4DV6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv6Q00
1VQDA 3CPWA 5C4JH 4GOPC 3HOWH 1JB7A 1VQJA 4OXPA 5FLMH 3T1YQ 5M5YH 3I4NH 1N32Q 1YI2A 1IBLL 1ASZA 2UUBQ 1U0LA 3G48A 3GTLH 2JA6G 1I6HH 4PG3A 1NE3A 1E1TA 3G4SA 3G71A 1KRTA 4PMWA 4LNQA 1VQIA 4GLXA 1E22A 4X64Q 4DR6Q 2UXDL 4GN3B 1B8AA 2NVQH 1XPOA 3E9HA 2VS1A 5EAYA 2MO0A 3HKSA 1SROA 1TWFH 3J81c 1IXRA 1QZGA 2B63G 1NMGA 2YTYA 3I4OA 1JJGA 2UU9Q 2KCTA 2KHIA 3UDFA 5GAGC 2VUMG 2OQKA 4JI1Q 1UWVA 2RHSB 2HIVA 2E8GA 4JOIC 4O0AA 2E5LQ 4A3DG 2Y0SG 3CPFA 1NMFA 1VQHA 1Z9FA 2BA1A 5LMUQ 4B3TQ 4XTCS 1YNXA 2NN6G 3GTOH 2VZAA 1G291 2ZTCA 4K0KQ 3KJPA 1VQNA 2RF4A 1L1OA 4KHZA 3MEFA 1UE5A 2B3GA 2K50A 1VQMA 1VQCA 1X3EA 4LUOA 2D0OA 3S16H 1BKBA 1IYJB 5IY0A 1Q1EA 3DLLA 3CMEA 5JEAJ 2C35B 3NBHB 3I55A 1EOVA 3H0GG 3PF5A 4IO9A 1PH4A 5IT9c 3CP0A 3CCJA 4L5RC 4BY1G 4DV6Q 4WJ4A 4DUZQ 2EQSA 4DV0L 4LW1A 3ULJA 3S1QH 3T1HL 1KD1C 5AJ3L 1I94Q 4LFCQ 3FKIG 4JOIA 2K75A 1EWIA 2I0QA 2OQ0A 4UP7A 2RCNA 1YIJA 3CAMA 4X65Q 4GOPB 1PH8A 3LGJA 1VQKA 4LF9Q 1GKHA 3HOXG 3CCQA 4DV3L 4POFA 1HNWQ 3OW2A 1PYSB 1HR0Q 1XMOQ 1OXSC 2GN5A 1YJWA 3RR5A 1YHQA 4B3ML 3UDXA 3FHWA 4A3EG 4IPHA 2Z6KC 5IYDG 3W1BA 4JI4Q 3PO2H 3GTKH 1FGUA 3W1GA 4YCUA 4A3IG 2JJQA 4JI8Q 1S3OA 1KRSA 1K3RA 4J15A 4JI1L 4A93H 1BBUA 3RLOA 4A3KH 3JC66 2E5LL 1CKNB 2R7ZG 4BY7H 3GD7A 3ER0A 3CC2A 4A3BG 3JAMi 1YVCA 1QZHA 3HFZB 4IFDJ 2R7DA 5FJ8G 2UXBL 5IYBG 1G51A 4OWWB 3ICEA 5LMNQ 5GADC 5M3FG 3D0FA 5J3BA 2JA5G 1K8AC 3D31A 1B7YB 1G6PA 4UPAA 4LF8L 4NPSA 1X6OA 5C4XG 5JJKA 1Y1VG 3MXNB 3L0OA 4YHHL 1YHBA 1PHJA 2YTXA 1DGSA 2F52A 1N34L 2XGTA 3F1ZA 4IJHA 4DR2L 1XNRQ 4B3RQ 3PUYA 1CKMA 1M90C 2JA9A 4H02A 4JI6L 1PH3A 3RNUA 3TQYA 1PA6A 4LF7Q 3HOYG 1HZBA 4A3FH 1N9WA 1IBML 1PVOA 1E1OA 1WCMG 3RZOH 2OTJA 1PFSA 2KBNA 2LXJA 1X3GA 1BBWA 5IP9H 1LTLA 1KAWA 1TWAH 2HT1A 2NZOA 1QUQB 4TVAB 3S2DH 4GN4B 3AFQA 1HNWL 1XTDA 5C0XI 5GROA 1VQOA 4QGUA 2JE6I 4DR5L 1XPUA 1A62A 1JJ2A 4OX9Q 2CWPA 1YJ9A 1EFWA 1HH2P 4JYAQ 2R93G 1Q86C 4LF4L 2CKZB 2JEBI 1B70B 4A3JG 4P74A 1N33Q 1HJPA 4LF6Q 2Q2TA 3HOWG 2GVBA 1MJEA 4R4TA 4LFAQ 5GAEC 1YJNA 4B3SQ 1YEZA 2Y0SE 3I4NG 3HOZH 2EXDA 2ES2A 3PSIA 4KLKA 4DR7L 4GLAC 3PUZA 3UE1A 3BU2A 2VQFL 4JI3L 2HHHQ 5M3MH 2DGYA 3A5UA 1XNQQ 1AE2A 2JEAI 2K52A 1X9NA 2JA7H 1Q12A 2ZM6Q 2ZJPA 1FJGQ 5K36G 4KI0A 4UP9A 4L5QA 3L2PA 4NXMQ 3VDYA 4BBRG 1K73C 1SN8A 3KDFB 1PV4A 4A3LG 1I3QH 1JJCB 2VQEQ 4DV4L 3PV0A 1XNRL 1PH1A 2JA8H 4P72A 4B3RL 4Y52H 5C44H 4HIOA 4RG1A 4OO1I 4RMFA 3TRZA 4OONA 5ELNA 4DV2Q 3AFPA 4YCVA 4DAMA 3STBC 3IRBA 1ASYA 4OWXB 3OYYA 4APVA 1QVCA 1WOCA 4PZ7A 1QVFA 4X66Q 3OTOL 5IP7H 4GLVB 2A1AA 4LF5L 2I5HA 4EQ5A 4GOPA 1K8GA 1AH9A 4DR3L 2R92H 4AIMA 4DV7L 4JI7L 2ZTDA 4HIDA 3WWVA 3GTPH 4JYAL 4X62Q 2NVTH 2PMZE 2UUCQ 1Q46A 4JI2Q 3AQQA 1HNZL 1GD7A 3AEVA 4LF6L 3K0XA 3TS0A 3J7ZC 2Q2HA 1X56A 2YU9H 1OXVA 1Q7YC 1QVGA 4P71A 4KHPQ 2WB1G 3PIOA 4LFBL 1I5FA 1YZ6A 2HHHL 3K81C 2KENA 1VS0A 1XNQL 3GTGH 4JBJA 3T1YL 3PF4A 1XPRA 1FJGL 1N32L 4NXML 3CW2C 2JQOA 1JMCA 4A3DH 2UUBL 4R4QA 4AH6A 3RN2A 5H1SE 4HIMA 4PZ6A 3JAMc 3PO2G 5BR8Q 4YY3Q 1HZ9A 3TS2A 2VNUD 1PH2A 3BJUA 4X64L 4DPGA 1O7IA 3M4OH 4DR6L 4A3MH 4A93G 1C0AA 4NXNQ 3UDIA 4HJAA 2OCEA 4A3KG 4L5SA 2LXKA 4BY7G 1OTCA 2OWOA 3GTMH 1CSQA 4JCVE 5ELOA 1L0WA 1UE7A 4DR1Q 2UU9L 1A63A 3KFUA 1XJVA 4JI5Q 1EQRA 1Y1WH 4IPGA 4MZ9A 1SMXA 2V1CC 3HKZG 4BBSH 2A19A 5IE8A 1A8VA 2ATWA 1P8LA 1QUQA 4LUZA 2WAQE 5LMUL 4B3TL 3M4QA 2QA4A 4K0KL 1TWGH 2L15A 5GQOA 2E2HH 2DUDA 1MKHA 2PNHA 2RHQB 4DV1Q 5C0XG 1WFQA 4X62L 1U5KA 1TWHH 5M5WH 1RIPA 4DUYQ 2CQOA 1PH5A 4BXXH 3HOXH 4FDBA 2D62A 1N36Q 3ULLA 4A3FG 1IL2A 4A3CH 4A4IA 2PQAB 4GNXB 1Q81C 3TREA 1JT8A 4AQYQ 2UXCQ 4DV6L 3J81j 4DUZL 1PYBA 3GDEA 2Z6KA 5IP9G 1PH6A 3M3YH 1NTGA 1WJJA 1IBKQ 2AWNA 1BVSA 1VQLA 2AMCB 2Q2IA 1I94L 3BZCA 4LFCL 3CD6A 1EIFA 3GTJH 3PUXA 2F3IA 1SLJA 4JBMA 1UE6A 2MO1A 1LYLA 3K80C 1YITA 1D7QA 2KHJA 1OXUA 4X65L 4LF9L 2WAQG 4MNOA 1IBLQ 2D0PA 1VQGA 3KDFA 4GS3A 2CCZA 5DLQE 1J5EQ 2K5NA 4IJLA 1LUZA 5IYCH 1UEBA 1XMOL 2R6GA 3F2CA 1HR0L 4A76A 3U50C 5C3EH 1CSPA 3GTQH 3HOZG 4JI4L 4OO1G 4A3GH 1Y1VH 4ME3A 1S40A 4JI5L 2B29A 2JK8A 4JI8L 4GKJQ 3Q8DA 5M3MG 2ID0A 2VL6A 4AYBG 1C7YA 3I4MH 2I5LX 1SFOH 5FLMG 2JA7G 3PUVA 5JJIA 4O2DA 1NBWA 3EBEA 2QEXA 1S72A 1E7ZA 3ERSX 1HNXQ 1GM5A 3S14H 3J80i 1KHIA 1Q82C 5LMNL 1V1QA 2E2JH 1HZAA 1EUJA 3L7ZC 4P73A 1NY4A 3ZJYC 3CCRA 4A75A 4NB3A 4UP8A 3W5OA 5C44G 4C2MH 1K9MC 1H95A 1PH9A 1X54A 4P75A 3KF8B 4JBWA 1Y14B 2BH2A 3CCLA 3RLFA 4JI0Q 4POGA 3K8AA 2UXCL 2WB1E 5IWAQ 1VQ9A 3EIVA 5IP7G 2IX0A 4IOAA 1PH7A 3HOUH 4LF7L 1Z47A 4DV0Q 3B6YA 1WI5A 2OTLA 2R92G 3NENA 3T1HQ 1V43A 4C3IH 3E9IA 3HOVH 5AJ3Q 3PO3H 3KF6B 2N3SA 3CCMA 1RL2A 3M4PA 4PZ8A 1N8RC 2NVXH 1L1OC 3U4ZA 1LM0A 2IT1A 2VW9A 1SRUA 1GVPA 1J5EL 2XTIA 3A74A 1X3FA 3U4VA 4HIKA 4DV3Q 4OX9L 2HQLA 4EX5A 3K7AH 4C3HH 2PI2A 4GNXC 1V9PA 3PGZA 4R1JA 3U58A 1N33L 1IZ6A 4MTNA 2ASBA 2IHFA 2K5VA 4BBRH 4GKJL 4B3MQ 4A3LH 4HJ5A 4ALPA 2JA6H 3NEMA 4WJ3M 4X6AH 3H3VH 3STBD 4HJ8A 3HKZE 2LSSA 4LFAL 4B3SL 4DNIA 1CKNA 2K4KA 1EYGA 4JV5Q 1NJIC 1JE5A 3UE0A 1HNXL 4QY7A 3H15A 4DV5Q 1CKOA 1SE8A 2B63H 3S17H 4IPCA 5E7NA 1EIYB 3DM3A 2ZM6L 2UXBQ 4QL5A 2VUMH 2N78A 3RN5A 4OWTB 3CCVA 4A3MG 3CC4A 1VCIA 2WP8J 3J81i 3KJOA 3K7UC 3CF5A 4QJFA 1FVIA 2F4VQ 2N8NA 4JI0L 1R9TH 4LF8Q 2VQEL 1EQQA 3H3VI 2EIFA 1TXYA 4YHHQ 2PQAA 4GNXA 4TQUS 5IWAL 1Y1WG 4DAYB 3A5ZB 3RZDH 1N34Q 3M7NA 4BBSG 4DV2L 4IPDA 4DR2Q 2NVYH 2PI2E 2YYZA 1XMQQ 4JI6Q 4QIWE 1CUKA 1VQ8A 5JEAG 4Y7NH 4R4IA 1K83H 5HY6A 3H0GH 4GN5A 2BH8A 4X66L 1IBMQ 3J7A5 2NZHA 5C0XJ 3S1RH 1VQ4A 4UY8C 4BA2I 4DR4Q 4GKKQ 4BY1H 3SGIA 4DK3C 1GO3E 3EN2A 1W3SA 4C3JH 2NN6I 3S1MH 2QGQA 3F8TA 3CC7A 1KC8C 4BXXG 3S2HH 3FKIH 1C9OA 1OXXK 4A3CG 2BA0A 4LUVA 3KLWA 1L1OB 4DR5Q 2MQHA 2UUCL 4XIGS 4JI2L 3S15H 5HGQA 1E24A 3F2BA 2AHOB 1FL0A 2MFIA 2MNAA 4LF4Q 1HZCA 2K5HA 4AYBE 4LWCA 4JC0A 5GAHC 2UUAQ 4KHPL 1D8LA 2E2IH 3F2DA 2KCMA 2K14A 4JV5L 4DV5L 2ZJQA 4A3EH 2HIXA 1VQPA 4HJ9A 3KOJA 3CCEA 2IHEA 5IYDH 1X65A 1KXLA 4A3IH 3AYHB 4DR7Q 2VQFQ 3FP9A 4JI3Q 3TEHB 5IYCG 2IX1A 2R7FA 4DKAC 3ULPA 2R7ZH 2AKWB 3RLNA 4A3BH 2F4VL 5C3EG 1MIUA 1UE1A 4QQBX 4IFDG 2N49A 5FJ8H 4R4CA 3I2ZA 5BR8L 4YY3L 2GVAA 2A8VA 1MJCA 4A3GG 4L5TA 1A0IA 5IYBH 3I7FA 3NELA 3A0JA 1Q1BA 1VQAA 4YWLA 3J80c 5M3FH 3S1NH 4NXNL 1M1KC 4DV4Q 2JA5H 4JBKA 1VQ6A 3I4MG 1VQEA 1I50H 3BZKA 3PIPA 1VQBA 4JG2A 2UXDQ 1KL9A 2CFMA 1XMQL 1VQ7A 4DR1L 1L2FA 5C4XH 5FLXc 4YWMA 4HJ7A 2Q2UA 1HR0W 1K0RA 2I5MX 1E3PA 4R4OA 1SR3A 4BA1I 4GKKL 4DR4L 1YBYA 2ALYB 3KF6A 2Z0SA 4IOCA 5JJLA 3OTOQ 2CWAA 1P16A 2FXQA 4LF5Q 1T9HA 3KYHC 1VQ5A 3HOYH 1YHAA 4DV1L 3CCUA 3CQZH 1WCMH 1J6QA 2AWOA 2VY3A 4DR3Q 4DV7Q 4JI7Q 2JA8G 4YCWA 1Q8KA 3E0EA 4IFDI 3CCSA 4DUYL 3PUWA 1KQSA 4DK6C 1AE3A 3HOUG 2ZTEA 4YWKA 5LMNW 3UDGA 1N36L 1HNZQ 3CMAA 5M5XH 1TWCH 3CXCA 2UUAL 3S24A 2IY5B 4AQYL 1KIXA 3GO5A 3HOVG 1VQFA 3PO3G 2WFWA 3PCOB 1WYDA 2H5XA 2ZJRA 3M85A 2R93H 3M9BA 1W2BA 1IBKL 1OXTA 1X55A 2YTVA 4A3JH 3G6EA 4LFBQ 2YV5A 3I56A
chains in the Genus database with same CATH superfamily
4H0LC 1VQJA 5FLMH 2AQ3B 5A2QE 3T53B 1ASZA 2UUBQ 1U0LA 3GTLH 2K33A 3U9OA 2WB1B 1RCVD 3G4SA 2UXDL 4GLXA 1E22A 1KABA 3S1MB 2VS1A 5EAYA 3HKSA 3J81c 1IXRA 1NMGA 3I4OA 1JB3A 2UU9Q 2KCTA 2KHIA 3UDFA 1E0BA 2OQKA 3TP7A 1UWVA 2HIVA 4O0AA 3MXUA 1NMFA 1VQHA 2JP1A 3NPPA 1K0SA 1G291 2ZTCA 2B3GA 5C3WA 1CZWA 1SBBB 1X3EA 1EOTA 5JOBA 3I3CA 5JEAJ 1J9OA 3I55A 1EOVA 1PH4A 1F9QA 4L5RC 4WJ4A 4DV6Q 2MJ8A 4DV0L 4LW1A 3M4YA 4ZK9B 2CW0C 4C3JG 3T1HL 3S1NB 1STGA 2K75A 1BCPB 3NHHA 4DV3L 3QJYA 3IL8A 3OW2A 3VA7A 1HR0Q 2GN5A 1XYIA 1PTOC 1JOKA 1YHQA 3UDXA 3CQZB 3OWFA 5IYDG 2B2UC 2N88A 4YCUA 4J1MA 2EJFC 5ELDA 4JI1L 1KLUD 1J8IA 1DOKA 2N55A 2R7ZG 2WAQB 3HS0C 1YVCA 1QZHA 1I4HA 1TWCB 1CZGA 2VB2X 1BNZA 2UXBL 3V96A 3NE5B 2KQ3A 5M3FG 5JPMC 2QDLA 1B7YB 1G6PA 1STEA 4UPAA 3Q0AA 1X6OA 5M3MB 3MXNB 1Q90A 3L0OA 2YTXA 3A8KE 1N34L 1Y8NB 4ZCKA 2XGTA 3F1ZA 2A69D 4DR2L 1CKMA 1CHQD 2JA9A 4HR7B 2K5WA 3TQYA 3RNUA 3GTLB 1N9WA 1DXMA 3RZOH 2OTJA 1PFSA 5C44B 1STBA 4KMUC 5IP9H 1TWAH 2J4XA 3BYTB 2XRSD 3TN2A 4KD3A 1VQOA 1AZPA 1HCZA 1A62A 3D3RA 3C3LA 4NP5A 4LF4L 1B70B 4DAPA 2B2YA 4P74A 5FO8B 2WKCA 1W6KA 3HOWG 3QR8A 1FD7D 1TIID 2Z6BA 2L5TA 2RDHA 1YJNA 2EZVA 1YEZA 4OO1H 2B8GA 4DR7L 3SK8A 3E5SA 2HHHQ 4KJOA 3V2TA 2DGYA 3D6WA 1XNQQ 2K52A 2PNRC 2ZJPA 