3E0EA

Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
91
Chain Sequence
MNYKISELMPNLSGTINAEVVTAYPKKEFSTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGGLEISVDNIGIIEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A
publication title Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
rcsb
source organism Methanococcus maripaludis
molecule tags Replication
total genus 22
structure length 91
sequence length 97
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3e0eA00
3S1RH 5JJLA 1N33Q 2VZAA 4QY7A 2DUDA 4BXXH 4A93H 2K5VA 4X65L 4AYBG 4LF8Q 1U0LA 4L5RC 4DNIA 3ICEA 2Y0SE 4NB3A 5AJ3L 1X3FA 4JG2A 1FJGL 2B63G 3W1BA 1LUZA 3ERSX 1CSQA 1W3SA 1HR0W 1N34L 1N36L 3PV0A 3CCSA 4HJ5A 1YZ6A 3M9BA 2VW9A 1DGSA 1XTDA 4RMFA 5JEAJ 1PH9A 4B3TQ 1B7YB 1CKMA 2BA1A 4DUYQ 3AQQA 1VQJA 2YV5A 1VQ9A 2UXBL 4LFBL 5C0XI 4JI2L 4A3JG 4X66L 1JB7A 1Q12A 2B29A 3J7ZC 3I4NG 3D0FA 3S16H 2EXDA 2WAQE 1C7YA 3UDFA 4DV7Q 2ZJRA 1RIPA 4GNXC 4IJHA 4YCUA 5IP9H 1EOVA 1JJ2A 5JJKA 1Y1VG 1X65A 2K14A 2QGQA 3KF6A 1Q46A 3RLFA 1GM5A 2AKWB 2ATWA 2UXDQ 4R4CA 4APVA 3GTOH 2K5HA 2KBNA 3K0XA 3I4OA 4JI8L 2MQHA 4KHZA 2NZHA 4LF8L 3KYHC 4NXMQ 2JA5G 5LMNL 3GTLH 2ASBA 2IX0A 4AQYQ 4DV6Q 1AE3A 3CC2A 5IP7G 1YNXA 3CQZH 3J81i 3DLLA 1KHIA 1XMQL 3PCOB 5BR8L 4B3TL 2UUBL 3NELA 1I6HH 1EIFA 5E7NA 1FGUA 2RF4A 4UY8C 1K0RA 1EYGA 1VQIA 3RN2A 2JA7G 3HOUG 2VNUD 3S1QH 5HY6A 4DR3Q 2ZJQA 3CCMA 3J7A5 3H15A 4JI0Q 1YHAA 4LUZA 3KF8B 1UE5A 4DV7L 3OW2A 4YWMA 3M7NA 1K8AC 2AMCB 1KQSA 4POGA 1NTGA 1C0AA 3GDEA 1ASZA 1VQDA 2QEXA 4L5TA 4DV5Q 4BY1G 1EQQA 1HJPA 4LW1A 1SMXA 1OXSC 4LFAQ 1I5FA 5HGQA 3G6EA 2CWPA 4A3MG 3CCLA 5M5WH 1PVOA 1J5EL 3RN5A 1UEBA 3TEHB 3E0EA 3U4ZA 3K80C 3PUVA 2I5MX 4HJAA 4AQYL 4DV6L 4BA2I 3GD7A 3M4QA 1V9PA 1Q82C 2JA9A 3A5ZB 3KLWA 1Q81C 4DR4L 2I5HA 1AH9A 4DK3C 1HZCA 1I50H 2IT1A 2BH8A 1W2BA 3S1NH 3CD6A 4IOAA 3K7UC 4QJFA 1YJ9A 5IT9c 4GKKL 3H0GG 4JI0L 5C0XG 2UUCQ 1SRUA 1SLJA 3VDYA 3TS0A 2N8NA 5GAGC 2ALYB 5IYDG 2AWOA 3PIPA 1VQ4A 1QZHA 1PHJA 1V1QA 4DR5L 3RLNA 5LMNW 2H5XA 4JI7Q 4MTNA 4LFAL 4WJ4A 1VQAA 5IWAQ 4A3FH 2ZTEA 3RR5A 1PH5A 4DR2L 2HHHQ 1VQFA 1KIXA 1QUQB 1CUKA 3BZCA 2Y0SG 1I3QH 2JA8H 4BBRG 1A8VA 2R7FA 1TWGH 1XPUA 2D0PA 4HIDA 1X56A 5JJIA 2PQAB 3AFPA 4GN4B 5M5YH 4MNOA 1YJNA 1PH4A 4GOPC 4A3KH 5C4JH 4LFCQ 4BXXG 4A93G 2A8VA 1Q8KA 2OWOA 1FL0A 1A63A 1SE8A 4DV2Q 3U4VA 3CPWA 2WAQG 3E9HA 4KLKA 3GTGH 3S15H 3HFZB 2KCMA 2Q2HA 1YHBA 1IBKL 3UDXA 2YTYA 4OWWB 3S2DH 3E9IA 4JI7L 4NXNQ 2IX1A 2LSSA 2PMZE 2AHOB 4P71A 3J81c 5GAHC 1A62A 4GLAC 4DV4L 1L0WA 4R4TA 4OONA 4JI3L 2ID0A 3CCRA 2JA6H 1CSPA 5IP9G 4JI6L 2YTXA 1PFSA 3CC7A 3F8TA 3T1YL 4B3MQ 3BU2A 1HZAA 4A3IH 1QUQA 1LTLA 1E22A 4HIKA 3G71A 4UP7A 1EUJA 2V1CC 1YVCA 4BY7G 2UU9Q 2VUMH 4LF7L 4JOIA 3RNUA 4A3EH 1R9TH 1X3GA 2ZTCA 4OX9Q 3M4OH 3EBEA 2Z6KA 3STBD 2PQAA 2BA0A 4XIGS 4DKAC 3CMAA 2GN5A 1IBLL 4TVAB 4A3BH 4YHHL 3I56A 3IRBA 1V43A 1E1TA 1KAWA 5C44H 4DV2L 1IBMQ 2RHSB 3PO3H 5C0XJ 2IHFA 4A4IA 2CCZA 4LF6Q 4JV5Q 4LWCA 1YEZA 4A76A 1VQ7A 1E3PA 1O7IA 4MZ9A 1PH1A 2I0QA 3G48A 3CMEA 4DR7L 2ES2A 4QQBX 2YYZA 1NBWA 3HOXH 2K75A 3GTKH 1L1OC 1Q1EA 3UDGA 5K36G 3F1ZA 5C4XH 3TREA 1N33L 4DV1Q 1EFWA 4EQ5A 2UXCQ 1WCMH 1TWFH 3PSIA 1VQ8A 4JI5Q 4IFDI 1I94Q 4A3GH 1EQRA 2UU9L 4OX9L 1NE3A 2Q2UA 4EX5A 1D8LA 5IYCH 3OTOQ 3K81C 3M3YH 4JCVE 1WOCA 1YIJA 1OXXK 4DUYL 2HIXA 4A75A 1HNZQ 1IBML 2NVXH 3AFQA 1BBUA 1OXTA 4LUVA 3U50C 3CXCA 1LM0A 1X9NA 3D31A 4LF6L 4JI1Q 4OO1I 4YWKA 4L5SA 2OQKA 1QVCA 2OQ0A 2ZTDA 4A3CH 4HJ9A 4OXPA 2NVTH 1XMOQ 3PGZA 3HOYH 1Q1BA 4YY3Q 2OTLA 3PF5A 2R7ZG 3PO2G 3PUXA 1KL9A 4AIMA 4DV0Q 1PA6A 4DV1L 3I4MH 2UXDL 2JEBI 4O0AA 1QVFA 4DR6Q 2UXCL 3CCEA 1N32Q 1SN8A 4JI5L 5LMUQ 3UE1A 1HNXQ 4NXML 2UUAQ 4GKJQ 1YHQA 1VQHA 1SR3A 4A3FG 3A0JA 4JI4Q 4JBMA 2AWNA 2N78A 4QIWE 3RLOA 1KRTA 5GADC 1GO3E 3JAMi 1OXVA 2CQOA 5FLMH 2JA8G 1KXLA 1JJCB 2YU9H 2NN6I 5J3BA 1HNZL 4GOPB 4YWLA 4HIOA 2R93H 1JJGA 3OYYA 2ZJPA 4A3DH 4JI1L 3B6YA 1GD7A 4DR3L 1HR0Q 4R4IA 4IO9A 1VQMA 4A3KG 2R7DA 2VQFQ 2WFWA 1BVSA 3J80i 3S2HH 1XMOL 3RZOH 3TRZA 2N3SA 2E2JH 4YY3L 4R4QA 2HQLA 3Q8DA 3W1GA 4DV5L 4DV0L 1Y14B 1VCIA 1VQCA 2PNHA 4IJLA 2HIVA 1VQNA 1K3RA 3M4PA 4DR6L 4BBSH 2K50A 2ZM6Q 1TWAH 3T1HQ 1Y1WH 2WB1E 4H02A 5LMUL 1Q86C 1N8RC 1C9OA 4QGUA 2UUAL 1IXRA 1T9HA 3ULLA 4UP8A 4JBWA 4PZ6A 3NBHB 4JI4L 4DR1Q 4KHPQ 2IHEA 3L2PA 1VQGA 1VQKA 2JA6G 4IFDG 1TXYA 4B3SQ 2JK8A 1VQ6A 4WJ3M 2VY3A 4A3IG 2MNAA 3GTJH 1ASYA 4PZ8A 4PG3A 4JBKA 4DAYB 1PYSB 1VQBA 5M5XH 4O2DA 3TS2A 1HZ9A 1UE6A 1B70B 4GOPA 4A3EG 2VUMG 2JJQA 1YITA 4IPDA 2GVAA 3WWVA 2Q2IA 4C3JH 2VQFL 2UUCL 1K73C 5M3FH 4OO1G 2A19A 3S14H 1D7QA 2VL6A 1FVIA 1K8GA 3CCJA 4A3BG 3EN2A 4LF4Q 2R6GA 1GKHA 5C44G 3F2BA 3PO3G 4A3LH 1MKHA 1RL2A 3HOWH 2PI2E 3UE0A 5GQOA 4GS3A 5IWAL 1L1OB 4GNXB 1XNQQ 4PMWA 2ZM6L 1WJJA 3G4SA 4DUZQ 2HHHL 4QL5A 1MJEA 2JEAI 4UPAA 2KHIA 2E2HH 4KHPL 1TWCH 3GO5A 3HOXG 1QVGA 3MXNB 3PF4A 4DAMA 1S40A 1SFOH 3F2CA 1N36Q 1JT8A 3KOJA 4PZ7A 1IZ6A 4B3SL 5C4XG 2CFMA 3J81j 5FJ8H 2LXKA 1YI2A 1K9MC 4C3HH 1MIUA 2IY5B 3MEFA 1WCMG 2EQSA 2VS1A 4IPHA 4LFCL 4JI2Q 2R92H 4LFBQ 3HOVH 2RHQB 1X55A 3HKZE 3CPFA 4XTCS 3PIOA 4A3GG 2NN6G 3ULPA 4FDBA 2GVBA 4X6AH 5IYCG 5IY0A 3CCUA 4JBJA 4LNQA 2F3IA 5M3MH 3S17H 4BBRH 3HOZH 4P72A 1WI5A 1UE1A 5IYBH 1A0IA 4NXNL 3SGIA 1IL2A 4Y7NH 3JAMc 4B3RQ 3JC66 3GTQH 2OCEA 3PUYA 1XNQL 4DUZL 1Q7YC 1CKNB 4JOIC 4JI8Q 3F2DA 4HJ7A 2EIFA 2PI2A 4A3CG 2Z6KC 5LMNQ 4GNXA 1P16A 1AE2A 1L1OA 1UWVA 3HOYG 4B3ML 4OWTB 1NY4A 1G51A 1XMQQ 3I2ZA 4P75A 5BR8Q 3J80c 3GTMH 2UUBQ 4IFDJ 3UDIA 3I4MG 4UP9A 2HT1A 2CKZB 4R1JA 4JYAQ 2NVYH 2JQOA 3S24A 5C3EH 4GLVB 2QA4A 1NJIC 4X62Q 1XJVA 4Y52H 3I7FA 3FKIH 1U5KA 2MFIA 3AYHB 3HKSA 1QZGA 1E24A 3FHWA 4LF5Q 3NEMA 5FLMG 1X6OA 4JV5L 1E1OA 1BBWA 1HZBA 4DK6C 1OTCA 2MO0A 2R93G 4B3RL 3A5UA 3H3VH 4A3DG 4BY7H 4NPSA 2B63H 4GN3B 4RG1A 3KFUA 2D62A 1L2FA 1X54A 1Z9FA 1SROA 2WB1G 1VQOA 1J5EQ 1YJWA 4C2MH 1NMFA 4HJ8A 4YCWA 1S72A 1CKNA 1VS0A 1S3OA 5IE8A 2F52A 3CP0A 4AYBE 1I94L 4A3JH 2MO1A 4BBSG 4DR4Q 4JYAL 3I4NH 3KJOA 1Y1WG 5GAEC 5EAYA 4ME3A 2E5LQ 3EIVA 2I5LX 4X62L 1HNWQ 2XGTA 3OTOL 4GKKQ 1P8LA 1Y1VH 4LF5L 2YTVA 4DV3Q 1E7ZA 4AH6A 5ELNA 4POFA 4LF9Q 1XNRQ 1MJCA 3ULJA 1PH6A 2Z0SA 1PH2A 3S1MH 4DR5Q 3TQYA 3I55A 1J6QA 1IYJB 1VQLA 4X64Q 2N49A 4J15A 3U58A 2JA5H 5GROA 2JE6I 4OWXB 4DR2Q 1EIYB 3NENA 1PH8A 2A1AA 2R7ZH 5IP7H 1YBYA 5M3FG 4JC0A 3H3VI 2Q2TA 4R4OA 2FXQA 4A3LG 2KCTA 2XTIA 1N32L 2RCNA 3ER0A 4C3IH 2VQEQ 2JA7H 3HOUH 1WFQA 4P73A 1HNXL 3HOWG 4GKJL 2D0OA 3BZKA 3KDFB 3CCVA 3W5OA 2K5NA 2E5LL 1K83H 3PO2H 1BKBA 1OXUA 3PUZA 4HIMA 4DPGA 4IOCA 3K7AH 5JEAG 3HKZG 1M1KC 1LYLA 3ZJYC 1JMCA 1M90C 3STBC 1Z47A 2KENA 4DV3L 4LF9L 4ALPA 4BY1H 1XNRL 3GTPH 1HNWL 4A3MH 4GN5A 4TQUS 1IBKQ 1VQPA 5FJ8G 2L15A 1TWHH 1HR0L 3LGJA 1CKOA 2F4VQ 2R92G 4X64L 1EWIA 2K52A 3HOVG 1XPRA 3DM3A 4YCVA 4IPCA 4DV4Q 3CAMA 1VQEA 4BA1I 3KJPA 2DGYA 1N9WA 4K0KQ 4P74A 4JI3Q 3AEVA 1XPOA 1PH7A 1GVPA 5M3MG 1KRSA 3BJUA 2CWAA 3M85A 4JI6Q 3HOZG 3T1YQ 3L0OA 4KI0A 1PV4A 2WP8J 3PUWA 5IYBG 1PH3A 2VQEL 3T1HL 1WYDA 4X65Q 3RZDH 5H1SE 4LUOA 4L5QA 2C35B 3FP9A 5AJ3Q 4LF7Q 1FJGQ 3H0GH 4DR1L 3A74A 2KHJA 1KC8C 5FLXc 1N34Q 5ELOA 1KD1C 3KDFA 5IYDH 2OTJA 3CC4A 2NVQH 1H95A 1IBLQ 1G6PA 3CW2C 1X3EA 4YHHQ 2E8GA 2NZOA 1G291 2UXBQ 2K4KA 4GLXA 1B8AA 3K8AA 4IPGA 4X66Q 2LXJA 3L7ZC 2BH2A 2F4VL 5C3EG 3CF5A 1JE5A 1UE7A 4DR7Q 2B3GA 1PYBA 1VQ5A 1HH2P 3KF6B 3CCQA 3FKIG 5DLQE 2E2IH 4K0KL 1NMGA 4LF4L
chains in the Genus database with same CATH superfamily
2VZAA 4BXXH 2F3VA 2Y0SB 4L5RC 4JG2A 3VR3A 3W1BA 1W3SA 3S1RB 1N34L 1DGSA 1XTDA 5JEAJ 3MXNA 1Q8IA 1VQJA 2F0HA 3QIAA 4A93B 2UXBL 1UUPA 4LFBL 1IHZA 2QEJC 4IUUA 3J7ZC 2WAQB 2FMCA 4DV7Q 1RIPA 4YCUA 5IP9H 1EOVA 3D6CA 1X65A 2SDFA 1CK1A 1OO9B 3RLFA 1GM5A 2AKWB 1V1OA 4ZAIA 2ATWA 2KBNA 3K0XA 4X3SA 2JA5G 2ASBA 2IX0A 4WFN3 1B3AA 1S5BD 4DV6Q 5IP7G 1XMQL 2B2VC 3PCOB 4B3TL 3BYTB 1IW7C 4UY8C 1K0RA 1EYGA 1VQIA 3RN2A 2JA7G 2VNUD 4EVOA 4Q0FA 3SHLA 1M8AA 3I90A 4YWMA 4POGA 1QE6A 2AUKA 3GDEA 1ASZA 3J7YW 1EQQA 1OXSC 1I5FA 1PZID 3M4YA 1PTOC 5M5WH 1CZWA 2EPBA 4I7ZC 4C3JG 1J5EL 3U4ZA 2KJXA 4BA2I 3FVQA 2L0CA 1ESRA 1J9OA 1W2BA 5EQ0A 3CD6A 1YNNC 1IYUA 2C5CA 3I70A 4JI0L 1IKMA 3A7AB 4XYQA 3VDYA 4OELB 1QZHA 3PIPA 2ALYB 2AWOA 1VQ4A 1GHKA 5I9PA 3KF8A 3RLNA 4WORA 1CA5A 2ZTEA 1T5XD 1HUNA 4Q5VA 3BZCA 2Q8RE 2Y0SG 3V05A 2JXMB 1A8VA 3IAYA 1TWGH 3MVVA 5JJZA 4HIDA 1BNZA 5JJIA 4A3FB 4GN4B 4MNOA 4FF4A 5DEHA 4A3KH 5I6WA 3T13A 3TSSA 4A93G 4DN4M 4HR7B 2OWOA 1D1KA 4K5XA 2WAQG 5M5YB 4I65A 3HFZB 2A68D 1PRTC 4OWWB 3L3OC 4JI7L 2PMZE 3J81c 3SK4A 3SK5A 4XDXA 4OONA 4IFDH 2JA6H 1CSPA 3OOCA 4JI6L 2YTXA 4UDUC 1PFSA 1V1PA 3F8TA 2QW7A 4L8JA 3BU2A 1FGBD 1ZYRD 1QUQA 2K05A 4A3IH 2E75C 3J81L 1EUJA 3T4AC 3RNUA 4A3EH 1CQVA 1EY7A 2IW3A 1O7YA 2Z6KA 3EBEA 2PQAA 2F03A 2K33A 5AFWA 4RHSA 1X3QA 1RHPA 4A3BH 1IBMQ 1EOTA 1BBXC 1TS4A 4DXGA 3D6WA 2VUMB 3M4OB 2VXWA 1B44D 3G48A 4QQBX 3HOXH 3URYA 3DUZA 3UDGA 3PO3B 1EU3A 2KA7A 4DV1Q 1WCMH 3PSIA 4JI5Q 2NN6H 1BO0A 4FYDA 2Q2UA 4EX5A 1D8LA 2Q8IB 2PZUA 1EWCA 1WOCA 1YIJA 4DUYL 3A8IE 1VF5C 4A3GB 4HSVA 5I6YA 3NSWA 2HQEA 2A74C 4LK1C 3NTKA 2ZTDA 1PTOF 1EIGA 1GHJA 2NVXB 1Q1BA 2CW0C 2MPMA 2K01A 1F2MA 2UXDL 2JEBI 4O0AA 5CV7A 4X3UA 4K6DA 1WTRA 4RKBA 4NXML 2NVTB 1YHQA 1FD7D 1VQHA 1SR3A 4A3FG 3E6ZX 2A69C 3MFGA 1KRTA 1GO3E 3I91A 4NMZA 3JAMi 3I4MB 2CQOA 5D3IB 2YU9H 3R8BA 4YWLA 3DMUA 3U9OA 2ZJPA 3RD4A 3B6YA 4IO9A 5LL6X 1VQMA 2DJGC 5ELFA 