3ZJYC

Crystal structure of importin 13 - rangtp - eif1a complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
74
Chain Sequence
FKEDGQEYAQVIKMLGNGRLEAMCFDRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNRSLKAYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Nuclear Export Activity of Importin13.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords GTP-BINDING NUCLEAR PROTEIN RAN
total genus 12
structure length 74
sequence length 81
ec nomenclature
pdb deposition date 2013-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3zjyC00
3RNUA 3HOVG 2IX0A 1VQMA 1U5KA 1MJEA 1CKNB 3CMAA 1YHAA 3PO2G 1GO3E 2UUAL 4UPAA 4APVA 4BXXH 1X56A 4A3EH 1L1OB 1N36L 1VQAA 1TWHH 4A3MH 1HH2P 3UDGA 4JI2L 4LF9L 1XMQL 5AJ3Q 1HNXQ 3GTQH 1KXLA 4O0AA 1NMGA 2ES2A 1VQOA 4QL5A 3HKZG 4HJ5A 4JI6Q 5GADC 4JI8L 5GAEC 4LFCL 3G48A 3ER0A 4LF5L 4OX9Q 2VNUD 2F3IA 2EXDA 3STBD 1GD7A 4XTCS 5ELOA 4Y52H 3E9HA 4AIMA 2NZHA 2YYZA 1FJGQ 3TRZA 1ASZA 2RCNA 4K0KQ 3HOZG 2WAQG 1M90C 1K8GA 1C9OA 4HJAA 4GLAC 1VQFA 3SGIA 2BH2A 4Y7NH 1CSPA 4JBWA 4DV0Q 2JA6H 2UUCL 4DR5Q 3K80C 4ALPA 3I56A 3CC7A 3GD7A 3PF5A 4A3CH 3J81c 1BBUA 1YIJA 1NBWA 4PMWA 4OWXB 3CC4A 2K5HA 2ZM6L 3GTKH 3K7AH 1N9WA 4GLXA 1FVIA 1Q8KA 1X3GA 4JI1L 1VQHA 4J15A 4KI0A 1PH1A 1G6PA 4WJ3M 3CD6A 1J5EQ 2Q2IA 1WI5A 1VQNA 2YV5A 1TWGH 4LNQA 2R93G 2MQHA 5C4XG 3L0OA 4MTNA 3E0EA 4NXNL 1YJWA 5IY0A 4LFBL 1X3FA 4A76A 1JJCB 3CMEA 3K81C 4GNXC 4OXPA 3NENA 5C3EG 1EQRA 2K14A 3JC66 3GTPH 2VQFL 1YI2A 4DK3C 3NBHB 4DUYQ 1EFWA 3HOYG 2JJQA 4LF6L 4A3JH 3A74A 3UE0A 2LXKA 3S2DH 1PH2A 1VQLA 3GTMH 4A3JG 2VUMH 4LFBQ 3MEFA 1YITA 4OONA 1I6HH 1VQCA 4QGUA 1N32L 4X6AH 1N8RC 1E7ZA 1SLJA 3J80c 1OTCA 3CCVA 1EIFA 4UP8A 4JI0Q 1Q12A 2PI2A 4YCWA 2FXQA 2OQKA 4JI3L 3HKSA 1MIUA 2AWOA 3PSIA 1A63A 4X64L 2KENA 2KHIA 2PI2E 3CP0A 4JI1Q 3UDXA 4JI0L 1BKBA 1L2FA 1V9PA 4LF4L 4POFA 1L1OC 2I5HA 4HJ9A 2A19A 2JEBI 3DM3A 1VQ6A 2VY3A 3AFQA 4DV3L 1PH9A 2UXCQ 2B3GA 1LM0A 4X66L 3AFPA 4UP9A 4X62Q 1Q1BA 2NVXH 2HHHQ 2AHOB 4GNXB 2UUCQ 1LYLA 4DV7L 3AYHB 3PCOB 5HGQA 1XMOL 4QY7A 1O7IA 2ZTDA 4IPDA 3HOZH 1VQPA 3FHWA 4A93H 2ASBA 1D7QA 2XGTA 3G4SA 1K8AC 1KD1C 4DR4Q 2NN6G 2Z0SA 3PF4A 2WP8J 3KFUA 1IBML 4TQUS 3FKIH 3CW2C 4LUOA 5LMUL 3W1BA 4DR1Q 4XIGS 4DR6Q 2N8NA 4AYBE 5IWAQ 1B7YB 5JJIA 4R4TA 1SFOH 2ATWA 1XTDA 4R4QA 1C0AA 2DGYA 4IJHA 5FLMG 5C44G 4A3KG 2Q2HA 3UDIA 1EYGA 4AYBG 2YU9H 3CCJA 2ZM6Q 4BY1G 1TXYA 3PUYA 5EAYA 3ZJYC 1S40A 2I0QA 5M5WH 4DKAC 1QZGA 1OXXK 4DAYB 4X62L 2F4VL 3OW2A 5H1SE 2QGQA 1SROA 3EIVA 4JBJA 4OWWB 3CC2A 1YZ6A 1T9HA 3HFZB 3PUVA 2N3SA 4DNIA 3A5UA 2B29A 2A8VA 2QEXA 1JJ2A 2EQSA 2R7DA 3ICEA 1UWVA 1PH6A 4DR7Q 2PQAB 3W5OA 1J5EL 1E1TA 4NB3A 4R4OA 4A3FH 4JI5Q 4DR4L 3KLWA 1I3QH 1QZHA 2R7ZH 4IO9A 1XMQQ 1HNXL 2CCZA 4KHZA 1OXSC 5ELNA 3PV0A 1XMOQ 4POGA 3FKIG 4GLVB 4A93G 3BZKA 1Z9FA 1PA6A 4GOPC 4R1JA 4YWMA 1KHIA 1XJVA 1Q86C 2VUMG 4BBSH 1Y1VG 4PG3A 3HOXG 2E2JH 2Z6KC 1L0WA 3RLFA 2F52A 4LF9Q 2Q2TA 4OO1I 1P16A 2L15A 1E24A 1A62A 3RZOH 3S16H 5M3FH 1KL9A 4A3CG 2DUDA 5M3MH 4YWKA 3GTJH 3CXCA 1EWIA 3HOVH 4DV1L 1CUKA 3CPWA 3S2HH 5C44H 2E8GA 1HNWL 3PO2H 3PIPA 5JJLA 2AKWB 3PIOA 4B3ML 2B63G 1R9TH 3J80i 4A3BH 1VQGA 4DUZL 5JEAJ 3M7NA 4GKKQ 1Y1WH 1VCIA 1WYDA 3GO5A 4A4IA 3CF5A 4DR7L 1YEZA 1CSQA 1EOVA 2I5MX 3BZCA 3CCSA 4GOPA 1P8LA 1HR0L 4A3FG 4YCUA 3HKZE 1B70B 2Y0SG 3BJUA 5IP7H 4JI2Q 2D0OA 4IOCA 2IX1A 5AJ3L 4JOIC 1YJNA 1RL2A 2I5LX 3H15A 1SN8A 2NVQH 1JMCA 1KIXA 4B3MQ 1PHJA 5LMNW 1QVFA 2H5XA 1WCMG 4X65L 3S1RH 2OQ0A 4LF6Q 3PUWA 2Y0SE 3G71A 3HOUH 3S14H 5E7NA 1JJGA 2HIXA 1HJPA 2JK8A 3HOYH 3PO3H 3MXNB 1XNRL 3HOUG 1I5FA 3I4OA 4IPCA 1TWCH 3TEHB 1B8AA 4QJFA 4DR2Q 3I4MG 2JA6G 2Z6KA 1E22A 1G291 4BBRG 3I4NH 1PV4A 3I4MH 4JI7L 4JYAQ 2OTJA 4DV5Q 1K73C 1X54A 2MNAA 2RHQB 1VQBA 5LMUQ 4DR6L 1V43A 5FLMH 1D8LA 1NMFA 3ULJA 3CQZH 3CAMA 3KF6B 4LFAQ 3UE1A 4X65Q 4O2DA 1WJJA 2E5LQ 4B3SQ 4B3RQ 4PZ7A 5GAGC 3D0FA 3S1MH 3S1QH 3TQYA 2IY5B 5K36G 4OWTB 1LTLA 3CCRA 3L2PA 2N49A 3Q8DA 5JEAG 1WOCA 2JA8G 4LF5Q 2LSSA 4P75A 2QA4A 3ULPA 4JI4Q 2BA1A 3H0GG 4BXXG 4IPHA 3A5ZB 2K75A 1HR0W 4IPGA 1KQSA 3B6YA 1YVCA 4JOIA 1IBKQ 4P72A 4UP7A 3T1YL 4QIWE 3M3YH 1H95A 1BVSA 1CKOA 1SRUA 1HZCA 2F4VQ 2A1AA 3KOJA 1KRTA 1WCMH 5LMNQ 4YHHQ 1Q82C 4BBRH 3F1ZA 3I4NG 1RIPA 1JE5A 1PH7A 1A8VA 1L1OA 3I55A 4P73A 3RN5A 4A3IH 3HOWG 5IYDG 5FLXc 3CCLA 4IFDJ 1VQJA 3J81i 3TREA 2R92G 4JI5L 2BA0A 5IWAL 2ID0A 4GN4B 4LFCQ 4JBKA 4OX9L 3LGJA 2C35B 5HY6A 3J81j 1IBLQ 1K83H 3PGZA 1K9MC 4IJLA 1VQ5A 1WFQA 1TWFH 1UE5A 3JAMc 3KJOA 2UUBL 1X55A 1N36Q 1I94L 2UU9Q 2E5LL 5GAHC 3F8TA 4A3LG 1HNWQ 1YBYA 4DR2L 3PUXA 1AE2A 3H3VH 1XPUA 4JG2A 3AEVA 1E1OA 3S15H 1HZ9A 4EQ5A 2YTXA 3RLNA 4DR3Q 4LUVA 4LF7Q 4A3EG 3RN2A 4NXML 4JI7Q 3K8AA 4DV1Q 3F2CA 3S24A 1Q7YC 4JC0A 3F2BA 1XPOA 4JBMA 2D62A 3H0GH 4DV2L 2ZJQA 1K0RA 1X3EA 1HNZQ 2CKZB 2JA9A 3GTGH 3KF6A 3TS2A 3BU2A 2CQOA 1M1KC 1I50H 1C7YA 4LF4Q 1PVOA 3PUZA 2RF4A 5IYBG 4B3TQ 4KHPQ 1KAWA 1A0IA 4NXNQ 1AE3A 1QUQB 1PH3A 3U4VA 3S1NH 2LXJA 4A3DG 2CWPA 2R7ZG 1Y14B 1VQKA 3T1HL 3RLOA 5GQOA 2JEAI 1FJGL 2HT1A 4DV4L 1TWAH 4B3SL 3K7UC 2K5VA 4R4CA 4LFAL 1Q81C 1IBLL 2JA7H 4DV7Q 2ZJRA 4B3RL 4MZ9A 1IYJB 4HIDA 1VQ7A 3OYYA 2V1CC 5DLQE 2EIFA 3ULLA 1JB7A 3JAMi 2E2HH 1X6OA 2R92H 2UXDQ 1VQ9A 4HJ7A 2RHSB 3M4OH 2VQEQ 2K50A 3KDFB 1X9NA 4A75A 1N34L 4X66Q 4A3LH 2KCTA 2UXBQ 1U0LA 4DUYL 4L5RC 2WFWA 1Z47A 4DR3L 1S3OA 3G6EA 1FL0A 1MKHA 1I94Q 4DV6Q 1NTGA 2UU9L 3S17H 2YTYA 2HIVA 1N34Q 3CCUA 2IHEA 2MO0A 4A3KH 2HQLA 3L7ZC 4PZ8A 3I2ZA 4C3IH 5C0XI 2JA8H 3J7A5 3DLLA 2AWNA 4FDBA 4JV5Q 1Y1WG 2R93H 4BY1H 1HZAA 2UXDL 4MNOA 2GVBA 2JA5G 1W2BA 4A3GG 3AQQA 1HZBA 1YHBA 3M4QA 5GROA 2N78A 1CKNA 3VDYA 1Q1EA 1NJIC 4JV5L 4YWLA 1W3SA 5IYBH 4JYAL 3M9BA 4NPSA 2MFIA 5BR8L 2IHFA 4A3DH 5M5YH 2NZOA 1PH4A 2KBNA 1IL2A 2VS1A 2WB1E 4YHHL 4YCVA 5C0XJ 2PMZE 1J6QA 4GOPB 1YHQA 4WJ4A 1VQ4A 3W1GA 2VQEL 3T1YQ 1PH5A 4DV5L 5IYCH 1E3PA 2K52A 1DGSA 4LUZA 3CCMA 4L5QA 4DV0L 2HHHL 4RG1A 1FGUA 2VL6A 4JCVE 2R7FA 1UE1A 4KLKA 5M3MG 4DR5L 1VS0A 4BBSG 2OWOA 1OXTA 3CPFA 1KRSA 4LF7L 3H3VI 2WB1G 4LWCA 2MO1A 4IOAA 3NELA 4JI4L 5C0XG 3M85A 5M3FG 3T1HQ 5JJKA 2UUBQ 1CKMA 4DV4Q 1OXVA 4HJ8A 1SE8A 4P74A 1KC8C 4JI3Q 3WWVA 2KHJA 2NN6I 1SR3A 4GS3A 5IP9H 4TVAB 4X64Q 4AQYL 3OTOL 3U4ZA 1EUJA 2ZJPA 4LF8L 4A3GH 3EN2A 5C4XH 5J3BA 1MJCA 5IP9G 4A3MG 4HIMA 1Q46A 4C3JH 1N32Q 1PFSA 1V1QA 3TS0A 1NE3A 4BA1I 4A3BG 4ME3A 3D31A 4JI8Q 2JA5H 1XNQQ 2YTVA 1SMXA 3A0JA 1YJ9A 4OO1G 4GKKL 4DPGA 2D0PA 1IXRA 1VQEA 1YNXA 2GVAA 3IRBA 4HIOA 3GTLH 4NXMQ 4LW1A 2NVTH 1QVCA 2PQAA 5FJ8G 1X65A 3E9IA 1LUZA 4HIKA 1S72A 5IYCG 3I7FA 4YY3Q 5FJ8H 2UXBL 1Y1VH 3HOXH 3U58A 4L5TA 3KJPA 1IBKL 2UXCL 2BH8A 5IT9c 1N33L 4C2MH 3KF8B 4P71A 5IE8A 1AH9A 4BY7G 1NY4A 4L5SA 4GN5A 2AMCB 4DR1L 1JT8A 4GNXA 4H02A 4K0KL 4JI6L 2PNHA 3KDFA 3NEMA 4LF8Q 1N33Q 4AH6A 2JE6I 2R6GA 2JQOA 2OCEA 2XTIA 4DUZQ 3J7ZC 2NVYH 2E2IH 1G51A 2B63H 4DAMA 4IFDI 4YY3L 4R4IA 4EX5A 3M4PA 5LMNL 3RZDH 4B3TL 4KHPL 4C3HH 2KCMA 3EBEA 5M5XH 2VW9A 2CFMA 4DV6L 2OTLA 1PH8A 1XNRQ 2VQFQ 1BBWA 1PYSB 1GVPA 2GN5A 3CCQA 4DV2Q 3UDFA 4PZ6A 1IZ6A 1GKHA 2ZTEA 4DK6C 4DV3Q 1QUQA 1PYBA 1XNQL 3STBC 1K3RA 1EQQA 3F2DA 1VQ8A 5C3EH 3FP9A 5IP7G 3GDEA 3PO3G 4BA2I 1XPRA 1UEBA 5C4JH 3ERSX 4GKJQ 1EIYB 4AQYQ 1QVGA 2Q2UA 3OTOQ 4UY8C 5BR8Q 1VQDA 3KYHC 2WAQE 2K5NA 1VQIA 2ALYB 1UE6A 4A3IG 5IYDH 2JA7G 2CWAA 2VZAA 4GKJL 1HR0Q 4QQBX 1UE7A 1OXUA 1ASYA 1IBMQ 4BY7H 3CCEA 2K4KA 2ZTCA 4IFDG 3RR5A 1HNZL 1GM5A 3HOWH 2IT1A 3K0XA 4RMFA 2UUAQ 3U50C 3GTOH 4GN3B
chains in the Genus database with same CATH superfamily
1VF7A 3HOVG 5EJWA 2M00A 3E5SA 4K2LA 4APVA 1X56A 1N36L 1HH2P 3UDGA 1RJTA 2X6LA 1QG7A 4EQNA 5JPMC 4O0AA 1PTOB 1QOHA 3ND8A 4HJ5A 1SXTA 4R8NA 4JI8L 4LFCL 4LF5L 3HKZB 3NBHA 2EXDA 3STBD 5KYLA 1Q8IA 5ELOA 4QCLA 3E9HA 4JW0A 3I3CA 2DNCA 4FO2A 4K0KQ 3WDNA 2WAQG 1V8QA 2ZT9C 4KMUC 1II3A 5I9OA 4C1NI 2MHVA 5EQ0A 4JBWA 4DV0Q 5CBAE 4DR5Q 5J22A 3PF5A 1EYCA 2JA6B 1SYDA 1YIJA 1TS5A 4PMWA 4OWXB 4X3UA 3SK8A 2WACA 1SYEA 3K7AH 4KI0A 1WI5A 4WORA 5EPKA 1VQNA 2DJGC 2R93G 4HTHA 4HSVA 1GHJA 1XYIA 5IY0A 4A76A 1JJCB 5I2YA 4OEMB 3K81C 3NSWA 2NYZD 1ENCA 4C3JB 3S2DB 5EPLA 1D5ZC 3GTPH 1YI2A 4DK3C 3GP7A 1EFWA 4XDXA 1TWCB 4ZRZA 4LF6L 2O5IC 4RAUC 3A74A 3UE0A 1PH2A 1VQLA 3GTMH 1VMPA 2R61A 4PQXA 4OONA 1N8RC 1OTCA 4QUCA 2J0TD 4JI0Q 1Q12A 2PI2A 5BN4A 1MBYA 2OQKA 1MIUA 2AWOA 3SHLA 3BVZA 4X64L 2KHIA 3IL8A 1U9RA 5C0XH 1BBXC 1WD1A 1FNVA 1BKBA 1L2FA 1V9PA 3OSOA 1VQ6A 1EYAA 2AUKA 2NVXH 3GTOH 2HHHQ 3J7AF 4GNXB 3S15B 4J1MA 2OT2A 1QNKA 1LYLA 3I73A 1WTQA 3AYHB 2N55A 1RDPD 1VQPA 4OGQC 2EDGA 1KNAA 3G4SA 1K8AC 5KIXA 4HCEA 4DR4Q 1KDBA 2Z0SA 3D6CA 1WVLA 1IBML 3TMEA 5LL6S 3EROA 3W1BA 2N8NA 4AYBE 4R4TA 1JC7A 4DNTB 4IJHA 1MD2D 4MTKA 2Q2HA 1HFGA 3T53B 4AYBG 4CDFC 2VB2X 4RGMA 3VA5A 1STAA 1H9RA 4C3JG 1ICWA 4BWGB 1SNQA 2A74C 2XN9C 4OO1H 1SROA 1JE4A 4ZCKA 1WTPA 3A5UA 1Z6HA 2QEXA 2EQSA 2R7DA 3D3RA 1J5EL 4DR4L 3S1QB 2K5QA 2R7ZH 2B2YA 4IO9A 1XMQQ 1HNXL 4A93G 3PV0A 2HQEA 4RHSA 1Z9FA 1O78A 4ZLTF 4BBSH 4N9PA 3HOXG 1BUVT 1E24A 4KJOA 4A3CG 1EWIA 1CUKA 3S2HH 1NSNS 2E8GA 1V1PA 1KAAA 3PIOA 1PFNA 2B2UC 1R4QB 4IQZA 3FDTA 1B1ZA 4OL7A 3J80i 4A3BH 5FO7B 2DY7A 1DD2A 1EOVA 3CCSA 1P8LA 1NUCA 2QCPX 3M4OB 3HKZE 1B70B 2Y0SG 1CM9A 2D0OA 4JOIC 2B2YC 2NTSA 1JMCA 1H9SB 2QEJC 2CW0C 2F0MA 1KIXA 2H5XA 4LF6Q 1XNRL 4IPCA 1ZEQX 1E22A 1J9OA 1G291 4BBRG 4JI7L 3H09A 4DV5Q 1X54A 2EYMA 1GUNA 1EY6A 1VQBA 4KD4A 1V43A 1GUOA 1D8LA 