3E0EA

Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
91
Chain Sequence
MNYKISELMPNLSGTINAEVVTAYPKKEFSTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGGLEISVDNIGIIEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein A
publication title Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
rcsb
source organism Methanococcus maripaludis
total genus 22
structure length 91
sequence length 97
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3e0eA00
3PUXA 1LM0A 4YHHL 2L15A 3RN5A 1D8LA 2R93H 1XTDA 3GTMH 4QQBX 1I50H 3BZKA 1XMOL 2BH8A 4DUYQ 4LF4L 1XPRA 1EIFA 1K73C 4H02A 3CPFA 1YITA 1XMOQ 2UUCQ 5IWAL 4GNXA 3RNUA 4BBSH 1KRTA 4HJAA 3CCSA 1WOCA 5M5XH 2PMZE 4NB3A 4JI6Q 3CCJA 4LNQA 1NJIC 1VQMA 2E5LL 2R92G 1I3QH 2Z0SA 4Y7NH 1TWAH 3MEFA 3T1HL 2N3SA 2B63G 4DV7L 1MIUA 1XPUA 4A3GH 3T1HQ 2ZJRA 3JAMi 1X3FA 1Y1VG 3U58A 2CFMA 3GDEA 3OYYA 4JBMA 1MJCA 2EQSA 4P75A 5LMUL 1MJEA 2IX1A 3S1QH 2FXQA 1VQBA 4DR5L 1YEZA 3GTOH 1SMXA 2ZTCA 4BXXH 1JJ2A 3OTOL 4EQ5A 5M3MG 4LF5L 1YNXA 3H3VI 3K81C 3KYHC 1PVOA 4GKJL 3PIPA 1VQIA 2PNHA 3H0GH 4LUZA 4R4CA 4DR4L 4B3RQ 2AHOB 3F2BA 2ALYB 2WAQE 3M85A 3ULPA 4B3TL 3U4VA 3S2HH 1GD7A 1I94Q 4R4TA 3TQYA 3ZJYC 4DR1L 4B3TQ 4X65Q 1CKMA 3F8TA 1HR0W 5IYDH 3W1BA 3F2DA 3PO2G 4IJLA 4DR2L 3CCLA 3NEMA 1SRUA 1YHBA 3PUYA 3CC4A 2JA6H 1QVCA 3J7A5 2ZM6L 1N34L 4C3JH 1I6HH 2ZM6Q 4JI1Q 4A3JG 1S3OA 2JQOA 3I7FA 3A0JA 1HNXL 1WYDA 4JI0L 2JK8A 4O0AA 2E2JH 4JI0Q 1HNXQ 4LF8Q 5C3EG 5C0XG 3D0FA 4JYAL 4IOCA 3ERSX 3RLOA 3RR5A 2R7FA 2GVBA 4NXML 4K0KL 4GN4B 4QJFA 1Y1WG 3KFUA 5JJLA 3H15A 4NXMQ 1JT8A 3BU2A 3E9IA 4YY3L 4L5SA 3G48A 1IYJB 4GKKQ 1N32Q 2BH2A 2E8GA 1PH3A 4GNXC 2Q2TA 1EQRA 1HNZQ 2VZAA 3K7AH 2E2HH 3CAMA 5FLXc 2RF4A 3VDYA 3PSIA 1XNRL 3NELA 3NENA 4C3IH 3TEHB 3KJOA 3STBC 1VQPA 2N78A 3RN2A 3EN2A 2HHHQ 4HJ9A 3J80c 4A3KH 3HOYH 4A3DG 3ULLA 4GOPC 1L1OB 1HZ9A 3BJUA 4LW1A 1KXLA 3HOVG 2YTYA 3CQZH 1VQHA 5IT9c 1AH9A 1PYBA 4HJ7A 4IFDI 3D31A 3RZDH 1UE6A 4C3HH 4BY1H 2GVAA 4A93H 4DR6L 3PUWA 4PMWA 2ZTEA 1SR3A 1XJVA 1XPOA 2WFWA 2ATWA 3BZCA 1WI5A 4AYBE 1OTCA 1JJGA 4PZ6A 3S17H 5FJ8G 1UWVA 4LF9L 2K75A 4KLKA 4JI8L 4DV3Q 3HOUH 4A3FG 5M5WH 1IBLQ 2V1CC 4O2DA 3PO3H 2K50A 2UU9L 1PHJA 4DR7Q 1NY4A 3GD7A 1A62A 2CCZA 5C44G 2YYZA 1GVPA 2UXBQ 4DV2L 3FHWA 5LMNW 3H3VH 3J81i 1AE2A 3GTPH 4DV4Q 5IY0A 5IP7G 4DV5L 3AEVA 1U0LA 3HOZG 4P72A 3U50C 2CWPA 1VQKA 1KAWA 3S15H 4X64Q 3ULJA 4P71A 1VQEA 2ZTDA 2R93G 1YIJA 5HY6A 2YTXA 1BKBA 3I56A 1UEBA 4UP9A 1YHQA 3I2ZA 2I0QA 1LTLA 1I5FA 5HGQA 3GTJH 1A63A 4GLAC 1B7YB 1K0RA 2RCNA 1WCMH 4JV5Q 2UXCL 1Q82C 4B3SQ 1QZHA 4BBSG 2A1AA 5IE8A 4OO1I 2K5NA 4GS3A 1O7IA 4UP8A 3JAMc 4YHHQ 3CPWA 2I5LX 4GN5A 2VQEL 2AWNA 2E2IH 4IPGA 4DK6C 4DR4Q 4LF4Q 3L0OA 4RMFA 1K8GA 4A3BH 2NZOA 4YWKA 4YWLA 4X66L 5IWAQ 1EIYB 4A3GG 5BR8L 1Q46A 2WB1E 3TRZA 5GAHC 3NBHB 4A3MH 5BR8Q 4OXPA 3S24A 1N9WA 4IPDA 4NXNL 4KHZA 2NVQH 2F4VL 2WP8J 1X9NA 2E5LQ 1A0IA 3A74A 4LFAL 4BXXG 2Q2IA 1X3EA 3OW2A 2QGQA 2BA0A 4J15A 4DV7Q 1VQ4A 1KQSA 4GOPA 2QEXA 4RG1A 3H0GG 3CC2A 3GTKH 2K52A 2ID0A 3HKSA 5LMUQ 1PH9A 3GTLH 2I5MX 1CKNA 2R7DA 4IFDG 1Y14B 1QUQB 4DR5Q 5M5YH 3G6EA 2VY3A 1E24A 2IHEA 3ICEA 2AKWB 3OTOQ 1HR0L 3HKZE 5IYDG 4LF5Q 1FJGL 2LXJA 3JC66 1EFWA 1VQJA 2Y0SE 4B3ML 1N32L 4GKJQ 1PFSA 3KDFA 1OXSC 3F2CA 4B3MQ 2H5XA 1FVIA 2F3IA 3A5ZB 3PUVA 3FKIH 4XIGS 4HIDA 3TS2A 3TS0A 5C4JH 2OTJA 3ER0A 2D62A 2ZJQA 1TWHH 3KF8B 4DR1Q 2JA7H 1X3GA 1P8LA 4IJHA 5C0XJ 4LUOA 3PF5A 4A75A 1KHIA 4UY8C 1Q12A 1B70B 2KBNA 4OX9L 2YU9H 4DR2Q 5AJ3L 4POGA 4OX9Q 4TQUS 1PH6A 4C2MH 1V9PA 3CF5A 3M4QA 2DGYA 2JE6I 4BBRG 4HIOA 3G4SA 1QVGA 4GLVB 1N34Q 4ALPA 1CSQA 1K83H 1IZ6A 3E0EA 1C0AA 2LXKA 4JYAQ 2VS1A 3S16H 2XGTA 5IP9H 1FGUA 5H1SE 3HOXH 4LF7L 4BBRH 2EXDA 1IBML 2VNUD 3B6YA 1Q8KA 2NVXH 4K0KQ 2NVYH 4LFCL 4YY3Q 1RIPA 3CCMA 5E7NA 1VQOA 3DM3A 4A4IA 2Q2UA 1SE8A 1BBUA 3M4PA 3U4ZA 3CW2C 2PI2E 4A3KG 1FL0A 2MO1A 1YI2A 3HOYG 3RZOH 2JA8H 2VUMH 3KLWA 1PH7A 1JJCB 1G51A 1YJ9A 2NN6I 1XNRQ 2OWOA 4QIWE 1TWCH 3K80C 4MZ9A 4KHPL 2JA5H 3I4OA 1Z47A 4YCWA 4BY1G 4DV1L 4A93G 3UE0A 2YTVA 2R7ZH 3AYHB 4JBWA 4JCVE 1U5KA 5GQOA 5JJIA 3Q8DA 3J81c 3M7NA 2R6GA 4JI2L 3DLLA 4A3IH 2F52A 3HOUG 4IO9A 3CMEA 1D7QA 1QZGA 1XNQL 2RHSB 3TREA 3W5OA 3PO3G 1HZAA 1XNQQ 4LWCA 5GADC 2JA6G 4BA2I 3I4NH 4DR6Q 3I4MH 2PQAA 2B29A 1E22A 5LMNL 1VQ7A 3UDGA 1YBYA 3J81j 1HNWL 2I5HA 1W3SA 3WWVA 1W2BA 1HNWQ 2PI2A 4LF9Q 4OWTB 4JI8Q 3CC7A 1PH5A 4A3EH 4OWWB 5ELOA 5GROA 4GNXB 4DK3C 4DR3L 2QA4A 2CQOA 1N8RC 1EYGA 2UU9Q 4DV0L 3HOWH 4DAYB 1VCIA 5EAYA 3SGIA 4X6AH 4JI5L 3K0XA 4HIKA 4DV2Q 2JEAI 4JI4L 1CKOA 2EIFA 2HQLA 3PGZA 2XTIA 3UDFA 4LFBL 1WCMG 1NE3A 4DV5Q 2ZJPA 3EIVA 2ES2A 1E3PA 1Q81C 3K7UC 1VQ9A 1PH1A 3UDIA 1KC8C 1Q1EA 1JMCA 1SLJA 4GOPB 4IPHA 2KCTA 4R4IA 1M90C 2YV5A 4P73A 5C4XH 3CCUA 4FDBA 4A3BG 2Z6KA 3E9HA 5JEAG 1GM5A 2HIXA 2UXCQ 1EOVA 1VQAA 3KF6A 5J3BA 2OTLA 3T1YL 1IL2A 4A3MG 4YCVA 1Q86C 1XMQL 5GAGC 2WAQG 5IYBH 4PZ7A 2VQEQ 3CMAA 3PUZA 1PV4A 1M1KC 4KI0A 5GAEC 3M9BA 4DV6L 1KL9A 1RL2A 1H95A 4BY7H 1L1OA 1MKHA 1V1QA 1X6OA 3CCRA 4TVAB 2D0OA 1N33L 5C0XI 4X66Q 2VQFL 4JC0A 2NZHA 3S2DH 2UUBL 1EQQA 2B3GA 1KRSA 2BA1A 4DUZL 4DKAC 1KIXA 4NXNQ 5M3FH 1S40A 1CSPA 4DUZQ 2DUDA 1TWGH 2F4VQ 2HT1A 4A3CH 1HJPA 4A3LH 4LFAQ 4UP7A 1YJWA 3STBD 1YHAA 5IYCH 3HFZB 1VQGA 4DUYL 2OCEA 3CCEA 3CD6A 2UUCL 1T9HA 4R4QA 1PA6A 2D0PA 2K4KA 3FKIG 2MQHA 3UDXA 2VW9A 2IY5B 2N49A 4L5RC 4JI6L 3PCOB 4POFA 3RLNA 1LUZA 3F1ZA 2JA7G 1NTGA 4Y52H 2GN5A 1E1TA 2K14A 3PIOA 1PH8A 1HR0Q 1FJGQ 4JOIC 4QL5A 1VS0A 1L0WA 4WJ3M 3S1NH 4YCUA 1VQ6A 1TWFH 1L2FA 4JBKA 4GLXA 4BA1I 1EUJA 2CWAA 2KHIA 2JEBI 5ELNA 2R92H 2K5HA 3GTGH 4MNOA 2RHQB 3G71A 3PV0A 3KOJA 1OXXK 3KJPA 1HH2P 2AMCB 4LF6L 2B63H 5IP9G 3HOXG 5AJ3Q 2IT1A 2Q2HA 1E1OA 1N36L 2LSSA 4LF6Q 1PH4A 1K3RA 1Y1VH 1SFOH 1CUKA 1N36Q 1YJNA 4B3RL 4APVA 4L5TA 2C35B 2Z6KC 4HJ5A 1I94L 2ASBA 5DLQE 4X65L 4HIMA 4AQYL 2JA8G 2VUMG 4AYBG 5M3MH 3I55A 4AQYQ 1NMGA 1VQ5A 1IBMQ 4LF7Q 2A8VA 4OO1G 2JA9A 2PQAB 1ASZA 1G291 1UE7A 2IX0A 3LGJA 1C9OA 1OXTA 2JA5G 4LFCQ 4MTNA 1QVFA 1SN8A 1L1OC 1X54A 2KHJA 1YVCA 4DAMA 4JI1L 4AIMA 4PG3A 2R7ZG 4A76A 2HIVA 4LF8L 1Q7YC 4NPSA 1UE1A 4JG2A 1E7ZA 1SROA 1X65A 2MO0A 2VL6A 3PO2H 4A3IG 1VQ8A 3GTQH 4OWXB 1Q1BA 3W1GA 4DPGA 1QUQA 4KHPQ 1IBKL 4R1JA 4ME3A 5JJKA 4PZ8A 1G6PA 1IBKQ 4JI7L 2KENA 4WJ4A 4DV1Q 3I4NG 4A3JH 4QY7A 3I4MG 4IOAA 4JI7Q 1AE3A 1X55A 2NVTH 4GKKL 1GO3E 1LYLA 4AH6A 1YZ6A 1WFQA 3CCQA 1OXVA 5C3EH 1HNZL 3AFPA 1PYSB 1UE5A 4UPAA 4JI2Q 3RLFA 1BVSA 1GKHA 4A3EG 1R9TH 4X62L 5K36G 1VQCA 2A19A 1B8AA 1ASYA 3HOWG 1Y1WH 3AQQA 4X62Q 3FP9A 3S14H 4JBJA 3GO5A 1S72A 2KCMA 3KF6B 2UXDL 4L5QA 2HHHL 2OQ0A 5LMNQ 2UXDQ 1A8VA 3UE1A 1NBWA 1IXRA 4JOIA 1P16A 2WB1G 4LUVA 3A5UA 1JE5A 3AFQA 4P74A 3S1RH 4OONA 4DR3Q 2MFIA 4DV0Q 3CCVA 3M3YH 2MNAA 4JI5Q 3CP0A 1C7YA 5JEAJ 2N8NA 3PF4A 4JI4Q 2OQKA 2AWOA 5C4XG 4LFBQ 1NMFA 4R4OA 4A3DH 4DNIA 1WJJA 3S1MH 3M4OH 3HOVH 1BBWA 1X56A 4DV3L 5IYBG 1PH2A 3K8AA 1J6QA 4HJ8A 1IBLL 3EBEA 1K8AC 3J80i 3J7ZC 4DR7L 1TXYA 4BY7G 3HKZG 4GN3B 4XTCS 1CKNB 1HZBA 4QGUA 1VQNA 1HZCA 2UXBL 1VQDA 2Y0SG 3L7ZC 4DV4L 1VQFA 3T1YQ 1KD1C 5FJ8H 1DGSA 1XMQQ 1J5EL 3MXNB 5FLMG 4A3FH 4JI3L 1J5EQ 2JJQA 1OXUA 3L2PA 4X64L 5M3FG 3KDFB 1VQLA 2CKZB 4JI3Q 4A3CG 4DV6Q 4A3LG 3IRBA 2UUAL 1EWIA 2K5VA 4YWMA 4EX5A 5IYCG 5C44H 3CXCA 1K9MC 2UUAQ 1Z9FA 1N33Q 2VQFQ 2NN6G 4JV5L 1JB7A 5IP7H 1V43A 5FLMH 2UUBQ 4B3SL 4IFDJ 3HOZH 4IPCA 2IHFA
chains in the Genus database with same CATH superfamily
3NQIA 4J1MA 4YHHL 4YIJA 3R8BA 2CH4A 1I50H 5IWAL 4GNXA 3RNUA 1MSGA 2PMZE 1YNND 2M9VA 2F0HA 3P7JA 4LNQA 1G2SA 1NJIC 1I3QH 2N3SA 2B63G 1MIUA 1SYDA 3T1HQ 3JAMi 1A2TA 1X3FA 1Y1VG 2J7ZA 1I4GA 2SDFA 3QJYA 3K5MA 1MJCA 1UUPA 3GTMB 5DEHA 1YEZA 4BXXH 4X3UA 4EQ5A 4LF5L 1YNXA 1KDAA 3KYHC 1FR3A 1U9RA 1PVOA 4XYQA 4B3RQ 2AHOB 5I4DA 2WAQE 3ULPA 2F0TA 4B3TL 1A3VA 2HQEA 1EQVA 2F0FA 4Y7NB 4KD4A 2WV6D 4IZ8A 5ELBA 2X6LA 2CW0D 3PO2G 4IJLA 2DJFC 1CQVA 3N6RA 3J7A5 2QILA 3LNNA 1YNJC 1LTBD 3S1QB 2R92B 4QUFA 2JQOA 1HNXL 1TQOA 2CHBD 4LF8Q 5C3EG 1EY6A 1Z7TA 4JYAL 4G7OC 3P1HA 3ERSX 2GVBA 4NXML 5JJLA 1RKNA 5KNBA 1RDPD 5CYUA 4KMUC 1EU3A 1IW7C 2JP1A 3LX0A 4O1NA 3BYYB 3VDYA 3IKJA 4CDCC 1B4OA 3ERQA 3K5NA 5E1FA 5EBCA 1BCPB 2F0IA 5HGTA 4HJ9A 2E2JB 5DM63 4A3KH 4N8X1 1RODA 4A3DG 3ULLA 4GOPC 1L1OB 1HZ9A 3BJUA 2GA4B 2O4XA 3CRKC 3HOVG 3CQZH 1PYBA 4A3JB 4H0LC 1UE6A 4BY1H 1AN8A 5IOCA 1SR3A 5EBDA 1JWSD 1XPOA 2WFWA 3A8JE 2ATWA 3KLRA 1IKLA 3HOUH 1UWVA 1BOSA 4DV3Q 2B2YC 1E2WA 5M5WH 4O2DA 1JOQA 4DR7Q 1TS5A 2CCZA 4RKBA 1D5ZC 3N52A 4HSPA 3GTPH 4DV4Q 2IW3A 2CH4W 4DV5L 3M4YA 2DNEA 2JXMB 3I91A 1VQKA 1KAWA 3NK9A 3RZDB 2N88A 4C56C 3E0JA 3NTHA 2SEBD 2YTXA 1YIJA 1BKBA 4A93B 4UP9A 3I2ZA 2B2VA 2F0MA 3SXHA 4B3SQ 1QZHA 3S17B 4GS3A 1O7IA 4UP8A 3VYUA 1I4XA 3CPWA 2VQEL 1QOHA 1WTQA 4DK6C 1STBA 4LF4Q 2QF7A 4TRDA 4YWLA 4A3GG 1GOZA 1Q46A 3NBHB 4OXPA 3S24A 1DYQA 2XNAC 1DONA 4DNRB 2WIIB 4K5WA 2E5LQ 3TN2A 2PQEA 4ZYSA 2F0GA 4L63B 2BA0A 5C4HA 3W3AA 4RCOA 2F0JA 3Q24A 2R93B 1PYWD 3GTLH 3K58A 2I5MX 4IFDG 4DF7A 5CBEE 2E2IB 3J7YW 1R4QB 5DM73 3G6EA 1STHA 3H09A 2AKWB 3HKZE 4RKLA 1VQJA 5M5XB 2OEOA 4CKCA 3FDTA 4DR4Q 4HIDA 2F3IA 4F7XA 2WAQB 3QWNA 4C3JG 1HQRD 2NVQB 2ZJQA 2D62A 2VB2X 1TWAB 4IJHA 4FVMA 1F77A 1Q12A 4ZK9B 2I46A 4DR2Q 5AJ3L 4POGA 2IX3A 4OX9Q 1V9PA 3M4QA 2A68C 4BBRG 4K2LA 4OIKA 1QNUA 4KTAA 3DMUA 3S16H 3HOXH 4BBRH 1IBML 1CTMA 2EY1A 4KY6A 4YY3Q 1VQOA 3U4ZA 3M4PA 1YI2A 1FL0A 1A3UA 