1F9PA 4FYDA 4KI0A 1FNUA 4L5QA 4NXMQ 3NQTA 1PDQA 3VDYA 1K73C 2KJXA 3CU7A 2IX3A 4DFAA 1I3QH 2VQEQ 2F0KA 1MBYA 2JA8H 2Q8RE 1PZJD 5J1ZA 2KVMA 5FOBB 3TRZA 1EY7A 2PQEA 4YCVA 1H9JA 1QVCA 4OEMB 4LF5L 3GTMB 1AH9A 1K8GA 4JI7L 3R2IA 4BBSB 1DM0B 2L0CA 3GTPH 2NUCA 2NVTH 1Q46A 4ZUJA 1EYDA 3BG3A 3TS0A 5LHY1 3HKZB 4DK1A 4RGTA 2WB1G 5IGCA 3DWAA 4R8NA 3K81C 1Z6HA 2KENA 2Z1CA 1VS0A 2HCIA 1SMYD 3PF4A 1XPRA 1FJGL 4FVMA 3CW2C 2JQOA 1W6JA 2UUBL 1WVLA 4HIMA 4BS9A 2MGSA 2VNUD 2BDOA 1SNQA 4Z9CB 5IGDA 4L5SA 2F03A 4XDXA 4V0BA 1CSQA 1A63A 1L0WA 1PRTF 2UU9L 1G6ZA 2Z4IA 4FP5D 1EQRA 4IPGA 5C3EB 3DM1A 4L8JA 4LUZA 5KNCA 5IT9E 3M4QA 1UEAB 3S9WA 4DV1Q 1SFOB 4KHVA 5M5WH 4DUYQ 2E2JB 3EQLC 4FDBA 4XT3B 4XT1B 1N36Q 1ET9A 2AQ1B 4DV6L 1PYBA 1F77A 4FXGC 3CHBD 1FR3A 2AWNA 3PIP3 5EPLA 3GTJH 2JA8B 3PUXA 2F3IA 2EYPA 3P1HA 1STAA 1E2VA 1IKMA 1D7QA 2WAQG 1IBLQ 4GS3A 3NQIA 3IAYA 5DLQE 5I6WA 1J5EQ 1A3UA 1HR0L 3PO3B 2R6GA 2F0WA 4A76A 4JVZA 2R3ZA 4DXGA 1V1OA 2PW5A 3MTSA 2M2LA 4A3GH 2XNAC 4GKJQ 5M3MG 2EY6A 2OT2A 2X69A 4C3HB 5KYLA 5FLMG 1GUWA 1LTAD 2A6EC 3MEHA 3PUVA 4O2DA 1NBWA 1S72A 1BCPF 1HNXQ 3PQIA 1Q82C 4K8IA 3H91A 1EUJA 1PMRA 5C44G 4C2MH 1PH9A 4P75A 3KF8B 5IOCA 2B63B 1TS2A 1C48A 1SAPA 3S17B 3CCLA 3RLFA 1TS5A 4HCSA 3K8AA 5J22A 4KV6A 1L0YB 2Y0SB 5IP7G 3HOUH 1Z47A 4IQZA 3B6YA 2XRQD 5C5MA 2OTLA 1V43A 3HOVH 2N3SA 4MIUA 3CCMA 3M4PA 2NVXH 3K57A 2HDLA 1CTMA 1NCVA 3U4VA 4HIKA 1Y69U 4TKOB 3K7AH 1HQMC 1MD2D 4HSPA 3PMFA 4MTNA 5KGUA 2K5VA 4BBRH 4HJ5A 2WINB 1I4GA 3FKIB 4X6AH 4CDFC 3C46A 3UE0A 4DV5Q 2RDGA 3P7JA 4IPCA 1EIYB 3DM3A 5M9OA 3D4RA 3NWSA 2PMZB 2IJ0A 1QB5D 2VXWA 4LF8Q 4LK1C 2VQEL 4WFN3 2EIFA 3OIQA 2KECA 2F0IA 4TQUS 3RUZA 4GZYC 2EJMA 3M7NA 2EYOA 2RA4A 4BBSG 1K28A 1II3A 4A3BB 2NVYH 1HUNA 1UNSA 4NMZA 1LTBD 1CUKA 1VQ8A 1A2TA 4R4IA 3J7A5 2DNEA 2BH8A 2F0NA 3H3VC 5C0XJ 3S1RH 1XTCD 1GO3E 5C4XB 5BN5A 4C3JH 1V1PA 2NN6I 5T1GA 4OIJA 5HURA 2QGQA 2K32A 1EY0A 2RBMA 3S2HH 1C9OA 4LUVA 2EYLA 1JOOA 1H9SA 5HGQA 3F2BA 1FL0A 3I73A 2K1BA 1PRTC 3A7LA 3TMEA 3BDLA 2WIIB 1RD9D 2R61A 2DN8A 3FEWX 4IUVA 2A68C 4HJ9A 5IYDH 3CRKC 1KXLA 3T13A 3I4LA 2A5HA 2R7FA 4H44C 4DKAC 2R7ZH 1WTQA 2F4VL 5C3EG 4QQBX 4QUFA 2SNMA 5C4JB 3KK7A 2L11A 3NELA 1VQAA 4YWLA 5M3FH 2PPBC 4JBKA 1I50H 2FJ2A 3PIPA 2UXDQ 3LWEA 1KL9A 1XMQL 1VQ7A 2Q2UA 2RSOA 1HR0W 2NTTA 3U9SA 1K3BC 4BA1I 3K7AB 2ALYB 3GP7A 5KRUA 1JWUD 2NVQB 4BBRB 1T9HA 4DV1L 3CCUA 1PZID 2VY3A 4KN7C 3R2TA 4DV7Q 4RGOS 2JA8G 4YCWA 1CT1D 3J7AV 4DUYL 4IALA 4XQJA 4ZYSA 2ZTEA 4RA8A 4YWKA 1N36L 3GTOB 1KAAA 3PO3G 2WFWA 2H5XA 1EY8A 4IUUA 3S16B 4RAUC 1AEXA 3A7AB 2XWBB 1BCPC 3HOWH 4OXPA 3T1YQ 4X3SA 4C3HG 5M5YH 1YI2A 1IBLL 1G2SA 3G48A 2DJGC 2AQ2B 4QUCA 4H13C 4DAYA 4LNQA 4DR6Q 1H9MA 4C3JB 1B8AA 1XPOA 2F3WA 3S2HB 2CVRA 2B63G 3X3NA 1I4PA 4JI1Q 1KDCA 2RHSB 4JOIC 1HXYD 2Y0SG 3PO2B 1Z9FA 2BA1A 3GTKB 2NN6G 4FF1A 2VZAA 3T56B 4A3KB 1L1OA 4KHZA 2RDFA 3L9AX 1I4QA 1F2ZA 1UE5A 2WV6D 2F0VA 3VR6A 5EKKA 3DLLA 1SYBA 1JC7A 2OEOA 1AW7A 4HN7A 2L4NA 5DM73 4IO9A 3TP6A 3VYUA 3CCJA 1DCZA 3ULJA 4FO2A 1YNNC 1F2YA 1KD1C 2NBFA 3FKIG 5C4ZA 2I0QA 2OQ0A 2RCNA 5COYA 3CAMA 1CQVA 1PH8A 1VQKA 4A3FB 4JPBW 1GKHA 2F0QA 2I46A 4POFA 3OPOA 1PYSB 3BS1A 2O5IC 1XMOQ 3VA5A 3K0YA 4KK7A 1HRJA 3RR5A 3N6RA 2Z6KC 4JI4Q 5BN4A 1FGUA 3W1GA 1ENFA 5JVG3 5G3LD 4JI8Q 1GHKA 1QG7A 1BBUA 2E5LL 4A3BG 3J7YW 2EYMA 3JAMi 3HFZB 4IFDJ 4L63B 2PZWA 4OWWB 1SE2A 5GADC 4NDXA 3D31A 3HOZB 1PTOD 4LF8L 4NPSA 5C4XG 2E76C 4AYBB 1SDFA 1LLRD 2JA7B 4CBVA 1DGSA 4IJHA 5M5YB 1D5XC 3PUYA 5AFWA 1PLFA 2B2UA 1PA6A 3MWYW 1E1OA 1WCMG 1HA6A 2KCNA 2F0FA 2LXJA 5C4HA 1BBWA 1LTLA 1KAWA 1YNJC 4KKUA 3SHLA 1EY4A 4TVAB 3HP3A 3AFQA 4ILWA 1CFMA 1HNWL 1STYA 1NSNS 1SNMA 1JJ2A 1B44D 4OX9Q 4FF2A 1HH2P 5IIFA 1Q86C 2CKZB 2JEBI 4OHJA 2F0TA 4LMQD 1BOSA 1MJEA 1R4PB 2EJGC 4X3TA 5GAEC 1HFNA 2EYJA 5K5PA 4KLKA 5FO7B 1EL0A 3PUZA 1IYUA 3BU2A 5FLXE 5M3MH 2EYHA 2F3VA 3A5UA 4CKEA 1AE2A 1X9NA 2CHBD 3OIPA 2QKIC 1FJGQ 4N9TA 4BBRG 1X3QA 2E74C 4UHVA 4HAEA 3A55A 1E2WA 4P72A 4B3RL 4HMJA 4K14A 5C44H 4HIOA 4OONA 5ELNA 4DV2Q 5KNBA 4DAMA 3STBC 3IRBA 1AN8A 3WDNA 1WTPA 2WKDA 1ASYA 3OYYA 2O5JC 4APVA 1WOCA 4E6IA 1PFMA 4A3MB 4X66Q 1QVFA 5IP7H 1ESRA 2A1AA 1G2TA 2BE5C 4GOPA 1LT4D 1O80A 1UAPA 2IWHA 3WOEA 4AIMA 4CKCA 1RF2D 4DV7L 4HIDA 5CMDA 5DAUA 3WWVA 5JPNC 4JYAL 1KNAA 2LS01 2UUCQ 4IUQA 2IW3A 3AEVA 3K0XA 1EQTA 2E2HB 1LV9A 1X56A 1OXVA 5EPKA 1EYAA 1QVGA 4M1UB 4KHPQ 4DGZA 3H09A 1I5FA 1YZ6A 5NUCA 3SK6A 3J81E 4JBJA 1ICFB 3T1YL 4ABNA 3M3YB 4A3DH 1TT2A 2CH4A 4PQXA 3JAMc 5BR8Q 3PO2G 1EU4A 4DR6L 1JR0D 1O7IA 4DPGA 3AMUA 4A3KG 1GOZA 2NZ1D 2PYKA 2F0UA 2OWOA 3ND9A 3GTMH 4ZKBB 4EQPA 2QCPX 2F4IA 1SYFA 3NXWA 2F0GA 3CKIB 4BBSH 1TY0A 3GTQB 5IE8A 1TVXA 3T16A 4B9XA 2WAQE 2QA4A 1F2LA 1RTOA 2B2VA 2RSNA 4RFBA 2PNHA 5ELEA 4X62L 2B2TC 4U673 3E6ZX 3S14B 1RIPA 3MXPA 4K6DA 5JJZA 3HOXH 2D62A 4A3FG 1Q81C 2H1EA 1JT8A 1PYWD 3MC0B 3GDEA 3LNNA 1QILA 1VQLA 5EJWA 5EBCA 1EIFA 1SLJA 3DUZA 3R93A 1V1PB 2ICIA 2D0PA 3KDFA 2CCZA 4IJLA 1LUZA 2M9VA 1XMOL 4G7OC 1VMPA 2ZT9C 3U50C 5C3EH 1CSPA 3J80L 1H9SB 3HOZG 4JI4L 1Y1VH 4F7XA 4ME3A 1S40A 4JI8L 3Q8DA 1GUSA 2JSOA 4EQOA 4AYBG 1SFOH 3KLSA 5E4XA 2JA7G 3FPUB 5JJIA 3ERSX 1GM5A 2JA6B 3J80i 1KHIA 1FNVA 2E2JH 3L7ZC 3ZJYC 4P73A 4JK1C 1NY4A 2MPMA 4F87A 2SEBD 3W5OA 1H95A 4KY6A 4JBWA 2K6AA 2BH2A 5T1IA 1X32A 2K05A 3VR5A 3K6OA 2B2WA 4A3DB 1VQ9A 1O7LA 2HCCA 3EIVA 1T5EA 3DHQA 2A6ED 1KLGD 3D6CA 1WI5A 2K28A 5CV4A 1RTNA 3NENA 2A6HC 1ENAA 5DM63 5AJ3Q 3PO3H 1MGSA 4PZ8A 3U4ZA 1LM0A 2VW9A 1ZYRC 2L55A 3MFYA 1X3FA 4OX9L 1SYDA 2HQLA 4C3HH 2PI2A 1JICA 4GNXC 1V9PA 3PGZA 1LACA 2A74C 4B3MQ 4ALPA 4WJ3M 5I6YA 4HJ8A 3HKZE 1A3VA 3S15B 2K4KA 1EYGA 2WACA 1NJIC 4WRDA 1XXGA 4QY7A 3HOXB 1SE8A 2B63H 3S17H 4CJ2C 3NTHA 5D3IB 4C56C 4OWTB 2PZUA 2JYOA 3CCVA 4A3MG 1GUNA 4A3EB 3KJOA 4K2KA 3CF5A 4QJFA 1FVIA 2F4VQ 5FKAC 2N8NA 4JI0L 1R9TH 2NN6H 1EQQA 1TXYA 5ELFA 3J7AF 5IWAL 4DAYB 4DV2L 4IPDA 1XMQQ 4JI6Q 3OMGA 3H6MA 4QIWE 4FF4A 1AFPA 1O78A 2OF1A 5JEAG 3DEPA 4Y7NH 4X66L 4DK0A 1IBMQ 4GN5A 2D2CC 2NZHA 3AU7A 4UY8C 1VQ4A 4B08A 1KDAA 1TS4A 1B53A 1Y1VB 3F8TA 1KC8C 4BXXG 3FKIH 5DEHA 4A3CG 3KLWA 1BXTA 1L1OB 4NW2A 2MQHA 2UUCL 1DOMA 2MFIA 2K5HA 4LWCA 2KA7A 4KHPL 4JV5L 2VB3X 3TSSA 2ZJQA 5LL6X 3I90A 1VQPA 2KCCA 2IHEA 5M5XB 4KY5A 2VQFQ 3FP9A 3BDCA 4JI3Q 1Q3LA 5IYCG 1LABA 2R93B 2XN9C 4A3BH 2F0DA 2N49A 5BR8L 1MJCA 4L5TA 3J80c 1LT3D 1JCKB 1Y8PB 2L9HA 2BOSA 3BZKA 4IURA 3I4NB 1ILPA 1MSHA 5C4XH 4HJ7A 4YWMA 1RDPD 3A54A 2I5MX 4R4OA 2A68D 1I6HB 4GKKL 5ISRA 3C1EA 3KF6A 3VYSA 5JJLA 3OTOQ 2CWAA 1P16A 2FXQA 2PW7A 1I6VC 2G9DA 4X3KA 1VQ5A 1WTXA 4K5VA 1WCMH 1J6QA 2AWOA 1D1KA 3E0EA 1XWEA 1S5ED 1KQSA 2A73B 1BR9A 1EIGA 1HNZQ 1DZ1A 3G7LA 2IY5B 1PTOB 3GO5A 3HRZC 3BZDB 3A56A 2ZJRA 4G7ZC 2DY7A 1W2BA 1R9TB 1OXTA 2D5DA 3DMUA 3ITPA 4LFBQ 4O42A 5C4JH 1CA6A 1JB7A 1LTTD 1A3TA 2SOBA 2C5CA 3S1QB 4Y7NB 2JA6G 2SDFA 2FMCA 4PG3A 1NE3A 1E1TA 3HG9A 4X64Q 2NWGA 4GN3B 1EU3A 2NVQH 2MO0A 1SROA 1SNPA 2NYZD 1JJGA 1SE4A 3N52A 4RH6A 2E5LQ 1RODA 3D8GA 4A3DG 3TZUA 1RHPA 4B3TQ 4XTCS 3GTOH 5L37A 5CYUA 4A93B 4K0KQ 3O13A 2X6GA 3KJPA 1FGBD 1QOHA 3IKJA 1VQNA 4BY7B 3MEFA 2K50A 2KHSA 1VQCA 1VQMA 3S16H 5D65A 1G91A 1IYJB 3QWNA 1LTRD 3CMEA 2C35B 1EZ6A 3PF5A 1HHVA 4XYQA 3IFDA 1E2ZA 1S4ZA 5AJ3L 1I94Q 2EPBA 4JOIA 1EWIA 4UP7A 2F1MA 3FDTA 1YIJA 1X3PA 4DXFA 1TS3A 4X65Q 4GOPB 3LGJA 4LF9Q 3HOXG 3CCQA 3EVQA 1U9RA 1HNWQ 3MA2B 4RWSC 2Z8LA 3HZXA 5CC4A 1OXSC 2OXPA 5D14A 3K58A 4LAAA 4IZ8A 4B3ML 4A3EG 1AP0A 1WCMB 4IPHA 5E4WC 3W1BA 3PO2H 3GTKH 2DNCA 2CH4W 4DU9A 1KRSA 4HTHA 4OGQC 3RLOA 4A3KH 3JC66 2EY1A 3CC2A 4I65A 2ENBA 2R7DA 5FJ8G 4H7BA 5IYBG 3ICEA 2MHVA 5LMNQ 3D0FA 5J3BA 1STNA 1QNKA 2LY7A 1Y1VG 1YHBA 1PHJA 2F52A 1WD0A 4B3RQ 1M90C 4MHEA 4JI6L 1PH3A 1SJHD 4A3FH 1IBML 4FXDA 4QB4A 1DOLA 1X3GA 4KKTA 5J39A 2JN4A 2HT1A 2K03A 2NZOA 4N8X1 4GN4B 5C0XI 2JE6I 2SNSA 2TSSA 3RD4A 4JYAQ 1STHA 2R93G 5CV7A 3QOLA 2R92B 1HJPA 4K5WA 1QWYA 3E0JA 4R4TA 4K2LA 4J6HA 4B3SQ 1VF7A 3HOZH 3I4NG 3P20A 2EXDA 2ES2A 3URYA 1YNJD 3PSIA 4CDCC 3UE1A 3C1FA 5A2QL 2VQFL 3BVZA 4JI3L 2JA7H 1Q12A 1LTSD 1JOQA 5EBDA 1U4LA 2L12A 5K36G 4UP9A 2O4XA 3L2PA 2E75C 4PV1C 1JE4A 1PV4A 3KDFB 3GTGB 5IGEA 1JJCB 1I4XA 3PV0A 3NBHA 1PH1A 2K04A 1XNRL 1F9SA 4JW0A 4RMFA 1U4RA 3BYYB 1TR5A 3P75A 2EE1A 3M4OB 2RKSA 3OTOL 3GV3A 4RHSA 1A15A 2F0HA 4O1NA 