2PQAA

Crystal structure of full-length human rpa 14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
128
Chain Sequence
RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the full-length human RPA14/32 complex gives insights into the mechanism of DNA binding and complex formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
total genus 29
structure length 128
sequence length 131
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pqaA00
2CFMA 4AH6A 5FLMG 1VQDA 1W2BA 1QVFA 4DNIA 1KAWA 1VQAA 4LF8L 4X65L 1Q1BA 3AEVA 4LUOA 4LFAL 3M7NA 1L1OB 1AE2A 2N49A 1VQBA 3NBHB 4PZ6A 5C0XJ 1OTCA 2VUMG 2NN6G 2NVTH 2CCZA 1IBMQ 1PH8A 3F2BA 4J15A 2IY5B 2ID0A 4QIWE 4LUVA 3PSIA 4NB3A 1X65A 2KCTA 3NENA 2RCNA 2HIVA 4JV5L 4A3GH 1Q1EA 1PYBA 3U4ZA 3I56A 2D62A 3M4OH 4NXML 2B29A 2D0OA 4IFDI 4AQYQ 1K3RA 2B3GA 4GOPC 1I5FA 5LMUL 4A3JH 1LTLA 1P16A 1XMOL 2UUCQ 4DV0L 2EXDA 3HOZH 4POFA 1VQCA 2JQOA 3A74A 3ZJYC 3L2PA 4X66L 3H0GG 4DV6L 4A3EG 2OWOA 2YTYA 5AJ3L 3OYYA 3AQQA 5IP7H 1Z9FA 2WAQG 4PZ8A 3CD6A 5M5XH 1EOVA 1GD7A 3I2ZA 3T1HQ 1SR3A 5BR8L 1YHQA 4LNQA 4A3DG 2AMCB 2PMZE 1DGSA 4IJLA 4DR6Q 4UP7A 4BBRG 4OO1G 2IT1A 3GO5A 4JBWA 4HIDA 4OXPA 4YY3Q 4XIGS 3E9HA 1Q7YC 1IBLQ 5C3EH 1G291 1VS0A 3CPFA 2ZJRA 1HZ9A 4AQYL 1Q86C 3HOUH 1VQGA 1J6QA 4BBSG 3A5ZB 4A3CH 1D7QA 2NN6I 1Y1VG 1K8AC 1GM5A 5IE8A 1AE3A 4R4IA 4NXNL 3U4VA 2OCEA 3H0GH 2N3SA 4A3EH 1XNRL 1S40A 1XPRA 4DUZL 1YBYA 1HNZQ 2UUBL 5GAHC 2HT1A 3EBEA 2OTLA 4B3RL 4A93G 3HOWH 1B7YB 4DV4L 4A3DH 3DLLA 4OX9Q 2A1AA 4JI0L 2B63H 2JA7H 4B3TL 3F8TA 5M5WH 3AYHB 3J81i 4C3JH 1YJNA 4DKAC 2AWOA 2JEAI 3IRBA 3F2CA 1EQQA 2VQFL 2VW9A 4A3JG 4HJAA 1I3QH 4LF4Q 4GLXA 5DLQE 3B6YA 5IYBH 1TWGH 1SFOH 2F4VL 4BY1G 4GS3A 4GKKL 3HOXH 2E8GA 1RL2A 3PUZA 5E7NA 2PQAB 5IYDG 5JJLA 4IOAA 4X62Q 2JEBI 2HQLA 4JBMA 2R6GA 2ALYB 1PH5A 4JCVE 1K0RA 2IX0A 1N36L 3I4MG 1A62A 2QGQA 2WB1E 3ULJA 4DV3L 1QZGA 1NJIC 4MZ9A 1A63A 2K14A 2Q2HA 5IY0A 5C3EG 3S1NH 3S16H 1BBUA 1VQEA 1SE8A 2K75A 1OXTA 2LSSA 3AFQA 3J81j 4DR4L 5IYCH 1N32L 4PMWA 2RHQB 3SGIA 3GTMH 3PO2H 4JOIC 1MIUA 3KJPA 4OO1I 3E9IA 4OONA 2MO0A 3ULLA 2UUBQ 1A0IA 4B3RQ 2IHFA 4GKKQ 3S2DH 4JI8Q 1I50H 3GDEA 3HOYH 1NMGA 3TRZA 1YNXA 1NBWA 2F3IA 4DV1Q 4UY8C 2FXQA 1YIJA 1X55A 4X62L 1X3FA 3RR5A 4A3CG 2Z6KA 3W1GA 3K81C 3I4NG 3J7ZC 2UXDL 4LF8Q 3S24A 4LFCQ 2JJQA 1NTGA 3VDYA 1PH2A 2UXBL 1TWAH 4DR4Q 4AYBE 1SRUA 3K80C 3CCMA 1X9NA 1VQHA 4UP8A 4DV6Q 3RN2A 2PNHA 5IYBG 1EQRA 1K9MC 1N34Q 1J5EL 1K8GA 2CWPA 4A3FG 3HOXG 4B3MQ 4JOIA 2NVYH 2BA0A 2R93G 1E1OA 2VY3A 1E22A 4R1JA 5C4JH 4QQBX 3CC7A 5LMNW 1EFWA 5IYDH 1BBWA 4JI4L 2E2HH 1Z47A 1EIFA 3A0JA 1VQMA 2BH2A 1LUZA 1VQ7A 2KHIA 4JYAL 2VQEL 2I5MX 4A4IA 3KOJA 2MNAA 1M90C 1MJEA 4JI3Q 4R4QA 5C0XG 3PF5A 1HZAA 3PGZA 1PH4A 3S1MH 1FVIA 2UXBQ 3J80i 4POGA 2DGYA 2PQAA 4NXNQ 5C4XH 3RLFA 4L5SA 5GROA 1XNQQ 1KC8C 3G71A 1QVGA 1V1QA 2R93H 2WP8J 1UE5A 2WFWA 4A3IG 3CAMA 2MQHA 5EAYA 2JA6G 4DR5L 4DV1L 1HR0W 3PO3H 1Q81C 4R4OA 4JI4Q 3LGJA 4YY3L 3Q8DA 5J3BA 2YTXA 3I4NH 3OW2A 5JEAJ 2NVXH 4A75A 4DR3Q 4LFBQ 2V1CC 4IO9A 3HOUG 4A3LH 2VS1A 1LM0A 5AJ3Q 1HNXL 1JMCA 2GN5A 3CC2A 3H3VH 4O0AA 3UE1A 3CCUA 4GNXA 1XNRQ 5GAEC 4L5TA 5M3MH 1XPUA 4LF5L 1XJVA 2HHHL 3S1QH 1GO3E 1NY4A 4BBRH 1WFQA 4LF6Q 2I0QA 1HJPA 4B3TQ 4YWMA 1PFSA 2ZM6Q 5JJKA 2ES2A 3M9BA 3HKSA 1VQ4A 2JA8H 1I6HH 3HKZE 1KIXA 2JA9A 3RLNA 1JJ2A 4DPGA 4A3KH 4O2DA 4X64L 3CMEA 1HR0L 5C44H 3TS2A 3TEHB 4RG1A 4DUZQ 5FJ8G 3KYHC 4GN5A 1IBML 4RMFA 1WI5A 1WJJA 3I7FA 1CSQA 2Y0SE 1IL2A 4KHZA 3M4PA 2E2JH 3KLWA 4DK3C 5LMNQ 4LF5Q 1YEZA 4A3GG 4HJ7A 4LUZA 1KL9A 2JA8G 4YWKA 1B70B 1PA6A 2CWAA 1X56A 3FP9A 3K0XA 3ULPA 1IBKL 4JI2L 3H3VI 1PV4A 2NZOA 2UXDQ 5H1SE 3H15A 1O7IA 2ZJPA 1HR0Q 4LFCL 1CKMA 4PZ7A 3FKIG 1QUQA 2JK8A 4WJ3M 3CCRA 4P74A 3PO3G 2NZHA 1FL0A 4IPDA 2HHHQ 1WOCA 3GTQH 4A3BH 4YWLA 1CUKA 3ERSX 1TWFH 2UXCL 5GADC 1JJCB 4B3ML 2Q2UA 4JI5Q 1IZ6A 1EWIA 3PF4A 3HOYG 4LF9Q 4DR6L 5IP9G 2F4VQ 4R4CA 3PV0A 2LXKA 3UE0A 2ZTDA 1JE5A 3OTOL 4DR2L 1VQOA 1TWCH 2VNUD 1SN8A 1BVSA 4JI6L 4X64Q 1E7ZA 4JYAQ 3PO2G 2IHEA 4BY7H 1VQFA 3FHWA 4BXXG 1T9HA 3PUWA 1Y14B 1VQKA 5IP7G 4BBSH 2BH8A 2YTVA 5FLXc 4A3MH 1S72A 1PH9A 4JI7Q 1CKNB 3M4QA 2UU9L 4GLVB 1Q82C 1GKHA 3F1ZA 3HOVH 1ASYA 3S1RH 3K7UC 1X54A 2R92H 5K36G 2ASBA 2R7ZG 1L1OA 2MFIA 3K8AA 4JI5L 4AIMA 3CCJA 1YITA 2E5LL 4LF7Q 3G48A 1HZBA 1TWHH 2EIFA 2LXJA 4EX5A 5GAGC 1XMQL 1Q8KA 2CQOA 5IWAL 3OTOQ 1S3OA 1U0LA 3BJUA 2RF4A 2F52A 4DR2Q 4QJFA 3S17H 3STBC 1N33L 3CCVA 4DR3L 1L2FA 1LYLA 2WAQE 1YHAA 1XTDA 3JC66 4GLAC 4A3MG 2VUMH 1E1TA 4HJ5A 3HOWG 2I5LX 1A8VA 1QUQB 3NEMA 2BA1A 3GTKH 1P8LA 2UXCQ 3BZCA 1L1OC 2VZAA 1M1KC 1Y1WG 2R92G 3KF6B 2A19A 2GVBA 2C35B 2K50A 4DV5Q 1ASZA 2JA6H 1C7YA 5IP9H 1VQJA 4JI3L 2D0PA 1Q12A 1N9WA 2ATWA 3D0FA 3U50C 2EQSA 3TS0A 4MTNA 4TQUS 4LFBL 3E0EA 2K5VA 3FKIH 2Y0SG 1B8AA 5ELOA 4BY7G 2RHSB 4BXXH 4A76A 1EYGA 4P72A 4KLKA 1N33Q 1OXXK 1VQLA 4A3BG 2JA5G 1I94Q 5IYCG 3RZDH 4IFDJ 3RNUA 3RZOH 1SLJA 1MJCA 3BU2A 4JI8L 3STBD 4LF6L 2OQKA 1KRTA 4IPHA 4QY7A 2JE6I 4B3SQ 1CSPA 1X3EA 4IPGA 1OXUA 2R7ZH 1BKBA 1YJWA 3I4MH 4KHPQ 1SROA 3I4OA 4JG2A 2UUAQ 3CCLA 3ER0A 4JI1L 5M3FG 3M3YH 4K0KQ 2ZTEA 3HOZG 1XMOQ 2UUCL 4GOPB 2I5HA 4DV7Q 2OQ0A 3ICEA 4GNXC 2Q2TA 4YCVA 4JC0A 5C44G 5HY6A 1UE7A 3EN2A 3GTOH 5GQOA 1PH1A 1UWVA 1WCMH 4LW1A 4XTCS 4QL5A 4DAMA 3J80c 4DR7L 1YVCA 1R9TH 3CCSA 2QA4A 4DV4Q 1CKOA 5M5YH 3TREA 4YCUA 4A3FH 1IXRA 1HNWQ 2R7DA 3M85A 3PUVA 4C3IH 2B63G 4R4TA 1FJGL 4JI2Q 3KF8B 1IBKQ 2KCMA 1FGUA 2QEXA 3S14H 1H95A 1KRSA 5FJ8H 3W1BA 4X65Q 3G6EA 4JI6Q 4OWWB 4LFAQ 3CCEA 4BA1I 3BZKA 4A93H 3EIVA 4IJHA 3JAMi 2JA5H 5LMNL 1XNQL 3CC4A 3GTPH 1E24A 1QZHA 5JJIA 1KXLA 2JA7G 4A3IH 5ELNA 4JI0Q 2CKZB 4B3SL 1IYJB 3CPWA 3CCQA 1V43A 4GN4B 1VQ5A 2UUAL 2E5LQ 4K0KL 1TXYA 4AYBG 4P73A 1GVPA 3NELA 1VQIA 1VQ8A 4ME3A 3KJOA 2YV5A 1HNXQ 2KENA 4LF4L 4GKJL 5C4XG 4YCWA 3UDXA 2WB1G 3T1YQ 1K73C 4BA2I 4JBKA 3J81c 1VQ9A 4ALPA 1VQPA 4DR5Q 4UPAA 4OWTB 3DM3A 2PI2E 4LF9L 2ZM6L 1MKHA 1V9PA 3W5OA 1XMQQ 4GN3B 2KHJA 3MXNB 1W3SA 2PI2A 2IX1A 2E2IH 4DAYB 4DV5L 3S15H 4HIKA 1NMFA 1JB7A 3S2HH 4X6AH 4DV0Q 4A3KG 4DK6C 3L7ZC 3CXCA 4P71A 1G51A 1N32Q 3I55A 5C0XI 2VL6A 5HGQA 4GKJQ 1PH3A 1QVCA 3HOVG 1Y1VH 1OXVA 3JAMc 3F2DA 3HKZG 4JV5Q 1JT8A 4APVA 1HZCA 1WYDA 4JBJA 3T1HL 1HNZL 4HIMA 2AWNA 2AHOB 1PH7A 1AH9A 4DUYQ 3PUYA 3PUXA 1L0WA 4YHHL 4DR1Q 5IT9c 5IWAQ 2KBNA 4GOPA 5LMUQ 2ZJQA 3CP0A 2L15A 3CW2C 2OTJA 4HJ9A 2VQEQ 1IBLL 4TVAB 2XGTA 5FLMH 3PCOB 4HIOA 4X66Q 2GVAA 3J7A5 2VQFQ 2K52A 3MEFA 4DV2L 4DV7L 3G4SA 1I94L 4QGUA 1PVOA 1KHIA 3T1YL 3D31A 1KD1C 1YHBA 1N34L 1J5EQ 1Y1WH 3CQZH 4Y52H 2Z6KC 1X6OA 2K5HA 3L0OA 5BR8Q 1X3GA 4OX9L 3KDFA 4BY1H 4FDBA 2K5NA 3A5UA 4DR7Q 2N78A 3AFPA 4DUYL 3CMAA 3PIOA 4KHPL 3WWVA 1HNWL 3PIPA 2YYZA 4MNOA 1G6PA 1PH6A 2H5XA 3CF5A 3U58A 1VCIA 2MO1A 1YZ6A 2XTIA 2A8VA 1UEBA 3K7AH 4DV3Q 4NPSA 3TQYA 1UE6A 4OWXB 3GTGH 1HH2P 3KDFB 2R7FA 4JI7L 4KI0A 4L5QA 2Q2IA 3UDIA 3UDGA 5M3MG 1VQNA 4GNXB 1YJ9A 1WCMG 3UDFA 4HJ8A 3RN5A 3GTLH 5M3FH 4YHHQ 4DR1L 4JI1Q 1KQSA 3HFZB 4LF7L 4C3HH 4IFDG 3GTJH 3RLOA 1PHJA 4NXMQ 1FJGQ 1C0AA 4PG3A 3KFUA 1SMXA 1N36Q 1D8LA 1C9OA 1E3PA 1OXSC 2ZTCA 4Y7NH 4A3LG 1JJGA 1XPOA 1N8RC 2K4KA 2Z0SA 1UE1A 3KF6A 5JEAG 4DV2Q 4IPCA 4P75A 1VQ6A 4WJ4A 1YI2A 2YU9H 2N8NA 4C2MH 2AKWB 2HIXA 2UU9Q 1RIPA 4LWCA 1EIYB 1U5KA 4EQ5A 2NVQH 1CKNA 4IOCA 4UP9A 1EUJA 1K83H 3GD7A 1NE3A 4L5RC 1Q46A 1PYSB 4H02A 2DUDA
chains in the Genus database with same CATH superfamily
1DJRD 1VQAA 2D5DA 5CV4A 4B08A 3AEVA 1SJED 3QOLA 3NBHB 5C0XJ 1LTRD 4DAYA 2NN6G 2NVTH 2E76C 2A74C 1STAA 2WV6D 3F2BA 2IY5B 1JWUD 2ID0A 3TSSA 2RCFA 4O1NA 4LUVA 4NB3A 4H7BA 2F0SA 1PTOH 2HIVA 4JV5L 4A3GH 2JA8B 3BDCA 3KBGA 2R7ZB 1I6HB 3MVVA 3FEWX 2B29A 4IFDI 4AQYQ 4GOPC 1I5FA 3KF8A 1P16A 2IL8A 1W6KA 1VQCA 1H9SA 2HDLA 2JQOA 3ZJYC 1EL0A 2OWOA 2YTYA 2IX3A 3DMUA 5M5XH 4LNQA 1GD7A 3T1HQ 1JORA 1QILA 4IJLA 4UP7A 4OO1G 2WKCA 1H9KA 3E9HA 1IBLQ 3HEJA 1D7QA 1VQGA 4A3CH 4OEMB 1XWEA 1GM5A 1F9PA 3KK7A 3U4VA 4C56C 3H0GH 1S40A 2L1BA 5JOBA 2UUBL 4B3RL 3EBEA 2OTLA 2PCFB 4A93G 1B7YB 4A3DH 3DXJC 2A1AA 3F8TA 5LL6X 3GTPB 2JEAI 1U4RA 3VR6A 1SNCA 2VQFL 2VW9A 3BS1A 1I3QH 1SDFA 4LF4Q 1KABA 2QDLA 4X3KA 3W2DA 1A2TA 5IYBH 1TWGH 2F4VL 1F9QA 4GKKL 2E8GA 3I3CA 5D3DA 5IYDG 1O80A 2JEBI 5I6YA 1DOLA 2ALYB 1D5ZC 2H4OA 3E3XA 1NJIC 1EYAA 2Q2HA 4TSSA 1PYWD 4DR4L 2LSSA 1OXTA 3AFQA 3GTMH 4JOIC 1MIUA 3E9IA 1T5XD 4GKKQ 1RD9D 3S1QB 2FXQA 1EY4A 1V1PA 1X3FA 3RZDB 2Z6KA 2B2VC 4OGQC 1CA5A 1NR4A 5EPJA 3J7ZC 4LF8Q 1Y8PB 3BYYB 1C48A 3V05A 3NTIA 1NTGA 3FKIB 1SRUA 1STHA 1X9NA 3Q23A 3HRZC 5IYBG 2CWPA 1NNXA 2BA0A 1JT8A 1LTAD 3T51B 1KDAA 5T1GA 1PFBA 2BH2A 3BVGA 4JVZA 1Z6HA 1ET9A 1LUZA 2F0QA 2KHIA 3I70A 3KOJA 1MJEA 1O7LA 1G6ZA 5C0XG 4G7OC 5HGTA 3PGZA 2QILA 4NXNQ 1EY0A 1XNQQ 1STYA 1QVGA 3K58A 2A6HC 4NW2A 4JK1C 3IL8A 4OELB 1S5FD 5EAYA 1FD7D 1WTVA 4DV1L 1HR0W 1IKMA 3K5OA 1I4RA 1EY9A 2J0TD 5J3BA 2DJGC 2YTXA 2KQ3A 3MWYW 4L63B 4EQPA 3OW2A 2EYOA 2F0KA 4A75A 1HNXL 1LM0A 5C4XB 1PRTF 3HS0C 2IJ0A 3NQTA 1SNDA 5FO7B 4WJWA 3TP5A 4CJ2C 5AFWA 5M3MH 3DEOA 4CDFC 1XJVA 5FO8B 1GO3E 4BBRH 2WKDA 4LF6Q 3NK9A 4B3TQ 4U68A 1S4ZA 1PFSA 5JJKA 2F3WA 3HKZE 1QWYA 1LT5D 5TSSA 3RLNA 1KIXA 1ONLA 2BE5D 4G7ZC 4A3KH 2F0FA 1NAPA 4X64L 1B9NA 4RG1A 1QNKA 3MA2B 1SYEA 4DGZA 3J80E 2Y0SE 1IL2A 3ONAB 1EYCA 1O78A 3A7AB 1SYBA 4R9WA 1SE4A 1B70B 1CI3M 1EOTA 1OO9B 2CWAA 1QE6A 1IYVA 1SYFA 1IBKL 3AMUA 2XVSA 1LT4D 1EY7A 3TP8A 5H1SE 2ZJPA 