1SMYC 2KJXA 2JA8H 1YJ9A 4OGQC 1XNRQ 1B2TA 4MZ9A 4C1NI 2JA5H 4EQPA 3BS1A 4K8IA 1K83B 4C3HG 1I6VC 4A93G 4DV1L 2WKCA 3GV6A 1CM9A 4QB4A 4BS9A 2R7ZH 5GQOA 3DWPA 2SNMA 2H1EA 3J81c 3DLLA 1EYCA 2A6HD 1XNQL 4H13C 3W5OA 3V05A 5GADC 3NWTA 1AZQA 4EQNA 3I4MH 2BOSA 1VQ7A 3UDGA 2VUMB 1K3BC 2AQ1B 4IALA 1HUMA 3WWVA 4OWTB 4JI8Q 1HPCA 1PH5A 5GROA 4DNTB 1N8RC 1EYGA 5D3IB 2EY6A 4X6AH 2JEAI 5FLXL 2L0CA 4JVZA 3UDFA 2HQLA 5HURA 1EU4A 1G8ZD 4ID6A 2A6EC 1SEBD 2QCPX 1Q1EA 1F2YA 4GOPB 2KCTA 1UNSA 2EYHA 4R4IA 1M90C 2YV5A 4HCEA 1F2ZA 1WVLA 2L55A 1UEAB 1SXTA 5JEAG 1D6EC 5IT9L 2UXCQ 1VQAA 5J3BA 1BBXC 4A3EB 2WAQG 5FLXE 3HOWB 3CMAA 1D5MC 2KCCA 4DAPA 3M9BA 4DV6L 1RL2A 1H95A 1L1OA 1VMPA 2OT2A 1N33L 5CMDA 4X66Q 2UUBL 2Z6BA 1S40A 5IT9E 1SNCA 4LFAQ 1YJWA 5CGKA 5C4XB 5T1IA 1VQGA 2OCEA 3CD6A 3K0YA 4F8MA 1EOTA 3EA6A 1QB5D 2K4KA 3D6CA 1LO5D 2VW9A 1L0XB 2N49A 1SNOA 2MP1A 3PCOB 4A3BB 4BY7B 3HKZB 4Y52H 2L4NA 2GN5A 2K14A 1HR0Q 2QDLA 1NR4A 2RSNA 1HFNA 1VS0A 5FOBB 3S2DB 3S1NH 4YCUA 3Q6SA 3TZUA 4CJ2C 5FO9B 4JBKA 2F0UA 4BA1I 1GUSA 1TVXA 2CWAA 4OIJA 3GTGH 5DAUA 3PV0A 3KOJA 1LV9A 1MD2D 5IP9G 5NUCA 1CUKA 1N36Q 3VR3A 1NAPA 1KDBA 2EY5A 2DY8A 3JAME 2C35B 4AQYL 2VUMG 5M3MH 2A8VA 1EWHA 1HTLD 4OO1G 3OMCA 2JA9A 2Q8RE 1ASZA 2IX0A 1PRTC 2K33A 4LFCQ 5ELDA 3E6ZX 2JA7B 2ENBA 2SNSA 3BVGA 1PZID 4A76A 4X3KA 2HIVA 1U4LA 3VA5A 1E7ZA 1SROA 4A3IG 3D6WA 4HTHA 1VQ8A 1LTGD 3GTQH 3W1GA 4R1JA 4CKEA 1IBKQ 1ENCA 4JI7Q 1AE3A 1X55A 4RGOS 1YZ6A 2LY7A 1STGA 1HNZL 4IUNA 4UPAA 1PTOD 1BVSA 1GKHA 4A3EG 1R9TH 3IAYA 1VQCA 2A19A 1O7LA 2F0KA 2K5WA 5E3FA 3HOWG 4X62Q 1S5FD 1WTHA 2KCMA 1EY5A 2OQ0A 5CORA 2UXDQ 1HHVA 4C1NK 1IXRA 4LUVA 3Q23A 4RAUC 3A5UA 3AFQA 4P74A 1PDQA 3F2UA 2K7VA 3OPOA 4DR3Q 2MFIA 3TSSA 4LJZC 4U68A 3K6OA 3MAQA 1DD2A 2MNAA 3CP0A 1C7YA 5JEAJ 3PF4A 1SNQA 1V1PB 5C4XG 4LFBQ 4R4OA 2EOTA 2KECA 1PTOF 1E2ZA 5T1GA 1VMCA 4N9PA 3M4OH 1BBWA 4FXDA 4IUVA 1E0BA 5IYBG 4ABNA 1IBLL 2IJ0A 1NCVA 3OMGA 4L6TB 4BY7G 1KABA 3HKZG 1HZCA 3OHXC 1KD1C 5FJ8H 1DGSA 1XMQQ 1J5EL 3MXNB 5FLMG 2RA4A 4JI3L 4A3FH 1OXUA 3KLSX 1ONLA 4YWMA 5IYCG 2RDFA 1BO0A 2KCNA 3T4AC 2F0VA 3OIPA 1V43A 5FLMH 1Y69U 4WFN3 1JB3A 1K8MA 4HN7A 2N55A 3VA7A 1XMOL 2BH8A 1XPRA 3CPFA 2UUCQ 4TKOB 5D3DA 5BN3A 1VF7A 2ZXOA 4CBVA 3CCJA 3FMCA 2Y0SB 2QKIC 3MEFA 4DV7L 3PIO3 1XPUA 2F4IA 4I7AA 4DU9A 1TWGB 3TP5A 4JBMA 1II3A 2EQSA 4LAAA 2IX1A 5BN5A 3RD4A 1I50B 1PFMA 2ZTCA 3GTOH 3OTOL 3H3VI 3MFYA 1KDCA 5ISRA 3K81C 4GKJL 3URYA 1VQIA 3H0GH 2FHTA 2A5HA 4FXKC 4R4CA 2EJMA 2FMCA 1MHWC 2E74C 3U4VA 2B2YA 2AQ2B 1I94Q 4R4TA 3TQYA 3ZJYC 4B3TQ 4K5XA 1CKMA 1I3QB 3A55A 2K04A 3F8TA 5IYDH 1RF2D 4KV6A 1EY7A 5C5MA 3NEMA 3PUYA 4P2CB 1QVCA 4EVOA 1I6HH 2LS01 4JI1Q 1S3OA 2C5CA 2OXPA 3A0JA 3TMEA 4JI0L 1F9RA 1HNXQ 3SK6A 3D0FA 2KHSA 4ILWA 5C0XG 2BE5D 3S9WA 1HXYD 2JSOA 1DJRD 3RR5A 2R7FA 2A73B 3KFUA 4NXMQ 4GKKQ 4WRDA 1JOOA 2E8GA 2Q2TA 3W2DA 3CRLC 5D65A 2E2HH 3CAMA 5FLXc 2RF4A 4RGNA 3PSIA 2K5DA 1T5EA 1UAPA 3KJOA 3STBC 1QG7A 5C6AA 5CR3A 1XXGA 1PRTB 3HOYH 4KD3A 2YTYA 1YNNC 5IT9c 1FYCA 1AH9A 4HJ7A 4KN4C 1TY0A 1D1KA 1S5DD 4DR6L 1DOMA 1XJVA 5EJWA 2MGSA 2L12A 1WI5A 4G4KA 4AYBE 1OTCA 3ONAB 4KLKA 1FGBD 2O5IC 2V1CC 3BDOA 2UU9L 1NY4A 3GD7A 1A62A 5C44G 1GVPA 2UXBQ 4A3KB 1VDZA 5LMNW 1B9MA 3I70A 1LTID 3AEVA 2G9DA 3CQZB 4CDFC 4P72A 5KIXA 3S15H 2E2DC 3ULJA 4P71A 1VQEA 4BY1B 2PW7A 3I56A 3P75A 1UEBA 4KJOA 3V2TA 1A63A 4GLAC 1B7YB 1WCMH 4G7HC 3HOVB 4JV5Q 4IUUA 1Q82C 4OO1I 5ELFA 3JAMc 5M5WB 3J7AV 1S5ED 2I5LX 4QCLA 4GN5A 1GHJA 1F9QA 2F0EA 2E76C 1FNVA 4YWKA 5BR8L 2WB1E 4KN7C 5KNCA 4A3MH 3KLSA 4IPDA 4NXNL 1V1PA 2XVSA 2F4VL 4QF4A 1X9NA 1C8CA 1A0IA 3A74A 4FO2A 4BXXG 3NSWA 3OW2A 2QGQA 4XQQA 4ME5A 1VQ4A 4ODGA 1CZWA 3CC2A 4RG1A 1WTXA 3HKSA 2ID0A 3BVZA 5LMUQ 2PYKA 2K6AA 3HEJA 4DR5Q 1PTOH 4PQXA 3SK4A 2VY3A 1C4QA 2IHEA 4J8QA 3ICEA 1FJGL 2LXJA 2XN9C 1B3QA 1PFSA 2K32A 1FVIA 1DOLA 3PIP3 3TS0A 2EPBA 1TWHH 4ZAIA 5IGFA 4DR1Q 1P8LA 5C0XJ 5KYLA 3PF5A 2I07B 1KHIA 4A3GB 1EQTA 1B70B 2KBNA 1RJTA 2F0DA 4TQUS 1PH6A 3CF5A 2DGYA 1N34Q 3OWEB 3GTLB 1OO9B 1S5CD 1C0AA 1ZKOA 2LXKA 1CQFA 1GUGA 3DHQA 4ZLTF 1Q8KA 2NVXH 4K0KQ 3S2HB 3GQBA 3CHBD 4TSSA 2K03A 3NTIA 1A2UA 1ESRA 5CV6A 5CC4A 3CCMA 3DM3A 4XQNA 5KNDA 4A3KG 3RZOH 2MO1A 4KKSA 3KLWA 1PH7A 1G51A 4C3JB 3K80C 1Z47A 4PNYA 4YCWA 4BY1G 1XX8A 3UE0A 1QCBD 3NPPA 2J4XA 1ZXTA 5JJIA 3HOXB 2HD3A 4BBRB 2R6GA 4JI2L 3M7NA 3HOUG 1LT6D 1HUNA 4IO9A 3CMEA 3R3OA 1ZYRC 3TREA 1XNQQ 4LWCA 1ENAA 1B50A 2RQXA 5LMNL 5CV5A 2JA8B 1ICWA 4RA8A 1HNWL 1W3SA 2PI2A 3MFGA 4LF9Q 4OWWB 5ELOA 4DFAA 4DK3C 1O78A 1LT4D 4DV0L 4DAYB 3SGIA 3Q0AA 2R7ZB 5FK9C 3K0XA 4HIKA 4DV2Q 3I72A 4JI4L 1CKOA 1I4HA 4FNFA 5JPMC 1F9PA 2G9HD 4DK1A 3K7UC 4CDEC 4C3HB 1JMCA 4IPHA 3G6JB 2RKSA 3I4MB 1TY2A 2XSCA 4P73A 1YNJD 1W6JA 4RFBA 1B9NA 1WTWA 3KF6A 2OTLA 3T1YL 3DXJC 1IL2A 4YCVA 5GAGC 4V190 4KI0A 5GAEC 4HMJA 3PMFA 1SE2A 2PMZB 5C0XI 2A74C 4RGTA 2VQFL 2IPKD 2BA1A 4DUZL 1CSPA 3NXWA 4A3CH 1HJPA 3BZDB 3GTJB 1YHAA 4IUTA 2NN6H 4R4QA 1PA6A 2KA7A 3KUPA 4J6HA 3UDXA 5I6YA 5JOBA 1SYGA 4POFA 1QILA 1NTGA 5I9OA 1PH8A 4JOIC 2A6HC 1L0WA 4WJ3M 4HAEA 4IUPA 1ML0D 4X3SA 2KHIA 2R92H 2K5HA 4KHVA 4MNOA 2AMCB 4LF6L 3ND8A 2BCOA 3HOXG 3GTKB 2IT1A 4JK1C 5KRUA 1AW7A 1PH4A 3WOFA 1H9RA 1V8QA 1XWEA 1LTRD 1YJNA 3I90A 3MEHA 4B3RL 3TBIB 1WTRA 1STNA 4NP5A 4RCNA 2Z6KC 2ASBA 5DLQE 2JA8G 4AYBG 4AQYQ 4LF7Q 1VQ5A 4FF1A 3S1NB 2PQAB 1UE7A 1OXTA 3OW7A 2JA5G 4MTNA 1JCKB 2R7ZG 4B9WA 3VR4A 4LF8L 1Q7YC 3OWFA 1X65A 5EKIA 4OWXB 1Q1BA 3HS0C 3VR2A 4KHPQ 2VXWA 4ME3A 5JJKA 3Q22A 5LL6X 2KENA 4A3JH 4QY7A 1PZJD 3I4MG 4IOAA 2K1BA 3R93A 2NVTH 1LYLA 4AH6A 1WFQA 4I7ZC 3RLFA 1Y1WH 3FP9A 3GO5A 2AUKA 3MWYW 1P16A 2WB1G 1TWCB 3GTQB 2TMPA 1WD0A 4E6IA 3M3YH 4FYDA 1W6KA 1X3QA 4JI5Q 1KLGD 2N8NA 2AWOA 2HCCA 3V96A 4A3IB 1JICA 1AFPA 3VYTA 3T51B 1WJJA 3MVVA 3BDCA 1R9TB 1X56A 4DV3L 1PH2A 4KY5A 1J6QA 3J80i 4DR7L 1TXYA 1STEA 4QGUA 1HZBA 2EY2A 3L7ZC 4DV4L 1LTAD 4XT3B 1J5EQ 3L2PA 3KDFB 4JI3Q 1CI3M 2DJGC 2R61A 3DWAA 3IRBA 2K5VA 1ZEQX 1K9MC 1TS4A 1O7ZA 1JB7A 5IP7H 4B3SL 4IFDJ 3R2TA 3M4OB 4L8JA 3HOZH 4IPCA 1G91A 3PUXA 3RN5A 1AP0A 1WTOA 1BNZA 2R93H 4QQBX 3BZKA 4LF4L 2F3VA 4DUYQ 1EIFA 5F2DA 4RHSA 1K73C 1XMOQ 1EWCA 4BBSH 1EIHA 4HJAA 4DAYA 3CCSA 1WOCA 5M5XH 4A3FB 4JI6Q 3NTKA 1AEXA 4HR7B 2CVRA 1HQMC 1VQMA 2E5LL 1EFID 2Z0SA 1TWAH 2ZJRA 3SVMA 1L0YB 2WINB 2CFMA 3GDEA 3OYYA 1HFGA 4M8AA 4P75A 2Z1CA 2FXQA 1VQBA 3UI2A 2XIWA 1SMXA 1JJ2A 5M3MG 3NWSA 1KAAA 5J22A 4F88A 5EQ0A 2F0LA 5A35A 4DR4L 1JE4A 3F2BA 1LABA 2ALYB 1GD7A 2K5QA 3NBHA 4X65Q 1SYBA 1U4MA 1HR0W 3W1BA 4DR2L 2L5TA 3CCLA 3CC4A 1YHBA 2JA6H 3HP3A 3SE0A 3KK7A 2ZM6L 2KEDA 4CGYB 4WORA 5I6WA 1WYDA 5CV9A 1GHKA 3GTOB 1T5XD 4O0AA 4JI0Q 2B2VC 4Q5VA 2F3WA 2Z9HA 3KBXA 3RLOA 3H0GB 4MHEA 3GP7A 4GN4B 4C3IG 3BU2A 2XWBB 3E9IA 4NDXA 4YY3L 3IFDA 3G48A 1JR0D 2BH2A 1PH3A 4PMCA 3A7LA 1D1IA 4ULLA 4CJ1B 1EEFD 2PNRC 3K7AH 1XNRL 3NENA 2D5DA 4C3IH 1VQPA 1I6HB 3EN2A 2HHHQ 2E75C 2LMCB 3NHHA 1X32A 1SJED 2ZXPA 1EY4A 4IFDI 2NB0A 1MGSA 1DCZA 3NP8A 1CHQD 1EZ6A 1EIGA 2ZTEA 1SAPA 2BDNA 2PPBC 1TU2B 5FJ8G 4JI8L 4A3FG 3D4WA 1QJOA 3PO3H 1PHJA 3QIAA 1ICFB 4PV1C 4LMQD 4UHVA 3FHWA 3HOYB 1JC7A 1AE2A 3S1RB 5IY0A 3X3MA 1U0LA 2A69D 2CWPA 3U50C 5COYA 4RGMA 4X64Q 4X3TA 1YHQA 1LTLA 1I5FA 1K0RA 2Q8TA 2UXCL 3AU7A 2K5NA 2F0PA 3MTSA 1GJXA 1HCZA 2D9UA 4YHHQ 2AWNA 3AB9A 2NUCA 1H9MA 3L0OA 4RMFA 4K14A 2BE5C 5ELCA 1K8GA 2NZOA 4A3BH 4G57A 4X66L 5IWAQ 3AMUA 3TRZA 1F2LA 1JWMD 5GAHC 5BR8Q 4DGZA 5C44B 2WP8J 3WOEA 1CFMA 4LFAL 2B2TC 2Q2IA 1X3EA 4J15A 1WCMB 3TP7A 4GOPA 3QOJA 4K8JA 2QEXA 3H0GG 2ZT9C 4NW2A 1TT2A 3VR6A 1PH9A 2R7DA 3TZDA 1Q3LA 1QUQB 5M5YH 1E24A 4EQOA 1HR0L 5IYDG 4LF5Q 5BN4A 1HA6A 3HZXA 2JN4A 3JC66 1EFWA 4B3ML 1N32L 2P5ZX 3KDFA 3F2CA 3A5ZB 3PUVA 4A3MB 3FKIH 2B8FA 3PQIA 1DZ1A 5C4JH 4OHJA 4KY7A 3ER0A 1KNEA 1SE4A 2JA7H 1X3GA 1Y8PB 3LWUA 4A75A 4UY8C 1I4PA 2YU9H 3DWQA 4C2MH 1V1OA 2JE6I 1RCVD 1SBBB 2NTTA 4GLVB 1EEID 1R4PB 1CSQA 4ALPA 3IFTA 4CJ0B 1WD1A 1IZ6A 1NUCA 3E0EA 5D14A 5KYIA 2B2UC 1WTPA 2HDMA 1EY8A 2VS1A 1KTKA 2XGTA 4O42A 3U9SA 4JYAQ 2EXDA 2ICEC 5A2QL 1IKMA 2NVYH 4LFCL 1XTCD 1S5BD 2IWHA 3D4DA 1TWHB 5E7NA 1SE8A 1BBUA 2B2WC 2FINB 1B53A 4R8IA 2NYZD 3HOYG 4JPBW 1SJHD 4RWSC 4F87A 3RUZA 3SK8A 4QIWE 1SYFA 2OWOA 3BYTB 3I4OA 2NTSA 2OF1A 1J8IA 2YTVA 2C9OA 3C2PA 5LHY1 3M7GA 4JCVE 1U5KA 2LKVA 2F03A 1IHZA 3Q8DA 1M8AA 1QZGA 3VR5A 2RHSB 4DXGA 1HZAA 4BA2I 2F0QA 3I4NH 3RZOB 2RDHA 2RVLA 3MC0B 5C3WA 1HNWQ 3CC7A 5K36H 3L3OC 3LWEA 3D4RA 4DR3L 2QA4A 1XYIA 1VCIA 2FJ2A 4OL7A 5EAYA 1PFBA 2AQ3B 2EIFA 4LFBL 3H6MA 2XTIA 1WCMG 1NE3A 2SOBA 4DV5Q 3D3RA 1BCPD 3EIVA 2ES2A 2X6GA 1Q81C 3J80L 1PH1A 3UDIA 1KC8C 4NMZA 1DOKA 2CW0C 5IGEA 2Z4IA 4FXGC 2Z6KA 3E9HA 1GM5A 3HOUB 3J81L 3DUZA 4A3MG 1Q86C 1XMQL 4M1UB 4PZ7A 2VQEQ 3PUZA 1PV4A 1M1KC 1V1QA 1MKHA 1X6OA 3GTPB 4TVAB 1JOKA 5KGUA 3J80E 2D0OA 1FNWA 1LT3D 2NZHA 3A7AB 1BCPF 5ELEA 1KRSA 4DKAC 2WKDA 5LL6S 5M3FH 2DNCA 4DUZQ 1TWGH 4A3LH 3STBD 2QEJC 3HFZB 3CU7A 2RCFA 2UUCL 3C1EA 3VYSA 2J0TD 1GXDC 1JORA 4L5RC 2Q8IB 3MXNA 3PIOA 3TP8A 4QL5A 2B8GA 1VQ6A 3FRPB 2QW7A 1TWFH 4GLXA 1C48A 1EUJA 3G71A 1OXXK 1HH2P 2B63H 5AJ3Q 1SNDA 2Q2HA 1E1OA 1PXUA 2LSSA 4LF6Q 2DY7A 1K3RA 1Y1VH 1SFOH 4LK1C 3QG1A 2TSSA 2M00A 4APVA 4L5TA 1LLRD 2M2LA 1I94L 1BF4A 3KBGA 3HRZC 2CQAA 4H44C 1IBMQ 1F2MA 5CV4A 3LGJA 1G291 2KQ3A 1SN8A 5G3LD 2KHJA 1YVCA 1BR9A 4JI1L 1ILQA 4PG3A 1STYA 1Z6HA 3QB3A 1UE1A 4JG2A 2MO0A 4MN3A 2VL6A 3PO2H 4QIWB 1SYEA 