3E0EA

Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
91
Chain Sequence
MNYKISELMPNLSGTINAEVVTAYPKKEFSTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGGLEISVDNIGIIEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A
publication title Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
rcsb
source organism Methanococcus maripaludis
molecule tags Replication
total genus 22
structure length 91
sequence length 97
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3e0eA00
4DR6Q 1B7YB 1HZAA 5K36G 3W5OA 5BR8L 4JI6L 4OX9L 1X9NA 5HY6A 3B6YA 2Y0SG 3WWVA 1X56A 4GNXB 3TS2A 1FL0A 2FXQA 3M85A 4NPSA 3STBD 4A76A 3GTMH 3RZOH 2AMCB 2UUAQ 1CKMA 1Q1EA 3UDFA 4LF4L 3KJPA 1C7YA 1HNZL 4LF7L 1TWAH 1C0AA 1I5FA 3KYHC 1RL2A 2XTIA 1Q1BA 3T1HQ 4GN4B 4LFAQ 1YITA 4GKKL 4PZ8A 4DV6L 3EBEA 1QUQB 1PH8A 3HOYH 4PG3A 4QJFA 2N3SA 3RLNA 1PYBA 1VQGA 4POFA 2UXBQ 4GNXC 1X65A 3CW2C 1VQ5A 1GVPA 4AYBE 1NE3A 4JI8L 3IRBA 4DV0Q 4GOPB 4B3ML 1M1KC 1VQ9A 2E2JH 3TREA 1VQKA 1PH9A 1GKHA 2ZTDA 3DM3A 1BVSA 4LF6L 4AQYL 1VQOA 2AHOB 2D0PA 1IBLQ 2ID0A 4DV7L 2N8NA 4B3TL 5ELNA 3CPWA 3GTPH 5AJ3Q 4DAMA 3U4VA 1HR0Q 4GOPC 3CXCA 4X65L 3KJOA 2ATWA 1YJWA 1YZ6A 2K14A 1VQIA 4IJHA 3L2PA 1YHQA 2JA8H 4RG1A 4ME3A 3RN2A 1H95A 4DKAC 3G6EA 2F52A 2NVQH 2HQLA 4YWLA 4HIOA 2JA5H 2I0QA 4B3RQ 5C0XI 1VQMA 1I94L 2JA5G 4JI5Q 2ALYB 1Y1WH 4OXPA 5LMUQ 1BBWA 3AYHB 4GNXA 1Y1WG 1QVFA 2WP8J 4DR6L 5C0XG 4PMWA 4PZ6A 2CQOA 4KHPQ 4OO1I 4JCVE 1E1OA 1EUJA 4XTCS 2N78A 4YWKA 1VQPA 3KDFB 4A3GH 5JEAJ 3J81c 4A3GG 3CCJA 4A93G 4OO1G 1JJGA 5FLMH 4DV1Q 5M3FH 2UUAL 4JV5Q 1YEZA 2KHJA 5FLMG 5M3FG 4OWWB 1K9MC 1QUQA 2A1AA 3JC66 4NXMQ 1XPUA 3J7ZC 3FKIH 3PV0A 2NVTH 3FKIG 5JEAG 3T1HL 4TQUS 1YBYA 4DR3Q 3G48A 4LFAL 1K0RA 4GOPA 3S2HH 3PIOA 2KENA 5IP7H 4BY7H 2E8GA 2UXBL 4JI1Q 5IP7G 4BY7G 2ZM6Q 2VY3A 5M5YH 2AWOA 2QEXA 5LMNW 3KLWA 2GVBA 2I5MX 1UE1A 3I2ZA 4DV0L 1E7ZA 3J7A5 1K3RA 4GS3A 1M90C 3ER0A 1N34Q 3PF4A 1E24A 2LSSA 2GN5A 3A74A 3UDIA 4BBSH 4BBSG 4QL5A 2R7ZH 1CSQA 4JBJA 2R7ZG 2JJQA 2RHQB 2WB1E 3ERSX 3PUWA 2ZTCA 4L5QA 4DV5Q 1IBLL 1XMQQ 3JAMc 2JK8A 1UE6A 5C4JH 3D0FA 5AJ3L 1VQBA 4IFDI 1A8VA 1KAWA 1HR0L 3S2DH 1JT8A 2R92H 3VDYA 4L5SA 2R92G 1VQ7A 3I4OA 4IFDG 1O7IA 1KHIA 1GM5A 3J81i 4DR1Q 2XGTA 4NXNQ 4TVAB 1I3QH 2HIVA 3CCEA 4B3RL 4LFCQ 3PUYA 3STBC 4IPCA 4JI5L 3ULLA 1Z9FA 3GTJH 4BA2I 4P72A 1AE3A 3D31A 3KDFA 2B3GA 3PUXA 5LMUL 4DUYQ 4LUOA 1QZHA 4A3LH 1OXUA 4A3EH 4KHPL 4A3LG 5EAYA 1KRTA 1VQFA 2HIXA 2OCEA 1EWIA 2BH2A 2OQKA 3HKZE 3RR5A 1K83H 4DV1L 1ASZA 1NTGA 4JV5L 2IX0A 1X55A 4A3DH 3L0OA 2NN6I 2K5HA 4UP8A 1VQLA 4LF9Q 4NXML 4J15A 2JA7G 1RIPA 4C3JH 3ICEA 2LXKA 1K8AC 1VQDA 4DR3L 4DR5Q 1XMOQ 2NN6G 1C9OA 1X3EA 3GD7A 1J6QA 4JI1L 2LXJA 3I4MH 2ZM6L 4DR7Q 1TWFH 3JAMi 3A5ZB 3I4MG 1ASYA 1IYJB 2KCMA 1KD1C 2YTXA 4C2MH 3PIPA 4A4IA 1J5EQ 3EN2A 1QZGA 4H02A 1PH4A 4X6AH 2NVXH 1N34L 3TQYA 3K7AH 3RNUA 1QVGA 2ASBA 2PQAB 3DLLA 4GN5A 3HKSA 3PUZA 4DV5L 5M3MH 2VL6A 1N32L 3OTOQ 5M3MG 1XMQL 4K0KQ 4JOIC 1VS0A 3NELA 1U5KA 1YI2A 3U4ZA 4HJ8A 3K81C 1WJJA 3ZJYC 3CMEA 1NY4A 1E1TA 2IHEA 1EFWA 1AE2A 2K5NA 3S1NH 4AIMA 1U0LA 1TWGH 4LW1A 3TS0A 4DR1L 4UP7A 5JJKA 4NXNL 5GAHC 1SFOH 4JBKA 1JB7A 1V43A 3CC7A 2Y0SE 4LFCL 2PNHA 3RN5A 3RLOA 1PH3A 2Q2HA 4DV4Q 5J3BA 2MO0A 4DUYL 4LFBQ 1EIFA 4HJAA 4A75A 1XPRA 4UPAA 1VQ6A 3OYYA 1EOVA 3CQZH 1LM0A 1PHJA 1PH7A 2CFMA 3M7NA 4AH6A 3CC4A 4JI4Q 4IPHA 1HJPA 4DUZQ 5IT9c 3GTOH 3Q8DA 4JI3Q 1GO3E 1UE7A 4LF9L 1Y1VH 1CKOA 2AWNA 1FJGQ 1DGSA 4DR4Q 1Y1VG 3AFQA 4LF5Q 3KFUA 4JOIA 2YTYA 4GLXA 2F4VQ 1VQCA 4DR5L 1YJNA 1XMOL 1SROA 4QQBX 3AFPA 4JI2Q 4P71A 1A0IA 4A93H 3T1YQ 4DR7L 2KBNA 1NBWA 4OONA 3H15A 5C4XH 4IOCA 1VQEA 5H1SE 1J5EL 5C4XG 1WFQA 3E9IA 2PQAA 3F2CA 4BBRG 2JEBI 5IWAQ 4DV2Q 3UDGA 4BXXH 2R7DA 2L15A 4BXXG 2GVAA 1KQSA 3M3YH 4P74A 2VNUD 4RMFA 5FLXc 1HZBA 3U58A 2NZHA 3E9HA 3KOJA 4DV3Q 4DR2Q 3OTOL 1CKNB 1TWHH 4K0KL 1PA6A 1MJEA 4DPGA 1SMXA 2CWAA 4ALPA 1XPOA 3HOXH 3K7UC 3LGJA 4UP9A 4DAYB 3CCRA 2V1CC 4HJ9A 3HOXG 1PH5A 1I50H 3NBHB 2QGQA 3AQQA 4A3IH 4B3SQ 3GTGH 3S1RH 4A3IG 1PH1A 1XNQQ 1UWVA 1IXRA 1VQAA 2I5LX 1CUKA 2K75A 2EXDA 4KHZA 3RZDH 1N32Q 5IYDH 3PUVA 2UU9Q 3GDEA 5IYDG 4DV4L 2MNAA 5GAEC 2YV5A 3MXNB 4A3KH 2HHHQ 1XNRQ 3H3VI 3HOWH 4Y52H 3UDXA 4A3KG 1JJ2A 4LFBL 4YCVA 3HOWG 4XIGS 3M4QA 3H3VH 1SE8A 1EQRA 4L5TA 2R6GA 4DNIA 2BH8A 1KRSA 2ES2A 2D0OA 2OTLA 1S72A 4C3HH 4JI4L 3TEHB 4JC0A 2IY5B 1A63A 1WOCA 3F1ZA 4DUZL 2F3IA 3PSIA 5M5XH 4JI3L 5LMNQ 2RHSB 1LYLA 3RLFA 5GQOA 2KCTA 1FJGL 1I6HH 4DR4L 1KC8C 3W1BA 4LF5L 2Z0SA 3I7FA 2DGYA 3MEFA 2JA9A 1XJVA 3NENA 3G4SA 4UY8C 2F4VL 1D8LA 4JI2L 2R7FA 2YTVA 1L0WA 2VQFQ 2ZJPA 4X64Q 3CCMA 3CAMA 1NJIC 2RCNA 4JI0Q 3T1YL 1Q81C 1VQJA 4NB3A 1P8LA 3OW2A 3H0GH 4R4IA 1X6OA 3S24A 3H0GG 5DLQE 3NEMA 2JA7H 3SGIA 1G51A 2MFIA 3CMAA 4LF8Q 5IWAL 4DV2L 4GKJL 3CD6A 1PYSB 1CKNA 2CWPA 4EQ5A 1SN8A 4MNOA 4YY3Q 1JJCB 4PZ7A 1N9WA 2DUDA 2VW9A 5GAGC 4DV3L 4DR2L 3A5UA 1EQQA 3GTLH 2E5LQ 4JG2A 2VZAA 3S17H 2BA0A 3KF8B 1TXYA 3FHWA 4IJLA 2K50A 1D7QA 3F2DA 1HZCA 3CCLA 4B3SL 1LTLA 2NZOA 1XNQL 1IBKQ 5JJLA 4X62Q 5GROA 4DK6C 2UUBQ 4R4TA 2VQEQ 2ZJRA 3KF6B 3I55A 1W3SA 1B70B 2UU9L 2YYZA 4OWXB 4A3FG 2HHHL 3FP9A 1SRUA 4KI0A 1XNRL 2K5VA 4Y7NH 4R4QA 2IX1A 1WI5A 2IHFA 4IOAA 2YU9H 3HOVH 5C44H 4A3MH 3E0EA 4IPDA 2RF4A 5C44G 1IBMQ 3HOVG 4A3MG 2D62A 1HR0W 4HJ5A 4QGUA 1SR3A 2UXDQ 3CPFA 5HGQA 4A3BH 3F8TA 4FDBA 5IYCH 3G71A 4A3BG 1LUZA 1YHBA 2B29A 1SLJA 3A0JA 2JQOA 5IYCG 5LMNL 1EYGA 3M9BA 5IE8A 1BBUA 1B8AA 3ULPA 2JEAI 2VUMH 2VUMG 3HOYG 1PV4A 2A19A 2CKZB 5GADC 3K8AA 2N49A 1Q82C 1X54A 4R1JA 2OWOA 2VQFL 1PH6A 4APVA 4X64L 3CCSA 1HNXQ 4JI0L 3PCOB 4X66Q 2C35B 1UEBA 4MTNA 1EIYB 4HJ7A 1G291 2UXCQ 1YJ9A 4WJ4A 4YCUA 4YWMA 2IT1A 1E3PA 4JYAQ 3S16H 1XTDA 2MQHA 3F2BA 5IYBH 4LF8L 4YCWA 5IYBG 1G6PA 1HH2P 4OWTB 1N8RC 3HOZH 2EIFA 1OXXK 4YY3L 1HNWQ 1KXLA 3HOZG 1VQNA 4IO9A 3EIVA 2AKWB 1WYDA 4MZ9A 4P75A 1UE5A 2VS1A 1OXVA 2E5LL 1Q12A 1IL2A 4BBRH 1E22A 4R4OA 5C0XJ 2JA8G 3W1GA 1OTCA 1FVIA 1PH2A 3CCUA 3KF6A 2PI2E 4GKJQ 2E2HH 3J81j 3BZKA 1Q8KA 1IBKL 4X62L 2CCZA 2I5HA 2WAQG 4JBWA 2Q2TA 2H5XA 5IP9H 2UUBL 2VQEL 4JI7Q 4LWCA 2UUCQ 3GTKH 5IP9G 4LNQA 4DK3C 2OTJA 1YVCA 4GN3B 2EQSA 2WB1G 5JJIA 1L1OB 2PI2A 1AH9A 2WFWA 3S1MH 4A3JH 4A3CH 1N33Q 1YNXA 1FGUA 4A3JG 1VQ8A 1YIJA 4GLAC 2ZJQA 3S1QH 1IBML 3HFZB 3K80C 5E7NA 4A3CG 2UXDL 4YHHQ 4L5RC 1QVCA 1VQ4A 1N36Q 3BZCA 4QY7A 1NMFA 3S14H 3UE0A 5BR8Q 1JE5A 4JI6Q 4KLKA 4OX9Q 1T9HA 4WJ3M 2E2IH 2ZTEA 1MJCA 1TWCH 3CF5A 1L1OC 4P73A 1W2BA 3UE1A 2HT1A 4O2DA 2OQ0A 3U50C 2R93H 1R9TH 2R93G 2K4KA 2K52A 3J80c 1L2FA 1Q7YC 1HNXL 4X66L 4LF4Q 4LF7Q 1HNZQ 4QIWE 1CSPA 3L7ZC 1MKHA 3CP0A 5IY0A 2UXCL 2NVYH 1V9PA 4BY1H 3CCQA 2WAQE 1MIUA 4BY1G 4BA1I 4JBMA 4GKKQ 3ULJA 3CC2A 1KL9A 4JYAL 2Z6KC 4DV6Q 3HKZG 1PVOA 4O0AA 2JA6H 3GO5A 2A8VA 1OXSC 3PO3H 3M4PA 2JA6G 4POGA 4IFDJ 1S40A 3PO3G 1WCMH 1JMCA 2B63H 4JI8Q 4B3MQ 1WCMG 2B63G 5ELOA 1X3GA 1VQHA 1VCIA 1HNWL 1A62A 1IZ6A 1P16A 1K73C 1HZ9A 1Q46A 5C3EH 3BU2A 4LF6Q 4IPGA 5C3EG 4AQYQ 1NMGA 3GTQH 3BJUA 1BKBA 4LUVA 5FJ8H 2JE6I 1Y14B 1Z47A 3M4OH 5FJ8G 4DV7Q 3AEVA 4HIKA 4B3TQ 4EX5A 4HIDA 4R4CA 1Q86C 1L1OA 3K0XA 1KIXA 2Q2UA 4JI7L 4HIMA 1V1QA 2UUCL 2MO1A 4X65Q 1PFSA 4GLVB 1X3FA 1YHAA 4A3EG 1K8GA 2KHIA 1S3OA 3I56A 2PMZE 3PGZA 3PF5A 4AYBG 1N33L 1GD7A 5M5WH 4C3IH 3I4NH 2Q2IA 2Z6KA 3CCVA 3I4NG 3J80i 1I94Q 3HOUH 3PO2H 3TRZA 4YHHL 4LUZA 3HOUG 2BA1A 1N36L 1OXTA 2QA4A 3PO2G 3S15H 4A3DG 4A3FH
chains in the Genus database with same CATH superfamily
1HZAA 1KNEA 1GXDC 1PRTD 4OX9L 2L5TA 2EYFA 3WWVA 3TS2A 2RDFA 1SNMA 5KRUA 3TMEA 3M85A 4NPSA 3STBD 2AMCB 1Q1EA 1SYBA 3UDFA 3KJPA 1YNJC 2KCNA 1TWAH 2F3VA 5K5PA 1RL2A 3I8ZA 4GKKL 4GN4B 1RD9D 1TQOA 1QUQB 3EBEA 1K8OA 1F77A 4POFA 1GVPA 4AYBE 2EDGA 4JPBW 3TP5A 1SFOB 4J8QA 1CFMA 4AQYL 1BXTA 1IBLQ 1SNPA 3LNNA 3NBIA 4HMIA 5ELDA 4DAMA 1HR0Q 3V2TA 1K28A 3KJOA 2ATWA 1YJWA 4IJHA 3T16A 1FGBD 1G6ZA 3L2PA 1YHQA 2JA8H 1H95A 4I7AA 1BR9A 1QVFA 5CV7A 5C0XG 2CQOA 1E1OA 1HA5A 4OO1G 5M3FH 4JV5Q 1SE4A 1QE6A 1K9MC 1QUQA 2A1AA 3OWEB 2AUKA 4I65A 3FKIH 5JEAH 1U4MA 1AZQA 4KD3A 1DD2A 3T1HL 1YBYA 4LFAL 1TWHB 1K0RA 2PW5A 4ZKBB 3PIOA 4K8IA 5IP7H 4BY7H 2UXBL 4ZLTF 2ZM6Q 1I50B 2VY3A 4BBSB 3LX0A 3A54A 3I2ZA 5ELCA 4DGZA 3K5NA 3S1RB 1PZJD 1Z7TA 1N34Q 3J7AV 1ICFB 1HXYD 5FK9C 1RF2D 2R7ZG 1LTID 3PUWA 4DV5Q 3S2DB 2R92B 4L6TB 3JAMc 2JK8A 3N52A 1A8VA 1KAWA 2BE5C 1JT8A 2B2WC 1K3BC 4F8MA 3QOJA 4KKSA 1VQ7A 4IFDG 1X3PA 2BOSA 3P75A 4H44C 2XGTA 3Q6SA 1O78A 4B3RL 1EZ6A 3ULLA 4JI5L 4BA2I 1EY7A 1TR5A 4P72A 2H1EA 3PUXA 3D31A 2NWGA 4F87A 5IOCA 5EJWA 1Y8NB 4X3UA 3RD4A 2KA7A 3A8KE 5EAYA 4NW2A 2ICEC 5CV5A 2Q8RE 2O5JC 4KY6A 1ILPA 3NPPA 3L0OA 2K5HA 4UP8A 1VQLA 4LF9Q 2JXMB 2JA7G 1RIPA 4C3JH 3DM1A 1K8AC 4DR5Q 1XMOQ 2NN6G 1U4LA 1X3EA 2B2WA 3I4MH 2SEBD 1UUPA 3A5ZB 3NUCA 4OEMB 5COYA 1IYJB 1J5EQ 1Q90A 2PQEA 4N9TA 4V190 2ICIA 2HDMA 3TQYA 3K7AH 1QVGA 2F1MA 4MN3A 1JWUD 1WTWA 1IL8A 3OTOQ 2P5ZX 2IWHA 1TWGB 3ZJYC 1E1TA 3A55A 3VR2A 2Q8TA 4DR1L 5GAHC 1PH3A 4ZRZA 4CGYB 2MO0A 4DUYL 4LFBQ 2Z9HA 3VR6A 4A75A 2BDOA 1WTRA 1STGA 2CW0C 1PHJA 1LM0A 3GTOB 1SAPA 2EVBA 3OMGA 1HJPA 2F0DA 4DUZQ 2NTSA 1RDPD 1DM0B 1GO3E 3A7AB 1CKOA 1DGSA 2DNEA 3AFQA 4M1UB 1CQFA 5C4XB 1SROA 3TN2A 3T1YQ 3HP3A 1CQVA 4DR7L 3W3AA 4OONA 5CV6A 2EY1A 3E9IA 4FVMA 5C5MA 2F0QA 4O1NA 2L15A 2HCIA 1PZKD 1XXGA 3E9HA 3KOJA 1CKNB 1PXUA 1XPOA 4DAYB 3HOXG 4E6IA 1DOMA 3GTGH 2K03A 1XNQQ 2K75A 1CUKA 1ENAA 1QWYA 2EXDA 