4A3LH

Rna polymerase ii initial transcribing complex with a 7nt dna-rna hybrid and soaked with ampcpp
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3lH00
4R4TA 3KF6A 2KHIA 4ME3A 2HHHQ 3H0GG 1FL0A 3CCJA 4DV1L 4YY3Q 4OX9L 1VQDA 4A3KH 4JOIA 4HJAA 1NJIC 1L1OC 2ID0A 2VL6A 4GN5A 3RLFA 3DLLA 5IP9H 3PF5A 4LW1A 3I55A 1EYGA 3PUYA 3CCVA 2MQHA 2ZTDA 4RG1A 1S3OA 1SRUA 2CWAA 1LUZA 5C0XJ 5AJ3Q 1M90C 5C0XG 2E2HH 1CSPA 2JE6I 3GTMH 3IRBA 1YNXA 3KDFA 1N34Q 1HR0W 1PFSA 1E3PA 1YVCA 2UUCQ 2ZTCA 3J80i 1K8AC 1PH1A 2HIXA 1HR0L 5IYDG 1IZ6A 1WI5A 1L1OB 1A63A 4BA2I 4KHPQ 3PUVA 4DR7L 1IBML 1TWAH 4C2MH 1PHJA 1S40A 4P75A 4JYAQ 1YITA 1RIPA 4DV0Q 4B3SQ 1VQLA 2QGQA 3KJOA 1D7QA 3EN2A 4A3MG 1B70B 3DM3A 2OTLA 3TS2A 2I5LX 3PCOB 4JI1L 2IT1A 3JAMi 1MJEA 2YTYA 1QZHA 2F3IA 3JAMc 4BY7H 4DAMA 4LF9L 4P71A 4BY1H 1CKOA 4LUVA 4PZ7A 5M3FH 2R92G 4HIOA 3M4PA 4A3LG 1J5EL 2E5LQ 2UXDL 5LMUQ 4B3TL 5IWAL 2CFMA 3PIOA 4NXNQ 4PMWA 2UU9Q 1YEZA 1X65A 3CAMA 2C35B 4BA1I 5C0XI 1XJVA 4JI0Q 4RMFA 3WWVA 4A3FH 4JOIC 1GKHA 2PI2A 2PNHA 3TQYA 1Y1VG 1HNZQ 4PZ8A 4K0KL 4YWMA 1Q7YC 3HKZG 2UUAL 4GNXA 1E1TA 3HKSA 4NB3A 4AQYL 1XPRA 1TWCH 2N78A 3CD6A 4C3JH 1KXLA 2RHQB 2NN6G 4LFBQ 3AQQA 2UXBL 2VQEQ 1UE5A 5JJIA 1X6OA 1KQSA 1K73C 1YZ6A 3E9HA 4JI4Q 2HQLA 3EIVA 1ASZA 4JI7L 1I3QH 4LF8L 4A3DG 4FDBA 1OXXK 2IY5B 4DV1Q 3CPWA 1W2BA 3S2DH 1HJPA 4IPDA 4HIKA 1I6HH 3BZKA 4YCVA 3Q8DA 4DV3L 1A62A 1XTDA 3F2BA 2IX0A 1CKNA 5LMNW 2Y0SG 1D8LA 1VQEA 4R4OA 2PI2E 4X6AH 1T9HA 3TS0A 3MXNB 3VDYA 1VQJA 1FGUA 1HR0Q 5IY0A 1X56A 4XTCS 2B63G 3K0XA 2GVAA 3T1HL 1SROA 2XGTA 3FKIH 1VQPA 4L5QA 1XNQL 2OCEA 4A3EG 1IBMQ 4DR7Q 3A0JA 4QL5A 1PH6A 3HOVH 3FP9A 2WFWA 1L2FA 4X65L 4O2DA 2NN6I 4IPHA 2WP8J 2D62A 3AYHB 3BU2A 1U5KA 5GADC 2MFIA 5DLQE 5C44H 2R7ZG 1LTLA 4GNXC 4LFAL 5FLXc 5JJKA 4JI1Q 4JI8L 5IP7G 4L5RC 3GDEA 3RN2A 4LF9Q 4DK6C 3K7UC 3J81j 1YJWA 1IBKL 5GAEC 1XNRL 2N3SA 4GN3B 1WCMG 1PVOA 4HJ9A 3U58A 1ASYA 1J5EQ 1H95A 1K9MC 1PH4A 2VUMG 5M3MG 2UXDQ 4B3TQ 3S1MH 3PUWA 5IWAQ 1GD7A 4NXML 2AMCB 1XMQL 3HOXH 1KIXA 4GNXB 1I50H 2JA7G 4A3BG 4TQUS 3CXCA 3D31A 4K0KQ 3FHWA 4DV4L 1X55A 2BA0A 2D0PA 2UUAQ 1HH2P 1YJNA 1NTGA 2LXKA 4AQYQ 3ULPA 3CCSA 4IPCA 4BXXH 4EX5A 3I4NG 3NEMA 1U0LA 1E7ZA 5IYDH 1Q81C 5IYCG 2NVXH 2Q2IA 4YHHL 4LF4L 3CP0A 2UXBQ 3OTOL 4GKJQ 2UXCL 3CW2C 4DUZL 1KRSA 1YJ9A 1PH5A 3RLNA 1YIJA 2R7FA 2KCMA 4IJHA 4JI7Q 1NBWA 2D0OA 4LF8Q 4A3MH 3HOWG 3GTLH 5BR8L 2R93G 4QIWE 3TREA 4XIGS 3PO3H 1GO3E 2KCTA 2NVQH 5HY6A 1HZAA 3M3YH 2JA6G 4A3IG 3S16H 4WJ3M 1TWGH 2JA5G 4BBSG 4DV3Q 1KD1C 3BJUA 5J3BA 3U4ZA 2H5XA 1PH2A 4JBMA 1KAWA 1IXRA 5GAGC 4PG3A 1VQ9A 4A3JG 2R92H 2ZJQA 2JA8G 4ALPA 2RCNA 1YHBA 1SR3A 2V1CC 3RR5A 1Q86C 3KJPA 1PA6A 3I4MH 5GAHC 1NY4A 4P73A 4HIDA 5GROA 1N36Q 2K5HA 3PGZA 2LXJA 1KL9A 4WJ4A 5FLMH 3T1HQ 2NVYH 5GQOA 3PO2G 1XNQQ 1EQQA 2Q2UA 1YHQA 4OO1G 4X65Q 3AEVA 3D0FA 3ICEA 2MO1A 3PSIA 1P8LA 5FJ8H 2N49A 2K4KA 4GLAC 4A3GH 4B3RL 5M5WH 3W1GA 2NVTH 5K36G 1IBLL 4LFAQ 1EQRA 4IO9A 1OTCA 4JI8Q 4UPAA 1HNWL 1UE6A 4X62L 4AYBE 3M4OH 1YBYA 3HOYH 2YTXA 2UUBQ 1IBKQ 1XNRQ 3S17H 1VQHA 3RNUA 1WYDA 1E1OA 4UY8C 4P74A 1B8AA 4JG2A 1FJGL 2VZAA 1Y1WH 1C0AA 3M9BA 2YTVA 2CQOA 3H3VH 4NXMQ 1XMQQ 4LUZA 2VQFL 1BBWA 3PIPA 2I0QA 1CKMA 3CPFA 5IP9G 4DR3L 3HOUG 2Z0SA 1K83H 1C9OA 3F2DA 3GTPH 3PUZA 1O7IA 4DV4Q 1EWIA 4HJ5A 4JBJA 3CQZH 3KF6B 1VQGA 2BH8A 4MTNA 3AFPA 4P72A 1I5FA 1HZCA 1AH9A 1K0RA 3B6YA 3CC2A 4OO1I 1IYJB 3I2ZA 3ULLA 4YHHQ 4LF4Q 2ZJPA 1GVPA 4GLVB 3CMEA 3OTOQ 2UXCQ 1J6QA 3CC4A 3K7AH 4A3EH 4DUZQ 1OXSC 2KHJA 2ASBA 4JI3L 5C4XH 1UE1A 4OX9Q 3S1NH 1VQNA 4X64L 3KDFB 3EBEA 4UP8A 4L5TA 4AIMA 5BR8Q 4B3ML 2E8GA 1KRTA 2WB1E 2PQAA 4A3CG 4DR2L 3PUXA 5IP7H 3K80C 4A76A 1AE3A 2MO0A 1E24A 4YCWA 2ZM6L 1N33L 4GOPA 4BY1G 3BZCA 5LMNL 5IYBG 5M3FG 2OWOA 1NMGA 3JC66 4OWXB 4QGUA 1E22A 1XPUA 4QY7A 4IFDJ 4POFA 1V9PA 3GD7A 3CCMA 3GTJH 1N32L 4GLXA 4X66L 4DV5L 3G48A 3STBD 4OWWB 2F52A 2OQKA 2L15A 3S1RH 4DR6Q 1EUJA 1QZGA 1VQKA 1X3FA 1Z47A 3S15H 4MZ9A 2R6GA 2WAQE 3S2HH 2B3GA 1VCIA 3F2CA 5C4JH 4B3RQ 1QVCA 1IBLQ 2OQ0A 1TWFH 4QQBX 4BBRG 3S24A 1AE2A 1HNWQ 4R4CA 5C3EH 3HOZG 4DNIA 2IHEA 2RHSB 3A5ZB 3H0GH 3HFZB 4YCUA 1LM0A 5ELNA 1QVGA 1FJGQ 3UE1A 2JA5H 2HIVA 2K5NA 1L1OA 2K75A 4Y7NH 2VQFQ 1JJ2A 4A3IH 3KYHC 4DR3Q 2FXQA 1JE5A 4IOCA 2RF4A 4A3JH 3GTOH 4IFDI 2K14A 3J7A5 4GOPC 4JI2L 4OWTB 1CUKA 1XPOA 2YYZA 3F8TA 1NMFA 4L5SA 3L0OA 2AWNA 4DPGA 4LF5L 4DV7L 1NE3A 3KFUA 1P16A 3A74A 4J15A 3UDFA 4JI3Q 2K52A 1UE7A 1N9WA 1CKNB 1Q8KA 4HJ7A 1HZ9A 4HJ8A 1HNXL 3GTGH 4A93G 1VQ8A 4X64Q 4GOPB 3AFQA 2OTJA 2CWPA 4A75A 4B3MQ 3H15A 1XMOL 1JT8A 1TWHH 4R4QA 3NBHB 4KI0A 4DV2L 1S72A 1OXUA 2ZM6Q 3TRZA 1N33Q 1V1QA 4A3LH 3GTQH 2VY3A 3T1YL 2EQSA 2Q2HA 1VQFA 5LMNQ 1K8GA 4DR5L 3I56A 2LSSA 1SMXA 3M85A 1G51A 3E0EA 4C3HH 4JBKA 1I94L 1N32Q 2CCZA 3I7FA 4X66Q 4DV5Q 3HOXG 3I4OA 1RL2A 1Y1VH 1Q46A 2BA1A 2N8NA 3HOUH 2AWOA 5HGQA 2ZJRA 4DUYL 2JEBI 4JBWA 3RLOA 4LF6L 1VS0A 3PV0A 4DR1L 2Z6KA 2VNUD 4HIMA 4GKKL 1X3EA 4BXXG 3ZJYC 3UDXA 3J80c 2DGYA 3RZOH 1JMCA 3UDGA 2E2JH 1HZBA 2AHOB 2F4VL 4LNQA 4A3DH 5JEAJ 2E2IH 5JEAG 5IT9c 2K5VA 1EIYB 1CSQA 4IJLA 2ALYB 4LFCL 3W1BA 4A3KG 3GTKH 4JCVE 3E9IA 4EQ5A 3OYYA 3ER0A 3HKZE 4A3CH 4DR4L 3CCQA 4C3IH 1SLJA 4H02A 3PO3G 2GN5A 1EOVA 1M1KC 1PH7A 4LF7L 1BVSA 1JJGA 4JI5L 3S1QH 1VQAA 3G4SA 3K81C 5IYBH 4A4IA 4KLKA 3NENA 4JI2Q 4AYBG 5IE8A 3KLWA 2B63H 3LGJA 1W3SA 4JV5L 1R9TH 5EAYA 1VQCA 3M4QA 3I4MG 4DAYB 2A1AA 3CCRA 1SFOH 4LF5Q 2B29A 4DV7Q 5FLMG 4DV6L 3RN5A 2ES2A 1B7YB 3PF4A 1QVFA 1VQ4A 4IPGA 2I5MX 4PZ6A 3M7NA 1HNXQ 2R7ZH 2AKWB 1FVIA 2R7DA 3G71A 1PH9A 5E7NA 2JA9A 5FJ8G 1C7YA 4JI6L 2Z6KC 4A3GG 1A8VA 2Y0SE 4QJFA 4UP7A 2QEXA 1XMOQ 4MNOA 4BBRH 1IL2A 1LYLA 1GM5A 4BY7G 1OXTA 3CCEA 4DV2Q 1VQ5A 3J81i 2JEAI 4IOAA 1WCMH 3HOZH 4DR6L 4GKJL 2JQOA 1V43A 1PH3A 3HOYG 3T1YQ 3L2PA 3SGIA 5M3MH 3J81c 1YI2A 2VUMH 4UP9A 1Q1EA 1UWVA 1VQBA 4DR5Q 3RZDH 2HHHL 1SN8A 3ULJA 1PYBA 4OXPA 1QUQA 4YY3L 2ATWA 4IFDG 1BBUA 1Y1WG 1G6PA 4YWLA 2GVBA 1I94Q 3OW2A 2JA7H 4A3BH 2MNAA 2NZOA 1SE8A 4A3FG 1K3RA 1TXYA 5AJ3L 4DUYQ 1VQIA 2WB1G 2EXDA 4KHZA 2BH2A 3TEHB 4LF6Q 2A8VA 1N34L 1X54A 4DR1Q 3I4NH 4APVA 3G6EA 3K8AA 2UUCL 4LWCA 5IYCH 1YHAA 4GKKQ 4X62Q 1MJCA 3S14H 3ERSX 4DKAC 4KHPL 1N36L 4DK3C 4JYAL 4B3SL 4DV0L 2NZHA 2ZTEA 1VQ6A 2F4VQ 2DUDA 3HOWH 3KOJA 2CKZB 5C4XG 1X3GA 4GS3A 2R93H 4A93H 1WFQA 4LFCQ 2IHFA 4R1JA 2YU9H 5JJLA 3CCUA 3NELA 1JJCB 1L0WA 1Q1BA 2JA6H 4JC0A 2WAQG 4BBSH 4DR4Q 3U4VA 4AH6A 3CF5A 2KENA 2YV5A 5M5YH 4LUOA 4LF7Q 2VW9A 2JA8H 1MKHA 1Q12A 3U50C 4JI5Q 3H3VI 5ELOA 2E5LL 2UUBL 3J7ZC 1Z9FA 4O0AA 5LMUL 3A5UA 2EIFA 4NXNL 3MEFA 2UU9L 1PYSB 1WOCA 2A19A 4OONA 4JV5Q 4Y52H 2IX1A 2I5HA 2Q2TA 2JJQA 3FKIG 1Q82C 4JI0L 3PO2H 1G291 2K50A 2PQAB 4NPSA 1WJJA 2JK8A 3CC7A 1VQ7A 4DV6Q 2XTIA 3UE0A 3W5OA 1HNZL 1KHIA 2KBNA 1VQOA 1X9NA 3HOVG 4YWKA 1KC8C 1EIFA 5H1SE 2QA4A 3L7ZC 2VS1A 3GO5A 1PH8A 5C44G 3F1ZA 1DGSA 4DR2Q 1EFWA 3STBC 1MIUA 4JI6Q 2PMZE 1PV4A 4POGA 4LFBL 1BKBA 2HT1A 3KF8B 4R4IA 1QUQB 2VQEL 5M5XH 1UEBA 1A0IA 1VQMA 1OXVA 3UDIA 1N8RC 3CCLA 4JI4L 1JB7A 3CMAA 1Y14B 5C3EG 4TVAB 4GN4B
chains in the Genus database with same CATH superfamily
3KF6A 1FL0A 4DV1L 1VQDA 3TDQA 3C46A 4PMCA 3Q6SA 4RWSC 1Q3LA 4LW1A 3I55A 3PUYA 4M1UB 1EY4A 2MQHA 2SNSA 4RG1A 1IYUA 2E2HH 2JE6I 5IGCA 3PIP3 1N34Q 1HRJA 1PFSA 1E3PA 4IUPA 2J7ZA 2DJFC 2ZXOA 3WDNA 1IZ6A 4ZRZA 4KHPQ 1SAPA 1TWAH 4C2MH 2B2YC 3A8IE 4P75A 1S40A 1YITA 4JYAQ 4FXDA 1RKNA 2KCNA 2QGQA 3KJOA 1I4QA 1D7QA 4A3MG 5DM73 3DM3A 3PCOB 4ABNA 5I6WA 2F0HA 2BDNA 2DJGC 3QR8A 3GTLB 4JVZA 4P71A 1CKOA 4BY1H 4LUVA 4PZ7A 3X3MA 2NVQB 3ITPA 3MXGA 4HSPA 1GUTA 2CFMA 5FO7B 2R92B 4PMWA 5KRUA 1YEZA 1JORA 2C35B 4BA1I 4K5VA 4RMFA 4A3FH 4JOIC 1Y1VG 2G5DA 1HNZQ 4K0KL 3DUZA 1Q7YC 2NVYB 4GNXA 3RMHA 4NB3A 1WTOA 1PYWD 2HQEA 1LT3D 2N78A 1Y8NB 1GUGA 1LTRD 3HKZB 4LFBQ 1UE5A 2XWJB 5JJIA 3E9HA 4JI4Q 1XYIA 1PTOB 4XQQA 1HPCA 1I3QH 4JI7L 4XQJA 3HOYB 4KKSA 1EY5A 4DV1Q 3CPWA 2K04A 1HJPA 4IPDA 2NBFA 3Q8DA 4DV3L 3A8KE 3QJYA 4LJZC 1CKNA 1I4RA 2OT2A 3BVMA 5CC4A 5LMNW 2PI2E 3TMEA 3VDYA 2JN4A 4ILWA 1FGUA 4M8AA 3DHQA 4K2LA 4CDFC 3J7AV 3OW7A 2WFWA 2NN6I 1ET9A 4IPHA 2D62A 2LMCB 5DLQE 1LTLA 1ZKOA 5IP7G 3RN2A 1YJWA 1XNRL 2EJFC 4CDCC 5IODA 1ASYA 1V1PA 2XRQD 1PH4A 2VUMG 5M3MG 1Z6HA 3HOXH 4EQPA 1KIXA 4GNXB 4R8NA 5CR3A 4KK7A 2O5IC 2EY2A 3K5NA 4QUCA 3CXCA 3D31A 4K0KQ 5EPJA 3R2TA 1O7LA 3OMGA 4A3BB 1WVLA 2L1BA 2LXKA 3S1RB 4ODGA 1YNND 1HHVA 2A5HA 3NEMA 1O78A 5IYCG 2B2UC 4J6HA 4LF4L 1XWEA 3CP0A 2F0WA 2UXCL 5FK9C 4DUZL 1FYCA 4JI7Q 4EVOA 3PO3H 2HDLA 1FNVA 3NWSA 5HY6A 3M3YH 2JA5B 3S16H 3HOWB 1JWSD 4DV3Q 1KD1C 2H5XA 4OL7A 4JBMA 1HA6A 4PG3A 1PXUA 2V4DA 2JA8G 2RCNA 3RR5A 1Q86C 3KJPA 4C56C 2F4IA 3LWUA 2LXJA 4WJ4A 5FLMH 3KLSX 2PW7A 3PO2G 1SXTA 3AEVA 1EQVA 3D3RA 1JWMD 2MO1A 5FJ8H 4RGMA 4GLAC 4A3GH 4B3RL 3W1GA 5K36G 4MHEA 1EQRA 4IO9A 1OTCA 1UE6A 3NHHA 2DY7A 3E3XA 5IGFA 1XNRQ 2KUMA 3RNUA 4UY8C 3QB3A 4P74A 2VZAA 1K28A 3VYUA 1TS2A 3QO2A 1YNNC 2B2TA 3F2UA 2K01A 2I0QA 2WIIB 3CPFA 5IP9G 4DR3L 2Z0SA 1K83H 2EYMA 3BDLA 4C3HB 2IX3A 3GQBA 2VB3X 3K5MA 4Q0FA 3HOUB 3J7YW 2KA7A 4CHTB 4P72A 1I5FA 1BCPF 1AH9A 1WTHA 1PRTC 4E6IA 4OO1I 4LF4Q 3CMEA 1EWHA 2UXCQ 3K7AH 2L9HA 3CRLC 4DUZQ 2BCOA 4A3EH 2ASBA 4F8MA 5C4XH 4OX9Q 5IGGA 4LAAA 3Q23A 2E2JB 4L5TA 4A3DB 1CFMA 1FNUA 2GA4B 4QF4A 3PUXA 2BDOA 3TP6A 2ZM6L 5LMNL 4QGUA 1FNWA 1XPUA 1ZYRC 2PQEA 3NBHA 3KF8A 1F2LA 1H9MA 