A;  2Q2U A;  1PH1 A;  1XMQ Q;  4DAY B;  1NMG A;  4P71 A;  2ZJQ A;  2MFI A;  3CW2 C;  4B3T Q;  4OX9 L;  2GN5 A;  2E2J H;  5FJ8 H;  1B7Y B;  1QUQ B;  4P74 A;  3PF5 A;  4RG1 A;  4DR1 Q;  3ICE A;  1W3S A;  5M3M H;  2PMZ E;  1EWI A;  3G6E A;  1SN8 A;  4GLX A;  4AQY Q;  3PUV A;  4A3L G;  5C44 H;  5M5Y H;  4DR2 L;  5IYC G;  4BBS G;  3OTO Q;  1KAW A;  2N78 A;  1EUJ A;  2B63 H;  3HOV H;  3RLF A;  2AKW B;  1X54 A;  2PQA A;  2KCM A;  5C3E H;  1JE5 A;  4BY7 H;  1D7Q A;  1WOC A;  4DV2 L;  1N8R C;  2N3S A;  4QL5 A;  2UXB L;  2KBN A;  2ZM6 Q;  1M90 C;  1L2F A;  4TVA B;  2F4V L;  1GO3 E;  5H1S E;  4DV3 L;  3M4O H;  2VY3 A;  1DGS A;  4LFB L;  4A75 A;  1HJP A;  2Z6K C;  1M1K C;  1CKN B;  1FJG L;  5FLM G;  3M9B A;  3CCV A;  4PZ6 A;  2AWN A;  2YTX A;  1EOV A; 
#chains in the Genus database with same CATH topology
 4CJ2 C;  4C2M B;  1AW7 A;  3KYH C;  5I2X A;  2F0T A;  3HOX H;  4UHV A;  2R92 G;  5CC4 A;  3GTM B;  1SNP A;  2JEB I;  4C3J B;  3NP8 A;  2FIN B;  4FXD A;  4J1M A;  2EYO A;  4HJ5 A;  4KN4 C;  1TY2 A;  2PZU A;  2Q2T A;  1UE6 A;  1YZ6 A;  4OWW B;  2R7Z B;  1DZ1 A;  1SFO B;  2F0U A;  2JA5 H;  1TS5 A;  2KEE A;  4IPG A;  1SLJ A;  5M3M G;  4UP7 A;  5M5W B;  3T53 B;  2F3W A;  3OW7 A;  1AZP A;  3VR6 A;  1ENC A;  3E9H A;  5M3F B;  4RCO A;  2E75 C;  4DK6 C;  2E74 C;  1Y1V H;  5C3E G;  5DLQ E;  1SE8 A;  4DV7 L;  3HOW H;  3K57 A;  5ELN A;  1STH A;  3I4L A;  4NMZ A;  4JI7 Q;  1LTG D;  1QNU A;  2NWG A;  1H9K A;  1I5F A;  2OTJ A;  3NQI A;  1STA A;  1STE A;  2JE6 I;  1FNU A;  4RGN A;  3KDF B;  1Q90 A;  3S16 B;  1O80 A;  4IAL A;  2VS1 A;  4JI2 L;  2DN8 A;  3X3M A;  3S1N B;  2VXW A;  4NXM Q;  2L11 A;  3ERO A;  3SHL A;  1M4V A;  1K8M A;  2RSO A;  3ITP A;  2BA0 A;  3Q23 A;  2NN6 H;  3K8A A;  3PO2 G;  4QMG A;  3HOU H;  4HJA A;  3T51 B;  4DKA C;  3I72 A;  5IP9 G;  5COY A;  5D14 A;  3BYT B;  4DR7 L;  2SEB D;  2AWO A;  3OMG A;  3RLN A;  1B8A A;  3M4O B;  3ND9 A;  4A3B B;  4DAV A;  1JR0 D;  2EYF A;  2NVY H;  2XWJ B;  1TWC B;  3BJU A;  3H3V I;  1GOZ A;  4FNF A;  4ZRZ A;  1SYF A;  1J5E L;  1C4Q A;  1XPR A;  3HOZ B;  1BCP B;  3W1G A;  1CI3 M;  4C3J G;  3AB9 A;  1VQN A;  4JI6 L;  3K5M A;  4EQP A;  4LF7 L;  3BVM A;  3BZC A;  3NEM A;  1IHZ A;  4HJ9 A;  1UEA B;  2R7Z G;  1W2B A;  1Z7T A;  5DEH A;  1JB3 A;  3Q22 A;  1BKB A;  5CR3 A;  1PH9 A;  2JA8 B;  1EYC A;  4B08 A;  1ZXT A;  2RDH A;  3NXW A;  4G7Z C;  1Q8I A;  1VQA A;  1VQ7 A;  1Q1B A;  5M3F G;  2CWP A;  3SGI A;  1SNQ A;  1KIX A;  2ZXP A;  5BN3 A;  3E0J A;  4LF9 L;  1X3G A;  1X65 A;  3J7A V;  1F2M A;  2NZH A;  3AEV A;  1WTW A;  2MHV A;  4FXK C;  5IT9 L;  3GTG B;  5CMD A;  3A8I E;  2I5L X;  1JWM D;  4DV7 Q;  2YYZ A;  1A2T A;  1KDB A;  2D62 A;  1ILP A;  4JI1 L;  4C3I H;  5C0X J;  4A3G B;  2B8F A;  1TQO A;  3IL8 A;  1JOR A;  1YJN A;  5BN4 A;  3VYS A;  4HMJ A;  1HH2 P;  5FJ8 G;  1XTC D;  3CC4 A;  1E7Z A;  1KTK A;  2K7V A;  1Q3L A;  3Q8D A;  4AYB E;  4X3K A;  4IUQ A;  5FO9 B;  3GTJ H;  1AFP A;  1PFM A;  5IGF A;  1QG7 A;  1EFW A;  4IJL A;  1HNX L;  1EY5 A;  2EYL A;  4HMI A;  2K14 A;  1JE4 A;  2B2T C;  4L5S A;  3OYY A;  1FYC A;  3QB3 A;  4H02 A;  5M9O A;  4E6I A;  5IT9 E;  2HIV A;  1YJ9 A;  1JB7 A;  2IL8 A;  2BCO A;  2PNH A;  4JBK A;  4DR7 Q;  1K8G A;  3RUZ A;  3TP8 A;  3J7Y W;  1BNZ A;  2IHF A;  4NDX A;  5GAE C;  4IOA A;  5ELD A;  3HOZ G;  4LMQ D;  5I4D A;  3MXN B;  1SXT A;  2VUM G;  5K36 H;  5FLX L;  1VQO A;  4C3H G;  2KCN A;  2EYM A;  4A3K H;  2R93 B;  4LWC A;  5CV4 A;  4DNR B;  4H13 C;  4TKO B;  4ZCK A;  2Y0S B;  1Y8O B;  4DUY L;  4LK1 C;  2NYZ D;  2BE5 C;  3S1R B;  4JI6 Q;  2IHE A;  3A0J A;  2OXP A;  4MN3 A;  3S14 H;  1R4Q B;  3C1E A;  3GTM H;  3VR3 A;  4Q0F A;  4UDU C;  2SDF A;  4LF7 Q;  2WV6 D;  2RHS B;  1U4R A;  1WTX A;  5C4J B;  3VYU A;  1PV4 A;  4IPC A;  4PG3 A;  5GQO A;  4A3L H;  2K52 A;  3CCQ A;  3H91 A;  2X69 A;  5NUC A;  1PZI D;  5E4W C;  2ZJP A;  2AQ3 B;  1XPU A;  3GTL B;  4IFD G;  5EBC A;  4JI5 Q;  1PRT F;  3HKZ E;  4A3M G;  5FLX E;  4LF9 Q;  1L1O A;  4X65 L;  4F8M A;  1GUG A;  1F9R A;  4GN4 B;  1Q12 A;  1DOK A;  1SE2 A;  2R3Z A;  3STB D;  2EJF C;  5FLM H;  4A3G G;  2UUC L;  3KUP A;  4B3M L;  4JBJ A;  2EE1 A;  2E2I H;  4APV A;  2PQA B;  4GNX A;  3GTP B;  2QDB A;  1C0A A;  1F9S A;  3H0G B;  2VW9 A;  4O42 A;  4JI1 Q;  4GOP A;  4RMF A;  1WD1 A;  2JA6 