3ZJYC

Crystal structure of importin 13 - rangtp - eif1a complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
74
Chain Sequence
FKEDGQEYAQVIKMLGNGRLEAMCFDRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNRSLKAYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
publication title Structural Basis for the Nuclear Export Activity of Importin13.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 74
sequence length 81
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3zjyC00
4LFAL 3S2DH 2ZTCA 4A3JG 4LF6Q 2IY5B 3KYHC 4LUVA 1Y1VH 4HIKA 1J6QA 4DK6C 2R7ZH 1X3EA 1MJEA 1EOVA 3I7FA 4JI5L 4LF9Q 2E5LL 1L1OA 1X56A 1VQ8A 5C4XG 1IYJB 3HOYG 2WAQG 1RL2A 1LUZA 4JOIC 1S72A 1KD1C 2AWOA 1B8AA 5DLQE 1C7YA 3ULLA 1G291 3GTMH 4GNXB 1Y1WH 4OWWB 4A3LG 2A19A 1G6PA 3UE0A 4A3IG 4YCWA 1J5EQ 1C9OA 2RHSB 4BBSG 3I4NG 3NENA 1A8VA 2HIXA 1RIPA 1U0LA 4GOPC 1PH6A 1IZ6A 4KHZA 1HNWL 1EWIA 1OXVA 1VQHA 2I5LX 1I94Q 1HZAA 1QVCA 1E1OA 2VNUD 1MJCA 5LMUQ 4JV5L 1LTLA 4A75A 2UUBL 1XNRL 4KHPQ 3NELA 4RG1A 4X64Q 3S1NH 4A3BH 4IO9A 3GDEA 1FL0A 2K5HA 4JBMA 1SFOH 3STBC 4BBRH 2PI2E 5M3MG 3PO3G 5C3EG 4X65Q 1YIJA 4GKJL 1PHJA 3PIPA 3J81c 5HY6A 1FVIA 5C0XJ 2ZM6Q 1N36Q 4DUZQ 3DLLA 4L5RC 1Q7YC 4HIOA 4DV3Q 4HJ8A 4GN3B 1GD7A 1OXSC 4AIMA 2BH8A 1WI5A 4A3CG 4OXPA 5JEAJ 3HKZG 4DR7L 5ELNA 2ID0A 5M5WH 2Q2UA 2Z6KA 2WAQE 5IP9G 2VQEQ 3ICEA 4IPCA 4DV2L 4A76A 1Q12A 3CCRA 1QZHA 2JEBI 2R92H 1C0AA 2WB1G 4LF7Q 3FP9A 5JJIA 5JJKA 3M4PA 2DGYA 4JI3L 3H0GG 1I50H 1SRUA 3K7UC 2ALYB 2VUMH 3H3VH 4JI1L 3S24A 3AYHB 4JI2Q 2E2IH 4DV5L 1N34L 2JQOA 4IOCA 4BY1H 2CWAA 4X62L 4DV0L 2EQSA 4APVA 1HNZQ 1SN8A 2UUCQ 4WJ4A 4YCUA 2KHIA 5C0XG 4R1JA 3CCUA 1BBWA 1YZ6A 4BY7H 4DUYQ 3M9BA 4GKKL 4A3DH 4Y52H 4DV1L 2E2JH 1X55A 5IYDG 2F3IA 1K8AC 1YEZA 4DV7Q 4LFCL 4ME3A 4WJ3M 1R9TH 3K80C 4JOIA 5C4XH 4UP7A 1KRTA 4H02A 3HOVH 1N9WA 4A3FG 3S17H 1XMQQ 3K7AH 1L2FA 3JC66 1HZCA 3AFPA 3U4ZA 5IE8A 5GADC 3G48A 4JI5Q 2JA8G 3PF4A 3W1GA 4A3IH 2E5LQ 1WYDA 4HIDA 3STBD 3KLWA 4DNIA 4GOPA 1K3RA 1OXUA 5IYBH 4POGA 3PUVA 1MKHA 1UE6A 2IT1A 3WWVA 3D31A 3U4VA 1KC8C 2NZOA 5M5XH 4XTCS 5C44H 3J81j 3HKZE 3T1YL 2WFWA 1A62A 3PUWA 4A3MH 2RCNA 2UXBL 3S1QH 2CCZA 2KBNA 2PI2A 5LMNW 1VCIA 3VDYA 1EQQA 2QA4A 1FGUA 1HZBA 4NPSA 1L0WA 5IYCG 2WB1E 3A0JA 4POFA 2QGQA 1PH1A 1AE3A 1JB7A 3CD6A 3RZDH 4LFBL 3ERSX 1IBKL 1YHQA 3KFUA 1AH9A 4O2DA 4OWXB 5IT9c 3ULPA 1W2BA 1PH3A 1KAWA 3TS2A 4A4IA 2D0PA 2E8GA 2PMZE 4P71A 1XNRQ 2NN6G 1PH8A 2ZJPA 3M85A 3Q8DA 4PG3A 5FLMH 3J80i 4DV6L 1HR0W 4A3KG 4GLVB 1LYLA 3I55A 4B3SL 2ASBA 3I4MG 3HOWG 4JYAQ 1V1QA 1KRSA 1MIUA 2BA1A 3CAMA 2KENA 3L2PA 1QVGA 3TRZA 3BU2A 1X9NA 1WCMG 5GQOA 2EIFA 2Q2TA 4DR2L 2JA7H 2RF4A 3PUYA 3OTOQ 3PIOA 3HOXH 2IHFA 3KDFA 1PVOA 1EUJA 3JAMc 2MFIA 4JI7Q 3LGJA 2K5VA 5M3FH 2KHJA 4YHHL 4QIWE 4A3EG 3U50C 1VQPA 1OTCA 2HT1A 4DR6L 2K50A 2E2HH 5LMNL 5C4JH 4DR3L 2CQOA 4IPHA 1IXRA 4B3TQ 4UP8A 1Y14B 3K8AA 1TWFH 1EFWA 3CC4A 2NVXH 2K52A 2NVYH 2XGTA 4DV2Q 5K36G 1TWHH 2R93G 2VZAA 4TQUS 1EYGA 1WFQA 2I0QA 1XPRA 1JMCA 4DR1L 1D8LA 3KF6A 4A93H 4JI1Q 2EXDA 1K83H 1KQSA 5AJ3L 1UWVA 1NTGA 3D0FA 3PGZA 3W1BA 4HIMA 4MTNA 4LUZA 3A5UA 4DV5Q 1K9MC 3PO2H 3E0EA 1EIFA 3F8TA 4X62Q 4DV0Q 2NZHA 4OO1G 2JK8A 4JG2A 1JJCB 2PQAB 2HHHL 4JI8Q 2UUAL 3HOZH 1CSPA 5IYDH 2QEXA 3PO3H 3S1MH 4GLXA 3CC7A 5H1SE 2JA5G 4GKKQ 1M90C 1SMXA 3CPFA 4DV1Q 3UDGA 3FKIH 3IRBA 2B63H 2UU9L 2OTJA 4HJAA 1IBMQ 4IOAA 2IHEA 4LFCQ 4R4IA 5JJLA 4JBWA 4BA1I 1IBLL 1TXYA 1QUQB 1TWGH 2K14A 1I5FA 3E9HA 2MNAA 1P16A 3RLNA 1HJPA 1PH2A 1HZ9A 1X3GA 3UE1A 1N32Q 3RLOA 4LNQA 1VQDA 4A3GG 4OONA 4OX9L 4DAMA 3T1YQ 4JI6Q 1X6OA 1VQ9A 4IFDJ 4EX5A 3UDFA 2UXBQ 4AH6A 2XTIA 4GNXA 2JA6H 4C3IH 4NB3A 3K81C 5M5YH 5HGQA 4GN5A 2H5XA 4JI0L 4BXXH 2L15A 1IBKQ 3M4OH 3HKSA 3M3YH 2MO0A 1BKBA 1SR3A 5FJ8H 3G71A 1U5KA 3CC2A 3CCLA 5IP7H 4LF9L 2UXDL 1YHAA 4K0KL 3PUXA 1Y1VG 1VQCA 2R7ZG 1Z47A 4YY3L 4P72A 1EIYB 4B3RL 4J15A 4B3SQ 5BR8L 2PQAA 4A3JH 2JE6I 2OQ0A 4AQYL 4DV4L 1XMOQ 5JEAG 4X6AH 1X54A 1YHBA 4LFAQ 2CWPA 1Y1WG 3UDIA 1CKNB 4Y7NH 3HOYH 1YJWA 4A3EH 4IFDG 1PH9A 1CSQA 2YTXA 3KOJA 3UDXA 1LM0A 3KJOA 4XIGS 1E22A 1ASYA 2D0OA 4A3LH 3CCMA 5LMUL 3OYYA 3GTLH 3RN2A 5GROA 4YHHQ 4BBSH 2VS1A 4X64L 3RNUA 1N33L 1SLJA 3I4NH 3NEMA 5LMNQ 4DR3Q 1V9PA 4O0AA 3S15H 4PZ8A 1Z9FA 1PV4A 4DR4L 1BVSA 4JBJA 4IJLA 2DUDA 3GTOH 1QVFA 1XNQL 4A3BG 3FHWA 2C35B 3MEFA 3S1RH 1VQ5A 4DR1Q 2PNHA 1L1OB 1E7ZA 2K4KA 4NXNL 1HNWQ 3J81i 4DK3C 3F2CA 4BBRG 2ZM6L 1N36L 1V43A 3S2HH 3GTPH 3AFQA 4MZ9A 3CF5A 4DV3L 4JV5Q 1Q81C 4LF5L 2A1AA 1PYSB 2UUBQ 4HJ7A 3CXCA 2ZJRA 2UUAQ 1KXLA 3RZOH 1Q46A 3GTKH 1E3PA 1JE5A 5M3MH 1PH4A 1HNXL 1GKHA 5C0XI 1VQOA 5C3EH 4R4OA 3K0XA 4KI0A 3A74A 4UPAA 4LF7L 4QJFA 3CQZH 1E24A 2N8NA 1XJVA 1XPUA 2F4VL 5IY0A 3TS0A 1K8GA 2VL6A 2NVTH 4GKJQ 4A3CH 2LSSA 2I5MX 4L5TA 2Z6KC 2R92G 3G4SA 4JI2L 2OCEA 5IP9H 1BBUA 3HOUG 4C3JH 1A63A 1N32L 2VUMG 1HNZL 3B6YA 2N49A 1NE3A 4GN4B 4X66L 1S40A 2AMCB 4IPDA 2YU9H 2N78A 3S16H 4DR7Q 3H0GH 4BY1G 3T1HL 3PSIA 1CUKA 4LWCA 4DKAC 1K0RA 4OX9Q 2UXCL 1CKOA 3HFZB 2YTVA 4FDBA 3CMEA 4JI4L 4UP9A 3GO5A 4DV7L 1PA6A 2Q2IA 4BY7G 1N8RC 4QL5A 1O7IA 4JI3Q 1FJGL 1VQ6A 4A3DG 3PV0A 1VQ4A 1IL2A 4NXML 4YWMA 2CFMA 1XPOA 1XMQL 5ELOA 4JI0Q 2MO1A 3EIVA 4JCVE 3RN5A 1HR0L 2ZJQA 1N34Q 3CCQA 1NMFA 1A0IA 1VQAA 3TREA 4DR5L 2UXDQ 3HOVG 1X65A 1YNXA 4RMFA 4K0KQ 2VQFL 4AYBG 2BA0A 1VQLA 1VQFA 3A5ZB 2NN6I 3M4QA 3CMAA 4YY3Q 1VQIA 4B3RQ 1NJIC 4LF4L 3PCOB 4GS3A 4L5QA 1P8LA 5BR8Q 5FLXc 4A3FH 2A8VA 4AQYQ 2JEAI 4DV4Q 3BZKA 4PMWA 3I2ZA 5IYBG 2B29A 2GN5A 4R4CA 2JA8H 2WP8J 4OWTB 1VQ7A 4B3ML 3DM3A 5C44G 4A3MG 1VQMA 4P73A 1NY4A 1Q1EA 4QY7A 3OW2A 3TQYA 5GAGC 2OQKA 2LXJA 5IWAL 1NMGA 1D7QA 2V1CC 1N33Q 1VQKA 4LF8L 3H3VI 1VQBA 2YYZA 2Y0SG 3CCJA 1OXXK 5IYCH 1Q82C 2KCMA 2OWOA 4DR4Q 4JYAL 4HJ9A 1SROA 2AHOB 2HIVA 1I6HH 2JA9A 2AKWB 4R4TA 2K5NA 3GTQH 2OTLA 3L0OA 4C2MH 5FLMG 4ALPA 4JC0A 1XNQQ 2B3GA 3OTOL 4LF6L 1AE2A 3ULJA 1K73C 4NXNQ 4LFBQ 2ZTDA 1TWAH 4GOPB 3U58A 1YI2A 3JAMi 3HOWH 2Q2HA 4QGUA 4A3KH 1YITA 3I4MH 2N3SA 4JI7L 3TEHB 1X3FA 2JA7G 1NBWA 1PH7A 1ASZA 2ATWA 3HOXG 1UE7A 4OO1I 2KCTA 1WCMH 1PH5A 1G51A 2D62A 1W3SA 3ER0A 3F1ZA 3SGIA 3J80c 1Q8KA 4DV6Q 1HNXQ 4B3TL 2GVAA 3I4OA 4AYBE 3AQQA 5GAEC 1WJJA 3NBHB 3CCSA 1J5EL 5M3FG 1UE5A 2R7FA 4R4QA 4LUOA 4C3HH 1L1OC 1UEBA 1B70B 2ZTEA 5J3BA 3F2BA 4DR2Q 1DGSA 2F4VQ 3HOUH 1HH2P 1I3QH 2R7DA 1EQRA 4P74A 1I94L 1JJGA 1YJ9A 4BA2I 3CCVA 4YWLA 1KHIA 1QUQA 3G6EA 1Q86C 1XTDA 4IPGA 2AWNA 3J7A5 4JI8L 1YVCA 3CPWA 4KHPL 2ES2A 2BH2A 4DR6Q 4A93G 4X66Q 2R93H 1VQNA 2Z0SA 2K75A 2JJQA 3S14H 3PO2G 1JT8A 3T1HQ 3GTJH 2UXCQ 2VY3A 2NVQH 1UE1A 1QZGA 2YV5A 3HOZG 4JI4Q 3EN2A 2Y0SE 2IX1A 1IBML 4PZ7A 4TVAB 3KDFB 1FJGQ 2CKZB 3KF8B 1OXTA 5E7NA 4DAYB 4X65L 3KJPA 1E1TA 3FKIG 3GTGH 4NXMQ 1PFSA 3BZCA 5AJ3Q 4LF5Q 2B63G 1HR0Q 4DUZL 2JA5H 1PYBA 2VW9A 3ZJYC 4DR5Q 4UY8C 2YTYA 2HHHQ 1JJ2A 3H15A 1VS0A 1S3OA 4P75A 3RLFA 2VQFQ 2RHQB 3E9IA 4YWKA 3W5OA 3CW2C 3I56A 4LW1A 4L5SA 1GVPA 1KL9A 2VQEL 4JBKA 4LF4Q 4JI6L 3BJUA 2R6GA 1M1KC 2HQLA 1YBYA 3GD7A 3KF6B 2UU9Q 3MXNB 5GAHC 3J7ZC 4MNOA 3CCEA 1Q1BA 3CP0A 1TWCH 1IBLQ 4PZ6A 4DPGA 4B3MQ 1GM5A 2GVBA 1VQGA 3AEVA 1SE8A 4HJ5A 1H95A 1T9HA 3PUZA 4GLAC 4EQ5A 3PF5A 1VQJA 4IJHA 1KIXA 4IFDI 4A3GH 1CKNA 2JA6G 2MQHA 1VQEA 5IWAQ 4GNXC 5EAYA 2IX0A 2LXKA 2UUCL 1B7YB 4KLKA 4BXXG 4LF8Q 1WOCA 1CKMA 4DUYL 2FXQA 3RR5A 2I5HA 4QQBX 5FJ8G 3EBEA 3L7ZC 5IP7G 3F2DA 1YJNA 1XMOL 1GO3E 2F52A 4YCVA 3M7NA
chains in the Genus database with same CATH superfamily
2ZTCA 1B1ZA 3KYHC 4LUVA 4DK6C 3G6JB 1MJEA 5IGEA 4JI5L 3I7FA 4DAYA 3J7AF 1X56A 1VQ8A 1CFMA 2BDNA 1LUZA 1KD1C 2WV6D 1G291 2F0JA 5JJZA 1CA6A 1Y1WH 4A3LG 4IFDH 1C9OA 3NENA 1SYEA 3X3MA 3BS1A 1NCVA 4ZK9B 3DEPA 3CHBD 4CBVA 4JV5L 4A75A 2UUBL 1XNRL 4X64Q 4RKLA 4A3BH 1SBBB 4IO9A 4JBMA 1EIGA 3STBC 4BBRH 5JVH3 4JW0A 3OW7A 2F0VA 2G9DA 4GKJL 5CV8A 3DLLA 1Q7YC 4HIOA 4DV3Q 4HJ8A 2KVMA 1WI5A 3HKZG 4KY6A 1ZEQX 2ID0A 3IFDA 5M5WH 1STEA 2B2TC 4HMJA 3K0YA 5E4WC 2F0FA 1Q12A 5IGDA 2WB1G 5JJKA 4FF3A 5EKIA 2ALYB 2B2UA 4OGQC 1U4RA 4NDXA 4DV5L 4BY1H 3HOUB 4DV0L 3H91A 1I3QB 5LL6S 4APVA 1SN8A 2UUCQ 2KHIA 5C0XG 2RKSA 3BVGA 2F0TA 3ERQA 1BBWA 2OF1A 1LT4D 4R1JA 4ZUJA 4F8MA 4GKKL 2TMPA 3CRKC 1X55A 5CV6A 1YEZA 2V4DA 5IOCA 4BY7B 1HA5A 4JOIA 5C4XH 4MN3A 5EPLA 1DONA 4H13C 4PMCA 1N9WA 3S17H 4B08A 4FO2A 1L2FA 5IT9E 3BVZA 1HZCA 3U4ZA 5IE8A 5I2XA 1LABA 4A3IH 2E5LQ 1WYDA 3STBD 4GOPA 4DNIA 3PUVA 2H1EA 1MKHA 3ND8A 1RDPD 4KY7A 2NZOA 4XTCS 4ZCKA 2UXBL 1FR3A 1JC7A 2ZXRA 2J0TD 5LMNW 1EQQA 2QA4A 3W2DA 1DCZA 2J7ZA 1PH1A 2O5IC 1IBKL 3JAME 5FO7B 2D5DA 4OWXB 2PMZE 1WTWA 3P75A 3Q6SA 2ZJPA 3Q8DA 1H9SA 4K2KA 3J80i 3HOWG 4GLVB 1LYLA 5DM73 4B3SL 2PYKA 3I4MG 4PNYA 1KRSA 3TP6A 5C3WA 1QVGA 2O4XA 3BU2A 4ULLA 3PIOA 1XX8A 4CKBA 5M3FH 4QIWE 1VQPA 5DNFA 2E2HH 5C4JH 2D9UA 2EOTA 3VYSA 5K36G 2XGTA 2I0QA 1XPRA 2K05A 1EYAA 2EYLA 2BE5C 3MXNA 1UWVA 1NTGA 4H44C 3A5UA 2MJ8A 3E0EA 3F8TA 3T53B 2PQAB 1EY8A 1HUMA 3CC7A 5H1SE 1SMXA 4DV1Q 3IRBA 1IW7D 3P7JA 1EWHA 1YNJD 4ME5A 1IBMQ 3NXWA 3S1NB 4B9XA 4JBWA 2NTTA 1IBLL 1B2TA 3OMCA 5G3LD 1GUNA 1QUQB 3H3VC 3E9HA 2MNAA 1HJPA 1HZ9A 2WACA 3UE1A 4DNTB 4A3GG 2F0EA 4OONA 1A2UA 5D65A 4NW2A 2QILA 1PXUA 2XWJB 3UDFA 2A69C 1CTMA 3AB9A 3SK5A 2HCCA 4NB3A 5HGQA 3C46A 4GN5A 5I9PA 5EJWA 2R92B 1BR9A 3HKSA 1LTGD 3VYUA 1PRTD 2JA6B 3H6MA 1SR3A 4LF9L 3G71A 1U5KA 2FINB 2VUMB 4K0KL 1Y1VG 2Q8RE 4L8JA 4YY3L 1JE4A 2E2IB 5BR8L 2PCFB 2JE6I 2OQ0A 4AQYL 