4K2LA 5G3LD 5IYDG 2HHHQ 1IYVA 4Y52H 1EY8A 1GUSA 4ID6A 1H9RA 2HCCA 4DAVA 1HA6A 2PMZB 3G6JB 5C5LA 4DNIA 5M5XB 4R8NA 3PIO3 4XT1B 5JPNC 2IY5B 2B63B 2RHSB 3H3VC 3RLFA 5GQOA 1AFPA 1WTOA 2Z0SA 2F4VL 3WDNA 1D8LA 3H0GB 4JK1C 1S5FD 2YTVA 1VMPA 3CCMA 2CH4W 4JI0Q 3CAMA 4KN4C 3M7GA 5DEHA 4RFBA 3OW2A 1QNKA 4R4IA 2F0OA 3VYTA 1F9QA 3BVGA 1ILQA 1CKNA 2CWPA 2FMMA 1Y8PB 3K58A 1JJCB 2DUDA 3SK8A 4DV3L 2F0EA 4C3IB 3A5UA 2MP1A 3EJIA 3PO2B 2IW3A 1WTPA 4IJLA 2NYZD 3H6MA 1CHPD 3F2DA 1D7QA 3MEHA 4A3FB 2JSOA 2HQEA 5JJLA 4DK6C 4CKEA 1TIID 3IKJA 1W3SA 2OF1A 3FP9A 4R4QA 2YU9H 3HOVH 2PNRC 2F0LA 4A3MH 5A2QE 1AP0A 2F0HA 4RGTA 4DAPA 2UXDQ 4KHVA 1EIHA 5FOBB 1LACA 1SLJA 2JQOA 1JICA 5LMNL 1EYGA 3M9BA 3NSWA 4HSPA 2VUMG 3K8AA 1Q82C 1HUMA 2D2CC 2EYOA 1MGSA 2DNCA 2EYHA 2D9UA 2B8GA 3GTPB 1YNNC 4LK1C 1GJXA 3W2DA 5IYBG 1G6PA 1KDBA 3BYYB 1GUOA 1OXXK 1HNWQ 1KXLA 3KBGA 1D1KA 2IJ0A 2K33A 4P75A 1G2SA 4BBRH 3MVVA 2JA8G 4RHRA 1OTCA 5J1ZA 2A68D 1JQYD 1CA5A 1V1OA 2CCZA 4JBWA 1SYDA 2M9VA 5IP9H 5CV8A 4LNQA 4DK3C 1I4HA 3S1QB 2WB1G 5C4ZA 5JJIA 3DUZA 4FO2A 3S1MH 4A3JH 1N33Q 1TS2A 1B9MA 1IBML 2F0IA 4H7BA 4YHHQ 1QVCA 1VQ4A 4HSVA 4QY7A 1NMFA 4I7ZC 3X3NA 3X3MA 2R93B 5BR8Q 1LT6D 4MIUA 4KLKA 2E2IH 2ZTEA 3CF5A 3SE0A 3UE1A 4FF1A 3J80c 1I4RA 4X66L 1CT1D 4DFAA 2F0TA 4K5XA 1HNZQ 2JA6B 1MKHA 1W6KA 1WTHA 3CCQA 5IT9E 4JYAL 4BY1G 4JBMA 2DY7A 1SXTA 1WCMB 3GO5A 3PO3H 1CM9A 3PQIA 4POGA 2WACA 1JMCA 4XQQA 4JI8Q 1A3TA 2RBMA 2F0KA 1X3GA 3BS1A 2B63G 3GTQB 2SDFA 1I3QB 1P16A 1Q46A 2QW7A 3DMUA 4IPGA 5C3EG 1IW7D 2EJMA 1BKBA 4ZCKA 4CBVA 4HAEA 5FJ8H 3I70A 4DV7Q 5E3FA 4B3TQ 3K57A 1Q86C 1KIXA 1RKNA 2WKCA 4JI7L 2M00A 1RJTA 2MO1A 5M5WB 5A2QL 1K8GA 2KHIA 3HOUB 3I56A 4AYBG 3I4NH 2K05A 4C3IG 2PPBC 1C48A 3TRZA 3PO2G 1N36L 3S15H 5K36H 2F0WA 4DR6Q 1JOOA 5D3IB 3GTMB 1X9NA 5HY6A 4C2MB 3B6YA 2Y0SG 3OMCA 5FO8B 2L4NA 1O7LA 3T51B 5IODA 4GNXB 1FL0A 3DWPA 1GHKA 3DWQA 2XWBB 1ESFA 1C7YA 4LF7L 4PQXA 3KYHC 2XTIA 1Q1BA 1YITA 3KLSX 4PZ8A 4PG3A 2FHTA 3KLRA 2G9DA 4QJFA 3RLNA 4GNXC 1X65A 1EZ8A 1R4PB 3FMCA 4DV0Q 4B3ML 3S1NB 1M1KC 3K6OA 3MXPA 2E2JH 3TREA 1VQKA 1L0XB 2ZTDA 3DM3A 4LF6L 5D65A 4XDXA 1FNVA 3MFYA 2ID0A 3HZXA 5ELNA 3CPWA 5AJ3Q 4WRDA 1B4OA 3CKIB 3CXCA 2B2YC 4EGVA 1YZ6A 2K14A 4ZKCB 4ME3A 3IFTA 1WTVA 2NBFA 4DKAC 1Y1VB 4M8AA 2F52A 1HPCA 2RSNA 1GUNA 1MSGA 4HIOA 2JA5G 4WORA 1PTOB 5LMUQ 4G7HC 1BBWA 1LTSD 4GNXA 1Y1WG 2L12A 4KHPQ 4PZ6A 4RKBA 5CBEE 1EUJA 4XTCS 2N78A 3D4RA 1HFNA 3J81c 4A3GG 3CCJA 3D3RA 4CDEC 5IT9L 5FLMH 4DV1Q 5JAVA 2UUAL 1RODA 2KHJA 1DOLA 4OWWB 3S2HB 1XPUA 3J7ZC 3ND9A 1FD7D 3E6ZX 2KQ3A 4J6HA 3ERQA 2B2YA 3K59A 2E8GA 1SNOA 4JI1Q 1SDFA 4IZ8A 4NKLA 3KLWA 1B1ZA 2R7ZB 1K3RA 2TMPA 5CV4A 4CDFC 4U673 1U9RA 4BBSH 3A74A 3WOEA 4JBJA 2WB1E 3NWTA 2ZTCA 5J22A 5JVG3 1XMQQ 1UE6A 5C4JH 3D0FA 4XXEA 1VQBA 2I07B 3C3LA 2RDHA 5CV9A 3SR1A 3S2DH 2R92H 3VDYA 4L5SA 3QO2A 3SK4A 2IL8A 1GM5A 2QDBA 4RAUC 4TVAB 2HIVA 2IPKD 4IPCA 4CJ1B 3OSOA 1PDQA 3ZYYX 1AE3A 2LMCB 5IGBA 4A3LH 1OXUA 2K6AA 1HFGA 1TU2B 4A3EH 3P7JA 1S5DD 4O42A 2OCEA 2JA7B 2OQKA 4KTAA 1K83H 4DNTB 4U68A 2IX0A 3NTIA 1X55A 4A3DH 4NXML 4J15A 1F2MA 1EY5A 2K32A 4HCSA 5D3DA 4XYOA 3R2IA 1TWFB 2WINB 4DR3L 3GTLB 1SYCA 2KEEA 3GD7A 2ZXOA 3PMFA 4IUVA 3I91A 2NVXB 5IIFA 3JAMi 3BYTB 2KCMA 4FP5D 2KOLA 2F0MA 4H13C 1QZGA 4ILWA 4X6AH 2M2LA 2F0VA 1TY2A 3RNUA 2L55A 3DLLA 1D5XC 2N88A 5M3MG 5I2YA 2F0FA 4JOIC 4K0KQ 2PCFB 1BCPB 4HJ8A 3CMEA 1NY4A 2IHEA 1EFWA 1Q3LA 2K5NA 2X69A 2QKIC 1TWGH 1VF7A 4NXNL 1D6EC 1JB7A 1V43A 3CC7A 1VMCA 4NDXA 2Y0SE 4LFCL 1G91A 2XVSA 3RLOA 3CQZB 4DV4Q 2EYPA 1EIFA 4KY5A 4UPAA 1BCPC 2J0TD 4IUTA 3S16B 1E2VA 2CFMA 2RDGA 3VR4A 2C9OA 4JI4Q 3GTOH 4JI3Q 1UE7A 2R61A 4LAAA 2EPBA 1Y1VG 2L9HA 5CC4A 4JOIA 2YTYA 4QQBX 4P71A 4A93H 1WTXA 2KBNA 4IOCA 5C4XH 4B08A 1F9RA 3F2CA 4BBRG 4KMUC 3H91A 1BOSA 2JEBI 3VYSA 4DV2Q 4BXXH 5EGTA 3J7YW 1B44D 5FLXc 3HOXB 1LT3D 3D8GA 1ZYRD 4DR2Q 1LO5D 2NUCA 3OW7A 1MJEA 4DPGA 2CWAA 4TKOB 3K7UC 2ENBA 2V1CC 4OELB 4HJ9A 1H9MA 4B3SQ 4A3IG 5FLXL 3EFXD 4OGQC 1VQAA 2BCOA 3PUVA 2UU9Q 5GAEC 2YV5A 1XNRQ 4A3KG 1JJ2A 1PTOF 3HOWG 4XIGS 3H3VH 1EQRA 4L5TA 1XYIA 3L3OC 2R6GA 1KRSA 2ES2A 4CKBA 4C3HH 2EJGC 3TEHB 1ICWA 5M5XH 1LYLA 1FJGL 3NHHA 1I6HH 4DR4L 4LF5L 3I7FA 2A5HA 4UY8C 3NENA 1Q8IA 4YIJA 4JI2L 1L0WA 2VQFQ 2ZJPA 4X64Q 1NJIC 3GQBA 2RCNA 3U9SA 3NK9A 1KABA 1P8LA 3H0GH 3M4OB 1X6OA 5DLQE 3SGIA 1G51A 5C6AA 2MFIA 5IWAL 5JJZA 3CD6A 4EQOA 3D4DA 1QILA 1LT4D 4K2KA 4KY7A 2MHVA 2MUYA 3P1HA 3TP7A 4PZ7A 3S17B 1HHVA 2VW9A 5DM73 4X3TA 3NQIA 2E5LQ 3EVQA 4JG2A 3Q22A 1TXYA 5LHY1 3VR3A 1SJHD 4ABNA 4JVZA 5GROA 2EYJA 2UUBQ 3K5MA 2ZJRA 4CJ2C 3A56A 4ZQ3A 4F7XA 2B39A 4Y7NH 2IX1A 2IHFA 1TWAB 1EU4A 3SEBA 3ONAB 3WOFA 1WD1A 3E0EA 5C44G 2XIWA 2X6GA 4QGUA 1SR3A 1BBXC 2VUMB 5HGQA 1PLFA 4A3BH 3G71A 1EYCA 1YHBA 3A0JA 5I6YA 5IYCG 1UEAB 4HN7A 2JEAI 3TP8A 5DM63 5GADC 1KNAA 5HURA 2N49A 4PMCA 4K14A 4ZAIA 1CHQD 3CCSA 4X3KA 2C35B 4MTNA 4HJ7A 2UXCQ 4DA2A 2NZ1D 1JCKB 2IT1A 3HGBA 4ME5A 1H9SA 1V1PB 4QUFA 2RVLA 4X3SA 4LF8L 1BNZA 5LL6S 5KYIA 1QG7A 3D4WA 4YY3L 1YNJD 3HOZG 1VQNA 2JA8B 5E4WC 4IO9A 4KJNA 1A15A 2Z4IA 4MZ9A 2VB3X 2E2HB 1OXVA 4RGNA 2ZT9C 2PO4A 3BZDB 1E0BA 1FVIA 1BCPF 1A2UA 2PZTA 3U9OA 3J81j 2WB1B 5CGKA 1IBKL 3KLSA 4X62L 2I5HA 2VQEL 1PZID 2OTJA 2EQSA 5M3FB 4ZK9B 2O5IC 4H0LC 2PI2A 1LT5D 1SNCA 2LFNA 4KKTA 1YIJA 1VQ8A 2NB0A 3S1QH 4A3CG 3HFZB 5E7NA 1EQTA 4IN3A 1XX8A 3BZCA 4RGOS 1TWCB 3S14H 3UE0A 4IURA 3BG3A 1R9TB 4OX9Q 3BDLA 1IW7C 4DF7A 1EY9A 4P73A 5C3WA 5I9OA 1W2BA 2HT1A 4O2DA 2R93H 2MGSA 4BY1B 2K04A 3FDTA 2K4KA 1L2FA 1HNXL 1V1PA 2FFKB 1CTMA 3ND8A 2WAQE 4BA1I 4GKKQ 3ULJA 5IGGA 2Z6KC 2JA6H 3CHBD 3DXJC 1S40A 4B9WA 1WCMH 5C3EB 1LV9A 2AQ3B 1EU3A 1A3UA 4FNFA 4LJZC 1HZ9A 5HGTA 5CBAE 3GTQH 1U4PA 4AQYQ 3E0JA 3ITPA 3BJUA 4LUVA 1Z47A 4KD4A 4HIKA 2HD3A 4N9PA 4HIDA 4R4CA 5EKIA 2Q2UA 3TSSA 4AYBB 1V1QA 2EY2A 2UUCL 1PFSA 1X3FA 1YHAA 4A3EG 2F4IA 3MAQA 3PGZA 5M5WH 3Q24A 4C3JB 1SYFA 2Z6KA 1DJRD 3J80i 3HOUH 3E3XA 2BE5D 2Y0SB 2BA1A 1SEBD 4A3DG 2QA4A 1ZKOA 1B7YB 3RZOB 4JI6L 4RCOA 1X56A 2XN9C 3NTKA 3GTMH 1CKMA 3J7AF 4LF4L 2XRSD 1C0AA 1TS5A 2RQXA 3T1HQ 4LFAQ 5JOBA 4DV6L 3HOYH 1SNQA 3TDQA 1VQGA 4PNYA 1H9KA 5IGFA 2UXBQ 2A6EC 3BDCA 3CW2C 4GOPB 3IRBA 1Y69U 5C3XA 4XT3B 5ISRA 1WVLA 2HUGA 2OXPA 2QCPX 1HQMC 2AHOB 2D5DA 2DN8A 2N8NA 2V4DA 2QDLA 4ULLA 4GOPC 2MPMA 3NXWA 1STAA 4X65L 2JA5B 3QOLA 1Y1WB 1JR0D 2NVQH 2HQLA 4IALA 3I72A 4B3RQ 1I94L 2F0GA 1U4RA 4JI5Q 2EXZA 4R9WA 1RTOA 2C5CA 4A3GB 5C0XH 3V96A 1F9SA 1PTOH 4JCVE 3KDFB 5JEAJ 4OO1H 4A93G 4LMQD 1JJGA 5ELFA 1STNA 5M3FG 2F0NA 3JC66 3EQLC 3PV0A 2NVTH 3DWAA 2CW0D 3FKIG 1BF4A 5JEAG 1SMYC 3R3OA 4GOPA 3S2HH 1O7ZA 2CVRA 3SHLA 5IP7G 4BY7G 5M5YH 2AWOA 5LMNW 3GTGB 2GVBA 1UE1A 1HTPA 3J7A5 3MFGA 4GS3A 1E2ZA 3ER0A 1PRTB 1E24A 1WTQA 4QL5A 2R7ZH 1CSQA 3ERSX 2RHQB 3I3CA 4L5QA 1IBLL 4PV1C 3C2PA 1HR0L 4KK7A 2A6HD 4IFDH 3OIQA 5KGUA 4K5WA 3A8IE 1ML0D 1PRTC 3GTJB 1QNUA 3J81i 4DR1Q 3CCEA 5DNFA 3PUYA 3STBC 2MJ8A 1AZPA 4DUYQ 3KDFA 2J7ZA 1IKMA 4LUOA 1J9OA 1STYA 5IGCA 1VQFA 2HIXA 3J81E 4WFN3 1Y8OB 3RR5A 4DK0A 4JV5L 2EY5A 1II3A 2F0SA 2NN6H 4C3JG 1STBA 3R93A 4IQZA 1J6QA 2ZM6L 4DR7Q 1TWFH 3N6RA 3I4MG 1KD1C 2NTTA 1D1IA 4A4IA 1TY0A 1B3AA 3EN2A 5KNCA 4H02A 2NVXH 1N34L 5M3MB 4G7ZC 2ASBA 1PFBA 1M8AA 2PQAB 3HKSA 1HTLD 4DV5L 2F03A 4C56C 4A3MB 4FXKC 1M4VA 2LKVA 1U5KA 1YI2A 1PMRA 3K81C 1WJJA 1CZWA 1I4GA 4AIMA 3DHQA 3TS0A 1PFNA 1SFOH 4JBKA 5IGEA 1JC7A 1BUVT 5J3BA 2H4OA 4HCEA 4MHEA 1EOVA 2EE1A 1HCZA 3CQZH 5E1FA 1WD0A 1PH7A 3M7NA 3CC4A 1LTRD 2Z6BA 4IPHA 3OIPA 5IT9c 1NAPA 5EBCA 3Q8DA 4LF9L 2AWNA 1GHJA 3KFUA 4GLXA 2F4VQ 3EA6A 1VQCA 4DR5L 1XMOL 1SSOA 4BBRB 3QB3A 3QWNA 2XNAC 4RKLA 1J5EL 1EL0A 4IUNA 1FYCA 3M3YB 2PQAA 3QR8A 2K5QA 1EOTA 3UDGA 2R7DA 1T5XD 2VNUD 1LTAD 1KQSA 4P74A 3O13A 2KEDA 2NZHA 4A3JB 3S1MB 4DV3Q 3OTOL 1TWHH 4A3IB 4ZYSA 1VF5C 3HOXH 3LGJA 3CCRA 1I50H 3NBHB 2QGQA 4BS9A 3RZDB 3S1RH 1TVXA 3HS0C 1PH1A 1UWVA 4A3KB 1IXRA 3HOWB 2I5LX 4G57A 4KHZA 1N32Q 5IYDH 3GDEA 2MNAA 3H3VI 5EKKA 3TBIB 3UDXA 4LFBL 4YCVA 1DXMA 3M4QA 1SE8A 5TSSA 1UNSA 1LLRD 2BH8A 1XTCD 2KUMA 1BQQT 2D0OA 4RCNA 5CR3A 4P2CB 1SBBB 1S72A 2OTLA 2RSOA 4KV6A 4JC0A 1WOCA 4DUZL 2F3IA 2K7VA 3G7LA 5LMNQ 5CORA 1F9PA 2KCTA 4FXDA 1KC8C 3MEFA 3QIAA 2KECA 5E4XA 1X32A 3T1YL 5F2DA 1VDZA 1Q81C 3OPOA 1ET6A 2JP1A 2RA4A 1DOKA 1PYSB 4KJOA 4EQ5A 4FF4A 1KDCA 1PRTF 1G2TA 1N9WA 3NBHA 3I4NB 3AU7A 1KDAA 4OL7A 2VZAA 3S17H 3KF8B 2DJFC 3I90A 2F0JA 2E75C 2K50A 2VXWA 3S15B 3CCLA 4BWGB 1LTLA 2NZOA 1XNQL 3F2UA 4DU9A 1W6JA 2A74C 3T4AC 4Z9CB 4FF3A 1O80A 1RCVD 3I55A 3JAME 4CDCC 5C44B 1B70B 4OWXB 2HHHL 4QF4A 1TS3A 4IOAA 1TT2A 5ELBA 3K0YA 4K6LA 3HOVG 2RF4A 1T5EA 3GV6A 1IBMQ 4A3MG 3E5SA 3SXHA 2ZXRA 2B2TC 4CHTB 4FDBA 2WV6D 1LUZA 3TP6A 2VUMH 5IE8A 3ULPA 3IFDA 1RHPA 3HOYG 1PV4A 2E2JB 2CKZB 1ENCA 3T13A 2B8FA 1X54A 1LTGD 4R1JA 4OHJA 4APVA 4JI0L 4X66Q 3SVMA 2WIIB 1UEBA 1EIYB 1SE3A 1G291 1YJ9A 1UAPA 1E3PA 4JYAQ 1XTDA 3DEPA 3HOZB 1D5MC 5CYUA 5IYBH 4YCWA 2EOTA 3URYA 1HH2P 1N8RC 1EWHA 3VA5A 2EIFA 5JPMC 3KF8A 2IX3A 1EIGA 2Z1CA 1KLUD 2FMCA 1Q12A 4ZUJA 1IL2A 2B2TA 1EYDA 3TZUA 5C0XJ 1PH2A 3CCUA 4GKJQ 3GTKB 2E2HH 3L9AX 3BZKA 1DCZA 4EQNA 1ENFA 2QEJC 1Q8KA 3T53B 2WAQG 4V0BA 5D14A 2KJXA 1EY0A 4TSSA 4JI7Q 3C1FA 5IP9G 1B2TA 2PZWA 4GN3B 3NQTA 4ODGA 3BDOA 1L1OB 1JOKA 1IKLA 1AH9A 1B3QA 3FVQA 1SYEA 1G8ZD 1ESRA 1FGUA 1YNXA 4A3JG 4GLAC 3A7LA 2UXDL 4L5RC 1N36Q 2A69D 1JE5A 3MWYW 4FXGC 1MJCA 5EBDA 1TWCH 