4A3LH

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lH00
3CCSA 3RLOA 3G48A 3M4QA 1KRSA 4MNOA 4UP7A 1Y1WG 2I0QA 4QIWE 4A3LG 1WJJA 3E9IA 1QVGA 1PH2A 5IYBH 1CSPA 3BJUA 1IBLL 1KXLA 3T1YQ 4BY7G 3KOJA 1QZGA 2JJQA 5IYCH 4A75A 1VQ6A 3KF6B 4KHZA 4UP9A 4DK3C 4DV3Q 1X9NA 1FVIA 4BBRH 3MEFA 4C3IH 2OTLA 2YU9H 2R92G 3G4SA 5H1SE 2K4KA 5IWAL 3GDEA 1PH3A 2AWOA 1GO3E 2CCZA 3UDFA 2VY3A 3PCOB 4R4IA 1KAWA 4JBJA 2E5LL 1Z9FA 4RMFA 2K5NA 1SLJA 1YIJA 1Y1WH 1KIXA 4GLXA 1PH8A 4A3LH 2CWPA 2ZM6L 2EIFA 1PYBA 2N49A 2V1CC 1YHQA 2L15A 2UXBQ 4LF4L 4LFCQ 2HQLA 1VQ7A 2UXCQ 4JI7Q 4OWWB 3M7NA 3KF8B 4IPHA 4YWMA 5M5XH 3DLLA 4HJAA 2JK8A 2VS1A 1Q81C 4YCVA 1VQOA 3RLNA 3OYYA 4DR5L 2R92H 2LXJA 1Q8KA 4DUZL 3HOXG 4JBMA 3TQYA 2ASBA 3S1NH 5JJIA 3Q8DA 4A3MG 4JI8L 4YY3L 1Q46A 2I5HA 1EIFA 4NXNL 5JJKA 3ERSX 4P73A 1JT8A 1X3FA 4GNXC 1L1OC 3J7ZC 4YCUA 1S72A 2KHJA 4YHHL 3NBHB 1GM5A 2UU9L 4JG2A 1EOVA 3KF6A 4IPGA 1OXVA 2JQOA 4C2MH 1XMQL 4YCWA 4JI3Q 2RHQB 4YWLA 4DK6C 5C4XG 1G51A 4UY8C 2NVTH 3J81j 3ICEA 2D62A 3PO3G 4JI1Q 1WYDA 2KENA 4AYBE 1EIYB 2HIXA 5GADC 3TEHB 4DV1Q 1WFQA 3IRBA 1MKHA 1HNWL 4PZ6A 1MIUA 3WWVA 1IZ6A 4DV0Q 1XPOA 4LF4Q 5C44G 5FLMG 5GAHC 4HJ9A 4A3MH 1VQ8A 4Y7NH 1NMFA 1K8AC 1VQCA 4DV7L 2A8VA 4XTCS 4HJ7A 1EQQA 4JI6Q 1RL2A 4DR2L 2AHOB 4LUOA 2D0OA 3KDFA 4LUVA 4X66Q 1HJPA 5C4XH 3KFUA 1AE2A 1ASYA 1IL2A 2B29A 3PO2G 3PO3H 4YY3Q 1VQGA 2K5HA 3M3YH 3JC66 1SE8A 3STBD 3K0XA 3GTMH 3A0JA 1GVPA 4JOIC 4A3JG 5C44H 2ZJQA 2DGYA 4YHHQ 2UU9Q 4NXML 2CFMA 1LYLA 4JC0A 1EQRA 1VCIA 2AWNA 1U5KA 3EBEA 5M3FG 1M90C 2UXDL 4DAMA 2B63G 2Q2IA 3S2HH 2IX0A 2Z0SA 1WI5A 1I6HH 4X62L 4LF7L 1QVFA 4QY7A 4LWCA 4AH6A 4IFDJ 1VQBA 2NVYH 1VQPA 4L5QA 1VQ9A 2F4VQ 1K0RA 1N32L 3T1HL 4P74A 4A3EG 3S17H 5IE8A 4JBWA 1VQ5A 1YBYA 4DR3L 5LMNL 2HHHL 1S40A 1HZAA 5M3FH 4AYBG 1UE6A 3AYHB 4A93G 1B8AA 3U58A 2B63H 1KQSA 4OX9L 3AQQA 5DLQE 2Y0SG 4JI5L 3M4OH 4IPCA 3W1GA 1NMGA 3OW2A 1OXXK 3GTKH 2IHEA 3CW2C 5C0XI 1V1QA 3M9BA 2FXQA 1LUZA 1GD7A 4DNIA 3HOZG 4IFDI 2VZAA 4DR7L 4TVAB 2N78A 3B6YA 3ZJYC 1QZHA 1QUQB 1E1OA 5IP7G 5M5WH 1I3QH 1HNXL 2Q2UA 2F52A 1D7QA 1B70B 4LF6L 3KLWA 1TWAH 3FKIG 5AJ3L 4B3ML 4A93H 4LF7Q 3HOYG 3HOVG 2OQ0A 1SFOH 3CAMA 4PG3A 4OO1I 4B3SQ 2C35B 2VQEL 3NENA 5K36G 2CWAA 3CXCA 2Q2HA 2A19A 3T1HQ 2WFWA 3OTOQ 4A3KG 1N32Q 4Y52H 4DR3Q 1TXYA 2HHHQ 3HOZH 4LNQA 4GS3A 3PUXA 2I5LX 3STBC 5FJ8H 2IX1A 3K7UC 5IP7H 3A5UA 2XTIA 4DV4L 4JI2Q 1VQJA 1XPUA 2PNHA 1Q12A 3FKIH 2MO0A 2VQFQ 1I94L 4L5TA 3HOVH 3HOYH 3ULPA 3U4VA 4DR6L 1R9TH 3W1BA 2QA4A 3I4NG 1XMOQ 4JYAQ 2IHFA 2PQAB 5BR8L 2JA8G 5EAYA 4A3KH 1HZCA 1FJGQ 4A3BG 2ZTEA 4ME3A 4LFBQ 2NZOA 3BZCA 1HNXQ 4XIGS 3RN2A 4BY7H 3A74A 1IBMQ 2JE6I 1PV4A 4B3MQ 3ULJA 1PH7A 1QUQA 4DV5Q 3CCQA 4JI0Q 4B3RL 3BZKA 5C3EG 4DR1Q 1NJIC 1BBWA 1OXUA 5HGQA 3I56A 4HIMA 3L7ZC 1CKNB 2GN5A 3CMEA 1LTLA 4IO9A 1LM0A 3CPWA 4DR4L 4J15A 1IBLQ 4OONA 4L5RC 1SRUA 1KRTA 2JA8H 3CCJA 2JA9A 2K50A 4P75A 4EQ5A 4A3BH 1X56A 1X6OA 5IYDG 2Q2TA 1E3PA 2VW9A 4POGA 3S1MH 3LGJA 1PH9A 5IWAQ 2PMZE 1PH4A 1XNRL 1Y1VG 3S1QH 3I2ZA 1YHAA 1IBKL 2E5LQ 1N33L 2PI2A 4A3IG 3HOXH 4A76A 4GKKL 3PIPA 4IJLA 4LF8L 2VNUD 1BVSA 2NN6G 3D0FA 2ZM6Q 4UPAA 3PF4A 2UUCL 4NPSA 4LF9L 2Y0SE 1E24A 2PQAA 3L0OA 3PUWA 4X65L 4GOPC 2YTYA 1HNZL 3PUVA 4POFA 1K9MC 2ATWA 3UDGA 4DR5Q 5IYDH 5J3BA 3CMAA 2ZJRA 2R7DA 1L0WA 5JEAG 4B3TL 1NBWA 4DUZQ 2WB1E 4WJ4A 2YTVA 2I5MX 3NELA 3BU2A 2BA0A 2QEXA 3CCVA 1PHJA 2ALYB 4WJ3M 2CQOA 2KHIA 3FHWA 4JI4L 1CKNA 4JI8Q 4A3IH 3F2BA 3M85A 1YEZA 2K5VA 4NXNQ 1AE3A 4GKJL 5JJLA 2WAQE 3F2DA 1Q7YC 3UE0A 1IYJB 1C7YA 4A3CG 4AIMA 5FLMH 1WCMG 1PYSB 5M5YH 3AEVA 1XMQQ 5GAEC 2K52A 1JJ2A 4YWKA 2B3GA 5LMUL 1X3GA 4LFAL 2MNAA 1AH9A 1JB7A 4GNXB 1N33Q 1L1OB 4GKKQ 4DV2L 4LF8Q 4PMWA 4A3DG 3S14H 1HNWQ 4A4IA 1A0IA 4LF9Q 4X65Q 3PO2H 3UDXA 4GN4B 1P8LA 1EYGA 1E1TA 1OXSC 1VQMA 2E2JH 3TS0A 4X64L 1I50H 4DV7Q 4A3CH 4A3JH 1HR0W 4B3TQ 1WCMH 4BBSG 1A63A 4OXPA 4DAYB 3S24A 4DR2Q 4GOPB 2F3IA 1XJVA 1X3EA 2GVBA 2N3SA 1VQAA 4DR1L 5C0XG 3RNUA 3G6EA 2E2HH 1IXRA 1J6QA 4A3DH 1PH1A 2GVAA 2YTXA 1OTCA 2MFIA 2JA7G 4NXMQ 2EQSA 2EXDA 2KCMA 5IY0A 1A62A 1Q1EA 3I7FA 3RZOH 4QQBX 1JE5A 1N8RC 2ZTDA 2UXDQ 3H0GG 2JA6G 2WB1G 4BBSH 1BKBA 3M4PA 4IOCA 4A3EH 1SMXA 2IY5B 4KHPL 3CC4A 1G6PA 1ASZA 1EWIA 4OO1G 4IJHA 4K0KL 3T1YL 2YYZA 4X62Q 1UWVA 1XTDA 4GNXA 3J7A5 1L1OA 1CKOA 1TWGH 1J5EL 2R93G 1C0AA 3J80c 4DV3L 2WAQG 4A3FG 1NE3A 4DPGA 2WP8J 3CCLA 4MZ9A 1A8VA 4UP8A 2RCNA 3CQZH 3D31A 3FP9A 1K3RA 3GO5A 3KYHC 2DUDA 3ULLA 4LW1A 2JA7H 3PUYA 2ZJPA 1SROA 3E0EA 5LMNQ 3H3VH 1DGSA 1VQDA 1EUJA 3E9HA 5HY6A 3H0GH 5C4JH 2JA6H 3MXNB 1VQNA 2ES2A 2Z6KA 3GD7A 1O7IA 4OX9Q 2UXBL 4JI5Q 4LFCL 4BBRG 3HOWG 1D8LA 3GTGH 2UUBL 2UXCL 4JI7L 4BA2I 2R93H 2OWOA 4A3FH 1VQFA 2R6GA 2XGTA 4PZ8A 1GKHA 3U50C 4DR7Q 1BBUA 1T9HA 2N8NA 3PUZA 2H5XA 1KD1C 3TS2A 1YVCA 3JAMc 4PZ7A 1XNQL 2K14A 3CCRA 3CF5A 4KHPQ 3CCEA 2AMCB 1MJEA 3K80C 4LF6Q 2K75A 5AJ3Q 4K0KQ 3CCMA 4JOIA 3CC7A 1J5EQ 1E7ZA 1X54A 2R7FA 2MO1A 4FDBA 3J81c 3HOWH 5ELOA 1M1KC 2KBNA 1L2FA 1P16A 1X55A 2VQEQ 3VDYA 2HT1A 1NY4A 2QGQA 4AQYL 2VUMG 2VL6A 1MJCA 5IT9c 4HIKA 2NVXH 1PFSA 2BA1A 4JI3L 4HJ8A 3I4NH 2AKWB 4R4OA 4X6AH 4LUZA 3GTPH 3EIVA 4HIOA 4JI1L 2UUAL 1V9PA 4KI0A 4H02A 1KL9A 2ZTCA 3PSIA 1TWHH 4DV1L 4GN5A 4DV4Q 1UE7A 4DV0L 4DKAC 5ELNA 1I5FA 2UUBQ 4HIDA 1JJGA 2RF4A 1I94Q 5GROA 3RZDH 4DR6Q 5C3EH 4BA1I 3HKZG 1VQHA 4JI6L 2IT1A 3KDFB 1H95A 3EN2A 4QJFA 2VUMH 5BR8Q 4A3GG 4APVA 4HJ5A 3S15H 4TQUS 1SR3A 1UE1A 3K81C 4X66L 3J80i 1XNQQ 5E7NA 1EFWA 1RIPA 5IP9G 4MTNA 3TREA 3GTLH 1S3OA 1Z47A 3CPFA 1VQIA 3NEMA 4R1JA 1N34L 2JA5G 3I4MG 1HH2P 3HKSA 4B3RQ 3L2PA 4KLKA 2E8GA 1Q86C 3AFPA 5JEAJ 2YV5A 4AQYQ 1JMCA 4L5SA 4BXXG 4OWXB 1OXTA 1Y1VH 4DR4Q 2OCEA 1HR0L 2KCTA 1Q82C 3RN5A 4A3GH 2UUAQ 2CKZB 4RG1A 1TWCH 4O2DA 1HZ9A 3I4OA 2BH2A 1B7YB 2Z6KC 5IP9H 2E2IH 4EX5A 4JCVE 2NN6I 2JA5H 1PA6A 4GLAC 1X65A 1V43A 3GTQH 3I4MH 2JEAI 1XNRQ 1YJWA 3A5ZB 3JAMi 2F4VL 2OTJA 3ER0A 1Q1BA 1VS0A 1IBKQ 4QGUA 1VQLA 3I55A 4BXXH 4DV6L 1PVOA 2A1AA 2ID0A 1PH5A 2UUCQ 1CUKA 1HNZQ 3J81i 1YITA 4P72A 1N34Q 2MQHA 3PGZA 2D0PA 3GTOH 1QVCA 3KJOA 3K8AA 5M3MG 2R7ZG 4JBKA 4QL5A 2BH8A 2NVQH 1NTGA 3CD6A 1JJCB 3F8TA 3H15A 4DUYL 5GQOA 2PI2E 1XPRA 3UE1A 4LF5L 1N9WA 3RR5A 3K7AH 1KHIA 1HR0Q 3G71A 4JI4Q 4R4CA 1W3SA 1K83H 2NZHA 4JV5L 3HFZB 1U0LA 1YI2A 4BY1G 3CC2A 4GKJQ 1YJNA 5C0XJ 4IOAA 3TRZA 4IPDA 4IFDG 3KJPA 3AFQA 4C3JH 1C9OA 1N36L 1K73C 1KC8C 1WOCA 4B3SL 4GLVB 4JI0L 3F1ZA 4R4QA 3S16H 1E22A 5LMUQ 5M3MH 4LFAQ 2R7ZH 1YZ6A 2HIVA 3U4ZA 2JEBI 3PF5A 3OTOL 4DV2Q 3W5OA 1PH6A 1VQEA 4O0AA 4P71A 4DV6Q 1K8GA 1W2BA 1VQ4A 3F2CA 1VQKA 3UDIA 2LXKA 3GTJH 4BY1H 4JI2L 3HOUG 4X64Q 3CCUA 3HKZE 3CP0A 2VQFL 1SN8A 4GN3B 5FLXc 1CSQA 2RHSB 1UE5A 4DUYQ 1HZBA 4LF5Q 1XMOL 1UEBA 4JYAL 5IYBG 1TWFH 3PIOA 5IYCG 3DM3A 1FL0A 3RLFA 5FJ8G 4R4TA 4ALPA 1YJ9A 1YNXA 4GOPA 1FJGL 3H3VI 4OWTB 3S2DH 4JV5Q 4LFBL 5GAGC 1YHBA 2LSSA 1G291 1IBML 3PV0A 1CKMA 4DV5L 1N36Q 1Y14B 4NB3A 4C3HH 3HOUH 2OQKA 5LMNW 3S1RH 3SGIA 1FGUA
chains in the Genus database with same CATH superfamily
3CCSA 1MBYA 3RLOA 3V2TA 3G48A 1XTCD 4UP7A 5D65A 4BBRB 1PH2A 1CSPA 3BJUA 1KXLA 1SE2A 3TDQA 3KOJA 4J1MA 2QILA 3S9WA 3KF6B 4KHZA 4DV3Q 2YU9H 2FMCA 1C8CA 4JPBW 1Y1WB 1PMRA 5HGTA 2I46A 1TWHB 5IWAL 2LY7A 5A2QL 1Z9FA 2ZM6L 2EIFA 1PYBA 2N49A 2VUMB 2UXCQ 4JI7Q 3BVZA 3S15B 3KBXA 4YWMA 1S4ZA 2VS1A 2A69C 4DR5L 4ILWA 1D6EC 5NUCA 4DUZL 5AFWA 5KNBA 3K59A 4JBMA 5ELFA 2F1MA 2JYOA 5JJIA 2B8GA 4JI8L 4A3MG 1Q46A 2F0TA 2CHBD 4P73A 3OIPA 4IALA 1KLGD 1JOQA 5C6AA 1EY4A 1GM5A 1BF4A 4JG2A 3MVVA 1MHWC 3PQIA 2RHQB 2O2LD 3J7AV 3FEWX 4LMQD 4UY8C 1HRJA 2RCFA 4KKUA 4N9PA 2Z9HA 4Y7NB 1WFQA 5JAVA 1HPCA 1HNWL 4DV0Q 2OT2A 4CDEC 5FLMG 1NMFA 1IHZA 1K8AC 3AU7A 4HJ7A 1CA5A 3SE0A 2AUKA 3KF8A 2FHTA 5D14A 4DR2L 1PFBA 5C4XH 3KFUA 1ASYA 2B29A 3PO2G 3PO3H 3HS0C 4YY3Q 2QCPX 1V1PA 3K7AB 4V0BA 3GTMH 1EOTA 1GVPA 3LX0A 2L0CA 4NXML 1K83B 2UU9Q 4EVOA 2CFMA 1HTPA 2M00A 2AWNA 1JOKA 1TS4A 5CV9A 2EY6A 2Q2IA 3J80L 3A56A 3TP7A 1HXYD 1I6HH 1GUGA 1E2WA 3UI2A 1TT2A 2L9HA 3FPUB 5JPMC 3S17B 1M8AA 4FF2A 4IFDJ 5EKIA 1VQBA 2K7VA 1Q90A 1SJED 3H09A 3C46A 2F4VQ 1RTNA 1K0RA 1RJTA 3EVQA 3KLSA 3T1HL 4B9XA 4C56C 4A3EG 4JBWA 1YBYA 3MZ5A 5M3FH 4AYBG 3U58A 2B63H 4OX9L 3AQQA 5DLQE 4JI5L 2SDFA 3M4OH 3W1GA 5HURA 1TWFB 3CW2C 5J39A 3GTKH 1V1QA 3VA7A 4R8IA 3M9BA 1GD7A 4DNIA 3HOZG 1G6ZA 1TWAB 2N78A 4XYQA 3FDTA 3S1RB 2Q2UA 2F52A 1F77A 4B3ML 1JR0D 4TRDA 4LF7Q 2PZTA 4PG3A 4B3SQ 1PRTC 1KNAA 2VQEL 4O42A 2EYHA 2CWAA 2Q2HA 1NR4A 4CDDC 4DR3Q 1TXYA 2HHHQ 3BDLA 4LNQA 4DV4L 3A5UA 5KNDA 1RCVD 1Q12A 1S5CD 1LTRD 3DEPA 1V8QA 3U4VA 3I4NG 3ND8A 2IHFA 1JQYD 3K58A 1UAPA 5A2QE 4RAUC 5K36H 2B2UA 4A3BG 4ME3A 3A8JE 3RN2A 3R93A 1PV4A 1PH7A 1EWCA 1QUQA 4DV5Q 2H1EA 2Z6BA 3S1NB 1OXUA 4HIMA 1GUTA 3L7ZC 2B2YA 1QCBD 2GN5A 1XWEA 3CMEA 1GUSA 4IO9A 4IUVA 1AW7A 3S1MB 2L12A 2JA8H 2JA9A 1X56A 1E3PA 2AQ1B 1K8OA 1U4MA 2SOBA 1QWYA 1PH9A 5IWAQ 1H9JA 1PH4A 4M8AA 4Q0FA 3MWYW 5DNFA 4X3UA 3SK8A 3I2ZA 1EU3A 1JORA 4A3MB 3OWFA 3CHBD 1IBKL 4GKKL 1STNA 2B2VA 4IJLA 2VNUD 1A2TA 1U4PA 2ZM6Q 2Y0SE 1PZJD 1TKWB 4NKLA 2EOTA 2K6AA 4DK1A 1F2ZA 5IODA 2BCOA 1K9MC 3TN2A 4DR5Q 5IYDH 5J3BA 2ZJRA 1B4OA 1F9QA 1ESFA 1NBWA 2F0UA 4DUZQ 3M3YB 3I72A 4WJ4A 3NELA 3DWQA 3BU2A 3CCVA 2Z8LA 2ALYB 2KHIA 4JI4L 1CKNA 4JI8Q 2NN6H 1CI3M 2WAQE 1Q7YC 4A3CG 1B9MA 1WCMG 2F4IA 2F0SA 5M5YH 3AEVA 3S2HB 2KEEA 3AB9A 1KDBA 