3E0EA

Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
91
Chain Sequence
b'MNYKISELMPNLSGTINAEVVTAYPKKEFSTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGGLEISVDNIGIIEKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A
publication title Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
rcsb
source organism Methanococcus maripaludis
molecule tags Replication
total genus 22
structure length 91
sequence length 97
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3e0eA00
2UUBQ 3OYYA 3BZKA 1OXUA 4POGA 3PUYA 3TQYA 4IO9A 5IYCG 1YHQA 3PO3H 3NEMA 1VQLA 2YV5A 2K5VA 4JOIC 3HFZB 3G6EA 4DV3Q 4A3CH 1NBWA 1XJVA 1P8LA 2K14A 3HOUH 3CPWA 1Y1VG 5DLQE 1IBKQ 3PO2G 2B29A 4C3JH 3M9BA 2EQSA 4AIMA 3KF6A 2N3SA 1PH4A 3GTPH 1E22A 4GNXC 4A3EH 1PHJA 3STBC 4BY7G 4HIDA 4JI2L 3FP9A 4K0KQ 1YEZA 4JG2A 4QQBX 4GLXA 1N32Q 2E2JH 3T1HQ 1W2BA 1X55A 4O0AA 5FLXc 4DR3Q 4B3SL 2JA8H 3PIPA 4BA2I 4JI8Q 3TEHB 4DUZQ 2UU9Q 5IWAL 2Z6KA 4JBJA 1N33L 1CUKA 2K5NA 1EQQA 4NXNL 5C3EH 2AMCB 4DV2Q 3L2PA 3CCSA 2H5XA 1WJJA 2NN6G 3L7ZC 1DGSA 3PV0A 3ZJYC 3CC7A 5LMNW 4A3GH 5LMUQ 5M5XH 3BZCA 1JMCA 1OXVA 2F4VQ 2ID0A 4QY7A 1BBWA 1QVGA 4JI6Q 1C0AA 2ALYB 1EFWA 2VY3A 4L5RC 5LMNL 4GKKL 2WB1E 4DUYL 3F8TA 4LF7L 2UUBL 2NZOA 2R92H 1PH8A 1E1TA 4JOIA 4A3DH 3NELA 3K0XA 2HHHQ 1VQBA 2MQHA 4DAYB 2R93G 4X66Q 4WJ4A 1CKNA 1PH7A 2BH8A 1LYLA 2WAQE 2JA7H 5M5WH 3CCVA 2JA5G 3E9HA 4GNXA 1IXRA 1VQ6A 1XNQL 2B63H 3ULLA 1JJ2A 2ZJPA 2E5LL 2WP8J 3HOWH 4JI7L 4PZ7A 4PZ8A 5ELNA 3HOYH 1EOVA 2VL6A 2Q2TA 3GTGH 3KLWA 1XPUA 1UE1A 2HIVA 4QGUA 2JJQA 3ERSX 4DAMA 4PZ6A 3K7UC 4BBRG 4DUZL 2F3IA 4JBWA 4OX9L 2YTYA 1PVOA 3B6YA 3CCRA 2UXCL 2GVBA 3EN2A 4YCWA 4A3BG 4DK3C 4DNIA 3AFPA 3EBEA 1TWFH 4LF8Q 2YTXA 4P74A 5IT9c 3I4MH 1Q8KA 4YHHQ 4X62Q 1PYBA 4LFCL 1Z9FA 1EIYB 1W3SA 4JC0A 2K52A 1I50H 4IJHA 3OTOQ 3ULJA 2YU9H 1QZGA 4A3IG 1U5KA 5FJ8G 4OXPA 2Y0SG 3S2DH 2ZTDA 4JV5L 3M4QA 4QIWE 1IBLL 3MXNB 2E2IH 1M90C 1EYGA 3JAMc 3CMAA 4LFBL 3STBD 2VUMG 3H15A 2IHFA 4EQ5A 5IYDH 3RN5A 3DM3A 1VQKA 5E7NA 3S17H 1HZAA 2VZAA 3J81j 3CCUA 1ASZA 2OWOA 2NVQH 2RCNA 3S1MH 2OQ0A 1XMOL 2JA6H 2HIXA 1GO3E 3PO3G 1A63A 3UE1A 1SLJA 4JI2Q 3CAMA 1NMGA 1XTDA 2ZTCA 1ASYA 3CP0A 3UE0A 1WCMH 1Y1WH 2Q2UA 4A3CG 3GD7A 1UE5A 1YZ6A 1VQNA 3HOUG 1YHBA 4A3KH 4DR1L 4GOPB 1KC8C 4B3SQ 4AQYL 1MJEA 3J80c 1K83H 1HR0W 5IWAQ 1UE7A 2KHJA 2UXDL 1N33Q 4A3EG 4HJ5A 1NJIC 1BBUA 1JT8A 1OXSC 4RMFA 4LF6L 2AWOA 4NXNQ 3S2HH 1IL2A 4JI1L 2BA0A 2CWPA 4YCUA 1S40A 1Z47A 3CPFA 4IPGA 1HR0L 4DV7L 5ELOA 3U4ZA 5GAHC 2JA8G 4LNQA 2QGQA 1VQCA 3RN2A 5LMNQ 1MJCA 4GKKQ 4DUYQ 1WYDA 4LF7Q 2YYZA 1IYJB 4LWCA 3D31A 5IP7H 5C3EG 2PNHA 1E1OA 1N8RC 4HIKA 4A3GG 4MZ9A 3IRBA 3HKZE 1PA6A 4B3MQ 1PH5A 1QVCA 2KBNA 1C9OA 5M3MH 1V9PA 3PGZA 2RHQB 4Y7NH 1VQOA 5FLMH 3G71A 3KF6B 1K8GA 4GLAC 2K4KA 1I94Q 2D0OA 1XNQQ 2R92G 3HOXH 4LUZA 2OTJA 2KCTA 5C44H 3ICEA 4A3DG 2E5LQ 4DV5L 3RNUA 3KFUA 5C0XI 1SN8A 4JI7Q 3KOJA 1VQPA 5IE8A 3I4OA 3T1YL 4B3TL 4J15A 4PMWA 4UY8C 3H0GH 5C0XJ 5EAYA 2JA7G 1WI5A 2IT1A 4UP9A 2UUCL 4H02A 2B63G 4LF4L 1Q82C 4OX9Q 1NE3A 1I3QH 1OXXK 2UXCQ 4AYBE 2I5MX 3CCQA 1JB7A 4GLVB 2ZTEA 1I5FA 1VQ7A 3HOWG 4IOCA 4UP8A 3W1GA 3HOYG 1HZCA 1D7QA 1YNXA 4DR5L 2A1AA 2UUAL 1AE3A 1D8LA 2VS1A 4LUVA 4A3MH 1KAWA 3K80C 1EUJA 4LFCQ 4LW1A 3K7AH 3PSIA 2D62A 4AH6A 4DV6L 1N34L 1R9TH 4LF5L 1A62A 1HZ9A 2VQFL 1QUQA 4GS3A 3UDXA 3KJOA 3WWVA 3HOVH 4UP7A 4OO1I 3PUZA 4JV5Q 1A8VA 5C0XG 4QL5A 5GQOA 2OCEA 4BXXH 4PG3A 1KRTA 1CKNB 1HH2P 4MTNA 4KHZA 4DR7L 3I4MG 4LFBQ 2BA1A 4B3ML 3LGJA 1X9NA 4LUOA 2VQEL 4GNXB 1PYSB 4C3IH 3FKIH 1LTLA 1VS0A 1VQDA 5GAEC 1VQJA 1A0IA 2IY5B 1GM5A 2JA9A 1I94L 2IX1A 1XMOQ 4R4QA 1EIFA 1FL0A 4GN5A 1PH6A 1X6OA 3I4NH 5C4XH 3A5UA 3AYHB 2MO0A 4JI5L 1XPOA 4NPSA 1XNRL 5IYDG 4DR1Q 2E8GA 3F1ZA 4AQYQ 5J3BA 3Q8DA 2NZHA 4X6AH 3GTOH 3CC2A 2UXDQ 4A93H 1TWAH 2JA6G 3J7A5 1E3PA 3ER0A 1K8AC 4BBSH 1NMFA 2QA4A 4LF6Q 3FHWA 1VQ9A 2NVXH 4JI1Q 3RLOA 1KD1C 2PQAA 1YVCA 1WCMG 1Y1WG 4DV4L 4A3KG 1YHAA 3KDFA 4DV7Q 2MNAA 1HR0Q 2VNUD 1G291 1E7ZA 3PF4A 4OWTB 4C3HH 4GN4B 1JJGA 4IFDI 1K73C 5JJLA 2R6GA 1K0RA 4A3FH 4A3LH 4BA1I 3S1RH 2PI2E 2I5LX 2XTIA 1MKHA 2ZJRA 1B70B 1GVPA 2R7DA 3PUVA 3UDFA 1XPRA 3NBHB 1FJGQ 1IBMQ 1X54A 2OTLA 1K3RA 1Q1EA 4GKJL 2DGYA 1OTCA 1SROA 4YY3L 1CSPA 4XTCS 1Q1BA 3U4VA 5GAGC 3J81i 4LF9Q 4JI4L 1C7YA 3PIOA 4R1JA 5IP7G 3AEVA 3TRZA 2K5HA 4DV5Q 1L0WA 1L1OC 1WFQA 5M3FH 1E24A 3L0OA 3PUWA 3T1YQ 4B3TQ 1CSQA 4POFA 5M3MG 5FLMG 2BH2A 1YJNA 1X56A 3I55A 3GTKH 1QVFA 2UUCQ 3HOXG 2A8VA 2JEBI 5C44G 2QEXA 2LXKA 5JEAJ 2R7ZH 1LM0A 2F52A 3J80i 4IPHA 4YCVA 4DR5Q 2UUAQ 1UE6A 4HJAA 1VQFA 3H0GG 2UXBL 1FVIA 1S72A 4A4IA 2N49A 3A74A 1YIJA 1HZBA 1Q46A 4O2DA 1X65A 3NENA 4P75A 2JQOA 4OWXB 3M4OH 1NTGA 1TWCH 1YJWA 4KLKA 2L15A 4B3RL 1HNWL 4DV6Q 4HIMA 1N34Q 2LXJA 3PF5A 2VQFQ 4LF5Q 3U50C 1VQMA 3S1NH 3TS0A 3KJPA 2OQKA 1KRSA 4JBKA 4DK6C 4EX5A 4JYAL 4YWKA 4RG1A 3H3VI 3GTQH 1SMXA 4DR7Q 4YWMA 1IBML 3KYHC 1FJGL 1X3EA 4FDBA 4KHPL 1IZ6A 4A3MG 1RIPA 1WOCA 1LUZA 2VQEQ 5IYBH 3CQZH 2CQOA 4JI0L 2DUDA 2CCZA 4LF9L 2Z6KC 1SR3A 5JEAG 3HOVG 3S16H 4IPCA 4OONA 3GO5A 1L1OA 4P73A 3GTJH 2D0PA 4BXXG 3BU2A 2ZM6L 5HY6A 4TQUS 3CF5A 2IHEA 3J7ZC 2PMZE 3F2CA 4JI5Q 3SGIA 4A3JH 1BVSA 1XNRQ 5IP9H 3FKIG 2AHOB 4IPDA 1FGUA 2WB1G 4X64L 2GVAA 4HJ9A 3BJUA 2MFIA 3A5ZB 2NN6I 3UDIA 4DR6L 2FXQA 2I5HA 4HIOA 3CC4A 4DR4L 3I4NG 1O7IA 5C4XG 1GKHA 3CCLA 4NXML 4DV4Q 5C4JH 2WAQG 1N36L 1VQ8A 1KHIA 2R7FA 2NVYH 1Q81C 3EIVA 3MEFA 4A75A 3M4PA 1QUQB 2JE6I 4R4OA 4A93G 1HJPA 5AJ3Q 4GN3B 4R4IA 1Q12A 1QZHA 5BR8L 1KQSA 4BBSG 1N9WA 4P71A 1S3OA 4X65Q 4DR2L 3F2BA 2NVTH 1HNZL 4GKJQ 4JI3L 3S24A 4R4CA 4YY3Q 3E0EA 3HOZH 1G51A 4DV0L 1AE2A 4BY1H 3CD6A 1J5EL 1VCIA 2KCMA 2N8NA 4JI4Q 2CFMA 2IX0A 3CXCA 4JBMA 2MO1A 4A3FG 4A3LG 1KXLA 4NB3A 1PH2A 5IYCH 3RLNA 4DV1Q 1SRUA 3M7NA 4IJLA 5IY0A 2EXDA 2WFWA 1PH9A 5JJIA 3GTMH 4L5TA 4UPAA 3H3VH 1Y1VH 3DLLA 3RZOH 1PH3A 2E2HH 3PO2H 3E9IA 1Q7YC 2ZJQA 4APVA 1Q86C 1SFOH 2Q2HA 4ME3A 4BY7H 1B7YB 3ULPA 3CMEA 2PQAB 3PCOB 3JC66 4DV3L 5M3FG 4OO1G 4L5QA 4DPGA 3GTLH 1BKBA 3KDFB 2V1CC 1EWIA 4MNOA 5M5YH 2Z0SA 2UXBQ 4Y52H 3HKSA 3W1BA 3CCMA 4LFAQ 4A76A 1IBKL 1IBLQ 3CCEA 3UDGA 4LF4Q 5K36G 2N78A 1B8AA 1VQIA 1VQ4A 4B3RQ 2YTVA 1HNWQ 4JCVE 5GROA 4HJ8A 3RR5A 5AJ3L 1XMQQ 2ATWA 4K0KL 2EIFA 2R7ZG 4C2MH 4JYAQ 1N32L 1VQ5A 3W5OA 3T1HL 4IFDJ 4X65L 3AFQA 1GD7A 4HJ7A 3VDYA 2HQLA 4KHPQ 4DR3L 5JJKA 4YWLA 4TVAB 1JJCB 1VQGA 4R4TA 5H1SE 1YJ9A 1PV4A 4JI8L 2UU9L 1L2FA 2KHIA 4JI0Q 1T9HA 4GOPC 3G48A 3K81C 1V43A 4QJFA 1CKOA 1TWHH 1X3FA 3JAMi 2HT1A 1KL9A 4DV2L 1EQRA 3RZDH 4DV1L 1JE5A 2VW9A 5LMUL 2ZM6Q 2R93H 1HNXQ 1CKMA 5HGQA 2F4VL 1P16A 3S1QH 4JI6L 1V1QA 5IYBG 2CKZB 3CCJA 1UEBA 2JA5H 3I2ZA 3TS2A 1RL2A 2ES2A 4X64Q 4P72A 3J81c 1H95A 2AWNA 4DKAC 1MIUA 4IFDG 2I0QA 4DR6Q 1SE8A 3KF8B 3S15H 2HHHL 2GN5A 4DR4Q 2C35B 2ASBA 2JEAI 3I7FA 3HKZG 4X66L 1KIXA 4NXMQ 1TXYA 4KI0A 3G4SA 3F2DA 2JK8A 2KENA 4A3JG 5GADC 1N36Q 3GDEA 5IP9G 1X3GA 4LFAL 4OWWB 3S14H 4BBRH 2XGTA 3A0JA 3RLFA 4IOAA 3CW2C 3D0FA 3K8AA 4A3BH 2AKWB 1TWGH 3OW2A 1OXTA 5BR8Q 4L5SA 2LSSA 1YITA 1XMQL 2Y0SE 2K75A 4DR2Q 4ALPA 2RF4A 1PH1A 3PUXA 1YI2A 3M85A 1HNZQ 1I6HH 4JI3Q 1VQEA 1NY4A 1UWVA 4DV0Q 1YBYA 2B3GA 4GOPA 1J5EQ 3I56A 3TREA 2CWAA 1G6PA 1J6QA 2RHSB 4A3IH 5FJ8H 1L1OB 4AYBG 3M3YH 2PI2A 3AQQA 3U58A 4XIGS 4LF8L 1U0LA 1M1KC 1VQHA 2K50A 4YHHL 1Y14B 2Q2IA 4X62L 1VQAA 2VUMH 1HNXL 3HOZG 4WJ3M 1AH9A 1PFSA 4BY1G 1K9MC 2A19A 3OTOL
chains in the Genus database with same CATH superfamily
1MGSA 5FLXL 3OYYA 3NWSA 4IO9A 1F2LA 2NZ1D 2K5VA 1PRTB 2EYOA 3EVQA 1NBWA 3EROA 1P8LA 1F9QA 3HOUH 3MAQA 3OWFA 3M4OB 3NUCA 2QCPX 1PH4A 4RGOS 3S1NB 1E22A 4GNXC 2XWBB 1LT4D 3STBC 1AN8A 1LTGD 1EQTA 4DXGA 4K0KQ 4QQBX 1LTBD 4GLXA 1N32Q 1EYDA 3T1HQ 1W2BA 2ZXRA 5D3DA 1CI3M 2K6AA 2VXWA 5M3MB 2DN8A 4JI8Q 3TEHB 3PIP3 3ONAB 5JPMC 3D8GA 3JAME 1SJHD 5CYUA 3GTJB 1Z6HA 2AMCB 3A54A 2H5XA 1HA6A 3L7ZC 3CKIB 3PV0A 5LMUQ 5M5XH 1SNCA 2F4VQ 2F0EA 5CV4A 4OL7A 3H6MA 5F2DA 4DUYL 1STNA 4LF7L 1GUWA 1EQVA 5FO7B 1BDOA 3MFYA 5DEHA 4OEMB 1SYFA 3K0XA 1SNMA 4DAVA 1S5BD 1VQBA 2MQHA 5EPJA 4DAYB 2R93G 2CHBD 4MHEA 1PYWD 1LYLA 3E9HA 4GNXA 3DWAA 1VQ6A 1V1OA 4AYBB 5NUCA 1HTLD 2L55A 2WP8J 4PZ7A 2NVTB 3GTGH 1EOTA 4C1NK 1PTOB 1X32A 2HIVA 4WFN3 2JJQA 3KBXA 3ERSX 4DAMA 4PZ6A 3JAML 4OX9L 3B6YA 3QR8A 4YCWA 4A3BG 4F8MA 3EBEA 2YTXA 4L6TB 4P74A 5C4XB 5IT9c 3OMGA 1PYBA 5KEEA 3ULJA 4NP5A 1G8ZD 5FJ8G 1Q90A 4OXPA 3S2DH 3K0YA 4JV5L 3M4QA 3GTLB 2E2IH 3SK4A 2HCIA 4XDXA 5E7NA 3CCUA 1RTNA 2RDHA 1XMOL 2JA6H 1Y8PB 2F0QA 2QDLA 2ZTCA 3UE0A 3R8BA 4A3CG 1UE5A 1YHBA 1KC8C 4C3JG 4JW0A 1UE7A 2PW5A 5IWAQ 2WV6D 1WTXA 1N33Q 4QUCA 1SNDA 2PZUA 3CPFA 1NR2A 3GTKB 3MA2B 4O42A 3S15B 4LWCA 3K5MA 2H4OA 1HQMC 2G5DA 2R7ZB 4ZQ3A 3IRBA 2KBNA 5JVG3 4Y7NH 5FLMH 1O80A 3G71A 2EJMA 4BBRB 5EGTA 3MEHA 3V96A 1JCKB 1AEXA 2D0OA 1XNQQ 2R92G 4LMQD 4LUZA 4ZYSA 3ICEA 4X3KA 4H13C 3KOJA 2F0NA 1NSNS 2X6LA 4FXKC 5C0XJ 4DK0A 2IT1A 3T4AC 2KECA 2UUCL 4H02A 2A69C 1BCPB 2OT2A 4AYBE 1SBBB 1JB7A 3HOWG 4IOCA 2L0CA 1DOMA 4DGZA 1A3TA 2A1AA 1SSOA 2VUMB 1K0SA 4CHTB 3EFXD 4LFCQ 1EUJA 4LW1A 2A6EC 3K7AH 4M1UB 2WKCA 3PSIA 4E6IA 3K58A 1HZ9A 4OO1I 1GXDC 3PUZA 4BXXH 4PG3A 4HSPA 1CKNB 2BA1A 3I72A 1X9NA 2VQEL 2B39A 1ILQA 2ICIA 1LTLA 4A3EB 1VQDA 4KHVA 2O4XA 2ZXPA 5GAEC 2JA9A 1B53A 4R4QA 1DCZA 1FL0A 2E2JB 3SE0A 1X6OA 3I4NH 4FYDA 4ME5A 4JI5L 3HOZB 1XNRL 5IYDG 4DR1Q 4PMBA 1MD2D 5J3BA 4Q5VA 3GTOH 3CC2A 4LAAA 1QJOA 