4A3LH

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lH00
3HOWG 2GVAA 3NBHB 3J81j 1Y1VG 1EIFA 1HNZL 3KFUA 3S2HH 2Z0SA 1CKOA 1N33L 5LMNQ 5GQOA 3DLLA 3GTMH 4UP7A 1K0RA 1OXXK 1L1OC 3D31A 2WAQG 4P73A 4BBRH 1VQ4A 4BXXH 1JB7A 3UDIA 4GOPC 5IYCG 4LF9L 3RNUA 1VQ6A 4C3HH 3M3YH 3I56A 4DUYL 3OW2A 1VQGA 3G48A 1DGSA 3T1HL 2V1CC 1UWVA 4PG3A 3U4ZA 1YHBA 1X3GA 5M3MH 3K7UC 4DV1Q 4RMFA 1PH6A 4B3MQ 1E24A 2LSSA 3GO5A 3K8AA 3KF6B 4PZ7A 1YJ9A 4JI4L 2OTJA 4X65Q 2VQFQ 4NPSA 1VQBA 4KI0A 1K73C 4A3EG 3S2DH 2MNAA 1I50H 4OXPA 4DV0Q 2AHOB 4A93G 2WAQE 3RLOA 4JI6L 4C2MH 3RZDH 1N32L 1PV4A 1XPRA 2I0QA 4YCUA 2E5LL 5J3BA 2MO1A 2JA5G 4KLKA 1Y1WG 1HH2P 2XTIA 1QVGA 1EUJA 3W5OA 3F2CA 4BBSH 2F4VL 4IPGA 3JAMc 1SROA 3RZOH 4DV5L 3ZJYC 4PMWA 4GNXA 3CCSA 4BY1H 4A93H 2VS1A 1VQOA 1X56A 1YNXA 1J5EL 4IPCA 3Q8DA 2ZJPA 4WJ3M 4EX5A 4BA1I 5M3MG 4OX9L 4JV5Q 4L5TA 4DR5Q 1O7IA 4GN5A 4B3RQ 4JI7Q 4LF4L 3I4MH 3VDYA 3M9BA 3PCOB 3CMAA 2VW9A 1SR3A 2Q2UA 3JC66 4A3CG 4JI8Q 2ATWA 4KHZA 1Q7YC 2RCNA 2UUCQ 4YWMA 5H1SE 1RIPA 1I6HH 3I4OA 2ZTEA 3RLNA 1Y1WH 4GKJL 3M7NA 4TVAB 1WJJA 4YY3Q 3CCUA 4GLAC 1G291 2HIXA 1QZGA 1SMXA 1NBWA 4JYAL 4X6AH 1IBKL 5M3FH 4K0KL 5JJIA 3PUZA 4X66L 3E9IA 2R93H 2F3IA 3I7FA 1UE7A 3B6YA 4GKKQ 1CSPA 5C4JH 4XTCS 2ZM6L 2E2HH 1VCIA 3TEHB 4C3IH 2WFWA 2VZAA 2OQ0A 1HZ9A 2YU9H 4DV2Q 2AMCB 1HNXQ 2IT1A 4LFAQ 3G71A 2AKWB 1PH8A 1V9PA 1E3PA 2R7DA 4EQ5A 5M3FG 1JMCA 1Z47A 2GN5A 4JG2A 4O0AA 4L5RC 1X6OA 4A3FG 4RG1A 3PGZA 1PHJA 3CMEA 2JJQA 1KD1C 1A8VA 4A3IH 1XMOL 4BA2I 3W1GA 5M5WH 4X64Q 1N36L 3BU2A 1JE5A 5C0XJ 3CCMA 2N8NA 2D0PA 4QY7A 1UE5A 3J7A5 1X9NA 4OWWB 4HIOA 2LXJA 3FP9A 2CKZB 4HIDA 1SFOH 3K0XA 4A3KH 4A3IG 2H5XA 2ES2A 4DR1L 2LXKA 1YJNA 4JCVE 3OTOL 3GTQH 2YV5A 1KAWA 4Y7NH 1S40A 1BKBA 1VQJA 1IBML 3JAMi 4AYBE 4DKAC 2Y0SE 5IE8A 1KRTA 1EQQA 3K80C 5IWAQ 2JA5H 2CWAA 2L15A 3NEMA 4HJAA 1N34Q 1ASZA 1IXRA 4YWKA 1Q82C 3S1NH 1UEBA 1CKNA 1X54A 3OYYA 3KOJA 5ELOA 4JI5Q 3GTLH 2UXBQ 2IY5B 1P8LA 2VQEL 4DV5Q 1BBWA 4DR3Q 1EFWA 4JI0Q 4AH6A 2R92G 2R6GA 4A3LH 3KJOA 4NXML 3NELA 1Q86C 2Z6KC 2KHJA 4OWTB 1WCMH 4DUZL 4IO9A 3J81c 4BBSG 1U5KA 3T1YL 1I94Q 3PSIA 3E0EA 1LTLA 4LNQA 1CUKA 3GTGH 3PUXA 2VY3A 4ME3A 4A3KG 2CFMA 2ZTCA 3E9HA 2EQSA 1CKNB 1P16A 3PV0A 1YJWA 5BR8Q 3CPWA 1MJEA 2KHIA 1EWIA 2ID0A 1TWCH 5JJKA 3PIPA 4LFCQ 1NMFA 2MO0A 3D0FA 1XNRL 4P75A 5K36G 2UXDQ 4R4IA 1QUQA 1G51A 1VS0A 3K7AH 5GROA 3F2BA 4A3JG 1HR0L 4B3TQ 5IYDH 4R4TA 1E1OA 1HZCA 4GLXA 3ULPA 1EOVA 4R4QA 4H02A 3UE1A 5C4XH 4A76A 1HR0W 3PIOA 1PH2A 3A5ZB 1S3OA 1AE2A 3BZCA 2NVYH 5LMNL 1C7YA 1PFSA 3HFZB 1L1OA 3CPFA 4A75A 1YI2A 1VQ5A 2CCZA 3H15A 4YWLA 4TQUS 4OWXB 1BBUA 3GTJH 1UE1A 5C3EH 5AJ3Q 3CAMA 2QEXA 1PH1A 4LF9Q 4DV6Q 2UXCQ 4Y52H 1FVIA 4APVA 4WJ4A 2A1AA 1Y1VH 4JI3L 1VQCA 2PQAB 2BA0A 3I2ZA 4GS3A 3S17H 4AQYQ 2UUBL 4UPAA 3FHWA 2YTVA 1PH3A 2CWPA 4JI4Q 2Q2HA 2E8GA 5GADC 2KCMA 2HQLA 2F52A 3PUYA 4AYBG 4NB3A 4A3DH 2ZTDA 4DR6L 3F8TA 1SRUA 2UU9L 4IFDG 1LYLA 2E2JH 4JI6Q 1N32Q 1MKHA 4LF6Q 2PMZE 4IOAA 1L2FA 1YVCA 4HJ9A 3PO2G 2K50A 3TREA 3AYHB 1CKMA 3CD6A 3TS2A 2VL6A 4P74A 4NXNL 5IY0A 3LGJA 1FJGQ 4ALPA 3CC7A 3PO3H 4OO1G 2R93G 1VQHA 3TRZA 5GAHC 3NENA 3FKIG 4A3BG 1N34L 1XNQL 5M5YH 5C0XG 2K4KA 4DUYQ 3GTKH 2B29A 4MNOA 4DR5L 4B3RL 4JBKA 4JI7L 2NVXH 1OXTA 5C3EG 1VQ7A 1VQ9A 1IYJB 4LF8Q 4DR3L 3S1RH 4BY1G 4X65L 3STBC 5ELNA 3MXNB 3F2DA 1A63A 5E7NA 4A3BH 3RLFA 4DV0L 3T1HQ 2IX1A 2NVTH 1HZBA 5FJ8H 3CCRA 4GKJQ 4A3MH 2WP8J 4YHHQ 3KLWA 3L7ZC 5GAGC 1VQFA 3KJPA 4MTNA 3H3VI 4YY3L 1JJ2A 3U50C 1KQSA 4B3SL 2YTYA 1L1OB 2BA1A 4LUVA 3HKZE 3A5UA 3HOZH 4DAMA 4DV4Q 1XJVA 3PO2H 2PQAA 4GOPB 4JI1L 4UP9A 5BR8L 1KRSA 3DM3A 1VQMA 1Q1BA 2IX0A 2MFIA 4GN3B 3HOVH 2K52A 4DV7Q 1MIUA 4X62L 2JA8H 1HJPA 1SLJA 1YITA 4A3DG 3PO3G 4FDBA 3HOZG 5LMUL 3ULLA 4DR7Q 1E22A 3UDXA 2NN6I 2KBNA 3HKSA 1J5EQ 1XMOQ 1PH5A 2BH8A 3A74A 5FJ8G 4DV3Q 4POGA 1HNWL 4JBJA 3IRBA 2AWOA 4OX9Q 4UY8C 3PUVA 2JA8G 4JV5L 4PZ6A 3H0GH 4LUZA 3RR5A 5AJ3L 1WOCA 3J81i 3EBEA 2VUMG 4A3LG 1GO3E 2HIVA 3UE0A 4JI3Q 5C4XG 3HOYH 1RL2A 2K5VA 4X62Q 3FKIH 4A3FH 4AIMA 2UUBQ 1K9MC 4IPHA 3S24A 2B63H 2NZHA 4GKKL 3HOVG 1D7QA 3K81C 2ZJQA 4LF7L 2Q2TA 5EAYA 1D8LA 1WI5A 5IYBH 2UU9Q 3CQZH 1QVFA 3ERSX 1Z9FA 1EIYB 5JEAJ 4PZ8A 1JT8A 4JOIC 1LUZA 1YHAA 4DR2Q 3SGIA 2A8VA 3STBD 5IP7G 2Q2IA 1B7YB 1VQDA 4IPDA 3PF5A 4QQBX 4DV1L 1FJGL 4HJ7A 1S72A 4DR4L 1VQEA 2JE6I 4A3JH 1XMQL 3CP0A 2JA7H 2I5HA 1CSQA 4YCWA 4NXMQ 3CCQA 1WYDA 4QL5A 1YHQA 2ZJRA 4QIWE 1I3QH 5GAEC 3BJUA 1OXSC 1K3RA 3KF8B 3G4SA 1XPOA 3M4PA 2K75A 3HOYG 2R7ZG 1J6QA 1I5FA 1U0LA 1XTDA 1OXVA 2AWNA 3HOUH 2B3GA 2E5LQ 2R7FA 3WWVA 4DUZQ 3TQYA 4XIGS 3H0GG 2N78A 2E2IH 3MEFA 3EIVA 2F4VQ 1TXYA 1VQ8A 1GKHA 2KENA 2R92H 4JI2Q 2OTLA 1Q1EA 3CCVA 1JJCB 2JEBI 4BXXG 4O2DA 1IBMQ 1NE3A 1W2BA 4IFDJ 2UUAL 1WCMG 1IBLQ 4DR1Q 4LF5Q 3M85A 3G6EA 1N33Q 3GTOH 1E1TA 3EN2A 4IJLA 2JA7G 1KIXA 2HHHL 4B3SQ 2YYZA 4LF4Q 4C3JH 2JA6H 5M5XH 4HIKA 5IWAL 1R9TH 1A62A 1B8AA 4YCVA 4QGUA 4P72A 2A19A 4R1JA 2RHSB 1X55A 2KCTA 2Z6KA 4A3MG 1M1KC 3S15H 4DV7L 4J15A 2FXQA 4JI5L 4GLVB 2OQKA 2UXBL 5JEAG 2HT1A 2D62A 3CCEA 2ASBA 3T1YQ 1I94L 2Y0SG 4DK6C 4JYAQ 4JI8L 5C44H 3S14H 5IT9c 1NJIC 1C0AA 3HKZG 1TWHH 4DK3C 3UDGA 4GN4B 1MJCA 4HIMA 4LFBQ 3J7ZC 2ZM6Q 5IP9H 3W1BA 5FLMH 4JC0A 3GDEA 1N8RC 5DLQE 4LFCL 5JJLA 1IBKQ 4IJHA 4LFAL 4UP8A 4BY7G 4KHPQ 2K5HA 1Q12A 2NZOA 4JOIA 1GD7A 1K83H 4R4OA 3ICEA 3A0JA 1KHIA 1T9HA 1X3EA 1YEZA 3ER0A 3F1ZA 4LF7Q 4B3TL 1QZHA 3KYHC 1XPUA 1TWGH 4JBMA 3I4NH 4BY7H 2QA4A 3CW2C 1NTGA 3GTPH 1X3FA 2JEAI 3H3VH 2K5NA 4POFA 3CXCA 1N36Q 2N3SA 4LF8L 2WB1E 4QJFA 4MZ9A 1VQLA 4A4IA 3OTOQ 3RN5A 4BBRG 1YBYA 3ULJA 3TS0A 3M4OH 3I4NG 2I5LX 5C44G 5IYCH 1G6PA 1H95A 3CC4A 3U4VA 4LW1A 1Q46A 1VQPA 2XGTA 4K0KQ 1KXLA 3HOUG 4X66Q 1JJGA 2CQOA 5IP9G 2JQOA 2YTXA 5IP7H 1X65A 5FLMG 1HNZQ 1OTCA 1IL2A 4P71A 3J80i 1VQKA 1M90C 1YZ6A 2OWOA 2NN6G 2VUMH 1AH9A 1V43A 2K14A 1HNXL 2PI2E 4LUOA 5C0XI 4A3GG 1UE6A 3CC2A 4JI1Q 1B70B 2B63G 1C9OA 1HZAA 1V1QA 4LWCA 1ASYA 1W3SA 2UUAQ 2VNUD 3UDFA 1IBLL 1E7ZA 4LF5L 4OO1I 1TWFH 4NXNQ 4R4CA 1NY4A 1EYGA 4HJ8A 4B3ML 1SN8A 5IYBG 2RF4A 4X64L 4JI0L 3BZKA 3CCJA 2VQFL 2JK8A 2JA6G 5FLXc 1GM5A 2NVQH 1PA6A 3HOXH 1FGUA 3M4QA 4DNIA 1Q81C 3CCLA 1XNQQ 4DV3L 1HNWQ 1FL0A 3AFPA 4IFDI 3J80c 4GNXB 2N49A 1EQRA 4JBWA 2EXDA 3L0OA 1PYBA 4YHHL 2IHFA 2GVBA 1NMGA 1HR0Q 1VQIA 3U58A 2R7ZH 3HOXG 2I5MX 1PH7A 4GNXC 2D0OA 4A3CH 3I55A 2PI2A 4LFBL 3KF6A 4DPGA 1VQAA 3KDFB 1Y14B 1OXUA 1QVCA 3RN2A 1WFQA 4L5QA 1GVPA 1KL9A 1QUQB 1XNRQ 2DUDA 4L5SA 1LM0A 3AEVA 1PYSB 2HHHQ 3S16H 4A3GH 2PNHA 3KDFA 2RHQB 2VQEQ 4DV4L 4DV6L 3I4MG 2C35B 3HOWH 2IHEA 4KHPL 1K8GA 4DR2L 1A0IA 1IZ6A 2OCEA 2ALYB 4AQYL 2QGQA 2UUCL 1BVSA 4DR4Q 2EIFA 1YIJA 3PF4A 1XMQQ 5LMNW 1TWAH 2UXCL 1VQNA 5LMUQ 2WB1G 4GOPA 1PH9A 3L2PA 3S1QH 4DR7L 1KC8C 2BH2A 4DR6Q 1PVOA 3PUWA 5HGQA 5IYDG 1L0WA 3AQQA 4HJ5A 2DGYA 1PH4A 4DAYB 4OONA 1SE8A 3AFQA 3CF5A 2MQHA 3GD7A 1AE3A 5HY6A 4JI2L 4DV2L 1K8AC 4A3EH 4LF6L 3S1MH 2UXDL 2JA9A 1N9WA 4IOCA 1Q8KA
chains in the Genus database with same CATH superfamily
5CR3A 1EY5A 5EPJA 5COYA 3S2HH 1CQFA 1CKOA 5TSSA 4K5VA 1XWEA 4UP7A 1J8IA 3D3RA 1SNPA 1VQ4A 2NVQB 3UDIA 2B2WC 5EGTA 5C3EB 3RNUA 2I46A 3M3YH 3SK4A 4DUYL 3OW2A 1VQGA 4TKOB 2V1CC 1VQ9A 3NQTA 5M3MH 4JI4L 1PZJD 3GTKB 4HTHA 1VQBA 3JAML 4KD3A 2NTTA 1I50H 4OXPA 1KABA 4A93G 3RLOA 4JI6L 4C2MH 3RZDH 2KA7A 1XPRA 3RMHA 2EXZA 5A35A 4R8NA 4EQPA 1DOMA 1TU2B 2F4VL 3TMEA 4BBSH 4IPGA 4Z9CB 1SEBD 2B2VC 4A93H 4FO2A 3FRPB 3A7LA 1YNXA 2BDNA 2EYJA 1GUOA 2A6HD 4K8JA 4IUPA 5I6WA 2ZJPA 3J7AF 4DR5Q 4B3RQ 4GN5A 3I4MH 5I6YA 2XIWA 3CMAA 2VW9A 2XVSA 2RCNA 1RIPA 4TVAB 1EYDA 4GLAC 2HIXA 3CCUA 4JYAL 1IBKL 1CSPA 1RD9D 2ZM6L 1I3QB 1VCIA 1MSHA 3D6WA 2YU9H 3NWTA 4IURA 2IT1A 4A93B 1E3PA 4EQ5A 4JG2A 4O0AA 3RD4A 4L5RC 1X6OA 4LK1C 3PGZA 1HQRD 1KD1C 4H0LC 1XMOL 3W1GA 4X64Q 1N36L 4IZ8A 2C5CA 3BU2A 5ELDA 1JE5A 2X6LA 1U4PA 4KY6A 2LFNA 4A3JB 4EVOA 4HIDA 2O5JC 3X3MA 4A3KH 3D4DA 3S9WA 5C0XH 3I91A 1JCKB 1TS5A 4JCVE 2SNMA 3GTQH 4LMQD 3M3YB 2YV5A 1KAWA 1BKBA 1YNJD 2CWAA 2KCCA 2Z9HA 3NEMA 5IGBA 4HJAA 4YWKA 2YU9B 2B2YA 5ELOA 3PIP3 4DV5Q 2DNEA 2R6GA 3KJOA 4RGMA 1Q86C 1S5DD 3MVVA 5CV5A 5JOBA 3EJIA 1ZXTA 1SE2A 3WOFA 3T53B 1JB3A 1WCMH 1WTQA 4DUZL 1I94Q 2KHSA 1LTLA 4BWGB 3VYUA 4ME3A 4A3KG 2CFMA 2RCFA 3E6ZX 3E9HA 4OHJA 1CKNB 4PQXA 4HN7A 1LABA 2ID0A 5JJKA 3PIPA 3VR3A 5K36G 4ZAIA 1DONA 1SMYC 1VS0A 4OELB 4A3JG 1Q3LA 3I72A 1LACA 1HZCA 1JORA 1MGSA 4G4KA 4G7OC 3PIOA 1S3OA 1C7YA 3S1MB 1JWSD 3HOYB 1L1OA 4X3TA 4A75A 2CCZA 2P5ZX 4OWXB 3KBXA 3GTJH 4LF9Q 3CAMA 2A1AA 1Y1VH 2SEBD 4JI3L 2XWBB 3S17H 1SYEA 5JJZA 3CU7A 1PH3A 1HUMA 2Q2HA 1MD2D 2HQLA 1IKMA 3PUYA 4BS9A 1TR5A 2ZTDA 2K05A 3F8TA 1I4HA 1RHPA 1I4XA 3M4OB 1BO0A 1D6EC 2VL6A 1NR4A 1FJGQ 1D1KA 4ALPA 3CC7A 4ZKBB 1ZYRC 3PO3H 4OO1G 4A3KB 3TRZA 1I6VC 3URYA 1GUGA 3FKIG 4A3BG 5C0XG 2L12A 2B29A 4JI7L 4LF8Q 1NCVA 1IYJB 4DR3L 3H0GB 1VF7A 2F4IA 3GTJB 1PDQA 3F2DA 4A3BH 4XXEA 4BBSB 3HOWB 3L7ZC 3QOLA 1F9PA 1BNZA 4KV6A 1I4QA 3SDZA 1KQSA 1CA6A 1L1OB 3A5UA 4MTKA 4DV4Q 1WTRA 4B9XA 3L9AX 2EDGA 4UP9A 4ZRZA 4ZLTF 4GN3B 1V1PB 2RDGA 3DEPA 4DV7Q 3FVQA 2CH4A 1HFGA 1SLJA 2JA8H 3PO3G 1O78A 1RTNA 3NTHA 4C3IB 3HOZG 2EJGC 1HQMC 3UDXA 2IJ0A 2KBNA 3U9OA 3HKSA 1J5EQ 4NMZA 4A3EB 1PLFA 4POGA 1HNWL 2PCFB 5I2YA 4UY8C 3HOUB 4JV5L 3PUVA 3DEOA 3VR5A 1S5ED 2OXPA 1SFOB 1HCZA 4AIMA 4TRDA 2NZHA 2IX3A 2KECA 4CKCA 4LF7L 