3QO2A 4DPGA 2EVBA 1QUQA 4PZ8A 4DV1Q 1JWUD 2ZXRA 3CKIB 3NUCA 4GKKL 4ZRZA 1GO3E 3S16B 1OXVA 5FO7B 5C3EH 1UE5A 3I8ZA 2R3ZA 1PZKD 1ASYA 4GZYC 2FMMA 2MPMA 3AQQA 5G3LF 3MA2B 3S14H 1S72A 4U673 4FF3A 1STAA 4L5QA 3T56B 4AYBB 2G5DA 1JE5A 4ZUJA 1TS3A 2JA5B 4WJWA 1A6XA 4OONA 4ZQ3A 1EYAA 1GUNA 4DA2A 3E5SA 1BUVT 1DXMA 2NVTB 4A3DH 1GUOA 4DNIA 3S1MH 3HOVH 1HRJA 3K8AA 1Y1WB 5TSSA 5AFWA 1RHPA 3EBEA 3J7ZC 1CKNB 2UXBL 4RHRA 3MHBA 2F1MA 2JJQA 1VQLA 2PO4A 4A3CG 4DV6Q 3H94A 3M3YB 3A8KE 2UUAL 1EWIA 4EX5A 3CXCA 2F0OA 2WB1B 4DN4M 1B44D 4CKBA 1N33Q 1IW7D 2NN6G 4JV5L 2UUBQ 5L37A 4CDDC 3SHLA 3OIQA 1LM0A 2L15A 1D8LA 2RDGA 2JYOA 1XTDA 5E4XA 2ICIA 2F0NA 1PLFA 3GTMH 1MI2A 2D2CC 4HMIA 4H02A 1YITA 1KRTA 1PMRA 4NB3A 1ZYRD 2KVMA 2R92G 5I2YA 4Y7NH 3IL8A 2L9HA 3T1HL 5JVG3 4A3GH 3HGBA 3HOZB 4ZUIA 3U58A 3H91A 5LMUL 3S1QH 1MJEA 2QDBA 3OOCA 4DR5L 2K28A 4DK0A 3P20A 1NNXA 4BBSB 1MSHA 3PIPA 2PNHA 4LUZA 3GV3A 1Q90A 1H9KA 3M85A 3D8GA 4IFDH 3S2HH 3DM1A 4IN3A 4DR1L 3HG9A 4JW0A 5I9PA 3F2DA 5FO8B 1K28A 1SRUA 3DEPA 1WTVA 3I3CA 1N34L 4C3JH 2ZM6Q 3GTGB 4A3JG 5FKAC 3I7FA 3I73A 2JK8A 2E2JH 3E3XA 3NBIA 4IOCA 5C5LA 4XQJA 3MXUA 4QJFA 1Y1WG 4K0KL 3H15A 1JT8A 2EJGC 4OEMB 1NSNS 5IGCA 4K6LA 4L5SA 1IYJB 5M3MB 3BDLA 2NBFA 4GNXC 1EQRA 1HNZQ 3OSOA 2VZAA 4UAIA 1TR5A 2EZVA 2JA6B 3NELA 4HCSA 1SSOA 3FPUB 3TEHB 1EL0A 1CT1D 1SNMA 2N78A 4XYOA 1D2BA 3RN2A 3J80c 2RSOA 5C4ZA 2B2TA 3FPPA 4H7BA 1F9SA 5CV8A 4LW1A 1KXLA 1VQHA 3D31A 3RZDH 1BQQT 4C3HH 1EZ8A 2GVAA 4A93H 1RTOA 3PUWA 4PMWA 5EPJA 3ND9A 3SR1A 3EJIA 3NQTA 2PZUA 3BZCA 3K7AB 1JJGA 4PZ6A 3S17H 4Z9CB 4LF9L 2K75A 4C3IB 3U9OA 5JPNC 1IBLQ 2A68D 2K50A 1E2VA 3X3NA 4ZKBB 2YYZA 2X69A 4DV2L 3H3VH 3J81i 1B3AA 5IP7G 3HOZG 2ZTDA 2R93G 5HY6A 3SDZA 2I0QA 2RBMA 3A56A 3G7LA 2V4DA 5HGQA 4I65A 3GTJH 1SMYD 2RCNA 2B2UA 4BBSG 2A1AA 5IE8A 1U4PA 1GUWA 3PO3B 2NZ1D 2E2IH 4IPGA 5JEAH 2B2WA 2MJ8A 2EYJA 4ZKCB 5IIFA 5CV7A 1EIYB 5IGDA 5K5PA 1N9WA 4KHZA 2NVQH 3A8IE 1PTOC 3FVQA 4DV7Q 1KQSA 4BWGB 2HUGA 3GTKH 2K52A 3C1FA 1CKNA 1H9JA 3MZ5A 1Y14B 3J7AF 4K2KA 1Y8OB 3OTOQ 1K0SA 3C3LA 2XWJB 2Y0SE 4GKJQ 1N32Q 1OXSC 2EDGA 3JAML 2A6ED 2H5XA 4XIGS 4B3MQ 2JA6G 3TS2A 1LTTD 1U4RA 2OTJA 4KKTA 4DAVA 2PZWA 3KF8B 3QR8A 4LUOA 3ZYYX 4G7ZC 1LTSD 2KUMA 4OX9L 2F0SA 3C46A 5EPLA 4HIOA 4QMGA 3BVMA 3G4SA 1QVGA 4FF4A 1QWYA 5J39A 1TS2A 1FD7D 1K83H 3K5LA 5M5YB 1O80A 4XXEA 1KLUD 5IP9H 1FGUA 5H1SE 4LF7L 2VNUD 3I4LA 2A69C 1I4QA 3B6YA 3FKIB 1I4RA 4EGVA 5C4JB 2PZTA 5C3XA 1RIPA 3FEWX 4FP5D 2PW5A 4A4IA 2Q2UA 3EQLC 3CW2C 2PI2E 4OELB 4R9WA 1H9SB 2EE1A 2VUMH 1EY0A 1JJCB 2IL8A 2WACA 2YU9B 2NN6I 4OO1H 3WDNA 4MIUA 4C2MB 1TWCH 4KHPL 3TP6A 3L9AX 4R8NA 3EROA 4QUCA 4RH6A 3AYHB 2L11A 1G6ZA 4JBWA 1O7YA 5M9OA 4A3IH 2F52A 1D7QA 2NVYB 5IGBA 3PO3G 1K8OA 1BDOA 1EY9A 4B9XA 1FNUA 4DR6Q 4XDXA 3A54A 2PQAA 2B29A 1E22A 1HTPA 2E2HB 1YBYA 3J81j 2I5HA 1W2BA 2K05A 4PMBA 4A3EH 2EYOA 1IL8A 2EXZA 4GNXB 3HOWH 2CQOA 3K57A 2UU9Q 2HDLA 3SK5A 2EYLA 1CA5A 4JI5L 1M4VA 4CHTB 3PGZA 2B39A 2NWGA 2XRQD 1X3PA 2LFNA 2ZJPA 4KKUA 1E3PA 3T53B 1VQ9A 3O13A 5JVH3 1PRTD 4IUQA 1HA5A 1Y8NB 1SLJA 3I4NB 3EFXD 5C4XH 3CCUA 4FDBA 4A3BG 1B1ZA 1SDFA 2HIXA 1EOVA 5KEEA 1SNPA 1QNKA 5IYBH 3R2IA 2Z8LA 4IQZA 1BXTA 1KL9A 1CZGA 4BY7H 3CCRA 2EYFA 4N9TA 2EYMA 4JC0A 1ILPA 1S4ZA 3S2DH 3S15B 1EQQA 2PCFB 2B3GA 5EGTA 1PRTF 1KIXA 1NR2A 4NXNQ 2DUDA 2HT1A 2F4VQ 4UP7A 5JAVA 5IGGA 5IYCH 2VB3X 5EKLA 1PFNA 3QOLA 4K5VA 4DUYL 3CCEA 1T9HA 4DXFA 2D0PA 3FKIG 2MQHA 2IY5B 4JI6L 3RLNA 1LUZA 3F1ZA 2JA7G 1ENFA 4HSVA 5I2XA 1E1TA 1FJGQ 3SEBA 1LT5D 1IYUA 1CA6A 2KOLA 1A3TA 1L2FA 3K59A 5M3FB 2K01A 4XT1B 3TDQA 2JEBI 5ELNA 2RHQB 1GUTA 3KJPA 4HEDA 2EYPA 1ET6A 1N36L 1G2TA 5EPKA 1PTOB 1LACA 4HJ5A 4Q0FA 4X65L 2F0WA 2H4OA 4HIMA 2L1BA 4K6DA 1EYDA 1BCPC 3I55A 1NMGA 1ET9A 2HCIA 1JQYD 1C9OA 1TWFB 1QVFA 2XRSD 4UDUC 1L1OC 1X54A 4DAMA 4AIMA 4S3SA 5JJZA 3MXGA 4NPSA 2B63B 3VYRA 1Y1VB 1SFOB 1IBKL 4KJNA 2AUJD 1G6PA 1DM0B 4JI7L 5A2QE 4WJ4A 3I4NG 1SYCA 3CCQA 5C0XH 1IYVA 3AFPA 1PYSB 2NVXB 4JI2Q 2BDOA 1AZPA 1Q8IA 4X62L 5K36G 3KF8A 1B8AA 3ITPA 4MTKA 4JBJA 3RMHA 3KF6B 3T13A 2UXDL 2HHHL 2MHVA 5LMNQ 2O5JC 1A8VA 3UE1A 1D5XC 1NBWA 4JOIA 3PO2B 1CK1A 3S1RH 1RD9D 3T16A 4KK7A 5IODA 4DV0Q 3CCVA 1TKWB 1MBYA 2Z4HA 2OQKA 4JI4Q 1NMFA 3K5OA 5C3EB 4V0BA 4N8FA 1J9OA 3MXPA 2EJFC 5EKKA 3NE5B 3H3VC 3DEOA 4HJ8A 2MUYA 2O2LD 1K8AC 3S14B 1H9SA 1A15A 3EVQA 4XTCS 4GN3B 4ZCKA 1VQNA 5CBAE 1VQDA 2Y0SG 1TIID 1VQFA 1VF5C 4IURA 3T1YQ 1ESFA 3BG3A 5M3FG 4X64L 2CKZB 5DNFA 4A3LG 2FFKB 1CHPD 4NKLA 5C44H 2DN8A 2KEEA 2UUAQ 1SE3A 1Z9FA 5J1ZA 4A3DB 2VQFQ 4FF2A 1QE6A 5E4WC 3S1MB 4B08A 1RTNA 1KNAA 3J81E 2IHFA
chains in the Genus database with same CATH topology
3PUXA 1LM0A 4YHHL 2L15A 3RN5A 1D8LA 2R93H 1XTDA 3GTMH 4QQBX 1I50H 3BZKA 1XMOL 2BH8A 4DUYQ 4LF4L 1XPRA 1EIFA 1K73C 4H02A 3CPFA 1YITA 1XMOQ 2UUCQ 5IWAL 4GNXA 3RNUA 4BBSH 1KRTA 4HJAA 3CCSA 1WOCA 5M5XH 2PMZE 4NB3A 4JI6Q 3CCJA 4LNQA 1NJIC 1VQMA 2E5LL 2R92G 1I3QH 2Z0SA 4Y7NH 1TWAH 3MEFA 3T1HL 2N3SA 2B63G 4DV7L 1MIUA 1XPUA 4A3GH 3T1HQ 2ZJRA 3JAMi 1X3FA 1Y1VG 3U58A 2CFMA 3GDEA 3OYYA 4JBMA 1MJCA 2EQSA 4P75A 5LMUL 1MJEA 2IX1A 3S1QH 2FXQA 1VQBA 4DR5L 1YEZA 3GTOH 1SMXA 2ZTCA 4BXXH 1JJ2A 3OTOL 4EQ5A 5M3MG 4LF5L 1YNXA 3H3VI 3K81C 3KYHC 1PVOA 4GKJL 3PIPA 1VQIA 2PNHA 3H0GH 4LUZA 4R4CA 4DR4L 4B3RQ 2AHOB 3F2BA 2ALYB 2WAQE 3M85A 3ULPA 4B3TL 3U4VA 3S2HH 1GD7A 1I94Q 4R4TA 3TQYA 3ZJYC 4DR1L 4B3TQ 4X65Q 1CKMA 3F8TA 1HR0W 5IYDH 3W1BA 3F2DA 3PO2G 4IJLA 4DR2L 3CCLA 3NEMA 1SRUA 1YHBA 3PUYA 3CC4A 2JA6H 1QVCA 3J7A5 2ZM6L 1N34L 4C3JH 1I6HH 2ZM6Q 4JI1Q 4A3JG 1S3OA 2JQOA 3I7FA 3A0JA 1HNXL 1WYDA 4JI0L 2JK8A 4O0AA 2E2JH 4JI0Q 1HNXQ 4LF8Q 5C3EG 5C0XG 3D0FA 4JYAL 4IOCA 3ERSX 3RLOA 3RR5A 2R7FA 2GVBA 4NXML 4K0KL 4GN4B 4QJFA 1Y1WG 3KFUA 5JJLA 3H15A 4NXMQ 1JT8A 3BU2A 3E9IA 4YY3L 4L5SA 3G48A 1IYJB 4GKKQ 1N32Q 2BH2A 2E8GA 1PH3A 4GNXC 2Q2TA 1EQRA 1HNZQ 2VZAA 3K7AH 2E2HH 3CAMA 5FLXc 2RF4A 3VDYA 3PSIA 1XNRL 3NELA 3NENA 4C3IH 3TEHB 3KJOA 3STBC 1VQPA 2N78A 3RN2A 3EN2A 2HHHQ 4HJ9A 3J80c 4A3KH 3HOYH 4A3DG 3ULLA 4GOPC 1L1OB 1HZ9A 3BJUA 4LW1A 1KXLA 3HOVG 2YTYA 3CQZH 1VQHA 5IT9c 1AH9A 1PYBA 4HJ7A 4IFDI 3D31A 3RZDH 1UE6A 4C3HH 4BY1H 2GVAA 4A93H 4DR6L 3PUWA 4PMWA 2ZTEA 1SR3A 1XJVA 1XPOA 2WFWA 2ATWA 3BZCA 1WI5A 4AYBE 1OTCA 1JJGA 4PZ6A 3S17H 5FJ8G 1UWVA 4LF9L 2K75A 4KLKA 4JI8L 4DV3Q 3HOUH 4A3FG 5M5WH 1IBLQ 2V1CC 4O2DA 3PO3H 2K50A 2UU9L 1PHJA 4DR7Q 1NY4A 3GD7A 1A62A 2CCZA 5C44G 2YYZA 1GVPA 2UXBQ 4DV2L 3FHWA 5LMNW 3H3VH 3J81i 1AE2A 3GTPH 4DV4Q 5IY0A 5IP7G 4DV5L 3AEVA 1U0LA 3HOZG 4P72A 3U50C 2CWPA 1VQKA 1KAWA 3S15H 4X64Q 3ULJA 4P71A 1VQEA 2ZTDA 2R93G 1YIJA 5HY6A 2YTXA 1BKBA 3I56A 1UEBA 4UP9A 1YHQA 3I2ZA 2I0QA 1LTLA 1I5FA 5HGQA 3GTJH 1A63A 4GLAC 1B7YB 1K0RA 2RCNA 1WCMH 4JV5Q 2UXCL 1Q82C 4B3SQ 1QZHA 4BBSG 2A1AA 5IE8A 4OO1I 2K5NA 4GS3A 1O7IA 4UP8A 3JAMc 4YHHQ 3CPWA 2I5LX 4GN5A 2VQEL 2AWNA 2E2IH 4IPGA 4DK6C 4DR4Q 4LF4Q 3L0OA 4RMFA 1K8GA 4A3BH 2NZOA 4YWKA 4YWLA 4X66L 5IWAQ 1EIYB 4A3GG 5BR8L 1Q46A 2WB1E 3TRZA 5GAHC 3NBHB 4A3MH 5BR8Q 4OXPA 3S24A 1N9WA 4IPDA 4NXNL 4KHZA 2NVQH 2F4VL 2WP8J 1X9NA 2E5LQ 1A0IA 3A74A 4LFAL 4BXXG 2Q2IA 1X3EA 3OW2A 2QGQA 2BA0A 4J15A 4DV7Q 1VQ4A 1KQSA 4GOPA 2QEXA 4RG1A 3H0GG 3CC2A 3GTKH 2K52A 2ID0A 3HKSA 5LMUQ 1PH9A 3GTLH 2I5MX 1CKNA 2R7DA 4IFDG 1Y14B 1QUQB 4DR5Q 5M5YH 3G6EA 2VY3A 1E24A 2IHEA 3ICEA 2AKWB 3OTOQ 1HR0L 3HKZE 5IYDG 4LF5Q 1FJGL 2LXJA 3JC66 1EFWA 1VQJA 2Y0SE 4B3ML 1N32L 4GKJQ 1PFSA 3KDFA 1OXSC 3F2CA 4B3MQ 2H5XA 1FVIA 2F3IA 3A5ZB 3PUVA 3FKIH 4XIGS 4HIDA 3TS2A 3TS0A 5C4JH 2OTJA 3ER0A 2D62A 2ZJQA 1TWHH 3KF8B 4DR1Q 2JA7H 1X3GA 1P8LA 4IJHA 5C0XJ 4LUOA 3PF5A 4A75A 1KHIA 4UY8C 1Q12A 1B70B 2KBNA 4OX9L 2YU9H 4DR2Q 5AJ3L 4POGA 4OX9Q 4TQUS 1PH6A 4C2MH 1V9PA 3CF5A 3M4QA 2DGYA 2JE6I 4BBRG 4HIOA 3G4SA 1QVGA 4GLVB 1N34Q 4ALPA 1CSQA 1K83H 1IZ6A 3E0EA 1C0AA 2LXKA 4JYAQ 2VS1A 3S16H 2XGTA 5IP9H 1FGUA 5H1SE 3HOXH 4LF7L 4BBRH 2EXDA 1IBML 2VNUD 3B6YA 1Q8KA 2NVXH 4K0KQ 2NVYH 4LFCL 4YY3Q 1RIPA 3CCMA 5E7NA 1VQOA 3DM3A 4A4IA 2Q2UA 1SE8A 1BBUA 3M4PA 3U4ZA 3CW2C 2PI2E 4A3KG 1FL0A 2MO1A 1YI2A 3HOYG 3RZOH 2JA8H 2VUMH 3KLWA 1PH7A 1JJCB 1G51A 1YJ9A 2NN6I 1XNRQ 2OWOA 4QIWE 1TWCH 3K80C 4MZ9A 4KHPL 2JA5H 3I4OA 1Z47A 4YCWA 4BY1G 4DV1L 4A93G 3UE0A 2YTVA 2R7ZH 3AYHB 4JBWA 4JCVE 1U5KA 5GQOA 5JJIA 3Q8DA 3J81c 3M7NA 2R6GA 4JI2L 3DLLA 4A3IH 2F52A 3HOUG 4IO9A 3CMEA 1D7QA 1QZGA 1XNQL 2RHSB 3TREA 3W5OA 3PO3G 1HZAA 1XNQQ 4LWCA 5GADC 2JA6G 4BA2I 3I4NH 4DR6Q 3I4MH 2PQAA 2B29A 1E22A 5LMNL 1VQ7A 3UDGA 1YBYA 3J81j 1HNWL 2I5HA 1W3SA 3WWVA 1W2BA 1HNWQ 2PI2A 4LF9Q 4OWTB 4JI8Q 3CC7A 1PH5A 4A3EH 4OWWB 5ELOA 5GROA 4GNXB 4DK3C 4DR3L 2QA4A 2CQOA 1N8RC 1EYGA 2UU9Q 4DV0L 3HOWH 4DAYB 1VCIA 5EAYA 3SGIA 4X6AH 4JI5L 3K0XA 4HIKA 4DV2Q 2JEAI 4JI4L 1CKOA 2EIFA 2HQLA 3PGZA 2XTIA 3UDFA 4LFBL 1WCMG 1NE3A 4DV5Q 2ZJPA 3EIVA 2ES2A 1E3PA 1Q81C 3K7UC 1VQ9A 1PH1A 3UDIA 1KC8C 1Q1EA 1JMCA 1SLJA 4GOPB 4IPHA 2KCTA 4R4IA 1M90C 2YV5A 4P73A 5C4XH 3CCUA 4FDBA 4A3BG 2Z6KA 3E9HA 5JEAG 1GM5A 2HIXA 2UXCQ 1EOVA 1VQAA 3KF6A 5J3BA 2OTLA 3T1YL 1IL2A 4A3MG 4YCVA 1Q86C 1XMQL 5GAGC 2WAQG 5IYBH 4PZ7A 2VQEQ 3CMAA 3PUZA 1PV4A 1M1KC 4KI0A 5GAEC 3M9BA 4DV6L 1KL9A 1RL2A 1H95A 4BY7H 1L1OA 1MKHA 1V1QA 1X6OA 3CCRA 4TVAB 2D0OA 1N33L 5C0XI 4X66Q 2VQFL 4JC0A 2NZHA 3S2DH 2UUBL 1EQQA 2B3GA 1KRSA 2BA1A 4DUZL 4DKAC 1KIXA 4NXNQ 5M3FH 1S40A 1CSPA 4DUZQ 2DUDA 1TWGH 2F4VQ 2HT1A 4A3CH 1HJPA 4A3LH 4LFAQ 