1NMFA 2FINB 2KECA 4IUVA 3ULJA 3O13A 2HCCA 4C3HG 4O2DA 4B3RQ 1LTGD 2EYOA 4PZ7A 1LTLA 1RCVD 3Q8DA 5JEAG 2JA8G 3I90A 2R92B 2BA1A 1SJHD 1EIGA 3A5ZB 1HR0W 3IAYA 3MC0B 4IPGA 1KQSA 1YVCA 4UP7A 4A3JB 3T1YL 3I4NB 3M3YH 2A1AA 3KOJA 4BBRH 3D4RA 1A8VA 3I55A 4J6HA 1STHA 3AB9A 4A3IH 5C3EB 3HOWG 5IYDG 3CCLA 4IFDJ 2EY6A 3J81i 2FHTA 3TREA 2R92G 4GN4B 4OX9L 4JBKA 3LGJA 3J81j 1TS3A 3OWEB 1VQ5A 2PPBC 1WFQA 3JAMc 1EL0A 2E5LL 5GAHC 1B9MA 2XWBB 2EYLA 4UHVA 3PO2B 4IUUA 2YTXA 4LF7Q 4A3EG 3F2CA 1XPOA 2ZJQA 1K0RA 2F0DA 1HNZQ 2JA9A 3SK4A 1I50H 2SEBD 3GTMB 4XYQA 1PVOA 1I4QA 2EYHA 1K28A 3T13A 3VYSA 4NXNQ 1PH3A 3S1NH 2CWPA 2XRQD 2F0NA 5KYIA 2PZWA 3T1HL 3RLOA 2JEAI 1EQTA 4HCSA 3BYTB 3K7UC 5KRUA 4R4CA 4RGTA 4A3FB 3MXNA 5FOBB 1F9QA 2EIFA 3ULLA 1JB7A 1X6OA 4OHJA 2R92H 1VQ9A 2NZ1D 2VQEQ 3KDFB 1TY0A 3OPOA 2UXBQ 3G6EA 1S5FD 1FL0A 3S17H 4DV6Q 4A3KH 1EZ6A 2AWNA 1HPCA 1AN8A 1BDOA 3VR2A 4BY1H 1HZAA 2N88A 1PZKD 1GOZA 1W2BA 1VF5C 1MI2A 2EYFA 1WTVA 2L11A 3AQQA 1GUTA 2K28A 5GROA 2N78A 3MEHA 4DAVA 1EZ8A 3VDYA 5C4ZA 3M9BA 5D65A 1IYUA 5M5YH 3K58A 1PH4A 4S3SA 1E2VA 4YCVA 2PMZE 4GOPB 4WJ4A 2F0FA 4DA2A 1BCPC 1TIID 4DV5L 5IYCH 2K52A 3CCMA 2LS01 5LHY1 2VL6A 4JCVE 4DR5L 3FPPA 2B2TA 1VS0A 3TZUA 4FF1A 2WB1G 1EY0A 2QW7A 4JI4L 3DWPA 2C5CA 5M3FG 1U4LA 2VB3X 5JJKA 2F0SA 1CKMA 4DV4Q 1OXVA 4YIJA 2BDNA 1DZ1A 3WWVA 2WKCA 4TVAB 3NWSA 4A3GH 4CDDC 3PIP3 2PCFB 5I9PA 1PFSA 4BA1I 4OO1G 4BBSB 3DWAA 1SYCA 4DPGA 2D0PA 1JB3A 4IUQA 2C9OA 3E3XA 2EZVA 3URYA 3WOEA 4HIKA 5IYCG 3I7FA 4KV6A 1EY7A 5ELFA 4RGOS 4TSSA 4KKSA 1A2TA 5IT9c 1I4HA 4C2MH 1BCPB 1K8MA 4FXDA 2JXMB 4H0LC 4DN4M 1NY4A 1MHWC 2RSNA 1DXMA 1CT1D 3NEMA 4DUZQ 2JQOA 1SBBB 2PQEA 2B63H 3J80L 4DAMA 2PO4A 3VA7A 5LMNL 4B3TL 4KHPL 4DV6L 3EBEA 3TDQA 2NVXB 4KJNA 4KY7A 5M3MB 3CCQA 3UDFA 5C5LA 2ZTEA 3DHQA 1F2LA 5I4DA 1HRJA 3EJIA 1B2TA 1VQ8A 3GTQB 1CI3M 3FP9A 4OIJA 3D6WA 3PO3G 4BA2I 3ERSX 1EIYB 4DXFA 2Q2UA 5BR8Q 1VQDA 2K5NA 5IYDH 2KVMA 3QOJA 5M3FB 4O42A 1IBMQ 3A7AB 4V190 2ZTCA 3UI2A 3T16A 3W2DA 3A55A 1HNZL 4RMFA 1EOTA 3FMCA 3J81L 4GN3B 3RNUA 4KKUA 4QUFA 2A6ED 1PTOC 2B2VA 1LACA 4BXXH 1L1OB 1DOMA 1OO9B 1VQAA 1TWHH 4A3MH 5AJ3Q 3T4AC 3E6ZX 4I65A 2F0LA 2FJ2A 5ELEA 5GADC 2LY7A 4JI6Q 4OX9Q 3G48A 2VNUD 1HHVA 1T5XD 3QG1A 4Y52H 1TWGB 1HA5A 2RCNA 2Z6BA 3PO3B 1K8GA 1M90C 1C9OA 1TWFB 4HJAA 3K5OA 1VQFA 4Q0FA 4NP5A 1CQVA 2BH2A 2JA6H 1VMCA 4KY5A 4QMGA 3I56A 1HUNA 2PZTA 4A3CH 3KLSA 3WOFA 1BBUA 2JN4A 3K59A 3G7LA 3VR3A 2K5HA 2ZM6L 3GTKH 2KUMA 1N9WA 3AU7A 2K05A 2I46A 1Q8KA 4JI1L 2PNRC 3CD6A 3QR8A 2Y0SB 2YV5A 2E75C 4LNQA 5C4XG 3L0OA 1B53A 4MTNA 2IX3A 1RF2D 1DYQA 2L55A 4FYDA 2HCIA 1EQRA 2K14A 1EY5A 5J1ZA 2VQFL 3HGBA 3NBHB 1XTCD 2JJQA 3OIQA 2QKIC 2D2CC 1K3BC 2LXKA 4CKBA 2MUYA 4A3JG 2VUMH 1O7YA 3MEFA 1YITA 1TVXA 1ENFA 3J80c 2RBMA 4YCWA 3QIAA 3HKSA 2A68D 5LL6X 1S5BD 1A63A 2M2LA 2PI2E 1F9SA 3CRLC 1YNND 2Q8IB 2QF7A 3J7AV 3EQLC 1I4RA 1L1OC 1X32A 3DM3A 2UXCQ 3V05A 1S5CD 1SYGA 2RSOA 4X66L 2XVSA 1XWEA 2PZUA 2Z4IA 1TQOA 2O5JC 3PCOB 4DK0A 3IFTA 3M7GA 2O4XA 2F4IA 1KD1C 4PMBA 3D4DA 1A3VA 2WP8J 3KFUA 3PF4A 4TQUS 5T1IA 3CW2C 4LUOA 1PLFA 1I4XA 5IOCA 2ICIA 1KABA 2AQ2B 4DR1Q 4XIGS 3RMHA 2F0TA 3K57A 1C0AA 5FLMG 5C44G 5CV7A 4A3KG 2V4DA 3UDIA 1J8IA 3CCJA 2ZM6Q 1G2TA 2P5ZX 3PUYA 1S40A 5JEAH 3SDZA 1S5ED 2IPKD 5ELDA 3FEWX 5IODA 3PUVA 3HFZB 2N3SA 3DEPA 2A6HD 4DNIA 2B29A 4A3MB 1JJ2A 1PH6A 4LAAA 1SNOA 1E1TA 4NB3A 4JI5Q 4Z9CB 1I3QB 1I3QH 2Z4HA 3Q22A 1LTBD 1OXSC 5ELNA 1EIHA 3FKIG 3BZDB 1PA6A 2NVQB 3R3OA 1DONA 4KN4C 1YNJC 4R1JA 1XJVA 1KHIA 4DU9A 3QJYA 2JSOA 4XXEA 1DJRD 2Z6KC 3M4YA 1P16A 1A62A 5M3FH 1KL9A 5AFWA 4XT3B 5M3MH 3JAME 1RHPA 4YWKA 1GUWA 3CXCA 4DV1L 3CPWA 5C44H 1GJXA 3HEJA 3A56A 5JJLA 4B3ML 2B63G 4CDEC 2KEDA 4X3SA 1NR4A 5JEAJ 5IGFA 1Y1WH 1YEZA 1CSQA 4DAYA 1K83B 2ZXOA 4YCUA 2K32A 5IP7H 4JI2Q 1MSGA 1UAPA 4H13C 1PHJA 5LMNW 1QVFA 4X65L 3S1RH 2OQ0A 1SYFA 3P20A 5E7NA 2B63B 2HIXA 3MXNB 4MN3A 4DR2Q 1TKWB 2JA6G 2KCCA 4JYAQ 4ZKBB 1K73C 1ESRA 5FLXL 1DOKA 5C6AA 2MNAA 2RHQB 2F1MA 1JOKA 2VXWA 3LX0A 5CV8A 3CQZH 3KF6B 4X65Q 4A3GB 1HFNA 1WJJA 2A6EC 3OMCA 4OELB 2NB0A 1BCPF 4I7ZC 4M1UB 2IY5B 4OWTB 4CDCC 4IUNA 3L2PA 3HG9A 2LSSA 4P75A 2QA4A 4BXXG 2E2HB 3DUZA 2X6GA 1JQYD 4JOIA 4QIWE 4F88A 2EOTA 2F0OA 4J8QA 1SRUA 3F1ZA 4FXKC 3OMGA 1PH7A 1L1OA 3TN2A 4KD3A 4P73A 3K7AB 5FLXc 2XRSD 3OOCA 3I8ZA 1PFBA 2BA0A 4LFCQ 1PFMA 1NR2A 5HY6A 1K83H 3PGZA 1CFMA 5JOBA 4NMZA 3J81E 2J7ZA 2HDLA 3H91A 3KJOA 1X55A 1N36Q 3TP8A 3F8TA 1HNWQ 1FGBD 1YBYA 3H3VH 1XPUA 1E1OA 1F77A 1HZ9A 4EQ5A 3RLNA 4NXML 4DR3Q 4LUVA 2F0WA 5CR3A 5KNCA 4DV1Q 1Q7YC 2KQ3A 3H0GH 4TRDA 4K8JA 1Y8PB 4P2CB 4LF4Q 1PTOH 3PUZA 4B3TQ 4KHPQ 1F2YA 1PYWD 1WCMB 3U4VA 1ZXTA 1Y69U 2R7ZG 1VQKA 2F0VA 2HT1A 3EFXD 1TWAH 2F0KA 2K5VA 3S1MB 3H6MA 1Q81C 3A8KE 2ZJRA 1IYJB 3NP8A 4MHEA 5DLQE 3V96A 2GA4B 1TS4A 2L5TA 2RQXA 5JJZA 1RKNA 1N34L 2F0PA 2KCTA 4DUYL 2EJMA 5F2DA 2YTYA 3HOYB 3L7ZC 3K5NA 3J7A5 4G7HC 3DLLA 1IW7D 2R93H 1FR3A 3SK5A 4RH6A 4CHTB 1HZBA 4PV1C 1XX8A 3M4QA 1NJIC 5CYUA 1W3SA 2WV6D 4JPBW 3I72A 2MFIA 4A3DH 2CH4A 5M5XB 2F3VA 2B2WC 4YHHL 1YHQA 3W1GA 2EYPA 1E3PA 3VYUA 3K5LA 1DGSA 5I6YA 1CA5A 1FGUA 5M3MG 5ELCA 1UE1A 1DCZA 5CORA 5FKAC 4BBSG 4LF7L 1OXTA 1KRSA 4XQJA 2MO1A 2CHBD 4IOAA 5TSSA 1HUMA 1CA6A 1GUGA 2UUBQ 3HS0C 3BYYB 4JI3Q 1SE8A 5HURA 2K03A 4AQYL 1AH9A 2M9VA 2F0UA 3U4ZA 5CMDA 1QNUA 1XXGA 5J3BA 1MJCA 1GXDC 2XSCA 4A3MG 1N32Q 5DNFA 3TS0A 3R93A 5M9OA 4JI8Q 3A0JA 4RCOA 4GKKL 5E3FA 3NUCA 3G6JB 5DEHA 3IRBA 2HDMA 3J80E 1EY8A 4TKOB 1STEA 5FJ8H 2R3ZA 4ZK9B 2KCNA 3ONAB 3HOXH 4A93B 4L5TA 4ULLA 1N33L 4IN3A 4DR1L 2QDBA 1JT8A 3QO2A 1HTLD 3KDFA 3TSSA 2JE6I 2E2IH 2EY2A 3J7ZC 1G51A 4R4IA 2X69A 3RZDH 4C3HH 1SFOB 2CFMA 2OTLA 1SE3A 1XNRQ 4FF2A 1GVPA 3I4LA 3DWQA 4DK6C 2G9HD 1K3RA 3Q24A 3F2DA 1EQQA 1I6HB 1SAPA 4A3BB 1Y1VB 5IP7G 3GDEA 1XPRA 1UEBA 1ESFA 3A54A 2F0JA 1IHZA 1SSOA 3PMFA 4UY8C 2WAQE 1VQIA 5D14A 2JA7G 2CWAA 2VZAA 3MZ5A 1KLGD 4QQBX 1UE7A 3OW7A 4BY7H 1EWHA 3RR5A 3HOWH 1GM5A 3C3LA 3K0XA 3A8JE 1QE6A 4WJWA 2UUAQ 1TWHB 1SJED 1U5KA 1VQMA 1MJEA 1CKNB 3PO2G 3BDOA 4GZYC 5JAVA 3C2PA 1O7LA 1GHKA 4FNFA 3S9WA 3R2TA 4G7OC 1S5DD 4JI2L 3TP5A 1XMQL 1HNXQ 3GTQH 3MWYW 1NMGA 1EQVA 2CVRA 1K0SA 2F3IA 1GD7A 2EY5A 1ILQA 2Z8LA 4AIMA 2YYZA 3IKJA 1FJGQ 5D3DA 1AFPA 4L63B 1RTOA 3LWEA 3SGIA 4Y7NH 3KK7A 2IW3A 2UUCL 3K80C 4ALPA 3M3YB 5BN5A 3GD7A 4K8IA 5FLXE 2NTTA 1H9KA 3J81c 2K5WA 2ICEC 1U4PA 3R8BA 2B2VC 2OXPA 5CV5A 4GLXA 4XQNA 1FVIA 1X3GA 4J15A 4WJ3M 1PTOD 2Q2IA 4NW2A 2MQHA 3MA2B 4NXNL 2B2TC 2EVBA 1D2BA 3PIO3 1X3FA 2R93B 1QCBD 4GNXC 1T5EA 4OXPA 1SE2A 3NENA 4BBRB 4K5WA 2A69C 1X3QA 4DUYQ 4CJ2C 4O1NA 4A3JH 3S2DH 2MPMA 2RVLA 3MXGA 4N8FA 1I6HH 1VQCA 4QGUA 2HUGA 1E7ZA 3GV3A 1SLJA 3JAML 1EIFA 1TY2A 1TWAB 1STYA 2F0GA 2FXQA 1JOOA 3J7YW 2LFNA 2F03A 3PSIA 3BDLA 2KENA 1C4QA 3UDXA 4JI0L 2PW5A 5KNDA 1UUPA 3MHBA 2EY1A 3I91A 5KGUA 3AFQA 1KDCA 1B4OA 2BDOA 3ERQA 3VR5A 4UP9A 1Q1BA 2AHOB 4K5XA 5IIFA 2UUCQ 1UEAB 2WINB 1XMOL 1JWMD 2OTJA 4A93H 3HOZH 1JWSD 3FHWA 4CBVA 3S17B 1Z7TA 1BR9A 1EFID 1ZYRD 2E2IB 2D9UA 1JWUD 4H44C 1VDZA 1FD7D 3A7LA 5LMUL 5IT9L 5IWAQ 1B7YB 1SYBA 1XTDA 2DGYA 3HRZC 2YU9H 1PDQA 3KBGA 4KN7C 1TXYA 3MFGA 1BO0A 5M5WH 4DKAC 3GTOB 4HN7A 1QZGA 2F4VL 3KF8A 2QGQA 1F2MA 2G5DA 2K04A 4JBJA 1YZ6A 1T9HA 3U9SA 1I50B 3OWFA 1UWVA 4DR7Q 3MTSA 4A3FH 1G91A 2R7ZB 2IJ0A 1DM0B 3KLWA 1QZHA 1L0YB 2CCZA 5EKIA 1XMOQ 4GLVB 2BE5C 3BZKA 3DMUA 1SMYC 5DAUA 1SNMA 4YWMA 2VUMG 4PG3A 2E2JH 1L0WA 3RLFA 4LF9Q 2F52A 4OO1I 2L15A 3RZOH 1EWCA 2DUDA 4ZUIA 3GTJH 3HOVH 1ILPA 3PO2H 3BS1A 2JYOA 2WIIB 1A6XA 2DN8A 4ABNA 1VQGA 3FRPB 3NK9A 4DUZL 4F8MA 1WYDA 3GO5A 3CF5A 1TR5A 2L9HA 4XYOA 3BZCA 4GOPA 1HR0L 4A3FG 2SOBA 2IX1A 3BJUA 5E1FA 1YJNA 1RL2A 2I5LX 3MXUA 1SN8A 4Y7NB 4B3MQ 4Q5VA 5EPJA 3HOUH 3PUWA 2Y0SE 4XT1B 2NVYB 2JK8A 3HOYH 3A8IE 3I4OA 3TEHB 1TWCH 2A5HA 4QJFA 3I4MG 1PRTF 2XWJB 3NE5B 3I4NH 4IFDH 4PNYA 5FO8B 1SNPA 3K5MA 3NBIA 1TS2A 3VYRA 1D5XC 1BQQT 1CQFA 5FLMH 3CAMA 4LFAQ 3UE1A 1KDAA 5K5PA 1A3TA 2OEOA 1D1KA 1QWYA 5GAGC 3D0FA 3S1MH 2XIWA 4FP5D 3Q6SA 5E4WC 3ULPA 4IPHA 2NWGA 2A6HC 3B6YA 4P72A 1LT4D 2H1EA 5CC4A 1S4ZA 1H95A 1CKOA 1HZCA 1KRTA 4WFN3 2CW0D 3T56B 4YHHQ 5CV4A 3I4NG 3GTKB 1F2ZA 4QIWB 1RIPA 1JE5A 2A69D 1SMYD 3RN5A 2NN6H 4HMIA 3GTGB 4JI5L 4HMJA 1IBLQ 3I70A 4IJLA 4N9TA 1TWFH 1E2WA 1UE5A 3NTHA 1IYVA 5FO9B 2UU9Q 3ZYYX 3RZDB 4A3LG 4DR2L 1AE2A 1A3UA 3RN2A 3S2HB 3C1FA 4JC0A 2D62A 3GTGH 4DV2L 1X3EA 4CJ1B 2J4XA 3KF6A 3TS2A 3BU2A 1C7YA 4CKEA 1EEID 5IYBG 2RF4A 4C3IB 1KAWA 1A0IA 4RCNA 1Y14B 4LJZC 5JPNC 1FJGL 4UAIA 4B3SL 1CZWA 2L1BA 2JA7H 1IBLL 4B3RL 4M8AA 1O7ZA 4MZ9A 3OYYA 2L0CA 4KY6A 1D6EC 3JAMi 3CHBD 4IZ8A 3NWTA 2UXDQ 1RD9D 3NTKA 4ZUJA 2K50A 4A3LH 2FMCA 4X66Q 1U0LA 4DR3L 1S3OA 4R8IA 4K6LA 3HOUB 1CHPD 1I94Q 1NTGA 3CCUA 2IHEA 4PZ8A 5C4JB 2FFKB 4FDBA 1U4RA 1Y1WG 3DXJC 3R2IA 2K7VA 2JA5G 4IUTA 4ZKCB 4A3GG 1F9PA 1LT6D 5D3IB 1YHBA 1CKNA 1GUSA 2TSSA 5ELBA 4YWLA 5IYBH 1ONLA 4NPSA 4IURA 4CGYB 4UDUC 3D8GA 2KBNA 4KHVA 2WB1E 1D1IA 5A2QE 5C0XJ 3IFDA 1EY9A 3ND9A 1VQ4A 2VQEL 1KTKA 3T1YQ 4LUZA 3GTLB 2HHHL 3CU7A 4RG1A 4KLKA 1WTOA 2F3WA 4EGVA 2OWOA 4QF4A 5C3WA 3QWNA 5NUCA 4LWCA 2RKSA 1WTXA 3NELA 4R9WA 1V1PB 5COYA 5IGBA 5C0XG 3M85A 3T1HQ 3BDCA 4HJ8A 5IGCA 1KC8C 4P74A 2KHJA 4X64Q 3OTOL 2ZJPA 2SNSA 3GTPB 4FF4A 5IP9G 1M4VA 1Q46A 1LV9A 1QILA 4C3JH 4BY7B 4ME3A 3D31A 2EPBA 2JA5H 1XNQQ 1B9NA 1SMXA 2F0QA 2YTVA 2KOLA 2FMMA 1PRTB 1VQEA 2GVAA 4HIOA 4NXMQ 2NVTH 5FJ8G 3E9IA 