3E0EA

Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
91
Chain Sequence
MNYKISELMPNLSGTINAEVVTAYPKKEFSTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGGLEISVDNIGIIEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
rcsb
source organism Methanococcus maripaludis
molecule tags Replication
molecule keywords Replication protein A
total genus 22
structure length 91
sequence length 97
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3e0eA00
4A3JH 2K5NA 4LUVA 3RN2A 3BJUA 1W2BA 4L5TA 5M3MH 4IPGA 2LSSA 3CQZH 4DV4Q 3GTPH 3OW2A 3EBEA 4A3IG 2IX1A 1HR0W 2A8VA 3OTOL 4KLKA 3RR5A 1LTLA 4YCVA 1XPRA 3AFQA 4BY7G 4JYAL 4X65L 1PHJA 2B63H 2F3IA 1FGUA 1BVSA 3M4QA 2EIFA 3HKZE 5IP9G 5M5WH 4MNOA 4DAMA 3J7ZC 3A5UA 3RLFA 4DAYB 3I4NH 4DR4L 1H95A 1X56A 2QGQA 4K0KL 1IYJB 4UY8C 4OX9L 4IO9A 1Q12A 2E2JH 2Z0SA 2AKWB 1LUZA 3HOWG 3CCEA 3D0FA 3AQQA 4DR5Q 4JV5Q 5IE8A 5JJKA 3F2BA 2E5LQ 4JI7Q 4A3KG 1JJGA 4OO1I 3U58A 2VY3A 2RHSB 4KHPL 1L2FA 4C2MH 4GNXB 4DR3Q 4B3ML 4JI0L 4BA2I 2Y0SE 3CP0A 1M1KC 4LF6L 5JEAG 2ZM6Q 4JC0A 1WJJA 4YHHL 1J5EQ 3K7AH 4DV0Q 1YI2A 2UUCL 1MKHA 5LMUQ 1MJEA 4JOIA 4LF4L 2HHHL 3S15H 1TWCH 2KCTA 4IOCA 4B3SL 3NELA 3HOXH 1VQ5A 2I5LX 1WOCA 3FKIH 5FJ8H 1QVGA 5HY6A 2UXDL 4AQYQ 2JA5H 4DR7L 3I56A 1VQ8A 1CKNB 2UXCQ 5C0XI 1PH3A 3JC66 1HZCA 1VQOA 4P73A 2YTYA 4ALPA 2I0QA 3KF6B 4UPAA 2UUBQ 1S72A 4BXXH 4DV3Q 5JJIA 1JB7A 1UE5A 2K14A 3ERSX 1YITA 3S17H 1QUQB 1GD7A 1AE3A 1VQFA 4LFCQ 1QZHA 3J7A5 1HNZQ 3U4ZA 1A62A 1VQ9A 1SE8A 5C4XH 2CWAA 5BR8L 4JBKA 4HJ8A 5IY0A 3BU2A 1EIYB 5FJ8G 2AMCB 4IFDG 1U0LA 1GM5A 1C7YA 1SMXA 2WFWA 1E3PA 1VQ7A 4GOPA 4EQ5A 2ZJRA 3RZOH 3G6EA 3J81j 1IBKL 4A75A 1VQMA 4GNXA 4NXNQ 2K75A 1SLJA 3PUYA 1N34Q 4BBSG 5FLXc 5LMNL 1VQNA 4IPHA 4LFAL 1VQIA 1QUQA 1CKMA 1P8LA 2NN6I 1X9NA 2UUAL 1LM0A 2CQOA 1Y1VG 1E1TA 4NB3A 2ZTDA 2N3SA 2PI2A 3NENA 4OONA 1G51A 2JJQA 4DR2Q 4GLXA 1SFOH 2R7ZH 2PQAA 3JAMi 2ES2A 1YBYA 1YEZA 4HIDA 4DR4Q 1DGSA 3DLLA 4JI8Q 4A3LH 2N49A 1CKOA 3J81i 3ER0A 2JE6I 5J3BA 3F2CA 4BBRG 4GNXC 2N8NA 2BH2A 1PVOA 4AH6A 2HT1A 3KJOA 4LF7L 3RNUA 4QQBX 3G71A 3KDFA 1MJCA 4A3EG 5C44H 2KHJA 4RMFA 4BA1I 1IBLL 4BY7H 4DV6L 4A93G 5H1SE 1WI5A 2PMZE 2DGYA 1N32L 2IHEA 1Q82C 3HOUG 1D8LA 1B8AA 3PF4A 4GKKQ 3M3YH 3CCVA 4DV7L 2IX0A 1NTGA 4QJFA 3HOVH 4P71A 4TVAB 4OWXB 1Y1WG 1PH4A 2WP8J 1BBUA 2EXDA 2QA4A 1OXUA 3CPFA 2VQFL 2ZTCA 1UE1A 2NVXH 4Y52H 3PUXA 1MIUA 3CD6A 1V43A 1K73C 1CSPA 2VW9A 1X55A 2I5HA 3NEMA 3FHWA 4C3IH 1SRUA 2JQOA 1NBWA 4R4IA 3I4MG 3MXNB 3PUWA 4LF5Q 4A3LG 4A3MH 4B3TL 3F1ZA 4R4CA 1IBML 1NMFA 5EAYA 1VQCA 4K0KQ 3KF6A 2JA6G 3HOXG 4YY3L 2Q2UA 1CKNA 4UP9A 1VQHA 1XMQQ 2NZOA 4HIMA 4DR5L 3GTQH 1E1OA 1WCMH 1QZGA 4APVA 4GN3B 2AWOA 1X3EA 4C3HH 3M85A 1P16A 2OTJA 4QY7A 4IOAA 1AE2A 1OXTA 1N34L 2OWOA 4GS3A 3E9IA 2XGTA 4A3MG 1SN8A 5GAGC 1I94Q 3S16H 1FVIA 2BA1A 2CFMA 4UP8A 1HNWQ 2C35B 4DV5Q 4XIGS 3T1HQ 1NMGA 3M4OH 4DUYQ 4GOPC 1PH8A 1HZBA 5C0XG 3E0EA 4DNIA 3S1RH 1EQRA 3ULPA 4GKJQ 3PO2G 3GTMH 2V1CC 2E2IH 2Q2IA 4FDBA 4R4OA 4X62L 4JI4L 4HJAA 4DR7Q 4B3RQ 2CKZB 3S2HH 2NVYH 4PZ7A 5IP9H 5IP7G 1VQBA 4GLAC 3KDFB 2B63G 3AEVA 1Q81C 3GDEA 2NN6G 4DKAC 2ALYB 4IPDA 4A3IH 5FLMH 5C3EG 1YJ9A 3E9HA 3OYYA 1EOVA 1PYBA 1V1QA 4YHHQ 4A3EH 3PIPA 2MO1A 3S1NH 1KAWA 1VQJA 5IYBG 5GAHC 1TWAH 2K5HA 3PUVA 4DV1Q 3W5OA 4KHPQ 3IRBA 4DK6C 3STBD 3H0GH 4DR3L 3PO3H 2Y0SG 1I3QH 5IYCH 4AIMA 3UDGA 1VCIA 2HIVA 3CCUA 2XTIA 4GN5A 3GTJH 4A3KH 3TEHB 4LF9L 4DR6L 4A3DH 3S1MH 4X6AH 4AQYL 1WFQA 1FJGL 5IYCG 1N33Q 3K80C 2R7ZG 2R92H 1IL2A 4DR1Q 3T1YQ 3PO3G 2Z6KA 4JI5L 1Y1WH 1Y1VH 3W1GA 3G4SA 4LWCA 1VQKA 3K0XA 3CW2C 4JI3Q 4X66L 4IJLA 2IY5B 1PH1A 1B70B 1XTDA 2MO0A 4GOPB 2UU9Q 4A3BH 3K7UC 1X65A 2MFIA 4LF5L 4JI2Q 2NVTH 2AHOB 4R4TA 3GTOH 1N36L 2VQEQ 4HJ7A 3HKSA 5AJ3L 5C0XJ 4DUZL 4A4IA 3UE0A 4A3FG 2JEBI 2RF4A 3I4OA 3DM3A 4GN4B 4YCUA 5IP7H 1XPOA 4O0AA 1S3OA 4JBMA 1HR0L 4JI1L 3S1QH 4NXML 1L1OB 4POGA 1QVFA 1NE3A 2VL6A 1CSQA 1GVPA 3CC2A 2R7DA 2AWNA 1YJWA 2R92G 1IBLQ 4Y7NH 2E8GA 4HIKA 1X6OA 3UDIA 3S2DH 3L0OA 1ASZA 4A3GH 1X54A 2ZTEA 1N8RC 2UXBQ 1KHIA 1YHQA 1PH7A 2WAQE 4IJHA 2F4VQ 5GAEC 1Q7YC 1HZAA 2Z6KC 4P74A 1XMOL 1JT8A 2JA7G 5IYBH 3FKIG 1IXRA 5HGQA 3H3VH 4AYBG 2NZHA 2JA9A 3PUZA 4R4QA 1R9TH 3A5ZB 3CAMA 4NPSA 5M5YH 2MNAA 1OXXK 5FLMG 1UE6A 3W1BA 5C3EH 1VQGA 2QEXA 3I7FA 2ID0A 1W3SA 4X64L 2R93G 4LF8Q 4YWMA 1VQ6A 4MTNA 3I55A 2A19A 4LFCL 1YHBA 4POFA 3J81c 3EN2A 5ELNA 1YZ6A 1HH2P 1IBMQ 4DV6Q 4LUZA 1NY4A 1I5FA 3G48A 4JI6L 1YJNA 3PO2H 2K50A 3CCLA 3HOYG 4JYAQ 2N78A 3UDXA 2VS1A 1TWGH 1G6PA 1VQEA 4NXNL 3FP9A 5LMUL 2WB1E 3KF8B 4P75A 3TQYA 3KJPA 2ZM6L 4BXXG 1PH6A 1KXLA 1S40A 4IPCA 4QGUA 1D7QA 4BY1G 1HNZL 5GADC 1K8GA 1E7ZA 1TWFH 3LGJA 1TXYA 3OTOQ 1HNXL 5DLQE 3PF5A 5IT9c 2MQHA 3CMEA 4JI7L 3F2DA 2CWPA 5JEAJ 3U4VA 4PG3A 1N33L 1JJCB 5IWAL 3AYHB 3BZKA 1WCMG 3J80i 5LMNQ 4OO1G 1UWVA 4A3CH 4YWKA 1XNRL 3H3VI 3CCJA 5C44G 3JAMc 1ASYA 4JI2L 1PH9A 4KHZA 1Q1EA 1N36Q 1L1OC 5M3FH 1A63A 1RIPA 2FXQA 3CCQA 4L5SA 3I4MH 2B3GA 3CCMA 4DV2Q 2PI2E 3EIVA 4JBJA 4B3SQ 4DV4L 2L15A 5BR8Q 3CC7A 4LF6Q 3HFZB 4A3DG 2E2HH 4HJ5A 4H02A 3ULLA 3H0GG 4C3JH 4BY1H 2UUBL 5ELOA 4JOIC 2Q2TA 2H5XA 1Q46A 1PH5A 4DV3L 3Q8DA 1JJ2A 4JBWA 1GKHA 1HJPA 1OXSC 1YVCA 2HQLA 3A0JA 4TQUS 1NJIC 2I5MX 4WJ3M 4OX9Q 3PGZA 4A76A 1IZ6A 1N9WA 2WAQG 3ZJYC 3VDYA 1XMOQ 4J15A 4A93H 4P72A 2D62A 5M3MG 4QL5A 1A0IA 3MEFA 1EUJA 5GQOA 2D0PA 2EQSA 1EWIA 4IFDI 2BA0A 2R93H 4JI8L 1QVCA 2ZJPA 2PQAB 4BBRH 2RCNA 3KLWA 1K0RA 2KENA 1OTCA 4DV0L 3ICEA 2ATWA 4YCWA 1I50H 1PYSB 2E5LL 4JI6Q 1EIFA 3S14H 1B7YB 3L2PA 3GD7A 3TS2A 1L1OA 2YTVA 4PMWA 4O2DA 3PV0A 4B3TQ 4L5RC 4A3GG 4OXPA 1Z47A 1TWHH 2JA5G 2R7FA 2D0OA 1WYDA 2B29A 1XPUA 4LFBQ 2UXDQ 1XJVA 3AFPA 1N32Q 2KHIA 1HZ9A 2UXCL 4XTCS 2R6GA 4X65Q 2RHQB 1X3FA 2IHFA 1HNWL 5IYDG 1G291 1Q1BA 2K52A 5M3FG 3H15A 2HHHQ 1Z9FA 4DK3C 3TRZA 1K83H 3CCSA 1J6QA 4AYBE 2VUMH 1KRTA 1Y14B 4A3CG 3RZDH 5LMNW 1K9MC 1U5KA 3B6YA 1FJGQ 5C4XG 4KI0A 3RLNA 3I2ZA 2PNHA 1BKBA 1CUKA 1FL0A 5C4JH 3T1YL 1KQSA 1UEBA 1XMQL 5M5XH 2VZAA 2OQ0A 3K81C 2YU9H 1XNQQ 3GTLH 1C0AA 3K8AA 3HOWH 2OQKA 4LFAQ 3HOZG 3WWVA 2HIXA 4YY3Q 4DV2L 4IFDJ 1KIXA 3KOJA 3CF5A 2UUCQ 3CC4A 3F8TA 4PZ8A 4LF7Q 4EX5A 2CCZA 4LF4Q 3HOVG 1EQQA 3UDFA 3KYHC 4DUZQ 4MZ9A 4DV1L 4WJ4A 2ASBA 3HOUH 4DR2L 4HIOA 1K8AC 4OWWB 3HOYH 2K4KA 3M4PA 3STBC 4JI3L 2A1AA 3CPWA 3HKZG 3M9BA 5E7NA 4LUOA 2LXKA 1EFWA 2VQFQ 4JCVE 4DR1L 1X3GA 1M90C 4DV7Q 1VQ4A 4GKJL 4RG1A 2UUAQ 1E24A 4DPGA 4JG2A 1L0WA 1VQAA 1KRSA 3CXCA 4LF8L 4B3RL 5IYDH 5AJ3Q 4DR6Q 1T9HA 4JV5L 2VQEL 2ZJQA 4QIWE 3UE1A 3RLOA 1K3RA 2KBNA 3A74A 3HOZH 1Q86C 3U50C 1I94L 2JEAI 3SGIA 3J80c 1IBKQ 2JK8A 4B3MQ 3TS0A 4DV5L 2LXJA 4JI0Q 3I4NG 4X66Q 1SR3A 1OXVA 3CMAA 1I6HH 2IT1A 4L5QA 2UU9L 2UXBL 1J5EL 1GO3E 2WB1G 1VQLA 1PA6A 2F52A 3L7ZC 4HJ9A 4LF9Q 2K5VA 4LFBL 5JJLA 1UE7A 4JI4Q 1BBWA 4X62Q 2NVQH 2GN5A 2DUDA 4YWLA 1O7IA 4BBSH 1RL2A 1EYGA 2VUMG 4GKKL 1VS0A 2YYZA 3NBHB 3ULJA 3RN5A 4A3JG 4A3FH 4JI5Q 1Q8KA 5IWAQ 1YHAA 4JI1Q 4NXMQ 1KD1C 3D31A 5GROA 1C9OA 4DUYL 4UP7A 3GTKH 2OCEA 4GLVB 3PCOB 3S24A 2KCMA 1A8VA 2JA6H 1LYLA 4A3BG 1JE5A 3TREA 1PV4A 4PZ6A 1V9PA 2JA8G 3T1HL 2JA7H 1HNXQ 4R1JA 3M7NA 4OWTB 1VQPA 2BH8A 2GVBA 2F4VL 3BZCA 3GTGH 1YNXA 5K36G 1PH2A 3KFUA 4LNQA 1XNQL 3PIOA 2JA8H 2GVAA 1XNRQ 1E22A 2YV5A 1PFSA 3CCRA 1JMCA 4LW1A 2VNUD 1KL9A 1SROA 3GO5A 1AH9A 3PSIA 2Q2HA 1KC8C 4X64Q 1VQDA 1HR0Q 1YIJA 4ME3A 2YTXA 2OTLA
chains in the Genus database with same CATH superfamily
4A3JH 2K5NA 3SK4A 1W2BA 2LSSA 3CQZH 1F77A 3R2IA 3SK6A 4M8AA 2A8VA 3DXJC 3RR5A 1XPRA 1B2TA 1LLRD 4DFAA 4IUNA 4X65L 2Y0SB 2F3IA 1FGUA 5M5WH 3J7ZC 1IYJB 1HTPA 1Q12A 3HG9A 5EBDA 3CCEA 4JV5Q 1O7YA 5IE8A 2E5LQ 4JI7Q 4A3KG 2KHSA 2RHSB 2VY3A 2MUYA 2XWBB 4KHPL 1EEFD 4HN7A 5C3WA 4YHHL 1K0SA 4DAYA 2M9VA 4EGVA 1MKHA 2JA6B 2FMMA 3TZDA 3U9SA 1TWCH 2KCTA 4B3SL 3NELA 4CHTB 2ZT9C 4I7AA 1X3PA 5C0XI 4A3LH 2UUBQ 2I0QA 3KF6B 5ELFA 3D4DA 4BXXH 1EY9A 4DV3Q 3ERSX 3S17H 1RCVD 1GD7A 2JSOA 3EQLC 4HMIA 4FXGC 2EY2A 4MIUA 1CA5A 2KA7A 1SE8A 3S9WA 2CWAA 3H09A 5DEHA 5BR8L 1EIYB 3BU2A 2EXZA 5FJ8G 4IFDG 1U0LA 3K5OA 1GM5A 5EKLA 5T1IA 1DOMA 1EZ6A 2WFWA 3NTHA 4KHVA 4N8FA 5CR3A 2ZJRA 3S2HB 4A75A 1Q8IA 1SLJA 5I4DA 5FLXc 1C48A 3J81E 1QUQA 1P8LA 4DA2A 2BDNA 3MHBA 1O7LA 1X9NA 1AZQA 2CQOA 4NB3A 3K59A 1KNAA 2ZTDA 2PI2A 3S16B 1G51A 4GLXA 4ZUIA 3JAMi 1YEZA 4XT1B 3BDOA 3DLLA 1LT4D 5FOBB 1CA6A 3S15B 1CKOA 3VR5A 4BBRG 2XNAC 1STAA 2MGSA 4LF7L 3GTJB 3QB3A 4QQBX 1U4LA 4QB4A 5C44H 1IBLL 4RMFA 4XXEA 2GA4B 4A93G 2JYOA 5H1SE 1WI5A 3P1HA 4C2MB 1N32L 2IHEA 3HOUG 1D8LA 1B8AA 4DV7L 1TT2A 1NTGA 2F0UA 2KEDA 3MAQA 4P71A 4OWXB 4A3DB 3KUPA 5IGGA 1BBUA 2ZTCA 1UE1A 1PFBA 3KK7A 1X55A 3NEMA 3M3YB 4C3IH 5KIXA 1B3QA 3I4MG 3F1ZA 4R4CA 3ONAB 2DN8A 2JA6G 3NHHA 5IODA 1CKNA 1XMQQ 1JE4A 1GUSA 3LWUA 1PLFA 4ID6A 4F88A 3J80E 3NWSA 2OTJA 1AE2A 3SR1A 4GS3A 3E9IA 1MSHA 5JVG3 1SN8A 3I91A 3S16H 3JAML 4DV5Q 3HOUB 3M4OH 1KLGD 3MFYA 1PH8A 1Y1VB 1HQRD 1K8MA 1EQRA 3GP7A 3D4RA 3GTMH 3PO2G 1JC7A 2Q2IA 4FDBA 2CKZB 1VQBA 4GLAC 3KDFB 1Q81C 3T4AC 1X32A 1FR3A 2J0TD 2ALYB 5C4JB 4ILWA 1GUNA 4CJ0B 4QMGA 3E9HA 1EOVA 1XX8A 1JQYD 4KTAA 1S5DD 3SK8A 2Q8IB 5GAHC 2K5HA 4H7BA 3W5OA 4KKSA 3IRBA 4DK6C 3STBD 4I65A 2HIVA 2L1BA 1A6XA 4DR6L 4A3DH 3TEHB 4LMQD 5BN5A 4CKEA 1Q3LA 1SNPA 1WFQA 4X3TA 2R7ZG 2R93B 3PO3G 3MXNA 1RJTA 4ME5A 2X6GA 1ESFA 1U4RA 4JI3Q 4IJLA 1PH1A 3QOJA 3K57A 1SDFA 4J1MA 2BE5C 4JI2Q 2NVTH 4CKCA 2AHOB 2KVMA 1SMYC 