4PMBA 4JVZA 1V1OA 4X3SA 2CWPA 2PQEA 3T4AC 4Y7NH 4A3DB 4A3EH 1PH9A 2F0WA 3R2IA 1SMYD 3KJOA 4XIGS 1E22A 2AUKA 4A3LH 3OYYA 1R9TB 2K28A 3DUZA 3K7AB 1SXTA 5LMNQ 2K33A 4DR3Q 1V9PA 3L9AX 2I46A 3I72A 4L63B 4OHJA 1XNQL 3C2PA 1VQ5A 1RJTA 2CVRA 1ET9A 1E7ZA 3J81i 3F2CA 2ZM6L 3AFQA 3CRLC 4GZYC 2A1AA 2KEDA 2ZJRA 2UUAQ 3K5NA 1PH4A 1VQOA 3IL8A 1WD0A 1NR4A 1FNUA 3A74A 4UPAA 1DOKA 1E24A 2N8NA 4CKCA 1HQMC 3DM1A 5IY0A 4G7ZC 1DOLA 2F4VL 3TS0A 1VMPA 1BBUA 2RA4A 2JA7B 1A63A 1C4QA 2KJXA 4C1NK 3HOXB 2NZ1D 5C5LA 2YU9H 2N78A 3S16H 5FLXE 1OO9B 2EYHA 3K5OA 1PTOD 3CMEA 3NQTA 1F2YA 2SEBD 1VQ6A 2LMCB 1TWFB 4YWMA 2NVXB 2NVYB 5C0XH 3GP7A 1N34Q 2F0HA 1VQAA 1A0IA 2UXDQ 3HOVG 4RMFA 4XYQA 1VQFA 3A5ZB 2NN6I 3M4QA 4B3RQ 3PCOB 2A8VA 1JWUD 5IYBG 4R4CA 2WP8J 1B3AA 3S1MB 3X3NA 1Q90A 3RUZA 3FKIB 2DNEA 4R9WA 3KLSX 1Q1EA 1TQOA 3OW2A 2NUCA 5GAGC 4FF1A 2OQKA 2LXJA 3EROA 3NE5B 3HG9A 1D7QA 1N33Q 1VQKA 1V8QA 2OWOA 3QJYA 3NHHA 1QG7A 5AFWA 5COYA 3L0OA 4C2MH 4XDXA 3LNNA 2B3GA 3FRPB 4LF6L 2KHSA 1K73C 4CJ2C 3HOWH 4QGUA 1JICA 3I4MH 4C3IB 4JI7L 1X3FA 2XSCA 2ATWA 3BYTB 2E74C 3T13A 1K8MA 1UE7A 3MVVA 4OO1I 1ZKOA 3R2TA 1ESRA 4DV6Q 1HNXQ 1Q8KA 1CA5A 3AQQA 4IUNA 3NBHB 1J5EL 1U4MA 2R7FA 1KDBA 5J3BA 1Y8OB 1AP0A 4DR2Q 4XQQA 1RHPA 4A3JB 2A6HD 4J1MA 2L9HA 1YJ9A 3NP8A 4YWLA 1JR0D 3I4LA 1RD9D 3OIPA 1QUQA 3G6EA 1Q86C 1XTDA 3J7YW 2AWNA 1AW7A 4JI8L 4F88A 3CPWA 4A93G 4DR6Q 3VR4A 2B8GA 1K8OA 2JJQA 4ZYSA 4G7HC 1JT8A 3T1HQ 3GTJH 1CI3M 4TSSA 3A56A 3HOZG 4BBSB 3EN2A 1PZJD 2Y0SE 4TVAB 2VB2X 1OXTA 4DAYB 4DAVA 4QMGA 3GTGH 1BCPC 3BZCA 4LF5Q 5FK9C 2VW9A 1YNND 4X3UA 1WTQA 2YTYA 1DJRD 2HHHQ 1S3OA 1LTTD 2F0SA 5EKLA 3CW2C 5I4DA 3S2HB 4JBKA 4LF4Q 4JI6L 1SSOA 4OEMB 1XTCD 2SOBA 1YBYA 3KF6B 3ONAB 4KY5A 4RWSC 1JOQA 4J8QA 1BBXC 3GTKB 5M3MB 1L0YB 2F3WA 3AEVA 1LTAD 1EEFD 3PF5A 1KIXA 4A3GH 1PZKD 2MQHA 4ABNA 2CW0C 5IWAQ 1BCPB 2IX0A 3K58A 1CZGA 2EZVA 1B7YB 4KLKA 4JK1C 4BXXG 4CKEA 5IIFA 1CKMA 4DUYL 2B2UC 5EPKA 3EBEA 3L7ZC 4RGMA 4C3JB 5IP7G 1YJNA 1GO3E 4DK0A 1IYUA 3S2DH 3H0GB 4ZUIA 1LTRD 2IY5B 1Y1VH 1J6QA 1KTKA 2DY8A 2PMZB 1X3EA 1EQTA 3NQIA 1GUGA 1KDAA 2K04A 3IFTA 5C4XG 1MSGA 4JOIC 1S72A 2AWOA 5DLQE 3ULLA 3GTMH 4KK7A 2ZXPA 4OWWB 2A19A 4A3IG 3MHBA 4QUFA 3BDCA 1BCPD 1QWYA 1RIPA 1B9MA 4GOPC 3DXJC 5CYUA 1PH6A 1C8CA 2EYOA 1IZ6A 4TRDA 4A3FB 2DJGC 1KLUD 2EPBA 3G7LA 1HNWL 4CHTB 1I94Q 4QIWB 1E1OA 2VNUD 2K6AA 3OWEB 1BNZA 1ICFB 1UAPA 4KHPQ 2IJ0A 3NELA 4RG1A 2F0UA 1FL0A 3KK7A 3VR3A 2QKIC 3SHLA 1IKLA 2CQAA 5KYIA 2DNCA 3BDOA 2K1BA 5C3EG 4X65Q 1DZ1A 5F2DA 5HY6A 1FVIA 1DD2A 2SNMA 3SE0A 1ENAA 1KDCA 1S5FD 5ELDA 1OXSC 4DXFA 4MTKA 4OXPA 1TWAB 4DR7L 4A3KB 2Q2UA 5IP9G 2WAQE 4RA8A 2VQEQ 4FXKC 4DV2L 4A76A 3HGBA 4LF7Q 3FP9A 5JJIA 3M4PA 2DGYA 3C3LA 1I6VC 1I50H 1SRUA 3K7UC 4LJZC 3AYHB 1SNPA 5BN3A 4JI2Q 4C3HB 2NTSA 2JQOA 3QIAA 1HNZQ 2FJ2A 1EY0A 1I4HA 1YZ6A 3SK6A 5FO9B 4Y52H 2E2DC 2E2JH 4HSVA 2F3IA 2ICIA 4LFCL 4H02A 3HOVH 2LKVA 2Z8LA 5ISRA 3HS0C 3G48A 4JI5Q 3MA2B 1U4LA 4I7ZC 1K3RA 1OXUA 3PMFA 5IYBH 3WWVA 2EJGC 3D31A 2JA5B 4QCLA 5M5XH 1A62A 3D6WA 2C9OA 1LLRD 3NBHA 1JB7A 4IUVA 3RZDH 2MGSA 1YHQA 1K28A 2X6GA 1CHQD 1SDFA 5IT9c 1PH3A 1KAWA 3TS2A 4A4IA 3NTIA 1W6KA 1TS5A 1TWCB 1XNRQ 2NN6G 1PH8A 5ELEA 1LO5D 2ASBA 3PO3H 1G6PA 1MIUA 2BA1A 3L2PA 1STYA 2RF4A 1STNA 3QO2A 1JCKB 3VYRA 5G3LF 1Q8IA 1PVOA 1EUJA 1J9OA 5HGTA 3JAMc 2MFIA 3LGJA 4K8JA 4YHHL 4A3EG 1HA6A 2R7ZB 4IPHA 1IXRA 3FPPA 1I4GA 5M3FB 1JMCA 1BO0A 3KF6A 4A93H 5CV9A 1K83H 1KQSA 3PGZA 2F0DA 4HIMA 3M4YA 4DV5Q 1V1PB 4K6LA 1EIFA 3H09A 5CBEE 4DV0Q 4OO1G 2DJFC 4JG2A 1EFID 3HOZH 1CSPA 4ODGA 5J1ZA 2QEXA 2EJFC 4GKKQ 1TS2A 5BN5A 1EZ8A 2IHEA 5JJLA 4BA1I 1TXYA 1SFOB 2DN8A 1TWGH 4UAIA 2ZXOA 2N88A 1X3GA 1EWCA 2X69A 2QW7A 3RLOA 4LNQA 1VQDA 4OX9L 3LWEA 1SE4A 1X6OA 5LL6X 2UXBQ 1SNMA 1IYVA 5M5YH 3Q23A 4BXXH 4IALA 1HTLD 2IL8A 1IBKQ 3M4OH 3MTSA 2KCCA 4CJ1B 3Q24A 5IP7H 1I4RA 1YHAA 1VQCA 1F2ZA 3TZUA 1Z47A 4P72A 2F0GA 4J15A 1STAA 5DAUA 3I90A 4B3SQ 5JEAG 4X6AH 1YHBA 4RCOA 4LFAQ 1YJWA 2GA4B 2WINB 4K5VA 1KNAA 1XXGA 5KNDA 5DM63 1LM0A 1R4QB 2L12A 2D0OA 1AFPA 3GTLH 4Y7NB 5E4XA 3TBIB 4XT1B 3WDNA 4X64L 3NEMA 3N6RA 3BDLA 3S15H 4JBJA 1SEBD 1FGBD 4HN7A 3GTOH 1QVFA 2C35B 3MEFA 3R3OA 5C44B 4A3MB 1L1OB 1IW7C 3E0JA 4NXNL 4DK3C 1YNJC 3S1QB 1V43A 3GTPH 3CF5A 5KIXA 4DV3L 1QNUA 3TP8A 1PYSB 4HJ7A 1EOTA 1KXLA 1JE5A 5KNBA 4RGOS 1GKHA 2Y0SB 3HRZC 5C3EH 1GUTA 4BS9A 4CJ0B 2EE1A 5CV4A 4U673 3MZ5A 3MFGA 1K8GA 5A35A 1EQVA 2D2CC 2I5MX 1H9RA 1TU2B 2R92G 3L3OC 1EYDA 3V2TA 4OIKA 4R8NA 5IP9H 1NSNS 2VUMG 3AU7A 1D6EC 3B6YA 2AMCB 2WKCA 1PRTC 4XXEA 1A6XA 1CUKA 2B2VA 3K57A 1CKOA 3HFZB 2YTVA 4JI4L 4UP9A 3GO5A 5EQ0A 1AZPA 1TR5A 2EYJA 2Q2IA 1N8RC 4JI3Q 1Y69U 4A3DG 3PV0A 2XNAC 2A6ED 2FMMA 1IL2A 2AQ2B 2HCIA 3DWPA 1XPOA 5ELOA 4JCVE 3RN5A 1TWHB 2EY1A 2E76C 1O80A 1NMFA 3TDQA 4DR5L 3TREA 5EPJA 5IGGA 1X65A 4DXGA 4K0KQ 4L6TB 2BA0A 1STGA 5CV7A 4DNRB 5C4HA 3CMAA 4YY3Q 1SMYC 1VQIA 3P20A 4KD3A 3PO2B 5BR8Q 5FLXc 4AQYQ 5D3DA 3BZKA 3OIQA 4PMWA 1PRTB 2PW5A 1SYFA 3QB3A 4OWTB 4B3ML 1HPCA 3DM3A 1B44D 3GQBA 1SYCA 1VQMA 3SK8A 1K0SA 3V96A 2B63B 1NY4A 4QY7A 1BOSA 2F0LA 5KEEA 2V1CC 5IT9L 3J80E 1OXXK 2B2YA 2KCMA 4OELB 2OTLA 5FLMG 1XNQQ 4JC0A 2NN6H 2XIWA 2VB3X 3GV3A 1RTNA 4LFBQ 3E3XA 1DXMA 2N3SA 2JA7G 1EL0A 2F0QA 1NBWA 1PH7A 2F0NA 2O5JC 1IL8A 3P1HA 3JAML 3VYTA 3HOXG 1V1PA 4HCSA 3R8BA 2JP1A 5I2YA 3M3YB 1EZ6A 4AYBE 2AQ3B 3CCSA 2MUYA 4R4QA 1UEBA 2F4VQ 3HOUH 4DGZA 4FF2A 1I3QH 1L0XB 1PTOC 2R7DA 5T1GA 4EVOA 1QOHA 4LMQD 1SYDA 1M8AA 5JOBA 2IWHA 1KHIA 3OOCA 3HOYB 3J7A5 2WAQB 2MPMA 1T5EA 4HR7B 3S9WA 3TMEA 1UE1A 1RCVD 2JN4A 1QZGA 1IBML 4PZ7A 3I4NB 1A3VA 2X6LA 3KDFB 3KJPA 1KABA 4OO1H 2AUJD 1E1TA 3FKIG 2BOSA 5AJ3Q 5ELBA 4K8IA 4DUZL 1PYBA 1PTOB 2G9HD 3S1RB 1S4ZA 2CH4A 1G6ZA 1JJ2A 1VS0A 3GTGB 3RLFA 3E9IA 3I56A 1GUOA 4HSPA 4LW1A 1LT3D 1KL9A 1AN8A 3VR2A 3BJUA 1M1KC 1E0BA 1X3PA 3GD7A 1JOKA 2UU9Q 3RZOB 1BCPF 1UUPA 2GVBA 1PFMA 2M9VA 4I65A 4ILWA 2CHBD 4EQOA 1T9HA 3PUZA 4EQ5A 2F1MA 2C5CA 3CQZB 4C3IG 3ND9A 2TSSA 3NWTA 2NVTB 1BDOA 5JAVA 2FMCA 1WOCA 1QJOA 4KN7C 1PFNA 3K6OA 5FJ8G 4RHRA 4V190 4XQNA 1DOMA 3SXHA 1E2VA 2F52A 2RDFA 3A55A 4A3JG 4LF6Q 1EOVA 1Y8NB 2NBFA 1L1OA 1IYJB 2A6HC 5JEAH 3Q22A 1UEAB 3OWFA 1CM9A 4QF4A 4YCWA 1J5EQ 4BBSG 1WTPA 1U4PA 3NPPA 3D4DA 4MIUA 2EDGA 4CDFC 4KHZA 2XRQD 3J81E 2K5QA 1VQHA 2I5LX 1QVCA 4KN4C 2JA8B 3J7AV 5LMUQ 5IGFA 1LTLA 3U9SA 3S1NH 2K5HA 1YNNC 3DMUA 1BQQT 5ELFA 2PI2E 2RQXA 5M3MG 3PO3G 4FP5D 1O7YA 5EGTA 4KKTA 1HQRD 2EXZA 1YIJA 1PHJA 3PIPA 1I6HB 1VF7A 2PZUA 1WTHA 1QE6A 3MWYW 1N36Q 1B9NA 2H4OA 3GTQB 4XT3B 1SNOA 1I4XA 4GN3B 1GD7A 2Z4HA 4AIMA 2BH8A 4O1NA 4A3CG 1LACA 1D5MC 3ICEA 4C3JG 2K5WA 2R92H 1C0AA 1WCMB 3H0GG 3SK4A 3BYYB 1R4PB 2VUMH 4JI1L 3H3VH 4ZKBB 3S24A 2F3VA 2QDBA 4H7BA 2E2IH 1N34L 4IOCA 4X62L 2EQSA 3A7AB 3A7LA 3CCUA 4X3TA 5EBDA 4DUYQ 1LT5D 1WTVA 1SJED 4A3DH 5TSSA 2A5HA 1LT6D 3R93A 4DV7Q 2R93B 3GV6A 5I9OA 4ME3A 5FLXL 1RF2D 4F7XA 1R9TH 4QUCA 4WJ3M 3S14B 1KRTA 4YIJA 4A3FG 1XMQQ 3K7AH 2NVQB 1ICWA 3JC66 5GADC 3IAYA 3W1GA 2L11A 4HMIA 4Z9CB 4HIDA 3KLWA 4RGNA 4NP5A 2HDLA 3TP7A 1UE6A 2IT1A 3U4VA 1KC8C 1HRJA 3J81j 3T1YL 2KOLA 3HKZE 3PUWA 3WOEA 2KBNA 3VDYA 4DAPA 1SNQA 4XQJA 1EY4A 1HZBA 4NPSA 2WB1E 3CD6A 2QGQA 1AE3A 3HZXA 3D8GA 3ERSX 1AH9A 1W2BA 1X32A 4P71A 4RAUC 1G2TA 3MC0B 4C1NI 3M85A 1HR0W 2A68C 4PG3A 5FLMH 4DV6L 1W6JA 4A3KG 4JYAQ 1H9JA 2KENA 1STBA 1NUCA 5KGUA 4DR2L 2JA7H 3OTOQ 1PMRA 1CQFA 3NUCA 3HOXH 3KDFA 4C56C 4C3HG 3K59A 2K5VA 2RDHA 1BF4A 1RKNA 4K5XA 3U50C 1OTCA 4DR6L 4DU9A 1B50A 1TY0A 4UP8A 4B3TQ 3QG1A 3K8AA 1TWFH 1JQYD 1EFWA 2NVXH 2NVYH 4DV2Q 4DF7A 1TIID 1EYGA 1WFQA 1Y1WB 4DR1L 1D8LA 2SDFA 3D0FA 3W1BA 4LF5L 4MTNA 4LUZA 1E2WA 1KAAA 3K5MA 2NZHA 1ZYRC 2JK8A 2HHHL 1JJCB 5IYDH 1HFGA 2RDGA 3S1MH 4GLXA 1ML0D 2JA5G 2EYFA 1M90C 3UDGA 2K7VA 3FKIH 2XWBB 3EJIA 1XWEA 4IOAA 4ZLTF 4LFCQ 4R4IA 4A3BB 5FKAC 3OHXC 5IGBA 1U9RA 4F87A 4K14A 3MFYA 4G4KA 2A68D 4J6HA 4BBRB 5L37A 1P16A 4QB4A 3RLNA 4E6IA 3BZDB 3D4WA 1HUNA 2PZWA 4M1UB 1NR2A 3EVQA 3DEOA 1TT2A 4IFDJ 3SEBA 4EX5A 4AH6A 2XTIA 2EYMA 4C3IH 5M5WB 1HTPA 4JI0L 2H5XA 2B2VC 5JVG3 2MO0A 2JYOA 5FJ8H 3CCLA 2QEJC 4V0BA 1HXYD 2HUGA 3NSWA 2R7ZG 1VDZA 5C5MA 1EIYB 4BY1B 4A3JH 4ID6A 2KCNA 4DV4L 1XMOQ 3A8IE 1X54A 3UDIA 1CKNB 3WOFA 1EY7A 1ZYRD 4KTAA 4WRDA 3KOJA 1AZQA 1B4OA 3UDXA 2BDOA 3V05A 2L0CA 3CCMA 3D3RA 2FFKB 4NKLA 5C4XB 4RCNA 4G57A 3RN2A 5GROA 4YHHQ 4BBSH 3S17B 2VS1A 4AYBB 3KLSA 1GJXA 1BUVT 5EKKA 4O0AA 4PZ8A 1PV4A 4DR4L 1SYGA 4A3IB 3O13A 2DUDA 4KV6A 3FHWA 2A74C 2PNHA 1S5BD 2K4KA 2B2YC 3S2HH 3MXGA 4MZ9A 3D6CA 4JV5Q 1Q81C 4KJNA 2UUBQ 1WTOA 4XYOA 3GTKH 1E3PA 5M3MH 1LTBD 1HFNA 1F9SA 4R4OA 3EFXD 4K5WA 5CBAE 5D3IB 4LF7L 4QJFA 4BWGB 1XPUA 5DEHA 2N55A 4EQNA 2RSOA 5E1FA 2VL6A 2B2WC 4GKJQ 4NMZA 4A3CH 2Z6KC 3G4SA 4JI2L 2KQ3A 1HHVA 2OCEA 1A2TA 2Q8TA 3HOUG 4C3JH 3LWUA 1N32L 1SYBA 1HNZL 2QF7A 1NE3A 1CQVA 3A54A 1A15A 4X66L 3PQIA 2F4IA 1S40A 3H0GH 1O7ZA 1GXDC 4KD4A 4OX9Q 4DKAC 3UI2A 1K0RA 2OXPA 2UXCL 1STHA 1CZWA 2WIIB 2EY2A 2E2HB 5C4JB 4BY7G 1QNKA 4QL5A 1MSHA 1FJGL 1VQ4A 1ENFA 2PO4A 4NXML 2CFMA 3BG3A 4PQXA 4Q5VA 1HR0L 1MGSA 1QCBD 3CCQA 1PRTF 4KKUA 4IN3A 2EJMA 1YNXA 1WD1A 2VQFL 2HD3A 5EBCA 4IUQA 1FNWA 4A3FH 5IGCA 2F0IA 4DK1A 3VA5A 4IUTA 1G8ZD 1VQ7A 5C44G 4A3MG 2B39A 1J8IA 2PZTA 1KLGD 3N52A 1C48A 1NMGA 3QOLA 1KNEA 1WTRA 2XRSD 4LF8L 1VQBA 4ZKCB 2Y0SG 1Q82C 1GHJA 3TZDA 2AHOB 1GHKA 1JOOA 2K5NA 3MAQA 3D4RA 4ALPA 3ITPA 4HAEA 4NXNQ 