2PQAA

Crystal structure of full-length human rpa 14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
128
Chain Sequence
RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the full-length human RPA14/32 complex gives insights into the mechanism of DNA binding and complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 29
structure length 128
sequence length 131
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pqaA00
4DAMA 1QVGA 1SFOH 2Q2HA 4OO1G 2VZAA 1VQ5A 2PMZE 4POFA 2CKZB 1E1TA 2E5LQ 3T1YL 4DV5L 2IY5B 3JC66 1HJPA 2CQOA 3RLFA 2Q2UA 2GVAA 1I94Q 4BY7G 3HKZG 4DK6C 4NXNQ 1VQCA 3UDFA 2IX1A 1L0WA 2RF4A 1VCIA 2IT1A 3RLOA 4DV0Q 1N34L 3AEVA 4YY3L 3K0XA 2F4VL 3HOUG 1MJEA 5ELNA 4IOCA 1OXXK 1MJCA 4A3BH 3PUYA 1JJCB 2UUBQ 4A3CH 3RNUA 3E0EA 1QZGA 2E2JH 1JJ2A 3HOZH 4HJ8A 2CCZA 1E24A 1YHQA 4B3MQ 2B29A 5M3MG 4DV6Q 1HZBA 2Q2IA 3RN5A 1BVSA 2K5NA 1DGSA 2A1AA 4AH6A 3ULJA 3I7FA 4LUVA 2RHSB 4TQUS 3DM3A 2VQFQ 3GTMH 4B3RQ 3AYHB 2FXQA 3I56A 5M3FG 1L1OA 2JQOA 2LXKA 4H02A 2QEXA 3ULLA 1L1OC 4X62L 4ME3A 4DUYQ 4DV3Q 1Y14B 1YJ9A 1J5EL 1N33L 4MZ9A 1PV4A 4LFBL 4P72A 5K36G 4OWTB 1S40A 4FDBA 3TS2A 4BY7H 5E7NA 5JJLA 5LMNQ 1R9TH 5C0XG 5LMNW 1WJJA 4MTNA 3ULPA 1NE3A 2K5HA 3G71A 4DR5Q 3HOUH 1M1KC 4DV1L 1J6QA 3E9HA 3PCOB 5FLMG 4ALPA 1TWAH 1VQIA 1PH3A 4LF9Q 4JCVE 3PUVA 4BBSG 4BXXG 1I94L 4UY8C 4P73A 4YHHQ 4NXNL 2ZJRA 4TVAB 5GADC 3TS0A 4DV0L 2GN5A 5M3MH 3CMEA 2JEBI 4IFDI 2WAQG 4LF8Q 4JBKA 3H3VH 2UUBL 4R4TA 2OTJA 3HOVG 2PQAB 3F8TA 5IWAQ 4BA1I 2UUAQ 3S14H 1VQKA 2R7FA 2Z0SA 3KOJA 4P75A 3SGIA 3DLLA 4WJ4A 5M3FH 3PUWA 4DV6L 2XGTA 3M7NA 3FKIG 4LF7Q 4NXMQ 2CFMA 1MKHA 4OONA 5FLXc 1QZHA 4XIGS 4LF6L 1UE1A 2KHJA 1SRUA 1PH5A 4YWKA 4B3RL 1OXSC 1D8LA 1LTLA 3CW2C 1PH4A 3A0JA 2RHQB 1XTDA 3PSIA 4DUYL 4DV3L 1E22A 2KBNA 4NB3A 4BBSH 3VDYA 5C3EG 4AYBG 5IYDG 2YU9H 4BXXH 3K81C 4A3EG 3OTOQ 2NN6G 4DUZQ 1XMQL 3MEFA 1VS0A 5LMNL 3FP9A 4LF5Q 4GKJQ 4QQBX 4R4IA 2Y0SG 1UWVA 3J81i 1OXVA 3BZCA 4JOIC 3KJPA 4DR5L 2MO0A 2BA1A 4NPSA 1PA6A 4IPHA 1MIUA 1Q81C 3CCEA 4DR2L 1JT8A 1B8AA 4YHHL 4A4IA 1VQLA 2I5MX 4A3MG 3HOVH 1B70B 1KRTA 1IBMQ 4UP7A 3U4ZA 2XTIA 3JAMc 3GTJH 1KIXA 3UE1A 2UXDQ 2DUDA 3T1HQ 4LF8L 2V1CC 3L7ZC 3W1GA 1A62A 2YYZA 3AQQA 4A3JG 4OO1I 1X3EA 4L5QA 5IWAL 3CCRA 2OQ0A 2YTVA 3NBHB 3S1RH 1XPRA 2JA6G 2KENA 2OCEA 5GAGC 1L1OB 3NENA 2B63G 2VQEQ 4DK3C 1AE3A 3I4OA 4Y52H 2YTXA 4LF7L 1I3QH 2HQLA 1IYJB 4A3KG 4NXML 1D7QA 1GM5A 1P16A 4X6AH 5C3EH 1CKNB 5IYDH 3CPFA 1CUKA 3HFZB 3U50C 2K75A 4HIOA 4A3EH 1JB7A 2F52A 1GO3E 3J80c 5IYBG 4X65L 4LFCQ 1W2BA 2I5LX 1PH1A 4GOPA 1VQDA 2CWPA 2K52A 2UXBL 2HHHL 4KHPQ 5IT9c 1VQGA 5C44G 2PNHA 3KDFB 3GO5A 1YBYA 4A3MH 1X3FA 4DUZL 4LF5L 2NVYH 3TEHB 4QGUA 2WFWA 4LF4Q 1K8AC 1SR3A 1KHIA 2IHFA 2DGYA 1XPUA 4A75A 3HKZE 3IRBA 4JI7Q 3H3VI 2BH8A 1KL9A 4C3JH 3UDIA 2YTYA 1WOCA 3FHWA 5BR8Q 4A3JH 3EN2A 3G6EA 4JI3Q 1IBML 3ICEA 2WB1G 2JA6H 4A3DH 1PVOA 1QUQA 2Z6KA 5HY6A 3W1BA 3BZKA 1VQMA 1G51A 4JC0A 3F2BA 2R93G 2UXDL 2HIXA 2IX0A 3ERSX 3T1HL 2UXCQ 4X64Q 1KC8C 3U58A 2CWAA 1HNWQ 4EX5A 3WWVA 4DAYB 3M85A 4R4CA 2D0PA 3TQYA 4APVA 5IYBH 2RCNA 3J7ZC 3AFPA 4YWLA 2VQEL 3CC4A 1YNXA 2ZJQA 1QVFA 5C44H 1PH2A 4DR4Q 5HGQA 3RLNA 2BH2A 4A3GG 1KAWA 4R4QA 1K83H 1PHJA 1GKHA 4GLAC 2R6GA 3K7UC 3K80C 3KF6A 4LFCL 2WP8J 4R4OA 1S72A 2VL6A 4QIWE 2ZJPA 2E5LL 3I2ZA 1YHAA 3PF5A 1RL2A 1U5KA 2ZTCA 4IOAA 1SROA 1X3GA 1X54A 4AQYQ 2ID0A 2QA4A 1K73C 1A63A 1XNRQ 5IE8A 2R7DA 2K14A 3S2DH 1X9NA 1SN8A 2HT1A 2VS1A 4P74A 3GTLH 1YI2A 3M4QA 2YV5A 2QGQA 1CKMA 4LF4L 1BBWA 1UEBA 1WCMG 2EIFA 1IBKQ 5IP9G 4B3SQ 2R93H 1YVCA 3CD6A 3BU2A 1TWGH 4JI7L 3CCLA 3NELA 4RMFA 2OQKA 4RG1A 1VQBA 3A5ZB 4JI3L 5BR8L 4JI6Q 5M5XH 4B3ML 4AIMA 4EQ5A 4PZ7A 5IP7G 3G48A 2N3SA 2WAQE 4DR3Q 1TWFH 3CC7A 2N78A 3S1MH 4A93G 1VQAA 5EAYA 2AWNA 2UXCL 1IXRA 4HJ5A 4HJAA 1FJGQ 1K3RA 4X64L 4A3GH 2VQFL 2NN6I 4PZ6A 5M5YH 3CCQA 4X66Q 4JI2Q 2F3IA 1KRSA 2N8NA 4LFAQ 3PO3G 3M4PA 2NVXH 5JJKA 2EQSA 4GOPB 1PH7A 1KXLA 4MNOA 5FLMH 2VW9A 2JA5G 4P71A 4KI0A 4DR4L 2LSSA 4GN3B 3Q8DA 4LWCA 4OWWB 2B3GA 4HIDA 4YWMA 4GNXA 3S2HH 2K4KA 1LM0A 2D0OA 3B6YA 5GROA 1UE5A 3EIVA 4JI4Q 2MQHA 1XNQQ 3H15A 1WCMH 2NZOA 5IP9H 1TXYA 1Y1VG 4AYBE 4AQYL 2AKWB 4XTCS 4LF9L 4JI8Q 5ELOA 2OTLA 1Z47A 1XNRL 2GVBA 1HNZQ 1EFWA 3GTOH 3TRZA 1N36Q 1HZ9A 2Y0SE 1Q46A 2AWOA 4JI0Q 3PGZA 3CCUA 1YITA 5IP7H 1A8VA 4LW1A 4HIMA 3FKIH 1Q86C 1IBKL 1SMXA 3I4NG 1XPOA 4C3HH 4A93H 2VNUD 2OWOA 2E2HH 1VQJA 1XJVA 1H95A 4DR6Q 1TWCH 1NMGA 5FJ8G 4JBMA 3M9BA 1V1QA 4JI6L 3CP0A 2UUAL 1I5FA 2R7ZG 2UUCQ 2K50A 3PO3H 1HZCA 1VQHA 1FVIA 2BA0A 4DR3L 4DNIA 1EYGA 2HIVA 3EBEA 3TREA 1ASZA 1C9OA 2LXJA 1EQQA 1X65A 2JA5H 1IZ6A 2ASBA 1JJGA 5GQOA 5C4XG 1E1OA 3U4VA 1O7IA 4X66L 1VQ7A 4C3IH 4LUZA 3F2CA 1Q1EA 2AHOB 4B3TQ 4OWXB 2JA7G 4LFAL 3M4OH 3PV0A 3CCMA 2R92G 1V9PA 4GOPC 4O0AA 4DR7Q 1Q8KA 4LUOA 1Y1VH 4QY7A 1NTGA 2MFIA 5AJ3Q 3RN2A 1Y1WG 5LMUQ 1YJNA 3GTKH 2N49A 4HJ9A 1C0AA 3OTOL 1EIFA 4QJFA 4A3IG 2JA9A 3NEMA 1HNXQ 4GKJL 4JI4L 1SLJA 1EIYB 2ES2A 3PIOA 2PI2A 4DPGA 1XNQL 1U0LA 4LFBQ 1VQOA 2MNAA 3L0OA 3A5UA 3I4NH 3K7AH 1AH9A 2AMCB 3GDEA 3D0FA 4BY1G 2KCTA 4JI8L 5GAHC 1C7YA 1HNZL 3UDXA 4UP9A 5FJ8H 1N36L 1K9MC 3PF4A 4JI0L 1WI5A 3UE0A 2R7ZH 1TWHH 4DV1Q 1ASYA 5IY0A 2Z6KC 1HR0Q 3PO2G 2B63H 1HR0W 3HOYG 4GKKQ 1EQRA 1Q12A 3E9IA 3F2DA 3STBC 4A3KH 3STBD 2NZHA 1B7YB 1HH2P 2E2IH 4DR6L 2WB1E 5C4XH 1IBLQ 5C0XI 3HOWG 4WJ3M 1CKOA 1EWIA 1OTCA 2IHEA 1KQSA 3GTPH 3S15H 4GLXA 1N32Q 3HKSA 2KHIA 1VQPA 2UUCL 4A3LG 1I6HH 2JA7H 1G6PA 1NMFA 4IPCA 2R92H 3CPWA 1BKBA 4GN5A 1Y1WH 3GTQH 4IFDJ 3CAMA 4POGA 4DV2Q 4JV5Q 3F1ZA 4GN4B 2VY3A 1UE7A 4K0KQ 3W5OA 4GNXB 4A3IH 4B3TL 3KJOA 2JEAI 3ER0A 4BBRG 2MO1A 3H0GG 2A19A 4A3FG 3CCSA 4KHPL 1FL0A 4DR7L 3KYHC 1NY4A 5AJ3L 3GTGH 1BBUA 5LMUL 1HZAA 3PIPA 1NJIC 4BY1H 3S17H 4C2MH 3S16H 1T9HA 1LYLA 4OX9Q 1SE8A 2PI2E 1HNXL 4A3BG 3S1NH 4IO9A 2VUMG 1KD1C 2ZTEA 4R1JA 3PO2H 4JI5Q 3HOYH 3J7A5 1OXTA 4A76A 4JG2A 4DV7Q 1CKNA 4DR1Q 1VQ4A 1XMOQ 4HIKA 4JI1L 1XMQQ 3ZJYC 3K8AA 1UE6A 5C4JH 1JMCA 1VQFA 3HOWH 3LGJA 1L2FA 1E7ZA 4A3LH 2I5HA 3KLWA 1RIPA 1V43A 1HR0L 3KDFA 4UPAA 2ATWA 4GKKL 4IJHA 4OXPA 1JE5A 1QVCA 2JK8A 4DR2Q 1M90C 1Q1BA 5J3BA 3I4MG 1PYBA 4Y7NH 4J15A 4LNQA 4JYAQ 1IBLL 4BA2I 1N32L 1HNWL 2L15A 3A74A 3CF5A 1WFQA 2JE6I 3D31A 3CMAA 1WYDA 1YZ6A 4BBRH 4KHZA 2D62A 2JA8G 3H0GH 4GS3A 4A3FH 1VQNA 1IL2A 1Q82C 1Q7YC 3HOXG 2UU9Q 1NBWA 1K0RA 3CCVA 5JEAJ 4DV2L 2JJQA 5H1SE 5GAEC 2ZM6Q 1CSQA 4DV4Q 4JV5L 1GVPA 3OYYA 4IFDG 4K0KL 4GNXC 4L5TA 1I50H 1YHBA 4IPGA 5IYCG 2ZTDA 4JI1Q 3I55A 4LF6Q 2A8VA 2VUMH 3RZOH 3RR5A 1OXUA 4KLKA 3JAMi 3S1QH 3OW2A 2K5VA 2E8GA 3S24A 1VQ9A 2I0QA 3KFUA 4X65Q 3CXCA 5JJIA 1PYSB 1VQ8A 3T1YQ 4DV5Q 3MXNB 1FGUA 1N8RC 3CQZH 2HHHQ 4OX9L 1QUQB 2UXBQ 1LUZA 1YEZA 3AFQA 4YCVA 1VQEA 4JI5L 2NVQH 1E3PA 3PUXA 1PH8A 4B3SL 1PFSA 4DV7L 4DR1L 1XMOL 3I4MH 1YIJA 1K8GA 4UP8A 4YCUA 4L5RC 1N34Q 2Q2TA 4YY3Q 1VQ6A 2F4VQ 4JOIA 4L5SA 3M3YH 1GD7A 1PH6A 3GD7A 2ALYB 1G291 1PH9A 1W3SA 1EOVA 3J80i 4GLVB 4O2DA 2JA8H 3KF8B 4PMWA 2NVTH 3J81j 5DLQE 4QL5A 4IJLA 4JBJA 3J81c 1FJGL 2C35B 3HOXH 1A0IA 1CSPA 4JYAL 1YJWA 4JI2L 2EXDA 4IPDA 2H5XA 3UDGA 1X56A 3KF6B 4YCWA 4HJ7A 3G4SA 3CCJA 5IYCH 4A3CG 4DKAC 4PG3A 5M5WH 1X6OA 2PQAA 3PUZA 3RZDH 1S3OA 1P8LA 1N9WA 3BJUA 1X55A 3HOZG 3CC2A 2UU9L 4JBWA 3L2PA 4A3DG 4DV4L 1AE2A 2ZM6L 4X62Q 2KCMA 1N33Q 1J5EQ 4PZ8A 1Z9FA 5JEAG 1EUJA 5C0XJ
chains in the Genus database with same CATH superfamily
3IKJA 4DAMA 2EZVA 2L12A 2Q2HA 1VQ5A 2CVRA 3GTKB 2CKZB 5FLXL 1E1TA 4CHTB 2E5LQ 2NVYB 3MHBA 4DV5L 5JAVA 1JOOA 2CQOA 4ZCKA 2Q2UA 1Q3LA 1STYA 1DOMA 2F3WA 4BY7G 4NXNQ 1VQCA 2IX1A 1ENFA 3RLOA 3AEVA 1TKWB 1DM0B 4IOCA 1MJCA 5CV8A 1A3TA 4LAAA 2E2JH 4QUCA 4A3KB 4B3MQ 2E2IB 5C4XB 1QWYA 1HUMA 1HZBA 3RN5A 1UEAB 3S15B 1BVSA 1Y8NB 2F0LA 2K04A 3I7FA 4F7XA 3OMGA 1D5ZC 2FXQA 4OO1H 1SYCA 5I4DA 3A56A 4A3IB 1TU2B 1N33L 1J5EL 4H0LC 4LFBL 1IL8A 1S40A 5LMNQ 4MTNA 3S16B 3MVVA 4C1NI 1M1KC 2CW0D 3PO2B 4BBSG 4JCVE 3MC0B 2EXZA 4P73A 2JSOA 4YHHQ 2DJFC 4NXNL 1Z7TA 5GADC 1SMYD 1SNCA 5C4JB 3TS0A 5IT9L 2K1BA 3HOWB 1SYGA 1I4HA 1IHZA 4ZK9B 2PQAB 1Q8IA 1JCKB 2UUAQ 3SGIA 3PUWA 3NWTA 4CKBA 2FMMA 4NXMQ 5FLXc 5KYIA 4XIGS 5A2QL 4RGMA 5IGEA 2O4XA 4KKTA 1OXSC 5C0XH 1EY8A 1HCZA 3H94A 2Q8RE 3PSIA 1WCMB 1QCBD 2HCIA 4AYBG 1ET9A 2F0SA 3K81C 4DUZQ 4QQBX 5LMNL 3FP9A 1EY5A 1X3QA 3Q0AA 1UWVA 3J81i 1DOKA 4YHHL 1G91A 3I4MB 2I5MX 4CKCA 4PQXA 3AU7A 1KRTA 1TWCB 4UP7A 4H44C 4DAPA 2XTIA 3JAMc 1KIXA 3UE1A 4CDFC 2UXDQ 3T1HQ 1WD1A 4K2KA 2NVTB 3T51B 3MXGA 1EU4A 3NBHB 2JA6G 5GAGC 5E1FA 2Z4IA 2L55A 4I65A 4NXML 3EJIA 3C2PA 1GM5A 1SYEA 1P16A 2LKVA 5C3EH 1Y1VB 1CUKA 2N88A 2BE5C 3D4RA 2F52A 4RGOS 4E6IA 3J80c 2DY8A 2UXBL 4WRDA 5IT9c 4DXFA 2AUKA 3GV3A 4I7ZC 4A3MH 1PZID 3EQLC 4DUZL 3TEHB 2WFWA 4HN7A 4LF4Q 1HQRD 1KHIA 5TSSA 3VYUA 4JI7Q 2BH8A 1KL9A 2TSSA 4C3JH 2YTYA 4DGZA 4A3JH 2JN4A 3MXNA 5C5MA 4A3DH 5BN3A 1PVOA 2Z6KA 2R93G 3A8KE 2UXDL 3T1HL 3KBGA 2F0NA 1LTBD 4RH6A 1BR9A 3U58A 1Y1WB 3ONAB 5IGGA 3TQYA 2D0PA 4EVOA 4RGTA 4DFAA 3CC4A 5C3WA 1LTTD 1KABA 3RLNA 2BH2A 4A3GG 4TSSA 3OSOA 1GKHA 4MTKA 3V96A 1DZ1A 3K7UC 2X69A 3KF6A 2WP8J 2VL6A 2PQEA 1SE4A 2NZ1D 1SROA 2XRQD 1CT1D 2ID0A 3NQTA 2EYPA 5IE8A 4BY7B 1H9SA 2XWJB 4FVMA 3GTLH 1YI2A 1EYDA 5IGBA 3IFDA 4LF4L 5KNBA 1UEBA 2FHTA 1TWGH 4JI7L 3J81E 1IYVA 1OO9B 1VQBA 4JI6Q 4PZ7A 5IP7G 3G48A 3P75A 4FO2A 2N78A 1LT6D 1FJGQ 2D2CC 2KVMA 5EPJA 4X66Q 3BVGA 1KRSA 2SOBA 2E76C 2VUMB 