2Q2TA 5KEEA 3CQZH 1QVFA 3ERSX 1Z9FA 3GTQB 4LJZC 4PZ8A 3BYYB 4IPDA 1L0XB 1VQDA 4DV1L 4HJ7A 4DR4L 4A3JH 2JXMB 3CP0A 4NXMQ 1SYDA 3CCQA 4QL5A 1PFNA 1F2MA 4DN4M 4Q5VA 2ZJRA 3G4SA 1YHQA 2R7ZG 1K3RA 2Q8IB 2EYLA 2L4NA 2K75A 3W2DA 2AWNA 3HOUH 4RH6A 1UNSA 3TQYA 4RGNA 3MEFA 2F4VQ 1TXYA 2V4DA 2K5DA 5FK9C 1NE3A 3I4MB 4U673 3ND9A 5I9OA 3DXJC 1IBLQ 3M85A 2K5WA 2B2TC 1E1TA 4DAVA 4B3SQ 2YYZA 3P7JA 4JK1C 3VYSA 1PRTC 4C3JH 4HIKA 3H09A 1R9TH 4QGUA 4P72A 1M1KC 1QILA 2FXQA 1TWFB 5K5PA 1A2UA 1PRTB 2D62A 2ASBA 2ZXRA 4DK6C 4JYAQ 2G9DA 1NJIC 1C0AA 4XT1B 5DNFA 4DK3C 1KDCA 1MJCA 1O7ZA 2ZM6Q 2DJGC 5IP9H 3GDEA 2VUMB 4FF3A 1IBKQ 1F2YA 1YNJC 5A2QE 4ZUJA 5CC4A 1Q12A 4HAEA 4R4OA 3ICEA 1BCPD 1T9HA 1YEZA 3F1ZA 3ER0A 1KDAA 3MA2B 1RDPD 1TWGH 1WVLA 4M1UB 3TBIB 5D3DA 3BVGA 2JEAI 2WINB 1TY2A 1N36Q 1JC7A 2D5DA 2KEDA 5NUCA 2N3SA 1SNQA 2WB1E 1Y1WB 3RN5A 3T56B 1TIID 1B1ZA 2OEOA 2NVYB 2I5LX 5IYCH 3U4VA 3G7LA 2XGTA 4K6LA 4IUQA 4QUFA 1JJGA 1B53A 4L6TB 1DZ1A 4P71A 3X3NA 1VQKA 1M90C 2F3VA 1YZ6A 1CZWA 2PI2E 4A3GG 1SBBB 3SK8A 3PO2B 1G91A 1DXMA 1HZAA 2VNUD 2Z1CA 5EBCA 1IBLL 1E7ZA 1LTSD 1WD1A 1HA5A 4NXNQ 2F0VA 1A3TA 1PZKD 2E2DC 3TZDA 1SN8A 5M5WB 1EYCA 2RF4A 3CCJA 2K7VA 5LL6X 2NVQH 1PA6A 3HOXH 3TN2A 3SK6A 1Q81C 1XNQQ 3A8JE 4DV3L 4NW2A 1TY0A 4IFDI 3J80c 4GNXB 1TKWB 1EQRA 1PTOF 1KNAA 2EJFC 2IHFA 1A6XA 4ABNA 4F7XA 1BCPC 3U58A 2R7ZH 4S3SA 3R93A 4CGYB 4GNXC 2D0OA 4FYDA 3I55A 3KF6A 1Y14B 2IPKD 2BCOA 1KL9A 1QUQB 2F0UA 1MI2A 1BCPB 1CHQD 1PYSB 5IODA 4A3GH 1C8CA 2M9VA 2HDLA 2RHQB 3I4MG 5JVH3 1SNOA 1K8GA 4BY1B 5CV7A 3FMCA 1LT6D 1JWMD 1AZPA 3QWNA 4K6DA 5D3IB 3PF4A 4XQQA 1TWAH 1QJOA 1VQNA 5DM63 5LMUQ 4DR7L 2EVBA 3L2PA 2A69D 2QKIC 2IL8A 1PVOA 4UHVA 5HGQA 5IYDG 3I90A 1PH4A 3LWEA 2E76C 2HUGA 1AFPA 1PRTD 1L0YB 2MQHA 3D4WA 4O42A 4JI2L 4DGZA 4X62L 3HOWG 2R92B 3NBHB 1Y1VG 3KFUA 2LY7A 1ESRA 1N33L 3GTMH 4FNFA 1OXXK 4BBRH 4M8AA 1JB7A 3OHXC 5IYCG 2EYFA 1VQ6A 4KHVA 1R4PB 1SMYD 2N88A 3T1HL 3U4ZA 1YHBA 1X3GA 4C3IG 1PH6A 4B3MQ 4RMFA 3GO5A 3HG9A 3K8AA 4PZ7A 1YJ9A 3MWYW 1JQYD 4A3EG 1KLUD 2VB2X 2AHOB 5M3FB 1N32L 1PV4A 2F3WA 2E5LL 2MO1A 1Y1WG 1HA6A 1U4MA 2NWGA 3ERQA 3MFGA 3W5OA 3F2CA 3HOXB 3JAMc 1KTKA 1TS3A 1TS2A 1BCPF 1FGBD 2XWJB 3E5SA 3A8IE 1SNDA 1J5EL 4IPCA 5KGUA 4WJ3M 4EX5A 4BA1I 5M3MG 4JV5Q 1O7IA 4LF4L 2NVXB 1G8ZD 3CRLC 3MZ5A 4EQOA 1G6ZA 4ZQ3A 2F0DA 4JI8Q 4QMGA 1XTCD 2J4XA 2ATWA 3OWEB 4YWMA 2DY7A 3I4OA 3RLNA 4GKJL 3M7NA 2X69A 1G291 2M2LA 1NBWA 3E9IA 1B3AA 3R2TA 3I7FA 1STNA 4GKKQ 5EPLA 5C4JH 3QOJA 2E2HH 1Z7TA 4RHRA 2WFWA 2VZAA 2AMCB 1ONLA 2GA4B 1MBYA 5EKKA 2AUKA 1M4VA 1V9PA 1C4QA 5M3FG 4IFDH 2BE5D 2RDHA 3K58A 2Y0SB 5FO9B 4C56C 3NWSA 5CYUA 2SOBA 3CCMA 3OOCA 2N8NA 4QY7A 2L9HA 1UE5A 1X9NA 3HEJA 2CKZB 1SFOH 5T1IA 3K0XA 1EIHA 4A3IG 2LXKA 1YJNA 1RJTA 1STAA 3EQLC 1IBML 2Y0SE 1EQQA 5IWAQ 2L15A 1J9OA 1N34Q 1ASZA 1SJHD 1DJRD 3S1NH 1FYCA 4JI5Q 3GTLH 3OYYA 2UXBQ 3KOJA 2IY5B 1P8LA 1EFWA 4IQZA 4JI0Q 2R92G 5IT9E 4A3LH 4NXML 4RHSA 3NELA 5FO7B 4X3KA 3J81c 3PSIA 2HD3A 4LNQA 3OW7A 3S1QB 3KBGA 2RKSA 1EU3A 2EQSA 1B2TA 4XYQA 5BR8Q 4WFN3 3CPWA 2KHIA 1MJEA 2MO0A 1FD7D 4KY7A 4R4IA 1HR0L 1G51A 5GROA 3VR6A 4B3SL 4A76A 2JYOA 3BDCA 3NBHA 4C3JB 3A5ZB 3BZCA 5LMNL 3AMUA 1RODA 2NVYH 4OIKA 2I07B 4ZK9B 1VQ5A 1YI2A 1TVXA 2KCNA 5G3LF 3SR1A 5AJ3Q 5C3EH 2QF7A 4BBRB 2PQAB 3WOEA 2BA0A 4UPAA 4H7BA 3ITPA 4JI4Q 5IIFA 2Z8LA 4NB3A 1STBA 4IFDG 2E2JH 1MKHA 3GTMB 5JPMC 5ISRA 3AYHB 3TS2A 1H9RA 5IY0A 4NXNL 2LKVA 4K5WA 4C3HB 2HCCA 4OGQC 1E2WA 1H9MA 2F0TA 2F0LA 1XNQL 1NUCA 4IUUA 4J6HA 4DUYQ 2EYPA 4DR5L 4B3RL 1OXTA 1LO5D 5C3EG 1VQ7A 1PTOD 4BY1G 3FKIB 3CRKC 3MXNB 4CDDC 3RLFA 1HZBA 5FJ8H 3CCRA 3C3LA 4A3MH 4YHHQ 3H3VI 1X3QA 2NB0A 4KKUA 2NZ1D 1IYVA 1W6KA 4NDXA 5EBDA 3D8GA 1XJVA 3PO2H 2PQAA 4GOPB 5BR8L 3DM3A 5D65A 1VQMA 2IX0A 3PIO3 1HJPA 4ZUIA 1YNND 1YITA 4A3DG 4FP5D 3IAYA 1K0SA 3T16A 2NN6I 3GV6A 1M8AA 2G5DA 1SYCA 1UAPA 1K3BC 3A74A 1Z6HA 3GV3A 1Q8IA 1IYUA 2AWOA 5A2QL 1LTRD 2XN9C 5AJ3L 5CORA 4H13C 1DCZA 2NN6H 4A3LG 3H94A 1SYBA 3MTSA 5C4XG 4X62Q 2K5VA 3FKIH 3MXUA 2B63H 2PW5A 5EAYA 1WI5A 3EROA 4HMIA 4QUCA 5M5XB 4CDFC 4K2LA 2PNRC 3IKJA 1D5XC 3S2DB 3SGIA 2A8VA 1HFNA 3STBD 5IP7G 3D6CA 3DM1A 4F88A 1GUSA 2JE6I 1XMQL 1K8MA 2H4OA 5JEAH 1CSQA 1WYDA 5GAEC 1I3QH 3HOYG 3IFDA 1SYFA 3M4PA 1J6QA 1I5FA 1U0LA 1XTDA 1OXVA 1IHZA 2E5LQ 2R7FA 3WWVA 4XIGS 1BXTA 5C6AA 3EIVA 1QNKA 5E4XA 4KD4A 3CCVA 2JEBI 1S5BD 2CW0C 1W2BA 4IFDJ 3TSSA 2UUAL 5DEHA 3G6EA 1N33Q 3GTOH 4XDXA 3EN2A 2JA7G 4DAPA 1I6HB 2R61A 1LT4D 1QE6A 1Y69U 4ID6A 5DM73 1EWCA 2NVTB 1EWHA 3RZOB 4X3UA 2RHSB 4R8IA 1QOHA 5K36H 2K01A 1ENCA 3T13A 2HT1A 1I94L 2Y0SG 4MIUA 3H6MA 2RDFA 3S14H 3BDLA 4U68A 3HKZG 1TWHH 3J7ZC 4JC0A 2WKCA 1N8RC 2AQ2B 4IJHA 4LFAL 4CJ2C 1JOQA 1CM9A 1QWYA 2K5HA 2NZOA 4JOIA 3QIAA 1KHIA 2NYZD 1X3EA 3GQBA 4KKTA 2JN4A 1EQVA 2CH4W 1AZQA 4B3TL 2E74C 3KYHC 3I4NH 4BY7H 2QA4A 3ONAB 2AUJD 2A68D 1KLGD 3CW2C 3GTPH 3MXNA 3H3VH 4JVZA 1O7LA 2K5NA 4G57A 3RUZA 1RTOA 2F0QA 4MZ9A 1STGA 1VQLA 2BOSA 3OTOQ 2F0KA 3R3OA 3ULJA 3TS0A 5E1FA 3I4NG 3J80E 4Q0FA 1RCVD 1Q46A 3HOUG 2CQOA 5CBAE 1QCBD 1HNZQ 1S4ZA 3J80i 2CQAA 5FKAC 1EYAA 2VB3X 2PO4A 1HNXL 4LUOA 4JI1Q 1B70B 1C9OA 1V1QA 1W3SA 3UDFA 1EYGA 4A3IB 3ND8A 3SVMA 2VXWA 2F0WA 1QB5D 4C3JG 3UI2A 5FLXc 3GTPB 1FGUA 4UDUC 4DNIA 2QDLA 2J7ZA 3MAQA 2N49A 4LAAA 5IGFA 1PYBA 1WTHA 3EVQA 2GVBA 4ZCKA 1UUPA 1W6JA 3NPPA 4RKLA 4EQNA 1I4PA 1O80A 3KDFB 1VQAA 1GUTA 3RN2A 4L5QA 3DWQA 3GP7A 1PFBA 2VQEQ 4DV6L 3A54A 2C35B 3HOWH 2NBFA 4N9TA 2ENBA 1F2ZA 2OCEA 4CJ0B 1FR3A 2UUCL 1BVSA 1A15A 4DR4Q 2EIFA 3HOZB 2JA7B 2FJ2A 5C5LA 5LMNW 3FDTA 1CZGA 1GOZA 3SK5A 2UXCL 2BH2A 4AYBB 1X32A 2K28A 2F0IA 1I50B 1SE8A 2KVMA 5HY6A 1C48A 1QNUA 2UXDL 3S1MH 5CGKA 4PG3A 3K59A 4IOCA 1Q8KA 1NSNS 3BVZA 5J1ZA 2R93B 1GUNA 1HNZL 2HQEA 4RA8A 3I70A 5LMNQ 1L1OC 1H9JA 3D31A 4R9WA 4P73A 4BXXH 2DY8A 4XYOA 4QCLA 1S5FD 1F77A 3P20A 4KK7A 1DGSA 4KJOA 4A3DB 1UWVA 4DV1Q 2K04A 3HOVB 2EPBA 3CKIB 4NPSA 4C1NI 2R7ZB 2PW7A 2MNAA 1EEID 4CHTB 1PRTF 2KQ3A 4YCUA 5J3BA 1PMRA 1HH2P 1QVGA 3RZOH 4DV5L 2B2UA 2Z6BA 4GNXA 4BY1H 1MHWC 3S15B 2VS1A 1VQOA 4FF1A 4CBVA 1XYIA 3S1RB 3R2IA 1HPCA 3NE5B 4OX9L 2RVLA 4ILWA 1HTPA 3M9BA 1TWHB 3PCOB 1SR3A 3JC66 4A3CG 5M3MB 4N8FA 2UUCQ 5H1SE 5EQ0A 2EY6A 2ZTEA 1Y1WH 1CI3M 2G9HD 3QO2A 3HP3A 1V1OA 2EY1A 4YY3Q 1NAPA 4X6AH 4K0KL 3PUZA 2O4XA 2OF1A 2F3IA 1LV9A 1PTOC 1PZID 4XTCS 3TEHB 4C3IH 1JR0D 1HZ9A 4DV2Q 3K57A 5C44B 2R7DA 1B50A 4DU9A 2GN5A 4A3FG 3ZYYX 4RG1A 3P1HA 1LTAD 1CFMA 1PHJA 3CMEA 2JJQA 1A8VA 1VMPA 1T5XD 1TQOA 4FVMA 3IL8A 5M5WH 1DOKA 5C0XJ 2D0PA 4DXFA 5CV6A 2J0TD 3J7A5 2LXJA 3Q0AA 1AP0A 2ES2A 5IGDA 1CTMA 5KNBA 4DR1L 1HHVA 5I4DA 4O1NA 1V1PA 4DF7A 3HKZB 4Y7NH 1S40A 1VQJA 1Q90A 4DKAC 5IE8A 3W3AA 2Q8RE 3K80C 3DMUA 2JA5H 1EFID 1V8QA 1IXRA 4MHEA 1Q82C 5I2XA 2K1BA 2N55A 1CKNA 4G7ZC 2B8FA 2F0HA 1WD0A 1BBWA 4DR3Q 1U9RA 1Y1VB 2D2CC 4AH6A 3NK9A 1GUWA 4FF4A 1WTOA 1EL0A 1SE3A 4ULLA 1F9RA 4BBSG 3NTIA 3T1YL 3E0EA 1CHPD 1ZEQX 5ELFA 1RF2D 4FXDA 2ZTCA 1EEFD 3TDQA 2DN8A 1YJWA 2EE1A 3PV0A 5CBEE 1TWCH 1NMFA 3D0FA 2K6AA 4P75A 3F2BA 3K7AH 4B3TQ 5IYDH 4B9WA 3ULPA 3PO3B 1EOVA 4R4QA 4H02A 3UE1A 1HR0W 2B2WA 3Q22A 2JA6B 1PH2A 1ENFA 2F0PA 1IW7D 1PFSA 1EY6A 3CPFA 2EY5A 4UAIA 5EKLA 3H15A 2PYKA 5EJWA 1BBUA 1LTGD 4NP5A 2QEXA 3IFTA 1PH1A 2EYOA 4Y52H 4APVA 3J80L 4AQYQ 1SDFA 1EIGA 5KIXA 2E8GA 2KCMA 3QR8A 3I4LA 3OMGA 1WCMB 1JE4A 4A3DH 3N6RA 1A3UA 2KUMA 2UU9L 1LYLA 3J81L 1N32Q 2A5HA 4RGTA 4LF6Q 4IOAA 1EY0A 4HJ9A 2K50A 3TREA 4PMBA 3CD6A 2QDBA 3K0YA 4P74A 2ICEC 2JA8B 3OWFA 3HGBA 1VQHA 4CKBA 2BE5C 3D4RA 5GAHC 3M7GA 3NENA 3I4NB 3NHHA 2WIIB 3GTKH 2K4KA 4MNOA 4JBKA 2NVXH 2K5QA 3S1RH 2QILA 4X65L 5ELNA 3K5MA 3MXPA 5E7NA 3H3VC 4DV0L 3T1HQ 2IX1A 4GKJQ 1PYWD 2L1BA 3KJPA 1F9SA 1VQFA 3FPPA 3I73A 4MTNA 4K8IA 2BA1A 4LUVA 1JOOA 3HKZE 3HOZH 1DD2A 3BZDB 1PXUA 3P75A 4DAMA 1STHA 1U4LA 4JI1L 5CV9A 5C3XA 1MIUA 2AQ3B 2WKDA 4FDBA 1E2ZA 3ULLA 1E22A 2FHTA 2TMPA 1SYGA 1BQQT 2L55A 3HRZC 1TT2A 4TSSA 5FJ8G 1K8OA 5IT9L 3IRBA 4KY5A 4H44C 2JA8G 4PZ6A 4DK1A 4YIJA 3H0GH 1JWUD 3RR5A 3Q23A 2KOLA 3OSOA 3J81i 3EBEA 2VUMG 4F8MA 2LMCB 3UE0A 4JI3Q 4V190 3HOYH 1NR2A 3HZXA 1K9MC 3S24A 2A6EC 4GKKL 1EY9A 4HCSA 3HOVG 1D7QA 3NSWA 4PMCA 3A8KE 2ZJQA 1D8LA 4RWSC 2F0OA 2UU9Q 3C1FA 1JT8A 1LUZA 1YHAA 2M00A 4DR2Q 1H9KA 2Q2IA 1B7YB 3DWAA 3PF5A 1FJGL 3O13A 2JA7H 1BUVT 2JSOA 4YCWA 1GJXA 4K5XA 2F0GA 1CQVA 1NNXA 4WORA 1ET9A 4QIWE 4EGVA 1XPOA 3BJUA 1OXSC 3VR2A 1ML0D 1GHJA 4F87A 2B3GA 4HEDA 3H0GG 3SXHA 2N78A 1VQ8A 1GKHA 2KENA 2R92H 5C4HA 1WTXA 5EKIA 4BXXG 2DNCA 1EY4A 1SJED 4O2DA 1IBMQ 2IW3A 4N8X1 3KUPA 4LF5Q 4XQNA 1U4RA 4OIJA 1KIXA 2HHHL 3CHBD 3C1EA 4ME5A 3K5LA 4WRDA 4IALA 5IWAL 1A62A 1HXYD 4YCVA 2A19A 4R1JA 3S16H 1X55A 1HRJA 2FFKB 2QEJC 4DV7L 2B2TA 4JI5L 2UXBL 4GLVB 4KN4C 3CCEA 4CKEA 4A3FB 2K32A 2MUYA 4QB4A 1R4QB 4HCEA 5C44H 2PZUA 2RA4A 5JVG3 4J8QA 2MP1A 4C2MB 3RZDB 4HIMA 4G7HC 3W1BA 2B2UC 4LFCL 4ODGA 1DM0B 3KF8A 3VA7A 1ILQA 4UP8A 2QCPX 1K83H 2ZXOA 1E0BA 4FF2A 3SEBA 4LF7Q 2JP1A 5JAVA 1QZHA 2Z4IA 4KN7C 1EZ6A 2IWHA 1NTGA 2HCIA 1X3FA 2XNAC 3R8BA 4POFA 2KEEA 3CXCA 1D2BA 2JA5B 2ZXPA 2RSNA 4A4IA 3V05A 4BBRG 3M4OH 5C44G 1H95A 3CC4A 4QF4A 4CJ1B 1BR9A 4XQJA 1VQPA 2AQ1B 2SNSA 4K0KQ 5J22A 5IP9G 2JQOA 1IL2A 1X65A 1OTCA 5KNDA 3M4YA 2VUMH 1EY8A 1V43A 2K14A 2CVRA 5C0XI 3K6OA 2ZT9C 3DUZA 2E75C 4LF5L 5BN3A 4OO1I 4R4CA 4B3ML 3Q6SA 4X64L 3MHBA 