2F0KA 4G7ZC 2JEBI 2RF4A 4YCUA 1XPOA 4NXML 4POGA 2K28A 1NE3A 2VL6A 3SHLA 2E2JB 2R7DA 1S4ZA 1SFOB 1L0YB 4HIKA 3C2PA 4LAAA 5CV9A 1STBA 3C3LA 1ASZA 1DD2A 3CU7A 1JORA 1KHIA 1YHQA 2F4VQ 4JK1C 2BDOA 4XT3B 5IYBH 3OHXC 2JA9A 3QG1A 2JP1A 1PRTD 5CYUA 2MNAA 2L5TA 1UE6A 2N88A 4HMJA 4X64L 5KNDA 4PMCA 2EZVA 1YHBA 5M3FB 1SYGA 4LJZC 4CKBA 1D1IA 1IBMQ 2WV6D 4DV6Q 4LUZA 1I5FA 3G48A 1YJNA 3UDXA 3HP3A 1SSOA 3RD4A 2WB1E 3Q23A 1KXLA 1PH6A 3PO2B 2ENBA 1HNZL 1LTTD 5GADC 2V4DA 3PF5A 4DXGA 1G6ZA 5FLXE 3DHQA 2CWPA 5JEAJ 3NWTA 1JJCB 2NTTA 1RD9D 3W2DA 1WCMG 3J80i 5ELDA 4A3CH 5I2YA 2HCIA 4CDEC 5C44G 3JAMc 1ASYA 4JI2L 1HTLD 2E74C 1PTOC 4ABNA 4OL7A 1PDQA 1RIPA 3SDZA 4X3KA 1F2ZA 4C56C 3T16A 3EIVA 4DV4L 2O4XA 3HFZB 2TMPA 3NTIA 4JOIC 3NQTA 3MXUA 2Q2TA 4Q0FA 1OXSC 3SE0A 1BNZA 3QIAA 2I5MX 3GTOB 3NP8A 4A76A 1IZ6A 1N9WA 2WAQG 3Q0AA 3G6JB 4A93H 1A0IA 5GQOA 3FVQA 1NR2A 2R92B 4RAUC 2B2WA 1STYA 4BBRH 4DV0L 2E2DC 1TIID 2NZ1D 1L1OA 3F2UA 1STHA 4PMWA 3PV0A 1IKMA 4L5RC 1RDPD 4CGYB 3GTKB 1TWHH 2R7FA 2LMCB 1LTRD 2KHIA 4X65Q 2E76C 3CKIB 1H9JA 1Q1BA 5M3FG 2HHHQ 3PMFA 2M00A 3TRZA 1TR5A 3J80L 2VUMH 1QNKA 1AN8A 3RZDH 4IFDH 2HCCA 3I2ZA 2PNHA 1KQSA 1XMQL 5M5XH 2Q8TA 2OQKA 4YY3Q 2SOBA 2EYPA 3WOFA 1H9SA 4FF2A 3F8TA 2AUJD 2CCZA 4MZ9A 1WCMB 4WJ4A 2K5WA 3GTQB 2KCNA 1IL8A 2XWJB 4QIWB 3M4PA 5D14A 5M5XB 3M9BA 5E7NA 4LUOA 2LXKA 4WRDA 4JCVE 4XQNA 1J9OA 5JEAH 2UUAQ 5FO8B 4DPGA 4JG2A 1L0WA 5E4XA 1KRSA 1NNXA 5IYDH 2G9DA 1EQVA 3H3VC 2F1MA 3TP6A 4WFN3 2R3ZA 1B9NA 3CRKC 1TS5A 3PO3B 3UE1A 3RLOA 1K3RA 1LTAD 4DAVA 1NSNS 1Q86C 2QKIC 2K33A 2B2VC 4R8IA 5IOCA 2UU9L 4UHVA 1JOOA 1GO3E 2WB1G 3L7ZC 4HJ9A 5M9OA 2HUGA 3S14B 1V1PB 1TQOA 2VUMG 4BBRB 3RN5A 1ML0D 4A3JG 4A3FH 1F9PA 2IJ0A 3PCOB 1WTQA 1A8VA 2JA6H 1LYLA 1JE5A 1PV4A 1O7ZA 2PQEA 3T1HL 2JA7H 3OW7A 1HNXQ 3MEHA 1LTGD 4JW0A 1VQPA 2BH8A 1VMPA 2GVBA 3BZCA 5K36G 4H13C 4E6IA 1JB3A 1TS3A 1GUOA 2RSOA 3CCRA 1KL9A 1KC8C 3BYYB 1HR0Q 2XRQD 2HQEA 3KLRA 4ME3A 4LUVA 3RN2A 2EVBA 2XIWA 4L5TA 1ICWA 3OW2A 1BXTA 4KLKA 4DNRB 1PYWD 3J7AF 4BY7G 4JYAL 1PHJA 1EWCA 4DAMA 3A5UA 4DR4L 1L0XB 2EYMA 2QGQA 3MXGA 4OX9L 3R3OA 4F87A 1TWFB 1X3QA 2Z1CA 1BDOA 2QDLA 4DR3Q 4BA2I 2Y0SE 4XQQA 4JC0A 2JA5B 1ZKOA 5J39A 1ONLA 1D5ZC 3MC0B 4LF4L 4JOIA 2QW7A 1H9SB 3EFXD 2PZUA 5EQ0A 1K8OA 1VQ5A 4K5VA 2DNCA 4HCSA 2UXDL 1D5MC 4AQYQ 3I56A 5C3EB 1VQOA 1DYQA 4UPAA 2KCCA 5LL6S 1S72A 3T13A 1JB7A 5JJIA 1TS4A 1UE5A 2K14A 3LWEA 1QUQB 2F0IA 1VQ9A 5F2DA 4A3GB 5IY0A 3RZOB 3S2DB 1F2LA 1SMXA 5AFWA 4ZCKA 4EQ5A 3RZOH 4GNXA 2K75A 1HRJA 1AW7A 4EQPA 5LMNL 1ILQA 4LFAL 1VQIA 3QJYA 4KJNA 1DOKA 1Y1VG 2PPBC 2R7ZH 4DR2Q 3TSSA 2ES2A 4DR4Q 1D1KA 3BZDB 1HFGA 2JE6I 1PVOA 2HDMA 2N8NA 4AH6A 1WTPA 3KDFA 3T56B 1MJCA 4A3EG 3J7AV 3KLSX 2KHJA 1TU2B 2PMZE 3C46A 2DGYA 1EYAA 1WTWA 1Q82C 3PF4A 3LX0A 5IGBA 1C4QA 2NWGA 3M3YH 4GKKQ 2A74C 2IX0A 1SYEA 2F4IA 3HOVH 3HOZB 1PH4A 2NVXB 4RWSC 2EXDA 3K5NA 1U9RA 4G7OC 4JVZA 4KY6A 1HUMA 3CD6A 2CH4A 4R8NA 3FDTA 5FK9C 2AQ3B 1I6HB 1LT3D 1LO5D 1TWHB 4LF5Q 3L9AX 3GV6A 1IBML 1I4GA 1KLUD 1QJOA 2NBFA 1VQCA 4K0KQ 4YY3L 3GTQH 4F8MA 2NN6H 5G3LF 1QZGA 1GUWA 4APVA 4GN3B 2AWOA 1T5EA 1PZJD 4IUUA 5ISRA 4NP5A 4OHJA 2KEEA 2XGTA 1I94Q 1FVIA 4QF4A 4UP8A 5EPJA 5C5MA 4XIGS 1H9RA 2AQ1B 3R8BA 1SYDA 1SYCA 2O5JC 3EROA 3ULPA 2I46A 1D6EC 4OEMB 2E2IH 4JI4L 4R4OA 4X62L 2G9HD 4DR7Q 4K2LA 3S2HH 4CDDC 5IP7G 4ZYSA 4B9WA 2B63G 4BBSB 3BVGA 3GDEA 2DY8A 1YJ9A 1EOTA 1V1QA 4YHHQ 1C8CA 1PRTF 1VQJA 4HSPA 3OSOA 1A3UA 4KV6A 3PUVA 2B8GA 1QB5D 2QCPX 5JAVA 2Y0SG 1I3QH 5IYCH 3UDGA 3S1MH 2F0NA 5IYCG 2D5DA 1IL2A 3T1YQ 4JI5L 3BG3A 1Y1WH 1CHPD 3KLSA 1GXDC 3CW2C 2IY5B 4GOPB 3K7UC 3VR4A 4LF5L 2OXPA 4HJ7A 1S5FD 5AJ3L 5C0XJ 4A4IA 2WAQB 3UE0A 2B2VA 4A3FG 4O0AA 2CW0C 1HR0L 2OEOA 1L1OB 4ODGA 5I9PA 1CSQA 2R92G 1WD1A 4Y7NH 4ZQ3A 3UDIA 4N8X1 3K6OA 3I72A 4IURA 4A3GH 2UXBQ 1PH7A 5CV7A 3N6RA 3S17B 1HZAA 1XMOL 1UUPA 1IXRA 3ND8A 5M3MB 4NPSA 1XYIA 5M5YH 1OXXK 5FLMG 3TP5A 2EYLA 5C3EH 1VQGA 1PZID 1DOLA 1W3SA 2R93G 4LF8Q 3I55A 2A19A 4RHSA 1PTOB 4POFA 3J81c 3G7LA 1YZ6A 1A3VA 1SNOA 3R93A 4I7ZC 2IL8A 5I2XA 1VQEA 4OGQC 5EBCA 5JPNC 3KJPA 4BXXG 2B2UC 2LY7A 1NR4A 1RODA 1TWFH 2EYFA 3OTOQ 1Y8PB 1RTOA 2MQHA 1F9RA 4J8QA 3CMEA 1F2YA 3F2DA 3U4VA 5HURA 2DY7A 4HAEA 4OO1G 5IT9E 2X69A 4YWKA 3WDNA 1PFNA 1KAAA 1FD7D 3V05A 4OO1H 1L1OC 1A2TA 1A63A 2FXQA 3CCQA 1EY5A 2PI2E 1UAPA 1YNJC 5E3FA 4A3JB 2L15A 3CC7A 4LF6Q 2L0CA 4A3DG 2E2HH 4HJ5A 2Z8LA 4H02A 3ULLA 4C3JH 5COYA 4BY1H 4B08A 2H5XA 1Q46A 3I90A 3H94A 3Q8DA 4JBWA 2F0DA 1PXUA 1IW7C 1JJ2A 1GKHA 1HJPA 3A0JA 4ZAIA 3GTPB 3M4OB 1NJIC 1GUGA 2EPBA 3KBGA 1U4MA 3ZJYC 2WB1B 1XMOQ 2QILA 4P72A 1HPCA 4ZKCB 1DCZA 5M3MG 2D0PA 2EQSA 1IW7D 2F3WA 4RFBA 3OMGA 4IFDI 2R93H 3OWFA 4JI8L 1FNUA 2A6HC 2RVLA 2PQAB 5D3DA 3K5LA 3MFGA 1OTCA 5JPMC 1EY0A 1G8ZD 1EIFA 5CBEE 1B7YB 4N9TA 5DM63 2A69C 2XSCA 2Z4HA 1EQTA 3KBXA 4OXPA 2B29A 1XPUA 3AFPA 4DGZA 4K6DA 2EJMA 2PZWA 1G291 2D9UA 4G4KA 1KABA 3H15A 5CBAE 1Z9FA 2VB3X 1YNND 4AYBE 4RGOS 5D65A 2F0OA 4C1NI 1WTVA 3S1RB 1PZKD 5LMNW 1H9KA 1U5KA 3B6YA 1FJGQ 5C4XG 2O5IC 2ZXPA 4EVOA 1JWMD 1BKBA 1FL0A 2BOSA 1UEBA 2VZAA 1MBYA 1EYDA 3K81C 4FP5D 3BYTB 4Y7NB 1C0AA 3K8AA 5BN3A 1ZXTA 3HOWH 2R61A 1KIXA 2Z4IA 4PMBA 1GHJA 3CC4A 1SJHD 4LF4Q 3GTGB 4DUZQ 4MHEA 3HOUH 1XWEA 1ENFA 3HOYH 3STBC 1DZ1A 4JI3L 2A1AA 4IQZA 3CPWA 1BQQT 3DUZA 3HOYB 3HKZG 1K28A 3VA5A 1ZYRC 1DJRD 1SNCA 4RG1A 1ESRA 1E24A 2B2TC 4UAIA 4DR6Q 1FNWA 1EY6A 1EY7A 2K32A 3A74A 2K01A 3HOZH 4TSSA 3Q24A 1Q90A 2JK8A 5KEEA 3I4NG 3CHBD 1SR3A 1I4PA 1Y8OB 5KNBA 3CMAA 4L63B 1A3TA 1JOKA 1V1OA 2K05A 2K5VA 5JJLA 4BBSH 3URYA 1O7IA 1SNQA 3ULJA 3NBHB 4JI5Q 1Q8KA 1YHAA 5CV6A 4NXMQ 3D31A 1KDAA 1D2BA 4NDXA 2OCEA 1MD2D 4A3BG 4PZ6A 1V9PA 4FF3A 1BUVT 4IALA 1ET9A 2F4VL 5C6AA 1YNXA 3KFUA 4LNQA 5EPLA 3PIOA 1XNRQ 4FYDA 1E22A 1PFSA 2VNUD 5JVH3 2A6HD 1SROA 2Q2HA 3NSWA 5DM73 2E2HB 5CC4A 2O2LD 4X64Q 1B44D 5M3MH 3EBEA 2IX1A 1HR0W 1BCPD 3OTOL 1LTLA 3AFQA 2K03A 5IP9G 2EIFA 4IOAA 1K83B 4MNOA 3RLFA 1H95A 2MJ8A 2PO4A 5KYIA 1X56A 2L12A 1BOSA 4K0KL 5CV4A 2RSNA 4IO9A 3NXWA 2AKWB 1LUZA 1LABA 2Z0SA 3D0FA 3AQQA 2RQXA 3F2BA 2F0GA 1D5XC 5KYLA 3NUCA 1M1KC 2QF7A 5JEAG 4LF6L 2P5ZX 1WJJA 2JA7B 1YI2A 2UUCL 2KJXA 3OWEB 5CMDA 1S5ED 3FRPB 1MJEA 2HHHL 1Y1WB 5JJZA 2ICIA 1S5BD 2I5LX 1WOCA 4KD3A 5HY6A 4DR7L 4A3KB 1VF5C 4U673 1BCPB 1VQ8A 2UXCQ 5FO9B 1HZCA 3I4NB 4P73A 2YTYA 4ZLTF 4C3IG 1CZWA 4CJ1B 1YITA 1AE3A 4LFCQ 1ILPA 1KTKA 2Z9HA 2AUKA 2EYJA 4RHRA 1E3PA 2L11A 1CT1D 4GOPA 2PW7A 3L3OC 3J81j 4NMZA 3PUYA 2B63B 4BBSG 1HXYD 1BBXC 1RF2D 2F0WA 1J8IA 2NN6I 2UUAL 1LM0A 3C1EA 3NENA 1NAPA 4PV1C 1SFOH 2PQAA 2K7VA 4KY7A 4HIDA 3HOXB 1AZPA 4JI8Q 4X3SA 2NUCA 1MGSA 4C3HB 3ER0A 4FVMA 3J81i 1BF4A 2BH2A 2HT1A 3KJOA 3PIO3 2OF1A 1G2TA 3TP7A 2YU9B 4FO2A 4BY7H 2NB0A 3AMUA 1NUCA 3MXPA 3I8ZA 1LV9A 2J7ZA 3VR6A 5KRUA 2B2WC 4QJFA 5C3XA 5IT9L 4A3FB 3HS0C 1Y1WG 1SE4A 4L8JA 2NVXH 4Y52H 4HTHA 5FKAC 1G2SA 4HSVA 1V43A 2VXWA 1CSPA 4G57A 5DNFA 4H0LC 2VW9A 1K73C 3FHWA 1O80A 2JQOA 4A3LG 4A3MH 4B3TL 3CQZB 4RCOA 2F0HA 2RA4A 2MHVA 1HA6A 2Q2UA 1KDCA 4UP9A 2NZOA 4DR5L 3RMHA 1E1OA 1WCMH 2L4NA 3MA2B 3S1QB 2NTSA 3GQBA 3M85A 3TP8A 1ZEQX 4QY7A 1PRTC 2OWOA 2XN9C 2RDGA 2FJ2A 3NE5B 2K5QA 4K14A 4ZK9B 4A3BB 2BA1A 1HNWQ 2CFMA 3T1HQ 4FNFA 1JICA 2WKCA 3E5SA 5A2QE 3TN2A 4GOPC 4AYBB 5C0XG 4Z9CB 4QUCA 3S1RH 4DNIA 1R4QB 5KNCA 4FF1A 1HCZA 2VUMB 2PNRC 4PZ7A 5IP9H 1CQVA 4EQOA 3AEVA 2QEJC 2A6EC 3E0JA 2NN6G 5EGTA 2AQ2B 3S1NB 1E2VA 1PYBA 3OOCA 4K5XA 5ELEA 5FO7B 4A3EH 3PIPA 2MO1A 3S1NH 1KAWA 5IYBG 3OIQA 2OT2A 4F7XA 4DV1Q 4KHPQ 3PO3H 4C3JG 4A3KH 3PQIA 4GN5A 2HDLA 1RHPA 2PCFB 4AQYL 1OO9B 1PTOD 2EJFC 3K80C 1Y1VH 1W6JA 4X66L 2MO0A 2FHTA 2SNSA 4X3UA 2B8FA 2MFIA 1YNJD 4A3BH 3VYUA 5I6WA 2VQEQ 4CDCC 3HKSA 3I73A 2QDBA 3MTSA 2K6AA 2F0SA 2F0JA 4N9PA 3FEWX 3A54A 1S3OA 4JBMA 4JI1L 3S1QH 1QE6A 1QVFA 4KK7A 2F0MA 1YJWA 4B9XA 3FMCA 2M2LA 3DEOA 2CQAA 2B2TA 2F0PA 2K5DA 1DM0B 5FLXL 1X54A 4A3MB 2RDHA 1LTSD 4JPBW 4C3IB 2J4XA 4IJHA 4KKTA 3O13A 4C1NK 1Q7YC 3MWYW 4RH6A 4C3JB 3FKIG 5HGQA 3H3VH 4AYBG 2NZHA 1R9TH 2B2YA 3W1BA 2QEXA 2ID0A 4YWMA 1VQ6A 1EIGA 4MTNA 1CFMA 4LFCL 3EN2A 5ELNA 1QILA 2JA8B 1NY4A 4JI6L 1JWUD 2F0EA 2K50A 3PO2H 3CCLA 3HOYG 1QNUA 5C44B 2VS1A 1I50B 1TWGH 5EPKA 4K8JA 5I9OA 4MN3A 3TQYA 3T51B 2ZM6L 1S40A 4IPCA 4QGUA 1TVXA 1D7QA 3LGJA 1EL0A 1HNXL 4U68A 5DLQE 5IT9c 4JI7L 4PG3A 5IWAL 3AYHB 5LMNQ 4DN4M 1DXMA 3H3VI 2WACA 1EU4A 4IZ8A 3CCJA 4RKBA 4KHZA 1Q1EA 2A5HA 1WVLA 3D3RA 2EYOA 3I4MH 3CCMA 4DV2Q 1R4PB 4B3SQ 4JBJA 3Q22A 5IIFA 2DNEA 3H0GG 5T1GA 2UUBL 2LS01 1LTBD 4QUFA 1E2ZA 4DV3L 5C5LA 2EOTA 1QCBD 4WJ3M 4FXKC 4OX9Q 2C9OA 4UDUC 3VDYA 1V1PA 1I4QA 2D62A 5CV5A 1EFID 4QL5A 3MZ5A 3BVMA 1TY2A 3C1FA 4XDXA 2KECA 1QWYA 2BCOA 3D6CA 5E4WC 2ZJPA 3SXHA 2IPKD 1K0RA 2KENA 4RGMA 3BS1A 1UNSA 2ATWA 2ZXOA 1U4PA 1I50H 1TWGB 2E5LL 4JI6Q 1ET6A 3FPUB 3P75A 4O2DA 1BR9A 1Z47A 2KOLA 1AFPA 1WYDA 2D0OA 3AU7A 5A2QL 2UXDQ 2H4OA 1HZ9A 1SNMA 1Z7TA 2R6GA 2RHQB 1STGA 1X3FA 2IHFA 1HNWL 5IYDG 4CBVA 5M5YB 4IUVA 1K83H 3CCSA 1J6QA 1FNVA 5K5PA 3I3CA 4KN4C 3TZUA 4XQJA 1K9MC 2EE1A 2DJFC 1CUKA 5C4HA 2YU9H 3GTLH 3J81L 3EA6A 4LFAQ 4V0BA 4DV2L 2E2IB 2L55A 4ZRZA 2UUCQ 4LF7Q 2LFNA 4PZ8A 3HOVG 1SAPA 1EQQA 4DV1L 5L37A 3OPOA 2ASBA 3TDQA 4PNYA 4IUPA 4DR2L 4A93B 2HD3A 3V96A 2VQFQ 1X3GA 4DV7Q 4OELB 1VQAA 3SVMA 4LF8L 2D2CC 2FINB 5AJ3Q 3P20A 5E1FA 1EYCA 2XRSD 3HOWB 3H0GB 2VQEL 2ZJQA 1BCPF 1JCKB 4K8IA 3K58A 3U50C 2JEAI 3SGIA 