1CKMA 5I9PA 3FKIG 4P74A 3PO3G 4IPDA 1CT1D 4K5VA 4A3BH 1TIID 4C1NK 1IZ6A 1EWIA 3HOYG 1FR3A 5J1ZA 4DAPA 1SN8A 2VNUD 5ELEA 3MXNA 5HURA 2CQAA 2RDHA 4ZUJA 3FHWA 4I7ZC 1T9HA 2QF7A 4ZLTF 1Y14B 1UEAB 1VQKA 3HOUB 4A3MH 4DK1A 1S72A 3J7YW 2UU9L 4GLVB 1Q82C 3S1RH 1X54A 2X6LA 3OIQA 2ZT9C 1L1OA 3LX0A 1YITA 4C3HG 2E5LL 3TZUA 4LF7Q 1HZBA 1TWHH 2LXJA 3G48A 5GAGC 4ZCKA 4G4KA 1XMQL 2RSNA 1U0LA 2F52A 2HCCA 3L9AX 3QWNA 1YHAA 1XTDA 2F3VA 1AEXA 3HOWG 2KUMA 3NEMA 1P8LA 5CR3A 1PTOC 1Y1WG 3TP7A 2C35B 2K50A 4DV5Q 1ASZA 1C7YA 1QJOA 4JI3L 4DF7A 1N9WA 3D0FA 4KD4A 1QCBD 4TQUS 2HDMA 5IOCA 3E0EA 2A6ED 2Q8RE 2RHSB 3FVQA 2ICEC 4RHRA 1VQLA 2F0EA 1I94Q 1S5DD 3S15B 4K6LA 2LFNA 4LF6L 2OQKA 1KRTA 4ID6A 2JE6I 1YJWA 2F0NA 3I4OA 4JI1L 2RVLA 5BN3A 1XMOQ 2UUCL 1SSOA 4GOPB 4DV7Q 1MI2A 3ICEA 5C5MA 1CZWA 4N9TA 4JC0A 1UE7A 2EJFC 2B39A 2NTTA 5GQOA 1UWVA 5JVH3 3J80c 4DAMA 1HFNA 4OIKA 4J1MA 4YCUA 4R4TA 1UUPA 2FHTA 2X69A 3RD4A 3HOXB 1E2WA 1CHPD 2JP1A 1SFOB 3S14H 2PMZB 1H95A 1GHJA 2DJFC 3GTGB 5FJ8H 4OWWB 1WTXA 1GUOA 3EIVA 4IJHA 3JAMi 3GTPH 2EYMA 1F2ZA 1F9RA 2A73B 4A3IH 4JI0Q 1H9SB 3KUPA 1IYJB 4GN4B 1Y1WB 1EU4A 1LT3D 3D4RA 1LT6D 1TXYA 4A3EB 1ZKOA 4ME3A 3GTOB 1M4VA 2PW5A 4G7HC 2M2LA 5C4XG 3ZYYX 1K0SA 2PYKA 4JBKA 2XWJB 5JVG3 4M8AA 4ALPA 5BN4A 1F2MA 4RH6A 2F4IA 1AZQA 2EYPA 5CMDA 3TP6A 1SBBB 4ZUIA 1MKHA 1V9PA 2KHJA 3MXNB 3TDQA 2E2IH 3S15H 2LY7A 4HIKA 1NMFA 3MXGA 1JB7A 3S2HH 5EQ0A 4X6AH 4DV0Q 4A3KG 1B4OA 1N32Q 4A3JB 3I55A 2Y0SB 1ET6A 1F2LA 1OXVA 3JAMc 2M00A 1ESFA 1NR2A 4JV5Q 4APVA 4HIMA 1HTLD 2AHOB 4HSPA 1PH7A 3C46A 3PUYA 3QIAA 1BUVT 1XXGA 4DR1Q 1KNEA 3VYRA 2JA6B 5IWAQ 2PZTA 2KBNA 1MHWC 5J39A 2KHSA 1Q46A 1IBLL 4TVAB 4ZYSA 2XGTA 5FLMH 1DZ1A 4X66Q 2GVAA 2SDFA 2VQFQ 2K01A 4NP5A 2D2CC 4RAUC 1N34L 4Y52H 2PZWA 2Z6KC 3L0OA 3NP8A 3KDFA 2NYZD 4FDBA 1TS4A 4KHPL 2F0LA 1HNWL 1XYIA 1MSGA 1G6PA 2EY2A 1RTOA 4KY7A 2R92B 1PH6A 1DCZA 3CF5A 5C0XH 3TQYA 4H0LC 1HH2P 1SE2A 4JI7L 4KI0A 4L5QA 1O7YA 2K6AA 1TS5A 5F2DA 1TWCB 4KY6A 3A8KE 4NDXA 3UDFA 1R9TB 4RGOS 3MAQA 4LF7L 4PG3A 1SMXA 2NBFA 2AQ3B 3GTQB 1D8LA 2I07B 1MD2D 2DY7A 1C8CA 3GV6A 1N8RC 4RFBA 5KNBA 2K4KA 5JEAG 4DV2Q 4XQJA 4P75A 2YU9H 4LWCA 3GD7A 5EJWA 1B3QA 1PYSB 1W2BA 1VQDA 2C5CA 4EVOA 4X65L 4X3UA 4KMUC 4LUOA 5DNFA 1AE2A 2N49A 1VQBA 3N6RA 2VUMG 5KNDA 1JICA 5CGKA 1IBMQ 4J15A 3OMGA 3PSIA 3NENA 5DM63 2RCNA 2QDBA 1BF4A 1PYBA 1QG7A 2P5ZX 2B2UA 2D62A 2XRSD 2EYLA 4ODGA 1H9JA 5LMUL 4A3JH 3D6CA 1XMOL 2UUCQ 3HOZH 2EXDA 1TKWB 3QO2A 3A74A 4IUTA 1STEA 3H0GG 1K28A 3SEBA 3E6ZX 3I2ZA 1TVXA 3PQIA 1YHQA 2AMCB 2PMZE 3MFYA 1ILPA 5KYLA 4OXPA 4YY3Q 2BDOA 3HOUH 1Q86C 3GTKB 2NN6I 3DM1A 1GHKA 1AE3A 2OEOA 2VUMB 2OCEA 2K1BA 4DUZL 4MIUA 1HNZQ 5GAHC 2HT1A 5DM73 3MTSA 3HOWH 1WD0A 3QB3A 4DV4L 1TWFB 2B63H 5M5WH 2L11A 2KA7A 4K2KA 3H6MA 3IRBA 3F2CA 5EGTA 4CKBA 4CKEA 4GLXA 4N9PA 3S14B 1PFNA 4BY1G 2MHVA 1RL2A 5E7NA 2PQAB 2B2TC 4X62Q 1AZPA 4XXEA 2R6GA 4JCVE 1K0RA 2IX0A 1N36L 5A2QE 3GQBA 3ULJA 1QZGA 5C3EG 1S5CD 3S1NH 3SDZA 1BBUA 3S16H 1VQEA 1SE8A 2K75A 5CV9A 5IYCH 5FK9C 3KJPA 4OONA 3S9WA 2Z8LA 1BNZA 2UUBQ 4B3RQ 3S16B 3OWEB 3PIP3 1RF2D 3NPPA 3GDEA 3HOYH 3TRZA 1NBWA 1PRTC 4FNFA 1ILQA 1V8QA 2F3IA 1YIJA 1SNPA 4A3CG 3W1GA 2GA4B 3I4LA 2EVBA 2NWGA 4Z9CB 5E4XA 1VQHA 3U9OA 5JAVA 1K9MC 1EQRA 4KY5A 5KGUA 4JOIA 3KLSA 1E22A 4R1JA 3CC7A 5LMNW 1EFWA 1D5MC 4JI4L 1Z47A 2R93B 1D2BA 1DOKA 1PDQA 1VQMA 2MUYA 3NWSA 1DONA 2I5MX 5D65A 4OL7A 3PF5A 1HZAA 2RDGA 4LMQD 3S1MH 2EYFA 3K0YA 2UXBQ 1BCPC 2PQAA 5C4XH 1KC8C 1FGBD 3LWUA 3I4NB 2WFWA 3CAMA 2MQHA 3J80L 2QCPX 1Q81C 4JI4Q 3Q8DA 2RQXA 1Y69U 2A68D 3I4NH 1WTOA 4K14A 4MN3A 2V1CC 4IO9A 2FJ2A 2VS1A 2EY6A 3CC2A 1WTRA 3H3VH 3UE1A 3S1MB 2H1EA 4L5TA 4IFDH 5C6AA 4YWMA 1JCKB 2TSSA 2ZM6Q 3S2DB 3M9BA 4PQXA 2JA8H 1LV9A 1I6HH 2JA9A 1NSNS 2OT2A 4KHVA 4DPGA 4IZ8A 2NB0A 5LHY1 3CMEA 4F87A 4RGTA 3TS2A 3VYUA 2NVTB 1IBML 1WJJA 2MP1A 4YIJA 4KHZA 2E2JH 3KLWA 3SE0A 2J4XA 5C3XA 1GJXA 4A3GG 1PA6A 3H91A 1I4PA 1X56A 3FP9A 3ULPA 4JI2L 2EJGC 4FYDA 3R93A 1KNAA 4NKLA 1PMRA 2NN6H 5C44B 2BDNA 1O7IA 4RHSA 2N55A 2Z9HA 2JK8A 4WJ3M 3CCRA 1FL0A 3J7AF 1WOCA 4ULLA 1CUKA 2QW7A 1H9RA 1TWFH 2A6HD 2XWBB 4J6HA 5GADC 2B63B 4A3DB 2Q2UA 3F2UA 1RDPD 4FF3A 4DR6L 3M7GA 2WAQB 4OO1H 3UE0A 1YNNC 5CBAE 4BY7H 2SOBA 4BXXG 3PUWA 4HCEA 2BH8A 4BBSH 2YTVA 5FLXc 3H94A 1SNOA 2HD3A 4FXGC 3D3RA 3HOVH 5K36G 3KLRA 3NBHA 4JI5L 4HSVA 3CCJA 2EIFA 4RGNA 4EX5A 3QJYA 4POGA 2JA7B 3BG3A 5IWAL 3C1FA 2RF4A 1EU3A 2XN9C 3BJUA 1FNWA 3VR5A 2EY1A 1K3BC 4FXDA 1N33L 1L2FA 2CH4A 4GLAC 4A3MG 4B9WA 4HJ5A 1PFMA 1QUQB 2BA1A 1ZXTA 2Q8TA 3BZCA 1L1OC 1M1KC 2R92G 3KF6B 4LK1C 5CORA 5ELBA 1ML0D 2D0PA 3TS0A 4MTNA 2K5VA 3FKIH 1B8AA 1G8ZD 2O5JC 4BY7G 4BXXH 3AB9A 1EYGA 3EVQA 4A3BG 4KJNA 3T4AC 5IYCG 3HOZB 4F7XA 4JI8L 1IL8A 1A3VA 1CSPA 2R7ZH 1OXUA 4FF4A 4KHPQ 2A5HA 3CCLA 4RA8A 2EE1A 5A2QL 4K0KQ 3HOZG 4B9XA 1F9SA 2ENBA 2I5HA 2RSOA 5D3IB 1TQOA 5HY6A 3SHLA 2KEDA 3EN2A 1HQMC 3KBXA 4HAEA 3GTOH 4IURA 4LW1A 5IGFA 1HPCA 4DR7L 3GTLB 5KIXA 4FP5D 2L12A 3M85A 1IW7C 2B63G 3LWEA 3L3OC 2Z4IA 3VR2A 2QEXA 3P20A 1CA6A 2QEJC 2TMPA 2OF1A 1BBXC 3W1BA 4X65Q 2K04A 4C2MB 1LTBD 4DA2A 4LFAQ 4A93H 4PMCA 2BCOA 1V1OA 3CC4A 1ESRA 4K2LA 1KXLA 2JA7G 1M8AA 5CV7A 4C3HB 4UDUC 1LACA 3CCQA 1HCZA 3H0GB 5C5LA 4V0BA 1V1PB 2YV5A 4LF4L 4HN7A 2B2UC 4GKJL 1LLRD 5FLXL 4BA2I 1ENCA 3VYSA 1AW7A 1VQPA 2F0HA 4UPAA 4OWTB 4LF9L 2PI2E 1BO0A 4GN3B 3X3MA 4DV5L 3RZOB 3Q0AA 5J22A 4IN3A 3DWAA 3L7ZC 3CXCA 1UNSA 2C9OA 4GKJQ 5C4HA 3J7A5 1WYDA 4CJ0B 1AH9A 1D5XC 2AWNA 1L0YB 3PUXA 4IALA 1SNQA 3I8ZA 1YNND 4GOPA 1GUNA 2ZJQA 3P1HA 3UI2A 2K52A 2SNSA 3MEFA 4DV2L 1PVOA 3G4SA 1KHIA 1AN8A 3GV3A 3D31A 5BN5A 3T1YL 1J5EQ 1B44D 5BR8Q 1X3GA 1EZ8A 4RKLA 2N78A 4DUYL 2K5QA 3PIOA 1C4QA 3WWVA 3PIPA 1VCIA 2MO1A 1YZ6A 3HOVB 4QCLA 4Y7NB 4IUQA 3KDFB 5ELCA 3OIPA 3UDIA 5M3FB 4GNXB 1EIHA 4YHHQ 4HMJA 4JI1Q 1KQSA 4F88A 1EWCA 1PHJA 2K05A 1N36Q 1EWHA 2ZTCA 1EEFD 1K8OA 1U4MA 2SEBD 1UE1A 3KF6A 2EYJA 4UAIA 1TY0A 3D8GA 4R8NA 4ZQ3A 1U5KA 3MC0B 4EQ5A 3PIO3 4IOCA 4UP9A 4DXGA 5IIFA 4DAYB 2CFMA 1QVFA 5FLMG 4A3FB 2FMMA 1KAWA 3DWQA 4LF8L 2EZVA 3URYA 3M7NA 2ZXRA 4PZ6A 1SMYD 2CW0C 4CJ1B 2XRQD 2CCZA 4EQOA 4QIWE 1BCPD 5E1FA 2KCTA 1TS2A 1Q1EA 5ELDA 4XT1B 3I56A 3H09A 3CHBD 3M4OH 3PMFA 1K3RA 2B3GA 1LTLA 1F2YA 4DV0L 4POFA 3L2PA 4X66L 4DV6L 4A3EG 1HHVA 3QR8A 1Z9FA 3EFXD 2WAQG 5T1IA 4PZ8A 1JR0D 1X32A 4ZK9B 1TU2B 2B8GA 1A6XA 4K5XA 3CRLC 4BBRG 3GO5A 3D6WA 4JBWA 4HIDA 3K5LA 1EIYB 1VS0A 5EKKA 2ZJRA 1HZ9A 4M1UB 1MSHA 4AQYL 4N8X1 3A5ZB 2KEEA 1Y1VG 5IE8A 1XNRL 4CDCC 1XPRA 4KK7A 2JN4A 1YBYA 2AUKA 3J81L 4DNRB 1Y8NB 5K5PA 3V96A 2NVQB 1TWHB 1FYCA 2AWOA 1TY2A 1NCVA 3S1RB 5KYIA 3NBIA 2RA4A 3HP3A 4HJAA 4KD3A 3CKIB 5DLQE 4XQQA 3B6YA 2BOSA 2PPBC 1EY5A 4C3IB 3T56B 1U9RA 5JJLA 3QG1A 4KKUA 1IW7D 1PH5A 1SE3A 2WB1E 4H13C 4DV3L 4A3BB 2K14A 1S5BD 3J81j 1HFGA 1BOSA 4PMWA 3PO2B 3SGIA 3PO2H 3ITPA 3VR3A 4OO1I 3OOCA 1II3A 1KLGD 1NMGA 2A69C 1YNXA 4UY8C 3QOJA 2RBMA 3RR5A 3A54A 3K81C 4ZKCB 4CHTB 3S24A 2JJQA 1TWAH 4DR4Q 4AYBE 3K80C 1GOZA 2KCNA 2PNHA 1J5EL 5C3WA 4Q0FA 4B3MQ 2R93G 2VY3A 5C4JH 4QQBX 5IYDH 1JWSD 1RCVD 1BBWA 4XYQA 2E2HH 5M5WB 2XIWA 1U4PA 1ICWA 4JYAL 2VQEL 2MNAA 1M90C 3HOWB 3MEHA 1RTNA 1CFMA 1CZGA 4FF1A 4KKSA 3S17B 1EQTA 1PH4A 2PW7A 2IWHA 4IUNA 3VYTA 5GROA 3G71A 4K5WA 3BDOA 1UE5A 3EJIA 5C4JB 2JA6G 4R4OA 3LGJA 4YY3L 3A55A 4L6TB 2MJ8A 1GUWA 2NVXH 2A6EC 3HOUG 5CC4A 2RDFA 4RWSC 4A3LH 5AJ3Q 4O0AA 3CCUA 1O7ZA 1XNRQ 1ZYRC 5IGBA 2F0WA 5GAEC 1BDOA 3IFTA 4PV1C 4LF5L 2HHHL 3S1QH 1NY4A 5NUCA 2I0QA 3HOYB 4RKBA 1PRTB 3M4OB 3HKSA 1VQ4A 2ICIA 2O4XA 1PLFA 4PMBA 3BZDB 3OW7A 1JJ2A 2NVYB 1DXMA 1I4XA 4O2DA 2L5TA 5JEAH 5C44H 3TEHB 3VR4A 3S1NB 4DUZQ 5FJ8G 4GN5A 3K57A 3J81E 3DWPA 1R4PB 3I7FA 3U9SA 4OIJA 4QF4A 4R8IA 3G7LA 2L4NA 4LF5Q 4DK3C 3MZ5A 1SXTA 3JAME 3NTKA 4LUZA 1JOQA 1A3TA 2G9DA 2JA8G 4YWKA 4P2CB 5G3LF 1TWGB 3K0XA 3H3VI 4FVMA 1FNVA 2UXDQ 2NZOA 3AU7A 1EEID 1GUGA 1B9MA 4LFCL 3RUZA 4PZ7A 4XT3B 3FDTA 4A3KB 1QUQA 1J8IA 2EY5A 2CH4W 3GTQH 2UXCL 3D4DA 3ERSX 2KJXA 1JJCB 3NQIA 4BBRB 1X3PA 5IGGA 4LF9Q 3ND9A 4R4CA 3PV0A 2ZTDA 1TWCH 3BVMA 3HKZB 3P75A 1BVSA 1CTMA 3PO2G 1BXTA 2IHEA 2KOLA 1VQFA 4CDDC 3JAML 5CV6A 5CV5A 5IP7G 4ILWA 3IFDA 1PH9A 1GUSA 4JI7Q 1I3QB 1CKNB 3M4QA 1GKHA 3F1ZA 1ASYA 4OHJA 2A68C 3C3LA 2R92H 4JW0A 2OXPA 2M9VA 4S3SA 3G6JB 2NVQH 2CQOA 1S3OA 2PZUA 4K8JA 3CQZB 1HQRD 4QJFA 2KCCA 4DR3L 3JC66 1LYLA 1PZJD 2WAQE 1STGA 4Q5VA 2I5LX 2NUCA 3GTKH 3TBIB 2E2HB 4IUVA 2ZXPA 4KN7C 2V4DA 3I91A 2A19A 2IW3A 1VDZA 3X3NA 1VQJA 1G2TA 1MGSA 3M4YA 4LFBL 4QIWB 1SAPA 2Y0SG 3FPPA 5JPMC 3O13A 1Y1VB 1E2VA 4A76A 4I65A 4KLKA 1L0XB 1PTOF 1QB5D 3RZDH 4IFDJ 1IYUA 3RNUA 1SLJA 1MJCA 3BU2A 3STBD 3OMCA 4IUPA 1K83B 3MHBA 1I50B 5FO9B 3BVZA 4IPGA 1X3EA 3I4MH 2EYHA 3EROA 4JG2A 3ER0A 3CRKC 5M3FG 3M3YH 4X3TA 2DY8A 2ZTEA 2DNEA 2WB1B 1LTSD 2OQ0A 4GNXC 4YCVA 1JQYD 1BCPB 1Q3LA 1KDBA 1AFPA 3T16A 1WCMH 4XTCS 4QL5A 5FLXE 1DD2A 1YVCA 3ND8A 3CCSA 1EY8A 2QA4A 1CKOA 5M5YH 3TREA 4DV4Q 1IXRA 4KV6A 3Q22A 2R7DA 3PUVA 4C3IH 1FJGL 3BDLA 4JI2Q 1I4QA 2KCMA 5IGEA 2AUJD 4JI6Q 2Z6BA 3CCEA 4BA1I 5LMNL 1XNQL 1J9OA 4WRDA 3D4WA 1QZHA 5ELNA 1I4GA 4EGVA 3GTJB 4B3SL 3I73A 1V43A 4F8MA 1VQ5A 2UUAL 2DN8A 2O2LD 3NWTA 4K0KL 3TN2A 1Q90A 4AYBG 4P73A 2K03A 3NELA 1VQIA 1VQ8A 1PTOD 3KJOA 1HNXQ 2KENA 3UDXA 3Q6SA 3T1YQ 1K73C 2L9HA 3J81c 4J8QA 1VQ9A 1RODA 5KEEA 2MGSA 4C3IG 2PI2A 2G9HD 2EOTA 4P71A 2VL6A 1QVCA 1WTWA 5A35A 1WTQA 1LO5D 