3BZKA 2VQFL 2JA6G 2O2LD 1GHKA 1ILPA 5IGCA 5C4ZA 1TWGB 1KDBA 5BN5A 3CCLA 3MEHA 1FL0A 1LTID 5ELEA 2DJFC 5AFWA 2Z4HA 4JBWA 2EXDA 4YHHL 1NMGA 2B2VA 2PZTA 4IN3A 3HOXG 1O7YA 1PH7A 4Y7NB 1X3PA 4C1NK 5IOCA 3NTKA 4DPGA 3OIPA 4J1MA 1A3VA 5IGEA 2DUDA 4OEMB 4ZYSA 4L5SA 2F1MA 3AEVA 1I4GA 1B44D 3KDFA 2IHEA 3KLSA 3CQZB 1A0IA 4AQYL 2QGQA 3Q24A 1XMQQ 2F0SA 4HSVA 3AB9A 1ESFA 3QG1A 3S1QH 3PUWA 2R3ZA 1L0WA 3VR4A 3LWUA 2RQXA 4OONA 2X6GA 2E2IB 1S5CD 3CF5A 3GD7A 1AE3A 4MN3A 5C4XB 1SE4A 1EY7A 5E3FA 3E3XA 4LF6L 2JA9A 1N9WA 1LT5D 2GVAA 3J81j 1EIFA 2Z0SA 5GQOA 2B2YC 3DLLA 1K0RA 4B08A 4A3GB 1ICFB 1YNNC 2WAQG 1BOSA 3BYTB 3QJYA 4GOPC 4LF9L 4GZYC 4C3HH 3I56A 3G48A 1T5EA 3T51B 1K28A 1TWAB 3K7UC 1E24A 2LSSA 2XSCA 3KF6B 1CA5A 2OTJA 2PZWA 4X65Q 2VQFQ 5M5YB 4KI0A 1K73C 5CMDA 3S2DH 4DV0Q 2WAQE 4I7AA 5LHY1 2I0QA 2JA5G 4KLKA 1PFMA 2XTIA 3MC0B 1EUJA 1XXGA 1LLRD 1SROA 5DAUA 2L11A 3ZJYC 4PMWA 1FNWA 3CCSA 1CT1D 2A68C 4KMUC 3NBIA 1X56A 3I8ZA 3OIQA 3Q8DA 3SE0A 2C9OA 4L5TA 4JI7Q 2WACA 4JPBW 4IUVA 1E2VA 3A7AB 5ELBA 3VDYA 4BY7B 4RFBA 2Q2UA 1BF4A 3GTOB 5FLXE 4KHZA 1Q7YC 1I6HH 1STYA 4HSPA 2FINB 5FLXL 1WJJA 1QZGA 1SMXA 5JJIA 5M3FH 2R93H 4X66L 1UE7A 3B6YA 4IUNA 4WJWA 2OQ0A 1TWCB 1HNXQ 1B9MA 3S14B 3GTLB 4LFAQ 3G71A 2AKWB 1PH8A 1QG7A 1B3QA 1JMCA 5FOBB 1Z47A 4CDEC 2F0NA 1ICWA 4IUTA 4A3IH 4DA2A 2L0CA 1JICA 4BA2I 1AW7A 3AU7A 2XRQD 4I65A 2A6HC 5M9OA 2B63B 2EYMA 2WV6D 3FPUB 4OWWB 2PMZB 4HIOA 3FP9A 2CW0D 2BDOA 3KLRA 5E4WC 2H5XA 1STEA 4RCOA 4HR7B 3OTOL 1IW7C 1F2LA 3N52A 3TP6A 4C3HG 3JAMi 1A2TA 4AYBE 1SAPA 1KRTA 3C2PA 2RSOA 3JAME 2EZVA 1UEAB 1UEBA 1X54A 1I4RA 4KTAA 2VQEL 1D1IA 4DAYA 3OMCA 1VF5C 1ENAA 1IL8A 2Z6KC 4FXKC 2B8GA 2KHJA 4OWTB 5F2DA 4IO9A 1U5KA 3TZUA 3FEWX 1CUKA 2OT2A 3GTGH 3PUXA 2VY3A 1G2TA 2A74C 5JPNC 1P16A 4RCNA 4P2CB 1EWIA 3V96A 4LFCQ 2WB1B 1XNRL 2UXDQ 1QUQA 3F2UA 4R4TA 1E1OA 4GLXA 2HHHQ 4QIWB 5C4XH 1AE2A 1VMCA 4L63B 3S16B 3HFZB 4YWLA 4TQUS 4PNYA 1UE1A 2UXCQ 3KK7A 4XT3B 4DV6Q 1FVIA 3H91A 4WJ4A 1VQCA 5I9PA 3I2ZA 4GS3A 3K5NA 2UUBL 3FHWA 2YTVA 2CWPA 5GADC 2F52A 4AYBG 4DR6L 1SRUA 1LTTD 4JI6Q 2PMZE 3GTGB 1DOLA 1L2FA 1H9SB 1YVCA 1JOKA 2L5TA 3PO2G 1CKMA 1K83B 1D5MC 3LGJA 3EFXD 4DXGA 2Q8TA 2R93G 1LTBD 3TP8A 3I3CA 4DFAA 1N34L 5M5YH 5J39A 5KYLA 3NXWA 4N9PA 2A6ED 1B4OA 5CV8A 3STBC 3BG3A 1A63A 2NVTH 3A56A 1PTOH 5HURA 2WP8J 1SNCA 3KLWA 5GAGC 4YY3L 1JJ2A 4JW0A 3U50C 2YTYA 4OO1H 1VDZA 4KJNA 2E2JB 1KRSA 1Q1BA 2MFIA 3L3OC 3HOVH 1SXTA 2K52A 5L37A 3VYRA 4I7ZC 5C4JB 2E2HB 5LMUL 4DR7Q 3DWPA 3BDOA 3SHLA 2FMCA 2RBMA 4V0BA 2EJMA 4L8JA 3LX0A 2KJXA 1XMOQ 1PH5A 2BH8A 5EPKA 4DV3Q 2D9UA 5LL6S 2PQEA 1F9QA 4JBJA 4RAUC 4OX9Q 1RKNA 3G6JB 1AN8A 4RGOS 4LUZA 1D5ZC 1WOCA 3A55A 1GO3E 2HIVA 1H9SA 2B39A 1RL2A 2F0FA 4A3FH 2UUBQ 3J7AV 1ZYRD 4IPHA 2SDFA 3C46A 3NQIA 3K81C 4A3MB 5IYBH 5KYIA 4OL7A 2XRSD 3J7YW 1B9NA 1EQTA 1EIYB 5JEAJ 2H1EA 4E6IA 4JOIC 2K33A 4QQBX 4KKSA 1DYQA 4NKLA 1S72A 3V2TA 1VQEA 2I5HA 3VA5A 2O5IC 3KF8B 1ZKOA 4CDCC 2F0JA 2MHVA 4DUZQ 2QW7A 2E2IH 4JI2Q 2OTLA 1Q1EA 2WAQB 1CK1A 1JJCB 4PV1C 3BVMA 4K2KA 3T4AC 3QB3A 1WCMG 3K5OA 5G3LD 4DR1Q 1EOTA 3K7AB 2MJ8A 4IJLA 4LF4Q 2JA6H 5M5XH 1PTOB 1TS4A 1B8AA 3DHQA 2MGSA 2KCTA 2Z6KA 5CV4A 4DK0A 4A3MG 3S15H 4J15A 1MSGA 2OQKA 2CHBD 3NP8A 5JEAG 5D14A 1BBXC 1WTVA 3T1YQ 5BN4A 3E0JA 3KLSX 2EY2A 4JI8L 5IT9c 3UDGA 3TP5A 1IKLA 4GN4B 4LFBQ 5FLMH 4K14A 1KNEA 4DNTB 5IGGA 5DLQE 4X3SA 5JJLA 5KRUA 4BY7G 4KHPQ 1GD7A 3A0JA 1SNMA 2F0MA 5FO8B 2ICIA 3VYTA 1GXDC 1XPUA 4JBMA 3TP7A 5C5MA 3BS1A 1WTWA 1FNVA 1BDOA 1EU4A 3LNNA 4LF8L 5ELCA 4QJFA 1YBYA 2EYHA 2K03A 1G6PA 4A3BB 4LW1A 1KXLA 2NUCA 4X66Q 1II3A 5FLMG 2YTXA 3NUCA 1FNUA 1LT3D 5IP7H 1WTPA 5KNCA 2OWOA 2A73B 2NN6G 1AH9A 2TSSA 3S17B 3WDNA 1R9TB 1UE6A 3CC2A 3PMFA 5T1GA 2B63G 4FXGC 4LWCA 3MXGA 2A69C 1ASYA 4DNRB 2UUAQ 1TWFH 1XX8A 1NY4A 2PPBC 4HJ8A 1AEXA 5IYBG 4JI0L 1SSOA 2JK8A 2F03A 2HDMA 4ZKCB 1GM5A 3M4QA 1HNWQ 1Y8OB 3AFPA 1Y8NB 1KAAA 3L0OA 3J81E 5C3WA 1HR0Q 1VQIA 1ET6A 1OO9B 2I5MX 4RKBA 4A3CH 2PI2A 4LFBL 1OXUA 1QVCA 1WFQA 1XNRQ 1GVPA 3S2HB 1HUNA 1LM0A 3OPOA 3S1NB 3HS0C 1Y8PB 2PNHA 4DV4L 4KHPL 5HGTA 4DR2L 1IZ6A 2ALYB 3PQIA 4HMJA 1YIJA 1HTLD 2MPMA 4GOPA 2WB1G 3EA6A 1PH9A 3U9SA 2F0EA 1KC8C 4DR6Q 2LS01 3AQQA 1EZ8A 4HJ5A 2DGYA 4DAYB 2EOTA 3AFQA 3MFYA 1G2SA 4DV2L 2NTSA 1K8AC 4A3EH 2FMMA
chains in the Genus database with same CATH topology
3HOWG 2GVAA 3NBHB 3J81j 1Y1VG 1EIFA 1HNZL 3KFUA 3S2HH 2Z0SA 1CKOA 1N33L 5LMNQ 5GQOA 3DLLA 3GTMH 4UP7A 1K0RA 1OXXK 1L1OC 3D31A 2WAQG 4P73A 4BBRH 1VQ4A 4BXXH 1JB7A 3UDIA 4GOPC 5IYCG 4LF9L 3RNUA 1VQ6A 4C3HH 3M3YH 3I56A 4DUYL 3OW2A 1VQGA 3G48A 1DGSA 3T1HL 2V1CC 1UWVA 4PG3A 3U4ZA 1YHBA 1X3GA 5M3MH 3K7UC 4DV1Q 4RMFA 1PH6A 4B3MQ 1E24A 2LSSA 3GO5A 3K8AA 3KF6B 4PZ7A 1YJ9A 4JI4L 2OTJA 4X65Q 2VQFQ 4NPSA 1VQBA 4KI0A 1K73C 4A3EG 3S2DH 2MNAA 1I50H 4OXPA 4DV0Q 2AHOB 4A93G 2WAQE 3RLOA 4JI6L 4C2MH 3RZDH 1N32L 1PV4A 1XPRA 2I0QA 4YCUA 2E5LL 5J3BA 2MO1A 2JA5G 4KLKA 1Y1WG 1HH2P 2XTIA 1QVGA 1EUJA 3W5OA 3F2CA 4BBSH 2F4VL 4IPGA 3JAMc 1SROA 3RZOH 4DV5L 3ZJYC 4PMWA 4GNXA 3CCSA 4BY1H 4A93H 2VS1A 1VQOA 1X56A 1YNXA 1J5EL 4IPCA 3Q8DA 2ZJPA 4WJ3M 4EX5A 4BA1I 5M3MG 4OX9L 4JV5Q 4L5TA 4DR5Q 1O7IA 4GN5A 4B3RQ 4JI7Q 4LF4L 3I4MH 3VDYA 3M9BA 3PCOB 3CMAA 2VW9A 1SR3A 2Q2UA 3JC66 4A3CG 4JI8Q 2ATWA 4KHZA 1Q7YC 2RCNA 2UUCQ 4YWMA 5H1SE 1RIPA 1I6HH 3I4OA 2ZTEA 3RLNA 1Y1WH 4GKJL 3M7NA 4TVAB 1WJJA 4YY3Q 3CCUA 4GLAC 1G291 2HIXA 1QZGA 1SMXA 1NBWA 4JYAL 4X6AH 1IBKL 5M3FH 4K0KL 5JJIA 3PUZA 4X66L 3E9IA 2R93H 2F3IA 3I7FA 1UE7A 3B6YA 4GKKQ 1CSPA 5C4JH 4XTCS 2ZM6L 2E2HH 1VCIA 3TEHB 4C3IH 2WFWA 2VZAA 2OQ0A 1HZ9A 2YU9H 4DV2Q 2AMCB 1HNXQ 2IT1A 4LFAQ 3G71A 2AKWB 1PH8A 1V9PA 1E3PA 2R7DA 4EQ5A 5M3FG 1JMCA 1Z47A 2GN5A 4JG2A 4O0AA 4L5RC 1X6OA 4A3FG 4RG1A 3PGZA 1PHJA 3CMEA 2JJQA 1KD1C 1A8VA 4A3IH 1XMOL 4BA2I 3W1GA 5M5WH 4X64Q 1N36L 3BU2A 1JE5A 5C0XJ 3CCMA 2N8NA 2D0PA 4QY7A 1UE5A 3J7A5 1X9NA 4OWWB 4HIOA 2LXJA 3FP9A 2CKZB 4HIDA 1SFOH 3K0XA 4A3KH 4A3IG 2H5XA 2ES2A 4DR1L 2LXKA 1YJNA 4JCVE 3OTOL 3GTQH 2YV5A 1KAWA 4Y7NH 1S40A 1BKBA 1VQJA 1IBML 3JAMi 4AYBE 4DKAC 2Y0SE 5IE8A 1KRTA 1EQQA 3K80C 5IWAQ 2JA5H 2CWAA 2L15A 3NEMA 4HJAA 1N34Q 1ASZA 1IXRA 4YWKA 1Q82C 3S1NH 1UEBA 1CKNA 1X54A 3OYYA 3KOJA 5ELOA 4JI5Q 3GTLH 2UXBQ 2IY5B 1P8LA 2VQEL 4DV5Q 1BBWA 4DR3Q 1EFWA 4JI0Q 4AH6A 2R92G 2R6GA 4A3LH 3KJOA 4NXML 3NELA 1Q86C 2Z6KC 2KHJA 4OWTB 1WCMH 4DUZL 4IO9A 3J81c 4BBSG 1U5KA 3T1YL 1I94Q 3PSIA 3E0EA 1LTLA 4LNQA 1CUKA 3GTGH 3PUXA 2VY3A 4ME3A 4A3KG 2CFMA 2ZTCA 3E9HA 2EQSA 1CKNB 1P16A 3PV0A 1YJWA 5BR8Q 3CPWA 1MJEA 2KHIA 1EWIA 2ID0A 1TWCH 5JJKA 3PIPA 4LFCQ 1NMFA 2MO0A 3D0FA 1XNRL 4P75A 5K36G 2UXDQ 4R4IA 1QUQA 1G51A 1VS0A 3K7AH 5GROA 3F2BA 4A3JG 1HR0L 4B3TQ 5IYDH 4R4TA 1E1OA 1HZCA 4GLXA 3ULPA 1EOVA 4R4QA 4H02A 3UE1A 5C4XH 4A76A 1HR0W 3PIOA 1PH2A 3A5ZB 1S3OA 1AE2A 3BZCA 2NVYH 5LMNL 1C7YA 1PFSA 3HFZB 1L1OA 3CPFA 4A75A 1YI2A 1VQ5A 2CCZA 3H15A 4YWLA 4TQUS 4OWXB 1BBUA 3GTJH 1UE1A 5C3EH 5AJ3Q 3CAMA 2QEXA 1PH1A 4LF9Q 4DV6Q 2UXCQ 4Y52H 1FVIA 4APVA 4WJ4A 2A1AA 1Y1VH 4JI3L 1VQCA 2PQAB 2BA0A 3I2ZA 4GS3A 3S17H 4AQYQ 2UUBL 4UPAA 3FHWA 2YTVA 1PH3A 2CWPA 4JI4Q 2Q2HA 2E8GA 5GADC 2KCMA 2HQLA 2F52A 3PUYA 4AYBG 4NB3A 4A3DH 2ZTDA 4DR6L 3F8TA 1SRUA 2UU9L 4IFDG 1LYLA 2E2JH 4JI6Q 1N32Q 1MKHA 4LF6Q 2PMZE 4IOAA 1L2FA 1YVCA 4HJ9A 3PO2G 2K50A 3TREA 3AYHB 1CKMA 3CD6A 3TS2A 2VL6A 4P74A 4NXNL 5IY0A 3LGJA 1FJGQ 4ALPA 3CC7A 3PO3H 4OO1G 2R93G 1VQHA 3TRZA 5GAHC 3NENA 3FKIG 4A3BG 1N34L 1XNQL 5M5YH 5C0XG 2K4KA 4DUYQ 3GTKH 2B29A 4MNOA 4DR5L 4B3RL 4JBKA 4JI7L 2NVXH 1OXTA 5C3EG 1VQ7A 1VQ9A 1IYJB 4LF8Q 4DR3L 3S1RH 4BY1G 4X65L 3STBC 5ELNA 3MXNB 3F2DA 1A63A 5E7NA 4A3BH 3RLFA 4DV0L 3T1HQ 2IX1A 2NVTH 1HZBA 5FJ8H 3CCRA 4GKJQ 4A3MH 2WP8J 4YHHQ 3KLWA 3L7ZC 5GAGC 1VQFA 3KJPA 4MTNA 3H3VI 4YY3L 1JJ2A 3U50C 1KQSA 4B3SL 2YTYA 1L1OB 2BA1A 4LUVA 3HKZE 3A5UA 3HOZH 4DAMA 4DV4Q 1XJVA 3PO2H 2PQAA 4GOPB 4JI1L 4UP9A 5BR8L 1KRSA 3DM3A 1VQMA 1Q1BA 2IX0A 2MFIA 4GN3B 3HOVH 2K52A 4DV7Q 1MIUA 4X62L 2JA8H 1HJPA 1SLJA 1YITA 4A3DG 3PO3G 4FDBA 3HOZG 5LMUL 3ULLA 4DR7Q 1E22A 3UDXA 2NN6I 2KBNA 3HKSA 1J5EQ 1XMOQ 1PH5A 2BH8A 3A74A 5FJ8G 4DV3Q 4POGA 1HNWL 4JBJA 3IRBA 2AWOA 4OX9Q 4UY8C 3PUVA 2JA8G 4JV5L 4PZ6A 3H0GH 4LUZA 3RR5A 5AJ3L 1WOCA 3J81i 3EBEA 2VUMG 4A3LG 1GO3E 2HIVA 3UE0A 4JI3Q 5C4XG 3HOYH 1RL2A 2K5VA 4X62Q 3FKIH 4A3FH 4AIMA 2UUBQ 1K9MC 4IPHA 3S24A 2B63H 2NZHA 4GKKL 3HOVG 1D7QA 3K81C 2ZJQA 4LF7L 2Q2TA 5EAYA 1D8LA 1WI5A 5IYBH 2UU9Q 3CQZH 1QVFA 3ERSX 1Z9FA 1EIYB 5JEAJ 4PZ8A 1JT8A 4JOIC 1LUZA 1YHAA 4DR2Q 3SGIA 2A8VA 3STBD 5IP7G 2Q2IA 1B7YB 1VQDA 4IPDA 3PF5A 4QQBX 4DV1L 1FJGL 4HJ7A 1S72A 4DR4L 1VQEA 2JE6I 4A3JH 1XMQL 3CP0A 2JA7H 2I5HA 1CSQA 4YCWA 4NXMQ 3CCQA 1WYDA 4QL5A 1YHQA 2ZJRA 4QIWE 1I3QH 5GAEC 3BJUA 1OXSC 1K3RA 3KF8B 3G4SA 1XPOA 3M4PA 2K75A 3HOYG 2R7ZG 1J6QA 1I5FA 1U0LA 1XTDA 1OXVA 2AWNA 3HOUH 2B3GA 2E5LQ 2R7FA 3WWVA 4DUZQ 3TQYA 4XIGS 3H0GG 2N78A 2E2IH 3MEFA 3EIVA 2F4VQ 1TXYA 1VQ8A 1GKHA 2KENA 2R92H 4JI2Q 2OTLA 1Q1EA 3CCVA 1JJCB 2JEBI 4BXXG 4O2DA 1IBMQ 1NE3A 1W2BA 4IFDJ 2UUAL 1WCMG 1IBLQ 4DR1Q 4LF5Q 3M85A 3G6EA 1N33Q 3GTOH 1E1TA 3EN2A 4IJLA 2JA7G 1KIXA 2HHHL 4B3SQ 2YYZA 4LF4Q 4C3JH 2JA6H 5M5XH 4HIKA 5IWAL 1R9TH 1A62A 1B8AA 4YCVA 4QGUA 4P72A 2A19A 4R1JA 2RHSB 1X55A 2KCTA 2Z6KA 4A3MG 1M1KC 3S15H 4DV7L 4J15A 2FXQA 4JI5L 4GLVB 2OQKA 2UXBL 5JEAG 2HT1A 2D62A 3CCEA 