1ESFA 2WFWA 1XX8A 1D5XC 1VF7A 4YY3L 2R93B 2ENBA 4DV5L 2PNHA 1ICFB 2WINB 4BBSH 4DR6L 1CHPD 4H02A 1LTBD 2XWBB 3ZYYX 3NBHB 3HS0C 3VR4A 2IHEA 2TMPA 1E2VA 3L2PA 1IYVA 1KDCA 1TWAB 1ASYA 3GTJH 1PRTF 4JBKA 4DAYB 1PYSB 1VQBA 1STYA 2NTTA 1UE6A 4GOPA 1B70B 2VUMG 4NW2A 2Q2IA 2UUCL 1K73C 4OO1G 1KNEA 2VL6A 1FVIA 1I4HA 4NKLA 1H9KA 4A3LH 4FF3A 4G57A 3PO3G 1MKHA 3UE0A 1H9MA 1L1OB 1HTPA 2EY5A 3ONAB 4FVMA 1GUNA 4KHPL 5CYUA 3D4DA 3MEHA 1S40A 3HOWB 3KOJA 3SXHA 4B3SL 1GUOA 4TSSA 4CKEA 4C3HH 5DM73 5EKKA 2JYOA 1CQFA 4F87A 2R92H 5M9OA 2E2HB 3HKZB 5IGFA 4A3GG 3VYSA 1SFOB 5IYCG 3CCUA 2F3IA 4RGTA 3OW7A 3S17H 4BBRH 4IUNA 1UE1A 3T53B 5IYBH 1PTOH 3BDLA 4NXNL 3SGIA 1X3PA 3JC66 3GTQH 3PUYA 1MBYA 1XNQL 1CKNB 4JOIC 4HJ7A 2PI2A 3MXPA 1WTXA 4A3CG 2G9DA 1EU4A 2F0DA 1SNCA 4CDCC 3GV6A 1ET9A 5BR8Q 3J80c 3GTMH 4IFDJ 3NBIA 3I4MG 4UP9A 2JQOA 2P5ZX 5IOCA 3IFDA 4GLVB 1TIID 3S2DB 1QZGA 3NEMA 2A6HD 2PQEA 4U673 4PMBA 3J80L 2EVBA 5C3EB 4G7HC 2R93G 1RTOA 5C4HA 3BVMA 4NPSA 3PMFA 2KHSA 4IQZA 1U4LA 3KFUA 1L2FA 1X54A 2K5DA 1SROA 1F2ZA 2RDHA 2XIWA 4C2MH 1SDFA 4HJ8A 1S72A 3VYUA 1D6EC 5J39A 3OMGA 2Z4IA 4H7BA 1EY6A 2B63B 4DR4Q 1LTGD 1FR3A 2E5LQ 4X62L 4ZUIA 2XGTA 2IPKD 4K6LA 4DV3Q 4POFA 2G9HD 4DR5Q 5FO8B 4G7OC 2F0GA 2JA5H 1SNMA 1HFGA 5GROA 3VR2A 2YU9B 4K14A 1PH8A 3NE5B 5IP7H 3H3VI 1EEID 2FXQA 4C1NK 3HEJA 2JA7H 1B4OA 1WFQA 4P73A 3HOWG 4GKJL 2EE1A 3KLSX 3TP6A 3KDFB 3CCVA 3MFYA 2K5NA 1BKBA 2I46A 4DPGA 3K7AH 3A8JE 3HKZG 2J4XA 5BN4A 1WTVA 5FO9B 4DNTB 5C5LA 1Z47A 2KENA 3MXUA 3NPPA 3TP7A 1XNRL 3MXGA 1IBKQ 1NSNS 1EFID 5FJ8G 1TWHH 4X64L 1K28A 3NP8A 3DM3A 5CV9A 4PV1C 5KIXA 4N9TA 3KJPA 4BA1I 1N9WA 4BY1B 3AEVA 2XWJB 4HN7A 3BJUA 3T1YQ 3L0OA 1LTRD 1PH3A 1SNQA 2VQEL 3T1HL 4X65Q 1S4ZA 3TBIB 3KLSA 1KC8C 2WKCA 5ELOA 2OTJA 3CC4A 3NBHA 4CJ0B 3CW2C 2QDBA 2KOLA 1G291 1HA6A 2K4KA 5ELBA 3H0GB 3HRZC 3K8AA 4IPGA 2F4VL 5C3EG 3KLRA 1PYBA 1FNUA 3OHXC 5DLQE 4RGNA 3S1RH 5JJLA 1S5FD 2B2TC 1N33Q 2DUDA 4A93H 2K5VA 1ZXTA 4MIUA 4U68A 2Y0SE 3ND8A 5AJ3L 4BBRB 1FJGL 2B63G 3ICEA 1CSQA 2B2YA 1N36L 3CCSA 4HJ5A 1YZ6A 1WTWA 4RMFA 1B7YB 1CKMA 5C0XI 2AQ1B 4JI2L 2Z8LA 1Q12A 1K0SA 3EROA 2KUMA 2EXDA 2WAQE 2ZJRA 2CH4W 2IX3A 2QGQA 2BDNA 4DGZA 1B50A 3VA5A 4APVA 3DWPA 3S16B 1B9NA 4JI8L 3WDNA 4CGYB 1DYQA 3I4LA 3GQBA 5KGUA 4BWGB 5FLXE 4AQYQ 1LTAD 1CTMA 3CQZH 4V0BA 3DLLA 4JW0A 1QCBD 1HQMC 1DOMA 2RVLA 3GTLB 4DR3Q 3G7LA 3J7A5 3KF8B 4DV7L 4XQQA 2AMCB 1C0AA 2QEXA 4BY1G 4LW1A 3G6EA 4N8FA 1ICWA 3PUVA 4DV6L 3NTIA 5ELDA 3BZDB 4IUQA 2Q8TA 5J22A 1QILA 4DK3C 1HZCA 3A55A 4IOAA 1YJ9A 2KEEA 4GKKL 3H0GG 3DHQA 1ZKOA 3TZDA 5HURA 1V1QA 4DK1A 4MTNA 5IWAQ 5CV8A 4A3FH 3RR5A 1TU2B 1PH5A 2HHHQ 2R7ZB 1M4VA 1V1PB 1KIXA 1QUQB 3EQLC 4ZUJA 4FO2A 3E3XA 5JAVA 2L1BA 4BBRG 3I8ZA 3DXJC 2NUCA 1IW7D 1XPUA 2D0PA 1X56A 2E76C 2PQAB 1SNDA 3AFPA 5M5YH 1PH4A 4BS9A 3KK7A 1LLRD 4KN7C 3BVZA 2FMMA 2A8VA 1I3QB 2JA8B 2BCOA 1LV9A 1DZ1A 1SE8A 2A6ED 5CV6A 2BE5D 1YHBA 2Q2HA 3UDXA 1KLUD 4B9XA 1I6VC 5C4JB 3S2DH 3E9IA 2IX1A 3DEOA 2K6AA 2LSSA 3RUZA 4HCEA 5GAHC 1DONA 1D5ZC 4R4TA 3CCRA 2IL8A 1H9RA 3HP3A 2B8GA 5D3DA 1F2LA 1GXDC 2F0TA 5ISRA 3EJIA 3G71A 2V1CC 1TS3A 1YVCA 2UU9Q 2VUMH 1TY2A 4LF7L 4DXFA 4OX9Q 3M4OH 2MJ8A 3CMAA 3STBD 1BF4A 2BA0A 4OO1H 3C3LA 2GN5A 1IBLL 4QUFA 2CHBD 2KQ3A 1V43A 3PO3H 2IHFA 4LF6Q 4TRDA 4JV5Q 4ZKCB 1R9TB 1VQ7A 3SE0A 1O7IA 1F9RA 1AW7A 2ZXOA 1Q1EA 5A2QL 1R4QB 1TY0A 5C44B 5K36G 5TSSA 1UNSA 4H13C 2UXCQ 2BOSA 1I94Q 3FDTA 3W2DA 4A3GH 2PPBC 4B9WA 1NE3A 1YNJD 4QMGA 1GOZA 1EY4A 3Q6SA 5IYCH 4NDXA 3OTOQ 2LFNA 2VB2X 3IKJA 2AQ3B 2HIXA 4ZCKA 4A75A 1IBML 1PFMA 2NVXH 2B2VA 2K04A 1RF2D 4LUVA 1OXTA 4JI1Q 3I72A 4HEDA 4YWKA 3J81E 1QVCA 3CQZB 4A3CH 3M3YB 2EJGC 4J6HA 4OXPA 2NVTH 3PGZA 3H09A 1AZPA 2R7ZG 3OWEB 3PUXA 5K5PA 4DV0Q 4DV1L 3I4MH 1TT2A 3ITPA 4ULLA 1GUWA 1EY8A 3CCEA 1N32Q 4JI5L 5LMUQ 3UE1A 1NR2A 1HNXQ 3HOYB 4G7ZC 2AWNA 1IKLA 3RLOA 2EY2A 2FINB 2MUYA 4R8IA 3K58A 2JA8G 4GOPB 4H44C 1TR5A 2R93H 2A73B 4IN3A 4WJWA 4R4IA 2K32A 5JPNC 2VQFQ 3X3NA 2HQLA 3Q8DA 4A3DB 1NAPA 1Y14B 4KY5A 1K3RA 3M4PA 3QJYA 4F7XA 1TWAH 1Q86C 5E4WC 2Z6BA 3S2HB 1IL8A 4K8IA 3RZOB 4JBWA 4C1NI 5EPKA 4M8AA 1QB5D 1VQGA 5FK9C 3S9WA 1TQOA 1VQKA 2F0EA 3MA2B 1VQ6A 4WJ3M 1H9JA 2O4XA 1ML0D 2K28A 1HUMA 4PG3A 1HQRD 2JJQA 4IPDA 1EY9A 2HDMA 1KABA 1NUCA 2SEBD 3CCJA 3EN2A 2R6GA 2SOBA 5C44G 3HGBA 2EYLA 3HOWH 2J0TD 1F9QA 4GS3A 1SYFA 4PMWA 4DUZQ 2X6GA 1NNXA 3Q23A 1MJEA 2E2HH 3BDCA 1QVGA 3QOLA 3UI2A 4DAMA 1PYWD 1SFOH 1F2YA 4LMQD 1IZ6A 5FJ8H 4ZRZA 1MIUA 1PDQA 1SE4A 3MEFA 2EQSA 4LFBQ 4LFCL 2B2WA 1A3UA 2RHQB 1SMYD 3HKZE 3CPFA 4XTCS 5CV4A 3PIOA 3ULPA 4IURA 2GVBA 4IUVA 4LNQA 1Y8OB 4E6IA 2WKDA 4F8MA 3HOVB 4B3RQ 2OCEA 1Q7YC 3F2DA 2EIFA 4X3KA 2Z6KC 3DWQA 4GNXA 3K59A 1BCPD 2NWGA 5ELCA 1EY5A 3HOYG 2F0JA 4B3ML 4KV6A 4OWTB 4Y7NB 1G91A 1NY4A 1XMQQ 4K5WA 5IGDA 1SYBA 2EYOA 4R1JA 1KAAA 1TVXA 4JYAQ 5C3EH 2QA4A 1NJIC 1XJVA 4IALA 4Y52H 2A5HA 5KNBA 3PIP3 2AQ2B 3FHWA 5CORA 4LF5Q 1MI2A 1X6OA 1STEA 5IGBA 1SBBB 4DFAA 4DK6C 2MO0A 2TSSA 4A3DG 4R8NA 4HTHA 2B63H 4OIJA 4RCOA 1J5EQ 3QB3A 4DAVA 2MP1A 2RSOA 2F52A 4H0LC 3R2TA 2XNAC 1UAPA 3SR1A 4BY7B 1L0YB 2MO1A 5IGGA 4RAUC 5EPLA 3V96A 1I4PA 3CKIB 3P20A 4ME3A 1P8LA 4RGOS 1E7ZA 1PH2A 1PH6A 1SYDA 3MZ5A 2A68C 4RH6A 5IGCA 4TKOB 5CGKA 1DCZA 1Y1VB 1A6XA 2A1AA 3QOJA 2ZXRA 3C2PA 4JC0A 1SAPA 1S5DD 3TN2A 2HDLA 5CR3A 2KCTA 2XTIA 2Z9HA 2B2UA 3J80E 1X32A 5KEEA 4WRDA 5L37A 2D0OA 3BZKA 1ZYRC 4XXEA 1HFNA 3QWNA 2E5LL 3NWSA 1PZJD 4HIMA 3MTSA 1JMCA 3DWAA 4C3IB 4HMJA 4DV3L 4B08A 1V8QA 4BY1H 4TQUS 4RFBA 2F0IA 1HR0L 1QWYA 3HOVG 1UEAB 2HUGA 4K0KQ 3OIPA 1SE3A 1SNPA 1KRSA 4JI6Q 1PV4A 3R93A 4LUOA 2C35B 2L12A 3H0GH 4DR1L 2KHJA 4KD4A 4FXDA 1H95A 1EYDA 1DJRD 1STGA 3L9AX 2E8GA 2NZOA 3RZDB 1R4PB 1SE2A 1B8AA 1QJOA 1ENCA 4OHJA 4X66Q 3L7ZC 4RGMA 1JE5A 1UE7A 5F2DA 2NVQB 4K2LA 2F3WA 5A35A 1O7ZA 2F0LA 2EDGA 1VQ5A 4LF4L 2DY8A 2HCCA 1QNUA 5G3LD 1TKWB 4QY7A 2KCNA 1U9RA 4X65L 1Y69U 4LF8Q 1U0LA 3OPOA 2PW7A 4NB3A 1X3FA 1J8IA 3K6OA 3TP5A 1G2SA 3ERSX 2L11A 1JWSD 4XYOA 3PV0A 2BA1A 4DUYQ 2RBMA 2YV5A 2OT2A 1E2WA 2B29A 3S16H 3D0FA 3FPUB 1GUSA 1C7YA 3UDFA 5I2XA 1ZEQX 3FEWX 1JJ2A 5JJKA 1Y1VG 2M2LA 2K14A 3KF6A 3CRKC 1LTTD 2UXDQ 3DEPA 2O2LD 3BG3A 4R4CA 4HMIA 2MQHA 2NZHA 4NXMQ 5LMNL 3GTLH 3SK8A 3VYTA 3CC2A 3J81i 1KHIA 3GTOB 2UUBL 3MWYW 3KUPA 3VA7A 4C3IG 2LKVA 1JCKB 2M00A 3CRLC 3CCMA 2EYFA 5HGTA 4K8JA 5JVH3 5K36H 3M7NA 4KD3A 2MGSA 1K8AC 1KQSA 3HG9A 1O80A 4DV5Q 5IGEA 3S1QB 1HJPA 3CU7A 4LFAQ 3SK6A 5HGQA 4FXKC 5EBCA 1B9MA 3CCLA 4RHRA 1PVOA 1UEBA 3TEHB 3E0EA 3K80C 2I5MX 1I4GA 4AQYL 3GD7A 1Q82C 2JA9A 3KLWA 3NHHA 1U4RA 1Q81C 2I5HA 4ZLTF 2IT1A 3K7UC 4KKUA 5IT9c 4ID6A 3N52A 4J1MA 5C0XG 1SRUA 1SLJA 2UUCQ 3TS0A 5GAGC 2R7ZH 5IYDG 1F77A 1I50B 5E4XA 3S1NB 1CHQD 4N9PA 4NP5A 4WJ4A 2OF1A 4DR2L 3PO2B 5IT9L 1EIHA 1RTNA 3H3VC 1FNWA 1CA6A 4CBVA 1CUKA 1BOSA 1JC7A 1I3QH 4L63B 2JA8H 4CDFC 1SXTA 1PFNA 3GP7A 5C5MA 2R7FA 2RDGA 1YJNA 5C4JH 1Q8KA 3I3CA 1A63A 1STNA 4DV2Q 3U4VA 5BN5A 1MSGA 1WTHA 2A6HC 5EJWA 4NXNQ 4ABNA 4KMUC 1EYAA 1A62A 4GLAC 4DV4L 1L0WA 3X3MA 5DM63 3GTGB 4JI3L 5LHY1 1I4QA 2C9OA 3A7LA 3CC7A 3NQTA 1HZAA 1LTLA 1E22A 4ZKBB 4JVZA 1G6ZA 1R9TH 1X3GA 2ZTCA 4RCNA 3FRPB 4N8X1 4YHHL 3I56A 1DD2A 1KAWA 5C44H 1KNAA 4HAEA 1MGSA 2LS01 4A4IA 2CCZA 2X6LA 4LWCA 1YEZA 4A76A 1E3PA 4MZ9A 3CMEA 4DR7L 2H1EA 2PZWA 4ME5A 5C4ZA 2ICIA 2EXZA 1L1OC 2F0WA 2FJ2A 5KRUA 5BN3A 2B2YC 3TREA 2KECA 4EQ5A 3LWUA 1AFPA 2SNMA 1SJHD 4KN4C 4IFDI 1MHWC 3WOFA 3GTKB 1EQRA 2UU9L 4OX9L 3H91A 5LL6S 1KDBA 5KNCA 1I4XA 5C4XB 3M3YH 4JCVE 1HNZQ 1TWFB 3AFQA 1X9NA 4DF7A 3CXCA 1LM0A 4KKSA 4LF6L 1W6KA 4LJZC 1JR0D 2OQ0A 2F4IA 5FOBB 1ENFA 4KKTA 1XMOQ 3C46A 4CKCA 3PQIA 3HOYH 3PF5A 3PO2G 2PYKA 3Q0AA 4AIMA 1PA6A 1XWEA 2F0FA 1Y8NB 2UXCL 1AN8A 1SN8A 4GKJQ 2UUAQ 2PNRC 5CV5A 4JI4Q 4QIWB 5D65A 1LT5D 2D2CC 5A2QE 4QB4A 5NUCA 1S5ED 2NBFA 2NN6I 5J3BA 3SVMA 1Z6HA 4HIOA 3OMCA 3OYYA 4FP5D 4A3DH 4JI1L 5COYA 1A2TA 3K0YA 3D8GA 1BVSA 3J80i 3S2HH 3RZOH 2N3SA 4R4QA 4YIJA 4DV0L 4IJLA 1VCIA 1VQCA 1VQNA 1HPCA 3R3OA 2ZM6Q 2WB1B 3T1HQ 5LMUL 3D4RA 2EYPA 1C9OA 1IXRA 4KY6A 3ULLA 2E2JB 5EBDA 1B2TA 1HHVA 1BDOA 2K5WA 1WVLA 2JK8A 1BXTA 1Y1WB 2MNAA 3K57A 4UHVA 4KJNA 4O2DA 2F0NA 2PO4A 1WD0A 3WWVA 1JOQA 2VQFL 1W6JA 1D7QA 5T1IA 2L5TA 4F88A 1JORA 1PTOD 1RL2A 5M5XB 3W3AA 2PI2E 4GNXB 5GQOA 1JOKA 1WJJA 1B53A 1HCZA 4C3JB 5M3FB 3N6RA 1C8CA 2JEAI 3S14B 4UPAA 2LY7A 1T5EA 3GO5A 4CJ1B 1PXUA 3F2CA 1N36Q 1JT8A 1XTCD 4PZ7A 5C4XG 2CFMA 1YI2A 1K9MC 1YNND 2IY5B 1TS2A 1SYGA 4IPHA 4JI2Q 3HOVH 1TWCB 2CQAA 3T56B 4FXGC 1JE4A 2RKSA 1SEBD 1O7LA 1RCVD 2XRSD 4P72A 2ICEC 1WI5A 2F0PA 4Y7NH 3JAMc 4Z9CB 1F9PA 2G5DA 4DUZL 4JI8Q 1C4QA 1HXYD 5M3MB 3HOZB 3K5MA 1STAA 2FFKB 3I2ZA 4P75A 3JAML 2CKZB 1K8OA 3S24A 2DY7A 2QKIC 3I7FA 1U5KA 3HKSA 1JWMD 2K03A 1E24A 1PRTD 1A2UA 5FLMG 2NVYB 1OTCA 1HZBA 4CKBA 5I4DA 3TP8A 4B3RL 1LTID 3AU7A 3H3VH 3FKIB 4BY7H 4GN3B 1DOKA 1LTSD 2D62A 3FMCA 1Z9FA 1VQOA 2WB1G 1YJWA 1XXGA 1NMFA 3TZUA 1QNKA 4YCWA 1VS0A 1S3OA 3CP0A 4AYBB 1JB3A 2NB0A 1HTLD 4JYAL 1LT3D 3KJOA 1Y1WG 5EAYA 1BCPB 1HNWQ 4GKKQ 1AP0A 1Y1VH 5EKIA 4LF5L 4A3JB 5ELNA 2BDOA 4LF9Q 2Z0SA 4RKLA 3RMHA 5IIFA 3TDQA 2A6EC 3I4NB 4S3SA 4V190 1IYJB 2BE5C 1VQLA 4PMCA 3U58A 1CZGA 2JE6I 2KCCA 3NENA 4K2KA 3MHBA 1D2BA 3S1MB 5M3FG 2Q2TA 2XSCA 4CDEC 3G6JB 2RCNA 4C3IH 1GUGA 3QO2A 1EQTA 3W5OA 4DK0A 2AUJD 1OXUA 2O5IC 2R61A 5JEAG 1M1KC 3ZJYC 1M90C 3STBC 3IL8A 3HOUB 4FNFA 2L15A 1H9SA 1K83B 3OWFA 1F9SA 