4A3LH

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lH00
1L1OC 4YY3Q 4L5RC 4FDBA 4TVAB 2BH8A 2EXDA 1PH6A 4A75A 1I94Q 4OWWB 3JAMc 1T9HA 1EYGA 1NMFA 1IZ6A 4IPCA 4JI5Q 1KRTA 1LUZA 3B6YA 4AQYQ 4JI0L 4R4TA 3S17H 4IOAA 4DV6Q 4DR2Q 3W1BA 3J80c 2ZJRA 1XPRA 2JA9A 1X3FA 5IE8A 1K73C 1CKNA 2K5VA 4R4IA 3ER0A 2E8GA 4B3RL 2K50A 4JBJA 1GKHA 1JB7A 1AE3A 2LXKA 5JEAG 1X3GA 5IWAQ 1TWCH 4JBWA 4DUYQ 3FHWA 2CKZB 2BH2A 2N49A 2VW9A 5IT9c 1PH2A 1KRSA 4JI4Q 4PMWA 1K83H 4A93H 2IHEA 4DV0L 2OQKA 4GLAC 1K8AC 1EUJA 3CD6A 4A3LG 2WB1E 2ZTEA 4ME3A 1YJ9A 5C4XG 2F3IA 3E9HA 4X62L 1CSPA 5C0XJ 4A3IH 4C3JH 1HZ9A 4A3LH 4GS3A 5ELNA 2OQ0A 5M5YH 4NXNL 3GD7A 3FP9A 5C4XH 2ES2A 1EQQA 1BBUA 2BA0A 2D62A 5J3BA 3PF5A 1IBLQ 3HOYG 3M9BA 2UXCQ 4WJ3M 2RCNA 3PUWA 1FJGQ 5ELOA 1P16A 2WAQG 5GQOA 1YEZA 1SMXA 4J15A 3PO3G 3HOYH 2H5XA 1L2FA 4QGUA 1KIXA 4DV3L 4A3JG 3CPWA 5GADC 3S1QH 3KOJA 3PO3H 4UY8C 2A8VA 1MIUA 2KCTA 2N3SA 1YHAA 4JI6Q 2HT1A 1L0WA 1KQSA 1KD1C 1HR0Q 4GN3B 4YWKA 5IYCG 1IL2A 4JCVE 4DK3C 4NXMQ 1YJNA 1GD7A 1HNZQ 1XMOQ 4C3HH 3SGIA 3J81c 4GNXC 1Q12A 3L7ZC 1K9MC 5IYCH 1V9PA 4DNIA 3GTGH 5E7NA 4DR1Q 1HNXQ 3KJOA 3TEHB 3KDFB 3CCEA 2R92G 1D8LA 1SRUA 2FXQA 4BXXH 4B3SL 4DR5L 1Y14B 4JYAQ 2E2JH 2PQAA 1S40A 4P75A 3AEVA 4AH6A 1AH9A 3K8AA 2K5HA 4A3DG 1VQJA 1E22A 1VQBA 3RN2A 3H15A 1OXVA 1NBWA 4NB3A 4A3DH 1JE5A 1WFQA 1IYJB 1U0LA 2AWOA 3ZJYC 2HHHL 3PCOB 1TWAH 1XPOA 4JI2L 3I55A 4PZ8A 3PIPA 1HZAA 4LF5L 1XPUA 3JAMi 4IFDI 4MZ9A 5FLXc 3Q8DA 3GTJH 3CCMA 1OXXK 2F52A 1VQ9A 4LF9Q 1CKNB 2QEXA 5HGQA 3GTPH 3GDEA 1M90C 1E24A 2C35B 4BA1I 1WYDA 3J80i 4DV7L 2JEBI 2QGQA 4BBRH 1HZCA 3UDXA 1Q81C 2UXBL 1C7YA 1QVFA 4HJ9A 1J5EQ 1HR0W 3EN2A 2N8NA 4LF8L 3PO2H 4GKJQ 5JJIA 3I4NH 4DR7Q 4MNOA 4IFDJ 5FLMG 4YY3L 5K36G 2Z6KC 3D0FA 1VQDA 2UUCQ 3D31A 3PF4A 1VQAA 4UPAA 1I94L 5FLMH 3I7FA 2JA6G 1LM0A 4JI5L 4AYBE 3AFQA 1QVCA 2HIXA 1CKMA 4A4IA 4DR2L 4A3CG 4AIMA 2JA6H 1H95A 1K0RA 4B3TQ 2KBNA 3HFZB 2KCMA 2AMCB 1MJEA 1VQ8A 2UXDQ 4A3CH 3UDIA 3PUYA 3S2HH 4LF7Q 4A3GG 5IWAL 4DUYL 3HOXG 1KAWA 1VCIA 4JI1Q 2GVAA 3A0JA 3TQYA 1P8LA 1NMGA 2UUBQ 1IBKQ 4A3GH 4RMFA 3HOXH 1LYLA 4LFBQ 4DV5Q 1SLJA 1DGSA 3KLWA 2E2IH 3RNUA 4DR4Q 3CP0A 2IX0A 4POFA 3HKZE 2Q2UA 4LUZA 4GOPC 3KYHC 4LW1A 5LMNQ 1A0IA 3CCSA 2UU9Q 5C44G 4B3RQ 3J81i 3RR5A 2ZM6Q 3S24A 3GO5A 1IBLL 1R9TH 1G291 1I6HH 2PMZE 1QUQA 5C44H 2ZTDA 5GAHC 1VQFA 5AJ3Q 4DV1L 3MXNB 2IT1A 1PYSB 2PQAB 4DV4L 3STBD 3CCVA 4NPSA 2VUMG 3GTQH 5IYBG 1YJWA 4DV2Q 4BY7H 3U4VA 4UP8A 4JI6L 1VQIA 1N32Q 3K7UC 3CCJA 2VUMH 1HR0L 4RG1A 1Q8KA 5IYBH 3A5ZB 4NXML 1HNZL 3CCUA 1XMOL 3VDYA 4B3MQ 2Q2IA 2Y0SG 3T1HQ 3NELA 2L15A 4POGA 3T1YQ 4YHHQ 3CC2A 1PH4A 4JBKA 1J6QA 4DR1L 2UXDL 4PZ7A 1I50H 1XMQL 1HNXL 3TREA 3U58A 4KHPQ 3GTKH 4A93G 4LWCA 5C0XI 3NBHB 3F2DA 3CC4A 4DAYB 5FJ8G 3ULPA 3S1MH 4GN4B 4GLXA 1Q86C 2RF4A 3KF6A 5FJ8H 1N34Q 4A3IG 4KHZA 2NVXH 2Q2TA 4OX9Q 1NE3A 4APVA 2WAQE 4JBMA 3M4OH 2R7DA 1WJJA 3TS0A 1HZBA 4OWXB 1KC8C 2BA1A 3G71A 4TQUS 3F2CA 4LFCL 5LMNW 2E5LQ 4EQ5A 2RHQB 1XNRL 2VNUD 1Q1BA 2B29A 1HNWQ 4JI7Q 3AYHB 3U4ZA 2OCEA 1X6OA 2K4KA 1VQEA 1YITA 4HIKA 3WWVA 3HKSA 4PZ6A 4O2DA 4LF9L 4HJAA 4HIMA 1Z9FA 2HQLA 1X3EA 1HJPA 5IP7G 1XNQL 3HOWH 2D0OA 3KFUA 1JJCB 1J5EL 3E0EA 4GKJL 4IJHA 3PSIA 3CPFA 3CF5A 4OONA 5IP7H 1SR3A 2VZAA 4DR7L 1YIJA 4R4OA 1V1QA 3S14H 1V43A 2NN6I 3K81C 2QA4A 2LSSA 5LMUQ 3NEMA 4OXPA 2R7ZG 1E1OA 4BXXG 2V1CC 4LNQA 1YVCA 2YYZA 2YTVA 3CMAA 2R7ZH 4LUVA 2VS1A 1VQGA 5GAEC 1KXLA 1ASZA 1A8VA 4B3TL 1CUKA 2VQEQ 5EAYA 1FVIA 1L1OA 2HIVA 1QUQB 4XTCS 4YCWA 4IPGA 3KF8B 4P72A 2CWAA 1ASYA 4LF7L 2R7FA 4LF4Q 2I5HA 5C0XG 4HJ5A 3H0GG 1YNXA 4P73A 5IP9H 4HJ8A 2UUBL 2UUAQ 1IBKL 1JMCA 1IBML 2KHIA 4LFBL 4DV5L 3H0GH 3PUZA 4DPGA 4LFAQ 4DR4L 4DR6Q 2A19A 4JOIA 4YWLA 3K7AH 3NENA 3I4OA 4BBRG 5C4JH 1X9NA 5LMNL 2UU9L 3BU2A 5GROA 1PH8A 3A5UA 1GM5A 1YZ6A 3PO2G 2Q2HA 5C3EG 2ZM6L 1MJCA 3BZCA 4DUZQ 4HIOA 3I4NG 3PIOA 4DR3Q 2GN5A 1N36Q 1CKOA 2JEAI 3J7ZC 5C3EH 1WOCA 1G6PA 2YV5A 3L0OA 4JC0A 2DGYA 2XTIA 1BBWA 3KF6B 1TWGH 3U50C 4DV2L 1N32L 1O7IA 4O0AA 1OTCA 2PNHA 2K52A 3S15H 1NTGA 1B7YB 1Y1VH 2ZJPA 3ULLA 1UWVA 1X54A 3RN5A 4AQYL 5M3FG 2JJQA 4DV6L 4B3ML 3AFPA 3T1HL 1PA6A 2I5MX 2NN6G 3EBEA 3T1YL 1YBYA 2EQSA 4YHHL 3S16H 4GKKQ 5M3FH 1VQMA 1XTDA 1E3PA 4KHPL 4ALPA 3RLOA 2JQOA 4P74A 4X65Q 3RLFA 4MTNA 3CXCA 2GVBA 4HIDA 4JI4L 4IPHA 3RZOH 1WCMG 4BBSG 1N34L 1G51A 2N78A 3M7NA 1PH5A 3HOUG 3M4QA 4C2MH 2B63G 4Y7NH 1CSQA 1WCMH 1TWHH 4BBSH 5JJLA 3CW2C 3ULJA 1E1TA 3HOUH 4OO1I 2B63H 3BJUA 2E5LL 3J81j 1GO3E 4KI0A 1XJVA 1N8RC 2UXCL 4UP7A 4JI7L 1HNWL 1FJGL 5BR8Q 1JJ2A 4IFDG 2NVYH 3M3YH 2MFIA 1N33Q 4BY7G 2CFMA 3GTLH 5DLQE 1UE7A 1VQLA 3HOZG 5H1SE 1L1OB 3AQQA 4A3BH 3G6EA 4A3MG 1OXUA 2K14A 4K0KQ 2D0PA 3HOZH 4KLKA 3HOVG 1N9WA 4A3MH 2E2HH 3CCLA 2OTJA 4YCUA 3OW2A 3F2BA 3CCQA 3HOVH 5LMUL 1EWIA 1UE5A 2K75A 1S72A 1VQKA 3LGJA 4JI8Q 4WJ4A 4X6AH 2KHJA 4LF6Q 3I4MG 3HKZG 2CQOA 2ID0A 1SE8A 5GAGC 3OTOQ 4A3FH 2YU9H 1PH1A 4JYAL 1OXSC 2VQEL 3GTOH 1M1KC 3I4MH 2ZJQA 1VQNA 2Z6KA 3JC66 3UDFA 4X66Q 3KJPA 4DKAC 4DK6C 4LF4L 3I2ZA 2RHSB 3M4PA 4PG3A 3PUXA 4QIWE 1VQPA 4QY7A 4YWMA 2VQFQ 1KHIA 1YHQA 2UUAL 4X64Q 2F4VQ 1EIYB 1EQRA 3DLLA 1VQ5A 1BVSA 1B70B 1VQHA 3F1ZA 3PV0A 1PH3A 1UEBA 1EIFA 4JOIC 3H3VI 2IHFA 4LFAL 1FL0A 2NVQH 4DR6L 4R4CA 4A3EG 1SROA 2NZOA 3HOWG 4OO1G 5M5WH 1IXRA 2I0QA 3RLNA 1OXTA 1FGUA 4QQBX 4HJ7A 3G4SA 4P71A 4IOCA 2PI2A 4A3EH 2LXJA 1PFSA 1YI2A 2CCZA 1WI5A 4DUZL 2A1AA 2JA8G 4DR3L 1N36L 5HY6A 5M3MG 1NJIC 5M5XH 3RZDH 3S2DH 2JA8H 1VQ6A 2MO0A 1A63A 4H02A 2CWPA 5M3MH 3S1RH 1QVGA 1I5FA 2UUCL 2JA7G 1A62A 2Z0SA 4GNXB 4GOPA 2OWOA 2JA7H 1MKHA 1W3SA 2AKWB 2VL6A 1PHJA 2WB1G 2WFWA 3GTMH 4L5SA 1UE1A 1Q82C 4JV5Q 1HH2P 4JI3Q 4DV1Q 1SFOH 4DV4Q 4GKKL 5IP9G 1TXYA 3A74A 3MEFA 1UE6A 4X65L 3I56A 4A3JH 4A3KG 3CC7A 1PYBA 4JI1L 1X56A 4GLVB 1QZGA 4JI0Q 3G48A 2ATWA 4A3KH 1Q1EA 1VQ7A 4C3IH 4IJLA 1VS0A 2XGTA 1VQ4A 1XMQQ 2MO1A 3PUVA 2JK8A 1B8AA 2K5NA 3W1GA 1Q7YC 2IY5B 4DAMA 1K8GA 2R92H 4R1JA 2JA5G 2R93G 4UP9A 2MQHA 5IY0A 4DV0Q 4JG2A 3CAMA 4L5TA 4BY1G 5BR8L 1X55A 1C9OA 1Y1WG 2JA5H 3CMEA 2R93H 1JJGA 5AJ3L 1N33L 4X62Q 3H3VH 4IPDA 3TS2A 4BY1H 1Y1WH 1Y1VG 2ZTCA 4LFCQ 4NXNQ 4QJFA 1XNRQ 1S3OA 3OYYA 2MNAA 1PH9A 2IX1A 1RL2A 1GVPA 3PGZA 2JE6I 3W5OA 4YCVA 1YHBA 4DV3Q 4XIGS 1SN8A 4LUOA 2PI2E 2NZHA 1XNQQ 1TWFH 3IRBA 4JI8L 4GN5A 3S1NH 4A76A 3M85A 1W2BA 3CCRA 4LF6L 3K0XA 3UE0A 2AWNA 2VY3A 2NVTH 3OTOL 2DUDA 4Y52H 4EX5A 2R6GA 1Z47A 2ASBA 4GNXA 4X66L 4OX9L 3UE1A 4OWTB 4QL5A 1LTLA 2VQFL 1EFWA 3UDGA 3STBC 1K3RA 5JJKA 3ERSX 4X64L 3L2PA 4B3SQ 4IO9A 4DR5Q 2F4VL 4GOPB 1Q46A 3DM3A 2KENA 4AYBG 2OTLA 5JEAJ 4A3BG 2Y0SE 1AE2A 1PH7A 3FKIG 1C0AA 1EOVA 5IYDG 2HHHQ 4K0KL 1QZHA 1IBMQ 1E7ZA 1BKBA 3FKIH 4JI2Q 2WP8J 4L5QA 5IYDH 1I3QH 2EIFA 1RIPA 4BA2I 1PV4A 4LF5Q 3KDFA 1JT8A 2I5LX 1KL9A 4R4QA 1VQOA 1VQCA 1X65A 3ICEA 1PVOA 2B3GA 1D7QA 3TRZA 3BZKA 4DV7Q 3E9IA 2UXBQ 1NY4A 3CQZH 2YTXA 4A3FG 2AHOB 3EIVA 3J7A5 4LF8Q 2ALYB 1U5KA 4JV5L 3K80C 2YTYA 3F8TA 4JI3L
chains in the Genus database with same CATH superfamily
2L12A 4N9TA 4A75A 4BS9A 2EYJA 2DJFC 1T9HA 1QCBD 2X6GA 5JPMC 2B8FA 1LUZA 4DF7A 4R4TA 3R3OA 3VYTA 3HGBA 5ELFA 2PZUA 2K50A 4JBJA 1JB7A 1EQTA 1X3GA 5IWAQ 1ENAA 1ENCA 2CKZB 2SEBD 2WACA 4PMWA 5JEAH 2LFNA 4A93H 2NTSA 1S5DD 3V96A 1PMRA 4A3LG 2F3IA 3E9HA 5C0XJ 2RDFA 1K8MA 1HZ9A 2L0CA 3PMFA 4GS3A 4MN3A 3GD7A 4KKSA 1O7LA 1IBLQ 3OWFA 2UXCQ 2RCNA 1FJGQ 2WAQG 3PO3G 1YEZA 1SMXA 3HOYH 4QGUA 4A3JG 4DU9A 4Q5VA 2WIIB 4ILWA 4JI6Q 2HT1A 3HRZC 1KD1C 2IW3A 4YWKA 5IYCG 1F2MA 1HNZQ 1XMOQ 2EYPA 1B3AA 1K9MC 3MZ5A 3GTGH 3KJOA 2R92G 1SRUA 5EBDA 4BXXH 4DR5L 1Y14B 3MXNA 2PQAA 4P75A 1HCZA 1AH9A 3BVMA 3RN2A 4ZCKA 1OXVA 1EFID 1L0YB 1JE5A 1V1PA 1JB3A 1WFQA 1D2BA 1FNWA 4PZ8A 1S5ED 4IFDI 2F52A 3OIQA 2QEXA 3GTPH 2XWBB 4BA1I 4ZQ3A 4BBRH 1HZCA 1QE6A 5I2XA 1C7YA 1QVFA 1J5EQ 3PO2H 3EN2A 5JJIA 4Y7NB 4DAPA 2EY5A 3J81E 3HOUB 1II3A 2Z6KC 1VQDA 3PF4A 4UPAA 2PZTA 4OEMB 3ITPA 1LM0A 5CV8A 4DA2A 1CHPD 4G7ZC 3M3YB 3LWEA 4AIMA 5CBEE 1STAA 4B3TQ 2AMCB 4B9XA 2VXWA 3PUYA 5IGGA 3HOZB 3K58A 5IWAL 3HOXG 1VCIA 1DONA 4QUCA 1P8LA 3VR5A 1NUCA 4A3GH 4BWGB 3HOVB 3H91A 3QR8A 3NSWA 1Y8PB 3HKZE 5CV9A 2SNSA 2Q2UA 2F0LA 1VF7A 4GOPC 1KDAA 2QKIC 3CCSA 4A3FB 5EPKA 4ME5A 4MHEA 3J81i 1WTXA 3GO5A 1IBLL 1I6HH 1SE2A 2PMZE 5C44H 1SE4A 2F0IA 4DV4L 5KNCA 2VUMG 3TP8A 4UP8A 2AUKA 1VQIA 4JI6L 1N32Q 4HR7B 1X3PA 4HMJA 1Q8KA 2KEDA 4MTKA 1HNZL 1XMOL 4B3MQ 2AUJD 3NELA 2L15A 4POGA 3T1YQ 1RKNA 1J6QA 4A3EB 2HQEA 3U58A 2NUCA 1RD9D 3WDNA 3Q23A 3GTKH 5C0XI 2O5JC 3A8KE 4DAYB 3ULPA 1O7YA 1PRTB 4GN4B 3S1RB 3LNNA 1B50A 5D3DA 1Q86C 4F8MA 2NVXH 3DWAA 2JA7B 4APVA 1WD1A 1IYVA 2R7DA 1WJJA 5JVG3 3TS0A 1KC8C 3MVVA 4RHSA 5D3IB 5LMNW 3D4WA 4KJOA 4FYDA 4EQ5A 2RHQB 2OXPA 5DM63 1PRTF 3AYHB 3U4ZA 1YITA 1X6OA 1YNND 4A3JB 1QWYA 4PZ6A 4HJAA 4FNFA 4XQQA 2HQLA 1HJPA 2D0OA 4C3IB 5DEHA 1JJCB 4IUQA 1J5EL 1KTKA 4FF4A 4IJHA 4OONA 5CYUA 1IKMA 1TVXA 1LTSD 4KMUC 2QA4A 5LMUQ 2R92B 4OXPA 2R7ZG 4DGZA 2DJGC 4JVZA 5ISRA 4B3TL 2FINB 1CUKA 4BY1B 1Y1WB 1SNMA 1FVIA 2HIVA 1QUQB 4XTCS 2FMCA 1WVLA 1ASYA 4X3KA 4ZRZA 2R7FA 1U4RA 2I07B 2HD3A 1JE4A 1JMCA 2KHIA 3PUZA 5C4ZA 1HA5A 1TS5A 2GA4B 4LFAQ 4DR6Q 4JOIA 4YWLA 2DNEA 1NNXA 2A73B 3I4OA 1SNOA 1GM5A 1YZ6A 4CKEA 4HIOA 5C3EG 3OWEB 2EJGC 1ILPA 3T16A 3MC0B 4DXGA 1Q8IA 1KDBA 1G6PA 3D6CA 4JC0A 1XYIA 2XTIA 3KF6B 2A6ED 1N32L 1QG7A 2PNHA 4IALA 3SK8A 