2MNAA 5I2XA 3PO2B 2M2LA 1KLUD 3PIO3 1K3BC 3VYRA 3J80E 4RCNA 1HNWQ 2SNSA 5CYUA 1A0IA 2ICIA 3UDXA 2E2JH 2J4XA 2ENBA 1A63A 4A3JH 4B3TQ 1RTOA 1XYIA 1UUPA 4DR2Q 4TSSA 1QB5D 2F3IA 1TU2B 4RKBA 1E2VA 1X3EA 5IOCA 3A7AB 3G6EA 1IXRA 2F0IA 5ELBA 2YTXA 3KLRA 4RHSA 4NXMQ 2EXDA 4A3EB 1A62A 1Q1EA 1W6JA 3RZOH 1GUNA 2I07B 4AYBB 2JA6G 1STHA 2WB1G 3X3MA 1EY9A 1SAPA 1TWGB 3QIAA 4GNXA 3J7A5 5C0XH 3J80c 4DPGA 2WP8J 3HOZB 5C4JB 3CQZH 3D31A 2FMMA 3FP9A 3ULLA 1CHQD 3LNNA 2ZT9C 1TS2A 1WVLA 3H3VH 2ICEC 1EUJA 3E9HA 4KJNA 1B44D 3MXNB 1VQNA 2Z6KA 3GD7A 4DAYA 4R9WA 4HSPA 4IUNA 4OX9Q 4S3SA 4JI5Q 3HOWG 3OSOA 2UUBL 2OEOA 3A55A 1FR3A 2TMPA 3MXPA 1CZGA 3EFXD 1GKHA 4DK0A 1CA6A 5EJWA 1T9HA 4WJ3M 1NAPA 4PZ7A 1XNQL 5EPLA 3CCEA 2AMCB 1MJEA 3K80C 4K0KQ 4JOIA 1SEBD 1SNMA 3I4NB 5ELOA 1M1KC 2IX1A 2VQEQ 3T56B 1HA6A 2HT1A 4UDUC 4AQYL 4A3BB 4HIKA 2WKCA 4JI3L 1JOOA 1MSGA 1O7ZA 4R4OA 2SEBD 2KJXA 2RSOA 4QUFA 4H02A 4DV4Q 4DKAC 4HIDA 3MXGA 1LTTD 1VQHA 3HKZG 2IT1A 4QJFA 4A3GG 3SK4A 2JN4A 1SR3A 1WTWA 1RIPA 5IP9G 4DXGA 3A8IE 2KCCA 3CPFA 1VQIA 4R1JA 1N34L 2JA5G 1FNWA 1BNZA 2DNEA 3DHQA 1JMCA 3MHBA 1OXTA 3C3LA 1QG7A 2OCEA 5I2YA 2CW0C 1Q8IA 3RN5A 2MHVA 3TP6A 2UUAQ 4KN4C 1F2LA 1QNUA 2BH2A 2E2IH 1WTRA 1DJRD 1X65A 3GTQH 3S14B 3IKJA 1B50A 2CH4W 1II3A 3ER0A 1VS0A 1IBKQ 4QGUA 2ZXPA 4E6IA 1VQLA 3GTOB 4BXXH 4DV6L 4NP5A 1I50B 2A1AA 2B2UC 2C5CA 1WCMB 3J81i 1QVCA 2R7ZG 2NVQH 2E2HB 3CD6A 3F8TA 3H15A 4LF5L 2D9UA 1HR0Q 4JI4Q 1W3SA 3CRKC 3QR8A 5IGDA 3CC2A 1YJNA 1PDQA 4DU9A 5C0XJ 1SNQA 4GLVB 4XT3B 2HD3A 3CKIB 3HZXA 3PF5A 1Z6HA 2EJMA 3HRZC 3OTOL 3GP7A 1T5XD 2B2VC 1ET9A 1VQ4A 1VQKA 3WOFA 3UDIA 3SR1A 5IT9E 1NCVA 4BY1H 3L3OC 5CORA 2JA6B 2K28A 2RHSB 1HCZA 1UE5A 4HMIA 1XMOL 4HCEA 3RLFA 1FL0A 1YJ9A 4R4TA 4ALPA 1FJGL 4JV5Q 5KYLA 3HOUB 2CH4A 4LFBL 4C3IG 1IBML 3DXJC 1L0XB 2D5DA 2ZXRA 1N36Q 1F9SA 1Y14B 2KQ3A 4NB3A 4C3HH 1EIHA 4ZUJA 2Z1CA 4JI0Q 4I7AA 1WTVA 3M4QA 4MNOA 1Y1WG 5CBAE 2I0QA 3HEJA 1WJJA 3HOWB 2YU9B 2KUMA 4F8MA 1Q3LA 1EIGA 1EY8A 1QZGA 2JJQA 4A75A 4RGTA 2NVXB 3K0YA 2B8FA 2OTLA 2R92G 1FYCA 3G4SA 1HUNA 1I4PA 4K6DA 1IL8A 1GO3E 2F0EA 3UDFA 2MGSA 2VY3A 3SEBA 4R4IA 3WOEA 1BQQT 1YIJA 4A3LH 2CWPA 1TR5A 2EY5A 4OWWB 3KF8B 5M5XH 3DLLA 1DCZA 5FO8B 2JK8A 2RDGA 4RHRA 1GXDC 3WDNA 4ODGA 3BYTB 4KN7C 3GTLB 1JC7A 1SE4A 4YY3L 4ABNA 2I5HA 4EQPA 5I4DA 1JT8A 3HKZB 4GNXC 1AEXA 4A3GB 2UU9L 3DEOA 4KD4A 4IPGA 4C2MH 2JQOA 1XMQL 4JI3Q 5CBEE 5K5PA 1F9RA 1G51A 1PTOD 2PO4A 2D62A 1WYDA 4DNTB 2JA5B 4OIKA 3TEHB 4RGOS 2OXPA 3W2DA 4PV1C 1XPOA 1VQ8A 1R4QB 2LMCB 5E3FA 4FXDA 5EKKA 2A8VA 4RH6A 2KVMA 3HP3A 3MTSA 4GZYC 1RL2A 2PZUA 4RGNA 3OOCA 2D0OA 2DY8A 3D6CA 1HJPA 3GTMB 1CQFA 1H9KA 3A0JA 4JOIC 4A3JG 5C44H 1ML0D 2ZJQA 5EPJA 1BDOA 1EQRA 1M90C 2UXDL 3H3VC 2F0MA 1EEFD 5DM63 3S16B 2Z0SA 2R7ZB 1WI5A 4X62L 4LF7L 4FF4A 3RD4A 3R8BA 4AH6A 1PZKD 2NVYH 5D3DA 2E2DC 1SE3A 1VQPA 4OL7A 4FF3A 1VQ9A 3K5NA 1KDCA 2EY2A 1GUWA 3K57A 1JICA 1VQ5A 4DR3L 5LMNL 2HHHL 3C1EA 1S40A 1SDFA 5I9OA 4PNYA 3GTKB 4CGYB 1J9OA 3OIQA 3R3OA 1I4GA 1STGA 2Y0SG 1Y8PB 3VR5A 1NMGA 1OXXK 2A6HD 5C0XI 2PW5A 4KK7A 4DA2A 3S2DB 3JAML 2VZAA 4DR7L 5LL6X 1V1OA 4BS9A 1QUQB 1E1OA 1I3QH 2A68D 1B70B 2NTSA 1GJXA 3FKIG 5AJ3L 4DFAA 3I90A 4A93H 3ERQA 2OQ0A 4H44C 3CAMA 1SFOH 4OO1I 4PMCA 1F2YA 4KV6A 3D4RA 2A19A 4RKLA 2WFWA 2RVLA 5EKLA 3OTOQ 2LS01 4A3KG 1ET6A 4C3IB 4KD3A 4JK1C 5DM73 4GS3A 2DNCA 2I5LX 1D1IA 2EXZA 3K7UC 4CKBA 2XTIA 5IP7H 1VQJA 2XWJB 3G7LA 4EQOA 3SDZA 4L5TA 3I70A 3HOVH 3HOYH 1EU4A 5CV6A 1R9TH 3W1BA 2EE1A 2QA4A 1XMOQ 5BR8L 4JVZA 5EAYA 1FJGQ 1H9RA 4LFBQ 5ELEA 2NZOA 2R92B 1HNXQ 1IBMQ 4ZAIA 2JE6I 3BZKA 1I4QA 1NJIC 3I56A 1CKNB 5I6WA 1LTLA 3CPWA 2F0KA 4J15A 1ESRA 1YNJD 1KRTA 4H13C 4EQ5A 4P75A 1LT3D 3IL8A 2F0GA 4POGA 3MA2B 3LGJA 5KGUA 1FGBD 1G2TA 4X3SA 3S1QH 3U9OA 2PI2A 1BOSA 5LL6S 1BR9A 4UPAA 2UUCL 2PQAA 1HNZL 2YTYA 2QDLA 3PUVA 4POFA 5IIFA 3CMAA 2R7DA 4B3TL 4EGVA 3K5MA 5DEHA 5FO7B 3ND9A 4ZLTF 4KKTA 4A3IH 1YEZA 2K5VA 1A3VA 4FXGC 5EGTA 2VB2X 3FMCA 1WTPA 2K32A 1PYSB 1XMQQ 5GAEC 2K52A 1JJ2A 4YWKA 5LMUL 1X3GA 5JEAH 1AH9A 1JB7A 4UHVA 4GNXB 5KYIA 1N33Q 3BZDB 2DJFC 4IZ8A 4A4IA 4LF9Q 1LACA 4A3JB 1OXSC 5IGGA 1NSNS 3BDOA 4G7ZC 4YIJA 1EY0A 4KTAA 1LV9A 4DAYB 3S24A 4K5XA 3D6WA 2JSOA 4DGZA 2XSCA 2CVRA 1SYDA 3RZOB 1PFNA 1J6QA 4A3DH 3MFGA 2JA7G 1H9MA 2EYMA 1PTOC 2K01A 5M5WB 1JE5A 1N8RC 2BDNA 1MSHA 2ZTDA 3H0GG 2UXDQ 4BBSH 3M4PA 4IOCA 5EBDA 1SMXA 3K5OA 2Y0SB 1ASZA 1C48A 4IJHA 4K0KL 3T1YL 4X62Q 1XTDA 1CKOA 2AQ3B 2PZWA 1C0AA 4PQXA 1NE3A 3CCLA 2VB3X 3ITPA 1BBXC 4UP8A 2RCNA 4R8NA 3X3NA 1Y8OB 2PYKA 4NDXA 3E0EA 5LMNQ 1VQDA 3FKIB 2WV6D 2E74C 2CW0D 1BO0A 4LFCL 2R93H 3QB3A 4A3KB 2OWOA 2D2CC 5EPKA 4MN3A 1VQFA 4XQNA 4A3FH 2XGTA 2A74C 4DR7Q 4CBVA 3BS1A 4ZCKA 1AP0A 2N8NA 2V4DA 3JAMc 4KHPQ 2K14A 1BUVT 5AJ3Q 3CCMA 2IWHA 1E7ZA 1X54A 2R7FA 2MO1A 5EQ0A 1CFMA 1S5FD 4CJ1B 1X55A 1P16A 2DJGC 3EJIA 5BN3A 2QGQA 4KMUC 1ICWA 5T1IA 4HJ8A 1RDPD 2AKWB 1ZYRD 4LUZA 2UUAL 2ZTCA 3LWUA 2A6HC 3PSIA 1IKLA 1TWHH 2EYLA 3C1FA 3H94A 1JJGA 1S5ED 1O7YA 1JCKB 1EFID 5CV7A 2VUMH 3VR2A 5BR8Q 2A68C 4HJ5A 1LT6D 3S15H 4HTHA 3K81C 4X66L 3TREA 4H7BA 4K8IA 3I4MG 3L2PA 4OIJA 4KLKA 1Q86C 3NQTA 2K1BA 3R2TA 5JEAJ 4L5SA 1LTGD 1Y1VH 1HR0L 2KCTA 1Q82C 1E0BA 3ZYYX 5IGFA 1PXUA 1SMYD 4EX5A 1PA6A 4ZK9B 2MPMA 1Q1BA 3I55A 4TKOB 5JVG3 2UUCQ 1PH5A 1CUKA 1EEID 1HNZQ 1YITA 4C3JG 4P72A 4K2LA 3BYYB 2MQHA 4IQZA 1VDZA 4JW0A 3GV3A 4ID6A 5M3MG 1HTLD 4JBKA 3EA6A 1W6KA 1NTGA 4HAEA 1YNJC 5LHY1 1XPRA 2E75C 3K7AH 1QOHA 3G71A 4R4CA 1K83H 4JV5L 3HFZB 4NW2A 1SJHD 4IFDG 3KJPA 1N36L 2XRSD 4JI0L 3F1ZA 4R4QA 5LMUQ 5FKAC 1YZ6A 4ZYSA 2Z4HA 5C3XA 1STYA 3W5OA 4K2KA 1JWUD 4Q5VA 1VQEA 1HQRD 3P7JA 4O0AA 1K8GA 1W2BA 2JA7B 4FNFA 4RA8A 3F2CA 3NWTA 3HOUG 4JI2L 2PNRC 4ZQ3A 3H0GB 1LTID 1TS5A 3A7LA 3DWPA 1HZBA 1UEBA 3NQIA 4CHTB 3GTGB 1CK1A 1PZID 4JYAL 1AFPA 3F2UA 1TWFH 4LK1C 5BN5A 1QE6A 1YNXA 2H4OA 4OO1H 3QG1A 1YHBA 1RF2D 1G291 2AQ2B 1LT4D 1CHPD 1I6VC 4XXEA 4XQJA 1CTMA 3S1RH 3SGIA 4XQQA 1ILQA 3P1HA 4QIWE 4F7XA 1QVGA 1PTOB 5IYBH 3T1YQ 3GQBA 5IYCH 1VQ6A 1CQVA 4UP9A 4DK3C 1X9NA 3MEFA 3GTPB 5H1SE 3K6OA 1PH3A 2AWOA 5CC4A 1I4HA 5ISRA 4GLXA 2N88A 3R2IA 3RZDB 4IUTA 2V1CC 1YHQA 5DAUA 1EQTA 2RKSA 4LFCQ 2HQLA 5I9PA 3M7NA 4IPHA 1Q81C 1VQOA 3RLNA 5T1GA 3NBIA 4K14A 4X3TA 3Q0AA 1WD1A 3NPPA 2ASBA 3S1NH 3P75A 1EYDA 3D3RA 2B39A 4NXNL 4C2MB 1GOZA 3ERSX 4OELB 1X3FA 2F03A 3J7ZC 4YCUA 1S72A 2HDMA 2KHJA 3Q24A 1EOVA 4OHJA 3NSWA 1OXVA 1TWCB 4YWLA 2BOSA 2L5TA 5C4XG 1TY0A 2NVTH 3ICEA 2F0WA 3PO3G 4AYBE 3I4MB 2HIXA 5GADC 5KIXA 3GV6A 1MKHA 4PZ6A 3WWVA 3OMGA 1IZ6A 1SYGA 4LF4Q 4HJ9A 4A3MH 4K8JA 5GAHC 1H9SB 3PMFA 4IUQA 1C4QA 1VQCA 1EQQA 1A2UA 4U68A 2AHOB 2EPBA 1D1KA 4KY7A 4LUOA 4X66Q 3SK6A 1IL2A 1KTKA 1VQGA 2K5HA 3M3YH 5COYA 3V05A 1IKMA 2PPBC 1KDAA 4YHHQ 4DAVA 2J7ZA 1ZYRC 1LYLA 1SNOA 1DM0B 5M3FG 3D4WA 3NBHA 4C3JB 2B63G 3NP8A 2NVYB 3S2HH 5M3MB 4UAIA 1QVFA 4QUCA 4DN4M 1AZPA 3MAQA 3HG9A 4HEDA 4FXKC 2KA7A 1HZAA 2K5QA 3OW7A 3AYHB 1B8AA 2NBFA 2RBMA 2O5IC 3TP5A 3OW2A 1SXTA 2IHEA 4DXFA 2QEJC 1DONA 4LJZC 1STBA 4N8FA 4TVAB 2FJ2A 1SFOB 1SMYC 1HNXL 1F2MA 4LF6L 3KLWA 3J81L 3E5SA 2HDLA 3MFYA 5ELDA 3VR4A 3BVMA 3VYUA 1I4XA 2AUJD 2C35B 3V96A 5K36G 1N32Q 5KNCA 3HOZH 4IURA 3STBC 1IYVA 3HOVB 4N8X1 1O7LA 3D8GA 3NE5B 4JI2Q 3QJYA 1MI2A 2XRQD 5J22A 1I94L 1LT5D 2FFKB 2LKVA 2DN8A 1B1ZA 4DR6L 4JYAQ 1R4PB 2PQAB 5C4HA 2JA8G 3A54A 3T16A 5CV8A 2F0VA 1J8IA 4BY7H 3A74A 3ULJA 2IPKD 3CCQA 4B3RL 1BBWA 5HGQA 2RDFA 3KBGA 3TZDA 4I7ZC 2PW7A 4DF7A 4DR4L 4L5RC 1SRUA 5D3IB 1X3QA 5TSSA 4A3BH 5IYDG 2BE5D 3S1QB 1JB3A 1MGSA 3VA5A 2EJGC 2IX3A 2K04A 2PMZE 1XNRL 1Y1VG 1YHAA 1N33L 3HOXH 1BCPB 2IW3A 3PIPA 1O78A 3L9AX 2NN6G 1KAAA 1VF5C 3D0FA 3C2PA 1TQOA 1KABA 1JE4A 1E24A 1EWHA 1TY2A 2JP1A 4NPSA 4LF9L 4MHEA 4L63B 3T4AC 1JWMD 1YNND 3UDGA 5C4XB 1L0WA 2NWGA 3PO3B 2WB1E 4CDFC 3G6JB 3VR6A 1PHJA 2CQOA 3J7AF 3QOLA 3FHWA 3F2BA 4NXNQ 4GKJL 3F2DA 1E2ZA 4AIMA 5CMDA 1SBBB 2KECA 4XDXA 2HQEA 1XXGA 1GHKA 2B3GA 1RHPA 1I6HB 4ME5A 4LFAL 1NUCA 2C9OA 1U9RA 4DV2L 4LF8Q 4ZKCB 4CDCC 3S14H 4X65Q 2SNMA 1PTOF 2XN9C 1HFNA 1TIID 3O13A 4NMZA 1EYGA 1VQMA 1I50H 4OEMB 3TP8A 5M3FB 1WD0A 1SNCA 1X3PA 3RUZA 4A3CH 1WCMH 1H9SA 2B63B 3NTHA 4GOPB 3M4OB 1XJVA 2EJFC 2GVBA 1SYBA 2E2HH 5C0XG 2K33A 1FNVA 4L6TB 3NHHA 2GVAA 1OTCA 2MFIA 1ICFB 2EQSA 1VMPA 4QQBX 3N6RA 2EYPA 1BKBA 3OWEB 2L4NA 2IY5B 4KHPL 3CC4A 3T13A 1G6PA 3RMHA 4OO1G 2YYZA 1B9NA 1UWVA 3J81E 1L1OA 2WAQG 4K6LA 2WIIB 1EQVA 3NTKA 4Z9CB 1K3RA 1K0SA 2DUDA 3PUYA 1SROA 3TBIB 1LABA 1DGSA 2JA6H 2ES2A 1QNKA 2PCFB 4A3FB 2UXBL 4N9TA 1D8LA 1LTAD 1UNSA 4BA2I 1A6XA 4WRDA 5EBCA 1K28A 2R6GA 1BBUA 1ENFA 2CQAA 5IGEA 1KD1C 1YVCA 1Y69U 5FO9B 3CCRA 4G7OC 4LF6Q 3Q6SA 5G3LD 1J5EQ 2G5DA 2XNAC 4FDBA 3FVQA 3J81c 3HOWH 1HHVA 2KBNA 3VDYA 2JA8B 1NY4A 1MJCA 2NVXH 3IAYA 1PFSA 2BA1A 2GA4B 4JI1L 1V9PA 2O4XA 1KL9A 4B9WA 1EYAA 4DV1L 3MXUA 2QF7A 2RDHA 5ELNA 1O80A 2RF4A 3OPOA 1I94Q 2JXMB 4IUPA 4DR6Q 5C3EH 4BA1I 2F0FA 4JI6L 3KDFB 3SVMA 4APVA 4TQUS 1UE1A 3J80i 2EVBA 5E7NA 1EY5A 3GTLH 4KKSA 1FNUA 1Z7TA 1ENAA 4B3RQ 1Y1VB 3DM1A 2E8GA 1UEAB 2X6GA 2YV5A 4BXXG 4OWXB 4ZRZA 1HUMA 5G3LF 4DR4Q 1JWSD 4DNRB 2XVSA 4ZKBB 4A3GH 5M5YB 4RG1A 1EYCA 5IP9H 3NTIA 1RD9D 2K05A 4JCVE 2JA5H 4GLAC 1V43A 2O5JC 3E6ZX 1XNRQ 2JEAI 1WTHA 1RODA 3A5ZB 5BN4A 1D2BA 2E2JB 2F0HA 2IL8A 1SSOA 3N52A 5C5LA 3PGZA 2D0PA 1LTSD 4QCLA 3Q22A 3H6MA 4QL5A 2RA4A 