1L1OC 2EYMA 4C1NI 1RTNA 2OQ0A 2NVYB 3U50C 2EZVA 1DONA 1R9TH 3IAYA 3TZDA 4LF7Q 3FRPB 4QIWE 1CSPA 3CP0A 5IY0A 1V9PA 1S5BD 4BY1H 1MIUA 1PVOA 3H09A 5C4JB 3HKZG 2A8VA 1JWSD 4RWSC 4IFDJ 2AQ2B 3PO3G 1JE4A 1JOQA 2B63H 5AFWA 1AN8A 4B3MQ 1HNWL 1VCIA 1KLGD 1PTOD 3D6WA 5BN3A 1IZ6A 5C3EH 4LF6Q 4DN4M 1NMGA 4EVOA 1B53A 2JE6I 5T1GA 3JAML 5FJ8G 3AEVA 4A3EB 1JB3A 1IYUA 1H9SB 1L1OA 2PYKA 5BN5A 4HIMA 2DJGC 3MZ5A 1K83B 1HQRD 4A3DB 3VYUA 3AB9A 3PF5A 1IHZA 3P20A 4PMBA 1N33L 4C3IH 2Q2IA 3I4NG 3PO2H 4Q0FA 4YHHL 4LUZA 1OXTA 4A3FH 5FO9B 5K36G 4NMZA 3W5OA 5BR8L 2N55A 1I4XA 2XSCA 3H94A 1F2ZA 3HEJA 2FXQA 3RZOH 1XWEA 4A76A 2UUAQ 1MHWC 1HNZL 3RUZA 1I5FA 4K6DA 1NUCA 1PH8A 2K5DA 1CA6A 2N3SA 1PYBA 5LL6X 3OOCA 1VQ5A 2A68C 1NE3A 4JI8L 1SNDA 3OHXC 1STHA 1VQ9A 1PH9A 1GKHA 2K28A 1BVSA 1VQOA 2GA4B 2D0PA 4DK1A 4DV7L 4JW0A 4B3TL 3GTPH 3U4VA 5EPLA 4WJWA 5NUCA 1EYAA 1VQIA 2LS01 4RG1A 5L37A 3RN2A 3G6EA 1CK1A 2FJ2A 4YWLA 2JA5H 2I0QA 5C0XI 1VQMA 2ALYB 3HG9A 1NCVA 1Y1WH 4OXPA 4A93B 3AYHB 1EEFD 2WP8J 3NTHA 4DR6L 4RHSA 4PMWA 3EROA 2K1BA 4OO1I 5KNDA 2L1BA 2O4XA 4YWKA 1VQPA 4A3GH 3FKIB 3MXGA 3MTSA 1YEZA 5FLMG 4NXMQ 2DY8A 1BCPD 4BY7B 1ZXTA 2K01A 2A6HC 4TQUS 4DR3Q 3G48A 5G3LF 2KENA 2EYLA 1K0SA 1KTKA 3LWUA 2QEXA 3MHBA 4DV0L 2I5MX 1E7ZA 1LTTD 2Z4HA 1M90C 3PF4A 2SNMA 2LSSA 3UDIA 2GN5A 4BBSG 2F0UA 1GOZA 3Q0AA 2JJQA 1B9NA 5AJ3L 3C46A 4IFDI 2AQ1B 3BVZA 3R8BA 4C3HB 2R92G 3V05A 2L11A 3I4OA 5C4HA 1O7IA 1KHIA 3D6CA 4NXNQ 1I3QH 1I6HB 1I4PA 4LFCQ 3GTJH 1Z9FA 5LMUL 4RH6A 2B3GA 1QZHA 5I2XA 4KHPL 4A3LG 1KRTA 2AUJD 1EWIA 2BH2A 3CRKC 1EEID 1S5CD 3HKZE 1ASZA 4DV1L 1NTGA 3K5LA 2NN6I 5BN4A 1V8QA 1AW7A 3ICEA 3I4MB 2LXKA 1B50A 4HEDA 2A73B 1VQDA 1C9OA 4IUPA 5I9PA 4DAYA 4JI1L 2LXJA 1L0YB 1D2BA 3J80E 1ASYA 3K7AB 2YTXA 4C2MH 3PIPA 1PH4A 3Q23A 3KUPA 5IGDA 3GV3A 4GN5A 3BVMA 1Z6HA 4Y7NB 1BDOA 3PUZA 1MSHA 5M9OA 5M3MH 2VL6A 1N32L 1XMQL 1VS0A 3NELA 3I4LA 3U4ZA 2PZUA 4RA8A 4A3BB 1AE2A 3S1NH 1QCBD 1U0LA 4R8IA 4LW1A 4UP7A 5JJKA 1PFMA 1LABA 5I4DA 3GP7A 1NR4A 1MBYA 2PNHA 3RN5A 4QB4A 2Q2HA 5KIXA 4HJAA 1XPRA 1VQ6A 2JN4A 3OYYA 1QB5D 4KKUA 3VR5A 2F0PA 4AH6A 3MA2B 3NWSA 2O2LD 1SYGA 2B2VC 4NP5A 1FJGQ 5JVH3 1Y1VH 4DR4Q 4LF5Q 2EY6A 2G5DA 3SDZA 2JYOA 1YJNA 3OWFA 3AFPA 4JI2Q 1A0IA 1GUTA 2E2DC 4RGMA 1NBWA 4IUUA 4QMGA 4QIWB 3H15A 1VQEA 5FO7B 5H1SE 5C4XG 1WFQA 3I73A 1ET9A 2CQAA 5IWAQ 4GZYC 1GUGA 2RKSA 4DNRB 4BXXG 2GVAA 3M3YH 4RMFA 4L8JA 1HZBA 3U58A 3VYRA 5DAUA 2SNSA 4K0KL 1PA6A 1SMXA 4ALPA 4KN7C 4UP9A 4K8JA 1PH5A 2B2VA 3FPUB 3AQQA 5A35A 4A3IH 3S14B 5EQ0A 3A8JE 5CMDA 2F3WA 2Z8LA 3RZDH 1FR3A 2LY7A 4QUCA 4DV4L 3MXNB 4A3KH 5KYLA 3HOWH 2VB2X 1E2WA 3DEOA 4F88A 1C8CA 4JI4L 1R4QB 1A63A 1SJED 4XYQA 1ONLA 4C3HG 3F1ZA 3PSIA 2CH4A 4JI3L 3CU7A 3W1BA 2DGYA 2JA9A 1XJVA 3G4SA 1DYQA 1F2LA 4UDUC 3J80L 2R7FA 4MTKA 2OEOA 1VQJA 4NB3A 5I6WA 2EJFC 3S24A 3H0GG 2E74C 4S3SA 3NEMA 1GUWA 2JA7H 3CMAA 4LF8Q 1KAAA 4DV2L 4GKJL 2E76C 1EY6A 3QJYA 3SK6A 1SN8A 2CHBD 3KK7A 4MNOA 4OIJA 5T1IA 4YY3Q 4HR7B 1LTBD 4DXFA 2B2UC 5GAGC 4DR2L 1EQQA 4HTHA 1HRJA 3GTLH 3NE5B 5KNBA 2BA0A 3IL8A 2SOBA 3FHWA 3LWEA 1HZCA 4B3SL 1AEXA 4L63B 5EKLA 3MXUA 1EQVA 1PYWD 1JWMD 1IBKQ 3MXNA 2J4XA 4X62Q 4R4TA 2VQEQ 1DZ1A 3KF6B 2YU9B 3HOVB 2UU9L 2YYZA 4A3FG 3K5OA 1A6XA 1SRUA 4KI0A 1XNRL 1A2TA 2K5VA 1WI5A 1TKWB 1S4ZA 3MC0B 5C44H 1MD2D 4DXGA 4IPDA 2D62A 1HR0W 4HJ5A 3HOYB 1NNXA 1FNUA 3CPFA 2BDNA 3F8TA 3T56B 5IYCH 4A3BG 2B29A 4UHVA 1BBUA 1B8AA 3PIP3 2B2UA 2A19A 4QCLA 4CJ0B 2Q8IB 2OWOA 2VQFL 1PH6A 4X64L 1HNXQ 3PCOB 2R3ZA 2G9HD 4WJ4A 3SK5A 1J8IA 4EQPA 1ZYRC 4YCUA 4YWMA 3S16H 4B9XA 4CDDC 1X3QA 2MQHA 3F2BA 2L0CA 1OO9B 4ZUIA 1A3VA 3M4YA 3AMUA 4OWTB 3HOZH 2TSSA 3RMHA 4TRDA 3EIVA 2AKWB 1WYDA 4N8FA 2NVQB 3KBXA 2A69C 1C4QA 1UE5A 2VS1A 3VA7A 4N8X1 2E5LL 2WAQB 1E22A 4R4OA 3W1GA 2A6ED 3KF6A 2PI2E 4CKCA 2ZXPA 1EFID 2Q2TA 2H5XA 3C1EA 2FINB 2WKDA 2UUBL 4LWCA 4C1NK 2UUCQ 3GTKH 3FEWX 4FF2A 1YVCA 1H9JA 1I4QA 1YNND 2KCCA 2WFWA 2XWJB 1O7YA 5FKAC 4A3CH 3FPPA 1EWCA 2NVTB 2ZJQA 2K5WA 2XRQD 3K80C 4HMJA 1NSNS 2E2IB 1PTOC 5KEEA 2QILA 1S5ED 5M5YB 1BO0A 4JI6Q 3UI2A 3S9WA 1T9HA 3J81L 4WJ3M 4J1MA 1TS4A 4IUQA 3HRZC 4FYDA 2KHSA 1HUNA 2R93G 3HKZB 1JORA 2K52A 1STEA 1Q7YC 4LF4Q 1QOHA 3L7ZC 3PO3B 2UXCL 2NVYH 2PW7A 4G7OC 2RCFA 3CC2A 1KL9A 1QJOA 4DV6Q 2I46A 1CI3M 4K5VA 4O0AA 4XQNA 1OXSC 1F2YA 3M4PA 2JA6G 2OT2A 2QF7A 5EPJA 5EPKA 1EY4A 1WCMG 5ELOA 1VQHA 1A62A 2KVMA 1K73C 1SMYD 3BU2A 3R2TA 1ZEQX 4Q5VA 4OIKA 1Y14B 1CZGA 3M4OH 5ELEA 2X6LA 4EX5A 5FLXE 3K0XA 4G4KA 1MI2A 4X65Q 4GLVB 1S3OA 2HDLA 1D5ZC 1K8MA 1NR2A 2PMZE 3NP8A 1GD7A 1SE2A 1I6VC 3CCVA 5J39A 4XQJA 1I94Q 4UAIA 1FNWA 3HOUG 3CRLC 3QG1A
chains in the Genus database with same CATH topology
4DR6Q 1B7YB 1HZAA 5K36G 3W5OA 5BR8L 4JI6L 4OX9L 1X9NA 5HY6A 3B6YA 2Y0SG 3WWVA 1X56A 4GNXB 3TS2A 1FL0A 2FXQA 3M85A 4NPSA 3STBD 4A76A 3GTMH 3RZOH 2AMCB 2UUAQ 1CKMA 1Q1EA 3UDFA 4LF4L 3KJPA 1C7YA 1HNZL 4LF7L 1TWAH 1C0AA 1I5FA 3KYHC 1RL2A 2XTIA 1Q1BA 3T1HQ 4GN4B 4LFAQ 1YITA 4GKKL 4PZ8A 4DV6L 3EBEA 1QUQB 1PH8A 3HOYH 4PG3A 4QJFA 2N3SA 3RLNA 1PYBA 1VQGA 4POFA 2UXBQ 4GNXC 1X65A 3CW2C 1VQ5A 1GVPA 4AYBE 1NE3A 4JI8L 3IRBA 4DV0Q 4GOPB 4B3ML 1M1KC 1VQ9A 2E2JH 3TREA 1VQKA 1PH9A 1GKHA 2ZTDA 3DM3A 1BVSA 4LF6L 4AQYL 1VQOA 2AHOB 2D0PA 1IBLQ 2ID0A 4DV7L 2N8NA 4B3TL 5ELNA 3CPWA 3GTPH 5AJ3Q 4DAMA 3U4VA 1HR0Q 4GOPC 3CXCA 4X65L 3KJOA 2ATWA 1YJWA 1YZ6A 2K14A 1VQIA 4IJHA 3L2PA 1YHQA 2JA8H 4RG1A 4ME3A 3RN2A 1H95A 4DKAC 3G6EA 2F52A 2NVQH 2HQLA 4YWLA 4HIOA 2JA5H 2I0QA 4B3RQ 5C0XI 1VQMA 1I94L 2JA5G 4JI5Q 2ALYB 1Y1WH 4OXPA 5LMUQ 1BBWA 3AYHB 4GNXA 1Y1WG 1QVFA 2WP8J 4DR6L 5C0XG 4PMWA 4PZ6A 2CQOA 4KHPQ 4OO1I 4JCVE 1E1OA 1EUJA 4XTCS 2N78A 4YWKA 1VQPA 3KDFB 4A3GH 5JEAJ 3J81c 4A3GG 3CCJA 4A93G 4OO1G 1JJGA 5FLMH 4DV1Q 5M3FH 2UUAL 4JV5Q 1YEZA 2KHJA 5FLMG 5M3FG 4OWWB 1K9MC 1QUQA 2A1AA 3JC66 4NXMQ 1XPUA 3J7ZC 3FKIH 3PV0A 2NVTH 3FKIG 5JEAG 3T1HL 4TQUS 1YBYA 4DR3Q 3G48A 4LFAL 1K0RA 4GOPA 3S2HH 3PIOA 2KENA 5IP7H 4BY7H 2E8GA 2UXBL 4JI1Q 5IP7G 4BY7G 2ZM6Q 2VY3A 5M5YH 2AWOA 2QEXA 5LMNW 3KLWA 2GVBA 2I5MX 1UE1A 3I2ZA 4DV0L 1E7ZA 3J7A5 1K3RA 4GS3A 1M90C 3ER0A 1N34Q 3PF4A 1E24A 2LSSA 2GN5A 3A74A 3UDIA 4BBSH 4BBSG 4QL5A 2R7ZH 1CSQA 4JBJA 2R7ZG 2JJQA 2RHQB 2WB1E 3ERSX 3PUWA 2ZTCA 4L5QA 4DV5Q 1IBLL 1XMQQ 3JAMc 2JK8A 1UE6A 5C4JH 3D0FA 5AJ3L 1VQBA 4IFDI 1A8VA 1KAWA 1HR0L 3S2DH 1JT8A 2R92H 3VDYA 4L5SA 2R92G 1VQ7A 3I4OA 4IFDG 1O7IA 1KHIA 1GM5A 3J81i 4DR1Q 2XGTA 4NXNQ 4TVAB 1I3QH 2HIVA 3CCEA 4B3RL 4LFCQ 3PUYA 3STBC 4IPCA 4JI5L 3ULLA 1Z9FA 3GTJH 4BA2I 4P72A 1AE3A 3D31A 3KDFA 2B3GA 3PUXA 5LMUL 4DUYQ 4LUOA 1QZHA 4A3LH 1OXUA 4A3EH 4KHPL 4A3LG 5EAYA 1KRTA 1VQFA 2HIXA 2OCEA 1EWIA 2BH2A 2OQKA 3HKZE 3RR5A 1K83H 4DV1L 1ASZA 1NTGA 4JV5L 2IX0A 1X55A 4A3DH 3L0OA 2NN6I 2K5HA 4UP8A 1VQLA 4LF9Q 4NXML 4J15A 2JA7G 1RIPA 4C3JH 3ICEA 2LXKA 1K8AC 1VQDA 4DR3L 4DR5Q 1XMOQ 2NN6G 1C9OA 1X3EA 3GD7A 1J6QA 4JI1L 2LXJA 3I4MH 2ZM6L 4DR7Q 1TWFH 3JAMi 3A5ZB 3I4MG 1ASYA 1IYJB 2KCMA 1KD1C 2YTXA 4C2MH 3PIPA 4A4IA 1J5EQ 3EN2A 1QZGA 4H02A 1PH4A 4X6AH 2NVXH 1N34L 3TQYA 3K7AH 3RNUA 1QVGA 2ASBA 2PQAB 3DLLA 4GN5A 3HKSA 3PUZA 4DV5L 5M3MH 2VL6A 1N32L 3OTOQ 5M3MG 1XMQL 4K0KQ 4JOIC 1VS0A 3NELA 1U5KA 1YI2A 3U4ZA 4HJ8A 3K81C 1WJJA 3ZJYC 3CMEA 1NY4A 1E1TA 2IHEA 1EFWA 1AE2A 2K5NA 3S1NH 4AIMA 1U0LA 1TWGH 4LW1A 3TS0A 4DR1L 4UP7A 5JJKA 4NXNL 5GAHC 1SFOH 4JBKA 1JB7A 1V43A 3CC7A 2Y0SE 4LFCL 2PNHA 3RN5A 3RLOA 1PH3A 2Q2HA 4DV4Q 5J3BA 2MO0A 4DUYL 4LFBQ 1EIFA 4HJAA 4A75A 1XPRA 4UPAA 1VQ6A 3OYYA 1EOVA 3CQZH 1LM0A 1PHJA 1PH7A 2CFMA 3M7NA 4AH6A 3CC4A 4JI4Q 4IPHA 1HJPA 4DUZQ 5IT9c 3GTOH 3Q8DA 4JI3Q 1GO3E 1UE7A 4LF9L 1Y1VH 1CKOA 2AWNA 1FJGQ 1DGSA 4DR4Q 1Y1VG 3AFQA 4LF5Q 3KFUA 4JOIA 2YTYA 4GLXA 2F4VQ 1VQCA 4DR5L 1YJNA 1XMOL 1SROA 4QQBX 3AFPA 4JI2Q 4P71A 1A0IA 4A93H 3T1YQ 4DR7L 2KBNA 1NBWA 4OONA 3H15A 5C4XH 4IOCA 1VQEA 5H1SE 1J5EL 5C4XG 1WFQA 3E9IA 2PQAA 3F2CA 4BBRG 2JEBI 5IWAQ 4DV2Q 3UDGA 4BXXH 2R7DA 2L15A 4BXXG 2GVAA 1KQSA 3M3YH 4P74A 2VNUD 4RMFA 5FLXc 1HZBA 3U58A 2NZHA 3E9HA 3KOJA 4DV3Q 4DR2Q 3OTOL 1CKNB 1TWHH 4K0KL 1PA6A 1MJEA 4DPGA 1SMXA 2CWAA 4ALPA 1XPOA 3HOXH 3K7UC 3LGJA 4UP9A 4DAYB 3CCRA 2V1CC 4HJ9A 3HOXG 1PH5A 1I50H 3NBHB 2QGQA 3AQQA 4A3IH 4B3SQ 3GTGH 3S1RH 4A3IG 1PH1A 1XNQQ 1UWVA 1IXRA 1VQAA 2I5LX 1CUKA 2K75A 2EXDA 4KHZA 3RZDH 1N32Q 5IYDH 3PUVA 2UU9Q 3GDEA 5IYDG 4DV4L 2MNAA 5GAEC 2YV5A 3MXNB 4A3KH 2HHHQ 1XNRQ 3H3VI 3HOWH 4Y52H 3UDXA 4A3KG 1JJ2A 4LFBL 4YCVA 3HOWG 4XIGS 3M4QA 3H3VH 1SE8A 1EQRA 4L5TA 2R6GA 4DNIA 2BH8A 1KRSA 2ES2A 2D0OA 2OTLA 1S72A 4C3HH 4JI4L 3TEHB 4JC0A 2IY5B 1A63A 1WOCA 3F1ZA 4DUZL 2F3IA 3PSIA 5M5XH 4JI3L 5LMNQ 2RHSB 1LYLA 3RLFA 5GQOA 2KCTA 1FJGL 1I6HH 4DR4L 1KC8C 3W1BA 4LF5L 2Z0SA 3I7FA 2DGYA 3MEFA 2JA9A 1XJVA 3NENA 3G4SA 4UY8C 2F4VL 1D8LA 4JI2L 2R7FA 2YTVA 1L0WA 2VQFQ 2ZJPA 4X64Q 3CCMA 3CAMA 1NJIC 2RCNA 4JI0Q 3T1YL 1Q81C 1VQJA 4NB3A 1P8LA 3OW2A 3H0GH 4R4IA 1X6OA 3S24A 3H0GG 5DLQE 3NEMA 2JA7H 3SGIA 1G51A 2MFIA 3CMAA 4LF8Q 5IWAL 4DV2L 4GKJL 3CD6A 1PYSB 1CKNA 2CWPA 4EQ5A 1SN8A 4MNOA 4YY3Q 1JJCB 4PZ7A 1N9WA 2DUDA 2VW9A 5GAGC 4DV3L 4DR2L 3A5UA 1EQQA 3GTLH 2E5LQ 4JG2A 2VZAA 3S17H 2BA0A 3KF8B 1TXYA 3FHWA 4IJLA 2K50A 1D7QA 3F2DA 1HZCA 3CCLA 4B3SL 1LTLA 2NZOA 1XNQL 1IBKQ 5JJLA 4X62Q 5GROA 4DK6C 2UUBQ 4R4TA 2VQEQ 2ZJRA 3KF6B 3I55A 1W3SA 1B70B 2UU9L 2YYZA 4OWXB 4A3FG 2HHHL 3FP9A 1SRUA 4KI0A 1XNRL 2K5VA 4Y7NH 4R4QA 2IX1A 1WI5A 2IHFA 4IOAA 2YU9H 