1EZ6A 2ZJPA 1S5CD 1UWVA 3ULLA 3QIAA 4AQYL 5M3FG 2JJQA 3NWTA 3QG1A 4B3ML 4GZYC 3AFPA 3FPPA 2NN6G 3T1YL 2EQSA 3E3XA 5CR3A 3K0YA 3MAQA 3FKIB 3OOCA 1XX8A 2DNCA 1GUTA 1EY9A 1PZKD 2K5DA 3CXCA 2GVBA 1LTBD 4HIDA 3T56B 5JVH3 5C6AA 1WCMG 1G51A 2N78A 1PH5A 3M4QA 4WORA 3H94A 2M9VA 3DM1A 4Y7NH 5JJLA 1IYUA 3ULJA 3HOUH 1D5MC 3BJUA 1WTWA 4PQXA 3J81j 1GO3E 1XJVA 5A2QL 4UP7A 4KKUA 2IX3A 3M3YH 4BY7G 2QF7A 1N33Q 2IPKD 2QILA 5H1SE 1L1OB 2B2YC 2NB0A 2BOSA 4QUFA 3G6EA 4NMZA 5DAUA 3EFXD 3H6MA 3HOZH 3NUCA 2XWJB 3CCLA 5IT9L 4JPBW 3CCQA 3HOVH 1K83B 4HMIA 3WOFA 5LMUL 1EWIA 1UE5A 2K75A 4WJ4A 3NHHA 4LF6Q 3HZXA 2ID0A 5GAGC 1HTLD 4N8X1 4A3FH 2YU9H 1OXSC 2Z6KA 1Z6HA 3KJPA 4DKAC 4DK6C 3I2ZA 2RHSB 3PUXA 4QY7A 1KHIA 1YHQA 1EU4A 1VQ5A 3DLLA 1BVSA 3PV0A 1UEBA 3S9WA 1W6KA 3H3VI 4LFAL 4FF2A 2Z1CA 4DR6L 1STHA 1DXMA 1PRTC 2QW7A 2CW0D 2OEOA 3OSOA 4HJ7A 2ES2A 4IOCA 4A3EH 1DOLA 2ICIA 5E4XA 2CQAA 3S1RH 1I5FA 2A69D 1A62A 2Z0SA 1GOZA 4GOPA 2OWOA 2B39A 2JA7H 1MKHA 1SYEA 3FVQA 5I9PA 2PNRC 1BCPF 3U9SA 2H1EA 1O80A 2QDLA 5KNDA 3A74A 1B1ZA 3HS0C 3MEFA 4A3JH 1PTOD 1PYBA 5FLXL 4JI1L 4GLVB 1QZGA 1BF4A 2ATWA 1VQ7A 1AZQA 4C3IH 3U9OA 1VQ4A 1XMQQ 2JK8A 4KD3A 1B8AA 2IY5B 4HSVA 4XT1B 4DAMA 1KNAA 2BE5D 2R92H 2EY1A 2JA5G 4DV0Q 2Z4IA 1SYFA 2F0OA 3NK9A 2E75C 5AJ3L 1N33L 4IPDA 3TS2A 4BY1H 1Y1WH 4LFCQ 4NXNQ 5I9OA 1ZYRD 2IX1A 1RL2A 2JE6I 3D4RA 1JQYD 4YCVA 1YHBA 2F0DA 4DV3Q 4XIGS 1V8QA 2PI2E 4LUOA 2NZHA 3D8GA 1A3VA 1CQVA 3M85A 5KGUA 2EYMA 4LF6L 3K0XA 1WCMB 1A6XA 4EX5A 3W3AA 4O1NA 1HA6A 1SSOA 1Z47A 4GNXA 3T53B 1F2YA 1CM9A 2KUMA 4QL5A 1K3RA 4R8IA 1HHVA 3D3RA 3GTQB 3T13A 4BY7B 1AEXA 1BUVT 3I72A 3VYRA 2CH4A 3SK4A 1LT4D 1XTCD 3VR4A 4ZUIA 3FKIH 1GXDC 1QB5D 1PV4A 1I4QA 2I5LX 3TBIB 4R4QA 1EYAA 3Q0AA 1FNUA 4DV7Q 3E9IA 1NY4A 2YTXA 2B2TC 3J7A5 2F0GA 1LO5D 4OL7A 1L1OC 4YY3Q 1PH6A 1U9RA 3L3OC 5CMDA 4OWWB 4KJNA 1EYGA 3A7AB 1IZ6A 4IPCA 4JI5Q 1IW7D 1EIHA 1BO0A 1TS2A 4DV6Q 3W1BA 2ZJRA 2K1BA 4R4IA 1JWSD 2E8GA 3OPOA 4NDXA 5CORA 3FHWA 2BH2A 1TY2A 5IT9c 1KRSA 4JI4Q 1K83H 4X3TA 4DV0L 3HP3A 4GLAC 2HCIA 4C3JG 2F0MA 5C4XG 1CSPA 1TS4A 3WOEA 1YNJD 4NXNL 3FP9A 5KRUA 1EQQA 1KLUD 1LV9A 2D62A 4DNRB 2PYKA 4XQJA 3M9BA 2F03A 4J15A 5JOBA 4K5XA 4DV3L 3KOJA 2A8VA 1MIUA 4HEDA 3JAME 1L0WA 3I90A 2B2YA 4ODGA 3NTIA 3K7AB 4JCVE 5HURA 3SGIA 3J80E 5CV5A 2EJFC 1MGSA 4J8QA 3TEHB 1DYQA 2F1MA 3KDFB 2B2WC 4PMCA 1D8LA 2JA5B 2O2LD 4ZUJA 4TRDA 4AH6A 3K8AA 2K5QA 4A3DG 1VQJA 1E22A 3H15A 1XXGA 3S15B 4NB3A 2VB2X 1U0LA 1PFNA 2HDLA 4JK1C 3S16B 1XPOA 3I55A 4IQZA 3JAMi 5FLXc 3Q8DA 1OXXK 1VQ9A 4LF9Q 1CKNB 1F77A 5HGQA 4DAYA 1PFMA 3J80i 4DV7L 2QGQA 4RA8A 3UDXA 1Q81C 4K5WA 4HJ9A 3HG9A 4IFDJ 4BBSB 4YY3L 2B63B 5FO9B 2UUCQ 1VQAA 3C3LA 5FLMH 5K36H 2JA6G 4JI5L 4AYBE 3AFQA 1QVCA 1LACA 2DN8A 2NVYB 3DEPA 5ELCA 4A4IA 1XWEA 1K0RA 1TIID 2KBNA 1MJEA 1HFNA 4A3CH 5IGBA 2PO4A 4RGMA 1I4PA 1F2ZA 3A0JA 2UUBQ 1NMGA 3TSSA 4KD4A 1DOMA 4LFBQ 1LYLA 1SLJA 5D14A 5IODA 2IX0A 4POFA 1QNKA 2AQ3B 1HRJA 3KYHC 1WTOA 2UU9Q 1IHZA 2EPBA 3EA6A 3RR5A 3HKZB 3GTOB 3I4MB 1G291 1G2TA 1SNPA 3NWSA 1QUQA 5J22A 4K5VA 3VYUA 2IT1A 1A15A 3GTQH 4BY7H 4DV2Q 3URYA 2PMZB 3K7UC 4RG1A 2NVQB 5IYBH 3KUPA 3VDYA 2Q2IA 3IAYA 5M5WB 3SVMA 1ONLA 2VB3X 1PH4A 1U4MA 5FKAC 3R2TA 3FPUB 3F2DA 4K8IA 2JA8B 3I73A 1PZJD 5M5YB 5FJ8H 3KF6A 3TMEA 3CRKC 4A3IG 1N34Q 4OX9Q 2MGSA 1ET6A 4B9WA 3GTMB 2C5CA 4OWXB 4G57A 4TQUS 3F2CA 1SFOB 4QCLA 2FMMA 2VNUD 1XNRL 1Q1BA 3E6ZX 1HNWQ 1WTHA 2OCEA 2K4KA 3DUZA 4HIKA 2ZT9C 4O2DA 4LF9L 2V4DA 4HIMA 1Z9FA 5LL6X 5NUCA 4A3KB 1X3EA 1XNQL 5IP7G 3KFUA 4HSPA 2B2VA 3E0EA 1RDPD 5I2YA 2Z8LA 3CF5A 3R2IA 1YIJA 4R4OA 2K32A 3IKJA 3K81C 1UAPA 2LMCB 3TZDA 3KLSX 2EVBA 5JAVA 4LNQA 1GUGA 1EY0A 1YVCA 2NWGA 1KXLA 1ASZA 1A8VA 5EAYA 2F0PA 1L1OA 2B2UA 4YCWA 5C0XG 4U673 3H0GG 1YNXA 4P73A 4HJ8A 2CH4W 2UUBL 3GTJB 4LFBL 1LT3D 5EJWA 1BNZA 1TWFB 4UAIA 2J7ZA 4H13C 3K7AH 2NVTB 4KHVA 1X9NA 1GUNA 3IFTA 1PH8A 3PIP3 1TQOA 4V0BA 2UU9L 2Q2HA 3K6OA 1MJCA 3BZCA 4DR3Q 2GN5A 4DN4M 1N36Q 2JEAI 3J7ZC 3SXHA 1LT6D 2F0VA 2DGYA 3U50C 4DV2L 2K52A 3S15H 1NTGA 1B7YB 4H44C 1B3QA 5FO7B 4YIJA 3I4LA 3S16H 1IKLA 1EEID 1EY5A 3E5SA 3RLOA 4P74A 4ALPA 3RLFA 1RODA 3O13A 1J8IA 1SNQA 2EXZA 2XRQD 1N34L 3M7NA 2F3VA 2Z4HA 1B9MA 4BBSH 3CW2C 1E1TA 2SOBA 2B2WA 2B63H 1C48A 3A8JE 4DFAA 2UXCL 4O42A 1HNWL 1FJGL 2ENBA 5BR8Q 3KF8A 2NTTA 2NVYH 2MFIA 5DLQE 1M8AA 1VF5C 2DY8A 4ID6A 1OXUA 4F7XA 4A3MG 3VR6A 1G2SA 1AW7A 4F87A 5J39A 1X32A 1CQFA 2KQ3A 3MXGA 5COYA 5FO8B 1KABA 3BVGA 1S72A 3LGJA 4JI8Q 5IOCA 4ZKCB 2KHJA 3DHQA 4PV1C 1SE8A 4A3IB 1QJOA 3QB3A 3GTOH 4K8JA 3I4MH 3PQIA 4X66Q 3UDFA 4QIWE 4YWMA 4EVOA 3ONAB 1EIYB 4JW0A 3S1QB 2WAQB 3PO3B 3K59A 5CV7A 2O5IC 1FL0A 2NVQH 4KTAA 3R93A 4R4CA 3OW7A 4C1NK 2NZOA 3HOWG 1D6EC 5M5WH 1IXRA 4QQBX 3QOLA 1JC7A 1YI2A 1PFSA 2Q8IB 4OO1H 1JOOA 4DR3L 2NYZD 1N36L 2J4XA 5M3MG 1NJIC 3MFYA 2K28A 2JA8H 3J7YW 1FR3A 1QVGA 2XIWA 1TR5A 3V05A 3CRLC 2E2JB 1W6JA 3AU7A 1DM0B 2F0JA 2AKWB 2VL6A 1PHJA 3GTMH 1A3TA 1SYDA 1UE1A 1HH2P 4JI3Q 4RHRA 4DV1Q 1SFOH 5IP9G 1EEFD 1TXYA 5A2QE 4JI0Q 3SR1A 4A3KH 3P7JA 1CFMA 4L6TB 5EPLA 1SMYD 1ET9A 2K5NA 3W1GA 1Q7YC 1F9PA 2F0NA 4H7BA 1K8GA 1GHJA 2R93G 2KHSA 3RMHA 5E3FA 5KYLA 1WD0A 1BOSA 4L5TA 5BR8L 3QO2A 1CTMA 2WV6D 3MWYW 1HQMC 2XRSD 4QJFA 2PCFB 4LK1C 3OYYA 2MNAA 1PH9A 3NQIA 5ELEA 1R4QB 3PGZA 3S2HB 2F4IA 1SE3A 1JWUD 2CVRA 1RF2D 2AQ1B 5C3WA 1WTPA 3HOXB 1TWFH 4JI8L 2PZWA 1Q90A 4GN5A 4DNTB 2E2IB 4OIKA 1W2BA 2NVTH 4Y52H 1X3QA 4RCNA 1JICA 4KKTA 4X66L 1R9TB 2LY7A 1A2TA 4L63B 4NP5A 5JJKA 3GV3A 3L2PA 4B3SQ 4IO9A 4FXDA 1FGBD 5BN3A 3DM3A 5EGTA 4KY7A 2VUMB 2A6HD 4AYBG 3BDCA 3SDZA 5JEAJ 1JCKB 1C0AA 1EQVA 2RDGA 1M4VA 3HEJA 5IYDG 2HHHQ 1DJRD 1BXTA 1IBMQ 1E7ZA 3DWPA 4JI2Q 4XYQA 1I50B 2EE1A 4BA2I 3KDFA 4C56C 1VQCA 1PVOA 3ICEA 1D7QA 3TRZA 3BZKA 2XN9C 3EIVA 2KVMA 4LF8Q 2ALYB 1U5KA 3M4OB 1EYDA 3F8TA 4JI3L 4L5RC 4FDBA 5JPNC 2EXDA 2R61A 3GQBA 3P20A 1YNNC 1O7ZA 4RGNA 5G3LD 4G4KA 3VR3A 3F2UA 1KRTA 4JI0L 4IOAA 4DR2Q 3BVZA 4RH6A 5IE8A 1CKNA 3T4AC 3HOWB 1S5BD 3W2DA 3NBIA 2LXKA 5JEAG 1PTOB 4JBWA 1KDCA 3RZDB 4J1MA 3TP6A 2VW9A 1PH2A 4HTHA 2RKSA 3MTSA 4FF1A 3S14B 2IHEA 5AFWA 3SK5A 2OT2A 3CD6A 2F0HA 4PNYA 2WB1E 1BCPB 2B8GA 5E1FA 4A3IH 2R7ZB 4A3LH 1PTOF 1BBUA 3V2TA 3HOYG 3PUWA 5GQOA 1L2FA 3CPWA 3S1QH 4FXKC 3PO3H 4UY8C 3K57A 3NQTA 5CBAE 1KQSA 1HR0Q 3EQLC 4V190 4GN3B 5FK9C 4WRDA 4DK3C 1SNDA 3J81c 5C4JB 5IYCH 4DNIA 1MD2D 1PFBA 5E7NA 1HUNA 3SK6A 1HNXQ 3A56A 1LTID 3CCEA 3KBGA 1RJTA 5C3EB 2A6EC 4B3SL 2EY2A 2IWHA 2SDFA 2E2JH 4JYAQ 1S40A 1TWGB 2K5HA 5KNBA 2TSSA 4CGYB 4FF3A 1IYJB 2HHHL 3ZJYC 3VA5A 3PCOB 4UHVA 5C0XH 3X3MA 4JI2L 5M3FB 3PIPA 5E4WC 1XPUA 1ENFA 5IGCA 3CCMA 1NR4A 3QJYA 3GDEA 5A35A 3TZUA 5KYIA 1ICFB 1WYDA 3RZOB 2JEBI 2RDHA 3DEOA 4LF8L 2N8NA 4C2MB 1TWHB 1V1OA 3D0FA 2PW7A 3E0JA 2FJ2A 2X69A 3I7FA 1E2VA 3I8ZA 1QILA 4DR2L 2KJXA 3GTLB 1H95A 3HFZB 1MSGA 2Q8TA 2QEJC 3S2HH 2K04A 4LF7Q 4A3GG 3EVQA 2PPBC 4QMGA 2GVAA 3TN2A 2E2HB 4RMFA 3HOXH 4N8FA 1SJHD 4Z9CB 2E2IH 4DR4Q 2G5DA 4EQNA 1SJED 4WFN3 1A0IA 4B3RQ 5C44G 3EJIA 4ABNA 1STBA 4CDCC 2MPMA 3S24A 1R9TH 2C9OA 2ZTDA 5IGDA 4M1UB 1K3BC 1OO9B 1VQFA 2K33A 4S3SA 3STBD 4NPSA 1YJWA 1HXYD 3C1EA 3CCJA 2VUMH 1HR0L 1S4ZA 3CCUA 2CW0C 1MSHA 1SYCA 3LWUA 5ELBA 2Y0SG 3T1HQ 5CV6A 1D5ZC 3SHLA 3G7LA 4JBKA 3FEWX 1I50H 3P1HA 4CKBA 4E6IA 1XMQL 1HNXL 3TREA 2K03A 3NBHB 3CC4A 2A69C 1EY8A 2WINB 4KV6A 4GLXA 1AFPA 2F0FA 1AZPA 3LX0A 2Q2TA 1U4PA 1H9MA 2MP1A 3M4OH 1HZBA 3G71A 4LFCL 2MHVA 4XQNA 2E5LQ 5EBCA 4JI7Q 5LL6S 1PTOC 1VQEA 1D1KA 2F0WA 1ML0D 2E2DC 3CHBD 3HOWH 4C3HG 2BDNA 1BCPC 2EYFA 1PTOH 1STYA 3CPFA 2L1BA 2BE5C 3L9AX 3S14H 1V43A 2LSSA 4X3UA 2D2CC 4RWSC 1CA5A 2YYZA 3CMAA 2YTVA 2R7ZH 3CKIB 2VS1A 5GAEC 1FYCA 5HGTA 1ZYRC 1SBBB 1CHQD 3BDOA 4ZAIA 1VMPA 1ZEQX 4P72A 5DM73 4LF7L 4LF4Q 2I5HA 3QWNA 4IURA 5IP9H 3BZDB 3BYYB 2UUAQ 2NZ1D 1DCZA 1EY7A 1SYGA 4DR4L 1TY0A 2A19A 3NENA 3S1NB 3H3VC 5C4JH 4XYOA 4UDUC 5I6WA 5GROA 4B3RL 4CDEC 2J0TD 4R9WA 3I4NG 4DUZQ 1CKOA 3C1FA 4QB4A 3N6RA 5C3EH 1STGA 3AMUA 3C2PA 1BBWA 1HQRD 2N88A 1TWGH 2F0EA 5CC4A 4TKOB 4O0AA 3MHBA 5I6YA 2IJ0A 2ZXRA 4DV6L 3T1HL 3DMUA 4J6HA 1YBYA 5M3FH 4A3GB 1E2ZA 2D5DA 2NN6H 2KEEA 1E3PA 1I3QB 2JQOA 4X65Q 1GHKA 2O4XA 3I70A 2K7VA 4MTNA 2KCNA 4JI4L 4CJ2C 2A68C 3RZOH 1JOKA 3HOUG 4C2MH 1CSQA 3CQZB 1WCMH 4B08A 1TWHH 4OO1I 1SAPA 2E5LL 3ND9A 1N8RC 3K5NA 4JI7L 4CDDC 4ZLTF 1IW7C 1JJ2A 1E0BA 4IFDG 2CFMA 3GTLH 1UE7A 1VQLA 3HOZG 3S17B 1GUOA 2CHBD 3AQQA 2K14A 3I91A 2ZXPA 3HOVG 1HUMA 4I65A 2E2HH 1TWCB 4YCUA 3EROA 4X6AH 3NP8A 1YNJC 4C3JB 1M1KC 5C4XB 2ZJQA 1VQNA 3FMCA 4LF4L 3M4PA 1JWMD 2OF1A 1VQPA 3Q24A 2VQFQ 2UUAL 2ICEC 4X64Q 2F4VQ 2N55A 1VQHA 1B70B 4JOIC 4QIWB 4CKCA 5EPJA 4CJ1B 2L4NA 4ZYSA 3VA7A 1Q3LA 4A3EG 3RLNA 1OXTA 3IL8A 4C3HB 3G4SA 4K0KQ 2PI2A 2LXJA 1WI5A 4DUZL 2A1AA 2F0SA 3G6JB 5T1IA 5L37A 2EYOA 2MO0A 5K5PA 1VQ6A 5C5MA 2JA7G 2UUCL 1G6ZA 4GNXB 3P75A 1K8OA 1STEA 3BYTB 2WB1G 4L5SA 2B2TA 5BN5A 4ZK9B 4A3DB 4DV4Q 1TWAB 4IN3A 4IUVA 1F9SA 1K28A 4X65L 1UE6A 4C3IG 1K0SA 4HCEA 3G48A 3X3NA 1QOHA 1FD7D 1Q1EA 3N52A 5FOBB 2I46A 4IJLA 2G9HD 2XGTA 3PUVA 1F9QA 1Z7TA 3I4NB 4FXGC 4UP9A 2MQHA 4IUPA 4JG2A 3DXJC 4BY1G 2JA5H 1Y1WG 1B9NA 4K6LA 4X62Q 3PIO3 1Y1VG 2JA6B 4EQOA 1S3OA 1LTGD 4I7ZC 1E2WA 2K05A 3KLRA 1RHPA 1SN8A 3S1NH 4HCSA 4XT3B 1H9KA 1EWHA 3CCRA 1DZ1A 4NKLA 2AWNA 2VY3A 1HFGA 1R4PB 2DUDA 1CZWA 2RSOA 4XXEA 2ASBA 1QNUA 4OX9L 