4A93H 2G9DA 3EA6A 1E3PA 3MTSA 2OEOA 4BBSH 3FHWA 2NVXH 2PQAA 1WCMG 4CKEA 1T5EA 4A3KG 1HR0Q 3KDFA 1E7ZA 3H94A 3PF4A 5JJLA 2R6GA 4A3DB 1EWHA 2F0GA 3S1RH 2PI2E 2E76C 1MKHA 1B70B 1GVPA 2R7DA 3UDFA 3NBHB 1FJGQ 1X54A 1K3RA 4FVMA 4GKJL 1I4PA 2J4XA 5M5WB 4XTCS 3T53B 3MHBA 1ILPA 4JI4L 1C7YA 4R1JA 5IP7G 3AEVA 3HOYB 3NXWA 4M8AA 1EY8A 1L0WA 2F0HA 3PIO3 3TBIB 5M3FH 3M7GA 1E24A 3T1YQ 1VF5C 5A2QE 2B2TA 1EWCA 5IGCA 2A8VA 5C44G 2QEXA 1CZWA 2LXKA 3RZDB 3TZUA 1LM0A 3I4MB 3OMCA 3RMHA 1UE6A 3V05A 3H0GG 1PRTC 4A4IA 2N49A 1IBLL 1Q46A 2TMPA 4O2DA 5CMDA 3M4OH 2IL8A 1YJWA 4B3RL 1HNWL 1VDZA 3PF5A 2VQFQ 2DNEA 3S1NH 1VQMA 1SAPA 4JYAL 5CV6A 1K8MA 4H0LC 1FJGL 3KLSA 4FDBA 2M2LA 2CQOA 4JI0L 2Z6KC 2KUMA 3EJIA 5JEAG 4GZYC 3HOVG 4OONA 3F2UA 5CV7A 4P73A 3GTJH 2D0PA 3MZ5A 4KKUA 3BU2A 4HMIA 5A2QL 2ZM6L 2RBMA 2EY1A 3J7ZC 3F2CA 2FMCA 3QJYA 1BVSA 3SVMA 2F0KA 1K83B 2XN9C 2AHOB 4DNTB 4CBVA 2WB1G 5KGUA 3R3OA 2NN6I 4DR6L 5C5MA 3SEBA 2M00A 1O7IA 4NXML 1ENAA 2H1EA 3TP6A 4DV4Q 4WRDA 5C4JH 1LABA 4N8X1 3Q6SA 1KHIA 1CA6A 3P7JA 1GOZA 1HJPA 5AJ3Q 4GN3B 1KQSA 1QZHA 4DR2L 3LX0A 2NVTH 3KLRA 1TS4A 1PTOH 2F0SA 1G51A 1NR4A 1GUTA 4DV0L 1PTOC 4CGYB 3CD6A 2NTSA 5LL6S 2CW0D 2CFMA 2IX0A 4A3LG 1EL0A 1KXLA 1PH2A 1V1PB 3RLNA 3M7NA 2EXDA 2XVSA 1Y69U 4UPAA 3A7AB 3H3VH 1DOKA 1XWEA 3H3VC 1PH3A 2E2HH 1BQQT 4DN4M 1QE6A 4RA8A 1J8IA 5CGKA 1IKLA 3FRPB 2XWJB 1H9SB 4F87A 2Q2HA 4ME3A 1WTHA 3CMEA 5IGFA 3PCOB 3JC66 4DV3L 4OO1G 2RKSA 3GTLH 3A8JE 4DAYA 4Y52H 2Z0SA 2UXBQ 3CCEA 2K05A 3T51B 2KQ3A 1R9TB 4FXDA 2J0TD 5AJ3L 1XMQQ 3KUPA 5CV5A 1CT1D 4C2MH 4IFDJ 2JXMB 1Q8IA 4KHPQ 1KDBA 3L9AX 3G6JB 3NTHA 1ENCA 4DR3L 3FKIB 1JJCB 1VQGA 4ULLA 3K81C 1IL8A 4JVZA 2B8GA 3GTGB 1DYQA 1V1QA 2CKZB 3I2ZA 2ES2A 4X64Q 4P72A 3J81c 1H95A 3KF8B 3S15H 2HHHL 4EGVA 4DR4Q 2JEAI 3HKZG 4X66L 1HFGA 4KI0A 4KK7A 2B2WC 2JK8A 4A3JG 5I2XA 1N36Q 1A3UA 2F3WA 3UI2A 4OWWB 1FNUA 4BBRH 3D6WA 3BYTB 5DM73 2K1BA 3D0FA 1TWGH 3QOJA 1XMQL 2Y0SE 2K75A 2XSCA 2E2IB 3PUXA 5C4HA 1O7LA 4JI3Q 1ESRA 3I56A 3TREA 4R8NA 3NQIA 4IZ8A 2JA6B 2AUJD 2PI2A 1K3BC 2V4DA 1W6JA 5I9PA 4LF8L 1WD0A 1BCPC 1VQHA 2K50A 5JJZA 1VQAA 2VUMH 4KD3A 4WJ3M 4HR7B 4BY1G 1FD7D 5C4ZA 3BZKA 2MPMA 4POGA 1IW7D 3PO3H 3NEMA 1VQLA 2YV5A 3K57A 3HFZB 1XJVA 1DZ1A 2L5TA 1Y1VG 1IBKQ 3PO2G 2EQSA 3I90A 4AIMA 4A3EH 2R3ZA 2M9VA 5IT9E 4BY7G 4HIDA 4JI2L 3GTQB 2SDFA 3C1EA 1YEZA 1V8QA 2X69A 2E2JH 1X55A 1A2TA 5CBEE 1D2BA 4KTAA 4Y7NB 2L1BA 3QB3A 1JWUD 4B3SL 4BA2I 3S16B 5ELBA 3VR6A 1CUKA 3OSOA 2BE5D 3DHQA 1EQQA 4DV2Q 2NN6G 5LMNW 2IW3A 5C3XA 4IUPA 1QNKA 1JMCA 2EJFC 1LACA 1S5CD 2ID0A 4JI6Q 2JYOA 5LMNL 5JVH3 3VR5A 4A3DH 2JN4A 2HDLA 5D14A 3BDCA 2D5DA 1CKNA 5DM63 3PQIA 1X3QA 1TIID 3E6ZX 5IT9L 3K7AB 5M5WH 3VYRA 2JA5G 2JA7H 1R4PB 1IXRA 3ULLA 1PFBA 4WJWA 4OIKA 2F0IA 3TP5A 4PZ8A 3HOYH 2Q2TA 4G57A 1GUGA 1XPUA 2B2YA 1SE2A 3VYTA 4QGUA 4V190 1HCZA 5I4DA 4LK1C 3K7UC 1IYVA 1DXMA 4TRDA 4JBWA 2YTYA 2EE1A 3VR4A 4DU9A 1STGA 3EN2A 1STHA 4DK3C 1F9RA 3AFPA 3CHBD 3I4MH 1Q8KA 3RZOB 4X62Q 3J7AF 4JC0A 1I50H 3OTOQ 2RDFA 2YU9H 3GTOB 1QZGA 4A3IG 1U5KA 1T5XD 2F0TA 3ERQA 4KN4C 2QDBA 2A6HD 4RKLA 3T13A 1Y8OB 1EYGA 3BYYB 5M5YB 3NBHA 4LFBL 3H91A 3MXNA 3H15A 3NPPA 1MSGA 3TDQA 3J81j 3S1MH 4XQNA 3J7AV 2OQ0A 3P1HA 4K8JA 2CW0C 3OIQA 1NAPA 4HMJA 1HPCA 3NK9A 5EKIA 2A5HA 1Y1WH 4DXFA 3GD7A 4ILWA 4DFAA 3URYA 1WTWA 1SEBD 3BG3A 4GOPB 3SXHA 1MJEA 3HGBA 1K83H 5K5PA 2KHJA 3X3MA 4B9XA 4HJ5A 1NJIC 1JT8A 4RMFA 1F77A 4JI1L 2BA0A 5IIFA 2R93B 4K6LA 1Z47A 5AFWA 2RCFA 2MJ8A 4DV7L 5GAHC 2JA8G 4RAUC 2VB3X 1MJCA 4DUYQ 4LF7Q 1ZEQX 1IYJB 2L12A 5C3EG 2PNHA 1E1OA 1NNXA 1VMPA 4A3GG 1FNVA 4B3MQ 1QVCA 1V9PA 2RHQB 4K2KA 3KF6B 1K8GA 5CC4A 4K5XA 3HOXH 3A55A 1L0YB 3RNUA 1VQPA 5IE8A 1EY6A 3I4OA 1GHJA 1RKNA 4UY8C 3QIAA 1KTKA 2RSOA 1GJXA 1CA5A 2B63G 1Q82C 4OX9Q 1NE3A 1EEFD 4GLVB 1WTOA 1STYA 4UP8A 1HZCA 1YNXA 1AE3A 1D8LA 1YNJC 2F0MA 4F88A 4LUVA 4A3MH 3K80C 2F0FA 5DAUA 1I6VC 3BVGA 1CQVA 1U4PA 3HP3A 1STAA 1R9TH 1A62A 4GS3A 3D4DA 3UDXA 4UP7A 4JV5Q 1A8VA 5C0XG 5GQOA 1XXGA 1KRTA 1DJRD 4B3ML 3LGJA 5C4JB 4LUOA 4C3JB 4YIJA 3FKIH 1JOKA 1C48A 3ND9A 3NQTA 5EKKA 2MP1A 1JWSD 1A0IA 1E2WA 3Q22A 2IY5B 2IX1A 1XMOQ 3RUZA 1EIFA 2IX3A 1TKWB 1PH6A 4ZKBB 1B9NA 2N88A 1XPOA 4NPSA 1DM0B 2RA4A 1TWAH 1H9SA 3CRKC 2K01A 5HURA 3D6CA 1G291 5M9OA 2E2HB 4GN4B 2R92B 4IFDI 1TY2A 1K0RA 4HN7A 1AW7A 1PFNA 1BNZA 2ZJRA 3AU7A 5JPNC 1QG7A 1YNND 1IBMQ 1LTSD 4IUTA 1SROA 4YY3L 1CSPA 3U4VA 2PQEA 3J81i 4KN7C 2F0DA 1PRTF 1UUPA 4RCNA 3HOWB 2K5HA 1EY5A 3H09A 1WTVA 4C2MB 1WFQA 3L0OA 1SXTA 1D6EC 1CSQA 5M3MG 2N55A 1QCBD 1ZYRD 5CV8A 1M4VA 1YJNA 1X56A 1C8CA 3U9SA 2UUCQ 1AZPA 1CZGA 3FVQA 1O78A 3KF8A 2F52A 3J80i 1LT5D 2KCNA 1VQFA 1SYCA 4N9TA 4HJAA 1S72A 5I6YA 3DUZA 3HZXA 4LF4L 4OWXB 4EQOA 2NWGA 1TWCH 1NCVA 2B2VC 1LV9A 5KRUA 4HCEA 4JBKA 4YWKA 3GTQH 1OO9B 3E3XA 2HQEA 1IBML 3T16A 1WOCA 1TU2B 1LUZA 2VQEQ 5IYBH 2DUDA 1WD1A 1SR3A 3S16H 2K32A 3GO5A 1H9MA 1PZID 1TWGB 1WCMB 4NDXA 1EY7A 5HY6A 1EY4A 4J8QA 1H9JA 2IHEA 4JI5Q 3SGIA 1XNRQ 3VR2A 4C3IG 5IP9H 4CDFC 1SMYD 2GVAA 5E3FA 1PTOF 2I5HA 3C46A 5C4XG 4F7XA 1WTQA 4XQQA 2WAQG 4A75A 3FMCA 1QUQB 1BXTA 4R4OA 3MXPA 1O7ZA 2X6GA 3K5LA 1S5DD 3PO3B 1S3OA 2PO4A 4X65Q 2EYHA 1HNZL 4GKJQ 4CDDC 3K5OA 2O5IC 3J81E 2F0VA 1MSHA 4C3HG 2JP1A 1QWYA 1RF2D 5C44B 4JI4Q 1B3AA 4JBMA 2MO1A 4A3FG 5BN3A 4DV1Q 1SRUA 1PH9A 5JJIA 4RGNA 3GTMH 1EYCA 2DY7A 3MFGA 2WACA 3RZOH 1UNSA 3E9IA 1Q7YC 2ZJQA 3I3CA 4APVA 3VYUA 2PW7A 4FXGC 1SFOH 1BR9A 1QOHA 1BKBA 1EU4A 2K04A 2V1CC 1EWIA 5M5YH 2HD3A 3X3NA 3CCMA 1IBLQ 2HCCA 3P75A 5K36G 3OW7A 3HOVB 3CRLC 4B3RQ 1HNWQ 4JCVE 4CJ0B 2EIFA 2R7ZG 3J81L 3IL8A 4JYAQ 1VQ5A 3W5OA 3FEWX 4X65L 4HJ7A 2HQLA 5JJKA 1ICWA 4TVAB 5H1SE 2JA7B 2WB1B 2UU9L 4JI0Q 4GOPC 3FPUB 1V43A 1K28A 4KV6A 1CKOA 5COYA 2HT1A 2EY6A 1C4QA 3KBGA 5LL6X 1EQRA 4DV1L 2VW9A 2ZM6Q 2R93H 1CKMA 1A3VA 3VA5A 4K8IA 3S1QH 4RKBA 1CFMA 1RL2A 2K33A 1SNOA 2A74C 1MIUA 4IFDG 4DR6Q 4KKTA 1SE8A 3MC0B 1IKMA 3W3AA 2R61A 4OELB 4NXMQ 3K5NA 1BCPF 1CQFA 1I50B 2YU9B 2PNRC 4IOAA 3LWEA 3CW2C 3K8AA 4V0BA 4A3BH 1OXTA 2LSSA 2QF7A 4DR2Q 5KIXA 1HA5A 1ICFB 1NY4A 4DV0Q 4GOPA 5EPKA 2CWAA 3S1MB 1G6PA 1S5ED 1L1OB 5FJ8H 4QIWB 3U58A 4XIGS 4X3SA 1Y1WB 4YHHL 1Y14B 2CQAA 3HOZG 2CVRA 1RJTA 1H9KA 1AH9A 1PFSA 2A19A 4ZUIA 3DWQA 2UUBQ 4RGTA 3C1FA 1FYCA 3TQYA 3DEOA 1D1IA 3TP7A 3OIPA 5IYCG 1YHQA 5G3LD 4JOIC 2NBFA 4DV3Q 3G6EA 4A3CH 4ZRZA 3CPWA 5DLQE 4PMCA 5ELEA 2B29A 4C3JH 4ZKCB 4H44C 2I07B 3KF6A 1EFID 4B08A 4PNYA 3Q24A 1M8AA 2DNCA 3FP9A 1SE3A 2DJGC 4JG2A 2AQ2B 3CQZB 4DR3Q 4DUZQ 2Z6KA 4JBJA 2K5NA 2B2UC 3HOXB 4DA2A 4NXNL 1JICA 3L2PA 1RTOA 3HKZB 1WJJA 1DGSA 2K5DA 3BZCA 1OXVA 2K7VA 3MWYW 1BBWA 2QW7A 4X3TA 4U68A 4ABNA 1SNQA 1EFWA 4L5RC 1PXUA 4GKKL 2WB1E 1F2ZA 3F8TA 1XYIA 2UUBL 2NZOA 2R92H 4RFBA 1PH8A 1E1TA 4JOIA 1KNAA 1LO5D 1TS5A 2KA7A 1H9RA 2HHHQ 1ZKOA 2EJGC 4I7AA 2SOBA 2Z6BA 4X66Q 4WJ4A 2NVYB 5IGBA 5ELCA 4A3MB 2I46A 1QNUA 1RCVD 1JJ2A 4ZK9B 2E5LL 3HOWH 4JI7L 5ELNA 1EOVA 1ML0D 2KEDA 2NB0A 2RQXA 1UE1A 1JORA 4I65A 2A68D 2NTTA 2IPKD 5T1GA 1PZKD 4DUZL 1PVOA 3CCRA 2UXCL 1UEAB 3A56A 3WDNA 1TWFH 4LF8Q 1JQYD 1Y1VB 5EBDA 1Z9FA 3PO2B 1W3SA 2L9HA 1QB5D 4NW2A 4BY7B 1TWAB 2Y0SG 4QIWE 1M90C 2BCOA 3IFTA 5E4WC 3CMAA 1AP0A 3STBD 2IHFA 4EQ5A 5IYDH 3RN5A 1KNEA 3J7YW 1VQKA 1JWMD 2VZAA 1A2UA 5E1FA 2OWOA 2RCNA 4Q0FA 4O1NA 1GO3E 4XQJA 1SLJA 4J1MA 4JI2Q 3CAMA 1XTDA 4KKSA 4BWGB 1WCMH 3HOUG 4A3KH 4B3SQ 4AQYL 2XRQD 3J80c 2UXDL 1TWHB 3DXJC 1OXSC 4LF6L 1IL2A 2CWPA 4YCUA 1S40A 4BS9A 2EY2A 4IPGA 2KJXA 3U4ZA 3NWTA 2MHVA 4HSVA 4LNQA 2QGQA 1VF7A 4JPBW 3RN2A 2IJ0A 5LMNQ 1WYDA 4RHSA 5IP7H 1N8RC 4HIKA 3HKZE 1PA6A 1PH5A 1ESFA 2PCFB 1C9OA 4S3SA 2B2WA 3PGZA 1SYBA 5T1IA 2K4KA 1TWCB 1I94Q 4FO2A 3NBIA 5C44H 5ISRA 4DV5L 5C0XI 4XT1B 1JC7A 1LT6D 2WINB 4JK1C 4OGQC 4B3TL 4J15A 4IUQA 3H0GH 4XXEA 1G91A 3WOEA 3C3LA 2BDOA 3M3YB 2QEJC 1LTID 3OPOA 1I3QH 1OXXK 3CCQA 2ZTEA 1I5FA 2Q8RE 1D7QA 2ZT9C 1SE4A 4ID6A 1U4LA 4DR5L 2UUAL 1EIGA 5C3WA 2VS1A 3I70A 2CH4W 2D62A 2Z8LA 5JEAH 4DV6L 1JE4A 1N34L 2D9UA 3WOFA 4LF5L 5CORA 3HOVH 1QUQA 3U9OA 4KY6A 1SYGA 4QL5A 3N6RA 4DR7L 1HH2P 4MTNA 4KHZA 4LFBQ 2AQ3B 1CTMA 1B1ZA 1PYSB 3GTPB 4XT3B 1VS0A 2E74C 1S4ZA 1VQJA 1GM5A 1I94L 2SEBD 3BS1A 5J1ZA 4TSSA 2KVMA 1J9OA 4I7ZC 4KJNA 3A5UA 3AYHB 3R93A 2MO0A 2JA8B 2E8GA 3F1ZA 4OHJA 2QILA 4K6DA 4X6AH 2KCCA 5C3EB 2JA6G 3GP7A 1II3A 1G6ZA 3ER0A 2QA4A 1VQ9A 4JI1Q 1SDFA 3GTMB 5LHY1 4FF2A 1B44D 1Z7TA 1YHAA 4DV7Q 2MNAA 2LS01 4QMGA 1MHWC 5EBCA 1JJGA 1HTPA 1SFOB 4A3LH 2EXZA 4RCOA 3PUVA 2SNMA 5IODA 3S9WA 1OTCA 4QB4A 4LF9Q 2B63B 4ZCKA 1HHVA 2F4IA 3QG1A 3TRZA 4CKCA 4K2LA 2K5WA 1CK1A 1L1OC 1EYAA 3Q23A 2RDGA 2A69D 4OO1H 1E0BA 2A73B 2KHSA 5FLMG 3RD4A 1SJED 3I55A 1QVFA 4X3UA 1Q3LA 4HCSA 2JEBI 2A6ED 1EY9A 1Y8NB 1ET9A 2AUKA 4YCVA 1FVIA 3S1QB 4IURA 1HZBA 3NENA 1DONA 2JQOA 1NTGA 1E2VA 4KLKA 4HIMA 4MN3A 3U50C 3BDLA 2OQKA 2EVBA 4EX5A 3NE5B 3QO2A 3AMUA 4EQNA 3H3VI 3KYHC 3ND8A 4L63B 3TMEA 1RIPA 4MTKA 1D5XC 2EPBA 3CQZH 5IGGA 2NVQB 2O2LD 3CU7A 2CCZA 4LF9L 4TKOB 4ZAIA 2A68C 4IPCA 5IGEA 4A3BB 1L1OA 3TP8A 1A6XA 4BXXG 2QKIC 2HDMA 3CF5A 4A3JH 5HGTA 1CHPD 4G4KA 5ELDA 4HJ9A 2MFIA 3A5ZB 4Z9CB 3S2HB 2FXQA 2PPBC 1HUNA 3CC4A 2F1MA 3I4NG 4PV1C 3CCLA 1PMRA 1DOLA 3BZDB 3C2PA 4FNFA 2R7FA 2NVYH 3EIVA 3M4PA 2JE6I 4A93G 3HG9A 1Q12A 5BR8L 4BBSG 4R8IA 3F2BA 3N52A 2LY7A 2RSNA 3S24A 4R4CA 4RHRA 4YY3Q 3E0EA 4NMZA 2PYKA 3D3RA 5I2YA 1J5EL 4BY1H 2O5JC 4NKLA 3LNNA 3CXCA 3OWEB 4C56C 5IY0A 