4LF4Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf4Q00
1S40A 4EQ5A 1PH8A 4ALPA 4DR2L 4H02A 5JEAJ 4DV4Q 1WOCA 4DR1L 1Y1VG 1I6HH 4LWCA 4JV5L 3UDGA 4R4CA 4L5RC 2WAQG 1EIYB 3G6EA 3STBD 4YCVA 1PH5A 4UP9A 4LF6L 4DV5Q 2IX0A 2PI2E 4JI4L 2JA8H 1JJ2A 3GTPH 4UY8C 1PFSA 4IJLA 2CQOA 5DLQE 2JA6H 3I56A 4JI2L 2CKZB 3FKIG 4DR7L 1BBWA 1A8VA 1U5KA 2NVQH 3T1HL 5LMNW 1W2BA 1J5EL 3ULLA 1MKHA 1X56A 3NELA 5IP7H 1Q81C 2UXCQ 5C0XI 1X3FA 4HJ8A 4DR4Q 4DAMA 4B3SL 3PIPA 1N36L 2VUMH 3GTKH 1L2FA 5ELOA 3H0GG 1A63A 2JA9A 4BBSH 5IYBH 3CC2A 4OX9Q 3TEHB 3I4NG 4A3KG 2AMCB 1HH2P 1Q8KA 3CF5A 4QGUA 3E9IA 1NY4A 3L7ZC 4MZ9A 4JI5Q 3AFPA 3GTJH 2Q2IA 4IPDA 1JJGA 5HY6A 3PV0A 1MJEA 4UP8A 5JJIA 3HOZG 3M3YH 1SROA 3KOJA 1C7YA 4RMFA 3HFZB 3MEFA 3JAMc 1D8LA 4LFAQ 4DR2Q 2ZM6L 2JK8A 2NN6I 4DV3Q 2B63G 4JV5Q 2R93G 5FJ8H 1AH9A 1EUJA 3OYYA 4UP7A 5GAGC 4OXPA 1E1OA 1UE1A 4LUVA 1VS0A 4QL5A 4R4IA 2MO1A 1XPRA 4A3EH 3PUZA 1M90C 1PH4A 2ALYB 4KHPQ 2VQEL 1V43A 2C35B 4DV1Q 3D0FA 3T1HQ 1QZGA 5IY0A 4UPAA 4DR5L 4LF8L 3CCQA 3CQZH 4LF4Q 3PO2H 2VS1A 4YHHL 1HZBA 2E8GA 1Q82C 2GVAA 1X55A 3GO5A 2F52A 3PGZA 4P73A 1C0AA 3TQYA 3I7FA 1TXYA 4IO9A 4A3BH 2AWOA 2B3GA 4WJ4A 2DGYA 4POGA 1KRTA 1VQFA 3S1QH 4GKKQ 2K5VA 5H1SE 4P74A 3J81c 3CMAA 1PYBA 3TRZA 3F2DA 4DV6L 3S1RH 5IYCG 5C44G 2YU9H 4PG3A 1YNXA 1EWIA 1K8GA 1VQ6A 5M5YH 4POFA 1YHAA 2MQHA 1ASYA 1Q7YC 1SR3A 1CKNA 2NVXH 4X66Q 3J7A5 1I94Q 3S16H 3HOVH 4YCUA 3J80i 4B3TQ 3S1NH 3CCEA 4LFBQ 1EQQA 1SN8A 2Q2TA 2XTIA 1QUQB 4FDBA 4AYBG 2UXBQ 4PZ8A 4DV7Q 1GVPA 4DV5L 1NMFA 3AEVA 4DUZQ 3CAMA 1BKBA 2R7DA 3S24A 4GOPB 5C4JH 3H15A 1XMQL 4X6AH 4IFDI 1DGSA 1IYJB 2PNHA 2LSSA 3RN5A 1PYSB 2E5LQ 4IPGA 2B63H 1IBKL 2AHOB 1XNQQ 2ASBA 5LMNL 1MIUA 4B3SQ 3PO2G 1L0WA 2NN6G 5JEAG 1E1TA 3AYHB 3HOXG 1N33L 3KJPA 2VQFQ 1VQ8A 1FJGQ 1XNRQ 4GNXC 2F4VL 2NZOA 4JOIA 1YHQA 4HIMA 3RLNA 2D62A 2ZJRA 1Q1BA 1YHBA 2H5XA 3BZCA 1N9WA 4GOPA 3ULPA 4L5SA 2L15A 2RCNA 3M4OH 1J6QA 3CCRA 5HGQA 4B3ML 1UE7A 4GNXB 3NENA 2GVBA 1HNWL 1PHJA 2JJQA 4JI3Q 3OTOL 4C2MH 1UE6A 3CMEA 2UUBQ 5LMUL 4JI6L 3S14H 4DR1Q 1B7YB 1XTDA 2KCMA 2YTXA 1VQBA 4X65L 4DV2L 3E9HA 1OXUA 2E2IH 2N49A 4IOAA 2DUDA 3J80c 1CSQA 3I4NH 4JI0L 4KLKA 4DAYB 2PMZE 1YJ9A 3LGJA 5IYCH 1M1KC 2KENA 2A1AA 1K3RA 2ID0A 2BH2A 3CCSA 2UXCL 4JI7Q 3K0XA 1I3QH 2IHEA 2N3SA 5ELNA 1Y14B 4YHHQ 2WAQE 2OTLA 4JBKA 2LXKA 1XNQL 4BBRH 3U58A 2I5LX 4K0KQ 5GADC 4JYAQ 1NJIC 1KXLA 4AQYQ 1Z47A 1OXSC 4JG2A 1QUQA 4NXML 2ZJPA 3KLWA 4NPSA 3PO3G 2EQSA 2F4VQ 1D7QA 2KCTA 3L0OA 1WFQA 2ZTEA 5GQOA 1N34Q 3HOUH 4DR3Q 4JI5L 4AH6A 1IBML 2HHHQ 2NVYH 3NEMA 1PH2A 1NE3A 1V9PA 1KAWA 3G71A 4A3FG 3HOXH 2UUAQ 4EX5A 4Y7NH 1X65A 3BJUA 5M5XH 2OTJA 1J5EQ 1LUZA 4YY3Q 2YV5A 4JI6Q 4PMWA 4DUYQ 2I0QA 4JBWA 3F2CA 3EN2A 1VQMA 3B6YA 3K7AH 1A62A 2MFIA 4LF5Q 3H3VI 1X9NA 4XTCS 2NVTH 3CCLA 1O7IA 1PH6A 4KHPL 1I50H 3HKZG 2YTYA 4A3IG 2K5HA 3HOVG 2VL6A 1OXTA 4O2DA 3G4SA 2VUMG 1FGUA 1YZ6A 4TQUS 2QA4A 1HZ9A 1VQOA 4LF4L 4LF7Q 5AJ3Q 1IZ6A 1X54A 1G51A 3JC66 3KF6A 4QY7A 4JI1L 3EIVA 1PA6A 5IWAQ 4BBSG 1QZHA 3HOWH 1PVOA 1UEBA 4R4OA 4DNIA 3RZDH 1AE3A 2JQOA 2EXDA 2CFMA 4BA2I 2WB1G 4BXXG 4A3CH 4A76A 1CSPA 4J15A 2JE6I 1MJCA 2ZM6Q 2B29A 2OQ0A 1VQIA 2JEBI 3ER0A 2K4KA 1TWFH 4A75A 3PF5A 2RHSB 1XPOA 3ERSX 4JI4Q 1VQLA 1OXVA 4O0AA 3GTGH 3CP0A 2D0OA 3RNUA 4AIMA 4X62L 2UU9Q 2MNAA 1KC8C 1Q1EA 4IPCA 4GOPC 4OWWB 5K36G 1HR0L 4YCWA 3HKZE 5BR8Q 3PF4A 1XMOQ 1EYGA 4WJ3M 2JA8G 1E22A 4GS3A 1N32Q 3E0EA 1KRSA 4HIKA 3UDFA 3AFQA 4DV7L 1GM5A 3HOYH 4LFCL 3T1YQ 3KFUA 5JJKA 2KHIA 2OWOA 4IFDG 4B3RL 3KF6B 2PQAB 4DR7Q 1HNZQ 2VQFL 4GN3B 2WB1E 3STBC 1WYDA 3M4QA 1IBLL 3CPWA 2V1CC 1JJCB 1QVFA 1KHIA 3S17H 1JMCA 2BH8A 4BY1H 3TREA 3A74A 3M7NA 5GROA 5IP9G 3VDYA 5GAHC 2UUCL 1YEZA 4AYBE 4JI1Q 3K8AA 2AWNA 4BXXH 4LNQA 3PO3H 1HZAA 3HOWG 4YWKA 3GD7A 4A3JH 2WFWA 5FLMH 4C3IH 1QVCA 1E7ZA 1FVIA 4X66L 4A3CG 4A93G 1TWCH 4IOCA 1SFOH 4GKJQ 4A93H 2BA1A 3A0JA 4GNXA 4HJ5A 3W5OA 3IRBA 3L2PA 4C3JH 4B3MQ 3CC7A 4A3BG 1PH1A 1SE8A 5EAYA 2UU9L 4A3LG 2IY5B 3OTOQ 1JB7A 3GTMH 5C3EG 1L1OC 1VQHA 1VCIA 5IYDH 4MTNA 4YWMA 2OCEA 1X3EA 3KJOA 3KYHC 4APVA 3UDXA 1UE5A 3ULJA 2ZJQA 4BY7H 3S2HH 1WCMG 3CD6A 2VY3A 5IP7G 2VW9A 3OW2A 2CWAA 3J7ZC 4JYAL 3PCOB 3DLLA 3S1MH 4DR6L 1L1OB 1HZCA 1N33Q 1HNZL 3U4VA 1CKOA 2Q2UA 3SGIA 3M9BA 1YJWA 4OX9L 4JI8Q 1SLJA 1K83H 4R4TA 1ASZA 2PQAA 4DR3L 5M3MG 3CC4A 1BBUA 2UXDL 5AJ3L 1EFWA 1JT8A 3BZKA 1IBMQ 2HHHL 1VQEA 2QGQA 2GN5A 3RLOA 4KHZA 3UE0A 2NZHA 1S3OA 5M5WH 3GTQH 1YJNA 3U4ZA 2ATWA 2K75A 2UUBL 4HIOA 2R7ZH 1GO3E 1LYLA 3CCUA 4DV0Q 3W1BA 1XPUA 3H3VH 4DUYL 1HR0W 1SRUA 1TWAH 2Y0SE 1VQJA 1KD1C 5C4XG 1K8AC 5M3FH 4OWXB 3H0GH 1VQPA 3I4MG 1OXXK 3EBEA 2VQEQ 4DV1L 4NB3A 1NTGA 2N78A 2UUAL 2R6GA 3KDFA 4PZ7A 4A4IA 4YY3L 4DV4L 4DR5Q 4A3KH 1PH9A 4B3TL 3TS2A 2LXJA 2F3IA 5C0XJ 4LF9L 3ICEA 2RF4A 5IT9c 4BY7G 1N36Q 4DKAC 4LF6Q 4RG1A 1JE5A 3T1YL 1HNXQ 4LFCQ 1IXRA 4P71A 2ZTDA 1IBLQ 1Q12A 3F2BA 2R92H 5M3FG 3NBHB 4JI8L 3I4MH 4DK6C 4GKKL 2VNUD 4P72A 2K50A 1TWGH 1PH3A 2N8NA 3K7UC 3A5UA 1V1QA 1IL2A 1EQRA 1UWVA 5IWAL 4HJAA 4DK3C 5FLMG 3PUXA 2R7ZG 2PI2A 2A19A 1HR0Q 3WWVA 4NXNQ 1XNRL 2IX1A 3HOUG 1W3SA 4DV3L 4HJ7A 5C4XH 2R7FA 4GKJL 3S2DH 2HQLA 4IFDJ 3PUVA 1N34L 2Z6KC 5M3MH 1OTCA 4A3GG 3MXNB 4GLXA 4LF5L 3HOZH 4LUOA 4L5TA 4JBMA 3KF8B 3UDIA 1Y1WG 1YVCA 2HIXA 1BVSA 1E24A 1X3GA 5FJ8G 3I4OA 1U0LA 2IT1A 4JCVE 1C9OA 1FL0A 1N8RC 2I5MX 1N32L 2Q2HA 4X64L 1EIFA 1K73C 1VQNA 4K0KL 2MO0A 1XJVA 5IE8A 4A3MG 1VQCA 3TS0A 2RHQB 1YI2A 2ZTCA 4B3RQ 4QJFA 4JI2Q 4BBRG 2E2HH 4BA1I 3CCVA 1FJGL 1H95A 2BA0A 3GTLH 1QVGA 1VQ4A 3M4PA 3JAMi 4A3DG 3CPFA 1IBKQ 4DV6Q 3RN2A 5FLXc 1VQ9A 5C3EH 2JEAI 1KL9A 1RL2A 2CWPA 1P8LA 2Y0SG 3FP9A 1HNWQ 3CXCA 1E3PA 1T9HA 1VQGA 4HIDA 4OO1I 1X6OA 2XGTA 3K81C 4LFAL 1SMXA 4A3MH 1XMOL 1PV4A 4X65Q 4DV2Q 5C44H 1HJPA 4A3IH 2I5HA 1VQ5A 2KHJA 3S15H 1A0IA 4ME3A 3U50C 1B8AA 5IP9H 2JA5G 4P75A 4QIWE 4OO1G 4JI0Q 4A3FH 4R4QA 1Y1WH 4DUZL 4DR6Q 4KI0A 1R9TH 1XMQQ 3KDFB 3HOYG 1GD7A 2Z6KA 2ES2A 3RR5A 2JA6G 1Q46A 2HT1A 3DM3A 1B70B 2FXQA 5LMUQ 2A8VA 2E5LL 4OWTB 1I94L 1CKNB 1I5FA 1NMGA 4LF7L 2JA7H 4HJ9A 3I2ZA 5LMNQ 4LFBL 2UXDQ 1G6PA 3A5ZB 3F1ZA 4Y52H 1G291 2K5NA 4BY1G 1WJJA 2K14A 2WP8J 2YTVA 3PSIA 3G48A 2IHFA 1RIPA 3CCJA 5E7NA 1GKHA 1TWHH 1HNXL 2E2JH 3RZOH 4QQBX 4R1JA 3RLFA 4DPGA 3J81i 1KIXA 3HKSA 1CUKA 3AQQA 2AKWB 1Q86C 2CCZA 4IJHA 1YBYA 4OONA 1PH7A 1P16A 3W1GA 2EIFA 3CCMA 3J81j 1NBWA 2VZAA 2JA7G 3PUYA 4X62Q 3M85A 1S72A 4AQYL 1WCMH 3D31A 3ZJYC 2YYZA 5C0XG 4NXMQ 1Z9FA 4A3LH 2OQKA 4TVAB 2HIVA 4DV0L 2JA5H 2Z0SA 5IYDG 4LF9Q 5J3BA 5IYBG 1VQ7A 3BU2A 1VQKA 3CW2C 2R92G 5GAEC 4A3DH 5JJLA 4GN5A 4C3HH 4GLAC 4MNOA 3PIOA 4A3JG 3FKIH 1AE2A 5BR8L 4LF8Q 3I55A 4XIGS 4YWLA 3GTOH 4GLVB 4X64Q 3UE1A 1EOVA 1L1OA 2K52A 3F8TA 1LTLA 4LUZA 1YIJA 4JOIC 2KBNA 1KQSA 2UXBL 3K80C 1WI5A 1Y1VH 3FHWA 3GDEA 1K0RA 4PZ6A 4A3GH 4LW1A 4NXNL 2QEXA 4GN4B 4JBJA 1VQDA 1YITA 1VQAA 3PUWA 2R93H 4JI7L 1CKMA 4DR4L 1LM0A 4IPHA 4JC0A 1K9MC 2UUCQ 2D0PA 4A3EG 3Q8DA 4JI3L 4L5QA
chains in the Genus database with same CATH superfamily
2DJGC 1V1PB 4RGNA 4DV4Q 4JV5L 1EIYB 2A6HC 4UP9A 1TY2A 4JI4L 4RGTA 5CR3A 3SK5A 4UY8C 1PFSA 2JA6H 1M4VA 2A5HA 3GQBA 2R7ZB 2HUGA 5LMNW 3DMUA 1W2BA 4DU9A 1F77A 3NELA 2UXCQ 4LMQD 4A93B 1A6XA 5C0XI 4HJ8A 1TWFB 4B3SL 3K7AB 1NNXA 2VUMH 5M3FB 2KCNA 1L2FA 2K01A 5ELOA 4F8MA 4OX9Q 4CKEA 1UUPA 2SOBA 1EYCA 1Q8KA 2A6HD 4QGUA 4ZCKA 2WKDA 2K6AA 1JWSD 1O7YA 5HY6A 3O13A 3M3YH 1SROA 1WTVA 5IGBA 3AU7A 3MHBA 3HFZB 4DR2Q 5IOCA 4DV3Q 2R93G 3J7AF 1AH9A 3OYYA 3T56B 4EQNA 4ULLA 1T5XD 4R4IA 4QL5A 1GOZA 4DXFA 5I4DA 4MN3A 1V43A 1PTOB 3CCQA 3CQZH 4DFAA 4QUFA 4EQPA 3R3OA 2E8GA 1X55A 2F52A 4P73A 1TXYA 4IO9A 1GUOA 4A3BH 3IFTA 2DGYA 3S9WA 1VQFA 2MGSA 3LWEA 3J81c 4BY7B 3TRZA 4DV6L 3S1RH 4ID6A 1SMYD 5C44G 1AFPA 3VR6A 5HURA 1EWIA 1YHAA 5C5MA 2MQHA 1ASYA 5COYA 4KY6A 3J80i 3CCEA 1EQQA 1SN8A 4FDBA 4DV7Q 5CORA 2D2CC 3W2DA 1NMFA 4DUZQ 1BKBA 1XMQL 4N8FA 1CTMA 1LT5D 2NYZD 2O2LD 1IYJB 3RUZA 1EWCA 2E5LQ 1STNA 4X3TA 4IUUA 2IX3A 4FF2A 4RGMA 5CC4A 3K57A 3KJPA 4HR7B 2B8GA 2F0QA 1FJGQ 2F4VL 4JOIA 2CW0D 1YHQA 4HIMA 3D8GA 2D62A 3AEVA 4KTAA 4L5SA 1M8AA 4L6TB 4B3ML 3CRLC 2F1MA 2GVBA 4CDDC 1PHJA 5A2QE 2UUBQ 1FR3A 3D6CA 4C3HG 3HG9A 5BN5A 2KCMA 2YTXA 3E9HA 2L12A 3J80c 4X3UA 1XX8A 3I4NH 4DAYB 3K5LA 1WTPA 1YJ9A 5IYCH 3G7LA 2KENA 4N9PA 1AEXA 2EY2A 2XVSA 3QOJA 5I2YA 2IHEA 5BN4A 2OTLA 1XNQL 4YHHQ 3S15B 4BBRH 3U58A 2PMZB 4RHRA 3LX0A 3PO3G 2QDBA 2EQSA 4H44C 2KCTA 1HPCA 4K5XA 1TWGB 4DR3Q 5ELFA 1B3AA 2HHHQ 2JA8B 1Y1VB 3RZOB 3OIQA 2BCOA 3L9AX 1EIGA 4YY3Q 2ENBA 3NQIA 1ONLA 2L9HA 2XRQD 1DCZA 1A62A 1RODA 3HOZB 1MD2D 2NVTH 3WOEA 1I4PA 3G4SA 4LF7Q 4JI1L 4BBSG 3GTJB 4FXKC 4C3JG 4J8QA 2JQOA 4BA2I 2CFMA 2WB1G 1EWHA 4A76A 1CSPA 2HD3A 4J15A 1MJCA 4KKSA 2ZM6Q 4XQJA 1B9NA 2QDLA 2RHSB 1B1ZA 2EXZA 2PQEA 1KC8C 5FLXL 4GOPC 1A3VA 4YCWA 3HKZE 1S5ED 1B3QA 3FVQA 1XMOQ 3Q23A 5AFWA 4CHTB 3UDFA 1GM5A 3HOYH 3N52A 4XXEA 4K8JA 4DR7Q 1HNZQ 1WYDA 1CI3M 4RCOA 2FHTA 3S17H 3L3OC 2ZXRA 2JXMB 3DWQA 2BDOA 2PZUA 3VDYA 1ENAA 2F0PA 4BXXH 2YU9B 3GD7A 2NVQB 5FLMH 4X66L 4A3CG 3NTHA 1FNWA 1STGA 1X32A 1WTQA 1SFOH 1KDBA 2E75C 3I90A 4EVOA 1SAPA 4C3JH 1NR4A 3ONAB 3IFDA 1PH1A 2UU9L 4A3LG 2B39A 3R93A 3BZDB 3K0YA 1X3EA 3QO2A 4APVA 1H9RA 2ZJQA 4G7OC 5EJWA 1EY8A 3I8ZA 5CBAE 3DLLA 1L1OB 1PLFA 1QE6A 2PCFB 2A6ED 2NVXB 1I4XA 3M9BA 4G4KA 5D14A 1PMRA 2KECA 1KDAA 1ASZA 5FO7B 