4LF4Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf4Q00
4JI8Q 4APVA 1TWGH 2RCNA 2ZTCA 3VDYA 1SMXA 4GN5A 2C35B 2Y0SE 1L0WA 1X6OA 4POFA 4A3MG 2LXJA 1IBLL 4PZ8A 1VQHA 4XIGS 3L2PA 3FKIH 3CC2A 1Z47A 5HGQA 3I55A 4YY3L 5IP7G 4AIMA 1I3QH 4IO9A 3OW2A 1VQ4A 3K81C 2JJQA 1BBUA 4P71A 1R9TH 1SE8A 4OX9L 1Q86C 2WB1G 1K73C 2UXBL 4UPAA 2JE6I 3PO2G 1Q46A 4JI3L 1YITA 3PO3G 1QVCA 1DGSA 3KDFB 2V1CC 1YJ9A 1JJGA 3EN2A 3PIPA 2JA8G 2KCMA 5HY6A 1N34Q 2E2HH 1L2FA 4DV1L 1MIUA 3I4MH 3CPFA 1Y1VH 2RHSB 4GLVB 2ZM6L 1SR3A 1YEZA 2B29A 1XMQQ 1VQNA 1AH9A 5C44G 4HIMA 2BH2A 5IYBH 4RMFA 4YWLA 4A3GG 2R6GA 3RNUA 1LYLA 4NB3A 2CQOA 5FLMH 1IBKL 1QUQA 1HZCA 2N78A 4XTCS 2L15A 5EAYA 3G6EA 2KCTA 3CCVA 3G48A 2OWOA 5IYDG 4JV5L 1PHJA 2E8GA 4HJ9A 1I6HH 3M7NA 3PUYA 4DV6L 1PV4A 1OTCA 2AKWB 1XPRA 3HOYH 1K9MC 3CW2C 1G6PA 2NN6I 5JEAJ 1IBLQ 1VQ8A 1OXXK 5IP9G 3JAMi 5IWAL 4WJ4A 2JA5H 4LUVA 4JBJA 1W3SA 4YY3Q 4A3FH 4JI1L 4OX9Q 4HJAA 3CCEA 4DNIA 3ER0A 1I50H 1V43A 2UUBL 5IE8A 2K4KA 1PH7A 2UXBQ 1XNQL 2AMCB 1WOCA 4DV0L 1X3EA 2K50A 2XTIA 1YJNA 4OO1I 1S40A 4JI3Q 3CCQA 3CPWA 2HIVA 4BBRG 2LXKA 4C3IH 1XPOA 3UE1A 4A3EG 3HOWG 3J7ZC 1NE3A 1X9NA 1HNXL 2JA7G 4DR2L 4DV1Q 1KHIA 2CFMA 2PI2E 5M3FG 3HOVG 2B63G 2ZM6Q 1EFWA 4X62L 3H0GH 3NEMA 4B3TL 1Q8KA 3M4OH 2N8NA 4A3CG 1NMGA 1E1OA 4A3DH 3HOZG 5M5XH 1HJPA 1VQ5A 2PNHA 2WFWA 2OQKA 3F2DA 1PYSB 1IBKQ 1HZBA 4LF8Q 1C0AA 2F4VL 1VQLA 2KHIA 5FJ8H 2A19A 2MO1A 4QL5A 3RLNA 4JV5Q 5JJKA 3GDEA 4DV6Q 4BY1H 3KF8B 4AH6A 3F1ZA 1QVFA 3S2DH 3NENA 3WWVA 1A63A 4JC0A 5GADC 4LUOA 4A93G 4DV2L 5M3MH 4JI0L 4BXXG 4BA1I 5LMNW 3ULLA 1P16A 3DM3A 2NZHA 5IWAQ 5C4XG 3BZCA 1EWIA 4JI1Q 2YU9H 2MQHA 1MJCA 2Z6KA 2UUBQ 3UDFA 1XNQQ 4DV0Q 1XMOL 2B3GA 3L7ZC 2VUMG 4A3LG 2ES2A 2BH8A 3PUXA 4LF9L 2R7ZG 1VQ6A 4A3JG 1GVPA 3STBD 2Z6KC 1N32L 3UDGA 2R7DA 1Q12A 1VS0A 1YZ6A 2H5XA 3E9HA 4EX5A 1HNXQ 4DR2Q 5GQOA 1CSQA 4A3MH 4POGA 2IX0A 1T9HA 5IYCG 3HFZB 3NELA 4JI4L 3CCSA 1S72A 3JAMc 4ME3A 5IP7H 1GO3E 3UE0A 4X62Q 1X54A 3CQZH 2BA0A 3IRBA 4PZ7A 2K5NA 3W1GA 4AQYL 4YWKA 4B3TQ 2R92G 4BXXH 3PIOA 1HR0L 1JJCB 1Y1WG 2K75A 2E2JH 2OCEA 3PO2H 1X65A 1PH2A 2K5HA 1L1OA 2F4VQ 3PO3H 2I5MX 3KF6A 4Y52H 2AWOA 4JI5L 2ASBA 2ATWA 1PVOA 2JA8H 2WB1E 4R4TA 5J3BA 1VQPA 4DV2Q 1L1OC 1WCMG 3B6YA 3KJPA 4HIOA 4JI0Q 1ASYA 5GAEC 2JEAI 2VW9A 3TEHB 5C44H 1XNRL 1PH4A 3CCUA 3GTPH 4GN4B 1IL2A 3TS0A 1WYDA 1J6QA 4RG1A 2YTXA 1J5EL 1D8LA 2JEBI 1XJVA 2E2IH 2IHFA 4A3GH 1KXLA 1XMOQ 3STBC 3T1YL 2PQAA 3G71A 4LF9Q 3F2CA 1VCIA 4R1JA 4IPCA 1X3FA 3EBEA 4LF4L 1PH8A 1Z9FA 4PZ6A 1N32Q 2F3IA 1TXYA 4JBWA 4GNXB 3GO5A 3M4PA 5LMNL 3RN2A 5IP9H 4B3SL 4JI4Q 1BKBA 1VQEA 4KHPL 2XGTA 4BA2I 4LF6L 1K8GA 4IJLA 2OQ0A 1CKNB 4R4CA 5ELNA 4IFDG 1EQRA 1K3RA 2D0PA 4AQYQ 2WP8J 3GTJH 1HR0Q 4GOPA 2YTVA 4X66L 2QGQA 4JBKA 2IX1A 3AEVA 1OXUA 3D0FA 3CD6A 4K0KL 3CXCA 2Z0SA 4DR7L 1HH2P 4DK3C 4X64L 4BBRH 1VQAA 1Q81C 4L5SA 4JI5Q 2NVXH 1NTGA 1SROA 4A3EH 3HOWH 3PSIA 4GOPC 5C0XJ 2JA7H 1NMFA 4JYAL 3E9IA 4C3JH 1YHQA 1VQJA 3KJOA 5M3FH 1BVSA 3HOVH 5JJLA 1TWHH 4NXNL 1HZ9A 2K52A 1JT8A 1XNRQ 2K14A 1IXRA 3K0XA 3HKZG 4Y7NH 4UY8C 4A3CH 2IY5B 2Y0SG 3OTOL 1J5EQ 4GS3A 3HOZH 1Q1EA 4DAYB 2HHHL 4MTNA 3T1YQ 3BU2A 1EIYB 1CKMA 5H1SE 4HJ7A 3K7UC 1SRUA 3TREA 4HIKA 2UXCL 1SFOH 4LF4Q 1G291 4QIWE 1HNZL 3DLLA 4HIDA 1KC8C 4H02A 1HR0W 2WAQE 3CAMA 3M9BA 1PYBA 4DR4L 1FL0A 3A5ZB 5LMNQ 4B3ML 3W5OA 3L0OA 1K8AC 4B3SQ 2HT1A 1QZHA 4LF6Q 1U0LA 4KHPQ 5C4XH 1Q7YC 4LFBL 3PCOB 4DKAC 4PMWA 4YHHL 2QEXA 4BBSG 3KDFA 3CCLA 2DUDA 2ZTEA 4X66Q 4A3LH 4IJHA 4A3IG 4MZ9A 1YVCA 2NN6G 3UDIA 3J80c 3CMAA 4JG2A 1EQQA 4A3JH 2R7ZH 4DR7Q 4K0KQ 4AYBE 4X64Q 4DR1L 1JMCA 3RZDH 1GD7A 2UXDL 2R7FA 4QJFA 3CCRA 4JYAQ 4R4IA 1CSPA 3K80C 3AFPA 4JCVE 2GVAA 3TRZA 3U4VA 2VQEL 1VQ7A 1B70B 4NXNQ 3U4ZA 1WFQA 1KL9A 4UP7A 3CCMA 1OXSC 2I0QA 1QVGA 5C4JH 3CC4A 5C0XI 4OO1G 2MFIA 1YI2A 4LF5L 3ZJYC 3GTGH 1NY4A 2R92H 1PH1A 1FVIA 3OTOQ 4DAMA 3I2ZA 4WJ3M 1Y1WH 2HHHQ 1PA6A 4IPDA 1LM0A 2VY3A 2NVTH 4O0AA 2UXCQ 3TS2A 4DV5L 1HNZQ 4B3RL 3AFQA 4OWWB 5DLQE 1WCMH 5C3EG 4DR4Q 1CKOA 4B3MQ 4LF7Q 3CP0A 3H3VI 4LFBQ 1A62A 3AQQA 4A3FG 3A74A 3PUVA 1H95A 1B7YB 3E0EA 4OXPA 4DK6C 3U50C 3I4NG 4YHHQ 1HZAA 1UE7A 3KFUA 4J15A 1AE3A 3D31A 5FLXc 5C0XG 1Q82C 4DUYL 4OWTB 1FGUA 4O2DA 3S1RH 1ASZA 4DR1Q 3OYYA 2GVBA 1G51A 2DGYA 2R93G 2UXDQ 3UDXA 3GTQH 3W1BA 1S3OA 1I94L 1UE5A 4R4QA 1N9WA 1YIJA 4BY7G 3SGIA 2AHOB 5JEAG 2D0OA 1KD1C 2JK8A 2VQEQ 3PF4A 3S2HH 3RR5A 1HNWL 1TWFH 2PMZE 3J81c 3S1NH 3A5UA 3H0GG 3PUWA 4IOAA 4LF5Q 4FDBA 4DR5L 2EQSA 4A3KG 4GKJL 4NXML 5K36G 1Q1BA 2OTJA 3J7A5 4OONA 3S14H 3HOXG 1UWVA 1OXVA 5ELOA 4JI2L 4DV5Q 1IYJB 4B3RQ 1U5KA 2OTLA 4QQBX 1VQBA 2VQFL 1GKHA 2RF4A 3J80i 4DR6L 3CCJA 3MEFA 1N36L 4L5QA 3HOUG 5IYDH 2KHJA 4YCUA 1V1QA 2NVYH 1X3GA 4YWMA 3PF5A 2RHQB 4LW1A 2ID0A 1OXTA 1QUQB 1IZ6A 2N49A 3CC7A 4C3HH 1QZGA 1PH3A 4QGUA 2ZJRA 4A3BG 4LFAL 1N33L 4DUYQ 2I5HA 2UUAL 4NPSA 2D62A 2CCZA 3FHWA 2GN5A 1BBWA 1UE1A 1KAWA 3HKZE 3M85A 1M1KC 4JI6L 4DV7L 1VQMA 1RL2A 1XTDA 2CWPA 4DV3L 1YNXA 1MKHA 4DUZL 2UU9L 4P75A 1I94Q 3EIVA 4HJ5A 3HKSA 3ULJA 3F2BA 1O7IA 1FJGL 2VZAA 3KYHC 1HNWQ 1VQFA 3S1QH 3BJUA 2MO0A 4LWCA 1GM5A 4DR3L 1EYGA 4GKKL 1A0IA 1V9PA 3H15A 4BBSH 4L5TA 4KHZA 4DR5Q 4GKJQ 1W2BA 1PH9A 3Q8DA 3GD7A 2Q2HA 4TVAB 3TQYA 4YCWA 4NXMQ 2B63H 4A3IH 4IPHA 1MJEA 3GTOH 1YJWA 1C7YA 3M3YH 2Q2IA 1VQKA 3BZKA 1KQSA 1E7ZA 1UE6A 4JI2Q 4X65L 5GAHC 4JI7L 4GLAC 2NVQH 4X6AH 5LMUL 2VQFQ 3T1HL 4TQUS 2JA6G 4DR6Q 3RN5A 2PI2A 1N36Q 3KOJA 3ICEA 2ALYB 4IPGA 3FP9A 4A93H 4LFAQ 1N33Q 2E5LL 2F52A 4L5RC 3FKIG 2UUCL 2UUAQ 3J81i 4YCVA 4GNXA 1E3PA 3KLWA 4GN3B 4JI6Q 3S24A 3K7AH 4DV7Q 1NBWA 1VQOA 4C2MH 1M90C 1CKNA 4P74A 3CF5A 4DUZQ 4DV3Q 3U58A 5E7NA 2UU9Q 2A8VA 4OWXB 4DV4L 1EUJA 5BR8L 5C3EH 4GNXC 2VUMH 1FJGQ 1UEBA 2Q2UA 3M4QA 1RIPA 2ZTDA 5M5WH 4DR3Q 4R4OA 3I4NH 4GKKQ 1WI5A 1VQIA 3LGJA 4PG3A 2HIXA 3I4MG 1Y1VG 5IYCH 3F8TA 4UP9A 1N8RC 4JBMA 4JOIA 4KI0A 4GLXA 1JB7A 1I5FA 1E22A 2KENA 3PUZA 5GROA 5IYBG 1YHAA 4X65Q 1IBML 4JI7Q 2R93H 4BY7H 5FLMG 5LMUQ 3T1HQ 1JJ2A 1TWCH 1P8LA 1E24A 2JA9A 1VQGA 4JOIC 5GAGC 5IT9c 3GTKH 1A8VA 2FXQA 1EIFA 4UP8A 4A4IA 5M5YH 4IOCA 2NZOA 1K83H 3A0JA 4P72A 3H3VH 3HOYG 5JJIA 1L1OB 1E1TA 3ERSX 5AJ3L 1C9OA 2CKZB 4LFCL 2MNAA 3CMEA 4A3KH 5IY0A 2WAQG 3KF6B 1SN8A 2E5LQ 3RLOA 2JA5G 2UUCQ 3GTMH 2YV5A 2EXDA 2IHEA 2YYZA 3S1MH 4IFDJ 3HOXH 2EIFA 2LSSA 3AYHB 1TWAH 4DV4Q 5BR8Q 1YBYA 4LF7L 4JI8L 2QA4A 1X55A 4P73A 1PH6A 3HOUH 2YTYA 1VQDA 4MNOA 4LF8L 1VQCA 2BA1A 2K5VA 2AWNA 4AYBG 2PQAB 3I56A 4KLKA 4A3BH 4EQ5A 3I7FA 1D7QA 1YHBA 1NJIC 1X56A 2Q2TA 1K0RA 3RLFA 1KRSA 2VL6A 4ALPA 3J81j 4A3DG 4HJ8A 2CWAA 1IBMQ 2ZJQA 3I4OA 1PFSA 2I5LX 3MXNB 2IT1A 2A1AA 5FJ8G 3GTLH 2ZJPA 1LUZA 4BY1G 3JC66 4GOPB 1KIXA 4LNQA 1XPUA 3PV0A 3PGZA 1N34L 1AE2A 5AJ3Q 1KRTA 2N3SA 5M3MG 3K8AA 4LFCQ 1JE5A 3RZOH 1LTLA 2JQOA 2HQLA 2VNUD 3S16H 3S17H 1XMQL 4DPGA 1PH5A 3NBHB 1EOVA 1Y14B 3ULPA 3S15H 1VQ9A 1CUKA 4A76A 1SLJA 2VS1A 3G4SA 1B8AA 4QY7A 4A75A 2JA6H 1WJJA 4IFDI 4LUZA 2KBNA
chains in the Genus database with same CATH superfamily
4JI8Q 1TWGH 1S5BD 2VB2X 3HEJA 1L0WA 4A3MG 4POFA 1VQHA 3CC2A 1Z47A 1K0SA 4KV6A 5IP7G 2RQXA 2O5JC 1VQ4A 3K81C 1BBUA 2OXPA 5A2QE 2F0SA 1BCPD 1VDZA 3GTKB 5FO8B 2KECA 3PO2G 3K5OA 1QVCA 2B2WA 3KDFB 3M7GA 1JJGA 2KJXA 1EZ6A 2WINB 5JPNC 1N34Q 1L2FA 3CPFA 3SEBA 2ZM6L 3NP8A 1NSNS 2RCFA 4PMCA 4JK1C 3CKIB 1XWEA 1CZGA 1E2ZA 4XYQA 1LTGD 3I70A 1LYLA 2N78A 3G6EA 2KCTA 3O13A 4IUTA 4JV5L 3BYYB 1SMYD 4A3BB 2AQ1B 5FK9C 1EYDA 1G6PA 1LTRD 1OXXK 2PPBC 4A3FH 4LAAA 4HJAA 3ER0A 1V43A 3D6CA 5IE8A 1PRTC 2UXBQ 2E75C 5C0XH 1WOCA 4K14A 1YJNA 2XTIA 3GTLB 4HAEA 3CCQA 4I7AA 3HOWG 3UE1A 4A3EG 5D65A 3J7ZC 2JA7G 1JORA 3S17B 4DV1Q 1KHIA 3K5NA 4KTAA 1EFWA 2HUGA 4X62L 3AMUA 3MFGA 4B3TL 3M4OH 2K5DA 3NWTA 4A3DH 1T5XD 4OHJA 1QE6A 1ONLA 1C0AA 4IUPA 1STAA 2SOBA 4ZQ3A 3VR3A 2MO1A 3RLNA 1ENAA 4DV6Q 4AH6A 1C4QA 1KNEA 2KCCA 3NENA 4A93G 4LUOA 4JI0L 4KJOA 4BXXG 4BA1I 3DM3A 2FMCA 3BZCA 4JI1Q 2WIIB 1DZ1A 1AZPA 2Z6KA 2UUBQ 3ONAB 4FO2A 1XMOL 3RMHA 4LK1C 2ES2A 4ZYSA 2R7ZG 1N32L 1EU4A 3E9HA 1HNXQ 4F7XA 1CSQA 2A69D 1ICWA 1T9HA 2IWHA 5I2YA 1S72A 3JAMc 3KK7A 4ME3A 5FLXL 3UE0A 2A6EC 2K5NA 3T4AC 2SEBD 2SNSA 1HR0L 3Q6SA 1H9JA 1I6HB 2F4VQ 3PO3H 5FOBB 1JOKA 2AWOA 1F2ZA 3NHHA 3PIO3 3J81L 1DOMA 1L1OC 2F3WA 4NDXA 3KJPA 5GAEC 4L6TB 5KRUA 1I50B 4CDFC 3TEHB 3QO2A 1PH4A 2NTTA 1IL2A 2C5CA 3TS0A 4A3GH 2E2IH 4F88A 1ICFB 4C3IB 2PQAA 2Z1CA 2RSOA 3BDCA 1EFID 3OPOA 3F2CA 4BY7B 3J7AF 5CBAE 1TXYA 4GNXB 3GO5A 3M4PA 4B3SL 5IP9H 4BA2I 5EKKA 1K8GA 3SK8A 4A3KB 5ELNA 1Z6HA 3K5MA 1EQRA 3MXNA 1K3RA 2EOTA 2D0PA 4WJWA 3S1MB 4BY1B 1K3BC 2EPBA 3CD6A 2Z0SA 1VQAA 3DUZA 1Q81C 4JI5Q 5HURA 2NVXH 4GOPC 3H91A 1J8IA 3VA7A 5C6AA 1HHVA 5DEHA 1YHQA 3VR5A 5M3FH 5JJLA 1TWHH 2YU9B 4NXNL 1D2BA 2K52A 2EE1A 1IXRA 4Y7NH 4UY8C 1G8ZD 4L63B 1QNUA 3OTOL 4GS3A 3HOZH 2HHHL 4MTNA 4CHTB 1EIYB 1CKMA 3JAME 1KABA 3TN2A 3TREA 1IYVA 4LF4Q 1JC7A 3DLLA 2X69A 2BE5D 1PTOF 1PYBA 2PYKA 4B3ML 1H9KA 4LF6Q 5C4XH 5I4DA 3PCOB 2QEXA 4BBSG 3CCLA 1UEAB 1Q3LA 1FNWA 2DUDA 5ELBA 1YVCA 2NN6G 3J80c 3CMAA 1EQQA 4A3JH 3N6RA 1FGBD 1GD7A 4KD3A 2UXDL 4QJFA 1RHPA 4JYAQ 1D1IA 2RDGA 3OMCA 1B70B 2EYLA 3RD4A 4UP7A 1CA6A 2I0QA 1OXSC 2L1BA 4LF5L 3GTGH 1NY4A 1EY6A 4FXKC 1FVIA 3I2ZA 2Z4IA 4KKSA 4RKBA 1R9TB 3C1FA 2NVTH 5IT9L 3TS2A 3FMCA 1UUPA 1YNND 4K5VA 4KY6A 3MEHA 1NCVA 1K8OA 3H3VI 3D4WA 4J15A 3P75A 1Q82C 