4EGVA 1CA6A 3UE1A 2VQFL 1EFWA 3UDGA 3ERSX 4X64L 2F4VL 5BN4A 3ERQA 3BS1A 5CGKA 1ILQA 4ZKBB 2KENA 1SXTA 4A3BG 3MXUA 2Y0SE 1PH7A 3FKIG 4K0KL 3NPPA 3GP7A 2WP8J 4L5QA 1I3QH 2EIFA 2JSOA 4LF5Q 3GV6A 1KNEA 2KCCA 4CHTB 1VQOA 3C46A 3S1MB 2SNMA 2B3GA 2YU9B 2UXBQ 2RVLA 3CQZH 1I4GA 3K80C 4TVAB 2BH8A 1IL8A 1I94Q 3A8IE 1I4HA 3JAMc 1NMFA 3B6YA 3BDLA 4AQYQ 1EZ8A 3S17H 3M7GA 3J80c 1MI2A 1XPRA 2A74C 1X3FA 2JA9A 1K73C 2JXMB 2K5VA 3ER0A 1WTRA 1GKHA 1LTTD 1G8ZD 1AE3A 1TWCH 2AQ2B 4DUYQ 2N49A 3J81L 2EYLA 1H9RA 4LAAA 2HDMA 2OQKA 1SEBD 1K8AC 1EUJA 4X3SA 2HCCA 2ZTEA 4ME3A 1YJ9A 1S5FD 4X62L 2F3WA 4C3JH 1H9SB 5ELNA 2OQ0A 5M5YH 5C4XH 1B2TA 5I4DA 2BA0A 3PF5A 2WB1B 5J3BA 4FP5D 1EY6A 4WJ3M 2NBFA 5F2DA 5ELOA 1P16A 1UUPA 2H5XA 1KIXA 4WJWA 1EU3A 5GADC 2RQXA 2KCTA 2N3SA 1YHAA 2PW5A 4RAUC 3H0GB 5KEEA 1IL2A 5J1ZA 4NXMQ 1YJNA 1GD7A 4C3HH 4GNXC 1PRTD 1Q12A 3L7ZC 1EWCA 1V9PA 4TSSA 5C5LA 2E76C 2MJ8A 4DR1Q 1JOQA 4ULLA 4P2CB 3SEBA 4RGTA 5IT9E 2FXQA 1AP0A 2F0TA 5KIXA 2EY6A 3AEVA 4K2LA 1VQBA 1SDFA 1Y1VB 1NBWA 4A3DH 1ICWA 2AWOA 1TWAH 2FFKB 4FVMA 1LLRD 4HAEA 5M9OA 1BR9A 1HZAA 4LF5L 3BG3A 4MZ9A 3NTHA 3GTJH 1RTOA 3J7AF 3NBHA 3QOJA 1M90C 1E24A 2C35B 2XVSA 2UXBL 1HR0W 2F0QA 4GKJQ 1B53A 3I4NH 4DR7Q 4MNOA 5FLMG 3A55A 5K36G 1CI3M 3D31A 1I94L 1CK1A 2HIXA 1ZXTA 1CKMA 4A3CG 2JA6H 1CZGA 2KCMA 3ZYYX 1VQ8A 2UXDQ 3NTKA 4A3BB 3UDIA 4R8NA 4LMQD 3RUZA 4DUYL 1J9OA 1KAWA 1VDZA 4JI1Q 3TQYA 4A3MB 1IBKQ 3A54A 4N9PA 2L55A 2M00A 4DV5Q 2R3ZA 1DGSA 3KLWA 3RNUA 3CP0A 5FLXE 4F88A 4LUZA 5G3LF 4LW1A 5LMNQ 2F0UA 2ZM6Q 1BQQT 2RA4A 5GAHC 1ZKOA 5AJ3Q 2EZVA 3MXPA 3MXNB 1B4OA 1PYSB 2PQAB 4DV1L 1DD2A 1EIGA 3CCVA 4IFDH 5IYBG 3U4VA 4KN7C 1V1PB 3A5ZB 4NXML 3RD4A 2RCFA 4YHHQ 3CC2A 4DR1L 4PZ7A 4KHPQ 4A93G 4LWCA 1PXUA 5M5XB 1PZID 3S2DB 3T51B 5FJ8G 3S1MH 5M3MB 1HPCA 1PDQA 2D9UA 4G7OC 2RF4A 4KHZA 1NE3A 2WAQE 4JBMA 2QDBA 2BA1A 4DAVA 3R8BA 2B29A 2LS01 2K6AA 4K6DA 3MEHA 3WWVA 3CU7A 3HKSA 5T1GA 1LT5D 1EY4A 1WTQA 1L0XB 2JYOA 3K5OA 1SMYC 4GKJL 4KK7A 3PSIA 1DOKA 5IP7H 4DR7L 1SR3A 2VZAA 1V1QA 3FRPB 2NN6I 1TT2A 1G91A 3AB9A 1U4LA 4RGOS 1T5EA 3NEMA 3OMGA 1MHWC 1E1OA 4BXXG 2EJMA 2KA7A 2V1CC 2TMPA 1EYCA 2R93B 5CV4A 4LUVA 1VQGA 3NXWA 5IGFA 5DNFA 4OELB 2VQEQ 2JP1A 4K14A 4U68A 2UXDL 4IPGA 3KF8B 2CWAA 1A3UA 3Q6SA 1D1IA 3TP5A 4HJ5A 5D65A 1IBKL 1IBML 4DV5L 3H0GH 4CJ0B 4DPGA 4RFBA 1BCPD 4BBRG 5LMNL 3BU2A 3PO2G 3A5UA 1H9JA 5JJZA 2ZM6L 1C8CA 3NE5B 3PIOA 1EL0A 1Y8NB 2X6LA 1WOCA 1MBYA 5LHY1 4DK0A 2YV5A 3L0OA 4KN4C 2EOTA 4KY6A 3I3CA 1BDOA 1O7IA 3A7LA 1OTCA 2A6HC 1Y1VH 3RN5A 1X54A 1HTPA 2E74C 1PA6A 2I5MX 3EBEA 4YHHL 1NR2A 4GKKQ 4AYBB 2KOLA 1VQMA 1XTDA 4KHPL 3OIPA 5EKIA 2RSNA 3D6WA 2Z9HA 1WTVA 2QCPX 4IPHA 4CBVA 5C4HA 3D4DA 4BBSG 1UEAB 1NAPA 3KK7A 1CT1D 2B63G 1I4RA 3OHXC 1T5XD 4DXFA 2Z6BA 1KAAA 3K5LA 4IUTA 4KI0A 4G7HC 1BBXC 5EKLA 1NCVA 2EYHA 2B2VC 1F2LA 4K2KA 4A3BH 2BDOA 2D0PA 4KLKA 1GJXA 2PQEA 1N9WA 4A3MH 2OTJA 1TKWB 3OW2A 1I4XA 2F0KA 3F2BA 2A68D 4A93B 4HN7A 3KLSA 2BCOA 1Y8OB 3DWQA 2XSCA 2EDGA 5ELDA 3I4MG 3HKZG 2CQOA 3K5MA 1NSNS 3OTOQ 2B2UC 1F9RA 1PH1A 4JYAL 2VQEL 4OHJA 3JC66 4XDXA 4PG3A 1I6VC 3HOYB 1EQRA 3F1ZA 3MFGA 1PH3A 1EIFA 2WKDA 2A5HA 2IHFA 4L8JA 4IUUA 4LJZC 1SROA 1LTRD 1GUWA 4OO1G 2I0QA 1FGUA 3KBXA 1VQKA 4P71A 5EKKA 2CCZA 3GTGB 2JA8G 5HY6A 1EOTA 4I7AA 2L9HA 1LTAD 4M8AA 5M5XH 3RZDH 3S2DH 1ESFA 2KECA 4H0LC 4RKLA 1A63A 4H02A 2CWPA 4EQPA 5M3MH 1SNCA 3OMCA 2HUGA 3TP7A 4RKBA 3UI2A 1PLFA 1W3SA 2WFWA 4JV5Q 1Q82C 4KY5A 1O78A 4GKKL 4OGQC 3I56A 4PMBA 4A3KG 3CC7A 1X56A 1D5XC 4QF4A 1B44D 3GTPB 4NW2A 1AN8A 1VS0A 4BBRB 2MO1A 1GUSA 1ESRA 3FDTA 1JR0D 3PO2B 1STNA 3TDQA 4R1JA 2K5WA 1SYBA 5IY0A 3CAMA 2P5ZX 1C4QA 3SE0A 3IFDA 1X55A 1C9OA 2R93H 3CMEA 1JJGA 2M2LA 3H3VH 4Q0FA 5EQ0A 4RCOA 2ZTCA 3M4YA 1RCVD 1XNRQ 1GVPA 2XNAC 2Q8RE 1A2UA 4OIJA 2L11A 5IIFA 3W5OA 1TS3A 3ND8A 4DK1A 4C1NI 1XNQQ 5IGEA 3IRBA 1JORA 4MIUA 4IZ8A 2FHTA 4A76A 3UE0A 5C3XA 1RTNA 3OTOL 1Y69U 2JN4A 3VYSA 2R6GA 1H9SA 2G9DA 1I6HB 4OWTB 5C44B 1LTLA 1TU2B 2LKVA 3STBC 4DR5Q 1VMCA 3J7AV 4GOPB 1Q46A 1UNSA 4IUNA 3H09A 3JAML 2ZXOA 2L5TA 2OTLA 2K01A 1AE2A 3J80L 2RBMA 1EOVA 1LABA 2IL8A 3Q22A 1KLGD 1QZHA 1BKBA 5IYDH 2Y0SB 4FO2A 1RIPA 2WKCA 1JT8A 3GTKB 2H4OA 1KL9A 1PYWD 1X65A 1FNVA 3MA2B 3VR2A 4A3FG 2AHOB 2NVXB 5TSSA 2DY7A 4JV5L 2YTYA 4CDFC 2MUYA
chains in the Genus database with same CATH topology
1L1OC 4YY3Q 4L5RC 4FDBA 4TVAB 2BH8A 2EXDA 1PH6A 4A75A 1I94Q 4OWWB 3JAMc 1T9HA 1EYGA 1NMFA 1IZ6A 4IPCA 4JI5Q 1KRTA 1LUZA 3B6YA 4AQYQ 4JI0L 4R4TA 3S17H 4IOAA 4DV6Q 4DR2Q 3W1BA 3J80c 2ZJRA 1XPRA 2JA9A 1X3FA 5IE8A 1K73C 1CKNA 2K5VA 4R4IA 3ER0A 2E8GA 4B3RL 2K50A 4JBJA 1GKHA 1JB7A 1AE3A 2LXKA 5JEAG 1X3GA 5IWAQ 1TWCH 4JBWA 4DUYQ 3FHWA 2CKZB 2BH2A 2N49A 2VW9A 5IT9c 1PH2A 1KRSA 4JI4Q 4PMWA 1K83H 4A93H 2IHEA 4DV0L 2OQKA 4GLAC 1K8AC 1EUJA 3CD6A 4A3LG 2WB1E 2ZTEA 4ME3A 1YJ9A 5C4XG 2F3IA 3E9HA 4X62L 1CSPA 5C0XJ 4A3IH 4C3JH 1HZ9A 4A3LH 4GS3A 5ELNA 2OQ0A 5M5YH 4NXNL 3GD7A 3FP9A 5C4XH 2ES2A 1EQQA 1BBUA 2BA0A 2D62A 5J3BA 3PF5A 1IBLQ 3HOYG 3M9BA 2UXCQ 4WJ3M 2RCNA 3PUWA 1FJGQ 5ELOA 1P16A 2WAQG 5GQOA 1YEZA 1SMXA 4J15A 3PO3G 3HOYH 2H5XA 1L2FA 4QGUA 1KIXA 4DV3L 4A3JG 3CPWA 5GADC 3S1QH 3KOJA 3PO3H 4UY8C 2A8VA 1MIUA 2KCTA 2N3SA 1YHAA 4JI6Q 2HT1A 1L0WA 1KQSA 1KD1C 1HR0Q 4GN3B 4YWKA 5IYCG 1IL2A 4JCVE 4DK3C 4NXMQ 1YJNA 1GD7A 1HNZQ 1XMOQ 4C3HH 3SGIA 3J81c 4GNXC 1Q12A 3L7ZC 1K9MC 5IYCH 1V9PA 4DNIA 3GTGH 5E7NA 4DR1Q 1HNXQ 3KJOA 3TEHB 3KDFB 3CCEA 2R92G 1D8LA 1SRUA 2FXQA 4BXXH 4B3SL 4DR5L 1Y14B 4JYAQ 2E2JH 2PQAA 1S40A 4P75A 3AEVA 4AH6A 1AH9A 3K8AA 2K5HA 4A3DG 1VQJA 1E22A 1VQBA 3RN2A 3H15A 1OXVA 1NBWA 4NB3A 4A3DH 1JE5A 1WFQA 1IYJB 1U0LA 2AWOA 3ZJYC 2HHHL 3PCOB 1TWAH 1XPOA 4JI2L 3I55A 4PZ8A 3PIPA 1HZAA 4LF5L 1XPUA 3JAMi 4IFDI 4MZ9A 5FLXc 3Q8DA 3GTJH 3CCMA 1OXXK 2F52A 1VQ9A 4LF9Q 1CKNB 2QEXA 5HGQA 3GTPH 3GDEA 1M90C 1E24A 2C35B 4BA1I 1WYDA 3J80i 4DV7L 2JEBI 2QGQA 4BBRH 1HZCA 3UDXA 1Q81C 2UXBL 1C7YA 1QVFA 4HJ9A 1J5EQ 1HR0W 3EN2A 2N8NA 4LF8L 3PO2H 4GKJQ 5JJIA 3I4NH 4DR7Q 4MNOA 4IFDJ 5FLMG 4YY3L 5K36G 2Z6KC 3D0FA 1VQDA 2UUCQ 3D31A 3PF4A 1VQAA 4UPAA 1I94L 5FLMH 3I7FA 2JA6G 1LM0A 4JI5L 4AYBE 3AFQA 1QVCA 2HIXA 1CKMA 4A4IA 4DR2L 4A3CG 4AIMA 2JA6H 1H95A 1K0RA 4B3TQ 2KBNA 3HFZB 2KCMA 2AMCB 1MJEA 1VQ8A 2UXDQ 4A3CH 3UDIA 3PUYA 3S2HH 4LF7Q 4A3GG 5IWAL 4DUYL 3HOXG 1KAWA 1VCIA 4JI1Q 2GVAA 3A0JA 3TQYA 1P8LA 1NMGA 2UUBQ 1IBKQ 4A3GH 4RMFA 3HOXH 1LYLA 4LFBQ 4DV5Q 1SLJA 1DGSA 3KLWA 2E2IH 3RNUA 4DR4Q 3CP0A 2IX0A 4POFA 3HKZE 2Q2UA 4LUZA 4GOPC 3KYHC 4LW1A 5LMNQ 1A0IA 3CCSA 2UU9Q 5C44G 4B3RQ 3J81i 3RR5A 2ZM6Q 3S24A 3GO5A 1IBLL 1R9TH 1G291 1I6HH 2PMZE 1QUQA 5C44H 2ZTDA 5GAHC 1VQFA 5AJ3Q 4DV1L 3MXNB 2IT1A 1PYSB 2PQAB 4DV4L 3STBD 3CCVA 4NPSA 2VUMG 3GTQH 5IYBG 1YJWA 4DV2Q 4BY7H 3U4VA 4UP8A 4JI6L 1VQIA 1N32Q 3K7UC 3CCJA 2VUMH 1HR0L 4RG1A 1Q8KA 5IYBH 3A5ZB 4NXML 1HNZL 3CCUA 1XMOL 3VDYA 4B3MQ 2Q2IA 2Y0SG 3T1HQ 3NELA 2L15A 4POGA 3T1YQ 4YHHQ 3CC2A 1PH4A 4JBKA 1J6QA 4DR1L 2UXDL 4PZ7A 1I50H 1XMQL 1HNXL 3TREA 3U58A 4KHPQ 3GTKH 4A93G 4LWCA 5C0XI 3NBHB 3F2DA 3CC4A 4DAYB 5FJ8G 3ULPA 3S1MH 4GN4B 4GLXA 1Q86C 2RF4A 3KF6A 5FJ8H 1N34Q 4A3IG 4KHZA 2NVXH 2Q2TA 4OX9Q 1NE3A 4APVA 2WAQE 4JBMA 3M4OH 2R7DA 1WJJA 3TS0A 1HZBA 4OWXB 1KC8C 2BA1A 3G71A 4TQUS 3F2CA 4LFCL 5LMNW 2E5LQ 4EQ5A 2RHQB 1XNRL 2VNUD 1Q1BA 2B29A 1HNWQ 4JI7Q 3AYHB 3U4ZA 2OCEA 1X6OA 2K4KA 1VQEA 1YITA 4HIKA 3WWVA 3HKSA 4PZ6A 4O2DA 4LF9L 4HJAA 4HIMA 1Z9FA 2HQLA 1X3EA 1HJPA 5IP7G 1XNQL 3HOWH 2D0OA 3KFUA 1JJCB 1J5EL 3E0EA 4GKJL 4IJHA 3PSIA 3CPFA 3CF5A 4OONA 5IP7H 1SR3A 2VZAA 4DR7L 1YIJA 4R4OA 1V1QA 3S14H 1V43A 2NN6I 3K81C 2QA4A 2LSSA 5LMUQ 3NEMA 4OXPA 2R7ZG 1E1OA 4BXXG 2V1CC 4LNQA 1YVCA 2YYZA 2YTVA 3CMAA 2R7ZH 4LUVA 2VS1A 1VQGA 5GAEC 1KXLA 1ASZA 1A8VA 4B3TL 1CUKA 2VQEQ 5EAYA 1FVIA 1L1OA 2HIVA 1QUQB 4XTCS 4YCWA 4IPGA 3KF8B 4P72A 2CWAA 1ASYA 4LF7L 2R7FA 4LF4Q 2I5HA 5C0XG 4HJ5A 3H0GG 1YNXA 4P73A 5IP9H 4HJ8A 2UUBL 2UUAQ 1IBKL 1JMCA 1IBML 2KHIA 4LFBL 4DV5L 3H0GH 3PUZA 4DPGA 4LFAQ 4DR4L 4DR6Q 2A19A 4JOIA 4YWLA 3K7AH 3NENA 3I4OA 4BBRG 5C4JH 1X9NA 5LMNL 2UU9L 3BU2A 5GROA 1PH8A 3A5UA 1GM5A 1YZ6A 3PO2G 2Q2HA 5C3EG 2ZM6L 1MJCA 3BZCA 4DUZQ 4HIOA 3I4NG 3PIOA 4DR3Q 2GN5A 1N36Q 1CKOA 2JEAI 3J7ZC 5C3EH 1WOCA 1G6PA 2YV5A 3L0OA 4JC0A 2DGYA 2XTIA 1BBWA 3KF6B 1TWGH 3U50C 4DV2L 1N32L 1O7IA 4O0AA 1OTCA 2PNHA 2K52A 3S15H 1NTGA 1B7YB 1Y1VH 2ZJPA 3ULLA 1UWVA 1X54A 3RN5A 4AQYL 5M3FG 2JJQA 4DV6L 4B3ML 3AFPA 3T1HL 1PA6A 2I5MX 2NN6G 3EBEA 3T1YL 1YBYA 2EQSA 4YHHL 3S16H 4GKKQ 5M3FH 1VQMA 1XTDA 1E3PA 4KHPL 4ALPA 3RLOA 2JQOA 4P74A 4X65Q 3RLFA 4MTNA 3CXCA 2GVBA 4HIDA 4JI4L 4IPHA 3RZOH 1WCMG 4BBSG 1N34L 1G51A 2N78A 3M7NA 1PH5A 3HOUG 3M4QA 4C2MH 2B63G 4Y7NH 1CSQA 1WCMH 1TWHH 4BBSH 5JJLA 3CW2C 3ULJA 1E1TA 3HOUH 4OO1I 2B63H 3BJUA 2E5LL 3J81j 1GO3E 4KI0A 1XJVA 1N8RC 2UXCL 4UP7A 4JI7L 1HNWL 1FJGL 5BR8Q 1JJ2A 4IFDG 2NVYH 3M3YH 2MFIA 1N33Q 4BY7G 2CFMA 3GTLH 5DLQE 1UE7A 1VQLA 3HOZG 5H1SE 1L1OB 3AQQA 4A3BH 3G6EA 4A3MG 1OXUA 2K14A 4K0KQ 2D0PA 3HOZH 4KLKA 3HOVG 1N9WA 4A3MH 2E2HH 3CCLA 2OTJA 4YCUA 3OW2A 3F2BA 3CCQA 3HOVH 5LMUL 1EWIA 1UE5A 2K75A 1S72A 1VQKA 3LGJA 4JI8Q 4WJ4A 4X6AH 2KHJA 4LF6Q 3I4MG 3HKZG 2CQOA 2ID0A 1SE8A 5GAGC 3OTOQ 4A3FH 2YU9H 1PH1A 4JYAL 1OXSC 2VQEL 3GTOH 1M1KC 3I4MH 2ZJQA 1VQNA 2Z6KA 3JC66 3UDFA 4X66Q 3KJPA 4DKAC 4DK6C 4LF4L 3I2ZA 2RHSB 3M4PA 4PG3A 3PUXA 