4GLXA 5M3FB 2X6LA 2F0MA 2F03A 1WTVA 1RD9D 1R9TB 4OIJA 1QZGA 4FNFA 1X3FA 1STEA 1Z47A 2R6GA 3J81E 3LWEA 4DAPA 4B3RQ 1CK1A 1QVCA 4HR7B 3K59A 4C3JG 4BBRG 4KKUA 4CJ2C 1AE2A 1ONLA 3TP7A 3HOZG 5KNDA 1LTAD 3HFZB 2A68C 2M00A 2QDBA 4Z9CB 5CV8A 1G6ZA 3H6MA 2K5NA 2RDHA 1L1OA 1F2MA 3D8GA 4Y7NH 1KABA 5J39A 1JJ2A 3VYTA 4A3IH 1VMCA 4DR3Q 1JE5A 5HURA 2RF4A 4J1MA 4H7BA 3R3OA 4A3JH 4IFDI 1PMRA 4JI2L 1E2WA 3SXHA 2I07B 1XPOA 2MUYA 2F0PA 3EVQA 1ZEQX 5IT9L 4DV7L 5BN4A 2R3ZA 1CM9A 4J15A 3T56B 2K52A 1UE7A 4G57A 1HNXL 3GTGH 4A93G 1VQ8A 1MGSA 1SYGA 5NUCA 3KUPA 2A73B 4A75A 2ZT9C 1TWHH 4R4QA 3NBHB 2YU9B 5EPKA 2ZM6Q 5LMNQ 1LT6D 4I7AA 2K7VA 5IGDA 3E0EA 1D1IA 1UNSA 2F0DA 2CCZA 5FOBB 2BOSA 1Y1VH 2BA1A 2F0LA 1HFNA 2JXMB 4LF6L 2Z6KA 2VNUD 4QIWB 4CKCA 4HIMA 4GKKL 1PTOF 5IIFA 3ZJYC 2WACA 3J80c 2R61A 3UDGA 3EFXD 1HZBA 1X3QA 3MXNA 3T53B 2E2IH 1X3PA 3GTKH 4IJLA 1C48A 4OHJA 4HCEA 1AZPA 3DMUA 4EQ5A 5K5PA 3HKZE 1SLJA 3E5SA 3NBIA 2IWHA 4LF7L 3L9AX 1JJGA 4JI5L 2QKIC 1TY0A 5IYBH 2C5CA 4A4IA 3SK8A 4JI2Q 5LL6X 1OO9B 3GTMB 3LGJA 1W3SA 2I46A 3I4MG 4HN7A 4DV7Q 4DV6L 1GJXA 3KLRA 1U4PA 4DGZA 5JVG3 1HNXQ 3G71A 1C7YA 5E7NA 1AEXA 2JA9A 1BF4A 1A8VA 4UP7A 4MNOA 2AQ2B 1IL2A 1LYLA 1GM5A 1OXTA 4DN4M 1A3UA 1SJED 3HS0C 2XIWA 3L2PA 2VUMH 5M3MH 3HOYG 4XT1B 4BY7B 4UP9A 1EU3A 3RZDH 2HHHL 1QE6A 1QUQA 1BBUA 1Y1WG 3IAYA 3EQLC 1G6PA 1H9RA 3CKIB 2P5ZX 2MNAA 4A3FG 2IW3A 1Q8IA 2B2WC 4LF6Q 1STAA 2UUCL 5IYCH 4GKKQ 3K5OA 2LY7A 4NKLA 3CQZB 4DV0L 2LS01 2NZHA 3A8JE 1VQ6A 2DUDA 1HUNA 2J4XA 2CKZB 2QF7A 1O7ZA 1WFQA 4K5XA 4X3UA 3NELA 1JJCB 1B44D 1L0WA 2F0EA 4JC0A 2WAQG 2WV6D 4DAVA 2Q8IB 1QJOA 2KENA 3NTHA 5M5YH 2EYLA 4LF7Q 2VW9A 2JA8H 3J7AF 1Q12A 5EJWA 2EYPA 4XYQA 4JI5Q 2E5LL 3H3VI 2EIFA 2UU9L 3T51B 2B2YA 2JJQA 3PO2H 3CC7A 4DV6Q 2XTIA 1F9RA 3UE0A 2KBNA 1X9NA 1KC8C 5IGBA 4KHVA 4CKBA 2F0JA 1TQOA 2CVRA 3HOVB 4IUVA 2XVSA 3F1ZA 1MD2D 3GV6A 2HCCA 1EL0A 1QUQB 5M5XH 1A0IA 1JB3A 3CCLA 4ZKBB 4TVAB 4R4TA 3ZYYX 2HHHQ 3CCJA 1A2TA 4A3KH 4JOIA 2JA5G 1L1OC 3DLLA 4KV6A 3PF5A 5IP9H 2H4OA 3H91A 1EYGA 4C1NK 5I9OA 3CCVA 5D3IB 1S3OA 1SRUA 3ND9A 1LUZA 1M90C 1I50B 1I4HA 4NMZA 1YVCA 2UUCQ 4I65A 2F0GA 1PH1A 1KDAA 1HR0L 4BA2I 3GTOB 3HP3A 2X69A 3R8BA 1HCZA 4DR7L 4DV0Q 2NVXB 4K6DA 3EA6A 1VQLA 4IURA 3EN2A 5A2QE 3AMUA 5C4ZA 3W2DA 4X3SA 2OTLA 2KVMA 2CHBD 4QB4A 3JAMc 4LF9L 3TZUA 1W6KA 1STGA 4HIOA 2QCPX 3NPPA 2E5LQ 5I4DA 1D5XC 2WINB 3NQIA 3UI2A 1S5BD 2UU9Q 1SYBA 5C0XI 1LO5D 1QILA 1U4LA 1ICFB 1KLGD 1QB5D 3VYSA 4ZQ3A 2EYOA 1A3VA 2UUAL 1XPRA 1TWCH 3AU7A 4C3JH 2RHQB 2NN6G 2UXBL 1CA5A 5M5WB 1X6OA 2A69D 3T13A 1IW7D 2D2CC 3EIVA 1ASZA 4A3DG 2IY5B 1H9JA 1W2BA 1I6HH 2RBMA 1JR0D 4YCVA 1A62A 1XTDA 2KHSA 4XDXA 4C3IG 2PZUA 1R4QB 4L63B 2Y0SG 1T9HA 5JAVA 2RVLA 2B2UA 3GTPB 1VQJA 1HR0Q 2KJXA 1NNXA 3K0XA 3FKIH 1GHJA 2OCEA 3TP5A 4A3EG 4DR7Q 2MHVA 4O2DA 3AYHB 3BU2A 4XYOA 5CBAE 3FVQA 2MFIA 5G3LD 5C44H 5FLXc 4L5RC 2HUGA 2R7ZB 4LF9Q 4TRDA 4DK6C 3J81j 1IBKL 5GAEC 2N3SA 1CQFA 1H95A 3U58A 3D6CA 1T5EA 5EKLA 3PUWA 1GD7A 4NXML 2IPKD 1EOTA 3BDCA 3G7LA 2A69C 2K32A 2RCFA 4TQUS 3SVMA 4RAUC 4ULLA 5CV9A 4DV4L 2L11A 2UUAQ 2D0PA 2JA7B 1YJNA 3CCSA 4FF1A 2B2VC 3S2HB 1E7ZA 2A6HD 5IYDH 4CKEA 1V8QA 2Q2IA 2UXBQ 3SK6A 3Q0AA 4EQNA 5EQ0A 3CW2C 1TWFB 3HGBA 3RLNA 3SDZA 5C3EB 1F9QA 3BYYB 4DU9A 5JOBA 3GTLH 3H0GB 1HFGA 4QIWE 3KBXA 4XIGS 1GO3E 4WJ3M 3FEWX 4FF4A 4RCOA 2NVQH 3BG3A 4A3IG 1TWGH 1U9RA 2R93B 1PH2A 2RKSA 5GAGC 1VQ9A 4A3JG 2JA6B 2NUCA 4UDUC 2R92H 1SR3A 1PA6A 5KYIA 3I4MH 1UAPA 4P73A 1N36Q 1RTOA 2K5HA 2Z4HA 1CA6A 1WTQA 2NVYH 5I6YA 1ESFA 4IQZA 2Q2UA 4OO1G 4ZK9B 5FO9B 1D5MC 2FJ2A 3PSIA 1B3AA 1DJRD 1Y8OB 2RDFA 3N6RA 1XXGA 3SEBA 5M9OA 1IBLL 3R2IA 1PTOH 4X62L 1YBYA 3HOYH 3V05A 2IJ0A 3MC0B 1IBKQ 1VQHA 1VMPA 1C0AA 1B8AA 2AQ3B 1Y1WH 3M9BA 2YTVA 4B9WA 4NXMQ 2A6HC 1BBWA 2NZ1D 1DD2A 3HEJA 1C9OA 1MSHA 1CZGA 4DV4Q 3KF6B 1VQGA 2BH8A 1O7YA 5CORA 4F7XA 4G4KA 1K0RA 3B6YA 3CC2A 4N9PA 3BDOA 3I2ZA 4ZCKA 3ULLA 5KYLA 4HTHA 3MZ5A 2HD3A 3Q24A 2F0SA 3A7AB 1OXSC 2EY5A 3QIAA 3MEHA 1VQNA 3EBEA 1GUSA 1G8ZD 3T16A 1KRTA 3N52A 2A74C 1PRTB 1AE3A 1N33L 3C1FA 3MHBA 5C3XA 5IYBG 1EY0A 2E74C 3JC66 1E22A 5I9PA 2BE5D 4BY1B 3S1QB 1U4RA 4DV5L 5KEEA 3G48A 2B63B 3S1RH 1VQKA 1LTID 4IUTA 2B8FA 1B9MA 5ELEA 5C6AA 1PDQA 1IBLQ 2OQ0A 1GUNA 4J8QA 4EQOA 4R4CA 3TZDA 4DNIA 2IHEA 2K1BA 1C8CA 1DOKA 3SHLA 2F0FA 5ELNA 2RQXA 2DY8A 4GZYC 4BS9A 2JA5H 4ZUJA 1GUWA 2K75A 3M4YA 3BVZA 1I3QB 3KYHC 2Z4IA 3S9WA 4ZUIA 1HXYD 4GOPC 5ELDA 1DOMA 1JCKB 3FRPB 1NMFA 4IALA 3Q22A 3I4NB 1SYEA 4H13C 3QWNA 3I8ZA 4HJ7A 1CKNB 1Q8KA 4DAYA 1HZ9A 1F2ZA 3AFQA 2OTJA 2MGSA 1XMOL 4KI0A 1OXUA 1N33Q 1F77A 2EQSA 2Q2HA 3A55A 3OPOA 1PTOD 2JP1A 1SMXA 1G51A 2DNEA 4C3HH 5DNFA 4DV5Q 3DEOA 1B1ZA 1Q46A 3HOUH 2AWOA 1JE4A 2EJGC 5HGQA 3HOXB 3SK4A 5EBCA 1V1PB 2NN6H 3GP7A 3CRKC 2F0QA 5T1IA 4BXXG 2N88A 3NWTA 1JOOA 3O13A 2DGYA 3C3LA 3RZOH 4N8X1 2E2JH 1SNCA 3HRZC 4A3DH 5EKKA 2F3VA 5JEAG 1EIYB 3W1BA 4A3KG 3TBIB 4A3CH 4DR4L 4C3IH 4H02A 2B2WA 2CW0D 1H9SA 2IL8A 1PH7A 1X32A 2A6ED 1NCVA 3PO3B 1VQAA 3K81C 3S16B 4NP5A 4V190 3FMCA 3KLWA 4JV5L 1R9TH 3M4QA 4DAYB 1SFOH 4PMBA 2F0VA 4AYBB 1LTSD 2NTSA 1VQ4A 2I5MX 1BXTA 4QJFA 2D5DA 1XMOQ 4HSVA 5D3DA 1KNAA 3CCEA 1VQ5A 4IOAA 4WJWA 3U9OA 4DR6L 4GKJL 2K28A 1PH3A 1STBA 3J81c 1YI2A 1UWVA 1VQBA 1SN8A 4YY3L 1PYBA 1SEBD 4DXFA 1KNEA 2B8GA 4EGVA 1EYAA 2NZOA 4KN4C 5EPLA 1BDOA 3C2PA 5AJ3L 2EYJA 1VQIA 4KHZA 2EXDA 2JYOA 2A8VA 5ELCA 3K8AA 2WB1B 4PQXA 3S14H 4DA2A 2F0OA 4DKAC 4FXKC 1NR4A 3P75A 4DK3C 2CW0C 3DWQA 2A6EC 1DXMA 1H9SB 3I3CA 1X3GA 4GS3A 2YU9H 3CCUA 1BQQT 4N8FA 1Q1BA 5C4XB 1TVXA 3WOEA 4DR4Q 4AH6A 3S2DB 1G91A 3A56A 3U50C 1WD0A 5ELOA 2UUBL 2EXZA 1KDBA 3J7ZC 1Z9FA 4O0AA 5LMUL 1IKLA 5KNBA 4NXNL 3MEFA 4JV5Q 2A19A 1Y8PB 1RTNA 1V1OA 3FKIG 1SMYD 2K50A 4XT3B 1WJJA 2F3WA 2JK8A 2QILA 1VQ7A 4OO1H 1BUVT 1KHIA 1VQOA 2LFNA 4JW0A 5H1SE 2ZXPA 3JAML 3L7ZC 1AP0A 5C44G 3MA2B 2LKVA 1GXDC 3A7LA 1SDFA 1MIUA 5CV5A 3KF8B 4R4IA 3V2TA 1UEBA 1TY2A 1VQMA 5FKAC 5HGTA 4DR6Q 5C3EG 1A15A 2OF1A 2KHIA 3H0GG 4YY3Q 1A2UA 4CJ0B 2K5WA 4HJAA 1NJIC 2VL6A 4G7ZC 3ERQA 3S1MB 1PFMA 2NTTA 4WORA 2SEBD 4L6TB 5AJ3Q 3GTMH 5C0XG 1CSPA 3IRBA 1YNXA 3KDFA 3P7JA 4Y7NB 1HR0W 1K8AC 1VF7A 5IYDG 1WI5A 2J0TD 2OEOA 1L1OB 1A63A 3D4WA 4ME5A 3HG9A 1RF2D 1PHJA 5DAUA 5JPNC 1QG7A 1RODA 2KEDA 1BR9A 1PRTF 1KTKA 1B70B 5CMDA 2OXPA 5A35A 3PQIA 1QCBD 4JI1L 3JAMi 1MJEA 2YTYA 4A3MB 5ELBA 1QWYA 4BY7H 4DAMA 3GTGB 3NQTA 1J8IA 3QG1A 2R92G 1J5EL 1LV9A 1TWHB 2UXDL 5LMUQ 4B3TL 5IWAL 4KY5A 4IFDH 3PIOA 4NXNQ 1L0XB 1K0SA 1X65A 3CAMA 3VR5A 2EZVA 5J22A 1XJVA 3WWVA 1GKHA 2PI2A 2PNHA 5BN3A 4PZ8A 5FLXL 2TSSA 3HKZG 1ICWA 2TMPA 1Y1VB 1ILQA 1KXLA 4I7ZC 1KQSA 2NVTB 1YZ6A 2HQLA 3OWEB 5LL6S 2L12A 3M4OB 3MFYA 1G2TA 1LTGD 4O1NA 4KD4A 4HIKA 4WRDA 3F2BA 2CH4W 4R4OA 1D8LA 1VQEA 2B2VA 3TS0A 3MXNB 3ND8A 1FGBD 5IY0A 1X56A 2B63G 4DNTB 2ICEC 1PFNA 1VQPA 1SROA 1XNQL 1CI3M 4QL5A 1PH6A 3HOVH 1L2FA 1GUOA 2L55A 2WP8J 5GADC 5L37A 1ET6A 4JPBW 5JJKA 4JI1Q 1IYVA 1CQVA 5C5LA 3S1NB 3C1EA 3TSSA 4KMUC 5IGEA 1EQTA 1YNJD 2O4XA 5ELFA 4YIJA 4KJNA 1QNKA 1D5ZC 4HJ9A 1J5EQ 1K9MC 2UXDQ 2CH4A 4B3TQ 5IWAQ 1T5XD 2AMCB 2XRSD 2RA4A 1XMQL 2VUMB 2EPBA 1I50H 4A3BG 4S3SA 1EEFD 2AUKA 2BA0A 4RGTA 5D65A 3VA5A 1NTGA 3IFTA 3ULPA 1EIGA 5FO8B 4BXXH 4EX5A 3I4NG 3S15B 1U0LA 5IOCA 3NP8A 1BO0A 5C5MA 3VR2A 2NVXH 5C4JB 3OTOL 1WTWA 1SE2A 1U4MA 1KRSA 5JEAH 1PH5A 1YIJA 4FYDA 2R7FA 4FO2A 3HOWG 5BR8L 5JJZA 2QEJC 1SE3A 3OIPA 1KAWA 1IXRA 4CDDC 4ALPA 1YHBA 4KJOA 2EJMA 2PMZB 2JA8B 3PGZA 1AFPA 1XNQQ 1YNJC 1YHQA 5CBEE 2KECA 3PIO3 2N49A 2K4KA 1BNZA 5M5WH 3MXPA 1RDPD 5CV6A 1HNWL 4AYBE 5EBDA 2YTXA 3S17H 1E1OA 5T1GA 2CQOA 1RCVD 4DK1A 3H3VH 3GTQB 4C3HG 1XMQQ 2DN8A 2VQFL 2K5QA 3PIPA 1WTPA 3IFDA 4MTKA 2EY6A 3HOUG 4K5WA 3GTPH 3PUZA 4HJ5A 1EWIA 1D2BA 2XWBB 3NTKA 5IT9E 4MTNA 1GHKA 3OIQA 2ENBA 1JWUD 3D4RA 1IYJB 4CDEC 2ZJPA 3OTOQ 4HMJA 2KHJA 2ZXRA 4JI3L 3H09A 4X64L 1S4ZA 4UP8A 3V96A 5BR8Q 2WB1E 2PQAA 4A3CG 3KK7A 4DR2L 1F2YA 3K80C 4A76A 1E24A 2AUJD 4GOPA 3W3AA 2FINB 3BZCA 5M3FG 4CBVA 1SNQA 4OWXB 5E3FA 4QY7A 4IFDJ 4POFA 1V9PA 1N32L 3GTJH 2FMMA 3STBD 4DXGA 4RCNA 4OWWB 4X3TA 2OQKA 2L15A 1EUJA 1SE4A 4MZ9A 3S2HH 1ILPA 1VCIA 3F2CA 1SYCA 1D6EC 2SDFA 1TWFH 5EGTA 3S24A 1HNWQ 3OMCA 4HEDA 5C3EH 1I4PA 2RHSB 3A5ZB 4C3JB 3H0GH 4YCUA 4BBRB 5JVH3 1LM0A 3AB9A 4PNYA 4ZAIA 1QVGA 3MTSA 1WCMB 3NXWA 3HOZB 2EYFA 3QOLA 2VQFQ 1DM0B 3MVVA 1IW7C 4JK1C 5C0XH 2FXQA 2K05A 1ESRA 2K14A 3J7A5 1I6HB 4OWTB 2G9HD 5CV4A 1CUKA 4C1NI 2YYZA 1CHPD 3M7GA 4IN3A 2AWNA 4KD3A 2X6GA 1SNPA 1HUMA 1P16A 4JI3Q 1N9WA 4X64Q 4GOPB 3H15A 5DM63 1JT8A 1AW7A 4A93B 1JQYD 4DV2L 1S72A 1LT5D 5CV7A 3TRZA 1V1QA 4BBSB 2VY3A 4DNRB 3T1YL 1VQFA 1K8GA 1Y69U 4DR5L 3I56A 2LSSA 5KNCA 3BS1A 3M85A 3LNNA 1S5CD 3P1HA 1N32Q 2Z9HA 4DFAA 3BZDB 1R4PB 2EY1A 3K58A 4DR1L 2F0KA 2MJ8A 1NUCA 3J81L 1AN8A 3UDXA 1UEAB 4IUNA 2FMCA 1BCPD 1L0YB 1JMCA 1TU2B 2QW7A 1VDZA 5JEAJ 5I2XA 2VB2X 4LFCL 4JCVE 3OYYA 3CCQA 4FXGC 2GN5A 1EOVA 4FP5D 1M1KC 1BVSA 3S1QH 4KLKA 1TWGB 4RGOS 2E2HB 2B63H 1VQCA 2PW5A 4NW2A 1RHPA 2A1AA 3PMFA 2Z1CA 3VYRA 1PZJD 1H9KA 3RN5A 1E2VA 1PZID 1B7YB 3I4MB 1QVFA 1WTRA 3M7NA 1DCZA 1TWAB 2AKWB 4C2MB 2QDLA 5CGKA 4JI6L 2FHTA 4BY7G 3H3VC 4DV2Q 2JEAI 1B3QA 3J81i 1RJTA 2JQOA 3T1YQ 4F88A 1B9NA 1CT1D 3SK5A 1Q1EA 4DR5Q 2Q8RE 2ATWA 3ULJA 1F9PA 4IFDG 3GV3A 2GVBA 4KY6A 4NDXA 1SNOA 4A3BH 1SE8A 1Y1WB 2ICIA 1BCPC 1SBBB 3ONAB 3E0JA 