2BH8A 5E1FA 1BCPD 4C1NI 5GQOA 1N9WA 1STEA 3RR5A 1KHIA 2OF1A 5F2DA 1EY6A 2BE5C 3QOJA 4BY1G 4GKJQ 1G91A 3AFQA 4QF4A 2R61A 3TMEA 1GHJA 1ONLA 1KC8C 3CU7A 3S16H 1QJOA 1E22A 5JPNC 3JAME 2R7ZH 4LFAQ 2HIVA 4QB4A 3U4ZA 2JEBI 4XYOA 4DV2Q 1PH6A 3URYA 4P71A 3CQZB 1YNNC 2B2WC 5M9OA 1SYEA 2QDBA 1A3TA 4C3HG 3GTJH 2EZVA 3CCUA 4DAPA 2VQFL 1PYWD 4KY6A 5J1ZA 2FINB 4GN3B 1DOKA 4DUYQ 3DM3A 1D5XC 2WAQB 4GOPA 3S2DH 1BCPF 2QW7A 3DMUA 5GAGC 2LSSA 1L0YB 3PV0A 1CKMA 3BVGA 2P5ZX 1SYFA 2F0PA 4RFBA 5LMNW 4DR1L 2X6LA 3M4YA 3IFTA 1KRSA 3TZUA 4A3LG 3PIP3 3E9IA 1IBLL 3Q23A 5C3WA 4BY7G 1BXTA 1FVIA 1D5ZC 4BBRH 4C3IH 1LTBD 2K4KA 3GDEA 2N55A 2CCZA 3PCOB 4CKCA 1KAWA 2QKIC 4JBJA 2E5LL 4RMFA 2K5NA 1SLJA 1B3AA 1Y1WH 3E3XA 1KIXA 1PH8A 4ZUIA 2B2TC 2UXBQ 2L15A 4LF4L 1VQ7A 2NZ1D 3MC0B 4HJAA 4YCVA 5FK9C 3OYYA 2R92H 1IYUA 2LXJA 2VXWA 1Q8KA 2MP1A 1ZEQX 3HOXG 5A35A 3TQYA 1PFMA 3Q8DA 1A15A 4G7HC 1EIFA 5JJKA 1T5EA 2L1BA 1L1OC 2EYOA 2NVTB 4YHHL 3NBHB 2A73B 3KF6A 4YCWA 3NXWA 4DK6C 2E2IB 3J81j 4JI1Q 2KENA 1EIYB 3NK9A 3GTQB 2MJ8A 4DV1Q 2HCCA 3IRBA 1MIUA 2A6ED 5C44G 4HN7A 1IW7D 4Y7NH 4HCSA 4QMGA 4DV7L 4XTCS 4JI6Q 1B2TA 1TS3A 4QIWB 5KRUA 5I6YA 4I65A 3KDFA 4J6HA 4LUVA 1EZ6A 1AE2A 2NVQB 2K5WA 2IJ0A 1B53A 5C5MA 3JC66 1SE8A 3STBD 3K0XA 4CJ0B 1G8ZD 2DGYA 1FD7D 4O1NA 4JC0A 1VCIA 3EBEA 1U5KA 4DAMA 4PMBA 2IX0A 4WJWA 4QY7A 3I8ZA 4LWCA 2NUCA 4L5QA 1AN8A 3FPPA 2F3VA 4FF1A 1S5DD 1N32L 4P74A 3S17H 5IE8A 4BY1B 3BDCA 1UE6A 4HR7B 4A93G 1LO5D 4CKEA 3VYSA 1KQSA 3J7YW 3QWNA 4IPCA 4C1NK 2KCNA 3IFDA 2FXQA 1LUZA 3U9SA 4IFDI 4MTKA 3B6YA 3ZJYC 1QZHA 5E4WC 4C3HB 5M5WH 5IP7G 3E0JA 2G9HD 1D7QA 1AZQA 4WORA 1TWAH 2WINB 2Q8IB 2HCIA 3HOYG 3HOVG 5IT9L 1G2SA 2KEDA 2F0LA 5CR3A 5IGBA 1ILPA 1CZWA 3NENA 3CXCA 3T1HQ 3A8KE 2NB0A 4Y52H 5CV4A 5CV5A 2F0JA 3NUCA 3VYTA 3PUXA 5FJ8H 4BWGB 3MEHA 4F87A 2L11A 1BCPC 2Z4IA 1XPUA 2PNHA 4HMJA 3FKIH 2MO0A 3I91A 2VQFQ 1DZ1A 2Q8TA 3ULPA 4BY7B 2RQXA 5M5XB 4A3KH 5JOBA 1HZCA 2F0DA 2ZTEA 3BZCA 4XIGS 4B3MQ 5KEEA 3M7GA 3I4LA 4FVMA 5C3EG 1HA5A 4DR1Q 3D4DA 4H0LC 1CM9A 3QO2A 1LM0A 1IBLQ 4OONA 3CCJA 2K50A 1PRTB 4RWSC 1X6OA 2Q2TA 2VW9A 3S1MH 2L55A 3HOXB 4IN3A 2WACA 3OHXC 2E5LQ 2E76C 4A3IG 5C4ZA 4A76A 4LF8L 1BVSA 3PF4A 3PUWA 4X65L 3L0OA 3VR3A 1F9PA 4GOPC 1SNPA 1VMCA 2TSSA 2ATWA 5JEAG 2RSNA 1QILA 2I5MX 2YTVA 1ZXTA 2BA0A 2QEXA 2LFNA 4K5VA 2M9VA 5L37A 1B3QA 5C44B 3M85A 1NR2A 1AE3A 5JJLA 4M1UB 1IYJB 3UE0A 1C7YA 5FLMH 3KK7A 2PQEA 5IGCA 1A3UA 2ZXOA 5JVH3 3CRLC 2EYJA 4FP5D 4G57A 1SNDA 1L1OB 1MD2D 1SYCA 4GKKQ 2HUGA 4PMWA 4A3DG 2F3WA 3KLSX 4KHVA 3PO2H 2XIWA 4GN4B 1P8LA 3T51B 1E1TA 5FLXL 3TS0A 4X64L 4DV7Q 1HR0W 4BBSG 3NWSA 4OXPA 3SXHA 1EZ8A 4KY5A 3K5LA 2B2YC 5JJZA 2G9DA 2N3SA 4EQNA 4ULLA 1I4RA 1VQAA 1ENCA 3RNUA 1DXMA 1U4LA 1PH1A 1NNXA 3W3AA 1VF7A 1LLRD 4F88A 2KOLA 5IY0A 2KCMA 2PMZB 1I3QB 3SHLA 3I7FA 3KUPA 3AMUA 3I73A 2A69D 4A93B 1GUOA 4A3EH 2A6EC 1IW7C 1EWIA 4HSVA 4G4KA 1X32A 2EDGA 2R93G 1J5EL 1TWGH 4DV3L 4A3FG 4MZ9A 1A8VA 3HGBA 2WB1B 2F0NA 1WTXA 3GO5A 3KYHC 2JA7H 4MIUA 3LWEA 4LW1A 4U673 2ZJPA 4KJOA 3DUZA 5HY6A 5C4JH 3H0GH 3HOYB 1O7IA 1R9TB 1RKNA 4BBRG 3GTGH 3EQLC 2UXCL 3BG3A 4JI7L 1EL0A 5CGKA 2F0OA 4PZ8A 3U50C 1D5MC 3TS2A 1EY7A 2H5XA 3PUZA 3CF5A 1DOMA 2K75A 1ZKOA 2X69A 4LAAA 3CC7A 2NTTA 3T53B 1PTOH 1L2FA 1KNEA 2VUMG 2VL6A 4FO2A 5IT9c 3I4NH 4X6AH 3GTPH 3EIVA 4HIOA 5E4XA 4KI0A 4GN5A 5C3EB 1UE7A 4DV0L 3MXNA 1I5FA 2UUBQ 2K5DA 5GROA 3RZDH 1XX8A 1H95A 4RGMA 3EN2A 1S5BD 2B2WA 1V1PB 1XNQQ 1EFWA 2EYFA 4MTNA 3ONAB 1S3OA 1DOLA 1Z47A 3NEMA 1HH2P 3FRPB 4RCOA 3HKSA 3TSSA 4B08A 2MUYA 2WKDA 4L8JA 1WTQA 4A3IB 4V190 3AFPA 4AQYQ 2KHSA 4XT1B 1PLFA 3P20A 2CKZB 5ELCA 2R3ZA 1TWCH 4O2DA 1HZ9A 3I4OA 1B7YB 2Z6KC 2NN6I 3I4MH 4WFN3 2A5HA 1YJWA 2OTJA 3JAMi 2F4VL 2DY7A 2J0TD 1PRTD 1DYQA 1PVOA 2ID0A 3EROA 1N34Q 3GTOH 5FLXE 3KJOA 3K8AA 4OGQC 4CJ2C 1JJCB 4DUYL 2PI2E 4A3DB 3UE1A 1DD2A 1TVXA 4K5WA 2B2TA 3I3CA 2XWBB 2NZHA 1STAA 4J8QA 2BDOA 1U0LA 1YI2A 1HFGA 1U4RA 4IOAA 3TRZA 4BBSB 4IPDA 4C3JH 1C9OA 1K73C 1WOCA 4B3SL 1Y8NB 4X3KA 5M3MH 4P2CB 2NYZD 1M4VA 3GTJB 4DV6Q 3DWAA 2LXKA 4X64Q 1PRTF 1OO9B 3HKZE 3CP0A 1SN8A 4IFDH 5FOBB 5FLXc 1CSQA 4LF5Q 1HQMC 5IYBG 2K03A 2R93B 3SK5A 5IYCG 2EY1A 5FJ8G 3PIOA 4FYDA 3H3VI 2F0QA 4OWTB 2Q8RE 4IUUA 1WTOA 3OMCA 1K8MA 4DV5L 1CT1D 3HOUH 2OQKA 3H91A 1FGUA
chains in the Genus database with same CATH topology
3CCSA 3RLOA 3G48A 3M4QA 1KRSA 4MNOA 4UP7A 1Y1WG 2I0QA 4QIWE 4A3LG 1WJJA 3E9IA 1QVGA 1PH2A 5IYBH 1CSPA 3BJUA 1IBLL 1KXLA 3T1YQ 4BY7G 3KOJA 1QZGA 2JJQA 5IYCH 4A75A 1VQ6A 3KF6B 4KHZA 4UP9A 4DK3C 4DV3Q 1X9NA 1FVIA 4BBRH 3MEFA 4C3IH 2OTLA 2YU9H 2R92G 3G4SA 5H1SE 2K4KA 5IWAL 3GDEA 1PH3A 2AWOA 1GO3E 2CCZA 3UDFA 2VY3A 3PCOB 4R4IA 1KAWA 4JBJA 2E5LL 1Z9FA 4RMFA 2K5NA 1SLJA 1YIJA 1Y1WH 1KIXA 4GLXA 1PH8A 4A3LH 2CWPA 2ZM6L 2EIFA 1PYBA 2N49A 2V1CC 1YHQA 2L15A 2UXBQ 4LF4L 4LFCQ 2HQLA 1VQ7A 2UXCQ 4JI7Q 4OWWB 3M7NA 3KF8B 4IPHA 4YWMA 5M5XH 3DLLA 4HJAA 2JK8A 2VS1A 1Q81C 4YCVA 1VQOA 3RLNA 3OYYA 4DR5L 2R92H 2LXJA 1Q8KA 4DUZL 3HOXG 4JBMA 3TQYA 2ASBA 3S1NH 5JJIA 3Q8DA 4A3MG 4JI8L 4YY3L 1Q46A 2I5HA 1EIFA 4NXNL 5JJKA 3ERSX 4P73A 1JT8A 1X3FA 4GNXC 1L1OC 3J7ZC 4YCUA 1S72A 2KHJA 4YHHL 3NBHB 1GM5A 2UU9L 4JG2A 1EOVA 3KF6A 4IPGA 1OXVA 2JQOA 4C2MH 1XMQL 4YCWA 4JI3Q 2RHQB 4YWLA 4DK6C 5C4XG 1G51A 4UY8C 2NVTH 3J81j 3ICEA 2D62A 3PO3G 4JI1Q 1WYDA 2KENA 4AYBE 1EIYB 2HIXA 5GADC 3TEHB 4DV1Q 1WFQA 3IRBA 1MKHA 1HNWL 4PZ6A 1MIUA 3WWVA 1IZ6A 4DV0Q 1XPOA 4LF4Q 5C44G 5FLMG 5GAHC 4HJ9A 4A3MH 1VQ8A 4Y7NH 1NMFA 1K8AC 1VQCA 4DV7L 2A8VA 4XTCS 4HJ7A 1EQQA 4JI6Q 1RL2A 4DR2L 2AHOB 4LUOA 2D0OA 3KDFA 4LUVA 4X66Q 1HJPA 5C4XH 3KFUA 1AE2A 1ASYA 1IL2A 2B29A 3PO2G 3PO3H 4YY3Q 1VQGA 2K5HA 3M3YH 3JC66 1SE8A 3STBD 3K0XA 3GTMH 3A0JA 1GVPA 4JOIC 4A3JG 5C44H 2ZJQA 2DGYA 4YHHQ 2UU9Q 4NXML 2CFMA 1LYLA 4JC0A 1EQRA 1VCIA 2AWNA 1U5KA 3EBEA 5M3FG 1M90C 2UXDL 4DAMA 2B63G 2Q2IA 3S2HH 2IX0A 2Z0SA 1WI5A 1I6HH 4X62L 4LF7L 1QVFA 4QY7A 4LWCA 4AH6A 4IFDJ 1VQBA 2NVYH 1VQPA 4L5QA 1VQ9A 2F4VQ 1K0RA 1N32L 3T1HL 4P74A 4A3EG 3S17H 5IE8A 4JBWA 1VQ5A 1YBYA 4DR3L 5LMNL 2HHHL 1S40A 1HZAA 5M3FH 4AYBG 1UE6A 3AYHB 4A93G 1B8AA 3U58A 2B63H 1KQSA 4OX9L 3AQQA 5DLQE 2Y0SG 4JI5L 3M4OH 4IPCA 3W1GA 1NMGA 3OW2A 1OXXK 3GTKH 2IHEA 3CW2C 5C0XI 1V1QA 3M9BA 2FXQA 1LUZA 1GD7A 4DNIA 3HOZG 4IFDI 2VZAA 4DR7L 4TVAB 2N78A 3B6YA 3ZJYC 1QZHA 1QUQB 1E1OA 5IP7G 5M5WH 1I3QH 1HNXL 2Q2UA 2F52A 1D7QA 1B70B 4LF6L 3KLWA 1TWAH 3FKIG 5AJ3L 4B3ML 4A93H 4LF7Q 3HOYG 3HOVG 2OQ0A 1SFOH 3CAMA 4PG3A 4OO1I 4B3SQ 2C35B 2VQEL 3NENA 5K36G 2CWAA 3CXCA 2Q2HA 2A19A 3T1HQ 2WFWA 3OTOQ 4A3KG 1N32Q 4Y52H 4DR3Q 1TXYA 2HHHQ 3HOZH 4LNQA 4GS3A 3PUXA 2I5LX 3STBC 5FJ8H 2IX1A 3K7UC 5IP7H 3A5UA 2XTIA 4DV4L 4JI2Q 1VQJA 1XPUA 2PNHA 1Q12A 3FKIH 2MO0A 2VQFQ 1I94L 4L5TA 3HOVH 3HOYH 3ULPA 3U4VA 4DR6L 1R9TH 3W1BA 2QA4A 3I4NG 1XMOQ 4JYAQ 2IHFA 2PQAB 5BR8L 2JA8G 5EAYA 4A3KH 1HZCA 1FJGQ 4A3BG 2ZTEA 4ME3A 4LFBQ 2NZOA 3BZCA 1HNXQ 4XIGS 3RN2A 4BY7H 3A74A 1IBMQ 2JE6I 1PV4A 4B3MQ 3ULJA 1PH7A 1QUQA 4DV5Q 3CCQA 4JI0Q 4B3RL 3BZKA 5C3EG 4DR1Q 1NJIC 1BBWA 1OXUA 5HGQA 3I56A 4HIMA 3L7ZC 1CKNB 2GN5A 3CMEA 1LTLA 4IO9A 1LM0A 3CPWA 4DR4L 4J15A 1IBLQ 4OONA 4L5RC 1SRUA 1KRTA 2JA8H 3CCJA 2JA9A 2K50A 4P75A 4EQ5A 4A3BH 1X56A 1X6OA 5IYDG 2Q2TA 1E3PA 2VW9A 4POGA 3S1MH 3LGJA 1PH9A 5IWAQ 2PMZE 1PH4A 1XNRL 1Y1VG 3S1QH 3I2ZA 1YHAA 1IBKL 2E5LQ 1N33L 2PI2A 4A3IG 3HOXH 4A76A 4GKKL 3PIPA 4IJLA 4LF8L 2VNUD 1BVSA 2NN6G 3D0FA 2ZM6Q 4UPAA 3PF4A 2UUCL 4NPSA 4LF9L 2Y0SE 1E24A 2PQAA 3L0OA 3PUWA 4X65L 4GOPC 2YTYA 1HNZL 3PUVA 4POFA 1K9MC 2ATWA 3UDGA 4DR5Q 5IYDH 5J3BA 3CMAA 2ZJRA 2R7DA 1L0WA 5JEAG 4B3TL 1NBWA 4DUZQ 2WB1E 4WJ4A 2YTVA 2I5MX 3NELA 3BU2A 2BA0A 2QEXA 3CCVA 1PHJA 2ALYB 4WJ3M 2CQOA 2KHIA 3FHWA 4JI4L 1CKNA 4JI8Q 4A3IH 3F2BA 3M85A 1YEZA 2K5VA 4NXNQ 1AE3A 4GKJL 5JJLA 2WAQE 3F2DA 1Q7YC 3UE0A 1IYJB 1C7YA 4A3CG 4AIMA 5FLMH 1WCMG 1PYSB 5M5YH 3AEVA 1XMQQ 5GAEC 2K52A 1JJ2A 4YWKA 2B3GA 5LMUL 1X3GA 4LFAL 2MNAA 1AH9A 1JB7A 4GNXB 1N33Q 1L1OB 4GKKQ 4DV2L 4LF8Q 4PMWA 4A3DG 3S14H 1HNWQ 4A4IA 1A0IA 4LF9Q 4X65Q 3PO2H 3UDXA 4GN4B 1P8LA 1EYGA 1E1TA 1OXSC 1VQMA 2E2JH 3TS0A 4X64L 1I50H 4DV7Q 4A3CH 4A3JH 1HR0W 4B3TQ 1WCMH 4BBSG 1A63A 4OXPA 4DAYB 3S24A 4DR2Q 4GOPB 2F3IA 1XJVA 1X3EA 2GVBA 2N3SA 1VQAA 4DR1L 5C0XG 3RNUA 3G6EA 2E2HH 1IXRA 1J6QA 4A3DH 1PH1A 2GVAA 2YTXA 1OTCA 2MFIA 2JA7G 4NXMQ 2EQSA 2EXDA 2KCMA 5IY0A 1A62A 1Q1EA 3I7FA 3RZOH 4QQBX 1JE5A 1N8RC 2ZTDA 2UXDQ 3H0GG 2JA6G 2WB1G 4BBSH 1BKBA 3M4PA 4IOCA 4A3EH 1SMXA 2IY5B 4KHPL 3CC4A 1G6PA 1ASZA 1EWIA 4OO1G 4IJHA 4K0KL 3T1YL 2YYZA 4X62Q 1UWVA 1XTDA 4GNXA 3J7A5 1L1OA 1CKOA 1TWGH 1J5EL 2R93G 1C0AA 3J80c 4DV3L 2WAQG 4A3FG 1NE3A 4DPGA 2WP8J 3CCLA 4MZ9A 1A8VA 4UP8A 2RCNA 3CQZH 3D31A 3FP9A 1K3RA 3GO5A 3KYHC 2DUDA 3ULLA 4LW1A 2JA7H 3PUYA 2ZJPA 1SROA 3E0EA 5LMNQ 3H3VH 1DGSA 1VQDA 1EUJA 3E9HA 5HY6A 3H0GH 5C4JH 2JA6H 3MXNB 1VQNA 2ES2A 2Z6KA 3GD7A 1O7IA 4OX9Q 2UXBL 4JI5Q 4LFCL 4BBRG 3HOWG 1D8LA 3GTGH 2UUBL 2UXCL 4JI7L 4BA2I 2R93H 2OWOA 4A3FH 1VQFA 2R6GA 2XGTA 4PZ8A 1GKHA 3U50C 4DR7Q 1BBUA 1T9HA 2N8NA 3PUZA 2H5XA 1KD1C 3TS2A 1YVCA 3JAMc 4PZ7A 1XNQL 2K14A 3CCRA 3CF5A 4KHPQ 3CCEA 2AMCB 1MJEA 3K80C 4LF6Q 2K75A 5AJ3Q 4K0KQ 3CCMA 4JOIA 3CC7A 1J5EQ 1E7ZA 1X54A 2R7FA 2MO1A 4FDBA 3J81c 3HOWH 5ELOA 1M1KC 2KBNA 1L2FA 1P16A 1X55A 2VQEQ 3VDYA 2HT1A 1NY4A 2QGQA 4AQYL 2VUMG 2VL6A 1MJCA 5IT9c 