1TWAH 1YI2A 3JAMi 4A3KH 3BVMA 3A8KE 2A73B 4X3KA 1ASZA 2KCTA 1ONLA 1PH5A 3ER0A 1F2LA 3SGIA 3J80c 1H9KA 1UNSA 5GAEC 1WJJA 4I7AA 5CC4A 1UE5A 4FXDA 2K01A 4C3HH 1L1OC 2IPKD 3RD4A 5K5PA 4M8AA 1EY5A 3T51B 1T5XD 3CCVA 3W3AA 4LK1C 2A6EC 4A3EB 1YVCA 2LS01 2ES2A 2BH2A 3LX0A 2I07B 2K75A 1LV9A 3PO2G 4RHSA 1PTOF 2L4NA 4KMUC 4JI4Q 2IX1A 1G2SA 4OL7A 2CKZB 3KF8B 4DA2A 1F9RA 1PFSA 2B63G 2JA5H 1WVLA 5E3FA 3ZJYC 4DR5Q 4UY8C 1EYCA 4P75A 2F0KA 2RHQB 2RCFA 3W5OA 1PLFA 2ICEC 4OIJA 4L5SA 1B53A 3QOJA 2HQEA 3NTKA 5GAHC 3I8ZA 3CCEA 2PPBC 1Q1BA 1SNDA 2EVBA 1TWCH 1IBLQ 4PZ6A 4B3MQ 3VR6A 1GM5A 1VQGA 1DYQA 3TP5A 1MBYA 4GLAC 4IFDI 4IJHA 1CKNA 2JA6G 1A3UA 1VQEA 4CDCC 5EAYA 4GNXC 3TSSA 2Z4IA 4FNFA 2UUCL 3HKZB 1SE2A 3RR5A 4QQBX 3F2DA 2WB1B 3M7NA 2YU9B 4LFAL 3S16B 2OEOA 4HIKA 4ZAIA 2R7ZH 5LHY1 1XYIA 5CR3A 4LF9Q 2E5LL 5CORA 3HOYG 2WAQG 1RL2A 1B8AA 1C7YA 3PIP3 4GNXB 3K5LA 3UE0A 2HDMA 1F77A 2RHSB 1ENCA 3I4NG 3TN2A 1A8VA 2HIXA 4Q0FA 1U0LA 3FVQA 3C1EA 1A3TA 1EWIA 1OXVA 1HZAA 1MJCA 1MD2D 2Q8IB 1F2MA 1BXTA 3GDEA 3QWNA 1SFOH 4UDUC 1EY9A 3SDZA 4MHEA 5HURA 4HCEA 2KUMA 2P5ZX 3J81c 5C0XJ 2ZM6Q 4L5RC 4DUZQ 4C2MB 4EQPA 1Z7TA 5JEAJ 1JWSD 1CT1D 2R61A 2B2WA 4RFBA 4WFN3 5ELNA 3HOWB 2Z6KA 3I4MB 4IPCA 3CCRA 1QZHA 2JEBI 3VR5A 2DY7A 4HTHA 4HEDA 3I91A 3URYA 4JI3L 2IX3A 5IODA 1ESFA 2ZT9C 4H0LC 1EU4A 2CWAA 4DFAA 4WJ4A 4YCUA 1S5ED 1AEXA 4BY7H 3M9BA 5C6AA 4DV1L 1JORA 5CMDA 2BE5D 5IYDG 1K8AC 2F03A 3K80C 2CH4W 4UP7A 4UHVA 3GTJB 1D2BA 2Z1CA 3C1FA 3AFPA 2JA8G 3PF4A 1MI2A 1O7LA 1G91A 4POGA 1QB5D 3KLRA 3EA6A 3MXUA 5C44H 4A3MH 2WFWA 2RCNA 1F9QA 3OSOA 4IUUA 3S1QH 2CCZA 2QDLA 2PI2A 1VCIA 3KUPA 1FGUA 2M2LA 1L0WA 5IYCG 3A0JA 4POFA 1EIHA 4LFBL 1PFBA 3KFUA 4O2DA 3ULPA 3M7GA 1I4QA 1NAPA 2D0PA 2E8GA 4TKOB 2A69D 3FPUB 4A3GB 2E75C 2K03A 3I55A 1V1QA 1EEID 1LTID 4N9TA 3I73A 3CAMA 2B8FA 3I3CA 3TRZA 1Q3LA 3J80L 4K6DA 1X9NA 1EY6A 1WCMG 5GQOA 2EIFA 2NB0A 2Q2TA 1SAPA 3NBIA 1SE3A 3PUYA 4RKBA 2B2TA 2IHFA 3KF8A 3U9OA 2RSNA 4JI7Q 3S2DB 2KHJA 2L55A 2HT1A 1Y1VB 2K50A 3HEJA 1E2ZA 5LMNL 4DR3L 2CQOA 4N8FA 1Y14B 3CC4A 2K52A 3FMCA 3CU7A 1Z6HA 2Z6BA 1TWHH 1PZID 2VZAA 4TQUS 3NTHA 2R93G 3GTMB 1D5XC 1TKWB 2LY7A 4FF4A 4KJOA 4JI1Q 2EXDA 4IUPA 5AJ3L 2PNRC 1K9MC 3PO2H 4U68A 4X62Q 1PYWD 4K2LA 4JI8Q 2UUAL 5T1IA 2JSOA 3KBXA 3CPFA 3CKIB 2BCOA 3DHQA 2B63H 2UU9L 2OTJA 4HJAA 3NWSA 2EY5A 2K14A 5M9OA 1I5FA 1RODA 1VF5C 1PH2A 2XVSA 5CGKA 4CDEC 1IHZA 1F9PA 3NK9A 2M00A 1H9MA 1CK1A 4DAMA 3T1YQ 4JI6Q 3F2UA 1VQ9A 2NWGA 3A8JE 4GNXA 2JA6H 1ET6A 2F0PA 3K81C 2F0OA 2RVLA 2L15A 2K5DA 1SJHD 3M3YH 3DWQA 1BKBA 3CC2A 2MHVA 1I50B 2UXDL 3MEHA 3PUXA 2F0MA 2NYZD 5C3XA 2IW3A 3AMUA 2K32A 4B3RL 2PQAA 1FD7D 1JWMD 1VMCA 1LTSD 3DWAA 1Y1WG 3HOYH 1GUSA 4IFDG 2E2JB 1JB3A 2PW7A 1CSQA 2YTXA 2MP1A 4PV1C 1ASYA 5LMUL 1WTXA 2EYPA 2J4XA 5K36H 1HCZA 3HOVB 4G7OC 5A2QE 1N33L 3RNUA 1SLJA 3I4NH 2AQ1B 5J22A 1Z9FA 3E6ZX 1BVSA 1PDQA 4IJLA 4O42A 1PTOH 3SR1A 4A3BG 3S1RH 1K3BC 5KRUA 1X3QA 4DR1Q 5M5XB 5ELCA 2KEEA 1HNWQ 4BBRG 4EGVA 1N36L 3IKJA 3J81L 3CXCA 1RTOA 3RZOH 1TS4A 1FYCA 1Q46A 3RZDB 5FO8B 1HNXL 5C0XI 1S5CD 3QR8A 3K0XA 4KI0A 5JPMC 3CQZH 1XJVA 3PO3B 5CV5A 4IQZA 2NVTH 2LSSA 4L5TA 4RGTA 4JPBW 3Q0AA 5I6WA 5KYLA 5NUCA 2Z9HA 3SVMA 2N49A 4GN4B 4IPDA 4DR7Q 1IKMA 4BY1G 3T1HL 3PSIA 4LWCA 4FYDA 1B3QA 4FDBA 4DV7L 1NNXA 1PA6A 4N9PA 1O7IA 1CHPD 1XMQL 4JI0Q 2QCPX 1MHWC 5BN4A 2MO1A 3EIVA 2ZJQA 2KA7A 4FXGC 1TY2A 4A93B 1D1KA 1SNCA 1TVXA 4AYBG 1K83B 1VQLA 1NJIC 4LF4L 4GS3A 4L5QA 1P8LA 2JEAI 4DV4Q 3I2ZA 3HOZB 1D1IA 1QILA 2B29A 2GN5A 2JA8H 2JXMB 1TS3A 3RMHA 4P73A 3TQYA 5IWAL 2FHTA 3HP3A 1TWGB 3H3VI 2YYZA 3CCJA 2L5TA 5IYCH 4DR4Q 4JYAL 5KNCA 4HJ9A 1SROA 5A2QL 2HIVA 5JPNC 1I6HH 2JA9A 2AKWB 4R4TA 3GTQH 5J39A 5C4ZA 2CW0D 3OTOL 1AE2A 4S3SA 3ULJA 3MXPA 2ZTDA 4GOPB 3U58A 2Q2HA 1O78A 1ZXTA 1YITA 3TEHB 1ILPA 1GOZA 1I4PA 3FDTA 5M5YB 2LFNA 1WCMH 3F1ZA 1G51A 1W3SA 2D62A 3VA7A 4B3TL 3M4OB 2GVAA 3I4OA 4KHVA 5M3FG 4IZ8A 4LUOA 2WKDA 1B70B 2ZTEA 3F2BA 1DGSA 4ZRZA 3KBGA 1HH2P 3FEWX 1EQRA 1S5DD 4ZQ3A 4P74A 4P2CB 1I94L 2RBMA 1JJGA 3T56B 4BA2I 1H9SB 1D5ZC 2KECA 4IPGA 2SNSA 2G5DA 1N32Q 5D14A 4KHPL 2R93H 1ILQA 3EQLC 3OPOA 4X66Q 5I6YA 2VXWA 2Z0SA 4LAAA 1VQNA 3S14H 1EU3A 4WJWA 2UXCQ 2L1BA 2VY3A 2NVQH 3GTLB 2YV5A 3OMGA 4WORA 4KKSA 5FOBB 1FJGQ 3S15B 5E7NA 4X65L 4NXMQ 2O2LD 1HR0Q 1II3A 3GTOB 3H15A 2VQFQ 3H94A 4CDDC 4YWKA 4R8IA 3PIO3 3GTPB 1GVPA 2OT2A 4N8X1 2VQEL 2R6GA 2ENBA 2HQLA 3MXNB 3J7ZC 4MNOA 4CGYB 2EY6A 3CP0A 1M4VA 5C3EB 3T16A 4DPGA 1SE8A 4HJ5A 1H95A 4FVMA 1VQJA 3E5SA 1DM0B 1Y8PB 3I70A 4B9WA 2LXKA 4IURA 1FNVA 4LF8Q 4DN4M 2FXQA 2I5HA 3ZYYX 2R3ZA 1XMOL 4RH6A 1GUWA 2XN9C 4YCVA
chains in the Genus database with same CATH topology
4LFAL 3S2DH 2ZTCA 4A3JG 4LF6Q 2IY5B 3KYHC 4LUVA 1Y1VH 4HIKA 1J6QA 4DK6C 2R7ZH 1X3EA 1MJEA 1EOVA 3I7FA 4JI5L 4LF9Q 2E5LL 1L1OA 1X56A 1VQ8A 5C4XG 1IYJB 3HOYG 2WAQG 1RL2A 1LUZA 4JOIC 1S72A 1KD1C 2AWOA 1B8AA 5DLQE 1C7YA 3ULLA 1G291 3GTMH 4GNXB 1Y1WH 4OWWB 4A3LG 2A19A 1G6PA 3UE0A 4A3IG 4YCWA 1J5EQ 1C9OA 2RHSB 4BBSG 3I4NG 3NENA 1A8VA 2HIXA 1RIPA 1U0LA 4GOPC 1PH6A 1IZ6A 4KHZA 1HNWL 1EWIA 1OXVA 1VQHA 2I5LX 1I94Q 1HZAA 1QVCA 1E1OA 2VNUD 1MJCA 5LMUQ 4JV5L 1LTLA 4A75A 2UUBL 1XNRL 4KHPQ 3NELA 4RG1A 4X64Q 3S1NH 4A3BH 4IO9A 3GDEA 1FL0A 2K5HA 4JBMA 1SFOH 3STBC 4BBRH 2PI2E 5M3MG 3PO3G 5C3EG 4X65Q 1YIJA 4GKJL 1PHJA 3PIPA 3J81c 5HY6A 1FVIA 5C0XJ 2ZM6Q 1N36Q 4DUZQ 3DLLA 4L5RC 1Q7YC 4HIOA 4DV3Q 4HJ8A 4GN3B 1GD7A 1OXSC 4AIMA 2BH8A 1WI5A 4A3CG 4OXPA 5JEAJ 3HKZG 4DR7L 5ELNA 2ID0A 5M5WH 2Q2UA 2Z6KA 2WAQE 5IP9G 2VQEQ 3ICEA 4IPCA 4DV2L 4A76A 1Q12A 3CCRA 1QZHA 2JEBI 2R92H 1C0AA 2WB1G 4LF7Q 3FP9A 5JJIA 5JJKA 3M4PA 2DGYA 4JI3L 3H0GG 1I50H 1SRUA 3K7UC 2ALYB 2VUMH 3H3VH 4JI1L 3S24A 3AYHB 4JI2Q 2E2IH 4DV5L 1N34L 2JQOA 4IOCA 4BY1H 2CWAA 4X62L 4DV0L 2EQSA 4APVA 1HNZQ 1SN8A 2UUCQ 4WJ4A 4YCUA 2KHIA 5C0XG 4R1JA 3CCUA 1BBWA 1YZ6A 4BY7H 4DUYQ 3M9BA 4GKKL 4A3DH 4Y52H 4DV1L 2E2JH 1X55A 5IYDG 2F3IA 1K8AC 1YEZA 4DV7Q 4LFCL 4ME3A 4WJ3M 1R9TH 3K80C 4JOIA 5C4XH 4UP7A 1KRTA 4H02A 3HOVH 1N9WA 4A3FG 3S17H 1XMQQ 3K7AH 1L2FA 3JC66 1HZCA 3AFPA 3U4ZA 5IE8A 5GADC 3G48A 4JI5Q 2JA8G 3PF4A 3W1GA 4A3IH 2E5LQ 1WYDA 4HIDA 3STBD 3KLWA 4DNIA 4GOPA 1K3RA 1OXUA 5IYBH 4POGA 3PUVA 1MKHA 1UE6A 2IT1A 3WWVA 3D31A 3U4VA 1KC8C 2NZOA 5M5XH 4XTCS 5C44H 3J81j 3HKZE 3T1YL 2WFWA 1A62A 3PUWA 4A3MH 2RCNA 2UXBL 3S1QH 2CCZA 2KBNA 2PI2A 5LMNW 1VCIA 3VDYA 1EQQA 2QA4A 1FGUA 1HZBA 4NPSA 1L0WA 5IYCG 2WB1E 3A0JA 4POFA 2QGQA 1PH1A 1AE3A 1JB7A 3CD6A 3RZDH 4LFBL 3ERSX 1IBKL 1YHQA 3KFUA 1AH9A 4O2DA 4OWXB 5IT9c 3ULPA 1W2BA 1PH3A 1KAWA 3TS2A 4A4IA 2D0PA 2E8GA 2PMZE 4P71A 1XNRQ 2NN6G 1PH8A 2ZJPA 3M85A 3Q8DA 4PG3A 5FLMH 3J80i 4DV6L 1HR0W 4A3KG 4GLVB 1LYLA 3I55A 4B3SL 2ASBA 3I4MG 3HOWG 4JYAQ 1V1QA 1KRSA 1MIUA 2BA1A 3CAMA 2KENA 3L2PA 1QVGA 3TRZA 3BU2A 1X9NA 1WCMG 5GQOA 2EIFA 2Q2TA 4DR2L 2JA7H 2RF4A 3PUYA 3OTOQ 3PIOA 3HOXH 2IHFA 3KDFA 1PVOA 1EUJA 3JAMc 2MFIA 4JI7Q 3LGJA 2K5VA 5M3FH 2KHJA 4YHHL 4QIWE 4A3EG 3U50C 1VQPA 1OTCA 2HT1A 4DR6L 2K50A 2E2HH 5LMNL 5C4JH 4DR3L 2CQOA 4IPHA 1IXRA 4B3TQ 4UP8A 1Y14B 3K8AA 1TWFH 1EFWA 3CC4A 2NVXH 2K52A 2NVYH 2XGTA 4DV2Q 5K36G 1TWHH 2R93G 2VZAA 4TQUS 1EYGA 1WFQA 2I0QA 1XPRA 1JMCA 4DR1L 1D8LA 3KF6A 4A93H 4JI1Q 2EXDA 1K83H 1KQSA 5AJ3L 1UWVA 1NTGA 3D0FA 3PGZA 3W1BA 4HIMA 4MTNA 4LUZA 3A5UA 4DV5Q 1K9MC 3PO2H 3E0EA 1EIFA 3F8TA 4X62Q 4DV0Q 2NZHA 4OO1G 2JK8A 4JG2A 1JJCB 2PQAB 2HHHL 4JI8Q 2UUAL 3HOZH 1CSPA 5IYDH 2QEXA 3PO3H 3S1MH 4GLXA 3CC7A 5H1SE 2JA5G 4GKKQ 1M90C 1SMXA 3CPFA 4DV1Q 3UDGA 3FKIH 3IRBA 2B63H 2UU9L 2OTJA 4HJAA 1IBMQ 4IOAA 2IHEA 4LFCQ 4R4IA 5JJLA 4JBWA 4BA1I 1IBLL 1TXYA 1QUQB 1TWGH 2K14A 1I5FA 3E9HA 2MNAA 1P16A 3RLNA 1HJPA 1PH2A 1HZ9A 1X3GA 3UE1A 1N32Q 3RLOA 4LNQA 1VQDA 4A3GG 4OONA 4OX9L 4DAMA 3T1YQ 4JI6Q 1X6OA 1VQ9A 4IFDJ 4EX5A 3UDFA 2UXBQ 4AH6A 2XTIA 4GNXA 2JA6H 4C3IH 4NB3A 3K81C 5M5YH 5HGQA 4GN5A 2H5XA 4JI0L 4BXXH 2L15A 1IBKQ 3M4OH 3HKSA 3M3YH 2MO0A 1BKBA 1SR3A 5FJ8H 3G71A 1U5KA 3CC2A 3CCLA 5IP7H 4LF9L 2UXDL 1YHAA 4K0KL 3PUXA 1Y1VG 1VQCA 2R7ZG 1Z47A 4YY3L 4P72A 1EIYB 4B3RL 4J15A 4B3SQ 5BR8L 2PQAA 4A3JH 2JE6I 2OQ0A 4AQYL 4DV4L 1XMOQ 5JEAG 4X6AH 1X54A 1YHBA 4LFAQ 2CWPA 1Y1WG 3UDIA 1CKNB 4Y7NH 3HOYH 1YJWA 4A3EH 4IFDG 1PH9A 1CSQA 2YTXA 3KOJA 3UDXA 1LM0A 3KJOA 4XIGS 1E22A 1ASYA 2D0OA 4A3LH 3CCMA 5LMUL 3OYYA 3GTLH 3RN2A 5GROA 4YHHQ 4BBSH 2VS1A 4X64L 3RNUA 1N33L 1SLJA 3I4NH 3NEMA 5LMNQ 4DR3Q 1V9PA 4O0AA 3S15H 4PZ8A 1Z9FA 1PV4A 4DR4L 1BVSA 4JBJA 4IJLA 2DUDA 3GTOH 1QVFA 1XNQL 4A3BG 3FHWA 2C35B 3MEFA 3S1RH 1VQ5A 4DR1Q 2PNHA 1L1OB 1E7ZA 2K4KA 4NXNL 1HNWQ 3J81i 4DK3C 3F2CA 4BBRG 2ZM6L 1N36L 1V43A 3S2HH 3GTPH 3AFQA 4MZ9A 3CF5A 4DV3L 4JV5Q 1Q81C 4LF5L 2A1AA 1PYSB 2UUBQ 4HJ7A 3CXCA 2ZJRA 2UUAQ 1KXLA 3RZOH 1Q46A 3GTKH 1E3PA 1JE5A 5M3MH 1PH4A 1HNXL 1GKHA 5C0XI 1VQOA 5C3EH 4R4OA 3K0XA 4KI0A 3A74A 4UPAA 4LF7L 4QJFA 3CQZH 1E24A 2N8NA 1XJVA 1XPUA 2F4VL 5IY0A 3TS0A 1K8GA 2VL6A 2NVTH 4GKJQ 4A3CH 2LSSA 2I5MX 4L5TA 2Z6KC 2R92G 3G4SA 4JI2L 2OCEA 5IP9H 1BBUA 3HOUG 4C3JH 1A63A 1N32L 2VUMG 1HNZL 3B6YA 2N49A 1NE3A 4GN4B 4X66L 1S40A 2AMCB 4IPDA 2YU9H 2N78A 3S16H 4DR7Q 3H0GH 4BY1G 3T1HL 3PSIA 1CUKA 4LWCA 4DKAC 1K0RA 4OX9Q 2UXCL 1CKOA 3HFZB 2YTVA 4FDBA 3CMEA 4JI4L 4UP9A 3GO5A 4DV7L 1PA6A 2Q2IA 4BY7G 1N8RC 4QL5A 1O7IA 4JI3Q 1FJGL 1VQ6A 4A3DG 3PV0A 1VQ4A 1IL2A 4NXML 4YWMA 2CFMA 1XPOA 1XMQL 5ELOA 4JI0Q 2MO1A 3EIVA 4JCVE 3RN5A 1HR0L 