2PQAA

Crystal structure of full-length human rpa 14/32 heterodimer
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
128
Chain Sequence
RAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the full-length human RPA14/32 complex gives insights into the mechanism of DNA binding and complex formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 128
sequence length 131
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-05-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pqaA00
3RZOH 2XGTA 4EQ5A 1KL9A 4GKKL 2KHJA 3W5OA 5IYDH 3L0OA 1WOCA 2VS1A 2IX0A 1RIPA 2NN6I 5IWAQ 2LSSA 4UP7A 4A3MH 1YHAA 1YNXA 4LF4Q 1JJ2A 1HR0Q 3M3YH 4A3KG 1CSQA 4P74A 3GTQH 2JA6G 1X65A 3GO5A 3PF5A 1N33L 4X64Q 1S40A 3B6YA 2Q2UA 4JBKA 1E7ZA 4JCVE 4DV2L 3DM3A 2YTVA 3STBC 3PIPA 2AMCB 3ERSX 4A3DH 2NZOA 2R7DA 2Z6KA 1EIYB 4BXXG 1PH6A 3KDFA 2K14A 1EQQA 1I94L 2ZJPA 1PHJA 3A74A 1SN8A 2R6GA 5DLQE 4TVAB 4LFAQ 4DK3C 3J81j 1G6PA 4L5QA 2MO0A 4UPAA 1CKOA 2B29A 3HOXH 2UXCQ 1W3SA 4YCUA 4X66L 5HGQA 4A3IH 4C3JH 4JI3L 4GN3B 2E8GA 1N36Q 1OXXK 1VQNA 3CMAA 1J6QA 4NXNQ 2KBNA 3UDFA 1IBML 1IBLQ 3L7ZC 3F8TA 5C44H 1O7IA 2B63G 3PCOB 1YZ6A 2R7ZG 1Q12A 3PV0A 4DAMA 1IZ6A 1UE5A 1IYJB 3G71A 2Z0SA 1CSPA 4ALPA 4R1JA 4IFDJ 2KCTA 1IL2A 3S2DH 4YCVA 4BY7H 3HOYH 3CC4A 4A3FG 4YWKA 4DV6Q 4PG3A 2R93G 4IOCA 4NB3A 4JI1Q 4GNXA 3TREA 2JQOA 4JI2L 1HJPA 3CCRA 1W2BA 4DK6C 3J81i 1K83H 2VZAA 3HKSA 3RN2A 1CUKA 2YTXA 4YHHQ 1EYGA 3I4MG 5M3MG 1X3FA 2C35B 5BR8L 1YEZA 1J5EQ 1VQAA 4H02A 4LF6Q 4RG1A 4A3LH 4A3BH 2I5HA 3KLWA 1V9PA 4GLAC 3I2ZA 1KRSA 1L1OB 1G291 3PO2H 1K9MC 2IT1A 5IYDG 4LF8Q 1VQMA 3BU2A 3CC2A 1VQKA 1JJCB 3ULJA 1KAWA 1NE3A 3PSIA 2QA4A 1YI2A 2JA6H 3MXNB 3J81c 3U58A 3CCUA 1PH4A 3H3VI 2IX1A 1WJJA 4KHPQ 1UE1A 3K7UC 1PVOA 1VQ8A 4JI7Q 4GOPC 3PUYA 1JJGA 4R4IA 4IFDG 2E2IH 2UXDL 2JA9A 4GN4B 2EXDA 3T1HQ 4UY8C 4DUYQ 4IPHA 4JI8Q 3PIOA 4P75A 4JBMA 4JI6L 3AYHB 2MQHA 1XMQQ 2VY3A 1PV4A 4PMWA 4DR1L 4DR3L 1MJEA 4A3DG 3EN2A 4DPGA 1XMOQ 2VQEL 2HHHL 4IOAA 4IFDI 1X56A 2N78A 2F4VQ 1AH9A 3CC7A 4OONA 4NXML 1N32Q 4X65L 1D8LA 1U5KA 1VQIA 4R4OA 1YHQA 1KXLA 1C7YA 5AJ3L 2B63H 3K80C 1YHBA 4X62Q 4JI0Q 3TEHB 1Y1WH 1N34L 4DUZL 3CF5A 2PQAB 4QIWE 3CCLA 4LF9Q 2UUAQ 2R7ZH 4A3CH 4A3IG 3I55A 3F2CA 5M5XH 3F2DA 4OO1I 1E24A 4DV3L 1Q81C 1Q46A 1VCIA 3EBEA 3KFUA 2PMZE 4JC0A 4LUOA 4QL5A 4LFCL 3RN5A 1QZHA 1PYBA 1VQCA 4A3FH 1M1KC 3E9HA 4GLXA 4DKAC 3GTGH 2R93H 3FP9A 2E5LQ 4OWWB 1VQBA 4HIKA 1M90C 5M3FG 4DV0L 4GNXB 2ZTEA 1B8AA 5K36G 2CWPA 1QVFA 3RR5A 1NMFA 5GQOA 1S3OA 2NN6G 3J7A5 1HNWQ 1NBWA 3BZCA 2CKZB 3H3VH 1EQRA 4KHZA 4JOIC 1HZAA 4RMFA 3OYYA 4YY3Q 2XTIA 4LF4L 1LUZA 5FLXc 2B3GA 3S1MH 2DGYA 2YU9H 5JEAJ 4LFBQ 2CFMA 4POGA 4LWCA 3CPFA 3M4OH 1GO3E 1OXVA 4X64L 2A8VA 4A3BG 4A3LG 3KYHC 2VQFQ 5LMNQ 1A62A 4HJ8A 1VQPA 1K73C 1Q82C 3PO3H 4HIOA 3K0XA 1XPRA 3PO2G 1RL2A 4DR7L 3ULLA 4JBWA 4R4TA 1LTLA 3G6EA 2JA5H 1E22A 3CCQA 3DLLA 3KF6A 3MEFA 1XNQQ 1LYLA 5HY6A 2Q2TA 1Y1VH 2WB1G 5EAYA 3J80c 3S16H 1WFQA 2GVAA 3VDYA 3KDFB 3STBD 4JV5Q 4LFAL 1PA6A 1BBUA 1YBYA 2ZM6L 2CQOA 1X9NA 4OXPA 3CD6A 2UXCL 3G48A 3CCEA 4JBJA 4DR6Q 4OWTB 1N36L 1HR0W 4IO9A 1X6OA 4DR2Q 5M5YH 4DV7Q 4HJ7A 1SFOH 1JB7A 3S1NH 1IBLL 1E3PA 1P8LA 2A1AA 3OTOL 4DNIA 4GN5A 5IE8A 1UE7A 1Q8KA 3K8AA 1PH8A 4WJ3M 1VQJA 3OW2A 1K3RA 1VQ4A 1IBKL 1HZBA 5JEAG 3U4ZA 1WYDA 4PZ7A 2WP8J 4HJ5A 1TWGH 1EOVA 4A3EG 3HFZB 1Y1WG 1Y14B 3GTKH 1FVIA 2CCZA 4A3CG 4A93H 4GS3A 2HQLA 1I3QH 3CCSA 2MFIA 2JA8G 1TWAH 3M9BA 1VQ7A 3HOUG 4YWLA 2QEXA 1TXYA 2CWAA 1QVCA 2K5VA 1T9HA 1R9TH 3AFPA 4DV2Q 4IJHA 5M3FH 1OXSC 4K0KL 2BA0A 2KHIA 5J3BA 5H1SE 3GDEA 3T1YQ 1L0WA 2ZTCA 2FXQA 1KQSA 4HIMA 3M4PA 4OO1G 1X3EA 3ZJYC 3AFQA 4OX9Q 1I94Q 4APVA 1TWCH 5IT9c 1SROA 5M5WH 2EQSA 1KIXA 4NPSA 3U4VA 2I5LX 4IPGA 4A76A 4JI4L 1B70B 1LM0A 2NVQH 4JI5L 2ALYB 4JI3Q 2JEBI 3GTJH 4DV4L 2RHQB 3JC66 3D31A 3I4NH 4KHPL 1IBMQ 4JI7L 4A4IA 3UE1A 3M85A 4A3GH 1A63A 3CXCA 5E7NA 3K81C 2ZTDA 3K7AH 4KLKA 4B3SQ 1N8RC 2R92G 1VQDA 1OTCA 1BBWA 4DUYL 1WCMG 2MO1A 1G51A 3ICEA 1XMQL 3PO3G 2PNHA 5IYBH 4UP8A 1NMGA 3JAMi 2JA7H 1UWVA 2I0QA 4BA1I 1AE3A 5ELNA 2JA5G 5GAGC 3E0EA 1AE2A 1Y1VG 2YV5A 5FJ8H 3HKZE 4P72A 4JI2Q 3I56A 4X62L 1NJIC 4BBSH 4X6AH 2UU9L 1FJGQ 1YJNA 1QVGA 5GAEC 2UUAL 2BA1A 3FHWA 1EUJA 2Q2HA 1EWIA 4IPDA 3SGIA 3RNUA 1A8VA 3S1QH 5IP7H 3I7FA 2UUBQ 4QGUA 1HNZQ 3HOVH 4BA2I 5JJLA 2NVYH 1I5FA 2UUCL 5C4JH 4LW1A 4A3EH 1XTDA 4B3ML 3M7NA 1K0RA 5JJKA 3HKZG 1Z9FA 1VQHA 2JA8H 3FKIH 2GVBA 2E5LL 1NTGA 2KENA 4P73A 3W1GA 3A5UA 3HOUH 1OXUA 2A19A 4B3TQ 4DR4Q 2H5XA 3A5ZB 4KI0A 3UE0A 4AH6A 4L5RC 1XNRQ 2K5NA 1Z47A 4YCWA 1GVPA 4JOIA 5GAHC 1TWFH 1QZGA 2OTLA 4AQYL 2JJQA 1SR3A 4UP9A 4LF5Q 2NVXH 1L1OC 2JEAI 1I6HH 4WJ4A 2I5MX 2UXBQ 3J7ZC 3UDXA 3GTMH 4GLVB 4YY3L 4JI4Q 2QGQA 2ZJRA 1SMXA 4JI6Q 1YVCA 1VQ6A 1SLJA 2Y0SE 4DR3Q 1FL0A 1KHIA 2EIFA 1MKHA 4GKJQ 2VQEQ 2HHHQ 4L5TA 5IWAL 2VQFL 4B3RQ 4NXMQ 2WFWA 4TQUS 4BY1G 1PH5A 5ELOA 2D0PA 1HNXQ 1JMCA 2WB1E 3HOZG 1HR0L 1SRUA 1HZCA 4DV1Q 4LF7L 2NVTH 1DGSA 2VNUD 1Q7YC 1XNQL 1PYSB 3NENA 4LNQA 4Y52H 3W1BA 2R92H 3WWVA 4J15A 4POFA 2ASBA 3I4NG 1E1TA 4A3JG 3KF6B 2N3SA 5LMUQ 1WCMH 2Y0SG 2NZHA 4O0AA 3RLFA 4A3GG 1PH9A 2E2JH 5IP9H 2VW9A 2JE6I 4DR5Q 2N8NA 1L2FA 1VS0A 3TS0A 4LFCQ 4QJFA 3AEVA 4DV5Q 4DR6L 2ATWA 1X55A 2IHEA 4MTNA 3A0JA 3CCMA 1S72A 1GM5A 2LXKA 5IYBG 4DV0Q 2JA7G 4JYAQ 1CKMA 1X54A 2IHFA 4XIGS 1YJWA 3CPWA 1CKNB 5LMNW 3HOWH 3L2PA 4Y7NH 2D62A 5FJ8G 1QUQB 1VQOA 4NXNL 3PUZA 3AQQA 3EIVA 4LUVA 3S17H 3ULPA 1I50H 1CKNA 4BBSG 4BBRH 2JK8A 1P16A 1QUQA 5IY0A 5FLMH 4GKKQ 2RCNA 4GNXC 2WAQE 5IP7G 3HOVG 2LXJA 5C4XG 2PI2A 4P71A 4FDBA 4YWMA 1VQEA 3PUVA 1Q1BA 2BH2A 4A93G 2HIXA 4C3IH 3BZKA 4A75A 3T1YL 4DV6L 4DR7Q 3FKIG 2VUMH 3H0GG 4JI1L 3LGJA 2ZJQA 4O2DA 2AHOB 1N33Q 4XTCS 4OX9L 3GTOH 2VL6A 1FGUA 1OXTA 1WI5A 2DUDA 4YHHL 2ES2A 1YJ9A 2K75A 2WAQG 3GD7A 2ZM6Q 3KOJA 4HJ9A 1J5EL 4LF6L 3RLNA 5C3EH 2OQ0A 4EX5A 2HIVA 2K52A 3BJUA 1C9OA 2AWOA 3PGZA 5IYCH 1TWHH 3ER0A 4GOPB 4BY1H 3PUWA 1SE8A 4JG2A 3HOZH 2PI2E 3F1ZA 2Z6KC 3G4SA 4LF8L 3OTOQ 3TS2A 4B3SL 1HZ9A 1D7QA 5GROA 1KRTA 1JE5A 4X66Q 4GOPA 4A3JH 3D0FA 1VQGA 1IBKQ 4QQBX 3F2BA 1B7YB 2K50A 3S2HH 3IRBA 2YTYA 2OQKA 3U50C 1PH3A 3I4OA 1JT8A 3T1HL 2GN5A 3RLOA 4JI8L 4AYBE 3KJOA 3KJPA 1XPUA 1HH2P 2BH8A 5C0XJ 2IY5B 1V43A 3CAMA 3KF8B 5IP9G 1FJGL 4K0KQ 1XMOL 3E9IA 2Q2IA 3M4QA 2F4VL 3TRZA 1N32L 4C2MH 2UUBL 1X3GA 2D0OA 3S1RH 1HNZL 2AKWB 1VQLA 5GADC 1VQ9A 4DAYB 4JI0L 4L5SA 1Q1EA 1BVSA 2ID0A 1V1QA 4A3KH 2AWNA 4C3HH 4LF9L 2K5HA 3HOWG 4AYBG 3Q8DA 5BR8Q 2F52A 5C4XH 4JI5Q 1L1OA 4B3TL 4DR4L 4MZ9A 1N9WA 3PUXA 4R4QA 2MNAA 4DV4Q 4A3MG 4BBRG 3JAMc 1ASZA 1XNRL 3PF4A 5JJIA 5FLMG 4HJAA 4LF5L 1K8AC 3H0GH 1E1OA 2UXBL 3S15H 4MNOA 4BXXH 3H15A 4IPCA 3NELA 4OWXB 3S14H 3GTLH 2VUMG 4HIDA 1YITA 1GD7A 1VQFA 4GKJL 1HNWL 1UEBA 2N49A 5C0XG 2E2HH 3CW2C 4B3RL 3NBHB 3NEMA 1HNXL 2UXDQ 1VQ5A 1UE6A 3TQYA 2OCEA 1GKHA 4DV1L 4LFBL 2RHSB 3CCVA 2F3IA 1MIUA 1KC8C 2UU9Q 1C0AA 4DR1Q 1EIFA 3HOXG 5C3EG 1EFWA 2RF4A 1A0IA 1K8GA 2V1CC 2OWOA 2L15A 5IYCG 4IJLA 3UDGA 5C0XI 2OTJA 5LMNL 1BKBA 4X65Q 5LMUL 2HT1A 1KD1C 2YYZA 1MJCA 1U0LA 2PQAA 5C44G 3UDIA 5AJ3Q 4DR5L 4PZ8A 2UUCQ 4B3MQ 1N34Q 4DUZQ 4DV5L 2R7FA 4QY7A 1H95A 1IXRA 4PZ6A 4LUZA 1XJVA 4R4CA 1Q86C 1NY4A 1PFSA 4ME3A 1ASYA 4JV5L 1PH7A 4DV3Q 4AIMA 3S24A 1YIJA 1PH1A 2K4KA 1XPOA 4BY7G 3HOYG 4JYAL 3CQZH 2KCMA 1PH2A 4LF7Q 3I4MH 4AQYQ 5M3MH 3CP0A 4DR2L 3CMEA 4DV7L 3GTPH 3CCJA 3RZDH 3J80i
chains in the Genus database with same CATH superfamily
2SNSA 4GKKL 1KTKA 2MHVA 2LSSA 4UP7A 1BDOA 4KD4A 1K28A 1RODA 1HTLD 3HG9A 1GUWA 1X65A 2B2WC 4X64Q 1S40A 3I4MB 2Q2UA 4JCVE 2KEDA 4UDUC 3GTPB 1ESRA 5BN3A 4A3DH 2NZOA 3RZOB 2B2VA 1HHVA 4B9XA 2Z6KA 1PH6A 3HOWB 1ZYRC 2XRSD 5DLQE 1PRTF 3MVVA 2UXCQ 4X66L 5T1GA 5HGQA 1U9RA 4A3IH 1VQNA 1LTSD 1OXXK 3L7ZC 1O7IA 5D14A 3H3VC 4C1NI 4XQQA 1IZ6A 2PW7A 2EYMA 1I4GA 1WTOA 2Z0SA 1I4PA 4YCVA 4BY7H 2LS01 5KNBA 5C6AA 4DV6Q 4FF3A 2JQOA 1O80A 1HJPA 2PNRC 2L12A 4C3JB 1SNDA 1B50A 1NAPA 1STNA 1GUGA 2F0DA 2YTXA 3VA7A 2C35B 4TRDA 1G2TA 5IYDG 4LF8Q 2AQ3B 3CC2A 1JORA 1VQKA 2QA4A 1V1OA 3U58A 3K7UC 2PMZB 1VQ8A 2BE5C 4JI7Q 3NUCA 1K83B 3MA2B 1JJGA 5FO9B 4IFDG 2E2IH 2UXDL 3PIOA 1V1PB 2B2YA 4JI6L 3AYHB 2MQHA 2F3WA 1PV4A 4PMWA 1EY7A 1LV9A 2VQEL 2HHHL 3CC7A 1N32Q 1QNUA 3NSWA 1I6VC 3OHXC 1D8LA 1U5KA 2QILA 3QWNA 3K5MA 3K80C 1YHBA 2IJ0A 3K5NA 1Y1WH 4HMJA 4QIWE 1EOTA 3I55A 3F2CA 1HPCA 4OO1I 1Q81C 2XVSA 4OL7A 3EBEA 3KFUA 5ELBA 3MEHA 1QZHA 2EDGA 1VQCA 2CH4A 3E9HA 4GLXA 1SYFA 3QOLA 2E5LQ 3E6ZX 1M90C 2ZTEA 4RGNA 4CJ2C 1SNCA 2CWPA 2O5IC 1QVFA 1NMFA 2EYPA 1EIHA 1V8QA 2CKZB 3NE5B 1HZAA 3T51B 4CDDC 4PMBA 3OIQA 4A3LG 1JOKA 3D4DA 4XXEA 1LT4D 1A62A 1K73C 2EY6A 4DR7L 3ULLA 4R4TA 3G6EA 4IFDH 5IIFA 2DN8A 2KQ3A 3I73A 4IURA 1LYLA 4K8JA 5HY6A 2Q2TA 1Y1VH 2WB1G 1ENFA 1JWSD 2NTTA 3O13A 2ZM6L 2CQOA 3C1FA 4OXPA 3CCEA 2YU9B 4DR6Q 1ICWA 1HR0W 4G7OC 3HS0C 3VR5A 1SFOH 3S1NH 1ZYRD 1E3PA 3BDOA 1JOOA 5A2QL 3KLSA 5I6YA 4DNIA 4GN5A 5IE8A 1AZQA 1UE7A 1BO0A 1PH8A 1B2TA 1IBKL 5J1ZA 4KTAA 3U4ZA 4FXGC 4HJ5A 4A3EG 3S16B 1EOVA 3GTKH 1ML0D 2HQLA 2MFIA 1VQ7A 3AU7A 5C5MA 2QEXA 3AFPA 3GDEA 4KN4C 1L0WA 1KQSA 1NCVA 3ZJYC 3AFQA 4A3IB 1H9JA 1Q90A 1SNOA 1SROA 2AUKA 5M9OA 2F0JA 2DNCA 2OF1A 1I3QB 2E2DC 3HP3A 3JC66 5EGTA 5ELFA 1H9MA 4C56C 3UE1A 3CXCA 5E7NA 5M3FB 3K7AH 1F2MA 5DM73 2NBFA 2F0TA 3TP8A 3OW7A 3D6WA 2PNHA 4ZKBB 3JAMi 1UWVA 4NKLA 5ELNA 3DEPA 5GAGC 4ZUIA 4Q5VA 5JPNC 1PDQA 