4HIKA 2NVXH 1PFSA 2BA1A 4JI3L 4HJ8A 3I4NH 2AKWB 4R4OA 4X6AH 4LUZA 3GTPH 3EIVA 4HIOA 4JI1L 2UUAL 1V9PA 4KI0A 4H02A 1KL9A 2ZTCA 3PSIA 1TWHH 4DV1L 4GN5A 4DV4Q 1UE7A 4DV0L 4DKAC 5ELNA 1I5FA 2UUBQ 4HIDA 1JJGA 2RF4A 1I94Q 5GROA 3RZDH 4DR6Q 5C3EH 4BA1I 3HKZG 1VQHA 4JI6L 2IT1A 3KDFB 1H95A 3EN2A 4QJFA 2VUMH 5BR8Q 4A3GG 4APVA 4HJ5A 3S15H 4TQUS 1SR3A 1UE1A 3K81C 4X66L 3J80i 1XNQQ 5E7NA 1EFWA 1RIPA 5IP9G 4MTNA 3TREA 3GTLH 1S3OA 1Z47A 3CPFA 1VQIA 3NEMA 4R1JA 1N34L 2JA5G 3I4MG 1HH2P 3HKSA 4B3RQ 3L2PA 4KLKA 2E8GA 1Q86C 3AFPA 5JEAJ 2YV5A 4AQYQ 1JMCA 4L5SA 4BXXG 4OWXB 1OXTA 1Y1VH 4DR4Q 2OCEA 1HR0L 2KCTA 1Q82C 3RN5A 4A3GH 2UUAQ 2CKZB 4RG1A 1TWCH 4O2DA 1HZ9A 3I4OA 2BH2A 1B7YB 2Z6KC 5IP9H 2E2IH 4EX5A 4JCVE 2NN6I 2JA5H 1PA6A 4GLAC 1X65A 1V43A 3GTQH 3I4MH 2JEAI 1XNRQ 1YJWA 3A5ZB 3JAMi 2F4VL 2OTJA 3ER0A 1Q1BA 1VS0A 1IBKQ 4QGUA 1VQLA 3I55A 4BXXH 4DV6L 1PVOA 2A1AA 2ID0A 1PH5A 2UUCQ 1CUKA 1HNZQ 3J81i 1YITA 4P72A 1N34Q 2MQHA 3PGZA 2D0PA 3GTOH 1QVCA 3KJOA 3K8AA 5M3MG 2R7ZG 4JBKA 4QL5A 2BH8A 2NVQH 1NTGA 3CD6A 1JJCB 3F8TA 3H15A 4DUYL 5GQOA 2PI2E 1XPRA 3UE1A 4LF5L 1N9WA 3RR5A 3K7AH 1KHIA 1HR0Q 3G71A 4JI4Q 4R4CA 1W3SA 1K83H 2NZHA 4JV5L 3HFZB 1U0LA 1YI2A 4BY1G 3CC2A 4GKJQ 1YJNA 5C0XJ 4IOAA 3TRZA 4IPDA 4IFDG 3KJPA 3AFQA 4C3JH 1C9OA 1N36L 1K73C 1KC8C 1WOCA 4B3SL 4GLVB 4JI0L 3F1ZA 4R4QA 3S16H 1E22A 5LMUQ 5M3MH 4LFAQ 2R7ZH 1YZ6A 2HIVA 3U4ZA 2JEBI 3PF5A 3OTOL 4DV2Q 3W5OA 1PH6A 1VQEA 4O0AA 4P71A 4DV6Q 1K8GA 1W2BA 1VQ4A 3F2CA 1VQKA 3UDIA 2LXKA 3GTJH 4BY1H 4JI2L 3HOUG 4X64Q 3CCUA 3HKZE 3CP0A 2VQFL 1SN8A 4GN3B 5FLXc 1CSQA 2RHSB 1UE5A 4DUYQ 1HZBA 4LF5Q 1XMOL 1UEBA 4JYAL 5IYBG 1TWFH 3PIOA 5IYCG 3DM3A 1FL0A 3RLFA 5FJ8G 4R4TA 4ALPA 1YJ9A 1YNXA 4GOPA 1FJGL 3H3VI 4OWTB 3S2DH 4JV5Q 4LFBL 5GAGC 1YHBA 2LSSA 1G291 1IBML 3PV0A 1CKMA 4DV5L 1N36Q 1Y14B 4NB3A 4C3HH 3HOUH 2OQKA 5LMNW 3S1RH 3SGIA 1FGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS A;  3RLO A;  3G48 A;  3M4Q A;  1KRS A;  4MNO A;  4UP7 A;  1Y1W G;  2I0Q A;  4QIW E;  4A3L G;  1WJJ A;  3E9I A;  1QVG A;  1PH2 A;  5IYB H;  1CSP A;  3BJU A;  1IBL L;  1KXL A;  3T1Y Q;  4BY7 G;  3KOJ A;  1QZG A;  2JJQ A;  5IYC H;  4A75 A;  1VQ6 A;  3KF6 B;  4KHZ A;  4UP9 A;  4DK3 C;  4DV3 Q;  1X9N A;  1FVI A;  4BBR H;  3MEF A;  4C3I H;  2OTL A;  2YU9 H;  2R92 G;  3G4S A;  5H1S E;  2K4K A;  5IWA L;  3GDE A;  1PH3 A;  2AWO A;  1GO3 E;  2CCZ A;  3UDF A;  2VY3 A;  3PCO B;  4R4I A;  1KAW A;  4JBJ A;  2E5L L;  1Z9F A;  4RMF A;  2K5N A;  1SLJ A;  1YIJ A;  1Y1W H;  1KIX A;  4GLX A;  1PH8 A;  4A3L H;  2CWP A;  2ZM6 L;  2EIF A;  1PYB A;  2N49 A;  2V1C C;  1YHQ A;  2L15 A;  2UXB Q;  4LF4 L;  4LFC Q;  2HQL A;  1VQ7 A;  2UXC Q;  4JI7 Q;  4OWW B;  3M7N A;  3KF8 B;  4IPH A;  4YWM A;  5M5X H;  3DLL A;  4HJA A;  2JK8 A;  2VS1 A;  1Q81 C;  4YCV A;  1VQO A;  3RLN A;  3OYY A;  4DR5 L;  2R92 H;  2LXJ A;  1Q8K A;  4DUZ L;  3HOX G;  4JBM A;  3TQY A;  2ASB A;  3S1N H;  5JJI A;  3Q8D A;  4A3M G;  4JI8 L;  4YY3 L;  1Q46 A;  2I5H A;  1EIF A;  4NXN L;  5JJK A;  3ERS X;  4P73 A;  1JT8 A;  1X3F A;  4GNX C;  1L1O C;  3J7Z C;  4YCU A;  1S72 A;  2KHJ A;  4YHH L;  3NBH B;  1GM5 A;  2UU9 L;  4JG2 A;  1EOV A;  3KF6 A;  4IPG A;  1OXV A;  2JQO A;  4C2M H;  1XMQ L;  4YCW A;  4JI3 Q;  2RHQ B;  4YWL A;  4DK6 C;  5C4X G;  1G51 A;  4UY8 C;  2NVT H;  3J81 j;  3ICE A;  2D62 A;  3PO3 G;  4JI1 Q;  1WYD A;  2KEN A;  4AYB E;  1EIY B;  2HIX A;  5GAD C;  3TEH B;  4DV1 Q;  1WFQ A;  3IRB A;  1MKH A;  1HNW L;  4PZ6 A;  1MIU A;  3WWV A;  1IZ6 A;  4DV0 Q;  1XPO A;  4LF4 Q;  5C44 G;  5FLM G;  5GAH C;  4HJ9 A;  4A3M H;  1VQ8 A;  4Y7N H;  1NMF A;  1K8A C;  1VQC A;  4DV7 L;  2A8V A;  4XTC S;  4HJ7 A;  1EQQ A;  4JI6 Q;  1RL2 A;  4DR2 L;  2AHO B;  4LUO A;  2D0O A;  3KDF A;  4LUV A;  4X66 Q;  1HJP A;  5C4X H;  3KFU A;  1AE2 A;  1ASY A;  1IL2 A;  2B29 A;  3PO2 G;  3PO3 H;  4YY3 Q;  1VQG A;  2K5H A;  3M3Y H;  3JC6 6;  1SE8 A;  3STB D;  3K0X A;  3GTM H;  3A0J A;  1GVP A;  4JOI C;  4A3J G;  5C44 H;  2ZJQ A;  2DGY A;  4YHH Q;  2UU9 Q;  4NXM L;  2CFM A;  1LYL A;  4JC0 A;  1EQR A;  1VCI A;  2AWN A;  1U5K A;  3EBE A;  5M3F G;  1M90 C;  2UXD L;  4DAM A;  2B63 G;  2Q2I A;  3S2H H;  2IX0 A;  2Z0S A;  1WI5 A;  1I6H H;  4X62 L;  4LF7 L;  1QVF A;  4QY7 A;  4LWC A;  4AH6 A;  4IFD J;  1VQB A;  2NVY H;  1VQP A;  4L5Q A;  1VQ9 A;  2F4V Q;  1K0R A;  1N32 L;  3T1H L;  4P74 A;  4A3E G;  3S17 H;  5IE8 A;  4JBW A;  1VQ5 A;  1YBY A;  4DR3 L;  5LMN L;  2HHH L;  1S40 A;  1HZA A;  5M3F H;  4AYB G;  1UE6 A;  3AYH B;  4A93 G;  1B8A A;  3U58 A;  2B63 H;  1KQS A;  4OX9 L;  3AQQ A;  5DLQ E;  2Y0S G;  4JI5 L;  3M4O H;  4IPC A;  3W1G A;  1NMG A;  3OW2 A;  1OXX K;  3GTK H;  2IHE A;  3CW2 C;  5C0X I;  1V1Q A;  3M9B A;  2FXQ A;  1LUZ A;  1GD7 A;  4DNI A;  3HOZ G;  4IFD I;  2VZA A;  4DR7 L;  4TVA B;  2N78 A;  3B6Y A;  3ZJY C;  1QZH A;  1QUQ B;  1E1O A;  5IP7 G;  5M5W H;  1I3Q H;  1HNX L;  2Q2U A;  2F52 A;  1D7Q A;  1B70 B;  4LF6 L;  3KLW A;  1TWA H;  3FKI G;  5AJ3 L;  4B3M L;  4A93 H;  4LF7 Q;  3HOY G;  3HOV G;  2OQ0 A;  1SFO H;  3CAM A;  4PG3 A;  4OO1 I;  4B3S Q;  2C35 B;  2VQE L;  3NEN A;  5K36 G;  2CWA A;  3CXC A;  2Q2H A;  2A19 A;  3T1H Q;  2WFW A;  3OTO Q;  4A3K G;  1N32 Q;  4Y52 H;  4DR3 Q;  1TXY A;  2HHH Q;  3HOZ H;  4LNQ A;  4GS3 A;  3PUX A;  2I5L X;  3STB C;  5FJ8 H;  2IX1 A;  3K7U C;  5IP7 H;  3A5U A;  2XTI A;  4DV4 L;  4JI2 Q;  1VQJ A;  1XPU A;  2PNH A;  1Q12 A;  3FKI H;  2MO0 A;  2VQF Q;  1I94 L;  4L5T A;  3HOV H;  3HOY H;  3ULP A;  3U4V A;  4DR6 L;  1R9T H;  3W1B A;  2QA4 A;  3I4N G;  1XMO Q;  4JYA Q;  2IHF A;  2PQA B;  5BR8 L;  2JA8 G;  5EAY A;  4A3K H;  1HZC A;  1FJG Q;  4A3B G;  2ZTE A;  4ME3 A;  4LFB Q;  2NZO A;  3BZC A;  1HNX Q;  4XIG S;  3RN2 A;  4BY7 H;  3A74 A;  1IBM Q;  2JE6 I;  1PV4 A;  4B3M Q;  3ULJ A;  1PH7 A;  1QUQ A;  4DV5 Q;  3CCQ A;  4JI0 Q;  4B3R L;  3BZK A;  5C3E G;  4DR1 Q;  1NJI C;  1BBW A;  1OXU A;  5HGQ A;  3I56 A;  4HIM A;  3L7Z C;  1CKN B;  2GN5 A;  3CME A;  1LTL A;  4IO9 A;  1LM0 A;  3CPW A;  4DR4 L;  4J15 A;  1IBL Q;  4OON A;  4L5R C;  1SRU A;  1KRT A;  2JA8 H;  3CCJ A;  2JA9 A;  2K50 A;  4P75 A;  4EQ5 A;  4A3B H;  1X56 A;  1X6O A;  5IYD G;  2Q2T A;  1E3P A;  2VW9 A;  4POG A;  3S1M H;  3LGJ A;  1PH9 A;  5IWA Q;  2PMZ E;  1PH4 A;  1XNR L;  1Y1V G;  3S1Q H;  3I2Z A;  1YHA A;  1IBK L;  2E5L Q;  1N33 L;  2PI2 A;  4A3I G;  3HOX H;  4A76 A;  4GKK L;  3PIP A;  4IJL A;  4LF8 L;  2VNU D;  1BVS A;  2NN6 G;  3D0F A;  2ZM6 Q;  4UPA A;  3PF4 A;  2UUC L;  4NPS A;  4LF9 L;  2Y0S E;  1E24 A;  2PQA A;  3L0O A;  3PUW A;  4X65 L;  4GOP C;  2YTY A;  1HNZ L;  3PUV A;  4POF A;  1K9M C;  2ATW A;  3UDG A;  4DR5 Q;  5IYD H;  5J3B A;  3CMA A;  2ZJR A;  2R7D A;  1L0W A;  5JEA G;  4B3T L;  1NBW A;  4DUZ Q;  2WB1 E;  4WJ4 A;  2YTV A;  2I5M X;  3NEL A;  3BU2 A;  2BA0 A;  2QEX A;  3CCV A;  1PHJ A;  2ALY B;  4WJ3 M;  2CQO A;  2KHI A;  3FHW A;  4JI4 L;  1CKN A;  4JI8 Q;  4A3I H;  3F2B A;  3M85 A;  1YEZ A;  2K5V A;  4NXN Q;  1AE3 A;  4GKJ L;  5JJL A;  2WAQ E;  3F2D A;  1Q7Y C;  3UE0 A;  1IYJ B;  1C7Y A;  4A3C G;  4AIM A;  5FLM H;  1WCM G;  1PYS B;  5M5Y H;  3AEV A;  1XMQ Q;  5GAE C;  2K52 A;  1JJ2 A;  4YWK A;  2B3G A;  5LMU L;  1X3G A;  4LFA L;  2MNA A;  1AH9 A;  1JB7 A;  4GNX B;  1N33 Q;  1L1O B;  4GKK Q;  4DV2 L;  4LF8 Q;  4PMW A;  4A3D G;  3S14 H;  1HNW Q;  4A4I A;  1A0I A;  4LF9 Q;  4X65 Q;  3PO2 H;  3UDX A;  4GN4 B;  1P8L A;  1EYG A;  1E1T A;  1OXS C;  1VQM A;  2E2J H;  3TS0 A;  4X64 L;  1I50 H;  4DV7 Q;  4A3C H;  4A3J H;  1HR0 W;  4B3T Q;  1WCM H;  4BBS G;  1A63 A;  4OXP A;  4DAY B;  3S24 A;  4DR2 Q;  4GOP B;  2F3I A;  1XJV A;  1X3E A;  2GVB A;  2N3S A;  1VQA A;  4DR1 L;  5C0X G;  3RNU A;  3G6E A;  2E2H H;  1IXR A;  1J6Q A;  4A3D H;  1PH1 A;  2GVA A;  2YTX A;  1OTC A;  2MFI A;  2JA7 G;  4NXM Q;  2EQS A;  2EXD A;  2KCM A;  5IY0 A;  1A62 A;  1Q1E A;  3I7F A;  3RZO H;  4QQB X;  1JE5 A;  1N8R C;  2ZTD A;  2UXD Q;  3H0G G;  2JA6 G;  2WB1 G;  4BBS H;  1BKB A;  3M4P A;  4IOC A;  4A3E H;  1SMX A;  2IY5 B;  4KHP L;  3CC4 A;  1G6P A;  1ASZ A;  1EWI A;  4OO1 G;  4IJH A;  4K0K L;  3T1Y L;  2YYZ A;  4X62 Q;  1UWV A;  1XTD A;  4GNX A;  3J7A 5;  1L1O A;  1CKO A;  1TWG H;  1J5E L;  2R93 G;  1C0A A;  3J80 c;  4DV3 L;  2WAQ G;  4A3F G;  1NE3 A;  4DPG A;  2WP8 J;  3CCL A;  4MZ9 A;  1A8V A;  4UP8 A;  2RCN A;  3CQZ H;  3D31 A;  3FP9 A;  1K3R A;  3GO5 A;  3KYH C;  2DUD A;  3ULL A;  4LW1 A;  2JA7 H;  3PUY A;  2ZJP A;  1SRO A;  3E0E A;  5LMN Q;  3H3V H;  1DGS A;  1VQD A;  1EUJ A;  3E9H A;  5HY6 A;  3H0G H;  5C4J H;  2JA6 H;  3MXN B;  1VQN A;  2ES2 A;  2Z6K A;  3GD7 A;  1O7I A;  4OX9 Q;  2UXB L;  4JI5 Q;  4LFC L;  4BBR G;  3HOW G;  1D8L A;  3GTG H;  2UUB L;  2UXC L;  4JI7 L;  4BA2 I;  2R93 H;  2OWO A;  4A3F H;  1VQF A;  2R6G A;  2XGT A;  4PZ8 A;  1GKH A;  3U50 C;  4DR7 Q;  1BBU A;  1T9H A;  2N8N A;  3PUZ A;  2H5X A;  1KD1 C;  3TS2 A;  1YVC A;  3JAM c;  4PZ7 A;  1XNQ L;  2K14 A;  3CCR A;  3CF5 A;  4KHP Q;  3CCE A;  2AMC B;  1MJE A;  3K80 C;  4LF6 Q;  2K75 A;  5AJ3 Q;  4K0K Q;  3CCM A;  4JOI A;  3CC7 A;  1J5E Q;  1E7Z A;  1X54 A;  2R7F A;  2MO1 A;  4FDB A;  3J81 c;  3HOW H;  5ELO A;  1M1K C;  2KBN A;  1L2F A;  1P16 A;  1X55 A;  2VQE