3HKZG 5D14A 4YHHL 2K5WA 2AQ2B 4E6IA 1ZEQX 2L15A 3CP0A 2OTJA 2VB3X 4HIOA 1CQVA 1JOOA 2LS01 4QGUA 2I46A 2F1MA 1YHBA 4K6DA 1Y1WH 3CQZH 1X6OA 1WVLA 4OX9L 4BY1H 2E2IB 2K5NA 5FOBB 4DR7Q 3AFPA 2K33A 1XX8A 3CMAA 2YYZA 1FNUA 3U58A 2YU9B 4A93B 2XTIA 3V2TA 1UEBA 2B2YC 4DV3Q 4JPBW 4NPSA 3KLSX 2VB2X 3ERQA 1UE6A 4FXKC 3A8JE 4BBSB 1B1ZA 3SK6A 4DK0A 1ENFA 1STNA 3R2TA 1TR5A 2Q2IA 4DU9A 2L55A 2EJMA 2ZXOA 3MFGA 5M3MG 1YJ9A 2F0MA 1JOKA 3GTLH 5M3FH 1HUMA 3DHQA 4WJ4A 1WCMB 3SXHA 1FJGQ 1C0AA 3KFUA 1GXDC 2Z1CA 4QB4A 1C9OA 1E3PA 1HXYD 3FMCA 4EQNA 2HQEA 5CYUA 4A3LG 1XPOA 3K5MA 4TKOB 1YI2A 4RCNA 1WTPA 1B3AA 2N8NA 2UU9Q 1BR9A 2AKWB 2HIXA 1RIPA 4BWGB 5I2YA 4L5RC 3RLOA 4DN4M 4H02A 4AH6A 1A15A 2B2TA 4DNIA 5I4DA 4DAVA 1Q1BA 2HCIA 4LFAL 1L1OB 1OTCA 1HRJA 3NTHA 1PH8A 3VA5A 5I6WA 1PRTD 1X65A 1H9MA 2E75C 3NXWA 1HTPA 3U4ZA 1RHPA 5E4WC 4NXML 2D0OA 4DNTB 2E2DC 1EYDA 3SVMA 3S2HB 3H3VC 2D9UA 4QUCA 5AJ3L 3OYYA 3AQQA 5IP7H 1PZID 2NTSA 5C4ZA 3R3OA 3CD6A 1EOVA 2IPKD 4A3DG 1SR3A 2G5DA 5BR8L 1DGSA 2B8FA 4DR6Q 2IT1A 3PO3B 1T5EA 4TRDA 3IKJA 4XIGS 1G2SA 2FINB 1Q7YC 3CU7A 1G291 1NUCA 3CPFA 5C3EH 1J6QA 4BBSG 2BE5C 1K8AC 4BY7B 4R4IA 4NXNL 1F77A 1MBYA 4A3EH 2N3SA 4ZAIA 4CGYB 2KECA 5EPKA 3DLLA 4OX9Q 4JI0L 2JA7H 4B3TL 3AYHB 3J81i 4C3JH 1YJNA 4DKAC 2MPMA 1VMPA 1EQQA 2O5IC 4A3JG 2F0JA 3OHXC 4A3MB 1TWAB 1SFOH 4GS3A 4ZRZA 3WOFA 3HOXH 1DOMA 1VMCA 3PUZA 3Q24A 4IOAA 4MTKA 2HQLA 4JBMA 3I4MG 1A62A 2QGQA 4IUUA 1A63A 4MZ9A 5IY0A 1N32L 3K59A 2RHQB 3NE5B 2MO0A 3ULLA 1A0IA 2IHFA 3NSWA 3I4MB 3S2DH 2F0GA 4JI8Q 1B50A 1I50H 4ZKBB 4DV1Q 1X55A 4X62L 3EA6A 3I4NG 1ICFB 2UXDL 4QMGA 1ENAA 4CKCA 4LFCQ 2K7VA 1PH2A 2E74C 3VDYA 2UXBL 1S5ED 3HGBA 2NVXB 3CCMA 2N88A 1KTKA 4UP8A 2QKIC 4DV6Q 3RN2A 3EQLC 2F4VQ 1K8GA 1N34Q 2EDGA 4A3FG 3HOXG 1LTTD 2NVYH 1E1OA 2F0UA 1CM9A 3MXUA 3DEPA 2R3ZA 1EIFA 3A0JA 2KVMA 4PNYA 3SR1A 1VQ7A 4A4IA 4JI3Q 4R4QA 3T13A 1FVIA 1EIGA 3J80i 1KDCA 2DGYA 4DXFA 3RLFA 4L5SA 1V1QA 2R93H 2FFKB 2WP8J 4A3IG 2F0DA 4UHVA 4XQNA 3SK5A 5I9OA 4DR5L 3PO3H 5JEAJ 4ABNA 5M9OA 4DR3Q 4ME5A 4LFBQ 1JMCA 2GN5A 1JB3A 1I4HA 2VXWA 2PO4A 4GNXA 2F0TA 1XPUA 1WD1A 4H44C 3K5NA 1WFQA 1HJPA 4KKTA 2ES2A 5FKAC 1EFID 4NMZA 2LMCB 4RCOA 3GTMB 1KAAA 3T53B 1HR0L 3NHHA 1RKNA 2Z4HA 4L8JA 1JE4A 5E3FA 3KYHC 4C1NI 1CQFA 1QOHA 4V190 4RMFA 1WI5A 1DYQA 1STBA 1VF5C 1CSQA 5JPNC 1B53A 3M4PA 5LMNQ 1YEZA 5EKLA 5JJZA 5IT9L 5K36H 5ISRA 4HJ7A 3A56A 2E2JB 1KL9A 1ZYRD 1Z7TA 5KNCA 4X3SA 1DM0B 4G57A 1SYDA 1PV4A 3H15A 1HR0Q 2XSCA 4QUFA 4GZYC 1E0BA 4N8FA 3SK8A 2EPBA 2NZHA 3K6OA 2HHHQ 4YWLA 1SNMA 3LNNA 4B3ML 4JI5Q 5EPLA 3PF4A 5IP9G 2LXKA 4KN4C 5M3MB 1JE5A 3OTOL 4DR2L 1LTID 1VQOA 3VA7A 4JI6L 3OPOA 1E7ZA 4X64Q 5G3LD 4JYAQ 2L0CA 5IT9E 1GUTA 5IGCA 3C2PA 3FPUB 3R8BA 2WIIB 4AYBB 4WORA 2RKSA 2B2WA 5COYA 3K7UC 2HUGA 2ASBA 1TS3A 2MFIA 3N52A 3K8AA 4AIMA 5IGDA 5M5XB 2R7ZG 2WINB 1IHZA 1Q8KA 4BY1B 3OTOQ 4DR2Q 2FMCA 3S17H 3STBC 1A3UA 3CCVA 2VUMH 2F03A 1E1TA 1A8VA 2A69D 2UXCQ 2VZAA 3E0JA 1PTOB 2NZ1D 2GVBA 1X3QA 2XNAC 2JA6H 5IP9H 1Q12A 2ATWA 3U50C 1I6VC 5ELOA 4P72A 1N33Q 1OXXK 4LJZC 2JA5G 1TT2A 1LABA 3RZOH 1U4LA 4FO2A 3J7AV 4IPHA 3A8IE 2AQ1B 2JSOA 4QY7A 1IKLA 4B3SQ 5EKIA 1BKBA 1WTHA 1SROA 2UUAQ 2B2WC 1CHQD 4CBVA 3GP7A 2JXMB 2K28A 4XDXA 1KLUD 2Q2TA 4IQZA 5DEHA 5C44G 4LAAA 1K8MA 3OSOA 1PH1A 3C1EA 1R9TH 2WACA 1HNWQ 4A3FH 2CVRA 4K8IA 3NUCA 4U673 1IBKQ 3KF8B 4C3JG 1FGUA 1A2UA 1G91A 1PZKD 1KRSA 3RMHA 3HG9A 3G6EA 3K7AB 1EQVA 3WOEA 3BZKA 2JA5H 4C3JB 4KTAA 1E24A 5JJIA 1B2TA 1YNJC 2CKZB 1JC7A 3CPWA 2K32A 5ELFA 5KRUA 2E5LQ 5M5YB 1W6JA 3R2IA 3IAYA 1BQQT 1GVPA 1YNJD 2F0PA 4FF2A 4I7AA 3FRPB 3E5SA 4RGMA 1XTCD 3HZXA 4YCWA 1D6EC 3W3AA 1Q8IA 2CHBD 4HTHA 5C3EB 2WB1G 2SNMA 3A7LA 3TMEA 3BYTB 3I90A 3P7JA 3M3YB 4DR5Q 3DM3A 2F0IA 4BS9A 1EY6A 1E2ZA 2ZM6L 3W5OA 1XMQQ 1W3SA 2IX1A 3DUZA 1RJTA 4DK6C 5L37A 5CV8A 1G51A 1SJHD 2EXZA 1SEBD 1SYGA 5HGQA 5C0XI 1PH3A 3HOVG 1Y1VH 2PNRC 3F2DA 4HCSA 3T1HL 1HZCA 4JBJA 4XYOA 1HNZL 4A3GB 4DUYQ 2F0OA 1L0WA 1LTGD 5I2XA 5IT9c 5IODA 5LMUQ 2PQEA 2K5DA 3CW2C 4HJ9A 2VQEQ 3PCOB 1JWMD 5LL6S 1CK1A 4DV7L 3SK4A 1I94L 1SYCA 2R61A 4CDEC 1KD1C 2B2VA 3MXPA 1AP0A 1D1IA 2K5HA 5CBEE 4MHEA 1BCPF 1R4QB 3A5UA 2DNCA 2Q8IB 1D1KA 4MNOA 2B2YA 4HR7B 3TZDA 2H5XA 2A8VA 3K7AH 4OWXB 3GTGH 2R7FA 4HEDA 5EBDA 2F0VA 1UAPA 1HA6A 5DAUA 3UDGA 3WDNA 1VQNA 1HUNA 1WCMG 4WFN3 1HA5A 3RN5A 4HJ8A 4HMIA 4DR1L 4O42A 4IFDG 3HFZB 2J7ZA 4C3HH 3I72A 4DFAA 3GTJH 4NXMQ 4A3IB 1SMYC 2CW0D 1EZ6A 1VF7A 1PXUA 1OXSC 4Y7NH 1JJGA 2JA5B 2Z0SA 4IPCA 1VQ6A 3OWFA 1Y8OB 4C2MH 2JYOA 5EBCA 4KJOA 1CKNA 1EUJA 1K83H 1NE3A 2LKVA 2X6GA 1QNUA 2EQSA 2DUDA
chains in the Genus database with same CATH topology
2CFMA 4AH6A 5FLMG 1VQDA 1W2BA 1QVFA 4DNIA 1KAWA 1VQAA 4LF8L 4X65L 1Q1BA 3AEVA 4LUOA 4LFAL 3M7NA 1L1OB 1AE2A 2N49A 1VQBA 3NBHB 4PZ6A 5C0XJ 1OTCA 2VUMG 2NN6G 2NVTH 2CCZA 1IBMQ 1PH8A 3F2BA 4J15A 2IY5B 2ID0A 4QIWE 4LUVA 3PSIA 4NB3A 1X65A 2KCTA 3NENA 2RCNA 2HIVA 4JV5L 4A3GH 1Q1EA 1PYBA 3U4ZA 3I56A 2D62A 3M4OH 4NXML 2B29A 2D0OA 4IFDI 4AQYQ 1K3RA 2B3GA 4GOPC 1I5FA 5LMUL 4A3JH 1LTLA 1P16A 1XMOL 2UUCQ 4DV0L 2EXDA 3HOZH 4POFA 1VQCA 2JQOA 3A74A 3ZJYC 3L2PA 4X66L 3H0GG 4DV6L 4A3EG 2OWOA 2YTYA 5AJ3L 3OYYA 3AQQA 5IP7H 1Z9FA 2WAQG 4PZ8A 3CD6A 5M5XH 1EOVA 1GD7A 3I2ZA 3T1HQ 1SR3A 5BR8L 1YHQA 4LNQA 4A3DG 2AMCB 2PMZE 1DGSA 4IJLA 4DR6Q 4UP7A 4BBRG 4OO1G 2IT1A 3GO5A 4JBWA 4HIDA 4OXPA 4YY3Q 4XIGS 3E9HA 1Q7YC 1IBLQ 5C3EH 1G291 1VS0A 3CPFA 2ZJRA 1HZ9A 4AQYL 1Q86C 3HOUH 1VQGA 1J6QA 4BBSG 3A5ZB 4A3CH 1D7QA 2NN6I 1Y1VG 1K8AC 1GM5A 5IE8A 1AE3A 4R4IA 4NXNL 3U4VA 2OCEA 3H0GH 2N3SA 4A3EH 1XNRL 1S40A 1XPRA 4DUZL 1YBYA 1HNZQ 2UUBL 5GAHC 2HT1A 3EBEA 2OTLA 4B3RL 4A93G 3HOWH 1B7YB 4DV4L 4A3DH 3DLLA 4OX9Q 2A1AA 4JI0L 2B63H 2JA7H 4B3TL 3F8TA 5M5WH 3AYHB 3J81i 4C3JH 1YJNA 4DKAC 2AWOA 2JEAI 3IRBA 3F2CA 1EQQA 2VQFL 2VW9A 4A3JG 4HJAA 1I3QH 4LF4Q 4GLXA 5DLQE 3B6YA 5IYBH 1TWGH 1SFOH 2F4VL 4BY1G 4GS3A 4GKKL 3HOXH 2E8GA 1RL2A 3PUZA 5E7NA 2PQAB 5IYDG 5JJLA 4IOAA 4X62Q 2JEBI 2HQLA 4JBMA 2R6GA 2ALYB 1PH5A 4JCVE 1K0RA 2IX0A 1N36L 3I4MG 1A62A 2QGQA 2WB1E 3ULJA 4DV3L 1QZGA 1NJIC 4MZ9A 1A63A 2K14A 2Q2HA 5IY0A 5C3EG 3S1NH 3S16H 1BBUA 1VQEA 1SE8A 2K75A 1OXTA 2LSSA 3AFQA 3J81j 4DR4L 5IYCH 1N32L 4PMWA 2RHQB 3SGIA 3GTMH 3PO2H 4JOIC 1MIUA 3KJPA 4OO1I 3E9IA 4OONA 2MO0A 3ULLA 2UUBQ 1A0IA 4B3RQ 2IHFA 4GKKQ 3S2DH 4JI8Q 1I50H 3GDEA 3HOYH 1NMGA 3TRZA 1YNXA 1NBWA 2F3IA 4DV1Q 4UY8C 2FXQA 1YIJA 1X55A 4X62L 1X3FA 3RR5A 4A3CG 2Z6KA 3W1GA 3K81C 3I4NG 3J7ZC 2UXDL 4LF8Q 3S24A 4LFCQ 2JJQA 1NTGA 3VDYA 1PH2A 2UXBL 1TWAH 4DR4Q 4AYBE 1SRUA 3K80C 3CCMA 1X9NA 1VQHA 4UP8A 4DV6Q 3RN2A 2PNHA 5IYBG 1EQRA 1K9MC 1N34Q 1J5EL 1K8GA 2CWPA 4A3FG 3HOXG 4B3MQ 4JOIA 2NVYH 2BA0A 2R93G 1E1OA 2VY3A 1E22A 4R1JA 5C4JH 4QQBX 3CC7A 5LMNW 1EFWA 5IYDH 1BBWA 4JI4L 2E2HH 1Z47A 1EIFA 3A0JA 1VQMA 2BH2A 1LUZA 1VQ7A 2KHIA 4JYAL 2VQEL 2I5MX 4A4IA 3KOJA 2MNAA 1M90C 1MJEA 4JI3Q 4R4QA 5C0XG 3PF5A 1HZAA 3PGZA 1PH4A 3S1MH 1FVIA 2UXBQ 3J80i 4POGA 2DGYA 2PQAA 4NXNQ 5C4XH 3RLFA 4L5SA 5GROA 1XNQQ 1KC8C 3G71A 1QVGA 1V1QA 2R93H 2WP8J 1UE5A 2WFWA 4A3IG 3CAMA 2MQHA 5EAYA 2JA6G 4DR5L 4DV1L 1HR0W 3PO3H 1Q81C 4R4OA 4JI4Q 3LGJA 4YY3L 3Q8DA 5J3BA 2YTXA 3I4NH 3OW2A 5JEAJ 2NVXH 4A75A 4DR3Q 4LFBQ 2V1CC 4IO9A 3HOUG 4A3LH 2VS1A 1LM0A 5AJ3Q 1HNXL 1JMCA 2GN5A 3CC2A 3H3VH 4O0AA 3UE1A 3CCUA 4GNXA 1XNRQ 5GAEC 4L5TA 5M3MH 1XPUA 4LF5L 1XJVA 2HHHL 3S1QH 1GO3E 1NY4A 4BBRH 1WFQA 4LF6Q 2I0QA 1HJPA 4B3TQ 4YWMA 1PFSA 2ZM6Q 5JJKA 2ES2A 3M9BA 3HKSA 1VQ4A 2JA8H 1I6HH 3HKZE 1KIXA 2JA9A 3RLNA 1JJ2A 4DPGA 4A3KH 4O2DA 4X64L 3CMEA 1HR0L 5C44H 3TS2A 3TEHB 4RG1A 4DUZQ 5FJ8G 3KYHC 4GN5A 1IBML 4RMFA 1WI5A 1WJJA 3I7FA 1CSQA 2Y0SE 1IL2A 4KHZA 3M4PA 2E2JH 3KLWA 4DK3C 5LMNQ 4LF5Q 1YEZA 4A3GG 4HJ7A 4LUZA 1KL9A 2JA8G 4YWKA 1B70B 1PA6A 2CWAA 1X56A 3FP9A 3K0XA 3ULPA 1IBKL 4JI2L 3H3VI 1PV4A 2NZOA 2UXDQ 5H1SE 3H15A 1O7IA 2ZJPA 1HR0Q 4LFCL 1CKMA 4PZ7A 3FKIG 1QUQA 2JK8A 4WJ3M 3CCRA 4P74A 3PO3G 2NZHA 1FL0A 4IPDA 2HHHQ 1WOCA 3GTQH 4A3BH 4YWLA 1CUKA 3ERSX 1TWFH 2UXCL 5GADC 1JJCB 4B3ML 2Q2UA 4JI5Q 1IZ6A 1EWIA 3PF4A 3HOYG 4LF9Q 4DR6L 5IP9G 2F4VQ 4R4CA 3PV0A 2LXKA 3UE0A 2ZTDA 1JE5A 3OTOL 4DR2L 1VQOA 1TWCH 2VNUD 1SN8A 1BVSA 4JI6L 4X64Q 1E7ZA 4JYAQ 3PO2G 2IHEA 4BY7H 1VQFA 3FHWA 4BXXG 1T9HA 3PUWA 1Y14B 1VQKA 5IP7G 4BBSH 2BH8A 2YTVA 5FLXc 4A3MH 1S72A 1PH9A 4JI7Q 1CKNB 3M4QA 2UU9L 4GLVB 1Q82C 1GKHA 3F1ZA 3HOVH 1ASYA 3S1RH 3K7UC 1X54A 2R92H 5K36G 2ASBA 2R7ZG 1L1OA 2MFIA 3K8AA 4JI5L 4AIMA 3CCJA 1YITA 2E5LL 4LF7Q 3G48A 1HZBA 1TWHH 2EIFA 2LXJA 4EX5A 5GAGC 1XMQL 1Q8KA 2CQOA 5IWAL 3OTOQ 1S3OA 1U0LA 3BJUA 2RF4A 2F52A 4DR2Q 4QJFA 3S17H 3STBC 1N33L 3CCVA 4DR3L 1L2FA 1LYLA 2WAQE 1YHAA 1XTDA 3JC66 4GLAC 4A3MG 2VUMH 1E1TA 4HJ5A 3HOWG 2I5LX 1A8VA 1QUQB 3NEMA 2BA1A 3GTKH 1P8LA 2UXCQ 3BZCA 1L1OC 2VZAA 1M1KC 1Y1WG 2R92G 3KF6B 2A19A 2GVBA 2C35B 2K50A 4DV5Q 1ASZA 2JA6H 1C7YA 5IP9H 1VQJA 4JI3L 2D0PA 1Q12A 1N9WA 2ATWA 3D0FA 3U50C 2EQSA 3TS0A 4MTNA 4TQUS 4LFBL 3E0EA 2K5VA 3FKIH 2Y0SG 1B8AA 5ELOA 4BY7G 2RHSB 4BXXH 4A76A 1EYGA 4P72A 4KLKA 1N33Q 1OXXK 1VQLA 4A3BG 2JA5G 1I94Q 5IYCG 3RZDH 4IFDJ 3RNUA 3RZOH 1SLJA 1MJCA 3BU2A 4JI8L 3STBD 4LF6L 2OQKA 1KRTA 4IPHA 4QY7A 2JE6I 4B3SQ 1CSPA 1X3EA 4IPGA 1OXUA 2R7ZH 1BKBA 1YJWA 3I4MH 4KHPQ 1SROA 3I4OA 4JG2A 2UUAQ 3CCLA 3ER0A 4JI1L 5M3FG 3M3YH 4K0KQ 2ZTEA 3HOZG 1XMOQ 2UUCL 4GOPB 2I5HA 4DV7Q 2OQ0A 3ICEA 4GNXC 2Q2TA 4YCVA 4JC0A 