3E0EA

Crystal structure of a domain of replication protein a from methanococcus maripaludis. northeast structural genomics targe mrr110b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
91
Chain Sequence
MNYKISELMPNLSGTINAEVVTAYPKKEFSTKGQLKSLFLKDDTGSIRGTLWNELADFEVKKGDIAEVSGYVKQGGLEISVDNIGIIEKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a domain of replication protein A from Methanococcus maripaludis. NorthEast Structural Genomics targe MrR110B
rcsb
source organism Methanococcus maripaludis
molecule tags Replication
molecule keywords Replication protein A
total genus 22
structure length 91
sequence length 97
ec nomenclature
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3e0eA00
1PH3A 2UUBL 3PCOB 1NY4A 1IYJB 4KI0A 3PF5A 1XNQQ 2NVTH 3RZOH 1NE3A 3W5OA 4AIMA 2JJQA 4LFBQ 1CKMA 1IBLQ 1MIUA 3F8TA 4B3SL 2AMCB 5IE8A 4LF9L 3CQZH 3CP0A 1A63A 4DR6L 1X3FA 2BA0A 3K8AA 3B6YA 4R4TA 2Z6KC 3J81i 4NXML 2D0OA 1UE1A 4P71A 4DAYB 2ZJRA 1PH9A 4IOAA 4LF7L 4R4CA 1YHQA 1GO3E 4JI5L 1FVIA 3HOUG 5BR8Q 5IYCG 1X56A 3J7A5 4A3GG 4LFCQ 2NN6G 4JOIA 4MZ9A 1X54A 4LFBL 2JQOA 2NN6I 4RG1A 3TREA 2Y0SE 3AYHB 2IX1A 2NZOA 2OQKA 1J5EL 3D0FA 1YJWA 4R4QA 1PH2A 3GTKH 3J80c 4POFA 3NENA 3CMEA 4JI4Q 3K7UC 2HHHL 1KRSA 4B3ML 2HIVA 1Q1EA 4IOCA 1WI5A 2YV5A 3NEMA 4LFAQ 3H0GH 4JI1Q 3J7ZC 4JI6Q 2ALYB 2MO1A 1JMCA 4A93H 4DV1Q 1PHJA 1VQ4A 2R92G 3ICEA 1QZHA 1Q81C 1X6OA 2B63H 5GAGC 5JEAG 1I50H 2Q2UA 2Y0SG 2RHQB 1QZGA 4JI8Q 2ES2A 4JV5L 1K3RA 4LUVA 3BU2A 3J80i 2N49A 5JEAJ 1HR0W 1IXRA 4X62Q 1EYGA 2L15A 5GAHC 5AJ3L 4Y52H 1XPRA 2WB1E 5IT9c 1VQ5A 1CKNB 1T9HA 4UY8C 4GN4B 2LSSA 1WOCA 4PZ7A 4HJ8A 2R7ZG 5IP9G 2ZTDA 3F2BA 4HJAA 4POGA 2YYZA 3GTPH 1B7YB 1RL2A 5M5YH 1VQMA 1KL9A 3G48A 2XTIA 4LUZA 2UXBQ 1VQGA 3T1HQ 5FLXc 3JC66 4DR1L 4DR7L 4GKKQ 3AFPA 1TWHH 5C44G 3PSIA 1C7YA 1E1OA 1K0RA 3UDXA 4X64Q 4HJ5A 2V1CC 4DR2L 3HOZH 1CKNA 5E7NA 1XMOL 2E5LQ 3A5ZB 4DNIA 4DR3Q 1EIYB 4R4OA 4A3BG 4MTNA 4IFDJ 4BBRH 2R93G 2OTLA 1HH2P 1P16A 2JE6I 4A3DH 3CW2C 3I2ZA 1A62A 1VQHA 2VS1A 4LF7Q 4KHPL 4P73A 4X66Q 3CF5A 1HNWL 3HKZG 1N34Q 3AEVA 4JI3Q 1U0LA 4IJHA 3STBC 3OTOL 1GM5A 2HQLA 1FJGQ 3KJPA 1EQQA 2ASBA 3S17H 1PV4A 1XPUA 2PMZE 1VQBA 1K8AC 1E3PA 2GVBA 1NBWA 3CPFA 1HNZL 1Q12A 4A3EG 3S1QH 2ATWA 2VUMG 3KF8B 2JA5H 4DV3L 3K80C 4P72A 1EFWA 4A3DG 3KF6B 3OYYA 4AQYL 2MQHA 3UDIA 1SN8A 4YCUA 3A5UA 3H3VH 4YHHQ 3F1ZA 3HOWG 1SRUA 1XMQL 4BY1G 2Q2HA 1HJPA 3W1BA 2NVYH 3M7NA 2KCMA 4OXPA 1X3EA 4TVAB 3RNUA 1E24A 2D0PA 2ID0A 3U50C 4NXNL 4C3JH 4QY7A 2UUCQ 1SFOH 1Y1VG 2HIXA 3TRZA 4X62L 4WJ4A 3HOWH 4TQUS 5EAYA 3PGZA 4BY7H 1V1QA 2UU9Q 1FGUA 2F4VL 1IBMQ 3E0EA 4JCVE 4UP9A 1W2BA 4B3SQ 3CCQA 2JEAI 3GTOH 3KFUA 5AJ3Q 1BKBA 3RN2A 4DUYQ 5BR8L 4LF6L 1EIFA 1PH5A 4R4IA 4LF4Q 2WP8J 3S14H 1A8VA 4QJFA 2D62A 1KRTA 4A3KH 4JBMA 3FHWA 4LFCL 1BVSA 3Q8DA 5C4XH 1K8GA 2B63G 4IPHA 4MNOA 2MNAA 2R92H 1C0AA 1SLJA 4DR5Q 4JI7L 2IT1A 3A74A 4L5RC 4C3IH 3JAMi 2PI2E 1VCIA 2E2IH 1D7QA 1VQCA 1WFQA 1LTLA 4R1JA 1J5EQ 3CCVA 4B3RL 4A3LH 5JJIA 2BH8A 1VQAA 1XNRQ 1SROA 5M3FG 4BA1I 3M9BA 4A76A 4LUOA 3W1GA 2IHEA 3G6EA 1Y1WG 1OXUA 4KHZA 1IZ6A 1TWAH 1PH7A 4JI3L 4BA2I 5IYCH 3E9HA 3CMAA 2K52A 1PFSA 1XJVA 3OW2A 1VQFA 3GTGH 2Q2IA 4LF8Q 1Y14B 3HOUH 4OO1G 2UUBQ 3M85A 4JV5Q 1VQJA 1YHAA 5LMUL 2K5VA 4GOPA 3VDYA 4JI0Q 1N9WA 3CD6A 1Q1BA 1N33L 1B70B 4DV4Q 2CQOA 2LXKA 3G71A 3EBEA 1GD7A 4UP7A 1N36Q 4QIWE 2OCEA 1JJCB 1WJJA 3KOJA 3TEHB 3JAMc 4JC0A 1HNXQ 1VS0A 1KHIA 3TQYA 3GO5A 2I5LX 4X65Q 3PIOA 1E22A 1XTDA 1Z47A 2VZAA 5M5WH 3ULPA 4A93G 4HJ9A 4GOPB 4A4IA 3I4NG 2YU9H 4GOPC 4DV0L 4A75A 2UXBL 5IYBG 2JEBI 3ER0A 1PH1A 4LFAL 3PIPA 1PYSB 1Q82C 3CCJA 4DV4L 1NMGA 1N34L 4JI4L 1IBKQ 1XPOA 5IY0A 1VQNA 4GKJL 4L5SA 3K7AH 3UE1A 4X66L 1HR0Q 3PUYA 3G4SA 1CSQA 2GVAA 3ULJA 1HNXL 4DV1L 4HJ7A 1LM0A 4H02A 3I4MH 1TWGH 3M3YH 3LGJA 1UEBA 1FJGL 1GVPA 2WAQE 1QVCA 3KJOA 3GTQH 4BXXH 1AE2A 2K5NA 3CXCA 1MJEA 4IO9A 1L1OB 3SGIA 1JB7A 2PQAA 1QVFA 4YWKA 3CPWA 4DR4Q 2AWNA 1X9NA 5M5XH 1YIJA 1IL2A 3AFQA 4O0AA 1SR3A 5C0XG 1UE7A 1RIPA 2DGYA 3PF4A 1I5FA 1UE5A 3S24A 2CFMA 1XNRL 1S40A 4RMFA 4K0KQ 2OWOA 4JYAL 4IJLA 4JOIC 1X65A 4DK6C 3PUXA 1Y1WH 4UP8A 5M3FH 3H3VI 2IY5B 4JI2L 2KHJA 1A0IA 4IPCA 2MO0A 5J3BA 4YY3Q 5IWAL 1PA6A 2UUAQ 2HHHQ 4B3MQ 1DGSA 2A8VA 3NBHB 4JBWA 2Z6KA 1JJ2A 4DV2Q 2N3SA 3I4NH 3CC2A 4JI1L 4UPAA 5GROA 2YTYA 1G291 2BH2A 4IFDG 1M1KC 2OTJA 1J6QA 4ALPA 1HNZQ 3PO2G 4AH6A 1PYBA 5C4XG 4LF4L 2CWPA 4WJ3M 3GDEA 1OXVA 1N36L 5C3EG 5ELNA 5HY6A 5JJKA 4IPGA 4A3KG 4JBJA 3S2DH 1KD1C 3KF6A 2VL6A 1SE8A 1D8LA 1IBLL 3RLFA 1YJNA 1E7ZA 1FL0A 4LW1A 3I56A 4GN3B 5DLQE 3AQQA 3CCSA 1G6PA 3HOYH 4DV5L 4DR6Q 2VNUD 3DLLA 3I55A 3CC4A 1TXYA 1N8RC 4DPGA 1OXSC 5C0XI 2VQFQ 1I94L 2B29A 1KC8C 1KAWA 4APVA 1L1OA 5FJ8G 4A3JG 4A3CG 1PH6A 2ZJPA 4GLXA 3M4PA 4GNXB 1Y1VH 1AE3A 4DR7Q 2N8NA 3K81C 2DUDA 2K50A 4LNQA 1SMXA 4J15A 2NZHA 5LMUQ 5ELOA 4FDBA 3J81j 2B3GA 5K36G 3H15A 1UE6A 1TWCH 1YVCA 4PG3A 4LF5Q 4A3LG 4OX9L 2JA8G 4DR4L 2JA7H 1VQIA 1YNXA 3RZDH 3D31A 2K4KA 3FP9A 2R7DA 2VQFL 2VUMH 3ZJYC 4JI6L 2ZM6L 4DV7Q 1YJ9A 2R7FA 4A3EH 2UXCQ 3MEFA 1JE5A 3S16H 1JT8A 5M3MH 1G51A 5C0XJ 1JJGA 3EN2A 2MFIA 4YCVA 5IP7G 4BBSG 4B3TQ 4HIDA 4K0KL 3CCRA 5FLMG 2F52A 3L7ZC 1EQRA 4JYAQ 3HOXH 1WCMH 4C3HH 1Q7YC 4DAMA 3BZKA 1IBKL 2K5HA 4DV2L 2AKWB 2GN5A 4HIOA 1B8AA 2R93H 1OTCA 3KDFB 4L5QA 4O2DA 4YY3L 2C35B 2BA1A 2E8GA 4YHHL 3J81c 4JI5Q 1K83H 3S1MH 1Z9FA 4BY7G 2PI2A 4GLVB 1EUJA 1NJIC 1ASYA 3HOZG 4PZ6A 1NTGA 4PZ8A 4IFDI 4GKJQ 2H5XA 2K14A 2UXCL 4DR1Q 4P74A 4X6AH 2AWOA 2JA6H 5IYDH 4AYBG 5C44H 2UUCL 4NXNQ 3M4QA 1PH8A 2JA9A 1YBYA 3E9IA 3IRBA 2I0QA 4A3FG 3RN5A 1K73C 4B3TL 1P8LA 4GN5A 1VQ7A 4BY1H 2LXJA 2EIFA 2UU9L 1OXXK 3PUVA 2E2JH 1IBML 3UE0A 5GADC 3L2PA 2JA5G 3CC7A 3RLOA 3MXNB 1WCMG 4OONA 4DKAC 1YI2A 4KHPQ 1PH4A 2QEXA 2WB1G 4X65L 4BBSH 2RCNA 5IP7H 4OO1I 1EWIA 1VQDA 1VQOA 1KQSA 3KYHC 4NB3A 2R6GA 2F3IA 4DV0Q 5M3MG 1AH9A 1X3GA 2K75A 2IX0A 3GD7A 1S72A 1XNQL 3STBD 4LF9Q 3T1YL 1YZ6A 3CCLA 2WFWA 2UUAL 1C9OA 2A19A 3HKZE 5HGQA 4DV3Q 1I6HH 2I5MX 1L2FA 2JA7G 4BBRG 2JA8H 4YCWA 4A3BH 3I7FA 2VW9A 3F2DA 1N32Q 1X55A 4OWWB 4A3FH 4AYBE 5GQOA 3CCEA 2EQSA 3CAMA 3UDGA 4GKKL 1O7IA 3BJUA 1TWFH 1QUQB 5IYDG 2JA6G 1OXTA 3S2HH 4QGUA 3U58A 3NELA 2YTXA 4IPDA 3U4VA 4DUZQ 2UXDQ 1VQEA 3CCUA 4A3GH 4GNXA 3GTJH 2HT1A 2RHSB 4LF8L 1S3OA 4DV6L 1KIXA 4DR3L 4QQBX 4GLAC 2OQ0A 2VY3A 1HZBA 3T1YQ 5IP9H 1CKOA 2R7ZH 2FXQA 4DV5Q 1CSPA 3KLWA 5LMNL 2RF4A 3TS2A 2VQEQ 3A0JA 3HOYG 3HOXG 1I3QH 1V43A 5FLMH 1Q46A 1XMOQ 1QVGA 2E5LL 2NVXH 1N33Q 1Q86C 4GS3A 2AHOB 1V9PA 3ERSX 1BBWA 2I5HA 2KCTA 2ZTCA 3PUWA 1NMFA 1HNWQ 1UWVA 4OWXB 4JI8L 3HFZB 2KENA 2N78A 3PO2H 3S1NH 2KBNA 2WAQG 3M4OH 4YWMA 4XTCS 3HKSA 4DR5L 3TS0A 4JI7Q 1L0WA 1K9MC 3H0GG 4L5TA 3GTMH 3L0OA 1CUKA 3WWVA 1GKHA 1YHBA 4JG2A 5LMNQ 1YITA 3K0XA 3S15H 4JI2Q 3KDFA 5IWAQ 4LWCA 4P75A 1HZCA 1MJCA 1WYDA 4B3RQ 2ZM6Q 4DV7L 5JJLA 1YEZA 2QA4A 1VQPA 2Z0SA 4NXMQ 3ULLA 1VQ6A 4C2MH 2IHFA 4ME3A 2QGQA 3RLNA 1R9TH 1M90C 4A3JH 5FJ8H 1EOVA 2JK8A 4X64L 3F2CA 2ZJQA 4A3CH 1LUZA 4A3IG 2F4VQ 2PNHA 1Q8KA 4PMWA 1I94Q 4JI0L 3RR5A 2A1AA 3HOVG 5LMNW 4Y7NH 3PV0A 1KXLA 3HOVH 4DUYL 3S1RH 3UDFA 4HIKA 3CCMA 2CWAA 3PUZA 3EIVA 4JBKA 5C3EH 4BXXG 4OWTB 4A3IH 1VQKA 1N32L 4DUZL 3FKIG 3DM3A 4HIMA 3I4MG 3PO3G 4EQ5A 3BZCA 3OTOQ 4A3MG 4XIGS 4LF6Q 4DV6Q 2CKZB 2Q2TA 3I4OA 4QL5A 5C4JH 2KHIA 2XGTA 4OX9Q 1PVOA 1HZAA 2ZTEA 3GTLH 2UXDL 1H95A 2PQAB 1HZ9A 1VQ9A 1E1TA 1L1OC 4YWLA 1VQLA 2EXDA 4LF5L 2E2HH 4NPSA 5GAEC 1U5KA 4GNXC 1LYLA 5IYBH 4AQYQ 2YTVA 3T1HL 1XMQQ 2NVQH 1W3SA 4EX5A 2VQEL 1MKHA 1QUQA 1HR0L 1VQ8A 5H1SE 4KLKA 3U4ZA 4A3MH 4DK3C 1BBUA 2CCZA 1ASZA 3PO3H 4DR2Q 3FKIH
chains in the Genus database with same CATH superfamily
1IYJB 3SE0A 3K5NA 1IBLQ 4RH6A 4B3SL 2SEBD 2M9VA 5IE8A 4LF9L 1A63A 3VYTA 2BA0A 2F0JA 1PLFA 3K8AA 3B6YA 4R4TA 3J81i 2ENBA 1W6KA 2D0OA 5I6WA 4IOAA 2PW7A 1GO3E 4JI5L 1HUNA 2RQXA 5IYCG 1X56A 4A3GG 1A6XA 1R4QB 3OIQA 1X54A 4LFBL 2R61A 2CW0D 2JQOA 2NN6I 2Y0SE 3AYHB 1KDAA 3K6OA 3NENA 3OHXC 1TQOA 3TDQA 4DFAA 2HIVA 1HQMC 4IOCA 1HA5A 3H0GH 3ITPA 3J7ZC 4JI6Q 2ALYB 1JMCA 5G3LF 3FRPB 3QG1A 4XT1B 3ICEA 2B63H 1X6OA 2FMMA 1DM0B 2RHQB 3T13A 3BG3A 3BU2A 3J80i 4K8JA 4X62Q 5M5XB 4Y52H 2HDLA 2LSSA 1WOCA 5IP9G 4XXEA 4HEDA 2F0SA 2M00A 4POGA 1B7YB 1JOKA 1RL2A 4LUZA 2UXBQ 1JWUD 4DR7L 4GKKQ 3AFPA 1QB5D 1TWHH 1S4ZA 1C8CA 1K0RA 1LTBD 1CKNA 1RHPA 1VDZA 4F8MA 4DNIA 2HCCA 5FO9B 1P16A 3CW2C 1A62A 2VS1A 2WB1B 4LF7Q 2Z1CA 3L3OC 3X3MA 3CF5A 4KHPL 4QCLA 4KD4A 3S2DB 5ISRA 5CYUA 1GM5A 3NQTA 1MBYA 3S1MB 1UNSA 1PV4A 4A3EB 2PMZE 1K8AC 1XPUA 4IUTA 2KQ3A 1HNZL 1DXMA 2L4NA 3S1QH 2JA6B 1BR9A 3I73A 2VUMG 4DV3L 3K80C 3IAYA 4A3DG 3KF6B 4CJ0B 3OYYA 3UDIA 3K58A 4YCUA 4EVOA 3HOWG 1IHZA 1SRUA 5I2XA 1EYDA 4NW2A 2KCMA 2EVBA 3RNUA 1E24A 2ID0A 5EPJA 4B08A 2JA7B 4BBSB 3Q23A 4TQUS 5EAYA 3MHBA 1WTPA 3Q6SA 2F0TA 3HGBA 1IBMQ 3E0EA 1W2BA 4UP9A 1IW7D 4JW0A 2EPBA 3CCQA 3KFUA 1EEID 4DUYQ 3NTIA 1ET9A 3T51B 4EGVA 1BO0A 4LF4Q 4KKUA 3S14H 4QJFA 3IFDA 3FHWA 4LFCL 4KK7A 1U4MA 1K8GA 3RZDB 5D3IB 3A74A 4L5RC 1SYCA 4C3IH 4IFDH 1VCIA 2VB3X 1WFQA 4R1JA 4L6TB 4B3RL 4CJ2C 1VQAA 1SROA 2E2IB 3NBHA 4LK1C 5EBCA 2J0TD 3M9BA 2EXZA 3G6EA 1EQVA 3S1QB 4KHZA 1BCPC 1IZ6A 1HUMA 1TWAH 4MTKA 2LY7A 1PFSA 4N9TA 1Y14B 4QUFA 2K5VA 4JI0Q 1XWEA 5C3EB 1Q1BA 1B70B 4DV4Q 3MAQA 1EU3A 4ILWA 2NVXB 4MN3A 2NBFA 3HRZC 4ZK9B 2IJ0A 3GO5A 1XTDA 1F2LA 4RCNA 4GOPB 2YU9H 4GOPC 4A75A 2JEBI 1PYSB 3NWTA 1N34L 4JI4L 3Q0AA 