3HOVH 5C44H 4A3MH 3E0EA 4IPDA 2RF4A 5C44G 1IBMQ 3HOVG 4A3MG 2D62A 1HR0W 4HJ5A 4QGUA 1SR3A 2UXDQ 3CPFA 5HGQA 4A3BH 3F8TA 4FDBA 5IYCH 3G71A 4A3BG 1LUZA 1YHBA 2B29A 1SLJA 3A0JA 2JQOA 5IYCG 5LMNL 1EYGA 3M9BA 5IE8A 1BBUA 1B8AA 3ULPA 2JEAI 2VUMH 2VUMG 3HOYG 1PV4A 2A19A 2CKZB 5GADC 3K8AA 2N49A 1Q82C 1X54A 4R1JA 2OWOA 2VQFL 1PH6A 4APVA 4X64L 3CCSA 1HNXQ 4JI0L 3PCOB 4X66Q 2C35B 1UEBA 4MTNA 1EIYB 4HJ7A 1G291 2UXCQ 1YJ9A 4WJ4A 4YCUA 4YWMA 2IT1A 1E3PA 4JYAQ 3S16H 1XTDA 2MQHA 3F2BA 5IYBH 4LF8L 4YCWA 5IYBG 1G6PA 1HH2P 4OWTB 1N8RC 3HOZH 2EIFA 1OXXK 4YY3L 1HNWQ 1KXLA 3HOZG 1VQNA 4IO9A 3EIVA 2AKWB 1WYDA 4MZ9A 4P75A 1UE5A 2VS1A 1OXVA 2E5LL 1Q12A 1IL2A 4BBRH 1E22A 4R4OA 5C0XJ 2JA8G 3W1GA 1OTCA 1FVIA 1PH2A 3CCUA 3KF6A 2PI2E 4GKJQ 2E2HH 3J81j 3BZKA 1Q8KA 1IBKL 4X62L 2CCZA 2I5HA 2WAQG 4JBWA 2Q2TA 2H5XA 5IP9H 2UUBL 2VQEL 4JI7Q 4LWCA 2UUCQ 3GTKH 5IP9G 4LNQA 4DK3C 2OTJA 1YVCA 4GN3B 2EQSA 2WB1G 5JJIA 1L1OB 2PI2A 1AH9A 2WFWA 3S1MH 4A3JH 4A3CH 1N33Q 1YNXA 1FGUA 4A3JG 1VQ8A 1YIJA 4GLAC 2ZJQA 3S1QH 1IBML 3HFZB 3K80C 5E7NA 4A3CG 2UXDL 4YHHQ 4L5RC 1QVCA 1VQ4A 1N36Q 3BZCA 4QY7A 1NMFA 3S14H 3UE0A 5BR8Q 1JE5A 4JI6Q 4KLKA 4OX9Q 1T9HA 4WJ3M 2E2IH 2ZTEA 1MJCA 1TWCH 3CF5A 1L1OC 4P73A 1W2BA 3UE1A 2HT1A 4O2DA 2OQ0A 3U50C 2R93H 1R9TH 2R93G 2K4KA 2K52A 3J80c 1L2FA 1Q7YC 1HNXL 4X66L 4LF4Q 4LF7Q 1HNZQ 4QIWE 1CSPA 3L7ZC 1MKHA 3CP0A 5IY0A 2UXCL 2NVYH 1V9PA 4BY1H 3CCQA 2WAQE 1MIUA 4BY1G 4BA1I 4JBMA 4GKKQ 3ULJA 3CC2A 1KL9A 4JYAL 2Z6KC 4DV6Q 3HKZG 1PVOA 4O0AA 2JA6H 3GO5A 2A8VA 1OXSC 3PO3H 3M4PA 2JA6G 4POGA 4IFDJ 1S40A 3PO3G 1WCMH 1JMCA 2B63H 4JI8Q 4B3MQ 1WCMG 2B63G 5ELOA 1X3GA 1VQHA 1VCIA 1HNWL 1A62A 1IZ6A 1P16A 1K73C 1HZ9A 1Q46A 5C3EH 3BU2A 4LF6Q 4IPGA 5C3EG 4AQYQ 1NMGA 3GTQH 3BJUA 1BKBA 4LUVA 5FJ8H 2JE6I 1Y14B 1Z47A 3M4OH 5FJ8G 4DV7Q 3AEVA 4HIKA 4B3TQ 4EX5A 4HIDA 4R4CA 1Q86C 1L1OA 3K0XA 1KIXA 2Q2UA 4JI7L 4HIMA 1V1QA 2UUCL 2MO1A 4X65Q 1PFSA 4GLVB 1X3FA 1YHAA 4A3EG 1K8GA 2KHIA 1S3OA 3I56A 2PMZE 3PGZA 3PF5A 4AYBG 1N33L 1GD7A 5M5WH 4C3IH 3I4NH 2Q2IA 2Z6KA 3CCVA 3I4NG 3J80i 1I94Q 3HOUH 3PO2H 3TRZA 4YHHL 4LUZA 3HOUG 2BA1A 1N36L 1OXTA 2QA4A 3PO2G 3S15H 4A3DG 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 Q;  1B7Y B;  1HZA A;  5K36 G;  3W5O A;  5BR8 L;  4JI6 L;  4OX9 L;  1X9N A;  5HY6 A;  3B6Y A;  2Y0S G;  3WWV A;  1X56 A;  4GNX B;  3TS2 A;  1FL0 A;  2FXQ A;  3M85 A;  4NPS A;  3STB D;  4A76 A;  3GTM H;  3RZO H;  2AMC B;  2UUA Q;  1CKM A;  1Q1E A;  3UDF A;  4LF4 L;  3KJP A;  1C7Y A;  1HNZ L;  4LF7 L;  1TWA H;  1C0A A;  1I5F A;  3KYH C;  1RL2 A;  2XTI A;  1Q1B A;  3T1H Q;  4GN4 B;  4LFA Q;  1YIT A;  4GKK L;  4PZ8 A;  4DV6 L;  3EBE A;  1QUQ B;  1PH8 A;  3HOY H;  4PG3 A;  4QJF A;  2N3S A;  3RLN A;  1PYB A;  1VQG A;  4POF A;  2UXB Q;  4GNX C;  1X65 A;  3CW2 C;  1VQ5 A;  1GVP A;  4AYB E;  1NE3 A;  4JI8 L;  3IRB A;  4DV0 Q;  4GOP B;  4B3M L;  1M1K C;  1VQ9 A;  2E2J H;  3TRE A;  1VQK A;  1PH9 A;  1GKH A;  2ZTD A;  3DM3 A;  1BVS A;  4LF6 L;  4AQY L;  1VQO A;  2AHO B;  2D0P A;  1IBL Q;  2ID0 A;  4DV7 L;  2N8N A;  4B3T L;  5ELN A;  3CPW A;  3GTP H;  5AJ3 Q;  4DAM A;  3U4V A;  1HR0 Q;  4GOP C;  3CXC A;  4X65 L;  3KJO A;  2ATW A;  1YJW A;  1YZ6 A;  2K14 A;  1VQI A;  4IJH A;  3L2P A;  1YHQ A;  2JA8 H;  4RG1 A;  4ME3 A;  3RN2 A;  1H95 A;  4DKA C;  3G6E A;  2F52 A;  2NVQ H;  2HQL A;  4YWL A;  4HIO A;  2JA5 H;  2I0Q A;  4B3R Q;  5C0X I;  1VQM A;  1I94 L;  2JA5 G;  4JI5 Q;  2ALY B;  1Y1W H;  4OXP A;  5LMU Q;  1BBW A;  3AYH B;  4GNX A;  1Y1W G;  1QVF A;  2WP8 J;  4DR6 L;  5C0X G;  4PMW A;  4PZ6 A;  2CQO A;  4KHP Q;  4OO1 I;  4JCV E;  1E1O A;  1EUJ A;  4XTC S;  2N78 A;  4YWK A;  1VQP A;  3KDF B;  4A3G H;  5JEA J;  3J81 c;  4A3G G;  3CCJ A;  4A93 G;  4OO1 G;  1JJG A;  5FLM H;  4DV1 Q;  5M3F H;  2UUA L;  4JV5 Q;  1YEZ A;  2KHJ A;  5FLM G;  5M3F G;  4OWW B;  1K9M C;  1QUQ A;  2A1A A;  3JC6 6;  4NXM Q;  1XPU A;  3J7Z C;  3FKI H;  3PV0 A;  2NVT H;  3FKI G;  5JEA G;  3T1H L;  4TQU S;  1YBY A;  4DR3 Q;  3G48 A;  4LFA L;  1K0R A;  4GOP A;  3S2H H;  3PIO A;  2KEN A;  5IP7 H;  4BY7 H;  2E8G A;  2UXB L;  4JI1 Q;  5IP7 G;  4BY7 G;  2ZM6 Q;  2VY3 A;  5M5Y H;  2AWO A;  2QEX A;  5LMN W;  3KLW A;  2GVB A;  2I5M X;  1UE1 A;  3I2Z A;  4DV0 L;  1E7Z A;  3J7A 5;  1K3R A;  4GS3 A;  1M90 C;  3ER0 A;  1N34 Q;  3PF4 A;  1E24 A;  2LSS A;  2GN5 A;  3A74 A;  3UDI A;  4BBS H;  4BBS G;  4QL5 A;  2R7Z H;  1CSQ A;  4JBJ A;  2R7Z G;  2JJQ A;  2RHQ B;  2WB1 E;  3ERS X;  3PUW A;  2ZTC A;  4L5Q A;  4DV5 Q;  1IBL L;  1XMQ Q;  3JAM c;  2JK8 A;  1UE6 A;  5C4J H;  3D0F A;  5AJ3 L;  1VQB A;  4IFD I;  1A8V A;  1KAW A;  1HR0 L;  3S2D H;  1JT8 A;  2R92 H;  3VDY A;  4L5S A;  2R92 G;  1VQ7 A;  3I4O A;  4IFD G;  1O7I A;  1KHI A;  1GM5 A;  3J81 i;  4DR1 Q;  2XGT A;  4NXN Q;  4TVA B;  1I3Q H;  2HIV A;  3CCE A;  4B3R L;  4LFC Q;  3PUY A;  3STB C;  4IPC A;  4JI5 L;  3ULL A;  1Z9F A;  3GTJ H;  4BA2 I;  4P72 A;  1AE3 A;  3D31 A;  3KDF A;  2B3G A;  3PUX A;  5LMU L;  4DUY Q;  4LUO A;  1QZH A;  4A3L H;  1OXU A;  4A3E H;  4KHP L;  4A3L G;  5EAY A;  1KRT A;  1VQF A;  2HIX A;  2OCE A;  1EWI A;  2BH2 A;  2OQK A;  3HKZ E;  3RR5 A;  1K83 H;  4DV1 L;  1ASZ A;  1NTG A;  4JV5 L;  2IX0 A;  1X55 A;  4A3D H;  3L0O A;  2NN6 I;  2K5H A;  4UP8 A;  1VQL A;  4LF9 Q;  4NXM L;  4J15 A;  2JA7 G;  1RIP A;  4C3J H;  3ICE A;  2LXK A;  1K8A C;  1VQD A;  4DR3 L;  4DR5 Q;  1XMO Q;  2NN6 G;  1C9O A;  1X3E A;  3GD7 A;  1J6Q A;  4JI1 L;  2LXJ A;  3I4M H;  2ZM6 L;  4DR7 Q;  1TWF H;  3JAM i;  3A5Z B;  3I4M G;  1ASY A;  1IYJ B;  2KCM A;  1KD1 C;  2YTX A;  4C2M H;  3PIP A;  4A4I A;  1J5E Q;  3EN2 A;  1QZG A;  4H02 A;  1PH4 A;  4X6A H;  2NVX H;  1N34 L;  3TQY A;  3K7A H;  3RNU A;  1QVG A;  2ASB A;  2PQA B;  3DLL A;  4GN5 A;  3HKS A;  3PUZ A;  4DV5 L;  5M3M H;  2VL6 A;  1N32 L;  3OTO Q;  5M3M G;  1XMQ L;  4K0K Q;  4JOI C;  1VS0 A;  3NEL A;  1U5K A;  1YI2 A;  3U4Z A;  4HJ8 A;  3K81 C;  1WJJ A;  3ZJY C;  3CME A;  1NY4 A;  1E1T A;  2IHE A;  1EFW A;  1AE2 A;  2K5N A;  3S1N H;  4AIM A;  1U0L A;  1TWG H;  4LW1 A;  3TS0 A;  4DR1 L;  4UP7 A;  5JJK A;  4NXN L;  5GAH C;  1SFO H;  4JBK A;  1JB7 A;  1V43 A;  3CC7 A;  2Y0S E;  4LFC L;  2PNH A;  3RN5 A;  3RLO A;  1PH3 A;  2Q2H A;  4DV4 Q;  5J3B A;  2MO0 A;  4DUY L;  4LFB Q;  1EIF A;  4HJA A;  4A75 A;  1XPR A;  4UPA A;  1VQ6 A;  3OYY A;  1EOV A;  3CQZ H;  1LM0 A;  1PHJ A;  1PH7 A;  2CFM A;  3M7N A;  4AH6 A;  3CC4 A;  4JI4 Q;  4IPH A;  1HJP A;  4DUZ Q;  5IT9 c;  3GTO H;  3Q8D A;  4JI3 Q;  1GO3 E;  1UE7 A;  4LF9 L;  1Y1V H;  1CKO A;  2AWN A;  1FJG Q;  1DGS A;  4DR4 Q;  1Y1V G;  3AFQ A;  4LF5 Q;  3KFU A;  4JOI A;  2YTY A;  4GLX A;  2F4V Q;  1VQC A;  4DR5 L;  1YJN A;  1XMO L;  1SRO A;  4QQB X;  3AFP A;  4JI2 Q;  4P71 A;  1A0I A;  4A93 H;  3T1Y Q;  4DR7 L;  2KBN A;  1NBW A;  4OON A;  3H15 A;  5C4X H;  4IOC A;  1VQE A;  5H1S E;  1J5E L;  5C4X G;  1WFQ A;  3E9I A;  2PQA A;  3F2C A;  4BBR G;  2JEB I;  5IWA Q;  4DV2 Q;  3UDG A;  4BXX H;  2R7D A;  2L15 A;  4BXX G;  2GVA A;  1KQS A;  3M3Y H;  4P74 A;  2VNU D;  4RMF A;  5FLX c;  1HZB A;  3U58 A;  2NZH A;  3E9H A;  3KOJ A;  4DV3 Q;  4DR2 Q;  3OTO L;  1CKN B;  1TWH H;  4K0K L;  1PA6 A;  1MJE A;  4DPG A;  1SMX A;  2CWA A;  4ALP A;  1XPO A;  3HOX H;  3K7U C;  3LGJ A;  4UP9 A;  4DAY B;  3CCR A;  2V1C C;  4HJ9 A;  3HOX G;  1PH5 A;  1I50 H;  3NBH B;  2QGQ A;  3AQQ A;  4A3I H;  4B3S Q;  3GTG H;  3S1R H;  4A3I G;  1PH1 A;  1XNQ Q;  1UWV A;  1IXR A;  1VQA A;  2I5L X;  1CUK A;  2K75 A;  2EXD A;  4KHZ A;  3RZD H;  1N32 Q;  5IYD H;  3PUV A;  2UU9 Q;  3GDE A;  5IYD G;  4DV4 L;  2MNA A;  5GAE C;  2YV5 A;  3MXN B;  4A3K H;  2HHH Q;  1XNR Q;  3H3V I;  3HOW H;  4Y52 H;  3UDX A;  4A3K G;  1JJ2 A;  4LFB L;  4YCV A;  3HOW G;  4XIG S;  3M4Q A;  3H3V H;  1SE8 A;  1EQR A;  4L5T A;  2R6G A;  4DNI A;  2BH8 A;  1KRS A;  2ES2 A;  2D0O A;  2OTL A;  1S72 A;  4C3H H;  4JI4 L;  3TEH B;  4JC0 A;  2IY5 B;  1A63 A;  1WOC A;  3F1Z A;  4DUZ L;  2F3I A;  3PSI A;  5M5X H;  4JI3 L;  5LMN Q;  2RHS B;  1LYL A;  3RLF A;  5GQO A;  2KCT A;  1FJG L;  1I6H H;  4DR4 L;  1KC8 C;  3W1B A;  4LF5 L;  2Z0S A;  3I7F A;  2DGY A;  3MEF A;  2JA9 A;  1XJV A;  3NEN A;  3G4S A;  4UY8 C;  2F4V L;  1D8L A;  4JI2 L;  2R7F A;  2YTV A;  1L0W A;  2VQF Q;  2ZJP A;  4X64 Q;  3CCM A;  3CAM A;  1NJI C;  2RCN A;  4JI0 Q;  3T1Y L;  1Q81 C;  1VQJ A;  4NB3 A;  1P8L A;  3OW2 A;  3H0G H;  4R4I A;  1X6O A;  3S24 A;  3H0G G;  5DLQ E;  3NEM A;  2JA7 H;  3SGI A;  1G51 A;  2MFI A;  3CMA A;  4LF8 Q;  5IWA L;  4DV2 L;  4GKJ L;  3CD6 A;  1PYS B;  1CKN A;  2CWP A;  4EQ5 A;  1SN8 A;  4MNO A;  4YY3 Q;  1JJC B;  4PZ7 A;  1N9W A;  2DUD A;  2VW9 A;  5GAG C;  4DV3 L;  4DR2 L;  3A5U A;  1EQQ A;  3GTL H;  2E5L Q;  4JG2 A;  2VZA A;  3S17 H;  2BA0 A;  3KF8 B;  1TXY A;  3FHW A;  4IJL A;  2K50 A;  1D7Q A;  3F2D A;  1HZC A;  3CCL A;  4B3S L;  1LTL A;  2NZO A;  1XNQ L;  1IBK Q;  5JJL A;  4X62 Q;  5GRO A;  4DK6 C;  2UUB Q;  4R4T A;  2VQE Q;  2ZJR A;  3KF6 B;  3I55 A;  1W3S A;  1B70 B;  2UU9 L;  2YYZ A;  4OWX B;  4A3F G;  2HHH L;  3FP9 A;  1SRU A;  4KI0 A;  1XNR L;  2K5V A;  4Y7N H;  4R4Q A;  2IX1 A;  1WI5 A;  2IHF A;  4IOA A;  2YU9 H;  3HOV H;  5C44 H;  4A3M H;  3E0E A;  4IPD A;  2RF4 A;  5C44 G;  1IBM Q;  3HOV G;  4A3M G;  2D62 A;  1HR0 W;  