1SNOA 2J7ZA 1EWIA 2CW0D 2K52A 4L6TB 1XPRA 4YCVA 2CVRA 2EOTA 1PFBA 1VQEA 2DGYA 4P74A 1Z7TA 1XPOA 4A3MB 3GTPB 2V4DA 1GVPA 3OIQA 5M3MG 3M85A 3T51B 3NWTA 3HOZG 1SSOA 4KI0A 5C3WA 4KHVA 1LT4D 5H1SE 2A69D 3RZDH 2D5DA 3FP9A 4LF7Q 2PW5A 2OXPA 3A74A 1QOHA 4KTAA 5C0XH 1G2TA 5CMDA 1N34Q 4GZYC 1YNJC 1KD1C 5IYDH 2NVQH 1IBLQ 1G6PA 1X3EA 3J7AV 1I4RA 4DU9A 3VR6A 2UXBQ 4GLXA 2PCFB 4UAIA 1D5MC 1LT6D 2LXJA 2BH2A 1K8MA 3CF5A 2GA4B 1B3QA 2KEDA 4RWSC 3LX0A 3KF6B 4KJOA 1SYEA 3FKIG 4K0KL 1NMGA 3SDZA 2RCFA 3D4WA 1WD1A 2B2WC 4AYBG 3D3RA 4DNIA 2E2IB 5DNFA 1LUZA 1HR0W 2EJMA 1PH9A 3M9BA 2VW9A 4B3TQ 3TMEA 3AQQA 1VQ9A 2F0OA 2LMCB 1WTPA 4A3JG 1DM0B 4X66L 2NZ1D 1JB7A 3I4NG 1GUTA 4GNXC 3K5OA 4IJHA 3SEBA 3CHBD 3OSOA 3MAQA 1ET6A 1Q46A 3GTOH 2K5HA 3I4OA 1JICA 4KHZA 1ILQA 4LF8L 3KYHC 2EZVA 4KK7A 4FF1A 1AE3A 1K3BC 1YNXA 3A54A 5KYIA 5BR8L 3NELA 1I6HH 2QILA 1CI3M 1EIFA 5E7NA 1FGUA 2RF4A 2I07B 4M1UB 3HOUG 1EZ6A 3S1QH 5HY6A 2ZJQA 1ONLA 3H15A 4JI0Q 1YHAA 4LUZA 1UE5A 3OW2A 2F0UA 2CH4A 1NTGA 1ILPA 1VQDA 4L5TA 4KY7A 1SMXA 4A3MG 2CWPA 3ND9A 1NCVA 3RN5A 5E3FA 4P2CB 4HJAA 1U4PA 1U4MA 3M4QA 1E0BA 1V9PA 3A5ZB 4X3TA 4ODGA 2SNSA 5M5WB 3U9SA 4DR4L 1AH9A 1BR9A 1I50H 2BH8A 2B39A 3S1NH 3PIO3 4QJFA 1BUVT 2O5JC 3HZXA 2KVMA 1SMYC 2EYHA 5FO7B 3PO2H 2F0QA 2N8NA 3NQIA 1KTKA 1PHJA 4DR5L 5LMNW 2EY6A 2H5XA 4JI7Q 2B2UC 3E5SA 4LFAL 1VQAA 3KBGA 4OGQC 3DM1A 5KYLA 1BQQT 2QDLA 1VQFA 4O1NA 4QF4A 1GJXA 3QR8A 4XT3B 4PNYA 1BCPC 5EGTA 4K5VA 4GOPC 4LFCQ 4BXXG 1FL0A 4C56C 1TWGB 4DNRB 3CPWA 4KLKA 3E9HA 3GTGH 3S15H 2KCMA 1IBKL 2YTYA 4A3KB 4DA2A 2PMZB 5T1GA 4G4KA 2AHOB 4P71A 4LAAA 2PZTA 2X69A 2ID0A 3P1HA 5IP9G 3T1YL 1FYCA 1PZKD 4EQNA 4B3MQ 3KBXA 1EZ8A 2HCIA 1Q3LA 3NXWA 2IJ0A 2MHVA 4HIKA 4UP7A 5EPJA 4BY7G 4JOIA 1LABA 1XYIA 2JA6B 4XIGS 4DKAC 4QCLA 5IT9E 4TVAB 4A3IB 3IRBA 4DV2L 1E1TA 1KDAA 2RHSB 2EYMA 5C0XJ 1WTOA 3A8KE 4ZK9B 5D14A 4A3EB 3BVGA 4XQNA 3C1FA 2I0QA 1PH1A 1TS5A 2ES2A 2YYZA 5KNDA 1Y8PB 1NBWA 4CHTB 2K75A 3GTKH 4A3BB 4ILWA 4RA8A 3F1ZA 5C4XH 1N33L 3V2TA 1EFWA 1TWFH 1VQ8A 2DNEA 1SJED 3HOXB 1VMCA 2RDFA 3QG1A 4R9WA 3K81C 1EYCA 1OXXK 1WCMB 2B8FA 2WACA 1PLFA 1BBUA 4OO1I 3U50C 1A3TA 3D31A 3FPPA 3VYRA 4L5SA 1Q90A 2OQKA 4HJ9A 1I6HB 3J7AF 2IWHA 4IZ8A 5CC4A 4YY3Q 2OTLA 1KL9A 3IFTA 1QVFA 4DR6Q 2EJFC 1RJTA 1EQVA 3AMUA 3F2UA 2Z1CA 2K1BA 1B1ZA 3A0JA 5C6AA 2DJFC 4JBMA 2N78A 4QIWE 1S5CD 5GADC 4IUTA 1OXVA 5FLMH 5CBEE 1KXLA 1JJCB 4OL7A 1HNZL 3C1EA 2DN8A 1JJGA 1GD7A 4DR3L 1HR0Q 2R3ZA 4A3KG 2R7DA 2RSNA 4PQXA 1XMOL 3TRZA 2WV6D 1HA5A 2K5QA 2E2JH 3LWEA 2XVSA 1L0XB 2ZXPA 4I7AA 3W1GA 4XQJA 3M7GA 2HIVA 1BCPF 3P7JA 2K50A 2WIIB 4MHEA 1Y1WH 2WB1E 1N8RC 2JSOA 4QUCA 4QGUA 2UUAL 1T9HA 4UP8A 4PZ6A 1WTQA 1CFMA 4JI4L 4IUPA 5FKAC 4DR1Q 4KHPQ 4XT1B 4IFDG 2JA6G 1TXYA 1RDPD 4ZQ3A 4B3SQ 4BBSB 3R2IA 2VY3A 2K7VA 2L4NA 4A3IG 1HRJA 4PZ8A 2NYZD 5M5XH 2OEOA 3TS2A 1HZ9A 5J1ZA 4A3EG 5JPMC 3Q22A 2GVAA 1YITA 4C3JH 5M3FH 2A19A 3S14H 1JWUD 2L9HA 1K8GA 1KLGD 3GTJB 4A3BG 1RD9D 4LF4Q 1GKHA 2F1MA 4CJ2C 3F2BA 1EL0A 5IWAL 3ERQA 1XNQQ 2ZM6L 1STBA 3G4SA 2HHHL 4QL5A 4JK1C 2H4OA 3S15B 2KHIA 1E2ZA 5JEAH 1EY0A 1TWCH 3HOXG 3MXNB 4DAPA 3NK9A 1RKNA 3PF4A 3MC0B 3K5NA 1CM9A 2B2TA 4EQPA 3J81j 2LXKA 1WCMG 2VS1A 1X55A 2NN6G 4FDBA 3K5LA 4DAYA 4X6AH 5IY0A 4JBJA 5M3MH 3HOZH 4C3HB 3H94A 2R92B 4HCSA 1A0IA 1IL2A 1A3VA 1JQYD 1O78A 3P75A 2JN4A 2ZT9C 3S17B 5LMNQ 4FF2A 1P16A 1AE2A 1L1OA 1II3A 3EVQA 3LNNA 1UWVA 1AZQA 1PTOB 2RQXA 5IODA 1G51A 4J8QA 3GTQB 2D9UA 2UUBQ 3UDIA 2HT1A 2NVYH 4X62Q 2HD3A 1ENAA 2MFIA 3AYHB 3FKIH 5E1FA 3GTMB 1NR4A 4JPBW 1FNVA 4JV5L 1E1OA 2QF7A 1BBWA 2N55A 2VB3X 3A5UA 5I9OA 1LO5D 3AB9A 4RG1A 2E74C 3WOEA 2EY1A 2E2DC 1CKNA 1VMPA 5IE8A 2F0VA 4AYBE 2Z4HA 3NTHA 5JVG3 4A3JH 1I94L 4BBSG 5JOBA 2M9VA 3I4NH 3BYYB 5GAEC 2XRQD 4C2MB 3EIVA 2I5LX 3OTOL 3GV3A 1H9SB 2F0KA 2YTVA 4AH6A 1XNRQ 3S1MH 1MJCA 3ULJA 5C3XA 3BDOA 3TQYA 3T16A 3I55A 3JAME 1J6QA 3E0JA 1C48A 4X64Q 2N49A 4J15A 3Q24A 3O13A 1PRTB 1CT1D 1AEXA 2NTSA 4OIKA 5G3LF 4OWXB 1EWHA 4DR2Q 1EIYB 1YBYA 2QCPX 4R4OA 4A3LG 1RODA 1N32L 3EA6A 3ER0A 1STHA 2VQEQ 3HOUH 2JA5B 1HNXL 1DXMA 1MSHA 4MN3A 4HSPA 1K83H 3PUZA 4IOCA 1HNWL 5EKLA 2FHTA 4CDDC 1LYLA 1SYCA 3BS1A 2DNCA 4EQOA 4O42A 2JA7B 4LF9L 4ALPA 3I73A 3GTPH 4A3MH 4GN5A 1QG7A 4MTKA 1VQPA 3LGJA 1CKOA 4C3HG 1LACA 2F4VQ 2R92G 4OEMB 2RA4A 3K7AB 3EFXD 4IPCA 4DV4Q 3CAMA 5DAUA 4JI3Q 4EGVA 1PH7A 1G8ZD 2L55A 1MD2D 1D1IA 1TWHB 2CWAA 2XN9C 2F0SA 2WP8J 3PUWA 5IYBG 1EEFD 2F0MA 1WYDA 5ELEA 4L5QA 5AJ3Q 1FJGQ 3NUCA 5FLXc 3KDFA 2N88A 5I2YA 4YHHQ 2EYJA 3A56A 1PMRA 3VR5A 2JP1A 1A15A 1VDZA 1JOOA 5CBAE 3H6MA 4DR7Q 2B3GA 5FLXL 1HH2P 1DOLA 3CCQA 4ZYSA 2E2IH
chains in the Genus database with same CATH topology
3S1RH 5JJLA 1N33Q 2VZAA 4QY7A 2DUDA 4BXXH 4A93H 2K5VA 4X65L 4AYBG 4LF8Q 1U0LA 4L5RC 4DNIA 3ICEA 2Y0SE 4NB3A 5AJ3L 1X3FA 4JG2A 1FJGL 2B63G 3W1BA 1LUZA 3ERSX 1CSQA 1W3SA 1HR0W 1N34L 1N36L 3PV0A 3CCSA 4HJ5A 1YZ6A 3M9BA 2VW9A 1DGSA 1XTDA 4RMFA 5JEAJ 1PH9A 4B3TQ 1B7YB 1CKMA 2BA1A 4DUYQ 3AQQA 1VQJA 2YV5A 1VQ9A 2UXBL 4LFBL 5C0XI 4JI2L 4A3JG 4X66L 1JB7A 1Q12A 2B29A 3J7ZC 3I4NG 3D0FA 3S16H 2EXDA 2WAQE 1C7YA 3UDFA 4DV7Q 2ZJRA 1RIPA 4GNXC 4IJHA 4YCUA 5IP9H 1EOVA 1JJ2A 5JJKA 1Y1VG 1X65A 2K14A 2QGQA 3KF6A 1Q46A 3RLFA 1GM5A 2AKWB 2ATWA 2UXDQ 4R4CA 4APVA 3GTOH 2K5HA 2KBNA 3K0XA 3I4OA 4JI8L 2MQHA 4KHZA 2NZHA 4LF8L 3KYHC 4NXMQ 2JA5G 5LMNL 3GTLH 2ASBA 2IX0A 4AQYQ 4DV6Q 1AE3A 3CC2A 5IP7G 1YNXA 3CQZH 3J81i 3DLLA 1KHIA 1XMQL 3PCOB 5BR8L 4B3TL 2UUBL 3NELA 1I6HH 1EIFA 5E7NA 1FGUA 2RF4A 4UY8C 1K0RA 1EYGA 1VQIA 3RN2A 2JA7G 3HOUG 2VNUD 3S1QH 5HY6A 4DR3Q 2ZJQA 3CCMA 3J7A5 3H15A 4JI0Q 1YHAA 4LUZA 3KF8B 1UE5A 4DV7L 3OW2A 4YWMA 3M7NA 1K8AC 2AMCB 1KQSA 4POGA 1NTGA 1C0AA 3GDEA 1ASZA 1VQDA 2QEXA 4L5TA 4DV5Q 4BY1G 1EQQA 1HJPA 4LW1A 1SMXA 1OXSC 4LFAQ 1I5FA 5HGQA 3G6EA 2CWPA 4A3MG 3CCLA 5M5WH 1PVOA 1J5EL 3RN5A 1UEBA 3TEHB 3E0EA 3U4ZA 3K80C 3PUVA 2I5MX 4HJAA 4AQYL 4DV6L 4BA2I 3GD7A 3M4QA 1V9PA 1Q82C 2JA9A 3A5ZB 3KLWA 1Q81C 4DR4L 2I5HA 1AH9A 4DK3C 1HZCA 1I50H 2IT1A 2BH8A 1W2BA 3S1NH 3CD6A 4IOAA 3K7UC 4QJFA 1YJ9A 5IT9c 4GKKL 3H0GG 4JI0L 5C0XG 2UUCQ 1SRUA 1SLJA 3VDYA 3TS0A 2N8NA 5GAGC 2ALYB 5IYDG 2AWOA 3PIPA 1VQ4A 1QZHA 1PHJA 1V1QA 4DR5L 3RLNA 5LMNW 2H5XA 4JI7Q 4MTNA 4LFAL 4WJ4A 1VQAA 5IWAQ 4A3FH 2ZTEA 3RR5A 1PH5A 4DR2L 2HHHQ 1VQFA 1KIXA 1QUQB 1CUKA 3BZCA 2Y0SG 1I3QH 2JA8H 4BBRG 1A8VA 2R7FA 1TWGH 1XPUA 2D0PA 4HIDA 1X56A 5JJIA 2PQAB 3AFPA 4GN4B 5M5YH 4MNOA 1YJNA 1PH4A 4GOPC 4A3KH 5C4JH 4LFCQ 4BXXG 4A93G 2A8VA 1Q8KA 2OWOA 1FL0A 1A63A 1SE8A 4DV2Q 3U4VA 3CPWA 2WAQG 3E9HA 4KLKA 3GTGH 3S15H 3HFZB 2KCMA 2Q2HA 1YHBA 1IBKL 3UDXA 2YTYA 4OWWB 3S2DH 3E9IA 4JI7L 4NXNQ 2IX1A 2LSSA 2PMZE 2AHOB 4P71A 3J81c 5GAHC 1A62A 4GLAC 4DV4L 1L0WA 4R4TA 4OONA 4JI3L 2ID0A 3CCRA 2JA6H 1CSPA 5IP9G 4JI6L 2YTXA 1PFSA 3CC7A 3F8TA 3T1YL 4B3MQ 3BU2A 1HZAA 4A3IH 1QUQA 1LTLA 1E22A 4HIKA 3G71A 4UP7A 1EUJA 2V1CC 1YVCA 4BY7G 2UU9Q 2VUMH 4LF7L 4JOIA 3RNUA 4A3EH 1R9TH 1X3GA 2ZTCA 4OX9Q 3M4OH 3EBEA 2Z6KA 3STBD 2PQAA 2BA0A 4XIGS 4DKAC 3CMAA 2GN5A 1IBLL 4TVAB 4A3BH 4YHHL 3I56A 3IRBA 1V43A 1E1TA 1KAWA 5C44H 4DV2L 1IBMQ 2RHSB 3PO3H 5C0XJ 2IHFA 4A4IA 2CCZA 4LF6Q 4JV5Q 4LWCA 1YEZA 4A76A 1VQ7A 1E3PA 1O7IA 4MZ9A 1PH1A 2I0QA 3G48A 3CMEA 4DR7L 2ES2A 4QQBX 2YYZA 1NBWA 3HOXH 2K75A 3GTKH 1L1OC 1Q1EA 3UDGA 5K36G 3F1ZA 5C4XH 3TREA 1N33L 4DV1Q 1EFWA 4EQ5A 2UXCQ 1WCMH 1TWFH 3PSIA 1VQ8A 4JI5Q 4IFDI 1I94Q 4A3GH 1EQRA 2UU9L 4OX9L 1NE3A 2Q2UA 4EX5A 1D8LA 5IYCH 3OTOQ 3K81C 3M3YH 4JCVE 1WOCA 1YIJA 1OXXK 4DUYL 2HIXA 4A75A 1HNZQ 1IBML 2NVXH 3AFQA 1BBUA 1OXTA 4LUVA 3U50C 3CXCA 1LM0A 1X9NA 3D31A 4LF6L 4JI1Q 4OO1I 4YWKA 4L5SA 2OQKA 1QVCA 2OQ0A 2ZTDA 4A3CH 4HJ9A 4OXPA 2NVTH 1XMOQ 3PGZA 3HOYH 1Q1BA 4YY3Q 2OTLA 3PF5A 2R7ZG 3PO2G 3PUXA 1KL9A 4AIMA 4DV0Q 1PA6A 4DV1L 3I4MH 2UXDL 2JEBI 4O0AA 1QVFA 4DR6Q 2UXCL 3CCEA 1N32Q 1SN8A 4JI5L 5LMUQ 3UE1A 1HNXQ 4NXML 2UUAQ 4GKJQ 1YHQA 1VQHA 1SR3A 4A3FG 3A0JA 4JI4Q 4JBMA 2AWNA 2N78A 4QIWE 3RLOA 1KRTA 5GADC 1GO3E 3JAMi 1OXVA 2CQOA 5FLMH 2JA8G 1KXLA 1JJCB 2YU9H 2NN6I 5J3BA 1HNZL 4GOPB 4YWLA 4HIOA 2R93H 1JJGA 3OYYA 2ZJPA 4A3DH 4JI1L 3B6YA 1GD7A 4DR3L 1HR0Q 4R4IA 4IO9A 1VQMA 4A3KG 2R7DA 2VQFQ 2WFWA 1BVSA 3J80i 3S2HH 1XMOL 3RZOH 3TRZA 2N3SA 2E2JH 4YY3L 4R4QA 2HQLA 3Q8DA 3W1GA 4DV5L 4DV0L 1Y14B 1VCIA 1VQCA 2PNHA 4IJLA 2HIVA 1VQNA 1K3RA 3M4PA 4DR6L 4BBSH 2K50A 2ZM6Q 1TWAH 3T1HQ 1Y1WH 2WB1E 4H02A 5LMUL 1Q86C 1N8RC 1C9OA 4QGUA 2UUAL 1IXRA 1T9HA 3ULLA 4UP8A 4JBWA 4PZ6A 3NBHB 4JI4L 4DR1Q 4KHPQ 2IHEA 3L2PA 1VQGA 1VQKA 2JA6G 4IFDG 1TXYA 4B3SQ 2JK8A 1VQ6A 4WJ3M 2VY3A 4A3IG 2MNAA 3GTJH 1ASYA 4PZ8A 4PG3A 4JBKA 4DAYB 1PYSB 1VQBA 5M5XH 4O2DA 3TS2A 1HZ9A 1UE6A 1B70B 4GOPA 4A3EG 2VUMG 2JJQA 1YITA 4IPDA 2GVAA 3WWVA 2Q2IA 4C3JH 2VQFL 2UUCL 1K73C 5M3FH 4OO1G 2A19A 3S14H 1D7QA 2VL6A 1FVIA 1K8GA 3CCJA 4A3BG 3EN2A 4LF4Q 2R6GA 1GKHA 5C44G 3F2BA 3PO3G 4A3LH 1MKHA 1RL2A 3HOWH 2PI2E 3UE0A 5GQOA 4GS3A 5IWAL 1L1OB 4GNXB 1XNQQ 4PMWA 2ZM6L 1WJJA 3G4SA 4DUZQ 2HHHL 4QL5A 1MJEA 2JEAI 4UPAA 2KHIA 2E2HH 4KHPL 1TWCH 3GO5A 3HOXG 1QVGA 3MXNB 3PF4A 4DAMA 1S40A 1SFOH 3F2CA 1N36Q 1JT8A 3KOJA 4PZ7A 1IZ6A 4B3SL 5C4XG 2CFMA 3J81j 5FJ8H 2LXKA 1YI2A 1K9MC 4C3HH 1MIUA 2IY5B 3MEFA 1WCMG 2EQSA 2VS1A 4IPHA 4LFCL 4JI2Q 2R92H 4LFBQ 3HOVH 2RHQB 1X55A 3HKZE 3CPFA 4XTCS 3PIOA 4A3GG 2NN6G 3ULPA 4FDBA 2GVBA 4X6AH 5IYCG 5IY0A 3CCUA 4JBJA 4LNQA 2F3IA 5M3MH 3S17H 4BBRH 3HOZH 4P72A 1WI5A 