2F0KA 4L5SA 1S5DD 3GQBA 3HKZB 1K3BC 1LV9A 1SBBB 1G8ZD 4IQZA 2GVAA 3F2UA 3ULJA 1F77A 4H02A 2DNEA 1E2WA 1GVPA 2WAQE 4HSPA 2K6AA 2FMCA 1PYWD 3ERQA 2ZXOA 1L0XB 1X9NA 1STBA 4O0AA 2QCPX 1V1OA 1UE7A 1RIPA 1I5FA 4OO1H 2K05A 1WTOA 3A8JE 4K0KQ 2F0DA 2A5HA 2RDHA 3KBGA 3H3VI 3V2TA 4JI2L 2E76C 1TS5A 1TWGB 3R2IA 1EZ8A 4FO2A 2HHHQ 2UUAQ 4B3MQ 5D3DA 2Z6KA 5NUCA 3TMEA 2N3SA 1FGBD 3MA2B 3A7LA 4EQNA 1LLRD 2KEEA 4UPAA 5GROA 2YTYA 2BH2A 2OTJA 1M1KC 1HNZQ 1FNVA 2X6GA 1OXVA 1ILPA 3E5SA 2D5DA 4H44C 4IPGA 4A3KG 1KD1C 3PIP3 2X6LA 1BDOA 1JCKB 4F87A 1SYFA 4OIJA 3D3RA 1U4LA 3AMUA 1OXSC 2VQFQ 1AZPA 1KC8C 2A6HD 2CVRA 1PH6A 2ZJPA 3M4PA 4GNXB 1Y1VH 3I4NB 5CV6A 3A56A 3K81C 2DUDA 5KNBA 4EQPA 1SMXA 3OSOA 2NZHA 3E0JA 4FDBA 2EE1A 5K36G 5IT9L 3H15A 2F0EA 1I4HA 2CH4W 3D31A 3LX0A 3L9AX 4RGNA 3MEHA 2ZM6L 4JI6L 4A3EH 1JE5A 4PV1C 5C0XJ 1UUPA 5EQ0A 1SNMA 1FR3A 4ME5A 3I3CA 1SE2A 4JYAQ 3A8KE 3HOXH 4PMCA 4DXFA 5CV7A 5C3WA 3BZKA 2AKWB 2GN5A 4HIOA 3RMHA 1HPCA 2KUMA 4CKEA 4L5QA 1WD1A 4K6LA 2C35B 1RODA 1CQVA 1LTTD 1GOZA 1Z9FA 4GLVB 1NTGA 5EBDA 4DR1Q 4P74A 3VR2A 2XWBB 5IYDH 4AYBG 3NQIA 4NXNQ 1CFMA 3M4QA 1PH8A 3HOYB 2JA9A 1YBYA 3IRBA 2I0QA 4B3TL 1K73C 1JR0D 2LXJA 3TSSA 5T1GA 1IW7C 1SE4A 1OXXK 2E2JH 1IBML 5IT9E 3EA6A 2EYOA 5CBEE 4KHPQ 5DM73 1PH4A 5FO8B 4X65L 2RCNA 2I07B 1STEA 4OO1I 1VQOA 1KQSA 1GUGA 2F3IA 4DV0Q 5M3MG 3AB9A 1S72A 2WFWA 5HGQA 4DV3Q 4WFN3 1GHKA 1L2FA 3J80E 2JA8H 4YCWA 3TP6A 1CI3M 3DEOA 4A3FH 1PZJD 4XDXA 2EQSA 3CAMA 3URYA 2JA6G 1LO5D 1PRTB 2M2LA 2Q8TA 3HOXB 4QGUA 3OWEB 4IZ8A 1EIHA 3CCUA 1SYEA 2HT1A 3MXUA 4DV6L 2AQ1B 4UAIA 1CKOA 4DV5Q 2F0OA 3KLWA 4OHJA 3A0JA 3D6CA 1GHJA 3D4DA 1V43A 1AZQA 2E5LL 4DAPA 4IURA 4GS3A 2Z9HA 3BDLA 1B53A 2KCTA 3TBIB 1NMFA 1HNWQ 3SXHA 2JN4A 1B9NA 3PO2H 5CR3A 2WAQG 2A6EC 3HKSA 2Z4IA 4JI7Q 4HR7B 2Z8LA 2D2CC 3LWUA 1L0WA 1K9MC 4L5TA 1CUKA 1GKHA 3O13A 3K0XA 4JI2Q 1RTNA 3TP5A 2NVTB 1ESFA 4B3RQ 1Y8OB 3OMGA 4DV7L 1YEZA 1VQPA 2IHFA 3VR4A 4ZLTF 2F0PA 1M90C 3JAML 4IUQA 2LKVA 5FJ8H 1QNKA 4X64L 4A3JH 4TKOB 2KCCA 2HUGA 2QILA 1Q8KA 5JVH3 1YNJD 4JI0L 3NTKA 4HAEA 5A2QE 3A7AB 4Y7NH 2PZTA 3S1RH 4HIKA 4G4KA 1HTLD 3EIVA 4ZAIA 3DM3A 3I4MG 3PO3G 3M7GA 2CKZB 4XT3B 1PRTF 3GTLH 1HZ9A 1E1TA 2O4XA 2EXDA 5DNFA 3AU7A 1WTQA 4LF5L 1A2UA 2E2HH 1KLGD 3C1FA 4A3MB 1U5KA 2K32A 3VA5A 2NVQH 2O5JC 4ZQ3A 5CMDA 1HR0L 3U4ZA 3M4YA 3CRLC 2UUBL 3RZOH 4KI0A 1K8OA 3PF5A 1EY8A 4AIMA 5FOBB 1D5ZC 4FXKC 4F88A 3VR5A 1JE4A 4ODGA 3CQZH 3CP0A 1SNQA 1ILQA 4RGOS 2Z6KC 1PH9A 2ZJRA 1DOLA 1K28A 3HOUG 2KECA 5BR8Q 5KIXA 1JWMD 3J7A5 2NN6G 4MZ9A 2MHVA 4RG1A 2NZOA 2OQKA 3GTKH 2B2YA 3J80c 2MGSA 1H9SB 3K7UC 1KRSA 2HHHL 4B3ML 2EZVA 4BY1B 1Q1EA 2H4OA 2B8GA 4JI1Q 1BF4A 5CGKA 4A93H 1O78A 2EJMA 2XSCA 1PHJA 2R92G 1Q81C 5KYIA 5GAGC 5DAUA 4X3SA 2Q2UA 2F3VA 2Y0SG 2ES2A 3OOCA 2N49A 5GAHC 2XRQD 2L0CA 2WB1E 5IT9c 1VQ5A 4UY8C 1HQRD 3PQIA 3NE5B 4HJ8A 2ZTDA 1F9SA 2QEJC 2V4DA 3VYUA 1H9JA 2K5DA 5I9PA 1PRTD 5D14A 1VQGA 4S3SA 4C3JG 3JC66 4DR1L 3T1HQ 2EJFC 5C44G 4KY6A 3PSIA 1SNCA 1BCPD 3CU7A 4X64Q 5EKLA 2V1CC 4K8IA 5M3MB 3HOZH 1XMOL 3A5ZB 1EIYB 4MTNA 2R93G 3OIPA 2OTLA 1HH2P 2JE6I 4P73A 1HNWL 3HKZG 3R93A 3AEVA 4JI3Q 4U673 4IJHA 3OTOL 4K5XA 1RJTA 2O2LD 1SE3A 3KJPA 3S17H 1VQBA 1U4PA 2GVBA 4UHVA 5CC4A 5KGUA 2EY2A 4A3EG 2ATWA 2D9UA 2JA5H 1EFWA 3MC0B 4DXGA 4AQYL 5M5WB 1BCPB 2P5ZX 3H3VH 3F1ZA 5JOBA 3C2PA 3WDNA 5C4HA 2NVYH 5KNDA 2D0PA 4KN7C 3SK4A 3U50C 4NXNL 5CV4A 3TRZA 4WJ4A 4X62L 1AW7A 4HCEA 3PGZA 2F0IA 1STNA 2RDGA 2F4VL 1QG7A 4JCVE 2JEAI 2OF1A 3NPPA 5IODA 1BKBA 2CH4A 5FK9C 1EIFA 4CKCA 1PH5A 4R4IA 2JA8B 4CDDC 1F9RA 1A8VA 1KLUD 4A3KH 1ENFA 2HQEA 5EPLA 1XXGA 2E74C 3Q8DA 4IPHA 4MNOA 1EY5A 3D8GA 5T1IA 1SLJA 4JI7L 1SXTA 2IT1A 2DY7A 2F0QA 1LTLA 3V96A 1J5EQ 1EY9A 1XNRQ 1V1PB 4BA1I 4A76A 4LUOA 2C5CA 1OXUA 3A55A 3CQZB 2E2JB 1I4PA 4JI3L 4BA2I 3FDTA 1D1KA 2PYKA 5FKAC 3OW2A 1VQFA 3HS0C 1TU2B 3NUCA 4A3KB 1XJVA 4JV5Q 1YHAA 2QW7A 2WV6D 1PFBA 1PTOD 1NNXA 3K5LA 2L9HA 1BXTA 3T16A 3EBEA 1FYCA 4V190 1N36Q 3I4MB 2F0LA 1WJJA 3BVGA 1VS0A 2NB0A 1KHIA 1I6VC 3TQYA 2EY5A 4A93G 1GUSA 3NK9A 4CBVA 2K33A 3DXJC 3FPPA 4NDXA 4U68A 1ICWA 1IBKQ 1XPOA 4HSVA 4FXGC 3K7AH 1HR0Q 1D1IA 1Z7TA 4Y7NB 3H0GB 3M3YH 2BCOA 1AE2A 1QWYA 2LMCB 2K5NA 2SNSA 1MJEA 1SNOA 4IO9A 1STHA 3SGIA 1SNPA 2PO4A 3TZDA 3CPWA 2L55A 4DR4Q 2AWNA 4RGMA 1BQQT 1A2TA 3Q22A 3HOUB 1SR3A 1H9SA 4J8QA 1U9RA 2R7ZB 2CFMA 1XNRL 4KJOA 4R8NA 1WTRA 5TSSA 2KOLA 4DA2A 3I8ZA 4BS9A 2F03A 5LHY1 1MD2D 1W6JA 5J3BA 4YY3Q 4J1MA 3RZOB 5DEHA 1PA6A 2R3ZA 5BN3A 2A8VA 4JBWA 4DV2Q 4JI1L 4O42A 5IGEA 4AH6A 5FLXE 1DZ1A 2PW5A 3OW7A 1OO9B 1N36L 4WJ3M 5C3EG 2G5DA 5JJKA 1QE6A 2VL6A 1SE8A 1D8LA 3ZYYX 3RLFA 4MIUA 1FL0A 4GN3B 5DLQE 3CCSA 1G6PA 3HOYH 2RCFA 3DLLA 3PIO3 1N8RC 4DPGA 1I94L 5C0XI 1L1OA 4A3JG 3PMFA 3E3XA 2F0MA 1SJHD 2K50A 4M1UB 4A93B 1O7ZA 4J15A 3J81j 2B3GA 4A3LG 1YVCA 2Z6BA 3QB3A 1A3TA 2RA4A 1T5EA 2R7DA 1TWHB 1FNWA 2K1BA 5C4JB 5C6AA 1YJ9A 2R7FA 4IN3A 3QIAA 3DM1A 4G7HC 1JJGA 3HG9A 3D6WA 5FLXL 2MFIA 2K04A 4YCVA 1HCZA 3EJIA 4BBSG 3BZDB 3UI2A 4K0KL 1LT6D 2F52A 3L7ZC 1EQRA 1WCMH 2B2UA 4DAMA 1EU4A 4XQQA 1B8AA 2R93H 1OTCA 3KDFB 5E4XA 4C3IB 4YY3L 2BA1A 2IPKD 2EYHA 3J81c 1K83H 1EUJA 1ASYA 3HOZG 4PZ6A 1B3AA 4HCSA 2AWOA 2JA6H 2WINB 5C44H 2UUCL 2A69D 3T53B 5G3LD 4A3FG 3RN5A 1VQ7A 2EIFA 2UU9L 1BCPF 5C3XA 1ONLA 4KKSA 3CC7A 1CQFA 1EIGA 4I7AA 3RLOA 3MXNB 1EY0A 2QEXA 4FF1A 4BBSH 4HTHA 4E6IA 1SJED 1LTID 1PZID 5KRUA 3JAME 1AH9A 3A8IE 3H09A 3STBD 3T1YL 3CCLA 1STGA 4CKBA 1Y1VB 4DF7A 1HXYD 1I50B 4LAAA 4QMGA 2VW9A 1N32Q 2XVSA 4AYBE 5JPMC 3CCEA 3UDGA 3BJUA 1TWFH 5IYDG 4CHTB 1Y8PB 1SYDA 3S2HH 3U58A 3NELA 4IPDA 4DUZQ 3U4VA 1VQEA 2XNAC 1DCZA 3GTJH 1E2VA 1XYIA 1TS3A 4DR3L 4GLAC 2VY3A 5IP9H 1PTOC 3J81E 1KNAA 1STYA 2VQEQ 3HOYG 3DWQA 2NYZD 4QF4A 1I3QH 1Q46A 4OIKA 2AHOB 4ID6A 1JB3A 1V9PA 1BBWA 4IUUA 3T4AC 2ZTCA 5E4WC 3MFYA 2EYPA 4OWXB 3HFZB 3MTSA 1IKMA 2KBNA 1XX8A 3M4OH 2L12A 4XTCS 4DR5L 1ZEQX 2JXMB 3H0GG 1C4QA 2FJ2A 3GV6A 3L0OA 3GTMH 5LMNQ 1YITA 3S15H 1HZCA 2ZM6Q 3HZXA 4C1NI 1MSHA 2Z0SA 4NXMQ 3ULLA 4ME3A 1Y8NB 1B50A 4N8FA 2K5WA 3F2CA 2JK8A 1D5MC 2N55A 4PNYA 3HOVB 4PMWA 1V1PA 1I94Q 1IYUA 2EYJA 4TSSA 1TS4A 3PV0A 1ESRA 2A68C 3UDFA 1NAPA 2RKSA 3MXNA 5C3EH 4X3TA 4OWTB 4A3IH 3FKIG 4EQ5A 3BZCA 3J80L 1ZYRD 1G2SA 2BDOA 2Z4HA 1HZAA 2ZTEA 2O5IC 1VQ9A 4YWLA 5JJZA 4NKLA 1YNJC 5GAEC 1XMQQ 5IYBH 3D4RA 4K14A 1JQYD 2RVLA 4KLKA 2RSNA 1RDPD 4A3MH 2UXBL 1TS2A 4KJNA 1PH3A 1LACA 3MVVA 3PCOB 1NY4A 1XNQQ 2QDLA 4LFBQ 3W5OA 5I4DA 1CKMA 1MIUA 5CORA 2AMCB 1X3FA 5LL6S 1LTAD 1UE1A 4PMBA 1EQTA 4DAYB 4LF7L 1YHQA 4KY5A 1FVIA 3KBXA 3H6MA 4R8IA 4LFCQ 1EEFD 3NWSA 3BVMA 5HGTA 1J5EL 4R4QA 1PH2A 1PFNA 3CMEA 1H9KA 1X32A 5M3FB 2YV5A 4LFAQ 3MWYW 4DV1Q 2BE5C 1QZHA 4FF4A 3TZUA 1A3UA 4ZYSA 1QZGA 4JV5L 1K3RA 4LUVA 3C46A 4EQOA 5JEAJ 1HR0W 1IXRA 5KEEA 5AJ3L 1IYVA 1YNNC 1XPRA 1CKNB 2R7ZG 3GTJB 3F2BA 2YYZA 5IGGA 2VB2X 5M5YH 1VQMA 1KL9A 2XTIA 1B44D 3W3AA 4L8JA 5IIFA 1E1OA 2B2WC 5KYLA 3DUZA 5CBAE 3UDXA 4HJ5A 1HFNA 2CQAA 5E7NA 2E5LQ 2DJGC 4DR3Q 1EZ6A 2DN8A 4BBRH 3PO2B 2PQEA 5C5MA 3KLSA 4X66Q 2RDFA 3WOFA 1Y1WB 1CA6A 3K57A 1N34Q 1U0LA 3J81L 1B3QA 3LWEA 3VA7A 1BBXC 2HQLA 4ABNA 1NBWA 1F2MA 1Q12A 5J39A 3KF8B 4P72A 1I4QA 3P20A 2MQHA 2SOBA 4B9WA 1SDFA 3S14B 5K36H 1XMQL 4BY1G 2Q2HA 3M7NA 1TY2A 1PZKD 1PTOF 4TVAB 5K5PA 1K83B 5EKIA 3P1HA 2UUCQ 4QY7A 1Y1VG 2HIXA 3KF8A 3P7JA 4RHSA 4BY7H 2UU9Q 1FNUA 3X3NA 1M4VA 1FGUA 2KCNA 2KJXA 1UAPA 3RN2A 1HHVA 1TVXA 2AUJD 1S5CD 2B2TC 2OT2A 1HRJA 1BVSA 2TSSA 5C4XH 2EYMA 1C0AA 1SMYC 1PMRA 2A6HC 4DR5Q 2R92H 4C56C 4A3IB 1O7LA 3EFXD 1D7QA 5COYA 1G91A 1K8MA 3SEBA 1D2BA 1KABA 3CCVA 2R92B 1WTWA 2IX3A 2EYLA 5JJIA 2BH8A 4ZUJA 2B39A 3N52A 2B2VA 3ND9A 1CZWA 1Z6HA 1Y1WG 1PH7A 1ML0D 3E9HA 3CMAA 2K52A 2KEDA 5ELBA 3GTGH 1ASZA 2HCIA 4OO1G 2UUBQ 2ICEC 3M85A 4R9WA 5C0XH 5LMUL 4GOPA 1N9WA 3K59A 3CD6A 2WKDA 4FYDA 1LT3D 1HTPA 4UP7A 5ELDA 1DOKA 4QIWE 1JJCB 3KOJA 3JAMc 2ZXRA 3PIOA 1E22A 3ULPA 1KDCA 1BOSA 4HJ9A 4A4IA 3I4NG 2AUKA 1R9TB 2HD3A 5IYBG 1PH1A 4N9PA 1CHQD 4DV4L 1JOOA 5A35A 5IY0A 2J7ZA 2NN6H 4X66L 1GUTA 5I9OA 3G4SA 2NTSA 1CSQA 1HNXL 4DV1L 2A73B 2OEOA 4FVMA 2K28A 1UEBA 1FJGL 1QVCA 2NUCA 2K01A 5JVG3 5I6YA 4RCOA 1RCVD 2F0UA 2JYOA 3RUZA 1SSOA 3SK6A 3IKJA 1QJOA 1NR4A 1YIJA 1IL2A 3AFQA 1PXUA 3PF4A 1UE5A 2WKCA 3S24A 1PTOH 1S40A 3R3OA 4IJLA 1X65A 4DK6C 3PUXA 1DYQA 2IY5B 2KHJA 1A0IA 4IPCA 2MO0A 4C2MB 3M3YB 4DNRB 1DGSA 2MJ8A 1JWSD 3BDCA 3CC2A 1L0YB 5E3FA 3QOJA 4WRDA 4C3IG 4IFDG 4BBRB 1LTRD 2AQ3B 4XQNA 1PYBA 3KK7A 4ZRZA 2PCFB 3H3VC 5ELNA 5HY6A 1EYCA 3S2DH 3KF6A 2WAQB 1JORA 3CRKC 1WTVA 1IKLA 2NVYB 4LW1A 4X3UA 3I56A 1F2YA 3AQQA 2F1MA 4DR6Q 4DV5L 4XYOA 1MGSA 3CC4A 1TXYA 3P75A 3HOWB 2K5QA 1K0SA 2B29A 1KAWA 4APVA 5FJ8G 4GLXA 2N8NA 2EJGC 4LNQA 5DM63 1SYBA 2LFNA 5ELOA 2BOSA 2FINB 3TP7A 4I65A 1CTMA 1RD9D 4PG3A 4K5VA 4F7XA 2F0VA 2I46A 2JA8G 1FD7D 1YNXA 2K4KA 2VUMH 3V05A 3QR8A 3MEFA 4M8AA 1JT8A 5M3MH 3HOZB 3I72A 3I91A 3EN2A 4B3TQ 4HIDA 3CCRA 5FLMG 4DAVA 5IGDA 1Q7YC 1IL8A 3NP8A 1WTHA 2K5HA 2QDBA 4JI5Q 4TRDA 3VYSA 2PI2A 1NJIC 4IFDI 2UXCL 4PZ8A 2K14A 1EWHA 3H91A 5IGCA 1KTKA 3LNNA 5M5YB 3R8BA 1WVLA 2XN9C 5EPKA 4WORA 1P8LA 3VR6A 4DAYA 1CZGA 1TWAB 2B2YC 5I2YA 1ICFB 3BYYB 2B63B 5GADC 4AYBB 1ET6A 1WCMG 4OONA 1BUVT 2G9DA 1EY7A 5ELFA 1VQDA 3KYHC 1SMYD 4NB3A 4G7OC 2R6GA 3EQLC 3NBIA 4LMQD 1LTSD 4A3BB 1X3GA 5C44B 2UUAL 1C9OA 1EY6A 1JOQA 1HFGA 2I5MX 1E2ZA 4BBRG 4A3BH 2SDFA 3CHBD 4OWWB 3J7YW 1CM9A 4A3GB 4ZUIA 