H;  2HIX A;  1K83 H;  4FP5 D;  2KJX A;  3ER0 A;  1G29 1;  4ODG A;  4G7H C;  4QIW E;  4JC0 A;  3BDL A;  2XNA C;  4C56 C;  4BBR B;  2DUD A;  2M2L A;  3RZO B;  1STY A;  1HNX Q;  5C4X H;  4N9T A;  1U4M A;  2GA4 B;  2ZT9 C;  2DNE A;  1BCP F;  3GTO B;  1W6K A;  1SYD A;  2WB1 E;  1E3P A;  1VQM A;  1L0X B;  4DA2 A;  4I7Z C;  3HRZ C;  1B3Q A;  4XDX A;  3AFQ A;  2R93 G;  4OHJ A;  1EWC A;  4A3B H;  2YU9 B;  2JA7 G;  1X3E A;  1SNC A;  2IY5 B;  3DXJ C;  1L0Y B;  1TWC H;  5J1Z A;  2Y0S G;  1PZJ D;  4JV5 L;  1KLU D;  2A6H C;  4CKB A;  2CKZ B;  1XPO A;  5IY0 A;  5EKI A;  2R7F A;  1OXX K;  1ZKO A;  4RKL A;  5AFW A;  5EPK A;  1GJX A;  4JPB W;  1XMQ L;  1UNS A;  4B3R L;  4B3T L;  1ET9 A;  3R93 A;  2H4O A;  1CKO A;  3X3N A;  3TS0 A;  2BOS A;  3NTI A;  1HUN A;  4R4O A;  3DMU A;  4KKS A;  1F9Q A;  1K3R A;  1BOS A;  3EIV A;  2KOL A;  3TZD A;  1EEI D;  2JEA I;  1GUS A;  3J81 L;  2K33 A;  1X6O A;  2JA8 H;  2KUM A;  4ILW A;  5G3L D;  3S15 B;  1KRT A;  1MD2 D;  2O5J C;  1C9O A;  3N6R A;  2H1E A;  1EWH A;  1VQL A;  1D8L A;  4HIK A;  1QVF A;  2K6A A;  2B29 A;  4OEM B;  1BF4 A;  1A6X A;  1CHQ D;  2ZXO A;  3CCJ A;  2F0N A;  4Y52 H;  3S1Q B;  4M1U B;  3NSW A;  2DGY A;  3BVZ A;  3H0G G;  5IYD H;  1JCK B;  3RN2 A;  5J39 A;  2UUC Q;  4B3M Q;  1HQM C;  4MIU A;  1ICW A;  2UU9 Q;  2AQ1 B;  3KF6 A;  1EY0 A;  1M8A A;  2ICE C;  3OIQ A;  1SNO A;  3J81 E;  4UPA A;  4DV5 L;  3SE0 A;  1FR3 A;  2VB3 X;  5E1F A;  1SYG A;  3F2D A;  1JWU D;  1MSH A;  3CKI B;  4YIJ A;  3FHW A;  5ELC A;  1SYB A;  2R61 A;  3TQY A;  2VQF L;  2IX1 A;  1CK1 A;  4LNQ A;  5EQ0 A;  5F2D A;  1N32 L;  2QEJ C;  5JEA J;  4R8I A;  1Y8P B;  2Q8I B;  5E4X A;  2AQ2 B;  2D0P A;  4B3S L;  2EY5 A;  1Q82 C;  1S5B D;  1K73 C;  1PHJ A;  2F1M A;  3NEL A;  1IW7 D;  1Q1E A;  2OWO A;  2A6E D;  3J80 i;  4HCS A;  2OEO A;  1S3O A;  2A73 B;  3S2H B;  5ELF A;  4BY1 H;  3MA2 B;  3CF5 A;  2UXB Q;  1S5C D;  1JT8 A;  4P2C B;  2JP1 A;  1FGU A;  3OW2 A;  3M3Y H;  1PLF A;  4K14 A;  3NEN A;  1XMQ Q;  1CZG A;  1NMG A;  3GV6 A;  2F0P A;  4B3T Q;  1TWG B;  2GN5 A;  3PF5 A;  2ENB A;  3URY A;  2PMZ E;  1SN8 A;  2P5Z X;  4KN7 C;  1BCP C;  2PO4 A;  1EQV A;  4B9X A;  2N78 A;  2B63 H;  1YNJ C;  2EXZ A;  1JE5 A;  4KJN A;  4BY7 H;  1D7Q A;  1N8R C;  4QL5 A;  2CH4 W;  3M7G A;  1M90 C;  3S1M B;  4IUV A;  4FF4 A;  1LT5 D;  1EZ8 A;  2Z6K C;  1CKN B;  1TR5 A;  3TS2 A;  2PW5 A;  4OEL B;  2DY7 A;  2AWN A;  4PZ6 A;  5IGG A;  2Z4I A;  4IOC A;  4DFA A;  3DWA A;  4DV4 L;  2B2V C;  2OQ0 A;  3LX0 A;  5C4Z A;  1H9R A;  1B53 A;  3CCL A;  4A3I B;  2A69 C;  5I9O A;  1V1P A;  3PF4 A;  2Q8R E;  1VQ5 A;  2C35 B;  1BDO A;  1WTV A;  3A5Z B;  3GTP H;  5CBA E;  2ES2 A;  1G8Z D;  3FEW X;  3S24 A;  5C0X H;  1CT1 D;  4KKU A;  5IGE A;  2HQL A;  2BDN A;  4KV6 A;  3IFD A;  2KCT A;  3D6W A;  3I4N H;  4DV5 Q;  2L4N A;  3EN2 A;  1EEF D;  3A5U A;  4DV1 Q;  2F0F A;  3VR5 A;  4IUR A;  2NBF A;  1YNN C;  4BBR H;  2F0M A;  3P75 A;  4GKJ L;  3K0Y A;  2VQF Q;  2CQA A;  1VDZ A;  1PH4 A;  1ASZ A;  1N32 Q;  4IUT A;  1CZW A;  5CV7 A;  5I6W A;  3BDO A;  4Y7N B;  4I7A A;  4B3S Q;  2QDL A;  2E76 C;  1PTO D;  4OWX B;  3LGJ A;  3LNN A;  1I4G A;  1WTH A;  2NTS A;  2CWA A;  3BYY B;  1PH5 A;  1E22 A;  4A3E B;  4DK0 A;  1RD9 D;  3F8T A;  1QZH A;  3RD4 A;  1DON A;  2X6G A;  2KHI A;  1U4P A;  4HTH A;  5LL6 S;  4HED A;  1ML0 D;  1L1O B;  3SR1 A;  1QOH A;  2EPB A;  1ENF A;  1RL2 A;  5FO8 B;  1B1Z A;  2MJ8 A;  4ZKC B;  2B2U A;  5M3M B;  1EIH A;  5C44 B;  5M5Y B;  2EYJ A;  4KY7 A;  3K58 A;  4X66 L;  5IOC A;  4A93 H;  1LTR D;  2PQE A;  3NK9 A;  1IL8 A;  4HJ8 A;  2K5H A;  1Z9F A;  4GNX B;  3KK7 A;  5C3E B;  3K0X A;  4GOP B;  1AE2 A;  5M5X H;  1SRO A;  3E3X A;  2LFN A;  2NTT A;  4ZUJ A;  1U0L A;  2A68 D;  3GO5 A;  3HOW G;  2Z9H A;  1GD7 A;  3H6M A;  3D8G A;  3QOL A;  1XNR L;  4OIJ A;  4P75 A;  4RGO S;  4DV4 Q;  2VNU D;  1D1K A;  4MHE A;  4KK7 A;  1QJO A;  5LMU L;  3LWE A;  3MXU A;  5IYB H;  4DXF A;  1YJW A;  2RBM A;  1O7I A;  2EZV A;  1BVS A;  3MFY A;  2NVT H;  1PVO A;  1E24 A;  4QUF A;  3PO2 B;  5EKL A;  2F0V A;  3NBH B;  1V1O A;  1VQK A;  4KHP L;  3A55 A;  3PQI A;  2EYH A;  1AH9 A;  3J80 c;  3DLL A;  2UUA L;  2K32 A;  1IKL A;  1C7Y A;  3ONA B;  4L8J A;  1HA6 A;  5C6A A;  5CV5 A;  4HCE A;  4DAY A;  2MQH A;  4GKJ Q;  2VL6 A;  2QEX A;  5GAH