2B2UA 4JI2Q 3VR3A 1NJIC 1MGSA 2BA1A 4A3GB 1EYCA 2QEJC 3SK6A 1A8VA 4O1NA 4DAYA 5IP7H 3HOVH 3LX0A 4LW1A 4A3EH 3MFGA 3M7NA 4FO2A 5IGDA 2K5DA 2GVBA 5C4HA 1HRJA 2JA7B 4UAIA 4KD3A 4ME5A 1OXUA 4DNTB 4L5RC 3NWSA 3CRKC 2OTLA 4A93G 4UP9A 3SEBA 1ET9A 1L1OC 1R4PB 2I5MX 2OXPA 3J7ZC 4NMZA 1TY2A 4GLVB 5CGKA 4L6TB 1YNNC 2D2CC 2IL8A 2Y0SE 1Y1WB 3SHLA 2L5TA 3VR6A 2VQFL 3HOZG 2OEOA 1PFNA 4ID6A 5FLXE 3N52A 1Q7YC 1PYSB 4LNQA 1I4XA 4Y52H 1TWFB 4CDFC 2QDBA 4J15A 3WWVA 1I6HB 3U9OA 2HDLA 4O0AA 2N8NA 1VS0A 4QJFA 5KIXA 4DV5Q 4HR7B 1SMYC 3J80E 4PV1C 2IW3A 1FNUA 4JYAQ 1YJWA 3CPWA 2F0LA 2SDFA 3TSSA 3PUZA 3AQQA 4BWGB 3RUZA 3J7YW 4BBSG 5DAUA 4BBRH 5ELDA 3VR4A 4GKKQ 2MPMA 1D2BA 2WAQE 5C4XG 4FDBA 5L37A 1Y1VB 5CV6A 2BH2A 4DF7A 4C3IH 2F0WA 3QJYA 3BZKA 3DMUA 3T1YL 4DV6L 2EYLA 3FKIG 2VUMH 1MHWC 3KLSX 3LGJA 3QOJA 1IW7D 3VA5A 2AHOB 2K5WA 4E6IA 1FGUA 2HUGA 4K2KA 1F9SA 3S1NB 1WI5A 2BDOA 3S17B 2K75A 3GD7A 3MFYA 3RLNA 2EJGC 3QO2A 4PMCA 4HSPA 2HIVA 4EQNA 3PGZA 3HOZH 4JG2A 5IGGA 4LF8L 2QKIC 3TS2A 3GTKB 1F9QA 2AUJD 4K14A 1KRTA 1JE5A 1H9KA 2DJGC 4X66Q 1Y69U 3D0FA 1VQGA 1CK1A 3DUZA 1EEFD 3F2BA 1KDBA 1Z7TA 1UNSA 1LTRD 1ILQA 4IUNA 3K0YA 5T1IA 2K03A 1SYEA 5CORA 1CHQD 3OOCA 2GN5A 3RLOA 4AYBE 5C3EB 3KUPA 1TR5A 3R2TA 1HH2P 1X32A 3CAMA 1FJGL 3M4QA 2KCNA 3TRZA 1N32L 1VQLA 2A69C 4KKTA 4LK1C 1S5FD 1C48A 3HOWG 1K8OA 5C4XH 1LACA 4WJ3M 4DV4Q 1CM9A 5JJIA 1BQQT 1SEBD 3A8IE 5CC4A 1Q3LA 3MXNA 4MNOA 1I4QA 4BXXH 3NELA 2VB3X 1E2WA 2E74C 4OWXB 4XQJA 1W6KA 3Q0AA 1VQFA 4EQOA 4GKJL 1MSGA 2N49A 2E2HH 1KNEA 3NBHB 3NEMA 1AFPA 2UXDQ 1VQ5A 3HOVB 1YNND 2OCEA 1T5XD 1OO9B 3CCVA 2HDMA 1PTOH 3Q24A 4FF2A 2V1CC 4HSVA 5IYCG 4IJLA 3UDGA 5C0XI 1BKBA 2BCOA 3S15B 5ELCA 4CDEC 1O7ZA 4PZ6A 1QJOA 4R4CA 1Q86C 1DYQA 2B2TA 3FPUB 1PH7A 5D3IB 1YIJA 4LF7Q 3I4MH 3D6CA 4AQYQ 5M3MH 4RGOS 3CMEA 3GTPH 3DEOA 1SMYD 3CCJA 4GNXA 3RZDH 5HGTA 1GUSA 3RZOH 1FD7D 4RH6A 5A35A 3S9WA 3W5OA 3L0OA 5CR3A 1LT3D 1WOCA 2VS1A 3J7AV 5LHY1 2NN6I 2J4XA 3K59A 1JJ2A 4JW0A 1ET6A 1HR0Q 3M3YH 2O5JC 1TVXA 1CSQA 2Z8LA 4P74A 4M1UB 2HQEA 3GO5A 4ILWA 4CBVA 3PIP3 5I2YA 2YTVA 3STBC 3PIPA 3EQLC 3SK4A 2R7DA 4V0BA 1EIYB 3KDFA 3OWEB 2ZJPA 3J81j 4DK3C 4A3MB 4UPAA 2MO0A 1S4ZA 1RDPD 2RBMA 1W3SA 1IL8A 4C3JH 2E8GA 3GTQB 3VYUA 3CMAA 3NQTA 3T13A 2F1MA 1YZ6A 4C3IB 1WTQA 1UE5A 2JP1A 1IYJB 4IFDJ 4R1JA 1EQVA 1BCPB 2KCTA 1F2LA 4PG3A 1H9SB 4S3SA 1AN8A 1S5DD 4NB3A 4JI2L 4ZLTF 3CCRA 4DK6C 4XT3B 5J22A 1K83H 4X3KA 3HKSA 3R93A 1CUKA 3OWFA 4YHHQ 3C1EA 4P2CB 1EYGA 4RGTA 3LNNA 1X3FA 5BR8L 1VQAA 2A69D 4FP5D 4A3BH 1V9PA 4GLAC 1KRSA 3PO2H 1K9MC 2IT1A 2K6AA 3HOYB 3BU2A 1JJCB 2EY1A 1YI2A 3PSIA 3K57A 2K1BA 3H3VI 4F8MA 3JAME 1STYA 1II3A 1GXDC 3E5SA 3R3OA 4XDXA 4K5XA 2LY7A 4X3UA 4FXKC 4EGVA 1UAPA 2JA9A 4GN4B 2A68C 2EXDA 4JBMA 4QUCA 2SEBD 1J9OA 4A3DG 2VY3A 2KA7A 4DPGA 4IOAA 1AH9A 1KDCA 4X65L 4R4OA 1VQIA 2JA6B 2F0EA 1KXLA 1C7YA 3TEHB 4DUZL 2JN4A 3HZXA 4LAAA 3H09A 4ZRZA 4A3IG 3TDQA 3BVGA 4DV3L 2KECA 3RN5A 4U673 1M1KC 3GTGH 4CHTB 4HIKA 1XYIA 5M3FG 1FNWA 1QB5D 2J7ZA 2L4NA 1PTOB 2N55A 5GQOA 2Z4IA 2R7ZB 1NBWA 2X6GA 3BZCA 4FF1A 1EQRA 4KHZA 4JOIC 4FF4A 3QG1A 5D3DA 2DGYA 2YU9H 4G7ZC 4LFBQ 3KBGA 4POGA 3CPFA 1GJXA 2PZUA 1OXVA 2QW7A 3BG3A 3ZYYX 4A3FB 1J8IA 2VQFQ 1JB3A 4HJ8A 3PO3H 4HIOA 3C2PA 1NUCA 3SK8A 1LTLA 3S16H 1HQRD 5EAYA 2F0OA 5M3MB 1LT6D 4HAEA 3STBD 4JV5Q 4LFAL 1BBUA 3RZDB 1YBYA 1E0BA 2K7VA 1EY9A 4L8JA 4OWTB 3GP7A 3NPPA 1N36L 4OO1H 4DR2Q 4HJ7A 1IBLL 2RCFA 2LMCB 4RHSA 3M3YB 1KAAA 1VQJA 1IYUA 3NWTA 1VQ4A 5JEAG 1WYDA 2PZWA 1PTOC 1Y1WG 3MC0B 4GS3A 1I3QH 4MIUA 2CWAA 1QVCA 1R9TH 1T9HA 2Z6BA 4IJHA 5M3FH 1DJRD 1HCZA 2KHIA 3DXJC 5J3BA 5H1SE 3T1YQ 2L1BA 3M4PA 3MHBA 2H1EA 4L63B 2B2VC 5M5WH 1KIXA 1TWGB 2I5LX 4JI4L 1B70B 3K6OA 4JI3Q 3I4NH 4DV4L 2RHQB 3D31A 1IBMQ 4A3GH 1A63A 3NBIA 3BYYB 1STAA 2MO1A 1IKLA 3J81E 3ICEA 5IYBH 4UP8A 1NR4A 2JA7H 4BA1I 1TS2A 3PIO3 3E0EA 3UI2A 1Y1VG 2K32A 2A68D 1WTXA 3KF8A 2NVQB 4A3BB 4KKUA 1M8AA 3A54A 3VYTA 4X62L 2KHSA 3GTJB 1FJGQ 5G3LD 1YJNA 1QVGA 1KLUD 1SNMA 1D5XC 3PO2B 1EWIA 1KNAA 3V96A 1DONA 5JJLA 1L0XB 3TZUA 5JEAH 2FFKB 3P20A 1EQTA 2VB2X 4DAPA 1K0RA 5JJKA 5IGEA 3HKZG 4DGZA 3T4AC 2ZXRA 3OMGA 3W1GA 3C3LA 2G5DA 3VYSA 1B3QA 4NDXA 2FINB 1SE2A 1F77A 3A5ZB 4AH6A 4GZYC 2EY2A 2F4IA 4X3SA 1NR2A 4IZ8A 2MJ8A 5GAHC 1TWFH 4LF7L 1I6HH 4AQYL 2JJQA 2JEAI 4FYDA 4WJ4A 4HTHA 5EKKA 2RSOA 2AQ1B 3UDXA 3GTMH 4YY3L 1RF2D 4DFAA 1DXMA 1SMXA 2NVYB 1SLJA 1KHIA 3CRLC 4PNYA 5CMDA 1MKHA 4GKJQ 4KN7C 3VR2A 2B8FA 2JA8B 2B2YC 3IL8A 4NXMQ 4TQUS 1PH5A 3HOUB 1HR0L 1STBA 2PCFB 1SRUA 1HZCA 2EYHA 2C5CA 1XNQL 1G2SA 3W1BA 2ASBA 4ZQ3A 3GTGB 3F2UA 3RLFA 3TP7A 1W6JA 2VW9A 4LFCQ 2NTSA 2O2LD 1X55A 1S72A 1B9NA 2KEEA 2LXKA 2K28A 1FNVA 1CKMA 1X54A 1CKNB 5LMNW 1STEA 3L2PA 2NVTB 4Y7NH 1D1IA 2PW5A 4FVMA 4CJ1B 4WORA 1SE4A 3S17H 2R92B 2BDNA 1I50H 1CKNA 2JK8A 1WCMB 5FLMH 2RCNA 1HA6A 3PO3B 5IP7G 3HOVG 4RA8A 4P71A 2F0QA 4YWMA 1PTOD 1Q1BA 2HIXA 3IFTA 4A75A 2ZJQA 1PXUA 1DOMA 1IW7C 4OX9L 1TIID 2EJFC 4YHHL 1U4LA 1EY0A 4OIJA 1EWCA 5E1FA 5C3EH 4X3TA 4H7BA 2FJ2A 2LKVA 4RCNA 1XX8A 1BUVT 1C9OA 3OMCA 2I07B 5KRUA 1TWHH 3ER0A 4GOPB 3PUWA 2PI2E 3OTOQ 5IT9E 5CBAE 4B3SL 1D7QA 5GROA 4GOPA 3FPPA 4ZCKA 5IGBA 3GTOB 1R9TB 5K5PA 5JPMC 3S2HH 3IRBA 2OQKA 3SR1A 3I4OA 2RA4A 3KJPA 1DCZA 3E0JA 2BH8A 1ICFB 4DA2A 4BY1B 2K01A 1SNPA 3E9IA 3FEWX 1AP0A 2Q2IA 5M5WB 1CTMA 1X3GA 2D0OA 1HNZL 2AKWB 4DAYB 3I4NB 1LTBD 4A3JB 2ID0A 3PQIA 4A3KH 2AWNA 4C3HH 4WFN3 4IUQA 5BR8Q 4K5VA 1L1OA 4IN3A 1N9WA 4R4QA 4A3MG 3PF4A 1XNRL 4BBRG 3EA6A 3BDLA 1CFMA 4HCSA 4LF5L 2KJXA 4RHRA 1CZWA 3S15H 1JC7A 4C1NK 3A56A 4C3IG 2XN9C 2VUMG 1U4RA 2L55A 4HN7A 4KV6A 4MHEA 5C0XG 1HNXL 3TQYA 4DV1L 4LFBL 4TKOB 1EEID 1JR0D 2DY8A 5G3LF 1KC8C 2UU9Q 1EIFA 4IQZA 1C0AA 2A73B 2B2UC 3CKIB 1K8GA 2L15A 1S5BD 2K5QA 3H0GB 4X65Q 2A6HC 2PQAA 5FLXL 2UUCQ 3UDIA 1PRTB 4DR5L 4B3MQ 1PZJD 3H6MA 5C3XA 4DUZQ 4QY7A 3GTLB 1H95A 1PFSA 4JV5L 4DV3Q 4AIMA 1TT2A 2K4KA 3GTMB 3HOYG 3CQZH 2KCMA 3CP0A 1HTPA 4DR2L 4DK0A 3J80L 1ZKOA 5C4ZA 1G91A 2C9OA 5CV7A 2XGTA 4LMQD 4PQXA 1KL9A 2KHJA 2EOTA 2IX0A 4A3MH 1YHAA 1YNXA 4XYQA 1CQFA 3V2TA 3GTQH 1JE4A 5BN5A 2JA6G 3PF5A 2IPKD 3B6YA 4JBKA 4J1MA 5KNCA 1DOKA 3ERSX 4HCEA 1K0SA 3HRZC 4BXXG 1B3AA 2K14A 5C0XH 1G6ZA 4Y7NB 2DY7A 1PHJA 1A6XA 1SN8A 2R6GA 4IALA 1DD2A 4TVAB 4LFAQ 4OGQC 1I50B 4L5QA 1O78A 2B29A 4JI3L 1N36Q 3SVMA 1IKMA 1J6QA 2NB0A 3UDFA 1IBML 4TSSA 3DWAA 1IBLQ 3PCOB 4MN3A 2GA4B 3LWUA 2R7ZG 1SDFA 3G71A 4ALPA 2M2LA 3HOYH 1TS4A 2ZXOA 4A3FG 5EKLA 4YWKA 4IOCA 1LT5D 3TREA 3HOXB 2NN6H 5E4XA 2EXZA 3J81i 1LTAD 2VZAA 2AQ2B 1TWHB 3RN2A 2F0MA 3I4MG 5C44B 2SNMA 2R3ZA 5M3MG 1J5EQ 1YEZA 4LF6Q 5KYIA 4RG1A 1HQMC 2Z1CA 3I2ZA 2CHBD 4N9PA 5CYUA 2Z9HA 1VQMA 3KLRA 4JI4Q 3S2HB 1KAWA 2JA6H 3MXNB 2A74C 3CCUA 1SSOA 2XWBB 3M4YA 3U9SA 4R4IA 1GUOA 1K8MA 3KK7A 3M7GA 4ZUJA 4YIJA 4UY8C 3K58A 4IPHA 4JI8Q 1SYGA 4P75A 5KGUA 1CT1D 1IHZA 4DR1L 4H0LC 1H9RA 4QF4A 4A3KB 4C3HB 2N78A 2F4VQ 1Y8PB 4NXML 1JICA 5AJ3L 2RDFA 4X62Q 3IKJA 4JI0Q 4G7HC 3BS1A 3VYRA 1DOLA 4A3CH 4LF9Q 2R7ZH 4C3JG 1SBBB 1VF7A 5M5XH 1QOHA 4OIKA 2A6HD 3J7AF 1Q46A 4LUOA 4LFCL 1PYBA 4A3FH 1EZ6A 4DKAC 4OWWB 2EE1A 3A8JE 4GNXB 1B8AA 2B63B 1MSHA 1ILPA 2VXWA 1YNJC 4IUTA 1VDZA 3H3VH 1C4QA 3G6JB 4RMFA 4YY3Q 4LF4L 1X3PA 2XTIA 1LUZA 5FLXc 2B3GA 4RAUC 5JVG3 2B39A 5JEAJ 2G9DA 2CFMA 4F87A 2F0HA 1GO3E 2A8VA 4A3BG 3KYHC 2R93B 3IFDA 5LMNQ 1CA6A 1A3TA 1Q82C 2WKDA 3K0XA 1XPRA 3PO2G 1RL2A 4JBWA 2JA5H 3CQZB 1E22A 5E3FA 1XNQQ 1SAPA 3MEFA 3BVZA 3KF6A 3J80c 1WFQA 3VDYA 3KDFB 1B1ZA 1PA6A 1D1KA 4KKSA 2MUYA 2M9VA 4F88A 1PRTD 3S1MB 4JBJA 4XQNA 1X6OA 2E76C 4ODGA 3M4OB 3EJIA 1QNKA 1JB7A 3R2IA 1P8LA 2NUCA 2A1AA 3V05A 3OTOL 1EIGA 4J6HA 5ELEA 1Q8KA 1K3RA 1DM0B 1HZBA 4DAVA 2EYJA 4PZ7A 2WP8J 1TWGH 3QB3A 4B9WA 1EL0A 5D65A 1FVIA 1JOQA 2JA8G 3TP5A 3HOUG 4YWLA 4DV2Q 4RCOA 1OXSC 3MWYW 2PO4A 4KK7A 4OX9Q 4CJ0B 1I94Q 4Q0FA 1BBXC 3GQBA 4APVA 1TWCH 4M8AA 3BVMA 4NPSA 1SJED 1LABA 2F0PA 5AFWA 3U4VA 5C3WA 4NW2A 4A76A 1LM0A 2NVQH 2ALYB 4G4KA 2JEBI 3GTJH 1EY5A 4KHPL 1ENAA 3TP6A 5JOBA 3Q23A 4QIWB 1R4QB 2WV6D 4KLKA 4B3SQ 2XIWA 1N8RC 2R92G 1OTCA 3Q22A 4DUYL 1S5ED 1WCMG 3JAML 1XMQL 2NYZD 1B4OA 3PO3G 4IUVA 1AE3A 3EFXD 1AE2A 2YV5A 4MTKA 5FJ8H 3HKZE 2R61A 2JYOA 1VMCA 4X6AH 2UU9L 4QUFA 3FHWA 2UUAL 1BCPC 2Q2HA 4OO1G 4KJNA 1HNZQ 1A3VA 2NVYH 5COYA 4HMIA 1QE6A 2UUCL 3HEJA 4B3ML 4ZAIA 1PFMA 1K3BC 1VQHA 1ENCA 2I46A 2JA8H 1NTGA 1BOSA 3HOUH 4QCLA 2ZXPA 1LTTD 2A19A 3UE0A 4KI0A 1WD1A 1XNRQ 2K5NA 2J0TD 1Z47A 4YCWA 1GVPA 4JOIA 1KLGD 1QWYA 4LF5Q 1SR3A 4BBSB 4V190 2E75C 2EJMA 2F0IA 1RD9D 1UEAB 1VQ6A 5C4JB 3NHHA 4DR3Q 1FL0A 1YNJD 1TS5A 4L5TA 1GHJA 1IYVA 2WFWA 4BY1G 2B2WA 5ELOA 2D0PA 5M5XB 1HNXQ 2WB1E 1JMCA 1ONLA 4DV1Q 2NVTH 1DGSA 3NENA 4OELB 2R92H 4POFA 1F9RA 3I4NG 2NVXB 4A3JG 3NTHA 1FGBD 1SYBA 2EVBA 1WCMH 2NZHA 4A3GG 4KHVA 5IP9H 1AZPA 4DR5Q 2QF7A 3MXPA 3AEVA 2KOLA 4MTNA 1PZKD 3A0JA 3CCMA 1S5CD 5IYBG 2PYKA 4DV0Q 2JA7G 2IHFA 3FRPB 2NZ1D 1LTGD 3H91A 1VQOA 3I4LA 5EPJA 2H4OA 4RFBA 1Z6HA 1ESFA 3H94A 1P16A 5IY0A 2E2JB 4OHJA 1BXTA 3LWEA 1HA5A 3RMHA 5IGCA 2LXJA 2JA5B 2PI2A 1STHA 1VQEA 2LFNA 1F9PA 4H13C 2HD3A 2KCCA 3H0GG 4Z9CB 4O2DA 4XTCS 3GTOH 1WTVA 2K05A 1WVLA 4RKLA 1SE3A 3GV6A 5IGFA 1J5EL 4LF6L 1MBYA 3MXGA 1TY0A 1RTNA 2AWOA 3BJUA 3I91A 1A15A 4BY1H 1WTHA 2XSCA 2X6LA 2Z6KC 1D5ZC 3F1ZA 5CV9A 4I65A 2FMMA 4A3JH 1BF4A 1B7YB 5C5LA 1PH3A 3T16A 3U50C 2RVLA 3WOEA 1Y8NB 3W3AA 1JT8A 1EU3A 4JI8L 3J81L 5I9PA 