4P71A 4KI0A 3X3NA 2EYMA 4HIDA 1BUVT 1QILA 4C3IG 4YWMA 1U9RA 3MEHA 1F2MA 2VB3X 2AQ3B 3GQBA 2AKWB 2EY1A 4NMZA 1HNZQ 1RD9D 4K5WA 2G9HD 5EQ0A 1Q46A 4DK1A 3CCUA 3M3YB 2FJ2A 1A8VA 1Q86C 4C3HH 4KHVA 1PTOD 1VQJA 3N6RA 4JI6L 2NYZD 5C4HA 3PO3H 1HZCA 1FVIA 2BA0A 3GTJB 5CV5A 1EYGA 4FF2A 4FXGC 2G9DA 3RMHA 1JJGA 1E1OA 1S5CD 1O7IA 4KJNA 4XYQA 5CMDA 4X66L 4LUZA 4HCEA 4GOPC 4DR7Q 1EQVA 1JR0D 2XVSA 4ULLA 4DXGA 1NTGA 2MFIA 2WKDA 4AYBB 2N49A 4HTHA 2JA9A 3L9AX 2K05A 2H1EA 2ES2A 3A8JE 1U0LA 3K6OA 3A5UA 1AH9A 2AMCB 3D0FA 1XWEA 2KCTA 3KLSA 1C7YA 1V1PB 1HNZL 5FJ8H 5I2XA 3PF4A 2RKSA 1PFMA 4GKKQ 5FKAC 2NZHA 1B7YB 4ZUJA 1GJXA 4R8NA 4EQOA 3HOZB 1CKOA 1EWIA 1OTCA 1VQPA 2KHIA 2JA6B 4FYDA 1A15A 2I46A 1NMFA 4IUQA 1SNOA 3CPWA 4C56C 1ML0D 3I70A 1G2SA 3WDNA 5EKKA 4DV2Q 4JV5Q 1GUWA 3W5OA 3KJOA 4UAIA 1RDPD 1A6XA 3CCSA 4DR7L 5ELDA 2CQAA 1NY4A 3GTGH 1ONLA 3PIPA 2KCNA 1K83B 4C2MH 2F1MA 2IWHA 3W2DA 2B2TA 4ZRZA 3S1NH 4IO9A 4R1JA 1YNNC 3HOYH 1YNND 1VQ4A 1PTOB 1I6VC 5FO8B 3M7GA 4HIKA 1J9OA 3NHHA 3ZJYC 1XMQQ 4QMGA 3MTSA 2C9OA 3KK7A 3N52A 2I5HA 3KLWA 1RIPA 4UPAA 1CA5A 4GKKL 2R93B 1M90C 2JK8A 4DR2Q 1Q1BA 5J3BA 3SR1A 3G6JB 1JWSD 4J15A 4LNQA 2RSNA 4BA2I 1CZGA 1RTOA 2F0OA 1HNWL 3D31A 2JA8G 1TWFB 3I73A 4WJWA 3S1MB 1TY0A 1HA5A 3HOXG 1NBWA 1K0RA 3CCVA 4A3GB 4DV2L 4JV5L 2ZM6Q 5M5YB 1CSQA 1G6ZA 1GVPA 4A3BH 1I50H 2NVXB 3OWEB 1OXUA 1KNEA 1STBA 2K5VA 2E8GA 5CBAE 4U673 5JJIA 1PYSB 3DWQA 3S2HB 1FGUA 2AQ2B 2HHHQ 1QUQB 1LUZA 4F87A 2BDOA 2NVQH 1E3PA 3PUXA 5DM63 1YIJA 1K8GA 1DCZA 4UP8A 4RKBA 1F2YA 1VQ6A 3OW7A 1PH6A 2ALYB 4X3SA 1YNJC 1W3SA 1YNJD 1JB3A 1AZPA 1PTOF 3P7JA 3IL8A 2P5ZX 4IJLA 4G57A 4ZYSA 3T53B 4CJ1B 3S1RB 3QO2A 1FD7D 5J39A 3DMUA 5M5WH 3RZDH 1X55A 1PYWD 3QIAA 4ZAIA 3O13A 2RCFA 2ZM6L 4FP5D 4C3IB 1KLGD 3WOFA 1F2LA 5C0XJ 4G7HC 1QVGA 5FK9C 4XT3B 1JWMD 2CHBD 4OO1G 2VZAA 1TT2A 2R3ZA 3HEJA 2Z1CA 4KKSA 3PMFA 1WTXA 1JORA 1MGSA 3JC66 1HJPA 1I94Q 4ZKBB 3K7AB 4F88A 1SJHD 1VCIA 2B39A 1MJEA 1OXXK 5EGTA 2B63B 4A3CH 1AW7A 4HJ8A 1E24A 4HAEA 3ZYYX 2ICIA 3GTPB 4P2CB 5I6YA 2K5NA 4AH6A 2B2YC 1JICA 4LUVA 3VYRA 4TQUS 1PXUA 3A54A 3WOEA 3OIQA 2QW7A 3VR6A 3T4AC 3AYHB 3I56A 4K2LA 2IPKD 1PRTF 3Q23A 1FGBD 2QEXA 1H9MA 3K0YA 4DUYQ 1IW7C 1F9PA 1Y14B 2QKIC 1T5XD 1HFNA 1B50A 4OWTB 1TQOA 4FDBA 3A55A 2F0JA 1R9TH 5C0XG 5LMNW 3S17B 3ULPA 1NE3A 3C3LA 2K5HA 3G71A 5F2DA 1J6QA 3MA2B 3PCOB 2X6GA 5FLMG 1TWAH 1VQIA 3IFTA 4OL7A 1EU3A 1I94L 3NBIA 4TVAB 5M3MH 3CMEA 2JEBI 5I6WA 2WAQG 4JBKA 4S3SA 1LTAD 3H3VH 2EJMA 3F8TA 4Y7NB 4BA1I 2D5DA 3S14H 1CQVA 4P75A 3L3OC 3DLLA 4WJ4A 3FKIG 1C8CA 2CFMA 1MKHA 4XQNA 1EYAA 3T16A 1D1KA 1ILPA 2B8FA 4KY5A 4QUFA 2WACA 1B4OA 1SRUA 1PH5A 4YWKA 2F0MA 1HFGA 1LTLA 4K8IA 1PH4A 2RHQB 3GV6A 4DUYL 1EIHA 3DWPA 1E22A 3RZOB 3VDYA 5C3EG 2YU9H 4BXXH 1JOKA 3S1QB 4U68A 1VS0A 1HQMC 2Y0SG 1TS4A 3BZCA 1GUOA 4JOIC 5IGCA 3KJPA 1LT4D 2MO0A 5EPKA 1PA6A 4ODGA 5DEHA 1MIUA 1B8AA 3HOVH 4A3MG 3G7LA 4L6TB 3BDCA 3BVMA 2DUDA 2V1CC 4C3JG 2JA8B 4G7OC 3W1GA 1EY0A 4A3JG 4OO1I 1XPRA 2JA5B 2YTVA 3HOXB 2KENA 5CC4A 4Y52H 1AE3A 3VYTA 4CJ2C 1I3QH 3M4OB 5CBEE 2PW5A 4X3UA 1Y8OB 3LX0A 1CKNB 3VR4A 3CPFA 2NUCA 5G3LD 2NN6H 1Y69U 4IURA 4X65L 4HR7B 1STGA 4MIUA 2DN8A 2PPBC 1D2BA 3KDFB 3MXPA 3PIO3 1S5ED 2DNCA 3VA5A 2NVYH 1W6JA 1LT5D 2F0IA 3OPOA 3LWEA 3TZUA 1SR3A 3I90A 5D3IB 2IHFA 3D4WA 3IRBA 5BR8Q 3EN2A 2MUYA 3H09A 3ICEA 2WB1G 3AB9A 3CU7A 3F2BA 2IX0A 4ID6A 3ERSX 2UXCQ 3MFYA 1H9RA 1GHJA 2GA4B 3JAML 4EX5A 3M85A 4R4CA 4APVA 3D8GA 3AFPA 3SK4A 2ICEC 1ET6A 1FNVA 2F0FA 2ZJQA 5C44H 1KAWA 1PHJA 4GLAC 1LV9A 2R6GA 1MSHA 1KTKA 1CK1A 3SDZA 2JP1A 4R4OA 2E5LL 4B9WA 3C1EA 2IX3A 3I2ZA 1U5KA 3Q24A 2CW0C 2ZTCA 2MHVA 4AQYQ 2QA4A 1UNSA 1XNRQ 3J80L 5IGDA 1EWHA 2HT1A 4P74A 1D6EC 1SMYC 1STEA 2VB2X 2YV5A 1CKMA 2F0UA 1HRJA 2F0TA 4B3SQ 3CD6A 3CHBD 2Q8IB 1L0XB 5EKIA 1MD2D 3A5ZB 4QF4A 5BR8L 4B3ML 4AIMA 4RFBA 4IZ8A 1EZ6A 2N3SA 4KN7C 4C3HG 5EAYA 2UXCL 4BBRB 2CH4A 4HJ5A 4DN4M 1IYUA 4FNFA 4RCNA 4PV1C 1BF4A 4JI2Q 2F3IA 2M00A 3TP8A 2NB0A 3PO3G 3M4PA 5L37A 1DYQA 5JJKA 1R4QB 1K3BC 4DNTB 3SK6A 5FLMH 2VW9A 2LSSA 4GN3B 1I4RA 4OWWB 1W6KA 1LM0A 2D0OA 5EKLA 5GROA 1HUNA 3ERQA 3H15A 1WCMH 3W3AA 2NZOA 1TXYA 3U9SA 4AYBE 3R2IA 4ZUIA 4AQYL 3VR5A 4XTCS 5ELCA 2OTLA 3DUZA 1XNRL 3GTOH 1HZ9A 2K5DA 5IIFA 3QR8A 3FKIH 1XPOA 1QNUA 4A93H 1RKNA 2A5HA 2OWOA 3D4DA 4DR6Q 1TWCH 5FJ8G 3MZ5A 4JBMA 3C1FA 1RHPA 2UUAL 2UUCQ 1VQHA 2EY6A 2HIVA 3TREA 1ASZA 4EGVA 2LXJA 1EQQA 5GQOA 1Q1EA 1AP0A 3PV0A 1A3UA 1WTPA 4LUOA 1Y1VH 4QY7A 5G3LF 3RN2A 1S5BD 1JC7A 4HJ9A 1C0AA 1EIFA 4KD4A 1HNXQ 2ZXOA 2Y0SB 1KLUD 1SYBA 1MHWC 1T5EA 3I4NH 3J7AF 3UDXA 4UP9A 4A3MB 1I4QA 1FYCA 2R7ZH 1EYCA 2MPMA 4DV1Q 5IY0A 2Z6KC 1HR0Q 1FNWA 3HOYG 2SDFA 4RAUC 3F2DA 3VR3A 1HPCA 4DR6L 1IBLQ 4FF4A 1GUNA 4A3JB 5EPLA 2IHEA 1KQSA 1A3VA 4A3DB 1I6HH 2UUCL 2JA7H 5FLXE 1CZWA 4RA8A 5BN5A 2R92H 4JVZA 1S4ZA 1BKBA 2F0GA 3DXJC 4GN5A 4BWGB 1Y1WH 3GTQH 4POGA 2R61A 1EL0A 4O42A 1UE7A 2RDHA 4J8QA 3ER0A 2K28A 2EY5A 3P20A 3BDOA 1FL0A 5FOBB 4BY1H 1HZAA 1D5MC 1BXTA 3FVQA 2B2WA 1T9HA 1LYLA 2XRSD 4N8X1 4ME5A 2CH4W 3HS0C 4A3BG 1HNXL 2L11A 4JI5Q 4HMIA 4JG2A 2OF1A 3K8AA 1UE6A 3BYYB 2A6EC 2A6ED 1JMCA 3DWAA 3GTLB 4FXDA 2WB1B 4PMCA 2KEEA 1G8ZD 1V43A 3M4YA 1HR0L 1B9MA 4IJHA 4OXPA 1TWGB 4XXEA 3VYSA 4KJOA 3QJYA 1IBLL 3MXUA 2FMCA 5C5LA 1YZ6A 2D62A 2OT2A 2QCPX 2Z8LA 3H0GH 4GS3A 4UHVA 3TN2A 3K5NA 3E3XA 1QOHA 1F9RA 4A3FH 1X3PA 1WVLA 2UU9Q 4DF7A 2JJQA 4KY7A 3OYYA 4L5TA 5IT9E 3FPPA 4JI1Q 1ENCA 2VUMH 2QDBA 2A8VA 2EJGC 2XNAC 2F0DA 4BBSB 4M1UB 3OW2A 3S24A 4DAYA 2I0QA 1SE3A 3HP3A 3CXCA 1VQ8A 3T1YQ 3MXNB 4IQZA 3CQZH 4KMUC 2M2LA 2WKCA 4DNRB 4JI5L 3NXWA 1GOZA 1PFSA 1PTOC 5C4ZA 5A2QE 4RCOA 4L5RC 3TP5A 4YY3Q 2HD3A 2F4VQ 3M3YH 1MI2A 1G291 1EOVA 4WFN3 1KDBA 3TBIB 4CDCC 1DOLA 2KOLA 5DLQE 1FJGL 1WTWA 4LJZC 1UAPA 2EXDA 1RTNA 4IPDA 2I07B 3KF6B 4IFDH 4HJ7A 3PO3B 5IYCH 4A3CG 2MGSA 1S3OA 1ZYRC 3BJUA 1ZYRD 3CC2A 2UU9L 1AE2A 1H9SB 4H13C 1E0BA 1JQYD 4PZ8A 2K32A 1EUJA 5EBCA 4JI1L 3QOLA 1SFOH 1M4VA 4NDXA 4TRDA 4POFA 1EOTA 2SEBD 5K5PA 3URYA 3T1YL 3RLFA 1BO0A 2GVAA 1LTID 2ENBA 3PQIA 3HKZG 4DK6C 3UDFA 2PZUA 5KRUA 2IT1A 2F3VA 4YY3L 1EQTA 3K0XA 2F4VL 4BS9A 3I91A 5ELNA 3PUYA 1XXGA 1QZGA 1B3AA 3DM1A 1JJ2A 3HOZH 1YHQA 5M3MG 4L63B 4OEMB 1PRTC 1H9JA 1PRTD 5CV6A 1EWCA 2VQFQ 3NTIA 4G4KA 3GTMH 1CHPD 2HDLA 2ZT9C 2L4NA 1L1OA 2LXKA 4RHSA 2PMZB 1L1OC 2BOSA 1LO5D 1NSNS 4DV3Q 2B2TC 5ELEA 1PV4A 5BN4A 1BQQT 3TS2A 1GUTA 1CM9A 2RDGA 1WJJA 1STNA 3VR2A 2O2LD 4C2MB 3EROA 3HOUH 1E2VA 2EVBA 3MWYW 4DK0A 4MN3A 4ALPA 3S1NB 4B08A 1PH3A 1VF7A 4LF9Q 3HOYB 1PZKD 3PUVA 4BXXG 4UY8C 1O7YA 5C3XA 2V4DA 1I4PA 1ZXTA 2GN5A 3H91A 1NNXA 4LF8Q 1D5XC 4R4TA 3HOVG 4JW0A 5IWAQ 5IOCA 2F0HA 3KOJA 2EYLA 5M3FH 1PDQA 3M7NA 3BVZA 4H7BA 4LF7Q 2F0VA 1QNKA 1QZHA 3K59A 5K36H 1WTRA 2EY2A 1RODA 3K57A 2J7ZA 3CW2C 5IGFA 3D6WA 1WTQA 4A3BB 1I50B 4DV3L 1ESRA 1ICWA 3OIPA 4CBVA 3OTOQ 2NN6G 1XMQL 4LF5Q 1EY9A 3MEFA 4GKJQ 1OXVA 2QDLA 2BA1A 4NPSA 1VMPA 4IPHA 1EIGA 2QF7A 2NVQB 1Q81C 3CCEA 4DR2L 1JT8A 2DJGC 1B70B 1IBMQ 2BCOA 3U4ZA 3HRZC 1PRTB 3VA7A 4LF8L 1IKLA 3L7ZC 2F0QA 4ABNA 1A62A 2YYZA 3AQQA 1CA6A 1X3EA 1ZEQX 3DHQA 5IWAL 2OQ0A 3CCRA 3S1RH 1L1OB 3NENA 2VQEQ 1EFID 3NE5B 4LF7L 4A3KG 3R8BA 1CI3M 4R8IA 5M5WB 3H3VC 4X6AH 5IYDH 5KIXA 3RZDB 2RA4A 5AFWA 3U50C 5I9OA 1Z6HA 4JPBW 4HIOA 4A3EH 1GO3E 2F03A 1W2BA 1VQDA 4YIJA 2HHHL 4KHPQ 2F0PA 5C44G 2H4OA 1NR4A 1HTLD 3NUCA 4ZQ3A 1SNMA 3DEOA 3GO5A 1YBYA 4LF5L 4QGUA 5ISRA 3BS1A 1K8AC 4KKUA 1TWHB 1XPUA 3T13A 3H3VI 1KAAA 2O5JC 1PFBA 1WOCA 3G6EA 3QOJA 1IBML 4NP5A 3W1BA 1G51A 2HIXA 4X64Q 1KC8C 2NTTA 2CWAA 4RGNA 3WWVA 1PMRA 5JPMC 5IYBH 3J7ZC 1QJOA 4K6DA 2KA7A 2VQEL 2B2UA 1YNXA 1QVFA 2B2UC 5DNFA 1PH2A 3R3OA 5HGQA 4R4QA 3R93A 1NUCA 1QE6A 3SXHA 3PIP3 1S72A 4QIWE 3NQIA 2ZJPA 5J1ZA 1YHAA 2VXWA 4IOAA 1F2ZA 1X54A 1SSOA 2R7DA 3HKZB 3S2DH 1SN8A 1R9TB 3KUPA 4K5XA 1U4LA 2QGQA 5J22A 1JWUD 1BBWA 1WCMG 1YVCA 3BU2A 2AUJD 1LTSD 3CCLA 1TWAB 5M5XH 2IJ0A 2XIWA 4EQ5A 2WAQE 4DR3Q 4A93G 2AWNA 1PFNA 4ILWA 1IXRA 4EQNA 4X64L 1TR5A 2NN6I 4PZ6A 3CCQA 1BCPF 1D1IA 3S14B 2A69D 1PH7A 1LABA 4MNOA 1FNUA 3Q8DA 4V190 2B3GA 2LY7A 3S9WA 4GNXA 2K4KA 4FF3A 5CORA 3B6YA 1UE5A 3EIVA 2MQHA 1XNQQ 5IP9H 1Y1VG 1CTMA 1TVXA 3SHLA 5ELOA 1Z47A 2GVBA 2YU9B 3TRZA 1N36Q 2Y0SE 4JI0Q 1YITA 4HIMA 1SMXA 3I4NG 1SNDA 4O1NA 4OELB 2E2HH 1XJVA 3HOVB 3IAYA 3CP0A 4J1MA 2R7ZG 3K5MA 2B2VA 4DR3L 1PLFA 2K01A 4DAVA 5D65A 1C9OA 2Z4HA 2JA5H 2ASBA 1VQ7A 1SBBB 2AHOB 4B3TQ 2JA7G 5A35A 3M4OH 4IUUA 2R92G 4O0AA 1I3QB 1Y1WG 5AJ3Q 3GTKH 1YJNA 1B1ZA 5JOBA 1I4GA 4N9PA 4DU9A 1ZKOA 2OEOA 3NEMA 2LS01 1K28A 1AZQA 2EYHA 2KHSA 2PI2A 1STHA 4DPGA 1XNQL 4LFBQ 3L0OA 5I9PA 3F2UA 3GDEA 4BY1G 1I4XA 1EEID 3OOCA 1N36L 3E6ZX 1B9NA 1K9MC 4JI0L 1WI5A 4OGQC 2BDNA 3FPUB 1HR0W 4LMQD 1Q12A 3E9IA 1ICFB 4A3KH 1KDCA 4XT1B 2QEJC 1HH2P 2E2IH 2E2JB 2WB1E 5C4XH 5C0XI 1WD0A 3S15H 4GLXA 1HA6A 3D6CA 3ND8A 1G6PA 4KV6A 5D3DA 4IFDJ 3GP7A 4RKLA 4N9TA 4GNXB 4A3IH 4B3TL 1S5DD 2EJFC 4XQJA 2MO1A 3H0GG 3J81L 5DM73 2A19A 4A3FG 1SDFA 1LTRD 3KYHC 2KJXA 5M9OA 5C44B 5AJ3L 3NBHA 1BBUA 2G5DA 1NJIC 2TMPA 3S16H 4G7ZC 5COYA 4OX9Q 1DONA 3ND9A 2VUMG 2PW7A 2ZTEA 3PO2H 1OXTA 4A76A 1XMOQ 2SNSA 5C4JH 3HOWH 1VQFA 1V1OA 1L2FA 1E7ZA 3R2TA 4A3LH 2A74C 1DXMA 1JE5A 1QVCA 3FRPB 1PYBA 1U4MA 2DNEA 1G2TA 3A7LA 1RCVD 1VMCA 2L15A 3A74A 1TS2A 2NBFA 3CMAA 1WYDA 4BBRH 4KHZA 1VQNA 4QIWB 4IALA 1Q82C 5JJZA 4K8JA 1MSGA 4HEDA 1VF5C 5GAEC 3E0JA 4IFDG 