2ASBA 3T1YQ 1I94L 2Y0SG 4DK6C 4JYAQ 4JI8L 5C44H 3S14H 5IT9c 1NJIC 1C0AA 3HKZG 1TWHH 4DK3C 3UDGA 4GN4B 1MJCA 4HIMA 4LFBQ 3J7ZC 2ZM6Q 5IP9H 3W1BA 5FLMH 4JC0A 3GDEA 1N8RC 5DLQE 4LFCL 5JJLA 1IBKQ 4IJHA 4LFAL 4UP8A 4BY7G 4KHPQ 2K5HA 1Q12A 2NZOA 4JOIA 1GD7A 1K83H 4R4OA 3ICEA 3A0JA 1KHIA 1T9HA 1X3EA 1YEZA 3ER0A 3F1ZA 4LF7Q 4B3TL 1QZHA 3KYHC 1XPUA 1TWGH 4JBMA 3I4NH 4BY7H 2QA4A 3CW2C 1NTGA 3GTPH 1X3FA 2JEAI 3H3VH 2K5NA 4POFA 3CXCA 1N36Q 2N3SA 4LF8L 2WB1E 4QJFA 4MZ9A 1VQLA 4A4IA 3OTOQ 3RN5A 4BBRG 1YBYA 3ULJA 3TS0A 3M4OH 3I4NG 2I5LX 5C44G 5IYCH 1G6PA 1H95A 3CC4A 3U4VA 4LW1A 1Q46A 1VQPA 2XGTA 4K0KQ 1KXLA 3HOUG 4X66Q 1JJGA 2CQOA 5IP9G 2JQOA 2YTXA 5IP7H 1X65A 5FLMG 1HNZQ 1OTCA 1IL2A 4P71A 3J80i 1VQKA 1M90C 1YZ6A 2OWOA 2NN6G 2VUMH 1AH9A 1V43A 2K14A 1HNXL 2PI2E 4LUOA 5C0XI 4A3GG 1UE6A 3CC2A 4JI1Q 1B70B 2B63G 1C9OA 1HZAA 1V1QA 4LWCA 1ASYA 1W3SA 2UUAQ 2VNUD 3UDFA 1IBLL 1E7ZA 4LF5L 4OO1I 1TWFH 4NXNQ 4R4CA 1NY4A 1EYGA 4HJ8A 4B3ML 1SN8A 5IYBG 2RF4A 4X64L 4JI0L 3BZKA 3CCJA 2VQFL 2JK8A 2JA6G 5FLXc 1GM5A 2NVQH 1PA6A 3HOXH 1FGUA 3M4QA 4DNIA 1Q81C 3CCLA 1XNQQ 4DV3L 1HNWQ 1FL0A 3AFPA 4IFDI 3J80c 4GNXB 2N49A 1EQRA 4JBWA 2EXDA 3L0OA 1PYBA 4YHHL 2IHFA 2GVBA 1NMGA 1HR0Q 1VQIA 3U58A 2R7ZH 3HOXG 2I5MX 1PH7A 4GNXC 2D0OA 4A3CH 3I55A 2PI2A 4LFBL 3KF6A 4DPGA 1VQAA 3KDFB 1Y14B 1OXUA 1QVCA 3RN2A 1WFQA 4L5QA 1GVPA 1KL9A 1QUQB 1XNRQ 2DUDA 4L5SA 1LM0A 3AEVA 1PYSB 2HHHQ 3S16H 4A3GH 2PNHA 3KDFA 2RHQB 2VQEQ 4DV4L 4DV6L 3I4MG 2C35B 3HOWH 2IHEA 4KHPL 1K8GA 4DR2L 1A0IA 1IZ6A 2OCEA 2ALYB 4AQYL 2QGQA 2UUCL 1BVSA 4DR4Q 2EIFA 1YIJA 3PF4A 1XMQQ 5LMNW 1TWAH 2UXCL 1VQNA 5LMUQ 2WB1G 4GOPA 1PH9A 3L2PA 3S1QH 4DR7L 1KC8C 2BH2A 4DR6Q 1PVOA 3PUWA 5HGQA 5IYDG 1L0WA 3AQQA 4HJ5A 2DGYA 1PH4A 4DAYB 4OONA 1SE8A 3AFQA 3CF5A 2MQHA 3GD7A 1AE3A 5HY6A 4JI2L 4DV2L 1K8AC 4A3EH 4LF6L 3S1MH 2UXDL 2JA9A 1N9WA 4IOCA 1Q8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW G;  2GVA A;  3NBH B;  3J81 j;  1Y1V G;  1EIF A;  1HNZ L;  3KFU A;  3S2H H;  2Z0S A;  1CKO A;  1N33 L;  5LMN Q;  5GQO A;  3DLL A;  3GTM H;  4UP7 A;  1K0R A;  1OXX K;  1L1O C;  3D31 A;  2WAQ G;  4P73 A;  4BBR H;  1VQ4 A;  4BXX H;  1JB7 A;  3UDI A;  4GOP C;  5IYC G;  4LF9 L;  3RNU A;  1VQ6 A;  4C3H H;  3M3Y H;  3I56 A;  4DUY L;  3OW2 A;  1VQG A;  3G48 A;  1DGS A;  3T1H L;  2V1C C;  1UWV A;  4PG3 A;  3U4Z A;  1YHB A;  1X3G A;  5M3M H;  3K7U C;  4DV1 Q;  4RMF A;  1PH6 A;  4B3M Q;  1E24 A;  2LSS A;  3GO5 A;  3K8A A;  3KF6 B;  4PZ7 A;  1YJ9 A;  4JI4 L;  2OTJ A;  4X65 Q;  2VQF Q;  4NPS A;  1VQB A;  4KI0 A;  1K73 C;  4A3E G;  3S2D H;  2MNA A;  1I50 H;  4OXP A;  4DV0 Q;  2AHO B;  4A93 G;  2WAQ E;  3RLO A;  4JI6 L;  4C2M H;  3RZD H;  1N32 L;  1PV4 A;  1XPR A;  2I0Q A;  4YCU A;  2E5L L;  5J3B A;  2MO1 A;  2JA5 G;  4KLK A;  1Y1W G;  1HH2 P;  2XTI A;  1QVG A;  1EUJ A;  3W5O A;  3F2C A;  4BBS H;  2F4V L;  4IPG A;  3JAM c;  1SRO A;  3RZO H;  4DV5 L;  3ZJY C;  4PMW A;  4GNX A;  3CCS A;  4BY1 H;  4A93 H;  2VS1 A;  1VQO A;  1X56 A;  1YNX A;  1J5E L;  4IPC A;  3Q8D A;  2ZJP A;  4WJ3 M;  4EX5 A;  4BA1 I;  5M3M G;  4OX9 L;  4JV5 Q;  4L5T A;  4DR5 Q;  1O7I A;  4GN5 A;  4B3R Q;  4JI7 Q;  4LF4 L;  3I4M H;  3VDY A;  3M9B A;  3PCO B;  3CMA A;  2VW9 A;  1SR3 A;  2Q2U A;  3JC6 6;  4A3C G;  4JI8 Q;  2ATW A;  4KHZ A;  1Q7Y C;  2RCN A;  2UUC Q;  4YWM A;  5H1S E;  1RIP A;  1I6H H;  3I4O A;  2ZTE A;  3RLN A;  1Y1W H;  4GKJ L;  3M7N A;  4TVA B;  1WJJ A;  4YY3 Q;  3CCU A;  4GLA C;  1G29 1;  2HIX A;  1QZG A;  1SMX A;  1NBW A;  4JYA L;  4X6A H;  1IBK L;  5M3F H;  4K0K L;  5JJI A;  3PUZ A;  4X66 L;  3E9I A;  2R93 H;  2F3I A;  3I7F A;  1UE7 A;  3B6Y A;  4GKK Q;  1CSP A;  5C4J H;  4XTC S;  2ZM6 L;  2E2H H;  1VCI A;  3TEH B;  4C3I H;  2WFW A;  2VZA A;  2OQ0 A;  1HZ9 A;  2YU9 H;  4DV2 Q;  2AMC B;  1HNX Q;  2IT1 A;  4LFA Q;  3G71 A;  2AKW B;  1PH8 A;  1V9P A;  1E3P A;  2R7D A;  4EQ5 A;  5M3F G;  1JMC A;  1Z47 A;  2GN5 A;  4JG2 A;  4O0A A;  4L5R C;  1X6O A;  4A3F G;  4RG1 A;  3PGZ A;  1PHJ A;  3CME A;  2JJQ A;  1KD1 C;  1A8V A;  4A3I H;  1XMO L;  4BA2 I;  3W1G A;  5M5W H;  4X64 Q;  1N36 L;  3BU2 A;  1JE5 A;  5C0X J;  3CCM A;  2N8N A;  2D0P A;  4QY7 A;  1UE5 A;  3J7A 5;  1X9N A;  4OWW B;  4HIO A;  2LXJ A;  3FP9 A;  2CKZ B;  4HID A;  1SFO H;  3K0X A;  4A3K H;  4A3I G;  2H5X A;  2ES2 A;  4DR1 L;  2LXK A;  1YJN A;  4JCV E;  3OTO L;  3GTQ H;  2YV5 A;  1KAW A;  4Y7N H;  1S40 A;  1BKB A;  1VQJ A;  1IBM L;  3JAM i;  4AYB E;  4DKA C;  2Y0S E;  5IE8 A;  1KRT A;  1EQQ A;  3K80 C;  5IWA Q;  2JA5 H;  2CWA A;  2L15 A;  3NEM A;  4HJA A;  1N34 Q;  1ASZ A;  1IXR A;  4YWK A;  1Q82 C;  3S1N H;  1UEB A;  1CKN A;  1X54 A;  3OYY A;  3KOJ A;  5ELO A;  4JI5 Q;  3GTL H;  2UXB Q;  2IY5 B;  1P8L A;  2VQE L;  4DV5 Q;  1BBW A;  4DR3 Q;  1EFW A;  4JI0 Q;  4AH6 A;  2R92 G;  2R6G A;  4A3L H;  3KJO A;  4NXM L;  3NEL A;  1Q86 C;  2Z6K C;  2KHJ A;  4OWT B;  1WCM H;  4DUZ L;  4IO9 A;  3J81 c;  4BBS G;  1U5K A;  3T1Y L;  1I94 Q;  3PSI A;  3E0E A;  1LTL A;  4LNQ A;  1CUK A;  3GTG H;  3PUX A;  2VY3 A;  4ME3 A;  4A3K G;  2CFM A;  2ZTC A;  3E9H A;  2EQS A;  1CKN B;  1P16 A;  3PV0 A;  1YJW A;  5BR8 Q;  3CPW A;  1MJE A;  2KHI A;  1EWI A;  2ID0 A;  1TWC H;  5JJK A;  3PIP A;  4LFC Q;  1NMF A;  2MO0 A;  3D0F A;  1XNR L;  4P75 A;  5K36 G;  2UXD Q;  4R4I A;  1QUQ A;  1G51 A;  1VS0 A;  3K7A H;  5GRO A;  3F2B A;  4A3J G;  1HR0 L;  4B3T Q;  5IYD H;  4R4T A;  1E1O A;  1HZC A;  4GLX A;  3ULP A;  1EOV A;  4R4Q A;  4H02 A;  3UE1 A;  5C4X H;  4A76 A;  1HR0 W;  3PIO A;  1PH2 A;  3A5Z B;  1S3O A;  1AE2 A;  3BZC A;  2NVY H;  5LMN L;  1C7Y A;  1PFS A;  3HFZ B;  1L1O A;  3CPF A;  4A75 A;  1YI2 A;  1VQ5 A;  2CCZ A;  3H15 A;  4YWL A;  4TQU S;  4OWX B;  1BBU A;  3GTJ H;  1UE1 A;  5C3E H;  5AJ3 Q;  3CAM A;  2QEX A;  1PH1 A;  4LF9 Q;  4DV6 Q;  2UXC Q;  4Y52 H;  1FVI A;  4APV A;  4WJ4 A;  2A1A A;  1Y1V H;  4JI3 L;  1VQC A;  2PQA B;  2BA0 A;  3I2Z A;  4GS3 A;  3S17 H;  4AQY Q;  2UUB L;  4UPA A;  3FHW A;  2YTV A;  1PH3 A;  2CWP A;  4JI4 Q;  2Q2H A;  2E8G A;  5GAD C;  2KCM A;  2HQL A;  2F52 A;  3PUY A;  4AYB G;  4NB3 A;  4A3D H;  2ZTD A;  4DR6 L;  3F8T A;  1SRU A;  2UU9 L;  4IFD G;  1LYL A;  2E2J H;  4JI6 Q;  1N32 Q;  1MKH A;  4LF6 Q;  2PMZ E;  4IOA A;  1L2F A;  1YVC A;  4HJ9 A;  3PO2 G;  2K50 A;  3TRE A;  3AYH B;  1CKM A;  3CD6 A;  3TS2 A;  2VL6 A;  4P74 A;  4NXN L;  5IY0 A;  3LGJ A;  1FJG Q;  4ALP A;  3CC7 A;  3PO3 H;  4OO1 G;  2R93 G;  1VQH A;  3TRZ A;  5GAH C;  3NEN A;  3FKI G;  4A3B G;  1N34 L;  1XNQ L;  5M5Y H;  5C0X G;  2K4K A;  4DUY Q;  3GTK H;  2B29 A;  4MNO A;  4DR5 L;  4B3R L;  4JBK A;  4JI7 L;  2NVX H;  1OXT A;  5C3E G;  1VQ7 A;  1VQ9 A;  1IYJ B;  4LF8 Q;  4DR3 L;  3S1R H;  4BY1 G;  4X65 L;  3STB C;  5ELN A;  3MXN B;  3F2D A;  1A63 A;  5E7N A;  4A3B H;  3RLF A;  4DV0 L;  3T1H Q;  2IX1 A;  2NVT H;  1HZB A;  5FJ8 H;  3CCR A;  4GKJ Q;  4A3M H;  2WP8 J;  4YHH Q;  3KLW A;  3L7Z C;  5GAG C;  1VQF A;  3KJP A;  4MTN A;  3H3V I;  4YY3 L;  1JJ2 A;  3U50 C;  1KQS A;  4B3S L;  2YTY A;  1L1O B;  2BA1 A;  4LUV A;  3HKZ E;  3A5U A;  3HOZ H;  4DAM A;  4DV4 Q;  1XJV A;  3PO2 H;  2PQA A;  4GOP B;  4JI1 L;  4UP9 A;  5BR8 L;  1KRS A;  3DM3 A;  1VQM A;  1Q1B A;  2IX0 A;  2MFI A;  4GN3 B;  3HOV H;  2K52 A;  4DV7 Q;  1MIU A;  4X62 L;  2JA8 H;  1HJP A;  1SLJ A;  1YIT A;  4A3D G;  3PO3 G;  4FDB A;  3HOZ G;  5LMU L;  3ULL A;  4DR7 Q;  1E22 A;  3UDX A;  2NN6 I;  2KBN A;  3HKS A;  1J5E Q;  1XMO Q;  1PH5 A;  2BH8 A;  3A74 A;  5FJ8 G;  4DV3 Q;  4POG A;  1HNW L;  4JBJ A;  3IRB A;  2AWO A;  4OX9 Q;  4UY8 C;  3PUV A;  2JA8 G;  4JV5 L;  4PZ6 A;  3H0G H;  4LUZ A;  3RR5 A;  5AJ3 L;  1WOC A;  3J81 i;  3EBE A;  2VUM G;  4A3L G;  1GO3 E;  2HIV A;  3UE0 A;  4JI3 Q;  5C4X G;  3HOY H;  1RL2 A;  2K5V A;  4X62 Q;  3FKI H;  4A3F H;  4AIM A;  2UUB Q;  1K9M C;  4IPH A;  3S24 A;  2B63 H;  2NZH A;  4GKK L;  3HOV G;  1D7Q A;  3K81 C;  2ZJQ A;  4LF7 L;  2Q2T A;  5EAY A;  1D8L A;  1WI5 A;  5IYB H;  2UU9 Q;  3CQZ H;  1QVF A;  3ERS X;  1Z9F A;  1EIY B;  5JEA J;  4PZ8 A;  1JT8 A;  4JOI C;  1LUZ A;  1YHA A;  4DR2 Q;  3SGI A;  2A8V A;  3STB D;  5IP7 G;  2Q2I A;  1B7Y B;  1VQD A;  4IPD A;  3PF5 A;  4QQB X;  4DV1 L;  1FJG L;  4HJ7 A;  1S72 A;  4DR4 L;  1VQE A;  2JE6 I;  4A3J H;  1XMQ L;  3CP0 A;  2JA7 H;  2I5H A;  1CSQ A;  4YCW A;  4NXM Q;  3CCQ A;  1WYD A;  4QL5 A;  1YHQ A;  2ZJR A;  4QIW E;  1I3Q H;  5GAE C;  3BJU A;  1OXS C;  1K3R A;  3KF8 B;  3G4S A;  1XPO A;  3M4P A;  2K75 A;  3HOY G;  2R7Z G;  1J6Q A;  1I5F A;  1U0L A;  1XTD A;  1OXV A;  2AWN A;  3HOU H;  2B3G A;  2E5L Q;  2R7F A;  3WWV A;  4DUZ Q;  3TQY A;  4XIG S;  3H0G G;  2N78 A;  2E2I H;  3MEF A;  3EIV A;  2F4V Q;  1TXY A;  1VQ8 A;  1GKH A;  2KEN A;  2R92 H;  4JI2 Q;  2OTL A;  1Q1E A;  3CCV A;  1JJC B;  2JEB I;  4BXX G;  4O2D A;  1IBM Q;  1NE3 A;  1W2B A;  4IFD J;  2UUA L;  1WCM G;  1IBL Q;  4DR1 Q;  4LF5 Q;  3M85 A;  3G6E A;  1N33 Q;  3GTO H;  1E1T A;  3EN2 A;  4IJL A;  2JA7 G;  1KIX A;  2HHH L;  4B3S Q;  2YYZ A;  4LF4 Q;  4C3J H;  2JA6 H;  5M5X H;  4HIK A;  5IWA L;  1R9T H;  1A62 A;  1B8A A;  4YCV A;  4QGU A;  4P72 A;  2A19 A;  4R1J A;  2RHS B;  1X55 A;  2KCT A;  2Z6K A;  4A3M G;  1M1K C;  3S15 H;  4DV7 L;  4J15 