3S14B 1LUZA 3H94A 4L6TB 5I6WA 1S72A 4YY3Q 1YNJD 4NKLA 2UXBL 1Y1VH 3U58A 1IBKL 1CHQD 2UXCL 2BH8A 2D5DA 3KF8B 4RGNA 5C4XB 5C5MA 2AMCB 3KLRA 3NTIA 4K0KL 4H02A 1NAPA 4JI6L 2PNHA 4JK1C 2R6GA 2XTIA 1TU2B 3OIPA 2YU9B 1B50A 4YY3L 4EX5A 3M4PA 2ZXPA 2VW9A 2MP1A 2VQFQ 1BBWA 1PYSB 2GN5A 5IGDA 2B8GA 4PZ6A 3SXHA 3S16B 4DV3Q 2OF1A 1QUQA 1XNQL 3STBC 3KUPA 1BXTA 3HOXB 3HOZB 2XNAC 2VUMB 2K5DA 4OIKA 3VYTA 4K6DA 5C4JH 3AMUA 2DJFC 1PTOF 1CK1A 1F9RA 4A3IG 2ALYB 1UE6A 4CJ0B 3F2UA 2F0EA 2K4KA 4IFDG 5HGTA 3P75A 1RODA 2IT1A 3H3VC 2IX0A 4C56C 3CMAA 1YHAA 1GO3E 2AUJD 4B9XA 2UUAL 1LTID 4UPAA 5IGEA 1QJOA 4DF7A 4A3EH 3P1HA 4LF9L 3SEBA 1KXLA 4HSPA 1JORA 2ES2A 1SDFA 1VQOA 4H7BA 4QL5A 1LO5D 3HKZG 3BVMA 5GAEC 3ER0A 1BOSA 4KK7A 1C8CA 4XTCS 1R4PB 1M8AA 2NZHA 3TRZA 1ASZA 3HOZG 4EVOA 4GLAC 1WTRA 1X3PA 1A15A 1CSPA 1AZQA 4LK1C 3HOVB 1V1OA 2EYJA 1LTSD 2QILA 4ZAIA 3CC7A 5IT9E 1LTTD 1NBWA 2H4OA 3T51B 5G3LD 2E2JB 1MGSA 2A68C 3CC4A 2L12A 1LTAD 3NPPA 5KEEA 1YNNC 4X3KA 1A2UA 3RD4A 1PH1A 1G6PA 1VQHA 1J5EQ 3MXPA 1TWGH 3BG3A 3E0JA 4BS9A 4F7XA 3E0EA 1YJWA 4C3IG 4PMCA 4LFBL 1EYDA 3CMEA 1AEXA 2F0HA 5C3EG 3I4MB 3CKIB 1I4PA 3JC66 4E6IA 4DK1A 2Z9HA 5KNBA 3HOYG 5G3LF 2QDLA 3NXWA 1WTWA 1W6KA 2L4NA 4LFBQ 1I6VC 1N32L 1CZGA 4X6AH 1AZPA 5C4HA 2IL8A 3CCVA 4ZQ3A 2EJFC 4UP8A 2IWHA 2BCOA 1G2SA 4JI3L 3V2TA 1BNZA 3S1NB 1U4MA 4ILWA 5C3XA 1IW7C 3CP0A 4JI1Q 5JVH3 3K0YA 4K5VA 4LF4L 2RDGA 4POFA 2I5HA 4HJ9A 4G7ZC 2A19A 2JEBI 2VY3A 1H9MA 4DV3L 1PH9A 2B3GA 1LM0A 4ID6A 4DAPA 3AFPA 4X62Q 2NBFA 3C1EA 5EGTA 3BVGA 4C2MB 5J39A 4DV7L 2O2LD 2PYKA 5HGQA 4QY7A 1O7IA 2ZTDA 4IPDA 3VR4A 1D7QA 2ASBA 2WAQB 2XGTA 3Q23A 3SVMA 2MGSA 2NN6G 2RA4A 4KTAA 2Q8RE 1MSHA 2TMPA 1JR0D 3FKIH 3SK6A 3HP3A 5EKLA 2RDHA 4DR6Q 4A3IB 5JJIA 1SFOH 2ATWA 4R4QA 1AP0A 4G57A 2DNEA 1EYGA 1D5MC 1W6JA 2PMZB 2RDFA 4BY1G 1L0XB 1PRTD 3LNNA 5EAYA 3EVQA 3ZJYC 2B2UA 2I0QA 5BN3A 1OXXK 3X3NA 2MJ8A 4DAYB 1JCKB 4X62L 3OW2A 5H1SE 1FNUA 3EIVA 2HD3A 1TT2A 4OWWB 3CC2A 3MVVA 1NCVA 2KEEA 3NQTA 1E0BA 2A8VA 3ICEA 3SR1A 1IL8A 1ET9A 2PQAB 3W5OA 1SNCA 3FKIB 4G4KA 4R4OA 1LLRD 3MFYA 2CH4W 4KHZA 4POGA 4RKLA 5A2QL 2E76C 3VR6A 5M5YB 4K14A 4DGZA 3Q0AA 2G9DA 4GOPC 1Q86C 1DOLA 1Y1VG 1HTPA 4DXGA 2Q2TA 3S16H 5I2XA 1SE4A 1B3AA 1KNEA 5ISRA 1PXUA 1HNWL 1STNA 3PIPA 2AKWB 5K36H 2E2DC 4JVZA 1R9TH 5C44B 4AYBB 3FVQA 4GKKQ 3M7NA 5EBCA 1VCIA 4A4IA 1B44D 4DR7L 2I5MX 1HCZA 2K01A 4IOCA 2K1BA 3KBXA 5AJ3L 3H15A 3W3AA 2NVQH 4WRDA 4A3DB 1WCMG 1QB5D 2KA7A 3G71A 3S14H 1JJGA 3PO3H 1HJPA 2AQ3B 4HAEA 3HOUG 2WB1B 1I5FA 1B8AA 4CKCA 2Z6KA 4EQPA 5DM63 1PV4A 1EU4A 1H9JA 3I4MH 3P7JA 5A35A 3HZXA 4F87A 5LMUQ 2B39A 1HQRD 4DR6L 1SEBD 2Q8TA 4C1NK 4MIUA 5EBDA 4B3SQ 1ZKOA 5EKKA 2E5LQ 4B08A 3S1QH 3TQYA 5K36G 3RUZA 1PRTC 3CCRA 2N49A 3PQIA 1WOCA 4LF5Q 2BOSA 4JI4Q 2JA5B 3H0GG 2B8FA 4KKTA 2K75A 4HEDA 3TP7A 1IBKQ 1O80A 4U673 1E2ZA 1BVSA 2F4VQ 4DNRB 1WCMH 5LMNQ 2ZXRA 1Q82C 3DEOA 1R9TB 1CTMA 1LT5D 2BE5D 1FNWA 1LT3D 2ENBA 5FK9C 1BCPD 3H0GB 1VQJA 5IWAL 2ID0A 2I07B 4RWSC 2C35B 1STGA 1HQMC 1RTNA 1EY4A 2A73B 1K9MC 1STBA 2UUBL 1I94L 1HA6A 4A3EB 2B2WA 4DFAA 3PUXA 4JG2A 3CRKC 3AEVA 3S15H 1PZID 4X3TA 4JI7Q 2NUCA 3K8AA 4JBMA 3S24A 3F2BA 5DM73 3TZDA 2SDFA 2CKZB 2CQOA 1M1KC 4V0BA 2JA7B 4FVMA 1AE3A 1QUQB 2KHSA 2LXJA 4A3DG 4ME5A 4EQOA 5GQOA 4DV4L 1I4GA 5T1GA 4LFAL 3D4WA 1Y8OB 4DV7Q 4RKBA 1LABA 2Z1CA 4HIDA 2V1CC 1UNSA 1VQ7A 2E2HH 3X3MA 4ODGA 1ET6A 5CBEE 1H9SA 3QOLA 3HOWB 4HJ7A 2RHSB 3M4OH 1Q90A 1X9NA 4A75A 4L5RC 1Z47A 2DY8A 2WFWA 2JP1A 1MKHA 3S1RB 2UU9L 3C46A 3MAQA 3K6OA 3CQZB 2HIVA 1N34Q 2MO0A 1WD0A 2HQLA 4C3IH 3I2ZA 5C0XI 2JA8H 2E74C 4JV5Q 2AQ1B 1BF4A 1EU3A 4I7AA 2UXDL 4MNOA 2GVBA 2F0IA 4HR7B 1Y1WB 4JV5L 1Q1EA 1B3QA 4RFBA 1ICFB 4N8X1 4JYAL 4RA8A 5BR8L 1Q3LA 2IHFA 4B9WA 2NZOA 2K33A 4U68A 4C3HB 2LKVA 3SE0A 4FXGC 1IKLA 2VS1A 5E4XA 1IL2A 1G6ZA 1ZYRC 1C48A 1J6QA 4L8JA 1PH5A 1AW7A 4L5QA 4DV0L 5L37A 2R7FA 3N52A 3CPFA 3H3VI 4IALA 4BY1B 1SNDA 1JICA 3EA6A 1EEFD 1NNXA 4XQQA 4A3KB 2NN6I 3GQBA 1SR3A 4GS3A 2KJXA 1WTHA 5IP9H 4LF8L 1EUJA 2PW7A 3EN2A 5C4XH 4HIMA 2WKDA 1V1QA 1NE3A 4A3BG 3U9OA 1YJ9A 4QB4A 5IGGA 1IXRA 4FF3A 1Y8NB 1YNXA 3L9AX 2EXZA 3GTLH 3QB3A 4LW1A 2K6AA 1QVCA 2NVTB 2PQAA 1X65A 1KLUD 1ENAA 3GV6A 3KJPA 3NHHA 1JOQA 5CV6A 2LMCB 2CQAA 1FYCA 4P71A 5IE8A 4BY7G 3FPUB 4L5SA 4GN5A 3ITPA 4GNXA 1N33Q 4LF8Q 1LTRD 4AH6A 2OCEA 2NVYH 3L3OC 4NDXA 1ML0D 5JVG3 4IFDI 2SNMA 5M5XH 2KCMA 2RCFA 4IUPA 1PH8A 3DM1A 4LMQD 3GTJB 1K8OA 4DV2Q 3RZOB 1IZ6A 1GKHA 3TBIB 1PMRA 1PYBA 4K2KA 2JA8B 2EE1A 4ZYSA 5C3EH 3N6RA 1G8ZD 3OHXC 4GKJQ 3TP6A 5CV9A 4AQYQ 5CGKA 1QVGA 3OTOQ 3KYHC 4RHRA 1IKMA 4GKJL 3NQIA 1HR0Q 1PZJD 1OXUA 1ASYA 2EJGC 1HXYD 3CCEA 3KLSX 3U50C 5M5WB 3LWUA
chains in the Genus database with same CATH topology
3RNUA 3HOVG 2IX0A 1VQMA 1U5KA 1MJEA 1CKNB 3CMAA 1YHAA 3PO2G 1GO3E 2UUAL 4UPAA 4APVA 4BXXH 1X56A 4A3EH 1L1OB 1N36L 1VQAA 1TWHH 4A3MH 1HH2P 3UDGA 4JI2L 4LF9L 1XMQL 5AJ3Q 1HNXQ 3GTQH 1KXLA 4O0AA 1NMGA 2ES2A 1VQOA 4QL5A 3HKZG 4HJ5A 4JI6Q 5GADC 4JI8L 5GAEC 4LFCL 3G48A 3ER0A 4LF5L 4OX9Q 2VNUD 2F3IA 2EXDA 3STBD 1GD7A 4XTCS 5ELOA 4Y52H 3E9HA 4AIMA 2NZHA 2YYZA 1FJGQ 3TRZA 1ASZA 2RCNA 4K0KQ 3HOZG 2WAQG 1M90C 1K8GA 1C9OA 4HJAA 4GLAC 1VQFA 3SGIA 2BH2A 4Y7NH 1CSPA 4JBWA 4DV0Q 2JA6H 2UUCL 4DR5Q 3K80C 4ALPA 3I56A 3CC7A 3GD7A 3PF5A 4A3CH 3J81c 1BBUA 1YIJA 1NBWA 4PMWA 4OWXB 3CC4A 2K5HA 2ZM6L 3GTKH 3K7AH 1N9WA 4GLXA 1FVIA 1Q8KA 1X3GA 4JI1L 1VQHA 4J15A 4KI0A 1PH1A 1G6PA 4WJ3M 3CD6A 1J5EQ 2Q2IA 1WI5A 1VQNA 2YV5A 1TWGH 4LNQA 2R93G 2MQHA 5C4XG 3L0OA 4MTNA 3E0EA 4NXNL 1YJWA 5IY0A 4LFBL 1X3FA 4A76A 1JJCB 3CMEA 3K81C 4GNXC 4OXPA 3NENA 5C3EG 1EQRA 2K14A 3JC66 3GTPH 2VQFL 1YI2A 4DK3C 3NBHB 4DUYQ 1EFWA 3HOYG 2JJQA 4LF6L 4A3JH 3A74A 3UE0A 2LXKA 3S2DH 1PH2A 1VQLA 3GTMH 4A3JG 2VUMH 4LFBQ 3MEFA 1YITA 4OONA 1I6HH 1VQCA 4QGUA 1N32L 4X6AH 1N8RC 1E7ZA 1SLJA 3J80c 1OTCA 3CCVA 1EIFA 4UP8A 4JI0Q 1Q12A 2PI2A 4YCWA 2FXQA 2OQKA 4JI3L 3HKSA 1MIUA 2AWOA 3PSIA 1A63A 4X64L 2KENA 2KHIA 2PI2E 3CP0A 4JI1Q 3UDXA 4JI0L 1BKBA 1L2FA 1V9PA 4LF4L 4POFA 1L1OC 2I5HA 4HJ9A 2A19A 2JEBI 3DM3A 1VQ6A 2VY3A 3AFQA 4DV3L 1PH9A 2UXCQ 2B3GA 1LM0A 4X66L 3AFPA 4UP9A 4X62Q 1Q1BA 2NVXH 2HHHQ 2AHOB 4GNXB 2UUCQ 1LYLA 4DV7L 3AYHB 3PCOB 5HGQA 1XMOL 4QY7A 1O7IA 2ZTDA 4IPDA 3HOZH 1VQPA 3FHWA 4A93H 2ASBA 1D7QA 2XGTA 3G4SA 1K8AC 1KD1C 4DR4Q 2NN6G 2Z0SA 3PF4A 2WP8J 3KFUA 1IBML 4TQUS 3FKIH 3CW2C 4LUOA 5LMUL 3W1BA 4DR1Q 4XIGS 4DR6Q 2N8NA 4AYBE 5IWAQ 1B7YB 5JJIA 4R4TA 1SFOH 2ATWA 1XTDA 4R4QA 1C0AA 2DGYA 4IJHA 5FLMG 5C44G 4A3KG 2Q2HA 3UDIA 1EYGA 4AYBG 2YU9H 3CCJA 2ZM6Q 4BY1G 1TXYA 3PUYA 5EAYA 3ZJYC 1S40A 2I0QA 5M5WH 4DKAC 1QZGA 1OXXK 4DAYB 4X62L 2F4VL 3OW2A 5H1SE 2QGQA 1SROA 3EIVA 4JBJA 4OWWB 3CC2A 1YZ6A 1T9HA 3HFZB 3PUVA 2N3SA 4DNIA 3A5UA 2B29A 2A8VA 2QEXA 1JJ2A 2EQSA 2R7DA 3ICEA 1UWVA 1PH6A 4DR7Q 2PQAB 3W5OA 1J5EL 1E1TA 4NB3A 4R4OA 4A3FH 4JI5Q 4DR4L 3KLWA 1I3QH 1QZHA 2R7ZH 4IO9A 1XMQQ 1HNXL 2CCZA 4KHZA 1OXSC 5ELNA 3PV0A 1XMOQ 4POGA 3FKIG 4GLVB 4A93G 3BZKA 1Z9FA 1PA6A 4GOPC 4R1JA 4YWMA 1KHIA 1XJVA 1Q86C 2VUMG 4BBSH 1Y1VG 4PG3A 3HOXG 2E2JH 2Z6KC 1L0WA 3RLFA 2F52A 4LF9Q 2Q2TA 4OO1I 1P16A 2L15A 1E24A 1A62A 3RZOH 3S16H 5M3FH 1KL9A 4A3CG 2DUDA 5M3MH 4YWKA 3GTJH 3CXCA 1EWIA 3HOVH 4DV1L 1CUKA 3CPWA 3S2HH 5C44H 2E8GA 1HNWL 3PO2H 3PIPA 5JJLA 2AKWB 3PIOA 4B3ML 2B63G 1R9TH 3J80i 4A3BH 1VQGA 4DUZL 5JEAJ 3M7NA 4GKKQ 1Y1WH 1VCIA 1WYDA 3GO5A 4A4IA 3CF5A 4DR7L 1YEZA 1CSQA 1EOVA 2I5MX 3BZCA 3CCSA 4GOPA 1P8LA 1HR0L 4A3FG 4YCUA 3HKZE 1B70B 2Y0SG 3BJUA 5IP7H 4JI2Q 2D0OA 4IOCA 2IX1A 5AJ3L 4JOIC 1YJNA 1RL2A 2I5LX 3H15A 1SN8A 2NVQH 1JMCA 1KIXA 4B3MQ 1PHJA 5LMNW 1QVFA 2H5XA 1WCMG 4X65L 3S1RH 2OQ0A 4LF6Q 3PUWA 2Y0SE 3G71A 3HOUH 3S14H 5E7NA 1JJGA 2HIXA 1HJPA 2JK8A 3HOYH 3PO3H 3MXNB 1XNRL 3HOUG 1I5FA 3I4OA 4IPCA 1TWCH 3TEHB 1B8AA 4QJFA 4DR2Q 3I4MG 2JA6G 2Z6KA 1E22A 1G291 4BBRG 3I4NH 1PV4A 3I4MH 4JI7L 4JYAQ 2OTJA 4DV5Q 1K73C 1X54A 2MNAA 2RHQB 1VQBA 5LMUQ 4DR6L 1V43A 5FLMH 1D8LA 1NMFA 3ULJA 3CQZH 3CAMA 3KF6B 4LFAQ 3UE1A 4X65Q 4O2DA 1WJJA 2E5LQ 4B3SQ 4B3RQ 4PZ7A 5GAGC 3D0FA 3S1MH 3S1QH 3TQYA 2IY5B 5K36G 4OWTB 1LTLA 3CCRA 3L2PA 2N49A 3Q8DA 5JEAG 1WOCA 2JA8G 4LF5Q 2LSSA 4P75A 2QA4A 3ULPA 4JI4Q 2BA1A 3H0GG 4BXXG 4IPHA 3A5ZB 2K75A 1HR0W 4IPGA 1KQSA 3B6YA 1YVCA 4JOIA 1IBKQ 4P72A 4UP7A 3T1YL 4QIWE 3M3YH 1H95A 1BVSA 1CKOA 1SRUA 1HZCA 2F4VQ 2A1AA 3KOJA 1KRTA 1WCMH 5LMNQ 4YHHQ 1Q82C 4BBRH 3F1ZA 3I4NG 1RIPA 1JE5A 1PH7A 1A8VA 1L1OA 3I55A 4P73A 3RN5A 4A3IH 3HOWG 5IYDG 5FLXc 3CCLA 4IFDJ 1VQJA 3J81i 3TREA 2R92G 4JI5L 2BA0A 5IWAL 2ID0A 4GN4B 4LFCQ 4JBKA 4OX9L 3LGJA 2C35B 5HY6A 3J81j 1IBLQ 1K83H 3PGZA 1K9MC 4IJLA 1VQ5A 1WFQA 1TWFH 1UE5A 3JAMc 3KJOA 2UUBL 1X55A 1N36Q 1I94L 2UU9Q 2E5LL 5GAHC 3F8TA 4A3LG 1HNWQ 1YBYA 4DR2L 3PUXA 1AE2A 3H3VH 1XPUA 4JG2A 3AEVA 1E1OA 3S15H 1HZ9A 4EQ5A 2YTXA 3RLNA 4DR3Q 4LUVA 4LF7Q 4A3EG 3RN2A 4NXML 4JI7Q 3K8AA 4DV1Q 3F2CA 3S24A 1Q7YC 4JC0A 3F2BA 1XPOA 4JBMA 2D62A 3H0GH 4DV2L 2ZJQA 1K0RA 1X3EA 1HNZQ 2CKZB 2JA9A 3GTGH 3KF6A 3TS2A 3BU2A 2CQOA 1M1KC 1I50H 1C7YA 4LF4Q 1PVOA 3PUZA 2RF4A 5IYBG 4B3TQ 4KHPQ 1KAWA 1A0IA 4NXNQ 1AE3A 1QUQB 1PH3A 3U4VA 3S1NH 2LXJA 4A3DG 2CWPA 2R7ZG 1Y14B 1VQKA 3T1HL 3RLOA 5GQOA 2JEAI 1FJGL 2HT1A 4DV4L 1TWAH 4B3SL 3K7UC 2K5VA 4R4CA 4LFAL 1Q81C 1IBLL 2JA7H 4DV7Q 2ZJRA 4B3RL 4MZ9A 1IYJB 4HIDA 1VQ7A 3OYYA 2V1CC 5DLQE 2EIFA 3ULLA 1JB7A 3JAMi 2E2HH 1X6OA 2R92H 2UXDQ 1VQ9A 4HJ7A 2RHSB 3M4OH 