1TXYA 4QMGA 4UAIA 4UHVA 3TEHB 4A3FB 4WFN3 1SJHD 3NSWA 4K2KA 4OELB 4APVA 4DR1Q 3I4NH 3E6ZX 3OHXC 1YHAA 4X62Q 3ERSX 2K33A 2K6AA 4B3SL 4OGQC 3HOWH 3KOJA 4LFCQ 2IHFA 5JJLA 2F0IA 2D9UA 3U4VA 3CF5A 3FPUB 2YV5A 3I73A 4ZKCB 2WAQB 4RA8A 3J80L 2WKCA 1SNMA 2XN9C 1PYSB 1FD7D 2I5HA 3DEPA 4JI0L 3QOJA 1Q82C 1G291 4NPSA 3DWPA 3HOVG 3W5OA 1BOSA 5G3LF 4YWKA 4O42A 1EIFA 2BE5C 2JSOA 2VS1A 3GO5A 3K5LA 4FVMA 4JI6Q 2PMZE 4POGA 1W6JA 2HT1A 4KY7A 2VQEL 3I70A 3D6WA 3BVGA 3CMAA 1B53A 1Y14B 4GN4B 3DM1A 3I90A 4ME3A 4OX9L 2N55A 2ID0A 4GN5A 1NAPA 3RLFA 3RD4A 1NSNS 1PRTD 4ZLTF 2ZTDA 2EE1A 5C0XJ 2CWAA 1ZXTA 3X3NA 4FF2A 2G9DA 2NWGA 5KGUA 2CQAA 3WOFA 1IHZA 1STNA 2ZTCA 3J80i 5LHY1 2HIXA 3PUVA 1IBML 1EZ6A 2KQ3A 2M9VA 4OIKA 2E2DC 4B3SQ 1RIPA 4U673 2RSNA 1AZQA 3TS2A 2I5LX 3OWFA 4RH6A 1BBXC 1E2ZA 1ZYRD 2IT1A 1QZHA 2F3IA 1E0BA 5M3FH 3M3YB 4IUUA 4KTAA 1HA5A 3M4PA 4A3LG 1TR5A 4R8IA 1JC7A 1EZ8A 1Z7TA 2NYZD 1TKWB 2PO4A 4JI0Q 5E1FA 1HTPA 3TQYA 2F1MA 1PTOC 4HAEA 4YWMA 1E1TA 2A68D 3HKSA 4AQYL 2Q8TA 1TS4A 3CD6A 4QCLA 3AQQA 2VQEQ 4A3GB 4RHRA 1D1KA 3HZXA 1K73C 1ENFA 1DYQA 4OEMB 4U68A 4DK0A 4LF8L 4FDBA 1LT4D 1OXXK 3RZOB 4HCSA 3S2DH 1K8MA 3P20A 3SE0A 1TS5A 3BZKA 5EKIA 2MPMA 1IL8A 1WTXA 2IX0A 3MXUA 4TKOB 3CU7A 4X6AH 1K83B 4C3IB 3KLSA 5KIXA 1JOKA 2Y0SB 4XTCS 2GVAA 3T1HL 2XGTA 4L5QA 1WD1A 1IBMQ 2XNAC 3A0JA 3FP9A 3DXJC 5F2DA 1G2SA 4X65L 1SYDA 1SFOB 1U5KA 3K7AB 3G6JB 4A3EB 2R7ZG 4IZ8A 4GNXC 4LFAL 4JI8L 1I4XA 5A2QL 3GDEA 1EYDA 1I4GA 3K7UC 4GN3B 1PVOA 1WCMG 1MBYA 2B39A 3MFGA 2HDMA 3S1MH 3T4AC 1CTMA 1S5FD 4CJ1B 2JA7G 1HQRD 3NTIA 4XQNA 1HQMC 3FHWA 3K0YA 1LTTD 1X55A 1HH2P 4AQYQ 4IPCA 3LX0A 2EVBA 1Q81C 2RSOA 4YHHL 2E75C 4GKJQ 4DF7A 1YJ9A 1EEID 2KCMA 4IJHA 3S14B 1K3BC 4L8JA 1NBWA 2D0OA 4LF8Q 4A3MH 2R93G 3TREA 2KCTA 1HZAA 2JA6G 2HCIA 4BBSG 1EY8A 3BJUA 5J3BA 3U4ZA 4V0BA 4A3IB 2ZJQA 5C4HA 2V1CC 2DNCA 5GAHC 1NY4A 4HIDA 4A3JB 5GROA 1KL9A 3T1HQ 5GQOA 4IUQA 4PV1C 1KDCA 1EQQA 3SR1A 4X65Q 3K6OA 3D0FA 3ICEA 1P8LA 3NE5B 4HMIA 2EYHA 3MWYW 4FF3A 1JOQA 2PNRC 4RHSA 4RKBA 2NVTH 4LFAQ 1SMYC 4R9WA 4JI8Q 4UPAA 2RDGA 1LLRD 2FFKB 3M4OH 2UUBQ 4BWGB 1WYDA 3I91A 4JG2A 1EYCA 3K57A 1FJGL 3KBGA 1S5ED 4LUZA 1IKMA 1ENCA 1EY7A 1M4VA 1CKMA 1QNUA 3J80E 5J1ZA 3F2DA 1O7IA 4JBJA 3CQZH 2Z8LA 2H1EA 3AFPA 4G7HC 1HZCA 4YHHQ 1TS3A 1MI2A 3NK9A 1GVPA 4GLVB 1J6QA 3CC4A 4ZYSA 4H44C 4G7OC 1UE1A 3S1NH 3KDFB 4AIMA 4K6LA 4B3ML 2E8GA 2E2IB 5IP7H 3GTKB 4MIUA 2MO0A 5E4XA 4YCWA 4QUFA 1EFID 4BY1G 5JPMC 1B4OA 2K5DA 2OWOA 1NMGA 1CZWA 4K8JA 1M8AA 5AFWA 2KOLA 3GD7A 3CCMA 4X66L 5C3WA 2B2TC 2F52A 3VR3A 2F0UA 4TSSA 3S15H 1TT2A 1XTCD 2WAQE 2C9OA 2B3GA 1PLFA 5C4JH 2NB0A 4QQBX 1DZ1A 1LABA 2EDGA 3OOCA 1II3A 4H0LC 5D14A 2PZWA 1FJGQ 3UE1A 2HIVA 4RFBA 1B2TA 5M3MB 1XX8A 3RZDB 2E76C 3I72A 4IOCA 3FDTA 5TSSA 3VA7A 5ISRA 3GTOH 3NUCA 3RUZA 3F8TA 4L5SA 3FPPA 1JICA 3L0OA 4DPGA 4LF5L 1NE3A 1MHWC 3KFUA 3UDFA 3A74A 4CGYB 4HJ8A 2SNMA 1PFBA 2CWPA 1EIHA 3I4LA 4B3MQ 3OSOA 5K36H 1HTLD 1SYFA 1DOLA 1GOZA 4N9TA 4ID6A 1FR3A 4A3LH 1LACA 3GTQH 2L4NA 3IL8A 1A6XA 1Q90A 5M5YB 1I6VC 2M2LA 2MP1A 4JBKA 1I94L 3I7FA 4X66Q 3HOXG 3A54A 3I4OA 1RL2A 2N8NA 1A3TA 1STYA 1K8OA 2ZJRA 4DUYL 2JEBI 3BYTB 4JBWA 3RLOA 3PO2B 5CYUA 1VS0A 3PV0A 1TIID 2F0NA 1MSGA 1X3EA 1PZKD 1O80A 3CHBD 1ENAA 1S5DD 4RGNA 2AHOB 2F4VL 4LNQA 5M5XB 1J9OA 4LK1C 5IT9c 2K5VA 1CSQA 3DWAA 2ALYB 4Q5VA 3E9IA 3ER0A 3PO3G 4X3KA 4A3KB 1ML0D 4KN7C 2Z6BA 3G4SA 5DEHA 3IKJA 3NENA 4AYBG 5IE8A 5EAYA 1SNDA 3CCRA 2VXWA 1DONA 2O2LD 4LF5Q 2B29A 3JAME 5FLMG 2ES2A 2O5JC 3PF4A 4IPGA 4PZ6A 2R7ZH 2R7DA 1FVIA 4LMQD 1PH9A 1KLUD 5FJ8G 2Z6KC 4A3GG 2XSCA 2Y0SE 2QEXA 3VR4A 4BBRH 1EY9A 2WKDA 2PYKA 4B9XA 3EJIA 1WCMH 3HOZH 1V43A 4F87A 3SGIA 2PZTA 1KAAA 1VF5C 1NR2A 3EROA 4OXPA 1EWCA 4YWLA 3D4DA 1I94Q 3S17B 3OW2A 2JA7H 4MN3A 4KKTA 1K3RA 4DUYQ 3L3OC 1C4QA 2WB1G 2PCFB 2BH2A 1N34L 1X54A 3G6EA 4LWCA 2KEEA 1B50A 1MJCA 2L5TA 1TWCB 3MAQA 4KHPL 3TP8A 1N36L 1LTBD 1EU4A 4JYAL 2AQ1B 1BCPB 2ZTEA 2F4VQ 4P2CB 5C4XG 2R93H 4A93H 1EY6A 4R1JA 2JA6H 2L0CA 4BBSH 2PPBC 2K03A 2EOTA 2F0TA 4RKLA 4LUOA 2SOBA 1MKHA 4K8IA 3TN2A 1STHA 1QOHA 5E4WC 1SSOA 5I2YA 3A5UA 3H94A 4Y52H 1WOCA 4OONA 5FLXE 2IX1A 2Q2TA 3R93A 1F9SA 2PQAB 3URYA 1HNZL 3U9SA 3FKIB 3GTJB 2KCCA 3VR6A 2QA4A 1PH8A 1DGSA 4DR2Q 1EFWA 3STBC 4XXEA 1PV4A 4LFBL 1BKBA 4K14A 4B08A 5BN5A 5C44B 1OXVA 1UUPA 5COYA 3UDIA 1N8RC 4JI4L 1JB7A 1CHQD
chains in the Genus database with same CATH topology
4R4TA 3KF6A 2KHIA 4ME3A 2HHHQ 3H0GG 1FL0A 3CCJA 4DV1L 4YY3Q 4OX9L 1VQDA 4A3KH 4JOIA 4HJAA 1NJIC 1L1OC 2ID0A 2VL6A 4GN5A 3RLFA 3DLLA 5IP9H 3PF5A 4LW1A 3I55A 1EYGA 3PUYA 3CCVA 2MQHA 2ZTDA 4RG1A 1S3OA 1SRUA 2CWAA 1LUZA 5C0XJ 5AJ3Q 1M90C 5C0XG 2E2HH 1CSPA 2JE6I 3GTMH 3IRBA 1YNXA 3KDFA 1N34Q 1HR0W 1PFSA 1E3PA 1YVCA 2UUCQ 2ZTCA 3J80i 1K8AC 1PH1A 2HIXA 1HR0L 5IYDG 1IZ6A 1WI5A 1L1OB 1A63A 4BA2I 4KHPQ 3PUVA 4DR7L 1IBML 1TWAH 4C2MH 1PHJA 1S40A 4P75A 4JYAQ 1YITA 1RIPA 4DV0Q 4B3SQ 1VQLA 2QGQA 3KJOA 1D7QA 3EN2A 4A3MG 1B70B 3DM3A 2OTLA 3TS2A 2I5LX 3PCOB 4JI1L 2IT1A 3JAMi 1MJEA 2YTYA 1QZHA 2F3IA 3JAMc 4BY7H 4DAMA 4LF9L 4P71A 4BY1H 1CKOA 4LUVA 4PZ7A 5M3FH 2R92G 4HIOA 3M4PA 4A3LG 1J5EL 2E5LQ 2UXDL 5LMUQ 4B3TL 5IWAL 2CFMA 3PIOA 4NXNQ 4PMWA 2UU9Q 1YEZA 1X65A 3CAMA 2C35B 4BA1I 5C0XI 1XJVA 4JI0Q 4RMFA 3WWVA 4A3FH 4JOIC 1GKHA 2PI2A 2PNHA 3TQYA 1Y1VG 1HNZQ 4PZ8A 4K0KL 4YWMA 1Q7YC 3HKZG 2UUAL 4GNXA 1E1TA 3HKSA 4NB3A 4AQYL 1XPRA 1TWCH 2N78A 3CD6A 4C3JH 1KXLA 2RHQB 2NN6G 4LFBQ 3AQQA 2UXBL 2VQEQ 1UE5A 5JJIA 1X6OA 1KQSA 1K73C 1YZ6A 3E9HA 4JI4Q 2HQLA 3EIVA 1ASZA 4JI7L 1I3QH 4LF8L 4A3DG 4FDBA 1OXXK 2IY5B 4DV1Q 3CPWA 1W2BA 3S2DH 1HJPA 4IPDA 4HIKA 1I6HH 3BZKA 4YCVA 3Q8DA 4DV3L 1A62A 1XTDA 3F2BA 2IX0A 1CKNA 5LMNW 2Y0SG 1D8LA 1VQEA 4R4OA 2PI2E 4X6AH 1T9HA 3TS0A 3MXNB 3VDYA 1VQJA 1FGUA 1HR0Q 5IY0A 1X56A 4XTCS 2B63G 3K0XA 2GVAA 3T1HL 1SROA 2XGTA 3FKIH 1VQPA 4L5QA 1XNQL 2OCEA 4A3EG 1IBMQ 4DR7Q 3A0JA 4QL5A 1PH6A 3HOVH 3FP9A 2WFWA 1L2FA 4X65L 4O2DA 2NN6I 4IPHA 2WP8J 2D62A 3AYHB 3BU2A 1U5KA 5GADC 2MFIA 5DLQE 5C44H 2R7ZG 1LTLA 4GNXC 4LFAL 5FLXc 5JJKA 4JI1Q 4JI8L 5IP7G 4L5RC 3GDEA 3RN2A 4LF9Q 4DK6C 3K7UC 3J81j 1YJWA 1IBKL 5GAEC 1XNRL 2N3SA 4GN3B 1WCMG 1PVOA 4HJ9A 3U58A 1ASYA 1J5EQ 1H95A 1K9MC 1PH4A 2VUMG 5M3MG 2UXDQ 4B3TQ 3S1MH 3PUWA 5IWAQ 1GD7A 4NXML 2AMCB 1XMQL 3HOXH 1KIXA 4GNXB 1I50H 2JA7G 4A3BG 4TQUS 3CXCA 3D31A 4K0KQ 3FHWA 4DV4L 1X55A 2BA0A 2D0PA 2UUAQ 1HH2P 1YJNA 1NTGA 2LXKA 4AQYQ 3ULPA 3CCSA 4IPCA 4BXXH 4EX5A 3I4NG 3NEMA 1U0LA 1E7ZA 5IYDH 1Q81C 5IYCG 2NVXH 2Q2IA 4YHHL 4LF4L 3CP0A 2UXBQ 3OTOL 4GKJQ 2UXCL 3CW2C 4DUZL 1KRSA 1YJ9A 1PH5A 3RLNA 1YIJA 2R7FA 2KCMA 4IJHA 4JI7Q 1NBWA 2D0OA 4LF8Q 4A3MH 3HOWG 3GTLH 5BR8L 2R93G 4QIWE 3TREA 4XIGS 3PO3H 1GO3E 2KCTA 2NVQH 5HY6A 1HZAA 3M3YH 2JA6G 4A3IG 3S16H 4WJ3M 1TWGH 2JA5G 4BBSG 4DV3Q 1KD1C 3BJUA 5J3BA 3U4ZA 2H5XA 1PH2A 4JBMA 1KAWA 1IXRA 5GAGC 4PG3A 1VQ9A 4A3JG 2R92H 2ZJQA 2JA8G 4ALPA 2RCNA 1YHBA 1SR3A 2V1CC 3RR5A 1Q86C 3KJPA 1PA6A 3I4MH 5GAHC 1NY4A 4P73A 4HIDA 5GROA 1N36Q 2K5HA 3PGZA 2LXJA 1KL9A 4WJ4A 5FLMH 3T1HQ 2NVYH 5GQOA 3PO2G 1XNQQ 1EQQA 2Q2UA 1YHQA 4OO1G 4X65Q 3AEVA 3D0FA 3ICEA 2MO1A 3PSIA 1P8LA 5FJ8H 2N49A 2K4KA 4GLAC 4A3GH 4B3RL 5M5WH 3W1GA 2NVTH 5K36G 1IBLL 4LFAQ 1EQRA 4IO9A 1OTCA 4JI8Q 4UPAA 1HNWL 1UE6A 4X62L 4AYBE 3M4OH 1YBYA 3HOYH 2YTXA 2UUBQ 1IBKQ 1XNRQ 3S17H 1VQHA 3RNUA 1WYDA 1E1OA 4UY8C 4P74A 1B8AA 4JG2A 1FJGL 2VZAA 1Y1WH 1C0AA 3M9BA 2YTVA 2CQOA 3H3VH 4NXMQ 1XMQQ 4LUZA 2VQFL 1BBWA 3PIPA 2I0QA 1CKMA 3CPFA 5IP9G 4DR3L 3HOUG 2Z0SA 1K83H 1C9OA 3F2DA 3GTPH 3PUZA 1O7IA 4DV4Q 1EWIA 4HJ5A 4JBJA 3CQZH 3KF6B 1VQGA 2BH8A 4MTNA 3AFPA 4P72A 1I5FA 1HZCA 1AH9A 1K0RA 3B6YA 3CC2A 4OO1I 1IYJB 3I2ZA 3ULLA 4YHHQ 4LF4Q 2ZJPA 1GVPA 4GLVB 3CMEA 3OTOQ 2UXCQ 1J6QA 3CC4A 3K7AH 4A3EH 4DUZQ 1OXSC 2KHJA 2ASBA 4JI3L 5C4XH 1UE1A 4OX9Q 3S1NH 1VQNA 4X64L 3KDFB 3EBEA 4UP8A 4L5TA 4AIMA 5BR8Q 4B3ML 2E8GA 1KRTA 2WB1E 2PQAA 4A3CG 4DR2L 3PUXA 5IP7H 3K80C 4A76A 1AE3A 2MO0A 1E24A 4YCWA 2ZM6L 1N33L 4GOPA 4BY1G 3BZCA 5LMNL 5IYBG 5M3FG 2OWOA 1NMGA 3JC66 4OWXB 4QGUA 1E22A 1XPUA 4QY7A 4IFDJ 4POFA 1V9PA 3GD7A 3CCMA 3GTJH 1N32L 4GLXA 4X66L 4DV5L 3G48A 3STBD 4OWWB 2F52A 2OQKA 2L15A 3S1RH 4DR6Q 1EUJA 1QZGA 1VQKA 1X3FA 1Z47A 3S15H 4MZ9A 2R6GA 2WAQE 3S2HH 2B3GA 1VCIA 3F2CA 5C4JH 4B3RQ 1QVCA 1IBLQ 2OQ0A 1TWFH 4QQBX 4BBRG 3S24A 1AE2A 1HNWQ 4R4CA 5C3EH 3HOZG 4DNIA 2IHEA 2RHSB 3A5ZB 3H0GH 3HFZB 4YCUA 1LM0A 5ELNA 1QVGA 1FJGQ 3UE1A 2JA5H 2HIVA 2K5NA 1L1OA 2K75A 4Y7NH 2VQFQ 1JJ2A 4A3IH 3KYHC 4DR3Q 2FXQA 1JE5A 4IOCA 2RF4A 4A3JH 3GTOH 4IFDI 2K14A 3J7A5 4GOPC 4JI2L 4OWTB 1CUKA 1XPOA 2YYZA 3F8TA 1NMFA 4L5SA 3L0OA 2AWNA 4DPGA 4LF5L 4DV7L 1NE3A 3KFUA 1P16A 3A74A 4J15A 3UDFA 4JI3Q 2K52A 1UE7A 1N9WA 1CKNB 1Q8KA 4HJ7A 1HZ9A 4HJ8A 1HNXL 3GTGH 4A93G 1VQ8A 4X64Q 4GOPB 3AFQA 2OTJA 2CWPA 4A75A 4B3MQ 3H15A 1XMOL 1JT8A 1TWHH 4R4QA 3NBHB 4KI0A 4DV2L 1S72A 1OXUA 2ZM6Q 3TRZA 1N33Q 1V1QA 4A3LH 3GTQH 2VY3A 3T1YL 2EQSA 2Q2HA 1VQFA 5LMNQ 1K8GA 4DR5L 3I56A 2LSSA 1SMXA 3M85A 1G51A 3E0EA 4C3HH 4JBKA 1I94L 1N32Q 2CCZA 3I7FA 4X66Q 4DV5Q 3HOXG 3I4OA 1RL2A 1Y1VH 1Q46A 2BA1A 2N8NA 3HOUH 2AWOA 5HGQA 2ZJRA 4DUYL 2JEBI 4JBWA 3RLOA 4LF6L 1VS0A 3PV0A 4DR1L 2Z6KA 2VNUD 4HIMA 4GKKL 1X3EA 4BXXG 3ZJYC 3UDXA 3J80c 2DGYA 3RZOH 1JMCA 3UDGA 2E2JH 1HZBA 2AHOB 2F4VL 4LNQA 4A3DH 5JEAJ 2E2IH 5JEAG 5IT9c 2K5VA 1EIYB 1CSQA 4IJLA 2ALYB 