4LF4Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf4Q00
4EQ5A 1HZ9A 1N33Q 2IX0A 2NN6I 2E2HH 3W1GA 1L0WA 3L0OA 1JT8A 3HOXH 2Z6KC 4IPHA 5IYCH 3E9HA 3KOJA 4B3TQ 1HNWQ 3J80i 1PYSB 3UE1A 5GAHC 5K36G 1U5KA 3S16H 5LMNL 4O2DA 3PF5A 4LUVA 1HZCA 1QVCA 4YCVA 4APVA 4DV4L 2EIFA 3RR5A 1S72A 1VQCA 1MKHA 4C2MH 4A3GG 3L2PA 2JEBI 5BR8Q 2MNAA 2N49A 4DUZL 3HOUG 4DR4Q 3T1HQ 3S15H 4OXPA 2VQFL 4DAYB 2WB1E 1MIUA 5AJ3L 2PI2A 4JBMA 2F4VL 1N34L 2IX1A 3H0GG 1QZHA 1IBLL 1PVOA 2E5LL 4BY1H 2K5HA 4DV1Q 4X66L 1YNXA 2CWPA 2JK8A 2OQ0A 1N36L 1PH6A 4UP8A 4JI8L 3GTMH 4A3CG 2BH2A 2EQSA 2LXKA 1UE5A 4JOIC 1CKMA 1EUJA 3HKSA 4FDBA 1E1TA 3ER0A 4HIKA 1R9TH 1IBKL 1XPRA 2ES2A 3A5ZB 1B7YB 3I7FA 3ULJA 1OXTA 2HQLA 4A3KH 4X65Q 1XMOQ 5GAEC 1UEBA 1XPUA 1UE7A 1L1OA 1M1KC 4A3BH 1XNRQ 4DV2Q 4P73A 4GOPB 4NXML 3ZJYC 3CCQA 4JI0Q 1Y1VG 3RN5A 3H15A 3CCUA 3RNUA 3VDYA 2Y0SG 3BZCA 1X54A 4DKAC 5M5YH 4JV5L 3LGJA 1FVIA 2AWOA 3RN2A 3HKZG 1HJPA 4LFCL 3NENA 3S14H 2I5MX 5M3FG 1SRUA 2KCTA 5J3BA 5M5XH 4A3JH 2B3GA 4BXXG 3E0EA 1N32L 3UDGA 2UUAL 4BA2I 4IFDI 2HT1A 3G48A 2KENA 4GLAC 3CCMA 3H0GH 2JE6I 4LF6L 2LXJA 4JI3L 3CMEA 4DR2L 2R7ZH 4LNQA 1U0LA 3HOVH 4JI7L 1ASZA 3GDEA 1HR0W 2UUCL 2RHQB 2ZTDA 2VQFQ 3AFQA 5HY6A 3ULLA 4DV0Q 1AH9A 3CW2C 5IY0A 5IP7G 3CCVA 2VY3A 1I94L 2F4VQ 4JYAL 1IL2A 1I3QH 4JBKA 1IBLQ 3HOYH 1Q1EA 4ALPA 1E3PA 2IY5B 2VS1A 4JOIA 4L5TA 1CSQA 1NE3A 3U4ZA 1A62A 2NVYH 2L15A 3H3VI 1YJWA 4LF4Q 4PMWA 1YIJA 1VQ9A 4B3TL 1PH2A 2ZM6L 1TWFH 2NVTH 1X3FA 1GO3E 1VQ5A 2D0OA 1YHBA 4YHHL 2YYZA 4GS3A 3G71A 3AEVA 1PH1A 4BXXH 2RCNA 4R4QA 1FGUA 2ID0A 3KF6B 4IFDG 3D0FA 3KF8B 5C4JH 3FHWA 3OTOQ 1YI2A 1LYLA 1Q86C 4B3RL 2N78A 1GD7A 2RF4A 1G6PA 5BR8L 3S24A 1VQPA 1Q12A 4JI1Q 1G51A 3NBHB 4UY8C 4JV5Q 2VUMH 2UXDL 3CCLA 4P74A 1VQ7A 3E9IA 5C0XJ 1N8RC 1KRTA 3J81i 1MJCA 4IPGA 2BH8A 4C3JH 1QZGA 2UUAQ 1RL2A 3AFPA 1CSPA 4WJ3M 1SR3A 1M90C 1C9OA 5DLQE 2JA7H 4DR6Q 2UXCQ 2QA4A 4UP7A 1EWIA 4PZ6A 4POFA 4DR2Q 1I6HH 5IYDH 3L7ZC 3J81j 1NBWA 4DR1Q 2JA8G 1XMOL 3FP9A 2ZJRA 4WJ4A 1VQ6A 4GNXB 1EQQA 4IPDA 3W1BA 3BJUA 4DV2L 1YBYA 1JJ2A 2H5XA 2MQHA 1V9PA 4R1JA 3T1YQ 2WP8J 4JI0L 4GKKL 1ASYA 2Q2TA 4XTCS 1VQ8A 4C3IH 5C44G 4HJ7A 2NZOA 1YHQA 2MO0A 2ZJPA 1PH5A 1OXXK 1EOVA 3I4MH 3TRZA 4BBSG 2XTIA 4UP9A 1EYGA 3DLLA 1CKOA 1EIFA 1XJVA 1B8AA 1LM0A 5M5WH 2ZM6Q 3ERSX 1PH7A 4MTNA 4QIWE 4TVAB 4YHHQ 3GTJH 2R92H 2VQEQ 3CQZH 5IP9G 1JJCB 4OONA 4P72A 3STBD 5GQOA 3F2BA 4L5QA 3F1ZA 1V1QA 4EX5A 1VQKA 2B29A 4B3RQ 2K75A 1KC8C 1I5FA 4MNOA 4OO1G 3S1QH 1E1OA 2HHHL 1X3GA 3JC66 4DV0L 3CXCA 1VQBA 1Y1WH 2B63G 5M3MG 3G6EA 3F2CA 1YITA 2UXDQ 2BA1A 4YWLA 1X55A 1HNXL 3B6YA 1UE1A 3GD7A 2Z0SA 2QEXA 1HNZL 3CF5A 4A3EH 4A3DG 4IOAA 4A3FH 1H95A 2WAQE 1NY4A 2CKZB 3GO5A 3J81c 1D7QA 3GTGH 4DUYL 2IHFA 4BBSH 4R4OA 3CAMA 3TQYA 2EXDA 4YY3L 3EIVA 4BY7H 1YVCA 4LF4L 4A75A 4KHZA 1IXRA 3K80C 2PI2E 1RIPA 3ICEA 4J15A 2D0PA 1JJGA 3RLOA 2VW9A 4IFDJ 4OX9L 3CC2A 4DNIA 3A5UA 3J7A5 3H3VH 5FLMG 2I5HA 1SE8A 2JQOA 4AH6A 3OTOL 3CCEA 4DV6L 1XMQQ 1SFOH 1HH2P 1VQIA 4PZ8A 1K73C 4GKKQ 4B3ML 3A0JA 3U58A 4JI1L 4DK3C 1S40A 3M4PA 3TEHB 4DV5L 1QUQA 1O7IA 2ZTEA 4YCUA 3STBC 4AYBE 1GVPA 1JMCA 2KCMA 1NJIC 1CKNA 2F3IA 2OWOA 4YWMA 1Q46A 5JJLA 3KJPA 2KHIA 2YTVA 3HOUH 3S17H 4LF8L 1EIYB 1HR0Q 1L1OB 5M3MH 1PH8A 2PQAA 3JAMc 2CQOA 1K3RA 4A3IG 1J5EQ 2JA6G 3PO3G 5ELNA 1Q1BA 5C4XG 4DR6L 2UXCL 4NB3A 3NELA 2ATWA 5C3EG 3K8AA 2A19A 1WCMG 3KDFA 3CCRA 4A3CH 4JI5L 1VQAA 4DR1L 1IYJB 2IHEA 4ME3A 1V43A 2VL6A 2HHHQ 2VNUD 1VQMA 3RLNA 4BBRG 1PH4A 1IBMQ 1WFQA 1VQHA 3UDFA 3T1YL 3M9BA 1K0RA 4HJAA 1HNXQ 4GLVB 4DK6C 1HNZQ 2WB1G 3MEFA 2E2IH 3BU2A 3W5OA 1WYDA 3SGIA 2N8NA 4DUYQ 1KD1C 1Y1VH 4JI4Q 4YY3Q 4LF5Q 1BBUA 3PCOB 3UDXA 4LW1A 3PIOA 5IE8A 2R93G 4P71A 3F2DA 2C35B 1X3EA 1TXYA 4X64Q 2VQEL 3PGZA 5M3FH 4A76A 3OW2A 3CC4A 1VQ4A 4OX9Q 3CD6A 3I4NG 4A93G 1A8VA 5FJ8G 3PO2G 4IJLA 1XPOA 4A3LG 4OO1I 4DV6Q 2GVBA 3FKIG 4BA1I 1KIXA 4RG1A 4GN3B 1Q82C 1SN8A 4B3SQ 2KBNA 4B3MQ 1PYBA 5LMNW 5GROA 5LMUL 1Y14B 2OTLA 4DV5Q 1NMGA 2E2JH 1YJNA 4A3MG 1VQGA 2NVXH 2UU9L 3GTOH 2K52A 2OQKA 3I56A 4R4CA 4DAMA 4LF8Q 3BZKA 4AYBG 1YEZA 1J6QA 5IP7H 1LTLA 2GN5A 2K5VA 3CMAA 1VQOA 1Q81C 1PHJA 4L5SA 1PH3A 1VCIA 1UE6A 1EQRA 3PIPA 4DPGA 3PSIA 3A74A 3PUVA 3Q8DA 3PF4A 4IJHA 1E24A 4POGA 4JI5Q 2DGYA 4OWXB 3CC7A 1BKBA 3I2ZA 1UWVA 2A8VA 4DV7Q 2A1AA 4TQUS 3S1RH 5IYCG 3G4SA 2MO1A 1K8GA 1TWGH 1XMQL 1B70B 3PUZA 4QL5A 3OYYA 2WFWA 1QVFA 4KLKA 4UPAA 1XNQL 1C0AA 3CPFA 4MZ9A 2NVQH 2D62A 3KYHC 4GN4B 3U50C 5FJ8H 4A3LH 2PNHA 4LF9Q 2FXQA 1D8LA 4DR5Q 2DUDA 1FJGQ 1SROA 1WI5A 3JAMi 2OTJA 3KFUA 1X56A 3EBEA 1HR0L 1VQLA 1NMFA 4DV3Q 4RMFA 1J5EL 4LFAQ 5FLXc 3K81C 3RZDH 1A63A 1PFSA 2VZAA 1VQDA 2R7FA 3CP0A 1SMXA 4R4TA 3PV0A 2I0QA 1Q8KA 4BY1G 3AYHB 1DGSA 1VQFA 2Y0SE 4A4IA 1Z9FA 4NXNL 3HKZE 3TS2A 5LMUQ 1XTDA 1VQEA 2AWNA 1VQJA 2AKWB 2NZHA 1MJEA 3GTPH 4A3GH 2UU9Q 1IBML 4PG3A 2JA8H 4X62L 1A0IA 4QY7A 4JI6L 3ULPA 4A3KG 4LWCA 2LSSA 2F52A 2CWAA 3IRBA 4A3BG 1SLJA 2YTXA 4LUZA 3KJOA 1WJJA 2HIXA 2K14A 3UE0A 4JI4L 4LF5L 4AQYL 1PA6A 5C44H 1YJ9A 1JB7A 4QJFA 2E8GA 1EFWA 4Y52H 3K0XA 2KHJA 2MFIA 4JBJA 4X64L 1AE2A 4YCWA 2OCEA 2Q2IA 4HJ5A 1K8AC 2Q2HA 1K83H 1K9MC 1W3SA 1KAWA 2YU9H 4C3HH 1VQNA 1KXLA 5GADC 5JJIA 3S1MH 4A3JG 2GVAA 2K5NA 3I4OA 4L5RC 4HIMA 4LF7L 5IP9H 1XNQQ 2IT1A 4B3SL 3GTQH 4QGUA 3HOZG 1C7YA 1OTCA 3GTKH 5IWAL 4GOPA 1L2FA 4PZ7A 2R7ZG 1KQSA 1HZAA 3HOVG 2HIVA 2V1CC 1JE5A 4JI2L 2B63H 4YWKA 4DR7Q 1IZ6A 4AIMA 4GLXA 4K0KL 4LFBQ 4A3DH 1E22A 2K4KA 3S2HH 3HOYG 1P16A 1YZ6A 3WWVA 2JEAI 3K7UC 1QUQB 2ASBA 4GKJL 4NXNQ 1X6OA 1CKNB 5C0XG 4DV7L 1G291 5IYBG 3GTLH 3CCSA 5JEAG 2PQAB 2Z6KA 4KHPQ 4X62Q 4OWTB 4H02A 1X65A 2Q2UA 1WOCA 4JI6Q 3M7NA 2R6GA 2NN6G 1YHAA 4JCVE 5FLMH 1W2BA 4LF9L 1TWAH 2UUBL 4DR5L 1T9HA 3KDFB 3HOWG 4QQBX 4GNXC 3M3YH 1VS0A 3M4QA 1FJGL 3J80c 4DR3L 4AQYQ 3HOZH 4KHPL 2WAQG 5LMNQ 2UXBL 1HZBA 4DV3L 1KRSA 3UDIA 5GAGC 4DV4Q 4LFAL 2VUMG 4KI0A 3S2DH 4LUOA 5E7NA 3DM3A 4JBWA 4DUZQ 4IPCA 4A3IH 3NEMA 2JA6H 3PO3H 2ZJQA 5EAYA 5AJ3Q 4OWWB 1TWCH 3U4VA 1GKHA 5C4XH 1P8LA 4LF7Q 5ELOA 1FL0A 4HIDA 1N34Q 2ALYB 1NTGA 4P75A 5C3EH 2JA9A 2JJQA 3KF6A 1WCMH 1Q7YC 2CCZA 5IWAQ 2E5LQ 1N33L 2JA7G 4X66Q 1KHIA 3D31A 5IYDG 4JI8Q 1OXSC 1N36Q 3RZOH 1BBWA 2AHOB 4XIGS 5IYBH 4JI2Q 3EN2A 4BBRH 1HNWL 1E7ZA 1OXUA 3F8TA 2ZTCA 1IBKQ 4IO9A 2JA5G 4O0AA 3HFZB 4K0KQ 2I5LX 2YTYA 4GN5A 3HOWH 1PV4A 3PUWA 3J7ZC 1AE3A 4HJ8A 4NXMQ 4GKJQ 1QVGA 1I50H 3CCJA 3RLFA 3I4MG 1Z47A 2R93H 3I55A 4DR4L 3T1HL 3HOXG 4JG2A 1TWHH 1X9NA 3PUYA 4LFCQ 3TREA 1LUZA 2AMCB 2N3SA 4Y7NH 4A93H 3I4NH 3M85A 2R92G 4GNXA 4X6AH 3PO2H 5JEAJ 1N9WA 4DV1L 1N32Q 3S1NH 2UUBQ 3FKIH 2RHSB 2YV5A 1GM5A 4R4IA 3TS0A 2PMZE 4DR3Q 4LF6Q 4JC0A 2XGTA 1CUKA 4GOPC 5IT9c 5H1SE 4NPSA 4JI3Q 3M4OH 4DR7L 1KL9A 4A3MH 2UXBQ 5JJKA 4HIOA 1Y1WG 2BA0A 4JI7Q 1BVSA 4LFBL 4X65L 1PH9A 3CPWA 1S3OA 4IOCA 2UUCQ 2K50A 3KLWA 1OXVA 3MXNB 4A3EG 1XNRL 2CFMA 2QGQA 5C0XI 4A3FG 2JA5H 2R7DA 1I94Q 3K7AH 4HJ9A 1L1OC 4JYAQ 5HGQA 4BY7G 3PUXA 3AQQA
chains in the Genus database with same CATH superfamily
1LACA 5FO9B 1B50A 2E2HH 2NN6I 3W1GA 4WORA 1STYA 1SYGA 3BYTB 1PFNA 1HNWQ 5JJZA 3K5NA 1U4MA 5K36G 1WCMB 1U5KA 3RD4A 4O2DA 3CU7A 2EIFA 3RR5A 1S72A 1BF4A 4KKUA 1MKHA 4C2MH 2JEBI 2O5IC 1SYCA 4OXPA 1EU3A 1D1KA 5AJ3L 3MEHA 4DGZA 2WB1B 5IT9L 3HOWB 4X66L 1YNXA 1I50B 2JK8A 3FPUB 4DXGA 1PH6A 2K7VA 4A3CG 2R93B 2EYMA 3EROA 2LXKA 1UE5A 1CKMA 1EUJA 1R9TH 1XPRA 3A5ZB 2KEDA 1XMOQ 5GAEC 1UE7A 1ENFA 1EQTA 4A3BH 1XNRQ 4KY6A 4P73A 1EYDA 2BE5D 4NXML 3ZJYC 4KHVA 5K36H 1AP0A 4A3MB 4QMGA 3HKZG 4LFCL 3GP7A 4B08A 3G6JB 2KCTA 5J3BA 1I4RA 2F0UA 5CV5A 2B3GA 4L6TB 3T4AC 4O1NA 4ZLTF 3UDGA 3K7AB 2UUAL 2EY1A 1XWEA 2NBFA 1ILQA 1PDQA 4LNQA 1U0LA 2PPBC 1HR0W 2UUCL 1CTMA 1EWHA 2VQFQ 2LS01 3AFQA 5HY6A 2WV6D 2O5JC 4CDCC 2DJGC 5IP7G 4JYAL 5EQ0A 3S16B 4JBKA 1RKNA 1E3PA 3URYA 3Q24A 4JOIA 4L5TA 3TP6A 5C0XH 2FINB 1XX8A 2L15A 4LF4Q 3S15B 1YIJA 3DWAA 4B3TL 1PH2A 1EYAA 1YHBA 4BY1B 2NN6H 1BO0A 1WTQA 4DK0A 2HQEA 2ID0A 3KF6B 3I73A 3D0FA 2RBMA 5C6AA 5C4JH 3GTMB 1LYLA 4B3RL 5A35A 1GD7A 5BR8L 2AQ1B 3E6ZX 1Q12A 2L12A 3MFYA 3NBHB 4UY8C 4JV5Q 2VUMH 2UXDL 3CCLA 2F0DA 1TQOA 2VXWA 5C0XJ 4A3KB 4DAPA 3S2HB 2JYOA 4IPGA 2BH8A 5JVG3 4R8NA 1RTNA 4M8AA 5D14A 2UXCQ 5M5YB 2QA4A 1G2TA 3N6RA 1EWIA 4POFA 4DR2Q 2CHBD 4HN7A 1I6HH 1CT1D 1YNJD 4GNXB 1EQQA 4IPDA 4DV2L 2WP8J 1LLRD 1VQ8A 3OIQA 4HMJA 1EFID 5BN3A 1YHQA 2KCCA 3HOVB 2ZJPA 3I4MH 2FFKB 1EYGA 1L0YB 3DUZA 4OHJA 5ELFA 5M5WH 3ERSX 3VYSA 3VR6A 4TVAB 4YHHQ 3GTJH 2H4OA 1C4QA 1JJCB 4OONA 5IP9G 3F2BA 5GQOA 4L5QA 3F1ZA 3TN2A 1VQKA 2Y0SB 1I5FA 3S1QH 1E1OA 3JC66 2J4XA 3CXCA 5AFWA 5EBDA 4DV0L 5M3MG 1VMCA 1X55A 4FXKC 4IOAA 4A3FH 1NY4A 3J81c 5LL6X 4DUYL 5K5PA 1ONLA 2WAQB 2X69A 4BBSH 1MSGA 1YVCA 4RH6A 5IGCA 4QF4A 2X6GA 2PI2E 3ICEA 3MVVA 4KY7A 1S4ZA 3OTOL 3A54A 4IUQA 1XMQQ 1HH2P 1QOHA 1A15A 1FNVA 1O7IA 2ZTEA 4AYBE 4E6IA 1CKNA 1HA5A 5JJLA 3HOUH 3S17H 3EFXD 5M3MH 2PQAA 3JAMc 3H6MA 5ELNA 5FO7B 1CA5A 3VR5A 2HDLA 2KQ3A 5J22A 4DR6L 4NB3A 1D2BA 2K5DA 1WCMG 2KEEA 1JQYD 1SNPA 5KEEA 1IYJB 1TS4A 1Z7TA 5FLXE 2Q8IB 3HOXB 1IL8A 1PH4A 2B2WA 1WTVA 1WFQA 3NTHA 3J7AV 1BCPC 1MD2D 1U4RA 4GLVB 1JICA 1PZJD 1HNXQ 2WB1G 3MEFA 1E2ZA 1KDAA 2CQAA 1KD1C 1DM0B 3P1HA 4YY3Q 1BBUA 4ZKBB 2EJFC 2R93G 1WTRA 4K6DA 1X3EA 3CD6A 1E2VA 1LTSD 4PQXA 3R2IA 1VQ4A 4A3LG 4BY7B 2GVBA 4BA1I 1KIXA 1C48A 1PYBA 2OTLA 1NMGA 1YJNA 1MI2A 