4UP7A 1YJWA 3STBD 1YHAA 5IYCH 3HFZB 1VQGA 4DUYL 2OCEA 3CCEA 3CD6A 2UUCL 1T9HA 4R4QA 1PA6A 2D0PA 2K4KA 3FKIG 2MQHA 3UDXA 2VW9A 2IY5B 2N49A 4L5RC 4JI6L 3PCOB 4POFA 3RLNA 1LUZA 3F1ZA 2JA7G 1NTGA 4Y52H 2GN5A 1E1TA 2K14A 3PIOA 1PH8A 1HR0Q 1FJGQ 4JOIC 4QL5A 1VS0A 1L0WA 4WJ3M 3S1NH 4YCUA 1VQ6A 1TWFH 1L2FA 4JBKA 4GLXA 4BA1I 1EUJA 2CWAA 2KHIA 2JEBI 5ELNA 2R92H 2K5HA 3GTGH 4MNOA 2RHQB 3G71A 3PV0A 3KOJA 1OXXK 3KJPA 1HH2P 2AMCB 4LF6L 2B63H 5IP9G 3HOXG 5AJ3Q 2IT1A 2Q2HA 1E1OA 1N36L 2LSSA 4LF6Q 1PH4A 1K3RA 1Y1VH 1SFOH 1CUKA 1N36Q 1YJNA 4B3RL 4APVA 4L5TA 2C35B 2Z6KC 4HJ5A 1I94L 2ASBA 5DLQE 4X65L 4HIMA 4AQYL 2JA8G 2VUMG 4AYBG 5M3MH 3I55A 4AQYQ 1NMGA 1VQ5A 1IBMQ 4LF7Q 2A8VA 4OO1G 2JA9A 2PQAB 1ASZA 1G291 1UE7A 2IX0A 3LGJA 1C9OA 1OXTA 2JA5G 4LFCQ 4MTNA 1QVFA 1SN8A 1L1OC 1X54A 2KHJA 1YVCA 4DAMA 4JI1L 4AIMA 4PG3A 2R7ZG 4A76A 2HIVA 4LF8L 1Q7YC 4NPSA 1UE1A 4JG2A 1E7ZA 1SROA 1X65A 2MO0A 2VL6A 3PO2H 4A3IG 1VQ8A 3GTQH 4OWXB 1Q1BA 3W1GA 4DPGA 1QUQA 4KHPQ 1IBKL 4R1JA 4ME3A 5JJKA 4PZ8A 1G6PA 1IBKQ 4JI7L 2KENA 4WJ4A 4DV1Q 3I4NG 4A3JH 4QY7A 3I4MG 4IOAA 4JI7Q 1AE3A 1X55A 2NVTH 4GKKL 1GO3E 1LYLA 4AH6A 1YZ6A 1WFQA 3CCQA 1OXVA 5C3EH 1HNZL 3AFPA 1PYSB 1UE5A 4UPAA 4JI2Q 3RLFA 1BVSA 1GKHA 4A3EG 1R9TH 4X62L 5K36G 1VQCA 2A19A 1B8AA 1ASYA 3HOWG 1Y1WH 3AQQA 4X62Q 3FP9A 3S14H 4JBJA 3GO5A 1S72A 2KCMA 3KF6B 2UXDL 4L5QA 2HHHL 2OQ0A 5LMNQ 2UXDQ 1A8VA 3UE1A 1NBWA 1IXRA 4JOIA 1P16A 2WB1G 4LUVA 3A5UA 1JE5A 3AFQA 4P74A 3S1RH 4OONA 4DR3Q 2MFIA 4DV0Q 3CCVA 3M3YH 2MNAA 4JI5Q 3CP0A 1C7YA 5JEAJ 2N8NA 3PF4A 4JI4Q 2OQKA 2AWOA 5C4XG 4LFBQ 1NMFA 4R4OA 4A3DH 4DNIA 1WJJA 3S1MH 3M4OH 3HOVH 1BBWA 1X56A 4DV3L 5IYBG 1PH2A 3K8AA 1J6QA 4HJ8A 1IBLL 3EBEA 1K8AC 3J80i 3J7ZC 4DR7L 1TXYA 4BY7G 3HKZG 4GN3B 4XTCS 1CKNB 1HZBA 4QGUA 1VQNA 1HZCA 2UXBL 1VQDA 2Y0SG 3L7ZC 4DV4L 1VQFA 3T1YQ 1KD1C 5FJ8H 1DGSA 1XMQQ 1J5EL 3MXNB 5FLMG 4A3FH 4JI3L 1J5EQ 2JJQA 1OXUA 3L2PA 4X64L 5M3FG 3KDFB 1VQLA 2CKZB 4JI3Q 4A3CG 4DV6Q 4A3LG 3IRBA 2UUAL 1EWIA 2K5VA 4YWMA 4EX5A 5IYCG 5C44H 3CXCA 1K9MC 2UUAQ 1Z9FA 1N33Q 2VQFQ 2NN6G 4JV5L 1JB7A 5IP7H 1V43A 5FLMH 2UUBQ 4B3SL 4IFDJ 3HOZH 4IPCA 2IHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUX A;  1LM0 A;  4YHH L;  2L15 A;  3RN5 A;  1D8L A;  2R93 H;  1XTD A;  3GTM H;  4QQB X;  1I50 H;  3BZK A;  1XMO L;  2BH8 A;  4DUY Q;  4LF4 L;  1XPR A;  1EIF A;  1K73 C;  4H02 A;  3CPF A;  1YIT A;  1XMO Q;  2UUC Q;  5IWA L;  4GNX A;  3RNU A;  4BBS H;  1KRT A;  4HJA A;  3CCS A;  1WOC A;  5M5X H;  2PMZ E;  4NB3 A;  4JI6 Q;  3CCJ A;  4LNQ A;  1NJI C;  1VQM A;  2E5L L;  2R92 G;  1I3Q H;  2Z0S A;  4Y7N H;  1TWA H;  3MEF A;  3T1H L;  2N3S A;  2B63 G;  4DV7 L;  1MIU A;  1XPU A;  4A3G H;  3T1H Q;  2ZJR A;  3JAM i;  1X3F A;  1Y1V G;  3U58 A;  2CFM A;  3GDE A;  3OYY A;  4JBM A;  1MJC A;  2EQS A;  4P75 A;  5LMU L;  1MJE A;  2IX1 A;  3S1Q H;  2FXQ A;  1VQB A;  4DR5 L;  1YEZ A;  3GTO H;  1SMX A;  2ZTC A;  4BXX H;  1JJ2 A;  3OTO L;  4EQ5 A;  5M3M G;  4LF5 L;  1YNX A;  3H3V I;  3K81 C;  3KYH C;  1PVO A;  4GKJ L;  3PIP A;  1VQI A;  2PNH A;  3H0G H;  4LUZ A;  4R4C A;  4DR4 L;  4B3R Q;  2AHO B;  3F2B A;  2ALY B;  2WAQ E;  3M85 A;  3ULP A;  4B3T L;  3U4V A;  3S2H H;  1GD7 A;  1I94 Q;  4R4T A;  3TQY A;  3ZJY C;  4DR1 L;  4B3T Q;  4X65 Q;  1CKM A;  3F8T A;  1HR0 W;  5IYD H;  3W1B A;  3F2D A;  3PO2 G;  4IJL A;  4DR2 L;  3CCL A;  3NEM A;  1SRU A;  1YHB A;  3PUY A;  3CC4 A;  2JA6 H;  1QVC A;  3J7A 5;  2ZM6 L;  1N34 L;  4C3J H;  1I6H H;  2ZM6 Q;  4JI1 Q;  4A3J G;  1S3O A;  2JQO A;  3I7F A;  3A0J A;  1HNX L;  1WYD A;  4JI0 L;  2JK8 A;  4O0A A;  2E2J H;  4JI0 Q;  1HNX Q;  4LF8 Q;  5C3E G;  5C0X G;  3D0F A;  4JYA L;  4IOC A;  3ERS X;  3RLO A;  3RR5 A;  2R7F A;  2GVB A;  4NXM L;  4K0K L;  4GN4 B;  4QJF A;  1Y1W G;  3KFU A;  5JJL A;  3H15 A;  4NXM Q;  1JT8 A;  3BU2 A;  3E9I A;  4YY3 L;  4L5S A;  3G48 A;  1IYJ B;  4GKK Q;  1N32 Q;  2BH2 A;  2E8G A;  1PH3 A;  4GNX C;  2Q2T A;  1EQR A;  1HNZ Q;  2VZA A;  3K7A H;  2E2H H;  3CAM A;  5FLX c;  2RF4 A;  3VDY A;  3PSI A;  1XNR L;  3NEL A;  3NEN A;  4C3I H;  3TEH B;  3KJO A;  3STB C;  1VQP A;  2N78 A;  3RN2 A;  3EN2 A;  2HHH Q;  4HJ9 A;  3J80 c;  4A3K H;  3HOY H;  4A3D G;  3ULL A;  4GOP C;  1L1O B;  1HZ9 A;  3BJU A;  4LW1 A;  1KXL A;  3HOV G;  2YTY A;  3CQZ H;  1VQH A;  5IT9 c;  1AH9 A;  1PYB A;  4HJ7 A;  4IFD I;  3D31 A;  3RZD H;  1UE6 A;  4C3H H;  4BY1 H;  2GVA A;  4A93 H;  4DR6 L;  3PUW A;  4PMW A;  2ZTE A;  1SR3 A;  1XJV A;  1XPO A;  2WFW A;  2ATW A;  3BZC A;  1WI5 A;  4AYB E;  1OTC A;  1JJG A;  4PZ6 A;  3S17 H;  5FJ8 G;  1UWV A;  4LF9 L;  2K75 A;  4KLK A;  4JI8 L;  4DV3 Q;  3HOU H;  4A3F G;  5M5W H;  1IBL Q;  2V1C C;  4O2D A;  3PO3 H;  2K50 A;  2UU9 L;  1PHJ A;  4DR7 Q;  1NY4 A;  3GD7 A;  1A62 A;  2CCZ A;  5C44 G;  2YYZ A;  1GVP A;  2UXB Q;  4DV2 L;  3FHW A;  5LMN W;  3H3V H;  3J81 i;  1AE2 A;  3GTP H;  4DV4 Q;  5IY0 A;  5IP7 G;  4DV5 L;  3AEV A;  1U0L A;  3HOZ G;  4P72 A;  3U50 C;  2CWP A;  1VQK A;  1KAW A;  3S15 H;  4X64 Q;  3ULJ A;  4P71 A;  1VQE A;  2ZTD A;  2R93 G;  1YIJ A;  5HY6 A;  2YTX A;  1BKB A;  3I56 A;  1UEB A;  4UP9 A;  1YHQ A;  3I2Z A;  2I0Q A;  1LTL A;  1I5F A;  5HGQ A;  3GTJ H;  1A63 A;  4GLA C;  1B7Y B;  1K0R A;  2RCN A;  1WCM H;  4JV5 Q;  2UXC L;  1Q82 C;  4B3S Q;  1QZH A;  4BBS G;  2A1A A;  5IE8 A;  4OO1 I;  2K5N A;  4GS3 A;  1O7I A;  4UP8 A;  3JAM c;  4YHH Q;  3CPW A;  2I5L X;  4GN5 A;  2VQE L;  2AWN A;  2E2I H;  4IPG A;  4DK6 C;  4DR4 Q;  4LF4 Q;  3L0O A;  4RMF A;  1K8G A;  4A3B H;  2NZO A;  4YWK A;  4YWL A;  4X66 L;  5IWA Q;  1EIY B;  4A3G G;  5BR8 L;  1Q46 A;  2WB1 E;  3TRZ A;  5GAH C;  3NBH B;  4A3M H;  5BR8 Q;  4OXP A;  3S24 A;  1N9W A;  4IPD A;  4NXN L;  4KHZ A;  2NVQ H;  2F4V L;  2WP8 J;  1X9N A;  2E5L Q;  1A0I A;  3A74 A;  4LFA L;  4BXX G;  2Q2I A;  1X3E A;  3OW2 A;  2QGQ A;  2BA0 A;  4J15 A;  4DV7 Q;  1VQ4 A;  1KQS A;  4GOP A;  2QEX A;  4RG1 A;  3H0G G;  3CC2 A;  3GTK H;  2K52 A;  2ID0 A;  3HKS A;  5LMU Q;  1PH9 A;  3GTL H;  2I5M X;  1CKN A;  2R7D A;  4IFD G;  1Y14 B;  1QUQ B;  4DR5 Q;  5M5Y H;  3G6E A;  2VY3 A;  1E24 A;  2IHE A;  3ICE A;  2AKW B;  3OTO Q;  1HR0 L;  3HKZ E;  5IYD G;  4LF5 Q;  1FJG L;  2LXJ A;  3JC6 6;  1EFW A;  1VQJ A;  2Y0S E;  4B3M L;  1N32 L;  4GKJ Q;  1PFS A;  3KDF A;  1OXS C;  3F2C A;  4B3M Q;  2H5X A;  1FVI A;  2F3I A;  3A5Z B;  3PUV A;  3FKI H;  4XIG S;  4HID A;  3TS2 A;  3TS0 A;  5C4J H;  2OTJ A;  3ER0 A;  2D62 A;  2ZJQ A;  1TWH H;  3KF8 B;  4DR1 Q;  2JA7 H;  1X3G A;  1P8L A;  4IJH A;  5C0X J;  4LUO A;  3PF5 A;  4A75 A;  1KHI A;  4UY8 C;  1Q12 A;  1B70 B;  2KBN A;  4OX9 L;  2YU9 H;  4DR2 Q;  5AJ3 L;  4POG A;  4OX9 Q;  4TQU S;  1PH6 A;  4C2M H;  1V9P A;  3CF5 A;  3M4Q A;  2DGY A;  2JE6 I;  4BBR G;  4HIO A;  3G4S A;  1QVG A;  4GLV B;  1N34 Q;  4ALP A;  1CSQ A;  1K83 H;  1IZ6 A;  3E0E A;  1C0A A;  2LXK A;  4JYA Q;  2VS1 A;  3S16 H;  2XGT A;  5IP9 H;  1FGU A;  5H1S E;  3HOX H;  4LF7 L;  4BBR H;  2EXD A;  1IBM L;  2VNU D;  3B6Y A;  1Q8K A;  2NVX H;  4K0K Q;  2NVY H;  4LFC L;  4YY3 Q;  1RIP A;  3CCM A;  5E7N A;  1VQO A;  3DM3 A;  4A4I A;  2Q2U A;  1SE8 A;  1BBU A;  3M4P A;  3U4Z A;  3CW2 C;  2PI2 E;  4A3K G;  1FL0 A;  2MO1 A;  1YI2 A;  3HOY G;  3RZO H;  2JA8 H;  2VUM H;  3KLW A;  1PH7 A;  1JJC B;  1G51 A;  1YJ9 A;  2NN6 I;  1XNR Q;  2OWO A;  4QIW E;  1TWC H;  3K80 C;  4MZ9 A;  4KHP L;  2JA5 H;  3I4O A;  1Z47 A;  4YCW A;  4BY1 G;  4DV1 L;  4A93 G;  3UE0 A;  2YTV A;  2R7Z H;  3AYH B;  4JBW A;  4JCV E;  1U5K A;  5GQO A;  5JJI A;  3Q8D A;  3J81 c;  3M7N A;  2R6G A;  4JI2 L;  3DLL A;  4A3I H;  2F52 A;  3HOU G;  4IO9 A;  3CME A;  1D7Q A;  1QZG A;  1XNQ L;  2RHS B;  3TRE A;  3W5O A;  3PO3 G;  1HZA A;  1XNQ Q;  4LWC A;  5GAD C;  2JA6 G;  4BA2 I;  3I4N H;  4DR6 Q;  3I4M H;  2PQA A;  2B29 A;  1E22 A;  5LMN L;  1VQ7 A;  3UDG A;  1YBY A;  3J81 j;  1HNW L;  2I5H A;  1W3S A;  3WWV A;  1W2B A;  1HNW Q;  2PI2 A;  4LF9 Q;  4OWT B;  4JI8 Q;  3CC7 A;  1PH5 A;  4A3E H;  4OWW B;  5ELO A;  5GRO A;  4GNX B;  4DK3 C;  4DR3 L;  2QA4 A;  2CQO A;  1N8R C;  1EYG A;  2UU9 Q;  4DV0 L;  3HOW H;  4DAY B;  1VCI A;  5EAY A;  3SGI A;  4X6A H;  4JI5 L;  3K0X A;  4HIK A;  4DV2 Q;  2JEA I;  4JI4 L;  1CKO A;  2EIF A;  2HQL A;  3PGZ A;  2XTI A;  3UDF A;  4LFB L;  1WCM G;  1NE3 A;  4DV5 Q;  2ZJP A;  3EIV A;  2ES2 A;  1E3P A;  1Q81 C;  3K7U C;  1VQ9 A;  1PH1 A;  3UDI A;  1KC8 C;  1Q1E A;  1JMC A;  1SLJ A;  4GOP B;  4IPH A;  2KCT A;  4R4I A;  1M90 C;  2YV5 A;  4P73 A;  5C4X H;  3CCU A;  4FDB A;  4A3B G;  2Z6K A;  3E9H A;  5JEA G;  1GM5 A;  2HIX A;  2UXC Q;  1EOV A;  1VQA A;  3KF6 A;  5J3B A;  2OTL A;  3T1Y L;  1IL2 A;  4A3M G;  4YCV A;  1Q86 C;  1XMQ L;  5GAG C;  2WAQ G;  5IYB H;  4PZ7 A;  2VQE Q;  3CMA A;  3PUZ A;  1PV4 A;  1M1K C;  4KI0 A;  5GAE C;  3M9B A;  4DV6 L;  1KL9 A;  1RL2 A;  1H95 A;  4BY7 H;  1L1O A;  1MKH A;  1V1Q A;  1X6O A;  3CCR A;  4TVA B;  2D0O A;  1N33 L;  5C0X I;  4X66 Q;  2VQF L;  4JC0 A;  2NZH A;  3S2D H;  2UUB L;  1EQQ A;  2B3G A;  1KRS A;  2BA1 A;  4DUZ L;  4DKA C;  1KIX A;  4NXN Q;  5M3F H;  1S40 A;  1CSP A;  4DUZ Q;  2DUD A;  1TWG H;  2F4V Q;  2HT1 A;  4A3C H;  1HJP A;  4A3L H;  4LFA Q;  4UP7 A;  1YJW A;  3STB D;  1YHA A;  5IYC H;  3HFZ B;  1VQG A;  4DUY L;  2OCE A;  3CCE A;  