1EFID 4CJ1B 3Q24A 4EQ5A 1Y1WB 4IUTA 3SEBA 3T51B 4B9WA 4X62Q 1WTWA 1HNZL 3AQQA 4DAVA 4LF6L 3J7ZC 3SE0A 4S3SA 2YU9H 4K8JA 4CDDC 4P71A 5E3FA 3PIOA 4LFBL 4EVOA 4XXEA 2BE5D 1LTGD 3HEJA 4UDUC 4R4QA 3KLRA 4AH6A 5H1SE 3RN2A 1WTVA 4PZ6A 3VR2A 4HEDA 3NSWA 4OELB 1HZ9A 4YY3Q 1PTOF 3BJUA 2L1BA 4X64L 4HMIA 4ZRZA 4PMCA 4A3MH 4ZQ3A 4A93G 4HJAA 2OCEA 4BY7G 2B39A 3MFGA 2V4DA 2J0TD 2X6LA 1XJVA 1IYVA 1ONLA 2CW0D 4I7ZC 1CK1A 5CGKA 4MZ9A 1SMXA 2V1CC 2A19A 1A8VA 3NBIA 1P8LA 1QUQA 1SNOA 5LL6S 1H9RA 3NTKA 4B3TL 4XQNA 5JEAH 5GQOA 4K0KL 3I4MB 3V05A 2E2HH 5IGFA 2MP1A 5C0XG 1WFQA 1U4PA 1TWHH 4HSVA 3L3OC 1HFGA 4BXXH 1H9KA 4A3CH 3TREA 3G6JB 5C5LA 3J81j 5CR3A 3M3YH 1PH6A 1NTGA 5I2XA 1NUCA 1IBKQ 1BVSA 4TRDA 2AMCB 1I94L 3CD6A 5IGBA 1CI3M 1BQQT 4JBMA 3VYRA 1UE6A 2MO1A 3I72A 1LYLA 1QNUA 1SXTA 5CBEE 1F2MA 1Y8OB 4DNTB 1HTPA 1OXUA 2KEEA 4X65L 4LF9L 2O2LD 1VQGA 4C3IB 3OW7A 5IYCH 1AZQA 1BF4A 1JWSD 3SDZA 4ZUIA 1ET6A 3QOJA 3GTQH 3KLSX 1UUPA 1WTOA 1NNXA 4JI5L 2B29A 1IW7C 4PMBA 4M8AA 1SSOA 1VDZA 2VL6A 1LT5D 2I5LX 1B50A 1WD1A 2CQAA 1B3QA 3EBEA 4X3UA 1GUOA 2QEXA 3S14H 2FINB 2YU9B 2DY8A 2EY2A 4CGYB 5LMNL 4A75A 3IFTA 4NB3A 1KDBA 4UP8A 1K9MC 1X54A 1Y14B 4JI0Q 2HD3A 4CKBA 4WJWA 2UXCL 2G9HD 2WB1E 5IWAQ 1A6XA 4QF4A 4EGVA 4IOAA 1PH7A 3BVMA 1PRTB 4ZLTF 3MXGA 2R92G 5CV5A 3RZDB 3KF6B 3MHBA 1RL2A 4F8MA 1KNEA 1N8RC 1L1OC 2IT1A 1SRUA 1GVPA 1JQYD 2XTIA 1KTKA 1K83B 1OO9B 3H0GB 5CV9A 5CBAE 4EX5A 4BY1B 2Z9HA 4R1JA 2QEJC 5CV6A 4A3LH 2JA6H 4YIJA 4B3SL 2A6HD 4DNIA 1BUVT 1DJRD 1TWHB 4JV5Q 5FO9B 1JE5A 1CKOA 1ZYRD 2E2IB 4QL5A 3OWEB 4MTKA 3OHXC 2WP8J 3K7UC 2KOLA 3OMCA 4A3IB 3RMHA 3QO2A 3H3VI 4YHHQ 2PQAA 2HUGA 4GNXA 1Y1WG 2IPKD 3A5ZB 4K5XA 3OOCA 5D3DA 3LWUA 1C8CA 3HGBA 3SXHA 5IT9L 1QJOA 4MN3A 5BN3A 2JA5B 3R3OA 5HY6A 4FF3A 2J7ZA 1IL8A 4GKKQ 4BA2I 1D6EC 3X3MA 1W3SA 5C3XA 1CA5A 1SYCA 3ONAB 1S5FD 1QCBD 4L6TB 1OXXK 5C6AA 2BDNA 2FHTA 3TP8A 4DR5Q 1O7ZA 4N8FA 2D9UA 3S15H 3HOYB 1HZCA 5DNFA 1B9MA 3JAME 1TY2A 1D5MC 1D8LA 1SNDA 3F2DA 1B9NA 2NTSA 4CDEC 2HIXA 1I4RA 4A3EH 3KOJA 3CCEA 3VR3A 3R8BA 5TSSA 3ULPA 2AKWB 1B3AA 4A3JB 1MIUA 4IFDG 5FJ8H 3I2ZA 4YY3L 2GVAA 5IYBH 1A0IA 3I7FA 3I4MG 4DV4Q 1VQ6A 2GA4B 1VQBA 3GV6A 4JG2A 3FMCA 1SE3A 3UI2A 4KN4C 1E3PA 4DR4L 1YBYA 4J8QA 4G4KA 2Z0SA 2XWJB 1GHJA 5JAVA 4DR3Q 1M4VA 1Q8KA 2Q8IB 3CCSA 1SEBD 3PUWA 5LMNW 3QB3A 5M5XH 3CXCA 2UUAL 3S24A 4C3IG 1VQFA 1EYCA 1WYDA 3M85A 4ID6A 3M9BA 1IBKL 2R93H 2YTVA 5JVH3 3I56A 1VQDA 1M8AA 2P5ZX 4OL7A 3CPWA 4GOPC 4FNFA 2DJFC 3ZYYX 2F0JA 3I4NH 1N32Q 2Z4HA 1I6HH 2JXMB 5EGTA 3G71A 1KRTA 4PMWA 5I2YA 1VQIA 5K36H 1DONA 2ZXPA 3E9HA 1QZGA 1C4QA 1TWFH 2YTYA 1FNWA 1A2UA 5EKIA 1ILQA 5GAGC 1HTLD 5CORA 2VUMG 4XYOA 2EYFA 2F0OA 2RVLA 5I4DA 3E3XA 2E8GA 3QG1A 3CPFA 5LMUQ 1YNXA 3NK9A 1MSGA 1PTOH 1EQVA 2RF4A 1S5BD 5E1FA 4ZKCB 3A8JE 5KNDA 4LUOA 2D0OA 1BKBA 1F9RA 5IY0A 1FYCA 1Q1EA 1U4MA 3I91A 3K5OA 2EXZA 2QF7A 3NBHB 3H0GG 2F0EA 5IT9c 3CP0A 4KD4A 4BY1G 4DUZQ 2EQSA 3S1QH 3WOFA 1B1ZA 2EDGA 4LFCQ 2RQXA 2B2VC 4C1NK 2ICEC 3W2DA 3RZOB 4ODGA 1EY9A 4LJZC 1TWAB 3M7GA 1YJWA 1QE6A 1BO0A 4QIWB 3FHWA 4A3IG 2A69C 1SYEA 2JJQA 1S3OA 1DD2A 4N9PA 1K3RA 4J15A 4K6LA 5ELBA 4A93H 4BY7H 1CKNB 1CQFA 3GD7A 3ER0A 4DF7A 4QMGA 4P2CB 1G51A 1EIHA 1L0XB 4IUNA 2JA5G 1GXDC 1K8AC 4UAIA 4Q0FA 5JJKA 4YHHL 5EQ0A 2B2YC 5C0XH 1PRTD 1LO5D 1XNRQ 3FVQA 4H02A 1JWMD 4LF7Q 3HOYG 1WTRA 1HZBA 1I3QB 3F2UA 1PVOA 4G7HC 1EY6A 2KBNA 5I9OA 1Q8IA 1QUQB 1TWFB 5KIXA 3DWQA 3S2DH 2PZTA 4IN3A 1XTDA 1EWCA 5GROA 5CV8A 3D4DA 4QGUA 4DR5L 1XPUA 2CWPA 1WTHA 1YJ9A 1EFWA 2B2WC 3NUCA 4A3JG 1N33Q 1NAPA 3DXJC 4R9WA 2Q2TA 4LF6Q 2GVBA 3K5LA 3J80E 3GTPB 2PCFB 2F0MA 2NVTB 4LFAQ 3ND8A 3EA6A 5IODA 2Y0SE 3Q6SA 4GLAC 2JEAI 1EY5A 2ZM6Q 1PZKD 3QIAA 1EZ8A 1ESFA 1SN8A 4A3LG 2M00A 2FMMA 3I8ZA 4DV4L 1ZKOA 4EQNA 4Y52H 4OO1I 4RG1A 3AFPA 1MHWC 1BCPD 4OWXB 4PZ7A 1GUTA 4GLVB 2F0LA 2F0SA 2I5HA 3K5NA 3PIO3 1SMYC 4DR3L 2R92H 1JORA 2ZTDA 2K01A 5EPJA 2PMZE 1HA5A 1VMCA 4JI2Q 4R8IA 1GD7A 2Q2HA 1PFBA 1VF5C 1Q7YC 2C9OA 4XQQA 2KEDA 5M5WB 2G5DA 2HHHL 1K8MA 3I70A 1EEFD 3W3AA 1XNQL 3GTGH 1T5XD 3FRPB 1N32L 4NXML 2K5QA 3MVVA 1JMCA 2QW7A 4FXKC 1ICWA 3MXNA 3GTJB 3ERQA 4G57A 5IGGA 3TS2A 1D1IA 1PH2A 3M4OH 1C0AA 4NXNQ 3UDIA 3TP5A 3S2DB 2LXKA 1OTCA 4JCVE 1G8ZD 5ELOA 1UE7A 3TZDA 4DR1Q 2EOTA 3KFUA 4JI5Q 1YNND 1Y1WH 2AUJD 3HKZG 1RKNA 1TQOA 2ATWA 4KKSA 4A3GB 3K5MA 5LMUL 2MUYA 3Q23A 1TWGH 2L15A 3AB9A 2DUDA 1MKHA 2RHQB 1MI2A 1K8OA 1ML0D 1U5KA 1ZEQX 4ME5A 4IUPA 2CQOA 4Q5VA 1PH5A 4HCEA 3ULLA 1IL2A 4A4IA 2PQAB 4GNXB 1RJTA 4V190 3C2PA 4AQYQ 2UXCQ 4C2MB 5KEEA 4DUZL 5IP9G 2Z6KA 1D2BA 1WJJA 2Q2IA 3BZCA 4LFCL 3DWPA 1SYGA 3K80C 1YITA 1HPCA 3HOUB 2KHJA 1SNCA 4MNOA 4RHRA 3HOVB 2K5NA 2HDMA 1UEBA 3F2CA 4DA2A 4ZAIA 1D5ZC 2NVXB 3SR1A 2H4OA 4IFDH 4OO1G 2B8FA 3KUPA 2JK8A 4WORA 2ID0A 5FLXL 4RCNA 2EY5A 1C7YA 3I4MH 1B2TA 5I9PA 2EVBA 5ELCA 3K59A 1E7ZA 3T4AC 1TKWB 4TSSA 1PXUA 1V1QA 1HZAA 3OSOA 2K5DA 3CCRA 1O7YA 2FFKB 3H94A 3KBGA 4POGA 1EWHA 4KJNA 2E2DC 1IW7D 3EJIA 2IX0A 1PFNA 4LF7L 3Q22A 4DV0Q 3T1HQ 1Z7TA 2ZXOA 3E9IA 4C3IH 3BVGA 1V8QA 5KYIA 2NVYB 2Q8TA 4CJ0B 1J5EL 2XIWA 1GJXA 3A74A 3D4WA 3SVMA 4DV3Q 3S1RB 1R4QB 1XX8A 3U58A 1N33L 2ASBA 3LX0A 1IZ6A 2IHFA 1TWGB 4GKJL 4RCOA 3NEMA 3H3VH 3STBD 3J81L 2LSSA 4LFAL 1TU2B 4RKBA 1CKNA 5G3LF 1HNXL 3H15A 2HQEA 4DN4M 5FK9C 2ZXRA 5E7NA 4KTAA 2ZM6L 2UXBQ 1S5DD 2VUMH 2N78A 3RN5A 4RGMA 2XVSA 3CC4A 1VCIA 3J81i 3NWTA 1B4OA 3MZ5A 1S5CD 1ZXTA 4RKLA 2TMPA 1BDOA 2R7ZB 1DYQA 4NKLA 1N34Q 3RZDH 4DR2Q 2PI2E 2YYZA 1LTID 1NR4A 3VYTA 5M3FB 1IKLA 1HQRD 2IL8A 1K83H 3H0GH 5HGTA 1I50B 3NP8A 4DR4Q 4RGNA 4BY1H 3FPPA 3SGIA 4DK3C 3EROA 3EN2A 4QCLA 2F0PA 3S1MH 1CHPD 4PNYA 3CC7A 1CM9A 5EKLA 3NTIA 2BA0A 3EFXD 2I07B 3JAML 3BDOA 2XSCA 4XIGS 4JI2L 1EEID 1E24A 2AHOB 3SK4A 1BBXC 2MNAA 4LF4Q 4AYBE 4JC0A 3KBXA 5GAHC 2UUAQ 2E2IH 2KCMA 2K14A 1SJED 4DV5L 4F88A 1IHZA 2AUKA 2LKVA 1X65A 4A3IH 3AYHB 4DR7Q 3TEHB 4ULLA 2NB0A 2IX1A 3RLNA 2QDBA 2PO4A 1UE1A 2KUMA 3KF8A 4U68A 4R4CA 4A3GG 2A8VA 3HOWB 3A0JA 2B2TA 1Q1BA 4BWGB 2LMCB 3S1NH 4C1NI 4NXNL 1M1KC 2BCOA 3DEOA 2QILA 2JA5H 1VQEA 5F2DA 2CFMA 4I7AA 1L2FA 2LFNA 5FLXc 4DR1L 3CRLC 1K0RA 3TBIB 1SR3A 1NR2A 3VR4A 4IOCA 1HUMA 5A35A 4LF5Q 3KYHC 3HOYH 1GUGA 1YHAA 3GQBA 3CQZH 3SK5A 3MAQA 4KY7A 4JI7Q 4IFDI 4CHTB 4DK6C 1AE3A 2RCFA 4DNRB 4OIKA 3HOUG 3UDGA 3CMAA 1TWCH 2VUMB 3A8IE 3TDQA 4AQYL 1KIXA 3HOVG 1ENCA 3PCOB 1LT6D 1X55A 4A3JH 3G6EA 2K7VA 2YV5A
chains in the Genus database with same CATH topology
1VQDA 3CPWA 5C4JH 4GOPC 3HOWH 1JB7A 1VQJA 4OXPA 5FLMH 3T1YQ 5M5YH 3I4NH 1N32Q 1YI2A 1IBLL 1ASZA 2UUBQ 1U0LA 3G48A 3GTLH 2JA6G 1I6HH 4PG3A 1NE3A 1E1TA 3G4SA 3G71A 1KRTA 4PMWA 4LNQA 1VQIA 4GLXA 1E22A 4X64Q 4DR6Q 2UXDL 4GN3B 1B8AA 2NVQH 1XPOA 3E9HA 2VS1A 5EAYA 2MO0A 3HKSA 1SROA 1TWFH 3J81c 1IXRA 1QZGA 2B63G 1NMGA 2YTYA 3I4OA 1JJGA 2UU9Q 2KCTA 2KHIA 3UDFA 5GAGC 2VUMG 2OQKA 4JI1Q 1UWVA 2RHSB 2HIVA 2E8GA 4JOIC 4O0AA 2E5LQ 4A3DG 2Y0SG 3CPFA 1NMFA 1VQHA 1Z9FA 2BA1A 5LMUQ 4B3TQ 4XTCS 1YNXA 2NN6G 3GTOH 2VZAA 1G291 2ZTCA 4K0KQ 3KJPA 1VQNA 2RF4A 1L1OA 4KHZA 3MEFA 1UE5A 2B3GA 2K50A 1VQMA 1VQCA 1X3EA 4LUOA 2D0OA 3S16H 1BKBA 1IYJB 5IY0A 1Q1EA 3DLLA 3CMEA 5JEAJ 2C35B 3NBHB 3I55A 1EOVA 3H0GG 3PF5A 4IO9A 1PH4A 5IT9c 3CP0A 3CCJA 4L5RC 4BY1G 4DV6Q 4WJ4A 4DUZQ 2EQSA 4DV0L 4LW1A 3ULJA 3S1QH 3T1HL 1KD1C 5AJ3L 1I94Q 4LFCQ 3FKIG 4JOIA 2K75A 1EWIA 2I0QA 2OQ0A 4UP7A 2RCNA 1YIJA 3CAMA 4X65Q 4GOPB 1PH8A 3LGJA 1VQKA 4LF9Q 1GKHA 3HOXG 3CCQA 4DV3L 4POFA 1HNWQ 3OW2A 1PYSB 1HR0Q 1XMOQ 1OXSC 2GN5A 1YJWA 3RR5A 1YHQA 4B3ML 3UDXA 3FHWA 4A3EG 4IPHA 2Z6KC 5IYDG 3W1BA 4JI4Q 3PO2H 3GTKH 1FGUA 3W1GA 4YCUA 4A3IG 2JJQA 4JI8Q 1S3OA 1KRSA 1K3RA 4J15A 4JI1L 4A93H 1BBUA 3RLOA 4A3KH 3JC66 2E5LL 1CKNB 2R7ZG 4BY7H 3GD7A 3ER0A 3CC2A 4A3BG 3JAMi 1YVCA 1QZHA 3HFZB 4IFDJ 2R7DA 5FJ8G 2UXBL 5IYBG 1G51A 4OWWB 3ICEA 5LMNQ 5GADC 5M3FG 3D0FA 5J3BA 2JA5G 1K8AC 3D31A 1B7YB 1G6PA 4UPAA 4LF8L 4NPSA 1X6OA 5C4XG 5JJKA 1Y1VG 3MXNB 3L0OA 4YHHL 1YHBA 1PHJA 2YTXA 1DGSA 2F52A 1N34L 2XGTA 3F1ZA 4IJHA 4DR2L 1XNRQ 4B3RQ 3PUYA 1CKMA 1M90C 2JA9A 4H02A 4JI6L 1PH3A 3RNUA 3TQYA 1PA6A 4LF7Q 3HOYG 1HZBA 4A3FH 1N9WA 1IBML 1PVOA 1E1OA 1WCMG 3RZOH 2OTJA 1PFSA 2KBNA 2LXJA 1X3GA 1BBWA 5IP9H 1LTLA 1KAWA 1TWAH 2HT1A 2NZOA 1QUQB 4TVAB 3S2DH 4GN4B 3AFQA 1HNWL 1XTDA 5C0XI 5GROA 1VQOA 