1WD0A 1F2ZA 1EY4A 1O7IA 4GKKL 1KAAA 1OXTA 2YTXA 2UXDQ 4A3GH 1GUWA 4LF8L 1S3OA 1KIXA 2QKIC 2OQ0A 5FO7B 2R7ZH 2FXQA 3SDZA 1CA5A 1EFID 3HOXG 1LT5D 4BY7B 4K2KA 1QVGA 2NVXH 2EY1A 4O1NA 2TMPA 3SK5A 1LT4D 1VMPA 1UWVA 4JI8L 2KENA 3BVZA 1TKWB 1TIID 4YWMA 3EROA 5L37A 4JK1C 3R2TA 3DWPA 2Q8RE 2WACA 1YHBA 1PDQA 1GJXA 3K7AB 4P75A 1MJCA 1WYDA 1AFPA 4C1NK 3QJYA 1H9RA 5JJLA 1I4RA 4QUCA 1VQ6A 4C2MH 3K0YA 1DJRD 2A6ED 4RWSC 1EOVA 3SK8A 5M9OA 3VYRA 5ELEA 2PNHA 4JVZA 1V8QA 2A1AA 3HOVG 2LS01 3HOVH 2ICIA 3E6ZX 5IOCA 4Q5VA 4JBKA 1ENCA 1I4GA 2E75C 4KHVA 1N32L 4HIMA 1UEAB 1AN8A 4H0LC 2DJFC 3OTOQ 4A3MG 4LF6Q 1QOHA 4QB4A 4DV6Q 2Q2TA 1O7YA 3I4OA 4QL5A 2KHIA 2XGTA 3NTHA 3MZ5A 2OXPA 4H13C 3WOEA 1F9PA 2UXDL 1H95A 2PQAB 1VQLA 1M8AA 4GNXC 4ZCKA 1D5XC 2PZUA 2VQEL 1QUQA 5H1SE 1WCMB 4UDUC 2CCZA 4DR2Q 1STAA 2NVTH 1NE3A 1SAPA 2JJQA 2JP1A 3MXGA 3F8TA 2J4XA 1E0BA 2A74C 4DR6L 4NXML 4P71A 4CDCC 4R4CA 2RSOA 1LTGD 1SEBD 4FF2A 4JOIA 2NTTA 1B9MA 4QIWB 3TREA 2IX1A 2F0GA 3FKIB 3D0FA 1U4RA 1YJWA 5J22A 4POFA 4JI4Q 4RKBA 3RD4A 1WI5A 3NEMA 1WTXA 2NWGA 2MO1A 2WIIB 5AFWA 2BDNA 4YIJA 1VQ4A 5JEAG 1PRTC 1I50H 4RA8A 4JI8Q 1H9MA 4RKLA 4K6DA 1EYGA 2L15A 1MSGA 1T9HA 4GN4B 4PZ7A 3HP3A 4HJAA 2A69C 3GTPH 1KNEA 3KUPA 1MI2A 2JSOA 4Q0FA 3G48A 2L11A 5FLXc 4DU9A 1A3VA 2E2HB 4XYQA 1C7YA 5KNCA 4DR2L 2R93B 4A3BG 4R4OA 4IFDJ 4FNFA 5D65A 4A3DH 3S1NB 3I2ZA 2G9HD 1VQHA 4WJWA 2MP1A 1PFMA 4C3JB 3ONAB 5C4ZA 3STBC 4A3DB 4XQJA 1FJGQ 2ZT9C 1QILA 1EQQA 2ASBA 5CV5A 1E3PA 5EJWA 3CPFA 5J1ZA 4RGTA 5C5LA 2B2VC 4A3JB 4FXDA 4Z9CB 1SN8A 4KTAA 1ENAA 3A5UA 1TR5A 2EY6A 3K5OA 4YHHQ 3S2HB 2YU9B 1GUOA 4KY7A 1HJPA 3W1BA 3GTKB 4OXPA 2CW0C 1X3EA 2C9OA 1A15A 4C3JH 1SFOH 3C3LA 3FMCA 1AEXA 3DHQA 2E2DC 5JAVA 4CDFC 3HOWH 2B2TA 1V1QA 3S17B 1SFOB 4B3SQ 3GTOH 2A68D 2MUYA 5AJ3Q 4GZYC 2KHSA 3QWNA 2JA5B 4H7BA 2XRSD 3G6JB 5BR8L 5C4XB 4LF6L 2GA4B 4HMIA 3I70A 2WP8J 5HURA 4JBMA 2D62A 1KRTA 2B63G 2MNAA 3GTPB 3DMUA 2PNRC 3OPOA 3JAMi 2PI2E 2E2IH 1VQCA 3TN2A 1EOTA 2HDMA 2B8FA 2IL8A 4A3LH 4DN4M 4HN7A 4ZKCB 5M3FG 3GTGB 3W1GA 2IHEA 5BN5A 4RAUC 5IYCH 3TP8A 4OGQC 1J8IA 3HOUH 4ZKBB 4N8X1 2Q2IA 4LF8Q 1VQJA 1X3PA 2FFKB 3BDOA 3FEWX 3VDYA 4DK0A 4IUVA 1N33L 2CQOA 2LXKA 3G71A 1GD7A 1ZXTA 3U9SA 2F0WA 4NP5A 5ELCA 3IL8A 2OCEA 1ZKOA 4RHRA 3TEHB 4JC0A 3OWFA 1HNXQ 1NR2A 2FHTA 4X65Q 2B2WA 2I5LX 5M5WH 1Z47A 2VZAA 1VF7A 3EVQA 5CV9A 3BYTB 4DV0L 1VF5C 3ER0A 3DWAA 4I7ZC 4J6HA 4LFAL 3N6RA 1TWFB 3SHLA 3PIPA 1Q82C 1SNDA 1Q90A 3CCJA 1NMGA 1VQNA 1EL0A 1TY0A 4GKJL 3UE1A 3PUYA 3NXWA 2QF7A 3C1EA 3Q24A 4HJ7A 1AP0A 1LM0A 1JICA 3I4MH 3ND8A 1RTOA 1TWGH 3LGJA 2MPMA 3KJOA 1R4PB 3G7LA 5IGBA 3GTQH 4BWGB 4BXXH 3A54A 3CXCA 2IW3A 2X69A 1L1OB 1JB7A 2PQAA 1QVFA 4YWKA 1GXDC 2AQ2B 5F2DA 5M5XH 5C0XG 2H1EA 3S9WA 2DGYA 4FP5D 1TT2A 3OMCA 4RMFA 2OWOA 3S15B 2F0FA 4JYAL 4JOIC 4RFBA 1Y1WH 5EKKA 2F0NA 4UP8A 5M3FH 5IWAL 4OELB 5E1FA 2RBMA 4HMJA 2KVMA 1CK1A 3NBHB 1JJ2A 3I4NH 2PMZB 2XIWA 1RF2D 3MXPA 1CT1D 1G291 4KV6A 1J6QA 4OL7A 3GTMB 4PQXA 4ALPA 1DD2A 3U9OA 3PO2G 1CHPD 5C4XG 4LF4L 2CWPA 4KKTA 2K03A 3GDEA 2XWJB 4JBJA 4L63B 1HA6A 3PO3B 1IBLL 1YJNA 2L1BA 1E7ZA 4IALA 1O80A 1J9OA 2VNUD 1B2TA 1I4XA 3I55A 5JPNC 2PPBC 4A3CG 3GTLB 1II3A 3VR3A 1AE3A 4DR7Q 2EYFA 4C3HB 4KD3A 1B4OA 2VXWA 5LMUQ 3J7AF 4DNTB 5BN4A 4LF5Q 1UE6A 1TWCH 1QNUA 4OX9L 4DR4L 2JA7H 1PTOB 1VQIA 3RZDH 3FP9A 3MFGA 2VQFL 3ZJYC 1I6HB 4DV7Q 2UXCQ 4DK1A 1F9QA 3IFTA 3S16H 5EGTA 3H94A 1G51A 4IUPA 5IP7G 4CDEC 1SYGA 4LJZC 1T5XD 1Y69U 4C3HH 3QOLA 1IBKL 4DV2L 1BNZA 3M4OB 4O2DA 3S1MH 4BY7G 2E8GA 2F0HA 5CV8A 4YHHL 1EYAA 4GKJQ 2H5XA 4B9XA 4X6AH 4G57A 2NZ1D 3K5MA 1NSNS 3FPUB 3S16B 3E9IA 4BY1H 1XTCD 4P2CB 4GN5A 1LABA 3PUVA 4K5WA 4A3FB 2ZXPA 3UE0A 1Q8IA 3NSWA 3L2PA 2JA5G 1YI2A 1GUNA 3SR1A 2Y0SB 4DGZA 4DKAC 2WB1G 3GV3A 5IP7H 1EWIA 4FF3A 3HEJA 3I4LA 1QCBD 3D4WA 5JEAH 1Q3LA 2F4IA 3KLSX 2BE5D 2DNCA 2K75A 2L5TA 2IX0A 3GD7A 1XNQL 1I3QB 4LF9Q 1YZ6A 1I6HH 2A19A 3HKZE 2F3WA 2JA7G 4OEMB 3I7FA 3F2DA 1X55A 1YNND 2KA7A 4KMUC 5GQOA 3GTOB 4K2LA 4CJ1B 1QUQB 3W2DA 3SVMA 5A2QL 2EDGA 2NVQB 4GNXA 3I90A 2RHSB 2VUMB 4QQBX 2IWHA 1HZBA 4X3KA 3T1YQ 1X3QA 1DONA 1CSPA 2EOTA 5LMNL 1VMCA 2RF4A 3TS2A 4C3HG 1N33Q 5FLMH 1B1ZA 1XMOQ 1S5ED 1Q86C 3ERSX 1NUCA 1NCVA 4KN4C 1KDBA 2I5HA 1JC7A 4V0BA 3PUWA 4CGYB 2N78A 3S1NH 4NMZA 3TS0A 1EWCA 3WWVA 4JG2A 3KLRA 1S5FD 3KDFA 5IWAQ 3DEPA 4LWCA 2QA4A 1C48A 2K7VA 3BS1A 3NHHA 2B2UC 2QGQA 2PZWA 2CHBD 3RLNA 4G7ZC 1R9TH 1G6ZA 4A3CH 2ZJQA 4JPBW 3J7AV 1LUZA 4A3IG 2F4VQ 4MHEA 3RR5A 1G2TA 3FVQA 5LMNW 2SNMA 1KXLA 4DUYL 1DOMA 3CCMA 2CWAA 3PUZA 4BXXG 1TWCB 1VQKA 4DUZL 1RKNA 3S1RB 4XIGS 1MHWC 4IUNA 5LL6X 5C4JH 1PVOA 4OX9Q 3QO2A 1D6EC 1L1OC 3GTQB 4NPSA 1LYLA 2Q8IB 4AQYQ 2YTVA 3T1HL 1W3SA 2N88A 4EX5A 1MKHA 2DY8A 1VQ8A 3GP7A 3T56B 1ZYRC 3CKIB 1S5BD 4DK3C 1BBUA 5IGFA 3PO3H 4ULLA 3FKIH
chains in the Genus database with same CATH topology
1PH3A 2UUBL 3PCOB 1NY4A 1IYJB 4KI0A 3PF5A 1XNQQ 2NVTH 3RZOH 1NE3A 3W5OA 4AIMA 2JJQA 4LFBQ 1CKMA 1IBLQ 1MIUA 3F8TA 4B3SL 2AMCB 5IE8A 4LF9L 3CQZH 3CP0A 1A63A 4DR6L 1X3FA 2BA0A 3K8AA 3B6YA 4R4TA 2Z6KC 3J81i 4NXML 2D0OA 1UE1A 4P71A 4DAYB 2ZJRA 1PH9A 4IOAA 4LF7L 4R4CA 1YHQA 1GO3E 4JI5L 1FVIA 3HOUG 5BR8Q 5IYCG 1X56A 3J7A5 4A3GG 4LFCQ 2NN6G 4JOIA 4MZ9A 1X54A 4LFBL 2JQOA 2NN6I 4RG1A 3TREA 2Y0SE 3AYHB 2IX1A 2NZOA 2OQKA 1J5EL 3D0FA 1YJWA 4R4QA 1PH2A 3GTKH 3J80c 4POFA 3NENA 3CMEA 4JI4Q 3K7UC 2HHHL 1KRSA 4B3ML 2HIVA 1Q1EA 4IOCA 1WI5A 2YV5A 3NEMA 4LFAQ 3H0GH 4JI1Q 3J7ZC 4JI6Q 2ALYB 2MO1A 1JMCA 4A93H 4DV1Q 1PHJA 1VQ4A 2R92G 3ICEA 1QZHA 1Q81C 1X6OA 2B63H 5GAGC 5JEAG 1I50H 2Q2UA 2Y0SG 2RHQB 1QZGA 4JI8Q 2ES2A 4JV5L 1K3RA 4LUVA 3BU2A 3J80i 2N49A 5JEAJ 1HR0W 1IXRA 4X62Q 1EYGA 2L15A 5GAHC 5AJ3L 4Y52H 1XPRA 2WB1E 5IT9c 1VQ5A 1CKNB 1T9HA 4UY8C 4GN4B 2LSSA 1WOCA 4PZ7A 4HJ8A 2R7ZG 5IP9G 2ZTDA 3F2BA 4HJAA 4POGA 2YYZA 3GTPH 1B7YB 1RL2A 5M5YH 1VQMA 1KL9A 3G48A 2XTIA 4LUZA 2UXBQ 1VQGA 3T1HQ 5FLXc 3JC66 4DR1L 4DR7L 4GKKQ 3AFPA 1TWHH 5C44G 3PSIA 1C7YA 1E1OA 1K0RA 3UDXA 4X64Q 4HJ5A 2V1CC 4DR2L 3HOZH 1CKNA 5E7NA 1XMOL 2E5LQ 3A5ZB 4DNIA 4DR3Q 1EIYB 4R4OA 4A3BG 4MTNA 4IFDJ 4BBRH 2R93G 2OTLA 1HH2P 1P16A 2JE6I 4A3DH 3CW2C 3I2ZA 1A62A 1VQHA 2VS1A 4LF7Q 4KHPL 4P73A 4X66Q 3CF5A 1HNWL 3HKZG 1N34Q 3AEVA 4JI3Q 1U0LA 4IJHA 3STBC 3OTOL 1GM5A 2HQLA 1FJGQ 3KJPA 1EQQA 2ASBA 3S17H 1PV4A 1XPUA 2PMZE 1VQBA 1K8AC 1E3PA 2GVBA 1NBWA 3CPFA 1HNZL 1Q12A 4A3EG 3S1QH 2ATWA 2VUMG 3KF8B 2JA5H 4DV3L 3K80C 4P72A 1EFWA 4A3DG 3KF6B 3OYYA 4AQYL 2MQHA 3UDIA 1SN8A 4YCUA 3A5UA 3H3VH 4YHHQ 3F1ZA 3HOWG 1SRUA 1XMQL 4BY1G 2Q2HA 1HJPA 3W1BA 2NVYH 3M7NA 2KCMA 4OXPA 1X3EA 4TVAB 3RNUA 1E24A 2D0PA 2ID0A 3U50C 4NXNL 4C3JH 4QY7A 2UUCQ 1SFOH 1Y1VG 2HIXA 3TRZA 4X62L 4WJ4A 3HOWH 4TQUS 5EAYA 3PGZA 4BY7H 1V1QA 2UU9Q 1FGUA 2F4VL 1IBMQ 3E0EA 4JCVE 4UP9A 1W2BA 4B3SQ 3CCQA 2JEAI 3GTOH 3KFUA 5AJ3Q 1BKBA 3RN2A 4DUYQ 5BR8L 4LF6L 1EIFA 1PH5A 4R4IA 4LF4Q 2WP8J 3S14H 1A8VA 4QJFA 2D62A 1KRTA 4A3KH 4JBMA 3FHWA 4LFCL 1BVSA 3Q8DA 5C4XH 1K8GA 2B63G 4IPHA 4MNOA 2MNAA 2R92H 1C0AA 1SLJA 4DR5Q 4JI7L 2IT1A 3A74A 4L5RC 4C3IH 3JAMi 2PI2E 1VCIA 2E2IH 1D7QA 1VQCA 1WFQA 1LTLA 4R1JA 1J5EQ 3CCVA 4B3RL 4A3LH 5JJIA 2BH8A 1VQAA 1XNRQ 1SROA 5M3FG 4BA1I 3M9BA 4A76A 4LUOA 3W1GA 2IHEA 3G6EA 1Y1WG 1OXUA 4KHZA 1IZ6A 1TWAH 1PH7A 4JI3L 4BA2I 5IYCH 3E9HA 3CMAA 2K52A 1PFSA 1XJVA 3OW2A 1VQFA 3GTGH 2Q2IA 4LF8Q 1Y14B 3HOUH 4OO1G 2UUBQ 3M85A 4JV5Q 1VQJA 1YHAA 5LMUL 2K5VA 4GOPA 3VDYA 4JI0Q 1N9WA 3CD6A 1Q1BA 1N33L 1B70B 4DV4Q 2CQOA 2LXKA 3G71A 3EBEA 1GD7A 4UP7A 1N36Q 4QIWE 2OCEA 1JJCB 1WJJA 3KOJA 3TEHB 3JAMc 4JC0A 1HNXQ 1VS0A 1KHIA 3TQYA 3GO5A 2I5LX 4X65Q 3PIOA 1E22A 1XTDA 1Z47A 2VZAA 5M5WH 3ULPA 4A93G 4HJ9A 4GOPB 4A4IA 3I4NG 2YU9H 4GOPC 4DV0L 4A75A 2UXBL 5IYBG 2JEBI 3ER0A 1PH1A 4LFAL 3PIPA 1PYSB 1Q82C 3CCJA 4DV4L 1NMGA 1N34L 4JI4L 1IBKQ 1XPOA 5IY0A 1VQNA 4GKJL 4L5SA 3K7AH 3UE1A 4X66L 1HR0Q 3PUYA 3G4SA 1CSQA 2GVAA 3ULJA 1HNXL 4DV1L 4HJ7A 1LM0A 4H02A 3I4MH 1TWGH 3M3YH 3LGJA 1UEBA 1FJGL 1GVPA 2WAQE 1QVCA 3KJOA 3GTQH 4BXXH 1AE2A 2K5NA 3CXCA 1MJEA 4IO9A 1L1OB 3SGIA 1JB7A 2PQAA 1QVFA 4YWKA 3CPWA 4DR4Q 2AWNA 1X9NA 5M5XH 1YIJA 1IL2A 3AFQA 4O0AA 1SR3A 5C0XG 1UE7A 1RIPA 2DGYA 3PF4A 1I5FA 1UE5A 3S24A 2CFMA 1XNRL 1S40A 4RMFA 4K0KQ 2OWOA 4JYAL 4IJLA 4JOIC 1X65A 4DK6C 3PUXA 1Y1WH 4UP8A 5M3FH 3H3VI 2IY5B 4JI2L 2KHJA 1A0IA 4IPCA 2MO0A 5J3BA 4YY3Q 5IWAL 1PA6A 2UUAQ 2HHHQ 4B3MQ 1DGSA 2A8VA 3NBHB 4JBWA 2Z6KA 1JJ2A 4DV2Q 2N3SA 3I4NH 3CC2A 4JI1L 4UPAA 5GROA 2YTYA 1G291 2BH2A 4IFDG 1M1KC 2OTJA 1J6QA 4ALPA 1HNZQ 3PO2G 4AH6A 1PYBA 5C4XG 4LF4L 2CWPA 4WJ3M 3GDEA 1OXVA 1N36L 5C3EG 5ELNA 5HY6A 5JJKA 4IPGA 4A3KG 4JBJA 3S2DH 1KD1C 3KF6A 2VL6A 1SE8A 1D8LA 1IBLL 3RLFA 1YJNA 1E7ZA 1FL0A 4LW1A 3I56A 4GN3B 5DLQE 3AQQA 3CCSA 1G6PA 3HOYH 4DV5L 4DR6Q 2VNUD 3DLLA 3I55A 3CC4A 1TXYA 1N8RC 4DPGA 1OXSC 5C0XI 2VQFQ 1I94L 2B29A 1KC8C 1KAWA 4APVA 1L1OA 5FJ8G 4A3JG 4A3CG 1PH6A 2ZJPA 4GLXA 3M4PA 4GNXB 1Y1VH 1AE3A 4DR7Q 2N8NA 3K81C 2DUDA 2K50A 4LNQA 1SMXA 4J15A 2NZHA 5LMUQ 5ELOA 4FDBA 3J81j 2B3GA 5K36G 3H15A 1UE6A 1TWCH 1YVCA 4PG3A 4LF5Q 4A3LG 4OX9L 2JA8G 4DR4L 2JA7H 1VQIA 1YNXA 3RZDH 3D31A 2K4KA 3FP9A 2R7DA 2VQFL 2VUMH 3ZJYC 4JI6L 2ZM6L 4DV7Q 1YJ9A 2R7FA 4A3EH 2UXCQ 3MEFA 1JE5A 3S16H 1JT8A 5M3MH 1G51A 5C0XJ 1JJGA 3EN2A 2MFIA 4YCVA 5IP7G 4BBSG 4B3TQ 4HIDA 4K0KL 3CCRA 5FLMG 2F52A 3L7ZC 1EQRA 4JYAQ 3HOXH 1WCMH 4C3HH 1Q7YC 4DAMA 3BZKA 1IBKL 2K5HA 4DV2L 2AKWB 2GN5A 4HIOA 1B8AA 2R93H 1OTCA 