4DUYL 1GHKA 1ML0D 4OWTB 3C2PA 1B50A 1TS3A 1G51A 2R93G 2K04A 4R4QA 5JEAG 2AHOB 1KD1C 2VQEQ 3PF4A 3RR5A 2PMZE 2F0NA 2WAQB 2CW0C 3TZUA 2EQSA 1GUSA 4NXML 5K36G 1PZKD 2B8GA 1LTBD 2G9DA 2OTJA 1TVXA 3HOXG 3D3RA 1IYJB 4B3RQ 1U5KA 4QQBX 1VQBA 4DNRB 1GKHA 2G9HD 3CCJA 2RKSA 4AYBB 1DYQA 3HOUG 3H09A 2KHJA 2NVYH 1X3GA 3KUPA 4LW1A 2ID0A 1OXTA 1WD0A 1IZ6A 1QZGA 4LFAL 1N33L 1TS5A 2I5HA 3T51B 4NPSA 1STNA 2A68D 1HQRD 2GN5A 1UE1A 4PQXA 3TP7A 3M85A 4JI6L 2B39A 3I73A 1I94Q 1STEA 4K5XA 1WTHA 1HNWQ 5E4XA 3S1QH 4LWCA 1A0IA 1Y1WB 1TU2B 4KHZA 4DR5Q 3Q8DA 3PMFA 1CQFA 2JP1A 4J1MA 2MP1A 1ET6A 2Q2IA 3BG3A 4JI2Q 1RDPD 2VQFQ 1HA5A 2B2UC 2F0WA 1X3PA 1N36Q 1HCZA 2KHSA 4RAUC 4DFAA 3S9WA 4A93H 4C1NK 2UUCL 5CYUA 2UUAQ 1E3PA 3KLWA 3S24A 4DV7Q 4P74A 4DV3Q 3CF5A 4DUZQ 2A8VA 4IUVA 4DV4L 3S1NB 3VR4A 2Q2UA 3H3VC 3M4QA 2ZTDA 1LTID 5EBDA 1WI5A 5DNFA 1KLUD 5C44B 3K6OA 1HTPA 2KEEA 1JQYD 2MPMA 4JI7Q 1O7ZA 1IBML 1O7YA 1MGSA 4FF3A 3IL8A 4BY7H 1JJ2A 2JA9A 5GAGC 5M5YH 4IOCA 4P72A 1HFGA 4KKTA 1E1TA 5AJ3L 4A3KH 1C9OA 3TDQA 1SSOA 3GTMH 2E5LQ 4CKEA 4K8IA 3RLOA 2FJ2A 2J4XA 3S1MH 1JICA 5I6YA 3P7JA 3GTJB 2IW3A 2EIFA 2A6HC 2LSSA 2EYHA 1TS4A 4BBRB 4FNFA 4LF7L 2QA4A 1PH6A 2YTYA 2H1EA 1FNVA 2K5VA 4CJ0B 2AWNA 2PQAB 3I56A 1LV9A 4MN3A 1WTQA 1S4ZA 1EWHA 1X56A 2EJGC 1K0RA 2NVQB 4KN4C 1KRSA 2VL6A 4A3DG 2NZ1D 2EXZA 1IKMA 3I4OA 3DHQA 3MXNB 1PMRA 1RD9D 2IT1A 3E5SA 4R8NA 1CTMA 4LFCQ 4J8QA 2I46A 4U68A 3K7AB 4HTHA 4C2MB 2OT2A 4EVOA 1G2SA 2L12A 2LFNA 3G4SA 1B8AA 3K57A 1PYWD 2L4NA 1QOHA 1SNDA 3I4NB 2RCNA 2JSOA 1SMXA 4GN5A 2C35B 3R2TA 4EQNA 2B2VA 2KQ3A 1X6OA 2EYMA 2DY7A 3NK9A 3L2PA 3FKIH 5HGQA 3TP6A 1JOQA 5D3IB 5EPJA 1R9TH 1SE8A 2B8FA 2WB1G 3G6JB 1K73C 1GUWA 1IKLA 2F0VA 5J22A 4H13C 4JI3L 3PO3G 1K83B 5CC4A 2V1CC 1LTTD 4K6LA 5IGCA 5HY6A 5FLXE 1BQQT 2E2HH 4GLVB 1YEZA 2B29A 1AH9A 4R8IA 4DNTB 3PIP3 2K32A 5IYBH 5AFWA 4A3GG 2I07B 2QCPX 4NB3A 1IBKL 1HZCA 5EAYA 2L15A 3CCVA 3SK5A 2OWOA 4ILWA 1BF4A 3J81E 4KD4A 1PHJA 1MI2A 1OTCA 2KUMA 1LO5D 1XPRA 3Q24A 1TKWB 5IODA 1TWFB 5IP9G 4NMZA 4B9XA 5IIFA 5IWAL 3T53B 2RA4A 3K0YA 1W3SA 1BCPC 2PZWA 4DNIA 1SYDA 1ZEQX 1XNQL 4DV0L 2F0LA 4NP5A 2CH4A 5JVH3 2F0PA 1X9NA 1X32A 3RZOB 2HDMA 2PI2E 2EZVA 5M3FG 2B63G 3S15B 2ZM6Q 1SYEA 4J6HA 5G3LF 2Y0SB 1I4RA 2Z4HA 4B9WA 1Q8KA 2N8NA 2JA6B 1NMGA 3J80L 1E1OA 3Q22A 3HOZG 1HTLD 1JWMD 3F2DA 2DN8A 1SMYC 1HZBA 3OIQA 1A3VA 1VQLA 4JV5Q 5JJKA 2A19A 1D6EC 3P20A 1QVFA 1A63A 4JC0A 4CJ1B 4DV2L 5C3WA 3VYRA 3MWYW 1Q90A 1V8QA 5LMNW 4WRDA 4ZUIA 1B4OA 1DOKA 5C4XG 1BUVT 1HQMC 3GTOB 2B3GA 3L7ZC 2QKIC 3A55A 2BH8A 3PUXA 1EQVA 4A3JG 2J0TD 5L37A 4FF2A 3STBD 1A2UA 1K28A 3I4MB 2NYZD 4K5WA 1Q12A 3HFZB 5DAUA 4X62Q 1X54A 3CQZH 2BA0A 4PZ7A 1Q8IA 4UAIA 1EWCA 1PFNA 3W1GA 4B3TQ 2F0FA 4HSVA 1JE4A 1JJCB 5ISRA 5CV7A 2OCEA 2E2JH 1X65A 2K5HA 3PQIA 3HOYB 2Q8RE 4Y52H 3KBXA 2ATWA 2JA8H 3A7LA 1D1KA 2JA5B 1EL0A 4DXGA 4R4TA 5J3BA 3B6YA 2MJ8A 4JI0Q 4HIOA 4V0BA 1ASYA 2VW9A 5C44H 1XNRL 1KAAA 3D4DA 3CCUA 4GN4B 3GTPH 1G91A 1WYDA 2YTXA 1XJVA 2IHFA 1KXLA 1XMOQ 3T1YL 5IT9E 2KA7A 2DJGC 2AUKA 1VCIA 4R1JA 4IPCA 2K05A 3EBEA 1N32Q 1PH8A 2A69C 3V2TA 1CA5A 2F3IA 4JBWA 5CV8A 5LMNL 3H0GB 5M9OA 4KHPL 1SDFA 2OQ0A 4FXDA 4JPBW 4I7ZC 3MHBA 3IFDA 3OHXC 4NW2A 5ELDA 1F2LA 1PRTB 3A8KE 3IKJA 3GTJH 1HR0Q 4X66L 2C9OA 4K0KL 4ZCKA 3CXCA 4RA8A 3S2DB 4X64L 4BBRH 1NTGA 1SROA 3NUCA 3PSIA 1NMFA 2BCOA 3HOVH 2BOSA 2HCIA 2B2UA 1CM9A 2K14A 2FINB 2IY5B 3HKZG 4A3CH 3NTIA 2ENBA 3L3OC 4TSSA 4DGZA 2PZTA 3BU2A 4IN3A 3K7UC 1SFOH 2WV6D 1KDAA 4HIDA 1KC8C 1HR0W 4H0LC 2WAQE 4F87A 1W6JA 3M9BA 1EOTA 4DR4L 2CQAA 4B3SQ 1K8AC 4LFBL 1B3AA 1Q7YC 4DKAC 4PMWA 4OIJA 4ME5A 3PO2B 4RKLA 3ZYYX 1XYIA 4C1NI 5JPMC 4JG2A 4RCOA 4AYBE 1GJXA 2QDLA 3RZDH 2XWBB 3CCRA 2MUYA 3AFPA 3TRZA 3U4VA 2J7ZA 3BVMA 1VQ7A 2LY7A 4NXNQ 4JVZA 1WFQA 4WJ4A 1SXTA 5C4JH 2MFIA 1YI2A 3ZJYC 5TSSA 1TQOA 3OTOQ 1I3QB 4DAMA 4WJ3M 5KNBA 2HHHQ 1SYBA 4IPDA 1LM0A 2TMPA 2VY3A 2HCCA 4CDDC 3D4RA 1Z7TA 5IGFA 4DV5L 3AFQA 4OWWB 1FNUA 1CI3M 5DLQE 3GV3A 4MIUA 1WCMH 2PW5A 1WTOA 4B3MQ 1KDBA 1PRTF 3CP0A 2XRQD 1A62A 3A74A 3PUVA 1Y1VB 3KFUA 3NTHA 2A73B 3TSSA 3D31A 2KEDA 2K28A 4EGVA 2NUCA 4XQJA 1SNCA 3HOWB 4O2DA 4A3EB 2JA7B 4C3JB 1PTOB 2SDFA 2F0EA 4DF7A 2UXDQ 3W1BA 1S3OA 1TT2A 1UE5A 4BY7G 3A8IE 2D0OA 4KN7C 4C56C 2PCFB 4PMBA 1TWFH 4QIWB 5D3DA 5LL6S 4XQNA 3PUWA 4LF5Q 4K2KA 2LS01 4A3KG 3H94A 2CH4W 3KF8A 5EKIA 4OONA 2ZT9C 3ND8A 3NTKA 3FPPA 4DR6L 3MEFA 3SXHA 4CKBA 1V1QA 1LT5D 4YWMA 3U9SA 2RHQB 1PLFA 4L8JA 2N49A 4C3HH 2R7ZB 4H44C 3F2UA 4DUYQ 4G4KA 3KBGA 5C5LA 2CCZA 2F0TA 5M5XB 1VMPA 2WKDA 2B2YA 2CWPA 2UU9L 1JCKB 3OMGA 4P75A 1CFMA 4HJ5A 3HKSA 3F2BA 1FJGL 1B44D 2EY6A 1I4HA 4DR3L 4GKKL 1PZID 2A5HA 1M8AA 3QOJA 4L5TA 5CV5A 3GD7A 4NXMQ 2B63H 2EDGA 4RGMA 4DAVA 4A3IH 3GTOH 2O4XA 1C7YA 4HCSA 1WTWA 1B53A 4X65L 5GAHC 2PZUA 2RDFA 5LMUL 1GHJA 3T1HL 2XWJB 1QJOA 3RN5A 3VR6A 3KOJA 2ALYB 4HMIA 2A68C 1BOSA 2L55A 5FO7B 3AB9A 4LFAQ 1N33Q 2F52A 5KYIA 3FKIG 4YCVA 3GTQB 4GN3B 1ILPA 2JN4A 4JI6Q 2HQEA 3S2HB 5E7NA 1SNPA 4BWGB 4GNXC 5BR8L 5C3EH 1SJED 3BZDB 3DWAA 2XRSD 1RIPA 1PFMA 5M5WH 4R4OA 1VQIA 1EY4A 4PG3A 2HIXA 4N9TA 5EBCA 3S14B 4RGOS 4UP9A 3TMEA 4JOIA 2FMMA 5IYBG 1YHAA 3NXWA 3G7LA 3FRPB 3GTKH 3CRLC 1Y8NB 1EIFA 4UP8A 5JJIA 3MXPA 2WAQG 1B1ZA 2UUCQ 2YV5A 2EXDA 2YYZA 4IFDJ 1VF5C 3A54A 3FEWX 4DV4Q 4X3KA 5T1IA 2E74C 4RFBA 1VQDA 4BBSB 1LTAD 1K8MA 3RUZA 4AYBG 4G57A 2F0DA 2FHTA 4QUFA 3BVZA 4A3BH 3M3YB 1LACA 2EY1A 2EYJA 4UDUC 4ALPA 2F03A 4HJ8A 2N55A 2CWAA 1IBMQ 1PTOD 2B2TA 2I5LX 3SDZA 4IURA 2A1AA 3ITPA 1EY0A 3GTLH 2ZJPA 1F9SA 5CR3A 3W3AA 2DJFC 4DAPA 5C4HA 1D5XC 5AJ3Q 1KRTA 4ZRZA 5DM63 2JQOA 2VNUD 2HQLA 3J80E 3S17H 1XMQL 5I2XA 1EOVA 2VUMB 2VS1A 1WD1A 5CBEE 1GUNA 1WJJA 1I4GA 4IFDI 2K5QA 4LF7Q 4APVA 4H7BA 1DD2A 2ZTCA 1BNZA 3QB3A 2Y0SE 3FDTA 1IBLL 1L0YB 2R93B 4YY3L 4CJ2C 4AIMA 1I3QH 2R92B 3OW2A 4OX9L 4P71A 1Q86C 4IALA 1DGSA 1WTRA 1YJ9A 3EN2A 2JA8G 5EKLA 2KCMA 1EYCA 1MIUA 1U9RA 1Y1VH 2B2WC 1SNOA 2EJFC 1VQNA 5C44G 1QILA 4QMGA 2Q8TA 4HIMA 2BH2A 4K2LA 4Z9CB 2R6GA 3S1RB 4O42A 3HOUB 1PTOH 4LF8L 5JVG3 3SVMA 3LNNA 5IYDG 3MXGA 4HJ9A 1I6HH 3M7NA 3PUYA 1LT4D 1EY5A 5J39A 3CW2C 4OL7A 5JJZA 1VQ8A 2Z8LA 1DONA 5EGTA 3JAMi 3AU7A 5D14A 1Y8PB 3R2IA 2H4OA 4IUUA 1I50H 3NBIA 5BN5A 2K4KA 1X3EA 2GA4B 2K50A 3QJYA 4OO1I 2AQ3B 1S40A 4JI3Q 1FR3A 1WTPA 2CHBD 3TZDA 4BBRG 4C3IH 3EFXD 2NTSA 4HSPA 1HUNA 1NE3A 1PDQA 4DR2L 4IUQA 1IL8A 3VYUA 3HOVG 4X3UA 5KGUA 1II3A 4A3CG 3VR2A 2F0HA 5M5XH 1EIGA 1HJPA 2PNHA 2WFWA 2OQKA 4IQZA 4N8X1 3X3MA 1IBKQ 3N52A 1M4VA 4EQOA 2KHIA 1U4LA 5FJ8H 4QL5A 2JXMB 4BY1H 3KF8B 5T1GA 1XTCD 4FVMA 3WWVA 5C3XA 3BDLA 1VMCA 5GADC 1TIID 5JAVA 2CW0D 3ULLA 1P16A 5IWAQ 3HP3A 2HD3A 3SK6A 2OF1A 2YU9H 3MXUA 2MQHA 1MJCA 4F8MA 3UDFA 1XNQQ 4DV0Q 1HUMA 4LF9L 1VQ6A 1GVPA 3EJIA 2Z6KC 3UDGA 2R7DA 1VS0A 1WVLA 1JOOA 5GQOA 2R61A 4POGA 2LKVA 3NELA 4JI4L 1LABA 1GO3E 1EY9A 3NQTA 3IRBA 3DEPA 4AQYL 4YWKA 3PIOA 2WACA 2E2DC 1L1OA 3BDOA 1LLRD 1J9OA 1CHQD 2ASBA 1PVOA 1A15A 4DV2Q 1WCMG 1U4PA 3SE0A 3SHLA 4A3FB 4ZLTF 1SE2A 1CT1D 4U673 3ND9A 3NQIA 2X6LA 1F2YA 1SAPA 4RG1A 4M1UB 1J5EL 1D8LA 2JEBI 3STBC 4TRDA 3G71A 5I6WA 1EY7A 2EY5A 1X3FA 1Z9FA 4PZ6A 2R3ZA 1HA6A 3RN2A 5EPLA 1VQEA 3M4OB 2XGTA 3WDNA 4IJLA 3OSOA 4LJZC 4A3DB 5CORA 4R4CA 2DNEA 3URYA 4DK1A 3OIPA 2FFKB 2K7VA 4GOPA 1ET9A 1KNAA 1LTSD 2QGQA 3AEVA 1L0XB 1IYUA 4DR7L 1HH2P 4DK3C 1TWAB 5CGKA 3CU7A 4RHSA 4Q5VA 3E9IA 3NE5B 1VQJA 3KJOA 5DM73 1BVSA 2ICEC 1O80A 3LX0A 1JT8A 1XNRQ 4XT3B 2Y0SG 4C3HG 1Q1EA 2PO4A 4XT1B 3T1YQ 2D2CC 2UXCL 4QIWE 1HNZL 4H02A 1MD2D 1C8CA 1G2TA 2L9HA 5LMNQ 3A5ZB 2HT1A 5IGEA 3W5OA 3L0OA 2QF7A 3T56B 4KHPQ 1QZHA 1U0LA 4X3TA 4OEMB 1AP0A 4YHHL 1I4PA 1SE4A 2VXWA 4DN4M 2MHVA 1DXMA 4X66Q 4A3LH 4A3IG 4MZ9A 5CMDA 3UDIA 4K0KQ 2D5DA 4X64Q 1JMCA 4DR1L 2F0IA 4CDEC 4R4IA 5KEEA 3VA5A 2GVAA 3U4ZA 1TY0A 3CCMA 2QEJC 4ZUJA 3CC4A 2NBFA 3CHBD 5CV9A 2R92H 4ULLA 1Y1WH 1U4RA 1PA6A 2K6AA 3VYSA 5FKAC 3DMUA 1IW7D 1BCPF 1EY8A 2F0KA 4RH6A 5C3EG 4DR4Q 4XYOA 4LFBQ 3AQQA 1GUGA 2M9VA 1F9PA 1H95A 1B7YB 2KCNA 1HZAA 1AE3A 1U4MA 1NR2A 1FGUA 5E4WC 2NVXB 3DEOA 3S1RH 5KIXA 5EJWA 1ASZA 1UAPA 3OYYA 1C48A 1BO0A 3L9AX 4XQQA 3SGIA 2EY2A 4Y7NB 4RCNA 4HEDA 3S1NH 4IOAA 3H0GG 1FYCA 3HOZB 4IFDH 4QF4A 4FDBA 4GKJL 3UI2A 1HXYD 1ZXTA 4R9WA 1Q1BA 4DU9A 4N8FA 1GUTA 3J7A5 2E76C 2XIWA 1STGA 1UWVA 5ELOA 4DV5Q 1JWSD 4FP5D 2OTLA 1PXUA 2RF4A 3Q23A 1YNJD 4L5QA 5G3LD 5IYDH 4YCUA 1PZJD 5ELFA 2IPKD 3BYTB 1PH3A 4A3BG 2ZJRA 2RDHA 4A3JB 3FHWA 1VQMA 1LT3D 1RL2A 1XTDA 2ZXRA 1R4QB 1MKHA 1V1PA 4HN7A 1AZQA 2CVRA 3I72A 2VZAA 3M4YA 2D9UA 3GTGB 3BJUA 2MO0A 1HRJA 5M3MB 2K5WA 1V9PA 3H15A 1GXDC 1W2BA 4TVAB 1IHZA 1WTXA 2NVTB 4IPHA 3D8GA 3BZKA 1KQSA 1E7ZA 1UE6A 4X6AH 2NVQH 1S5ED 1CQVA 4DR6Q 2F1MA 3QIAA 1D5MC 2EJMA 4A3MB 4OO1H 3I4LA 1RTNA 5JOBA 3FP9A 1G6ZA 4L5RC 3J81i 3KLSX 3K7AH 1ZYRD 4HCEA 4C2MH 3Q0AA 1CKNA 1VQOA 2UU9Q 3U58A 3I3CA 1EUJA 3EQLC 1KDCA 2EYFA 1FJGQ 1UEBA 2OEOA 4DR3Q 4GKKQ 3I4NH 1O7LA 3TP8A 4KK7A 1Y1VG 1N8RC 1MBYA 4DXFA 4JBMA 1NNXA 4GLXA 1I5FA 2KENA 4X65Q 1ESRA 4C3JG 2PNRC 1BDOA 2TSSA 5LMUQ 2NVYB 3T1HQ 1EEFD 1P8LA 1E24A 2G5DA 3HZXA 3HKZB 4DAYA 1AEXA 2BE5C 4KY5A 2HDLA 4PNYA 2XSCA 1K83H 3A0JA 1EQTA 1L1OB 2CKZB 2MNAA 5IY0A 4NKLA 5KNCA 4GZYC 3AYHB 1TWAH 4FYDA 3S1QB 5BR8Q 4UHVA 4JI8L 1NR4A 4CGYB 4P73A 3K5LA 3LWUA 3NPPA 2Z6BA 3WOFA 4MNOA 1AN8A 3MFYA 4IZ8A 2BA1A 4ABNA 4C3IG 4KLKA 4EQ5A 1STBA 