1XPUA 1D6EC 5C0XJ 3KF8B 4K0KQ 1VF5C 1TWCB 2ZT9C 2F4VL 4C2MH 2UUBL 1LTID 5GADC 1VQ9A 3I90A 4JI0L 4L5SA 1Q1EA 2D5DA 3OSOA 5EBCA 2Q8IB 1V1QA 4LF9L 1BCPD 2Y0SB 5JJZA 2K5HA 2QDLA 3Q8DA 3D3RA 2IX3A 2F52A 4JI5Q 3I72A 4B3TL 4DR4L 4MZ9A 4KY6A 1PZID 3PUXA 2MNAA 1ASZA 3NP8A 3JAMc 3BDCA 5FLMG 4JK1C 1K8AC 3H0GH 2RSNA 2UXBL 3ND9A 3H15A 4IPCA 3P7JA 3ONAB 5JVH3 4ZK9B 3S1RB 3GTLH 4CKBA 1YITA 4H44C 1UEBA 3CW2C 1U4PA 1V1PA 4R9WA 5FK9C 4B3RL 4NP5A 1PYWD 4EVOA 1GKHA 2RHSB 1MIUA 5CV4A 4DR1Q 3HOXG 5C3EG 1NSNS 2RF4A 3G7LA 2OTJA 5CBEE 5LMNL 1EY6A 2JSOA 5LMUL 2DJFC 3DHQA 3FDTA 1RJTA 5I4DA 1I4RA 5C44G 3X3MA 5AJ3Q 4PZ8A 3S14B 2R7FA 1IXRA 2WAQB 4LUZA 4DU9A 1M4VA 4ME3A 1ASYA 4FNFA 2ICIA 1WTPA 3S24A 4LJZC 1PH2A 4KY5A 5EQ0A 2P5ZX 3TMEA 4DXFA 4EQ5A 2F0KA 3MXUA 1TS3A 5IYDH 1QG7A 2HCCA 1RIPA 1NNXA 4O42A 1SJHD 5IWAQ 2A6EC 4LF4Q 2EZVA 4A3KG 3OPOA 3EVQA 4C3HG 1L0YB 2K04A 3ERQA 1N33L 1E7ZA 4DV2L 4JPBW 1EY8A 3DM3A 2AMCB 1EZ8A 2RQXA 1EQQA 2KVMA 1I94L 4AYBB 3A74A 1EU4A 1G6PA 5A2QE 1CKOA 3HOXH 4YCUA 3P75A 4GN3B 2N88A 4NXNQ 2KBNA 2B63G 3F8TA 5IT9L 5C44H 3I8ZA 3A8KE 1Q12A 1RKNA 4A3DB 3PV0A 4DAMA 1FR3A 3MTSA 1CSPA 1AW7A 3D8GA 3S2DH 1IL2A 3CC4A 1HFGA 2R93G 4IUUA 4JI1Q 4RKBA 1TU2B 1W2BA 3P1HA 1CA5A 4CDCC 3X3NA 4K5WA 4H02A 1WTRA 1GUTA 1STGA 4A3LH 2I5HA 3KLWA 5CV5A 1L1OB 1G291 4WJWA 4BY7B 5IODA 3ULJA 1NE3A 4WRDA 4QMGA 3J81c 3D4RA 1PH4A 2IX1A 1WJJA 4CKCA 4KHPQ 1TKWB 1UE1A 2BE5D 2RDHA 1PVOA 1MI2A 3QIAA 4GOPC 3PUYA 5CV8A 4K6LA 4F7XA 4EQPA 3T56B 3ND8A 4C2MB 3T1HQ 4DUYQ 1BR9A 5LL6S 3IAYA 5EKIA 1XMQQ 1MJEA 4RWSC 4K6DA 4DR3L 3EN2A 1XMOQ 4IFDI 1X56A 4OONA 2EYOA 1WD0A 1YHQA 2B63H 1N34L 1BCPF 3CF5A 2PQAB 3CCLA 2UUAQ 3F2DA 2Z4HA 1E24A 4ZKCB 1VCIA 2E2IB 2PMZE 4JC0A 4QL5A 3SE0A 2R93H 3FP9A 3T53B 5KNDA 1VQBA 2D9UA 4DV0L 1RTOA 5K36G 2EY5A 4I7ZC 3RR5A 3SXHA 1S3OA 2NN6G 3SK5A 5I6WA 3J7A5 1HNWQ 5KYLA 1JWUD 3OYYA 2XNAC 1Y8OB 3DWQA 3S1MH 3R8BA 5DM63 4LWCA 3NTIA 3M4OH 3E3XA 2F0SA 4X64L 2A6ED 1AEXA 1VQPA 4ULLA 1EWHA 4FXDA 3CCQA 3DLLA 5I2XA 1SNQA 1T5EA 1XXGA 2GVAA 2EPBA 2ICEC 1X9NA 3CD6A 2UXCL 3G48A 1PRTC 4IO9A 5M5YH 4DV7Q 2CH4W 5EJWA 1FYCA 1G8ZD 1JCKB 3K8AA 3OW2A 4ABNA 1GOZA 2CQAA 3HFZB 1Y14B 5FKAC 2CCZA 4A3CG 1O7YA 4A93H 3CCSA 4I7AA 3WDNA 1TWAH 3M9BA 1TXYA 1DZ1A 1RCVD 2K5VA 2TMPA 1PTOF 1EYAA 1SFOB 4K0KL 5ISRA 2BA0A 5K36H 2ZTCA 2FXQA 1PLFA 4HIMA 1CZGA 3HKZB 1X3EA 4N8X1 4XYOA 2Q8TA 4CGYB 5IT9c 2XRQD 2EQSA 2WKCA 4IPGA 4JI5L 5I9OA 1MD2D 1ZXTA 4JI7L 4A4IA 3M85A 1CI3M 4J8QA 3K81C 2ZTDA 3S2DB 2FHTA 1VQDA 1PMRA 1BBWA 1G51A 1LO5D 1NMGA 2I0QA 2JA5G 4K2LA 2F03A 2DNEA 5FOBB 4DXGA 4P72A 3I70A 3I56A 3A55A 2XWJB 5BN4A 4BBSH 1F2ZA 4HEDA 2WIIB 4JVZA 3SDZA 5GAEC 1EUJA 4IPDA 3RNUA 3SGIA 4R8IA 2MP1A 3K7AB 2UUBQ 3I7FA 3S1QH 4QGUA 1A3UA 4BA2I 3EROA 1I5FA 5C4JH 2WB1B 1XTDA 3C46A 2L11A 1JQYD 2L9HA 1Z9FA 3FKIH 1KABA 2OT2A 2E5LL 4DNRB 2F0GA 3DWPA 2PZTA 5EBDA 2KENA 1E2VA 4P73A 2IWHA 3A5UA 1D5MC 4DN4M 4B3TQ 2H5XA 4DR4Q 2PPBC 1X3QA 1QZGA 5J39A 2NVXH 2UXBQ 3QR8A 1VMPA 4QB4A 2CW0C 1HFNA 2F0NA 2QGQA 5FO8B 2ZJRA 4JI6Q 3W2DA 1YVCA 4A3EB 2CVRA 3KBXA 2EIFA 3NBHA 2VQEQ 2HHHQ 5IWAL 4B3RQ 2ENBA 2PQEA 3RD4A 3TZDA 2VNUD 4K8IA 3NXWA 1E1TA 2F0FA 3KF6B 2A5HA 2N3SA 5LMUQ 1HXYD 4N8FA 2Y0SG 1E2ZA 2JXMB 2BOSA 1PH9A 2E2JH 3FMCA 1TQOA 2JE6I 1L2FA 1CHPD 3TS0A 4DR6L 2ATWA 2IHEA 1XTCD 2L0CA 3GV3A 3PMFA 2FMCA 4DK1A 4KY7A 1ZEQX 1GM5A 1QCBD 1SYDA 1C8CA 4XIGS 3HOWH 1EYDA 1UUPA 2D62A 2B2TC 1F2YA 1QUQB 5FJ8G 1B53A 5FO7B 2G9HD 4NXNL 3EIVA 2KUMA 4G57A 4LUVA 3ULPA 1PFBA 2X69A 1B9MA 1JWMD 1QUQA 4GNXC 3OIPA 3FVQA 2V4DA 3PUVA 4ZYSA 1O7LA 1LLRD 3HGBA 4DR7Q 3NTKA 4JI1L 1N33Q 1GUNA 1I4HA 4B08A 2VL6A 1OXTA 5M5YB 2DUDA 2ES2A 1YJ9A 2WAQG 4HJ9A 2ZM6Q 3KOJA 5NUCA 4U68A 4BBRB 1B44D 5TSSA 2NWGA 2OQ0A 4EX5A 2K52A 5IYCH 3TN2A 1SE8A 5DNFA 1GHKA 3A7LA 3G4SA 2MGSA 1A2UA 1CQVA 4KJOA 1HZ9A 3BZDB 4A93B 1WTWA 2VUMB 5E4WC 4RGMA 1TWAB 2WACA 1IBKQ 3I3CA 2K33A 1XWEA 3AB9A 4QQBX 1BNZA 3D4WA 2K50A 1QILA 2YTYA 3DM1A 3N6RA 3T1HL 2HCIA 3NK9A 5IOCA 3KJOA 1KDAA 3URYA 2QCPX 2IY5B 1V43A 5IP9G 1SYCA 1H9SA 3HOZB 1XMOL 5EPKA 4OEMB 3S1RH 3A7AB 5LL6X 5HURA 2B8GA 1BVSA 3L9AX 3WOFA 2WINB 4AYBG 5EPLA 3MZ5A 1U4MA 3K5OA 4HJAA 3NQIA 1E1OA 3BYTB 4BS9A 2F0VA 2TSSA 4KMUC 2M00A 3S14H 1Q8IA 4HIDA 1GD7A 1EFID 2Q8RE 1HUMA 4N9TA 1EY4A 3Q6SA 1HNWL 2CW0D 5KEEA 5F2DA 3K5LA 3S1QB 1HUNA 5C4XB 1SXTA 1UE6A 2O4XA 2F0UA 2F3IA 1EFWA 1A0IA 3CHBD 2OWOA 1RHPA 3FKIB 3ITPA 4CKEA 2HT1A 1KD1C 2YYZA 1MJCA 1U0LA 1A2TA 4R8NA 3TBIB 3MAQA 1N34Q 2SOBA 4DV5L 2RKSA 5DEHA 2F3VA 1XJVA 4UHVA 1NY4A 4IUPA 2EYFA 2E2HB 2RDGA 3L3OC 1PH1A 5JAVA 1XPOA 4BY7G 3CU7A 4XT1B 4JYAL 4DV7L 3AMUA 3J80i
chains in the Genus database with same CATH topology
3RZOH 2XGTA 4EQ5A 1KL9A 4GKKL 2KHJA 3W5OA 5IYDH 3L0OA 1WOCA 2VS1A 2IX0A 1RIPA 2NN6I 5IWAQ 2LSSA 4UP7A 4A3MH 1YHAA 1YNXA 4LF4Q 1JJ2A 1HR0Q 3M3YH 4A3KG 1CSQA 4P74A 3GTQH 2JA6G 1X65A 3GO5A 3PF5A 1N33L 4X64Q 1S40A 3B6YA 2Q2UA 4JBKA 1E7ZA 4JCVE 4DV2L 3DM3A 2YTVA 3STBC 3PIPA 2AMCB 3ERSX 4A3DH 2NZOA 2R7DA 2Z6KA 1EIYB 4BXXG 1PH6A 3KDFA 2K14A 1EQQA 1I94L 2ZJPA 1PHJA 3A74A 1SN8A 2R6GA 5DLQE 4TVAB 4LFAQ 4DK3C 3J81j 1G6PA 4L5QA 2MO0A 4UPAA 1CKOA 2B29A 3HOXH 2UXCQ 1W3SA 4YCUA 4X66L 5HGQA 4A3IH 4C3JH 4JI3L 4GN3B 2E8GA 1N36Q 1OXXK 1VQNA 3CMAA 1J6QA 4NXNQ 2KBNA 3UDFA 1IBML 1IBLQ 3L7ZC 3F8TA 5C44H 1O7IA 2B63G 3PCOB 1YZ6A 2R7ZG 1Q12A 3PV0A 4DAMA 1IZ6A 1UE5A 1IYJB 3G71A 2Z0SA 1CSPA 4ALPA 4R1JA 4IFDJ 2KCTA 1IL2A 3S2DH 4YCVA 4BY7H 3HOYH 3CC4A 4A3FG 4YWKA 4DV6Q 4PG3A 2R93G 4IOCA 4NB3A 4JI1Q 4GNXA 3TREA 2JQOA 4JI2L 1HJPA 3CCRA 1W2BA 4DK6C 3J81i 1K83H 2VZAA 3HKSA 3RN2A 1CUKA 2YTXA 4YHHQ 1EYGA 3I4MG 5M3MG 1X3FA 2C35B 5BR8L 1YEZA 1J5EQ 1VQAA 4H02A 4LF6Q 4RG1A 4A3LH 4A3BH 2I5HA 3KLWA 1V9PA 4GLAC 3I2ZA 1KRSA 1L1OB 1G291 3PO2H 1K9MC 2IT1A 5IYDG 4LF8Q 1VQMA 3BU2A 3CC2A 1VQKA 1JJCB 3ULJA 1KAWA 1NE3A 3PSIA 2QA4A 1YI2A 2JA6H 3MXNB 3J81c 3U58A 3CCUA 1PH4A 3H3VI 2IX1A 1WJJA 4KHPQ 1UE1A 3K7UC 1PVOA 1VQ8A 4JI7Q 4GOPC 3PUYA 1JJGA 4R4IA 4IFDG 2E2IH 2UXDL 2JA9A 4GN4B 2EXDA 3T1HQ 4UY8C 4DUYQ 4IPHA 4JI8Q 3PIOA 4P75A 4JBMA 4JI6L 3AYHB 2MQHA 1XMQQ 2VY3A 1PV4A 4PMWA 4DR1L 4DR3L 1MJEA 4A3DG 3EN2A 4DPGA 1XMOQ 2VQEL 2HHHL 4IOAA 4IFDI 1X56A 2N78A 2F4VQ 1AH9A 3CC7A 4OONA 4NXML 1N32Q 4X65L 1D8LA 1U5KA 1VQIA 4R4OA 1YHQA 1KXLA 1C7YA 5AJ3L 2B63H 3K80C 1YHBA 4X62Q 4JI0Q 3TEHB 1Y1WH 1N34L 4DUZL 3CF5A 2PQAB 4QIWE 3CCLA 4LF9Q 2UUAQ 2R7ZH 4A3CH 4A3IG 3I55A 3F2CA 5M5XH 3F2DA 4OO1I 1E24A 4DV3L 1Q81C 1Q46A 1VCIA 3EBEA 3KFUA 2PMZE 4JC0A 4LUOA 4QL5A 4LFCL 3RN5A 1QZHA 1PYBA 1VQCA 4A3FH 1M1KC 3E9HA 4GLXA 4DKAC 3GTGH 2R93H 3FP9A 2E5LQ 4OWWB 1VQBA 4HIKA 1M90C 5M3FG 4DV0L 4GNXB 2ZTEA 1B8AA 5K36G 2CWPA 1QVFA 3RR5A 1NMFA 5GQOA 1S3OA 2NN6G 3J7A5 1HNWQ 1NBWA 3BZCA 2CKZB 3H3VH 1EQRA 4KHZA 4JOIC 1HZAA 4RMFA 3OYYA 4YY3Q 2XTIA 4LF4L 1LUZA 5FLXc 2B3GA 3S1MH 2DGYA 2YU9H 5JEAJ 4LFBQ 2CFMA 4POGA 4LWCA 3CPFA 3M4OH 1GO3E 1OXVA 4X64L 2A8VA 4A3BG 4A3LG 3KYHC 2VQFQ 5LMNQ 1A62A 4HJ8A 1VQPA 1K73C 1Q82C 3PO3H 4HIOA 3K0XA 1XPRA 3PO2G 1RL2A 4DR7L 3ULLA 4JBWA 4R4TA 1LTLA 3G6EA 2JA5H 1E22A 3CCQA 3DLLA 3KF6A 3MEFA 1XNQQ 1LYLA 5HY6A 2Q2TA 1Y1VH 2WB1G 5EAYA 3J80c 3S16H 1WFQA 2GVAA 3VDYA 3KDFB 3STBD 4JV5Q 4LFAL 1PA6A 1BBUA 1YBYA 2ZM6L 2CQOA 1X9NA 4OXPA 3CD6A 2UXCL 3G48A 3CCEA 4JBJA 4DR6Q 4OWTB 1N36L 1HR0W 4IO9A 1X6OA 4DR2Q 5M5YH 4DV7Q 4HJ7A 1SFOH 1JB7A 3S1NH 1IBLL 1E3PA 1P8LA 2A1AA 3OTOL 4DNIA 4GN5A 5IE8A 1UE7A 1Q8KA 3K8AA 1PH8A 4WJ3M 1VQJA 3OW2A 1K3RA 1VQ4A 1IBKL 1HZBA 5JEAG 3U4ZA 1WYDA 4PZ7A 2WP8J 4HJ5A 1TWGH 1EOVA 4A3EG 3HFZB 1Y1WG 1Y14B 3GTKH 1FVIA 2CCZA 4A3CG 4A93H 4GS3A 2HQLA 1I3QH 3CCSA 2MFIA 2JA8G 1TWAH 3M9BA 1VQ7A 3HOUG 4YWLA 2QEXA 1TXYA 2CWAA 1QVCA 2K5VA 1T9HA 1R9TH 3AFPA 4DV2Q 4IJHA 5M3FH 1OXSC 4K0KL 2BA0A 2KHIA 5J3BA 5H1SE 3GDEA 3T1YQ 1L0WA 2ZTCA 2FXQA 1KQSA 4HIMA 3M4PA 4OO1G 1X3EA 3ZJYC 3AFQA 4OX9Q 1I94Q 4APVA 1TWCH 5IT9c 1SROA 5M5WH 2EQSA 1KIXA 4NPSA 3U4VA 2I5LX 4IPGA 4A76A 4JI4L 1B70B 1LM0A 2NVQH 4JI5L 2ALYB 4JI3Q 2JEBI 3GTJH 4DV4L 2RHQB 3JC66 3D31A 3I4NH 4KHPL 1IBMQ 4JI7L 4A4IA 3UE1A 3M85A 4A3GH 1A63A 3CXCA 5E7NA 3K81C 2ZTDA 3K7AH 4KLKA 4B3SQ 1N8RC 2R92G 1VQDA 1OTCA 1BBWA 4DUYL 1WCMG 2MO1A 1G51A 3ICEA 1XMQL 3PO3G 2PNHA 5IYBH 4UP8A 1NMGA 3JAMi 2JA7H 1UWVA 2I0QA 4BA1I 1AE3A 5ELNA 2JA5G 5GAGC 3E0EA 1AE2A 1Y1VG 2YV5A 5FJ8H 3HKZE 4P72A 4JI2Q 3I56A 4X62L 1NJIC 4BBSH 4X6AH 2UU9L 1FJGQ 1YJNA 1QVGA 5GAEC 2UUAL 2BA1A 3FHWA 1EUJA 2Q2HA 1EWIA 4IPDA 3SGIA 3RNUA 1A8VA 3S1QH 5IP7H 3I7FA 2UUBQ 4QGUA 1HNZQ 3HOVH 4BA2I 5JJLA 2NVYH 1I5FA 2UUCL 5C4JH 4LW1A 4A3EH 1XTDA 4B3ML 3M7NA 1K0RA 5JJKA 3HKZG 1Z9FA 1VQHA 2JA8H 3FKIH 2GVBA 2E5LL 1NTGA 2KENA 4P73A 3W1GA 3A5UA 3HOUH 1OXUA 2A19A 4B3TQ 4DR4Q 2H5XA 3A5ZB 4KI0A 3UE0A 4AH6A 4L5RC 1XNRQ 2K5NA 1Z47A 4YCWA 1GVPA 4JOIA 5GAHC 1TWFH 1QZGA 2OTLA 4AQYL 2JJQA 1SR3A 4UP9A 4LF5Q 2NVXH 1L1OC 2JEAI 1I6HH 4WJ4A 2I5MX 2UXBQ 3J7ZC 3UDXA 3GTMH 4GLVB 4YY3L 4JI4Q 2QGQA 2ZJRA 1SMXA 4JI6Q 1YVCA 1VQ6A 1SLJA 2Y0SE 4DR3Q 1FL0A 1KHIA 2EIFA 1MKHA 4GKJQ 2VQEQ 2HHHQ 4L5TA 5IWAL 2VQFL 4B3RQ 4NXMQ 2WFWA 4TQUS 4BY1G 1PH5A 5ELOA 2D0PA 1HNXQ 1JMCA 2WB1E 3HOZG 1HR0L 1SRUA 1HZCA 4DV1Q 4LF7L 2NVTH 1DGSA 2VNUD 1Q7YC 1XNQL 1PYSB 3NENA 4LNQA 4Y52H 3W1BA 2R92H 3WWVA 4J15A 4POFA 2ASBA 3I4NG 1E1TA 4A3JG 3KF6B 2N3SA 5LMUQ 1WCMH 2Y0SG 2NZHA 4O0AA 3RLFA 4A3GG 1PH9A 2E2JH 5IP9H 2VW9A 2JE6I 4DR5Q 2N8NA 1L2FA 1VS0A 3TS0A 4LFCQ 4QJFA 3AEVA 