Q;  3VDY A;  2HT1 A;  1NY4 A;  2QGQ A;  4AQY L;  2VUM G;  2VL6 A;  1MJC A;  5IT9 c;  4HIK A;  2NVX H;  1PFS A;  2BA1 A;  4JI3 L;  4HJ8 A;  3I4N H;  2AKW B;  4R4O A;  4X6A H;  4LUZ A;  3GTP H;  3EIV A;  4HIO A;  4JI1 L;  2UUA L;  1V9P A;  4KI0 A;  4H02 A;  1KL9 A;  2ZTC A;  3PSI A;  1TWH H;  4DV1 L;  4GN5 A;  4DV4 Q;  1UE7 A;  4DV0 L;  4DKA C;  5ELN A;  1I5F A;  2UUB Q;  4HID A;  1JJG A;  2RF4 A;  1I94 Q;  5GRO A;  3RZD H;  4DR6 Q;  5C3E H;  4BA1 I;  3HKZ G;  1VQH A;  4JI6 L;  2IT1 A;  3KDF B;  1H95 A;  3EN2 A;  4QJF A;  2VUM H;  5BR8 Q;  4A3G G;  4APV A;  4HJ5 A;  3S15 H;  4TQU S;  1SR3 A;  1UE1 A;  3K81 C;  4X66 L;  3J80 i;  1XNQ Q;  5E7N A;  1EFW A;  1RIP A;  5IP9 G;  4MTN A;  3TRE A;  3GTL H;  1S3O A;  1Z47 A;  3CPF A;  1VQI A;  3NEM A;  4R1J A;  1N34 L;  2JA5 G;  3I4M G;  1HH2 P;  3HKS A;  4B3R Q;  3L2P A;  4KLK A;  2E8G A;  1Q86 C;  3AFP A;  5JEA J;  2YV5 A;  4AQY Q;  1JMC A;  4L5S A;  4BXX G;  4OWX B;  1OXT A;  1Y1V H;  4DR4 Q;  2OCE A;  1HR0 L;  2KCT A;  1Q82 C;  3RN5 A;  4A3G H;  2UUA Q;  2CKZ B;  4RG1 A;  1TWC H;  4O2D A;  1HZ9 A;  3I4O A;  2BH2 A;  1B7Y B;  2Z6K C;  5IP9 H;  2E2I H;  4EX5 A;  4JCV E;  2NN6 I;  2JA5 H;  1PA6 A;  4GLA C;  1X65 A;  1V43 A;  3GTQ H;  3I4M H;  2JEA I;  1XNR Q;  1YJW A;  3A5Z B;  3JAM i;  2F4V L;  2OTJ A;  3ER0 A;  1Q1B A;  1VS0 A;  1IBK Q;  4QGU A;  1VQL A;  3I55 A;  4BXX H;  4DV6 L;  1PVO A;  2A1A A;  2ID0 A;  1PH5 A;  2UUC Q;  1CUK A;  1HNZ Q;  3J81 i;  1YIT A;  4P72 A;  1N34 Q;  2MQH A;  3PGZ A;  2D0P A;  3GTO H;  1QVC A;  3KJO A;  3K8A A;  5M3M G;  2R7Z G;  4JBK A;  4QL5 A;  2BH8 A;  2NVQ H;  1NTG A;  3CD6 A;  1JJC B;  3F8T A;  3H15 A;  4DUY L;  5GQO A;  2PI2 E;  1XPR A;  3UE1 A;  4LF5 L;  1N9W A;  3RR5 A;  3K7A H;  1KHI A;  1HR0 Q;  3G71 A;  4JI4 Q;  4R4C A;  1W3S A;  1K83 H;  2NZH A;  4JV5 L;  3HFZ B;  1U0L A;  1YI2 A;  4BY1 G;  3CC2 A;  4GKJ Q;  1YJN A;  5C0X J;  4IOA A;  3TRZ A;  4IPD A;  4IFD G;  3KJP A;  3AFQ A;  4C3J H;  1C9O A;  1N36 L;  1K73 C;  1KC8 C;  1WOC A;  4B3S L;  4GLV B;  4JI0 L;  3F1Z A;  4R4Q A;  3S16 H;  1E22 A;  5LMU Q;  5M3M H;  4LFA Q;  2R7Z H;  1YZ6 A;  2HIV A;  3U4Z A;  2JEB I;  3PF5 A;  3OTO L;  4DV2 Q;  3W5O A;  1PH6 A;  1VQE A;  4O0A A;  4P71 A;  4DV6 Q;  1K8G A;  1W2B A;  1VQ4 A;  3F2C A;  1VQK A;  3UDI A;  2LXK A;  3GTJ H;  4BY1 H;  4JI2 L;  3HOU G;  4X64 Q;  3CCU A;  3HKZ E;  3CP0 A;  2VQF L;  1SN8 A;  4GN3 B;  5FLX c;  1CSQ A;  2RHS B;  1UE5 A;  4DUY Q;  1HZB A;  4LF5 Q;  1XMO L;  1UEB A;  4JYA L;  5IYB G;  1TWF H;  3PIO A;  5IYC G;  3DM3 A;  1FL0 A;  3RLF A;  5FJ8 G;  4R4T A;  4ALP A;  1YJ9 A;  1YNX A;  4GOP A;  1FJG L;  3H3V I;  4OWT B;  3S2D H;  4JV5 Q;  4LFB L;  5GAG C;  1YHB A;  2LSS A;  1G29 1;  1IBM L;  3PV0 A;  1CKM A;  4DV5 L;  1N36 Q;  1Y14 B;  4NB3 A;  4C3H H;  3HOU H;  2OQK A;  5LMN W;  3S1R H;  3SGI A;  1FGU A; 
#chains in the Genus database with same CATH topology
 3CCS A;  1MBY A;  3RLO A;  3V2T A;  3G48 A;  1XTC D;  4UP7 A;  5D65 A;  4BBR B;  1PH2 A;  1CSP A;  3BJU A;  1KXL A;  1SE2 A;  3TDQ A;  3KOJ A;  4J1M A;  2QIL A;  3S9W A;  3KF6 B;  4KHZ A;  4DV3 Q;  2YU9 H;  2FMC A;  1C8C A;  4JPB W;  1Y1W B;  1PMR A;  5HGT A;  2I46 A;  1TWH B;  5IWA L;  2LY7 A;  5A2Q L;  1Z9F A;  2ZM6 L;  2EIF A;  1PYB A;  2N49 A;  2VUM B;  2UXC Q;  4JI7 Q;  3BVZ A;  3S15 B;  3KBX A;  4YWM A;  1S4Z A;  2VS1 A;  2A69 C;  4DR5 L;  4ILW A;  1D6E C;  5NUC A;  4DUZ L;  5AFW A;  5KNB A;  3K59 A;  4JBM A;  5ELF A;  2F1M A;  2JYO A;  5JJI A;  2B8G A;  4JI8 L;  4A3M G;  1Q46 A;  2F0T A;  2CHB D;  4P73 A;  3OIP A;  4IAL A;  1KLG D;  1JOQ A;  5C6A A;  1EY4 A;  1GM5 A;  1BF4 A;  4JG2 A;  3MVV A;  1MHW C;  3PQI A;  2RHQ B;  2O2L D;  3J7A V;  3FEW X;  4LMQ D;  4UY8 C;  1HRJ A;  2RCF A;  4KKU A;  4N9P A;  2Z9H A;  4Y7N B;  1WFQ A;  5JAV A;  1HPC A;  1HNW L;  4DV0 Q;  2OT2 A;  4CDE C;  5FLM G;  1NMF A;  1IHZ A;  1K8A C;  3AU7 A;  4HJ7 A;  1CA5 A;  3SE0 A;  2AUK A;  3KF8 A;  2FHT A;  5D14 A;  4DR2 L;  1PFB A;  5C4X H;  3KFU A;  1ASY A;  2B29 A;  3PO2 G;  3PO3 H;  3HS0 C;  4YY3 Q;  2QCP X;  1V1P A;  3K7A B;  4V0B A;  3GTM H;  1EOT A;  1GVP A;  3LX0 A;  2L0C A;  4NXM L;  1K83 B;  2UU9 Q;  4EVO A;  2CFM A;  1HTP A;  2M00 A;  2AWN A;  1JOK A;  1TS4 A;  5CV9 A;  2EY6 A;  2Q2I A;  3J80 L;  3A56 A;  3TP7 A;  1HXY D;  1I6H H;  1GUG A;  1E2W A;  3UI2 A;  1TT2 A;  2L9H A;  3FPU B;  5JPM C;  3S17 B;  1M8A A;  4FF2 A;  4IFD J;  5EKI A;  1VQB A;  2K7V A;  1Q90 A;  1SJE D;  3H09 A;  3C46 A;  2F4V Q;  1RTN A;  1K0R A;  1RJT A;  3EVQ A;  3KLS A;  3T1H L;  4B9X A;  4C56 C;  4A3E G;  4JBW A;  1YBY A;  3MZ5 A;  5M3F H;  4AYB G;  3U58 A;  2B63 H;  4OX9 L;  3AQQ A;  5DLQ E;  4JI5 L;  2SDF A;  3M4O H;  3W1G A;  5HUR A;  1TWF B;  3CW2 C;  5J39 A;  3GTK H;  1V1Q A;  3VA7 A;  4R8I A;  3M9B A;  1GD7 A;  4DNI A;  3HOZ G;  1G6Z A;  1TWA B;  2N78 A;  4XYQ A;  3FDT A;  3S1R B;  2Q2U A;  2F52 A;  1F77 A;  4B3M L;  1JR0 D;  4TRD A;  4LF7 Q;  2PZT A;  4PG3 A;  4B3S Q;  1PRT C;  1KNA A;  2VQE L;  4O42 A;  2EYH A;  2CWA A;  2Q2H A;  1NR4 A;  4CDD C;  4DR3 Q;  1TXY A;  2HHH Q;  3BDL A;  4LNQ A;  4DV4 L;  3A5U A;  5KND A;  1RCV D;  1Q12 A;  1S5C D;  1LTR D;  3DEP A;  1V8Q A;  3U4V A;  3I4N G;  3ND8 A;  2IHF A;  1JQY D;  3K58 A;  1UAP A;  5A2Q E;  4RAU C;  5K36 H;  2B2U A;  4A3B G;  4ME3 A;  3A8J E;  3RN2 A;  3R93 A;  1PV4 A;  1PH7 A;  1EWC A;  1QUQ A;  4DV5 Q;  2H1E A;  2Z6B A;  3S1N B;  1OXU A;  4HIM A;  1GUT A;  3L7Z C;  2B2Y A;  1QCB D;  2GN5 A;  1XWE A;  3CME A;  1GUS A;  4IO9 A;  4IUV A;  1AW7 A;  3S1M B;  2L12 A;  2JA8 H;  2JA9 A;  1X56 A;  1E3P A;  2AQ1 B;  1K8O A;  1U4M A;  2SOB A;  1QWY A;  1PH9 A;  5IWA Q;  1H9J A;  1PH4 A;  4M8A A;  4Q0F A;  3MWY W;  5DNF A;  4X3U A;  3SK8 A;  3I2Z A;  1EU3 A;  1JOR A;  4A3M B;  3OWF A;  3CHB D;  1IBK L;  4GKK L;  1STN A;  2B2V A;  4IJL A;  2VNU D;  1A2T A;  1U4P A;  2ZM6 Q;  2Y0S E;  1PZJ D;  1TKW B;  4NKL A;  2EOT A;  2K6A A;  4DK1 A;  1F2Z A;  5IOD A;  2BCO A;  1K9M C;  3TN2 A;  4DR5 Q;  5IYD H;  5J3B A;  2ZJR A;  1B4O A;  1F9Q A;  1ESF A;  1NBW A;  2F0U A;  4DUZ Q;  3M3Y B;  3I72 A;  4WJ4 A;  3NEL A;  3DWQ A;  3BU2 A;  3CCV A;  2Z8L A;  2ALY B;  2KHI A;  4JI4 L;  1CKN A;  4JI8 Q;  2NN6 H;  1CI3 M;  2WAQ E;  1Q7Y C;  4A3C G;  1B9M A;  1WCM G;  2F4I A;  2F0S A;  5M5Y H;  3AEV A;  3S2H B;  2KEE A;  3AB9 A;  1KDB A;  2MNA A;  5I2X A;  3PO2 B;  2M2L A;  1KLU D;  3PIO 3;  1K3B C;  3VYR A;  3J80 E;  4RCN A;  1HNW Q;  2SNS A;  5CYU A;  1A0I A;  2ICI A;  3UDX A;  2E2J H;  2J4X A;  2ENB A;  1A63 A;  4A3J H;  4B3T Q;  1RTO A;  1XYI A;  1UUP A;  4DR2 Q;  4TSS A;  1QB5 D;  2F3I A;  1TU2 B;  4RKB A;  1E2V A;  1X3E A;  5IOC A;  3A7A B;  3G6E A;  1IXR A;  2F0I A;  5ELB A;  2YTX A;  3KLR A;  4RHS A;  4NXM Q;  2EXD A;  4A3E B;  1A62 A;  1Q1E A;  1W6J A;  3RZO H;  1GUN A;  2I07 B;  4AYB B;  2JA6 G;  1STH A;  2WB1 G;  3X3M A;  1EY9 A;  1SAP A;  1TWG B;  3QIA A;  4GNX A;  3J7A 5;  5C0X H;  3J80 c;  4DPG A;  2WP8 J;  3HOZ B;  5C4J B;  3CQZ H;  3D31 A;  2FMM A;  3FP9 A;  3ULL A;  1CHQ D;  3LNN A;  2ZT9 C;  1TS2 A;  1WVL A;  3H3V H;  2ICE C;  1EUJ A;  3E9H A;  4KJN A;  1B44 D;  3MXN B;  1VQN A;  2Z6K A;  3GD7 A;  4DAY A;  4R9W A;  4HSP A;  4IUN A;  4OX9 Q;  4S3S A;  4JI5 Q;  3HOW G;  3OSO A;  2UUB L;  2OEO A;  3A55 A;  1FR3 A;  2TMP A;  3MXP A;  1CZG A;  3EFX D;  1GKH A;  4DK0 A;  1CA6 A;  5EJW A;  1T9H A;  4WJ3 M;  1NAP A;  4PZ7 A;  1XNQ L;  5EPL A;  3CCE A;  2AMC B;  1MJE A;  3K80 C;  4K0K Q;  4JOI A;  1SEB D;  1SNM A;  3I4N B;  5ELO A;  1M1K C;  2IX1 A;  2VQE Q;  3T56 B;  1HA6 A;  2HT1 A;  4UDU C;  4AQY L;  4A3B B;  4HIK A;  2WKC A;  4JI3 L;  1JOO A;  1MSG A;  1O7Z A;  4R4O A;  2SEB D;  2KJX A;  2RSO A;  4QUF A;  4H02 A;  4DV4 Q;  4DKA C;  4HID A;  3MXG A;  1LTT D;  1VQH A;  3HKZ G;  2IT1 A;  4QJF A;  4A3G G;  3SK4 A;  2JN4 A;  1SR3 A;  1WTW A;  1RIP A;  5IP9 G;  4DXG A;  3A8I E;  2KCC A;  3CPF A;  1VQI A;  4R1J A;  1N34 L;  2JA5 G;  1FNW A;  1BNZ A;  2DNE A;  3DHQ A;  1JMC A;  3MHB A;  1OXT A;  3C3L A;  1QG7 A;  2OCE A;  5I2Y A;  2CW0 C;  1Q8I A;  3RN5 A;  2MHV A;  3TP6 A;  2UUA Q;  4KN4 C;  1F2L A;  1QNU A;  2BH2 A;  2E2I H;  1WTR A;  1DJR D;  1X65 A;  3GTQ H;  3S14 B;  3IKJ A;  1B50 A;  2CH4 W;  1II3 A;  3ER0 A;  1VS0 A;  1IBK Q;  4QGU A;  2ZXP A;  4E6I A;  1VQL A;  3GTO B;  4BXX H;  4DV6 L;  4NP5 A;  1I50 B;  2A1A A;  2B2U C;  2C5C A;  1WCM B;  3J81 i;  1QVC A;  2R7Z G;  2NVQ H;  2E2H B;  3CD6 A;  3F8T A;  3H15 A;  4LF5 L;  2D9U A;  1HR0 Q;  4JI4 Q;  1W3S A;  3CRK C;  3QR8 A;  5IGD A;  3CC2 A;  1YJN A;  1PDQ A;  4DU9 A;  5C0X J;  1SNQ A;  4GLV B;  4XT3 B;  2HD3 A;  3CKI B;  3HZX A;  3PF5 A;  1Z6H A;  2EJM A;  3HRZ C;  3OTO L;  3GP7 A;  1T5X D;  2B2V C;  1ET9 A;  1VQ4 A;  1VQK A;  3WOF A;  3UDI A;  3SR1 A;  5IT9 E;  1NCV A;  4BY1 H;  3L3O C;  5COR A;  2JA6 B;  2K28 A;  2RHS B;  1HCZ A;  1UE5 A;  4HMI A;  1XMO L;  4HCE A;  3RLF A;  1FL0 A;  1YJ9 A;  4R4T A;  4ALP A;  1FJG L;  4JV5 Q;  5KYL A;  3HOU B;  2CH4 A;  4LFB L;  4C3I G;  1IBM L;  3DXJ C;  1L0X B;  2D5D A;  2ZXR A;  1N36 Q;  1F9S A;  1Y14 B;  2KQ3 A;  4NB3 A;  4C3H H;  1EIH A;  4ZUJ A;  2Z1C A;  4JI0 Q;  4I7A A;  