4QIWE 1VQPA 4QY7A 4YWMA 2VQFQ 1KHIA 1YHQA 2UUAL 4X64Q 2F4VQ 1EIYB 1EQRA 3DLLA 1VQ5A 1BVSA 1B70B 1VQHA 3F1ZA 3PV0A 1PH3A 1UEBA 1EIFA 4JOIC 3H3VI 2IHFA 4LFAL 1FL0A 2NVQH 4DR6L 4R4CA 4A3EG 1SROA 2NZOA 3HOWG 4OO1G 5M5WH 1IXRA 2I0QA 3RLNA 1OXTA 1FGUA 4QQBX 4HJ7A 3G4SA 4P71A 4IOCA 2PI2A 4A3EH 2LXJA 1PFSA 1YI2A 2CCZA 1WI5A 4DUZL 2A1AA 2JA8G 4DR3L 1N36L 5HY6A 5M3MG 1NJIC 5M5XH 3RZDH 3S2DH 2JA8H 1VQ6A 2MO0A 1A63A 4H02A 2CWPA 5M3MH 3S1RH 1QVGA 1I5FA 2UUCL 2JA7G 1A62A 2Z0SA 4GNXB 4GOPA 2OWOA 2JA7H 1MKHA 1W3SA 2AKWB 2VL6A 1PHJA 2WB1G 2WFWA 3GTMH 4L5SA 1UE1A 1Q82C 4JV5Q 1HH2P 4JI3Q 4DV1Q 1SFOH 4DV4Q 4GKKL 5IP9G 1TXYA 3A74A 3MEFA 1UE6A 4X65L 3I56A 4A3JH 4A3KG 3CC7A 1PYBA 4JI1L 1X56A 4GLVB 1QZGA 4JI0Q 3G48A 2ATWA 4A3KH 1Q1EA 1VQ7A 4C3IH 4IJLA 1VS0A 2XGTA 1VQ4A 1XMQQ 2MO1A 3PUVA 2JK8A 1B8AA 2K5NA 3W1GA 1Q7YC 2IY5B 4DAMA 1K8GA 2R92H 4R1JA 2JA5G 2R93G 4UP9A 2MQHA 5IY0A 4DV0Q 4JG2A 3CAMA 4L5TA 4BY1G 5BR8L 1X55A 1C9OA 1Y1WG 2JA5H 3CMEA 2R93H 1JJGA 5AJ3L 1N33L 4X62Q 3H3VH 4IPDA 3TS2A 4BY1H 1Y1WH 1Y1VG 2ZTCA 4LFCQ 4NXNQ 4QJFA 1XNRQ 1S3OA 3OYYA 2MNAA 1PH9A 2IX1A 1RL2A 1GVPA 3PGZA 2JE6I 3W5OA 4YCVA 1YHBA 4DV3Q 4XIGS 1SN8A 4LUOA 2PI2E 2NZHA 1XNQQ 1TWFH 3IRBA 4JI8L 4GN5A 3S1NH 4A76A 3M85A 1W2BA 3CCRA 4LF6L 3K0XA 3UE0A 2AWNA 2VY3A 2NVTH 3OTOL 2DUDA 4Y52H 4EX5A 2R6GA 1Z47A 2ASBA 4GNXA 4X66L 4OX9L 3UE1A 4OWTB 4QL5A 1LTLA 2VQFL 1EFWA 3UDGA 3STBC 1K3RA 5JJKA 3ERSX 4X64L 3L2PA 4B3SQ 4IO9A 4DR5Q 2F4VL 4GOPB 1Q46A 3DM3A 2KENA 4AYBG 2OTLA 5JEAJ 4A3BG 2Y0SE 1AE2A 1PH7A 3FKIG 1C0AA 1EOVA 5IYDG 2HHHQ 4K0KL 1QZHA 1IBMQ 1E7ZA 1BKBA 3FKIH 4JI2Q 2WP8J 4L5QA 5IYDH 1I3QH 2EIFA 1RIPA 4BA2I 1PV4A 4LF5Q 3KDFA 1JT8A 2I5LX 1KL9A 4R4QA 1VQOA 1VQCA 1X65A 3ICEA 1PVOA 2B3GA 1D7QA 3TRZA 3BZKA 4DV7Q 3E9IA 2UXBQ 1NY4A 3CQZH 2YTXA 4A3FG 2AHOB 3EIVA 3J7A5 4LF8Q 2ALYB 1U5KA 4JV5L 3K80C 2YTYA 3F8TA 4JI3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O C;  4YY3 Q;  4L5R C;  4FDB A;  4TVA B;  2BH8 A;  2EXD A;  1PH6 A;  4A75 A;  1I94 Q;  4OWW B;  3JAM c;  1T9H A;  1EYG A;  1NMF A;  1IZ6 A;  4IPC A;  4JI5 Q;  1KRT A;  1LUZ A;  3B6Y A;  4AQY Q;  4JI0 L;  4R4T A;  3S17 H;  4IOA A;  4DV6 Q;  4DR2 Q;  3W1B A;  3J80 c;  2ZJR A;  1XPR A;  2JA9 A;  1X3F A;  5IE8 A;  1K73 C;  1CKN A;  2K5V A;  4R4I A;  3ER0 A;  2E8G A;  4B3R L;  2K50 A;  4JBJ A;  1GKH A;  1JB7 A;  1AE3 A;  2LXK A;  5JEA G;  1X3G A;  5IWA Q;  1TWC H;  4JBW A;  4DUY Q;  3FHW A;  2CKZ B;  2BH2 A;  2N49 A;  2VW9 A;  5IT9 c;  1PH2 A;  1KRS A;  4JI4 Q;  4PMW A;  1K83 H;  4A93 H;  2IHE A;  4DV0 L;  2OQK A;  4GLA C;  1K8A C;  1EUJ A;  3CD6 A;  4A3L G;  2WB1 E;  2ZTE A;  4ME3 A;  1YJ9 A;  5C4X G;  2F3I A;  3E9H A;  4X62 L;  1CSP A;  5C0X J;  4A3I H;  4C3J H;  1HZ9 A;  4A3L H;  4GS3 A;  5ELN A;  2OQ0 A;  5M5Y H;  4NXN L;  3GD7 A;  3FP9 A;  5C4X H;  2ES2 A;  1EQQ A;  1BBU A;  2BA0 A;  2D62 A;  5J3B A;  3PF5 A;  1IBL Q;  3HOY G;  3M9B A;  2UXC Q;  4WJ3 M;  2RCN A;  3PUW A;  1FJG Q;  5ELO A;  1P16 A;  2WAQ G;  5GQO A;  1YEZ A;  1SMX A;  4J15 A;  3PO3 G;  3HOY H;  2H5X A;  1L2F A;  4QGU A;  1KIX A;  4DV3 L;  4A3J G;  3CPW A;  5GAD C;  3S1Q H;  3KOJ A;  3PO3 H;  4UY8 C;  2A8V A;  1MIU A;  2KCT A;  2N3S A;  1YHA A;  4JI6 Q;  2HT1 A;  1L0W A;  1KQS A;  1KD1 C;  1HR0 Q;  4GN3 B;  4YWK A;  5IYC G;  1IL2 A;  4JCV E;  4DK3 C;  4NXM Q;  1YJN A;  1GD7 A;  1HNZ Q;  1XMO Q;  4C3H H;  3SGI A;  3J81 c;  4GNX C;  1Q12 A;  3L7Z C;  1K9M C;  5IYC H;  1V9P A;  4DNI A;  3GTG H;  5E7N A;  4DR1 Q;  1HNX Q;  3KJO A;  3TEH B;  3KDF B;  3CCE A;  2R92 G;  1D8L A;  1SRU A;  2FXQ A;  4BXX H;  4B3S L;  4DR5 L;  1Y14 B;  4JYA Q;  2E2J H;  2PQA A;  1S40 A;  4P75 A;  3AEV A;  4AH6 A;  1AH9 A;  3K8A A;  2K5H A;  4A3D G;  1VQJ A;  1E22 A;  1VQB A;  3RN2 A;  3H15 A;  1OXV A;  1NBW A;  4NB3 A;  4A3D H;  1JE5 A;  1WFQ A;  1IYJ B;  1U0L A;  2AWO A;  3ZJY C;  2HHH L;  3PCO B;  1TWA H;  1XPO A;  4JI2 L;  3I55 A;  4PZ8 A;  3PIP A;  1HZA A;  4LF5 L;  1XPU A;  3JAM i;  4IFD I;  4MZ9 A;  5FLX c;  3Q8D A;  3GTJ H;  3CCM A;  1OXX K;  2F52 A;  1VQ9 A;  4LF9 Q;  1CKN B;  2QEX A;  5HGQ A;  3GTP H;  3GDE A;  1M90 C;  1E24 A;  2C35 B;  4BA1 I;  1WYD A;  3J80 i;  4DV7 L;  2JEB I;  2QGQ A;  4BBR H;  1HZC A;  3UDX A;  1Q81 C;  2UXB L;  1C7Y A;  1QVF A;  4HJ9 A;  1J5E Q;  1HR0 W;  3EN2 A;  2N8N A;  4LF8 L;  3PO2 H;  4GKJ Q;  5JJI A;  3I4N H;  4DR7 Q;  4MNO A;  4IFD J;  5FLM G;  4YY3 L;  5K36 G;  2Z6K C;  3D0F A;  1VQD A;  2UUC Q;  3D31 A;  3PF4 A;  1VQA A;  4UPA A;  1I94 L;  5FLM H;  3I7F A;  2JA6 G;  1LM0 A;  4JI5 L;  4AYB E;  3AFQ A;  1QVC A;  2HIX A;  1CKM A;  4A4I A;  4DR2 L;  4A3C G;  4AIM A;  2JA6 H;  1H95 A;  1K0R A;  4B3T Q;  2KBN A;  3HFZ B;  2KCM A;  2AMC B;  1MJE A;  1VQ8 A;  2UXD Q;  4A3C H;  3UDI A;  3PUY A;  3S2H H;  4LF7 Q;  4A3G G;  5IWA L;  4DUY L;  3HOX G;  1KAW A;  1VCI A;  4JI1 Q;  2GVA A;  3A0J A;  3TQY A;  1P8L A;  1NMG A;  2UUB Q;  1IBK Q;  4A3G H;  4RMF A;  3HOX H;  1LYL A;  4LFB Q;  4DV5 Q;  1SLJ A;  1DGS A;  3KLW A;  2E2I H;  3RNU A;  4DR4 Q;  3CP0 A;  2IX0 A;  4POF A;  3HKZ E;  2Q2U A;  4LUZ A;  4GOP C;  3KYH C;  4LW1 A;  5LMN Q;  1A0I A;  3CCS A;  2UU9 Q;  5C44 G;  4B3R Q;  3J81 i;  3RR5 A;  2ZM6 Q;  3S24 A;  3GO5 A;  1IBL L;  1R9T H;  1G29 1;  1I6H H;  2PMZ E;  1QUQ A;  5C44 H;  2ZTD A;  5GAH C;  1VQF A;  5AJ3 Q;  4DV1 L;  3MXN B;  2IT1 A;  1PYS B;  2PQA B;  4DV4 L;  3STB D;  3CCV A;  4NPS A;  2VUM G;  3GTQ H;  5IYB G;  1YJW A;  4DV2 Q;  4BY7 H;  3U4V A;  4UP8 A;  4JI6 L;  1VQI A;  1N32 Q;  3K7U C;  3CCJ A;  2VUM H;  1HR0 L;  4RG1 A;  1Q8K A;  5IYB H;  3A5Z B;  4NXM L;  1HNZ L;  3CCU A;  1XMO L;  3VDY A;  4B3M Q;  2Q2I A;  2Y0S G;  3T1H Q;  3NEL A;  2L15 A;  4POG A;  3T1Y Q;  4YHH Q;  3CC2 A;  1PH4 A;  4JBK A;  1J6Q A;  4DR1 L;  2UXD L;  4PZ7 A;  1I50 H;  1XMQ L;  1HNX L;  3TRE A;  3U58 A;  4KHP Q;  3GTK H;  4A93 G;  4LWC A;  5C0X I;  3NBH B;  3F2D A;  3CC4 A;  4DAY B;  5FJ8 G;  3ULP A;  3S1M H;  4GN4 B;  4GLX A;  1Q86 C;  2RF4 A;  3KF6 A;  5FJ8 H;  1N34 Q;  4A3I G;  4KHZ A;  2NVX H;  2Q2T A;  4OX9 Q;  1NE3 A;  4APV A;  2WAQ E;  4JBM A;  3M4O H;  2R7D A;  1WJJ A;  3TS0 A;  1HZB A;  4OWX B;  1KC8 C;  2BA1 A;  3G71 A;  4TQU S;  3F2C A;  4LFC L;  5LMN W;  2E5L Q;  4EQ5 A;  2RHQ B;  1XNR L;  2VNU D;  1Q1B A;  2B29 A;  1HNW Q;  4JI7 Q;  3AYH B;  3U4Z A;  2OCE A;  1X6O A;  2K4K A;  1VQE A;  1YIT A;  4HIK A;  3WWV A;  3HKS A;  4PZ6 A;  4O2D A;  4LF9 L;  4HJA A;  4HIM A;  1Z9F A;  2HQL A;  1X3E A;  1HJP A;  5IP7 G;  1XNQ L;  3HOW H;  2D0O A;  3KFU A;  1JJC B;  1J5E L;  3E0E A;  4GKJ L;  4IJH A;  3PSI A;  3CPF A;  3CF5 A;  4OON A;  5IP7 H;  1SR3 A;  2VZA A;  4DR7 L;  1YIJ A;  4R4O A;  1V1Q A;  3S14 H;  1V43 A;  2NN6 I;  3K81 C;  2QA4 A;  2LSS A;  5LMU Q;  3NEM A;  4OXP A;  2R7Z G;  1E1O A;  4BXX G;  2V1C C;  4LNQ A;  1YVC A;  2YYZ A;  2YTV A;  3CMA A;  2R7Z H;  4LUV A;  2VS1 A;  1VQG A;  5GAE C;  1KXL A;  1ASZ A;  1A8V A;  4B3T L;  1CUK A;  2VQE Q;  5EAY A;  1FVI A;  1L1O A;  2HIV A;  1QUQ B;  4XTC S;  4YCW A;  4IPG A;  3KF8 B;  4P72 A;  2CWA A;  1ASY A;  4LF7 L;  2R7F A;  4LF4 Q;  2I5H A;  5C0X G;  4HJ5 A;  3H0G G;  1YNX A;  4P73 A;  5IP9 H;  4HJ8 A;  2UUB L;  2UUA Q;  1IBK L;  1JMC A;  1IBM L;  2KHI A;  4LFB L;  4DV5 L;  3H0G H;  3PUZ A;  4DPG A;  4LFA Q;  4DR4 L;  4DR6 Q;  2A19 A;  4JOI A;  4YWL A;  3K7A H;  3NEN A;  3I4O A;  4BBR G;  5C4J H;  1X9N A;  5LMN L;  2UU9 L;  3BU2 A;  5GRO A;  1PH8 A;  3A5U A;  1GM5 A;  1YZ6 A;  3PO2 G;  2Q2H A;  5C3E G;  2ZM6 L;  1MJC A;  3BZC A;  4DUZ Q;  4HIO A;  3I4N G;  3PIO A;  4DR3 Q;  2GN5 A;  1N36 Q;  1CKO A;  2JEA I;  3J7Z C;  5C3E H;  1WOC A;  1G6P A;  2YV5 A;  3L0O A;  4JC0 A;  2DGY A;  2XTI A;  1BBW A;  3KF6 B;  1TWG H;  3U50 C;  4DV2 L;  1N32 L;  1O7I A;  4O0A A;  1OTC A;  2PNH A;  2K52 A;  3S15 H;  1NTG A;  1B7Y B;  1Y1V H;  2ZJP A;  3ULL A;  1UWV A;  1X54 A;  3RN5 A;  4AQY L;  5M3F G;  2JJQ A;  4DV6 L;  4B3M L;  3AFP A;  3T1H L;  1PA6 A;  2I5M X;  2NN6 G;  3EBE A;  3T1Y L;  1YBY A;  2EQS A;  4YHH L;  3S16 H;  4GKK Q;  5M3F H;  1VQM A;  1XTD A;  1E3P A;  4KHP L;  4ALP A;  3RLO A;  2JQO A;  4P74 A;  4X65 Q;  3RLF A;  4MTN A;  3CXC A;  2GVB A;  4HID A;  4JI4 L;  4IPH A;  3RZO H;  1WCM G;  4BBS G;  1N34 L;  1G51 A;  2N78 A;  3M7N A;  1PH5 A;  3HOU G;  3M4Q A;  4C2M H;  2B63 G;  4Y7N H;  1CSQ A;  1WCM H;  1TWH H;  4BBS H;  5JJL A;  3CW2 C;  3ULJ A;  1E1T A;  3HOU H;  4OO1 I;  2B63 H;  3BJU A;  2E5L L;  3J81 j;  1GO3 E;  4KI0 A;  1XJV A;  1N8R C;  2UXC L;  4UP7 A;  4JI7 L;  1HNW L;  1FJG L;  5BR8 Q;  1JJ2 A;  4IFD G;  2NVY H;  3M3Y H;  2MFI A;  1N33 Q;  4BY7 G;  2CFM A;  3GTL H;  5DLQ E;  1UE7 A;  1VQL A;  3HOZ G;  5H1S E;  1L1O B;  3AQQ A;  4A3B H;  3G6E A;  4A3M G;  1OXU A;  2K14 A;  4K0K Q;  2D0P A;  3HOZ H;  4KLK A;  3HOV G;  1N9W A;  4A3M H;  2E2H H;  3CCL A;  2OTJ A;  4YCU A;  3OW2 A;  3F2B A;  3CCQ A;  3HOV H;  5LMU L;  1EWI A;  1UE5 A;  2K75 A;  1S72 A;  1VQK A;  3LGJ A;  4JI8 Q;  4WJ4 A;  4X6A H;  2KHJ A;  4LF6 Q;  3I4M G;  3HKZ G;  2CQO A;  2ID0 A;  1SE8 A;  5GAG C;  3OTO Q;  4A3F H;  2YU9 H;  1PH1 A;  4JYA L;  1OXS C;  2VQE L;  3GTO H;  1M1K C;  3I4M H;  2ZJQ A;  1VQN A;  2Z6K A;  3JC6 6;  3UDF A;  4X66 