2ZJQA 1N34Q 3CCQA 1NMFA 1A0IA 1VQAA 3TREA 4DR5L 2UXDQ 3HOVG 1X65A 1YNXA 4RMFA 4K0KQ 2VQFL 4AYBG 2BA0A 1VQLA 1VQFA 3A5ZB 2NN6I 3M4QA 3CMAA 4YY3Q 1VQIA 4B3RQ 1NJIC 4LF4L 3PCOB 4GS3A 4L5QA 1P8LA 5BR8Q 5FLXc 4A3FH 2A8VA 4AQYQ 2JEAI 4DV4Q 3BZKA 4PMWA 3I2ZA 5IYBG 2B29A 2GN5A 4R4CA 2JA8H 2WP8J 4OWTB 1VQ7A 4B3ML 3DM3A 5C44G 4A3MG 1VQMA 4P73A 1NY4A 1Q1EA 4QY7A 3OW2A 3TQYA 5GAGC 2OQKA 2LXJA 5IWAL 1NMGA 1D7QA 2V1CC 1N33Q 1VQKA 4LF8L 3H3VI 1VQBA 2YYZA 2Y0SG 3CCJA 1OXXK 5IYCH 1Q82C 2KCMA 2OWOA 4DR4Q 4JYAL 4HJ9A 1SROA 2AHOB 2HIVA 1I6HH 2JA9A 2AKWB 4R4TA 2K5NA 3GTQH 2OTLA 3L0OA 4C2MH 5FLMG 4ALPA 4JC0A 1XNQQ 2B3GA 3OTOL 4LF6L 1AE2A 3ULJA 1K73C 4NXNQ 4LFBQ 2ZTDA 1TWAH 4GOPB 3U58A 1YI2A 3JAMi 3HOWH 2Q2HA 4QGUA 4A3KH 1YITA 3I4MH 2N3SA 4JI7L 3TEHB 1X3FA 2JA7G 1NBWA 1PH7A 1ASZA 2ATWA 3HOXG 1UE7A 4OO1I 2KCTA 1WCMH 1PH5A 1G51A 2D62A 1W3SA 3ER0A 3F1ZA 3SGIA 3J80c 1Q8KA 4DV6Q 1HNXQ 4B3TL 2GVAA 3I4OA 4AYBE 3AQQA 5GAEC 1WJJA 3NBHB 3CCSA 1J5EL 5M3FG 1UE5A 2R7FA 4R4QA 4LUOA 4C3HH 1L1OC 1UEBA 1B70B 2ZTEA 5J3BA 3F2BA 4DR2Q 1DGSA 2F4VQ 3HOUH 1HH2P 1I3QH 2R7DA 1EQRA 4P74A 1I94L 1JJGA 1YJ9A 4BA2I 3CCVA 4YWLA 1KHIA 1QUQA 3G6EA 1Q86C 1XTDA 4IPGA 2AWNA 3J7A5 4JI8L 1YVCA 3CPWA 4KHPL 2ES2A 2BH2A 4DR6Q 4A93G 4X66Q 2R93H 1VQNA 2Z0SA 2K75A 2JJQA 3S14H 3PO2G 1JT8A 3T1HQ 3GTJH 2UXCQ 2VY3A 2NVQH 1UE1A 1QZGA 2YV5A 3HOZG 4JI4Q 3EN2A 2Y0SE 2IX1A 1IBML 4PZ7A 4TVAB 3KDFB 1FJGQ 2CKZB 3KF8B 1OXTA 5E7NA 4DAYB 4X65L 3KJPA 1E1TA 3FKIG 3GTGH 4NXMQ 1PFSA 3BZCA 5AJ3Q 4LF5Q 2B63G 1HR0Q 4DUZL 2JA5H 1PYBA 2VW9A 3ZJYC 4DR5Q 4UY8C 2YTYA 2HHHQ 1JJ2A 3H15A 1VS0A 1S3OA 4P75A 3RLFA 2VQFQ 2RHQB 3E9IA 4YWKA 3W5OA 3CW2C 3I56A 4LW1A 4L5SA 1GVPA 1KL9A 2VQEL 4JBKA 4LF4Q 4JI6L 3BJUA 2R6GA 1M1KC 2HQLA 1YBYA 3GD7A 3KF6B 2UU9Q 3MXNB 5GAHC 3J7ZC 4MNOA 3CCEA 1Q1BA 3CP0A 1TWCH 1IBLQ 4PZ6A 4DPGA 4B3MQ 1GM5A 2GVBA 1VQGA 3AEVA 1SE8A 4HJ5A 1H95A 1T9HA 3PUZA 4GLAC 4EQ5A 3PF5A 1VQJA 4IJHA 1KIXA 4IFDI 4A3GH 1CKNA 2JA6G 2MQHA 1VQEA 5IWAQ 4GNXC 5EAYA 2IX0A 2LXKA 2UUCL 1B7YB 4KLKA 4BXXG 4LF8Q 1WOCA 1CKMA 4DUYL 2FXQA 3RR5A 2I5HA 4QQBX 5FJ8G 3EBEA 3L7ZC 5IP7G 3F2DA 1YJNA 1XMOL 1GO3E 2F52A 4YCVA 3M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA L;  3S2D H;  2ZTC A;  4A3J G;  4LF6 Q;  2IY5 B;  3KYH C;  4LUV A;  1Y1V H;  4HIK A;  1J6Q A;  4DK6 C;  2R7Z H;  1X3E A;  1MJE A;  1EOV A;  3I7F A;  4JI5 L;  4LF9 Q;  2E5L L;  1L1O A;  1X56 A;  1VQ8 A;  5C4X G;  1IYJ B;  3HOY G;  2WAQ G;  1RL2 A;  1LUZ A;  4JOI C;  1S72 A;  1KD1 C;  2AWO A;  1B8A A;  5DLQ E;  1C7Y A;  3ULL A;  1G29 1;  3GTM H;  4GNX B;  1Y1W H;  4OWW B;  4A3L G;  2A19 A;  1G6P A;  3UE0 A;  4A3I G;  4YCW A;  1J5E Q;  1C9O A;  2RHS B;  4BBS G;  3I4N G;  3NEN A;  1A8V A;  2HIX A;  1RIP A;  1U0L A;  4GOP C;  1PH6 A;  1IZ6 A;  4KHZ A;  1HNW L;  1EWI A;  1OXV A;  1VQH A;  2I5L X;  1I94 Q;  1HZA A;  1QVC A;  1E1O A;  2VNU D;  1MJC A;  5LMU Q;  4JV5 L;  1LTL A;  4A75 A;  2UUB L;  1XNR L;  4KHP Q;  3NEL A;  4RG1 A;  4X64 Q;  3S1N H;  4A3B H;  4IO9 A;  3GDE A;  1FL0 A;  2K5H A;  4JBM A;  1SFO H;  3STB C;  4BBR H;  2PI2 E;  5M3M G;  3PO3 G;  5C3E G;  4X65 Q;  1YIJ A;  4GKJ L;  1PHJ A;  3PIP A;  3J81 c;  5HY6 A;  1FVI A;  5C0X J;  2ZM6 Q;  1N36 Q;  4DUZ Q;  3DLL A;  4L5R C;  1Q7Y C;  4HIO A;  4DV3 Q;  4HJ8 A;  4GN3 B;  1GD7 A;  1OXS C;  4AIM A;  2BH8 A;  1WI5 A;  4A3C G;  4OXP A;  5JEA J;  3HKZ G;  4DR7 L;  5ELN A;  2ID0 A;  5M5W H;  2Q2U A;  2Z6K A;  2WAQ E;  5IP9 G;  2VQE Q;  3ICE A;  4IPC A;  4DV2 L;  4A76 A;  1Q12 A;  3CCR A;  1QZH A;  2JEB I;  2R92 H;  1C0A A;  2WB1 G;  4LF7 Q;  3FP9 A;  5JJI A;  5JJK A;  3M4P A;  2DGY A;  4JI3 L;  3H0G G;  1I50 H;  1SRU A;  3K7U C;  2ALY B;  2VUM H;  3H3V H;  4JI1 L;  3S24 A;  3AYH B;  4JI2 Q;  2E2I H;  4DV5 L;  1N34 L;  2JQO A;  4IOC A;  4BY1 H;  2CWA A;  4X62 L;  4DV0 L;  2EQS A;  4APV A;  1HNZ Q;  1SN8 A;  2UUC Q;  4WJ4 A;  4YCU A;  2KHI A;  5C0X G;  4R1J A;  3CCU A;  1BBW A;  1YZ6 A;  4BY7 H;  4DUY Q;  3M9B A;  4GKK L;  4A3D H;  4Y52 H;  4DV1 L;  2E2J H;  1X55 A;  5IYD G;  2F3I A;  1K8A C;  1YEZ A;  4DV7 Q;  4LFC L;  4ME3 A;  4WJ3 M;  1R9T H;  3K80 C;  4JOI A;  5C4X H;  4UP7 A;  1KRT A;  4H02 A;  3HOV H;  1N9W A;  4A3F G;  3S17 H;  1XMQ Q;  3K7A H;  1L2F A;  3JC6 6;  1HZC A;  3AFP A;  3U4Z A;  5IE8 A;  5GAD C;  3G48 A;  4JI5 Q;  2JA8 G;  3PF4 A;  3W1G A;  4A3I H;  2E5L Q;  1WYD A;  4HID A;  3STB D;  3KLW A;  4DNI A;  4GOP A;  1K3R A;  1OXU A;  5IYB H;  4POG A;  3PUV A;  1MKH A;  1UE6 A;  2IT1 A;  3WWV A;  3D31 A;  3U4V A;  1KC8 C;  2NZO A;  5M5X H;  4XTC S;  5C44 H;  3J81 j;  3HKZ E;  3T1Y L;  2WFW A;  1A62 A;  3PUW A;  4A3M H;  2RCN A;  2UXB L;  3S1Q H;  2CCZ A;  2KBN A;  2PI2 A;  5LMN W;  1VCI A;  3VDY A;  1EQQ A;  2QA4 A;  1FGU A;  1HZB A;  4NPS A;  1L0W A;  5IYC G;  2WB1 E;  3A0J A;  4POF A;  2QGQ A;  1PH1 A;  1AE3 A;  1JB7 A;  3CD6 A;  3RZD H;  4LFB L;  3ERS X;  1IBK L;  1YHQ A;  3KFU A;  1AH9 A;  4O2D A;  4OWX B;  5IT9 c;  3ULP A;  1W2B A;  1PH3 A;  1KAW A;  3TS2 A;  4A4I A;  2D0P A;  2E8G A;  2PMZ E;  4P71 A;  1XNR Q;  2NN6 G;  1PH8 A;  2ZJP A;  3M85 A;  3Q8D A;  4PG3 A;  5FLM H;  3J80 i;  4DV6 L;  1HR0 W;  4A3K G;  4GLV B;  1LYL A;  3I55 A;  4B3S L;  2ASB A;  3I4M G;  3HOW G;  4JYA Q;  1V1Q A;  1KRS A;  1MIU A;  2BA1 A;  3CAM A;  2KEN A;  3L2P A;  1QVG A;  3TRZ A;  3BU2 A;  1X9N A;  1WCM G;  5GQO A;  2EIF A;  2Q2T A;  4DR2 L;  2JA7 H;  2RF4 A;  3PUY A;  3OTO Q;  3PIO A;  3HOX H;  2IHF A;  3KDF A;  1PVO A;  1EUJ A;  3JAM c;  2MFI A;  4JI7 Q;  3LGJ A;  2K5V A;  5M3F H;  2KHJ A;  4YHH L;  4QIW E;  4A3E G;  3U50 C;  1VQP A;  1OTC A;  2HT1 A;  4DR6 L;  2K50 A;  2E2H H;  5LMN L;  5C4J H;  4DR3 L;  2CQO A;  4IPH A;  1IXR A;  4B3T Q;  4UP8 A;  1Y14 B;  3K8A A;  1TWF H;  1EFW A;  3CC4 A;  2NVX H;  2K52 A;  2NVY H;  2XGT A;  4DV2 Q;  5K36 G;  1TWH H;  2R93 G;  2VZA A;  4TQU S;  1EYG A;  1WFQ A;  2I0Q A;  1XPR A;  1JMC A;  4DR1 L;  1D8L A;  3KF6 A;  4A93 H;  4JI1 Q;  2EXD A;  1K83 H;  1KQS A;  5AJ3 L;  1UWV A;  1NTG A;  3D0F A;  3PGZ A;  3W1B A;  4HIM A;  4MTN A;  4LUZ A;  3A5U A;  4DV5 Q;  1K9M C;  3PO2 H;  3E0E A;  1EIF A;  3F8T A;  4X62 Q;  4DV0 Q;  2NZH A;  4OO1 G;  2JK8 A;  4JG2 A;  1JJC B;  2PQA B;  2HHH L;  4JI8 Q;  2UUA L;  3HOZ H;  1CSP A;  5IYD H;  2QEX A;  3PO3 H;  3S1M H;  4GLX A;  3CC7 A;  5H1S E;  2JA5 G;  4GKK Q;  1M90 C;  1SMX A;  3CPF A;  4DV1 Q;  3UDG A;  3FKI H;  3IRB A;  2B63 H;  2UU9 L;  2OTJ A;  4HJA A;  1IBM Q;  4IOA A;  2IHE A;  4LFC Q;  4R4I A;  5JJL A;  4JBW A;  4BA1 I;  1IBL L;  1TXY A;  1QUQ B;  1TWG H;  2K14 A;  1I5F A;  3E9H A;  2MNA A;  1P16 A;  3RLN A;  1HJP A;  1PH2 A;  1HZ9 A;  1X3G A;  3UE1 A;  1N32 Q;  3RLO A;  4LNQ A;  1VQD A;  4A3G G;  4OON A;  4OX9 L;  4DAM A;  3T1Y Q;  4JI6 Q;  1X6O A;  1VQ9 A;  4IFD J;  4EX5 A;  3UDF A;  2UXB Q;  4AH6 A;  2XTI A;  4GNX A;  2JA6 H;  4C3I H;  4NB3 A;  3K81 C;  5M5Y H;  5HGQ A;  4GN5 A;  2H5X A;  4JI0 L;  4BXX H;  2L15 A;  1IBK Q;  3M4O H;  3HKS A;  3M3Y H;  2MO0 A;  1BKB A;  1SR3 A;  5FJ8 H;  3G71 A;  1U5K A;  3CC2 A;  3CCL A;  5IP7 H;  4LF9 L;  2UXD L;  1YHA A;  4K0K L;  3PUX A;  1Y1V G;  1VQC A;  2R7Z G;  1Z47 A;  4YY3 L;  4P72 A;  1EIY B;  4B3R L;  4J15 A;  4B3S Q;  5BR8 L;  2PQA A;  4A3J H;  2JE6 I;  2OQ0 A;  4AQY L;  4DV4 L;  1XMO Q;  5JEA G;  4X6A H;  1X54 A;  1YHB A;  4LFA Q;  2CWP A;  1Y1W G;  3UDI A;  1CKN B;  4Y7N H;  3HOY H;  1YJW A;  4A3E H;  4IFD G;  1PH9 A;  1CSQ A;  2YTX A;  3KOJ A;  3UDX A;  1LM0 A;  3KJO A;  4XIG S;  1E22 A;  1ASY A;  2D0O A;  4A3L H;  3CCM A;  5LMU L;  3OYY A;  3GTL H;  3RN2 A;  5GRO A;  4YHH Q;  4BBS H;  2VS1 A;  4X64 L;  3RNU A;  1N33 L;  1SLJ A;  3I4N H;  3NEM A;  5LMN Q;  4DR3 Q;  1V9P A;  4O0A A;  3S15 H;  4PZ8 A;  1Z9F A;  1PV4 A;  4DR4 L;  1BVS A;  4JBJ A;  4IJL A;  2DUD A;  3GTO H;  1QVF A;  1XNQ L;  4A3B G;  3FHW A;  2C35 B;  3MEF A;  3S1R H;  1VQ5 A;  4DR1 Q;  2PNH A;  1L1O B;  1E7Z A;  2K4K A;  4NXN L;  1HNW Q;  3J81 i;  4DK3 C;  3F2C A;  4BBR G;  2ZM6 L;  1N36 L;  1V43 A;  3S2H H;  3GTP H;  3AFQ A;  4MZ9 A;  3CF5 A;  4DV3 L;  4JV5 Q;  1Q81 C;  4LF5 L;  2A1A A;  1PYS B;  2UUB Q;  4HJ7 A;  3CXC A;  2ZJR A;  2UUA Q;  1KXL A;  3RZO H;  1Q46 A;  3GTK H;  1E3P A;  1JE5 A;  5M3M H;  1PH4 A;  1HNX L;  1GKH A;  5C0X I;  1VQO A;  5C3E H;  4R4O A;  3K0X A;  4KI0 A;  3A74 A;  4UPA A;  4LF7 L;  4QJF A;  3CQZ H;  1E24 A;  2N8N A;  1XJV A;  1XPU A;  2F4V L;  5IY0 A;  3TS0 A;  1K8G A;  2VL6 A;  2NVT H;  4GKJ Q;  4A3C H;  2LSS A;  2I5M X;  4L5T A;  2Z6K C;  2R92 G;  3G4S A;  4JI2 L;  2OCE A;  5IP9 H;  1BBU A;  3HOU G;  4C3J H;  1A63 A;  1N32 L;  2VUM G;  1HNZ L;  3B6Y A;  2N49 A;  1NE3 A;  4GN4 B;  4X66 L;  1S40 A;  2AMC B;  4IPD A;  2YU9 H;  2N78 A;  3S16 H;  4DR7 Q;  3H0G H;  4BY1 G;  3T1H L;  3PSI A;  1CUK A;  4LWC A;  4DKA C;  1K0R A;  4OX9 Q;  2UXC L;  1CKO A;  3HFZ B;  2YTV A;  4FDB A;  3CME A;  4JI4 L;  4UP9 A;  3GO5 A;  4DV7 L;  1PA6 A;  2Q2I A;  4BY7 G;  1N8R C;  4QL5 A;  1O7I A;  4JI3 Q;  1FJG L;  1VQ6 A;  4A3D G;  3PV0 A;  1VQ4 A;  1IL2 A;  4NXM L;  4YWM A;  2CFM A;  1XPO A;  1XMQ L;  5ELO A;  4JI0 Q;  2MO1 A;  3EIV A;  4JCV E;  3RN5 A;  1HR0 L;  2ZJQ A;  1N34 Q;  3CCQ A;  1NMF A;  1A0I A;  1VQA A;  3TRE A;  4DR5 L;  2UXD Q;  3HOV G;  1X65 A;  1YNX A;  