3K59A 1K8OA 1E2ZA 1V1PA 5KYLA 2L4NA 2CH4A 1Y1VH 1JB3A 1TVXA 3PO2H 4IALA 1Q86C 2F0OA 1PRTD 4BY7H 1ONLA 1ZXTA 2P5ZX 5M3FG 4L5QA 4DPGA 2BOSA 1IW7C 2ICEC 4J6HA 4CDEC 4LF4Q 3I4LA 2N78A 3SK6A 2YTVA 1GUOA 5C5LA 5GROA 3RR5A 4K0KL 2J7ZA 2NN6H 1N32L 3L3OC 4PQXA 5JAVA 3T1HL 3AFQA 4C3IB 1YJ9A 1KLUD 4JI8L 1L2FA 2KHIA 2OF1A 1T9HA 1BO0A 4QJFA 1TWHH 1X3FA 5KNBA 1VMCA 3FDTA 5JOBA 5LMUL 2KOLA 3QOLA 1HNXQ 2WAQB 2F4VL 4RWSC 1P16A 2BE5C 5FO8B 1KDAA 4P2CB 1TQOA 4HEDA 2JA5H 3TS2A 1I4RA 1B2TA 4HAEA 1EU3A 1KLGD 5BN4A 2Z1CA 1TWFB 4C1NI 1TXYA 3HS0C 4C3HB 5FK9C 3GDEA 4DF7A 1MI2A 4ODGA 2Q8IB 3R2TA 4DNRB 3DEPA 4A3FB 2AKWB 1PTOD 4L5SA 1AZQA 1U4RA 1U9RA 1SYDA 1YI2A 3M85A 5FO9B 1XX8A 1HNZQ 3SK8A 1UWVA 2E2DC 2K28A 5I6WA 1J6QA 4A3IH 4AYBG 3M3YH 3AQQA 3SHLA 1NUCA 1U0LA 5EJWA 1LTAD 4OIJA 1M1KC 5A35A 3OOCA 2Q2IA 1HNXL 4A3KB 5IGDA 1K9MC 4IUNA 3IFDA 1W6KA 4L8JA 1OXUA 3PUYA 1GUNA 2EYMA 3VR3A 2MGSA 2EYPA 2K14A 1SYEA 3T56B 1I4GA 2A6HC 3M9BA 3GTPH 2N3SA 3IKJA 2B2VA 2D2CC 4UDUC 5KNCA 1PHJA 3TZDA 2FJ2A 1PZJD 4O0AA 3BDOA 2Z4IA 5FLXc 2JA8H 3PIPA 3DWPA 3PMFA 2UU9Q 5IWAL 3BVZA 1N33L 4IN3A 4CJ2C 4FF4A 1TY0A 4QF4A 5C3EH 3CCSA 4A3GH 3ZJYC 2C5CA 3CC7A 2EY5A 2FFKB 1GHKA 3H0GB 4QY7A 1RDPD 1QVGA 1KDCA 3NSWA 1C0AA 2ALYB 2VY3A 1I3QB 3NELA 3R2IA 1LTRD 3D4RA 5EQ0A 3J80E 3W2DA 3HEJA 1PH7A 2BH8A 2WAQE 3CCVA 1FGBD 2Z9HA 1IHZA 1XNQL 2B63H 1ENFA 2ZJPA 3MVVA 1EEID 2Q8TA 2VL6A 3KLWA 3MXUA 2RVLA 2VB2X 3ITPA 3NHHA 1D1KA 2B2TC 1ET6A 1BCPD 4B9WA 4BBRG 2F3IA 2ZXOA 2GVBA 4DNIA 4QCLA 1KAAA 5C0XH 2XRSD 3EQLC 1LTTD 3P20A 4YHHQ 5EPLA 4LFCL 1EIYB 2K52A 3KK7A 4IJHA 3E0JA 3J80L 2ZTDA 3BVMA 4RH6A 3MXNB 5J39A 3I91A 4RGMA 1EY0A 3JAMc 2F03A 2L11A 5D3IB 2VUMG 1WTRA 4UAIA 3DM3A 2EYFA 3S17H 1HZAA 2NVQH 1ASZA 2G9HD 3VA7A 5CR3A 1O7YA 1HRJA 2HIXA 1A63A 3PO3G 3UE1A 1NMGA 1ASYA 3CP0A 2Q2UA 1YZ6A 1VQNA 3NTKA 4FF1A 4DR1L 1F9SA 1HR0W 1RODA 3D4WA 4A3EG 4IQZA 1BBUA 2AWOA 4NXNQ 3S2HH 1D5MC 2FHTA 1HR0L 2NYZD 1IYUA 5ELOA 1QILA 3OHXC 1VQCA 4GKKQ 2YYZA 3D31A 1R4QB 2LFNA 4DK1A 4MZ9A 1TS2A 4G7ZC 4KJOA 5M3MH 1VQOA 2E75C 2K03A 3S14B 1JOOA 3I73A 4GLAC 1YNNC 5J22A 2OTJA 2EZVA 2KCTA 4A3DG 1B3QA 5DNFA 2E5LQ 3KFUA 1SN8A 4JI7Q 1GUSA 1I6HB 5I9OA 3T1YL 4PMWA 3FPPA 1PFMA 5EAYA 1JOQA 2JA7G 1WI5A 3TN2A 1EZ8A 4UP9A 1B9MA 2Y0SB 4HTHA 2UXCQ 2I5MX 1VQ7A 3NTIA 1ZYRC 3HOYG 3W1GA 2K5QA 1AFPA 2XNAC 4G7OC 1KAWA 4A3JB 4AH6A 2VQFL 1B50A 2XIWA 3KJOA 4H7BA 3WWVA 1B4OA 1STBA 2OCEA 2PMZB 3HOUB 3I4MG 4GNXB 4C3IH 2PZWA 5G3LF 4KY5A 1A15A 2FINB 4FP5D 4GN5A 2NUCA 5IOCA 5C4XH 1DD2A 4BY1B 4AQYQ 2B8FA 2NZHA 3A8KE 2UXDQ 2B2UA 1TT2A 3M4YA 3J7A5 1K8AC 1NMFA 4LF6Q 5M5XB 3RLOA 1SMYC 1KD1C 4EQPA 1YVCA 1Y1WG 5FOBB 4DV4L 2F0LA 5E4XA 2VNUD 2OXPA 1LLRD 4OWTB 4C3HH 3VYSA 3GV3A 4CJ1B 1K73C 4N8FA 5L37A 4A3FH 4BA1I 4K5VA 1HUMA 2EDGA 2I5LX 1SNPA 2XTIA 1XPRA 2OTLA 1Q1EA 3DMUA 2DGYA 4K14A 2IWHA 1STEA 1JR0D 3HRZC 1Q1BA 4N9PA 5GAGC 1RHPA 1KABA 4UHVA 1EIHA 1EZ6A 2WKDA 2BDNA 3KLSX 3PIOA 2EYJA 4KMUC 4DV5Q 3E5SA 3O13A 1HQRD 3PUWA 4B3TQ 4POFA 2BH2A 3GTKH 5K36H 1YNJD 3HOXG 1U4MA 2C9OA 5JEAJ 2R7ZH 2F3VA 4IPHA 2LKVA 4DR5Q 2UUAQ 2UXBL 2TSSA 2EOTA 3A74A 4ZLTF 4P75A 5BN5A 4G7HC 1X65A 1YIJA 1TS3A 5ELFA 2JA5B 2EYLA 2L15A 4FF3A 3S2DB 4DV6Q 1N34Q 1F9PA 2LXJA 4LF5Q 3TS0A 3KJPA 1D5ZC 2F0WA 1KRSA 4DK6C 4RG1A 1SMXA 4DR7Q 4YWMA 4KHPL 1X3EA 2FMMA 3GQBA 1IZ6A 4A3MG 5EKLA 2ENBA 1G2TA 4KY7A 4IFDH 1BUVT 1PDQA 4TQUS 1F2MA 5CV9A 2PMZE 2SNSA 4CDCC 1BF4A 3FKIG 4IPDA 3A7LA 1FGUA 4X64L 4A3IB 3BJUA 3UDIA 1LT3D 4XYOA 4HIOA 4DR4L 3AB9A 1GKHA 1N36L 1VQ8A 1TR5A 1Q81C 3MEFA 1HXYD 4R4IA 1N9WA 2WIIB 4P71A 2Z4HA 2MUYA 4JI3L 2B2YC 3HOZH 4EVOA 1AE2A 3ZYYX 3I8ZA 3SDZA 1VCIA 1FNWA 2KCMA 4XYQA 2N8NA 3Q0AA 4NB3A 5IYCH 1FR3A 1XTCD 4IJLA 2WFWA 3K6OA 1G2SA 4L5TA 1UAPA 4QUFA 1HFNA 3DLLA 4CKBA 3SR1A 1F2YA 1I4XA 3MXGA 2JSOA 4R9WA 5KYIA 2F0UA 3GV6A 2F0JA 1B7YB 3ULPA 2PQAB 4A3GB 3KDFB 4MNOA 3HKSA 3W1BA 4A76A 4LFAQ 1IBKL 3UDGA 2DY8A 1B8AA 1VQIA 5CBAE 1VQ4A 2GA4B 4HJ8A 5C6AA 2ATWA 1MBYA 1BOSA 1PLFA 1WTPA 3DM1A 1X3PA 1GD7A 3VDYA 4YWLA 4R4TA 3LWUA 4K5WA 5D65A 2AQ1B 1PV4A 5KNDA 1WVLA 4MIUA 3G48A 4U673 3JAMi 1KL9A 4DV2L 3IAYA 3I4NB 3RZDH 1JE5A 3QWNA 5HGQA 1CHQD 4IUVA 4JI6L 5IYBG 2PZTA 3NP8A 3CCJA 1UEBA 4A93B 2DJFC 4BBSB 2AWNA 2F0PA 2LMCB 2KEEA 4DKAC 2I0QA 2NVXB 5FLXE 2GN5A 2C35B 2ASBA 3I7FA 5TSSA 1KIXA 3SK5A 3F2DA 3G4SA 2KENA 5GADC 1I4QA 5IP9G 1X3GA 4LFAL 3S14H 1RD9D 2XGTA 3A0JA 4KD4A 3RLFA 3S1RB 3A8IE 3OW2A 5BR8Q 1YITA 1L0XB 4ALPA 2RF4A 1PH1A 4DAPA 1BBXC 1I6HH 1VQEA 1YBYA 2B3GA 1J5EQ 3S17B 4ZUJA 1I4HA 2RHSB 4LJZC 3G7LA 1S5FD 5M3FB 1CM9A 3V2TA 4IUUA 4X62L 3TSSA 2HUGA 5FKAC 3Q8DA 4WORA 3OTOL
chains in the Genus database with same CATH topology
2UUBQ 3OYYA 3BZKA 1OXUA 4POGA 3PUYA 3TQYA 4IO9A 5IYCG 1YHQA 3PO3H 3NEMA 1VQLA 2YV5A 2K5VA 4JOIC 3HFZB 3G6EA 4DV3Q 4A3CH 1NBWA 1XJVA 1P8LA 2K14A 3HOUH 3CPWA 1Y1VG 5DLQE 1IBKQ 3PO2G 2B29A 4C3JH 3M9BA 2EQSA 4AIMA 3KF6A 2N3SA 1PH4A 3GTPH 1E22A 4GNXC 4A3EH 1PHJA 3STBC 4BY7G 4HIDA 4JI2L 3FP9A 4K0KQ 1YEZA 4JG2A 4QQBX 4GLXA 1N32Q 2E2JH 3T1HQ 1W2BA 1X55A 4O0AA 5FLXc 4DR3Q 4B3SL 2JA8H 3PIPA 4BA2I 4JI8Q 3TEHB 4DUZQ 2UU9Q 5IWAL 2Z6KA 4JBJA 1N33L 1CUKA 2K5NA 1EQQA 4NXNL 5C3EH 2AMCB 4DV2Q 3L2PA 3CCSA 2H5XA 1WJJA 2NN6G 3L7ZC 1DGSA 3PV0A 3ZJYC 3CC7A 5LMNW 4A3GH 5LMUQ 5M5XH 3BZCA 1JMCA 1OXVA 2F4VQ 2ID0A 4QY7A 1BBWA 1QVGA 4JI6Q 1C0AA 2ALYB 1EFWA 2VY3A 4L5RC 5LMNL 4GKKL 2WB1E 4DUYL 3F8TA 4LF7L 2UUBL 2NZOA 2R92H 1PH8A 1E1TA 4JOIA 4A3DH 3NELA 3K0XA 2HHHQ 1VQBA 2MQHA 4DAYB 2R93G 4X66Q 4WJ4A 1CKNA 1PH7A 2BH8A 1LYLA 2WAQE 2JA7H 5M5WH 3CCVA 2JA5G 3E9HA 4GNXA 1IXRA 1VQ6A 1XNQL 2B63H 3ULLA 1JJ2A 2ZJPA 2E5LL 2WP8J 3HOWH 4JI7L 4PZ7A 4PZ8A 5ELNA 3HOYH 1EOVA 2VL6A 2Q2TA 3GTGH 3KLWA 1XPUA 1UE1A 2HIVA 4QGUA 2JJQA 3ERSX 4DAMA 4PZ6A 3K7UC 4BBRG 4DUZL 2F3IA 4JBWA 4OX9L 2YTYA 1PVOA 3B6YA 3CCRA 2UXCL 2GVBA 3EN2A 4YCWA 4A3BG 4DK3C 4DNIA 3AFPA 3EBEA 1TWFH 4LF8Q 2YTXA 4P74A 5IT9c 3I4MH 1Q8KA 4YHHQ 4X62Q 1PYBA 4LFCL 1Z9FA 1EIYB 1W3SA 4JC0A 2K52A 1I50H 4IJHA 3OTOQ 3ULJA 2YU9H 1QZGA 4A3IG 1U5KA 5FJ8G 4OXPA 2Y0SG 3S2DH 2ZTDA 4JV5L 3M4QA 4QIWE 1IBLL 3MXNB 2E2IH 1M90C 1EYGA 3JAMc 3CMAA 4LFBL 3STBD 2VUMG 3H15A 2IHFA 4EQ5A 5IYDH 3RN5A 3DM3A 1VQKA 5E7NA 3S17H 1HZAA 2VZAA 3J81j 3CCUA 1ASZA 2OWOA 2NVQH 2RCNA 3S1MH 2OQ0A 1XMOL 2JA6H 2HIXA 1GO3E 3PO3G 1A63A 3UE1A 1SLJA 4JI2Q 3CAMA 1NMGA 1XTDA 2ZTCA 1ASYA 3CP0A 3UE0A 1WCMH 1Y1WH 2Q2UA 4A3CG 3GD7A 1UE5A 1YZ6A 1VQNA 3HOUG 1YHBA 4A3KH 4DR1L 4GOPB 1KC8C 4B3SQ 4AQYL 1MJEA 3J80c 1K83H 1HR0W 5IWAQ 1UE7A 2KHJA 2UXDL 1N33Q 4A3EG 4HJ5A 1NJIC 1BBUA 1JT8A 1OXSC 4RMFA 4LF6L 2AWOA 4NXNQ 3S2HH 1IL2A 4JI1L 2BA0A 2CWPA 4YCUA 1S40A 1Z47A 3CPFA 4IPGA 1HR0L 4DV7L 5ELOA 3U4ZA 5GAHC 2JA8G 4LNQA 2QGQA 1VQCA 3RN2A 5LMNQ 1MJCA 4GKKQ 4DUYQ 1WYDA 4LF7Q 2YYZA 1IYJB 4LWCA 3D31A 5IP7H 5C3EG 2PNHA 1E1OA 1N8RC 4HIKA 4A3GG 4MZ9A 3IRBA 3HKZE 1PA6A 4B3MQ 1PH5A 1QVCA 2KBNA 1C9OA 5M3MH 1V9PA 3PGZA 2RHQB 4Y7NH 1VQOA 5FLMH 3G71A 3KF6B 1K8GA 4GLAC 2K4KA 1I94Q 2D0OA 1XNQQ 2R92G 3HOXH 4LUZA 2OTJA 2KCTA 5C44H 3ICEA 4A3DG 2E5LQ 4DV5L 3RNUA 3KFUA 5C0XI 1SN8A 4JI7Q 3KOJA 1VQPA 5IE8A 3I4OA 3T1YL 4B3TL 4J15A 4PMWA 4UY8C 3H0GH 5C0XJ 5EAYA 2JA7G 1WI5A 2IT1A 4UP9A 2UUCL 4H02A 2B63G 4LF4L 1Q82C 4OX9Q 1NE3A 1I3QH 1OXXK 2UXCQ 4AYBE 2I5MX 3CCQA 1JB7A 4GLVB 2ZTEA 1I5FA 1VQ7A 3HOWG 4IOCA 4UP8A 3W1GA 3HOYG 1HZCA 1D7QA 1YNXA 4DR5L 2A1AA 2UUAL 1AE3A 1D8LA 2VS1A 4LUVA 4A3MH 1KAWA 3K80C 1EUJA 4LFCQ 4LW1A 3K7AH 3PSIA 2D62A 4AH6A 4DV6L 1N34L 1R9TH 4LF5L 1A62A 1HZ9A 2VQFL 1QUQA 4GS3A 3UDXA 3KJOA 3WWVA 3HOVH 4UP7A 4OO1I 3PUZA 4JV5Q 1A8VA 5C0XG 4QL5A 5GQOA 2OCEA 4BXXH 4PG3A 1KRTA 1CKNB 1HH2P 4MTNA 4KHZA 4DR7L 3I4MG 4LFBQ 2BA1A 4B3ML 3LGJA 1X9NA 4LUOA 2VQEL 4GNXB 1PYSB 4C3IH 3FKIH 1LTLA 1VS0A 1VQDA 5GAEC 1VQJA 1A0IA 2IY5B 1GM5A 2JA9A 1I94L 2IX1A 1XMOQ 4R4QA 1EIFA 1FL0A 4GN5A 1PH6A 1X6OA 3I4NH 5C4XH 3A5UA 3AYHB 2MO0A 4JI5L 1XPOA 4NPSA 1XNRL 5IYDG 4DR1Q 2E8GA 3F1ZA 4AQYQ 5J3BA 3Q8DA 2NZHA 4X6AH 3GTOH 3CC2A 2UXDQ 4A93H 1TWAH 2JA6G 3J7A5 1E3PA 3ER0A 1K8AC 4BBSH 1NMFA 2QA4A 4LF6Q 3FHWA 1VQ9A 2NVXH 4JI1Q 3RLOA 1KD1C 2PQAA 1YVCA 1WCMG 1Y1WG 4DV4L 4A3KG 1YHAA 3KDFA 4DV7Q 2MNAA 1HR0Q 2VNUD 1G291 1E7ZA 3PF4A 4OWTB 4C3HH 4GN4B 1JJGA 4IFDI 1K73C 5JJLA 2R6GA 1K0RA 4A3FH 4A3LH 4BA1I 3S1RH 2PI2E 2I5LX 2XTIA 1MKHA 2ZJRA 1B70B 1GVPA 2R7DA 3PUVA 3UDFA 1XPRA 3NBHB 1FJGQ 1IBMQ 1X54A 2OTLA 1K3RA 1Q1EA 4GKJL 2DGYA 1OTCA 1SROA 4YY3L 1CSPA 4XTCS 1Q1BA 3U4VA 5GAGC 3J81i 4LF9Q 4JI4L 1C7YA 3PIOA 4R1JA 5IP7G 3AEVA 3TRZA 2K5HA 4DV5Q 1L0WA 1L1OC 1WFQA 5M3FH 1E24A 3L0OA 3PUWA 3T1YQ 4B3TQ 1CSQA 4POFA 5M3MG 5FLMG 2BH2A 1YJNA 1X56A 3I55A 3GTKH 1QVFA 2UUCQ 3HOXG 2A8VA 2JEBI 5C44G 2QEXA 2LXKA 5JEAJ 2R7ZH 1LM0A 2F52A 3J80i 4IPHA 4YCVA 4DR5Q 2UUAQ 1UE6A 4HJAA 1VQFA 3H0GG 2UXBL 1FVIA 1S72A 4A4IA 2N49A 3A74A 1YIJA 1HZBA 1Q46A 4O2DA 1X65A 3NENA 4P75A 2JQOA 4OWXB 3M4OH 1NTGA 1TWCH 1YJWA 4KLKA 2L15A 4B3RL 1HNWL 4DV6Q 4HIMA 1N34Q 2LXJA 3PF5A 2VQFQ 4LF5Q 3U50C 1VQMA 3S1NH 3TS0A 3KJPA 2OQKA 1KRSA 4JBKA 4DK6C 4EX5A 4JYAL 4YWKA 4RG1A 3H3VI 3GTQH 1SMXA 4DR7Q 4YWMA 1IBML 3KYHC 1FJGL 1X3EA 4FDBA 4KHPL 1IZ6A 4A3MG 1RIPA 1WOCA 1LUZA 2VQEQ 5IYBH 3CQZH 2CQOA 4JI0L 2DUDA 2CCZA 4LF9L 2Z6KC 1SR3A 5JEAG 3HOVG 3S16H 4IPCA 4OONA 3GO5A 1L1OA 4P73A 3GTJH 2D0PA 4BXXG 3BU2A 2ZM6L 5HY6A 4TQUS 3CF5A 2IHEA 3J7ZC 2PMZE 3F2CA 4JI5Q 3SGIA 4A3JH 1BVSA 1XNRQ 5IP9H 3FKIG 2AHOB 4IPDA 