5AJ3L 1JT8A 1IBMQ 3UE0A 2EY1A 1AP0A 3D4WA 4KY5A 4DNTB 5KNBA 2K75A 3NE5B 2A68D 2F0HA 1G2SA 3W1BA 1XPUA 1HR0W 5NUCA 4RKBA 1KD1C 2B2UC 1IW7D 4HSVA 2NVTB 3S1QB 2H4OA 1O80A 4DR5Q 4IFDI 3TS2A 3KBXA 4YY3L 2LXJA 2F3IA 1YNJD 1GHKA 2RF4A 4BY7G 1RKNA 4DKAC 4LF6Q 1VF7A 4RG1A 2TMPA 1HNXQ 3T1YL 4FYDA 4IUQA 4Q5VA 1IBLQ 3S14B 1Q12A 3F2BA 4DK0A 4DK6C 1U4RA 2K50A 2SEBD 1F2ZA 3E5SA 1HRJA 3A5UA 1V1QA 3DXJC 1IL2A 5IWAL 2NUCA 3PUXA 3FEWX 5I6WA 1DD2A 3HOXB 2IX1A 1W3SA 2R7FA 1JE4A 3PO2B 2HQLA 4GKJL 1N34L 1ICFB 4GLXA 4L5TA 2KA7A 1K28A 1U0LA 2IT1A 3K59A 1N8RC 3CKIB 5EKLA 4DN4M 4OELB 5JPMC 1ICWA 2Q2HA 1U9RA 4WFN3 4A3MG 1NAPA 4F87A 4XQNA 1YI2A 2E2HH 3CCVA 1FJGL 2BA0A 1VQ4A 3M4PA 4RWSC 3CPFA 4IQZA 4CGYB 4DA2A 5C3EH 4G7ZC 1RL2A 2CWPA 1P8LA 3CXCA 5EQ0A 1LTGD 1E3PA 1T9HA 3MC0B 2RDFA 4OO1I 4MIUA 4LFAL 4A3IH 2F3WA 3S15H 4IUNA 2MHVA 4K8IA 1MGSA 4DUZL 2IL8A 3RZDB 1XMQQ 3RR5A 4C56C 2HT1A 1PFNA 2E5LL 1MSHA 1CKNB 3EROA 3H6MA 4HJ9A 3KF8A 1G6PA 3F1ZA 1EQTA 2K5NA 3ERQA 3PSIA 2K14A 3CCJA 1A3UA 3RZOH 4R1JA 3RLFA 3TP6A 5EPKA 2CCZA 4IJHA 4WORA 4CKCA 1PH7A 3W1GA 2KUMA 3CCMA 2ICIA 2KQ3A 5ELDA 4AQYL 1QOHA 1BDOA 3ZJYC 5C0XG 1IL8A 1SNMA 4R8NA 5CYUA 3NBIA 5IYDG 4LF9Q 2AUJD 3E6ZX 4DNRB 2R92G 5GAEC 1G91A 4GN5A 1EY7A 4A3JG 4LF8Q 3M7GA 1DOKA 1SNQA 3UE1A 4X64Q 2K52A 1YIJA 5KYLA 2B2VC 3H09A 2TSSA 4DAPA 3GV6A 2Q8IB 4RKLA 1SYCA 1W6JA 1CA6A 5IODA 1B44D 1LM0A 2UUCQ 2EYPA 5C4HA 1SEBD 1S40A 1PH8A 3S17B 1K3BC 1WOCA 4DR1L 4R4CA 2JA8H 2IX0A 2PI2E 1I4GA 4IJLA 3BYYB 5DLQE 3I91A 1AZQA 4DR7L 3FKIG 1BBWA 1A8VA 1STYA 1U5KA 1NCVA 3FPUB 2NVQH 3TZDA 1D5ZC 3ND8A 1J5EL 1X56A 1SFOB 1X3FA 4PMCA 4DAMA 3GTKH 2JA9A 1STAA 5IYBH 3CC2A 1GUTA 2AMCB 1ET9A 4A3IB 4XYOA 1HH2P 1SYFA 1I6VC 5C6AA 4JI5Q 2EPBA 3GTJH 3ITPA 4HMIA 3VR3A 3G6JB 3KOJA 4RMFA 1I4HA 1D8LA 2ZM6L 1PRTD 4FNFA 1UNSA 1TS4A 5FJ8H 3A7LA 5GAGC 5D3IB 1LTSD 1VS0A 2A68C 4NMZA 1XPRA 2MJ8A 4P2CB 1QJOA 2D5DA 4KKTA 3C1EA 2L11A 2ALYB 1PH4A 4DV1Q 4KHPQ 3T1HQ 5KEEA 3D0FA 1BXTA 5IY0A 1TWCB 1CQVA 1O78A 1HTLD 2GVAA 3KLSX 3HOYB 3TQYA 3QR8A 1H9SA 4N8X1 2AWOA 2B3GA 4FXGC 4WJ4A 5IGCA 4POGA 1KRTA 2GA4B 3S1QH 1PRTC 1LTAD 4GKKQ 2K5VA 1PDQA 1YNNC 2WKCA 2YU9H 1K8GA 3MFGA 1Q7YC 1QILA 1SR3A 3S16H 4YCUA 4B3TQ 3S1NH 4HTHA 1TS2A 2Q2TA 2B2TA 2RVLA 3A7AB 4PZ8A 1PZKD 1S5DD 2EY5A 5C4JH 4NP5A 2LSSA 4QCLA 3QWNA 1EEFD 1PYSB 2A69D 1IBKL 3PO2G 3D4RA 2Z8LA 1E1TA 3HOXG 2Z6BA 5DM63 3EQLC 2B2VA 4LAAA 2ZJRA 1YHBA 2RCNA 4CBVA 5HGQA 3T4AC 3NENA 1EU3A 3OTOL 2F0UA 4FF4A 1G6ZA 5C3WA 5LMUL 5FO9B 4DR1Q 1B7YB 4X65L 1VQBA 2G9DA 4RFBA 4CKBA 4B9XA 4JI0L 2FINB 2E74C 2O4XA 3LGJA 3OIPA 5JJZA 2BH2A 3CCSA 2UXCL 4DR4Q 5C4XB 5ELNA 2LXKA 2I5LX 5J39A 4JYAQ 1NJIC 1KXLA 1OXSC 4JG2A 1QUQA 3TBIB 4O1NA 1BCPF 3FKIB 2RA4A 2RQXA 2ZTEA 1N34Q 4JI5L 4JVZA 4AH6A 3PIO3 1IBML 2A73B 1PH2A 1NE3A 4PV1C 1V9PA 1D1KA 4A3FG 3HOXH 2F03A 2UUAQ 1LT4D 1JCKB 4Y7NH 1X65A 3BJUA 3GTLB 4EGVA 3MVVA 2I0QA 2CHBD 3EN2A 5I2XA 5LHY1 3H3VI 2QW7A 4XTCS 3BVZA 3DWAA 3CCLA 2PYKA 5D65A 3HOVG 3H91A 2VUMG 1FGUA 1HZ9A 1VQOA 1WTOA 1BBXC 1G51A 3KF6A 1PVOA 1UEBA 4R4OA 1AE3A 2DNEA 2EXDA 3OWFA 3NWSA 3WDNA 4BXXG 4B9WA 3S16B 2JEBI 2K4KA 1TWFH 1I4RA 4OEMB 1XPOA 2QILA 4JI4Q 2VUMB 1VQLA 3CP0A 2D0OA 4A3EB 1WTWA 2HCIA 1RTNA 5KNCA 1HR0L 3PF4A 1X3QA 2JA8G 1N32Q 3E0EA 4HIKA 3URYA 1B9MA 3AFQA 3NTIA 5J1ZA 4DV7L 3KFUA 5EPLA 2F3VA 4IFDG 1S5CD 1QNUA 1ZEQX 4B3RL 2WB1E 3M4QA 4HEDA 4N9TA 2V1CC 3TSSA 2JA5B 2RBMA 3A74A 3TREA 2B2YA 4NW2A 2K5WA 3K8AA 4XQQA 4A3JH 1JICA 1F9RA 1FVIA 4G7HC 5DM73 3CU7A 3HOVB 3DWPA 3DM1A 2BA1A 3A0JA 1TY0A 4Z9CB 2Z9HA 4B3MQ 3CC7A 4A3BG 1SE8A 5EAYA 3Q6SA 1VCIA 1CHQD 5IYDH 3AMUA 1JOOA 1K8MA 3NTKA 4A3MB 2B2WC 2OCEA 3KJOA 1GHJA 4BY7H 3S1RB 3FMCA 3CD6A 3TP7A 5IP7G 2CW0C 3OW2A 1EIHA 2CWAA 3J7ZC 4FF3A 4JYAL 3P1HA 1N33Q 3U4VA 4OX9L 3SGIA 1Y8PB 3A55A 2K04A 1SLJA 4UHVA 1ILQA 4RA8A 2D9UA 2Z4IA 2R3ZA 3U4ZA 4HIOA 4LJZC 4Y7NB 1QB5D 3E0JA 2PZWA 3H3VH 4XDXA 1SRUA 4CDEC 1U4LA 5C4XG 1VQJA 2F0GA 3FPPA 1VMPA 1E2VA 3MXGA 4OWXB 1VQPA 3BDCA 5KRUA 1ZKOA 3K5NA 4NB3A 1HCZA 1NTGA 4KN7C 2UUAL 4PZ7A 4DV4L 3TDQA 4DAVA 4XT3B 1I3QB 4LF9L 3ICEA 4H0LC 1ML0D 2L5TA 5E4WC 4L8JA 4LFCQ 2NWGA 5M5YB 1D6EC 1DXMA 1SXTA 5IIFA 2K7VA 1LTRD 2R92H 5M3FG 3I4MH 4JI8L 4GKKL 2VNUD 4HMJA 2NVYB 1JR0D 4DK3C 2R7ZG 1KTKA 2PI2A 1HR0Q 2F0TA 4U68A 1XNRL 1Q8IA 1VMCA 1WTXA 1MSGA 4HJ7A 3MWYW 2MUYA 2X69A 1QCBD 3FRPB 3NXWA 4LF5L 4JBMA 1Y1WG 2HIXA 3M4YA 1CHPD 1I50B 5FJ8G 2XN9C 2BE5C 3BVGA 2Z1CA 1LT3D 1N32L 1V8QA 2F0SA 1VQNA 3E3XA 5CV8A 2RHQB 2ZTCA 4JI2Q 2NZ1D 1H95A 3NBHA 3MZ5A 5FLXE 3C1FA 3JAMi 3J7YW 1VQ9A 5FLXc 1KL9A 1DOLA 1SE4A 1I4QA 2SDFA 2AUKA 1PXUA 1VQGA 1X6OA 2CH4W 3VA7A 1MHWC 4OIKA 4A3MH 3ZYYX 3U50C 2JA5G 4A3FH 4R4QA 3OHXC 4DR6Q 4CJ2C 1J9OA 3HOYG 2Z6KA 3MFYA 1PTOD 5TSSA 2ES2A 2JA6G 1Q46A 2WAQB 2A8VA 3S1NB 4OWTB 3A8KE 4LF7L 5LMNQ 1E2WA 2UXDQ 3A5ZB 4Y52H 3KBGA 4BY1G 5EBDA 4F7XA 2WP8J 2YTVA 3Q22A 2IHFA 3G48A 1K8OA 1TWHH 5C4JB 2DJFC 4C2MB 3J81i 1KIXA 2AQ2B 3VYSA 4RGOS 1SYBA 1YBYA 4K2KA 5LL6S 1P16A 3AB9A 1NBWA 2VZAA 5C5LA 4J1MA 2JA7G 4X62Q 5EKIA 3D31A 2YYZA 4A3LH 2OQKA 3QJYA 4TVAB 1KABA 4XT1B 5F2DA 1PYWD 1QG7A 4HAEA 4MHEA 1CA5A 2EYOA 3CW2C 2HDMA 4A3DH 4KD3A 4MNOA 2FJ2A 2PW7A 3PIOA 2DY8A 2B2UA 2R92B 4YWLA 4K6DA 1SYEA 4GLVB 2UXBL 4LUZA 3C2PA 3PMFA 2KHSA 1WI5A 2B2WA 1EY6A 1FNVA 1W6KA 4PZ6A 1LTID 1II3A 2HDLA 2R93H 2JSOA 2PW5A 1RJTA 3TMEA 1K9MC 2HCCA 1RD9D 2D0PA 4JI3L 3FDTA 4KJNA 4L5QA 4UAIA 4ALPA 4DR2L 4H02A 1CQFA 1Y1VG 1DM0B 5J22A 3UDGA 1D5XC 2F0WA 4BY1B 4L5RC 3SDZA 1A2UA 3G6EA 1SJHD 2XWBB 4YCVA 3STBD 4DV5Q 2WB1B 2F0IA 5JOBA 1EY5A 3J81E 3EFXD 2F0LA 4JI2L 3PO3B 2EY6A 4A3JB 3BYTB 1H9JA 1VDZA 2EYHA 1MKHA 1EU4A 5IP7H 3H3VC 3OSOA 3PIPA 1N36L 3GP7A 1ESFA 2RSNA 1L0YB 1V1PA 5FO8B 4CJ1B 3CF5A 1H9SB 3E9IA 4MZ9A 3S2DB 2KJXA 4IPDA 1JJGA 1RDPD 3PV0A 2ZT9C 3S1MB 4K2LA 4BWGB 5JJIA 1C7YA 5CV4A 5L37A 1EFID 4LFAQ 5A2QL 2NN6I 4JV5Q 2KVMA 1EUJA 3D3RA 4UP7A 4OXPA 2NBFA 4LUVA 4A3EH 1HA6A 2VQEL 4IFDH 4UPAA 4LF8L 3PO2H 4YHHL 1Q82C 4CDFC 3I7FA 4X3SA 3J80E 1Y69U 1FNUA 3T51B 2LS01 3DEPA 4C1NI 3OWEB 4KN4C 1SE2A 5C3XA 5I9OA 5IYCG 2K1BA 1F2YA 2KEDA 2L0CA 1S5FD 4PG3A 5M5YH 2E2HB 5E1FA 5IGFA 1EQVA 3J7A5 4X66Q 1O7ZA 2EJGC 3I4MB 1I94Q 3HOVH 4PQXA 2ZXOA 3NQTA 2UXBQ 1DOMA 2XNAC 3V2TA 4GZYC 2K5QA 1STHA 2F0EA 3EJIA 4E6IA 3C3LA 2R7DA 4GOPB 3H15A 4X6AH 1H9KA 3P7JA 4IALA 1FD7D 2PNHA 3K5OA 1ZYRC 1XNQQ 2ASBA 2K5DA 5LMNL 1E2ZA 2IJ0A 4B3SQ 3HP3A 4ZK9B 1L0WA 2F0KA 5DAUA 5JEAG 1N33L 3BDLA 4ZLTF 1XNRQ 2NZOA 3T53B 4DGZA 4GOPA 3ULPA 2H5XA 3BZCA 3T16A 2L15A 2SNMA 1UE7A 4O42A 4GNXB 1CZGA 3D4DA 4JI3Q 4Q0FA 4OO1H 1UE6A 5JVG3 4IUTA 1XTDA 3TP8A 4DV2L 2E2IH 4IOAA 3QIAA 1OXUA 2N49A 3OPOA 2DUDA 4ABNA 2A74C 1CSQA 3MXPA 1WTRA 4KLKA 2PMZE 2E2DC 2E76C 4HN7A 5HGTA 2A1AA 1K3RA 2ID0A 5JPNC 4JI7Q 3K0XA 1I3QH 4JBKA 2F0OA 1DONA 4RCNA 4L63B 4K0KQ 1ZXTA 5GADC 2R61A 4AQYQ 1Z47A 2NN6H 1SYDA 4NXML 2ZJPA 3KLWA 2F4VQ 1D7QA 5KGUA 4QIWB 5EPJA 3W3AA 2JA7B 4DF7A 3HOUH 1Y8OB 1HA5A 2OXPA 3BVMA 1LABA 2NVYH 1GUWA 5CGKA 3GTQB 4V0BA 1DZ1A 4EX5A 5CMDA 3VYRA 2OTJA 4JI6Q 4ZUIA 4PMWA 1F9SA 4DUYQ 4JBWA 1D1IA 1B53A 5ELEA 3P75A 2KEEA 4LF5Q 2AQ3B 3SXHA 1O7IA 4KHPL 1I50H 3HKZG 2YTYA 4R9WA 1KNEA 1TR5A 2K5HA 4O2DA 1OXTA 1YZ6A 2QA4A 5AJ3Q 1IZ6A 1PA6A 1ILPA 2XRSD 2K28A 1ENFA 3SR1A 3BDOA 1QZHA 3HOWH 3HS0C 2BE5D 4DNIA 4K5WA 1R9TB 2JE6I 2B29A 2WINB 4A75A 5EKKA 3GTKB 1Z6HA 1OXVA 3GTGH 4KY7A 1STBA 3RNUA 4AIMA 2UU9Q 2MNAA 2A6EC 5CV5A 2X6GA 4WJ3M 1EYGA 2PZTA 1E22A 4GS3A 1KRSA 5CV7A 3KUPA 4A3FB 3RD4A 1HUMA 4YIJA 3T1YQ 5JJKA 2F4IA 2KHIA 1BF4A 2PQAB 3NWTA 5EGTA 1PZJD 1TS3A 4QMGA 4ZRZA 1IBLL 1PZID 3CPWA 2N88A 4HCEA 1KHIA 2N55A 3OW7A 3Q24A 4BY1H 2SNSA 2DNCA 2UUCL 5IP9G 3M7NA 3KK7A 1PTOC 3A8JE 1EY9A 2AWNA 4LNQA 1TWHB 1JWUD 3PO3H 2P5ZX 1QVCA 1E7ZA 2IPKD 5FKAC 1TWCH 4TKOB 1R4PB 4IOCA 1VF5C 4HJ5A 3IRBA 3L2PA 1WD0A 3F2UA 3OTOQ 1JB7A 4BBSB 1XYIA 1SNPA 4M1UB 3SHLA 4MTNA 2EOTA 1BR9A 3KYHC 4IUVA 1D5MC 1UE5A 3ULJA 3S2HH 5C0XH 2VY3A 4U673 4A3DB 1SJED 3PCOB 4J6HA 4H7BA 4F88A 3S1MH 4DR6L 1EZ6A 2DY7A 1HZCA 1Q3LA 1YJWA 4JI8Q 4I65A 5D3DA 3I70A 5M3MG 2UXDL 1EFWA 3BZKA 1VQEA 1DYQA 3RLOA 4KHZA 2NZHA 5CBEE 5M5WH 1EEID 1B50A 3GTQH 2UUBL 2L4NA 2R7ZH 1GO3E 4DV0Q 5K5PA 4DUYL 1PRTB 2XSCA 3LWUA 1RHPA 1K8AC 5M3FH 3I4MG 5CV6A 2MP1A 1OXXK 4NDXA 2J0TD 4DV1L 1UEAB 2LKVA 1EY4A 2N78A 4ZYSA 3QOLA 4A4IA 1PH9A 1HTPA 1N36Q 2C5CA 4KMUC 4K6LA 4ODGA 1SMYC 2ZTDA 1YNND 3NBHB 4K5VA 4P72A 1PH3A 3K7UC 1UWVA 3TP5A 1JOQA 1ZYRD 1IW7C 2C9OA 2RKSA 3P20A 5FLMG 3NPPA 3LNNA 2EJFC 5C4XH 3S2DH 4IFDJ 5M3MH 1OTCA 3K6OA 4A3GG 3EVQA 3MXNB 4WRDA 4FF1A 4LUOA 2EYMA 3UDIA 1YVCA 5IGEA 2PNRC 1X3GA 4V190 4FO2A 1CT1D 5IT9E 1C9OA 4LK1C 2I5MX 2J7ZA 3HEJA 2JN4A 1EIFA 2AQ1B 2MO0A 1XJVA 3TS0A 1Z7TA 1QWYA 4QJFA 4BBRG 4B3RQ 3GTLH 2WIIB 4IZ8A 3RN2A 3NHHA 2Y0SG 3SK8A 2WV6D 1F9QA 5KIXA 2XGTA 3K81C 3PQIA 1R4QB 4X65Q 5C44H 1LT6D 1VQ5A 4FVMA 4ME3A 5IP9H 1B8AA 4P75A 2FFKB 4JI0Q 1Y1WH 1OO9B 1SYGA 3Q0AA 1KNAA 3A8IE 1B70B 5LMUQ 4KJOA 2JA7H 1I94L 3GV3A 1NMGA 4R8IA 3HGBA 1G291 2I46A 1WJJA 1RIPA 1HNXL 1GKHA 2E2JH 4QQBX 3R2TA 2XWJB 4DPGA 1CUKA 2JYOA 3AQQA 2AKWB 1Q86C 3NUCA 2EIFA 3J81j 3I4NB 3PUYA 4WJWA 4OL7A 1S72A 4I7ZC 1B4OA 3GTMB 1Z9FA 4DV0L 2JA5H 5J3BA 1WVLA 5IYBG 1VQ7A 1VQKA 3HOWB 4C3HH 1Q90A 3KLSA 1H9MA 3OOCA 5BR8L 4IURA 2E2IB 1EYAA 4ZAIA 2G9HD 1K83B 3GTOH 1PRTF 1EOVA 5I6YA 1LTLA 4JOIC 3K80C 1Y1VH 3GDEA 