4DV5Q 4DR6L 2ATWA 1X55A 2IHEA 4MTNA 3A0JA 3CCMA 1S72A 1GM5A 2LXKA 5IYBG 4DV0Q 2JA7G 4JYAQ 1CKMA 1X54A 2IHFA 4XIGS 1YJWA 3CPWA 1CKNB 5LMNW 3HOWH 3L2PA 4Y7NH 2D62A 5FJ8G 1QUQB 1VQOA 4NXNL 3PUZA 3AQQA 3EIVA 4LUVA 3S17H 3ULPA 1I50H 1CKNA 4BBSG 4BBRH 2JK8A 1P16A 1QUQA 5IY0A 5FLMH 4GKKQ 2RCNA 4GNXC 2WAQE 5IP7G 3HOVG 2LXJA 5C4XG 2PI2A 4P71A 4FDBA 4YWMA 1VQEA 3PUVA 1Q1BA 2BH2A 4A93G 2HIXA 4C3IH 3BZKA 4A75A 3T1YL 4DV6L 4DR7Q 3FKIG 2VUMH 3H0GG 4JI1L 3LGJA 2ZJQA 4O2DA 2AHOB 1N33Q 4XTCS 4OX9L 3GTOH 2VL6A 1FGUA 1OXTA 1WI5A 2DUDA 4YHHL 2ES2A 1YJ9A 2K75A 2WAQG 3GD7A 2ZM6Q 3KOJA 4HJ9A 1J5EL 4LF6L 3RLNA 5C3EH 2OQ0A 4EX5A 2HIVA 2K52A 3BJUA 1C9OA 2AWOA 3PGZA 5IYCH 1TWHH 3ER0A 4GOPB 4BY1H 3PUWA 1SE8A 4JG2A 3HOZH 2PI2E 3F1ZA 2Z6KC 3G4SA 4LF8L 3OTOQ 3TS2A 4B3SL 1HZ9A 1D7QA 5GROA 1KRTA 1JE5A 4X66Q 4GOPA 4A3JH 3D0FA 1VQGA 1IBKQ 4QQBX 3F2BA 1B7YB 2K50A 3S2HH 3IRBA 2YTYA 2OQKA 3U50C 1PH3A 3I4OA 1JT8A 3T1HL 2GN5A 3RLOA 4JI8L 4AYBE 3KJOA 3KJPA 1XPUA 1HH2P 2BH8A 5C0XJ 2IY5B 1V43A 3CAMA 3KF8B 5IP9G 1FJGL 4K0KQ 1XMOL 3E9IA 2Q2IA 3M4QA 2F4VL 3TRZA 1N32L 4C2MH 2UUBL 1X3GA 2D0OA 3S1RH 1HNZL 2AKWB 1VQLA 5GADC 1VQ9A 4DAYB 4JI0L 4L5SA 1Q1EA 1BVSA 2ID0A 1V1QA 4A3KH 2AWNA 4C3HH 4LF9L 2K5HA 3HOWG 4AYBG 3Q8DA 5BR8Q 2F52A 5C4XH 4JI5Q 1L1OA 4B3TL 4DR4L 4MZ9A 1N9WA 3PUXA 4R4QA 2MNAA 4DV4Q 4A3MG 4BBRG 3JAMc 1ASZA 1XNRL 3PF4A 5JJIA 5FLMG 4HJAA 4LF5L 1K8AC 3H0GH 1E1OA 2UXBL 3S15H 4MNOA 4BXXH 3H15A 4IPCA 3NELA 4OWXB 3S14H 3GTLH 2VUMG 4HIDA 1YITA 1GD7A 1VQFA 4GKJL 1HNWL 1UEBA 2N49A 5C0XG 2E2HH 3CW2C 4B3RL 3NBHB 3NEMA 1HNXL 2UXDQ 1VQ5A 1UE6A 3TQYA 2OCEA 1GKHA 4DV1L 4LFBL 2RHSB 3CCVA 2F3IA 1MIUA 1KC8C 2UU9Q 1C0AA 4DR1Q 1EIFA 3HOXG 5C3EG 1EFWA 2RF4A 1A0IA 1K8GA 2V1CC 2OWOA 2L15A 5IYCG 4IJLA 3UDGA 5C0XI 2OTJA 5LMNL 1BKBA 4X65Q 5LMUL 2HT1A 1KD1C 2YYZA 1MJCA 1U0LA 2PQAA 5C44G 3UDIA 5AJ3Q 4DR5L 4PZ8A 2UUCQ 4B3MQ 1N34Q 4DUZQ 4DV5L 2R7FA 4QY7A 1H95A 1IXRA 4PZ6A 4LUZA 1XJVA 4R4CA 1Q86C 1NY4A 1PFSA 4ME3A 1ASYA 4JV5L 1PH7A 4DV3Q 4AIMA 3S24A 1YIJA 1PH1A 2K4KA 1XPOA 4BY7G 3HOYG 4JYAL 3CQZH 2KCMA 1PH2A 4LF7Q 3I4MH 4AQYQ 5M3MH 3CP0A 4DR2L 3CMEA 4DV7L 3GTPH 3CCJA 3RZDH 3J80i
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO H;  2XGT A;  4EQ5 A;  1KL9 A;  4GKK L;  2KHJ A;  3W5O A;  5IYD H;  3L0O A;  1WOC A;  2VS1 A;  2IX0 A;  1RIP A;  2NN6 I;  5IWA Q;  2LSS A;  4UP7 A;  4A3M H;  1YHA A;  1YNX A;  4LF4 Q;  1JJ2 A;  1HR0 Q;  3M3Y H;  4A3K G;  1CSQ A;  4P74 A;  3GTQ H;  2JA6 G;  1X65 A;  3GO5 A;  3PF5 A;  1N33 L;  4X64 Q;  1S40 A;  3B6Y A;  2Q2U A;  4JBK A;  1E7Z A;  4JCV E;  4DV2 L;  3DM3 A;  2YTV A;  3STB C;  3PIP A;  2AMC B;  3ERS X;  4A3D H;  2NZO A;  2R7D A;  2Z6K A;  1EIY B;  4BXX G;  1PH6 A;  3KDF A;  2K14 A;  1EQQ A;  1I94 L;  2ZJP A;  1PHJ A;  3A74 A;  1SN8 A;  2R6G A;  5DLQ E;  4TVA B;  4LFA Q;  4DK3 C;  3J81 j;  1G6P A;  4L5Q A;  2MO0 A;  4UPA A;  1CKO A;  2B29 A;  3HOX H;  2UXC Q;  1W3S A;  4YCU A;  4X66 L;  5HGQ A;  4A3I H;  4C3J H;  4JI3 L;  4GN3 B;  2E8G A;  1N36 Q;  1OXX K;  1VQN A;  3CMA A;  1J6Q A;  4NXN Q;  2KBN A;  3UDF A;  1IBM L;  1IBL Q;  3L7Z C;  3F8T A;  5C44 H;  1O7I A;  2B63 G;  3PCO B;  1YZ6 A;  2R7Z G;  1Q12 A;  3PV0 A;  4DAM A;  1IZ6 A;  1UE5 A;  1IYJ B;  3G71 A;  2Z0S A;  1CSP A;  4ALP A;  4R1J A;  4IFD J;  2KCT A;  1IL2 A;  3S2D H;  4YCV A;  4BY7 H;  3HOY H;  3CC4 A;  4A3F G;  4YWK A;  4DV6 Q;  4PG3 A;  2R93 G;  4IOC A;  4NB3 A;  4JI1 Q;  4GNX A;  3TRE A;  2JQO A;  4JI2 L;  1HJP A;  3CCR A;  1W2B A;  4DK6 C;  3J81 i;  1K83 H;  2VZA A;  3HKS A;  3RN2 A;  1CUK A;  2YTX A;  4YHH Q;  1EYG A;  3I4M G;  5M3M G;  1X3F A;  2C35 B;  5BR8 L;  1YEZ A;  1J5E Q;  1VQA A;  4H02 A;  4LF6 Q;  4RG1 A;  4A3L H;  4A3B H;  2I5H A;  3KLW A;  1V9P A;  4GLA C;  3I2Z A;  1KRS A;  1L1O B;  1G29 1;  3PO2 H;  1K9M C;  2IT1 A;  5IYD G;  4LF8 Q;  1VQM A;  3BU2 A;  3CC2 A;  1VQK A;  1JJC B;  3ULJ A;  1KAW A;  1NE3 A;  3PSI A;  2QA4 A;  1YI2 A;  2JA6 H;  3MXN B;  3J81 c;  3U58 A;  3CCU A;  1PH4 A;  3H3V I;  2IX1 A;  1WJJ A;  4KHP Q;  1UE1 A;  3K7U C;  1PVO A;  1VQ8 A;  4JI7 Q;  4GOP C;  3PUY A;  1JJG A;  4R4I A;  4IFD G;  2E2I H;  2UXD L;  2JA9 A;  4GN4 B;  2EXD A;  3T1H Q;  4UY8 C;  4DUY Q;  4IPH A;  4JI8 Q;  3PIO A;  4P75 A;  4JBM A;  4JI6 L;  3AYH B;  2MQH A;  1XMQ Q;  2VY3 A;  1PV4 A;  4PMW A;  4DR1 L;  4DR3 L;  1MJE A;  4A3D G;  3EN2 A;  4DPG A;  1XMO Q;  2VQE L;  2HHH L;  4IOA A;  4IFD I;  1X56 A;  2N78 A;  2F4V Q;  1AH9 A;  3CC7 A;  4OON A;  4NXM L;  1N32 Q;  4X65 L;  1D8L A;  1U5K A;  1VQI A;  4R4O A;  1YHQ A;  1KXL A;  1C7Y A;  5AJ3 L;  2B63 H;  3K80 C;  1YHB A;  4X62 Q;  4JI0 Q;  3TEH B;  1Y1W H;  1N34 L;  4DUZ L;  3CF5 A;  2PQA B;  4QIW E;  3CCL A;  4LF9 Q;  2UUA Q;  2R7Z H;  4A3C H;  4A3I G;  3I55 A;  3F2C A;  5M5X H;  3F2D A;  4OO1 I;  1E24 A;  4DV3 L;  1Q81 C;  1Q46 A;  1VCI A;  3EBE A;  3KFU A;  2PMZ E;  4JC0 A;  4LUO A;  4QL5 A;  4LFC L;  3RN5 A;  1QZH A;  1PYB A;  1VQC A;  4A3F H;  1M1K C;  3E9H A;  4GLX A;  4DKA C;  3GTG H;  2R93 H;  3FP9 A;  2E5L Q;  4OWW B;  1VQB A;  4HIK A;  1M90 C;  5M3F G;  4DV0 L;  4GNX B;  2ZTE A;  1B8A A;  5K36 G;  2CWP A;  1QVF A;  3RR5 A;  1NMF A;  5GQO A;  1S3O A;  2NN6 G;  3J7A 5;  1HNW Q;  1NBW A;  3BZC A;  2CKZ B;  3H3V H;  1EQR A;  4KHZ A;  4JOI C;  1HZA A;  4RMF A;  3OYY A;  4YY3 Q;  2XTI A;  4LF4 L;  1LUZ A;  5FLX c;  2B3G A;  3S1M H;  2DGY A;  2YU9 H;  5JEA J;  4LFB Q;  2CFM A;  4POG A;  4LWC A;  3CPF A;  3M4O H;  1GO3 E;  1OXV A;  4X64 L;  2A8V A;  4A3B G;  4A3L G;  3KYH C;  2VQF Q;  5LMN Q;  1A62 A;  4HJ8 A;  1VQP A;  1K73 C;  1Q82 C;  3PO3 H;  4HIO A;  3K0X A;  1XPR A;  3PO2 G;  1RL2 A;  4DR7 L;  3ULL A;  4JBW A;  4R4T A;  1LTL A;  3G6E A;  2JA5 H;  1E22 A;  3CCQ A;  3DLL A;  3KF6 A;  3MEF A;  1XNQ Q;  1LYL A;  5HY6 A;  2Q2T A;  1Y1V H;  2WB1 G;  5EAY A;  3J80 c;  3S16 H;  1WFQ A;  2GVA A;  3VDY A;  3KDF B;  3STB D;  4JV5 Q;  4LFA L;  1PA6 A;  1BBU A;  1YBY A;  2ZM6 L;  2CQO A;  1X9N A;  4OXP A;  3CD6 A;  2UXC L;  3G48 A;  3CCE A;  4JBJ A;  4DR6 Q;  4OWT B;  1N36 L;  1HR0 W;  4IO9 A;  1X6O A;  4DR2 Q;  5M5Y H;  4DV7 Q;  4HJ7 A;  1SFO H;  1JB7 A;  3S1N H;  1IBL L;  1E3P A;  1P8L A;  2A1A A;  3OTO L;  4DNI A;  4GN5 A;  5IE8 A;  1UE7 A;  1Q8K A;  3K8A A;  1PH8 A;  4WJ3 M;  1VQJ A;  3OW2 A;  1K3R A;  1VQ4 A;  1IBK L;  1HZB A;  5JEA G;  3U4Z A;  1WYD A;  4PZ7 A;  2WP8 J;  4HJ5 A;  1TWG H;  1EOV A;  4A3E G;  3HFZ B;  1Y1W G;  1Y14 B;  3GTK H;  1FVI A;  2CCZ A;  4A3C G;  4A93 H;  4GS3 A;  2HQL A;  1I3Q H;  3CCS A;  2MFI A;  2JA8 G;  1TWA H;  3M9B A;  1VQ7 A;  3HOU G;  4YWL A;  2QEX A;  1TXY A;  2CWA A;  1QVC A;  2K5V A;  1T9H A;  1R9T H;  3AFP A;  4DV2 Q;  4IJH A;  5M3F H;  1OXS C;  4K0K L;  2BA0 A;  2KHI A;  5J3B A;  5H1S E;  3GDE A;  3T1Y Q;  1L0W A;  2ZTC A;  2FXQ A;  1KQS A;  4HIM A;  3M4P A;  4OO1 G;  1X3E A;  3ZJY C;  3AFQ A;  4OX9 Q;  1I94 Q;  4APV A;  1TWC H;  5IT9 c;  1SRO A;  5M5W H;  2EQS A;  1KIX A;  4NPS A;  3U4V A;  2I5L X;  4IPG A;  4A76 A;  4JI4 L;  1B70 B;  1LM0 A;  2NVQ H;  4JI5 L;  2ALY B;  4JI3 Q;  2JEB I;  3GTJ H;  4DV4 L;  2RHQ B;  3JC6 6;  3D31 A;  3I4N H;  4KHP L;  1IBM Q;  4JI7 L;  4A4I A;  3UE1 A;  3M85 A;  4A3G H;  1A63 A;  3CXC A;  5E7N A;  3K81 C;  2ZTD A;  3K7A H;  4KLK A;  4B3S Q;  1N8R C;  2R92 G;  1VQD A;  1OTC A;  1BBW A;  4DUY L;  1WCM G;  2MO1 A;  1G51 A;  3ICE A;  1XMQ L;  3PO3 G;  2PNH A;  5IYB H;  4UP8 A;  1NMG A;  3JAM i;  2JA7 H;  1UWV A;  2I0Q A;  4BA1 I;  1AE3 A;  5ELN A;  2JA5 G;  5GAG C;  3E0E A;  1AE2 A;  1Y1V G;  2YV5 A;  5FJ8 H;  3HKZ E;  4P72 A;  4JI2 Q;  3I56 A;  4X62 L;  1NJI C;  4BBS H;  4X6A H;  2UU9 L;  1FJG Q;  1YJN A;  1QVG A;  5GAE C;  2UUA L;  2BA1 A;  3FHW A;  1EUJ A;  2Q2H A;  1EWI A;  4IPD A;  3SGI A;  3RNU A;  1A8V A;  3S1Q H;  5IP7 H;  3I7F A;  2UUB Q;  4QGU A;  1HNZ Q;  3HOV H;  4BA2 I;  5JJL A;  2NVY H;  1I5F A;  2UUC L;  5C4J H;  4LW1 A;  4A3E H;  1XTD A;  4B3M L;  3M7N A;  1K0R A;  5JJK A;  3HKZ G;  1Z9F A;  1VQH A;  2JA8 H;  3FKI H;  2GVB A;  2E5L L;  1NTG A;  2KEN A;  4P73 A;  3W1G A;  3A5U A;  3HOU H;  1OXU A;  2A19 A;  4B3T Q;  4DR4 Q;  2H5X A;  3A5Z B;  4KI0 A;  3UE0 A;  4AH6 A;  4L5R C;  1XNR Q;  2K5N A;  1Z47 A;  4YCW A;  1GVP A;  4JOI A;  5GAH C;  1TWF H;  1QZG A;  2OTL A;  4AQY L;  2JJQ A;  1SR3 A;  4UP9 A;  4LF5 Q;  2NVX H;  1L1O C;  2JEA I;  1I6H H;  4WJ4 A;  2I5M X;  2UXB Q;  3J7Z C;  3UDX A;  3GTM H;  4GLV B;  4YY3 L;  4JI4 Q;  2QGQ A;  2ZJR A;  1SMX A;  4JI6 Q;  1YVC A;  1VQ6 A;  1SLJ A;  2Y0S E;  4DR3 Q;  1FL0 A;  1KHI A;  2EIF A;  1MKH A;  4GKJ Q;  2VQE Q;  2HHH Q;  4L5T A;  5IWA L;  2VQF L;  4B3R Q;  4NXM Q;  2WFW A;  4TQU S;  4BY1 G;  1PH5 A;  5ELO A;  2D0P A;  1HNX Q;  1JMC A;  2WB1 E;  3HOZ G;  1HR0 L;  1SRU A;  1HZC A;  4DV1 Q;  4LF7 L;  2NVT H;  1DGS A;  2VNU D;  1Q7Y C;  1XNQ L;  1PYS B;  3NEN A;  4LNQ A;  4Y52 H;  3W1B A;  2R92 H;  3WWV A;  4J15 A;  4POF A;  2ASB A;  3I4N G;  1E1T A;  4A3J G;  3KF6 B;  2N3S A;  5LMU Q;  1WCM H;  2Y0S G;  2NZH A;  4O0A A;  3RLF A;  4A3G G;  1PH9 A;  2E2J H;  5IP9 H;  2VW9 A;  2JE6 I;  4DR5 Q;  2N8N A;  1L2F A;  1VS0 A;  3TS0 A;  4LFC Q;  4QJF A;  3AEV A;  4DV5 Q;  4DR6 L;  2ATW A;  1X55 A;  2IHE A;  4MTN A;  3A0J A;  3CCM A;  1S72 A;  1GM5 A;  2LXK A;  5IYB G;  