1FGUA 2WB1G 4X64L 2GVAA 4HJ9A 3BJUA 2MFIA 3A5ZB 2NN6I 3UDIA 4DR6L 2FXQA 2I5HA 4HIOA 3CC4A 4DR4L 3I4NG 1O7IA 5C4XG 1GKHA 3CCLA 4NXML 4DV4Q 5C4JH 2WAQG 1N36L 1VQ8A 1KHIA 2R7FA 2NVYH 1Q81C 3EIVA 3MEFA 4A75A 3M4PA 1QUQB 2JE6I 4R4OA 4A93G 1HJPA 5AJ3Q 4GN3B 4R4IA 1Q12A 1QZHA 5BR8L 1KQSA 4BBSG 1N9WA 4P71A 1S3OA 4X65Q 4DR2L 3F2BA 2NVTH 1HNZL 4GKJQ 4JI3L 3S24A 4R4CA 4YY3Q 3E0EA 3HOZH 1G51A 4DV0L 1AE2A 4BY1H 3CD6A 1J5EL 1VCIA 2KCMA 2N8NA 4JI4Q 2CFMA 2IX0A 3CXCA 4JBMA 2MO1A 4A3FG 4A3LG 1KXLA 4NB3A 1PH2A 5IYCH 3RLNA 4DV1Q 1SRUA 3M7NA 4IJLA 5IY0A 2EXDA 2WFWA 1PH9A 5JJIA 3GTMH 4L5TA 4UPAA 3H3VH 1Y1VH 3DLLA 3RZOH 1PH3A 2E2HH 3PO2H 3E9IA 1Q7YC 2ZJQA 4APVA 1Q86C 1SFOH 2Q2HA 4ME3A 4BY7H 1B7YB 3ULPA 3CMEA 2PQAB 3PCOB 3JC66 4DV3L 5M3FG 4OO1G 4L5QA 4DPGA 3GTLH 1BKBA 3KDFB 2V1CC 1EWIA 4MNOA 5M5YH 2Z0SA 2UXBQ 4Y52H 3HKSA 3W1BA 3CCMA 4LFAQ 4A76A 1IBKL 1IBLQ 3CCEA 3UDGA 4LF4Q 5K36G 2N78A 1B8AA 1VQIA 1VQ4A 4B3RQ 2YTVA 1HNWQ 4JCVE 5GROA 4HJ8A 3RR5A 5AJ3L 1XMQQ 2ATWA 4K0KL 2EIFA 2R7ZG 4C2MH 4JYAQ 1N32L 1VQ5A 3W5OA 3T1HL 4IFDJ 4X65L 3AFQA 1GD7A 4HJ7A 3VDYA 2HQLA 4KHPQ 4DR3L 5JJKA 4YWLA 4TVAB 1JJCB 1VQGA 4R4TA 5H1SE 1YJ9A 1PV4A 4JI8L 2UU9L 1L2FA 2KHIA 4JI0Q 1T9HA 4GOPC 3G48A 3K81C 1V43A 4QJFA 1CKOA 1TWHH 1X3FA 3JAMi 2HT1A 1KL9A 4DV2L 1EQRA 3RZDH 4DV1L 1JE5A 2VW9A 5LMUL 2ZM6Q 2R93H 1HNXQ 1CKMA 5HGQA 2F4VL 1P16A 3S1QH 4JI6L 1V1QA 5IYBG 2CKZB 3CCJA 1UEBA 2JA5H 3I2ZA 3TS2A 1RL2A 2ES2A 4X64Q 4P72A 3J81c 1H95A 2AWNA 4DKAC 1MIUA 4IFDG 2I0QA 4DR6Q 1SE8A 3KF8B 3S15H 2HHHL 2GN5A 4DR4Q 2C35B 2ASBA 2JEAI 3I7FA 3HKZG 4X66L 1KIXA 4NXMQ 1TXYA 4KI0A 3G4SA 3F2DA 2JK8A 2KENA 4A3JG 5GADC 1N36Q 3GDEA 5IP9G 1X3GA 4LFAL 4OWWB 3S14H 4BBRH 2XGTA 3A0JA 3RLFA 4IOAA 3CW2C 3D0FA 3K8AA 4A3BH 2AKWB 1TWGH 3OW2A 1OXTA 5BR8Q 4L5SA 2LSSA 1YITA 1XMQL 2Y0SE 2K75A 4DR2Q 4ALPA 2RF4A 1PH1A 3PUXA 1YI2A 3M85A 1HNZQ 1I6HH 4JI3Q 1VQEA 1NY4A 1UWVA 4DV0Q 1YBYA 2B3GA 4GOPA 1J5EQ 3I56A 3TREA 2CWAA 1G6PA 1J6QA 2RHSB 4A3IH 5FJ8H 1L1OB 4AYBG 3M3YH 2PI2A 3AQQA 3U58A 4XIGS 4LF8L 1U0LA 1M1KC 1VQHA 2K50A 4YHHL 1Y14B 2Q2IA 4X62L 1VQAA 2VUMH 1HNXL 3HOZG 4WJ3M 1AH9A 1PFSA 4BY1G 1K9MC 2A19A 3OTOL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB Q;  3OYY A;  3BZK A;  1OXU A;  4POG A;  3PUY A;  3TQY A;  4IO9 A;  5IYC G;  1YHQ A;  3PO3 H;  3NEM A;  1VQL A;  2YV5 A;  2K5V A;  4JOI C;  3HFZ B;  3G6E A;  4DV3 Q;  4A3C H;  1NBW A;  1XJV A;  1P8L A;  2K14 A;  3HOU H;  3CPW A;  1Y1V G;  5DLQ E;  1IBK Q;  3PO2 G;  2B29 A;  4C3J H;  3M9B A;  2EQS A;  4AIM A;  3KF6 A;  2N3S A;  1PH4 A;  3GTP H;  1E22 A;  4GNX C;  4A3E H;  1PHJ A;  3STB C;  4BY7 G;  4HID A;  4JI2 L;  3FP9 A;  4K0K Q;  1YEZ A;  4JG2 A;  4QQB X;  4GLX A;  1N32 Q;  2E2J H;  3T1H Q;  1W2B A;  1X55 A;  4O0A A;  5FLX c;  4DR3 Q;  4B3S L;  2JA8 H;  3PIP A;  4BA2 I;  4JI8 Q;  3TEH B;  4DUZ Q;  2UU9 Q;  5IWA L;  2Z6K A;  4JBJ A;  1N33 L;  1CUK A;  2K5N A;  1EQQ A;  4NXN L;  5C3E H;  2AMC B;  4DV2 Q;  3L2P A;  3CCS A;  2H5X A;  1WJJ A;  2NN6 G;  3L7Z C;  1DGS A;  3PV0 A;  3ZJY C;  3CC7 A;  5LMN W;  4A3G H;  5LMU Q;  5M5X H;  3BZC A;  1JMC A;  1OXV A;  2F4V Q;  2ID0 A;  4QY7 A;  1BBW A;  1QVG A;  4JI6 Q;  1C0A A;  2ALY B;  1EFW A;  2VY3 A;  4L5R C;  5LMN L;  4GKK L;  2WB1 E;  4DUY L;  3F8T A;  4LF7 L;  2UUB L;  2NZO A;  2R92 H;  1PH8 A;  1E1T A;  4JOI A;  4A3D H;  3NEL A;  3K0X A;  2HHH Q;  1VQB A;  2MQH A;  4DAY B;  2R93 G;  4X66 Q;  4WJ4 A;  1CKN A;  1PH7 A;  2BH8 A;  1LYL A;  2WAQ E;  2JA7 H;  5M5W H;  3CCV A;  2JA5 G;  3E9H A;  4GNX A;  1IXR A;  1VQ6 A;  1XNQ L;  2B63 H;  3ULL A;  1JJ2 A;  2ZJP A;  2E5L L;  2WP8 J;  3HOW H;  4JI7 L;  4PZ7 A;  4PZ8 A;  5ELN A;  3HOY H;  1EOV A;  2VL6 A;  2Q2T A;  3GTG H;  3KLW A;  1XPU A;  1UE1 A;  2HIV A;  4QGU A;  2JJQ A;  3ERS X;  4DAM A;  4PZ6 A;  3K7U C;  4BBR G;  4DUZ L;  2F3I A;  4JBW A;  4OX9 L;  2YTY A;  1PVO A;  3B6Y A;  3CCR A;  2UXC L;  2GVB A;  3EN2 A;  4YCW A;  4A3B G;  4DK3 C;  4DNI A;  3AFP A;  3EBE A;  1TWF H;  4LF8 Q;  2YTX A;  4P74 A;  5IT9 c;  3I4M H;  1Q8K A;  4YHH Q;  4X62 Q;  1PYB A;  4LFC L;  1Z9F A;  1EIY B;  1W3S A;  4JC0 A;  2K52 A;  1I50 H;  4IJH A;  3OTO Q;  3ULJ A;  2YU9 H;  1QZG A;  4A3I G;  1U5K A;  5FJ8 G;  4OXP A;  2Y0S G;  3S2D H;  2ZTD A;  4JV5 L;  3M4Q A;  4QIW E;  1IBL L;  3MXN B;  2E2I H;  1M90 C;  1EYG A;  3JAM c;  3CMA A;  4LFB L;  3STB D;  2VUM G;  3H15 A;  2IHF A;  4EQ5 A;  5IYD H;  3RN5 A;  3DM3 A;  1VQK A;  5E7N A;  3S17 H;  1HZA A;  2VZA A;  3J81 j;  3CCU A;  1ASZ A;  2OWO A;  2NVQ H;  2RCN A;  3S1M H;  2OQ0 A;  1XMO L;  2JA6 H;  2HIX A;  1GO3 E;  3PO3 G;  1A63 A;  3UE1 A;  1SLJ A;  4JI2 Q;  3CAM A;  1NMG A;  1XTD A;  2ZTC A;  1ASY A;  3CP0 A;  3UE0 A;  1WCM H;  1Y1W H;  2Q2U A;  4A3C G;  3GD7 A;  1UE5 A;  1YZ6 A;  1VQN A;  3HOU G;  1YHB A;  4A3K H;  4DR1 L;  4GOP B;  1KC8 C;  4B3S Q;  4AQY L;  1MJE A;  3J80 c;  1K83 H;  1HR0 W;  5IWA Q;  1UE7 A;  2KHJ A;  2UXD L;  1N33 Q;  4A3E G;  4HJ5 A;  1NJI C;  1BBU A;  1JT8 A;  1OXS C;  4RMF A;  4LF6 L;  2AWO A;  4NXN Q;  3S2H H;  1IL2 A;  4JI1 L;  2BA0 A;  2CWP A;  4YCU A;  1S40 A;  1Z47 A;  3CPF A;  4IPG A;  1HR0 L;  4DV7 L;  5ELO A;  3U4Z A;  5GAH C;  2JA8 G;  4LNQ A;  2QGQ A;  1VQC A;  3RN2 A;  5LMN Q;  1MJC A;  4GKK Q;  4DUY Q;  1WYD A;  4LF7 Q;  2YYZ A;  1IYJ B;  4LWC A;  3D31 A;  5IP7 H;  5C3E G;  2PNH A;  1E1O A;  1N8R C;  4HIK A;  4A3G G;  4MZ9 A;  3IRB A;  3HKZ E;  1PA6 A;  4B3M Q;  1PH5 A;  1QVC A;  2KBN A;  1C9O A;  5M3M H;  1V9P A;  3PGZ A;  2RHQ B;  4Y7N H;  1VQO A;  5FLM H;  3G71 A;  3KF6 B;  1K8G A;  4GLA C;  2K4K A;  1I94 Q;  2D0O A;  1XNQ Q;  2R92 G;  3HOX H;  4LUZ A;  2OTJ A;  2KCT A;  5C44 H;  3ICE A;  4A3D G;  2E5L Q;  4DV5 L;  3RNU A;  3KFU A;  5C0X I;  1SN8 A;  4JI7 Q;  3KOJ A;  1VQP A;  5IE8 A;  3I4O A;  3T1Y L;  4B3T L;  4J15 A;  4PMW A;  4UY8 C;  3H0G H;  5C0X J;  5EAY A;  2JA7 G;  1WI5 A;  2IT1 A;  4UP9 A;  2UUC L;  4H02 A;  2B63 G;  4LF4 L;  1Q82 C;  4OX9 Q;  1NE3 A;  1I3Q H;  1OXX K;  2UXC Q;  4AYB E;  2I5M X;  3CCQ A;  1JB7 A;  4GLV B;  2ZTE A;  1I5F A;  1VQ7 A;  3HOW G;  4IOC A;  4UP8 A;  3W1G A;  3HOY G;  1HZC A;  1D7Q A;  1YNX A;  4DR5 L;  2A1A A;  2UUA L;  1AE3 A;  1D8L A;  2VS1 A;  4LUV A;  4A3M H;  1KAW A;  3K80 C;  1EUJ A;  4LFC Q;  4LW1 A;  3K7A H;  3PSI A;  2D62 A;  4AH6 A;  4DV6 L;  1N34 L;  1R9T H;  4LF5 L;  1A62 A;  1HZ9 A;  2VQF L;  1QUQ A;  4GS3 A;  3UDX A;  3KJO A;  3WWV A;  3HOV H;  4UP7 A;  4OO1 I;  3PUZ A;  4JV5 Q;  1A8V A;  5C0X G;  4QL5 A;  5GQO A;  2OCE A;  4BXX H;  4PG3 A;  1KRT A;  1CKN B;  1HH2 P;  4MTN A;  4KHZ A;  4DR7 L;  3I4M G;  4LFB Q;  2BA1 A;  4B3M L;  3LGJ A;  1X9N A;  4LUO A;  2VQE L;  4GNX B;  1PYS B;  4C3I H;  3FKI H;  1LTL A;  1VS0 A;  1VQD A;  5GAE C;  1VQJ A;  1A0I A;  2IY5 B;  1GM5 A;  2JA9 A;  1I94 L;  2IX1 A;  1XMO Q;  4R4Q A;  1EIF A;  1FL0 A;  4GN5 A;  1PH6 A;  1X6O A;  3I4N H;  5C4X H;  3A5U A;  3AYH B;  2MO0 A;  4JI5 L;  1XPO A;  4NPS A;  1XNR L;  5IYD G;  4DR1 Q;  2E8G A;  3F1Z A;  4AQY Q;  5J3B A;  3Q8D A;  2NZH A;  4X6A H;  3GTO H;  3CC2 A;  2UXD Q;  4A93 H;  1TWA H;  2JA6 G;  3J7A 5;  1E3P A;  3ER0 A;  1K8A C;  4BBS H;  1NMF A;  2QA4 A;  4LF6 Q;  3FHW A;  1VQ9 A;  2NVX H;  4JI1 Q;  3RLO A;  1KD1 C;  2PQA A;  1YVC A;  1WCM G;  1Y1W G;  4DV4 L;  4A3K G;  1YHA A;  3KDF A;  4DV7 Q;  2MNA A;  1HR0 Q;  2VNU D;  1G29 1;  1E7Z A;  3PF4 A;  4OWT B;  4C3H H;  4GN4 B;  1JJG A;  4IFD I;  1K73 C;  5JJL A;  2R6G A;  1K0R A;  4A3F H;  4A3L H;  4BA1 I;  3S1R H;  2PI2 E;  2I5L X;  2XTI A;  1MKH A;  2ZJR A;  1B70 B;  1GVP A;  2R7D A;  3PUV A;  3UDF A;  1XPR A;  3NBH B;  1FJG Q;  1IBM Q;  1X54 A;  2OTL A;  1K3R A;  1Q1E A;  4GKJ L;  2DGY A;  1OTC A;  1SRO A;  4YY3 L;  1CSP A;  4XTC S;  1Q1B A;  3U4V A;  5GAG C;  3J81 i;  4LF9 Q;  4JI4 L;  1C7Y A;  3PIO A;  4R1J A;  5IP7 G;  3AEV A;  3TRZ A;  2K5H A;  4DV5 Q;  1L0W A;  1L1O C;  1WFQ A;  5M3F H;  1E24 A;  3L0O A;  3PUW A;  3T1Y Q;  4B3T Q;  1CSQ A;  4POF A;  5M3M G;  5FLM G;  2BH2 A;  1YJN A;  1X56 A;  3I55 A;  3GTK H;  1QVF A;  2UUC Q;  3HOX G;  2A8V A;  2JEB I;  5C44 G;  2QEX A;  2LXK A;  5JEA J;  2R7Z H;  1LM0 A;  2F52 A;  3J80 i;  4IPH A;  4YCV A;  4DR5 Q;  2UUA Q;  1UE6 A;  4HJA A;  1VQF A;  3H0G G;  2UXB L;  1FVI A;  1S72 A;  4A4I A;  2N49 A;  3A74 A;  1YIJ A;  1HZB A;  1Q46 A;  4O2D A;  1X65 A;  3NEN A;  4P75 A;  2JQO A;  4OWX B;  3M4O H;  1NTG A;  1TWC H;  1YJW A;  4KLK A;  2L15 A;  4B3R L;  1HNW L;  4DV6 Q;  4HIM A;  1N34 Q;  2LXJ A;  3PF5 A;  2VQF Q;  4LF5 Q;  3U50 C;  1VQM A;  3S1N H;  3TS0 A;  3KJP A;  2OQK A;  1KRS A;  4JBK A;  4DK6 C;  4EX5 A;  4JYA L;  4YWK A;  4RG1 A;  3H3V I;  3GTQ H;  1SMX A;  4DR7 Q;  4YWM A;  1IBM L;  3KYH C;  1FJG L;  1X3E A;  4FDB A;  4KHP L;  1IZ6 A;  4A3M G;  1RIP A;  1WOC A;  1LUZ A;  2VQE Q;  5IYB H;  3CQZ H;  2CQO A;  4JI0 L;  2DUD A;  2CCZ A;  4LF9 L;  2Z6K C;  1SR3 A;  5JEA G;  3HOV G;  3S16 H;  4IPC A;  4OON A;  3GO5 A;  1L1O A;  4P73 A;  3GTJ H;  2D0P A;  4BXX G;  3BU2 A;  2ZM6 L;  5HY6 A;  4TQU S;  3CF5 A;  2IHE A;  3J7Z C;  2PMZ E;  3F2C A;  4JI5 Q;  3SGI A;  4A3J H;  1BVS A;  1XNR Q;  5IP9 H;  3FKI G;  2AHO B;  4IPD A;  1FGU A;  2WB1 G;  4X64 L;  2GVA A;  4HJ9 A;  3BJU A;  2MFI A;  3A5Z B;  2NN6 I;  3UDI A;  4DR6 L;  2FXQ A;  