A;  2FXQ A;  4JI5 L;  4GLV B;  2OQK A;  2UXB L;  5JEA G;  2HT1 A;  2D62 A;  3CCE A;  2ASB A;  3T1Y Q;  1I94 L;  2Y0S G;  4DK6 C;  4JYA Q;  4JI8 L;  5C44 H;  3S14 H;  5IT9 c;  1NJI C;  1C0A A;  3HKZ G;  1TWH H;  4DK3 C;  3UDG A;  4GN4 B;  1MJC A;  4HIM A;  4LFB Q;  3J7Z C;  2ZM6 Q;  5IP9 H;  3W1B A;  5FLM H;  4JC0 A;  3GDE A;  1N8R C;  5DLQ E;  4LFC L;  5JJL A;  1IBK Q;  4IJH A;  4LFA L;  4UP8 A;  4BY7 G;  4KHP Q;  2K5H A;  1Q12 A;  2NZO A;  4JOI A;  1GD7 A;  1K83 H;  4R4O A;  3ICE A;  3A0J A;  1KHI A;  1T9H A;  1X3E A;  1YEZ A;  3ER0 A;  3F1Z A;  4LF7 Q;  4B3T L;  1QZH A;  3KYH C;  1XPU A;  1TWG H;  4JBM A;  3I4N H;  4BY7 H;  2QA4 A;  3CW2 C;  1NTG A;  3GTP H;  1X3F A;  2JEA I;  3H3V H;  2K5N A;  4POF A;  3CXC A;  1N36 Q;  2N3S A;  4LF8 L;  2WB1 E;  4QJF A;  4MZ9 A;  1VQL A;  4A4I A;  3OTO Q;  3RN5 A;  4BBR G;  1YBY A;  3ULJ A;  3TS0 A;  3M4O H;  3I4N G;  2I5L X;  5C44 G;  5IYC H;  1G6P A;  1H95 A;  3CC4 A;  3U4V A;  4LW1 A;  1Q46 A;  1VQP A;  2XGT A;  4K0K Q;  1KXL A;  3HOU G;  4X66 Q;  1JJG A;  2CQO A;  5IP9 G;  2JQO A;  2YTX A;  5IP7 H;  1X65 A;  5FLM G;  1HNZ Q;  1OTC A;  1IL2 A;  4P71 A;  3J80 i;  1VQK A;  1M90 C;  1YZ6 A;  2OWO A;  2NN6 G;  2VUM H;  1AH9 A;  1V43 A;  2K14 A;  1HNX L;  2PI2 E;  4LUO A;  5C0X I;  4A3G G;  1UE6 A;  3CC2 A;  4JI1 Q;  1B70 B;  2B63 G;  1C9O A;  1HZA A;  1V1Q A;  4LWC A;  1ASY A;  1W3S A;  2UUA Q;  2VNU D;  3UDF A;  1IBL L;  1E7Z A;  4LF5 L;  4OO1 I;  1TWF H;  4NXN Q;  4R4C A;  1NY4 A;  1EYG A;  4HJ8 A;  4B3M L;  1SN8 A;  5IYB G;  2RF4 A;  4X64 L;  4JI0 L;  3BZK A;  3CCJ A;  2VQF L;  2JK8 A;  2JA6 G;  5FLX c;  1GM5 A;  2NVQ H;  1PA6 A;  3HOX H;  1FGU A;  3M4Q A;  4DNI A;  1Q81 C;  3CCL A;  1XNQ Q;  4DV3 L;  1HNW Q;  1FL0 A;  3AFP A;  4IFD I;  3J80 c;  4GNX B;  2N49 A;  1EQR A;  4JBW A;  2EXD A;  3L0O A;  1PYB A;  4YHH L;  2IHF A;  2GVB A;  1NMG A;  1HR0 Q;  1VQI A;  3U58 A;  2R7Z H;  3HOX G;  2I5M X;  1PH7 A;  4GNX C;  2D0O A;  4A3C H;  3I55 A;  2PI2 A;  4LFB L;  3KF6 A;  4DPG A;  1VQA A;  3KDF B;  1Y14 B;  1OXU A;  1QVC A;  3RN2 A;  1WFQ A;  4L5Q A;  1GVP A;  1KL9 A;  1QUQ B;  1XNR Q;  2DUD A;  4L5S A;  1LM0 A;  3AEV A;  1PYS B;  2HHH Q;  3S16 H;  4A3G H;  2PNH A;  3KDF A;  2RHQ B;  2VQE Q;  4DV4 L;  4DV6 L;  3I4M G;  2C35 B;  3HOW H;  2IHE A;  4KHP L;  1K8G A;  4DR2 L;  1A0I A;  1IZ6 A;  2OCE A;  2ALY B;  4AQY L;  2QGQ A;  2UUC L;  1BVS A;  4DR4 Q;  2EIF A;  1YIJ A;  3PF4 A;  1XMQ Q;  5LMN W;  1TWA H;  2UXC L;  1VQN A;  5LMU Q;  2WB1 G;  4GOP A;  1PH9 A;  3L2P A;  3S1Q H;  4DR7 L;  1KC8 C;  2BH2 A;  4DR6 Q;  1PVO A;  3PUW A;  5HGQ A;  5IYD G;  1L0W A;  3AQQ A;  4HJ5 A;  2DGY A;  1PH4 A;  4DAY B;  4OON A;  1SE8 A;  3AFQ A;  3CF5 A;  2MQH A;  3GD7 A;  1AE3 A;  5HY6 A;  4JI2 L;  4DV2 L;  1K8A C;  4A3E H;  4LF6 L;  3S1M H;  2UXD L;  2JA9 A;  1N9W A;  4IOC A;  1Q8K A; 
#chains in the Genus database with same CATH topology
 5CR3 A;  1EY5 A;  5EPJ A;  5COY A;  3S2H H;  1CQF A;  1CKO A;  5TSS A;  4K5V A;  1XWE A;  4UP7 A;  1J8I A;  3D3R A;  1SNP A;  1VQ4 A;  2NVQ B;  3UDI A;  2B2W C;  5EGT A;  5C3E B;  3RNU A;  2I46 A;  3M3Y H;  3SK4 A;  4DUY L;  3OW2 A;  1VQG A;  4TKO B;  2V1C C;  1VQ9 A;  3NQT A;  5M3M H;  4JI4 L;  1PZJ D;  3GTK B;  4HTH A;  1VQB A;  3JAM L;  4KD3 A;  2NTT A;  1I50 H;  4OXP A;  1KAB A;  4A93 G;  3RLO A;  4JI6 L;  4C2M H;  3RZD H;  2KA7 A;  1XPR A;  3RMH A;  2EXZ A;  5A35 A;  4R8N A;  4EQP A;  1DOM A;  1TU2 B;  2F4V L;  3TME A;  4BBS H;  4IPG A;  4Z9C B;  1SEB D;  2B2V C;  4A93 H;  4FO2 A;  3FRP B;  3A7L A;  1YNX A;  2BDN A;  2EYJ A;  1GUO A;  2A6H D;  4K8J A;  4IUP A;  5I6W A;  2ZJP A;  3J7A F;  4DR5 Q;  4B3R Q;  4GN5 A;  3I4M H;  5I6Y A;  2XIW A;  3CMA A;  2VW9 A;  2XVS A;  2RCN A;  1RIP A;  4TVA B;  1EYD A;  4GLA C;  2HIX A;  3CCU A;  4JYA L;  1IBK L;  1CSP A;  1RD9 D;  2ZM6 L;  1I3Q B;  1VCI A;  1MSH A;  3D6W A;  2YU9 H;  3NWT A;  4IUR A;  2IT1 A;  4A93 B;  1E3P A;  4EQ5 A;  4JG2 A;  4O0A A;  3RD4 A;  4L5R C;  1X6O A;  4LK1 C;  3PGZ A;  1HQR D;  1KD1 C;  4H0L C;  1XMO L;  3W1G A;  4X64 Q;  1N36 L;  4IZ8 A;  2C5C A;  3BU2 A;  5ELD A;  1JE5 A;  2X6L A;  1U4P A;  4KY6 A;  2LFN A;  4A3J B;  4EVO A;  4HID A;  2O5J C;  3X3M A;  4A3K H;  3D4D A;  3S9W A;  5C0X H;  3I91 A;  1JCK B;  1TS5 A;  4JCV E;  2SNM A;  3GTQ H;  4LMQ D;  3M3Y B;  2YV5 A;  1KAW A;  1BKB A;  1YNJ D;  2CWA A;  2KCC A;  2Z9H A;  3NEM A;  5IGB A;  4HJA A;  4YWK A;  2YU9 B;  2B2Y A;  5ELO A;  3PIP 3;  4DV5 Q;  2DNE A;  2R6G A;  3KJO A;  4RGM A;  1Q86 C;  1S5D D;  3MVV A;  5CV5 A;  5JOB A;  3EJI A;  1ZXT A;  1SE2 A;  3WOF A;  3T53 B;  1JB3 A;  1WCM H;  1WTQ A;  4DUZ L;  1I94 Q;  2KHS A;  1LTL A;  4BWG B;  3VYU A;  4ME3 A;  4A3K G;  2CFM A;  2RCF A;  3E6Z X;  3E9H A;  4OHJ A;  1CKN B;  4PQX A;  4HN7 A;  1LAB A;  2ID0 A;  5JJK A;  3PIP A;  3VR3 A;  5K36 G;  4ZAI A;  1DON A;  1SMY C;  1VS0 A;  4OEL B;  4A3J G;  1Q3L A;  3I72 A;  1LAC A;  1HZC A;  1JOR A;  1MGS A;  4G4K A;  4G7O C;  3PIO A;  1S3O A;  1C7Y A;  3S1M B;  1JWS D;  3HOY B;  1L1O A;  4X3T A;  4A75 A;  2CCZ A;  2P5Z X;  4OWX B;  3KBX A;  3GTJ H;  4LF9 Q;  3CAM A;  2A1A A;  1Y1V H;  2SEB D;  4JI3 L;  2XWB B;  3S17 H;  1SYE A;  5JJZ A;  3CU7 A;  1PH3 A;  1HUM A;  2Q2H A;  1MD2 D;  2HQL A;  1IKM A;  3PUY A;  4BS9 A;  1TR5 A;  2ZTD A;  2K05 A;  3F8T A;  1I4H A;  1RHP A;  1I4X A;  3M4O B;  1BO0 A;  1D6E C;  2VL6 A;  1NR4 A;  1FJG Q;  1D1K A;  4ALP A;  3CC7 A;  4ZKB B;  1ZYR C;  3PO3 H;  4OO1 G;  4A3K B;  3TRZ A;  1I6V C;  3URY A;  1GUG A;  3FKI G;  4A3B G;  5C0X G;  2L12 A;  2B29 A;  4JI7 L;  4LF8 Q;  1NCV A;  1IYJ B;  4DR3 L;  3H0G B;  1VF7 A;  2F4I A;  3GTJ B;  1PDQ A;  3F2D A;  4A3B H;  4XXE A;  4BBS B;  3HOW B;  3L7Z C;  3QOL A;  1F9P A;  1BNZ A;  4KV6 A;  1I4Q A;  3SDZ A;  1KQS A;  1CA6 A;  1L1O B;  3A5U A;  4MTK A;  4DV4 Q;  1WTR A;  4B9X A;  3L9A X;  2EDG A;  4UP9 A;  4ZRZ A;  4ZLT F;  4GN3 B;  1V1P B;  2RDG A;  3DEP A;  4DV7 Q;  3FVQ A;  2CH4 A;  1HFG A;  1SLJ A;  2JA8 H;  3PO3 G;  1O78 A;  1RTN A;  3NTH A;  4C3I B;  3HOZ G;  2EJG C;  1HQM C;  3UDX A;  2IJ0 A;  2KBN A;  3U9O A;  3HKS A;  1J5E Q;  4NMZ A;  4A3E B;  1PLF A;  4POG A;  1HNW L;  2PCF B;  5I2Y A;  4UY8 C;  3HOU B;  4JV5 L;  3PUV A;  3DEO A;  3VR5 A;  1S5E D;  2OXP A;  1SFO B;  1HCZ A;  4AIM A;  4TRD A;  2NZH A;  2IX3 A;  2KEC A;  4CKC A;  4LF7 L;  2Q2T A;  5KEE A;  3CQZ H;  1QVF A;  3ERS X;  1Z9F A;  3GTQ B;  4LJZ C;  4PZ8 A;  3BYY B;  4IPD A;  1L0X B;  1VQD A;  4DV1 L;  4HJ7 A;  4DR4 L;  4A3J H;  2JXM B;  3CP0 A;  4NXM Q;  1SYD A;  3CCQ A;  4QL5 A;  1PFN A;  1F2M A;  4DN4 M;  4Q5V A;  2ZJR A;  3G4S A;  1YHQ A;  2R7Z G;  1K3R A;  2Q8I B;  2EYL A;  2L4N A;  2K75 A;  3W2D A;  2AWN A;  3HOU H;  4RH6 A;  1UNS A;  3TQY A;  4RGN A;  3MEF A;  2F4V Q;  1TXY A;  2V4D A;  2K5D A;  5FK9 C;  1NE3 A;  3I4M B;  4U67 3;  3ND9 A;  5I9O A;  3DXJ C;  1IBL Q;  3M85 A;  2K5W A;  2B2T C;  1E1T A;  4DAV A;  4B3S Q;  2YYZ A;  3P7J A;  4JK1 C;  3VYS A;  1PRT C;  4C3J H;  4HIK A;  3H09 A;  1R9T H;  4QGU A;  4P72 A;  1M1K C;  1QIL A;  2FXQ A;  1TWF B;  5K5P A;  1A2U A;  1PRT B;  2D62 A;  2ASB A;  2ZXR A;  4DK6 C;  4JYA Q;  2G9D A;  1NJI C;  1C0A A;  4XT1 B;  5DNF A;  4DK3 C;  1KDC A;  1MJC A;  1O7Z A;  2ZM6 Q;  2DJG C;  5IP9 H;  3GDE A;  2VUM B;  4FF3 A;  1IBK Q;  1F2Y A;  1YNJ C;  5A2Q E;  4ZUJ A;  5CC4 A;  1Q12 A;  4HAE A;  4R4O A;  3ICE A;  1BCP D;  1T9H A;  1YEZ A;  3F1Z A;  3ER0 A;  1KDA A;  3MA2 B;  1RDP D;  1TWG H;  1WVL A;  4M1U B;  3TBI B;  5D3D A;  3BVG A;  2JEA I;  2WIN B;  1TY2 A;  1N36 Q;  1JC7 A;  2D5D A;  2KED A;  5NUC A;  2N3S A;  1SNQ A;  2WB1 E;  1Y1W B;  3RN5 A;  3T56 B;  1TII D;  1B1Z A;  2OEO A;  2NVY B;  2I5L X;  5IYC H;  3U4V A;  3G7L A;  2XGT A;  4K6L A;  4IUQ A;  4QUF A;  1JJG A;  1B53 A;  4L6T B;  1DZ1 A;  4P71 A;  3X3N A;  1VQK A;  1M90 C;  2F3V A;  1YZ6 A;  1CZW A;  2PI2 E;  4A3G G;  1SBB B;  3SK8 A;  3PO2 B;  1G91 A;  1DXM A;  1HZA A;  2VNU D;  2Z1C A;  5EBC A;  1IBL L;  1E7Z A;  1LTS D;  1WD1 A;  1HA5 A;  4NXN Q;  2F0V A;  1A3T A;  1PZK D;  2E2D C;  3TZD A;  1SN8 A;  5M5W B;  1EYC A;  2RF4 A;  3CCJ A;  2K7V A;  5LL6 X;  2NVQ H;  1PA6 A;  3HOX H;  3TN2 A;  3SK6 A;  1Q81 C;  1XNQ Q;  3A8J E;  4DV3 L;  4NW2 A;  1TY0 A;  4IFD I;  3J80 c;  4GNX B;  1TKW B;  1EQR A;  1PTO F;  1KNA A;  2EJF C;  2IHF A;  1A6X A;  4ABN A;  4F7X A;  1BCP C;  3U58 A;  2R7Z H;  4S3S A;  3R93 A;  4CGY B;  4GNX C;  2D0O A;  4FYD A;  3I55 A;  3KF6 A;  1Y14 B;  2IPK D;  2BCO A;  1KL9 A;  1QUQ B;  2F0U A;  1MI2 A;  1BCP B;  1CHQ D;  1PYS B;  5IOD A;  4A3G H;  1C8C A;  2M9V A;  2HDL A;  2RHQ B;  3I4M G;  5JVH 3;  1SNO A;  1K8G A;  4BY1 B;  5CV7 A;  3FMC A;  1LT6 D;  1JWM D;  1AZP A;  3QWN A;  4K6D A;  5D3I B;  3PF4 A;  4XQQ A;  1TWA H;  1QJO A;  1VQN A;  5DM6 3;  5LMU Q;  4DR7 L;  2EVB A;  3L2P A;  2A69 D;  2QKI C;  2IL8 A;  1PVO A;  4UHV A;  5HGQ A;  5IYD G;  3I90 A;  1PH4 A;  3LWE A;  2E76 C;  2HUG A;  1AFP A;  1PRT D;  1L0Y B;  2MQH A;  3D4W A;  4O42 A;  4JI2 L;  4DGZ A;  4X62 L;  3HOW G;  2R92 B;  3NBH B;  1Y1V G;  3KFU A;  2LY7 A;  1ESR A;  1N33 L;  3GTM H;  4FNF A;  1OXX K;  4BBR H;  4M8A A;  1JB7 A;  3OHX C;  