4A3MG 1VQGA 3GTOH 4KN7C 4CDEC 3CMAA 4L5SA 4CJ2C 1PH3A 3PIPA 3A74A 1TS2A 3Q8DA 3PF4A 4A3GB 5C3XA 2FHTA 4JI5Q 3CC7A 1WTHA 1E0BA 4HR7B 1UWVA 2A8VA 1Y8PB 2F0GA 2RDFA 2L1BA 3S9WA 3S1RH 3G4SA 2MO1A 2NZ1D 3P75A 3PUZA 2PO4A 4X3TA 2D62A 3U50C 4A3LH 1WTWA 2N55A 2FXQA 2LMCB 1PLFA 4R9WA 3SK5A 1FJGQ 1SROA 1WI5A 3JAMi 3KFUA 5IIFA 1HR0L 1EY9A 4O42A 3DMUA 5D65A 4K5WA 4R4TA 3PV0A 5G3LF 4BY1G 4A4IA 1JWMD 2WACA 3OPOA 5LMUQ 2KOLA 3OW7A 1EYCA 4YIJA 2UU9Q 4PG3A 5M3FB 4X62L 2LY7A 5JOBA 4JI6L 2HCIA 4A3KG 4LWCA 1ZXTA 2F1MA 4DAYA 2CWAA 3VR3A 1PRTC 3QO2A 2YTXA 4LUZA 3KJOA 1WJJA 2HIXA 4JI4L 5NUCA 4NKLA 3X3MA 1JB7A 1G8ZD 1B3QA 4ULLA 1FNUA 4JBJA 5KYLA 4X64L 1AE2A 4C3HH 5GADC 2GVAA 1HFGA 3U9OA 4LF7L 2P5ZX 3A56A 1XNQQ 4B3SL 1DJRD 4QGUA 4ZK9B 2DY8A 5KNBA 1C7YA 3HOZG 4KKSA 2PZWA 1SDFA 3NQIA 3HOVG 2HIVA 1HUMA 2K03A 4IZ8A 1TWGB 1KLGD 2F3WA 4IUTA 3NBIA 3D6CA 2B2VC 4GLXA 4K0KL 4A3DH 1CM9A 4QB4A 3K5LA 5CR3A 3S2HH 1DCZA 4NXNQ 1CKNB 4DV7L 1G291 5IYBG 2F0TA 2PQAB 1ET9A 4OWTB 3H91A 1WOCA 1T9HA 3WDNA 3ONAB 4GNXC 1VS0A 1FGBD 1GUNA 1PTOB 4AQYQ 4DR3L 3HOZH 4KHPL 2WAQG 4KKTA 4DV3L 2JA8B 1K8MA 5E7NA 3EVQA 1RDPD 3A7AB 3QOLA 1IW7C 1TWCH 2NVQH 5C4XH 5C44B 4DAVA 2E5LQ 2JJQA 1W6KA 3QG1A 2WIIB 4EQPA 5IWAQ 5JPMC 1RD9D 5CV4A 5IYBH 3S1MB 2SNMA 1HNWL 1E7ZA 5JAVA 1SE3A 5DNFA 2HDMA 1QWYA 2I5LX 2A6ED 4XQQA 1V8QA 4FXDA 3I55A 2EYJA 3HOXG 1F9RA 3PUYA 1AN8A 5ISRA 2N3SA 2Z6BA 4A93H 3J80L 3HS0C 2ZXOA 1EY0A 4X6AH 3PO2H 2B2YC 2F0NA 1N9WA 1SYEA 3S1NH 2RHSB 4UAIA 1MGSA 4R4IA 5L37A 2O2LD 4JI3Q 4IFDG 5IT9c 5H1SE 4NPSA 2UXBQ 1KL9A 5JJKA 1LTBD 4JI7Q 1PH9A 1SYBA 3CPWA 1TWAB 1I4GA 1XNRL 2PZTA 4BY7G 2PCFB 4EQ5A 5IGEA 1HZ9A 1A2UA 1GXDC 1L0WA 4JK1C 3L0OA 1JT8A 4A3IB 3HOXH 2JA6B 2Z6KC 4IPHA 5IYCH 3KOJA 4NMZA 3PO3B 5EPJA 3HG9A 2ZT9C 4MTKA 1PYSB 3UE1A 5GAHC 1BUVT 5CBAE 3PF5A 3BVGA 1QVCA 4DV4L 3Q6SA 4NW2A 3RZOB 4A3GG 1STAA 4BBRB 2EYFA 2E74C 2VQFL 4DAYB 1PMRA 2EYLA 5FOBB 1EY6A 4JBMA 1TY0A 4CDFC 1PVOA 2CWPA 2DNEA 1N36L 4JI8L 4IN3A 1K8OA 2BH2A 2EQSA 3T16A 4JOIC 1TWHB 3HKSA 4Y7NB 1IBKL 2HUGA 1OXTA 1UEBA 1XPUA 1L1OA 4DN4M 1ICFB 1M1KC 5EGTA 5JVH3 2M00A 2O4XA 3CCQA 3W2DA 2MP1A 4JI0Q 3SK8A 3BZCA 5C3WA 4JV5L 2A6HD 5D3IB 2AWOA 4FNFA 3HZXA 2EVBA 1JR0D 4AYBB 1SXTA 5M3FG 5M5XH 4IUNA 2F0SA 4A3JH 4BXXG 3BDLA 3E0EA 1N32L 2A5HA 2TSSA 4BA2I 3TZUA 2KENA 1E2WA 1QJOA 4LF6L 1Y8OB 3M7GA 4JVZA 2E75C 3CMEA 4DR2L 2R7ZH 3QB3A 1VDZA 2FJ2A 1AFPA 1BNZA 3D8GA 1I4QA 1JCKB 1AEXA 1AH9A 3CW2C 1I94L 2VY3A 3PIP3 2K04A 1I3QH 4FYDA 1Q1EA 4ALPA 1H9JA 1X3QA 4S3SA 5E1FA 2NVYH 3H3VI 1YJWA 3NBHA 3CRLC 3DWPA 3VR2A 4EQNA 2F0HA 1VQ9A 2K01A 1X3FA 5FK9C 1LTRD 5KYIA 4YHHL 2BDNA 4BXXH 2RCNA 1FGUA 4CGYB 1YNND 1G6PA 2RF4A 1JOQA 4JI1Q 1G51A 4PMCA 3E9IA 5CBEE 1KRTA 4RHRA 5C4HA 1MJCA 3AFPA 2KUMA 1PTOD 1M90C 3RMHA 1C9OA 3SE0A 3TDQA 2QKIC 3J81j 3DHQA 3S14B 1NBWA 4K8IA 4DR1Q 2NUCA 3K58A 2JA8G 3KLSX 4K6LA 4HSVA 2ZJRA 3MXGA 3W1BA 3NSWA 3H0GB 4XYOA 1U9RA 4ZQ3A 1ASYA 4XTCS 1B3AA 1HQMC 5C44G 4F7XA 2C5CA 1SMYD 3MZ5A 4K8JA 3J7AF 1PRTF 4UP9A 3O13A 1CKOA 1EIFA 1B8AA 2ZM6Q 2EPBA 2F0PA 1PH7A 4QIWE 2IPKD 1PYWD 2R92H 3CQZH 2A68C 3HOYB 3QIAA 4EX5A 1QG7A 2B29A 2G9HD 2LFNA 3EA6A 4MNOA 4OO1G 4H0LC 2NVTB 1TWFB 1X3GA 4P2CB 2OT2A 4JW0A 5CV6A 1F2ZA 4F87A 1YITA 3C3LA 4QUFA 1HNXL 1UE1A 3GD7A 2NTTA 1H95A 4TKOB 4A3EH 2CKZB 3GTGH 2A74C 2IHFA 2Z9HA 3L9AX 4YY3L 2EXDA 2J7ZA 4I7AA 2OXPA 1IXRA 2B2UA 1BQQT 2D0PA 3CC2A 1LTAD 4C3JB 3H3VH 1ZYRD 4LK1C 1SE8A 2JQOA 1SFOH 4IUVA 3H3VC 4H44C 4PZ8A 1FR3A 4GKKQ 1FYCA 2JA7B 1Z6HA 4RKBA 3A0JA 1S40A 3TBIB 1ICWA 1BR9A 1TS5A 1X32A 4YCUA 2Q8RE 2KCMA 1NJIC 5CV8A 3BDCA 1L1OB 3I91A 4G57A 1HRJA 4A3IG 1K3RA 2JA6G 1SNMA 2JN4A 3PO3G 1JC7A 1Q1BA 2RDGA 3WOFA 4C3IB 3NELA 2ATWA 2A19A 3KDFA 4A3CH 2HD3A 4JI5L 2ZXPA 1RODA 2K5QA 2Q8TA 1D5MC 1V43A 2VL6A 4DU9A 2F03A 5D3DA 1VQMA 1O7LA 1SJED 4BBRG 1IBMQ 3K6OA 2EJMA 1GHJA 3UDFA 3T1YL 3M9BA 4HJAA 4DK6C 1VMPA 2F0VA 2NWGA 1WYDA 4LF5Q 3MA2B 1DZ1A 3PCOB 3UDXA 3PIOA 4XXEA 1Y69U 2BE5C 2GA4B 4P71A 1Y1WB 3A8KE 2C35B 1TXYA 3MC0B 3CRKC 4RGOS 2VQEL 3CC4A 4OX9Q 1I4XA 1A8VA 1XPOA 1LABA 2F0IA 1ESRA 1QILA 4R8IA 4B3MQ 5LMNW 5LMUL 3NPPA 1F2LA 4DV5Q 2E2JH 4N9PA 2UU9L 1GUOA 2K52A 1TS3A 2FMMA 4R4CA 4LF8Q 1LT5D 3BZKA 3KUPA 4AYBG 5IP7H 2F3VA 2MJ8A 1LTTD 4IQZA 1EQRA 3PSIA 2F0WA 3QOJA 1EQVA 1E24A 2PZUA 1K3BC 4OWXB 1BKBA 2A1AA 1Q90A 4QL5A 1XNQL 3OYYA 4UPAA 1F9PA 3H94A 3FVQA 3K5OA 2XRSD 3Q22A 4ZRZA 4OIJA 4RMFA 1J5EL 1KLUD 1Q8IA 3RZDH 2B2TA 4N9TA 1VQDA 2R7FA 3SXHA 4CKEA 2E2IB 4ME5A 5CV9A 2I0QA 1Q8KA 2CW0D 3TSSA 3AYHB 1Y1VB 4CJ1B 1Z9FA 4NXNL 3HKZE 1SE2A 2VB2X 3TS2A 1MJEA 3GTPH 1RCVD 3ULPA 3HRZC 3E0JA 2F52A 3SEBA 1YNJC 1TT2A 4H7BA 2Z4HA 4AQYL 1PA6A 2E8GA 5J39A 1KDBA 2NVXB 1EOTA 1WTOA 2OCEA 2Q2IA 4OL7A 1K9MC 1H9KA 5JJIA 1JWSD 1SSOA 1CFMA 4KMUC 4L5RC 5IP9H 4V190 1J8IA 3ND8A 1OTCA 5IWAL 5FLXL 4GOPA 3CKIB 2BOSA 3MWYW 2V1CC 3PMFA 1JOOA 1Y8NB 5EPKA 4DR7Q 1DYQA 4LFBQ 2RQXA 2K4KA 3HGBA 3HOYG 2ASBA 1EEID 3NWTA 2QILA 2NYZD 1QNUA 5KNDA 1H9RA 4CKBA 3VYRA 1SYFA 2C9OA 2KA7A 1B9NA 3QWNA 4H02A 1JORA 3NTIA 1YHAA 4LF9L 4DR5L 3HOWG 3KDFB 3M3YH 3M4QA 3J80c 1S5ED 1IHZA 2UXBL 3FPPA 4LFAL 4LUOA 3DM3A 3KK7A 3A7LA 4IPCA 3NEMA 2ZJQA 3BVMA 5AJ3Q 1P8LA 4HIDA 2G9DA 1SNCA 2ALYB 2XSCA 2CCZA 1WCMH 2JA7G 4FVMA 1F9SA 4X66Q 5IYDG 1K83B 2YU9B 4XIGS 2AHOB 1RF2D 2EYOA 2RSNA 3EN2A 5CMDA 4NDXA 2EXZA 3GTQB 2JXMB 1EY7A 3LNNA 3ITPA 3GTKB 4GN5A 2F0JA 3T13A 5BN5A 3HOWH 4C3IG 1PV4A 2L55A 1AE3A 4GKJQ 4HSPA 4NXMQ 1I50H 1JE4A 2R93H 4QCLA 2B63B 2QEJC 4LFCQ 3BG3A 3I70A 2F0LA 3PQIA 3M85A 2PW5A 4PMBA 2EY5A 2UUBQ 4ILWA 1HHVA 2YV5A 3TS0A 3GTLB 3V2TA 4JC0A 4CKCA 5T1IA 2PMZB 4A3MH 4XT3B 1Y1WG 2BA0A 4B9XA 5I6YA 4MIUA 2EZVA 1BVSA 1D5ZC 1PFMA 1S3OA 2UUCQ 1OXVA 2PYKA 2QGQA 4HAEA 1HA6A 3D3RA 1NSNS 3K7AH 1L1OC 4JYAQ 2A69D 1Q3LA 3PUXA 3L2PA 3OIPA 3S2DB 3IKJA 5C4ZA 4C1NK 1JOKA 1KAAA 2IL8A 4B3TQ 3E5SA 5C5LA 3J80i 4FF1A 3UI2A 2I07B 1ENCA 2CVRA 5C3EB 3S16H 5LMNL 4YCVA 3SK6A 1R4QB 1MSHA 1VQCA 3LWEA 2F0FA 5BR8Q 2MNAA 4DUZL 2L4NA 3S15H 2DY7A 2WB1E 1MIUA 2PI2A 4K14A 1N34L 1I6VC 2IX1A 1LT4D 2JP1A 4BY1H 4ZCKA 2K5HA 4DV1Q 2K1BA 3NWSA 2OQ0A 3NUCA 3GTMH 4UP8A 1STNA 5CGKA 4WFN3 1G91A 1O80A 4IUPA 1JB3A 2PQEA 3Q0AA 1E1TA 4HIKA 4ZAIA 2ES2A 3I4NB 5E3FA 4A3KH 4X65Q 4B9WA 1NUCA 3FKIB 4H13C 4DV2Q 4GOPB 1DD2A 3PIO3 4HCEA 1Y1VG 3M4OB 3RN5A 3H15A 3VDYA 2Y0SG 4DKAC 5M5YH 3LGJA 1FVIA 3RN2A 2L11A 3NENA 5I2XA 3OWEB 1V1OA 2K5WA 2JA5B 4IFDI 5EPLA 2HT1A 3G48A 3CCMA 1F2MA 1B1ZA 2JE6I 4IUUA 2LXJA 4XYQA 3VYUA 2E2HB 3HOVH 1ASZA 4K2KA 3GDEA 2G5DA 2WINB 3KLRA 4ZYSA 4DV0Q 3ULLA 4K5VA 3J81L 2L9HA 1W6JA 3CCVA 2F4VQ 1IL2A 2EY6A 1IBLQ 2IY5B 2VS1A 5CV7A 2VB3X 4DF7A 4C2MB 1CQFA 1CSQA 3U4ZA 1G6ZA 5C5MA 4PMWA 1I4PA 5IGBA 2ZM6L 1VQ5A 3C2PA 3GQBA 3J81E 4FF4A 1HXYD 3G71A 1F77A 2EYPA 4R4QA 1PFBA 5DM63 3OTOQ 3FHWA 1QCBD 1YI2A 3H09A 1Q86C 1QB5D 2Z4IA 2EOTA 2N78A 3BDOA 4RGTA 3S24A 5KNCA 1R9TB 1KDCA 3OMGA 1VQ7A 2M2LA 3K5MA 3MXPA 1N8RC 4A3BB 1RL2A 4J1MA 4WJ3M 1SR3A 1ML0D 4DR6Q 2ICIA 4UP7A 1XTCD 4PZ6A 3JAME 1XMOL 3FP9A 4WJ4A 3TP8A 5DAUA 5IODA 3BJUA 5KGUA 1EL0A 1YBYA 2H5XA 2MQHA 1V9PA 4GKKL 2AUJD 2Q2TA 4WJWA 2QW7A 3T56B 4DA2A 4TSSA 2BCOA 4K2LA 1A3TA 2MO0A 1B44D 1EOVA 2A6EC 1WD0A 2QF7A 1SJHD 1LV9A 1XJVA 4HMIA 4MTNA 1JWUD 2KHSA 4NP5A 1TKWB 4P72A 1MBYA 1V1QA 3KBXA 1B9MA 2K75A 3BZDB 4IFDH 1EEFD 4DNTB 1CA6A 1VQBA 3BS1A 1EIGA 2B63G 3G6EA 3B6YA 2QEXA 1WD1A 5C4JB 3CF5A 2WAQE 3GO5A 3EJIA 4BY7H 4R4OA 1X3PA 1GOZA 4LF4L 2VUMB 1SYDA 3K80C 2IWHA 5DM73 4J15A 4IFDJ 2K33A 4OX9L 1EY4A 1TU2B 4DNIA 3A5UA 1EU4A 5FLMG 4AH6A 3CCEA 1VQIA 2OF1A 4B3ML 3U58A 1STHA 4RCNA 4DK3C 3M4PA 4DV5L 2L5TA 3D6WA 4EVOA 1I6HB 3ERQA 1QUQA 4A3GH 1JMCA 1KNEA 2F3IA 2E76C 4YWMA 1G2SA 2YTVA 4N8FA 4LF8L 2D9UA 1HR0Q 3MHBA 2CQOA 2UXCL 1WVLA 2XN9C 5LHY1 2J0TD 5C3EG 2V4DA 3I4MB 3CCRA 4UHVA 1VQAA 1D1IA 1EY5A 2HHHQ 2Z1CA 5M5WB 3RLNA 3SHLA 3GTJB 1K0RA 3RUZA 1HNZQ 3F2UA 1SNDA 3BU2A 3W5OA 4Q0FA 2FMCA 2N8NA 4JI4Q 3S1QB 3V96A 5IE8A 4X3SA 4FO2A 3F2DA 1F9QA 3QR8A 4X64Q 3OOCA 2A6HC 1EZ8A 5M3FH 3PGZA 3OW2A 3I4NG 4A3FB 5FJ8G 4OO1I 4IJLA 3KBGA 4X3UA 4DV6Q 1KNAA 4BBSB 2SOBA 3FKIG 4GN3B 1SN8A 4B3SQ 2KBNA 2NTSA 4DXFA 1Y14B 2IW3A 3NTKA 4C56C 2B2VA 3T53B 3W3AA 4HTHA 1LTLA 2GN5A 1Q81C 5F2DA 3PUVA 1ZKOA 2K6AA 4IJHA 4POGA 1GHKA 3HOUB 3S17B 4G7OC 3I2ZA 4DV7Q 5M3MB 2K05A 3OWFA 4MN3A 1K8GA 5ELEA 1TWGH 2KECA 1XMQL 5TSSA 2WFWA 1NNXA 3GV3A 4KLKA 1QVFA 4FF2A 2CH4W 5FJ8H 3KYHC 4GN4B 3MXNA 2PNHA 1D8LA 2R61A 4RWSC 2DUDA 3FEWX 2HCCA 4OELB 4ABNA 2OTJA 1YNNC 1X56A 3EBEA 1CZGA 4DV3Q 1BCPB 5FLXc 2EJGC 3K81C 4KD3A 1AZQA 3CP0A 4LJZC 1VQFA 1PZKD 1PTOH 1GUGA 1PTOC 1VQEA 2AWNA 1VQJA 2JA8H 3IL8A 1A0IA 1V1PA 1UEAB 2MPMA 2F4IA 2B2WC 4FF3A 2LSSA 3IRBA 4A3BG 4ZUIA 3UE0A 2K14A 1B4OA 1STGA 5C44H 2QDBA 1EFWA 3OMCA 2SNSA 2KJXA 3GTOB 2KHJA 3KLSA 5M9OA 2PW7A 2Q2HA 3VA7A 1VQNA 1KXLA 1KAWA 1SMYC 3OSOA 3S1MH 2ICEC 1S5DD 2K5NA 2B2YA 2IT1A 2R3ZA 5I2YA 4G7HC 3D4DA 4FP5D 1KQSA 4L63B 4OO1H 4EGVA 5JPNC 1JE5A 3S1RB 1LO5D 4RCOA 4YWKA 1IZ6A 2E2DC 3AMUA 5CC4A 2AQ3B 1YZ6A 2JEAI 3K7UC 5IT9E 1QUQB 4GKJL 3SVMA 3NHHA 5C0XG 5EKLA 1WTPA 4OGQC 2Z6KA 1CHPD 3LWUA 1X65A 3DEOA 2Q2UA 1IKMA 2R6GA 2NN6G 4JCVE 1W2BA 1TWAH 2UUBL 3MXUA 4QQBX 1FJGL 1ZYRC 1HZBA 3UDIA 4XQNA 1ET6A 4DV4Q 2VUMG 2RKSA 3HP3A 2AUKA 3P20A 1PRTB 4PV1C 4A3IH 2JA6H 3PO3H 4LMQD 3VYTA 5EAYA 2KVMA 4RKLA 1GKHA 3D4WA 3I72A 5ELOA 1FL0A 2KCNA 