1UE1A 5IYBH 1A0IA 4NXNL 3SGIA 1IL2A 4Y7NH 3JAMc 4B3RQ 3JC66 3GTQH 2OCEA 3PUYA 1XNQL 4DUZL 1Q7YC 1CKNB 4JOIC 4JI8Q 3F2DA 4HJ7A 2EIFA 2PI2A 4A3CG 2Z6KC 5LMNQ 4GNXA 1P16A 1AE2A 1L1OA 1UWVA 3HOYG 4B3ML 4OWTB 1NY4A 1G51A 1XMQQ 3I2ZA 4P75A 5BR8Q 3J80c 3GTMH 2UUBQ 4IFDJ 3UDIA 3I4MG 4UP9A 2HT1A 2CKZB 4R1JA 4JYAQ 2NVYH 2JQOA 3S24A 5C3EH 4GLVB 2QA4A 1NJIC 4X62Q 1XJVA 4Y52H 3I7FA 3FKIH 1U5KA 2MFIA 3AYHB 3HKSA 1QZGA 1E24A 3FHWA 4LF5Q 3NEMA 5FLMG 1X6OA 4JV5L 1E1OA 1BBWA 1HZBA 4DK6C 1OTCA 2MO0A 2R93G 4B3RL 3A5UA 3H3VH 4A3DG 4BY7H 4NPSA 2B63H 4GN3B 4RG1A 3KFUA 2D62A 1L2FA 1X54A 1Z9FA 1SROA 2WB1G 1VQOA 1J5EQ 1YJWA 4C2MH 1NMFA 4HJ8A 4YCWA 1S72A 1CKNA 1VS0A 1S3OA 5IE8A 2F52A 3CP0A 4AYBE 1I94L 4A3JH 2MO1A 4BBSG 4DR4Q 4JYAL 3I4NH 3KJOA 1Y1WG 5GAEC 5EAYA 4ME3A 2E5LQ 3EIVA 2I5LX 4X62L 1HNWQ 2XGTA 3OTOL 4GKKQ 1P8LA 1Y1VH 4LF5L 2YTVA 4DV3Q 1E7ZA 4AH6A 5ELNA 4POFA 4LF9Q 1XNRQ 1MJCA 3ULJA 1PH6A 2Z0SA 1PH2A 3S1MH 4DR5Q 3TQYA 3I55A 1J6QA 1IYJB 1VQLA 4X64Q 2N49A 4J15A 3U58A 2JA5H 5GROA 2JE6I 4OWXB 4DR2Q 1EIYB 3NENA 1PH8A 2A1AA 2R7ZH 5IP7H 1YBYA 5M3FG 4JC0A 3H3VI 2Q2TA 4R4OA 2FXQA 4A3LG 2KCTA 2XTIA 1N32L 2RCNA 3ER0A 4C3IH 2VQEQ 2JA7H 3HOUH 1WFQA 4P73A 1HNXL 3HOWG 4GKJL 2D0OA 3BZKA 3KDFB 3CCVA 3W5OA 2K5NA 2E5LL 1K83H 3PO2H 1BKBA 1OXUA 3PUZA 4HIMA 4DPGA 4IOCA 3K7AH 5JEAG 3HKZG 1M1KC 1LYLA 3ZJYC 1JMCA 1M90C 3STBC 1Z47A 2KENA 4DV3L 4LF9L 4ALPA 4BY1H 1XNRL 3GTPH 1HNWL 4A3MH 4GN5A 4TQUS 1IBKQ 1VQPA 5FJ8G 2L15A 1TWHH 1HR0L 3LGJA 1CKOA 2F4VQ 2R92G 4X64L 1EWIA 2K52A 3HOVG 1XPRA 3DM3A 4YCVA 4IPCA 4DV4Q 3CAMA 1VQEA 4BA1I 3KJPA 2DGYA 1N9WA 4K0KQ 4P74A 4JI3Q 3AEVA 1XPOA 1PH7A 1GVPA 5M3MG 1KRSA 3BJUA 2CWAA 3M85A 4JI6Q 3HOZG 3T1YQ 3L0OA 4KI0A 1PV4A 2WP8J 3PUWA 5IYBG 1PH3A 2VQEL 3T1HL 1WYDA 4X65Q 3RZDH 5H1SE 4LUOA 4L5QA 2C35B 3FP9A 5AJ3Q 4LF7Q 1FJGQ 3H0GH 4DR1L 3A74A 2KHJA 1KC8C 5FLXc 1N34Q 5ELOA 1KD1C 3KDFA 5IYDH 2OTJA 3CC4A 2NVQH 1H95A 1IBLQ 1G6PA 3CW2C 1X3EA 4YHHQ 2E8GA 2NZOA 1G291 2UXBQ 2K4KA 4GLXA 1B8AA 3K8AA 4IPGA 4X66Q 2LXJA 3L7ZC 2BH2A 2F4VL 5C3EG 3CF5A 1JE5A 1UE7A 4DR7Q 2B3GA 1PYBA 1VQ5A 1HH2P 3KF6B 3CCQA 3FKIG 5DLQE 2E2IH 4K0KL 1NMGA 4LF4L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1R H;  5JJL A;  1N33 Q;  2VZA A;  4QY7 A;  2DUD A;  4BXX H;  4A93 H;  2K5V A;  4X65 L;  4AYB G;  4LF8 Q;  1U0L A;  4L5R C;  4DNI A;  3ICE A;  2Y0S E;  4NB3 A;  5AJ3 L;  1X3F A;  4JG2 A;  1FJG L;  2B63 G;  3W1B A;  1LUZ A;  3ERS X;  1CSQ A;  1W3S A;  1HR0 W;  1N34 L;  1N36 L;  3PV0 A;  3CCS A;  4HJ5 A;  1YZ6 A;  3M9B A;  2VW9 A;  1DGS A;  1XTD A;  4RMF A;  5JEA J;  1PH9 A;  4B3T Q;  1B7Y B;  1CKM A;  2BA1 A;  4DUY Q;  3AQQ A;  1VQJ A;  2YV5 A;  1VQ9 A;  2UXB L;  4LFB L;  5C0X I;  4JI2 L;  4A3J G;  4X66 L;  1JB7 A;  1Q12 A;  2B29 A;  3J7Z C;  3I4N G;  3D0F A;  3S16 H;  2EXD A;  2WAQ E;  1C7Y A;  3UDF A;  4DV7 Q;  2ZJR A;  1RIP A;  4GNX C;  4IJH A;  4YCU A;  5IP9 H;  1EOV A;  1JJ2 A;  5JJK A;  1Y1V G;  1X65 A;  2K14 A;  2QGQ A;  3KF6 A;  1Q46 A;  3RLF A;  1GM5 A;  2AKW B;  2ATW A;  2UXD Q;  4R4C A;  4APV A;  3GTO H;  2K5H A;  2KBN A;  3K0X A;  3I4O A;  4JI8 L;  2MQH A;  4KHZ A;  2NZH A;  4LF8 L;  3KYH C;  4NXM Q;  2JA5 G;  5LMN L;  3GTL H;  2ASB A;  2IX0 A;  4AQY Q;  4DV6 Q;  1AE3 A;  3CC2 A;  5IP7 G;  1YNX A;  3CQZ H;  3J81 i;  3DLL A;  1KHI A;  1XMQ L;  3PCO B;  5BR8 L;  4B3T L;  2UUB L;  3NEL A;  1I6H H;  1EIF A;  5E7N A;  1FGU A;  2RF4 A;  4UY8 C;  1K0R A;  1EYG A;  1VQI A;  3RN2 A;  2JA7 G;  3HOU G;  2VNU D;  3S1Q H;  5HY6 A;  4DR3 Q;  2ZJQ A;  3CCM A;  3J7A 5;  3H15 A;  4JI0 Q;  1YHA A;  4LUZ A;  3KF8 B;  1UE5 A;  4DV7 L;  3OW2 A;  4YWM A;  3M7N A;  1K8A C;  2AMC B;  1KQS A;  4POG A;  1NTG A;  1C0A A;  3GDE A;  1ASZ A;  1VQD A;  2QEX A;  4L5T A;  4DV5 Q;  4BY1 G;  1EQQ A;  1HJP A;  4LW1 A;  1SMX A;  1OXS C;  4LFA Q;  1I5F A;  5HGQ A;  3G6E A;  2CWP A;  4A3M G;  3CCL A;  5M5W H;  1PVO A;  1J5E L;  3RN5 A;  1UEB A;  3TEH B;  3E0E A;  3U4Z A;  3K80 C;  3PUV A;  2I5M X;  4HJA A;  4AQY L;  4DV6 L;  4BA2 I;  3GD7 A;  3M4Q A;  1V9P A;  1Q82 C;  2JA9 A;  3A5Z B;  3KLW A;  1Q81 C;  4DR4 L;  2I5H A;  1AH9 A;  4DK3 C;  1HZC A;  1I50 H;  2IT1 A;  2BH8 A;  1W2B A;  3S1N H;  3CD6 A;  4IOA A;  3K7U C;  4QJF A;  1YJ9 A;  5IT9 c;  4GKK L;  3H0G G;  4JI0 L;  5C0X G;  2UUC Q;  1SRU A;  1SLJ A;  3VDY A;  3TS0 A;  2N8N A;  5GAG C;  2ALY B;  5IYD G;  2AWO A;  3PIP A;  1VQ4 A;  1QZH A;  1PHJ A;  1V1Q A;  4DR5 L;  3RLN A;  5LMN W;  2H5X A;  4JI7 Q;  4MTN A;  4LFA L;  4WJ4 A;  1VQA A;  5IWA Q;  4A3F H;  2ZTE A;  3RR5 A;  1PH5 A;  4DR2 L;  2HHH Q;  1VQF A;  1KIX A;  1QUQ B;  1CUK A;  3BZC A;  2Y0S G;  1I3Q H;  2JA8 H;  4BBR G;  1A8V A;  2R7F A;  1TWG H;  1XPU A;  2D0P A;  4HID A;  1X56 A;  5JJI A;  2PQA B;  3AFP A;  4GN4 B;  5M5Y H;  4MNO A;  1YJN A;  1PH4 A;  4GOP C;  4A3K H;  5C4J H;  4LFC Q;  4BXX G;  4A93 G;  2A8V A;  1Q8K A;  2OWO A;  1FL0 A;  1A63 A;  1SE8 A;  4DV2 Q;  3U4V A;  3CPW A;  2WAQ G;  3E9H A;  4KLK A;  3GTG H;  3S15 H;  3HFZ B;  2KCM A;  2Q2H A;  1YHB A;  1IBK L;  3UDX A;  2YTY A;  4OWW B;  3S2D H;  3E9I A;  4JI7 L;  4NXN Q;  2IX1 A;  2LSS A;  2PMZ E;  2AHO B;  4P71 A;  3J81 c;  5GAH C;  1A62 A;  4GLA C;  4DV4 L;  1L0W A;  4R4T A;  4OON A;  4JI3 L;  2ID0 A;  3CCR A;  2JA6 H;  1CSP A;  5IP9 G;  4JI6 L;  2YTX A;  1PFS A;  3CC7 A;  3F8T A;  3T1Y L;  4B3M Q;  3BU2 A;  1HZA A;  4A3I H;  1QUQ A;  1LTL A;  1E22 A;  4HIK A;  3G71 A;  4UP7 A;  1EUJ A;  2V1C C;  1YVC A;  4BY7 G;  2UU9 Q;  2VUM H;  4LF7 L;  4JOI A;  3RNU A;  4A3E H;  1R9T H;  1X3G A;  2ZTC A;  4OX9 Q;  3M4O H;  3EBE A;  2Z6K A;  3STB D;  2PQA A;  2BA0 A;  4XIG S;  4DKA C;  3CMA A;  2GN5 A;  1IBL L;  4TVA B;  4A3B H;  4YHH L;  3I56 A;  3IRB A;  1V43 A;  1E1T A;  1KAW A;  5C44 H;  4DV2 L;  1IBM Q;  2RHS B;  3PO3 H;  5C0X J;  2IHF A;  4A4I A;  2CCZ A;  4LF6 Q;  4JV5 Q;  4LWC A;  1YEZ A;  4A76 A;  1VQ7 A;  1E3P A;  1O7I A;  4MZ9 A;  1PH1 A;  2I0Q A;  3G48 A;  3CME A;  4DR7 L;  2ES2 A;  4QQB X;  2YYZ A;  1NBW A;  3HOX H;  2K75 A;  3GTK H;  1L1O C;  1Q1E A;  3UDG A;  5K36 G;  3F1Z A;  5C4X H;  3TRE A;  1N33 L;  4DV1 Q;  1EFW A;  4EQ5 A;  2UXC Q;  1WCM H;  1TWF H;  3PSI A;  1VQ8 A;  4JI5 Q;  4IFD I;  1I94 Q;  4A3G H;  1EQR A;  2UU9 L;  4OX9 L;  1NE3 A;  2Q2U A;  4EX5 A;  1D8L A;  5IYC H;  3OTO Q;  3K81 C;  3M3Y H;  4JCV E;  1WOC A;  1YIJ A;  1OXX K;  4DUY L;  2HIX A;  4A75 A;  1HNZ Q;  1IBM L;  2NVX H;  3AFQ A;  1BBU A;  1OXT A;  4LUV A;  3U50 C;  3CXC A;  1LM0 A;  1X9N A;  3D31 A;  4LF6 L;  4JI1 Q;  4OO1 I;  4YWK A;  4L5S A;  2OQK A;  1QVC A;  2OQ0 A;  2ZTD A;  4A3C H;  4HJ9 A;  4OXP A;  2NVT H;  1XMO Q;  3PGZ A;  3HOY H;  1Q1B A;  4YY3 Q;  2OTL A;  3PF5 A;  2R7Z G;  3PO2 G;  3PUX A;  1KL9 A;  4AIM A;  4DV0 Q;  1PA6 A;  4DV1 L;  3I4M H;  2UXD L;  2JEB I;  4O0A A;  1QVF A;  4DR6 Q;  2UXC L;  3CCE A;  1N32 Q;  1SN8 A;  4JI5 L;  5LMU Q;  3UE1 A;  1HNX Q;  4NXM L;  2UUA Q;  4GKJ Q;  1YHQ A;  1VQH A;  1SR3 A;  4A3F G;  3A0J A;  4JI4 Q;  4JBM A;  2AWN A;  2N78 A;  4QIW E;  3RLO A;  1KRT A;  5GAD C;  1GO3 E;  3JAM i;  1OXV A;  2CQO A;  5FLM H;  2JA8 G;  1KXL A;  1JJC B;  2YU9 H;  2NN6 I;  5J3B A;  1HNZ L;  4GOP B;  4YWL A;  4HIO A;  2R93 H;  1JJG A;  3OYY A;  2ZJP A;  4A3D H;  4JI1 L;  3B6Y A;  1GD7 A;  4DR3 L;  1HR0 Q;  4R4I A;  4IO9 A;  1VQM A;  4A3K G;  2R7D A;  2VQF Q;  2WFW A;  1BVS A;  3J80 i;  3S2H H;  1XMO L;  3RZO H;  3TRZ A;  2N3S A;  2E2J H;  4YY3 L;  4R4Q A;  2HQL A;  3Q8D A;  3W1G A;  4DV5 L;  4DV0 L;  1Y14 B;  1VCI A;  1VQC A;  2PNH A;  4IJL A;  2HIV A;  1VQN A;  1K3R A;  3M4P A;  4DR6 L;  4BBS H;  2K50 A;  2ZM6 Q;  1TWA H;  3T1H Q;  1Y1W H;  2WB1 E;  4H02 A;  5LMU L;  1Q86 C;  1N8R C;  1C9O A;  4QGU A;  2UUA L;  1IXR A;  1T9H A;  3ULL A;  4UP8 A;  4JBW A;  4PZ6 A;  3NBH B;  4JI4 L;  4DR1 Q;  4KHP Q;  2IHE A;  3L2P A;  1VQG A;  1VQK A;  2JA6 G;  4IFD G;  1TXY A;  4B3S Q;  2JK8 A;  1VQ6 A;  4WJ3 M;  2VY3 A;  4A3I G;  2MNA A;  3GTJ H;  1ASY A;  4PZ8 A;  4PG3 A;  4JBK A;  4DAY B;  1PYS B;  1VQB A;  5M5X H;  4O2D A;  3TS2 A;  1HZ9 A;  1UE6 A;  1B70 B;  4GOP A;  4A3E G;  2VUM G;  2JJQ A;  1YIT A;  4IPD A;  2GVA A;  3WWV A;  2Q2I A;  4C3J H;  2VQF L;  2UUC L;  1K73 C;  5M3F H;  4OO1 G;  2A19 A;  3S14 H;  1D7Q A;  2VL6 A;  1FVI A;  1K8G A;  3CCJ A;  4A3B G;  3EN2 A;  4LF4 Q;  2R6G A;  1GKH A;  5C44 G;  3F2B A;  3PO3 G;  4A3L H;  1MKH A;  1RL2 A;  3HOW H;  2PI2 E;  3UE0 A;  5GQO A;  4GS3 A;  5IWA L;  1L1O B;  4GNX B;  1XNQ Q;  4PMW A;  2ZM6 L;  1WJJ A;  3G4S A;  4DUZ Q;  2HHH L;  4QL5 A;  1MJE A;  2JEA I;  4UPA A;  2KHI A;  2E2H H;  4KHP L;  1TWC H;  3GO5 A;  3HOX G;  1QVG A;  3MXN B;  3PF4 A;  4DAM A;  1S40 A;  1SFO H;  3F2C A;  1N36 Q;  1JT8 A;  3KOJ A;  4PZ7 A;  1IZ6 A;  4B3S L;  5C4X G;  2CFM A;  3J81 j;  5FJ8 H;  2LXK A;  1YI2 A;  1K9M C;  4C3H H;  1MIU A;  2IY5 B;  3MEF A;  1WCM G;  2EQS A;  2VS1 A;  4IPH A;  4LFC L;  4JI2 Q;  2R92 H;  4LFB Q;  3HOV H;  2RHQ B;  1X55 A;  3HKZ E;  3CPF A;  4XTC S;  3PIO A;  4A3G G;  2NN6 G;  3ULP A;  4FDB A;  2GVB A;  4X6A H;  5IYC G;  5IY0 A;  3CCU A;  4JBJ A;  4LNQ A;  2F3I A;  5M3M H;  3S17 H;  4BBR H;  3HOZ H;  4P72 A;  1WI5 A;  1UE1 A;  5IYB H;  1A0I A;  4NXN L;  3SGI A;  1IL2 A;  4Y7N H;  3JAM c;  4B3R Q;  3JC6 6;  3GTQ H;  