4QGUA 2JE6I 4DR5L 1XPUA 1A62A 1JJ2A 4OX9Q 2CWPA 1YJ9A 1EFWA 1HH2P 4JYAQ 2R93G 1Q86C 4LF4L 2CKZB 2JEBI 1B70B 4A3JG 4P74A 1N33Q 1HJPA 4LF6Q 2Q2TA 3HOWG 2GVBA 1MJEA 4R4TA 4LFAQ 5GAEC 1YJNA 4B3SQ 1YEZA 2Y0SE 3I4NG 3HOZH 2EXDA 2ES2A 3PSIA 4KLKA 4DR7L 4GLAC 3PUZA 3UE1A 3BU2A 2VQFL 4JI3L 2HHHQ 5M3MH 2DGYA 3A5UA 1XNQQ 1AE2A 2JEAI 2K52A 1X9NA 2JA7H 1Q12A 2ZM6Q 2ZJPA 1FJGQ 5K36G 4KI0A 4UP9A 4L5QA 3L2PA 4NXMQ 3VDYA 4BBRG 1K73C 1SN8A 3KDFB 1PV4A 4A3LG 1I3QH 1JJCB 2VQEQ 4DV4L 3PV0A 1XNRL 1PH1A 2JA8H 4P72A 4B3RL 4Y52H 5C44H 4HIOA 4RG1A 4OO1I 4RMFA 3TRZA 4OONA 5ELNA 4DV2Q 3AFPA 4YCVA 4DAMA 3STBC 3IRBA 1ASYA 4OWXB 3OYYA 4APVA 1QVCA 1WOCA 4PZ7A 1QVFA 4X66Q 3OTOL 5IP7H 4GLVB 2A1AA 4LF5L 2I5HA 4EQ5A 4GOPA 1K8GA 1AH9A 4DR3L 2R92H 4AIMA 4DV7L 4JI7L 2ZTDA 4HIDA 3WWVA 3GTPH 4JYAL 4X62Q 2NVTH 2PMZE 2UUCQ 1Q46A 4JI2Q 3AQQA 1HNZL 1GD7A 3AEVA 4LF6L 3K0XA 3TS0A 3J7ZC 2Q2HA 1X56A 2YU9H 1OXVA 1Q7YC 1QVGA 4P71A 4KHPQ 2WB1G 3PIOA 4LFBL 1I5FA 1YZ6A 2HHHL 3K81C 2KENA 1VS0A 1XNQL 3GTGH 4JBJA 3T1YL 3PF4A 1XPRA 1FJGL 1N32L 4NXML 3CW2C 2JQOA 1JMCA 4A3DH 2UUBL 4R4QA 4AH6A 3RN2A 5H1SE 4HIMA 4PZ6A 3JAMc 3PO2G 5BR8Q 4YY3Q 1HZ9A 3TS2A 2VNUD 1PH2A 3BJUA 4X64L 4DPGA 1O7IA 3M4OH 4DR6L 4A3MH 4A93G 1C0AA 4NXNQ 3UDIA 4HJAA 2OCEA 4A3KG 4L5SA 2LXKA 4BY7G 1OTCA 2OWOA 3GTMH 1CSQA 4JCVE 5ELOA 1L0WA 1UE7A 4DR1Q 2UU9L 1A63A 3KFUA 1XJVA 4JI5Q 1EQRA 1Y1WH 4IPGA 4MZ9A 1SMXA 2V1CC 3HKZG 4BBSH 2A19A 5IE8A 1A8VA 2ATWA 1P8LA 1QUQA 4LUZA 2WAQE 5LMUL 4B3TL 3M4QA 2QA4A 4K0KL 1TWGH 2L15A 5GQOA 2E2HH 2DUDA 1MKHA 2PNHA 2RHQB 4DV1Q 5C0XG 1WFQA 4X62L 1U5KA 1TWHH 5M5WH 1RIPA 4DUYQ 2CQOA 1PH5A 4BXXH 3HOXH 4FDBA 2D62A 1N36Q 3ULLA 4A3FG 1IL2A 4A3CH 4A4IA 2PQAB 4GNXB 1Q81C 3TREA 1JT8A 4AQYQ 2UXCQ 4DV6L 3J81j 4DUZL 1PYBA 3GDEA 2Z6KA 5IP9G 1PH6A 3M3YH 1NTGA 1WJJA 1IBKQ 2AWNA 1BVSA 1VQLA 2AMCB 2Q2IA 1I94L 3BZCA 4LFCL 3CD6A 1EIFA 3GTJH 3PUXA 2F3IA 1SLJA 4JBMA 1UE6A 2MO1A 1LYLA 3K80C 1YITA 1D7QA 2KHJA 1OXUA 4X65L 4LF9L 2WAQG 4MNOA 1IBLQ 2D0PA 1VQGA 3KDFA 4GS3A 2CCZA 5DLQE 1J5EQ 2K5NA 4IJLA 1LUZA 5IYCH 1UEBA 1XMOL 2R6GA 3F2CA 1HR0L 4A76A 3U50C 5C3EH 1CSPA 3GTQH 3HOZG 4JI4L 4OO1G 4A3GH 1Y1VH 4ME3A 1S40A 4JI5L 2B29A 2JK8A 4JI8L 4GKJQ 3Q8DA 5M3MG 2ID0A 2VL6A 4AYBG 1C7YA 3I4MH 2I5LX 1SFOH 5FLMG 2JA7G 3PUVA 5JJIA 4O2DA 1NBWA 3EBEA 2QEXA 1S72A 1E7ZA 3ERSX 1HNXQ 1GM5A 3S14H 3J80i 1KHIA 1Q82C 5LMNL 1V1QA 2E2JH 1HZAA 1EUJA 3L7ZC 4P73A 1NY4A 3ZJYC 3CCRA 4A75A 4NB3A 4UP8A 3W5OA 5C44G 4C2MH 1K9MC 1H95A 1PH9A 1X54A 4P75A 3KF8B 4JBWA 1Y14B 2BH2A 3CCLA 3RLFA 4JI0Q 4POGA 3K8AA 2UXCL 2WB1E 5IWAQ 1VQ9A 3EIVA 5IP7G 2IX0A 4IOAA 1PH7A 3HOUH 4LF7L 1Z47A 4DV0Q 3B6YA 1WI5A 2OTLA 2R92G 3NENA 3T1HQ 1V43A 4C3IH 3E9IA 3HOVH 5AJ3Q 3PO3H 3KF6B 2N3SA 3CCMA 1RL2A 3M4PA 4PZ8A 1N8RC 2NVXH 1L1OC 3U4ZA 1LM0A 2IT1A 2VW9A 1SRUA 1GVPA 1J5EL 2XTIA 3A74A 1X3FA 3U4VA 4HIKA 4DV3Q 4OX9L 2HQLA 4EX5A 3K7AH 4C3HH 2PI2A 4GNXC 1V9PA 3PGZA 4R1JA 3U58A 1N33L 1IZ6A 4MTNA 2ASBA 2IHFA 2K5VA 4BBRH 4GKJL 4B3MQ 4A3LH 4HJ5A 4ALPA 2JA6H 3NEMA 4WJ3M 4X6AH 3H3VH 3STBD 4HJ8A 3HKZE 2LSSA 4LFAL 4B3SL 4DNIA 1CKNA 2K4KA 1EYGA 4JV5Q 1NJIC 1JE5A 3UE0A 1HNXL 4QY7A 3H15A 4DV5Q 1CKOA 1SE8A 2B63H 3S17H 4IPCA 5E7NA 1EIYB 3DM3A 2ZM6L 2UXBQ 4QL5A 2VUMH 2N78A 3RN5A 4OWTB 3CCVA 4A3MG 3CC4A 1VCIA 2WP8J 3J81i 3KJOA 3K7UC 3CF5A 4QJFA 1FVIA 2F4VQ 2N8NA 4JI0L 1R9TH 4LF8Q 2VQEL 1EQQA 3H3VI 2EIFA 1TXYA 4YHHQ 2PQAA 4GNXA 4TQUS 5IWAL 1Y1WG 4DAYB 3A5ZB 3RZDH 1N34Q 3M7NA 4BBSG 4DV2L 4IPDA 4DR2Q 2NVYH 2PI2E 2YYZA 1XMQQ 4JI6Q 4QIWE 1CUKA 1VQ8A 5JEAG 4Y7NH 4R4IA 1K83H 5HY6A 3H0GH 4GN5A 2BH8A 4X66L 1IBMQ 3J7A5 2NZHA 5C0XJ 3S1RH 1VQ4A 4UY8C 4BA2I 4DR4Q 4GKKQ 4BY1H 3SGIA 4DK3C 1GO3E 3EN2A 1W3SA 4C3JH 2NN6I 3S1MH 2QGQA 3F8TA 3CC7A 1KC8C 4BXXG 3S2HH 3FKIH 1C9OA 1OXXK 4A3CG 2BA0A 4LUVA 3KLWA 1L1OB 4DR5Q 2MQHA 2UUCL 4XIGS 4JI2L 3S15H 5HGQA 1E24A 3F2BA 2AHOB 1FL0A 2MFIA 2MNAA 4LF4Q 1HZCA 2K5HA 4AYBE 4LWCA 4JC0A 5GAHC 2UUAQ 4KHPL 1D8LA 2E2IH 3F2DA 2KCMA 2K14A 4JV5L 4DV5L 2ZJQA 4A3EH 2HIXA 1VQPA 4HJ9A 3KOJA 3CCEA 2IHEA 5IYDH 1X65A 1KXLA 4A3IH 3AYHB 4DR7Q 2VQFQ 3FP9A 4JI3Q 3TEHB 5IYCG 2IX1A 2R7FA 4DKAC 3ULPA 2R7ZH 2AKWB 3RLNA 4A3BH 2F4VL 5C3EG 1MIUA 1UE1A 4QQBX 4IFDG 2N49A 5FJ8H 4R4CA 3I2ZA 5BR8L 4YY3L 2GVAA 2A8VA 1MJCA 4A3GG 4L5TA 1A0IA 5IYBH 3I7FA 3NELA 3A0JA 1Q1BA 1VQAA 4YWLA 3J80c 5M3FH 3S1NH 4NXNL 1M1KC 4DV4Q 2JA5H 4JBKA 1VQ6A 3I4MG 1VQEA 1I50H 3BZKA 3PIPA 1VQBA 4JG2A 2UXDQ 1KL9A 2CFMA 1XMQL 1VQ7A 4DR1L 1L2FA 5C4XH 5FLXc 4YWMA 4HJ7A 2Q2UA 1HR0W 1K0RA 2I5MX 1E3PA 4R4OA 1SR3A 4BA1I 4GKKL 4DR4L 1YBYA 2ALYB 3KF6A 2Z0SA 4IOCA 5JJLA 3OTOQ 2CWAA 1P16A 2FXQA 4LF5Q 1T9HA 3KYHC 1VQ5A 3HOYH 1YHAA 4DV1L 3CCUA 3CQZH 1WCMH 1J6QA 2AWOA 2VY3A 4DR3Q 4DV7Q 4JI7Q 2JA8G 4YCWA 1Q8KA 3E0EA 4IFDI 3CCSA 4DUYL 3PUWA 1KQSA 4DK6C 1AE3A 3HOUG 2ZTEA 4YWKA 5LMNW 3UDGA 1N36L 1HNZQ 3CMAA 5M5XH 1TWCH 3CXCA 2UUAL 3S24A 2IY5B 4AQYL 1KIXA 3GO5A 3HOVG 1VQFA 3PO3G 2WFWA 3PCOB 1WYDA 2H5XA 2ZJRA 3M85A 2R93H 3M9BA 1W2BA 1IBKL 1OXTA 1X55A 2YTVA 4A3JH 3G6EA 4LFBQ 2YV5A 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQD A;  3CPW A;  5C4J H;  4GOP C;  3HOW H;  1JB7 A;  1VQJ A;  4OXP A;  5FLM H;  3T1Y Q;  5M5Y H;  3I4N H;  1N32 Q;  1YI2 A;  1IBL L;  1ASZ A;  2UUB Q;  1U0L A;  3G48 A;  3GTL H;  2JA6 G;  1I6H H;  4PG3 A;  1NE3 A;  1E1T A;  3G4S A;  3G71 A;  1KRT A;  4PMW A;  4LNQ A;  1VQI A;  4GLX A;  1E22 A;  4X64 Q;  4DR6 Q;  2UXD L;  4GN3 B;  1B8A A;  2NVQ H;  1XPO A;  3E9H A;  2VS1 A;  5EAY A;  2MO0 A;  3HKS A;  1SRO A;  1TWF H;  3J81 c;  1IXR A;  1QZG A;  2B63 G;  1NMG A;  2YTY A;  3I4O A;  1JJG A;  2UU9 Q;  2KCT A;  2KHI A;  3UDF A;  5GAG C;  2VUM G;  2OQK A;  4JI1 Q;  1UWV A;  2RHS B;  2HIV A;  2E8G A;  4JOI C;  4O0A A;  2E5L Q;  4A3D G;  2Y0S G;  3CPF A;  1NMF A;  1VQH A;  1Z9F A;  2BA1 A;  5LMU Q;  4B3T Q;  4XTC S;  1YNX A;  2NN6 G;  3GTO H;  2VZA A;  1G29 1;  2ZTC A;  4K0K Q;  3KJP A;  1VQN A;  2RF4 A;  1L1O A;  4KHZ A;  3MEF A;  1UE5 A;  2B3G A;  2K50 A;  1VQM A;  1VQC A;  1X3E A;  4LUO A;  2D0O A;  3S16 H;  1BKB A;  1IYJ B;  5IY0 A;  1Q1E A;  3DLL A;  3CME A;  5JEA J;  2C35 B;  3NBH B;  3I55 A;  1EOV A;  3H0G G;  3PF5 A;  4IO9 A;  1PH4 A;  5IT9 c;  3CP0 A;  3CCJ A;  4L5R C;  4BY1 G;  4DV6 Q;  4WJ4 A;  4DUZ Q;  2EQS A;  4DV0 L;  4LW1 A;  3ULJ A;  3S1Q H;  3T1H L;  1KD1 C;  5AJ3 L;  1I94 Q;  4LFC Q;  3FKI G;  4JOI A;  2K75 A;  1EWI A;  2I0Q A;  2OQ0 A;  4UP7 A;  2RCN A;  1YIJ A;  3CAM A;  4X65 Q;  4GOP B;  1PH8 A;  3LGJ A;  1VQK A;  4LF9 Q;  1GKH A;  3HOX G;  3CCQ A;  4DV3 L;  4POF A;  1HNW Q;  3OW2 A;  1PYS B;  1HR0 Q;  1XMO Q;  1OXS C;  2GN5 A;  1YJW A;  3RR5 A;  1YHQ A;  4B3M L;  3UDX A;  3FHW A;  4A3E G;  4IPH A;  2Z6K C;  5IYD G;  3W1B A;  4JI4 Q;  3PO2 H;  3GTK H;  1FGU A;  3W1G A;  4YCU A;  4A3I G;  2JJQ A;  4JI8 Q;  1S3O A;  1KRS A;  1K3R A;  4J15 A;  4JI1 L;  4A93 H;  1BBU A;  3RLO A;  4A3K H;  3JC6 6;  2E5L L;  1CKN B;  2R7Z G;  4BY7 H;  3GD7 A;  3ER0 A;  3CC2 A;  4A3B G;  3JAM i;  1YVC A;  1QZH A;  3HFZ B;  4IFD J;  2R7D A;  5FJ8 G;  2UXB L;  5IYB G;  1G51 A;  4OWW B;  3ICE A;  5LMN Q;  5GAD C;  5M3F G;  3D0F A;  5J3B A;  2JA5 G;  1K8A C;  3D31 A;  1B7Y B;  1G6P A;  4UPA A;  4LF8 L;  4NPS A;  1X6O A;  5C4X G;  5JJK A;  1Y1V G;  3MXN B;  3L0O A;  4YHH L;  1YHB A;  1PHJ A;  2YTX A;  1DGS A;  2F52 A;  1N34 L;  2XGT A;  3F1Z A;  4IJH A;  4DR2 L;  1XNR Q;  4B3R Q;  3PUY A;  1CKM A;  1M90 C;  2JA9 A;  4H02 A;  4JI6 L;  1PH3 A;  3RNU A;  3TQY A;  1PA6 A;  4LF7 Q;  3HOY G;  1HZB A;  4A3F H;  1N9W A;  1IBM L;  1PVO A;  1E1O A;  1WCM G;  3RZO H;  2OTJ A;  1PFS A;  2KBN A;  2LXJ A;  1X3G A;  1BBW A;  5IP9 H;  1LTL A;  1KAW A;  1TWA H;  2HT1 A;  2NZO A;  1QUQ B;  4TVA B;  3S2D H;  4GN4 B;  3AFQ A;  1HNW L;  1XTD A;  5C0X I;  5GRO A;  1VQO A;  4QGU A;  2JE6 I;  4DR5 L;  1XPU A;  1A62 A;  1JJ2 A;  4OX9 Q;  2CWP A;  1YJ9 A;  1EFW A;  1HH2 P;  4JYA Q;  2R93 G;  1Q86 C;  4LF4 L;  2CKZ B;  2JEB I;  1B70 B;  4A3J G;  4P74 A;  1N33 Q;  1HJP A;  4LF6 Q;  2Q2T A;  3HOW G;  2GVB A;  1MJE A;  4R4T A;  4LFA Q;  5GAE C;  1YJN A;  4B3S Q;  1YEZ A;  2Y0S E;  3I4N G;  3HOZ H;  2EXD A;  2ES2 A;  3PSI A;  4KLK A;  4DR7 L;  4GLA C;  3PUZ A;  3UE1 A;  3BU2 A;  2VQF L;  4JI3 