2ZXRA 1PZJD 4IPGA 1AN8A 4LF6Q 5IYCG 5JVG3 1BOSA 3I72A 2JYOA 4KLKA 3JAMi 1WTHA 1VQ9A 3TP6A 2E74C 1ESFA 3TZDA 2UXBQ 4OX9L 3AFQA 1YEZA 2Z6BA 1VQEA 4ZKCB 4B3SL 1XMOL 2JXMB 2WAQB 3I4MH 2X6LA 3I3CA 4YCUA 4KTAA 2EPBA 1N34Q 3GTOB 2Q2TA 3TMEA 5T1IA 1PH9A 2PNRC 3J80i 3HG9A 4GLVB 3TSSA 2K7VA 3SK5A 1GUGA 3FKIB 5C6AA 4PMWA 2NVTH 4A93B 3NTKA 4QL5A 4JBJA 3J81c 2RBMA 3NPPA 1YJWA 4JI2L 4Q5VA 4YCWA 3CCJA 3OMCA 4PG3A 1X6OA 1GXDC 1P8LA 3HOZG 2E75C 5T1GA 3P1HA 2WINB 4JBWA 3L2PA 5C3EB 3EFXD 1SE2A 5E4XA 4X62Q 5CR3A 4LF6L 1E2ZA 3C46A 5D14A 3EA6A 2L5TA 3HZXA 3V05A 4Q0FA 4ZLTF 2PMZE 2BE5D 5ELBA 2F0EA 3A8IE 5LL6X 2IY5B 4HSPA 2XWBB 4NW2A 4IN3A 4B9XA 1J8IA 3I4NB 4C3JB 1L0WA 2RF4A 4DV0Q 4OHJA 1N34L 3T56B 3HOUG 4OIKA 4CJ0B 3MAQA 2K5WA 2R7ZB 3EVQA 1JJCB 1SAPA 2UUBQ 3CRKC 3RNUA 2L1BA 3E0EA 2CCZA 2EYJA 2B29A 2DY7A 3BDLA 4DV6Q 4XDXA 2Q2IA 1U4PA 1DGSA 1I6HB 1XTCD 2A1AA 2JA7B 3ULJA 5JEAH 2R92B 2RHSB 1XX8A 3DM3A 4B3RQ 3GTQB 4RHRA 1F9SA 4N8FA 5M3FG 3FDTA 2JQOA 4H02A 3ULLA 2B2WC 4X62L 4ME3A 2PO4A 1YJ9A 1C48A 3K5LA 4MZ9A 4P72A 4LK1C 5K36G 4BY7H 5E7NA 5JJLA 2Z9HA 3J7AV 4BY1B 2FINB 1JOQA 2HQEA 4V0BA 3JAME 2RQXA 4DR5Q 4DV1L 3E9HA 4TKOB 1II3A 2IW3A 2ZJRA 2N55A 5HURA 4DV0L 1SNPA 3NK9A 4IFDI 2EYOA 2UUBL 2OTJA 1V1PA 1ILQA 1STAA 3J80E 1VQKA 2R7FA 2Z0SA 4DV6L 2XGTA 1TS5A 1MBYA 1Q90A 4OONA 3I4LA 3J7YW 3H0GB 1UE1A 4A3FB 2KHJA 2EOTA 4B3RL 1D8LA 4F8MA 3A0JA 3LWUA 1XTDA 2C5CA 2KBNA 3UI2A 4NB3A 4BBSH 5IYDG 1HXYD 4A3EG 3ITPA 2HUGA 4R4IA 2AQ1B 1V8QA 3CQZB 4DR5L 5EJWA 2RSOA 3Q22A 5KNDA 4IUNA 4C3HB 1VQLA 4A4IA 1B2TA 4J6HA 2KCCA 4XQQA 3GTJH 5JPNC 2F0KA 2PYKA 4I7AA 2WIIB 3A7AB 4L5QA 5E3FA 3SEBA 2OCEA 1HHVA 2B63G 4DK3C 1A2TA 3I4OA 2YTXA 2HQLA 1IYJB 1D7QA 1EEFD 1F77A 2KUMA 3HFZB 1JB7A 2K75A 1U4RA 4HSVA 4KN4C 5IYBG 4LFCQ 2I5LX 1PH1A 4GOPA 2CWPA 2K52A 3FMCA 5I2YA 1VQGA 5IODA 4HMJA 4QB4A 2K5QA 2PNHA 1SFOB 1CHQD 5KYLA 1X32A 1X3FA 2NWGA 1S5FD 1RF2D 2XSCA 2DGYA 3HKZE 3UDIA 1WTVA 3FHWA 3NWSA 4JI3Q 2JA6H 1QUQA 5HY6A 3BZKA 4PNYA 1VQMA 4JC0A 3KBXA 4IUVA 1B44D 1E2WA 3Q6SA 2L0CA 4PMBA 1HNWQ 2ZXPA 4DAYB 4KD3A 1K0SA 2RCNA 4YWLA 3TDQA 2HCCA 4DR4Q 2EDGA 3D3RA 1XYIA 4K5VA 1K83H 3NSWA 3GTMB 3GTGB 3K80C 3KLSX 5FO7B 4LFCL 1R4PB 3SE0A 1RL2A 3PF5A 1PTOH 1A63A 1X3GA 1SYDA 1K73C 2K14A 4JK1C 2QILA 4FF1A 5CV9A 1X9NA 2VS1A 3M4QA 5KGUA 2K03A 3OHXC 2EIFA 2R93H 1IBKQ 5IP9G 3HOUB 5CGKA 5FO9B 2F4IA 3NELA 4RMFA 1O78A 2OQKA 4KK7A 4RG1A 1RJTA 5KNCA 2K33A 1WTOA 2HDMA 1DD2A 1O7LA 4JI3L 1BCPC 1BCPD 1H9KA 1TWFH 3CC7A 2M9VA 3S1MH 3LNNA 3QWNA 1VQAA 4K14A 4HJAA 1K3RA 2J0TD 5CV7A 4A3GH 2VQFL 1KNAA 5M5YH 2Q8TA 3U9OA 2N8NA 1TIID 4HCSA 5CYUA 4LFAQ 2FFKB 5DAUA 3QB3A 5M3FB 2NVXH 4MHEA 2EQSA 4GOPB 1KXLA 1F9QA 1QB5D 2JA5G 4DR4L 4LWCA 3S2HH 4JI4Q 4OIJA 4LF9L 4JI8Q 1LTGD 1EFWA 3RD4A 1ENAA 2AWOA 2MJ8A 1B3QA 3PGZA 4R9WA 3KLRA 5IP7H 4LW1A 1SYFA 4IUTA 3NTHA 3SK8A 3QG1A 1IBKL 1DJRD 2VNUD 1SNQA 1H95A 4L8JA 1NMGA 5EBDA 1O80A 3M9BA 1V1QA 1Y8PB 5CV4A 3SVMA 1I5FA 2K50A 1L0YB 4KY6A 3TP7A 4DNIA 4IUPA 3EBEA 5E4WC 1X65A 1IZ6A 2LFNA 5C4XG 3U4VA 2PCFB 2B8GA 4C3IH 3F2CA 5NUCA 4OWXB 4LFAL 3CCMA 1V9PA 2K6AA 1LLRD 1Q8KA 1K8OA 4C1NK 2J4XA 5LMUQ 3AMUA 1BDOA 3OTOL 4A3EB 2PZTA 4CDEC 3I8ZA 4QJFA 1CQFA 4A3IG 4GKJL 1NCVA 4JI4L 1SLJA 1EIYB 3PIOA 1VQOA 2MNAA 3K7AH 1EY7A 4JI8L 3DEPA 3BZDB 5GAHC 1BCPB 3OWFA 2RDFA 4M8AA 3UE0A 1TWHH 1ASYA 3PO2G 1KDAA 1IKMA 2B63H 4GZYC 1EQRA 4DA2A 3STBC 3K58A 3STBD 3HGBA 5LHY1 3HOWG 4WJ3M 4XYOA 5KEEA 3GTPH 1N32Q 1GHKA 1BBXC 3HKSA 4A3LG 4UDUC 4IPCA 5LL6S 2KEDA 2L9HA 3KF8A 4NKLA 1LACA 3CAMA 1JE4A 3CKIB 3F1ZA 4GN4B 2VY3A 1SEBD 2MP1A 4K0KQ 2B2YA 3H6MA 2JEAI 1AFPA 4BBRG 5HGTA 3V2TA 3MFGA 4KHPL 1GUSA 1K8MA 5LMUL 4CDDC 3S17H 2EE1A 3X3MA 1SE8A 2PI2E 1IW7D 1M8AA 1KD1C 2KQ3A 2NTSA 3J7A5 4DV7Q 1CKNA 4DR1Q 1TY2A 3S2DB 2OXPA 3LGJA 5JVH3 5M3MB 2IL8A 3BG3A 3KDFA 2ATWA 3I4MG 1B53A 4WORA 4Y7NH 2D9UA 4JYAQ 3CRLC 1N32L 3CF5A 5M5XB 1WFQA 2JE6I 2A69C 1CFMA 1EY6A 2LMCB 1FR3A 2WV6D 4K6LA 1NR2A 4EQPA 1IL2A 1Q7YC 4RWSC 4QCLA 5JEAJ 1O7ZA 4DV4Q 1AEXA 5H1SE 1TS3A 2PZWA 4X3TA 4K0KL 4GNXC 2O5IC 3I55A 1YHBA 3NP8A 2ZTDA 3RZOH 1UUPA 3RR5A 4CKEA 2KECA 1NAPA 3FEWX 3S1QH 3E5SA 3KFUA 4X65Q 2F0WA 2RVLA 4DV5Q 1N8RC 4YCVA 2A68C 2A68D 4FXKC 1PH8A 4DV7L 4Z9CB 4DR1L 5ELFA 1SJED 2EYFA 4JOIA 4L5SA 4X3KA 1GD7A 2SNMA 3GD7A 3RUZA 1BNZA 1QG7A 3K5OA 2A73B 1SXTA 1HTPA 3BYTB 4O2DA 2JA8H 2B2VC 3KF8B 2E2DC 3J81j 2E2HB 2C35B 3HOXH 1A0IA 1CSPA 1EY4A 4JYAL 2H5XA 3UDGA 1X56A 1A2UA 3G4SA 1C4QA 4DKAC 2XN9C 2PQAA 3PUZA 1EZ8A 1N9WA 1VDZA 4A3DG 2A6HC 4DV4L 2A6HD 4CGYB 2KCMA 1N33Q 1J5EQ 1LT3D 1Z9FA 5JEAG 4A75A
chains in the Genus database with same CATH topology
4DAMA 1QVGA 1SFOH 2Q2HA 4OO1G 2VZAA 1VQ5A 2PMZE 4POFA 2CKZB 1E1TA 2E5LQ 3T1YL 4DV5L 2IY5B 3JC66 1HJPA 2CQOA 3RLFA 2Q2UA 2GVAA 1I94Q 4BY7G 3HKZG 4DK6C 4NXNQ 1VQCA 3UDFA 2IX1A 1L0WA 2RF4A 1VCIA 2IT1A 3RLOA 4DV0Q 1N34L 3AEVA 4YY3L 3K0XA 2F4VL 3HOUG 1MJEA 5ELNA 4IOCA 1OXXK 1MJCA 4A3BH 3PUYA 1JJCB 2UUBQ 4A3CH 3RNUA 3E0EA 1QZGA 2E2JH 1JJ2A 3HOZH 4HJ8A 2CCZA 1E24A 1YHQA 4B3MQ 2B29A 5M3MG 4DV6Q 1HZBA 2Q2IA 3RN5A 1BVSA 2K5NA 1DGSA 2A1AA 4AH6A 3ULJA 3I7FA 4LUVA 2RHSB 4TQUS 3DM3A 2VQFQ 3GTMH 4B3RQ 3AYHB 2FXQA 3I56A 5M3FG 1L1OA 2JQOA 2LXKA 4H02A 2QEXA 3ULLA 1L1OC 4X62L 4ME3A 4DUYQ 4DV3Q 1Y14B 1YJ9A 1J5EL 1N33L 4MZ9A 1PV4A 4LFBL 4P72A 5K36G 4OWTB 1S40A 4FDBA 3TS2A 4BY7H 5E7NA 5JJLA 5LMNQ 1R9TH 5C0XG 5LMNW 1WJJA 4MTNA 3ULPA 1NE3A 2K5HA 3G71A 4DR5Q 3HOUH 1M1KC 4DV1L 1J6QA 3E9HA 3PCOB 5FLMG 4ALPA 1TWAH 1VQIA 1PH3A 4LF9Q 4JCVE 3PUVA 4BBSG 4BXXG 1I94L 4UY8C 4P73A 4YHHQ 4NXNL 2ZJRA 4TVAB 5GADC 3TS0A 4DV0L 2GN5A 5M3MH 3CMEA 2JEBI 4IFDI 2WAQG 4LF8Q 4JBKA 3H3VH 2UUBL 4R4TA 2OTJA 3HOVG 2PQAB 3F8TA 5IWAQ 4BA1I 2UUAQ 3S14H 1VQKA 2R7FA 2Z0SA 3KOJA 4P75A 3SGIA 3DLLA 4WJ4A 5M3FH 3PUWA 4DV6L 2XGTA 3M7NA 3FKIG 4LF7Q 4NXMQ 2CFMA 1MKHA 4OONA 5FLXc 1QZHA 4XIGS 4LF6L 1UE1A 2KHJA 1SRUA 1PH5A 4YWKA 4B3RL 1OXSC 1D8LA 1LTLA 3CW2C 1PH4A 3A0JA 2RHQB 1XTDA 3PSIA 4DUYL 4DV3L 1E22A 2KBNA 4NB3A 4BBSH 3VDYA 5C3EG 4AYBG 5IYDG 2YU9H 4BXXH 3K81C 4A3EG 3OTOQ 2NN6G 4DUZQ 1XMQL 3MEFA 1VS0A 5LMNL 3FP9A 4LF5Q 4GKJQ 4QQBX 4R4IA 2Y0SG 1UWVA 3J81i 1OXVA 3BZCA 4JOIC 3KJPA 4DR5L 2MO0A 2BA1A 4NPSA 1PA6A 4IPHA 1MIUA 1Q81C 3CCEA 4DR2L 1JT8A 1B8AA 4YHHL 4A4IA 1VQLA 2I5MX 4A3MG 3HOVH 1B70B 1KRTA 1IBMQ 4UP7A 3U4ZA 2XTIA 3JAMc 3GTJH 1KIXA 3UE1A 2UXDQ 2DUDA 3T1HQ 4LF8L 2V1CC 3L7ZC 3W1GA 1A62A 2YYZA 3AQQA 4A3JG 4OO1I 1X3EA 4L5QA 5IWAL 3CCRA 2OQ0A 2YTVA 3NBHB 3S1RH 1XPRA 2JA6G 2KENA 2OCEA 5GAGC 1L1OB 3NENA 2B63G 2VQEQ 4DK3C 1AE3A 3I4OA 4Y52H 2YTXA 4LF7L 1I3QH 2HQLA 1IYJB 4A3KG 4NXML 1D7QA 1GM5A 1P16A 4X6AH 5C3EH 1CKNB 5IYDH 3CPFA 1CUKA 3HFZB 3U50C 2K75A 4HIOA 4A3EH 1JB7A 2F52A 1GO3E 3J80c 5IYBG 4X65L 4LFCQ 1W2BA 2I5LX 1PH1A 4GOPA 1VQDA 2CWPA 2K52A 2UXBL 2HHHL 4KHPQ 5IT9c 1VQGA 5C44G 2PNHA 3KDFB 3GO5A 1YBYA 4A3MH 1X3FA 4DUZL 4LF5L 2NVYH 3TEHB 4QGUA 2WFWA 4LF4Q 1K8AC 1SR3A 1KHIA 2IHFA 2DGYA 1XPUA 4A75A 3HKZE 3IRBA 4JI7Q 3H3VI 2BH8A 1KL9A 4C3JH 3UDIA 2YTYA 1WOCA 3FHWA 5BR8Q 4A3JH 3EN2A 3G6EA 4JI3Q 1IBML 3ICEA 2WB1G 2JA6H 4A3DH 1PVOA 1QUQA 2Z6KA 5HY6A 3W1BA 3BZKA 1VQMA 1G51A 4JC0A 3F2BA 2R93G 2UXDL 2HIXA 2IX0A 3ERSX 3T1HL 2UXCQ 4X64Q 1KC8C 3U58A 2CWAA 1HNWQ 4EX5A 3WWVA 4DAYB 3M85A 4R4CA 2D0PA 3TQYA 4APVA 5IYBH 2RCNA 3J7ZC 3AFPA 4YWLA 2VQEL 3CC4A 1YNXA 2ZJQA 1QVFA 5C44H 1PH2A 4DR4Q 5HGQA 3RLNA 2BH2A 4A3GG 1KAWA 4R4QA 1K83H 1PHJA 1GKHA 4GLAC 2R6GA 3K7UC 3K80C 3KF6A 4LFCL 2WP8J 4R4OA 1S72A 2VL6A 4QIWE 2ZJPA 2E5LL 3I2ZA 1YHAA 3PF5A 1RL2A 1U5KA 2ZTCA 4IOAA 1SROA 1X3GA 1X54A 4AQYQ 2ID0A 2QA4A 1K73C 1A63A 1XNRQ 5IE8A 2R7DA 2K14A 3S2DH 1X9NA 1SN8A 2HT1A 2VS1A 4P74A 3GTLH 1YI2A 3M4QA 2YV5A 2QGQA 1CKMA 4LF4L 1BBWA 1UEBA 1WCMG 2EIFA 1IBKQ 5IP9G 4B3SQ 2R93H 1YVCA 3CD6A 3BU2A 1TWGH 4JI7L 3CCLA 3NELA 4RMFA 2OQKA 4RG1A 1VQBA 3A5ZB 4JI3L 5BR8L 4JI6Q 5M5XH 4B3ML 4AIMA 4EQ5A 4PZ7A 5IP7G 3G48A 2N3SA 2WAQE 4DR3Q 1TWFH 3CC7A 2N78A 3S1MH 4A93G 1VQAA 5EAYA 2AWNA 2UXCL 1IXRA 4HJ5A 4HJAA 1FJGQ 1K3RA 4X64L 4A3GH 2VQFL 2NN6I 4PZ6A 5M5YH 3CCQA 4X66Q 4JI2Q 2F3IA 1KRSA 2N8NA 4LFAQ 3PO3G 3M4PA 2NVXH 5JJKA 2EQSA 4GOPB 1PH7A 1KXLA 4MNOA 5FLMH 2VW9A 2JA5G 4P71A 4KI0A 4DR4L 2LSSA 4GN3B 3Q8DA 4LWCA 4OWWB 2B3GA 4HIDA 4YWMA 4GNXA 3S2HH 2K4KA 1LM0A 2D0OA 3B6YA 5GROA 1UE5A 3EIVA 4JI4Q 2MQHA 1XNQQ 3H15A 1WCMH 2NZOA 5IP9H 1TXYA 1Y1VG 4AYBE 4AQYL 2AKWB 4XTCS 4LF9L 4JI8Q 5ELOA 2OTLA 1Z47A 1XNRL 2GVBA 1HNZQ 1EFWA 3GTOH 3TRZA 1N36Q 1HZ9A 2Y0SE 1Q46A 2AWOA 4JI0Q 3PGZA 3CCUA 1YITA 5IP7H 1A8VA 4LW1A 4HIMA 3FKIH 1Q86C 1IBKL 1SMXA 3I4NG 1XPOA 4C3HH 4A93H 2VNUD 2OWOA 2E2HH 1VQJA 1XJVA 1H95A 4DR6Q 1TWCH 1NMGA 5FJ8G 4JBMA 3M9BA 1V1QA 4JI6L 3CP0A 2UUAL 1I5FA 2R7ZG 2UUCQ 2K50A 3PO3H 1HZCA 1VQHA 1FVIA 2BA0A 4DR3L 4DNIA 1EYGA 2HIVA 3EBEA 3TREA 1ASZA 1C9OA 2LXJA 1EQQA 1X65A 2JA5H 1IZ6A 2ASBA 1JJGA 5GQOA 5C4XG 1E1OA 3U4VA 1O7IA 4X66L 1VQ7A 4C3IH 4LUZA 3F2CA 1Q1EA 2AHOB 4B3TQ 4OWXB 2JA7G 4LFAL 3M4OH 3PV0A 3CCMA 2R92G 1V9PA 4GOPC 4O0AA 4DR7Q 1Q8KA 4LUOA 1Y1VH 4QY7A 1NTGA 2MFIA 5AJ3Q 3RN2A 1Y1WG 5LMUQ 1YJNA 3GTKH 2N49A 4HJ9A 1C0AA 3OTOL 1EIFA 4QJFA 4A3IG 2JA9A 3NEMA 1HNXQ 4GKJL 4JI4L 1SLJA 1EIYB 2ES2A 3PIOA 2PI2A 4DPGA 1XNQL 1U0LA 4LFBQ 1VQOA 2MNAA 3L0OA 3A5UA 3I4NH 3K7AH 1AH9A 2AMCB 3GDEA 3D0FA 4BY1G 2KCTA 4JI8L 5GAHC 1C7YA 1HNZL 3UDXA 4UP9A 5FJ8H 1N36L 1K9MC 3PF4A 4JI0L 1WI5A 3UE0A 2R7ZH 1TWHH 4DV1Q 1ASYA 