5IYC G;  2EYF A;  1VQ6 A;  4KHV A;  1R4P B;  1SMY D;  2N88 A;  3T1H L;  3U4Z A;  1YHB A;  1X3G A;  4C3I G;  1PH6 A;  4B3M Q;  4RMF A;  3GO5 A;  3HG9 A;  3K8A A;  4PZ7 A;  1YJ9 A;  3MWY W;  1JQY D;  4A3E G;  1KLU D;  2VB2 X;  2AHO B;  5M3F B;  1N32 L;  1PV4 A;  2F3W A;  2E5L L;  2MO1 A;  1Y1W G;  1HA6 A;  1U4M A;  2NWG A;  3ERQ A;  3MFG A;  3W5O A;  3F2C A;  3HOX B;  3JAM c;  1KTK A;  1TS3 A;  1TS2 A;  1BCP F;  1FGB D;  2XWJ B;  3E5S A;  3A8I E;  1SND A;  1J5E L;  4IPC A;  5KGU A;  4WJ3 M;  4EX5 A;  4BA1 I;  5M3M G;  4JV5 Q;  1O7I A;  4LF4 L;  2NVX B;  1G8Z D;  3CRL C;  3MZ5 A;  4EQO A;  1G6Z A;  4ZQ3 A;  2F0D A;  4JI8 Q;  4QMG A;  1XTC D;  2J4X A;  2ATW A;  3OWE B;  4YWM A;  2DY7 A;  3I4O A;  3RLN A;  4GKJ L;  3M7N A;  2X69 A;  1G29 1;  2M2L A;  1NBW A;  3E9I A;  1B3A A;  3R2T A;  3I7F A;  1STN A;  4GKK Q;  5EPL A;  5C4J H;  3QOJ A;  2E2H H;  1Z7T A;  4RHR A;  2WFW A;  2VZA A;  2AMC B;  1ONL A;  2GA4 B;  1MBY A;  5EKK A;  2AUK A;  1M4V A;  1V9P A;  1C4Q A;  5M3F G;  4IFD H;  2BE5 D;  2RDH A;  3K58 A;  2Y0S B;  5FO9 B;  4C56 C;  3NWS A;  5CYU A;  2SOB A;  3CCM A;  3OOC A;  2N8N A;  4QY7 A;  2L9H A;  1UE5 A;  1X9N A;  3HEJ A;  2CKZ B;  1SFO H;  5T1I A;  3K0X A;  1EIH A;  4A3I G;  2LXK A;  1YJN A;  1RJT A;  1STA A;  3EQL C;  1IBM L;  2Y0S E;  1EQQ A;  5IWA Q;  2L15 A;  1J9O A;  1N34 Q;  1ASZ A;  1SJH D;  1DJR D;  3S1N H;  1FYC A;  4JI5 Q;  3GTL H;  3OYY A;  2UXB Q;  3KOJ A;  2IY5 B;  1P8L A;  1EFW A;  4IQZ A;  4JI0 Q;  2R92 G;  5IT9 E;  4A3L H;  4NXM L;  4RHS A;  3NEL A;  5FO7 B;  4X3K A;  3J81 c;  3PSI A;  2HD3 A;  4LNQ A;  3OW7 A;  3S1Q B;  3KBG A;  2RKS A;  1EU3 A;  2EQS A;  1B2T A;  4XYQ A;  5BR8 Q;  4WFN 3;  3CPW A;  2KHI A;  1MJE A;  2MO0 A;  1FD7 D;  4KY7 A;  4R4I A;  1HR0 L;  1G51 A;  5GRO A;  3VR6 A;  4B3S L;  4A76 A;  2JYO A;  3BDC A;  3NBH A;  4C3J B;  3A5Z B;  3BZC A;  5LMN L;  3AMU A;  1ROD A;  2NVY H;  4OIK A;  2I07 B;  4ZK9 B;  1VQ5 A;  1YI2 A;  1TVX A;  2KCN A;  5G3L F;  3SR1 A;  5AJ3 Q;  5C3E H;  2QF7 A;  4BBR B;  2PQA B;  3WOE A;  2BA0 A;  4UPA A;  4H7B A;  3ITP A;  4JI4 Q;  5IIF A;  2Z8L A;  4NB3 A;  1STB A;  4IFD G;  2E2J H;  1MKH A;  3GTM B;  5JPM C;  5ISR A;  3AYH B;  3TS2 A;  1H9R A;  5IY0 A;  4NXN L;  2LKV A;  4K5W A;  4C3H B;  2HCC A;  4OGQ C;  1E2W A;  1H9M A;  2F0T A;  2F0L A;  1XNQ L;  1NUC A;  4IUU A;  4J6H A;  4DUY Q;  2EYP A;  4DR5 L;  4B3R L;  1OXT A;  1LO5 D;  5C3E G;  1VQ7 A;  1PTO D;  4BY1 G;  3FKI B;  3CRK C;  3MXN B;  4CDD C;  3RLF A;  1HZB A;  5FJ8 H;  3CCR A;  3C3L A;  4A3M H;  4YHH Q;  3H3V I;  1X3Q A;  2NB0 A;  4KKU A;  2NZ1 D;  1IYV A;  1W6K A;  4NDX A;  5EBD A;  3D8G A;  1XJV A;  3PO2 H;  2PQA A;  4GOP B;  5BR8 L;  3DM3 A;  5D65 A;  1VQM A;  2IX0 A;  3PIO 3;  1HJP A;  4ZUI A;  1YNN D;  1YIT A;  4A3D G;  4FP5 D;  3IAY A;  1K0S A;  3T16 A;  2NN6 I;  3GV6 A;  1M8A A;  2G5D A;  1SYC A;  1UAP A;  1K3B C;  3A74 A;  1Z6H A;  3GV3 A;  1Q8I A;  1IYU A;  2AWO A;  5A2Q L;  1LTR D;  2XN9 C;  5AJ3 L;  5COR A;  4H13 C;  1DCZ A;  2NN6 H;  4A3L G;  3H94 A;  1SYB A;  3MTS A;  5C4X G;  4X62 Q;  2K5V A;  3FKI H;  3MXU A;  2B63 H;  2PW5 A;  5EAY A;  1WI5 A;  3ERO A;  4HMI A;  4QUC A;  5M5X B;  4CDF C;  4K2L A;  2PNR C;  3IKJ A;  1D5X C;  3S2D B;  3SGI A;  2A8V A;  1HFN A;  3STB D;  5IP7 G;  3D6C A;  3DM1 A;  4F88 A;  1GUS A;  2JE6 I;  1XMQ L;  1K8M A;  2H4O A;  5JEA H;  1CSQ A;  1WYD A;  5GAE C;  1I3Q H;  3HOY G;  3IFD A;  1SYF A;  3M4P A;  1J6Q A;  1I5F A;  1U0L A;  1XTD A;  1OXV A;  1IHZ A;  2E5L Q;  2R7F A;  3WWV A;  4XIG S;  1BXT A;  5C6A A;  3EIV A;  1QNK A;  5E4X A;  4KD4 A;  3CCV A;  2JEB I;  1S5B D;  2CW0 C;  1W2B A;  4IFD J;  3TSS A;  2UUA L;  5DEH A;  3G6E A;  1N33 Q;  3GTO H;  4XDX A;  3EN2 A;  2JA7 G;  4DAP A;  1I6H B;  2R61 A;  1LT4 D;  1QE6 A;  1Y69 U;  4ID6 A;  5DM7 3;  1EWC A;  2NVT B;  1EWH A;  3RZO B;  4X3U A;  2RHS B;  4R8I A;  1QOH A;  5K36 H;  2K01 A;  1ENC A;  3T13 A;  2HT1 A;  1I94 L;  2Y0S G;  4MIU A;  3H6M A;  2RDF A;  3S14 H;  3BDL A;  4U68 A;  3HKZ G;  1TWH H;  3J7Z C;  4JC0 A;  2WKC A;  1N8R C;  2AQ2 B;  4IJH A;  4LFA L;  4CJ2 C;  1JOQ A;  1CM9 A;  1QWY A;  2K5H A;  2NZO A;  4JOI A;  3QIA A;  1KHI A;  2NYZ D;  1X3E A;  3GQB A;  4KKT A;  2JN4 A;  1EQV A;  2CH4 W;  1AZQ A;  4B3T L;  2E74 C;  3KYH C;  3I4N H;  4BY7 H;  2QA4 A;  3ONA B;  2AUJ D;  2A68 D;  1KLG D;  3CW2 C;  3GTP H;  3MXN A;  3H3V H;  4JVZ A;  1O7L A;  2K5N A;  4G57 A;  3RUZ A;  1RTO A;  2F0Q A;  4MZ9 A;  1STG A;  1VQL A;  2BOS A;  3OTO Q;  2F0K A;  3R3O A;  3ULJ A;  3TS0 A;  5E1F A;  3I4N G;  3J80 E;  4Q0F A;  1RCV D;  1Q46 A;  3HOU G;  2CQO A;  5CBA E;  1QCB D;  1HNZ Q;  1S4Z A;  3J80 i;  2CQA A;  5FKA C;  1EYA A;  2VB3 X;  2PO4 A;  1HNX L;  4LUO A;  4JI1 Q;  1B70 B;  1C9O A;  1V1Q A;  1W3S A;  3UDF A;  1EYG A;  4A3I B;  3ND8 A;  3SVM A;  2VXW A;  2F0W A;  1QB5 D;  4C3J G;  3UI2 A;  5FLX c;  3GTP B;  1FGU A;  4UDU C;  4DNI A;  2QDL A;  2J7Z A;  3MAQ A;  2N49 A;  4LAA A;  5IGF A;  1PYB A;  1WTH A;  3EVQ A;  2GVB A;  4ZCK A;  1UUP A;  1W6J A;  3NPP A;  4RKL A;  4EQN A;  1I4P A;  1O80 A;  3KDF B;  1VQA A;  1GUT A;  3RN2 A;  4L5Q A;  3DWQ A;  3GP7 A;  1PFB A;  2VQE Q;  4DV6 L;  3A54 A;  2C35 B;  3HOW H;  2NBF A;  4N9T A;  2ENB A;  1F2Z A;  2OCE A;  4CJ0 B;  1FR3 A;  2UUC L;  1BVS A;  1A15 A;  4DR4 Q;  2EIF A;  3HOZ B;  2JA7 B;  2FJ2 A;  5C5L A;  5LMN W;  3FDT A;  1CZG A;  1GOZ A;  3SK5 A;  2UXC L;  2BH2 A;  4AYB B;  1X32 A;  2K28 A;  2F0I A;  1I50 B;  1SE8 A;  2KVM A;  5HY6 A;  1C48 A;  1QNU A;  2UXD L;  3S1M H;  5CGK A;  4PG3 A;  3K59 A;  4IOC A;  1Q8K A;  1NSN S;  3BVZ A;  5J1Z A;  2R93 B;  1GUN A;  1HNZ L;  2HQE A;  4RA8 A;  3I70 A;  5LMN Q;  1L1O C;  1H9J A;  3D31 A;  4R9W A;  4P73 A;  4BXX H;  2DY8 A;  4XYO A;  4QCL A;  1S5F D;  1F77 A;  3P20 A;  4KK7 A;  1DGS A;  4KJO A;  4A3D B;  1UWV A;  4DV1 Q;  2K04 A;  3HOV B;  2EPB A;  3CKI B;  4NPS A;  4C1N I;  2R7Z B;  2PW7 A;  2MNA A;  1EEI D;  4CHT B;  1PRT F;  2KQ3 A;  4YCU A;  5J3B A;  1PMR A;  1HH2 P;  1QVG A;  3RZO H;  4DV5 L;  2B2U A;  2Z6B A;  4GNX A;  4BY1 H;  1MHW C;  3S15 B;  2VS1 A;  1VQO A;  4FF1 A;  4CBV A;  1XYI A;  3S1R B;  3R2I A;  1HPC A;  3NE5 B;  4OX9 L;  2RVL A;  4ILW A;  1HTP A;  3M9B A;  1TWH B;  3PCO B;  1SR3 A;  3JC6 6;  4A3C G;  5M3M B;  4N8F A;  2UUC Q;  5H1S E;  5EQ0 A;  2EY6 A;  2ZTE A;  1Y1W H;  1CI3 M;  2G9H D;  3QO2 A;  3HP3 A;  1V1O A;  2EY1 A;  4YY3 Q;  1NAP A;  4X6A H;  4K0K L;  3PUZ A;  2O4X A;  2OF1 A;  2F3I A;  1LV9 A;  1PTO C;  1PZI D;  4XTC S;  3TEH B;  4C3I H;  1JR0 D;  1HZ9 A;  4DV2 Q;  3K57 A;  5C44 B;  2R7D A;  1B50 A;  4DU9 A;  2GN5 A;  4A3F G;  3ZYY X;  4RG1 A;  3P1H A;  1LTA D;  1CFM A;  1PHJ A;  3CME A;  2JJQ A;  1A8V A;  1VMP A;  1T5X D;  1TQO A;  4FVM A;  3IL8 A;  5M5W H;  1DOK A;  5C0X J;  2D0P A;  4DXF A;  5CV6 A;  2J0T D;  3J7A 5;  2LXJ A;  3Q0A A;  1AP0 A;  2ES2 A;  5IGD A;  1CTM A;  5KNB A;  4DR1 L;  1HHV A;  5I4D A;  4O1N A;  1V1P A;  4DF7 A;  3HKZ B;  4Y7N H;  1S40 A;  1VQJ A;  1Q90 A;  4DKA C;  5IE8 A;  3W3A A;  2Q8R E;  3K80 C;  3DMU A;  2JA5 H;  1EFI D;  1V8Q A;  1IXR A;  4MHE A;  1Q82 C;  5I2X A;  2K1B A;  2N55 A;  1CKN A;  4G7Z C;  2B8F A;  2F0H A;  1WD0 A;  1BBW A;  4DR3 Q;  1U9R A;  1Y1V B;  2D2C C;  4AH6 A;  3NK9 A;  1GUW A;  4FF4 A;  1WTO A;  1EL0 A;  1SE3 A;  4ULL A;  1F9R A;  4BBS G;  3NTI A;  3T1Y L;  3E0E A;  1CHP D;  1ZEQ X;  5ELF A;  1RF2 D;  4FXD A;  2ZTC A;  1EEF D;  3TDQ A;  2DN8 A;  1YJW A;  2EE1 A;  3PV0 A;  5CBE E;  1TWC H;  1NMF A;  3D0F A;  2K6A A;  4P75 A;  3F2B A;  3K7A H;  4B3T Q;  5IYD H;  4B9W A;  3ULP A;  3PO3 B;  1EOV A;  4R4Q A;  4H02 A;  3UE1 A;  1HR0 W;  2B2W A;  3Q22 A;  2JA6 B;  1PH2 A;  1ENF A;  2F0P A;  1IW7 D;  1PFS A;  1EY6 A;  3CPF A;  2EY5 A;  4UAI A;  5EKL A;  3H15 A;  2PYK A;  5EJW A;  1BBU A;  1LTG D;  4NP5 A;  2QEX A;  3IFT A;  1PH1 A;  2EYO A;  4Y52 H;  4APV A;  3J80 L;  4AQY Q;  1SDF A;  1EIG A;  5KIX A;  2E8G A;  2KCM A;  3QR8 A;  3I4L A;  3OMG A;  1WCM B;  1JE4 A;  4A3D H;  3N6R A;  1A3U A;  2KUM A;  2UU9 L;  1LYL A;  3J81 L;  1N32 Q;  2A5H A;  4RGT A;  4LF6 Q;  4IOA A;  1EY0 A;  4HJ9 A;  2K50 A;  3TRE A;  4PMB A;  3CD6 A;  2QDB A;  3K0Y A;  4P74 A;  2ICE C;  2JA8 B;  3OWF A;  3HGB A;  1VQH A;  4CKB A;  2BE5 C;  3D4R A;  5GAH C;  3M7G A;  3NEN A;  3I4N B;  3NHH A;  2WII B;  3GTK H;  2K4K A;  4MNO A;  4JBK A;  2NVX H;  2K5Q A;  3S1R H;  2QIL A;  4X65 L;  5ELN A;  3K5M A;  3MXP A;  5E7N A;  3H3V C;  4DV0 L;  3T1H Q;  2IX1 A;  4GKJ Q;  1PYW D;  2L1B A;  3KJP A;  1F9S A;  1VQF A;  3FPP A;  3I73 A;  4MTN A;  4K8I A;  2BA1 A;  4LUV A;  1JOO A;  3HKZ E;  3HOZ H;  1DD2 A;  3BZD B;  1PXU A;  3P75 A;  4DAM A;  1STH A;  1U4L A;  4JI1 L;  5CV9 A;  5C3X A;  1MIU A;  2AQ3 B;  2WKD A;  4FDB A;  1E2Z A;  3ULL A;  1E22 A;  2FHT A;  2TMP A;  1SYG A;  1BQQ T;  2L55 A;  3HRZ C;  1TT2 A;  4TSS A;  5FJ8 G;  1K8O A;  5IT9 L;  3IRB A;  4KY5 A;  4H44 C;  2JA8 G;  4PZ6 A;  4DK1 A;  4YIJ A;  3H0G H;  1JWU D;  3RR5 A;  3Q23 A;  2KOL A;  3OSO A;  3J81 i;  3EBE A;  2VUM G;  4F8M A;  2LMC B;  3UE0 A;  4JI3 Q;  4V19 0;  3HOY H;  1NR2 A;  3HZX A;  1K9M C;  3S24 A;  2A6E C;  4GKK L;  1EY9 