1NTGA 2JA9A 1Q7YC 3KF8A 1UUPA 3D31A 1XXGA 4JI8Q 1N36Q 4C3HB 3RZOH 3GV6A 4JI2Q 4BBRH 4KTAA 2DN8A 1IBKQ 3LX0A 4IO9A 2D2CC 2YTYA 4KN4C 1CZWA 3A8IE 5ELBA 4HJ8A 1SNQA 1M8AA 3CCJA 3I4MG 1Z47A 2QCPX 4JG2A 1TWHH 1X9NA 3TREA 4Y7NH 4A3DB 1O7YA 2MGSA 1F2YA 1RJTA 4DV1L 1N32Q 1STBA 2H1EA 3FDTA 3V05A 2F0QA 1GM5A 4LF6Q 3X3NA 1AW7A 1CUKA 5CYUA 1HTLD 1U4PA 4X65L 4IOCA 2K50A 3KLWA 3R8BA 4DFAA 3MXNB 4I7ZC 2CFMA 1A6XA 2XIWA 4A3FG 2R7DA 1I94Q 4FXGC 4HJ9A 3HOZB 5HGQA 4BBSG 3NQTA 1TR5A 1A2TA 3MTSA 3MFGA 1N33Q 1B2TA 2IX0A 1LT6D 3Q23A 1D5XC 1S5CD 4RFBA 1EWCA 3E9HA 1NAPA 1TWCB 1II3A 2K32A 3BYYB 5KIXA 2NVQB 3A55A 5C4XB 4U68A 1IYUA 4G7ZC 4CJ0B 1SE4A 3L3OC 4LUVA 1HZCA 4APVA 3D4RA 3U9SA 2XWJB 1V1PB 2D5DA 1ILPA 2N49A 3HOUG 4DR4Q 5E4WC 3T1HQ 4N8X1 5HURA 3TMEA 2F4VL 3H0GG 1QNKA 4BWGB 1QZHA 1IBLL 2E5LL 1QE6A 4X3KA 2CW0C 5E4XA 2Z8LA 5CORA 4FDBA 3K57A 3ER0A 1BCPD 4A93B 4ZKCB 1B7YB 3I7FA 1SNOA 3ULJA 2HQLA 3PO2B 3S1NB 1EY8A 1O7ZA 3QJYA 2B39A 1STEA 1T5XD 2WKDA 5I6WA 3CCUA 3RNUA 1X54A 1K0SA 2F0MA 1R4PB 1HJPA 4IURA 3S14H 2I5MX 1SRUA 1AZPA 2XRQD 3MAQA 1CI3M 4GLAC 3H0GH 4JI3L 3TP7A 4CHTB 5EKIA 4JI7L 4KJNA 1HPCA 2RHQB 3DM1A 1GUSA 2ZTDA 4K5XA 4C3JG 4Q5VA 5IY0A 1I4HA 4L8JA 4KJOA 4IALA 1RHPA 3HOYH 3I90A 2X6LA 5I9PA 1FNWA 1NE3A 1A62A 1H9SA 4RHSA 2NVTH 1TWFH 1GO3E 2D0OA 1RTOA 2YYZA 4GS3A 3AEVA 1PH1A 3SK4A 1XYIA 2WKCA 3KF8B 4OEMB 2K28A 1VQPA 2I46A 1CK1A 1KTKA 1OO9B 4PNYA 4P74A 4F88A 3J81i 4HEDA 2DNCA 4C3JH 1QZGA 2UUAQ 1CSPA 1EZ6A 2XNAC 5DLQE 2JA7H 4KY5A 3NP8A 5IYDH 3L7ZC 5M5XB 2QDLA 4A3JB 1PRTD 2A73B 1VQ6A 2B8FA 4QUCA 1PTOF 1LT3D 1JJ2A 1GUWA 4R1JA 1S5FD 4U673 1K28A 3T1YQ 4JI0L 2R7ZB 4C3IH 4HJ7A 2NZOA 1PH5A 1HTPA 1OXXK 3TRZA 1J9OA 2XTIA 5DEHA 3DLLA 3A8JE 4C3HG 1LM0A 2RDHA 1I3QB 3M4YA 4QIWB 2VQEQ 2JSOA 3STBD 4GZYC 1EIHA 3DXJC 4UDUC 3DWQA 2NVYB 4B3RQ 1KC8C 3C46A 2HHHL 4EQOA 5FO8B 2OEOA 1Y1WH 2UXDQ 3F2CA 2BA1A 4YWLA 1VF5C 2F0KA 1HNZL 1DOKA 2Z0SA 4A3DG 2EYHA 3NE5B 1D7QA 3CAMA 3CHBD 3TQYA 3EIVA 1DXMA 1ESFA 5ELCA 4A75A 4KHZA 3E3XA 2A69C 1RIPA 1JJGA 3RLOA 4DNRB 2VW9A 1D6EC 3J7A5 3N52A 2I5HA 4DV6L 1UAPA 1K73C 1O78A 2B8GA 4JI1L 1GJXA 3TEHB 1BXTA 4RGMA 3K0YA 3STBC 1GVPA 2OWOA 4XT1B 1Q46A 3KJPA 2KHIA 1IW7D 1EIYB 3DEPA 1PH8A 1J5EQ 4M1UB 5I9OA 2IX3A 5C4XG 3K8AA 1TY2A 1NR2A 4DR1L 2IHEA 5EBCA 3I8ZA 4ME3A 2CH4A 4JPBW 1S5BD 2VNUD 1UNSA 3BVZA 2R92B 3CQZB 1VQHA 3IFDA 1IYVA 2E2IH 3P7JA 3SGIA 4DUYQ 1Y1VH 3IFTA 1DONA 1DOLA 4LW1A 2IJ0A 2EDGA 4A76A 1A3UA 4A3EB 4A93G 4CDDC 3PO2G 3GTGB 4RG1A 1Q82C 5GROA 1H9SB 2LKVA 3JAML 2NVXH 1GUTA 2OQKA 2RVLA 3I56A 3C1EA 3HEJA 1LTID 4DAMA 1SFOB 2XVSA 1YEZA 5T1GA 1J6QA 1VQOA 4RA8A 2K5VA 5FKAC 3R93A 3SDZA 1PHJA 4BS9A 4LAAA 2SEBD 1VCIA 1UE6A 4DPGA 1HFNA 4RGNA 2DGYA 2AQ2B 2B2UC 2NB0A 5I4DA 4TQUS 2ZXRA 1U4LA 5IYCG 4OIKA 1B70B 1C0AA 1PXUA 3CPFA 4MZ9A 1PZID 4J6HA 4DK1A 4LF9Q 4DR5Q 1TVXA 2PNRC 1NR4A 5KRUA 4XQJA 1VQLA 1NMFA 2EY2A 1BDOA 4LFAQ 1L0XB 1BBXC 1A63A 1ENAA 1PFSA 2VZAA 1SMXA 3EQLC 3J80E 3ND9A 3T51B 1NCVA 1DGSA 2Y0SE 3ZYYX 3G7LA 1XTDA 3HKZB 2NZHA 2AKWB 5IGGA 2SDFA 5BN4A 4XDXA 1IBML 3R2TA 3NK9A 4QY7A 4ZUJA 1SAPA 1SLJA 4LF5L 2EE1A 4ID6A 3FMCA 1YJ9A 2E2JB 4QJFA 4Y52H 3K0XA 2MFIA 4YCWA 4HJ5A 1K8AC 1K83H 1T5EA 1W3SA 2F0OA 2YU9H 3I3CA 3I4OA 5IGDA 4A3JG 4HIMA 4V0BA 3IAYA 3GTQH 4KD4A 5ELDA 5A2QL 1TIID 1WTXA 3GTKH 1L2FA 4PZ7A 1CQVA 2R7ZG 1HZAA 4C1NI 2XWBB 4JI2L 2B63H 4AIMA 4G4KA 4I65A 1E22A 4Z9CB 2L0CA 4MHEA 5HGTA 1LTGD 1P16A 3AU7A 2N88A 3I4LA 3WWVA 5A2QE 2RA4A 1BOSA 1X6OA 3GTLH 1BCPF 3CCSA 3RZDB 5JEAG 1HQRD 4WRDA 5IGFA 4X62Q 3K59A 3M7NA 4JI6Q 5FLMH 1HCZA 3WOEA 1SBBB 1VF7A 3J7YW 5LMNQ 3GTPB 5EKKA 1KRSA 5GAGC 2BDOA 4KI0A 4F8MA 3NXWA 3S2DH 4JBWA 4DUZQ 5EJWA 4HCSA 2B2TC 4CBVA 4OWWB 1C8CA 3U4VA 4LF7Q 1N34Q 1FD7D 1DOMA 1KABA 4P75A 5C3EH 2RCFA 3KF6A 1N33L 1A3VA 1ZEQX 1KHIA 1OXSC 5IOCA 5J1ZA 1BBWA 1HUNA 3VA5A 5JEAH 1OXUA 2DJFC 3F8TA 3R3OA 2ZTCA 4J8QA 2JA5G 4O0AA 3HFZB 4K0KQ 3VR4A 5LL6S 4KV6A 3TP5A 1SEBD 3PUWA 1MHWC 3J7ZC 1QVGA 1CHQD 3C1FA 2MUYA 3RLFA 4KK7A 4DR4L 3T1HL 2A68D 1LUZA 2AMCB 2ENBA 2RSOA 4TRDA 3I4NH 3AB9A 4GNXA 2R92G 2M9VA 3OHXC 5JEAJ 1IKLA 1B53A 3FKIH 1M4VA 5G3LD 2TMPA 1H9MA 2PMZE 3SR1A 4DR3Q 4KHPQ 2XGTA 4GOPC 3M4OH 4DR7L 2MHVA 4HIOA 2F0EA 4LFBL 5COYA 4ODGA 4A3EG 5C0XI 3M3YB 2JA5H 3TZDA 4RAUC 3FRPB 3AQQA
chains in the Genus database with same CATH topology
4EQ5A 1HZ9A 1N33Q 2IX0A 2NN6I 2E2HH 3W1GA 1L0WA 3L0OA 1JT8A 3HOXH 2Z6KC 4IPHA 5IYCH 3E9HA 3KOJA 4B3TQ 1HNWQ 3J80i 1PYSB 3UE1A 5GAHC 5K36G 1U5KA 3S16H 5LMNL 4O2DA 3PF5A 4LUVA 1HZCA 1QVCA 4YCVA 4APVA 4DV4L 2EIFA 3RR5A 1S72A 1VQCA 1MKHA 4C2MH 4A3GG 3L2PA 2JEBI 5BR8Q 2MNAA 2N49A 4DUZL 3HOUG 4DR4Q 3T1HQ 3S15H 4OXPA 2VQFL 4DAYB 2WB1E 1MIUA 5AJ3L 2PI2A 4JBMA 2F4VL 1N34L 2IX1A 3H0GG 1QZHA 1IBLL 1PVOA 2E5LL 4BY1H 2K5HA 4DV1Q 4X66L 1YNXA 2CWPA 2JK8A 2OQ0A 1N36L 1PH6A 4UP8A 4JI8L 3GTMH 4A3CG 2BH2A 2EQSA 2LXKA 1UE5A 4JOIC 1CKMA 1EUJA 3HKSA 4FDBA 1E1TA 3ER0A 4HIKA 1R9TH 1IBKL 1XPRA 2ES2A 3A5ZB 1B7YB 3I7FA 3ULJA 1OXTA 2HQLA 4A3KH 4X65Q 1XMOQ 5GAEC 1UEBA 1XPUA 1UE7A 1L1OA 1M1KC 4A3BH 1XNRQ 4DV2Q 4P73A 4GOPB 4NXML 3ZJYC 3CCQA 4JI0Q 1Y1VG 3RN5A 3H15A 3CCUA 3RNUA 3VDYA 2Y0SG 3BZCA 1X54A 4DKAC 5M5YH 4JV5L 3LGJA 1FVIA 2AWOA 3RN2A 3HKZG 1HJPA 4LFCL 3NENA 3S14H 2I5MX 5M3FG 1SRUA 2KCTA 5J3BA 5M5XH 4A3JH 2B3GA 4BXXG 3E0EA 1N32L 3UDGA 2UUAL 4BA2I 4IFDI 2HT1A 3G48A 2KENA 4GLAC 3CCMA 3H0GH 2JE6I 4LF6L 2LXJA 4JI3L 3CMEA 4DR2L 2R7ZH 4LNQA 1U0LA 3HOVH 4JI7L 1ASZA 3GDEA 1HR0W 2UUCL 2RHQB 2ZTDA 2VQFQ 3AFQA 5HY6A 3ULLA 4DV0Q 1AH9A 3CW2C 5IY0A 5IP7G 3CCVA 2VY3A 1I94L 2F4VQ 4JYAL 1IL2A 1I3QH 4JBKA 1IBLQ 3HOYH 1Q1EA 4ALPA 1E3PA 2IY5B 2VS1A 4JOIA 4L5TA 1CSQA 1NE3A 3U4ZA 1A62A 2NVYH 2L15A 3H3VI 1YJWA 4LF4Q 4PMWA 1YIJA 1VQ9A 4B3TL 1PH2A 2ZM6L 1TWFH 2NVTH 1X3FA 1GO3E 1VQ5A 2D0OA 1YHBA 4YHHL 2YYZA 4GS3A 3G71A 3AEVA 1PH1A 4BXXH 2RCNA 4R4QA 1FGUA 2ID0A 3KF6B 4IFDG 3D0FA 3KF8B 5C4JH 3FHWA 3OTOQ 1YI2A 1LYLA 1Q86C 4B3RL 2N78A 1GD7A 2RF4A 1G6PA 5BR8L 3S24A 1VQPA 1Q12A 4JI1Q 1G51A 3NBHB 4UY8C 4JV5Q 2VUMH 2UXDL 3CCLA 4P74A 1VQ7A 3E9IA 5C0XJ 1N8RC 1KRTA 3J81i 1MJCA 4IPGA 2BH8A 4C3JH 1QZGA 2UUAQ 1RL2A 3AFPA 1CSPA 4WJ3M 1SR3A 1M90C 1C9OA 5DLQE 2JA7H 4DR6Q 2UXCQ 2QA4A 4UP7A 1EWIA 4PZ6A 4POFA 4DR2Q 1I6HH 5IYDH 3L7ZC 3J81j 1NBWA 4DR1Q 2JA8G 1XMOL 3FP9A 2ZJRA 4WJ4A 1VQ6A 4GNXB 1EQQA 4IPDA 3W1BA 3BJUA 4DV2L 1YBYA 1JJ2A 2H5XA 2MQHA 1V9PA 4R1JA 3T1YQ 2WP8J 4JI0L 4GKKL 1ASYA 2Q2TA 4XTCS 1VQ8A 4C3IH 5C44G 4HJ7A 2NZOA 1YHQA 2MO0A 2ZJPA 1PH5A 1OXXK 1EOVA 3I4MH 3TRZA 4BBSG 2XTIA 4UP9A 1EYGA 3DLLA 1CKOA 1EIFA 1XJVA 1B8AA 1LM0A 5M5WH 2ZM6Q 3ERSX 1PH7A 4MTNA 4QIWE 4TVAB 4YHHQ 3GTJH 2R92H 2VQEQ 3CQZH 5IP9G 1JJCB 4OONA 4P72A 3STBD 5GQOA 3F2BA 4L5QA 3F1ZA 1V1QA 4EX5A 1VQKA 2B29A 4B3RQ 2K75A 1KC8C 1I5FA 4MNOA 4OO1G 3S1QH 1E1OA 2HHHL 1X3GA 3JC66 4DV0L 3CXCA 1VQBA 1Y1WH 2B63G 5M3MG 3G6EA 3F2CA 1YITA 2UXDQ 2BA1A 4YWLA 1X55A 1HNXL 3B6YA 1UE1A 3GD7A 2Z0SA 2QEXA 1HNZL 3CF5A 4A3EH 4A3DG 4IOAA 4A3FH 1H95A 2WAQE 1NY4A 2CKZB 3GO5A 3J81c 1D7QA 3GTGH 4DUYL 2IHFA 4BBSH 4R4OA 3CAMA 3TQYA 2EXDA 4YY3L 3EIVA 4BY7H 1YVCA 4LF4L 4A75A 4KHZA 1IXRA 3K80C 2PI2E 1RIPA 3ICEA 4J15A 2D0PA 1JJGA 3RLOA 2VW9A 4IFDJ 4OX9L 3CC2A 4DNIA 3A5UA 3J7A5 3H3VH 5FLMG 2I5HA 1SE8A 2JQOA 4AH6A 3OTOL 3CCEA 4DV6L 1XMQQ 1SFOH 1HH2P 1VQIA 4PZ8A 1K73C 4GKKQ 4B3ML 3A0JA 3U58A 4JI1L 4DK3C 1S40A 3M4PA 3TEHB 4DV5L 1QUQA 1O7IA 2ZTEA 4YCUA 3STBC 4AYBE 1GVPA 1JMCA 2KCMA 1NJIC 1CKNA 2F3IA 2OWOA 4YWMA 1Q46A 5JJLA 3KJPA 2KHIA 2YTVA 3HOUH 3S17H 4LF8L 1EIYB 1HR0Q 1L1OB 5M3MH 1PH8A 2PQAA 3JAMc 2CQOA 1K3RA 4A3IG 1J5EQ 2JA6G 3PO3G 5ELNA 1Q1BA 5C4XG 4DR6L 2UXCL 4NB3A 3NELA 2ATWA 5C3EG 3K8AA 2A19A 1WCMG 3KDFA 3CCRA 4A3CH 4JI5L 1VQAA 4DR1L 1IYJB 2IHEA 4ME3A 1V43A 2VL6A 2HHHQ 2VNUD 1VQMA 3RLNA 4BBRG 1PH4A 1IBMQ 1WFQA 1VQHA 3UDFA 3T1YL 3M9BA 1K0RA 4HJAA 1HNXQ 4GLVB 4DK6C 1HNZQ 2WB1G 3MEFA 2E2IH 3BU2A 3W5OA 1WYDA 3SGIA 2N8NA 4DUYQ 1KD1C 1Y1VH 4JI4Q 4YY3Q 4LF5Q 1BBUA 3PCOB 3UDXA 4LW1A 3PIOA 5IE8A 2R93G 4P71A 3F2DA 2C35B 1X3EA 1TXYA 4X64Q 2VQEL 3PGZA 5M3FH 4A76A 3OW2A 3CC4A 1VQ4A 4OX9Q 3CD6A 3I4NG 4A93G 1A8VA 5FJ8G 3PO2G 4IJLA 1XPOA 4A3LG 4OO1I 4DV6Q 2GVBA 3FKIG 4BA1I 1KIXA 4RG1A 4GN3B 1Q82C 1SN8A 4B3SQ 2KBNA 4B3MQ 1PYBA 5LMNW 5GROA 5LMUL 1Y14B 2OTLA 4DV5Q 1NMGA 2E2JH 1YJNA 4A3MG 1VQGA 2NVXH 2UU9L 3GTOH 2K52A 2OQKA 3I56A 4R4CA 4DAMA 4LF8Q 3BZKA 4AYBG 1YEZA 1J6QA 5IP7H 1LTLA 2GN5A 2K5VA 3CMAA 1VQOA 1Q81C 1PHJA 4L5SA 1PH3A 1VCIA 1UE6A 1EQRA 3PIPA 4DPGA 3PSIA 3A74A 3PUVA 3Q8DA 3PF4A 4IJHA 1E24A 4POGA 4JI5Q 2DGYA 4OWXB 3CC7A 1BKBA 3I2ZA 1UWVA 2A8VA 4DV7Q 2A1AA 4TQUS 3S1RH 5IYCG 3G4SA 2MO1A 1K8GA 1TWGH 1XMQL 1B70B 3PUZA 4QL5A 3OYYA 2WFWA 1QVFA 4KLKA 4UPAA 1XNQL 1C0AA 3CPFA 4MZ9A 2NVQH 2D62A 3KYHC 4GN4B 3U50C 5FJ8H 4A3LH 2PNHA 4LF9Q 2FXQA 1D8LA 4DR5Q 2DUDA 1FJGQ 1SROA 1WI5A 3JAMi 2OTJA 3KFUA 1X56A 3EBEA 1HR0L 1VQLA 1NMFA 4DV3Q 4RMFA 1J5EL 4LFAQ 5FLXc 3K81C 3RZDH 1A63A 1PFSA 2VZAA 1VQDA 2R7FA 3CP0A 1SMXA 4R4TA 3PV0A 2I0QA 1Q8KA 4BY1G 3AYHB 1DGSA 1VQFA 2Y0SE 4A4IA 1Z9FA 4NXNL 3HKZE 3TS2A 5LMUQ 1XTDA 1VQEA 2AWNA 1VQJA 2AKWB 2NZHA 1MJEA 3GTPH 4A3GH 2UU9Q 1IBML 4PG3A 2JA8H 4X62L 1A0IA 4QY7A 4JI6L 3ULPA 4A3KG 4LWCA 2LSSA 2F52A 2CWAA 3IRBA 4A3BG 1SLJA 2YTXA 4LUZA 3KJOA 1WJJA 2HIXA 2K14A 3UE0A 4JI4L 4LF5L 4AQYL 1PA6A 5C44H 1YJ9A 1JB7A 4QJFA 2E8GA 1EFWA 4Y52H 