1QNKA 3X3MA 1EOTA 1K0RA 2NTSA 2ICEC 4GN4B 1VQDA 1YITA 2B63B 2JP1A 4DR4L 4IPHA 4JC0A 5DEHA 2QKIC 4OHJA 5FK9C 3SK6A 1GUGA 1BCPD 2B2TC 3VYTA 4EQ5A 1JORA 3MA2B 1GUNA 5JEAJ 1I6HH 4LWCA 4A3KB 4ZUJA 2WAQG 1PH5A 3JAME 4LF6L 3GTPH 1JJ2A 2PPBC 1JB3A 2CQOA 3I56A 2CKZB 1G8ZD 5IGDA 2F0MA 3T1HL 1IKMA 2MPMA 3ULLA 1U4PA 1GJXA 1Q81C 1TT2A 1PFMA 2EJMA 1KLUD 3H0GG 1A63A 2L55A 4BBSH 3IAYA 3TEHB 3I4NG 2F0NA 4A3KG 2J4XA 5I9PA 1SNOA 5C44B 2G5DA 1NY4A 3L7ZC 3AFPA 2Q2IA 3R8BA 3U9OA 4QUCA 1MJEA 4UP8A 3HOZG 4G57A 3HZXA 3MEFA 3JAMc 2JK8A 2B63G 3DUZA 4M8AA 1TKWB 3SK4A 3J81L 1E1OA 1UE1A 1HFGA 2XIWA 1SBBB 2MO1A 1XWEA 1TQOA 3PUZA 1M90C 2EVBA 2C35B 4IUPA 1QZGA 2OEOA 4DR5L 4LF4Q 2VS1A 1HZBA 1C0AA 2F0VA 3GO5A 3PGZA 1TWAB 1KLGD 4C3JB 1ENCA 3I3CA 1JC7A 1T5EA 2CQAA 2NTTA 1EY0A 2Y0SB 4TRDA 5H1SE 4P74A 3CMAA 1PYBA 3VA5A 3F2DA 1HQMC 1YNXA 1VQ6A 1U4MA 4POFA 4DK1A 4KHVA 3SEBA 4ZKBB 1CKNA 3QG1A 2NVXH 4JW0A 1GXDC 1TU2B 4LFBQ 2XTIA 1QUQB 5E4XA 4AYBG 1JQYD 1GVPA 1UAPA 4DV5L 3CAMA 3S24A 2NB0A 4KD4A 1DGSA 3NSWA 3RN5A 4IPGA 2B63H 5IT9L 2RDGA 2AHOB 5ELBA 5M3MB 1MIUA 2IW3A 2KOLA 2NN6G 1HQRD 5EBCA 3J80L 1S5BD 1PFBA 3AYHB 4DXGA 3VR5A 1VQ8A 4UDUC 2VQFQ 4RHSA 4GNXC 3BG3A 2EYJA 2V4DA 2RCFA 3RLNA 1Q1BA 2L1BA 3MXNA 3M4OH 1N9WA 3IKJA 1J6QA 3CCRA 3GTPB 2RSOA 5M5WB 1HNWL 2JJQA 1RTOA 4C2MH 2DN8A 4C3IB 3CMEA 5ELCA 3SVMA 4JI6L 3S14H 1BO0A 2A69C 1ESRA 2M9VA 4ME5A 4ZKCB 1TIID 1IYUA 2M2LA 1M1KC 2B2YC 4ILWA 1F2LA 2WACA 1STEA 2N3SA 4HSPA 1X3PA 5G3LF 1Y14B 2WAQE 1HHVA 1Y1WB 5C4ZA 1NUCA 4NPSA 1LTTD 2EYLA 2FMCA 1D2BA 4HCSA 3L0OA 1WFQA 5GQOA 2LY7A 2H1EA 3C46A 3OMCA 3NEMA 1KAWA 3G71A 5M5XH 5A35A 1J5EQ 1LUZA 1TS5A 2YV5A 2R93B 1IHZA 3F2CA 1VQMA 5C3EB 3B6YA 3K7AH 5DNFA 2BOSA 2MFIA 3V96A 3K5MA 3H0GB 1X9NA 3RMHA 2QEJC 1PH6A 1IYVA 1WCMB 1J8IA 4A3IG 2VL6A 1EL0A 4TQUS 3SE0A 4LF4L 1X54A 3JC66 3MTSA 4QY7A 2O5JC 3EIVA 3UI2A 5IWAQ 3DHQA 2EZVA 5IGGA 3RZDH 4A3CH 1BQQT 2RDHA 3A54A 3VR4A 1F2MA 2VB3X 1SSOA 4QF4A 2OQ0A 4JPBW 1VQIA 5JAVA 3ER0A 3GTOB 3PF5A 3ERSX 1KDCA 4O0AA 5JEAH 4X62L 1Q1EA 4IPCA 4OWWB 5K36G 3I4LA 5BR8Q 2Q8TA 3HRZC 2K32A 1SDFA 3OMGA 2OF1A 2BDNA 1RCVD 1LLRD 4ZQ3A 4LFCL 3TN2A 2OWOA 3KF6B 4QB4A 2VQFL 4GN3B 3X3NA 3STBC 1FGBD 5KYIA 3NP8A 1JJCB 3KLRA 1QVFA 4TSSA 1JMCA 2BH8A 4KK7A 5KNDA 1XXGA 5GROA 1BUVT 5GAHC 3M4OB 4OGQC 1HXYD 1YEZA 4JI1Q 4AYBE 2X6LA 3MEHA 2E2JB 4FXDA 3QB3A 1HZAA 2JA6B 3HOWG 1SNCA 1NR2A 4YWKA 2WFWA 1CFMA 3N6RA 4C3IH 1ET6A 4A93G 4GKJQ 4A93H 4AYBB 3H94A 5E3FA 4GNXA 3W5OA 5LL6X 2IY5B 3GTMH 2F0DA 2LMCB 1IKLA 1L1OC 1VQHA 5C3EG 4YWMA 5T1IA 3UDXA 1BNZA 4IN3A 1WCMG 2VW9A 1V1OA 1A3TA 1CK1A 1C4QA 1F9PA 4C3HB 3VYUA 1BCPB 1TVXA 3V05A 1HNZL 1CKOA 2Q2UA 5ISRA 1DJRD 4B08A 1K83H 4R4TA 2FMMA 2PQAA 4DR3L 1LACA 3CC4A 1BBUA 5K36H 2HHHL 3I72A 2QGQA 2GN5A 1S3OA 4MTKA 1L0XB 1YJNA 4OIJA 2ATWA 2OT2A 3CRKC 1LYLA 5M5XB 3CCUA 1TWAH 2Y0SE 2VXWA 2EE1A 3H0GH 3EBEA 2VQEQ 5T1GA 1I6HB 1EYDA 2R6GA 3KDFA 4S3SA 4A3KH 3I73A 4B3TL 5C0XJ 5IT9c 4C3IG 3NK9A 4BBRB 1JE5A 2K33A 1IXRA 1GUSA 1LTBD 2K05A 3ND9A 4P71A 4RH6A 2HQEA 1PTOF 1WD1A 1EZ8A 1CZWA 1TWGH 2N8NA 1B2TA 5M9OA 1EQRA 4JK1C 3WOFA 4HJAA 4K14A 1LO5D 2VB2X 3TZUA 4A3GB 2A19A 2PO4A 1AZPA 3WWVA 4NXNQ 3HOUG 4DV3L 1G2TA 1SE3A 1YNJC 1AN8A 3PUVA 2Z6KC 4DAYA 3HOZH 3DEOA 3IL8A 3KF8B 3PIP3 1BVSA 1E24A 2LFNA 3I4OA 4JCVE 1FL0A 5FOBB 3HOUB 4X64L 2M00A 1K73C 4RAUC 4K0KL 5IE8A 1VQCA 2EDGA 4BA1I 4BS9A 1QVGA 1C48A 4X3KA 2Q8RE 4A3DG 2O5IC 1HUNA 1IBKQ 2ZXPA 4DV6Q 1A15A 2JEAI 3FP9A 1HNWQ 1O7LA 2F0FA 4HIDA 1WTHA 1SMXA 1XMOL 1PV4A 4DV2Q 1HJPA 2B8FA 2I5HA 4FP5D 2KHJA 1A0IA 3J7AV 4QIWE 4H13C 4OO1G 3U9SA 5BN3A 3MXUA 4NKLA 4KI0A 1R9TH 3EA6A 2I07B 3KDFB 2QCPX 1GD7A 4CDCC 3M3YB 1Y8NB 3DM3A 2FXQA 1LV9A 5G3LD 4XYQA 3MAQA 1I5FA 4KV6A 3I2ZA 4LFBL 1RF2D 1E0BA 1JOKA 3GTGB 4PNYA 1BCPC 1MI2A 5E7NA 3K58A 5JVH3 3T13A 3HKSA 1PTOH 1K0SA 4KKUA 1MBYA 1CM9A 1S4ZA 3CQZB 3BS1A 4OONA 4EQOA 4PMBA 4CJ0B 3VR2A 1BOSA 4A3BB 3M85A 1NSNS 1SNDA 1WCMH 4NXMQ 3R2IA 1XTCD 2HIVA 1AW7A 2Z0SA 1C8CA 3BU2A 5JJLA 3JAML 2QF7A 4GLAC 2CVRA 5CV9A 3FKIH 1HFNA 1FYCA 1AE2A 2F0JA 2IWHA 3I55A 4XIGS 3HKZB 1L1OA 3F8TA 1KQSA 2KBNA 3FHWA 2CH4A 3A56A 1JWMD 4LW1A 4NXNL 3D6WA 4A3GH 1A2TA 2QEXA 2Z4HA 4JBJA 1VQAA 1KAAA 2K03A 2KCCA 3PUWA 4JI7L 1CKMA 3S2HB 4I7AA 4C1NK 4A3EG 3Q8DA 2EYFA 3CHBD
chains in the Genus database with same CATH topology
1S40A 4EQ5A 1PH8A 4ALPA 4DR2L 4H02A 5JEAJ 4DV4Q 1WOCA 4DR1L 1Y1VG 1I6HH 4LWCA 4JV5L 3UDGA 4R4CA 4L5RC 2WAQG 1EIYB 3G6EA 3STBD 4YCVA 1PH5A 4UP9A 4LF6L 4DV5Q 2IX0A 2PI2E 4JI4L 2JA8H 1JJ2A 3GTPH 4UY8C 1PFSA 4IJLA 2CQOA 5DLQE 2JA6H 3I56A 4JI2L 2CKZB 3FKIG 4DR7L 1BBWA 1A8VA 1U5KA 2NVQH 3T1HL 5LMNW 1W2BA 1J5EL 3ULLA 1MKHA 1X56A 3NELA 5IP7H 1Q81C 2UXCQ 5C0XI 1X3FA 4HJ8A 4DR4Q 4DAMA 4B3SL 3PIPA 1N36L 2VUMH 3GTKH 1L2FA 5ELOA 3H0GG 1A63A 2JA9A 4BBSH 5IYBH 3CC2A 4OX9Q 3TEHB 3I4NG 4A3KG 2AMCB 1HH2P 1Q8KA 3CF5A 4QGUA 3E9IA 1NY4A 3L7ZC 4MZ9A 4JI5Q 3AFPA 3GTJH 2Q2IA 4IPDA 1JJGA 5HY6A 3PV0A 1MJEA 4UP8A 5JJIA 3HOZG 3M3YH 1SROA 3KOJA 1C7YA 4RMFA 3HFZB 3MEFA 3JAMc 1D8LA 4LFAQ 4DR2Q 2ZM6L 2JK8A 2NN6I 4DV3Q 2B63G 4JV5Q 2R93G 5FJ8H 1AH9A 1EUJA 3OYYA 4UP7A 5GAGC 4OXPA 1E1OA 1UE1A 4LUVA 1VS0A 4QL5A 4R4IA 2MO1A 1XPRA 4A3EH 3PUZA 1M90C 1PH4A 2ALYB 4KHPQ 2VQEL 1V43A 2C35B 4DV1Q 3D0FA 3T1HQ 1QZGA 5IY0A 4UPAA 4DR5L 4LF8L 3CCQA 3CQZH 4LF4Q 3PO2H 2VS1A 4YHHL 1HZBA 2E8GA 1Q82C 2GVAA 1X55A 3GO5A 2F52A 3PGZA 4P73A 1C0AA 3TQYA 3I7FA 1TXYA 4IO9A 4A3BH 2AWOA 2B3GA 4WJ4A 2DGYA 4POGA 1KRTA 1VQFA 3S1QH 4GKKQ 2K5VA 5H1SE 4P74A 3J81c 3CMAA 1PYBA 3TRZA 3F2DA 4DV6L 3S1RH 5IYCG 5C44G 2YU9H 4PG3A 1YNXA 1EWIA 1K8GA 1VQ6A 5M5YH 4POFA 1YHAA 2MQHA 1ASYA 1Q7YC 1SR3A 1CKNA 2NVXH 4X66Q 3J7A5 1I94Q 3S16H 3HOVH 4YCUA 3J80i 4B3TQ 3S1NH 3CCEA 4LFBQ 1EQQA 1SN8A 2Q2TA 2XTIA 1QUQB 4FDBA 4AYBG 2UXBQ 4PZ8A 4DV7Q 1GVPA 4DV5L 1NMFA 3AEVA 4DUZQ 3CAMA 1BKBA 2R7DA 3S24A 4GOPB 5C4JH 3H15A 1XMQL 4X6AH 4IFDI 1DGSA 1IYJB 2PNHA 2LSSA 3RN5A 1PYSB 2E5LQ 4IPGA 2B63H 1IBKL 2AHOB 1XNQQ 2ASBA 5LMNL 1MIUA 4B3SQ 3PO2G 1L0WA 2NN6G 5JEAG 1E1TA 3AYHB 3HOXG 1N33L 3KJPA 2VQFQ 1VQ8A 1FJGQ 1XNRQ 4GNXC 2F4VL 2NZOA 4JOIA 1YHQA 4HIMA 3RLNA 2D62A 2ZJRA 1Q1BA 1YHBA 2H5XA 3BZCA 1N9WA 4GOPA 3ULPA 4L5SA 2L15A 2RCNA 3M4OH 1J6QA 3CCRA 5HGQA 4B3ML 1UE7A 4GNXB 3NENA 2GVBA 1HNWL 1PHJA 2JJQA 4JI3Q 3OTOL 4C2MH 1UE6A 3CMEA 2UUBQ 5LMUL 4JI6L 3S14H 4DR1Q 1B7YB 1XTDA 2KCMA 2YTXA 1VQBA 4X65L 4DV2L 3E9HA 1OXUA 2E2IH 2N49A 4IOAA 2DUDA 3J80c 1CSQA 3I4NH 4JI0L 4KLKA 4DAYB 2PMZE 1YJ9A 3LGJA 5IYCH 1M1KC 2KENA 2A1AA 1K3RA 2ID0A 2BH2A 3CCSA 2UXCL 4JI7Q 3K0XA 1I3QH 2IHEA 2N3SA 5ELNA 1Y14B 4YHHQ 2WAQE 2OTLA 4JBKA 2LXKA 1XNQL 4BBRH 3U58A 2I5LX 4K0KQ 5GADC 4JYAQ 1NJIC 1KXLA 4AQYQ 1Z47A 1OXSC 4JG2A 1QUQA 4NXML 2ZJPA 3KLWA 4NPSA 3PO3G 2EQSA 2F4VQ 1D7QA 2KCTA 3L0OA 1WFQA 2ZTEA 5GQOA 1N34Q 3HOUH 4DR3Q 4JI5L 4AH6A 1IBML 2HHHQ 2NVYH 3NEMA 1PH2A 1NE3A 1V9PA 1KAWA 3G71A 4A3FG 3HOXH 2UUAQ 4EX5A 4Y7NH 1X65A 3BJUA 5M5XH 2OTJA 1J5EQ 1LUZA 4YY3Q 2YV5A 4JI6Q 4PMWA 4DUYQ 2I0QA 4JBWA 3F2CA 3EN2A 1VQMA 3B6YA 3K7AH 1A62A 2MFIA 4LF5Q 3H3VI 1X9NA 4XTCS 2NVTH 3CCLA 1O7IA 1PH6A 4KHPL 1I50H 3HKZG 2YTYA 4A3IG 2K5HA 3HOVG 2VL6A 1OXTA 4O2DA 3G4SA 2VUMG 1FGUA 1YZ6A 4TQUS 2QA4A 1HZ9A 1VQOA 4LF4L 4LF7Q 5AJ3Q 1IZ6A 1X54A 1G51A 3JC66 3KF6A 4QY7A 4JI1L 3EIVA 1PA6A 5IWAQ 4BBSG 1QZHA 3HOWH 1PVOA 1UEBA 4R4OA 4DNIA 3RZDH 1AE3A 2JQOA 2EXDA 2CFMA 4BA2I 2WB1G 4BXXG 4A3CH 4A76A 1CSPA 4J15A 2JE6I 1MJCA 2ZM6Q 2B29A 2OQ0A 1VQIA 2JEBI 3ER0A 2K4KA 1TWFH 4A75A 3PF5A 2RHSB 1XPOA 3ERSX 4JI4Q 1VQLA 1OXVA 4O0AA 3GTGH 3CP0A 2D0OA 3RNUA 4AIMA 4X62L 2UU9Q 2MNAA 1KC8C 1Q1EA 4IPCA 4GOPC 4OWWB 5K36G 1HR0L 4YCWA 3HKZE 5BR8Q 3PF4A 1XMOQ 1EYGA 4WJ3M 2JA8G 1E22A 4GS3A 1N32Q 3E0EA 1KRSA 4HIKA 3UDFA 3AFQA 4DV7L 1GM5A 3HOYH 4LFCL 3T1YQ 3KFUA 5JJKA 2KHIA 2OWOA 4IFDG 4B3RL 3KF6B 2PQAB 4DR7Q 1HNZQ 2VQFL 4GN3B 2WB1E 3STBC 1WYDA 3M4QA 1IBLL 3CPWA 2V1CC 1JJCB 1QVFA 1KHIA 3S17H 1JMCA 2BH8A 4BY1H 3TREA 3A74A 3M7NA 5GROA 5IP9G 3VDYA 5GAHC 2UUCL 1YEZA 4AYBE 4JI1Q 3K8AA 2AWNA 4BXXH 4LNQA 3PO3H 1HZAA 3HOWG 4YWKA 3GD7A 4A3JH 2WFWA 5FLMH 4C3IH 1QVCA 1E7ZA 1FVIA 4X66L 4A3CG 4A93G 1TWCH 4IOCA 1SFOH 4GKJQ 4A93H 2BA1A 3A0JA 4GNXA 4HJ5A 3W5OA 3IRBA 3L2PA 4C3JH 4B3MQ 3CC7A 4A3BG 1PH1A 1SE8A 5EAYA 2UU9L 4A3LG 2IY5B 3OTOQ 1JB7A 3GTMH 5C3EG 1L1OC 1VQHA 1VCIA 5IYDH 4MTNA 4YWMA 2OCEA 1X3EA 3KJOA 3KYHC 4APVA 3UDXA 1UE5A 3ULJA 2ZJQA 4BY7H 3S2HH 1WCMG 3CD6A 2VY3A 5IP7G 2VW9A 3OW2A 2CWAA 3J7ZC 4JYAL 3PCOB 3DLLA 3S1MH 4DR6L 1L1OB 1HZCA 1N33Q 1HNZL 3U4VA 1CKOA 2Q2UA 3SGIA 3M9BA 1YJWA 4OX9L 4JI8Q 1SLJA 1K83H 4R4TA 1ASZA 2PQAA 4DR3L 5M3MG 3CC4A 1BBUA 2UXDL 5AJ3L 1EFWA 1JT8A 3BZKA 1IBMQ 2HHHL 1VQEA 2QGQA 2GN5A 3RLOA 4KHZA 3UE0A 2NZHA 1S3OA 5M5WH 3GTQH 1YJNA 3U4ZA 2ATWA 2K75A 2UUBL 4HIOA 2R7ZH 1GO3E 1LYLA 3CCUA 4DV0Q 3W1BA 1XPUA 3H3VH 4DUYL 1HR0W 1SRUA 1TWAH 2Y0SE 1VQJA 1KD1C 5C4XG 1K8AC 5M3FH 4OWXB 3H0GH 1VQPA 3I4MG 1OXXK 3EBEA 2VQEQ 4DV1L 4NB3A 1NTGA 2N78A 2UUAL 2R6GA 3KDFA 4PZ7A 4A4IA 4YY3L 4DV4L 4DR5Q 4A3KH 1PH9A 4B3TL 3TS2A 2LXJA 2F3IA 5C0XJ 4LF9L 3ICEA 2RF4A 5IT9c 4BY7G 1N36Q 4DKAC 4LF6Q 4RG1A 1JE5A 3T1YL 1HNXQ 4LFCQ 1IXRA 4P71A 2ZTDA 1IBLQ 1Q12A 3F2BA 2R92H 5M3FG 3NBHB 4JI8L 3I4MH 4DK6C 4GKKL 2VNUD 4P72A 2K50A 1TWGH 1PH3A 2N8NA 3K7UC 3A5UA 1V1QA 1IL2A 1EQRA 1UWVA 5IWAL 4HJAA 4DK3C 5FLMG 3PUXA 2R7ZG 2PI2A 2A19A 