4A3LH

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lH00
5LMUL 1IBKL 4IPHA 1E24A 1XNRL 3HOYH 2I5HA 1C9OA 2L15A 2UUAQ 3H3VH 1UEBA 2RHSB 4Y7NH 4R4TA 5J3BA 3A5UA 4IOAA 1A62A 2E8GA 1VQAA 1HJPA 4NXMQ 3CCJA 4MTNA 3S2DH 2D0OA 2KCTA 3F8TA 4DNIA 1VQNA 1X54A 4UP7A 2BH8A 3UE1A 1CKMA 3PUWA 2VZAA 3KJOA 1K0RA 4JBJA 1PH2A 1MIUA 1N34Q 3TS2A 4DR4Q 1JJGA 4DR3Q 4GS3A 4HIKA 1I94L 4MNOA 4JI8Q 2NVQH 2I0QA 3CCEA 3A0JA 2ASBA 3L0OA 4APVA 3S24A 4JG2A 2JA5G 4A3KH 3H0GH 1XNRQ 2JA9A 2VS1A 1IXRA 4DR2Q 1S72A 4BBRH 3TRZA 4BBSH 1N32Q 4KLKA 2LSSA 4LF8L 2GVAA 1CKNA 1VQCA 1L2FA 1BKBA 1YEZA 3M9BA 4X64Q 5LMNQ 1S40A 2NVXH 4B3ML 1N33Q 3OYYA 4YY3L 1SE8A 3CW2C 4GOPB 4A3MG 3RLOA 2PMZE 3KF8B 3CCQA 4DR1Q 1HNZQ 2E5LL 1FJGL 2VUMH 3NEMA 4DK6C 3HFZB 3B6YA 1SROA 4J15A 4LF4Q 2A19A 3ERSX 4L5SA 1QUQB 1NMFA 4PMWA 1BVSA 1VQ4A 4BY1G 2K75A 2CWAA 3KF6B 4A3FH 5GQOA 3JAMi 1N8RC 1U0LA 4P72A 4IO9A 3CQZH 1LTLA 1BBUA 1PH4A 2Q2HA 3K81C 4DV7Q 5ELOA 2RHQB 4GNXA 1YJWA 4A76A 1K9MC 5C44H 3HOZG 4FDBA 1SLJA 4JI7L 1Q82C 4A3JH 2IX0A 2KENA 4JV5Q 4BY7G 4X62Q 1E3PA 4O0AA 1VS0A 3CC2A 4NPSA 5HY6A 4LF9L 4GN5A 1U5KA 2NN6G 3GTQH 2WAQG 2FXQA 2MO0A 1UE7A 2C35B 2UXCQ 1HZAA 1DGSA 5M3FH 1CKOA 4JI0L 4GLAC 3GTPH 4GKJL 1C7YA 1CUKA 3U4VA 1UE5A 3I4NH 3PGZA 5IYBH 1VQ7A 3HOXG 4OWTB 2BH2A 1A63A 2PI2A 1PVOA 3KJPA 2JE6I 3U4ZA 1PHJA 4POFA 5GADC 3S17H 2ZTCA 2AMCB 3FKIH 5IYCG 4R4IA 1W3SA 2UU9Q 1UWVA 4A3JG 1KD1C 1X3EA 4DUYQ 3K8AA 2CKZB 2NZHA 4DV5L 3UE0A 3ZJYC 4OX9Q 1B70B 1PH7A 2OWOA 4JI3Q 1G291 1X9NA 1EWIA 1YHAA 2B3GA 5IYDG 2UUCL 2K14A 4EX5A 1XMOL 3M4QA 3ULLA 4JI2Q 4JI1Q 4JCVE 3MEFA 2F3IA 4IJHA 3CCRA 1IL2A 4HIMA 5GAHC 2HT1A 2JQOA 2IX1A 2VQEL 1V1QA 1MJEA 1Y1WH 4DAYB 4A3MH 2V1CC 4LF6L 4UP9A 3AFPA 4GN4B 4LF5Q 2YV5A 1I50H 3A74A 1FGUA 3RN5A 4DV5Q 5IWAL 1NE3A 5AJ3Q 4HIOA 4OX9L 5LMNL 3CCSA 3M4OH 1GKHA 2ZJQA 4JBKA 4LUOA 4BY7H 4JYAQ 1SN8A 3E9HA 2PNHA 1FL0A 4DKAC 2ZJPA 2OTJA 2UXDL 1RL2A 3HOXH 2UUCQ 3CD6A 1YBYA 2MNAA 2GVBA 2XTIA 2I5LX 1XMQL 3KLWA 2ID0A 2K5NA 2YTVA 5IP9H 4JI3L 3OW2A 1VCIA 1VQKA 2RCNA 1XTDA 2F4VQ 4ALPA 1KRSA 2ATWA 4K0KQ 4A3EG 3S14H 4LF6Q 4B3RL 3DM3A 1VQJA 1NY4A 4L5TA 1IBLQ 3CPFA 4LFAQ 3EBEA 4HIDA 4LWCA 1YITA 2E2IH 2DUDA 4JYAL 3J81c 1X3FA 4JI7Q 2R93H 3FP9A 3PO2H 1V9PA 2N3SA 2HQLA 3TS0A 2LXKA 2WAQE 4BBRG 2CCZA 1JB7A 1KAWA 4DR5L 1MKHA 3PUZA 3STBD 1Q8KA 1EYGA 2JA6G 1K3RA 2E2HH 2NVYH 1XPRA 5C0XG 2UXDQ 1IBKQ 4GLVB 1PH5A 2OQKA 4YWKA 3H3VI 1YIJA 3FHWA 3F2BA 4B3RQ 4JBMA 2BA0A 2IHFA 2WB1G 3W1GA 3CXCA 1E22A 4YCWA 2VQFQ 4DV6L 1Y1VH 4WJ4A 3D31A 2Y0SE 4NXML 1J5EQ 5HGQA 3L2PA 4IFDJ 1E1TA 2WP8J 1PA6A 5JJLA 3PF4A 4NXNL 3I56A 3E9IA 3JC66 4YCVA 4A3FG 3S1RH 5C3EH 3W5OA 2HIVA 2XGTA 4GNXC 3H0GG 4TQUS 3RNUA 3T1YQ 1WI5A 3CCLA 4NB3A 2BA1A 2K4KA 2WFWA 5M5YH 5IYBG 3PIPA 1PV4A 2GN5A 4R1JA 2N49A 5M3FG 2B63H 4HJ9A 4H02A 4YY3Q 3ULPA 2QGQA 4ME3A 1CKNB 3ICEA 1WCMG 1I5FA 2VQFL 3AQQA 4LUVA 4DV1L 1PYBA 1CSQA 4XIGS 2MQHA 1QVCA 2ZTEA 3PUYA 1YZ6A 1P8LA 5ELNA 1N9WA 4AYBG 1MJCA 1AE3A 1NMGA 1XMOQ 4JI4Q 3GTMH 3HOZH 4A3LG 1KXLA 3GTKH 2ZJRA 1HNWL 2NN6I 3G4SA 1TXYA 2OCEA 4BXXH 4GKKL 2Z6KA 1KHIA 4PG3A 3MXNB 1D8LA 1Q12A 1WCMH 2ZTDA 1VQPA 3S1NH 1CSPA 4JBWA 4JI6Q 2LXJA 4A3CH 2MO1A 4DV3L 4LF5L 3HOVH 1BBWA 2KCMA 2KBNA 4JOIC 4DAMA 3JAMc 4DUZL 3GTGH 2KHJA 3U50C 4X65Q 5C4JH 1B8AA 2AWOA 4KHPL 5LMUQ 2N8NA 4JV5L 1LUZA 2K5VA 2OQ0A 1JJCB 3S2HH 3PO2G 2A1AA 1PYSB 4HJAA 2R93G 5IP7G 3RZDH 5FLMH 4LF9Q 2JA7G 3GTJH 4C3HH 3TREA 2ZM6L 4OWXB 1EQQA 4LFAL 2R7DA 4YHHQ 3T1HQ 2QA4A 1W2BA 4LFCQ 2VNUD 2UUBL 5C0XI 4JI4L 1C0AA 1UE1A 2EXDA 3M3YH 4POGA 2AKWB 4DV3Q 4DUYL 4A75A 1HNXL 2PQAB 4LF7L 2N78A 3BU2A 1QVFA 1JT8A 1VQ9A 1O7IA 2EIFA 1X65A 2KHIA 3L7ZC 3PO3G 3NBHB 4DV0L 4IPDA 3J81i 1P16A 1WFQA 4C3JH 1NJIC 4JI2L 1PFSA 3WWVA 3J7ZC 4DV6Q 4LF8Q 2VY3A 5C3EG 4DR7Q 1VQGA 2R7ZG 4IOCA 3KDFB 3PV0A 3G6EA 4C3IH 2YTYA 1Q7YC 2HIXA 3UDFA 1E1OA 3UDIA 5M5WH 5C0XJ 4DR1L 1HNZL 1Y1WG 2E5LQ 2F52A 4BA2I 4O2DA 5LMNW 1RIPA 3RLNA 4DV4L 2JEAI 3HOUG 1HZCA 2R92H 5IP9G 1K83H 1LYLA 3A5ZB 5GAEC 1TWAH 3SGIA 3VDYA 2UUBQ 4B3TQ 5BR8L 1OXVA 4AH6A 3OTOQ 2A8VA 1KL9A 4AIMA 4A3LH 1WYDA 4GOPA 2R7ZH 4P74A 4B3SQ 5IY0A 1S3OA 4X66Q 3RZOH 1NBWA 1TWFH 4PZ6A 1VQ6A 1VQBA 4PZ7A 4A3BH 4KI0A 1KQSA 4LW1A 1V43A 4GN3B 4AQYL 1JJ2A 2CWPA 4QJFA 4RMFA 1Y1VG 1XNQQ 1GM5A 1Q86C 1VQ5A 4BA1I 3I55A 4C2MH 3NELA 5IE8A 4A3GH 1Q81C 4DV1Q 1HNWQ 5C4XG 4TVAB 1L1OB 4GKKQ 3CMEA 2IT1A 3EIVA 3HOVG 3CCUA 4DR3L 4L5RC 3D0FA 5BR8Q 5DLQE 4GOPC 1QVGA 3GTLH 4DR6Q 1K73C 1HZ9A 1E7ZA 5IP7H 3S16H 4QL5A 3KOJA 1OXTA 4X66L 4DV2L 1N33L 4KHPQ 2JEBI 1WOCA 1QZHA 1JMCA 2CFMA 3CC4A 1VQDA 3ULJA 1N32L 2R6GA 2YTXA 4A3DG 4R4OA 1YNXA 4A93H 1KRTA 1PH8A 3EN2A 3Q8DA 1PH1A 4YHHL 1VQFA 2R7FA 4YWLA 3T1HL 3I4NG 3KYHC 1N36L 4NXNQ 2VL6A 1ASZA 4BY1H 4IPCA 2QEXA 2EQSA 1EIFA 2K50A 2AHOB 3RLFA 3AEVA 3CMAA 2ES2A 2HHHQ 2K5HA 4JI5Q 5M3MG 4L5QA 4OWWB 1PH9A 4IJLA 4A93G 4X62L 3PSIA 3PCOB 3J80i 3I4MH 5C44G 1HR0Q 2DGYA 1VQ8A 1QZGA 2UUAL 3DLLA 1HNXQ 3HKSA 3HKZG 4DV2Q 4QY7A 3S15H 5EAYA 5JJKA 4UPAA 5JEAJ 4GKJQ 3FKIG 5IYCH 1SFOH 1N36Q 3HOWG 3PF5A 4P71A 1YHQA 5IYDH 5K36G 1N34L 4P75A 3S1MH 4DR4L 1G6PA 3KF6A 4OO1G 4LUZA 3LGJA 2UXBQ 3UDXA 4JI0Q 4X6AH 4UP8A 3OTOL 4JOIA 2IHEA 1KIXA 2UU9L 2IY5B 1L1OA 1IBMQ 1HH2P 4DV4Q 3PUXA 1K8GA 2NVTH 1Q46A 2Q2UA 3KDFA 1IZ6A 4X64L 2ALYB 3F2CA 4GLXA 5M3MH 1I94Q 1XPUA 2Z6KC 4IFDI 4A3EH 5GROA 1I3QH 4OXPA 4A3KG 2MFIA 5M5XH 4QGUA 4AQYQ 4JI6L 4DR2L 1YJNA 5JJIA 2OTLA 1HR0W 2JK8A 1R9TH 3ER0A 4DUZQ 2JA7H 5FLXc 5GAGC 4X65L 1A0IA 4A3DH 1I6HH 5JEAG 3I4MG 1FVIA 3CF5A 1XNQL 4R4QA 4DPGA 1IBML 4JI1L 2E2JH 5H1SE 4R4CA 1QUQA 1X3GA 3CP0A 3CCMA 2D0PA 3K7UC 3T1YL 4EQ5A 2UXBL 3W1BA 4LFCL 1L0WA 2VQEQ 1YI2A 1K8AC 4DV0Q 4P73A 4DR6L 4BBSG 1L1OC 4HJ7A 1Q1BA 4LF7Q 1XJVA 3BZCA 3BZKA 4PZ8A 3CC7A 1X56A 1GD7A 1YJ9A 4LFBL 2YU9H 1YHBA 5IT9c 1Q1EA 5C4XH 3GD7A 4OONA 4A3CG 4OO1I 3J81j 1EFWA 4A3GG 2JA8G 3M85A 1EOVA 1VQLA 1GVPA 4RG1A 1ASYA 3KFUA 4A3IH 3J80c 2HHHL 4LNQA 5FJ8H 1B7YB 2F4VL 2UXCL 2H5XA 3I4OA 4A3BG 1TWCH 2JJQA 3F1ZA 3TEHB 4HJ8A 3H15A 4YWMA 1TWHH 3HKZE 2WB1E 1HR0L 4B3SL 1IBLL 1OXUA 4WJ3M 3IRBA 3TQYA 4DR5Q 2JA5H 3HOWH 1OXSC 4K0KL 4B3TL 3K7AH 4JI8L 1AE2A 3PIOA 4BXXG 3CAMA 1H95A 2YYZA 2PI2E 1KC8C 1VQHA 1A8VA 1FJGQ 3HOUH 2B63G 1VQIA 4MZ9A 1OXXK 3RR5A 2D62A 4GNXB 3BJUA 2ZM6Q 1OTCA 3CCVA 3NENA 4JC0A 1IYJB 1PH3A 4LFBQ 2Q2IA 3M4PA 1EIYB 4IFDG 1J6QA 1TWGH 3K80C 2Q2TA 3E0EA 3U58A 2Z0SA 3I2ZA 1XPOA 5FJ8G 1M1KC 3HOYG 4LF4L 5IWAQ 5AJ3L 2R92G 3PO3H 1Z9FA 1J5EL 3PUVA 1NTGA 1D7QA 3G71A 1AH9A 4AYBE 4XTCS 1UE6A 2VW9A 1X6OA 1M90C 1GO3E 4QQBX 1WJJA 1LM0A 1G51A 1T9HA 1SMXA 2B29A 2CQOA 2NZOA 3K0XA 3STBC 4A4IA 4DV7L 2JA6H 4KHZA 1Y14B 2I5MX 3CPWA 1VQOA 3GDEA 5FLMG 1EQRA 3GO5A 1XMQQ 2PQAA 3M7NA 4Y52H 2Y0SG 1SR3A 3UDGA 4A3IG 4DK3C 4YCUA 4DR7L 1JE5A 2JA8H 4UY8C 3J7A5 3I7FA 1EUJA 1X55A 3F2DA 3RN2A 1VQMA 3S1QH 3G48A 4IPGA 5E7NA 3GTOH 2RF4A 1Z47A 1PH6A 4HJ5A 1SRUA 4QIWE 2AWNA 2VUMG 1VQEA 1HZBA 1YVCA 3AFQA 3AYHB 2K52A 4JI5L 4B3MQ
chains in the Genus database with same CATH superfamily
1FNVA 3RZDB 5LMUL 1E24A 1XNRL 3HOYH 4HSPA 2L15A 3NXWA 3DUZA 2A73B 5CYUA 4Y7NH 1HJPA 3S2DH 1JORA 2OXPA 4DNIA 3BDOA 1X54A 4CKEA 1CKMA 3PUWA 1D5ZC 1F9SA 1K0RA 5J39A 1PH2A 4HIKA 4MNOA 2NVQH 3MXPA 3CCEA 3A0JA 2ASBA 2K01A 3S24A 1UUPA 5E4XA 1F9RA 1S72A 2VB2X 1N32Q 4KLKA 1VQCA 1L2FA 2NVXH 1K3BC 1N33Q 4LK1C 2F0IA 1Y8PB 4CKBA 4KKSA 4YY3L 4GOPB 3RLOA 2PMZE 4DR1Q 1WTVA 5KNCA 1FJGL 1HFNA 2VUMH 1SMYD 4A3JB 1GOZA 3HFZB 4S3SA 3K59A 1QUQB 2EY5A 4PV1C 2K75A 5IGBA 2CWAA 4A3FH 2QDBA 1N8RC 1SSOA 3K5OA 3S2HB 5DM73 3K81C 4DV7Q 2NBFA 4GNXA 1J9OA 3HOZG 4CJ1B 1RODA 4BY7G 4O0AA 4RCNA 5M9OA 2JYOA 2K32A 4GN5A 1U5KA 2E2IB 2FXQA 5C4HA 4E6IA 5EPKA 3GTPH 4GLAC 1PDQA 2ICIA 1CM9A 5JVH3 1TS3A 1VQ7A 2SNMA 2PI2A 1PVOA 2JE6I 4ZLTF 2LS01 2EYLA 3T56B 2E75C 4R4IA 3DWAA 2R3ZA 5LHY1 3FPPA 5CBEE 5HGTA 1A2UA 2F0UA 3K8AA 2NZHA 4XDXA 3F2UA 3MA2B 5COYA 4P2CB 3UE0A 3ZJYC 4DV5L 4KJOA 1PTOB 1JICA 1G291 5CBAE 4JI3Q 1I50B 2K14A 1XMOL 5C3EB 1TT2A 2D9UA 2DJFC 4JCVE 4IJHA 4HIMA 5A2QE 1RD9D 1V1QA 1BCPC 1Y1WH 3CRKC 3AFPA 3I73A 4GN4B 4FF3A 2YV5A 3ND8A 3A74A 1FGUA 3HP3A 4CGYB 5AJ3Q 4Y52H 1II3A 1GKHA 3C1FA 4JBKA 3K6OA 3OIPA 2PNHA 1FL0A 3J7AV 2UXDL 2UUCQ 3CD6A 2XTIA 3K0YA 2ID0A 3PO2B 1SBBB 4JI3L 3OW2A 3VR4A 1VCIA 1HHVA 2RCNA 3A55A 5DAUA 4ALPA 1VMCA 4K0KQ 1VQJA 4L5TA 3EBEA 3KK7A 4LWCA 3VYTA 2DUDA 1JWSD 2M00A 3K5LA 4JYAL 3J81c 5DEHA 3TZDA 3WDNA 4DNRB 3Q0AA 2HQLA 5KIXA 3TS0A 2LXKA 2JA6G 3STBD 1Q8KA 5D3DA 4DN4M 3S1RB 2E2HH 3A56A 3DWQA 2UXDQ 1IBKQ 3ND9A 2IHFA 1G6ZA 1BOSA 1ESFA 1WTXA 1E1TA 3PIO3 2IPKD 4YCVA 4IUTA 4A3FG 5I2YA 1STBA 2HIVA 4HTHA 3RNUA 3CCLA 3D6CA 5FLXE 5M5YH 4OEMB 3PIPA 1CHQD 2F4IA 1S5DD 5M3FG 2B63H 2QGQA 1I5FA 2VQFL 2MPMA 3AQQA 4K8JA 1TY2A 1QVCA 4RHSA 2JA6B 2ZXOA 2ZJRA 2F1MA 4RFBA 2EJGC 1RJTA 1E0BA 5G3LF 1Q12A 1WCMH 5FKAC 1AEXA 1CSPA 4JBWA 1GHKA 4A3CH 4JW0A 5KEEA 1KLGD 2MO1A 1BBWA 1K8OA 2KBNA 5E4WC 4DAMA 3U50C 1B8AA 2AWOA 3SK4A 5LMUQ 1K8MA 4JV5L 5IODA 2K5VA 4OELB 1JC7A 4L63B 3PO2G 4LF9Q 1EQQA 2ZM6L 4H0LC 2R7DA 2SEBD 1Y8NB 2QA4A 1W2BA 2VNUD 3X3MA 4DV3Q 3NTIA 4A75A 2EYPA 3BU2A 4HN7A 1QVFA 3JAME 3RMHA 1VQ9A 1AFPA 1X65A 3L7ZC 5CV7A 4IPDA 4JPBW 4J8QA 1P16A 1TWAB 1WFQA 4C3JH 3WWVA 1VQGA 2R7ZG 3A8KE 2F3WA 4ZUIA 1Q7YC 3NQIA 3UDIA 1E1OA 4DR1L 2NVXB 1IKMA 2F52A 4PMBA 4DV4L 2JEAI 2R92H 5IP9G 4LAAA 1K83H 4BXXG 1FNWA 