Q;  3KJP A;  4DKA C;  4DK6 C;  4LF4 L;  3I2Z A;  2RHS B;  3M4P A;  4PG3 A;  3PUX A;  4QIW E;  1VQP A;  4QY7 A;  4YWM A;  2VQF Q;  1KHI A;  1YHQ A;  2UUA L;  4X64 Q;  2F4V Q;  1EIY B;  1EQR A;  3DLL A;  1VQ5 A;  1BVS A;  1B70 B;  1VQH A;  3F1Z A;  3PV0 A;  1PH3 A;  1UEB A;  1EIF A;  4JOI C;  3H3V I;  2IHF A;  4LFA L;  1FL0 A;  2NVQ H;  4DR6 L;  4R4C A;  4A3E G;  1SRO A;  2NZO A;  3HOW G;  4OO1 G;  5M5W H;  1IXR A;  2I0Q A;  3RLN A;  1OXT A;  1FGU A;  4QQB X;  4HJ7 A;  3G4S A;  4P71 A;  4IOC A;  2PI2 A;  4A3E H;  2LXJ A;  1PFS A;  1YI2 A;  2CCZ A;  1WI5 A;  4DUZ L;  2A1A A;  2JA8 G;  4DR3 L;  1N36 L;  5HY6 A;  5M3M G;  1NJI C;  5M5X H;  3RZD H;  3S2D H;  2JA8 H;  1VQ6 A;  2MO0 A;  1A63 A;  4H02 A;  2CWP A;  5M3M H;  3S1R H;  1QVG A;  1I5F A;  2UUC L;  2JA7 G;  1A62 A;  2Z0S A;  4GNX B;  4GOP A;  2OWO A;  2JA7 H;  1MKH A;  1W3S A;  2AKW B;  2VL6 A;  1PHJ A;  2WB1 G;  2WFW A;  3GTM H;  4L5S A;  1UE1 A;  1Q82 C;  4JV5 Q;  1HH2 P;  4JI3 Q;  4DV1 Q;  1SFO H;  4DV4 Q;  4GKK L;  5IP9 G;  1TXY A;  3A74 A;  3MEF A;  1UE6 A;  4X65 L;  3I56 A;  4A3J H;  4A3K G;  3CC7 A;  1PYB A;  4JI1 L;  1X56 A;  4GLV B;  1QZG A;  4JI0 Q;  3G48 A;  2ATW A;  4A3K H;  1Q1E A;  1VQ7 A;  4C3I H;  4IJL A;  1VS0 A;  2XGT A;  1VQ4 A;  1XMQ Q;  2MO1 A;  3PUV A;  2JK8 A;  1B8A A;  2K5N A;  3W1G A;  1Q7Y C;  2IY5 B;  4DAM A;  1K8G A;  2R92 H;  4R1J A;  2JA5 G;  2R93 G;  4UP9 A;  2MQH A;  5IY0 A;  4DV0 Q;  4JG2 A;  3CAM A;  4L5T A;  4BY1 G;  5BR8 L;  1X55 A;  1C9O A;  1Y1W G;  2JA5 H;  3CME A;  2R93 H;  1JJG A;  5AJ3 L;  1N33 L;  4X62 Q;  3H3V H;  4IPD A;  3TS2 A;  4BY1 H;  1Y1W H;  1Y1V G;  2ZTC A;  4LFC Q;  4NXN Q;  4QJF A;  1XNR Q;  1S3O A;  3OYY A;  2MNA A;  1PH9 A;  2IX1 A;  1RL2 A;  1GVP A;  3PGZ A;  2JE6 I;  3W5O A;  4YCV A;  1YHB A;  4DV3 Q;  4XIG S;  1SN8 A;  4LUO A;  2PI2 E;  2NZH A;  1XNQ Q;  1TWF H;  3IRB A;  4JI8 L;  4GN5 A;  3S1N H;  4A76 A;  3M85 A;  1W2B A;  3CCR A;  4LF6 L;  3K0X A;  3UE0 A;  2AWN A;  2VY3 A;  2NVT H;  3OTO L;  2DUD A;  4Y52 H;  4EX5 A;  2R6G A;  1Z47 A;  2ASB A;  4GNX A;  4X66 L;  4OX9 L;  3UE1 A;  4OWT B;  4QL5 A;  1LTL A;  2VQF L;  1EFW A;  3UDG A;  3STB C;  1K3R A;  5JJK A;  3ERS X;  4X64 L;  3L2P A;  4B3S Q;  4IO9 A;  4DR5 Q;  2F4V L;  4GOP B;  1Q46 A;  3DM3 A;  2KEN A;  4AYB G;  2OTL A;  5JEA J;  4A3B G;  2Y0S E;  1AE2 A;  1PH7 A;  3FKI G;  1C0A A;  1EOV A;  5IYD G;  2HHH Q;  4K0K L;  1QZH A;  1IBM Q;  1E7Z A;  1BKB A;  3FKI H;  4JI2 Q;  2WP8 J;  4L5Q A;  5IYD H;  1I3Q H;  2EIF A;  1RIP A;  4BA2 I;  1PV4 A;  4LF5 Q;  3KDF A;  1JT8 A;  2I5L X;  1KL9 A;  4R4Q A;  1VQO A;  1VQC A;  1X65 A;  3ICE A;  1PVO A;  2B3G A;  1D7Q A;  3TRZ A;  3BZK A;  4DV7 Q;  3E9I A;  2UXB Q;  1NY4 A;  3CQZ H;  2YTX A;  4A3F G;  2AHO B;  3EIV A;  3J7A 5;  4LF8 Q;  2ALY B;  1U5K A;  4JV5 L;  3K80 C;  2YTY A;  3F8T A;  4JI3 L; 
#chains in the Genus database with same CATH topology
 2L12 A;  4N9T A;  4A75 A;  4BS9 A;  2EYJ A;  2DJF C;  1T9H A;  1QCB D;  2X6G A;  5JPM C;  2B8F A;  1LUZ A;  4DF7 A;  4R4T A;  3R3O A;  3VYT A;  3HGB A;  5ELF A;  2PZU A;  2K50 A;  4JBJ A;  1JB7 A;  1EQT A;  1X3G A;  5IWA Q;  1ENA A;  1ENC A;  2CKZ B;  2SEB D;  2WAC A;  4PMW A;  5JEA H;  2LFN A;  4A93 H;  2NTS A;  1S5D D;  3V96 A;  1PMR A;  4A3L G;  2F3I A;  3E9H A;  5C0X J;  2RDF A;  1K8M A;  1HZ9 A;  2L0C A;  3PMF A;  4GS3 A;  4MN3 A;  3GD7 A;  4KKS A;  1O7L A;  1IBL Q;  3OWF A;  2UXC Q;  2RCN A;  1FJG Q;  2WAQ G;  3PO3 G;  1YEZ A;  1SMX A;  3HOY H;  4QGU A;  4A3J G;  4DU9 A;  4Q5V A;  2WII B;  4ILW A;  4JI6 Q;  2HT1 A;  3HRZ C;  1KD1 C;  2IW3 A;  4YWK A;  5IYC G;  1F2M A;  1HNZ Q;  1XMO Q;  2EYP A;  1B3A A;  1K9M C;  3MZ5 A;  3GTG H;  3KJO A;  2R92 G;  1SRU A;  5EBD A;  4BXX H;  4DR5 L;  1Y14 B;  3MXN A;  2PQA A;  4P75 A;  1HCZ A;  1AH9 A;  3BVM A;  3RN2 A;  4ZCK A;  1OXV A;  1EFI D;  1L0Y B;  1JE5 A;  1V1P A;  1JB3 A;  1WFQ A;  1D2B A;  1FNW A;  4PZ8 A;  1S5E D;  4IFD I;  2F52 A;  3OIQ A;  2QEX A;  3GTP H;  2XWB B;  4BA1 I;  4ZQ3 A;  4BBR H;  1HZC A;  1QE6 A;  5I2X A;  1C7Y A;  1QVF A;  1J5E Q;  3PO2 H;  3EN2 A;  5JJI A;  4Y7N B;  4DAP A;  2EY5 A;  3J81 E;  3HOU B;  1II3 A;  2Z6K C;  1VQD A;  3PF4 A;  4UPA A;  2PZT A;  4OEM B;  3ITP A;  1LM0 A;  5CV8 A;  4DA2 A;  1CHP D;  4G7Z C;  3M3Y B;  3LWE A;  4AIM A;  5CBE E;  1STA A;  4B3T Q;  2AMC B;  4B9X A;  2VXW A;  3PUY A;  5IGG A;  3HOZ B;  3K58 A;  5IWA L;  3HOX G;  1VCI A;  1DON A;  4QUC A;  1P8L A;  3VR5 A;  1NUC A;  4A3G H;  4BWG B;  3HOV B;  3H91 A;  3QR8 A;  3NSW A;  1Y8P B;  3HKZ E;  5CV9 A;  2SNS A;  2Q2U A;  2F0L A;  1VF7 A;  4GOP C;  1KDA A;  2QKI C;  3CCS A;  4A3F B;  5EPK A;  4ME5 A;  4MHE A;  3J81 i;  1WTX A;  3GO5 A;  1IBL L;  1I6H H;  1SE2 A;  2PMZ E;  5C44 H;  1SE4 A;  2F0I A;  4DV4 L;  5KNC A;  2VUM G;  3TP8 A;  4UP8 A;  2AUK A;  1VQI A;  4JI6 L;  1N32 Q;  4HR7 B;  1X3P A;  4HMJ A;  1Q8K A;  2KED A;  4MTK A;  1HNZ L;  1XMO L;  4B3M Q;  2AUJ D;  3NEL A;  2L15 A;  4POG A;  3T1Y Q;  1RKN A;  1J6Q A;  4A3E B;  2HQE A;  3U58 A;  2NUC A;  1RD9 D;  3WDN A;  3Q23 A;  3GTK H;  5C0X I;  2O5J C;  3A8K E;  4DAY B;  3ULP A;  1O7Y A;  1PRT B;  4GN4 B;  3S1R B;  3LNN A;  1B50 A;  5D3D A;  1Q86 C;  4F8M A;  2NVX H;  3DWA A;  2JA7 B;  4APV A;  1WD1 A;  1IYV A;  2R7D A;  1WJJ A;  5JVG 3;  3TS0 A;  1KC8 C;  3MVV A;  4RHS A;  5D3I B;  5LMN W;  3D4W A;  4KJO A;  4FYD A;  4EQ5 A;  2RHQ B;  2OXP A;  5DM6 3;  1PRT F;  3AYH B;  3U4Z A;  1YIT A;  1X6O A;  1YNN D;  4A3J B;  1QWY A;  4PZ6 A;  4HJA A;  4FNF A;  4XQQ A;  2HQL A;  1HJP A;  2D0O A;  4C3I B;  5DEH A;  1JJC B;  4IUQ A;  1J5E L;  1KTK A;  4FF4 A;  4IJH A;  4OON A;  5CYU A;  1IKM A;  1TVX A;  1LTS D;  4KMU C;  2QA4 A;  5LMU Q;  2R92 B;  4OXP A;  2R7Z G;  4DGZ A;  2DJG C;  4JVZ A;  5ISR A;  4B3T L;  2FIN B;  1CUK A;  4BY1 B;  1Y1W B;  1SNM A;  1FVI A;  2HIV A;  1QUQ B;  4XTC S;  2FMC A;  1WVL A;  1ASY A;  4X3K A;  4ZRZ A;  2R7F A;  1U4R A;  2I07 B;  2HD3 A;  1JE4 A;  1JMC A;  2KHI A;  3PUZ A;  5C4Z A;  1HA5 A;  1TS5 A;  2GA4 B;  4LFA Q;  4DR6 Q;  4JOI A;  4YWL A;  2DNE A;  1NNX A;  2A73 B;  3I4O A;  1SNO A;  1GM5 A;  1YZ6 A;  4CKE A;  4HIO A;  5C3E G;  3OWE B;  2EJG C;  1ILP A;  3T16 A;  3MC0 B;  4DXG A;  1Q8I A;  1KDB A;  1G6P A;  3D6C A;  4JC0 A;  1XYI A;  2XTI A;  3KF6 B;  2A6E D;  1N32 L;  1QG7 A;  2PNH A;  4IAL A;  3SK8 A;  1EZ6 A;  2ZJP A;  1S5C D;  1UWV A;  3ULL A;  3QIA A;  4AQY L;  5M3F G;  2JJQ A;  3NWT A;  3QG1 A;  4B3M L;  4GZY C;  3AFP A;  3FPP A;  2NN6 G;  3T1Y L;  2EQS A;  3E3X A;  5CR3 A;  3K0Y A;  3MAQ A;  3FKI B;  3OOC A;  1XX8 A;  2DNC A;  1GUT A;  1EY9 A;  1PZK D;  2K5D A;  3CXC A;  2GVB A;  1LTB D;  4HID A;  3T56 B;  5JVH 3;  5C6A A;  1WCM G;  1G51 A;  2N78 A;  1PH5 A;  3M4Q A;  4WOR A;  3H94 A;  2M9V A;  3DM1 A;  4Y7N H;  5JJL A;  1IYU A;  3ULJ A;  3HOU H;  1D5M C;  3BJU A;  1WTW A;  4PQX A;  3J81 j;  1GO3 E;  1XJV A;  5A2Q L;  4UP7 A;  4KKU A;  2IX3 A;  3M3Y H;  4BY7 G;  2QF7 A;  1N33 Q;  2IPK D;  2QIL A;  5H1S E;  1L1O B;  2B2Y C;  2NB0 A;  2BOS A;  4QUF A;  3G6E A;  4NMZ A;  5DAU A;  3EFX D;  3H6M A;  3HOZ H;  3NUC A;  2XWJ B;  3CCL A;  5IT9 L;  4JPB W;  3CCQ A;  3HOV H;  1K83 B;  4HMI A;  3WOF A;  5LMU L;  1EWI A;  1UE5 A;  2K75 A;  4WJ4 A;  3NHH A;  4LF6 Q;  3HZX A;  2ID0 A;  5GAG C;  1HTL D;  4N8X 1;  4A3F H;  2YU9 H;  1OXS C;  2Z6K A;  1Z6H A;  3KJP A;  4DKA C;  4DK6 C;  3I2Z A;  2RHS B;  3PUX A;  4QY7 A;  1KHI A;  1YHQ A;  1EU4 A;  1VQ5 A;  3DLL A;  1BVS A;  3PV0 A;  1UEB A;  3S9W A;  1W6K A;  3H3V I;  4LFA L;  4FF2 A;  2Z1C A;  4DR6 L;  1STH A;  1DXM A;  1PRT C;  2QW7 A;  2CW0 D;  2OEO A;  3OSO A;  4HJ7 A;  2ES2 A;  4IOC A;  4A3E H;  1DOL A;  2ICI A;  5E4X A;  2CQA A;  3S1R H;  1I5F A;  2A69 D;  1A62 A;  2Z0S A;  1GOZ A;  4GOP A;  2OWO A;  2B39 A;  2JA7 H;  1MKH A;  1SYE A;  3FVQ A;  5I9P A;  2PNR C;  1BCP F;  3U9S A;  2H1E A;  1O80 A;  2QDL A;  5KND A;  3A74 A;  1B1Z A;  3HS0 C;  3MEF A;  4A3J H;  1PTO D;  1PYB A;  5FLX L;  4JI1 L;  4GLV B;  1QZG A;  1BF4 A;  2ATW A;  1VQ7 A;  1AZQ A;  4C3I H;  3U9O A;  1VQ4 A;  1XMQ Q;  2JK8 A;  4KD3 A;  1B8A A;  2IY5 B;  4HSV A;  4XT1 B;  4DAM A;  1KNA A;  2BE5 D;  2R92 H;  2EY1 A;  2JA5 G;  4DV0 Q;  2Z4I A;  1SYF A;  2F0O A;  3NK9 A;  2E75 C;  5AJ3 L;  1N33 L;  4IPD A;  3TS2 A;  4BY1 H;  1Y1W H;  4LFC Q;  4NXN Q;  5I9O A;  1ZYR D;  2IX1 A;  1RL2 A;  2JE6 I;  3D4R A;  1JQY D;  4YCV A;  1YHB A;  2F0D A;  4DV3 Q;  4XIG S;  1V8Q A;  2PI2 E;  4LUO A;  2NZH A;  3D8G A;  1A3V A;  1CQV A;  3M85 A;  5KGU A;  2EYM A;  4LF6 L;  3K0X A;  1WCM B;  1A6X A;  4EX5 A;  3W3A A;  4O1N A;  1HA6 A;  1SSO A;  1Z47 A;  4GNX A;  3T53 B;  1F2Y A;  1CM9 A;  2KUM A;  4QL5 A;  1K3R A;  4R8I A;  1HHV A;  3D3R A;  3GTQ B;  3T13 A;  4BY7 B;  1AEX A;  1BUV T;  3I72 A;  3VYR A;  2CH4 A;  3SK4 A;  1LT4 D;  1XTC D;  3VR4 A;  4ZUI A;  3FKI H;  1GXD C;  1QB5 D;  1PV4 A;  1I4Q A;  2I5L X;  3TBI B;  4R4Q A;  1EYA A;  3Q0A A;  1FNU A;  4DV7 Q;  3E9I A;  1NY4 A;  2YTX A;  2B2T C;  3J7A 5;  2F0G A;  1LO5 D;  4OL7 A;  1L1O C;  4YY3 Q;  1PH6 A;  1U9R A;  3L3O C;  5CMD A;  4OWW B;  4KJN A;  1EYG A;  3A7A B;  1IZ6 A;  4IPC A;  4JI5 Q;  1IW7 D;  