3K0XA 2KHJA 2MFIA 4JBJA 4X64L 1AE2A 4YCWA 2OCEA 2Q2IA 4HJ5A 1K8AC 2Q2HA 1K83H 1K9MC 1W3SA 1KAWA 2YU9H 4C3HH 1VQNA 1KXLA 5GADC 5JJIA 3S1MH 4A3JG 2GVAA 2K5NA 3I4OA 4L5RC 4HIMA 4LF7L 5IP9H 1XNQQ 2IT1A 4B3SL 3GTQH 4QGUA 3HOZG 1C7YA 1OTCA 3GTKH 5IWAL 4GOPA 1L2FA 4PZ7A 2R7ZG 1KQSA 1HZAA 3HOVG 2HIVA 2V1CC 1JE5A 4JI2L 2B63H 4YWKA 4DR7Q 1IZ6A 4AIMA 4GLXA 4K0KL 4LFBQ 4A3DH 1E22A 2K4KA 3S2HH 3HOYG 1P16A 1YZ6A 3WWVA 2JEAI 3K7UC 1QUQB 2ASBA 4GKJL 4NXNQ 1X6OA 1CKNB 5C0XG 4DV7L 1G291 5IYBG 3GTLH 3CCSA 5JEAG 2PQAB 2Z6KA 4KHPQ 4X62Q 4OWTB 4H02A 1X65A 2Q2UA 1WOCA 4JI6Q 3M7NA 2R6GA 2NN6G 1YHAA 4JCVE 5FLMH 1W2BA 4LF9L 1TWAH 2UUBL 4DR5L 1T9HA 3KDFB 3HOWG 4QQBX 4GNXC 3M3YH 1VS0A 3M4QA 1FJGL 3J80c 4DR3L 4AQYQ 3HOZH 4KHPL 2WAQG 5LMNQ 2UXBL 1HZBA 4DV3L 1KRSA 3UDIA 5GAGC 4DV4Q 4LFAL 2VUMG 4KI0A 3S2DH 4LUOA 5E7NA 3DM3A 4JBWA 4DUZQ 4IPCA 4A3IH 3NEMA 2JA6H 3PO3H 2ZJQA 5EAYA 5AJ3Q 4OWWB 1TWCH 3U4VA 1GKHA 5C4XH 1P8LA 4LF7Q 5ELOA 1FL0A 4HIDA 1N34Q 2ALYB 1NTGA 4P75A 5C3EH 2JA9A 2JJQA 3KF6A 1WCMH 1Q7YC 2CCZA 5IWAQ 2E5LQ 1N33L 2JA7G 4X66Q 1KHIA 3D31A 5IYDG 4JI8Q 1OXSC 1N36Q 3RZOH 1BBWA 2AHOB 4XIGS 5IYBH 4JI2Q 3EN2A 4BBRH 1HNWL 1E7ZA 1OXUA 3F8TA 2ZTCA 1IBKQ 4IO9A 2JA5G 4O0AA 3HFZB 4K0KQ 2I5LX 2YTYA 4GN5A 3HOWH 1PV4A 3PUWA 3J7ZC 1AE3A 4HJ8A 4NXMQ 4GKJQ 1QVGA 1I50H 3CCJA 3RLFA 3I4MG 1Z47A 2R93H 3I55A 4DR4L 3T1HL 3HOXG 4JG2A 1TWHH 1X9NA 3PUYA 4LFCQ 3TREA 1LUZA 2AMCB 2N3SA 4Y7NH 4A93H 3I4NH 3M85A 2R92G 4GNXA 4X6AH 3PO2H 5JEAJ 1N9WA 4DV1L 1N32Q 3S1NH 2UUBQ 3FKIH 2RHSB 2YV5A 1GM5A 4R4IA 3TS0A 2PMZE 4DR3Q 4LF6Q 4JC0A 2XGTA 1CUKA 4GOPC 5IT9c 5H1SE 4NPSA 4JI3Q 3M4OH 4DR7L 1KL9A 4A3MH 2UXBQ 5JJKA 4HIOA 1Y1WG 2BA0A 4JI7Q 1BVSA 4LFBL 4X65L 1PH9A 3CPWA 1S3OA 4IOCA 2UUCQ 2K50A 3KLWA 1OXVA 3MXNB 4A3EG 1XNRL 2CFMA 2QGQA 5C0XI 4A3FG 2JA5H 2R7DA 1I94Q 3K7AH 4HJ9A 1L1OC 4JYAQ 5HGQA 4BY7G 3PUXA 3AQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQ5 A;  1HZ9 A;  1N33 Q;  2IX0 A;  2NN6 I;  2E2H H;  3W1G A;  1L0W A;  3L0O A;  1JT8 A;  3HOX H;  2Z6K C;  4IPH A;  5IYC H;  3E9H A;  3KOJ A;  4B3T Q;  1HNW Q;  3J80 i;  1PYS B;  3UE1 A;  5GAH C;  5K36 G;  1U5K A;  3S16 H;  5LMN L;  4O2D A;  3PF5 A;  4LUV A;  1HZC A;  1QVC A;  4YCV A;  4APV A;  4DV4 L;  2EIF A;  3RR5 A;  1S72 A;  1VQC A;  1MKH A;  4C2M H;  4A3G G;  3L2P A;  2JEB I;  5BR8 Q;  2MNA A;  2N49 A;  4DUZ L;  3HOU G;  4DR4 Q;  3T1H Q;  3S15 H;  4OXP A;  2VQF L;  4DAY B;  2WB1 E;  1MIU A;  5AJ3 L;  2PI2 A;  4JBM A;  2F4V L;  1N34 L;  2IX1 A;  3H0G G;  1QZH A;  1IBL L;  1PVO A;  2E5L L;  4BY1 H;  2K5H A;  4DV1 Q;  4X66 L;  1YNX A;  2CWP A;  2JK8 A;  2OQ0 A;  1N36 L;  1PH6 A;  4UP8 A;  4JI8 L;  3GTM H;  4A3C G;  2BH2 A;  2EQS A;  2LXK A;  1UE5 A;  4JOI C;  1CKM A;  1EUJ A;  3HKS A;  4FDB A;  1E1T A;  3ER0 A;  4HIK A;  1R9T H;  1IBK L;  1XPR A;  2ES2 A;  3A5Z B;  1B7Y B;  3I7F A;  3ULJ A;  1OXT A;  2HQL A;  4A3K H;  4X65 Q;  1XMO Q;  5GAE C;  1UEB A;  1XPU A;  1UE7 A;  1L1O A;  1M1K C;  4A3B H;  1XNR Q;  4DV2 Q;  4P73 A;  4GOP B;  4NXM L;  3ZJY C;  3CCQ A;  4JI0 Q;  1Y1V G;  3RN5 A;  3H15 A;  3CCU A;  3RNU A;  3VDY A;  2Y0S G;  3BZC A;  1X54 A;  4DKA C;  5M5Y H;  4JV5 L;  3LGJ A;  1FVI A;  2AWO A;  3RN2 A;  3HKZ G;  1HJP A;  4LFC L;  3NEN A;  3S14 H;  2I5M X;  5M3F G;  1SRU A;  2KCT A;  5J3B A;  5M5X H;  4A3J H;  2B3G A;  4BXX G;  3E0E A;  1N32 L;  3UDG A;  2UUA L;  4BA2 I;  4IFD I;  2HT1 A;  3G48 A;  2KEN A;  4GLA C;  3CCM A;  3H0G H;  2JE6 I;  4LF6 L;  2LXJ A;  4JI3 L;  3CME A;  4DR2 L;  2R7Z H;  4LNQ A;  1U0L A;  3HOV H;  4JI7 L;  1ASZ A;  3GDE A;  1HR0 W;  2UUC L;  2RHQ B;  2ZTD A;  2VQF Q;  3AFQ A;  5HY6 A;  3ULL A;  4DV0 Q;  1AH9 A;  3CW2 C;  5IY0 A;  5IP7 G;  3CCV A;  2VY3 A;  1I94 L;  2F4V Q;  4JYA L;  1IL2 A;  1I3Q H;  4JBK A;  1IBL Q;  3HOY H;  1Q1E A;  4ALP A;  1E3P A;  2IY5 B;  2VS1 A;  4JOI A;  4L5T A;  1CSQ A;  1NE3 A;  3U4Z A;  1A62 A;  2NVY H;  2L15 A;  3H3V I;  1YJW A;  4LF4 Q;  4PMW A;  1YIJ A;  1VQ9 A;  4B3T L;  1PH2 A;  2ZM6 L;  1TWF H;  2NVT H;  1X3F A;  1GO3 E;  1VQ5 A;  2D0O A;  1YHB A;  4YHH L;  2YYZ A;  4GS3 A;  3G71 A;  3AEV A;  1PH1 A;  4BXX H;  2RCN A;  4R4Q A;  1FGU A;  2ID0 A;  3KF6 B;  4IFD G;  3D0F A;  3KF8 B;  5C4J H;  3FHW A;  3OTO Q;  1YI2 A;  1LYL A;  1Q86 C;  4B3R L;  2N78 A;  1GD7 A;  2RF4 A;  1G6P A;  5BR8 L;  3S24 A;  1VQP A;  1Q12 A;  4JI1 Q;  1G51 A;  3NBH B;  4UY8 C;  4JV5 Q;  2VUM H;  2UXD L;  3CCL A;  4P74 A;  1VQ7 A;  3E9I A;  5C0X J;  1N8R C;  1KRT A;  3J81 i;  1MJC A;  4IPG A;  2BH8 A;  4C3J H;  1QZG A;  2UUA Q;  1RL2 A;  3AFP A;  1CSP A;  4WJ3 M;  1SR3 A;  1M90 C;  1C9O A;  5DLQ E;  2JA7 H;  4DR6 Q;  2UXC Q;  2QA4 A;  4UP7 A;  1EWI A;  4PZ6 A;  4POF A;  4DR2 Q;  1I6H H;  5IYD H;  3L7Z C;  3J81 j;  1NBW A;  4DR1 Q;  2JA8 G;  1XMO L;  3FP9 A;  2ZJR A;  4WJ4 A;  1VQ6 A;  4GNX B;  1EQQ A;  4IPD A;  3W1B A;  3BJU A;  4DV2 L;  1YBY A;  1JJ2 A;  2H5X A;  2MQH A;  1V9P A;  4R1J A;  3T1Y Q;  2WP8 J;  4JI0 L;  4GKK L;  1ASY A;  2Q2T A;  4XTC S;  1VQ8 A;  4C3I H;  5C44 G;  4HJ7 A;  2NZO A;  1YHQ A;  2MO0 A;  2ZJP A;  1PH5 A;  1OXX K;  1EOV A;  3I4M H;  3TRZ A;  4BBS G;  2XTI A;  4UP9 A;  1EYG A;  3DLL A;  1CKO A;  1EIF A;  1XJV A;  1B8A A;  1LM0 A;  5M5W H;  2ZM6 Q;  3ERS X;  1PH7 A;  4MTN A;  4QIW E;  4TVA B;  4YHH Q;  3GTJ H;  2R92 H;  2VQE Q;  3CQZ H;  5IP9 G;  1JJC B;  4OON A;  4P72 A;  3STB D;  5GQO A;  3F2B A;  4L5Q A;  3F1Z A;  1V1Q A;  4EX5 A;  1VQK A;  2B29 A;  4B3R Q;  2K75 A;  1KC8 C;  1I5F A;  4MNO A;  4OO1 G;  3S1Q H;  1E1O A;  2HHH L;  1X3G A;  3JC6 6;  4DV0 L;  3CXC A;  1VQB A;  1Y1W H;  2B63 G;  5M3M G;  3G6E A;  3F2C A;  1YIT A;  2UXD Q;  2BA1 A;  4YWL A;  1X55 A;  1HNX L;  3B6Y A;  1UE1 A;  3GD7 A;  2Z0S A;  2QEX A;  1HNZ L;  3CF5 A;  4A3E H;  4A3D G;  4IOA A;  4A3F H;  1H95 A;  2WAQ E;  1NY4 A;  2CKZ B;  3GO5 A;  3J81 c;  1D7Q A;  3GTG H;  4DUY L;  2IHF A;  4BBS H;  4R4O A;  3CAM A;  3TQY A;  2EXD A;  4YY3 L;  3EIV A;  4BY7 H;  1YVC A;  4LF4 L;  4A75 A;  4KHZ A;  1IXR A;  3K80 C;  2PI2 E;  1RIP A;  3ICE A;  4J15 A;  2D0P A;  1JJG A;  3RLO A;  2VW9 A;  4IFD J;  4OX9 L;  3CC2 A;  4DNI A;  3A5U A;  3J7A 5;  3H3V H;  5FLM G;  2I5H A;  1SE8 A;  2JQO A;  4AH6 A;  3OTO L;  3CCE A;  4DV6 L;  1XMQ Q;  1SFO H;  1HH2 P;  1VQI A;  4PZ8 A;  1K73 C;  4GKK Q;  4B3M L;  3A0J A;  3U58 A;  4JI1 L;  4DK3 C;  1S40 A;  3M4P A;  3TEH B;  4DV5 L;  1QUQ A;  1O7I A;  2ZTE A;  4YCU A;  3STB C;  4AYB E;  1GVP A;  1JMC A;  2KCM A;  1NJI C;  1CKN A;  2F3I A;  2OWO A;  4YWM A;  1Q46 A;  5JJL A;  3KJP A;  2KHI A;  2YTV A;  3HOU H;  3S17 H;  4LF8 L;  1EIY B;  1HR0 Q;  1L1O B;  5M3M H;  1PH8 A;  2PQA A;  3JAM c;  2CQO A;  1K3R A;  4A3I G;  1J5E Q;  2JA6 G;  3PO3 G;  5ELN A;  1Q1B A;  5C4X G;  4DR6 L;  2UXC L;  4NB3 A;  3NEL A;  2ATW A;  5C3E G;  3K8A A;  2A19 A;  1WCM G;  3KDF A;  3CCR A;  4A3C H;  4JI5 L;  1VQA A;  4DR1 L;  1IYJ B;  2IHE A;  4ME3 A;  1V43 A;  2VL6 A;  2HHH Q;  2VNU D;  1VQM A;  3RLN A;  4BBR G;  1PH4 A;  1IBM Q;  1WFQ A;  1VQH A;  3UDF A;  3T1Y L;  3M9B A;  1K0R A;  4HJA A;  1HNX Q;  4GLV B;  4DK6 C;  1HNZ Q;  2WB1 G;  3MEF A;  2E2I H;  3BU2 A;  3W5O A;  1WYD A;  3SGI A;  2N8N A;  4DUY Q;  1KD1 C;  1Y1V H;  4JI4 Q;  4YY3 Q;  4LF5 Q;  1BBU A;  3PCO B;  3UDX A;  4LW1 A;  3PIO A;  5IE8 A;  2R93 G;  4P71 A;  3F2D A;  2C35 B;  1X3E A;  1TXY A;  4X64 Q;  2VQE L;  3PGZ A;  5M3F H;  4A76 A;  3OW2 A;  3CC4 A;  1VQ4 A;  4OX9 Q;  3CD6 A;  3I4N G;  4A93 G;  1A8V A;  5FJ8 G;  3PO2 G;  4IJL A;  1XPO A;  4A3L G;  4OO1 I;  4DV6 Q;  2GVB A;  3FKI G;  4BA1 I;  1KIX A;  4RG1 A;  4GN3 B;  1Q82 C;  1SN8 A;  4B3S Q;  2KBN A;  4B3M Q;  1PYB A;  5LMN W;  5GRO A;  5LMU L;  1Y14 B;  2OTL A;  4DV5 Q;  1NMG A;  2E2J H;  1YJN A;  4A3M G;  1VQG A;  2NVX H;  2UU9 L;  3GTO H;  2K52 A;  2OQK A;  3I56 A;  4R4C A;  4DAM A;  4LF8 Q;  3BZK A;  4AYB G;  1YEZ A;  1J6Q A;  5IP7 H;  1LTL A;  2GN5 A;  2K5V A;  3CMA A;  1VQO A;  1Q81 C;  1PHJ A;  4L5S A;  1PH3 A;  1VCI A;  1UE6 A;  1EQR A;  3PIP A;  4DPG A;  3PSI A;  3A74 A;  3PUV A;  3Q8D A;  3PF4 A;  4IJH A;  1E24 A;  4POG A;  4JI5 Q;  2DGY A;  4OWX B;  3CC7 A;  1BKB A;  3I2Z A;  1UWV A;  2A8V A;  4DV7 Q;  2A1A A;  4TQU S;  3S1R H;  5IYC G;  3G4S A;  2MO1 A;  1K8G A;  1TWG H;  1XMQ L;  1B70 B;  3PUZ A;  4QL5 A;  3OYY A;  2WFW A;  1QVF A;  4KLK A;  4UPA A;  1XNQ L;  1C0A A;  3CPF A;  4MZ9 A;  2NVQ H;  2D62 A;  3KYH C;  4GN4 B;  3U50 C;  5FJ8 H;  4A3L H;  2PNH A;  4LF9 Q;  2FXQ A;  1D8L A;  4DR5 Q;  2DUD A;  1FJG Q;  1SRO A;  1WI5 A;  3JAM i;  2OTJ A;  3KFU A;  1X56 A;  3EBE A;  1HR0 L;  1VQL A;  1NMF A;  4DV3 Q;  4RMF A;  1J5E L;  4LFA Q;  5FLX c;  3K81 C;  3RZD H;  1A63 A;  1PFS A;  2VZA A;  1VQD A;  2R7F A;  3CP0 A;  1SMX A;  4R4T A;  3PV0 A;  2I0Q A;  1Q8K A;  4BY1 G;  3AYH B;  1DGS A;  1VQF A;  2Y0S E;  4A4I A;  1Z9F A;  4NXN L;  3HKZ E;  3TS2 A;  5LMU Q;  1XTD A;  1VQE A;  2AWN A;  1VQJ A;  2AKW B;  2NZH A;  1MJE A;  3GTP H;  4A3G H;  2UU9 Q;  1IBM L;  4PG3 A;  2JA8 H;  4X62 L;  1A0I A;  4QY7 A;  4JI6 L;  3ULP A;  4A3K G;  4LWC A;  2LSS A;  2F52 A;  2CWA A;  3IRB A;  4A3B G;  1SLJ A;  2YTX A;  4LUZ A;  3KJO A;  1WJJ A;  2HIX A;  2K14 A;  3UE0 A;  4JI4 L;  4LF5 L;  