3KDFB 4L5QA 4O2DA 4YY3L 2C35B 2BA1A 2E8GA 4YHHL 3J81c 4JI5Q 1K83H 3S1MH 1Z9FA 4BY7G 2PI2A 4GLVB 1EUJA 1NJIC 1ASYA 3HOZG 4PZ6A 1NTGA 4PZ8A 4IFDI 4GKJQ 2H5XA 2K14A 2UXCL 4DR1Q 4P74A 4X6AH 2AWOA 2JA6H 5IYDH 4AYBG 5C44H 2UUCL 4NXNQ 3M4QA 1PH8A 2JA9A 1YBYA 3E9IA 3IRBA 2I0QA 4A3FG 3RN5A 1K73C 4B3TL 1P8LA 4GN5A 1VQ7A 4BY1H 2LXJA 2EIFA 2UU9L 1OXXK 3PUVA 2E2JH 1IBML 3UE0A 5GADC 3L2PA 2JA5G 3CC7A 3RLOA 3MXNB 1WCMG 4OONA 4DKAC 1YI2A 4KHPQ 1PH4A 2QEXA 2WB1G 4X65L 4BBSH 2RCNA 5IP7H 4OO1I 1EWIA 1VQDA 1VQOA 1KQSA 3KYHC 4NB3A 2R6GA 2F3IA 4DV0Q 5M3MG 1AH9A 1X3GA 2K75A 2IX0A 3GD7A 1S72A 1XNQL 3STBD 4LF9Q 3T1YL 1YZ6A 3CCLA 2WFWA 2UUAL 1C9OA 2A19A 3HKZE 5HGQA 4DV3Q 1I6HH 2I5MX 1L2FA 2JA7G 4BBRG 2JA8H 4YCWA 4A3BH 3I7FA 2VW9A 3F2DA 1N32Q 1X55A 4OWWB 4A3FH 4AYBE 5GQOA 3CCEA 2EQSA 3CAMA 3UDGA 4GKKL 1O7IA 3BJUA 1TWFH 1QUQB 5IYDG 2JA6G 1OXTA 3S2HH 4QGUA 3U58A 3NELA 2YTXA 4IPDA 3U4VA 4DUZQ 2UXDQ 1VQEA 3CCUA 4A3GH 4GNXA 3GTJH 2HT1A 2RHSB 4LF8L 1S3OA 4DV6L 1KIXA 4DR3L 4QQBX 4GLAC 2OQ0A 2VY3A 1HZBA 3T1YQ 5IP9H 1CKOA 2R7ZH 2FXQA 4DV5Q 1CSPA 3KLWA 5LMNL 2RF4A 3TS2A 2VQEQ 3A0JA 3HOYG 3HOXG 1I3QH 1V43A 5FLMH 1Q46A 1XMOQ 1QVGA 2E5LL 2NVXH 1N33Q 1Q86C 4GS3A 2AHOB 1V9PA 3ERSX 1BBWA 2I5HA 2KCTA 2ZTCA 3PUWA 1NMFA 1HNWQ 1UWVA 4OWXB 4JI8L 3HFZB 2KENA 2N78A 3PO2H 3S1NH 2KBNA 2WAQG 3M4OH 4YWMA 4XTCS 3HKSA 4DR5L 3TS0A 4JI7Q 1L0WA 1K9MC 3H0GG 4L5TA 3GTMH 3L0OA 1CUKA 3WWVA 1GKHA 1YHBA 4JG2A 5LMNQ 1YITA 3K0XA 3S15H 4JI2Q 3KDFA 5IWAQ 4LWCA 4P75A 1HZCA 1MJCA 1WYDA 4B3RQ 2ZM6Q 4DV7L 5JJLA 1YEZA 2QA4A 1VQPA 2Z0SA 4NXMQ 3ULLA 1VQ6A 4C2MH 2IHFA 4ME3A 2QGQA 3RLNA 1R9TH 1M90C 4A3JH 5FJ8H 1EOVA 2JK8A 4X64L 3F2CA 2ZJQA 4A3CH 1LUZA 4A3IG 2F4VQ 2PNHA 1Q8KA 4PMWA 1I94Q 4JI0L 3RR5A 2A1AA 3HOVG 5LMNW 4Y7NH 3PV0A 1KXLA 3HOVH 4DUYL 3S1RH 3UDFA 4HIKA 3CCMA 2CWAA 3PUZA 3EIVA 4JBKA 5C3EH 4BXXG 4OWTB 4A3IH 1VQKA 1N32L 4DUZL 3FKIG 3DM3A 4HIMA 3I4MG 3PO3G 4EQ5A 3BZCA 3OTOQ 4A3MG 4XIGS 4LF6Q 4DV6Q 2CKZB 2Q2TA 3I4OA 4QL5A 5C4JH 2KHIA 2XGTA 4OX9Q 1PVOA 1HZAA 2ZTEA 3GTLH 2UXDL 1H95A 2PQAB 1HZ9A 1VQ9A 1E1TA 1L1OC 4YWLA 1VQLA 2EXDA 4LF5L 2E2HH 4NPSA 5GAEC 1U5KA 4GNXC 1LYLA 5IYBH 4AQYQ 2YTVA 3T1HL 1XMQQ 2NVQH 1W3SA 4EX5A 2VQEL 1MKHA 1QUQA 1HR0L 1VQ8A 5H1SE 4KLKA 3U4ZA 4A3MH 4DK3C 1BBUA 2CCZA 1ASZA 3PO3H 4DR2Q 3FKIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH3 A;  2UUB L;  3PCO B;  1NY4 A;  1IYJ B;  4KI0 A;  3PF5 A;  1XNQ Q;  2NVT H;  3RZO H;  1NE3 A;  3W5O A;  4AIM A;  2JJQ A;  4LFB Q;  1CKM A;  1IBL Q;  1MIU A;  3F8T A;  4B3S L;  2AMC B;  5IE8 A;  4LF9 L;  3CQZ H;  3CP0 A;  1A63 A;  4DR6 L;  1X3F A;  2BA0 A;  3K8A A;  3B6Y A;  4R4T A;  2Z6K C;  3J81 i;  4NXM L;  2D0O A;  1UE1 A;  4P71 A;  4DAY B;  2ZJR A;  1PH9 A;  4IOA A;  4LF7 L;  4R4C A;  1YHQ A;  1GO3 E;  4JI5 L;  1FVI A;  3HOU G;  5BR8 Q;  5IYC G;  1X56 A;  3J7A 5;  4A3G G;  4LFC Q;  2NN6 G;  4JOI A;  4MZ9 A;  1X54 A;  4LFB L;  2JQO A;  2NN6 I;  4RG1 A;  3TRE A;  2Y0S E;  3AYH B;  2IX1 A;  2NZO A;  2OQK A;  1J5E L;  3D0F A;  1YJW A;  4R4Q A;  1PH2 A;  3GTK H;  3J80 c;  4POF A;  3NEN A;  3CME A;  4JI4 Q;  3K7U C;  2HHH L;  1KRS A;  4B3M L;  2HIV A;  1Q1E A;  4IOC A;  1WI5 A;  2YV5 A;  3NEM A;  4LFA Q;  3H0G H;  4JI1 Q;  3J7Z C;  4JI6 Q;  2ALY B;  2MO1 A;  1JMC A;  4A93 H;  4DV1 Q;  1PHJ A;  1VQ4 A;  2R92 G;  3ICE A;  1QZH A;  1Q81 C;  1X6O A;  2B63 H;  5GAG C;  5JEA G;  1I50 H;  2Q2U A;  2Y0S G;  2RHQ B;  1QZG A;  4JI8 Q;  2ES2 A;  4JV5 L;  1K3R A;  4LUV A;  3BU2 A;  3J80 i;  2N49 A;  5JEA J;  1HR0 W;  1IXR A;  4X62 Q;  1EYG A;  2L15 A;  5GAH C;  5AJ3 L;  4Y52 H;  1XPR A;  2WB1 E;  5IT9 c;  1VQ5 A;  1CKN B;  1T9H A;  4UY8 C;  4GN4 B;  2LSS A;  1WOC A;  4PZ7 A;  4HJ8 A;  2R7Z G;  5IP9 G;  2ZTD A;  3F2B A;  4HJA A;  4POG A;  2YYZ A;  3GTP H;  1B7Y B;  1RL2 A;  5M5Y H;  1VQM A;  1KL9 A;  3G48 A;  2XTI A;  4LUZ A;  2UXB Q;  1VQG A;  3T1H Q;  5FLX c;  3JC6 6;  4DR1 L;  4DR7 L;  4GKK Q;  3AFP A;  1TWH H;  5C44 G;  3PSI A;  1C7Y A;  1E1O A;  1K0R A;  3UDX A;  4X64 Q;  4HJ5 A;  2V1C C;  4DR2 L;  3HOZ H;  1CKN A;  5E7N A;  1XMO L;  2E5L Q;  3A5Z B;  4DNI A;  4DR3 Q;  1EIY B;  4R4O A;  4A3B G;  4MTN A;  4IFD J;  4BBR H;  2R93 G;  2OTL A;  1HH2 P;  1P16 A;  2JE6 I;  4A3D H;  3CW2 C;  3I2Z A;  1A62 A;  1VQH A;  2VS1 A;  4LF7 Q;  4KHP L;  4P73 A;  4X66 Q;  3CF5 A;  1HNW L;  3HKZ G;  1N34 Q;  3AEV A;  4JI3 Q;  1U0L A;  4IJH A;  3STB C;  3OTO L;  1GM5 A;  2HQL A;  1FJG Q;  3KJP A;  1EQQ A;  2ASB A;  3S17 H;  1PV4 A;  1XPU A;  2PMZ E;  1VQB A;  1K8A C;  1E3P A;  2GVB A;  1NBW A;  3CPF A;  1HNZ L;  1Q12 A;  4A3E G;  3S1Q H;  2ATW A;  2VUM G;  3KF8 B;  2JA5 H;  4DV3 L;  3K80 C;  4P72 A;  1EFW A;  4A3D G;  3KF6 B;  3OYY A;  4AQY L;  2MQH A;  3UDI A;  1SN8 A;  4YCU A;  3A5U A;  3H3V H;  4YHH Q;  3F1Z A;  3HOW G;  1SRU A;  1XMQ L;  4BY1 G;  2Q2H A;  1HJP A;  3W1B A;  2NVY H;  3M7N A;  2KCM A;  4OXP A;  1X3E A;  4TVA B;  3RNU A;  1E24 A;  2D0P A;  2ID0 A;  3U50 C;  4NXN L;  4C3J H;  4QY7 A;  2UUC Q;  1SFO H;  1Y1V G;  2HIX A;  3TRZ A;  4X62 L;  4WJ4 A;  3HOW H;  4TQU S;  5EAY A;  3PGZ A;  4BY7 H;  1V1Q A;  2UU9 Q;  1FGU A;  2F4V L;  1IBM Q;  3E0E A;  4JCV E;  4UP9 A;  1W2B A;  4B3S Q;  3CCQ A;  2JEA I;  3GTO H;  3KFU A;  5AJ3 Q;  1BKB A;  3RN2 A;  4DUY Q;  5BR8 L;  4LF6 L;  1EIF A;  1PH5 A;  4R4I A;  4LF4 Q;  2WP8 J;  3S14 H;  1A8V A;  4QJF A;  2D62 A;  1KRT A;  4A3K H;  4JBM A;  3FHW A;  4LFC L;  1BVS A;  3Q8D A;  5C4X H;  1K8G A;  2B63 G;  4IPH A;  4MNO A;  2MNA A;  2R92 H;  1C0A A;  1SLJ A;  4DR5 Q;  4JI7 L;  2IT1 A;  3A74 A;  4L5R C;  4C3I H;  3JAM i;  2PI2 E;  1VCI A;  2E2I H;  1D7Q A;  1VQC A;  1WFQ A;  1LTL A;  4R1J A;  1J5E Q;  3CCV A;  4B3R L;  4A3L H;  5JJI A;  2BH8 A;  1VQA A;  1XNR Q;  1SRO A;  5M3F G;  4BA1 I;  3M9B A;  4A76 A;  4LUO A;  3W1G A;  2IHE A;  3G6E A;  1Y1W G;  1OXU A;  4KHZ A;  1IZ6 A;  1TWA H;  1PH7 A;  4JI3 L;  4BA2 I;  5IYC H;  3E9H A;  3CMA A;  2K52 A;  1PFS A;  1XJV A;  3OW2 A;  1VQF A;  3GTG H;  2Q2I A;  4LF8 Q;  1Y14 B;  3HOU H;  4OO1 G;  2UUB Q;  3M85 A;  4JV5 Q;  1VQJ A;  1YHA A;  5LMU L;  2K5V A;  4GOP A;  3VDY A;  4JI0 Q;  1N9W A;  3CD6 A;  1Q1B A;  1N33 L;  1B70 B;  4DV4 Q;  2CQO A;  2LXK A;  3G71 A;  3EBE A;  1GD7 A;  4UP7 A;  1N36 Q;  4QIW E;  2OCE A;  1JJC B;  1WJJ A;  3KOJ A;  3TEH B;  3JAM c;  4JC0 A;  1HNX Q;  1VS0 A;  1KHI A;  3TQY A;  3GO5 A;  2I5L X;  4X65 Q;  3PIO A;  1E22 A;  1XTD A;  1Z47 A;  2VZA A;  5M5W H;  3ULP A;  4A93 G;  4HJ9 A;  4GOP B;  4A4I A;  3I4N G;  2YU9 H;  4GOP C;  4DV0 L;  4A75 A;  2UXB L;  5IYB G;  2JEB I;  3ER0 A;  1PH1 A;  4LFA L;  3PIP A;  1PYS B;  1Q82 C;  3CCJ A;  4DV4 L;  1NMG A;  1N34 L;  4JI4 L;  1IBK Q;  1XPO A;  5IY0 A;  1VQN A;  4GKJ L;  4L5S A;  3K7A H;  3UE1 A;  4X66 L;  1HR0 Q;  3PUY A;  3G4S A;  1CSQ A;  2GVA A;  3ULJ A;  1HNX L;  4DV1 L;  4HJ7 A;  1LM0 A;  4H02 A;  3I4M H;  1TWG H;  3M3Y H;  3LGJ A;  1UEB A;  1FJG L;  1GVP A;  2WAQ E;  1QVC A;  3KJO A;  3GTQ H;  4BXX H;  1AE2 A;  2K5N A;  3CXC A;  1MJE A;  4IO9 A;  1L1O B;  3SGI A;  1JB7 A;  2PQA A;  1QVF A;  4YWK A;  3CPW A;  4DR4 Q;  2AWN A;  1X9N A;  5M5X H;  1YIJ A;  1IL2 A;  3AFQ A;  4O0A A;  1SR3 A;  5C0X G;  1UE7 A;  1RIP A;  2DGY A;  3PF4 A;  1I5F A;  1UE5 A;  3S24 A;  2CFM A;  1XNR L;  1S40 A;  4RMF A;  4K0K Q;  2OWO A;  4JYA L;  4IJL A;  4JOI C;  1X65 A;  4DK6 C;  3PUX A;  1Y1W H;  4UP8 A;  5M3F H;  3H3V I;  2IY5 B;  4JI2 L;  2KHJ A;  1A0I A;  4IPC A;  2MO0 A;  5J3B A;  4YY3 Q;  5IWA L;  1PA6 A;  2UUA Q;  2HHH Q;  4B3M Q;  1DGS A;  2A8V A;  3NBH B;  4JBW A;  2Z6K A;  1JJ2 A;  4DV2 Q;  2N3S A;  3I4N H;  3CC2 A;  4JI1 L;  4UPA A;  5GRO A;  2YTY A;  1G29 1;  2BH2 A;  4IFD G;  1M1K C;  2OTJ A;  1J6Q A;  4ALP A;  1HNZ Q;  3PO2 G;  4AH6 A;  1PYB A;  5C4X G;  4LF4 L;  2CWP A;  4WJ3 M;  3GDE A;  1OXV A;  1N36 L;  5C3E G;  5ELN A;  5HY6 A;  5JJK A;  4IPG A;  4A3K G;  4JBJ A;  3S2D H;  1KD1 C;  3KF6 A;  2VL6 A;  1SE8 A;  1D8L A;  1IBL L;  3RLF A;  1YJN A;  1E7Z A;  1FL0 A;  4LW1 A;  3I56 A;  4GN3 B;  5DLQ E;  3AQQ A;  3CCS A;  1G6P A;  3HOY H;  4DV5 L;  4DR6 Q;  2VNU D;  3DLL A;  3I55 A;  3CC4 A;  1TXY A;  1N8R C;  4DPG A;  1OXS C;  5C0X I;  2VQF Q;  1I94 L;  2B29 A;  1KC8 C;  1KAW A;  4APV A;  1L1O A;  5FJ8 G;  4A3J G;  4A3C G;  1PH6 A;  2ZJP A;  4GLX A;  3M4P A;  4GNX B;  1Y1V H;  1AE3 A;  4DR7 Q;  2N8N A;  3K81 C;  2DUD A;  2K50 A;  4LNQ A;  1SMX A;  4J15 A;  2NZH A;  5LMU Q;  5ELO A;  4FDB A;  3J81 j;  2B3G A;  5K36 G;  3H15 A;  1UE6 A;  1TWC H;  1YVC A;  4PG3 A;  4LF5 Q;  4A3L G;  4OX9 L;  2JA8 G;  4DR4 L;  2JA7 H;  1VQI A;  1YNX A;  3RZD H;  3D31 A;  2K4K A;  3FP9 A;  2R7D A;  2VQF L;  2VUM H;  3ZJY C;  4JI6 L;  2ZM6 L;  4DV7 Q;  1YJ9 A;  2R7F A;  4A3E H;  2UXC Q;  3MEF A;  1JE5 A;  3S16 H;  1JT8 A;  5M3M H;  1G51 A;  5C0X J;  1JJG A;  3EN2 A;  2MFI A;  4YCV A;  5IP7 G;  4BBS G;  4B3T Q;  4HID A;  4K0K L;  3CCR A;  5FLM G;  2F52 A;  3L7Z C;  1EQR A;  4JYA Q;  3HOX H;  1WCM H;  4C3H H;  1Q7Y C;  4DAM A;  3BZK A;  1IBK L;  2K5H A;  4DV2 L;  2AKW B;  2GN5 A;  4HIO A;  1B8A A;  2R93 H;  1OTC A;  3KDF B;  4L5Q A;  4O2D A;  4YY3 L;  2C35 B;  2BA1 A;  2E8G A;  4YHH L;  3J81 c;  4JI5 Q;  1K83 H;  3S1M H;  1Z9F A;  4BY7 G;  2PI2 A;  4GLV B;  1EUJ A;  1NJI C;  1ASY A;  3HOZ G;  4PZ6 A;  1NTG A;  