3BDLA 3ZYYX 4B3MQ 4JI0Q 4DV5L 3GV3A 2CW0D 2IT1A 2UXBL 1J5EL 1PA6A 3DMUA 2F52A 1EEID 3A8IE 1UE7A 1BBWA 4OIKA 4RKLA 2NVQH 1CZGA 1EYGA 2ZXRA 1VS0A 1I4HA 3GTMB 3LNNA 1KD1C 3ITPA 5GROA 4DUYL 4UP7A 4GLVB 3X3NA 2KCMA 3I4LA 2F0TA 1PTOF 4DU9A 5C4ZA 2F3VA 1W6KA 1PH2A 1E2WA 2JA8H 1SE2A 4LW1A 1PTOH 2MPMA 2E75C 1VQDA 1YIJA 1NCVA 3HEJA 3QOLA 3BJUA 1IKLA 4IPGA 4DV4Q 5EKKA 3GTPH 4A3IG 4YIJA 1QG7A 2WIIB 4YCVA 2FMCA 2B63H 3M4QA 1BVSA 3HKZE 2Q8RE 3I4NH 4DAYB 1ENCA 1ZYRD 4UY8C 2RCFA 3H91A 2B2YC 2E2JH 3HOWG 3U9OA 4DR5Q 1KDBA 5JJKA 1WD0A 2IX3A 3U58A 4OO1I 1JJGA 1L2FA 4C2MH 4GNXB 1MHWC 1CM9A 4B3ML 4JI0L 3CP0A 3K7AB 1HQMC 2LKVA 2ZM6Q 1SXTA 3T53B 1J5EQ 3K7AH 4DV0Q 4CDFC 1SJED 3K5MA 3X3MA 5LMUQ 3S15H 1CHQD 4IOCA 3HOXH 3NTKA 3NQIA 3IFDA 3FKIH 5FJ8H 1QVGA 2R7ZB 4DK0A 2JA5H 4J6HA 1CKNB 1PH3A 1F9QA 3JC66 4ALPA 3W3AA 4DAPA 1VQFA 1QZHA 3J7A5 1HA5A 2CHBD 3U4ZA 1A62A 3P7JA 1HNZQ 5C4XH 4JBKA 3E6ZX 4HJ8A 1B4OA 2AMCB 1C7YA 1Y69U 3BDCA 1VQ7A 4DNTB 4ULLA 3G6EA 2NVYB 1IBKL 4NXNQ 1VQMA 1R9TB 1N34Q 3CRLC 2SEBD 1VQNA 4IPHA 1QOHA 1CKMA 3PIP3 5J22A 4RGTA 1FGBD 1E1TA 3DWQA 4RCNA 2NVTB 2N3SA 4OONA 2JJQA 1SMYD 1YBYA 1DGSA 1TY0A 2N49A 5J3BA 3F2CA 3QO2A 4GNXC 5TSSA 5IGDA 2TSSA 3R2TA 4TRDA 3RNUA 2CVRA 3NK9A 3G71A 4BA1I 4DV6L 4KMUC 1MSGA 4FF4A 3M4YA 3RZDB 2RDFA 3CCVA 3DWPA 3IL8A 4TVAB 2WP8J 4BS9A 2QA4A 1OXUA 3CPFA 5I6YA 2VQFL 1JOQA 3NPPA 3PUXA 1MIUA 1EZ8A 1CQFA 1WTOA 2I5HA 1SRUA 3HRZC 1NBWA 1II3A 2L9HA 4R4IA 3MXNB 3PUWA 4H44C 4ZKBB 3HKZB 3BVZA 1NMFA 3A55A 5EAYA 1B1ZA 1IHZA 3KF6A 4WORA 4BY7B 5KGUA 1E0BA 3HOXG 2PZTA 1EY4A 2F03A 1VQHA 4HIMA 4KD4A 4IUTA 5IGCA 1X3EA 2PYKA 4C3HH 1P16A 1OXTA 1N34L 1CK1A 1M8AA 3WOEA 4A3MG 5GAGC 1GOZA 1O78A 2C35B 2SNMA 1NMGA 4DUYQ 1VDZA 1HZBA 3J7YW 4P2CB 1RTNA 3E0EA 3H6MA 4KY5A 3A7AB 4GKJQ 2V1CC 3NBHA 4B3RQ 4LK1C 3SK5A 4HJAA 2NVYH 2F0VA 1GJXA 2VB2X 4DKAC 1F9SA 1PFMA 1SE3A 4IPDA 4A3IH 5FLMH 5C3EG 3OYYA 4A3IB 1A2UA 2NYZD 1TWAH 4Q5VA 3K0YA 3DM1A 1YNNC 1GUTA 3H0GH 3ND9A 4DR3L 4AIMA 1VCIA 3CCUA 4LF9L 2XTIA 2F0LA 3GTJH 4X6AH 4V190 1FJGL 1N33Q 2R92H 4DR1Q 1SBBB 2Z6KA 3DWAA 3W1GA 2SDFA 3M7GA 3G4SA 4LWCA 1VQKA 3K0XA 3ERQA 1B70B 1XTDA 2UU9Q 5IGFA 1X65A 3IKJA 1SYFA 2A68D 4MTKA 4R4TA 3GTOH 1N36L 1B3AA 4RA8A 4DUZL 3Q6SA 1EY8A 2N55A 3DM3A 3I4OA 4GN4B 5IP7H 3A8KE 3OMCA 4BY1B 1B9MA 1GHKA 3VYSA 1EWHA 4QCLA 1GVPA 1VF7A 3CC2A 2AWNA 1TS2A 1I4RA 1IBLQ 3GTLB 2E8GA 4XYQA 5J1ZA 1X6OA 5DAUA 3S2DH 1TKWB 1F2MA 3L0OA 3I4MB 2PW5A 5C4XB 2ZTEA 4RGNA 1N8RC 2IW3A 1DONA 2WAQE 4IUQA 5GAEC 2Z6KC 4P74A 1JT8A 2JA7G 1M4VA 3PUZA 4R4QA 5D3IB 1G91A 3A5ZB 3CAMA 3KF8A 2B2UA 2EYHA 3I7FA 4DF7A 1I4XA 2MP1A 1ENAA 2FFKB 3I70A 4G7HC 1LACA 1HH2P 1WTXA 1S5CD 1JWSD 1WTRA 1KNEA 4JYAQ 2A6ED 2N78A 4O1NA 3A8JE 1G6PA 1HUNA 4NXNL 5HGTA 2DJGC 3FP9A 5LMUL 4ZUJA 1LT6D 4FXDA 4P75A 3FKIB 3KF8B 5G3LD 5CORA 4M1UB 1CI3M 4BY1G 1K8GA 1E7ZA 1TXYA 2EY6A 1CTMA 1T5XD 2EY5A 3VA7A 1N33L 4K2KA 3VR2A 3DEPA 4KJOA 1STNA 4HCEA 1WTHA 3BZKA 5ELCA 3D8GA 4CJ2C 2A73B 1UWVA 1XNRL 2B39A 4HR7B 3TMEA 3SEBA 1PH9A 1N36Q 5M3FH 3RUZA 3OIPA 4L5SA 2XVSA 2B3GA 3N52A 1IYUA 1ICFB 4IN3A 5BR8Q 1BCPC 4K6LA 5M5WB 5A35A 3UI2A 5ELOA 1PH5A 3QWNA 3IFTA 3QR8A 1YVCA 2HQLA 4TQUS 2K04A 4S3SA 3PGZA 5EJWA 3NBIA 1SYBA 4J15A 4O42A 2KUMA 1EUJA 1RKNA 3MEFA 2H1EA 1EWIA 1SNDA 3VYTA 2BA0A 1UEAB 1V8QA 4GZYC 5LHY1 1QVCA 3S1MB 5BN4A 2RCNA 3KLWA 3ICEA 5LL6X 1PRTB 2EJGC 5C0XH 2NVQB 4YCWA 1PYSB 2A68C 4BWGB 4DXFA 3L2PA 3GD7A 1XXGA 3S14H 3TS2A 2YTVA 4KN7C 1I6VC 4B3TQ 4NW2A 4A3GG 4L6TB 1STEA 2JA5G 4LFBQ 3EVQA 3AB9A 1XJVA 1N32Q 5ELBA 2UXCL 4XTCS 1XTCD 1MI2A 1I3QB 2F0FA 1AEXA 1JR0D 2K52A 4WJWA 4DK3C 3A56A 5NUCA 1SEBD 1TWAB 3EJIA 1KRTA 3TBIB 1Y14B 4A3CG 4A3EB 1HHVA 2KQ3A 2IWHA 4KI0A 3RLNA 3T1YL 5C4JH 3FPPA 1H9MA 1A15A 2BE5D 2OQ0A 1XNQQ 1K3BC 3HOZG 4IFDJ 3WWVA 2HIXA 4XYOA 3KOJA 3CF5A 4R9WA 4EX5A 1LT5D 3UDFA 3KYHC 4HIOA 1B53A 3A7LA 1K8AC 4OWWB 2K4KA 3HZXA 1EFWA 4DR1L 4NKLA 1M90C 4OIJA 1VQ4A 5EKIA 4GKJL 1LTID 4B3RL 3MVVA 3CXCA 1VMCA 2EDGA 2I07B 2ICEC 2K1BA 3VR3A 1T9HA 4JV5L 3VYRA 2JXMB 4QIWE 1EIHA 2KBNA 2WKDA 2JN4A 1I94L 3J80c 1IBKQ 3TS0A 2LXJA 2X6LA 4X66Q 1OXVA 2C5CA 1I6HH 4L5QA 1VQLA 4DK1A 5CGKA 4LF9Q 2EY1A 5IGEA 4LFBL 1HFNA 3HGBA 1B50A 4JI4Q 1PMRA 4X62Q 2GN5A 2DUDA 1Y8NB 2G5DA 4YWLA 1RL2A 2A69D 5CV8A 4C3HG 4GKKL 2YYZA 4PQXA 3HOVB 1BO0A 5IWAQ 4HEDA 4JI1Q 3D6WA 1C9OA 1TWCB 3GTKH 3S24A 2RBMA 3V2TA 1Z6HA 4K5WA 3TREA 3D4WA 4TKOB 1EU3A 2JA8G 1IYVA 2WINB 4R1JA 5K36H 3M7NA 2Z6BA 4OWTB 4KKUA 2PMZB 4EQNA 5JOBA 3GTGH 3IAYA 3E3XA 2RKSA 2CH4W 1XNQL 2GVAA 1FYCA 2YV5A 1JMCA 1AH9A 3GO5A 3JAME 3PSIA 1AP0A 2F0QA 2YTXA 2OTLA
chains in the Genus database with same CATH topology
4A3JH 2K5NA 4LUVA 3RN2A 3BJUA 1W2BA 4L5TA 5M3MH 4IPGA 2LSSA 3CQZH 4DV4Q 3GTPH 3OW2A 3EBEA 4A3IG 2IX1A 1HR0W 2A8VA 3OTOL 4KLKA 3RR5A 1LTLA 4YCVA 1XPRA 3AFQA 4BY7G 4JYAL 4X65L 1PHJA 2B63H 2F3IA 1FGUA 1BVSA 3M4QA 2EIFA 3HKZE 5IP9G 5M5WH 4MNOA 4DAMA 3J7ZC 3A5UA 3RLFA 4DAYB 3I4NH 4DR4L 1H95A 1X56A 2QGQA 4K0KL 1IYJB 4UY8C 4OX9L 4IO9A 1Q12A 2E2JH 2Z0SA 2AKWB 1LUZA 3HOWG 3CCEA 3D0FA 3AQQA 4DR5Q 4JV5Q 5IE8A 5JJKA 3F2BA 2E5LQ 4JI7Q 4A3KG 1JJGA 4OO1I 3U58A 2VY3A 2RHSB 4KHPL 1L2FA 4C2MH 4GNXB 4DR3Q 4B3ML 4JI0L 4BA2I 2Y0SE 3CP0A 1M1KC 4LF6L 5JEAG 2ZM6Q 4JC0A 1WJJA 4YHHL 1J5EQ 3K7AH 4DV0Q 1YI2A 2UUCL 1MKHA 5LMUQ 1MJEA 4JOIA 4LF4L 2HHHL 3S15H 1TWCH 2KCTA 4IOCA 4B3SL 3NELA 3HOXH 1VQ5A 2I5LX 1WOCA 3FKIH 5FJ8H 1QVGA 5HY6A 2UXDL 4AQYQ 2JA5H 4DR7L 3I56A 1VQ8A 1CKNB 2UXCQ 5C0XI 1PH3A 3JC66 1HZCA 1VQOA 4P73A 2YTYA 4ALPA 2I0QA 3KF6B 4UPAA 2UUBQ 1S72A 4BXXH 4DV3Q 5JJIA 1JB7A 1UE5A 2K14A 3ERSX 1YITA 3S17H 1QUQB 1GD7A 1AE3A 1VQFA 4LFCQ 1QZHA 3J7A5 1HNZQ 3U4ZA 1A62A 1VQ9A 1SE8A 5C4XH 2CWAA 5BR8L 4JBKA 4HJ8A 5IY0A 3BU2A 1EIYB 5FJ8G 2AMCB 4IFDG 1U0LA 1GM5A 1C7YA 1SMXA 2WFWA 1E3PA 1VQ7A 4GOPA 4EQ5A 2ZJRA 3RZOH 3G6EA 3J81j 1IBKL 4A75A 1VQMA 4GNXA 4NXNQ 2K75A 1SLJA 3PUYA 1N34Q 4BBSG 5FLXc 5LMNL 1VQNA 4IPHA 4LFAL 1VQIA 1QUQA 1CKMA 1P8LA 2NN6I 1X9NA 2UUAL 1LM0A 2CQOA 1Y1VG 1E1TA 4NB3A 2ZTDA 2N3SA 2PI2A 3NENA 4OONA 1G51A 2JJQA 4DR2Q 4GLXA 1SFOH 2R7ZH 2PQAA 3JAMi 2ES2A 1YBYA 1YEZA 4HIDA 4DR4Q 1DGSA 3DLLA 4JI8Q 4A3LH 2N49A 1CKOA 3J81i 3ER0A 2JE6I 5J3BA 3F2CA 4BBRG 4GNXC 2N8NA 2BH2A 1PVOA 4AH6A 2HT1A 3KJOA 4LF7L 3RNUA 4QQBX 3G71A 3KDFA 1MJCA 4A3EG 5C44H 2KHJA 4RMFA 4BA1I 1IBLL 4BY7H 4DV6L 4A93G 5H1SE 1WI5A 2PMZE 2DGYA 1N32L 2IHEA 1Q82C 3HOUG 1D8LA 1B8AA 3PF4A 4GKKQ 3M3YH 3CCVA 4DV7L 2IX0A 1NTGA 4QJFA 3HOVH 4P71A 4TVAB 4OWXB 1Y1WG 1PH4A 2WP8J 1BBUA 2EXDA 2QA4A 1OXUA 3CPFA 2VQFL 2ZTCA 1UE1A 2NVXH 4Y52H 3PUXA 1MIUA 3CD6A 1V43A 1K73C 1CSPA 2VW9A 1X55A 2I5HA 3NEMA 3FHWA 4C3IH 1SRUA 2JQOA 1NBWA 4R4IA 3I4MG 3MXNB 3PUWA 4LF5Q 4A3LG 4A3MH 4B3TL 3F1ZA 4R4CA 1IBML 1NMFA 5EAYA 1VQCA 4K0KQ 3KF6A 2JA6G 3HOXG 4YY3L 2Q2UA 1CKNA 4UP9A 1VQHA 1XMQQ 2NZOA 4HIMA 4DR5L 3GTQH 1E1OA 1WCMH 1QZGA 4APVA 4GN3B 2AWOA 1X3EA 4C3HH 3M85A 1P16A 2OTJA 4QY7A 4IOAA 1AE2A 1OXTA 1N34L 2OWOA 4GS3A 3E9IA 2XGTA 4A3MG 1SN8A 5GAGC 1I94Q 3S16H 1FVIA 2BA1A 2CFMA 4UP8A 1HNWQ 2C35B 4DV5Q 4XIGS 3T1HQ 1NMGA 3M4OH 4DUYQ 4GOPC 1PH8A 1HZBA 5C0XG 3E0EA 4DNIA 3S1RH 1EQRA 3ULPA 4GKJQ 3PO2G 3GTMH 2V1CC 2E2IH 2Q2IA 4FDBA 4R4OA 4X62L 4JI4L 4HJAA 4DR7Q 4B3RQ 2CKZB 3S2HH 2NVYH 4PZ7A 5IP9H 5IP7G 1VQBA 4GLAC 3KDFB 2B63G 3AEVA 1Q81C 3GDEA 2NN6G 4DKAC 2ALYB 4IPDA 4A3IH 5FLMH 5C3EG 1YJ9A 3E9HA 3OYYA 1EOVA 1PYBA 1V1QA 4YHHQ 4A3EH 3PIPA 2MO1A 3S1NH 1KAWA 1VQJA 5IYBG 5GAHC 1TWAH 2K5HA 3PUVA 4DV1Q 3W5OA 4KHPQ 3IRBA 4DK6C 3STBD 3H0GH 4DR3L 3PO3H 2Y0SG 1I3QH 5IYCH 4AIMA 3UDGA 1VCIA 2HIVA 3CCUA 2XTIA 4GN5A 3GTJH 4A3KH 3TEHB 4LF9L 4DR6L 4A3DH 3S1MH 4X6AH 4AQYL 1WFQA 1FJGL 5IYCG 1N33Q 3K80C 2R7ZG 2R92H 1IL2A 4DR1Q 3T1YQ 3PO3G 2Z6KA 4JI5L 1Y1WH 1Y1VH 3W1GA 3G4SA 4LWCA 1VQKA 3K0XA 3CW2C 4JI3Q 4X66L 4IJLA 2IY5B 1PH1A 1B70B 1XTDA 2MO0A 4GOPB 2UU9Q 4A3BH 3K7UC 1X65A 2MFIA 4LF5L 4JI2Q 2NVTH 2AHOB 4R4TA 3GTOH 1N36L 2VQEQ 4HJ7A 3HKSA 5AJ3L 5C0XJ 4DUZL 4A4IA 3UE0A 4A3FG 2JEBI 2RF4A 3I4OA 3DM3A 4GN4B 4YCUA 5IP7H 1XPOA 4O0AA 1S3OA 4JBMA 1HR0L 4JI1L 3S1QH 4NXML 1L1OB 4POGA 1QVFA 1NE3A 2VL6A 1CSQA 1GVPA 3CC2A 2R7DA 2AWNA 1YJWA 2R92G 1IBLQ 4Y7NH 2E8GA 4HIKA 1X6OA 3UDIA 3S2DH 3L0OA 1ASZA 4A3GH 1X54A 2ZTEA 1N8RC 2UXBQ 1KHIA 1YHQA 1PH7A 2WAQE 4IJHA 2F4VQ 5GAEC 1Q7YC 1HZAA 2Z6KC 4P74A 1XMOL 1JT8A 2JA7G 5IYBH 3FKIG 1IXRA 5HGQA 3H3VH 4AYBG 2NZHA 2JA9A 3PUZA 4R4QA 1R9TH 3A5ZB 3CAMA 4NPSA 5M5YH 2MNAA 1OXXK 5FLMG 1UE6A 3W1BA 5C3EH 1VQGA 2QEXA 3I7FA 2ID0A 1W3SA 4X64L 2R93G 4LF8Q 4YWMA 1VQ6A 4MTNA 3I55A 2A19A 4LFCL 1YHBA 4POFA 3J81c 3EN2A 5ELNA 1YZ6A 1HH2P 1IBMQ 4DV6Q 4LUZA 1NY4A 1I5FA 3G48A 4JI6L 1YJNA 3PO2H 2K50A 3CCLA 3HOYG 4JYAQ 2N78A 3UDXA 2VS1A 1TWGH 1G6PA 1VQEA 4NXNL 3FP9A 5LMUL 2WB1E 3KF8B 4P75A 3TQYA 3KJPA 2ZM6L 4BXXG 1PH6A 1KXLA 1S40A 4IPCA 4QGUA 1D7QA 4BY1G 1HNZL 5GADC 1K8GA 1E7ZA 1TWFH 3LGJA 1TXYA 3OTOQ 1HNXL 5DLQE 3PF5A 5IT9c 2MQHA 3CMEA 4JI7L 3F2DA 2CWPA 5JEAJ 3U4VA 4PG3A 1N33L 1JJCB 5IWAL 3AYHB 3BZKA 1WCMG 3J80i 5LMNQ 4OO1G 1UWVA 4A3CH 4YWKA 1XNRL 3H3VI 3CCJA 5C44G 3JAMc 1ASYA 4JI2L 1PH9A 4KHZA 1Q1EA 1N36Q 1L1OC 5M3FH 1A63A 1RIPA 2FXQA 3CCQA 4L5SA 3I4MH 2B3GA 3CCMA 4DV2Q 2PI2E 3EIVA 4JBJA 4B3SQ 4DV4L 2L15A 5BR8Q 3CC7A 4LF6Q 3HFZB 4A3DG 2E2HH 4HJ5A 4H02A 3ULLA 3H0GG 4C3JH 4BY1H 2UUBL 5ELOA 4JOIC 2Q2TA 2H5XA 1Q46A 1PH5A 4DV3L 3Q8DA 1JJ2A 4JBWA 1GKHA 1HJPA 1OXSC 1YVCA 2HQLA 3A0JA 4TQUS 