A;  4HCS A;  3HOV G;  1D7Q A;  3NSW A;  4PMC A;  3A8K E;  2ZJQ A;  1D8L A;  4RWS C;  2F0O A;  2UU9 Q;  3C1F A;  1JT8 A;  1LUZ A;  1YHA A;  2M00 A;  4DR2 Q;  1H9K A;  2Q2I A;  1B7Y B;  3DWA A;  3PF5 A;  1FJG L;  3O13 A;  2JA7 H;  1BUV T;  2JSO A;  4YCW A;  1GJX A;  4K5X A;  2F0G A;  1CQV A;  1NNX A;  4WOR A;  1ET9 A;  4QIW E;  4EGV A;  1XPO A;  3BJU A;  1OXS C;  3VR2 A;  1ML0 D;  1GHJ A;  4F87 A;  2B3G A;  4HED A;  3H0G G;  3SXH A;  2N78 A;  1VQ8 A;  1GKH A;  2KEN A;  2R92 H;  5C4H A;  1WTX A;  5EKI A;  4BXX G;  2DNC A;  1EY4 A;  1SJE D;  4O2D A;  1IBM Q;  2IW3 A;  4N8X 1;  3KUP A;  4LF5 Q;  4XQN A;  1U4R A;  4OIJ A;  1KIX A;  2HHH L;  3CHB D;  3C1E A;  4ME5 A;  3K5L A;  4WRD A;  4IAL A;  5IWA L;  1A62 A;  1HXY D;  4YCV A;  2A19 A;  4R1J A;  3S16 H;  1X55 A;  1HRJ A;  2FFK B;  2QEJ C;  4DV7 L;  2B2T A;  4JI5 L;  2UXB L;  4GLV B;  4KN4 C;  3CCE A;  4CKE A;  4A3F B;  2K32 A;  2MUY A;  4QB4 A;  1R4Q B;  4HCE A;  5C44 H;  2PZU A;  2RA4 A;  5JVG 3;  4J8Q A;  2MP1 A;  4C2M B;  3RZD B;  4HIM A;  4G7H C;  3W1B A;  2B2U C;  4LFC L;  4ODG A;  1DM0 B;  3KF8 A;  3VA7 A;  1ILQ A;  4UP8 A;  2QCP X;  1K83 H;  2ZXO A;  1E0B A;  4FF2 A;  3SEB A;  4LF7 Q;  2JP1 A;  5JAV A;  1QZH A;  2Z4I A;  4KN7 C;  1EZ6 A;  2IWH A;  1NTG A;  2HCI A;  1X3F A;  2XNA C;  3R8B A;  4POF A;  2KEE A;  3CXC A;  1D2B A;  2JA5 B;  2ZXP A;  2RSN A;  4A4I A;  3V05 A;  4BBR G;  3M4O H;  5C44 G;  1H95 A;  3CC4 A;  4QF4 A;  4CJ1 B;  1BR9 A;  4XQJ A;  1VQP A;  2AQ1 B;  2SNS A;  4K0K Q;  5J22 A;  5IP9 G;  2JQO A;  1IL2 A;  1X65 A;  1OTC A;  5KND A;  3M4Y A;  2VUM H;  1EY8 A;  1V43 A;  2K14 A;  2CVR A;  5C0X I;  3K6O A;  2ZT9 C;  3DUZ A;  2E75 C;  4LF5 L;  5BN3 A;  4OO1 I;  4R4C A;  4B3M L;  3Q6S A;  4X64 L;  3MHB A;  3BZK A;  2VQF L;  2JA6 G;  2O2L D;  1GHK A;  1ILP A;  5IGC A;  5C4Z A;  1TWG B;  1KDB A;  5BN5 A;  3CCL A;  3MEH A;  1FL0 A;  1LTI D;  5ELE A;  2DJF C;  5AFW A;  2Z4H A;  4JBW A;  2EXD A;  4YHH L;  1NMG A;  2B2V A;  2PZT A;  4IN3 A;  3HOX G;  1O7Y A;  1PH7 A;  4Y7N B;  1X3P A;  4C1N K;  5IOC A;  3NTK A;  4DPG A;  3OIP A;  4J1M A;  1A3V A;  5IGE A;  2DUD A;  4OEM B;  4ZYS A;  4L5S A;  2F1M A;  3AEV A;  1I4G A;  1B44 D;  3KDF A;  2IHE A;  3KLS A;  3CQZ B;  1A0I A;  4AQY L;  2QGQ A;  3Q24 A;  1XMQ Q;  2F0S A;  4HSV A;  3AB9 A;  1ESF A;  3QG1 A;  3S1Q H;  3PUW A;  2R3Z A;  1L0W A;  3VR4 A;  3LWU A;  2RQX A;  4OON A;  2X6G A;  2E2I B;  1S5C D;  3CF5 A;  3GD7 A;  1AE3 A;  4MN3 A;  5C4X B;  1SE4 A;  1EY7 A;  5E3F A;  3E3X A;  4LF6 L;  2JA9 A;  1N9W A;  1LT5 D;  2GVA A;  3J81 j;  1EIF A;  2Z0S A;  5GQO A;  2B2Y C;  3DLL A;  1K0R A;  4B08 A;  4A3G B;  1ICF B;  1YNN C;  2WAQ G;  1BOS A;  3BYT B;  3QJY A;  4GOP C;  4LF9 L;  4GZY C;  4C3H H;  3I56 A;  3G48 A;  1T5E A;  3T51 B;  1K28 A;  1TWA B;  3K7U C;  1E24 A;  2LSS A;  2XSC A;  3KF6 B;  1CA5 A;  2OTJ A;  2PZW A;  4X65 Q;  2VQF Q;  5M5Y B;  4KI0 A;  1K73 C;  5CMD A;  3S2D H;  4DV0 Q;  2WAQ E;  4I7A A;  5LHY 1;  2I0Q A;  2JA5 G;  4KLK A;  1PFM A;  2XTI A;  3MC0 B;  1EUJ A;  1XXG A;  1LLR D;  1SRO A;  5DAU A;  2L11 A;  3ZJY C;  4PMW A;  1FNW A;  3CCS A;  1CT1 D;  2A68 C;  4KMU C;  3NBI A;  1X56 A;  3I8Z A;  3OIQ A;  3Q8D A;  3SE0 A;  2C9O A;  4L5T A;  4JI7 Q;  2WAC A;  4JPB W;  4IUV A;  1E2V A;  3A7A B;  5ELB A;  3VDY A;  4BY7 B;  4RFB A;  2Q2U A;  1BF4 A;  3GTO B;  5FLX E;  4KHZ A;  1Q7Y C;  1I6H H;  1STY A;  4HSP A;  2FIN B;  5FLX L;  1WJJ A;  1QZG A;  1SMX A;  5JJI A;  5M3F H;  2R93 H;  4X66 L;  1UE7 A;  3B6Y A;  4IUN A;  4WJW A;  2OQ0 A;  1TWC B;  1HNX Q;  1B9M A;  3S14 B;  3GTL B;  4LFA Q;  3G71 A;  2AKW B;  1PH8 A;  1QG7 A;  1B3Q A;  1JMC A;  5FOB B;  1Z47 A;  4CDE C;  2F0N A;  1ICW A;  4IUT A;  4A3I H;  4DA2 A;  2L0C A;  1JIC A;  4BA2 I;  1AW7 A;  3AU7 A;  2XRQ D;  4I65 A;  2A6H C;  5M9O A;  2B63 B;  2EYM A;  2WV6 D;  3FPU B;  4OWW B;  2PMZ B;  4HIO A;  3FP9 A;  2CW0 D;  2BDO A;  3KLR A;  5E4W C;  2H5X A;  1STE A;  4RCO A;  4HR7 B;  3OTO L;  1IW7 C;  1F2L A;  3N52 A;  3TP6 A;  4C3H G;  3JAM i;  1A2T A;  4AYB E;  1SAP A;  1KRT A;  3C2P A;  2RSO A;  3JAM E;  2EZV A;  1UEA B;  1UEB A;  1X54 A;  1I4R A;  4KTA A;  2VQE L;  1D1I A;  4DAY A;  3OMC A;  1VF5 C;  1ENA A;  1IL8 A;  2Z6K C;  4FXK C;  2B8G A;  2KHJ A;  4OWT B;  5F2D A;  4IO9 A;  1U5K A;  3TZU A;  3FEW X;  1CUK A;  2OT2 A;  3GTG H;  3PUX A;  2VY3 A;  1G2T A;  2A74 C;  5JPN C;  1P16 A;  4RCN A;  4P2C B;  1EWI A;  3V96 A;  4LFC Q;  2WB1 B;  1XNR L;  2UXD Q;  1QUQ A;  3F2U A;  4R4T A;  1E1O A;  4GLX A;  2HHH Q;  4QIW B;  5C4X H;  1AE2 A;  1VMC A;  4L63 B;  3S16 B;  3HFZ B;  4YWL A;  4TQU S;  4PNY A;  1UE1 A;  2UXC Q;  3KK7 A;  4XT3 B;  4DV6 Q;  1FVI A;  3H91 A;  4WJ4 A;  1VQC A;  5I9P A;  3I2Z A;  4GS3 A;  3K5N A;  2UUB L;  3FHW A;  2YTV A;  2CWP A;  5GAD C;  2F52 A;  4AYB G;  4DR6 L;  1SRU A;  1LTT D;  4JI6 Q;  2PMZ E;  3GTG B;  1DOL A;  1L2F A;  1H9S B;  1YVC A;  1JOK A;  2L5T A;  3PO2 G;  1CKM A;  1K83 B;  1D5M C;  3LGJ A;  3EFX D;  4DXG A;  2Q8T A;  2R93 G;  1LTB D;  3TP8 A;  3I3C A;  4DFA A;  1N34 L;  5M5Y H;  5J39 A;  5KYL A;  3NXW A;  4N9P A;  2A6E D;  1B4O A;  5CV8 A;  3STB C;  3BG3 A;  1A63 A;  2NVT H;  3A56 A;  1PTO H;  5HUR A;  2WP8 J;  1SNC A;  3KLW A;  5GAG C;  4YY3 L;  1JJ2 A;  4JW0 A;  3U50 C;  2YTY A;  4OO1 H;  1VDZ A;  4KJN A;  2E2J B;  1KRS A;  1Q1B A;  2MFI A;  3L3O C;  3HOV H;  1SXT A;  2K52 A;  5L37 A;  3VYR A;  4I7Z C;  5C4J B;  2E2H B;  5LMU L;  4DR7 Q;  3DWP A;  3BDO A;  3SHL A;  2FMC A;  2RBM A;  4V0B A;  2EJM A;  4L8J A;  3LX0 A;  2KJX A;  1XMO Q;  1PH5 A;  2BH8 A;  5EPK A;  4DV3 Q;  2D9U A;  5LL6 S;  2PQE A;  1F9Q A;  4JBJ A;  4RAU C;  4OX9 Q;  1RKN A;  3G6J B;  1AN8 A;  4RGO S;  4LUZ A;  1D5Z C;  1WOC A;  3A55 A;  1GO3 E;  2HIV A;  1H9S A;  2B39 A;  1RL2 A;  2F0F A;  4A3F H;  2UUB Q;  3J7A V;  1ZYR D;  4IPH A;  2SDF A;  3C46 A;  3NQI A;  3K81 C;  4A3M B;  5IYB H;  5KYI A;  4OL7 A;  2XRS D;  3J7Y W;  1B9N A;  1EQT A;  1EIY B;  5JEA J;  2H1E A;  4E6I A;  4JOI C;  2K33 A;  4QQB X;  4KKS A;  1DYQ A;  4NKL A;  1S72 A;  3V2T A;  1VQE A;  2I5H A;  3VA5 A;  2O5I C;  3KF8 B;  1ZKO A;  4CDC C;  2F0J A;  2MHV A;  4DUZ Q;  2QW7 A;  2E2I H;  4JI2 Q;  2OTL A;  1Q1E A;  2WAQ B;  1CK1 A;  1JJC B;  4PV1 C;  3BVM A;  4K2K A;  3T4A C;  3QB3 A;  1WCM G;  3K5O A;  5G3L D;  4DR1 Q;  1EOT A;  3K7A B;  2MJ8 A;  4IJL A;  4LF4 Q;  2JA6 H;  5M5X H;  1PTO B;  1TS4 A;  1B8A A;  3DHQ A;  2MGS A;  2KCT A;  2Z6K A;  5CV4 A;  4DK0 A;  4A3M G;  3S15 H;  4J15 A;  1MSG A;  2OQK A;  2CHB D;  3NP8 A;  5JEA G;  5D14 A;  1BBX C;  1WTV A;  3T1Y Q;  5BN4 A;  3E0J A;  3KLS X;  2EY2 A;  4JI8 L;  5IT9 c;  3UDG A;  3TP5 A;  1IKL A;  4GN4 B;  4LFB Q;  5FLM H;  4K14 A;  1KNE A;  4DNT B;  5IGG A;  5DLQ E;  4X3S A;  5JJL A;  5KRU A;  4BY7 G;  4KHP Q;  1GD7 A;  3A0J A;  1SNM A;  2F0M A;  5FO8 B;  2ICI A;  3VYT A;  1GXD C;  1XPU A;  4JBM A;  3TP7 A;  5C5M A;  3BS1 A;  1WTW A;  1FNV A;  1BDO A;  1EU4 A;  3LNN A;  4LF8 L;  5ELC A;  4QJF A;  1YBY A;  2EYH A;  2K03 A;  1G6P A;  4A3B B;  4LW1 A;  1KXL A;  2NUC A;  4X66 Q;  1II3 A;  5FLM G;  2YTX A;  3NUC A;  1FNU A;  1LT3 D;  5IP7 H;  1WTP A;  5KNC A;  2OWO A;  2A73 B;  2NN6 G;  1AH9 A;  2TSS A;  3S17 B;  3WDN A;  1R9T B;  1UE6 A;  3CC2 A;  3PMF A;  5T1G A;  2B63 G;  4FXG C;  4LWC A;  3MXG A;  2A69 C;  1ASY A;  4DNR B;  2UUA Q;  1TWF H;  1XX8 A;  1NY4 A;  2PPB C;  4HJ8 A;  1AEX A;  5IYB G;  4JI0 L;  1SSO A;  2JK8 A;  2F03 A;  2HDM A;  4ZKC B;  1GM5 A;  3M4Q A;  1HNW Q;  1Y8O B;  3AFP A;  1Y8N B;  1KAA A;  3L0O A;  3J81 E;  5C3W A;  1HR0 Q;  1VQI A;  1ET6 A;  1OO9 B;  2I5M X;  4RKB A;  4A3C H;  2PI2 A;  4LFB L;  1OXU A;  1QVC A;  1WFQ A;  1XNR Q;  1GVP A;  3S2H B;  1HUN A;  1LM0 A;  3OPO A;  3S1N B;  3HS0 C;  1Y8P B;  2PNH A;  4DV4 L;  4KHP L;  5HGT A;  4DR2 L;  1IZ6 A;  2ALY B;  3PQI A;  4HMJ A;  1YIJ A;  1HTL D;  2MPM A;  4GOP A;  2WB1 G;  3EA6 A;  1PH9 A;  3U9S A;  2F0E A;  1KC8 C;  4DR6 Q;  2LS0 1;  3AQQ A;  1EZ8 A;  4HJ5 A;  2DGY A;  4DAY B;  2EOT A;  3AFQ A;  3MFY A;  1G2S A;  4DV2 L;  2NTS A;  1K8A C;  4A3E H;  2FMM A; 
#chains in the Genus database with same CATH homology