4DV0 Q;  2JA7 G;  4JYA Q;  1CKM A;  1X54 A;  2IHF A;  4XIG S;  1YJW A;  3CPW A;  1CKN B;  5LMN W;  3HOW H;  3L2P A;  4Y7N H;  2D62 A;  5FJ8 G;  1QUQ B;  1VQO A;  4NXN L;  3PUZ A;  3AQQ A;  3EIV A;  4LUV A;  3S17 H;  3ULP A;  1I50 H;  1CKN A;  4BBS G;  4BBR H;  2JK8 A;  1P16 A;  1QUQ A;  5IY0 A;  5FLM H;  4GKK Q;  2RCN A;  4GNX C;  2WAQ E;  5IP7 G;  3HOV G;  2LXJ A;  5C4X G;  2PI2 A;  4P71 A;  4FDB A;  4YWM A;  1VQE A;  3PUV A;  1Q1B A;  2BH2 A;  4A93 G;  2HIX A;  4C3I H;  3BZK A;  4A75 A;  3T1Y L;  4DV6 L;  4DR7 Q;  3FKI G;  2VUM H;  3H0G G;  4JI1 L;  3LGJ A;  2ZJQ A;  4O2D A;  2AHO B;  1N33 Q;  4XTC S;  4OX9 L;  3GTO H;  2VL6 A;  1FGU A;  1OXT A;  1WI5 A;  2DUD A;  4YHH L;  2ES2 A;  1YJ9 A;  2K75 A;  2WAQ G;  3GD7 A;  2ZM6 Q;  3KOJ A;  4HJ9 A;  1J5E L;  4LF6 L;  3RLN A;  5C3E H;  2OQ0 A;  4EX5 A;  2HIV A;  2K52 A;  3BJU A;  1C9O A;  2AWO A;  3PGZ A;  5IYC H;  1TWH H;  3ER0 A;  4GOP B;  4BY1 H;  3PUW A;  1SE8 A;  4JG2 A;  3HOZ H;  2PI2 E;  3F1Z A;  2Z6K C;  3G4S A;  4LF8 L;  3OTO Q;  3TS2 A;  4B3S L;  1HZ9 A;  1D7Q A;  5GRO A;  1KRT A;  1JE5 A;  4X66 Q;  4GOP A;  4A3J H;  3D0F A;  1VQG A;  1IBK Q;  4QQB X;  3F2B A;  1B7Y B;  2K50 A;  3S2H H;  3IRB A;  2YTY A;  2OQK A;  3U50 C;  1PH3 A;  3I4O A;  1JT8 A;  3T1H L;  2GN5 A;  3RLO A;  4JI8 L;  4AYB E;  3KJO A;  3KJP A;  1XPU A;  1HH2 P;  2BH8 A;  5C0X J;  2IY5 B;  1V43 A;  3CAM A;  3KF8 B;  5IP9 G;  1FJG L;  4K0K Q;  1XMO L;  3E9I A;  2Q2I A;  3M4Q A;  2F4V L;  3TRZ A;  1N32 L;  4C2M H;  2UUB L;  1X3G A;  2D0O A;  3S1R H;  1HNZ L;  2AKW B;  1VQL A;  5GAD C;  1VQ9 A;  4DAY B;  4JI0 L;  4L5S A;  1Q1E A;  1BVS A;  2ID0 A;  1V1Q A;  4A3K H;  2AWN A;  4C3H H;  4LF9 L;  2K5H A;  3HOW G;  4AYB G;  3Q8D A;  5BR8 Q;  2F52 A;  5C4X H;  4JI5 Q;  1L1O A;  4B3T L;  4DR4 L;  4MZ9 A;  1N9W A;  3PUX A;  4R4Q A;  2MNA A;  4DV4 Q;  4A3M G;  4BBR G;  3JAM c;  1ASZ A;  1XNR L;  3PF4 A;  5JJI A;  5FLM G;  4HJA A;  4LF5 L;  1K8A C;  3H0G H;  1E1O A;  2UXB L;  3S15 H;  4MNO A;  4BXX H;  3H15 A;  4IPC A;  3NEL A;  4OWX B;  3S14 H;  3GTL H;  2VUM G;  4HID A;  1YIT A;  1GD7 A;  1VQF A;  4GKJ L;  1HNW L;  1UEB A;  2N49 A;  5C0X G;  2E2H H;  3CW2 C;  4B3R L;  3NBH B;  3NEM A;  1HNX L;  2UXD Q;  1VQ5 A;  1UE6 A;  3TQY A;  2OCE A;  1GKH A;  4DV1 L;  4LFB L;  2RHS B;  3CCV A;  2F3I A;  1MIU A;  1KC8 C;  2UU9 Q;  1C0A A;  4DR1 Q;  1EIF A;  3HOX G;  5C3E G;  1EFW A;  2RF4 A;  1A0I A;  1K8G A;  2V1C C;  2OWO A;  2L15 A;  5IYC G;  4IJL A;  3UDG A;  5C0X I;  2OTJ A;  5LMN L;  1BKB A;  4X65 Q;  5LMU L;  2HT1 A;  1KD1 C;  2YYZ A;  1MJC A;  1U0L A;  2PQA A;  5C44 G;  3UDI A;  5AJ3 Q;  4DR5 L;  4PZ8 A;  2UUC Q;  4B3M Q;  1N34 Q;  4DUZ Q;  4DV5 L;  2R7F A;  4QY7 A;  1H95 A;  1IXR A;  4PZ6 A;  4LUZ A;  1XJV A;  4R4C A;  1Q86 C;  1NY4 A;  1PFS A;  4ME3 A;  1ASY A;  4JV5 L;  1PH7 A;  4DV3 Q;  4AIM A;  3S24 A;  1YIJ A;  1PH1 A;  2K4K A;  1XPO A;  4BY7 G;  3HOY G;  4JYA L;  3CQZ H;  2KCM A;  1PH2 A;  4LF7 Q;  3I4M H;  4AQY Q;  5M3M H;  3CP0 A;  4DR2 L;  3CME A;  4DV7 L;  3GTP H;  3CCJ A;  3RZD H;  3J80 i; 
#chains in the Genus database with same CATH topology
 2SNS A;  4GKK L;  1KTK A;  2MHV A;  2LSS A;  4UP7 A;  1BDO A;  4KD4 A;  1K28 A;  1ROD A;  1HTL D;  3HG9 A;  1GUW A;  1X65 A;  2B2W C;  4X64 Q;  1S40 A;  3I4M B;  2Q2U A;  4JCV E;  2KED A;  4UDU C;  3GTP B;  1ESR A;  5BN3 A;  4A3D H;  2NZO A;  3RZO B;  2B2V A;  1HHV A;  4B9X A;  2Z6K A;  1PH6 A;  3HOW B;  1ZYR C;  2XRS D;  5DLQ E;  1PRT F;  3MVV A;  2UXC Q;  4X66 L;  5T1G A;  5HGQ A;  1U9R A;  4A3I H;  1VQN A;  1LTS D;  1OXX K;  3L7Z C;  1O7I A;  5D14 A;  3H3V C;  4C1N I;  4XQQ A;  1IZ6 A;  2PW7 A;  2EYM A;  1I4G A;  1WTO A;  2Z0S A;  1I4P A;  4YCV A;  4BY7 H;  2LS0 1;  5KNB A;  5C6A A;  4DV6 Q;  4FF3 A;  2JQO A;  1O80 A;  1HJP A;  2PNR C;  2L12 A;  4C3J B;  1SND A;  1B50 A;  1NAP A;  1STN A;  1GUG A;  2F0D A;  2YTX A;  3VA7 A;  2C35 B;  4TRD A;  1G2T A;  5IYD G;  4LF8 Q;  2AQ3 B;  3CC2 A;  1JOR A;  1VQK A;  2QA4 A;  1V1O A;  3U58 A;  3K7U C;  2PMZ B;  1VQ8 A;  2BE5 C;  4JI7 Q;  3NUC A;  1K83 B;  3MA2 B;  1JJG A;  5FO9 B;  4IFD G;  2E2I H;  2UXD L;  3PIO A;  1V1P B;  2B2Y A;  4JI6 L;  3AYH B;  2MQH A;  2F3W A;  1PV4 A;  4PMW A;  1EY7 A;  1LV9 A;  2VQE L;  2HHH L;  3CC7 A;  1N32 Q;  1QNU A;  3NSW A;  1I6V C;  3OHX C;  1D8L A;  1U5K A;  2QIL A;  3QWN A;  3K5M A;  3K80 C;  1YHB A;  2IJ0 A;  3K5N A;  1Y1W H;  4HMJ A;  4QIW E;  1EOT A;  3I55 A;  3F2C A;  1HPC A;  4OO1 I;  1Q81 C;  2XVS A;  4OL7 A;  3EBE A;  3KFU A;  5ELB A;  3MEH A;  1QZH A;  2EDG A;  1VQC A;  2CH4 A;  3E9H A;  4GLX A;  1SYF A;  3QOL A;  2E5L Q;  3E6Z X;  1M90 C;  2ZTE A;  4RGN A;  4CJ2 C;  1SNC A;  2CWP A;  2O5I C;  1QVF A;  1NMF A;  2EYP A;  1EIH A;  1V8Q A;  2CKZ B;  3NE5 B;  1HZA A;  3T51 B;  4CDD C;  4PMB A;  3OIQ A;  4A3L G;  1JOK A;  3D4D A;  4XXE A;  1LT4 D;  1A62 A;  1K73 C;  2EY6 A;  4DR7 L;  3ULL A;  4R4T A;  3G6E A;  4IFD H;  5IIF A;  2DN8 A;  2KQ3 A;  3I73 A;  4IUR A;  1LYL A;  4K8J A;  5HY6 A;  2Q2T A;  1Y1V H;  2WB1 G;  1ENF A;  1JWS D;  2NTT A;  3O13 A;  2ZM6 L;  2CQO A;  3C1F A;  4OXP A;  3CCE A;  2YU9 B;  4DR6 Q;  1ICW A;  1HR0 W;  4G7O C;  3HS0 C;  3VR5 A;  1SFO H;  3S1N H;  1ZYR D;  1E3P A;  3BDO A;  1JOO A;  5A2Q L;  3KLS A;  5I6Y A;  4DNI A;  4GN5 A;  5IE8 A;  1AZQ A;  1UE7 A;  1BO0 A;  1PH8 A;  1B2T A;  1IBK L;  5J1Z A;  4KTA A;  3U4Z A;  4FXG C;  4HJ5 A;  4A3E G;  3S16 B;  1EOV A;  3GTK H;  1ML0 D;  2HQL A;  2MFI A;  1VQ7 A;  3AU7 A;  5C5M A;  2QEX A;  3AFP A;  3GDE A;  4KN4 C;  1L0W A;  1KQS A;  1NCV A;  3ZJY C;  3AFQ A;  4A3I B;  1H9J A;  1Q90 A;  1SNO A;  1SRO A;  2AUK A;  5M9O A;  2F0J A;  2DNC A;  2OF1 A;  1I3Q B;  2E2D C;  3HP3 A;  3JC6 6;  5EGT A;  5ELF A;  1H9M A;  4C56 C;  3UE1 A;  3CXC A;  5E7N A;  5M3F B;  3K7A H;  1F2M A;  5DM7 3;  2NBF A;  2F0T A;  3TP8 A;  3OW7 A;  3D6W A;  2PNH A;  4ZKB B;  3JAM i;  1UWV A;  4NKL A;  5ELN A;  3DEP A;  5GAG C;  4ZUI A;  4Q5V A;  5JPN C;  1PDQ A;  2B2U A;  4JI2 Q;  3VR3 A;  1NJI C;  1MGS A;  2BA1 A;  4A3G B;  1EYC A;  2QEJ C;  3SK6 A;  1A8V A;  4O1N A;  4DAY A;  5IP7 H;  3HOV H;  3LX0 A;  4LW1 A;  4A3E H;  3MFG A;  3M7N A;  4FO2 A;  5IGD A;  2K5D A;  2GVB A;  5C4H A;  1HRJ A;  2JA7 B;  4UAI A;  4KD3 A;  4ME5 A;  1OXU A;  4DNT B;  4L5R C;  3NWS A;  3CRK C;  2OTL A;  4A93 G;  4UP9 A;  3SEB A;  1ET9 A;  1L1O C;  1R4P B;  2I5M X;  2OXP A;  3J7Z C;  4NMZ A;  1TY2 A;  4GLV B;  5CGK A;  4L6T B;  1YNN C;  2D2C C;  2IL8 A;  2Y0S E;  1Y1W B;  3SHL A;  2L5T A;  3VR6 A;  2VQF L;  3HOZ G;  2OEO A;  1PFN A;  4ID6 A;  5FLX E;  3N52 A;  1Q7Y C;  1PYS B;  4LNQ A;  1I4X A;  4Y52 H;  1TWF B;  4CDF C;  2QDB A;  4J15 A;  3WWV A;  1I6H B;  3U9O A;  2HDL A;  4O0A A;  2N8N A;  1VS0 A;  4QJF A;  5KIX A;  4DV5 Q;  4HR7 B;  1SMY C;  3J80 E;  4PV1 C;  2IW3 A;  1FNU A;  4JYA Q;  1YJW A;  3CPW A;  2F0L A;  2SDF A;  3TSS A;  3PUZ A;  3AQQ A;  4BWG B;  3RUZ A;  3J7Y W;  4BBS G;  5DAU A;  4BBR H;  5ELD A;  3VR4 A;  4GKK Q;  2MPM A;  1D2B A;  2WAQ E;  5C4X G;  4FDB A;  5L37 A;  1Y1V B;  5CV6 A;  2BH2 A;  4DF7 A;  4C3I H;  2F0W A;  3QJY A;  3BZK A;  3DMU A;  3T1Y L;  4DV6 L;  2EYL A;  3FKI G;  2VUM H;  1MHW C;  3KLS X;  3LGJ A;  3QOJ A;  1IW7 D;  3VA5 A;  2AHO B;  2K5W A;  4E6I A;  1FGU A;  2HUG A;  4K2K A;  1F9S A;  3S1N B;  1WI5 A;  2BDO A;  3S17 B;  2K75 A;  3GD7 A;  3MFY A;  3RLN A;  2EJG C;  3QO2 A;  4PMC A;  4HSP A;  2HIV A;  4EQN A;  3PGZ A;  3HOZ H;  4JG2 A;  5IGG A;  4LF8 L;  2QKI C;  3TS2 A;  3GTK B;  1F9Q A;  2AUJ D;  4K14 A;  1KRT A;  1JE5 A;  1H9K A;  2DJG C;  4X66 Q;  1Y69 U;  3D0F A;  1VQG A;  1CK1 A;  3DUZ A;  1EEF D;  3F2B A;  1KDB A;  1Z7T A;  1UNS A;  1LTR D;  1ILQ A;  4IUN A;  3K0Y A;  5T1I A;  2K03 A;  1SYE A;  5COR A;  1CHQ D;  3OOC A;  2GN5 A;  3RLO A;  4AYB E;  5C3E B;  3KUP A;  1TR5 A;  3R2T A;  1HH2 P;  1X32 A;  3CAM A;  1FJG L;  3M4Q A;  2KCN A;  3TRZ A;  1N32 L;  1VQL A;  2A69 C;  4KKT A;  4LK1 C;  1S5F D;  1C48 A;  3HOW G;  1K8O A;  5C4X H;  1LAC A;  4WJ3 M;  4DV4 Q;  1CM9 A;  5JJI A;  1BQQ T;  1SEB D;  3A8I E;  5CC4 A;  1Q3L A;  3MXN A;  4MNO A;  1I4Q A;  4BXX H;  3NEL A;  2VB3 X;  1E2W A;  2E74 C;  4OWX B;  4XQJ A;  1W6K A;  3Q0A A;  1VQF A;  4EQO A;  4GKJ L;  1MSG A;  2N49 A;  2E2H H;  1KNE A;  3NBH B;  3NEM A;  1AFP A;  2UXD Q;  1VQ5 A;  3HOV B;  1YNN D;  2OCE A;  1T5X D;  1OO9 B;  3CCV A;  2HDM A;  1PTO H;  3Q24 A;  4FF2 A;  2V1C C;  4HSV A;  5IYC G;  4IJL A;  3UDG A;  5C0X I;  1BKB A;  2BCO A;  3S15 B;  5ELC A;  4CDE C;  1O7Z A;  4PZ6 A;  1QJO A;  4R4C A;  1Q86 C;  1DYQ A;  2B2T A;  3FPU B;  1PH7 A;  5D3I B;  1YIJ A;  4LF7 Q;  3I4M H;  3D6C A;  4AQY Q;  5M3M H;  4RGO S;  3CME A;  3GTP H;  3DEO A;  1SMY D;  3CCJ A;  4GNX A;  3RZD H;  5HGT A;  1GUS A;  3RZO H;  1FD7 D;  4RH6 A;  5A35 A;  3S9W A;  3W5O A;  3L0O A;  5CR3 A;  1LT3 D;  1WOC A;  2VS1 A;  3J7A V;  5LHY 1;  2NN6 I;  2J4X A;  3K59 A;  1JJ2 A;  4JW0 A;  1ET6 A;  1HR0 Q;  3M3Y H;  2O5J C;  1TVX A;  1CSQ A;  2Z8L A;  4P74 A;  4M1U B;  2HQE A;  3GO5 A;  4ILW A;  4CBV A;  3PIP 3;  5I2Y A;  2YTV A;  3STB C;  3PIP A;  3EQL C;  3SK4 A;  2R7D A;  4V0B A;  1EIY B;  3KDF A;  3OWE B;  2ZJP A;  3J81 j;  4DK3 C;  4A3M B;  4UPA A;  2MO0 