2OCE A;  3PUY A;  1XNQ L;  4DUZ L;  1Q7Y C;  1CKN B;  4JOI C;  4JI8 Q;  3F2D A;  4HJ7 A;  2EIF A;  2PI2 A;  4A3C G;  2Z6K C;  5LMN Q;  4GNX A;  1P16 A;  1AE2 A;  1L1O A;  1UWV A;  3HOY G;  4B3M L;  4OWT B;  1NY4 A;  1G51 A;  1XMQ Q;  3I2Z A;  4P75 A;  5BR8 Q;  3J80 c;  3GTM H;  2UUB Q;  4IFD J;  3UDI A;  3I4M G;  4UP9 A;  2HT1 A;  2CKZ B;  4R1J A;  4JYA Q;  2NVY H;  2JQO A;  3S24 A;  5C3E H;  4GLV B;  2QA4 A;  1NJI C;  4X62 Q;  1XJV A;  4Y52 H;  3I7F A;  3FKI H;  1U5K A;  2MFI A;  3AYH B;  3HKS A;  1QZG A;  1E24 A;  3FHW A;  4LF5 Q;  3NEM A;  5FLM G;  1X6O A;  4JV5 L;  1E1O A;  1BBW A;  1HZB A;  4DK6 C;  1OTC A;  2MO0 A;  2R93 G;  4B3R L;  3A5U A;  3H3V H;  4A3D G;  4BY7 H;  4NPS A;  2B63 H;  4GN3 B;  4RG1 A;  3KFU A;  2D62 A;  1L2F A;  1X54 A;  1Z9F A;  1SRO A;  2WB1 G;  1VQO A;  1J5E Q;  1YJW A;  4C2M H;  1NMF A;  4HJ8 A;  4YCW A;  1S72 A;  1CKN A;  1VS0 A;  1S3O A;  5IE8 A;  2F52 A;  3CP0 A;  4AYB E;  1I94 L;  4A3J H;  2MO1 A;  4BBS G;  4DR4 Q;  4JYA L;  3I4N H;  3KJO A;  1Y1W G;  5GAE C;  5EAY A;  4ME3 A;  2E5L Q;  3EIV A;  2I5L X;  4X62 L;  1HNW Q;  2XGT A;  3OTO L;  4GKK Q;  1P8L A;  1Y1V H;  4LF5 L;  2YTV A;  4DV3 Q;  1E7Z A;  4AH6 A;  5ELN A;  4POF A;  4LF9 Q;  1XNR Q;  1MJC A;  3ULJ A;  1PH6 A;  2Z0S A;  1PH2 A;  3S1M H;  4DR5 Q;  3TQY A;  3I55 A;  1J6Q A;  1IYJ B;  1VQL A;  4X64 Q;  2N49 A;  4J15 A;  3U58 A;  2JA5 H;  5GRO A;  2JE6 I;  4OWX B;  4DR2 Q;  1EIY B;  3NEN A;  1PH8 A;  2A1A A;  2R7Z H;  5IP7 H;  1YBY A;  5M3F G;  4JC0 A;  3H3V I;  2Q2T A;  4R4O A;  2FXQ A;  4A3L G;  2KCT A;  2XTI A;  1N32 L;  2RCN A;  3ER0 A;  4C3I H;  2VQE Q;  2JA7 H;  3HOU H;  1WFQ A;  4P73 A;  1HNX L;  3HOW G;  4GKJ L;  2D0O A;  3BZK A;  3KDF B;  3CCV A;  3W5O A;  2K5N A;  2E5L L;  1K83 H;  3PO2 H;  1BKB A;  1OXU A;  3PUZ A;  4HIM A;  4DPG A;  4IOC A;  3K7A H;  5JEA G;  3HKZ G;  1M1K C;  1LYL A;  3ZJY C;  1JMC A;  1M90 C;  3STB C;  1Z47 A;  2KEN A;  4DV3 L;  4LF9 L;  4ALP A;  4BY1 H;  1XNR L;  3GTP H;  1HNW L;  4A3M H;  4GN5 A;  4TQU S;  1IBK Q;  1VQP A;  5FJ8 G;  2L15 A;  1TWH H;  1HR0 L;  3LGJ A;  1CKO A;  2F4V Q;  2R92 G;  4X64 L;  1EWI A;  2K52 A;  3HOV G;  1XPR A;  3DM3 A;  4YCV A;  4IPC A;  4DV4 Q;  3CAM A;  1VQE A;  4BA1 I;  3KJP A;  2DGY A;  1N9W A;  4K0K Q;  4P74 A;  4JI3 Q;  3AEV A;  1XPO A;  1PH7 A;  1GVP A;  5M3M G;  1KRS A;  3BJU A;  2CWA A;  3M85 A;  4JI6 Q;  3HOZ G;  3T1Y Q;  3L0O A;  4KI0 A;  1PV4 A;  2WP8 J;  3PUW A;  5IYB G;  1PH3 A;  2VQE L;  3T1H L;  1WYD A;  4X65 Q;  3RZD H;  5H1S E;  4LUO A;  4L5Q A;  2C35 B;  3FP9 A;  5AJ3 Q;  4LF7 Q;  1FJG Q;  3H0G H;  4DR1 L;  3A74 A;  2KHJ A;  1KC8 C;  5FLX c;  1N34 Q;  5ELO A;  1KD1 C;  3KDF A;  5IYD H;  2OTJ A;  3CC4 A;  2NVQ H;  1H95 A;  1IBL Q;  1G6P A;  3CW2 C;  1X3E A;  4YHH Q;  2E8G A;  2NZO A;  1G29 1;  2UXB Q;  2K4K A;  4GLX A;  1B8A A;  3K8A A;  4IPG A;  4X66 Q;  2LXJ A;  3L7Z C;  2BH2 A;  2F4V L;  5C3E G;  3CF5 A;  1JE5 A;  1UE7 A;  4DR7 Q;  2B3G A;  1PYB A;  1VQ5 A;  1HH2 P;  3KF6 B;  3CCQ A;  3FKI G;  5DLQ E;  2E2I H;  4K0K L;  1NMG A;  4LF4 L; 
#chains in the Genus database with same CATH topology
 2VZA A;  4BXX H;  2F3V A;  2Y0S B;  4L5R C;  4JG2 A;  3VR3 A;  3W1B A;  1W3S A;  3S1R B;  1N34 L;  1DGS A;  1XTD A;  5JEA J;  3MXN A;  1Q8I A;  1VQJ A;  2F0H A;  3QIA A;  4A93 B;  2UXB L;  1UUP A;  4LFB L;  1IHZ A;  2QEJ C;  4IUU A;  3J7Z C;  2WAQ B;  2FMC A;  4DV7 Q;  1RIP A;  4YCU A;  5IP9 H;  1EOV A;  3D6C A;  1X65 A;  2SDF A;  1CK1 A;  1OO9 B;  3RLF A;  1GM5 A;  2AKW B;  1V1O A;  4ZAI A;  2ATW A;  2KBN A;  3K0X A;  4X3S A;  2JA5 G;  2ASB A;  2IX0 A;  4WFN 3;  1B3A A;  1S5B D;  4DV6 Q;  5IP7 G;  1XMQ L;  2B2V C;  3PCO B;  4B3T L;  3BYT B;  1IW7 C;  4UY8 C;  1K0R A;  1EYG A;  1VQI A;  3RN2 A;  2JA7 G;  2VNU D;  4EVO A;  4Q0F A;  3SHL A;  1M8A A;  3I90 A;  4YWM A;  4POG A;  1QE6 A;  2AUK A;  3GDE A;  1ASZ A;  3J7Y W;  1EQQ A;  1OXS C;  1I5F A;  1PZI D;  3M4Y A;  1PTO C;  5M5W H;  1CZW A;  2EPB A;  4I7Z C;  4C3J G;  1J5E L;  3U4Z A;  2KJX A;  4BA2 I;  3FVQ A;  2L0C A;  1ESR A;  1J9O A;  1W2B A;  5EQ0 A;  3CD6 A;  1YNN C;  1IYU A;  2C5C A;  3I70 A;  4JI0 L;  1IKM A;  3A7A B;  4XYQ A;  3VDY A;  4OEL B;  1QZH A;  3PIP A;  2ALY B;  2AWO A;  1VQ4 A;  1GHK A;  5I9P A;  3KF8 A;  3RLN A;  4WOR A;  1CA5 A;  2ZTE A;  1T5X D;  1HUN A;  4Q5V A;  3BZC A;  2Q8R E;  2Y0S G;  3V05 A;  2JXM B;  1A8V A;  3IAY A;  1TWG H;  3MVV A;  5JJZ A;  4HID A;  1BNZ A;  5JJI A;  4A3F B;  4GN4 B;  4MNO A;  4FF4 A;  5DEH A;  4A3K H;  5I6W A;  3T13 A;  3TSS A;  4A93 G;  4DN4 M;  4HR7 B;  2OWO A;  1D1K A;  4K5X A;  2WAQ G;  5M5Y B;  4I65 A;  3HFZ B;  2A68 D;  1PRT C;  4OWW B;  3L3O C;  4JI7 L;  2PMZ E;  3J81 c;  3SK4 A;  3SK5 A;  4XDX A;  4OON A;  4IFD H;  2JA6 H;  1CSP A;  3OOC A;  4JI6 L;  2YTX A;  4UDU C;  1PFS A;  1V1P A;  3F8T A;  2QW7 A;  4L8J A;  3BU2 A;  1FGB D;  1ZYR D;  1QUQ A;  2K05 A;  4A3I H;  2E75 C;  3J81 L;  1EUJ A;  3T4A C;  3RNU A;  4A3E H;  1CQV A;  1EY7 A;  2IW3 A;  1O7Y A;  2Z6K A;  3EBE A;  2PQA A;  2F03 A;  2K33 A;  5AFW A;  4RHS A;  1X3Q A;  1RHP A;  4A3B H;  1IBM Q;  1EOT A;  1BBX C;  1TS4 A;  4DXG A;  3D6W A;  2VUM B;  3M4O B;  2VXW A;  1B44 D;  3G48 A;  4QQB X;  3HOX H;  3URY A;  3DUZ A;  3UDG A;  3PO3 B;  1EU3 A;  2KA7 A;  4DV1 Q;  1WCM H;  3PSI A;  4JI5 Q;  2NN6 H;  1BO0 A;  4FYD A;  2Q2U A;  4EX5 A;  1D8L A;  2Q8I B;  2PZU A;  1EWC A;  1WOC A;  1YIJ A;  4DUY L;  3A8I E;  1VF5 C;  4A3G B;  4HSV A;  5I6Y A;  3NSW A;  2HQE A;  2A74 C;  4LK1 C;  3NTK A;  2ZTD A;  1PTO F;  1EIG A;  1GHJ A;  2NVX B;  1Q1B A;  2CW0 C;  2MPM A;  2K01 A;  1F2M A;  2UXD L;  2JEB I;  4O0A A;  5CV7 A;  4X3U A;  4K6D A;  1WTR A;  4RKB A;  4NXM L;  2NVT B;  1YHQ A;  1FD7 D;  1VQH A;  1SR3 A;  4A3F G;  3E6Z X;  2A69 C;  3MFG A;  1KRT A;  1GO3 E;  3I91 A;  4NMZ A;  3JAM i;  3I4M B;  2CQO A;  5D3I B;  2YU9 H;  3R8B A;  4YWL A;  3DMU A;  3U9O A;  2ZJP A;  3RD4 A;  3B6Y A;  4IO9 A;  5LL6 X;  1VQM A;  2DJG C;  5ELF A;  1ESF A;  2WFW A;  1XX8 A;  1D5X C;  1VF7 A;  4YY3 L;  2R93 B;  2ENB A;  4DV5 L;  2PNH A;  1ICF B;  2WIN B;  4BBS H;  4DR6 L;  1CHP D;  4H02 A;  1LTB D;  2XWB B;  3ZYY X;  3NBH B;  3HS0 C;  3VR4 A;  2IHE A;  2TMP A;  1E2V A;  3L2P A;  1IYV A;  1KDC A;  1TWA B;  1ASY A;  3GTJ H;  1PRT F;  4JBK A;  4DAY B;  1PYS B;  1VQB A;  1STY A;  2NTT A;  1UE6 A;  4GOP A;  1B70 B;  2VUM G;  4NW2 A;  2Q2I A;  2UUC L;  1K73 C;  4OO1 G;  1KNE A;  2VL6 A;  1FVI A;  1I4H A;  4NKL A;  1H9K A;  4A3L H;  4FF3 A;  4G57 A;  3PO3 G;  1MKH A;  3UE0 A;  1H9M A;  1L1O B;  1HTP A;  2EY5 A;  3ONA B;  4FVM A;  1GUN A;  4KHP L;  5CYU A;  3D4D A;  3MEH A;  1S40 A;  3HOW B;  3KOJ A;  3SXH A;  4B3S L;  1GUO A;  4TSS A;  4CKE A;  4C3H H;  5DM7 3;  5EKK A;  2JYO A;  1CQF A;  4F87 A;  2R92 H;  5M9O A;  2E2H B;  3HKZ B;  5IGF A;  4A3G G;  3VYS A;  1SFO B;  5IYC G;  3CCU A;  2F3I A;  4RGT A;  3OW7 A;  3S17 H;  4BBR H;  4IUN A;  1UE1 A;  3T53 B;  5IYB H;  1PTO H;  3BDL A;  4NXN L;  3SGI A;  1X3P A;  3JC6 6;  3GTQ H;  3PUY A;  1MBY A;  1XNQ L;  1CKN B;  4JOI C;  4HJ7 A;  2PI2 A;  3MXP A;  1WTX A;  4A3C G;  2G9D A;  1EU4 A;  2F0D A;  1SNC A;  4CDC C;  3GV6 A;  1ET9 A;  5BR8 Q;  3J80 c;  3GTM H;  4IFD J;  3NBI A;  3I4M G;  4UP9 A;  2JQO A;  2P5Z X;  5IOC A;  3IFD A;  4GLV B;  1TII D;  3S2D B;  1QZG A;  3NEM A;  2A6H D;  2PQE A;  4U67 3;  4PMB A;  3J80 L;  2EVB A;  5C3E B;  4G7H C;  2R93 G;  1RTO A;  5C4H A;  3BVM A;  4NPS A;  3PMF A;  2KHS A;  4IQZ A;  1U4L A;  3KFU A;  1L2F A;  1X54 A;  2K5D A;  1SRO A;  1F2Z A;  2RDH A;  2XIW A;  4C2M H;  1SDF A;  4HJ8 A;  1S72 A;  3VYU A;  1D6E C;  5J39 A;  3OMG A;  2Z4I A;  4H7B A;  1EY6 A;  2B63 B;  4DR4 Q;  1LTG D;  1FR3 A;  2E5L Q;  4X62 L;  4ZUI A;  2XGT A;  2IPK D;  4K6L A;  4DV3 Q;  4POF A;  2G9H D;  4DR5 Q;  5FO8 B;  4G7O C;  2F0G A;  2JA5 H;  1SNM A;  1HFG A;  5GRO A;  3VR2 A;  2YU9 B;  4K14 A;  1PH8 A;  3NE5 B;  5IP7 H;  3H3V I;  1EEI D;  2FXQ A;  4C1N K;  3HEJ A;  2JA7 H;  1B4O A;  1WFQ A;  4P73 A;  3HOW G;  4GKJ L;  2EE1 A;  3KLS X;  3TP6 A;  3KDF B;  3CCV A;  3MFY A;  2K5N A;  1BKB A;  2I46 A;  4DPG A;  3K7A H;  3A8J E;  3HKZ G;  2J4X A;  5BN4 A;  1WTV A;  5FO9 B;  4DNT B;  5C5L A;  1Z47 A;  2KEN A;  3MXU A;  3NPP A;  3TP7 A;  1XNR L;  3MXG A;  1IBK Q;  1NSN S;  1EFI D;  5FJ8 G;  1TWH H;  4X64 L;  1K28 A;  3NP8 A;  3DM3 A;  5CV9 A;  4PV1 C;  5KIX A;  4N9T A;  3KJP A;  4BA1 I;  1N9W A;  4BY1 B;  3AEV A;  2XWJ B;  4HN7 A;  3BJU A;  3T1Y Q;  3L0O A;  1LTR D;  1PH3 A;  1SNQ A;  2VQE L;  3T1H L;  4X65 Q;  1S4Z A;  3TBI B;  3KLS A;  1KC8 C;  2WKC A;  5ELO A;  2OTJ A;  3CC4 A;  3NBH A;  4CJ0 B;  3CW2 C;  2QDB A;  2KOL A;  1G29 1;  1HA6 A;  2K4K A;  5ELB A;  3H0G B;  3HRZ C;  3K8A A;  4IPG A;  2F4V L;  5C3E G;  3KLR A;  1PYB A;  1FNU A;  3OHX C;  5DLQ E;  4RGN A;  3S1R H;  5JJL A;  1S5F D;  2B2T C;  1N33 Q;  2DUD A;  4A93 H;  2K5V A;  1ZXT A;  4MIU A;  4U68 A;  2Y0S E;  3ND8 A;  5AJ3 L;  4BBR B;  1FJG L;  2B63 G;  3ICE A;  1CSQ A;  2B2Y A;  1N36 L;  3CCS A;  4HJ5 A;  1YZ6 A;  1WTW A;  4RMF A;  1B7Y B;  1CKM A;  5C0X I;  2AQ1 B;  4JI2 L;  2Z8L A;  1Q12 A;  1K0S A;  3ERO A;  2KUM A;  2EXD A;  2WAQ E;  2ZJR A;  2CH4 W;  2IX3 A;  2QGQ A;  2BDN