3MFYA 3OTOQ 1CQFA 4A3LH 2R7ZH 4C1NK 4GOPA 3C46A 4RKBA 4B3SQ 1QOHA 4R8NA 4PZ7A 1KQSA 2ENBA 3D4RA 4RMFA 1PFNA 1XNQQ 1Q86C 1VQ5A 4BA1I 4A3GH 4C2MH 4IUPA 5IE8A 1Q81C 1L1OB 4GKKQ 3HOVG 4DR3L 5ELEA 5M3MB 4K6DA 3FMCA 1YNJC 1GXDC 4FXKC 3MXUA 1HZ9A 4ZAIA 2E2DC 3S16H 4QL5A 4UAIA 3C2PA 1H9MA 1JMCA 1SJED 2XNAC 1RKNA 1YNXA 1KRTA 1PH8A 3EN2A 5JEAH 3GTLB 1VQFA 2R7FA 2J7ZA 1HPCA 1LTGD 2E76C 3KYHC 1N36L 3TDQA 4I7AA 4IPCA 3N52A 3RLFA 4L8JA 3A54A 2HHHQ 1B2TA 2K5HA 4JI5Q 1C48A 5M3MG 4A93G 4QUFA 1AP0A 1BR9A 5C44G 2MGSA 3HKSA 3HKZG 4N9TA 3QJYA 5EAYA 4UPAA 2BE5C 5JEAJ 5C0XH 3DEPA 5EBDA 5K36G 1ILQA 3KF6A 2HUGA 4OO1G 1H9SA 1Y8OB 4X6AH 1EY6A 1HXYD 2UU9L 1HH2P 2Q2UA 1G2SA 3F2CA 2ALYB 4GLXA 1MSHA 3J81E 4IFDI 4A3EH 5GROA 5EBCA 4A3KG 2NYZD 5C3XA 4AQYQ 1B1ZA 5NUCA 3ZYYX 1YJNA 4HAEA 1R9TH 3MXGA 1A0IA 2V4DA 3I70A 2PW7A 1LT3D 3I4MG 4K5XA 5T1GA 5M5XB 1X3GA 2D0PA 4FP5D 1I4QA 4IQZA 3W1BA 1DCZA 2VQEQ 1K8AC 3I4NB 4DR6L 1IYUA 4PNYA 4LF7Q 1TWCB 1XJVA 3BZCA 3IFTA 5EKIA 3QOJA 3D3RA 3GD7A 4OONA 4ODGA 3J81j 2F0OA 2JA8G 2JP1A 3M85A 1SNMA 1VQLA 4RKLA 2QW7A 1LT6D 4LNQA 1RHPA 4A3BG 3CKIB 4HJ8A 1VF7A 3TQYA 2JA5H 2EPBA 4B3TL 3K7AH 2A6HC 2HQEA 4IUVA 3SEBA 4CHTB 4ZKCB 1HRJA 2YYZA 1XYIA 1KC8C 1CFMA 3VYSA 1VQIA 4MZ9A 2HCIA 3A8JE 3SE0A 4GNXB 3CCVA 2LMCB 2F0DA 4JC0A 1VF5C 2KA7A 1TWGH 3H0GB 2Q2TA 3E0EA 3J7AF 3I2ZA 3QIAA 4BBSB 3HGBA 1EU4A 3PUVA 3GQBA 1G91A 2JXMB 2KOLA 4XTCS 1M90C 2F0KA 1BNZA 2PZTA 3STBC 4G7HC 2KHSA 4DV7L 1Y14B 2FJ2A 3X3NA 1R4PB 3GDEA 1EQRA 1XMQQ 2PQAA 1SR3A 4DK3C 4YCUA 5I4DA 1JE5A 2IX3A 4UY8C 2JA8H 3J7A5 1PTOC 2NVYB 3P20A 3F2DA 3KBGA 3KLSA 5E7NA 2DY8A 1Z47A 1SRUA 2VUMG 4DAPA 3TP8A 3AFQA 3LNNA 2JA7H 2EYMA 1QWYA 1D6EC 1C9OA 2UUAQ 5FOBB 3S1QB 2B2WA 2D2CC 4R4TA 4IOAA 1A62A 2E8GA 1AN8A 4RAUC 1STNA 2VB3X 2XWBB 2KCTA 3F8TA 1PRTF 3R2IA 2G9HD 2VZAA 3Q23A 3KJOA 1N34Q 3TS2A 4DR4Q 4DR3Q 2KEEA 2I0QA 1S5ED 3L0OA 2KCCA 1A2TA 4JG2A 4A3KH 3H0GH 4DK0A 4BBSH 4X64Q 1SNCA 4KK7A 3GP7A 3OYYA 1JR0D 5EQ0A 1SE8A 3CW2C 4C1NI 4A3MG 1HNZQ 3EVQA 3NEMA 4J15A 1SROA 5K36H 2A19A 3ERSX 1NMFA 2B2VC 2F0SA 4OIKA 3ITPA 3CQZH 4P72A 4R9WA 2XRQD 1PRTD 1PH4A 5G3LD 4MTKA 4OIJA 2NN6H 2K5WA 5C44H 1I6HB 3KUPA 1SLJA 2EY1A 3P7JA 4A3JH 2AUJD 4ZYSA 1VS0A 1KDAA 1G2TA 2CW0C 2WAQG 2JA7B 2UXCQ 1D2BA 1DGSA 5LL6X 1XXGA 2K7VA 1UE5A 1SNPA 1STGA 1EU3A 2IW3A 1S5CD 2BH2A 3KJPA 2K1BA 3U4ZA 5GADC 4QCLA 1DZ1A 1SMYC 3PMFA 3ERQA 4O1NA 4FXGC 2UU9Q 1UWVA 2CHBD 2CKZB 4A3MB 3N6RA 1B70B 3NBHA 1EWIA 1YHAA 3MEHA 5BN3A 1KDCA 3M4QA 3ULLA 3I72A 4EQPA 4JI2Q 2F3IA 2F0GA 3HKZB 2MJ8A 3OSOA 4K14A 3QR8A 4LF6L 3IFDA 4UP9A 4EGVA 2L5TA 1I50H 4TKOB 3RN5A 5FO9B 4OX9L 5LMNL 3HS0C 5LL6S 4LUOA 4DKAC 1EEID 4A3FB 1YBYA 2K03A 1K28A 2K5NA 5IP9H 1VQKA 1XTDA 3WOEA 1KRSA 3Q22A 2KQ3A 4A3EG 3JAML 3HOVB 3DM3A 1IBLQ 1D1IA 4HIDA 3KBXA 2E2IH 4JI7Q 2ZXPA 3PO2H 1V9PA 2WAQE 1JB7A 3S14B 1K3RA 4KY7A 3LX0A 5C4ZA 3DXJC 2NWGA 1ET6A 5C0XG 1K0SA 1PTOF 4GLVB 2OQKA 4B3RQ 3F2BA 2WB1G 3W1GA 2IWHA 1HA5A 4G57A 4NXML 1J5EQ 3S15B 2K33A 5HGQA 5DM63 1SYCA 4XQNA 5JJLA 4NXNL 1SFOB 1CA6A 5C3EH 3LWUA 3H0GG 4TQUS 1BUVT 1LABA 1B4OA 2K4KA 2WFWA 5IYBG 1PV4A 3EQLC 2AUKA 2BDNA 4HJ9A 4H02A 4YY3Q 3ICEA 2HDMA 1WCMG 3PQIA 4LUVA 4HMJA 1PYBA 4X3UA 1CSQA 1DJRD 3PUYA 1LTSD 1YZ6A 1P8LA 4F8MA 3GV3A 1XMOQ 4DK1A 3GTKH 1PTOD 1QILA 4RGNA 1EY0A 4GKKL 1LTBD 4A3BB 4A3DB 4HMIA 5CV8A 3GTJB 4JI6Q 3OWFA 3HOVH 1H9RA 3MHBA 4JOIC 1TWGB 5BN4A 1CT1D 5C4JH 1EY9A 2N8NA 3P1HA 1LUZA 4Z9CB 2F0JA 3S2HH 1PYSB 3KLRA 1PRTC 3TREA 4LFAL 1X3PA 1GJXA 1STAA 4OHJA 1ET9A 1F2YA 2UUBL 1CZWA 5C0XI 2A69C 2PQAB 5KYLA 2F0TA 1PZID 4K6LA 5M3FB 2KHIA 5A2QL 4DV0L 3QB3A 3R2TA 1NJIC 1PZKD 1PFSA 2WACA 3J7ZC 2SDFA 4IOCA 3KDFB 2B39A 4CDFC 2A68C 1E2WA 3G6EA 1HNZL 5C0XJ 4WORA 1Y1WG 2WV6D 4O2DA 1RIPA 4U673 1HZCA 1LYLA 5GAEC 3D4WA 1D1KA 4XQQA 5EGTA 2UUBQ 5BR8L 1OXVA 4AIMA 1GHJA 4FXDA 1WYDA 5J1ZA 4P74A 3S1MB 1F77A 1VQ6A 4A3BH 3CQZB 4LW1A 1V43A 4AQYL 4JK1C 2BDOA 4H44C 1EL0A 1SYGA 1Y1VG 1LO5D 3TBIB 1HNWQ 1S5FD 1EWCA 3O13A 3OIQA 3EIVA 2P5ZX 1ESRA 1R4QB 5C4JB 1I3QB 1SYBA 1KDBA 3AB9A 4GOPC 1QVGA 5IP7H 1CI3M 1LACA 2RDHA 3KOJA 4X66L 4IALA 4DV2L 4KHPQ 4A3GB 4BY1B 5D3IB 1WOCA 2X6LA 3CC4A 2FFKB 3MTSA 1VQDA 5CR3A 5A35A 4EQOA 1RCVD 1N32L 1Q3LA 1NUCA 2R6GA 4A3DG 1T5XD 3T1HL 4YWLA 5TSSA 4DFAA 2RDGA 1LT5D 2Z6BA 3BZDB 3MVVA 3NHHA 1SNOA 1ASZA 1QG7A 2K50A 1EY7A 2CQAA 3IL8A 4IJLA 4X62L 3PSIA 2B2UC 2BE5D 2QDLA 3PCOB 1BQQT 1IHZA 4IUQA 2XIWA 3UI2A 3E3XA 3NTHA 5KNBA 4DV2Q 5JJKA 3NUCA 5JPMC 4GKJQ 3FKIG 5IYCH 3DMUA 2AQ1B 4F7XA 4P71A 3PF5A 1SYDA 3M7GA 2XVSA 4P75A 3NSWA 3UDXA 1H9SB 4JOIA 5ELBA 4F87A 2TSSA 3HOUB 2IY5B 1QE6A 4DV4Q 3PUXA 2NVTH 1Q46A 4A93H 1I94Q 5M3MH 1ENFA 4FNFA 1I3QH 2PZUA 4CDCC 2E2JB 2MFIA 1BCPB 1EOTA 4DR2L 3T51B 1TY0A 3U9SA 1HR0W 4DUZQ 3NTKA 1GUOA 4X65L 3DHQA 2EYFA 5JEAG 1PZJD 1FVIA 1XNQL 1SE2A 1IBML 4LMQD 3CP0A 1B3QA 2MP1A 5C5LA 3T1YL 1B53A 4EQ5A 4K5VA 4LFCL 1YI2A 5IGGA 3R93A 4P73A 2M2LA 2K05A 3I91A 1YJ9A 4LFBL 1Q1EA 1GUWA 1SEBD 3GTOB 2F03A 4M1UB 1EFWA 3J81L 4A3GG 4WFN3 3VR5A 2RKSA 3KFUA 4DAYA 3J80c 4F88A 5IOCA 2H5XA 2JJQA 3H15A 1TWHH 1HR0L 3CHBD 4B3SL 1BO0A 4NP5A 3IRBA 3T4AC 4DR5Q 1OXSC 3SK8A 1PFMA 3BVMA 2PI2E 1MGSA 1U9RA 4CJ2C 2EY6A 3OOCA 1K83B 1SNQA 5J22A 4LFBQ 4H13C 1YNND 1EIGA 3K80C 3U58A 3BG3A 4UHVA 5FJ8G 5AJ3L 1R9TB 4KV6A 1D7QA 1Z9FA 4KTAA 1AH9A 1CK1A 4FF2A 4KKTA 4AYBE 3VA5A 1GO3E 2DNCA 4KN4C 1WJJA 1T9HA 1SMXA 2CVRA 2I5MX 5IGFA 2EVBA 2JN4A 2O5IC 4V190 3GO5A 2PMZB 4A3IG 1JOQA 4OL7A 3T53B 1EUJA 1ZXTA 3RN2A 3AMUA 2DY7A 1SNDA 1W6JA 2B2UA 4ZK9B 3GTOH 1PH6A 3EA6A 1VQEA 1Q8IA 3KF8A 1H9KA 3DM1A 1NR2A 1HTLD 2K52A 5K5PA 1I4GA 1IBKL 3AU7A 3G7LA 2I5HA 1NR4A 4BWGB 1UEBA 2RHSB 1NCVA 3M4YA 3A5UA 1TS2A 1VQAA 3CCJA 4MTNA 1VQNA 4UP7A 4CDDC 1MD2D 2BH8A 4HCSA 5I9OA 3MWYW 3J7YW 1MIUA 1RTNA 4JI8Q 1L0XB 3OMGA 4APVA 4IUUA 1XNRQ 2Z8LA 1IXRA 1EZ6A 3TRZA 2KCNA 2LSSA 2QEJC 1BKBA 3M9BA 5LMNQ 1S40A 5BN5A 1JOKA 3S1NB 2A6HD 5E1FA 1Z7TA 2EDGA 3CCQA 2FINB 4QB4A 1BVSA 1VQ4A 1STEA 2EOTA 3KF6B 3RZOB 4OGQC 5GQOA 3JAMi 1U0LA 4N8X1 1LTLA 1EYAA 1BBUA 2RBMA 1EFID 5ELOA 3Q6SA 1YJWA 5KYIA 4JI7L 2KENA 4JV5Q 4X62Q 2O4XA 4K2KA 4NPSA 2F0PA 5HY6A 2OF1A 4LF9L 1MI2A 1TS4A 3BS1A 1STHA 2N55A 2C35B 4GKJL 4JI0L 1CUKA 3U4VA 4DA2A 5IYBH 1YNJD 3HOXG 1TU2B 3A7AB 1PHJA 1ICFB 2ZTCA 1F2LA 1LTRD 4NKLA 4A3JG 1V1PB 1KD1C 4DUYQ 3GTPB 1Y1WB 5EKKA 1PH7A 2B3GA 3OHXC 2UUCL 2SOBA 4AYBB 5I6YA 4JI1Q 3K58A 2WIIB 1JQYD 1IL2A 1T5EA 2JA5B 5GAHC 1GUNA 2RQXA 4A3MH 2V1CC 2A5HA 4CDEC 1DOLA 4U68A 4LF5Q 4DV5Q 5IWAL 1NE3A 1PRTB 5EKLA 4ME5A 2EYHA 4BY7H 2ZJQA 4JYAQ 1SN8A 3VYRA 2PO4A 2ZJPA 1RL2A 4B08A 2MNAA 2L1BA 1D5XC 2GVBA 3KLSX 1XMQL 2X6GA 4EQNA 5JOBA 2YTVA 1B9NA 2EZVA 3C1EA 2F4VQ 3MXNA 2ZXRA 4I65A 3W3AA 2PQEA 3CPFA 4LFAQ 3I90A 1EWHA 1U4PA 2R93H 1X3FA 2WKDA 2Z4IA 2F0MA 2N3SA 4X3TA 2CCZA 1ENCA 1KAWA 2EE1A 4DR5L 4FF1A 1EYGA 4X3SA 1MSGA 1XPRA 1C8CA 1JOOA 2R61A 4YWKA 5CV4A 3QWNA 4JBMA 2VQFQ 1E22A 4YCWA 1Y1VH 4KD3A 4WJ4A 3D31A 1O7ZA 2Y0SE 1JE4A 3MAQA 3OWEB 5IGEA 3L2PA 4IFDJ 1PA6A 5D14A 3PF4A 3I56A 3S1RH 3HOYB 3W5OA 1NNXA 4QF4A 4EVOA 4XT3B 4NB3A 1O78A 2N49A 1ICWA 4CJ0B 4C3IB 1SDFA 1CA5A 4DV1L 1PFBA 3CU7A 4XIGS 2ZTEA 5ELNA 1N9WA 4AYBG 1MJCA 1AE3A 1NMGA 4A3LG 3BDCA 1HNWL 4ZKBB 2L9HA 3G4SA 4BXXH 1HCZA 4MN3A 1KHIA 2NZ1D 4PG3A 3MXNB 1VQPA 1SYFA 1ILPA 1TQOA 4DV3L 2VUMB 4Q5VA 1AW7A 1HQMC 2WKCA 3JAMc 3BVZA 3GTGH 2KHJA 4KHPL 1DONA 1RF2D 2R93B 2X69A 2OQ0A 4HJAA 1JCKB 4KN7C 2KVMA 2F0HA 2CH4A 4OWXB 3T1HQ 2Z1CA 1Z6HA 3S9WA 4J1MA 1W6KA 5EPJA 2AKWB 4KMUC 5F2DA 1HNXL 4RCOA 4LF7L 4RGOS 4A3IB 3V05A 5I2XA 5KGUA 1JT8A 1O7IA 4C3IG 3H3VC 2B2TC 3PO3G 5I9PA 2R92B 2RA4A 4JI2L 4N8FA 4DV6Q 2VY3A 1UEAB 4DR7Q 4RGTA 3PV0A 1E2VA 2XN9C 2YTYA 1EZ8A 5M5WH 5C5MA 3RLNA 4FVMA 1PTOH 4B3TQ 1TWAH 3VDYA 3BDLA 4AH6A 2F0QA 2A8VA 1KL9A 1A3VA 1I4XA 1LT4D 3GTKB 1SYEA 4X3KA 5IY0A 4TRDA 2CH4W 1S3OA 3RZOH 5C6AA 4PZ6A 5I6WA 3TP6A 3FEWX 2EJMA 2CWPA 5CV6A 5C4XG 1ML0D 4TVAB 2A69D 4L5RC 2ZT9C 4HR7B 2AQ3B 3J80E 3PIP3 2HCCA 5HURA 2L55A 2PNRC 1K73C 1OXTA 1TVXA 2JA8B 2JEBI 3A7LA 1U4LA 2F3VA 1QZHA 2CFMA 2XWJB 2DN8A 2SNSA 4RH6A 3NWTA 1QJOA 2YTXA 4DU9A 4R4OA 3Q8DA 4YHHL 2QCPX 3EFXD 3I4NG 4NXNQ 2VL6A 3RD4A 1GUSA 4HCEA 4BY1H 2QEXA 1WTQA 2AHOB 1CQVA 4Y7NB 3CMAA 2ES2A 3FDTA 1F2MA 4B9WA 2G5DA 3GTQB 3J80i 4DF7A 1HR0Q 1QB5D 2DGYA 1VQ8A 1QZGA 2UUAL 4WRDA 3SVMA 3WOFA 2NVQB 4I7ZC 4G7ZC 3FPUB 1N36Q 3S17B 4IURA 1YHQA 4A3KB 4UDUC 2PCFB 3HRZC 4ZUJA 1N34L 1BBXC 3S1MH 3HOWB 4DR4L 2K28A 4LUZA 2UXBQ 1KABA 5E3FA 4UP8A 1EQVA 5IT9E 2IHEA 3P75A 4XXEA 1G8ZD 2PW5A 1K8GA 3KDFA 1IZ6A 4X64L 1BDOA 2Z6KC 1GUGA 4OXPA 4QGUA 2E74C 1C4QA 3QO2A 1ZYRC 5JJIA 2JK8A 3PO3B 5FLXc 1FD7D 5C44B 3TP7A 1I6HH 4G7OC 1O7YA 3CF5A 4Q0FA 4G4KA 4R4QA 5H1SE 2K6AA 4R4CA 1QUQA 3CCMA 2UXBL 3HZXA 2PPBC 4CKCA 3D8GA 1LTID 4DV0Q 4LJZC 2BOSA 4DXFA 2LY7A 4HJ7A 1Q1BA 4NMZA 3CC7A 1GD7A 2Q8TA 5C4XH 2L11A 4OO1I 1EY5A 3MFGA 1EOVA 1HTPA 1GVPA 1ASYA 1B7YB 3BYYB 1WD0A 3I4OA 1TKWB 1TWCH 3F1ZA 4OO1H 4IN3A 4C3JB 2IL8A 2WB1E 3HKZE 1DXMA 1WVLA 1IBLL 5FK9C 1OXUA 4WJ3M 2HD3A 1HA6A 4JI8L 1AE2A 2GA4B 3PIOA 4C56C 1Y1VB 3H09A 3V2TA 3CAMA 1VQHA 2OEOA 1A8VA 4RGMA 1FJGQ 1WTPA 3HOUH 1FR3A 1OXXK 1KTKA 3BJUA 2ZM6Q 1OTCA 1V8QA 2Z4HA 3NENA 4QUCA 1GUTA 1IYJB 2Q2IA 3M4PA 3R8BA 4IFDG 1HUMA 4IFDH 2R7ZB 2Z0SA 1XPOA 1J5EL 2WAQB 1NTGA 2VXWA 3VA7A 1SAPA 2RVLA 5AFWA 2TMPA 2A68D 3SK5A 2C5CA 