4AQY L;  1PA6 A;  5C44 H;  1YJ9 A;  1JB7 A;  4QJF A;  2E8G A;  1EFW A;  4Y52 H;  3K0X A;  2KHJ A;  2MFI A;  4JBJ A;  4X64 L;  1AE2 A;  4YCW A;  2OCE A;  2Q2I A;  4HJ5 A;  1K8A C;  2Q2H A;  1K83 H;  1K9M C;  1W3S A;  1KAW A;  2YU9 H;  4C3H H;  1VQN A;  1KXL A;  5GAD C;  5JJI A;  3S1M H;  4A3J G;  2GVA A;  2K5N A;  3I4O A;  4L5R C;  4HIM A;  4LF7 L;  5IP9 H;  1XNQ Q;  2IT1 A;  4B3S L;  3GTQ H;  4QGU A;  3HOZ G;  1C7Y A;  1OTC A;  3GTK H;  5IWA L;  4GOP A;  1L2F A;  4PZ7 A;  2R7Z G;  1KQS A;  1HZA A;  3HOV G;  2HIV A;  2V1C C;  1JE5 A;  4JI2 L;  2B63 H;  4YWK A;  4DR7 Q;  1IZ6 A;  4AIM A;  4GLX A;  4K0K L;  4LFB Q;  4A3D H;  1E22 A;  2K4K A;  3S2H H;  3HOY G;  1P16 A;  1YZ6 A;  3WWV A;  2JEA I;  3K7U C;  1QUQ B;  2ASB A;  4GKJ L;  4NXN Q;  1X6O A;  1CKN B;  5C0X G;  4DV7 L;  1G29 1;  5IYB G;  3GTL H;  3CCS A;  5JEA G;  2PQA B;  2Z6K A;  4KHP Q;  4X62 Q;  4OWT B;  4H02 A;  1X65 A;  2Q2U A;  1WOC A;  4JI6 Q;  3M7N A;  2R6G A;  2NN6 G;  1YHA A;  4JCV E;  5FLM H;  1W2B A;  4LF9 L;  1TWA H;  2UUB L;  4DR5 L;  1T9H A;  3KDF B;  3HOW G;  4QQB X;  4GNX C;  3M3Y H;  1VS0 A;  3M4Q A;  1FJG L;  3J80 c;  4DR3 L;  4AQY Q;  3HOZ H;  4KHP L;  2WAQ G;  5LMN Q;  2UXB L;  1HZB A;  4DV3 L;  1KRS A;  3UDI A;  5GAG C;  4DV4 Q;  4LFA L;  2VUM G;  4KI0 A;  3S2D H;  4LUO A;  5E7N A;  3DM3 A;  4JBW A;  4DUZ Q;  4IPC A;  4A3I H;  3NEM A;  2JA6 H;  3PO3 H;  2ZJQ A;  5EAY A;  5AJ3 Q;  4OWW B;  1TWC H;  3U4V A;  1GKH A;  5C4X H;  1P8L A;  4LF7 Q;  5ELO A;  1FL0 A;  4HID A;  1N34 Q;  2ALY B;  1NTG A;  4P75 A;  5C3E H;  2JA9 A;  2JJQ A;  3KF6 A;  1WCM H;  1Q7Y C;  2CCZ A;  5IWA Q;  2E5L Q;  1N33 L;  2JA7 G;  4X66 Q;  1KHI A;  3D31 A;  5IYD G;  4JI8 Q;  1OXS C;  1N36 Q;  3RZO H;  1BBW A;  2AHO B;  4XIG S;  5IYB H;  4JI2 Q;  3EN2 A;  4BBR H;  1HNW L;  1E7Z A;  1OXU A;  3F8T A;  2ZTC A;  1IBK Q;  4IO9 A;  2JA5 G;  4O0A A;  3HFZ B;  4K0K Q;  2I5L X;  2YTY A;  4GN5 A;  3HOW H;  1PV4 A;  3PUW A;  3J7Z C;  1AE3 A;  4HJ8 A;  4NXM Q;  4GKJ Q;  1QVG A;  1I50 H;  3CCJ A;  3RLF A;  3I4M G;  1Z47 A;  2R93 H;  3I55 A;  4DR4 L;  3T1H L;  3HOX G;  4JG2 A;  1TWH H;  1X9N A;  3PUY A;  4LFC Q;  3TRE A;  1LUZ A;  2AMC B;  2N3S A;  4Y7N H;  4A93 H;  3I4N H;  3M85 A;  2R92 G;  4GNX A;  4X6A H;  3PO2 H;  5JEA J;  1N9W A;  4DV1 L;  1N32 Q;  3S1N H;  2UUB Q;  3FKI H;  2RHS B;  2YV5 A;  1GM5 A;  4R4I A;  3TS0 A;  2PMZ E;  4DR3 Q;  4LF6 Q;  4JC0 A;  2XGT A;  1CUK A;  4GOP C;  5IT9 c;  5H1S E;  4NPS A;  4JI3 Q;  3M4O H;  4DR7 L;  1KL9 A;  4A3M H;  2UXB Q;  5JJK A;  4HIO A;  1Y1W G;  2BA0 A;  4JI7 Q;  1BVS A;  4LFB L;  4X65 L;  1PH9 A;  3CPW A;  1S3O A;  4IOC A;  2UUC Q;  2K50 A;  3KLW A;  1OXV A;  3MXN B;  4A3E G;  1XNR L;  2CFM A;  2QGQ A;  5C0X I;  4A3F G;  2JA5 H;  2R7D A;  1I94 Q;  3K7A H;  4HJ9 A;  1L1O C;  4JYA Q;  5HGQ A;  4BY7 G;  3PUX A;  3AQQ A; 
#chains in the Genus database with same CATH topology
 1LAC A;  5FO9 B;  1B50 A;  2E2H H;  2NN6 I;  3W1G A;  4WOR A;  1STY A;  1SYG A;  3BYT B;  1PFN A;  1HNW Q;  5JJZ A;  3K5N A;  1U4M A;  5K36 G;  1WCM B;  1U5K A;  3RD4 A;  4O2D A;  3CU7 A;  2EIF A;  3RR5 A;  1S72 A;  1BF4 A;  4KKU A;  1MKH A;  4C2M H;  2JEB I;  2O5I C;  1SYC A;  4OXP A;  1EU3 A;  1D1K A;  5AJ3 L;  3MEH A;  4DGZ A;  2WB1 B;  5IT9 L;  3HOW B;  4X66 L;  1YNX A;  1I50 B;  2JK8 A;  3FPU B;  4DXG A;  1PH6 A;  2K7V A;  4A3C G;  2R93 B;  2EYM A;  3ERO A;  2LXK A;  1UE5 A;  1CKM A;  1EUJ A;  1R9T H;  1XPR A;  3A5Z B;  2KED A;  1XMO Q;  5GAE C;  1UE7 A;  1ENF A;  1EQT A;  4A3B H;  1XNR Q;  4KY6 A;  4P73 A;  1EYD A;  2BE5 D;  4NXM L;  3ZJY C;  4KHV A;  5K36 H;  1AP0 A;  4A3M B;  4QMG A;  3HKZ G;  4LFC L;  3GP7 A;  4B08 A;  3G6J B;  2KCT A;  5J3B A;  1I4R A;  2F0U A;  5CV5 A;  2B3G A;  4L6T B;  3T4A C;  4O1N A;  4ZLT F;  3UDG A;  3K7A B;  2UUA L;  2EY1 A;  1XWE A;  2NBF A;  1ILQ A;  1PDQ A;  4LNQ A;  1U0L A;  2PPB C;  1HR0 W;  2UUC L;  1CTM A;  1EWH A;  2VQF Q;  2LS0 1;  3AFQ A;  5HY6 A;  2WV6 D;  2O5J C;  4CDC C;  2DJG C;  5IP7 G;  4JYA L;  5EQ0 A;  3S16 B;  4JBK A;  1RKN A;  1E3P A;  3URY A;  3Q24 A;  4JOI A;  4L5T A;  3TP6 A;  5C0X H;  2FIN B;  1XX8 A;  2L15 A;  4LF4 Q;  3S15 B;  1YIJ A;  3DWA A;  4B3T L;  1PH2 A;  1EYA A;  1YHB A;  4BY1 B;  2NN6 H;  1BO0 A;  1WTQ A;  4DK0 A;  2HQE A;  2ID0 A;  3KF6 B;  3I73 A;  3D0F A;  2RBM A;  5C6A A;  5C4J H;  3GTM B;  1LYL A;  4B3R L;  5A35 A;  1GD7 A;  5BR8 L;  2AQ1 B;  3E6Z X;  1Q12 A;  2L12 A;  3MFY A;  3NBH B;  4UY8 C;  4JV5 Q;  2VUM H;  2UXD L;  3CCL A;  2F0D A;  1TQO A;  2VXW A;  5C0X J;  4A3K B;  4DAP A;  3S2H B;  2JYO A;  4IPG A;  2BH8 A;  5JVG 3;  4R8N A;  1RTN A;  4M8A A;  5D14 A;  2UXC Q;  5M5Y B;  2QA4 A;  1G2T A;  3N6R A;  1EWI A;  4POF A;  4DR2 Q;  2CHB D;  4HN7 A;  1I6H H;  1CT1 D;  1YNJ D;  4GNX B;  1EQQ A;  4IPD A;  4DV2 L;  2WP8 J;  1LLR D;  1VQ8 A;  3OIQ A;  4HMJ A;  1EFI D;  5BN3 A;  1YHQ A;  2KCC A;  3HOV B;  2ZJP A;  3I4M H;  2FFK B;  1EYG A;  1L0Y B;  3DUZ A;  4OHJ A;  5ELF A;  5M5W H;  3ERS X;  3VYS A;  3VR6 A;  4TVA B;  4YHH Q;  3GTJ H;  2H4O A;  1C4Q A;  1JJC B;  4OON A;  5IP9 G;  3F2B A;  5GQO A;  4L5Q A;  3F1Z A;  3TN2 A;  1VQK A;  2Y0S B;  1I5F A;  3S1Q H;  1E1O A;  3JC6 6;  2J4X A;  3CXC A;  5AFW A;  5EBD A;  4DV0 L;  5M3M G;  1VMC A;  1X55 A;  4FXK C;  4IOA A;  4A3F H;  1NY4 A;  3J81 c;  5LL6 X;  4DUY L;  5K5P A;  1ONL A;  2WAQ B;  2X69 A;  4BBS H;  1MSG A;  1YVC A;  4RH6 A;  5IGC A;  4QF4 A;  2X6G A;  2PI2 E;  3ICE A;  3MVV A;  4KY7 A;  1S4Z A;  3OTO L;  3A54 A;  4IUQ A;  1XMQ Q;  1HH2 P;  1QOH A;  1A15 A;  1FNV A;  1O7I A;  2ZTE A;  4AYB E;  4E6I A;  1CKN A;  1HA5 A;  5JJL A;  3HOU H;  3S17 H;  3EFX D;  5M3M H;  2PQA A;  3JAM c;  3H6M A;  5ELN A;  5FO7 B;  1CA5 A;  3VR5 A;  2HDL A;  2KQ3 A;  5J22 A;  4DR6 L;  4NB3 A;  1D2B A;  2K5D A;  1WCM G;  2KEE A;  1JQY D;  1SNP A;  5KEE A;  1IYJ B;  1TS4 A;  1Z7T A;  5FLX E;  2Q8I B;  3HOX B;  1IL8 A;  1PH4 A;  2B2W A;  1WTV A;  1WFQ A;  3NTH A;  3J7A V;  1BCP C;  1MD2 D;  1U4R A;  4GLV B;  1JIC A;  1PZJ D;  1HNX Q;  2WB1 G;  3MEF A;  1E2Z A;  1KDA A;  2CQA A;  1KD1 C;  1DM0 B;  3P1H A;  4YY3 Q;  1BBU A;  4ZKB B;  2EJF C;  2R93 G;  1WTR A;  4K6D A;  1X3E A;  3CD6 A;  1E2V A;  1LTS D;  4PQX A;  3R2I A;  1VQ4 A;  4A3L G;  4BY7 B;  2GVB A;  4BA1 I;  1KIX A;  1C48 A;  1PYB A;  2OTL A;  1NMG A;  1YJN A;  1MI2 A;  4A3M G;  1VQG A;  3GTO H;  4KN7 C;  4CDE C;  3CMA A;  4L5S A;  4CJ2 C;  1PH3 A;  3PIP A;  3A74 A;  1TS2 A;  3Q8D A;  3PF4 A;  4A3G B;  5C3X A;  2FHT A;  4JI5 Q;  3CC7 A;  1WTH A;  1E0B A;  4HR7 B;  1UWV A;  2A8V A;  1Y8P B;  2F0G A;  2RDF A;  2L1B A;  3S9W A;  3S1R H;  3G4S A;  2MO1 A;  2NZ1 D;  3P75 A;  3PUZ A;  2PO4 A;  4X3T A;  2D62 A;  3U50 C;  4A3L H;  1WTW A;  2N55 A;  2FXQ A;  2LMC B;  1PLF A;  4R9W A;  3SK5 A;  1FJG Q;  1SRO A;  1WI5 A;  3JAM i;  3KFU A;  5IIF A;  1HR0 L;  1EY9 A;  4O42 A;  3DMU A;  5D65 A;  4K5W A;  4R4T A;  3PV0 A;  5G3L F;  4BY1 G;  4A4I A;  1JWM D;  2WAC A;  3OPO A;  5LMU Q;  2KOL A;  3OW7 A;  1EYC A;  4YIJ A;  2UU9 Q;  4PG3 A;  5M3F B;  4X62 L;  2LY7 A;  5JOB A;  4JI6 L;  2HCI A;  4A3K G;  4LWC A;  1ZXT A;  2F1M A;  4DAY A;  2CWA A;  3VR3 A;  1PRT C;  3QO2 A;  2YTX A;  4LUZ A;  3KJO A;  1WJJ A;  2HIX A;  4JI4 L;  5NUC A;  4NKL A;  3X3M A;  1JB7 A;  1G8Z D;  1B3Q A;  4ULL A;  1FNU A;  4JBJ A;  5KYL A;  4X64 L;  1AE2 A;  4C3H H;  5GAD C;  2GVA A;  1HFG A;  3U9O A;  4LF7 L;  2P5Z X;  3A56 A;  1XNQ Q;  4B3S L;  1DJR D;  4QGU A;  4ZK9 B;  2DY8 A;  5KNB A;  1C7Y A;  3HOZ G;  4KKS A;  2PZW A;  1SDF A;  3NQI A;  3HOV G;  2HIV A;  1HUM A;  2K03 A;  4IZ8 A;  1TWG B;  1KLG D;  2F3W A;  4IUT A;  3NBI A;  3D6C A;  2B2V C;  4GLX A;  4K0K L;  4A3D H;  1CM9 A;  4QB4 A;  3K5L A;  5CR3 A;  3S2H H;  1DCZ A;  4NXN Q;  1CKN B;  4DV7 L;  1G29 1;  5IYB G;  2F0T A;  2PQA B;  1ET9 A;  4OWT B;  3H91 A;  1WOC A;  1T9H A;  3WDN A;  3ONA B;  4GNX C;  1VS0 A;  1FGB D;  1GUN A;  1PTO B;  4AQY Q;  4DR3 L;  3HOZ H;  4KHP L;  2WAQ G;  4KKT A;  4DV3 L;  2JA8 B;  1K8M A;  5E7N A;  3EVQ A;  1RDP D;  3A7A B;  3QOL A;  1IW7 C;  1TWC H;  2NVQ H;  5C4X H;  5C44 B;  4DAV A;  2E5L Q;  2JJQ A;  1W6K A;  3QG1 A;  2WII B;  4EQP A;  5IWA Q;  5JPM C;  1RD9 D;  5CV4 A;  5IYB H;  3S1M B;  2SNM A;  1HNW L;  1E7Z A;  5JAV A;  1SE3 A;  5DNF A;  2HDM A;  1QWY A;  2I5L X;  2A6E D;  4XQQ A;  1V8Q A;  4FXD A;  3I55 A;  2EYJ A;  3HOX G;  1F9R A;  3PUY A;  1AN8 A;  5ISR A;  2N3S A;  2Z6B A;  4A93 H;  3J80 L;  3HS0 C;  2ZXO A;  1EY0 A;  4X6A H;  3PO2 H;  2B2Y C;  2F0N A;  1N9W A;  1SYE A;  3S1N H;  2RHS B;  4UAI A;  1MGS A;  4R4I A;  5L37 A;  2O2L D;  4JI3 Q;  4IFD G;  5IT9 c;  5H1S E;  4NPS A;  2UXB Q;  1KL9 A;  5JJK A;  1LTB D;  4JI7 Q;  1PH9 A;  1SYB A;  3CPW A;  1TWA B;  1I4G A;  1XNR L;  2PZT A;  4BY7 G;  2PCF B;  4EQ5 A;  5IGE A;  1HZ9 A;  1A2U A;  1GXD C;  1L0W A;  4JK1 C;  3L0O A;  1JT8 A;  4A3I B;  3HOX H;  2JA6 B;  2Z6K C;  4IPH A;  5IYC H;  3KOJ A;  4NMZ A;  3PO3 B;  5EPJ A;  3HG9 A;  2ZT9 C;  4MTK A;  1PYS B;  3UE1 A;  5GAH C;  1BUV T;  5CBA E;  3PF5 A;  3BVG A;  1QVC A;  4DV4 L;  3Q6S A;  4NW2 A;  3RZO B;  4A3G G;  1STA A;  4BBR B;  2EYF A;  2E74 C;  2VQF L;  