C;  2XN9 C;  1QUQ A;  4RFB A;  1SMY D;  2K01 A;  1AE3 A;  1DXM A;  3TZU A;  1RIP A;  1FVI A;  4XT1 B;  1I4R A;  1MIU A;  4A3E G;  1ZYR D;  2X6L A;  1SJE D;  2B2Y A;  4YCV A;  4A3J H;  3BU2 A;  1L0W A;  2TSS A;  4UP9 A;  3CCM A;  1O7Y A;  4A3F B;  3KBX A;  1N34 L;  1K3B C;  1NCV A;  1X3Q A;  3PO3 H;  3I4O A;  4IJH A;  1S72 A;  4KMU C;  3V2T A;  2K5N A;  2RQX A;  4K0K Q;  1HZB A;  5C44 G;  4ZKB B;  2VZA A;  3TME A;  4NXN L;  3LWU A;  1YBY A;  3H94 A;  4F87 A;  4R4T A;  5FO7 B;  4JBM A;  2JJQ A;  3ERQ A;  1AEX A;  2HHH L;  1H9S A;  5C3W A;  1A0I A;  2E2H B;  1JOK A;  4X66 Q;  1G6Z A;  5KNC A;  3T1H L;  3FPU B;  1CSP A;  1NBW A;  4HID A;  2Y0S E;  2MUY A;  4LF8 L;  1A2U A;  4U68 A;  2ZJR A;  5FK9 C;  1D5Z C;  1XXG A;  4DN4 M;  4YCU A;  5A2Q L;  3MXP A;  1WTP A;  3FKI B;  2JSO A;  1I3Q B;  5ELO A;  3NTH A;  2LKV A;  1AZQ A;  1U5K A;  4RH6 A;  1HZA A;  1KQS A;  1HNZ L;  1Y1W H;  4EQO A;  1XNR Q;  2CW0 C;  2E2J B;  1QIL A;  1WVL A;  2K5D A;  4DR6 Q;  3I4M B;  2KQ3 A;  5FOB B;  3I8Z A;  1VQ6 A;  3EA6 A;  1KRS A;  4A3I H;  2MNA A;  4DF7 A;  5LMU Q;  2PI2 A;  1YI2 A;  4KD4 A;  4LAA A;  1LT3 D;  4LF4 L;  3RR5 A;  2EXD A;  3CQZ H;  3CHB D;  3CXC A;  1LYL A;  3KF8 B;  3G48 A;  3PUY A;  1TWF H;  4BBS H;  1B2T A;  4S3S A;  2EJM A;  3KLW A;  4KHP Q;  5A35 A;  5A2Q E;  1LLR D;  2DY8 A;  4H7B A;  4IUU A;  1PXU A;  4UP8 A;  3S2D H;  1JC7 A;  4Q5V A;  1P8L A;  4R4Q A;  4NB3 A;  3K7A B;  2UUA Q;  3A74 A;  5EBD A;  5I2Y A;  2VUM B;  3EBE A;  2BA1 A;  4WRD A;  4C3H B;  1VQI A;  1PYS B;  5IIF A;  4XYQ A;  3OSO A;  4ID6 A;  2L55 A;  5K36 G;  1EQR A;  3DEO A;  1LV9 A;  3NE5 B;  4X62 L;  5JEA H;  4MTK A;  4LF5 L;  1ASY A;  4A3F G;  1A8V A;  1VQF A;  3W5O A;  3WDN A;  5EAY A;  1XNQ Q;  2R92 H;  5IOD A;  2LSS A;  4YWK A;  4WJ3 M;  4FO2 A;  5K5P A;  2UUB L;  1SDF A;  4PMW A;  4ZLT F;  5JJL A;  4F88 A;  5KYI A;  3KJP A;  1N34 Q;  1ZYR C;  2KHJ A;  1D5X C;  5JJZ A;  4GLV B;  4JI5 L;  3KFU A;  2QA4 A;  4OXP A;  1CSQ A;  4NXN Q;  2G5D A;  1I4Q A;  1OXT A;  4XXE A;  3HOY H;  1B44 D;  3ULJ A;  3K59 A;  1V1P B;  2HHH Q;  3T13 A;  4A3M B;  1CA5 A;  1QWY A;  4CKE A;  3CC2 A;  1QVC A;  3B6Y A;  3T1H Q;  1CTM A;  3I56 A;  3NBI A;  3S9W A;  3FKI G;  3QOJ A;  3V96 A;  2EVB A;  4LF8 Q;  2F03 A;  1NR2 A;  4X6A H;  2J0T D;  1IZ6 A;  4DNT B;  2F0E A;  1ILQ A;  3NUC A;  1E2W A;  4N9P A;  1VQ9 A;  4FYD A;  3I4M G;  1BUV T;  1TWA B;  2ID0 A;  4IZ8 A;  2L9H A;  1HNZ Q;  4GLA C;  4A3D H;  3O13 A;  2JA6 G;  1DJR D;  1Q81 C;  3E5S A;  4QY7 A;  2H5X A;  4GS3 A;  2QF7 A;  3J81 i;  2Z0S A;  3GP7 A;  1II3 A;  1S5F D;  4DUZ Q;  3J7A 5;  3CCE A;  2WAQ G;  3S17 B;  2K28 A;  4LF4 Q;  3DUZ A;  1CFM A;  2E8G A;  2B2T A;  2EQS A;  2I5M X;  1JOQ A;  4FF2 A;  4JI0 Q;  1NJI C;  2XIW A;  1TVX A;  2N55 A;  3MVV A;  1GUO A;  2YTY A;  1SYC A;  1G2T A;  4EQ5 A;  1LTI D;  5C4H A;  1I50 H;  3KLS X;  3JAM L;  1EQQ A;  2O5I C;  2FHT A;  2JA7 B;  1STB A;  5HGQ A;  4C2M H;  1TS4 A;  2AHO B;  2NN6 I;  2PPB C;  3J7Z C;  2IX3 A;  2F0L A;  1PH8 A;  4WJW A;  4J15 A;  2F0K A;  4X64 Q;  1YNX A;  4C3J H;  4X62 Q;  4PMB A;  4LF5 Q;  1EL0 A;  5HGT A;  4NP5 A;  3A7A B;  3TDQ A;  4OIK A;  2R7Z H;  2O2L D;  3GD7 A;  3QJY A;  2UUB Q;  4KHZ A;  4EVO A;  1SFO H;  1X32 A;  4KKT A;  2RSN A;  4BWG B;  2OF1 A;  1GUW A;  1HCZ A;  2G9D A;  3SK8 A;  5M5W H;  5FLX c;  5GAD C;  1EZ6 A;  2FJ2 A;  2QKI C;  1HPC A;  1NMF A;  4V0B A;  2LXK A;  1SMX A;  2EOT A;  3IRB A;  2J7Z A;  2PNR C;  4LJZ C;  2ASB A;  5M3F H;  1E1O A;  1SNM A;  1TWH B;  4KHV A;  3JAM E;  1B70 B;  1KNE A;  3UDX A;  3H15 A;  4P73 A;  3PUW A;  1J8I A;  4O0A A;  1L1O C;  1EYD A;  4TRD A;  4MNO A;  2FXQ A;  2F3I A;  2UU9 L;  3MWY W;  1C8C A;  1RKN A;  2B39 A;  3RZD B;  4DV3 Q;  1G91 A;  4NPS A;  4GNX C;  1JOO A;  3S16 H;  3V05 A;  1MBY A;  1IL2 A;  2XTI A;  4GOP C;  2PYK A;  3EQL C;  1EIF A;  3CME A;  3S1N H;  1IKM A;  4DAY B;  3W3A A;  2E2J H;  5FJ8 H;  1QUQ B;  1LAB A;  3HEJ A;  4AQY Q;  4K6L A;  4DR2 L;  5IYC G;  3OTO Q;  3TP5 A;  1PRT D;  2AKW B;  1X54 A;  2KCM A;  3GTK B;  3QO2 A;  1PTO B;  2F0Q A;  1D1I A;  2N3S A;  2UXB L;  3MTS A;  3I3C A;  1L2F A;  1HUM A;  4TVA B;  2F4V L;  1K0S A;  1GO3 E;  1EFI D;  1HTP A;  3M4O H;  2HQE A;  1X3P A;  1SE3 A;  1SYE A;  3DEP A;  3K5N A;  2CHB D;  3M9B A;  1I94 