5IY0A 2Z6KC 1HR0Q 3PO2G 2B63H 1HR0W 3HOYG 4GKKQ 1EQRA 1Q12A 3E9IA 3F2DA 3STBC 4A3KH 3STBD 2NZHA 1B7YB 1HH2P 2E2IH 4DR6L 2WB1E 5C4XH 1IBLQ 5C0XI 3HOWG 4WJ3M 1CKOA 1EWIA 1OTCA 2IHEA 1KQSA 3GTPH 3S15H 4GLXA 1N32Q 3HKSA 2KHIA 1VQPA 2UUCL 4A3LG 1I6HH 2JA7H 1G6PA 1NMFA 4IPCA 2R92H 3CPWA 1BKBA 4GN5A 1Y1WH 3GTQH 4IFDJ 3CAMA 4POGA 4DV2Q 4JV5Q 3F1ZA 4GN4B 2VY3A 1UE7A 4K0KQ 3W5OA 4GNXB 4A3IH 4B3TL 3KJOA 2JEAI 3ER0A 4BBRG 2MO1A 3H0GG 2A19A 4A3FG 3CCSA 4KHPL 1FL0A 4DR7L 3KYHC 1NY4A 5AJ3L 3GTGH 1BBUA 5LMUL 1HZAA 3PIPA 1NJIC 4BY1H 3S17H 4C2MH 3S16H 1T9HA 1LYLA 4OX9Q 1SE8A 2PI2E 1HNXL 4A3BG 3S1NH 4IO9A 2VUMG 1KD1C 2ZTEA 4R1JA 3PO2H 4JI5Q 3HOYH 3J7A5 1OXTA 4A76A 4JG2A 4DV7Q 1CKNA 4DR1Q 1VQ4A 1XMOQ 4HIKA 4JI1L 1XMQQ 3ZJYC 3K8AA 1UE6A 5C4JH 1JMCA 1VQFA 3HOWH 3LGJA 1L2FA 1E7ZA 4A3LH 2I5HA 3KLWA 1RIPA 1V43A 1HR0L 3KDFA 4UPAA 2ATWA 4GKKL 4IJHA 4OXPA 1JE5A 1QVCA 2JK8A 4DR2Q 1M90C 1Q1BA 5J3BA 3I4MG 1PYBA 4Y7NH 4J15A 4LNQA 4JYAQ 1IBLL 4BA2I 1N32L 1HNWL 2L15A 3A74A 3CF5A 1WFQA 2JE6I 3D31A 3CMAA 1WYDA 1YZ6A 4BBRH 4KHZA 2D62A 2JA8G 3H0GH 4GS3A 4A3FH 1VQNA 1IL2A 1Q82C 1Q7YC 3HOXG 2UU9Q 1NBWA 1K0RA 3CCVA 5JEAJ 4DV2L 2JJQA 5H1SE 5GAEC 2ZM6Q 1CSQA 4DV4Q 4JV5L 1GVPA 3OYYA 4IFDG 4K0KL 4GNXC 4L5TA 1I50H 1YHBA 4IPGA 5IYCG 2ZTDA 4JI1Q 3I55A 4LF6Q 2A8VA 2VUMH 3RZOH 3RR5A 1OXUA 4KLKA 3JAMi 3S1QH 3OW2A 2K5VA 2E8GA 3S24A 1VQ9A 2I0QA 3KFUA 4X65Q 3CXCA 5JJIA 1PYSB 1VQ8A 3T1YQ 4DV5Q 3MXNB 1FGUA 1N8RC 3CQZH 2HHHQ 4OX9L 1QUQB 2UXBQ 1LUZA 1YEZA 3AFQA 4YCVA 1VQEA 4JI5L 2NVQH 1E3PA 3PUXA 1PH8A 4B3SL 1PFSA 4DV7L 4DR1L 1XMOL 3I4MH 1YIJA 1K8GA 4UP8A 4YCUA 4L5RC 1N34Q 2Q2TA 4YY3Q 1VQ6A 2F4VQ 4JOIA 4L5SA 3M3YH 1GD7A 1PH6A 3GD7A 2ALYB 1G291 1PH9A 1W3SA 1EOVA 3J80i 4GLVB 4O2DA 2JA8H 3KF8B 4PMWA 2NVTH 3J81j 5DLQE 4QL5A 4IJLA 4JBJA 3J81c 1FJGL 2C35B 3HOXH 1A0IA 1CSPA 4JYAL 1YJWA 4JI2L 2EXDA 4IPDA 2H5XA 3UDGA 1X56A 3KF6B 4YCWA 4HJ7A 3G4SA 3CCJA 5IYCH 4A3CG 4DKAC 4PG3A 5M5WH 1X6OA 2PQAA 3PUZA 3RZDH 1S3OA 1P8LA 1N9WA 3BJUA 1X55A 3HOZG 3CC2A 2UU9L 4JBWA 3L2PA 4A3DG 4DV4L 1AE2A 2ZM6L 4X62Q 2KCMA 1N33Q 1J5EQ 4PZ8A 1Z9FA 5JEAG 1EUJA 5C0XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAM A;  1QVG A;  1SFO H;  2Q2H A;  4OO1 G;  2VZA A;  1VQ5 A;  2PMZ E;  4POF A;  2CKZ B;  1E1T A;  2E5L Q;  3T1Y L;  4DV5 L;  2IY5 B;  3JC6 6;  1HJP A;  2CQO A;  3RLF A;  2Q2U A;  2GVA A;  1I94 Q;  4BY7 G;  3HKZ G;  4DK6 C;  4NXN Q;  1VQC A;  3UDF A;  2IX1 A;  1L0W A;  2RF4 A;  1VCI A;  2IT1 A;  3RLO A;  4DV0 Q;  1N34 L;  3AEV A;  4YY3 L;  3K0X A;  2F4V L;  3HOU G;  1MJE A;  5ELN A;  4IOC A;  1OXX K;  1MJC A;  4A3B H;  3PUY A;  1JJC B;  2UUB Q;  4A3C H;  3RNU A;  3E0E A;  1QZG A;  2E2J H;  1JJ2 A;  3HOZ H;  4HJ8 A;  2CCZ A;  1E24 A;  1YHQ A;  4B3M Q;  2B29 A;  5M3M G;  4DV6 Q;  1HZB A;  2Q2I A;  3RN5 A;  1BVS A;  2K5N A;  1DGS A;  2A1A A;  4AH6 A;  3ULJ A;  3I7F A;  4LUV A;  2RHS B;  4TQU S;  3DM3 A;  2VQF Q;  3GTM H;  4B3R Q;  3AYH B;  2FXQ A;  3I56 A;  5M3F G;  1L1O A;  2JQO A;  2LXK A;  4H02 A;  2QEX A;  3ULL A;  1L1O C;  4X62 L;  4ME3 A;  4DUY Q;  4DV3 Q;  1Y14 B;  1YJ9 A;  1J5E L;  1N33 L;  4MZ9 A;  1PV4 A;  4LFB L;  4P72 A;  5K36 G;  4OWT B;  1S40 A;  4FDB A;  3TS2 A;  4BY7 H;  5E7N A;  5JJL A;  5LMN Q;  1R9T H;  5C0X G;  5LMN W;  1WJJ A;  4MTN A;  3ULP A;  1NE3 A;  2K5H A;  3G71 A;  4DR5 Q;  3HOU H;  1M1K C;  4DV1 L;  1J6Q A;  3E9H A;  3PCO B;  5FLM G;  4ALP A;  1TWA H;  1VQI A;  1PH3 A;  4LF9 Q;  4JCV E;  3PUV A;  4BBS G;  4BXX G;  1I94 L;  4UY8 C;  4P73 A;  4YHH Q;  4NXN L;  2ZJR A;  4TVA B;  5GAD C;  3TS0 A;  4DV0 L;  2GN5 A;  5M3M H;  3CME A;  2JEB I;  4IFD I;  2WAQ G;  4LF8 Q;  4JBK A;  3H3V H;  2UUB L;  4R4T A;  2OTJ A;  3HOV G;  2PQA B;  3F8T A;  5IWA Q;  4BA1 I;  2UUA Q;  3S14 H;  1VQK A;  2R7F A;  2Z0S A;  3KOJ A;  4P75 A;  3SGI A;  3DLL A;  4WJ4 A;  5M3F H;  3PUW A;  4DV6 L;  2XGT A;  3M7N A;  3FKI G;  4LF7 Q;  4NXM Q;  2CFM A;  1MKH A;  4OON A;  5FLX c;  1QZH A;  4XIG S;  4LF6 L;  1UE1 A;  2KHJ A;  1SRU A;  1PH5 A;  4YWK A;  4B3R L;  1OXS C;  1D8L A;  1LTL A;  3CW2 C;  1PH4 A;  3A0J A;  2RHQ B;  1XTD A;  3PSI A;  4DUY L;  4DV3 L;  1E22 A;  2KBN A;  4NB3 A;  4BBS H;  3VDY A;  5C3E G;  4AYB G;  5IYD G;  2YU9 H;  4BXX H;  3K81 C;  4A3E G;  3OTO Q;  2NN6 G;  4DUZ Q;  1XMQ L;  3MEF A;  1VS0 A;  5LMN L;  3FP9 A;  4LF5 Q;  4GKJ Q;  4QQB X;  4R4I A;  2Y0S G;  1UWV A;  3J81 i;  1OXV A;  3BZC A;  4JOI C;  3KJP A;  4DR5 L;  2MO0 A;  2BA1 A;  4NPS A;  1PA6 A;  4IPH A;  1MIU A;  1Q81 C;  3CCE A;  4DR2 L;  1JT8 A;  1B8A A;  4YHH L;  4A4I A;  1VQL A;  2I5M X;  4A3M G;  3HOV H;  1B70 B;  1KRT A;  1IBM Q;  4UP7 A;  3U4Z A;  2XTI A;  3JAM c;  3GTJ H;  1KIX A;  3UE1 A;  2UXD Q;  2DUD A;  3T1H Q;  4LF8 L;  2V1C C;  3L7Z C;  3W1G A;  1A62 A;  2YYZ A;  3AQQ A;  4A3J G;  4OO1 I;  1X3E A;  4L5Q A;  5IWA L;  3CCR A;  2OQ0 A;  2YTV A;  3NBH B;  3S1R H;  1XPR A;  2JA6 G;  2KEN A;  2OCE A;  5GAG C;  1L1O B;  3NEN A;  2B63 G;  2VQE Q;  4DK3 C;  1AE3 A;  3I4O A;  4Y52 H;  2YTX A;  4LF7 L;  1I3Q H;  2HQL A;  1IYJ B;  4A3K G;  4NXM L;  1D7Q A;  1GM5 A;  1P16 A;  4X6A H;  5C3E H;  1CKN B;  5IYD H;  3CPF A;  1CUK A;  3HFZ B;  3U50 C;  2K75 A;  4HIO A;  4A3E H;  1JB7 A;  2F52 A;  1GO3 E;  3J80 c;  5IYB G;  4X65 L;  4LFC Q;  1W2B A;  2I5L X;  1PH1 A;  4GOP A;  1VQD A;  2CWP A;  2K52 A;  2UXB L;  2HHH L;  4KHP Q;  5IT9 c;  1VQG A;  5C44 G;  2PNH A;  3KDF B;  3GO5 A;  1YBY A;  4A3M H;  1X3F A;  4DUZ L;  4LF5 L;  2NVY H;  3TEH B;  4QGU A;  2WFW A;  4LF4 Q;  1K8A C;  1SR3 A;  1KHI A;  2IHF A;  2DGY A;  1XPU A;  4A75 A;  3HKZ E;  3IRB A;  4JI7 Q;  3H3V I;  2BH8 A;  1KL9 A;  4C3J H;  3UDI A;  2YTY A;  1WOC A;  3FHW A;  5BR8 Q;  4A3J H;  3EN2 A;  3G6E A;  4JI3 Q;  1IBM L;  3ICE A;  2WB1 G;  2JA6 H;  4A3D H;  1PVO A;  1QUQ A;  2Z6K A;  5HY6 A;  3W1B A;  3BZK A;  1VQM A;  1G51 A;  4JC0 A;  3F2B A;  2R93 G;  2UXD L;  2HIX A;  2IX0 A;  3ERS X;  3T1H L;  2UXC Q;  4X64 Q;  1KC8 C;  3U58 A;  2CWA A;  1HNW Q;  4EX5 A;  3WWV A;  4DAY B;  3M85 A;  4R4C A;  2D0P A;  3TQY A;  4APV A;  5IYB H;  2RCN A;  3J7Z C;  3AFP A;  4YWL A;  2VQE L;  3CC4 A;  1YNX A;  2ZJQ A;  1QVF A;  5C44 H;  1PH2 A;  4DR4 Q;  5HGQ A;  3RLN A;  2BH2 A;  4A3G G;  1KAW A;  4R4Q A;  1K83 H;  1PHJ A;  1GKH A;  4GLA C;  2R6G A;  3K7U C;  3K80 C;  3KF6 A;  4LFC L;  2WP8 J;  4R4O A;  1S72 A;  2VL6 A;  4QIW E;  2ZJP A;  2E5L L;  3I2Z A;  1YHA A;  3PF5 A;  1RL2 A;  1U5K A;  2ZTC A;  4IOA A;  1SRO A;  1X3G A;  1X54 A;  4AQY Q;  2ID0 A;  2QA4 A;  1K73 C;  1A63 A;  1XNR Q;  5IE8 A;  2R7D A;  2K14 A;  3S2D H;  1X9N A;  1SN8 A;  2HT1 A;  2VS1 A;  4P74 A;  3GTL H;  1YI2 A;  3M4Q A;  2YV5 A;  2QGQ A;  1CKM A;  4LF4 L;  1BBW A;  1UEB A;  1WCM G;  2EIF A;  1IBK Q;  5IP9 G;  4B3S Q;  2R93 H;  1YVC A;  3CD6 A;  3BU2 A;  1TWG H;  4JI7 L;  3CCL A;  3NEL A;  4RMF A;  2OQK A;  4RG1 A;  1VQB A;  3A5Z B;  4JI3 L;  5BR8 L;  4JI6 Q;  5M5X H;  4B3M L;  4AIM A;  4EQ5 A;  4PZ7 A;  5IP7 G;  3G48 A;  2N3S A;  2WAQ E;  4DR3 Q;  1TWF H;  3CC7 A;  2N78 A;  3S1M H;  4A93 G;  1VQA A;  5EAY A;  2AWN A;  2UXC L;  1IXR A;  4HJ5 A;  4HJA A;  1FJG Q;  1K3R A;  4X64 L;  4A3G H;  2VQF L;  2NN6 I;  4PZ6 A;  5M5Y H;  3CCQ A;  4X66 Q;  4JI2 Q;  2F3I A;  1KRS A;  2N8N A;  4LFA Q;  3PO3 G;  3M4P A;  2NVX H;  5JJK A;  2EQS A;  4GOP B;  1PH7 A;  1KXL A;  4MNO A;  5FLM H;  2VW9 A;  2JA5 G;  4P71 A;  4KI0 A;  4DR4 L;  2LSS A;  4GN3 B;  3Q8D A;  4LWC A;  4OWW B;  2B3G A;  4HID A;  4YWM A;  4GNX A;  3S2H H;  2K4K A;  1LM0 A;  2D0O A;  3B6Y A;  5GRO A;  1UE5 A;  3EIV A;  4JI4 Q;  2MQH A;  1XNQ Q;  3H15 A;  1WCM H;  2NZO A;  5IP9 H;  1TXY A;  1Y1V G;  4AYB E;  4AQY L;  2AKW B;  4XTC S;  4LF9 L;  4JI8 Q;  5ELO A;  2OTL A;  1Z47 A;  1XNR L;  2GVB A;  1HNZ Q;  1EFW A;  3GTO H;  3TRZ A;  1N36 Q;  1HZ9 A;  2Y0S E;  1Q46 A;  2AWO A;  4JI0 Q;  3PGZ A;  3CCU A;  1YIT A;  5IP7 H;  1A8V A;  4LW1 A;  4HIM A;  3FKI H;  1Q86 C;  1IBK L;  1SMX A;  3I4N G;  1XPO A;  4C3H H;  4A93 H;  2VNU D;  2OWO A;  2E2H H;  1VQJ A;  1XJV A;  1H95 A;  4DR6 Q;  1TWC H;  1NMG A;  5FJ8 G;  4JBM A;  3M9B A;  1V1Q A;  4JI6 L;  3CP0 A;  2UUA L;  1I5F A;  2R7Z G;  2UUC Q;  2K50 A;  3PO3 H;  1HZC A;  1VQH A;  1FVI A;  2BA0 A;  4DR3 L;  4DNI A;  1EYG A;  2HIV A;  3EBE A;  3TRE A;  1ASZ A;  1C9O A;  2LXJ A;  1EQQ A;  1X65 A;  2JA5 H;  1IZ6 A;  2ASB A;  1JJG A;  5GQO A;  5C4X G;  1E1O A;  3U4V A;  1O7I A;  4X66 L;  1VQ7 A;  4C3I H;  4LUZ A;  3F2C A;  1Q1E A;  2AHO B;  4B3T Q;  4OWX B;  2JA7 G;  4LFA L;  3M4O H;  3PV0 A;  3CCM A;  2R92 G;  1V9P A;  4GOP C;  4O0A A;  4DR7 Q;  1Q8K A;  4LUO A;  1Y1V H;  4QY7 A;  1NTG A;  2MFI A;  5AJ3 Q;  3RN2 A;  1Y1W G;  5LMU Q;  1YJN A;  3GTK H;  2N49 A;  4HJ9 A;  1C0A A;  3OTO L;  1EIF A;  4QJF A;  4A3I G;  2JA9 A;  3NEM A;  1HNX Q;  4GKJ L;  4JI4 L;  1SLJ A;  1EIY B;  2ES2 A;  3PIO A;  2PI2 A;  4DPG A;  1XNQ L;  1U0L A;  4LFB Q;  1VQO A;  2MNA A;  3L0O A;  3A5U A;  3I4N H;  3K7A H;  1AH9 A;  2AMC B;  3GDE A;  3D0F A;  4BY1 G;  2KCT A;  4JI8 L;  5GAH C;  1C7Y A;  1HNZ L;  3UDX A;  4UP9 A;  5FJ8 H;  1N36 L;  1K9M C;  3PF4 A;  4JI0 L;  1WI5 A;  3UE0 A;  2R7Z H;  1TWH H;  4DV1 Q;  1ASY A;  5IY0 A;  2Z6K C;  1HR0 Q;  3PO2 G;  2B63 H;  1HR0 W;  3HOY G;  4GKK Q;  1EQR A;  