4PZ8 A;  4IFD I;  4GKJ Q;  2H5X A;  2K14 A;  2UXC L;  4DR1 Q;  4P74 A;  4X6A H;  2AWO A;  2JA6 H;  5IYD H;  4AYB G;  5C44 H;  2UUC L;  4NXN Q;  3M4Q A;  1PH8 A;  2JA9 A;  1YBY A;  3E9I A;  3IRB A;  2I0Q A;  4A3F G;  3RN5 A;  1K73 C;  4B3T L;  1P8L A;  4GN5 A;  1VQ7 A;  4BY1 H;  2LXJ A;  2EIF A;  2UU9 L;  1OXX K;  3PUV A;  2E2J H;  1IBM L;  3UE0 A;  5GAD C;  3L2P A;  2JA5 G;  3CC7 A;  3RLO A;  3MXN B;  1WCM G;  4OON A;  4DKA C;  1YI2 A;  4KHP Q;  1PH4 A;  2QEX A;  2WB1 G;  4X65 L;  4BBS H;  2RCN A;  5IP7 H;  4OO1 I;  1EWI A;  1VQD A;  1VQO A;  1KQS A;  3KYH C;  4NB3 A;  2R6G A;  2F3I A;  4DV0 Q;  5M3M G;  1AH9 A;  1X3G A;  2K75 A;  2IX0 A;  3GD7 A;  1S72 A;  1XNQ L;  3STB D;  4LF9 Q;  3T1Y L;  1YZ6 A;  3CCL A;  2WFW A;  2UUA L;  1C9O A;  2A19 A;  3HKZ E;  5HGQ A;  4DV3 Q;  1I6H H;  2I5M X;  1L2F A;  2JA7 G;  4BBR G;  2JA8 H;  4YCW A;  4A3B H;  3I7F A;  2VW9 A;  3F2D A;  1N32 Q;  1X55 A;  4OWW B;  4A3F H;  4AYB E;  5GQO A;  3CCE A;  2EQS A;  3CAM A;  3UDG A;  4GKK L;  1O7I A;  3BJU A;  1TWF H;  1QUQ B;  5IYD G;  2JA6 G;  1OXT A;  3S2H H;  4QGU A;  3U58 A;  3NEL A;  2YTX A;  4IPD A;  3U4V A;  4DUZ Q;  2UXD Q;  1VQE A;  3CCU A;  4A3G H;  4GNX A;  3GTJ H;  2HT1 A;  2RHS B;  4LF8 L;  1S3O A;  4DV6 L;  1KIX A;  4DR3 L;  4QQB X;  4GLA C;  2OQ0 A;  2VY3 A;  1HZB A;  3T1Y Q;  5IP9 H;  1CKO A;  2R7Z H;  2FXQ A;  4DV5 Q;  1CSP A;  3KLW A;  5LMN L;  2RF4 A;  3TS2 A;  2VQE Q;  3A0J A;  3HOY G;  3HOX G;  1I3Q H;  1V43 A;  5FLM H;  1Q46 A;  1XMO Q;  1QVG A;  2E5L L;  2NVX H;  1N33 Q;  1Q86 C;  4GS3 A;  2AHO B;  1V9P A;  3ERS X;  1BBW A;  2I5H A;  2KCT A;  2ZTC A;  3PUW A;  1NMF A;  1HNW Q;  1UWV A;  4OWX B;  4JI8 L;  3HFZ B;  2KEN A;  2N78 A;  3PO2 H;  3S1N H;  2KBN A;  2WAQ G;  3M4O H;  4YWM A;  4XTC S;  3HKS A;  4DR5 L;  3TS0 A;  4JI7 Q;  1L0W A;  1K9M C;  3H0G G;  4L5T A;  3GTM H;  3L0O A;  1CUK A;  3WWV A;  1GKH A;  1YHB A;  4JG2 A;  5LMN Q;  1YIT A;  3K0X A;  3S15 H;  4JI2 Q;  3KDF A;  5IWA Q;  4LWC A;  4P75 A;  1HZC A;  1MJC A;  1WYD A;  4B3R Q;  2ZM6 Q;  4DV7 L;  5JJL A;  1YEZ A;  2QA4 A;  1VQP A;  2Z0S A;  4NXM Q;  3ULL A;  1VQ6 A;  4C2M H;  2IHF A;  4ME3 A;  2QGQ A;  3RLN A;  1R9T H;  1M90 C;  4A3J H;  5FJ8 H;  1EOV A;  2JK8 A;  4X64 L;  3F2C A;  2ZJQ A;  4A3C H;  1LUZ A;  4A3I G;  2F4V Q;  2PNH A;  1Q8K A;  4PMW A;  1I94 Q;  4JI0 L;  3RR5 A;  2A1A A;  3HOV G;  5LMN W;  4Y7N H;  3PV0 A;  1KXL A;  3HOV H;  4DUY L;  3S1R H;  3UDF A;  4HIK A;  3CCM A;  2CWA A;  3PUZ A;  3EIV A;  4JBK A;  5C3E H;  4BXX G;  4OWT B;  4A3I H;  1VQK A;  1N32 L;  4DUZ L;  3FKI G;  3DM3 A;  4HIM A;  3I4M G;  3PO3 G;  4EQ5 A;  3BZC A;  3OTO Q;  4A3M G;  4XIG S;  4LF6 Q;  4DV6 Q;  2CKZ B;  2Q2T A;  3I4O A;  4QL5 A;  5C4J H;  2KHI A;  2XGT A;  4OX9 Q;  1PVO A;  1HZA A;  2ZTE A;  3GTL H;  2UXD L;  1H95 A;  2PQA B;  1HZ9 A;  1VQ9 A;  1E1T A;  1L1O C;  4YWL A;  1VQL A;  2EXD A;  4LF5 L;  2E2H H;  4NPS A;  5GAE C;  1U5K A;  4GNX C;  1LYL A;  5IYB H;  4AQY Q;  2YTV A;  3T1H L;  1XMQ Q;  2NVQ H;  1W3S A;  4EX5 A;  2VQE L;  1MKH A;  1QUQ A;  1HR0 L;  1VQ8 A;  5H1S E;  4KLK A;  3U4Z A;  4A3M H;  4DK3 C;  1BBU A;  2CCZ A;  1ASZ A;  3PO3 H;  4DR2 Q;  3FKI H; 
#chains in the Genus database with same CATH topology
 1IYJ B;  3SE0 A;  3K5N A;  1IBL Q;  4RH6 A;  4B3S L;  2SEB D;  2M9V A;  5IE8 A;  4LF9 L;  1A63 A;  3VYT A;  2BA0 A;  2F0J A;  1PLF A;  3K8A A;  3B6Y A;  4R4T A;  3J81 i;  2ENB A;  1W6K A;  2D0O A;  5I6W A;  4IOA A;  2PW7 A;  1GO3 E;  4JI5 L;  1HUN A;  2RQX A;  5IYC G;  1X56 A;  4A3G G;  1A6X A;  1R4Q B;  3OIQ A;  1X54 A;  4LFB L;  2R61 A;  2CW0 D;  2JQO A;  2NN6 I;  2Y0S E;  3AYH B;  1KDA A;  3K6O A;  3NEN A;  3OHX C;  1TQO A;  3TDQ A;  4DFA A;  2HIV A;  1HQM C;  4IOC A;  1HA5 A;  3H0G H;  3ITP A;  3J7Z C;  4JI6 Q;  2ALY B;  1JMC A;  5G3L F;  3FRP B;  3QG1 A;  4XT1 B;  3ICE A;  2B63 H;  1X6O A;  2FMM A;  1DM0 B;  2RHQ B;  3T13 A;  3BG3 A;  3BU2 A;  3J80 i;  4K8J A;  4X62 Q;  5M5X B;  4Y52 H;  2HDL A;  2LSS A;  1WOC A;  5IP9 G;  4XXE A;  4HED A;  2F0S A;  2M00 A;  4POG A;  1B7Y B;  1JOK A;  1RL2 A;  4LUZ A;  2UXB Q;  1JWU D;  4DR7 L;  4GKK Q;  3AFP A;  1QB5 D;  1TWH H;  1S4Z A;  1C8C A;  1K0R A;  1LTB D;  1CKN A;  1RHP A;  1VDZ A;  4F8M A;  4DNI A;  2HCC A;  5FO9 B;  1P16 A;  3CW2 C;  1A62 A;  2VS1 A;  2WB1 B;  4LF7 Q;  2Z1C A;  3L3O C;  3X3M A;  3CF5 A;  4KHP L;  4QCL A;  4KD4 A;  3S2D B;  5ISR A;  5CYU A;  1GM5 A;  3NQT A;  1MBY A;  3S1M B;  1UNS A;  1PV4 A;  4A3E B;  2PMZ E;  1K8A C;  1XPU A;  4IUT A;  2KQ3 A;  1HNZ L;  1DXM A;  2L4N A;  3S1Q H;  2JA6 B;  1BR9 A;  3I73 A;  2VUM G;  4DV3 L;  3K80 C;  3IAY A;  4A3D G;  3KF6 B;  4CJ0 B;  3OYY A;  3UDI A;  3K58 A;  4YCU A;  4EVO A;  3HOW G;  1IHZ A;  1SRU A;  5I2X A;  1EYD A;  4NW2 A;  2KCM A;  2EVB A;  3RNU A;  1E24 A;  2ID0 A;  5EPJ A;  4B08 A;  2JA7 B;  4BBS B;  3Q23 A;  4TQU S;  5EAY A;  3MHB A;  1WTP A;  3Q6S A;  2F0T A;  3HGB A;  1IBM Q;  3E0E A;  1W2B A;  4UP9 A;  1IW7 D;  4JW0 A;  2EPB A;  3CCQ A;  3KFU A;  1EEI D;  4DUY Q;  3NTI A;  1ET9 A;  3T51 B;  4EGV A;  1BO0 A;  4LF4 Q;  4KKU A;  3S14 H;  4QJF A;  3IFD A;  3FHW A;  4LFC L;  4KK7 A;  1U4M A;  1K8G A;  3RZD B;  5D3I B;  3A74 A;  4L5R C;  1SYC A;  4C3I H;  4IFD H;  1VCI A;  2VB3 X;  1WFQ A;  4R1J A;  4L6T B;  4B3R L;  4CJ2 C;  1VQA A;  1SRO A;  2E2I B;  3NBH A;  4LK1 C;  5EBC A;  2J0T D;  3M9B A;  2EXZ A;  3G6E A;  1EQV A;  3S1Q B;  4KHZ A;  1BCP C;  1IZ6 A;  1HUM A;  1TWA H;  4MTK A;  2LY7 A;  1PFS A;  4N9T A;  1Y14 B;  4QUF A;  2K5V A;  4JI0 Q;  1XWE A;  5C3E B;  1Q1B A;  1B70 B;  4DV4 Q;  3MAQ A;  1EU3 A;  4ILW A;  2NVX B;  4MN3 A;  2NBF A;  3HRZ C;  4ZK9 B;  2IJ0 A;  3GO5 A;  1XTD A;  1F2L A;  4RCN A;  4GOP B;  2YU9 H;  4GOP C;  4A75 A;  2JEB I;  1PYS B;  3NWT A;  1N34 L;  4JI4 L;  3Q0A A;  2F0K A;  4L5S A;  1S5D D;  3GQB A;  3HKZ B;  1K3B C;  1LV9 A;  1SBB B;  1G8Z D;  4IQZ A;  2GVA A;  3F2U A;  3ULJ A;  1F77 A;  4H02 A;  2DNE A;  1E2W A;  1GVP A;  2WAQ E;  4HSP A;  2K6A A;  2FMC A;  1PYW D;  3ERQ A;  2ZXO A;  1L0X B;  1X9N A;  1STB A;  4O0A A;  2QCP X;  1V1O A;  1UE7 A;  1RIP A;  1I5F A;  4OO1 H;  2K05 A;  1WTO A;  3A8J E;  4K0K Q;  2F0D A;  2A5H A;  2RDH A;  3KBG A;  3H3V I;  3V2T A;  4JI2 L;  2E76 C;  1TS5 A;  1TWG B;  3R2I A;  1EZ8 A;  4FO2 A;  2HHH Q;  2UUA Q;  4B3M Q;  5D3D A;  2Z6K A;  5NUC A;  3TME A;  2N3S A;  1FGB D;  3MA2 B;  3A7L A;  4EQN A;  1LLR D;  2KEE A;  4UPA A;  5GRO A;  2YTY A;  2BH2 A;  2OTJ A;  1M1K C;  1HNZ Q;  1FNV A;  2X6G A;  1OXV A;  1ILP A;  3E5S A;  2D5D A;  4H44 C;  4IPG A;  4A3K G;  1KD1 C;  3PIP 3;  2X6L A;  1BDO A;  1JCK B;  4F87 A;  1SYF A;  4OIJ A;  3D3R A;  1U4L A;  3AMU A;  1OXS C;  2VQF Q;  1AZP A;  1KC8 C;  2A6H D;  2CVR A;  1PH6 A;  2ZJP A;  3M4P A;  4GNX B;  1Y1V H;  3I4N B;  5CV6 A;  3A56 A;  3K81 C;  2DUD A;  5KNB A;  4EQP A;  1SMX A;  3OSO A;  2NZH A;  3E0J A;  4FDB A;  2EE1 A;  5K36 G;  5IT9 L;  3H15 A;  2F0E A;  1I4H A;  2CH4 W;  3D31 A;  3LX0 A;  3L9A X;  4RGN A;  3MEH A;  2ZM6 L;  4JI6 L;  4A3E H;  1JE5 A;  4PV1 C;  5C0X J;  1UUP A;  5EQ0 A;  1SNM A;  1FR3 A;  4ME5 A;  3I3C A;  1SE2 A;  4JYA Q;  3A8K E;  3HOX H;  4PMC A;  4DXF A;  5CV7 A;  5C3W A;  3BZK A;  2AKW B;  2GN5 A;  4HIO A;  3RMH A;  1HPC A;  2KUM A;  4CKE A;  4L5Q A;  1WD1 A;  4K6L A;  2C35 B;  1ROD A;  1CQV A;  1LTT D;  1GOZ A;  1Z9F A;  4GLV B;  1NTG A;  5EBD A;  4DR1 Q;  4P74 A;  3VR2 A;  2XWB B;  5IYD H;  4AYB G;  3NQI A;  4NXN Q;  1CFM A;  3M4Q A;  1PH8 A;  3HOY B;  2JA9 A;  1YBY A;  3IRB A;  2I0Q A;  4B3T L;  1K73 C;  1JR0 D;  2LXJ A;  3TSS A;  5T1G A;  1IW7 C;  1SE4 A;  1OXX K;  2E2J H;  1IBM L;  5IT9 E;  3EA6 A;  2EYO A;  5CBE E;  4KHP Q;  5DM7 3;  1PH4 A;  5FO8 B;  4X65 L;  2RCN A;  2I07 B;  1STE A;  4OO1 I;  1VQO A;  1KQS A;  1GUG A;  2F3I A;  4DV0 Q;  5M3M G;  3AB9 A;  1S72 A;  2WFW A;  5HGQ A;  4DV3 Q;  4WFN 3;  1GHK A;  1L2F A;  3J80 E;  2JA8 H;  4YCW A;  3TP6 A;  1CI3 M;  3DEO A;  4A3F H;  1PZJ D;  4XDX A;  2EQS A;  3CAM A;  3URY A;  2JA6 G;  1LO5 D;  1PRT B;  2M2L A;  2Q8T A;  3HOX B;  4QGU A;  3OWE B;  4IZ8 A;  1EIH A;  3CCU A;  1SYE A;  2HT1 A;  3MXU A;  4DV6 L;  2AQ1 B;  4UAI A;  1CKO A;  4DV5 Q;  2F0O A;  3KLW A;  4OHJ A;  3A0J A;  3D6C A;  1GHJ A;  3D4D A;  1V43 A;  1AZQ A;  2E5L L;  4DAP A;  4IUR A;  4GS3 A;  2Z9H A;  3BDL A;  1B53 A;  2KCT A;  3TBI B;  1NMF A;  1HNW Q;  3SXH A;  2JN4 A;  1B9N A;  3PO2 H;  5CR3 A;  2WAQ G;  2A6E C;  3HKS A;  2Z4I A;  4JI7 Q;  4HR7 B;  2Z8L A;  2D2C C;  3LWU A;  1L0W A;  1K9M C;  4L5T A;  1CUK A;  1GKH A;  3O13 A;  3K0X A;  4JI2 Q;  1RTN A;  3TP5 A;  2NVT B;  1ESF A;  4B3R Q;  1Y8O B;  3OMG A;  4DV7 L;  1YEZ A;  1VQP A;  2IHF A;  3VR4 A;  4ZLT F;  2F0P A;  1M90 C;  3JAM L;  4IUQ A;  2LKV A;  5FJ8 H;  1QNK A;  4X64 L;  4A3J H;  4TKO B;  2KCC A;  2HUG A;  2QIL A;  1Q8K A;  5JVH 3;  1YNJ D;  4JI0 L;  3NTK A;  4HAE A;  5A2Q E;  3A7A B;  4Y7N H;  2PZT A;  3S1R H;  4HIK A;  4G4K A;  1HTL D;  3EIV A;  4ZAI A;  3DM3 A;  3I4M G;  3PO3 G;  3M7G A;  2CKZ B;  4XT3 B;  1PRT F;  3GTL H;  1HZ9 A;  1E1T A;  2O4X A;  2EXD A;  5DNF A;  3AU7 A;  1WTQ A;  4LF5 L;  1A2U A;  2E2H H;  1KLG D;  3C1F A;  4A3M B;  1U5K A;  2K32 A;  3VA5 A;  2NVQ H;  2O5J C;  4ZQ3 A;  5CMD A;  1HR0 L;  3U4Z A;  3M4Y A;  3CRL C;  2UUB L;  3RZO H;  4KI0 A;  1K8O A;  3PF5 A;  1EY8 A;  4AIM A;  5FOB B;  1D5Z C;  4FXK C;  4F88 A;  3VR5 A;  1JE4 A;  4ODG A;  3CQZ H;  3CP0 A;  1SNQ A;  1ILQ A;  4RGO S;  2Z6K C;  1PH9 A;  2ZJR A;  1DOL A;  1K28 A;  3HOU G;  2KEC A;  5BR8 Q;  5KIX A;  1JWM D;  3J7A 5;  2NN6 G;  4MZ9 A;  2MHV A;  4RG1 A;  2NZO A;  2OQK A;  3GTK H;  2B2Y A;  3J80 c;  2MGS A;  1H9S B;  3K7U C;  1KRS A;  2HHH L;  4B3M L;  2EZV A;  4BY1 B;  1Q1E A;  2H4O A;  2B8G A;  4JI1 Q;  1BF4 A;  5CGK A;  4A93 H;  1O78 A;  2EJM A;  2XSC A;  1PHJ A;  2R92 G;  1Q81 C;  5KYI A;  5GAG C;  5DAU A;  4X3S A;  2Q2U A;  2F3V A;  2Y0S G;  2ES2 A;  3OOC A;  2N49 A;  5GAH C;  2XRQ D;  2L0C A;  2WB1 E;  5IT9 c;  1VQ5 A;  4UY8 C;  1HQR D;  3PQI A;  3NE5 B;  4HJ8 A;  2ZTD A;  1F9S A;  2QEJ C;  2V4D A;  3VYU A;  1H9J A;  2K5D A;  5I9P A;  1PRT D;  5D14 A;  1VQG A;  4S3S A;  4C3J G;  3JC6 6;  4DR1 L;  3T1H Q;  2EJF C;  5C44 G;  4KY6 A;  3PSI A;  1SNC A;  1BCP D;  3CU7 A;  4X64 Q;  5EKL A;  2V1C C;  4K8I A;  5M3M B;  3HOZ H;  1XMO L;  3A5Z B;  1EIY B;  4MTN A;  2R93 G;  3OIP A;  2OTL A;  1HH2 P;  2JE6 I;  4P73 A;  1HNW L;  3HKZ G;  3R93 A;  3AEV A;  4JI3 Q;  4U67 3;  4IJH A;  3OTO L;  4K5X A;  1RJT A;  2O2L D;  1SE3 A;  3KJP A;  3S17 H;  1VQB A;  1U4P A;  2GVB A;  4UHV A;  5CC4 A;  5KGU A;  2EY2 A;  4A3E G;  2ATW A;  2D9U A;  2JA5 H;  1EFW A;  3MC0 B;  4DXG A;  4AQY L;  5M5W B;  1BCP B;  2P5Z X;  3H3V H;  3F1Z A;  5JOB A;  3C2P A;  3WDN A;  5C4H A;  2NVY H;  5KND A;  2D0P A;  4KN7 C;  3SK4 A;  3U50 C;  4NXN L;  5CV4 A;  3TRZ A;  4WJ4 A;  4X62 L;  1AW7 A;  4HCE A;  3PGZ A;  2F0I A;  1STN A;  2RDG A;  2F4V L;  1QG7 A;  4JCV E;  2JEA I;  2OF1 A;  3NPP A;  5IOD A;  1BKB A;  2CH4 A;  5FK9 C;  1EIF A;  4CKC A;  1PH5 A;  4R4I A;  2JA8 B;  4CDD C;  1F9R A;  1A8V A;  1KLU D;  4A3K H;  1ENF A;  2HQE A;  5EPL A;  1XXG A;  2E74 C;  3Q8D A;  4IPH A;  4MNO A;  1EY5 A;  3D8G A;  5T1I A;  1SLJ A;  4JI7 L;  1SXT A;  2IT1 A;  2DY7 A;  2F0Q A;  1LTL A;  3V96 A;  1J5E Q;  1EY9 A;  1XNR Q;  1V1P B;  4BA1 I;  4A76 A;  4LUO A;  2C5C A;  1OXU A;  3A55 A;  3CQZ B;  2E2J B;  1I4P A;  4JI3 L;  4BA2 I;  3FDT A;  1D1K A;  2PYK A;  5FKA C;  3OW2 A;  1VQF A;  3HS0 C;  1TU2 B;  3NUC A;  4A3K B;  1XJV A;  4JV5 Q;  1YHA A;  2QW7 A;  2WV6 D;  1PFB A;  1PTO D;  1NNX A;  3K5L A;  2L9H A;  1BXT A;  3T16 A;  3EBE A;  1FYC A;  4V19 0;  1N36 Q;  3I4M B;  2F0L A;  1WJJ A;  3BVG A;  1VS0 A;  2NB0 A;  1KHI A;  1I6V C;  3TQY A;  2EY5 A;  4A93 G;  1GUS A;  3NK9 A;  4CBV A;  2K33 A;  3DXJ C;  3FPP A;  4NDX A;  4U68 A;  1ICW A;  1IBK Q;  1XPO A;  4HSV A;  4FXG C;  3K7A H;  1HR0 Q;  1D1I A;  1Z7T A;  4Y7N B;  3H0G B;  3M3Y H;  2BCO A;  1AE2 A;  1QWY A;  2LMC B;  2K5N A;  2SNS A;  1MJE A;  1SNO A;  4IO9 A;  1STH A;  3SGI A;  1SNP A;  2PO4 A;  3TZD A;  3CPW A;  2L55 A;  4DR4 Q;  2AWN A;  4RGM A;  1BQQ T;  1A2T A;  3Q22 A;  3HOU B;  1SR3 A;  1H9S A;  4J8Q A;  1U9R A;  2R7Z B;  2CFM A;  1XNR L;  4KJO A;  4R8N A;  1WTR A;  5TSS A;  2KOL A;  4DA2 A;  3I8Z A;  4BS9 A;  2F03 A;  5LHY 1;  1MD2 D;  1W6J A;  5J3B A;  4YY3 Q;  4J1M A;  3RZO B;  5DEH A;  1PA6 A;  2R3Z A;  5BN3 A;  2A8V A;  4JBW A;  4DV2 Q;  4JI1 L;  4O42 A;  5IGE A;  4AH6 A;  5FLX E;  1DZ1 A;  2PW5 A;  3OW7 A;  1OO9 B;  1N36 L;  4WJ3 M;  5C3E G;  2G5D A;  5JJK A;  1QE6 A;  2VL6 A;  1SE8 A;  1D8L A;  3ZYY X;  3RLF A;  4MIU A;  1FL0 A;  4GN3 B;  5DLQ E;  3CCS A;  1G6P A;  3HOY H;  2RCF A;  3DLL A;  3PIO 3;  1N8R C;  4DPG A;  1I94 L;  5C0X I;  1L1O A;  4A3J G;  3PMF A;  3E3X A;  2F0M A;  1SJH D;  2K50 A;  4M1U B;  4A93 B;  1O7Z A;  4J15 A;  3J81 j;  2B3G A;  4A3L G;  1YVC A;  2Z6B A;  3QB3 A;  1A3T A;  2RA4 A;  1T5E A;  2R7D A;  1TWH B;  1FNW A;  2K1B A;  5C4J B;  5C6A A;  1YJ9 A;  2R7F A;  4IN3 A;  3QIA A;  3DM1 A;  4G7H C;  1JJG A;  3HG9 A;  3D6W A;  5FLX L;  2MFI A;  2K04 A;  4YCV A;  1HCZ A;  3EJI A;  4BBS G;  3BZD B;  3UI2 A;  4K0K L;  1LT6 D;  2F52 A;  3L7Z C;  1EQR A;  1WCM H;  2B2U A;  4DAM A;  1EU4 A;  4XQQ A;  1B8A A;  2R93 H;  1OTC A;  3KDF B;  5E4X A;  4C3I B;  4YY3 L;  2BA1 A;  2IPK D;  2EYH A;  3J81 c;  1K83 H;  1EUJ A;  1ASY A;  3HOZ G;  4PZ6 A;  1B3A A;  4HCS A;  2AWO A;  2JA6 H;  2WIN B;  5C44 H;  2UUC L;  2A69 D;  3T53 B;  5G3L D;  4A3F G;  3RN5 A;  1VQ7 A;  2EIF A;  2UU9 L;  1BCP F;  5C3X A;  1ONL A;  4KKS A;  3CC7 A;  1CQF A;  1EIG A;  4I7A A;  3RLO A;  3MXN B;  1EY0 A;  2QEX A;  4FF1 A;  4BBS H;  4HTH A;  4E6I A;  1SJE D;  1LTI D;  1PZI D;  5KRU A;  3JAM E;  1AH9 A;  3A8I E;  3H09 A;  3STB D;  3T1Y L;  3CCL A;  1STG A;  4CKB A;  1Y1V B;  4DF7 A;  1HXY D;  1I50 B;  4LAA A;  4QMG A;  2VW9 A;  1N32 Q;  2XVS A;  4AYB E;  5JPM C;  3CCE A;  3UDG A;  3BJU A;  1TWF H;  5IYD G;  4CHT B;  1Y8P B;  1SYD A;  3S2H H;  3U58 A;  3NEL A;  4IPD A;  4DUZ Q;  3U4V A;  1VQE A;  2XNA C;  1DCZ A;  3GTJ H;  1E2V A;  1XYI A;  1TS3 A;  4DR3 L;  4GLA C;  2VY3 A;  5IP9 H;  1PTO C;  3J81 E;  1KNA A;  1STY A;  2VQE Q;  3HOY G;  3DWQ A;  2NYZ D;  4QF4 A;  1I3Q H;  1Q46 A;  4OIK A;  2AHO B;  4ID6 A;  1JB3 A;  1V9P A;  1BBW A;  4IUU A;  3T4A C;  2ZTC A;  5E4W C;  3MFY A;  2EYP A;  4OWX B;  3HFZ B;  3MTS A;  1IKM A;  2KBN A;  1XX8 A;  3M4O H;  2L12 A;  4XTC S;  4DR5 L;  1ZEQ X;  2JXM B;  3H0G G;  1C4Q A;  2FJ2 A;  3GV6 A;  3L0O A;  3GTM H;  5LMN Q;  1YIT A;  3S15 H;  1HZC A;  2ZM6 Q;  3HZX A;  4C1N I;  1MSH A;  2Z0S A;  4NXM Q;  3ULL A;  4ME3 A;  1Y8N B;  1B50 A;  4N8F A;  2K5W A;  3F2C A;  2JK8 A;  1D5M C;  2N55 A;  4PNY A;  3HOV B;  4PMW A;  1V1P A;  1I94 Q;  1IYU A;  2EYJ A;  4TSS A;  1TS4 A;  3PV0 A;  1ESR A;  2A68 C;  3UDF A;  1NAP A;  2RKS A;  3MXN A;  5C3E H;  4X3T A;  4OWT B;  4A3I H;  3FKI G;  4EQ5 A;  3BZC A;  3J80 L;  1ZYR D;  1G2S A;  2BDO A;  2Z4H A;  1HZA A;  2ZTE A;  2O5I C;  1VQ9 A;  4YWL A;  5JJZ A;  4NKL A;  1YNJ C;  5GAE C;  1XMQ Q;  5IYB H;  3D4R A;  4K14 A;  1JQY D;  2RVL A;  4KLK A;  2RSN A;  1RDP D;  4A3M H;  2UXB L;  1TS2 A;  4KJN A;  1PH3 A;  1LAC A;  3MVV A;  3PCO B;  1NY4 A;  1XNQ Q;  2QDL A;  4LFB Q;  3W5O A;  5I4D A;  1CKM A;  1MIU A;  5COR A;  2AMC B;  1X3F A;  5LL6 S;  1LTA D;  1UE1 A;  4PMB A;  1EQT A;  4DAY B;  4LF7 L;  1YHQ A;  4KY5 A;  1FVI A;  3KBX A;  3H6M A;  4R8I A;  4LFC Q;  1EEF D;  3NWS A;  3BVM A;  5HGT A;  1J5E L;  4R4Q A;  1PH2 A;  1PFN A;  3CME A;  1H9K A;  1X32 A;  5M3F B;  2YV5 A;  4LFA Q;  3MWY W;  4DV1 Q;  2BE5 C;  1QZH A;  4FF4 A;  3TZU A;  1A3U A;  4ZYS A;  1QZG A;  4JV5 L;  1K3R A;  4LUV A;  3C46 A;  4EQO A;  5JEA J;  1HR0 W;  1IXR A;  5KEE A;  5AJ3 L;  1IYV A;  1YNN C;  1XPR A;  1CKN B;  2R7Z G;  3GTJ B;  3F2B A;  2YYZ A;  5IGG A;  2VB2 X;  5M5Y H;  1VQM A;  1KL9 A;  2XTI A;  1B44 D;  3W3A A;  4L8J A;  5IIF A;  1E1O A;  2B2W C;  5KYL A;  3DUZ A;  5CBA E;  3UDX A;  4HJ5 A;  1HFN A;  2CQA A;  5E7N A;  2E5L Q;  2DJG C;  4DR3 Q;  1EZ6 A;  2DN8 A;  4BBR H;  3PO2 B;  2PQE A;  5C5M A;  3KLS A;  4X66 Q;  2RDF A;  3WOF A;  1Y1W B;  1CA6 A;  3K57 A;  1N34 Q;  1U0L A;  3J81 L;  1B3Q A;  3LWE A;  3VA7 A;  1BBX C;  2HQL A;  4ABN A;  1NBW A;  1F2M A;  1Q12 A;  5J39 A;  3KF8 B;  4P72 A;  1I4Q A;  3P20 A;  2MQH A;  2SOB A;  4B9W A;  1SDF A;  3S14 B;  5K36 H;  1XMQ L;  4BY1 G;  2Q2H A;  3M7N A;  1TY2 A;  1PZK D;  1PTO F;  4TVA B;  5K5P A;  1K83 B;  5EKI A;  3P1H A;  2UUC Q;  4QY7 A;  1Y1V G;  2HIX A;  3KF8 A;  3P7J A;  4RHS A;  4BY7 H;  2UU9 Q;  1FNU A;  3X3N A;  1M4V A;  1FGU A;  2KCN A;  2KJX A;  1UAP A;  3RN2 A;  1HHV A;  1TVX A;  2AUJ D;  1S5C D;  2B2T C;  2OT2 A;  1HRJ A;  1BVS A;  2TSS A;  5C4X H;  2EYM A;  1C0A A;  1SMY C;  1PMR A;  2A6H C;  4DR5 Q;  2R92 H;  4C56 C;  4A3I B;  1O7L A;  3EFX D;  1D7Q A;  5COY A;  1G91 A;  1K8M A;  3SEB A;  1D2B A;  1KAB A;  3CCV A;  2R92 B;  1WTW A;  2IX3 A;  2EYL A;  5JJI A;  2BH8 A;  4ZUJ A;  2B39 A;  3N52 A;  2B2V A;  3ND9 A;  1CZW A;  1Z6H A;  1Y1W G;  1PH7 A;  1ML0 D;  3E9H A;  3CMA A;  2K52 A;  2KED A;  5ELB A;  3GTG H;  1ASZ A;  2HCI A;  4OO1 G;  2UUB Q;  2ICE C;  3M85 A;  4R9W A;  5C0X H;  5LMU L;  4GOP A;  1N9W A;  3K59 A;  3CD6 A;  2WKD A;  4FYD A;  1LT3 D;  1HTP A;  4UP7 A;  5ELD A;  1DOK A;  4QIW E;  1JJC B;  3KOJ A;  3JAM c;  2ZXR A;  3PIO A;  1E22 A;  3ULP A;  1KDC A;  1BOS A;  4HJ9 A;  4A4I A;  3I4N G;  2AUK A;  1R9T B;  2HD3 A;  5IYB G;  1PH1 A;  4N9P A;  1CHQ D;  4DV4 L;  1JOO A;  5A35 A;  5IY0 A;  2J7Z A;  2NN6 H;  4X66 L;  1GUT A;  5I9O A;  3G4S A;  2NTS A;  1CSQ A;  1HNX L;  4DV1 L;  2A73 B;  2OEO A;  4FVM A;  2K28 A;  1UEB A;  1FJG L;  1QVC A;  2NUC A;  2K01 A;  5JVG 3;  5I6Y A;  4RCO A;  1RCV D;  2F0U A;  2JYO A;  3RUZ A;  1SSO A;  3SK6 A;  3IKJ A;  1QJO A;  1NR4 A;  1YIJ A;  1IL2 A;  3AFQ A;  1PXU A;  3PF4 A;  1UE5 A;  2WKC A;  3S24 A;  1PTO H;  1S40 A;  3R3O A;  4IJL A;  1X65 A;  4DK6 C;  3PUX A;  1DYQ A;  2IY5 B;  2KHJ A;  1A0I A;  4IPC A;  2MO0 A;  4C2M B;  3M3Y B;  4DNR B;  1DGS A;  2MJ8 A;  1JWS D;  3BDC A;  3CC2 A;  1L0Y B;  5E3F A;  3QOJ A;  4WRD A;  4C3I G;  4IFD G;  4BBR B;  1LTR D;  2AQ3 B;  4XQN A;  1PYB A;  3KK7 A;  4ZRZ A;  2PCF B;  3H3V C;  5ELN A;  5HY6 A;  1EYC A;  3S2D H;  3KF6 A;  2WAQ B;  1JOR A;  3CRK C;  1WTV A;  1IKL A;  2NVY B;  4LW1 A;  4X3U A;  3I56 A;  1F2Y A;  3AQQ A;  2F1M A;  4DR6 Q;  4DV5 L;  