A;  1S4Z A;  1RDP D;  2RBM A;  1W3S A;  1IL8 A;  4C3J H;  2E8G A;  3GTQ B;  3VYU A;  3CMA A;  3NQT A;  3T13 A;  2F1M A;  1YZ6 A;  4C3I B;  1WTQ A;  1UE5 A;  2JP1 A;  1IYJ B;  4IFD J;  4R1J A;  1EQV A;  1BCP B;  2KCT A;  1F2L A;  4PG3 A;  1H9S B;  4S3S A;  1AN8 A;  1S5D D;  4NB3 A;  4JI2 L;  4ZLT F;  3CCR A;  4DK6 C;  4XT3 B;  5J22 A;  1K83 H;  4X3K A;  3HKS A;  3R93 A;  1CUK A;  3OWF A;  4YHH Q;  3C1E A;  4P2C B;  1EYG A;  4RGT A;  3LNN A;  1X3F A;  5BR8 L;  1VQA A;  2A69 D;  4FP5 D;  4A3B H;  1V9P A;  4GLA C;  1KRS A;  3PO2 H;  1K9M C;  2IT1 A;  2K6A A;  3HOY B;  3BU2 A;  1JJC B;  2EY1 A;  1YI2 A;  3PSI A;  3K57 A;  2K1B A;  3H3V I;  4F8M A;  3JAM E;  1STY A;  1II3 A;  1GXD C;  3E5S A;  3R3O A;  4XDX A;  4K5X A;  2LY7 A;  4X3U A;  4FXK C;  4EGV A;  1UAP A;  2JA9 A;  4GN4 B;  2A68 C;  2EXD A;  4JBM A;  4QUC A;  2SEB D;  1J9O A;  4A3D G;  2VY3 A;  2KA7 A;  4DPG A;  4IOA A;  1AH9 A;  1KDC A;  4X65 L;  4R4O A;  1VQI A;  2JA6 B;  2F0E A;  1KXL A;  1C7Y A;  3TEH B;  4DUZ L;  2JN4 A;  3HZX A;  4LAA A;  3H09 A;  4ZRZ A;  4A3I G;  3TDQ A;  3BVG A;  4DV3 L;  2KEC A;  3RN5 A;  4U67 3;  1M1K C;  3GTG H;  4CHT B;  4HIK A;  1XYI A;  5M3F G;  1FNW A;  1QB5 D;  2J7Z A;  2L4N A;  1PTO B;  2N55 A;  5GQO A;  2Z4I A;  2R7Z B;  1NBW A;  2X6G A;  3BZC A;  4FF1 A;  1EQR A;  4KHZ A;  4JOI C;  4FF4 A;  3QG1 A;  5D3D A;  2DGY A;  2YU9 H;  4G7Z C;  4LFB Q;  3KBG A;  4POG A;  3CPF A;  1GJX A;  2PZU A;  1OXV A;  2QW7 A;  3BG3 A;  3ZYY X;  4A3F B;  1J8I A;  2VQF Q;  1JB3 A;  4HJ8 A;  3PO3 H;  4HIO A;  3C2P A;  1NUC A;  3SK8 A;  1LTL A;  3S16 H;  1HQR D;  5EAY A;  2F0O A;  5M3M B;  1LT6 D;  4HAE A;  3STB D;  4JV5 Q;  4LFA L;  1BBU A;  3RZD B;  1YBY A;  1E0B A;  2K7V A;  1EY9 A;  4L8J A;  4OWT B;  3GP7 A;  3NPP A;  1N36 L;  4OO1 H;  4DR2 Q;  4HJ7 A;  1IBL L;  2RCF A;  2LMC B;  4RHS A;  3M3Y B;  1KAA A;  1VQJ A;  1IYU A;  3NWT A;  1VQ4 A;  5JEA G;  1WYD A;  2PZW A;  1PTO C;  1Y1W G;  3MC0 B;  4GS3 A;  1I3Q H;  4MIU A;  2CWA A;  1QVC A;  1R9T H;  1T9H A;  2Z6B A;  4IJH A;  5M3F H;  1DJR D;  1HCZ A;  2KHI A;  3DXJ C;  5J3B A;  5H1S E;  3T1Y Q;  2L1B A;  3M4P A;  3MHB A;  2H1E A;  4L63 B;  2B2V C;  5M5W H;  1KIX A;  1TWG B;  2I5L X;  4JI4 L;  1B70 B;  3K6O A;  4JI3 Q;  3I4N H;  4DV4 L;  2RHQ B;  3D31 A;  1IBM Q;  4A3G H;  1A63 A;  3NBI A;  3BYY B;  1STA A;  2MO1 A;  1IKL A;  3J81 E;  3ICE A;  5IYB H;  4UP8 A;  1NR4 A;  2JA7 H;  4BA1 I;  1TS2 A;  3PIO 3;  3E0E A;  3UI2 A;  1Y1V G;  2K32 A;  2A68 D;  1WTX A;  3KF8 A;  2NVQ B;  4A3B B;  4KKU A;  1M8A A;  3A54 A;  3VYT A;  4X62 L;  2KHS A;  3GTJ B;  1FJG Q;  5G3L D;  1YJN A;  1QVG A;  1KLU D;  1SNM A;  1D5X C;  3PO2 B;  1EWI A;  1KNA A;  3V96 A;  1DON A;  5JJL A;  1L0X B;  3TZU A;  5JEA H;  2FFK B;  3P20 A;  1EQT A;  2VB2 X;  4DAP A;  1K0R A;  5JJK A;  5IGE A;  3HKZ G;  4DGZ A;  3T4A C;  2ZXR A;  3OMG A;  3W1G A;  3C3L A;  2G5D A;  3VYS A;  1B3Q A;  4NDX A;  2FIN B;  1SE2 A;  1F77 A;  3A5Z B;  4AH6 A;  4GZY C;  2EY2 A;  2F4I A;  4X3S A;  1NR2 A;  4IZ8 A;  2MJ8 A;  5GAH C;  1TWF H;  4LF7 L;  1I6H H;  4AQY L;  2JJQ A;  2JEA I;  4FYD A;  4WJ4 A;  4HTH A;  5EKK A;  2RSO A;  2AQ1 B;  3UDX A;  3GTM H;  4YY3 L;  1RF2 D;  4DFA A;  1DXM A;  1SMX A;  2NVY B;  1SLJ A;  1KHI A;  3CRL C;  4PNY A;  5CMD A;  1MKH A;  4GKJ Q;  4KN7 C;  3VR2 A;  2B8F A;  2JA8 B;  2B2Y C;  3IL8 A;  4NXM Q;  4TQU S;  1PH5 A;  3HOU B;  1HR0 L;  1STB A;  2PCF B;  1SRU A;  1HZC A;  2EYH A;  2C5C A;  1XNQ L;  1G2S A;  3W1B A;  2ASB A;  4ZQ3 A;  3GTG B;  3F2U A;  3RLF A;  3TP7 A;  1W6J A;  2VW9 A;  4LFC Q;  2NTS A;  2O2L D;  1X55 A;  1S72 A;  1B9N A;  2KEE A;  2LXK A;  2K28 A;  1FNV A;  1CKM A;  1X54 A;  1CKN B;  5LMN W;  1STE A;  3L2P A;  2NVT B;  4Y7N H;  1D1I A;  2PW5 A;  4FVM A;  4CJ1 B;  4WOR A;  1SE4 A;  3S17 H;  2R92 B;  2BDN A;  1I50 H;  1CKN A;  2JK8 A;  1WCM B;  5FLM H;  2RCN A;  1HA6 A;  3PO3 B;  5IP7 G;  3HOV G;  4RA8 A;  4P71 A;  2F0Q A;  4YWM A;  1PTO D;  1Q1B A;  2HIX A;  3IFT A;  4A75 A;  2ZJQ A;  1PXU A;  1DOM A;  1IW7 C;  4OX9 L;  1TII D;  2EJF C;  4YHH L;  1U4L A;  1EY0 A;  4OIJ A;  1EWC A;  5E1F A;  5C3E H;  4X3T A;  4H7B A;  2FJ2 A;  2LKV A;  4RCN A;  1XX8 A;  1BUV T;  1C9O A;  3OMC A;  2I07 B;  5KRU A;  1TWH H;  3ER0 A;  4GOP B;  3PUW A;  2PI2 E;  3OTO Q;  5IT9 E;  5CBA E;  4B3S L;  1D7Q A;  5GRO A;  4GOP A;  3FPP A;  4ZCK A;  5IGB A;  3GTO B;  1R9T B;  5K5P A;  5JPM C;  3S2H H;  3IRB A;  2OQK A;  3SR1 A;  3I4O A;  2RA4 A;  3KJP A;  1DCZ A;  3E0J A;  2BH8 A;  1ICF B;  4DA2 A;  4BY1 B;  2K01 A;  1SNP A;  3E9I A;  3FEW X;  1AP0 A;  2Q2I A;  5M5W B;  1CTM A;  1X3G A;  2D0O A;  1HNZ L;  2AKW B;  4DAY B;  3I4N B;  1LTB D;  4A3J B;  2ID0 A;  3PQI A;  4A3K H;  2AWN A;  4C3H H;  4WFN 3;  4IUQ A;  5BR8 Q;  4K5V A;  1L1O A;  4IN3 A;  1N9W A;  4R4Q A;  4A3M G;  3PF4 A;  1XNR L;  4BBR G;  3EA6 A;  3BDL A;  1CFM A;  4HCS A;  4LF5 L;  2KJX A;  4RHR A;  1CZW A;  3S15 H;  1JC7 A;  4C1N K;  3A56 A;  4C3I G;  2XN9 C;  2VUM G;  1U4R A;  2L55 A;  4HN7 A;  4KV6 A;  4MHE A;  5C0X G;  1HNX L;  3TQY A;  4DV1 L;  4LFB L;  4TKO B;  1EEI D;  1JR0 D;  2DY8 A;  5G3L F;  1KC8 C;  2UU9 Q;  1EIF A;  4IQZ A;  1C0A A;  2A73 B;  2B2U C;  3CKI B;  1K8G A;  2L15 A;  1S5B D;  2K5Q A;  3H0G B;  4X65 Q;  2A6H C;  2PQA A;  5FLX L;  2UUC Q;  3UDI A;  1PRT B;  4DR5 L;  4B3M Q;  1PZJ D;  3H6M A;  5C3X A;  4DUZ Q;  4QY7 A;  3GTL B;  1H95 A;  1PFS A;  4JV5 L;  4DV3 Q;  4AIM A;  1TT2 A;  2K4K A;  3GTM B;  3HOY G;  3CQZ H;  2KCM A;  3CP0 A;  1HTP A;  4DR2 L;  4DK0 A;  3J80 L;  1ZKO A;  5C4Z A;  1G91 A;  2C9O A;  5CV7 A;  2XGT A;  4LMQ D;  4PQX A;  1KL9 A;  2KHJ A;  2EOT A;  2IX0 A;  4A3M H;  1YHA A;  1YNX A;  4XYQ A;  1CQF A;  3V2T A;  3GTQ H;  1JE4 A;  5BN5 A;  2JA6 G;  3PF5 A;  2IPK D;  3B6Y A;  4JBK A;  4J1M A;  5KNC A;  1DOK A;  3ERS X;  4HCE A;  1K0S A;  3HRZ C;  4BXX G;  1B3A A;  2K14 A;  5C0X H;  1G6Z A;  4Y7N B;  2DY7 A;  1PHJ A;  1A6X A;  1SN8 A;  2R6G A;  4IAL A;  1DD2 A;  4TVA B;  4LFA Q;  4OGQ C;  1I50 B;  4L5Q A;  1O78 A;  2B29 A;  4JI3 L;  1N36 Q;  3SVM A;  1IKM A;  1J6Q A;  2NB0 A;  3UDF A;  1IBM L;  4TSS A;  3DWA A;  1IBL Q;  3PCO B;  4MN3 A;  2GA4 B;  3LWU A;  2R7Z G;  1SDF A;  3G71 A;  4ALP A;  2M2L A;  3HOY H;  1TS4 A;  2ZXO A;  4A3F G;  5EKL A;  4YWK A;  4IOC A;  1LT5 D;  3TRE A;  3HOX B;  2NN6 H;  5E4X A;  2EXZ A;  3J81 i;  1LTA D;  2VZA A;  2AQ2 B;  1TWH B;  3RN2 A;  2F0M A;  3I4M G;  5C44 B;  2SNM A;  2R3Z A;  5M3M G;  1J5E Q;  1YEZ A;  4LF6 Q;  5KYI A;  4RG1 A;  1HQM C;  2Z1C A;  3I2Z A;  2CHB D;  4N9P A;  5CYU A;  2Z9H A;  1VQM A;  3KLR A;  4JI4 Q;  3S2H B;  1KAW A;  2JA6 H;  3MXN B;  2A74 C;  3CCU A;  1SSO A;  2XWB B;  3M4Y A;  3U9S A;  4R4I A;  1GUO A;  1K8M A;  3KK7 A;  3M7G A;  4ZUJ A;  4YIJ A;  4UY8 C;  3K58 A;  4IPH A;  4JI8 Q;  1SYG A;  4P75 A;  5KGU A;  1CT1 D;  1IHZ A;  4DR1 L;  4H0L C;  1H9R A;  4QF4 A;  4A3K B;  4C3H B;  2N78 A;  2F4V Q;  1Y8P B;  4NXM L;  1JIC A;  5AJ3 L;  2RDF A;  4X62 Q;  3IKJ A;  4JI0 Q;  4G7H C;  3BS1 A;  3VYR A;  1DOL A;  4A3C H;  4LF9 Q;  2R7Z H;  4C3J G;  1SBB B;  1VF7 A;  5M5X H;  1QOH A;  4OIK A;  2A6H D;  3J7A F;  1Q46 A;  4LUO A;  4LFC L;  1PYB A;  4A3F H;  1EZ6 A;  4DKA C;  4OWW B;  2EE1 A;  3A8J E;  4GNX B;  1B8A A;  2B63 B;  1MSH A;  1ILP A;  2VXW A;  1YNJ C;  4IUT A;  1VDZ A;  3H3V H;  1C4Q A;  3G6J B;  4RMF A;  4YY3 Q;  4LF4 L;  1X3P A;  2XTI A;  1LUZ A;  5FLX c;  2B3G A;  4RAU C;  5JVG 3;  2B39 A;  5JEA J;  2G9D A;  2CFM A;  4F87 A;  2F0H A;  1GO3 E;  2A8V A;  4A3B G;  3KYH C;  2R93 B;  3IFD A;  5LMN Q;  1CA6 A;  1A3T A;  1Q82 C;  2WKD A;  3K0X A;  1XPR A;  3PO2 G;  1RL2 A;  4JBW A;  2JA5 H;  3CQZ B;  1E22 A;  5E3F A;  1XNQ Q;  1SAP A;  3MEF A;  3BVZ A;  3KF6 A;  3J80 c;  1WFQ A;  3VDY A;  3KDF B;  1B1Z A;  1PA6 A;  1D1K A;  4KKS A;  2MUY A;  2M9V A;  4F88 A;  1PRT D;  3S1M B;  4JBJ A;  4XQN A;  1X6O A;  2E76 C;  4ODG A;  3M4O B;  3EJI A;  1QNK A;  1JB7 A;  3R2I A;  1P8L A;  2NUC A;  2A1A A;  3V05 A;  3OTO L;  1EIG A;  4J6H A;  5ELE A;  1Q8K A;  1K3R A;  1DM0 B;  1HZB A;  4DAV A;  2EYJ A;  4PZ7 A;  2WP8 J;  1TWG H;  3QB3 A;  4B9W A;  1EL0 A;  5D65 A;  1FVI A;  1JOQ A;  2JA8 G;  3TP5 A;  3HOU G;  4YWL A;  4DV2 Q;  4RCO A;  1OXS C;  3MWY W;  2PO4 A;  4KK7 A;  4OX9 Q;  4CJ0 B;  1I94 Q;  4Q0F A;  1BBX C;  3GQB A;  4APV A;  1TWC H;  4M8A A;  3BVM A;  4NPS A;  1SJE D;  1LAB A;  2F0P A;  5AFW A;  3U4V A;  5C3W A;  4NW2 A;  4A76 A;  1LM0 A;  2NVQ H;  2ALY B;  4G4K A;  2JEB I;  3GTJ H;  1EY5 A;  4KHP L;  1ENA A;  3TP6 A;  5JOB A;  3Q23 A;  4QIW B;  1R4Q B;  2WV6 D;  4KLK A;  4B3S Q;  2XIW A;  1N8R C;  2R92 G;  1OTC A;  3Q22 A;  4DUY L;  1S5E D;  1WCM G;  3JAM L;  1XMQ L;  2NYZ D;  1B4O A;  3PO3 G;  4IUV A;  1AE3 A;  3EFX D;  1AE2 A;  2YV5 A;  4MTK A;  5FJ8 H;  3HKZ E;  2R61 A;  2JYO A;  1VMC A;  4X6A H;  2UU9 L;  4QUF A;  3FHW A;  2UUA L;  1BCP C;  2Q2H A;  4OO1 G;  4KJN A;  1HNZ Q;  1A3V A;  2NVY H;  5COY A;  4HMI A;  1QE6 A;  2UUC L;  3HEJ A;  4B3M L;  4ZAI A;  1PFM A;  1K3B C;  1VQH A;  1ENC A;  2I46 A;  2JA8 H;  1NTG A;  1BOS A;  3HOU H;  4QCL A;  2ZXP A;  1LTT D;  2A19 A;  3UE0 A;  4KI0 A;  1WD1 A;  1XNR Q;  2K5N A;  2J0T D;  1Z47 A;  4YCW A;  1GVP A;  