1EIH A;  1BO0 A;  1TS2 A;  4DV6 Q;  3W1B A;  2ZJR A;  2K1B A;  4R4I A;  1JWS D;  2E8G A;  3OPO A;  4NDX A;  5COR A;  3FHW A;  2BH2 A;  1TY2 A;  5IT9 c;  1KRS A;  4JI4 Q;  1K83 H;  4X3T A;  4DV0 L;  3HP3 A;  4GLA C;  2HCI A;  4C3J G;  2F0M A;  5C4X G;  1CSP A;  1TS4 A;  3WOE A;  1YNJ D;  4NXN L;  3FP9 A;  5KRU A;  1EQQ A;  1KLU D;  1LV9 A;  2D62 A;  4DNR B;  2PYK A;  4XQJ A;  3M9B A;  2F03 A;  4J15 A;  5JOB A;  4K5X A;  4DV3 L;  3KOJ A;  2A8V A;  1MIU A;  4HED A;  3JAM E;  1L0W A;  3I90 A;  2B2Y A;  4ODG A;  3NTI A;  3K7A B;  4JCV E;  5HUR A;  3SGI A;  3J80 E;  5CV5 A;  2EJF C;  1MGS A;  4J8Q A;  3TEH B;  1DYQ A;  2F1M A;  3KDF B;  2B2W C;  4PMC A;  1D8L A;  2JA5 B;  2O2L D;  4ZUJ A;  4TRD A;  4AH6 A;  3K8A A;  2K5Q A;  4A3D G;  1VQJ A;  1E22 A;  3H15 A;  1XXG A;  3S15 B;  4NB3 A;  2VB2 X;  1U0L A;  1PFN A;  2HDL A;  4JK1 C;  3S16 B;  1XPO A;  3I55 A;  4IQZ A;  3JAM i;  5FLX c;  3Q8D A;  1OXX K;  1VQ9 A;  4LF9 Q;  1CKN B;  1F77 A;  5HGQ A;  4DAY A;  1PFM A;  3J80 i;  4DV7 L;  2QGQ A;  4RA8 A;  3UDX A;  1Q81 C;  4K5W A;  4HJ9 A;  3HG9 A;  4IFD J;  4BBS B;  4YY3 L;  2B63 B;  5FO9 B;  2UUC Q;  1VQA A;  3C3L A;  5FLM H;  5K36 H;  2JA6 G;  4JI5 L;  4AYB E;  3AFQ A;  1QVC A;  1LAC A;  2DN8 A;  2NVY B;  3DEP A;  5ELC A;  4A4I A;  1XWE A;  1K0R A;  1TII D;  2KBN A;  1MJE A;  1HFN A;  4A3C H;  5IGB A;  2PO4 A;  4RGM A;  1I4P A;  1F2Z A;  3A0J A;  2UUB Q;  1NMG A;  3TSS A;  4KD4 A;  1DOM A;  4LFB Q;  1LYL A;  1SLJ A;  5D14 A;  5IOD A;  2IX0 A;  4POF A;  1QNK A;  2AQ3 B;  1HRJ A;  3KYH C;  1WTO A;  2UU9 Q;  1IHZ A;  2EPB A;  3EA6 A;  3RR5 A;  3HKZ B;  3GTO B;  3I4M B;  1G29 1;  1G2T A;  1SNP A;  3NWS A;  1QUQ A;  5J22 A;  4K5V A;  3VYU A;  2IT1 A;  1A15 A;  3GTQ H;  4BY7 H;  4DV2 Q;  3URY A;  2PMZ B;  3K7U C;  4RG1 A;  2NVQ B;  5IYB H;  3KUP A;  3VDY A;  2Q2I A;  3IAY A;  5M5W B;  3SVM A;  1ONL A;  2VB3 X;  1PH4 A;  1U4M A;  5FKA C;  3R2T A;  3FPU B;  3F2D A;  4K8I A;  2JA8 B;  3I73 A;  1PZJ D;  5M5Y B;  5FJ8 H;  3KF6 A;  3TME A;  3CRK C;  4A3I G;  1N34 Q;  4OX9 Q;  2MGS A;  1ET6 A;  4B9W A;  3GTM B;  2C5C A;  4OWX B;  4G57 A;  4TQU S;  3F2C A;  1SFO B;  4QCL A;  2FMM A;  2VNU D;  1XNR L;  1Q1B A;  3E6Z X;  1HNW Q;  1WTH A;  2OCE A;  2K4K A;  3DUZ A;  4HIK A;  2ZT9 C;  4O2D A;  4LF9 L;  2V4D A;  4HIM A;  1Z9F A;  5LL6 X;  5NUC A;  4A3K B;  1X3E A;  1XNQ L;  5IP7 G;  3KFU A;  4HSP A;  2B2V A;  3E0E A;  1RDP D;  5I2Y A;  2Z8L A;  3CF5 A;  3R2I A;  1YIJ A;  4R4O A;  2K32 A;  3IKJ A;  3K81 C;  1UAP A;  2LMC B;  3TZD A;  3KLS X;  2EVB A;  5JAV A;  4LNQ A;  1GUG A;  1EY0 A;  1YVC A;  2NWG A;  1KXL A;  1ASZ A;  1A8V A;  5EAY A;  2F0P A;  1L1O A;  2B2U A;  4YCW A;  5C0X G;  4U67 3;  3H0G G;  1YNX A;  4P73 A;  4HJ8 A;  2CH4 W;  2UUB L;  3GTJ B;  4LFB L;  1LT3 D;  5EJW A;  1BNZ A;  1TWF B;  4UAI A;  2J7Z A;  4H13 C;  3K7A H;  2NVT B;  4KHV A;  1X9N A;  1GUN A;  3IFT A;  1PH8 A;  3PIP 3;  1TQO A;  4V0B A;  2UU9 L;  2Q2H A;  3K6O A;  1MJC A;  3BZC A;  4DR3 Q;  2GN5 A;  4DN4 M;  1N36 Q;  2JEA I;  3J7Z C;  3SXH A;  1LT6 D;  2F0V A;  2DGY A;  3U50 C;  4DV2 L;  2K52 A;  3S15 H;  1NTG A;  1B7Y B;  4H44 C;  1B3Q A;  5FO7 B;  4YIJ A;  3I4L A;  3S16 H;  1IKL A;  1EEI D;  1EY5 A;  3E5S A;  3RLO A;  4P74 A;  4ALP A;  3RLF A;  1ROD A;  3O13 A;  1J8I A;  1SNQ A;  2EXZ A;  2XRQ D;  1N34 L;  3M7N A;  2F3V A;  2Z4H A;  1B9M A;  4BBS H;  3CW2 C;  1E1T A;  2SOB A;  2B2W A;  2B63 H;  1C48 A;  3A8J E;  4DFA A;  2UXC L;  4O42 A;  1HNW L;  1FJG L;  2ENB A;  5BR8 Q;  3KF8 A;  2NTT A;  2NVY H;  2MFI A;  5DLQ E;  1M8A A;  1VF5 C;  2DY8 A;  4ID6 A;  1OXU A;  4F7X A;  4A3M G;  3VR6 A;  1G2S A;  1AW7 A;  4F87 A;  5J39 A;  1X32 A;  1CQF A;  2KQ3 A;  3MXG A;  5COY A;  5FO8 B;  1KAB A;  3BVG A;  1S72 A;  3LGJ A;  4JI8 Q;  5IOC A;  4ZKC B;  2KHJ A;  3DHQ A;  4PV1 C;  1SE8 A;  4A3I B;  1QJO A;  3QB3 A;  3GTO H;  4K8J A;  3I4M H;  3PQI A;  4X66 Q;  3UDF A;  4QIW E;  4YWM A;  4EVO A;  3ONA B;  1EIY B;  4JW0 A;  3S1Q B;  2WAQ B;  3PO3 B;  3K59 A;  5CV7 A;  2O5I C;  1FL0 A;  2NVQ H;  4KTA A;  3R93 A;  4R4C A;  3OW7 A;  4C1N K;  2NZO A;  3HOW G;  1D6E C;  5M5W H;  1IXR A;  4QQB X;  3QOL A;  1JC7 A;  1YI2 A;  1PFS A;  2Q8I B;  4OO1 H;  1JOO A;  4DR3 L;  2NYZ D;  1N36 L;  2J4X A;  5M3M G;  1NJI C;  3MFY A;  2K28 A;  2JA8 H;  3J7Y W;  1FR3 A;  1QVG A;  2XIW A;  1TR5 A;  3V05 A;  3CRL C;  2E2J B;  1W6J A;  3AU7 A;  1DM0 B;  2F0J A;  2AKW B;  2VL6 A;  1PHJ A;  3GTM H;  1A3T A;  1SYD A;  1UE1 A;  1HH2 P;  4JI3 Q;  4RHR A;  4DV1 Q;  1SFO H;  5IP9 G;  1EEF D;  1TXY A;  5A2Q E;  4JI0 Q;  3SR1 A;  4A3K H;  3P7J A;  1CFM A;  4L6T B;  5EPL A;  1SMY D;  1ET9 A;  2K5N A;  3W1G A;  1Q7Y C;  1F9P A;  2F0N A;  4H7B A;  1K8G A;  1GHJ A;  2R93 G;  2KHS A;  3RMH A;  5E3F A;  5KYL A;  1WD0 A;  1BOS A;  4L5T A;  5BR8 L;  3QO2 A;  1CTM A;  2WV6 D;  3MWY W;  1HQM C;  2XRS D;  4QJF A;  2PCF B;  4LK1 C;  3OYY A;  2MNA A;  1PH9 A;  3NQI A;  5ELE A;  1R4Q B;  3PGZ A;  3S2H B;  2F4I A;  1SE3 A;  1JWU D;  2CVR A;  1RF2 D;  2AQ1 B;  5C3W A;  1WTP A;  3HOX B;  1TWF H;  4JI8 L;  2PZW A;  1Q90 A;  4GN5 A;  4DNT B;  2E2I B;  4OIK A;  1W2B A;  2NVT H;  4Y52 H;  1X3Q A;  4RCN A;  1JIC A;  4KKT A;  4X66 L;  1R9T B;  2LY7 A;  1A2T A;  4L63 B;  4NP5 A;  5JJK A;  3GV3 A;  3L2P A;  4B3S Q;  4IO9 A;  4FXD A;  1FGB D;  5BN3 A;  3DM3 A;  5EGT A;  4KY7 A;  2VUM B;  2A6H D;  4AYB G;  3BDC A;  3SDZ A;  5JEA J;  1JCK B;  1C0A A;  1EQV A;  2RDG A;  1M4V A;  3HEJ A;  5IYD G;  2HHH Q;  1DJR D;  1BXT A;  1IBM Q;  1E7Z A;  3DWP A;  4JI2 Q;  4XYQ A;  1I50 B;  2EE1 A;  4BA2 I;  3KDF A;  4C56 C;  1VQC A;  1PVO A;  3ICE A;  1D7Q A;  3TRZ A;  3BZK A;  2XN9 C;  3EIV A;  2KVM A;  4LF8 Q;  2ALY B;  1U5K A;  3M4O B;  1EYD A;  3F8T A;  4JI3 L;  4L5R C;  4FDB A;  5JPN C;  2EXD A;  2R61 A;  3GQB A;  3P20 A;  1YNN C;  1O7Z A;  4RGN A;  5G3L D;  4G4K A;  3VR3 A;  3F2U A;  1KRT A;  4JI0 L;  4IOA A;  4DR2 Q;  3BVZ A;  4RH6 A;  5IE8 A;  1CKN A;  3T4A C;  3HOW B;  1S5B D;  3W2D A;  3NBI A;  2LXK A;  5JEA G;  1PTO B;  4JBW A;  1KDC A;  3RZD B;  4J1M A;  3TP6 A;  2VW9 A;  1PH2 A;  4HTH A;  2RKS A;  3MTS A;  4FF1 A;  3S14 B;  2IHE A;  5AFW A;  3SK5 A;  2OT2 A;  3CD6 A;  2F0H A;  4PNY A;  2WB1 E;  1BCP B;  2B8G A;  5E1F A;  4A3I H;  2R7Z B;  4A3L H;  1PTO F;  1BBU A;  3V2T A;  3HOY G;  3PUW A;  5GQO A;  1L2F A;  3CPW A;  3S1Q H;  4FXK C;  3PO3 H;  4UY8 C;  3K57 A;  3NQT A;  5CBA E;  1KQS A;  1HR0 Q;  3EQL C;  4V19 0;  4GN3 B;  5FK9 C;  4WRD A;  4DK3 C;  1SND A;  3J81 c;  5C4J B;  5IYC H;  4DNI A;  1MD2 D;  1PFB A;  5E7N A;  1HUN A;  3SK6 A;  1HNX Q;  3A56 A;  1LTI D;  3CCE A;  3KBG A;  1RJT A;  5C3E B;  2A6E C;  4B3S L;  2EY2 A;  2IWH A;  2SDF A;  2E2J H;  4JYA Q;  1S40 A;  1TWG B;  2K5H A;  5KNB A;  2TSS A;  4CGY B;  4FF3 A;  1IYJ B;  2HHH L;  3ZJY C;  3VA5 A;  3PCO B;  4UHV A;  5C0X H;  3X3M A;  4JI2 L;  5M3F B;  3PIP A;  5E4W C;  1XPU A;  1ENF A;  5IGC A;  3CCM A;  1NR4 A;  3QJY A;  3GDE A;  5A35 A;  3TZU A;  5KYI A;  1ICF B;  1WYD A;  3RZO B;  2JEB I;  2RDH A;  3DEO A;  4LF8 L;  2N8N A;  4C2M B;  1TWH B;  1V1O A;  3D0F A;  2PW7 A;  3E0J A;  2FJ2 A;  2X69 A;  3I7F A;  1E2V A;  3I8Z A;  1QIL A;  4DR2 L;  2KJX A;  3GTL B;  1H95 A;  3HFZ B;  1MSG A;  2Q8T A;  2QEJ C;  3S2H H;  2K04 A;  4LF7 Q;  4A3G G;  3EVQ A;  2PPB C;  4QMG A;  2GVA A;  3TN2 A;  2E2H B;  4RMF A;  3HOX H;  4N8F A;  1SJH D;  4Z9C B;  2E2I H;  4DR4 Q;  2G5D A;  4EQN A;  1SJE D;  4WFN 3;  1A0I A;  4B3R Q;  5C44 G;  3EJI A;  4ABN A;  1STB A;  4CDC C;  2MPM A;  3S24 A;  1R9T H;  2C9O A;  2ZTD A;  5IGD A;  4M1U B;  1K3B C;  1OO9 B;  1VQF A;  2K33 A;  4S3S A;  3STB D;  4NPS A;  1YJW A;  1HXY D;  3C1E A;  3CCJ A;  2VUM H;  1HR0 L;  1S4Z A;  3CCU A;  2CW0 C;  1MSH A;  1SYC A;  3LWU A;  5ELB A;  2Y0S G;  3T1H Q;  5CV6 A;  1D5Z C;  3SHL A;  3G7L A;  4JBK A;  3FEW X;  1I50 H;  3P1H A;  4CKB A;  4E6I A;  1XMQ L;  1HNX L;  3TRE A;  2K03 A;  3NBH B;  3CC4 A;  2A69 C;  1EY8 A;  2WIN B;  4KV6 A;  4GLX A;  1AFP A;  2F0F A;  1AZP A;  3LX0 A;  2Q2T A;  1U4P A;  1H9M A;  2MP1 A;  3M4O H;  1HZB A;  3G71 A;  4LFC L;  2MHV A;  4XQN A;  2E5L Q;  5EBC A;  4JI7 Q;  5LL6 S;  1PTO C;  1VQE A;  1D1K A;  2F0W A;  1ML0 D;  2E2D C;  3CHB D;  3HOW H;  4C3H G;  2BDN A;  1BCP C;  2EYF A;  1PTO H;  1STY A;  3CPF A;  2L1B A;  2BE5 C;  3L9A X;  3S14 H;  1V43 A;  2LSS A;  4X3U A;  2D2C C;  4RWS C;  1CA5 A;  2YYZ A;  3CMA A;  2YTV A;  2R7Z H;  3CKI B;  2VS1 A;  5GAE C;  1FYC A;  5HGT A;  1ZYR C;  1SBB B;  1CHQ D;  3BDO A;  4ZAI A;  1VMP A;  1ZEQ X;  4P72 A;  5DM7 3;  4LF7 L;  4LF4 Q;  2I5H A;  3QWN A;  4IUR A;  5IP9 H;  3BZD B;  3BYY B;  2UUA Q;  2NZ1 D;  1DCZ A;  1EY7 A;  1SYG A;  4DR4 L;  1TY0 A;  2A19 A;  3NEN A;  3S1N B;  3H3V C;  5C4J H;  4XYO A;  4UDU C;  5I6W A;  5GRO A;  4B3R L;  4CDE C;  2J0T D;  4R9W A;  3I4N G;  4DUZ Q;  1CKO A;  3C1F A;  4QB4 A;  3N6R A;  5C3E H;  1STG A;  3AMU A;  3C2P A;  1BBW A;  1HQR D;  2N88 A;  1TWG H;  2F0E A;  5CC4 A;  4TKO B;  4O0A A;  3MHB A;  5I6Y A;  2IJ0 A;  2ZXR A;  4DV6 L;  3T1H L;  3DMU A;  4J6H A;  1YBY A;  5M3F H;  4A3G B;  1E2Z A;  2D5D A;  2NN6 H;  2KEE A;  1E3P A;  1I3Q