4XYO A;  1MGS A;  3CC4 A;  1TXY A;  3P75 A;  3HOW B;  2K5Q A;  1K0S A;  2B29 A;  1KAW A;  4APV A;  5FJ8 G;  4GLX A;  2N8N A;  2EJG C;  4LNQ A;  5DM6 3;  1SYB A;  2LFN A;  5ELO A;  2BOS A;  2FIN B;  3TP7 A;  4I65 A;  1CTM A;  1RD9 D;  4PG3 A;  4K5V A;  4F7X A;  2F0V A;  2I46 A;  2JA8 G;  1FD7 D;  1YNX A;  2K4K A;  2VUM H;  3V05 A;  3QR8 A;  3MEF A;  4M8A A;  1JT8 A;  5M3M H;  3HOZ B;  3I72 A;  3I91 A;  3EN2 A;  4B3T Q;  4HID A;  3CCR A;  5FLM G;  4DAV A;  5IGD A;  1Q7Y C;  1IL8 A;  3NP8 A;  1WTH A;  2K5H A;  2QDB A;  4JI5 Q;  4TRD A;  3VYS A;  2PI2 A;  1NJI C;  4IFD I;  2UXC L;  4PZ8 A;  2K14 A;  1EWH A;  3H91 A;  5IGC A;  1KTK A;  3LNN A;  5M5Y B;  3R8B A;  1WVL A;  2XN9 C;  5EPK A;  4WOR A;  1P8L A;  3VR6 A;  4DAY A;  1CZG A;  1TWA B;  2B2Y C;  5I2Y A;  1ICF B;  3BYY B;  2B63 B;  5GAD C;  4AYB B;  1ET6 A;  1WCM G;  4OON A;  1BUV T;  2G9D A;  1EY7 A;  5ELF A;  1VQD A;  3KYH C;  1SMY D;  4NB3 A;  4G7O C;  2R6G A;  3EQL C;  3NBI A;  4LMQ D;  1LTS D;  4A3B B;  1X3G A;  5C44 B;  2UUA L;  1C9O A;  1EY6 A;  1JOQ A;  1HFG A;  2I5M X;  1E2Z A;  4BBR G;  4A3B H;  2SDF A;  3CHB D;  4OWW B;  3J7Y W;  1CM9 A;  4A3G B;  4ZUI A;  1WD0 A;  1F2Z A;  1EY4 A;  1O7I A;  4GKK L;  1KAA A;  1OXT A;  2YTX A;  2UXD Q;  4A3G H;  1GUW A;  4LF8 L;  1S3O A;  1KIX A;  2QKI C;  2OQ0 A;  5FO7 B;  2R7Z H;  2FXQ A;  3SDZ A;  1CA5 A;  1EFI D;  3HOX G;  1LT5 D;  4BY7 B;  4K2K A;  1QVG A;  2NVX H;  2EY1 A;  4O1N A;  2TMP A;  3SK5 A;  1LT4 D;  1VMP A;  1UWV A;  4JI8 L;  2KEN A;  3BVZ A;  1TKW B;  1TII D;  4YWM A;  3ERO A;  5L37 A;  4JK1 C;  3R2T A;  3DWP A;  2Q8R E;  2WAC A;  1YHB A;  1PDQ A;  1GJX A;  3K7A B;  4P75 A;  1MJC A;  1WYD A;  1AFP A;  4C1N K;  3QJY A;  1H9R A;  5JJL A;  1I4R A;  4QUC A;  1VQ6 A;  4C2M H;  3K0Y A;  1DJR D;  2A6E D;  4RWS C;  1EOV A;  3SK8 A;  5M9O A;  3VYR A;  5ELE A;  2PNH A;  4JVZ A;  1V8Q A;  2A1A A;  3HOV G;  2LS0 1;  3HOV H;  2ICI A;  3E6Z X;  5IOC A;  4Q5V A;  4JBK A;  1ENC A;  1I4G A;  2E75 C;  4KHV A;  1N32 L;  4HIM A;  1UEA B;  1AN8 A;  4H0L C;  2DJF C;  3OTO Q;  4A3M G;  4LF6 Q;  1QOH A;  4QB4 A;  4DV6 Q;  2Q2T A;  1O7Y A;  3I4O A;  4QL5 A;  2KHI A;  2XGT A;  3NTH A;  3MZ5 A;  2OXP A;  4H13 C;  3WOE A;  1F9P A;  2UXD L;  1H95 A;  2PQA B;  1VQL A;  1M8A A;  4GNX C;  4ZCK A;  1D5X C;  2PZU A;  2VQE L;  1QUQ A;  5H1S E;  1WCM B;  4UDU C;  2CCZ A;  4DR2 Q;  1STA A;  2NVT H;  1NE3 A;  1SAP A;  2JJQ A;  2JP1 A;  3MXG A;  3F8T A;  2J4X A;  1E0B A;  2A74 C;  4DR6 L;  4NXM L;  4P71 A;  4CDC C;  4R4C A;  2RSO A;  1LTG D;  1SEB D;  4FF2 A;  4JOI A;  2NTT A;  1B9M A;  4QIW B;  3TRE A;  2IX1 A;  2F0G A;  3FKI B;  3D0F A;  1U4R A;  1YJW A;  5J22 A;  4POF A;  4JI4 Q;  4RKB A;  3RD4 A;  1WI5 A;  3NEM A;  1WTX A;  2NWG A;  2MO1 A;  2WII B;  5AFW A;  2BDN A;  4YIJ A;  1VQ4 A;  5JEA G;  1PRT C;  1I50 H;  4RA8 A;  4JI8 Q;  1H9M A;  4RKL A;  4K6D A;  1EYG A;  2L15 A;  1MSG A;  1T9H A;  4GN4 B;  4PZ7 A;  3HP3 A;  4HJA A;  2A69 C;  3GTP H;  1KNE A;  3KUP A;  1MI2 A;  2JSO A;  4Q0F A;  3G48 A;  2L11 A;  5FLX c;  4DU9 A;  1A3V A;  2E2H B;  4XYQ A;  1C7Y A;  5KNC A;  4DR2 L;  2R93 B;  4A3B G;  4R4O A;  4IFD J;  4FNF A;  5D65 A;  4A3D H;  3S1N B;  3I2Z A;  2G9H D;  1VQH A;  4WJW A;  2MP1 A;  1PFM A;  4C3J B;  3ONA B;  5C4Z A;  3STB C;  4A3D B;  4XQJ A;  1FJG Q;  2ZT9 C;  1QIL A;  1EQQ A;  2ASB A;  5CV5 A;  1E3P A;  5EJW A;  3CPF A;  5J1Z A;  4RGT A;  5C5L A;  2B2V C;  4A3J B;  4FXD A;  4Z9C B;  1SN8 A;  4KTA A;  1ENA A;  3A5U A;  1TR5 A;  2EY6 A;  3K5O A;  4YHH Q;  3S2H B;  2YU9 B;  1GUO A;  4KY7 A;  1HJP A;  3W1B A;  3GTK B;  4OXP A;  2CW0 C;  1X3E A;  2C9O A;  1A15 A;  4C3J H;  1SFO H;  3C3L A;  3FMC A;  1AEX A;  3DHQ A;  2E2D C;  5JAV A;  4CDF C;  3HOW H;  2B2T A;  1V1Q A;  3S17 B;  1SFO B;  4B3S Q;  3GTO H;  2A68 D;  2MUY A;  5AJ3 Q;  4GZY C;  2KHS A;  3QWN A;  2JA5 B;  4H7B A;  2XRS D;  3G6J B;  5BR8 L;  5C4X B;  4LF6 L;  2GA4 B;  4HMI A;  3I70 A;  2WP8 J;  5HUR A;  4JBM A;  2D62 A;  1KRT A;  2B63 G;  2MNA A;  3GTP B;  3DMU A;  2PNR C;  3OPO A;  3JAM i;  2PI2 E;  2E2I H;  1VQC A;  3TN2 A;  1EOT A;  2HDM A;  2B8F A;  2IL8 A;  4A3L H;  4DN4 M;  4HN7 A;  4ZKC B;  5M3F G;  3GTG B;  3W1G A;  2IHE A;  5BN5 A;  4RAU C;  5IYC H;  3TP8 A;  4OGQ C;  1J8I A;  3HOU H;  4ZKB B;  4N8X 1;  2Q2I A;  4LF8 Q;  1VQJ A;  1X3P A;  2FFK B;  3BDO A;  3FEW X;  3VDY A;  4DK0 A;  4IUV A;  1N33 L;  2CQO A;  2LXK A;  3G71 A;  1GD7 A;  1ZXT A;  3U9S A;  2F0W A;  4NP5 A;  5ELC A;  3IL8 A;  2OCE A;  1ZKO A;  4RHR A;  3TEH B;  4JC0 A;  3OWF A;  1HNX Q;  1NR2 A;  2FHT A;  4X65 Q;  2B2W A;  2I5L X;  5M5W H;  1Z47 A;  2VZA A;  1VF7 A;  3EVQ A;  5CV9 A;  3BYT B;  4DV0 L;  1VF5 C;  3ER0 A;  3DWA A;  4I7Z C;  4J6H A;  4LFA L;  3N6R A;  1TWF B;  3SHL A;  3PIP A;  1Q82 C;  1SND A;  1Q90 A;  3CCJ A;  1NMG A;  1VQN A;  1EL0 A;  1TY0 A;  4GKJ L;  3UE1 A;  3PUY A;  3NXW A;  2QF7 A;  3C1E A;  3Q24 A;  4HJ7 A;  1AP0 A;  1LM0 A;  1JIC A;  3I4M H;  3ND8 A;  1RTO A;  1TWG H;  3LGJ A;  2MPM A;  3KJO A;  1R4P B;  3G7L A;  5IGB A;  3GTQ H;  4BWG B;  4BXX H;  3A54 A;  3CXC A;  2IW3 A;  2X69 A;  1L1O B;  1JB7 A;  2PQA A;  1QVF A;  4YWK A;  1GXD C;  2AQ2 B;  5F2D A;  5M5X H;  5C0X G;  2H1E A;  3S9W A;  2DGY A;  4FP5 D;  1TT2 A;  3OMC A;  4RMF A;  2OWO A;  3S15 B;  2F0F A;  4JYA L;  4JOI C;  4RFB A;  1Y1W H;  5EKK A;  2F0N A;  4UP8 A;  5M3F H;  5IWA L;  4OEL B;  5E1F A;  2RBM A;  4HMJ A;  2KVM A;  1CK1 A;  3NBH B;  1JJ2 A;  3I4N H;  2PMZ B;  2XIW A;  1RF2 D;  3MXP A;  1CT1 D;  1G29 1;  4KV6 A;  1J6Q A;  4OL7 A;  3GTM B;  4PQX A;  4ALP A;  1DD2 A;  3U9O A;  3PO2 G;  1CHP D;  5C4X G;  4LF4 L;  2CWP A;  4KKT A;  2K03 A;  3GDE A;  2XWJ B;  4JBJ A;  4L63 B;  1HA6 A;  3PO3 B;  1IBL L;  1YJN A;  2L1B A;  1E7Z A;  4IAL A;  1O80 A;  1J9O A;  2VNU D;  1B2T A;  1I4X A;  3I55 A;  5JPN C;  2PPB C;  4A3C G;  3GTL B;  1II3 A;  3VR3 A;  1AE3 A;  4DR7 Q;  2EYF A;  4C3H B;  4KD3 A;  1B4O A;  2VXW A;  5LMU Q;  3J7A F;  4DNT B;  5BN4 A;  4LF5 Q;  1UE6 A;  1TWC H;  1QNU A;  4OX9 L;  4DR4 L;  2JA7 H;  1PTO B;  1VQI A;  3RZD H;  3FP9 A;  3MFG A;  2VQF L;  3ZJY C;  1I6H B;  4DV7 Q;  2UXC Q;  4DK1 A;  1F9Q A;  3IFT A;  3S16 H;  5EGT A;  3H94 A;  1G51 A;  4IUP A;  5IP7 G;  4CDE C;  1SYG A;  4LJZ C;  1T5X D;  1Y69 U;  4C3H H;  3QOL A;  1IBK L;  4DV2 L;  1BNZ A;  3M4O B;  4O2D A;  3S1M H;  4BY7 G;  2E8G A;  2F0H A;  5CV8 A;  4YHH L;  1EYA A;  4GKJ Q;  2H5X A;  4B9X A;  4X6A H;  4G57 A;  2NZ1 D;  3K5M A;  1NSN S;  3FPU B;  3S16 B;  3E9I A;  4BY1 H;  1XTC D;  4P2C B;  4GN5 A;  1LAB A;  3PUV A;  4K5W A;  4A3F B;  2ZXP A;  3UE0 A;  1Q8I A;  3NSW A;  3L2P A;  2JA5 G;  1YI2 A;  1GUN A;  3SR1 A;  2Y0S B;  4DGZ A;  4DKA C;  2WB1 G;  3GV3 A;  5IP7 H;  1EWI A;  4FF3 A;  3HEJ A;  3I4L A;  1QCB D;  3D4W A;  5JEA H;  1Q3L A;  2F4I A;  3KLS X;  2BE5 D;  2DNC A;  2K75 A;  2L5T A;  2IX0 A;  3GD7 A;  1XNQ L;  1I3Q B;  4LF9 Q;  1YZ6 A;  1I6H H;  2A19 A;  3HKZ E;  2F3W A;  2JA7 G;  4OEM B;  3I7F A;  3F2D A;  1X55 A;  1YNN D;  2KA7 A;  4KMU C;  5GQO A;  3GTO B;  4K2L A;  4CJ1 B;  1QUQ B;  3W2D A;  3SVM A;  5A2Q L;  2EDG A;  2NVQ B;  4GNX A;  3I90 A;  2RHS B;  2VUM B;  4QQB X;  2IWH A;  1HZB A;  4X3K A;  3T1Y Q;  1X3Q A;  1DON A;  1CSP A;  2EOT A;  5LMN L;  1VMC A;  2RF4 A;  3TS2 A;  4C3H G;  1N33 Q;  5FLM H;  1B1Z A;  1XMO Q;  1S5E D;  1Q86 C;  3ERS X;  1NUC A;  1NCV A;  4KN4 C;  1KDB A;  2I5H A;  1JC7 A;  4V0B A;  3PUW A;  4CGY B;  2N78 A;  3S1N H;  4NMZ A;  3TS0 A;  1EWC A;  3WWV A;  4JG2 A;  3KLR A;  1S5F D;  3KDF A;  5IWA Q;  3DEP A;  4LWC A;  2QA4 A;  1C48 A;  2K7V A;  3BS1 A;  3NHH A;  2B2U C;  2QGQ A;  2PZW A;  2CHB D;  3RLN A;  4G7Z C;  1R9T H;  1G6Z A;  4A3C H;  2ZJQ A;  4JPB W;  3J7A V;  1LUZ A;  4A3I G;  2F4V Q;  4MHE A;  3RR5 A;  1G2T A;  3FVQ A;  5LMN W;  2SNM A;  1KXL A;  4DUY L;  1DOM A;  3CCM A;  2CWA A;  3PUZ A;  4BXX G;  1TWC B;  1VQK A;  4DUZ L;  1RKN A;  3S1R B;  4XIG S;  1MHW C;  4IUN A;  5LL6 X;  5C4J H;  1PVO A;  4OX9 Q;  3QO2 A;  1D6E C;  1L1O C;  3GTQ B;  4NPS A;  1LYL A;  2Q8I B;  4AQY Q;  2YTV A;  3T1H L;  1W3S A;  2N88 A;  4EX5 A;  1MKH A;  2DY8 A;  1VQ8 A;  3GP7 A;  3T56 B;  1ZYR C;  3CKI B;  1S5B D;  4DK3 C;  1BBU A;  5IGF A;  3PO3 H;  4ULL A;  3FKI H; 
#chains in the Genus database with same CATH homology