4JOI A;  1KLG D;  1QWY A;  4LF5 Q;  1SR3 A;  4BBS B;  4V19 0;  2E75 C;  2EJM A;  2F0I A;  1RD9 D;  1UEA B;  1VQ6 A;  5C4J B;  3NHH A;  4DR3 Q;  1FL0 A;  1YNJ D;  1TS5 A;  4L5T A;  1GHJ A;  1IYV A;  2WFW A;  4BY1 G;  2B2W A;  5ELO A;  2D0P A;  5M5X B;  1HNX Q;  2WB1 E;  1JMC A;  1ONL A;  4DV1 Q;  2NVT H;  1DGS A;  3NEN A;  4OEL B;  2R92 H;  4POF A;  1F9R A;  3I4N G;  2NVX B;  4A3J G;  3NTH A;  1FGB D;  1SYB A;  2EVB A;  1WCM H;  2NZH A;  4A3G G;  4KHV A;  5IP9 H;  1AZP A;  4DR5 Q;  2QF7 A;  3MXP A;  3AEV A;  2KOL A;  4MTN A;  1PZK D;  3A0J A;  3CCM A;  1S5C D;  5IYB G;  2PYK A;  4DV0 Q;  2JA7 G;  2IHF A;  3FRP B;  2NZ1 D;  1LTG D;  3H91 A;  1VQO A;  3I4L A;  5EPJ A;  2H4O A;  4RFB A;  1Z6H A;  1ESF A;  3H94 A;  1P16 A;  5IY0 A;  2E2J B;  4OHJ A;  1BXT A;  3LWE A;  1HA5 A;  3RMH A;  5IGC A;  2LXJ A;  2JA5 B;  2PI2 A;  1STH A;  1VQE A;  2LFN A;  1F9P A;  4H13 C;  2HD3 A;  2KCC A;  3H0G G;  4Z9C B;  4O2D A;  4XTC S;  3GTO H;  1WTV A;  2K05 A;  1WVL A;  4RKL A;  1SE3 A;  3GV6 A;  5IGF A;  1J5E L;  4LF6 L;  1MBY A;  3MXG A;  1TY0 A;  1RTN A;  2AWO A;  3BJU A;  3I91 A;  1A15 A;  4BY1 H;  1WTH A;  2XSC A;  2X6L A;  2Z6K C;  1D5Z C;  3F1Z A;  5CV9 A;  4I65 A;  2FMM A;  4A3J H;  1BF4 A;  1B7Y B;  5C5L A;  1PH3 A;  3T16 A;  3U50 C;  2RVL A;  3WOE A;  1Y8N B;  3W3A A;  1JT8 A;  1EU3 A;  4JI8 L;  3J81 L;  5I9P A;  1XPU A;  1D6E C;  5C0X J;  3KF8 B;  4K0K Q;  1VF5 C;  1TWC B;  2ZT9 C;  2F4V L;  4C2M H;  2UUB L;  1LTI D;  5GAD C;  1VQ9 A;  3I90 A;  4JI0 L;  4L5S A;  1Q1E A;  2D5D A;  3OSO A;  5EBC A;  2Q8I B;  1V1Q A;  4LF9 L;  1BCP D;  2Y0S B;  5JJZ A;  2K5H A;  2QDL A;  3Q8D A;  3D3R A;  2IX3 A;  2F52 A;  4JI5 Q;  3I72 A;  4B3T L;  4DR4 L;  4MZ9 A;  4KY6 A;  1PZI D;  3PUX A;  2MNA A;  1ASZ A;  3NP8 A;  3JAM c;  3BDC A;  5FLM G;  4JK1 C;  1K8A C;  3H0G H;  2RSN A;  2UXB L;  3ND9 A;  3H15 A;  4IPC A;  3P7J A;  3ONA B;  5JVH 3;  4ZK9 B;  3S1R B;  3GTL H;  4CKB A;  1YIT A;  4H44 C;  1UEB A;  3CW2 C;  1U4P A;  1V1P A;  4R9W A;  5FK9 C;  4B3R L;  4NP5 A;  1PYW D;  4EVO A;  1GKH A;  2RHS B;  1MIU A;  5CV4 A;  4DR1 Q;  3HOX G;  5C3E G;  1NSN S;  2RF4 A;  3G7L A;  2OTJ A;  5CBE E;  5LMN L;  1EY6 A;  2JSO A;  5LMU L;  2DJF C;  3DHQ A;  3FDT A;  1RJT A;  5I4D A;  1I4R A;  5C44 G;  3X3M A;  5AJ3 Q;  4PZ8 A;  3S14 B;  2R7F A;  1IXR A;  2WAQ B;  4LUZ A;  4DU9 A;  1M4V A;  4ME3 A;  1ASY A;  4FNF A;  2ICI A;  1WTP A;  3S24 A;  4LJZ C;  1PH2 A;  4KY5 A;  5EQ0 A;  2P5Z X;  3TME A;  4DXF A;  4EQ5 A;  2F0K A;  3MXU A;  1TS3 A;  5IYD H;  1QG7 A;  2HCC A;  1RIP A;  1NNX A;  4O42 A;  1SJH D;  5IWA Q;  2A6E C;  4LF4 Q;  2EZV A;  4A3K G;  3OPO A;  3EVQ A;  4C3H G;  1L0Y B;  2K04 A;  3ERQ A;  1N33 L;  1E7Z A;  4DV2 L;  4JPB W;  1EY8 A;  3DM3 A;  2AMC B;  1EZ8 A;  2RQX A;  1EQQ A;  2KVM A;  1I94 L;  4AYB B;  3A74 A;  1EU4 A;  1G6P A;  5A2Q E;  1CKO A;  3HOX H;  4YCU A;  3P75 A;  4GN3 B;  2N88 A;  4NXN Q;  2KBN A;  2B63 G;  3F8T A;  5IT9 L;  5C44 H;  3I8Z A;  3A8K E;  1Q12 A;  1RKN A;  4A3D B;  3PV0 A;  4DAM A;  1FR3 A;  3MTS A;  1CSP A;  1AW7 A;  3D8G A;  3S2D H;  1IL2 A;  3CC4 A;  1HFG A;  2R93 G;  4IUU A;  4JI1 Q;  4RKB A;  1TU2 B;  1W2B A;  3P1H A;  1CA5 A;  4CDC C;  3X3N A;  4K5W A;  4H02 A;  1WTR A;  1GUT A;  1STG A;  4A3L H;  2I5H A;  3KLW A;  5CV5 A;  1L1O B;  1G29 1;  4WJW A;  4BY7 B;  5IOD A;  3ULJ A;  1NE3 A;  4WRD A;  4QMG A;  3J81 c;  3D4R A;  1PH4 A;  2IX1 A;  1WJJ A;  4CKC A;  4KHP Q;  1TKW B;  1UE1 A;  2BE5 D;  2RDH A;  1PVO A;  1MI2 A;  3QIA A;  4GOP C;  3PUY A;  5CV8 A;  4K6L A;  4F7X A;  4EQP A;  3T56 B;  3ND8 A;  4C2M B;  3T1H Q;  4DUY Q;  1BR9 A;  5LL6 S;  3IAY A;  5EKI A;  1XMQ Q;  1MJE A;  4RWS C;  4K6D A;  4DR3 L;  3EN2 A;  1XMO Q;  4IFD I;  1X56 A;  4OON A;  2EYO A;  1WD0 A;  1YHQ A;  2B63 H;  1N34 L;  1BCP F;  3CF5 A;  2PQA B;  3CCL A;  2UUA Q;  3F2D A;  2Z4H A;  1E24 A;  4ZKC B;  1VCI A;  2E2I B;  2PMZ E;  4JC0 A;  4QL5 A;  3SE0 A;  2R93 H;  3FP9 A;  3T53 B;  5KND A;  1VQB A;  2D9U A;  4DV0 L;  1RTO A;  5K36 G;  2EY5 A;  4I7Z C;  3RR5 A;  3SXH A;  1S3O A;  2NN6 G;  3SK5 A;  5I6W A;  3J7A 5;  1HNW Q;  5KYL A;  1JWU D;  3OYY A;  2XNA C;  1Y8O B;  3DWQ A;  3S1M H;  3R8B A;  5DM6 3;  4LWC A;  3NTI A;  3M4O H;  3E3X A;  2F0S A;  4X64 L;  2A6E D;  1AEX A;  1VQP A;  4ULL A;  1EWH A;  4FXD A;  3CCQ A;  3DLL A;  5I2X A;  1SNQ A;  1T5E A;  1XXG A;  2GVA A;  2EPB A;  2ICE C;  1X9N A;  3CD6 A;  2UXC L;  3G48 A;  1PRT C;  4IO9 A;  5M5Y H;  4DV7 Q;  2CH4 W;  5EJW A;  1FYC A;  1G8Z D;  1JCK B;  3K8A A;  3OW2 A;  4ABN A;  1GOZ A;  2CQA A;  3HFZ B;  1Y14 B;  5FKA C;  2CCZ A;  4A3C G;  1O7Y A;  4A93 H;  3CCS A;  4I7A A;  3WDN A;  1TWA H;  3M9B A;  1TXY A;  1DZ1 A;  1RCV D;  2K5V A;  2TMP A;  1PTO F;  1EYA A;  1SFO B;  4K0K L;  5ISR A;  2BA0 A;  5K36 H;  2ZTC A;  2FXQ A;  1PLF A;  4HIM A;  1CZG A;  3HKZ B;  1X3E A;  4N8X 1;  4XYO A;  2Q8T A;  4CGY B;  5IT9 c;  2XRQ D;  2EQS A;  2WKC A;  4IPG A;  4JI5 L;  5I9O A;  1MD2 D;  1ZXT A;  4JI7 L;  4A4I A;  3M85 A;  1CI3 M;  4J8Q A;  3K81 C;  2ZTD A;  3S2D B;  2FHT A;  1VQD A;  1PMR A;  1BBW A;  1G51 A;  1LO5 D;  1NMG A;  2I0Q A;  2JA5 G;  4K2L A;  2F03 A;  2DNE A;  5FOB B;  4DXG A;  4P72 A;  3I70 A;  3I56 A;  3A55 A;  2XWJ B;  5BN4 A;  4BBS H;  1F2Z A;  4HED A;  2WII B;  4JVZ A;  3SDZ A;  5GAE C;  1EUJ A;  4IPD A;  3RNU A;  3SGI A;  4R8I A;  2MP1 A;  3K7A B;  2UUB Q;  3I7F A;  3S1Q H;  4QGU A;  1A3U A;  4BA2 I;  3ERO A;  1I5F A;  5C4J H;  2WB1 B;  1XTD A;  3C46 A;  2L11 A;  1JQY D;  2L9H A;  1Z9F A;  3FKI H;  1KAB A;  2OT2 A;  2E5L L;  4DNR B;  2F0G A;  3DWP A;  2PZT A;  5EBD A;  2KEN A;  1E2V A;  4P73 A;  2IWH A;  3A5U A;  1D5M C;  4DN4 M;  4B3T Q;  2H5X A;  4DR4 Q;  2PPB C;  1X3Q A;  1QZG A;  5J39 A;  2NVX H;  2UXB Q;  3QR8 A;  1VMP A;  4QB4 A;  2CW0 C;  1HFN A;  2F0N A;  2QGQ A;  5FO8 B;  2ZJR A;  4JI6 Q;  3W2D A;  1YVC A;  4A3E B;  2CVR A;  3KBX A;  2EIF A;  3NBH A;  2VQE Q;  2HHH Q;  5IWA L;  4B3R Q;  2ENB A;  2PQE A;  3RD4 A;  3TZD A;  2VNU D;  4K8I A;  3NXW A;  1E1T A;  2F0F A;  3KF6 B;  2A5H A;  2N3S A;  5LMU Q;  1HXY D;  4N8F A;  2Y0S G;  1E2Z A;  2JXM B;  2BOS A;  1PH9 A;  2E2J H;  3FMC A;  1TQO A;  2JE6 I;  1L2F A;  1CHP D;  3TS0 A;  4DR6 L;  2ATW A;  2IHE A;  1XTC D;  2L0C A;  3GV3 A;  3PMF A;  2FMC A;  4DK1 A;  4KY7 A;  1ZEQ X;  1GM5 A;  1QCB D;  1SYD A;  1C8C A;  4XIG S;  3HOW H;  1EYD A;  1UUP A;  2D62 A;  2B2T C;  1F2Y A;  1QUQ B;  5FJ8 G;  1B53 A;  5FO7 B;  2G9H D;  4NXN L;  3EIV A;  2KUM A;  4G57 A;  4LUV A;  3ULP A;  1PFB A;  2X69 A;  1B9M A;  1JWM D;  1QUQ A;  4GNX C;  3OIP A;  3FVQ A;  2V4D A;  3PUV A;  4ZYS A;  1O7L A;  1LLR D;  3HGB A;  4DR7 Q;  3NTK A;  4JI1 L;  1N33 Q;  1GUN A;  1I4H A;  4B08 A;  2VL6 A;  1OXT A;  5M5Y B;  2DUD A;  2ES2 A;  1YJ9 A;  2WAQ G;  4HJ9 A;  2ZM6 Q;  3KOJ A;  5NUC A;  4U68 A;  4BBR B;  1B44 D;  5TSS A;  2NWG A;  2OQ0 A;  4EX5 A;  2K52 A;  5IYC H;  3TN2 A;  1SE8 A;  5DNF A;  1GHK A;  3A7L A;  3G4S A;  2MGS A;  1A2U A;  1CQV A;  4KJO A;  1HZ9 A;  3BZD B;  4A93 B;  1WTW A;  2VUM B;  5E4W C;  4RGM A;  1TWA B;  2WAC A;  1IBK Q;  3I3C A;  2K33 A;  1XWE A;  3AB9 A;  4QQB X;  1BNZ A;  3D4W A;  2K50 A;  1QIL A;  2YTY A;  3DM1 A;  3N6R A;  3T1H L;  2HCI A;  3NK9 A;  5IOC A;  3KJO A;  1KDA A;  3URY A;  2QCP X;  2IY5 B;  1V43 A;  5IP9 G;  1SYC A;  1H9S A;  3HOZ B;  1XMO L;  5EPK A;  4OEM B;  3S1R H;  3A7A B;  5LL6 X;  5HUR A;  2B8G A;  1BVS A;  3L9A X;  3WOF A;  2WIN B;  4AYB G;  5EPL A;  3MZ5 A;  1U4M A;  3K5O A;  4HJA A;  3NQI A;  1E1O A;  3BYT B;  4BS9 A;  2F0V A;  2TSS A;  4KMU C;  2M00 A;  3S14 H;  1Q8I A;  4HID A;  1GD7 A;  1EFI D;  2Q8R E;  1HUM A;  4N9T A;  1EY4 A;  3Q6S A;  1HNW L;  2CW0 D;  5KEE A;  5F2D A;  3K5L A;  3S1Q B;  1HUN A;  5C4X B;  1SXT A;  1UE6 A;  2O4X A;  2F0U A;  2F3I A;  1EFW A;  1A0I A;  3CHB D;  2OWO A;  1RHP A;  3FKI B;  3ITP A;  4CKE A;  2HT1 A;  1KD1 C;  2YYZ A;  1MJC A;  1U0L A;  1A2T A;  4R8N A;  3TBI B;  3MAQ A;  1N34 Q;  2SOB A;  4DV5 L;  2RKS A;  5DEH A;  2F3V A;  1XJV A;  4UHV A;  1NY4 A;  4IUP A;  2EYF A;  2E2H B;  2RDG A;  3L3O C;  1PH1 A;  5JAV A;  1XPO A;  4BY7 G;  3CU7 A;  4XT1 B;  4JYA L;  4DV7 L;  3AMU A;  3J80 i; 
#chains in the Genus database with same CATH homology