L;  2HHH Q;  5M3M H;  2DGY A;  3A5U A;  1XNQ Q;  1AE2 A;  2JEA I;  2K52 A;  1X9N A;  2JA7 H;  1Q12 A;  2ZM6 Q;  2ZJP A;  1FJG Q;  5K36 G;  4KI0 A;  4UP9 A;  4L5Q A;  3L2P A;  4NXM Q;  3VDY A;  4BBR G;  1K73 C;  1SN8 A;  3KDF B;  1PV4 A;  4A3L G;  1I3Q H;  1JJC B;  2VQE Q;  4DV4 L;  3PV0 A;  1XNR L;  1PH1 A;  2JA8 H;  4P72 A;  4B3R L;  4Y52 H;  5C44 H;  4HIO A;  4RG1 A;  4OO1 I;  4RMF A;  3TRZ A;  4OON A;  5ELN A;  4DV2 Q;  3AFP A;  4YCV A;  4DAM A;  3STB C;  3IRB A;  1ASY A;  4OWX B;  3OYY A;  4APV A;  1QVC A;  1WOC A;  4PZ7 A;  1QVF A;  4X66 Q;  3OTO L;  5IP7 H;  4GLV B;  2A1A A;  4LF5 L;  2I5H A;  4EQ5 A;  4GOP A;  1K8G A;  1AH9 A;  4DR3 L;  2R92 H;  4AIM A;  4DV7 L;  4JI7 L;  2ZTD A;  4HID A;  3WWV A;  3GTP H;  4JYA L;  4X62 Q;  2NVT H;  2PMZ E;  2UUC Q;  1Q46 A;  4JI2 Q;  3AQQ A;  1HNZ L;  1GD7 A;  3AEV A;  4LF6 L;  3K0X A;  3TS0 A;  3J7Z C;  2Q2H A;  1X56 A;  2YU9 H;  1OXV A;  1Q7Y C;  1QVG A;  4P71 A;  4KHP Q;  2WB1 G;  3PIO A;  4LFB L;  1I5F A;  1YZ6 A;  2HHH L;  3K81 C;  2KEN A;  1VS0 A;  1XNQ L;  3GTG H;  4JBJ A;  3T1Y L;  3PF4 A;  1XPR A;  1FJG L;  1N32 L;  4NXM L;  3CW2 C;  2JQO A;  1JMC A;  4A3D H;  2UUB L;  4R4Q A;  4AH6 A;  3RN2 A;  5H1S E;  4HIM A;  4PZ6 A;  3JAM c;  3PO2 G;  5BR8 Q;  4YY3 Q;  1HZ9 A;  3TS2 A;  2VNU D;  1PH2 A;  3BJU A;  4X64 L;  4DPG A;  1O7I A;  3M4O H;  4DR6 L;  4A3M H;  4A93 G;  1C0A A;  4NXN Q;  3UDI A;  4HJA A;  2OCE A;  4A3K G;  4L5S A;  2LXK A;  4BY7 G;  1OTC A;  2OWO A;  3GTM H;  1CSQ A;  4JCV E;  5ELO A;  1L0W A;  1UE7 A;  4DR1 Q;  2UU9 L;  1A63 A;  3KFU A;  1XJV A;  4JI5 Q;  1EQR A;  1Y1W H;  4IPG A;  4MZ9 A;  1SMX A;  2V1C C;  3HKZ G;  4BBS H;  2A19 A;  5IE8 A;  1A8V A;  2ATW A;  1P8L A;  1QUQ A;  4LUZ A;  2WAQ E;  5LMU L;  4B3T L;  3M4Q A;  2QA4 A;  4K0K L;  1TWG H;  2L15 A;  5GQO A;  2E2H H;  2DUD A;  1MKH A;  2PNH A;  2RHQ B;  4DV1 Q;  5C0X G;  1WFQ A;  4X62 L;  1U5K A;  1TWH H;  5M5W H;  1RIP A;  4DUY Q;  2CQO A;  1PH5 A;  4BXX H;  3HOX H;  4FDB A;  2D62 A;  1N36 Q;  3ULL A;  4A3F G;  1IL2 A;  4A3C H;  4A4I A;  2PQA B;  4GNX B;  1Q81 C;  3TRE A;  1JT8 A;  4AQY Q;  2UXC Q;  4DV6 L;  3J81 j;  4DUZ L;  1PYB A;  3GDE A;  2Z6K A;  5IP9 G;  1PH6 A;  3M3Y H;  1NTG A;  1WJJ A;  1IBK Q;  2AWN A;  1BVS A;  1VQL A;  2AMC B;  2Q2I A;  1I94 L;  3BZC A;  4LFC L;  3CD6 A;  1EIF A;  3GTJ H;  3PUX A;  2F3I A;  1SLJ A;  4JBM A;  1UE6 A;  2MO1 A;  1LYL A;  3K80 C;  1YIT A;  1D7Q A;  2KHJ A;  1OXU A;  4X65 L;  4LF9 L;  2WAQ G;  4MNO A;  1IBL Q;  2D0P A;  1VQG A;  3KDF A;  4GS3 A;  2CCZ A;  5DLQ E;  1J5E Q;  2K5N A;  4IJL A;  1LUZ A;  5IYC H;  1UEB A;  1XMO L;  2R6G A;  3F2C A;  1HR0 L;  4A76 A;  3U50 C;  5C3E H;  1CSP A;  3GTQ H;  3HOZ G;  4JI4 L;  4OO1 G;  4A3G H;  1Y1V H;  4ME3 A;  1S40 A;  4JI5 L;  2B29 A;  2JK8 A;  4JI8 L;  4GKJ Q;  3Q8D A;  5M3M G;  2ID0 A;  2VL6 A;  4AYB G;  1C7Y A;  3I4M H;  2I5L X;  1SFO H;  5FLM G;  2JA7 G;  3PUV A;  5JJI A;  4O2D A;  1NBW A;  3EBE A;  2QEX A;  1S72 A;  1E7Z A;  3ERS X;  1HNX Q;  1GM5 A;  3S14 H;  3J80 i;  1KHI A;  1Q82 C;  5LMN L;  1V1Q A;  2E2J H;  1HZA A;  1EUJ A;  3L7Z C;  4P73 A;  1NY4 A;  3ZJY C;  3CCR A;  4A75 A;  4NB3 A;  4UP8 A;  3W5O A;  5C44 G;  4C2M H;  1K9M C;  1H95 A;  1PH9 A;  1X54 A;  4P75 A;  3KF8 B;  4JBW A;  1Y14 B;  2BH2 A;  3CCL A;  3RLF A;  4JI0 Q;  4POG A;  3K8A A;  2UXC L;  2WB1 E;  5IWA Q;  1VQ9 A;  3EIV A;  5IP7 G;  2IX0 A;  4IOA A;  1PH7 A;  3HOU H;  4LF7 L;  1Z47 A;  4DV0 Q;  3B6Y A;  1WI5 A;  2OTL A;  2R92 G;  3NEN A;  3T1H Q;  1V43 A;  4C3I H;  3E9I A;  3HOV H;  5AJ3 Q;  3PO3 H;  3KF6 B;  2N3S A;  3CCM A;  1RL2 A;  3M4P A;  4PZ8 A;  1N8R C;  2NVX H;  1L1O C;  3U4Z A;  1LM0 A;  2IT1 A;  2VW9 A;  1SRU A;  1GVP A;  1J5E L;  2XTI A;  3A74 A;  1X3F A;  3U4V A;  4HIK A;  4DV3 Q;  4OX9 L;  2HQL A;  4EX5 A;  3K7A H;  4C3H H;  2PI2 A;  4GNX C;  1V9P A;  3PGZ A;  4R1J A;  3U58 A;  1N33 L;  1IZ6 A;  4MTN A;  2ASB A;  2IHF A;  2K5V A;  4BBR H;  4GKJ L;  4B3M Q;  4A3L H;  4HJ5 A;  4ALP A;  2JA6 H;  3NEM A;  4WJ3 M;  4X6A H;  3H3V H;  3STB D;  4HJ8 A;  3HKZ E;  2LSS A;  4LFA L;  4B3S L;  4DNI A;  1CKN A;  2K4K A;  1EYG A;  4JV5 Q;  1NJI C;  1JE5 A;  3UE0 A;  1HNX L;  4QY7 A;  3H15 A;  4DV5 Q;  1CKO A;  1SE8 A;  2B63 H;  3S17 H;  4IPC A;  5E7N A;  1EIY B;  3DM3 A;  2ZM6 L;  2UXB Q;  4QL5 A;  2VUM H;  2N78 A;  3RN5 A;  4OWT B;  3CCV A;  4A3M G;  3CC4 A;  1VCI A;  2WP8 J;  3J81 i;  3KJO A;  3K7U C;  3CF5 A;  4QJF A;  1FVI A;  2F4V Q;  2N8N A;  4JI0 L;  1R9T H;  4LF8 Q;  2VQE L;  1EQQ A;  3H3V I;  2EIF A;  1TXY A;  4YHH Q;  2PQA A;  4GNX A;  4TQU S;  5IWA L;  1Y1W G;  4DAY B;  3A5Z B;  3RZD H;  1N34 Q;  3M7N A;  4BBS G;  4DV2 L;  4IPD A;  4DR2 Q;  2NVY H;  2PI2 E;  2YYZ A;  1XMQ Q;  4JI6 Q;  4QIW E;  1CUK A;  1VQ8 A;  5JEA G;  4Y7N H;  4R4I A;  1K83 H;  5HY6 A;  3H0G H;  4GN5 A;  2BH8 A;  4X66 L;  1IBM Q;  3J7A 5;  2NZH A;  5C0X J;  3S1R H;  1VQ4 A;  4UY8 C;  4BA2 I;  4DR4 Q;  4GKK Q;  4BY1 H;  3SGI A;  4DK3 C;  1GO3 E;  3EN2 A;  1W3S A;  4C3J H;  2NN6 I;  3S1M H;  2QGQ A;  3F8T A;  3CC7 A;  1KC8 C;  4BXX G;  3S2H H;  3FKI H;  1C9O A;  1OXX K;  4A3C G;  2BA0 A;  4LUV A;  3KLW A;  1L1O B;  4DR5 Q;  2MQH A;  2UUC L;  4XIG S;  4JI2 L;  3S15 H;  5HGQ A;  1E24 A;  3F2B A;  2AHO B;  1FL0 A;  2MFI A;  2MNA A;  4LF4 Q;  1HZC A;  2K5H A;  4AYB E;  4LWC A;  4JC0 A;  5GAH C;  2UUA Q;  4KHP L;  1D8L A;  2E2I H;  3F2D A;  2KCM A;  2K14 A;  4JV5 L;  4DV5 L;  2ZJQ A;  4A3E H;  2HIX A;  1VQP A;  4HJ9 A;  3KOJ A;  3CCE A;  2IHE A;  5IYD H;  1X65 A;  1KXL A;  4A3I H;  3AYH B;  4DR7 Q;  2VQF Q;  3FP9 A;  4JI3 Q;  3TEH B;  5IYC G;  2IX1 A;  2R7F A;  4DKA C;  3ULP A;  2R7Z H;  2AKW B;  3RLN A;  4A3B H;  2F4V L;  5C3E G;  1MIU A;  1UE1 A;  4QQB X;  4IFD G;  2N49 A;  5FJ8 H;  4R4C A;  3I2Z A;  5BR8 L;  4YY3 L;  2GVA A;  2A8V A;  1MJC A;  4A3G G;  4L5T A;  1A0I A;  5IYB H;  3I7F A;  3NEL A;  3A0J A;  1Q1B A;  1VQA A;  4YWL A;  3J80 c;  5M3F H;  3S1N H;  4NXN L;  1M1K C;  4DV4 Q;  2JA5 H;  4JBK A;  1VQ6 A;  3I4M G;  1VQE A;  1I50 H;  3BZK A;  3PIP A;  1VQB A;  4JG2 A;  2UXD Q;  1KL9 A;  2CFM A;  1XMQ L;  1VQ7 A;  4DR1 L;  1L2F A;  5C4X H;  5FLX c;  4YWM A;  4HJ7 A;  2Q2U A;  1HR0 W;  1K0R A;  2I5M X;  1E3P A;  4R4O A;  1SR3 A;  4BA1 I;  4GKK L;  4DR4 L;  1YBY A;  2ALY B;  3KF6 A;  2Z0S A;  4IOC A;  5JJL A;  3OTO Q;  2CWA A;  1P16 A;  2FXQ A;  4LF5 Q;  1T9H A;  3KYH C;  1VQ5 A;  3HOY H;  1YHA A;  4DV1 L;  3CCU A;  3CQZ H;  1WCM H;  1J6Q A;  2AWO A;  2VY3 A;  4DR3 Q;  4DV7 Q;  4JI7 Q;  2JA8 G;  4YCW A;  1Q8K A;  3E0E A;  4IFD I;  3CCS A;  4DUY L;  3PUW A;  1KQS A;  4DK6 C;  1AE3 A;  3HOU G;  2ZTE A;  4YWK A;  5LMN W;  3UDG A;  1N36 L;  1HNZ Q;  3CMA A;  5M5X H;  1TWC H;  3CXC A;  2UUA L;  3S24 A;  2IY5 B;  4AQY L;  1KIX A;  3GO5 A;  3HOV G;  1VQF A;  3PO3 G;  2WFW A;  3PCO B;  1WYD A;  2H5X A;  2ZJR A;  3M85 A;  2R93 H;  3M9B A;  1W2B A;  1IBK L;  1OXT A;  1X55 A;  2YTV A;  4A3J H;  3G6E A;  4LFB Q;  2YV5 A;  3I56 A; 
#chains in the Genus database with same CATH topology