A;  4DGZ A;  1B50 A;  3VA5 A;  4APV A;  3DWP A;  3S16 B;  1B9N A;  4JI8 L;  3WDN A;  4CGY B;  1DYQ A;  3I4L A;  3GQB A;  5KGU A;  4BWG B;  5FLX E;  4AQY Q;  1LTA D;  1CTM A;  3CQZ H;  4V0B A;  3DLL A;  4JW0 A;  1QCB D;  1HQM C;  1DOM A;  2RVL A;  3GTL B;  4DR3 Q;  3G7L A;  3J7A 5;  3KF8 B;  4DV7 L;  4XQQ A;  2AMC B;  1C0A A;  2QEX A;  4BY1 G;  4LW1 A;  3G6E A;  4N8F A;  1ICW A;  3PUV A;  4DV6 L;  3NTI A;  5ELD A;  3BZD B;  4IUQ A;  2Q8T A;  5J22 A;  1QIL A;  4DK3 C;  1HZC A;  3A55 A;  4IOA A;  1YJ9 A;  2KEE A;  4GKK L;  3H0G G;  3DHQ A;  1ZKO A;  3TZD A;  5HUR A;  1V1Q A;  4DK1 A;  4MTN A;  5IWA Q;  5CV8 A;  4A3F H;  3RR5 A;  1TU2 B;  1PH5 A;  2HHH Q;  2R7Z B;  1M4V A;  1V1P B;  1KIX A;  1QUQ B;  3EQL C;  4ZUJ A;  4FO2 A;  3E3X A;  5JAV A;  2L1B A;  4BBR G;  3I8Z A;  3DXJ C;  2NUC A;  1IW7 D;  1XPU A;  2D0P A;  1X56 A;  2E76 C;  2PQA B;  1SND A;  3AFP A;  5M5Y H;  1PH4 A;  4BS9 A;  3KK7 A;  1LLR D;  4KN7 C;  3BVZ A;  2FMM A;  2A8V A;  1I3Q B;  2JA8 B;  2BCO A;  1LV9 A;  1DZ1 A;  1SE8 A;  2A6E D;  5CV6 A;  2BE5 D;  1YHB A;  2Q2H A;  3UDX A;  1KLU D;  4B9X A;  1I6V C;  5C4J B;  3S2D H;  3E9I A;  2IX1 A;  3DEO A;  2K6A A;  2LSS A;  3RUZ A;  4HCE A;  5GAH C;  1DON A;  1D5Z C;  4R4T A;  3CCR A;  2IL8 A;  1H9R A;  3HP3 A;  2B8G A;  5D3D A;  1F2L A;  1GXD C;  2F0T A;  5ISR A;  3EJI A;  3G71 A;  2V1C C;  1TS3 A;  1YVC A;  2UU9 Q;  2VUM H;  1TY2 A;  4LF7 L;  4DXF A;  4OX9 Q;  3M4O H;  2MJ8 A;  3CMA A;  3STB D;  1BF4 A;  2BA0 A;  4OO1 H;  3C3L A;  2GN5 A;  1IBL L;  4QUF A;  2CHB D;  2KQ3 A;  1V43 A;  3PO3 H;  2IHF A;  4LF6 Q;  4TRD A;  4JV5 Q;  4ZKC B;  1R9T B;  1VQ7 A;  3SE0 A;  1O7I A;  1F9R A;  1AW7 A;  2ZXO A;  1Q1E A;  5A2Q L;  1R4Q B;  1TY0 A;  5C44 B;  5K36 G;  5TSS A;  1UNS A;  4H13 C;  2UXC Q;  2BOS A;  1I94 Q;  3FDT A;  3W2D A;  4A3G H;  2PPB C;  4B9W A;  1NE3 A;  1YNJ D;  4QMG A;  1GOZ A;  1EY4 A;  3Q6S A;  5IYC H;  4NDX A;  3OTO Q;  2LFN A;  2VB2 X;  3IKJ A;  2AQ3 B;  2HIX A;  4ZCK A;  4A75 A;  1IBM L;  1PFM A;  2NVX H;  2B2V A;  2K04 A;  1RF2 D;  4LUV A;  1OXT A;  4JI1 Q;  3I72 A;  4HED A;  4YWK A;  3J81 E;  1QVC A;  3CQZ B;  4A3C H;  3M3Y B;  2EJG C;  4J6H A;  4OXP A;  2NVT H;  3PGZ A;  3H09 A;  1AZP A;  2R7Z G;  3OWE B;  3PUX A;  5K5P A;  4DV0 Q;  4DV1 L;  3I4M H;  1TT2 A;  3ITP A;  4ULL A;  1GUW A;  1EY8 A;  3CCE A;  1N32 Q;  4JI5 L;  5LMU Q;  3UE1 A;  1NR2 A;  1HNX Q;  3HOY B;  4G7Z C;  2AWN A;  1IKL A;  3RLO A;  2EY2 A;  2FIN B;  2MUY A;  4R8I A;  3K58 A;  2JA8 G;  4GOP B;  4H44 C;  1TR5 A;  2R93 H;  2A73 B;  4IN3 A;  4WJW A;  4R4I A;  2K32 A;  5JPN C;  2VQF Q;  3X3N A;  2HQL A;  3Q8D A;  4A3D B;  1NAP A;  1Y14 B;  4KY5 A;  1K3R A;  3M4P A;  3QJY A;  4F7X A;  1TWA H;  1Q86 C;  5E4W C;  2Z6B A;  3S2H B;  1IL8 A;  4K8I A;  3RZO B;  4JBW A;  4C1N I;  5EPK A;  4M8A A;  1QB5 D;  1VQG A;  5FK9 C;  3S9W A;  1TQO A;  1VQK A;  2F0E A;  3MA2 B;  1VQ6 A;  4WJ3 M;  1H9J A;  2O4X A;  1ML0 D;  2K28 A;  1HUM A;  4PG3 A;  1HQR D;  2JJQ A;  4IPD A;  1EY9 A;  2HDM A;  1KAB A;  1NUC A;  2SEB D;  3CCJ A;  3EN2 A;  2R6G A;  2SOB A;  5C44 G;  3HGB A;  2EYL A;  3HOW H;  2J0T D;  1F9Q A;  4GS3 A;  1SYF A;  4PMW A;  4DUZ Q;  2X6G A;  1NNX A;  3Q23 A;  1MJE A;  2E2H H;  3BDC A;  1QVG A;  3QOL A;  3UI2 A;  4DAM A;  1PYW D;  1SFO H;  1F2Y A;  4LMQ D;  1IZ6 A;  5FJ8 H;  4ZRZ A;  1MIU A;  1PDQ A;  1SE4 A;  3MEF A;  2EQS A;  4LFB Q;  4LFC L;  2B2W A;  1A3U A;  2RHQ B;  1SMY D;  3HKZ E;  3CPF A;  4XTC S;  5CV4 A;  3PIO A;  3ULP A;  4IUR A;  2GVB A;  4IUV A;  4LNQ A;  1Y8O B;  4E6I A;  2WKD A;  4F8M A;  3HOV B;  4B3R Q;  2OCE A;  1Q7Y C;  3F2D A;  2EIF A;  4X3K A;  2Z6K C;  3DWQ A;  4GNX A;  3K59 A;  1BCP D;  2NWG A;  5ELC A;  1EY5 A;  3HOY G;  2F0J A;  4B3M L;  4KV6 A;  4OWT B;  4Y7N B;  1G91 A;  1NY4 A;  1XMQ Q;  4K5W A;  5IGD A;  1SYB A;  2EYO A;  4R1J A;  1KAA A;  1TVX A;  4JYA Q;  5C3E H;  2QA4 A;  1NJI C;  1XJV A;  4IAL A;  4Y52 H;  2A5H A;  5KNB A;  3PIP 3;  2AQ2 B;  3FHW A;  5COR A;  4LF5 Q;  1MI2 A;  1X6O A;  1STE A;  5IGB A;  1SBB B;  4DFA A;  4DK6 C;  2MO0 A;  2TSS A;  4A3D G;  4R8N A;  4HTH A;  2B63 H;  4OIJ A;  4RCO A;  1J5E Q;  3QB3 A;  4DAV A;  2MP1 A;  2RSO A;  2F52 A;  4H0L C;  3R2T A;  2XNA C;  1UAP A;  3SR1 A;  4BY7 B;  1L0Y B;  2MO1 A;  5IGG A;  4RAU C;  5EPL A;  3V96 A;  1I4P A;  3CKI B;  3P20 A;  4ME3 A;  1P8L A;  4RGO S;  1E7Z A;  1PH2 A;  1PH6 A;  1SYD A;  3MZ5 A;  2A68 C;  4RH6 A;  5IGC A;  4TKO B;  5CGK A;  1DCZ A;  1Y1V B;  1A6X A;  2A1A A;  3QOJ A;  2ZXR A;  3C2P A;  4JC0 A;  1SAP A;  1S5D D;  3TN2 A;  2HDL A;  5CR3 A;  2KCT A;  2XTI A;  2Z9H A;  2B2U A;  3J80 E;  1X32 A;  5KEE A;  4WRD A;  5L37 A;  2D0O A;  3BZK A;  1ZYR C;  4XXE A;  1HFN A;  3QWN A;  2E5L L;  3NWS A;  1PZJ D;  4HIM A;  3MTS A;  1JMC A;  3DWA A;  4C3I B;  4HMJ A;  4DV3 L;  4B08 A;  1V8Q A;  4BY1 H;  4TQU S;  4RFB A;  2F0I A;  1HR0 L;  1QWY A;  3HOV G;  1UEA B;  2HUG A;  4K0K Q;  3OIP A;  1SE3 A;  1SNP A;  1KRS A;  4JI6 Q;  1PV4 A;  3R93 A;  4LUO A;  2C35 B;  2L12 A;  3H0G H;  4DR1 L;  2KHJ A;  4KD4 A;  4FXD A;  1H95 A;  1EYD A;  1DJR D;  1STG A;  3L9A X;  2E8G A;  2NZO A;  3RZD B;  1R4P B;  1SE2 A;  1B8A A;  1QJO A;  1ENC A;  4OHJ A;  4X66 Q;  3L7Z C;  4RGM A;  1JE5 A;  1UE7 A;  5F2D A;  2NVQ B;  4K2L A;  2F3W A;  5A35 A;  1O7Z A;  2F0L A;  2EDG A;  1VQ5 A;  4LF4 L;  2DY8 A;  2HCC A;  1QNU A;  5G3L D;  1TKW B;  4QY7 A;  2KCN A;  1U9R A;  4X65 L;  1Y69 U;  4LF8 Q;  1U0L A;  3OPO A;  2PW7 A;  4NB3 A;  1X3F A;  1J8I A;  3K6O A;  3TP5 A;  1G2S A;  3ERS X;  2L11 A;  1JWS D;  4XYO A;  3PV0 A;  2BA1 A;  4DUY Q;  2RBM A;  2YV5 A;  2OT2 A;  1E2W A;  2B29 A;  3S16 H;  3D0F A;  3FPU B;  1GUS A;  1C7Y A;  3UDF A;  5I2X A;  1ZEQ X;  3FEW X;  1JJ2 A;  5JJK A;  1Y1V G;  2M2L A;  2K14 A;  3KF6 A;  3CRK C;  1LTT D;  2UXD Q;  3DEP A;  2O2L D;  3BG3 A;  4R4C A;  4HMI A;  2MQH A;  2NZH A;  4NXM Q;  5LMN L;  3GTL H;  3SK8 A;  3VYT A;  3CC2 A;  3J81 i;  1KHI A;  3GTO B;  2UUB L;  3MWY W;  3KUP A;  3VA7 A;  4C3I G;  2LKV A;  1JCK B;  2M00 A;  3CRL C;  3CCM A;  2EYF A;  5HGT A;  4K8J A;  5JVH 3;  5K36 H;  3M7N A;  4KD3 A;  2MGS A;  1K8A C;  1KQS A;  3HG9 A;  1O80 A;  4DV5 Q;  5IGE A;  3S1Q B;  1HJP A;  3CU7 A;  4LFA Q;  3SK6 A;  5HGQ A;  4FXK C;  5EBC A;  1B9M A;  3CCL A;  4RHR A;  1PVO A;  1UEB A;  3TEH B;  3E0E A;  3K80 C;  2I5M X;  1I4G A;  4AQY L;  3GD7 A;  1Q82 C;  2JA9 A;  3KLW A;  3NHH A;  1U4R A;  1Q81 C;  2I5H A;  4ZLT F;  2IT1 A;  3K7U C;  4KKU A;  5IT9 c;  4ID6 A;  3N52 A;  4J1M A;  5C0X G;  1SRU A;  1SLJ A;  2UUC Q;  3TS0 A;  5GAG C;  2R7Z H;  5IYD G;  1F77 A;  1I50 B;  5E4X A;  3S1N B;  1CHQ D;  4N9P A;  4NP5 A;  4WJ4 A;  2OF1 A;  4DR2 L;  3PO2 B;  5IT9 L;  1EIH A;  1RTN A;  3H3V C;  1FNW A;  1CA6 A;  4CBV A;  1CUK A;  1BOS A;  1JC7 A;  1I3Q H;  4L63 B;  2JA8 H;  4CDF C;  1SXT A;  1PFN A;  3GP7 A;  5C5M A;  2R7F A;  2RDG A;  1YJN A;  5C4J H;  1Q8K A;  3I3C A;  1A63 A;  1STN A;  4DV2 Q;  3U4V A;  5BN5 A;  1MSG A;  1WTH A;  2A6H C;  5EJW A;  4NXN Q;  4ABN A;  4KMU C;  1EYA A;  1A62 A;  4GLA C;  4DV4 L;  1L0W A;  3X3M A;  5DM6 3;  3GTG B;  4JI3 L;  5LHY 1;  1I4Q A;  2C9O A;  3A7L A;  3CC7 A;  3NQT A;  1HZA A;  1LTL A;  1E22 A;  4ZKB B;  4JVZ A;  1G6Z A;  1R9T H;  1X3G A;  2ZTC A;  4RCN A;  3FRP B;  4N8X 1;  4YHH L;  3I56 A;  1DD2 A;  1KAW A;  5C44 H;  1KNA A;  4HAE A;  1MGS A;  2LS0 1;  4A4I A;  2CCZ A;  2X6L A;  4LWC A;  1YEZ A;  4A76 A;  1E3P A;  4MZ9 A;  3CME A;  4DR7 L;  2H1E A;  2PZW A;  4ME5 A;  5C4Z A;  2ICI A;  2EXZ A;  1L1O C;  2F0W A;  2FJ2 A;  5KRU A;  5BN3 A;  2B2Y C;  3TRE A;  2KEC A;  4EQ5 A;  3LWU A;  1AFP A;  2SNM A;  1SJH D;  4KN4 C;  4IFD I;  1MHW C;  3WOF A;  3GTK B;  1EQR A;  2UU9 L;  4OX9 L;  3H91 A;  5LL6 S;  1KDB A;  5KNC A;  1I4X A;  5C4X B;  3M3Y H;  4JCV E;  1HNZ Q;  1TWF B;  3AFQ A;  1X9N A;  4DF7 A;  3CXC A;  1LM0 A;  4KKS A;  4LF6 L;  1W6K A;  4LJZ C;  1JR0 D;  2OQ0 A;  2F4I A;  5FOB B;  1ENF A;  4KKT A;  1XMO Q;  3C46 A;  4CKC A;  3PQI A;  3HOY H;  3PF5 A;  3PO2 G;  2PYK A;  3Q0A A;  4AIM A;  1PA6 A;  1XWE A;  2F0F A;  1Y8N B;  2UXC L;  1AN8 A;  1SN8 A;  4GKJ Q;  2UUA Q;  2PNR C;  5CV5 A;  4JI4 Q;  4QIW B;  5D65 A;  1LT5 D;  2D2C C;  5A2Q E;  4QB4 A;  5NUC A;  1S5E D;  2NBF A;  2NN6 I;  5J3B A;  3SVM A;  1Z6H A;  4HIO A;  3OMC A;  3OYY A;  4FP5 D;  4A3D H;  4JI1 L;  5COY A;  1A2T A;  3K0Y A;  3D8G A;  1BVS A;  3J80 i;  3S2H H;  3RZO H;  2N3S A;  4R4Q A;  4YIJ A;  4DV0 L;  4IJL A;  1VCI A;  1VQC A;  1VQN A;  1HPC A;  3R3O A;  2ZM6 Q;  2WB1 B;  3T1H Q;  5LMU L;  3D4R A;  2EYP A;  1C9O A;  1IXR A;  4KY6 A;  3ULL A;  2E2J B;  5EBD A;  1B2T A;  1HHV A;  1BDO A;  2K5W A;  1WVL A;  2JK8 A;  1BXT A;  1Y1W B;  2MNA A;  3K57 A;  4UHV A;  4KJN A;  4O2D A;  2F0N A;  2PO4 A;  1WD0 A;  3WWV A;  1JOQ A;  2VQF L;  1W6J A;  1D7Q A;  5T1I A;  2L5T A;  4F88 A;  1JOR A;  1PTO D;  1RL2 A;  5M5X B;  3W3A A;  2PI2 E;  4GNX B;  5GQO A;  1JOK A;  1WJJ A;  1B53 A;  1HCZ A;  4C3J B;  5M3F B;  3N6R A;  1C8C A;  2JEA I;  3S14 B;  4UPA A;  2LY7 A;  1T5E A;  3GO5 A;  4CJ1 B;  1PXU A;  3F2C A;  1N36 Q;  1JT8 A;  1XTC D;  4PZ7 A;  5C4X G;  2CFM A;  1YI2 A;  1K9M C;  1YNN D;  2IY5 B;  1TS2 A;  1SYG A;  4IPH A;  