 3HOW G;  2GVA A;  3NBH B;  3J81 j;  1Y1V G;  1EIF A;  1HNZ L;  3KFU A;  3S2H H;  2Z0S A;  1CKO A;  1N33 L;  5LMN Q;  5GQO A;  3DLL A;  3GTM H;  4UP7 A;  1K0R A;  1OXX K;  1L1O C;  3D31 A;  2WAQ G;  4P73 A;  4BBR H;  1VQ4 A;  4BXX H;  1JB7 A;  3UDI A;  4GOP C;  5IYC G;  4LF9 L;  3RNU A;  1VQ6 A;  4C3H H;  3M3Y H;  3I56 A;  4DUY L;  3OW2 A;  1VQG A;  3G48 A;  1DGS A;  3T1H L;  2V1C C;  1UWV A;  4PG3 A;  3U4Z A;  1YHB A;  1X3G A;  5M3M H;  3K7U C;  4DV1 Q;  4RMF A;  1PH6 A;  4B3M Q;  1E24 A;  2LSS A;  3GO5 A;  3K8A A;  3KF6 B;  4PZ7 A;  1YJ9 A;  4JI4 L;  2OTJ A;  4X65 Q;  2VQF Q;  4NPS A;  1VQB A;  4KI0 A;  1K73 C;  4A3E G;  3S2D H;  2MNA A;  1I50 H;  4OXP A;  4DV0 Q;  2AHO B;  4A93 G;  2WAQ E;  3RLO A;  4JI6 L;  4C2M H;  3RZD H;  1N32 L;  1PV4 A;  1XPR A;  2I0Q A;  4YCU A;  2E5L L;  5J3B A;  2MO1 A;  2JA5 G;  4KLK A;  1Y1W G;  1HH2 P;  2XTI A;  1QVG A;  1EUJ A;  3W5O A;  3F2C A;  4BBS H;  2F4V L;  4IPG A;  3JAM c;  1SRO A;  3RZO H;  4DV5 L;  3ZJY C;  4PMW A;  4GNX A;  3CCS A;  4BY1 H;  4A93 H;  2VS1 A;  1VQO A;  1X56 A;  1YNX A;  1J5E L;  4IPC A;  3Q8D A;  2ZJP A;  4WJ3 M;  4EX5 A;  4BA1 I;  5M3M G;  4OX9 L;  4JV5 Q;  4L5T A;  4DR5 Q;  1O7I A;  4GN5 A;  4B3R Q;  4JI7 Q;  4LF4 L;  3I4M H;  3VDY A;  3M9B A;  3PCO B;  3CMA A;  2VW9 A;  1SR3 A;  2Q2U A;  3JC6 6;  4A3C G;  4JI8 Q;  2ATW A;  4KHZ A;  1Q7Y C;  2RCN A;  2UUC Q;  4YWM A;  5H1S E;  1RIP A;  1I6H H;  3I4O A;  2ZTE A;  3RLN A;  1Y1W H;  4GKJ L;  3M7N A;  4TVA B;  1WJJ A;  4YY3 Q;  3CCU A;  4GLA C;  1G29 1;  2HIX A;  1QZG A;  1SMX A;  1NBW A;  4JYA L;  4X6A H;  1IBK L;  5M3F H;  4K0K L;  5JJI A;  3PUZ A;  4X66 L;  3E9I A;  2R93 H;  2F3I A;  3I7F A;  1UE7 A;  3B6Y A;  4GKK Q;  1CSP A;  5C4J H;  4XTC S;  2ZM6 L;  2E2H H;  1VCI A;  3TEH B;  4C3I H;  2WFW A;  2VZA A;  2OQ0 A;  1HZ9 A;  2YU9 H;  4DV2 Q;  2AMC B;  1HNX Q;  2IT1 A;  4LFA Q;  3G71 A;  2AKW B;  1PH8 A;  1V9P A;  1E3P A;  2R7D A;  4EQ5 A;  5M3F G;  1JMC A;  1Z47 A;  2GN5 A;  4JG2 A;  4O0A A;  4L5R C;  1X6O A;  4A3F G;  4RG1 A;  3PGZ A;  1PHJ A;  3CME A;  2JJQ A;  1KD1 C;  1A8V A;  4A3I H;  1XMO L;  4BA2 I;  3W1G A;  5M5W H;  4X64 Q;  1N36 L;  3BU2 A;  1JE5 A;  5C0X J;  3CCM A;  2N8N A;  2D0P A;  4QY7 A;  1UE5 A;  3J7A 5;  1X9N A;  4OWW B;  4HIO A;  2LXJ A;  3FP9 A;  2CKZ B;  4HID A;  1SFO H;  3K0X A;  4A3K H;  4A3I G;  2H5X A;  2ES2 A;  4DR1 L;  2LXK A;  1YJN A;  4JCV E;  3OTO L;  3GTQ H;  2YV5 A;  1KAW A;  4Y7N H;  1S40 A;  1BKB A;  1VQJ A;  1IBM L;  3JAM i;  4AYB E;  4DKA C;  2Y0S E;  5IE8 A;  1KRT A;  1EQQ A;  3K80 C;  5IWA Q;  2JA5 H;  2CWA A;  2L15 A;  3NEM A;  4HJA A;  1N34 Q;  1ASZ A;  1IXR A;  4YWK A;  1Q82 C;  3S1N H;  1UEB A;  1CKN A;  1X54 A;  3OYY A;  3KOJ A;  5ELO A;  4JI5 Q;  3GTL H;  2UXB Q;  2IY5 B;  1P8L A;  2VQE L;  4DV5 Q;  1BBW A;  4DR3 Q;  1EFW A;  4JI0 Q;  4AH6 A;  2R92 G;  2R6G A;  4A3L H;  3KJO A;  4NXM L;  3NEL A;  1Q86 C;  2Z6K C;  2KHJ A;  4OWT B;  1WCM H;  4DUZ L;  4IO9 A;  3J81 c;  4BBS G;  1U5K A;  3T1Y L;  1I94 Q;  3PSI A;  3E0E A;  1LTL A;  4LNQ A;  1CUK A;  3GTG H;  3PUX A;  2VY3 A;  4ME3 A;  4A3K G;  2CFM A;  2ZTC A;  3E9H A;  2EQS A;  1CKN B;  1P16 A;  3PV0 A;  1YJW A;  5BR8 Q;  3CPW A;  1MJE A;  2KHI A;  1EWI A;  2ID0 A;  1TWC H;  5JJK A;  3PIP A;  4LFC Q;  1NMF A;  2MO0 A;  3D0F A;  1XNR L;  4P75 A;  5K36 G;  2UXD Q;  4R4I A;  1QUQ A;  1G51 A;  1VS0 A;  3K7A H;  5GRO A;  3F2B A;  4A3J G;  1HR0 L;  4B3T Q;  5IYD H;  4R4T A;  1E1O A;  1HZC A;  4GLX A;  3ULP A;  1EOV A;  4R4Q A;  4H02 A;  3UE1 A;  5C4X H;  4A76 A;  1HR0 W;  3PIO A;  1PH2 A;  3A5Z B;  1S3O A;  1AE2 A;  3BZC A;  2NVY H;  5LMN L;  1C7Y A;  1PFS A;  3HFZ B;  1L1O A;  3CPF A;  4A75 A;  1YI2 A;  1VQ5 A;  2CCZ A;  3H15 A;  4YWL A;  4TQU S;  4OWX B;  1BBU A;  3GTJ H;  1UE1 A;  5C3E H;  5AJ3 Q;  3CAM A;  2QEX A;  1PH1 A;  4LF9 Q;  4DV6 Q;  2UXC Q;  4Y52 H;  1FVI A;  4APV A;  4WJ4 A;  2A1A A;  1Y1V H;  4JI3 L;  1VQC A;  2PQA B;  2BA0 A;  3I2Z A;  4GS3 A;  3S17 H;  4AQY Q;  2UUB L;  4UPA A;  3FHW A;  2YTV A;  1PH3 A;  2CWP A;  4JI4 Q;  2Q2H A;  2E8G A;  5GAD C;  2KCM A;  2HQL A;  2F52 A;  3PUY A;  4AYB G;  4NB3 A;  4A3D H;  2ZTD A;  4DR6 L;  3F8T A;  1SRU A;  2UU9 L;  4IFD G;  1LYL A;  2E2J H;  4JI6 Q;  1N32 Q;  1MKH A;  4LF6 Q;  2PMZ E;  4IOA A;  1L2F A;  1YVC A;  4HJ9 A;  3PO2 G;  2K50 A;  3TRE A;  3AYH B;  1CKM A;  3CD6 A;  3TS2 A;  2VL6 A;  4P74 A;  4NXN L;  5IY0 A;  3LGJ A;  1FJG Q;  4ALP A;  3CC7 A;  3PO3 H;  4OO1 G;  2R93 G;  1VQH A;  3TRZ A;  5GAH C;  3NEN A;  3FKI G;  4A3B G;  1N34 L;  1XNQ L;  5M5Y H;  5C0X G;  2K4K A;  4DUY Q;  3GTK H;  2B29 A;  4MNO A;  4DR5 L;  4B3R L;  4JBK A;  4JI7 L;  2NVX H;  1OXT A;  5C3E G;  1VQ7 A;  1VQ9 A;  1IYJ B;  4LF8 Q;  4DR3 L;  3S1R H;  4BY1 G;  4X65 L;  3STB C;  5ELN A;  3MXN B;  3F2D A;  1A63 A;  5E7N A;  4A3B H;  3RLF A;  4DV0 L;  3T1H Q;  2IX1 A;  2NVT H;  1HZB A;  5FJ8 H;  3CCR A;  4GKJ Q;  4A3M H;  2WP8 J;  4YHH Q;  3KLW A;  3L7Z C;  5GAG C;  1VQF A;  3KJP A;  4MTN A;  3H3V I;  4YY3 L;  1JJ2 A;  3U50 C;  1KQS A;  4B3S L;  2YTY A;  1L1O B;  2BA1 A;  4LUV A;  3HKZ E;  3A5U A;  3HOZ H;  4DAM A;  4DV4 Q;  1XJV A;  3PO2 H;  2PQA A;  4GOP B;  4JI1 L;  4UP9 A;  5BR8 L;  1KRS A;  3DM3 A;  1VQM A;  1Q1B A;  2IX0 A;  2MFI A;  4GN3 B;  3HOV H;  2K52 A;  4DV7 Q;  1MIU A;  4X62 L;  2JA8 H;  1HJP A;  1SLJ A;  1YIT A;  4A3D G;  3PO3 G;  4FDB A;  3HOZ G;  5LMU L;  3ULL A;  4DR7 Q;  1E22 A;  3UDX A;  2NN6 I;  2KBN A;  3HKS A;  1J5E Q;  1XMO Q;  1PH5 A;  2BH8 A;  3A74 A;  5FJ8 G;  4DV3 Q;  4POG A;  1HNW L;  4JBJ A;  3IRB A;  2AWO A;  4OX9 Q;  4UY8 C;  3PUV A;  2JA8 G;  4JV5 L;  4PZ6 A;  3H0G H;  4LUZ A;  3RR5 A;  5AJ3 L;  1WOC A;  3J81 i;  3EBE A;  2VUM G;  4A3L G;  1GO3 E;  2HIV A;  3UE0 A;  4JI3 Q;  5C4X G;  3HOY H;  1RL2 A;  2K5V A;  4X62 Q;  3FKI H;  4A3F H;  4AIM A;  2UUB Q;  1K9M C;  4IPH A;  3S24 A;  2B63 H;  2NZH A;  4GKK L;  3HOV G;  1D7Q A;  3K81 C;  2ZJQ A;  4LF7 L;  2Q2T A;  5EAY A;  1D8L A;  1WI5 A;  5IYB H;  2UU9 Q;  3CQZ H;  1QVF A;  3ERS X;  1Z9F A;  1EIY B;  5JEA J;  4PZ8 A;  1JT8 A;  4JOI C;  1LUZ A;  1YHA A;  4DR2 Q;  3SGI A;  2A8V A;  3STB D;  5IP7 G;  2Q2I A;  1B7Y B;  1VQD A;  4IPD A;  3PF5 A;  4QQB X;  4DV1 L;  1FJG L;  4HJ7 A;  1S72 A;  4DR4 L;  1VQE A;  2JE6 I;  4A3J H;  1XMQ L;  3CP0 A;  2JA7 H;  2I5H A;  1CSQ A;  4YCW A;  4NXM Q;  3CCQ A;  1WYD A;  4QL5 A;  1YHQ A;  2ZJR A;  4QIW E;  1I3Q H;  5GAE C;  3BJU A;  1OXS C;  1K3R A;  3KF8 B;  3G4S A;  1XPO A;  3M4P A;  2K75 A;  3HOY G;  2R7Z G;  1J6Q A;  1I5F A;  1U0L A;  1XTD A;  1OXV A;  2AWN A;  3HOU H;  2B3G A;  2E5L Q;  2R7F A;  3WWV A;  4DUZ Q;  3TQY A;  4XIG S;  3H0G G;  2N78 A;  2E2I H;  3MEF A;  3EIV A;  2F4V Q;  1TXY A;  1VQ8 A;  1GKH A;  2KEN A;  2R92 H;  4JI2 Q;  2OTL A;  1Q1E A;  3CCV A;  1JJC B;  2JEB I;  4BXX G;  4O2D A;  1IBM Q;  1NE3 A;  1W2B A;  4IFD J;  2UUA L;  1WCM G;  1IBL Q;  4DR1 Q;  4LF5 Q;  3M85 A;  3G6E A;  1N33 Q;  3GTO H;  1E1T A;  3EN2 A;  4IJL A;  2JA7 G;  1KIX A;  2HHH L;  4B3S Q;  2YYZ A;  4LF4 Q;  4C3J H;  2JA6 H;  5M5X H;  4HIK A;  5IWA L;  1R9T H;  1A62 A;  1B8A A;  4YCV A;  4QGU A;  4P72 A;  2A19 A;  4R1J A;  2RHS B;  1X55 A;  2KCT A;  2Z6K A;  4A3M G;  1M1K C;  3S15 H;  4DV7 L;  4J15 A;  2FXQ A;  4JI5 L;  4GLV B;  2OQK A;  2UXB L;  5JEA G;  2HT1 A;  2D62 A;  3CCE A;  2ASB A;  3T1Y Q;  1I94 L;  2Y0S G;  4DK6 C;  4JYA Q;  4JI8 L;  5C44 H;  3S14 H;  5IT9 c;  1NJI C;  1C0A A;  3HKZ G;  1TWH H;  4DK3 C;  3UDG A;  4GN4 B;  1MJC A;  4HIM A;  4LFB Q;  3J7Z C;  2ZM6 Q;  5IP9 H;  3W1B A;  5FLM H;  4JC0 A;  3GDE A;  1N8R C;  5DLQ E;  4LFC L;  5JJL A;  1IBK Q;  4IJH A;  4LFA L;  4UP8 A;  4BY7 G;  4KHP Q;  2K5H A;  1Q12 A;  2NZO A;  4JOI A;  1GD7 A;  1K83 H;  4R4O A;  3ICE A;  3A0J A;  1KHI A;  1T9H A;  1X3E A;  1YEZ A;  3ER0 A;  3F1Z A;  4LF7 Q;  4B3T L;  1QZH A;  3KYH C;  1XPU A;  1TWG H;  4JBM A;  3I4N H;  4BY7 H;  2QA4 A;  3CW2 C;  1NTG A;  3GTP H;  1X3F A;  2JEA I;  3H3V H;  2K5N A;  4POF A;  3CXC A;  1N36 Q;  2N3S A;  4LF8 L;  2WB1 E;  4QJF A;  4MZ9 A;  1VQL A;  4A4I A;  3OTO Q;  3RN5 A;  4BBR G;  1YBY A;  3ULJ A;  3TS0 A;  3M4O H;  3I4N G;  2I5L X;  5C44 G;  5IYC H;  1G6P A;  1H95 A;  3CC4 A;  3U4V A;  4LW1 A;  1Q46 A;  1VQP A;  2XGT A;  4K0K Q;  1KXL A;  3HOU G;  4X66 Q;  1JJG A;  2CQO A;  5IP9 G;  2JQO A;  2YTX A;  5IP7 H;  1X65 A;  5FLM G;  1HNZ Q;  1OTC A;  1IL2 A;  4P71 A;  3J80 i;  1VQK A;  1M90 C;  1YZ6 A;  2OWO A;  2NN6 G;  2VUM H;  1AH9 A;  1V43 A;  2K14 A;  1HNX L;  2PI2 E;  4LUO A;  5C0X I;  4A3G G;  1UE6 A;  3CC2 A;  4JI1 Q;  1B70 B;  2B63 G;  1C9O A;  1HZA A;  1V1Q A;  4LWC A;  1ASY A;  1W3S A;  2UUA Q;  2VNU D;  3UDF A;  1IBL L;  1E7Z A;  4LF5 L;  4OO1 I;  1TWF H;  4NXN Q;  4R4C A;  1NY4 A;  1EYG A;  4HJ8 A;  4B3M L;  1SN8 A;  5IYB G;  2RF4 A;  4X64 L;  4JI0 L;  3BZK A;  3CCJ A;  2VQF L;  2JK8 A;  2JA6 G;  5FLX c;  1GM5 A;  2NVQ H;  1PA6 A;  3HOX H;  1FGU A;  3M4Q A;  4DNI A;  1Q81 C;  3CCL A;  1XNQ Q;  4DV3 L;  1HNW Q;  1FL0 A;  3AFP A;  4IFD I;  3J80 c;  4GNX B;  2N49 A;  1EQR A;  4JBW A;  2EXD A;  3L0O A;  1PYB A;  4YHH L;  2IHF A;  2GVB A;  1NMG A;  1HR0 Q;  1VQI A;  3U58 A;  2R7Z H;  3HOX G;  2I5M X;  1PH7 A;  4GNX C;  2D0O A;  4A3C H;  3I55 A;  2PI2 A;  4LFB L;  3KF6 A;  4DPG A;  1VQA A;  3KDF B;  1Y14 B;  1OXU A;  1QVC A;  3RN2 A;  1WFQ A;  4L5Q A;  1GVP A;  1KL9 A;  1QUQ B;  1XNR Q;  2DUD A;  4L5S A;  1LM0 A;  3AEV A;  1PYS B;  2HHH Q;  3S16 H;  4A3G H;  2PNH A;  3KDF A;  2RHQ B;  2VQE Q;  4DV4 L;  4DV6 L;  3I4M G;  2C35 B;  3HOW H;  2IHE A;  4KHP L;  1K8G A;  4DR2 L;  1A0I A;  1IZ6 A;  2OCE A;  2ALY B;  4AQY L;  2QGQ A;  2UUC L;  1BVS A;  4DR4 Q;  2EIF A;  1YIJ A;  3PF4 A;  1XMQ Q;  5LMN W;  1TWA H;  2UXC L;  1VQN A;  5LMU Q;  2WB1 G;  4GOP A;  1PH9 A;  3L2P A;  3S1Q H;  4DR7 L;  1KC8 C;  2BH2 A;  4DR6 Q;  1PVO A;  3PUW A;  5HGQ A;  5IYD G;  1L0W A;  3AQQ A;  4HJ5 A;  2DGY A;  1PH4 A;  4DAY B;  4OON A;  1SE8 A;  3AFQ A;  3CF5 A;  2MQH A;  3GD7 A;  1AE3 A;  5HY6 A;  4JI2 L;  4DV2 L;  1K8A C;  4A3E H;  4LF6 L;  3S1M H;  2UXD L;  2JA9 A;  1N9W A;  4IOC A;  1Q8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...