 4H0L C;  1VQJ A;  5FLM H;  2AQ3 B;  5A2Q E;  3T53 B;  1ASZ A;  2UUB Q;  1U0L A;  3GTL H;  2K33 A;  3U9O A;  2WB1 B;  1RCV D;  3G4S A;  2UXD L;  4GLX A;  1E22 A;  1KAB A;  3S1M B;  2VS1 A;  5EAY A;  3HKS A;  3J81 c;  1IXR A;  1NMG A;  3I4O A;  1JB3 A;  2UU9 Q;  2KCT A;  2KHI A;  3UDF A;  1E0B A;  2OQK A;  3TP7 A;  1UWV A;  2HIV A;  4O0A A;  3MXU A;  1NMF A;  1VQH A;  2JP1 A;  3NPP A;  1K0S A;  1G29 1;  2ZTC A;  2B3G A;  5C3W A;  1CZW A;  1SBB B;  1X3E A;  1EOT A;  5JOB A;  3I3C A;  5JEA J;  1J9O A;  3I55 A;  1EOV A;  1PH4 A;  1F9Q A;  4L5R C;  4WJ4 A;  4DV6 Q;  2MJ8 A;  4DV0 L;  4LW1 A;  3M4Y A;  4ZK9 B;  2CW0 C;  4C3J G;  3T1H L;  3S1N B;  1STG A;  2K75 A;  1BCP B;  3NHH A;  4DV3 L;  3QJY A;  3IL8 A;  3OW2 A;  3VA7 A;  1HR0 Q;  2GN5 A;  1XYI A;  1PTO C;  1JOK A;  1YHQ A;  3UDX A;  3CQZ B;  3OWF A;  5IYD G;  2B2U C;  2N88 A;  4YCU A;  4J1M A;  2EJF C;  5ELD A;  4JI1 L;  1KLU D;  1J8I A;  1DOK A;  2N55 A;  2R7Z G;  2WAQ B;  3HS0 C;  1YVC A;  1QZH A;  1I4H A;  1TWC B;  1CZG A;  2VB2 X;  1BNZ A;  2UXB L;  3V96 A;  3NE5 B;  2KQ3 A;  5M3F G;  5JPM C;  2QDL A;  1B7Y B;  1G6P A;  1STE A;  4UPA A;  3Q0A A;  1X6O A;  5M3M B;  3MXN B;  1Q90 A;  3L0O A;  2YTX A;  3A8K E;  1N34 L;  1Y8N B;  4ZCK A;  2XGT A;  3F1Z A;  2A69 D;  4DR2 L;  1CKM A;  1CHQ D;  2JA9 A;  4HR7 B;  2K5W A;  3TQY A;  3RNU A;  3GTL B;  1N9W A;  1DXM A;  3RZO H;  2OTJ A;  1PFS A;  5C44 B;  1STB A;  4KMU C;  5IP9 H;  1TWA H;  2J4X A;  3BYT B;  2XRS D;  3TN2 A;  4KD3 A;  1VQO A;  1AZP A;  1HCZ A;  1A62 A;  3D3R A;  3C3L A;  4NP5 A;  4LF4 L;  1B70 B;  4DAP A;  2B2Y A;  4P74 A;  5FO8 B;  2WKC A;  1W6K A;  3HOW G;  3QR8 A;  1FD7 D;  1TII D;  2Z6B A;  2L5T A;  2RDH A;  1YJN A;  2EZV A;  1YEZ A;  4OO1 H;  2B8G A;  4DR7 L;  3SK8 A;  3E5S A;  2HHH Q;  4KJO A;  3V2T A;  2DGY A;  3D6W A;  1XNQ Q;  2K52 A;  2PNR C;  2ZJP A;  1F9P A;  4FYD A;  4KI0 A;  1FNU A;  4L5Q A;  4NXM Q;  3NQT A;  1PDQ A;  3VDY A;  1K73 C;  2KJX A;  3CU7 A;  2IX3 A;  4DFA A;  1I3Q H;  2VQE Q;  2F0K A;  1MBY A;  2JA8 H;  2Q8R E;  1PZJ D;  5J1Z A;  2KVM A;  5FOB B;  3TRZ A;  1EY7 A;  2PQE A;  4YCV A;  1H9J A;  1QVC A;  4OEM B;  4LF5 L;  3GTM B;  1AH9 A;  1K8G A;  4JI7 L;  3R2I A;  4BBS B;  1DM0 B;  2L0C A;  3GTP H;  2NUC A;  2NVT H;  1Q46 A;  4ZUJ A;  1EYD A;  3BG3 A;  3TS0 A;  5LHY 1;  3HKZ B;  4DK1 A;  4RGT A;  2WB1 G;  5IGC A;  3DWA A;  4R8N A;  3K81 C;  1Z6H A;  2KEN A;  2Z1C A;  1VS0 A;  2HCI A;  1SMY D;  3PF4 A;  1XPR A;  1FJG L;  4FVM A;  3CW2 C;  2JQO A;  1W6J A;  2UUB L;  1WVL A;  4HIM A;  4BS9 A;  2MGS A;  2VNU D;  2BDO A;  1SNQ A;  4Z9C B;  5IGD A;  4L5S A;  2F03 A;  4XDX A;  4V0B A;  1CSQ A;  1A63 A;  1L0W A;  1PRT F;  2UU9 L;  1G6Z A;  2Z4I A;  4FP5 D;  1EQR A;  4IPG A;  5C3E B;  3DM1 A;  4L8J A;  4LUZ A;  5KNC A;  5IT9 E;  3M4Q A;  1UEA B;  3S9W A;  4DV1 Q;  1SFO B;  4KHV A;  5M5W H;  4DUY Q;  2E2J B;  3EQL C;  4FDB A;  4XT3 B;  4XT1 B;  1N36 Q;  1ET9 A;  2AQ1 B;  4DV6 L;  1PYB A;  1F77 A;  4FXG C;  3CHB D;  1FR3 A;  2AWN A;  3PIP 3;  5EPL A;  3GTJ H;  2JA8 B;  3PUX A;  2F3I A;  2EYP A;  3P1H A;  1STA A;  1E2V A;  1IKM A;  1D7Q A;  2WAQ G;  1IBL Q;  4GS3 A;  3NQI A;  3IAY A;  5DLQ E;  5I6W A;  1J5E Q;  1A3U A;  1HR0 L;  3PO3 B;  2R6G A;  2F0W A;  4A76 A;  4JVZ A;  2R3Z A;  4DXG A;  1V1O A;  2PW5 A;  3MTS A;  2M2L A;  4A3G H;  2XNA C;  4GKJ Q;  5M3M G;  2EY6 A;  2OT2 A;  2X69 A;  4C3H B;  5KYL A;  5FLM G;  1GUW A;  1LTA D;  2A6E C;  3MEH A;  3PUV A;  4O2D A;  1NBW A;  1S72 A;  1BCP F;  1HNX Q;  3PQI A;  1Q82 C;  4K8I A;  3H91 A;  1EUJ A;  1PMR A;  5C44 G;  4C2M H;  1PH9 A;  4P75 A;  3KF8 B;  5IOC A;  2B63 B;  1TS2 A;  1C48 A;  1SAP A;  3S17 B;  3CCL A;  3RLF A;  1TS5 A;  4HCS A;  3K8A A;  5J22 A;  4KV6 A;  1L0Y B;  2Y0S B;  5IP7 G;  3HOU H;  1Z47 A;  4IQZ A;  3B6Y A;  2XRQ D;  5C5M A;  2OTL A;  1V43 A;  3HOV H;  2N3S A;  4MIU A;  3CCM A;  3M4P A;  2NVX H;  3K57 A;  2HDL A;  1CTM A;  1NCV A;  3U4V A;  4HIK A;  1Y69 U;  4TKO B;  3K7A H;  1HQM C;  1MD2 D;  4HSP A;  3PMF A;  4MTN A;  5KGU A;  2K5V A;  4BBR H;  4HJ5 A;  2WIN B;  1I4G A;  3FKI B;  4X6A H;  4CDF C;  3C46 A;  3UE0 A;  4DV5 Q;  2RDG A;  3P7J A;  4IPC A;  1EIY B;  3DM3 A;  5M9O A;  3D4R A;  3NWS A;  2PMZ B;  2IJ0 A;  1QB5 D;  2VXW A;  4LF8 Q;  4LK1 C;  2VQE L;  4WFN 3;  2EIF A;  3OIQ A;  2KEC A;  2F0I A;  4TQU S;  3RUZ A;  4GZY C;  2EJM A;  3M7N A;  2EYO A;  2RA4 A;  4BBS G;  1K28 A;  1II3 A;  4A3B B;  2NVY H;  1HUN A;  1UNS A;  4NMZ A;  1LTB D;  1CUK A;  1VQ8 A;  1A2T A;  4R4I A;  3J7A 5;  2DNE A;  2BH8 A;  2F0N A;  3H3V C;  5C0X J;  3S1R H;  1XTC D;  1GO3 E;  5C4X B;  5BN5 A;  4C3J H;  1V1P A;  2NN6 I;  5T1G A;  4OIJ A;  5HUR A;  2QGQ A;  2K32 A;  1EY0 A;  2RBM A;  3S2H H;  1C9O A;  4LUV A;  2EYL A;  1JOO A;  1H9S A;  5HGQ A;  3F2B A;  1FL0 A;  3I73 A;  2K1B A;  1PRT C;  3A7L A;  3TME A;  3BDL A;  2WII B;  1RD9 D;  2R61 A;  2DN8 A;  3FEW X;  4IUV A;  2A68 C;  4HJ9 A;  5IYD H;  3CRK C;  1KXL A;  3T13 A;  3I4L A;  2A5H A;  2R7F A;  4H44 C;  4DKA C;  2R7Z H;  1WTQ A;  2F4V L;  5C3E G;  4QQB X;  4QUF A;  2SNM A;  5C4J B;  3KK7 A;  2L11 A;  3NEL A;  1VQA A;  4YWL A;  5M3F H;  2PPB C;  4JBK A;  1I50 H;  2FJ2 A;  3PIP A;  2UXD Q;  3LWE A;  1KL9 A;  1XMQ L;  1VQ7 A;  2Q2U A;  2RSO A;  1HR0 W;  2NTT A;  3U9S A;  1K3B C;  4BA1 I;  3K7A B;  2ALY B;  3GP7 A;  5KRU A;  1JWU D;  2NVQ B;  4BBR B;  1T9H A;  4DV1 L;  3CCU A;  1PZI D;  2VY3 A;  4KN7 C;  3R2T A;  4DV7 Q;  4RGO S;  2JA8 G;  4YCW A;  1CT1 D;  3J7A V;  4DUY L;  4IAL A;  4XQJ A;  4ZYS A;  2ZTE A;  4RA8 A;  4YWK A;  1N36 L;  3GTO B;  1KAA A;  3PO3 G;  2WFW A;  2H5X A;  1EY8 A;  4IUU A;  3S16 B;  4RAU C;  1AEX A;  3A7A B;  2XWB B;  1BCP C;  3HOW H;  4OXP A;  3T1Y Q;  4X3S A;  4C3H G;  5M5Y H;  1YI2 A;  1IBL L;  1G2S A;  3G48 A;  2DJG C;  2AQ2 B;  4QUC A;  4H13 C;  4DAY A;  4LNQ A;  4DR6 Q;  1H9M A;  4C3J B;  1B8A A;  1XPO A;  2F3W A;  3S2H B;  2CVR A;  2B63 G;  3X3N A;  1I4P A;  4JI1 Q;  1KDC A;  2RHS B;  4JOI C;  1HXY D;  2Y0S G;  3PO2 B;  1Z9F A;  2BA1 A;  3GTK B;  2NN6 G;  4FF1 A;  2VZA A;  3T56 B;  4A3K B;  1L1O A;  4KHZ A;  2RDF A;  3L9A X;  1I4Q A;  1F2Z A;  1UE5 A;  2WV6 D;  2F0V A;  3VR6 A;  5EKK A;  3DLL A;  1SYB A;  1JC7 A;  2OEO A;  1AW7 A;  4HN7 A;  2L4N A;  5DM7 3;  4IO9 A;  3TP6 A;  3VYU A;  3CCJ A;  1DCZ A;  3ULJ A;  4FO2 A;  1YNN C;  1F2Y A;  1KD1 C;  2NBF A;  3FKI G;  5C4Z A;  2I0Q A;  2OQ0 A;  2RCN A;  5COY A;  3CAM A;  1CQV A;  1PH8 A;  1VQK A;  4A3F B;  4JPB W;  1GKH A;  2F0Q A;  2I46 A;  4POF A;  3OPO A;  1PYS B;  3BS1 A;  2O5I C;  1XMO Q;  3VA5 A;  3K0Y A;  4KK7 A;  1HRJ A;  3RR5 A;  3N6R A;  2Z6K C;  4JI4 Q;  5BN4 A;  1FGU A;  3W1G A;  1ENF A;  5JVG 3;  5G3L D;  4JI8 Q;  1GHK A;  1QG7 A;  1BBU A;  2E5L L;  4A3B G;  3J7Y W;  2EYM A;  3JAM i;  3HFZ B;  4IFD J;  4L63 B;  2PZW A;  4OWW B;  1SE2 A;  5GAD C;  4NDX A;  3D31 A;  3HOZ B;  1PTO D;  4LF8 L;  4NPS A;  5C4X G;  2E76 C;  4AYB B;  1SDF A;  1LLR D;  2JA7 B;  4CBV A;  1DGS A;  4IJH A;  5M5Y B;  1D5X C;  3PUY A;  5AFW A;  1PLF A;  2B2U A;  1PA6 A;  3MWY W;  1E1O A;  1WCM G;  1HA6 A;  2KCN A;  2F0F A;  2LXJ A;  5C4H A;  1BBW A;  1LTL A;  1KAW A;  1YNJ C;  4KKU A;  3SHL A;  1EY4 A;  4TVA B;  3HP3 A;  3AFQ A;  4ILW A;  1CFM A;  1HNW L;  1STY A;  1NSN S;  1SNM A;  1JJ2 A;  1B44 D;  4OX9 Q;  4FF2 A;  1HH2 P;  5IIF A;  1Q86 C;  2CKZ B;  2JEB I;  4OHJ A;  2F0T A;  4LMQ D;  1BOS A;  1MJE A;  1R4P B;  2EJG C;  4X3T A;  5GAE C;  1HFN A;  2EYJ A;  5K5P A;  4KLK A;  5FO7 B;  1EL0 A;  3PUZ A;  1IYU A;  3BU2 A;  5FLX E;  5M3M H;  2EYH A;  2F3V A;  3A5U A;  4CKE A;  1AE2 A;  1X9N A;  2CHB D;  3OIP A;  2QKI C;  1FJG Q;  4N9T A;  4BBR G;  1X3Q A;  2E74 C;  4UHV A;  4HAE A;  3A55 A;  1E2W A;  4P72 A;  4B3R L;  4HMJ A;  4K14 A;  5C44 H;  4HIO A;  4OON A;  5ELN A;  4DV2 Q;  5KNB A;  4DAM A;  3STB C;  3IRB A;  1AN8 A;  3WDN A;  1WTP A;  2WKD A;  1ASY A;  3OYY A;  2O5J C;  4APV A;  1WOC A;  4E6I A;  1PFM A;  4A3M B;  4X66 Q;  1QVF A;  5IP7 H;  1ESR A;  2A1A A;  1G2T A;  2BE5 C;  4GOP A;  1LT4 D;  1O80 A;  1UAP A;  2IWH A;  3WOE A;  4AIM A;  4CKC A;  1RF2 D;  4DV7 L;  4HID A;  5CMD A;  5DAU A;  3WWV A;  5JPN C;  4JYA L;  1KNA A;  2LS0 1;  2UUC Q;  4IUQ A;  2IW3 A;  3AEV A;  3K0X A;  1EQT A;  2E2H B;  1LV9 A;  1X56 A;  1OXV A;  5EPK A;  1EYA A;  1QVG A;  4M1U B;  4KHP Q;  4DGZ A;  3H09 A;  1I5F A;  1YZ6 A;  5NUC A;  3SK6 A;  3J81 E;  4JBJ A;  1ICF B;  3T1Y L;  4ABN A;  3M3Y B;  4A3D H;  1TT2 A;  2CH4 A;  4PQX A;  3JAM c;  5BR8 Q;  3PO2 G;  1EU4 A;  4DR6 L;  1JR0 D;  1O7I A;  4DPG A;  3AMU A;  4A3K G;  1GOZ A;  2NZ1 D;  2PYK A;  2F0U A;  2OWO A;  3ND9 A;  3GTM H;  4ZKB B;  4EQP A;  2QCP X;  2F4I A;  1SYF A;  3NXW A;  2F0G A;  3CKI B;  4BBS H;  1TY0 A;  3GTQ B;  5IE8 A;  1TVX A;  3T16 A;  4B9X A;  2WAQ E;  2QA4 A;  1F2L A;  1RTO A;  2B2V A;  2RSN A;  4RFB A;  2PNH A;  5ELE A;  4X62 L;  2B2T C;  4U67 3;  3E6Z X;  3S14 B;  1RIP A;  3MXP A;  4K6D A;  5JJZ A;  3HOX H;  2D62 A;  4A3F G;  1Q81 C;  2H1E A;  1JT8 A;  1PYW D;  3MC0 B;  3GDE A;  3LNN A;  1QIL A;  1VQL A;  5EJW A;  5EBC A;  1EIF A;  1SLJ A;  3DUZ A;  3R93 A;  1V1P B;  2ICI A;  2D0P A;  3KDF A;  2CCZ A;  4IJL A;  1LUZ A;  2M9V