1UE6A 4QQBX 2OT2A 3RUZA 4C2MB 1LM0A 1AZPA 1G51A 2B29A 2NZOA 3HOZB 3GTMB 3T13A 3K5MA 2PZWA 4KHZA 3LWEA 1IYVA 4R8IA 2LKVA 4QMGA 1VQOA 5FLMG 2G9DA 3M7NA 1ONLA 2Y0SG 2B2WC 4DR7L 5EJWA 3TN2A 2E2HB 5JAVA 2B2TA 4J6HA 2B8GA 1X55A 3S1QH 1YNNC 3GTGB 4RWSC 3CRLC 2RF4A 4HJ5A 1FGBD 5T1IA 3VR3A 1HZBA 3AYHB 4QIWB 2QF7A 4JI5L 4B3MQ 4ID6A 3NBIA 4IPHA 2O2LD 3J80L 2AQ2B 1TR5A 3E0JA 1B50A 3H3VH 4JVZA 2EY2A 4C3JG 1EY4A 5J3BA 2KJXA 1XX8A 4NXMQ 3FKIB 1A6XA 2D0OA 3MZ5A 1EYDA 3T16A 1L0YB 2KEDA 4FO2A 3UE1A 4DGZA 1IL8A 3NK9A 1SXTA 4JBJA 1JJGA 4ZRZA 3TSSA 4GS3A 1I94L 3E5SA 2JA5G 1CTMA 2JA9A 2VS1A 3NP8A 4DR2Q 4BBRH 4LF8L 2GVAA 1CKNA 4OWWB 1YEZA 3HG9A 4B3ML 1M8AA 1KNAA 4K0KL 2E5LL 3KF8B 4DK6C 5CV5A 4LF4Q 2N88A 3B6YA 5JVG3 4L5SA 3M4OB 1O7LA 4PMWA 1F2ZA 4BY1G 1DYQA 2JSOA 4M8AA 1KNEA 3BVGA 4IO9A 1IW7C 3SHLA 2Q2HA 3DEOA 2Q8IB 2RHQB 4A76A 1K9MC 4FDBA 2IJ0A 3NE5B 2IX0A 1Q82C 2EYOA 1E3PA 5FO7B 1B44D 3CC2A 2NN6G 3GTQH 1DM0B 2MO0A 1UE7A 1HZAA 5M3FH 1CKOA 2K04A 5FLXL 1C7YA 3I4NH 3PGZA 2D5DA 2LFNA 4OWTB 1A63A 2FMMA 2NB0A 3K57A 4HSVA 4POFA 3S17H 2A6EC 2F0FA 4FYDA 2AMCB 2C9OA 3FKIH 5IYCG 1VDZA 3SXHA 1W3SA 2A74C 2EXZA 1X3EA 1F9QA 1H9JA 4OX9Q 1CZGA 2OWOA 1X9NA 4V0BA 1TIID 5JJZA 3FVQA 3TP5A 1RTOA 5IYDG 2EYJA 4EX5A 1WD1A 4IZ8A 3MEFA 4XYOA 3CCRA 1PMRA 1DOKA 1WTWA 5M5YB 2JQOA 2IX1A 2VQEL 1E2ZA 1MJEA 4DAYB 2B8FA 4ZQ3A 3V96A 3NPPA 4B9XA 4HIOA 4HEDA 3CCSA 3M4OH 1Q90A 5CMDA 3L9AX 2PYKA 3E9HA 1X3QA 2OTJA 2B2VA 4DNTB 3HOXH 3BYTB 1QNKA 2I5LX 4XYQA 3KLWA 2Z9HA 4PMCA 1F9PA 3S16B 1KAAA 5KRUA 1EYCA 2WB1B 2ATWA 1STYA 3S14H 4B3RL 4LF6Q 1X32A 1D5MC 2MUYA 1NY4A 2YU9B 1TS5A 5C4XB 1XTCD 1EEFD 1YITA 5CORA 3FP9A 4RA8A 3VR2A 1ZEQX 4BBRG 3Q24A 4FF4A 1BXTA 4DXGA 1MKHA 3PUZA 2NVYH 5DNFA 1PH5A 1EIHA 3URYA 3H3VI 1YIJA 3FHWA 2BA0A 2HDLA 3CXCA 4DV6L 3GV6A 1PYWD 2WP8J 1LV9A 3E9IA 3JC66 3VYUA 2F0VA 5CV9A 2XGTA 4GNXC 4XQJA 3T1YQ 1WI5A 1HUNA 4ULLA 5JPNC 2BA1A 2GN5A 4R1JA 3H94A 3MC0B 3K5NA 4NW2A 3ULPA 4ME3A 1CKNB 1ENAA 2RSOA 4K5WA 1AZQA 2NVTB 1JWMD 5ELDA 2MQHA 4PQXA 3I3CA 3HOZH 4JI4Q 3GTMH 1J8IA 2A6ED 1KXLA 1SE3A 2NN6I 4XT1B 1TXYA 2OCEA 1TWFB 2QILA 2Z6KA 1D8LA 1EQTA 2ZTDA 5C3WA 3S1NH 3OPOA 2BCOA 2L4NA 1SE4A 2LXJA 2B2YC 1WTOA 3VR6A 4BS9A 3TMEA 4LF5L 2KCMA 2M9VA 4DUZL 1A3UA 2WINB 4X65Q 3SDZA 1PLFA 2DJGC 2F0LA 2I46A 4KHVA 1JJCB 2A1AA 2K5DA 4DAVA 5IP7G 3RZDH 2R93G 5FLMH 2JA7G 3GTJH 4C3HH 2H1EA 2J0TD 4YHHQ 4L6TB 3EROA 4LFCQ 1I6VC 1PXUA 1IKLA 1FNUA 1OO9B 2L12A 4JI4L 1C0AA 2Q8RE 1UE1A 2EXDA 3M3YH 1BF4A 1EY8A 4POGA 4DUYL 2N78A 1U4RA 1V1OA 2EIFA 3NBHB 2K5QA 3DWPA 1WTHA 1HFGA 1TWHB 3J81i 1NSNS 1LLRD 4LF8Q 1JWUD 3TZUA 5C3EG 3I4LA 4KKUA 1KLUD 2DNEA 4C3IH 2HIXA 3C3LA 3UDFA 2E5LQ 4CBVA 4BA2I 5LMNW 3HOUG 5CGKA 3A5ZB 2HT1A 3SGIA 5EPLA 4O42A 2F0WA 3NWSA 3QG1A 3W2DA 4X66Q 1NBWA 1TWFH 1VQBA 4KI0A 2RCFA 1A3TA 3L3OC 4GN3B 3ONAB 1JJ2A 2ICEC 4QJFA 1NAPA 1GM5A 1UNSA 3I55A 2NTTA 3NELA 4DV1Q 5IGCA 2IT1A 3CMEA 3CCUA 4YIJA 4BY7B 4A3EB 4BBRB 3D0FA 5BR8Q 1B9MA 1XWEA 5DLQE 3GTLH 4DR6Q 1E7ZA 3D4DA 4C3HB 4IUNA 3M3YB 3ULJA 1LTTD 2MHVA 1WTRA 1DOMA 1PH1A 2QKIC 4K8IA 1IW7D 1FYCA 2EQSA 1EIFA 1UAPA 3AEVA 5ELFA 4TSSA 3HEJA 1ZKOA 1SJHD 4L5QA 1PH9A 5M5WB 3I4MH 1MHWC 3DLLA 1HNXQ 4QY7A 3S15H 2FHTA 3OMCA 1I4RA 1SFOH 3HOWG 5IYDH 1G6PA 3HOXB 2RSNA 3K7AB 3LGJA 4JI0Q 3OTOL 1VMPA 1KIXA 1L1OA 1I4PA 1RDPD 1IBMQ 3E6ZX 2B2YA 2CW0D 4KY6A 1S4ZA 4NDXA 1CHPD 1XPUA 2KECA 4WJWA 5M5XH 4JI6L 5IGDA 3SR1A 1LTAD 2OTLA 2XRSD 4KY5A 3IAYA 3ER0A 1BCPF 3U9OA 5GAGC 4A3DH 4A93B 2O5JC 4DPGA 1QCBD 4JI1L 2E2JH 4ILWA 4ZCKA 3K7UC 5D65A 2H4OA 1L0WA 3OW7A 4BBSG 1L1OC 5FO8B 2KUMA 3H91A 5IT9L 3BZKA 4PZ8A 1X56A 2I07B 5ELCA 2YU9H 1YHBA 1HQRD 5IT9c 1MBYA 4A3CG 1B3AA 3I4MB 1QNUA 2B63B 4C3HG 4RG1A 4A3IH 2HHHL 1Y69U 4ABNA 5FJ8H 2F4VL 2UXCL 1BCPD 4KD4A 3TEHB 3D6WA 4YWMA 1M4VA 3HOWH 3S2DB 2XSCA 1H95A 4N9PA 3R3OA 2J4XA 3A8IE 2B63G 1WCMB 3RR5A 2FMCA 2D62A 3H6MA 2NUCA 3EJIA 1PH3A 5KNDA 1EIYB 1J6QA 4MIUA 1M1KC 3QOLA 3HOYG 4LF4L 2RDFA 5IWAQ 2R92G 3PO3H 3G71A 4K2LA 1S5BD 1DD2A 5IIFA 2VW9A 1X6OA 4KJNA 2F0NA 5CC4A 1U4MA 4A4IA 3K0XA 2CQOA 2JA6H 3I8ZA 3CPWA 2Y0SB 3FRPB 1V1PA 2EJFC 3UDGA 4GZYC 3G6JB 3SK6A 4RHRA 3IKJA 3I7FA 2F0EA 3NQTA 1JB3A 1VQMA 5L37A 4IPGA 3G48A 1I4HA 2L0CA 4MHEA 1O80A 1A15A 2AWNA 4QIWE 5ISRA 4H7BA 1YVCA 1ZYRD 2NTSA 1N33L
chains in the Genus database with same CATH topology
5LMUL 1IBKL 4IPHA 1E24A 1XNRL 3HOYH 2I5HA 1C9OA 2L15A 2UUAQ 3H3VH 1UEBA 2RHSB 4Y7NH 4R4TA 5J3BA 3A5UA 4IOAA 1A62A 2E8GA 1VQAA 1HJPA 4NXMQ 3CCJA 4MTNA 3S2DH 2D0OA 2KCTA 3F8TA 4DNIA 1VQNA 1X54A 4UP7A 2BH8A 3UE1A 1CKMA 3PUWA 2VZAA 3KJOA 1K0RA 4JBJA 1PH2A 1MIUA 1N34Q 3TS2A 4DR4Q 1JJGA 4DR3Q 4GS3A 4HIKA 1I94L 4MNOA 4JI8Q 2NVQH 2I0QA 3CCEA 3A0JA 2ASBA 3L0OA 4APVA 3S24A 4JG2A 2JA5G 4A3KH 3H0GH 1XNRQ 2JA9A 2VS1A 1IXRA 4DR2Q 1S72A 4BBRH 3TRZA 4BBSH 1N32Q 4KLKA 2LSSA 4LF8L 2GVAA 1CKNA 1VQCA 1L2FA 1BKBA 1YEZA 3M9BA 4X64Q 5LMNQ 1S40A 2NVXH 4B3ML 1N33Q 3OYYA 4YY3L 1SE8A 3CW2C 4GOPB 4A3MG 3RLOA 2PMZE 3KF8B 3CCQA 4DR1Q 1HNZQ 2E5LL 1FJGL 2VUMH 3NEMA 4DK6C 3HFZB 3B6YA 1SROA 4J15A 4LF4Q 2A19A 3ERSX 4L5SA 1QUQB 1NMFA 4PMWA 1BVSA 1VQ4A 4BY1G 2K75A 2CWAA 3KF6B 4A3FH 5GQOA 3JAMi 1N8RC 1U0LA 4P72A 4IO9A 3CQZH 1LTLA 1BBUA 1PH4A 2Q2HA 3K81C 4DV7Q 5ELOA 2RHQB 4GNXA 1YJWA 4A76A 1K9MC 5C44H 3HOZG 4FDBA 1SLJA 4JI7L 1Q82C 4A3JH 2IX0A 2KENA 4JV5Q 4BY7G 4X62Q 1E3PA 4O0AA 1VS0A 3CC2A 4NPSA 5HY6A 4LF9L 4GN5A 1U5KA 2NN6G 3GTQH 2WAQG 2FXQA 2MO0A 1UE7A 2C35B 2UXCQ 1HZAA 1DGSA 5M3FH 1CKOA 4JI0L 4GLAC 3GTPH 4GKJL 1C7YA 1CUKA 3U4VA 1UE5A 3I4NH 3PGZA 5IYBH 1VQ7A 3HOXG 4OWTB 2BH2A 1A63A 2PI2A 1PVOA 3KJPA 2JE6I 3U4ZA 1PHJA 4POFA 5GADC 3S17H 2ZTCA 2AMCB 3FKIH 5IYCG 4R4IA 1W3SA 2UU9Q 1UWVA 4A3JG 1KD1C 1X3EA 4DUYQ 3K8AA 2CKZB 2NZHA 4DV5L 3UE0A 3ZJYC 4OX9Q 1B70B 1PH7A 2OWOA 4JI3Q 1G291 1X9NA 1EWIA 1YHAA 2B3GA 5IYDG 2UUCL 2K14A 4EX5A 1XMOL 3M4QA 3ULLA 4JI2Q 4JI1Q 4JCVE 3MEFA 2F3IA 4IJHA 3CCRA 1IL2A 4HIMA 5GAHC 2HT1A 2JQOA 2IX1A 2VQEL 1V1QA 1MJEA 1Y1WH 4DAYB 4A3MH 2V1CC 4LF6L 4UP9A 3AFPA 4GN4B 4LF5Q 2YV5A 1I50H 3A74A 1FGUA 3RN5A 4DV5Q 5IWAL 1NE3A 5AJ3Q 4HIOA 4OX9L 5LMNL 3CCSA 3M4OH 1GKHA 2ZJQA 4JBKA 4LUOA 4BY7H 4JYAQ 1SN8A 3E9HA 2PNHA 1FL0A 4DKAC 2ZJPA 2OTJA 2UXDL 1RL2A 3HOXH 2UUCQ 3CD6A 1YBYA 2MNAA 2GVBA 2XTIA 2I5LX 1XMQL 3KLWA 2ID0A 2K5NA 2YTVA 5IP9H 4JI3L 3OW2A 1VCIA 1VQKA 2RCNA 1XTDA 2F4VQ 4ALPA 1KRSA 2ATWA 4K0KQ 4A3EG 3S14H 4LF6Q 4B3RL 3DM3A 1VQJA 1NY4A 4L5TA 1IBLQ 3CPFA 4LFAQ 3EBEA 4HIDA 4LWCA 1YITA 2E2IH 2DUDA 4JYAL 3J81c 1X3FA 4JI7Q 2R93H 3FP9A 3PO2H 1V9PA 2N3SA 2HQLA 3TS0A 2LXKA 2WAQE 4BBRG 2CCZA 1JB7A 1KAWA 4DR5L 1MKHA 3PUZA 3STBD 1Q8KA 1EYGA 2JA6G 1K3RA 2E2HH 2NVYH 1XPRA 5C0XG 2UXDQ 1IBKQ 4GLVB 1PH5A 2OQKA 4YWKA 3H3VI 1YIJA 3FHWA 3F2BA 4B3RQ 4JBMA 2BA0A 2IHFA 2WB1G 3W1GA 3CXCA 1E22A 4YCWA 2VQFQ 4DV6L 1Y1VH 4WJ4A 3D31A 2Y0SE 4NXML 1J5EQ 5HGQA 3L2PA 4IFDJ 1E1TA 2WP8J 1PA6A 5JJLA 3PF4A 4NXNL 3I56A 3E9IA 3JC66 4YCVA 4A3FG 3S1RH 5C3EH 3W5OA 2HIVA 2XGTA 4GNXC 3H0GG 4TQUS 3RNUA 3T1YQ 1WI5A 3CCLA 4NB3A 2BA1A 2K4KA 2WFWA 5M5YH 5IYBG 3PIPA 1PV4A 2GN5A 4R1JA 2N49A 5M3FG 2B63H 4HJ9A 4H02A 4YY3Q 3ULPA 2QGQA 4ME3A 1CKNB 3ICEA 1WCMG 1I5FA 2VQFL 3AQQA 4LUVA 4DV1L 1PYBA 1CSQA 4XIGS 2MQHA 1QVCA 2ZTEA 3PUYA 1YZ6A 1P8LA 5ELNA 1N9WA 4AYBG 1MJCA 1AE3A 1NMGA 1XMOQ 4JI4Q 3GTMH 3HOZH 4A3LG 1KXLA 3GTKH 2ZJRA 1HNWL 2NN6I 3G4SA 1TXYA 2OCEA 4BXXH 4GKKL 2Z6KA 1KHIA 4PG3A 3MXNB 1D8LA 1Q12A 1WCMH 2ZTDA 1VQPA 3S1NH 1CSPA 4JBWA 4JI6Q 2LXJA 4A3CH 2MO1A 4DV3L 4LF5L 3HOVH 1BBWA 2KCMA 2KBNA 4JOIC 4DAMA 3JAMc 4DUZL 3GTGH 2KHJA 3U50C 4X65Q 5C4JH 1B8AA 2AWOA 4KHPL 5LMUQ 2N8NA 4JV5L 1LUZA 2K5VA 2OQ0A 1JJCB 3S2HH 3PO2G 2A1AA 1PYSB 4HJAA 2R93G 5IP7G 3RZDH 5FLMH 4LF9Q 2JA7G 3GTJH 4C3HH 3TREA 2ZM6L 4OWXB 1EQQA 4LFAL 2R7DA 4YHHQ 3T1HQ 2QA4A 1W2BA 4LFCQ 2VNUD 2UUBL 5C0XI 4JI4L 1C0AA 1UE1A 2EXDA 3M3YH 4POGA 2AKWB 4DV3Q 4DUYL 4A75A 1HNXL 2PQAB 4LF7L 2N78A 3BU2A 1QVFA 1JT8A 1VQ9A 1O7IA 2EIFA 1X65A 2KHIA 3L7ZC 3PO3G 3NBHB 4DV0L 4IPDA 3J81i 1P16A 1WFQA 4C3JH 1NJIC 4JI2L 1PFSA 3WWVA 3J7ZC 4DV6Q 4LF8Q 2VY3A 5C3EG 4DR7Q 1VQGA 2R7ZG 4IOCA 3KDFB 3PV0A 3G6EA 4C3IH 2YTYA 1Q7YC 2HIXA 3UDFA 1E1OA 3UDIA 5M5WH 5C0XJ 4DR1L 1HNZL 1Y1WG 2E5LQ 2F52A 4BA2I 4O2DA 5LMNW 1RIPA 3RLNA 4DV4L 2JEAI 3HOUG 1HZCA 2R92H 5IP9G 1K83H 1LYLA 3A5ZB 5GAEC 1TWAH 3SGIA 3VDYA 2UUBQ 4B3TQ 5BR8L 1OXVA 4AH6A 3OTOQ 2A8VA 1KL9A 4AIMA 4A3LH 1WYDA 4GOPA 2R7ZH 4P74A 4B3SQ 5IY0A 1S3OA 4X66Q 3RZOH 1NBWA 1TWFH 4PZ6A 1VQ6A 1VQBA 4PZ7A 4A3BH 4KI0A 1KQSA 4LW1A 1V43A 4GN3B 4AQYL 1JJ2A 2CWPA 4QJFA 4RMFA 1Y1VG 1XNQQ 1GM5A 1Q86C 1VQ5A 4BA1I 3I55A 4C2MH 3NELA 5IE8A 4A3GH 1Q81C 4DV1Q 1HNWQ 5C4XG 4TVAB 1L1OB 4GKKQ 3CMEA 2IT1A 3EIVA 3HOVG 3CCUA 4DR3L 4L5RC 3D0FA 5BR8Q 5DLQE 4GOPC 1QVGA 3GTLH 4DR6Q 1K73C 1HZ9A 1E7ZA 5IP7H 3S16H 4QL5A 3KOJA 1OXTA 4X66L 4DV2L 1N33L 4KHPQ 2JEBI 1WOCA 1QZHA 1JMCA 2CFMA 3CC4A 1VQDA 3ULJA 1N32L 2R6GA 2YTXA 4A3DG 4R4OA 1YNXA 4A93H 1KRTA 1PH8A 3EN2A 3Q8DA 1PH1A 4YHHL 1VQFA 2R7FA 4YWLA 3T1HL 3I4NG 3KYHC 1N36L 4NXNQ 2VL6A 1ASZA 4BY1H 4IPCA 2QEXA 2EQSA 1EIFA 2K50A 2AHOB 3RLFA 3AEVA 3CMAA 2ES2A 2HHHQ 2K5HA 4JI5Q 5M3MG 4L5QA 4OWWB 1PH9A 4IJLA 4A93G 4X62L 3PSIA 3PCOB 3J80i 3I4MH 5C44G 1HR0Q 2DGYA 1VQ8A 1QZGA 2UUAL 3DLLA 1HNXQ 3HKSA 3HKZG 4DV2Q 4QY7A 3S15H 5EAYA 5JJKA 4UPAA 5JEAJ 4GKJQ 3FKIG 5IYCH 1SFOH 1N36Q 3HOWG 3PF5A 4P71A 1YHQA 