1Q12 A;  3E9I A;  3F2D A;  3STB C;  4A3K H;  3STB D;  2NZH A;  1B7Y B;  1HH2 P;  2E2I H;  4DR6 L;  2WB1 E;  5C4X H;  1IBL Q;  5C0X I;  3HOW G;  4WJ3 M;  1CKO A;  1EWI A;  1OTC A;  2IHE A;  1KQS A;  3GTP H;  3S15 H;  4GLX A;  1N32 Q;  3HKS A;  2KHI A;  1VQP A;  2UUC L;  4A3L G;  1I6H H;  2JA7 H;  1G6P A;  1NMF A;  4IPC A;  2R92 H;  3CPW A;  1BKB A;  4GN5 A;  1Y1W H;  3GTQ H;  4IFD J;  3CAM A;  4POG A;  4DV2 Q;  4JV5 Q;  3F1Z A;  4GN4 B;  2VY3 A;  1UE7 A;  4K0K Q;  3W5O A;  4GNX B;  4A3I H;  4B3T L;  3KJO A;  2JEA I;  3ER0 A;  4BBR G;  2MO1 A;  3H0G G;  2A19 A;  4A3F G;  3CCS A;  4KHP L;  1FL0 A;  4DR7 L;  3KYH C;  1NY4 A;  5AJ3 L;  3GTG H;  1BBU A;  5LMU L;  1HZA A;  3PIP A;  1NJI C;  4BY1 H;  3S17 H;  4C2M H;  3S16 H;  1T9H A;  1LYL A;  4OX9 Q;  1SE8 A;  2PI2 E;  1HNX L;  4A3B G;  3S1N H;  4IO9 A;  2VUM G;  1KD1 C;  2ZTE A;  4R1J A;  3PO2 H;  4JI5 Q;  3HOY H;  3J7A 5;  1OXT A;  4A76 A;  4JG2 A;  4DV7 Q;  1CKN A;  4DR1 Q;  1VQ4 A;  1XMO Q;  4HIK A;  4JI1 L;  1XMQ Q;  3ZJY C;  3K8A A;  1UE6 A;  5C4J H;  1JMC A;  1VQF A;  3HOW H;  3LGJ A;  1L2F A;  1E7Z A;  4A3L H;  2I5H A;  3KLW A;  1RIP A;  1V43 A;  1HR0 L;  3KDF A;  4UPA A;  2ATW A;  4GKK L;  4IJH A;  4OXP A;  1JE5 A;  1QVC A;  2JK8 A;  4DR2 Q;  1M90 C;  1Q1B A;  5J3B A;  3I4M G;  1PYB A;  4Y7N H;  4J15 A;  4LNQ A;  4JYA Q;  1IBL L;  4BA2 I;  1N32 L;  1HNW L;  2L15 A;  3A74 A;  3CF5 A;  1WFQ A;  2JE6 I;  3D31 A;  3CMA A;  1WYD A;  1YZ6 A;  4BBR H;  4KHZ A;  2D62 A;  2JA8 G;  3H0G H;  4GS3 A;  4A3F H;  1VQN A;  1IL2 A;  1Q82 C;  1Q7Y C;  3HOX G;  2UU9 Q;  1NBW A;  1K0R A;  3CCV A;  5JEA J;  4DV2 L;  2JJQ A;  5H1S E;  5GAE C;  2ZM6 Q;  1CSQ A;  4DV4 Q;  4JV5 L;  1GVP A;  3OYY A;  4IFD G;  4K0K L;  4GNX C;  4L5T A;  1I50 H;  1YHB A;  4IPG A;  5IYC G;  2ZTD A;  4JI1 Q;  3I55 A;  4LF6 Q;  2A8V A;  2VUM H;  3RZO H;  3RR5 A;  1OXU A;  4KLK A;  3JAM i;  3S1Q H;  3OW2 A;  2K5V A;  2E8G A;  3S24 A;  1VQ9 A;  2I0Q A;  3KFU A;  4X65 Q;  3CXC A;  5JJI A;  1PYS B;  1VQ8 A;  3T1Y Q;  4DV5 Q;  3MXN B;  1FGU A;  1N8R C;  3CQZ H;  2HHH Q;  4OX9 L;  1QUQ B;  2UXB Q;  1LUZ A;  1YEZ A;  3AFQ A;  4YCV A;  1VQE A;  4JI5 L;  2NVQ H;  1E3P A;  3PUX A;  1PH8 A;  4B3S L;  1PFS A;  4DV7 L;  4DR1 L;  1XMO L;  3I4M H;  1YIJ A;  1K8G A;  4UP8 A;  4YCU A;  4L5R C;  1N34 Q;  2Q2T A;  4YY3 Q;  1VQ6 A;  2F4V Q;  4JOI A;  4L5S A;  3M3Y H;  1GD7 A;  1PH6 A;  3GD7 A;  2ALY B;  1G29 1;  1PH9 A;  1W3S A;  1EOV A;  3J80 i;  4GLV B;  4O2D A;  2JA8 H;  3KF8 B;  4PMW A;  2NVT H;  3J81 j;  5DLQ E;  4QL5 A;  4IJL A;  4JBJ A;  3J81 c;  1FJG L;  2C35 B;  3HOX H;  1A0I A;  1CSP A;  4JYA L;  1YJW A;  4JI2 L;  2EXD A;  4IPD A;  2H5X A;  3UDG A;  1X56 A;  3KF6 B;  4YCW A;  4HJ7 A;  3G4S A;  3CCJ A;  5IYC H;  4A3C G;  4DKA C;  4PG3 A;  5M5W H;  1X6O A;  2PQA A;  3PUZ A;  3RZD H;  1S3O A;  1P8L A;  1N9W A;  3BJU A;  1X55 A;  3HOZ G;  3CC2 A;  2UU9 L;  4JBW A;  3L2P A;  4A3D G;  4DV4 L;  1AE2 A;  2ZM6 L;  4X62 Q;  2KCM A;  1N33 Q;  1J5E Q;  4PZ8 A;  1Z9F A;  5JEA G;  1EUJ A;  5C0X J; 
#chains in the Genus database with same CATH topology
 3IKJ A;  4DAM A;  2EZV A;  2L12 A;  2Q2H A;  1VQ5 A;  2CVR A;  3GTK B;  2CKZ B;  5FLX L;  1E1T A;  4CHT B;  2E5L Q;  2NVY B;  3MHB A;  4DV5 L;  5JAV A;  1JOO A;  2CQO A;  4ZCK A;  2Q2U A;  1Q3L A;  1STY A;  1DOM A;  2F3W A;  4BY7 G;  4NXN Q;  1VQC A;  2IX1 A;  1ENF A;  3RLO A;  3AEV A;  1TKW B;  1DM0 B;  4IOC A;  1MJC A;  5CV8 A;  1A3T A;  4LAA A;  2E2J H;  4QUC A;  4A3K B;  4B3M Q;  2E2I B;  5C4X B;  1QWY A;  1HUM A;  1HZB A;  3RN5 A;  1UEA B;  3S15 B;  1BVS A;  1Y8N B;  2F0L A;  2K04 A;  3I7F A;  4F7X A;  3OMG A;  1D5Z C;  2FXQ A;  4OO1 H;  1SYC A;  5I4D A;  3A56 A;  4A3I B;  1TU2 B;  1N33 L;  1J5E L;  4H0L C;  4LFB L;  1IL8 A;  1S40 A;  5LMN Q;  4MTN A;  3S16 B;  3MVV A;  4C1N I;  1M1K C;  2CW0 D;  3PO2 B;  4BBS G;  4JCV E;  3MC0 B;  2EXZ A;  4P73 A;  2JSO A;  4YHH Q;  2DJF C;  4NXN L;  1Z7T A;  5GAD C;  1SMY D;  1SNC A;  5C4J B;  3TS0 A;  5IT9 L;  2K1B A;  3HOW B;  1SYG A;  1I4H A;  1IHZ A;  4ZK9 B;  2PQA B;  1Q8I A;  1JCK B;  2UUA Q;  3SGI A;  3PUW A;  3NWT A;  4CKB A;  2FMM A;  4NXM Q;  5FLX c;  5KYI A;  4XIG S;  5A2Q L;  4RGM A;  5IGE A;  2O4X A;  4KKT A;  1OXS C;  5C0X H;  1EY8 A;  1HCZ A;  3H94 A;  2Q8R E;  3PSI A;  1WCM B;  1QCB D;  2HCI A;  4AYB G;  1ET9 A;  2F0S A;  3K81 C;  4DUZ Q;  4QQB X;  5LMN L;  3FP9 A;  1EY5 A;  1X3Q A;  3Q0A A;  1UWV A;  3J81 i;  1DOK A;  4YHH L;  1G91 A;  3I4M B;  2I5M X;  4CKC A;  4PQX A;  3AU7 A;  1KRT A;  1TWC B;  4UP7 A;  4H44 C;  4DAP A;  2XTI A;  3JAM c;  1KIX A;  3UE1 A;  4CDF C;  2UXD Q;  3T1H Q;  1WD1 A;  4K2K A;  2NVT B;  3T51 B;  3MXG A;  1EU4 A;  3NBH B;  2JA6 G;  5GAG C;  5E1F A;  2Z4I A;  2L55 A;  4I65 A;  4NXM L;  3EJI A;  3C2P A;  1GM5 A;  1SYE A;  1P16 A;  2LKV A;  5C3E H;  1Y1V B;  1CUK A;  2N88 A;  2BE5 C;  3D4R A;  2F52 A;  4RGO S;  4E6I A;  3J80 c;  2DY8 A;  2UXB L;  4WRD A;  5IT9 c;  4DXF A;  2AUK A;  3GV3 A;  4I7Z C;  4A3M H;  1PZI D;  3EQL C;  4DUZ L;  3TEH B;  2WFW A;  4HN7 A;  4LF4 Q;  1HQR D;  1KHI A;  5TSS A;  3VYU A;  4JI7 Q;  2BH8 A;  1KL9 A;  2TSS A;  4C3J H;  2YTY A;  4DGZ A;  4A3J H;  2JN4 A;  3MXN A;  5C5M A;  4A3D H;  5BN3 A;  1PVO A;  2Z6K A;  2R93 G;  3A8K E;  2UXD L;  3T1H L;  3KBG A;  2F0N A;  1LTB D;  4RH6 A;  1BR9 A;  3U58 A;  1Y1W B;  3ONA B;  5IGG A;  3TQY A;  2D0P A;  4EVO A;  4RGT A;  4DFA A;  3CC4 A;  5C3W A;  1LTT D;  1KAB A;  3RLN A;  2BH2 A;  4A3G G;  4TSS A;  3OSO A;  1GKH A;  4MTK A;  3V96 A;  1DZ1 A;  3K7U C;  2X69 A;  3KF6 A;  2WP8 J;  2VL6 A;  2PQE A;  1SE4 A;  2NZ1 D;  1SRO A;  2XRQ D;  1CT1 D;  2ID0 A;  3NQT A;  2EYP A;  5IE8 A;  4BY7 B;  1H9S A;  2XWJ B;  4FVM A;  3GTL H;  1YI2 A;  1EYD A;  5IGB A;  3IFD A;  4LF4 L;  5KNB A;  1UEB A;  2FHT A;  1TWG H;  4JI7 L;  3J81 E;  1IYV A;  1OO9 B;  1VQB A;  4JI6 Q;  4PZ7 A;  5IP7 G;  3G48 A;  3P75 A;  4FO2 A;  2N78 A;  1LT6 D;  1FJG Q;  2D2C C;  2KVM A;  5EPJ A;  4X66 Q;  3BVG A;  1KRS A;  2SOB A;  2E76 C;  2VUM B;  4P71 A;  4KI0 A;  3X3N A;  2EYM A;  4HID A;  1BUV T;  1QIL A;  4C3I G;  4YWM A;  1U9R A;  3MEH A;  1F2M A;  2VB3 X;  2AQ3 B;  3GQB A;  2AKW B;  2EY1 A;  4NMZ A;  1HNZ Q;  1RD9 D;  4K5W A;  2G9H D;  5EQ0 A;  1Q46 A;  4DK1 A;  3CCU A;  3M3Y B;  2FJ2 A;  1A8V A;  1Q86 C;  4C3H H;  4KHV A;  1PTO D;  1VQJ A;  3N6R A;  4JI6 L;  2NYZ D;  5C4H A;  3PO3 H;  1HZC A;  1FVI A;  2BA0 A;  3GTJ B;  5CV5 A;  1EYG A;  4FF2 A;  4FXG C;  2G9D A;  3RMH A;  1JJG A;  1E1O A;  1S5C D;  1O7I A;  4KJN A;  4XYQ A;  5CMD A;  4X66 L;  4LUZ A;  4HCE A;  4GOP C;  4DR7 Q;  1EQV A;  1JR0 D;  2XVS A;  4ULL A;  4DXG A;  1NTG A;  2MFI A;  2WKD A;  4AYB B;  2N49 A;  4HTH A;  2JA9 A;  3L9A X;  2K05 A;  2H1E A;  2ES2 A;  3A8J E;  1U0L A;  3K6O A;  3A5U A;  1AH9 A;  2AMC B;  3D0F A;  1XWE A;  2KCT A;  3KLS A;  1C7Y A;  1V1P B;  1HNZ L;  5FJ8 H;  5I2X A;  3PF4 A;  2RKS A;  1PFM A;  4GKK Q;  5FKA C;  2NZH A;  1B7Y B;  4ZUJ A;  1GJX A;  4R8N A;  4EQO A;  3HOZ B;  1CKO A;  1EWI A;  1OTC A;  1VQP A;  2KHI A;  2JA6 B;  4FYD A;  1A15 A;  2I46 A;  1NMF A;  4IUQ A;  1SNO A;  3CPW A;  4C56 C;  1ML0 D;  3I70 A;  1G2S A;  3WDN A;  5EKK A;  4DV2 Q;  4JV5 Q;  1GUW A;  3W5O A;  3KJO A;  4UAI A;  1RDP D;  1A6X A;  3CCS A;  4DR7 L;  5ELD A;  2CQA A;  1NY4 A;  3GTG H;  1ONL A;  3PIP A;  2KCN A;  1K83 B;  4C2M H;  2F1M A;  2IWH A;  3W2D A;  2B2T A;  4ZRZ A;  3S1N H;  4IO9 A;  4R1J A;  1YNN C;  3HOY H;  1YNN D;  1VQ4 A;  1PTO B;  1I6V C;  5FO8 B;  3M7G A;  4HIK A;  1J9O A;  3NHH A;  3ZJY C;  1XMQ Q;  4QMG A;  3MTS A;  2C9O A;  3KK7 A;  3N52 A;  2I5H A;  3KLW A;  1RIP A;  4UPA A;  1CA5 A;  4GKK L;  2R93 B;  1M90 C;  2JK8 A;  4DR2 Q;  1Q1B A;  5J3B A;  3SR1 A;  3G6J B;  1JWS D;  4J15 A;  4LNQ A;  2RSN A;  4BA2 I;  1CZG A;  1RTO A;  2F0O A;  1HNW L;  3D31 A;  2JA8 G;  1TWF B;  3I73 A;  4WJW A;  3S1M B;  1TY0 A;  1HA5 A;  3HOX G;  1NBW A;  1K0R A;  3CCV A;  4A3G B;  4DV2 L;  4JV5 L;  2ZM6 Q;  5M5Y B;  1CSQ A;  1G6Z A;  1GVP A;  4A3B H;  1I50 H;  2NVX B;  3OWE B;  1OXU A;  1KNE A;  1STB A;  2K5V A;  2E8G A;  5CBA E;  4U67 3;  5JJI A;  1PYS B;  3DWQ A;  3S2H B;  1FGU A;  2AQ2 B;  2HHH Q;  1QUQ B;  1LUZ A;  4F87 A;  2BDO A;  2NVQ H;  1E3P A;  3PUX A;  5DM6 3;  1YIJ A;  1K8G A;  1DCZ A;  4UP8 A;  4RKB A;  1F2Y A;  1VQ6 A;  3OW7 A;  1PH6 A;  2ALY B;  4X3S A;  1YNJ C;  1W3S A;  1YNJ D;  1JB3 A;  1AZP A;  1PTO F;  3P7J A;  3IL8 A;  2P5Z X;  4IJL A;  4G57 A;  4ZYS A;  3T53 B;  4CJ1 B;  3S1R B;  3QO2 A;  1FD7 D;  5J39 A;  3DMU A;  5M5W H;  3RZD H;  1X55 A;  1PYW D;  3QIA A;  4ZAI A;  3O13 A;  2RCF A;  2ZM6 L;  4FP5 D;  4C3I B;  1KLG D;  3WOF A;  1F2L A;  5C0X J;  4G7H C;  1QVG A;  5FK9 C;  4XT3 B;  1JWM D;  2CHB D;  4OO1 G;  2VZA A;  1TT2 A;  2R3Z A;  3HEJ A;  2Z1C A;  4KKS A;  3PMF A;  1WTX A;  1JOR A;  1MGS A;  3JC6 6;  1HJP A;  1I94 Q;  4ZKB B;  3K7A B;  4F88 A;  1SJH D;  1VCI A;  2B39 A;  1MJE A;  1OXX K;  5EGT A;  2B63 B;  4A3C H;  1AW7 A;  4HJ8 A;  1E24 A;  4HAE A;  3ZYY X;  2ICI A;  3GTP B;  4P2C B;  5I6Y A;  2K5N A;  4AH6 A;  2B2Y C;  1JIC A;  4LUV A;  3VYR A;  4TQU S;  1PXU A;  3A54 A;  3WOE A;  3OIQ A;  2QW7 A;  3VR6 A;  3T4A C;  3AYH B;  3I56 