4LFCL 3W1BA 4A3KG 3GTKH 4JCVE 3E9IA 4EQ5A 3OYYA 3ER0A 3HKZE 4A3CH 4DR4L 3CCQA 4C3IH 1SLJA 4H02A 3PO3G 2GN5A 1EOVA 1M1KC 1PH7A 4LF7L 1BVSA 1JJGA 4JI5L 3S1QH 1VQAA 3G4SA 3K81C 5IYBH 4A4IA 4KLKA 3NENA 4JI2Q 4AYBG 5IE8A 3KLWA 2B63H 3LGJA 1W3SA 4JV5L 1R9TH 5EAYA 1VQCA 3M4QA 3I4MG 4DAYB 2A1AA 3CCRA 1SFOH 4LF5Q 2B29A 4DV7Q 5FLMG 4DV6L 3RN5A 2ES2A 1B7YB 3PF4A 1QVFA 1VQ4A 4IPGA 2I5MX 4PZ6A 3M7NA 1HNXQ 2R7ZH 2AKWB 1FVIA 2R7DA 3G71A 1PH9A 5E7NA 2JA9A 5FJ8G 1C7YA 4JI6L 2Z6KC 4A3GG 1A8VA 2Y0SE 4QJFA 4UP7A 2QEXA 1XMOQ 4MNOA 4BBRH 1IL2A 1LYLA 1GM5A 4BY7G 1OXTA 3CCEA 4DV2Q 1VQ5A 3J81i 2JEAI 4IOAA 1WCMH 3HOZH 4DR6L 4GKJL 2JQOA 1V43A 1PH3A 3HOYG 3T1YQ 3L2PA 3SGIA 5M3MH 3J81c 1YI2A 2VUMH 4UP9A 1Q1EA 1UWVA 1VQBA 4DR5Q 3RZDH 2HHHL 1SN8A 3ULJA 1PYBA 4OXPA 1QUQA 4YY3L 2ATWA 4IFDG 1BBUA 1Y1WG 1G6PA 4YWLA 2GVBA 1I94Q 3OW2A 2JA7H 4A3BH 2MNAA 2NZOA 1SE8A 4A3FG 1K3RA 1TXYA 5AJ3L 4DUYQ 1VQIA 2WB1G 2EXDA 4KHZA 2BH2A 3TEHB 4LF6Q 2A8VA 1N34L 1X54A 4DR1Q 3I4NH 4APVA 3G6EA 3K8AA 2UUCL 4LWCA 5IYCH 1YHAA 4GKKQ 4X62Q 1MJCA 3S14H 3ERSX 4DKAC 4KHPL 1N36L 4DK3C 4JYAL 4B3SL 4DV0L 2NZHA 2ZTEA 1VQ6A 2F4VQ 2DUDA 3HOWH 3KOJA 2CKZB 5C4XG 1X3GA 4GS3A 2R93H 4A93H 1WFQA 4LFCQ 2IHFA 4R1JA 2YU9H 5JJLA 3CCUA 3NELA 1JJCB 1L0WA 1Q1BA 2JA6H 4JC0A 2WAQG 4BBSH 4DR4Q 3U4VA 4AH6A 3CF5A 2KENA 2YV5A 5M5YH 4LUOA 4LF7Q 2VW9A 2JA8H 1MKHA 1Q12A 3U50C 4JI5Q 3H3VI 5ELOA 2E5LL 2UUBL 3J7ZC 1Z9FA 4O0AA 5LMUL 3A5UA 2EIFA 4NXNL 3MEFA 2UU9L 1PYSB 1WOCA 2A19A 4OONA 4JV5Q 4Y52H 2IX1A 2I5HA 2Q2TA 2JJQA 3FKIG 1Q82C 4JI0L 3PO2H 1G291 2K50A 2PQAB 4NPSA 1WJJA 2JK8A 3CC7A 1VQ7A 4DV6Q 2XTIA 3UE0A 3W5OA 1HNZL 1KHIA 2KBNA 1VQOA 1X9NA 3HOVG 4YWKA 1KC8C 1EIFA 5H1SE 2QA4A 3L7ZC 2VS1A 3GO5A 1PH8A 5C44G 3F1ZA 1DGSA 4DR2Q 1EFWA 3STBC 1MIUA 4JI6Q 2PMZE 1PV4A 4POGA 4LFBL 1BKBA 2HT1A 3KF8B 4R4IA 1QUQB 2VQEL 5M5XH 1UEBA 1A0IA 1VQMA 1OXVA 3UDIA 1N8RC 3CCLA 4JI4L 1JB7A 3CMAA 1Y14B 5C3EG 4TVAB 4GN4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4T A;  3KF6 A;  2KHI A;  4ME3 A;  2HHH Q;  3H0G G;  1FL0 A;  3CCJ A;  4DV1 L;  4YY3 Q;  4OX9 L;  1VQD A;  4A3K H;  4JOI A;  4HJA A;  1NJI C;  1L1O C;  2ID0 A;  2VL6 A;  4GN5 A;  3RLF A;  3DLL A;  5IP9 H;  3PF5 A;  4LW1 A;  3I55 A;  1EYG A;  3PUY A;  3CCV A;  2MQH A;  2ZTD A;  4RG1 A;  1S3O A;  1SRU A;  2CWA A;  1LUZ A;  5C0X J;  5AJ3 Q;  1M90 C;  5C0X G;  2E2H H;  1CSP A;  2JE6 I;  3GTM H;  3IRB A;  1YNX A;  3KDF A;  1N34 Q;  1HR0 W;  1PFS A;  1E3P A;  1YVC A;  2UUC Q;  2ZTC A;  3J80 i;  1K8A C;  1PH1 A;  2HIX A;  1HR0 L;  5IYD G;  1IZ6 A;  1WI5 A;  1L1O B;  1A63 A;  4BA2 I;  4KHP Q;  3PUV A;  4DR7 L;  1IBM L;  1TWA H;  4C2M H;  1PHJ A;  1S40 A;  4P75 A;  4JYA Q;  1YIT A;  1RIP A;  4DV0 Q;  4B3S Q;  1VQL A;  2QGQ A;  3KJO A;  1D7Q A;  3EN2 A;  4A3M G;  1B70 B;  3DM3 A;  2OTL A;  3TS2 A;  2I5L X;  3PCO B;  4JI1 L;  2IT1 A;  3JAM i;  1MJE A;  2YTY A;  1QZH A;  2F3I A;  3JAM c;  4BY7 H;  4DAM A;  4LF9 L;  4P71 A;  4BY1 H;  1CKO A;  4LUV A;  4PZ7 A;  5M3F H;  2R92 G;  4HIO A;  3M4P A;  4A3L G;  1J5E L;  2E5L Q;  2UXD L;  5LMU Q;  4B3T L;  5IWA L;  2CFM A;  3PIO A;  4NXN Q;  4PMW A;  2UU9 Q;  1YEZ A;  1X65 A;  3CAM A;  2C35 B;  4BA1 I;  5C0X I;  1XJV A;  4JI0 Q;  4RMF A;  3WWV A;  4A3F H;  4JOI C;  1GKH A;  2PI2 A;  2PNH A;  3TQY A;  1Y1V G;  1HNZ Q;  4PZ8 A;  4K0K L;  4YWM A;  1Q7Y C;  3HKZ G;  2UUA L;  4GNX A;  1E1T A;  3HKS A;  4NB3 A;  4AQY L;  1XPR A;  1TWC H;  2N78 A;  3CD6 A;  4C3J H;  1KXL A;  2RHQ B;  2NN6 G;  4LFB Q;  3AQQ A;  2UXB L;  2VQE Q;  1UE5 A;  5JJI A;  1X6O A;  1KQS A;  1K73 C;  1YZ6 A;  3E9H A;  4JI4 Q;  2HQL A;  3EIV A;  1ASZ A;  4JI7 L;  1I3Q H;  4LF8 L;  4A3D G;  4FDB A;  1OXX K;  2IY5 B;  4DV1 Q;  3CPW A;  1W2B A;  3S2D H;  1HJP A;  4IPD A;  4HIK A;  1I6H H;  3BZK A;  4YCV A;  3Q8D A;  4DV3 L;  1A62 A;  1XTD A;  3F2B A;  2IX0 A;  1CKN A;  5LMN W;  2Y0S G;  1D8L A;  1VQE A;  4R4O A;  2PI2 E;  4X6A H;  1T9H A;  3TS0 A;  3MXN B;  3VDY A;  1VQJ A;  1FGU A;  1HR0 Q;  5IY0 A;  1X56 A;  4XTC S;  2B63 G;  3K0X A;  2GVA A;  3T1H L;  1SRO A;  2XGT A;  3FKI H;  1VQP A;  4L5Q A;  1XNQ L;  2OCE A;  4A3E G;  1IBM Q;  4DR7 Q;  3A0J A;  4QL5 A;  1PH6 A;  3HOV H;  3FP9 A;  2WFW A;  1L2F A;  4X65 L;  4O2D A;  2NN6 I;  4IPH A;  2WP8 J;  2D62 A;  3AYH B;  3BU2 A;  1U5K A;  5GAD C;  2MFI A;  5DLQ E;  5C44 H;  2R7Z G;  1LTL A;  4GNX C;  4LFA L;  5FLX c;  5JJK A;  4JI1 Q;  4JI8 L;  5IP7 G;  4L5R C;  3GDE A;  3RN2 A;  4LF9 Q;  4DK6 C;  3K7U C;  3J81 j;  1YJW A;  1IBK L;  5GAE C;  1XNR L;  2N3S A;  4GN3 B;  1WCM G;  1PVO A;  4HJ9 A;  3U58 A;  1ASY A;  1J5E Q;  1H95 A;  1K9M C;  1PH4 A;  2VUM G;  5M3M G;  2UXD Q;  4B3T Q;  3S1M H;  3PUW A;  5IWA Q;  1GD7 A;  4NXM L;  2AMC B;  1XMQ L;  3HOX H;  1KIX A;  4GNX B;  1I50 H;  2JA7 G;  4A3B G;  4TQU S;  3CXC A;  3D31 A;  4K0K Q;  3FHW A;  4DV4 L;  1X55 A;  2BA0 A;  2D0P A;  2UUA Q;  1HH2 P;  1YJN A;  1NTG A;  2LXK A;  4AQY Q;  3ULP A;  3CCS A;  4IPC A;  4BXX H;  4EX5 A;  3I4N G;  3NEM A;  1U0L A;  1E7Z A;  5IYD H;  1Q81 C;  5IYC G;  2NVX H;  2Q2I A;  4YHH L;  4LF4 L;  3CP0 A;  2UXB Q;  3OTO L;  4GKJ Q;  2UXC L;  3CW2 C;  4DUZ L;  1KRS A;  1YJ9 A;  1PH5 A;  3RLN A;  1YIJ A;  2R7F A;  2KCM A;  4IJH A;  4JI7 Q;  1NBW A;  2D0O A;  4LF8 Q;  4A3M H;  3HOW G;  3GTL H;  5BR8 L;  2R93 G;  4QIW E;  3TRE A;  4XIG S;  3PO3 H;  1GO3 E;  2KCT A;  2NVQ H;  5HY6 A;  1HZA A;  3M3Y H;  2JA6 G;  4A3I G;  3S16 H;  4WJ3 M;  1TWG H;  2JA5 G;  4BBS G;  4DV3 Q;  1KD1 C;  3BJU A;  5J3B A;  3U4Z A;  2H5X A;  1PH2 A;  4JBM A;  1KAW A;  1IXR A;  5GAG C;  4PG3 A;  1VQ9 A;  4A3J G;  2R92 H;  2ZJQ A;  2JA8 G;  4ALP A;  2RCN A;  1YHB A;  1SR3 A;  2V1C C;  3RR5 A;  1Q86 C;  3KJP A;  1PA6 A;  3I4M H;  5GAH C;  1NY4 A;  4P73 A;  4HID A;  5GRO A;  1N36 Q;  2K5H A;  3PGZ A;  2LXJ A;  1KL9 A;  4WJ4 A;  5FLM H;  3T1H Q;  2NVY H;  5GQO A;  3PO2 G;  1XNQ Q;  1EQQ A;  2Q2U A;  1YHQ A;  4OO1 G;  4X65 Q;  3AEV A;  3D0F A;  3ICE A;  2MO1 A;  3PSI A;  1P8L A;  5FJ8 H;  2N49 A;  2K4K A;  4GLA C;  4A3G H;  4B3R L;  5M5W H;  3W1G A;  2NVT H;  5K36 G;  1IBL L;  4LFA Q;  1EQR A;  4IO9 A;  1OTC A;  4JI8 Q;  4UPA A;  1HNW L;  1UE6 A;  4X62 L;  4AYB E;  3M4O H;  1YBY A;  3HOY H;  2YTX A;  2UUB Q;  1IBK Q;  1XNR Q;  3S17 H;  1VQH A;  3RNU A;  1WYD A;  1E1O A;  4UY8 C;  4P74 A;  1B8A A;  4JG2 A;  1FJG L;  2VZA A;  1Y1W H;  1C0A A;  3M9B A;  2YTV A;  2CQO A;  3H3V H;  4NXM Q;  1XMQ Q;  4LUZ A;  2VQF L;  1BBW A;  3PIP A;  2I0Q A;  1CKM A;  3CPF A;  5IP9 G;  4DR3 L;  3HOU G;  2Z0S A;  1K83 H;  1C9O A;  3F2D A;  3GTP H;  3PUZ A;  1O7I A;  4DV4 Q;  1EWI A;  4HJ5 A;  4JBJ A;  3CQZ H;  3KF6 B;  1VQG A;  2BH8 A;  4MTN A;  3AFP A;  4P72 A;  1I5F A;  1HZC A;  1AH9 A;  1K0R A;  3B6Y A;  3CC2 A;  4OO1 I;  1IYJ B;  3I2Z A;  3ULL A;  4YHH Q;  4LF4 Q;  2ZJP A;  1GVP A;  4GLV B;  3CME A;  3OTO Q;  2UXC Q;  1J6Q A;  3CC4 A;  3K7A H;  4A3E H;  4DUZ Q;  1OXS C;  2KHJ A;  2ASB A;  4JI3 L;  5C4X H;  1UE1 A;  4OX9 Q;  3S1N H;  1VQN A;  4X64 L;  3KDF B;  3EBE A;  4UP8 A;  4L5T A;  4AIM A;  5BR8 Q;  4B3M L;  2E8G A;  1KRT A;  2WB1 E;  2PQA A;  4A3C G;  4DR2 L;  3PUX A;  5IP7 H;  3K80 C;  4A76 A;  1AE3 A;  2MO0 A;  1E24 A;  4YCW A;  2ZM6 L;  1N33 L;  4GOP A;  4BY1 G;  3BZC A;  5LMN L;  5IYB G;  5M3F G;  2OWO A;  1NMG A;  3JC6 6;  4OWX B;  4QGU A;  1E22 A;  1XPU A;  4QY7 A;  4IFD J;  4POF A;  1V9P A;  3GD7 A;  3CCM A;  3GTJ H;  1N32 L;  4GLX A;  4X66 L;  4DV5 L;  3G48 A;  3STB D;  4OWW B;  2F52 A;  2OQK A;  2L15 A;  3S1R H;  4DR6 Q;  1EUJ A;  1QZG A;  1VQK A;  1X3F A;  1Z47 A;  3S15 H;  4MZ9 A;  2R6G A;  2WAQ E;  3S2H H;  2B3G A;  1VCI A;  3F2C A;  5C4J H;  4B3R Q;  1QVC A;  1IBL Q;  2OQ0 A;  1TWF H;  4QQB X;  4BBR G;  3S24 A;  1AE2 A;  1HNW Q;  4R4C A;  5C3E H;  3HOZ G;  4DNI A;  2IHE A;  2RHS B;  3A5Z B;  3H0G H;  3HFZ B;  4YCU A;  1LM0 A;  5ELN A;  1QVG A;  1FJG Q;  3UE1 A;  2JA5 H;  2HIV A;  2K5N A;  1L1O A;  2K75 A;  4Y7N H;  2VQF Q;  1JJ2 A;  4A3I H;  3KYH C;  4DR3 Q;  2FXQ A;  1JE5 A;  4IOC A;  2RF4 A;  4A3J H;  3GTO H;  4IFD I;  2K14 A;  3J7A 5;  4GOP C;  4JI2 L;  4OWT B;  1CUK A;  1XPO A;  2YYZ A;  3F8T A;  1NMF A;  4L5S A;  3L0O A;  2AWN A;  4DPG A;  4LF5 L;  4DV7 L;  1NE3 A;  3KFU A;  1P16 A;  3A74 A;  4J15 A;  3UDF A;  4JI3 Q;  2K52 A;  1UE7 A;  1N9W A;  1CKN B;  1Q8K A;  4HJ7 A;  1HZ9 A;  4HJ8 A;  1HNX L;  3GTG H;  4A93 G;  1VQ8 A;  4X64 Q;  4GOP B;  3AFQ A;  2OTJ A;  2CWP A;  4A75 A;  4B3M Q;  3H15 A;  1XMO L;  1JT8 A;  1TWH H;  4R4Q A;  3NBH B;  4KI0 A;  4DV2 L;  1S72 A;  1OXU A;  2ZM6 Q;  3TRZ A;  1N33 Q;  1V1Q A;  4A3L H;  3GTQ H;  2VY3 A;  3T1Y L;  2EQS A;  2Q2H A;  1VQF A;  5LMN Q;  1K8G A;  4DR5 L;  3I56 A;  2LSS A;  1SMX A;  3M85 A;  1G51 A;  3E0E A;  4C3H H;  4JBK A;  1I94 L;  1N32 Q;  2CCZ A;  3I7F A;  4X66 Q;  4DV5 Q;  3HOX G;  3I4O A;  1RL2 A;  1Y1V H;  1Q46 A;  2BA1 A;  2N8N A;  3HOU H;  2AWO A;  5HGQ A;  2ZJR A;  4DUY L;  2JEB I;  4JBW A;  3RLO A;  4LF6 L;  1VS0 A;  3PV0 A;  4DR1 L;  2Z6K A;  2VNU D;  4HIM A;  4GKK L;  1X3E A;  4BXX G;  3ZJY C;  3UDX A;  3J80 c;  2DGY A;  3RZO H;  1JMC A;  3UDG A;  2E2J H;  1HZB A;  2AHO B;  2F4V L;  4LNQ A;  4A3D H;  5JEA J;  2E2I H;  5JEA G;  5IT9 c;  2K5V