5IYDH 5K36G 1N34L 4P75A 3S1MH 4DR4L 1G6PA 3KF6A 4OO1G 4LUZA 3LGJA 2UXBQ 3UDXA 4JI0Q 4X6AH 4UP8A 3OTOL 4JOIA 2IHEA 1KIXA 2UU9L 2IY5B 1L1OA 1IBMQ 1HH2P 4DV4Q 3PUXA 1K8GA 2NVTH 1Q46A 2Q2UA 3KDFA 1IZ6A 4X64L 2ALYB 3F2CA 4GLXA 5M3MH 1I94Q 1XPUA 2Z6KC 4IFDI 4A3EH 5GROA 1I3QH 4OXPA 4A3KG 2MFIA 5M5XH 4QGUA 4AQYQ 4JI6L 4DR2L 1YJNA 5JJIA 2OTLA 1HR0W 2JK8A 1R9TH 3ER0A 4DUZQ 2JA7H 5FLXc 5GAGC 4X65L 1A0IA 4A3DH 1I6HH 5JEAG 3I4MG 1FVIA 3CF5A 1XNQL 4R4QA 4DPGA 1IBML 4JI1L 2E2JH 5H1SE 4R4CA 1QUQA 1X3GA 3CP0A 3CCMA 2D0PA 3K7UC 3T1YL 4EQ5A 2UXBL 3W1BA 4LFCL 1L0WA 2VQEQ 1YI2A 1K8AC 4DV0Q 4P73A 4DR6L 4BBSG 1L1OC 4HJ7A 1Q1BA 4LF7Q 1XJVA 3BZCA 3BZKA 4PZ8A 3CC7A 1X56A 1GD7A 1YJ9A 4LFBL 2YU9H 1YHBA 5IT9c 1Q1EA 5C4XH 3GD7A 4OONA 4A3CG 4OO1I 3J81j 1EFWA 4A3GG 2JA8G 3M85A 1EOVA 1VQLA 1GVPA 4RG1A 1ASYA 3KFUA 4A3IH 3J80c 2HHHL 4LNQA 5FJ8H 1B7YB 2F4VL 2UXCL 2H5XA 3I4OA 4A3BG 1TWCH 2JJQA 3F1ZA 3TEHB 4HJ8A 3H15A 4YWMA 1TWHH 3HKZE 2WB1E 1HR0L 4B3SL 1IBLL 1OXUA 4WJ3M 3IRBA 3TQYA 4DR5Q 2JA5H 3HOWH 1OXSC 4K0KL 4B3TL 3K7AH 4JI8L 1AE2A 3PIOA 4BXXG 3CAMA 1H95A 2YYZA 2PI2E 1KC8C 1VQHA 1A8VA 1FJGQ 3HOUH 2B63G 1VQIA 4MZ9A 1OXXK 3RR5A 2D62A 4GNXB 3BJUA 2ZM6Q 1OTCA 3CCVA 3NENA 4JC0A 1IYJB 1PH3A 4LFBQ 2Q2IA 3M4PA 1EIYB 4IFDG 1J6QA 1TWGH 3K80C 2Q2TA 3E0EA 3U58A 2Z0SA 3I2ZA 1XPOA 5FJ8G 1M1KC 3HOYG 4LF4L 5IWAQ 5AJ3L 2R92G 3PO3H 1Z9FA 1J5EL 3PUVA 1NTGA 1D7QA 3G71A 1AH9A 4AYBE 4XTCS 1UE6A 2VW9A 1X6OA 1M90C 1GO3E 4QQBX 1WJJA 1LM0A 1G51A 1T9HA 1SMXA 2B29A 2CQOA 2NZOA 3K0XA 3STBC 4A4IA 4DV7L 2JA6H 4KHZA 1Y14B 2I5MX 3CPWA 1VQOA 3GDEA 5FLMG 1EQRA 3GO5A 1XMQQ 2PQAA 3M7NA 4Y52H 2Y0SG 1SR3A 3UDGA 4A3IG 4DK3C 4YCUA 4DR7L 1JE5A 2JA8H 4UY8C 3J7A5 3I7FA 1EUJA 1X55A 3F2DA 3RN2A 1VQMA 3S1QH 3G48A 4IPGA 5E7NA 3GTOH 2RF4A 1Z47A 1PH6A 4HJ5A 1SRUA 4QIWE 2AWNA 2VUMG 1VQEA 1HZBA 1YVCA 3AFQA 3AYHB 2K52A 4JI5L 4B3MQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU L;  1IBK L;  4IPH A;  1E24 A;  1XNR L;  3HOY H;  2I5H A;  1C9O A;  2L15 A;  2UUA Q;  3H3V H;  1UEB A;  2RHS B;  4Y7N H;  4R4T A;  5J3B A;  3A5U A;  4IOA A;  1A62 A;  2E8G A;  1VQA A;  1HJP A;  4NXM Q;  3CCJ A;  4MTN A;  3S2D H;  2D0O A;  2KCT A;  3F8T A;  4DNI A;  1VQN A;  1X54 A;  4UP7 A;  2BH8 A;  3UE1 A;  1CKM A;  3PUW A;  2VZA A;  3KJO A;  1K0R A;  4JBJ A;  1PH2 A;  1MIU A;  1N34 Q;  3TS2 A;  4DR4 Q;  1JJG A;  4DR3 Q;  4GS3 A;  4HIK A;  1I94 L;  4MNO A;  4JI8 Q;  2NVQ H;  2I0Q A;  3CCE A;  3A0J A;  2ASB A;  3L0O A;  4APV A;  3S24 A;  4JG2 A;  2JA5 G;  4A3K H;  3H0G H;  1XNR Q;  2JA9 A;  2VS1 A;  1IXR A;  4DR2 Q;  1S72 A;  4BBR H;  3TRZ A;  4BBS H;  1N32 Q;  4KLK A;  2LSS A;  4LF8 L;  2GVA A;  1CKN A;  1VQC A;  1L2F A;  1BKB A;  1YEZ A;  3M9B A;  4X64 Q;  5LMN Q;  1S40 A;  2NVX H;  4B3M L;  1N33 Q;  3OYY A;  4YY3 L;  1SE8 A;  3CW2 C;  4GOP B;  4A3M G;  3RLO A;  2PMZ E;  3KF8 B;  3CCQ A;  4DR1 Q;  1HNZ Q;  2E5L L;  1FJG L;  2VUM H;  3NEM A;  4DK6 C;  3HFZ B;  3B6Y A;  1SRO A;  4J15 A;  4LF4 Q;  2A19 A;  3ERS X;  4L5S A;  1QUQ B;  1NMF A;  4PMW A;  1BVS A;  1VQ4 A;  4BY1 G;  2K75 A;  2CWA A;  3KF6 B;  4A3F H;  5GQO A;  3JAM i;  1N8R C;  1U0L A;  4P72 A;  4IO9 A;  3CQZ H;  1LTL A;  1BBU A;  1PH4 A;  2Q2H A;  3K81 C;  4DV7 Q;  5ELO A;  2RHQ B;  4GNX A;  1YJW A;  4A76 A;  1K9M C;  5C44 H;  3HOZ G;  4FDB A;  1SLJ A;  4JI7 L;  1Q82 C;  4A3J H;  2IX0 A;  2KEN A;  4JV5 Q;  4BY7 G;  4X62 Q;  1E3P A;  4O0A A;  1VS0 A;  3CC2 A;  4NPS A;  5HY6 A;  4LF9 L;  4GN5 A;  1U5K A;  2NN6 G;  3GTQ H;  2WAQ G;  2FXQ A;  2MO0 A;  1UE7 A;  2C35 B;  2UXC Q;  1HZA A;  1DGS A;  5M3F H;  1CKO A;  4JI0 L;  4GLA C;  3GTP H;  4GKJ L;  1C7Y A;  1CUK A;  3U4V A;  1UE5 A;  3I4N H;  3PGZ A;  5IYB H;  1VQ7 A;  3HOX G;  4OWT B;  2BH2 A;  1A63 A;  2PI2 A;  1PVO A;  3KJP A;  2JE6 I;  3U4Z A;  1PHJ A;  4POF A;  5GAD C;  3S17 H;  2ZTC A;  2AMC B;  3FKI H;  5IYC G;  4R4I A;  1W3S A;  2UU9 Q;  1UWV A;  4A3J G;  1KD1 C;  1X3E A;  4DUY Q;  3K8A A;  2CKZ B;  2NZH A;  4DV5 L;  3UE0 A;  3ZJY C;  4OX9 Q;  1B70 B;  1PH7 A;  2OWO A;  4JI3 Q;  1G29 1;  1X9N A;  1EWI A;  1YHA A;  2B3G A;  5IYD G;  2UUC L;  2K14 A;  4EX5 A;  1XMO L;  3M4Q A;  3ULL A;  4JI2 Q;  4JI1 Q;  4JCV E;  3MEF A;  2F3I A;  4IJH A;  3CCR A;  1IL2 A;  4HIM A;  5GAH C;  2HT1 A;  2JQO A;  2IX1 A;  2VQE L;  1V1Q A;  1MJE A;  1Y1W H;  4DAY B;  4A3M H;  2V1C C;  4LF6 L;  4UP9 A;  3AFP A;  4GN4 B;  4LF5 Q;  2YV5 A;  1I50 H;  3A74 A;  1FGU A;  3RN5 A;  4DV5 Q;  5IWA L;  1NE3 A;  5AJ3 Q;  4HIO A;  4OX9 L;  5LMN L;  3CCS A;  3M4O H;  1GKH A;  2ZJQ A;  4JBK A;  4LUO A;  4BY7 H;  4JYA Q;  1SN8 A;  3E9H A;  2PNH A;  1FL0 A;  4DKA C;  2ZJP A;  2OTJ A;  2UXD L;  1RL2 A;  3HOX H;  2UUC Q;  3CD6 A;  1YBY A;  2MNA A;  2GVB A;  2XTI A;  2I5L X;  1XMQ L;  3KLW A;  2ID0 A;  2K5N A;  2YTV A;  5IP9 H;  4JI3 L;  3OW2 A;  1VCI A;  1VQK A;  2RCN A;  1XTD A;  2F4V Q;  4ALP A;  1KRS A;  2ATW A;  4K0K Q;  4A3E G;  3S14 H;  4LF6 Q;  4B3R L;  3DM3 A;  1VQJ A;  1NY4 A;  4L5T A;  1IBL Q;  3CPF A;  4LFA Q;  3EBE A;  4HID A;  4LWC A;  1YIT A;  2E2I H;  2DUD A;  4JYA L;  3J81 c;  1X3F A;  4JI7 Q;  2R93 H;  3FP9 A;  3PO2 H;  1V9P A;  2N3S A;  2HQL A;  3TS0 A;  2LXK A;  2WAQ E;  4BBR G;  2CCZ A;  1JB7 A;  1KAW A;  4DR5 L;  1MKH A;  3PUZ A;  3STB D;  1Q8K A;  1EYG A;  2JA6 G;  1K3R A;  2E2H H;  2NVY H;  1XPR A;  5C0X G;  2UXD Q;  1IBK Q;  4GLV B;  1PH5 A;  2OQK A;  4YWK A;  3H3V I;  1YIJ A;  3FHW A;  3F2B A;  4B3R Q;  4JBM A;  2BA0 A;  2IHF A;  2WB1 G;  3W1G A;  3CXC A;  1E22 A;  4YCW A;  2VQF Q;  4DV6 L;  1Y1V H;  4WJ4 A;  3D31 A;  2Y0S E;  4NXM L;  1J5E Q;  5HGQ A;  3L2P A;  4IFD J;  1E1T A;  2WP8 J;  1PA6 A;  5JJL A;  3PF4 A;  4NXN L;  3I56 A;  3E9I A;  3JC6 6;  4YCV A;  4A3F G;  3S1R H;  5C3E H;  3W5O A;  2HIV A;  2XGT A;  4GNX C;  3H0G G;  4TQU S;  3RNU A;  3T1Y Q;  1WI5 A;  3CCL A;  4NB3 A;  2BA1 A;  2K4K A;  2WFW A;  5M5Y H;  5IYB G;  3PIP A;  1PV4 A;  2GN5 A;  4R1J A;  2N49 A;  5M3F G;  2B63 H;  4HJ9 A;  4H02 A;  4YY3 Q;  3ULP A;  2QGQ A;  4ME3 A;  1CKN B;  3ICE A;  1WCM G;  1I5F A;  2VQF L;  3AQQ A;  4LUV A;  4DV1 L;  1PYB A;  1CSQ A;  4XIG S;  2MQH A;  1QVC A;  2ZTE A;  3PUY A;  1YZ6 A;  1P8L A;  5ELN A;  1N9W A;  4AYB G;  1MJC A;  1AE3 A;  1NMG A;  1XMO Q;  4JI4 Q;  3GTM H;  3HOZ H;  4A3L G;  1KXL A;  3GTK H;  2ZJR A;  1HNW L;  2NN6 I;  3G4S A;  1TXY A;  2OCE A;  4BXX H;  4GKK L;  2Z6K A;  1KHI A;  4PG3 A;  3MXN B;  1D8L A;  1Q12 A;  1WCM H;  2ZTD A;  1VQP A;  3S1N H;  1CSP A;  4JBW A;  4JI6 Q;  2LXJ A;  4A3C H;  2MO1 A;  4DV3 L;  4LF5 L;  3HOV H;  1BBW A;  2KCM A;  2KBN A;  4JOI C;  4DAM A;  3JAM c;  4DUZ L;  3GTG H;  2KHJ A;  3U50 C;  4X65 Q;  5C4J H;  1B8A A;  2AWO A;  4KHP L;  5LMU Q;  2N8N A;  4JV5 L;  1LUZ A;  2K5V A;  2OQ0 A;  1JJC B;  3S2H H;  3PO2 G;  2A1A A;  1PYS B;  4HJA A;  2R93 G;  5IP7 G;  3RZD H;  5FLM H;  4LF9 Q;  2JA7 G;  3GTJ H;  4C3H H;  3TRE A;  2ZM6 L;  4OWX B;  1EQQ A;  4LFA L;  2R7D A;  4YHH Q;  3T1H Q;  2QA4 A;  1W2B A;  4LFC Q;  2VNU D;  2UUB L;  5C0X I;  4JI4 L;  1C0A A;  1UE1 A;  2EXD A;  3M3Y H;  4POG A;  2AKW B;  4DV3 Q;  4DUY L;  4A75 A;  1HNX L;  2PQA B;  4LF7 L;  2N78 A;  3BU2 A;  1QVF A;  1JT8 A;  1VQ9 A;  1O7I A;  2EIF A;  1X65 A;  2KHI A;  3L7Z C;  3PO3 G;  3NBH B;  4DV0 L;  4IPD A;  3J81 i;  1P16 A;  1WFQ A;  4C3J H;  1NJI C;  4JI2 L;  1PFS A;  3WWV A;  3J7Z C;  4DV6 Q;  4LF8 Q;  2VY3 A;  5C3E G;  4DR7 Q;  1VQG A;  2R7Z G;  4IOC A;  3KDF B;  3PV0 A;  3G6E A;  4C3I H;  2YTY A;  1Q7Y C;  2HIX A;  3UDF A;  1E1O A;  3UDI A;  5M5W H;  5C0X J;  4DR1 L;  1HNZ L;  1Y1W G;  2E5L Q;  2F52 A;  4BA2 I;  4O2D A;  5LMN W;  1RIP A;  3RLN A;  4DV4 L;  2JEA I;  3HOU G;  1HZC A;  2R92 H;  5IP9 G;  1K83 H;  1LYL A;  3A5Z B;  5GAE C;  1TWA H;  3SGI A;  3VDY A;  2UUB Q;  4B3T Q;  5BR8 L;  1OXV A;  4AH6 A;  3OTO Q;  2A8V A;  1KL9 A;  4AIM A;  4A3L H;  1WYD A;  4GOP A;  2R7Z H;  4P74 A;  4B3S Q;  5IY0 A;  1S3O A;  4X66 Q;  3RZO H;  1NBW A;  1TWF H;  4PZ6 A;  1VQ6 A;  1VQB A;  4PZ7 A;  4A3B H;  4KI0 A;  1KQS A;  4LW1 A;  1V43 A;  4GN3 B;  4AQY L;  1JJ2 A;  2CWP A;  4QJF A;  4RMF A;  1Y1V G;  1XNQ Q;  1GM5 A;  1Q86 C;  1VQ5 A;  4BA1 I;  3I55 A;  4C2M H;  3NEL A;  5IE8 A;  4A3G H;  1Q81 C;  4DV1 Q;  1HNW Q;  5C4X G;  4TVA B;  1L1O B;  4GKK Q;  3CME A;  2IT1 A;  3EIV A;  3HOV G;  3CCU A;  4DR3 L;  4L5R C;  3D0F A;  5BR8 Q;  5DLQ E;  4GOP C;  1QVG A;  3GTL H;  4DR6 Q;  1K73 C;  1HZ9 A;  1E7Z A;  5IP7 H;  3S16 H;  4QL5 A;  3KOJ A;  1OXT A;  4X66 L;  4DV2 L;  1N33 L;  4KHP Q;  2JEB I;  1WOC A;  1QZH A;  1JMC A;  2CFM A;  3CC4 A;  1VQD A;  3ULJ A;  1N32 L;  2R6G A;  2YTX A;  4A3D G;  4R4O A;  1YNX A;  4A93 H;  1KRT A;  1PH8 A;  3EN2 A;  3Q8D A;  1PH1 A;  4YHH L;  1VQF A;  2R7F A;  4YWL A;  3T1H L;  3I4N G;  3KYH C;  1N36 L;  4NXN Q;  2VL6 A;  1ASZ A;  4BY1 H;  4IPC A;  2QEX A;  2EQS A;  1EIF A;  2K50 A;  2AHO B;  3RLF A;  3AEV A;  3CMA A;  2ES2 A;  2HHH Q;  2K5H A;  4JI5 Q;  5M3M G;  4L5Q A;  4OWW B;  1PH9 A;  4IJL A;  4A93 G;  4X62 L;  3PSI A;  3PCO B;  3J80 i;  3I4M H;  5C44 G;  1HR0 Q;  2DGY A;  1VQ8 A;  1QZG A;  2UUA L;  3DLL A;  1HNX Q;  3HKS A;  3HKZ G;  4DV2 Q;  4QY7 A;  3S15 H;  5EAY A;  5JJK A;  4UPA A;  5JEA