A;  4K2L A;  2IPK D;  1PRT F;  3Q23 A;  1FGB D;  2QEX A;  1H9M A;  3K0Y A;  4DUY Q;  1IW7 C;  1F9P A;  1Y14 B;  2QKI C;  1T5X D;  1HFN A;  1B50 A;  4OWT B;  1TQO A;  4FDB A;  3A55 A;  2F0J A;  1R9T H;  5C0X G;  5LMN W;  3S17 B;  3ULP A;  1NE3 A;  3C3L A;  2K5H A;  3G71 A;  5F2D A;  1J6Q A;  3MA2 B;  3PCO B;  2X6G A;  5FLM G;  1TWA H;  1VQI A;  3IFT A;  4OL7 A;  1EU3 A;  1I94 L;  3NBI A;  4TVA B;  5M3M H;  3CME A;  2JEB I;  5I6W A;  2WAQ G;  4JBK A;  4S3S A;  1LTA D;  3H3V H;  2EJM A;  3F8T A;  4Y7N B;  4BA1 I;  2D5D A;  3S14 H;  1CQV A;  4P75 A;  3L3O C;  3DLL A;  4WJ4 A;  3FKI G;  1C8C A;  2CFM A;  1MKH A;  4XQN A;  1EYA A;  3T16 A;  1D1K A;  1ILP A;  2B8F A;  4KY5 A;  4QUF A;  2WAC A;  1B4O A;  1SRU A;  1PH5 A;  4YWK A;  2F0M A;  1HFG A;  1LTL A;  4K8I A;  1PH4 A;  2RHQ B;  3GV6 A;  4DUY L;  1EIH A;  3DWP A;  1E22 A;  3RZO B;  3VDY A;  5C3E G;  2YU9 H;  4BXX H;  1JOK A;  3S1Q B;  4U68 A;  1VS0 A;  1HQM C;  2Y0S G;  1TS4 A;  3BZC A;  1GUO A;  4JOI C;  5IGC A;  3KJP A;  1LT4 D;  2MO0 A;  5EPK A;  1PA6 A;  4ODG A;  5DEH A;  1MIU A;  1B8A A;  3HOV H;  4A3M G;  3G7L A;  4L6T B;  3BDC A;  3BVM A;  2DUD A;  2V1C C;  4C3J G;  2JA8 B;  4G7O C;  3W1G A;  1EY0 A;  4A3J G;  4OO1 I;  1XPR A;  2JA5 B;  2YTV A;  3HOX B;  2KEN A;  5CC4 A;  4Y52 H;  1AE3 A;  3VYT A;  4CJ2 C;  1I3Q H;  3M4O B;  5CBE E;  2PW5 A;  4X3U A;  1Y8O B;  3LX0 A;  1CKN B;  3VR4 A;  3CPF A;  2NUC A;  5G3L D;  2NN6 H;  1Y69 U;  4IUR A;  4X65 L;  4HR7 B;  1STG A;  4MIU A;  2DN8 A;  2PPB C;  1D2B A;  3KDF B;  3MXP A;  3PIO 3;  1S5E D;  2DNC A;  3VA5 A;  2NVY H;  1W6J A;  1LT5 D;  2F0I A;  3OPO A;  3LWE A;  3TZU A;  1SR3 A;  3I90 A;  5D3I B;  2IHF A;  3D4W A;  3IRB A;  5BR8 Q;  3EN2 A;  2MUY A;  3H09 A;  3ICE A;  2WB1 G;  3AB9 A;  3CU7 A;  3F2B A;  2IX0 A;  4ID6 A;  3ERS X;  2UXC Q;  3MFY A;  1H9R A;  1GHJ A;  2GA4 B;  3JAM L;  4EX5 A;  3M85 A;  4R4C A;  4APV A;  3D8G A;  3AFP A;  3SK4 A;  2ICE C;  1ET6 A;  1FNV A;  2F0F A;  2ZJQ A;  5C44 H;  1KAW A;  1PHJ A;  4GLA C;  1LV9 A;  2R6G A;  1MSH A;  1KTK A;  1CK1 A;  3SDZ A;  2JP1 A;  4R4O A;  2E5L L;  4B9W A;  3C1E A;  2IX3 A;  3I2Z A;  1U5K A;  3Q24 A;  2CW0 C;  2ZTC A;  2MHV A;  4AQY Q;  2QA4 A;  1UNS A;  1XNR Q;  3J80 L;  5IGD A;  1EWH A;  2HT1 A;  4P74 A;  1D6E C;  1SMY C;  1STE A;  2VB2 X;  2YV5 A;  1CKM A;  2F0U A;  1HRJ A;  2F0T A;  4B3S Q;  3CD6 A;  3CHB D;  2Q8I B;  1L0X B;  5EKI A;  1MD2 D;  3A5Z B;  4QF4 A;  5BR8 L;  4B3M L;  4AIM A;  4RFB A;  4IZ8 A;  1EZ6 A;  2N3S A;  4KN7 C;  4C3H G;  5EAY A;  2UXC L;  4BBR B;  2CH4 A;  4HJ5 A;  4DN4 M;  1IYU A;  4FNF A;  4RCN A;  4PV1 C;  1BF4 A;  4JI2 Q;  2F3I A;  2M00 A;  3TP8 A;  2NB0 A;  3PO3 G;  3M4P A;  5L37 A;  1DYQ A;  5JJK A;  1R4Q B;  1K3B C;  4DNT B;  3SK6 A;  5FLM H;  2VW9 A;  2LSS A;  4GN3 B;  1I4R A;  4OWW B;  1W6K A;  1LM0 A;  2D0O A;  5EKL A;  5GRO A;  1HUN A;  3ERQ A;  3H15 A;  1WCM H;  3W3A A;  2NZO A;  1TXY A;  3U9S A;  4AYB E;  3R2I A;  4ZUI A;  4AQY L;  3VR5 A;  4XTC S;  5ELC A;  2OTL A;  3DUZ A;  1XNR L;  3GTO H;  1HZ9 A;  2K5D A;  5IIF A;  3QR8 A;  3FKI H;  1XPO A;  1QNU A;  4A93 H;  1RKN A;  2A5H A;  2OWO A;  3D4D A;  4DR6 Q;  1TWC H;  5FJ8 G;  3MZ5 A;  4JBM A;  3C1F A;  1RHP A;  2UUA L;  2UUC Q;  1VQH A;  2EY6 A;  2HIV A;  3TRE A;  1ASZ A;  4EGV A;  2LXJ A;  1EQQ A;  5GQO A;  1Q1E A;  1AP0 A;  3PV0 A;  1A3U A;  1WTP A;  4LUO A;  1Y1V H;  4QY7 A;  5G3L F;  3RN2 A;  1S5B D;  1JC7 A;  4HJ9 A;  1C0A A;  1EIF A;  4KD4 A;  1HNX Q;  2ZXO A;  2Y0S B;  1KLU D;  1SYB A;  1MHW C;  1T5E A;  3I4N H;  3J7A F;  3UDX A;  4UP9 A;  4A3M B;  1I4Q A;  1FYC A;  2R7Z H;  1EYC A;  2MPM A;  4DV1 Q;  5IY0 A;  2Z6K C;  1HR0 Q;  1FNW A;  3HOY G;  2SDF A;  4RAU C;  3F2D A;  3VR3 A;  1HPC A;  4DR6 L;  1IBL Q;  4FF4 A;  1GUN A;  4A3J B;  5EPL A;  2IHE A;  1KQS A;  1A3V A;  4A3D B;  1I6H H;  2UUC L;  2JA7 H;  5FLX E;  1CZW A;  4RA8 A;  5BN5 A;  2R92 H;  4JVZ A;  1S4Z A;  1BKB A;  2F0G A;  3DXJ C;  4GN5 A;  4BWG B;  1Y1W H;  3GTQ H;  4POG A;  2R61 A;  1EL0 A;  4O42 A;  1UE7 A;  2RDH A;  4J8Q A;  3ER0 A;  2K28 A;  2EY5 A;  3P20 A;  3BDO A;  1FL0 A;  5FOB B;  4BY1 H;  1HZA A;  1D5M C;  1BXT A;  3FVQ A;  2B2W A;  1T9H A;  1LYL A;  2XRS D;  4N8X 1;  4ME5 A;  2CH4 W;  3HS0 C;  4A3B G;  1HNX L;  2L11 A;  4JI5 Q;  4HMI A;  4JG2 A;  2OF1 A;  3K8A A;  1UE6 A;  3BYY B;  2A6E C;  2A6E D;  1JMC A;  3DWA A;  3GTL B;  4FXD A;  2WB1 B;  4PMC A;  2KEE A;  1G8Z D;  1V43 A;  3M4Y A;  1HR0 L;  1B9M A;  4IJH A;  4OXP A;  1TWG B;  4XXE A;  3VYS A;  4KJO A;  3QJY A;  1IBL L;  3MXU A;  2FMC A;  5C5L A;  1YZ6 A;  2D62 A;  2OT2 A;  2QCP X;  2Z8L A;  3H0G H;  4GS3 A;  4UHV A;  3TN2 A;  3K5N A;  3E3X A;  1QOH A;  1F9R A;  4A3F H;  1X3P A;  1WVL A;  2UU9 Q;  4DF7 A;  2JJQ A;  4KY7 A;  3OYY A;  4L5T A;  5IT9 E;  3FPP A;  4JI1 Q;  1ENC A;  2VUM H;  2QDB A;  2A8V A;  2EJG C;  2XNA C;  2F0D A;  4BBS B;  4M1U B;  3OW2 A;  3S24 A;  4DAY A;  2I0Q A;  1SE3 A;  3HP3 A;  3CXC A;  1VQ8 A;  3T1Y Q;  3MXN B;  4IQZ A;  3CQZ H;  4KMU C;  2M2L A;  2WKC A;  4DNR B;  4JI5 L;  3NXW A;  1GOZ A;  1PFS A;  1PTO C;  5C4Z A;  5A2Q E;  4RCO A;  4L5R C;  3TP5 A;  4YY3 Q;  2HD3 A;  2F4V Q;  3M3Y H;  1MI2 A;  1G29 1;  1EOV A;  4WFN 3;  1KDB A;  3TBI B;  4CDC C;  1DOL A;  2KOL A;  5DLQ E;  1FJG L;  1WTW A;  4LJZ C;  1UAP A;  2EXD A;  1RTN A;  4IPD A;  2I07 B;  3KF6 B;  4IFD H;  4HJ7 A;  3PO3 B;  5IYC H;  4A3C G;  2MGS A;  1S3O A;  1ZYR C;  3BJU A;  1ZYR D;  3CC2 A;  2UU9 L;  1AE2 A;  1H9S B;  4H13 C;  1E0B A;  1JQY D;  4PZ8 A;  2K32 A;  1EUJ A;  5EBC A;  4JI1 L;  3QOL A;  1SFO H;  1M4V A;  4NDX A;  4TRD A;  4POF A;  1EOT A;  2SEB D;  5K5P A;  3URY A;  3T1Y L;  3RLF A;  1BO0 A;  2GVA A;  1LTI D;  2ENB A;  3PQI A;  3HKZ G;  4DK6 C;  3UDF A;  2PZU A;  5KRU A;  2IT1 A;  2F3V A;  4YY3 L;  1EQT A;  3K0X A;  2F4V L;  4BS9 A;  3I91 A;  5ELN A;  3PUY A;  1XXG A;  1QZG A;  1B3A A;  3DM1 A;  1JJ2 A;  3HOZ H;  1YHQ A;  5M3M G;  4L63 B;  4OEM B;  1PRT C;  1H9J A;  1PRT D;  5CV6 A;  1EWC A;  2VQF Q;  3NTI A;  4G4K A;  3GTM H;  1CHP D;  2HDL A;  2ZT9 C;  2L4N A;  1L1O A;  2LXK A;  4RHS A;  2PMZ B;  1L1O C;  2BOS A;  1LO5 D;  1NSN S;  4DV3 Q;  2B2T C;  5ELE A;  1PV4 A;  5BN4 A;  1BQQ T;  3TS2 A;  1GUT A;  1CM9 A;  2RDG A;  1WJJ A;  1STN A;  3VR2 A;  2O2L D;  4C2M B;  3ERO A;  3HOU H;  1E2V A;  2EVB A;  3MWY W;  4DK0 A;  4MN3 A;  4ALP A;  3S1N B;  4B08 A;  1PH3 A;  1VF7 A;  4LF9 Q;  3HOY B;  1PZK D;  3PUV A;  4BXX G;  4UY8 C;  1O7Y A;  5C3X A;  2V4D A;  1I4P A;  1ZXT A;  2GN5 A;  3H91 A;  1NNX A;  4LF8 Q;  1D5X C;  4R4T A;  3HOV G;  4JW0 A;  5IWA Q;  5IOC A;  2F0H A;  3KOJ A;  2EYL A;  5M3F H;  1PDQ A;  3M7N A;  3BVZ A;  4H7B A;  4LF7 Q;  2F0V A;  1QNK A;  1QZH A;  3K59 A;  5K36 H;  1WTR A;  2EY2 A;  1ROD A;  3K57 A;  2J7Z A;  3CW2 C;  5IGF A;  3D6W A;  1WTQ A;  4A3B B;  1I50 B;  4DV3 L;  1ESR A;  1ICW A;  3OIP A;  4CBV A;  3OTO Q;  2NN6 G;  1XMQ L;  4LF5 Q;  1EY9 A;  3MEF A;  4GKJ Q;  1OXV A;  2QDL A;  2BA1 A;  4NPS A;  1VMP A;  4IPH A;  1EIG A;  2QF7 A;  2NVQ B;  1Q81 C;  3CCE A;  4DR2 L;  1JT8 A;  2DJG C;  1B70 B;  1IBM Q;  2BCO A;  3U4Z A;  3HRZ C;  1PRT B;  3VA7 A;  4LF8 L;  1IKL A;  3L7Z C;  2F0Q A;  4ABN A;  1A62 A;  2YYZ A;  3AQQ A;  1CA6 A;  1X3E A;  1ZEQ X;  3DHQ A;  5IWA L;  2OQ0 A;  3CCR A;  3S1R H;  1L1O B;  3NEN A;  2VQE Q;  1EFI D;  3NE5 B;  4LF7 L;  4A3K G;  3R8B A;  1CI3 M;  4R8I A;  5M5W B;  3H3V C;  4X6A H;  5IYD H;  5KIX A;  3RZD B;  2RA4 A;  5AFW A;  3U50 C;  5I9O A;  1Z6H A;  4JPB W;  4HIO A;  4A3E H;  1GO3 E;  2F03 A;  1W2B A;  1VQD A;  4YIJ A;  2HHH L;  4KHP Q;  2F0P A;  5C44 G;  2H4O A;  1NR4 A;  1HTL D;  3NUC A;  4ZQ3 A;  1SNM A;  3DEO A;  3GO5 A;  1YBY A;  4LF5 L;  4QGU A;  5ISR A;  3BS1 A;  1K8A C;  4KKU A;  1TWH B;  1XPU A;  3T13 A;  3H3V I;  1KAA A;  2O5J C;  1PFB A;  1WOC A;  3G6E A;  3QOJ A;  1IBM L;  4NP5 A;  3W1B A;  1G51 A;  2HIX A;  4X64 Q;  1KC8 C;  2NTT A;  2CWA A;  4RGN A;  3WWV A;  1PMR A;  5JPM C;  5IYB H;  3J7Z C;  1QJO A;  4K6D A;  2KA7 A;  2VQE L;  2B2U A;  1YNX A;  1QVF A;  2B2U C;  5DNF A;  1PH2 A;  3R3O A;  5HGQ A;  4R4Q A;  3R93 A;  1NUC A;  1QE6 A;  3SXH A;  3PIP 3;  1S72 A;  4QIW E;  3NQI A;  2ZJP A;  5J1Z A;  1YHA A;  2VXW A;  4IOA A;  1F2Z A;  1X54 A;  1SSO A;  2R7D A;  3HKZ B;  3S2D H;  1SN8 A;  1R9T B;  3KUP A;  4K5X A;  1U4L A;  2QGQ A;  5J22 A;  1JWU D;  1BBW A;  1WCM G;  1YVC A;  3BU2 A;  2AUJ D;  1LTS D;  3CCL A;  1TWA B;  5M5X H;  2IJ0 A;  2XIW A;  4EQ5 A;  2WAQ E;  4DR3 Q;  4A93 G;  2AWN A;  1PFN A;  4ILW A;  1IXR A;  4EQN A;  4X64 L;  1TR5 A;  2NN6 I;  4PZ6 A;  3CCQ A;  1BCP F;  1D1I A;  3S14 B;  2A69 D;  1PH7 A;  1LAB A;  4MNO A;  1FNU A;  3Q8D A;  4V19 0;  2B3G A;  2LY7 A;  3S9W A;  4GNX A;  2K4K A;  4FF3 A;  5COR A;  3B6Y A;  1UE5 A;  3EIV A;  2MQH A;  1XNQ Q;  5IP9 H;  1Y1V G;  1CTM A;  1TVX A;  3SHL A;  5ELO A;  1Z47 A;  2GVB A;  2YU9 B;  3TRZ A;  1N36 Q;  2Y0S E;  4JI0 Q;  1YIT A;  4HIM A;  1SMX A;  3I4N G;  1SND A;  4O1N A;  4OEL B;  2E2H H;  1XJV A;  3HOV B;  3IAY A;  3CP0 A;  4J1M A;  2R7Z G;  3K5M A;  2B2V A;  4DR3 L;  1PLF A;  2K01 A;  4DAV A;  5D65 A;  1C9O A;  2Z4H A;  2JA5 H;  2ASB A;  1VQ7 A;  1SBB B;  2AHO B;  4B3T