2VQEQ 2K50A 3KDFB 1X9NA 4A75A 1N34L 4X66Q 4A3LH 2KCTA 2UXBQ 1U0LA 4DUYL 4L5RC 2WFWA 1Z47A 4DR3L 1S3OA 3G6EA 1FL0A 1MKHA 1I94Q 4DV6Q 1NTGA 2UU9L 3S17H 2YTYA 2HIVA 1N34Q 3CCUA 2IHEA 2MO0A 4A3KH 2HQLA 3L7ZC 4PZ8A 3I2ZA 4C3IH 5C0XI 2JA8H 3J7A5 3DLLA 2AWNA 4FDBA 4JV5Q 1Y1WG 2R93H 4BY1H 1HZAA 2UXDL 4MNOA 2GVBA 2JA5G 1W2BA 4A3GG 3AQQA 1HZBA 1YHBA 3M4QA 5GROA 2N78A 1CKNA 3VDYA 1Q1EA 1NJIC 4JV5L 4YWLA 1W3SA 5IYBH 4JYAL 3M9BA 4NPSA 2MFIA 5BR8L 2IHFA 4A3DH 5M5YH 2NZOA 1PH4A 2KBNA 1IL2A 2VS1A 2WB1E 4YHHL 4YCVA 5C0XJ 2PMZE 1J6QA 4GOPB 1YHQA 4WJ4A 1VQ4A 3W1GA 2VQEL 3T1YQ 1PH5A 4DV5L 5IYCH 1E3PA 2K52A 1DGSA 4LUZA 3CCMA 4L5QA 4DV0L 2HHHL 4RG1A 1FGUA 2VL6A 4JCVE 2R7FA 1UE1A 4KLKA 5M3MG 4DR5L 1VS0A 4BBSG 2OWOA 1OXTA 3CPFA 1KRSA 4LF7L 3H3VI 2WB1G 4LWCA 2MO1A 4IOAA 3NELA 4JI4L 5C0XG 3M85A 5M3FG 3T1HQ 5JJKA 2UUBQ 1CKMA 4DV4Q 1OXVA 4HJ8A 1SE8A 4P74A 1KC8C 4JI3Q 3WWVA 2KHJA 2NN6I 1SR3A 4GS3A 5IP9H 4TVAB 4X64Q 4AQYL 3OTOL 3U4ZA 1EUJA 2ZJPA 4LF8L 4A3GH 3EN2A 5C4XH 5J3BA 1MJCA 5IP9G 4A3MG 4HIMA 1Q46A 4C3JH 1N32Q 1PFSA 1V1QA 3TS0A 1NE3A 4BA1I 4A3BG 4ME3A 3D31A 4JI8Q 2JA5H 1XNQQ 2YTVA 1SMXA 3A0JA 1YJ9A 4OO1G 4GKKL 4DPGA 2D0PA 1IXRA 1VQEA 1YNXA 2GVAA 3IRBA 4HIOA 3GTLH 4NXMQ 4LW1A 2NVTH 1QVCA 2PQAA 5FJ8G 1X65A 3E9IA 1LUZA 4HIKA 1S72A 5IYCG 3I7FA 4YY3Q 5FJ8H 2UXBL 1Y1VH 3HOXH 3U58A 4L5TA 3KJPA 1IBKL 2UXCL 2BH8A 5IT9c 1N33L 4C2MH 3KF8B 4P71A 5IE8A 1AH9A 4BY7G 1NY4A 4L5SA 4GN5A 2AMCB 4DR1L 1JT8A 4GNXA 4H02A 4K0KL 4JI6L 2PNHA 3KDFA 3NEMA 4LF8Q 1N33Q 4AH6A 2JE6I 2R6GA 2JQOA 2OCEA 2XTIA 4DUZQ 3J7ZC 2NVYH 2E2IH 1G51A 2B63H 4DAMA 4IFDI 4YY3L 4R4IA 4EX5A 3M4PA 5LMNL 3RZDH 4B3TL 4KHPL 4C3HH 2KCMA 3EBEA 5M5XH 2VW9A 2CFMA 4DV6L 2OTLA 1PH8A 1XNRQ 2VQFQ 1BBWA 1PYSB 1GVPA 2GN5A 3CCQA 4DV2Q 3UDFA 4PZ6A 1IZ6A 1GKHA 2ZTEA 4DK6C 4DV3Q 1QUQA 1PYBA 1XNQL 3STBC 1K3RA 1EQQA 3F2DA 1VQ8A 5C3EH 3FP9A 5IP7G 3GDEA 3PO3G 4BA2I 1XPRA 1UEBA 5C4JH 3ERSX 4GKJQ 1EIYB 4AQYQ 1QVGA 2Q2UA 3OTOQ 4UY8C 5BR8Q 1VQDA 3KYHC 2WAQE 2K5NA 1VQIA 2ALYB 1UE6A 4A3IG 5IYDH 2JA7G 2CWAA 2VZAA 4GKJL 1HR0Q 4QQBX 1UE7A 1OXUA 1ASYA 1IBMQ 4BY7H 3CCEA 2K4KA 2ZTCA 4IFDG 3RR5A 1HNZL 1GM5A 3HOWH 2IT1A 3K0XA 4RMFA 2UUAQ 3U50C 3GTOH 4GN3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNU A;  3HOV G;  2IX0 A;  1VQM A;  1U5K A;  1MJE A;  1CKN B;  3CMA A;  1YHA A;  3PO2 G;  1GO3 E;  2UUA L;  4UPA A;  4APV A;  4BXX H;  1X56 A;  4A3E H;  1L1O B;  1N36 L;  1VQA A;  1TWH H;  4A3M H;  1HH2 P;  3UDG A;  4JI2 L;  4LF9 L;  1XMQ L;  5AJ3 Q;  1HNX Q;  3GTQ H;  1KXL A;  4O0A A;  1NMG A;  2ES2 A;  1VQO A;  4QL5 A;  3HKZ G;  4HJ5 A;  4JI6 Q;  5GAD C;  4JI8 L;  5GAE C;  4LFC L;  3G48 A;  3ER0 A;  4LF5 L;  4OX9 Q;  2VNU D;  2F3I A;  2EXD A;  3STB D;  1GD7 A;  4XTC S;  5ELO A;  4Y52 H;  3E9H A;  4AIM A;  2NZH A;  2YYZ A;  1FJG Q;  3TRZ A;  1ASZ A;  2RCN A;  4K0K Q;  3HOZ G;  2WAQ G;  1M90 C;  1K8G A;  1C9O A;  4HJA A;  4GLA C;  1VQF A;  3SGI A;  2BH2 A;  4Y7N H;  1CSP A;  4JBW A;  4DV0 Q;  2JA6 H;  2UUC L;  4DR5 Q;  3K80 C;  4ALP A;  3I56 A;  3CC7 A;  3GD7 A;  3PF5 A;  4A3C H;  3J81 c;  1BBU A;  1YIJ A;  1NBW A;  4PMW A;  4OWX B;  3CC4 A;  2K5H A;  2ZM6 L;  3GTK H;  3K7A H;  1N9W A;  4GLX A;  1FVI A;  1Q8K A;  1X3G A;  4JI1 L;  1VQH A;  4J15 A;  4KI0 A;  1PH1 A;  1G6P A;  4WJ3 M;  3CD6 A;  1J5E Q;  2Q2I A;  1WI5 A;  1VQN A;  2YV5 A;  1TWG H;  4LNQ A;  2R93 G;  2MQH A;  5C4X G;  3L0O A;  4MTN A;  3E0E A;  4NXN L;  1YJW A;  5IY0 A;  4LFB L;  1X3F A;  4A76 A;  1JJC B;  3CME A;  3K81 C;  4GNX C;  4OXP A;  3NEN A;  5C3E G;  1EQR A;  2K14 A;  3JC6 6;  3GTP H;  2VQF L;  1YI2 A;  4DK3 C;  3NBH B;  4DUY Q;  1EFW A;  3HOY G;  2JJQ A;  4LF6 L;  4A3J H;  3A74 A;  3UE0 A;  2LXK A;  3S2D H;  1PH2 A;  1VQL A;  3GTM H;  4A3J G;  2VUM H;  4LFB Q;  3MEF A;  1YIT A;  4OON A;  1I6H H;  1VQC A;  4QGU A;  1N32 L;  4X6A H;  1N8R C;  1E7Z A;  1SLJ A;  3J80 c;  1OTC A;  3CCV A;  1EIF A;  4UP8 A;  4JI0 Q;  1Q12 A;  2PI2 A;  4YCW A;  2FXQ A;  2OQK A;  4JI3 L;  3HKS A;  1MIU A;  2AWO A;  3PSI A;  1A63 A;  4X64 L;  2KEN A;  2KHI A;  2PI2 E;  3CP0 A;  4JI1 Q;  3UDX A;  4JI0 L;  1BKB A;  1L2F A;  1V9P A;  4LF4 L;  4POF A;  1L1O C;  2I5H A;  4HJ9 A;  2A19 A;  2JEB I;  3DM3 A;  1VQ6 A;  2VY3 A;  3AFQ A;  4DV3 L;  1PH9 A;  2UXC Q;  2B3G A;  1LM0 A;  4X66 L;  3AFP A;  4UP9 A;  4X62 Q;  1Q1B A;  2NVX H;  2HHH Q;  2AHO B;  4GNX B;  2UUC Q;  1LYL A;  4DV7 L;  3AYH B;  3PCO B;  5HGQ A;  1XMO L;  4QY7 A;  1O7I A;  2ZTD A;  4IPD A;  3HOZ H;  1VQP A;  3FHW A;  4A93 H;  2ASB A;  1D7Q A;  2XGT A;  3G4S A;  1K8A C;  1KD1 C;  4DR4 Q;  2NN6 G;  2Z0S A;  3PF4 A;  2WP8 J;  3KFU A;  1IBM L;  4TQU S;  3FKI H;  3CW2 C;  4LUO A;  5LMU L;  3W1B A;  4DR1 Q;  4XIG S;  4DR6 Q;  2N8N A;  4AYB E;  5IWA Q;  1B7Y B;  5JJI A;  4R4T A;  1SFO H;  2ATW A;  1XTD A;  4R4Q A;  1C0A A;  2DGY A;  4IJH A;  5FLM G;  5C44 G;  4A3K G;  2Q2H A;  3UDI A;  1EYG A;  4AYB G;  2YU9 H;  3CCJ A;  2ZM6 Q;  4BY1 G;  1TXY A;  3PUY A;  5EAY A;  3ZJY C;  1S40 A;  2I0Q A;  5M5W H;  4DKA C;  1QZG A;  1OXX K;  4DAY B;  4X62 L;  2F4V L;  3OW2 A;  5H1S E;  2QGQ A;  1SRO A;  3EIV A;  4JBJ A;  4OWW B;  3CC2 A;  1YZ6 A;  1T9H A;  3HFZ B;  3PUV A;  2N3S A;  4DNI A;  3A5U A;  2B29 A;  2A8V A;  2QEX A;  1JJ2 A;  2EQS A;  2R7D A;  3ICE A;  1UWV A;  1PH6 A;  4DR7 Q;  2PQA B;  3W5O A;  1J5E L;  1E1T A;  4NB3 A;  4R4O A;  4A3F H;  4JI5 Q;  4DR4 L;  3KLW A;  1I3Q H;  1QZH A;  2R7Z H;  4IO9 A;  1XMQ Q;  1HNX L;  2CCZ A;  4KHZ A;  1OXS C;  5ELN A;  3PV0 A;  1XMO Q;  4POG A;  3FKI G;  4GLV B;  4A93 G;  3BZK A;  1Z9F A;  1PA6 A;  4GOP C;  4R1J A;  4YWM A;  1KHI A;  1XJV A;  1Q86 C;  2VUM G;  4BBS H;  1Y1V G;  4PG3 A;  3HOX G;  2E2J H;  2Z6K C;  1L0W A;  3RLF A;  2F52 A;  4LF9 Q;  2Q2T A;  4OO1 I;  1P16 A;  2L15 A;  1E24 A;  1A62 A;  3RZO H;  3S16 H;  5M3F H;  1KL9 A;  4A3C G;  2DUD A;  5M3M H;  4YWK A;  3GTJ H;  3CXC A;  1EWI A;  3HOV H;  4DV1 L;  1CUK A;  3CPW A;  3S2H H;  5C44 H;  2E8G A;  1HNW L;  3PO2 H;  3PIP A;  5JJL A;  2AKW B;  3PIO A;  4B3M L;  2B63 G;  1R9T H;  3J80 i;  4A3B H;  1VQG A;  4DUZ L;  5JEA J;  3M7N A;  4GKK Q;  1Y1W H;  1VCI A;  1WYD A;  3GO5 A;  4A4I A;  3CF5 A;  4DR7 L;  1YEZ A;  1CSQ A;  1EOV A;  2I5M X;  3BZC A;  3CCS A;  4GOP A;  1P8L A;  1HR0 L;  4A3F G;  4YCU A;  3HKZ E;  1B70 B;  2Y0S G;  3BJU A;  5IP7 H;  4JI2 Q;  2D0O A;  4IOC A;  2IX1 A;  5AJ3 L;  4JOI C;  1YJN A;  1RL2 A;  2I5L X;  3H15 A;  1SN8 A;  2NVQ H;  1JMC A;  1KIX A;  4B3M Q;  1PHJ A;  5LMN W;  1QVF A;  2H5X A;  1WCM G;  4X65 L;  3S1R H;  2OQ0 A;  4LF6 Q;  3PUW A;  2Y0S E;  3G71 A;  3HOU H;  3S14 H;  5E7N A;  1JJG A;  2HIX A;  1HJP A;  2JK8 A;  3HOY H;  3PO3 H;  3MXN B;  1XNR L;  3HOU G;  1I5F A;  3I4O A;  4IPC A;  1TWC H;  3TEH B;  1B8A A;  4QJF A;  4DR2 Q;  3I4M G;  2JA6 G;  2Z6K A;  1E22 A;  1G29 1;  4BBR G;  3I4N H;  1PV4 A;  3I4M H;  4JI7 L;  4JYA Q;  2OTJ A;  4DV5 Q;  1K73 C;  1X54 A;  2MNA A;  2RHQ B;  1VQB A;  5LMU Q;  4DR6 L;  1V43 A;  5FLM H;  1D8L A;  1NMF A;  3ULJ A;  3CQZ H;  3CAM A;  3KF6 B;  4LFA Q;  3UE1 A;  4X65 Q;  4O2D A;  1WJJ A;  2E5L Q;  4B3S Q;  4B3R Q;  4PZ7 A;  5GAG C;  3D0F A;  3S1M H;  3S1Q H;  3TQY A;  2IY5 B;  5K36 G;  4OWT B;  1LTL A;  3CCR A;  3L2P A;  2N49 A;  3Q8D A;  5JEA G;  1WOC A;  2JA8 G;  4LF5 Q;  2LSS A;  4P75 A;  2QA4 A;  3ULP A;  4JI4 Q;  2BA1 A;  3H0G G;  4BXX G;  4IPH A;  3A5Z B;  2K75 A;  1HR0 W;  4IPG A;  1KQS A;  3B6Y A;  1YVC A;  4JOI A;  1IBK Q;  4P72 A;  4UP7 A;  3T1Y L;  4QIW E;  3M3Y H;  1H95 A;  1BVS A;  1CKO A;  1SRU A;  1HZC A;  2F4V Q;  2A1A A;  3KOJ A;  1KRT A;  1WCM H;  5LMN Q;  4YHH Q;  1Q82 C;  4BBR H;  3F1Z A;  3I4N G;  1RIP A;  1JE5 A;  1PH7 A;  1A8V A;  1L1O A;  3I55 A;  4P73 A;  3RN5 A;  4A3I H;  3HOW G;  5IYD G;  5FLX c;  3CCL A;  4IFD J;  1VQJ A;  3J81 i;  3TRE A;  2R92 G;  4JI5 L;  2BA0 A;  5IWA L;  2ID0 A;  4GN4 B;  4LFC Q;  4JBK A;  4OX9 L;  3LGJ A;  2C35 B;  5HY6 A;  3J81 j;  1IBL Q;  1K83 H;  3PGZ A;  1K9M C;  4IJL A;  1VQ5 A;  1WFQ A;  1TWF H;  1UE5 A;  3JAM c;  3KJO A;  2UUB L;  1X55 A;  1N36 Q;  1I94 L;  2UU9 Q;  2E5L L;  5GAH C;  3F8T A;  4A3L G;  1HNW Q;  1YBY A;  4DR2 L;  3PUX A;  1AE2 A;  3H3V H;  1XPU A;  4JG2 A;  3AEV A;  1E1O A;  3S15 H;  1HZ9 A;  4EQ5 A;  2YTX A;  3RLN A;  4DR3 Q;  4LUV A;  4LF7 Q;  4A3E G;  3RN2 A;  4NXM L;  4JI7 Q;  3K8A A;  4DV1 Q;  3F2C A;  3S24 A;  1Q7Y C;  4JC0 A;  3F2B A;  1XPO A;  4JBM A;  2D62 A;  3H0G H;  4DV2 L;  2ZJQ A;  1K0R A;  1X3E A;  1HNZ Q;  2CKZ B;  2JA9 A;  3GTG H;  3KF6 A;  3TS2 A;  3BU2 A;  2CQO A;  1M1K C;  1I50 H;  1C7Y A;  4LF4 Q;  1PVO A;  3PUZ A;  2RF4 A;  5IYB G;  4B3T Q;  4KHP Q;  1KAW A;  1A0I A;  4NXN Q;  1AE3 A;  1QUQ B;  1PH3 A;  3U4V A;  3S1N H;  2LXJ A;  4A3D G;  2CWP A;  2R7Z G;  1Y14 B;  1VQK A;  3T1H L;  3RLO A;  5GQO A;  2JEA I;  1FJG L;  2HT1 A;  4DV4 L;  1TWA H;  4B3S L;  3K7U C;  2K5V A;  4R4C A;  4LFA L;  1Q81 C;  1IBL L;  2JA7 H;  4DV7 Q;  2ZJR A;  4B3R L;  4MZ9 A;  1IYJ B;  4HID A;  1VQ7 A;  3OYY A;  2V1C C;  5DLQ E;  2EIF A;  3ULL A;  1JB7 A;  3JAM i;  2E2H H;  1X6O A;  2R92 H;  2UXD Q;  1VQ9 A;  4HJ7 A;  2RHS B;  3M4O H;  2VQE Q;  2K50 A;  3KDF B;  1X9N A;  4A75 A;  1N34 L;  4X66 Q;  4A3L H;  2KCT A;  2UXB Q;  1U0L A;  4DUY L;  4L5R C;  2WFW A;  1Z47 