1NJIC 2I5MX 4WJ3M 4OX9Q 3PGZA 4A76A 1IZ6A 1N9WA 2WAQG 3ZJYC 3VDYA 1XMOQ 4J15A 4A93H 4P72A 2D62A 5M3MG 4QL5A 1A0IA 3MEFA 1EUJA 5GQOA 2D0PA 2EQSA 1EWIA 4IFDI 2BA0A 2R93H 4JI8L 1QVCA 2ZJPA 2PQAB 4BBRH 2RCNA 3KLWA 1K0RA 2KENA 1OTCA 4DV0L 3ICEA 2ATWA 4YCWA 1I50H 1PYSB 2E5LL 4JI6Q 1EIFA 3S14H 1B7YB 3L2PA 3GD7A 3TS2A 1L1OA 2YTVA 4PMWA 4O2DA 3PV0A 4B3TQ 4L5RC 4A3GG 4OXPA 1Z47A 1TWHH 2JA5G 2R7FA 2D0OA 1WYDA 2B29A 1XPUA 4LFBQ 2UXDQ 1XJVA 3AFPA 1N32Q 2KHIA 1HZ9A 2UXCL 4XTCS 2R6GA 4X65Q 2RHQB 1X3FA 2IHFA 1HNWL 5IYDG 1G291 1Q1BA 2K52A 5M3FG 3H15A 2HHHQ 1Z9FA 4DK3C 3TRZA 1K83H 3CCSA 1J6QA 4AYBE 2VUMH 1KRTA 1Y14B 4A3CG 3RZDH 5LMNW 1K9MC 1U5KA 3B6YA 1FJGQ 5C4XG 4KI0A 3RLNA 3I2ZA 2PNHA 1BKBA 1CUKA 1FL0A 5C4JH 3T1YL 1KQSA 1UEBA 1XMQL 5M5XH 2VZAA 2OQ0A 3K81C 2YU9H 1XNQQ 3GTLH 1C0AA 3K8AA 3HOWH 2OQKA 4LFAQ 3HOZG 3WWVA 2HIXA 4YY3Q 4DV2L 4IFDJ 1KIXA 3KOJA 3CF5A 2UUCQ 3CC4A 3F8TA 4PZ8A 4LF7Q 4EX5A 2CCZA 4LF4Q 3HOVG 1EQQA 3UDFA 3KYHC 4DUZQ 4MZ9A 4DV1L 4WJ4A 2ASBA 3HOUH 4DR2L 4HIOA 1K8AC 4OWWB 3HOYH 2K4KA 3M4PA 3STBC 4JI3L 2A1AA 3CPWA 3HKZG 3M9BA 5E7NA 4LUOA 2LXKA 1EFWA 2VQFQ 4JCVE 4DR1L 1X3GA 1M90C 4DV7Q 1VQ4A 4GKJL 4RG1A 2UUAQ 1E24A 4DPGA 4JG2A 1L0WA 1VQAA 1KRSA 3CXCA 4LF8L 4B3RL 5IYDH 5AJ3Q 4DR6Q 1T9HA 4JV5L 2VQEL 2ZJQA 4QIWE 3UE1A 3RLOA 1K3RA 2KBNA 3A74A 3HOZH 1Q86C 3U50C 1I94L 2JEAI 3SGIA 3J80c 1IBKQ 2JK8A 4B3MQ 3TS0A 4DV5L 2LXJA 4JI0Q 3I4NG 4X66Q 1SR3A 1OXVA 3CMAA 1I6HH 2IT1A 4L5QA 2UU9L 2UXBL 1J5EL 1GO3E 2WB1G 1VQLA 1PA6A 2F52A 3L7ZC 4HJ9A 4LF9Q 2K5VA 4LFBL 5JJLA 1UE7A 4JI4Q 1BBWA 4X62Q 2NVQH 2GN5A 2DUDA 4YWLA 1O7IA 4BBSH 1RL2A 1EYGA 2VUMG 4GKKL 1VS0A 2YYZA 3NBHB 3ULJA 3RN5A 4A3JG 4A3FH 4JI5Q 1Q8KA 5IWAQ 1YHAA 4JI1Q 4NXMQ 1KD1C 3D31A 5GROA 1C9OA 4DUYL 4UP7A 3GTKH 2OCEA 4GLVB 3PCOB 3S24A 2KCMA 1A8VA 2JA6H 1LYLA 4A3BG 1JE5A 3TREA 1PV4A 4PZ6A 1V9PA 2JA8G 3T1HL 2JA7H 1HNXQ 4R1JA 3M7NA 4OWTB 1VQPA 2BH8A 2GVBA 2F4VL 3BZCA 3GTGH 1YNXA 5K36G 1PH2A 3KFUA 4LNQA 1XNQL 3PIOA 2JA8H 2GVAA 1XNRQ 1E22A 2YV5A 1PFSA 3CCRA 1JMCA 4LW1A 2VNUD 1KL9A 1SROA 3GO5A 1AH9A 3PSIA 2Q2HA 1KC8C 4X64Q 1VQDA 1HR0Q 1YIJA 4ME3A 2YTXA 2OTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J H;  2K5N A;  4LUV A;  3RN2 A;  3BJU A;  1W2B A;  4L5T A;  5M3M H;  4IPG A;  2LSS A;  3CQZ H;  4DV4 Q;  3GTP H;  3OW2 A;  3EBE A;  4A3I G;  2IX1 A;  1HR0 W;  2A8V A;  3OTO L;  4KLK A;  3RR5 A;  1LTL A;  4YCV A;  1XPR A;  3AFQ A;  4BY7 G;  4JYA L;  4X65 L;  1PHJ A;  2B63 H;  2F3I A;  1FGU A;  1BVS A;  3M4Q A;  2EIF A;  3HKZ E;  5IP9 G;  5M5W H;  4MNO A;  4DAM A;  3J7Z C;  3A5U A;  3RLF A;  4DAY B;  3I4N H;  4DR4 L;  1H95 A;  1X56 A;  2QGQ A;  4K0K L;  1IYJ B;  4UY8 C;  4OX9 L;  4IO9 A;  1Q12 A;  2E2J H;  2Z0S A;  2AKW B;  1LUZ A;  3HOW G;  3CCE A;  3D0F A;  3AQQ A;  4DR5 Q;  4JV5 Q;  5IE8 A;  5JJK A;  3F2B A;  2E5L Q;  4JI7 Q;  4A3K G;  1JJG A;  4OO1 I;  3U58 A;  2VY3 A;  2RHS B;  4KHP L;  1L2F A;  4C2M H;  4GNX B;  4DR3 Q;  4B3M L;  4JI0 L;  4BA2 I;  2Y0S E;  3CP0 A;  1M1K C;  4LF6 L;  5JEA G;  2ZM6 Q;  4JC0 A;  1WJJ A;  4YHH L;  1J5E Q;  3K7A H;  4DV0 Q;  1YI2 A;  2UUC L;  1MKH A;  5LMU Q;  1MJE A;  4JOI A;  4LF4 L;  2HHH L;  3S15 H;  1TWC H;  2KCT A;  4IOC A;  4B3S L;  3NEL A;  3HOX H;  1VQ5 A;  2I5L X;  1WOC A;  3FKI H;  5FJ8 H;  1QVG A;  5HY6 A;  2UXD L;  4AQY Q;  2JA5 H;  4DR7 L;  3I56 A;  1VQ8 A;  1CKN B;  2UXC Q;  5C0X I;  1PH3 A;  3JC6 6;  1HZC A;  1VQO A;  4P73 A;  2YTY A;  4ALP A;  2I0Q A;  3KF6 B;  4UPA A;  2UUB Q;  1S72 A;  4BXX H;  4DV3 Q;  5JJI A;  1JB7 A;  1UE5 A;  2K14 A;  3ERS X;  1YIT A;  3S17 H;  1QUQ B;  1GD7 A;  1AE3 A;  1VQF A;  4LFC Q;  1QZH A;  3J7A 5;  1HNZ Q;  3U4Z A;  1A62 A;  1VQ9 A;  1SE8 A;  5C4X H;  2CWA A;  5BR8 L;  4JBK A;  4HJ8 A;  5IY0 A;  3BU2 A;  1EIY B;  5FJ8 G;  2AMC B;  4IFD G;  1U0L A;  1GM5 A;  1C7Y A;  1SMX A;  2WFW A;  1E3P A;  1VQ7 A;  4GOP A;  4EQ5 A;  2ZJR A;  3RZO H;  3G6E A;  3J81 j;  1IBK L;  4A75 A;  1VQM A;  4GNX A;  4NXN Q;  2K75 A;  1SLJ A;  3PUY A;  1N34 Q;  4BBS G;  5FLX c;  5LMN L;  1VQN A;  4IPH A;  4LFA L;  1VQI A;  1QUQ A;  1CKM A;  1P8L A;  2NN6 I;  1X9N A;  2UUA L;  1LM0 A;  2CQO A;  1Y1V G;  1E1T A;  4NB3 A;  2ZTD A;  2N3S A;  2PI2 A;  3NEN A;  4OON A;  1G51 A;  2JJQ A;  4DR2 Q;  4GLX A;  1SFO H;  2R7Z H;  2PQA A;  3JAM i;  2ES2 A;  1YBY A;  1YEZ A;  4HID A;  4DR4 Q;  1DGS A;  3DLL A;  4JI8 Q;  4A3L H;  2N49 A;  1CKO A;  3J81 i;  3ER0 A;  2JE6 I;  5J3B A;  3F2C A;  4BBR G;  4GNX C;  2N8N A;  2BH2 A;  1PVO A;  4AH6 A;  2HT1 A;  3KJO A;  4LF7 L;  3RNU A;  4QQB X;  3G71 A;  3KDF A;  1MJC A;  4A3E G;  5C44 H;  2KHJ A;  4RMF A;  4BA1 I;  1IBL L;  4BY7 H;  4DV6 L;  4A93 G;  5H1S E;  1WI5 A;  2PMZ E;  2DGY A;  1N32 L;  2IHE A;  1Q82 C;  3HOU G;  1D8L A;  1B8A A;  3PF4 A;  4GKK Q;  3M3Y H;  3CCV A;  4DV7 L;  2IX0 A;  1NTG A;  4QJF A;  3HOV H;  4P71 A;  4TVA B;  4OWX B;  1Y1W G;  1PH4 A;  2WP8 J;  1BBU A;  2EXD A;  2QA4 A;  1OXU A;  3CPF A;  2VQF L;  2ZTC A;  1UE1 A;  2NVX H;  4Y52 H;  3PUX A;  1MIU A;  3CD6 A;  1V43 A;  1K73 C;  1CSP A;  2VW9 A;  1X55 A;  2I5H A;  3NEM A;  3FHW A;  4C3I H;  1SRU A;  2JQO A;  1NBW A;  4R4I A;  3I4M G;  3MXN B;  3PUW A;  4LF5 Q;  4A3L G;  4A3M H;  4B3T L;  3F1Z A;  4R4C A;  1IBM L;  1NMF A;  5EAY A;  1VQC A;  4K0K Q;  3KF6 A;  2JA6 G;  3HOX G;  4YY3 L;  2Q2U A;  1CKN A;  4UP9 A;  1VQH A;  1XMQ Q;  2NZO A;  4HIM A;  4DR5 L;  3GTQ H;  1E1O A;  1WCM H;  1QZG A;  4APV A;  4GN3 B;  2AWO A;  1X3E A;  4C3H H;  3M85 A;  1P16 A;  2OTJ A;  4QY7 A;  4IOA A;  1AE2 A;  1OXT A;  1N34 L;  2OWO A;  4GS3 A;  3E9I A;  2XGT A;  4A3M G;  1SN8 A;  5GAG C;  1I94 Q;  3S16 H;  1FVI A;  2BA1 A;  2CFM A;  4UP8 A;  1HNW Q;  2C35 B;  4DV5 Q;  4XIG S;  3T1H Q;  1NMG A;  3M4O H;  4DUY Q;  4GOP C;  1PH8 A;  1HZB A;  5C0X G;  3E0E A;  4DNI A;  3S1R H;  1EQR A;  3ULP A;  4GKJ Q;  3PO2 G;  3GTM H;  2V1C C;  2E2I H;  2Q2I A;  4FDB A;  4R4O A;  4X62 L;  4JI4 L;  4HJA A;  4DR7 Q;  4B3R Q;  2CKZ B;  3S2H H;  2NVY H;  4PZ7 A;  5IP9 H;  5IP7 G;  1VQB A;  4GLA C;  3KDF B;  2B63 G;  3AEV A;  1Q81 C;  3GDE A;  2NN6 G;  4DKA C;  2ALY B;  4IPD A;  4A3I H;  5FLM H;  5C3E G;  1YJ9 A;  3E9H A;  3OYY A;  1EOV A;  1PYB A;  1V1Q A;  4YHH Q;  4A3E H;  3PIP A;  2MO1 A;  3S1N H;  1KAW A;  1VQJ A;  5IYB G;  5GAH C;  1TWA H;  2K5H A;  3PUV A;  4DV1 Q;  3W5O A;  4KHP Q;  3IRB A;  4DK6 C;  3STB D;  3H0G H;  4DR3 L;  3PO3 H;  2Y0S G;  1I3Q H;  5IYC H;  4AIM A;  3UDG A;  1VCI A;  2HIV A;  3CCU A;  2XTI A;  4GN5 A;  3GTJ H;  4A3K H;  3TEH B;  4LF9 L;  4DR6 L;  4A3D H;  3S1M H;  4X6A H;  4AQY L;  1WFQ A;  1FJG L;  5IYC G;  1N33 Q;  3K80 C;  2R7Z G;  2R92 H;  1IL2 A;  4DR1 Q;  3T1Y Q;  3PO3 G;  2Z6K A;  4JI5 L;  1Y1W H;  1Y1V H;  3W1G A;  3G4S A;  4LWC A;  1VQK A;  3K0X A;  3CW2 C;  4JI3 Q;  4X66 L;  4IJL A;  2IY5 B;  1PH1 A;  1B70 B;  1XTD A;  2MO0 A;  4GOP B;  2UU9 Q;  4A3B H;  3K7U C;  1X65 A;  2MFI A;  4LF5 L;  4JI2 Q;  2NVT H;  2AHO B;  4R4T A;  3GTO H;  1N36 L;  2VQE Q;  4HJ7 A;  3HKS A;  5AJ3 L;  5C0X J;  4DUZ L;  4A4I A;  3UE0 A;  4A3F G;  2JEB I;  2RF4 A;  3I4O A;  3DM3 A;  4GN4 B;  4YCU A;  5IP7 H;  1XPO A;  4O0A A;  1S3O A;  4JBM A;  1HR0 L;  4JI1 L;  3S1Q H;  4NXM L;  1L1O B;  4POG A;  1QVF A;  1NE3 A;  2VL6 A;  1CSQ A;  1GVP A;  3CC2 A;  2R7D A;  2AWN A;  1YJW A;  2R92 G;  1IBL Q;  4Y7N H;  2E8G A;  4HIK A;  1X6O A;  3UDI A;  3S2D H;  3L0O A;  1ASZ A;  4A3G H;  1X54 A;  2ZTE A;  1N8R C;  2UXB Q;  1KHI A;  1YHQ A;  1PH7 A;  2WAQ E;  4IJH A;  2F4V Q;  5GAE C;  1Q7Y C;  1HZA A;  2Z6K C;  4P74 A;  1XMO L;  1JT8 A;  2JA7 G;  5IYB H;  3FKI G;  1IXR A;  5HGQ A;  3H3V H;  4AYB G;  2NZH A;  2JA9 A;  3PUZ A;  4R4Q A;  1R9T H;  3A5Z B;  3CAM A;  4NPS A;  5M5Y H;  2MNA A;  1OXX K;  5FLM G;  1UE6 A;  3W1B A;  5C3E H;  1VQG A;  2QEX A;  3I7F A;  2ID0 A;  1W3S A;  4X64 L;  2R93 G;  4LF8 Q;  4YWM A;  1VQ6 A;  4MTN A;  3I55 A;  2A19 A;  4LFC L;  1YHB A;  4POF A;  3J81 c;  3EN2 A;  5ELN A;  1YZ6 A;  1HH2 P;  1IBM Q;  4DV6 Q;  4LUZ A;  1NY4 A;  1I5F A;  3G48 A;  4JI6 L;  1YJN A;  3PO2 H;  2K50 A;  3CCL A;  3HOY G;  4JYA Q;  2N78 A;  3UDX A;  2VS1 A;  1TWG H;  1G6P A;  1VQE A;  4NXN L;  3FP9 A;  5LMU L;  2WB1 E;  3KF8 B;  4P75 A;  3TQY A;  3KJP A;  2ZM6 L;  4BXX G;  1PH6 A;  1KXL A;  1S40 A;  4IPC A;  4QGU A;  1D7Q A;  4BY1 G;  1HNZ L;  5GAD C;  1K8G A;  1E7Z A;  1TWF H;  3LGJ A;  1TXY A;  3OTO Q;  1HNX L;  5DLQ E;  3PF5 A;  5IT9 c;  2MQH A;  3CME A;  4JI7 L;  3F2D A;  2CWP A;  5JEA J;  3U4V A;  4PG3 A;  1N33 L;  1JJC B;  5IWA L;  3AYH B;  3BZK A;  1WCM G;  3J80 i;  5LMN Q;  4OO1 G;  1UWV A;  4A3C H;  4YWK A;  1XNR L;  3H3V I;  3CCJ A;  5C44 G;  3JAM c;  1ASY A;  4JI2 L;  1PH9 A;  4KHZ A;  1Q1E A;  1N36 Q;  1L1O C;  5M3F H;  1A63 A;  1RIP A;  2FXQ A;  3CCQ A;  4L5S A;  3I4M H;  2B3G A;  3CCM A;  4DV2 Q;  2PI2 E;  3EIV A;  4JBJ A;  4B3S Q;  4DV4 L;  2L15 A;  5BR8 Q;  3CC7 A;  4LF6 Q;  3HFZ B;  4A3D G;  2E2H H;  4HJ5 A;  4H02 A;  3ULL A;  3H0G G;  4C3J H;  4BY1 H;  2UUB L;  5ELO A;  4JOI C;  2Q2T A;  2H5X A;  1Q46 A;  1PH5 A;  4DV3 L;  3Q8D A;  1JJ2 A;  4JBW A;  1GKH A;  1HJP A;  1OXS C;  1YVC A;  2HQL A;  3A0J A;  4TQU S;  1NJI C;  2I5M X;  4WJ3 M;  4OX9 Q;  3PGZ A;  4A76 A;  1IZ6 A;  1N9W A;  2WAQ G;  3ZJY C;  