Q;  2JA7 G;  5A35 A;  3M4O H;  4IUU A;  2R92 G;  4O0A A;  1I3Q B;  1Y1W G;  5AJ3 Q;  3GTK H;  1YJN A;  1B1Z A;  5JOB A;  1I4G A;  4N9P A;  4DU9 A;  1ZKO A;  2OEO A;  3NEM A;  2LS0 1;  1K28 A;  1AZQ A;  2EYH A;  2KHS A;  2PI2 A;  1STH A;  4DPG A;  1XNQ L;  4LFB Q;  3L0O A;  5I9P A;  3F2U A;  3GDE A;  4BY1 G;  1I4X A;  1EEI D;  3OOC A;  1N36 L;  3E6Z X;  1B9N A;  1K9M C;  4JI0 L;  1WI5 A;  4OGQ C;  2BDN A;  3FPU B;  1HR0 W;  4LMQ D;  1Q12 A;  3E9I A;  1ICF B;  4A3K H;  1KDC A;  4XT1 B;  2QEJ C;  1HH2 P;  2E2I H;  2E2J B;  2WB1 E;  5C4X H;  5C0X I;  1WD0 A;  3S15 H;  4GLX A;  1HA6 A;  3D6C A;  3ND8 A;  1G6P A;  4KV6 A;  5D3D A;  4IFD J;  3GP7 A;  4RKL A;  4N9T A;  4GNX B;  4A3I H;  4B3T L;  1S5D D;  2EJF C;  4XQJ A;  2MO1 A;  3H0G G;  3J81 L;  5DM7 3;  2A19 A;  4A3F G;  1SDF A;  1LTR D;  3KYH C;  2KJX A;  5M9O A;  5C44 B;  5AJ3 L;  3NBH A;  1BBU A;  2G5D A;  1NJI C;  2TMP A;  3S16 H;  4G7Z C;  5COY A;  4OX9 Q;  1DON A;  3ND9 A;  2VUM G;  2PW7 A;  2ZTE A;  3PO2 H;  1OXT A;  4A76 A;  1XMO Q;  2SNS A;  5C4J H;  3HOW H;  1VQF A;  1V1O A;  1L2F A;  1E7Z A;  3R2T A;  4A3L H;  2A74 C;  1DXM A;  1JE5 A;  1QVC A;  3FRP B;  1PYB A;  1U4M A;  2DNE A;  1G2T A;  3A7L A;  1RCV D;  1VMC A;  2L15 A;  3A74 A;  1TS2 A;  2NBF A;  3CMA A;  1WYD A;  4BBR H;  4KHZ A;  1VQN A;  4QIW B;  4IAL A;  1Q82 C;  5JJZ A;  4K8J A;  1MSG A;  4HED A;  1VF5 C;  5GAE C;  3E0J A;  4IFD G;  2ZXR A;  1PZJ D;  4IPG A;  1AN8 A;  4LF6 Q;  5IYC G;  5JVG 3;  1BOS A;  3I72 A;  2JYO A;  4KLK A;  3JAM i;  1WTH A;  1VQ9 A;  3TP6 A;  2E74 C;  1ESF A;  3TZD A;  2UXB Q;  4OX9 L;  3AFQ A;  1YEZ A;  2Z6B A;  1VQE A;  4ZKC B;  4B3S L;  1XMO L;  2JXM B;  2WAQ B;  3I4M H;  2X6L A;  3I3C A;  4YCU A;  4KTA A;  2EPB A;  1N34 Q;  3GTO B;  2Q2T A;  3TME A;  5T1I A;  1PH9 A;  2PNR C;  3J80 i;  3HG9 A;  4GLV B;  3TSS A;  2K7V A;  3SK5 A;  1GUG A;  3FKI B;  5C6A A;  4PMW A;  2NVT H;  4A93 B;  3NTK A;  4QL5 A;  4JBJ A;  3J81 c;  2RBM A;  3NPP A;  1YJW A;  4JI2 L;  4Q5V A;  4YCW A;  3CCJ A;  3OMC A;  4PG3 A;  1X6O A;  1GXD C;  1P8L A;  3HOZ G;  2E75 C;  5T1G A;  3P1H A;  2WIN B;  4JBW A;  3L2P A;  5C3E B;  3EFX D;  1SE2 A;  5E4X A;  4X62 Q;  5CR3 A;  4LF6 L;  1E2Z A;  3C46 A;  5D14 A;  3EA6 A;  2L5T A;  3HZX A;  3V05 A;  4Q0F A;  4ZLT F;  2PMZ E;  2BE5 D;  5ELB A;  2F0E A;  3A8I E;  5LL6 X;  2IY5 B;  4HSP A;  2XWB B;  4NW2 A;  4IN3 A;  4B9X A;  1J8I A;  3I4N B;  4C3J B;  1L0W A;  2RF4 A;  4DV0 Q;  4OHJ A;  1N34 L;  3T56 B;  3HOU G;  4OIK A;  4CJ0 B;  3MAQ A;  2K5W A;  2R7Z B;  3EVQ A;  1JJC B;  1SAP A;  2UUB Q;  3CRK C;  3RNU A;  2L1B A;  3E0E A;  2CCZ A;  2EYJ A;  2B29 A;  2DY7 A;  3BDL A;  4DV6 Q;  4XDX A;  2Q2I A;  1U4P A;  1DGS A;  1I6H B;  1XTC D;  2A1A A;  2JA7 B;  3ULJ A;  5JEA H;  2R92 B;  2RHS B;  1XX8 A;  3DM3 A;  4B3R Q;  3GTQ B;  4RHR A;  1F9S A;  4N8F A;  5M3F G;  3FDT A;  2JQO A;  4H02 A;  3ULL A;  2B2W C;  4X62 L;  4ME3 A;  2PO4 A;  1YJ9 A;  1C48 A;  3K5L A;  4MZ9 A;  4P72 A;  4LK1 C;  5K36 G;  4BY7 H;  5E7N A;  5JJL A;  2Z9H A;  3J7A V;  4BY1 B;  2FIN B;  1JOQ A;  2HQE A;  4V0B A;  3JAM E;  2RQX A;  4DR5 Q;  4DV1 L;  3E9H A;  4TKO B;  1II3 A;  2IW3 A;  2ZJR A;  2N55 A;  5HUR A;  4DV0 L;  1SNP A;  3NK9 A;  4IFD I;  2EYO A;  2UUB L;  2OTJ A;  1V1P A;  1ILQ A;  1STA A;  3J80 E;  1VQK A;  2R7F A;  2Z0S A;  4DV6 L;  2XGT A;  1TS5 A;  1MBY A;  1Q90 A;  4OON A;  3I4L A;  3J7Y W;  3H0G B;  1UE1 A;  4A3F B;  2KHJ A;  2EOT A;  4B3R L;  1D8L A;  4F8M A;  3A0J A;  3LWU A;  1XTD A;  2C5C A;  2KBN A;  3UI2 A;  4NB3 A;  4BBS H;  5IYD G;  1HXY D;  4A3E G;  3ITP A;  2HUG A;  4R4I A;  2AQ1 B;  1V8Q A;  3CQZ B;  4DR5 L;  5EJW A;  2RSO A;  3Q22 A;  5KND A;  4IUN A;  4C3H B;  1VQL A;  4A4I A;  1B2T A;  4J6H A;  2KCC A;  4XQQ A;  3GTJ H;  5JPN C;  2F0K A;  2PYK A;  4I7A A;  2WII B;  3A7A B;  4L5Q A;  5E3F A;  3SEB A;  2OCE A;  1HHV A;  2B63 G;  4DK3 C;  1A2T A;  3I4O A;  2YTX A;  2HQL A;  1IYJ B;  1D7Q A;  1EEF D;  1F77 A;  2KUM A;  3HFZ B;  1JB7 A;  2K75 A;  1U4R A;  4HSV A;  4KN4 C;  5IYB G;  4LFC Q;  2I5L X;  1PH1 A;  4GOP A;  2CWP A;  2K52 A;  3FMC A;  5I2Y A;  1VQG A;  5IOD A;  4HMJ A;  4QB4 A;  2K5Q A;  2PNH A;  1SFO B;  1CHQ D;  5KYL A;  1X32 A;  1X3F A;  2NWG A;  1S5F D;  1RF2 D;  2XSC A;  2DGY A;  3HKZ E;  3UDI A;  1WTV A;  3FHW A;  3NWS A;  4JI3 Q;  2JA6 H;  1QUQ A;  5HY6 A;  3BZK A;  4PNY A;  1VQM A;  4JC0 A;  3KBX A;  4IUV A;  1B44 D;  1E2W A;  3Q6S A;  2L0C A;  4PMB A;  1HNW Q;  2ZXP A;  4DAY B;  4KD3 A;  1K0S A;  2RCN A;  4YWL A;  3TDQ A;  2HCC A;  4DR4 Q;  2EDG A;  3D3R A;  1XYI A;  4K5V A;  1K83 H;  3NSW A;  3GTM B;  3GTG B;  3K80 C;  3KLS X;  5FO7 B;  4LFC L;  1R4P B;  3SE0 A;  1RL2 A;  3PF5 A;  1PTO H;  1A63 A;  1X3G A;  1SYD A;  1K73 C;  2K14 A;  4JK1 C;  2QIL A;  4FF1 A;  5CV9 A;  1X9N A;  2VS1 A;  3M4Q A;  5KGU A;  2K03 A;  3OHX C;  2EIF A;  2R93 H;  1IBK Q;  5IP9 G;  3HOU B;  5CGK A;  5FO9 B;  2F4I A;  3NEL A;  4RMF A;  1O78 A;  2OQK A;  4KK7 A;  4RG1 A;  1RJT A;  5KNC A;  2K33 A;  1WTO A;  2HDM A;  1DD2 A;  1O7L A;  4JI3 L;  1BCP C;  1BCP D;  1H9K A;  1TWF H;  3CC7 A;  2M9V A;  3S1M H;  3LNN A;  3QWN A;  1VQA A;  4K14 A;  4HJA A;  1K3R A;  2J0T D;  5CV7 A;  4A3G H;  2VQF L;  1KNA A;  5M5Y H;  2Q8T A;  3U9O A;  2N8N A;  1TII D;  4HCS A;  5CYU A;  4LFA Q;  2FFK B;  5DAU A;  3QB3 A;  5M3F B;  2NVX H;  4MHE A;  2EQS A;  4GOP B;  1KXL A;  1F9Q A;  1QB5 D;  2JA5 G;  4DR4 L;  4LWC A;  3S2H H;  4JI4 Q;  4OIJ A;  4LF9 L;  4JI8 Q;  1LTG D;  1EFW A;  3RD4 A;  1ENA A;  2AWO A;  2MJ8 A;  1B3Q A;  3PGZ A;  4R9W A;  3KLR A;  5IP7 H;  4LW1 A;  1SYF A;  4IUT A;  3NTH A;  3SK8 A;  3QG1 A;  1IBK L;  1DJR D;  2VNU D;  1SNQ A;  1H95 A;  4L8J A;  1NMG A;  5EBD A;  1O80 A;  3M9B A;  1V1Q A;  1Y8P B;  5CV4 A;  3SVM A;  1I5F A;  2K50 A;  1L0Y B;  4KY6 A;  3TP7 A;  4DNI A;  4IUP A;  3EBE A;  5E4W C;  1X65 A;  1IZ6 A;  2LFN A;  5C4X G;  3U4V A;  2PCF B;  2B8G A;  4C3I H;  3F2C A;  5NUC A;  4OWX B;  4LFA L;  3CCM A;  1V9P A;  2K6A A;  1LLR D;  1Q8K A;  1K8O A;  4C1N K;  2J4X A;  5LMU Q;  3AMU A;  1BDO A;  3OTO L;  4A3E B;  2PZT A;  4CDE C;  3I8Z A;  4QJF A;  1CQF A;  4A3I G;  4GKJ L;  1NCV A;  4JI4 L;  1SLJ A;  1EIY B;  3PIO A;  1VQO A;  2MNA A;  3K7A H;  1EY7 A;  4JI8 L;  3DEP A;  3BZD B;  5GAH C;  1BCP B;  3OWF A;  2RDF A;  4M8A A;  3UE0 A;  1TWH H;  1ASY A;  3PO2 G;  1KDA A;  1IKM A;  2B63 H;  4GZY C;  1EQR A;  4DA2 A;  3STB C;  3K58 A;  3STB D;  3HGB A;  5LHY 1;  3HOW G;  4WJ3 M;  4XYO A;  5KEE A;  3GTP H;  1N32 Q;  1GHK A;  1BBX C;  3HKS A;  4A3L G;  4UDU C;  4IPC A;  5LL6 S;  2KED A;  2L9H A;  3KF8 A;  4NKL A;  1LAC A;  3CAM A;  1JE4 A;  3CKI B;  3F1Z A;  4GN4 B;  2VY3 A;  1SEB D;  2MP1 A;  4K0K Q;  2B2Y A;  3H6M A;  2JEA I;  1AFP A;  4BBR G;  5HGT A;  3V2T A;  3MFG A;  4KHP L;  1GUS A;  1K8M A;  5LMU L;  4CDD C;  3S17 H;  2EE1 A;  3X3M A;  1SE8 A;  2PI2 E;  1IW7 D;  1M8A A;  1KD1 C;  2KQ3 A;  2NTS A;  3J7A 5;  4DV7 Q;  1CKN A;  4DR1 Q;  1TY2 A;  3S2D B;  2OXP A;  3LGJ A;  5JVH 3;  5M3M B;  2IL8 A;  3BG3 A;  3KDF A;  2ATW A;  3I4M G;  1B53 A;  4WOR A;  4Y7N H;  2D9U A;  4JYA Q;  3CRL C;  1N32 L;  3CF5 A;  5M5X B;  1WFQ A;  2JE6 I;  2A69 C;  1CFM A;  1EY6 A;  2LMC B;  1FR3 A;  2WV6 D;  4K6L A;  1NR2 A;  4EQP A;  1IL2 A;  1Q7Y C;  4RWS C;  4QCL A;  5JEA J;  1O7Z A;  4DV4 Q;  1AEX A;  5H1S E;  1TS3 A;  2PZW A;  4X3T A;  4K0K L;  4GNX C;  2O5I C;  3I55 A;  1YHB A;  3NP8 A;  2ZTD A;  3RZO H;  1UUP A;  3RR5 A;  4CKE A;  2KEC A;  1NAP A;  3FEW X;  3S1Q H;  3E5S A;  3KFU A;  4X65 Q;  2F0W A;  2RVL A;  4DV5 Q;  1N8R C;  4YCV A;  2A68 C;  2A68 D;  4FXK C;  1PH8 A;  4DV7 L;  4Z9C B;  4DR1 L;  5ELF A;  1SJE D;  2EYF A;  4JOI A;  4L5S A;  4X3K A;  1GD7 A;  2SNM A;  3GD7 A;  3RUZ A;  1BNZ A;  1QG7 A;  3K5O A;  2A73 B;  1SXT A;  1HTP A;  3BYT B;  4O2D A;  2JA8 H;  2B2V C;  3KF8 B;  2E2D C;  3J81 j;  2E2H B;  2C35 B;  3HOX H;  1A0I A;  1CSP A;  1EY4 A;  4JYA L;  2H5X A;  3UDG A;  1X56 A;  1A2U A;  3G4S A;  1C4Q A;  4DKA C;  2XN9 C;  2PQA A;  3PUZ A;  1EZ8 A;  1N9W A;  1VDZ A;  4A3D G;  2A6H C;  4DV4 L;  2A6H D;  4CGY B;  2KCM A;  1N33 Q;  1J5E Q;  1LT3 D;  1Z9F A;  5JEA G;  4A75 A; 
#chains in the Genus database with same CATH homology