3CD6 A;  2UUC L;  1T9H A;  4R4Q A;  1PA6 A;  2D0P A;  2K4K A;  3FKI G;  2MQH A;  3UDX A;  2VW9 A;  2IY5 B;  2N49 A;  4L5R C;  4JI6 L;  3PCO B;  4POF A;  3RLN A;  1LUZ A;  3F1Z A;  2JA7 G;  1NTG A;  4Y52 H;  2GN5 A;  1E1T A;  2K14 A;  3PIO A;  1PH8 A;  1HR0 Q;  1FJG Q;  4JOI C;  4QL5 A;  1VS0 A;  1L0W A;  4WJ3 M;  3S1N H;  4YCU A;  1VQ6 A;  1TWF H;  1L2F A;  4JBK A;  4GLX A;  4BA1 I;  1EUJ A;  2CWA A;  2KHI A;  2JEB I;  5ELN A;  2R92 H;  2K5H A;  3GTG H;  4MNO A;  2RHQ B;  3G71 A;  3PV0 A;  3KOJ A;  1OXX K;  3KJP A;  1HH2 P;  2AMC B;  4LF6 L;  2B63 H;  5IP9 G;  3HOX G;  5AJ3 Q;  2IT1 A;  2Q2H A;  1E1O A;  1N36 L;  2LSS A;  4LF6 Q;  1PH4 A;  1K3R A;  1Y1V H;  1SFO H;  1CUK A;  1N36 Q;  1YJN A;  4B3R L;  4APV A;  4L5T A;  2C35 B;  2Z6K C;  4HJ5 A;  1I94 L;  2ASB A;  5DLQ E;  4X65 L;  4HIM A;  4AQY L;  2JA8 G;  2VUM G;  4AYB G;  5M3M H;  3I55 A;  4AQY Q;  1NMG A;  1VQ5 A;  1IBM Q;  4LF7 Q;  2A8V A;  4OO1 G;  2JA9 A;  2PQA B;  1ASZ A;  1G29 1;  1UE7 A;  2IX0 A;  3LGJ A;  1C9O A;  1OXT A;  2JA5 G;  4LFC Q;  4MTN A;  1QVF A;  1SN8 A;  1L1O C;  1X54 A;  2KHJ A;  1YVC A;  4DAM A;  4JI1 L;  4AIM A;  4PG3 A;  2R7Z G;  4A76 A;  2HIV A;  4LF8 L;  1Q7Y C;  4NPS A;  1UE1 A;  4JG2 A;  1E7Z A;  1SRO A;  1X65 A;  2MO0 A;  2VL6 A;  3PO2 H;  4A3I G;  1VQ8 A;  3GTQ H;  4OWX B;  1Q1B A;  3W1G A;  4DPG A;  1QUQ A;  4KHP Q;  1IBK L;  4R1J A;  4ME3 A;  5JJK A;  4PZ8 A;  1G6P A;  1IBK Q;  4JI7 L;  2KEN A;  4WJ4 A;  4DV1 Q;  3I4N G;  4A3J H;  4QY7 A;  3I4M G;  4IOA A;  4JI7 Q;  1AE3 A;  1X55 A;  2NVT H;  4GKK L;  1GO3 E;  1LYL A;  4AH6 A;  1YZ6 A;  1WFQ A;  3CCQ A;  1OXV A;  5C3E H;  1HNZ L;  3AFP A;  1PYS B;  1UE5 A;  4UPA A;  4JI2 Q;  3RLF A;  1BVS A;  1GKH A;  4A3E G;  1R9T H;  4X62 L;  5K36 G;  1VQC A;  2A19 A;  1B8A A;  1ASY A;  3HOW G;  1Y1W H;  3AQQ A;  4X62 Q;  3FP9 A;  3S14 H;  4JBJ A;  3GO5 A;  1S72 A;  2KCM A;  3KF6 B;  2UXD L;  4L5Q A;  2HHH L;  2OQ0 A;  5LMN Q;  2UXD Q;  1A8V A;  3UE1 A;  1NBW A;  1IXR A;  4JOI A;  1P16 A;  2WB1 G;  4LUV A;  3A5U A;  1JE5 A;  3AFQ A;  4P74 A;  3S1R H;  4OON A;  4DR3 Q;  2MFI A;  4DV0 Q;  3CCV A;  3M3Y H;  2MNA A;  4JI5 Q;  3CP0 A;  1C7Y A;  5JEA J;  2N8N A;  3PF4 A;  4JI4 Q;  2OQK A;  2AWO A;  5C4X G;  4LFB Q;  1NMF A;  4R4O A;  4A3D H;  4DNI A;  1WJJ A;  3S1M H;  3M4O H;  3HOV H;  1BBW A;  1X56 A;  4DV3 L;  5IYB G;  1PH2 A;  3K8A A;  1J6Q A;  4HJ8 A;  1IBL L;  3EBE A;  1K8A C;  3J80 i;  3J7Z C;  4DR7 L;  1TXY A;  4BY7 G;  3HKZ G;  4GN3 B;  4XTC S;  1CKN B;  1HZB A;  4QGU A;  1VQN A;  1HZC A;  2UXB L;  1VQD A;  2Y0S G;  3L7Z C;  4DV4 L;  1VQF A;  3T1Y Q;  1KD1 C;  5FJ8 H;  1DGS A;  1XMQ Q;  1J5E L;  3MXN B;  5FLM G;  4A3F H;  4JI3 L;  1J5E Q;  2JJQ A;  1OXU A;  3L2P A;  4X64 L;  5M3F G;  3KDF B;  1VQL A;  2CKZ B;  4JI3 Q;  4A3C G;  4DV6 Q;  4A3L G;  3IRB A;  2UUA L;  1EWI A;  2K5V A;  4YWM A;  4EX5 A;  5IYC G;  5C44 H;  3CXC A;  1K9M C;  2UUA Q;  1Z9F A;  1N33 Q;  2VQF Q;  2NN6 G;  4JV5 L;  1JB7 A;  5IP7 H;  1V43 A;  5FLM H;  2UUB Q;  4B3S L;  4IFD J;  3HOZ H;  4IPC A;  2IHF A; 
#chains in the Genus database with same CATH topology
 3NQI A;  4J1M A;  4YHH L;  4YIJ A;  3R8B A;  2CH4 A;  1I50 H;  5IWA L;  4GNX A;  3RNU A;  1MSG A;  2PMZ E;  1YNN D;  2M9V A;  2F0H A;  3P7J A;  4LNQ A;  1G2S A;  1NJI C;  1I3Q H;  2N3S A;  2B63 G;  1MIU A;  1SYD A;  3T1H Q;  3JAM i;  1A2T A;  1X3F A;  1Y1V G;  2J7Z A;  1I4G A;  2SDF A;  3QJY A;  3K5M A;  1MJC A;  1UUP A;  3GTM B;  5DEH A;  1YEZ A;  4BXX H;  4X3U A;  4EQ5 A;  4LF5 L;  1YNX A;  1KDA A;  3KYH C;  1FR3 A;  1U9R A;  1PVO A;  4XYQ A;  4B3R Q;  2AHO B;  5I4D A;  2WAQ E;  3ULP A;  2F0T A;  4B3T L;  1A3V A;  2HQE A;  1EQV A;  2F0F A;  4Y7N B;  4KD4 A;  2WV6 D;  4IZ8 A;  5ELB A;  2X6L A;  2CW0 D;  3PO2 G;  4IJL A;  2DJF C;  1CQV A;  3N6R A;  3J7A 5;  2QIL A;  3LNN A;  1YNJ C;  1LTB D;  3S1Q B;  2R92 B;  4QUF A;  2JQO A;  1HNX L;  1TQO A;  2CHB D;  4LF8 Q;  5C3E G;  1EY6 A;  1Z7T A;  4JYA L;  4G7O C;  3P1H A;  3ERS X;  2GVB A;  4NXM L;  5JJL A;  1RKN A;  5KNB A;  1RDP D;  5CYU A;  4KMU C;  1EU3 A;  1IW7 C;  2JP1 A;  3LX0 A;  4O1N A;  3BYY B;  3VDY A;  3IKJ A;  4CDC C;  1B4O A;  3ERQ A;  3K5N A;  5E1F A;  5EBC A;  1BCP B;  2F0I A;  5HGT A;  4HJ9 A;  2E2J B;  5DM6 3;  4A3K H;  4N8X 1;  1ROD A;  4A3D G;  3ULL A;  4GOP C;  1L1O B;  1HZ9 A;  3BJU A;  2GA4 B;  2O4X A;  3CRK C;  3HOV G;  3CQZ H;  1PYB A;  4A3J B;  4H0L C;  1UE6 A;  4BY1 H;  1AN8 A;  5IOC A;  1SR3 A;  5EBD A;  1JWS D;  1XPO A;  2WFW A;  3A8J E;  2ATW A;  3KLR A;  1IKL A;  3HOU H;  1UWV A;  1BOS A;  4DV3 Q;  2B2Y C;  1E2W A;  5M5W H;  4O2D A;  1JOQ A;  4DR7 Q;  1TS5 A;  2CCZ A;  4RKB A;  1D5Z C;  3N52 A;  4HSP A;  3GTP H;  4DV4 Q;  2IW3 A;  2CH4 W;  4DV5 L;  3M4Y A;  2DNE A;  2JXM B;  3I91 A;  1VQK A;  1KAW A;  3NK9 A;  3RZD B;  2N88 A;  4C56 C;  3E0J A;  3NTH A;  2SEB D;  2YTX A;  1YIJ A;  1BKB A;  4A93 B;  4UP9 A;  3I2Z A;  2B2V A;  2F0M A;  3SXH A;  4B3S Q;  1QZH A;  3S17 B;  4GS3 A;  1O7I A;  4UP8 A;  3VYU A;  1I4X A;  3CPW A;  2VQE L;  1QOH A;  1WTQ A;  4DK6 C;  1STB A;  4LF4 Q;  2QF7 A;  4TRD A;  4YWL A;  4A3G G;  1GOZ A;  1Q46 A;  3NBH B;  4OXP A;  3S24 A;  1DYQ A;  2XNA C;  1DON A;  4DNR B;  2WII B;  4K5W A;  2E5L Q;  3TN2 A;  2PQE A;  4ZYS A;  2F0G A;  4L63 B;  2BA0 A;  5C4H A;  3W3A A;  4RCO A;  2F0J A;  3Q24 A;  2R93 B;  1PYW D;  3GTL H;  3K58 A;  2I5M X;  4IFD G;  4DF7 A;  5CBE E;  2E2I B;  3J7Y W;  1R4Q B;  5DM7 3;  3G6E A;  1STH A;  3H09 A;  2AKW B;  3HKZ E;  4RKL A;  1VQJ A;  5M5X B;  2OEO A;  4CKC A;  3FDT A;  4DR4 Q;  4HID A;  2F3I A;  4F7X A;  2WAQ B;  3QWN A;  4C3J G;  1HQR D;  2NVQ B;  2ZJQ A;  2D62 A;  2VB2 X;  1TWA B;  4IJH A;  4FVM A;  1F77 A;  1Q12 A;  4ZK9 B;  2I46 A;  4DR2 Q;  5AJ3 L;  4POG A;  2IX3 A;  4OX9 Q;  1V9P A;  3M4Q A;  2A68 C;  4BBR G;  4K2L A;  4OIK A;  1QNU A;  4KTA A;  3DMU A;  3S16 H;  3HOX H;  4BBR H;  1IBM L;  1CTM A;  2EY1 A;  4KY6 A;  4YY3 Q;  1VQO A;  3U4Z A;  3M4P A;  1YI2 A;  1FL0 A;  1A3U A;  1SMY C;  2KJX A;  2JA8 H;  1YJ9 A;  4OGQ C;  1XNR Q;  1B2T A;  4MZ9 A;  4C1N I;  2JA5 H;  4EQP A;  3BS1 A;  4K8I A;  1K83 B;  4C3H G;  1I6V C;  4A93 G;  4DV1 L;  2WKC A;  3GV6 A;  1CM9 A;  4QB4 A;  4BS9 A;  2R7Z H;  5GQO A;  3DWP A;  2SNM A;  2H1E A;  3J81 c;  3DLL A;  1EYC A;  2A6H D;  1XNQ L;  4H13 C;  3W5O A;  3V05 A;  5GAD C;  3NWT A;  1AZQ A;  4EQN A;  3I4M H;  2BOS A;  1VQ7 A;  3UDG A;  2VUM B;  1K3B C;  2AQ1 B;  4IAL A;  1HUM A;  3WWV A;  4OWT B;  4JI8 Q;  1HPC A;  1PH5 A;  5GRO A;  4DNT B;  1N8R C;  1EYG A;  5D3I B;  2EY6 A;  4X6A H;  2JEA I;  5FLX L;  2L0C A;  4JVZ A;  3UDF A;  2HQL A;  5HUR A;  1EU4 A;  1G8Z D;  4ID6 A;  2A6E C;  1SEB D;  2QCP X;  1Q1E A;  1F2Y A;  4GOP B;  2KCT A;  1UNS A;  2EYH A;  4R4I A;  1M90 C;  2YV5 A;  4HCE A;  1F2Z A;  1WVL A;  2L55 A;  1UEA B;  1SXT A;  5JEA G;  1D6E C;  5IT9 L;  2UXC Q;  1VQA A;  5J3B A;  1BBX C;  4A3E B;  2WAQ G;  5FLX E;  3HOW B;  3CMA A;  1D5M C;  2KCC A;  4DAP A;  3M9B A;  4DV6 L;  1RL2 A;  1H95 A;  1L1O A;  1VMP A;  2OT2 A;  1N33 L;  5CMD A;  4X66 Q;  2UUB L;  2Z6B A;  1S40 A;  5IT9 E;  1SNC A;  4LFA Q;  1YJW A;  5CGK A;  5C4X B;  5T1I A;  1VQG A;  2OCE A;  3CD6 A;  3K0Y A;  4F8M A;  1EOT A;  3EA6 A;  1QB5 D;  2K4K A;  3D6C A;  1LO5 D;  2VW9 A;  1L0X B;  2N49 A;  1SNO A;  2MP1 A;  3PCO B;  4A3B B;  4BY7 B;  3HKZ B;  4Y52 H;  2L4N A;  2GN5 A;  2K14 A;  1HR0 Q;  2QDL A;  1NR4 A;  2RSN A;  1HFN A;  1VS0 A;  5FOB B;  3S2D B;  3S1N H;  4YCU A;  3Q6S A;  3TZU A;  4CJ2 C;  5FO9 B;  4JBK A;  2F0U A;  4BA1 I;  1GUS A;  1TVX A;  2CWA A;  4OIJ A;  3GTG H;  5DAU A;  3PV0 A;  3KOJ A;  1LV9 A;  1MD2 D;  5IP9 G;  5NUC A;  1CUK A;  1N36 Q;  3VR3 A;  1NAP A;  1KDB A;  2EY5 A;  2DY8 A;  3JAM E;  2C35 B;  4AQY L;  2VUM G;  5M3M H;  2A8V A;  1EWH A;  1HTL D;  4OO1 G;  3OMC A;  2JA9 A;  2Q8R E;  1ASZ A;  2IX0 A;  1PRT C;  2K33 A;  4LFC Q;  5ELD A;  3E6Z X;  2JA7 B;  2ENB A;  2SNS A;  3BVG A;  1PZI D;  4A76 A;  4X3K A;  2HIV A;  1U4L A;  3VA5 A;  1E7Z A;  1SRO A;  4A3I G;  3D6W A;  4HTH A;  1VQ8 A;  1LTG D;  3GTQ H;  3W1G A;  4R1J A;  4CKE A;  1IBK Q;  1ENC A;  4JI7 Q;  1AE3 A;  1X55 A;  4RGO S;  1YZ6 A;  2LY7 A;  1STG A;  1HNZ L;  4IUN A;  4UPA A;  1PTO D;  1BVS A;  1GKH A;  4A3E G;  1R9T H;  3IAY A;  1VQC A;  2A19 A;  1O7L A;  2F0K A;  2K5W A;  5E3F A;  3HOW G;  4X62 Q;  1S5F D;  1WTH A;  2KCM A;  1EY5 A;  2OQ0 A;  5COR A;  2UXD Q;  1HHV A;  4C1N K;  1IXR A;  4LUV A;  3Q23 A;  4RAU C;  3A5U A;  3AFQ A;  4P74 A;  1PDQ A;  3F2U A;  2K7V A;  3OPO A;  4DR3 Q;  2MFI A;  3TSS A;  4LJZ C;  4U68 A;  3K6O A;  3MAQ A;  1DD2 A;  2MNA A;  3CP0 A;  1C7Y A;  5JEA J;  3PF4 A;  1SNQ A;  1V1P B;  5C4X G;  4LFB Q;  4R4O A;  2EOT A;  2KEC A;  1PTO F;  1E2Z A;  5T1G A;  1VMC A;  4N9P A;  3M4O H;  1BBW A;  4FXD A;  4IUV A;  1E0B A;  5IYB G;  4ABN A;  1IBL L;  2IJ0 A;  1NCV A;  3OMG A;  4L6T B;  4BY7 G;  1KAB A;  3HKZ G;  1HZC A;  3OHX C;  1KD1 C;  5FJ8 H;  1DGS A;  1XMQ Q;  1J5E L;  3MXN B;  5FLM G;  2RA4 A;  4JI3 L;  4A3F H;  1OXU A;  3KLS X;  1ONL A;  4YWM A;  5IYC G;  2RDF A;  1BO0 A;  2KCN A;  3T4A C;  2F0V A;  3OIP A;  1V43 A;  5FLM H;  1Y69 U;  4WFN 3;  1JB3 A;  1K8M A;  4HN7 A;  2N55 A;  3VA7 