4JI2 Q;  3HOV H;  1TWC B;  2CQA A;  3T56 B;  4FXG C;  1JE4 A;  2RKS A;  1SEB D;  1O7L A;  1RCV D;  2XRS D;  4P72 A;  2ICE C;  1WI5 A;  2F0P A;  4Y7N H;  3JAM c;  4Z9C B;  1F9P A;  2G5D A;  4DUZ L;  4JI8 Q;  1C4Q A;  1HXY D;  5M3M B;  3HOZ B;  3K5M A;  1STA A;  2FFK B;  3I2Z A;  4P75 A;  3JAM L;  2CKZ B;  1K8O A;  3S24 A;  2DY7 A;  2QKI C;  3I7F A;  1U5K A;  3HKS A;  1JWM D;  2K03 A;  1E24 A;  1PRT D;  1A2U A;  5FLM G;  2NVY B;  1OTC A;  1HZB A;  4CKB A;  5I4D A;  3TP8 A;  4B3R L;  1LTI D;  3AU7 A;  3H3V H;  3FKI B;  4BY7 H;  4GN3 B;  1DOK A;  1LTS D;  2D62 A;  3FMC A;  1Z9F A;  1VQO A;  2WB1 G;  1YJW A;  1XXG A;  1NMF A;  3TZU A;  1QNK A;  4YCW A;  1VS0 A;  1S3O A;  3CP0 A;  4AYB B;  1JB3 A;  2NB0 A;  1HTL D;  4JYA L;  1LT3 D;  3KJO A;  1Y1W G;  5EAY A;  1BCP B;  1HNW Q;  4GKK Q;  1AP0 A;  1Y1V H;  5EKI A;  4LF5 L;  4A3J B;  5ELN A;  2BDO A;  4LF9 Q;  2Z0S A;  4RKL A;  3RMH A;  5IIF A;  3TDQ A;  2A6E C;  3I4N B;  4S3S A;  4V19 0;  1IYJ B;  2BE5 C;  1VQL A;  4PMC A;  3U58 A;  1CZG A;  2JE6 I;  2KCC A;  3NEN A;  4K2K A;  3MHB A;  1D2B A;  3S1M B;  5M3F G;  2Q2T A;  2XSC A;  4CDE C;  3G6J B;  2RCN A;  4C3I H;  1GUG A;  3QO2 A;  1EQT A;  3W5O A;  4DK0 A;  2AUJ D;  1OXU A;  2O5I C;  2R61 A;  5JEA G;  1M1K C;  3ZJY C;  1M90 C;  3STB C;  3IL8 A;  3HOU B;  4FNF A;  2L15 A;  1H9S A;  1K83 B;  3OWF A;  1F9S A;  1SNO A;  2J7Z A;  1EWI A;  2CW0 D;  2K52 A;  4L6T B;  1XPR A;  4YCV A;  2CVR A;  2EOT A;  1PFB A;  1VQE A;  2DGY A;  4P74 A;  1Z7T A;  1XPO A;  4A3M B;  3GTP B;  2V4D A;  1GVP A;  3OIQ A;  5M3M G;  3M85 A;  3T51 B;  3NWT A;  3HOZ G;  1SSO A;  4KI0 A;  5C3W A;  4KHV A;  1LT4 D;  5H1S E;  2A69 D;  3RZD H;  2D5D A;  3FP9 A;  4LF7 Q;  2PW5 A;  2OXP A;  3A74 A;  1QOH A;  4KTA A;  5C0X H;  1G2T A;  5CMD A;  1N34 Q;  4GZY C;  1YNJ C;  1KD1 C;  5IYD H;  2NVQ H;  1IBL Q;  1G6P A;  1X3E A;  3J7A V;  1I4R A;  4DU9 A;  3VR6 A;  2UXB Q;  4GLX A;  2PCF B;  4UAI A;  1D5M C;  1LT6 D;  2LXJ A;  2BH2 A;  1K8M A;  3CF5 A;  2GA4 B;  1B3Q A;  2KED A;  4RWS C;  3LX0 A;  3KF6 B;  4KJO A;  1SYE A;  3FKI G;  4K0K L;  1NMG A;  3SDZ A;  2RCF A;  3D4W A;  1WD1 A;  2B2W C;  4AYB G;  3D3R A;  4DNI A;  2E2I B;  5DNF A;  1LUZ A;  1HR0 W;  2EJM A;  1PH9 A;  3M9B A;  2VW9 A;  4B3T Q;  3TME A;  3AQQ A;  1VQ9 A;  2F0O A;  2LMC B;  1WTP A;  4A3J G;  1DM0 B;  4X66 L;  2NZ1 D;  1JB7 A;  3I4N G;  1GUT A;  4GNX C;  3K5O A;  4IJH A;  3SEB A;  3CHB D;  3OSO A;  3MAQ A;  1ET6 A;  1Q46 A;  3GTO H;  2K5H A;  3I4O A;  1JIC A;  4KHZ A;  1ILQ A;  4LF8 L;  3KYH C;  2EZV A;  4KK7 A;  4FF1 A;  1AE3 A;  1K3B C;  1YNX A;  3A54 A;  5KYI A;  5BR8 L;  3NEL A;  1I6H H;  2QIL A;  1CI3 M;  1EIF A;  5E7N A;  1FGU A;  2RF4 A;  2I07 B;  4M1U B;  3HOU G;  1EZ6 A;  3S1Q H;  5HY6 A;  2ZJQ A;  1ONL A;  3H15 A;  4JI0 Q;  1YHA A;  4LUZ A;  1UE5 A;  3OW2 A;  2F0U A;  2CH4 A;  1NTG A;  1ILP A;  1VQD A;  4L5T A;  4KY7 A;  1SMX A;  4A3M G;  2CWP A;  3ND9 A;  1NCV A;  3RN5 A;  5E3F A;  4P2C B;  4HJA A;  1U4P A;  1U4M A;  3M4Q A;  1E0B A;  1V9P A;  3A5Z B;  4X3T A;  4ODG A;  2SNS A;  5M5W B;  3U9S A;  4DR4 L;  1AH9 A;  1BR9 A;  1I50 H;  2BH8 A;  2B39 A;  3S1N H;  3PIO 3;  4QJF A;  1BUV T;  2O5J C;  3HZX A;  2KVM A;  1SMY C;  2EYH A;  5FO7 B;  3PO2 H;  2F0Q A;  2N8N A;  3NQI A;  1KTK A;  1PHJ A;  4DR5 L;  5LMN W;  2EY6 A;  2H5X A;  4JI7 Q;  2B2U C;  3E5S A;  4LFA L;  1VQA A;  3KBG A;  4OGQ C;  3DM1 A;  5KYL A;  1BQQ T;  2QDL A;  1VQF A;  4O1N A;  4QF4 A;  1GJX A;  3QR8 A;  4XT3 B;  4PNY A;  1BCP C;  5EGT A;  4K5V A;  4GOP C;  4LFC Q;  4BXX G;  1FL0 A;  4C56 C;  1TWG B;  4DNR B;  3CPW A;  4KLK A;  3E9H A;  3GTG H;  3S15 H;  2KCM A;  1IBK L;  2YTY A;  4A3K B;  4DA2 A;  2PMZ B;  5T1G A;  4G4K A;  2AHO B;  4P71 A;  4LAA A;  2PZT A;  2X69 A;  2ID0 A;  3P1H A;  5IP9 G;  3T1Y L;  1FYC A;  1PZK D;  4EQN A;  4B3M Q;  3KBX A;  1EZ8 A;  2HCI A;  1Q3L A;  3NXW A;  2IJ0 A;  2MHV A;  4HIK A;  4UP7 A;  5EPJ A;  4BY7 G;  4JOI A;  1LAB A;  1XYI A;  2JA6 B;  4XIG S;  4DKA C;  4QCL A;  5IT9 E;  4TVA B;  4A3I B;  3IRB A;  4DV2 L;  1E1T A;  1KDA A;  2RHS B;  2EYM A;  5C0X J;  1WTO A;  3A8K E;  4ZK9 B;  5D14 A;  4A3E B;  3BVG A;  4XQN A;  3C1F A;  2I0Q A;  1PH1 A;  1TS5 A;  2ES2 A;  2YYZ A;  5KND A;  1Y8P B;  1NBW A;  4CHT B;  2K75 A;  3GTK H;  4A3B B;  4ILW A;  4RA8 A;  3F1Z A;  5C4X H;  1N33 L;  3V2T A;  1EFW A;  1TWF H;  1VQ8 A;  2DNE A;  1SJE D;  3HOX B;  1VMC A;  2RDF A;  3QG1 A;  4R9W A;  3K81 C;  1EYC A;  1OXX K;  1WCM B;  2B8F A;  2WAC A;  1PLF A;  1BBU A;  4OO1 I;  3U50 C;  1A3T A;  3D31 A;  3FPP A;  3VYR A;  4L5S A;  1Q90 A;  2OQK A;  4HJ9 A;  1I6H B;  3J7A F;  2IWH A;  4IZ8 A;  5CC4 A;  4YY3 Q;  2OTL A;  1KL9 A;  3IFT A;  1QVF A;  4DR6 Q;  2EJF C;  1RJT A;  1EQV A;  3AMU A;  3F2U A;  2Z1C A;  2K1B A;  1B1Z A;  3A0J A;  5C6A A;  2DJF C;  4JBM A;  2N78 A;  4QIW E;  1S5C D;  5GAD C;  4IUT A;  1OXV A;  5FLM H;  5CBE E;  1KXL A;  1JJC B;  4OL7 A;  1HNZ L;  3C1E A;  2DN8 A;  1JJG A;  1GD7 A;  4DR3 L;  1HR0 Q;  2R3Z A;  4A3K G;  2R7D A;  2RSN A;  4PQX A;  1XMO L;  3TRZ A;  2WV6 D;  1HA5 A;  2K5Q A;  2E2J H;  3LWE A;  2XVS A;  1L0X B;  2ZXP A;  4I7A A;  3W1G A;  4XQJ A;  3M7G A;  2HIV A;  1BCP F;  3P7J A;  2K50 A;  2WII B;  4MHE A;  1Y1W H;  2WB1 E;  1N8R C;  2JSO A;  4QUC A;  4QGU A;  2UUA L;  1T9H A;  4UP8 A;  4PZ6 A;  1WTQ A;  1CFM A;  4JI4 L;  4IUP A;  5FKA C;  4DR1 Q;  4KHP Q;  4XT1 B;  4IFD G;  2JA6 G;  1TXY A;  1RDP D;  4ZQ3 A;  4B3S Q;  4BBS B;  3R2I A;  2VY3 A;  2K7V A;  2L4N A;  4A3I G;  1HRJ A;  4PZ8 A;  2NYZ D;  5M5X H;  2OEO A;  3TS2 A;  1HZ9 A;  5J1Z A;  4A3E G;  5JPM C;  3Q22 A;  2GVA A;  1YIT A;  4C3J H;  5M3F H;  2A19 A;  3S14 H;  1JWU D;  2L9H A;  1K8G A;  1KLG D;  3GTJ B;  4A3B G;  1RD9 D;  4LF4 Q;  1GKH A;  2F1M A;  4CJ2 C;  3F2B A;  1EL0 A;  5IWA L;  3ERQ A;  1XNQ Q;  2ZM6 L;  1STB A;  3G4S A;  2HHH L;  4QL5 A;  4JK1 C;  2H4O A;  3S15 B;  2KHI A;  1E2Z A;  5JEA H;  1EY0 A;  1TWC H;  3HOX G;  3MXN B;  4DAP A;  3NK9 A;  1RKN A;  3PF4 A;  3MC0 B;  3K5N A;  1CM9 A;  2B2T A;  4EQP A;  3J81 j;  2LXK A;  1WCM G;  2VS1 A;  1X55 A;  2NN6 G;  4FDB A;  3K5L A;  4DAY A;  4X6A H;  5IY0 A;  4JBJ A;  5M3M H;  3HOZ H;  4C3H B;  3H94 A;  2R92 B;  4HCS A;  1A0I A;  1IL2 A;  1A3V A;  1JQY D;  1O78 A;  3P75 A;  2JN4 A;  2ZT9 C;  3S17 B;  5LMN Q;  4FF2 A;  1P16 A;  1AE2 A;  1L1O A;  1II3 A;  3EVQ A;  3LNN A;  1UWV A;  1AZQ A;  1PTO B;  2RQX A;  5IOD A;  1G51 A;  4J8Q A;  3GTQ B;  2D9U A;  2UUB Q;  3UDI A;  2HT1 A;  2NVY H;  4X62 Q;  2HD3 A;  1ENA A;  2MFI A;  3AYH B;  3FKI H;  5E1F A;  3GTM B;  1NR4 A;  4JPB W;  1FNV A;  4JV5 L;  1E1O A;  2QF7 A;  1BBW A;  2N55 A;  2VB3 X;  3A5U A;  5I9O A;  1LO5 D;  3AB9 A;  4RG1 A;  2E74 C;  3WOE A;  2EY1 A;  2E2D C;  1CKN A;  1VMP A;  5IE8 A;  2F0V A;  4AYB E;  2Z4H A;  3NTH A;  5JVG 3;  4A3J H;  1I94 L;  4BBS G;  5JOB A;  2M9V A;  3I4N H;  3BYY B;  5GAE C;  2XRQ D;  4C2M B;  3EIV A;  2I5L X;  3OTO L;  3GV3 A;  1H9S B;  2F0K A;  2YTV A;  4AH6 A;  1XNR Q;  3S1M H;  1MJC A;  3ULJ A;  5C3X A;  3BDO A;  3TQY A;  3T16 A;  3I55 A;  3JAM E;  1J6Q A;  3E0J A;  1C48 A;  4X64 Q;  2N49 A;  4J15 A;  3Q24 A;  3O13 A;  1PRT B;  1CT1 D;  1AEX A;  2NTS A;  4OIK A;  5G3L F;  4OWX B;  1EWH A;  4DR2 Q;  1EIY B;  1YBY A;  2QCP X;  4R4O A;  4A3L G;  1ROD A;  1N32 L;  3EA6 A;  3ER0 A;  1STH A;  2VQE Q;  3HOU H;  2JA5 B;  1HNX L;  1DXM A;  1MSH A;  4MN3 A;  4HSP A;  1K83 H;  3PUZ A;  4IOC A;  1HNW L;  5EKL A;  2FHT A;  4CDD C;  1LYL A;  1SYC A;  3BS1 A;  2DNC A;  4EQO A;  4O42 A;  2JA7 B;  4LF9 L;  4ALP A;  3I73 A;  3GTP H;  4A3M H;  4GN5 A;  1QG7 A;  4MTK A;  1VQP A;  3LGJ A;  1CKO A;  4C3H G;  1LAC A;  2F4V Q;  2R92 G;  4OEM B;  2RA4 A;  3K7A B;  3EFX D;  4IPC A;  4DV4 Q;  3CAM A;  5DAU A;  4JI3 Q;  4EGV A;  1PH7 A;  1G8Z D;  2L55 A;  1MD2 D;  1D1I A;  1TWH B;  2CWA A;  2XN9 C;  2F0S A;  2WP8 J;  3PUW A;  5IYB G;  1EEF D;  2F0M A;  1WYD A;  5ELE A;  4L5Q A;  5AJ3 Q;  1FJG Q;  3NUC A;  5FLX c;  3KDF A;  2N88 A;  5I2Y A;  4YHH Q;  2EYJ A;  3A56 A;  1PMR A;  3VR5 A;  2JP1 A;  1A15 A;  1VDZ A;  1JOO A;  5CBA E;  3H6M A;  4DR7 Q;  2B3G A;  5FLX L;  1HH2 P;  1DOL A;  3CCQ A;  4ZYS A;  2E2I H; 
#chains in the Genus database with same CATH homology