3VDY A;  1XMO Q;  4J15 A;  4A93 H;  4P72 A;  2D62 A;  5M3M G;  4QL5 A;  1A0I A;  3MEF A;  1EUJ A;  5GQO A;  2D0P A;  2EQS A;  1EWI A;  4IFD I;  2BA0 A;  2R93 H;  4JI8 L;  1QVC A;  2ZJP A;  2PQA B;  4BBR H;  2RCN A;  3KLW A;  1K0R A;  2KEN A;  1OTC A;  4DV0 L;  3ICE A;  2ATW A;  4YCW A;  1I50 H;  1PYS B;  2E5L L;  4JI6 Q;  1EIF A;  3S14 H;  1B7Y B;  3L2P A;  3GD7 A;  3TS2 A;  1L1O A;  2YTV A;  4PMW A;  4O2D A;  3PV0 A;  4B3T Q;  4L5R C;  4A3G G;  4OXP A;  1Z47 A;  1TWH H;  2JA5 G;  2R7F A;  2D0O A;  1WYD A;  2B29 A;  1XPU A;  4LFB Q;  2UXD Q;  1XJV A;  3AFP A;  1N32 Q;  2KHI A;  1HZ9 A;  2UXC L;  4XTC S;  2R6G A;  4X65 Q;  2RHQ B;  1X3F A;  2IHF A;  1HNW L;  5IYD G;  1G29 1;  1Q1B A;  2K52 A;  5M3F G;  3H15 A;  2HHH Q;  1Z9F A;  4DK3 C;  3TRZ A;  1K83 H;  3CCS A;  1J6Q A;  4AYB E;  2VUM H;  1KRT A;  1Y14 B;  4A3C G;  3RZD H;  5LMN W;  1K9M C;  1U5K A;  3B6Y A;  1FJG Q;  5C4X G;  4KI0 A;  3RLN A;  3I2Z A;  2PNH A;  1BKB A;  1CUK A;  1FL0 A;  5C4J H;  3T1Y L;  1KQS A;  1UEB A;  1XMQ L;  5M5X H;  2VZA A;  2OQ0 A;  3K81 C;  2YU9 H;  1XNQ Q;  3GTL H;  1C0A A;  3K8A A;  3HOW H;  2OQK A;  4LFA Q;  3HOZ G;  3WWV A;  2HIX A;  4YY3 Q;  4DV2 L;  4IFD J;  1KIX A;  3KOJ A;  3CF5 A;  2UUC Q;  3CC4 A;  3F8T A;  4PZ8 A;  4LF7 Q;  4EX5 A;  2CCZ A;  4LF4 Q;  3HOV G;  1EQQ A;  3UDF A;  3KYH C;  4DUZ Q;  4MZ9 A;  4DV1 L;  4WJ4 A;  2ASB A;  3HOU H;  4DR2 L;  4HIO A;  1K8A C;  4OWW B;  3HOY H;  2K4K A;  3M4P A;  3STB C;  4JI3 L;  2A1A A;  3CPW A;  3HKZ G;  3M9B A;  5E7N A;  4LUO A;  2LXK A;  1EFW A;  2VQF Q;  4JCV E;  4DR1 L;  1X3G A;  1M90 C;  4DV7 Q;  1VQ4 A;  4GKJ L;  4RG1 A;  2UUA Q;  1E24 A;  4DPG A;  4JG2 A;  1L0W A;  1VQA A;  1KRS A;  3CXC A;  4LF8 L;  4B3R L;  5IYD H;  5AJ3 Q;  4DR6 Q;  1T9H A;  4JV5 L;  2VQE L;  2ZJQ A;  4QIW E;  3UE1 A;  3RLO A;  1K3R A;  2KBN A;  3A74 A;  3HOZ H;  1Q86 C;  3U50 C;  1I94 L;  2JEA I;  3SGI A;  3J80 c;  1IBK Q;  2JK8 A;  4B3M Q;  3TS0 A;  4DV5 L;  2LXJ A;  4JI0 Q;  3I4N G;  4X66 Q;  1SR3 A;  1OXV A;  3CMA A;  1I6H H;  2IT1 A;  4L5Q A;  2UU9 L;  2UXB L;  1J5E L;  1GO3 E;  2WB1 G;  1VQL A;  1PA6 A;  2F52 A;  3L7Z C;  4HJ9 A;  4LF9 Q;  2K5V A;  4LFB L;  5JJL A;  1UE7 A;  4JI4 Q;  1BBW A;  4X62 Q;  2NVQ H;  2GN5 A;  2DUD A;  4YWL A;  1O7I A;  4BBS H;  1RL2 A;  1EYG A;  2VUM G;  4GKK L;  1VS0 A;  2YYZ A;  3NBH B;  3ULJ A;  3RN5 A;  4A3J G;  4A3F H;  4JI5 Q;  1Q8K A;  5IWA Q;  1YHA A;  4JI1 Q;  4NXM Q;  1KD1 C;  3D31 A;  5GRO A;  1C9O A;  4DUY L;  4UP7 A;  3GTK H;  2OCE A;  4GLV B;  3PCO B;  3S24 A;  2KCM A;  1A8V A;  2JA6 H;  1LYL A;  4A3B G;  1JE5 A;  3TRE A;  1PV4 A;  4PZ6 A;  1V9P A;  2JA8 G;  3T1H L;  2JA7 H;  1HNX Q;  4R1J A;  3M7N A;  4OWT B;  1VQP A;  2BH8 A;  2GVB A;  2F4V L;  3BZC A;  3GTG H;  1YNX A;  5K36 G;  1PH2 A;  3KFU A;  4LNQ A;  1XNQ L;  3PIO A;  2JA8 H;  2GVA A;  1XNR Q;  1E22 A;  2YV5 A;  1PFS A;  3CCR A;  1JMC A;  4LW1 A;  2VNU D;  1KL9 A;  1SRO A;  3GO5 A;  1AH9 A;  3PSI A;  2Q2H A;  1KC8 C;  4X64 Q;  1VQD A;  1HR0 Q;  1YIJ A;  4ME3 A;  2YTX A;  2OTL A; 
#chains in the Genus database with same CATH topology
 4A3J H;  2K5N A;  3SK4 A;  1W2B A;  2LSS A;  3CQZ H;  1F77 A;  3R2I A;  3SK6 A;  4M8A A;  2A8V A;  3DXJ C;  3RR5 A;  1XPR A;  1B2T A;  1LLR D;  4DFA A;  4IUN A;  4X65 L;  2Y0S B;  2F3I A;  1FGU A;  5M5W H;  3J7Z C;  1IYJ B;  1HTP A;  1Q12 A;  3HG9 A;  5EBD A;  3CCE A;  4JV5 Q;  1O7Y A;  5IE8 A;  2E5L Q;  4JI7 Q;  4A3K G;  2KHS A;  2RHS B;  2VY3 A;  2MUY A;  2XWB B;  4KHP L;  1EEF D;  4HN7 A;  5C3W A;  4YHH L;  1K0S A;  4DAY A;  2M9V A;  4EGV A;  1MKH A;  2JA6 B;  2FMM A;  3TZD A;  3U9S A;  1TWC H;  2KCT A;  4B3S L;  3NEL A;  4CHT B;  2ZT9 C;  4I7A A;  1X3P A;  5C0X I;  4A3L H;  2UUB Q;  2I0Q A;  3KF6 B;  5ELF A;  3D4D A;  4BXX H;  1EY9 A;  4DV3 Q;  3ERS X;  3S17 H;  1RCV D;  1GD7 A;  2JSO A;  3EQL C;  4HMI A;  4FXG C;  2EY2 A;  4MIU A;  1CA5 A;  2KA7 A;  1SE8 A;  3S9W A;  2CWA A;  3H09 A;  5DEH A;  5BR8 L;  1EIY B;  3BU2 A;  2EXZ A;  5FJ8 G;  4IFD G;  1U0L A;  3K5O A;  1GM5 A;  5EKL A;  5T1I A;  1DOM A;  1EZ6 A;  2WFW A;  3NTH A;  4KHV A;  4N8F A;  5CR3 A;  2ZJR A;  3S2H B;  4A75 A;  1Q8I A;  1SLJ A;  5I4D A;  5FLX c;  1C48 A;  3J81 E;  1QUQ A;  1P8L A;  4DA2 A;  2BDN A;  3MHB A;  1O7L A;  1X9N A;  1AZQ A;  2CQO A;  4NB3 A;  3K59 A;  1KNA A;  2ZTD A;  2PI2 A;  3S16 B;  1G51 A;  4GLX A;  4ZUI A;  3JAM i;  1YEZ A;  4XT1 B;  3BDO A;  3DLL A;  1LT4 D;  5FOB B;  1CA6 A;  3S15 B;  1CKO A;  3VR5 A;  4BBR G;  2XNA C;  1STA A;  2MGS A;  4LF7 L;  3GTJ B;  3QB3 A;  4QQB X;  1U4L A;  4QB4 A;  5C44 H;  1IBL L;  4RMF A;  4XXE A;  2GA4 B;  4A93 G;  2JYO A;  5H1S E;  1WI5 A;  3P1H A;  4C2M B;  1N32 L;  2IHE A;  3HOU G;  1D8L A;  1B8A A;  4DV7 L;  1TT2 A;  1NTG A;  2F0U A;  2KED A;  3MAQ A;  4P71 A;  4OWX B;  4A3D B;  3KUP A;  5IGG A;  1BBU A;  2ZTC A;  1UE1 A;  1PFB A;  3KK7 A;  1X55 A;  3NEM A;  3M3Y B;  4C3I H;  5KIX A;  1B3Q A;  3I4M G;  3F1Z A;  4R4C A;  3ONA B;  2DN8 A;  2JA6 G;  3NHH A;  5IOD A;  1CKN A;  1XMQ Q;  1JE4 A;  1GUS A;  3LWU A;  1PLF A;  4ID6 A;  4F88 A;  3J80 E;  3NWS A;  2OTJ A;  1AE2 A;  3SR1 A;  4GS3 A;  3E9I A;  1MSH A;  5JVG 3;  1SN8 A;  3I91 A;  3S16 H;  3JAM L;  4DV5 Q;  3HOU B;  3M4O H;  1KLG D;  3MFY A;  1PH8 A;  1Y1V B;  1HQR D;  1K8M A;  1EQR A;  3GP7 A;  3D4R A;  3GTM H;  3PO2 G;  1JC7 A;  2Q2I A;  4FDB A;  2CKZ B;  1VQB A;  4GLA C;  3KDF B;  1Q81 C;  3T4A C;  1X32 A;  1FR3 A;  2J0T D;  2ALY B;  5C4J B;  4ILW A;  1GUN A;  4CJ0 B;  4QMG A;  3E9H A;  1EOV A;  1XX8 A;  1JQY D;  4KTA A;  1S5D D;  3SK8 A;  2Q8I B;  5GAH C;  2K5H A;  4H7B A;  3W5O A;  4KKS A;  3IRB A;  4DK6 C;  3STB D;  4I65 A;  2HIV A;  2L1B A;  1A6X A;  4DR6 L;  4A3D H;  3TEH B;  4LMQ D;  5BN5 A;  4CKE A;  1Q3L A;  1SNP A;  1WFQ A;  4X3T A;  2R7Z G;  2R93 B;  3PO3 G;  3MXN A;  1RJT A;  4ME5 A;  2X6G A;  1ESF A;  1U4R A;  4JI3 Q;  4IJL A;  1PH1 A;  3QOJ A;  3K57 A;  1SDF A;  4J1M A;  2BE5 C;  4JI2 Q;  2NVT H;  4CKC A;  2AHO B;  2KVM A;  1SMY C;  2F0K A;  4G7Z C;  2JEB I;  2RF4 A;  4YCU A;  1XPO A;  4NXM L;  4POG A;  2K28 A;  1NE3 A;  2VL6 A;  3SHL A;  2E2J B;  2R7D A;  1S4Z A;  1SFO B;  1L0Y B;  4HIK A;  3C2P A;  4LAA A;  5CV9 A;  1STB A;  3C3L A;  1ASZ A;  1DD2 A;  3CU7 A;  1JOR A;  1KHI A;  1YHQ A;  2F4V Q;  4JK1 C;  2BDO A;  4XT3 B;  5IYB H;  3OHX C;  2JA9 A;  3QG1 A;  2JP1 A;  1PRT D;  5CYU A;  2MNA A;  2L5T A;  1UE6 A;  2N88 A;  4HMJ A;  4X64 L;  5KND A;  4PMC A;  2EZV A;  1YHB A;  5M3F B;  1SYG A;  4LJZ C;  4CKB A;  1D1I A;  1IBM Q;  2WV6 D;  4DV6 Q;  4LUZ A;  1I5F A;  3G48 A;  1YJN A;  3UDX A;  3HP3 A;  1SSO A;  3RD4 A;  2WB1 E;  3Q23 A;  1KXL A;  1PH6 A;  3PO2 B;  2ENB A;  1HNZ L;  1LTT D;  5GAD C;  2V4D A;  3PF5 A;  4DXG A;  1G6Z A;  5FLX E;  3DHQ A;  2CWP A;  5JEA J;  3NWT A;  1JJC B;  2NTT A;  1RD9 D;  3W2D A;  1WCM G;  3J80 i;  5ELD A;  4A3C H;  5I2Y A;  2HCI A;  4CDE C;  5C44 G;  3JAM c;  1ASY A;  4JI2 L;  1HTL D;  2E74 C;  1PTO C;  4ABN A;  4OL7 A;  1PDQ A;  1RIP A;  3SDZ A;  4X3K A;  1F2Z A;  4C56 C;  3T16 A;  3EIV A;  4DV4 L;  2O4X A;  3HFZ B;  2TMP A;  3NTI A;  4JOI C;  3NQT A;  3MXU A;  2Q2T A;  4Q0F A;  1OXS C;  3SE0 A;  1BNZ A;  3QIA A;  2I5M X;  3GTO B;  3NP8 A;  4A76 A;  1IZ6 A;  1N9W A;  2WAQ G;  3Q0A A;  3G6J B;  4A93 H;  1A0I A;  5GQO A;  3FVQ A;  1NR2 A;  2R92 B;  4RAU C;  2B2W A;  1STY A;  4BBR H;  4DV0 L;  2E2D C;  1TII D;  2NZ1 D;  1L1O A;  3F2U A;  1STH A;  4PMW A;  3PV0 A;  1IKM A;  4L5R C;  1RDP D;  4CGY B;  3GTK B;  1TWH H;  2R7F A;  2LMC B;  1LTR D;  2KHI A;  4X65 Q;  2E76 C;  3CKI B;  1H9J A;  1Q1B A;  5M3F G;  2HHH Q;  3PMF A;  2M00 A;  3TRZ A;  1TR5 A;  3J80 L;  2VUM H;  1QNK A;  1AN8 A;  3RZD H;  4IFD H;  2HCC A;  3I2Z A;  2PNH A;  1KQS A;  1XMQ L;  5M5X H;  2Q8T A;  2OQK A;  4YY3 Q;  2SOB A;  2EYP A;  3WOF A;  1H9S A;  4FF2 A;  3F8T A;  2AUJ D;  2CCZ A;  4MZ9 A;  1WCM B;  4WJ4 A;  2K5W A;  3GTQ B;  2KCN A;  1IL8 A;  2XWJ B;  4QIW B;  3M4P A;  5D14 A;  5M5X B;  3M9B A;  5E7N A;  4LUO A;  2LXK A;  4WRD A;  4JCV E;  4XQN A;  1J9O A;  5JEA H;  2UUA Q;  5FO8 B;  4DPG A;  4JG2 A;  1L0W A;  5E4X A;  1KRS A;  1NNX A;  5IYD H;  2G9D A;  1EQV A;  3H3V C;  2F1M A;  3TP6 A;  4WFN 3;  2R3Z A;  1B9N A;  3CRK C;  1TS5 A;  3PO3 B;  3UE1 A;  3RLO A;  1K3R A;  1LTA D;  4DAV A;  1NSN S;  1Q86 C;  2QKI C;  2K33 A;  2B2V C;  4R8I A;  5IOC A;  2UU9 L;  4UHV A;  1JOO A;  1GO3 E;  2WB1 G;  3L7Z C;  4HJ9 A;  5M9O A;  2HUG A;  3S14 B;  1V1P B;  1TQO A;  2VUM G;  4BBR B;  3RN5 A;  1ML0 D;  4A3J G;  4A3F H;  1F9P A;  2IJ0 A;  3PCO B;  1WTQ A;  1A8V A;  2JA6 H;  1LYL A;  1JE5 A;  1PV4 A;  1O7Z A;  2PQE A;  3T1H L;  2JA7 H;  3OW7 A;  1HNX Q;  3MEH A;  1LTG D;  4JW0 A;  1VQP A;  2BH8 A;  1VMP A;  2GVB A;  3BZC A;  5K36 G;  4H13 C;  4E6I A;  1JB3 A;  1TS3 A;  1GUO A;  2RSO A;  3CCR A;  1KL9 A;  1KC8 C;  3BYY B;  1HR0 Q;  2XRQ D;  2HQE A;  3KLR A;  4ME3 A;  4LUV A;  3RN2 A;  2EVB A;  2XIW A;  4L5T A;  1ICW A;  3OW2 A;  1BXT A;  4KLK A;  4DNR B;  1PYW D;  3J7A F;  4BY7 G;  4JYA L;  1PHJ A;  1EWC A;  4DAM A;  3A5U A;  4DR4 L;  1L0X B;  2EYM A;  2QGQ A;  3MXG A;  4OX9 L;  3R3O A;  4F87 A;  1TWF B;  1X3Q A;  2Z1C A;  1BDO A;  2QDL A;  4DR3 