4HJ5 A;  4QGU A;  1SR3 A;  2UXD Q;  3CPF A;  5HGQ A;  4A3B H;  3F8T A;  4FDB A;  5IYC H;  3G71 A;  4A3B G;  1LUZ A;  1YHB A;  2B29 A;  1SLJ A;  3A0J A;  2JQO A;  5IYC G;  5LMN L;  1EYG A;  3M9B A;  5IE8 A;  1BBU A;  1B8A A;  3ULP A;  2JEA I;  2VUM H;  2VUM G;  3HOY G;  1PV4 A;  2A19 A;  2CKZ B;  5GAD C;  3K8A A;  2N49 A;  1Q82 C;  1X54 A;  4R1J A;  2OWO A;  2VQF L;  1PH6 A;  4APV A;  4X64 L;  3CCS A;  1HNX Q;  4JI0 L;  3PCO B;  4X66 Q;  2C35 B;  1UEB A;  4MTN A;  1EIY B;  4HJ7 A;  1G29 1;  2UXC Q;  1YJ9 A;  4WJ4 A;  4YCU A;  4YWM A;  2IT1 A;  1E3P A;  4JYA Q;  3S16 H;  1XTD A;  2MQH A;  3F2B A;  5IYB H;  4LF8 L;  4YCW A;  5IYB G;  1G6P A;  1HH2 P;  4OWT B;  1N8R C;  3HOZ H;  2EIF A;  1OXX K;  4YY3 L;  1HNW Q;  1KXL A;  3HOZ G;  1VQN A;  4IO9 A;  3EIV A;  2AKW B;  1WYD A;  4MZ9 A;  4P75 A;  1UE5 A;  2VS1 A;  1OXV A;  2E5L L;  1Q12 A;  1IL2 A;  4BBR H;  1E22 A;  4R4O A;  5C0X J;  2JA8 G;  3W1G A;  1OTC A;  1FVI A;  1PH2 A;  3CCU A;  3KF6 A;  2PI2 E;  4GKJ Q;  2E2H H;  3J81 j;  3BZK A;  1Q8K A;  1IBK L;  4X62 L;  2CCZ A;  2I5H A;  2WAQ G;  4JBW A;  2Q2T A;  2H5X A;  5IP9 H;  2UUB L;  2VQE L;  4JI7 Q;  4LWC A;  2UUC Q;  3GTK H;  5IP9 G;  4LNQ A;  4DK3 C;  2OTJ A;  1YVC A;  4GN3 B;  2EQS A;  2WB1 G;  5JJI A;  1L1O B;  2PI2 A;  1AH9 A;  2WFW A;  3S1M H;  4A3J H;  4A3C H;  1N33 Q;  1YNX A;  1FGU A;  4A3J G;  1VQ8 A;  1YIJ A;  4GLA C;  2ZJQ A;  3S1Q H;  1IBM L;  3HFZ B;  3K80 C;  5E7N A;  4A3C G;  2UXD L;  4YHH Q;  4L5R C;  1QVC A;  1VQ4 A;  1N36 Q;  3BZC A;  4QY7 A;  1NMF A;  3S14 H;  3UE0 A;  5BR8 Q;  1JE5 A;  4JI6 Q;  4KLK A;  4OX9 Q;  1T9H A;  4WJ3 M;  2E2I H;  2ZTE A;  1MJC A;  1TWC H;  3CF5 A;  1L1O C;  4P73 A;  1W2B A;  3UE1 A;  2HT1 A;  4O2D A;  2OQ0 A;  3U50 C;  2R93 H;  1R9T H;  2R93 G;  2K4K A;  2K52 A;  3J80 c;  1L2F A;  1Q7Y C;  1HNX L;  4X66 L;  4LF4 Q;  4LF7 Q;  1HNZ Q;  4QIW E;  1CSP A;  3L7Z C;  1MKH A;  3CP0 A;  5IY0 A;  2UXC L;  2NVY H;  1V9P A;  4BY1 H;  3CCQ A;  2WAQ E;  1MIU A;  4BY1 G;  4BA1 I;  4JBM A;  4GKK Q;  3ULJ A;  3CC2 A;  1KL9 A;  4JYA L;  2Z6K C;  4DV6 Q;  3HKZ G;  1PVO A;  4O0A A;  2JA6 H;  3GO5 A;  2A8V A;  1OXS C;  3PO3 H;  3M4P A;  2JA6 G;  4POG A;  4IFD J;  1S40 A;  3PO3 G;  1WCM H;  1JMC A;  2B63 H;  4JI8 Q;  4B3M Q;  1WCM G;  2B63 G;  5ELO A;  1X3G A;  1VQH A;  1VCI A;  1HNW L;  1A62 A;  1IZ6 A;  1P16 A;  1K73 C;  1HZ9 A;  1Q46 A;  5C3E H;  3BU2 A;  4LF6 Q;  4IPG A;  5C3E G;  4AQY Q;  1NMG A;  3GTQ H;  3BJU A;  1BKB A;  4LUV A;  5FJ8 H;  2JE6 I;  1Y14 B;  1Z47 A;  3M4O H;  5FJ8 G;  4DV7 Q;  3AEV A;  4HIK A;  4B3T Q;  4EX5 A;  4HID A;  4R4C A;  1Q86 C;  1L1O A;  3K0X A;  1KIX A;  2Q2U A;  4JI7 L;  4HIM A;  1V1Q A;  2UUC L;  2MO1 A;  4X65 Q;  1PFS A;  4GLV B;  1X3F A;  1YHA A;  4A3E G;  1K8G A;  2KHI A;  1S3O A;  3I56 A;  2PMZ E;  3PGZ A;  3PF5 A;  4AYB G;  1N33 L;  1GD7 A;  5M5W H;  4C3I H;  3I4N H;  2Q2I A;  2Z6K A;  3CCV A;  3I4N G;  3J80 i;  1I94 Q;  3HOU H;  3PO2 H;  3TRZ A;  4YHH L;  4LUZ A;  3HOU G;  2BA1 A;  1N36 L;  1OXT A;  2QA4 A;  3PO2 G;  3S15 H;  4A3D G;  4A3F H; 
#chains in the Genus database with same CATH topology
 1HZA A;  1KNE A;  1GXD C;  1PRT D;  4OX9 L;  2L5T A;  2EYF A;  3WWV A;  3TS2 A;  2RDF A;  1SNM A;  5KRU A;  3TME A;  3M85 A;  4NPS A;  3STB D;  2AMC B;  1Q1E A;  1SYB A;  3UDF A;  3KJP A;  1YNJ C;  2KCN A;  1TWA H;  2F3V A;  5K5P A;  1RL2 A;  3I8Z A;  4GKK L;  4GN4 B;  1RD9 D;  1TQO A;  1QUQ B;  3EBE A;  1K8O A;  1F77 A;  4POF A;  1GVP A;  4AYB E;  2EDG A;  4JPB W;  3TP5 A;  1SFO B;  4J8Q A;  1CFM A;  4AQY L;  1BXT A;  1IBL Q;  1SNP A;  3LNN A;  3NBI A;  4HMI A;  5ELD A;  4DAM A;  1HR0 Q;  3V2T A;  1K28 A;  3KJO A;  2ATW A;  1YJW A;  4IJH A;  3T16 A;  1FGB D;  1G6Z A;  3L2P A;  1YHQ A;  2JA8 H;  1H95 A;  4I7A A;  1BR9 A;  1QVF A;  5CV7 A;  5C0X G;  2CQO A;  1E1O A;  1HA5 A;  4OO1 G;  5M3F H;  4JV5 Q;  1SE4 A;  1QE6 A;  1K9M C;  1QUQ A;  2A1A A;  3OWE B;  2AUK A;  4I65 A;  3FKI H;  5JEA H;  1U4M A;  1AZQ A;  4KD3 A;  1DD2 A;  3T1H L;  1YBY A;  4LFA L;  1TWH B;  1K0R A;  2PW5 A;  4ZKB B;  3PIO A;  4K8I A;  5IP7 H;  4BY7 H;  2UXB L;  4ZLT F;  2ZM6 Q;  1I50 B;  2VY3 A;  4BBS B;  3LX0 A;  3A54 A;  3I2Z A;  5ELC A;  4DGZ A;  3K5N A;  3S1R B;  1PZJ D;  1Z7T A;  1N34 Q;  3J7A V;  1ICF B;  1HXY D;  5FK9 C;  1RF2 D;  2R7Z G;  1LTI D;  3PUW A;  4DV5 Q;  3S2D B;  2R92 B;  4L6T B;  3JAM c;  2JK8 A;  3N52 A;  1A8V A;  1KAW A;  2BE5 C;  1JT8 A;  2B2W C;  1K3B C;  4F8M A;  3QOJ A;  4KKS A;  1VQ7 A;  4IFD G;  1X3P A;  2BOS A;  3P75 A;  4H44 C;  2XGT A;  3Q6S A;  1O78 A;  4B3R L;  1EZ6 A;  3ULL A;  4JI5 L;  4BA2 I;  1EY7 A;  1TR5 A;  4P72 A;  2H1E A;  3PUX A;  3D31 A;  2NWG A;  4F87 A;  5IOC A;  5EJW A;  1Y8N B;  4X3U A;  3RD4 A;  2KA7 A;  3A8K E;  5EAY A;  4NW2 A;  2ICE C;  5CV5 A;  2Q8R E;  2O5J C;  4KY6 A;  1ILP A;  3NPP A;  3L0O A;  2K5H A;  4UP8 A;  1VQL A;  4LF9 Q;  2JXM B;  2JA7 G;  1RIP A;  4C3J H;  3DM1 A;  1K8A C;  4DR5 Q;  1XMO Q;  2NN6 G;  1U4L A;  1X3E A;  2B2W A;  3I4M H;  2SEB D;  1UUP A;  3A5Z B;  3NUC A;  4OEM B;  5COY A;  1IYJ B;  1J5E Q;  1Q90 A;  2PQE A;  4N9T A;  4V19 0;  2ICI A;  2HDM A;  3TQY A;  3K7A H;  1QVG A;  2F1M A;  4MN3 A;  1JWU D;  1WTW A;  1IL8 A;  3OTO Q;  2P5Z X;  2IWH A;  1TWG B;  3ZJY C;  1E1T A;  3A55 A;  3VR2 A;  2Q8T A;  4DR1 L;  5GAH C;  1PH3 A;  4ZRZ A;  4CGY B;  2MO0 A;  4DUY L;  4LFB Q;  2Z9H A;  3VR6 A;  4A75 A;  2BDO A;  1WTR A;  1STG A;  2CW0 C;  1PHJ A;  1LM0 A;  3GTO B;  1SAP A;  2EVB A;  3OMG A;  1HJP A;  2F0D A;  4DUZ Q;  2NTS A;  1RDP D;  1DM0 B;  1GO3 E;  3A7A B;  1CKO A;  1DGS A;  2DNE A;  3AFQ A;  4M1U B;  1CQF A;  5C4X B;  1SRO A;  3TN2 A;  3T1Y Q;  3HP3 A;  1CQV A;  4DR7 L;  3W3A A;  4OON A;  5CV6 A;  2EY1 A;  3E9I A;  4FVM A;  5C5M A;  2F0Q A;  4O1N A;  2L15 A;  2HCI A;  1PZK D;  1XXG A;  3E9H A;  3KOJ A;  1CKN B;  1PXU A;  1XPO A;  4DAY B;  3HOX G;  4E6I A;  1DOM A;  3GTG H;  2K03 A;  1XNQ Q;  2K75 A;  1CUK A;  1ENA A;  1QWY A;  2EXD A;  4K2L A;  5G3L D;  5IYD G;  2HHH Q;  1IYV A;  4Y52 H;  1EY8 A;  1GUS A;  4ID6 A;  1H9R A;  2HCC A;  4DAV A;  1HA6 A;  2PMZ B;  3G6J B;  5C5L A;  4DNI A;  5M5X B;  4R8N A;  3PIO 3;  4XT1 B;  5JPN C;  2IY5 B;  2B63 B;  2RHS B;  3H3V C;  3RLF A;  5GQO A;  1AFP A;  1WTO A;  2Z0S A;  2F4V L;  3WDN A;  1D8L A;  3H0G B;  4JK1 C;  1S5F D;  2YTV A;  1VMP A;  3CCM A;  2CH4 W;  4JI0 Q;  3CAM A;  4KN4 C;  3M7G A;  5DEH A;  4RFB A;  3OW2 A;  1QNK A;  4R4I A;  2F0O A;  3VYT A;  1F9Q A;  3BVG A;  1ILQ A;  1CKN A;  2CWP A;  2FMM A;  1Y8P B;  3K58 A;  1JJC B;  2DUD A;  3SK8 A;  4DV3 L;  2F0E A;  4C3I B;  3A5U A;  2MP1 A;  3EJI A;  3PO2 B;  2IW3 A;  1WTP A;  4IJL A;  2NYZ D;  3H6M A;  1CHP D;  3F2D A;  1D7Q A;  3MEH A;  4A3F B;  2JSO A;  2HQE A;  5JJL A;  4DK6 C;  4CKE A;  1TII D;  3IKJ A;  1W3S A;  2OF1 A;  3FP9 A;  4R4Q A;  2YU9 H;  3HOV H;  2PNR C;  2F0L A;  4A3M H;  5A2Q E;  1AP0 A;  2F0H A;  4RGT A;  4DAP A;  2UXD Q;  4KHV A;  1EIH A;  5FOB B;  1LAC A;  1SLJ A;  2JQO A;  1JIC A;  5LMN L;  1EYG A;  3M9B A;  3NSW A;  4HSP A;  2VUM G;  3K8A A;  1Q82 C;  1HUM A;  2D2C C;  2EYO A;  1MGS A;  2DNC A;  2EYH A;  2D9U A;  2B8G A;  3GTP B;  1YNN C;  4LK1 C;  1GJX A;  3W2D A;  5IYB G;  1G6P A;  1KDB A;  3BYY B;  1GUO A;  1OXX K;  1HNW Q;  1KXL A;  3KBG A;  1D1K A;  2IJ0 A;  2K33 A;  4P75 A;  1G2S A;  4BBR H;  3MVV A;  2JA8 G;  4RHR A;  1OTC A;  5J1Z A;  2A68 D;  1JQY D;  1CA5 A;  1V1O A;  2CCZ A;  4JBW A;  1SYD A;  2M9V A;  5IP9 H;  5CV8 A;  4LNQ A;  4DK3 C;  1I4H A;  3S1Q B;  2WB1 G;  5C4Z A;  5JJI A;  3DUZ A;  4FO2 A;  3S1M H;  4A3J H;  1N33 Q;  1TS2 A;  1B9M A;  1IBM L;  2F0I A;  4H7B A;  4YHH Q;  1QVC A;  1VQ4 A;  4HSV A;  4QY7 A;  1NMF A;  4I7Z C;  3X3N A;  3X3M A;  2R93 B;  5BR8 Q;  1LT6 D;  4MIU A;  4KLK A;  2E2I H;  2ZTE A;  3CF5 A;  3SE0 A;  3UE1 A;  4FF1 A;  3J80 c;  1I4R A;  4X66 L;  1CT1 D;  4DFA A;  2F0T A;  4K5X A;  1HNZ Q;  2JA6 B;  1MKH A;  1W6K A;  1WTH A;  3CCQ A;  5IT9 E;  4JYA L;  4BY1 G;  4JBM A;  2DY7 A;  1SXT A;  1WCM B;  3GO5 A;  3PO3 H;  1CM9 A;  3PQI A;  4POG A;  2WAC A;  1JMC A;  4XQQ A;  4JI8 Q;  1A3T A;  2RBM A;  2F0K A;  1X3G A;  3BS1 A;  2B63 G;  3GTQ B;  2SDF A;  1I3Q B;  1P16 A;  1Q46 A;  2QW7 A;  3DMU A;  4IPG A;  5C3E G;  1IW7 D;  2EJM A;  1BKB A;  4ZCK A;  4CBV A;  4HAE A;  5FJ8 H;  3I70 A;  4DV7 Q;  5E3F A;  4B3T Q;  3K57 A;  1Q86 C;  1KIX A;  1RKN A;  2WKC A;  4JI7 L;  2M00 A;  1RJT A;  2MO1 A;  5M5W B;  5A2Q L;  1K8G A;  2KHI A;  3HOU B;  3I56 A;  4AYB G;  3I4N H;  2K05 A;  4C3I G;  2PPB C;  1C48 A;  3TRZ A;  3PO2 G;  1N36 L;  3S15 H;  5K36 H;  2F0W A;  4DR6 Q;  1JOO A;  5D3I B;  3GTM B;  1X9N A;  5HY6 A;  4C2M B;  3B6Y A;  2Y0S G;  3OMC A;  5FO8 B;  2L4N A;  1O7L A;  3T51 B;  5IOD A;  4GNX B;  1FL0 A;  3DWP A;  1GHK A;  3DWQ A;  2XWB B;  1ESF A;  1C7Y A;  4LF7 L;  4PQX A;  3KYH C;  2XTI A;  1Q1B A;  1YIT A;  3KLS X;  4PZ8 A;  4PG3 A;  2FHT A;  3KLR A;  2G9D A;  4QJF A;  3RLN A;  4GNX C;  1X65 A;  1EZ8 A;  1R4P B;  3FMC A;  4DV0 Q;  4B3M L;  3S1N B;  1M1K C;  3K6O A;  3MXP A;  2E2J H;  3TRE A;  1VQK A;  1L0X B;  2ZTD A;  3DM3 A;  4LF6 L;  5D65 A;  4XDX A;  1FNV A;  3MFY A;  2ID0 A;  3HZX A;  5ELN A;  3CPW A;  5AJ3 Q;  