5C44G 5HY6A 1UE7A 3EN2A 3GTOH 5GQOA 1PH1A 1UWVA 1WCMH 4LW1A 4XTCS 4QL5A 4DAMA 3J80c 4DR7L 1YVCA 1R9TH 3CCSA 2QA4A 4DV4Q 1CKOA 5M5YH 3TREA 4YCUA 4A3FH 1IXRA 1HNWQ 2R7DA 3M85A 3PUVA 4C3IH 2B63G 4R4TA 1FJGL 4JI2Q 3KF8B 1IBKQ 2KCMA 1FGUA 2QEXA 3S14H 1H95A 1KRSA 5FJ8H 3W1BA 4X65Q 3G6EA 4JI6Q 4OWWB 4LFAQ 3CCEA 4BA1I 3BZKA 4A93H 3EIVA 4IJHA 3JAMi 2JA5H 5LMNL 1XNQL 3CC4A 3GTPH 1E24A 1QZHA 5JJIA 1KXLA 2JA7G 4A3IH 5ELNA 4JI0Q 2CKZB 4B3SL 1IYJB 3CPWA 3CCQA 1V43A 4GN4B 1VQ5A 2UUAL 2E5LQ 4K0KL 1TXYA 4AYBG 4P73A 1GVPA 3NELA 1VQIA 1VQ8A 4ME3A 3KJOA 2YV5A 1HNXQ 2KENA 4LF4L 4GKJL 5C4XG 4YCWA 3UDXA 2WB1G 3T1YQ 1K73C 4BA2I 4JBKA 3J81c 1VQ9A 4ALPA 1VQPA 4DR5Q 4UPAA 4OWTB 3DM3A 2PI2E 4LF9L 2ZM6L 1MKHA 1V9PA 3W5OA 1XMQQ 4GN3B 2KHJA 3MXNB 1W3SA 2PI2A 2IX1A 2E2IH 4DAYB 4DV5L 3S15H 4HIKA 1NMFA 1JB7A 3S2HH 4X6AH 4DV0Q 4A3KG 4DK6C 3L7ZC 3CXCA 4P71A 1G51A 1N32Q 3I55A 5C0XI 2VL6A 5HGQA 4GKJQ 1PH3A 1QVCA 3HOVG 1Y1VH 1OXVA 3JAMc 3F2DA 3HKZG 4JV5Q 1JT8A 4APVA 1HZCA 1WYDA 4JBJA 3T1HL 1HNZL 4HIMA 2AWNA 2AHOB 1PH7A 1AH9A 4DUYQ 3PUYA 3PUXA 1L0WA 4YHHL 4DR1Q 5IT9c 5IWAQ 2KBNA 4GOPA 5LMUQ 2ZJQA 3CP0A 2L15A 3CW2C 2OTJA 4HJ9A 2VQEQ 1IBLL 4TVAB 2XGTA 5FLMH 3PCOB 4HIOA 4X66Q 2GVAA 3J7A5 2VQFQ 2K52A 3MEFA 4DV2L 4DV7L 3G4SA 1I94L 4QGUA 1PVOA 1KHIA 3T1YL 3D31A 1KD1C 1YHBA 1N34L 1J5EQ 1Y1WH 3CQZH 4Y52H 2Z6KC 1X6OA 2K5HA 3L0OA 5BR8Q 1X3GA 4OX9L 3KDFA 4BY1H 4FDBA 2K5NA 3A5UA 4DR7Q 2N78A 3AFPA 4DUYL 3CMAA 3PIOA 4KHPL 3WWVA 1HNWL 3PIPA 2YYZA 4MNOA 1G6PA 1PH6A 2H5XA 3CF5A 3U58A 1VCIA 2MO1A 1YZ6A 2XTIA 2A8VA 1UEBA 3K7AH 4DV3Q 4NPSA 3TQYA 1UE6A 4OWXB 3GTGH 1HH2P 3KDFB 2R7FA 4JI7L 4KI0A 4L5QA 2Q2IA 3UDIA 3UDGA 5M3MG 1VQNA 4GNXB 1YJ9A 1WCMG 3UDFA 4HJ8A 3RN5A 3GTLH 5M3FH 4YHHQ 4DR1L 4JI1Q 1KQSA 3HFZB 4LF7L 4C3HH 4IFDG 3GTJH 3RLOA 1PHJA 4NXMQ 1FJGQ 1C0AA 4PG3A 3KFUA 1SMXA 1N36Q 1D8LA 1C9OA 1E3PA 1OXSC 2ZTCA 4Y7NH 4A3LG 1JJGA 1XPOA 1N8RC 2K4KA 2Z0SA 1UE1A 3KF6A 5JEAG 4DV2Q 4IPCA 4P75A 1VQ6A 4WJ4A 1YI2A 2YU9H 2N8NA 4C2MH 2AKWB 2HIXA 2UU9Q 1RIPA 4LWCA 1EIYB 1U5KA 4EQ5A 2NVQH 1CKNA 4IOCA 4UP9A 1EUJA 1K83H 3GD7A 1NE3A 4L5RC 1Q46A 1PYSB 4H02A 2DUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFM A;  4AH6 A;  5FLM G;  1VQD A;  1W2B A;  1QVF A;  4DNI A;  1KAW A;  1VQA A;  4LF8 L;  4X65 L;  1Q1B A;  3AEV A;  4LUO A;  4LFA L;  3M7N A;  1L1O B;  1AE2 A;  2N49 A;  1VQB A;  3NBH B;  4PZ6 A;  5C0X J;  1OTC A;  2VUM G;  2NN6 G;  2NVT H;  2CCZ A;  1IBM Q;  1PH8 A;  3F2B A;  4J15 A;  2IY5 B;  2ID0 A;  4QIW E;  4LUV A;  3PSI A;  4NB3 A;  1X65 A;  2KCT A;  3NEN A;  2RCN A;  2HIV A;  4JV5 L;  4A3G H;  1Q1E A;  1PYB A;  3U4Z A;  3I56 A;  2D62 A;  3M4O H;  4NXM L;  2B29 A;  2D0O A;  4IFD I;  4AQY Q;  1K3R A;  2B3G A;  4GOP C;  1I5F A;  5LMU L;  4A3J H;  1LTL A;  1P16 A;  1XMO L;  2UUC Q;  4DV0 L;  2EXD A;  3HOZ H;  4POF A;  1VQC A;  2JQO A;  3A74 A;  3ZJY C;  3L2P A;  4X66 L;  3H0G G;  4DV6 L;  4A3E G;  2OWO A;  2YTY A;  5AJ3 L;  3OYY A;  3AQQ A;  5IP7 H;  1Z9F A;  2WAQ G;  4PZ8 A;  3CD6 A;  5M5X H;  1EOV A;  1GD7 A;  3I2Z A;  3T1H Q;  1SR3 A;  5BR8 L;  1YHQ A;  4LNQ A;  4A3D G;  2AMC B;  2PMZ E;  1DGS A;  4IJL A;  4DR6 Q;  4UP7 A;  4BBR G;  4OO1 G;  2IT1 A;  3GO5 A;  4JBW A;  4HID A;  4OXP A;  4YY3 Q;  4XIG S;  3E9H A;  1Q7Y C;  1IBL Q;  5C3E H;  1G29 1;  1VS0 A;  3CPF A;  2ZJR A;  1HZ9 A;  4AQY L;  1Q86 C;  3HOU H;  1VQG A;  1J6Q A;  4BBS G;  3A5Z B;  4A3C H;  1D7Q A;  2NN6 I;  1Y1V G;  1K8A C;  1GM5 A;  5IE8 A;  1AE3 A;  4R4I A;  4NXN L;  3U4V A;  2OCE A;  3H0G H;  2N3S A;  4A3E H;  1XNR L;  1S40 A;  1XPR A;  4DUZ L;  1YBY A;  1HNZ Q;  2UUB L;  5GAH C;  2HT1 A;  3EBE A;  2OTL A;  4B3R L;  4A93 G;  3HOW H;  1B7Y B;  4DV4 L;  4A3D H;  3DLL A;  4OX9 Q;  2A1A A;  4JI0 L;  2B63 H;  2JA7 H;  4B3T L;  3F8T A;  5M5W H;  3AYH B;  3J81 i;  4C3J H;  1YJN A;  4DKA C;  2AWO A;  2JEA I;  3IRB A;  3F2C A;  1EQQ A;  2VQF L;  2VW9 A;  4A3J G;  4HJA A;  1I3Q H;  4LF4 Q;  4GLX A;  5DLQ E;  3B6Y A;  5IYB H;  1TWG H;  1SFO H;  2F4V L;  4BY1 G;  4GS3 A;  4GKK L;  3HOX H;  2E8G A;  1RL2 A;  3PUZ A;  5E7N A;  2PQA B;  5IYD G;  5JJL A;  4IOA A;  4X62 Q;  2JEB I;  2HQL A;  4JBM A;  2R6G A;  2ALY B;  1PH5 A;  4JCV E;  1K0R A;  2IX0 A;  1N36 L;  3I4M G;  1A62 A;  2QGQ A;  2WB1 E;  3ULJ A;  4DV3 L;  1QZG A;  1NJI C;  4MZ9 A;  1A63 A;  2K14 A;  2Q2H A;  5IY0 A;  5C3E G;  3S1N H;  3S16 H;  1BBU A;  1VQE A;  1SE8 A;  2K75 A;  1OXT A;  2LSS A;  3AFQ A;  3J81 j;  4DR4 L;  5IYC H;  1N32 L;  4PMW A;  2RHQ B;  3SGI A;  3GTM H;  3PO2 H;  4JOI C;  1MIU A;  3KJP A;  4OO1 I;  3E9I A;  4OON A;  2MO0 A;  3ULL A;  2UUB Q;  1A0I A;  4B3R Q;  2IHF A;  4GKK Q;  3S2D H;  4JI8 Q;  1I50 H;  3GDE A;  3HOY H;  1NMG A;  3TRZ A;  1YNX A;  1NBW A;  2F3I A;  4DV1 Q;  4UY8 C;  2FXQ A;  1YIJ A;  1X55 A;  4X62 L;  1X3F A;  3RR5 A;  4A3C G;  2Z6K A;  3W1G A;  3K81 C;  3I4N G;  3J7Z C;  2UXD L;  4LF8 Q;  3S24 A;  4LFC Q;  2JJQ A;  1NTG A;  3VDY A;  1PH2 A;  2UXB L;  1TWA H;  4DR4 Q;  4AYB E;  1SRU A;  3K80 C;  3CCM A;  1X9N A;  1VQH A;  4UP8 A;  4DV6 Q;  3RN2 A;  2PNH A;  5IYB G;  1EQR A;  1K9M C;  1N34 Q;  1J5E L;  1K8G A;  2CWP A;  4A3F G;  3HOX G;  4B3M Q;  4JOI A;  2NVY H;  2BA0 A;  2R93 G;  1E1O A;  2VY3 A;  1E22 A;  4R1J A;  5C4J H;  4QQB X;  3CC7 A;  5LMN W;  1EFW A;  5IYD H;  1BBW A;  4JI4 L;  2E2H H;  1Z47 A;  1EIF A;  3A0J A;  1VQM A;  2BH2 A;  1LUZ A;  1VQ7 A;  2KHI A;  4JYA L;  2VQE L;  2I5M X;  4A4I A;  3KOJ A;  2MNA A;  1M90 C;  1MJE A;  4JI3 Q;  4R4Q A;  5C0X G;  3PF5 A;  1HZA A;  3PGZ A;  1PH4 A;  3S1M H;  1FVI A;  2UXB Q;  3J80 i;  4POG A;  2DGY A;  2PQA A;  4NXN Q;  5C4X H;  3RLF A;  4L5S A;  5GRO A;  1XNQ Q;  1KC8 C;  3G71 A;  1QVG A;  1V1Q A;  2R93 H;  2WP8 J;  1UE5 A;  2WFW A;  4A3I G;  3CAM A;  2MQH A;  5EAY A;  2JA6 G;  4DR5 L;  4DV1 L;  1HR0 W;  3PO3 H;  1Q81 C;  4R4O A;  4JI4 Q;  3LGJ A;  4YY3 L;  3Q8D A;  5J3B A;  2YTX A;  3I4N H;  3OW2 A;  5JEA J;  2NVX H;  4A75 A;  4DR3 Q;  4LFB Q;  2V1C C;  4IO9 A;  3HOU G;  4A3L H;  2VS1 A;  1LM0 A;  5AJ3 Q;  1HNX L;  1JMC A;  2GN5 A;  3CC2 A;  3H3V H;  4O0A A;  3UE1 A;  3CCU A;  4GNX A;  1XNR Q;  5GAE C;  4L5T A;  5M3M H;  1XPU A;  4LF5 L;  1XJV A;  2HHH L;  3S1Q H;  1GO3 E;  1NY4 A;  4BBR H;  1WFQ A;  4LF6 Q;  2I0Q A;  1HJP A;  4B3T Q;  4YWM A;  1PFS A;  2ZM6 Q;  5JJK A;  2ES2 A;  3M9B A;  3HKS A;  1VQ4 A;  2JA8 H;  1I6H H;  3HKZ E;  1KIX A;  2JA9 A;  3RLN A;  1JJ2 A;  4DPG A;  4A3K H;  4O2D A;  4X64 L;  3CME A;  1HR0 L;  5C44 H;  3TS2 A;  3TEH B;  4RG1 A;  4DUZ Q;  5FJ8 G;  3KYH C;  4GN5 A;  1IBM L;  4RMF A;  1WI5 A;  1WJJ A;  3I7F A;  1CSQ A;  2Y0S E;  1IL2 A;  4KHZ A;  3M4P A;  2E2J H;  3KLW A;  4DK3 C;  5LMN Q;  4LF5 Q;  1YEZ A;  4A3G G;  4HJ7 A;  4LUZ A;  1KL9 A;  2JA8 G;  4YWK A;  1B70 B;  1PA6 A;  2CWA A;  1X56 A;  3FP9 A;  3K0X A;  3ULP A;  1IBK L;  4JI2 L;  3H3V I;  1PV4 A;  2NZO A;  2UXD Q;  5H1S E;  3H15 A;  1O7I A;  2ZJP A;  1HR0 Q;  4LFC L;  1CKM A;  4PZ7 A;  3FKI G;  1QUQ A;  2JK8 A;  4WJ3 M;  3CCR A;  4P74 A;  3PO3 G;  2NZH A;  1FL0 A;  4IPD A;  2HHH Q;  1WOC A;  3GTQ H;  4A3B H;  4YWL A;  1CUK A;  3ERS X;  1TWF H;  2UXC L;  5GAD C;  1JJC B;  4B3M L;  2Q2U A;  4JI5 Q;  1IZ6 A;  1EWI A;  3PF4 A;  3HOY G;  4LF9 Q;  4DR6 L;  5IP9 G;  2F4V Q;  4R4C A;  3PV0 A;  2LXK A;  3UE0 A;  2ZTD A;  1JE5 A;  3OTO L;  4DR2 L;  1VQO A;  1TWC H;  2VNU D;  1SN8 A;  1BVS A;  4JI6 L;  4X64 Q;  1E7Z A;  4JYA Q;  3PO2 G;  2IHE A;  4BY7 H;  1VQF A;  3FHW A;  4BXX G;  1T9H A;  3PUW A;  1Y14 B;  1VQK A;  5IP7 G;  4BBS H;  2BH8 A;  2YTV A;  5FLX c;  4A3M H;  1S72 A;  1PH9 A;  4JI7 Q;  1CKN B;  3M4Q A;  2UU9 L;  4GLV B;  1Q82 C;  1GKH A;  3F1Z A;  3HOV H;  1ASY A;  3S1R H;  3K7U C;  1X54 A;  2R92 H;  5K36 G;  2ASB A;  2R7Z G;  1L1O A;  2MFI A;  3K8A A;  4JI5 L;  4AIM A;  3CCJ A;  1YIT A;  2E5L L;  4LF7 Q;  3G48 A;  1HZB A;  1TWH H;  2EIF A;  2LXJ A;  4EX5 A;  5GAG C;  1XMQ L;  1Q8K A;  2CQO A;  5IWA L;  3OTO Q;  1S3O A;  1U0L A;  3BJU A;  2RF4 A;  2F52 A;  4DR2 Q;  4QJF A;  3S17 H;  3STB C;  1N33 L;  3CCV A;  4DR3 L;  1L2F A;  1LYL A;  2WAQ E;  1YHA A;  1XTD A;  3JC6 6;  4GLA C;  4A3M G;  2VUM H;  1E1T A;  4HJ5 A;  3HOW G;  2I5L X;  1A8V A;  1QUQ B;  3NEM A;  2BA1 A;  3GTK H;  1P8L A;  2UXC Q;  3BZC A;  1L1O C;  2VZA A;  1M1K C;  1Y1W G;  2R92 G;  3KF6 B;  2A19 A;  2GVB A;  2C35 B;  2K50 A;  4DV5 Q;  1ASZ A;  2JA6 H;  1C7Y A;  5IP9 H;  1VQJ A;  4JI3 L;  2D0P A;  1Q12 A;  1N9W A;  2ATW A;  3D0F A;  3U50 C;  2EQS A;  3TS0 A;  4MTN A;  4TQU S;  4LFB L;  3E0E A;  2K5V A;  3FKI H;  2Y0S G;  1B8A A;  5ELO A;  4BY7 G;  2RHS B;  4BXX H;  4A76 A;  1EYG A;  4P72 A;  4KLK A;  1N33 Q;  1OXX K;  1VQL A;  4A3B G;  2JA5 G;  1I94 Q;  5IYC G;  3RZD H;  4IFD J;  3RNU A;  3RZO H;  1SLJ A;  1MJC A;  3BU2 A;  4JI8 L;  3STB D;  4LF6 L;  2OQK A;  1KRT A;  4IPH A;  4QY7 A;  2JE6 I;  4B3S Q;  1CSP A;  1X3E A;  4IPG A;  1OXU A;  2R7Z H;  1BKB A;  1YJW A;  3I4M H;  4KHP Q;  1SRO A;  3I4O A;  4JG2 A;  2UUA Q;  3CCL A;  3ER0 A;  4JI1 L;  5M3F G;  3M3Y H;  4K0K Q;  2ZTE A;  3HOZ G;  1XMO Q;  2UUC L;  4GOP B;  2I5H A;  4DV7 Q;  2OQ0 A;  3ICE A;  4GNX C;  2Q2T A;  4YCV A;  4JC0 A;  5C44 G;  5HY6 A;  1UE7 A;  3EN2 A;  3GTO H;  5GQO A;  1PH1 A;  1UWV A;  1WCM H;  4LW1 A;  