Q;  4BA2 I;  2Y0S E;  4XQQ A;  4JC0 A;  2JA5 B;  1ZKO A;  5J39 A;  1ONL A;  1D5Z C;  3MC0 B;  4LF4 L;  4JOI A;  2QW7 A;  1H9S B;  3EFX D;  2PZU A;  5EQ0 A;  1K8O A;  1VQ5 A;  4K5V A;  2DNC A;  4HCS A;  2UXD L;  1D5M C;  4AQY Q;  3I56 A;  5C3E B;  1VQO A;  1DYQ A;  4UPA A;  2KCC A;  5LL6 S;  1S72 A;  3T13 A;  1JB7 A;  5JJI A;  1TS4 A;  1UE5 A;  2K14 A;  3LWE A;  1QUQ B;  2F0I A;  1VQ9 A;  5F2D A;  4A3G B;  5IY0 A;  3RZO B;  3S2D B;  1F2L A;  1SMX A;  5AFW A;  4ZCK A;  4EQ5 A;  3RZO H;  4GNX A;  2K75 A;  1HRJ A;  1AW7 A;  4EQP A;  5LMN L;  1ILQ A;  4LFA L;  1VQI A;  3QJY A;  4KJN A;  1DOK A;  1Y1V G;  2PPB C;  2R7Z H;  4DR2 Q;  3TSS A;  2ES2 A;  4DR4 Q;  1D1K A;  3BZD B;  1HFG A;  2JE6 I;  1PVO A;  2HDM A;  2N8N A;  4AH6 A;  1WTP A;  3KDF A;  3T56 B;  1MJC A;  4A3E G;  3J7A V;  3KLS X;  2KHJ A;  1TU2 B;  2PMZ E;  3C46 A;  2DGY A;  1EYA A;  1WTW A;  1Q82 C;  3PF4 A;  3LX0 A;  5IGB A;  1C4Q A;  2NWG A;  3M3Y H;  4GKK Q;  2A74 C;  2IX0 A;  1SYE A;  2F4I A;  3HOV H;  3HOZ B;  1PH4 A;  2NVX B;  4RWS C;  2EXD A;  3K5N A;  1U9R A;  4G7O C;  4JVZ A;  4KY6 A;  1HUM A;  3CD6 A;  2CH4 A;  4R8N A;  3FDT A;  5FK9 C;  2AQ3 B;  1I6H B;  1LT3 D;  1LO5 D;  1TWH B;  4LF5 Q;  3L9A X;  3GV6 A;  1IBM L;  1I4G A;  1KLU D;  1QJO A;  2NBF A;  1VQC A;  4K0K Q;  4YY3 L;  3GTQ H;  4F8M A;  2NN6 H;  5G3L F;  1QZG A;  1GUW A;  4APV A;  4GN3 B;  2AWO A;  1T5E A;  1PZJ D;  4IUU A;  5ISR A;  4NP5 A;  4OHJ A;  2KEE A;  2XGT A;  1I94 Q;  1FVI A;  4QF4 A;  4UP8 A;  5EPJ A;  5C5M A;  4XIG S;  1H9R A;  2AQ1 B;  3R8B A;  1SYD A;  1SYC A;  2O5J C;  3ERO A;  3ULP A;  2I46 A;  1D6E C;  4OEM B;  2E2I H;  4JI4 L;  4R4O A;  4X62 L;  2G9H D;  4DR7 Q;  4K2L A;  3S2H H;  4CDD C;  5IP7 G;  4ZYS A;  4B9W A;  2B63 G;  4BBS B;  3BVG A;  3GDE A;  2DY8 A;  1YJ9 A;  1EOT A;  1V1Q A;  4YHH Q;  1C8C A;  1PRT F;  1VQJ A;  4HSP A;  3OSO A;  1A3U A;  4KV6 A;  3PUV A;  2B8G A;  1QB5 D;  2QCP X;  5JAV A;  2Y0S G;  1I3Q H;  5IYC H;  3UDG A;  3S1M H;  2F0N A;  5IYC G;  2D5D A;  1IL2 A;  3T1Y Q;  4JI5 L;  3BG3 A;  1Y1W H;  1CHP D;  3KLS A;  1GXD C;  3CW2 C;  2IY5 B;  4GOP B;  3K7U C;  3VR4 A;  4LF5 L;  2OXP A;  4HJ7 A;  1S5F D;  5AJ3 L;  5C0X J;  4A4I A;  2WAQ B;  3UE0 A;  2B2V A;  4A3F G;  4O0A A;  2CW0 C;  1HR0 L;  2OEO A;  1L1O B;  4ODG A;  5I9P A;  1CSQ A;  2R92 G;  1WD1 A;  4Y7N H;  4ZQ3 A;  3UDI A;  4N8X 1;  3K6O A;  3I72 A;  4IUR A;  4A3G H;  2UXB Q;  1PH7 A;  5CV7 A;  3N6R A;  3S17 B;  1HZA A;  1XMO L;  1UUP A;  1IXR A;  3ND8 A;  5M3M B;  4NPS A;  1XYI A;  5M5Y H;  1OXX K;  5FLM G;  3TP5 A;  2EYL A;  5C3E H;  1VQG A;  1PZI D;  1DOL A;  1W3S A;  2R93 G;  4LF8 Q;  3I55 A;  2A19 A;  4RHS A;  1PTO B;  4POF A;  3J81 c;  3G7L A;  1YZ6 A;  1A3V A;  1SNO A;  3R93 A;  4I7Z C;  2IL8 A;  5I2X A;  1VQE A;  4OGQ C;  5EBC A;  5JPN C;  3KJP A;  4BXX G;  2B2U C;  2LY7 A;  1NR4 A;  1ROD A;  1TWF H;  2EYF A;  3OTO Q;  1Y8P B;  1RTO A;  2MQH A;  1F9R A;  4J8Q A;  3CME A;  1F2Y A;  3F2D A;  3U4V A;  5HUR A;  2DY7 A;  4HAE A;  4OO1 G;  5IT9 E;  2X69 A;  4YWK A;  3WDN A;  1PFN A;  1KAA A;  1FD7 D;  3V05 A;  4OO1 H;  1L1O C;  1A2T A;  1A63 A;  2FXQ A;  3CCQ A;  1EY5 A;  2PI2 E;  1UAP A;  1YNJ C;  5E3F A;  4A3J B;  2L15 A;  3CC7 A;  4LF6 Q;  2L0C A;  4A3D G;  2E2H H;  4HJ5 A;  2Z8L A;  4H02 A;  3ULL A;  4C3J H;  5COY A;  4BY1 H;  4B08 A;  2H5X A;  1Q46 A;  3I90 A;  3H94 A;  3Q8D A;  4JBW A;  2F0D A;  1PXU A;  1IW7 C;  1JJ2 A;  1GKH A;  1HJP A;  3A0J A;  4ZAI A;  3GTP B;  3M4O B;  1NJI C;  1GUG A;  2EPB A;  3KBG A;  1U4M A;  3ZJY C;  2WB1 B;  1XMO Q;  2QIL A;  4P72 A;  1HPC A;  4ZKC B;  1DCZ A;  5M3M G;  2D0P A;  2EQS A;  1IW7 D;  2F3W A;  4RFB A;  3OMG A;  4IFD I;  2R93 H;  3OWF A;  4JI8 L;  1FNU A;  2A6H C;  2RVL A;  2PQA B;  5D3D A;  3K5L A;  3MFG A;  1OTC A;  5JPM C;  1EY0 A;  1G8Z D;  1EIF A;  5CBE E;  1B7Y B;  4N9T A;  5DM6 3;  2A69 C;  2XSC A;  2Z4H A;  1EQT A;  3KBX A;  4OXP A;  2B29 A;  1XPU A;  3AFP A;  4DGZ A;  4K6D A;  2EJM A;  2PZW A;  1G29 1;  2D9U A;  4G4K A;  1KAB A;  3H15 A;  5CBA E;  1Z9F A;  2VB3 X;  1YNN D;  4AYB E;  4RGO S;  5D65 A;  2F0O A;  4C1N I;  1WTV A;  3S1R B;  1PZK D;  5LMN W;  1H9K A;  1U5K A;  3B6Y A;  1FJG Q;  5C4X G;  2O5I C;  2ZXP A;  4EVO A;  1JWM D;  1BKB A;  1FL0 A;  2BOS A;  1UEB A;  2VZA A;  1MBY A;  1EYD A;  3K81 C;  4FP5 D;  3BYT B;  4Y7N B;  1C0A A;  3K8A A;  5BN3 A;  1ZXT A;  3HOW H;  2R61 A;  1KIX A;  2Z4I A;  4PMB A;  1GHJ A;  3CC4 A;  1SJH D;  4LF4 Q;  3GTG B;  4DUZ Q;  4MHE A;  3HOU H;  1XWE A;  1ENF A;  3HOY H;  3STB C;  1DZ1 A;  4JI3 L;  2A1A A;  4IQZ A;  3CPW A;  1BQQ T;  3DUZ A;  3HOY B;  3HKZ G;  1K28 A;  3VA5 A;  1ZYR C;  1DJR D;  1SNC A;  4RG1 A;  1ESR A;  1E24 A;  2B2T C;  4UAI A;  4DR6 Q;  1FNW A;  1EY6 A;  1EY7 A;  2K32 A;  3A74 A;  2K01 A;  3HOZ H;  4TSS A;  3Q24 A;  1Q90 A;  2JK8 A;  5KEE A;  3I4N G;  3CHB D;  1SR3 A;  1I4P A;  1Y8O B;  5KNB A;  3CMA A;  4L63 B;  1A3T A;  1JOK A;  1V1O A;  2K05 A;  2K5V A;  5JJL A;  4BBS H;  3URY A;  1O7I A;  1SNQ A;  3ULJ A;  3NBH B;  4JI5 Q;  1Q8K A;  1YHA A;  5CV6 A;  4NXM Q;  3D31 A;  1KDA A;  1D2B A;  4NDX A;  2OCE A;  1MD2 D;  4A3B G;  4PZ6 A;  1V9P A;  4FF3 A;  1BUV T;  4IAL A;  1ET9 A;  2F4V L;  5C6A A;  1YNX A;  3KFU A;  4LNQ A;  5EPL A;  3PIO A;  1XNR Q;  4FYD A;  1E22 A;  1PFS A;  2VNU D;  5JVH 3;  2A6H D;  1SRO A;  2Q2H A;  3NSW A;  5DM7 3;  2E2H B;  5CC4 A;  2O2L D;  4X64 Q;  1B44 D;  5M3M H;  3EBE A;  2IX1 A;  1HR0 W;  1BCP D;  3OTO L;  1LTL A;  3AFQ A;  2K03 A;  5IP9 G;  2EIF A;  4IOA A;  1K83 B;  4MNO A;  3RLF A;  1H95 A;  2MJ8 A;  2PO4 A;  5KYI A;  1X56 A;  2L12 A;  1BOS A;  4K0K L;  5CV4 A;  2RSN A;  4IO9 A;  3NXW A;  2AKW B;  1LUZ A;  1LAB A;  2Z0S A;  3D0F A;  3AQQ A;  2RQX A;  3F2B A;  2F0G A;  1D5X C;  5KYL A;  3NUC A;  1M1K C;  2QF7 A;  5JEA G;  4LF6 L;  2P5Z X;  1WJJ A;  2JA7 B;  1YI2 A;  2UUC L;  2KJX A;  3OWE B;  5CMD A;  1S5E D;  3FRP B;  1MJE A;  2HHH L;  1Y1W B;  5JJZ A;  2ICI A;  1S5B D;  2I5L X;  1WOC A;  4KD3 A;  5HY6 A;  4DR7 L;  4A3K B;  1VF5 C;  4U67 3;  1BCP B;  1VQ8 A;  2UXC Q;  5FO9 B;  1HZC A;  3I4N B;  4P73 A;  2YTY A;  4ZLT F;  4C3I G;  1CZW A;  4CJ1 B;  1YIT A;  1AE3 A;  4LFC Q;  1ILP A;  1KTK A;  2Z9H A;  2AUK A;  2EYJ A;  4RHR A;  1E3P A;  2L11 A;  1CT1 D;  4GOP A;  2PW7 A;  3L3O C;  3J81 j;  4NMZ A;  3PUY A;  2B63 B;  4BBS G;  1HXY D;  1BBX C;  1RF2 D;  2F0W A;  1J8I A;  2NN6 I;  2UUA L;  1LM0 A;  3C1E A;  3NEN A;  1NAP A;  4PV1 C;  1SFO H;  2PQA A;  2K7V A;  4KY7 A;  4HID A;  3HOX B;  1AZP A;  4JI8 Q;  4X3S A;  2NUC A;  1MGS A;  4C3H B;  3ER0 A;  4FVM A;  3J81 i;  1BF4 A;  2BH2 A;  2HT1 A;  3KJO A;  3PIO 3;  2OF1 A;  1G2T A;  3TP7 A;  2YU9 B;  4FO2 A;  4BY7 H;  2NB0 A;  3AMU A;  1NUC A;  3MXP A;  3I8Z A;  1LV9 A;  2J7Z A;  3VR6 A;  5KRU A;  2B2W C;  4QJF A;  5C3X A;  5IT9 L;  4A3F B;  3HS0 C;  1Y1W G;  1SE4 A;  4L8J A;  2NVX H;  4Y52 H;  4HTH A;  5FKA C;  1G2S A;  4HSV A;  1V43 A;  2VXW A;  1CSP A;  4G57 A;  5DNF A;  4H0L C;  2VW9 A;  1K73 C;  3FHW A;  1O80 A;  2JQO A;  4A3L G;  4A3M H;  4B3T L;  3CQZ B;  4RCO A;  2F0H A;  2RA4 A;  2MHV A;  1HA6 A;  2Q2U A;  1KDC A;  4UP9 A;  2NZO A;  4DR5 L;  3RMH A;  1E1O A;  1WCM H;  2L4N A;  3MA2 B;  3S1Q B;  2NTS A;  3GQB A;  3M85 A;  3TP8 A;  1ZEQ X;  4QY7 A;  1PRT C;  2OWO A;  2XN9 C;  2RDG A;  2FJ2 A;  3NE5 B;  2K5Q A;  4K14 A;  4ZK9 B;  4A3B B;  2BA1 A;  1HNW Q;  2CFM A;  3T1H Q;  4FNF A;  1JIC A;  2WKC A;  3E5S A;  5A2Q E;  3TN2 A;  4GOP C;  4AYB B;  5C0X G;  4Z9C B;  4QUC A;  3S1R H;  4DNI A;  1R4Q B;  5KNC A;  4FF1 A;  1HCZ A;  2VUM B;  2PNR C;  4PZ7 A;  5IP9 H;  1CQV A;  4EQO A;  3AEV A;  2QEJ C;  2A6E C;  3E0J A;  2NN6 G;  5EGT A;  2AQ2 B;  3S1N B;  1E2V A;  1PYB A;  3OOC A;  4K5X A;  5ELE A;  5FO7 B;  4A3E H;  3PIP A;  2MO1 A;  3S1N H;  1KAW A;  5IYB G;  3OIQ A;  2OT2 A;  4F7X A;  4DV1 Q;  4KHP Q;  3PO3 H;  4C3J G;  4A3K H;  3PQI A;  4GN5 A;  2HDL A;  1RHP A;  2PCF B;  4AQY L;  1OO9 B;  1PTO D;  2EJF C;  3K80 C;  1Y1V H;  1W6J A;  4X66 L;  2MO0 A;  2FHT A;  2SNS A;  4X3U A;  2B8F A;  2MFI A;  1YNJ D;  4A3B H;  3VYU A;  5I6W A;  2VQE Q;  4CDC C;  3HKS A;  3I73 A;  2QDB A;  3MTS A;  2K6A A;  2F0S A;  2F0J A;  4N9P A;  3FEW X;  3A54 A;  1S3O A;  4JBM A;  4JI1 L;  3S1Q H;  1QE6 A;  1QVF A;  4KK7 A;  2F0M A;  1YJW A;  4B9X A;  3FMC A;  2M2L A;  3DEO A;  2CQA A;  2B2T A;  2F0P A;  2K5D A;  1DM0 B;  5FLX L;  1X54 A;  4A3M B;  2RDH A;  1LTS D;  4JPB W;  4C3I B;  2J4X A;  4IJH A;  4KKT A;  3O13 A;  4C1N K;  1Q7Y C;  3MWY W;  4RH6 A;  4C3J B;  3FKI G;  5HGQ A;  3H3V H;  4AYB G;  2NZH A;  1R9T H;  2B2Y A;  3W1B A;  2QEX A;  2ID0 A;  4YWM A;  1VQ6 A;  1EIG A;  4MTN A;  1CFM A;  4LFC L;  3EN2 A;  5ELN A;  1QIL A;  2JA8 B;  1NY4 A;  4JI6 L;  1JWU D;  2F0E A;  2K50 A;  3PO2 H;  3CCL A;  3HOY G;  1QNU A;  5C44 B;  2VS1 A;  1I50 B;  1TWG H;  5EPK A;  4K8J A;  5I9O A;  4MN3 A;  3TQY A;  3T51 B;  2ZM6 L;  1S40 A;  4IPC A;  4QGU A;  1TVX A;  1D7Q A;  3LGJ A;  1EL0 A;  1HNX L;  4U68 A;  5DLQ E;  5IT9 c;  4JI7 L;  4PG3 A;  5IWA L;  3AYH B;  5LMN Q;  4DN4 M;  1DXM A;  3H3V I;  2WAC A;  1EU4 A;  4IZ8 A;  3CCJ A;  4RKB A;  4KHZ A;  1Q1E A;  2A5H A;  1WVL A;  3D3R A;  2EYO A;  3I4M