1WTV A;  3M4Q A;  4MNO A;  1Y1W G;  5CBA E;  2I0Q A;  3HEJ A;  1WJJ A;  3HOW B;  2YU9 B;  2KUM A;  4F8M A;  1Q3L A;  1EIG A;  1EY8 A;  1QZG A;  2JJQ A;  4A75 A;  4RGT A;  2NVX B;  3K0Y A;  2B8F A;  2OTL A;  2R92 G;  1FYC A;  3G4S A;  1HUN A;  1I4P A;  4K6D A;  1IL8 A;  1GO3 E;  2F0E A;  3UDF A;  2MGS A;  2VY3 A;  3SEB A;  4R4I A;  3WOE A;  1BQQ T;  1YIJ A;  4A3L H;  2CWP A;  1TR5 A;  2EY5 A;  4OWW B;  3KF8 B;  5M5X H;  3DLL A;  1DCZ A;  5FO8 B;  2JK8 A;  2RDG A;  4RHR A;  1GXD C;  3WDN A;  4ODG A;  3BYT B;  4KN7 C;  3GTL B;  1JC7 A;  1SE4 A;  4YY3 L;  4ABN A;  2I5H A;  4EQP A;  5I4D A;  1JT8 A;  3HKZ B;  4GNX C;  1AEX A;  4A3G B;  2UU9 L;  3DEO A;  4KD4 A;  4IPG A;  4C2M H;  2JQO A;  1XMQ L;  4JI3 Q;  5CBE E;  5K5P A;  1F9R A;  1G51 A;  1PTO D;  2PO4 A;  2D62 A;  1WYD A;  4DNT B;  2JA5 B;  4OIK A;  3TEH B;  4RGO S;  2OXP A;  3W2D A;  4PV1 C;  1XPO A;  1VQ8 A;  1R4Q B;  2LMC B;  5E3F A;  4FXD A;  5EKK A;  2A8V A;  4RH6 A;  2KVM A;  3HP3 A;  3MTS A;  4GZY C;  1RL2 A;  2PZU A;  4RGN A;  3OOC A;  2D0O A;  2DY8 A;  3D6C A;  1HJP A;  3GTM B;  1CQF A;  1H9K A;  3A0J A;  4JOI C;  4A3J G;  5C44 H;  1ML0 D;  2ZJQ A;  5EPJ A;  1BDO A;  1EQR A;  1M90 C;  2UXD L;  3H3V C;  2F0M A;  1EEF D;  5DM6 3;  3S16 B;  2Z0S A;  2R7Z B;  1WI5 A;  4X62 L;  4LF7 L;  4FF4 A;  3RD4 A;  3R8B A;  4AH6 A;  1PZK D;  2NVY H;  5D3D A;  2E2D C;  1SE3 A;  1VQP A;  4OL7 A;  4FF3 A;  1VQ9 A;  3K5N A;  1KDC A;  2EY2 A;  1GUW A;  3K57 A;  1JIC A;  1VQ5 A;  4DR3 L;  5LMN L;  2HHH L;  3C1E A;  1S40 A;  1SDF A;  5I9O A;  4PNY A;  3GTK B;  4CGY B;  1J9O A;  3OIQ A;  3R3O A;  1I4G A;  1STG A;  2Y0S G;  1Y8P B;  3VR5 A;  1NMG A;  1OXX K;  2A6H D;  5C0X I;  2PW5 A;  4KK7 A;  4DA2 A;  3S2D B;  3JAM L;  2VZA A;  4DR7 L;  5LL6 X;  1V1O A;  4BS9 A;  1QUQ B;  1E1O A;  1I3Q H;  2A68 D;  1B70 B;  2NTS A;  1GJX A;  3FKI G;  5AJ3 L;  4DFA A;  3I90 A;  4A93 H;  3ERQ A;  2OQ0 A;  4H44 C;  3CAM A;  1SFO H;  4OO1 I;  4PMC A;  1F2Y A;  4KV6 A;  3D4R A;  2A19 A;  4RKL A;  2WFW A;  2RVL A;  5EKL A;  3OTO Q;  2LS0 1;  4A3K G;  1ET6 A;  4C3I B;  4KD3 A;  4JK1 C;  5DM7 3;  4GS3 A;  2DNC A;  2I5L X;  1D1I A;  2EXZ A;  3K7U C;  4CKB A;  2XTI A;  5IP7 H;  1VQJ A;  2XWJ B;  3G7L A;  4EQO A;  3SDZ A;  4L5T A;  3I70 A;  3HOV H;  3HOY H;  1EU4 A;  5CV6 A;  1R9T H;  3W1B A;  2EE1 A;  2QA4 A;  1XMO Q;  5BR8 L;  4JVZ A;  5EAY A;  1FJG Q;  1H9R A;  4LFB Q;  5ELE A;  2NZO A;  2R92 B;  1HNX Q;  1IBM Q;  4ZAI A;  2JE6 I;  3BZK A;  1I4Q A;  1NJI C;  3I56 A;  1CKN B;  5I6W A;  1LTL A;  3CPW A;  2F0K A;  4J15 A;  1ESR A;  1YNJ D;  1KRT A;  4H13 C;  4EQ5 A;  4P75 A;  1LT3 D;  3IL8 A;  2F0G A;  4POG A;  3MA2 B;  3LGJ A;  5KGU A;  1FGB D;  1G2T A;  4X3S A;  3S1Q H;  3U9O A;  2PI2 A;  1BOS A;  5LL6 S;  1BR9 A;  4UPA A;  2UUC L;  2PQA A;  1HNZ L;  2YTY A;  2QDL A;  3PUV A;  4POF A;  5IIF A;  3CMA A;  2R7D A;  4B3T L;  4EGV A;  3K5M A;  5DEH A;  5FO7 B;  3ND9 A;  4ZLT F;  4KKT A;  4A3I H;  1YEZ A;  2K5V A;  1A3V A;  4FXG C;  5EGT A;  2VB2 X;  3FMC A;  1WTP A;  2K32 A;  1PYS B;  1XMQ Q;  5GAE C;  2K52 A;  1JJ2 A;  4YWK A;  5LMU L;  1X3G A;  5JEA H;  1AH9 A;  1JB7 A;  4UHV A;  4GNX B;  5KYI A;  1N33 Q;  3BZD B;  2DJF C;  4IZ8 A;  4A4I A;  4LF9 Q;  1LAC A;  4A3J B;  1OXS C;  5IGG A;  1NSN S;  3BDO A;  4G7Z C;  4YIJ A;  1EY0 A;  4KTA A;  1LV9 A;  4DAY B;  3S24 A;  4K5X A;  3D6W A;  2JSO A;  4DGZ A;  2XSC A;  2CVR A;  1SYD A;  3RZO B;  1PFN A;  1J6Q A;  4A3D H;  3MFG A;  2JA7 G;  1H9M A;  2EYM A;  1PTO C;  2K01 A;  5M5W B;  1JE5 A;  1N8R C;  2BDN A;  1MSH A;  2ZTD A;  3H0G G;  2UXD Q;  4BBS H;  3M4P A;  4IOC A;  5EBD A;  1SMX A;  3K5O A;  2Y0S B;  1ASZ A;  1C48 A;  4IJH A;  4K0K L;  3T1Y L;  4X62 Q;  1XTD A;  1CKO A;  2AQ3 B;  2PZW A;  1C0A A;  4PQX A;  1NE3 A;  3CCL A;  2VB3 X;  3ITP A;  1BBX C;  4UP8 A;  2RCN A;  4R8N A;  3X3N A;  1Y8O B;  2PYK A;  4NDX A;  3E0E A;  5LMN Q;  1VQD A;  3FKI B;  2WV6 D;  2E74 C;  2CW0 D;  1BO0 A;  4LFC L;  2R93 H;  3QB3 A;  4A3K B;  2OWO A;  2D2C C;  5EPK A;  4MN3 A;  1VQF A;  4XQN A;  4A3F H;  2XGT A;  2A74 C;  4DR7 Q;  4CBV A;  3BS1 A;  4ZCK A;  1AP0 A;  2N8N A;  2V4D A;  3JAM c;  4KHP Q;  2K14 A;  1BUV T;  5AJ3 Q;  3CCM A;  2IWH A;  1E7Z A;  1X54 A;  2R7F A;  2MO1 A;  5EQ0 A;  1CFM A;  1S5F D;  4CJ1 B;  1X55 A;  1P16 A;  2DJG C;  3EJI A;  5BN3 A;  2QGQ A;  4KMU C;  1ICW A;  5T1I A;  4HJ8 A;  1RDP D;  2AKW B;  1ZYR D;  4LUZ A;  2UUA L;  2ZTC A;  3LWU A;  2A6H C;  3PSI A;  1IKL A;  1TWH H;  2EYL A;  3C1F A;  3H94 A;  1JJG A;  1S5E D;  1O7Y A;  1JCK B;  1EFI D;  5CV7 A;  2VUM H;  3VR2 A;  5BR8 Q;  2A68 C;  4HJ5 A;  1LT6 D;  3S15 H;  4HTH A;  3K81 C;  4X66 L;  3TRE A;  4H7B A;  4K8I A;  3I4M G;  3L2P A;  4OIJ A;  4KLK A;  1Q86 C;  3NQT A;  2K1B A;  3R2T A;  5JEA J;  4L5S A;  1LTG D;  1Y1V H;  1HR0 L;  2KCT A;  1Q82 C;  1E0B A;  3ZYY X;  5IGF A;  1PXU A;  1SMY D;  4EX5 A;  1PA6 A;  4ZK9 B;  2MPM A;  1Q1B A;  3I55 A;  4TKO B;  5JVG 3;  2UUC Q;  1PH5 A;  1CUK A;  1EEI D;  1HNZ Q;  1YIT A;  4C3J G;  4P72 A;  4K2L A;  3BYY B;  2MQH A;  4IQZ A;  1VDZ A;  4JW0 A;  3GV3 A;  4ID6 A;  5M3M G;  1HTL D;  4JBK A;  3EA6 A;  1W6K A;  1NTG A;  4HAE A;  1YNJ C;  5LHY 1;  1XPR A;  2E75 C;  3K7A H;  1QOH A;  3G71 A;  4R4C A;  1K83 H;  4JV5 L;  3HFZ B;  4NW2 A;  1SJH D;  4IFD G;  3KJP A;  1N36 L;  2XRS D;  4JI0 L;  3F1Z A;  4R4Q A;  5LMU Q;  5FKA C;  1YZ6 A;  4ZYS A;  2Z4H A;  5C3X A;  1STY A;  3W5O A;  4K2K A;  1JWU D;  4Q5V A;  1VQE A;  1HQR D;  3P7J A;  4O0A A;  1K8G A;  1W2B A;  2JA7 B;  4FNF A;  4RA8 A;  3F2C A;  3NWT A;  3HOU G;  4JI2 L;  2PNR C;  4ZQ3 A;  3H0G B;  1LTI D;  1TS5 A;  3A7L A;  3DWP A;  1HZB A;  1UEB A;  3NQI A;  4CHT B;  3GTG B;  1CK1 A;  1PZI D;  4JYA L;  1AFP A;  3F2U A;  1TWF H;  4LK1 C;  5BN5 A;  1QE6 A;  1YNX A;  2H4O A;  4OO1 H;  3QG1 A;  1YHB A;  1RF2 D;  1G29 1;  2AQ2 B;  1LT4 D;  1CHP D;  1I6V C;  4XXE A;  4XQJ A;  1CTM A;  3S1R H;  3SGI A;  4XQQ A;  1ILQ A;  3P1H A;  4QIW E;  4F7X A;  1QVG A;  1PTO B;  5IYB H;  3T1Y Q;  3GQB A;  5IYC H;  1VQ6 A;  1CQV A;  4UP9 A;  4DK3 C;  1X9N A;  3MEF A;  3GTP B;  5H1S E;  3K6O A;  1PH3 A;  2AWO A;  5CC4 A;  1I4H A;  5ISR A;  4GLX A;  2N88 A;  3R2I A;  3RZD B;  4IUT A;  2V1C C;  1YHQ A;  5DAU A;  1EQT A;  2RKS A;  4LFC Q;  2HQL A;  5I9P A;  3M7N A;  4IPH A;  1Q81 C;  1VQO A;  3RLN A;  5T1G A;  3NBI A;  4K14 A;  4X3T A;  3Q0A A;  1WD1 A;  3NPP A;  2ASB A;  3S1N H;  3P75 A;  1EYD A;  3D3R A;  2B39 A;  4NXN L;  4C2M B;  1GOZ A;  3ERS X;  4OEL B;  1X3F A;  2F03 A;  3J7Z C;  4YCU A;  1S72 A;  2HDM A;  2KHJ A;  3Q24 A;  1EOV A;  4OHJ A;  3NSW A;  1OXV A;  1TWC B;  4YWL A;  2BOS A;  2L5T A;  5C4X G;  1TY0 A;  2NVT H;  3ICE A;  2F0W A;  3PO3 G;  4AYB E;  3I4M B;  2HIX A;  5GAD C;  5KIX A;  3GV6 A;  1MKH A;  4PZ6 A;  3WWV A;  3OMG A;  1IZ6 A;  1SYG A;  4LF4 Q;  4HJ9 A;  4A3M H;  4K8J A;  5GAH C;  1H9S B;  3PMF A;  4IUQ A;  1C4Q A;  1VQC A;  1EQQ A;  1A2U A;  4U68 A;  2AHO B;  2EPB A;  1D1K A;  4KY7 A;  4LUO A;  4X66 Q;  3SK6 A;  1IL2 A;  1KTK A;  1VQG A;  2K5H A;  3M3Y H;  5COY A;  3V05 A;  1IKM A;  2PPB C;  1KDA A;  4YHH Q;  4DAV A;  2J7Z A;  1ZYR C;  1LYL A;  1SNO A;  1DM0 B;  5M3F G;  3D4W A;  3NBH A;  4C3J B;  2B63 G;  3NP8 A;  2NVY B;  3S2H H;  5M3M B;  4UAI A;  1QVF A;  4QUC A;  4DN4 M;  1AZP A;  3MAQ A;  3HG9 A;  4HED A;  4FXK C;  2KA7 A;  1HZA A;  2K5Q A;  3OW7 A;  3AYH B;  1B8A A;  2NBF A;  2RBM A;  2O5I C;  3TP5 A;  3OW2 A;  1SXT A;  2IHE A;  4DXF A;  2QEJ C;  1DON A;  4LJZ C;  1STB A;  4N8F A;  4TVA B;  2FJ2 A;  1SFO B;  1SMY C;  1HNX L;  1F2M A;  4LF6 L;  3KLW A;  3J81 L;  3E5S A;  2HDL A;  3MFY A;  5ELD A;  3VR4 A;  3BVM A;  3VYU A;  1I4X A;  2AUJ D;  2C35 B;  3V96 A;  5K36 G;  1N32 Q;  5KNC A;  3HOZ H;  4IUR A;  3STB C;  1IYV A;  3HOV B;  4N8X 1;  1O7L A;  3D8G A;  3NE5 B;  4JI2 Q;  3QJY A;  1MI2 A;  2XRQ D;  5J22 A;  1I94 L;  1LT5 D;  2FFK B;  2LKV A;  2DN8 A;  1B1Z A;  4DR6 L;  4JYA Q;  1R4P B;  2PQA B;  5C4H A;  2JA8 G;  3A54 A;  3T16 A;  5CV8 A;  2F0V A;  1J8I A;  4BY7 H;  3A74 A;  3ULJ A;  2IPK D;  3CCQ A;  4B3R L;  1BBW A;  5HGQ A;  2RDF A;  3KBG A;  3TZD A;  4I7Z C;  2PW7 A;  4DF7 A;  4DR4 L;  4L5R C;  1SRU A;  5D3I B;  1X3Q A;  5TSS A;  4A3B H;  5IYD G;  2BE5 D;  3S1Q B;  1JB3 A;  1MGS A;  3VA5 A;  2EJG C;  2IX3 A;  2K04 A;  2PMZ E;  1XNR L;  1Y1V G;  1YHA A;  1N33 L;  3HOX H;  1BCP B;  2IW3 A;  3PIP A;  1O78 A;  3L9A X;  2NN6 G;  1KAA A;  1VF5 C;  3D0F A;  3C2P A;  1TQO A;  1KAB A;  1JE4 A;  1E24 A;  1EWH A;  1TY2 A;  2JP1 A;  4NPS A;  4LF9 L;  4MHE A;  4L63 B;  3T4A C;  1JWM D;  1YNN D;  3UDG A;  5C4X B;  1L0W A;  2NWG A;  3PO3 B;  2WB1 E;  4CDF C;  3G6J B;  3VR6 A;  1PHJ A;  2CQO A;  3J7A F;  3QOL A;  3FHW A;  3F2B A;  4NXN Q;  4GKJ L;  3F2D A;  1E2Z A;  4AIM A;  5CMD A;  1SBB B;  2KEC A;  4XDX A;  2HQE A;  1XXG A;  1GHK A;  2B3G A;  1RHP A;  1I6H B;  4ME5 A;  4LFA L;  1NUC A;  2C9O A;  1U9R A;  4DV2 L;  4LF8 Q;  4ZKC B;  4CDC C;  3S14 H;  4X65 Q;  2SNM A;  1PTO F;  2XN9 C;  1HFN A;  1TII D;  3O13 A;  4NMZ A;  1EYG A;  1VQM A;  1I50 H;  4OEM B;  3TP8 A;  5M3F B;  1WD0 A;  1SNC A;  1X3P A;  3RUZ A;  4A3C H;  1WCM