3I7FA 1SNMA 1NJIC 4CKCA 2Q2TA 4ID6A 1I6VC 3EA6A 5F2DA 1XXGA 1HPCA 3J81j 3EVQA 2JYOA 2ZJQA 5HGTA 3A7AB 5FJ8G 4A93B 1YNNC 4GOPB 4BY1G 1XPUA 3PV0A 4WFN3 1N34L 1AE2A 2RBMA 3K8AA 3I90A 3RZOH 1LTLA 1KTKA 1Y14B 3S15H 3KLRA 4A76A 3R8BA 1SLJA 1ENFA 1I4QA 5K5PA 5CV6A 3U9OA 1DCZA 2JA6H 3LWEA 3VDYA 5C5MA 4X3SA 1W6KA 1EEID 2LXJA 4PZ8A 4XIGS 2F4IA 3W2DA 3I55A 4IO9A 2B2VC 2JJQA 1PTOC 5C4ZA 5CV4A 4BS9A 2UXBL 1X3QA 4UPAA 3MZ5A 1STYA 2JE6I 3ERQA 1Q46A 1PRTD 5M5YB 1ILQA 1YITA 3T13A 4EQPA 1GOZA 4ZK9B 3E3XA 5IOCA 3PIPA 5LL6X 3GTMB 1F9RA 4DV1L 3HS0C 3I4MH 2RHSB 3A8JE 1SR3A 2F0MA 3R3OA 1XMQQ 2F0GA 3D6WA 2NB0A 4RMFA 4YWLA 3V96A 3RNUA 2CQOA 5FLMH 1QUQA 5KNDA 4XTCS 1BXTA 3G48A 3I8ZA 2E8GA 5BN3A 3QR8A 4DV6L 1PV4A 2RVLA 5COYA 2AKWB 3V05A 3HOYH 1K9MC 3TBIB 2F0QA 2NN6I 3HRZC 5JEAJ 4OGQC 1IBLQ 2JA5H 4LUVA 4JBJA 4YY3Q 4JI1L 4OX9Q 3CCEA 2UUBL 1DM0B 2PQEA 1PH7A 5E1FA 2AMCB 1EU3A 1SJHD 3CPWA 2HIVA 2F3VA 2LXKA 1XPOA 1MSHA 4QB4A 1HNXL 2WKCA 2CFMA 3HGBA 2F0OA 3GV6A 4KJNA 3H0GH 3NEMA 4I65A 4MHEA 2A6ED 3WOEA 1VQ5A 4LF8Q 1PYSB 4KY7A 2F4VL 4KMUC 1QG7A 3GDEA 3F1ZA 3FKIB 3S2DH 2KOLA 5M3MH 2RSNA 2NZHA 1XX8A 3NWSA 4RWSC 2KVMA 1EWIA 1GUOA 3FVQA 1A2TA 1SYCA 1A6XA 2VUMG 4A3LG 1SE3A 5A2QL 1H9RA 3J7YW 2E2HB 3OW7A 1HFNA 2H5XA 1YZ6A 4EX5A 1JB3A 5EPKA 4DR2Q 4A3MH 3VYTA 3GP7A 2IX0A 5IYCG 1AFPA 2IJ0A 3CCSA 2AQ2B 3BVGA 5IP7H 1V1PB 1QWYA 2R92G 5FO9B 4FXGC 1Y1WG 2K75A 1Y69U 3PO2H 1MSGA 1PH2A 4YIJA 2I5MX 4G7HC 3KF6A 4JI5L 4ZKBB 2WB1E 2XN9C 1VQPA 5ELCA 2DY8A 3IAYA 2K1BA 2JEAI 1ENCA 1J6QA 1RKNA 3MVVA 4LF9Q 3E0JA 4LF4L 1TWCB 1NUCA 1RF2D 1V1OA 3CRKC 4JI4Q 1BKBA 3C46A 1VF7A 4LF6L 3HG9A 1CKNB 4IFDG 3MAQA 2K01A 4DA2A 4AQYQ 4RGTA 2WP8J 1JR0D 1QB5D 2YTVA 3HOXB 4JBKA 2MGSA 2IX1A 1OXUA 3D0FA 2L11A 4L5SA 4K8JA 4HR7B 4Q0FA 1NAPA 3HOWH 4A3EH 5C0XJ 2JA7H 1EZ8A 1RCVD 3NBHA 4C3JH 2A74C 2O5IC 4JYAL 4S3SA 4PV1C 2ZXOA 3C3LA 1H9SA 2XVSA 1HZ9A 3MA2B 4RHRA 2QW7A 3K0XA 4O1NA 5J1ZA 4M8AA 2BDOA 1J5EQ 4DAYB 2NWGA 5H1SE 4HJ7A 1JWUD 1SRUA 2EVBA 1QCBD 4HIKA 4QCLA 1G291 2L5TA 5BN4A 5IGGA 3FPUB 3CAMA 4BXXH 1FL0A 3DM1A 1STHA 3CQZB 4OELB 2SNMA 4KHVA 1AW7A 2E2JB 2N88A 2M2LA 3KDFA 3NSWA 3S16B 2ZTEA 2K03A 4IJHA 2JA8B 2R7ZH 4DR7Q 3IFTA 4XDXA 2R7FA 1RJTA 1TWGB 2O2LD 1CSPA 3K80C 4JCVE 3GTPB 2VQEL 1KL9A 4JW0A 1QVGA 4OO1G 1EIHA 5C0XI 3QG1A 1B2TA 1E2WA 2F0JA 1PH1A 1DOLA 3J7AV 3DWPA 4O0AA 2UXCQ 2DNCA 1HNZQ 4B3RL 3DXJC 1CKOA 3OWFA 4A3FG 3BS1A 3E0EA 4OXPA 3DWQA 4DK6C 3U50C 3I4NG 4YHHQ 1TY2A 1UE7A 2EYPA 1ZKOA 5FLXc 5C0XG 1SEBD 5NUCA 1KLGD 3OOCA 4DR1Q 2GVBA 3MTSA 2DGYA 2M00A 3HOVB 3UDXA 3GTQH 1S5DD 3GQBA 3OWEB 1Y8OB 1I94L 1YIJA 1N9WA 1E2VA 3P1HA 2JK8A 5A35A 1RTOA 4E6IA 3S2HH 1HNWL 1EYAA 3J81c 3A5UA 1BR9A 5IGDA 4MTKA 4ZAIA 4DR5L 1SFOB 4G7OC 2PW7A 1S5FD 3S14H 1IW7C 1OXVA 4RGNA 4JI2L 3SR1A 3JAML 1B9MA 1QNKA 2VQFL 3J80i 1F9QA 1N36L 4FF1A 2Q8IB 1I4XA 3X3NA 3PF5A 1B3QA 1QUQB 3CC7A 2IX3A 4QGUA 2UUAL 3RZDB 1BCPB 2D62A 1BBWA 1KAWA 3HKZE 1M1KC 4DV7L 4DV3L 1YNXA 4DUZL 3EIVA 4DK0A 3E6ZX 5C4JB 3ULJA 1O7IA 3I91A 3KYHC 4FF4A 1VQFA 2B2YC 3K59A 1EYGA 1GM5A 1D5ZC 3MC0B 4BBSH 1O78A 4GKJQ 1PH9A 2F0UA 2Q2HA 3TQYA 4YCWA 1WTVA 1SNQA 2V4DA 1MJEA 2NN6H 2K33A 1YJWA 3M3YH 2IL8A 3QWNA 1VQKA 2ZXPA 1E0BA 3H6MA 1WCMB 4JI7L 4HMJA 4QUCA 4GLAC 3EROA 1YNJC 1BBXC 2JA6G 2X6GA 4TQUS 1H9MA 2PI2A 3ICEA 4ODGA 4IPGA 2BDNA 5ELEA 4B08A 2P5ZX 3A56A 2E5LL 2PMZB 4GNXA 1F77A 2WB1B 5IGBA 1NBWA 2EYOA 4K6DA 1M90C 3PO3B 1CZWA 4OWXB 2VUMH 2A6HD 1F2MA 5LHY1 1DJRD 3LGJA 1S5CD 2Z9HA 3I4MG 5IYCH 1FD7D 3F8TA 1RODA 1TS2A 2QDBA 4A3GB 2E2IB 1TR5A 1A3TA 4KI0A 2XNAC 3R93A 5I9OA 1JB7A 1E22A 3PUZA 2R93H 5GROA 2L0CA 3T16A 5FLMG 5JEAH 1TWCH 5IT9c 4JOIC 1VQGA 1OO9B 1A8VA 4C3HB 2FXQA 4KKUA 4A4IA 4V190 4OIKA 2NZOA 1SYFA 3H3VH 3HOYG 3ERSX 5EQ0A 3CMEA 4LFCL 1CK1A 1T5EA 3KF6B 1SN8A 5K36H 2JA5G 2IHEA 1ZYRC 1UNSA 2ICIA 4P2CB 2AUJD 3HOXH 4WORA 4N9PA 3QOLA 1YBYA 4CBVA 1X55A 3HOUH 5E3FA 1B9NA 1VQCA 5M3FB 2B63B 1TWHB 1PFBA 4A3IB 1R4PB 1D7QA 1YHBA 1MHWC 4IUNA 3RLFA 1SYGA 1A3UA 3KLSA 2VB3X 3C1EA 1ESFA 1PFSA 4TKOB 2QILA 5KYLA 1LT6D 4ZKCB 4CDCC 4LNQA 1LUZA 3JC66 5I9PA 1KIXA 3SK4A 3TP5A 2LMCB 2B2TC 3PGZA 5C4XB 2N3SA 5M3MG 1JE5A 3S16H 4DPGA 1PH5A 3NBHB 1CHPD 3ULPA 1VQ9A 1CUKA 3K58A 5C3EB 1H9SB 4G7ZC 1SBBB 4XXEA 4QY7A 4A75A 4LUZA 4LMQD 5M5WB 2KBNA
chains in the Genus database with same CATH topology
4JI8Q 4APVA 1TWGH 2RCNA 2ZTCA 3VDYA 1SMXA 4GN5A 2C35B 2Y0SE 1L0WA 1X6OA 4POFA 4A3MG 2LXJA 1IBLL 4PZ8A 1VQHA 4XIGS 3L2PA 3FKIH 3CC2A 1Z47A 5HGQA 3I55A 4YY3L 5IP7G 4AIMA 1I3QH 4IO9A 3OW2A 1VQ4A 3K81C 2JJQA 1BBUA 4P71A 1R9TH 1SE8A 4OX9L 1Q86C 2WB1G 1K73C 2UXBL 4UPAA 2JE6I 3PO2G 1Q46A 4JI3L 1YITA 3PO3G 1QVCA 1DGSA 3KDFB 2V1CC 1YJ9A 1JJGA 3EN2A 3PIPA 2JA8G 2KCMA 5HY6A 1N34Q 2E2HH 1L2FA 4DV1L 1MIUA 3I4MH 3CPFA 1Y1VH 2RHSB 4GLVB 2ZM6L 1SR3A 1YEZA 2B29A 1XMQQ 1VQNA 1AH9A 5C44G 4HIMA 2BH2A 5IYBH 4RMFA 4YWLA 4A3GG 2R6GA 3RNUA 1LYLA 4NB3A 2CQOA 5FLMH 1IBKL 1QUQA 1HZCA 2N78A 4XTCS 2L15A 5EAYA 3G6EA 2KCTA 3CCVA 3G48A 2OWOA 5IYDG 4JV5L 1PHJA 2E8GA 4HJ9A 1I6HH 3M7NA 3PUYA 4DV6L 1PV4A 1OTCA 2AKWB 1XPRA 3HOYH 1K9MC 3CW2C 1G6PA 2NN6I 5JEAJ 1IBLQ 1VQ8A 1OXXK 5IP9G 3JAMi 5IWAL 4WJ4A 2JA5H 4LUVA 4JBJA 1W3SA 4YY3Q 4A3FH 4JI1L 4OX9Q 4HJAA 3CCEA 4DNIA 3ER0A 1I50H 1V43A 2UUBL 5IE8A 2K4KA 1PH7A 2UXBQ 1XNQL 2AMCB 1WOCA 4DV0L 1X3EA 2K50A 2XTIA 1YJNA 4OO1I 1S40A 4JI3Q 3CCQA 3CPWA 2HIVA 4BBRG 2LXKA 4C3IH 1XPOA 3UE1A 4A3EG 3HOWG 3J7ZC 1NE3A 1X9NA 1HNXL 2JA7G 4DR2L 4DV1Q 1KHIA 2CFMA 2PI2E 5M3FG 3HOVG 2B63G 2ZM6Q 1EFWA 4X62L 3H0GH 3NEMA 4B3TL 1Q8KA 3M4OH 2N8NA 4A3CG 1NMGA 1E1OA 4A3DH 3HOZG 5M5XH 1HJPA 1VQ5A 2PNHA 2WFWA 2OQKA 3F2DA 1PYSB 1IBKQ 1HZBA 4LF8Q 1C0AA 2F4VL 1VQLA 2KHIA 5FJ8H 2A19A 2MO1A 4QL5A 3RLNA 4JV5Q 5JJKA 3GDEA 4DV6Q 4BY1H 3KF8B 4AH6A 3F1ZA 1QVFA 3S2DH 3NENA 3WWVA 1A63A 4JC0A 5GADC 4LUOA 4A93G 4DV2L 5M3MH 4JI0L 4BXXG 4BA1I 5LMNW 3ULLA 1P16A 3DM3A 2NZHA 5IWAQ 5C4XG 3BZCA 1EWIA 4JI1Q 2YU9H 2MQHA 1MJCA 2Z6KA 2UUBQ 3UDFA 1XNQQ 4DV0Q 1XMOL 2B3GA 3L7ZC 2VUMG 4A3LG 2ES2A 2BH8A 3PUXA 4LF9L 2R7ZG 1VQ6A 4A3JG 1GVPA 3STBD 2Z6KC 1N32L 3UDGA 2R7DA 1Q12A 1VS0A 1YZ6A 2H5XA 3E9HA 4EX5A 1HNXQ 4DR2Q 5GQOA 1CSQA 4A3MH 4POGA 2IX0A 1T9HA 5IYCG 3HFZB 3NELA 4JI4L 3CCSA 1S72A 3JAMc 4ME3A 5IP7H 1GO3E 3UE0A 4X62Q 1X54A 3CQZH 2BA0A 3IRBA 4PZ7A 2K5NA 3W1GA 4AQYL 4YWKA 4B3TQ 2R92G 4BXXH 3PIOA 1HR0L 1JJCB 1Y1WG 2K75A 2E2JH 2OCEA 3PO2H 1X65A 1PH2A 2K5HA 1L1OA 2F4VQ 3PO3H 2I5MX 3KF6A 4Y52H 2AWOA 4JI5L 2ASBA 2ATWA 1PVOA 2JA8H 2WB1E 4R4TA 5J3BA 1VQPA 4DV2Q 1L1OC 1WCMG 3B6YA 3KJPA 4HIOA 4JI0Q 1ASYA 5GAEC 2JEAI 2VW9A 3TEHB 5C44H 1XNRL 1PH4A 3CCUA 3GTPH 4GN4B 1IL2A 3TS0A 1WYDA 1J6QA 4RG1A 2YTXA 1J5EL 1D8LA 2JEBI 1XJVA 2E2IH 2IHFA 4A3GH 1KXLA 1XMOQ 3STBC 3T1YL 2PQAA 3G71A 4LF9Q 3F2CA 1VCIA 4R1JA 4IPCA 1X3FA 3EBEA 4LF4L 1PH8A 1Z9FA 4PZ6A 1N32Q 2F3IA 1TXYA 4JBWA 4GNXB 3GO5A 3M4PA 5LMNL 3RN2A 5IP9H 4B3SL 4JI4Q 1BKBA 1VQEA 4KHPL 2XGTA 4BA2I 4LF6L 1K8GA 4IJLA 2OQ0A 1CKNB 4R4CA 5ELNA 4IFDG 1EQRA 1K3RA 2D0PA 4AQYQ 2WP8J 3GTJH 1HR0Q 4GOPA 2YTVA 4X66L 2QGQA 4JBKA 2IX1A 3AEVA 1OXUA 3D0FA 3CD6A 4K0KL 3CXCA 2Z0SA 4DR7L 1HH2P 4DK3C 4X64L 4BBRH 1VQAA 1Q81C 4L5SA 4JI5Q 2NVXH 1NTGA 1SROA 4A3EH 3HOWH 3PSIA 4GOPC 5C0XJ 2JA7H 1NMFA 4JYAL 3E9IA 4C3JH 1YHQA 1VQJA 3KJOA 5M3FH 1BVSA 3HOVH 5JJLA 1TWHH 4NXNL 1HZ9A 2K52A 1JT8A 1XNRQ 2K14A 1IXRA 3K0XA 3HKZG 4Y7NH 4UY8C 4A3CH 2IY5B 2Y0SG 3OTOL 1J5EQ 4GS3A 3HOZH 1Q1EA 4DAYB 2HHHL 4MTNA 3T1YQ 3BU2A 1EIYB 1CKMA 5H1SE 4HJ7A 3K7UC 1SRUA 3TREA 4HIKA 2UXCL 1SFOH 4LF4Q 1G291 4QIWE 1HNZL 3DLLA 4HIDA 1KC8C 4H02A 1HR0W 2WAQE 3CAMA 3M9BA 1PYBA 4DR4L 1FL0A 3A5ZB 5LMNQ 4B3ML 3W5OA 3L0OA 1K8AC 4B3SQ 2HT1A 1QZHA 4LF6Q 1U0LA 4KHPQ 5C4XH 1Q7YC 4LFBL 3PCOB 4DKAC 4PMWA 4YHHL 2QEXA 4BBSG 3KDFA 3CCLA 2DUDA 2ZTEA 4X66Q 4A3LH 4IJHA 4A3IG 4MZ9A 1YVCA 2NN6G 3UDIA 3J80c 3CMAA 4JG2A 1EQQA 4A3JH 2R7ZH 4DR7Q 4K0KQ 4AYBE 4X64Q 4DR1L 1JMCA 3RZDH 1GD7A 2UXDL 2R7FA 4QJFA 3CCRA 4JYAQ 4R4IA 1CSPA 3K80C 3AFPA 4JCVE 2GVAA 3TRZA 3U4VA 2VQEL 1VQ7A 1B70B 4NXNQ 3U4ZA 1WFQA 1KL9A 4UP7A 3CCMA 1OXSC 2I0QA 1QVGA 5C4JH 3CC4A 5C0XI 4OO1G 2MFIA 1YI2A 4LF5L 3ZJYC 3GTGH 1NY4A 2R92H 1PH1A 1FVIA 3OTOQ 4DAMA 3I2ZA 4WJ3M 1Y1WH 2HHHQ 1PA6A 4IPDA 1LM0A 2VY3A 2NVTH 4O0AA 2UXCQ 3TS2A 4DV5L 1HNZQ 4B3RL 3AFQA 4OWWB 5DLQE 1WCMH 5C3EG 4DR4Q 1CKOA 4B3MQ 4LF7Q 3CP0A 3H3VI 4LFBQ 1A62A 3AQQA 4A3FG 3A74A 3PUVA 1H95A 1B7YB 3E0EA 4OXPA 4DK6C 3U50C 3I4NG 4YHHQ 1HZAA 1UE7A 3KFUA 4J15A 1AE3A 3D31A 5FLXc 5C0XG 1Q82C 4DUYL 4OWTB 1FGUA 4O2DA 3S1RH 1ASZA 4DR1Q 3OYYA 2GVBA 1G51A 2DGYA 2R93G 2UXDQ 3UDXA 3GTQH 3W1BA 1S3OA 1I94L 1UE5A 4R4QA 1N9WA 1YIJA 4BY7G 3SGIA 2AHOB 5JEAG 2D0OA 1KD1C 2JK8A 2VQEQ 3PF4A 3S2HH 3RR5A 1HNWL 1TWFH 2PMZE 3J81c 3S1NH 3A5UA 3H0GG 3PUWA 4IOAA 4LF5Q 4FDBA 4DR5L 2EQSA 4A3KG 4GKJL 4NXML 5K36G 1Q1BA 2OTJA 3J7A5 4OONA 3S14H 3HOXG 1UWVA 1OXVA 5ELOA 4JI2L 4DV5Q 1IYJB 4B3RQ 1U5KA 2OTLA 4QQBX 1VQBA 2VQFL 1GKHA 2RF4A 3J80i 4DR6L 3CCJA 3MEFA 1N36L 4L5QA 3HOUG 5IYDH 2KHJA 4YCUA 1V1QA 2NVYH 1X3GA 4YWMA 3PF5A 2RHQB 4LW1A 2ID0A 1OXTA 1QUQB 1IZ6A 2N49A 3CC7A 4C3HH 1QZGA 1PH3A 4QGUA 2ZJRA 4A3BG 4LFAL 1N33L 4DUYQ 2I5HA 2UUAL 4NPSA 2D62A 2CCZA 3FHWA 2GN5A 1BBWA 1UE1A 1KAWA 3HKZE 3M85A 1M1KC 4JI6L 4DV7L 1VQMA 1RL2A 1XTDA 2CWPA 4DV3L 1YNXA 1MKHA 4DUZL 2UU9L 4P75A 1I94Q 3EIVA 4HJ5A 3HKSA 3ULJA 3F2BA 1O7IA 1FJGL 