H;  3CCM A;  4DV2 Q;  1R4P B;  4B3S Q;  4JBJ A;  3Q22 A;  5IIF A;  2DNE A;  3H0G G;  5T1G A;  2UUB L;  2LS0 1;  1LTB D;  4QUF A;  1E2Z A;  4DV3 L;  5C5L A;  2EOT A;  1QCB D;  4WJ3 M;  4FXK C;  4OX9 Q;  2C9O A;  4UDU C;  3VDY A;  1V1P A;  1I4Q A;  2D62 A;  5CV5 A;  1EFI D;  4QL5 A;  3MZ5 A;  3BVM A;  1TY2 A;  3C1F A;  4XDX A;  2KEC A;  1QWY A;  2BCO A;  3D6C A;  5E4W C;  2ZJP A;  3SXH A;  2IPK D;  1K0R A;  2KEN A;  4RGM A;  3BS1 A;  1UNS A;  2ATW A;  2ZXO A;  1U4P A;  1I50 H;  1TWG B;  2E5L L;  4JI6 Q;  1ET6 A;  3FPU B;  3P75 A;  4O2D A;  1BR9 A;  1Z47 A;  2KOL A;  1AFP A;  1WYD A;  2D0O A;  3AU7 A;  5A2Q L;  2UXD Q;  2H4O A;  1HZ9 A;  1SNM A;  1Z7T A;  2R6G A;  2RHQ B;  1STG A;  1X3F A;  2IHF A;  1HNW L;  5IYD G;  4CBV A;  5M5Y B;  4IUV A;  1K83 H;  3CCS A;  1J6Q A;  1FNV A;  5K5P A;  3I3C A;  4KN4 C;  3TZU A;  4XQJ A;  1K9M C;  2EE1 A;  2DJF C;  1CUK A;  5C4H A;  2YU9 H;  3GTL H;  3J81 L;  3EA6 A;  4LFA Q;  4V0B A;  4DV2 L;  2E2I B;  2L55 A;  4ZRZ A;  2UUC Q;  4LF7 Q;  2LFN A;  4PZ8 A;  3HOV G;  1SAP A;  1EQQ A;  4DV1 L;  5L37 A;  3OPO A;  2ASB A;  3TDQ A;  4PNY A;  4IUP A;  4DR2 L;  4A93 B;  2HD3 A;  3V96 A;  2VQF Q;  1X3G A;  4DV7 Q;  4OEL B;  1VQA A;  3SVM A;  4LF8 L;  2D2C C;  2FIN B;  5AJ3 Q;  3P20 A;  5E1F A;  1EYC A;  2XRS D;  3HOW B;  3H0G B;  2VQE L;  2ZJQ A;  1BCP F;  1JCK B;  4K8I A;  3K58 A;  3U50 C;  2JEA I;  3SGI A;  3BDL A;  3ZYY X;  4B3M Q;  4JI0 Q;  4DV5 L;  3GV3 A;  2CW0 D;  2IT1 A;  2UXB L;  1J5E L;  1PA6 A;  3DMU A;  2F52 A;  1EEI D;  3A8I E;  1UE7 A;  1BBW A;  4OIK A;  4RKL A;  2NVQ H;  1CZG A;  1EYG A;  2ZXR A;  1VS0 A;  1I4H A;  3GTM B;  3LNN A;  1KD1 C;  3ITP A;  5GRO A;  4DUY L;  4UP7 A;  4GLV B;  3X3N A;  2KCM A;  3I4L A;  2F0T A;  1PTO F;  4DU9 A;  5C4Z A;  2F3V A;  1W6K A;  1PH2 A;  1E2W A;  2JA8 H;  1SE2 A;  4LW1 A;  1PTO H;  2MPM A;  2E75 C;  1VQD A;  1YIJ A;  1NCV A;  3HEJ A;  3QOL A;  3BJU A;  1IKL A;  4IPG A;  4DV4 Q;  5EKK A;  3GTP H;  4A3I G;  4YIJ A;  1QG7 A;  2WII B;  4YCV A;  2FMC A;  2B63 H;  3M4Q A;  1BVS A;  3HKZ E;  2Q8R E;  3I4N H;  4DAY B;  1ENC A;  1ZYR D;  4UY8 C;  2RCF A;  3H91 A;  2B2Y C;  2E2J H;  3HOW G;  3U9O A;  4DR5 Q;  1KDB A;  5JJK A;  1WD0 A;  2IX3 A;  3U58 A;  4OO1 I;  1JJG A;  1L2F A;  4C2M H;  4GNX B;  1MHW C;  1CM9 A;  4B3M L;  4JI0 L;  3CP0 A;  3K7A B;  1HQM C;  2LKV A;  2ZM6 Q;  1SXT A;  3T53 B;  1J5E Q;  3K7A H;  4DV0 Q;  4CDF C;  1SJE D;  3K5M A;  3X3M A;  5LMU Q;  3S15 H;  1CHQ D;  4IOC A;  3HOX H;  3NTK A;  3NQI A;  3IFD A;  3FKI H;  5FJ8 H;  1QVG A;  2R7Z B;  4DK0 A;  2JA5 H;  4J6H A;  1CKN B;  1PH3 A;  1F9Q A;  3JC6 6;  4ALP A;  3W3A A;  4DAP A;  1VQF A;  1QZH A;  3J7A 5;  1HA5 A;  2CHB D;  3U4Z A;  1A62 A;  3P7J A;  1HNZ Q;  5C4X H;  4JBK A;  3E6Z X;  4HJ8 A;  1B4O A;  2AMC B;  1C7Y A;  1Y69 U;  3BDC A;  1VQ7 A;  4DNT B;  4ULL A;  3G6E A;  2NVY B;  1IBK L;  4NXN Q;  1VQM A;  1R9T B;  1N34 Q;  3CRL C;  2SEB D;  1VQN A;  4IPH A;  1QOH A;  1CKM A;  3PIP 3;  5J22 A;  4RGT A;  1FGB D;  1E1T A;  3DWQ A;  4RCN A;  2NVT B;  2N3S A;  4OON A;  2JJQ A;  1SMY D;  1YBY A;  1DGS A;  1TY0 A;  2N49 A;  5J3B A;  3F2C A;  3QO2 A;  4GNX C;  5TSS A;  5IGD A;  2TSS A;  3R2T A;  4TRD A;  3RNU A;  2CVR A;  3NK9 A;  3G71 A;  4BA1 I;  4DV6 L;  4KMU C;  1MSG A;  4FF4 A;  3M4Y A;  3RZD B;  2RDF A;  3CCV A;  3DWP A;  3IL8 A;  4TVA B;  2WP8 J;  4BS9 A;  2QA4 A;  1OXU A;  3CPF A;  5I6Y A;  2VQF L;  1JOQ A;  3NPP A;  3PUX A;  1MIU A;  1EZ8 A;  1CQF A;  1WTO A;  2I5H A;  1SRU A;  3HRZ C;  1NBW A;  1II3 A;  2L9H A;  4R4I A;  3MXN B;  3PUW A;  4H44 C;  4ZKB B;  3HKZ B;  3BVZ A;  1NMF A;  3A55 A;  5EAY A;  1B1Z A;  1IHZ A;  3KF6 A;  4WOR A;  4BY7 B;  5KGU A;  1E0B A;  3HOX G;  2PZT A;  1EY4 A;  2F03 A;  1VQH A;  4HIM A;  4KD4 A;  4IUT A;  5IGC A;  1X3E A;  2PYK A;  4C3H H;  1P16 A;  1OXT A;  1N34 L;  1CK1 A;  1M8A A;  3WOE A;  4A3M G;  5GAG C;  1GOZ A;  1O78 A;  2C35 B;  2SNM A;  1NMG A;  4DUY Q;  1VDZ A;  1HZB A;  3J7Y W;  4P2C B;  1RTN A;  3E0E A;  3H6M A;  4KY5 A;  3A7A B;  4GKJ Q;  2V1C C;  3NBH A;  4B3R Q;  4LK1 C;  3SK5 A;  4HJA A;  2NVY H;  2F0V A;  1GJX A;  2VB2 X;  4DKA C;  1F9S A;  1PFM A;  1SE3 A;  4IPD A;  4A3I H;  5FLM H;  5C3E G;  3OYY A;  4A3I B;  1A2U A;  2NYZ D;  1TWA H;  4Q5V A;  3K0Y A;  3DM1 A;  1YNN C;  1GUT A;  3H0G H;  3ND9 A;  4DR3 L;  4AIM A;  1VCI A;  3CCU A;  4LF9 L;  2XTI A;  2F0L A;  3GTJ H;  4X6A H;  4V19 0;  1FJG L;  1N33 Q;  2R92 H;  4DR1 Q;  1SBB B;  2Z6K A;  3DWA A;  3W1G A;  2SDF A;  3M7G A;  3G4S A;  4LWC A;  1VQK A;  3K0X A;  3ERQ A;  1B70 B;  1XTD A;  2UU9 Q;  5IGF A;  1X65 A;  3IKJ A;  1SYF A;  2A68 D;  4MTK A;  4R4T A;  3GTO H;  1N36 L;  1B3A A;  4RA8 A;  4DUZ L;  3Q6S A;  1EY8 A;  2N55 A;  3DM3 A;  3I4O A;  4GN4 B;  5IP7 H;  3A8K E;  3OMC A;  4BY1 B;  1B9M A;  1GHK A;  3VYS A;  1EWH A;  4QCL A;  1GVP A;  1VF7 A;  3CC2 A;  2AWN A;  1TS2 A;  1I4R A;  1IBL Q;  3GTL B;  2E8G A;  4XYQ A;  5J1Z A;  1X6O A;  5DAU A;  3S2D H;  1TKW B;  1F2M A;  3L0O A;  3I4M B;  2PW5 A;  5C4X B;  2ZTE A;  4RGN A;  1N8R C;  2IW3 A;  1DON A;  2WAQ E;  4IUQ A;  5GAE C;  2Z6K C;  4P74 A;  1JT8 A;  2JA7 G;  1M4V A;  3PUZ A;  4R4Q A;  5D3I B;  1G91 A;  3A5Z B;  3CAM A;  3KF8 A;  2B2U A;  2EYH A;  3I7F A;  4DF7 A;  1I4X A;  2MP1 A;  1ENA A;  2FFK B;  3I70 A;  4G7H C;  1LAC A;  1HH2 P;  1WTX A;  1S5C D;  1JWS D;  1WTR A;  1KNE A;  4JYA Q;  2A6E D;  2N78 A;  4O1N A;  3A8J E;  1G6P A;  1HUN A;  4NXN L;  5HGT A;  2DJG C;  3FP9 A;  5LMU L;  4ZUJ A;  1LT6 D;  4FXD A;  4P75 A;  3FKI B;  3KF8 B;  5G3L D;  5COR A;  4M1U B;  1CI3 M;  4BY1 G;  1K8G A;  1E7Z A;  1TXY A;  2EY6 A;  1CTM A;  1T5X D;  2EY5 A;  3VA7 A;  1N33 L;  4K2K A;  3VR2 A;  3DEP A;  4KJO A;  1STN A;  4HCE A;  1WTH A;  3BZK A;  5ELC A;  3D8G A;  4CJ2 C;  2A73 B;  1UWV A;  1XNR L;  2B39 A;  4HR7 B;  3TME A;  3SEB A;  1PH9 A;  1N36 Q;  5M3F H;  3RUZ A;  3OIP A;  4L5S A;  2XVS A;  2B3G A;  3N52 A;  1IYU A;  1ICF B;  4IN3 A;  5BR8 Q;  1BCP C;  4K6L A;  5M5W B;  5A35 A;  3UI2 A;  5ELO A;  1PH5 A;  3QWN A;  3IFT A;  3QR8 A;  1YVC A;  2HQL A;  4TQU S;  2K04 A;  4S3S A;  3PGZ A;  5EJW A;  3NBI A;  1SYB A;  4J15 A;  4O42 A;  2KUM A;  1EUJ A;  1RKN A;  3MEF A;  2H1E A;  1EWI A;  1SND A;  3VYT A;  2BA0 A;  1UEA B;  1V8Q A;  4GZY C;  5LHY 1;  1QVC A;  3S1M B;  5BN4 A;  2RCN A;  3KLW A;  3ICE A;  5LL6 X;  1PRT B;  2EJG C;  5C0X H;  2NVQ B;  4YCW A;  1PYS B;  2A68 C;  4BWG B;  4DXF A;  3L2P A;  3GD7 A;  1XXG A;  3S14 H;  3TS2 A;  2YTV A;  4KN7 C;  1I6V C;  4B3T Q;  4NW2 A;  4A3G G;  4L6T B;  1STE A;  2JA5 G;  4LFB Q;  3EVQ A;  3AB9 A;  1XJV A;  1N32 Q;  5ELB A;  2UXC L;  4XTC S;  1XTC D;  1MI2 A;  1I3Q B;  2F0F A;  1AEX A;  1JR0 D;  2K52 A;  4WJW A;  4DK3 C;  3A56 A;  5NUC A;  1SEB D;  1TWA B;  3EJI A;  1KRT A;  3TBI B;  1Y14 B;  4A3C G;  4A3E B;  1HHV A;  2KQ3 A;  2IWH A;  4KI0 A;  3RLN A;  3T1Y L;  5C4J H;  3FPP A;  1H9M A;  1A15 A;  2BE5 D;  2OQ0 A;  1XNQ Q;  1K3B C;  3HOZ G;  4IFD J;  3WWV A;  2HIX A;  4XYO A;  3KOJ A;  3CF5 A;  4R9W A;  4EX5 A;  1LT5 D;  3UDF A;  3KYH C;  4HIO A;  1B53 A;  3A7L A;  1K8A C;  4OWW B;  2K4K A;  3HZX A;  1EFW A;  4DR1 L;  4NKL A;  1M90 C;  4OIJ A;  1VQ4 A;  5EKI A;  4GKJ L;  1LTI D;  4B3R L;  3MVV A;  3CXC A;  1VMC A;  2EDG A;  2I07 B;  2ICE C;  2K1B A;  3VR3 A;  1T9H A;  4JV5 L;  3VYR A;  2JXM B;  4QIW E;  1EIH A;  2KBN A;  2WKD A;  2JN4 A;  1I94 L;  3J80 c;  1IBK Q;  3TS0 A;  2LXJ A;  2X6L A;  4X66 Q;  1OXV A;  2C5C A;  1I6H H;  4L5Q A;  1VQL A;  4DK1 A;  5CGK A;  4LF9 Q;  2EY1 A;  5IGE A;  4LFB L;  1HFN A;  3HGB A;  1B50 A;  4JI4 Q;  1PMR A;  4X62 Q;  2GN5 A;  2DUD A;  1Y8N B;  2G5D A;  4YWL A;  1RL2 A;  2A69 D;  5CV8 A;  4C3H G;  4GKK L;  2YYZ A;  4PQX A;  3HOV B;  1BO0 A;  5IWA Q;  4HED A;  4JI1 Q;  3D6W A;  1C9O A;  1TWC B;  3GTK H;  3S24 A;  2RBM A;  3V2T A;  1Z6H A;  4K5W A;  3TRE A;  3D4W A;  4TKO B;  1EU3 A;  2JA8 G;  1IYV A;  2WIN B;  4R1J A;  5K36 H;  3M7N A;  2Z6B A;  4OWT B;  4KKU A;  2PMZ B;  4EQN A;  5JOB A;  3GTG H;  3IAY A;  3E3X A;  2RKS A;  2CH4 W;  1XNQ L;  2GVA A;  1FYC A;  2YV5 A;  1JMC A;  1AH9 A;  3GO5 A;  3JAM E;  3PSI A;  1AP0 A;  2F0Q A;  2YTX A;  2OTL A; 
#chains in the Genus database with same CATH homology