1HR0Q 3WWVA 4NXNQ 1XNRL 2IX1A 3HOUG 1W3SA 4DV3L 4HJ7A 5C4XH 2R7FA 4GKJL 3S2DH 2HQLA 4IFDJ 3PUVA 1N34L 2Z6KC 5M3MH 1OTCA 4A3GG 3MXNB 4GLXA 4LF5L 3HOZH 4LUOA 4L5TA 4JBMA 3KF8B 3UDIA 1Y1WG 1YVCA 2HIXA 1BVSA 1E24A 1X3GA 5FJ8G 3I4OA 1U0LA 2IT1A 4JCVE 1C9OA 1FL0A 1N8RC 2I5MX 1N32L 2Q2HA 4X64L 1EIFA 1K73C 1VQNA 4K0KL 2MO0A 1XJVA 5IE8A 4A3MG 1VQCA 3TS0A 2RHQB 1YI2A 2ZTCA 4B3RQ 4QJFA 4JI2Q 4BBRG 2E2HH 4BA1I 3CCVA 1FJGL 1H95A 2BA0A 3GTLH 1QVGA 1VQ4A 3M4PA 3JAMi 4A3DG 3CPFA 1IBKQ 4DV6Q 3RN2A 5FLXc 1VQ9A 5C3EH 2JEAI 1KL9A 1RL2A 2CWPA 1P8LA 2Y0SG 3FP9A 1HNWQ 3CXCA 1E3PA 1T9HA 1VQGA 4HIDA 4OO1I 1X6OA 2XGTA 3K81C 4LFAL 1SMXA 4A3MH 1XMOL 1PV4A 4X65Q 4DV2Q 5C44H 1HJPA 4A3IH 2I5HA 1VQ5A 2KHJA 3S15H 1A0IA 4ME3A 3U50C 1B8AA 5IP9H 2JA5G 4P75A 4QIWE 4OO1G 4JI0Q 4A3FH 4R4QA 1Y1WH 4DUZL 4DR6Q 4KI0A 1R9TH 1XMQQ 3KDFB 3HOYG 1GD7A 2Z6KA 2ES2A 3RR5A 2JA6G 1Q46A 2HT1A 3DM3A 1B70B 2FXQA 5LMUQ 2A8VA 2E5LL 4OWTB 1I94L 1CKNB 1I5FA 1NMGA 4LF7L 2JA7H 4HJ9A 3I2ZA 5LMNQ 4LFBL 2UXDQ 1G6PA 3A5ZB 3F1ZA 4Y52H 1G291 2K5NA 4BY1G 1WJJA 2K14A 2WP8J 2YTVA 3PSIA 3G48A 2IHFA 1RIPA 3CCJA 5E7NA 1GKHA 1TWHH 1HNXL 2E2JH 3RZOH 4QQBX 4R1JA 3RLFA 4DPGA 3J81i 1KIXA 3HKSA 1CUKA 3AQQA 2AKWB 1Q86C 2CCZA 4IJHA 1YBYA 4OONA 1PH7A 1P16A 3W1GA 2EIFA 3CCMA 3J81j 1NBWA 2VZAA 2JA7G 3PUYA 4X62Q 3M85A 1S72A 4AQYL 1WCMH 3D31A 3ZJYC 2YYZA 5C0XG 4NXMQ 1Z9FA 4A3LH 2OQKA 4TVAB 2HIVA 4DV0L 2JA5H 2Z0SA 5IYDG 4LF9Q 5J3BA 5IYBG 1VQ7A 3BU2A 1VQKA 3CW2C 2R92G 5GAEC 4A3DH 5JJLA 4GN5A 4C3HH 4GLAC 4MNOA 3PIOA 4A3JG 3FKIH 1AE2A 5BR8L 4LF8Q 3I55A 4XIGS 4YWLA 3GTOH 4GLVB 4X64Q 3UE1A 1EOVA 1L1OA 2K52A 3F8TA 1LTLA 4LUZA 1YIJA 4JOIC 2KBNA 1KQSA 2UXBL 3K80C 1WI5A 1Y1VH 3FHWA 3GDEA 1K0RA 4PZ6A 4A3GH 4LW1A 4NXNL 2QEXA 4GN4B 4JBJA 1VQDA 1YITA 1VQAA 3PUWA 2R93H 4JI7L 1CKMA 4DR4L 1LM0A 4IPHA 4JC0A 1K9MC 2UUCQ 2D0PA 4A3EG 3Q8DA 4JI3L 4L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S40 A;  4EQ5 A;  1PH8 A;  4ALP A;  4DR2 L;  4H02 A;  5JEA J;  4DV4 Q;  1WOC A;  4DR1 L;  1Y1V G;  1I6H H;  4LWC A;  4JV5 L;  3UDG A;  4R4C A;  4L5R C;  2WAQ G;  1EIY B;  3G6E A;  3STB D;  4YCV A;  1PH5 A;  4UP9 A;  4LF6 L;  4DV5 Q;  2IX0 A;  2PI2 E;  4JI4 L;  2JA8 H;  1JJ2 A;  3GTP H;  4UY8 C;  1PFS A;  4IJL A;  2CQO A;  5DLQ E;  2JA6 H;  3I56 A;  4JI2 L;  2CKZ B;  3FKI G;  4DR7 L;  1BBW A;  1A8V A;  1U5K A;  2NVQ H;  3T1H L;  5LMN W;  1W2B A;  1J5E L;  3ULL A;  1MKH A;  1X56 A;  3NEL A;  5IP7 H;  1Q81 C;  2UXC Q;  5C0X I;  1X3F A;  4HJ8 A;  4DR4 Q;  4DAM A;  4B3S L;  3PIP A;  1N36 L;  2VUM H;  3GTK H;  1L2F A;  5ELO A;  3H0G G;  1A63 A;  2JA9 A;  4BBS H;  5IYB H;  3CC2 A;  4OX9 Q;  3TEH B;  3I4N G;  4A3K G;  2AMC B;  1HH2 P;  1Q8K A;  3CF5 A;  4QGU A;  3E9I A;  1NY4 A;  3L7Z C;  4MZ9 A;  4JI5 Q;  3AFP A;  3GTJ H;  2Q2I A;  4IPD A;  1JJG A;  5HY6 A;  3PV0 A;  1MJE A;  4UP8 A;  5JJI A;  3HOZ G;  3M3Y H;  1SRO A;  3KOJ A;  1C7Y A;  4RMF A;  3HFZ B;  3MEF A;  3JAM c;  1D8L A;  4LFA Q;  4DR2 Q;  2ZM6 L;  2JK8 A;  2NN6 I;  4DV3 Q;  2B63 G;  4JV5 Q;  2R93 G;  5FJ8 H;  1AH9 A;  1EUJ A;  3OYY A;  4UP7 A;  5GAG C;  4OXP A;  1E1O A;  1UE1 A;  4LUV A;  1VS0 A;  4QL5 A;  4R4I A;  2MO1 A;  1XPR A;  4A3E H;  3PUZ A;  1M90 C;  1PH4 A;  2ALY B;  4KHP Q;  2VQE L;  1V43 A;  2C35 B;  4DV1 Q;  3D0F A;  3T1H Q;  1QZG A;  5IY0 A;  4UPA A;  4DR5 L;  4LF8 L;  3CCQ A;  3CQZ H;  4LF4 Q;  3PO2 H;  2VS1 A;  4YHH L;  1HZB A;  2E8G A;  1Q82 C;  2GVA A;  1X55 A;  3GO5 A;  2F52 A;  3PGZ A;  4P73 A;  1C0A A;  3TQY A;  3I7F A;  1TXY A;  4IO9 A;  4A3B H;  2AWO A;  2B3G A;  4WJ4 A;  2DGY A;  4POG A;  1KRT A;  1VQF A;  3S1Q H;  4GKK Q;  2K5V A;  5H1S E;  4P74 A;  3J81 c;  3CMA A;  1PYB A;  3TRZ A;  3F2D A;  4DV6 L;  3S1R H;  5IYC G;  5C44 G;  2YU9 H;  4PG3 A;  1YNX A;  1EWI A;  1K8G A;  1VQ6 A;  5M5Y H;  4POF A;  1YHA A;  2MQH A;  1ASY A;  1Q7Y C;  1SR3 A;  1CKN A;  2NVX H;  4X66 Q;  3J7A 5;  1I94 Q;  3S16 H;  3HOV H;  4YCU A;  3J80 i;  4B3T Q;  3S1N H;  3CCE A;  4LFB Q;  1EQQ A;  1SN8 A;  2Q2T A;  2XTI A;  1QUQ B;  4FDB A;  4AYB G;  2UXB Q;  4PZ8 A;  4DV7 Q;  1GVP A;  4DV5 L;  1NMF A;  3AEV A;  4DUZ Q;  3CAM A;  1BKB A;  2R7D A;  3S24 A;  4GOP B;  5C4J H;  3H15 A;  1XMQ L;  4X6A H;  4IFD I;  1DGS A;  1IYJ B;  2PNH A;  2LSS A;  3RN5 A;  1PYS B;  2E5L Q;  4IPG A;  2B63 H;  1IBK L;  2AHO B;  1XNQ Q;  2ASB A;  5LMN L;  1MIU A;  4B3S Q;  3PO2 G;  1L0W A;  2NN6 G;  5JEA G;  1E1T A;  3AYH B;  3HOX G;  1N33 L;  3KJP A;  2VQF Q;  1VQ8 A;  1FJG Q;  1XNR Q;  4GNX C;  2F4V L;  2NZO A;  4JOI A;  1YHQ A;  4HIM A;  3RLN A;  2D62 A;  2ZJR A;  1Q1B A;  1YHB A;  2H5X A;  3BZC A;  1N9W A;  4GOP A;  3ULP A;  4L5S A;  2L15 A;  2RCN A;  3M4O H;  1J6Q A;  3CCR A;  5HGQ A;  4B3M L;  1UE7 A;  4GNX B;  3NEN A;  2GVB A;  1HNW L;  1PHJ A;  2JJQ A;  4JI3 Q;  3OTO L;  4C2M H;  1UE6 A;  3CME A;  2UUB Q;  5LMU L;  4JI6 L;  3S14 H;  4DR1 Q;  1B7Y B;  1XTD A;  2KCM A;  2YTX A;  1VQB A;  4X65 L;  4DV2 L;  3E9H A;  1OXU A;  2E2I H;  2N49 A;  4IOA A;  2DUD A;  3J80 c;  1CSQ A;  3I4N H;  4JI0 L;  4KLK A;  4DAY B;  2PMZ E;  1YJ9 A;  3LGJ A;  5IYC H;  1M1K C;  2KEN A;  2A1A A;  1K3R A;  2ID0 A;  2BH2 A;  3CCS A;  2UXC L;  4JI7 Q;  3K0X A;  1I3Q H;  2IHE A;  2N3S A;  5ELN A;  1Y14 B;  4YHH Q;  2WAQ E;  2OTL A;  4JBK A;  2LXK A;  1XNQ L;  4BBR H;  3U58 A;  2I5L X;  4K0K Q;  5GAD C;  4JYA Q;  1NJI C;  1KXL A;  4AQY Q;  1Z47 A;  1OXS C;  4JG2 A;  1QUQ A;  4NXM L;  2ZJP A;  3KLW A;  4NPS A;  3PO3 G;  2EQS A;  2F4V Q;  1D7Q A;  2KCT A;  3L0O A;  1WFQ A;  2ZTE A;  5GQO A;  1N34 Q;  3HOU H;  4DR3 Q;  4JI5 L;  4AH6 A;  1IBM L;  2HHH Q;  2NVY H;  3NEM A;  1PH2 A;  1NE3 A;  1V9P A;  1KAW A;  3G71 A;  4A3F G;  3HOX H;  2UUA Q;  4EX5 A;  4Y7N H;  1X65 A;  3BJU A;  5M5X H;  2OTJ A;  1J5E Q;  1LUZ A;  4YY3 Q;  2YV5 A;  4JI6 Q;  4PMW A;  4DUY Q;  2I0Q A;  4JBW A;  3F2C A;  3EN2 A;  1VQM A;  3B6Y A;  3K7A H;  1A62 A;  2MFI A;  4LF5 Q;  3H3V I;  1X9N A;  4XTC S;  2NVT H;  3CCL A;  1O7I A;  1PH6 A;  4KHP L;  1I50 H;  3HKZ G;  2YTY A;  4A3I G;  2K5H A;  3HOV G;  2VL6 A;  1OXT A;  4O2D A;  3G4S A;  2VUM G;  1FGU A;  1YZ6 A;  4TQU S;  2QA4 A;  1HZ9 A;  1VQO A;  4LF4 L;  4LF7 Q;  5AJ3 Q;  1IZ6 A;  1X54 A;  1G51 A;  3JC6 6;  3KF6 A;  4QY7 A;  4JI1 L;  3EIV A;  1PA6 A;  5IWA Q;  4BBS G;  1QZH A;  3HOW H;  1PVO A;  1UEB A;  4R4O A;  4DNI A;  3RZD H;  1AE3 A;  2JQO A;  2EXD A;  2CFM A;  4BA2 I;  2WB1 G;  4BXX G;  4A3C H;  4A76 A;  1CSP A;  4J15 A;  2JE6 I;  1MJC A;  2ZM6 Q;  2B29 A;  2OQ0 A;  1VQI A;  2JEB I;  3ER0 A;  2K4K A;  1TWF H;  4A75 A;  3PF5 A;  2RHS B;  1XPO A;  3ERS X;  4JI4 Q;  1VQL A;  1OXV A;  4O0A A;  3GTG H;  3CP0 A;  2D0O A;  3RNU A;  4AIM A;  4X62 L;  2UU9 Q;  2MNA A;  1KC8 C;  1Q1E A;  4IPC A;  4GOP C;  4OWW B;  5K36 G;  1HR0 L;  4YCW A;  3HKZ E;  5BR8 Q;  3PF4 A;  1XMO Q;  1EYG A;  4WJ3 M;  2JA8 G;  1E22 A;  4GS3 A;  1N32 Q;  3E0E A;  1KRS A;  4HIK A;  3UDF A;  3AFQ A;  4DV7 L;  1GM5 A;  3HOY H;  4LFC L;  3T1Y Q;  3KFU A;  5JJK A;  2KHI A;  2OWO A;  4IFD G;  4B3R L;  3KF6 B;  2PQA B;  4DR7 Q;  1HNZ Q;  2VQF L;  4GN3 B;  2WB1 E;  3STB C;  1WYD A;  3M4Q A;  1IBL L;  3CPW A;  2V1C C;  1JJC B;  1QVF A;  1KHI A;  3S17 H;  1JMC A;  2BH8 A;  4BY1 H;  3TRE A;  3A74 A;  3M7N A;  5GRO A;  5IP9 G;  3VDY A;  5GAH C;  2UUC L;  1YEZ A;  4AYB E;  4JI1 Q;  3K8A A;  2AWN A;  4BXX H;  4LNQ A;  3PO3 H;  1HZA A;  3HOW G;  4YWK A;  3GD7 A;  4A3J H;  2WFW A;  5FLM H;  4C3I H;  1QVC A;  1E7Z A;  1FVI A;  4X66 L;  4A3C G;  4A93 G;  1TWC H;  4IOC A;  1SFO H;  4GKJ Q;  4A93 H;  2BA1 A;  3A0J A;  4GNX A;  4HJ5 A;  3W5O A;  3IRB A;  3L2P A;  4C3J H;  4B3M Q;  3CC7 A;  4A3B G;  1PH1 A;  1SE8 A;  5EAY A;  2UU9 L;  4A3L G;  2IY5 B;  3OTO Q;  1JB7 A;  3GTM H;  5C3E G;  1L1O C;  1VQH A;  1VCI A;  5IYD H;  4MTN A;  4YWM A;  2OCE A;  1X3E A;  3KJO A;  3KYH C;  4APV A;  3UDX A;  1UE5 A;  3ULJ A;  2ZJQ A;  4BY7 H;  3S2H H;  1WCM G;  3CD6 A;  2VY3 A;  5IP7 G;  2VW9 A;  3OW2 A;  2CWA A;  3J7Z C;  4JYA L;  3PCO B;  3DLL A;  3S1M H;  4DR6 L;  1L1O B;  1HZC A;  1N33 Q;  1HNZ L;  3U4V A;  1CKO A;  2Q2U A;  3SGI A;  3M9B A;  1YJW A;  4OX9 L;  4JI8 Q;  1SLJ A;  1K83 H;  4R4T A;  1ASZ A;  2PQA A;  4DR3 L;  5M3M G;  3CC4 A;  1BBU A;  2UXD L;  5AJ3 L;  1EFW A;  1JT8 A;  3BZK A;  1IBM Q;  2HHH L;  1VQE A;  2QGQ A;  2GN5 A;  3RLO A;  4KHZ A;  3UE0 A;  2NZH A;  1S3O A;  5M5W H;  3GTQ H;  1YJN A;  3U4Z A;  2ATW A;  2K75 A;  2UUB L;  4HIO A;  2R7Z H;  1GO3 E;  1LYL A;  3CCU A;  4DV0 Q;  3W1B A;  1XPU A;  3H3V H;  4DUY L;  1HR0 W;  1SRU A;  1TWA H;  2Y0S E;  1VQJ A;  1KD1 C;  5C4X G;  1K8A C;  5M3F H;  4OWX B;  3H0G H;  1VQP A;  3I4M G;  1OXX K;  3EBE A;  2VQE Q;  4DV1 L;  4NB3 A;  1NTG A;  2N78 A;  2UUA L;  2R6G A;  3KDF A;  4PZ7 A;  4A4I A;  4YY3 L;  4DV4 L;  4DR5 Q;  4A3K H;  1PH9 A;  4B3T L;  3TS2 A;  2LXJ A;  2F3I A;  5C0X J;  4LF9 L;  3ICE A;  2RF4 A;  5IT9 c;  4BY7 G;  1N36 Q;  4DKA C;  4LF6 Q;  4RG1 A;  1JE5 A;  3T1Y L;  1HNX Q;  4LFC Q;  1IXR A;  4P71 A;  2ZTD A;  1IBL Q;  1Q12 A;  3F2B A;  2R92 H;  5M3F G;  3NBH B;  4JI8 L;  3I4M H;  4DK6 C;  4GKK L;  2VNU D;  4P72 A;  2K50 A;  1TWG H;  1PH3 A;  2N8N A;  3K7U C;  3A5U A;  1V1Q A;  1IL2 A;  1EQR