4XTC S;  4QL5 A;  4DAM A;  3J80 c;  4DR7 L;  1YVC A;  1R9T H;  3CCS A;  2QA4 A;  4DV4 Q;  1CKO A;  5M5Y H;  3TRE A;  4YCU A;  4A3F H;  1IXR A;  1HNW Q;  2R7D A;  3M85 A;  3PUV A;  4C3I H;  2B63 G;  4R4T A;  1FJG L;  4JI2 Q;  3KF8 B;  1IBK Q;  2KCM A;  1FGU A;  2QEX A;  3S14 H;  1H95 A;  1KRS A;  5FJ8 H;  3W1B A;  4X65 Q;  3G6E A;  4JI6 Q;  4OWW B;  4LFA Q;  3CCE A;  4BA1 I;  3BZK A;  4A93 H;  3EIV A;  4IJH A;  3JAM i;  2JA5 H;  5LMN L;  1XNQ L;  3CC4 A;  3GTP H;  1E24 A;  1QZH A;  5JJI A;  1KXL A;  2JA7 G;  4A3I H;  5ELN A;  4JI0 Q;  2CKZ B;  4B3S L;  1IYJ B;  3CPW A;  3CCQ A;  1V43 A;  4GN4 B;  1VQ5 A;  2UUA L;  2E5L Q;  4K0K L;  1TXY A;  4AYB G;  4P73 A;  1GVP A;  3NEL A;  1VQI A;  1VQ8 A;  4ME3 A;  3KJO A;  2YV5 A;  1HNX Q;  2KEN A;  4LF4 L;  4GKJ L;  5C4X G;  4YCW A;  3UDX A;  2WB1 G;  3T1Y Q;  1K73 C;  4BA2 I;  4JBK A;  3J81 c;  1VQ9 A;  4ALP A;  1VQP A;  4DR5 Q;  4UPA A;  4OWT B;  3DM3 A;  2PI2 E;  4LF9 L;  2ZM6 L;  1MKH A;  1V9P A;  3W5O A;  1XMQ Q;  4GN3 B;  2KHJ A;  3MXN B;  1W3S A;  2PI2 A;  2IX1 A;  2E2I H;  4DAY B;  4DV5 L;  3S15 H;  4HIK A;  1NMF A;  1JB7 A;  3S2H H;  4X6A H;  4DV0 Q;  4A3K G;  4DK6 C;  3L7Z C;  3CXC A;  4P71 A;  1G51 A;  1N32 Q;  3I55 A;  5C0X I;  2VL6 A;  5HGQ A;  4GKJ Q;  1PH3 A;  1QVC A;  3HOV G;  1Y1V H;  1OXV A;  3JAM c;  3F2D A;  3HKZ G;  4JV5 Q;  1JT8 A;  4APV A;  1HZC A;  1WYD A;  4JBJ A;  3T1H L;  1HNZ L;  4HIM A;  2AWN A;  2AHO B;  1PH7 A;  1AH9 A;  4DUY Q;  3PUY A;  3PUX A;  1L0W A;  4YHH L;  4DR1 Q;  5IT9 c;  5IWA Q;  2KBN A;  4GOP A;  5LMU Q;  2ZJQ A;  3CP0 A;  2L15 A;  3CW2 C;  2OTJ A;  4HJ9 A;  2VQE Q;  1IBL L;  4TVA B;  2XGT A;  5FLM H;  3PCO B;  4HIO A;  4X66 Q;  2GVA A;  3J7A 5;  2VQF Q;  2K52 A;  3MEF A;  4DV2 L;  4DV7 L;  3G4S A;  1I94 L;  4QGU A;  1PVO A;  1KHI A;  3T1Y L;  3D31 A;  1KD1 C;  1YHB A;  1N34 L;  1J5E Q;  1Y1W H;  3CQZ H;  4Y52 H;  2Z6K C;  1X6O A;  2K5H A;  3L0O A;  5BR8 Q;  1X3G A;  4OX9 L;  3KDF A;  4BY1 H;  4FDB A;  2K5N A;  3A5U A;  4DR7 Q;  2N78 A;  3AFP A;  4DUY L;  3CMA A;  3PIO A;  4KHP L;  3WWV A;  1HNW L;  3PIP A;  2YYZ A;  4MNO A;  1G6P A;  1PH6 A;  2H5X A;  3CF5 A;  3U58 A;  1VCI A;  2MO1 A;  1YZ6 A;  2XTI A;  2A8V A;  1UEB A;  3K7A H;  4DV3 Q;  4NPS A;  3TQY A;  1UE6 A;  4OWX B;  3GTG H;  1HH2 P;  3KDF B;  2R7F A;  4JI7 L;  4KI0 A;  4L5Q A;  2Q2I A;  3UDI A;  3UDG A;  5M3M G;  1VQN A;  4GNX B;  1YJ9 A;  1WCM G;  3UDF A;  4HJ8 A;  3RN5 A;  3GTL H;  5M3F H;  4YHH Q;  4DR1 L;  4JI1 Q;  1KQS A;  3HFZ B;  4LF7 L;  4C3H H;  4IFD G;  3GTJ H;  3RLO A;  1PHJ A;  4NXM Q;  1FJG Q;  1C0A A;  4PG3 A;  3KFU A;  1SMX A;  1N36 Q;  1D8L A;  1C9O A;  1E3P A;  1OXS C;  2ZTC A;  4Y7N H;  4A3L G;  1JJG A;  1XPO A;  1N8R C;  2K4K A;  2Z0S A;  1UE1 A;  3KF6 A;  5JEA G;  4DV2 Q;  4IPC A;  4P75 A;  1VQ6 A;  4WJ4 A;  1YI2 A;  2YU9 H;  2N8N A;  4C2M H;  2AKW B;  2HIX A;  2UU9 Q;  1RIP A;  4LWC A;  1EIY B;  1U5K A;  4EQ5 A;  2NVQ H;  1CKN A;  4IOC A;  4UP9 A;  1EUJ A;  1K83 H;  3GD7 A;  1NE3 A;  4L5R C;  1Q46 A;  1PYS B;  4H02 A;  2DUD A; 
#chains in the Genus database with same CATH topology
 1DJR D;  1VQA A;  2D5D A;  5CV4 A;  4B08 A;  3AEV A;  1SJE D;  3QOL A;  3NBH B;  5C0X J;  1LTR D;  4DAY A;  2NN6 G;  2NVT H;  2E76 C;  2A74 C;  1STA A;  2WV6 D;  3F2B A;  2IY5 B;  1JWU D;  2ID0 A;  3TSS A;  2RCF A;  4O1N A;  4LUV A;  4NB3 A;  4H7B A;  2F0S A;  1PTO H;  2HIV A;  4JV5 L;  4A3G H;  2JA8 B;  3BDC A;  3KBG A;  2R7Z B;  1I6H B;  3MVV A;  3FEW X;  2B29 A;  4IFD I;  4AQY Q;  4GOP C;  1I5F A;  3KF8 A;  1P16 A;  2IL8 A;  1W6K A;  1VQC A;  1H9S A;  2HDL A;  2JQO A;  3ZJY C;  1EL0 A;  2OWO A;  2YTY A;  2IX3 A;  3DMU A;  5M5X H;  4LNQ A;  1GD7 A;  3T1H Q;  1JOR A;  1QIL A;  4IJL A;  4UP7 A;  4OO1 G;  2WKC A;  1H9K A;  3E9H A;  1IBL Q;  3HEJ A;  1D7Q A;  1VQG A;  4A3C H;  4OEM B;  1XWE A;  1GM5 A;  1F9P A;  3KK7 A;  3U4V A;  4C56 C;  3H0G H;  1S40 A;  2L1B A;  5JOB A;  2UUB L;  4B3R L;  3EBE A;  2OTL A;  2PCF B;  4A93 G;  1B7Y B;  4A3D H;  3DXJ C;  2A1A A;  3F8T A;  5LL6 X;  3GTP B;  2JEA I;  1U4R A;  3VR6 A;  1SNC A;  2VQF L;  2VW9 A;  3BS1 A;  1I3Q H;  1SDF A;  4LF4 Q;  1KAB A;  2QDL A;  4X3K A;  3W2D A;  1A2T A;  5IYB H;  1TWG H;  2F4V L;  1F9Q A;  4GKK L;  2E8G A;  3I3C A;  5D3D A;  5IYD G;  1O80 A;  2JEB I;  5I6Y A;  1DOL A;  2ALY B;  1D5Z C;  2H4O A;  3E3X A;  1NJI C;  1EYA A;  2Q2H A;  4TSS A;  1PYW D;  4DR4 L;  2LSS A;  1OXT A;  3AFQ A;  3GTM H;  4JOI C;  1MIU A;  3E9I A;  1T5X D;  4GKK Q;  1RD9 D;  3S1Q B;  2FXQ A;  1EY4 A;  1V1P A;  1X3F A;  3RZD B;  2Z6K A;  2B2V C;  4OGQ C;  1CA5 A;  1NR4 A;  5EPJ A;  3J7Z C;  4LF8 Q;  1Y8P B;  3BYY B;  1C48 A;  3V05 A;  3NTI A;  1NTG A;  3FKI B;  1SRU A;  1STH A;  1X9N A;  3Q23 A;  3HRZ C;  5IYB G;  2CWP A;  1NNX A;  2BA0 A;  1JT8 A;  1LTA D;  3T51 B;  1KDA A;  5T1G A;  1PFB A;  2BH2 A;  3BVG A;  4JVZ A;  1Z6H A;  1ET9 A;  1LUZ A;  2F0Q A;  2KHI A;  3I70 A;  3KOJ A;  1MJE A;  1O7L A;  1G6Z A;  5C0X G;  4G7O C;  5HGT A;  3PGZ A;  2QIL A;  4NXN Q;  1EY0 A;  1XNQ Q;  1STY A;  1QVG A;  3K58 A;  2A6H C;  4NW2 A;  4JK1 C;  3IL8 A;  4OEL B;  1S5F D;  5EAY A;  1FD7 D;  1WTV A;  4DV1 L;  1HR0 W;  1IKM A;  3K5O A;  1I4R A;  1EY9 A;  2J0T D;  5J3B A;  2DJG C;  2YTX A;  2KQ3 A;  3MWY W;  4L63 B;  4EQP A;  3OW2 A;  2EYO A;  2F0K A;  4A75 A;  1HNX L;  1LM0 A;  5C4X B;  1PRT F;  3HS0 C;  2IJ0 A;  3NQT A;  1SND A;  5FO7 B;  4WJW A;  3TP5 A;  4CJ2 C;  5AFW A;  5M3M H;  3DEO A;  4CDF C;  1XJV A;  5FO8 B;  1GO3 E;  4BBR H;  2WKD A;  4LF6 Q;  3NK9 A;  4B3T Q;  4U68 A;  1S4Z A;  1PFS A;  5JJK A;  2F3W A;  3HKZ E;  1QWY A;  1LT5 D;  5TSS A;  3RLN A;  1KIX A;  1ONL A;  2BE5 D;  4G7Z C;  4A3K H;  2F0F A;  1NAP A;  4X64 L;  1B9N A;  4RG1 A;  1QNK A;  3MA2 B;  1SYE A;  4DGZ A;  3J80 E;  2Y0S E;  1IL2 A;  3ONA B;  1EYC A;  1O78 A;  3A7A B;  1SYB A;  4R9W A;  1SE4 A;  1B70 B;  1CI3 M;  1EOT A;  1OO9 B;  2CWA A;  1QE6 A;  1IYV A;  1SYF A;  1IBK L;  3AMU A;  2XVS A;  1LT4 D;  1EY7 A;  3TP8 A;  5H1S E;  2ZJP A;  1CKM A;  5I9P A;  3FKI G;  4P74 A;  3PO3 G;  4IPD A;  1CT1 D;  4K5V A;  4A3B H;  1TII D;  4C1N K;  1IZ6 A;  1EWI A;  3HOY G;  1FR3 A;  5J1Z A;  4DAP A;  1SN8 A;  2VNU D;  5ELE A;  3MXN A;  5HUR A;  2CQA A;  2RDH A;  4ZUJ A;  3FHW A;  4I7Z C;  1T9H A;  2QF7 A;  4ZLT F;  1Y14 B;  1UEA B;  1VQK A;  3HOU B;  4A3M H;  4DK1 A;  1S72 A;  3J7Y W;  2UU9 L;  4GLV B;  1Q82 C;  3S1R H;  1X54 A;  2X6L A;  3OIQ A;  2ZT9 C;  1L1O A;  3LX0 A;  1YIT A;  4C3H G;  2E5L L;  3TZU A;  4LF7 Q;  1HZB A;  1TWH H;  2LXJ A;  3G48 A;  5GAG C;  4ZCK A;  4G4K A;  1XMQ L;  2RSN A;  1U0L A;  2F52 A;  2HCC A;  3L9A X;  3QWN A;  1YHA A;  1XTD A;  2F3V A;  1AEX A;  3HOW G;  2KUM A;  3NEM A;  1P8L A;  5CR3 A;  1PTO C;  1Y1W G;  3TP7 A;  2C35 B;  2K50 A;  4DV5 Q;  1ASZ A;  1C7Y A;  1QJO A;  4JI3 L;  4DF7 A;  1N9W A;  3D0F A;  4KD4 A;  1QCB D;  4TQU S;  2HDM A;  5IOC A;  3E0E A;  2A6E D;  2Q8R E;  2RHS B;  3FVQ A;  2ICE C;  4RHR A;  1VQL A;  2F0E A;  1I94 Q;  1S5D D;  3S15 B;  4K6L A;  2LFN A;  4LF6 L;  2OQK A;  1KRT A;  4ID6 A;  2JE6 I;  1YJW A;  2F0N A;  3I4O A;  4JI1 L;  2RVL A;  5BN3 A;  1XMO Q;  2UUC L;  1SSO A;  4GOP B;  4DV7 Q;  1MI2 A;  3ICE A;  5C5M A;  1CZW A;  4N9T A;  4JC0 A;  1UE7 A;  2EJF C;  2B39 A;  2NTT A;  5GQO A;  1UWV A;  5JVH 3;  3J80 c;  4DAM A;  1HFN A;  4OIK A;  4J1M A;  4YCU A;  4R4T A;  1UUP A;  2FHT A;  2X69 A;  3RD4 A;  3HOX B;  1E2W A;  1CHP D;  2JP1 A;  1SFO B;  3S14 H;  2PMZ B;  1H95 A;  1GHJ A;  2DJF C;  3GTG B;  5FJ8 H;  4OWW B;  1WTX A;  1GUO A;  3EIV A;  4IJH A;  3JAM i;  3GTP H;  2EYM A;  1F2Z A;  1F9R A;  2A73 B;  4A3I H;  4JI0 Q;  1H9S B;  3KUP A;  1IYJ B;  4GN4 B;  1Y1W B;  1EU4 A;  1LT3 D;  3D4R A;  1LT6 D;  1TXY A;  4A3E B;  1ZKO A;  4ME3 A;  3GTO B;  1M4V A;  2PW5 A;  4G7H C;  2M2L A;  5C4X G;  3ZYY X;  1K0S A;  2PYK A;  4JBK A;  2XWJ B;  5JVG 3;  4M8A A;  4ALP A;  5BN4 A;  1F2M A;  4RH6 A;  2F4I A;  1AZQ A;  2EYP A;  5CMD A;  3TP6 A;  1SBB B;  4ZUI A;  1MKH A;  1V9P A;  2KHJ A;  3MXN B;  3TDQ A;  2E2I H;  3S15 H;  2LY7 A;  4HIK A;  1NMF A;  3MXG A;  1JB7 A;  3S2H H;  5EQ0 A;  4X6A H;  4DV0 Q;  4A3K G;  1B4O A;  1N32 Q;  4A3J B;  3I55 A;  2Y0S B;  1ET6 A;  1F2L A;  1OXV A;  3JAM c;  2M00 A;  1ESF A;  1NR2 A;  4JV5 Q;  4APV A;  4HIM A;  1HTL D;  2AHO B;  4HSP A;  1PH7 A;  3C46 A;  3PUY A;  3QIA A;  1BUV T;  1XXG A;  4DR1 Q;  1KNE A;  3VYR A;  2JA6 B;  5IWA Q;  2PZT A;  2KBN A;  1MHW C;  5J39 A;  2KHS A;  1Q46 A;  1IBL L;  4TVA B;  4ZYS A;  2XGT A;  5FLM H;  1DZ1 A;  4X66 Q;  2GVA A;  2SDF A;  2VQF Q;  2K01 A;  4NP5 A;  2D2C C;  4RAU C;  1N34 L;  4Y52 H;  2PZW A;  2Z6K C;  3L0O A;  3NP8 A;  3KDF A;  2NYZ D;  4FDB A;  1TS4 A;  4KHP L;  2F0L A;  1HNW L;  1XYI A;  1MSG A;  1G6P A;  2EY2 A;  1RTO A;  4KY7 A;  2R92 B;  1PH6 A;  1DCZ A;  3CF5 A;  5C0X H;  3TQY A;  4H0L C;  1HH2 P;  1SE2 A;  4JI7 L;  4KI0 A;  4L5Q A;  1O7Y A;  2K6A A;  1TS5 A;  5F2D A;  1TWC B;  4KY6 A;  3A8K E;  4NDX A;  3UDF A;  1R9T B;  4RGO S;  3MAQ A;  4LF7 L;  4PG3 A;  1SMX A;  2NBF A;  2AQ3 B;  3GTQ B;  1D8L A;  2I07 B;  1MD2 D;  2DY7 A;  1C8C A;  3GV6 A;  1N8R C;  4RFB A;  5KNB A;  2K4K A;  5JEA G;  4DV2 Q;  4XQJ A;  4P75 A;  