 4A3J H;  2K5N A;  4LUV A;  3RN2 A;  3BJU A;  1W2B A;  4L5T A;  5M3M H;  4IPG A;  2LSS A;  3CQZ H;  4DV4 Q;  3GTP H;  3OW2 A;  3EBE A;  4A3I G;  2IX1 A;  1HR0 W;  2A8V A;  3OTO L;  4KLK A;  3RR5 A;  1LTL A;  4YCV A;  1XPR A;  3AFQ A;  4BY7 G;  4JYA L;  4X65 L;  1PHJ A;  2B63 H;  2F3I A;  1FGU A;  1BVS A;  3M4Q A;  2EIF A;  3HKZ E;  5IP9 G;  5M5W H;  4MNO A;  4DAM A;  3J7Z C;  3A5U A;  3RLF A;  4DAY B;  3I4N H;  4DR4 L;  1H95 A;  1X56 A;  2QGQ A;  4K0K L;  1IYJ B;  4UY8 C;  4OX9 L;  4IO9 A;  1Q12 A;  2E2J H;  2Z0S A;  2AKW B;  1LUZ A;  3HOW G;  3CCE A;  3D0F A;  3AQQ A;  4DR5 Q;  4JV5 Q;  5IE8 A;  5JJK A;  3F2B A;  2E5L Q;  4JI7 Q;  4A3K G;  1JJG A;  4OO1 I;  3U58 A;  2VY3 A;  2RHS B;  4KHP L;  1L2F A;  4C2M H;  4GNX B;  4DR3 Q;  4B3M L;  4JI0 L;  4BA2 I;  2Y0S E;  3CP0 A;  1M1K C;  4LF6 L;  5JEA G;  2ZM6 Q;  4JC0 A;  1WJJ A;  4YHH L;  1J5E Q;  3K7A H;  4DV0 Q;  1YI2 A;  2UUC L;  1MKH A;  5LMU Q;  1MJE A;  4JOI A;  4LF4 L;  2HHH L;  3S15 H;  1TWC H;  2KCT A;  4IOC A;  4B3S L;  3NEL A;  3HOX H;  1VQ5 A;  2I5L X;  1WOC A;  3FKI H;  5FJ8 H;  1QVG A;  5HY6 A;  2UXD L;  4AQY Q;  2JA5 H;  4DR7 L;  3I56 A;  1VQ8 A;  1CKN B;  2UXC Q;  5C0X I;  1PH3 A;  3JC6 6;  1HZC A;  1VQO A;  4P73 A;  2YTY A;  4ALP A;  2I0Q A;  3KF6 B;  4UPA A;  2UUB Q;  1S72 A;  4BXX H;  4DV3 Q;  5JJI A;  1JB7 A;  1UE5 A;  2K14 A;  3ERS X;  1YIT A;  3S17 H;  1QUQ B;  1GD7 A;  1AE3 A;  1VQF A;  4LFC Q;  1QZH A;  3J7A 5;  1HNZ Q;  3U4Z A;  1A62 A;  1VQ9 A;  1SE8 A;  5C4X H;  2CWA A;  5BR8 L;  4JBK A;  4HJ8 A;  5IY0 A;  3BU2 A;  1EIY B;  5FJ8 G;  2AMC B;  4IFD G;  1U0L A;  1GM5 A;  1C7Y A;  1SMX A;  2WFW A;  1E3P A;  1VQ7 A;  4GOP A;  4EQ5 A;  2ZJR A;  3RZO H;  3G6E A;  3J81 j;  1IBK L;  4A75 A;  1VQM A;  4GNX A;  4NXN Q;  2K75 A;  1SLJ A;  3PUY A;  1N34 Q;  4BBS G;  5FLX c;  5LMN L;  1VQN A;  4IPH A;  4LFA L;  1VQI A;  1QUQ A;  1CKM A;  1P8L A;  2NN6 I;  1X9N A;  2UUA L;  1LM0 A;  2CQO A;  1Y1V G;  1E1T A;  4NB3 A;  2ZTD A;  2N3S A;  2PI2 A;  3NEN A;  4OON A;  1G51 A;  2JJQ A;  4DR2 Q;  4GLX A;  1SFO H;  2R7Z H;  2PQA A;  3JAM i;  2ES2 A;  1YBY A;  1YEZ A;  4HID A;  4DR4 Q;  1DGS A;  3DLL A;  4JI8 Q;  4A3L H;  2N49 A;  1CKO A;  3J81 i;  3ER0 A;  2JE6 I;  5J3B A;  3F2C A;  4BBR G;  4GNX C;  2N8N A;  2BH2 A;  1PVO A;  4AH6 A;  2HT1 A;  3KJO A;  4LF7 L;  3RNU A;  4QQB X;  3G71 A;  3KDF A;  1MJC A;  4A3E G;  5C44 H;  2KHJ A;  4RMF A;  4BA1 I;  1IBL L;  4BY7 H;  4DV6 L;  4A93 G;  5H1S E;  1WI5 A;  2PMZ E;  2DGY A;  1N32 L;  2IHE A;  1Q82 C;  3HOU G;  1D8L A;  1B8A A;  3PF4 A;  4GKK Q;  3M3Y H;  3CCV A;  4DV7 L;  2IX0 A;  1NTG A;  4QJF A;  3HOV H;  4P71 A;  4TVA B;  4OWX B;  1Y1W G;  1PH4 A;  2WP8 J;  1BBU A;  2EXD A;  2QA4 A;  1OXU A;  3CPF A;  2VQF L;  2ZTC A;  1UE1 A;  2NVX H;  4Y52 H;  3PUX A;  1MIU A;  3CD6 A;  1V43 A;  1K73 C;  1CSP A;  2VW9 A;  1X55 A;  2I5H A;  3NEM A;  3FHW A;  4C3I H;  1SRU A;  2JQO A;  1NBW A;  4R4I A;  3I4M G;  3MXN B;  3PUW A;  4LF5 Q;  4A3L G;  4A3M H;  4B3T L;  3F1Z A;  4R4C A;  1IBM L;  1NMF A;  5EAY A;  1VQC A;  4K0K Q;  3KF6 A;  2JA6 G;  3HOX G;  4YY3 L;  2Q2U A;  1CKN A;  4UP9 A;  1VQH A;  1XMQ Q;  2NZO A;  4HIM A;  4DR5 L;  3GTQ H;  1E1O A;  1WCM H;  1QZG A;  4APV A;  4GN3 B;  2AWO A;  1X3E A;  4C3H H;  3M85 A;  1P16 A;  2OTJ A;  4QY7 A;  4IOA A;  1AE2 A;  1OXT A;  1N34 L;  2OWO A;  4GS3 A;  3E9I A;  2XGT A;  4A3M G;  1SN8 A;  5GAG C;  1I94 Q;  3S16 H;  1FVI A;  2BA1 A;  2CFM A;  4UP8 A;  1HNW Q;  2C35 B;  4DV5 Q;  4XIG S;  3T1H Q;  1NMG A;  3M4O H;  4DUY Q;  4GOP C;  1PH8 A;  1HZB A;  5C0X G;  3E0E A;  4DNI A;  3S1R H;  1EQR A;  3ULP A;  4GKJ Q;  3PO2 G;  3GTM H;  2V1C C;  2E2I H;  2Q2I A;  4FDB A;  4R4O A;  4X62 L;  4JI4 L;  4HJA A;  4DR7 Q;  4B3R Q;  2CKZ B;  3S2H H;  2NVY H;  4PZ7 A;  5IP9 H;  5IP7 G;  1VQB A;  4GLA C;  3KDF B;  2B63 G;  3AEV A;  1Q81 C;  3GDE A;  2NN6 G;  4DKA C;  2ALY B;  4IPD A;  4A3I H;  5FLM H;  5C3E G;  1YJ9 A;  3E9H A;  3OYY A;  1EOV A;  1PYB A;  1V1Q A;  4YHH Q;  4A3E H;  3PIP A;  2MO1 A;  3S1N H;  1KAW A;  1VQJ A;  5IYB G;  5GAH C;  1TWA H;  2K5H A;  3PUV A;  4DV1 Q;  3W5O A;  4KHP Q;  3IRB A;  4DK6 C;  3STB D;  3H0G H;  4DR3 L;  3PO3 H;  2Y0S G;  1I3Q H;  5IYC H;  4AIM A;  3UDG A;  1VCI A;  2HIV A;  3CCU A;  2XTI A;  4GN5 A;  3GTJ H;  4A3K H;  3TEH B;  4LF9 L;  4DR6 L;  4A3D H;  3S1M H;  4X6A H;  4AQY L;  1WFQ A;  1FJG L;  5IYC G;  1N33 Q;  3K80 C;  2R7Z G;  2R92 H;  1IL2 A;  4DR1 Q;  3T1Y Q;  3PO3 G;  2Z6K A;  4JI5 L;  1Y1W H;  1Y1V H;  3W1G A;  3G4S A;  4LWC A;  1VQK A;  3K0X A;  3CW2 C;  4JI3 Q;  4X66 L;  4IJL A;  2IY5 B;  1PH1 A;  1B70 B;  1XTD A;  2MO0 A;  4GOP B;  2UU9 Q;  4A3B H;  3K7U C;  1X65 A;  2MFI A;  4LF5 L;  4JI2 Q;  2NVT H;  2AHO B;  4R4T A;  3GTO H;  1N36 L;  2VQE Q;  4HJ7 A;  3HKS A;  5AJ3 L;  5C0X J;  4DUZ L;  4A4I A;  3UE0 A;  4A3F G;  2JEB I;  2RF4 A;  3I4O A;  3DM3 A;  4GN4 B;  4YCU A;  5IP7 H;  1XPO A;  4O0A A;  1S3O A;  4JBM A;  1HR0 L;  4JI1 L;  3S1Q H;  4NXM L;  1L1O B;  4POG A;  1QVF A;  1NE3 A;  2VL6 A;  1CSQ A;  1GVP A;  3CC2 A;  2R7D A;  2AWN A;  1YJW A;  2R92 G;  1IBL Q;  4Y7N H;  2E8G A;  4HIK A;  1X6O A;  3UDI A;  3S2D H;  3L0O A;  1ASZ A;  4A3G H;  1X54 A;  2ZTE A;  1N8R C;  2UXB Q;  1KHI A;  1YHQ A;  1PH7 A;  2WAQ E;  4IJH A;  2F4V Q;  5GAE C;  1Q7Y C;  1HZA A;  2Z6K C;  4P74 A;  1XMO L;  1JT8 A;  2JA7 G;  5IYB H;  3FKI G;  1IXR A;  5HGQ A;  3H3V H;  4AYB G;  2NZH A;  2JA9 A;  3PUZ A;  4R4Q A;  1R9T H;  3A5Z B;  3CAM A;  4NPS A;  5M5Y H;  2MNA A;  1OXX K;  5FLM G;  1UE6 A;  3W1B A;  5C3E H;  1VQG A;  2QEX A;  3I7F A;  2ID0 A;  1W3S A;  4X64 L;  2R93 G;  4LF8 Q;  4YWM A;  1VQ6 A;  4MTN A;  3I55 A;  2A19 A;  4LFC L;  1YHB A;  4POF A;  3J81 c;  3EN2 A;  5ELN A;  1YZ6 A;  1HH2 P;  1IBM Q;  4DV6 Q;  4LUZ A;  1NY4 A;  1I5F A;  3G48 A;  4JI6 L;  1YJN A;  3PO2 H;  2K50 A;  3CCL A;  3HOY G;  4JYA Q;  2N78 A;  3UDX A;  2VS1 A;  1TWG H;  1G6P A;  1VQE A;  4NXN L;  3FP9 A;  5LMU L;  2WB1 E;  3KF8 B;  4P75 A;  3TQY A;  3KJP A;  2ZM6 L;  4BXX G;  1PH6 A;  1KXL A;  1S40 A;  4IPC A;  4QGU A;  1D7Q A;  4BY1 G;  1HNZ L;  5GAD C;  1K8G A;  1E7Z A;  1TWF H;  3LGJ A;  1TXY A;  3OTO Q;  1HNX L;  5DLQ E;  3PF5 A;  5IT9 c;  2MQH A;  3CME A;  4JI7 L;  3F2D A;  2CWP A;  5JEA J;  3U4V A;  4PG3 A;  1N33 L;  1JJC B;  5IWA L;  3AYH B;  3BZK A;  1WCM G;  3J80 i;  5LMN Q;  4OO1 G;  1UWV A;  4A3C H;  4YWK A;  1XNR L;  3H3V I;  3CCJ A;  5C44 G;  3JAM c;  1ASY A;  4JI2 L;  1PH9 A;  4KHZ A;  1Q1E A;  1N36 Q;  1L1O C;  5M3F H;  1A63 A;  1RIP A;  2FXQ A;  3CCQ A;  4L5S A;  3I4M H;  2B3G A;  3CCM A;  4DV2 Q;  2PI2 E;  3EIV A;  4JBJ A;  4B3S Q;  4DV4 L;  2L15 A;  5BR8 Q;  3CC7 A;  4LF6 Q;  3HFZ B;  4A3D G;  2E2H H;  4HJ5 A;  4H02 A;  3ULL A;  3H0G G;  4C3J H;  4BY1 H;  2UUB L;  5ELO A;  4JOI C;  2Q2T A;  2H5X A;  1Q46 A;  1PH5 A;  4DV3 L;  3Q8D A;  1JJ2 A;  4JBW A;  1GKH A;  1HJP A;  1OXS C;  1YVC A;  2HQL A;  3A0J A;  4TQU S;  1NJI C;  2I5M X;  4WJ3 M;  4OX9 Q;  3PGZ A;  4A76 A;  1IZ6 A;  1N9W A;  2WAQ G;  3ZJY C;  3VDY A;  1XMO Q;  4J15 A;  4A93 H;  4P72 A;  2D62 A;  5M3M G;  4QL5 A;  1A0I A;  3MEF A;  1EUJ A;  5GQO A;  2D0P A;  2EQS A;  1EWI A;  4IFD I;  2BA0 A;  2R93 H;  4JI8 L;  1QVC A;  2ZJP A;  2PQA B;  4BBR H;  2RCN A;  3KLW A;  1K0R A;  2KEN A;  1OTC A;  4DV0 L;  3ICE A;  2ATW A;  4YCW A;  1I50 H;  1PYS B;  2E5L L;  4JI6 Q;  1EIF A;  3S14 H;  1B7Y B;  3L2P A;  3GD7 A;  3TS2 A;  1L1O A;  2YTV A;  4PMW A;  4O2D A;  3PV0 A;  4B3T Q;  4L5R C;  4A3G G;  4OXP A;  1Z47 A;  1TWH H;  2JA5 G;  2R7F A;  2D0O A;  1WYD A;  2B29 A;  1XPU A;  4LFB Q;  2UXD Q;  1XJV A;  3AFP A;  1N32 Q;  2KHI A;  1HZ9 A;  2UXC L;  4XTC S;  2R6G A;  4X65 Q;  2RHQ B;  1X3F A;  2IHF A;  1HNW L;  5IYD G;  1G29 1;  1Q1B A;  2K52 A;  5M3F G;  3H15 A;  2HHH Q;  1Z9F A;  4DK3 C;  3TRZ A;  1K83 H;  3CCS A;  1J6Q A;  4AYB E;  2VUM H;  1KRT A;  1Y14 B;  4A3C G;  3RZD H;  5LMN W;  1K9M C;  1U5K A;  3B6Y A;  1FJG Q;  5C4X G;  4KI0 A;  3RLN A;  3I2Z A;  2PNH A;  1BKB A;  1CUK A;  1FL0 A;  5C4J H;  3T1Y L;  1KQS A;  1UEB A;  1XMQ L;  5M5X H;  2VZA A;  2OQ0 A;  3K81 C;  2YU9 H;  1XNQ Q;  3GTL H;  1C0A A;  3K8A A;  3HOW H;  2OQK A;  4LFA Q;  3HOZ G;  3WWV A;  2HIX A;  4YY3 Q;  4DV2 L;  4IFD J;  1KIX A;  3KOJ A;  3CF5 A;  2UUC Q;  3CC4 A;  3F8T A;  4PZ8 A;  4LF7 Q;  4EX5 A;  2CCZ A;  4LF4 Q;  3HOV G;  1EQQ A;  3UDF A;  3KYH C;  4DUZ Q;  4MZ9 A;  4DV1 L;  4WJ4 A;  2ASB A;  3HOU H;  4DR2 L;  4HIO A;  1K8A C;  4OWW B;  3HOY H;  2K4K A;  3M4P A;  3STB C;  4JI3 L;  2A1A A;  3CPW A;  3HKZ G;  3M9B A;  5E7N A;  4LUO A;  2LXK A;  1EFW A;  2VQF Q;  4JCV E;  4DR1 L;  1X3G A;  1M90 C;  4DV7 Q;  1VQ4 A;  4GKJ L;  4RG1 A;  2UUA Q;  1E24 A;  4DPG A;  4JG2 A;  1L0W A;  1VQA A;  1KRS A;  3CXC A;  4LF8 L;  4B3R L;  5IYD H;  5AJ3 Q;  4DR6 Q;  1T9H A;  4JV5 L;  2VQE L;  2ZJQ A;  4QIW E;  3UE1 A;  3RLO A;  1K3R A;  2KBN A;  3A74 A;  3HOZ H;  1Q86 C;  3U50 C;  1I94 L;  2JEA I;  3SGI A;  3J80 c;  1IBK Q;  2JK8 A;  4B3M Q;  3TS0 A;  4DV5 L;  2LXJ A;  4JI0 Q;  3I4N G;  4X66 Q;  1SR3 A;  1OXV A;  3CMA A;  1I6H H;  2IT1 A;  4L5Q A;  2UU9 L;  2UXB L;  1J5E L;  1GO3 E;  2WB1 G;  1VQL A;  1PA6 A;  2F52 A;  3L7Z C;  4HJ9 A;  4LF9 Q;  2K5V A;  4LFB L;  5JJL A;  1UE7 A;  4JI4 Q;  1BBW A;  4X62 Q;  2NVQ H;  2GN5 A;  2DUD A;  4YWL A;  1O7I A;  4BBS H;  1RL2 A;  1EYG A;  2VUM G;  4GKK L;  1VS0 A;  2YYZ A;  3NBH B;  3ULJ A;  3RN5 A;  4A3J G;  4A3F H;  4JI5 Q;  1Q8K A;  5IWA Q;  1YHA A;  4JI1 Q;  4NXM Q;  1KD1 C;  3D31 A;  5GRO A;  1C9O A;  4DUY L;  4UP7 A;  3GTK H;  2OCE A;  4GLV B;  3PCO B;  3S24 A;  2KCM A;  1A8V A;  2JA6 H;  1LYL A;  4A3B G;  1JE5 A;  3TRE A;  1PV4 A;  4PZ6 A;  1V9P A;  2JA8 G;  3T1H L;  2JA7 H;  1HNX Q;  4R1J A;  3M7N A;  4OWT B;  1VQP A;  2BH8 A;  2GVB A;  2F4V L;  3BZC A;  3GTG H;  1YNX A;  5K36 G;  1PH2 A;  3KFU A;  4LNQ A;  1XNQ L;  3PIO A;  2JA8 H;  2GVA A;  1XNR Q;  1E22 A;  2YV5 A;  1PFS A;  3CCR A;  1JMC A;  4LW1 A;  2VNU D;  1KL9 A;  1SRO A;  3GO5 A;  1AH9 A;  3PSI A;  2Q2H A;  1KC8 C;  4X64 Q;  1VQD A;  1HR0 Q;  1YIJ A;  4ME3 A;  2YTX A;  2OTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...