A;  4DR3 L;  1S3O A;  3G6E A;  1FL0 A;  1MKH A;  1I94 Q;  4DV6 Q;  1NTG A;  2UU9 L;  3S17 H;  2YTY A;  2HIV A;  1N34 Q;  3CCU A;  2IHE A;  2MO0 A;  4A3K H;  2HQL A;  3L7Z C;  4PZ8 A;  3I2Z A;  4C3I H;  5C0X I;  2JA8 H;  3J7A 5;  3DLL A;  2AWN A;  4FDB A;  4JV5 Q;  1Y1W G;  2R93 H;  4BY1 H;  1HZA A;  2UXD L;  4MNO A;  2GVB A;  2JA5 G;  1W2B A;  4A3G G;  3AQQ A;  1HZB A;  1YHB A;  3M4Q A;  5GRO A;  2N78 A;  1CKN A;  3VDY A;  1Q1E A;  1NJI C;  4JV5 L;  4YWL A;  1W3S A;  5IYB H;  4JYA L;  3M9B A;  4NPS A;  2MFI A;  5BR8 L;  2IHF A;  4A3D H;  5M5Y H;  2NZO A;  1PH4 A;  2KBN A;  1IL2 A;  2VS1 A;  2WB1 E;  4YHH L;  4YCV A;  5C0X J;  2PMZ E;  1J6Q A;  4GOP B;  1YHQ A;  4WJ4 A;  1VQ4 A;  3W1G A;  2VQE L;  3T1Y Q;  1PH5 A;  4DV5 L;  5IYC H;  1E3P A;  2K52 A;  1DGS A;  4LUZ A;  3CCM A;  4L5Q A;  4DV0 L;  2HHH L;  4RG1 A;  1FGU A;  2VL6 A;  4JCV E;  2R7F A;  1UE1 A;  4KLK A;  5M3M G;  4DR5 L;  1VS0 A;  4BBS G;  2OWO A;  1OXT A;  3CPF A;  1KRS A;  4LF7 L;  3H3V I;  2WB1 G;  4LWC A;  2MO1 A;  4IOA A;  3NEL A;  4JI4 L;  5C0X G;  3M85 A;  5M3F G;  3T1H Q;  5JJK A;  2UUB Q;  1CKM A;  4DV4 Q;  1OXV A;  4HJ8 A;  1SE8 A;  4P74 A;  1KC8 C;  4JI3 Q;  3WWV A;  2KHJ A;  2NN6 I;  1SR3 A;  4GS3 A;  5IP9 H;  4TVA B;  4X64 Q;  4AQY L;  3OTO L;  3U4Z A;  1EUJ A;  2ZJP A;  4LF8 L;  4A3G H;  3EN2 A;  5C4X H;  5J3B A;  1MJC A;  5IP9 G;  4A3M G;  4HIM A;  1Q46 A;  4C3J H;  1N32 Q;  1PFS A;  1V1Q A;  3TS0 A;  1NE3 A;  4BA1 I;  4A3B G;  4ME3 A;  3D31 A;  4JI8 Q;  2JA5 H;  1XNQ Q;  2YTV A;  1SMX A;  3A0J A;  1YJ9 A;  4OO1 G;  4GKK L;  4DPG A;  2D0P A;  1IXR A;  1VQE A;  1YNX A;  2GVA A;  3IRB A;  4HIO A;  3GTL H;  4NXM Q;  4LW1 A;  2NVT H;  1QVC A;  2PQA A;  5FJ8 G;  1X65 A;  3E9I A;  1LUZ A;  4HIK A;  1S72 A;  5IYC G;  3I7F A;  4YY3 Q;  5FJ8 H;  2UXB L;  1Y1V H;  3HOX H;  3U58 A;  4L5T A;  3KJP A;  1IBK L;  2UXC L;  2BH8 A;  5IT9 c;  1N33 L;  4C2M H;  3KF8 B;  4P71 A;  5IE8 A;  1AH9 A;  4BY7 G;  1NY4 A;  4L5S A;  4GN5 A;  2AMC B;  4DR1 L;  1JT8 A;  4GNX A;  4H02 A;  4K0K L;  4JI6 L;  2PNH A;  3KDF A;  3NEM A;  4LF8 Q;  1N33 Q;  4AH6 A;  2JE6 I;  2R6G A;  2JQO A;  2OCE A;  2XTI A;  4DUZ Q;  3J7Z C;  2NVY H;  2E2I H;  1G51 A;  2B63 H;  4DAM A;  4IFD I;  4YY3 L;  4R4I A;  4EX5 A;  3M4P A;  5LMN L;  3RZD H;  4B3T L;  4KHP L;  4C3H H;  2KCM A;  3EBE A;  5M5X H;  2VW9 A;  2CFM A;  4DV6 L;  2OTL A;  1PH8 A;  1XNR Q;  2VQF Q;  1BBW A;  1PYS B;  1GVP A;  2GN5 A;  3CCQ A;  4DV2 Q;  3UDF A;  4PZ6 A;  1IZ6 A;  1GKH A;  2ZTE A;  4DK6 C;  4DV3 Q;  1QUQ A;  1PYB A;  1XNQ L;  3STB C;  1K3R A;  1EQQ A;  3F2D A;  1VQ8 A;  5C3E H;  3FP9 A;  5IP7 G;  3GDE A;  3PO3 G;  4BA2 I;  1XPR A;  1UEB A;  5C4J H;  3ERS X;  4GKJ Q;  1EIY B;  4AQY Q;  1QVG A;  2Q2U A;  3OTO Q;  4UY8 C;  5BR8 Q;  1VQD A;  3KYH C;  2WAQ E;  2K5N A;  1VQI A;  2ALY B;  1UE6 A;  4A3I G;  5IYD H;  2JA7 G;  2CWA A;  2VZA A;  4GKJ L;  1HR0 Q;  4QQB X;  1UE7 A;  1OXU A;  1ASY A;  1IBM Q;  4BY7 H;  3CCE A;  2K4K A;  2ZTC A;  4IFD G;  3RR5 A;  1HNZ L;  1GM5 A;  3HOW H;  2IT1 A;  3K0X A;  4RMF A;  2UUA Q;  3U50 C;  3GTO H;  4GN3 B; 
#chains in the Genus database with same CATH topology
 1VF7 A;  3HOV G;  5EJW A;  2M00 A;  3E5S A;  4K2L A;  4APV A;  1X56 A;  1N36 L;  1HH2 P;  3UDG A;  1RJT A;  2X6L A;  1QG7 A;  4EQN A;  5JPM C;  4O0A A;  1PTO B;  1QOH A;  3ND8 A;  4HJ5 A;  1SXT A;  4R8N A;  4JI8 L;  4LFC L;  4LF5 L;  3HKZ B;  3NBH A;  2EXD A;  3STB D;  5KYL A;  1Q8I A;  5ELO A;  4QCL A;  3E9H A;  4JW0 A;  3I3C A;  2DNC A;  4FO2 A;  4K0K Q;  3WDN A;  2WAQ G;  1V8Q A;  2ZT9 C;  4KMU C;  1II3 A;  5I9O A;  4C1N I;  2MHV A;  5EQ0 A;  4JBW A;  4DV0 Q;  5CBA E;  4DR5 Q;  5J22 A;  3PF5 A;  1EYC A;  2JA6 B;  1SYD A;  1YIJ A;  1TS5 A;  4PMW A;  4OWX B;  4X3U A;  3SK8 A;  2WAC A;  1SYE A;  3K7A H;  4KI0 A;  1WI5 A;  4WOR A;  5EPK A;  1VQN A;  2DJG C;  2R93 G;  4HTH A;  4HSV A;  1GHJ A;  1XYI A;  5IY0 A;  4A76 A;  1JJC B;  5I2Y A;  4OEM B;  3K81 C;  3NSW A;  2NYZ D;  1ENC A;  4C3J B;  3S2D B;  5EPL A;  1D5Z C;  3GTP H;  1YI2 A;  4DK3 C;  3GP7 A;  1EFW A;  4XDX A;  1TWC B;  4ZRZ A;  4LF6 L;  2O5I C;  4RAU C;  3A74 A;  3UE0 A;  1PH2 A;  1VQL A;  3GTM H;  1VMP A;  2R61 A;  4PQX A;  4OON A;  1N8R C;  1OTC A;  4QUC A;  2J0T D;  4JI0 Q;  1Q12 A;  2PI2 A;  5BN4 A;  1MBY A;  2OQK A;  1MIU A;  2AWO A;  3SHL A;  3BVZ A;  4X64 L;  2KHI A;  3IL8 A;  1U9R A;  5C0X H;  1BBX C;  1WD1 A;  1FNV A;  1BKB A;  1L2F A;  1V9P A;  3OSO A;  1VQ6 A;  1EYA A;  2AUK A;  2NVX H;  3GTO H;  2HHH Q;  3J7A F;  4GNX B;  3S15 B;  4J1M A;  2OT2 A;  1QNK A;  1LYL A;  3I73 A;  1WTQ A;  3AYH B;  2N55 A;  1RDP D;  1VQP A;  4OGQ C;  2EDG A;  1KNA A;  3G4S A;  1K8A C;  5KIX A;  4HCE A;  4DR4 Q;  1KDB A;  2Z0S A;  3D6C A;  1WVL A;  1IBM L;  3TME A;  5LL6 S;  3ERO A;  3W1B A;  2N8N A;  4AYB E;  4R4T A;  1JC7 A;  4DNT B;  4IJH A;  1MD2 D;  4MTK A;  2Q2H A;  1HFG A;  3T53 B;  4AYB G;  4CDF C;  2VB2 X;  4RGM A;  3VA5 A;  1STA A;  1H9R A;  4C3J G;  1ICW A;  4BWG B;  1SNQ A;  2A74 C;  2XN9 C;  4OO1 H;  1SRO A;  1JE4 A;  4ZCK A;  1WTP A;  3A5U A;  1Z6H A;  2QEX A;  2EQS A;  2R7D A;  3D3R A;  1J5E L;  4DR4 L;  3S1Q B;  2K5Q A;  2R7Z H;  2B2Y A;  4IO9 A;  1XMQ Q;  1HNX L;  4A93 G;  3PV0 A;  2HQE A;  4RHS A;  1Z9F A;  1O78 A;  4ZLT F;  4BBS H;  4N9P A;  3HOX G;  1BUV T;  1E24 A;  4KJO A;  4A3C G;  1EWI A;  1CUK A;  3S2H H;  1NSN S;  2E8G A;  1V1P A;  1KAA A;  3PIO A;  1PFN A;  2B2U C;  1R4Q B;  4IQZ A;  3FDT A;  1B1Z A;  4OL7 A;  3J80 i;  4A3B H;  5FO7 B;  2DY7 A;  1DD2 A;  1EOV A;  3CCS A;  1P8L A;  1NUC A;  2QCP X;  3M4O B;  3HKZ E;  1B70 B;  2Y0S G;  1CM9 A;  2D0O A;  4JOI C;  2B2Y C;  2NTS A;  1JMC A;  1H9S B;  2QEJ C;  2CW0 C;  2F0M A;  1KIX A;  2H5X A;  4LF6 Q;  1XNR L;  4IPC A;  1ZEQ X;  1E22 A;  1J9O A;  1G29 1;  4BBR G;  4JI7 L;  3H09 A;  4DV5 Q;  1X54 A;  2EYM A;  1GUN A;  1EY6 A;  1VQB A;  4KD4 A;  1V43 A;  1GUO A;  1D8L A;  1NMF A;  2FIN B;  2KEC A;  4IUV A;  3ULJ A;  3O13 A;  2HCC A;  4C3H G;  4O2D A;  4B3R Q;  1LTG D;  2EYO A;  4PZ7 A;  1LTL A;  1RCV D;  3Q8D A;  5JEA G;  2JA8 G;  3I90 A;  2R92 B;  2BA1 A;  1SJH D;  1EIG A;  3A5Z B;  1HR0 W;  3IAY A;  3MC0 B;  4IPG A;  1KQS A;  1YVC A;  4UP7 A;  4A3J B;  3T1Y L;  3I4N B;  3M3Y H;  2A1A A;  3KOJ A;  4BBR H;  3D4R A;  1A8V A;  3I55 A;  4J6H A;  1STH A;  3AB9 A;  4A3I H;  5C3E B;  3HOW G;  5IYD G;  3CCL A;  4IFD J;  2EY6 A;  3J81 i;  2FHT A;  3TRE A;  2R92 G;  4GN4 B;  4OX9 L;  4JBK A;  3LGJ A;  3J81 j;  1TS3 A;  3OWE B;  1VQ5 A;  2PPB C;  1WFQ A;  3JAM c;  1EL0 A;  2E5L L;  5GAH C;  1B9M A;  2XWB B;  2EYL A;  4UHV A;  3PO2 B;  4IUU A;  2YTX A;  4LF7 Q;  4A3E G;  3F2C A;  1XPO A;  2ZJQ A;  1K0R A;  2F0D A;  1HNZ Q;  2JA9 A;  3SK4 A;  1I50 H;  2SEB D;  3GTM B;  4XYQ A;  1PVO A;  1I4Q A;  2EYH A;  1K28 A;  3T13 A;  3VYS A;  4NXN Q;  1PH3 A;  3S1N H;  2CWP A;  2XRQ D;  2F0N A;  5KYI A;  2PZW A;  3T1H L;  3RLO A;  2JEA I;  1EQT A;  4HCS A;  3BYT B;  3K7U C;  5KRU A;  4R4C A;  4RGT A;  4A3F B;  3MXN A;  5FOB B;  1F9Q A;  2EIF A;  3ULL A;  1JB7 A;  1X6O A;  4OHJ A;  2R92 H;  1VQ9 A;  2NZ1 D;  2VQE Q;  3KDF B;  1TY0 A;  3OPO A;  2UXB Q;  3G6E A;  1S5F D;  1FL0 A;  3S17 H;  4DV6 Q;  4A3K H;  1EZ6 A;  2AWN A;  1HPC A;  1AN8 A;  1BDO A;  3VR2 A;  4BY1 H;  1HZA A;  2N88 A;  1PZK D;  1GOZ A;  1W2B A;  1VF5 C;  1MI2 A;  2EYF A;  1WTV A;  2L11 A;  3AQQ A;  1GUT A;  2K28 A;  5GRO A;  2N78 A;  3MEH A;  4DAV A;  1EZ8 A;  3VDY A;  5C4Z A;  3M9B A;  5D65 A;  1IYU A;  5M5Y H;  3K58 A;  1PH4 A;  4S3S A;  1E2V A;  4YCV A;  2PMZ E;  4GOP B;  4WJ4 A;  2F0F A;  4DA2 A;  1BCP C;  1TII D;  4DV5 L;  5IYC H;  2K52 A;  3CCM A;  2LS0 1;  5LHY 1;  2VL6 A;  4JCV E;  4DR5 L;  3FPP A;  2B2T A;  1VS0 A;  3TZU A;  4FF1 A;  2WB1 G;  1EY0 A;  2QW7 A;  4JI4 L;  3DWP A;  2C5C A;  5M3F G;  1U4L A;  2VB3 X;  5JJK A;  2F0S A;  1CKM A;  4DV4 Q;  1OXV A;  4YIJ A;  2BDN A;  1DZ1 A;  3WWV A;  2WKC A;  4TVA B;  3NWS A;  4A3G H;  4CDD C;  3PIP 3;  2PCF B;  5I9P A;  1PFS A;  4BA1 I;  4OO1 G;  4BBS B;  3DWA A;  1SYC A;  4DPG A;  2D0P A;  1JB3 A;  4IUQ A;  2C9O A;  3E3X A;  2EZV A;  3URY A;  3WOE A;  4HIK A;  5IYC G;  3I7F A;  4KV6 A;  1EY7 A;  5ELF A;  4RGO S;  4TSS A;  4KKS A;  1A2T A;  5IT9 c;  1I4H A;  4C2M H;  1BCP B;  1K8M A;  4FXD A;  2JXM B;  4H0L C;  4DN4 M;  1NY4 A;  1MHW C;  2RSN A;  1DXM A;  1CT1 D;  3NEM A;  4DUZ Q;  2JQO A;  1SBB B;  2PQE A;  2B63 H;  3J80 L;  4DAM A;  2PO4 A;  3VA7 A;  5LMN L;  4B3T L;  4KHP L;  4DV6 L;  3EBE A;  3TDQ A;  2NVX B;  4KJN A;  4KY7 A;  5M3M B;  3CCQ A;  3UDF A;  5C5L A;  2ZTE A;  3DHQ A;  1F2L A;  5I4D A;  1HRJ A;  3EJI A;  1B2T A;  1VQ8 A;  3GTQ B;  1CI3 M;  3FP9 A;  4OIJ A;  3D6W A;  3PO3 G;  4BA2 I;  3ERS X;  1EIY B;  4DXF A;  2Q2U A;  5BR8 Q;  1VQD A;  2K5N A;  5IYD H;  2KVM A;  3QOJ A;  5M3F B;  4O42 A;  1IBM Q;  3A7A B;  4V19 0;  2ZTC A;  3UI2 A;  3T16 A;  3W2D A;  3A55 A;  1HNZ L;  4RMF A;  1EOT A;  3FMC A;  3J81 L;  4GN3 B;  3RNU A;  4KKU A;  4QUF A;  2A6E D;  1PTO C;  2B2V A;  1LAC A;  4BXX H;  1L1O B;  1DOM A;  1OO9 B;  1VQA A;  1TWH H;  4A3M H;  5AJ3 Q;  3T4A C;  3E6Z X;  4I65 A;  2F0L A;  2FJ2 A;  5ELE A;  5GAD C;  2LY7 A;  4JI6 Q;  4OX9 Q;  3G48 A;  2VNU D;  1HHV