A;  1EIY B;  1CSQ A;  4IJL A;  2ALY B;  4LFC L;  3W1B A;  4A3K G;  3GTK H;  4JCV E;  3E9I A;  4EQ5 A;  3OYY A;  3ER0 A;  3HKZ E;  4A3C H;  4DR4 L;  3CCQ A;  4C3I H;  1SLJ A;  4H02 A;  3PO3 G;  2GN5 A;  1EOV A;  1M1K C;  1PH7 A;  4LF7 L;  1BVS A;  1JJG A;  4JI5 L;  3S1Q H;  1VQA A;  3G4S A;  3K81 C;  5IYB H;  4A4I A;  4KLK A;  3NEN A;  4JI2 Q;  4AYB G;  5IE8 A;  3KLW A;  2B63 H;  3LGJ A;  1W3S A;  4JV5 L;  1R9T H;  5EAY A;  1VQC A;  3M4Q A;  3I4M G;  4DAY B;  2A1A A;  3CCR A;  1SFO H;  4LF5 Q;  2B29 A;  4DV7 Q;  5FLM G;  4DV6 L;  3RN5 A;  2ES2 A;  1B7Y B;  3PF4 A;  1QVF A;  1VQ4 A;  4IPG A;  2I5M X;  4PZ6 A;  3M7N A;  1HNX Q;  2R7Z H;  2AKW B;  1FVI A;  2R7D A;  3G71 A;  1PH9 A;  5E7N A;  2JA9 A;  5FJ8 G;  1C7Y A;  4JI6 L;  2Z6K C;  4A3G G;  1A8V A;  2Y0S E;  4QJF A;  4UP7 A;  2QEX A;  1XMO Q;  4MNO A;  4BBR H;  1IL2 A;  1LYL A;  1GM5 A;  4BY7 G;  1OXT A;  3CCE A;  4DV2 Q;  1VQ5 A;  3J81 i;  2JEA I;  4IOA A;  1WCM H;  3HOZ H;  4DR6 L;  4GKJ L;  2JQO A;  1V43 A;  1PH3 A;  3HOY G;  3T1Y Q;  3L2P A;  3SGI A;  5M3M H;  3J81 c;  1YI2 A;  2VUM H;  4UP9 A;  1Q1E A;  1UWV A;  1VQB A;  4DR5 Q;  3RZD H;  2HHH L;  1SN8 A;  3ULJ A;  1PYB A;  4OXP A;  1QUQ A;  4YY3 L;  2ATW A;  4IFD G;  1BBU A;  1Y1W G;  1G6P A;  4YWL A;  2GVB A;  1I94 Q;  3OW2 A;  2JA7 H;  4A3B H;  2MNA A;  2NZO A;  1SE8 A;  4A3F G;  1K3R A;  1TXY A;  5AJ3 L;  4DUY Q;  1VQI A;  2WB1 G;  2EXD A;  4KHZ A;  2BH2 A;  3TEH B;  4LF6 Q;  2A8V A;  1N34 L;  1X54 A;  4DR1 Q;  3I4N H;  4APV A;  3G6E A;  3K8A A;  2UUC L;  4LWC A;  5IYC H;  1YHA A;  4GKK Q;  4X62 Q;  1MJC A;  3S14 H;  3ERS X;  4DKA C;  4KHP L;  1N36 L;  4DK3 C;  4JYA L;  4B3S L;  4DV0 L;  2NZH A;  2ZTE A;  1VQ6 A;  2F4V Q;  2DUD A;  3HOW H;  3KOJ A;  2CKZ B;  5C4X G;  1X3G A;  4GS3 A;  2R93 H;  4A93 H;  1WFQ A;  4LFC Q;  2IHF A;  4R1J A;  2YU9 H;  5JJL A;  3CCU A;  3NEL A;  1JJC B;  1L0W A;  1Q1B A;  2JA6 H;  4JC0 A;  2WAQ G;  4BBS H;  4DR4 Q;  3U4V A;  4AH6 A;  3CF5 A;  2KEN A;  2YV5 A;  5M5Y H;  4LUO A;  4LF7 Q;  2VW9 A;  2JA8 H;  1MKH A;  1Q12 A;  3U50 C;  4JI5 Q;  3H3V I;  5ELO A;  2E5L L;  2UUB L;  3J7Z C;  1Z9F A;  4O0A A;  5LMU L;  3A5U A;  2EIF A;  4NXN L;  3MEF A;  2UU9 L;  1PYS B;  1WOC A;  2A19 A;  4OON A;  4JV5 Q;  4Y52 H;  2IX1 A;  2I5H A;  2Q2T A;  2JJQ A;  3FKI G;  1Q82 C;  4JI0 L;  3PO2 H;  1G29 1;  2K50 A;  2PQA B;  4NPS A;  1WJJ A;  2JK8 A;  3CC7 A;  1VQ7 A;  4DV6 Q;  2XTI A;  3UE0 A;  3W5O A;  1HNZ L;  1KHI A;  2KBN A;  1VQO A;  1X9N A;  3HOV G;  4YWK A;  1KC8 C;  1EIF A;  5H1S E;  2QA4 A;  3L7Z C;  2VS1 A;  3GO5 A;  1PH8 A;  5C44 G;  3F1Z A;  1DGS A;  4DR2 Q;  1EFW A;  3STB C;  1MIU A;  4JI6 Q;  2PMZ E;  1PV4 A;  4POG A;  4LFB L;  1BKB A;  2HT1 A;  3KF8 B;  4R4I A;  1QUQ B;  2VQE L;  5M5X H;  1UEB A;  1A0I A;  1VQM A;  1OXV A;  3UDI A;  1N8R C;  3CCL A;  4JI4 L;  1JB7 A;  3CMA A;  1Y14 B;  5C3E G;  4TVA B;  4GN4 B; 
#chains in the Genus database with same CATH topology
 3KF6 A;  1FL0 A;  4DV1 L;  1VQD A;  3TDQ A;  3C46 A;  4PMC A;  3Q6S A;  4RWS C;  1Q3L A;  4LW1 A;  3I55 A;  3PUY A;  4M1U B;  1EY4 A;  2MQH A;  2SNS A;  4RG1 A;  1IYU A;  2E2H H;  2JE6 I;  5IGC A;  3PIP 3;  1N34 Q;  1HRJ A;  1PFS A;  1E3P A;  4IUP A;  2J7Z A;  2DJF C;  2ZXO A;  3WDN A;  1IZ6 A;  4ZRZ A;  4KHP Q;  1SAP A;  1TWA H;  4C2M H;  2B2Y C;  3A8I E;  4P75 A;  1S40 A;  1YIT A;  4JYA Q;  4FXD A;  1RKN A;  2KCN A;  2QGQ A;  3KJO A;  1I4Q A;  1D7Q A;  4A3M G;  5DM7 3;  3DM3 A;  3PCO B;  4ABN A;  5I6W A;  2F0H A;  2BDN A;  2DJG C;  3QR8 A;  3GTL B;  4JVZ A;  4P71 A;  1CKO A;  4BY1 H;  4LUV A;  4PZ7 A;  3X3M A;  2NVQ B;  3ITP A;  3MXG A;  4HSP A;  1GUT A;  2CFM A;  5FO7 B;  2R92 B;  4PMW A;  5KRU A;  1YEZ A;  1JOR A;  2C35 B;  4BA1 I;  4K5V A;  4RMF A;  4A3F H;  4JOI C;  1Y1V G;  2G5D A;  1HNZ Q;  4K0K L;  3DUZ A;  1Q7Y C;  2NVY B;  4GNX A;  3RMH A;  4NB3 A;  1WTO A;  1PYW D;  2HQE A;  1LT3 D;  2N78 A;  1Y8N B;  1GUG A;  1LTR D;  3HKZ B;  4LFB Q;  1UE5 A;  2XWJ B;  5JJI A;  3E9H A;  4JI4 Q;  1XYI A;  1PTO B;  4XQQ A;  1HPC A;  1I3Q H;  4JI7 L;  4XQJ A;  3HOY B;  4KKS A;  1EY5 A;  4DV1 Q;  3CPW A;  2K04 A;  1HJP A;  4IPD A;  2NBF A;  3Q8D A;  4DV3 L;  3A8K E;  3QJY A;  4LJZ C;  1CKN A;  1I4R A;  2OT2 A;  3BVM A;  5CC4 A;  5LMN W;  2PI2 E;  3TME A;  3VDY A;  2JN4 A;  4ILW A;  1FGU A;  4M8A A;  3DHQ A;  4K2L A;  4CDF C;  3J7A V;  3OW7 A;  2WFW A;  2NN6 I;  1ET9 A;  4IPH A;  2D62 A;  2LMC B;  5DLQ E;  1LTL A;  1ZKO A;  5IP7 G;  3RN2 A;  1YJW A;  1XNR L;  2EJF C;  4CDC C;  5IOD A;  1ASY A;  1V1P A;  2XRQ D;  1PH4 A;  2VUM G;  5M3M G;  1Z6H A;  3HOX H;  4EQP A;  1KIX A;  4GNX B;  4R8N A;  5CR3 A;  4KK7 A;  2O5I C;  2EY2 A;  3K5N A;  4QUC A;  3CXC A;  3D31 A;  4K0K Q;  5EPJ A;  3R2T A;  1O7L A;  3OMG A;  4A3B B;  1WVL A;  2L1B A;  2LXK A;  3S1R B;  4ODG A;  1YNN D;  1HHV A;  2A5H A;  3NEM A;  1O78 A;  5IYC G;  2B2U C;  4J6H A;  4LF4 L;  1XWE A;  3CP0 A;  2F0W A;  2UXC L;  5FK9 C;  4DUZ L;  1FYC A;  4JI7 Q;  4EVO A;  3PO3 H;  2HDL A;  1FNV A;  3NWS A;  5HY6 A;  3M3Y H;  2JA5 B;  3S16 H;  3HOW B;  1JWS D;  4DV3 Q;  1KD1 C;  2H5X A;  4OL7 A;  4JBM A;  1HA6 A;  4PG3 A;  1PXU A;  2V4D A;  2JA8 G;  2RCN A;  3RR5 A;  1Q86 C;  3KJP A;  4C56 C;  2F4I A;  3LWU A;  2LXJ A;  4WJ4 A;  5FLM H;  3KLS X;  2PW7 A;  3PO2 G;  1SXT A;  3AEV A;  1EQV A;  3D3R A;  1JWM D;  2MO1 A;  5FJ8 H;  4RGM A;  4GLA C;  4A3G H;  4B3R L;  3W1G A;  5K36 G;  4MHE A;  1EQR A;  4IO9 A;  1OTC A;  1UE6 A;  3NHH A;  2DY7 A;  3E3X A;  5IGF A;  1XNR Q;  2KUM A;  3RNU A;  4UY8 C;  3QB3 A;  4P74 A;  2VZA A;  1K28 A;  3VYU A;  1TS2 A;  3QO2 A;  1YNN C;  2B2T A;  3F2U A;  2K01 A;  2I0Q A;  2WII B;  3CPF A;  5IP9 G;  4DR3 L;  2Z0S A;  1K83 H;  2EYM A;  3BDL A;  4C3H B;  2IX3 A;  3GQB A;  2VB3 X;  3K5M A;  4Q0F A;  3HOU B;  3J7Y W;  2KA7 A;  4CHT B;  4P72 A;  1I5F A;  1BCP F;  1AH9 A;  1WTH A;  1PRT C;  4E6I A;  4OO1 I;  4LF4 Q;  3CME A;  1EWH A;  2UXC Q;  3K7A H;  2L9H A;  3CRL C;  4DUZ Q;  2BCO A;  4A3E H;  2ASB A;  4F8M A;  5C4X H;  4OX9 Q;  5IGG A;  4LAA A;  3Q23 A;  2E2J B;  4L5T A;  4A3D B;  1CFM A;  1FNU A;  2GA4 B;  4QF4 A;  3PUX A;  2BDO A;  3TP6 A;  2ZM6 L;  5LMN L;  4QGU A;  1FNW A;  1XPU A;  1ZYR C;  2PQE A;  3NBH A;  3KF8 A;  1F2L A;  1H9M A;  4GLX A;  5M3F B;  2X6L A;  2F0M A;  2F03 A;  1WTV A;  1RD9 D;  1R9T B;  4OIJ A;  1QZG A;  4FNF A;  1X3F A;  1STE A;  1Z47 A;  2R6G A;  3J81 E;  3LWE A;  4DAP A;  4B3R Q;  1CK1 A;  1QVC A;  4HR7 B;  3K59 A;  4C3J G;  4BBR G;  4KKU A;  4CJ2 C;  1AE2 A;  1ONL A;  3TP7 A;  3HOZ G;  5KND A;  1LTA D;  3HFZ B;  2A68 C;  2M00 A;  2QDB A;  4Z9C B;  5CV8 A;  1G6Z A;  3H6M A;  2K5N A;  2RDH A;  1L1O A;  1F2M A;  3D8G A;  4Y7N H;  1KAB A;  5J39 A;  1JJ2 A;  3VYT A;  4A3I H;  1VMC A;  4DR3 Q;  1JE5 A;  5HUR A;  2RF4 A;  4J1M A;  4H7B A;  3R3O A;  4A3J H;  4IFD I;  1PMR A;  4JI2 L;  1E2W A;  3SXH A;  2I07 B;  1XPO A;  2MUY A;  2F0P A;  3EVQ A;  1ZEQ X;  5IT9 L;  4DV7 L;  5BN4 A;  2R3Z A;  1CM9 A;  4J15 A;  3T56 B;  2K52 A;  1UE7 A;  4G57 A;  1HNX L;  3GTG H;  4A93 G;  1VQ8 A;  1MGS A;  1SYG A;  5NUC A;  3KUP A;  2A73 B;  4A75 A;  2ZT9 C;  1TWH H;  4R4Q A;  3NBH B;  2YU9 B;  5EPK A;  2ZM6 Q;  5LMN Q;  1LT6 D;  4I7A A;  2K7V A;  5IGD A;  3E0E A;  1D1I A;  1UNS A;  2F0D A;  2CCZ A;  5FOB B;  2BOS A;  1Y1V H;  2BA1 A;  2F0L A;  1HFN A;  2JXM B;  4LF6 L;  2Z6K A;  2VNU D;  4QIW B;  4CKC A;  4HIM A;  4GKK L;  1PTO F;  5IIF A;  3ZJY C;  2WAC A;  3J80 c;  2R61 A;  3UDG A;  3EFX D;  1HZB A;  1X3Q A;  3MXN A;  3T53 B;  2E2I H;  1X3P A;  3GTK H;  4IJL A;  1C48 A;  4OHJ A;  4HCE A;  1AZP A;  3DMU A;  4EQ5 A;  5K5P A;  3HKZ E;  1SLJ A;  3E5S A;  3NBI A;  2IWH A;  4LF7 L;  3L9A X;  1JJG A;  4JI5 L;  2QKI C;  1TY0 A;  5IYB H;  2C5C A;  4A4I A;  3SK8 A;  4JI2 Q;  5LL6 X;  1OO9 B;  3GTM B;  3LGJ A;  1W3S A;  2I46 A;  3I4M G;  4HN7 A;  4DV7 Q;  4DV6 L;  1GJX A;  3KLR A;  1U4P A;  4DGZ A;  5JVG 3;  1HNX Q;  3G71 A;  1C7Y A;  5E7N A;  1AEX A;  2JA9 A;  1BF4 A;  1A8V A;  4UP7 A;  4MNO A;  2AQ2 B;  1IL2 A;  1LYL A;  1GM5 A;  1OXT A;  4DN4 M;  1A3U A;  1SJE D;  3HS0 C;  2XIW A;  3L2P A;  2VUM H;  5M3M H;  3HOY G;  4XT1 B;  4BY7 B;  4UP9 A;  1EU3 A;  3RZD H;  2HHH L;  1QE6 A;  1QUQ A;  1BBU A;  1Y1W G;  3IAY A;  3EQL C;  1G6P A;  1H9R A;  3CKI B;  2P5Z X;  2MNA A;  4A3F G;  2IW3 A;  1Q8I A;  2B2W C;  4LF6 Q;  1STA A;  2UUC L;  5IYC H;  4GKK Q;  3K5O A;  2LY7 A;  4NKL A;  3CQZ B;  4DV0 L;  2LS0 1;  2NZH A;  3A8J E;  1VQ6 A;  2DUD A;  1HUN A;  2J4X A;  2CKZ B;  2QF7 A;  1O7Z A;  1WFQ A;  4K5X A;  4X3U A;  3NEL A;  1JJC B;  1B44 D;  1L0W A;  2F0E A;  4JC0 A;  2WAQ G;  2WV6 D;  4DAV A;  2Q8I B;  1QJO A;  2KEN A;  3NTH A;  5M5Y H;  2EYL A;  4LF7 Q;  2VW9 A;  2JA8 H;  3J7A F;  1Q12 A;  5EJW A;  2EYP A;  4XYQ A;  4JI5 Q;  2E5L L;  3H3V I;  2EIF A;  2UU9 L;  3T51 B;  2B2Y A;  2JJQ A;  3PO2 H;  3CC7 A;  4DV6 Q;  2XTI A;  1F9R A;  3UE0 A;  2KBN A;  1X9N A;  1KC8 C;  5IGB A;  4KHV A;  4CKB A;  2F0J A;  1TQO A;  2CVR A;  3HOV B;  4IUV A;  2XVS A;  3F1Z A;  1MD2 D;  3GV6 A;  2HCC A;  1EL0 A;  1QUQ B;  5M5X H;  1A0I A;  1JB3 A;  3CCL A;  4ZKB B;  4TVA B;  4R4T A;  3ZYY X;  2HHH Q;  