J;  4GKJ Q;  3FKI G;  5IYC H;  1SFO H;  1N36 Q;  3HOW G;  3PF5 A;  4P71 A;  1YHQ A;  5IYD H;  5K36 G;  1N34 L;  4P75 A;  3S1M H;  4DR4 L;  1G6P A;  3KF6 A;  4OO1 G;  4LUZ A;  3LGJ A;  2UXB Q;  3UDX A;  4JI0 Q;  4X6A H;  4UP8 A;  3OTO L;  4JOI A;  2IHE A;  1KIX A;  2UU9 L;  2IY5 B;  1L1O A;  1IBM Q;  1HH2 P;  4DV4 Q;  3PUX A;  1K8G A;  2NVT H;  1Q46 A;  2Q2U A;  3KDF A;  1IZ6 A;  4X64 L;  2ALY B;  3F2C A;  4GLX A;  5M3M H;  1I94 Q;  1XPU A;  2Z6K C;  4IFD I;  4A3E H;  5GRO A;  1I3Q H;  4OXP A;  4A3K G;  2MFI A;  5M5X H;  4QGU A;  4AQY Q;  4JI6 L;  4DR2 L;  1YJN A;  5JJI A;  2OTL A;  1HR0 W;  2JK8 A;  1R9T H;  3ER0 A;  4DUZ Q;  2JA7 H;  5FLX c;  5GAG C;  4X65 L;  1A0I A;  4A3D H;  1I6H H;  5JEA G;  3I4M G;  1FVI A;  3CF5 A;  1XNQ L;  4R4Q A;  4DPG A;  1IBM L;  4JI1 L;  2E2J H;  5H1S E;  4R4C A;  1QUQ A;  1X3G A;  3CP0 A;  3CCM A;  2D0P A;  3K7U C;  3T1Y L;  4EQ5 A;  2UXB L;  3W1B A;  4LFC L;  1L0W A;  2VQE Q;  1YI2 A;  1K8A C;  4DV0 Q;  4P73 A;  4DR6 L;  4BBS G;  1L1O C;  4HJ7 A;  1Q1B A;  4LF7 Q;  1XJV A;  3BZC A;  3BZK A;  4PZ8 A;  3CC7 A;  1X56 A;  1GD7 A;  1YJ9 A;  4LFB L;  2YU9 H;  1YHB A;  5IT9 c;  1Q1E A;  5C4X H;  3GD7 A;  4OON A;  4A3C G;  4OO1 I;  3J81 j;  1EFW A;  4A3G G;  2JA8 G;  3M85 A;  1EOV A;  1VQL A;  1GVP A;  4RG1 A;  1ASY A;  3KFU A;  4A3I H;  3J80 c;  2HHH L;  4LNQ A;  5FJ8 H;  1B7Y B;  2F4V L;  2UXC L;  2H5X A;  3I4O A;  4A3B G;  1TWC H;  2JJQ A;  3F1Z A;  3TEH B;  4HJ8 A;  3H15 A;  4YWM A;  1TWH H;  3HKZ E;  2WB1 E;  1HR0 L;  4B3S L;  1IBL L;  1OXU A;  4WJ3 M;  3IRB A;  3TQY A;  4DR5 Q;  2JA5 H;  3HOW H;  1OXS C;  4K0K L;  4B3T L;  3K7A H;  4JI8 L;  1AE2 A;  3PIO A;  4BXX G;  3CAM A;  1H95 A;  2YYZ A;  2PI2 E;  1KC8 C;  1VQH A;  1A8V A;  1FJG Q;  3HOU H;  2B63 G;  1VQI A;  4MZ9 A;  1OXX K;  3RR5 A;  2D62 A;  4GNX B;  3BJU A;  2ZM6 Q;  1OTC A;  3CCV A;  3NEN A;  4JC0 A;  1IYJ B;  1PH3 A;  4LFB Q;  2Q2I A;  3M4P A;  1EIY B;  4IFD G;  1J6Q A;  1TWG H;  3K80 C;  2Q2T A;  3E0E A;  3U58 A;  2Z0S A;  3I2Z A;  1XPO A;  5FJ8 G;  1M1K C;  3HOY G;  4LF4 L;  5IWA Q;  5AJ3 L;  2R92 G;  3PO3 H;  1Z9F A;  1J5E L;  3PUV A;  1NTG A;  1D7Q A;  3G71 A;  1AH9 A;  4AYB E;  4XTC S;  1UE6 A;  2VW9 A;  1X6O A;  1M90 C;  1GO3 E;  4QQB X;  1WJJ A;  1LM0 A;  1G51 A;  1T9H A;  1SMX A;  2B29 A;  2CQO A;  2NZO A;  3K0X A;  3STB C;  4A4I A;  4DV7 L;  2JA6 H;  4KHZ A;  1Y14 B;  2I5M X;  3CPW A;  1VQO A;  3GDE A;  5FLM G;  1EQR A;  3GO5 A;  1XMQ Q;  2PQA A;  3M7N A;  4Y52 H;  2Y0S G;  1SR3 A;  3UDG A;  4A3I G;  4DK3 C;  4YCU A;  4DR7 L;  1JE5 A;  2JA8 H;  4UY8 C;  3J7A 5;  3I7F A;  1EUJ A;  1X55 A;  3F2D A;  3RN2 A;  1VQM A;  3S1Q H;  3G48 A;  4IPG A;  5E7N A;  3GTO H;  2RF4 A;  1Z47 A;  1PH6 A;  4HJ5 A;  1SRU A;  4QIW E;  2AWN A;  2VUM G;  1VQE A;  1HZB A;  1YVC A;  3AFQ A;  3AYH B;  2K52 A;  4JI5 L;  4B3M Q; 
#chains in the Genus database with same CATH topology
 1FNV A;  3RZD B;  5LMU L;  1E24 A;  1XNR L;  3HOY H;  4HSP A;  2L15 A;  3NXW A;  3DUZ A;  2A73 B;  5CYU A;  4Y7N H;  1HJP A;  3S2D H;  1JOR A;  2OXP A;  4DNI A;  3BDO A;  1X54 A;  4CKE A;  1CKM A;  3PUW A;  1D5Z C;  1F9S A;  1K0R A;  5J39 A;  1PH2 A;  4HIK A;  4MNO A;  2NVQ H;  3MXP A;  3CCE A;  3A0J A;  2ASB A;  2K01 A;  3S24 A;  1UUP A;  5E4X A;  1F9R A;  1S72 A;  2VB2 X;  1N32 Q;  4KLK A;  1VQC A;  1L2F A;  2NVX H;  1K3B C;  1N33 Q;  4LK1 C;  2F0I A;  1Y8P B;  4CKB A;  4KKS A;  4YY3 L;  4GOP B;  3RLO A;  2PMZ E;  4DR1 Q;  1WTV A;  5KNC A;  1FJG L;  1HFN A;  2VUM H;  1SMY D;  4A3J B;  1GOZ A;  3HFZ B;  4S3S A;  3K59 A;  1QUQ B;  2EY5 A;  4PV1 C;  2K75 A;  5IGB A;  2CWA A;  4A3F H;  2QDB A;  1N8R C;  1SSO A;  3K5O A;  3S2H B;  5DM7 3;  3K81 C;  4DV7 Q;  2NBF A;  4GNX A;  1J9O A;  3HOZ G;  4CJ1 B;  1ROD A;  4BY7 G;  4O0A A;  4RCN A;  5M9O A;  2JYO A;  2K32 A;  4GN5 A;  1U5K A;  2E2I B;  2FXQ A;  5C4H A;  4E6I A;  5EPK A;  3GTP H;  4GLA C;  1PDQ A;  2ICI A;  1CM9 A;  5JVH 3;  1TS3 A;  1VQ7 A;  2SNM A;  2PI2 A;  1PVO A;  2JE6 I;  4ZLT F;  2LS0 1;  2EYL A;  3T56 B;  2E75 C;  4R4I A;  3DWA A;  2R3Z A;  5LHY 1;  3FPP A;  5CBE E;  5HGT A;  1A2U A;  2F0U A;  3K8A A;  2NZH A;  4XDX A;  3F2U A;  3MA2 B;  5COY A;  4P2C B;  3UE0 A;  3ZJY C;  4DV5 L;  4KJO A;  1PTO B;  1JIC A;  1G29 1;  5CBA E;  4JI3 Q;  1I50 B;  2K14 A;  1XMO L;  5C3E B;  1TT2 A;  2D9U A;  2DJF C;  4JCV E;  4IJH A;  4HIM A;  5A2Q E;  1RD9 D;  1V1Q A;  1BCP C;  1Y1W H;  3CRK C;  3AFP A;  3I73 A;  4GN4 B;  4FF3 A;  2YV5 A;  3ND8 A;  3A74 A;  1FGU A;  3HP3 A;  4CGY B;  5AJ3 Q;  4Y52 H;  1II3 A;  1GKH A;  3C1F A;  4JBK A;  3K6O A;  3OIP A;  2PNH A;  1FL0 A;  3J7A V;  2UXD L;  2UUC Q;  3CD6 A;  2XTI A;  3K0Y A;  2ID0 A;  3PO2 B;  1SBB B;  4JI3 L;  3OW2 A;  3VR4 A;  1VCI A;  1HHV A;  2RCN A;  3A55 A;  5DAU A;  4ALP A;  1VMC A;  4K0K Q;  1VQJ A;  4L5T A;  3EBE A;  3KK7 A;  4LWC A;  3VYT A;  2DUD A;  1JWS D;  2M00 A;  3K5L A;  4JYA L;  3J81 c;  5DEH A;  3TZD A;  3WDN A;  4DNR B;  3Q0A A;  2HQL A;  5KIX A;  3TS0 A;  2LXK A;  2JA6 G;  3STB D;  1Q8K A;  5D3D A;  4DN4 M;  3S1R B;  2E2H H;  3A56 A;  3DWQ A;  2UXD Q;  1IBK Q;  3ND9 A;  2IHF A;  1G6Z A;  1BOS A;  1ESF A;  1WTX A;  1E1T A;  3PIO 3;  2IPK D;  4YCV A;  4IUT A;  4A3F G;  5I2Y A;  1STB A;  2HIV A;  4HTH A;  3RNU A;  3CCL A;  3D6C A;  5FLX E;  5M5Y H;  4OEM B;  3PIP A;  1CHQ D;  2F4I A;  1S5D D;  5M3F G;  2B63 H;  2QGQ A;  1I5F A;  2VQF L;  2MPM A;  3AQQ A;  4K8J A;  1TY2 A;  1QVC A;  4RHS A;  2JA6 B;  2ZXO A;  2ZJR A;  2F1M A;  4RFB A;  2EJG C;  1RJT A;  1E0B A;  5G3L F;  1Q12 A;  1WCM H;  5FKA C;  1AEX A;  1CSP A;  4JBW A;  1GHK A;  4A3C H;  4JW0 A;  5KEE A;  1KLG D;  2MO1 A;  1BBW A;  1K8O A;  2KBN A;  5E4W C;  4DAM A;  3U50 C;  1B8A A;  2AWO A;  3SK4 A;  5LMU Q;  1K8M A;  4JV5 L;  5IOD A;  2K5V A;  4OEL B;  1JC7 A;  4L63 B;  3PO2 G;  4LF9 Q;  1EQQ A;  2ZM6 L;  4H0L C;  2R7D A;  2SEB D;  1Y8N B;  2QA4 A;  1W2B A;  2VNU D;  3X3M A;  4DV3 Q;  3NTI A;  4A75 A;  2EYP A;  3BU2 A;  4HN7 A;  1QVF A;  3JAM E;  3RMH A;  1VQ9 A;  1AFP A;  1X65 A;  3L7Z C;  5CV7 A;  4IPD A;  4JPB W;  4J8Q A;  1P16 A;  1TWA B;  1WFQ A;  4C3J H;  3WWV A;  1VQG A;  2R7Z G;  3A8K E;  2F3W A;  4ZUI A;  1Q7Y C;  3NQI A;  3UDI A;  1E1O A;  4DR1 L;  2NVX B;  1IKM A;  2F52 A;  4PMB A;  4DV4 L;  2JEA I;  2R92 H;  5IP9 G;  4LAA A;  1K83 H;  4BXX G;  1FNW A;  3MFY A;  3OTO Q;  1CQF A;  4A3L H;  2R7Z H;  4C1N K;  4GOP A;  3C46 A;  4RKB A;  4B3S Q;  1QOH A;  4R8N A;  4PZ7 A;  1KQS A;  2ENB A;  3D4R A;  4RMF A;  1PFN A;  1XNQ Q;  1Q86 C;  1VQ5 A;  4BA1 I;  4A3G H;  4C2M H;  4IUP A;  5IE8 A;  1Q81 C;  1L1O B;  4GKK Q;  3HOV G;  4DR3 L;  5ELE A;  5M3M B;  4K6D A;  3FMC A;  1YNJ C;  1GXD C;  4FXK C;  3MXU A;  1HZ9 A;  4ZAI A;  2E2D C;  3S16 H;  4QL5 A;  4UAI A;  3C2P A;  1H9M A;  1JMC A;  1SJE D;  2XNA C;  1RKN A;  1YNX A;  1KRT A;  1PH8 A;  3EN2 A;  5JEA H;  3GTL B;  1VQF A;  2R7F A;  2J7Z A;  1HPC A;  1LTG D;  2E76 C;  3KYH C;  1N36 L;  3TDQ A;  4I7A A;  4IPC A;  3N52 A;  3RLF A;  4L8J A;  3A54 A;  2HHH Q;  1B2T A;  2K5H A;  4JI5 Q;  1C48 A;  5M3M G;  4A93 G;  4QUF A;  1AP0 A;  1BR9 A;  5C44 G;  2MGS A;  3HKS A;  3HKZ G;  4N9T A;  3QJY A;  5EAY A;  4UPA A;  2BE5 C;  5JEA J;  5C0X H;  3DEP A;  5EBD A;  5K36 G;  1ILQ A;  3KF6 A;  2HUG A;  4OO1 G;  1H9S A;  1Y8O B;  4X6A H;  1EY6 A;  1HXY D;  2UU9 L;  1HH2 P;  2Q2U A;  1G2S A;  3F2C A;  2ALY B;  4GLX A;  1MSH A;  3J81 E;  4IFD I;  4A3E H;  5GRO A;  5EBC A;  4A3K G;  2NYZ D;  5C3X A;  4AQY Q;  1B1Z A;  5NUC A;  3ZYY X;  1YJN A;  4HAE A;  1R9T H;  3MXG A;  1A0I A;  2V4D A;  3I70 A;  2PW7 A;  1LT3 D;  3I4M G;  4K5X A;  5T1G A;  5M5X B;  1X3G A;  2D0P A;  4FP5 D;  1I4Q A;  4IQZ A;  3W1B A;  1DCZ A;  2VQE Q;  1K8A C;  3I4N B;  4DR6 L;  1IYU A;  4PNY A;  4LF7 Q;  1TWC B;  1XJV A;  3BZC A;  3IFT A;  5EKI A;  3QOJ A;  3D3R A;  3GD7 A;  4OON A;  4ODG A;  3J81 j;  2F0O A;  2JA8 G;  2JP1 A;  3M85 A;  1SNM A;  1VQL A;  4RKL A;  2QW7 A;  1LT6 D;  4LNQ A;  1RHP A;  4A3B G;  3CKI B;  4HJ8 A;  1VF7 A;  3TQY A;  2JA5 H;  2EPB A;  4B3T L;  3K7A H;  2A6H C;  2HQE A;  4IUV A;  3SEB A;  4CHT B;  4ZKC B;  1HRJ A;  2YYZ A;  1XYI A;  1KC8 C;  1CFM A;  3VYS A;  1VQI A;  4MZ9 A;  2HCI A;  3A8J E;  3SE0 A;  4GNX B;  3CCV A;  2LMC B;  2F0D A;  4JC0 A;  1VF5 C;  2KA7 A;  1TWG H;  3H0G B;  2Q2T A;  3E0E A;  3J7A F;  3I2Z A;  3QIA A;  4BBS B;  3HGB A;  1EU4 A;  3PUV A;  3GQB A;  1G91 A;  2JXM B;  2KOL A;  4XTC S;  1M90 C;  2F0K A;  1BNZ A;  2PZT A;  3STB C;  4G7H C;  2KHS A;  4DV7 L;  1Y14 B;  2FJ2 A;  3X3N A;  1R4P B;  3GDE A;  1EQR A;  1XMQ Q;  2PQA A;  1SR3 A;  4DK3 C;  4YCU A;  5I4D A;  1JE5 A;  2IX3 A;  4UY8 C;  2JA8 H;  3J7A 5;  1PTO C;  2NVY B;  3P20 A;  3F2D A;  3KBG A;  3KLS A;  5E7N A;  2DY8 A;  1Z47 A;  1SRU A;  2VUM G;  4DAP A;  3TP8 A;  3AFQ A;  3LNN A;  2JA7 H;  2EYM A;  1QWY A;  1D6E C;  1C9O A;  2UUA Q;  5FOB B;  3S1Q B;  2B2W A;  2D2C C;  4R4T A;  4IOA A;  1A62 A;  2E8G A;  1AN8 A;  4RAU C;  1STN A;  2VB3 X;  2XWB B;  2KCT A;  3F8T A;  1PRT F;  3R2I A;  2G9H D;  2VZA A;  3Q23 A;  3KJO A;  1N34 Q;  3TS2 A;  4DR4 Q;  4DR3 Q;  2KEE A;  2I0Q A;  1S5E D;  3L0O A;  2KCC A;  