 1PH3 A;  2UUB L;  3PCO B;  1NY4 A;  1IYJ B;  4KI0 A;  3PF5 A;  1XNQ Q;  2NVT H;  3RZO H;  1NE3 A;  3W5O A;  4AIM A;  2JJQ A;  4LFB Q;  1CKM A;  1IBL Q;  1MIU A;  3F8T A;  4B3S L;  2AMC B;  5IE8 A;  4LF9 L;  3CQZ H;  3CP0 A;  1A63 A;  4DR6 L;  1X3F A;  2BA0 A;  3K8A A;  3B6Y A;  4R4T A;  2Z6K C;  3J81 i;  4NXM L;  2D0O A;  1UE1 A;  4P71 A;  4DAY B;  2ZJR A;  1PH9 A;  4IOA A;  4LF7 L;  4R4C A;  1YHQ A;  1GO3 E;  4JI5 L;  1FVI A;  3HOU G;  5BR8 Q;  5IYC G;  1X56 A;  3J7A 5;  4A3G G;  4LFC Q;  2NN6 G;  4JOI A;  4MZ9 A;  1X54 A;  4LFB L;  2JQO A;  2NN6 I;  4RG1 A;  3TRE A;  2Y0S E;  3AYH B;  2IX1 A;  2NZO A;  2OQK A;  1J5E L;  3D0F A;  1YJW A;  4R4Q A;  1PH2 A;  3GTK H;  3J80 c;  4POF A;  3NEN A;  3CME A;  4JI4 Q;  3K7U C;  2HHH L;  1KRS A;  4B3M L;  2HIV A;  1Q1E A;  4IOC A;  1WI5 A;  2YV5 A;  3NEM A;  4LFA Q;  3H0G H;  4JI1 Q;  3J7Z C;  4JI6 Q;  2ALY B;  2MO1 A;  1JMC A;  4A93 H;  4DV1 Q;  1PHJ A;  1VQ4 A;  2R92 G;  3ICE A;  1QZH A;  1Q81 C;  1X6O A;  2B63 H;  5GAG C;  5JEA G;  1I50 H;  2Q2U A;  2Y0S G;  2RHQ B;  1QZG A;  4JI8 Q;  2ES2 A;  4JV5 L;  1K3R A;  4LUV A;  3BU2 A;  3J80 i;  2N49 A;  5JEA J;  1HR0 W;  1IXR A;  4X62 Q;  1EYG A;  2L15 A;  5GAH C;  5AJ3 L;  4Y52 H;  1XPR A;  2WB1 E;  5IT9 c;  1VQ5 A;  1CKN B;  1T9H A;  4UY8 C;  4GN4 B;  2LSS A;  1WOC A;  4PZ7 A;  4HJ8 A;  2R7Z G;  5IP9 G;  2ZTD A;  3F2B A;  4HJA A;  4POG A;  2YYZ A;  3GTP H;  1B7Y B;  1RL2 A;  5M5Y H;  1VQM A;  1KL9 A;  3G48 A;  2XTI A;  4LUZ A;  2UXB Q;  1VQG A;  3T1H Q;  5FLX c;  3JC6 6;  4DR1 L;  4DR7 L;  4GKK Q;  3AFP A;  1TWH H;  5C44 G;  3PSI A;  1C7Y A;  1E1O A;  1K0R A;  3UDX A;  4X64 Q;  4HJ5 A;  2V1C C;  4DR2 L;  3HOZ H;  1CKN A;  5E7N A;  1XMO L;  2E5L Q;  3A5Z B;  4DNI A;  4DR3 Q;  1EIY B;  4R4O A;  4A3B G;  4MTN A;  4IFD J;  4BBR H;  2R93 G;  2OTL A;  1HH2 P;  1P16 A;  2JE6 I;  4A3D H;  3CW2 C;  3I2Z A;  1A62 A;  1VQH A;  2VS1 A;  4LF7 Q;  4KHP L;  4P73 A;  4X66 Q;  3CF5 A;  1HNW L;  3HKZ G;  1N34 Q;  3AEV A;  4JI3 Q;  1U0L A;  4IJH A;  3STB C;  3OTO L;  1GM5 A;  2HQL A;  1FJG Q;  3KJP A;  1EQQ A;  2ASB A;  3S17 H;  1PV4 A;  1XPU A;  2PMZ E;  1VQB A;  1K8A C;  1E3P A;  2GVB A;  1NBW A;  3CPF A;  1HNZ L;  1Q12 A;  4A3E G;  3S1Q H;  2ATW A;  2VUM G;  3KF8 B;  2JA5 H;  4DV3 L;  3K80 C;  4P72 A;  1EFW A;  4A3D G;  3KF6 B;  3OYY A;  4AQY L;  2MQH A;  3UDI A;  1SN8 A;  4YCU A;  3A5U A;  3H3V H;  4YHH Q;  3F1Z A;  3HOW G;  1SRU A;  1XMQ L;  4BY1 G;  2Q2H A;  1HJP A;  3W1B A;  2NVY H;  3M7N A;  2KCM A;  4OXP A;  1X3E A;  4TVA B;  3RNU A;  1E24 A;  2D0P A;  2ID0 A;  3U50 C;  4NXN L;  4C3J H;  4QY7 A;  2UUC Q;  1SFO H;  1Y1V G;  2HIX A;  3TRZ A;  4X62 L;  4WJ4 A;  3HOW H;  4TQU S;  5EAY A;  3PGZ A;  4BY7 H;  1V1Q A;  2UU9 Q;  1FGU A;  2F4V L;  1IBM Q;  3E0E A;  4JCV E;  4UP9 A;  1W2B A;  4B3S Q;  3CCQ A;  2JEA I;  3GTO H;  3KFU A;  5AJ3 Q;  1BKB A;  3RN2 A;  4DUY Q;  5BR8 L;  4LF6 L;  1EIF A;  1PH5 A;  4R4I A;  4LF4 Q;  2WP8 J;  3S14 H;  1A8V A;  4QJF A;  2D62 A;  1KRT A;  4A3K H;  4JBM A;  3FHW A;  4LFC L;  1BVS A;  3Q8D A;  5C4X H;  1K8G A;  2B63 G;  4IPH A;  4MNO A;  2MNA A;  2R92 H;  1C0A A;  1SLJ A;  4DR5 Q;  4JI7 L;  2IT1 A;  3A74 A;  4L5R C;  4C3I H;  3JAM i;  2PI2 E;  1VCI A;  2E2I H;  1D7Q A;  1VQC A;  1WFQ A;  1LTL A;  4R1J A;  1J5E Q;  3CCV A;  4B3R L;  4A3L H;  5JJI A;  2BH8 A;  1VQA A;  1XNR Q;  1SRO A;  5M3F G;  4BA1 I;  3M9B A;  4A76 A;  4LUO A;  3W1G A;  2IHE A;  3G6E A;  1Y1W G;  1OXU A;  4KHZ A;  1IZ6 A;  1TWA H;  1PH7 A;  4JI3 L;  4BA2 I;  5IYC H;  3E9H A;  3CMA A;  2K52 A;  1PFS A;  1XJV A;  3OW2 A;  1VQF A;  3GTG H;  2Q2I A;  4LF8 Q;  1Y14 B;  3HOU H;  4OO1 G;  2UUB Q;  3M85 A;  4JV5 Q;  1VQJ A;  1YHA A;  5LMU L;  2K5V A;  4GOP A;  3VDY A;  4JI0 Q;  1N9W A;  3CD6 A;  1Q1B A;  1N33 L;  1B70 B;  4DV4 Q;  2CQO A;  2LXK A;  3G71 A;  3EBE A;  1GD7 A;  4UP7 A;  1N36 Q;  4QIW E;  2OCE A;  1JJC B;  1WJJ A;  3KOJ A;  3TEH B;  3JAM c;  4JC0 A;  1HNX Q;  1VS0 A;  1KHI A;  3TQY A;  3GO5 A;  2I5L X;  4X65 Q;  3PIO A;  1E22 A;  1XTD A;  1Z47 A;  2VZA A;  5M5W H;  3ULP A;  4A93 G;  4HJ9 A;  4GOP B;  4A4I A;  3I4N G;  2YU9 H;  4GOP C;  4DV0 L;  4A75 A;  2UXB L;  5IYB G;  2JEB I;  3ER0 A;  1PH1 A;  4LFA L;  3PIP A;  1PYS B;  1Q82 C;  3CCJ A;  4DV4 L;  1NMG A;  1N34 L;  4JI4 L;  1IBK Q;  1XPO A;  5IY0 A;  1VQN A;  4GKJ L;  4L5S A;  3K7A H;  3UE1 A;  4X66 L;  1HR0 Q;  3PUY A;  3G4S A;  1CSQ A;  2GVA A;  3ULJ A;  1HNX L;  4DV1 L;  4HJ7 A;  1LM0 A;  4H02 A;  3I4M H;  1TWG H;  3M3Y H;  3LGJ A;  1UEB A;  1FJG L;  1GVP A;  2WAQ E;  1QVC A;  3KJO A;  3GTQ H;  4BXX H;  1AE2 A;  2K5N A;  3CXC A;  1MJE A;  4IO9 A;  1L1O B;  3SGI A;  1JB7 A;  2PQA A;  1QVF A;  4YWK A;  3CPW A;  4DR4 Q;  2AWN A;  1X9N A;  5M5X H;  1YIJ A;  1IL2 A;  3AFQ A;  4O0A A;  1SR3 A;  5C0X G;  1UE7 A;  1RIP A;  2DGY A;  3PF4 A;  1I5F A;  1UE5 A;  3S24 A;  2CFM A;  1XNR L;  1S40 A;  4RMF A;  4K0K Q;  2OWO A;  4JYA L;  4IJL A;  4JOI C;  1X65 A;  4DK6 C;  3PUX A;  1Y1W H;  4UP8 A;  5M3F H;  3H3V I;  2IY5 B;  4JI2 L;  2KHJ A;  1A0I A;  4IPC A;  2MO0 A;  5J3B A;  4YY3 Q;  5IWA L;  1PA6 A;  2UUA Q;  2HHH Q;  4B3M Q;  1DGS A;  2A8V A;  3NBH B;  4JBW A;  2Z6K A;  1JJ2 A;  4DV2 Q;  2N3S A;  3I4N H;  3CC2 A;  4JI1 L;  4UPA A;  5GRO A;  2YTY A;  1G29 1;  2BH2 A;  4IFD G;  1M1K C;  2OTJ A;  1J6Q A;  4ALP A;  1HNZ Q;  3PO2 G;  4AH6 A;  1PYB A;  5C4X G;  4LF4 L;  2CWP A;  4WJ3 M;  3GDE A;  1OXV A;  1N36 L;  5C3E G;  5ELN A;  5HY6 A;  5JJK A;  4IPG A;  4A3K G;  4JBJ A;  3S2D H;  1KD1 C;  3KF6 A;  2VL6 A;  1SE8 A;  1D8L A;  1IBL L;  3RLF A;  1YJN A;  1E7Z A;  1FL0 A;  4LW1 A;  3I56 A;  4GN3 B;  5DLQ E;  3AQQ A;  3CCS A;  1G6P A;  3HOY H;  4DV5 L;  4DR6 Q;  2VNU D;  3DLL A;  3I55 A;  3CC4 A;  1TXY A;  1N8R C;  4DPG A;  1OXS C;  5C0X I;  2VQF Q;  1I94 L;  2B29 A;  1KC8 C;  1KAW A;  4APV A;  1L1O A;  5FJ8 G;  4A3J G;  4A3C G;  1PH6 A;  2ZJP A;  4GLX A;  3M4P A;  4GNX B;  1Y1V H;  1AE3 A;  4DR7 Q;  2N8N A;  3K81 C;  2DUD A;  2K50 A;  4LNQ A;  1SMX A;  4J15 A;  2NZH A;  5LMU Q;  5ELO A;  4FDB A;  3J81 j;  2B3G A;  5K36 G;  3H15 A;  1UE6 A;  1TWC H;  1YVC A;  4PG3 A;  4LF5 Q;  4A3L G;  4OX9 L;  2JA8 G;  4DR4 L;  2JA7 H;  1VQI A;  1YNX A;  3RZD H;  3D31 A;  2K4K A;  3FP9 A;  2R7D A;  2VQF L;  2VUM H;  3ZJY C;  4JI6 L;  2ZM6 L;  4DV7 Q;  1YJ9 A;  2R7F A;  4A3E H;  2UXC Q;  3MEF A;  1JE5 A;  3S16 H;  1JT8 A;  5M3M H;  1G51 A;  5C0X J;  1JJG A;  3EN2 A;  2MFI A;  4YCV A;  5IP7 G;  4BBS G;  4B3T Q;  4HID A;  4K0K L;  3CCR A;  5FLM G;  2F52 A;  3L7Z C;  1EQR A;  4JYA Q;  3HOX H;  1WCM H;  4C3H H;  1Q7Y C;  4DAM A;  3BZK A;  1IBK L;  2K5H A;  4DV2 L;  2AKW B;  2GN5 A;  4HIO A;  1B8A A;  2R93 H;  1OTC A;  3KDF B;  4L5Q A;  4O2D A;  4YY3 L;  2C35 B;  2BA1 A;  2E8G A;  4YHH L;  3J81 c;  4JI5 Q;  1K83 H;  3S1M H;  1Z9F A;  4BY7 G;  2PI2 A;  4GLV B;  1EUJ A;  1NJI C;  1ASY A;  3HOZ G;  4PZ6 A;  1NTG A;  4PZ8 A;  4IFD I;  4GKJ Q;  2H5X A;  2K14 A;  2UXC L;  4DR1 Q;  4P74 A;  4X6A H;  2AWO A;  2JA6 H;  5IYD H;  4AYB G;  5C44 H;  2UUC L;  4NXN Q;  3M4Q A;  1PH8 A;  2JA9 A;  1YBY A;  3E9I A;  3IRB A;  2I0Q A;  4A3F G;  3RN5 A;  1K73 C;  4B3T L;  1P8L A;  4GN5 A;  1VQ7 A;  4BY1 H;  2LXJ A;  2EIF A;  2UU9 L;  1OXX K;  3PUV A;  2E2J H;  1IBM L;  3UE0 A;  5GAD C;  3L2P A;  2JA5 G;  3CC7 A;  3RLO A;  3MXN B;  1WCM G;  4OON A;  4DKA C;  1YI2 A;  4KHP Q;  1PH4 A;  2QEX A;  2WB1 G;  4X65 L;  4BBS H;  2RCN A;  5IP7 H;  4OO1 I;  1EWI A;  1VQD A;  1VQO A;  1KQS A;  3KYH C;  4NB3 A;  2R6G A;  2F3I A;  4DV0 Q;  5M3M G;  1AH9 A;  1X3G A;  2K75 A;  2IX0 A;  3GD7 A;  1S72 A;  1XNQ L;  3STB D;  4LF9 Q;  3T1Y L;  1YZ6 A;  3CCL A;  2WFW A;  2UUA L;  1C9O A;  2A19 A;  3HKZ E;  5HGQ A;  4DV3 Q;  1I6H H;  2I5M X;  1L2F A;  2JA7 G;  4BBR G;  2JA8 H;  4YCW A;  4A3B H;  3I7F A;  2VW9 A;  3F2D A;  1N32 Q;  1X55 A;  4OWW B;  4A3F H;  4AYB E;  5GQO A;  3CCE A;  2EQS A;  3CAM A;  3UDG A;  4GKK L;  1O7I A;  3BJU A;  1TWF H;  1QUQ B;  5IYD G;  2JA6 G;  1OXT A;  3S2H H;  4QGU A;  3U58 A;  3NEL A;  2YTX A;  4IPD A;  3U4V A;  4DUZ Q;  2UXD Q;  1VQE A;  3CCU A;  4A3G H;  4GNX A;  3GTJ H;  2HT1 A;  2RHS B;  4LF8 L;  1S3O A;  4DV6 L;  1KIX A;  4DR3 L;  4QQB X;  4GLA C;  2OQ0 A;  2VY3 A;  1HZB A;  3T1Y Q;  5IP9 H;  1CKO A;  2R7Z H;  2FXQ A;  4DV5 Q;  1CSP A;  3KLW A;  5LMN L;  2RF4 A;  3TS2 A;  2VQE Q;  3A0J A;  3HOY G;  3HOX G;  1I3Q H;  1V43 A;  5FLM H;  1Q46 A;  1XMO Q;  1QVG A;  2E5L L;  2NVX H;  1N33 Q;  1Q86 C;  4GS3 A;  2AHO B;  1V9P A;  3ERS X;  1BBW A;  2I5H A;  2KCT A;  2ZTC A;  3PUW A;  1NMF A;  1HNW Q;  1UWV A;  4OWX B;  4JI8 L;  3HFZ B;  2KEN A;  2N78 A;  3PO2 H;  3S1N H;  2KBN A;  2WAQ G;  3M4O H;  4YWM A;  4XTC S;  3HKS A;  4DR5 L;  3TS0 A;  4JI7 Q;  1L0W A;  1K9M C;  3H0G G;  4L5T A;  3GTM H;  3L0O A;  1CUK A;  3WWV A;  1GKH A;  1YHB A;  4JG2 A;  5LMN Q;  1YIT A;  3K0X A;  3S15 H;  4JI2 Q;  3KDF A;  5IWA Q;  4LWC A;  4P75 A;  1HZC A;  1MJC A;  1WYD A;  4B3R Q;  2ZM6 Q;  4DV7 L;  5JJL A;  1YEZ A;  2QA4 A;  1VQP A;  2Z0S A;  4NXM Q;  3ULL A;  1VQ6 A;  4C2M H;  2IHF A;  4ME3 A;  2QGQ A;  3RLN A;  1R9T H;  1M90 C;  4A3J H;  5FJ8 H;  1EOV A;  2JK8 A;  4X64 L;  3F2C A;  2ZJQ A;  4A3C H;  1LUZ A;  4A3I G;  2F4V Q;  2PNH A;  1Q8K A;  4PMW A;  1I94 Q;  4JI0 L;  3RR5 A;  2A1A A;  3HOV G;  5LMN W;  4Y7N H;  3PV0 A;  1KXL A;  3HOV H;  4DUY L;  3S1R H;  3UDF A;  4HIK A;  3CCM A;  2CWA A;  3PUZ A;  3EIV A;  4JBK A;  5C3E H;  4BXX G;  4OWT B;  4A3I H;  1VQK A;  1N32 L;  4DUZ L;  3FKI G;  3DM3 A;  4HIM A;  3I4M G;  3PO3 G;  4EQ5 A;  3BZC A;  3OTO Q;  4A3M G;  4XIG S;  4LF6 Q;  4DV6 Q;  2CKZ B;  2Q2T A;  3I4O A;  4QL5 A;  5C4J H;  2KHI A;  2XGT A;  4OX9 Q;  1PVO A;  1HZA A;  2ZTE A;  3GTL H;  2UXD L;  1H95 A;  2PQA B;  1HZ9 A;  1VQ9 A;  1E1T A;  1L1O C;  4YWL A;  1VQL A;  2EXD A;  4LF5 L;  2E2H H;  4NPS A;  5GAE C;  1U5K A;  4GNX C;  1LYL A;  5IYB H;  4AQY Q;  2YTV A;  3T1H L;  1XMQ Q;  2NVQ H;  1W3S A;  4EX5 A;  2VQE L;  1MKH A;  1QUQ A;  1HR0 L;  1VQ8 A;  5H1S E;  4KLK A;  3U4Z A;  4A3M H;  4DK3 C;  1BBU A;  2CCZ A;  1ASZ A;  3PO3 H;  4DR2 Q;  3FKI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...