4RMF A;  4K0K Q;  2VQF L;  4AYB G;  2BA0 A;  1VQL A;  1VQF A;  3A5Z B;  2NN6 I;  3M4Q A;  3CMA A;  4YY3 Q;  1VQI A;  4B3R Q;  1NJI C;  4LF4 L;  3PCO B;  4GS3 A;  4L5Q A;  1P8L A;  5BR8 Q;  5FLX c;  4A3F H;  2A8V A;  4AQY Q;  2JEA I;  4DV4 Q;  3BZK A;  4PMW A;  3I2Z A;  5IYB G;  2B29 A;  2GN5 A;  4R4C A;  2JA8 H;  2WP8 J;  4OWT B;  1VQ7 A;  4B3M L;  3DM3 A;  5C44 G;  4A3M G;  1VQM A;  4P73 A;  1NY4 A;  1Q1E A;  4QY7 A;  3OW2 A;  3TQY A;  5GAG C;  2OQK A;  2LXJ A;  5IWA L;  1NMG A;  1D7Q A;  2V1C C;  1N33 Q;  1VQK A;  4LF8 L;  3H3V I;  1VQB A;  2YYZ A;  2Y0S G;  3CCJ A;  1OXX K;  5IYC H;  1Q82 C;  2KCM A;  2OWO A;  4DR4 Q;  4JYA L;  4HJ9 A;  1SRO A;  2AHO B;  2HIV A;  1I6H H;  2JA9 A;  2AKW B;  4R4T A;  2K5N A;  3GTQ H;  2OTL A;  3L0O A;  4C2M H;  5FLM G;  4ALP A;  4JC0 A;  1XNQ Q;  2B3G A;  3OTO L;  4LF6 L;  1AE2 A;  3ULJ A;  1K73 C;  4NXN Q;  4LFB Q;  2ZTD A;  1TWA H;  4GOP B;  3U58 A;  1YI2 A;  3JAM i;  3HOW H;  2Q2H A;  4QGU A;  4A3K H;  1YIT A;  3I4M H;  2N3S A;  4JI7 L;  3TEH B;  1X3F A;  2JA7 G;  1NBW A;  1PH7 A;  1ASZ A;  2ATW A;  3HOX G;  1UE7 A;  4OO1 I;  2KCT A;  1WCM H;  1PH5 A;  1G51 A;  2D62 A;  1W3S A;  3ER0 A;  3F1Z A;  3SGI A;  3J80 c;  1Q8K A;  4DV6 Q;  1HNX Q;  4B3T L;  2GVA A;  3I4O A;  4AYB E;  3AQQ A;  5GAE C;  1WJJ A;  3NBH B;  3CCS A;  1J5E L;  5M3F G;  1UE5 A;  2R7F A;  4R4Q A;  4LUO A;  4C3H H;  1L1O C;  1UEB A;  1B70 B;  2ZTE A;  5J3B A;  3F2B A;  4DR2 Q;  1DGS A;  2F4V Q;  3HOU H;  1HH2 P;  1I3Q H;  2R7D A;  1EQR A;  4P74 A;  1I94 L;  1JJG A;  1YJ9 A;  4BA2 I;  3CCV A;  4YWL A;  1KHI A;  1QUQ A;  3G6E A;  1Q86 C;  1XTD A;  4IPG A;  2AWN A;  3J7A 5;  4JI8 L;  1YVC A;  3CPW A;  4KHP L;  2ES2 A;  2BH2 A;  4DR6 Q;  4A93 G;  4X66 Q;  2R93 H;  1VQN A;  2Z0S A;  2K75 A;  2JJQ A;  3S14 H;  3PO2 G;  1JT8 A;  3T1H Q;  3GTJ H;  2UXC Q;  2VY3 A;  2NVQ H;  1UE1 A;  1QZG A;  2YV5 A;  3HOZ G;  4JI4 Q;  3EN2 A;  2Y0S E;  2IX1 A;  1IBM L;  4PZ7 A;  4TVA B;  3KDF B;  1FJG Q;  2CKZ B;  3KF8 B;  1OXT A;  5E7N A;  4DAY B;  4X65 L;  3KJP A;  1E1T A;  3FKI G;  3GTG H;  4NXM Q;  1PFS A;  3BZC A;  5AJ3 Q;  4LF5 Q;  2B63 G;  1HR0 Q;  4DUZ L;  2JA5 H;  1PYB A;  2VW9 A;  3ZJY C;  4DR5 Q;  4UY8 C;  2YTY A;  2HHH Q;  1JJ2 A;  3H15 A;  1VS0 A;  1S3O A;  4P75 A;  3RLF A;  2VQF Q;  2RHQ B;  3E9I A;  4YWK A;  3W5O A;  3CW2 C;  3I56 A;  4LW1 A;  4L5S A;  1GVP A;  1KL9 A;  2VQE L;  4JBK A;  4LF4 Q;  4JI6 L;  3BJU A;  2R6G A;  1M1K C;  2HQL A;  1YBY A;  3GD7 A;  3KF6 B;  2UU9 Q;  3MXN B;  5GAH C;  3J7Z C;  4MNO A;  3CCE A;  1Q1B A;  3CP0 A;  1TWC H;  1IBL Q;  4PZ6 A;  4DPG A;  4B3M Q;  1GM5 A;  2GVB A;  1VQG A;  3AEV A;  1SE8 A;  4HJ5 A;  1H95 A;  1T9H A;  3PUZ A;  4GLA C;  4EQ5 A;  3PF5 A;  1VQJ A;  4IJH A;  1KIX A;  4IFD I;  4A3G H;  1CKN A;  2JA6 G;  2MQH A;  1VQE A;  5IWA Q;  4GNX C;  5EAY A;  2IX0 A;  2LXK A;  2UUC L;  1B7Y B;  4KLK A;  4BXX G;  4LF8 Q;  1WOC A;  1CKM A;  4DUY L;  2FXQ A;  3RR5 A;  2I5H A;  4QQB X;  5FJ8 G;  3EBE A;  3L7Z C;  5IP7 G;  3F2D A;  1YJN A;  1XMO L;  1GO3 E;  2F52 A;  4YCV A;  3M7N A; 
#chains in the Genus database with same CATH topology
 2ZTC A;  1B1Z A;  3KYH C;  4LUV A;  4DK6 C;  3G6J B;  1MJE A;  5IGE A;  4JI5 L;  3I7F A;  4DAY A;  3J7A F;  1X56 A;  1VQ8 A;  1CFM A;  2BDN A;  1LUZ A;  1KD1 C;  2WV6 D;  1G29 1;  2F0J A;  5JJZ A;  1CA6 A;  1Y1W H;  4A3L G;  4IFD H;  1C9O A;  3NEN A;  1SYE A;  3X3M A;  3BS1 A;  1NCV A;  4ZK9 B;  3DEP A;  3CHB D;  4CBV A;  4JV5 L;  4A75 A;  2UUB L;  1XNR L;  4X64 Q;  4RKL A;  4A3B H;  1SBB B;  4IO9 A;  4JBM A;  1EIG A;  3STB C;  4BBR H;  5JVH 3;  4JW0 A;  3OW7 A;  2F0V A;  2G9D A;  4GKJ L;  5CV8 A;  3DLL A;  1Q7Y C;  4HIO A;  4DV3 Q;  4HJ8 A;  2KVM A;  1WI5 A;  3HKZ G;  4KY6 A;  1ZEQ X;  2ID0 A;  3IFD A;  5M5W H;  1STE A;  2B2T C;  4HMJ A;  3K0Y A;  5E4W C;  2F0F A;  1Q12 A;  5IGD A;  2WB1 G;  5JJK A;  4FF3 A;  5EKI A;  2ALY B;  2B2U A;  4OGQ C;  1U4R A;  4NDX A;  4DV5 L;  4BY1 H;  3HOU B;  4DV0 L;  3H91 A;  1I3Q B;  5LL6 S;  4APV A;  1SN8 A;  2UUC Q;  2KHI A;  5C0X G;  2RKS A;  3BVG A;  2F0T A;  3ERQ A;  1BBW A;  2OF1 A;  1LT4 D;  4R1J A;  4ZUJ A;  4F8M A;  4GKK L;  2TMP A;  3CRK C;  1X55 A;  5CV6 A;  1YEZ A;  2V4D A;  5IOC A;  4BY7 B;  1HA5 A;  4JOI A;  5C4X H;  4MN3 A;  5EPL A;  1DON A;  4H13 C;  4PMC A;  1N9W A;  3S17 H;  4B08 A;  4FO2 A;  1L2F A;  5IT9 E;  3BVZ A;  1HZC A;  3U4Z A;  5IE8 A;  5I2X A;  1LAB A;  4A3I H;  2E5L Q;  1WYD A;  3STB D;  4GOP A;  4DNI A;  3PUV A;  2H1E A;  1MKH A;  3ND8 A;  1RDP D;  4KY7 A;  2NZO A;  4XTC S;  4ZCK A;  2UXB L;  1FR3 A;  1JC7 A;  2ZXR A;  2J0T D;  5LMN W;  1EQQ A;  2QA4 A;  3W2D A;  1DCZ A;  2J7Z A;  1PH1 A;  2O5I C;  1IBK L;  3JAM E;  5FO7 B;  2D5D A;  4OWX B;  2PMZ E;  1WTW A;  3P75 A;  3Q6S A;  2ZJP A;  3Q8D A;  1H9S A;  4K2K A;  3J80 i;  3HOW G;  4GLV B;  1LYL A;  5DM7 3;  4B3S L;  2PYK A;  3I4M G;  4PNY A;  1KRS A;  3TP6 A;  5C3W A;  1QVG A;  2O4X A;  3BU2 A;  4ULL A;  3PIO A;  1XX8 A;  4CKB A;  5M3F H;  4QIW E;  1VQP A;  5DNF A;  2E2H H;  5C4J H;  2D9U A;  2EOT A;  3VYS A;  5K36 G;  2XGT A;  2I0Q A;  1XPR A;  2K05 A;  1EYA A;  2EYL A;  2BE5 C;  3MXN A;  1UWV A;  1NTG A;  4H44 C;  3A5U A;  2MJ8 A;  3E0E A;  3F8T A;  3T53 B;  2PQA B;  1EY8 A;  1HUM A;  3CC7 A;  5H1S E;  1SMX A;  4DV1 Q;  3IRB A;  1IW7 D;  3P7J A;  1EWH A;  1YNJ D;  4ME5 A;  1IBM Q;  3NXW A;  3S1N B;  4B9X A;  4JBW A;  2NTT A;  1IBL L;  1B2T A;  3OMC A;  5G3L D;  1GUN A;  1QUQ B;  3H3V C;  3E9H A;  2MNA A;  1HJP A;  1HZ9 A;  2WAC A;  3UE1 A;  4DNT B;  4A3G G;  2F0E A;  4OON A;  1A2U A;  5D65 A;  4NW2 A;  2QIL A;  1PXU A;  2XWJ B;  3UDF A;  2A69 C;  1CTM A;  3AB9 A;  3SK5 A;  2HCC A;  4NB3 A;  5HGQ A;  3C46 A;  4GN5 A;  5I9P A;  5EJW A;  2R92 B;  1BR9 A;  3HKS A;  1LTG D;  3VYU A;  1PRT D;  2JA6 B;  3H6M A;  1SR3 A;  4LF9 L;  3G71 A;  1U5K A;  2FIN B;  2VUM B;  4K0K L;  1Y1V G;  2Q8R E;  4L8J A;  4YY3 L;  1JE4 A;  2E2I B;  5BR8 L;  2PCF B;  2JE6 I;  2OQ0 A;  4AQY L;  4PMB A;  4JVZ A;  1V1O A;  4X3S A;  2CWP A;  2PQE A;  3T4A C;  4Y7N H;  4A3D B;  4A3E H;  1PH9 A;  2F0W A;  3R2I A;  1SMY D;  3KJO A;  4XIG S;  1E22 A;  2AUK A;  4A3L H;  3OYY A;  1R9T B;  2K28 A;  3DUZ A;  3K7A B;  1SXT A;  5LMN Q;  2K33 A;  4DR3 Q;  1V9P A;  3L9A X;  2I46 A;  3I72 A;  4L63 B;  4OHJ A;  1XNQ L;  3C2P A;  1VQ5 A;  1RJT A;  2CVR A;  1ET9 A;  1E7Z A;  3J81 i;  3F2C A;  2ZM6 L;  3AFQ A;  3CRL C;  4GZY C;  2A1A A;  2KED A;  2ZJR A;  2UUA Q;  3K5N A;  1PH4 A;  1VQO A;  3IL8 A;  1WD0 A;  1NR4 A;  1FNU A;  3A74 A;  4UPA A;  1DOK A;  1E24 A;  2N8N A;  4CKC A;  1HQM C;  3DM1 A;  5IY0 A;  4G7Z C;  1DOL A;  2F4V L;  3TS0 A;  1VMP A;  1BBU A;  2RA4 A;  2JA7 B;  1A63 A;  1C4Q A;  2KJX A;  4C1N K;  3HOX B;  2NZ1 D;  5C5L A;  2YU9 H;  2N78 A;  3S16 H;  5FLX E;  1OO9 B;  2EYH A;  3K5O A;  1PTO D;  3CME A;  3NQT A;  1F2Y A;  2SEB D;  1VQ6 A;  2LMC B;  1TWF B;  4YWM A;  2NVX B;  2NVY B;  5C0X H;  3GP7 A;  1N34 Q;  2F0H A;  1VQA A;  1A0I A;  2UXD Q;  3HOV G;  4RMF A;  4XYQ A;  1VQF A;  3A5Z B;  2NN6 I;  3M4Q A;  4B3R Q;  3PCO B;  2A8V A;  1JWU D;  5IYB G;  4R4C A;  2WP8 J;  1B3A A;  3S1M B;  3X3N A;  1Q90 A;  3RUZ A;  3FKI B;  2DNE A;  4R9W A;  3KLS X;  1Q1E A;  1TQO A;  3OW2 A;  2NUC A;  5GAG C;  4FF1 A;  2OQK A;  2LXJ A;  3ERO A;  3NE5 B;  3HG9 A;  1D7Q A;  1N33 Q;  1VQK A;  1V8Q A;  2OWO A;  3QJY A;  3NHH A;  1QG7 A;  5AFW A;  5COY A;  3L0O A;  4C2M H;  4XDX A;  3LNN A;  2B3G A;  3FRP B;  4LF6 L;  2KHS A;  1K73 C;  4CJ2 C;  3HOW H;  4QGU A;  1JIC A;  3I4M H;  4C3I B;  4JI7 L;  1X3F A;  2XSC A;  2ATW A;  3BYT B;  2E74 C;  3T13 A;  1K8M A;  1UE7 A;  3MVV A;  4OO1 I;  1ZKO A;  3R2T A;  1ESR A;  4DV6 Q;  1HNX Q;  1Q8K A;  1CA5 A;  3AQQ A;  4IUN A;  3NBH B;  1J5E L;  1U4M A;  2R7F A;  1KDB A;  5J3B A;  1Y8O B;  1AP0 A;  4DR2 Q;  4XQQ A;  1RHP A;  4A3J B;  2A6H D;  4J1M A;  2L9H A;  1YJ9 A;  3NP8 A;  4YWL A;  1JR0 D;  3I4L A;  1RD9 D;  3OIP A;  1QUQ A;  3G6E A;  1Q86 C;  1XTD A;  3J7Y W;  2AWN A;  1AW7 A;  4JI8 L;  4F88 A;  3CPW A;  4A93 G;  4DR6 Q;  3VR4 A;  2B8G A;  1K8O A;  2JJQ A;  4ZYS A;  4G7H C;  1JT8 A;  3T1H Q;  3GTJ H;  1CI3 M;  4TSS A;  3A56 A;  3HOZ G;  4BBS B;  3EN2 A;  1PZJ D;  2Y0S E;  4TVA B;  2VB2 X;  1OXT A;  4DAY B;  4DAV A;  4QMG A;  3GTG H;  1BCP C;  3BZC A;  4LF5 Q;  5FK9 C;  2VW9 A;  1YNN D;  4X3U A;  1WTQ A;  2YTY A;  1DJR D;  2HHH Q;  1S3O A;  1LTT D;  2F0S A;  5EKL A;  3CW2 C;  5I4D A;  3S2H B;  4JBK A;  4LF4 Q;  4JI6 L;  1SSO A;  4OEM B;  1XTC D;  2SOB A;  1YBY A;  3KF6 B;  3ONA B;  4KY5 A;  4RWS C;  1JOQ A;  4J8Q A;  1BBX C;  3GTK B;  5M3M B;  1L0Y B;  2F3W A;  3AEV A;  1LTA D;  1EEF D;  3PF5 A;  1KIX A;  4A3G H;  1PZK D;  2MQH A;  4ABN A;  2CW0 C;  5IWA Q;  1BCP B;  2IX0 A;  3K58 A;  1CZG A;  2EZV A;  1B7Y B;  4KLK A;  4JK1 C;  4BXX G;  4CKE A;  5IIF A;  1CKM A;  4DUY L;  2B2U C;  5EPK A;  3EBE A;  3L7Z C;  4RGM A;  4C3J B;  5IP7 G;  1YJN A;  1GO3 E;  4DK0 A;  1IYU A;  3S2D H;  3H0G B;  4ZUI A;  1LTR D;  2IY5 B;  1Y1V H;  1J6Q A;  1KTK A;  2DY8 A;  2PMZ B;  1X3E A;  1EQT A;  3NQI A;  1GUG A;  1KDA A;  2K04 A;  3IFT A;  5C4X G;  1MSG A;  4JOI C;  1S72 A;  2AWO A;  5DLQ E;  3ULL A;  3GTM H;  4KK7 A;  2ZXP A;  4OWW