4DAY B;  1PMR A;  2EYL A;  5FOB B;  1EY6 A;  4JBM A;  1TY0 A;  4CDF C;  1PVO A;  2CWP A;  2DNE A;  1N36 L;  4JI8 L;  4IN3 A;  1K8O A;  2BH2 A;  2EQS A;  3T16 A;  4JOI C;  1TWH B;  3HKS A;  4Y7N B;  1IBK L;  2HUG A;  1OXT A;  1UEB A;  1XPU A;  1L1O A;  4DN4 M;  1ICF B;  1M1K C;  5EGT A;  5JVH 3;  2M00 A;  2O4X A;  3CCQ A;  3W2D A;  2MP1 A;  4JI0 Q;  3SK8 A;  3BZC A;  5C3W A;  4JV5 L;  2A6H D;  5D3I B;  2AWO A;  4FNF A;  3HZX A;  2EVB A;  1JR0 D;  4AYB B;  1SXT A;  5M3F G;  5M5X H;  4IUN A;  2F0S A;  4A3J H;  4BXX G;  3BDL A;  3E0E A;  1N32 L;  2A5H A;  2TSS A;  4BA2 I;  3TZU A;  2KEN A;  1E2W A;  1QJO A;  4LF6 L;  1Y8O B;  3M7G A;  4JVZ A;  2E75 C;  3CME A;  4DR2 L;  2R7Z H;  3QB3 A;  1VDZ A;  2FJ2 A;  1AFP A;  1BNZ A;  3D8G A;  1I4Q A;  1JCK B;  1AEX A;  1AH9 A;  3CW2 C;  1I94 L;  2VY3 A;  3PIP 3;  2K04 A;  1I3Q H;  4FYD A;  1Q1E A;  4ALP A;  1H9J A;  1X3Q A;  4S3S A;  5E1F A;  2NVY H;  3H3V I;  1YJW A;  3NBH A;  3CRL C;  3DWP A;  3VR2 A;  4EQN A;  2F0H A;  1VQ9 A;  2K01 A;  1X3F A;  5FK9 C;  1LTR D;  5KYI A;  4YHH L;  2BDN A;  4BXX H;  2RCN A;  1FGU A;  4CGY B;  1YNN D;  1G6P A;  2RF4 A;  1JOQ A;  4JI1 Q;  1G51 A;  4PMC A;  3E9I A;  5CBE E;  1KRT A;  4RHR A;  5C4H A;  1MJC A;  3AFP A;  2KUM A;  1PTO D;  1M90 C;  3RMH A;  1C9O A;  3SE0 A;  3TDQ A;  2QKI C;  3J81 j;  3DHQ A;  3S14 B;  1NBW A;  4K8I A;  4DR1 Q;  2NUC A;  3K58 A;  2JA8 G;  3KLS X;  4K6L A;  4HSV A;  2ZJR A;  3MXG A;  3W1B A;  3NSW A;  3H0G B;  4XYO A;  1U9R A;  4ZQ3 A;  1ASY A;  4XTC S;  1B3A A;  1HQM C;  5C44 G;  4F7X A;  2C5C A;  1SMY D;  3MZ5 A;  4K8J A;  3J7A F;  1PRT F;  4UP9 A;  3O13 A;  1CKO A;  1EIF A;  1B8A A;  2ZM6 Q;  2EPB A;  2F0P A;  1PH7 A;  4QIW E;  2IPK D;  1PYW D;  2R92 H;  3CQZ H;  2A68 C;  3HOY B;  3QIA A;  4EX5 A;  1QG7 A;  2B29 A;  2G9H D;  2LFN A;  3EA6 A;  4MNO A;  4OO1 G;  4H0L C;  2NVT B;  1TWF B;  1X3G A;  4P2C B;  2OT2 A;  4JW0 A;  5CV6 A;  1F2Z A;  4F87 A;  1YIT A;  3C3L A;  4QUF A;  1HNX L;  1UE1 A;  3GD7 A;  2NTT A;  1H95 A;  4TKO B;  4A3E H;  2CKZ B;  3GTG H;  2A74 C;  2IHF A;  2Z9H A;  3L9A X;  4YY3 L;  2EXD A;  2J7Z A;  4I7A A;  2OXP A;  1IXR A;  2B2U A;  1BQQ T;  2D0P A;  3CC2 A;  1LTA D;  4C3J B;  3H3V H;  1ZYR D;  4LK1 C;  1SE8 A;  2JQO A;  1SFO H;  4IUV A;  3H3V C;  4H44 C;  4PZ8 A;  1FR3 A;  4GKK Q;  1FYC A;  2JA7 B;  1Z6H A;  4RKB A;  3A0J A;  1S40 A;  3TBI B;  1ICW A;  1BR9 A;  1TS5 A;  1X32 A;  4YCU A;  2Q8R E;  2KCM A;  1NJI C;  5CV8 A;  3BDC A;  1L1O B;  3I91 A;  4G57 A;  1HRJ A;  4A3I G;  1K3R A;  2JA6 G;  1SNM A;  2JN4 A;  3PO3 G;  1JC7 A;  1Q1B A;  2RDG A;  3WOF A;  4C3I B;  3NEL A;  2ATW A;  2A19 A;  3KDF A;  4A3C H;  2HD3 A;  4JI5 L;  2ZXP A;  1ROD A;  2K5Q A;  2Q8T A;  1D5M C;  1V43 A;  2VL6 A;  4DU9 A;  2F03 A;  5D3D A;  1VQM A;  1O7L A;  1SJE D;  4BBR G;  1IBM Q;  3K6O A;  2EJM A;  1GHJ A;  3UDF A;  3T1Y L;  3M9B A;  4HJA A;  4DK6 C;  1VMP A;  2F0V A;  2NWG A;  1WYD A;  4LF5 Q;  3MA2 B;  1DZ1 A;  3PCO B;  3UDX A;  3PIO A;  4XXE A;  1Y69 U;  2BE5 C;  2GA4 B;  4P71 A;  1Y1W B;  3A8K E;  2C35 B;  1TXY A;  3MC0 B;  3CRK C;  4RGO S;  2VQE L;  3CC4 A;  4OX9 Q;  1I4X A;  1A8V A;  1XPO A;  1LAB A;  2F0I A;  1ESR A;  1QIL A;  4R8I A;  4B3M Q;  5LMN W;  5LMU L;  3NPP A;  1F2L A;  4DV5 Q;  2E2J H;  4N9P A;  2UU9 L;  1GUO A;  2K52 A;  1TS3 A;  2FMM A;  4R4C A;  4LF8 Q;  1LT5 D;  3BZK A;  3KUP A;  4AYB G;  5IP7 H;  2F3V A;  2MJ8 A;  1LTT D;  4IQZ A;  1EQR A;  3PSI A;  2F0W A;  3QOJ A;  1EQV A;  1E24 A;  2PZU A;  1K3B C;  4OWX B;  1BKB A;  2A1A A;  1Q90 A;  4QL5 A;  1XNQ L;  3OYY A;  4UPA A;  1F9P A;  3H94 A;  3FVQ A;  3K5O A;  2XRS D;  3Q22 A;  4ZRZ A;  4OIJ A;  4RMF A;  1J5E L;  1KLU D;  1Q8I A;  3RZD H;  2B2T A;  4N9T A;  1VQD A;  2R7F A;  3SXH A;  4CKE A;  2E2I B;  4ME5 A;  5CV9 A;  2I0Q A;  1Q8K A;  2CW0 D;  3TSS A;  3AYH B;  1Y1V B;  4CJ1 B;  1Z9F A;  4NXN L;  3HKZ E;  1SE2 A;  2VB2 X;  3TS2 A;  1MJE A;  3GTP H;  1RCV D;  3ULP A;  3HRZ C;  3E0J A;  2F52 A;  3SEB A;  1YNJ C;  1TT2 A;  4H7B A;  2Z4H A;  4AQY L;  1PA6 A;  2E8G A;  5J39 A;  1KDB A;  2NVX B;  1EOT A;  1WTO A;  2OCE A;  2Q2I A;  4OL7 A;  1K9M C;  1H9K A;  5JJI A;  1JWS D;  1SSO A;  1CFM A;  4KMU C;  4L5R C;  5IP9 H;  4V19 0;  1J8I A;  3ND8 A;  1OTC A;  5IWA L;  5FLX L;  4GOP A;  3CKI B;  2BOS A;  3MWY W;  2V1C C;  3PMF A;  1JOO A;  1Y8N B;  5EPK A;  4DR7 Q;  1DYQ A;  4LFB Q;  2RQX A;  2K4K A;  3HGB A;  3HOY G;  2ASB A;  1EEI D;  3NWT A;  2QIL A;  2NYZ D;  1QNU A;  5KND A;  1H9R A;  4CKB A;  3VYR A;  1SYF A;  2C9O A;  2KA7 A;  1B9N A;  3QWN A;  4H02 A;  1JOR A;  3NTI A;  1YHA A;  4LF9 L;  4DR5 L;  3HOW G;  3KDF B;  3M3Y H;  3M4Q A;  3J80 c;  1S5E D;  1IHZ A;  2UXB L;  3FPP A;  4LFA L;  4LUO A;  3DM3 A;  3KK7 A;  3A7L A;  4IPC A;  3NEM A;  2ZJQ A;  3BVM A;  5AJ3 Q;  1P8L A;  4HID A;  2G9D A;  1SNC A;  2ALY B;  2XSC A;  2CCZ A;  1WCM H;  2JA7 G;  4FVM A;  1F9S A;  4X66 Q;  5IYD G;  1K83 B;  2YU9 B;  4XIG S;  2AHO B;  1RF2 D;  2EYO A;  2RSN A;  3EN2 A;  5CMD A;  4NDX A;  2EXZ A;  3GTQ B;  2JXM B;  1EY7 A;  3LNN A;  3ITP A;  3GTK B;  4GN5 A;  2F0J A;  3T13 A;  5BN5 A;  3HOW H;  4C3I G;  1PV4 A;  2L55 A;  1AE3 A;  4GKJ Q;  4HSP A;  4NXM Q;  1I50 H;  1JE4 A;  2R93 H;  4QCL A;  2B63 B;  2QEJ C;  4LFC Q;  3BG3 A;  3I70 A;  2F0L A;  3PQI A;  3M85 A;  2PW5 A;  4PMB A;  2EY5 A;  2UUB Q;  4ILW A;  1HHV A;  2YV5 A;  3TS0 A;  3GTL B;  3V2T A;  4JC0 A;  4CKC A;  5T1I A;  2PMZ B;  4A3M H;  4XT3 B;  1Y1W G;  2BA0 A;  4B9X A;  5I6Y A;  4MIU A;  2EZV A;  1BVS A;  1D5Z C;  1PFM A;  1S3O A;  2UUC Q;  1OXV A;  2PYK A;  2QGQ A;  4HAE A;  1HA6 A;  3D3R A;  1NSN S;  3K7A H;  1L1O C;  4JYA Q;  2A69 D;  1Q3L A;  3PUX A;  3L2P A;  3OIP A;  3S2D B;  3IKJ A;  5C4Z A;  4C1N K;  1JOK A;  1KAA A;  2IL8 A;  4B3T Q;  3E5S A;  5C5L A;  3J80 i;  4FF1 A;  3UI2 A;  2I07 B;  1ENC A;  2CVR A;  5C3E B;  3S16 H;  5LMN L;  4YCV A;  3SK6 A;  1R4Q B;  1MSH A;  1VQC A;  3LWE A;  2F0F A;  5BR8 Q;  2MNA A;  4DUZ L;  2L4N A;  3S15 H;  2DY7 A;  2WB1 E;  1MIU A;  2PI2 A;  4K14 A;  1N34 L;  1I6V C;  2IX1 A;  1LT4 D;  2JP1 A;  4BY1 H;  4ZCK A;  2K5H A;  4DV1 Q;  2K1B A;  3NWS A;  2OQ0 A;  3NUC A;  3GTM H;  4UP8 A;  1STN A;  5CGK A;  4WFN 3;  1G91 A;  1O80 A;  4IUP A;  1JB3 A;  2PQE A;  3Q0A A;  1E1T A;  4HIK A;  4ZAI A;  2ES2 A;  3I4N B;  5E3F A;  4A3K H;  4X65 Q;  4B9W A;  1NUC A;  3FKI B;  4H13 C;  4DV2 Q;  4GOP B;  1DD2 A;  3PIO 3;  4HCE A;  1Y1V G;  3M4O B;  3RN5 A;  3H15 A;  3VDY A;  2Y0S G;  4DKA C;  5M5Y H;  3LGJ A;  1FVI A;  3RN2 A;  2L11 A;  3NEN A;  5I2X A;  3OWE B;  1V1O A;  2K5W A;  2JA5 B;  4IFD I;  5EPL A;  2HT1 A;  3G48 A;  3CCM A;  1F2M A;  1B1Z A;  2JE6 I;  4IUU A;  2LXJ A;  4XYQ A;  3VYU A;  2E2H B;  3HOV H;  1ASZ A;  4K2K A;  3GDE A;  2G5D A;  2WIN B;  3KLR A;  4ZYS A;  4DV0 Q;  3ULL A;  4K5V A;  3J81 L;  2L9H A;  1W6J A;  3CCV A;  2F4V Q;  1IL2 A;  2EY6 A;  1IBL Q;  2IY5 B;  2VS1 A;  5CV7 A;  2VB3 X;  4DF7 A;  4C2M B;  1CQF A;  1CSQ A;  3U4Z A;  1G6Z A;  5C5M A;  4PMW A;  1I4P A;  5IGB A;  2ZM6 L;  1VQ5 A;  3C2P A;  3GQB A;  3J81 E;  4FF4 A;  1HXY D;  3G71 A;  1F77 A;  2EYP A;  4R4Q A;  1PFB A;  5DM6 3;  3OTO Q;  3FHW A;  1QCB D;  1YI2 A;  3H09 A;  1Q86 C;  1QB5 D;  2Z4I A;  2EOT A;  2N78 A;  3BDO A;  4RGT A;  3S24 A;  5KNC A;  1R9T B;  1KDC A;  3OMG A;  1VQ7 A;  2M2L A;  3K5M A;  3MXP A;  1N8R C;  4A3B B;  1RL2 A;  4J1M A;  4WJ3 M;  1SR3 A;  1ML0 D;  4DR6 Q;  2ICI A;  4UP7 A;  1XTC D;  4PZ6 A;  3JAM E;  1XMO L;  3FP9 A;  4WJ4 A;  3TP8 A;  5DAU A;  5IOD A;  3BJU A;  5KGU A;  1EL0 A;  1YBY A;  2H5X A;  2MQH A;  1V9P A;  4GKK L;  2AUJ D;  2Q2T A;  4WJW A;  2QW7 A;  3T56 B;  4DA2 A;  4TSS A;  2BCO A;  4K2L A;  1A3T A;  2MO0 A;  1B44 D;  1EOV A;  2A6E C;  1WD0 A;  2QF7 A;  1SJH D;  1LV9 A;  1XJV A;  4HMI A;  4MTN A;  1JWU D;  2KHS A;  4NP5 A;  1TKW B;  4P72 A;  1MBY A;  1V1Q A;  3KBX A;  1B9M A;  2K75 A;  3BZD B;  4IFD H;  1EEF D;  4DNT B;  1CA6 A;  1VQB A;  3BS1 A;  1EIG A;  2B63 G;  3G6E A;  3B6Y A;  2QEX A;  1WD1 A;  5C4J B;  3CF5 A;  2WAQ E;  3GO5 A;  3EJI A;  4BY7 H;  4R4O A;  1X3P A;  1GOZ A;  4LF4 L;  2VUM B;  1SYD A;  3K80 C;  2IWH A;  5DM7 3;  4J15 A;  4IFD J;  2K33 A;  4OX9 L;  1EY4 A;  1TU2 B;  4DNI A;  3A5U A;  1EU4 A;  5FLM G;  4AH6 A;  3CCE A;  1VQI A;  2OF1 A;  4B3M L;  3U58 A;  1STH A;  4RCN A;  4DK3 C;  3M4P A;  4DV5 L;  2L5T A;  3D6W A;  4EVO A;  1I6H B;  3ERQ A;  1QUQ A;  4A3G H;  1JMC A;  1KNE A;  2F3I A;  2E76 C;  4YWM A;  1G2S A;  2YTV A;  4N8F A;  4LF8 L;  2D9U A;  1HR0 Q;  3MHB A;  2CQO A;  2UXC L;  1WVL A;  2XN9 C;  5LHY 1;  2J0T D;  5C3E G;  2V4D A;  3I4M B;  3CCR A;  4UHV A;  1VQA A;  1D1I A;  1EY5 A;  2HHH Q;  2Z1C A;  5M5W B;  3RLN A;  3SHL A;  3GTJ B;  1K0R A;  3RUZ A;  1HNZ Q;  3F2U A;  1SND A;  3BU2 A;  3W5O A;  4Q0F A;  2FMC A;  2N8N A;  4JI4 Q;  3S1Q B;  3V96 A;  5IE8 A;  4X3S A;  4FO2 A;  3F2D A;  1F9Q A;  3QR8 A;  4X64 Q;  3OOC A;  2A6H C;  1EZ8 A;  5M3F H;  3PGZ A;  3OW2 A;  3I4N G;  4A3F B;  5FJ8 G;  4OO1 I;  4IJL A;  3KBG A;  4X3U A;  4DV6 Q;  1KNA A;  4BBS B;  2SOB A;  3FKI G;  4GN3 B;  1SN8 A;  4B3S Q;  2KBN A;  2NTS A;  4DXF A;  1Y14 B;  2IW3 