 4DAM A;  1QVG A;  1SFO H;  2Q2H A;  4OO1 G;  2VZA A;  1VQ5 A;  2PMZ E;  4POF A;  2CKZ B;  1E1T A;  2E5L Q;  3T1Y L;  4DV5 L;  2IY5 B;  3JC6 6;  1HJP A;  2CQO A;  3RLF A;  2Q2U A;  2GVA A;  1I94 Q;  4BY7 G;  3HKZ G;  4DK6 C;  4NXN Q;  1VQC A;  3UDF A;  2IX1 A;  1L0W A;  2RF4 A;  1VCI A;  2IT1 A;  3RLO A;  4DV0 Q;  1N34 L;  3AEV A;  4YY3 L;  3K0X A;  2F4V L;  3HOU G;  1MJE A;  5ELN A;  4IOC A;  1OXX K;  1MJC A;  4A3B H;  3PUY A;  1JJC B;  2UUB Q;  4A3C H;  3RNU A;  3E0E A;  1QZG A;  2E2J H;  1JJ2 A;  3HOZ H;  4HJ8 A;  2CCZ A;  1E24 A;  1YHQ A;  4B3M Q;  2B29 A;  5M3M G;  4DV6 Q;  1HZB A;  2Q2I A;  3RN5 A;  1BVS A;  2K5N A;  1DGS A;  2A1A A;  4AH6 A;  3ULJ A;  3I7F A;  4LUV A;  2RHS B;  4TQU S;  3DM3 A;  2VQF Q;  3GTM H;  4B3R Q;  3AYH B;  2FXQ A;  3I56 A;  5M3F G;  1L1O A;  2JQO A;  2LXK A;  4H02 A;  2QEX A;  3ULL A;  1L1O C;  4X62 L;  4ME3 A;  4DUY Q;  4DV3 Q;  1Y14 B;  1YJ9 A;  1J5E L;  1N33 L;  4MZ9 A;  1PV4 A;  4LFB L;  4P72 A;  5K36 G;  4OWT B;  1S40 A;  4FDB A;  3TS2 A;  4BY7 H;  5E7N A;  5JJL A;  5LMN Q;  1R9T H;  5C0X G;  5LMN W;  1WJJ A;  4MTN A;  3ULP A;  1NE3 A;  2K5H A;  3G71 A;  4DR5 Q;  3HOU H;  1M1K C;  4DV1 L;  1J6Q A;  3E9H A;  3PCO B;  5FLM G;  4ALP A;  1TWA H;  1VQI A;  1PH3 A;  4LF9 Q;  4JCV E;  3PUV A;  4BBS G;  4BXX G;  1I94 L;  4UY8 C;  4P73 A;  4YHH Q;  4NXN L;  2ZJR A;  4TVA B;  5GAD C;  3TS0 A;  4DV0 L;  2GN5 A;  5M3M H;  3CME A;  2JEB I;  4IFD I;  2WAQ G;  4LF8 Q;  4JBK A;  3H3V H;  2UUB L;  4R4T A;  2OTJ A;  3HOV G;  2PQA B;  3F8T A;  5IWA Q;  4BA1 I;  2UUA Q;  3S14 H;  1VQK A;  2R7F A;  2Z0S A;  3KOJ A;  4P75 A;  3SGI A;  3DLL A;  4WJ4 A;  5M3F H;  3PUW A;  4DV6 L;  2XGT A;  3M7N A;  3FKI G;  4LF7 Q;  4NXM Q;  2CFM A;  1MKH A;  4OON A;  5FLX c;  1QZH A;  4XIG S;  4LF6 L;  1UE1 A;  2KHJ A;  1SRU A;  1PH5 A;  4YWK A;  4B3R L;  1OXS C;  1D8L A;  1LTL A;  3CW2 C;  1PH4 A;  3A0J A;  2RHQ B;  1XTD A;  3PSI A;  4DUY L;  4DV3 L;  1E22 A;  2KBN A;  4NB3 A;  4BBS H;  3VDY A;  5C3E G;  4AYB G;  5IYD G;  2YU9 H;  4BXX H;  3K81 C;  4A3E G;  3OTO Q;  2NN6 G;  4DUZ Q;  1XMQ L;  3MEF A;  1VS0 A;  5LMN L;  3FP9 A;  4LF5 Q;  4GKJ Q;  4QQB X;  4R4I A;  2Y0S G;  1UWV A;  3J81 i;  1OXV A;  3BZC A;  4JOI C;  3KJP A;  4DR5 L;  2MO0 A;  2BA1 A;  4NPS A;  1PA6 A;  4IPH A;  1MIU A;  1Q81 C;  3CCE A;  4DR2 L;  1JT8 A;  1B8A A;  4YHH L;  4A4I A;  1VQL A;  2I5M X;  4A3M G;  3HOV H;  1B70 B;  1KRT A;  1IBM Q;  4UP7 A;  3U4Z A;  2XTI A;  3JAM c;  3GTJ H;  1KIX A;  3UE1 A;  2UXD Q;  2DUD A;  3T1H Q;  4LF8 L;  2V1C C;  3L7Z C;  3W1G A;  1A62 A;  2YYZ A;  3AQQ A;  4A3J G;  4OO1 I;  1X3E A;  4L5Q A;  5IWA L;  3CCR A;  2OQ0 A;  2YTV A;  3NBH B;  3S1R H;  1XPR A;  2JA6 G;  2KEN A;  2OCE A;  5GAG C;  1L1O B;  3NEN A;  2B63 G;  2VQE Q;  4DK3 C;  1AE3 A;  3I4O A;  4Y52 H;  2YTX A;  4LF7 L;  1I3Q H;  2HQL A;  1IYJ B;  4A3K G;  4NXM L;  1D7Q A;  1GM5 A;  1P16 A;  4X6A H;  5C3E H;  1CKN B;  5IYD H;  3CPF A;  1CUK A;  3HFZ B;  3U50 C;  2K75 A;  4HIO A;  4A3E H;  1JB7 A;  2F52 A;  1GO3 E;  3J80 c;  5IYB G;  4X65 L;  4LFC Q;  1W2B A;  2I5L X;  1PH1 A;  4GOP A;  1VQD A;  2CWP A;  2K52 A;  2UXB L;  2HHH L;  4KHP Q;  5IT9 c;  1VQG A;  5C44 G;  2PNH A;  3KDF B;  3GO5 A;  1YBY A;  4A3M H;  1X3F A;  4DUZ L;  4LF5 L;  2NVY H;  3TEH B;  4QGU A;  2WFW A;  4LF4 Q;  1K8A C;  1SR3 A;  1KHI A;  2IHF A;  2DGY A;  1XPU A;  4A75 A;  3HKZ E;  3IRB A;  4JI7 Q;  3H3V I;  2BH8 A;  1KL9 A;  4C3J H;  3UDI A;  2YTY A;  1WOC A;  3FHW A;  5BR8 Q;  4A3J H;  3EN2 A;  3G6E A;  4JI3 Q;  1IBM L;  3ICE A;  2WB1 G;  2JA6 H;  4A3D H;  1PVO A;  1QUQ A;  2Z6K A;  5HY6 A;  3W1B A;  3BZK A;  1VQM A;  1G51 A;  4JC0 A;  3F2B A;  2R93 G;  2UXD L;  2HIX A;  2IX0 A;  3ERS X;  3T1H L;  2UXC Q;  4X64 Q;  1KC8 C;  3U58 A;  2CWA A;  1HNW Q;  4EX5 A;  3WWV A;  4DAY B;  3M85 A;  4R4C A;  2D0P A;  3TQY A;  4APV A;  5IYB H;  2RCN A;  3J7Z C;  3AFP A;  4YWL A;  2VQE L;  3CC4 A;  1YNX A;  2ZJQ A;  1QVF A;  5C44 H;  1PH2 A;  4DR4 Q;  5HGQ A;  3RLN A;  2BH2 A;  4A3G G;  1KAW A;  4R4Q A;  1K83 H;  1PHJ A;  1GKH A;  4GLA C;  2R6G A;  3K7U C;  3K80 C;  3KF6 A;  4LFC L;  2WP8 J;  4R4O A;  1S72 A;  2VL6 A;  4QIW E;  2ZJP A;  2E5L L;  3I2Z A;  1YHA A;  3PF5 A;  1RL2 A;  1U5K A;  2ZTC A;  4IOA A;  1SRO A;  1X3G A;  1X54 A;  4AQY Q;  2ID0 A;  2QA4 A;  1K73 C;  1A63 A;  1XNR Q;  5IE8 A;  2R7D A;  2K14 A;  3S2D H;  1X9N A;  1SN8 A;  2HT1 A;  2VS1 A;  4P74 A;  3GTL H;  1YI2 A;  3M4Q A;  2YV5 A;  2QGQ A;  1CKM A;  4LF4 L;  1BBW A;  1UEB A;  1WCM G;  2EIF A;  1IBK Q;  5IP9 G;  4B3S Q;  2R93 H;  1YVC A;  3CD6 A;  3BU2 A;  1TWG H;  4JI7 L;  3CCL A;  3NEL A;  4RMF A;  2OQK A;  4RG1 A;  1VQB A;  3A5Z B;  4JI3 L;  5BR8 L;  4JI6 Q;  5M5X H;  4B3M L;  4AIM A;  4EQ5 A;  4PZ7 A;  5IP7 G;  3G48 A;  2N3S A;  2WAQ E;  4DR3 Q;  1TWF H;  3CC7 A;  2N78 A;  3S1M H;  4A93 G;  1VQA A;  5EAY A;  2AWN A;  2UXC L;  1IXR A;  4HJ5 A;  4HJA A;  1FJG Q;  1K3R A;  4X64 L;  4A3G H;  2VQF L;  2NN6 I;  4PZ6 A;  5M5Y H;  3CCQ A;  4X66 Q;  4JI2 Q;  2F3I A;  1KRS A;  2N8N A;  4LFA Q;  3PO3 G;  3M4P A;  2NVX H;  5JJK A;  2EQS A;  4GOP B;  1PH7 A;  1KXL A;  4MNO A;  5FLM H;  2VW9 A;  2JA5 G;  4P71 A;  4KI0 A;  4DR4 L;  2LSS A;  4GN3 B;  3Q8D A;  4LWC A;  4OWW B;  2B3G A;  4HID A;  4YWM A;  4GNX A;  3S2H H;  2K4K A;  1LM0 A;  2D0O A;  3B6Y A;  5GRO A;  1UE5 A;  3EIV A;  4JI4 Q;  2MQH A;  1XNQ Q;  3H15 A;  1WCM H;  2NZO A;  5IP9 H;  1TXY A;  1Y1V G;  4AYB E;  4AQY L;  2AKW B;  4XTC S;  4LF9 L;  4JI8 Q;  5ELO A;  2OTL A;  1Z47 A;  1XNR L;  2GVB A;  1HNZ Q;  1EFW A;  3GTO H;  3TRZ A;  1N36 Q;  1HZ9 A;  2Y0S E;  1Q46 A;  2AWO A;  4JI0 Q;  3PGZ A;  3CCU A;  1YIT A;  5IP7 H;  1A8V A;  4LW1 A;  4HIM A;  3FKI H;  1Q86 C;  1IBK L;  1SMX A;  3I4N G;  1XPO A;  4C3H H;  4A93 H;  2VNU D;  2OWO A;  2E2H H;  1VQJ A;  1XJV A;  1H95 A;  4DR6 Q;  1TWC H;  1NMG A;  5FJ8 G;  4JBM A;  3M9B A;  1V1Q A;  4JI6 L;  3CP0 A;  2UUA L;  1I5F A;  2R7Z G;  2UUC Q;  2K50 A;  3PO3 H;  1HZC A;  1VQH A;  1FVI A;  2BA0 A;  4DR3 L;  4DNI A;  1EYG A;  2HIV A;  3EBE A;  3TRE A;  1ASZ A;  1C9O A;  2LXJ A;  1EQQ A;  1X65 A;  2JA5 H;  1IZ6 A;  2ASB A;  1JJG A;  5GQO A;  5C4X G;  1E1O A;  3U4V A;  1O7I A;  4X66 L;  1VQ7 A;  4C3I H;  4LUZ A;  3F2C A;  1Q1E A;  2AHO B;  4B3T Q;  4OWX B;  2JA7 G;  4LFA L;  3M4O H;  3PV0 A;  3CCM A;  2R92 G;  1V9P A;  4GOP C;  4O0A A;  4DR7 Q;  1Q8K A;  4LUO A;  1Y1V H;  4QY7 A;  1NTG A;  2MFI A;  5AJ3 Q;  3RN2 A;  1Y1W G;  5LMU Q;  1YJN A;  3GTK H;  2N49 A;  4HJ9 A;  1C0A A;  3OTO L;  1EIF A;  4QJF A;  4A3I G;  2JA9 A;  3NEM A;  1HNX Q;  4GKJ L;  4JI4 L;  1SLJ A;  1EIY B;  2ES2 A;  3PIO A;  2PI2 A;  4DPG A;  1XNQ L;  1U0L A;  4LFB Q;  1VQO A;  2MNA A;  3L0O A;  3A5U A;  3I4N H;  3K7A H;  1AH9 A;  2AMC B;  3GDE A;  3D0F A;  4BY1 G;  2KCT A;  4JI8 L;  5GAH C;  1C7Y A;  1HNZ L;  3UDX A;  4UP9 A;  5FJ8 H;  1N36 L;  1K9M C;  3PF4 A;  4JI0 L;  1WI5 A;  3UE0 A;  2R7Z H;  1TWH H;  4DV1 Q;  1ASY A;  5IY0 A;  2Z6K C;  1HR0 Q;  3PO2 G;  2B63 H;  1HR0 W;  3HOY G;  4GKK Q;  1EQR A;  1Q12 A;  3E9I A;  3F2D A;  3STB C;  4A3K H;  3STB D;  2NZH A;  1B7Y B;  1HH2 P;  2E2I H;  4DR6 L;  2WB1 E;  5C4X H;  1IBL Q;  5C0X I;  3HOW G;  4WJ3 M;  1CKO A;  1EWI A;  1OTC A;  2IHE A;  1KQS A;  3GTP H;  3S15 H;  4GLX A;  1N32 Q;  3HKS A;  2KHI A;  1VQP A;  2UUC L;  4A3L G;  1I6H H;  2JA7 H;  1G6P A;  1NMF A;  4IPC A;  2R92 H;  3CPW A;  1BKB A;  4GN5 A;  1Y1W H;  3GTQ H;  4IFD J;  3CAM A;  4POG A;  4DV2 Q;  4JV5 Q;  3F1Z A;  4GN4 B;  2VY3 A;  1UE7 A;  4K0K Q;  3W5O A;  4GNX B;  4A3I H;  4B3T L;  3KJO A;  2JEA I;  3ER0 A;  4BBR G;  2MO1 A;  3H0G G;  2A19 A;  4A3F G;  3CCS A;  4KHP L;  1FL0 A;  4DR7 L;  3KYH C;  1NY4 A;  5AJ3 L;  3GTG H;  1BBU A;  5LMU L;  1HZA A;  3PIP A;  1NJI C;  4BY1 H;  3S17 H;  4C2M H;  3S16 H;  1T9H A;  1LYL A;  4OX9 Q;  1SE8 A;  2PI2 E;  1HNX L;  4A3B G;  3S1N H;  4IO9 A;  2VUM G;  1KD1 C;  2ZTE A;  4R1J A;  3PO2 H;  4JI5 Q;  3HOY H;  3J7A 5;  1OXT A;  4A76 A;  4JG2 A;  4DV7 Q;  1CKN A;  4DR1 Q;  1VQ4 A;  1XMO Q;  4HIK A;  4JI1 L;  1XMQ Q;  3ZJY C;  3K8A A;  1UE6 A;  5C4J H;  1JMC A;  1VQF A;  3HOW H;  3LGJ A;  1L2F A;  1E7Z A;  4A3L H;  2I5H A;  3KLW A;  1RIP A;  1V43 A;  1HR0 L;  3KDF A;  4UPA A;  2ATW A;  4GKK L;  4IJH A;  4OXP A;  1JE5 A;  1QVC A;  2JK8 A;  4DR2 Q;  1M90 C;  1Q1B A;  5J3B A;  3I4M G;  1PYB A;  4Y7N H;  4J15 A;  4LNQ A;  4JYA Q;  1IBL L;  4BA2 I;  1N32 L;  1HNW L;  2L15 A;  3A74 A;  3CF5 A;  1WFQ A;  2JE6 I;  3D31 A;  3CMA A;  1WYD A;  1YZ6 A;  4BBR H;  4KHZ A;  2D62 A;  2JA8 G;  3H0G H;  4GS3 A;  4A3F H;  1VQN A;  1IL2 A;  1Q82 C;  1Q7Y C;  3HOX G;  2UU9 Q;  1NBW A;  1K0R A;  3CCV A;  5JEA J;  4DV2 L;  2JJQ A;  5H1S E;  5GAE C;  2ZM6 Q;  1CSQ A;  4DV4 Q;  4JV5 L;  1GVP A;  3OYY A;  4IFD G;  4K0K L;  4GNX C;  4L5T A;  1I50 H;  1YHB A;  4IPG A;  5IYC G;  2ZTD A;  4JI1 Q;  3I55 A;  4LF6 Q;  2A8V A;  2VUM H;  3RZO H;  3RR5 A;  1OXU A;  4KLK A;  3JAM i;  3S1Q H;  3OW2 A;  2K5V A;  2E8G A;  3S24 A;  1VQ9 A;  2I0Q A;  3KFU A;  4X65 Q;  3CXC A;  5JJI A;  1PYS B;  1VQ8 A;  3T1Y Q;  4DV5 Q;  3MXN B;  1FGU A;  1N8R C;  3CQZ H;  2HHH Q;  4OX9 L;  1QUQ B;  2UXB Q;  1LUZ A;  1YEZ A;  3AFQ A;  4YCV A;  1VQE A;  4JI5 L;  2NVQ H;  1E3P A;  3PUX A;  1PH8 A;  4B3S L;  1PFS A;  4DV7 L;  4DR1 L;  1XMO L;  3I4M H;  1YIJ A;  1K8G A;  4UP8 A;  4YCU A;  4L5R C;  1N34 Q;  2Q2T A;  4YY3 Q;  1VQ6 A;  2F4V Q;  4JOI A;  4L5S A;  3M3Y H;  1GD7 A;  1PH6 A;  3GD7 A;  2ALY B;  1G29 1;  1PH9 A;  1W3S A;  1EOV A;  3J80 i;  4GLV B;  4O2D A;  2JA8 H;  3KF8 B;  4PMW A;  2NVT H;  3J81 j;  5DLQ E;  4QL5 A;  4IJL A;  4JBJ A;  3J81 c;  1FJG L;  2C35 B;  3HOX H;  1A0I A;  1CSP A;  4JYA L;  1YJW A;  4JI2 L;  2EXD A;  4IPD A;  2H5X A;  3UDG A;  1X56 A;  3KF6 B;  4YCW A;  4HJ7 A;  3G4S A;  3CCJ A;  5IYC H;  4A3C G;  4DKA C;  4PG3 A;  5M5W H;  1X6O A;  2PQA A;  3PUZ A;  3RZD H;  1S3O A;  1P8L A;  1N9W A;  3BJU A;  1X55 A;  3HOZ G;  3CC2 A;  2UU9 L;  4JBW A;  3L2P A;  4A3D G;  4DV4 L;  1AE2 A;  2ZM6 L;  4X62 Q;  2KCM A;  1N33 Q;  1J5E Q;  4PZ8 A;  1Z9F A;  5JEA G;  1EUJ A;  5C0X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...