A;  1XMO L;  2BH8 A;  1XPR A;  3CPF A;  2UUC Q;  4TKO B;  5D3D A;  5BN3 A;  1VF7 A;  2ZXO A;  4CBV A;  3CCJ A;  3FMC A;  2Y0S B;  2QKI C;  3MEF A;  4DV7 L;  3PIO 3;  1XPU A;  2F4I A;  4I7A A;  4DU9 A;  1TWG B;  3TP5 A;  4JBM A;  1II3 A;  2EQS A;  4LAA A;  2IX1 A;  5BN5 A;  3RD4 A;  1I50 B;  1PFM A;  2ZTC A;  3GTO H;  3OTO L;  3H3V I;  3MFY A;  1KDC A;  5ISR A;  3K81 C;  4GKJ L;  3URY A;  1VQI A;  3H0G H;  2FHT A;  2A5H A;  4FXK C;  4R4C A;  2EJM A;  2FMC A;  1MHW C;  2E74 C;  3U4V A;  2B2Y A;  2AQ2 B;  1I94 Q;  4R4T A;  3TQY A;  3ZJY C;  4B3T Q;  4K5X A;  1CKM A;  1I3Q B;  3A55 A;  2K04 A;  3F8T A;  5IYD H;  1RF2 D;  4KV6 A;  1EY7 A;  5C5M A;  3NEM A;  3PUY A;  4P2C B;  1QVC A;  4EVO A;  1I6H H;  2LS0 1;  4JI1 Q;  1S3O A;  2C5C A;  2OXP A;  3A0J A;  3TME A;  4JI0 L;  1F9R A;  1HNX Q;  3SK6 A;  3D0F A;  2KHS A;  4ILW A;  5C0X G;  2BE5 D;  3S9W A;  1HXY D;  2JSO A;  1DJR D;  3RR5 A;  2R7F A;  2A73 B;  3KFU A;  4NXM Q;  4GKK Q;  4WRD A;  1JOO A;  2E8G A;  2Q2T A;  3W2D A;  3CRL C;  5D65 A;  2E2H H;  3CAM A;  5FLX c;  2RF4 A;  4RGN A;  3PSI A;  2K5D A;  1T5E A;  1UAP A;  3KJO A;  3STB C;  1QG7 A;  5C6A A;  5CR3 A;  1XXG A;  1PRT B;  3HOY H;  4KD3 A;  2YTY A;  1YNN C;  5IT9 c;  1FYC A;  1AH9 A;  4HJ7 A;  4KN4 C;  1TY0 A;  1D1K A;  1S5D D;  4DR6 L;  1DOM A;  1XJV A;  5EJW A;  2MGS A;  2L12 A;  1WI5 A;  4G4K A;  4AYB E;  1OTC A;  3ONA B;  4KLK A;  1FGB D;  2O5I C;  2V1C C;  3BDO A;  2UU9 L;  1NY4 A;  3GD7 A;  1A62 A;  5C44 G;  1GVP A;  2UXB Q;  4A3K B;  1VDZ A;  5LMN W;  1B9M A;  3I70 A;  1LTI D;  3AEV A;  2G9D A;  3CQZ B;  4CDF C;  4P72 A;  5KIX A;  3S15 H;  2E2D C;  3ULJ A;  4P71 A;  1VQE A;  4BY1 B;  2PW7 A;  3I56 A;  3P75 A;  1UEB A;  4KJO A;  3V2T A;  1A63 A;  4GLA C;  1B7Y B;  1WCM H;  4G7H C;  3HOV B;  4JV5 Q;  4IUU A;  1Q82 C;  4OO1 I;  5ELF A;  3JAM c;  5M5W B;  3J7A V;  1S5E D;  2I5L X;  4QCL A;  4GN5 A;  1GHJ A;  1F9Q A;  2F0E A;  2E76 C;  1FNV A;  4YWK A;  5BR8 L;  2WB1 E;  4KN7 C;  5KNC A;  4A3M H;  3KLS A;  4IPD A;  4NXN L;  1V1P A;  2XVS A;  2F4V L;  4QF4 A;  1X9N A;  1C8C A;  1A0I A;  3A74 A;  4FO2 A;  4BXX G;  3NSW A;  3OW2 A;  2QGQ A;  4XQQ A;  4ME5 A;  1VQ4 A;  4ODG A;  1CZW A;  3CC2 A;  4RG1 A;  1WTX A;  3HKS A;  2ID0 A;  3BVZ A;  5LMU Q;  2PYK A;  2K6A A;  3HEJ A;  4DR5 Q;  1PTO H;  4PQX A;  3SK4 A;  2VY3 A;  1C4Q A;  2IHE A;  4J8Q A;  3ICE A;  1FJG L;  2LXJ A;  2XN9 C;  1B3Q A;  1PFS A;  2K32 A;  1FVI A;  1DOL A;  3PIP 3;  3TS0 A;  2EPB A;  1TWH H;  4ZAI A;  5IGF A;  4DR1 Q;  1P8L A;  5C0X J;  5KYL A;  3PF5 A;  2I07 B;  1KHI A;  4A3G B;  1EQT A;  1B70 B;  2KBN A;  1RJT A;  2F0D A;  4TQU S;  1PH6 A;  3CF5 A;  2DGY A;  1N34 Q;  3OWE B;  3GTL B;  1OO9 B;  1S5C D;  1C0A A;  1ZKO A;  2LXK A;  1CQF A;  1GUG A;  3DHQ A;  4ZLT F;  1Q8K A;  2NVX H;  4K0K Q;  3S2H B;  3GQB A;  3CHB D;  4TSS A;  2K03 A;  3NTI A;  1A2U A;  1ESR A;  5CV6 A;  5CC4 A;  3CCM A;  3DM3 A;  4XQN A;  5KND A;  4A3K G;  3RZO H;  2MO1 A;  4KKS A;  3KLW A;  1PH7 A;  1G51 A;  4C3J B;  3K80 C;  1Z47 A;  4PNY A;  4YCW A;  4BY1 G;  1XX8 A;  3UE0 A;  1QCB D;  3NPP A;  2J4X A;  1ZXT A;  5JJI A;  3HOX B;  2HD3 A;  4BBR B;  2R6G A;  4JI2 L;  3M7N A;  3HOU G;  1LT6 D;  1HUN A;  4IO9 A;  3CME A;  3R3O A;  1ZYR C;  3TRE A;  1XNQ Q;  4LWC A;  1ENA A;  1B50 A;  2RQX A;  5LMN L;  5CV5 A;  2JA8 B;  1ICW A;  4RA8 A;  1HNW L;  1W3S A;  2PI2 A;  3MFG A;  4LF9 Q;  4OWW B;  5ELO A;  4DFA A;  4DK3 C;  1O78 A;  1LT4 D;  4DV0 L;  4DAY B;  3SGI A;  3Q0A A;  2R7Z B;  5FK9 C;  3K0X A;  4HIK A;  4DV2 Q;  3I72 A;  4JI4 L;  1CKO A;  1I4H A;  4FNF A;  5JPM C;  1F9P A;  2G9H D;  4DK1 A;  3K7U C;  4CDE C;  4C3H B;  1JMC A;  4IPH A;  3G6J B;  2RKS A;  3I4M B;  1TY2 A;  2XSC A;  4P73 A;  1YNJ D;  1W6J A;  4RFB A;  1B9N A;  1WTW A;  3KF6 A;  2OTL A;  3T1Y L;  3DXJ C;  1IL2 A;  4YCV A;  5GAG C;  4V19 0;  4KI0 A;  5GAE C;  4HMJ A;  3PMF A;  1SE2 A;  2PMZ B;  5C0X I;  2A74 C;  4RGT A;  2VQF L;  2IPK D;  2BA1 A;  4DUZ L;  1CSP A;  3NXW A;  4A3C H;  1HJP A;  3BZD B;  3GTJ B;  1YHA A;  4IUT A;  2NN6 H;  4R4Q A;  1PA6 A;  2KA7 A;  3KUP A;  4J6H A;  3UDX A;  5I6Y A;  5JOB A;  1SYG A;  4POF A;  1QIL A;  1NTG A;  5I9O A;  1PH8 A;  4JOI C;  2A6H C;  1L0W A;  4WJ3 M;  4HAE A;  4IUP A;  1ML0 D;  4X3S A;  2KHI A;  2R92 H;  2K5H A;  4KHV A;  4MNO A;  2AMC B;  4LF6 L;  3ND8 A;  2BCO A;  3HOX G;  3GTK B;  2IT1 A;  4JK1 C;  5KRU A;  1AW7 A;  1PH4 A;  3WOF A;  1H9R A;  1V8Q A;  1XWE A;  1LTR D;  1YJN A;  3I90 A;  3MEH A;  4B3R L;  3TBI B;  1WTR A;  1STN A;  4NP5 A;  4RCN A;  2Z6K C;  2ASB A;  5DLQ E;  2JA8 G;  4AYB G;  4AQY Q;  4LF7 Q;  1VQ5 A;  4FF1 A;  3S1N B;  2PQA B;  1UE7 A;  1OXT A;  3OW7 A;  2JA5 G;  4MTN A;  1JCK B;  2R7Z G;  4B9W A;  3VR4 A;  4LF8 L;  1Q7Y C;  3OWF A;  1X65 A;  5EKI A;  4OWX B;  1Q1B A;  3HS0 C;  3VR2 A;  4KHP Q;  2VXW A;  4ME3 A;  5JJK A;  3Q22 A;  5LL6 X;  2KEN A;  4A3J H;  4QY7 A;  1PZJ D;  3I4M G;  4IOA A;  2K1B A;  3R93 A;  2NVT H;  1LYL A;  4AH6 A;  1WFQ A;  4I7Z C;  3RLF A;  1Y1W H;  3FP9 A;  3GO5 A;  2AUK A;  3MWY W;  1P16 A;  2WB1 G;  1TWC B;  3GTQ B;  2TMP A;  1WD0 A;  4E6I A;  3M3Y H;  4FYD A;  1W6K A;  1X3Q A;  4JI5 Q;  1KLG D;  2N8N A;  2AWO A;  2HCC A;  3V96 A;  4A3I B;  1JIC A;  1AFP A;  3VYT A;  3T51 B;  1WJJ A;  3MVV A;  3BDC A;  1R9T B;  1X56 A;  4DV3 L;  1PH2 A;  4KY5 A;  1J6Q A;  3J80 i;  4DR7 L;  1TXY A;  1STE A;  4QGU A;  1HZB A;  2EY2 A;  3L7Z C;  4DV4 L;  1LTA D;  4XT3 B;  1J5E Q;  3L2P A;  3KDF B;  4JI3 Q;  1CI3 M;  2DJG C;  2R61 A;  3DWA A;  3IRB A;  2K5V A;  1ZEQ X;  1K9M C;  1TS4 A;  1O7Z A;  1JB7 A;  5IP7 H;  4B3S L;  4IFD J;  3R2T A;  3M4O B;  4L8J A;  3HOZ H;  4IPC A;  1G91 A;  3PUX A;  3RN5 A;  1AP0 A;  1WTO A;  1BNZ A;  2R93 H;  4QQB X;  3BZK A;  4LF4 L;  2F3V A;  4DUY Q;  1EIF A;  5F2D A;  4RHS A;  1K73 C;  1XMO Q;  1EWC A;  4BBS H;  1EIH A;  4HJA A;  4DAY A;  3CCS A;  1WOC A;  5M5X H;  4A3F B;  4JI6 Q;  3NTK A;  1AEX A;  4HR7 B;  2CVR A;  1HQM C;  1VQM A;  2E5L L;  1EFI D;  2Z0S A;  1TWA H;  2ZJR A;  3SVM A;  1L0Y B;  2WIN B;  2CFM A;  3GDE A;  3OYY A;  1HFG A;  4M8A A;  4P75 A;  2Z1C A;  2FXQ A;  1VQB A;  3UI2 A;  2XIW A;  1SMX A;  1JJ2 A;  5M3M G;  3NWS A;  1KAA A;  5J22 A;  4F88 A;  5EQ0 A;  2F0L A;  5A35 A;  4DR4 L;  1JE4 A;  3F2B A;  1LAB A;  2ALY B;  1GD7 A;  2K5Q A;  3NBH A;  4X65 Q;  1SYB A;  1U4M A;  1HR0 W;  3W1B A;  4DR2 L;  2L5T A;  3CCL A;  3CC4 A;  1YHB A;  2JA6 H;  3HP3 A;  3SE0 A;  3KK7 A;  2ZM6 L;  2KED A;  4CGY B;  4WOR A;  5I6W A;  1WYD A;  5CV9 A;  1GHK A;  3GTO B;  1T5X D;  4O0A A;  4JI0 Q;  2B2V C;  4Q5V A;  2F3W A;  2Z9H A;  3KBX A;  3RLO A;  3H0G B;  4MHE A;  3GP7 A;  4GN4 B;  4C3I G;  3BU2 A;  2XWB B;  3E9I A;  4NDX A;  4YY3 L;  3IFD A;  3G48 A;  1JR0 D;  2BH2 A;  1PH3 A;  4PMC A;  3A7L A;  1D1I A;  4ULL A;  4CJ1 B;  1EEF D;  2PNR C;  3K7A H;  1XNR L;  3NEN A;  2D5D A;  4C3I H;  1VQP A;  1I6H B;  3EN2 A;  2HHH Q;  2E75 C;  2LMC B;  3NHH A;  1X32 A;  1SJE D;  2ZXP A;  1EY4 A;  4IFD I;  2NB0 A;  1MGS A;  1DCZ A;  3NP8 A;  1CHQ D;  1EZ6 A;  1EIG A;  2ZTE A;  1SAP A;  2BDN A;  2PPB C;  1TU2 B;  5FJ8 G;  4JI8 L;  4A3F G;  3D4W A;  1QJO A;  3PO3 H;  1PHJ A;  3QIA A;  1ICF B;  4PV1 C;  4LMQ D;  4UHV A;  3FHW A;  3HOY B;  1JC7 A;  1AE2 A;  3S1R B;  5IY0 A;  3X3M A;  1U0L A;  2A69 D;  2CWP A;  3U50 C;  5COY A;  4RGM A;  4X64 Q;  4X3T A;  1YHQ A;  1LTL A;  1I5F A;  1K0R A;  2Q8T A;  2UXC L;  3AU7 A;  2K5N A;  2F0P A;  3MTS A;  1GJX A;  1HCZ A;  2D9U A;  4YHH Q;  2AWN A;  3AB9 A;  2NUC A;  1H9M A;  3L0O A;  4RMF A;  4K14 A;  2BE5 C;  5ELC A;  1K8G A;  2NZO A;  4A3B H;  4G57 A;  4X66 L;  5IWA Q;  3AMU A;  3TRZ A;  1F2L A;  1JWM D;  5GAH C;  5BR8 Q;  4DGZ A;  5C44 B;  2WP8 J;  3WOE A;  1CFM A;  4LFA L;  2B2T C;  2Q2I A;  1X3E A;  4J15 A;  1WCM B;  3TP7 A;  4GOP A;  3QOJ A;  4K8J A;  2QEX A;  3H0G G;  2ZT9 C;  4NW2 A;  1TT2 A;  3VR6 A;  1PH9 A;  2R7D A;  3TZD A;  1Q3L A;  1QUQ B;  5M5Y H;  1E24 A;  4EQO A;  1HR0 L;  5IYD G;  4LF5 Q;  5BN4 A;  1HA6 A;  3HZX A;  2JN4 A;  3JC6 6;  1EFW A;  4B3M L;  1N32 L;  2P5Z X;  3KDF A;  3F2C A;  3A5Z B;  3PUV A;  4A3M B;  3FKI H;  2B8F A;  3PQI A;  1DZ1 A;  5C4J H;  4OHJ A;  4KY7 A;  3ER0 A;  1KNE A;  1SE4 A;  2JA7 H;  1X3G A;  1Y8P B;  3LWU A;  4A75 A;  4UY8 C;  1I4P A;  2YU9 H;  3DWQ A;  4C2M H;  1V1O A;  2JE6 I;  1RCV D;  1SBB B;  2NTT A;  4GLV B;  1EEI D;  1R4P B;  1CSQ A;  4ALP A;  3IFT A;  4CJ0 B;  1WD1 A;  1IZ6 A;  1NUC A;  3E0E A;  5D14 A;  5KYI A;  2B2U C;  1WTP A;  2HDM A;  1EY8 A;  2VS1 A;  1KTK A;  2XGT A;  4O42 A;  3U9S A;  4JYA Q;  2EXD A;  2ICE C;  5A2Q L;  1IKM A;  2NVY H;  4LFC L;  1XTC D;  1S5B D;  2IWH A;  3D4D A;  1TWH B;  5E7N A;  1SE8 A;  1BBU A;  2B2W C;  2FIN B;  1B53 A;  4R8I A;  2NYZ D;  3HOY G;  4JPB W;  1SJH D;  4RWS C;  4F87 A;  3RUZ A;  3SK8 A;  4QIW E;  1SYF A;  2OWO A;  3BYT B;  3I4O A;  2NTS A;  2OF1 A;  1J8I A;  2YTV A;  2C9O A;  3C2P A;  5LHY 1;  3M7G A;  4JCV E;  1U5K A;  2LKV A;  2F03 A;  1IHZ A;  3Q8D A;  1M8A A;  1QZG A;  3VR5 A;  2RHS B;  4DXG A;  1HZA A;  4BA2 I;  2F0Q A;  3I4N H;  3RZO B;  2RDH A;  2RVL A;  3MC0 B;  5C3W A;  1HNW Q;  3CC7 A;  5K36 H;  3L3O C;  3LWE A;  3D4R A;  4DR3 L;  2QA4 