2VZAA 3KYHC 1HNWQ 1VQFA 3S1QH 3BJUA 2MO0A 4LWCA 1GM5A 4DR3L 1EYGA 4GKKL 1A0IA 1V9PA 3H15A 4BBSH 4L5TA 4KHZA 4DR5Q 4GKJQ 1W2BA 1PH9A 3Q8DA 3GD7A 2Q2HA 4TVAB 3TQYA 4YCWA 4NXMQ 2B63H 4A3IH 4IPHA 1MJEA 3GTOH 1YJWA 1C7YA 3M3YH 2Q2IA 1VQKA 3BZKA 1KQSA 1E7ZA 1UE6A 4JI2Q 4X65L 5GAHC 4JI7L 4GLAC 2NVQH 4X6AH 5LMUL 2VQFQ 3T1HL 4TQUS 2JA6G 4DR6Q 3RN5A 2PI2A 1N36Q 3KOJA 3ICEA 2ALYB 4IPGA 3FP9A 4A93H 4LFAQ 1N33Q 2E5LL 2F52A 4L5RC 3FKIG 2UUCL 2UUAQ 3J81i 4YCVA 4GNXA 1E3PA 3KLWA 4GN3B 4JI6Q 3S24A 3K7AH 4DV7Q 1NBWA 1VQOA 4C2MH 1M90C 1CKNA 4P74A 3CF5A 4DUZQ 4DV3Q 3U58A 5E7NA 2UU9Q 2A8VA 4OWXB 4DV4L 1EUJA 5BR8L 5C3EH 4GNXC 2VUMH 1FJGQ 1UEBA 2Q2UA 3M4QA 1RIPA 2ZTDA 5M5WH 4DR3Q 4R4OA 3I4NH 4GKKQ 1WI5A 1VQIA 3LGJA 4PG3A 2HIXA 3I4MG 1Y1VG 5IYCH 3F8TA 4UP9A 1N8RC 4JBMA 4JOIA 4KI0A 4GLXA 1JB7A 1I5FA 1E22A 2KENA 3PUZA 5GROA 5IYBG 1YHAA 4X65Q 1IBML 4JI7Q 2R93H 4BY7H 5FLMG 5LMUQ 3T1HQ 1JJ2A 1TWCH 1P8LA 1E24A 2JA9A 1VQGA 4JOIC 5GAGC 5IT9c 3GTKH 1A8VA 2FXQA 1EIFA 4UP8A 4A4IA 5M5YH 4IOCA 2NZOA 1K83H 3A0JA 4P72A 3H3VH 3HOYG 5JJIA 1L1OB 1E1TA 3ERSX 5AJ3L 1C9OA 2CKZB 4LFCL 2MNAA 3CMEA 4A3KH 5IY0A 2WAQG 3KF6B 1SN8A 2E5LQ 3RLOA 2JA5G 2UUCQ 3GTMH 2YV5A 2EXDA 2IHEA 2YYZA 3S1MH 4IFDJ 3HOXH 2EIFA 2LSSA 3AYHB 1TWAH 4DV4Q 5BR8Q 1YBYA 4LF7L 4JI8L 2QA4A 1X55A 4P73A 1PH6A 3HOUH 2YTYA 1VQDA 4MNOA 4LF8L 1VQCA 2BA1A 2K5VA 2AWNA 4AYBG 2PQAB 3I56A 4KLKA 4A3BH 4EQ5A 3I7FA 1D7QA 1YHBA 1NJIC 1X56A 2Q2TA 1K0RA 3RLFA 1KRSA 2VL6A 4ALPA 3J81j 4A3DG 4HJ8A 2CWAA 1IBMQ 2ZJQA 3I4OA 1PFSA 2I5LX 3MXNB 2IT1A 2A1AA 5FJ8G 3GTLH 2ZJPA 1LUZA 4BY1G 3JC66 4GOPB 1KIXA 4LNQA 1XPUA 3PV0A 3PGZA 1N34L 1AE2A 5AJ3Q 1KRTA 2N3SA 5M3MG 3K8AA 4LFCQ 1JE5A 3RZOH 1LTLA 2JQOA 2HQLA 2VNUD 3S16H 3S17H 1XMQL 4DPGA 1PH5A 3NBHB 1EOVA 1Y14B 3ULPA 3S15H 1VQ9A 1CUKA 4A76A 1SLJA 2VS1A 3G4SA 1B8AA 4QY7A 4A75A 2JA6H 1WJJA 4IFDI 4LUZA 2KBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 Q;  4APV A;  1TWG H;  2RCN A;  2ZTC A;  3VDY A;  1SMX A;  4GN5 A;  2C35 B;  2Y0S E;  1L0W A;  1X6O A;  4POF A;  4A3M G;  2LXJ A;  1IBL L;  4PZ8 A;  1VQH A;  4XIG S;  3L2P A;  3FKI H;  3CC2 A;  1Z47 A;  5HGQ A;  3I55 A;  4YY3 L;  5IP7 G;  4AIM A;  1I3Q H;  4IO9 A;  3OW2 A;  1VQ4 A;  3K81 C;  2JJQ A;  1BBU A;  4P71 A;  1R9T H;  1SE8 A;  4OX9 L;  1Q86 C;  2WB1 G;  1K73 C;  2UXB L;  4UPA A;  2JE6 I;  3PO2 G;  1Q46 A;  4JI3 L;  1YIT A;  3PO3 G;  1QVC A;  1DGS A;  3KDF B;  2V1C C;  1YJ9 A;  1JJG A;  3EN2 A;  3PIP A;  2JA8 G;  2KCM A;  5HY6 A;  1N34 Q;  2E2H H;  1L2F A;  4DV1 L;  1MIU A;  3I4M H;  3CPF A;  1Y1V H;  2RHS B;  4GLV B;  2ZM6 L;  1SR3 A;  1YEZ A;  2B29 A;  1XMQ Q;  1VQN A;  1AH9 A;  5C44 G;  4HIM A;  2BH2 A;  5IYB H;  4RMF A;  4YWL A;  4A3G G;  2R6G A;  3RNU A;  1LYL A;  4NB3 A;  2CQO A;  5FLM H;  1IBK L;  1QUQ A;  1HZC A;  2N78 A;  4XTC S;  2L15 A;  5EAY A;  3G6E A;  2KCT A;  3CCV A;  3G48 A;  2OWO A;  5IYD G;  4JV5 L;  1PHJ A;  2E8G A;  4HJ9 A;  1I6H H;  3M7N A;  3PUY A;  4DV6 L;  1PV4 A;  1OTC A;  2AKW B;  1XPR A;  3HOY H;  1K9M C;  3CW2 C;  1G6P A;  2NN6 I;  5JEA J;  1IBL Q;  1VQ8 A;  1OXX K;  5IP9 G;  3JAM i;  5IWA L;  4WJ4 A;  2JA5 H;  4LUV A;  4JBJ A;  1W3S A;  4YY3 Q;  4A3F H;  4JI1 L;  4OX9 Q;  4HJA A;  3CCE A;  4DNI A;  3ER0 A;  1I50 H;  1V43 A;  2UUB L;  5IE8 A;  2K4K A;  1PH7 A;  2UXB Q;  1XNQ L;  2AMC B;  1WOC A;  4DV0 L;  1X3E A;  2K50 A;  2XTI A;  1YJN A;  4OO1 I;  1S40 A;  4JI3 Q;  3CCQ A;  3CPW A;  2HIV A;  4BBR G;  2LXK A;  4C3I H;  1XPO A;  3UE1 A;  4A3E G;  3HOW G;  3J7Z C;  1NE3 A;  1X9N A;  1HNX L;  2JA7 G;  4DR2 L;  4DV1 Q;  1KHI A;  2CFM A;  2PI2 E;  5M3F G;  3HOV G;  2B63 G;  2ZM6 Q;  1EFW A;  4X62 L;  3H0G H;  3NEM A;  4B3T L;  1Q8K A;  3M4O H;  2N8N A;  4A3C G;  1NMG A;  1E1O A;  4A3D H;  3HOZ G;  5M5X H;  1HJP A;  1VQ5 A;  2PNH A;  2WFW A;  2OQK A;  3F2D A;  1PYS B;  1IBK Q;  1HZB A;  4LF8 Q;  1C0A A;  2F4V L;  1VQL A;  2KHI A;  5FJ8 H;  2A19 A;  2MO1 A;  4QL5 A;  3RLN A;  4JV5 Q;  5JJK A;  3GDE A;  4DV6 Q;  4BY1 H;  3KF8 B;  4AH6 A;  3F1Z A;  1QVF A;  3S2D H;  3NEN A;  3WWV A;  1A63 A;  4JC0 A;  5GAD C;  4LUO A;  4A93 G;  4DV2 L;  5M3M H;  4JI0 L;  4BXX G;  4BA1 I;  5LMN W;  3ULL A;  1P16 A;  3DM3 A;  2NZH A;  5IWA Q;  5C4X G;  3BZC A;  1EWI A;  4JI1 Q;  2YU9 H;  2MQH A;  1MJC A;  2Z6K A;  2UUB Q;  3UDF A;  1XNQ Q;  4DV0 Q;  1XMO L;  2B3G A;  3L7Z C;  2VUM G;  4A3L G;  2ES2 A;  2BH8 A;  3PUX A;  4LF9 L;  2R7Z G;  1VQ6 A;  4A3J G;  1GVP A;  3STB D;  2Z6K C;  1N32 L;  3UDG A;  2R7D A;  1Q12 A;  1VS0 A;  1YZ6 A;  2H5X A;  3E9H A;  4EX5 A;  1HNX Q;  4DR2 Q;  5GQO A;  1CSQ A;  4A3M H;  4POG A;  2IX0 A;  1T9H A;  5IYC G;  3HFZ B;  3NEL A;  4JI4 L;  3CCS A;  1S72 A;  3JAM c;  4ME3 A;  5IP7 H;  1GO3 E;  3UE0 A;  4X62 Q;  1X54 A;  3CQZ H;  2BA0 A;  3IRB A;  4PZ7 A;  2K5N A;  3W1G A;  4AQY L;  4YWK A;  4B3T Q;  2R92 G;  4BXX H;  3PIO A;  1HR0 L;  1JJC B;  1Y1W G;  2K75 A;  2E2J H;  2OCE A;  3PO2 H;  1X65 A;  1PH2 A;  2K5H A;  1L1O A;  2F4V Q;  3PO3 H;  2I5M X;  3KF6 A;  4Y52 H;  2AWO A;  4JI5 L;  2ASB A;  2ATW A;  1PVO A;  2JA8 H;  2WB1 E;  4R4T A;  5J3B A;  1VQP A;  4DV2 Q;  1L1O C;  1WCM G;  3B6Y A;  3KJP A;  4HIO A;  4JI0 Q;  1ASY A;  5GAE C;  2JEA I;  2VW9 A;  3TEH B;  5C44 H;  1XNR L;  1PH4 A;  3CCU A;  3GTP H;  4GN4 B;  1IL2 A;  3TS0 A;  1WYD A;  1J6Q A;  4RG1 A;  2YTX A;  1J5E L;  1D8L A;  2JEB I;  1XJV A;  2E2I H;  2IHF A;  4A3G H;  1KXL A;  1XMO Q;  3STB C;  3T1Y L;  2PQA A;  3G71 A;  4LF9 Q;  3F2C A;  1VCI A;  4R1J A;  4IPC A;  1X3F A;  3EBE A;  4LF4 L;  1PH8 A;  1Z9F A;  4PZ6 A;  1N32 Q;  2F3I A;  1TXY A;  4JBW A;  4GNX B;  3GO5 A;  3M4P A;  5LMN L;  3RN2 A;  5IP9 H;  4B3S L;  4JI4 Q;  1BKB A;  1VQE A;  4KHP L;  2XGT A;  4BA2 I;  4LF6 L;  1K8G A;  4IJL A;  2OQ0 A;  1CKN B;  4R4C A;  5ELN A;  4IFD G;  1EQR A;  1K3R A;  2D0P A;  4AQY Q;  2WP8 J;  3GTJ H;  1HR0 Q;  4GOP A;  2YTV A;  4X66 L;  2QGQ A;  4JBK A;  2IX1 A;  3AEV A;  1OXU A;  3D0F A;  3CD6 A;  4K0K L;  3CXC A;  2Z0S A;  4DR7 L;  1HH2 P;  4DK3 C;  4X64 L;  4BBR H;  1VQA A;  1Q81 C;  4L5S A;  4JI5 Q;  2NVX H;  1NTG A;  1SRO A;  4A3E H;  3HOW H;  3PSI A;  4GOP C;  5C0X J;  2JA7 H;  1NMF A;  4JYA L;  3E9I A;  4C3J H;  1YHQ A;  1VQJ A;  3KJO A;  5M3F H;  1BVS A;  3HOV H;  5JJL A;  1TWH H;  4NXN L;  1HZ9 A;  2K52 A;  1JT8 A;  1XNR Q;  2K14 A;  1IXR A;  3K0X A;  3HKZ G;  4Y7N H;  4UY8 C;  4A3C H;  2IY5 B;  2Y0S G;  3OTO L;  1J5E Q;  4GS3 A;  3HOZ H;  1Q1E A;  4DAY B;  2HHH L;  4MTN A;  3T1Y Q;  3BU2 A;  1EIY B;  1CKM A;  5H1S E;  4HJ7 A;  3K7U C;  1SRU A;  3TRE A;  4HIK A;  2UXC L;  1SFO H;  4LF4 Q;  1G29 1;  4QIW E;  1HNZ L;  3DLL A;  4HID A;  1KC8 C;  4H02 A;  1HR0 W;  2WAQ E;  3CAM A;  3M9B A;  1PYB A;  4DR4 L;  1FL0 A;  3A5Z B;  5LMN Q;  4B3M L;  3W5O A;  3L0O A;  1K8A C;  4B3S Q;  2HT1 A;  1QZH A;  4LF6 Q;  1U0L A;  4KHP Q;  5C4X H;  1Q7Y C;  4LFB L;  3PCO B;  4DKA C;  4PMW A;  4YHH L;  2QEX A;  4BBS G;  3KDF A;  3CCL A;  2DUD A;  2ZTE A;  4X66 Q;  4A3L H;  4IJH A;  4A3I G;  4MZ9 A;  1YVC A;  2NN6 G;  3UDI A;  3J80 c;  3CMA A;  4JG2 A;  1EQQ A;  4A3J H;  2R7Z H;  4DR7 Q;  4K0K Q;  4AYB E;  4X64 Q;  4DR1 L;  1JMC A;  3RZD H;  1GD7 A;  2UXD L;  2R7F A;  4QJF A;  3CCR A;  4JYA Q;  4R4I A;  1CSP A;  3K80 C;  3AFP A;  4JCV E;  2GVA A;  3TRZ A;  3U4V A;  2VQE L;  1VQ7 A;  1B70 B;  4NXN Q;  3U4Z A;  1WFQ A;  1KL9 A;  4UP7 A;  3CCM A;  1OXS C;  2I0Q A;  1QVG A;  5C4J H;  3CC4 A;  5C0X I;  4OO1 G;  2MFI A;  1YI2 A;  4LF5 L;  3ZJY C;  3GTG H;  1NY4 A;  2R92 H;  1PH1 A;  1FVI A;  3OTO Q;  4DAM A;  3I2Z A;  4WJ3 M;  1Y1W H;  2HHH Q;  1PA6 A;  4IPD A;  1LM0 A;  2VY3 A;  2NVT H;  4O0A A;  2UXC Q;  3TS2 A;  4DV5 L;  1HNZ Q;  4B3R L;  3AFQ A;  4OWW B;  5DLQ E;  1WCM H;  5C3E G;  4DR4 Q;  1CKO A;  4B3M Q;  4LF7 Q;  3CP0 A;  3H3V I;  4LFB Q;  1A62 A;  3AQQ A;  4A3F G;  3A74 A;  3PUV A;  1H95 A;  1B7Y B;  3E0E A;  4OXP A;  4DK6 C;  3U50 C;  3I4N G;  4YHH Q;  1HZA A;  1UE7 A;  3KFU A;  4J15 A;  1AE3 A;  3D31 A;  5FLX c;  5C0X G;  1Q82 C;  4DUY L;  4OWT B;  1FGU A;  4O2D A;  3S1R H;  1ASZ A;  4DR1 Q;  3OYY A;  2GVB A;  1G51 A;  2DGY A;  2R93 G;  2UXD Q;  3UDX A;  3GTQ H;  3W1B A;  1S3O A;  1I94 L;  1UE5 A;  4R4Q A;  1N9W A;  1YIJ A;  4BY7 G;  3SGI A;  2AHO B;  5JEA G;  2D0O A;  1KD1 C;  2JK8 A;  2VQE Q;  3PF4 A;  3S2H H;  3RR5 A;  1HNW L;  1TWF H;  2PMZ E;  3J81 c;  3S1N H;  3A5U A;  3H0G G;  3PUW A;  4IOA A;  4LF5 Q;  4FDB A;  4DR5 L;  2EQS A;  4A3K G;  4GKJ L;  4NXM L;  5K36 G;  1Q1B A;  2OTJ A;  3J7A 5;  4OON A;  3S14 H;  3HOX G;  1UWV A;  1OXV A;  5ELO A;  4JI2 L;  4DV5 Q;  1IYJ B;  4B3R Q;  1U5K A;  2OTL A;  4QQB X;  1VQB A;  2VQF L;  1GKH A;  2RF4 A;  3J80 i;  4DR6 L;  3CCJ A;  3MEF A;  1N36 L;  4L5Q A;  3HOU G;  5IYD H;  2KHJ A;  4YCU A;  1V1Q A;  2NVY H;  1X3G A;  4YWM A;  3PF5 A;  2RHQ B;  4LW1 A;  2ID0 A;  1OXT A;  1QUQ B;  1IZ6 A;  2N49 A;  3CC7 A;  4C3H H;  1QZG A;  1PH3 A;  4QGU A;  2ZJR A;  4A3B G;  4LFA L;  1N33 L;  4DUY Q;  2I5H A;  2UUA L;  4NPS A;  2D62 A;  2CCZ A;  3FHW A;  2GN5 A;  1BBW A;  1UE1 A;  1KAW A;  3HKZ E;  3M85 A;  1M1K C;  4JI6 L;  4DV7 L;  1VQM A;  1RL2 A;  1XTD A;  2CWP A;  4DV3 L;  1YNX A;  1MKH A;  4DUZ L;  2UU9 L;  