2I5H A;  4HIO A;  3CC4 A;  4DR4 L;  3I4N G;  1O7I A;  5C4X G;  1GKH A;  3CCL A;  4NXM L;  4DV4 Q;  5C4J H;  2WAQ G;  1N36 L;  1VQ8 A;  1KHI A;  2R7F A;  2NVY H;  1Q81 C;  3EIV A;  3MEF A;  4A75 A;  3M4P A;  1QUQ B;  2JE6 I;  4R4O A;  4A93 G;  1HJP A;  5AJ3 Q;  4GN3 B;  4R4I A;  1Q12 A;  1QZH A;  5BR8 L;  1KQS A;  4BBS G;  1N9W A;  4P71 A;  1S3O A;  4X65 Q;  4DR2 L;  3F2B A;  2NVT H;  1HNZ L;  4GKJ Q;  4JI3 L;  3S24 A;  4R4C A;  4YY3 Q;  3E0E A;  3HOZ H;  1G51 A;  4DV0 L;  1AE2 A;  4BY1 H;  3CD6 A;  1J5E L;  1VCI A;  2KCM A;  2N8N A;  4JI4 Q;  2CFM A;  2IX0 A;  3CXC A;  4JBM A;  2MO1 A;  4A3F G;  4A3L G;  1KXL A;  4NB3 A;  1PH2 A;  5IYC H;  3RLN A;  4DV1 Q;  1SRU A;  3M7N A;  4IJL A;  5IY0 A;  2EXD A;  2WFW A;  1PH9 A;  5JJI A;  3GTM H;  4L5T A;  4UPA A;  3H3V H;  1Y1V H;  3DLL A;  3RZO H;  1PH3 A;  2E2H H;  3PO2 H;  3E9I A;  1Q7Y C;  2ZJQ A;  4APV A;  1Q86 C;  1SFO H;  2Q2H A;  4ME3 A;  4BY7 H;  1B7Y B;  3ULP A;  3CME A;  2PQA B;  3PCO B;  3JC6 6;  4DV3 L;  5M3F G;  4OO1 G;  4L5Q A;  4DPG A;  3GTL H;  1BKB A;  3KDF B;  2V1C C;  1EWI A;  4MNO A;  5M5Y H;  2Z0S A;  2UXB Q;  4Y52 H;  3HKS A;  3W1B A;  3CCM A;  4LFA Q;  4A76 A;  1IBK L;  1IBL Q;  3CCE A;  3UDG A;  4LF4 Q;  5K36 G;  2N78 A;  1B8A A;  1VQI A;  1VQ4 A;  4B3R Q;  2YTV A;  1HNW Q;  4JCV E;  5GRO A;  4HJ8 A;  3RR5 A;  5AJ3 L;  1XMQ Q;  2ATW A;  4K0K L;  2EIF A;  2R7Z G;  4C2M H;  4JYA Q;  1N32 L;  1VQ5 A;  3W5O A;  3T1H L;  4IFD J;  4X65 L;  3AFQ A;  1GD7 A;  4HJ7 A;  3VDY A;  2HQL A;  4KHP Q;  4DR3 L;  5JJK A;  4YWL A;  4TVA B;  1JJC B;  1VQG A;  4R4T A;  5H1S E;  1YJ9 A;  1PV4 A;  4JI8 L;  2UU9 L;  1L2F A;  2KHI A;  4JI0 Q;  1T9H A;  4GOP C;  3G48 A;  3K81 C;  1V43 A;  4QJF A;  1CKO A;  1TWH H;  1X3F A;  3JAM i;  2HT1 A;  1KL9 A;  4DV2 L;  1EQR A;  3RZD H;  4DV1 L;  1JE5 A;  2VW9 A;  5LMU L;  2ZM6 Q;  2R93 H;  1HNX Q;  1CKM A;  5HGQ A;  2F4V L;  1P16 A;  3S1Q H;  4JI6 L;  1V1Q A;  5IYB G;  2CKZ B;  3CCJ A;  1UEB A;  2JA5 H;  3I2Z A;  3TS2 A;  1RL2 A;  2ES2 A;  4X64 Q;  4P72 A;  3J81 c;  1H95 A;  2AWN A;  4DKA C;  1MIU A;  4IFD G;  2I0Q A;  4DR6 Q;  1SE8 A;  3KF8 B;  3S15 H;  2HHH L;  2GN5 A;  4DR4 Q;  2C35 B;  2ASB A;  2JEA I;  3I7F A;  3HKZ G;  4X66 L;  1KIX A;  4NXM Q;  1TXY A;  4KI0 A;  3G4S A;  3F2D A;  2JK8 A;  2KEN A;  4A3J G;  5GAD C;  1N36 Q;  3GDE A;  5IP9 G;  1X3G A;  4LFA L;  4OWW B;  3S14 H;  4BBR H;  2XGT A;  3A0J A;  3RLF A;  4IOA A;  3CW2 C;  3D0F A;  3K8A A;  4A3B H;  2AKW B;  1TWG H;  3OW2 A;  1OXT A;  5BR8 Q;  4L5S A;  2LSS A;  1YIT A;  1XMQ L;  2Y0S E;  2K75 A;  4DR2 Q;  4ALP A;  2RF4 A;  1PH1 A;  3PUX A;  1YI2 A;  3M85 A;  1HNZ Q;  1I6H H;  4JI3 Q;  1VQE A;  1NY4 A;  1UWV A;  4DV0 Q;  1YBY A;  2B3G A;  4GOP A;  1J5E Q;  3I56 A;  3TRE A;  2CWA A;  1G6P A;  1J6Q A;  2RHS B;  4A3I H;  5FJ8 H;  1L1O B;  4AYB G;  3M3Y H;  2PI2 A;  3AQQ A;  3U58 A;  4XIG S;  4LF8 L;  1U0L A;  1M1K C;  1VQH A;  2K50 A;  4YHH L;  1Y14 B;  2Q2I A;  4X62 L;  1VQA A;  2VUM H;  1HNX L;  3HOZ G;  4WJ3 M;  1AH9 A;  1PFS A;  4BY1 G;  1K9M C;  2A19 A;  3OTO L; 
#chains in the Genus database with same CATH topology
 1MGS A;  5FLX L;  3OYY A;  3NWS A;  4IO9 A;  1F2L A;  2NZ1 D;  2K5V A;  1PRT B;  2EYO A;  3EVQ A;  1NBW A;  3ERO A;  1P8L A;  1F9Q A;  3HOU H;  3MAQ A;  3OWF A;  3M4O B;  3NUC A;  2QCP X;  1PH4 A;  4RGO S;  3S1N B;  1E22 A;  4GNX C;  2XWB B;  1LT4 D;  3STB C;  1AN8 A;  1LTG D;  1EQT A;  4DXG A;  4K0K Q;  4QQB X;  1LTB D;  4GLX A;  1N32 Q;  1EYD A;  3T1H Q;  1W2B A;  2ZXR A;  5D3D A;  1CI3 M;  2K6A A;  2VXW A;  5M3M B;  2DN8 A;  4JI8 Q;  3TEH B;  3PIP 3;  3ONA B;  5JPM C;  3D8G A;  3JAM E;  1SJH D;  5CYU A;  3GTJ B;  1Z6H A;  2AMC B;  3A54 A;  2H5X A;  1HA6 A;  3L7Z C;  3CKI B;  3PV0 A;  5LMU Q;  5M5X H;  1SNC A;  2F4V Q;  2F0E A;  5CV4 A;  4OL7 A;  3H6M A;  5F2D A;  4DUY L;  1STN A;  4LF7 L;  1GUW A;  1EQV A;  5FO7 B;  1BDO A;  3MFY A;  5DEH A;  4OEM B;  1SYF A;  3K0X A;  1SNM A;  4DAV A;  1S5B D;  1VQB A;  2MQH A;  5EPJ A;  4DAY B;  2R93 G;  2CHB D;  4MHE A;  1PYW D;  1LYL A;  3E9H A;  4GNX A;  3DWA A;  1VQ6 A;  1V1O A;  4AYB B;  5NUC A;  1HTL D;  2L55 A;  2WP8 J;  4PZ7 A;  2NVT B;  3GTG H;  1EOT A;  4C1N K;  1PTO B;  1X32 A;  2HIV A;  4WFN 3;  2JJQ A;  3KBX A;  3ERS X;  4DAM A;  4PZ6 A;  3JAM L;  4OX9 L;  3B6Y A;  3QR8 A;  4YCW A;  4A3B G;  4F8M A;  3EBE A;  2YTX A;  4L6T B;  4P74 A;  5C4X B;  5IT9 c;  3OMG A;  1PYB A;  5KEE A;  3ULJ A;  4NP5 A;  1G8Z D;  5FJ8 G;  1Q90 A;  4OXP A;  3S2D H;  3K0Y A;  4JV5 L;  3M4Q A;  3GTL B;  2E2I H;  3SK4 A;  2HCI A;  4XDX A;  5E7N A;  3CCU A;  1RTN A;  2RDH A;  1XMO L;  2JA6 H;  1Y8P B;  2F0Q A;  2QDL A;  2ZTC A;  3UE0 A;  3R8B A;  4A3C G;  1UE5 A;  1YHB A;  1KC8 C;  4C3J G;  4JW0 A;  1UE7 A;  2PW5 A;  5IWA Q;  2WV6 D;  1WTX A;  1N33 Q;  4QUC A;  1SND A;  2PZU A;  3CPF A;  1NR2 A;  3GTK B;  3MA2 B;  4O42 A;  3S15 B;  4LWC A;  3K5M A;  2H4O A;  1HQM C;  2G5D A;  2R7Z B;  4ZQ3 A;  3IRB A;  2KBN A;  5JVG 3;  4Y7N H;  5FLM H;  1O80 A;  3G71 A;  2EJM A;  4BBR B;  5EGT A;  3MEH A;  3V96 A;  1JCK B;  1AEX A;  2D0O A;  1XNQ Q;  2R92 G;  4LMQ D;  4LUZ A;  4ZYS A;  3ICE A;  4X3K A;  4H13 C;  3KOJ A;  2F0N A;  1NSN S;  2X6L A;  4FXK C;  5C0X J;  4DK0 A;  2IT1 A;  3T4A C;  2KEC A;  2UUC L;  4H02 A;  2A69 C;  1BCP B;  2OT2 A;  4AYB E;  1SBB B;  1JB7 A;  3HOW G;  4IOC A;  2L0C A;  1DOM A;  4DGZ A;  1A3T A;  2A1A A;  1SSO A;  2VUM B;  1K0S A;  4CHT B;  3EFX D;  4LFC Q;  1EUJ A;  4LW1 A;  2A6E C;  3K7A H;  4M1U B;  2WKC A;  3PSI A;  4E6I A;  3K58 A;  1HZ9 A;  4OO1 I;  1GXD C;  3PUZ A;  4BXX H;  4PG3 A;  4HSP A;  1CKN B;  2BA1 A;  3I72 A;  1X9N A;  2VQE L;  2B39 A;  1ILQ A;  2ICI A;  1LTL A;  4A3E B;  1VQD A;  4KHV A;  2O4X A;  2ZXP A;  5GAE C;  2JA9 A;  1B53 A;  4R4Q A;  1DCZ A;  1FL0 A;  2E2J B;  3SE0 A;  1X6O A;  3I4N H;  4FYD A;  4ME5 A;  4JI5 L;  3HOZ B;  1XNR L;  5IYD G;  4DR1 Q;  4PMB A;  1MD2 D;  5J3B A;  4Q5V A;  3GTO H;  3CC2 A;  4LAA A;  1QJO A;  4A93 H;  2G9D A;  3EA6 A;  1E3P A;  3MTS A;  2OEO A;  4BBS H;  3FHW A;  2NVX H;  2PQA A;  1WCM G;  4CKE A;  1T5E A;  4A3K G;  1HR0 Q;  3KDF A;  1E7Z A;  3H94 A;  3PF4 A;  5JJL A;  2R6G A;  4A3D B;  1EWH A;  2F0G A;  3S1R H;  2PI2 E;  2E76 C;  1MKH A;  1B70 B;  1GVP A;  2R7D A;  3UDF A;  3NBH B;  1FJG Q;  1X54 A;  1K3R A;  4FVM A;  4GKJ L;  1I4P A;  2J4X A;  5M5W B;  4XTC S;  3T53 B;  3MHB A;  1ILP A;  4JI4 L;  1C7Y A;  4R1J A;  5IP7 G;  3AEV A;  3HOY B;  3NXW A;  4M8A A;  1EY8 A;  1L0W A;  2F0H A;  3PIO 3;  3TBI B;  5M3F H;  3M7G A;  1E24 A;  3T1Y Q;  1VF5 C;  5A2Q E;  2B2T A;  1EWC A;  5IGC A;  2A8V A;  5C44 G;  2QEX A;  1CZW A;  2LXK A;  3RZD B;  3TZU A;  1LM0 A;  3I4M B;  3OMC A;  3RMH A;  1UE6 A;  3V05 A;  3H0G G;  1PRT C;  4A4I A;  2N49 A;  1IBL L;  1Q46 A;  2TMP A;  4O2D A;  5CMD A;  3M4O H;  2IL8 A;  1YJW A;  4B3R L;  1HNW L;  1VDZ A;  3PF5 A;  2VQF Q;  2DNE A;  3S1N H;  1VQM A;  1SAP A;  4JYA L;  5CV6 A;  1K8M A;  4H0L C;  1FJG L;  3KLS A;  4FDB A;  2M2L A;  2CQO A;  4JI0 L;  2Z6K C;  2KUM A;  3EJI A;  5JEA G;  4GZY C;  3HOV G;  4OON A;  3F2U A;  5CV7 A;  4P73 A;  3GTJ H;  2D0P A;  3MZ5 A;  4KKU A;  3BU2 A;  4HMI A;  5A2Q L;  2ZM6 L;  2RBM A;  2EY1 A;  3J7Z C;  3F2C A;  2FMC A;  3QJY A;  1BVS A;  3SVM A;  2F0K A;  1K83 B;  2XN9 C;  2AHO B;  4DNT B;  4CBV A;  2WB1 G;  5KGU A;  3R3O A;  2NN6 I;  4DR6 L;  5C5M A;  3SEB A;  2M00 A;  1O7I A;  4NXM L;  1ENA A;  2H1E A;  3TP6 A;  4DV4 Q;  4WRD A;  5C4J H;  1LAB A;  4N8X 1;  3Q6S A;  1KHI A;  1CA6 A;  3P7J A;  1GOZ A;  1HJP A;  5AJ3 Q;  4GN3 B;  1KQS A;  1QZH A;  4DR2 L;  3LX0 A;  2NVT H;  3KLR A;  1TS4 A;  1PTO H;  2F0S A;  1G51 A;  1NR4 A;  1GUT A;  4DV0 L;  1PTO C;  4CGY B;  3CD6 A;  2NTS A;  5LL6 S;  2CW0 D;  2CFM A;  2IX0 A;  4A3L G;  1EL0 A;  1KXL A;  1PH2 A;  1V1P B;  3RLN A;  3M7N A;  2EXD A;  2XVS A;  1Y69 U;  4UPA A;  3A7A B;  3H3V H;  1DOK A;  1XWE A;  3H3V C;  1PH3 A;  2E2H H;  1BQQ T;  4DN4 M;  1QE6 A;  4RA8 A;  1J8I A;  5CGK A;  1IKL A;  3FRP B;  2XWJ B;  1H9S B;  4F87 A;  2Q2H A;  4ME3 A;  1WTH A;  3CME A;  5IGF A;  3PCO B;  3JC6 6;  4DV3 L;  4OO1 G;  2RKS A;  3GTL H;  3A8J E;  4DAY A;  4Y52 H;  2Z0S A;  2UXB Q;  3CCE A;  2K05 A;  3T51 B;  2KQ3 A;  1R9T B;  4FXD A;  2J0T D;  5AJ3 L;  1XMQ Q;  3KUP A;  5CV5 A;  1CT1 D;  4C2M H;  4IFD J;  2JXM B;  1Q8I A;  4KHP Q;  1KDB A;  3L9A X;  3G6J B;  3NTH A;  1ENC A;  4DR3 L;  3FKI B;  1JJC B;  1VQG A;  4ULL A;  3K81 C;  1IL8 A;  4JVZ A;  2B8G A;  3GTG B;  1DYQ A;  1V1Q A;  2CKZ B;  3I2Z A;  2ES2 A;  4X64 Q;  4P72 A;  3J81 c;  1H95 A;  3KF8 B;  3S15 H;  2HHH L;  4EGV A;  4DR4 Q;  2JEA I;  3HKZ G;  4X66 L;  1HFG A;  4KI0 A;  4KK7 A;  2B2W C;  2JK8 A;  4A3J G;  5I2X A;  1N36 Q;  1A3U A;  2F3W A;  3UI2 A;  4OWW B;  1FNU A;  4BBR H;  3D6W A;  3BYT B;  5DM7 3;  2K1B A;  3D0F A;  1TWG H;  3QOJ A;  1XMQ L;  2Y0S E;  2K75 A;  2XSC A;  2E2I B;  3PUX A;  5C4H A;  1O7L A;  4JI3 Q;  1ESR A;  3I56 A;  3TRE A;  4R8N A;  3NQI A;  4IZ8 A;  2JA6 B;  2AUJ D;  2PI2 A;  1K3B C;  2V4D A;  1W6J A;  5I9P A;  4LF8 L;  1WD0 A;  1BCP C;  1VQH A;  2K50 A;  5JJZ A;  1VQA A;  2VUM H;  4KD3 A;  4WJ3 M;  4HR7 B;  4BY1 G;  1FD7 D;  5C4Z A;  3BZK A;  2MPM A;  4POG