A;  1XYI A;  1VCI A;  2FJ2 A;  4OL7 A;  5EAY A;  1PFB A;  2AQ3 B;  2EIF A;  4LFB L;  3H6M A;  2XTI A;  1WCM G;  1NE3 A;  2SOB A;  4DV5 Q;  3D3R A;  1BCP D;  3EIV A;  2ES2 A;  2X6G A;  1Q81 C;  3J80 L;  1PH1 A;  3UDI A;  1KC8 C;  4NMZ A;  1DOK A;  2CW0 C;  5IGE A;  2Z4I A;  4FXG C;  2Z6K A;  3E9H A;  1GM5 A;  3HOU B;  3J81 L;  3DUZ A;  4A3M G;  1Q86 C;  1XMQ L;  4M1U B;  4PZ7 A;  2VQE Q;  3PUZ A;  1PV4 A;  1M1K C;  1V1Q A;  1MKH A;  1X6O A;  3GTP B;  4TVA B;  1JOK A;  5KGU A;  3J80 E;  2D0O A;  1FNW A;  1LT3 D;  2NZH A;  3A7A B;  1BCP F;  5ELE A;  1KRS A;  4DKA C;  2WKD A;  5LL6 S;  5M3F H;  2DNC A;  4DUZ Q;  1TWG H;  4A3L H;  3STB D;  2QEJ C;  3HFZ B;  3CU7 A;  2RCF A;  2UUC L;  3C1E A;  3VYS A;  2J0T D;  1GXD C;  1JOR A;  4L5R C;  2Q8I B;  3MXN A;  3PIO A;  3TP8 A;  4QL5 A;  2B8G A;  1VQ6 A;  3FRP B;  2QW7 A;  1TWF H;  4GLX A;  1C48 A;  1EUJ A;  3G71 A;  1OXX K;  1HH2 P;  2B63 H;  5AJ3 Q;  1SND A;  2Q2H A;  1E1O A;  1PXU A;  2LSS A;  4LF6 Q;  2DY7 A;  1K3R A;  1Y1V H;  1SFO H;  4LK1 C;  3QG1 A;  2TSS A;  2M00 A;  4APV A;  4L5T A;  1LLR D;  2M2L A;  1I94 L;  1BF4 A;  3KBG A;  3HRZ C;  2CQA A;  4H44 C;  1IBM Q;  1F2M A;  5CV4 A;  3LGJ A;  1G29 1;  2KQ3 A;  1SN8 A;  5G3L D;  2KHJ A;  1YVC A;  1BR9 A;  4JI1 L;  1ILQ A;  4PG3 A;  1STY A;  1Z6H A;  3QB3 A;  1UE1 A;  4JG2 A;  2MO0 A;  4MN3 A;  2VL6 A;  3PO2 H;  4QIW B;  1SYE A;  3QO2 A;  4DPG A;  2EVB A;  1QUQ A;  4PZ8 A;  4DV1 Q;  1JWU D;  2ZXR A;  3CKI B;  3NUC A;  4GKK L;  4ZRZ A;  1GO3 E;  3S16 B;  1OXV A;  5FO7 B;  5C3E H;  1UE5 A;  3I8Z A;  2R3Z A;  1PZK D;  1ASY A;  4GZY C;  2FMM A;  2MPM A;  3AQQ A;  5G3L F;  3MA2 B;  3S14 H;  1S72 A;  4U67 3;  4FF3 A;  1STA A;  4L5Q A;  3T56 B;  4AYB B;  2G5D A;  1JE5 A;  4ZUJ A;  1TS3 A;  2JA5 B;  4WJW A;  1A6X A;  4OON A;  4ZQ3 A;  1EYA A;  1GUN A;  4DA2 A;  3E5S A;  1BUV T;  1DXM A;  2NVT B;  4A3D H;  1GUO A;  4DNI A;  3S1M H;  3HOV H;  1HRJ A;  3K8A A;  1Y1W B;  5TSS A;  5AFW A;  1RHP A;  3EBE A;  3J7Z C;  1CKN B;  2UXB L;  4RHR A;  3MHB A;  2F1M A;  2JJQ A;  1VQL A;  2PO4 A;  4A3C G;  4DV6 Q;  3H94 A;  3M3Y B;  3A8K E;  2UUA L;  1EWI A;  4EX5 A;  3CXC A;  2F0O A;  2WB1 B;  4DN4 M;  1B44 D;  4CKB A;  1N33 Q;  1IW7 D;  2NN6 G;  4JV5 L;  2UUB Q;  5L37 A;  4CDD C;  3SHL A;  3OIQ A;  1LM0 A;  2L15 A;  1D8L A;  2RDG A;  2JYO A;  1XTD A;  5E4X A;  2ICI A;  2F0N A;  1PLF A;  3GTM H;  1MI2 A;  2D2C C;  4HMI A;  4H02 A;  1YIT A;  1KRT A;  1PMR A;  4NB3 A;  1ZYR D;  2KVM A;  2R92 G;  5I2Y A;  4Y7N H;  3IL8 A;  2L9H A;  3T1H L;  5JVG 3;  4A3G H;  3HGB A;  3HOZ B;  4ZUI A;  3U58 A;  3H91 A;  5LMU L;  3S1Q H;  1MJE A;  2QDB A;  3OOC A;  4DR5 L;  2K28 A;  4DK0 A;  3P20 A;  1NNX A;  4BBS B;  1MSH A;  3PIP A;  2PNH A;  4LUZ A;  3GV3 A;  1Q90 A;  1H9K A;  3M85 A;  3D8G A;  4IFD H;  3S2H H;  3DM1 A;  4IN3 A;  4DR1 L;  3HG9 A;  4JW0 A;  5I9P A;  3F2D A;  5FO8 B;  1K28 A;  1SRU A;  3DEP A;  1WTV A;  3I3C A;  1N34 L;  4C3J H;  2ZM6 Q;  3GTG B;  4A3J G;  5FKA C;  3I7F A;  3I73 A;  2JK8 A;  2E2J H;  3E3X A;  3NBI A;  4IOC A;  5C5L A;  4XQJ A;  3MXU A;  4QJF A;  1Y1W G;  4K0K L;  3H15 A;  1JT8 A;  2EJG C;  4OEM B;  1NSN S;  5IGC A;  4K6L A;  4L5S A;  1IYJ B;  5M3M B;  3BDL A;  2NBF A;  4GNX C;  1EQR A;  1HNZ Q;  3OSO A;  2VZA A;  4UAI A;  1TR5 A;  2EZV A;  2JA6 B;  3NEL A;  4HCS A;  1SSO A;  3FPU B;  3TEH B;  1EL0 A;  1CT1 D;  1SNM A;  2N78 A;  4XYO A;  1D2B A;  3RN2 A;  3J80 c;  2RSO A;  5C4Z A;  2B2T A;  3FPP A;  4H7B A;  1F9S A;  5CV8 A;  4LW1 A;  1KXL A;  1VQH A;  3D31 A;  3RZD H;  1BQQ T;  4C3H H;  1EZ8 A;  2GVA A;  4A93 H;  1RTO A;  3PUW A;  4PMW A;  5EPJ A;  3ND9 A;  3SR1 A;  3EJI A;  3NQT A;  2PZU A;  3BZC A;  3K7A B;  1JJG A;  4PZ6 A;  3S17 H;  4Z9C B;  4LF9 L;  2K75 A;  4C3I B;  3U9O A;  5JPN C;  1IBL Q;  2A68 D;  2K50 A;  1E2V A;  3X3N A;  4ZKB B;  2YYZ A;  2X69 A;  4DV2 L;  3H3V H;  3J81 i;  1B3A A;  5IP7 G;  3HOZ G;  2ZTD A;  2R93 G;  5HY6 A;  3SDZ A;  2I0Q A;  2RBM A;  3A56 A;  3G7L A;  2V4D A;  5HGQ A;  4I65 A;  3GTJ H;  1SMY D;  2RCN A;  2B2U A;  4BBS G;  2A1A A;  5IE8 A;  1U4P A;  1GUW A;  3PO3 B;  2NZ1 D;  2E2I H;  4IPG A;  5JEA H;  2B2W A;  2MJ8 A;  2EYJ A;  4ZKC B;  5IIF A;  5CV7 A;  1EIY B;  5IGD A;  5K5P A;  1N9W A;  4KHZ A;  2NVQ H;  3A8I E;  1PTO C;  3FVQ A;  4DV7 Q;  1KQS A;  4BWG B;  2HUG A;  3GTK H;  2K52 A;  3C1F A;  1CKN A;  1H9J A;  3MZ5 A;  1Y14 B;  3J7A F;  4K2K A;  1Y8O B;  3OTO Q;  1K0S A;  3C3L A;  2XWJ B;  2Y0S E;  4GKJ Q;  1N32 Q;  1OXS C;  2EDG A;  3JAM L;  2A6E D;  2H5X A;  4XIG S;  4B3M Q;  2JA6 G;  3TS2 A;  1LTT D;  1U4R A;  2OTJ A;  4KKT A;  4DAV A;  2PZW A;  3KF8 B;  3QR8 A;  4LUO A;  3ZYY X;  4G7Z C;  1LTS D;  2KUM A;  4OX9 L;  2F0S A;  3C46 A;  5EPL A;  4HIO A;  4QMG A;  3BVM A;  3G4S A;  1QVG A;  4FF4 A;  1QWY A;  5J39 A;  1TS2 A;  1FD7 D;  1K83 H;  3K5L A;  5M5Y B;  1O80 A;  4XXE A;  1KLU D;  5IP9 H;  1FGU A;  5H1S E;  4LF7 L;  2VNU D;  3I4L A;  2A69 C;  1I4Q A;  3B6Y A;  3FKI B;  1I4R A;  4EGV A;  5C4J B;  2PZT A;  5C3X A;  1RIP A;  3FEW X;  4FP5 D;  2PW5 A;  4A4I A;  2Q2U A;  3EQL C;  3CW2 C;  2PI2 E;  4OEL B;  4R9W A;  1H9S B;  2EE1 A;  2VUM H;  1EY0 A;  1JJC B;  2IL8 A;  2WAC A;  2YU9 B;  2NN6 I;  4OO1 H;  3WDN A;  4MIU A;  4C2M B;  1TWC H;  4KHP L;  3TP6 A;  3L9A X;  4R8N A;  3ERO A;  4QUC A;  4RH6 A;  3AYH B;  2L11 A;  1G6Z A;  4JBW A;  1O7Y A;  5M9O A;  4A3I H;  2F52 A;  1D7Q A;  2NVY B;  5IGB A;  3PO3 G;  1K8O A;  1BDO A;  1EY9 A;  4B9X A;  1FNU A;  4DR6 Q;  4XDX A;  3A54 A;  2PQA A;  2B29 A;  1E22 A;  1HTP A;  2E2H B;  1YBY A;  3J81 j;  2I5H A;  1W2B A;  2K05 A;  4PMB A;  4A3E H;  2EYO A;  1IL8 A;  2EXZ A;  4GNX B;  3HOW H;  2CQO A;  3K57 A;  2UU9 Q;  2HDL A;  3SK5 A;  2EYL A;  1CA5 A;  4JI5 L;  1M4V A;  4CHT B;  3PGZ A;  2B39 A;  2NWG A;  2XRQ D;  1X3P A;  2LFN A;  2ZJP A;  4KKU A;  1E3P A;  3T53 B;  1VQ9 A;  3O13 A;  5JVH 3;  1PRT D;  4IUQ A;  1HA5 A;  1Y8N B;  1SLJ A;  3I4N B;  3EFX D;  5C4X H;  3CCU A;  4FDB A;  4A3B G;  1B1Z A;  1SDF A;  2HIX A;  1EOV A;  5KEE A;  1SNP A;  1QNK A;  5IYB H;  3R2I A;  2Z8L A;  4IQZ A;  1BXT A;  1KL9 A;  1CZG A;  4BY7 H;  3CCR A;  2EYF A;  4N9T A;  2EYM A;  4JC0 A;  1ILP A;  1S4Z A;  3S2D H;  3S15 B;  1EQQ A;  2PCF B;  2B3G A;  5EGT A;  1PRT F;  1KIX A;  1NR2 A;  4NXN Q;  2DUD A;  2HT1 A;  2F4V Q;  4UP7 A;  5JAV A;  5IGG A;  5IYC H;  2VB3 X;  5EKL A;  1PFN A;  3QOL A;  4K5V A;  4DUY L;  3CCE A;  1T9H A;  4DXF A;  2D0P A;  3FKI G;  2MQH A;  2IY5 B;  4JI6 L;  3RLN A;  1LUZ A;  3F1Z A;  2JA7 G;  1ENF A;  4HSV A;  5I2X A;  1E1T A;  1FJG Q;  3SEB A;  1LT5 D;  1IYU A;  1CA6 A;  2KOL A;  1A3T A;  1L2F A;  3K59 A;  5M3F B;  2K01 A;  4XT1 B;  3TDQ A;  2JEB I;  5ELN A;  2RHQ B;  1GUT A;  3KJP A;  4HED A;  2EYP A;  1ET6 A;  1N36 L;  1G2T A;  5EPK A;  1PTO B;  1LAC A;  4HJ5 A;  4Q0F A;  4X65 L;  2F0W A;  2H4O A;  4HIM A;  2L1B A;  4K6D A;  1EYD A;  1BCP C;  3I55 A;  1NMG A;  1ET9 A;  2HCI A;  1JQY D;  1C9O A;  1TWF B;  1QVF A;  2XRS D;  4UDU C;  1L1O C;  1X54 A;  4DAM A;  4AIM A;  4S3S A;  5JJZ A;  3MXG A;  4NPS A;  2B63 B;  3VYR A;  1Y1V B;  1SFO B;  1IBK L;  4KJN A;  2AUJ D;  1G6P A;  1DM0 B;  4JI7 L;  5A2Q E;  4WJ4 A;  3I4N G;  1SYC A;  3CCQ A;  5C0X H;  1IYV A;  3AFP A;  1PYS B;  2NVX B;  4JI2 Q;  2BDO A;  1AZP A;  1Q8I A;  4X62 L;  5K36 G;  3KF8 A;  1B8A A;  3ITP A;  4MTK A;  4JBJ A;  3RMH A;  3KF6 B;  3T13 A;  2UXD L;  2HHH L;  2MHV A;  5LMN Q;  2O5J C;  1A8V A;  3UE1 A;  1D5X C;  1NBW A;  4JOI A;  3PO2 B;  1CK1 A;  3S1R H;  1RD9 D;  3T16 A;  4KK7 A;  5IOD A;  4DV0 Q;  3CCV A;  1TKW B;  1MBY A;  2Z4H A;  2OQK A;  4JI4 Q;  1NMF A;  3K5O A;  5C3E B;  4V0B A;  4N8F A;  1J9O A;  3MXP A;  2EJF C;  5EKK A;  3NE5 B;  3H3V C;  3DEO A;  4HJ8 A;  2MUY A;  2O2L D;  1K8A C;  3S14 B;  1H9S A;  1A15 A;  3EVQ A;  4XTC S;  4GN3 B;  4ZCK A;  1VQN A;  5CBA E;  1VQD A;  2Y0S G;  1TII D;  1VQF A;  1VF5 C;  4IUR A;  3T1Y Q;  1ESF A;  3BG3 A;  5M3F G;  4X64 L;  2CKZ B;  5DNF A;  4A3L G;  2FFK B;  1CHP D;  4NKL A;  5C44 H;  2DN8 A;  2KEE A;  2UUA Q;  1SE3 A;  1Z9F A;  5J1Z A;  4A3D B;  2VQF Q;  4FF2 A;  1QE6 A;  5E4W C;  3S1M B;  4B08 A;  1RTN A;  1KNA A;  3J81 E;  2IHF A; 
#chains in the Genus database with same CATH homology