H;  1H9S A;  2B63 B;  3NTH A;  4GOP B;  3M4O B;  1XJV A;  2EJF C;  2GVB A;  1SYB A;  2E2H H;  5C0X G;  2K33 A;  1FNV A;  4L6T B;  3NHH A;  2GVA A;  1OTC A;  2MFI A;  1ICF B;  2EQS A;  1VMP A;  4QQB X;  3N6R A;  2EYP A;  1BKB A;  3OWE B;  2L4N A;  2IY5 B;  4KHP L;  3CC4 A;  3T13 A;  1G6P A;  3RMH A;  4OO1 G;  2YYZ A;  1B9N A;  1UWV A;  3J81 E;  1L1O A;  2WAQ G;  4K6L A;  2WII B;  1EQV A;  3NTK A;  4Z9C B;  1K3R A;  1K0S A;  2DUD A;  3PUY A;  1SRO A;  3TBI B;  1LAB A;  1DGS A;  2JA6 H;  2ES2 A;  1QNK A;  2PCF B;  4A3F B;  2UXB L;  4N9T A;  1D8L A;  1LTA D;  1UNS A;  4BA2 I;  1A6X A;  4WRD A;  5EBC A;  1K28 A;  2R6G A;  1BBU A;  1ENF A;  2CQA A;  5IGE A;  1KD1 C;  1YVC A;  1Y69 U;  5FO9 B;  3CCR A;  4G7O C;  4LF6 Q;  3Q6S A;  5G3L D;  1J5E Q;  2G5D A;  2XNA C;  4FDB A;  3FVQ A;  3J81 c;  3HOW H;  1HHV A;  2KBN A;  3VDY A;  2JA8 B;  1NY4 A;  1MJC A;  2NVX H;  3IAY A;  1PFS A;  2BA1 A;  2GA4 B;  4JI1 L;  1V9P A;  2O4X A;  1KL9 A;  4B9W A;  1EYA A;  4DV1 L;  3MXU A;  2QF7 A;  2RDH A;  5ELN A;  1O80 A;  2RF4 A;  3OPO A;  1I94 Q;  2JXM B;  4IUP A;  4DR6 Q;  5C3E H;  4BA1 I;  2F0F A;  4JI6 L;  3KDF B;  3SVM A;  4APV A;  4TQU S;  1UE1 A;  3J80 i;  2EVB A;  5E7N A;  1EY5 A;  3GTL H;  4KKS A;  1FNU A;  1Z7T A;  1ENA A;  4B3R Q;  1Y1V B;  3DM1 A;  2E8G A;  1UEA B;  2X6G A;  2YV5 A;  4BXX G;  4OWX B;  4ZRZ A;  1HUM A;  5G3L F;  4DR4 Q;  1JWS D;  4DNR B;  2XVS A;  4ZKB B;  4A3G H;  5M5Y B;  4RG1 A;  1EYC A;  5IP9 H;  3NTI A;  1RD9 D;  2K05 A;  4JCV E;  2JA5 H;  4GLA C;  1V43 A;  2O5J C;  3E6Z X;  1XNR Q;  2JEA I;  1WTH A;  1ROD A;  3A5Z B;  5BN4 A;  1D2B A;  2E2J B;  2F0H A;  2IL8 A;  1SSO A;  3N52 A;  5C5L A;  3PGZ A;  2D0P A;  1LTS D;  4QCL A;  3Q22 A;  3H6M A;  4QL5 A;  2RA4 A;  2BH8 A;  5E1F A;  1BCP D;  4C1N I;  5GQO A;  1N9W A;  1STE A;  3RR5 A;  1KHI A;  2OF1 A;  5F2D A;  1EY6 A;  2BE5 C;  3QOJ A;  4BY1 G;  4GKJ Q;  1G91 A;  3AFQ A;  4QF4 A;  2R61 A;  3TME A;  1GHJ A;  1ONL A;  1KC8 C;  3CU7 A;  3S16 H;  1QJO A;  1E22 A;  5JPN C;  3JAM E;  2R7Z H;  4LFA Q;  2HIV A;  4QB4 A;  3U4Z A;  2JEB I;  4XYO A;  4DV2 Q;  1PH6 A;  3URY A;  4P71 A;  3CQZ B;  1YNN C;  2B2W C;  5M9O A;  1SYE A;  2QDB A;  1A3T A;  4C3H G;  3GTJ H;  2EZV A;  3CCU A;  4DAP A;  2VQF L;  1PYW D;  4KY6 A;  5J1Z A;  2FIN B;  4GN3 B;  1DOK A;  4DUY Q;  3DM3 A;  1D5X C;  2WAQ B;  4GOP A;  3S2D H;  1BCP F;  2QW7 A;  3DMU A;  5GAG C;  2LSS A;  1L0Y B;  3PV0 A;  1CKM A;  3BVG A;  2P5Z X;  1SYF A;  2F0P A;  4RFB A;  5LMN W;  4DR1 L;  2X6L A;  3M4Y A;  3IFT A;  1KRS A;  3TZU A;  4A3L G;  3PIP 3;  3E9I A;  1IBL L;  3Q23 A;  5C3W A;  4BY7 G;  1BXT A;  1FVI A;  1D5Z C;  4BBR H;  4C3I H;  1LTB D;  2K4K A;  3GDE A;  2N55 A;  2CCZ A;  3PCO B;  4CKC A;  1KAW A;  2QKI C;  4JBJ A;  2E5L L;  4RMF A;  2K5N A;  1SLJ A;  1B3A A;  1Y1W H;  3E3X A;  1KIX A;  1PH8 A;  4ZUI A;  2B2T C;  2UXB Q;  2L15 A;  4LF4 L;  1VQ7 A;  2NZ1 D;  3MC0 B;  4HJA A;  4YCV A;  5FK9 C;  3OYY A;  2R92 H;  1IYU A;  2LXJ A;  2VXW A;  1Q8K A;  2MP1 A;  1ZEQ X;  3HOX G;  5A35 A;  3TQY A;  1PFM A;  3Q8D A;  1A15 A;  4G7H C;  1EIF A;  5JJK A;  1T5E A;  2L1B A;  1L1O C;  2EYO A;  2NVT B;  4YHH L;  3NBH B;  2A73 B;  3KF6 A;  4YCW A;  3NXW A;  4DK6 C;  2E2I B;  3J81 j;  4JI1 Q;  2KEN A;  1EIY B;  3NK9 A;  3GTQ B;  2MJ8 A;  4DV1 Q;  2HCC A;  3IRB A;  1MIU A;  2A6E D;  5C44 G;  4HN7 A;  1IW7 D;  4Y7N H;  4HCS A;  4QMG A;  4DV7 L;  4XTC S;  4JI6 Q;  1B2T A;  1TS3 A;  4QIW B;  5KRU A;  5I6Y A;  4I65 A;  3KDF A;  4J6H A;  4LUV A;  1EZ6 A;  1AE2 A;  2NVQ B;  2K5W A;  2IJ0 A;  1B53 A;  5C5M A;  3JC6 6;  1SE8 A;  3STB D;  3K0X A;  4CJ0 B;  1G8Z D;  2DGY A;  1FD7 D;  4O1N A;  4JC0 A;  1VCI A;  3EBE A;  1U5K A;  4DAM A;  4PMB A;  2IX0 A;  4WJW A;  4QY7 A;  3I8Z A;  4LWC A;  2NUC A;  4L5Q A;  1AN8 A;  3FPP A;  2F3V A;  4FF1 A;  1S5D D;  1N32 L;  4P74 A;  3S17 H;  5IE8 A;  4BY1 B;  3BDC A;  1UE6 A;  4HR7 B;  4A93 G;  1LO5 D;  4CKE A;  3VYS A;  1KQS A;  3J7Y W;  3QWN A;  4IPC A;  4C1N K;  2KCN A;  3IFD A;  2FXQ A;  1LUZ A;  3U9S A;  4IFD I;  4MTK A;  3B6Y A;  3ZJY C;  1QZH A;  5E4W C;  4C3H B;  5M5W H;  5IP7 G;  3E0J A;  2G9H D;  1D7Q A;  1AZQ A;  4WOR A;  1TWA H;  2WIN B;  2Q8I B;  2HCI A;  3HOY G;  3HOV G;  5IT9 L;  1G2S A;  2KED A;  2F0L A;  5CR3 A;  5IGB A;  1ILP A;  1CZW A;  3NEN A;  3CXC A;  3T1H Q;  3A8K E;  2NB0 A;  4Y52 H;  5CV4 A;  5CV5 A;  2F0J A;  3NUC A;  3VYT A;  3PUX A;  5FJ8 H;  4BWG B;  3MEH A;  4F87 A;  2L11 A;  1BCP C;  2Z4I A;  1XPU A;  2PNH A;  4HMJ A;  3FKI H;  2MO0 A;  3I91 A;  2VQF Q;  1DZ1 A;  2Q8T A;  3ULP A;  4BY7 B;  2RQX A;  5M5X B;  4A3K H;  5JOB A;  1HZC A;  2F0D A;  2ZTE A;  3BZC A;  4XIG S;  4B3M Q;  5KEE A;  3M7G A;  3I4L A;  4FVM A;  5C3E G;  1HA5 A;  4DR1 Q;  3D4D A;  4H0L C;  1CM9 A;  3QO2 A;  1LM0 A;  1IBL Q;  4OON A;  3CCJ A;  2K50 A;  1PRT B;  4RWS C;  1X6O A;  2Q2T A;  2VW9 A;  3S1M H;  2L55 A;  3HOX B;  4IN3 A;  2WAC A;  3OHX C;  2E5L Q;  2E76 C;  4A3I G;  5C4Z A;  4A76 A;  4LF8 L;  1BVS A;  3PF4 A;  3PUW A;  4X65 L;  3L0O A;  3VR3 A;  1F9P A;  4GOP C;  1SNP A;  1VMC A;  2TSS A;  2ATW A;  5JEA G;  2RSN A;  1QIL A;  2I5M X;  2YTV A;  1ZXT A;  2BA0 A;  2QEX A;  2LFN A;  4K5V A;  2M9V A;  5L37 A;  1B3Q A;  5C44 B;  3M85 A;  1NR2 A;  1AE3 A;  5JJL A;  4M1U B;  1IYJ B;  3UE0 A;  1C7Y A;  5FLM H;  3KK7 A;  2PQE A;  5IGC A;  1A3U A;  2ZXO A;  5JVH 3;  3CRL C;  2EYJ A;  4FP5 D;  4G57 A;  1SND A;  1L1O B;  1MD2 D;  1SYC A;  4GKK Q;  2HUG A;  4PMW A;  4A3D G;  2F3W A;  3KLS X;  4KHV A;  3PO2 H;  2XIW A;  4GN4 B;  1P8L A;  3T51 B;  1E1T A;  5FLX L;  3TS0 A;  4X64 L;  4DV7 Q;  1HR0 W;  4BBS G;  3NWS A;  4OXP A;  3SXH A;  1EZ8 A;  4KY5 A;  3K5L A;  2B2Y C;  5JJZ A;  2G9D A;  2N3S A;  4EQN A;  4ULL A;  1I4R A;  1VQA A;  1ENC A;  3RNU A;  1DXM A;  1U4L A;  1PH1 A;  1NNX A;  3W3A A;  1VF7 A;  1LLR D;  4F88 A;  2KOL A;  5IY0 A;  2KCM A;  2PMZ B;  1I3Q B;  3SHL A;  3I7F A;  3KUP A;  3AMU A;  3I73 A;  2A69 D;  4A93 B;  1GUO A;  4A3E H;  2A6E C;  1IW7 C;  1EWI A;  4HSV A;  4G4K A;  1X32 A;  2EDG A;  2R93 G;  1J5E L;  1TWG H;  4DV3 L;  4A3F G;  4MZ9 A;  1A8V A;  3HGB A;  2WB1 B;  2F0N A;  1WTX A;  3GO5 A;  3KYH C;  2JA7 H;  4MIU A;  3LWE A;  4LW1 A;  4U67 3;  2ZJP A;  4KJO A;  3DUZ A;  5HY6 A;  5C4J H;  3H0G H;  3HOY B;  1O7I A;  1R9T B;  1RKN A;  4BBR G;  3GTG H;  3EQL C;  2UXC L;  3BG3 A;  4JI7 L;  1EL0 A;  5CGK A;  2F0O A;  4PZ8 A;  3U50 C;  1D5M C;  3TS2 A;  1EY7 A;  2H5X A;  3PUZ A;  3CF5 A;  1DOM A;  2K75 A;  1ZKO A;  2X69 A;  4LAA A;  3CC7 A;  2NTT A;  3T53 B;  1PTO H;  1L2F A;  1KNE A;  2VUM G;  2VL6 A;  4FO2 A;  5IT9 c;  3I4N H;  4X6A H;  3GTP H;  3EIV A;  4HIO A;  5E4X A;  4KI0 A;  4GN5 A;  5C3E B;  1UE7 A;  4DV0 L;  3MXN A;  1I5F A;  2UUB Q;  2K5D A;  5GRO A;  3RZD H;  1XX8 A;  1H95 A;  4RGM A;  3EN2 A;  1S5B D;  2B2W A;  1V1P B;  1XNQ Q;  1EFW A;  2EYF A;  4MTN A;  3ONA B;  1S3O A;  1DOL A;  1Z47 A;  3NEM A;  1HH2 P;  3FRP B;  4RCO A;  3HKS A;  3TSS A;  4B08 A;  2MUY A;  2WKD A;  4L8J A;  1WTQ A;  4A3I B;  4V19 0;  3AFP A;  4AQY Q;  2KHS A;  4XT1 B;  1PLF A;  3P20 A;  2CKZ B;  5ELC A;  2R3Z A;  1TWC H;  4O2D A;  1HZ9 A;  3I4O A;  1B7Y B;  2Z6K C;  2NN6 I;  3I4M H;  4WFN 3;  2A5H A;  1YJW A;  2OTJ A;  3JAM i;  2F4V L;  2DY7 A;  2J0T D;  1PRT D;  1DYQ A;  1PVO A;  2ID0 A;  3ERO A;  1N34 Q;  3GTO H;  5FLX E;  3KJO A;  3K8A A;  4OGQ C;  4CJ2 C;  1JJC B;  4DUY L;  2PI2 E;  4A3D B;  3UE1 A;  1DD2 A;  1TVX A;  4K5W A;  2B2T A;  3I3C A;  2XWB B;  2NZH A;  1STA A;  4J8Q A;  2BDO A;  1U0L A;  1YI2 A;  1HFG A;  1U4R A;  4IOA A;  3TRZ A;  4BBS B;  4IPD A;  4C3J H;  1C9O A;  1K73 C;  1WOC A;  4B3S L;  1Y8N B;  4X3K A;  5M3M H;  4P2C B;  2NYZ D;  1M4V A;  3GTJ B;  4DV6 Q;  3DWA A;  2LXK A;  4X64 Q;  1PRT F;  1OO9 B;  3HKZ E;  3CP0 A;  1SN8 A;  4IFD H;  5FOB B;  5FLX c;  1CSQ A;  4LF5 Q;  1HQM C;  5IYB G;  2K03 A;  2R93 B;  3SK5 A;  5IYC G;  2EY1 A;  5FJ8 G;  3PIO A;  4FYD A;  3H3V I;  2F0Q A;  4OWT B;  2Q8R E;  4IUU A;  1WTO A;  3OMC A;  1K8M A;  4DV5 L;  1CT1 D;  3HOU H;  2OQK A;  3H91 A;  1FGU A; 
#chains in the Genus database with same CATH homology