4P75 A;  1I94 Q;  3EIV A;  4HJ5 A;  3HKS A;  3ULJ A;  3F2B A;  1O7I A;  1FJG L;  2VZA A;  3KYH C;  1HNW Q;  1VQF A;  3S1Q H;  3BJU A;  2MO0 A;  4LWC A;  1GM5 A;  4DR3 L;  1EYG A;  4GKK L;  1A0I A;  1V9P A;  3H15 A;  4BBS H;  4L5T A;  4KHZ A;  4DR5 Q;  4GKJ Q;  1W2B A;  1PH9 A;  3Q8D A;  3GD7 A;  2Q2H A;  4TVA B;  3TQY A;  4YCW A;  4NXM Q;  2B63 H;  4A3I H;  4IPH A;  1MJE A;  3GTO H;  1YJW A;  1C7Y A;  3M3Y H;  2Q2I A;  1VQK A;  3BZK A;  1KQS A;  1E7Z A;  1UE6 A;  4JI2 Q;  4X65 L;  5GAH C;  4JI7 L;  4GLA C;  2NVQ H;  4X6A H;  5LMU L;  2VQF Q;  3T1H L;  4TQU S;  2JA6 G;  4DR6 Q;  3RN5 A;  2PI2 A;  1N36 Q;  3KOJ A;  3ICE A;  2ALY B;  4IPG A;  3FP9 A;  4A93 H;  4LFA Q;  1N33 Q;  2E5L L;  2F52 A;  4L5R C;  3FKI G;  2UUC L;  2UUA Q;  3J81 i;  4YCV A;  4GNX A;  1E3P A;  3KLW A;  4GN3 B;  4JI6 Q;  3S24 A;  3K7A H;  4DV7 Q;  1NBW A;  1VQO A;  4C2M H;  1M90 C;  1CKN A;  4P74 A;  3CF5 A;  4DUZ Q;  4DV3 Q;  3U58 A;  5E7N A;  2UU9 Q;  2A8V A;  4OWX B;  4DV4 L;  1EUJ A;  5BR8 L;  5C3E H;  4GNX C;  2VUM H;  1FJG Q;  1UEB A;  2Q2U A;  3M4Q A;  1RIP A;  2ZTD A;  5M5W H;  4DR3 Q;  4R4O A;  3I4N H;  4GKK Q;  1WI5 A;  1VQI A;  3LGJ A;  4PG3 A;  2HIX A;  3I4M G;  1Y1V G;  5IYC H;  3F8T A;  4UP9 A;  1N8R C;  4JBM A;  4JOI A;  4KI0 A;  4GLX A;  1JB7 A;  1I5F A;  1E22 A;  2KEN A;  3PUZ A;  5GRO A;  5IYB G;  1YHA A;  4X65 Q;  1IBM L;  4JI7 Q;  2R93 H;  4BY7 H;  5FLM G;  5LMU Q;  3T1H Q;  1JJ2 A;  1TWC H;  1P8L A;  1E24 A;  2JA9 A;  1VQG A;  4JOI C;  5GAG C;  5IT9 c;  3GTK H;  1A8V A;  2FXQ A;  1EIF A;  4UP8 A;  4A4I A;  5M5Y H;  4IOC A;  2NZO A;  1K83 H;  3A0J A;  4P72 A;  3H3V H;  3HOY G;  5JJI A;  1L1O B;  1E1T A;  3ERS X;  5AJ3 L;  1C9O A;  2CKZ B;  4LFC L;  2MNA A;  3CME A;  4A3K H;  5IY0 A;  2WAQ G;  3KF6 B;  1SN8 A;  2E5L Q;  3RLO A;  2JA5 G;  2UUC Q;  3GTM H;  2YV5 A;  2EXD A;  2IHE A;  2YYZ A;  3S1M H;  4IFD J;  3HOX H;  2EIF A;  2LSS A;  3AYH B;  1TWA H;  4DV4 Q;  5BR8 Q;  1YBY A;  4LF7 L;  4JI8 L;  2QA4 A;  1X55 A;  4P73 A;  1PH6 A;  3HOU H;  2YTY A;  1VQD A;  4MNO A;  4LF8 L;  1VQC A;  2BA1 A;  2K5V A;  2AWN A;  4AYB G;  2PQA B;  3I56 A;  4KLK A;  4A3B H;  4EQ5 A;  3I7F A;  1D7Q A;  1YHB A;  1NJI C;  1X56 A;  2Q2T A;  1K0R A;  3RLF A;  1KRS A;  2VL6 A;  4ALP A;  3J81 j;  4A3D G;  4HJ8 A;  2CWA A;  1IBM Q;  2ZJQ A;  3I4O A;  1PFS A;  2I5L X;  3MXN B;  2IT1 A;  2A1A A;  5FJ8 G;  3GTL H;  2ZJP A;  1LUZ A;  4BY1 G;  3JC6 6;  4GOP B;  1KIX A;  4LNQ A;  1XPU A;  3PV0 A;  3PGZ A;  1N34 L;  1AE2 A;  5AJ3 Q;  1KRT A;  2N3S A;  5M3M G;  3K8A A;  4LFC Q;  1JE5 A;  3RZO H;  1LTL A;  2JQO A;  2HQL A;  2VNU D;  3S16 H;  3S17 H;  1XMQ L;  4DPG A;  1PH5 A;  3NBH B;  1EOV A;  1Y14 B;  3ULP A;  3S15 H;  1VQ9 A;  1CUK A;  4A76 A;  1SLJ A;  2VS1 A;  3G4S A;  1B8A A;  4QY7 A;  4A75 A;  2JA6 H;  1WJJ A;  4IFD I;  4LUZ A;  2KBN A; 
#chains in the Genus database with same CATH topology
 4JI8 Q;  1TWG H;  1S5B D;  2VB2 X;  3HEJ A;  1L0W A;  4A3M G;  4POF A;  1VQH A;  3CC2 A;  1Z47 A;  1K0S A;  4KV6 A;  5IP7 G;  2RQX A;  2O5J C;  1VQ4 A;  3K81 C;  1BBU A;  2OXP A;  5A2Q E;  2F0S A;  1BCP D;  1VDZ A;  3GTK B;  5FO8 B;  2KEC A;  3PO2 G;  3K5O A;  1QVC A;  2B2W A;  3KDF B;  3M7G A;  1JJG A;  2KJX A;  1EZ6 A;  2WIN B;  5JPN C;  1N34 Q;  1L2F A;  3CPF A;  3SEB A;  2ZM6 L;  3NP8 A;  1NSN S;  2RCF A;  4PMC A;  4JK1 C;  3CKI B;  1XWE A;  1CZG A;  1E2Z A;  4XYQ A;  1LTG D;  3I70 A;  1LYL A;  2N78 A;  3G6E A;  2KCT A;  3O13 A;  4IUT A;  4JV5 L;  3BYY B;  1SMY D;  4A3B B;  2AQ1 B;  5FK9 C;  1EYD A;  1G6P A;  1LTR D;  1OXX K;  2PPB C;  4A3F H;  4LAA A;  4HJA A;  3ER0 A;  1V43 A;  3D6C A;  5IE8 A;  1PRT C;  2UXB Q;  2E75 C;  5C0X H;  1WOC A;  4K14 A;  1YJN A;  2XTI A;  3GTL B;  4HAE A;  3CCQ A;  4I7A A;  3HOW G;  3UE1 A;  4A3E G;  5D65 A;  3J7Z C;  2JA7 G;  1JOR A;  3S17 B;  4DV1 Q;  1KHI A;  3K5N A;  4KTA A;  1EFW A;  2HUG A;  4X62 L;  3AMU A;  3MFG A;  4B3T L;  3M4O H;  2K5D A;  3NWT A;  4A3D H;  1T5X D;  4OHJ A;  1QE6 A;  1ONL A;  1C0A A;  4IUP A;  1STA A;  2SOB A;  4ZQ3 A;  3VR3 A;  2MO1 A;  3RLN A;  1ENA A;  4DV6 Q;  4AH6 A;  1C4Q A;  1KNE A;  2KCC A;  3NEN A;  4A93 G;  4LUO A;  4JI0 L;  4KJO A;  4BXX G;  4BA1 I;  3DM3 A;  2FMC A;  3BZC A;  4JI1 Q;  2WII B;  1DZ1 A;  1AZP A;  2Z6K A;  2UUB Q;  3ONA B;  4FO2 A;  1XMO L;  3RMH A;  4LK1 C;  2ES2 A;  4ZYS A;  2R7Z G;  1N32 L;  1EU4 A;  3E9H A;  1HNX Q;  4F7X A;  1CSQ A;  2A69 D;  1ICW A;  1T9H A;  2IWH A;  5I2Y A;  1S72 A;  3JAM c;  3KK7 A;  4ME3 A;  5FLX L;  3UE0 A;  2A6E C;  2K5N A;  3T4A C;  2SEB D;  2SNS A;  1HR0 L;  3Q6S A;  1H9J A;  1I6H B;  2F4V Q;  3PO3 H;  5FOB B;  1JOK A;  2AWO A;  1F2Z A;  3NHH A;  3PIO 3;  3J81 L;  1DOM A;  1L1O C;  2F3W A;  4NDX A;  3KJP A;  5GAE C;  4L6T B;  5KRU A;  1I50 B;  4CDF C;  3TEH B;  3QO2 A;  1PH4 A;  2NTT A;  1IL2 A;  2C5C A;  3TS0 A;  4A3G H;  2E2I H;  4F88 A;  1ICF B;  4C3I B;  2PQA A;  2Z1C A;  2RSO A;  3BDC A;  1EFI D;  3OPO A;  3F2C A;  4BY7 B;  3J7A F;  5CBA E;  1TXY A;  4GNX B;  3GO5 A;  3M4P A;  4B3S L;  5IP9 H;  4BA2 I;  5EKK A;  1K8G A;  3SK8 A;  4A3K B;  5ELN A;  1Z6H A;  3K5M A;  1EQR A;  3MXN A;  1K3R A;  2EOT A;  2D0P A;  4WJW A;  3S1M B;  4BY1 B;  1K3B C;  2EPB A;  3CD6 A;  2Z0S A;  1VQA A;  3DUZ A;  1Q81 C;  4JI5 Q;  5HUR A;  2NVX H;  4GOP C;  3H91 A;  1J8I A;  3VA7 A;  5C6A A;  1HHV A;  5DEH A;  1YHQ A;  3VR5 A;  5M3F H;  5JJL A;  1TWH H;  2YU9 B;  4NXN L;  1D2B A;  2K52 A;  2EE1 A;  1IXR A;  4Y7N H;  4UY8 C;  1G8Z D;  4L63 B;  1QNU A;  3OTO L;  4GS3 A;  3HOZ H;  2HHH L;  4MTN A;  4CHT B;  1EIY B;  1CKM A;  3JAM E;  1KAB A;  3TN2 A;  3TRE A;  1IYV A;  4LF4 Q;  1JC7 A;  3DLL A;  2X69 A;  2BE5 D;  1PTO F;  1PYB A;  2PYK A;  4B3M L;  1H9K A;  4LF6 Q;  5C4X H;  5I4D A;  3PCO B;  2QEX A;  4BBS G;  3CCL A;  1UEA B;  1Q3L A;  1FNW A;  2DUD A;  5ELB A;  1YVC A;  2NN6 G;  3J80 c;  3CMA A;  1EQQ A;  4A3J H;  3N6R A;  1FGB D;  1GD7 A;  4KD3 A;  2UXD L;  4QJF A;  1RHP A;  4JYA Q;  1D1I A;  2RDG A;  3OMC A;  1B70 B;  2EYL A;  3RD4 A;  4UP7 A;  1CA6 A;  2I0Q A;  1OXS C;  2L1B A;  4LF5 L;  3GTG H;  1NY4 A;  1EY6 A;  4FXK C;  1FVI A;  3I2Z A;  2Z4I A;  4KKS A;  4RKB A;  1R9T B;  3C1F A;  2NVT H;  5IT9 L;  3TS2 A;  3FMC A;  1UUP A;  1YNN D;  4K5V A;  4KY6 A;  3MEH A;  1NCV A;  1K8O A;  3H3V I;  3D4W A;  4J15 A;  3P75 A;  1Q82 C;  4DUY L;  1GHK A;  1ML0 D;  4OWT B;  3C2P A;  1B50 A;  1TS3 A;  1G51 A;  2R93 G;  2K04 A;  4R4Q A;  5JEA G;  2AHO B;  1KD1 C;  2VQE Q;  3PF4 A;  3RR5 A;  2PMZ E;  2F0N A;  2WAQ B;  2CW0 C;  3TZU A;  2EQS A;  1GUS A;  4NXM L;  5K36 G;  1PZK D;  2B8G A;  1LTB D;  2G9D A;  2OTJ A;  1TVX A;  3HOX G;  3D3R A;  1IYJ B;  4B3R Q;  1U5K A;  4QQB X;  1VQB A;  4DNR B;  1GKH A;  2G9H D;  3CCJ A;  2RKS A;  4AYB B;  1DYQ A;  3HOU G;  3H09 A;  2KHJ A;  2NVY H;  1X3G A;  3KUP A;  4LW1 A;  2ID0 A;  1OXT A;  1WD0 A;  1IZ6 A;  1QZG A;  4LFA L;  1N33 L;  1TS5 A;  2I5H A;  3T51 B;  4NPS A;  1STN A;  2A68 D;  1HQR D;  2GN5 A;  1UE1 A;  4PQX A;  3TP7 A;  3M85 A;  4JI6 L;  2B39 A;  3I73 A;  1I94 Q;  1STE A;  4K5X A;  1WTH A;  1HNW Q;  5E4X A;  3S1Q H;  4LWC A;  1A0I A;  1Y1W B;  1TU2 B;  4KHZ A;  4DR5 Q;  3Q8D A;  3PMF A;  1CQF A;  2JP1 A;  4J1M A;  2MP1 A;  1ET6 A;  2Q2I A;  3BG3 A;  4JI2 Q;  1RDP D;  2VQF Q;  1HA5 A;  2B2U C;  2F0W A;  1X3P A;  1N36 Q;  1HCZ A;  2KHS A;  4RAU C;  4DFA A;  3S9W A;  4A93 H;  4C1N K;  2UUC L;  5CYU A;  2UUA Q;  1E3P A;  3KLW A;  3S24 A;  4DV7 Q;  4P74 A;  4DV3 Q;  3CF5 A;  4DUZ Q;  2A8V A;  4IUV A;  4DV4 L;  3S1N B;  3VR4 A;  2Q2U A;  3H3V C;  3M4Q A;  2ZTD A;  1LTI D;  5EBD A;  1WI5 A;  5DNF A;  1KLU D;  5C44 B;  3K6O A;  1HTP A;  2KEE A;  1JQY D;  2MPM A;  4JI7 Q;  1O7Z A;  1IBM L;  1O7Y A;  1MGS A;  4FF3 A;  3IL8 A;  4BY7 H;  1JJ2 A;  2JA9 A;  5GAG C;  5M5Y H;  4IOC A;  4P72 A;  1HFG A;  4KKT A;  1E1T A;  5AJ3 L;  4A3K H;  1C9O A;  3TDQ A;  1SSO A;  3GTM H;  2E5L Q;  4CKE A;  4K8I A;  3RLO A;  2FJ2 A;  2J4X A;  3S1M H;  1JIC A;  5I6Y A;  3P7J A;  3GTJ B;  2IW3 A;  2EIF A;  2A6H C;  2LSS A;  2EYH A;  1TS4 A;  4BBR B;  4FNF A;  4LF7 L;  2QA4 A;  1PH6 A;  2YTY A;  2H1E A;  1FNV A;  2K5V A;  4CJ0 B;  2AWN A;  2PQA B;  3I56 A;  1LV9 A;  4MN3 A;  1WTQ A;  1S4Z A;  1EWH A;  1X56 A;  2EJG C;  1K0R A;  2NVQ B;  4KN4 C;  1KRS A;  2VL6 A;  4A3D G;  2NZ1 D;  2EXZ A;  1IKM A;  3I4O A;  3DHQ A;  3MXN B;  1PMR A;  1RD9 D;  2IT1 A;  3E5S A;  4R8N A;  1CTM A;  4LFC Q;  4J8Q A;  2I46 A;  4U68 A;  3K7A B;  4HTH A;  4C2M B;  2OT2 A;  4EVO A;  1G2S A;  2L12 A;  2LFN A;  3G4S A;  1B8A A;  3K57 A;  1PYW D;  2L4N A;  1QOH A;  1SND A;  3I4N B;  2RCN A;  2JSO A;  1SMX A;  4GN5 A;  2C35 B;  3R2T A;  4EQN A;  2B2V A;  2KQ3 A;  1X6O A;  2EYM A;  2DY7 A;  3NK9 A;  3L2P A;  3FKI H;  5HGQ A;  3TP6 A;  1JOQ A;  5D3I B;  5EPJ A;  1R9T H;  1SE8 A;  2B8F A;  2WB1 G;  3G6J B;  1K73 C;  1GUW A;  1IKL A;  2F0V A;  5J22 A;  4H13 C;  4JI3 L;  3PO3 G;  1K83 B;  5CC4 A;  2V1C C;  1LTT D;  4K6L A;  5IGC A;  5HY6 A;  5FLX E;  1BQQ T;  2E2H H;  4GLV B;  1YEZ A;  2B29 A;  1AH9 A;  4R8I A;  4DNT B;  3PIP 3;  2K32 A;  5IYB H;  5AFW A;  4A3G G;  2I07 B;  2QCP X;  4NB3 A;  1IBK L;  1HZC