A;  1UWV A;  5IWA L;  4HJA A;  4DK3 C;  5FLM G;  3PUX A;  2R7Z G;  2PI2 A;  2A19 A;  1HR0 Q;  3WWV A;  4NXN Q;  1XNR L;  2IX1 A;  3HOU G;  1W3S A;  4DV3 L;  4HJ7 A;  5C4X H;  2R7F A;  4GKJ L;  3S2D H;  2HQL A;  4IFD J;  3PUV A;  1N34 L;  2Z6K C;  5M3M H;  1OTC A;  4A3G G;  3MXN B;  4GLX A;  4LF5 L;  3HOZ H;  4LUO A;  4L5T A;  4JBM A;  3KF8 B;  3UDI A;  1Y1W G;  1YVC A;  2HIX A;  1BVS A;  1E24 A;  1X3G A;  5FJ8 G;  3I4O A;  1U0L A;  2IT1 A;  4JCV E;  1C9O A;  1FL0 A;  1N8R C;  2I5M X;  1N32 L;  2Q2H A;  4X64 L;  1EIF A;  1K73 C;  1VQN A;  4K0K L;  2MO0 A;  1XJV A;  5IE8 A;  4A3M G;  1VQC A;  3TS0 A;  2RHQ B;  1YI2 A;  2ZTC A;  4B3R Q;  4QJF A;  4JI2 Q;  4BBR G;  2E2H H;  4BA1 I;  3CCV A;  1FJG L;  1H95 A;  2BA0 A;  3GTL H;  1QVG A;  1VQ4 A;  3M4P A;  3JAM i;  4A3D G;  3CPF A;  1IBK Q;  4DV6 Q;  3RN2 A;  5FLX c;  1VQ9 A;  5C3E H;  2JEA I;  1KL9 A;  1RL2 A;  2CWP A;  1P8L A;  2Y0S G;  3FP9 A;  1HNW Q;  3CXC A;  1E3P A;  1T9H A;  1VQG A;  4HID A;  4OO1 I;  1X6O A;  2XGT A;  3K81 C;  4LFA L;  1SMX A;  4A3M H;  1XMO L;  1PV4 A;  4X65 Q;  4DV2 Q;  5C44 H;  1HJP A;  4A3I H;  2I5H A;  1VQ5 A;  2KHJ A;  3S15 H;  1A0I A;  4ME3 A;  3U50 C;  1B8A A;  5IP9 H;  2JA5 G;  4P75 A;  4QIW E;  4OO1 G;  4JI0 Q;  4A3F H;  4R4Q A;  1Y1W H;  4DUZ L;  4DR6 Q;  4KI0 A;  1R9T H;  1XMQ Q;  3KDF B;  3HOY G;  1GD7 A;  2Z6K A;  2ES2 A;  3RR5 A;  2JA6 G;  1Q46 A;  2HT1 A;  3DM3 A;  1B70 B;  2FXQ A;  5LMU Q;  2A8V A;  2E5L L;  4OWT B;  1I94 L;  1CKN B;  1I5F A;  1NMG A;  4LF7 L;  2JA7 H;  4HJ9 A;  3I2Z A;  5LMN Q;  4LFB L;  2UXD Q;  1G6P A;  3A5Z B;  3F1Z A;  4Y52 H;  1G29 1;  2K5N A;  4BY1 G;  1WJJ A;  2K14 A;  2WP8 J;  2YTV A;  3PSI A;  3G48 A;  2IHF A;  1RIP A;  3CCJ A;  5E7N A;  1GKH A;  1TWH H;  1HNX L;  2E2J H;  3RZO H;  4QQB X;  4R1J A;  3RLF A;  4DPG A;  3J81 i;  1KIX A;  3HKS A;  1CUK A;  3AQQ A;  2AKW B;  1Q86 C;  2CCZ A;  4IJH A;  1YBY A;  4OON A;  1PH7 A;  1P16 A;  3W1G A;  2EIF A;  3CCM A;  3J81 j;  1NBW A;  2VZA A;  2JA7 G;  3PUY A;  4X62 Q;  3M85 A;  1S72 A;  4AQY L;  1WCM H;  3D31 A;  3ZJY C;  2YYZ A;  5C0X G;  4NXM Q;  1Z9F A;  4A3L H;  2OQK A;  4TVA B;  2HIV A;  4DV0 L;  2JA5 H;  2Z0S A;  5IYD G;  4LF9 Q;  5J3B A;  5IYB G;  1VQ7 A;  3BU2 A;  1VQK A;  3CW2 C;  2R92 G;  5GAE C;  4A3D H;  5JJL A;  4GN5 A;  4C3H H;  4GLA C;  4MNO A;  3PIO A;  4A3J G;  3FKI H;  1AE2 A;  5BR8 L;  4LF8 Q;  3I55 A;  4XIG S;  4YWL A;  3GTO H;  4GLV B;  4X64 Q;  3UE1 A;  1EOV A;  1L1O A;  2K52 A;  3F8T A;  1LTL A;  4LUZ A;  1YIJ A;  4JOI C;  2KBN A;  1KQS A;  2UXB L;  3K80 C;  1WI5 A;  1Y1V H;  3FHW A;  3GDE A;  1K0R A;  4PZ6 A;  4A3G H;  4LW1 A;  4NXN L;  2QEX A;  4GN4 B;  4JBJ A;  1VQD A;  1YIT A;  1VQA A;  3PUW A;  2R93 H;  4JI7 L;  1CKM A;  4DR4 L;  1LM0 A;  4IPH A;  4JC0 A;  1K9M C;  2UUC Q;  2D0P A;  4A3E G;  3Q8D A;  4JI3 L;  4L5Q A; 
#chains in the Genus database with same CATH topology
 2DJG C;  1V1P B;  4RGN A;  4DV4 Q;  4JV5 L;  1EIY B;  2A6H C;  4UP9 A;  1TY2 A;  4JI4 L;  4RGT A;  5CR3 A;  3SK5 A;  4UY8 C;  1PFS A;  2JA6 H;  1M4V A;  2A5H A;  3GQB A;  2R7Z B;  2HUG A;  5LMN W;  3DMU A;  1W2B A;  4DU9 A;  1F77 A;  3NEL A;  2UXC Q;  4LMQ D;  4A93 B;  1A6X A;  5C0X I;  4HJ8 A;  1TWF B;  4B3S L;  3K7A B;  1NNX A;  2VUM H;  5M3F B;  2KCN A;  1L2F A;  2K01 A;  5ELO A;  4F8M A;  4OX9 Q;  4CKE A;  1UUP A;  2SOB A;  1EYC A;  1Q8K A;  2A6H D;  4QGU A;  4ZCK A;  2WKD A;  2K6A A;  1JWS D;  1O7Y A;  5HY6 A;  3O13 A;  3M3Y H;  1SRO A;  1WTV A;  5IGB A;  3AU7 A;  3MHB A;  3HFZ B;  4DR2 Q;  5IOC A;  4DV3 Q;  2R93 G;  3J7A F;  1AH9 A;  3OYY A;  3T56 B;  4EQN A;  4ULL A;  1T5X D;  4R4I A;  4QL5 A;  1GOZ A;  4DXF A;  5I4D A;  4MN3 A;  1V43 A;  1PTO B;  3CCQ A;  3CQZ H;  4DFA A;  4QUF A;  4EQP A;  3R3O A;  2E8G A;  1X55 A;  2F52 A;  4P73 A;  1TXY A;  4IO9 A;  1GUO A;  4A3B H;  3IFT A;  2DGY A;  3S9W A;  1VQF A;  2MGS A;  3LWE A;  3J81 c;  4BY7 B;  3TRZ A;  4DV6 L;  3S1R H;  4ID6 A;  1SMY D;  5C44 G;  1AFP A;  3VR6 A;  5HUR A;  1EWI A;  1YHA A;  5C5M A;  2MQH A;  1ASY A;  5COY A;  4KY6 A;  3J80 i;  3CCE A;  1EQQ A;  1SN8 A;  4FDB A;  4DV7 Q;  5COR A;  2D2C C;  3W2D A;  1NMF A;  4DUZ Q;  1BKB A;  1XMQ L;  4N8F A;  1CTM A;  1LT5 D;  2NYZ D;  2O2L D;  1IYJ B;  3RUZ A;  1EWC A;  2E5L Q;  1STN A;  4X3T A;  4IUU A;  2IX3 A;  4FF2 A;  4RGM A;  5CC4 A;  3K57 A;  3KJP A;  4HR7 B;  2B8G A;  2F0Q A;  1FJG Q;  2F4V L;  4JOI A;  2CW0 D;  1YHQ A;  4HIM A;  3D8G A;  2D62 A;  3AEV A;  4KTA A;  4L5S A;  1M8A A;  4L6T B;  4B3M L;  3CRL C;  2F1M A;  2GVB A;  4CDD C;  1PHJ A;  5A2Q E;  2UUB Q;  1FR3 A;  3D6C A;  4C3H G;  3HG9 A;  5BN5 A;  2KCM A;  2YTX A;  3E9H A;  2L12 A;  3J80 c;  4X3U A;  1XX8 A;  3I4N H;  4DAY B;  3K5L A;  1WTP A;  1YJ9 A;  5IYC H;  3G7L A;  2KEN A;  4N9P A;  1AEX A;  2EY2 A;  2XVS A;  3QOJ A;  5I2Y A;  2IHE A;  5BN4 A;  2OTL A;  1XNQ L;  4YHH Q;  3S15 B;  4BBR H;  3U58 A;  2PMZ B;  4RHR A;  3LX0 A;  3PO3 G;  2QDB A;  2EQS A;  4H44 C;  2KCT A;  1HPC A;  4K5X A;  1TWG B;  4DR3 Q;  5ELF A;  1B3A A;  2HHH Q;  2JA8 B;  1Y1V B;  3RZO B;  3OIQ A;  2BCO A;  3L9A X;  1EIG A;  4YY3 Q;  2ENB A;  3NQI A;  1ONL A;  2L9H A;  2XRQ D;  1DCZ A;  1A62 A;  1ROD A;  3HOZ B;  1MD2 D;  2NVT H;  3WOE A;  1I4P A;  3G4S A;  4LF7 Q;  4JI1 L;  4BBS G;  3GTJ B;  4FXK C;  4C3J G;  4J8Q A;  2JQO A;  4BA2 I;  2CFM A;  2WB1 G;  1EWH A;  4A76 A;  1CSP A;  2HD3 A;  4J15 A;  1MJC A;  4KKS A;  2ZM6 Q;  4XQJ A;  1B9N A;  2QDL A;  2RHS B;  1B1Z A;  2EXZ A;  2PQE A;  1KC8 C;  5FLX L;  4GOP C;  1A3V A;  4YCW A;  3HKZ E;  1S5E D;  1B3Q A;  3FVQ A;  1XMO Q;  3Q23 A;  5AFW A;  4CHT B;  3UDF A;  1GM5 A;  3HOY H;  3N52 A;  4XXE A;  4K8J A;  4DR7 Q;  1HNZ Q;  1WYD A;  1CI3 M;  4RCO A;  2FHT A;  3S17 H;  3L3O C;  2ZXR A;  2JXM B;  3DWQ A;  2BDO A;  2PZU A;  3VDY A;  1ENA A;  2F0P A;  4BXX H;  2YU9 B;  3GD7 A;  2NVQ B;  5FLM H;  4X66 L;  4A3C G;  3NTH A;  1FNW A;  1STG A;  1X32 A;  1WTQ A;  1SFO H;  1KDB A;  2E75 C;  3I90 A;  4EVO A;  1SAP A;  4C3J H;  1NR4 A;  3ONA B;  3IFD A;  1PH1 A;  2UU9 L;  4A3L G;  2B39 A;  3R93 A;  3BZD B;  3K0Y A;  1X3E A;  3QO2 A;  4APV A;  1H9R A;  2ZJQ A;  4G7O C;  5EJW A;  1EY8 A;  3I8Z A;  5CBA E;  3DLL A;  1L1O B;  1PLF A;  1QE6 A;  2PCF B;  2A6E D;  2NVX B;  1I4X A;  3M9B A;  4G4K A;  5D14 A;  1PMR A;  2KEC A;  1KDA A;  1ASZ A;  5FO7 B;  5AJ3 L;  1JT8 A;  1IBM Q;  3UE0 A;  2EY1 A;  1AP0 A;  3D4W A;  4KY5 A;  4DNT B;  5KNB A;  2K75 A;  3NE5 B;  2A68 D;  2F0H A;  1G2S A;  3W1B A;  1XPU A;  1HR0 W;  5NUC A;  4RKB A;  1KD1 C;  2B2U C;  1IW7 D;  4HSV A;  2NVT B;  3S1Q B;  2H4O A;  1O80 A;  4DR5 Q;  4IFD I;  3TS2 A;  3KBX A;  4YY3 L;  2LXJ A;  2F3I A;  1YNJ D;  1GHK A;  2RF4 A;  4BY7 G;  1RKN A;  4DKA C;  4LF6 Q;  1VF7 A;  4RG1 A;  2TMP A;  1HNX Q;  3T1Y L;  4FYD A;  4IUQ A;  4Q5V A;  1IBL Q;  3S14 B;  1Q12 A;  3F2B A;  4DK0 A;  4DK6 C;  1U4R A;  2K50 A;  2SEB D;  1F2Z A;  3E5S A;  1HRJ A;  3A5U A;  1V1Q A;  3DXJ C;  1IL2 A;  5IWA L;  2NUC A;  3PUX A;  3FEW X;  5I6W A;  1DD2 A;  3HOX B;  2IX1 A;  1W3S A;  2R7F A;  1JE4 A;  3PO2 B;  2HQL A;  4GKJ L;  1N34 L;  1ICF B;  4GLX A;  4L5T A;  2KA7 A;  1K28 A;  1U0L A;  2IT1 A;  3K59 A;  1N8R C;  3CKI B;  5EKL A;  4DN4 M;  4OEL B;  5JPM C;  1ICW A;  2Q2H A;  1U9R A;  4WFN 3;  4A3M G;  1NAP A;  4F87 A;  4XQN A;  1YI2 A;  2E2H H;  3CCV A;  1FJG L;  2BA0 A;  1VQ4 A;  3M4P A;  4RWS C;  3CPF A;  4IQZ A;  4CGY B;  4DA2 A;  5C3E H;  4G7Z C;  1RL2 A;  2CWP A;  1P8L A;  3CXC A;  5EQ0 A;  1LTG D;  1E3P A;  1T9H A;  3MC0 B;  2RDF A;  4OO1 I;  4MIU A;  4LFA L;  4A3I H;  2F3W A;  3S15 H;  4IUN A;  2MHV A;  4K8I A;  1MGS A;  4DUZ L;  2IL8 A;  3RZD B;  1XMQ Q;  3RR5 A;  4C56 C;  2HT1 A;  1PFN A;  2E5L L;  1MSH A;  1CKN B;  3ERO A;  3H6M A;  4HJ9 A;  3KF8 A;  1G6P A;  3F1Z A;  1EQT A;  2K5N A;  3ERQ A;  3PSI A;  2K14 A;  3CCJ A;  1A3U A;  3RZO H;  4R1J A;  3RLF A;  3TP6 A;  5EPK A;  2CCZ A;  4IJH A;  4WOR A;  4CKC A;  1PH7 A;  3W1G A;  2KUM A;  3CCM A;  2ICI A;  2KQ3 A;  5ELD A;  4AQY L;  1QOH A;  1BDO A;  3ZJY C;  5C0X G;  1IL8 A;  1SNM A;  4R8N A;  5CYU A;  3NBI A;  5IYD G;  4LF9 Q;  2AUJ D;  3E6Z X;  4DNR B;  2R92 G;  5GAE C;  1G91 A;  4GN5 A;  1EY7 A;  4A3J G;  4LF8 Q;  3M7G A;  1DOK A;  1SNQ A;  3UE1 A;  4X64 Q;  2K52 A;  1YIJ A;  5KYL A;  2B2V C;  3H09 A;  2TSS A;  4DAP A;  3GV6 A;  2Q8I B;  4RKL A;  1SYC A;  1W6J A;  1CA6 A;  5IOD A;  1B44 D;  1LM0 A;  2UUC Q;  2EYP A;  5C4H A;  1SEB D;  1S40 A;  1PH8 A;  3S17 B;  1K3B C;  1WOC A;  4DR1 L;  4R4C A;  2JA8 H;  2IX0 A;  2PI2 E;  1I4G A;  4IJL A;  3BYY B;  5DLQ E;  3I91 A;  1AZQ A;  4DR7 L;  3FKI G;  1BBW A;  1A8V A;  1STY A;  1U5K A;  1NCV A;  3FPU B;  2NVQ H;  3TZD A;  1D5Z C;  3ND8 A;  1J5E L;  1X56 A;  1SFO B;  1X3F A;  4PMC A;  4DAM A;  3GTK H;  2JA9 A;  1STA A;  5IYB H;  3CC2 A;  1GUT A;  2AMC B;  1ET9 A;  4A3I B;  4XYO A;  1HH2 P;  1SYF A;  1I6V C;  5C6A A;  4JI5 Q;  2EPB A;  3GTJ H;  3ITP A;  4HMI A;  3VR3 A;  3G6J B;  3KOJ A;  4RMF A;  1I4H A;  1D8L A;  2ZM6 L;  1PRT D;  4FNF A;  1UNS A;  1TS4 A;  5FJ8 H;  3A7L A;  5GAG C;  5D3I B;  1LTS D;  1VS0 A;  2A68 C;  4NMZ A;  1XPR A;  2MJ8 A;  4P2C B;  