A;  1T5X D;  3QG1 A;  4Y52 H;  1TWG B;  1HA5 A;  2RCN A;  2Z6B A;  3PO3 B;  1K8G A;  1M90 C;  1C9O A;  1TWF B;  4HJA A;  3K5O A;  1VQF A;  4Q0F A;  4NP5 A;  1CQV A;  2BH2 A;  2JA6 H;  1VMC A;  4KY5 A;  4QMG A;  3I56 A;  1HUN A;  2PZT A;  4A3C H;  3KLS A;  3WOF A;  1BBU A;  2JN4 A;  3K59 A;  3G7L A;  3VR3 A;  2K5H A;  2ZM6 L;  3GTK H;  2KUM A;  1N9W A;  3AU7 A;  2K05 A;  2I46 A;  1Q8K A;  4JI1 L;  2PNR C;  3CD6 A;  3QR8 A;  2Y0S B;  2YV5 A;  2E75 C;  4LNQ A;  5C4X G;  3L0O A;  1B53 A;  4MTN A;  2IX3 A;  1RF2 D;  1DYQ A;  2L55 A;  4FYD A;  2HCI A;  1EQR A;  2K14 A;  1EY5 A;  5J1Z A;  2VQF L;  3HGB A;  3NBH B;  1XTC D;  2JJQ A;  3OIQ A;  2QKI C;  2D2C C;  1K3B C;  2LXK A;  4CKB A;  2MUY A;  4A3J G;  2VUM H;  1O7Y A;  3MEF A;  1YIT A;  1TVX A;  1ENF A;  3J80 c;  2RBM A;  4YCW A;  3QIA A;  3HKS A;  2A68 D;  5LL6 X;  1S5B D;  1A63 A;  2M2L A;  2PI2 E;  1F9S A;  3CRL C;  1YNN D;  2Q8I B;  2QF7 A;  3J7A V;  3EQL C;  1I4R A;  1L1O C;  1X32 A;  3DM3 A;  2UXC Q;  3V05 A;  1S5C D;  1SYG A;  2RSO A;  4X66 L;  2XVS A;  1XWE A;  2PZU A;  2Z4I A;  1TQO A;  2O5J C;  3PCO B;  4DK0 A;  3IFT A;  3M7G A;  2O4X A;  2F4I A;  1KD1 C;  4PMB A;  3D4D A;  1A3V A;  2WP8 J;  3KFU A;  3PF4 A;  4TQU S;  5T1I A;  3CW2 C;  4LUO A;  1PLF A;  1I4X A;  5IOC A;  2ICI A;  1KAB A;  2AQ2 B;  4DR1 Q;  4XIG S;  3RMH A;  2F0T A;  3K57 A;  1C0A A;  5FLM G;  5C44 G;  5CV7 A;  4A3K G;  2V4D A;  3UDI A;  1J8I A;  3CCJ A;  2ZM6 Q;  1G2T A;  2P5Z X;  3PUY A;  1S40 A;  5JEA H;  3SDZ A;  1S5E D;  2IPK D;  5ELD A;  3FEW X;  5IOD A;  3PUV A;  3HFZ B;  2N3S A;  3DEP A;  2A6H D;  4DNI A;  2B29 A;  4A3M B;  1JJ2 A;  1PH6 A;  4LAA A;  1SNO A;  1E1T A;  4NB3 A;  4JI5 Q;  4Z9C B;  1I3Q B;  1I3Q H;  2Z4H A;  3Q22 A;  1LTB D;  1OXS C;  5ELN A;  1EIH A;  3FKI G;  3BZD B;  1PA6 A;  2NVQ B;  3R3O A;  1DON A;  4KN4 C;  1YNJ C;  4R1J A;  1XJV A;  1KHI A;  4DU9 A;  3QJY A;  2JSO A;  4XXE A;  1DJR D;  2Z6K C;  3M4Y A;  1P16 A;  1A62 A;  5M3F H;  1KL9 A;  5AFW A;  4XT3 B;  5M3M H;  3JAM E;  1RHP A;  4YWK A;  1GUW A;  3CXC A;  4DV1 L;  3CPW A;  5C44 H;  1GJX A;  3HEJ A;  3A56 A;  5JJL A;  4B3M L;  2B63 G;  4CDE C;  2KED A;  4X3S A;  1NR4 A;  5JEA J;  5IGF A;  1Y1W H;  1YEZ A;  1CSQ A;  4DAY A;  1K83 B;  2ZXO A;  4YCU A;  2K32 A;  5IP7 H;  4JI2 Q;  1MSG A;  1UAP A;  4H13 C;  1PHJ A;  5LMN W;  1QVF A;  4X65 L;  3S1R H;  2OQ0 A;  1SYF A;  3P20 A;  5E7N A;  2B63 B;  2HIX A;  3MXN B;  4MN3 A;  4DR2 Q;  1TKW B;  2JA6 G;  2KCC A;  4JYA Q;  4ZKB B;  1K73 C;  1ESR A;  5FLX L;  1DOK A;  5C6A A;  2MNA A;  2RHQ B;  2F1M A;  1JOK A;  2VXW A;  3LX0 A;  5CV8 A;  3CQZ H;  3KF6 B;  4X65 Q;  4A3G B;  1HFN A;  1WJJ A;  2A6E C;  3OMC A;  4OEL B;  2NB0 A;  1BCP F;  4I7Z C;  4M1U B;  2IY5 B;  4OWT B;  4CDC C;  4IUN A;  3L2P A;  3HG9 A;  2LSS A;  4P75 A;  2QA4 A;  4BXX G;  2E2H B;  3DUZ A;  2X6G A;  1JQY D;  4JOI A;  4QIW E;  4F88 A;  2EOT A;  2F0O A;  4J8Q A;  1SRU A;  3F1Z A;  4FXK C;  3OMG A;  1PH7 A;  1L1O A;  3TN2 A;  4KD3 A;  4P73 A;  3K7A B;  5FLX c;  2XRS D;  3OOC A;  3I8Z A;  1PFB A;  2BA0 A;  4LFC Q;  1PFM A;  1NR2 A;  5HY6 A;  1K83 H;  3PGZ A;  1CFM A;  5JOB A;  4NMZ A;  3J81 E;  2J7Z A;  2HDL A;  3H91 A;  3KJO A;  1X55 A;  1N36 Q;  3TP8 A;  3F8T A;  1HNW Q;  1FGB D;  1YBY A;  3H3V H;  1XPU A;  1E1O A;  1F77 A;  1HZ9 A;  4EQ5 A;  3RLN A;  4NXM L;  4DR3 Q;  4LUV A;  2F0W A;  5CR3 A;  5KNC A;  4DV1 Q;  1Q7Y C;  2KQ3 A;  3H0G H;  4TRD A;  4K8J A;  1Y8P B;  4P2C B;  4LF4 Q;  1PTO H;  3PUZ A;  4B3T Q;  4KHP Q;  1F2Y A;  1PYW D;  1WCM B;  3U4V A;  1ZXT A;  1Y69 U;  2R7Z G;  1VQK A;  2F0V A;  2HT1 A;  3EFX D;  1TWA H;  2F0K A;  2K5V A;  3S1M B;  3H6M A;  1Q81 C;  3A8K E;  2ZJR A;  1IYJ B;  3NP8 A;  4MHE A;  5DLQ E;  3V96 A;  2GA4 B;  1TS4 A;  2L5T A;  2RQX A;  5JJZ A;  1RKN A;  1N34 L;  2F0P A;  2KCT A;  4DUY L;  2EJM A;  5F2D A;  2YTY A;  3HOY B;  3L7Z C;  3K5N A;  3J7A 5;  4G7H C;  3DLL A;  1IW7 D;  2R93 H;  1FR3 A;  3SK5 A;  4RH6 A;  4CHT B;  1HZB A;  4PV1 C;  1XX8 A;  3M4Q A;  1NJI C;  5CYU A;  1W3S A;  2WV6 D;  4JPB W;  3I72 A;  2MFI A;  4A3D H;  2CH4 A;  5M5X B;  2F3V A;  2B2W C;  4YHH L;  1YHQ A;  3W1G A;  2EYP A;  1E3P A;  3VYU A;  3K5L A;  1DGS A;  5I6Y A;  1CA5 A;  1FGU A;  5M3M G;  5ELC A;  1UE1 A;  1DCZ A;  5COR A;  5FKA C;  4BBS G;  4LF7 L;  1OXT A;  1KRS A;  4XQJ A;  2MO1 A;  2CHB D;  4IOA A;  5TSS A;  1HUM A;  1CA6 A;  1GUG A;  2UUB Q;  3HS0 C;  3BYY B;  4JI3 Q;  1SE8 A;  5HUR A;  2K03 A;  4AQY L;  1AH9 A;  2M9V A;  2F0U A;  3U4Z A;  5CMD A;  1QNU A;  1XXG A;  5J3B A;  1MJC A;  1GXD C;  2XSC A;  4A3M G;  1N32 Q;  5DNF A;  3TS0 A;  3R93 A;  5M9O A;  4JI8 Q;  3A0J A;  4RCO A;  4GKK L;  5E3F A;  3NUC A;  3G6J B;  5DEH A;  3IRB A;  2HDM A;  3J80 E;  1EY8 A;  4TKO B;  1STE A;  5FJ8 H;  2R3Z A;  4ZK9 B;  2KCN A;  3ONA B;  3HOX H;  4A93 B;  4L5T A;  4ULL A;  1N33 L;  4IN3 A;  4DR1 L;  2QDB A;  1JT8 A;  3QO2 A;  1HTL D;  3KDF A;  3TSS A;  2JE6 I;  2E2I H;  2EY2 A;  3J7Z C;  1G51 A;  4R4I A;  2X69 A;  3RZD H;  4C3H H;  1SFO B;  2CFM A;  2OTL A;  1SE3 A;  1XNR Q;  4FF2 A;  1GVP A;  3I4L A;  3DWQ A;  4DK6 C;  2G9H D;  1K3R A;  3Q24 A;  3F2D A;  1EQQ A;  1I6H B;  1SAP A;  4A3B B;  1Y1V B;  5IP7 G;  3GDE A;  1XPR A;  1UEB A;  1ESF A;  3A54 A;  2F0J A;  1IHZ A;  1SSO A;  3PMF A;  4UY8 C;  2WAQ E;  1VQI A;  5D14 A;  2JA7 G;  2CWA A;  2VZA A;  3MZ5 A;  1KLG D;  4QQB X;  1UE7 A;  3OW7 A;  4BY7 H;  1EWH A;  3RR5 A;  3HOW H;  1GM5 A;  3C3L A;  3K0X A;  3A8J E;  1QE6 A;  4WJW A;  2UUA Q;  1TWH B;  1SJE D;  1U5K A;  1VQM A;  1MJE A;  1CKN B;  3PO2 G;  3BDO A;  4GZY C;  5JAV A;  3C2P A;  1O7L A;  1GHK A;  4FNF A;  3S9W A;  3R2T A;  4G7O C;  1S5D D;  4JI2 L;  3TP5 A;  1XMQ L;  1HNX Q;  3GTQ H;  3MWY W;  1NMG A;  1EQV A;  2CVR A;  1K0S A;  2F3I A;  1GD7 A;  2EY5 A;  1ILQ A;  2Z8L A;  4AIM A;  2YYZ A;  3IKJ A;  1FJG Q;  5D3D A;  1AFP A;  4L63 B;  1RTO A;  3LWE A;  3SGI A;  4Y7N H;  3KK7 A;  2IW3 A;  2UUC L;  3K80 C;  4ALP A;  3M3Y B;  5BN5 A;  3GD7 A;  4K8I A;  5FLX E;  2NTT A;  1H9K A;  3J81 c;  2K5W A;  2ICE C;  1U4P A;  3R8B A;  2B2V C;  2OXP A;  5CV5 A;  4GLX A;  4XQN A;  1FVI A;  1X3G A;  4J15 A;  4WJ3 M;  1PTO D;  2Q2I A;  4NW2 A;  2MQH A;  3MA2 B;  4NXN L;  2B2T C;  2EVB A;  1D2B A;  3PIO 3;  1X3F A;  2R93 B;  1QCB D;  4GNX C;  1T5E A;  4OXP A;  1SE2 A;  3NEN A;  4BBR B;  4K5W A;  2A69 C;  1X3Q A;  4DUY Q;  4CJ2 C;  4O1N A;  4A3J H;  3S2D H;  2MPM A;  2RVL A;  3MXG A;  4N8F A;  1I6H H;  1VQC A;  4QGU A;  2HUG A;  1E7Z A;  3GV3 A;  1SLJ A;  3JAM L;  1EIF A;  1TY2 A;  1TWA B;  1STY A;  2F0G A;  2FXQ A;  1JOO A;  3J7Y W;  2LFN A;  2F03 A;  3PSI A;  3BDL A;  2KEN A;  1C4Q A;  3UDX A;  4JI0 L;  2PW5 A;  5KND A;  1UUP A;  3MHB A;  2EY1 A;  3I91 A;  5KGU A;  3AFQ A;  1KDC A;  1B4O A;  2BDO A;  3ERQ A;  3VR5 A;  4UP9 A;  1Q1B A;  2AHO B;  4K5X A;  5IIF A;  2UUC Q;  1UEA B;  2WIN B;  1XMO L;  1JWM D;  2OTJ A;  4A93 H;  3HOZ H;  1JWS D;  3FHW A;  4CBV A;  3S17 B;  1Z7T A;  1BR9 A;  1EFI D;  1ZYR D;  2E2I B;  2D9U A;  1JWU D;  4H44 C;  1VDZ A;  1FD7 D;  3A7L A;  5LMU L;  5IT9 L;  5IWA Q;  1B7Y B;  1SYB A;  1XTD A;  2DGY A;  3HRZ C;  2YU9 H;  1PDQ A;  3KBG A;  4KN7 C;  1TXY A;  3MFG A;  1BO0 A;  5M5W H;  4DKA C;  3GTO B;  4HN7 A;  1QZG A;  2F4V L;  3KF8 A;  2QGQ A;  1F2M A;  2G5D A;  2K04 A;  4JBJ A;  1YZ6 A;  1T9H A;  3U9S A;  1I50 B;  3OWF A;  1UWV A;  4DR7 Q;  3MTS A;  4A3F H;  1G91 A;  2R7Z B;  2IJ0 A;  1DM0 B;  3KLW A;  1QZH A;  1L0Y B;  2CCZ A;  5EKI A;  1XMO Q;  4GLV B;  2BE5 C;  3BZK A;  3DMU A;  1SMY C;  5DAU A;  1SNM A;  4YWM A;  2VUM G;  4PG3 A;  2E2J H;  1L0W A;  3RLF A;  4LF9 Q;  2F52 A;  4OO1 I;  2L15 A;  3RZO H;  1EWC A;  2DUD A;  4ZUI A;  3GTJ H;  3HOV H;  1ILP A;  3PO2 H;  3BS1 A;  2JYO A;  2WII B;  1A6X A;  2DN8 A;  4ABN A;  1VQG A;  3FRP B;  3NK9 A;  4DUZ L;  4F8M A;  1WYD A;  3GO5 A;  3CF5 A;  1TR5 A;  2L9H A;  4XYO A;  3BZC A;  4GOP A;  1HR0 L;  4A3F G;  2SOB A;  2IX1 A;  3BJU A;  5E1F A;  1YJN A;  1RL2 A;  2I5L X;  3MXU A;  1SN8 A;  4Y7N B;  4B3M Q;  4Q5V A;  5EPJ A;  3HOU H;  3PUW A;  2Y0S E;  4XT1 B;  2NVY B;  2JK8 A;  3HOY H;  3A8I E;  3I4O A;  3TEH B;  1TWC H;  2A5H A;  4QJF A;  3I4M G;  1PRT F;  2XWJ B;  3NE5 B;  3I4N H;  4IFD H;  4PNY A;  5FO8 B;  1SNP A;  3K5M A;  3NBI A;  1TS2 A;  3VYR A;  1D5X C;  1BQQ T;  1CQF A;  5FLM H;  3CAM A;  4LFA Q;  3UE1 A;  1KDA A;  5K5P A;  1A3T A;  2OEO A;  1D1K A;  1QWY A;  5GAG C;  3D0F A;  3S1M H;  2XIW A;  4FP5 D;  3Q6S A;  5E4W C;  3ULP A;  4IPH A;  2NWG A;  2A6H C;  3B6Y A;  4P72 A;  1LT4 D;  2H1E A;  5CC4 A;  1S4Z A;  1H95 A;  1CKO A;  1HZC A;  1KRT A;  4WFN 3;  2CW0 D;  3T56 B;  4YHH Q;  5CV4 A;  3I4N G;  3GTK B;  1F2Z A;  4QIW B;  1RIP A;  1JE5 A;  2A69 D;  1SMY D;  3RN5 A;  2NN6 H;  4HMI A;  3GTG B;  4JI5 L;  4HMJ A;  1IBL Q;  3I70 A;  4IJL A;  4N9T A;  1TWF H;  1E2W A;  1UE5 A;  3NTH A;  1IYV A;  5FO9 B;  2UU9 Q;  3ZYY X;  3RZD B;  4A3L G;  4DR2 L;  1AE2 A;  1A3U A;  3RN2 A;  3S2H B;  3C1F A;  4JC0 A;  2D62 A;  3GTG H;  4DV2 L;  1X3E A;  4CJ1 B;  2J4X A;  3KF6 A;  3TS2 A;  3BU2 A;  1C7Y A;  4CKE A;  1EEI D;  5IYB G;  2RF4 A;  4C3I B;  1KAW A;  1A0I A;  4RCN A;  1Y14 B;  4LJZ C;  5JPN C;  1FJG L;  4UAI A;  