B;  2A19 A;  4A3I G;  3MHB A;  4QUF A;  3BDC A;  1BCP D;  1QWY A;  1RIP A;  1B9M A;  4GOP C;  3DXJ C;  5CYU A;  1PH6 A;  1C8C A;  2EYO A;  1IZ6 A;  4TRD A;  4A3F B;  2DJG C;  1KLU D;  2EPB A;  3G7L A;  1HNW L;  4CHT B;  1I94 Q;  4QIW B;  1E1O A;  2VNU D;  2K6A A;  3OWE B;  1BNZ A;  1ICF B;  1UAP A;  4KHP Q;  2IJ0 A;  3NEL A;  4RG1 A;  2F0U A;  1FL0 A;  3KK7 A;  3VR3 A;  2QKI C;  3SHL A;  1IKL A;  2CQA A;  5KYI A;  2DNC A;  3BDO A;  2K1B A;  5C3E G;  4X65 Q;  1DZ1 A;  5F2D A;  5HY6 A;  1FVI A;  1DD2 A;  2SNM A;  3SE0 A;  1ENA A;  1KDC A;  1S5F D;  5ELD A;  1OXS C;  4DXF A;  4MTK A;  4OXP A;  1TWA B;  4DR7 L;  4A3K B;  2Q2U A;  5IP9 G;  2WAQ E;  4RA8 A;  2VQE Q;  4FXK C;  4DV2 L;  4A76 A;  3HGB A;  4LF7 Q;  3FP9 A;  5JJI A;  3M4P A;  2DGY A;  3C3L A;  1I6V C;  1I50 H;  1SRU A;  3K7U C;  4LJZ C;  3AYH B;  1SNP A;  5BN3 A;  4JI2 Q;  4C3H B;  2NTS A;  2JQO A;  3QIA A;  1HNZ Q;  2FJ2 A;  1EY0 A;  1I4H A;  1YZ6 A;  3SK6 A;  5FO9 B;  4Y52 H;  2E2D C;  2E2J H;  4HSV A;  2F3I A;  2ICI A;  4LFC L;  4H02 A;  3HOV H;  2LKV A;  2Z8L A;  5ISR A;  3HS0 C;  3G48 A;  4JI5 Q;  3MA2 B;  1U4L A;  4I7Z C;  1K3R A;  1OXU A;  3PMF A;  5IYB H;  3WWV A;  2EJG C;  3D31 A;  2JA5 B;  4QCL A;  5M5X H;  1A62 A;  3D6W A;  2C9O A;  1LLR D;  3NBH A;  1JB7 A;  4IUV A;  3RZD H;  2MGS A;  1YHQ A;  1K28 A;  2X6G A;  1CHQ D;  1SDF A;  5IT9 c;  1PH3 A;  1KAW A;  3TS2 A;  4A4I A;  3NTI A;  1W6K A;  1TS5 A;  1TWC B;  1XNR Q;  2NN6 G;  1PH8 A;  5ELE A;  1LO5 D;  2ASB A;  3PO3 H;  1G6P A;  1MIU A;  2BA1 A;  3L2P A;  1STY A;  2RF4 A;  1STN A;  3QO2 A;  1JCK B;  3VYR A;  5G3L F;  1Q8I A;  1PVO A;  1EUJ A;  1J9O A;  5HGT A;  3JAM c;  2MFI A;  3LGJ A;  4K8J A;  4YHH L;  4A3E G;  1HA6 A;  2R7Z B;  4IPH A;  1IXR A;  3FPP A;  1I4G A;  5M3F B;  1JMC A;  1BO0 A;  3KF6 A;  4A93 H;  5CV9 A;  1K83 H;  1KQS A;  3PGZ A;  2F0D A;  4HIM A;  3M4Y A;  4DV5 Q;  1V1P B;  4K6L A;  1EIF A;  3H09 A;  5CBE E;  4DV0 Q;  4OO1 G;  2DJF C;  4JG2 A;  1EFI D;  3HOZ H;  1CSP A;  4ODG A;  5J1Z A;  2QEX A;  2EJF C;  4GKK Q;  1TS2 A;  5BN5 A;  1EZ8 A;  2IHE A;  5JJL A;  4BA1 I;  1TXY A;  1SFO B;  2DN8 A;  1TWG H;  4UAI A;  2ZXO A;  2N88 A;  1X3G A;  1EWC A;  2X69 A;  2QW7 A;  3RLO A;  4LNQ A;  1VQD A;  4OX9 L;  3LWE A;  1SE4 A;  1X6O A;  5LL6 X;  2UXB Q;  1SNM A;  1IYV A;  5M5Y H;  3Q23 A;  4BXX H;  4IAL A;  1HTL D;  2IL8 A;  1IBK Q;  3M4O H;  3MTS A;  2KCC A;  4CJ1 B;  3Q24 A;  5IP7 H;  1I4R A;  1YHA A;  1VQC A;  1F2Z A;  3TZU A;  1Z47 A;  4P72 A;  2F0G A;  4J15 A;  1STA A;  5DAU A;  3I90 A;  4B3S Q;  5JEA G;  4X6A H;  1YHB A;  4RCO A;  4LFA Q;  1YJW A;  2GA4 B;  2WIN B;  4K5V A;  1KNA A;  1XXG A;  5KND A;  5DM6 3;  1LM0 A;  1R4Q B;  2L12 A;  2D0O A;  1AFP A;  3GTL H;  4Y7N B;  5E4X A;  3TBI B;  4XT1 B;  3WDN A;  4X64 L;  3NEM A;  3N6R A;  3BDL A;  3S15 H;  4JBJ A;  1SEB D;  1FGB D;  4HN7 A;  3GTO H;  1QVF A;  2C35 B;  3MEF A;  3R3O A;  5C44 B;  4A3M B;  1L1O B;  1IW7 C;  3E0J A;  4NXN L;  4DK3 C;  1YNJ C;  3S1Q B;  1V43 A;  3GTP H;  3CF5 A;  5KIX A;  4DV3 L;  1QNU A;  3TP8 A;  1PYS B;  4HJ7 A;  1EOT A;  1KXL A;  1JE5 A;  5KNB A;  4RGO S;  1GKH A;  2Y0S B;  3HRZ C;  5C3E H;  1GUT A;  4BS9 A;  4CJ0 B;  2EE1 A;  5CV4 A;  4U67 3;  3MZ5 A;  3MFG A;  1K8G A;  5A35 A;  1EQV A;  2D2C C;  2I5M X;  1H9R A;  1TU2 B;  2R92 G;  3L3O C;  1EYD A;  3V2T A;  4OIK A;  4R8N A;  5IP9 H;  1NSN S;  2VUM G;  3AU7 A;  1D6E C;  3B6Y A;  2AMC B;  2WKC A;  1PRT C;  4XXE A;  1A6X A;  1CUK A;  2B2V A;  3K57 A;  1CKO A;  3HFZ B;  2YTV A;  4JI4 L;  4UP9 A;  3GO5 A;  5EQ0 A;  1AZP A;  1TR5 A;  2EYJ A;  2Q2I A;  1N8R C;  4JI3 Q;  1Y69 U;  4A3D G;  3PV0 A;  2XNA C;  2A6E D;  2FMM A;  1IL2 A;  2AQ2 B;  2HCI A;  3DWP A;  1XPO A;  5ELO A;  4JCV E;  3RN5 A;  1TWH B;  2EY1 A;  2E76 C;  1O80 A;  1NMF A;  3TDQ A;  4DR5 L;  3TRE A;  5EPJ A;  5IGG A;  1X65 A;  4DXG A;  4K0K Q;  4L6T B;  2BA0 A;  1STG A;  5CV7 A;  4DNR B;  5C4H A;  3CMA A;  4YY3 Q;  1SMY C;  1VQI A;  3P20 A;  4KD3 A;  3PO2 B;  5BR8 Q;  5FLX c;  4AQY Q;  5D3D A;  3BZK A;  3OIQ A;  4PMW A;  1PRT B;  2PW5 A;  1SYF A;  3QB3 A;  4OWT B;  4B3M L;  1HPC A;  3DM3 A;  1B44 D;  3GQB A;  1SYC A;  1VQM A;  3SK8 A;  1K0S A;  3V96 A;  2B63 B;  1NY4 A;  4QY7 A;  1BOS A;  2F0L A;  5KEE A;  2V1C C;  5IT9 L;  3J80 E;  1OXX K;  2B2Y A;  2KCM A;  4OEL B;  2OTL A;  5FLM G;  1XNQ Q;  4JC0 A;  2NN6 H;  2XIW A;  2VB3 X;  3GV3 A;  1RTN A;  4LFB Q;  3E3X A;  1DXM A;  2N3S A;  2JA7 G;  1EL0 A;  2F0Q A;  1NBW A;  1PH7 A;  2F0N A;  2O5J C;  1IL8 A;  3P1H A;  3JAM L;  3VYT A;  3HOX G;  1V1P A;  4HCS A;  3R8B A;  2JP1 A;  5I2Y A;  3M3Y B;  1EZ6 A;  4AYB E;  2AQ3 B;  3CCS A;  2MUY A;  4R4Q A;  1UEB A;  2F4V Q;  3HOU H;  4DGZ A;  4FF2 A;  1I3Q H;  1L0X B;  1PTO C;  2R7D A;  5T1G A;  4EVO A;  1QOH A;  4LMQ D;  1SYD A;  1M8A A;  5JOB A;  2IWH A;  1KHI A;  3OOC A;  3HOY B;  3J7A 5;  2WAQ B;  2MPM A;  1T5E A;  4HR7 B;  3S9W A;  3TME A;  1UE1 A;  1RCV D;  2JN4 A;  1QZG A;  1IBM L;  4PZ7 A;  3I4N B;  1A3V A;  2X6L A;  3KDF B;  3KJP A;  1KAB A;  4OO1 H;  2AUJ D;  1E1T A;  3FKI G;  2BOS A;  5AJ3 Q;  5ELB A;  4K8I A;  4DUZ L;  1PYB A;  1PTO B;  2G9H D;  3S1R B;  1S4Z A;  2CH4 A;  1G6Z A;  1JJ2 A;  1VS0 A;  3GTG B;  3RLF A;  3E9I A;  3I56 A;  1GUO A;  4HSP A;  4LW1 A;  1LT3 D;  1KL9 A;  1AN8 A;  3VR2 A;  3BJU A;  1M1K C;  1E0B A;  1X3P A;  3GD7 A;  1JOK A;  2UU9 Q;  3RZO B;  1BCP F;  1UUP A;  2GVB A;  1PFM A;  2M9V A;  4I65 A;  4ILW A;  2CHB D;  4EQO A;  1T9H A;  3PUZ A;  4EQ5 A;  2F1M A;  2C5C A;  3CQZ B;  4C3I G;  3ND9 A;  2TSS A;  3NWT A;  2NVT B;  1BDO A;  5JAV A;  2FMC A;  1WOC A;  1QJO A;  4KN7 C;  1PFN A;  3K6O A;  5FJ8 G;  4RHR A;  4V19 0;  4XQN A;  1DOM A;  3SXH A;  1E2V A;  2F52 A;  2RDF A;  3A55 A;  4A3J G;  4LF6 Q;  1EOV A;  1Y8N B;  2NBF A;  1L1O A;  1IYJ B;  2A6H C;  5JEA H;  3Q22 A;  1UEA B;  3OWF A;  1CM9 A;  4QF4 A;  4YCW A;  1J5E Q;  4BBS G;  1WTP A;  1U4P A;  3NPP A;  3D4D A;  4MIU A;  2EDG A;  4CDF C;  4KHZ A;  2XRQ D;  3J81 E;  2K5Q A;  1VQH A;  2I5L X;  1QVC A;  4KN4 C;  2JA8 B;  3J7A V;  5LMU Q;  5IGF A;  1LTL A;  3U9S A;  3S1N H;  2K5H A;  1YNN C;  3DMU A;  1BQQ T;  5ELF A;  2PI2 E;  2RQX A;  5M3M G;  3PO3 G;  4FP5 D;  1O7Y A;  5EGT A;  4KKT A;  1HQR D;  2EXZ A;  1YIJ A;  1PHJ A;  3PIP A;  1I6H B;  1VF7 A;  2PZU A;  1WTH A;  1QE6 A;  3MWY W;  1N36 Q;  1B9N A;  2H4O A;  3GTQ B;  4XT3 B;  1SNO A;  1I4X A;  4GN3 B;  1GD7 A;  2Z4H A;  4AIM A;  2BH8 A;  4O1N A;  4A3C G;  1LAC A;  1D5M C;  3ICE A;  4C3J G;  2K5W A;  2R92 H;  1C0A A;  1WCM B;  3H0G G;  3SK4 A;  3BYY B;  1R4P B;  2VUM H;  4JI1 L;  3H3V H;  4ZKB B;  3S24 A;  2F3V A;  2QDB A;  4H7B A;  2E2I H;  1N34 L;  4IOC A;  4X62 L;  2EQS A;  3A7A B;  3A7L A;  3CCU A;  4X3T A;  5EBD A;  4DUY Q;  1LT5 D;  1WTV A;  1SJE D;  4A3D H;  5TSS A;  2A5H A;  1LT6 D;  3R93 A;  4DV7 Q;  2R93 B;  3GV6 A;  5I9O A;  4ME3 A;  5FLX L;  1RF2 D;  4F7X A;  1R9T H;  4QUC A;  4WJ3 M;  3S14 B;  1KRT A;  4YIJ A;  4A3F G;  1XMQ Q;  3K7A H;  2NVQ B;  1ICW A;  3JC6 6;  5GAD C;  3IAY A;  3W1G A;  2L11 A;  4HMI A;  4Z9C B;  4HID A;  3KLW A;  4RGN A;  4NP5 A;  2HDL A;  3TP7 A;  1UE6 A;  2IT1 A;  3U4V A;  1KC8 C;  1HRJ A;  3J81 j;  3T1Y L;  2KOL A;  3HKZ E;  3PUW A;  3WOE A;  2KBN A;  3VDY A;  4DAP A;  1SNQ A;  4XQJ A;  1EY4 A;  1HZB A;  4NPS A;  2WB1 E;  3CD6 A;  2QGQ A;  1AE3 A;  3HZX A;  3D8G A;  3ERS X;  1AH9 A;  1W2B A;  1X32 A;  4P71 A;  4RAU C;  1G2T A;  3MC0 B;  4C1N I;  3M85 A;  1HR0 W;  2A68 C;  4PG3 A;  5FLM H;  4DV6 L;  1W6J A;  4A3K G;  4JYA Q;  1H9J A;  2KEN A;  1STB A;  1NUC A;  5KGU A;  4DR2 L;  2JA7 H;  3OTO Q;  1PMR A;  1CQF A;  3NUC A;  3HOX H;  3KDF A;  4C56 C;  4C3H G;  3K59 A;  2K5V A;  2RDH A;  1BF4 A;  1RKN A;  4K5X A;  3U50 C;  1OTC A;  4DR6 L;  4DU9 A;  1B50 A;  1TY0 A;  4UP8 A;  4B3T Q;  3QG1 A;  3K8A A;  1TWF H;  1JQY D;  1EFW A;  2NVX H;  2NVY H;  4DV2 Q;  4DF7 A;  1TII D;  1EYG A;  1WFQ A;  1Y1W B;  4DR1 L;  1D8L A;  2SDF A;  3D0F A;  3W1B A;  4LF5 L;  4MTN A;  4LUZ A;  1E2W A;  1KAA A;  3K5M A;  2NZH A;  1ZYR C;  2JK8 A;  2HHH L;  1JJC B;  5IYD H;  1HFG A;  2RDG A;  3S1M H;  4GLX A;  1ML0 D;  2JA5 G;  2EYF A;  1M90 C;  3UDG A;  2K7V A;  3FKI H;  2XWB B;  3EJI A;  1XWE A;  4IOA A;  4ZLT F;  4LFC Q;  4R4I A;  4A3B B;  5FKA C;  3OHX C;  5IGB A;  1U9R A;  4F87 A;  4K14 A;  3MFY A;  4G4K A;  2A68 D;  4J6H A;  4BBR B;  5L37 A;  1P16 A;  4QB4 A;  3RLN A;  4E6I A;  3BZD B;  3D4W A;  1HUN A;  2PZW A;  4M1U B;  1NR2 A;  3EVQ A;  3DEO A;  1TT2 A;  4IFD J;  3SEB A;  4EX5 A;  4AH6 A;  2XTI A;  2EYM A;  4C3I H;  5M5W B;  1HTP A;  4JI0 L;  2H5X A;  2B2V C;  5JVG 3;  2MO0 A;  2JYO A;  5FJ8 H;  3CCL A;  2QEJ C;  4V0B A;  1HXY D;  2HUG A;  3NSW A;  2R7Z G;  1VDZ A;  5C5M A;  1EIY B;  4BY1 B;  4A3J H;  4ID6 A;  2KCN A;  4DV4 L;  1XMO Q;  3A8I E;  1X54 A;  3UDI A;  1CKN B;  3WOF A;  1EY7 A;  1ZYR D;  4KTA A;  4WRD A;  3KOJ A;  1AZQ A;  1B4O A;  3UDX A;  2BDO A;  3V05 A;  2L0C A;  3CCM A;  3D3R A;  2FFK B;  4NKL A;  5C4X B;  4RCN A;  4G57 A;  3RN2 A;  5GRO A;  4YHH Q;  4BBS H;  3S17 B;  2VS1 A;  4AYB B;  3KLS A;  1GJX A;  1BUV T;  5EKK A;  4O0A A;  4PZ8 A;  1PV4 A;  4DR4 L;  1SYG A;  4A3I B;  3O13 A;  2DUD