 3RZO H;  2XGT A;  4EQ5 A;  1KL9 A;  4GKK L;  2KHJ A;  3W5O A;  5IYD H;  3L0O A;  1WOC A;  2VS1 A;  2IX0 A;  1RIP A;  2NN6 I;  5IWA Q;  2LSS A;  4UP7 A;  4A3M H;  1YHA A;  1YNX A;  4LF4 Q;  1JJ2 A;  1HR0 Q;  3M3Y H;  4A3K G;  1CSQ A;  4P74 A;  3GTQ H;  2JA6 G;  1X65 A;  3GO5 A;  3PF5 A;  1N33 L;  4X64 Q;  1S40 A;  3B6Y A;  2Q2U A;  4JBK A;  1E7Z A;  4JCV E;  4DV2 L;  3DM3 A;  2YTV A;  3STB C;  3PIP A;  2AMC B;  3ERS X;  4A3D H;  2NZO A;  2R7D A;  2Z6K A;  1EIY B;  4BXX G;  1PH6 A;  3KDF A;  2K14 A;  1EQQ A;  1I94 L;  2ZJP A;  1PHJ A;  3A74 A;  1SN8 A;  2R6G A;  5DLQ E;  4TVA B;  4LFA Q;  4DK3 C;  3J81 j;  1G6P A;  4L5Q A;  2MO0 A;  4UPA A;  1CKO A;  2B29 A;  3HOX H;  2UXC Q;  1W3S A;  4YCU A;  4X66 L;  5HGQ A;  4A3I H;  4C3J H;  4JI3 L;  4GN3 B;  2E8G A;  1N36 Q;  1OXX K;  1VQN A;  3CMA A;  1J6Q A;  4NXN Q;  2KBN A;  3UDF A;  1IBM L;  1IBL Q;  3L7Z C;  3F8T A;  5C44 H;  1O7I A;  2B63 G;  3PCO B;  1YZ6 A;  2R7Z G;  1Q12 A;  3PV0 A;  4DAM A;  1IZ6 A;  1UE5 A;  1IYJ B;  3G71 A;  2Z0S A;  1CSP A;  4ALP A;  4R1J A;  4IFD J;  2KCT A;  1IL2 A;  3S2D H;  4YCV A;  4BY7 H;  3HOY H;  3CC4 A;  4A3F G;  4YWK A;  4DV6 Q;  4PG3 A;  2R93 G;  4IOC A;  4NB3 A;  4JI1 Q;  4GNX A;  3TRE A;  2JQO A;  4JI2 L;  1HJP A;  3CCR A;  1W2B A;  4DK6 C;  3J81 i;  1K83 H;  2VZA A;  3HKS A;  3RN2 A;  1CUK A;  2YTX A;  4YHH Q;  1EYG A;  3I4M G;  5M3M G;  1X3F A;  2C35 B;  5BR8 L;  1YEZ A;  1J5E Q;  1VQA A;  4H02 A;  4LF6 Q;  4RG1 A;  4A3L H;  4A3B H;  2I5H A;  3KLW A;  1V9P A;  4GLA C;  3I2Z A;  1KRS A;  1L1O B;  1G29 1;  3PO2 H;  1K9M C;  2IT1 A;  5IYD G;  4LF8 Q;  1VQM A;  3BU2 A;  3CC2 A;  1VQK A;  1JJC B;  3ULJ A;  1KAW A;  1NE3 A;  3PSI A;  2QA4 A;  1YI2 A;  2JA6 H;  3MXN B;  3J81 c;  3U58 A;  3CCU A;  1PH4 A;  3H3V I;  2IX1 A;  1WJJ A;  4KHP Q;  1UE1 A;  3K7U C;  1PVO A;  1VQ8 A;  4JI7 Q;  4GOP C;  3PUY A;  1JJG A;  4R4I A;  4IFD G;  2E2I H;  2UXD L;  2JA9 A;  4GN4 B;  2EXD A;  3T1H Q;  4UY8 C;  4DUY Q;  4IPH A;  4JI8 Q;  3PIO A;  4P75 A;  4JBM A;  4JI6 L;  3AYH B;  2MQH A;  1XMQ Q;  2VY3 A;  1PV4 A;  4PMW A;  4DR1 L;  4DR3 L;  1MJE A;  4A3D G;  3EN2 A;  4DPG A;  1XMO Q;  2VQE L;  2HHH L;  4IOA A;  4IFD I;  1X56 A;  2N78 A;  2F4V Q;  1AH9 A;  3CC7 A;  4OON A;  4NXM L;  1N32 Q;  4X65 L;  1D8L A;  1U5K A;  1VQI A;  4R4O A;  1YHQ A;  1KXL A;  1C7Y A;  5AJ3 L;  2B63 H;  3K80 C;  1YHB A;  4X62 Q;  4JI0 Q;  3TEH B;  1Y1W H;  1N34 L;  4DUZ L;  3CF5 A;  2PQA B;  4QIW E;  3CCL A;  4LF9 Q;  2UUA Q;  2R7Z H;  4A3C H;  4A3I G;  3I55 A;  3F2C A;  5M5X H;  3F2D A;  4OO1 I;  1E24 A;  4DV3 L;  1Q81 C;  1Q46 A;  1VCI A;  3EBE A;  3KFU A;  2PMZ E;  4JC0 A;  4LUO A;  4QL5 A;  4LFC L;  3RN5 A;  1QZH A;  1PYB A;  1VQC A;  4A3F H;  1M1K C;  3E9H A;  4GLX A;  4DKA C;  3GTG H;  2R93 H;  3FP9 A;  2E5L Q;  4OWW B;  1VQB A;  4HIK A;  1M90 C;  5M3F G;  4DV0 L;  4GNX B;  2ZTE A;  1B8A A;  5K36 G;  2CWP A;  1QVF A;  3RR5 A;  1NMF A;  5GQO A;  1S3O A;  2NN6 G;  3J7A 5;  1HNW Q;  1NBW A;  3BZC A;  2CKZ B;  3H3V H;  1EQR A;  4KHZ A;  4JOI C;  1HZA A;  4RMF A;  3OYY A;  4YY3 Q;  2XTI A;  4LF4 L;  1LUZ A;  5FLX c;  2B3G A;  3S1M H;  2DGY A;  2YU9 H;  5JEA J;  4LFB Q;  2CFM A;  4POG A;  4LWC A;  3CPF A;  3M4O H;  1GO3 E;  1OXV A;  4X64 L;  2A8V A;  4A3B G;  4A3L G;  3KYH C;  2VQF Q;  5LMN Q;  1A62 A;  4HJ8 A;  1VQP A;  1K73 C;  1Q82 C;  3PO3 H;  4HIO A;  3K0X A;  1XPR A;  3PO2 G;  1RL2 A;  4DR7 L;  3ULL A;  4JBW A;  4R4T A;  1LTL A;  3G6E A;  2JA5 H;  1E22 A;  3CCQ A;  3DLL A;  3KF6 A;  3MEF A;  1XNQ Q;  1LYL A;  5HY6 A;  2Q2T A;  1Y1V H;  2WB1 G;  5EAY A;  3J80 c;  3S16 H;  1WFQ A;  2GVA A;  3VDY A;  3KDF B;  3STB D;  4JV5 Q;  4LFA L;  1PA6 A;  1BBU A;  1YBY A;  2ZM6 L;  2CQO A;  1X9N A;  4OXP A;  3CD6 A;  2UXC L;  3G48 A;  3CCE A;  4JBJ A;  4DR6 Q;  4OWT B;  1N36 L;  1HR0 W;  4IO9 A;  1X6O A;  4DR2 Q;  5M5Y H;  4DV7 Q;  4HJ7 A;  1SFO H;  1JB7 A;  3S1N H;  1IBL L;  1E3P A;  1P8L A;  2A1A A;  3OTO L;  4DNI A;  4GN5 A;  5IE8 A;  1UE7 A;  1Q8K A;  3K8A A;  1PH8 A;  4WJ3 M;  1VQJ A;  3OW2 A;  1K3R A;  1VQ4 A;  1IBK L;  1HZB A;  5JEA G;  3U4Z A;  1WYD A;  4PZ7 A;  2WP8 J;  4HJ5 A;  1TWG H;  1EOV A;  4A3E G;  3HFZ B;  1Y1W G;  1Y14 B;  3GTK H;  1FVI A;  2CCZ A;  4A3C G;  4A93 H;  4GS3 A;  2HQL A;  1I3Q H;  3CCS A;  2MFI A;  2JA8 G;  1TWA H;  3M9B A;  1VQ7 A;  3HOU G;  4YWL A;  2QEX A;  1TXY A;  2CWA A;  1QVC A;  2K5V A;  1T9H A;  1R9T H;  3AFP A;  4DV2 Q;  4IJH A;  5M3F H;  1OXS C;  4K0K L;  2BA0 A;  2KHI A;  5J3B A;  5H1S E;  3GDE A;  3T1Y Q;  1L0W A;  2ZTC A;  2FXQ A;  1KQS A;  4HIM A;  3M4P A;  4OO1 G;  1X3E A;  3ZJY C;  3AFQ A;  4OX9 Q;  1I94 Q;  4APV A;  1TWC H;  5IT9 c;  1SRO A;  5M5W H;  2EQS A;  1KIX A;  4NPS A;  3U4V A;  2I5L X;  4IPG A;  4A76 A;  4JI4 L;  1B70 B;  1LM0 A;  2NVQ H;  4JI5 L;  2ALY B;  4JI3 Q;  2JEB I;  3GTJ H;  4DV4 L;  2RHQ B;  3JC6 6;  3D31 A;  3I4N H;  4KHP L;  1IBM Q;  4JI7 L;  4A4I A;  3UE1 A;  3M85 A;  4A3G H;  1A63 A;  3CXC A;  5E7N A;  3K81 C;  2ZTD A;  3K7A H;  4KLK A;  4B3S Q;  1N8R C;  2R92 G;  1VQD A;  1OTC A;  1BBW A;  4DUY L;  1WCM G;  2MO1 A;  1G51 A;  3ICE A;  1XMQ L;  3PO3 G;  2PNH A;  5IYB H;  4UP8 A;  1NMG A;  3JAM i;  2JA7 H;  1UWV A;  2I0Q A;  4BA1 I;  1AE3 A;  5ELN A;  2JA5 G;  5GAG C;  3E0E A;  1AE2 A;  1Y1V G;  2YV5 A;  5FJ8 H;  3HKZ E;  4P72 A;  4JI2 Q;  3I56 A;  4X62 L;  1NJI C;  4BBS H;  4X6A H;  2UU9 L;  1FJG Q;  1YJN A;  1QVG A;  5GAE C;  2UUA L;  2BA1 A;  3FHW A;  1EUJ A;  2Q2H A;  1EWI A;  4IPD A;  3SGI A;  3RNU A;  1A8V A;  3S1Q H;  5IP7 H;  3I7F A;  2UUB Q;  4QGU A;  1HNZ Q;  3HOV H;  4BA2 I;  5JJL A;  2NVY H;  1I5F A;  2UUC L;  5C4J H;  4LW1 A;  4A3E H;  1XTD A;  4B3M L;  3M7N A;  1K0R A;  5JJK A;  3HKZ G;  1Z9F A;  1VQH A;  2JA8 H;  3FKI H;  2GVB A;  2E5L L;  1NTG A;  2KEN A;  4P73 A;  3W1G A;  3A5U A;  3HOU H;  1OXU A;  2A19 A;  4B3T Q;  4DR4 Q;  2H5X A;  3A5Z B;  4KI0 A;  3UE0 A;  4AH6 A;  4L5R C;  1XNR Q;  2K5N A;  1Z47 A;  4YCW A;  1GVP A;  4JOI A;  5GAH C;  1TWF H;  1QZG A;  2OTL A;  4AQY L;  2JJQ A;  1SR3 A;  4UP9 A;  4LF5 Q;  2NVX H;  1L1O C;  2JEA I;  1I6H H;  4WJ4 A;  2I5M X;  2UXB Q;  3J7Z C;  3UDX A;  3GTM H;  4GLV B;  4YY3 L;  4JI4 Q;  2QGQ A;  2ZJR A;  1SMX A;  4JI6 Q;  1YVC A;  1VQ6 A;  1SLJ A;  2Y0S E;  4DR3 Q;  1FL0 A;  1KHI A;  2EIF A;  1MKH A;  4GKJ Q;  2VQE Q;  2HHH Q;  4L5T A;  5IWA L;  2VQF L;  4B3R Q;  4NXM Q;  2WFW A;  4TQU S;  4BY1 G;  1PH5 A;  5ELO A;  2D0P A;  1HNX Q;  1JMC A;  2WB1 E;  3HOZ G;  1HR0 L;  1SRU A;  1HZC A;  4DV1 Q;  4LF7 L;  2NVT H;  1DGS A;  2VNU D;  1Q7Y C;  1XNQ L;  1PYS B;  3NEN A;  4LNQ A;  4Y52 H;  3W1B A;  2R92 H;  3WWV A;  4J15 A;  4POF A;  2ASB A;  3I4N G;  1E1T A;  4A3J G;  3KF6 B;  2N3S A;  5LMU Q;  1WCM H;  2Y0S G;  2NZH A;  4O0A A;  3RLF A;  4A3G G;  1PH9 A;  2E2J H;  5IP9 H;  2VW9 A;  2JE6 I;  4DR5 Q;  2N8N A;  1L2F A;  1VS0 A;  3TS0 A;  4LFC Q;  4QJF A;  3AEV A;  4DV5 Q;  4DR6 L;  2ATW A;  1X55 A;  2IHE A;  4MTN A;  3A0J A;  3CCM A;  1S72 A;  1GM5 A;  2LXK A;  5IYB G;  4DV0 Q;  2JA7 G;  4JYA Q;  1CKM A;  1X54 A;  2IHF A;  4XIG S;  1YJW A;  3CPW A;  1CKN B;  5LMN W;  3HOW H;  3L2P A;  4Y7N H;  2D62 A;  5FJ8 G;  1QUQ B;  1VQO A;  4NXN L;  3PUZ A;  3AQQ A;  3EIV A;  4LUV A;  3S17 H;  3ULP A;  1I50 H;  1CKN A;  4BBS G;  4BBR H;  2JK8 A;  1P16 A;  1QUQ A;  5IY0 A;  5FLM H;  4GKK Q;  2RCN A;  4GNX C;  2WAQ E;  5IP7 G;  3HOV G;  2LXJ A;  5C4X G;  2PI2 A;  4P71 A;  4FDB A;  4YWM A;  1VQE A;  3PUV A;  1Q1B A;  2BH2 A;  4A93 G;  2HIX A;  4C3I H;  3BZK A;  4A75 A;  3T1Y L;  4DV6 L;  4DR7 Q;  3FKI G;  2VUM H;  3H0G G;  4JI1 L;  3LGJ A;  2ZJQ A;  4O2D A;  2AHO B;  1N33 Q;  4XTC S;  4OX9 L;  3GTO H;  2VL6 A;  1FGU A;  1OXT A;  1WI5 A;  2DUD A;  4YHH L;  2ES2 A;  1YJ9 A;  2K75 A;  2WAQ G;  3GD7 A;  2ZM6 Q;  3KOJ A;  4HJ9 A;  1J5E L;  4LF6 L;  3RLN A;  5C3E H;  2OQ0 A;  4EX5 A;  2HIV A;  2K52 A;  3BJU A;  1C9O A;  2AWO A;  3PGZ A;  5IYC H;  1TWH H;  3ER0 A;  4GOP B;  4BY1 H;  3PUW A;  1SE8 A;  4JG2 A;  3HOZ H;  2PI2 E;  3F1Z A;  2Z6K C;  3G4S A;  4LF8 L;  3OTO Q;  3TS2 A;  4B3S L;  1HZ9 A;  1D7Q A;  5GRO A;  1KRT A;  1JE5 A;  4X66 Q;  4GOP A;  4A3J H;  3D0F A;  1VQG A;  1IBK Q;  4QQB X;  3F2B A;  1B7Y B;  2K50 A;  3S2H H;  3IRB A;  2YTY A;  2OQK A;  3U50 C;  1PH3 A;  3I4O A;  1JT8 A;  3T1H L;  2GN5 A;  3RLO A;  4JI8 L;  4AYB E;  3KJO A;  3KJP A;  1XPU A;  1HH2 P;  2BH8 A;  5C0X J;  2IY5 B;  1V43 A;  3CAM A;  3KF8 B;  5IP9 G;  1FJG L;  4K0K Q;  1XMO L;  3E9I A;  2Q2I A;  3M4Q A;  2F4V L;  3TRZ A;  1N32 L;  4C2M H;  2UUB L;  1X3G A;  2D0O A;  3S1R H;  1HNZ L;  2AKW B;  1VQL A;  5GAD C;  1VQ9 A;  4DAY B;  4JI0 L;  4L5S A;  1Q1E A;  1BVS A;  2ID0 A;  1V1Q A;  4A3K H;  2AWN A;  4C3H H;  4LF9 L;  2K5H A;  3HOW G;  4AYB G;  3Q8D A;  5BR8 Q;  2F52 A;  5C4X H;  4JI5 Q;  1L1O A;  4B3T L;  4DR4 L;  4MZ9 A;  1N9W A;  3PUX A;  4R4Q A;  2MNA A;  4DV4 Q;  4A3M G;  4BBR G;  3JAM c;  1ASZ A;  1XNR L;  3PF4 A;  5JJI A;  5FLM G;  4HJA A;  4LF5 L;  1K8A C;  3H0G H;  1E1O A;  2UXB L;  3S15 H;  4MNO A;  4BXX H;  3H15 A;  4IPC A;  3NEL A;  4OWX B;  3S14 H;  3GTL H;  2VUM G;  4HID A;  1YIT A;  1GD7 A;  1VQF A;  4GKJ L;  1HNW L;  1UEB A;  2N49 A;  5C0X G;  2E2H H;  3CW2 C;  4B3R L;  3NBH B;  3NEM A;  1HNX L;  2UXD Q;  1VQ5 A;  1UE6 A;  3TQY A;  2OCE A;  1GKH A;  4DV1 L;  4LFB L;  2RHS B;  3CCV A;  2F3I A;  1MIU A;  1KC8 C;  2UU9 Q;  1C0A A;  4DR1 Q;  1EIF A;  3HOX G;  5C3E G;  1EFW A;  2RF4 A;  1A0I A;  1K8G A;  2V1C C;  2OWO A;  2L15 A;  5IYC G;  4IJL A;  3UDG A;  5C0X I;  2OTJ A;  5LMN L;  1BKB A;  4X65 Q;  5LMU L;  2HT1 A;  1KD1 C;  2YYZ A;  1MJC A;  1U0L A;  2PQA A;  5C44 G;  3UDI A;  5AJ3 Q;  4DR5 L;  4PZ8 A;  2UUC Q;  4B3M Q;  1N34 Q;  4DUZ Q;  4DV5 L;  2R7F A;  4QY7 A;  1H95 A;  1IXR A;  4PZ6 A;  4LUZ A;  1XJV A;  4R4C A;  1Q86 C;  1NY4 A;  1PFS A;  4ME3 A;  1ASY A;  4JV5 L;  1PH7 A;  4DV3 Q;  4AIM A;  3S24 A;  1YIJ A;  1PH1 A;  2K4K A;  1XPO A;  4BY7 G;  3HOY G;  4JYA L;  3CQZ H;  2KCM A;  1PH2 A;  4LF7 Q;  3I4M H;  4AQY Q;  5M3M H;  3CP0 A;  4DR2 L;  3CME A;  4DV7 L;  3GTP H;  3CCJ A;  3RZD H;  3J80 i; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...