A;  1IW7 D;  3PO3 H;  3NEM A;  1VQL A;  2YV5 A;  3K57 A;  3HFZ B;  1XJV A;  1DZ1 A;  2L5T A;  1Y1V G;  1IBK Q;  3PO2 G;  2EQS A;  3I90 A;  4AIM A;  4A3E H;  2R3Z A;  2M9V A;  5IT9 E;  4BY7 G;  4HID A;  4JI2 L;  3GTQ B;  2SDF A;  3C1E A;  1YEZ A;  1V8Q A;  2X69 A;  2E2J H;  1X55 A;  1A2T A;  5CBE E;  1D2B A;  4KTA A;  4Y7N B;  2L1B A;  3QB3 A;  1JWU D;  4B3S L;  4BA2 I;  3S16 B;  5ELB A;  3VR6 A;  1CUK A;  3OSO A;  2BE5 D;  3DHQ A;  1EQQ A;  4DV2 Q;  2NN6 G;  5LMN W;  2IW3 A;  5C3X A;  4IUP A;  1QNK A;  1JMC A;  2EJF C;  1LAC A;  1S5C D;  2ID0 A;  4JI6 Q;  2JYO A;  5LMN L;  5JVH 3;  3VR5 A;  4A3D H;  2JN4 A;  2HDL A;  5D14 A;  3BDC A;  2D5D A;  1CKN A;  5DM6 3;  3PQI A;  1X3Q A;  1TII D;  3E6Z X;  5IT9 L;  3K7A B;  5M5W H;  3VYR A;  2JA5 G;  2JA7 H;  1R4P B;  1IXR A;  3ULL A;  1PFB A;  4WJW A;  4OIK A;  2F0I A;  3TP5 A;  4PZ8 A;  3HOY H;  2Q2T A;  4G57 A;  1GUG A;  1XPU A;  2B2Y A;  1SE2 A;  3VYT A;  4QGU A;  4V19 0;  1HCZ A;  5I4D A;  4LK1 C;  3K7U C;  1IYV A;  1DXM A;  4TRD A;  4JBW A;  2YTY A;  2EE1 A;  3VR4 A;  4DU9 A;  1STG A;  3EN2 A;  1STH A;  4DK3 C;  1F9R A;  3AFP A;  3CHB D;  3I4M H;  1Q8K A;  3RZO B;  4X62 Q;  3J7A F;  4JC0 A;  1I50 H;  3OTO Q;  2RDF A;  2YU9 H;  3GTO B;  1QZG A;  4A3I G;  1U5K A;  1T5X D;  2F0T A;  3ERQ A;  4KN4 C;  2QDB A;  2A6H D;  4RKL A;  3T13 A;  1Y8O B;  1EYG A;  3BYY B;  5M5Y B;  3NBH A;  4LFB L;  3H91 A;  3MXN A;  3H15 A;  3NPP A;  1MSG A;  3TDQ A;  3J81 j;  3S1M H;  4XQN A;  3J7A V;  2OQ0 A;  3P1H A;  4K8J A;  2CW0 C;  3OIQ A;  1NAP A;  4HMJ A;  1HPC A;  3NK9 A;  5EKI A;  2A5H A;  1Y1W H;  4DXF A;  3GD7 A;  4ILW A;  4DFA A;  3URY A;  1WTW A;  1SEB D;  3BG3 A;  4GOP B;  3SXH A;  1MJE A;  3HGB A;  1K83 H;  5K5P A;  2KHJ A;  3X3M A;  4B9X A;  4HJ5 A;  1NJI C;  1JT8 A;  4RMF A;  1F77 A;  4JI1 L;  2BA0 A;  5IIF A;  2R93 B;  4K6L A;  1Z47 A;  5AFW A;  2RCF A;  2MJ8 A;  4DV7 L;  5GAH C;  2JA8 G;  4RAU C;  2VB3 X;  1MJC A;  4DUY Q;  4LF7 Q;  1ZEQ X;  1IYJ B;  2L12 A;  5C3E G;  2PNH A;  1E1O A;  1NNX A;  1VMP A;  4A3G G;  1FNV A;  4B3M Q;  1QVC A;  1V9P A;  2RHQ B;  4K2K A;  3KF6 B;  1K8G A;  5CC4 A;  4K5X A;  3HOX H;  3A55 A;  1L0Y B;  3RNU A;  1VQP A;  5IE8 A;  1EY6 A;  3I4O A;  1GHJ A;  1RKN A;  4UY8 C;  3QIA A;  1KTK A;  2RSO A;  1GJX A;  1CA5 A;  2B63 G;  1Q82 C;  4OX9 Q;  1NE3 A;  1EEF D;  4GLV B;  1WTO A;  1STY A;  4UP8 A;  1HZC A;  1YNX A;  1AE3 A;  1D8L A;  1YNJ C;  2F0M A;  4F88 A;  4LUV A;  4A3M H;  3K80 C;  2F0F A;  5DAU A;  1I6V C;  3BVG A;  1CQV A;  1U4P A;  3HP3 A;  1STA A;  1R9T H;  1A62 A;  4GS3 A;  3D4D A;  3UDX A;  4UP7 A;  4JV5 Q;  1A8V A;  5C0X G;  5GQO A;  1XXG A;  1KRT A;  1DJR D;  4B3M L;  3LGJ A;  5C4J B;  4LUO A;  4C3J B;  4YIJ A;  3FKI H;  1JOK A;  1C48 A;  3ND9 A;  3NQT A;  5EKK A;  2MP1 A;  1JWS D;  1A0I A;  1E2W A;  3Q22 A;  2IY5 B;  2IX1 A;  1XMO Q;  3RUZ A;  1EIF A;  2IX3 A;  1TKW B;  1PH6 A;  4ZKB B;  1B9N A;  2N88 A;  1XPO A;  4NPS A;  1DM0 B;  2RA4 A;  1TWA H;  1H9S A;  3CRK C;  2K01 A;  5HUR A;  3D6C A;  1G29 1;  5M9O A;  2E2H B;  4GN4 B;  2R92 B;  4IFD I;  1TY2 A;  1K0R A;  4HN7 A;  1AW7 A;  1PFN A;  1BNZ A;  2ZJR A;  3AU7 A;  5JPN C;  1QG7 A;  1YNN D;  1IBM Q;  1LTS D;  4IUT A;  1SRO A;  4YY3 L;  1CSP A;  3U4V A;  2PQE A;  3J81 i;  4KN7 C;  2F0D A;  1PRT F;  1UUP A;  4RCN A;  3HOW B;  2K5H A;  1EY5 A;  3H09 A;  1WTV A;  4C2M B;  1WFQ A;  3L0O A;  1SXT A;  1D6E C;  1CSQ A;  5M3M G;  2N55 A;  1QCB D;  1ZYR D;  5CV8 A;  1M4V A;  1YJN A;  1X56 A;  1C8C A;  3U9S A;  2UUC Q;  1AZP A;  1CZG A;  3FVQ A;  1O78 A;  3KF8 A;  2F52 A;  3J80 i;  1LT5 D;  2KCN A;  1VQF A;  1SYC A;  4N9T A;  4HJA A;  1S72 A;  5I6Y A;  3DUZ A;  3HZX A;  4LF4 L;  4OWX B;  4EQO A;  2NWG A;  1TWC H;  1NCV A;  2B2V C;  1LV9 A;  5KRU A;  4HCE A;  4JBK A;  4YWK A;  3GTQ H;  1OO9 B;  3E3X A;  2HQE A;  1IBM L;  3T16 A;  1WOC A;  1TU2 B;  1LUZ A;  2VQE Q;  5IYB H;  2DUD A;  1WD1 A;  1SR3 A;  3S16 H;  2K32 A;  3GO5 A;  1H9M A;  1PZI D;  1TWG B;  1WCM B;  4NDX A;  1EY7 A;  5HY6 A;  1EY4 A;  4J8Q A;  1H9J A;  2IHE A;  4JI5 Q;  3SGI A;  1XNR Q;  3VR2 A;  4C3I G;  5IP9 H;  4CDF C;  1SMY D;  2GVA A;  5E3F A;  1PTO F;  2I5H A;  3C46 A;  5C4X G;  4F7X A;  1WTQ A;  4XQQ A;  2WAQ G;  4A75 A;  3FMC A;  1QUQ B;  1BXT A;  4R4O A;  3MXP A;  1O7Z A;  2X6G A;  3K5L A;  1S5D D;  3PO3 B;  1S3O A;  2PO4 A;  4X65 Q;  2EYH A;  1HNZ L;  4GKJ Q;  4CDD C;  3K5O A;  2O5I C;  3J81 E;  2F0V A;  1MSH A;  4C3H G;  2JP1 A;  1QWY A;  1RF2 D;  5C44 B;  4JI4 Q;  1B3A A;  4JBM A;  2MO1 A;  4A3F G;  5BN3 A;  4DV1 Q;  1SRU A;  1PH9 A;  5JJI A;  4RGN A;  3GTM H;  1EYC A;  2DY7 A;  3MFG A;  2WAC A;  3RZO H;  1UNS A;  3E9I A;  1Q7Y C;  2ZJQ A;  3I3C A;  4APV A;  3VYU A;  2PW7 A;  4FXG C;  1SFO H;  1BR9 A;  1QOH A;  1BKB A;  1EU4 A;  2K04 A;  2V1C C;  1EWI A;  5M5Y H;  2HD3 A;  3X3N A;  3CCM A;  1IBL Q;  2HCC A;  3P75 A;  5K36 G;  3OW7 A;  3HOV B;  3CRL C;  4B3R Q;  1HNW Q;  4JCV E;  4CJ0 B;  2EIF A;  2R7Z G;  3J81 L;  3IL8 A;  4JYA Q;  1VQ5 A;  3W5O A;  3FEW X;  4X65 L;  4HJ7 A;  2HQL A;  5JJK A;  1ICW A;  4TVA B;  5H1S E;  2JA7 B;  2WB1 B;  2UU9 L;  4JI0 Q;  4GOP C;  3FPU B;  1V43 A;  1K28 A;  4KV6 A;  1CKO A;  5COY A;  2HT1 A;  2EY6 A;  1C4Q A;  3KBG A;  5LL6 X;  1EQR A;  4DV1 L;  2VW9 A;  2ZM6 Q;  2R93 H;  1CKM A;  1A3V A;  3VA5 A;  4K8I A;  3S1Q H;  4RKB A;  1CFM A;  1RL2 A;  2K33 A;  1SNO A;  2A74 C;  1MIU A;  4IFD G;  4DR6 Q;  4KKT A;  1SE8 A;  3MC0 B;  1IKM A;  3W3A A;  2R61 A;  4OEL B;  4NXM Q;  3K5N A;  1BCP F;  1CQF A;  1I50 B;  2YU9 B;  2PNR C;  4IOA A;  3LWE A;  3CW2 C;  3K8A A;  4V0B A;  4A3B H;  1OXT A;  2LSS A;  2QF7 A;  4DR2 Q;  5KIX A;  1HA5 A;  1ICF B;  1NY4 A;  4DV0 Q;  4GOP A;  5EPK A;  2CWA A;  3S1M B;  1G6P A;  1S5E D;  1L1O B;  5FJ8 H;  4QIW B;  3U58 A;  4XIG S;  4X3S A;  1Y1W B;  4YHH L;  1Y14 B;  2CQA A;  3HOZ G;  2CVR A;  1RJT A;  1H9K A;  1AH9 A;  1PFS A;  2A19 A;  4ZUI A;  3DWQ A;  2UUB Q;  4RGT A;  3C1F A;  1FYC A;  3TQY A;  3DEO A;  1D1I A;  3TP7 A;  3OIP A;  5IYC G;  1YHQ A;  5G3L D;  4JOI C;  2NBF A;  4DV3 Q;  3G6E A;  4A3C H;  4ZRZ A;  3CPW A;  5DLQ E;  4PMC A;  5ELE A;  2B29 A;  4C3J H;  4ZKC B;  4H44 C;  2I07 B;  3KF6 A;  1EFI D;  4B08 A;  4PNY A;  3Q24 A;  1M8A A;  2DNC A;  3FP9 A;  1SE3 A;  2DJG C;  4JG2 A;  2AQ2 B;  3CQZ B;  4DR3 Q;  4DUZ Q;  2Z6K A;  4JBJ A;  2K5N A;  2B2U C;  3HOX B;  4DA2 A;  4NXN L;  1JIC A;  3L2P A;  1RTO A;  3HKZ B;  1WJJ A;  1DGS A;  2K5D A;  3BZC A;  1OXV A;  2K7V A;  3MWY W;  1BBW A;  2QW7 A;  4X3T A;  4U68 A;  4ABN A;  1SNQ A;  1EFW A;  4L5R C;  1PXU A;  4GKK L;  2WB1 E;  1F2Z A;  3F8T A;  1XYI A;  2UUB L;  2NZO A;  2R92 H;  4RFB A;  1PH8 A;  1E1T A;  4JOI A;  1KNA A;  1LO5 D;  1TS5 A;  2KA7 A;  1H9R A;  2HHH Q;  1ZKO A;  2EJG C;  4I7A A;  2SOB A;  2Z6B A;  4X66 Q;  4WJ4 A;  2NVY B;  5IGB A;  5ELC A;  4A3M B;  2I46 A;  1QNU A;  1RCV D;  1JJ2 A;  4ZK9 B;  2E5L L;  3HOW H;  4JI7 L;  5ELN A;  1EOV A;  1ML0 D;  2KED A;  2NB0 A;  2RQX A;  1UE1 A;  1JOR A;  4I65 A;  2A68 D;  2NTT A;  2IPK D;  5T1G A;  1PZK D;  4DUZ L;  1PVO A;  3CCR A;  2UXC L;  1UEA B;  3A56 A;  3WDN A;  1TWF H;  4LF8 Q;  1JQY D;  1Y1V B;  5EBD A;  1Z9F A;  3PO2 B;  1W3S A;  2L9H A;  1QB5 D;  4NW2 A;  4BY7 B;  1TWA B;  2Y0S G;  4QIW E;  1M90 C;  2BCO A;  3IFT A;  5E4W C;  3CMA A;  1AP0 A;  3STB D;  2IHF A;  4EQ5 A;  5IYD H;  3RN5 A;  1KNE A;  3J7Y W;  1VQK A;  1JWM D;  2VZA A;  1A2U A;  5E1F A;  2OWO A;  2RCN A;  4Q0F A;  4O1N A;  1GO3 E;  4XQJ A;  1SLJ A;  4J1M A;  4JI2 Q;  3CAM A;  1XTD A;  4KKS A;  4BWG B;  1WCM H;  3HOU G;  4A3K H;  4B3S Q;  4AQY L;  2XRQ D;  3J80 c;  2UXD L;  1TWH B;  3DXJ C;  1OXS C;  4LF6 L;  1IL2 A;  2CWP A;  4YCU A;  1S40 A;  4BS9 A;  2EY2 A;  4IPG A;  2KJX A;  3U4Z A;  3NWT A;  2MHV A;  4HSV A;  4LNQ A;  2QGQ A;  1VF7 A;  4JPB W;  3RN2 A;  2IJ0 A;  5LMN Q;  1WYD A;  4RHS A;  5IP7 H;  1N8R C;  4HIK A;  3HKZ E;  1PA6 A;  1PH5 A;  1ESF A;  2PCF B;  1C9O A;  4S3S A;  2B2W A;  3PGZ A;  1SYB A;  5T1I A;  2K4K A;  1TWC B;  1I94 Q;  4FO2 A;  3NBI A;  5C44 H;  5ISR A;  4DV5 L;  5C0X I;  4XT1 B;  1JC7 A;  1LT6 D;  2WIN B;  4JK1 C;  4OGQ C;  4B3T L;  4J15 A;  4IUQ A;  3H0G H;  4XXE A;  1G91 A;  3WOE A;  3C3L A;  2BDO A;  3M3Y B;  2QEJ C;  1LTI D;  3OPO A;  1I3Q H;  1OXX K;  3CCQ A;  2ZTE A;  1I5F A;  2Q8R E;  1D7Q A;  2ZT9 C;  1SE4 A;  4ID6 A;  1U4L A;  4DR5 L;  2UUA L;  1EIG A;  5C3W A;  2VS1 A;  3I70 A;  2CH4 W;  2D62 A;  2Z8L A;  5JEA H;  4DV6 L;  1JE4 A;  1N34 L;  2D9U A;  3WOF A;  4LF5 L;  5COR A;  3HOV H;  1QUQ A;  3U9O A;  4KY6 A;  1SYG A;  4QL5 A;  3N6R A;  4DR7 L;  1HH2 P;  4MTN A;  4KHZ A;  4LFB Q;  2AQ3 B;  1CTM A;  1B1Z A;  1PYS B;  3GTP B;  4XT3 B;  1VS0 A;  2E74 C;  1S4Z A;  1VQJ A;  1GM5 A;  1I94 L;  2SEB D;  3BS1 A;  5J1Z A;  4TSS A;  2KVM A;  1J9O A;  4I7Z C;  4KJN A;  3A5U A;  3AYH B;  3R93 A;  2MO0 A;  2JA8 B;  2E8G A;  3F1Z A;  4OHJ A;  2QIL A;  4K6D A;  4X6A H;  2KCC A;  5C3E B;  2JA6 G;  3GP7 A;  1II3 A;  1G6Z A;  3ER0 A;  2QA4 A;  1VQ9 A;  4JI1 Q;  1SDF A;  3GTM B;  5LHY 1;  4FF2 A;  1B44 D;  1Z7T A;  1YHA A;  4DV7 Q;  2MNA A;  2LS0 1;  4QMG A;  1MHW C;  5EBC A;  1JJG A;  1HTP A;  1SFO B;  4A3L H;  2EXZ A;  4RCO A;  