2YU9 H;  4LWC A;  3GD7 A;  5EJW A;  1B3Q A;  1PYS B;  1W2B A;  1VQD A;  2C5C A;  4EVO A;  4X65 L;  4X3U A;  4KMU C;  4LUO A;  5DNF A;  1AE2 A;  2N49 A;  1VQB A;  3N6R A;  2VUM G;  5KND A;  1JIC A;  5CGK A;  1IBM Q;  4J15 A;  3OMG A;  3PSI A;  3NEN A;  5DM6 3;  2RCN A;  2QDB A;  1BF4 A;  1PYB A;  1QG7 A;  2P5Z X;  2B2U A;  2D62 A;  2XRS D;  2EYL A;  4ODG A;  1H9J A;  5LMU L;  4A3J H;  3D6C A;  1XMO L;  2UUC Q;  3HOZ H;  2EXD A;  1TKW B;  3QO2 A;  3A74 A;  4IUT A;  1STE A;  3H0G G;  1K28 A;  3SEB A;  3E6Z X;  3I2Z A;  1TVX A;  3PQI A;  1YHQ A;  2AMC B;  2PMZ E;  3MFY A;  1ILP A;  5KYL A;  4OXP A;  4YY3 Q;  2BDO A;  3HOU H;  1Q86 C;  3GTK B;  2NN6 I;  3DM1 A;  1GHK A;  1AE3 A;  2OEO A;  2VUM B;  2OCE A;  2K1B A;  4DUZ L;  4MIU A;  1HNZ Q;  5GAH C;  2HT1 A;  5DM7 3;  3MTS A;  3HOW H;  1WD0 A;  3QB3 A;  4DV4 L;  1TWF B;  2B63 H;  5M5W H;  2L11 A;  2KA7 A;  4K2K A;  3H6M A;  3IRB A;  3F2C A;  5EGT A;  4CKB A;  4CKE A;  4GLX A;  4N9P A;  3S14 B;  1PFN A;  4BY1 G;  2MHV A;  1RL2 A;  5E7N A;  2PQA B;  2B2T C;  4X62 Q;  1AZP A;  4XXE A;  2R6G A;  4JCV E;  1K0R A;  2IX0 A;  1N36 L;  5A2Q E;  3GQB A;  3ULJ A;  1QZG A;  5C3E G;  1S5C D;  3S1N H;  3SDZ A;  1BBU A;  3S16 H;  1VQE A;  1SE8 A;  2K75 A;  5CV9 A;  5IYC H;  5FK9 C;  3KJP A;  4OON A;  3S9W A;  2Z8L A;  1BNZ A;  2UUB Q;  4B3R Q;  3S16 B;  3OWE B;  3PIP 3;  1RF2 D;  3NPP A;  3GDE A;  3HOY H;  3TRZ A;  1NBW A;  1PRT C;  4FNF A;  1ILQ A;  1V8Q A;  2F3I A;  1YIJ A;  1SNP A;  4A3C G;  3W1G A;  2GA4 B;  3I4L A;  2EVB A;  2NWG A;  4Z9C B;  5E4X A;  1VQH A;  3U9O A;  5JAV A;  1K9M C;  1EQR A;  4KY5 A;  5KGU A;  4JOI A;  3KLS A;  1E22 A;  4R1J A;  3CC7 A;  5LMN W;  1EFW A;  1D5M C;  4JI4 L;  1Z47 A;  2R93 B;  1D2B A;  1DOK A;  1PDQ A;  1VQM A;  2MUY A;  3NWS A;  1DON A;  2I5M X;  5D65 A;  4OL7 A;  3PF5 A;  1HZA A;  2RDG A;  4LMQ D;  3S1M H;  2EYF A;  3K0Y A;  2UXB Q;  1BCP C;  2PQA A;  5C4X H;  1KC8 C;  1FGB D;  3LWU A;  3I4N B;  2WFW A;  3CAM A;  2MQH A;  3J80 L;  2QCP X;  1Q81 C;  4JI4 Q;  3Q8D A;  2RQX A;  1Y69 U;  2A68 D;  3I4N H;  1WTO A;  4K14 A;  4MN3 A;  2V1C C;  4IO9 A;  2FJ2 A;  2VS1 A;  2EY6 A;  3CC2 A;  1WTR A;  3H3V H;  3UE1 A;  3S1M B;  2H1E A;  4L5T A;  4IFD H;  5C6A A;  4YWM A;  1JCK B;  2TSS A;  2ZM6 Q;  3S2D B;  3M9B A;  4PQX A;  2JA8 H;  1LV9 A;  1I6H H;  2JA9 A;  1NSN S;  2OT2 A;  4KHV A;  4DPG A;  4IZ8 A;  2NB0 A;  5LHY 1;  3CME A;  4F87 A;  4RGT A;  3TS2 A;  3VYU A;  2NVT B;  1IBM L;  1WJJ A;  2MP1 A;  4YIJ A;  4KHZ A;  2E2J H;  3KLW A;  3SE0 A;  2J4X A;  5C3X A;  1GJX A;  4A3G G;  1PA6 A;  3H91 A;  1I4P A;  1X56 A;  3FP9 A;  3ULP A;  4JI2 L;  2EJG C;  4FYD A;  3R93 A;  1KNA A;  4NKL A;  1PMR A;  2NN6 H;  5C44 B;  2BDN A;  1O7I A;  4RHS A;  2N55 A;  2Z9H A;  2JK8 A;  4WJ3 M;  3CCR A;  1FL0 A;  3J7A F;  1WOC A;  4ULL A;  1CUK A;  2QW7 A;  1H9R A;  1TWF H;  2A6H D;  2XWB B;  4J6H A;  5GAD C;  2B63 B;  4A3D B;  2Q2U A;  3F2U A;  1RDP D;  4FF3 A;  4DR6 L;  3M7G A;  2WAQ B;  4OO1 H;  3UE0 A;  1YNN C;  5CBA E;  4BY7 H;  2SOB A;  4BXX G;  3PUW A;  4HCE A;  2BH8 A;  4BBS H;  2YTV A;  5FLX c;  3H94 A;  1SNO A;  2HD3 A;  4FXG C;  3D3R A;  3HOV H;  5K36 G;  3KLR A;  3NBH A;  4JI5 L;  4HSV A;  3CCJ A;  2EIF A;  4RGN A;  4EX5 A;  3QJY A;  4POG A;  2JA7 B;  3BG3 A;  5IWA L;  3C1F A;  2RF4 A;  1EU3 A;  2XN9 C;  3BJU A;  1FNW A;  3VR5 A;  2EY1 A;  1K3B C;  4FXD A;  1N33 L;  1L2F A;  2CH4 A;  4GLA C;  4A3M G;  4B9W A;  4HJ5 A;  1PFM A;  1QUQ B;  2BA1 A;  1ZXT A;  2Q8T A;  3BZC A;  1L1O C;  1M1K C;  2R92 G;  3KF6 B;  4LK1 C;  5COR A;  5ELB A;  1ML0 D;  2D0P A;  3TS0 A;  4MTN A;  2K5V A;  3FKI H;  1B8A A;  1G8Z D;  2O5J C;  4BY7 G;  4BXX H;  3AB9 A;  1EYG A;  3EVQ A;  4A3B G;  4KJN A;  3T4A C;  5IYC G;  3HOZ B;  4F7X A;  4JI8 L;  1IL8 A;  1A3V A;  1CSP A;  2R7Z H;  1OXU A;  4FF4 A;  4KHP Q;  2A5H A;  3CCL A;  4RA8 A;  2EE1 A;  5A2Q L;  4K0K Q;  3HOZ G;  4B9X A;  1F9S A;  2ENB A;  2I5H A;  2RSO A;  5D3I B;  1TQO A;  5HY6 A;  3SHL A;  2KED A;  3EN2 A;  1HQM C;  3KBX A;  4HAE A;  3GTO H;  4IUR A;  4LW1 A;  5IGF A;  1HPC A;  4DR7 L;  3GTL B;  5KIX A;  4FP5 D;  2L12 A;  3M85 A;  1IW7 C;  2B63 G;  3LWE A;  3L3O C;  2Z4I A;  3VR2 A;  2QEX A;  3P20 A;  1CA6 A;  2QEJ C;  2TMP A;  2OF1 A;  1BBX C;  3W1B A;  4X65 Q;  2K04 A;  4C2M B;  1LTB D;  4DA2 A;  4LFA Q;  4A93 H;  4PMC A;  2BCO A;  1V1O A;  3CC4 A;  1ESR A;  4K2L A;  1KXL A;  2JA7 G;  1M8A A;  5CV7 A;  4C3H B;  4UDU C;  1LAC A;  3CCQ A;  1HCZ A;  3H0G B;  5C5L A;  4V0B A;  1V1P B;  2YV5 A;  4LF4 L;  4HN7 A;  2B2U C;  4GKJ L;  1LLR D;  5FLX L;  4BA2 I;  1ENC A;  3VYS A;  1AW7 A;  1VQP A;  2F0H A;  4UPA A;  4OWT B;  4LF9 L;  2PI2 E;  1BO0 A;  4GN3 B;  3X3M A;  4DV5 L;  3RZO B;  3Q0A A;  5J22 A;  4IN3 A;  3DWA A;  3L7Z C;  3CXC A;  1UNS A;  2C9O A;  4GKJ Q;  5C4H A;  3J7A 5;  1WYD A;  4CJ0 B;  1AH9 A;  1D5X C;  2AWN A;  1L0Y B;  3PUX A;  4IAL A;  1SNQ A;  3I8Z A;  1YNN D;  4GOP A;  1GUN A;  2ZJQ A;  3P1H A;  3UI2 A;  2K52 A;  2SNS A;  3MEF A;  4DV2 L;  1PVO A;  3G4S A;  1KHI A;  1AN8 A;  3GV3 A;  3D31 A;  5BN5 A;  3T1Y L;  1J5E Q;  1B44 D;  5BR8 Q;  1X3G A;  1EZ8 A;  4RKL A;  2N78 A;  4DUY L;  2K5Q A;  3PIO A;  1C4Q A;  3WWV A;  3PIP A;  1VCI A;  2MO1 A;  1YZ6 A;  3HOV B;  4QCL A;  4Y7N B;  4IUQ A;  3KDF B;  5ELC A;  3OIP A;  3UDI A;  5M3F B;  4GNX B;  1EIH A;  4YHH Q;  4HMJ A;  4JI1 Q;  1KQS A;  4F88 A;  1EWC A;  1PHJ A;  2K05 A;  1N36 Q;  1EWH A;  2ZTC A;  1EEF D;  1K8O A;  1U4M A;  2SEB D;  1UE1 A;  3KF6 A;  2EYJ A;  4UAI A;  1TY0 A;  3D8G A;  4R8N A;  4ZQ3 A;  1U5K A;  3MC0 B;  4EQ5 A;  3PIO 3;  4IOC A;  4UP9 A;  4DXG A;  5IIF A;  4DAY B;  2CFM A;  1QVF A;  5FLM G;  4A3F B;  2FMM A;  1KAW A;  3DWQ A;  4LF8 L;  2EZV A;  3URY A;  3M7N A;  2ZXR A;  4PZ6 A;  1SMY D;  2CW0 C;  4CJ1 B;  2XRQ D;  2CCZ A;  4EQO A;  4QIW E;  1BCP D;  5E1F A;  2KCT A;  1TS2 A;  1Q1E A;  5ELD A;  4XT1 B;  3I56 A;  3H09 A;  3CHB D;  3M4O H;  3PMF A;  1K3R A;  2B3G A;  1LTL A;  1F2Y A;  4DV0 L;  4POF A;  3L2P A;  4X66 L;  4DV6 L;  4A3E G;  1HHV A;  3QR8 A;  1Z9F A;  3EFX D;  2WAQ G;  5T1I A;  4PZ8 A;  1JR0 D;  1X32 A;  4ZK9 B;  1TU2 B;  2B8G A;  1A6X A;  4K5X A;  3CRL C;  4BBR G;  3GO5 A;  3D6W A;  4JBW A;  4HID A;  3K5L A;  1EIY B;  1VS0 A;  5EKK A;  2ZJR A;  1HZ9 A;  4M1U B;  1MSH A;  4AQY L;  4N8X 1;  3A5Z B;  2KEE A;  1Y1V G;  5IE8 A;  1XNR L;  4CDC C;  1XPR A;  4KK7 A;  2JN4 A;  1YBY A;  2AUK A;  3J81 L;  4DNR B;  1Y8N B;  5K5P A;  3V96 A;  2NVQ B;  1TWH B;  1FYC A;  2AWO A;  1TY2 A;  1NCV A;  3S1R B;  5KYI A;  3NBI A;  2RA4 A;  3HP3 A;  4HJA A;  4KD3 A;  3CKI B;  5DLQ E;  4XQQ A;  3B6Y A;  2BOS A;  2PPB C;  1EY5 A;  4C3I B;  3T56 B;  1U9R A;  5JJL A;  3QG1 A;  4KKU A;  1IW7 D;  1PH5 A;  1SE3 A;  2WB1 E;  4H13 C;  4DV3 L;  4A3B B;  2K14 A;  1S5B D;  3J81 j;  1HFG A;  1BOS A;  4PMW A;  3PO2 B;  3SGI A;  3PO2 H;  3ITP A;  3VR3 A;  4OO1 I;  3OOC A;  1II3 A;  1KLG D;  1NMG A;  2A69 C;  1YNX A;  4UY8 C;  3QOJ A;  2RBM A;  3RR5 A;  3A54 A;  3K81 C;  4ZKC B;  4CHT B;  3S24 A;  2JJQ A;  1TWA H;  4DR4 Q;  4AYB E;  3K80 C;  1GOZ A;  2KCN A;  2PNH A;  1J5E L;  5C3W A;  4Q0F A;  4B3M Q;  2R93 G;  2VY3 A;  5C4J H;  4QQB X;  5IYD H;  1JWS D;  1RCV D;  1BBW A;  4XYQ A;  2E2H H;  5M5W B;  2XIW A;  1U4P A;  1ICW A;  4JYA L;  2VQE L;  2MNA A;  1M90 C;  3HOW B;  3MEH A;  1RTN A;  1CFM A;  1CZG A;  4FF1 A;  4KKS A;  3S17 B;  1EQT A;  1PH4 A;  2PW7 A;  2IWH A;  4IUN A;  3VYT A;  5GRO A;  3G71 A;  4K5W A;  3BDO A;  1UE5 A;  3EJI A;  5C4J B;  2JA6 G;  4R4O A;  3LGJ A;  4YY3 L;  3A55 A;  4L6T B;  2MJ8 A;  1GUW A;  2NVX H;  2A6E C;  3HOU G;  5CC4 A;  2RDF A;  4RWS C;  4A3L H;  5AJ3 Q;  4O0A A;  3CCU A;  1O7Z A;  1XNR Q;  1ZYR C;  5IGB A;  2F0W A;  5GAE C;  1BDO A;  3IFT A;  4PV1 C;  4LF5 L;  2HHH L;  3S1Q H;  1NY4 A;  5NUC A;  2I0Q A;  3HOY B;  4RKB A;  1PRT B;  3M4O B;  3HKS A;  1VQ4 A;  2ICI A;  2O4X A;  1PLF A;  4PMB A;  3BZD B;  3OW7 A;  1JJ2 A;  2NVY B;  1DXM A;  1I4X A;  4O2D A;  2L5T A;  5JEA H;  5C44 H;  3TEH B;  3VR4 A;  3S1N B;  4DUZ Q;  5FJ8 G;  4GN5 A;  3K57 A;  3J81 E;  3DWP A;  1R4P B;  3I7F A;  3U9S A;  4OIJ A;  4QF4 A;  4R8I A;  3G7L A;  2L4N A;  4LF5 Q;  4DK3 C;  3MZ5 A;  1SXT A;  3JAM E;  3NTK A;  4LUZ A;  1JOQ A;  1A3T A;  2G9D A;  2JA8 G;  4YWK A;  4P2C B;  5G3L F;  1TWG B;  3K0X A;  3H3V I;  4FVM A;  1FNV A;  2UXD Q;  2NZO A;  3AU7 A;  1EEI D;  1GUG A;  1B9M A;  4LFC L;  3RUZ A;  4PZ7 A;  4XT3 B;  3FDT A;  4A3K B;  1QUQ A;  1J8I A;  2EY5 A;  2CH4 W;  3GTQ H;  2UXC L;  3D4D A;  3ERS X;  2KJX A;  1JJC B;  3NQI A;  4BBR B;  1X3P A;  5IGG A;  4LF9 Q;  3ND9 A;  4R4C A;  3PV0 A;  2ZTD A;  1TWC H;  3BVM A;  3HKZ B;  3P75 A;  1BVS A;  1CTM A;  3PO2 G;  1BXT A;  2IHE A;  2KOL A;  1VQF A;  4CDD C;  3JAM L;  5CV6 A;  5CV5 A;  5IP7 G;  4ILW A;  3IFD A;  1PH9 A;  1GUS A;  4JI7 Q;  1I3Q B;  1CKN B;  3M4Q A;  1GKH A;  3F1Z A;  1ASY A;  4OHJ A;  2A68 C;  3C3L A;  2R92 H;  4JW0 A;  2OXP A;  2M9V A;  4S3S A;  3G6J B;  2NVQ H;  2CQO A;  1S3O A;  2PZU A;  4K8J A;  3CQZ B;  1HQR D;  4QJF A;  2KCC A;  4DR3 L;  3JC6 6;  1LYL A;  1PZJ D;  2WAQ E;  1STG A;  4Q5V A;  2I5L X;  2NUC A;  3GTK H;  3TBI B;  2E2H B;  4IUV A;  2ZXP A;  4KN7 C;  2V4D A;  3I91 A;  2A19 A;  2IW3 A;  1VDZ A;  3X3N A;  1VQJ A;  1G2T A;  1MGS A;  3M4Y A;  4LFB L;  4QIW B;  1SAP A;  2Y0S G;  3FPP A;  5JPM C;  3O13 A;  1Y1V B;  1E2V A;  4A76 A;  4I65 A;  4KLK A;  1L0X B;  1PTO F;  1QB5 D;  3RZD H;  4IFD J;  1IYU A;  3RNU A;  1SLJ A;  1MJC A;  3BU2 A;  3STB D;  3OMC A;  4IUP A;  1K83 B;  3MHB A;  1I50 B;  5FO9 B;  3BVZ A;  4IPG A;  1X3E A;  3I4M H;  2EYH A;  3ERO A;  4JG2 A;  3ER0 A;  3CRK C;  5M3F G;  3M3Y H;  4X3T A;  2DY8 A;  2ZTE A;  2DNE A;  2WB1 B;  1LTS D;  2OQ0 A;  4GNX C;  4YCV A;  1JQY D;  1BCP B;  1Q3L A;  1KDB A;  1AFP A;  3T16 A;  1WCM H;  4XTC S;  4QL5 A;  5FLX E;  1DD2 A;  1YVC A;  3ND8 A;  3CCS A;  1EY8 A;  2QA4 A;  1CKO A;  5M5Y H;  3TRE A;  4DV4 Q;  1IXR A;  4KV6 A;  3Q22 A;  2R7D A;  3PUV A;  4C3I H;  1FJG L;  3BDL A;  4JI2 Q;  1I4Q A;  2KCM A;  5IGE A;  2AUJ D;  4JI6 Q;  2Z6B A;  3CCE A;  4BA1 I;  5LMN L;  1XNQ L;  1J9O A;  4WRD A;  3D4W A;  1QZH A;  5ELN A;  1I4G A;  4EGV A;  3GTJ B;  4B3S L;  3I73 A;  1V43 A;  4F8M A;  1VQ5 A;  2UUA L;  2DN8 A;  2O2L D;  3NWT A;  4K0K L;  3TN2 A;  1Q90 A;  4AYB G;  4P73 A;  2K03 A;  3NEL A;  1VQI A;  1VQ8 A;  1PTO D;  3KJO A;  1HNX Q;  2KEN A;  3UDX A;  3Q6S A;  3T1Y Q;  1K73 C;  2L9H A;  3J81 c;  4J8Q A;  1VQ9 A;  1ROD A;  5KEE A;  2MGS A;  4C3I G;  2PI2 A;  2G9H D;  2EOT A;  4P71 A;  2VL6 A;  1QVC A;  1WTW A;  5A35 A;  1WTQ A;  1LO5 D;  3HKZ G;  5D14 A;  4YHH L;  2K5W A;  2AQ2 B;  4E6I A;  1ZEQ X;  2L15 A;  3CP0 A;  2OTJ A;  2VB3 X;  4HIO A;  1CQV A;  1JOO A;  2LS0 1;  4QGU A;  2I46 A;  2F1M A;  1YHB A;  4K6D A;  1Y1W H;  3CQZ H;  1X6O A;  1WVL A;  4OX9 L;  4BY1 H;  2E2I B;  2K5N A;  5FOB B;  4DR7 Q;  3AFP A;  2K33 A;  1XX8 A;  3CMA A;  2YYZ A;  1FNU A;  3U58 A;  2YU9 B;  4A93 B;  2XTI A;  3V2T A;  1UEB A;  2B2Y C;  4DV3 Q;  4JPB W;  4NPS A;  3KLS X;  2VB2 X;  3ERQ A;  1UE6 A;  4FXK C;  3A8J E;  4BBS B;  1B1Z A;  3SK6 A;  4DK0 A;  1ENF A;  1STN A;  3R2T A;  1TR5 A;  2Q2I A;  4DU9 A;  2L55 A;  2EJM A;  2ZXO A;  3MFG A;  5M3M G;  1YJ9 A;  2F0M A;  1JOK A;  3GTL H;  5M3F H;  1HUM A;  3DHQ A;  4WJ4 A;  1WCM B;  3SXH A;  1FJG Q;  1C0A A;  3KFU A;  1GXD C;  2Z1C A;  4QB4 A;  1C9O A;  1E3P A;  1HXY D;  3FMC A;  4EQN A;  2HQE A;  5CYU A;  4A3L G;  1XPO A;  3K5M A;  4TKO B;  1YI2 A;  4RCN A;  1WTP A;  1B3A A;  2N8N A;  2UU9 Q;  1BR9 A;  2AKW B;  2HIX A;  1RIP A;  4BWG B;  5I2Y A;  4L5R C;  3RLO A;  4DN4 M;  4H02 A;  4AH6 A;  1A15 A;  2B2T A;  4DNI A;  5I4D A;  4DAV A;  1Q1B A;  2HCI A;  4LFA L;  1L1O B;  1OTC A;  1HRJ A;  3NTH A;  1PH8 A;  3VA5 A;  5I6W A;  1PRT D;  1X65 A;  1H9M A;  2E75 C;  3NXW A;  1HTP A;  3U4Z A;  1RHP A;  5E4W C;  4NXM L;  2D0O A;  4DNT B;  2E2D C;  1EYD A;  3SVM A;  3S2H B;  3H3V C;  2D9U A;  4QUC A;  5AJ3 L;  3OYY A;  3AQQ A;  5IP7 H;  1PZI D;  2NTS A;  5C4Z A;  3R3O A;  3CD6 A;  1EOV A;  2IPK D;  4A3D G;  1SR3 A;  2G5D A;  5BR8 L;  1DGS A;  2B8F A;  4DR6 Q;  2IT1 A;  3PO3 B;  1T5E A;  4TRD A;  3IKJ A;  4XIG S;  1G2S A;  2FIN B;  1Q7Y C;  3CU7 A;  1G29 1;  1NUC A;  3CPF A;  5C3E H;  1J6Q A;  4BBS G;  2BE5 C;  1K8A C;  4BY7 B;  4R4I A;  4NXN L;  1F77 A;  1MBY A;  4A3E H;  2N3S A;  4ZAI A;  4CGY B;  2KEC A;  5EPK A;  3DLL A;  4OX9 Q;  4JI0 L;  2JA7 H;  4B3T L;  3AYH B;  3J81 i;  4C3J H;  1YJN A;  4DKA C;  2MPM A;  1VMP A;  1EQQ A;  2O5I C;  4A3J G;  2F0J A;  3OHX C;  4A3M B;  1TWA B;  1SFO H;  4GS3 A;  4ZRZ A;  3WOF A;  3HOX H;  1DOM A;  1VMC A;  3PUZ A;  3Q24 A;  4IOA A;  4MTK A;  2HQL A;  4JBM A;  3I4M G;  1A62 A;  2QGQ A;  4IUU A;  1A63 A;  4MZ9 A;  5IY0 A;  1N32 L;  3K59 A;  2RHQ B;  3NE5 B;  2MO0 A;  3ULL A;  1A0I A;  2IHF A;  3NSW A;  3I4M B;  3S2D H;  2F0G A;  4JI8 Q;  1B50 A;  1I50 H;  4ZKB B;  4DV1 Q;  1X55 A;  4X62 L;  3EA6 A;  3I4N G;  1ICF B;  2UXD L;  4QMG A;  1ENA A;  4CKC A;  4LFC Q;  2K7V A;  1PH2 A;  2E74 C;  3VDY A;  2UXB L;  1S5E D;  3HGB A;  2NVX B;  3CCM A;  2N88 A;  1KTK A;  4UP8 A;  2QKI C;  4DV6 Q;  3RN2 A;  3EQL C;  2F4V Q;  1K8G A;  1N34 Q;  2EDG A;  4A3F G;  3HOX G;  1LTT D;  2NVY H;  1E1O A;  2F0U A;  1CM9 A;  3MXU A;  3DEP A;  2R3Z A;  1EIF A;  3A0J A;  2KVM A;  4PNY A;  3SR1 A;  1VQ7 A;  4A4I A;  4JI3 Q;  4R4Q A;  3T13 A;  1FVI A;  1EIG A;  3J80 i;  1KDC A;  2DGY A;  4DXF A;  3RLF A;  4L5S A;  1V1Q A;  2R93 H;  2FFK B;  2WP8 J;  4A3I G;  2F0D A;  4UHV A;  4XQN A;  3SK5 A;  5I9O A;  4DR5 L;  3PO3 H;  5JEA J;  4ABN A;  5M9O A;  4DR3 Q;  4ME5 A;  4LFB Q;  1JMC A;  2GN5 A;  1JB3 A;  1I4H A;  2VXW A;  2PO4 A;  4GNX A;  2F0T A;  1XPU A;  1WD1 A;  4H44 C;  3K5N A;  1WFQ A;  1HJP A;  4KKT A;  2ES2 A;  5FKA C;  1EFI D;  4NMZ A;  2LMC B;  4RCO A;  3GTM B;  1KAA A;  3T53 B;  1HR0 L;  3NHH A;  1RKN A;  2Z4H A;  4L8J A;  1JE4 A;  5E3F A;  3KYH C;  4C1N I;  1CQF A;  1QOH A;  4V19 0;  4RMF A;  1WI5 A;  1DYQ A;  1STB A;  1VF5 C;  1CSQ A;  5JPN C;  1B53 A;  3M4P A;  5LMN Q;  1YEZ A;  5EKL A;  5JJZ A;  5IT9 L;  5K36 H;  5ISR A;  4HJ7 A;  3A56 A;  2E2J B;  1KL9 A;  1ZYR D;  1Z7T A;  5KNC A;  4X3S A;  1DM0 B;  4G57 A;  1SYD A;  1PV4 A;  3H15 A;  1HR0 Q;  2XSC A;  4QUF A;  4GZY C;  1E0B A;  4N8F A;  3SK8 A;  2EPB A;  2NZH A;  3K6O A;  2HHH Q;  4YWL A;  1SNM A;  3LNN A;  4B3M L;  4JI5 Q;  5EPL A;  3PF4 A;  5IP9 G;  2LXK A;  4KN4 C;  5M3M B;  1JE5 A;  3OTO L;  4DR2 L;  1LTI D;  1VQO A;  3VA7 A;  4JI6 L;  3OPO A;  1E7Z A;  4X64 Q;  5G3L D;  4JYA Q;  2L0C A;  5IT9 E;  1GUT A;  5IGC A;  3C2P A;  3FPU B;  3R8B A;  2WII B;  4AYB B;  4WOR A;  2RKS A;  2B2W A;  5COY A;  3K7U C;  2HUG A;  2ASB A;  1TS3 A;  2MFI A;  3N52 A;  3K8A A;  4AIM A;  5IGD A;  5M5X B;  2R7Z G;  2WIN B;  1IHZ A;  1Q8K A;  4BY1 B;  3OTO Q;  4DR2 Q;  2FMC A;  3S17 H;  3STB C;  1A3U A;  3CCV A;  2VUM H;  2F03 A;  1E1T A;  1A8V A;  2A69 D;  2UXC Q;  2VZA A;  3E0J A;  1PTO B;  2NZ1 D;  2GVB A;  1X3Q A;  2XNA C;  2JA6 H;  5IP9 H;  1Q12 A;  2ATW A;  3U50 C;  1I6V C;  5ELO A;  4P72 A;  1N33 Q;  1OXX K;  4LJZ C;  2JA5 G;  1TT2 A;  1LAB A;  3RZO H;  1U4L A;  4FO2 A;  3J7A V;  4IPH A;  3A8I E;  2AQ1 B;  2JSO A;  4QY7 A;  1IKL A;  4B3S Q;  5EKI A;  1BKB A;  1WTH A;  1SRO A;  2UUA Q;  2B2W C;  1CHQ D;  4CBV A;  3GP7 A;  2JXM B;  2K28 A;  4XDX A;  1KLU D;  2Q2T A;  4IQZ A;  5DEH A;  5C44 G;  4LAA A;  1K8M A;  3OSO A;  1PH1 A;  3C1E A;  1R9T H;  2WAC A;  1HNW Q;  4A3F H;  2CVR A;  4K8I A;  3NUC A;  4U67 3;  1IBK Q;  3KF8 B;  4C3J G;  1FGU A;  1A2U A;  1G91 A;  1PZK D;  1KRS A;  3RMH A;  3HG9 A;  3G6E A;  3K7A B;  1EQV A;  3WOE A;  3BZK A;  2JA5 H;  4C3J B;  4KTA A;  1E24 A;  5JJI A;  1B2T A;  1YNJ C;  2CKZ B;  1JC7 A;  3CPW A;  2K32 A;  5ELF A;  5KRU A;  2E5L Q;  5M5Y B;  1W6J A;  3R2I A;  3IAY A;  1BQQ T;  1GVP A;  1YNJ D;  2F0P A;  4FF2 A;  4I7A A;  3FRP B;  3E5S A;  4RGM A;  1XTC D;  3HZX A;  4YCW A;  1D6E C;  3W3A A;  1Q8I A;  2CHB D;  4HTH A;  5C3E B;  2WB1 G;  2SNM A;  3A7L A;  3TME A;  3BYT B;  3I90 A;  3P7J A;  3M3Y B;  4DR5 Q;  3DM3 A;  2F0I A;  4BS9 A;  1EY6 A;  1E2Z A;  2ZM6 L;  3W5O A;  1XMQ Q;  1W3S A;  2IX1 A;  3DUZ A;  1RJT A;  4DK6 C;  5L37 A;  5CV8 A;  1G51 A;  1SJH D;  2EXZ A;  1SEB D;  1SYG A;  5HGQ A;  5C0X I;  1PH3 A;  3HOV G;  1Y1V H;  2PNR C;  3F2D A;  4HCS A;  3T1H L;  1HZC A;  4JBJ A;  4XYO A;  1HNZ L;  4A3G B;  4DUY Q;  2F0O A;  1L0W A;  1LTG D;  5I2X A;  5IT9 c;  5IOD A;  5LMU Q;  2PQE A;  2K5D A;  3CW2 C;  4HJ9 A;  2VQE Q;  3PCO B;  1JWM D;  5LL6 S;  1CK1 A;  4DV7 L;  3SK4 A;  1I94 L;  1SYC A;  2R61 A;  4CDE C;  1KD1 C;  2B2V A;  3MXP A;  1AP0 A;  1D1I A;  2K5H A;  5CBE E;  4MHE A;  1BCP F;  1R4Q B;  3A5U A;  2DNC A;  2Q8I B;  1D1K A;  4MNO A;  2B2Y A;  4HR7 B;  3TZD A;  2H5X A;  2A8V A;  3K7A H;  4OWX B;  3GTG H;  2R7F A;  4HED A;  5EBD A;  2F0V A;  1UAP A;  1HA6 A;  5DAU A;  3UDG A;  3WDN A;  1VQN A;  1HUN A;  1WCM G;  4WFN 3;  1HA5 A;  3RN5 A;  4HJ8 A;  4HMI A;  4DR1 L;  4O42 A;  4IFD G;  3HFZ B;  2J7Z A;  4C3H H;  3I72 A;  4DFA A;  3GTJ H;  4NXM Q;  4A3I B;  1SMY C;  2CW0 D;  1EZ6 A;  1VF7 A;  1PXU A;  1OXS C;  4Y7N H;  1JJG A;  2JA5 B;  2Z0S A;  4IPC A;  1VQ6 A;  3OWF A;  1Y8O B;  4C2M H;  2JYO A;  5EBC A;  4KJO A;  1CKN A;  1EUJ A;  1K83 H;  1NE3 A;  2LKV A;  2X6G A;  1QNU A;  2EQS A;  2DUD A; 
#chains in the Genus database with same CATH homology