4B3S L;  1CZW A;  2L1B A;  2JA7 H;  1IBL L;  4B3R L;  4M8A A;  1O7Z A;  4MZ9 A;  3OYY A;  2L0C A;  4KY6 A;  1D6E C;  3JAM i;  3CHB D;  4IZ8 A;  3NWT A;  2UXD Q;  1RD9 D;  3NTK A;  4ZUJ A;  2K50 A;  4A3L H;  2FMC A;  4X66 Q;  1U0L A;  4DR3 L;  1S3O A;  4R8I A;  4K6L A;  3HOU B;  1CHP D;  1I94 Q;  1NTG A;  3CCU A;  2IHE A;  4PZ8 A;  5C4J B;  2FFK B;  4FDB A;  1U4R A;  1Y1W G;  3DXJ C;  3R2I A;  2K7V A;  2JA5 G;  4IUT A;  4ZKC B;  4A3G G;  1F9P A;  1LT6 D;  5D3I B;  1YHB A;  1CKN A;  1GUS A;  2TSS A;  5ELB A;  4YWL A;  5IYB H;  1ONL A;  4NPS A;  4IUR A;  4CGY B;  4UDU C;  3D8G A;  2KBN A;  4KHV A;  2WB1 E;  1D1I A;  5A2Q E;  5C0X J;  3IFD A;  1EY9 A;  3ND9 A;  1VQ4 A;  2VQE L;  1KTK A;  3T1Y Q;  4LUZ A;  3GTL B;  2HHH L;  3CU7 A;  4RG1 A;  4KLK A;  1WTO A;  2F3W A;  4EGV A;  2OWO A;  4QF4 A;  5C3W A;  3QWN A;  5NUC A;  4LWC A;  2RKS A;  1WTX A;  3NEL A;  4R9W A;  1V1P B;  5COY A;  5IGB A;  5C0X G;  3M85 A;  3T1H Q;  3BDC A;  4HJ8 A;  5IGC A;  1KC8 C;  4P74 A;  2KHJ A;  4X64 Q;  3OTO L;  2ZJP A;  2SNS A;  3GTP B;  4FF4 A;  5IP9 G;  1M4V A;  1Q46 A;  1LV9 A;  1QIL A;  4C3J H;  4BY7 B;  4ME3 A;  3D31 A;  2EPB A;  2JA5 H;  1XNQ Q;  1B9N A;  1SMX A;  2F0Q A;  2YTV A;  2KOL A;  2FMM A;  1PRT B;  1VQE A;  2GVA A;  4HIO A;  4NXM Q;  2NVT H;  5FJ8 G;  3E9I A;  3S14 B;  1LUZ A;  3H94 A;  4L6T B;  5I6W A;  1S72 A;  4YY3 Q;  1YNJ D;  4NKL A;  2UXB L;  1Y1V H;  3U58 A;  1IBK L;  1CHQ D;  2UXC L;  2BH8 A;  2D5D A;  3KF8 B;  4RGN A;  5C4X B;  5C5M A;  2AMC B;  3KLR A;  3NTI A;  4K0K L;  4H02 A;  1NAP A;  4JI6 L;  2PNH A;  4JK1 C;  2R6G A;  2XTI A;  1TU2 B;  3OIP A;  2YU9 B;  1B50 A;  4YY3 L;  4EX5 A;  3M4P A;  2ZXP A;  2VW9 A;  2MP1 A;  2VQF Q;  1BBW A;  1PYS B;  2GN5 A;  5IGD A;  2B8G A;  4PZ6 A;  3SXH A;  3S16 B;  4DV3 Q;  2OF1 A;  1QUQ A;  1XNQ L;  3STB C;  3KUP A;  1BXT A;  3HOX B;  3HOZ B;  2XNA C;  2VUM B;  2K5D A;  4OIK A;  3VYT A;  4K6D A;  5C4J H;  3AMU A;  2DJF C;  1PTO F;  1CK1 A;  1F9R A;  4A3I G;  2ALY B;  1UE6 A;  4CJ0 B;  3F2U A;  2F0E A;  2K4K A;  4IFD G;  5HGT A;  3P75 A;  1ROD A;  2IT1 A;  3H3V C;  2IX0 A;  4C56 C;  3CMA A;  1YHA A;  1GO3 E;  2AUJ D;  4B9X A;  2UUA L;  1LTI D;  4UPA A;  5IGE A;  1QJO A;  4DF7 A;  4A3E H;  3P1H A;  4LF9 L;  3SEB A;  1KXL A;  4HSP A;  1JOR A;  2ES2 A;  1SDF A;  1VQO A;  4H7B A;  4QL5 A;  1LO5 D;  3HKZ G;  3BVM A;  5GAE C;  3ER0 A;  1BOS A;  4KK7 A;  1C8C A;  4XTC S;  1R4P B;  1M8A A;  2NZH A;  3TRZ A;  1ASZ A;  3HOZ G;  4EVO A;  4GLA C;  1WTR A;  1X3P A;  1A15 A;  1CSP A;  1AZQ A;  4LK1 C;  3HOV B;  1V1O A;  2EYJ A;  1LTS D;  2QIL A;  4ZAI A;  3CC7 A;  5IT9 E;  1LTT D;  1NBW A;  2H4O A;  3T51 B;  5G3L D;  2E2J B;  1MGS A;  2A68 C;  3CC4 A;  2L12 A;  1LTA D;  3NPP A;  5KEE A;  1YNN C;  4X3K A;  1A2U A;  3RD4 A;  1PH1 A;  1G6P A;  1VQH A;  1J5E Q;  3MXP A;  1TWG H;  3BG3 A;  3E0J A;  4BS9 A;  4F7X A;  3E0E A;  1YJW A;  4C3I G;  4PMC A;  4LFB L;  1EYD A;  3CME A;  1AEX A;  2F0H A;  5C3E G;  3I4M B;  3CKI B;  1I4P A;  3JC6 6;  4E6I A;  4DK1 A;  2Z9H A;  5KNB A;  3HOY G;  5G3L F;  2QDL A;  3NXW A;  1WTW A;  1W6K A;  2L4N A;  4LFB Q;  1I6V C;  1N32 L;  1CZG A;  4X6A H;  1AZP A;  5C4H A;  2IL8 A;  3CCV A;  4ZQ3 A;  2EJF C;  4UP8 A;  2IWH A;  2BCO A;  1G2S A;  4JI3 L;  3V2T A;  1BNZ A;  3S1N B;  1U4M A;  4ILW A;  5C3X A;  1IW7 C;  3CP0 A;  4JI1 Q;  5JVH 3;  3K0Y A;  4K5V A;  4LF4 L;  2RDG A;  4POF A;  2I5H A;  4HJ9 A;  4G7Z C;  2A19 A;  2JEB I;  2VY3 A;  1H9M A;  4DV3 L;  1PH9 A;  2B3G A;  1LM0 A;  4ID6 A;  4DAP A;  3AFP A;  4X62 Q;  2NBF A;  3C1E A;  5EGT A;  3BVG A;  4C2M B;  5J39 A;  4DV7 L;  2O2L D;  2PYK A;  5HGQ A;  4QY7 A;  1O7I A;  2ZTD A;  4IPD A;  3VR4 A;  1D7Q A;  2ASB A;  2WAQ B;  2XGT A;  3Q23 A;  3SVM A;  2MGS A;  2NN6 G;  2RA4 A;  4KTA A;  2Q8R E;  1MSH A;  2TMP A;  1JR0 D;  3FKI H;  3SK6 A;  3HP3 A;  5EKL A;  2RDH A;  4DR6 Q;  4A3I B;  5JJI A;  1SFO H;  2ATW A;  4R4Q A;  1AP0 A;  4G57 A;  2DNE A;  1EYG A;  1D5M C;  1W6J A;  2PMZ B;  2RDF A;  4BY1 G;  1L0X B;  1PRT D;  3LNN A;  5EAY A;  3EVQ A;  3ZJY C;  2B2U A;  2I0Q A;  5BN3 A;  1OXX K;  3X3N A;  2MJ8 A;  4DAY B;  1JCK B;  4X62 L;  3OW2 A;  5H1S E;  1FNU A;  3EIV A;  2HD3 A;  1TT2 A;  4OWW B;  3CC2 A;  3MVV A;  1NCV A;  2KEE A;  3NQT A;  1E0B A;  2A8V A;  3ICE A;  3SR1 A;  1IL8 A;  1ET9 A;  2PQA B;  3W5O A;  1SNC A;  3FKI B;  4G4K A;  4R4O A;  1LLR D;  3MFY A;  2CH4 W;  4KHZ A;  4POG A;  4RKL A;  5A2Q L;  2E76 C;  3VR6 A;  5M5Y B;  4K14 A;  4DGZ A;  3Q0A A;  2G9D A;  4GOP C;  1Q86 C;  1DOL A;  1Y1V G;  1HTP A;  4DXG A;  2Q2T A;  3S16 H;  5I2X A;  1SE4 A;  1B3A A;  1KNE A;  5ISR A;  1PXU A;  1HNW L;  1STN A;  3PIP A;  2AKW B;  5K36 H;  2E2D C;  4JVZ A;  1R9T H;  5C44 B;  4AYB B;  3FVQ A;  4GKK Q;  3M7N A;  5EBC A;  1VCI A;  4A4I A;  1B44 D;  4DR7 L;  2I5M X;  1HCZ A;  2K01 A;  4IOC A;  2K1B A;  3KBX A;  5AJ3 L;  3H15 A;  3W3A A;  2NVQ H;  4WRD A;  4A3D B;  1WCM G;  1QB5 D;  2KA7 A;  3G71 A;  3S14 H;  1JJG A;  3PO3 H;  1HJP A;  2AQ3 B;  4HAE A;  3HOU G;  2WB1 B;  1I5F A;  1B8A A;  4CKC A;  2Z6K A;  4EQP A;  5DM6 3;  1PV4 A;  1EU4 A;  1H9J A;  3I4M H;  3P7J A;  5A35 A;  3HZX A;  4F87 A;  5LMU Q;  2B39 A;  1HQR D;  4DR6 L;  1SEB D;  2Q8T A;  4C1N K;  4MIU A;  5EBD A;  4B3S Q;  1ZKO A;  5EKK A;  2E5L Q;  4B08 A;  3S1Q H;  3TQY A;  5K36 G;  3RUZ A;  1PRT C;  3CCR A;  2N49 A;  3PQI A;  1WOC A;  4LF5 Q;  2BOS A;  4JI4 Q;  2JA5 B;  3H0G G;  2B8F A;  4KKT A;  2K75 A;  4HED A;  3TP7 A;  1IBK Q;  1O80 A;  4U67 3;  1E2Z A;  1BVS A;  2F4V Q;  4DNR B;  1WCM H;  5LMN Q;  2ZXR A;  1Q82 C;  3DEO A;  1R9T B;  1CTM A;  1LT5 D;  2BE5 D;  1FNW A;  1LT3 D;  2ENB A;  5FK9 C;  1BCP D;  3H0G B;  1VQJ A;  5IWA L;  2ID0 A;  2I07 B;  4RWS C;  2C35 B;  1STG A;  1HQM C;  1RTN A;  1EY4 A;  2A73 B;  1K9M C;  1STB A;  2UUB L;  1I94 L;  1HA6 A;  4A3E B;  2B2W A;  4DFA A;  3PUX A;  4JG2 A;  3CRK C;  3AEV A;  3S15 H;  1PZI D;  4X3T A;  4JI7 Q;  2NUC A;  3K8A A;  4JBM A;  3S24 A;  3F2B A;  5DM7 3;  3TZD A;  2SDF A;  2CKZ B;  2CQO A;  1M1K C;  4V0B A;  2JA7 B;  4FVM A;  1AE3 A;  1QUQ B;  2KHS A;  2LXJ A;  4A3D G;  4ME5 A;  4EQO A;  5GQO A;  4DV4 L;  1I4G A;  5T1G A;  4LFA L;  3D4W A;  1Y8O B;  4DV7 Q;  4RKB A;  1LAB A;  2Z1C A;  4HID A;  2V1C C;  1UNS A;  1VQ7 A;  2E2H H;  3X3M A;  4ODG A;  1ET6 A;  5CBE E;  1H9S A;  3QOL A;  3HOW B;  4HJ7 A;  2RHS B;  3M4O H;  1Q90 A;  1X9N A;  4A75 A;  4L5R C;  1Z47 A;  2DY8 A;  2WFW A;  2JP1 A;  1MKH A;  3S1R B;  2UU9 L;  3C46 A;  3MAQ A;  3K6O A;  3CQZ B;  2HIV A;  1N34 Q;  2MO0 A;  1WD0 A;  2HQL A;  4C3I H;  3I2Z A;  5C0X I;  2JA8 H;  2E74 C;  4JV5 Q;  2AQ1 B;  1BF4 A;  1EU3 A;  4I7A A;  2UXD L;  4MNO A;  2GVB A;  2F0I A;  4HR7 B;  1Y1W B;  4JV5 L;  1Q1E A;  1B3Q A;  4RFB A;  1ICF B;  4N8X 1;  4JYA L;  4RA8 A;  5BR8 L;  1Q3L A;  2IHF A;  4B9W A;  2NZO A;  2K33 A;  4U68 A;  4C3H B;  2LKV A;  3SE0 A;  4FXG C;  1IKL A;  2VS1 A;  5E4X A;  1IL2 A;  1G6Z A;  1ZYR C;  1C48 A;  1J6Q A;  4L8J A;  1PH5 A;  1AW7 A;  4L5Q A;  4DV0 L;  5L37 A;  2R7F A;  3N52 A;  3CPF A;  3H3V I;  4IAL A;  4BY1 B;  1SND A;  1JIC A;  3EA6 A;  1EEF D;  1NNX A;  4XQQ A;  4A3K B;  2NN6 I;  3GQB A;  1SR3 A;  4GS3 A;  2KJX A;  1WTH A;  5IP9 H;  4LF8 L;  1EUJ A;  2PW7 A;  3EN2 A;  5C4X H;  4HIM A;  2WKD A;  1V1Q A;  1NE3 A;  4A3B G;  3U9O A;  1YJ9 A;  4QB4 A;  5IGG A;  1IXR A;  4FF3 A;  1Y8N B;  1YNX A;  3L9A X;  2EXZ A;  3GTL H;  3QB3 A;  4LW1 A;  2K6A A;  1QVC A;  2NVT B;  2PQA A;  1X65 A;  1KLU D;  1ENA A;  3GV6 A;  3KJP A;  3NHH A;  1JOQ A;  5CV6 A;  2LMC B;  2CQA A;  1FYC A;  4P71 A;  5IE8 A;  4BY7 G;  3FPU B;  4L5S A;  4GN5 A;  3ITP A;  4GNX A;  1N33 Q;  4LF8 Q;  1LTR D;  4AH6 A;  2OCE A;  2NVY H;  3L3O C;  4NDX A;  1ML0 D;  5JVG 3;  4IFD I;  2SNM A;  5M5X H;  2KCM A;  2RCF A;  4IUP A;  1PH8 A;  3DM1 A;  4LMQ D;  3GTJ B;  1K8O A;  4DV2 Q;  3RZO B;  1IZ6 A;  1GKH A;  3TBI B;  1PMR A;  1PYB A;  4K2K A;  2JA8 B;  2EE1 A;  4ZYS A;  5C3E H;  3N6R A;  1G8Z D;  3OHX C;  4GKJ Q;  3TP6 A;  5CV9 A;  4AQY Q;  5CGK A;  1QVG A;  3OTO Q;  3KYH C;  4RHR A;  1IKM A;  4GKJ L;  3NQI A;  1HR0 Q;  1PZJ D;  1OXU A;  1ASY A;  2EJG C;  1HXY D;  3CCE A;  3KLS X;  3U50 C;  5M5W B;  3LWU A; 
#chains in the Genus database with same CATH homology