4WRD A;  1B4O A;  3CKI B;  3CXC A;  2B2Y C;  4EGV A;  1YZ6 A;  2K14 A;  4ZKC B;  4ME3 A;  3IFT A;  1WTV A;  2NBF A;  4DKA C;  1Y1V B;  4M8A A;  2F52 A;  1HPC A;  2RSN A;  1GUN A;  1MSG A;  4HIO A;  2JA5 G;  4WOR A;  1PTO B;  5LMU Q;  4G7H C;  1BBW A;  1LTS D;  4GNX A;  1Y1W G;  2L12 A;  4KHP Q;  4PZ6 A;  4RKB A;  5CBE E;  1EUJ A;  4XTC S;  2N78 A;  3D4R A;  1HFN A;  3J81 c;  4A3G G;  3CCJ A;  3D3R A;  4CDE C;  5IT9 L;  5FLM H;  4DV1 Q;  5JAV A;  2UUA L;  1ROD A;  2KHJ A;  1DOL A;  4OWW B;  3S2H B;  1XPU A;  3J7Z C;  3ND9 A;  1FD7 D;  3E6Z X;  2KQ3 A;  4J6H A;  3ERQ A;  2B2Y A;  3K59 A;  2E8G A;  1SNO A;  4JI1 Q;  1SDF A;  4IZ8 A;  4NKL A;  3KLW A;  1B1Z A;  2R7Z B;  1K3R A;  2TMP A;  5CV4 A;  4CDF C;  4U67 3;  1U9R A;  4BBS H;  3A74 A;  3WOE A;  4JBJ A;  2WB1 E;  3NWT A;  2ZTC A;  5J22 A;  5JVG 3;  1XMQ Q;  1UE6 A;  5C4J H;  3D0F A;  4XXE A;  1VQB A;  2I07 B;  3C3L A;  2RDH A;  5CV9 A;  3SR1 A;  3S2D H;  2R92 H;  3VDY A;  4L5S A;  3QO2 A;  3SK4 A;  2IL8 A;  1GM5 A;  2QDB A;  4RAU C;  4TVA B;  2HIV A;  2IPK D;  4IPC A;  4CJ1 B;  3OSO A;  1PDQ A;  3ZYY X;  1AE3 A;  2LMC B;  5IGB A;  4A3L H;  1OXU A;  2K6A A;  1HFG A;  1TU2 B;  4A3E H;  3P7J A;  1S5D D;  4O42 A;  2OCE A;  2JA7 B;  2OQK A;  4KTA A;  1K83 H;  4DNT B;  4U68 A;  2IX0 A;  3NTI A;  1X55 A;  4A3D H;  4NXM L;  4J15 A;  1F2M A;  1EY5 A;  2K32 A;  4HCS A;  5D3D A;  4XYO A;  3R2I A;  1TWF B;  2WIN B;  4DR3 L;  3GTL B;  1SYC A;  2KEE A;  3GD7 A;  2ZXO A;  3PMF A;  4IUV A;  3I91 A;  2NVX B;  5IIF A;  3JAM i;  3BYT B;  2KCM A;  4FP5 D;  2KOL A;  2F0M A;  4H13 C;  1QZG A;  4ILW A;  4X6A H;  2M2L A;  2F0V A;  1TY2 A;  3RNU A;  2L55 A;  3DLL A;  1D5X C;  2N88 A;  5M3M G;  5I2Y A;  2F0F A;  4JOI C;  4K0K Q;  2PCF B;  1BCP B;  4HJ8 A;  3CME A;  1NY4 A;  2IHE A;  1EFW A;  1Q3L A;  2K5N A;  2X69 A;  2QKI C;  1TWG H;  1VF7 A;  4NXN L;  1D6E C;  1JB7 A;  1V43 A;  3CC7 A;  1VMC A;  4NDX A;  2Y0S E;  4LFC L;  1G91 A;  2XVS A;  3RLO A;  3CQZ B;  4DV4 Q;  2EYP A;  1EIF A;  4KY5 A;  4UPA A;  1BCP C;  2J0T D;  4IUT A;  3S16 B;  1E2V A;  2CFM A;  2RDG A;  3VR4 A;  2C9O A;  4JI4 Q;  3GTO H;  4JI3 Q;  1UE7 A;  2R61 A;  4LAA A;  2EPB A;  1Y1V G;  2L9H A;  5CC4 A;  4JOI A;  2YTY A;  4QQB X;  4P71 A;  4A93 H;  1WTX A;  2KBN A;  4IOC A;  5C4X H;  4B08 A;  1F9R A;  3F2C A;  4BBR G;  4KMU C;  3H91 A;  1BOS A;  2JEB I;  3VYS A;  4DV2 Q;  4BXX H;  5EGT A;  3J7Y W;  1B44 D;  5FLX c;  3HOX B;  1LT3 D;  3D8G A;  1ZYR D;  4DR2 Q;  1LO5 D;  2NUC A;  3OW7 A;  1MJE A;  4DPG A;  2CWA A;  4TKO B;  3K7U C;  2ENB A;  2V1C C;  4OEL B;  4HJ9 A;  1H9M A;  4B3S Q;  4A3I G;  5FLX L;  3EFX D;  4OGQ C;  1VQA A;  2BCO A;  3PUV A;  2UU9 Q;  5GAE C;  2YV5 A;  1XNR Q;  4A3K G;  1JJ2 A;  1PTO F;  3HOW G;  4XIG S;  3H3V H;  1EQR A;  4L5T A;  1XYI A;  3L3O C;  2R6G A;  1KRS A;  2ES2 A;  4CKB A;  4C3H H;  2EJG C;  3TEH B;  1ICW A;  5M5X H;  1LYL A;  1FJG L;  3NHH A;  1I6H H;  4DR4 L;  4LF5 L;  3I7F A;  2A5H A;  4UY8 C;  3NEN A;  1Q8I A;  4YIJ A;  4JI2 L;  1L0W A;  2VQF Q;  2ZJP A;  4X64 Q;  1NJI C;  3GQB A;  2RCN A;  3U9S A;  3NK9 A;  1KAB A;  1P8L A;  3H0G H;  3M4O B;  1X6O A;  5DLQ E;  3SGI A;  1G51 A;  5C6A A;  2MFI A;  5IWA L;  5JJZ A;  3CD6 A;  4EQO A;  3D4D A;  1QIL A;  1LT4 D;  4K2K A;  4KY7 A;  2MHV A;  2MUY A;  3P1H A;  3TP7 A;  4PZ7 A;  3S17 B;  1HHV A;  2VW9 A;  5DM7 3;  4X3T A;  3NQI A;  2E5L Q;  3EVQ A;  4JG2 A;  3Q22 A;  1TXY A;  5LHY 1;  3VR3 A;  1SJH D;  4ABN A;  4JVZ A;  5GRO A;  2EYJ A;  2UUB Q;  3K5M A;  2ZJR A;  4CJ2 C;  3A56 A;  4ZQ3 A;  4F7X A;  2B39 A;  4Y7N H;  2IX1 A;  2IHF A;  1TWA B;  1EU4 A;  3SEB A;  3ONA B;  3WOF A;  1WD1 A;  3E0E A;  5C44 G;  2XIW A;  2X6G A;  4QGU A;  1SR3 A;  1BBX C;  2VUM B;  5HGQ A;  1PLF A;  4A3B H;  3G71 A;  1EYC A;  1YHB A;  3A0J A;  5I6Y A;  5IYC G;  1UEA B;  4HN7 A;  2JEA I;  3TP8 A;  5DM6 3;  5GAD C;  1KNA A;  5HUR A;  2N49 A;  4PMC A;  4K14 A;  4ZAI A;  1CHQ D;  3CCS A;  4X3K A;  2C35 B;  4MTN A;  4HJ7 A;  2UXC Q;  4DA2 A;  2NZ1 D;  1JCK B;  2IT1 A;  3HGB A;  4ME5 A;  1H9S A;  1V1P B;  4QUF A;  2RVL A;  4X3S A;  4LF8 L;  1BNZ A;  5LL6 S;  5KYI A;  1QG7 A;  3D4W A;  4YY3 L;  1YNJ D;  3HOZ G;  1VQN A;  2JA8 B;  5E4W C;  4IO9 A;  4KJN A;  1A15 A;  2Z4I A;  4MZ9 A;  2VB3 X;  2E2H B;  1OXV A;  4RGN A;  2ZT9 C;  2PO4 A;  3BZD B;  1E0B A;  1FVI A;  1BCP F;  1A2U A;  2PZT A;  3U9O A;  3J81 j;  2WB1 B;  5CGK A;  1IBK L;  3KLS A;  4X62 L;  2I5H A;  2VQE L;  1PZI D;  2OTJ A;  2EQS A;  5M3F B;  4ZK9 B;  2O5I C;  4H0L C;  2PI2 A;  1LT5 D;  1SNC A;  2LFN A;  4KKT A;  1YIJ A;  1VQ8 A;  2NB0 A;  3S1Q H;  4A3C G;  3HFZ B;  5E7N A;  1EQT A;  4IN3 A;  1XX8 A;  3BZC A;  4RGO S;  1TWC B;  3S14 H;  3UE0 A;  4IUR A;  3BG3 A;  1R9T B;  4OX9 Q;  3BDL A;  1IW7 C;  4DF7 A;  1EY9 A;  4P73 A;  5C3W A;  5I9O A;  1W2B A;  2HT1 A;  4O2D A;  2R93 H;  2MGS A;  4BY1 B;  2K04 A;  3FDT A;  2K4K A;  1L2F A;  1HNX L;  1V1P A;  2FFK B;  1CTM A;  3ND8 A;  2WAQ E;  4BA1 I;  4GKK Q;  3ULJ A;  5IGG A;  2Z6K C;  2JA6 H;  3CHB D;  3DXJ C;  1S40 A;  4B9W A;  1WCM H;  5C3E B;  1LV9 A;  2AQ3 B;  1EU3 A;  1A3U A;  4FNF A;  4LJZ C;  1HZ9 A;  5HGT A;  5CBA E;  3GTQ H;  1U4P A;  4AQY Q;  3E0J A;  3ITP A;  3BJU A;  4LUV A;  1Z47 A;  4KD4 A;  4HIK A;  2HD3 A;  4N9P A;  4HID A;  4R4C A;  5EKI A;  2Q2U A;  3TSS A;  4AYB B;  1V1Q A;  2EY2 A;  2UUC L;  1PFS A;  1X3F A;  1YHA A;  4A3E G;  2F4I A;  3MAQ A;  3PGZ A;  5M5W H;  3Q24 A;  4C3J B;  1SYF A;  2Z6K A;  1DJR D;  3J80 i;  3HOU H;  3E3X A;  2BE5 D;  2Y0S B;  2BA1 A;  1SEB D;  4A3D G;  2QA4 A;  1ZKO A;  1B7Y B;  3RZO B;  4JI6 L;  4RCO A;  1X56 A;  2XN9 C;  3NTK A;  3GTM H;  1CKM A;  3J7A F;  4LF4 L;  2XRS D;  1C0A A;  1TS5 A;  2RQX A;  3T1H Q;  4LFA Q;  5JOB A;  4DV6 L;  3HOY H;  1SNQ A;  3TDQ A;  1VQG A;  4PNY A;  1H9K A;  5IGF A;  2UXB Q;  2A6E C;  3BDC A;  3CW2 C;  4GOP B;  3IRB A;  1Y69 U;  5C3X A;  4XT3 B;  5ISR A;  1WVL A;  2HUG A;  2OXP A;  2QCP X;  1HQM C;  2AHO B;  2D5D A;  2DN8 A;  2N8N A;  2V4D A;  2QDL A;  4ULL A;  4GOP C;  2MPM A;  3NXW A;  1STA A;  4X65 L;  2JA5 B;  3QOL A;  1Y1W B;  1JR0 D;  2NVQ H;  2HQL A;  4IAL A;  3I72 A;  4B3R Q;  1I94 L;  2F0G A;  1U4R A;  4JI5 Q;  2EXZ A;  4R9W A;  1RTO A;  2C5C A;  4A3G B;  5C0X H;  3V96 A;  1F9S A;  1PTO H;  4JCV E;  3KDF B;  5JEA J;  4OO1 H;  4A93 G;  4LMQ D;  1JJG A;  5ELF A;  1STN A;  5M3F G;  2F0N A;  3JC6 6;  3EQL C;  3PV0 A;  2NVT H;  3DWA A;  2CW0 D;  3FKI G;  1BF4 A;  5JEA G;  1SMY C;  3R3O A;  4GOP A;  3S2H H;  1O7Z A;  2CVR A;  3SHL A;  5IP7 G;  4BY7 G;  5M5Y H;  2AWO A;  5LMN W;  3GTG B;  2GVB A;  1UE1 A;  1HTP A;  3J7A 5;  3MFG A;  4GS3 A;  1E2Z A;  3ER0 A;  1PRT B;  1E24 A;  1WTQ A;  4QL5 A;  2R7Z H;  1CSQ A;  3ERS X;  2RHQ B;  3I3C A;  4L5Q A;  1IBL L;  4PV1 C;  3C2P A;  1HR0 L;  4KK7 A;  2A6H D;  4IFD H;  3OIQ A;  5KGU A;  4K5W A;  3A8I E;  1ML0 D;  1PRT C;  3GTJ B;  1QNU A;  3J81 i;  4DR1 Q;  3CCE A;  5DNF A;  3PUY A;  3STB C;  2MJ8 A;  1AZP A;  4DUY Q;  3KDF A;  2J7Z A;  1IKM A;  4LUO A;  1J9O A;  1STY A;  5IGC A;  1VQF A;  2HIX A;  3J81 E;  4WFN 3;  1Y8O B;  3RR5 A;  4DK0 A;  4JV5 L;  2EY5 A;  1II3 A;  2F0S A;  2NN6 H;  4C3J G;  1STB A;  3R93 A;  4IQZ A;  1J6Q A;  2ZM6 L;  4DR7 Q;  1TWF H;  3N6R A;  3I4M G;  1KD1 C;  2NTT A;  1D1I A;  4A4I A;  1TY0 A;  1B3A A;  3EN2 A;  5KNC A;  4H02 A;  2NVX H;  1N34 L;  5M3M B;  4G7Z C;  2ASB A;  1PFB A;  1M8A A;  2PQA B;  3HKS A;  1HTL D;  4DV5 L;  2F03 A;  4C56 C;  4A3M B;  4FXK C;  1M4V A;  2LKV A;  1U5K A;  1YI2 A;  1PMR A;  3K81 C;  1WJJ A;  1CZW A;  1I4G A;  4AIM A;  3DHQ A;  3TS0 A;  1PFN A;  1SFO H;  4JBK A;  5IGE A;  1JC7 A;  1BUV T;  5J3B A;  2H4O A;  4HCE A;  4MHE A;  1EOV A;  2EE1 A;  1HCZ A;  3CQZ H;  5E1F A;  1WD0 A;  1PH7 A;  3M7N A;  3CC4 A;  1LTR D;  2Z6B A;  4IPH A;  3OIP A;  5IT9 c;  1NAP A;  5EBC A;  3Q8D A;  4LF9 L;  2AWN A;  1GHJ A;  3KFU A;  4GLX A;  2F4V Q;  3EA6 A;  1VQC A;  4DR5 L;  1XMO L;  1SSO A;  4BBR B;  3QB3 A;  3QWN A;  2XNA C;  4RKL A;  1J5E L;  1EL0 A;  4IUN A;  1FYC A;  3M3Y B;  2PQA A;  3QR8 A;  2K5Q A;  1EOT A;  3UDG A;  2R7D A;  1T5X D;  2VNU D;  1LTA D;  1KQS A;  4P74 A;  3O13 A;  2KED A;  2NZH A;  4A3J B;  3S1M B;  4DV3 Q;  3OTO L;  1TWH H;  4A3I B;  4ZYS A;  1VF5 C;  3HOX H;  3LGJ A;  3CCR A;  1I50 H;  3NBH B;  2QGQ A;  4BS9 A;  3RZD B;  3S1R H;  1TVX A;  3HS0 C;  1PH1 A;  1UWV A;  4A3K B;  1IXR A;  3HOW B;  2I5L X;  4G57 A;  4KHZ A;  1N32 Q;  5IYD H;  3GDE A;  2MNA A;  3H3V I;  5EKK A;  3TBI B;  3UDX A;  4LFB L;  4YCV A;  1DXM A;  3M4Q A;  1SE8 A;  5TSS A;  1UNS A;  1LLR D;  2BH8 A;  1XTC D;  2KUM A;  1BQQ T;  2D0O A;  4RCN A;  5CR3 A;  4P2C B;  1SBB B;  1S72 A;  2OTL A;  2RSO A;  4KV6 A;  4JC0 A;  1WOC A;  4DUZ L;  2F3I A;  2K7V A;  3G7L A;  5LMN Q;  5COR A;  1F9P A;  2KCT A;  4FXD A;  1KC8 C;  3MEF A;  3QIA A;  2KEC A;  5E4X A;  1X32 A;  3T1Y L;  5F2D A;  1VDZ A;  1Q81 C;  3OPO A;  1ET6 A;  2JP1 A;  2RA4 A;  1DOK A;  1PYS B;  4KJO A;  4EQ5 A;  4FF4 A;  1KDC A;  1PRT F;  1G2T A;  1N9W A;  3NBH A;  3I4N B;  3AU7 A;  1KDA A;  4OL7 A;  2VZA A;  3S17 H;  3KF8 B;  2DJF C;  3I90 A;  2F0J A;  2E75 C;  2K50 A;  2VXW A;  3S15 B;  3CCL A;  4BWG B;  1LTL A;  2NZO A;  1XNQ L;  3F2U A;  4DU9 A;  1W6J A;  2A74 C;  3T4A C;  4Z9C B;  4FF3 A;  1O80 A;  1RCV D;  3I55 A;  3JAM E;  4CDC C;  5C44 B;  1B70 B;  4OWX B;  2HHH L;  4QF4 A;  1TS3 A;  4IOA A;  1TT2 A;  5ELB A;  3K0Y A;  4K6L A;  3HOV G;  2RF4 A;  1T5E A;  3GV6 A;  1IBM Q;  4A3M G;  3E5S A;  3SXH A;  2ZXR A;  2B2T C;  4CHT B;  4FDB A;  2WV6 D;  1LUZ A;  3TP6 A;  2VUM H;  5IE8 A;  3ULP A;  3IFD A;  1RHP A;  3HOY G;  1PV4 A;  2E2J B;  2CKZ B;  1ENC A;  3T13 A;  2B8F A;  1X54 A;  1LTG D;  4R1J A;  4OHJ A;  4APV A;  4JI0 L;  4X66 Q;  3SVM A;  2WII B;  1UEB A;  1EIY B;  1SE3 A;  1G29 1;  1YJ9 A;  1UAP A;  1E3P A;  4JYA Q;  1XTD A;  3DEP A;  3HOZ B;  1D5M C;  5CYU A;  5IYB H;  4YCW A;  2EOT A;  3URY A;  1HH2 P;  1N8R C;  1EWH A;  3VA5 A;  2EIF A;  5JPM C;  3KF8 A;  2IX3 A;  1EIG A;  2Z1C A;  1KLU D;  2FMC A;  1Q12 A;  4ZUJ A;  1IL2 A;  2B2T A;  1EYD A;  3TZU A;  5C0X J;  1PH2 A;  3CCU A;  4GKJ Q;  3GTK B;  2E2H H;  3L9A X;  3BZK A;  1DCZ A;  4EQN A;  1ENF A;  2QEJ C;  1Q8K A;  3T53 B;  2WAQ G;  4V0B A;  5D14 A;  2KJX A;  1EY0 A;  4TSS A;  4JI7 Q;  3C1F A;  5IP9 G;  1B2T A;  2PZW A;  4GN3 B;  3NQT A;  4ODG A;  3BDO A;  1L1O B;  1JOK A;  1IKL A;  1AH9 A;  1B3Q A;  3FVQ A;  1SYE A;  1G8Z D;  1ESR A;  1FGU A;  1YNX A;  4A3J G;  4GLA C;  3A7L A;  2UXD L;  4L5R C;  1N36 Q;  2A69 D;  1JE5 A;  3MWY W;  4FXG C;  1MJC A;  5EBD A;  1TWC H;  1L1O C;  2EYM A;  4C1N I;  1RTN A;  2OQ0 A;  2NVY B;  3U50 C;  2EZV A;  1DON A;  1R9T H;  3IAY A;  3TZD A;  4LF7 Q;  3FRP B;  4QIW E;  1CSP A;  3CP0 A;  5IY0 A;  1V9P A;  1S5B D;  4BY1 H;  1MIU A;  1PVO A;  3H09 A;  5C4J B;  3HKZ G;  2A8V A;  1JWS D;  4RWS C;  4IFD J;  2AQ2 B;  3PO3 G;  1JE4 A;  1JOQ A;  2B63 H;  5AFW A;  1AN8 A;  4B3M Q;  1HNW L;  1VCI A;  1KLG D;  1PTO D;  3D6W A;  5BN3 A;  1IZ6 A;  5C3E H;  4LF6 Q;  4DN4 M;  1NMG A;  4EVO A;  1B53 A;  2JE6 I;  5T1G A;  3JAM L;  5FJ8 G;  3AEV A;  4A3E B;  1JB3 A;  1IYU A;  1H9S B;  1L1O A;  2PYK A;  5BN5 A;  4HIM A;  2DJG C;  3MZ5 A;  1K83 B;  1HQR D;  4A3D B;  3VYU A;  3AB9 A;  3PF5 A;  1IHZ A;  3P20 A;  4PMB A;  1N33 L;  4C3I H;  2Q2I A;  3I4N G;  3PO2 H;  4Q0F A;  4YHH L;  4LUZ A;  1OXT A;  4A3F H;  5FO9 B;  5K36 G;  4NMZ A;  3W5O A;  5BR8 L;  2N55 A;  1I4X A;  2XSC A;  3H94 A;  1F2Z A;  3HEJ A;  2FXQ A;  3RZO H;  1XWE A;  4A76 A;  2UUA Q;  1MHW C;  1HNZ L;  3RUZ A;  1I5F A;  4K6D A;  1NUC A;  1PH8 A;  2K5D A;  1CA6 A;  2N3S A;  1PYB A;  5LL6 X;  3OOC A;  1VQ5 A;  2A68 C;  1NE3 A;  4JI8 L;  1SND A;  3OHX C;  1STH A;  1VQ9 A;  1PH9 A;  1GKH A;  2K28 A;  1BVS A;  1VQO A;  2GA4 B;  2D0P A;  4DK1 A;  4DV7 L;  4JW0 A;  4B3T L;  3GTP H;  3U4V A;  5EPL A;  4WJW A;  5NUC A;  1EYA A;  1VQI A;  2LS0 1;  4RG1 A;  5L37 A;  3RN2 A;  3G6E A;  1CK1 A;  2FJ2 A;  4YWL A;  2JA5 H;  2I0Q A;  5C0X I;  1VQM A;  2ALY B;  3HG9 A;  1NCV A;  1Y1W H;  4OXP A;  4A93 B;  3AYH B;  1EEF D;  2WP8 J;  3NTH A;  4DR6 L;  4RHS A;  4PMW A;  3ERO A;  2K1B A;  4OO1 I;  5KND A;  2L1B A;  2O4X A;  4YWK A;  1VQP A;  4A3G H;  3FKI B;  3MXG A;  3MTS A;  1YEZ A;  5FLM G;  4NXM Q;  2DY8 A;  1BCP D;  4BY7 B;  1ZXT A;  2K01 A;  2A6H C;  4TQU S;  4DR3 Q;  3G48 A;  5G3L F;  2KEN A;  2EYL A;  1K0S A;  1KTK A;  3LWU A;  2QEX A;  3MHB A;  4DV0 L;  2I5M X;  1E7Z A;  1LTT D;  2Z4H A;  1M90 C;  3PF4 A;  2SNM A;  2LSS A;  3UDI A;  2GN5 A;  4BBS G;  2F0U A;  1GOZ A;  3Q0A A;  2JJQ A;  1B9N A;  5AJ3 L;  3C46 A;  4IFD I;  2AQ1 B;  3BVZ A;  3R8B A;  4C3H B;  2R92 G;  3V05 A;  2L11 A;  3I4O A;  5C4H A;  1O7I A;  1KHI A;  3D6C A;  4NXN Q;  1I3Q H;  1I6H B;  1I4P A;  4LFC Q;  3GTJ H;  1Z9F A;  5LMU L;  4RH6 A;  2B3G A;  1QZH A;  5I2X A;  4KHP L;  4A3L G;  1KRT A;  2AUJ D;  1EWI A;  2BH2 A;  3CRK C;  1EEI D;  1S5C D;  3HKZ E;  1ASZ A;  4DV1 L;  1NTG A;  3K5L A;  2NN6 I;  5BN4 A;  1V8Q A;  1AW7 A;  3ICE A;  3I4M B;  2LXK A;  1B50 A;  4HED A;  2A73 B;  1VQD A;  1C9O A;  4IUP A;  5I9P A;  4DAY A;  4JI1 L;  2LXJ A;  1L0Y B;  1D2B A;  3J80 E;  1ASY A;  3K7A B;  2YTX A;  4C2M H;  3PIP A;  1PH4 A;  3Q23 A;  3KUP A;  5IGD A;  3GV3 A;  4GN5 A;  3BVM A;  1Z6H A;  4Y7N B;  1BDO A;  3PUZ A;  1MSH A;  5M9O A;  5M3M H;  2VL6 A;  1N32 L;  1XMQ L;  1VS0 A;  3NEL A;  3I4L A;  3U4Z A;  2PZU A;  4RA8 A;  4A3B B;  1AE2 A;  3S1N H;  1QCB D;  1U0L A;  4R8I A;  4LW1 A;  4UP7 A;  5JJK A;  1PFM A;  1LAB A;  5I4D A;  3GP7 A;  1NR4 A;  1MBY A;  2PNH A;  3RN5 A;  4QB4 A;  2Q2H A;  5KIX A;  4HJA A;  1XPR A;  1VQ6 A;  2JN4 A;  3OYY A;  1QB5 D;  4KKU A;  3VR5 A;  2F0P A;  4AH6 A;  3MA2 B;  3NWS A;  2O2L D;  1SYG A;  2B2V C;  4NP5 A;  1FJG Q;  5JVH 3;  1Y1V H;  4DR4 Q;  4LF5 Q;  2EY6 A;  2G5D A;  3SDZ A;  2JYO A;  1YJN A;  3OWF A;  3AFP A;  4JI2 Q;  1A0I A;  1GUT A;  2E2D C;  4RGM A;  1NBW A;  4IUU A;  4QMG A;  4QIW B;  3H15 A;  1VQE A;  5FO7 B;  5H1S E;  5C4X G;  1WFQ A;  3I73 A;  1ET9 A;  2CQA A;  5IWA Q;  4GZY C;  1GUG A;  2RKS A;  4DNR B;  4BXX G;  2GVA A;  3M3Y H;  4RMF A;  4L8J A;  1HZB A;  3U58 A;  3VYR A;  5DAU A;  2SNS A;  4K0K L;  1PA6 A;  1SMX A;  4ALP A;  4KN7 C;  4UP9 A;  4K8J A;  1PH5 A;  2B2V A;  3FPU B;  3AQQ A;  5A35 A;  4A3I H;  3S14 B;  5EQ0 A;  3A8J E;  5CMD A;  2F3W A;  2Z8L A;  3RZD H;  1FR3 A;  2LY7 A;  4QUC A;  4DV4 L;  3MXN B;  4A3K H;  5KYL A;  3HOW H;  2VB2 X;  1E2W A;  3DEO A;  4F88 A;  1C8C A;  4JI4 L;  1R4Q B;  1A63 A;  1SJE D;  4XYQ A;  1ONL A;  4C3H G;  3F1Z A;  3PSI A;  2CH4 A;  4JI3 L;  3CU7 A;  3W1B A;  2DGY A;  2JA9 A;  1XJV A;  3G4S A;  1DYQ A;  1F2L A;  4UDU C;  3J80 L;  2R7F A;  4MTK A;  2OEO A;  1VQJ A;  4NB3 A;  5I6W A;  2EJF C;  3S24 A;  3H0G G;  2E74 C;  4S3S A;  3NEM A;  1GUW A;  2JA7 H;  3CMA A;  4LF8 Q;  1KAA A;  4DV2 L;  4GKJ L;  2E76 C;  1EY6 A;  3QJY A;  3SK6 A;  1SN8 A;  2CHB D;  3KK7 A;  4MNO A;  4OIJ A;  5T1I A;  4YY3 Q;  4HR7 B;  1LTB D;  4DXF A;  2B2U C;  5GAG C;  4DR2 L;  1EQQ A;  4HTH A;  1HRJ A;  3GTL H;  3NE5 B;  5KNB A;  2BA0 A;  3IL8 A;  2SOB A;  3FHW A;  3LWE A;  1HZC A;  4B3S L;  1AEX A;  4L63 B;  5EKL A;  3MXU A;  1EQV A;  1PYW D;  1JWM D;  1IBK Q;  3MXN A;  2J4X A;  4X62 Q;  4R4T A;  2VQE Q;  1DZ1 A;  3KF6 B;  2YU9 B;  3HOV B;  2UU9 L;  2YYZ A;  4A3F G;  3K5O A;  1A6X A;  1SRU A;  4KI0 A;  1XNR L;  1A2T A;  2K5V A;  1WI5 A;  1TKW B;  1S4Z A;  3MC0 B;  5C44 H;  1MD2 D;  4DXG A;  4IPD A;  2D62 A;  1HR0 W;  4HJ5 A;  3HOY B;  1NNX A;  1FNU A;  3CPF A;  2BDN A;  3F8T A;  3T56 B;  5IYC H;  4A3B G;  2B29 A;  4UHV A;  1BBU A;  1B8A A;  3PIP 3;  2B2U A;  2A19 A;  4QCL A;  4CJ0 B;  2Q8I B;  2OWO A;  2VQF L;  1PH6 A;  4X64 L;  1HNX Q;  3PCO B;  2R3Z A;  2G9H D;  4WJ4 A;  3SK5 A;  1J8I A;  4EQP A;  1ZYR C;  4YCU A;  4YWM A;  3S16 H;  4B9X A;  4CDD C;  1X3Q A;  2MQH A;  3F2B A;  2L0C A;  1OO9 B;  4ZUI A;  1A3V A;  3M4Y A;  3AMU A;  4OWT B;  3HOZ H;  2TSS A;  3RMH A;  4TRD A;  3EIV A;  2AKW B;  1WYD A;  4N8F A;  2NVQ B;  3KBX A;  2A69 C;  1C4Q A;  1UE5 A;  2VS1 A;  3VA7 A;  4N8X 1;  2E5L L;  2WAQ B;  1E22 A;  4R4O A;  3W1G A;  2A6E D;  3KF6 A;  2PI2 E;  4CKC A;  2ZXP A;  1EFI D;  2Q2T A;  2H5X A;  3C1E A;  2FIN B;  2WKD A;  2UUB L;  4LWC A;  4C1N K;  2UUC Q;  3GTK H;  3FEW X;  4FF2 A;  1YVC A;  1H9J A;  1I4Q A;  1YNN D;  2KCC A;  2WFW A;  2XWJ B;  1O7Y A;  5FKA C;  4A3C H;  3FPP A;  1EWC A;  2NVT B;  2ZJQ A;  2K5W A;  2XRQ D;  3K80 C;  4HMJ A;  1NSN S;  2E2I B;  1PTO C;  5KEE A;  2QIL A;  1S5E D;  5M5Y B;  1BO0 A;  4JI6 Q;  3UI2 A;  3S9W A;  1T9H A;  3J81 L;  4WJ3 M;  4J1M A;  1TS4 A;  4IUQ A;  3HRZ C;  4FYD A;  2KHS A;  1HUN A;  2R93 G;  3HKZ B;  1JOR A;  2K52 A;  1STE A;  1Q7Y C;  4LF4 Q;  1QOH A;  3L7Z C;  3PO3 B;  2UXC L;  2NVY H;  2PW7 A;  4G7O C;  2RCF A;  3CC2 A;  1KL9 A;  1QJO A;  4DV6 Q;  2I46 A;  1CI3 M;  4K5V A;  4O0A A;  4XQN A;  1OXS C;  1F2Y A;  3M4P A;  2JA6 G;  2OT2 A;  2QF7 A;  5EPJ A;  5EPK A;  1EY4 A;  1WCM G;  5ELO A;  1VQH A;  1A62 A;  2KVM A;  1K73 C;  1SMY D;  3BU2 A;  3R2T A;  1ZEQ X;  4Q5V A;  4OIK A;  1Y14 B;  1CZG A;  3M4O H;  5ELE A;  2X6L A;  4EX5 A;  5FLX E;  3K0X A;  4G4K A;  1MI2 A;  4X65 Q;  4GLV B;  1S3O A;  2HDL A;  1D5Z C;  1K8M A;  1NR2 A;  2PMZ E;  3NP8 A;  1GD7 A;  1SE2 A;  1I6V C;  3CCV A;  5J39 A;  4XQJ A;  1I94 Q;  4UAI A;  1FNW A;  3HOU G;  3CRL C;  3QG1 A; 
#chains in the Genus database with same CATH homology