 2CFM A;  4AH6 A;  5FLM G;  1VQD A;  1W2B A;  1QVF A;  4DNI A;  1KAW A;  1VQA A;  4LF8 L;  4X65 L;  1Q1B A;  3AEV A;  4LUO A;  4LFA L;  3M7N A;  1L1O B;  1AE2 A;  2N49 A;  1VQB A;  3NBH B;  4PZ6 A;  5C0X J;  1OTC A;  2VUM G;  2NN6 G;  2NVT H;  2CCZ A;  1IBM Q;  1PH8 A;  3F2B A;  4J15 A;  2IY5 B;  2ID0 A;  4QIW E;  4LUV A;  3PSI A;  4NB3 A;  1X65 A;  2KCT A;  3NEN A;  2RCN A;  2HIV A;  4JV5 L;  4A3G H;  1Q1E A;  1PYB A;  3U4Z A;  3I56 A;  2D62 A;  3M4O H;  4NXM L;  2B29 A;  2D0O A;  4IFD I;  4AQY Q;  1K3R A;  2B3G A;  4GOP C;  1I5F A;  5LMU L;  4A3J H;  1LTL A;  1P16 A;  1XMO L;  2UUC Q;  4DV0 L;  2EXD A;  3HOZ H;  4POF A;  1VQC A;  2JQO A;  3A74 A;  3ZJY C;  3L2P A;  4X66 L;  3H0G G;  4DV6 L;  4A3E G;  2OWO A;  2YTY A;  5AJ3 L;  3OYY A;  3AQQ A;  5IP7 H;  1Z9F A;  2WAQ G;  4PZ8 A;  3CD6 A;  5M5X H;  1EOV A;  1GD7 A;  3I2Z A;  3T1H Q;  1SR3 A;  5BR8 L;  1YHQ A;  4LNQ A;  4A3D G;  2AMC B;  2PMZ E;  1DGS A;  4IJL A;  4DR6 Q;  4UP7 A;  4BBR G;  4OO1 G;  2IT1 A;  3GO5 A;  4JBW A;  4HID A;  4OXP A;  4YY3 Q;  4XIG S;  3E9H A;  1Q7Y C;  1IBL Q;  5C3E H;  1G29 1;  1VS0 A;  3CPF A;  2ZJR A;  1HZ9 A;  4AQY L;  1Q86 C;  3HOU H;  1VQG A;  1J6Q A;  4BBS G;  3A5Z B;  4A3C H;  1D7Q A;  2NN6 I;  1Y1V G;  1K8A C;  1GM5 A;  5IE8 A;  1AE3 A;  4R4I A;  4NXN L;  3U4V A;  2OCE A;  3H0G H;  2N3S A;  4A3E H;  1XNR L;  1S40 A;  1XPR A;  4DUZ L;  1YBY A;  1HNZ Q;  2UUB L;  5GAH C;  2HT1 A;  3EBE A;  2OTL A;  4B3R L;  4A93 G;  3HOW H;  1B7Y B;  4DV4 L;  4A3D H;  3DLL A;  4OX9 Q;  2A1A A;  4JI0 L;  2B63 H;  2JA7 H;  4B3T L;  3F8T A;  5M5W H;  3AYH B;  3J81 i;  4C3J H;  1YJN A;  4DKA C;  2AWO A;  2JEA I;  3IRB A;  3F2C A;  1EQQ A;  2VQF L;  2VW9 A;  4A3J G;  4HJA A;  1I3Q H;  4LF4 Q;  4GLX A;  5DLQ E;  3B6Y A;  5IYB H;  1TWG H;  1SFO H;  2F4V L;  4BY1 G;  4GS3 A;  4GKK L;  3HOX H;  2E8G A;  1RL2 A;  3PUZ A;  5E7N A;  2PQA B;  5IYD G;  5JJL A;  4IOA A;  4X62 Q;  2JEB I;  2HQL A;  4JBM A;  2R6G A;  2ALY B;  1PH5 A;  4JCV E;  1K0R A;  2IX0 A;  1N36 L;  3I4M G;  1A62 A;  2QGQ A;  2WB1 E;  3ULJ A;  4DV3 L;  1QZG A;  1NJI C;  4MZ9 A;  1A63 A;  2K14 A;  2Q2H A;  5IY0 A;  5C3E G;  3S1N H;  3S16 H;  1BBU A;  1VQE A;  1SE8 A;  2K75 A;  1OXT A;  2LSS A;  3AFQ A;  3J81 j;  4DR4 L;  5IYC H;  1N32 L;  4PMW A;  2RHQ B;  3SGI A;  3GTM H;  3PO2 H;  4JOI C;  1MIU A;  3KJP A;  4OO1 I;  3E9I A;  4OON A;  2MO0 A;  3ULL A;  2UUB Q;  1A0I A;  4B3R Q;  2IHF A;  4GKK Q;  3S2D H;  4JI8 Q;  1I50 H;  3GDE A;  3HOY H;  1NMG A;  3TRZ A;  1YNX A;  1NBW A;  2F3I A;  4DV1 Q;  4UY8 C;  2FXQ A;  1YIJ A;  1X55 A;  4X62 L;  1X3F A;  3RR5 A;  4A3C G;  2Z6K A;  3W1G A;  3K81 C;  3I4N G;  3J7Z C;  2UXD L;  4LF8 Q;  3S24 A;  4LFC Q;  2JJQ A;  1NTG A;  3VDY A;  1PH2 A;  2UXB L;  1TWA H;  4DR4 Q;  4AYB E;  1SRU A;  3K80 C;  3CCM A;  1X9N A;  1VQH A;  4UP8 A;  4DV6 Q;  3RN2 A;  2PNH A;  5IYB G;  1EQR A;  1K9M C;  1N34 Q;  1J5E L;  1K8G A;  2CWP A;  4A3F G;  3HOX G;  4B3M Q;  4JOI A;  2NVY H;  2BA0 A;  2R93 G;  1E1O A;  2VY3 A;  1E22 A;  4R1J A;  5C4J H;  4QQB X;  3CC7 A;  5LMN W;  1EFW A;  5IYD H;  1BBW A;  4JI4 L;  2E2H H;  1Z47 A;  1EIF A;  3A0J A;  1VQM A;  2BH2 A;  1LUZ A;  1VQ7 A;  2KHI A;  4JYA L;  2VQE L;  2I5M X;  4A4I A;  3KOJ A;  2MNA A;  1M90 C;  1MJE A;  4JI3 Q;  4R4Q A;  5C0X G;  3PF5 A;  1HZA A;  3PGZ A;  1PH4 A;  3S1M H;  1FVI A;  2UXB Q;  3J80 i;  4POG A;  2DGY A;  2PQA A;  4NXN Q;  5C4X H;  3RLF A;  4L5S A;  5GRO A;  1XNQ Q;  1KC8 C;  3G71 A;  1QVG A;  1V1Q A;  2R93 H;  2WP8 J;  1UE5 A;  2WFW A;  4A3I G;  3CAM A;  2MQH A;  5EAY A;  2JA6 G;  4DR5 L;  4DV1 L;  1HR0 W;  3PO3 H;  1Q81 C;  4R4O A;  4JI4 Q;  3LGJ A;  4YY3 L;  3Q8D A;  5J3B A;  2YTX A;  3I4N H;  3OW2 A;  5JEA J;  2NVX H;  4A75 A;  4DR3 Q;  4LFB Q;  2V1C C;  4IO9 A;  3HOU G;  4A3L H;  2VS1 A;  1LM0 A;  5AJ3 Q;  1HNX L;  1JMC A;  2GN5 A;  3CC2 A;  3H3V H;  4O0A A;  3UE1 A;  3CCU A;  4GNX A;  1XNR Q;  5GAE C;  4L5T A;  5M3M H;  1XPU A;  4LF5 L;  1XJV A;  2HHH L;  3S1Q H;  1GO3 E;  1NY4 A;  4BBR H;  1WFQ A;  4LF6 Q;  2I0Q A;  1HJP A;  4B3T Q;  4YWM A;  1PFS A;  2ZM6 Q;  5JJK A;  2ES2 A;  3M9B A;  3HKS A;  1VQ4 A;  2JA8 H;  1I6H H;  3HKZ E;  1KIX A;  2JA9 A;  3RLN A;  1JJ2 A;  4DPG A;  4A3K H;  4O2D A;  4X64 L;  3CME A;  1HR0 L;  5C44 H;  3TS2 A;  3TEH B;  4RG1 A;  4DUZ Q;  5FJ8 G;  3KYH C;  4GN5 A;  1IBM L;  4RMF A;  1WI5 A;  1WJJ A;  3I7F A;  1CSQ A;  2Y0S E;  1IL2 A;  4KHZ A;  3M4P A;  2E2J H;  3KLW A;  4DK3 C;  5LMN Q;  4LF5 Q;  1YEZ A;  4A3G G;  4HJ7 A;  4LUZ A;  1KL9 A;  2JA8 G;  4YWK A;  1B70 B;  1PA6 A;  2CWA A;  1X56 A;  3FP9 A;  3K0X A;  3ULP A;  1IBK L;  4JI2 L;  3H3V I;  1PV4 A;  2NZO A;  2UXD Q;  5H1S E;  3H15 A;  1O7I A;  2ZJP A;  1HR0 Q;  4LFC L;  1CKM A;  4PZ7 A;  3FKI G;  1QUQ A;  2JK8 A;  4WJ3 M;  3CCR A;  4P74 A;  3PO3 G;  2NZH A;  1FL0 A;  4IPD A;  2HHH Q;  1WOC A;  3GTQ H;  4A3B H;  4YWL A;  1CUK A;  3ERS X;  1TWF H;  2UXC L;  5GAD C;  1JJC B;  4B3M L;  2Q2U A;  4JI5 Q;  1IZ6 A;  1EWI A;  3PF4 A;  3HOY G;  4LF9 Q;  4DR6 L;  5IP9 G;  2F4V Q;  4R4C A;  3PV0 A;  2LXK A;  3UE0 A;  2ZTD A;  1JE5 A;  3OTO L;  4DR2 L;  1VQO A;  1TWC H;  2VNU D;  1SN8 A;  1BVS A;  4JI6 L;  4X64 Q;  1E7Z A;  4JYA Q;  3PO2 G;  2IHE A;  4BY7 H;  1VQF A;  3FHW A;  4BXX G;  1T9H A;  3PUW A;  1Y14 B;  1VQK A;  5IP7 G;  4BBS H;  2BH8 A;  2YTV A;  5FLX c;  4A3M H;  1S72 A;  1PH9 A;  4JI7 Q;  1CKN B;  3M4Q A;  2UU9 L;  4GLV B;  1Q82 C;  1GKH A;  3F1Z A;  3HOV H;  1ASY A;  3S1R H;  3K7U C;  1X54 A;  2R92 H;  5K36 G;  2ASB A;  2R7Z G;  1L1O A;  2MFI A;  3K8A A;  4JI5 L;  4AIM A;  3CCJ A;  1YIT A;  2E5L L;  4LF7 Q;  3G48 A;  1HZB A;  1TWH H;  2EIF A;  2LXJ A;  4EX5 A;  5GAG C;  1XMQ L;  1Q8K A;  2CQO A;  5IWA L;  3OTO Q;  1S3O A;  1U0L A;  3BJU A;  2RF4 A;  2F52 A;  4DR2 Q;  4QJF A;  3S17 H;  3STB C;  1N33 L;  3CCV A;  4DR3 L;  1L2F A;  1LYL A;  2WAQ E;  1YHA A;  1XTD A;  3JC6 6;  4GLA C;  4A3M G;  2VUM H;  1E1T A;  4HJ5 A;  3HOW G;  2I5L X;  1A8V A;  1QUQ B;  3NEM A;  2BA1 A;  3GTK H;  1P8L A;  2UXC Q;  3BZC A;  1L1O C;  2VZA A;  1M1K C;  1Y1W G;  2R92 G;  3KF6 B;  2A19 A;  2GVB A;  2C35 B;  2K50 A;  4DV5 Q;  1ASZ A;  2JA6 H;  1C7Y A;  5IP9 H;  1VQJ A;  4JI3 L;  2D0P A;  1Q12 A;  1N9W A;  2ATW A;  3D0F A;  3U50 C;  2EQS A;  3TS0 A;  4MTN A;  4TQU S;  4LFB L;  3E0E A;  2K5V A;  3FKI H;  2Y0S G;  1B8A A;  5ELO A;  4BY7 G;  2RHS B;  4BXX H;  4A76 A;  1EYG A;  4P72 A;  4KLK A;  1N33 Q;  1OXX K;  1VQL A;  4A3B G;  2JA5 G;  1I94 Q;  5IYC G;  3RZD H;  4IFD J;  3RNU A;  3RZO H;  1SLJ A;  1MJC A;  3BU2 A;  4JI8 L;  3STB D;  4LF6 L;  2OQK A;  1KRT A;  4IPH A;  4QY7 A;  2JE6 I;  4B3S Q;  1CSP A;  1X3E A;  4IPG A;  1OXU A;  2R7Z H;  1BKB A;  1YJW A;  3I4M H;  4KHP Q;  1SRO A;  3I4O A;  4JG2 A;  2UUA Q;  3CCL A;  3ER0 A;  4JI1 L;  5M3F G;  3M3Y H;  4K0K Q;  2ZTE A;  3HOZ G;  1XMO Q;  2UUC L;  4GOP B;  2I5H A;  4DV7 Q;  2OQ0 A;  3ICE A;  4GNX C;  2Q2T A;  4YCV A;  4JC0 A;  5C44 G;  5HY6 A;  1UE7 A;  3EN2 A;  3GTO H;  5GQO A;  1PH1 A;  1UWV A;  1WCM H;  4LW1 A;  4XTC S;  4QL5 A;  4DAM A;  3J80 c;  4DR7 L;  1YVC A;  1R9T H;  3CCS A;  2QA4 A;  4DV4 Q;  1CKO A;  5M5Y H;  3TRE A;  4YCU A;  4A3F H;  1IXR A;  1HNW Q;  2R7D A;  3M85 A;  3PUV A;  4C3I H;  2B63 G;  4R4T A;  1FJG L;  4JI2 Q;  3KF8 B;  1IBK Q;  2KCM A;  1FGU A;  2QEX A;  3S14 H;  1H95 A;  1KRS A;  5FJ8 H;  3W1B A;  4X65 Q;  3G6E A;  4JI6 Q;  4OWW B;  4LFA Q;  3CCE A;  4BA1 I;  3BZK A;  4A93 H;  3EIV A;  4IJH A;  3JAM i;  2JA5 H;  5LMN L;  1XNQ L;  3CC4 A;  3GTP H;  1E24 A;  1QZH A;  5JJI A;  1KXL A;  2JA7 G;  4A3I H;  5ELN A;  4JI0 Q;  2CKZ B;  4B3S L;  1IYJ B;  3CPW A;  3CCQ A;  1V43 A;  4GN4 B;  1VQ5 A;  2UUA L;  2E5L Q;  4K0K L;  1TXY A;  4AYB G;  4P73 A;  1GVP A;  3NEL A;  1VQI A;  1VQ8 A;  4ME3 A;  3KJO A;  2YV5 A;  1HNX Q;  2KEN A;  4LF4 L;  4GKJ L;  5C4X G;  4YCW A;  3UDX A;  2WB1 G;  3T1Y Q;  1K73 C;  4BA2 I;  4JBK A;  3J81 c;  1VQ9 A;  4ALP A;  1VQP A;  4DR5 Q;  4UPA A;  4OWT B;  3DM3 A;  2PI2 E;  4LF9 L;  2ZM6 L;  1MKH A;  1V9P A;  3W5O A;  1XMQ Q;  4GN3 B;  2KHJ A;  3MXN B;  1W3S A;  2PI2 A;  2IX1 A;  2E2I H;  4DAY B;  4DV5 L;  3S15 H;  4HIK A;  1NMF A;  1JB7 A;  3S2H H;  4X6A H;  4DV0 Q;  4A3K G;  4DK6 C;  3L7Z C;  3CXC A;  4P71 A;  1G51 A;  1N32 Q;  3I55 A;  5C0X I;  2VL6 A;  5HGQ A;  4GKJ Q;  1PH3 A;  1QVC A;  3HOV G;  1Y1V H;  1OXV A;  3JAM c;  3F2D A;  3HKZ G;  4JV5 Q;  1JT8 A;  4APV A;  1HZC A;  1WYD A;  4JBJ A;  3T1H L;  1HNZ L;  4HIM A;  2AWN A;  2AHO B;  1PH7 A;  1AH9 A;  4DUY Q;  3PUY A;  3PUX A;  1L0W A;  4YHH L;  4DR1 Q;  5IT9 c;  5IWA Q;  2KBN A;  4GOP A;  5LMU Q;  2ZJQ A;  3CP0 A;  2L15 A;  3CW2 C;  2OTJ A;  4HJ9 A;  2VQE Q;  1IBL L;  4TVA B;  2XGT A;  5FLM H;  3PCO B;  4HIO A;  4X66 Q;  2GVA A;  3J7A 5;  2VQF Q;  2K52 A;  3MEF A;  4DV2 L;  4DV7 L;  3G4S A;  1I94 L;  4QGU A;  1PVO A;  1KHI A;  3T1Y L;  3D31 A;  1KD1 C;  1YHB A;  1N34 L;  1J5E Q;  1Y1W H;  3CQZ H;  4Y52 H;  2Z6K C;  1X6O A;  2K5H A;  3L0O A;  5BR8 Q;  1X3G A;  4OX9 L;  3KDF A;  4BY1 H;  4FDB A;  2K5N A;  3A5U A;  4DR7 Q;  2N78 A;  3AFP A;  4DUY L;  3CMA A;  3PIO A;  4KHP L;  3WWV A;  1HNW L;  3PIP A;  2YYZ A;  4MNO A;  1G6P A;  1PH6 A;  2H5X A;  3CF5 A;  3U58 A;  1VCI A;  2MO1 A;  1YZ6 A;  2XTI A;  2A8V A;  1UEB A;  3K7A H;  4DV3 Q;  4NPS A;  3TQY A;  1UE6 A;  4OWX B;  3GTG H;  1HH2 P;  3KDF B;  2R7F A;  4JI7 L;  4KI0 A;  4L5Q A;  2Q2I A;  3UDI A;  3UDG A;  5M3M G;  1VQN A;  4GNX B;  1YJ9 A;  1WCM G;  3UDF A;  4HJ8 A;  3RN5 A;  3GTL H;  5M3F H;  4YHH Q;  4DR1 L;  4JI1 Q;  1KQS A;  3HFZ B;  4LF7 L;  4C3H H;  4IFD G;  3GTJ H;  3RLO A;  1PHJ A;  4NXM Q;  1FJG Q;  1C0A A;  4PG3 A;  3KFU A;  1SMX A;  1N36 Q;  1D8L A;  1C9O A;  1E3P A;  1OXS C;  2ZTC A;  4Y7N H;  4A3L G;  1JJG A;  1XPO A;  1N8R C;  2K4K A;  2Z0S A;  1UE1 A;  3KF6 A;  5JEA G;  4DV2 Q;  4IPC A;  4P75 A;  1VQ6 A;  4WJ4 A;  1YI2 A;  2YU9 H;  2N8N A;  4C2M H;  2AKW B;  2HIX A;  2UU9 Q;  1RIP A;  4LWC A;  1EIY B;  1U5K A;  4EQ5 A;  2NVQ H;  1CKN A;  4IOC A;  4UP9 A;  1EUJ A;  1K83 H;  3GD7 A;  1NE3 A;  4L5R C;  1Q46 A;  1PYS B;  4H02 A;  2DUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...