A;  1XMO L;  4G7O C;  1VMP A;  2ZT9 C;  3U50 C;  5C3E H;  1CSP A;  3J80 L;  1H9S B;  3HOZ G;  4JI4 L;  1Y1V H;  4F7X A;  4ME3 A;  1S40 A;  4JI8 L;  3Q8D A;  1GUS A;  2JSO A;  4EQO A;  4AYB G;  1SFO H;  3KLS A;  5E4X A;  2JA7 G;  3FPU B;  5JJI A;  3ERS X;  1GM5 A;  2JA6 B;  3J80 i;  1KHI A;  1FNV A;  2E2J H;  3L7Z C;  3ZJY C;  4P73 A;  4JK1 C;  1NY4 A;  2MPM A;  4F87 A;  2SEB D;  3W5O A;  1H95 A;  4KY6 A;  4JBW A;  2K6A A;  2BH2 A;  5T1I A;  1X32 A;  2K05 A;  3VR5 A;  3K6O A;  2B2W A;  4A3D B;  1VQ9 A;  1O7L A;  2HCC A;  3EIV A;  1T5E A;  3DHQ A;  2A6E D;  1KLG D;  3D6C A;  1WI5 A;  2K28 A;  5CV4 A;  1RTN A;  3NEN A;  2A6H C;  1ENA A;  5DM6 3;  5AJ3 Q;  3PO3 H;  1MGS A;  4PZ8 A;  3U4Z A;  1LM0 A;  2VW9 A;  1ZYR C;  2L55 A;  3MFY A;  1X3F A;  4OX9 L;  1SYD A;  2HQL A;  4C3H H;  2PI2 A;  1JIC A;  4GNX C;  1V9P A;  3PGZ A;  1LAC A;  2A74 C;  4B3M Q;  4ALP A;  4WJ3 M;  5I6Y A;  4HJ8 A;  3HKZ E;  1A3V A;  3S15 B;  2K4K A;  1EYG A;  2WAC A;  1NJI C;  4WRD A;  1XXG A;  4QY7 A;  3HOX B;  1SE8 A;  2B63 H;  3S17 H;  4CJ2 C;  3NTH A;  5D3I B;  4C56 C;  4OWT B;  2PZU A;  2JYO A;  3CCV A;  4A3M G;  1GUN A;  4A3E B;  3KJO A;  4K2K A;  3CF5 A;  4QJF A;  1FVI A;  2F4V Q;  5FKA C;  2N8N A;  4JI0 L;  1R9T H;  2NN6 H;  1EQQ A;  1TXY A;  5ELF A;  3J7A F;  5IWA L;  4DAY B;  4DV2 L;  4IPD A;  1XMQ Q;  4JI6 Q;  3OMG A;  3H6M A;  4QIW E;  4FF4 A;  1AFP A;  1O78 A;  2OF1 A;  5JEA G;  3DEP A;  4Y7N H;  4X66 L;  4DK0 A;  1IBM Q;  4GN5 A;  2D2C C;  2NZH A;  3AU7 A;  4UY8 C;  1VQ4 A;  4B08 A;  1KDA A;  1TS4 A;  1B53 A;  1Y1V B;  3F8T A;  1KC8 C;  4BXX G;  3FKI H;  5DEH A;  4A3C G;  3KLW A;  1BXT A;  1L1O B;  4NW2 A;  2MQH A;  2UUC L;  1DOM A;  2MFI A;  2K5H A;  4LWC A;  2KA7 A;  4KHP L;  4JV5 L;  2VB3 X;  3TSS A;  2ZJQ A;  5LL6 X;  3I90 A;  1VQP A;  2KCC A;  2IHE A;  5M5X B;  4KY5 A;  2VQF Q;  3FP9 A;  3BDC A;  4JI3 Q;  1Q3L A;  5IYC G;  1LAB A;  2R93 B;  2XN9 C;  4A3B H;  2F0D A;  2N49 A;  5BR8 L;  1MJC A;  4L5T A;  3J80 c;  1LT3 D;  1JCK B;  1Y8P B;  2L9H A;  2BOS A;  3BZK A;  4IUR A;  3I4N B;  1ILP A;  1MSH A;  5C4X H;  4HJ7 A;  4YWM A;  1RDP D;  3A54 A;  2I5M X;  4R4O A;  2A68 D;  1I6H B;  4GKK L;  5ISR A;  3C1E A;  3KF6 A;  3VYS A;  5JJL A;  3OTO Q;  2CWA A;  1P16 A;  2FXQ A;  2PW7 A;  1I6V C;  2G9D A;  4X3K A;  1VQ5 A;  1WTX A;  4K5V A;  1WCM H;  1J6Q A;  2AWO A;  1D1K A;  3E0E A;  1XWE A;  1S5E D;  1KQS A;  2A73 B;  1BR9 A;  1EIG A;  1HNZ Q;  1DZ1 A;  3G7L A;  2IY5 B;  1PTO B;  3GO5 A;  3HRZ C;  3BZD B;  3A56 A;  2ZJR A;  4G7Z C;  2DY7 A;  1W2B A;  1R9T B;  1OXT A;  2D5D A;  3DMU A;  3ITP A;  4LFB Q;  4O42 A;  5C4J H;  1CA6 A;  1JB7 A;  1LTT D;  1A3T A;  2SOB A;  2C5C A;  3S1Q B;  4Y7N B;  2JA6 G;  2SDF A;  2FMC A;  4PG3 A;  1NE3 A;  1E1T A;  3HG9 A;  4X64 Q;  2NWG A;  4GN3 B;  1EU3 A;  2NVQ H;  2MO0 A;  1SRO A;  1SNP A;  2NYZ D;  1JJG A;  1SE4 A;  3N52 A;  4RH6 A;  2E5L Q;  1ROD A;  3D8G A;  4A3D G;  3TZU A;  1RHP A;  4B3T Q;  4XTC S;  3GTO H;  5L37 A;  5CYU A;  4A93 B;  4K0K Q;  3O13 A;  2X6G A;  3KJP A;  1FGB D;  1QOH A;  3IKJ A;  1VQN A;  4BY7 B;  3MEF A;  2K50 A;  2KHS A;  1VQC A;  1VQM A;  3S16 H;  5D65 A;  1G91 A;  1IYJ B;  3QWN A;  1LTR D;  3CME A;  2C35 B;  1EZ6 A;  3PF5 A;  1HHV A;  4XYQ A;  3IFD A;  1E2Z A;  1S4Z A;  5AJ3 L;  1I94 Q;  2EPB A;  4JOI A;  1EWI A;  4UP7 A;  2F1M A;  3FDT A;  1YIJ A;  1X3P A;  4DXF A;  1TS3 A;  4X65 Q;  4GOP B;  3LGJ A;  4LF9 Q;  3HOX G;  3CCQ A;  3EVQ A;  1U9R A;  1HNW Q;  3MA2 B;  4RWS C;  2Z8L A;  3HZX A;  5CC4 A;  1OXS C;  2OXP A;  5D14 A;  3K58 A;  4LAA A;  4IZ8 A;  4B3M L;  4A3E G;  1AP0 A;  1WCM B;  4IPH A;  5E4W C;  3W1B A;  3PO2 H;  3GTK H;  2DNC A;  2CH4 W;  4DU9 A;  1KRS A;  4HTH A;  4OGQ C;  3RLO A;  4A3K H;  3JC6 6;  2EY1 A;  3CC2 A;  4I65 A;  2ENB A;  2R7D A;  5FJ8 G;  4H7B A;  5IYB G;  3ICE A;  2MHV A;  5LMN Q;  3D0F A;  5J3B A;  1STN A;  1QNK A;  2LY7 A;  1Y1V G;  1YHB A;  1PHJ A;  2F52 A;  1WD0 A;  4B3R Q;  1M90 C;  4MHE A;  4JI6 L;  1PH3 A;  1SJH D;  4A3F H;  1IBM L;  4FXD A;  4QB4 A;  1DOL A;  1X3G A;  4KKT A;  5J39 A;  2JN4 A;  2HT1 A;  2K03 A;  2NZO A;  4N8X 1;  4GN4 B;  5C0X I;  2JE6 I;  2SNS A;  2TSS A;  3RD4 A;  4JYA Q;  1STH A;  2R93 G;  5CV7 A;  3QOL A;  2R92 B;  1HJP A;  4K5W A;  1QWY A;  3E0J A;  4R4T A;  4K2L A;  4J6H A;  4B3S Q;  1VF7 A;  3HOZ H;  3I4N G;  3P20 A;  2EXD A;  2ES2 A;  3URY A;  1YNJ D;  3PSI A;  4CDC C;  3UE1 A;  3C1F A;  5A2Q L;  2VQF L;  3BVZ A;  4JI3 L;  2JA7 H;  1Q12 A;  1LTS D;  1JOQ A;  5EBD A;  1U4L A;  2L12 A;  5K36 G;  4UP9 A;  2O4X A;  3L2P A;  2E75 C;  4PV1 C;  1JE4 A;  1PV4 A;  3KDF B;  3GTG B;  5IGE A;  1JJC B;  1I4X A;  3PV0 A;  3NBH A;  1PH1 A;  2K04 A;  1XNR L;  1F9S A;  4JW0 A;  4RMF A;  1U4R A;  3BYY B;  1TR5 A;  3P75 A;  2EE1 A;  3M4O B;  2RKS A;  3OTO L;  3GV3 A;  4RHS A;  1A15 A;  2F0H A;  4O1N A;  1EFI D;  4CJ1 B;  3Q24 A;  4EQ5 A;  1Y1W B;  4IUT A;  3SEB A;  3T51 B;  4B9W A;  4X62 Q;  1WTW A;  1HNZ L;  3AQQ A;  4DAV A;  4LF6 L;  3J7Z C;  3SE0 A;  4S3S A;  2YU9 H;  4K8J A;  4CDD C;  4P71 A;  5E3F A;  3PIO A;  4LFB L;  4EVO A;  4XXE A;  2BE5 D;  1LTG D;  3HEJ A;  4UDU C;  4R4Q A;  3KLR A;  4AH6 A;  5H1S E;  3RN2 A;  1WTV A;  4PZ6 A;  3VR2 A;  4HED A;  3NSW A;  4OEL B;  1HZ9 A;  4YY3 Q;  1PTO F;  3BJU A;  2L1B A;  4X64 L;  4HMI A;  4ZRZ A;  4PMC A;  4A3M H;  4ZQ3 A;  4A93 G;  4HJA A;  2OCE A;  4BY7 G;  2B39 A;  3MFG A;  2V4D A;  2J0T D;  2X6L A;  1XJV A;  1IYV A;  1ONL A;  2CW0 D;  4I7Z C;  1CK1 A;  5CGK A;  4MZ9 A;  1SMX A;  2V1C C;  2A19 A;  1A8V A;  3NBI A;  1P8L A;  1QUQ A;  1SNO A;  5LL6 S;  1H9R A;  3NTK A;  4B3T L;  4XQN A;  5JEA H;  5GQO A;  4K0K L;  3I4M B;  3V05 A;  2E2H H;  5IGF A;  2MP1 A;  5C0X G;  1WFQ A;  1U4P A;  1TWH H;  4HSV A;  3L3O C;  1HFG A;  4BXX H;  1H9K A;  4A3C H;  3TRE A;  3G6J B;  5C5L A;  3J81 j;  5CR3 A;  3M3Y H;  1PH6 A;  1NTG A;  5I2X A;  1NUC A;  1IBK Q;  1BVS A;  4TRD A;  2AMC B;  1I94 L;  3CD6 A;  5IGB A;  1CI3 M;  1BQQ T;  4JBM A;  3VYR A;  1UE6 A;  2MO1 A;  3I72 A;  1LYL A;  1QNU A;  1SXT A;  5CBE E;  1F2M A;  1Y8O B;  4DNT B;  1HTP A;  1OXU A;  2KEE A;  4X65 L;  4LF9 L;  2O2L D;  1VQG A;  4C3I B;  3OW7 A;  5IYC H;  1AZQ A;  1BF4 A;  1JWS D;  3SDZ A;  4ZUI A;  1ET6 A;  3QOJ A;  3GTQ H;  3KLS X;  1UUP A;  1WTO A;  1NNX A;  4JI5 L;  2B29 A;  1IW7 C;  4PMB A;  4M8A A;  1SSO A;  1VDZ A;  2VL6 A;  1LT5 D;  2I5L X;  1B50 A;  1WD1 A;  2CQA A;  1B3Q A;  3EBE A;  4X3U A;  1GUO A;  2QEX A;  3S14 H;  2FIN B;  2YU9 B;  2DY8 A;  2EY2 A;  4CGY B;  5LMN L;  4A75 A;  3IFT A;  4NB3 A;  1KDB A;  4UP8 A;  1K9M C;  1X54 A;  1Y14 B;  4JI0 Q;  2HD3 A;  4CKB A;  4WJW A;  2UXC L;  2G9H D;  2WB1 E;  5IWA Q;  1A6X A;  4QF4 A;  4EGV A;  4IOA A;  1PH7 A;  3BVM A;  1PRT B;  4ZLT F;  3MXG A;  2R92 G;  5CV5 A;  3RZD B;  3KF6 B;  3MHB A;  1RL2 A;  4F8M A;  1KNE A;  1N8R C;  1L1O C;  2IT1 A;  1SRU A;  1GVP A;  1JQY D;  2XTI A;  1KTK A;  1K83 B;  1OO9 B;  3H0G B;  5CV9 A;  5CBA E;  4EX5 A;  4BY1 B;  2Z9H A;  4R1J A;  2QEJ C;  5CV6 A;  4A3L H;  2JA6 H;  4YIJ A;  4B3S L;  2A6H D;  4DNI A;  1BUV T;  1DJR D;  1TWH B;  4JV5 Q;  5FO9 B;  1JE5 A;  1CKO A;  1ZYR D;  2E2I B;  4QL5 A;  3OWE B;  4MTK A;  3OHX C;  2WP8 J;  3K7U C;  2KOL A;  3OMC A;  4A3I B;  3RMH A;  3QO2 A;  3H3V I;  4YHH Q;  2PQA A;  2HUG A;  4GNX A;  1Y1W G;  2IPK D;  3A5Z B;  4K5X A;  3OOC A;  5D3D A;  3LWU A;  1C8C A;  3HGB A;  3SXH A;  5IT9 L;  1QJO A;  4MN3 A;  5BN3 A;  2JA5 B;  3R3O A;  5HY6 A;  4FF3 A;  2J7Z A;  1IL8 A;  4GKK Q;  4BA2 I;  1D6E C;  3X3M A;  1W3S A;  5C3X A;  1CA5 A;  1SYC A;  3ONA B;  1S5F D;  1QCB D;  4L6T B;  1OXX K;  5C6A A;  2BDN A;  2FHT A;  3TP8 A;  4DR5 Q;  1O7Z A;  4N8F A;  2D9U A;  3S15 H;  3HOY B;  1HZC A;  5DNF A;  1B9M A;  3JAM E;  1TY2 A;  1D5M C;  1D8L A;  1SND A;  3F2D A;  1B9N A;  2NTS A;  4CDE C;  2HIX A;  1I4R A;  4A3E H;  3KOJ A;  3CCE A;  3VR3 A;  3R8B A;  5TSS A;  3ULP A;  2AKW B;  1B3A A;  4A3J B;  1MIU A;  4IFD G;  5FJ8 H;  3I2Z A;  4YY3 L;  2GVA A;  5IYB H;  1A0I A;  3I7F A;  3I4M G;  4DV4 Q;  1VQ6 A;  2GA4 B;  1VQB A;  3GV6 A;  4JG2 A;  3FMC A;  1SE3 A;  