1A2T A;  4JG2 A;  4A3K H;  3H0G H;  4DK0 A;  4BBS H;  4X64 Q;  1SNC A;  4KK7 A;  3GP7 A;  3OYY A;  1JR0 D;  5EQ0 A;  1SE8 A;  3CW2 C;  4C1N I;  4A3M G;  1HNZ Q;  3EVQ A;  3NEM A;  4J15 A;  1SRO A;  5K36 H;  2A19 A;  3ERS X;  1NMF A;  2B2V C;  2F0S A;  4OIK A;  3ITP A;  3CQZ H;  4P72 A;  4R9W A;  2XRQ D;  1PRT D;  1PH4 A;  5G3L D;  4MTK A;  4OIJ A;  2NN6 H;  2K5W A;  5C44 H;  1I6H B;  3KUP A;  1SLJ A;  2EY1 A;  3P7J A;  4A3J H;  2AUJ D;  4ZYS A;  1VS0 A;  1KDA A;  1G2T A;  2CW0 C;  2WAQ G;  2JA7 B;  2UXC Q;  1D2B A;  1DGS A;  5LL6 X;  1XXG A;  2K7V A;  1UE5 A;  1SNP A;  1STG A;  1EU3 A;  2IW3 A;  1S5C D;  2BH2 A;  3KJP A;  2K1B A;  3U4Z A;  5GAD C;  4QCL A;  1DZ1 A;  1SMY C;  3PMF A;  3ERQ A;  4O1N A;  4FXG C;  2UU9 Q;  1UWV A;  2CHB D;  2CKZ B;  4A3M B;  3N6R A;  1B70 B;  3NBH A;  1EWI A;  1YHA A;  3MEH A;  5BN3 A;  1KDC A;  3M4Q A;  3ULL A;  3I72 A;  4EQP A;  4JI2 Q;  2F3I A;  2F0G A;  3HKZ B;  2MJ8 A;  3OSO A;  4K14 A;  3QR8 A;  4LF6 L;  3IFD A;  4UP9 A;  4EGV A;  2L5T A;  1I50 H;  4TKO B;  3RN5 A;  5FO9 B;  4OX9 L;  5LMN L;  3HS0 C;  5LL6 S;  4LUO A;  4DKA C;  1EEI D;  4A3F B;  1YBY A;  2K03 A;  1K28 A;  2K5N A;  5IP9 H;  1VQK A;  1XTD A;  3WOE A;  1KRS A;  3Q22 A;  2KQ3 A;  4A3E G;  3JAM L;  3HOV B;  3DM3 A;  1IBL Q;  1D1I A;  4HID A;  3KBX A;  2E2I H;  4JI7 Q;  2ZXP A;  3PO2 H;  1V9P A;  2WAQ E;  1JB7 A;  3S14 B;  1K3R A;  4KY7 A;  3LX0 A;  5C4Z A;  3DXJ C;  2NWG A;  1ET6 A;  5C0X G;  1K0S A;  1PTO F;  4GLV B;  2OQK A;  4B3R Q;  3F2B A;  2WB1 G;  3W1G A;  2IWH A;  1HA5 A;  4G57 A;  4NXM L;  1J5E Q;  3S15 B;  2K33 A;  5HGQ A;  5DM6 3;  1SYC A;  4XQN A;  5JJL A;  4NXN L;  1SFO B;  1CA6 A;  5C3E H;  3LWU A;  3H0G G;  4TQU S;  1BUV T;  1LAB A;  1B4O A;  2K4K A;  2WFW A;  5IYB G;  1PV4 A;  3EQL C;  2AUK A;  2BDN A;  4HJ9 A;  4H02 A;  4YY3 Q;  3ICE A;  2HDM A;  1WCM G;  3PQI A;  4LUV A;  4HMJ A;  1PYB A;  4X3U A;  1CSQ A;  1DJR D;  3PUY A;  1LTS D;  1YZ6 A;  1P8L A;  4F8M A;  3GV3 A;  1XMO Q;  4DK1 A;  3GTK H;  1PTO D;  1QIL A;  4RGN A;  1EY0 A;  4GKK L;  1LTB D;  4A3B B;  4A3D B;  4HMI A;  5CV8 A;  3GTJ B;  4JI6 Q;  3OWF A;  3HOV H;  1H9R A;  3MHB A;  4JOI C;  1TWG B;  5BN4 A;  1CT1 D;  5C4J H;  1EY9 A;  2N8N A;  3P1H A;  1LUZ A;  4Z9C B;  2F0J A;  3S2H H;  1PYS B;  3KLR A;  1PRT C;  3TRE A;  4LFA L;  1X3P A;  1GJX A;  1STA A;  4OHJ A;  1ET9 A;  1F2Y A;  2UUB L;  1CZW A;  5C0X I;  2A69 C;  2PQA B;  5KYL A;  2F0T A;  1PZI D;  4K6L A;  5M3F B;  2KHI A;  5A2Q L;  4DV0 L;  3QB3 A;  3R2T A;  1NJI C;  1PZK D;  1PFS A;  2WAC A;  3J7Z C;  2SDF A;  4IOC A;  3KDF B;  2B39 A;  4CDF C;  2A68 C;  1E2W A;  3G6E A;  1HNZ L;  5C0X J;  4WOR A;  1Y1W G;  2WV6 D;  4O2D A;  1RIP A;  4U67 3;  1HZC A;  1LYL A;  5GAE C;  3D4W A;  1D1K A;  4XQQ A;  5EGT A;  2UUB Q;  5BR8 L;  1OXV A;  4AIM A;  1GHJ A;  4FXD A;  1WYD A;  5J1Z A;  4P74 A;  3S1M B;  1F77 A;  1VQ6 A;  4A3B H;  3CQZ B;  4LW1 A;  1V43 A;  4AQY L;  4JK1 C;  2BDO A;  4H44 C;  1EL0 A;  1SYG A;  1Y1V G;  1LO5 D;  3TBI B;  1HNW Q;  1S5F D;  1EWC A;  3O13 A;  3OIQ A;  3EIV A;  2P5Z X;  1ESR A;  1R4Q B;  5C4J B;  1I3Q B;  1SYB A;  1KDB A;  3AB9 A;  4GOP C;  1QVG A;  5IP7 H;  1CI3 M;  1LAC A;  2RDH A;  3KOJ A;  4X66 L;  4IAL A;  4DV2 L;  4KHP Q;  4A3G B;  4BY1 B;  5D3I B;  1WOC A;  2X6L A;  3CC4 A;  2FFK B;  3MTS A;  1VQD A;  5CR3 A;  5A35 A;  4EQO A;  1RCV D;  1N32 L;  1Q3L A;  1NUC A;  2R6G A;  4A3D G;  1T5X D;  3T1H L;  4YWL A;  5TSS A;  4DFA A;  2RDG A;  1LT5 D;  2Z6B A;  3BZD B;  3MVV A;  3NHH A;  1SNO A;  1ASZ A;  1QG7 A;  2K50 A;  1EY7 A;  2CQA A;  3IL8 A;  4IJL A;  4X62 L;  3PSI A;  2B2U C;  2BE5 D;  2QDL A;  3PCO B;  1BQQ T;  1IHZ A;  4IUQ A;  2XIW A;  3UI2 A;  3E3X A;  3NTH A;  5KNB A;  4DV2 Q;  5JJK A;  3NUC A;  5JPM C;  4GKJ Q;  3FKI G;  5IYC H;  3DMU A;  2AQ1 B;  4F7X A;  4P71 A;  3PF5 A;  1SYD A;  3M7G A;  2XVS A;  4P75 A;  3NSW A;  3UDX A;  1H9S B;  4JOI A;  5ELB A;  4F87 A;  2TSS A;  3HOU B;  2IY5 B;  1QE6 A;  4DV4 Q;  3PUX A;  2NVT H;  1Q46 A;  4A93 H;  1I94 Q;  5M3M H;  1ENF A;  4FNF A;  1I3Q H;  2PZU A;  4CDC C;  2E2J B;  2MFI A;  1BCP B;  1EOT A;  4DR2 L;  3T51 B;  1TY0 A;  3U9S A;  1HR0 W;  4DUZ Q;  3NTK A;  1GUO A;  4X65 L;  3DHQ A;  2EYF A;  5JEA G;  1PZJ D;  1FVI A;  1XNQ L;  1SE2 A;  1IBM L;  4LMQ D;  3CP0 A;  1B3Q A;  2MP1 A;  5C5L A;  3T1Y L;  1B53 A;  4EQ5 A;  4K5V A;  4LFC L;  1YI2 A;  5IGG A;  3R93 A;  4P73 A;  2M2L A;  2K05 A;  3I91 A;  1YJ9 A;  4LFB L;  1Q1E A;  1GUW A;  1SEB D;  3GTO B;  2F03 A;  4M1U B;  1EFW A;  3J81 L;  4A3G G;  4WFN 3;  3VR5 A;  2RKS A;  3KFU A;  4DAY A;  3J80 c;  4F88 A;  5IOC A;  2H5X A;  2JJQ A;  3H15 A;  1TWH H;  1HR0 L;  3CHB D;  4B3S L;  1BO0 A;  4NP5 A;  3IRB A;  3T4A C;  4DR5 Q;  1OXS C;  3SK8 A;  1PFM A;  3BVM A;  2PI2 E;  1MGS A;  1U9R A;  4CJ2 C;  2EY6 A;  3OOC A;  1K83 B;  1SNQ A;  5J22 A;  4LFB Q;  4H13 C;  1YNN D;  1EIG A;  3K80 C;  3U58 A;  3BG3 A;  4UHV A;  5FJ8 G;  5AJ3 L;  1R9T B;  4KV6 A;  1D7Q A;  1Z9F A;  4KTA A;  1AH9 A;  1CK1 A;  4FF2 A;  4KKT A;  4AYB E;  3VA5 A;  1GO3 E;  2DNC A;  4KN4 C;  1WJJ A;  1T9H A;  1SMX A;  2CVR A;  2I5M X;  5IGF A;  2EVB A;  2JN4 A;  2O5I C;  4V19 0;  3GO5 A;  2PMZ B;  4A3I G;  1JOQ A;  4OL7 A;  3T53 B;  1EUJ A;  1ZXT A;  3RN2 A;  3AMU A;  2DY7 A;  1SND A;  1W6J A;  2B2U A;  4ZK9 B;  3GTO H;  1PH6 A;  3EA6 A;  1VQE A;  1Q8I A;  3KF8 A;  1H9K A;  3DM1 A;  1NR2 A;  1HTL D;  2K52 A;  5K5P A;  1I4G A;  1IBK L;  3AU7 A;  3G7L A;  2I5H A;  1NR4 A;  4BWG B;  1UEB A;  2RHS B;  1NCV A;  3M4Y A;  3A5U A;  1TS2 A;  1VQA A;  3CCJ A;  4MTN A;  1VQN A;  4UP7 A;  4CDD C;  1MD2 D;  2BH8 A;  4HCS A;  5I9O A;  3MWY W;  3J7Y W;  1MIU A;  1RTN A;  4JI8 Q;  1L0X B;  3OMG A;  4APV A;  4IUU A;  1XNR Q;  2Z8L A;  1IXR A;  1EZ6 A;  3TRZ A;  2KCN A;  2LSS A;  2QEJ C;  1BKB A;  3M9B A;  5LMN Q;  1S40 A;  5BN5 A;  1JOK A;  3S1N B;  2A6H D;  5E1F A;  1Z7T A;  2EDG A;  3CCQ A;  2FIN B;  4QB4 A;  1BVS A;  1VQ4 A;  1STE A;  2EOT A;  3KF6 B;  3RZO B;  4OGQ C;  5GQO A;  3JAM i;  1U0L A;  4N8X 1;  1LTL A;  1EYA A;  1BBU A;  2RBM A;  1EFI D;  5ELO A;  3Q6S A;  1YJW A;  5KYI A;  4JI7 L;  2KEN A;  4JV5 Q;  4X62 Q;  2O4X A;  4K2K A;  4NPS A;  2F0P A;  5HY6 A;  2OF1 A;  4LF9 L;  1MI2 A;  1TS4 A;  3BS1 A;  1STH A;  2N55 A;  2C35 B;  4GKJ L;  4JI0 L;  1CUK A;  3U4V A;  4DA2 A;  5IYB H;  1YNJ D;  3HOX G;  1TU2 B;  3A7A B;  1PHJ A;  1ICF B;  2ZTC A;  1F2L A;  1LTR D;  4NKL A;  4A3J G;  1V1P B;  1KD1 C;  4DUY Q;  3GTP B;  1Y1W B;  5EKK A;  1PH7 A;  2B3G A;  3OHX C;  2UUC L;  2SOB A;  4AYB B;  5I6Y A;  4JI1 Q;  3K58 A;  2WII B;  1JQY D;  1IL2 A;  1T5E A;  2JA5 B;  5GAH C;  1GUN A;  2RQX A;  4A3M H;  2V1C C;  2A5H A;  4CDE C;  1DOL A;  4U68 A;  4LF5 Q;  4DV5 Q;  5IWA L;  1NE3 A;  1PRT B;  5EKL A;  4ME5 A;  2EYH A;  4BY7 H;  2ZJQ A;  4JYA Q;  1SN8 A;  3VYR A;  2PO4 A;  2ZJP A;  1RL2 A;  4B08 A;  2MNA A;  2L1B A;  1D5X C;  2GVB A;  3KLS X;  1XMQ L;  2X6G A;  4EQN A;  5JOB A;  2YTV A;  1B9N A;  2EZV A;  3C1E A;  2F4V Q;  3MXN A;  2ZXR A;  4I65 A;  3W3A A;  2PQE A;  3CPF A;  4LFA Q;  3I90 A;  1EWH A;  1U4P A;  2R93 H;  1X3F A;  2WKD A;  2Z4I A;  2F0M A;  2N3S A;  4X3T A;  2CCZ A;  1ENC A;  1KAW A;  2EE1 A;  4DR5 L;  4FF1 A;  1EYG A;  4X3S A;  1MSG A;  1XPR A;  1C8C A;  1JOO A;  2R61 A;  4YWK A;  5CV4 A;  3QWN A;  4JBM A;  2VQF Q;  1E22 A;  4YCW A;  1Y1V H;  4KD3 A;  4WJ4 A;  3D31 A;  1O7Z A;  2Y0S E;  1JE4 A;  3MAQ A;  3OWE B;  5IGE A;  3L2P A;  4IFD J;  1PA6 A;  5D14 A;  3PF4 A;  3I56 A;  3S1R H;  3HOY B;  3W5O A;  1NNX A;  4QF4 A;  4EVO A;  4XT3 B;  4NB3 A;  1O78 A;  2N49 A;  1ICW A;  4CJ0 B;  4C3I B;  1SDF A;  1CA5 A;  4DV1 L;  1PFB A;  3CU7 A;  4XIG S;  2ZTE A;  5ELN A;  1N9W A;  4AYB G;  1MJC A;  1AE3 A;  1NMG A;  4A3L G;  3BDC A;  1HNW L;  4ZKB B;  2L9H A;  3G4S A;  4BXX H;  1HCZ A;  4MN3 A;  1KHI A;  2NZ1 D;  4PG3 A;  3MXN B;  1VQP A;  1SYF A;  1ILP A;  1TQO A;  4DV3 L;  2VUM B;  4Q5V A;  1AW7 A;  1HQM C;  2WKC A;  3JAM c;  3BVZ A;  3GTG H;  2KHJ A;  4KHP L;  1DON A;  1RF2 D;  2R93 B;  2X69 A;  2OQ0 A;  4HJA A;  1JCK B;  4KN7 C;  2KVM A;  2F0H A;  2CH4 A;  4OWX B;  3T1H Q;  2Z1C A;  1Z6H A;  3S9W A;  4J1M A;  1W6K A;  5EPJ A;  2AKW B;  4KMU C;  5F2D A;  1HNX L;  4RCO A;  4LF7 L;  4RGO S;  4A3I B;  3V05 A;  5I2X A;  5KGU A;  1JT8 A;  1O7I A;  4C3I G;  3H3V C;  2B2T C;  3PO3 G;  5I9P A;  2R92 B;  2RA4 A;  4JI2 L;  4N8F A;  4DV6 Q;  2VY3 A;  1UEA B;  4DR7 Q;  4RGT A;  3PV0 A;  1E2V A;  2XN9 C;  2YTY A;  1EZ8 A;  5M5W H;  5C5M A;  3RLN A;  4FVM A;  1PTO H;  4B3T Q;  1TWA H;  3VDY A;  3BDL A;  4AH6 A;  2F0Q A;  2A8V A;  1KL9 A;  1A3V A;  1I4X A;  1LT4 D;  3GTK B;  1SYE A;  4X3K A;  5IY0 A;  4TRD A;  2CH4 W;  1S3O A;  3RZO H;  5C6A A;  4PZ6 A;  5I6W A;  3TP6 A;  3FEW X;  2EJM A;  2CWP A;  5CV6 A;  5C4X G;  1ML0 D;  4TVA B;  2A69 D;  4L5R C;  2ZT9 C;  4HR7 B;  2AQ3 B;  3J80 E;  3PIP 3;  2HCC A;  5HUR A;  2L55 A;  2PNR C;  1K73 C;  1OXT A;  1TVX A;  2JA8 B;  2JEB I;  3A7L A;  1U4L A;  2F3V A;  1QZH A;  2CFM A;  2XWJ B;  2DN8 A;  2SNS A;  4RH6 A;  3NWT A;  1QJO A;  2YTX A;  4DU9 A;  4R4O A;  3Q8D A;  4YHH L;  2QCP X;  3EFX D;  3I4N