1QJO A;  2D5D A;  4KKT A;  3C1E A;  2L11 A;  2ALY B;  1PH4 A;  4DV1 Q;  4KHP Q;  3T1H Q;  5KEE A;  3D0F A;  1BXT A;  5IY0 A;  1TWC B;  1CQV A;  1O78 A;  1HTL D;  2GVA A;  3KLS X;  3HOY B;  3TQY A;  3QR8 A;  1H9S A;  4N8X 1;  2AWO A;  2B3G A;  4FXG C;  4WJ4 A;  5IGC A;  4POG A;  1KRT A;  2GA4 B;  3S1Q H;  1PRT C;  1LTA D;  4GKK Q;  2K5V A;  1PDQ A;  1YNN C;  2WKC A;  2YU9 H;  1K8G A;  3MFG A;  1Q7Y C;  1QIL A;  1SR3 A;  3S16 H;  4YCU A;  4B3T Q;  3S1N H;  4HTH A;  1TS2 A;  2Q2T A;  2B2T A;  2RVL A;  3A7A B;  4PZ8 A;  1PZK D;  1S5D D;  2EY5 A;  5C4J H;  4NP5 A;  2LSS A;  4QCL A;  3QWN A;  1EEF D;  1PYS B;  2A69 D;  1IBK L;  3PO2 G;  3D4R A;  2Z8L A;  1E1T A;  3HOX G;  2Z6B A;  5DM6 3;  3EQL C;  2B2V A;  4LAA A;  2ZJR A;  1YHB A;  2RCN A;  4CBV A;  5HGQ A;  3T4A C;  3NEN A;  1EU3 A;  3OTO L;  2F0U A;  4FF4 A;  1G6Z A;  5C3W A;  5LMU L;  5FO9 B;  4DR1 Q;  1B7Y B;  4X65 L;  1VQB A;  2G9D A;  4RFB A;  4CKB A;  4B9X A;  4JI0 L;  2FIN B;  2E74 C;  2O4X A;  3LGJ A;  3OIP A;  5JJZ A;  2BH2 A;  3CCS A;  2UXC L;  4DR4 Q;  5C4X B;  5ELN A;  2LXK A;  2I5L X;  5J39 A;  4JYA Q;  1NJI C;  1KXL A;  1OXS C;  4JG2 A;  1QUQ A;  3TBI B;  4O1N A;  1BCP F;  3FKI B;  2RA4 A;  2RQX A;  2ZTE A;  1N34 Q;  4JI5 L;  4JVZ A;  4AH6 A;  3PIO 3;  1IBM L;  2A73 B;  1PH2 A;  1NE3 A;  4PV1 C;  1V9P A;  1D1K A;  4A3F G;  3HOX H;  2F03 A;  2UUA Q;  1LT4 D;  1JCK B;  4Y7N H;  1X65 A;  3BJU A;  3GTL B;  4EGV A;  3MVV A;  2I0Q A;  2CHB D;  3EN2 A;  5I2X A;  5LHY 1;  3H3V I;  2QW7 A;  4XTC S;  3BVZ A;  3DWA A;  3CCL A;  2PYK A;  5D65 A;  3HOV G;  3H91 A;  2VUM G;  1FGU A;  1HZ9 A;  1VQO A;  1WTO A;  1BBX C;  1G51 A;  3KF6 A;  1PVO A;  1UEB A;  4R4O A;  1AE3 A;  2DNE A;  2EXD A;  3OWF A;  3NWS A;  3WDN A;  4BXX G;  4B9W A;  3S16 B;  2JEB I;  2K4K A;  1TWF H;  1I4R A;  4OEM B;  1XPO A;  2QIL A;  4JI4 Q;  2VUM B;  1VQL A;  3CP0 A;  2D0O A;  4A3E B;  1WTW A;  2HCI A;  1RTN A;  5KNC A;  1HR0 L;  3PF4 A;  1X3Q A;  2JA8 G;  1N32 Q;  3E0E A;  4HIK A;  3URY A;  1B9M A;  3AFQ A;  3NTI A;  5J1Z A;  4DV7 L;  3KFU A;  5EPL A;  2F3V A;  4IFD G;  1S5C D;  1QNU A;  1ZEQ X;  4B3R L;  2WB1 E;  3M4Q A;  4HED A;  4N9T A;  2V1C C;  3TSS A;  2JA5 B;  2RBM A;  3A74 A;  3TRE A;  2B2Y A;  4NW2 A;  2K5W A;  3K8A A;  4XQQ A;  4A3J H;  1JIC A;  1F9R A;  1FVI A;  4G7H C;  5DM7 3;  3CU7 A;  3HOV B;  3DWP A;  3DM1 A;  2BA1 A;  3A0J A;  1TY0 A;  4Z9C B;  2Z9H A;  4B3M Q;  3CC7 A;  4A3B G;  1SE8 A;  5EAY A;  3Q6S A;  1VCI A;  1CHQ D;  5IYD H;  3AMU A;  1JOO A;  1K8M A;  3NTK A;  4A3M B;  2B2W C;  2OCE A;  3KJO A;  1GHJ A;  4BY7 H;  3S1R B;  3FMC A;  3CD6 A;  3TP7 A;  5IP7 G;  2CW0 C;  3OW2 A;  1EIH A;  2CWA A;  3J7Z C;  4FF3 A;  4JYA L;  3P1H A;  1N33 Q;  3U4V A;  4OX9 L;  3SGI A;  1Y8P B;  3A55 A;  2K04 A;  1SLJ A;  4UHV A;  1ILQ A;  4RA8 A;  2D9U A;  2Z4I A;  2R3Z A;  3U4Z A;  4HIO A;  4LJZ C;  4Y7N B;  1QB5 D;  3E0J A;  2PZW A;  3H3V H;  4XDX A;  1SRU A;  4CDE C;  1U4L A;  5C4X G;  1VQJ A;  2F0G A;  3FPP A;  1VMP A;  1E2V A;  3MXG A;  4OWX B;  1VQP A;  3BDC A;  5KRU A;  1ZKO A;  3K5N A;  4NB3 A;  1HCZ A;  1NTG A;  4KN7 C;  2UUA L;  4PZ7 A;  4DV4 L;  3TDQ A;  4DAV A;  4XT3 B;  1I3Q B;  4LF9 L;  3ICE A;  4H0L C;  1ML0 D;  2L5T A;  5E4W C;  4L8J A;  4LFC Q;  2NWG A;  5M5Y B;  1D6E C;  1DXM A;  1SXT A;  5IIF A;  2K7V A;  1LTR D;  2R92 H;  5M3F G;  3I4M H;  4JI8 L;  4GKK L;  2VNU D;  4HMJ A;  2NVY B;  1JR0 D;  4DK3 C;  2R7Z G;  1KTK A;  2PI2 A;  1HR0 Q;  2F0T A;  4U68 A;  1XNR L;  1Q8I A;  1VMC A;  1WTX A;  1MSG A;  4HJ7 A;  3MWY W;  2MUY A;  2X69 A;  1QCB D;  3FRP B;  3NXW A;  4LF5 L;  4JBM A;  1Y1W G;  2HIX A;  3M4Y A;  1CHP D;  1I50 B;  5FJ8 G;  2XN9 C;  2BE5 C;  3BVG A;  2Z1C A;  1LT3 D;  1N32 L;  1V8Q A;  2F0S A;  1VQN A;  3E3X A;  5CV8 A;  2RHQ B;  2ZTC A;  4JI2 Q;  2NZ1 D;  1H95 A;  3NBH A;  3MZ5 A;  5FLX E;  3C1F A;  3JAM i;  3J7Y W;  1VQ9 A;  5FLX c;  1KL9 A;  1DOL A;  1SE4 A;  1I4Q A;  2SDF A;  2AUK A;  1PXU A;  1VQG A;  1X6O A;  2CH4 W;  3VA7 A;  1MHW C;  4OIK A;  4A3M H;  3ZYY X;  3U50 C;  2JA5 G;  4A3F H;  4R4Q A;  3OHX C;  4DR6 Q;  4CJ2 C;  1J9O A;  3HOY G;  2Z6K A;  3MFY A;  1PTO D;  5TSS A;  2ES2 A;  2JA6 G;  1Q46 A;  2WAQ B;  2A8V A;  3S1N B;  4OWT B;  3A8K E;  4LF7 L;  5LMN Q;  1E2W A;  2UXD Q;  3A5Z B;  4Y52 H;  3KBG A;  4BY1 G;  5EBD A;  4F7X A;  2WP8 J;  2YTV A;  3Q22 A;  2IHF A;  3G48 A;  1K8O A;  1TWH H;  5C4J B;  2DJF C;  4C2M B;  3J81 i;  1KIX A;  2AQ2 B;  3VYS A;  4RGO S;  1SYB A;  1YBY A;  4K2K A;  5LL6 S;  1P16 A;  3AB9 A;  1NBW A;  2VZA A;  5C5L A;  4J1M A;  2JA7 G;  4X62 Q;  5EKI A;  3D31 A;  2YYZ A;  4A3L H;  2OQK A;  3QJY A;  4TVA B;  1KAB A;  4XT1 B;  5F2D A;  1PYW D;  1QG7 A;  4HAE A;  4MHE A;  1CA5 A;  2EYO A;  3CW2 C;  2HDM A;  4A3D H;  4KD3 A;  4MNO A;  2FJ2 A;  2PW7 A;  3PIO A;  2DY8 A;  2B2U A;  2R92 B;  4YWL A;  4K6D A;  1SYE A;  4GLV B;  2UXB L;  4LUZ A;  3C2P A;  3PMF A;  2KHS A;  1WI5 A;  2B2W A;  1EY6 A;  1FNV A;  1W6K A;  4PZ6 A;  1LTI D;  1II3 A;  2HDL A;  2R93 H;  2JSO A;  2PW5 A;  1RJT A;  3TME A;  1K9M C;  2HCC A;  1RD9 D;  2D0P A;  4JI3 L;  3FDT A;  4KJN A;  4L5Q A;  4UAI A;  4ALP A;  4DR2 L;  4H02 A;  1CQF A;  1Y1V G;  1DM0 B;  5J22 A;  3UDG A;  1D5X C;  2F0W A;  4BY1 B;  4L5R C;  3SDZ A;  1A2U A;  3G6E A;  1SJH D;  2XWB B;  4YCV A;  3STB D;  4DV5 Q;  2WB1 B;  2F0I A;  5JOB A;  1EY5 A;  3J81 E;  3EFX D;  2F0L A;  4JI2 L;  3PO3 B;  2EY6 A;  4A3J B;  3BYT B;  1H9J A;  1VDZ A;  2EYH A;  1MKH A;  1EU4 A;  5IP7 H;  3H3V C;  3OSO A;  3PIP A;  1N36 L;  3GP7 A;  1ESF A;  2RSN A;  1L0Y B;  1V1P A;  5FO8 B;  4CJ1 B;  3CF5 A;  1H9S B;  3E9I A;  4MZ9 A;  3S2D B;  2KJX A;  4IPD A;  1JJG A;  1RDP D;  3PV0 A;  2ZT9 C;  3S1M B;  4K2L A;  4BWG B;  5JJI A;  1C7Y A;  5CV4 A;  5L37 A;  1EFI D;  4LFA Q;  5A2Q L;  2NN6 I;  4JV5 Q;  2KVM A;  1EUJ A;  3D3R A;  4UP7 A;  4OXP A;  2NBF A;  4LUV A;  4A3E H;  1HA6 A;  2VQE L;  4IFD H;  4UPA A;  4LF8 L;  3PO2 H;  4YHH L;  1Q82 C;  4CDF C;  3I7F A;  4X3S A;  3J80 E;  1Y69 U;  1FNU A;  3T51 B;  2LS0 1;  3DEP A;  4C1N I;  3OWE B;  4KN4 C;  1SE2 A;  5C3X A;  5I9O A;  5IYC G;  2K1B A;  1F2Y A;  2KED A;  2L0C A;  1S5F D;  4PG3 A;  5M5Y H;  2E2H B;  5E1F A;  5IGF A;  1EQV A;  3J7A 5;  4X66 Q;  1O7Z A;  2EJG C;  3I4M B;  1I94 Q;  3HOV H;  4PQX A;  2ZXO A;  3NQT A;  2UXB Q;  1DOM A;  2XNA C;  3V2T A;  4GZY C;  2K5Q A;  1STH A;  2F0E A;  3EJI A;  4E6I A;  3C3L A;  2R7D A;  4GOP B;  3H15 A;  4X6A H;  1H9K A;  3P7J A;  4IAL A;  1FD7 D;  2PNH A;  3K5O A;  1ZYR C;  1XNQ Q;  2ASB A;  2K5D A;  5LMN L;  1E2Z A;  2IJ0 A;  4B3S Q;  3HP3 A;  4ZK9 B;  1L0W A;  2F0K A;  5DAU A;  5JEA G;  1N33 L;  3BDL A;  4ZLT F;  1XNR Q;  2NZO A;  3T53 B;  4DGZ A;  4GOP A;  3ULP A;  2H5X A;  3BZC A;  3T16 A;  2L15 A;  2SNM A;  1UE7 A;  4O42 A;  4GNX B;  1CZG A;  3D4D A;  4JI3 Q;  4Q0F A;  4OO1 H;  1UE6 A;  5JVG 3;  4IUT A;  1XTD A;  3TP8 A;  4DV2 L;  2E2I H;  4IOA A;  3QIA A;  1OXU A;  2N49 A;  3OPO A;  2DUD A;  4ABN A;  2A74 C;  1CSQ A;  3MXP A;  1WTR A;  4KLK A;  2PMZ E;  2E2D C;  2E76 C;  4HN7 A;  5HGT A;  2A1A A;  1K3R A;  2ID0 A;  5JPN C;  4JI7 Q;  3K0X A;  1I3Q H;  4JBK A;  2F0O A;  1DON A;  4RCN A;  4L63 B;  4K0K Q;  1ZXT A;  5GAD C;  2R61 A;  4AQY Q;  1Z47 A;  2NN6 H;  1SYD A;  4NXM L;  2ZJP A;  3KLW A;  2F4V Q;  1D7Q A;  5KGU A;  4QIW B;  5EPJ A;  3W3A A;  2JA7 B;  4DF7 A;  3HOU H;  1Y8O B;  1HA5 A;  2OXP A;  3BVM A;  1LAB A;  2NVY H;  1GUW A;  5CGK A;  3GTQ B;  4V0B A;  1DZ1 A;  4EX5 A;  5CMD A;  3VYR A;  2OTJ A;  4JI6 Q;  4ZUI A;  4PMW A;  1F9S A;  4DUY Q;  4JBW A;  1D1I A;  1B53 A;  5ELE A;  3P75 A;  2KEE A;  4LF5 Q;  2AQ3 B;  3SXH A;  1O7I A;  4KHP L;  1I50 H;  3HKZ G;  2YTY A;  4R9W A;  1KNE A;  1TR5 A;  2K5H A;  4O2D A;  1OXT A;  1YZ6 A;  2QA4 A;  5AJ3 Q;  1IZ6 A;  1PA6 A;  1ILP A;  2XRS D;  2K28 A;  1ENF A;  3SR1 A;  3BDO A;  1QZH A;  3HOW H;  3HS0 C;  2BE5 D;  4DNI A;  4K5W A;  1R9T B;  2JE6 I;  2B29 A;  2WIN B;  4A75 A;  5EKK A;  3GTK B;  1Z6H A;  1OXV A;  3GTG H;  4KY7 A;  1STB A;  3RNU A;  4AIM A;  2UU9 Q;  2MNA A;  2A6E C;  5CV5 A;  2X6G A;  4WJ3 M;  1EYG A;  2PZT A;  1E22 A;  4GS3 A;  1KRS A;  5CV7 A;  3KUP A;  4A3F B;  3RD4 A;  1HUM A;  4YIJ A;  3T1Y Q;  5JJK A;  2F4I A;  2KHI A;  1BF4 A;  2PQA B;  3NWT A;  5EGT A;  1PZJ D;  1TS3 A;  4QMG A;  4ZRZ A;  1IBL L;  1PZI D;  3CPW A;  2N88 A;  4HCE A;  1KHI A;  2N55 A;  3OW7 A;  3Q24 A;  4BY1 H;  2SNS A;  2DNC A;  2UUC L;  5IP9 G;  3M7N A;  3KK7 A;  1PTO C;  3A8J E;  1EY9 A;  2AWN A;  4LNQ A;  1TWH B;  1JWU D;  3PO3 H;  2P5Z X;  1QVC A;  1E7Z A;  2IPK D;  5FKA C;  1TWC H;  4TKO B;  1R4P B;  4IOC A;  1VF5 C;  4HJ5 A;  3IRB A;  3L2P A;  1WD0 A;  3F2U A;  3OTO Q;  1JB7 A;  4BBS B;  1XYI A;  1SNP A;  4M1U B;  3SHL A;  4MTN A;  2EOT A;  1BR9 A;  3KYH C;  4IUV A;  1D5M C;  1UE5 A;  3ULJ A;  3S2H H;  5C0X H;  2VY3 A;  4U67 3;  4A3D B;  1SJE D;  3PCO B;  4J6H A;  4H7B A;  4F88 A;  3S1M H;  4DR6 L;  1EZ6 A;  2DY7 A;  1HZC A;  1Q3L A;  1YJW A;  4JI8 Q;  4I65 A;  5D3D A;  3I70 A;  5M3M G;  2UXD L;  1EFW A;  3BZK A;  1VQE A;  1DYQ A;  3RLO A;  4KHZ A;  2NZH A;  5CBE E;  5M5W H;  1EEI D;  1B50 A;  3GTQ H;  2UUB L;  2L4N A;  2R7Z H;  1GO3 E;  4DV0 Q;  5K5P A;  4DUY L;  1PRT B;  2XSC A;  3LWU A;  1RHP A;  1K8A C;  5M3F H;  3I4M G;  5CV6 A;  2MP1 A;  1OXX K;  4NDX A;  2J0T D;  4DV1 L;  1UEA B;  2LKV A;  1EY4 A;  2N78 A;  4ZYS A;  3QOL A;  4A4I A;  1PH9 A;  1HTP A;  1N36 Q;  2C5C A;  4KMU C;  4K6L A;  4ODG A;  1SMY C;  2ZTD A;  1YNN D;  3NBH B;  4K5V A;  4P72 A;  1PH3 A;  3K7U C;  1UWV A;  3TP5 A;  1JOQ A;  1ZYR D;  1IW7 C;  2C9O A;  2RKS A;  3P20 A;  5FLM G;  3NPP A;  3LNN A;  2EJF C;  5C4X H;  3S2D H;  4IFD J;  5M3M H;  1OTC A;  3K6O A;  4A3G G;  3EVQ A;  3MXN B;  4WRD A;  4FF1 A;  4LUO A;  2EYM A;  3UDI A;  1YVC A;  5IGE A;  2PNR C;  1X3G A;  4V19 0;  4FO2 A;  1CT1 D;  5IT9 E;  1C9O A;  4LK1 C;  2I5M X;  2J7Z A;  3HEJ A;  2JN4 A;  1EIF A;  2AQ1 B;  2MO0 A;  1XJV A;  3TS0 A;  1Z7T A;  1QWY A;  4QJF A;  4BBR G;  4B3R Q;  3GTL H;  2WII B;  4IZ8 A;  3RN2 A;  3NHH A;  2Y0S G;  3SK8 A;  2WV6 D;  1F9Q A;  5KIX A;  2XGT A;  3K81 C;  3PQI A;  1R4Q B;  4X65 Q;  5C44 H;  1LT6 D;  1VQ5 A;  4FVM A;  4ME3 A;  5IP9 H;  1B8A A;  4P75 A;  2FFK B;  4JI0 Q;  1Y1W H;  1OO9 B;  1SYG A;  3Q0A A;  1KNA A;  3A8I E;  1B70 B;  5LMU Q;  4KJO A;  2JA7 H;  1I94 L;  3GV3 A;  1NMG A;  4R8I A;  3HGB A;  1G29 1;  2I46 A;  1WJJ A;  1RIP A;  1HNX L;  1GKH A;  2E2J H;  4QQB X;  3R2T A;  2XWJ B;  4DPG A;  1CUK A;  2JYO A;  3AQQ A;  2AKW B;  1Q86 C;  3NUC A;  2EIF A;  3J81 j;  3I4N B;  3PUY A;  4WJW A;  4OL7 A;  1S72 A;  4I7Z C;  1B4O A;  3GTM B;  1Z9F A;  4DV0 L;  2JA5 H;  5J3B A;  1WVL A;  5IYB G;  1VQ7 A;  1VQK A;  3HOW B;  4C3H H;  1Q90 A;  3KLS A;  1H9M A;  3OOC A;  5BR8 L;  4IUR A;  2E2I B;  1EYA A;  4ZAI A;  2G9H D;  1K83 B;  3GTO H;  1PRT F;  1EOV A;  5I6Y A;  1LTL A;  4JOI C;  3K80 C;  1Y1V H;  3GDE A;  1QNK A;  3X3M A;  1EOT A;  1K0R A;  2NTS A;  2ICE C;  4GN4 B;  1VQD A;  1YIT A;  2B63 B;  2JP1 A;  4DR4 L;  4IPH A;  4JC0 A;  5DEH A;  2QKI C;  4OHJ A;  5FK9 C;  3SK6 A;  1GUG A;  1BCP D;  2B2T C;  3VYT A;  4EQ5 A;  1JOR A;  3MA2 B;  1GUN A;  5JEA J;  1I6H H;  4LWC A;  4A3K B;  4ZUJ A;  2WAQ G;  1PH5 A;  3JAM E;  4LF6 L;  3GTP H;  1JJ2 A;  2PPB C;  1JB3 A;  2CQO A;  3I56 A;  2CKZ B;  1G8Z D;  5IGD A;  2F0M A;  3T1H L;  1IKM A;  2MPM A;  3ULL A;  1U4P A;  1GJX A;  1Q81 C;  1TT2 A;  1PFM A;  2EJM A;  1KLU D;  3H0G G;  1A63 A;  2L55 A;  4BBS H;  3IAY A;  3TEH B;  3I4N G;  2F0N A;  4A3K G;  2J4X A;  5I9P A;  1SNO A;  5C44 B;  2G5D A;  1NY4 A;  3L7Z C;  3AFP A;  2Q2I A;  3R8B A;  3U9O A;  4QUC A;  1MJE A;  4UP8 A;  3HOZ G;  4G57 A;  3HZX A;  3MEF A;  3JAM c;  2JK8 A;  2B63 G;  3DUZ A;  4M8A A;  1TKW B;  3SK4 A;  3J81 L;  1E1O A;  1UE1 A;  1HFG A;  2XIW A;  1SBB B;  2MO1 A;  1XWE A;  1TQO A;  3PUZ A;  1M90 C;  2EVB A;  2C35 B;  4IUP A;  1QZG A;  2OEO A;  4DR5 L;  4LF4 Q;  2VS1 A;  1HZB A;  1C0A A;  2F0V A;  3GO5 A;  3PGZ A;  1TWA B;  1KLG D;  4C3J B;  1ENC A;  3I3C A;  1JC7 A;  1T5E A;  2CQA A;  2NTT A;  1EY0 A;  2Y0S B;  4TRD A;  5H1S E;  4P74 A;  3CMA A;  1PYB A;  3VA5 A;  3F2D A;  1HQM C;  1YNX A;  1VQ6 A;  1U4M A;  4POF A;  4DK1 A;  4KHV A;  3SEB A;  4ZKB B;  1CKN A;  3QG1 A;  2NVX H;  4JW0 A;  1GXD C;  1TU2 B;  4LFB Q;  2XTI A;  1QUQ B;  5E4X A;  4AYB G;  1JQY D;  1GVP A;  1UAP A;  4DV5 L;  3CAM A;  3S24 A;  2NB0 A;  4KD4 A;  1DGS A;  3NSW A;  3RN5 A;  4IPG A;  2B63 H;  5IT9 L;  2RDG A;  2AHO B;  5ELB A;  5M3M B;  1MIU A;  2IW3 A;  2KOL A;  2NN6 G;  1HQR D;  5EBC A;  3J80 L;  1S5B D;  1PFB A;  3AYH B;  4DXG A;  3VR5 A;  1VQ8 A;  4UDU C;  2VQF Q;  4RHS A;  4GNX C;  3BG3 A;  2EYJ A;  2V4D A;  2RCF A;  3RLN A;  1Q1B A;  2L1B A;  3MXN A;  3M4O H;  1N9W A;  3IKJ A;  1J6Q A;  3CCR A;  3GTP B;  2RSO A;  5M5W B;  1HNW L;  2JJQ A;  1RTO A;  4C2M H;  2DN8 A;  4C3I B;  3CME A;  5ELC A;  3SVM A;  4JI6 L;  3S14 H;  1BO0 A;  2A69 C;  1ESR A;  2M9V A;  4ME5 A;  4ZKC B;  1TII D;  1IYU A;  2M2L A;  1M1K C;  2B2Y C;  4ILW A;  1F2L A;  2WAC A;  1STE A;  2N3S A;  4HSP A;  1X3P A;  5G3L F;  1Y14 B;  2WAQ E;  1HHV A;  1Y1W B;  5C4Z A;  1NUC A;  4NPS A;  1LTT D;  2EYL A;  2FMC A;  1D2B A;  4HCS A;  3L0O A;  1WFQ A;  5GQO A;  2LY7 A;  2H1E A;  3C46 A;  3OMC A;  3NEM A;  1KAW A;  3G71 A;  5M5X H;  5A35 A;  1J5E Q;  1LUZ A;  1TS5 A;  2YV5 A;  2R93 B;  1IHZ A;  3F2C A;  1VQM A;  5C3E B;  3B6Y A;  3K7A H;  5DNF A;  2BOS A;  2MFI A;  3V96 A;  3K5M A;  3H0G B;  1X9N A;  3RMH A;  2QEJ C;  1PH6 A;  1IYV A;  1WCM B;  1J8I A;  4A3I G;  2VL6 A;  1EL0 A;  4TQU S;  3SE0 A;  4LF4 L;  1X54 A;  3JC6 6;  3MTS A;  4QY7 A;  2O5J C;  3EIV A;  3UI2 A;  5IWA Q;  3DHQ A;  2EZV A;  5IGG A;  3RZD H;  4A3C H;  1BQQ T;  2RDH A;  3A54 A;  3VR4 A;  1F2M A;  2VB3 X;  1SSO A;  4QF4 A;  2OQ0 A;  4JPB W;  1VQI A;  5JAV A;  3ER0 A;  3GTO B;  3PF5 A;  3ERS X;  1KDC A;  4O0A A;  5JEA H;  4X62 L;  1Q1E A;  4IPC A;  4OWW B;  5K36 G;  3I4L A;  5BR8 Q;  2Q8T A;  3HRZ C;  2K32 A;  1SDF A;  3OMG A;  2OF1 A;  2BDN A;  1RCV D;  1LLR D;  4ZQ3 A;  4LFC L;  3TN2 A;  2OWO A;  3KF6 B;  4QB4 A;  2VQF L;  4GN3 B;  3X3N A;  3STB C;  1FGB D;  5KYI A;  3NP8 A;  1JJC B;  3KLR A;  1QVF A;  4TSS A;  1JMC A;  2BH8 A;  4KK7 A;  5KND A;  1XXG A;  5GRO A;  1BUV T;  5GAH C;  3M4O B;  4OGQ C;  1HXY D;  1YEZ A;  4JI1 Q;  4AYB E;  2X6L A;  3MEH A;  2E2J B;  4FXD A;  3QB3 A;  1HZA A;  2JA6 B;  3HOW G;  1SNC A;  1NR2 A;  4YWK A;  2WFW A;  1CFM A;  3N6R A;  4C3I H;  1ET6 A;  4A93 G;  4GKJ Q;  4A93 H;  4AYB B;  3H94 A;  5E3F A;  4GNX A;  3W5O A;  5LL6 X;  2IY5 B;  3GTM H;  2F0D A;  2LMC B;  1IKL A;  1L1O C;  1VQH A;  5C3E G;  4YWM A;  5T1I A;  3UDX A;  1BNZ A;  4IN3 A;  1WCM G;  2VW9 A;  1V1O A;  1A3T A;  1CK1 A;  1C4Q A;  1F9P A;  4C3H B;  3VYU A;  1BCP B;  1TVX A;  3V05 A;  1HNZ L;  1CKO A;  2Q2U A;  5ISR A;  1DJR D;  4B08 A;  1K83 H;  4R4T A;  2FMM A;  2PQA A;  4DR3 L;  1LAC A;  3CC4 A;  1BBU A;  5K36 H;  2HHH L;  3I72 A;  2QGQ A;  2GN5 A;  1S3O A;  4MTK A;  1L0X B;  1YJN A;  4OIJ A;  2ATW A;  2OT2 A;  3CRK C;  1LYL A;  5M5X B;  3CCU A;  1TWA H;  2Y0S E;  2VXW A;  2EE1 A;  3H0G H;  3EBE A;  2VQE Q;  5T1G A;  1I6H B;  1EYD A;  2R6G A;  3KDF A;  4S3S A;  4A3K H;  3I73 A;  4B3T L;  5C0X J;  5IT9 c;  4C3I G;  3NK9 A;  4BBR B;  1JE5 A;  2K33 A;  1IXR A;  1GUS A;  1LTB D;  2K05 A;  3ND9 A;  4P71 A;  4RH6 A;  2HQE A;  1PTO F;  1WD1 A;  1EZ8 A;  1CZW A;  1TWG H;  2N8N A;  1B2T A;  5M9O A;  1EQR A;  4JK1 C;  3WOF A;  4HJA A;  4K14 A;  1LO5 D;  2VB2 X;  3TZU A;  4A3G B;  2A19 A;  2PO4 A;  1AZP A;  3WWV A;  4NXN Q;  3HOU G;  4DV3 L;  1G2T A;  1SE3 A;  1YNJ C;  1AN8 A;  3PUV A;  2Z6K C;  4DAY A;  3HOZ H;  3DEO A;  3IL8 A;  3KF8 B;  3PIP 3;  1BVS A;  1E24 A;  2LFN A;  3I4O A;  4JCV E;  1FL0 A;  5FOB B;  3HOU B;  4X64 L;  2M00 A;  1K73 C;  4RAU C;  4K0K L;  5IE8 A;  1VQC A;  2EDG A;  4BA1 I;  4BS9 A;  1QVG A;  1C48 A;  4X3K A;  2Q8R E;  4A3D G;  2O5I C;  1HUN A;  1IBK Q;  2ZXP A;  4DV6 Q;  1A15 A;  2JEA I;  3FP9 A;  1HNW Q;  1O7L A;  2F0F A;  4HID A;  1WTH A;  1SMX A;  1XMO L;  1PV4 A;  4DV2 Q;  1HJP A;  2B8F A;  2I5H A;  4FP5 D;  2KHJ A;  1A0I A;  3J7A V;  4QIW E;  4H13 C;  4OO1 G;  3U9S A;  5BN3 A;  3MXU A;  4NKL A;  4KI0 A;  1R9T H;  3EA6 A;  2I07 B;  3KDF B;  2QCP X;  1GD7 A;  4CDC C;  3M3Y B;  1Y8N B;  3DM3 A;  2FXQ A;  1LV9 A;  5G3L D;  4XYQ A;  3MAQ A;  1I5F A;  4KV6 A;  3I2Z A;  4LFB L;  1RF2 D;  1E0B A;  1JOK A;  3GTG B;  4PNY A;  1BCP C;  1MI2 A;  5E7N A;  3K58 A;  5JVH 3;  3T13 A;  3HKS A;  1PTO H;  1K0S A;  4KKU A;  1MBY A;  1CM9 A;  1S4Z A;  3CQZ B;  3BS1 A;  4OON A;  4EQO A;  4PMB A;  4CJ0 B;  3VR2 A;  1BOS A;  4A3B B;  3M85 A;  1NSN S;  1SND A;  1WCM H;  4NXM Q;  3R2I A;  1XTC D;  2HIV A;  1AW7 A;  2Z0S A;  1C8C A;  3BU2 A;  5JJL A;  3JAM L;  2QF7 A;  4GLA C;  2CVR A;  5CV9 A;  3FKI H;  1HFN A;  1FYC A;  1AE2 A;  2F0J A;  2IWH A;  3I55 A;  4XIG S;  3HKZ B;  1L1O A;  3F8T A;  1KQS A;  2KBN A;  3FHW A;  2CH4 A;  3A56 A;  1JWM D;  4LW1 A;  4NXN L;  3D6W A;  4A3G H;  1A2T A;  2QEX A;  2Z4H A;  4JBJ A;  1VQA A;  1KAA A;  2K03 A;  2KCC A;  3PUW A;  4JI7 L;  1CKM A;  3S2H B;  4I7A A;  4C1N K;  4A3E G;  3Q8D A;  2EYF A;  3CHB D; 
#chains in the Genus database with same CATH homology