A;  5EAY A;  2L15 A;  3CCV A;  3SK5 A;  2OWO A;  4ILW A;  1BF4 A;  3J81 E;  4KD4 A;  1PHJ A;  1MI2 A;  1OTC A;  2KUM A;  1LO5 D;  1XPR A;  3Q24 A;  1TKW B;  5IOD A;  1TWF B;  5IP9 G;  4NMZ A;  4B9X A;  5IIF A;  5IWA L;  3T53 B;  2RA4 A;  3K0Y A;  1W3S A;  1BCP C;  2PZW A;  4DNI A;  1SYD A;  1ZEQ X;  1XNQ L;  4DV0 L;  2F0L A;  4NP5 A;  2CH4 A;  5JVH 3;  2F0P A;  1X9N A;  1X32 A;  3RZO B;  2HDM A;  2PI2 E;  2EZV A;  5M3F G;  2B63 G;  3S15 B;  2ZM6 Q;  1SYE A;  4J6H A;  5G3L F;  2Y0S B;  1I4R A;  2Z4H A;  4B9W A;  1Q8K A;  2N8N A;  2JA6 B;  1NMG A;  3J80 L;  1E1O A;  3Q22 A;  3HOZ G;  1HTL D;  1JWM D;  3F2D A;  2DN8 A;  1SMY C;  1HZB A;  3OIQ A;  1A3V A;  1VQL A;  4JV5 Q;  5JJK A;  2A19 A;  1D6E C;  3P20 A;  1QVF A;  1A63 A;  4JC0 A;  4CJ1 B;  4DV2 L;  5C3W A;  3VYR A;  3MWY W;  1Q90 A;  1V8Q A;  5LMN W;  4WRD A;  4ZUI A;  1B4O A;  1DOK A;  5C4X G;  1BUV T;  1HQM C;  3GTO B;  2B3G A;  3L7Z C;  2QKI C;  3A55 A;  2BH8 A;  3PUX A;  1EQV A;  4A3J G;  2J0T D;  5L37 A;  4FF2 A;  3STB D;  1A2U A;  1K28 A;  3I4M B;  2NYZ D;  4K5W A;  1Q12 A;  3HFZ B;  5DAU A;  4X62 Q;  1X54 A;  3CQZ H;  2BA0 A;  4PZ7 A;  1Q8I A;  4UAI A;  1EWC A;  1PFN A;  3W1G A;  4B3T Q;  2F0F A;  4HSV A;  1JE4 A;  1JJC B;  5ISR A;  5CV7 A;  2OCE A;  2E2J H;  1X65 A;  2K5H A;  3PQI A;  3HOY B;  2Q8R E;  4Y52 H;  3KBX A;  2ATW A;  2JA8 H;  3A7L A;  1D1K A;  2JA5 B;  1EL0 A;  4DXG A;  4R4T A;  5J3B A;  3B6Y A;  2MJ8 A;  4JI0 Q;  4HIO A;  4V0B A;  1ASY A;  2VW9 A;  5C44 H;  1XNR L;  1KAA A;  3D4D A;  3CCU A;  4GN4 B;  3GTP H;  1G91 A;  1WYD A;  2YTX A;  1XJV A;  2IHF A;  1KXL A;  1XMO Q;  3T1Y L;  5IT9 E;  2KA7 A;  2DJG C;  2AUK A;  1VCI A;  4R1J A;  4IPC A;  2K05 A;  3EBE A;  1N32 Q;  1PH8 A;  2A69 C;  3V2T A;  1CA5 A;  2F3I A;  4JBW A;  5CV8 A;  5LMN L;  3H0G B;  5M9O A;  4KHP L;  1SDF A;  2OQ0 A;  4FXD A;  4JPB W;  4I7Z C;  3MHB A;  3IFD A;  3OHX C;  4NW2 A;  5ELD A;  1F2L A;  1PRT B;  3A8K E;  3IKJ A;  3GTJ H;  1HR0 Q;  4X66 L;  2C9O A;  4K0K L;  4ZCK A;  3CXC A;  4RA8 A;  3S2D B;  4X64 L;  4BBR H;  1NTG A;  1SRO A;  3NUC A;  3PSI A;  1NMF A;  2BCO A;  3HOV H;  2BOS A;  2HCI A;  2B2U A;  1CM9 A;  2K14 A;  2FIN B;  2IY5 B;  3HKZ G;  4A3C H;  3NTI A;  2ENB A;  3L3O C;  4TSS A;  4DGZ A;  2PZT A;  3BU2 A;  4IN3 A;  3K7U C;  1SFO H;  2WV6 D;  1KDA A;  4HID A;  1KC8 C;  1HR0 W;  4H0L C;  2WAQ E;  4F87 A;  1W6J A;  3M9B A;  1EOT A;  4DR4 L;  2CQA A;  4B3S Q;  1K8A C;  4LFB L;  1B3A A;  1Q7Y C;  4DKA C;  4PMW A;  4OIJ A;  4ME5 A;  3PO2 B;  4RKL A;  3ZYY X;  1XYI A;  4C1N I;  5JPM C;  4JG2 A;  4RCO A;  4AYB E;  1GJX A;  2QDL A;  3RZD H;  2XWB B;  3CCR A;  2MUY A;  3AFP A;  3TRZ A;  3U4V A;  2J7Z A;  3BVM A;  1VQ7 A;  2LY7 A;  4NXN Q;  4JVZ A;  1WFQ A;  4WJ4 A;  1SXT A;  5C4J H;  2MFI A;  1YI2 A;  3ZJY C;  5TSS A;  1TQO A;  3OTO Q;  1I3Q B;  4DAM A;  4WJ3 M;  5KNB A;  2HHH Q;  1SYB A;  4IPD A;  1LM0 A;  2TMP A;  2VY3 A;  2HCC A;  4CDD C;  3D4R A;  1Z7T A;  5IGF A;  4DV5 L;  3AFQ A;  4OWW B;  1FNU A;  1CI3 M;  5DLQ E;  3GV3 A;  4MIU A;  1WCM H;  2PW5 A;  1WTO A;  4B3M Q;  1KDB A;  1PRT F;  3CP0 A;  2XRQ D;  1A62 A;  3A74 A;  3PUV A;  1Y1V B;  3KFU A;  3NTH A;  2A73 B;  3TSS A;  3D31 A;  2KED A;  2K28 A;  4EGV A;  2NUC A;  4XQJ A;  1SNC A;  3HOW B;  4O2D A;  4A3E B;  2JA7 B;  4C3J B;  1PTO B;  2SDF A;  2F0E A;  4DF7 A;  2UXD Q;  3W1B A;  1S3O A;  1TT2 A;  1UE5 A;  4BY7 G;  3A8I E;  2D0O A;  4KN7 C;  4C56 C;  2PCF B;  4PMB A;  1TWF H;  4QIW B;  5D3D A;  5LL6 S;  4XQN A;  3PUW A;  4LF5 Q;  4K2K A;  2LS0 1;  4A3K G;  3H94 A;  2CH4 W;  3KF8 A;  5EKI A;  4OON A;  2ZT9 C;  3ND8 A;  3NTK A;  3FPP A;  4DR6 L;  3MEF A;  3SXH A;  4CKB A;  1V1Q A;  1LT5 D;  4YWM A;  3U9S A;  2RHQ B;  1PLF A;  4L8J A;  2N49 A;  4C3H H;  2R7Z B;  4H44 C;  3F2U A;  4DUY Q;  4G4K A;  3KBG A;  5C5L A;  2CCZ A;  2F0T A;  5M5X B;  1VMP A;  2WKD A;  2B2Y A;  2CWP A;  2UU9 L;  1JCK B;  3OMG A;  4P75 A;  1CFM A;  4HJ5 A;  3HKS A;  3F2B A;  1FJG L;  1B44 D;  2EY6 A;  1I4H A;  4DR3 L;  4GKK L;  1PZI D;  2A5H A;  1M8A A;  3QOJ A;  4L5T A;  5CV5 A;  3GD7 A;  4NXM Q;  2B63 H;  2EDG A;  4RGM A;  4DAV A;  4A3I H;  3GTO H;  2O4X A;  1C7Y A;  4HCS A;  1WTW A;  1B53 A;  4X65 L;  5GAH C;  2PZU A;  2RDF A;  5LMU L;  1GHJ A;  3T1H L;  2XWJ B;  1QJO A;  3RN5 A;  3VR6 A;  3KOJ A;  2ALY B;  4HMI A;  2A68 C;  1BOS A;  2L55 A;  5FO7 B;  3AB9 A;  4LFA Q;  1N33 Q;  2F52 A;  5KYI A;  3FKI G;  4YCV A;  3GTQ B;  4GN3 B;  1ILP A;  2JN4 A;  4JI6 Q;  2HQE A;  3S2H B;  5E7N A;  1SNP A;  4BWG B;  4GNX C;  5BR8 L;  5C3E H;  1SJE D;  3BZD B;  3DWA A;  2XRS D;  1RIP A;  1PFM A;  5M5W H;  4R4O A;  1VQI A;  1EY4 A;  4PG3 A;  2HIX A;  4N9T A;  5EBC A;  3S14 B;  4RGO S;  4UP9 A;  3TME A;  4JOI A;  2FMM A;  5IYB G;  1YHA A;  3NXW A;  3G7L A;  3FRP B;  3GTK H;  3CRL C;  1Y8N B;  1EIF A;  4UP8 A;  5JJI A;  3MXP A;  2WAQ G;  1B1Z A;  2UUC Q;  2YV5 A;  2EXD A;  2YYZ A;  4IFD J;  1VF5 C;  3A54 A;  3FEW X;  4DV4 Q;  4X3K A;  5T1I A;  2E74 C;  4RFB A;  1VQD A;  4BBS B;  1LTA D;  1K8M A;  3RUZ A;  4AYB G;  4G57 A;  2F0D A;  2FHT A;  4QUF A;  3BVZ A;  4A3B H;  3M3Y B;  1LAC A;  2EY1 A;  2EYJ A;  4UDU C;  4ALP A;  2F03 A;  4HJ8 A;  2N55 A;  2CWA A;  1IBM Q;  1PTO D;  2B2T A;  2I5L X;  3SDZ A;  4IUR A;  2A1A A;  3ITP A;  1EY0 A;  3GTL H;  2ZJP A;  1F9S A;  5CR3 A;  3W3A A;  2DJF C;  4DAP A;  5C4H A;  1D5X C;  5AJ3 Q;  1KRT A;  4ZRZ A;  5DM6 3;  2JQO A;  2VNU D;  2HQL A;  3J80 E;  3S17 H;  1XMQ L;  5I2X A;  1EOV A;  2VUM B;  2VS1 A;  1WD1 A;  5CBE E;  1GUN A;  1WJJ A;  1I4G A;  4IFD I;  2K5Q A;  4LF7 Q;  4APV A;  4H7B A;  1DD2 A;  2ZTC A;  1BNZ A;  3QB3 A;  2Y0S E;  3FDT A;  1IBL L;  1L0Y B;  2R93 B;  4YY3 L;  4CJ2 C;  4AIM A;  1I3Q H;  2R92 B;  3OW2 A;  4OX9 L;  4P71 A;  1Q86 C;  4IAL A;  1DGS A;  1WTR A;  1YJ9 A;  3EN2 A;  2JA8 G;  5EKL A;  2KCM A;  1EYC A;  1MIU A;  1U9R A;  1Y1V H;  2B2W C;  1SNO A;  2EJF C;  1VQN A;  5C44 G;  1QIL A;  4QMG A;  2Q8T A;  4HIM A;  2BH2 A;  4K2L A;  4Z9C B;  2R6G A;  3S1R B;  4O42 A;  3HOU B;  1PTO H;  4LF8 L;  5JVG 3;  3SVM A;  3LNN A;  5IYD G;  3MXG A;  4HJ9 A;  1I6H H;  3M7N A;  3PUY A;  1LT4 D;  1EY5 A;  5J39 A;  3CW2 C;  4OL7 A;  5JJZ A;  1VQ8 A;  2Z8L A;  1DON A;  5EGT A;  3JAM i;  3AU7 A;  5D14 A;  1Y8P B;  3R2I A;  2H4O A;  4IUU A;  1I50 H;  3NBI A;  5BN5 A;  2K4K A;  1X3E A;  2GA4 B;  2K50 A;  3QJY A;  4OO1 I;  2AQ3 B;  1S40 A;  4JI3 Q;  1FR3 A;  1WTP A;  2CHB D;  3TZD A;  4BBR G;  4C3I H;  3EFX D;  2NTS A;  4HSP A;  1HUN A;  1NE3 A;  1PDQ A;  4DR2 L;  4IUQ A;  1IL8 A;  3VYU A;  3HOV G;  4X3U A;  5KGU A;  1II3 A;  4A3C G;  3VR2 A;  2F0H A;  5M5X H;  1EIG A;  1HJP A;  2PNH A;  2WFW A;  2OQK A;  4IQZ A;  4N8X 1;  3X3M A;  1IBK Q;  3N52 A;  1M4V A;  4EQO A;  2KHI A;  1U4L A;  5FJ8 H;  4QL5 A;  2JXM B;  4BY1 H;  3KF8 B;  5T1G A;  1XTC D;  4FVM A;  3WWV A;  5C3X A;  3BDL A;  1VMC A;  5GAD C;  1TII D;  5JAV A;  2CW0 D;  3ULL A;  1P16 A;  5IWA Q;  3HP3 A;  2HD3 A;  3SK6 A;  2OF1 A;  2YU9 H;  3MXU A;  2MQH A;  1MJC A;  4F8M A;  3UDF A;  1XNQ Q;  4DV0 Q;  1HUM A;  4LF9 L;  1VQ6 A;  1GVP A;  3EJI A;  2Z6K C;  3UDG A;  2R7D A;  1VS0 A;  1WVL A;  1JOO A;  5GQO A;  2R61 A;  4POG A;  2LKV A;  3NEL A;  4JI4 L;  1LAB A;  1GO3 E;  1EY9 A;  3NQT A;  3IRB A;  3DEP A;  4AQY L;  4YWK A;  3PIO A;  2WAC A;  2E2D C;  1L1O A;  3BDO A;  1LLR D;  1J9O A;  1CHQ D;  2ASB A;  1PVO A;  1A15 A;  4DV2 Q;  1WCM G;  1U4P A;  3SE0 A;  3SHL A;  4A3F B;  4ZLT F;  1SE2 A;  1CT1 D;  4U67 3;  3ND9 A;  3NQI A;  2X6L A;  1F2Y A;  1SAP A;  4RG1 A;  4M1U B;  1J5E L;  1D8L A;  2JEB I;  3STB C;  4TRD A;  3G71 A;  5I6W A;  1EY7 A;  2EY5 A;  1X3F A;  1Z9F A;  4PZ6 A;  2R3Z A;  1HA6 A;  3RN2 A;  5EPL A;  1VQE A;  3M4O B;  2XGT A;  3WDN A;  4IJL A;  3OSO A;  4LJZ C;  4A3D B;  5COR A;  4R4C A;  2DNE A;  3URY A;  4DK1 A;  3OIP A;  2FFK B;  2K7V A;  4GOP A;  1ET9 A;  1KNA A;  1LTS D;  2QGQ A;  3AEV A;  1L0X B;  1IYU A;  4DR7 L;  1HH2 P;  4DK3 C;  1TWA B;  5CGK A;  3CU7 A;  4RHS A;  4Q5V A;  3E9I A;  3NE5 B;  1VQJ A;  3KJO A;  5DM7 3;  1BVS A;  2ICE C;  1O80 A;  3LX0 A;  1JT8 A;  1XNR Q;  4XT3 B;  2Y0S G;  4C3H G;  1Q1E A;  2PO4 A;  4XT1 B;  3T1Y Q;  2D2C C;  2UXC L;  4QIW E;  1HNZ L;  4H02 A;  1MD2 D;  1C8C A;  1G2T A;  2L9H A;  5LMN Q;  3A5Z B;  2HT1 A;  5IGE A;  3W5O A;  3L0O A;  2QF7 A;  3T56 B;  4KHP Q;  1QZH A;  1U0L A;  4X3T A;  4OEM B;  1AP0 A;  4YHH L;  1I4P A;  1SE4 A;  2VXW A;  4DN4 M;  2MHV A;  1DXM A;  4X66 Q;  4A3L H;  4A3I G;  4MZ9 A;  5CMD A;  3UDI A;  4K0K Q;  2D5D A;  4X64 Q;  1JMC A;  4DR1 L;  2F0I A;  4CDE C;  4R4I A;  5KEE A;  3VA5 A;  2GVA A;  3U4Z A;  1TY0 A;  3CCM A;  2QEJ C;  4ZUJ A;  3CC4 A;  2NBF A;  3CHB D;  5CV9 A;  2R92 H;  4ULL A;  1Y1W H;  1U4R A;  1PA6 A;  2K6A A;  3VYS A;  5FKA C;  3DMU A;  1IW7 D;  1BCP F;  1EY8 A;  2F0K A;  4RH6 A;  5C3E G;  4DR4 Q;  4XYO A;  4LFB Q;  3AQQ A;  1GUG A;  2M9V A;  1F9P A;  1H95 A;  1B7Y B;  2KCN A;  1HZA A;  1AE3 A;  1U4M A;  1NR2 A;  1FGU A;  5E4W C;  2NVX B;  3DEO A;  3S1R H;  5KIX A;  5EJW A;  1ASZ A;  1UAP A;  3OYY A;  1C48 A;  1BO0 A;  3L9A X;  4XQQ A;  3SGI A;  2EY2 A;  4Y7N B;  4RCN