B;  2JQO A;  4X65 Q;  1GHK A;  2O4X A;  3I70 A;  2K7V A;  4MTN A;  2KCN A;  4JI4 L;  4CJ2 C;  2A68 C;  3RZO H;  1JOK A;  3HOU G;  4C2M H;  1CSQ A;  3CQZ B;  1WCM H;  4B08 A;  1TWH H;  4OO1 I;  1SAP A;  2E5L L;  3ND9 A;  1N8R C;  3K5N A;  4JI7 L;  4CDD C;  4ZLT F;  1IW7 C;  1JJ2 A;  1E0B A;  4IFD G;  2CFM A;  3GTL H;  1UE7 A;  1VQL A;  3HOZ G;  3S17 B;  1GUO A;  2CHB D;  3AQQ A;  2K14 A;  3I91 A;  2ZXP A;  3HOV G;  1HUM A;  4I65 A;  2E2H H;  1TWC B;  4YCU A;  3ERO A;  4X6A H;  3NP8 A;  1YNJ C;  4C3J B;  1M1K C;  5C4X B;  2ZJQ A;  1VQN A;  3FMC A;  4LF4 L;  3M4P A;  1JWM D;  2OF1 A;  1VQP A;  3Q24 A;  2VQF Q;  2UUA L;  2ICE C;  4X64 Q;  2F4V Q;  2N55 A;  1VQH A;  1B70 B;  4JOI C;  4QIW B;  4CKC A;  5EPJ A;  4CJ1 B;  2L4N A;  4ZYS A;  3VA7 A;  1Q3L A;  4A3E G;  3RLN A;  1OXT A;  3IL8 A;  4C3H B;  3G4S A;  4K0K Q;  2PI2 A;  2LXJ A;  1WI5 A;  4DUZ L;  2A1A A;  2F0S A;  3G6J B;  5T1I A;  5L37 A;  2EYO A;  2MO0 A;  5K5P A;  1VQ6 A;  5C5M A;  2JA7 G;  2UUC L;  1G6Z A;  4GNX B;  3P75 A;  1K8O A;  1STE A;  3BYT B;  2WB1 G;  4L5S A;  2B2T A;  5BN5 A;  4ZK9 B;  4A3D B;  4DV4 Q;  1TWA B;  4IN3 A;  4IUV A;  1F9S A;  1K28 A;  4X65 L;  1UE6 A;  4C3I G;  1K0S A;  4HCE A;  3G48 A;  3X3N A;  1QOH A;  1FD7 D;  1Q1E A;  3N52 A;  5FOB B;  2I46 A;  4IJL A;  2G9H D;  2XGT A;  3PUV A;  1F9Q A;  1Z7T A;  3I4N B;  4FXG C;  4UP9 A;  2MQH A;  4IUP A;  4JG2 A;  3DXJ C;  4BY1 G;  2JA5 H;  1Y1W G;  1B9N A;  4K6L A;  4X62 Q;  3PIO 3;  1Y1V G;  2JA6 B;  4EQO A;  1S3O A;  1LTG D;  4I7Z C;  1E2W A;  2K05 A;  3KLR A;  1RHP A;  1SN8 A;  3S1N H;  4HCS A;  4XT3 B;  1H9K A;  1EWH A;  3CCR A;  1DZ1 A;  4NKL A;  2AWN A;  2VY3 A;  1HFG A;  1R4P B;  2DUD A;  1CZW A;  2RSO A;  4XXE A;  2ASB A;  1QNU A;  4OX9 L;  4EGV A;  1CA6 A;  3UE1 A;  2VQF L;  1EFW A;  3UDG A;  3ERS X;  4X64 L;  2F4V L;  5BN4 A;  3ERQ A;  3BS1 A;  5CGK A;  1ILQ A;  4ZKB B;  2KEN A;  1SXT A;  4A3B G;  3MXU A;  2Y0S E;  1PH7 A;  3FKI G;  4K0K L;  3NPP A;  3GP7 A;  2WP8 J;  4L5Q A;  1I3Q H;  2EIF A;  2JSO A;  4LF5 Q;  3GV6 A;  1KNE A;  2KCC A;  4CHT B;  1VQO A;  3C46 A;  3S1M B;  2SNM A;  2B3G A;  2YU9 B;  2UXB Q;  2RVL A;  3CQZ H;  1I4G A;  3K80 C;  4TVA B;  2BH8 A;  1IL8 A;  1I94 Q;  3A8I E;  1I4H A;  3JAM c;  1NMF A;  3B6Y A;  3BDL A;  4AQY Q;  1EZ8 A;  3S17 H;  3M7G A;  3J80 c;  1MI2 A;  1XPR A;  2A74 C;  1X3F A;  2JA9 A;  1K73 C;  2JXM B;  2K5V A;  3ER0 A;  1WTR A;  1GKH A;  1LTT D;  1G8Z D;  1AE3 A;  1TWC H;  2AQ2 B;  4DUY Q;  2N49 A;  3J81 L;  2EYL A;  1H9R A;  4LAA A;  2HDM A;  2OQK A;  1SEB D;  1K8A C;  1EUJ A;  4X3S A;  2HCC A;  2ZTE A;  4ME3 A;  1YJ9 A;  1S5F D;  4X62 L;  2F3W A;  4C3J H;  1H9S B;  5ELN A;  2OQ0 A;  5M5Y H;  5C4X H;  1B2T A;  5I4D A;  2BA0 A;  3PF5 A;  2WB1 B;  5J3B A;  4FP5 D;  1EY6 A;  4WJ3 M;  2NBF A;  5F2D A;  5ELO A;  1P16 A;  1UUP A;  2H5X A;  1KIX A;  4WJW A;  1EU3 A;  5GAD C;  2RQX A;  2KCT A;  2N3S A;  1YHA A;  2PW5 A;  4RAU C;  3H0G B;  5KEE A;  1IL2 A;  5J1Z A;  4NXM Q;  1YJN A;  1GD7 A;  4C3H H;  4GNX C;  1PRT D;  1Q12 A;  3L7Z C;  1EWC A;  1V9P A;  4TSS A;  5C5L A;  2E76 C;  2MJ8 A;  4DR1 Q;  1JOQ A;  4ULL A;  4P2C B;  3SEB A;  4RGT A;  5IT9 E;  2FXQ A;  1AP0 A;  2F0T A;  5KIX A;  2EY6 A;  3AEV A;  4K2L A;  1VQB A;  1SDF A;  1Y1V B;  1NBW A;  4A3D H;  1ICW A;  2AWO A;  1TWA H;  2FFK B;  4FVM A;  1LLR D;  4HAE A;  5M9O A;  1BR9 A;  1HZA A;  4LF5 L;  3BG3 A;  4MZ9 A;  3NTH A;  3GTJ H;  1RTO A;  3J7A F;  3NBH A;  3QOJ A;  1M90 C;  1E24 A;  2C35 B;  2XVS A;  2UXB L;  1HR0 W;  2F0Q A;  4GKJ Q;  1B53 A;  3I4N H;  4DR7 Q;  4MNO A;  5FLM G;  3A55 A;  5K36 G;  1CI3 M;  3D31 A;  1I94 L;  1CK1 A;  2HIX A;  1ZXT A;  1CKM A;  4A3C G;  2JA6 H;  1CZG A;  2KCM A;  3ZYY X;  1VQ8 A;  2UXD Q;  3NTK A;  4A3B B;  3UDI A;  4R8N A;  4LMQ D;  3RUZ A;  4DUY L;  1J9O A;  1KAW A;  1VDZ A;  4JI1 Q;  3TQY A;  4A3M B;  1IBK Q;  3A54 A;  4N9P A;  2L55 A;  2M00 A;  4DV5 Q;  2R3Z A;  1DGS A;  3KLW A;  3RNU A;  3CP0 A;  5FLX E;  4F88 A;  4LUZ A;  5G3L F;  4LW1 A;  5LMN Q;  2F0U A;  2ZM6 Q;  1BQQ T;  2RA4 A;  5GAH C;  1ZKO A;  5AJ3 Q;  2EZV A;  3MXP A;  3MXN B;  1B4O A;  1PYS B;  2PQA B;  4DV1 L;  1DD2 A;  1EIG A;  3CCV A;  4IFD H;  5IYB G;  3U4V A;  4KN7 C;  1V1P B;  3A5Z B;  4NXM L;  3RD4 A;  2RCF A;  4YHH Q;  3CC2 A;  4DR1 L;  4PZ7 A;  4KHP Q;  4A93 G;  4LWC A;  1PXU A;  5M5X B;  1PZI D;  3S2D B;  3T51 B;  5FJ8 G;  3S1M H;  5M3M B;  1HPC A;  1PDQ A;  2D9U A;  4G7O C;  2RF4 A;  4KHZ A;  1NE3 A;  2WAQ E;  4JBM A;  2QDB A;  2BA1 A;  4DAV A;  3R8B A;  2B29 A;  2LS0 1;  2K6A A;  4K6D A;  3MEH A;  3WWV A;  3CU7 A;  3HKS A;  5T1G A;  1LT5 D;  1EY4 A;  1WTQ A;  1L0X B;  2JYO A;  3K5O A;  1SMY C;  4GKJ L;  4KK7 A;  3PSI A;  1DOK A;  5IP7 H;  4DR7 L;  1SR3 A;  2VZA A;  1V1Q A;  3FRP B;  2NN6 I;  1TT2 A;  1G91 A;  3AB9 A;  1U4L A;  4RGO S;  1T5E A;  3NEM A;  3OMG A;  1MHW C;  1E1O A;  4BXX G;  2EJM A;  2KA7 A;  2V1C C;  2TMP A;  1EYC A;  2R93 B;  5CV4 A;  4LUV A;  1VQG A;  3NXW A;  5IGF A;  5DNF A;  4OEL B;  2VQE Q;  2JP1 A;  4K14 A;  4U68 A;  2UXD L;  4IPG A;  3KF8 B;  2CWA A;  1A3U A;  3Q6S A;  1D1I A;  3TP5 A;  4HJ5 A;  5D65 A;  1IBK L;  1IBM L;  4DV5 L;  3H0G H;  4CJ0 B;  4DPG A;  4RFB A;  1BCP D;  4BBR G;  5LMN L;  3BU2 A;  3PO2 G;  3A5U A;  1H9J A;  5JJZ A;  2ZM6 L;  1C8C A;  3NE5 B;  3PIO A;  1EL0 A;  1Y8N B;  2X6L A;  1WOC A;  1MBY A;  5LHY 1;  4DK0 A;  2YV5 A;  3L0O A;  4KN4 C;  2EOT A;  4KY6 A;  3I3C A;  1BDO A;  1O7I A;  3A7L A;  1OTC A;  2A6H C;  1Y1V H;  3RN5 A;  1X54 A;  1HTP A;  2E74 C;  1PA6 A;  2I5M X;  3EBE A;  4YHH L;  1NR2 A;  4GKK Q;  4AYB B;  2KOL A;  1VQM A;  1XTD A;  4KHP L;  3OIP A;  5EKI A;  2RSN A;  3D6W A;  2Z9H A;  1WTV A;  2QCP X;  4IPH A;  4CBV A;  5C4H A;  3D4D A;  4BBS G;  1UEA B;  1NAP A;  3KK7 A;  1CT1 D;  2B63 G;  1I4R A;  3OHX C;  1T5X D;  4DXF A;  2Z6B A;  1KAA A;  3K5L A;  4IUT A;  4KI0 A;  4G7H C;  1BBX C;  5EKL A;  1NCV A;  2EYH A;  2B2V C;  1F2L A;  4K2K A;  4A3B H;  2BDO A;  2D0P A;  4KLK A;  1GJX A;  2PQE A;  1N9W A;  4A3M H;  2OTJ A;  1TKW B;  3OW2 A;  1I4X A;  2F0K A;  3F2B A;  2A68 D;  4A93 B;  4HN7 A;  3KLS A;  2BCO A;  1Y8O B;  3DWQ A;  2XSC A;  2EDG A;  5ELD A;  3I4M G;  3HKZ G;  2CQO A;  3K5M A;  1NSN S;  3OTO Q;  2B2U C;  1F9R A;  1PH1 A;  4JYA L;  2VQE L;  4OHJ A;  3JC6 6;  4XDX A;  4PG3 A;  1I6V C;  3HOY B;  1EQR A;  3F1Z A;  3MFG A;  1PH3 A;  1EIF A;  2WKD A;  2A5H A;  2IHF A;  4L8J A;  4IUU A;  4LJZ C;  1SRO A;  1LTR D;  1GUW A;  4OO1 G;  2I0Q A;  1FGU A;  3KBX A;  1VQK A;  4P71 A;  5EKK A;  2CCZ A;  3GTG B;  2JA8 G;  5HY6 A;  1EOT A;  4I7A A;  2L9H A;  1LTA D;  4M8A A;  5M5X H;  3RZD H;  3S2D H;  1ESF A;  2KEC A;  4H0L C;  4RKL A;  1A63 A;  4H02 A;  2CWP A;  4EQP A;  5M3M H;  1SNC A;  3OMC A;  2HUG A;  3TP7 A;  4RKB A;  3UI2 A;  1PLF A;  1W3S A;  2WFW A;  4JV5 Q;  1Q82 C;  4KY5 A;  1O78 A;  4GKK L;  4OGQ C;  3I56 A;  4PMB A;  4A3K G;  3CC7 A;  1X56 A;  1D5X C;  4QF4 A;  1B44 D;  3GTP B;  4NW2 A;  1AN8 A;  1VS0 A;  4BBR B;  2MO1 A;  1GUS A;  1ESR A;  3FDT A;  1JR0 D;  3PO2 B;  1STN A;  3TDQ A;  4R1J A;  2K5W A;  1SYB A;  5IY0 A;  3CAM A;  2P5Z X;  1C4Q A;  3SE0 A;  3IFD A;  1X55 A;  1C9O A;  2R93 H;  3CME A;  1JJG A;  2M2L A;  3H3V H;  4Q0F A;  5EQ0 A;  4RCO A;  2ZTC A;  3M4Y A;  1RCV D;  1XNR Q;  1GVP A;  2XNA C;  2Q8R E;  1A2U A;  4OIJ A;  2L11 A;  5IIF A;  3W5O A;  1TS3 A;  3ND8 A;  4DK1 A;  4C1N I;  1XNQ Q;  5IGE A;  3IRB A;  1JOR A;  4MIU A;  4IZ8 A;  2FHT A;  4A76 A;  3UE0 A;  5C3X A;  1RTN A;  3OTO L;  1Y69 U;  2JN4 A;  3VYS A;  2R6G A;  1H9S A;  2G9D A;  1I6H B;  4OWT B;  5C44 B;  1LTL A;  1TU2 B;  2LKV A;  3STB C;  4DR5 Q;  1VMC A;  3J7A V;  4GOP B;  1Q46 A;  1UNS A;  4IUN A;  3H09 A;  3JAM L;  2ZXO A;  2L5T A;  2OTL A;  2K01 A;  1AE2 A;  3J80 L;  2RBM A;  1EOV A;  1LAB A;  2IL8 A;  3Q22 A;  1KLG D;  1QZH A;  1BKB A;  5IYD H;  2Y0S B;  4FO2 A;  1RIP A;  2WKC A;  1JT8 A;  3GTK B;  2H4O A;  1KL9 A;  1PYW D;  1X65 A;  1FNV A;  3MA2 B;  3VR2 A;  4A3F G;  2AHO B;  2NVX B;  5TSS A;  2DY7 A;  4JV5 L;  2YTY A;  4CDF C;  2MUY A; 
#chains in the Genus database with same CATH homology