A;  4KV6 A;  3FHW A;  2A74 C;  2PNH A;  1S5B D;  2K4K A;  2B2Y C;  3S2H H;  3MXG A;  4MZ9 A;  3D6C A;  4JV5 Q;  1Q81 C;  4KJN A;  2UUB Q;  1WTO A;  4XYO A;  3GTK H;  1E3P A;  5M3M H;  1LTB D;  1HFN A;  1F9S A;  4R4O A;  3EFX D;  4K5W A;  5CBA E;  5D3I B;  4LF7 L;  4QJF A;  4BWG B;  1XPU A;  5DEH A;  2N55 A;  4EQN A;  2RSO A;  5E1F A;  2VL6 A;  2B2W C;  4GKJ Q;  4NMZ A;  4A3C H;  2Z6K C;  3G4S A;  4JI2 L;  2KQ3 A;  1HHV A;  2OCE A;  1A2T A;  2Q8T A;  3HOU G;  4C3J H;  3LWU A;  1N32 L;  1SYB A;  1HNZ L;  2QF7 A;  1NE3 A;  1CQV A;  3A54 A;  1A15 A;  4X66 L;  3PQI A;  2F4I A;  1S40 A;  3H0G H;  1O7Z A;  1GXD C;  4KD4 A;  4OX9 Q;  4DKA C;  3UI2 A;  1K0R A;  2OXP A;  2UXC L;  1STH A;  1CZW A;  2WII B;  2EY2 A;  2E2H B;  5C4J B;  4BY7 G;  1QNK A;  4QL5 A;  1MSH A;  1FJG L;  1VQ4 A;  1ENF A;  2PO4 A;  4NXM L;  2CFM A;  3BG3 A;  4PQX A;  4Q5V A;  1HR0 L;  1MGS A;  1QCB D;  3CCQ A;  1PRT F;  4KKU A;  4IN3 A;  2EJM A;  1YNX A;  1WD1 A;  2VQF L;  2HD3 A;  5EBC A;  4IUQ A;  1FNW A;  4A3F H;  5IGC A;  2F0I A;  4DK1 A;  3VA5 A;  4IUT A;  1G8Z D;  1VQ7 A;  5C44 G;  4A3M G;  2B39 A;  1J8I A;  2PZT A;  1KLG D;  3N52 A;  1C48 A;  1NMG A;  3QOL A;  1KNE A;  1WTR A;  2XRS D;  4LF8 L;  1VQB A;  4ZKC B;  2Y0S G;  1Q82 C;  1GHJ A;  3TZD A;  2AHO B;  1GHK A;  1JOO A;  2K5N A;  3MAQ A;  3D4R A;  4ALP A;  3ITP A;  4HAE A;  4NXN Q;  1TWA H;  1YI2 A;  3JAM i;  4A3K H;  3BVM A;  3A8K E;  2A73 B;  4X3K A;  1ASZ A;  2KCT A;  1ONL A;  1PH5 A;  3ER0 A;  1F2L A;  3SGI A;  3J80 c;  1H9K A;  1UNS A;  5GAE C;  1WJJ A;  4I7A A;  5CC4 A;  1UE5 A;  4FXD A;  2K01 A;  4C3H H;  1L1O C;  2IPK D;  3RD4 A;  5K5P A;  4M8A A;  1EY5 A;  3T51 B;  1T5X D;  3CCV A;  3W3A A;  4LK1 C;  2A6E C;  4A3E B;  1YVC A;  2LS0 1;  2ES2 A;  2BH2 A;  3LX0 A;  2I07 B;  2K75 A;  1LV9 A;  3PO2 G;  4RHS A;  1PTO F;  2L4N A;  4KMU C;  4JI4 Q;  2IX1 A;  1G2S A;  4OL7 A;  2CKZ B;  3KF8 B;  4DA2 A;  1F9R A;  1PFS A;  2B63 G;  2JA5 H;  1WVL A;  5E3F A;  3ZJY C;  4DR5 Q;  4UY8 C;  1EYC A;  4P75 A;  2F0K A;  2RHQ B;  2RCF A;  3W5O A;  1PLF A;  2ICE C;  4OIJ A;  4L5S A;  1B53 A;  3QOJ A;  2HQE A;  3NTK A;  5GAH C;  3I8Z A;  3CCE A;  2PPB C;  1Q1B A;  1SND A;  2EVB A;  1TWC H;  1IBL Q;  4PZ6 A;  4B3M Q;  3VR6 A;  1GM5 A;  1VQG A;  1DYQ A;  3TP5 A;  1MBY A;  4GLA C;  4IFD I;  4IJH A;  1CKN A;  2JA6 G;  1A3U A;  1VQE A;  4CDC C;  5EAY A;  4GNX C;  3TSS A;  2Z4I A;  4FNF A;  2UUC L;  3HKZ B;  1SE2 A;  3RR5 A;  4QQB X;  3F2D A;  2WB1 B;  3M7N A;  2YU9 B;  4LFA L;  3S16 B;  2OEO A;  4HIK A;  4ZAI A;  2R7Z H;  5LHY 1;  1XYI A;  5CR3 A;  4LF9 Q;  2E5L L;  5COR A;  3HOY G;  2WAQ G;  1RL2 A;  1B8A A;  1C7Y A;  3PIP 3;  4GNX B;  3K5L A;  3UE0 A;  2HDM A;  1F77 A;  2RHS B;  1ENC A;  3I4N G;  3TN2 A;  1A8V A;  2HIX A;  4Q0F A;  1U0L A;  3FVQ A;  3C1E A;  1A3T A;  1EWI A;  1OXV A;  1HZA A;  1MJC A;  1MD2 D;  2Q8I B;  1F2M A;  1BXT A;  3GDE A;  3QWN A;  1SFO H;  4UDU C;  1EY9 A;  3SDZ A;  4MHE A;  5HUR A;  4HCE A;  2KUM A;  2P5Z X;  3J81 c;  5C0X J;  2ZM6 Q;  4L5R C;  4DUZ Q;  4C2M B;  4EQP A;  1Z7T A;  5JEA J;  1JWS D;  1CT1 D;  2R61 A;  2B2W A;  4RFB A;  4WFN 3;  5ELN A;  3HOW B;  2Z6K A;  3I4M B;  4IPC A;  3CCR A;  1QZH A;  2JEB I;  3VR5 A;  2DY7 A;  4HTH A;  4HED A;  3I91 A;  3URY A;  4JI3 L;  2IX3 A;  5IOD A;  1ESF A;  2ZT9 C;  4H0L C;  1EU4 A;  2CWA A;  4DFA A;  4WJ4 A;  4YCU A;  1S5E D;  1AEX A;  4BY7 H;  3M9B A;  5C6A A;  4DV1 L;  1JOR A;  5CMD A;  2BE5 D;  5IYD G;  1K8A C;  2F03 A;  3K80 C;  2CH4 W;  4UP7 A;  4UHV A;  3GTJ B;  1D2B A;  2Z1C A;  3C1F A;  3AFP A;  2JA8 G;  3PF4 A;  1MI2 A;  1O7L A;  1G91 A;  4POG A;  1QB5 D;  3KLR A;  3EA6 A;  3MXU A;  5C44 H;  4A3M H;  2WFW A;  2RCN A;  1F9Q A;  3OSO A;  4IUU A;  3S1Q H;  2CCZ A;  2QDL A;  2PI2 A;  1VCI A;  3KUP A;  1FGU A;  2M2L A;  1L0W A;  5IYC G;  3A0J A;  4POF A;  1EIH A;  4LFB L;  1PFB A;  3KFU A;  4O2D A;  3ULP A;  3M7G A;  1I4Q A;  1NAP A;  2D0P A;  2E8G A;  4TKO B;  2A69 D;  3FPU B;  4A3G B;  2E75 C;  2K03 A;  3I55 A;  1V1Q A;  1EEI D;  1LTI D;  4N9T A;  3I73 A;  3CAM A;  2B8F A;  3I3C A;  3TRZ A;  1Q3L A;  3J80 L;  4K6D A;  1X9N A;  1EY6 A;  1WCM G;  5GQO A;  2EIF A;  2NB0 A;  2Q2T A;  1SAP A;  3NBI A;  1SE3 A;  3PUY A;  4RKB A;  2B2T A;  2IHF A;  3KF8 A;  3U9O A;  2RSN A;  4JI7 Q;  3S2D B;  2KHJ A;  2L55 A;  2HT1 A;  1Y1V B;  2K50 A;  3HEJ A;  1E2Z A;  5LMN L;  4DR3 L;  2CQO A;  4N8F A;  1Y14 B;  3CC4 A;  2K52 A;  3FMC A;  3CU7 A;  1Z6H A;  2Z6B A;  1TWH H;  1PZI D;  2VZA A;  4TQU S;  3NTH A;  2R93 G;  3GTM B;  1D5X C;  1TKW B;  2LY7 A;  4FF4 A;  4KJO A;  4JI1 Q;  2EXD A;  4IUP A;  5AJ3 L;  2PNR C;  1K9M C;  3PO2 H;  4U68 A;  4X62 Q;  1PYW D;  4K2L A;  4JI8 Q;  2UUA L;  5T1I A;  2JSO A;  3KBX A;  3CPF A;  3CKI B;  2BCO A;  3DHQ A;  2B63 H;  2UU9 L;  2OTJ A;  4HJA A;  3NWS A;  2EY5 A;  2K14 A;  5M9O A;  1I5F A;  1ROD A;  1VF5 C;  1PH2 A;  2XVS A;  5CGK A;  4CDE C;  1IHZ A;  1F9P A;  3NK9 A;  2M00 A;  1H9M A;  1CK1 A;  4DAM A;  3T1Y Q;  4JI6 Q;  3F2U A;  1VQ9 A;  2NWG A;  3A8J E;  4GNX A;  2JA6 H;  1ET6 A;  2F0P A;  3K81 C;  2F0O A;  2RVL A;  2L15 A;  2K5D A;  1SJH D;  3M3Y H;  3DWQ A;  1BKB A;  3CC2 A;  2MHV A;  1I50 B;  2UXD L;  3MEH A;  3PUX A;  2F0M A;  2NYZ D;  5C3X A;  2IW3 A;  3AMU A;  2K32 A;  4B3R L;  2PQA A;  1FD7 D;  1JWM D;  1VMC A;  1LTS D;  3DWA A;  1Y1W G;  3HOY H;  1GUS A;  4IFD G;  2E2J B;  1JB3 A;  2PW7 A;  1CSQ A;  2YTX A;  2MP1 A;  4PV1 C;  1ASY A;  5LMU L;  1WTX A;  2EYP A;  2J4X A;  5K36 H;  1HCZ A;  3HOV B;  4G7O C;  5A2Q E;  1N33 L;  3RNU A;  1SLJ A;  3I4N H;  2AQ1 B;  5J22 A;  1Z9F A;  3E6Z X;  1BVS A;  1PDQ A;  4IJL A;  4O42 A;  1PTO H;  3SR1 A;  4A3B G;  3S1R H;  1K3B C;  5KRU A;  1X3Q A;  4DR1 Q;  5M5X B;  5ELC A;  2KEE A;  1HNW Q;  4BBR G;  4EGV A;  1N36 L;  3IKJ A;  3J81 L;  3CXC A;  1RTO A;  3RZO H;  1TS4 A;  1FYC A;  1Q46 A;  3RZD B;  5FO8 B;  1HNX L;  5C0X I;  1S5C D;  3QR8 A;  3K0X A;  4KI0 A;  5JPM C;  3CQZ H;  1XJV A;  3PO3 B;  5CV5 A;  4IQZ A;  2NVT H;  2LSS A;  4L5T A;  4RGT A;  4JPB W;  3Q0A A;  5I6W A;  5KYL A;  5NUC A;  2Z9H A;  3SVM A;  2N49 A;  4GN4 B;  4IPD A;  4DR7 Q;  1IKM A;  4BY1 G;  3T1H L;  3PSI A;  4LWC A;  4FYD A;  1B3Q A;  4FDB A;  4DV7 L;  1NNX A;  1PA6 A;  4N9P A;  1O7I A;  1CHP D;  1XMQ L;  4JI0 Q;  2QCP X;  1MHW C;  5BN4 A;  2MO1 A;  3EIV A;  2ZJQ A;  2KA7 A;  4FXG C;  1TY2 A;  4A93 B;  1D1K A;  1SNC A;  1TVX A;  4AYB G;  1K83 B;  1VQL A;  1NJI C;  4LF4 L;  4GS3 A;  4L5Q A;  1P8L A;  2JEA I;  4DV4 Q;  3I2Z A;  3HOZ B;  1D1I A;  1QIL A;  2B29 A;  2GN5 A;  2JA8 H;  2JXM B;  1TS3 A;  3RMH A;  4P73 A;  3TQY A;  5IWA L;  2FHT A;  3HP3 A;  1TWG B;  3H3V I;  2YYZ A;  3CCJ A;  2L5T A;  5IYC H;  4DR4 Q;  4JYA L;  5KNC A;  4HJ9 A;  1SRO A;  5A2Q L;  2HIV A;  5JPN C;  1I6H H;  2JA9 A;  2AKW B;  4R4T A;  3GTQ H;  5J39 A;  5C4Z A;  2CW0 D;  3OTO L;  1AE2 A;  4S3S A;  3ULJ A;  3MXP A;  2ZTD A;  4GOP B;  3U58 A;  2Q2H A;  1O78 A;  1ZXT A;  1YIT A;  3TEH B;  1ILP A;  1GOZ A;  1I4P A;  3FDT A;  5M5Y B;  2LFN A;  1WCM H;  3F1Z A;  1G51 A;  1W3S A;  2D62 A;  3VA7 A;  4B3T L;  3M4O B;  2GVA A;  3I4O A;  4KHV A;  5M3F G;  4IZ8 A;  4LUO A;  2WKD A;  1B70 B;  2ZTE A;  3F2B A;  1DGS A;  4ZRZ A;  3KBG A;  1HH2 P;  3FEW X;  1EQR A;  1S5D D;  4ZQ3 A;  4P74 A;  4P2C B;  1I94 L;  2RBM A;  1JJG A;  3T56 B;  4BA2 I;  1H9S B;  1D5Z C;  2KEC A;  4IPG A;  2SNS A;  2G5D A;  1N32 Q;  5D14 A;  4KHP L;  2R93 H;  1ILQ A;  3EQL C;  3OPO A;  4X66 Q;  5I6Y A;  2VXW A;  2Z0S A;  4LAA A;  1VQN A;  3S14 H;  1EU3 A;  4WJW A;  2UXC Q;  2L1B A;  2VY3 A;  2NVQ H;  3GTL B;  2YV5 A;  3OMG A;  4WOR A;  4KKS A;  5FOB B;  1FJG Q;  3S15 B;  5E7N A;  4X65 L;  4NXM Q;  2O2L D;  1HR0 Q;  1II3 A;  3GTO B;  3H15 A;  2VQF Q;  3H94 A;  4CDD C;  4YWK A;  4R8I A;  3PIO 3;  3GTP B;  1GVP A;  2OT2 A;  4N8X 1;  2VQE L;  2R6G A;  2ENB A;  2HQL A;  3MXN B;  3J7Z C;  4MNO A;  4CGY B;  2EY6 A;  3CP0 A;  1M4V A;  5C3E B;  3T16 A;  4DPG A;  1SE8 A;  4HJ5 A;  1H95 A;  4FVM A;  1VQJ A;  3E5S A;  1DM0 B;  1Y8P B;  3I70 A;  4B9W A;  2LXK A;  4IUR A;  1FNV A;  4LF8 Q;  4DN4 M;  2FXQ A;  2I5H A;  3ZYY X;  2R3Z A;  1XMO L;  4RH6 A;  1GUW A;  2XN9 C;  4YCV A; 
#chains in the Genus database with same CATH homology