 4DR6 Q;  1B7Y B;  1HZA A;  5K36 G;  3W5O A;  5BR8 L;  4JI6 L;  4OX9 L;  1X9N A;  5HY6 A;  3B6Y A;  2Y0S G;  3WWV A;  1X56 A;  4GNX B;  3TS2 A;  1FL0 A;  2FXQ A;  3M85 A;  4NPS A;  3STB D;  4A76 A;  3GTM H;  3RZO H;  2AMC B;  2UUA Q;  1CKM A;  1Q1E A;  3UDF A;  4LF4 L;  3KJP A;  1C7Y A;  1HNZ L;  4LF7 L;  1TWA H;  1C0A A;  1I5F A;  3KYH C;  1RL2 A;  2XTI A;  1Q1B A;  3T1H Q;  4GN4 B;  4LFA Q;  1YIT A;  4GKK L;  4PZ8 A;  4DV6 L;  3EBE A;  1QUQ B;  1PH8 A;  3HOY H;  4PG3 A;  4QJF A;  2N3S A;  3RLN A;  1PYB A;  1VQG A;  4POF A;  2UXB Q;  4GNX C;  1X65 A;  3CW2 C;  1VQ5 A;  1GVP A;  4AYB E;  1NE3 A;  4JI8 L;  3IRB A;  4DV0 Q;  4GOP B;  4B3M L;  1M1K C;  1VQ9 A;  2E2J H;  3TRE A;  1VQK A;  1PH9 A;  1GKH A;  2ZTD A;  3DM3 A;  1BVS A;  4LF6 L;  4AQY L;  1VQO A;  2AHO B;  2D0P A;  1IBL Q;  2ID0 A;  4DV7 L;  2N8N A;  4B3T L;  5ELN A;  3CPW A;  3GTP H;  5AJ3 Q;  4DAM A;  3U4V A;  1HR0 Q;  4GOP C;  3CXC A;  4X65 L;  3KJO A;  2ATW A;  1YJW A;  1YZ6 A;  2K14 A;  1VQI A;  4IJH A;  3L2P A;  1YHQ A;  2JA8 H;  4RG1 A;  4ME3 A;  3RN2 A;  1H95 A;  4DKA C;  3G6E A;  2F52 A;  2NVQ H;  2HQL A;  4YWL A;  4HIO A;  2JA5 H;  2I0Q A;  4B3R Q;  5C0X I;  1VQM A;  1I94 L;  2JA5 G;  4JI5 Q;  2ALY B;  1Y1W H;  4OXP A;  5LMU Q;  1BBW A;  3AYH B;  4GNX A;  1Y1W G;  1QVF A;  2WP8 J;  4DR6 L;  5C0X G;  4PMW A;  4PZ6 A;  2CQO A;  4KHP Q;  4OO1 I;  4JCV E;  1E1O A;  1EUJ A;  4XTC S;  2N78 A;  4YWK A;  1VQP A;  3KDF B;  4A3G H;  5JEA J;  3J81 c;  4A3G G;  3CCJ A;  4A93 G;  4OO1 G;  1JJG A;  5FLM H;  4DV1 Q;  5M3F H;  2UUA L;  4JV5 Q;  1YEZ A;  2KHJ A;  5FLM G;  5M3F G;  4OWW B;  1K9M C;  1QUQ A;  2A1A A;  3JC6 6;  4NXM Q;  1XPU A;  3J7Z C;  3FKI H;  3PV0 A;  2NVT H;  3FKI G;  5JEA G;  3T1H L;  4TQU S;  1YBY A;  4DR3 Q;  3G48 A;  4LFA L;  1K0R A;  4GOP A;  3S2H H;  3PIO A;  2KEN A;  5IP7 H;  4BY7 H;  2E8G A;  2UXB L;  4JI1 Q;  5IP7 G;  4BY7 G;  2ZM6 Q;  2VY3 A;  5M5Y H;  2AWO A;  2QEX A;  5LMN W;  3KLW A;  2GVB A;  2I5M X;  1UE1 A;  3I2Z A;  4DV0 L;  1E7Z A;  3J7A 5;  1K3R A;  4GS3 A;  1M90 C;  3ER0 A;  1N34 Q;  3PF4 A;  1E24 A;  2LSS A;  2GN5 A;  3A74 A;  3UDI A;  4BBS H;  4BBS G;  4QL5 A;  2R7Z H;  1CSQ A;  4JBJ A;  2R7Z G;  2JJQ A;  2RHQ B;  2WB1 E;  3ERS X;  3PUW A;  2ZTC A;  4L5Q A;  4DV5 Q;  1IBL L;  1XMQ Q;  3JAM c;  2JK8 A;  1UE6 A;  5C4J H;  3D0F A;  5AJ3 L;  1VQB A;  4IFD I;  1A8V A;  1KAW A;  1HR0 L;  3S2D H;  1JT8 A;  2R92 H;  3VDY A;  4L5S A;  2R92 G;  1VQ7 A;  3I4O A;  4IFD G;  1O7I A;  1KHI A;  1GM5 A;  3J81 i;  4DR1 Q;  2XGT A;  4NXN Q;  4TVA B;  1I3Q H;  2HIV A;  3CCE A;  4B3R L;  4LFC Q;  3PUY A;  3STB C;  4IPC A;  4JI5 L;  3ULL A;  1Z9F A;  3GTJ H;  4BA2 I;  4P72 A;  1AE3 A;  3D31 A;  3KDF A;  2B3G A;  3PUX A;  5LMU L;  4DUY Q;  4LUO A;  1QZH A;  4A3L H;  1OXU A;  4A3E H;  4KHP L;  4A3L G;  5EAY A;  1KRT A;  1VQF A;  2HIX A;  2OCE A;  1EWI A;  2BH2 A;  2OQK A;  3HKZ E;  3RR5 A;  1K83 H;  4DV1 L;  1ASZ A;  1NTG A;  4JV5 L;  2IX0 A;  1X55 A;  4A3D H;  3L0O A;  2NN6 I;  2K5H A;  4UP8 A;  1VQL A;  4LF9 Q;  4NXM L;  4J15 A;  2JA7 G;  1RIP A;  4C3J H;  3ICE A;  2LXK A;  1K8A C;  1VQD A;  4DR3 L;  4DR5 Q;  1XMO Q;  2NN6 G;  1C9O A;  1X3E A;  3GD7 A;  1J6Q A;  4JI1 L;  2LXJ A;  3I4M H;  2ZM6 L;  4DR7 Q;  1TWF H;  3JAM i;  3A5Z B;  3I4M G;  1ASY A;  1IYJ B;  2KCM A;  1KD1 C;  2YTX A;  4C2M H;  3PIP A;  4A4I A;  1J5E Q;  3EN2 A;  1QZG A;  4H02 A;  1PH4 A;  4X6A H;  2NVX H;  1N34 L;  3TQY A;  3K7A H;  3RNU A;  1QVG A;  2ASB A;  2PQA B;  3DLL A;  4GN5 A;  3HKS A;  3PUZ A;  4DV5 L;  5M3M H;  2VL6 A;  1N32 L;  3OTO Q;  5M3M G;  1XMQ L;  4K0K Q;  4JOI C;  1VS0 A;  3NEL A;  1U5K A;  1YI2 A;  3U4Z A;  4HJ8 A;  3K81 C;  1WJJ A;  3ZJY C;  3CME A;  1NY4 A;  1E1T A;  2IHE A;  1EFW A;  1AE2 A;  2K5N A;  3S1N H;  4AIM A;  1U0L A;  1TWG H;  4LW1 A;  3TS0 A;  4DR1 L;  4UP7 A;  5JJK A;  4NXN L;  5GAH C;  1SFO H;  4JBK A;  1JB7 A;  1V43 A;  3CC7 A;  2Y0S E;  4LFC L;  2PNH A;  3RN5 A;  3RLO A;  1PH3 A;  2Q2H A;  4DV4 Q;  5J3B A;  2MO0 A;  4DUY L;  4LFB Q;  1EIF A;  4HJA A;  4A75 A;  1XPR A;  4UPA A;  1VQ6 A;  3OYY A;  1EOV A;  3CQZ H;  1LM0 A;  1PHJ A;  1PH7 A;  2CFM A;  3M7N A;  4AH6 A;  3CC4 A;  4JI4 Q;  4IPH A;  1HJP A;  4DUZ Q;  5IT9 c;  3GTO H;  3Q8D A;  4JI3 Q;  1GO3 E;  1UE7 A;  4LF9 L;  1Y1V H;  1CKO A;  2AWN A;  1FJG Q;  1DGS A;  4DR4 Q;  1Y1V G;  3AFQ A;  4LF5 Q;  3KFU A;  4JOI A;  2YTY A;  4GLX A;  2F4V Q;  1VQC A;  4DR5 L;  1YJN A;  1XMO L;  1SRO A;  4QQB X;  3AFP A;  4JI2 Q;  4P71 A;  1A0I A;  4A93 H;  3T1Y Q;  4DR7 L;  2KBN A;  1NBW A;  4OON A;  3H15 A;  5C4X H;  4IOC A;  1VQE A;  5H1S E;  1J5E L;  5C4X G;  1WFQ A;  3E9I A;  2PQA A;  3F2C A;  4BBR G;  2JEB I;  5IWA Q;  4DV2 Q;  3UDG A;  4BXX H;  2R7D A;  2L15 A;  4BXX G;  2GVA A;  1KQS A;  3M3Y H;  4P74 A;  2VNU D;  4RMF A;  5FLX c;  1HZB A;  3U58 A;  2NZH A;  3E9H A;  3KOJ A;  4DV3 Q;  4DR2 Q;  3OTO L;  1CKN B;  1TWH H;  4K0K L;  1PA6 A;  1MJE A;  4DPG A;  1SMX A;  2CWA A;  4ALP A;  1XPO A;  3HOX H;  3K7U C;  3LGJ A;  4UP9 A;  4DAY B;  3CCR A;  2V1C C;  4HJ9 A;  3HOX G;  1PH5 A;  1I50 H;  3NBH B;  2QGQ A;  3AQQ A;  4A3I H;  4B3S Q;  3GTG H;  3S1R H;  4A3I G;  1PH1 A;  1XNQ Q;  1UWV A;  1IXR A;  1VQA A;  2I5L X;  1CUK A;  2K75 A;  2EXD A;  4KHZ A;  3RZD H;  1N32 Q;  5IYD H;  3PUV A;  2UU9 Q;  3GDE A;  5IYD G;  4DV4 L;  2MNA A;  5GAE C;  2YV5 A;  3MXN B;  4A3K H;  2HHH Q;  1XNR Q;  3H3V I;  3HOW H;  4Y52 H;  3UDX A;  4A3K G;  1JJ2 A;  4LFB L;  4YCV A;  3HOW G;  4XIG S;  3M4Q A;  3H3V H;  1SE8 A;  1EQR A;  4L5T A;  2R6G A;  4DNI A;  2BH8 A;  1KRS A;  2ES2 A;  2D0O A;  2OTL A;  1S72 A;  4C3H H;  4JI4 L;  3TEH B;  4JC0 A;  2IY5 B;  1A63 A;  1WOC A;  3F1Z A;  4DUZ L;  2F3I A;  3PSI A;  5M5X H;  4JI3 L;  5LMN Q;  2RHS B;  1LYL A;  3RLF A;  5GQO A;  2KCT A;  1FJG L;  1I6H H;  4DR4 L;  1KC8 C;  3W1B A;  4LF5 L;  2Z0S A;  3I7F A;  2DGY A;  3MEF A;  2JA9 A;  1XJV A;  3NEN A;  3G4S A;  4UY8 C;  2F4V L;  1D8L A;  4JI2 L;  2R7F A;  2YTV A;  1L0W A;  2VQF Q;  2ZJP A;  4X64 Q;  3CCM A;  3CAM A;  1NJI C;  2RCN A;  4JI0 Q;  3T1Y L;  1Q81 C;  1VQJ A;  4NB3 A;  1P8L A;  3OW2 A;  3H0G H;  4R4I A;  1X6O A;  3S24 A;  3H0G G;  5DLQ E;  3NEM A;  2JA7 H;  3SGI A;  1G51 A;  2MFI A;  3CMA A;  4LF8 Q;  5IWA L;  4DV2 L;  4GKJ L;  3CD6 A;  1PYS B;  1CKN A;  2CWP A;  4EQ5 A;  1SN8 A;  4MNO A;  4YY3 Q;  1JJC B;  4PZ7 A;  1N9W A;  2DUD A;  2VW9 A;  5GAG C;  4DV3 L;  4DR2 L;  3A5U A;  1EQQ A;  3GTL H;  2E5L Q;  4JG2 A;  2VZA A;  3S17 H;  2BA0 A;  3KF8 B;  1TXY A;  3FHW A;  4IJL A;  2K50 A;  1D7Q A;  3F2D A;  1HZC A;  3CCL A;  4B3S L;  1LTL A;  2NZO A;  1XNQ L;  1IBK Q;  5JJL A;  4X62 Q;  5GRO A;  4DK6 C;  2UUB Q;  4R4T A;  2VQE Q;  2ZJR A;  3KF6 B;  3I55 A;  1W3S A;  1B70 B;  2UU9 L;  2YYZ A;  4OWX B;  4A3F G;  2HHH L;  3FP9 A;  1SRU A;  4KI0 A;  1XNR L;  2K5V A;  4Y7N H;  4R4Q A;  2IX1 A;  1WI5 A;  2IHF A;  4IOA A;  2YU9 H;  3HOV H;  5C44 H;  4A3M H;  3E0E A;  4IPD A;  2RF4 A;  5C44 G;  1IBM Q;  3HOV G;  4A3M G;  2D62 A;  1HR0 W;  4HJ5 A;  4QGU A;  1SR3 A;  2UXD Q;  3CPF A;  5HGQ A;  4A3B H;  3F8T A;  4FDB A;  5IYC H;  3G71 A;  4A3B G;  1LUZ A;  1YHB A;  2B29 A;  1SLJ A;  3A0J A;  2JQO A;  5IYC G;  5LMN L;  1EYG A;  3M9B A;  5IE8 A;  1BBU A;  1B8A A;  3ULP A;  2JEA I;  2VUM H;  2VUM G;  3HOY G;  1PV4 A;  2A19 A;  2CKZ B;  5GAD C;  3K8A A;  2N49 A;  1Q82 C;  1X54 A;  4R1J A;  2OWO A;  2VQF L;  1PH6 A;  4APV A;  4X64 L;  3CCS A;  1HNX Q;  4JI0 L;  3PCO B;  4X66 Q;  2C35 B;  1UEB A;  4MTN A;  1EIY B;  4HJ7 A;  1G29 1;  2UXC Q;  1YJ9 A;  4WJ4 A;  4YCU A;  4YWM A;  2IT1 A;  1E3P A;  4JYA Q;  3S16 H;  1XTD A;  2MQH A;  3F2B A;  5IYB H;  4LF8 L;  4YCW A;  5IYB G;  1G6P A;  1HH2 P;  4OWT B;  1N8R C;  3HOZ H;  2EIF A;  1OXX K;  4YY3 L;  1HNW Q;  1KXL A;  3HOZ G;  1VQN A;  4IO9 A;  3EIV A;  2AKW B;  1WYD A;  4MZ9 A;  4P75 A;  1UE5 A;  2VS1 A;  1OXV A;  2E5L L;  1Q12 A;  1IL2 A;  4BBR H;  1E22 A;  4R4O A;  5C0X J;  2JA8 G;  3W1G A;  1OTC A;  1FVI A;  1PH2 A;  3CCU A;  3KF6 A;  2PI2 E;  4GKJ Q;  2E2H H;  3J81 j;  3BZK A;  1Q8K A;  1IBK L;  4X62 L;  2CCZ A;  2I5H A;  2WAQ G;  4JBW A;  2Q2T A;  2H5X A;  5IP9 H;  2UUB L;  2VQE L;  4JI7 Q;  4LWC A;  2UUC Q;  3GTK H;  5IP9 G;  4LNQ A;  4DK3 C;  2OTJ A;  1YVC A;  4GN3 B;  2EQS A;  2WB1 G;  5JJI A;  1L1O B;  2PI2 A;  1AH9 A;  2WFW A;  3S1M H;  4A3J H;  4A3C H;  1N33 Q;  1YNX A;  1FGU A;  4A3J G;  1VQ8 A;  1YIJ A;  4GLA C;  2ZJQ A;  3S1Q H;  1IBM L;  3HFZ B;  3K80 C;  5E7N A;  4A3C G;  2UXD L;  4YHH Q;  4L5R C;  1QVC A;  1VQ4 A;  1N36 Q;  3BZC A;  4QY7 A;  1NMF A;  3S14 H;  3UE0 A;  5BR8 Q;  1JE5 A;  4JI6 Q;  4KLK A;  4OX9 Q;  1T9H A;  4WJ3 M;  2E2I H;  2ZTE A;  1MJC A;  1TWC H;  3CF5 A;  1L1O C;  4P73 A;  1W2B A;  3UE1 A;  2HT1 A;  4O2D A;  2OQ0 A;  3U50 C;  2R93 H;  1R9T H;  2R93 G;  2K4K A;  2K52 A;  3J80 c;  1L2F A;  1Q7Y C;  1HNX L;  4X66 L;  4LF4 Q;  4LF7 Q;  1HNZ Q;  4QIW E;  1CSP A;  3L7Z C;  1MKH A;  3CP0 A;  5IY0 A;  2UXC L;  2NVY H;  1V9P A;  4BY1 H;  3CCQ A;  2WAQ E;  1MIU A;  4BY1 G;  4BA1 I;  4JBM A;  4GKK Q;  3ULJ A;  3CC2 A;  1KL9 A;  4JYA L;  2Z6K C;  4DV6 Q;  3HKZ G;  1PVO A;  4O0A A;  2JA6 H;  3GO5 A;  2A8V A;  1OXS C;  3PO3 H;  3M4P A;  2JA6 G;  4POG A;  4IFD J;  1S40 A;  3PO3 G;  1WCM H;  1JMC A;  2B63 H;  4JI8 Q;  4B3M Q;  1WCM G;  2B63 G;  5ELO A;  1X3G A;  1VQH A;  1VCI A;  1HNW L;  1A62 A;  1IZ6 A;  1P16 A;  1K73 C;  1HZ9 A;  1Q46 A;  5C3E H;  3BU2 A;  4LF6 Q;  4IPG A;  5C3E G;  4AQY Q;  1NMG A;  3GTQ H;  3BJU A;  1BKB A;  4LUV A;  5FJ8 H;  2JE6 I;  1Y14 B;  1Z47 A;  3M4O H;  5FJ8 G;  4DV7 Q;  3AEV A;  4HIK A;  4B3T Q;  4EX5 A;  4HID A;  4R4C A;  1Q86 C;  1L1O A;  3K0X A;  1KIX A;  2Q2U A;  4JI7 L;  4HIM A;  1V1Q A;  2UUC L;  2MO1 A;  4X65 Q;  1PFS A;  4GLV B;  1X3F A;  1YHA A;  4A3E G;  1K8G A;  2KHI A;  1S3O A;  3I56 A;  2PMZ E;  3PGZ A;  3PF5 A;  4AYB G;  1N33 L;  1GD7 A;  5M5W H;  4C3I H;  3I4N H;  2Q2I A;  2Z6K A;  3CCV A;  3I4N G;  3J80 i;  1I94 Q;  3HOU H;  3PO2 H;  3TRZ A;  4YHH L;  4LUZ A;  3HOU G;  2BA1 A;  1N36 L;  1OXT A;  2QA4 A;  3PO2 G;  3S15 H;  4A3D G;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...