 1L1O C;  4YY3 Q;  4L5R C;  4FDB A;  4TVA B;  2BH8 A;  2EXD A;  1PH6 A;  4A75 A;  1I94 Q;  4OWW B;  3JAM c;  1T9H A;  1EYG A;  1NMF A;  1IZ6 A;  4IPC A;  4JI5 Q;  1KRT A;  1LUZ A;  3B6Y A;  4AQY Q;  4JI0 L;  4R4T A;  3S17 H;  4IOA A;  4DV6 Q;  4DR2 Q;  3W1B A;  3J80 c;  2ZJR A;  1XPR A;  2JA9 A;  1X3F A;  5IE8 A;  1K73 C;  1CKN A;  2K5V A;  4R4I A;  3ER0 A;  2E8G A;  4B3R L;  2K50 A;  4JBJ A;  1GKH A;  1JB7 A;  1AE3 A;  2LXK A;  5JEA G;  1X3G A;  5IWA Q;  1TWC H;  4JBW A;  4DUY Q;  3FHW A;  2CKZ B;  2BH2 A;  2N49 A;  2VW9 A;  5IT9 c;  1PH2 A;  1KRS A;  4JI4 Q;  4PMW A;  1K83 H;  4A93 H;  2IHE A;  4DV0 L;  2OQK A;  4GLA C;  1K8A C;  1EUJ A;  3CD6 A;  4A3L G;  2WB1 E;  2ZTE A;  4ME3 A;  1YJ9 A;  5C4X G;  2F3I A;  3E9H A;  4X62 L;  1CSP A;  5C0X J;  4A3I H;  4C3J H;  1HZ9 A;  4A3L H;  4GS3 A;  5ELN A;  2OQ0 A;  5M5Y H;  4NXN L;  3GD7 A;  3FP9 A;  5C4X H;  2ES2 A;  1EQQ A;  1BBU A;  2BA0 A;  2D62 A;  5J3B A;  3PF5 A;  1IBL Q;  3HOY G;  3M9B A;  2UXC Q;  4WJ3 M;  2RCN A;  3PUW A;  1FJG Q;  5ELO A;  1P16 A;  2WAQ G;  5GQO A;  1YEZ A;  1SMX A;  4J15 A;  3PO3 G;  3HOY H;  2H5X A;  1L2F A;  4QGU A;  1KIX A;  4DV3 L;  4A3J G;  3CPW A;  5GAD C;  3S1Q H;  3KOJ A;  3PO3 H;  4UY8 C;  2A8V A;  1MIU A;  2KCT A;  2N3S A;  1YHA A;  4JI6 Q;  2HT1 A;  1L0W A;  1KQS A;  1KD1 C;  1HR0 Q;  4GN3 B;  4YWK A;  5IYC G;  1IL2 A;  4JCV E;  4DK3 C;  4NXM Q;  1YJN A;  1GD7 A;  1HNZ Q;  1XMO Q;  4C3H H;  3SGI A;  3J81 c;  4GNX C;  1Q12 A;  3L7Z C;  1K9M C;  5IYC H;  1V9P A;  4DNI A;  3GTG H;  5E7N A;  4DR1 Q;  1HNX Q;  3KJO A;  3TEH B;  3KDF B;  3CCE A;  2R92 G;  1D8L A;  1SRU A;  2FXQ A;  4BXX H;  4B3S L;  4DR5 L;  1Y14 B;  4JYA Q;  2E2J H;  2PQA A;  1S40 A;  4P75 A;  3AEV A;  4AH6 A;  1AH9 A;  3K8A A;  2K5H A;  4A3D G;  1VQJ A;  1E22 A;  1VQB A;  3RN2 A;  3H15 A;  1OXV A;  1NBW A;  4NB3 A;  4A3D H;  1JE5 A;  1WFQ A;  1IYJ B;  1U0L A;  2AWO A;  3ZJY C;  2HHH L;  3PCO B;  1TWA H;  1XPO A;  4JI2 L;  3I55 A;  4PZ8 A;  3PIP A;  1HZA A;  4LF5 L;  1XPU A;  3JAM i;  4IFD I;  4MZ9 A;  5FLX c;  3Q8D A;  3GTJ H;  3CCM A;  1OXX K;  2F52 A;  1VQ9 A;  4LF9 Q;  1CKN B;  2QEX A;  5HGQ A;  3GTP H;  3GDE A;  1M90 C;  1E24 A;  2C35 B;  4BA1 I;  1WYD A;  3J80 i;  4DV7 L;  2JEB I;  2QGQ A;  4BBR H;  1HZC A;  3UDX A;  1Q81 C;  2UXB L;  1C7Y A;  1QVF A;  4HJ9 A;  1J5E Q;  1HR0 W;  3EN2 A;  2N8N A;  4LF8 L;  3PO2 H;  4GKJ Q;  5JJI A;  3I4N H;  4DR7 Q;  4MNO A;  4IFD J;  5FLM G;  4YY3 L;  5K36 G;  2Z6K C;  3D0F A;  1VQD A;  2UUC Q;  3D31 A;  3PF4 A;  1VQA A;  4UPA A;  1I94 L;  5FLM H;  3I7F A;  2JA6 G;  1LM0 A;  4JI5 L;  4AYB E;  3AFQ A;  1QVC A;  2HIX A;  1CKM A;  4A4I A;  4DR2 L;  4A3C G;  4AIM A;  2JA6 H;  1H95 A;  1K0R A;  4B3T Q;  2KBN A;  3HFZ B;  2KCM A;  2AMC B;  1MJE A;  1VQ8 A;  2UXD Q;  4A3C H;  3UDI A;  3PUY A;  3S2H H;  4LF7 Q;  4A3G G;  5IWA L;  4DUY L;  3HOX G;  1KAW A;  1VCI A;  4JI1 Q;  2GVA A;  3A0J A;  3TQY A;  1P8L A;  1NMG A;  2UUB Q;  1IBK Q;  4A3G H;  4RMF A;  3HOX H;  1LYL A;  4LFB Q;  4DV5 Q;  1SLJ A;  1DGS A;  3KLW A;  2E2I H;  3RNU A;  4DR4 Q;  3CP0 A;  2IX0 A;  4POF A;  3HKZ E;  2Q2U A;  4LUZ A;  4GOP C;  3KYH C;  4LW1 A;  5LMN Q;  1A0I A;  3CCS A;  2UU9 Q;  5C44 G;  4B3R Q;  3J81 i;  3RR5 A;  2ZM6 Q;  3S24 A;  3GO5 A;  1IBL L;  1R9T H;  1G29 1;  1I6H H;  2PMZ E;  1QUQ A;  5C44 H;  2ZTD A;  5GAH C;  1VQF A;  5AJ3 Q;  4DV1 L;  3MXN B;  2IT1 A;  1PYS B;  2PQA B;  4DV4 L;  3STB D;  3CCV A;  4NPS A;  2VUM G;  3GTQ H;  5IYB G;  1YJW A;  4DV2 Q;  4BY7 H;  3U4V A;  4UP8 A;  4JI6 L;  1VQI A;  1N32 Q;  3K7U C;  3CCJ A;  2VUM H;  1HR0 L;  4RG1 A;  1Q8K A;  5IYB H;  3A5Z B;  4NXM L;  1HNZ L;  3CCU A;  1XMO L;  3VDY A;  4B3M Q;  2Q2I A;  2Y0S G;  3T1H Q;  3NEL A;  2L15 A;  4POG A;  3T1Y Q;  4YHH Q;  3CC2 A;  1PH4 A;  4JBK A;  1J6Q A;  4DR1 L;  2UXD L;  4PZ7 A;  1I50 H;  1XMQ L;  1HNX L;  3TRE A;  3U58 A;  4KHP Q;  3GTK H;  4A93 G;  4LWC A;  5C0X I;  3NBH B;  3F2D A;  3CC4 A;  4DAY B;  5FJ8 G;  3ULP A;  3S1M H;  4GN4 B;  4GLX A;  1Q86 C;  2RF4 A;  3KF6 A;  5FJ8 H;  1N34 Q;  4A3I G;  4KHZ A;  2NVX H;  2Q2T A;  4OX9 Q;  1NE3 A;  4APV A;  2WAQ E;  4JBM A;  3M4O H;  2R7D A;  1WJJ A;  3TS0 A;  1HZB A;  4OWX B;  1KC8 C;  2BA1 A;  3G71 A;  4TQU S;  3F2C A;  4LFC L;  5LMN W;  2E5L Q;  4EQ5 A;  2RHQ B;  1XNR L;  2VNU D;  1Q1B A;  2B29 A;  1HNW Q;  4JI7 Q;  3AYH B;  3U4Z A;  2OCE A;  1X6O A;  2K4K A;  1VQE A;  1YIT A;  4HIK A;  3WWV A;  3HKS A;  4PZ6 A;  4O2D A;  4LF9 L;  4HJA A;  4HIM A;  1Z9F A;  2HQL A;  1X3E A;  1HJP A;  5IP7 G;  1XNQ L;  3HOW H;  2D0O A;  3KFU A;  1JJC B;  1J5E L;  3E0E A;  4GKJ L;  4IJH A;  3PSI A;  3CPF A;  3CF5 A;  4OON A;  5IP7 H;  1SR3 A;  2VZA A;  4DR7 L;  1YIJ A;  4R4O A;  1V1Q A;  3S14 H;  1V43 A;  2NN6 I;  3K81 C;  2QA4 A;  2LSS A;  5LMU Q;  3NEM A;  4OXP A;  2R7Z G;  1E1O A;  4BXX G;  2V1C C;  4LNQ A;  1YVC A;  2YYZ A;  2YTV A;  3CMA A;  2R7Z H;  4LUV A;  2VS1 A;  1VQG A;  5GAE C;  1KXL A;  1ASZ A;  1A8V A;  4B3T L;  1CUK A;  2VQE Q;  5EAY A;  1FVI A;  1L1O A;  2HIV A;  1QUQ B;  4XTC S;  4YCW A;  4IPG A;  3KF8 B;  4P72 A;  2CWA A;  1ASY A;  4LF7 L;  2R7F A;  4LF4 Q;  2I5H A;  5C0X G;  4HJ5 A;  3H0G G;  1YNX A;  4P73 A;  5IP9 H;  4HJ8 A;  2UUB L;  2UUA Q;  1IBK L;  1JMC A;  1IBM L;  2KHI A;  4LFB L;  4DV5 L;  3H0G H;  3PUZ A;  4DPG A;  4LFA Q;  4DR4 L;  4DR6 Q;  2A19 A;  4JOI A;  4YWL A;  3K7A H;  3NEN A;  3I4O A;  4BBR G;  5C4J H;  1X9N A;  5LMN L;  2UU9 L;  3BU2 A;  5GRO A;  1PH8 A;  3A5U A;  1GM5 A;  1YZ6 A;  3PO2 G;  2Q2H A;  5C3E G;  2ZM6 L;  1MJC A;  3BZC A;  4DUZ Q;  4HIO A;  3I4N G;  3PIO A;  4DR3 Q;  2GN5 A;  1N36 Q;  1CKO A;  2JEA I;  3J7Z C;  5C3E H;  1WOC A;  1G6P A;  2YV5 A;  3L0O A;  4JC0 A;  2DGY A;  2XTI A;  1BBW A;  3KF6 B;  1TWG H;  3U50 C;  4DV2 L;  1N32 L;  1O7I A;  4O0A A;  1OTC A;  2PNH A;  2K52 A;  3S15 H;  1NTG A;  1B7Y B;  1Y1V H;  2ZJP A;  3ULL A;  1UWV A;  1X54 A;  3RN5 A;  4AQY L;  5M3F G;  2JJQ A;  4DV6 L;  4B3M L;  3AFP A;  3T1H L;  1PA6 A;  2I5M X;  2NN6 G;  3EBE A;  3T1Y L;  1YBY A;  2EQS A;  4YHH L;  3S16 H;  4GKK Q;  5M3F H;  1VQM A;  1XTD A;  1E3P A;  4KHP L;  4ALP A;  3RLO A;  2JQO A;  4P74 A;  4X65 Q;  3RLF A;  4MTN A;  3CXC A;  2GVB A;  4HID A;  4JI4 L;  4IPH A;  3RZO H;  1WCM G;  4BBS G;  1N34 L;  1G51 A;  2N78 A;  3M7N A;  1PH5 A;  3HOU G;  3M4Q A;  4C2M H;  2B63 G;  4Y7N H;  1CSQ A;  1WCM H;  1TWH H;  4BBS H;  5JJL A;  3CW2 C;  3ULJ A;  1E1T A;  3HOU H;  4OO1 I;  2B63 H;  3BJU A;  2E5L L;  3J81 j;  1GO3 E;  4KI0 A;  1XJV A;  1N8R C;  2UXC L;  4UP7 A;  4JI7 L;  1HNW L;  1FJG L;  5BR8 Q;  1JJ2 A;  4IFD G;  2NVY H;  3M3Y H;  2MFI A;  1N33 Q;  4BY7 G;  2CFM A;  3GTL H;  5DLQ E;  1UE7 A;  1VQL A;  3HOZ G;  5H1S E;  1L1O B;  3AQQ A;  4A3B H;  3G6E A;  4A3M G;  1OXU A;  2K14 A;  4K0K Q;  2D0P A;  3HOZ H;  4KLK A;  3HOV G;  1N9W A;  4A3M H;  2E2H H;  3CCL A;  2OTJ A;  4YCU A;  3OW2 A;  3F2B A;  3CCQ A;  3HOV H;  5LMU L;  1EWI A;  1UE5 A;  2K75 A;  1S72 A;  1VQK A;  3LGJ A;  4JI8 Q;  4WJ4 A;  4X6A H;  2KHJ A;  4LF6 Q;  3I4M G;  3HKZ G;  2CQO A;  2ID0 A;  1SE8 A;  5GAG C;  3OTO Q;  4A3F H;  2YU9 H;  1PH1 A;  4JYA L;  1OXS C;  2VQE L;  3GTO H;  1M1K C;  3I4M H;  2ZJQ A;  1VQN A;  2Z6K A;  3JC6 6;  3UDF A;  4X66 Q;  3KJP A;  4DKA C;  4DK6 C;  4LF4 L;  3I2Z A;  2RHS B;  3M4P A;  4PG3 A;  3PUX A;  4QIW E;  1VQP A;  4QY7 A;  4YWM A;  2VQF Q;  1KHI A;  1YHQ A;  2UUA L;  4X64 Q;  2F4V Q;  1EIY B;  1EQR A;  3DLL A;  1VQ5 A;  1BVS A;  1B70 B;  1VQH A;  3F1Z A;  3PV0 A;  1PH3 A;  1UEB A;  1EIF A;  4JOI C;  3H3V I;  2IHF A;  4LFA L;  1FL0 A;  2NVQ H;  4DR6 L;  4R4C A;  4A3E G;  1SRO A;  2NZO A;  3HOW G;  4OO1 G;  5M5W H;  1IXR A;  2I0Q A;  3RLN A;  1OXT A;  1FGU A;  4QQB X;  4HJ7 A;  3G4S A;  4P71 A;  4IOC A;  2PI2 A;  4A3E H;  2LXJ A;  1PFS A;  1YI2 A;  2CCZ A;  1WI5 A;  4DUZ L;  2A1A A;  2JA8 G;  4DR3 L;  1N36 L;  5HY6 A;  5M3M G;  1NJI C;  5M5X H;  3RZD H;  3S2D H;  2JA8 H;  1VQ6 A;  2MO0 A;  1A63 A;  4H02 A;  2CWP A;  5M3M H;  3S1R H;  1QVG A;  1I5F A;  2UUC L;  2JA7 G;  1A62 A;  2Z0S A;  4GNX B;  4GOP A;  2OWO A;  2JA7 H;  1MKH A;  1W3S A;  2AKW B;  2VL6 A;  1PHJ A;  2WB1 G;  2WFW A;  3GTM H;  4L5S A;  1UE1 A;  1Q82 C;  4JV5 Q;  1HH2 P;  4JI3 Q;  4DV1 Q;  1SFO H;  4DV4 Q;  4GKK L;  5IP9 G;  1TXY A;  3A74 A;  3MEF A;  1UE6 A;  4X65 L;  3I56 A;  4A3J H;  4A3K G;  3CC7 A;  1PYB A;  4JI1 L;  1X56 A;  4GLV B;  1QZG A;  4JI0 Q;  3G48 A;  2ATW A;  4A3K H;  1Q1E A;  1VQ7 A;  4C3I H;  4IJL A;  1VS0 A;  2XGT A;  1VQ4 A;  1XMQ Q;  2MO1 A;  3PUV A;  2JK8 A;  1B8A A;  2K5N A;  3W1G A;  1Q7Y C;  2IY5 B;  4DAM A;  1K8G A;  2R92 H;  4R1J A;  2JA5 G;  2R93 G;  4UP9 A;  2MQH A;  5IY0 A;  4DV0 Q;  4JG2 A;  3CAM A;  4L5T A;  4BY1 G;  5BR8 L;  1X55 A;  1C9O A;  1Y1W G;  2JA5 H;  3CME A;  2R93 H;  1JJG A;  5AJ3 L;  1N33 L;  4X62 Q;  3H3V H;  4IPD A;  3TS2 A;  4BY1 H;  1Y1W H;  1Y1V G;  2ZTC A;  4LFC Q;  4NXN Q;  4QJF A;  1XNR Q;  1S3O A;  3OYY A;  2MNA A;  1PH9 A;  2IX1 A;  1RL2 A;  1GVP A;  3PGZ A;  2JE6 I;  3W5O A;  4YCV A;  1YHB A;  4DV3 Q;  4XIG S;  1SN8 A;  4LUO A;  2PI2 E;  2NZH A;  1XNQ Q;  1TWF H;  3IRB A;  4JI8 L;  4GN5 A;  3S1N H;  4A76 A;  3M85 A;  1W2B A;  3CCR A;  4LF6 L;  3K0X A;  3UE0 A;  2AWN A;  2VY3 A;  2NVT H;  3OTO L;  2DUD A;  4Y52 H;  4EX5 A;  2R6G A;  1Z47 A;  2ASB A;  4GNX A;  4X66 L;  4OX9 L;  3UE1 A;  4OWT B;  4QL5 A;  1LTL A;  2VQF L;  1EFW A;  3UDG A;  3STB C;  1K3R A;  5JJK A;  3ERS X;  4X64 L;  3L2P A;  4B3S Q;  4IO9 A;  4DR5 Q;  2F4V L;  4GOP B;  1Q46 A;  3DM3 A;  2KEN A;  4AYB G;  2OTL A;  5JEA J;  4A3B G;  2Y0S E;  1AE2 A;  1PH7 A;  3FKI G;  1C0A A;  1EOV A;  5IYD G;  2HHH Q;  4K0K L;  1QZH A;  1IBM Q;  1E7Z A;  1BKB A;  3FKI H;  4JI2 Q;  2WP8 J;  4L5Q A;  5IYD H;  1I3Q H;  2EIF A;  1RIP A;  4BA2 I;  1PV4 A;  4LF5 Q;  3KDF A;  1JT8 A;  2I5L X;  1KL9 A;  4R4Q A;  1VQO A;  1VQC A;  1X65 A;  3ICE A;  1PVO A;  2B3G A;  1D7Q A;  3TRZ A;  3BZK A;  4DV7 Q;  3E9I A;  2UXB Q;  1NY4 A;  3CQZ H;  2YTX A;  4A3F G;  2AHO B;  3EIV A;  3J7A 5;  4LF8 Q;  2ALY B;  1U5K A;  4JV5 L;  3K80 C;  2YTY A;  3F8T A;  4JI3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...