L;  3G4S A;  3GTQ B;  1B9N A;  1EY9 A;  1B9M A;  5LMN Q;  1DOL A;  4GKK L;  3T16 A;  5G3L F;  3HOZ H;  2XRQ D;  4PNY A;  1H9S B;  1GKH A;  4OWT B;  1GXD C;  2VUM H;  3ERS X;  4QJF A;  5JJI A;  5T1G A;  5CYU A;  3M4Q A;  4UY8 C;  1V9P A;  1S5D D;  2RDF A;  1MHW C;  2F3V A;  1E1T A;  3SK4 A;  1WCM B;  3TEH B;  4ALP A;  4QUC A;  1MI2 A;  5KYL A;  1VF5 C;  2L12 A;  2DJG C;  2K5Q A;  2Q8T A;  5IP7 G;  2KVM A;  1S5E D;  5E7N A;  3SXH A;  4DXG A;  2B63 G;  1WJJ A;  3CC7 A;  4DV0 L;  1E2Z A;  2NVQ B;  4G57 A;  2DJF C;  2IJ0 A;  2JYO A;  3WWV A;  1BBU A;  4BY7 G;  2WIN B;  3R2I A;  1U9R A;  2QCP X;  3D4R A;  4DR3 L;  2RF4 A;  3GQB A;  3FMC A;  5IWA L;  3GTG H;  5J22 A;  2R7D A;  4A3M H;  3C46 A;  3ZYY X;  1V1Q A;  1T5E A;  1GVP A;  1RCV D;  1AN8 A;  3M85 A;  3FPP A;  1T5X D;  2NVX B;  5DM6 3;  4A3G H;  3M4Y A;  3EVQ A;  3J81 c;  3STB C;  1RTO A;  1O7L A;  1I4P A;  1RDP D;  4O2D A;  3PCO B;  3DHQ A;  4QF4 A;  3RLO A;  4XQN A;  3CPF A;  3SK5 A;  4DPG A;  2L1B A;  4DV1 L;  1JIC A;  5BN5 A;  1LTA D;  1TWA H;  4LF6 L;  1KAA A;  4KY5 A;  3SK6 A;  1O78 A;  1TXY A;  2ATW A;  2JA9 A;  5AJ3 Q;  4HR7 B;  1YIJ A;  5E3F A;  1R4P B;  2F0H A;  2SOB A;  4DR2 Q;  4RAU C;  5ELE A;  5JPN C;  2KED A;  1YEZ A;  3S17 H;  2ICI A;  3KOJ A;  4CBV A;  4JVZ A;  4FF1 A;  4JK1 C;  2F4V Q;  3G7L A;  4DNI A;  3GDE A;  1I94 Q;  2PW7 A;  5D3D A;  2R93 H;  5IGC A;  1CQF A;  4JI4 Q;  2EY6 A;  4GKK Q;  1V8Q A;  2RDG A;  4C1N K;  1XTD A;  2JA7 H;  2L15 A;  1JJC B;  1WCM G;  2F0W A;  2M00 A;  3S1R H;  3EFX D;  1BBW A;  4V19 0;  5JOB A;  3MFG A;  2BDO A;  5C4J H;  1TT2 A;  2B2W A;  3MHB A;  2I5H A;  1D6E C;  4POG A;  1KHI A;  1OXU A;  1EYG A;  2CVR A;  3SDZ A;  1Z6H A;  2WAC A;  4Z9C B;  4FVM A;  4OGQ C;  2HCI A;  4B9W A;  4POF A;  2N49 A;  3Q0A A;  1Y1V B;  2G9H D;  1TKW B;  1H9M A;  2HDL A;  2MP1 A;  3GTL H;  4LFA Q;  4DV0 Q;  4ZK9 B;  3HOW B;  4ZQ3 A;  3M4P A;  2CFM A;  5EGT A;  4AYB G;  1W6J A;  4TQU S;  1A63 A;  4DR3 Q;  1PFS A;  1KNA A;  1PH7 A;  5IWA Q;  2AUJ D;  2I0Q A;  1VQP A;  1WD0 A;  3E0E A;  1J6Q A;  4BXX H;  1EQT A;  5KND A;  1HFG A;  3BS1 A;  3H0G H;  1IBK Q;  1WFQ A;  1Y14 B;  4A4I A;  2F52 A;  1HHV A;  1JQY D;  1LTT D;  3MC0 B;  3OMC A;  2V1C C;  1B4O A;  3HOV G;  3HOU B;  4LF6 Q;  2Z8L A;  4A3C H;  2V4D A;  3RZO H;  5IGB A;  2KCC A;  1N36 Q;  5GAG C;  1EY8 A;  3D4D A;  4U67 3;  2UXD L;  1SR3 A;  2C9O A;  3GTO H;  4OO1 H;  4ZYS A;  2XRS D;  2NVY B;  4EX5 A;  4IN3 A;  4EGV A;  1RF2 D;  3HOX G;  4R1J A;  5GRO A;  1EY7 A;  3TRE A;  3HP3 A;  2FMM A;  4KD3 A;  1OTC A;  2F0S A;  2YU9 H;  1IW7 C;  4K0K L;  1S40 A;  1QNK A;  2A6E C;  3CRL C;  3GTQ H;  1Q86 C;  1K28 A;  4A3J G;  2JN4 A;  4YWL A;  5CV6 A;  1Q46 A;  2Q2I A;  3UDI A;  1SND A;  2JA5 G;  3PO3 G;  1VCI A;  3HKZ G;  2NB0 A;  2PZW A;  1XMO L;  1DYQ A;  3UE1 A;  2B2U C;  1BQQ T;  2D2C C;  3E6Z X;  1ZEQ X;  3HFZ B;  1PYW D;  1STG A;  3ULP A;  4KLK A;  2NZ1 D;  4L6T B;  5C3X A;  3PIO A;  3PUX A;  2K05 A;  2N8N A;  1Y1V G;  1NR4 A;  5LMN W;  4ME5 A;  2AMC B;  1YHA A;  2M9V A;  3RN5 A;  4GN3 B;  1MKH A;  4PMC A;  4JOI A;  3S15 H;  4DK3 C;  4K2L A;  3U4V A;  2WFW A;  4DR6 L;  3BZK A;  3D31 A;  3CCS A;  4RHR A;  3K5O A;  3VYR A;  3S1Q H;  1BR9 A;  4KY6 A;  5COR A;  1D5M C;  2DNC A;  4GZY C;  3ULL A;  2PZT A;  1Y1W G;  3NPP A;  2CCZ A;  2FFK B;  3QG1 A;  3H3V H;  4MTN A;  2NN6 G;  2QIL A;  5ELB A;  2RCF A;  2MPM A;  3GTJ B;  1H9J A;  1VMC A;  4PZ8 A;  3HOU G;  1FGB D;  4XQQ A;  1I6H B;  2LS0 1;  3F2C A;  2F0O A;  1J9O A;  3R3O A;  1KAB A;  1UUP A;  1A62 A;  3HKS A;  4DGZ A;  2K03 A;  3U9O A;  2E2D C;  4K5W A;  1NSN S;  2K75 A;  3BVG A;  1VQC A;  4XT3 B;  2UXD Q;  4R8N A;  1ESF A;  1HA5 A;  2RHQ B;  2GVB A;  4QGU A;  4QQB X;  1XNQ L;  4CDD C;  3I7F A;  4BA2 I;  3S2H H;  5C0X I;  1NTG A;  1V43 A;  2O4X A;  1NNX A;  2A19 A;  1MGS A;  2B2Y C;  5JEA G;  1VQ4 A;  1JJ2 A;  1S4Z A;  3WOF A;  5KIX A;  1LTB D;  1PTO C;  3CU7 A;  2SNS A;  5C5L A;  4RGM A;  3S14 B;  3W1B A;  1SJH D;  3NTK A;  3NHH A;  4IFD J;  1T9H A;  4LFC Q;  4L5T A;  1ICF B;  1TWG H;  2JXM B;  1FL0 A;  1PH6 A;  1VQ8 A;  3R2T A;  2OT2 A;  1RJT A;  1XMO Q;  1VQD A;  1KXL A;  4IPH A;  3MZ5 A;  2OCE A;  3KF6 B;  4OO1 I;  5KNB A;  3OIP A;  2ZM6 L;  1D2B A;  3HOY G;  2KEN A;  4H44 C;  1H95 A;  2CH4 