A;  4HED A;  3S1N H;  4IOA A;  3H0G G;  1FYC A;  3HOZ B;  4IFD H;  4QF4 A;  4FDB A;  4GKJ L;  3UI2 A;  1HXY D;  1ZXT A;  4R9W A;  1Q1B A;  4DU9 A;  4N8F A;  1GUT A;  3J7A 5;  2E76 C;  2XIW A;  1STG A;  1UWV A;  5ELO A;  4DV5 Q;  1JWS D;  4FP5 D;  2OTL A;  1PXU A;  2RF4 A;  3Q23 A;  1YNJ D;  4L5Q A;  5G3L D;  5IYD H;  4YCU A;  1PZJ D;  5ELF A;  2IPK D;  3BYT B;  1PH3 A;  4A3B G;  2ZJR A;  2RDH A;  4A3J B;  3FHW A;  1VQM A;  1LT3 D;  1RL2 A;  1XTD A;  2ZXR A;  1R4Q B;  1MKH A;  1V1P A;  4HN7 A;  1AZQ A;  2CVR A;  3I72 A;  2VZA A;  3M4Y A;  2D9U A;  3GTG B;  3BJU A;  2MO0 A;  1HRJ A;  5M3M B;  2K5W A;  1V9P A;  3H15 A;  1GXD C;  1W2B A;  4TVA B;  1IHZ A;  1WTX A;  2NVT B;  4IPH A;  3D8G A;  3BZK A;  1KQS A;  1E7Z A;  1UE6 A;  4X6A H;  2NVQ H;  1S5E D;  1CQV A;  4DR6 Q;  2F1M A;  3QIA A;  1D5M C;  2EJM A;  4A3M B;  4OO1 H;  3I4L A;  1RTN A;  5JOB A;  3FP9 A;  1G6Z A;  4L5R C;  3J81 i;  3KLS X;  3K7A H;  1ZYR D;  4HCE A;  4C2M H;  3Q0A A;  1CKN A;  1VQO A;  2UU9 Q;  3U58 A;  3I3C A;  1EUJ A;  3EQL C;  1KDC A;  2EYF A;  1FJG Q;  1UEB A;  2OEO A;  4DR3 Q;  4GKK Q;  3I4N H;  1O7L A;  3TP8 A;  4KK7 A;  1Y1V G;  1N8R C;  1MBY A;  4DXF A;  4JBM A;  1NNX A;  4GLX A;  1I5F A;  2KEN A;  4X65 Q;  1ESR A;  4C3J G;  2PNR C;  1BDO A;  2TSS A;  5LMU Q;  2NVY B;  3T1H Q;  1EEF D;  1P8L A;  1E24 A;  2G5D A;  3HZX A;  3HKZ B;  4DAY A;  1AEX A;  2BE5 C;  4KY5 A;  2HDL A;  4PNY A;  2XSC A;  1K83 H;  3A0J A;  1EQT A;  1L1O B;  2CKZ B;  2MNA A;  5IY0 A;  4NKL A;  5KNC A;  4GZY C;  3AYH B;  1TWA H;  4FYD A;  3S1Q B;  5BR8 Q;  4UHV A;  4JI8 L;  1NR4 A;  4CGY B;  4P73 A;  3K5L A;  3LWU A;  3NPP A;  2Z6B A;  3WOF A;  4MNO A;  1AN8 A;  3MFY A;  4IZ8 A;  2BA1 A;  4ABN A;  4C3I G;  4KLK A;  4EQ5 A;  1STB A;  3I7F A;  1SNM A;  1NJI C;  4CKC A;  2Q2T A;  4ID6 A;  1I6V C;  3EA6 A;  5F2D A;  1XXG A;  1HPC A;  3J81 j;  3EVQ A;  2JYO A;  2ZJQ A;  5HGT A;  3A7A B;  5FJ8 G;  4A93 B;  1YNN C;  4GOP B;  4BY1 G;  1XPU A;  3PV0 A;  4WFN 3;  1N34 L;  1AE2 A;  2RBM A;  3K8A A;  3I90 A;  3RZO H;  1LTL A;  1KTK A;  1Y14 B;  3S15 H;  3KLR A;  4A76 A;  3R8B A;  1SLJ A;  1ENF A;  1I4Q A;  5K5P A;  5CV6 A;  3U9O A;  1DCZ A;  2JA6 H;  3LWE A;  3VDY A;  5C5M A;  4X3S A;  1W6K A;  1EEI D;  2LXJ A;  4PZ8 A;  4XIG S;  2F4I A;  3W2D A;  3I55 A;  4IO9 A;  2B2V C;  2JJQ A;  1PTO C;  5C4Z A;  5CV4 A;  4BS9 A;  2UXB L;  1X3Q A;  4UPA A;  3MZ5 A;  1STY A;  2JE6 I;  3ERQ A;  1Q46 A;  1PRT D;  5M5Y B;  1ILQ A;  1YIT A;  3T13 A;  4EQP A;  1GOZ A;  4ZK9 B;  3E3X A;  5IOC A;  3PIP A;  5LL6 X;  3GTM B;  1F9R A;  4DV1 L;  3HS0 C;  3I4M H;  2RHS B;  3A8J E;  1SR3 A;  2F0M A;  3R3O A;  1XMQ Q;  2F0G A;  3D6W A;  2NB0 A;  4RMF A;  4YWL A;  3V96 A;  3RNU A;  2CQO A;  5FLM H;  1QUQ A;  5KND A;  4XTC S;  1BXT A;  3G48 A;  3I8Z A;  2E8G A;  5BN3 A;  3QR8 A;  4DV6 L;  1PV4 A;  2RVL A;  5COY A;  2AKW B;  3V05 A;  3HOY H;  1K9M C;  3TBI B;  2F0Q A;  2NN6 I;  3HRZ C;  5JEA J;  4OGQ C;  1IBL Q;  2JA5 H;  4LUV A;  4JBJ A;  4YY3 Q;  4JI1 L;  4OX9 Q;  3CCE A;  2UUB L;  1DM0 B;  2PQE A;  1PH7 A;  5E1F A;  2AMC B;  1EU3 A;  1SJH D;  3CPW A;  2HIV A;  2F3V A;  2LXK A;  1XPO A;  1MSH A;  4QB4 A;  1HNX L;  2WKC A;  2CFM A;  3HGB A;  2F0O A;  3GV6 A;  4KJN A;  3H0G H;  3NEM A;  4I65 A;  4MHE A;  2A6E D;  3WOE A;  1VQ5 A;  4LF8 Q;  1PYS B;  4KY7 A;  2F4V L;  4KMU C;  1QG7 A;  3GDE A;  3F1Z A;  3FKI B;  3S2D H;  2KOL A;  5M3M H;  2RSN A;  2NZH A;  1XX8 A;  3NWS A;  4RWS C;  2KVM A;  1EWI A;  1GUO A;  3FVQ A;  1A2T A;  1SYC A;  1A6X A;  2VUM G;  4A3L G;  1SE3 A;  5A2Q L;  1H9R A;  3J7Y W;  2E2H B;  3OW7 A;  1HFN A;  2H5X A;  1YZ6 A;  4EX5 A;  1JB3 A;  5EPK A;  4DR2 Q;  4A3M H;  3VYT A;  3GP7 A;  2IX0 A;  5IYC G;  1AFP A;  2IJ0 A;  3CCS A;  2AQ2 B;  3BVG A;  5IP7 H;  1V1P B;  1QWY A;  2R92 G;  5FO9 B;  4FXG C;  1Y1W G;  2K75 A;  1Y69 U;  3PO2 H;  1MSG A;  1PH2 A;  4YIJ A;  2I5M X;  4G7H C;  3KF6 A;  4JI5 L;  4ZKB B;  2WB1 E;  2XN9 C;  1VQP A;  5ELC A;  2DY8 A;  3IAY A;  2K1B A;  2JEA I;  1ENC A;  1J6Q A;  1RKN A;  3MVV A;  4LF9 Q;  3E0J A;  4LF4 L;  1TWC B;  1NUC A;  1RF2 D;  1V1O A;  3CRK C;  4JI4 Q;  1BKB A;  3C46 A;  1VF7 A;  4LF6 L;  3HG9 A;  1CKN B;  4IFD G;  3MAQ A;  2K01 A;  4DA2 A;  4AQY Q;  4RGT A;  2WP8 J;  1JR0 D;  1QB5 D;  2YTV A;  3HOX B;  4JBK A;  2MGS A;  2IX1 A;  1OXU A;  3D0F A;  2L11 A;  4L5S A;  4K8J A;  4HR7 B;  4Q0F A;  1NAP A;  3HOW H;  4A3E H;  5C0X J;  2JA7 H;  1EZ8 A;  1RCV D;  3NBH A;  4C3J H;  2A74 C;  2O5I C;  4JYA L;  4S3S A;  4PV1 C;  2ZXO A;  3C3L A;  1H9S A;  2XVS A;  1HZ9 A;  3MA2 B;  4RHR A;  2QW7 A;  3K0X A;  4O1N A;  5J1Z A;  4M8A A;  2BDO A;  1J5E Q;  4DAY B;  2NWG A;  5H1S E;  4HJ7 A;  1JWU D;  1SRU A;  2EVB A;  1QCB D;  4HIK A;  4QCL A;  1G29 1;  2L5T A;  5BN4 A;  5IGG A;  3FPU B;  3CAM A;  4BXX H;  1FL0 A;  3DM1 A;  1STH A;  3CQZ B;  4OEL B;  2SNM A;  4KHV A;  1AW7 A;  2E2J B;  2N88 A;  2M2L A;  3KDF A;  3NSW A;  3S16 B;  2ZTE A;  2K03 A;  4IJH A;  2JA8 B;  2R7Z H;  4DR7 Q;  3IFT A;  4XDX A;  2R7F A;  1RJT A;  1TWG B;  2O2L D;  1CSP A;  3K80 C;  4JCV E;  3GTP B;  2VQE L;  1KL9 A;  4JW0 A;  1QVG A;  4OO1 G;  1EIH A;  5C0X I;  3QG1 A;  1B2T A;  1E2W A;  2F0J A;  1PH1 A;  1DOL A;  3J7A V;  3DWP A;  4O0A A;  2UXC Q;  2DNC A;  1HNZ Q;  4B3R L;  3DXJ C;  1CKO A;  3OWF A;  4A3F G;  3BS1 A;  3E0E A;  4OXP A;  3DWQ A;  4DK6 C;  3U50 C;  3I4N G;  4YHH Q;  1TY2 A;  1UE7 A;  2EYP A;  1ZKO A;  5FLX c;  5C0X G;  1SEB D;  5NUC A;  1KLG D;  3OOC A;  4DR1 Q;  2GVB A;  3MTS A;  2DGY A;  2M00 A;  3HOV B;  3UDX A;  3GTQ H;  1S5D D;  3GQB A;  3OWE B;  1Y8O B;  1I94 L;  1YIJ A;  1N9W A;  1E2V A;  3P1H A;  2JK8 A;  5A35 A;  1RTO A;  4E6I A;  3S2H H;  1HNW L;  1EYA A;  3J81 c;  3A5U A;  1BR9 A;  5IGD A;  4MTK A;  4ZAI A;  4DR5 L;  1SFO B;  4G7O C;  2PW7 A;  1S5F D;  3S14 H;  1IW7 C;  1OXV A;  4RGN A;  4JI2 L;  3SR1 A;  3JAM L;  1B9M A;  1QNK A;  2VQF L;  3J80 i;  1F9Q A;  1N36 L;  4FF1 A;  2Q8I B;  1I4X A;  3X3N A;  3PF5 A;  1B3Q A;  1QUQ B;  3CC7 A;  2IX3 A;  4QGU A;  2UUA L;  3RZD B;  1BCP B;  2D62 A;  1BBW A;  1KAW A;  3HKZ E;  1M1K C;  4DV7 L;  4DV3 L;  1YNX A;  4DUZ L;  3EIV A;  4DK0 A;  3E6Z X;  5C4J B;  3ULJ A;  1O7I A;  3I91 A;  3KYH C;  4FF4 A;  1VQF A;  2B2Y C;  3K59 A;  1EYG A;  1GM5 A;  1D5Z C;  3MC0 B;  4BBS H;  1O78 A;  4GKJ Q;  1PH9 A;  2F0U A;  2Q2H A;  3TQY A;  4YCW A;  1WTV A;  1SNQ A;  2V4D A;  1MJE A;  2NN6 H;  2K33 A;  1YJW A;  3M3Y H;  2IL8 A;  3QWN A;  1VQK A;  2ZXP A;  1E0B A;  3H6M A;  1WCM B;  4JI7 L;  4HMJ A;  4QUC A;  4GLA C;  3ERO A;  1YNJ C;  1BBX C;  2JA6 G;  2X6G A;  4TQU S;  1H9M A;  2PI2 A;  3ICE A;  4ODG A;  4IPG A;  2BDN A;  5ELE A;  4B08 A;  2P5Z X;  3A56 A;  2E5L L;  2PMZ B;  4GNX A;  1F77 A;  2WB1 B;  5IGB A;  1NBW A;  2EYO A;  4K6D A;  1M90 C;  3PO3 B;  1CZW A;  4OWX B;  2VUM H;  2A6H D;  1F2M A;  5LHY 1;  1DJR D;  3LGJ A;  1S5C D;  2Z9H A;  3I4M G;  5IYC H;  1FD7 D;  3F8T A;  1ROD A;  1TS2 A;  2QDB A;  4A3G B;  2E2I B;  1TR5 A;  1A3T A;  4KI0 A;  2XNA C;  3R93 A;  5I9O A;  1JB7 A;  1E22 A;  3PUZ A;  2R93 H;  5GRO A;  2L0C A;  3T16 A;  5FLM G;  5JEA H;  1TWC H;  5IT9 c;  4JOI C;  1VQG A;  1OO9 B;  1A8V A;  4C3H B;  2FXQ A;  4KKU A;  4A4I A;  4V19 0;  4OIK A;  2NZO A;  1SYF A;  3H3V H;  3HOY G;  3ERS X;  5EQ0 A;  3CME A;  4LFC L;  1CK1 A;  1T5E A;  3KF6 B;  1SN8 A;  5K36 H;  2JA5 G;  2IHE A;  1ZYR C;  1UNS A;  2ICI A;  4P2C B;  2AUJ D;  3HOX H;  4WOR A;  4N9P A;  3QOL A;  1YBY A;  4CBV A;  1X55 A;  3HOU H;  5E3F A;  1B9N A;  1VQC A;  5M3F B;  2B63 B;  1TWH B;  1PFB A;  4A3I B;  1R4P B;  1D7Q A;  1YHB A;  1MHW C;  4IUN A;  3RLF A;  1SYG A;  1A3U A;  3KLS A;  2VB3 X;  3C1E A;  1ESF A;  1PFS A;  4TKO B;  2QIL A;  5KYL A;  1LT6 D;  4ZKC B;  4CDC C;  4LNQ A;  1LUZ A;  3JC6 6;  5I9P A;  1KIX A;  3SK4 A;  3TP5 A;  2LMC B;  2B2T C;  3PGZ A;  5C4X B;  2N3S A;  5M3M G;  1JE5 A;  3S16 H;  4DPG A;  1PH5 A;  3NBH B;  1CHP D;  3ULP A;  1VQ9 A;  1CUK A;  3K58 A;  5C3E B;  1H9S B;  4G7Z C;  1SBB B;  4XXE A;  4QY7 A;  4A75 A;  4LUZ A;  4LMQ D;  5M5W B;  2KBN A; 
#chains in the Genus database with same CATH homology