 4LFA L;  3S2D H;  2ZTC A;  4A3J G;  4LF6 Q;  2IY5 B;  3KYH C;  4LUV A;  1Y1V H;  4HIK A;  1J6Q A;  4DK6 C;  2R7Z H;  1X3E A;  1MJE A;  1EOV A;  3I7F A;  4JI5 L;  4LF9 Q;  2E5L L;  1L1O A;  1X56 A;  1VQ8 A;  5C4X G;  1IYJ B;  3HOY G;  2WAQ G;  1RL2 A;  1LUZ A;  4JOI C;  1S72 A;  1KD1 C;  2AWO A;  1B8A A;  5DLQ E;  1C7Y A;  3ULL A;  1G29 1;  3GTM H;  4GNX B;  1Y1W H;  4OWW B;  4A3L G;  2A19 A;  1G6P A;  3UE0 A;  4A3I G;  4YCW A;  1J5E Q;  1C9O A;  2RHS B;  4BBS G;  3I4N G;  3NEN A;  1A8V A;  2HIX A;  1RIP A;  1U0L A;  4GOP C;  1PH6 A;  1IZ6 A;  4KHZ A;  1HNW L;  1EWI A;  1OXV A;  1VQH A;  2I5L X;  1I94 Q;  1HZA A;  1QVC A;  1E1O A;  2VNU D;  1MJC A;  5LMU Q;  4JV5 L;  1LTL A;  4A75 A;  2UUB L;  1XNR L;  4KHP Q;  3NEL A;  4RG1 A;  4X64 Q;  3S1N H;  4A3B H;  4IO9 A;  3GDE A;  1FL0 A;  2K5H A;  4JBM A;  1SFO H;  3STB C;  4BBR H;  2PI2 E;  5M3M G;  3PO3 G;  5C3E G;  4X65 Q;  1YIJ A;  4GKJ L;  1PHJ A;  3PIP A;  3J81 c;  5HY6 A;  1FVI A;  5C0X J;  2ZM6 Q;  1N36 Q;  4DUZ Q;  3DLL A;  4L5R C;  1Q7Y C;  4HIO A;  4DV3 Q;  4HJ8 A;  4GN3 B;  1GD7 A;  1OXS C;  4AIM A;  2BH8 A;  1WI5 A;  4A3C G;  4OXP A;  5JEA J;  3HKZ G;  4DR7 L;  5ELN A;  2ID0 A;  5M5W H;  2Q2U A;  2Z6K A;  2WAQ E;  5IP9 G;  2VQE Q;  3ICE A;  4IPC A;  4DV2 L;  4A76 A;  1Q12 A;  3CCR A;  1QZH A;  2JEB I;  2R92 H;  1C0A A;  2WB1 G;  4LF7 Q;  3FP9 A;  5JJI A;  5JJK A;  3M4P A;  2DGY A;  4JI3 L;  3H0G G;  1I50 H;  1SRU A;  3K7U C;  2ALY B;  2VUM H;  3H3V H;  4JI1 L;  3S24 A;  3AYH B;  4JI2 Q;  2E2I H;  4DV5 L;  1N34 L;  2JQO A;  4IOC A;  4BY1 H;  2CWA A;  4X62 L;  4DV0 L;  2EQS A;  4APV A;  1HNZ Q;  1SN8 A;  2UUC Q;  4WJ4 A;  4YCU A;  2KHI A;  5C0X G;  4R1J A;  3CCU A;  1BBW A;  1YZ6 A;  4BY7 H;  4DUY Q;  3M9B A;  4GKK L;  4A3D H;  4Y52 H;  4DV1 L;  2E2J H;  1X55 A;  5IYD G;  2F3I A;  1K8A C;  1YEZ A;  4DV7 Q;  4LFC L;  4ME3 A;  4WJ3 M;  1R9T H;  3K80 C;  4JOI A;  5C4X H;  4UP7 A;  1KRT A;  4H02 A;  3HOV H;  1N9W A;  4A3F G;  3S17 H;  1XMQ Q;  3K7A H;  1L2F A;  3JC6 6;  1HZC A;  3AFP A;  3U4Z A;  5IE8 A;  5GAD C;  3G48 A;  4JI5 Q;  2JA8 G;  3PF4 A;  3W1G A;  4A3I H;  2E5L Q;  1WYD A;  4HID A;  3STB D;  3KLW A;  4DNI A;  4GOP A;  1K3R A;  1OXU A;  5IYB H;  4POG A;  3PUV A;  1MKH A;  1UE6 A;  2IT1 A;  3WWV A;  3D31 A;  3U4V A;  1KC8 C;  2NZO A;  5M5X H;  4XTC S;  5C44 H;  3J81 j;  3HKZ E;  3T1Y L;  2WFW A;  1A62 A;  3PUW A;  4A3M H;  2RCN A;  2UXB L;  3S1Q H;  2CCZ A;  2KBN A;  2PI2 A;  5LMN W;  1VCI A;  3VDY A;  1EQQ A;  2QA4 A;  1FGU A;  1HZB A;  4NPS A;  1L0W A;  5IYC G;  2WB1 E;  3A0J A;  4POF A;  2QGQ A;  1PH1 A;  1AE3 A;  1JB7 A;  3CD6 A;  3RZD H;  4LFB L;  3ERS X;  1IBK L;  1YHQ A;  3KFU A;  1AH9 A;  4O2D A;  4OWX B;  5IT9 c;  3ULP A;  1W2B A;  1PH3 A;  1KAW A;  3TS2 A;  4A4I A;  2D0P A;  2E8G A;  2PMZ E;  4P71 A;  1XNR Q;  2NN6 G;  1PH8 A;  2ZJP A;  3M85 A;  3Q8D A;  4PG3 A;  5FLM H;  3J80 i;  4DV6 L;  1HR0 W;  4A3K G;  4GLV B;  1LYL A;  3I55 A;  4B3S L;  2ASB A;  3I4M G;  3HOW G;  4JYA Q;  1V1Q A;  1KRS A;  1MIU A;  2BA1 A;  3CAM A;  2KEN A;  3L2P A;  1QVG A;  3TRZ A;  3BU2 A;  1X9N A;  1WCM G;  5GQO A;  2EIF A;  2Q2T A;  4DR2 L;  2JA7 H;  2RF4 A;  3PUY A;  3OTO Q;  3PIO A;  3HOX H;  2IHF A;  3KDF A;  1PVO A;  1EUJ A;  3JAM c;  2MFI A;  4JI7 Q;  3LGJ A;  2K5V A;  5M3F H;  2KHJ A;  4YHH L;  4QIW E;  4A3E G;  3U50 C;  1VQP A;  1OTC A;  2HT1 A;  4DR6 L;  2K50 A;  2E2H H;  5LMN L;  5C4J H;  4DR3 L;  2CQO A;  4IPH A;  1IXR A;  4B3T Q;  4UP8 A;  1Y14 B;  3K8A A;  1TWF H;  1EFW A;  3CC4 A;  2NVX H;  2K52 A;  2NVY H;  2XGT A;  4DV2 Q;  5K36 G;  1TWH H;  2R93 G;  2VZA A;  4TQU S;  1EYG A;  1WFQ A;  2I0Q A;  1XPR A;  1JMC A;  4DR1 L;  1D8L A;  3KF6 A;  4A93 H;  4JI1 Q;  2EXD A;  1K83 H;  1KQS A;  5AJ3 L;  1UWV A;  1NTG A;  3D0F A;  3PGZ A;  3W1B A;  4HIM A;  4MTN A;  4LUZ A;  3A5U A;  4DV5 Q;  1K9M C;  3PO2 H;  3E0E A;  1EIF A;  3F8T A;  4X62 Q;  4DV0 Q;  2NZH A;  4OO1 G;  2JK8 A;  4JG2 A;  1JJC B;  2PQA B;  2HHH L;  4JI8 Q;  2UUA L;  3HOZ H;  1CSP A;  5IYD H;  2QEX A;  3PO3 H;  3S1M H;  4GLX A;  3CC7 A;  5H1S E;  2JA5 G;  4GKK Q;  1M90 C;  1SMX A;  3CPF A;  4DV1 Q;  3UDG A;  3FKI H;  3IRB A;  2B63 H;  2UU9 L;  2OTJ A;  4HJA A;  1IBM Q;  4IOA A;  2IHE A;  4LFC Q;  4R4I A;  5JJL A;  4JBW A;  4BA1 I;  1IBL L;  1TXY A;  1QUQ B;  1TWG H;  2K14 A;  1I5F A;  3E9H A;  2MNA A;  1P16 A;  3RLN A;  1HJP A;  1PH2 A;  1HZ9 A;  1X3G A;  3UE1 A;  1N32 Q;  3RLO A;  4LNQ A;  1VQD A;  4A3G G;  4OON A;  4OX9 L;  4DAM A;  3T1Y Q;  4JI6 Q;  1X6O A;  1VQ9 A;  4IFD J;  4EX5 A;  3UDF A;  2UXB Q;  4AH6 A;  2XTI A;  4GNX A;  2JA6 H;  4C3I H;  4NB3 A;  3K81 C;  5M5Y H;  5HGQ A;  4GN5 A;  2H5X A;  4JI0 L;  4BXX H;  2L15 A;  1IBK Q;  3M4O H;  3HKS A;  3M3Y H;  2MO0 A;  1BKB A;  1SR3 A;  5FJ8 H;  3G71 A;  1U5K A;  3CC2 A;  3CCL A;  5IP7 H;  4LF9 L;  2UXD L;  1YHA A;  4K0K L;  3PUX A;  1Y1V G;  1VQC A;  2R7Z G;  1Z47 A;  4YY3 L;  4P72 A;  1EIY B;  4B3R L;  4J15 A;  4B3S Q;  5BR8 L;  2PQA A;  4A3J H;  2JE6 I;  2OQ0 A;  4AQY L;  4DV4 L;  1XMO Q;  5JEA G;  4X6A H;  1X54 A;  1YHB A;  4LFA Q;  2CWP A;  1Y1W G;  3UDI A;  1CKN B;  4Y7N H;  3HOY H;  1YJW A;  4A3E H;  4IFD G;  1PH9 A;  1CSQ A;  2YTX A;  3KOJ A;  3UDX A;  1LM0 A;  3KJO A;  4XIG S;  1E22 A;  1ASY A;  2D0O A;  4A3L H;  3CCM A;  5LMU L;  3OYY A;  3GTL H;  3RN2 A;  5GRO A;  4YHH Q;  4BBS H;  2VS1 A;  4X64 L;  3RNU A;  1N33 L;  1SLJ A;  3I4N H;  3NEM A;  5LMN Q;  4DR3 Q;  1V9P A;  4O0A A;  3S15 H;  4PZ8 A;  1Z9F A;  1PV4 A;  4DR4 L;  1BVS A;  4JBJ A;  4IJL A;  2DUD A;  3GTO H;  1QVF A;  1XNQ L;  4A3B G;  3FHW A;  2C35 B;  3MEF A;  3S1R H;  1VQ5 A;  4DR1 Q;  2PNH A;  1L1O B;  1E7Z A;  2K4K A;  4NXN L;  1HNW Q;  3J81 i;  4DK3 C;  3F2C A;  4BBR G;  2ZM6 L;  1N36 L;  1V43 A;  3S2H H;  3GTP H;  3AFQ A;  4MZ9 A;  3CF5 A;  4DV3 L;  4JV5 Q;  1Q81 C;  4LF5 L;  2A1A A;  1PYS B;  2UUB Q;  4HJ7 A;  3CXC A;  2ZJR A;  2UUA Q;  1KXL A;  3RZO H;  1Q46 A;  3GTK H;  1E3P A;  1JE5 A;  5M3M H;  1PH4 A;  1HNX L;  1GKH A;  5C0X I;  1VQO A;  5C3E H;  4R4O A;  3K0X A;  4KI0 A;  3A74 A;  4UPA A;  4LF7 L;  4QJF A;  3CQZ H;  1E24 A;  2N8N A;  1XJV A;  1XPU A;  2F4V L;  5IY0 A;  3TS0 A;  1K8G A;  2VL6 A;  2NVT H;  4GKJ Q;  4A3C H;  2LSS A;  2I5M X;  4L5T A;  2Z6K C;  2R92 G;  3G4S A;  4JI2 L;  2OCE A;  5IP9 H;  1BBU A;  3HOU G;  4C3J H;  1A63 A;  1N32 L;  2VUM G;  1HNZ L;  3B6Y A;  2N49 A;  1NE3 A;  4GN4 B;  4X66 L;  1S40 A;  2AMC B;  4IPD A;  2YU9 H;  2N78 A;  3S16 H;  4DR7 Q;  3H0G H;  4BY1 G;  3T1H L;  3PSI A;  1CUK A;  4LWC A;  4DKA C;  1K0R A;  4OX9 Q;  2UXC L;  1CKO A;  3HFZ B;  2YTV A;  4FDB A;  3CME A;  4JI4 L;  4UP9 A;  3GO5 A;  4DV7 L;  1PA6 A;  2Q2I A;  4BY7 G;  1N8R C;  4QL5 A;  1O7I A;  4JI3 Q;  1FJG L;  1VQ6 A;  4A3D G;  3PV0 A;  1VQ4 A;  1IL2 A;  4NXM L;  4YWM A;  2CFM A;  1XPO A;  1XMQ L;  5ELO A;  4JI0 Q;  2MO1 A;  3EIV A;  4JCV E;  3RN5 A;  1HR0 L;  2ZJQ A;  1N34 Q;  3CCQ A;  1NMF A;  1A0I A;  1VQA A;  3TRE A;  4DR5 L;  2UXD Q;  3HOV G;  1X65 A;  1YNX A;  4RMF A;  4K0K Q;  2VQF L;  4AYB G;  2BA0 A;  1VQL A;  1VQF A;  3A5Z B;  2NN6 I;  3M4Q A;  3CMA A;  4YY3 Q;  1VQI A;  4B3R Q;  1NJI C;  4LF4 L;  3PCO B;  4GS3 A;  4L5Q A;  1P8L A;  5BR8 Q;  5FLX c;  4A3F H;  2A8V A;  4AQY Q;  2JEA I;  4DV4 Q;  3BZK A;  4PMW A;  3I2Z A;  5IYB G;  2B29 A;  2GN5 A;  4R4C A;  2JA8 H;  2WP8 J;  4OWT B;  1VQ7 A;  4B3M L;  3DM3 A;  5C44 G;  4A3M G;  1VQM A;  4P73 A;  1NY4 A;  1Q1E A;  4QY7 A;  3OW2 A;  3TQY A;  5GAG C;  2OQK A;  2LXJ A;  5IWA L;  1NMG A;  1D7Q A;  2V1C C;  1N33 Q;  1VQK A;  4LF8 L;  3H3V I;  1VQB A;  2YYZ A;  2Y0S G;  3CCJ A;  1OXX K;  5IYC H;  1Q82 C;  2KCM A;  2OWO A;  4DR4 Q;  4JYA L;  4HJ9 A;  1SRO A;  2AHO B;  2HIV A;  1I6H H;  2JA9 A;  2AKW B;  4R4T A;  2K5N A;  3GTQ H;  2OTL A;  3L0O A;  4C2M H;  5FLM G;  4ALP A;  4JC0 A;  1XNQ Q;  2B3G A;  3OTO L;  4LF6 L;  1AE2 A;  3ULJ A;  1K73 C;  4NXN Q;  4LFB Q;  2ZTD A;  1TWA H;  4GOP B;  3U58 A;  1YI2 A;  3JAM i;  3HOW H;  2Q2H A;  4QGU A;  4A3K H;  1YIT A;  3I4M H;  2N3S A;  4JI7 L;  3TEH B;  1X3F A;  2JA7 G;  1NBW A;  1PH7 A;  1ASZ A;  2ATW A;  3HOX G;  1UE7 A;  4OO1 I;  2KCT A;  1WCM H;  1PH5 A;  1G51 A;  2D62 A;  1W3S A;  3ER0 A;  3F1Z A;  3SGI A;  3J80 c;  1Q8K A;  4DV6 Q;  1HNX Q;  4B3T L;  2GVA A;  3I4O A;  4AYB E;  3AQQ A;  5GAE C;  1WJJ A;  3NBH B;  3CCS A;  1J5E L;  5M3F G;  1UE5 A;  2R7F A;  4R4Q A;  4LUO A;  4C3H H;  1L1O C;  1UEB A;  1B70 B;  2ZTE A;  5J3B A;  3F2B A;  4DR2 Q;  1DGS A;  2F4V Q;  3HOU H;  1HH2 P;  1I3Q H;  2R7D A;  1EQR A;  4P74 A;  1I94 L;  1JJG A;  1YJ9 A;  4BA2 I;  3CCV A;  4YWL A;  1KHI A;  1QUQ A;  3G6E A;  1Q86 C;  1XTD A;  4IPG A;  2AWN A;  3J7A 5;  4JI8 L;  1YVC A;  3CPW A;  4KHP L;  2ES2 A;  2BH2 A;  4DR6 Q;  4A93 G;  4X66 Q;  2R93 H;  1VQN A;  2Z0S A;  2K75 A;  2JJQ A;  3S14 H;  3PO2 G;  1JT8 A;  3T1H Q;  3GTJ H;  2UXC Q;  2VY3 A;  2NVQ H;  1UE1 A;  1QZG A;  2YV5 A;  3HOZ G;  4JI4 Q;  3EN2 A;  2Y0S E;  2IX1 A;  1IBM L;  4PZ7 A;  4TVA B;  3KDF B;  1FJG Q;  2CKZ B;  3KF8 B;  1OXT A;  5E7N A;  4DAY B;  4X65 L;  3KJP A;  1E1T A;  3FKI G;  3GTG H;  4NXM Q;  1PFS A;  3BZC A;  5AJ3 Q;  4LF5 Q;  2B63 G;  1HR0 Q;  4DUZ L;  2JA5 H;  1PYB A;  2VW9 A;  3ZJY C;  4DR5 Q;  4UY8 C;  2YTY A;  2HHH Q;  1JJ2 A;  3H15 A;  1VS0 A;  1S3O A;  4P75 A;  3RLF A;  2VQF Q;  2RHQ B;  3E9I A;  4YWK A;  3W5O A;  3CW2 C;  3I56 A;  4LW1 A;  4L5S A;  1GVP A;  1KL9 A;  2VQE L;  4JBK A;  4LF4 Q;  4JI6 L;  3BJU A;  2R6G A;  1M1K C;  2HQL A;  1YBY A;  3GD7 A;  3KF6 B;  2UU9 Q;  3MXN B;  5GAH C;  3J7Z C;  4MNO A;  3CCE A;  1Q1B A;  3CP0 A;  1TWC H;  1IBL Q;  4PZ6 A;  4DPG A;  4B3M Q;  1GM5 A;  2GVB A;  1VQG A;  3AEV A;  1SE8 A;  4HJ5 A;  1H95 A;  1T9H A;  3PUZ A;  4GLA C;  4EQ5 A;  3PF5 A;  1VQJ A;  4IJH A;  1KIX A;  4IFD I;  4A3G H;  1CKN A;  2JA6 G;  2MQH A;  1VQE A;  5IWA Q;  4GNX C;  5EAY A;  2IX0 A;  2LXK A;  2UUC L;  1B7Y B;  4KLK A;  4BXX G;  4LF8 Q;  1WOC A;  1CKM A;  4DUY L;  2FXQ A;  3RR5 A;  2I5H A;  4QQB X;  5FJ8 G;  3EBE A;  3L7Z C;  5IP7 G;  3F2D A;  1YJN A;  1XMO L;  1GO3 E;  2F52 A;  4YCV A;  3M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...