3CCJ A;  1A2T A;  4A3K H;  4JOI A;  2JA5 G;  1L1O C;  3DLL A;  4KV6 A;  3PF5 A;  5IP9 H;  2H4O A;  3H91 A;  1EYG A;  4C1N K;  5I9O A;  3CCV A;  5D3I B;  1S3O A;  1SRU A;  3ND9 A;  1LUZ A;  1M90 C;  1I50 B;  1I4H A;  4NMZ A;  1YVC A;  2UUC Q;  4I65 A;  2F0G A;  1PH1 A;  1KDA A;  1HR0 L;  4BA2 I;  3GTO B;  3HP3 A;  2X69 A;  3R8B A;  1HCZ A;  4DR7 L;  4DV0 Q;  2NVX B;  4K6D A;  3EA6 A;  1VQL A;  4IUR A;  3EN2 A;  5A2Q E;  3AMU A;  5C4Z A;  3W2D A;  4X3S A;  2OTL A;  2KVM A;  2CHB D;  4QB4 A;  3JAM c;  4LF9 L;  3TZU A;  1W6K A;  1STG A;  4HIO A;  2QCP X;  3NPP A;  2E5L Q;  5I4D A;  1D5X C;  2WIN B;  3NQI A;  3UI2 A;  1S5B D;  2UU9 Q;  1SYB A;  5C0X I;  1LO5 D;  1QIL A;  1U4L A;  1ICF B;  1KLG D;  1QB5 D;  3VYS A;  4ZQ3 A;  2EYO A;  1A3V A;  2UUA L;  1XPR A;  1TWC H;  3AU7 A;  4C3J H;  2RHQ B;  2NN6 G;  2UXB L;  1CA5 A;  5M5W B;  1X6O A;  2A69 D;  3T13 A;  1IW7 D;  2D2C C;  3EIV A;  1ASZ A;  4A3D G;  2IY5 B;  1H9J A;  1W2B A;  1I6H H;  2RBM A;  1JR0 D;  4YCV A;  1A62 A;  1XTD A;  2KHS A;  4XDX A;  4C3I G;  2PZU A;  1R4Q B;  4L63 B;  2Y0S G;  1T9H A;  5JAV A;  2RVL A;  2B2U A;  3GTP B;  1VQJ A;  1HR0 Q;  2KJX A;  1NNX A;  3K0X A;  3FKI H;  1GHJ A;  2OCE A;  3TP5 A;  4A3E G;  4DR7 Q;  2MHV A;  4O2D A;  3AYH B;  3BU2 A;  4XYO A;  5CBA E;  3FVQ A;  2MFI A;  5G3L D;  5C44 H;  5FLX c;  4L5R C;  2HUG A;  2R7Z B;  4LF9 Q;  4TRD A;  4DK6 C;  3J81 j;  1IBK L;  5GAE C;  2N3S A;  1CQF A;  1H95 A;  3U58 A;  3D6C A;  1T5E A;  5EKL A;  3PUW A;  1GD7 A;  4NXM L;  2IPK D;  1EOT A;  3BDC A;  3G7L A;  2A69 C;  2K32 A;  2RCF A;  4TQU S;  3SVM A;  4RAU C;  4ULL A;  5CV9 A;  4DV4 L;  2L11 A;  2UUA Q;  2D0P A;  2JA7 B;  1YJN A;  3CCS A;  4FF1 A;  2B2V C;  3S2H B;  1E7Z A;  2A6H D;  5IYD H;  4CKE A;  1V8Q A;  2Q2I A;  2UXB Q;  3SK6 A;  3Q0A A;  4EQN A;  5EQ0 A;  3CW2 C;  1TWF B;  3HGB A;  3RLN A;  3SDZ A;  5C3E B;  1F9Q A;  3BYY B;  4DU9 A;  5JOB A;  3GTL H;  3H0G B;  1HFG A;  4QIW E;  3KBX A;  4XIG S;  1GO3 E;  4WJ3 M;  3FEW X;  4FF4 A;  4RCO A;  2NVQ H;  3BG3 A;  4A3I G;  1TWG H;  1U9R A;  2R93 B;  1PH2 A;  2RKS A;  5GAG C;  1VQ9 A;  4A3J G;  2JA6 B;  2NUC A;  4UDU C;  2R92 H;  1SR3 A;  1PA6 A;  5KYI A;  3I4M H;  1UAP A;  4P73 A;  1N36 Q;  1RTO A;  2K5H A;  2Z4H A;  1CA6 A;  1WTQ A;  2NVY H;  5I6Y A;  1ESF A;  4IQZ A;  2Q2U A;  4OO1 G;  4ZK9 B;  5FO9 B;  1D5M C;  2FJ2 A;  3PSI A;  1B3A A;  1DJR D;  1Y8O B;  2RDF A;  3N6R A;  1XXG A;  3SEB A;  5M9O A;  1IBL L;  3R2I A;  1PTO H;  4X62 L;  1YBY A;  3HOY H;  3V05 A;  2IJ0 A;  3MC0 B;  1IBK Q;  1VQH A;  1VMP A;  1C0A A;  1B8A A;  2AQ3 B;  1Y1W H;  3M9B A;  2YTV A;  4B9W A;  4NXM Q;  2A6H C;  1BBW A;  2NZ1 D;  1DD2 A;  3HEJ A;  1C9O A;  1MSH A;  1CZG A;  4DV4 Q;  3KF6 B;  1VQG A;  2BH8 A;  1O7Y A;  5COR A;  4F7X A;  4G4K A;  1K0R A;  3B6Y A;  3CC2 A;  4N9P A;  3BDO A;  3I2Z A;  4ZCK A;  3ULL A;  5KYL A;  4HTH A;  3MZ5 A;  2HD3 A;  3Q24 A;  2F0S A;  3A7A B;  1OXS C;  2EY5 A;  3QIA A;  3MEH A;  1VQN A;  3EBE A;  1GUS A;  1G8Z D;  3T16 A;  1KRT A;  3N52 A;  2A74 C;  1PRT B;  1AE3 A;  1N33 L;  3C1F A;  3MHB A;  5C3X A;  5IYB G;  1EY0 A;  2E74 C;  3JC6 6;  1E22 A;  5I9P A;  2BE5 D;  4BY1 B;  3S1Q B;  1U4R A;  4DV5 L;  5KEE A;  3G48 A;  2B63 B;  3S1R H;  1VQK A;  1LTI D;  4IUT A;  2B8F A;  1B9M A;  5ELE A;  5C6A A;  1PDQ A;  1IBL Q;  2OQ0 A;  1GUN A;  4J8Q A;  4EQO A;  4R4C A;  3TZD A;  4DNI A;  2IHE A;  2K1B A;  1C8C A;  1DOK A;  3SHL A;  2F0F A;  5ELN A;  2RQX A;  2DY8 A;  4GZY C;  4BS9 A;  2JA5 H;  4ZUJ A;  1GUW A;  2K75 A;  3M4Y A;  3BVZ A;  1I3Q B;  3KYH C;  2Z4I A;  3S9W A;  4ZUI A;  1HXY D;  4GOP C;  5ELD A;  1DOM A;  1JCK B;  3FRP B;  1NMF A;  4IAL A;  3Q22 A;  3I4N B;  1SYE A;  4H13 C;  3QWN A;  3I8Z A;  4HJ7 A;  1CKN B;  1Q8K A;  4DAY A;  1HZ9 A;  1F2Z A;  3AFQ A;  2OTJ A;  2MGS A;  1XMO L;  4KI0 A;  1OXU A;  1N33 Q;  1F77 A;  2EQS A;  2Q2H A;  3A55 A;  3OPO A;  1PTO D;  2JP1 A;  1SMX A;  1G51 A;  2DNE A;  4C3H H;  5DNF A;  4DV5 Q;  3DEO A;  1B1Z A;  1Q46 A;  3HOU H;  2AWO A;  1JE4 A;  2EJG C;  5HGQ A;  3HOX B;  3SK4 A;  5EBC A;  1V1P B;  2NN6 H;  3GP7 A;  3CRK C;  2F0Q A;  5T1I A;  4BXX G;  2N88 A;  3NWT A;  1JOO A;  3O13 A;  2DGY A;  3C3L A;  3RZO H;  4N8X 1;  2E2J H;  1SNC A;  3HRZ C;  4A3D H;  5EKK A;  2F3V A;  5JEA G;  1EIY B;  3W1B A;  4A3K G;  3TBI B;  4A3C H;  4DR4 L;  4C3I H;  4H02 A;  2B2W A;  2CW0 D;  1H9S A;  2IL8 A;  1PH7 A;  1X32 A;  2A6E D;  1NCV A;  3PO3 B;  1VQA A;  3K81 C;  3S16 B;  4NP5 A;  4V19 0;  3FMC A;  3KLW A;  4JV5 L;  1R9T H;  3M4Q A;  4DAY B;  1SFO H;  4PMB A;  2F0V A;  4AYB B;  1LTS D;  2NTS A;  1VQ4 A;  2I5M X;  1BXT A;  4QJF A;  2D5D A;  1XMO Q;  4HSV A;  5D3D A;  1KNA A;  3CCE A;  1VQ5 A;  4IOA A;  4WJW A;  3U9O A;  4DR6 L;  4GKJ L;  2K28 A;  1PH3 A;  1STB A;  3J81 c;  1YI2 A;  1UWV A;  1VQB A;  1SN8 A;  4YY3 L;  1PYB A;  1SEB D;  4DXF A;  1KNE A;  2B8G A;  4EGV A;  1EYA A;  2NZO A;  4KN4 C;  5EPL A;  1BDO A;  3C2P A;  5AJ3 L;  2EYJ A;  1VQI A;  4KHZ A;  2EXD A;  2JYO A;  2A8V A;  5ELC A;  3K8A A;  2WB1 B;  4PQX A;  3S14 H;  4DA2 A;  2F0O A;  4DKA C;  4FXK C;  1NR4 A;  3P75 A;  4DK3 C;  2CW0 C;  3DWQ A;  2A6E C;  1DXM A;  1H9S B;  3I3C A;  1X3G A;  4GS3 A;  2YU9 H;  3CCU A;  1BQQ T;  4N8F A;  1Q1B A;  5C4X B;  1TVX A;  3WOE A;  4DR4 Q;  4AH6 A;  3S2D B;  1G91 A;  3A56 A;  3U50 C;  1WD0 A;  5ELO A;  2UUB L;  2EXZ A;  1KDB A;  3J7Z C;  1Z9F A;  4O0A A;  5LMU L;  1IKL A;  5KNB A;  4NXN L;  3MEF A;  4JV5 Q;  2A19 A;  1Y8P B;  1RTN A;  1V1O A;  3FKI G;  1SMY D;  2K50 A;  4XT3 B;  1WJJ A;  2F3W A;  2JK8 A;  2QIL A;  1VQ7 A;  4OO1 H;  1BUV T;  1KHI A;  1VQO A;  2LFN A;  4JW0 A;  5H1S E;  2ZXP A;  3JAM L;  3L7Z C;  1AP0 A;  5C44 G;  3MA2 B;  2LKV A;  1GXD C;  3A7L A;  1SDF A;  1MIU A;  5CV5 A;  3KF8 B;  4R4I A;  3V2T A;  1UEB A;  1TY2 A;  1VQM A;  5FKA C;  5HGT A;  4DR6 Q;  5C3E G;  1A15 A;  2OF1 A;  2KHI A;  3H0G G;  4YY3 Q;  1A2U A;  4CJ0 B;  2K5W A;  4HJA A;  1NJI C;  2VL6 A;  4G7Z C;  3ERQ A;  3S1M B;  1PFM A;  2NTT A;  4WOR A;  2SEB D;  4L6T B;  5AJ3 Q;  3GTM H;  5C0X G;  1CSP A;  3IRB A;  1YNX A;  3KDF A;  3P7J A;  4Y7N B;  1HR0 W;  1K8A C;  1VF7 A;  5IYD G;  1WI5 A;  2J0T D;  2OEO A;  1L1O B;  1A63 A;  3D4W A;  4ME5 A;  3HG9 A;  1RF2 D;  1PHJ A;  5DAU A;  5JPN C;  1QG7 A;  1ROD A;  2KED A;  1BR9 A;  1PRT F;  1KTK A;  1B70 B;  5CMD A;  2OXP A;  5A35 A;  3PQI A;  1QCB D;  4JI1 L;  3JAM i;  1MJE A;  2YTY A;  4A3M B;  5ELB A;  1QWY A;  4BY7 H;  4DAM A;  3GTG B;  3NQT A;  1J8I A;  3QG1 A;  2R92 G;  1J5E L;  1LV9 A;  1TWH B;  2UXD L;  5LMU Q;  4B3T L;  5IWA L;  4KY5 A;  4IFD H;  3PIO A;  4NXN Q;  1L0X B;  1K0S A;  1X65 A;  3CAM A;  3VR5 A;  2EZV A;  5J22 A;  1XJV A;  3WWV A;  1GKH A;  2PI2 A;  2PNH A;  5BN3 A;  4PZ8 A;  5FLX L;  2TSS A;  3HKZ G;  1ICW A;  2TMP A;  1Y1V B;  1ILQ A;  1KXL A;  4I7Z C;  1KQS A;  2NVT B;  1YZ6 A;  2HQL A;  3OWE B;  5LL6 S;  2L12 A;  3M4O B;  3MFY A;  1G2T A;  1LTG D;  4O1N A;  4KD4 A;  4HIK A;  4WRD A;  3F2B A;  2CH4 W;  4R4O A;  1D8L A;  1VQE A;  2B2V A;  3TS0 A;  3MXN B;  3ND8 A;  1FGB D;  5IY0 A;  1X56 A;  2B63 G;  4DNT B;  2ICE C;  1PFN A;  1VQP A;  1SRO A;  1XNQ L;  1CI3 M;  4QL5 A;  1PH6 A;  3HOV H;  1L2F A;  1GUO A;  2L55 A;  2WP8 J;  5GAD C;  5L37 A;  1ET6 A;  4JPB W;  5JJK A;  4JI1 Q;  1IYV A;  1CQV A;  5C5L A;  3S1N B;  3C1E A;  3TSS A;  4KMU C;  5IGE A;  1EQT A;  1YNJ D;  2O4X A;  5ELF A;  4YIJ A;  4KJN A;  1QNK A;  1D5Z C;  4HJ9 A;  1J5E Q;  1K9M C;  2UXD Q;  2CH4 A;  4B3T Q;  5IWA Q;  1T5X D;  2AMC B;  2XRS D;  2RA4 A;  1XMQ L;  2VUM B;  2EPB A;  1I50 H;  4A3B G;  4S3S A;  1EEF D;  2AUK A;  2BA0 A;  4RGT A;  5D65 A;  3VA5 A;  1NTG A;  3IFT A;  3ULP A;  1EIG A;  5FO8 B;  4BXX H;  4EX5 A;  3I4N G;  3S15 B;  1U0L A;  5IOC A;  3NP8 A;  1BO0 A;  5C5M A;  3VR2 A;  2NVX H;  5C4J B;  3OTO L;  1WTW A;  1SE2 A;  1U4M A;  1KRS A;  5JEA H;  1PH5 A;  1YIJ A;  4FYD A;  2R7F A;  4FO2 A;  3HOW G;  5BR8 L;  5JJZ A;  2QEJ C;  1SE3 A;  3OIP A;  1KAW A;  1IXR A;  4CDD C;  4ALP A;  1YHB A;  4KJO A;  2EJM A;  2PMZ B;  2JA8 B;  3PGZ A;  1AFP A;  1XNQ Q;  1YNJ C;  1YHQ A;  5CBE E;  2KEC A;  3PIO 3;  2N49 A;  2K4K A;  1BNZ A;  5M5W H;  3MXP A;  1RDP D;  5CV6 A;  1HNW L;  4AYB E;  5EBD A;  2YTX A;  3S17 H;  1E1O A;  5T1G A;  2CQO A;  1RCV D;  4DK1 A;  3H3V H;  3GTQ B;  4C3H G;  1XMQ Q;  2DN8 A;  2VQF L;  2K5Q A;  3PIP A;  1WTP A;  3IFD A;  4MTK A;  2EY6 A;  3HOU G;  4K5W A;  3GTP H;  3PUZ A;  4HJ5 A;  1EWI A;  1D2B A;  2XWB B;  3NTK A;  5IT9 E;  4MTN A;  1GHK A;  3OIQ A;  2ENB A;  1JWU D;  3D4R A;  1IYJ B;  4CDE C;  2ZJP A;  3OTO Q;  4HMJ A;  2KHJ A;  2ZXR A;  4JI3 L;  3H09 A;  4X64 L;  1S4Z A;  4UP8 A;  3V96 A;  5BR8 Q;  2WB1 E;  2PQA A;  4A3C G;  3KK7 A;  4DR2 L;  1F2Y A;  3K80 C;  4A76 A;  1E24 A;  2AUJ D;  4GOP A;  3W3A A;  2FIN B;  3BZC A;  5M3F G;  4CBV A;  1SNQ A;  4OWX B;  5E3F A;  4QY7 A;  4IFD J;  4POF A;  1V9P A;  1N32 L;  3GTJ H;  2FMM A;  3STB D;  4DXG A;  4RCN A;  4OWW B;  4X3T A;  2OQK A;  2L15 A;  1EUJ A;  1SE4 A;  4MZ9 A;  3S2H H;  1ILP A;  1VCI A;  3F2C A;  1SYC A;  1D6E C;  2SDF A;  1TWF H;  5EGT A;  3S24 A;  1HNW Q;  3OMC A;  4HED A;  5C3E H;  