 4JI8 Q;  4APV A;  1TWG H;  2RCN A;  2ZTC A;  3VDY A;  1SMX A;  4GN5 A;  2C35 B;  2Y0S E;  1L0W A;  1X6O A;  4POF A;  4A3M G;  2LXJ A;  1IBL L;  4PZ8 A;  1VQH A;  4XIG S;  3L2P A;  3FKI H;  3CC2 A;  1Z47 A;  5HGQ A;  3I55 A;  4YY3 L;  5IP7 G;  4AIM A;  1I3Q H;  4IO9 A;  3OW2 A;  1VQ4 A;  3K81 C;  2JJQ A;  1BBU A;  4P71 A;  1R9T H;  1SE8 A;  4OX9 L;  1Q86 C;  2WB1 G;  1K73 C;  2UXB L;  4UPA A;  2JE6 I;  3PO2 G;  1Q46 A;  4JI3 L;  1YIT A;  3PO3 G;  1QVC A;  1DGS A;  3KDF B;  2V1C C;  1YJ9 A;  1JJG A;  3EN2 A;  3PIP A;  2JA8 G;  2KCM A;  5HY6 A;  1N34 Q;  2E2H H;  1L2F A;  4DV1 L;  1MIU A;  3I4M H;  3CPF A;  1Y1V H;  2RHS B;  4GLV B;  2ZM6 L;  1SR3 A;  1YEZ A;  2B29 A;  1XMQ Q;  1VQN A;  1AH9 A;  5C44 G;  4HIM A;  2BH2 A;  5IYB H;  4RMF A;  4YWL A;  4A3G G;  2R6G A;  3RNU A;  1LYL A;  4NB3 A;  2CQO A;  5FLM H;  1IBK L;  1QUQ A;  1HZC A;  2N78 A;  4XTC S;  2L15 A;  5EAY A;  3G6E A;  2KCT A;  3CCV A;  3G48 A;  2OWO A;  5IYD G;  4JV5 L;  1PHJ A;  2E8G A;  4HJ9 A;  1I6H H;  3M7N A;  3PUY A;  4DV6 L;  1PV4 A;  1OTC A;  2AKW B;  1XPR A;  3HOY H;  1K9M C;  3CW2 C;  1G6P A;  2NN6 I;  5JEA J;  1IBL Q;  1VQ8 A;  1OXX K;  5IP9 G;  3JAM i;  5IWA L;  4WJ4 A;  2JA5 H;  4LUV A;  4JBJ A;  1W3S A;  4YY3 Q;  4A3F H;  4JI1 L;  4OX9 Q;  4HJA A;  3CCE A;  4DNI A;  3ER0 A;  1I50 H;  1V43 A;  2UUB L;  5IE8 A;  2K4K A;  1PH7 A;  2UXB Q;  1XNQ L;  2AMC B;  1WOC A;  4DV0 L;  1X3E A;  2K50 A;  2XTI A;  1YJN A;  4OO1 I;  1S40 A;  4JI3 Q;  3CCQ A;  3CPW A;  2HIV A;  4BBR G;  2LXK A;  4C3I H;  1XPO A;  3UE1 A;  4A3E G;  3HOW G;  3J7Z C;  1NE3 A;  1X9N A;  1HNX L;  2JA7 G;  4DR2 L;  4DV1 Q;  1KHI A;  2CFM A;  2PI2 E;  5M3F G;  3HOV G;  2B63 G;  2ZM6 Q;  1EFW A;  4X62 L;  3H0G H;  3NEM A;  4B3T L;  1Q8K A;  3M4O H;  2N8N A;  4A3C G;  1NMG A;  1E1O A;  4A3D H;  3HOZ G;  5M5X H;  1HJP A;  1VQ5 A;  2PNH A;  2WFW A;  2OQK A;  3F2D A;  1PYS B;  1IBK Q;  1HZB A;  4LF8 Q;  1C0A A;  2F4V L;  1VQL A;  2KHI A;  5FJ8 H;  2A19 A;  2MO1 A;  4QL5 A;  3RLN A;  4JV5 Q;  5JJK A;  3GDE A;  4DV6 Q;  4BY1 H;  3KF8 B;  4AH6 A;  3F1Z A;  1QVF A;  3S2D H;  3NEN A;  3WWV A;  1A63 A;  4JC0 A;  5GAD C;  4LUO A;  4A93 G;  4DV2 L;  5M3M H;  4JI0 L;  4BXX G;  4BA1 I;  5LMN W;  3ULL A;  1P16 A;  3DM3 A;  2NZH A;  5IWA Q;  5C4X G;  3BZC A;  1EWI A;  4JI1 Q;  2YU9 H;  2MQH A;  1MJC A;  2Z6K A;  2UUB Q;  3UDF A;  1XNQ Q;  4DV0 Q;  1XMO L;  2B3G A;  3L7Z C;  2VUM G;  4A3L G;  2ES2 A;  2BH8 A;  3PUX A;  4LF9 L;  2R7Z G;  1VQ6 A;  4A3J G;  1GVP A;  3STB D;  2Z6K C;  1N32 L;  3UDG A;  2R7D A;  1Q12 A;  1VS0 A;  1YZ6 A;  2H5X A;  3E9H A;  4EX5 A;  1HNX Q;  4DR2 Q;  5GQO A;  1CSQ A;  4A3M H;  4POG A;  2IX0 A;  1T9H A;  5IYC G;  3HFZ B;  3NEL A;  4JI4 L;  3CCS A;  1S72 A;  3JAM c;  4ME3 A;  5IP7 H;  1GO3 E;  3UE0 A;  4X62 Q;  1X54 A;  3CQZ H;  2BA0 A;  3IRB A;  4PZ7 A;  2K5N A;  3W1G A;  4AQY L;  4YWK A;  4B3T Q;  2R92 G;  4BXX H;  3PIO A;  1HR0 L;  1JJC B;  1Y1W G;  2K75 A;  2E2J H;  2OCE A;  3PO2 H;  1X65 A;  1PH2 A;  2K5H A;  1L1O A;  2F4V Q;  3PO3 H;  2I5M X;  3KF6 A;  4Y52 H;  2AWO A;  4JI5 L;  2ASB A;  2ATW A;  1PVO A;  2JA8 H;  2WB1 E;  4R4T A;  5J3B A;  1VQP A;  4DV2 Q;  1L1O C;  1WCM G;  3B6Y A;  3KJP A;  4HIO A;  4JI0 Q;  1ASY A;  5GAE C;  2JEA I;  2VW9 A;  3TEH B;  5C44 H;  1XNR L;  1PH4 A;  3CCU A;  3GTP H;  4GN4 B;  1IL2 A;  3TS0 A;  1WYD A;  1J6Q A;  4RG1 A;  2YTX A;  1J5E L;  1D8L A;  2JEB I;  1XJV A;  2E2I H;  2IHF A;  4A3G H;  1KXL A;  1XMO Q;  3STB C;  3T1Y L;  2PQA A;  3G71 A;  4LF9 Q;  3F2C A;  1VCI A;  4R1J A;  4IPC A;  1X3F A;  3EBE A;  4LF4 L;  1PH8 A;  1Z9F A;  4PZ6 A;  1N32 Q;  2F3I A;  1TXY A;  4JBW A;  4GNX B;  3GO5 A;  3M4P A;  5LMN L;  3RN2 A;  5IP9 H;  4B3S L;  4JI4 Q;  1BKB A;  1VQE A;  4KHP L;  2XGT A;  4BA2 I;  4LF6 L;  1K8G A;  4IJL A;  2OQ0 A;  1CKN B;  4R4C A;  5ELN A;  4IFD G;  1EQR A;  1K3R A;  2D0P A;  4AQY Q;  2WP8 J;  3GTJ H;  1HR0 Q;  4GOP A;  2YTV A;  4X66 L;  2QGQ A;  4JBK A;  2IX1 A;  3AEV A;  1OXU A;  3D0F A;  3CD6 A;  4K0K L;  3CXC A;  2Z0S A;  4DR7 L;  1HH2 P;  4DK3 C;  4X64 L;  4BBR H;  1VQA A;  1Q81 C;  4L5S A;  4JI5 Q;  2NVX H;  1NTG A;  1SRO A;  4A3E H;  3HOW H;  3PSI A;  4GOP C;  5C0X J;  2JA7 H;  1NMF A;  4JYA L;  3E9I A;  4C3J H;  1YHQ A;  1VQJ A;  3KJO A;  5M3F H;  1BVS A;  3HOV H;  5JJL A;  1TWH H;  4NXN L;  1HZ9 A;  2K52 A;  1JT8 A;  1XNR Q;  2K14 A;  1IXR A;  3K0X A;  3HKZ G;  4Y7N H;  4UY8 C;  4A3C H;  2IY5 B;  2Y0S G;  3OTO L;  1J5E Q;  4GS3 A;  3HOZ H;  1Q1E A;  4DAY B;  2HHH L;  4MTN A;  3T1Y Q;  3BU2 A;  1EIY B;  1CKM A;  5H1S E;  4HJ7 A;  3K7U C;  1SRU A;  3TRE A;  4HIK A;  2UXC L;  1SFO H;  4LF4 Q;  1G29 1;  4QIW E;  1HNZ L;  3DLL A;  4HID A;  1KC8 C;  4H02 A;  1HR0 W;  2WAQ E;  3CAM A;  3M9B A;  1PYB A;  4DR4 L;  1FL0 A;  3A5Z B;  5LMN Q;  4B3M L;  3W5O A;  3L0O A;  1K8A C;  4B3S Q;  2HT1 A;  1QZH A;  4LF6 Q;  1U0L A;  4KHP Q;  5C4X H;  1Q7Y C;  4LFB L;  3PCO B;  4DKA C;  4PMW A;  4YHH L;  2QEX A;  4BBS G;  3KDF A;  3CCL A;  2DUD A;  2ZTE A;  4X66 Q;  4A3L H;  4IJH A;  4A3I G;  4MZ9 A;  1YVC A;  2NN6 G;  3UDI A;  3J80 c;  3CMA A;  4JG2 A;  1EQQ A;  4A3J H;  2R7Z H;  4DR7 Q;  4K0K Q;  4AYB E;  4X64 Q;  4DR1 L;  1JMC A;  3RZD H;  1GD7 A;  2UXD L;  2R7F A;  4QJF A;  3CCR A;  4JYA Q;  4R4I A;  1CSP A;  3K80 C;  3AFP A;  4JCV E;  2GVA A;  3TRZ A;  3U4V A;  2VQE L;  1VQ7 A;  1B70 B;  4NXN Q;  3U4Z A;  1WFQ A;  1KL9 A;  4UP7 A;  3CCM A;  1OXS C;  2I0Q A;  1QVG A;  5C4J H;  3CC4 A;  5C0X I;  4OO1 G;  2MFI A;  1YI2 A;  4LF5 L;  3ZJY C;  3GTG H;  1NY4 A;  2R92 H;  1PH1 A;  1FVI A;  3OTO Q;  4DAM A;  3I2Z A;  4WJ3 M;  1Y1W H;  2HHH Q;  1PA6 A;  4IPD A;  1LM0 A;  2VY3 A;  2NVT H;  4O0A A;  2UXC Q;  3TS2 A;  4DV5 L;  1HNZ Q;  4B3R L;  3AFQ A;  4OWW B;  5DLQ E;  1WCM H;  5C3E G;  4DR4 Q;  1CKO A;  4B3M Q;  4LF7 Q;  3CP0 A;  3H3V I;  4LFB Q;  1A62 A;  3AQQ A;  4A3F G;  3A74 A;  3PUV A;  1H95 A;  1B7Y B;  3E0E A;  4OXP A;  4DK6 C;  3U50 C;  3I4N G;  4YHH Q;  1HZA A;  1UE7 A;  3KFU A;  4J15 A;  1AE3 A;  3D31 A;  5FLX c;  5C0X G;  1Q82 C;  4DUY L;  4OWT B;  1FGU A;  4O2D A;  3S1R H;  1ASZ A;  4DR1 Q;  3OYY A;  2GVB A;  1G51 A;  2DGY A;  2R93 G;  2UXD Q;  3UDX A;  3GTQ H;  3W1B A;  1S3O A;  1I94 L;  1UE5 A;  4R4Q A;  1N9W A;  1YIJ A;  4BY7 G;  3SGI A;  2AHO B;  5JEA G;  2D0O A;  1KD1 C;  2JK8 A;  2VQE Q;  3PF4 A;  3S2H H;  3RR5 A;  1HNW L;  1TWF H;  2PMZ E;  3J81 c;  3S1N H;  3A5U A;  3H0G G;  3PUW A;  4IOA A;  4LF5 Q;  4FDB A;  4DR5 L;  2EQS A;  4A3K G;  4GKJ L;  4NXM L;  5K36 G;  1Q1B A;  2OTJ A;  3J7A 5;  4OON A;  3S14 H;  3HOX G;  1UWV A;  1OXV A;  5ELO A;  4JI2 L;  4DV5 Q;  1IYJ B;  4B3R Q;  1U5K A;  2OTL A;  4QQB X;  1VQB A;  2VQF L;  1GKH A;  2RF4 A;  3J80 i;  4DR6 L;  3CCJ A;  3MEF A;  1N36 L;  4L5Q A;  3HOU G;  5IYD H;  2KHJ A;  4YCU A;  1V1Q A;  2NVY H;  1X3G A;  4YWM A;  3PF5 A;  2RHQ B;  4LW1 A;  2ID0 A;  1OXT A;  1QUQ B;  1IZ6 A;  2N49 A;  3CC7 A;  4C3H H;  1QZG A;  1PH3 A;  4QGU A;  2ZJR A;  4A3B G;  4LFA L;  1N33 L;  4DUY Q;  2I5H A;  2UUA L;  4NPS A;  2D62 A;  2CCZ A;  3FHW A;  2GN5 A;  1BBW A;  1UE1 A;  1KAW A;  3HKZ E;  3M85 A;  1M1K C;  4JI6 L;  4DV7 L;  1VQM A;  1RL2 A;  1XTD A;  2CWP A;  4DV3 L;  1YNX A;  1MKH A;  4DUZ L;  2UU9 L;  4P75 A;  1I94 Q;  3EIV A;  4HJ5 A;  3HKS A;  3ULJ A;  3F2B A;  1O7I A;  1FJG L;  2VZA A;  3KYH C;  1HNW Q;  1VQF A;  3S1Q H;  3BJU A;  2MO0 A;  4LWC A;  1GM5 A;  4DR3 L;  1EYG A;  4GKK L;  1A0I A;  1V9P A;  3H15 A;  4BBS H;  4L5T A;  4KHZ A;  4DR5 Q;  4GKJ Q;  1W2B A;  1PH9 A;  3Q8D A;  3GD7 A;  2Q2H A;  4TVA B;  3TQY A;  4YCW A;  4NXM Q;  2B63 H;  4A3I H;  4IPH A;  1MJE A;  3GTO H;  1YJW A;  1C7Y A;  3M3Y H;  2Q2I A;  1VQK A;  3BZK A;  1KQS A;  1E7Z A;  1UE6 A;  4JI2 Q;  4X65 L;  5GAH C;  4JI7 L;  4GLA C;  2NVQ H;  4X6A H;  5LMU L;  2VQF Q;  3T1H L;  4TQU S;  2JA6 G;  4DR6 Q;  3RN5 A;  2PI2 A;  1N36 Q;  3KOJ A;  3ICE A;  2ALY B;  4IPG A;  3FP9 A;  4A93 H;  4LFA Q;  1N33 Q;  2E5L L;  2F52 A;  4L5R C;  3FKI G;  2UUC L;  2UUA Q;  3J81 i;  4YCV A;  4GNX A;  1E3P A;  3KLW A;  4GN3 B;  4JI6 Q;  3S24 A;  3K7A H;  4DV7 Q;  1NBW A;  1VQO A;  4C2M H;  1M90 C;  1CKN A;  4P74 A;  3CF5 A;  4DUZ Q;  4DV3 Q;  3U58 A;  5E7N A;  2UU9 Q;  2A8V A;  4OWX B;  4DV4 L;  1EUJ A;  5BR8 L;  5C3E H;  4GNX C;  2VUM H;  1FJG Q;  1UEB A;  2Q2U A;  3M4Q A;  1RIP A;  2ZTD A;  5M5W H;  4DR3 Q;  4R4O A;  3I4N H;  4GKK Q;  1WI5 A;  1VQI A;  3LGJ A;  4PG3 A;  2HIX A;  3I4M G;  1Y1V G;  5IYC H;  3F8T A;  4UP9 A;  1N8R C;  4JBM A;  4JOI A;  4KI0 A;  4GLX A;  1JB7 A;  1I5F A;  1E22 A;  2KEN A;  3PUZ A;  5GRO A;  5IYB G;  1YHA A;  4X65 Q;  1IBM L;  4JI7 Q;  2R93 H;  4BY7 H;  5FLM G;  5LMU Q;  3T1H Q;  1JJ2 A;  1TWC H;  1P8L A;  1E24 A;  2JA9 A;  1VQG A;  4JOI C;  5GAG C;  5IT9 c;  3GTK H;  1A8V A;  2FXQ A;  1EIF A;  4UP8 A;  4A4I A;  5M5Y H;  4IOC A;  2NZO A;  1K83 H;  3A0J A;  4P72 A;  3H3V H;  3HOY G;  5JJI A;  1L1O B;  1E1T A;  3ERS X;  5AJ3 L;  1C9O A;  2CKZ B;  4LFC L;  2MNA A;  3CME A;  4A3K H;  5IY0 A;  2WAQ G;  3KF6 B;  1SN8 A;  2E5L Q;  3RLO A;  2JA5 G;  2UUC Q;  3GTM H;  2YV5 A;  2EXD A;  2IHE A;  2YYZ A;  3S1M H;  4IFD J;  3HOX H;  2EIF A;  2LSS A;  3AYH B;  1TWA H;  4DV4 Q;  5BR8 Q;  1YBY A;  4LF7 L;  4JI8 L;  2QA4 A;  1X55 A;  4P73 A;  1PH6 A;  3HOU H;  2YTY A;  1VQD A;  4MNO A;  4LF8 L;  1VQC A;  2BA1 A;  2K5V A;  2AWN A;  4AYB G;  2PQA B;  3I56 A;  4KLK A;  4A3B H;  4EQ5 A;  3I7F A;  1D7Q A;  1YHB A;  1NJI C;  1X56 A;  2Q2T A;  1K0R A;  3RLF A;  1KRS A;  2VL6 A;  4ALP A;  3J81 j;  4A3D G;  4HJ8 A;  2CWA A;  1IBM Q;  2ZJQ A;  3I4O A;  1PFS A;  2I5L X;  3MXN B;  2IT1 A;  2A1A A;  5FJ8 G;  3GTL H;  2ZJP A;  1LUZ A;  4BY1 G;  3JC6 6;  4GOP B;  1KIX A;  4LNQ A;  1XPU A;  3PV0 A;  3PGZ A;  1N34 L;  1AE2 A;  5AJ3 Q;  1KRT A;  2N3S A;  5M3M G;  3K8A A;  4LFC Q;  1JE5 A;  3RZO H;  1LTL A;  2JQO A;  2HQL A;  2VNU D;  3S16 H;  3S17 H;  1XMQ L;  4DPG A;  1PH5 A;  3NBH B;  1EOV A;  1Y14 B;  3ULP A;  3S15 H;  1VQ9 A;  1CUK A;  4A76 A;  1SLJ A;  2VS1 A;  3G4S A;  1B8A A;  4QY7 A;  4A75 A;  2JA6 H;  1WJJ A;  4IFD I;  4LUZ A;  2KBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...