3PUV A;  2SNM A;  5IOD A;  3S9W A;  1OTC A;  4QB4 A;  4LF9 Q;  2B63 B;  4ZCK A;  1HHV A;  2F4I A;  3QG1 A;  3TRZ A;  4CKC A;  4K2L A;  2K5W A;  1CK1 A;  1L1O C;  1EYA A;  3Q23 A;  2RDG A;  2A69 D;  4OO1 H;  1E0B A;  2A73 B;  2KHS A;  5FLM G;  3RD4 A;  1SJE D;  3I55 A;  1QVF A;  4X3U A;  1Q3L A;  4HCS A;  2JEB I;  2A6E D;  1EY9 A;  1Y8N B;  1ET9 A;  2AUK A;  4YCV A;  1FVI A;  3S1Q B;  4IUR A;  1HZB A;  3NEN A;  1DON A;  2JQO A;  1NTG A;  1E2V A;  4KLK A;  4HIM A;  4MN3 A;  3U50 C;  3BDL A;  2OQK A;  2EVB A;  4EX5 A;  3NE5 B;  3QO2 A;  3AMU A;  4EQN A;  3H3V I;  3KYH C;  3ND8 A;  4L63 B;  3TME A;  1RIP A;  4MTK A;  1D5X C;  2EPB A;  3CQZ H;  5IGG A;  2NVQ B;  2O2L D;  3CU7 A;  2CCZ A;  4LF9 L;  4TKO B;  4ZAI A;  2A68 C;  4IPC A;  5IGE A;  4A3B B;  1L1O A;  3TP8 A;  1A6X A;  4BXX G;  2QKI C;  2HDM A;  3CF5 A;  4A3J H;  5HGT A;  1CHP D;  4G4K A;  5ELD A;  4HJ9 A;  2MFI A;  3A5Z B;  4Z9C B;  3S2H B;  2FXQ A;  2PPB C;  1HUN A;  3CC4 A;  2F1M A;  3I4N G;  4PV1 C;  3CCL A;  1PMR A;  1DOL A;  3BZD B;  3C2P A;  4FNF A;  2R7F A;  2NVY H;  3EIV A;  3M4P A;  2JE6 I;  4A93 G;  3HG9 A;  1Q12 A;  5BR8 L;  4BBS G;  4R8I A;  3F2B A;  3N52 A;  2LY7 A;  2RSN A;  3S24 A;  4R4C A;  4RHR A;  4YY3 Q;  3E0E A;  4NMZ A;  2PYK A;  3D3R A;  5I2Y A;  1J5E L;  4BY1 H;  2O5J C;  4NKL A;  3LNN A;  3CXC A;  3OWE B;  4C56 C;  5IY0 A;  3K59 A;  1K8O A;  1E2Z A;  1V1P A;  5KYL A;  2L4N A;  2CH4 A;  1Y1V H;  1JB3 A;  1TVX A;  3PO2 H;  4IAL A;  1Q86 C;  2F0O A;  1PRT D;  4BY7 H;  1ONL A;  1ZXT A;  2P5Z X;  5M3F G;  4L5Q A;  4DPG A;  2BOS A;  1IW7 C;  2ICE C;  4J6H A;  4CDE C;  4LF4 Q;  3I4L A;  2N78 A;  3SK6 A;  2YTV A;  1GUO A;  5C5L A;  5GRO A;  3RR5 A;  4K0K L;  2J7Z A;  2NN6 H;  1N32 L;  3L3O C;  4PQX A;  5JAV A;  3T1H L;  3AFQ A;  4C3I B;  1YJ9 A;  1KLU D;  4JI8 L;  1L2F A;  2KHI A;  2OF1 A;  1T9H A;  1BO0 A;  4QJF A;  1TWH H;  1X3F A;  5KNB A;  1VMC A;  3FDT A;  5JOB A;  5LMU L;  2KOL A;  3QOL A;  1HNX Q;  2WAQ B;  2F4V L;  4RWS C;  1P16 A;  2BE5 C;  5FO8 B;  1KDA A;  4P2C B;  1TQO A;  4HED A;  2JA5 H;  3TS2 A;  1I4R A;  1B2T A;  4HAE A;  1EU3 A;  1KLG D;  5BN4 A;  2Z1C A;  1TWF B;  4C1N I;  1TXY A;  3HS0 C;  4C3H B;  5FK9 C;  3GDE A;  4DF7 A;  1MI2 A;  4ODG A;  2Q8I B;  3R2T A;  4DNR B;  3DEP A;  4A3F B;  2AKW B;  1PTO D;  4L5S A;  1AZQ A;  1U4R A;  1U9R A;  1SYD A;  1YI2 A;  3M85 A;  5FO9 B;  1XX8 A;  1HNZ Q;  3SK8 A;  1UWV A;  2E2D C;  2K28 A;  5I6W A;  1J6Q A;  4A3I H;  4AYB G;  3M3Y H;  3AQQ A;  3SHL A;  1NUC A;  1U0L A;  5EJW A;  1LTA D;  4OIJ A;  1M1K C;  5A35 A;  3OOC A;  2Q2I A;  1HNX L;  4A3K B;  5IGD A;  1K9M C;  4IUN A;  3IFD A;  1W6K A;  4L8J A;  1OXU A;  3PUY A;  1GUN A;  2EYM A;  3VR3 A;  2MGS A;  2EYP A;  2K14 A;  1SYE A;  3T56 B;  1I4G A;  2A6H C;  3M9B A;  3GTP H;  2N3S A;  3IKJ A;  2B2V A;  2D2C C;  4UDU C;  5KNC A;  1PHJ A;  3TZD A;  2FJ2 A;  1PZJ D;  4O0A A;  3BDO A;  2Z4I A;  5FLX c;  2JA8 H;  3PIP A;  3DWP A;  3PMF A;  2UU9 Q;  5IWA L;  3BVZ A;  1N33 L;  4IN3 A;  4CJ2 C;  4FF4 A;  1TY0 A;  4QF4 A;  5C3E H;  3CCS A;  4A3G H;  3ZJY C;  2C5C A;  3CC7 A;  2EY5 A;  2FFK B;  1GHK A;  3H0G B;  4QY7 A;  1RDP D;  1QVG A;  1KDC A;  3NSW A;  1C0A A;  2ALY B;  2VY3 A;  1I3Q B;  3NEL A;  3R2I A;  1LTR D;  3D4R A;  5EQ0 A;  3J80 E;  3W2D A;  3HEJ A;  1PH7 A;  2BH8 A;  2WAQ E;  3CCV A;  1FGB D;  2Z9H A;  1IHZ A;  1XNQ L;  2B63 H;  1ENF A;  2ZJP A;  3MVV A;  1EEI D;  2Q8T A;  2VL6 A;  3KLW A;  3MXU A;  2RVL A;  2VB2 X;  3ITP A;  3NHH A;  1D1K A;  2B2T C;  1ET6 A;  1BCP D;  4B9W A;  4BBR G;  2F3I A;  2ZXO A;  2GVB A;  4DNI A;  4QCL A;  1KAA A;  5C0X H;  2XRS D;  3EQL C;  1LTT D;  3P20 A;  4YHH Q;  5EPL A;  4LFC L;  1EIY B;  2K52 A;  3KK7 A;  4IJH A;  3E0J A;  3J80 L;  2ZTD A;  3BVM A;  4RH6 A;  3MXN B;  5J39 A;  3I91 A;  4RGM A;  1EY0 A;  3JAM c;  2F03 A;  2L11 A;  5D3I B;  2VUM G;  1WTR A;  4UAI A;  3DM3 A;  2EYF A;  3S17 H;  1HZA A;  2NVQ H;  1ASZ A;  2G9H D;  3VA7 A;  5CR3 A;  1O7Y A;  1HRJ A;  2HIX A;  1A63 A;  3PO3 G;  3UE1 A;  1NMG A;  1ASY A;  3CP0 A;  2Q2U A;  1YZ6 A;  1VQN A;  3NTK A;  4FF1 A;  4DR1 L;  1F9S A;  1HR0 W;  1ROD A;  3D4W A;  4A3E G;  4IQZ A;  1BBU A;  2AWO A;  4NXN Q;  3S2H H;  1D5M C;  2FHT A;  1HR0 L;  2NYZ D;  1IYU A;  5ELO A;  1QIL A;  3OHX C;  1VQC A;  4GKK Q;  2YYZ A;  3D31 A;  1R4Q B;  2LFN A;  4DK1 A;  4MZ9 A;  1TS2 A;  4G7Z C;  4KJO A;  5M3M H;  1VQO A;  2E75 C;  2K03 A;  3S14 B;  1JOO A;  3I73 A;  4GLA C;  1YNN C;  5J22 A;  2OTJ A;  2EZV A;  2KCT A;  4A3D G;  1B3Q A;  5DNF A;  2E5L Q;  3KFU A;  1SN8 A;  4JI7 Q;  1GUS A;  1I6H B;  5I9O A;  3T1Y L;  4PMW A;  3FPP A;  1PFM A;  5EAY A;  1JOQ A;  2JA7 G;  1WI5 A;  3TN2 A;  1EZ8 A;  4UP9 A;  1B9M A;  2Y0S B;  4HTH A;  2UXC Q;  2I5M X;  1VQ7 A;  3NTI A;  1ZYR C;  3HOY G;  3W1G A;  2K5Q A;  1AFP A;  2XNA C;  4G7O C;  1KAW A;  4A3J B;  4AH6 A;  2VQF L;  1B50 A;  2XIW A;  3KJO A;  4H7B A;  3WWV A;  1B4O A;  1STB A;  2OCE A;  2PMZ B;  3HOU B;  3I4M G;  4GNX B;  4C3I H;  2PZW A;  5G3L F;  4KY5 A;  1A15 A;  2FIN B;  4FP5 D;  4GN5 A;  2NUC A;  5IOC A;  5C4X H;  1DD2 A;  4BY1 B;  4AQY Q;  2B8F A;  2NZH A;  3A8K E;  2UXD Q;  2B2U A;  1TT2 A;  3M4Y A;  3J7A 5;  1K8A C;  1NMF A;  4LF6 Q;  5M5X B;  3RLO A;  1SMY C;  1KD1 C;  4EQP A;  1YVC A;  1Y1W G;  5FOB B;  4DV4 L;  2F0L A;  5E4X A;  2VNU D;  2OXP A;  1LLR D;  4OWT B;  4C3H H;  3VYS A;  3GV3 A;  4CJ1 B;  1K73 C;  4N8F A;  5L37 A;  4A3F H;  4BA1 I;  4K5V A;  1HUM A;  2EDG A;  2I5L X;  1SNP A;  2XTI A;  1XPR A;  2OTL A;  1Q1E A;  3DMU A;  2DGY A;  4K14 A;  2IWH A;  1STE A;  1JR0 D;  3HRZ C;  1Q1B A;  4N9P A;  5GAG C;  1RHP A;  1KAB A;  4UHV A;  1EIH A;  1EZ6 A;  2WKD A;  2BDN A;  3KLS X;  3PIO A;  2EYJ A;  4KMU C;  4DV5 Q;  3E5S A;  3O13 A;  1HQR D;  3PUW A;  4B3T Q;  4POF A;  2BH2 A;  3GTK H;  5K36 H;  1YNJ D;  3HOX G;  1U4M A;  2C9O A;  5JEA J;  2R7Z H;  2F3V A;  4IPH A;  2LKV A;  4DR5 Q;  2UUA Q;  2UXB L;  2TSS A;  2EOT A;  3A74 A;  4ZLT F;  4P75 A;  5BN5 A;  4G7H C;  1X65 A;  1YIJ A;  1TS3 A;  5ELF A;  2JA5 B;  2EYL A;  2L15 A;  4FF3 A;  3S2D B;  4DV6 Q;  1N34 Q;  1F9P A;  2LXJ A;  4LF5 Q;  3TS0 A;  3KJP A;  1D5Z C;  2F0W A;  1KRS A;  4DK6 C;  4RG1 A;  1SMX A;  4DR7 Q;  4YWM A;  4KHP L;  1X3E A;  2FMM A;  3GQB A;  1IZ6 A;  4A3M G;  5EKL A;  2ENB A;  1G2T A;  4KY7 A;  4IFD H;  1BUV T;  1PDQ A;  4TQU S;  1F2M A;  5CV9 A;  2PMZ E;  2SNS A;  4CDC C;  1BF4 A;  3FKI G;  4IPD A;  3A7L A;  1FGU A;  4X64 L;  4A3I B;  3BJU A;  3UDI A;  1LT3 D;  4XYO A;  4HIO A;  4DR4 L;  3AB9 A;  1GKH A;  1N36 L;  1VQ8 A;  1TR5 A;  1Q81 C;  3MEF A;  1HXY D;  4R4I A;  1N9W A;  2WII B;  4P71 A;  2Z4H A;  2MUY A;  4JI3 L;  2B2Y C;  3HOZ H;  4EVO A;  1AE2 A;  3ZYY X;  3I8Z A;  3SDZ A;  1VCI A;  1FNW A;  2KCM A;  4XYQ A;  2N8N A;  3Q0A A;  4NB3 A;  5IYC H;  1FR3 A;  1XTC D;  4IJL A;  2WFW A;  3K6O A;  1G2S A;  4L5T A;  1UAP A;  4QUF A;  1HFN A;  3DLL A;  4CKB A;  3SR1 A;  1F2Y A;  1I4X A;  3MXG A;  2JSO A;  4R9W A;  5KYI A;  2F0U A;  3GV6 A;  2F0J A;  1B7Y B;  3ULP A;  2PQA B;  4A3G B;  3KDF B;  4MNO A;  3HKS A;  3W1B A;  4A76 A;  4LFA Q;  1IBK L;  3UDG A;  2DY8 A;  1B8A A;  1VQI A;  5CBA E;  1VQ4 A;  2GA4 B;  4HJ8 A;  5C6A A;  2ATW A;  1MBY A;  1BOS A;  1PLF A;  1WTP A;  3DM1 A;  1X3P A;  1GD7 A;  3VDY A;  4YWL A;  4R4T A;  3LWU A;  4K5W A;  5D65 A;  2AQ1 B;  1PV4 A;  5KND A;  1WVL A;  4MIU A;  3G48 A;  4U67 3;  3JAM i;  1KL9 A;  4DV2 L;  3IAY A;  3I4N B;  3RZD H;  1JE5 A;  3QWN A;  5HGQ A;  1CHQ D;  4IUV A;  4JI6 L;  5IYB G;  2PZT A;  3NP8 A;  3CCJ A;  1UEB A;  4A93 B;  2DJF C;  4BBS B;  2AWN A;  2F0P A;  2LMC B;  2KEE A;  4DKA C;  2I0Q A;  2NVX B;  5FLX E;  2GN5 A;  2C35 B;  2ASB A;  3I7F A;  5TSS A;  1KIX A;  3SK5 A;  3F2D A;  3G4S A;  2KEN A;  5GAD C;  1I4Q A;  5IP9 G;  1X3G A;  4LFA L;  3S14 H;  1RD9 D;  2XGT A;  3A0J A;  4KD4 A;  3RLF A;  3S1R B;  3A8I E;  3OW2 A;  5BR8 Q;  1YIT A;  1L0X B;  4ALP A;  2RF4 A;  1PH1 A;  4DAP A;  1BBX C;  1I6H H;  1VQE A;  1YBY A;  2B3G A;  1J5E Q;  3S17 B;  4ZUJ A;  1I4H A;  2RHS B;  4LJZ C;  3G7L A;  1S5F D;  5M3F B;  1CM9 A;  3V2T A;  4IUU A;  4X62 L;  3TSS A;  2HUG A;  5FKA C;  3Q8D A;  4WOR A;  3OTO L; 
#chains in the Genus database with same CATH homology