A;  1P16 A;  1ROD A;  3JAM i;  5JVG 3;  3K7U C;  3S1M H;  1NAP A;  1B3A A;  1BBX C;  3TN2 A;  1DM0 B;  2EJG C;  4C3I G;  1A3U A;  3MEH A;  5CBE E;  4XTC S;  2A68 C;  2E2I B;  1TS2 A;  1DOM A;  2OQK A;  3G71 A;  1CM9 A;  1ET6 A;  3J81 j;  5L37 A;  1X3F A;  1WTR A;  3K5L A;  3I73 A;  1GUT A;  2XSC A;  2JA6 B;  1K83 B;  1PRT B;  4DUZ L;  4PQX A;  3TP6 A;  1DCZ A;  5C5M A;  1CHP D;  4A3D G;  5HY6 A;  2R6G A;  3HGB A;  4MZ9 A;  4RKB A;  3PGZ A;  4JI0 L;  2WAQ B;  2UXC Q;  2IX0 A;  2NZO A;  5C4X B;  3H3V C;  3UE0 A;  2PCF B;  3IFT A;  4YHH L;  2GVA A;  4DR5 L;  2Z4H A;  1SEB D;  3T1Y L;  1NUC A;  4KI0 A;  4X64 L;  4Y7N H;  2XVS A;  4A3K G;  2D9U A;  2VB2 X;  3TRZ A;  4GN5 A;  4H0L C;  4DV2 Q;  2A74 C;  2BE5 D;  3JC6 6;  1SMY C;  4I65 A;  2IT1 A;  2BH2 A;  1A3V A;  2F0D A;  4A3E H;  1EYA A;  1XJV A;  5CV8 A;  1K8O A;  3Q24 A;  2Q2U A;  1PH1 A;  4P71 A;  3KLR A;  3P20 A;  4OX9 L;  4RG1 A;  1W3S A;  5M3M H;  4A3L G;  1EWI A;  3G6E A;  5C44 H;  5M5Y H;  4FF3 A;  2B8G A;  1KAW A;  1EUJ A;  1LT6 D;  3L9A X;  5C3E H;  5JPM C;  1WOC A;  2KBN A;  2ZM6 Q;  4DV3 L;  2FMC A;  4LFB L;  4A75 A;  1FJG L;  4CDF C;  5FLM G;  1PFN A;  3CCV A;  4R9W A;  4CDE C;  1BXT A;  1Y69 U;  5EPL A;  4ZAI A;  3UDF A;  3D6C A;  1F77 A;  5J3B A;  3I55 A;  3U4Z A;  1LTL A;  3OWE B;  4AQY L;  4BS9 A;  1R9T B;  1HFN A;  1Z47 A;  4XYO A;  3NQT A;  5IT9 c;  4AH6 A;  3OTO L;  3CD6 A;  4CHT B;  4K5X A;  3CAM A;  1UE7 A;  3HG9 A;  4IUN A;  3PO2 H;  2PI2 E;  2SNM A;  1EY4 A;  4LUV A;  3G6J B;  4JI2 Q;  5C4X G;  4HJ7 A;  1C48 A;  2KHS A;  1CKN A;  1UWV A;  4LUZ A;  5IP9 H;  1F2L A;  1OXS C;  2WKC A;  1I6H H;  1PA6 A;  5LMN L;  2NUC A;  1I6V C;  2QGQ A;  2HCC A;  5IE8 A;  1GHJ A;  2ZTE A;  1IYJ B;  4YHH Q;  1IYV A;  1GM5 A;  4DR5 Q;  3BDC A;  1KD1 C;  3T1Y Q;  1F2Y A;  3SVM A;  4JCV E;  4A3B G;  3A54 A;  1LT4 D;  1A3T A;  2A6H D;  1K9M C;  4BY1 B;  4CKC A;  2K1B A;  1HTL D;  3OPO A;  4F7X A;  1MJE A;  3M3Y B;  1N9W A;  3TBI B;  1PH3 A;  1YVC A;  1K8A C;  4A3F H;  4QB4 A;  1YIT A;  1J5E Q;  3A8J E;  1WTO A;  4XIG S;  4HSV A;  4DV6 L;  4C1N I;  5T1I A;  3A56 A;  1HR0 L;  1X9N A;  1FNW A;  4JI3 L;  1VQH A;  1KDA A;  2JA8 G;  3JAM c;  4YY3 L;  4OX9 Q;  1HQR D;  2B63 B;  1QE6 A;  2I07 B;  4HSP A;  5KEE A;  1VMP A;  3K80 C;  2J4X A;  4BY7 B;  2E2H H;  3W2D A;  1Q7Y C;  5I6Y A;  1XX8 A;  4LW1 A;  2EY1 A;  3I90 A;  3VR2 A;  1MSG A;  1RTN A;  1EU4 A;  1AP0 A;  4TSS A;  3FKI H;  2ZTC A;  1I3Q H;  4LFB Q;  3KLS A;  5IYD G;  1FJG Q;  2LMC B;  3DM1 A;  3CCR A;  4IO9 A;  3UI2 A;  3A8K E;  5D3I B;  1YHB A;  4DK1 A;  3FRP B;  2IWH A;  1VF7 A;  4JYA L;  1FD7 D;  2MO0 A;  3M7N A;  3I4M H;  4EQN A;  5AJ3 L;  3F1Z A;  4DAM A;  3L0O A;  4P72 A;  3VDY A;  3MEF A;  1CUK A;  3I2Z A;  3AQQ A;  1EIG A;  2VQE L;  3I4N B;  2RVL A;  3F2B A;  1N33 L;  1NE3 A;  3MXG A;  4RWS C;  2EYP A;  3HZX A;  3AU7 A;  1HZC A;  2AUK A;  2LY7 A;  3FVQ A;  3L2P A;  4L63 B;  1OXV A;  1X55 A;  4OON A;  4DAP A;  3ZJY C;  4JI4 L;  4K2K A;  1QZG A;  4KJO A;  4WOR A;  1I4X A;  3K7A H;  4RCN A;  4BY1 G;  3UDG A;  3D4W A;  2F0J A;  3CRK C;  5JJK A;  4C3H H;  3U50 C;  1NY4 A;  1VS0 A;  1CA6 A;  1JMC A;  3MAQ A;  1U4L A;  4WFN 3;  5I9P A;  1QVG A;  3NBH A;  3NWT A;  1Q8K A;  3AYH B;  2B3G A;  3CP0 A;  3L7Z C;  3T4A C;  4IPD A;  3VA7 A;  4FXG C;  1ONL A;  1BCP D;  4ULL A;  3IAY A;  2IW3 A;  1HNW L;  1ENA A;  4DV6 Q;  1YNJ D;  1SRU A;  4DUY Q;  3BZD B;  4K8J A;  1HR0 Q;  4LFA L;  4A93 B;  2WKD A;  4JI3 Q;  4J8Q A;  3FDT A;  2Q2H A;  3HS0 C;  3QWN A;  4G7O C;  4YY3 Q;  5M5X B;  3OHX C;  4IFD H;  2Z1C A;  5JAV A;  3GV3 A;  3Q6S A;  4AYB B;  4ZUI A;  4FDB A;  2F0I A;  2WP8 J;  3BG3 A;  3H09 A;  3ND8 A;  1IBK L;  3A7L A;  1WTQ A;  2K4K A;  2A69 D;  3TP7 A;  2K04 A;  4AIM A;  4CDC C;  3N52 A;  4X65 Q;  3CPW A;  4X3S A;  4BXX G;  4PV1 C;  2KA7 A;  4DR4 L;  2K5W A;  4NW2 A;  4JW0 A;  2OTL A;  2NVT B;  5C0X G;  4HIM A;  4JYA Q;  1N36 L;  4IQZ A;  4NKL A;  2HD3 A;  2E5L L;  1R9T H;  4L5R C;  3HOV B;  3I4N G;  3D3R A;  5DM7 3;  1Y8N B;  1IBL L;  4G4K A;  5JVH 3;  1YNN D;  4PZ7 A;  2JQO A;  1TS3 A;  4BBR G;  1QB5 D;  3T56 B;  4CJ0 B;  2VQE Q;  4A3C G;  3KDF A;  5IYC H;  1N33 Q;  4K5V A;  1WYD A;  3F2U A;  5BR8 L;  1PRT C;  4UAI A;  1LM0 A;  1PFB A;  1G51 A;  4CJ1 B;  1RHP A;  2XWB