G;  4NXN Q;  2VL6 A;  3RD4 A;  1GUS A;  4HCE A;  4BY1 H;  2QEX A;  1WTQ A;  2AHO B;  1CQV A;  4Y7N B;  3CMA A;  2ES2 A;  3FDT A;  1F2M A;  4B9W A;  2G5D A;  3GTQ B;  3J80 i;  4DF7 A;  1HR0 Q;  1QB5 D;  2DGY A;  1VQ8 A;  1QZG A;  2UUA L;  4WRD A;  3SVM A;  3WOF A;  2NVQ B;  4I7Z C;  4G7Z C;  3FPU B;  1N36 Q;  3S17 B;  4IUR A;  1YHQ A;  4A3K B;  4UDU C;  2PCF B;  3HRZ C;  4ZUJ A;  1N34 L;  1BBX C;  3S1M H;  3HOW B;  4DR4 L;  2K28 A;  4LUZ A;  2UXB Q;  1KAB A;  5E3F A;  4UP8 A;  1EQV A;  5IT9 E;  2IHE A;  3P75 A;  4XXE A;  1G8Z D;  2PW5 A;  1K8G A;  3KDF A;  1IZ6 A;  4X64 L;  1BDO A;  2Z6K C;  1GUG A;  4OXP A;  4QGU A;  2E74 C;  1C4Q A;  3QO2 A;  1ZYR C;  5JJI A;  2JK8 A;  3PO3 B;  5FLX c;  1FD7 D;  5C44 B;  3TP7 A;  1I6H H;  4G7O C;  1O7Y A;  3CF5 A;  4Q0F A;  4G4K A;  4R4Q A;  5H1S E;  2K6A A;  4R4C A;  1QUQ A;  3CCM A;  2UXB L;  3HZX A;  2PPB C;  4CKC A;  3D8G A;  1LTI D;  4DV0 Q;  4LJZ C;  2BOS A;  4DXF A;  2LY7 A;  4HJ7 A;  1Q1B A;  4NMZ A;  3CC7 A;  1GD7 A;  2Q8T A;  5C4X H;  2L11 A;  4OO1 I;  1EY5 A;  3MFG A;  1EOV A;  1HTP A;  1GVP A;  1ASY A;  1B7Y B;  3BYY B;  1WD0 A;  3I4O A;  1TKW B;  1TWC H;  3F1Z A;  4OO1 H;  4IN3 A;  4C3J B;  2IL8 A;  2WB1 E;  3HKZ E;  1DXM A;  1WVL A;  1IBL L;  5FK9 C;  1OXU A;  4WJ3 M;  2HD3 A;  1HA6 A;  4JI8 L;  1AE2 A;  2GA4 B;  3PIO A;  4C56 C;  1Y1V B;  3H09 A;  3V2T A;  3CAM A;  1VQH A;  2OEO A;  1A8V A;  4RGM A;  1FJG Q;  1WTP A;  3HOU H;  1FR3 A;  1OXX K;  1KTK A;  3BJU A;  2ZM6 Q;  1OTC A;  1V8Q A;  2Z4H A;  3NEN A;  4QUC A;  1GUT A;  1IYJ B;  2Q2I A;  3M4P A;  3R8B A;  4IFD G;  1HUM A;  4IFD H;  2R7Z B;  2Z0S A;  1XPO A;  1J5E L;  2WAQ B;  1NTG A;  2VXW A;  3VA7 A;  1SAP A;  2RVL A;  5AFW A;  2TMP A;  2A68 D;  3SK5 A;  2C5C A;  1UE6 A;  4QQB X;  2OT2 A;  3RUZ A;  4C2M B;  1LM0 A;  1AZP A;  1G51 A;  2B29 A;  2NZO A;  3HOZ B;  3GTM B;  3T13 A;  3K5M A;  2PZW A;  4KHZ A;  3LWE A;  1IYV A;  4R8I A;  2LKV A;  4QMG A;  1VQO A;  5FLM G;  2G9D A;  3M7N A;  1ONL A;  2Y0S G;  2B2W C;  4DR7 L;  5EJW A;  3TN2 A;  2E2H B;  5JAV A;  2B2T A;  4J6H A;  2B8G A;  1X55 A;  3S1Q H;  1YNN C;  3GTG B;  4RWS C;  3CRL C;  2RF4 A;  4HJ5 A;  1FGB D;  5T1I A;  3VR3 A;  1HZB A;  3AYH B;  4QIW B;  2QF7 A;  4JI5 L;  4B3M Q;  4ID6 A;  3NBI A;  4IPH A;  2O2L D;  3J80 L;  2AQ2 B;  1TR5 A;  3E0J A;  1B50 A;  3H3V H;  4JVZ A;  2EY2 A;  4C3J G;  1EY4 A;  5J3B A;  2KJX A;  1XX8 A;  4NXM Q;  3FKI B;  1A6X A;  2D0O A;  3MZ5 A;  1EYD A;  3T16 A;  1L0Y B;  2KED A;  4FO2 A;  3UE1 A;  4DGZ A;  1IL8 A;  3NK9 A;  1SXT A;  4JBJ A;  1JJG A;  4ZRZ A;  3TSS A;  4GS3 A;  1I94 L;  3E5S A;  2JA5 G;  1CTM A;  2JA9 A;  2VS1 A;  3NP8 A;  4DR2 Q;  4BBR H;  4LF8 L;  2GVA A;  1CKN A;  4OWW B;  1YEZ A;  3HG9 A;  4B3M L;  1M8A A;  1KNA A;  4K0K L;  2E5L L;  3KF8 B;  4DK6 C;  5CV5 A;  4LF4 Q;  2N88 A;  3B6Y A;  5JVG 3;  4L5S A;  3M4O B;  1O7L A;  4PMW A;  1F2Z A;  4BY1 G;  1DYQ A;  2JSO A;  4M8A A;  1KNE A;  3BVG A;  4IO9 A;  1IW7 C;  3SHL A;  2Q2H A;  3DEO A;  2Q8I B;  2RHQ B;  4A76 A;  1K9M C;  4FDB A;  2IJ0 A;  3NE5 B;  2IX0 A;  1Q82 C;  2EYO A;  1E3P A;  5FO7 B;  1B44 D;  3CC2 A;  2NN6 G;  3GTQ H;  1DM0 B;  2MO0 A;  1UE7 A;  1HZA A;  5M3F H;  1CKO A;  2K04 A;  5FLX L;  1C7Y A;  3I4N H;  3PGZ A;  2D5D A;  2LFN A;  4OWT B;  1A63 A;  2FMM A;  2NB0 A;  3K57 A;  4HSV A;  4POF A;  3S17 H;  2A6E C;  2F0F A;  4FYD A;  2AMC B;  2C9O A;  3FKI H;  5IYC G;  1VDZ A;  3SXH A;  1W3S A;  2A74 C;  2EXZ A;  1X3E A;  1F9Q A;  1H9J A;  4OX9 Q;  1CZG A;  2OWO A;  1X9N A;  4V0B A;  1TII D;  5JJZ A;  3FVQ A;  3TP5 A;  1RTO A;  5IYD G;  2EYJ A;  4EX5 A;  1WD1 A;  4IZ8 A;  3MEF A;  4XYO A;  3CCR A;  1PMR A;  1DOK A;  1WTW A;  5M5Y B;  2JQO A;  2IX1 A;  2VQE L;  1E2Z A;  1MJE A;  4DAY B;  2B8F A;  4ZQ3 A;  3V96 A;  3NPP A;  4B9X A;  4HIO A;  4HED A;  3CCS A;  3M4O H;  1Q90 A;  5CMD A;  3L9A X;  2PYK A;  3E9H A;  1X3Q A;  2OTJ A;  2B2V A;  4DNT B;  3HOX H;  3BYT B;  1QNK A;  2I5L X;  4XYQ A;  3KLW A;  2Z9H A;  4PMC A;  1F9P A;  3S16 B;  1KAA A;  5KRU A;  1EYC A;  2WB1 B;  2ATW A;  1STY A;  3S14 H;  4B3R L;  4LF6 Q;  1X32 A;  1D5M C;  2MUY A;  1NY4 A;  2YU9 B;  1TS5 A;  5C4X B;  1XTC D;  1EEF D;  1YIT A;  5COR A;  3FP9 A;  4RA8 A;  3VR2 A;  1ZEQ X;  4BBR G;  3Q24 A;  4FF4 A;  1BXT A;  4DXG A;  1MKH A;  3PUZ A;  2NVY H;  5DNF A;  1PH5 A;  1EIH A;  3URY A;  3H3V I;  1YIJ A;  3FHW A;  2BA0 A;  2HDL A;  3CXC A;  4DV6 L;  3GV6 A;  1PYW D;  2WP8 J;  1LV9 A;  3E9I A;  3JC6 6;  3VYU A;  2F0V A;  5CV9 A;  2XGT A;  4GNX C;  4XQJ A;  3T1Y Q;  1WI5 A;  1HUN A;  4ULL A;  5JPN C;  2BA1 A;  2GN5 A;  4R1J A;  3H94 A;  3MC0 B;  3K5N A;  4NW2 A;  3ULP A;  4ME3 A;  1CKN B;  1ENA A;  2RSO A;  4K5W A;  1AZQ A;  2NVT B;  1JWM D;  5ELD A;  2MQH A;  4PQX A;  3I3C A;  3HOZ H;  4JI4 Q;  3GTM H;  1J8I A;  2A6E D;  1KXL A;  1SE3 A;  2NN6 I;  4XT1 B;  1TXY A;  2OCE A;  1TWF B;  2QIL A;  2Z6K A;  1D8L A;  1EQT A;  2ZTD A;  5C3W A;  3S1N H;  3OPO A;  2BCO A;  2L4N A;  1SE4 A;  2LXJ A;  2B2Y C;  1WTO A;  3VR6 A;  4BS9 A;  3TME A;  4LF5 L;  2KCM A;  2M9V A;  4DUZ L;  1A3U A;  2WIN B;  4X65 Q;  3SDZ A;  1PLF A;  2DJG C;  2F0L A;  2I46 A;  4KHV A;  1JJC B;  2A1A A;  2K5D A;  4DAV A;  5IP7 G;  3RZD H;  2R93 G;  5FLM H;  2JA7 G;  3GTJ H;  4C3H H;  2H1E A;  2J0T D;  4YHH Q;  4L6T B;  3ERO A;  4LFC Q;  1I6V C;  1PXU A;  1IKL A;  1FNU A;  1OO9 B;  2L12 A;  4JI4 L;  1C0A A;  2Q8R E;  1UE1 A;  2EXD A;  3M3Y H;  1BF4 A;  1EY8 A;  4POG A;  4DUY L;  2N78 A;  1U4R A;  1V1O A;  2EIF A;  3NBH B;  2K5Q A;  3DWP A;  1WTH A;  1HFG A;  1TWH B;  3J81 i;  1NSN S;  1LLR D;  4LF8 Q;  1JWU D;  3TZU A;  5C3E G;  3I4L A;  4KKU A;  1KLU D;  2DNE A;  4C3I H;  2HIX A;  3C3L A;  3UDF A;  2E5L Q;  4CBV A;  4BA2 I;  5LMN W;  3HOU G;  5CGK A;  3A5Z B;  2HT1 A;  3SGI A;  5EPL A;  4O42 A;  2F0W A;  3NWS A;  3QG1 A;  3W2D A;  4X66 Q;  1NBW A;  1TWF H;  1VQB A;  4KI0 A;  2RCF A;  1A3T A;  3L3O C;  4GN3 B;  3ONA B;  1JJ2 A;  2ICE C;  4QJF A;  1NAP A;  1GM5 A;  1UNS A;  3I55 A;  2NTT A;  3NEL A;  4DV1 Q;  5IGC A;  2IT1 A;  3CME A;  3CCU A;  4YIJ A;  4BY7 B;  4A3E B;  4BBR B;  3D0F A;  5BR8 Q;  1B9M A;  1XWE A;  5DLQ E;  3GTL H;  4DR6 Q;  1E7Z A;  3D4D A;  4C3H B;  4IUN A;  3M3Y B;  3ULJ A;  1LTT D;  2MHV A;  1WTR A;  1DOM A;  1PH1 A;  2QKI C;  4K8I A;  1IW7 D;  1FYC A;  2EQS A;  1EIF A;  1UAP A;  3AEV A;  5ELF A;  4TSS A;  3HEJ A;  1ZKO A;  1SJH D;  4L5Q A;  1PH9 A;  5M5W B;  3I4M H;  1MHW C;  3DLL A;  1HNX Q;  4QY7 A;  3S15 H;  2FHT A;  3OMC A;  1I4R A;  1SFO H;  3HOW G;  5IYD H;  1G6P A;  3HOX B;  2RSN A;  3K7A B;  3LGJ A;  4JI0 Q;  3OTO L;  1VMP A;  1KIX A;  1L1O A;  1I4P A;  1RDP D;  1IBM Q;  3E6Z X;  2B2Y A;  2CW0 D;  4KY6 A;  1S4Z A;  4NDX A;  1CHP D;  1XPU A;  2KEC A;  4WJW A;  5M5X H;  4JI6 L;  5IGD A;  3SR1 A;  1LTA D;  2OTL A;  2XRS D;  4KY5 A;  3IAY A;  3ER0 A;  1BCP F;  3U9O A;  5GAG C;  4A3D H;  4A93 B;  2O5J C;  4DPG A;  1QCB D;  4JI1 L;  2E2J H;  4ILW A;  4ZCK A;  3K7U C;  5D65 A;  2H4O A;  1L0W A;  3OW7 A;  4BBS G;  1L1O C;  5FO8 B;  2KUM A;  3H91 A;  5IT9 L;  3BZK A;  4PZ8 A;  1X56 A;  2I07 B;  5ELC A;  2YU9 H;  1YHB A;  1HQR D;  5IT9 c;  1MBY A;  4A3C G;  1B3A A;  3I4M B;  1QNU A;  2B63 B;  4C3H G;  4RG1 A;  4A3I H;  2HHH L;  1Y69 U;  4ABN A;  5FJ8 H;  2F4V L;  2UXC L;  1BCP D;  4KD4 A;  3TEH B;  3D6W A;  4YWM A;  1M4V A;  3HOW H;  3S2D B;  2XSC A;  1H95 A;  4N9P A;  3R3O A;  2J4X A;  3A8I E;  2B63 G;  1WCM B;  3RR5 A;  2FMC A;  2D62 A;  3H6M A;  2NUC A;  3EJI A;  1PH3 A;  5KND A;  1EIY B;  1J6Q A;  4MIU A;  1M1K C;  3QOL A;  3HOY G;  4LF4 L;  2RDF A;  5IWA Q;  2R92 G;  3PO3 H;  3G71 A;  4K2L A;  1S5B D;  1DD2 A;  5IIF A;  2VW9 A;  1X6O A;  4KJN A;  2F0N A;  5CC4 A;  1U4M A;  4A4I A;  3K0X A;  2CQO A;  2JA6 H;  3I8Z A;  3CPW A;  2Y0S B;  3FRP B;  1V1P A;  2EJF C;  3UDG A;  4GZY C;  3G6J B;  3SK6 A;  4RHR A;  3IKJ A;  3I7F A;  2F0E A;  3NQT A;  1JB3 A;  1VQM A;  5L37 A;  4IPG A;  3G48 A;  1I4H A;  2L0C A;  4MHE A;  1O80 A;  1A15 A;  2AWN A;  4QIW E;  5ISR A;  4H7B A;  1YVC A;  1ZYR D;  2NTS A;  1N33 L; 
#chains in the Genus database with same CATH homology