 3CCS A;  3RLO A;  3G48 A;  3M4Q A;  1KRS A;  4MNO A;  4UP7 A;  1Y1W G;  2I0Q A;  4QIW E;  4A3L G;  1WJJ A;  3E9I A;  1QVG A;  1PH2 A;  5IYB H;  1CSP A;  3BJU A;  1IBL L;  1KXL A;  3T1Y Q;  4BY7 G;  3KOJ A;  1QZG A;  2JJQ A;  5IYC H;  4A75 A;  1VQ6 A;  3KF6 B;  4KHZ A;  4UP9 A;  4DK3 C;  4DV3 Q;  1X9N A;  1FVI A;  4BBR H;  3MEF A;  4C3I H;  2OTL A;  2YU9 H;  2R92 G;  3G4S A;  5H1S E;  2K4K A;  5IWA L;  3GDE A;  1PH3 A;  2AWO A;  1GO3 E;  2CCZ A;  3UDF A;  2VY3 A;  3PCO B;  4R4I A;  1KAW A;  4JBJ A;  2E5L L;  1Z9F A;  4RMF A;  2K5N A;  1SLJ A;  1YIJ A;  1Y1W H;  1KIX A;  4GLX A;  1PH8 A;  4A3L H;  2CWP A;  2ZM6 L;  2EIF A;  1PYB A;  2N49 A;  2V1C C;  1YHQ A;  2L15 A;  2UXB Q;  4LF4 L;  4LFC Q;  2HQL A;  1VQ7 A;  2UXC Q;  4JI7 Q;  4OWW B;  3M7N A;  3KF8 B;  4IPH A;  4YWM A;  5M5X H;  3DLL A;  4HJA A;  2JK8 A;  2VS1 A;  1Q81 C;  4YCV A;  1VQO A;  3RLN A;  3OYY A;  4DR5 L;  2R92 H;  2LXJ A;  1Q8K A;  4DUZ L;  3HOX G;  4JBM A;  3TQY A;  2ASB A;  3S1N H;  5JJI A;  3Q8D A;  4A3M G;  4JI8 L;  4YY3 L;  1Q46 A;  2I5H A;  1EIF A;  4NXN L;  5JJK A;  3ERS X;  4P73 A;  1JT8 A;  1X3F A;  4GNX C;  1L1O C;  3J7Z C;  4YCU A;  1S72 A;  2KHJ A;  4YHH L;  3NBH B;  1GM5 A;  2UU9 L;  4JG2 A;  1EOV A;  3KF6 A;  4IPG A;  1OXV A;  2JQO A;  4C2M H;  1XMQ L;  4YCW A;  4JI3 Q;  2RHQ B;  4YWL A;  4DK6 C;  5C4X G;  1G51 A;  4UY8 C;  2NVT H;  3J81 j;  3ICE A;  2D62 A;  3PO3 G;  4JI1 Q;  1WYD A;  2KEN A;  4AYB E;  1EIY B;  2HIX A;  5GAD C;  3TEH B;  4DV1 Q;  1WFQ A;  3IRB A;  1MKH A;  1HNW L;  4PZ6 A;  1MIU A;  3WWV A;  1IZ6 A;  4DV0 Q;  1XPO A;  4LF4 Q;  5C44 G;  5FLM G;  5GAH C;  4HJ9 A;  4A3M H;  1VQ8 A;  4Y7N H;  1NMF A;  1K8A C;  1VQC A;  4DV7 L;  2A8V A;  4XTC S;  4HJ7 A;  1EQQ A;  4JI6 Q;  1RL2 A;  4DR2 L;  2AHO B;  4LUO A;  2D0O A;  3KDF A;  4LUV A;  4X66 Q;  1HJP A;  5C4X H;  3KFU A;  1AE2 A;  1ASY A;  1IL2 A;  2B29 A;  3PO2 G;  3PO3 H;  4YY3 Q;  1VQG A;  2K5H A;  3M3Y H;  3JC6 6;  1SE8 A;  3STB D;  3K0X A;  3GTM H;  3A0J A;  1GVP A;  4JOI C;  4A3J G;  5C44 H;  2ZJQ A;  2DGY A;  4YHH Q;  2UU9 Q;  4NXM L;  2CFM A;  1LYL A;  4JC0 A;  1EQR A;  1VCI A;  2AWN A;  1U5K A;  3EBE A;  5M3F G;  1M90 C;  2UXD L;  4DAM A;  2B63 G;  2Q2I A;  3S2H H;  2IX0 A;  2Z0S A;  1WI5 A;  1I6H H;  4X62 L;  4LF7 L;  1QVF A;  4QY7 A;  4LWC A;  4AH6 A;  4IFD J;  1VQB A;  2NVY H;  1VQP A;  4L5Q A;  1VQ9 A;  2F4V Q;  1K0R A;  1N32 L;  3T1H L;  4P74 A;  4A3E G;  3S17 H;  5IE8 A;  4JBW A;  1VQ5 A;  1YBY A;  4DR3 L;  5LMN L;  2HHH L;  1S40 A;  1HZA A;  5M3F H;  4AYB G;  1UE6 A;  3AYH B;  4A93 G;  1B8A A;  3U58 A;  2B63 H;  1KQS A;  4OX9 L;  3AQQ A;  5DLQ E;  2Y0S G;  4JI5 L;  3M4O H;  4IPC A;  3W1G A;  1NMG A;  3OW2 A;  1OXX K;  3GTK H;  2IHE A;  3CW2 C;  5C0X I;  1V1Q A;  3M9B A;  2FXQ A;  1LUZ A;  1GD7 A;  4DNI A;  3HOZ G;  4IFD I;  2VZA A;  4DR7 L;  4TVA B;  2N78 A;  3B6Y A;  3ZJY C;  1QZH A;  1QUQ B;  1E1O A;  5IP7 G;  5M5W H;  1I3Q H;  1HNX L;  2Q2U A;  2F52 A;  1D7Q A;  1B70 B;  4LF6 L;  3KLW A;  1TWA H;  3FKI G;  5AJ3 L;  4B3M L;  4A93 H;  4LF7 Q;  3HOY G;  3HOV G;  2OQ0 A;  1SFO H;  3CAM A;  4PG3 A;  4OO1 I;  4B3S Q;  2C35 B;  2VQE L;  3NEN A;  5K36 G;  2CWA A;  3CXC A;  2Q2H A;  2A19 A;  3T1H Q;  2WFW A;  3OTO Q;  4A3K G;  1N32 Q;  4Y52 H;  4DR3 Q;  1TXY A;  2HHH Q;  3HOZ H;  4LNQ A;  4GS3 A;  3PUX A;  2I5L X;  3STB C;  5FJ8 H;  2IX1 A;  3K7U C;  5IP7 H;  3A5U A;  2XTI A;  4DV4 L;  4JI2 Q;  1VQJ A;  1XPU A;  2PNH A;  1Q12 A;  3FKI H;  2MO0 A;  2VQF Q;  1I94 L;  4L5T A;  3HOV H;  3HOY H;  3ULP A;  3U4V A;  4DR6 L;  1R9T H;  3W1B A;  2QA4 A;  3I4N G;  1XMO Q;  4JYA Q;  2IHF A;  2PQA B;  5BR8 L;  2JA8 G;  5EAY A;  4A3K H;  1HZC A;  1FJG Q;  4A3B G;  2ZTE A;  4ME3 A;  4LFB Q;  2NZO A;  3BZC A;  1HNX Q;  4XIG S;  3RN2 A;  4BY7 H;  3A74 A;  1IBM Q;  2JE6 I;  1PV4 A;  4B3M Q;  3ULJ A;  1PH7 A;  1QUQ A;  4DV5 Q;  3CCQ A;  4JI0 Q;  4B3R L;  3BZK A;  5C3E G;  4DR1 Q;  1NJI C;  1BBW A;  1OXU A;  5HGQ A;  3I56 A;  4HIM A;  3L7Z C;  1CKN B;  2GN5 A;  3CME A;  1LTL A;  4IO9 A;  1LM0 A;  3CPW A;  4DR4 L;  4J15 A;  1IBL Q;  4OON A;  4L5R C;  1SRU A;  1KRT A;  2JA8 H;  3CCJ A;  2JA9 A;  2K50 A;  4P75 A;  4EQ5 A;  4A3B H;  1X56 A;  1X6O A;  5IYD G;  2Q2T A;  1E3P A;  2VW9 A;  4POG A;  3S1M H;  3LGJ A;  1PH9 A;  5IWA Q;  2PMZ E;  1PH4 A;  1XNR L;  1Y1V G;  3S1Q H;  3I2Z A;  1YHA A;  1IBK L;  2E5L Q;  1N33 L;  2PI2 A;  4A3I G;  3HOX H;  4A76 A;  4GKK L;  3PIP A;  4IJL A;  4LF8 L;  2VNU D;  1BVS A;  2NN6 G;  3D0F A;  2ZM6 Q;  4UPA A;  3PF4 A;  2UUC L;  4NPS A;  4LF9 L;  2Y0S E;  1E24 A;  2PQA A;  3L0O A;  3PUW A;  4X65 L;  4GOP C;  2YTY A;  1HNZ L;  3PUV A;  4POF A;  1K9M C;  2ATW A;  3UDG A;  4DR5 Q;  5IYD H;  5J3B A;  3CMA A;  2ZJR A;  2R7D A;  1L0W A;  5JEA G;  4B3T L;  1NBW A;  4DUZ Q;  2WB1 E;  4WJ4 A;  2YTV A;  2I5M X;  3NEL A;  3BU2 A;  2BA0 A;  2QEX A;  3CCV A;  1PHJ A;  2ALY B;  4WJ3 M;  2CQO A;  2KHI A;  3FHW A;  4JI4 L;  1CKN A;  4JI8 Q;  4A3I H;  3F2B A;  3M85 A;  1YEZ A;  2K5V A;  4NXN Q;  1AE3 A;  4GKJ L;  5JJL A;  2WAQ E;  3F2D A;  1Q7Y C;  3UE0 A;  1IYJ B;  1C7Y A;  4A3C G;  4AIM A;  5FLM H;  1WCM G;  1PYS B;  5M5Y H;  3AEV A;  1XMQ Q;  5GAE C;  2K52 A;  1JJ2 A;  4YWK A;  2B3G A;  5LMU L;  1X3G A;  4LFA L;  2MNA A;  1AH9 A;  1JB7 A;  4GNX B;  1N33 Q;  1L1O B;  4GKK Q;  4DV2 L;  4LF8 Q;  4PMW A;  4A3D G;  3S14 H;  1HNW Q;  4A4I A;  1A0I A;  4LF9 Q;  4X65 Q;  3PO2 H;  3UDX A;  4GN4 B;  1P8L A;  1EYG A;  1E1T A;  1OXS C;  1VQM A;  2E2J H;  3TS0 A;  4X64 L;  1I50 H;  4DV7 Q;  4A3C H;  4A3J H;  1HR0 W;  4B3T Q;  1WCM H;  4BBS G;  1A63 A;  4OXP A;  4DAY B;  3S24 A;  4DR2 Q;  4GOP B;  2F3I A;  1XJV A;  1X3E A;  2GVB A;  2N3S A;  1VQA A;  4DR1 L;  5C0X G;  3RNU A;  3G6E A;  2E2H H;  1IXR A;  1J6Q A;  4A3D H;  1PH1 A;  2GVA A;  2YTX A;  1OTC A;  2MFI A;  2JA7 G;  4NXM Q;  2EQS A;  2EXD A;  2KCM A;  5IY0 A;  1A62 A;  1Q1E A;  3I7F A;  3RZO H;  4QQB X;  1JE5 A;  1N8R C;  2ZTD A;  2UXD Q;  3H0G G;  2JA6 G;  2WB1 G;  4BBS H;  1BKB A;  3M4P A;  4IOC A;  4A3E H;  1SMX A;  2IY5 B;  4KHP L;  3CC4 A;  1G6P A;  1ASZ A;  1EWI A;  4OO1 G;  4IJH A;  4K0K L;  3T1Y L;  2YYZ A;  4X62 Q;  1UWV A;  1XTD A;  4GNX A;  3J7A 5;  1L1O A;  1CKO A;  1TWG H;  1J5E L;  2R93 G;  1C0A A;  3J80 c;  4DV3 L;  2WAQ G;  4A3F G;  1NE3 A;  4DPG A;  2WP8 J;  3CCL A;  4MZ9 A;  1A8V A;  4UP8 A;  2RCN A;  3CQZ H;  3D31 A;  3FP9 A;  1K3R A;  3GO5 A;  3KYH C;  2DUD A;  3ULL A;  4LW1 A;  2JA7 H;  3PUY A;  2ZJP A;  1SRO A;  3E0E A;  5LMN Q;  3H3V H;  1DGS A;  1VQD A;  1EUJ A;  3E9H A;  5HY6 A;  3H0G H;  5C4J H;  2JA6 H;  3MXN B;  1VQN A;  2ES2 A;  2Z6K A;  3GD7 A;  1O7I A;  4OX9 Q;  2UXB L;  4JI5 Q;  4LFC L;  4BBR G;  3HOW G;  1D8L A;  3GTG H;  2UUB L;  2UXC L;  4JI7 L;  4BA2 I;  2R93 H;  2OWO A;  4A3F H;  1VQF A;  2R6G A;  2XGT A;  4PZ8 A;  1GKH A;  3U50 C;  4DR7 Q;  1BBU A;  1T9H A;  2N8N A;  3PUZ A;  2H5X A;  1KD1 C;  3TS2 A;  1YVC A;  3JAM c;  4PZ7 A;  1XNQ L;  2K14 A;  3CCR A;  3CF5 A;  4KHP Q;  3CCE A;  2AMC B;  1MJE A;  3K80 C;  4LF6 Q;  2K75 A;  5AJ3 Q;  4K0K Q;  3CCM A;  4JOI A;  3CC7 A;  1J5E Q;  1E7Z A;  1X54 A;  2R7F A;  2MO1 A;  4FDB A;  3J81 c;  3HOW H;  5ELO A;  1M1K C;  2KBN A;  1L2F A;  1P16 A;  1X55 A;  2VQE Q;  3VDY A;  2HT1 A;  1NY4 A;  2QGQ A;  4AQY L;  2VUM G;  2VL6 A;  1MJC A;  5IT9 c;  4HIK A;  2NVX H;  1PFS A;  2BA1 A;  4JI3 L;  4HJ8 A;  3I4N H;  2AKW B;  4R4O A;  4X6A H;  4LUZ A;  3GTP H;  3EIV A;  4HIO A;  4JI1 L;  2UUA L;  1V9P A;  4KI0 A;  4H02 A;  1KL9 A;  2ZTC A;  3PSI A;  1TWH H;  4DV1 L;  4GN5 A;  4DV4 Q;  1UE7 A;  4DV0 L;  4DKA C;  5ELN A;  1I5F A;  2UUB Q;  4HID A;  1JJG A;  2RF4 A;  1I94 Q;  5GRO A;  3RZD H;  4DR6 Q;  5C3E H;  4BA1 I;  3HKZ G;  1VQH A;  4JI6 L;  2IT1 A;  3KDF B;  1H95 A;  3EN2 A;  4QJF A;  2VUM H;  5BR8 Q;  4A3G G;  4APV A;  4HJ5 A;  3S15 H;  4TQU S;  1SR3 A;  1UE1 A;  3K81 C;  4X66 L;  3J80 i;  1XNQ Q;  5E7N A;  1EFW A;  1RIP A;  5IP9 G;  4MTN A;  3TRE A;  3GTL H;  1S3O A;  1Z47 A;  3CPF A;  1VQI A;  3NEM A;  4R1J A;  1N34 L;  2JA5 G;  3I4M G;  1HH2 P;  3HKS A;  4B3R Q;  3L2P A;  4KLK A;  2E8G A;  1Q86 C;  3AFP A;  5JEA J;  2YV5 A;  4AQY Q;  1JMC A;  4L5S A;  4BXX G;  4OWX B;  1OXT A;  1Y1V H;  4DR4 Q;  2OCE A;  1HR0 L;  2KCT A;  1Q82 C;  3RN5 A;  4A3G H;  2UUA Q;  2CKZ B;  4RG1 A;  1TWC H;  4O2D A;  1HZ9 A;  3I4O A;  2BH2 A;  1B7Y B;  2Z6K C;  5IP9 H;  2E2I H;  4EX5 A;  4JCV E;  2NN6 I;  2JA5 H;  1PA6 A;  4GLA C;  1X65 A;  1V43 A;  3GTQ H;  3I4M H;  2JEA I;  1XNR Q;  1YJW A;  3A5Z B;  3JAM i;  2F4V L;  2OTJ A;  3ER0 A;  1Q1B A;  1VS0 A;  1IBK Q;  4QGU A;  1VQL A;  3I55 A;  4BXX H;  4DV6 L;  1PVO A;  2A1A A;  2ID0 A;  1PH5 A;  2UUC Q;  1CUK A;  1HNZ Q;  3J81 i;  1YIT A;  4P72 A;  1N34 Q;  2MQH A;  3PGZ A;  2D0P A;  3GTO H;  1QVC A;  3KJO A;  3K8A A;  5M3M G;  2R7Z G;  4JBK A;  4QL5 A;  2BH8 A;  2NVQ H;  1NTG A;  3CD6 A;  1JJC B;  3F8T A;  3H15 A;  4DUY L;  5GQO A;  2PI2 E;  1XPR A;  3UE1 A;  4LF5 L;  1N9W A;  3RR5 A;  3K7A H;  1KHI A;  1HR0 Q;  3G71 A;  4JI4 Q;  4R4C A;  1W3S A;  1K83 H;  2NZH A;  4JV5 L;  3HFZ B;  1U0L A;  1YI2 A;  4BY1 G;  3CC2 A;  4GKJ Q;  1YJN A;  5C0X J;  4IOA A;  3TRZ A;  4IPD A;  4IFD G;  3KJP A;  3AFQ A;  4C3J H;  1C9O A;  1N36 L;  1K73 C;  1KC8 C;  1WOC A;  4B3S L;  4GLV B;  4JI0 L;  3F1Z A;  4R4Q A;  3S16 H;  1E22 A;  5LMU Q;  5M3M H;  4LFA Q;  2R7Z H;  1YZ6 A;  2HIV A;  3U4Z A;  2JEB I;  3PF5 A;  3OTO L;  4DV2 Q;  3W5O A;  1PH6 A;  1VQE A;  4O0A A;  4P71 A;  4DV6 Q;  1K8G A;  1W2B A;  1VQ4 A;  3F2C A;  1VQK A;  3UDI A;  2LXK A;  3GTJ H;  4BY1 H;  4JI2 L;  3HOU G;  4X64 Q;  3CCU A;  3HKZ E;  3CP0 A;  2VQF L;  1SN8 A;  4GN3 B;  5FLX c;  1CSQ A;  2RHS B;  1UE5 A;  4DUY Q;  1HZB A;  4LF5 Q;  1XMO L;  1UEB A;  4JYA L;  5IYB G;  1TWF H;  3PIO A;  5IYC G;  3DM3 A;  1FL0 A;  3RLF A;  5FJ8 G;  4R4T A;  4ALP A;  1YJ9 A;  1YNX A;  4GOP A;  1FJG L;  3H3V I;  4OWT B;  3S2D H;  4JV5 Q;  4LFB L;  5GAG C;  1YHB A;  2LSS A;  1G29 1;  1IBM L;  3PV0 A;  1CKM A;  4DV5 L;  1N36 Q;  1Y14 B;  4NB3 A;  4C3H H;  3HOU H;  2OQK A;  5LMN W;  3S1R H;  3SGI A;  1FGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...