B;  2L5T A;  3OOC A;  3CMA A;  1A15 A;  2MGS A;  4OO1 G;  3HOX B;  1ESR A;  3SEB A;  5FKA C;  2BH8 A;  4JG2 A;  3C2P A;  2D5D A;  3J7A F;  2A5H A;  1IBM L;  4HN7 A;  4A3J B;  4ABN A;  1EY6 A;  2D0O A;  2TMP A;  4R4C A;  2JK8 A;  2Z6B A;  2ZTD A;  3PO3 B;  3HKZ B;  2JA5 B;  3KF8 A;  4LUO A;  1LTS D;  4A76 A;  3KBG A;  4JV5 Q;  4N8F A;  2B2W C;  4A93 G;  1SBB B;  3OWF A;  3DWP A;  4J6H A;  4B3R Q;  1IYU A;  2ZXR A;  4YCW A;  5IP7 H;  1HNW Q;  2MO1 A;  1HXY D;  4JI8 L;  1UEB A;  1LUZ A;  1PDQ A;  3K6O A;  2XGT A;  4KTA A;  3RMH A;  1PZK D;  1GHK A;  2F4I A;  1VQG A;  3R8B A;  1FNV A;  2HT1 A;  1TWH H;  1UE5 A;  1CKM A;  3NWS A;  4K6D A;  1VQE A;  1WI5 A;  4QIW B;  3PIP A;  2Z6K A;  2C5C A;  3VR4 A;  3PIP 3;  1SAP A;  5EKK A;  3P1H A;  4X3T A;  2B2V A;  2EY2 A;  1UE1 A;  1DD2 A;  5IYB G;  3RZD H;  1Y1W B;  2L0C A;  2YTV A;  4RA8 A;  2A8V A;  1PYB A;  1CQV A;  4YWM A;  1PTO F;  2HUG A;  3PSI A;  2WB1 B;  1JJG A;  1TY0 A;  4DR1 L;  4RHS A;  1XYI A;  1KC8 C;  2ALY B;  3EJI A;  4DR4 Q;  1E0B A;  4RGT A;  3IKJ A;  1E2V A;  1QCB D;  3AFP A;  3CQZ B;  4IFD I;  2E5L Q;  3E9I A;  5KRU A;  4HAE A;  1TWF B;  3L3O C;  4OL7 A;  4BBS B;  5EJW A;  1IBL Q;  3GTK H;  5ISR A;  1PTO H;  2I46 A;  3S2D B;  3KJO A;  2YV5 A;  1SE4 A;  2F0G A;  2QW7 A;  5BR8 Q;  1IXR A;  3C1F A;  1G6P A;  1EU3 A;  1G2S A;  1VQJ A;  2EDG A;  2WII B;  3DWQ A;  5LHY 1;  2WAQ E;  1O7Z A;  3K81 C;  4L5Q A;  2EIF A;  4JBW A;  3PV0 A;  4LFC L;  1X56 A;  1IBM Q;  1B50 A;  1GUN A;  2R92 B;  3AMU A;  1HRJ A;  3PMF A;  1PMR A;  5IGD A;  2IPK D;  5LL6 X;  4XQJ A;  1PH2 A;  1WCM H;  3PUZ A;  4CGY B;  3VA5 A;  1HZ9 A;  3PIO 3;  4K8I A;  2RA4 A;  3MXN A;  5DNF A;  3TSS A;  1EIY B;  4BA1 I;  1TU2 B;  3U58 A;  3HOY B;  2RCN A;  1SSO A;  4O1N A;  5HUR A;  3D0F A;  1KDC A;  1STN A;  4JI8 Q;  2NVQ H;  2A1A A;  4WJ4 A;  4JOI C;  1LAC A;  4N8X 1;  1MJC A;  5DAU A;  4JI7 L;  1LO5 D;  2N88 A;  1EOT A;  1K0R A;  4C3I B;  2K5V A;  5CV9 A;  1TII D;  1VQB A;  3RNU A;  4R4I A;  4ME3 A;  2CQO A;  2CW0 D;  1OO9 B;  4DU9 A;  2K50 A;  2RKS A;  3J80 L;  2LXJ A;  4NXM L;  2KEC A;  2NVX H;  1F9P A;  1HR0 W;  1XWE A;  5CGK A;  2WB1 G;  2UXC L;  4A3I G;  4HIO A;  1YHQ A;  4A3D B;  3DM3 A;  1KL9 A;  3CCU A;  3I70 A;  2ZJQ A;  2MFI A;  3CW2 C;  1B7Y B;  1F2Z A;  4P74 A;  4IUP A;  4DR1 Q;  3ICE A;  5KGU A;  1BO0 A;  4GLX A;  3PUV A;  4BBS G;  3HOV H;  5TSS A;  3QIA A;  5EPJ A;  3RLF A;  2PQA A;  3C3L A;  4QCL A;  3P7J A;  5D65 A;  1KLG D;  1JWS D;  4DV2 L;  3VYT A;  3WOE A;  3QR8 A;  2PMZ B;  5H1S E;  2VY3 A;  4X3U A;  1DGS A;  1UAP A;  1HJP A;  4A3K B;  1M1K C;  1I50 B;  3J80 E;  1I4H A;  2HDM A;  3I91 A;  3FP9 A;  4M8A A;  2YTX A;  1EOV A;  3U9S A; 
#chains in the Genus database with same CATH homology
 4IOC A;  5LMN Q;  4GKK L;  3KYH C;  4DV4 L;  3HOZ H;  2OQ0 A;  3HOX H;  3UDF A;  1GKH A;  4OWT B;  5J3B A;  2VUM H;  3ERS X;  2R92 G;  4QJF A;  3I55 A;  3CCL A;  3U4Z A;  5JJI A;  1LTL A;  2JEB I;  3M4Q A;  4UY8 C;  1V9P A;  3PF4 A;  4AQY L;  1VQ5 A;  1Z47 A;  2C35 B;  5IT9 c;  4AH6 A;  3OTO L;  3CD6 A;  1E1T A;  3TEH B;  4ALP A;  3A5Z B;  4HJ5 A;  3GTP H;  3CAM A;  2ES2 A;  1I94 L;  4OWW B;  2Q2T A;  1UE7 A;  1UE6 A;  1YZ6 A;  3PO2 H;  2PI2 E;  3S24 A;  2JA5 H;  5IP7 G;  4LUV A;  4IPG A;  2HQL A;  4JI2 Q;  5C4X G;  1SLJ A;  4HJ7 A;  5M3M G;  2KCT A;  3I4N H;  4UP7 A;  5E7N A;  4DV5 Q;  1CKN A;  1UWV A;  4LUZ A;  5IP9 H;  3EN2 A;  3A5U A;  1OXS C;  4DV1 Q;  2B63 G;  1WJJ A;  3E9H A;  3CC7 A;  1I6H H;  4DV0 L;  1PA6 A;  5LMN L;  4DK6 C;  4BBR H;  1Y1V H;  3WWV A;  2QGQ A;  5DLQ E;  5C3E G;  1BBU A;  5IE8 A;  2ZTE A;  4BY7 G;  2VQF Q;  4GKJ L;  1IYJ B;  4YHH Q;  1PH4 A;  1SE8 A;  1ASZ A;  1GM5 A;  4DR3 L;  2RF4 A;  4DV7 L;  4DR5 Q;  1KD1 C;  1N32 Q;  3HOW H;  5IWA L;  5ELN A;  3T1Y Q;  3GTG H;  4JCV E;  2R7D A;  4A3M H;  4JI7 Q;  4A3B G;  1V1Q A;  4B3S Q;  1GVP A;  1K9M C;  1I5F A;  3M85 A;  2OTJ A;  4OWX B;  3LGJ A;  2JE6 I;  1MJE A;  2CWA A;  3KDF B;  4A3G H;  1PH5 A;  3J81 c;  3STB C;  1E22 A;  1N9W A;  4O2D A;  2VS1 A;  3F8T A;  1PH3 A;  1YVC A;  1K8A C;  4JI2 L;  4A3F H;  3PCO B;  1YIT A;  4NXM Q;  1QZH A;  1J5E Q;  3RLO A;  2KHI A;  3CPF A;  4DPG A;  4XIG S;  1L1O B;  4DV6 L;  4DV1 L;  1HR0 L;  1X9N A;  1TWA H;  2BA0 A;  1RL2 A;  4JI3 L;  2I0Q