1I4P A;  2RHS B;  3A5Z B;  4C3J B;  3H0G H;  4YCU A;  4BBR B;  5JVH 3;  1LM0 A;  3AB9 A;  4PNY A;  4ZAI A;  1QVG A;  3MTS A;  1WCM B;  3NXW A;  3HOZ B;  2EYF A;  3QOL A;  2VQF Q;  1DM0 B;  3MVV A;  1IW7 C;  4JK1 C;  5C0X H;  2FXQ A;  2K05 A;  1ESR A;  2K14 A;  3J7A 5;  1I6H B;  4OWT B;  2G9H D;  5CV4 A;  1CUK A;  4C1N I;  2YYZ A;  1CHP D;  3M7G A;  4IN3 A;  2AWN A;  4KD3 A;  2X6G A;  1SNP A;  1HUM A;  1P16 A;  4JI3 Q;  1N9W A;  4X64 Q;  4GOP B;  3H15 A;  5DM6 3;  1JT8 A;  1AW7 A;  4A93 B;  1JQY D;  4DV2 L;  1S72 A;  1LT5 D;  5CV7 A;  3TRZ A;  1V1Q A;  4BBS B;  2VY3 A;  4DNR B;  3T1Y L;  1VQF A;  1K8G A;  1Y69 U;  4DR5 L;  3I56 A;  2LSS A;  5KNC A;  3BS1 A;  3M85 A;  3LNN A;  1S5C D;  3P1H A;  1N32 Q;  2Z9H A;  4DFA A;  3BZD B;  1R4P B;  2EY1 A;  3K58 A;  4DR1 L;  2F0K A;  2MJ8 A;  1NUC A;  3J81 L;  1AN8 A;  3UDX A;  1UEA B;  4IUN A;  2FMC A;  1BCP D;  1L0Y B;  1JMC A;  1TU2 B;  2QW7 A;  1VDZ A;  5JEA J;  5I2X A;  2VB2 X;  4LFC L;  4JCV E;  3OYY A;  3CCQ A;  4FXG C;  2GN5 A;  1EOV A;  4FP5 D;  1M1K C;  1BVS A;  3S1Q H;  4KLK A;  1TWG B;  4RGO S;  2E2H B;  2B63 H;  1VQC A;  2PW5 A;  4NW2 A;  1RHP A;  2A1A A;  3PMF A;  2Z1C A;  3VYR A;  1PZJ D;  1H9K A;  3RN5 A;  1E2V A;  1PZI D;  1B7Y B;  3I4M B;  1QVF A;  1WTR A;  3M7N A;  1DCZ A;  1TWA B;  2AKW B;  4C2M B;  2QDL A;  5CGK A;  4JI6 L;  2FHT A;  4BY7 G;  3H3V C;  4DV2 Q;  2JEA I;  1B3Q A;  3J81 i;  1RJT A;  2JQO A;  3T1Y Q;  4F88 A;  1B9N A;  1CT1 D;  3SK5 A;  1Q1E A;  4DR5 Q;  2Q8R E;  2ATW A;  3ULJ A;  1F9P A;  4IFD G;  3GV3 A;  2GVB A;  4KY6 A;  4NDX A;  1SNO A;  4A3B H;  1SE8 A;  1Y1W B;  2ICI A;  1BCP C;  1SBB B;  3ONA B;  3E0J A;  1TXY A;  4QMG A;  4UAI A;  4UHV A;  3TEH B;  4A3F B;  4WFN 3;  1SJH D;  3NSW A;  4K2K A;  4OEL B;  4APV A;  4DR1 Q;  3I4N H;  3E6Z X;  3OHX C;  1YHA A;  4X62 Q;  3ERS X;  2K33 A;  2K6A A;  4B3S L;  4OGQ C;  3HOW H;  3KOJ A;  4LFC Q;  2IHF A;  5JJL A;  2F0I A;  2D9U A;  3U4V A;  3CF5 A;  3FPU B;  2YV5 A;  3I73 A;  4ZKC B;  2WAQ B;  4RA8 A;  3J80 L;  2WKC A;  1SNM A;  2XN9 C;  1PYS B;  1FD7 D;  2I5H A;  3DEP A;  4JI0 L;  3QOJ A;  1Q82 C;  1G29 1;  4NPS A;  3DWP A;  3HOV G;  3W5O A;  1BOS A;  5G3L F;  4YWK A;  4O42 A;  1EIF A;  2BE5 C;  2JSO A;  2VS1 A;  3GO5 A;  3K5L A;  4FVM A;  4JI6 Q;  2PMZ E;  4POG A;  1W6J A;  2HT1 A;  4KY7 A;  2VQE L;  3I70 A;  3D6W A;  3BVG A;  3CMA A;  1B53 A;  1Y14 B;  4GN4 B;  3DM1 A;  3I90 A;  4ME3 A;  4OX9 L;  2N55 A;  2ID0 A;  4GN5 A;  1NAP A;  3RLF A;  3RD4 A;  1NSN S;  1PRT D;  4ZLT F;  2ZTD A;  2EE1 A;  5C0X J;  2CWA A;  1ZXT A;  3X3N A;  4FF2 A;  2G9D A;  2NWG A;  5KGU A;  2CQA A;  3WOF A;  1IHZ A;  1STN A;  2ZTC A;  3J80 i;  5LHY 1;  2HIX A;  3PUV A;  1IBM L;  1EZ6 A;  2KQ3 A;  2M9V A;  4OIK A;  2E2D C;  4B3S Q;  1RIP A;  4U67 3;  2RSN A;  1AZQ A;  3TS2 A;  2I5L X;  3OWF A;  4RH6 A;  1BBX C;  1E2Z A;  1ZYR D;  2IT1 A;  1QZH A;  2F3I A;  1E0B A;  5M3F H;  3M3Y B;  4IUU A;  4KTA A;  1HA5 A;  3M4P A;  4A3L G;  1TR5 A;  4R8I A;  1JC7 A;  1EZ8 A;  1Z7T A;  2NYZ D;  1TKW B;  2PO4 A;  4JI0 Q;  5E1F A;  1HTP A;  3TQY A;  2F1M A;  1PTO C;  4HAE A;  4YWM A;  1E1T A;  2A68 D;  3HKS A;  4AQY L;  2Q8T A;  1TS4 A;  3CD6 A;  4QCL A;  3AQQ A;  2VQE Q;  4A3G B;  4RHR A;  1D1K A;  3HZX A;  1K73 C;  1ENF A;  1DYQ A;  4OEM B;  4U68 A;  4DK0 A;  4LF8 L;  4FDB A;  1LT4 D;  1OXX K;  3RZO B;  4HCS A;  3S2D H;  1K8M A;  3P20 A;  3SE0 A;  1TS5 A;  3BZK A;  5EKI A;  2MPM A;  1IL8 A;  1WTX A;  2IX0 A;  3MXU A;  4TKO B;  3CU7 A;  4X6A H;  1K83 B;  4C3I B;  3KLS A;  5KIX A;  1JOK A;  2Y0S B;  4XTC S;  2GVA A;  3T1H L;  2XGT A;  4L5Q A;  1WD1 A;  1IBM Q;  2XNA C;  3A0J A;  3FP9 A;  3DXJ C;  5F2D A;  1G2S A;  4X65 L;  1SYD A;  1SFO B;  1U5K A;  3K7A B;  3G6J B;  4A3E B;  2R7Z G;  4IZ8 A;  4GNX C;  4LFA L;  4JI8 L;  1I4X A;  5A2Q L;  3GDE A;  1EYD A;  1I4G A;  3K7U C;  4GN3 B;  1PVO A;  1WCM G;  1MBY A;  2B39 A;  3MFG A;  2HDM A;  3S1M H;  3T4A C;  1CTM A;  1S5F D;  4CJ1 B;  2JA7 G;  1HQR D;  3NTI A;  4XQN A;  1HQM C;  3FHW A;  3K0Y A;  1LTT D;  1X55 A;  1HH2 P;  4AQY Q;  4IPC A;  3LX0 A;  2EVB A;  1Q81 C;  2RSO A;  4YHH L;  2E75 C;  4GKJ Q;  4DF7 A;  1YJ9 A;  1EEI D;  2KCM A;  4IJH A;  3S14 B;  1K3B C;  4L8J A;  1NBW A;  2D0O A;  4LF8 Q;  4A3M H;  2R93 G;  3TRE A;  2KCT A;  1HZA A;  2JA6 G;  2HCI A;  4BBS G;  1EY8 A;  3BJU A;  5J3B A;  3U4Z A;  4V0B A;  4A3I B;  2ZJQ A;  5C4H A;  2V1C C;  2DNC A;  5GAH C;  1NY4 A;  4HID A;  4A3J B;  5GRO A;  1KL9 A;  3T1H Q;  5GQO A;  4IUQ A;  4PV1 C;  1KDC A;  1EQQ A;  3SR1 A;  4X65 Q;  3K6O A;  3D0F A;  3ICE A;  1P8L A;  3NE5 B;  4HMI A;  2EYH A;  3MWY W;  4FF3 A;  1JOQ A;  2PNR C;  4RHS A;  4RKB A;  2NVT H;  4LFA Q;  1SMY C;  4R9W A;  4JI8 Q;  4UPA A;  2RDG A;  1LLR D;  2FFK B;  3M4O H;  2UUB Q;  4BWG B;  1WYD A;  3I91 A;  4JG2 A;  1EYC A;  3K57 A;  1FJG L;  3KBG A;  1S5E D;  4LUZ A;  1IKM A;  1ENC A;  1EY7 A;  1M4V A;  1CKM A;  1QNU A;  3J80 E;  5J1Z A;  3F2D A;  1O7I A;  4JBJ A;  3CQZ H;  2Z8L A;  2H1E A;  3AFP A;  4G7H C;  1HZC A;  4YHH Q;  1TS3 A;  1MI2 A;  3NK9 A;  1GVP A;  4GLV B;  1J6Q A;  3CC4 A;  4ZYS A;  4H44 C;  4G7O C;  1UE1 A;  3S1N H;  3KDF B;  4AIM A;  4K6L A;  4B3M L;  2E8G A;  2E2I B;  5IP7 H;  3GTK B;  4MIU A;  2MO0 A;  5E4X A;  4YCW A;  4QUF A;  1EFI D;  4BY1 G;  5JPM C;  1B4O A;  2K5D A;  2OWO A;  1NMG A;  1CZW A;  4K8J A;  1M8A A;  5AFW A;  2KOL A;  3GD7 A;  3CCM A;  4X66 L;  5C3W A;  2B2T C;  2F52 A;  3VR3 A;  2F0U A;  4TSS A;  3S15 H;  1TT2 A;  1XTC D;  2WAQ E;  2C9O A;  2B3G A;  1PLF A;  5C4J H;  2NB0 A;  4QQB X;  1DZ1 A;  1LAB A;  2EDG A;  3OOC A;  1II3 A;  4H0L C;  5D14 A;  2PZW A;  1FJG Q;  3UE1 A;  2HIV A;  4RFB A;  1B2T A;  5M3M B;  1XX8 A;  3RZD B;  2E76 C;  3I72 A;  4IOC A;  3FDT A;  5TSS A;  3VA7 A;  5ISR A;  3GTO H;  3NUC A;  3RUZ A;  3F8T A;  4L5S A;  3FPP A;  1JIC A;  3L0O A;  4DPG A;  4LF5 L;  1NE3 A;  1MHW C;  3KFU A;  3UDF A;  3A74 A;  4CGY B;  4HJ8 A;  2SNM A;  1PFB A;  2CWP A;  1EIH A;  3I4L A;  4B3M Q;  3OSO A;  5K36 H;  1HTL D;  1SYF A;  1DOL A;  1GOZ A;  4N9T A;  4ID6 A;  1FR3 A;  4A3L H;  1LAC A;  3GTQ H;  2L4N A;  3IL8 A;  1A6X A;  1Q90 A;  5M5Y B;  1I6V C;  2M2L A;  2MP1 A;  4JBK A;  1I94 L;  3I7F A;  4X66 Q;  3HOX G;  3A54 A;  3I4O A;  1RL2 A;  2N8N A;  1A3T A;  1STY A;  1K8O A;  2ZJR A;  4DUY L;  2JEB I;  3BYT B;  4JBW A;  3RLO A;  3PO2 B;  5CYU A;  1VS0 A;  3PV0 A;  1TII D;  2F0N A;  1MSG A;  1X3E A;  1PZK D;  1O80 A;  3CHB D;  1ENA A;  1S5D D;  4RGN A;  2AHO B;  2F4V L;  4LNQ A;  5M5X B;  1J9O A;  4LK1 C;  5IT9 c;  2K5V A;  1CSQ A;  3DWA A;  2ALY B;  4Q5V A;  3E9I A;  3ER0 A;  3PO3 G;  4X3K A;  4A3K B;  1ML0 D;  4KN7 C;  2Z6B A;  3G4S A;  5DEH A;  3IKJ A;  3NEN A;  4AYB G;  5IE8 A;  5EAY A;  1SND A;  3CCR A;  2VXW A;  1DON A;  2O2L D;  4LF5 Q;  2B29 A;  3JAM E;  5FLM G;  2ES2 A;  2O5J C;  3PF4 A;  4IPG A;  4PZ6 A;  2R7Z H;  2R7D A;  1FVI A;  4LMQ D;  1PH9 A;  1KLU D;  5FJ8 G;  2Z6K C;  4A3G G;  2XSC A;  2Y0S E;  2QEX A;  3VR4 A;  4BBR H;  1EY9 A;  2WKD A;  2PYK A;  4B9X A;  3EJI A;  1WCM H;  3HOZ H;  1V43 A;  4F87 A;  3SGI A;  2PZT A;  1KAA A;  1VF5 C;  1NR2 A;  3ERO A;  4OXP A;  1EWC A;  4YWL A;  3D4D A;  1I94 Q;  3S17 B;  3OW2 A;  2JA7 H;  4MN3 A;  4KKT A;  1K3R A;  4DUY Q;  3L3O C;  1C4Q A;  2WB1 G;  2PCF B;  2BH2 A;  1N34 L;  1X54 A;  3G6E A;  4LWC A;  2KEE A;  1B50 A;  1MJC A;  2L5T A;  1TWC B;  3MAQ A;  4KHP L;  3TP8 A;  1N36 L;  1LTB D;  1EU4 A;  4JYA L;  2AQ1 B;  1BCP B;  2ZTE A;  2F4V Q;  4P2C B;  5C4X G;  2R93 H;  4A93 H;  1EY6 A;  4R1J A;  2JA6 H;  2L0C A;  4BBS H;  2PPB C;  2K03 A;  2EOT A;  2F0T A;  4RKL A;  4LUO A;  2SOB A;  1MKH A;  4K8I A;  3TN2 A;  1STH A;  1QOH A;  5E4W C;  1SSO A;  5I2Y A;  3A5U A;  3H94 A;  4Y52 H;  1WOC A;  4OON A;  5FLX E;  2IX1 A;  2Q2T A;  3R93 A;  1F9S A;  2PQA B;  3URY A;  1HNZ L;  3U9S A;  3FKI B;  3GTJ B;  2KCC A;  3VR6 A;  2QA4 A;  1PH8 A;  1DGS A;  4DR2 Q;  1EFW A;  3STB C;  4XXE A;  1PV4 A;  4LFB L;  1BKB A;  4K14 A;  4B08 A;  5BN5 A;  5C44 B;  1OXV A;  1UUP A;  5COY A;  3UDI A;  1N8R C;  4JI4 L;  1JB7 A;  1CHQ D; 
#chains in the Genus database with same CATH homology
 4R4T A;  3KF6 A;  2KHI A;  4ME3 A;  2HHH Q;  3H0G G;  1FL0 A;  3CCJ A;  4DV1 L;  4YY3 Q;  4OX9 L;  1VQD A;  4A3K H;  4JOI A;  4HJA A;  1NJI C;  1L1O C;  2ID0 A;  2VL6 A;  4GN5 A;  3RLF A;  3DLL A;  5IP9 H;  3PF5 A;  4LW1 A;  3I55 A;  1EYG A;  3PUY A;  3CCV A;  2MQH A;  2ZTD A;  4RG1 A;  1S3O A;  1SRU A;  2CWA A;  1LUZ A;  5C0X J;  5AJ3 Q;  1M90 C;  5C0X G;  2E2H H;  1CSP A;  2JE6 I;  3GTM H;  3IRB A;  1YNX A;  3KDF A;  1N34 Q;  1HR0 W;  1PFS A;  1E3P A;  1YVC A;  2UUC Q;  2ZTC A;  3J80 i;  1K8A C;  1PH1 A;  2HIX A;  1HR0 L;  5IYD G;  1IZ6 A;  1WI5 A;  1L1O B;  1A63 A;  4BA2 I;  4KHP Q;  3PUV A;  4DR7 L;  1IBM L;  1TWA H;  4C2M H;  1PHJ A;  1S40 A;  4P75 A;  4JYA Q;  1YIT A;  1RIP A;  4DV0 Q;  4B3S Q;  1VQL A;  2QGQ A;  3KJO A;  1D7Q A;  3EN2 A;  4A3M G;  1B70 B;  3DM3 A;  2OTL A;  3TS2 A;  2I5L X;  3PCO B;  4JI1 L;  2IT1 A;  3JAM i;  1MJE A;  2YTY A;  1QZH A;  2F3I A;  3JAM c;  4BY7 H;  4DAM A;  4LF9 L;  4P71 A;  4BY1 H;  1CKO A;  4LUV A;  4PZ7 A;  5M3F H;  2R92 G;  4HIO A;  3M4P A;  4A3L G;  1J5E L;  2E5L Q;  2UXD L;  5LMU Q;  4B3T L;  5IWA L;  2CFM A;  3PIO A;  4NXN Q;  4PMW A;  2UU9 Q;  1YEZ A;  1X65 A;  3CAM A;  2C35 B;  4BA1 I;  5C0X I;  1XJV A;  4JI0 Q;  4RMF A;  3WWV A;  4A3F H;  4JOI C;  1GKH A;  2PI2 A;  2PNH A;  3TQY A;  1Y1V G;  1HNZ Q;  4PZ8 A;  4K0K L;  4YWM A;  1Q7Y C;  3HKZ G;  2UUA L;  4GNX A;  1E1T A;  3HKS A;  4NB3 A;  4AQY L;  1XPR A;  1TWC H;  2N78 A;  3CD6 A;  4C3J H;  1KXL A;  2RHQ B;  2NN6 G;  4LFB Q;  3AQQ A;  2UXB L;  2VQE Q;  1UE5 A;  5JJI A;  1X6O A;  1KQS A;  1K73 C;  1YZ6 A;  3E9H A;  4JI4 Q;  2HQL A;  3EIV A;  1ASZ A;  4JI7 L;  1I3Q H;  4LF8 L;  4A3D G;  4FDB A;  1OXX K;  2IY5 B;  4DV1 Q;  3CPW A;  1W2B A;  3S2D H;  1HJP A;  4IPD A;  4HIK A;  1I6H H;  3BZK A;  4YCV A;  3Q8D A;  4DV3 L;  1A62 A;  1XTD A;  3F2B A;  2IX0 A;  1CKN A;  5LMN W;  2Y0S G;  1D8L A;  1VQE A;  4R4O A;  2PI2 E;  4X6A H;  1T9H A;  3TS0 A;  3MXN B;  3VDY A;  1VQJ A;  1FGU A;  1HR0 Q;  5IY0 A;  1X56 A;  4XTC S;  2B63 G;  3K0X A;  2GVA A;  3T1H L;  1SRO A;  2XGT A;  3FKI H;  1VQP A;  4L5Q A;  1XNQ L;  2OCE A;  4A3E G;  1IBM Q;  4DR7 Q;  3A0J A;  4QL5 A;  1PH6 A;  3HOV H;  3FP9 A;  2WFW A;  1L2F A;  4X65 L;  4O2D A;  2NN6 I;  4IPH A;  2WP8 J;  2D62 A;  3AYH B;  3BU2 A;  1U5K A;  5GAD C;  2MFI A;  5DLQ E;  5C44 H;  2R7Z G;  1LTL A;  4GNX C;  4LFA L;  5FLX c;  5JJK A;  4JI1 Q;  4JI8 L;  5IP7 G;  4L5R C;  3GDE A;  3RN2 A;  4LF9 Q;  4DK6 C;  3K7U C;  3J81 j;  1YJW A;  1IBK L;  5GAE C;  1XNR L;  2N3S A;  4GN3 B;  1WCM G;  1PVO A;  4HJ9 A;  3U58 A;  1ASY A;  1J5E Q;  1H95 A;  1K9M C;  1PH4 A;  2VUM G;  5M3M G;  2UXD Q;  4B3T Q;  3S1M H;  3PUW A;  5IWA Q;  1GD7 A;  4NXM L;  2AMC B;  1XMQ L;  3HOX H;  1KIX A;  4GNX B;  1I50 H;  2JA7 G;  4A3B G;  4TQU S;  3CXC A;  3D31 A;  4K0K Q;  3FHW A;  4DV4 L;  1X55 A;  2BA0 A;  2D0P A;  2UUA Q;  1HH2 P;  1YJN A;  1NTG A;  2LXK A;  4AQY Q;  3ULP A;  3CCS A;  4IPC A;  4BXX H;  4EX5 A;  3I4N G;  3NEM A;  1U0L A;  1E7Z A;  5IYD H;  1Q81 C;  5IYC G;  2NVX H;  2Q2I A;  4YHH L;  4LF4 L;  3CP0 A;  2UXB Q;  3OTO L;  4GKJ Q;  2UXC L;  3CW2 C;  4DUZ L;  1KRS A;  1YJ9 A;  1PH5 A;  3RLN A;  1YIJ A;  2R7F A;  2KCM A;  4IJH A;  4JI7 Q;  1NBW A;  2D0O A;  4LF8 Q;  4A3M H;  3HOW G;  3GTL H;  5BR8 L;  2R93 G;  4QIW E;  3TRE A;  4XIG S;  3PO3 H;  1GO3 E;  2KCT A;  2NVQ H;  5HY6 A;  1HZA A;  3M3Y H;  2JA6 G;  4A3I G;  3S16 H;  4WJ3 M;  1TWG H;  2JA5 G;  4BBS G;  4DV3 Q;  1KD1 C;  3BJU A;  5J3B A;  3U4Z A;  2H5X A;  1PH2 A;  4JBM A;  1KAW A;  1IXR A;  5GAG C;  4PG3 A;  1VQ9 A;  4A3J G;  2R92 H;  2ZJQ A;  2JA8 G;  4ALP A;  2RCN A;  1YHB A;  1SR3 A;  2V1C C;  3RR5 A;  1Q86 C;  3KJP A;  1PA6 A;  3I4M H;  5GAH C;  1NY4 A;  4P73 A;  4HID A;  5GRO A;  1N36 Q;  2K5H A;  3PGZ A;  2LXJ A;  1KL9 A;  4WJ4 A;  5FLM H;  3T1H Q;  2NVY H;  5GQO A;  3PO2 G;  1XNQ Q;  1EQQ A;  2Q2U A;  1YHQ A;  4OO1 G;  4X65 Q;  3AEV A;  3D0F A;  3ICE A;  2MO1 A;  3PSI A;  1P8L A;  5FJ8 H;  2N49 A;  2K4K A;  4GLA C;  4A3G H;  4B3R L;  5M5W H;  3W1G A;  2NVT H;  5K36 G;  1IBL L;  4LFA Q;  1EQR A;  4IO9 A;  1OTC A;  4JI8 Q;  4UPA A;  1HNW L;  1UE6 A;  4X62 L;  4AYB E;  3M4O H;  1YBY A;  3HOY H;  2YTX A;  2UUB Q;  1IBK Q;  1XNR Q;  3S17 H;  1VQH A;  3RNU A;  1WYD A;  1E1O A;  4UY8 C;  4P74 A;  1B8A A;  4JG2 A;  1FJG L;  2VZA A;  1Y1W H;  1C0A A;  3M9B A;  2YTV A;  2CQO A;  3H3V H;  4NXM Q;  1XMQ Q;  4LUZ A;  2VQF L;  1BBW A;  3PIP A;  2I0Q A;  1CKM A;  3CPF A;  5IP9 G;  4DR3 L;  3HOU G;  2Z0S A;  1K83 H;  1C9O A;  3F2D A;  3GTP H;  3PUZ A;  1O7I A;  4DV4 Q;  1EWI A;  4HJ5 A;  4JBJ A;  3CQZ H;  3KF6 B;  1VQG A;  2BH8 A;  4MTN A;  3AFP A;  4P72 A;  1I5F A;  1HZC A;  1AH9 A;  1K0R A;  3B6Y A;  3CC2 A;  4OO1 I;  1IYJ B;  3I2Z A;  3ULL A;  4YHH Q;  4LF4 Q;  2ZJP A;  1GVP A;  4GLV B;  3CME A;  3OTO Q;  2UXC Q;  1J6Q A;  3CC4 A;  3K7A H;  4A3E H;  4DUZ Q;  1OXS C;  2KHJ A;  2ASB A;  4JI3 L;  5C4X H;  1UE1 A;  4OX9 Q;  3S1N H;  1VQN A;  4X64 L;  3KDF B;  3EBE A;  4UP8 A;  4L5T A;  4AIM A;  5BR8 Q;  4B3M L;  2E8G A;  1KRT A;  2WB1 E;  2PQA A;  4A3C G;  4DR2 L;  3PUX A;  5IP7 H;  3K80 C;  4A76 A;  1AE3 A;  2MO0 A;  1E24 A;  4YCW A;  2ZM6 L;  1N33 L;  4GOP A;  4BY1 G;  3BZC A;  5LMN L;  5IYB G;  5M3F G;  2OWO A;  1NMG A;  3JC6 6;  4OWX B;  4QGU A;  1E22 A;  1XPU A;  4QY7 A;  4IFD J;  4POF A;  1V9P A;  3GD7 A;  3CCM A;  3GTJ H;  1N32 L;  4GLX A;  4X66 L;  4DV5 L;  3G48 A;  3STB D;  4OWW B;  2F52 A;  2OQK A;  2L15 A;  3S1R H;  4DR6 Q;  1EUJ A;  1QZG A;  1VQK A;  1X3F A;  1Z47 A;  3S15 H;  4MZ9 A;  2R6G A;  2WAQ E;  3S2H H;  2B3G A;  1VCI A;  3F2C A;  5C4J H;  4B3R Q;  1QVC A;  1IBL Q;  2OQ0 A;  1TWF H;  4QQB X;  4BBR G;  3S24 A;  1AE2 A;  1HNW Q;  4R4C A;  5C3E H;  3HOZ G;  4DNI A;  2IHE A;  2RHS B;  3A5Z B;  3H0G H;  3HFZ B;  4YCU A;  1LM0 A;  5ELN A;  1QVG A;  1FJG Q;  3UE1 A;  2JA5 H;  2HIV A;  2K5N A;  1L1O A;  2K75 A;  4Y7N H;  2VQF Q;  1JJ2 A;  4A3I H;  3KYH C;  4DR3 Q;  2FXQ A;  1JE5 A;  4IOC A;  2RF4 A;  4A3J H;  3GTO H;  4IFD I;  2K14 A;  3J7A 5;  4GOP C;  4JI2 L;  4OWT B;  1CUK A;  1XPO A;  2YYZ A;  3F8T A;  1NMF A;  4L5S A;  3L0O A;  2AWN A;  4DPG A;  4LF5 L;  4DV7 L;  1NE3 A;  3KFU A;  1P16 A;  3A74 A;  4J15 A;  3UDF A;  4JI3 Q;  2K52 A;  1UE7 A;  1N9W A;  1CKN B;  1Q8K A;  4HJ7 A;  1HZ9 A;  4HJ8 A;  1HNX L;  3GTG H;  4A93 G;  1VQ8 A;  4X64 Q;  4GOP B;  3AFQ A;  2OTJ A;  2CWP A;  4A75 A;  4B3M Q;  3H15 A;  1XMO L;  1JT8 A;  1TWH H;  4R4Q A;  3NBH B;  4KI0 A;  4DV2 L;  1S72 A;  1OXU A;  2ZM6 Q;  3TRZ A;  1N33 Q;  1V1Q A;  4A3L H;  3GTQ H;  2VY3 A;  3T1Y L;  2EQS A;  2Q2H A;  1VQF A;  5LMN Q;  1K8G A;  4DR5 L;  3I56 A;  2LSS A;  1SMX A;  3M85 A;  1G51 A;  3E0E A;  4C3H H;  4JBK A;  1I94 L;  1N32 Q;  2CCZ A;  3I7F A;  4X66 Q;  4DV5 Q;  3HOX G;  3I4O A;  1RL2 A;  1Y1V H;  1Q46 A;  2BA1 A;  2N8N A;  3HOU H;  2AWO A;  5HGQ A;  2ZJR A;  4DUY L;  2JEB I;  4JBW A;  3RLO A;  4LF6 L;  1VS0 A;  3PV0 A;  4DR1 L;  2Z6K A;  2VNU D;  4HIM A;  4GKK L;  1X3E A;  4BXX G;  3ZJY C;  3UDX A;  3J80 c;  2DGY A;  3RZO H;  1JMC A;  3UDG A;  2E2J H;  1HZB A;  2AHO B;  2F4V L;  4LNQ A;  4A3D H;  5JEA J;  2E2I H;  5JEA G;  5IT9 c;  2K5V A;  1EIY B;  1CSQ A;  4IJL A;  2ALY B;  4LFC L;  3W1B A;  4A3K G;  3GTK H;  4JCV E;  3E9I A;  4EQ5 A;  3OYY A;  3ER0 A;  3HKZ E;  4A3C H;  4DR4 L;  3CCQ A;  4C3I H;  1SLJ A;  4H02 A;  3PO3 G;  2GN5 A;  1EOV A;  1M1K C;  1PH7 A;  4LF7 L;  1BVS A;  1JJG A;  4JI5 L;  3S1Q H;  1VQA A;  3G4S A;  3K81 C;  5IYB H;  4A4I A;  4KLK A;  3NEN A;  4JI2 Q;  4AYB G;  5IE8 A;  3KLW A;  2B63 H;  3LGJ A;  1W3S A;  4JV5 L;  1R9T H;  5EAY A;  1VQC A;  3M4Q A;  3I4M G;  4DAY B;  2A1A A;  3CCR A;  1SFO H;  4LF5 Q;  2B29 A;  4DV7 Q;  5FLM G;  4DV6 L;  3RN5 A;  2ES2 A;  1B7Y B;  3PF4 A;  1QVF A;  1VQ4 A;  4IPG A;  2I5M X;  4PZ6 A;  3M7N A;  1HNX Q;  2R7Z H;  2AKW B;  1FVI A;  2R7D A;  3G71 A;  1PH9 A;  5E7N A;  2JA9 A;  5FJ8 G;  1C7Y A;  4JI6 L;  2Z6K C;  4A3G G;  1A8V A;  2Y0S E;  4QJF A;  4UP7 A;  2QEX A;  1XMO Q;  4MNO A;  4BBR H;  1IL2 A;  1LYL A;  1GM5 A;  4BY7 G;  1OXT A;  3CCE A;  4DV2 Q;  1VQ5 A;  3J81 i;  2JEA I;  4IOA A;  1WCM H;  3HOZ H;  4DR6 L;  4GKJ L;  2JQO A;  1V43 A;  1PH3 A;  3HOY G;  3T1Y Q;  3L2P A;  3SGI A;  5M3M H;  3J81 c;  1YI2 A;  2VUM H;  4UP9 A;  1Q1E A;  1UWV A;  1VQB A;  4DR5 Q;  3RZD H;  2HHH L;  1SN8 A;  3ULJ A;  1PYB A;  4OXP A;  1QUQ A;  4YY3 L;  2ATW A;  4IFD G;  1BBU A;  1Y1W G;  1G6P A;  4YWL A;  2GVB A;  1I94 Q;  3OW2 A;  2JA7 H;  4A3B H;  2MNA A;  2NZO A;  1SE8 A;  4A3F G;  1K3R A;  1TXY A;  5AJ3 L;  4DUY Q;  1VQI A;  2WB1 G;  2EXD A;  4KHZ A;  2BH2 A;  3TEH B;  4LF6 Q;  2A8V A;  1N34 L;  1X54 A;  4DR1 Q;  3I4N H;  4APV A;  3G6E A;  3K8A A;  2UUC L;  4LWC A;  5IYC H;  1YHA A;  4GKK Q;  4X62 Q;  1MJC A;  3S14 H;  3ERS X;  4DKA C;  4KHP L;  1N36 L;  4DK3 C;  4JYA L;  4B3S L;  4DV0 L;  2NZH A;  2ZTE A;  1VQ6 A;  2F4V Q;  2DUD A;  3HOW H;  3KOJ A;  2CKZ B;  5C4X G;  1X3G A;  4GS3 A;  2R93 H;  4A93 H;  1WFQ A;  4LFC Q;  2IHF A;  4R1J A;  2YU9 H;  5JJL A;  3CCU A;  3NEL A;  1JJC B;  1L0W A;  1Q1B A;  2JA6 H;  4JC0 A;  2WAQ G;  4BBS H;  4DR4 Q;  3U4V A;  4AH6 A;  3CF5 A;  2KEN A;  2YV5 A;  5M5Y H;  4LUO A;  4LF7 Q;  2VW9 A;  2JA8 H;  1MKH A;  1Q12 A;  3U50 C;  4JI5 Q;  3H3V I;  5ELO A;  2E5L L;  2UUB L;  3J7Z C;  1Z9F A;  4O0A A;  5LMU L;  3A5U A;  2EIF A;  4NXN L;  3MEF A;  2UU9 L;  1PYS B;  1WOC A;  2A19 A;  4OON A;  4JV5 Q;  4Y52 H;  2IX1 A;  2I5H A;  2Q2T A;  2JJQ A;  3FKI G;  1Q82 C;  4JI0 L;  3PO2 H;  1G29 1;  2K50 A;  2PQA B;  4NPS A;  1WJJ A;  2JK8 A;  3CC7 A;  1VQ7 A;  4DV6 Q;  2XTI A;  3UE0 A;  3W5O A;  1HNZ L;  1KHI A;  2KBN A;  1VQO A;  1X9N A;  3HOV G;  4YWK A;  1KC8 C;  1EIF A;  5H1S E;  2QA4 A;  3L7Z C;  2VS1 A;  3GO5 A;  1PH8 A;  5C44 G;  3F1Z A;  1DGS A;  4DR2 Q;  1EFW A;  3STB C;  1MIU A;  4JI6 Q;  2PMZ E;  1PV4 A;  4POG A;  4LFB L;  1BKB A;  2HT1 A;  3KF8 B;  4R4I A;  1QUQ B;  2VQE L;  5M5X H;  1UEB A;  1A0I A;  1VQM A;  1OXV A;  3UDI A;  1N8R C;  3CCL A;  4JI4 L;  1JB7 A;  3CMA A;  1Y14 B;  5C3E G;  4TVA B;  4GN4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...