 3PUX A;  1LM0 A;  4YHH L;  2L15 A;  3RN5 A;  1D8L A;  2R93 H;  1XTD A;  3GTM H;  4QQB X;  1I50 H;  3BZK A;  1XMO L;  2BH8 A;  4DUY Q;  4LF4 L;  1XPR A;  1EIF A;  1K73 C;  4H02 A;  3CPF A;  1YIT A;  1XMO Q;  2UUC Q;  5IWA L;  4GNX A;  3RNU A;  4BBS H;  1KRT A;  4HJA A;  3CCS A;  1WOC A;  5M5X H;  2PMZ E;  4NB3 A;  4JI6 Q;  3CCJ A;  4LNQ A;  1NJI C;  1VQM A;  2E5L L;  2R92 G;  1I3Q H;  2Z0S A;  4Y7N H;  1TWA H;  3MEF A;  3T1H L;  2N3S A;  2B63 G;  4DV7 L;  1MIU A;  1XPU A;  4A3G H;  3T1H Q;  2ZJR A;  3JAM i;  1X3F A;  1Y1V G;  3U58 A;  2CFM A;  3GDE A;  3OYY A;  4JBM A;  1MJC A;  2EQS A;  4P75 A;  5LMU L;  1MJE A;  2IX1 A;  3S1Q H;  2FXQ A;  1VQB A;  4DR5 L;  1YEZ A;  3GTO H;  1SMX A;  2ZTC A;  4BXX H;  1JJ2 A;  3OTO L;  4EQ5 A;  5M3M G;  4LF5 L;  1YNX A;  3H3V I;  3K81 C;  3KYH C;  1PVO A;  4GKJ L;  3PIP A;  1VQI A;  2PNH A;  3H0G H;  4LUZ A;  4R4C A;  4DR4 L;  4B3R Q;  2AHO B;  3F2B A;  2ALY B;  2WAQ E;  3M85 A;  3ULP A;  4B3T L;  3U4V A;  3S2H H;  1GD7 A;  1I94 Q;  4R4T A;  3TQY A;  3ZJY C;  4DR1 L;  4B3T Q;  4X65 Q;  1CKM A;  3F8T A;  1HR0 W;  5IYD H;  3W1B A;  3F2D A;  3PO2 G;  4IJL A;  4DR2 L;  3CCL A;  3NEM A;  1SRU A;  1YHB A;  3PUY A;  3CC4 A;  2JA6 H;  1QVC A;  3J7A 5;  2ZM6 L;  1N34 L;  4C3J H;  1I6H H;  2ZM6 Q;  4JI1 Q;  4A3J G;  1S3O A;  2JQO A;  3I7F A;  3A0J A;  1HNX L;  1WYD A;  4JI0 L;  2JK8 A;  4O0A A;  2E2J H;  4JI0 Q;  1HNX Q;  4LF8 Q;  5C3E G;  5C0X G;  3D0F A;  4JYA L;  4IOC A;  3ERS X;  3RLO A;  3RR5 A;  2R7F A;  2GVB A;  4NXM L;  4K0K L;  4GN4 B;  4QJF A;  1Y1W G;  3KFU A;  5JJL A;  3H15 A;  4NXM Q;  1JT8 A;  3BU2 A;  3E9I A;  4YY3 L;  4L5S A;  3G48 A;  1IYJ B;  4GKK Q;  1N32 Q;  2BH2 A;  2E8G A;  1PH3 A;  4GNX C;  2Q2T A;  1EQR A;  1HNZ Q;  2VZA A;  3K7A H;  2E2H H;  3CAM A;  5FLX c;  2RF4 A;  3VDY A;  3PSI A;  1XNR L;  3NEL A;  3NEN A;  4C3I H;  3TEH B;  3KJO A;  3STB C;  1VQP A;  2N78 A;  3RN2 A;  3EN2 A;  2HHH Q;  4HJ9 A;  3J80 c;  4A3K H;  3HOY H;  4A3D G;  3ULL A;  4GOP C;  1L1O B;  1HZ9 A;  3BJU A;  4LW1 A;  1KXL A;  3HOV G;  2YTY A;  3CQZ H;  1VQH A;  5IT9 c;  1AH9 A;  1PYB A;  4HJ7 A;  4IFD I;  3D31 A;  3RZD H;  1UE6 A;  4C3H H;  4BY1 H;  2GVA A;  4A93 H;  4DR6 L;  3PUW A;  4PMW A;  2ZTE A;  1SR3 A;  1XJV A;  1XPO A;  2WFW A;  2ATW A;  3BZC A;  1WI5 A;  4AYB E;  1OTC A;  1JJG A;  4PZ6 A;  3S17 H;  5FJ8 G;  1UWV A;  4LF9 L;  2K75 A;  4KLK A;  4JI8 L;  4DV3 Q;  3HOU H;  4A3F G;  5M5W H;  1IBL Q;  2V1C C;  4O2D A;  3PO3 H;  2K50 A;  2UU9 L;  1PHJ A;  4DR7 Q;  1NY4 A;  3GD7 A;  1A62 A;  2CCZ A;  5C44 G;  2YYZ A;  1GVP A;  2UXB Q;  4DV2 L;  3FHW A;  5LMN W;  3H3V H;  3J81 i;  1AE2 A;  3GTP H;  4DV4 Q;  5IY0 A;  5IP7 G;  4DV5 L;  3AEV A;  1U0L A;  3HOZ G;  4P72 A;  3U50 C;  2CWP A;  1VQK A;  1KAW A;  3S15 H;  4X64 Q;  3ULJ A;  4P71 A;  1VQE A;  2ZTD A;  2R93 G;  1YIJ A;  5HY6 A;  2YTX A;  1BKB A;  3I56 A;  1UEB A;  4UP9 A;  1YHQ A;  3I2Z A;  2I0Q A;  1LTL A;  1I5F A;  5HGQ A;  3GTJ H;  1A63 A;  4GLA C;  1B7Y B;  1K0R A;  2RCN A;  1WCM H;  4JV5 Q;  2UXC L;  1Q82 C;  4B3S Q;  1QZH A;  4BBS G;  2A1A A;  5IE8 A;  4OO1 I;  2K5N A;  4GS3 A;  1O7I A;  4UP8 A;  3JAM c;  4YHH Q;  3CPW A;  2I5L X;  4GN5 A;  2VQE L;  2AWN A;  2E2I H;  4IPG A;  4DK6 C;  4DR4 Q;  4LF4 Q;  3L0O A;  4RMF A;  1K8G A;  4A3B H;  2NZO A;  4YWK A;  4YWL A;  4X66 L;  5IWA Q;  1EIY B;  4A3G G;  5BR8 L;  1Q46 A;  2WB1 E;  3TRZ A;  5GAH C;  3NBH B;  4A3M H;  5BR8 Q;  4OXP A;  3S24 A;  1N9W A;  4IPD A;  4NXN L;  4KHZ A;  2NVQ H;  2F4V L;  2WP8 J;  1X9N A;  2E5L Q;  1A0I A;  3A74 A;  4LFA L;  4BXX G;  2Q2I A;  1X3E A;  3OW2 A;  2QGQ A;  2BA0 A;  4J15 A;  4DV7 Q;  1VQ4 A;  1KQS A;  4GOP A;  2QEX A;  4RG1 A;  3H0G G;  3CC2 A;  3GTK H;  2K52 A;  2ID0 A;  3HKS A;  5LMU Q;  1PH9 A;  3GTL H;  2I5M X;  1CKN A;  2R7D A;  4IFD G;  1Y14 B;  1QUQ B;  4DR5 Q;  5M5Y H;  3G6E A;  2VY3 A;  1E24 A;  2IHE A;  3ICE A;  2AKW B;  3OTO Q;  1HR0 L;  3HKZ E;  5IYD G;  4LF5 Q;  1FJG L;  2LXJ A;  3JC6 6;  1EFW A;  1VQJ A;  2Y0S E;  4B3M L;  1N32 L;  4GKJ Q;  1PFS A;  3KDF A;  1OXS C;  3F2C A;  4B3M Q;  2H5X A;  1FVI A;  2F3I A;  3A5Z B;  3PUV A;  3FKI H;  4XIG S;  4HID A;  3TS2 A;  3TS0 A;  5C4J H;  2OTJ A;  3ER0 A;  2D62 A;  2ZJQ A;  1TWH H;  3KF8 B;  4DR1 Q;  2JA7 H;  1X3G A;  1P8L A;  4IJH A;  5C0X J;  4LUO A;  3PF5 A;  4A75 A;  1KHI A;  4UY8 C;  1Q12 A;  1B70 B;  2KBN A;  4OX9 L;  2YU9 H;  4DR2 Q;  5AJ3 L;  4POG A;  4OX9 Q;  4TQU S;  1PH6 A;  4C2M H;  1V9P A;  3CF5 A;  3M4Q A;  2DGY A;  2JE6 I;  4BBR G;  4HIO A;  3G4S A;  1QVG A;  4GLV B;  1N34 Q;  4ALP A;  1CSQ A;  1K83 H;  1IZ6 A;  3E0E A;  1C0A A;  2LXK A;  4JYA Q;  2VS1 A;  3S16 H;  2XGT A;  5IP9 H;  1FGU A;  5H1S E;  3HOX H;  4LF7 L;  4BBR H;  2EXD A;  1IBM L;  2VNU D;  3B6Y A;  1Q8K A;  2NVX H;  4K0K Q;  2NVY H;  4LFC L;  4YY3 Q;  1RIP A;  3CCM A;  5E7N A;  1VQO A;  3DM3 A;  4A4I A;  2Q2U A;  1SE8 A;  1BBU A;  3M4P A;  3U4Z A;  3CW2 C;  2PI2 E;  4A3K G;  1FL0 A;  2MO1 A;  1YI2 A;  3HOY G;  3RZO H;  2JA8 H;  2VUM H;  3KLW A;  1PH7 A;  1JJC B;  1G51 A;  1YJ9 A;  2NN6 I;  1XNR Q;  2OWO A;  4QIW E;  1TWC H;  3K80 C;  4MZ9 A;  4KHP L;  2JA5 H;  3I4O A;  1Z47 A;  4YCW A;  4BY1 G;  4DV1 L;  4A93 G;  3UE0 A;  2YTV A;  2R7Z H;  3AYH B;  4JBW A;  4JCV E;  1U5K A;  5GQO A;  5JJI A;  3Q8D A;  3J81 c;  3M7N A;  2R6G A;  4JI2 L;  3DLL A;  4A3I H;  2F52 A;  3HOU G;  4IO9 A;  3CME A;  1D7Q A;  1QZG A;  1XNQ L;  2RHS B;  3TRE A;  3W5O A;  3PO3 G;  1HZA A;  1XNQ Q;  4LWC A;  5GAD C;  2JA6 G;  4BA2 I;  3I4N H;  4DR6 Q;  3I4M H;  2PQA A;  2B29 A;  1E22 A;  5LMN L;  1VQ7 A;  3UDG A;  1YBY A;  3J81 j;  1HNW L;  2I5H A;  1W3S A;  3WWV A;  1W2B A;  1HNW Q;  2PI2 A;  4LF9 Q;  4OWT B;  4JI8 Q;  3CC7 A;  1PH5 A;  4A3E H;  4OWW B;  5ELO A;  5GRO A;  4GNX B;  4DK3 C;  4DR3 L;  2QA4 A;  2CQO A;  1N8R C;  1EYG A;  2UU9 Q;  4DV0 L;  3HOW H;  4DAY B;  1VCI A;  5EAY A;  3SGI A;  4X6A H;  4JI5 L;  3K0X A;  4HIK A;  4DV2 Q;  2JEA I;  4JI4 L;  1CKO A;  2EIF A;  2HQL A;  3PGZ A;  2XTI A;  3UDF A;  4LFB L;  1WCM G;  1NE3 A;  4DV5 Q;  2ZJP A;  3EIV A;  2ES2 A;  1E3P A;  1Q81 C;  3K7U C;  1VQ9 A;  1PH1 A;  3UDI A;  1KC8 C;  1Q1E A;  1JMC A;  1SLJ A;  4GOP B;  4IPH A;  2KCT A;  4R4I A;  1M90 C;  2YV5 A;  4P73 A;  5C4X H;  3CCU A;  4FDB A;  4A3B G;  2Z6K A;  3E9H A;  5JEA G;  1GM5 A;  2HIX A;  2UXC Q;  1EOV A;  1VQA A;  3KF6 A;  5J3B A;  2OTL A;  3T1Y L;  1IL2 A;  4A3M G;  4YCV A;  1Q86 C;  1XMQ L;  5GAG C;  2WAQ G;  5IYB H;  4PZ7 A;  2VQE Q;  3CMA A;  3PUZ A;  1PV4 A;  1M1K C;  4KI0 A;  5GAE C;  3M9B A;  4DV6 L;  1KL9 A;  1RL2 A;  1H95 A;  4BY7 H;  1L1O A;  1MKH A;  1V1Q A;  1X6O A;  3CCR A;  4TVA B;  2D0O A;  1N33 L;  5C0X I;  4X66 Q;  2VQF L;  4JC0 A;  2NZH A;  3S2D H;  2UUB L;  1EQQ A;  2B3G A;  1KRS A;  2BA1 A;  4DUZ L;  4DKA C;  1KIX A;  4NXN Q;  5M3F H;  1S40 A;  1CSP A;  4DUZ Q;  2DUD A;  1TWG H;  2F4V Q;  2HT1 A;  4A3C H;  1HJP A;  4A3L H;  4LFA Q;  4UP7 A;  1YJW A;  3STB D;  1YHA A;  5IYC H;  3HFZ B;  1VQG A;  4DUY L;  2OCE A;  3CCE A;  3CD6 A;  2UUC L;  1T9H A;  4R4Q A;  1PA6 A;  2D0P A;  2K4K A;  3FKI G;  2MQH A;  3UDX A;  2VW9 A;  2IY5 B;  2N49 A;  4L5R C;  4JI6 L;  3PCO B;  4POF A;  3RLN A;  1LUZ A;  3F1Z A;  2JA7 G;  1NTG A;  4Y52 H;  2GN5 A;  1E1T A;  2K14 A;  3PIO A;  1PH8 A;  1HR0 Q;  1FJG Q;  4JOI C;  4QL5 A;  1VS0 A;  1L0W A;  4WJ3 M;  3S1N H;  4YCU A;  1VQ6 A;  1TWF H;  1L2F A;  4JBK A;  4GLX A;  4BA1 I;  1EUJ A;  2CWA A;  2KHI A;  2JEB I;  5ELN A;  2R92 H;  2K5H A;  3GTG H;  4MNO A;  2RHQ B;  3G71 A;  3PV0 A;  3KOJ A;  1OXX K;  3KJP A;  1HH2 P;  2AMC B;  4LF6 L;  2B63 H;  5IP9 G;  3HOX G;  5AJ3 Q;  2IT1 A;  2Q2H A;  1E1O A;  1N36 L;  2LSS A;  4LF6 Q;  1PH4 A;  1K3R A;  1Y1V H;  1SFO H;  1CUK A;  1N36 Q;  1YJN A;  4B3R L;  4APV A;  4L5T A;  2C35 B;  2Z6K C;  4HJ5 A;  1I94 L;  2ASB A;  5DLQ E;  4X65 L;  4HIM A;  4AQY L;  2JA8 G;  2VUM G;  4AYB G;  5M3M H;  3I55 A;  4AQY Q;  1NMG A;  1VQ5 A;  1IBM Q;  4LF7 Q;  2A8V A;  4OO1 G;  2JA9 A;  2PQA B;  1ASZ A;  1G29 1;  1UE7 A;  2IX0 A;  3LGJ A;  1C9O A;  1OXT A;  2JA5 G;  4LFC Q;  4MTN A;  1QVF A;  1SN8 A;  1L1O C;  1X54 A;  2KHJ A;  1YVC A;  4DAM A;  4JI1 L;  4AIM A;  4PG3 A;  2R7Z G;  4A76 A;  2HIV A;  4LF8 L;  1Q7Y C;  4NPS A;  1UE1 A;  4JG2 A;  1E7Z A;  1SRO A;  1X65 A;  2MO0 A;  2VL6 A;  3PO2 H;  4A3I G;  1VQ8 A;  3GTQ H;  4OWX B;  1Q1B A;  3W1G A;  4DPG A;  1QUQ A;  4KHP Q;  1IBK L;  4R1J A;  4ME3 A;  5JJK A;  4PZ8 A;  1G6P A;  1IBK Q;  4JI7 L;  2KEN A;  4WJ4 A;  4DV1 Q;  3I4N G;  4A3J H;  4QY7 A;  3I4M G;  4IOA A;  4JI7 Q;  1AE3 A;  1X55 A;  2NVT H;  4GKK L;  1GO3 E;  1LYL A;  4AH6 A;  1YZ6 A;  1WFQ A;  3CCQ A;  1OXV A;  5C3E H;  1HNZ L;  3AFP A;  1PYS B;  1UE5 A;  4UPA A;  4JI2 Q;  3RLF A;  1BVS A;  1GKH A;  4A3E G;  1R9T H;  4X62 L;  5K36 G;  1VQC A;  2A19 A;  1B8A A;  1ASY A;  3HOW G;  1Y1W H;  3AQQ A;  4X62 Q;  3FP9 A;  3S14 H;  4JBJ A;  3GO5 A;  1S72 A;  2KCM A;  3KF6 B;  2UXD L;  4L5Q A;  2HHH L;  2OQ0 A;  5LMN Q;  2UXD Q;  1A8V A;  3UE1 A;  1NBW A;  1IXR A;  4JOI A;  1P16 A;  2WB1 G;  4LUV A;  3A5U A;  1JE5 A;  3AFQ A;  4P74 A;  3S1R H;  4OON A;  4DR3 Q;  2MFI A;  4DV0 Q;  3CCV A;  3M3Y H;  2MNA A;  4JI5 Q;  3CP0 A;  1C7Y A;  5JEA J;  2N8N A;  3PF4 A;  4JI4 Q;  2OQK A;  2AWO A;  5C4X G;  4LFB Q;  1NMF A;  4R4O A;  4A3D H;  4DNI A;  1WJJ A;  3S1M H;  3M4O H;  3HOV H;  1BBW A;  1X56 A;  4DV3 L;  5IYB G;  1PH2 A;  3K8A A;  1J6Q A;  4HJ8 A;  1IBL L;  3EBE A;  1K8A C;  3J80 i;  3J7Z C;  4DR7 L;  1TXY A;  4BY7 G;  3HKZ G;  4GN3 B;  4XTC S;  1CKN B;  1HZB A;  4QGU A;  1VQN A;  1HZC A;  2UXB L;  1VQD A;  2Y0S G;  3L7Z C;  4DV4 L;  1VQF A;  3T1Y Q;  1KD1 C;  5FJ8 H;  1DGS A;  1XMQ Q;  1J5E L;  3MXN B;  5FLM G;  4A3F H;  4JI3 L;  1J5E Q;  2JJQ A;  1OXU A;  3L2P A;  4X64 L;  5M3F G;  3KDF B;  1VQL A;  2CKZ B;  4JI3 Q;  4A3C G;  4DV6 Q;  4A3L G;  3IRB A;  2UUA L;  1EWI A;  2K5V A;  4YWM A;  4EX5 A;  5IYC G;  5C44 H;  3CXC A;  1K9M C;  2UUA Q;  1Z9F A;  1N33 Q;  2VQF Q;  2NN6 G;  4JV5 L;  1JB7 A;  5IP7 H;  1V43 A;  5FLM H;  2UUB Q;  4B3S L;  4IFD J;  3HOZ H;  4IPC A;  2IHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...