 3RNU A;  3HOV G;  2IX0 A;  1VQM A;  1U5K A;  1MJE A;  1CKN B;  3CMA A;  1YHA A;  3PO2 G;  1GO3 E;  2UUA L;  4UPA A;  4APV A;  4BXX H;  1X56 A;  4A3E H;  1L1O B;  1N36 L;  1VQA A;  1TWH H;  4A3M H;  1HH2 P;  3UDG A;  4JI2 L;  4LF9 L;  1XMQ L;  5AJ3 Q;  1HNX Q;  3GTQ H;  1KXL A;  4O0A A;  1NMG A;  2ES2 A;  1VQO A;  4QL5 A;  3HKZ G;  4HJ5 A;  4JI6 Q;  5GAD C;  4JI8 L;  5GAE C;  4LFC L;  3G48 A;  3ER0 A;  4LF5 L;  4OX9 Q;  2VNU D;  2F3I A;  2EXD A;  3STB D;  1GD7 A;  4XTC S;  5ELO A;  4Y52 H;  3E9H A;  4AIM A;  2NZH A;  2YYZ A;  1FJG Q;  3TRZ A;  1ASZ A;  2RCN A;  4K0K Q;  3HOZ G;  2WAQ G;  1M90 C;  1K8G A;  1C9O A;  4HJA A;  4GLA C;  1VQF A;  3SGI A;  2BH2 A;  4Y7N H;  1CSP A;  4JBW A;  4DV0 Q;  2JA6 H;  2UUC L;  4DR5 Q;  3K80 C;  4ALP A;  3I56 A;  3CC7 A;  3GD7 A;  3PF5 A;  4A3C H;  3J81 c;  1BBU A;  1YIJ A;  1NBW A;  4PMW A;  4OWX B;  3CC4 A;  2K5H A;  2ZM6 L;  3GTK H;  3K7A H;  1N9W A;  4GLX A;  1FVI A;  1Q8K A;  1X3G A;  4JI1 L;  1VQH A;  4J15 A;  4KI0 A;  1PH1 A;  1G6P A;  4WJ3 M;  3CD6 A;  1J5E Q;  2Q2I A;  1WI5 A;  1VQN A;  2YV5 A;  1TWG H;  4LNQ A;  2R93 G;  2MQH A;  5C4X G;  3L0O A;  4MTN A;  3E0E A;  4NXN L;  1YJW A;  5IY0 A;  4LFB L;  1X3F A;  4A76 A;  1JJC B;  3CME A;  3K81 C;  4GNX C;  4OXP A;  3NEN A;  5C3E G;  1EQR A;  2K14 A;  3JC6 6;  3GTP H;  2VQF L;  1YI2 A;  4DK3 C;  3NBH B;  4DUY Q;  1EFW A;  3HOY G;  2JJQ A;  4LF6 L;  4A3J H;  3A74 A;  3UE0 A;  2LXK A;  3S2D H;  1PH2 A;  1VQL A;  3GTM H;  4A3J G;  2VUM H;  4LFB Q;  3MEF A;  1YIT A;  4OON A;  1I6H H;  1VQC A;  4QGU A;  1N32 L;  4X6A H;  1N8R C;  1E7Z A;  1SLJ A;  3J80 c;  1OTC A;  3CCV A;  1EIF A;  4UP8 A;  4JI0 Q;  1Q12 A;  2PI2 A;  4YCW A;  2FXQ A;  2OQK A;  4JI3 L;  3HKS A;  1MIU A;  2AWO A;  3PSI A;  1A63 A;  4X64 L;  2KEN A;  2KHI A;  2PI2 E;  3CP0 A;  4JI1 Q;  3UDX A;  4JI0 L;  1BKB A;  1L2F A;  1V9P A;  4LF4 L;  4POF A;  1L1O C;  2I5H A;  4HJ9 A;  2A19 A;  2JEB I;  3DM3 A;  1VQ6 A;  2VY3 A;  3AFQ A;  4DV3 L;  1PH9 A;  2UXC Q;  2B3G A;  1LM0 A;  4X66 L;  3AFP A;  4UP9 A;  4X62 Q;  1Q1B A;  2NVX H;  2HHH Q;  2AHO B;  4GNX B;  2UUC Q;  1LYL A;  4DV7 L;  3AYH B;  3PCO B;  5HGQ A;  1XMO L;  4QY7 A;  1O7I A;  2ZTD A;  4IPD A;  3HOZ H;  1VQP A;  3FHW A;  4A93 H;  2ASB A;  1D7Q A;  2XGT A;  3G4S A;  1K8A C;  1KD1 C;  4DR4 Q;  2NN6 G;  2Z0S A;  3PF4 A;  2WP8 J;  3KFU A;  1IBM L;  4TQU S;  3FKI H;  3CW2 C;  4LUO A;  5LMU L;  3W1B A;  4DR1 Q;  4XIG S;  4DR6 Q;  2N8N A;  4AYB E;  5IWA Q;  1B7Y B;  5JJI A;  4R4T A;  1SFO H;  2ATW A;  1XTD A;  4R4Q A;  1C0A A;  2DGY A;  4IJH A;  5FLM G;  5C44 G;  4A3K G;  2Q2H A;  3UDI A;  1EYG A;  4AYB G;  2YU9 H;  3CCJ A;  2ZM6 Q;  4BY1 G;  1TXY A;  3PUY A;  5EAY A;  3ZJY C;  1S40 A;  2I0Q A;  5M5W H;  4DKA C;  1QZG A;  1OXX K;  4DAY B;  4X62 L;  2F4V L;  3OW2 A;  5H1S E;  2QGQ A;  1SRO A;  3EIV A;  4JBJ A;  4OWW B;  3CC2 A;  1YZ6 A;  1T9H A;  3HFZ B;  3PUV A;  2N3S A;  4DNI A;  3A5U A;  2B29 A;  2A8V A;  2QEX A;  1JJ2 A;  2EQS A;  2R7D A;  3ICE A;  1UWV A;  1PH6 A;  4DR7 Q;  2PQA B;  3W5O A;  1J5E L;  1E1T A;  4NB3 A;  4R4O A;  4A3F H;  4JI5 Q;  4DR4 L;  3KLW A;  1I3Q H;  1QZH A;  2R7Z H;  4IO9 A;  1XMQ Q;  1HNX L;  2CCZ A;  4KHZ A;  1OXS C;  5ELN A;  3PV0 A;  1XMO Q;  4POG A;  3FKI G;  4GLV B;  4A93 G;  3BZK A;  1Z9F A;  1PA6 A;  4GOP C;  4R1J A;  4YWM A;  1KHI A;  1XJV A;  1Q86 C;  2VUM G;  4BBS H;  1Y1V G;  4PG3 A;  3HOX G;  2E2J H;  2Z6K C;  1L0W A;  3RLF A;  2F52 A;  4LF9 Q;  2Q2T A;  4OO1 I;  1P16 A;  2L15 A;  1E24 A;  1A62 A;  3RZO H;  3S16 H;  5M3F H;  1KL9 A;  4A3C G;  2DUD A;  5M3M H;  4YWK A;  3GTJ H;  3CXC A;  1EWI A;  3HOV H;  4DV1 L;  1CUK A;  3CPW A;  3S2H H;  5C44 H;  2E8G A;  1HNW L;  3PO2 H;  3PIP A;  5JJL A;  2AKW B;  3PIO A;  4B3M L;  2B63 G;  1R9T H;  3J80 i;  4A3B H;  1VQG A;  4DUZ L;  5JEA J;  3M7N A;  4GKK Q;  1Y1W H;  1VCI A;  1WYD A;  3GO5 A;  4A4I A;  3CF5 A;  4DR7 L;  1YEZ A;  1CSQ A;  1EOV A;  2I5M X;  3BZC A;  3CCS A;  4GOP A;  1P8L A;  1HR0 L;  4A3F G;  4YCU A;  3HKZ E;  1B70 B;  2Y0S G;  3BJU A;  5IP7 H;  4JI2 Q;  2D0O A;  4IOC A;  2IX1 A;  5AJ3 L;  4JOI C;  1YJN A;  1RL2 A;  2I5L X;  3H15 A;  1SN8 A;  2NVQ H;  1JMC A;  1KIX A;  4B3M Q;  1PHJ A;  5LMN W;  1QVF A;  2H5X A;  1WCM G;  4X65 L;  3S1R H;  2OQ0 A;  4LF6 Q;  3PUW A;  2Y0S E;  3G71 A;  3HOU H;  3S14 H;  5E7N A;  1JJG A;  2HIX A;  1HJP A;  2JK8 A;  3HOY H;  3PO3 H;  3MXN B;  1XNR L;  3HOU G;  1I5F A;  3I4O A;  4IPC A;  1TWC H;  3TEH B;  1B8A A;  4QJF A;  4DR2 Q;  3I4M G;  2JA6 G;  2Z6K A;  1E22 A;  1G29 1;  4BBR G;  3I4N H;  1PV4 A;  3I4M H;  4JI7 L;  4JYA Q;  2OTJ A;  4DV5 Q;  1K73 C;  1X54 A;  2MNA A;  2RHQ B;  1VQB A;  5LMU Q;  4DR6 L;  1V43 A;  5FLM H;  1D8L A;  1NMF A;  3ULJ A;  3CQZ H;  3CAM A;  3KF6 B;  4LFA Q;  3UE1 A;  4X65 Q;  4O2D A;  1WJJ A;  2E5L Q;  4B3S Q;  4B3R Q;  4PZ7 A;  5GAG C;  3D0F A;  3S1M H;  3S1Q H;  3TQY A;  2IY5 B;  5K36 G;  4OWT B;  1LTL A;  3CCR A;  3L2P A;  2N49 A;  3Q8D A;  5JEA G;  1WOC A;  2JA8 G;  4LF5 Q;  2LSS A;  4P75 A;  2QA4 A;  3ULP A;  4JI4 Q;  2BA1 A;  3H0G G;  4BXX G;  4IPH A;  3A5Z B;  2K75 A;  1HR0 W;  4IPG A;  1KQS A;  3B6Y A;  1YVC A;  4JOI A;  1IBK Q;  4P72 A;  4UP7 A;  3T1Y L;  4QIW E;  3M3Y H;  1H95 A;  1BVS A;  1CKO A;  1SRU A;  1HZC A;  2F4V Q;  2A1A A;  3KOJ A;  1KRT A;  1WCM H;  5LMN Q;  4YHH Q;  1Q82 C;  4BBR H;  3F1Z A;  3I4N G;  1RIP A;  1JE5 A;  1PH7 A;  1A8V A;  1L1O A;  3I55 A;  4P73 A;  3RN5 A;  4A3I H;  3HOW G;  5IYD G;  5FLX c;  3CCL A;  4IFD J;  1VQJ A;  3J81 i;  3TRE A;  2R92 G;  4JI5 L;  2BA0 A;  5IWA L;  2ID0 A;  4GN4 B;  4LFC Q;  4JBK A;  4OX9 L;  3LGJ A;  2C35 B;  5HY6 A;  3J81 j;  1IBL Q;  1K83 H;  3PGZ A;  1K9M C;  4IJL A;  1VQ5 A;  1WFQ A;  1TWF H;  1UE5 A;  3JAM c;  3KJO A;  2UUB L;  1X55 A;  1N36 Q;  1I94 L;  2UU9 Q;  2E5L L;  5GAH C;  3F8T A;  4A3L G;  1HNW Q;  1YBY A;  4DR2 L;  3PUX A;  1AE2 A;  3H3V H;  1XPU A;  4JG2 A;  3AEV A;  1E1O A;  3S15 H;  1HZ9 A;  4EQ5 A;  2YTX A;  3RLN A;  4DR3 Q;  4LUV A;  4LF7 Q;  4A3E G;  3RN2 A;  4NXM L;  4JI7 Q;  3K8A A;  4DV1 Q;  3F2C A;  3S24 A;  1Q7Y C;  4JC0 A;  3F2B A;  1XPO A;  4JBM A;  2D62 A;  3H0G H;  4DV2 L;  2ZJQ A;  1K0R A;  1X3E A;  1HNZ Q;  2CKZ B;  2JA9 A;  3GTG H;  3KF6 A;  3TS2 A;  3BU2 A;  2CQO A;  1M1K C;  1I50 H;  1C7Y A;  4LF4 Q;  1PVO A;  3PUZ A;  2RF4 A;  5IYB G;  4B3T Q;  4KHP Q;  1KAW A;  1A0I A;  4NXN Q;  1AE3 A;  1QUQ B;  1PH3 A;  3U4V A;  3S1N H;  2LXJ A;  4A3D G;  2CWP A;  2R7Z G;  1Y14 B;  1VQK A;  3T1H L;  3RLO A;  5GQO A;  2JEA I;  1FJG L;  2HT1 A;  4DV4 L;  1TWA H;  4B3S L;  3K7U C;  2K5V A;  4R4C A;  4LFA L;  1Q81 C;  1IBL L;  2JA7 H;  4DV7 Q;  2ZJR A;  4B3R L;  4MZ9 A;  1IYJ B;  4HID A;  1VQ7 A;  3OYY A;  2V1C C;  5DLQ E;  2EIF A;  3ULL A;  1JB7 A;  3JAM i;  2E2H H;  1X6O A;  2R92 H;  2UXD Q;  1VQ9 A;  4HJ7 A;  2RHS B;  3M4O H;  2VQE Q;  2K50 A;  3KDF B;  1X9N A;  4A75 A;  1N34 L;  4X66 Q;  4A3L H;  2KCT A;  2UXB Q;  1U0L A;  4DUY L;  4L5R C;  2WFW A;  1Z47 A;  4DR3 L;  1S3O A;  3G6E A;  1FL0 A;  1MKH A;  1I94 Q;  4DV6 Q;  1NTG A;  2UU9 L;  3S17 H;  2YTY A;  2HIV A;  1N34 Q;  3CCU A;  2IHE A;  2MO0 A;  4A3K H;  2HQL A;  3L7Z C;  4PZ8 A;  3I2Z A;  4C3I H;  5C0X I;  2JA8 H;  3J7A 5;  3DLL A;  2AWN A;  4FDB A;  4JV5 Q;  1Y1W G;  2R93 H;  4BY1 H;  1HZA A;  2UXD L;  4MNO A;  2GVB A;  2JA5 G;  1W2B A;  4A3G G;  3AQQ A;  1HZB A;  1YHB A;  3M4Q A;  5GRO A;  2N78 A;  1CKN A;  3VDY A;  1Q1E A;  1NJI C;  4JV5 L;  4YWL A;  1W3S A;  5IYB H;  4JYA L;  3M9B A;  4NPS A;  2MFI A;  5BR8 L;  2IHF A;  4A3D H;  5M5Y H;  2NZO A;  1PH4 A;  2KBN A;  1IL2 A;  2VS1 A;  2WB1 E;  4YHH L;  4YCV A;  5C0X J;  2PMZ E;  1J6Q A;  4GOP B;  1YHQ A;  4WJ4 A;  1VQ4 A;  3W1G A;  2VQE L;  3T1Y Q;  1PH5 A;  4DV5 L;  5IYC H;  1E3P A;  2K52 A;  1DGS A;  4LUZ A;  3CCM A;  4L5Q A;  4DV0 L;  2HHH L;  4RG1 A;  1FGU A;  2VL6 A;  4JCV E;  2R7F A;  1UE1 A;  4KLK A;  5M3M G;  4DR5 L;  1VS0 A;  4BBS G;  2OWO A;  1OXT A;  3CPF A;  1KRS A;  4LF7 L;  3H3V I;  2WB1 G;  4LWC A;  2MO1 A;  4IOA A;  3NEL A;  4JI4 L;  5C0X G;  3M85 A;  5M3F G;  3T1H Q;  5JJK A;  2UUB Q;  1CKM A;  4DV4 Q;  1OXV A;  4HJ8 A;  1SE8 A;  4P74 A;  1KC8 C;  4JI3 Q;  3WWV A;  2KHJ A;  2NN6 I;  1SR3 A;  4GS3 A;  5IP9 H;  4TVA B;  4X64 Q;  4AQY L;  3OTO L;  3U4Z A;  1EUJ A;  2ZJP A;  4LF8 L;  4A3G H;  3EN2 A;  5C4X H;  5J3B A;  1MJC A;  5IP9 G;  4A3M G;  4HIM A;  1Q46 A;  4C3J H;  1N32 Q;  1PFS A;  1V1Q A;  3TS0 A;  1NE3 A;  4BA1 I;  4A3B G;  4ME3 A;  3D31 A;  4JI8 Q;  2JA5 H;  1XNQ Q;  2YTV A;  1SMX A;  3A0J A;  1YJ9 A;  4OO1 G;  4GKK L;  4DPG A;  2D0P A;  1IXR A;  1VQE A;  1YNX A;  2GVA A;  3IRB A;  4HIO A;  3GTL H;  4NXM Q;  4LW1 A;  2NVT H;  1QVC A;  2PQA A;  5FJ8 G;  1X65 A;  3E9I A;  1LUZ A;  4HIK A;  1S72 A;  5IYC G;  3I7F A;  4YY3 Q;  5FJ8 H;  2UXB L;  1Y1V H;  3HOX H;  3U58 A;  4L5T A;  3KJP A;  1IBK L;  2UXC L;  2BH8 A;  5IT9 c;  1N33 L;  4C2M H;  3KF8 B;  4P71 A;  5IE8 A;  1AH9 A;  4BY7 G;  1NY4 A;  4L5S A;  4GN5 A;  2AMC B;  4DR1 L;  1JT8 A;  4GNX A;  4H02 A;  4K0K L;  4JI6 L;  2PNH A;  3KDF A;  3NEM A;  4LF8 Q;  1N33 Q;  4AH6 A;  2JE6 I;  2R6G A;  2JQO A;  2OCE A;  2XTI A;  4DUZ Q;  3J7Z C;  2NVY H;  2E2I H;  1G51 A;  2B63 H;  4DAM A;  4IFD I;  4YY3 L;  4R4I A;  4EX5 A;  3M4P A;  5LMN L;  3RZD H;  4B3T L;  4KHP L;  4C3H H;  2KCM A;  3EBE A;  5M5X H;  2VW9 A;  2CFM A;  4DV6 L;  2OTL A;  1PH8 A;  1XNR Q;  2VQF Q;  1BBW A;  1PYS B;  1GVP A;  2GN5 A;  3CCQ A;  4DV2 Q;  3UDF A;  4PZ6 A;  1IZ6 A;  1GKH A;  2ZTE A;  4DK6 C;  4DV3 Q;  1QUQ A;  1PYB A;  1XNQ L;  3STB C;  1K3R A;  1EQQ A;  3F2D A;  1VQ8 A;  5C3E H;  3FP9 A;  5IP7 G;  3GDE A;  3PO3 G;  4BA2 I;  1XPR A;  1UEB A;  5C4J H;  3ERS X;  4GKJ Q;  1EIY B;  4AQY Q;  1QVG A;  2Q2U A;  3OTO Q;  4UY8 C;  5BR8 Q;  1VQD A;  3KYH C;  2WAQ E;  2K5N A;  1VQI A;  2ALY B;  1UE6 A;  4A3I G;  5IYD H;  2JA7 G;  2CWA A;  2VZA A;  4GKJ L;  1HR0 Q;  4QQB X;  1UE7 A;  1OXU A;  1ASY A;  1IBM Q;  4BY7 H;  3CCE A;  2K4K A;  2ZTC A;  4IFD G;  3RR5 A;  1HNZ L;  1GM5 A;  3HOW H;  2IT1 A;  3K0X A;  4RMF A;  2UUA Q;  3U50 C;  3GTO H;  4GN3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...