A;  3NTK A;  4C56 C;  2B2V A;  3T53 B;  3W3A A;  4HTH A;  1LTL A;  2GN5 A;  1Q81 C;  5F2D A;  3PUV A;  1ZKO A;  2K6A A;  4IJH A;  4POG A;  1GHK A;  3HOU B;  3S17 B;  4G7O C;  3I2Z A;  4DV7 Q;  5M3M B;  2K05 A;  3OWF A;  4MN3 A;  1K8G A;  5ELE A;  1TWG H;  2KEC A;  1XMQ L;  5TSS A;  2WFW A;  1NNX A;  3GV3 A;  4KLK A;  1QVF A;  4FF2 A;  2CH4 W;  5FJ8 H;  3KYH C;  4GN4 B;  3MXN A;  2PNH A;  1D8L A;  2R61 A;  4RWS C;  2DUD A;  3FEW X;  2HCC A;  4OEL B;  4ABN A;  2OTJ A;  1YNN C;  1X56 A;  3EBE A;  1CZG A;  4DV3 Q;  1BCP B;  5FLX c;  2EJG C;  3K81 C;  4KD3 A;  1AZQ A;  3CP0 A;  4LJZ C;  1VQF A;  1PZK D;  1PTO H;  1GUG A;  1PTO C;  1VQE A;  2AWN A;  1VQJ A;  2JA8 H;  3IL8 A;  1A0I A;  1V1P A;  1UEA B;  2MPM A;  2F4I A;  2B2W C;  4FF3 A;  2LSS A;  3IRB A;  4A3B G;  4ZUI A;  3UE0 A;  2K14 A;  1B4O A;  1STG A;  5C44 H;  2QDB A;  1EFW A;  3OMC A;  2SNS A;  2KJX A;  3GTO B;  2KHJ A;  3KLS A;  5M9O A;  2PW7 A;  2Q2H A;  3VA7 A;  1VQN A;  1KXL A;  1KAW A;  1SMY C;  3OSO A;  3S1M H;  2ICE C;  1S5D D;  2K5N A;  2B2Y A;  2IT1 A;  2R3Z A;  5I2Y A;  4G7H C;  3D4D A;  4FP5 D;  1KQS A;  4L63 B;  4OO1 H;  4EGV A;  5JPN C;  1JE5 A;  3S1R B;  1LO5 D;  4RCO A;  4YWK A;  1IZ6 A;  2E2D C;  3AMU A;  5CC4 A;  2AQ3 B;  1YZ6 A;  2JEA I;  3K7U C;  5IT9 E;  1QUQ B;  4GKJ L;  3SVM A;  3NHH A;  5C0X G;  5EKL A;  1WTP A;  4OGQ C;  2Z6K A;  1CHP D;  3LWU A;  1X65 A;  3DEO A;  2Q2U A;  1IKM A;  2R6G A;  2NN6 G;  4JCV E;  1W2B A;  1TWA H;  2UUB L;  3MXU A;  4QQB X;  1FJG L;  1ZYR C;  1HZB A;  3UDI A;  4XQN A;  1ET6 A;  4DV4 Q;  2VUM G;  2RKS A;  3HP3 A;  2AUK A;  3P20 A;  1PRT B;  4PV1 C;  4A3I H;  2JA6 H;  3PO3 H;  4LMQ D;  3VYT A;  5EAY A;  2KVM A;  4RKL A;  1GKH A;  3D4W A;  3I72 A;  5ELO A;  1FL0 A;  2KCN A;  1NTG A;  2JA9 A;  1Q7Y C;  3KF8 A;  1UUP A;  3D31 A;  1XXG A;  4JI8 Q;  1N36 Q;  4C3H B;  3RZO H;  3GV6 A;  4JI2 Q;  4BBR H;  4KTA A;  2DN8 A;  1IBK Q;  3LX0 A;  4IO9 A;  2D2C C;  2YTY A;  4KN4 C;  1CZW A;  3A8I E;  5ELB A;  4HJ8 A;  1SNQ A;  1M8A A;  3CCJ A;  3I4M G;  1Z47 A;  2QCP X;  4JG2 A;  1TWH H;  1X9N A;  3TRE A;  4Y7N H;  4A3D B;  1O7Y A;  2MGS A;  1F2Y A;  1RJT A;  4DV1 L;  1N32 Q;  1STB A;  2H1E A;  3FDT A;  3V05 A;  2F0Q A;  1GM5 A;  4LF6 Q;  3X3N A;  1AW7 A;  1CUK A;  5CYU A;  1HTL D;  1U4P A;  4X65 L;  4IOC A;  2K50 A;  3KLW A;  3R8B A;  4DFA A;  3MXN B;  4I7Z C;  2CFM A;  1A6X A;  2XIW A;  4A3F G;  2R7D A;  1I94 Q;  4FXG C;  4HJ9 A;  3HOZ B;  5HGQ A;  4BBS G;  3NQT A;  1TR5 A;  1A2T A;  3MTS A;  3MFG A;  1N33 Q;  1B2T A;  2IX0 A;  1LT6 D;  3Q23 A;  1D5X C;  1S5C D;  4RFB A;  1EWC A;  3E9H A;  1NAP A;  1TWC B;  1II3 A;  2K32 A;  3BYY B;  5KIX A;  2NVQ B;  3A55 A;  5C4X B;  4U68 A;  1IYU A;  4G7Z C;  4CJ0 B;  1SE4 A;  3L3O C;  4LUV A;  1HZC A;  4APV A;  3D4R A;  3U9S A;  2XWJ B;  1V1P B;  2D5D A;  1ILP A;  2N49 A;  3HOU G;  4DR4 Q;  5E4W C;  3T1H Q;  4N8X 1;  5HUR A;  3TME A;  2F4V L;  3H0G G;  1QNK A;  4BWG B;  1QZH A;  1IBL L;  2E5L L;  1QE6 A;  4X3K A;  2CW0 C;  5E4X A;  2Z8L A;  5COR A;  4FDB A;  3K57 A;  3ER0 A;  1BCP D;  4A93 B;  4ZKC B;  1B7Y B;  3I7F A;  1SNO A;  3ULJ A;  2HQL A;  3PO2 B;  3S1N B;  1EY8 A;  1O7Z A;  3QJY A;  2B39 A;  1STE A;  1T5X D;  2WKD A;  5I6W A;  3CCU A;  3RNU A;  1X54 A;  1K0S A;  2F0M A;  1R4P B;  1HJP A;  4IUR A;  3S14 H;  2I5M X;  1SRU A;  1AZP A;  2XRQ D;  3MAQ A;  1CI3 M;  4GLA C;  3H0G H;  4JI3 L;  3TP7 A;  4CHT B;  5EKI A;  4JI7 L;  4KJN A;  1HPC A;  2RHQ B;  3DM1 A;  1GUS A;  2ZTD A;  4K5X A;  4C3J G;  4Q5V A;  5IY0 A;  1I4H A;  4L8J A;  4KJO A;  4IAL A;  1RHP A;  3HOY H;  3I90 A;  2X6L A;  5I9P A;  1FNW A;  1NE3 A;  1A62 A;  1H9S A;  4RHS A;  2NVT H;  1TWF H;  1GO3 E;  2D0O A;  1RTO A;  2YYZ A;  4GS3 A;  3AEV A;  1PH1 A;  3SK4 A;  1XYI A;  2WKC A;  3KF8 B;  4OEM B;  2K28 A;  1VQP A;  2I46 A;  1CK1 A;  1KTK A;  1OO9 B;  4PNY A;  4P74 A;  4F88 A;  3J81 i;  4HED A;  2DNC A;  4C3J H;  1QZG A;  2UUA Q;  1CSP A;  1EZ6 A;  2XNA C;  5DLQ E;  2JA7 H;  4KY5 A;  3NP8 A;  5IYD H;  3L7Z C;  5M5X B;  2QDL A;  4A3J B;  1PRT D;  2A73 B;  1VQ6 A;  2B8F A;  4QUC A;  1PTO F;  1LT3 D;  1JJ2 A;  1GUW A;  4R1J A;  1S5F D;  4U67 3;  1K28 A;  3T1Y Q;  4JI0 L;  2R7Z B;  4C3I H;  4HJ7 A;  2NZO A;  1PH5 A;  1HTP A;  1OXX K;  3TRZ A;  1J9O A;  2XTI A;  5DEH A;  3DLL A;  3A8J E;  4C3H G;  1LM0 A;  2RDH A;  1I3Q B;  3M4Y A;  4QIW B;  2VQE Q;  2JSO A;  3STB D;  4GZY C;  1EIH A;  3DXJ C;  4UDU C;  3DWQ A;  2NVY B;  4B3R Q;  1KC8 C;  3C46 A;  2HHH L;  4EQO A;  5FO8 B;  2OEO A;  1Y1W H;  2UXD Q;  3F2C A;  2BA1 A;  4YWL A;  1VF5 C;  2F0K A;  1HNZ L;  1DOK A;  2Z0S A;  4A3D G;  2EYH A;  3NE5 B;  1D7Q A;  3CAM A;  3CHB D;  3TQY A;  3EIV A;  1DXM A;  1ESF A;  5ELC A;  4A75 A;  4KHZ A;  3E3X A;  2A69 C;  1RIP A;  1JJG A;  3RLO A;  4DNR B;  2VW9 A;  1D6E C;  3J7A 5;  3N52 A;  2I5H A;  4DV6 L;  1UAP A;  1K73 C;  1O78 A;  2B8G A;  4JI1 L;  1GJX A;  3TEH B;  1BXT A;  4RGM A;  3K0Y A;  3STB C;  1GVP A;  2OWO A;  4XT1 B;  1Q46 A;  3KJP A;  2KHI A;  1IW7 D;  1EIY B;  3DEP A;  1PH8 A;  1J5E Q;  4M1U B;  5I9O A;  2IX3 A;  5C4X G;  3K8A A;  1TY2 A;  1NR2 A;  4DR1 L;  2IHE A;  5EBC A;  3I8Z A;  4ME3 A;  2CH4 A;  4JPB W;  1S5B D;  2VNU D;  1UNS A;  3BVZ A;  2R92 B;  3CQZ B;  1VQH A;  3IFD A;  1IYV A;  2E2I H;  3P7J A;  3SGI A;  4DUY Q;  1Y1V H;  3IFT A;  1DON A;  1DOL A;  4LW1 A;  2IJ0 A;  2EDG A;  4A76 A;  1A3U A;  4A3E B;  4A93 G;  4CDD C;  3PO2 G;  3GTG B;  4RG1 A;  1Q82 C;  5GRO A;  1H9S B;  2LKV A;  3JAM L;  2NVX H;  1GUT A;  2OQK A;  2RVL A;  3I56 A;  3C1E A;  3HEJ A;  1LTI D;  4DAM A;  1SFO B;  2XVS A;  1YEZ A;  5T1G A;  1J6Q A;  1VQO A;  4RA8 A;  2K5V A;  5FKA C;  3R93 A;  3SDZ A;  1PHJ A;  4BS9 A;  4LAA A;  2SEB D;  1VCI A;  1UE6 A;  4DPG A;  1HFN A;  4RGN A;  2DGY A;  2AQ2 B;  2B2U C;  2NB0 A;  5I4D A;  4TQU S;  2ZXR A;  1U4L A;  5IYC G;  4OIK A;  1B70 B;  1C0A A;  1PXU A;  3CPF A;  4MZ9 A;  1PZI D;  4J6H A;  4DK1 A;  4LF9 Q;  4DR5 Q;  1TVX A;  2PNR C;  1NR4 A;  5KRU A;  4XQJ A;  1VQL A;  1NMF A;  2EY2 A;  1BDO A;  4LFA Q;  1L0X B;  1BBX C;  1A63 A;  1ENA A;  1PFS A;  2VZA A;  1SMX A;  3EQL C;  3J80 E;  3ND9 A;  3T51 B;  1NCV A;  1DGS A;  2Y0S E;  3ZYY X;  3G7L A;  1XTD A;  3HKZ B;  2NZH A;  2AKW B;  5IGG A;  2SDF A;  5BN4 A;  4XDX A;  1IBM L;  3R2T A;  3NK9 A;  4QY7 A;  4ZUJ A;  1SAP A;  1SLJ A;  4LF5 L;  2EE1 A;  4ID6 A;  3FMC A;  1YJ9 A;  2E2J B;  4QJF A;  4Y52 H;  3K0X A;  2MFI A;  4YCW A;  4HJ5 A;  1K8A C;  1K83 H;  1T5E A;  1W3S A;  2F0O A;  2YU9 H;  3I3C A;  3I4O A;  5IGD A;  4A3J G;  4HIM A;  4V0B A;  3IAY A;  3GTQ H;  4KD4 A;  5ELD A;  5A2Q L;  1TII D;  1WTX A;  3GTK H;  1L2F A;  4PZ7 A;  1CQV A;  2R7Z G;  1HZA A;  4C1N I;  2XWB B;  4JI2 L;  2B63 H;  4AIM A;  4G4K A;  4I65 A;  1E22 A;  4Z9C B;  2L0C A;  4MHE A;  5HGT A;  1LTG D;  1P16 A;  3AU7 A;  2N88 A;  3I4L A;  3WWV A;  5A2Q E;  2RA4 A;  1BOS A;  1X6O A;  3GTL H;  1BCP F;  3CCS A;  3RZD B;  5JEA G;  1HQR D;  4WRD A;  5IGF A;  4X62 Q;  3K59 A;  3M7N A;  4JI6 Q;  5FLM H;  1HCZ A;  3WOE A;  1SBB B;  1VF7 A;  3J7Y W;  5LMN Q;  3GTP B;  5EKK A;  1KRS A;  5GAG C;  2BDO A;  4KI0 A;  4F8M A;  3NXW A;  3S2D H;  4JBW A;  4DUZ Q;  5EJW A;  4HCS A;  2B2T C;  4CBV A;  4OWW B;  1C8C A;  3U4V A;  4LF7 Q;  1N34 Q;  1FD7 D;  1DOM A;  1KAB A;  4P75 A;  5C3E H;  2RCF A;  3KF6 A;  1N33 L;  1A3V A;  1ZEQ X;  1KHI A;  1OXS C;  5IOC A;  5J1Z A;  1BBW A;  1HUN A;  3VA5 A;  5JEA H;  1OXU A;  2DJF C;  3F8T A;  3R3O A;  2ZTC A;  4J8Q A;  2JA5 G;  4O0A A;  3HFZ B;  4K0K Q;  3VR4 A;  5LL6 S;  4KV6 A;  3TP5 A;  1SEB D;  3PUW A;  1MHW C;  3J7Z C;  1QVG A;  1CHQ D;  3C1F A;  2MUY A;  3RLF A;  4KK7 A;  4DR4 L;  3T1H L;  2A68 D;  1LUZ A;  2AMC B;  2ENB A;  2RSO A;  4TRD A;  3I4N H;  3AB9 A;  4GNX A;  2R92 G;  2M9V A;  3OHX C;  5JEA J;  1IKL A;  1B53 A;  3FKI H;  1M4V A;  5G3L D;  2TMP A;  1H9M A;  2PMZ E;  3SR1 A;  4DR3 Q;  4KHP Q;  2XGT A;  4GOP C;  3M4O H;  4DR7 L;  2MHV A;  4HIO A;  2F0E A;  4LFB L;  5COY A;  4ODG A;  4A3E G;  5C0X I;  3M3Y B;  2JA5 H;  3TZD A;  4RAU C;  3FRP B;  3AQQ A; 
#chains in the Genus database with same CATH homology