 3S1R H;  5JJL A;  1N33 Q;  2VZA A;  4QY7 A;  2DUD A;  4BXX H;  4A93 H;  2K5V A;  4X65 L;  4AYB G;  4LF8 Q;  1U0L A;  4L5R C;  4DNI A;  3ICE A;  2Y0S E;  4NB3 A;  5AJ3 L;  1X3F A;  4JG2 A;  1FJG L;  2B63 G;  3W1B A;  1LUZ A;  3ERS X;  1CSQ A;  1W3S A;  1HR0 W;  1N34 L;  1N36 L;  3PV0 A;  3CCS A;  4HJ5 A;  1YZ6 A;  3M9B A;  2VW9 A;  1DGS A;  1XTD A;  4RMF A;  5JEA J;  1PH9 A;  4B3T Q;  1B7Y B;  1CKM A;  2BA1 A;  4DUY Q;  3AQQ A;  1VQJ A;  2YV5 A;  1VQ9 A;  2UXB L;  4LFB L;  5C0X I;  4JI2 L;  4A3J G;  4X66 L;  1JB7 A;  1Q12 A;  2B29 A;  3J7Z C;  3I4N G;  3D0F A;  3S16 H;  2EXD A;  2WAQ E;  1C7Y A;  3UDF A;  4DV7 Q;  2ZJR A;  1RIP A;  4GNX C;  4IJH A;  4YCU A;  5IP9 H;  1EOV A;  1JJ2 A;  5JJK A;  1Y1V G;  1X65 A;  2K14 A;  2QGQ A;  3KF6 A;  1Q46 A;  3RLF A;  1GM5 A;  2AKW B;  2ATW A;  2UXD Q;  4R4C A;  4APV A;  3GTO H;  2K5H A;  2KBN A;  3K0X A;  3I4O A;  4JI8 L;  2MQH A;  4KHZ A;  2NZH A;  4LF8 L;  3KYH C;  4NXM Q;  2JA5 G;  5LMN L;  3GTL H;  2ASB A;  2IX0 A;  4AQY Q;  4DV6 Q;  1AE3 A;  3CC2 A;  5IP7 G;  1YNX A;  3CQZ H;  3J81 i;  3DLL A;  1KHI A;  1XMQ L;  3PCO B;  5BR8 L;  4B3T L;  2UUB L;  3NEL A;  1I6H H;  1EIF A;  5E7N A;  1FGU A;  2RF4 A;  4UY8 C;  1K0R A;  1EYG A;  1VQI A;  3RN2 A;  2JA7 G;  3HOU G;  2VNU D;  3S1Q H;  5HY6 A;  4DR3 Q;  2ZJQ A;  3CCM A;  3J7A 5;  3H15 A;  4JI0 Q;  1YHA A;  4LUZ A;  3KF8 B;  1UE5 A;  4DV7 L;  3OW2 A;  4YWM A;  3M7N A;  1K8A C;  2AMC B;  1KQS A;  4POG A;  1NTG A;  1C0A A;  3GDE A;  1ASZ A;  1VQD A;  2QEX A;  4L5T A;  4DV5 Q;  4BY1 G;  1EQQ A;  1HJP A;  4LW1 A;  1SMX A;  1OXS C;  4LFA Q;  1I5F A;  5HGQ A;  3G6E A;  2CWP A;  4A3M G;  3CCL A;  5M5W H;  1PVO A;  1J5E L;  3RN5 A;  1UEB A;  3TEH B;  3E0E A;  3U4Z A;  3K80 C;  3PUV A;  2I5M X;  4HJA A;  4AQY L;  4DV6 L;  4BA2 I;  3GD7 A;  3M4Q A;  1V9P A;  1Q82 C;  2JA9 A;  3A5Z B;  3KLW A;  1Q81 C;  4DR4 L;  2I5H A;  1AH9 A;  4DK3 C;  1HZC A;  1I50 H;  2IT1 A;  2BH8 A;  1W2B A;  3S1N H;  3CD6 A;  4IOA A;  3K7U C;  4QJF A;  1YJ9 A;  5IT9 c;  4GKK L;  3H0G G;  4JI0 L;  5C0X G;  2UUC Q;  1SRU A;  1SLJ A;  3VDY A;  3TS0 A;  2N8N A;  5GAG C;  2ALY B;  5IYD G;  2AWO A;  3PIP A;  1VQ4 A;  1QZH A;  1PHJ A;  1V1Q A;  4DR5 L;  3RLN A;  5LMN W;  2H5X A;  4JI7 Q;  4MTN A;  4LFA L;  4WJ4 A;  1VQA A;  5IWA Q;  4A3F H;  2ZTE A;  3RR5 A;  1PH5 A;  4DR2 L;  2HHH Q;  1VQF A;  1KIX A;  1QUQ B;  1CUK A;  3BZC A;  2Y0S G;  1I3Q H;  2JA8 H;  4BBR G;  1A8V A;  2R7F A;  1TWG H;  1XPU A;  2D0P A;  4HID A;  1X56 A;  5JJI A;  2PQA B;  3AFP A;  4GN4 B;  5M5Y H;  4MNO A;  1YJN A;  1PH4 A;  4GOP C;  4A3K H;  5C4J H;  4LFC Q;  4BXX G;  4A93 G;  2A8V A;  1Q8K A;  2OWO A;  1FL0 A;  1A63 A;  1SE8 A;  4DV2 Q;  3U4V A;  3CPW A;  2WAQ G;  3E9H A;  4KLK A;  3GTG H;  3S15 H;  3HFZ B;  2KCM A;  2Q2H A;  1YHB A;  1IBK L;  3UDX A;  2YTY A;  4OWW B;  3S2D H;  3E9I A;  4JI7 L;  4NXN Q;  2IX1 A;  2LSS A;  2PMZ E;  2AHO B;  4P71 A;  3J81 c;  5GAH C;  1A62 A;  4GLA C;  4DV4 L;  1L0W A;  4R4T A;  4OON A;  4JI3 L;  2ID0 A;  3CCR A;  2JA6 H;  1CSP A;  5IP9 G;  4JI6 L;  2YTX A;  1PFS A;  3CC7 A;  3F8T A;  3T1Y L;  4B3M Q;  3BU2 A;  1HZA A;  4A3I H;  1QUQ A;  1LTL A;  1E22 A;  4HIK A;  3G71 A;  4UP7 A;  1EUJ A;  2V1C C;  1YVC A;  4BY7 G;  2UU9 Q;  2VUM H;  4LF7 L;  4JOI A;  3RNU A;  4A3E H;  1R9T H;  1X3G A;  2ZTC A;  4OX9 Q;  3M4O H;  3EBE A;  2Z6K A;  3STB D;  2PQA A;  2BA0 A;  4XIG S;  4DKA C;  3CMA A;  2GN5 A;  1IBL L;  4TVA B;  4A3B H;  4YHH L;  3I56 A;  3IRB A;  1V43 A;  1E1T A;  1KAW A;  5C44 H;  4DV2 L;  1IBM Q;  2RHS B;  3PO3 H;  5C0X J;  2IHF A;  4A4I A;  2CCZ A;  4LF6 Q;  4JV5 Q;  4LWC A;  1YEZ A;  4A76 A;  1VQ7 A;  1E3P A;  1O7I A;  4MZ9 A;  1PH1 A;  2I0Q A;  3G48 A;  3CME A;  4DR7 L;  2ES2 A;  4QQB X;  2YYZ A;  1NBW A;  3HOX H;  2K75 A;  3GTK H;  1L1O C;  1Q1E A;  3UDG A;  5K36 G;  3F1Z A;  5C4X H;  3TRE A;  1N33 L;  4DV1 Q;  1EFW A;  4EQ5 A;  2UXC Q;  1WCM H;  1TWF H;  3PSI A;  1VQ8 A;  4JI5 Q;  4IFD I;  1I94 Q;  4A3G H;  1EQR A;  2UU9 L;  4OX9 L;  1NE3 A;  2Q2U A;  4EX5 A;  1D8L A;  5IYC H;  3OTO Q;  3K81 C;  3M3Y H;  4JCV E;  1WOC A;  1YIJ A;  1OXX K;  4DUY L;  2HIX A;  4A75 A;  1HNZ Q;  1IBM L;  2NVX H;  3AFQ A;  1BBU A;  1OXT A;  4LUV A;  3U50 C;  3CXC A;  1LM0 A;  1X9N A;  3D31 A;  4LF6 L;  4JI1 Q;  4OO1 I;  4YWK A;  4L5S A;  2OQK A;  1QVC A;  2OQ0 A;  2ZTD A;  4A3C H;  4HJ9 A;  4OXP A;  2NVT H;  1XMO Q;  3PGZ A;  3HOY H;  1Q1B A;  4YY3 Q;  2OTL A;  3PF5 A;  2R7Z G;  3PO2 G;  3PUX A;  1KL9 A;  4AIM A;  4DV0 Q;  1PA6 A;  4DV1 L;  3I4M H;  2UXD L;  2JEB I;  4O0A A;  1QVF A;  4DR6 Q;  2UXC L;  3CCE A;  1N32 Q;  1SN8 A;  4JI5 L;  5LMU Q;  3UE1 A;  1HNX Q;  4NXM L;  2UUA Q;  4GKJ Q;  1YHQ A;  1VQH A;  1SR3 A;  4A3F G;  3A0J A;  4JI4 Q;  4JBM A;  2AWN A;  2N78 A;  4QIW E;  3RLO A;  1KRT A;  5GAD C;  1GO3 E;  3JAM i;  1OXV A;  2CQO A;  5FLM H;  2JA8 G;  1KXL A;  1JJC B;  2YU9 H;  2NN6 I;  5J3B A;  1HNZ L;  4GOP B;  4YWL A;  4HIO A;  2R93 H;  1JJG A;  3OYY A;  2ZJP A;  4A3D H;  4JI1 L;  3B6Y A;  1GD7 A;  4DR3 L;  1HR0 Q;  4R4I A;  4IO9 A;  1VQM A;  4A3K G;  2R7D A;  2VQF Q;  2WFW A;  1BVS A;  3J80 i;  3S2H H;  1XMO L;  3RZO H;  3TRZ A;  2N3S A;  2E2J H;  4YY3 L;  4R4Q A;  2HQL A;  3Q8D A;  3W1G A;  4DV5 L;  4DV0 L;  1Y14 B;  1VCI A;  1VQC A;  2PNH A;  4IJL A;  2HIV A;  1VQN A;  1K3R A;  3M4P A;  4DR6 L;  4BBS H;  2K50 A;  2ZM6 Q;  1TWA H;  3T1H Q;  1Y1W H;  2WB1 E;  4H02 A;  5LMU L;  1Q86 C;  1N8R C;  1C9O A;  4QGU A;  2UUA L;  1IXR A;  1T9H A;  3ULL A;  4UP8 A;  4JBW A;  4PZ6 A;  3NBH B;  4JI4 L;  4DR1 Q;  4KHP Q;  2IHE A;  3L2P A;  1VQG A;  1VQK A;  2JA6 G;  4IFD G;  1TXY A;  4B3S Q;  2JK8 A;  1VQ6 A;  4WJ3 M;  2VY3 A;  4A3I G;  2MNA A;  3GTJ H;  1ASY A;  4PZ8 A;  4PG3 A;  4JBK A;  4DAY B;  1PYS B;  1VQB A;  5M5X H;  4O2D A;  3TS2 A;  1HZ9 A;  1UE6 A;  1B70 B;  4GOP A;  4A3E G;  2VUM G;  2JJQ A;  1YIT A;  4IPD A;  2GVA A;  3WWV A;  2Q2I A;  4C3J H;  2VQF L;  2UUC L;  1K73 C;  5M3F H;  4OO1 G;  2A19 A;  3S14 H;  1D7Q A;  2VL6 A;  1FVI A;  1K8G A;  3CCJ A;  4A3B G;  3EN2 A;  4LF4 Q;  2R6G A;  1GKH A;  5C44 G;  3F2B A;  3PO3 G;  4A3L H;  1MKH A;  1RL2 A;  3HOW H;  2PI2 E;  3UE0 A;  5GQO A;  4GS3 A;  5IWA L;  1L1O B;  4GNX B;  1XNQ Q;  4PMW A;  2ZM6 L;  1WJJ A;  3G4S A;  4DUZ Q;  2HHH L;  4QL5 A;  1MJE A;  2JEA I;  4UPA A;  2KHI A;  2E2H H;  4KHP L;  1TWC H;  3GO5 A;  3HOX G;  1QVG A;  3MXN B;  3PF4 A;  4DAM A;  1S40 A;  1SFO H;  3F2C A;  1N36 Q;  1JT8 A;  3KOJ A;  4PZ7 A;  1IZ6 A;  4B3S L;  5C4X G;  2CFM A;  3J81 j;  5FJ8 H;  2LXK A;  1YI2 A;  1K9M C;  4C3H H;  1MIU A;  2IY5 B;  3MEF A;  1WCM G;  2EQS A;  2VS1 A;  4IPH A;  4LFC L;  4JI2 Q;  2R92 H;  4LFB Q;  3HOV H;  2RHQ B;  1X55 A;  3HKZ E;  3CPF A;  4XTC S;  3PIO A;  4A3G G;  2NN6 G;  3ULP A;  4FDB A;  2GVB A;  4X6A H;  5IYC G;  5IY0 A;  3CCU A;  4JBJ A;  4LNQ A;  2F3I A;  5M3M H;  3S17 H;  4BBR H;  3HOZ H;  4P72 A;  1WI5 A;  1UE1 A;  5IYB H;  1A0I A;  4NXN L;  3SGI A;  1IL2 A;  4Y7N H;  3JAM c;  4B3R Q;  3JC6 6;  3GTQ H;  2OCE A;  3PUY A;  1XNQ L;  4DUZ L;  1Q7Y C;  1CKN B;  4JOI C;  4JI8 Q;  3F2D A;  4HJ7 A;  2EIF A;  2PI2 A;  4A3C G;  2Z6K C;  5LMN Q;  4GNX A;  1P16 A;  1AE2 A;  1L1O A;  1UWV A;  3HOY G;  4B3M L;  4OWT B;  1NY4 A;  1G51 A;  1XMQ Q;  3I2Z A;  4P75 A;  5BR8 Q;  3J80 c;  3GTM H;  2UUB Q;  4IFD J;  3UDI A;  3I4M G;  4UP9 A;  2HT1 A;  2CKZ B;  4R1J A;  4JYA Q;  2NVY H;  2JQO A;  3S24 A;  5C3E H;  4GLV B;  2QA4 A;  1NJI C;  4X62 Q;  1XJV A;  4Y52 H;  3I7F A;  3FKI H;  1U5K A;  2MFI A;  3AYH B;  3HKS A;  1QZG A;  1E24 A;  3FHW A;  4LF5 Q;  3NEM A;  5FLM G;  1X6O A;  4JV5 L;  1E1O A;  1BBW A;  1HZB A;  4DK6 C;  1OTC A;  2MO0 A;  2R93 G;  4B3R L;  3A5U A;  3H3V H;  4A3D G;  4BY7 H;  4NPS A;  2B63 H;  4GN3 B;  4RG1 A;  3KFU A;  2D62 A;  1L2F A;  1X54 A;  1Z9F A;  1SRO A;  2WB1 G;  1VQO A;  1J5E Q;  1YJW A;  4C2M H;  1NMF A;  4HJ8 A;  4YCW A;  1S72 A;  1CKN A;  1VS0 A;  1S3O A;  5IE8 A;  2F52 A;  3CP0 A;  4AYB E;  1I94 L;  4A3J H;  2MO1 A;  4BBS G;  4DR4 Q;  4JYA L;  3I4N H;  3KJO A;  1Y1W G;  5GAE C;  5EAY A;  4ME3 A;  2E5L Q;  3EIV A;  2I5L X;  4X62 L;  1HNW Q;  2XGT A;  3OTO L;  4GKK Q;  1P8L A;  1Y1V H;  4LF5 L;  2YTV A;  4DV3 Q;  1E7Z A;  4AH6 A;  5ELN A;  4POF A;  4LF9 Q;  1XNR Q;  1MJC A;  3ULJ A;  1PH6 A;  2Z0S A;  1PH2 A;  3S1M H;  4DR5 Q;  3TQY A;  3I55 A;  1J6Q A;  1IYJ B;  1VQL A;  4X64 Q;  2N49 A;  4J15 A;  3U58 A;  2JA5 H;  5GRO A;  2JE6 I;  4OWX B;  4DR2 Q;  1EIY B;  3NEN A;  1PH8 A;  2A1A A;  2R7Z H;  5IP7 H;  1YBY A;  5M3F G;  4JC0 A;  3H3V I;  2Q2T A;  4R4O A;  2FXQ A;  4A3L G;  2KCT A;  2XTI A;  1N32 L;  2RCN A;  3ER0 A;  4C3I H;  2VQE Q;  2JA7 H;  3HOU H;  1WFQ A;  4P73 A;  1HNX L;  3HOW G;  4GKJ L;  2D0O A;  3BZK A;  3KDF B;  3CCV A;  3W5O A;  2K5N A;  2E5L L;  1K83 H;  3PO2 H;  1BKB A;  1OXU A;  3PUZ A;  4HIM A;  4DPG A;  4IOC A;  3K7A H;  5JEA G;  3HKZ G;  1M1K C;  1LYL A;  3ZJY C;  1JMC A;  1M90 C;  3STB C;  1Z47 A;  2KEN A;  4DV3 L;  4LF9 L;  4ALP A;  4BY1 H;  1XNR L;  3GTP H;  1HNW L;  4A3M H;  4GN5 A;  4TQU S;  1IBK Q;  1VQP A;  5FJ8 G;  2L15 A;  1TWH H;  1HR0 L;  3LGJ A;  1CKO A;  2F4V Q;  2R92 G;  4X64 L;  1EWI A;  2K52 A;  3HOV G;  1XPR A;  3DM3 A;  4YCV A;  4IPC A;  4DV4 Q;  3CAM A;  1VQE A;  4BA1 I;  3KJP A;  2DGY A;  1N9W A;  4K0K Q;  4P74 A;  4JI3 Q;  3AEV A;  1XPO A;  1PH7 A;  1GVP A;  5M3M G;  1KRS A;  3BJU A;  2CWA A;  3M85 A;  4JI6 Q;  3HOZ G;  3T1Y Q;  3L0O A;  4KI0 A;  1PV4 A;  2WP8 J;  3PUW A;  5IYB G;  1PH3 A;  2VQE L;  3T1H L;  1WYD A;  4X65 Q;  3RZD H;  5H1S E;  4LUO A;  4L5Q A;  2C35 B;  3FP9 A;  5AJ3 Q;  4LF7 Q;  1FJG Q;  3H0G H;  4DR1 L;  3A74 A;  2KHJ A;  1KC8 C;  5FLX c;  1N34 Q;  5ELO A;  1KD1 C;  3KDF A;  5IYD H;  2OTJ A;  3CC4 A;  2NVQ H;  1H95 A;  1IBL Q;  1G6P A;  3CW2 C;  1X3E A;  4YHH Q;  2E8G A;  2NZO A;  1G29 1;  2UXB Q;  2K4K A;  4GLX A;  1B8A A;  3K8A A;  4IPG A;  4X66 Q;  2LXJ A;  3L7Z C;  2BH2 A;  2F4V L;  5C3E G;  3CF5 A;  1JE5 A;  1UE7 A;  4DR7 Q;  2B3G A;  1PYB A;  1VQ5 A;  1HH2 P;  3KF6 B;  3CCQ A;  3FKI G;  5DLQ E;  2E2I H;  4K0K L;  1NMG A;  4LF4 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...