 1S40 A;  4EQ5 A;  1PH8 A;  4ALP A;  4DR2 L;  4H02 A;  5JEA J;  4DV4 Q;  1WOC A;  4DR1 L;  1Y1V G;  1I6H H;  4LWC A;  4JV5 L;  3UDG A;  4R4C A;  4L5R C;  2WAQ G;  1EIY B;  3G6E A;  3STB D;  4YCV A;  1PH5 A;  4UP9 A;  4LF6 L;  4DV5 Q;  2IX0 A;  2PI2 E;  4JI4 L;  2JA8 H;  1JJ2 A;  3GTP H;  4UY8 C;  1PFS A;  4IJL A;  2CQO A;  5DLQ E;  2JA6 H;  3I56 A;  4JI2 L;  2CKZ B;  3FKI G;  4DR7 L;  1BBW A;  1A8V A;  1U5K A;  2NVQ H;  3T1H L;  5LMN W;  1W2B A;  1J5E L;  3ULL A;  1MKH A;  1X56 A;  3NEL A;  5IP7 H;  1Q81 C;  2UXC Q;  5C0X I;  1X3F A;  4HJ8 A;  4DR4 Q;  4DAM A;  4B3S L;  3PIP A;  1N36 L;  2VUM H;  3GTK H;  1L2F A;  5ELO A;  3H0G G;  1A63 A;  2JA9 A;  4BBS H;  5IYB H;  3CC2 A;  4OX9 Q;  3TEH B;  3I4N G;  4A3K G;  2AMC B;  1HH2 P;  1Q8K A;  3CF5 A;  4QGU A;  3E9I A;  1NY4 A;  3L7Z C;  4MZ9 A;  4JI5 Q;  3AFP A;  3GTJ H;  2Q2I A;  4IPD A;  1JJG A;  5HY6 A;  3PV0 A;  1MJE A;  4UP8 A;  5JJI A;  3HOZ G;  3M3Y H;  1SRO A;  3KOJ A;  1C7Y A;  4RMF A;  3HFZ B;  3MEF A;  3JAM c;  1D8L A;  4LFA Q;  4DR2 Q;  2ZM6 L;  2JK8 A;  2NN6 I;  4DV3 Q;  2B63 G;  4JV5 Q;  2R93 G;  5FJ8 H;  1AH9 A;  1EUJ A;  3OYY A;  4UP7 A;  5GAG C;  4OXP A;  1E1O A;  1UE1 A;  4LUV A;  1VS0 A;  4QL5 A;  4R4I A;  2MO1 A;  1XPR A;  4A3E H;  3PUZ A;  1M90 C;  1PH4 A;  2ALY B;  4KHP Q;  2VQE L;  1V43 A;  2C35 B;  4DV1 Q;  3D0F A;  3T1H Q;  1QZG A;  5IY0 A;  4UPA A;  4DR5 L;  4LF8 L;  3CCQ A;  3CQZ H;  4LF4 Q;  3PO2 H;  2VS1 A;  4YHH L;  1HZB A;  2E8G A;  1Q82 C;  2GVA A;  1X55 A;  3GO5 A;  2F52 A;  3PGZ A;  4P73 A;  1C0A A;  3TQY A;  3I7F A;  1TXY A;  4IO9 A;  4A3B H;  2AWO A;  2B3G A;  4WJ4 A;  2DGY A;  4POG A;  1KRT A;  1VQF A;  3S1Q H;  4GKK Q;  2K5V A;  5H1S E;  4P74 A;  3J81 c;  3CMA A;  1PYB A;  3TRZ A;  3F2D A;  4DV6 L;  3S1R H;  5IYC G;  5C44 G;  2YU9 H;  4PG3 A;  1YNX A;  1EWI A;  1K8G A;  1VQ6 A;  5M5Y H;  4POF A;  1YHA A;  2MQH A;  1ASY A;  1Q7Y C;  1SR3 A;  1CKN A;  2NVX H;  4X66 Q;  3J7A 5;  1I94 Q;  3S16 H;  3HOV H;  4YCU A;  3J80 i;  4B3T Q;  3S1N H;  3CCE A;  4LFB Q;  1EQQ A;  1SN8 A;  2Q2T A;  2XTI A;  1QUQ B;  4FDB A;  4AYB G;  2UXB Q;  4PZ8 A;  4DV7 Q;  1GVP A;  4DV5 L;  1NMF A;  3AEV A;  4DUZ Q;  3CAM A;  1BKB A;  2R7D A;  3S24 A;  4GOP B;  5C4J H;  3H15 A;  1XMQ L;  4X6A H;  4IFD I;  1DGS A;  1IYJ B;  2PNH A;  2LSS A;  3RN5 A;  1PYS B;  2E5L Q;  4IPG A;  2B63 H;  1IBK L;  2AHO B;  1XNQ Q;  2ASB A;  5LMN L;  1MIU A;  4B3S Q;  3PO2 G;  1L0W A;  2NN6 G;  5JEA G;  1E1T A;  3AYH B;  3HOX G;  1N33 L;  3KJP A;  2VQF Q;  1VQ8 A;  1FJG Q;  1XNR Q;  4GNX C;  2F4V L;  2NZO A;  4JOI A;  1YHQ A;  4HIM A;  3RLN A;  2D62 A;  2ZJR A;  1Q1B A;  1YHB A;  2H5X A;  3BZC A;  1N9W A;  4GOP A;  3ULP A;  4L5S A;  2L15 A;  2RCN A;  3M4O H;  1J6Q A;  3CCR A;  5HGQ A;  4B3M L;  1UE7 A;  4GNX B;  3NEN A;  2GVB A;  1HNW L;  1PHJ A;  2JJQ A;  4JI3 Q;  3OTO L;  4C2M H;  1UE6 A;  3CME A;  2UUB Q;  5LMU L;  4JI6 L;  3S14 H;  4DR1 Q;  1B7Y B;  1XTD A;  2KCM A;  2YTX A;  1VQB A;  4X65 L;  4DV2 L;  3E9H A;  1OXU A;  2E2I H;  2N49 A;  4IOA A;  2DUD A;  3J80 c;  1CSQ A;  3I4N H;  4JI0 L;  4KLK A;  4DAY B;  2PMZ E;  1YJ9 A;  3LGJ A;  5IYC H;  1M1K C;  2KEN A;  2A1A A;  1K3R A;  2ID0 A;  2BH2 A;  3CCS A;  2UXC L;  4JI7 Q;  3K0X A;  1I3Q H;  2IHE A;  2N3S A;  5ELN A;  1Y14 B;  4YHH Q;  2WAQ E;  2OTL A;  4JBK A;  2LXK A;  1XNQ L;  4BBR H;  3U58 A;  2I5L X;  4K0K Q;  5GAD C;  4JYA Q;  1NJI C;  1KXL A;  4AQY Q;  1Z47 A;  1OXS C;  4JG2 A;  1QUQ A;  4NXM L;  2ZJP A;  3KLW A;  4NPS A;  3PO3 G;  2EQS A;  2F4V Q;  1D7Q A;  2KCT A;  3L0O A;  1WFQ A;  2ZTE A;  5GQO A;  1N34 Q;  3HOU H;  4DR3 Q;  4JI5 L;  4AH6 A;  1IBM L;  2HHH Q;  2NVY H;  3NEM A;  1PH2 A;  1NE3 A;  1V9P A;  1KAW A;  3G71 A;  4A3F G;  3HOX H;  2UUA Q;  4EX5 A;  4Y7N H;  1X65 A;  3BJU A;  5M5X H;  2OTJ A;  1J5E Q;  1LUZ A;  4YY3 Q;  2YV5 A;  4JI6 Q;  4PMW A;  4DUY Q;  2I0Q A;  4JBW A;  3F2C A;  3EN2 A;  1VQM A;  3B6Y A;  3K7A H;  1A62 A;  2MFI A;  4LF5 Q;  3H3V I;  1X9N A;  4XTC S;  2NVT H;  3CCL A;  1O7I A;  1PH6 A;  4KHP L;  1I50 H;  3HKZ G;  2YTY A;  4A3I G;  2K5H A;  3HOV G;  2VL6 A;  1OXT A;  4O2D A;  3G4S A;  2VUM G;  1FGU A;  1YZ6 A;  4TQU S;  2QA4 A;  1HZ9 A;  1VQO A;  4LF4 L;  4LF7 Q;  5AJ3 Q;  1IZ6 A;  1X54 A;  1G51 A;  3JC6 6;  3KF6 A;  4QY7 A;  4JI1 L;  3EIV A;  1PA6 A;  5IWA Q;  4BBS G;  1QZH A;  3HOW H;  1PVO A;  1UEB A;  4R4O A;  4DNI A;  3RZD H;  1AE3 A;  2JQO A;  2EXD A;  2CFM A;  4BA2 I;  2WB1 G;  4BXX G;  4A3C H;  4A76 A;  1CSP A;  4J15 A;  2JE6 I;  1MJC A;  2ZM6 Q;  2B29 A;  2OQ0 A;  1VQI A;  2JEB I;  3ER0 A;  2K4K A;  1TWF H;  4A75 A;  3PF5 A;  2RHS B;  1XPO A;  3ERS X;  4JI4 Q;  1VQL A;  1OXV A;  4O0A A;  3GTG H;  3CP0 A;  2D0O A;  3RNU A;  4AIM A;  4X62 L;  2UU9 Q;  2MNA A;  1KC8 C;  1Q1E A;  4IPC A;  4GOP C;  4OWW B;  5K36 G;  1HR0 L;  4YCW A;  3HKZ E;  5BR8 Q;  3PF4 A;  1XMO Q;  1EYG A;  4WJ3 M;  2JA8 G;  1E22 A;  4GS3 A;  1N32 Q;  3E0E A;  1KRS A;  4HIK A;  3UDF A;  3AFQ A;  4DV7 L;  1GM5 A;  3HOY H;  4LFC L;  3T1Y Q;  3KFU A;  5JJK A;  2KHI A;  2OWO A;  4IFD G;  4B3R L;  3KF6 B;  2PQA B;  4DR7 Q;  1HNZ Q;  2VQF L;  4GN3 B;  2WB1 E;  3STB C;  1WYD A;  3M4Q A;  1IBL L;  3CPW A;  2V1C C;  1JJC B;  1QVF A;  1KHI A;  3S17 H;  1JMC A;  2BH8 A;  4BY1 H;  3TRE A;  3A74 A;  3M7N A;  5GRO A;  5IP9 G;  3VDY A;  5GAH C;  2UUC L;  1YEZ A;  4AYB E;  4JI1 Q;  3K8A A;  2AWN A;  4BXX H;  4LNQ A;  3PO3 H;  1HZA A;  3HOW G;  4YWK A;  3GD7 A;  4A3J H;  2WFW A;  5FLM H;  4C3I H;  1QVC A;  1E7Z A;  1FVI A;  4X66 L;  4A3C G;  4A93 G;  1TWC H;  4IOC A;  1SFO H;  4GKJ Q;  4A93 H;  2BA1 A;  3A0J A;  4GNX A;  4HJ5 A;  3W5O A;  3IRB A;  3L2P A;  4C3J H;  4B3M Q;  3CC7 A;  4A3B G;  1PH1 A;  1SE8 A;  5EAY A;  2UU9 L;  4A3L G;  2IY5 B;  3OTO Q;  1JB7 A;  3GTM H;  5C3E G;  1L1O C;  1VQH A;  1VCI A;  5IYD H;  4MTN A;  4YWM A;  2OCE A;  1X3E A;  3KJO A;  3KYH C;  4APV A;  3UDX A;  1UE5 A;  3ULJ A;  2ZJQ A;  4BY7 H;  3S2H H;  1WCM G;  3CD6 A;  2VY3 A;  5IP7 G;  2VW9 A;  3OW2 A;  2CWA A;  3J7Z C;  4JYA L;  3PCO B;  3DLL A;  3S1M H;  4DR6 L;  1L1O B;  1HZC A;  1N33 Q;  1HNZ L;  3U4V A;  1CKO A;  2Q2U A;  3SGI A;  3M9B A;  1YJW A;  4OX9 L;  4JI8 Q;  1SLJ A;  1K83 H;  4R4T A;  1ASZ A;  2PQA A;  4DR3 L;  5M3M G;  3CC4 A;  1BBU A;  2UXD L;  5AJ3 L;  1EFW A;  1JT8 A;  3BZK A;  1IBM Q;  2HHH L;  1VQE A;  2QGQ A;  2GN5 A;  3RLO A;  4KHZ A;  3UE0 A;  2NZH A;  1S3O A;  5M5W H;  3GTQ H;  1YJN A;  3U4Z A;  2ATW A;  2K75 A;  2UUB L;  4HIO A;  2R7Z H;  1GO3 E;  1LYL A;  3CCU A;  4DV0 Q;  3W1B A;  1XPU A;  3H3V H;  4DUY L;  1HR0 W;  1SRU A;  1TWA H;  2Y0S E;  1VQJ A;  1KD1 C;  5C4X G;  1K8A C;  5M3F H;  4OWX B;  3H0G H;  1VQP A;  3I4M G;  1OXX K;  3EBE A;  2VQE Q;  4DV1 L;  4NB3 A;  1NTG A;  2N78 A;  2UUA L;  2R6G A;  3KDF A;  4PZ7 A;  4A4I A;  4YY3 L;  4DV4 L;  4DR5 Q;  4A3K H;  1PH9 A;  4B3T L;  3TS2 A;  2LXJ A;  2F3I A;  5C0X J;  4LF9 L;  3ICE A;  2RF4 A;  5IT9 c;  4BY7 G;  1N36 Q;  4DKA C;  4LF6 Q;  4RG1 A;  1JE5 A;  3T1Y L;  1HNX Q;  4LFC Q;  1IXR A;  4P71 A;  2ZTD A;  1IBL Q;  1Q12 A;  3F2B A;  2R92 H;  5M3F G;  3NBH B;  4JI8 L;  3I4M H;  4DK6 C;  4GKK L;  2VNU D;  4P72 A;  2K50 A;  1TWG H;  1PH3 A;  2N8N A;  3K7U C;  3A5U A;  1V1Q A;  1IL2 A;  1EQR A;  1UWV A;  5IWA L;  4HJA A;  4DK3 C;  5FLM G;  3PUX A;  2R7Z G;  2PI2 A;  2A19 A;  1HR0 Q;  3WWV A;  4NXN Q;  1XNR L;  2IX1 A;  3HOU G;  1W3S A;  4DV3 L;  4HJ7 A;  5C4X H;  2R7F A;  4GKJ L;  3S2D H;  2HQL A;  4IFD J;  3PUV A;  1N34 L;  2Z6K C;  5M3M H;  1OTC A;  4A3G G;  3MXN B;  4GLX A;  4LF5 L;  3HOZ H;  4LUO A;  4L5T A;  4JBM A;  3KF8 B;  3UDI A;  1Y1W G;  1YVC A;  2HIX A;  1BVS A;  1E24 A;  1X3G A;  5FJ8 G;  3I4O A;  1U0L A;  2IT1 A;  4JCV E;  1C9O A;  1FL0 A;  1N8R C;  2I5M X;  1N32 L;  2Q2H A;  4X64 L;  1EIF A;  1K73 C;  1VQN A;  4K0K L;  2MO0 A;  1XJV A;  5IE8 A;  4A3M G;  1VQC A;  3TS0 A;  2RHQ B;  1YI2 A;  2ZTC A;  4B3R Q;  4QJF A;  4JI2 Q;  4BBR G;  2E2H H;  4BA1 I;  3CCV A;  1FJG L;  1H95 A;  2BA0 A;  3GTL H;  1QVG A;  1VQ4 A;  3M4P A;  3JAM i;  4A3D G;  3CPF A;  1IBK Q;  4DV6 Q;  3RN2 A;  5FLX c;  1VQ9 A;  5C3E H;  2JEA I;  1KL9 A;  1RL2 A;  2CWP A;  1P8L A;  2Y0S G;  3FP9 A;  1HNW Q;  3CXC A;  1E3P A;  1T9H A;  1VQG A;  4HID A;  4OO1 I;  1X6O A;  2XGT A;  3K81 C;  4LFA L;  1SMX A;  4A3M H;  1XMO L;  1PV4 A;  4X65 Q;  4DV2 Q;  5C44 H;  1HJP A;  4A3I H;  2I5H A;  1VQ5 A;  2KHJ A;  3S15 H;  1A0I A;  4ME3 A;  3U50 C;  1B8A A;  5IP9 H;  2JA5 G;  4P75 A;  4QIW E;  4OO1 G;  4JI0 Q;  4A3F H;  4R4Q A;  1Y1W H;  4DUZ L;  4DR6 Q;  4KI0 A;  1R9T H;  1XMQ Q;  3KDF B;  3HOY G;  1GD7 A;  2Z6K A;  2ES2 A;  3RR5 A;  2JA6 G;  1Q46 A;  2HT1 A;  3DM3 A;  1B70 B;  2FXQ A;  5LMU Q;  2A8V A;  2E5L L;  4OWT B;  1I94 L;  1CKN B;  1I5F A;  1NMG A;  4LF7 L;  2JA7 H;  4HJ9 A;  3I2Z A;  5LMN Q;  4LFB L;  2UXD Q;  1G6P A;  3A5Z B;  3F1Z A;  4Y52 H;  1G29 1;  2K5N A;  4BY1 G;  1WJJ A;  2K14 A;  2WP8 J;  2YTV A;  3PSI A;  3G48 A;  2IHF A;  1RIP A;  3CCJ A;  5E7N A;  1GKH A;  1TWH H;  1HNX L;  2E2J H;  3RZO H;  4QQB X;  4R1J A;  3RLF A;  4DPG A;  3J81 i;  1KIX A;  3HKS A;  1CUK A;  3AQQ A;  2AKW B;  1Q86 C;  2CCZ A;  4IJH A;  1YBY A;  4OON A;  1PH7 A;  1P16 A;  3W1G A;  2EIF A;  3CCM A;  3J81 j;  1NBW A;  2VZA A;  2JA7 G;  3PUY A;  4X62 Q;  3M85 A;  1S72 A;  4AQY L;  1WCM H;  3D31 A;  3ZJY C;  2YYZ A;  5C0X G;  4NXM Q;  1Z9F A;  4A3L H;  2OQK A;  4TVA B;  2HIV A;  4DV0 L;  2JA5 H;  2Z0S A;  5IYD G;  4LF9 Q;  5J3B A;  5IYB G;  1VQ7 A;  3BU2 A;  1VQK A;  3CW2 C;  2R92 G;  5GAE C;  4A3D H;  5JJL A;  4GN5 A;  4C3H H;  4GLA C;  4MNO A;  3PIO A;  4A3J G;  3FKI H;  1AE2 A;  5BR8 L;  4LF8 Q;  3I55 A;  4XIG S;  4YWL A;  3GTO H;  4GLV B;  4X64 Q;  3UE1 A;  1EOV A;  1L1O A;  2K52 A;  3F8T A;  1LTL A;  4LUZ A;  1YIJ A;  4JOI C;  2KBN A;  1KQS A;  2UXB L;  3K80 C;  1WI5 A;  1Y1V H;  3FHW A;  3GDE A;  1K0R A;  4PZ6 A;  4A3G H;  4LW1 A;  4NXN L;  2QEX A;  4GN4 B;  4JBJ A;  1VQD A;  1YIT A;  1VQA A;  3PUW A;  2R93 H;  4JI7 L;  1CKM A;  4DR4 L;  1LM0 A;  4IPH A;  4JC0 A;  1K9M C;  2UUC Q;  2D0P A;  4A3E G;  3Q8D A;  4JI3 L;  4L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...