 4EQ5 A;  1HZ9 A;  1N33 Q;  2IX0 A;  2NN6 I;  2E2H H;  3W1G A;  1L0W A;  3L0O A;  1JT8 A;  3HOX H;  2Z6K C;  4IPH A;  5IYC H;  3E9H A;  3KOJ A;  4B3T Q;  1HNW Q;  3J80 i;  1PYS B;  3UE1 A;  5GAH C;  5K36 G;  1U5K A;  3S16 H;  5LMN L;  4O2D A;  3PF5 A;  4LUV A;  1HZC A;  1QVC A;  4YCV A;  4APV A;  4DV4 L;  2EIF A;  3RR5 A;  1S72 A;  1VQC A;  1MKH A;  4C2M H;  4A3G G;  3L2P A;  2JEB I;  5BR8 Q;  2MNA A;  2N49 A;  4DUZ L;  3HOU G;  4DR4 Q;  3T1H Q;  3S15 H;  4OXP A;  2VQF L;  4DAY B;  2WB1 E;  1MIU A;  5AJ3 L;  2PI2 A;  4JBM A;  2F4V L;  1N34 L;  2IX1 A;  3H0G G;  1QZH A;  1IBL L;  1PVO A;  2E5L L;  4BY1 H;  2K5H A;  4DV1 Q;  4X66 L;  1YNX A;  2CWP A;  2JK8 A;  2OQ0 A;  1N36 L;  1PH6 A;  4UP8 A;  4JI8 L;  3GTM H;  4A3C G;  2BH2 A;  2EQS A;  2LXK A;  1UE5 A;  4JOI C;  1CKM A;  1EUJ A;  3HKS A;  4FDB A;  1E1T A;  3ER0 A;  4HIK A;  1R9T H;  1IBK L;  1XPR A;  2ES2 A;  3A5Z B;  1B7Y B;  3I7F A;  3ULJ A;  1OXT A;  2HQL A;  4A3K H;  4X65 Q;  1XMO Q;  5GAE C;  1UEB A;  1XPU A;  1UE7 A;  1L1O A;  1M1K C;  4A3B H;  1XNR Q;  4DV2 Q;  4P73 A;  4GOP B;  4NXM L;  3ZJY C;  3CCQ A;  4JI0 Q;  1Y1V G;  3RN5 A;  3H15 A;  3CCU A;  3RNU A;  3VDY A;  2Y0S G;  3BZC A;  1X54 A;  4DKA C;  5M5Y H;  4JV5 L;  3LGJ A;  1FVI A;  2AWO A;  3RN2 A;  3HKZ G;  1HJP A;  4LFC L;  3NEN A;  3S14 H;  2I5M X;  5M3F G;  1SRU A;  2KCT A;  5J3B A;  5M5X H;  4A3J H;  2B3G A;  4BXX G;  3E0E A;  1N32 L;  3UDG A;  2UUA L;  4BA2 I;  4IFD I;  2HT1 A;  3G48 A;  2KEN A;  4GLA C;  3CCM A;  3H0G H;  2JE6 I;  4LF6 L;  2LXJ A;  4JI3 L;  3CME A;  4DR2 L;  2R7Z H;  4LNQ A;  1U0L A;  3HOV H;  4JI7 L;  1ASZ A;  3GDE A;  1HR0 W;  2UUC L;  2RHQ B;  2ZTD A;  2VQF Q;  3AFQ A;  5HY6 A;  3ULL A;  4DV0 Q;  1AH9 A;  3CW2 C;  5IY0 A;  5IP7 G;  3CCV A;  2VY3 A;  1I94 L;  2F4V Q;  4JYA L;  1IL2 A;  1I3Q H;  4JBK A;  1IBL Q;  3HOY H;  1Q1E A;  4ALP A;  1E3P A;  2IY5 B;  2VS1 A;  4JOI A;  4L5T A;  1CSQ A;  1NE3 A;  3U4Z A;  1A62 A;  2NVY H;  2L15 A;  3H3V I;  1YJW A;  4LF4 Q;  4PMW A;  1YIJ A;  1VQ9 A;  4B3T L;  1PH2 A;  2ZM6 L;  1TWF H;  2NVT H;  1X3F A;  1GO3 E;  1VQ5 A;  2D0O A;  1YHB A;  4YHH L;  2YYZ A;  4GS3 A;  3G71 A;  3AEV A;  1PH1 A;  4BXX H;  2RCN A;  4R4Q A;  1FGU A;  2ID0 A;  3KF6 B;  4IFD G;  3D0F A;  3KF8 B;  5C4J H;  3FHW A;  3OTO Q;  1YI2 A;  1LYL A;  1Q86 C;  4B3R L;  2N78 A;  1GD7 A;  2RF4 A;  1G6P A;  5BR8 L;  3S24 A;  1VQP A;  1Q12 A;  4JI1 Q;  1G51 A;  3NBH B;  4UY8 C;  4JV5 Q;  2VUM H;  2UXD L;  3CCL A;  4P74 A;  1VQ7 A;  3E9I A;  5C0X J;  1N8R C;  1KRT A;  3J81 i;  1MJC A;  4IPG A;  2BH8 A;  4C3J H;  1QZG A;  2UUA Q;  1RL2 A;  3AFP A;  1CSP A;  4WJ3 M;  1SR3 A;  1M90 C;  1C9O A;  5DLQ E;  2JA7 H;  4DR6 Q;  2UXC Q;  2QA4 A;  4UP7 A;  1EWI A;  4PZ6 A;  4POF A;  4DR2 Q;  1I6H H;  5IYD H;  3L7Z C;  3J81 j;  1NBW A;  4DR1 Q;  2JA8 G;  1XMO L;  3FP9 A;  2ZJR A;  4WJ4 A;  1VQ6 A;  4GNX B;  1EQQ A;  4IPD A;  3W1B A;  3BJU A;  4DV2 L;  1YBY A;  1JJ2 A;  2H5X A;  2MQH A;  1V9P A;  4R1J A;  3T1Y Q;  2WP8 J;  4JI0 L;  4GKK L;  1ASY A;  2Q2T A;  4XTC S;  1VQ8 A;  4C3I H;  5C44 G;  4HJ7 A;  2NZO A;  1YHQ A;  2MO0 A;  2ZJP A;  1PH5 A;  1OXX K;  1EOV A;  3I4M H;  3TRZ A;  4BBS G;  2XTI A;  4UP9 A;  1EYG A;  3DLL A;  1CKO A;  1EIF A;  1XJV A;  1B8A A;  1LM0 A;  5M5W H;  2ZM6 Q;  3ERS X;  1PH7 A;  4MTN A;  4QIW E;  4TVA B;  4YHH Q;  3GTJ H;  2R92 H;  2VQE Q;  3CQZ H;  5IP9 G;  1JJC B;  4OON A;  4P72 A;  3STB D;  5GQO A;  3F2B A;  4L5Q A;  3F1Z A;  1V1Q A;  4EX5 A;  1VQK A;  2B29 A;  4B3R Q;  2K75 A;  1KC8 C;  1I5F A;  4MNO A;  4OO1 G;  3S1Q H;  1E1O A;  2HHH L;  1X3G A;  3JC6 6;  4DV0 L;  3CXC A;  1VQB A;  1Y1W H;  2B63 G;  5M3M G;  3G6E A;  3F2C A;  1YIT A;  2UXD Q;  2BA1 A;  4YWL A;  1X55 A;  1HNX L;  3B6Y A;  1UE1 A;  3GD7 A;  2Z0S A;  2QEX A;  1HNZ L;  3CF5 A;  4A3E H;  4A3D G;  4IOA A;  4A3F H;  1H95 A;  2WAQ E;  1NY4 A;  2CKZ B;  3GO5 A;  3J81 c;  1D7Q A;  3GTG H;  4DUY L;  2IHF A;  4BBS H;  4R4O A;  3CAM A;  3TQY A;  2EXD A;  4YY3 L;  3EIV A;  4BY7 H;  1YVC A;  4LF4 L;  4A75 A;  4KHZ A;  1IXR A;  3K80 C;  2PI2 E;  1RIP A;  3ICE A;  4J15 A;  2D0P A;  1JJG A;  3RLO A;  2VW9 A;  4IFD J;  4OX9 L;  3CC2 A;  4DNI A;  3A5U A;  3J7A 5;  3H3V H;  5FLM G;  2I5H A;  1SE8 A;  2JQO A;  4AH6 A;  3OTO L;  3CCE A;  4DV6 L;  1XMQ Q;  1SFO H;  1HH2 P;  1VQI A;  4PZ8 A;  1K73 C;  4GKK Q;  4B3M L;  3A0J A;  3U58 A;  4JI1 L;  4DK3 C;  1S40 A;  3M4P A;  3TEH B;  4DV5 L;  1QUQ A;  1O7I A;  2ZTE A;  4YCU A;  3STB C;  4AYB E;  1GVP A;  1JMC A;  2KCM A;  1NJI C;  1CKN A;  2F3I A;  2OWO A;  4YWM A;  1Q46 A;  5JJL A;  3KJP A;  2KHI A;  2YTV A;  3HOU H;  3S17 H;  4LF8 L;  1EIY B;  1HR0 Q;  1L1O B;  5M3M H;  1PH8 A;  2PQA A;  3JAM c;  2CQO A;  1K3R A;  4A3I G;  1J5E Q;  2JA6 G;  3PO3 G;  5ELN A;  1Q1B A;  5C4X G;  4DR6 L;  2UXC L;  4NB3 A;  3NEL A;  2ATW A;  5C3E G;  3K8A A;  2A19 A;  1WCM G;  3KDF A;  3CCR A;  4A3C H;  4JI5 L;  1VQA A;  4DR1 L;  1IYJ B;  2IHE A;  4ME3 A;  1V43 A;  2VL6 A;  2HHH Q;  2VNU D;  1VQM A;  3RLN A;  4BBR G;  1PH4 A;  1IBM Q;  1WFQ A;  1VQH A;  3UDF A;  3T1Y L;  3M9B A;  1K0R A;  4HJA A;  1HNX Q;  4GLV B;  4DK6 C;  1HNZ Q;  2WB1 G;  3MEF A;  2E2I H;  3BU2 A;  3W5O A;  1WYD A;  3SGI A;  2N8N A;  4DUY Q;  1KD1 C;  1Y1V H;  4JI4 Q;  4YY3 Q;  4LF5 Q;  1BBU A;  3PCO B;  3UDX A;  4LW1 A;  3PIO A;  5IE8 A;  2R93 G;  4P71 A;  3F2D A;  2C35 B;  1X3E A;  1TXY A;  4X64 Q;  2VQE L;  3PGZ A;  5M3F H;  4A76 A;  3OW2 A;  3CC4 A;  1VQ4 A;  4OX9 Q;  3CD6 A;  3I4N G;  4A93 G;  1A8V A;  5FJ8 G;  3PO2 G;  4IJL A;  1XPO A;  4A3L G;  4OO1 I;  4DV6 Q;  2GVB A;  3FKI G;  4BA1 I;  1KIX A;  4RG1 A;  4GN3 B;  1Q82 C;  1SN8 A;  4B3S Q;  2KBN A;  4B3M Q;  1PYB A;  5LMN W;  5GRO A;  5LMU L;  1Y14 B;  2OTL A;  4DV5 Q;  1NMG A;  2E2J H;  1YJN A;  4A3M G;  1VQG A;  2NVX H;  2UU9 L;  3GTO H;  2K52 A;  2OQK A;  3I56 A;  4R4C A;  4DAM A;  4LF8 Q;  3BZK A;  4AYB G;  1YEZ A;  1J6Q A;  5IP7 H;  1LTL A;  2GN5 A;  2K5V A;  3CMA A;  1VQO A;  1Q81 C;  1PHJ A;  4L5S A;  1PH3 A;  1VCI A;  1UE6 A;  1EQR A;  3PIP A;  4DPG A;  3PSI A;  3A74 A;  3PUV A;  3Q8D A;  3PF4 A;  4IJH A;  1E24 A;  4POG A;  4JI5 Q;  2DGY A;  4OWX B;  3CC7 A;  1BKB A;  3I2Z A;  1UWV A;  2A8V A;  4DV7 Q;  2A1A A;  4TQU S;  3S1R H;  5IYC G;  3G4S A;  2MO1 A;  1K8G A;  1TWG H;  1XMQ L;  1B70 B;  3PUZ A;  4QL5 A;  3OYY A;  2WFW A;  1QVF A;  4KLK A;  4UPA A;  1XNQ L;  1C0A A;  3CPF A;  4MZ9 A;  2NVQ H;  2D62 A;  3KYH C;  4GN4 B;  3U50 C;  5FJ8 H;  4A3L H;  2PNH A;  4LF9 Q;  2FXQ A;  1D8L A;  4DR5 Q;  2DUD A;  1FJG Q;  1SRO A;  1WI5 A;  3JAM i;  2OTJ A;  3KFU A;  1X56 A;  3EBE A;  1HR0 L;  1VQL A;  1NMF A;  4DV3 Q;  4RMF A;  1J5E L;  4LFA Q;  5FLX c;  3K81 C;  3RZD H;  1A63 A;  1PFS A;  2VZA A;  1VQD A;  2R7F A;  3CP0 A;  1SMX A;  4R4T A;  3PV0 A;  2I0Q A;  1Q8K A;  4BY1 G;  3AYH B;  1DGS A;  1VQF A;  2Y0S E;  4A4I A;  1Z9F A;  4NXN L;  3HKZ E;  3TS2 A;  5LMU Q;  1XTD A;  1VQE A;  2AWN A;  1VQJ A;  2AKW B;  2NZH A;  1MJE A;  3GTP H;  4A3G H;  2UU9 Q;  1IBM L;  4PG3 A;  2JA8 H;  4X62 L;  1A0I A;  4QY7 A;  4JI6 L;  3ULP A;  4A3K G;  4LWC A;  2LSS A;  2F52 A;  2CWA A;  3IRB A;  4A3B G;  1SLJ A;  2YTX A;  4LUZ A;  3KJO A;  1WJJ A;  2HIX A;  2K14 A;  3UE0 A;  4JI4 L;  4LF5 L;  4AQY L;  1PA6 A;  5C44 H;  1YJ9 A;  1JB7 A;  4QJF A;  2E8G A;  1EFW A;  4Y52 H;  3K0X A;  2KHJ A;  2MFI A;  4JBJ A;  4X64 L;  1AE2 A;  4YCW A;  2OCE A;  2Q2I A;  4HJ5 A;  1K8A C;  2Q2H A;  1K83 H;  1K9M C;  1W3S A;  1KAW A;  2YU9 H;  4C3H H;  1VQN A;  1KXL A;  5GAD C;  5JJI A;  3S1M H;  4A3J G;  2GVA A;  2K5N A;  3I4O A;  4L5R C;  4HIM A;  4LF7 L;  5IP9 H;  1XNQ Q;  2IT1 A;  4B3S L;  3GTQ H;  4QGU A;  3HOZ G;  1C7Y A;  1OTC A;  3GTK H;  5IWA L;  4GOP A;  1L2F A;  4PZ7 A;  2R7Z G;  1KQS A;  1HZA A;  3HOV G;  2HIV A;  2V1C C;  1JE5 A;  4JI2 L;  2B63 H;  4YWK A;  4DR7 Q;  1IZ6 A;  4AIM A;  4GLX A;  4K0K L;  4LFB Q;  4A3D H;  1E22 A;  2K4K A;  3S2H H;  3HOY G;  1P16 A;  1YZ6 A;  3WWV A;  2JEA I;  3K7U C;  1QUQ B;  2ASB A;  4GKJ L;  4NXN Q;  1X6O A;  1CKN B;  5C0X G;  4DV7 L;  1G29 1;  5IYB G;  3GTL H;  3CCS A;  5JEA G;  2PQA B;  2Z6K A;  4KHP Q;  4X62 Q;  4OWT B;  4H02 A;  1X65 A;  2Q2U A;  1WOC A;  4JI6 Q;  3M7N A;  2R6G A;  2NN6 G;  1YHA A;  4JCV E;  5FLM H;  1W2B A;  4LF9 L;  1TWA H;  2UUB L;  4DR5 L;  1T9H A;  3KDF B;  3HOW G;  4QQB X;  4GNX C;  3M3Y H;  1VS0 A;  3M4Q A;  1FJG L;  3J80 c;  4DR3 L;  4AQY Q;  3HOZ H;  4KHP L;  2WAQ G;  5LMN Q;  2UXB L;  1HZB A;  4DV3 L;  1KRS A;  3UDI A;  5GAG C;  4DV4 Q;  4LFA L;  2VUM G;  4KI0 A;  3S2D H;  4LUO A;  5E7N A;  3DM3 A;  4JBW A;  4DUZ Q;  4IPC A;  4A3I H;  3NEM A;  2JA6 H;  3PO3 H;  2ZJQ A;  5EAY A;  5AJ3 Q;  4OWW B;  1TWC H;  3U4V A;  1GKH A;  5C4X H;  1P8L A;  4LF7 Q;  5ELO A;  1FL0 A;  4HID A;  1N34 Q;  2ALY B;  1NTG A;  4P75 A;  5C3E H;  2JA9 A;  2JJQ A;  3KF6 A;  1WCM H;  1Q7Y C;  2CCZ A;  5IWA Q;  2E5L Q;  1N33 L;  2JA7 G;  4X66 Q;  1KHI A;  3D31 A;  5IYD G;  4JI8 Q;  1OXS C;  1N36 Q;  3RZO H;  1BBW A;  2AHO B;  4XIG S;  5IYB H;  4JI2 Q;  3EN2 A;  4BBR H;  1HNW L;  1E7Z A;  1OXU A;  3F8T A;  2ZTC A;  1IBK Q;  4IO9 A;  2JA5 G;  4O0A A;  3HFZ B;  4K0K Q;  2I5L X;  2YTY A;  4GN5 A;  3HOW H;  1PV4 A;  3PUW A;  3J7Z C;  1AE3 A;  4HJ8 A;  4NXM Q;  4GKJ Q;  1QVG A;  1I50 H;  3CCJ A;  3RLF A;  3I4M G;  1Z47 A;  2R93 H;  3I55 A;  4DR4 L;  3T1H L;  3HOX G;  4JG2 A;  1TWH H;  1X9N A;  3PUY A;  4LFC Q;  3TRE A;  1LUZ A;  2AMC B;  2N3S A;  4Y7N H;  4A93 H;  3I4N H;  3M85 A;  2R92 G;  4GNX A;  4X6A H;  3PO2 H;  5JEA J;  1N9W A;  4DV1 L;  1N32 Q;  3S1N H;  2UUB Q;  3FKI H;  2RHS B;  2YV5 A;  1GM5 A;  4R4I A;  3TS0 A;  2PMZ E;  4DR3 Q;  4LF6 Q;  4JC0 A;  2XGT A;  1CUK A;  4GOP C;  5IT9 c;  5H1S E;  4NPS A;  4JI3 Q;  3M4O H;  4DR7 L;  1KL9 A;  4A3M H;  2UXB Q;  5JJK A;  4HIO A;  1Y1W G;  2BA0 A;  4JI7 Q;  1BVS A;  4LFB L;  4X65 L;  1PH9 A;  3CPW A;  1S3O A;  4IOC A;  2UUC Q;  2K50 A;  3KLW A;  1OXV A;  3MXN B;  4A3E G;  1XNR L;  2CFM A;  2QGQ A;  5C0X I;  4A3F G;  2JA5 H;  2R7D A;  1I94 Q;  3K7A H;  4HJ9 A;  1L1O C;  4JYA Q;  5HGQ A;  4BY7 G;  3PUX A;  3AQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...