 5LMU L;  1IBK L;  4IPH A;  1E24 A;  1XNR L;  3HOY H;  2I5H A;  1C9O A;  2L15 A;  2UUA Q;  3H3V H;  1UEB A;  2RHS B;  4Y7N H;  4R4T A;  5J3B A;  3A5U A;  4IOA A;  1A62 A;  2E8G A;  1VQA A;  1HJP A;  4NXM Q;  3CCJ A;  4MTN A;  3S2D H;  2D0O A;  2KCT A;  3F8T A;  4DNI A;  1VQN A;  1X54 A;  4UP7 A;  2BH8 A;  3UE1 A;  1CKM A;  3PUW A;  2VZA A;  3KJO A;  1K0R A;  4JBJ A;  1PH2 A;  1MIU A;  1N34 Q;  3TS2 A;  4DR4 Q;  1JJG A;  4DR3 Q;  4GS3 A;  4HIK A;  1I94 L;  4MNO A;  4JI8 Q;  2NVQ H;  2I0Q A;  3CCE A;  3A0J A;  2ASB A;  3L0O A;  4APV A;  3S24 A;  4JG2 A;  2JA5 G;  4A3K H;  3H0G H;  1XNR Q;  2JA9 A;  2VS1 A;  1IXR A;  4DR2 Q;  1S72 A;  4BBR H;  3TRZ A;  4BBS H;  1N32 Q;  4KLK A;  2LSS A;  4LF8 L;  2GVA A;  1CKN A;  1VQC A;  1L2F A;  1BKB A;  1YEZ A;  3M9B A;  4X64 Q;  5LMN Q;  1S40 A;  2NVX H;  4B3M L;  1N33 Q;  3OYY A;  4YY3 L;  1SE8 A;  3CW2 C;  4GOP B;  4A3M G;  3RLO A;  2PMZ E;  3KF8 B;  3CCQ A;  4DR1 Q;  1HNZ Q;  2E5L L;  1FJG L;  2VUM H;  3NEM A;  4DK6 C;  3HFZ B;  3B6Y A;  1SRO A;  4J15 A;  4LF4 Q;  2A19 A;  3ERS X;  4L5S A;  1QUQ B;  1NMF A;  4PMW A;  1BVS A;  1VQ4 A;  4BY1 G;  2K75 A;  2CWA A;  3KF6 B;  4A3F H;  5GQO A;  3JAM i;  1N8R C;  1U0L A;  4P72 A;  4IO9 A;  3CQZ H;  1LTL A;  1BBU A;  1PH4 A;  2Q2H A;  3K81 C;  4DV7 Q;  5ELO A;  2RHQ B;  4GNX A;  1YJW A;  4A76 A;  1K9M C;  5C44 H;  3HOZ G;  4FDB A;  1SLJ A;  4JI7 L;  1Q82 C;  4A3J H;  2IX0 A;  2KEN A;  4JV5 Q;  4BY7 G;  4X62 Q;  1E3P A;  4O0A A;  1VS0 A;  3CC2 A;  4NPS A;  5HY6 A;  4LF9 L;  4GN5 A;  1U5K A;  2NN6 G;  3GTQ H;  2WAQ G;  2FXQ A;  2MO0 A;  1UE7 A;  2C35 B;  2UXC Q;  1HZA A;  1DGS A;  5M3F H;  1CKO A;  4JI0 L;  4GLA C;  3GTP H;  4GKJ L;  1C7Y A;  1CUK A;  3U4V A;  1UE5 A;  3I4N H;  3PGZ A;  5IYB H;  1VQ7 A;  3HOX G;  4OWT B;  2BH2 A;  1A63 A;  2PI2 A;  1PVO A;  3KJP A;  2JE6 I;  3U4Z A;  1PHJ A;  4POF A;  5GAD C;  3S17 H;  2ZTC A;  2AMC B;  3FKI H;  5IYC G;  4R4I A;  1W3S A;  2UU9 Q;  1UWV A;  4A3J G;  1KD1 C;  1X3E A;  4DUY Q;  3K8A A;  2CKZ B;  2NZH A;  4DV5 L;  3UE0 A;  3ZJY C;  4OX9 Q;  1B70 B;  1PH7 A;  2OWO A;  4JI3 Q;  1G29 1;  1X9N A;  1EWI A;  1YHA A;  2B3G A;  5IYD G;  2UUC L;  2K14 A;  4EX5 A;  1XMO L;  3M4Q A;  3ULL A;  4JI2 Q;  4JI1 Q;  4JCV E;  3MEF A;  2F3I A;  4IJH A;  3CCR A;  1IL2 A;  4HIM A;  5GAH C;  2HT1 A;  2JQO A;  2IX1 A;  2VQE L;  1V1Q A;  1MJE A;  1Y1W H;  4DAY B;  4A3M H;  2V1C C;  4LF6 L;  4UP9 A;  3AFP A;  4GN4 B;  4LF5 Q;  2YV5 A;  1I50 H;  3A74 A;  1FGU A;  3RN5 A;  4DV5 Q;  5IWA L;  1NE3 A;  5AJ3 Q;  4HIO A;  4OX9 L;  5LMN L;  3CCS A;  3M4O H;  1GKH A;  2ZJQ A;  4JBK A;  4LUO A;  4BY7 H;  4JYA Q;  1SN8 A;  3E9H A;  2PNH A;  1FL0 A;  4DKA C;  2ZJP A;  2OTJ A;  2UXD L;  1RL2 A;  3HOX H;  2UUC Q;  3CD6 A;  1YBY A;  2MNA A;  2GVB A;  2XTI A;  2I5L X;  1XMQ L;  3KLW A;  2ID0 A;  2K5N A;  2YTV A;  5IP9 H;  4JI3 L;  3OW2 A;  1VCI A;  1VQK A;  2RCN A;  1XTD A;  2F4V Q;  4ALP A;  1KRS A;  2ATW A;  4K0K Q;  4A3E G;  3S14 H;  4LF6 Q;  4B3R L;  3DM3 A;  1VQJ A;  1NY4 A;  4L5T A;  1IBL Q;  3CPF A;  4LFA Q;  3EBE A;  4HID A;  4LWC A;  1YIT A;  2E2I H;  2DUD A;  4JYA L;  3J81 c;  1X3F A;  4JI7 Q;  2R93 H;  3FP9 A;  3PO2 H;  1V9P A;  2N3S A;  2HQL A;  3TS0 A;  2LXK A;  2WAQ E;  4BBR G;  2CCZ A;  1JB7 A;  1KAW A;  4DR5 L;  1MKH A;  3PUZ A;  3STB D;  1Q8K A;  1EYG A;  2JA6 G;  1K3R A;  2E2H H;  2NVY H;  1XPR A;  5C0X G;  2UXD Q;  1IBK Q;  4GLV B;  1PH5 A;  2OQK A;  4YWK A;  3H3V I;  1YIJ A;  3FHW A;  3F2B A;  4B3R Q;  4JBM A;  2BA0 A;  2IHF A;  2WB1 G;  3W1G A;  3CXC A;  1E22 A;  4YCW A;  2VQF Q;  4DV6 L;  1Y1V H;  4WJ4 A;  3D31 A;  2Y0S E;  4NXM L;  1J5E Q;  5HGQ A;  3L2P A;  4IFD J;  1E1T A;  2WP8 J;  1PA6 A;  5JJL A;  3PF4 A;  4NXN L;  3I56 A;  3E9I A;  3JC6 6;  4YCV A;  4A3F G;  3S1R H;  5C3E H;  3W5O A;  2HIV A;  2XGT A;  4GNX C;  3H0G G;  4TQU S;  3RNU A;  3T1Y Q;  1WI5 A;  3CCL A;  4NB3 A;  2BA1 A;  2K4K A;  2WFW A;  5M5Y H;  5IYB G;  3PIP A;  1PV4 A;  2GN5 A;  4R1J A;  2N49 A;  5M3F G;  2B63 H;  4HJ9 A;  4H02 A;  4YY3 Q;  3ULP A;  2QGQ A;  4ME3 A;  1CKN B;  3ICE A;  1WCM G;  1I5F A;  2VQF L;  3AQQ A;  4LUV A;  4DV1 L;  1PYB A;  1CSQ A;  4XIG S;  2MQH A;  1QVC A;  2ZTE A;  3PUY A;  1YZ6 A;  1P8L A;  5ELN A;  1N9W A;  4AYB G;  1MJC A;  1AE3 A;  1NMG A;  1XMO Q;  4JI4 Q;  3GTM H;  3HOZ H;  4A3L G;  1KXL A;  3GTK H;  2ZJR A;  1HNW L;  2NN6 I;  3G4S A;  1TXY A;  2OCE A;  4BXX H;  4GKK L;  2Z6K A;  1KHI A;  4PG3 A;  3MXN B;  1D8L A;  1Q12 A;  1WCM H;  2ZTD A;  1VQP A;  3S1N H;  1CSP A;  4JBW A;  4JI6 Q;  2LXJ A;  4A3C H;  2MO1 A;  4DV3 L;  4LF5 L;  3HOV H;  1BBW A;  2KCM A;  2KBN A;  4JOI C;  4DAM A;  3JAM c;  4DUZ L;  3GTG H;  2KHJ A;  3U50 C;  4X65 Q;  5C4J H;  1B8A A;  2AWO A;  4KHP L;  5LMU Q;  2N8N A;  4JV5 L;  1LUZ A;  2K5V A;  2OQ0 A;  1JJC B;  3S2H H;  3PO2 G;  2A1A A;  1PYS B;  4HJA A;  2R93 G;  5IP7 G;  3RZD H;  5FLM H;  4LF9 Q;  2JA7 G;  3GTJ H;  4C3H H;  3TRE A;  2ZM6 L;  4OWX B;  1EQQ A;  4LFA L;  2R7D A;  4YHH Q;  3T1H Q;  2QA4 A;  1W2B A;  4LFC Q;  2VNU D;  2UUB L;  5C0X I;  4JI4 L;  1C0A A;  1UE1 A;  2EXD A;  3M3Y H;  4POG A;  2AKW B;  4DV3 Q;  4DUY L;  4A75 A;  1HNX L;  2PQA B;  4LF7 L;  2N78 A;  3BU2 A;  1QVF A;  1JT8 A;  1VQ9 A;  1O7I A;  2EIF A;  1X65 A;  2KHI A;  3L7Z C;  3PO3 G;  3NBH B;  4DV0 L;  4IPD A;  3J81 i;  1P16 A;  1WFQ A;  4C3J H;  1NJI C;  4JI2 L;  1PFS A;  3WWV A;  3J7Z C;  4DV6 Q;  4LF8 Q;  2VY3 A;  5C3E G;  4DR7 Q;  1VQG A;  2R7Z G;  4IOC A;  3KDF B;  3PV0 A;  3G6E A;  4C3I H;  2YTY A;  1Q7Y C;  2HIX A;  3UDF A;  1E1O A;  3UDI A;  5M5W H;  5C0X J;  4DR1 L;  1HNZ L;  1Y1W G;  2E5L Q;  2F52 A;  4BA2 I;  4O2D A;  5LMN W;  1RIP A;  3RLN A;  4DV4 L;  2JEA I;  3HOU G;  1HZC A;  2R92 H;  5IP9 G;  1K83 H;  1LYL A;  3A5Z B;  5GAE C;  1TWA H;  3SGI A;  3VDY A;  2UUB Q;  4B3T Q;  5BR8 L;  1OXV A;  4AH6 A;  3OTO Q;  2A8V A;  1KL9 A;  4AIM A;  4A3L H;  1WYD A;  4GOP A;  2R7Z H;  4P74 A;  4B3S Q;  5IY0 A;  1S3O A;  4X66 Q;  3RZO H;  1NBW A;  1TWF H;  4PZ6 A;  1VQ6 A;  1VQB A;  4PZ7 A;  4A3B H;  4KI0 A;  1KQS A;  4LW1 A;  1V43 A;  4GN3 B;  4AQY L;  1JJ2 A;  2CWP A;  4QJF A;  4RMF A;  1Y1V G;  1XNQ Q;  1GM5 A;  1Q86 C;  1VQ5 A;  4BA1 I;  3I55 A;  4C2M H;  3NEL A;  5IE8 A;  4A3G H;  1Q81 C;  4DV1 Q;  1HNW Q;  5C4X G;  4TVA B;  1L1O B;  4GKK Q;  3CME A;  2IT1 A;  3EIV A;  3HOV G;  3CCU A;  4DR3 L;  4L5R C;  3D0F A;  5BR8 Q;  5DLQ E;  4GOP C;  1QVG A;  3GTL H;  4DR6 Q;  1K73 C;  1HZ9 A;  1E7Z A;  5IP7 H;  3S16 H;  4QL5 A;  3KOJ A;  1OXT A;  4X66 L;  4DV2 L;  1N33 L;  4KHP Q;  2JEB I;  1WOC A;  1QZH A;  1JMC A;  2CFM A;  3CC4 A;  1VQD A;  3ULJ A;  1N32 L;  2R6G A;  2YTX A;  4A3D G;  4R4O A;  1YNX A;  4A93 H;  1KRT A;  1PH8 A;  3EN2 A;  3Q8D A;  1PH1 A;  4YHH L;  1VQF A;  2R7F A;  4YWL A;  3T1H L;  3I4N G;  3KYH C;  1N36 L;  4NXN Q;  2VL6 A;  1ASZ A;  4BY1 H;  4IPC A;  2QEX A;  2EQS A;  1EIF A;  2K50 A;  2AHO B;  3RLF A;  3AEV A;  3CMA A;  2ES2 A;  2HHH Q;  2K5H A;  4JI5 Q;  5M3M G;  4L5Q A;  4OWW B;  1PH9 A;  4IJL A;  4A93 G;  4X62 L;  3PSI A;  3PCO B;  3J80 i;  3I4M H;  5C44 G;  1HR0 Q;  2DGY A;  1VQ8 A;  1QZG A;  2UUA L;  3DLL A;  1HNX Q;  3HKS A;  3HKZ G;  4DV2 Q;  4QY7 A;  3S15 H;  5EAY A;  5JJK A;  4UPA A;  5JEA J;  4GKJ Q;  3FKI G;  5IYC H;  1SFO H;  1N36 Q;  3HOW G;  3PF5 A;  4P71 A;  1YHQ A;  5IYD H;  5K36 G;  1N34 L;  4P75 A;  3S1M H;  4DR4 L;  1G6P A;  3KF6 A;  4OO1 G;  4LUZ A;  3LGJ A;  2UXB Q;  3UDX A;  4JI0 Q;  4X6A H;  4UP8 A;  3OTO L;  4JOI A;  2IHE A;  1KIX A;  2UU9 L;  2IY5 B;  1L1O A;  1IBM Q;  1HH2 P;  4DV4 Q;  3PUX A;  1K8G A;  2NVT H;  1Q46 A;  2Q2U A;  3KDF A;  1IZ6 A;  4X64 L;  2ALY B;  3F2C A;  4GLX A;  5M3M H;  1I94 Q;  1XPU A;  2Z6K C;  4IFD I;  4A3E H;  5GRO A;  1I3Q H;  4OXP A;  4A3K G;  2MFI A;  5M5X H;  4QGU A;  4AQY Q;  4JI6 L;  4DR2 L;  1YJN A;  5JJI A;  2OTL A;  1HR0 W;  2JK8 A;  1R9T H;  3ER0 A;  4DUZ Q;  2JA7 H;  5FLX c;  5GAG C;  4X65 L;  1A0I A;  4A3D H;  1I6H H;  5JEA G;  3I4M G;  1FVI A;  3CF5 A;  1XNQ L;  4R4Q A;  4DPG A;  1IBM L;  4JI1 L;  2E2J H;  5H1S E;  4R4C A;  1QUQ A;  1X3G A;  3CP0 A;  3CCM A;  2D0P A;  3K7U C;  3T1Y L;  4EQ5 A;  2UXB L;  3W1B A;  4LFC L;  1L0W A;  2VQE Q;  1YI2 A;  1K8A C;  4DV0 Q;  4P73 A;  4DR6 L;  4BBS G;  1L1O C;  4HJ7 A;  1Q1B A;  4LF7 Q;  1XJV A;  3BZC A;  3BZK A;  4PZ8 A;  3CC7 A;  1X56 A;  1GD7 A;  1YJ9 A;  4LFB L;  2YU9 H;  1YHB A;  5IT9 c;  1Q1E A;  5C4X H;  3GD7 A;  4OON A;  4A3C G;  4OO1 I;  3J81 j;  1EFW A;  4A3G G;  2JA8 G;  3M85 A;  1EOV A;  1VQL A;  1GVP A;  4RG1 A;  1ASY A;  3KFU A;  4A3I H;  3J80 c;  2HHH L;  4LNQ A;  5FJ8 H;  1B7Y B;  2F4V L;  2UXC L;  2H5X A;  3I4O A;  4A3B G;  1TWC H;  2JJQ A;  3F1Z A;  3TEH B;  4HJ8 A;  3H15 A;  4YWM A;  1TWH H;  3HKZ E;  2WB1 E;  1HR0 L;  4B3S L;  1IBL L;  1OXU A;  4WJ3 M;  3IRB A;  3TQY A;  4DR5 Q;  2JA5 H;  3HOW H;  1OXS C;  4K0K L;  4B3T L;  3K7A H;  4JI8 L;  1AE2 A;  3PIO A;  4BXX G;  3CAM A;  1H95 A;  2YYZ A;  2PI2 E;  1KC8 C;  1VQH A;  1A8V A;  1FJG Q;  3HOU H;  2B63 G;  1VQI A;  4MZ9 A;  1OXX K;  3RR5 A;  2D62 A;  4GNX B;  3BJU A;  2ZM6 Q;  1OTC A;  3CCV A;  3NEN A;  4JC0 A;  1IYJ B;  1PH3 A;  4LFB Q;  2Q2I A;  3M4P A;  1EIY B;  4IFD G;  1J6Q A;  1TWG H;  3K80 C;  2Q2T A;  3E0E A;  3U58 A;  2Z0S A;  3I2Z A;  1XPO A;  5FJ8 G;  1M1K C;  3HOY G;  4LF4 L;  5IWA Q;  5AJ3 L;  2R92 G;  3PO3 H;  1Z9F A;  1J5E L;  3PUV A;  1NTG A;  1D7Q A;  3G71 A;  1AH9 A;  4AYB E;  4XTC S;  1UE6 A;  2VW9 A;  1X6O A;  1M90 C;  1GO3 E;  4QQB X;  1WJJ A;  1LM0 A;  1G51 A;  1T9H A;  1SMX A;  2B29 A;  2CQO A;  2NZO A;  3K0X A;  3STB C;  4A4I A;  4DV7 L;  2JA6 H;  4KHZ A;  1Y14 B;  2I5M X;  3CPW A;  1VQO A;  3GDE A;  5FLM G;  1EQR A;  3GO5 A;  1XMQ Q;  2PQA A;  3M7N A;  4Y52 H;  2Y0S G;  1SR3 A;  3UDG A;  4A3I G;  4DK3 C;  4YCU A;  4DR7 L;  1JE5 A;  2JA8 H;  4UY8 C;  3J7A 5;  3I7F A;  1EUJ A;  1X55 A;  3F2D A;  3RN2 A;  1VQM A;  3S1Q H;  3G48 A;  4IPG A;  5E7N A;  3GTO H;  2RF4 A;  1Z47 A;  1PH6 A;  4HJ5 A;  1SRU A;  4QIW E;  2AWN A;  2VUM G;  1VQE A;  1HZB A;  1YVC A;  3AFQ A;  3AYH B;  2K52 A;  4JI5 L;  4B3M Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...