 2UUB Q;  3OYY A;  3BZK A;  1OXU A;  4POG A;  3PUY A;  3TQY A;  4IO9 A;  5IYC G;  1YHQ A;  3PO3 H;  3NEM A;  1VQL A;  2YV5 A;  2K5V A;  4JOI C;  3HFZ B;  3G6E A;  4DV3 Q;  4A3C H;  1NBW A;  1XJV A;  1P8L A;  2K14 A;  3HOU H;  3CPW A;  1Y1V G;  5DLQ E;  1IBK Q;  3PO2 G;  2B29 A;  4C3J H;  3M9B A;  2EQS A;  4AIM A;  3KF6 A;  2N3S A;  1PH4 A;  3GTP H;  1E22 A;  4GNX C;  4A3E H;  1PHJ A;  3STB C;  4BY7 G;  4HID A;  4JI2 L;  3FP9 A;  4K0K Q;  1YEZ A;  4JG2 A;  4QQB X;  4GLX A;  1N32 Q;  2E2J H;  3T1H Q;  1W2B A;  1X55 A;  4O0A A;  5FLX c;  4DR3 Q;  4B3S L;  2JA8 H;  3PIP A;  4BA2 I;  4JI8 Q;  3TEH B;  4DUZ Q;  2UU9 Q;  5IWA L;  2Z6K A;  4JBJ A;  1N33 L;  1CUK A;  2K5N A;  1EQQ A;  4NXN L;  5C3E H;  2AMC B;  4DV2 Q;  3L2P A;  3CCS A;  2H5X A;  1WJJ A;  2NN6 G;  3L7Z C;  1DGS A;  3PV0 A;  3ZJY C;  3CC7 A;  5LMN W;  4A3G H;  5LMU Q;  5M5X H;  3BZC A;  1JMC A;  1OXV A;  2F4V Q;  2ID0 A;  4QY7 A;  1BBW A;  1QVG A;  4JI6 Q;  1C0A A;  2ALY B;  1EFW A;  2VY3 A;  4L5R C;  5LMN L;  4GKK L;  2WB1 E;  4DUY L;  3F8T A;  4LF7 L;  2UUB L;  2NZO A;  2R92 H;  1PH8 A;  1E1T A;  4JOI A;  4A3D H;  3NEL A;  3K0X A;  2HHH Q;  1VQB A;  2MQH A;  4DAY B;  2R93 G;  4X66 Q;  4WJ4 A;  1CKN A;  1PH7 A;  2BH8 A;  1LYL A;  2WAQ E;  2JA7 H;  5M5W H;  3CCV A;  2JA5 G;  3E9H A;  4GNX A;  1IXR A;  1VQ6 A;  1XNQ L;  2B63 H;  3ULL A;  1JJ2 A;  2ZJP A;  2E5L L;  2WP8 J;  3HOW H;  4JI7 L;  4PZ7 A;  4PZ8 A;  5ELN A;  3HOY H;  1EOV A;  2VL6 A;  2Q2T A;  3GTG H;  3KLW A;  1XPU A;  1UE1 A;  2HIV A;  4QGU A;  2JJQ A;  3ERS X;  4DAM A;  4PZ6 A;  3K7U C;  4BBR G;  4DUZ L;  2F3I A;  4JBW A;  4OX9 L;  2YTY A;  1PVO A;  3B6Y A;  3CCR A;  2UXC L;  2GVB A;  3EN2 A;  4YCW A;  4A3B G;  4DK3 C;  4DNI A;  3AFP A;  3EBE A;  1TWF H;  4LF8 Q;  2YTX A;  4P74 A;  5IT9 c;  3I4M H;  1Q8K A;  4YHH Q;  4X62 Q;  1PYB A;  4LFC L;  1Z9F A;  1EIY B;  1W3S A;  4JC0 A;  2K52 A;  1I50 H;  4IJH A;  3OTO Q;  3ULJ A;  2YU9 H;  1QZG A;  4A3I G;  1U5K A;  5FJ8 G;  4OXP A;  2Y0S G;  3S2D H;  2ZTD A;  4JV5 L;  3M4Q A;  4QIW E;  1IBL L;  3MXN B;  2E2I H;  1M90 C;  1EYG A;  3JAM c;  3CMA A;  4LFB L;  3STB D;  2VUM G;  3H15 A;  2IHF A;  4EQ5 A;  5IYD H;  3RN5 A;  3DM3 A;  1VQK A;  5E7N A;  3S17 H;  1HZA A;  2VZA A;  3J81 j;  3CCU A;  1ASZ A;  2OWO A;  2NVQ H;  2RCN A;  3S1M H;  2OQ0 A;  1XMO L;  2JA6 H;  2HIX A;  1GO3 E;  3PO3 G;  1A63 A;  3UE1 A;  1SLJ A;  4JI2 Q;  3CAM A;  1NMG A;  1XTD A;  2ZTC A;  1ASY A;  3CP0 A;  3UE0 A;  1WCM H;  1Y1W H;  2Q2U A;  4A3C G;  3GD7 A;  1UE5 A;  1YZ6 A;  1VQN A;  3HOU G;  1YHB A;  4A3K H;  4DR1 L;  4GOP B;  1KC8 C;  4B3S Q;  4AQY L;  1MJE A;  3J80 c;  1K83 H;  1HR0 W;  5IWA Q;  1UE7 A;  2KHJ A;  2UXD L;  1N33 Q;  4A3E G;  4HJ5 A;  1NJI C;  1BBU A;  1JT8 A;  1OXS C;  4RMF A;  4LF6 L;  2AWO A;  4NXN Q;  3S2H H;  1IL2 A;  4JI1 L;  2BA0 A;  2CWP A;  4YCU A;  1S40 A;  1Z47 A;  3CPF A;  4IPG A;  1HR0 L;  4DV7 L;  5ELO A;  3U4Z A;  5GAH C;  2JA8 G;  4LNQ A;  2QGQ A;  1VQC A;  3RN2 A;  5LMN Q;  1MJC A;  4GKK Q;  4DUY Q;  1WYD A;  4LF7 Q;  2YYZ A;  1IYJ B;  4LWC A;  3D31 A;  5IP7 H;  5C3E G;  2PNH A;  1E1O A;  1N8R C;  4HIK A;  4A3G G;  4MZ9 A;  3IRB A;  3HKZ E;  1PA6 A;  4B3M Q;  1PH5 A;  1QVC A;  2KBN A;  1C9O A;  5M3M H;  1V9P A;  3PGZ A;  2RHQ B;  4Y7N H;  1VQO A;  5FLM H;  3G71 A;  3KF6 B;  1K8G A;  4GLA C;  2K4K A;  1I94 Q;  2D0O A;  1XNQ Q;  2R92 G;  3HOX H;  4LUZ A;  2OTJ A;  2KCT A;  5C44 H;  3ICE A;  4A3D G;  2E5L Q;  4DV5 L;  3RNU A;  3KFU A;  5C0X I;  1SN8 A;  4JI7 Q;  3KOJ A;  1VQP A;  5IE8 A;  3I4O A;  3T1Y L;  4B3T L;  4J15 A;  4PMW A;  4UY8 C;  3H0G H;  5C0X J;  5EAY A;  2JA7 G;  1WI5 A;  2IT1 A;  4UP9 A;  2UUC L;  4H02 A;  2B63 G;  4LF4 L;  1Q82 C;  4OX9 Q;  1NE3 A;  1I3Q H;  1OXX K;  2UXC Q;  4AYB E;  2I5M X;  3CCQ A;  1JB7 A;  4GLV B;  2ZTE A;  1I5F A;  1VQ7 A;  3HOW G;  4IOC A;  4UP8 A;  3W1G A;  3HOY G;  1HZC A;  1D7Q A;  1YNX A;  4DR5 L;  2A1A A;  2UUA L;  1AE3 A;  1D8L A;  2VS1 A;  4LUV A;  4A3M H;  1KAW A;  3K80 C;  1EUJ A;  4LFC Q;  4LW1 A;  3K7A H;  3PSI A;  2D62 A;  4AH6 A;  4DV6 L;  1N34 L;  1R9T H;  4LF5 L;  1A62 A;  1HZ9 A;  2VQF L;  1QUQ A;  4GS3 A;  3UDX A;  3KJO A;  3WWV A;  3HOV H;  4UP7 A;  4OO1 I;  3PUZ A;  4JV5 Q;  1A8V A;  5C0X G;  4QL5 A;  5GQO A;  2OCE A;  4BXX H;  4PG3 A;  1KRT A;  1CKN B;  1HH2 P;  4MTN A;  4KHZ A;  4DR7 L;  3I4M G;  4LFB Q;  2BA1 A;  4B3M L;  3LGJ A;  1X9N A;  4LUO A;  2VQE L;  4GNX B;  1PYS B;  4C3I H;  3FKI H;  1LTL A;  1VS0 A;  1VQD A;  5GAE C;  1VQJ A;  1A0I A;  2IY5 B;  1GM5 A;  2JA9 A;  1I94 L;  2IX1 A;  1XMO Q;  4R4Q A;  1EIF A;  1FL0 A;  4GN5 A;  1PH6 A;  1X6O A;  3I4N H;  5C4X H;  3A5U A;  3AYH B;  2MO0 A;  4JI5 L;  1XPO A;  4NPS A;  1XNR L;  5IYD G;  4DR1 Q;  2E8G A;  3F1Z A;  4AQY Q;  5J3B A;  3Q8D A;  2NZH A;  4X6A H;  3GTO H;  3CC2 A;  2UXD Q;  4A93 H;  1TWA H;  2JA6 G;  3J7A 5;  1E3P A;  3ER0 A;  1K8A C;  4BBS H;  1NMF A;  2QA4 A;  4LF6 Q;  3FHW A;  1VQ9 A;  2NVX H;  4JI1 Q;  3RLO A;  1KD1 C;  2PQA A;  1YVC A;  1WCM G;  1Y1W G;  4DV4 L;  4A3K G;  1YHA A;  3KDF A;  4DV7 Q;  2MNA A;  1HR0 Q;  2VNU D;  1G29 1;  1E7Z A;  3PF4 A;  4OWT B;  4C3H H;  4GN4 B;  1JJG A;  4IFD I;  1K73 C;  5JJL A;  2R6G A;  1K0R A;  4A3F H;  4A3L H;  4BA1 I;  3S1R H;  2PI2 E;  2I5L X;  2XTI A;  1MKH A;  2ZJR A;  1B70 B;  1GVP A;  2R7D A;  3PUV A;  3UDF A;  1XPR A;  3NBH B;  1FJG Q;  1IBM Q;  1X54 A;  2OTL A;  1K3R A;  1Q1E A;  4GKJ L;  2DGY A;  1OTC A;  1SRO A;  4YY3 L;  1CSP A;  4XTC S;  1Q1B A;  3U4V A;  5GAG C;  3J81 i;  4LF9 Q;  4JI4 L;  1C7Y A;  3PIO A;  4R1J A;  5IP7 G;  3AEV A;  3TRZ A;  2K5H A;  4DV5 Q;  1L0W A;  1L1O C;  1WFQ A;  5M3F H;  1E24 A;  3L0O A;  3PUW A;  3T1Y Q;  4B3T Q;  1CSQ A;  4POF A;  5M3M G;  5FLM G;  2BH2 A;  1YJN A;  1X56 A;  3I55 A;  3GTK H;  1QVF A;  2UUC Q;  3HOX G;  2A8V A;  2JEB I;  5C44 G;  2QEX A;  2LXK A;  5JEA J;  2R7Z H;  1LM0 A;  2F52 A;  3J80 i;  4IPH A;  4YCV A;  4DR5 Q;  2UUA Q;  1UE6 A;  4HJA A;  1VQF A;  3H0G G;  2UXB L;  1FVI A;  1S72 A;  4A4I A;  2N49 A;  3A74 A;  1YIJ A;  1HZB A;  1Q46 A;  4O2D A;  1X65 A;  3NEN A;  4P75 A;  2JQO A;  4OWX B;  3M4O H;  1NTG A;  1TWC H;  1YJW A;  4KLK A;  2L15 A;  4B3R L;  1HNW L;  4DV6 Q;  4HIM A;  1N34 Q;  2LXJ A;  3PF5 A;  2VQF Q;  4LF5 Q;  3U50 C;  1VQM A;  3S1N H;  3TS0 A;  3KJP A;  2OQK A;  1KRS A;  4JBK A;  4DK6 C;  4EX5 A;  4JYA L;  4YWK A;  4RG1 A;  3H3V I;  3GTQ H;  1SMX A;  4DR7 Q;  4YWM A;  1IBM L;  3KYH C;  1FJG L;  1X3E A;  4FDB A;  4KHP L;  1IZ6 A;  4A3M G;  1RIP A;  1WOC A;  1LUZ A;  2VQE Q;  5IYB H;  3CQZ H;  2CQO A;  4JI0 L;  2DUD A;  2CCZ A;  4LF9 L;  2Z6K C;  1SR3 A;  5JEA G;  3HOV G;  3S16 H;  4IPC A;  4OON A;  3GO5 A;  1L1O A;  4P73 A;  3GTJ H;  2D0P A;  4BXX G;  3BU2 A;  2ZM6 L;  5HY6 A;  4TQU S;  3CF5 A;  2IHE A;  3J7Z C;  2PMZ E;  3F2C A;  4JI5 Q;  3SGI A;  4A3J H;  1BVS A;  1XNR Q;  5IP9 H;  3FKI G;  2AHO B;  4IPD A;  1FGU A;  2WB1 G;  4X64 L;  2GVA A;  4HJ9 A;  3BJU A;  2MFI A;  3A5Z B;  2NN6 I;  3UDI A;  4DR6 L;  2FXQ A;  2I5H A;  4HIO A;  3CC4 A;  4DR4 L;  3I4N G;  1O7I A;  5C4X G;  1GKH A;  3CCL A;  4NXM L;  4DV4 Q;  5C4J H;  2WAQ G;  1N36 L;  1VQ8 A;  1KHI A;  2R7F A;  2NVY H;  1Q81 C;  3EIV A;  3MEF A;  4A75 A;  3M4P A;  1QUQ B;  2JE6 I;  4R4O A;  4A93 G;  1HJP A;  5AJ3 Q;  4GN3 B;  4R4I A;  1Q12 A;  1QZH A;  5BR8 L;  1KQS A;  4BBS G;  1N9W A;  4P71 A;  1S3O A;  4X65 Q;  4DR2 L;  3F2B A;  2NVT H;  1HNZ L;  4GKJ Q;  4JI3 L;  3S24 A;  4R4C A;  4YY3 Q;  3E0E A;  3HOZ H;  1G51 A;  4DV0 L;  1AE2 A;  4BY1 H;  3CD6 A;  1J5E L;  1VCI A;  2KCM A;  2N8N A;  4JI4 Q;  2CFM A;  2IX0 A;  3CXC A;  4JBM A;  2MO1 A;  4A3F G;  4A3L G;  1KXL A;  4NB3 A;  1PH2 A;  5IYC H;  3RLN A;  4DV1 Q;  1SRU A;  3M7N A;  4IJL A;  5IY0 A;  2EXD A;  2WFW A;  1PH9 A;  5JJI A;  3GTM H;  4L5T A;  4UPA A;  3H3V H;  1Y1V H;  3DLL A;  3RZO H;  1PH3 A;  2E2H H;  3PO2 H;  3E9I A;  1Q7Y C;  2ZJQ A;  4APV A;  1Q86 C;  1SFO H;  2Q2H A;  4ME3 A;  4BY7 H;  1B7Y B;  3ULP A;  3CME A;  2PQA B;  3PCO B;  3JC6 6;  4DV3 L;  5M3F G;  4OO1 G;  4L5Q A;  4DPG A;  3GTL H;  1BKB A;  3KDF B;  2V1C C;  1EWI A;  4MNO A;  5M5Y H;  2Z0S A;  2UXB Q;  4Y52 H;  3HKS A;  3W1B A;  3CCM A;  4LFA Q;  4A76 A;  1IBK L;  1IBL Q;  3CCE A;  3UDG A;  4LF4 Q;  5K36 G;  2N78 A;  1B8A A;  1VQI A;  1VQ4 A;  4B3R Q;  2YTV A;  1HNW Q;  4JCV E;  5GRO A;  4HJ8 A;  3RR5 A;  5AJ3 L;  1XMQ Q;  2ATW A;  4K0K L;  2EIF A;  2R7Z G;  4C2M H;  4JYA Q;  1N32 L;  1VQ5 A;  3W5O A;  3T1H L;  4IFD J;  4X65 L;  3AFQ A;  1GD7 A;  4HJ7 A;  3VDY A;  2HQL A;  4KHP Q;  4DR3 L;  5JJK A;  4YWL A;  4TVA B;  1JJC B;  1VQG A;  4R4T A;  5H1S E;  1YJ9 A;  1PV4 A;  4JI8 L;  2UU9 L;  1L2F A;  2KHI A;  4JI0 Q;  1T9H A;  4GOP C;  3G48 A;  3K81 C;  1V43 A;  4QJF A;  1CKO A;  1TWH H;  1X3F A;  3JAM i;  2HT1 A;  1KL9 A;  4DV2 L;  1EQR A;  3RZD H;  4DV1 L;  1JE5 A;  2VW9 A;  5LMU L;  2ZM6 Q;  2R93 H;  1HNX Q;  1CKM A;  5HGQ A;  2F4V L;  1P16 A;  3S1Q H;  4JI6 L;  1V1Q A;  5IYB G;  2CKZ B;  3CCJ A;  1UEB A;  2JA5 H;  3I2Z A;  3TS2 A;  1RL2 A;  2ES2 A;  4X64 Q;  4P72 A;  3J81 c;  1H95 A;  2AWN A;  4DKA C;  1MIU A;  4IFD G;  2I0Q A;  4DR6 Q;  1SE8 A;  3KF8 B;  3S15 H;  2HHH L;  2GN5 A;  4DR4 Q;  2C35 B;  2ASB A;  2JEA I;  3I7F A;  3HKZ G;  4X66 L;  1KIX A;  4NXM Q;  1TXY A;  4KI0 A;  3G4S A;  3F2D A;  2JK8 A;  2KEN A;  4A3J G;  5GAD C;  1N36 Q;  3GDE A;  5IP9 G;  1X3G A;  4LFA L;  4OWW B;  3S14 H;  4BBR H;  2XGT A;  3A0J A;  3RLF A;  4IOA A;  3CW2 C;  3D0F A;  3K8A A;  4A3B H;  2AKW B;  1TWG H;  3OW2 A;  1OXT A;  5BR8 Q;  4L5S A;  2LSS A;  1YIT A;  1XMQ L;  2Y0S E;  2K75 A;  4DR2 Q;  4ALP A;  2RF4 A;  1PH1 A;  3PUX A;  1YI2 A;  3M85 A;  1HNZ Q;  1I6H H;  4JI3 Q;  1VQE A;  1NY4 A;  1UWV A;  4DV0 Q;  1YBY A;  2B3G A;  4GOP A;  1J5E Q;  3I56 A;  3TRE A;  2CWA A;  1G6P A;  1J6Q A;  2RHS B;  4A3I H;  5FJ8 H;  1L1O B;  4AYB G;  3M3Y H;  2PI2 A;  3AQQ A;  3U58 A;  4XIG S;  4LF8 L;  1U0L A;  1M1K C;  1VQH A;  2K50 A;  4YHH L;  1Y14 B;  2Q2I A;  4X62 L;  1VQA A;  2VUM H;  1HNX L;  3HOZ G;  4WJ3 M;  1AH9 A;  1PFS A;  4BY1 G;  1K9M C;  2A19 A;  3OTO L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...