A;  4LF6 L;  3K8A A;  1VQH A;  3PO2 G;  4JYA Q;  1TXY A;  2JA8 G;  3JAM c;  2ATW A;  4YY3 L;  4X66 L;  4OX9 Q;  3HOU H;  4A93 H;  4HJA A;  2JA9 A;  4DKA C;  5AJ3 Q;  4HJ8 A;  2K5H A;  1Z9F A;  3K80 C;  5IP9 G;  4GNX B;  1YIJ A;  4DR7 L;  4DR2 Q;  3K0X A;  4GOP B;  2E2H H;  1AE2 A;  5M5X H;  1Q7Y C;  1SRO A;  2AWO A;  3RLN A;  1B8A A;  1YEZ A;  3S17 H;  4LW1 A;  3KOJ A;  1U0L A;  3GO5 A;  2NVY H;  3HOW G;  3BJU A;  3H3V I;  2F4V Q;  1GD7 A;  3FKI H;  2ZTC A;  1J5E L;  1I3Q H;  4LFB Q;  1XPR A;  4DNI A;  5IYD G;  1FJG Q;  3GDE A;  3W1G A;  4IO9 A;  3CCR A;  1I94 Q;  1XNR L;  3FP9 A;  4P75 A;  2R93 H;  4JI4 Q;  1YHB A;  1VQN A;  4JI6 L;  4GKK Q;  2VNU D;  4DV4 Q;  1XTD A;  2JA7 H;  2L15 A;  4LF7 L;  1JJC B;  4JYA L;  5LMU L;  3BZC A;  1WCM G;  5IYB H;  2MO0 A;  3NEM A;  1YJW A;  3M7N A;  3S1R H;  1O7I A;  4HJ9 A;  3I4M H;  2R7Z G;  5AJ3 L;  1BBW A;  1BVS A;  3F1Z A;  1W2B A;  2NVT H;  1PVO A;  4DAM A;  1E24 A;  3L0O A;  4P72 A;  3VDY A;  1BKB A;  3MEF A;  1CUK A;  3I2Z A;  5C4J H;  1PH9 A;  3AQQ A;  2I5H A;  3NBH B;  4POG A;  1KHI A;  1OXU A;  2VQE L;  1EYG A;  3F2B A;  1VQK A;  1N33 L;  1VQA A;  1NE3 A;  4KHP L;  1VQ7 A;  1Q1B A;  5M3F G;  1HZC A;  1AH9 A;  2CWP A;  3SGI A;  4POF A;  2N49 A;  1KIX A;  3J80 c;  3DLL A;  2UUA L;  3L2P A;  4LF9 L;  1X3G A;  1X65 A;  1C7Y A;  3GTL H;  4LFA Q;  1OXV A;  1X55 A;  4DV0 Q;  4OON A;  2NZH A;  3ZJY C;  4JI4 L;  3AEV A;  1QZG A;  3M4P A;  2CFM A;  2MQH A;  3K7A H;  4GKJ Q;  4AYB G;  2VL6 A;  2QEX A;  5GAH C;  4TQU S;  4BY1 G;  1A63 A;  1QUQ A;  3UDG A;  2I5L X;  4DR3 Q;  1PFS A;  4DV7 Q;  5JJK A;  2YYZ A;  1PH7 A;  4C3H H;  3U50 C;  5IWA Q;  1AE3 A;  2D62 A;  1NY4 A;  1FVI A;  1RIP A;  1VS0 A;  1VQP A;  3E0E A;  4JI1 L;  4C3I H;  5C0X J;  1MIU A;  1J6Q A;  4A3E G;  1JMC A;  4BXX H;  1QVG A;  4A3J H;  4YCV A;  3BU2 A;  1L0W A;  4UP9 A;  3CCM A;  3H0G H;  1IBK Q;  1Q8K A;  1YJN A;  3AYH B;  1N34 L;  2B3G A;  3CP0 A;  3PO3 H;  3L7Z C;  3I4O A;  1HH2 P;  5FJ8 G;  3CC4 A;  4IPD A;  1E7Z A;  1WFQ A;  1Y14 B;  4IJH A;  1S72 A;  3Q8D A;  4AYB E;  2K5N A;  4K0K Q;  4A4I A;  3GTJ H;  1HZB A;  5C44 G;  1HNW L;  2F52 A;  2VZA A;  4NXN L;  1EFW A;  4DV6 Q;  2V1C C;  1SRU A;  1YBY A;  4IJL A;  4DUY Q;  1HNX L;  3HOV G;  1HR0 Q;  4LFA L;  2K14 A;  4R4T A;  4JBM A;  2JJQ A;  4JI3 Q;  4LF6 Q;  4L5S A;  2HHH L;  3OYY A;  4H02 A;  4A3C H;  2Q2H A;  3RZO H;  1A0I A;  4YY3 Q;  4X66 Q;  1N36 Q;  5GAG C;  2HIV A;  3T1H L;  1YJ9 A;  1CSP A;  1NBW A;  4HID A;  2UXD L;  1SR3 A;  2Y0S E;  1JB7 A;  2PNH A;  4LF8 L;  4JBK A;  3GTO H;  1K8G A;  4DR7 Q;  4FDB A;  3G4S A;  2WP8 J;  2IHF A;  5GAE C;  2ZJR A;  4EX5 A;  4IOA A;  4YCU A;  1IBK L;  3HOZ G;  3HOX G;  3MXN B;  5ELO A;  4R1J A;  5GRO A;  3TRE A;  2VUM G;  2K4K A;  1VQO A;  1OTC A;  1U5K A;  4A3K H;  2YU9 H;  1HZA A;  4LWC A;  1S40 A;  4K0K L;  4AIM A;  1KQS A;  1HNZ L;  1Q86 C;  4X65 Q;  3GTQ H;  3CPW A;  1Y1W H;  4BXX G;  4A3J G;  1XNR Q;  4DUY L;  4YWL A;  4DR6 Q;  4DR4 L;  1Q46 A;  2IHE A;  3A0J A;  2OTL A;  4JI6 Q;  3S14 H;  2Q2I A;  1VQ6 A;  3UDI A;  3GTM H;  5C0X G;  2JA5 G;  3PO3 G;  1VCI A;  1KRS A;  3HKZ G;  2MNA A;  5LMU Q;  2RHS B;  4HIM A;  4A3I H;  1N36 L;  4LF7 Q;  2PI2 A;  1YI2 A;  1XMO L;  4L5R C;  2E5L L;  1R9T H;  3UE1 A;  3I4N G;  3HFZ B;  3ULP A;  4KLK A;  4LF4 L;  3RR5 A;  3PIO A;  4IPC A;  1PV4 A;  2EXD A;  3CQZ H;  3PUX A;  4PG3 A;  1IBL L;  5GQO A;  3CXC A;  1LYL A;  4PZ7 A;  4A3L H;  2K52 A;  3KF8 B;  2JQO A;  2N8N A;  3CCQ A;  3G48 A;  4BBR G;  2VQE Q;  1Y1V G;  1TWF H;  3PUY A;  4A3C G;  3KDF A;  5IYC H;  4BBS H;  5LMN W;  1N33 Q;  3KLW A;  4KHP Q;  2AMC B;  1YHA A;  1WYD A;  2ZJP A;  3RN5 A;  1XPU A;  4GN3 B;  1MKH A;  4IFD G;  5BR8 L;  4UP8 A;  4JOI A;  3S15 H;  3S2D H;  1LM0 A;  4JI5 Q;  1G51 A;  1P8L A;  3HKZ E;  4R4Q A;  4A3M G;  4DK3 C;  4NB3 A;  4LF9 Q;  3CMA A;  1L1O A;  2UUA Q;  3A74 A;  4X65 L;  4OO1 G;  2BH8 A;  3EBE A;  4JG2 A;  2BA1 A;  4GN4 B;  2WFW A;  3U4V A;  1Q12 A;  3BZK A;  4DR6 L;  1VQI A;  1PYS B;  3STB D;  3D31 A;  5FLM H;  4A3G G;  2UUC L;  4B3M L;  1IBM L;  4JBJ A;  3CCS A;  5K36 G;  1EQR A;  2E2I H;  4X62 L;  3S1Q H;  4APV A;  4LF5 L;  1ASY A;  4A3F G;  2PQA B;  1A8V A;  1VQF A;  3W5O A;  4GNX A;  2D0O A;  1C0A A;  5EAY A;  2VW9 A;  4JI1 Q;  1XNQ Q;  3ULL A;  4GOP A;  2R92 H;  4RMF A;  1Y1W G;  4R4C A;  2LSS A;  2JK8 A;  2ZTD A;  4YWK A;  4WJ3 M;  2CCZ A;  2JA6 H;  2HIX A;  3H3V H;  1K83 H;  2UUB L;  4LUO A;  4MTN A;  2NN6 G;  4PMW A;  5JJL A;  3KJP A;  3ER0 A;  4A76 A;  1G29 1;  1N34 Q;  4JV5 Q;  4QIW E;  4JC0 A;  4PZ8 A;  3HOU G;  2KHJ A;  4A93 G;  4GLV B;  4JI5 L;  3KFU A;  3F2C A;  4B3R Q;  2QA4 A;  4OXP A;  4YCW A;  5IP7 H;  1HNW Q;  2MO1 A;  2DUD A;  4JI8 L;  1A62 A;  1CSQ A;  4NXN Q;  1UEB A;  1LUZ A;  3HKS A;  1OXT A;  5C4X H;  1HNX Q;  3HOY H;  3ULJ A;  2XGT A;  2HHH Q;  1VQG A;  2HT1 A;  1TWH H;  3CC2 A;  2K75 A;  1UE5 A;  1QVC A;  3B6Y A;  1CKM A;  3I56 A;  3T1H Q;  2WB1 E;  1E3P A;  1VQC A;  1VQE A;  1VQM A;  1WI5 A;  2UXD Q;  3FKI G;  2RHQ B;  4QGU A;  2Z6K A;  2GVB A;  3PIP A;  4QQB X;  1XNQ L;  4LF8 Q;  3AFQ A;  3I7F A;  2R93 G;  4X6A H;  4A3B H;  1IZ6 A;  4BA2 I;  3S2H H;  2JA7 G;  5C0X I;  1NTG A;  1V43 A;  1X3E A;  1UE1 A;  2IY5 B;  1TWC H;  2A19 A;  2Y0S G;  4JV5 L;  5IYB G;  3RZD H;  5JEA G;  2CKZ B;  1VQ4 A;  1JJ2 A;  1VQ9 A;  1XPO A;  2YTV A;  5IY0 A;  2R7F A;  1OXX K;  3I4M G;  2A8V A;  2ID0 A;  1PYB A;  1XMQ L;  4B3R L;  4YWM A;  4B3T L;  3W1B A;  1HNZ Q;  3PSI A;  4GLA C;  1JJG A;  4A3D H;  2JA6 G;  4DR1 L;  4IFD J;  1T9H A;  1Q81 C;  1CKO A;  4QY7 A;  3TS0 A;  2H5X A;  2ALY B;  1KC8 C;  4DR4 Q;  4LFC Q;  4GS3 A;  4L5T A;  1TWG H;  3J81 i;  1FL0 A;  1PH6 A;  4R4O A;  2Z0S A;  3AFP A;  1K3R A;  1VQ8 A;  4IFD I;  3EIV A;  1XMO Q;  1VQD A;  2E5L Q;  3E9I A;  4DUZ Q;  3J7A 5;  2JEA I;  3CCE A;  2WAQ G;  1KXL A;  4IPH A;  1X6O A;  4LF4 Q;  2OCE A;  3KF6 B;  2JA8 H;  4OO1 I;  1IBL Q;  2ZM6 L;  2E8G A;  3GTK H;  3HOY G;  2EQS A;  2KEN A;  2I5M X;  1H95 A;  1KRT A;  1NJI C;  4JI0 Q;  3KJO A;  1P16 A;  2YV5 A;  3TS2 A;  1C9O A;  3JAM i;  3K7U C;  1VQL A;  1QVF A;  1D8L A;  4HIK A;  2YTY A;  3S1M H;  5BR8 Q;  1IXR A;  4EQ5 A;  2B29 A;  1I50 H;  1G6P A;  1VQJ A;  1EQQ A;  3CCJ A;  4Y52 H;  5HGQ A;  4XTC S;  4C2M H;  2WAQ E;  2AHO B;  2NN6 I;  3K81 C;  4L5Q A;  2OQK A;  2EIF A;  2DGY A;  4JBW A;  3J7Z C;  3G71 A;  3H0G G;  3PV0 A;  4LFC L;  5IYD H;  1PH8 A;  3RN2 A;  3J81 j;  2UUC Q;  1X56 A;  1X3F A;  4J15 A;  1IBM Q;  4B3M Q;  4X64 Q;  1YNX A;  4C3J H;  4X62 Q;  2UU9 Q;  4LF5 Q;  4DUZ L;  1PH2 A;  3KF6 A;  1WCM H;  4A3D G;  5HY6 A;  2R6G A;  3PUZ A;  4MZ9 A;  1HZ9 A;  4UPA A;  2R7Z H;  3GD7 A;  4DV5 L;  2UUB Q;  4KHZ A;  3PGZ A;  1SFO H;  4JI0 L;  2UXC Q;  2IX0 A;  3F2D A;  1EIY B;  4BA1 I;  2NZO A;  5FLX c;  5M5W H;  3FHW A;  5GAD C;  3U58 A;  3UE0 A;  1NMF A;  3TQY A;  2LXK A;  1SMX A;  2RCN A;  3IRB A;  2VQF L;  4LNQ A;  4YHH L;  2IX1 A;  2GVA A;  3D0F A;  2ASB A;  4DR5 L;  4JI8 Q;  1N32 L;  5M3F H;  1E1O A;  5JEA J;  2A1A A;  3T1Y L;  2NVQ H;  4WJ4 A;  4JOI C;  1MJC A;  1B70 B;  3UDX A;  4JI7 L;  3H15 A;  4KI0 A;  4P73 A;  2D0P A;  3PUW A;  4B3S L;  4O0A A;  1L1O C;  1K0R A;  1Q82 C;  4MNO A;  2K5V A;  2FXQ A;  1K73 C;  4X64 L;  1PHJ A;  1VQB A;  2F3I A;  3NEL A;  4Y7N H;  4R4I A;  3RNU A;  2UU9 L;  1Q1E A;  2OWO A;  3J80 i;  4A3K G;  4ME3 A;  1S3O A;  3TRZ A;  4GN5 A;  4DV2 Q;  4BY1 H;  2CQO A;  3CF5 A;  2UXB Q;  1JT8 A;  3JC6 6;  2K50 A;  4DV3 Q;  2LXJ A;  2IT1 A;  1FGU A;  4NPS A;  4GNX C;  2NVX H;  4NXM L;  2BH2 A;  3OW2 A;  1HR0 W;  3S16 H;  1IL2 A;  3M3Y H;  4A3E H;  2XTI A;  4GOP C;  2WB1 G;  2UXC L;  1EIF A;  3CME A;  1XJV A;  4A3I G;  4HIO A;  1YHQ A;  3S1N H;  3DM3 A;  1KL9 A;  3CCU A;  3NEN A;  2Q2U A;  1PH1 A;  1XMQ Q;  4DAY B;  1NMG A;  4P71 A;  2ZJQ A;  2MFI A;  3CW2 C;  4B3T Q;  4OX9 L;  2GN5 A;  2E2J H;  5FJ8 H;  1B7Y B;  1QUQ B;  4P74 A;  3PF5 A;  4RG1 A;  4DR1 Q;  3ICE A;  1W3S A;  5M3M H;  2PMZ E;  1EWI A;  3G6E A;  1SN8 A;  4GLX A;  4AQY Q;  3PUV A;  4A3L G;  5C44 H;  5M5Y H;  4DR2 L;  5IYC G;  4BBS G;  3OTO Q;  1KAW A;  2N78 A;  1EUJ A;  2B63 H;  3HOV H;  3RLF A;  2AKW B;  1X54 A;  2PQA A;  2KCM A;  5C3E H;  1JE5 A;  4BY7 H;  1D7Q A;  1WOC A;  4DV2 L;  1N8R C;  2N3S A;  4QL5 A;  2UXB L;  2KBN A;  2ZM6 Q;  1M90 C;  1L2F A;  4TVA B;  2F4V L;  1GO3 E;  5H1S E;  4DV3 L;  3M4O H;  2VY3 A;  1DGS A;  4LFB L;  4A75 A;  1HJP A;  2Z6K C;  1M1K C;  1CKN B;  1FJG L;  5FLM G;  3M9B A;  3CCV A;  4PZ6 A;  2AWN A;  2YTX A;  1EOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...