3UI2 A;  4KN4 C;  1E3P A;  4DR4 L;  1YBY A;  4J8Q A;  4G4K A;  2Z0S A;  2XWJ B;  1GHJ A;  5JAV A;  4DR3 Q;  1M4V A;  1Q8K A;  2Q8I B;  3CCS A;  1SEB D;  3PUW A;  5LMN W;  3QB3 A;  5M5X H;  3CXC A;  2UUA L;  3S24 A;  4C3I G;  1VQF A;  1EYC A;  1WYD A;  3M85 A;  4ID6 A;  3M9B A;  1IBK L;  2R93 H;  2YTV A;  5JVH 3;  3I56 A;  1VQD A;  1M8A A;  2P5Z X;  4OL7 A;  3CPW A;  4GOP C;  4FNF A;  2DJF C;  3ZYY X;  2F0J A;  3I4N H;  1N32 Q;  2Z4H A;  1I6H H;  2JXM B;  5EGT A;  3G71 A;  1KRT A;  4PMW A;  5I2Y A;  1VQI A;  5K36 H;  1DON A;  2ZXP A;  3E9H A;  1QZG A;  1C4Q A;  1TWF H;  2YTY A;  1FNW A;  1A2U A;  5EKI A;  1ILQ A;  5GAG C;  1HTL D;  5COR A;  2VUM G;  4XYO A;  2EYF A;  2F0O A;  2RVL A;  5I4D A;  3E3X A;  2E8G A;  3QG1 A;  3CPF A;  5LMU Q;  1YNX A;  3NK9 A;  1MSG A;  1PTO H;  1EQV A;  2RF4 A;  1S5B D;  5E1F A;  4ZKC B;  3A8J E;  5KND A;  4LUO A;  2D0O A;  1BKB A;  1F9R A;  5IY0 A;  1FYC A;  1Q1E A;  1U4M A;  3I91 A;  3K5O A;  2EXZ A;  2QF7 A;  3NBH B;  3H0G G;  2F0E A;  5IT9 c;  3CP0 A;  4KD4 A;  4BY1 G;  4DUZ Q;  2EQS A;  3S1Q H;  3WOF A;  1B1Z A;  2EDG A;  4LFC Q;  2RQX A;  2B2V C;  4C1N K;  2ICE C;  3W2D A;  3RZO B;  4ODG A;  1EY9 A;  4LJZ C;  1TWA B;  3M7G A;  1YJW A;  1QE6 A;  1BO0 A;  4QIW B;  3FHW A;  4A3I G;  2A69 C;  1SYE A;  2JJQ A;  1S3O A;  1DD2 A;  4N9P A;  1K3R A;  4J15 A;  4K6L A;  5ELB A;  4A93 H;  4BY7 H;  1CKN B;  1CQF A;  3GD7 A;  3ER0 A;  4DF7 A;  4QMG A;  4P2C B;  1G51 A;  1EIH A;  1L0X B;  4IUN A;  2JA5 G;  1GXD C;  1K8A C;  4UAI A;  4Q0F A;  5JJK A;  4YHH L;  5EQ0 A;  2B2Y C;  5C0X H;  1PRT D;  1LO5 D;  1XNR Q;  3FVQ A;  4H02 A;  1JWM D;  4LF7 Q;  3HOY G;  1WTR A;  1HZB A;  1I3Q B;  3F2U A;  1PVO A;  4G7H C;  1EY6 A;  2KBN A;  5I9O A;  1Q8I A;  1QUQ B;  1TWF B;  5KIX A;  3DWQ A;  3S2D H;  2PZT A;  4IN3 A;  1XTD A;  1EWC A;  5GRO A;  5CV8 A;  3D4D A;  4QGU A;  4DR5 L;  1XPU A;  2CWP A;  1WTH A;  1YJ9 A;  1EFW A;  2B2W C;  3NUC A;  4A3J G;  1N33 Q;  1NAP A;  3DXJ C;  4R9W A;  2Q2T A;  4LF6 Q;  2GVB A;  3K5L A;  3J80 E;  3GTP B;  2PCF B;  2F0M A;  2NVT B;  4LFA Q;  3ND8 A;  3EA6 A;  5IOD A;  2Y0S E;  3Q6S A;  4GLA C;  2JEA I;  1EY5 A;  2ZM6 Q;  1PZK D;  3QIA A;  1EZ8 A;  1ESF A;  1SN8 A;  4A3L G;  2M00 A;  2FMM A;  3I8Z A;  4DV4 L;  1ZKO A;  4EQN A;  4Y52 H;  4OO1 I;  4RG1 A;  3AFP A;  1MHW C;  1BCP D;  4OWX B;  4PZ7 A;  1GUT A;  4GLV B;  2F0L A;  2F0S A;  2I5H A;  3K5N A;  3PIO 3;  1SMY C;  4DR3 L;  2R92 H;  1JOR A;  2ZTD A;  2K01 A;  5EPJ A;  2PMZ E;  1HA5 A;  1VMC A;  4JI2 Q;  4R8I A;  1GD7 A;  2Q2H A;  1PFB A;  1VF5 C;  1Q7Y C;  2C9O A;  4XQQ A;  2KED A;  5M5W B;  2G5D A;  2HHH L;  1K8M A;  3I70 A;  1EEF D;  3W3A A;  1XNQ L;  3GTG H;  1T5X D;  3FRP B;  1N32 L;  4NXM L;  2K5Q A;  3MVV A;  1JMC A;  2QW7 A;  4FXK C;  1ICW A;  3MXN A;  3GTJ B;  3ERQ A;  4G57 A;  5IGG A;  3TS2 A;  1D1I A;  1PH2 A;  3M4O H;  1C0A A;  4NXN Q;  3UDI A;  3TP5 A;  3S2D B;  2LXK A;  1OTC A;  4JCV E;  1G8Z D;  5ELO A;  1UE7 A;  3TZD A;  4DR1 Q;  2EOT A;  3KFU A;  4JI5 Q;  1YNN D;  1Y1W H;  2AUJ D;  3HKZ G;  1RKN A;  1TQO A;  2ATW A;  4KKS A;  4A3G B;  3K5M A;  5LMU L;  2MUY A;  3Q23 A;  1TWG H;  2L15 A;  3AB9 A;  2DUD A;  1MKH A;  2RHQ B;  1MI2 A;  1K8O A;  1ML0 D;  1U5K A;  1ZEQ X;  4ME5 A;  4IUP A;  2CQO A;  4Q5V A;  1PH5 A;  4HCE A;  3ULL A;  1IL2 A;  4A4I A;  2PQA B;  4GNX B;  1RJT A;  4V19 0;  3C2P A;  4AQY Q;  2UXC Q;  4C2M B;  5KEE A;  4DUZ L;  5IP9 G;  2Z6K A;  1D2B A;  1WJJ A;  2Q2I A;  3BZC A;  4LFC L;  3DWP A;  1SYG A;  3K80 C;  1YIT A;  1HPC A;  3HOU B;  2KHJ A;  1SNC A;  4MNO A;  4RHR A;  3HOV B;  2K5N A;  2HDM A;  1UEB A;  3F2C A;  4DA2 A;  4ZAI A;  1D5Z C;  2NVX B;  3SR1 A;  2H4O A;  4IFD H;  4OO1 G;  2B8F A;  3KUP A;  2JK8 A;  4WOR A;  2ID0 A;  5FLX L;  4RCN A;  2EY5 A;  1C7Y A;  3I4M H;  1B2T A;  5I9P A;  2EVB A;  5ELC A;  3K59 A;  1E7Z A;  3T4A C;  1TKW B;  4TSS A;  1PXU A;  1V1Q A;  1HZA A;  3OSO A;  2K5D A;  3CCR A;  1O7Y A;  2FFK B;  3H94 A;  3KBG A;  4POG A;  1EWH A;  4KJN A;  2E2D C;  1IW7 D;  3EJI A;  2IX0 A;  1PFN A;  4LF7 L;  3Q22 A;  4DV0 Q;  3T1H Q;  1Z7T A;  2ZXO A;  3E9I A;  4C3I H;  3BVG A;  1V8Q A;  5KYI A;  2NVY B;  2Q8T A;  4CJ0 B;  1J5E L;  2XIW A;  1GJX A;  3A74 A;  3D4W A;  3SVM A;  4DV3 Q;  3S1R B;  1R4Q B;  1XX8 A;  3U58 A;  1N33 L;  2ASB A;  3LX0 A;  1IZ6 A;  2IHF A;  1TWG B;  4GKJ L;  4RCO A;  3NEM A;  3H3V H;  3STB D;  3J81 L;  2LSS A;  4LFA L;  1TU2 B;  4RKB A;  1CKN A;  5G3L F;  1HNX L;  3H15 A;  2HQE A;  4DN4 M;  5FK9 C;  2ZXR A;  5E7N A;  4KTA A;  2ZM6 L;  2UXB Q;  1S5D D;  2VUM H;  2N78 A;  3RN5 A;  4RGM A;  2XVS A;  3CC4 A;  1VCI A;  3J81 i;  3NWT A;  1B4O A;  3MZ5 A;  1S5C D;  1ZXT A;  4RKL A;  2TMP A;  1BDO A;  2R7Z B;  1DYQ A;  4NKL A;  1N34 Q;  3RZD H;  4DR2 Q;  2PI2 E;  2YYZ A;  1LTI D;  1NR4 A;  3VYT A;  5M3F B;  1IKL A;  1HQR D;  2IL8 A;  1K83 H;  3H0G H;  5HGT A;  1I50 B;  3NP8 A;  4DR4 Q;  4RGN A;  4BY1 H;  3FPP A;  3SGI A;  4DK3 C;  3ERO A;  3EN2 A;  4QCL A;  2F0P A;  3S1M H;  1CHP D;  4PNY A;  3CC7 A;  1CM9 A;  5EKL A;  3NTI A;  2BA0 A;  3EFX D;  2I07 B;  3JAM L;  3BDO A;  2XSC A;  4XIG S;  4JI2 L;  1EEI D;  1E24 A;  2AHO B;  3SK4 A;  1BBX C;  2MNA A;  4LF4 Q;  4AYB E;  4JC0 A;  3KBX A;  5GAH C;  2UUA Q;  2E2I H;  2KCM A;  2K14 A;  1SJE D;  4DV5 L;  4F88 A;  1IHZ A;  2AUK A;  2LKV A;  1X65 A;  4A3I H;  3AYH B;  4DR7 Q;  3TEH B;  4ULL A;  2NB0 A;  2IX1 A;  3RLN A;  2QDB A;  2PO4 A;  1UE1 A;  2KUM A;  3KF8 A;  4U68 A;  4R4C A;  4A3G G;  2A8V A;  3HOW B;  3A0J A;  2B2T A;  1Q1B A;  4BWG B;  2LMC B;  3S1N H;  4C1N I;  4NXN L;  1M1K C;  2BCO A;  3DEO A;  2QIL A;  2JA5 H;  1VQE A;  5F2D A;  2CFM A;  4I7A A;  1L2F A;  2LFN A;  5FLX c;  4DR1 L;  3CRL C;  1K0R A;  3TBI B;  1SR3 A;  1NR2 A;  3VR4 A;  4IOC A;  1HUM A;  5A35 A;  4LF5 Q;  3KYH C;  3HOY H;  1GUG A;  1YHA A;  3GQB A;  3CQZ H;  3SK5 A;  3MAQ A;  4KY7 A;  4JI7 Q;  4IFD I;  4CHT B;  4DK6 C;  1AE3 A;  2RCF A;  4DNR B;  4OIK A;  3HOU G;  3UDG A;  3CMA A;  1TWC H;  2VUM B;  3A8I E;  3TDQ A;  4AQY L;  1KIX A;  3HOV G;  1ENC A;  3PCO B;  1LT6 D;  1X55 A;  4A3J H;  3G6E A;  2K7V A;  2YV5 A; 
#chains in the Genus database with same CATH homology
 1VQD A;  3CPW A;  5C4J H;  4GOP C;  3HOW H;  1JB7 A;  1VQJ A;  4OXP A;  5FLM H;  3T1Y Q;  5M5Y H;  3I4N H;  1N32 Q;  1YI2 A;  1IBL L;  1ASZ A;  2UUB Q;  1U0L A;  3G48 A;  3GTL H;  2JA6 G;  1I6H H;  4PG3 A;  1NE3 A;  1E1T A;  3G4S A;  3G71 A;  1KRT A;  4PMW A;  4LNQ A;  1VQI A;  4GLX A;  1E22 A;  4X64 Q;  4DR6 Q;  2UXD L;  4GN3 B;  1B8A A;  2NVQ H;  1XPO A;  3E9H A;  2VS1 A;  5EAY A;  2MO0 A;  3HKS A;  1SRO A;  1TWF H;  3J81 c;  1IXR A;  1QZG A;  2B63 G;  1NMG A;  2YTY A;  3I4O A;  1JJG A;  2UU9 Q;  2KCT A;  2KHI A;  3UDF A;  5GAG C;  2VUM G;  2OQK A;  4JI1 Q;  1UWV A;  2RHS B;  2HIV A;  2E8G A;  4JOI C;  4O0A A;  2E5L Q;  4A3D G;  2Y0S G;  3CPF A;  1NMF A;  1VQH A;  1Z9F A;  2BA1 A;  5LMU Q;  4B3T Q;  4XTC S;  1YNX A;  2NN6 G;  3GTO H;  2VZA A;  1G29 1;  2ZTC A;  4K0K Q;  3KJP A;  1VQN A;  2RF4 A;  1L1O A;  4KHZ A;  3MEF A;  1UE5 A;  2B3G A;  2K50 A;  1VQM A;  1VQC A;  1X3E A;  4LUO A;  2D0O A;  3S16 H;  1BKB A;  1IYJ B;  5IY0 A;  1Q1E A;  3DLL A;  3CME A;  5JEA J;  2C35 B;  3NBH B;  3I55 A;  1EOV A;  3H0G G;  3PF5 A;  4IO9 A;  1PH4 A;  5IT9 c;  3CP0 A;  3CCJ A;  4L5R C;  4BY1 G;  4DV6 Q;  4WJ4 A;  4DUZ Q;  2EQS A;  4DV0 L;  4LW1 A;  3ULJ A;  3S1Q H;  3T1H L;  1KD1 C;  5AJ3 L;  1I94 Q;  4LFC Q;  3FKI G;  4JOI A;  2K75 A;  1EWI A;  2I0Q A;  2OQ0 A;  4UP7 A;  2RCN A;  1YIJ A;  3CAM A;  4X65 Q;  4GOP B;  1PH8 A;  3LGJ A;  1VQK A;  4LF9 Q;  1GKH A;  3HOX G;  3CCQ A;  4DV3 L;  4POF A;  1HNW Q;  3OW2 A;  1PYS B;  1HR0 Q;  1XMO Q;  1OXS C;  2GN5 A;  1YJW A;  3RR5 A;  1YHQ A;  4B3M L;  3UDX A;  3FHW A;  4A3E G;  4IPH A;  2Z6K C;  5IYD G;  3W1B A;  4JI4 Q;  3PO2 H;  3GTK H;  1FGU A;  3W1G A;  4YCU A;  4A3I G;  2JJQ A;  4JI8 Q;  1S3O A;  1KRS A;  1K3R A;  4J15 A;  4JI1 L;  4A93 H;  1BBU A;  3RLO A;  4A3K H;  3JC6 6;  2E5L L;  1CKN B;  2R7Z G;  4BY7 H;  3GD7 A;  3ER0 A;  3CC2 A;  4A3B G;  3JAM i;  1YVC A;  1QZH A;  3HFZ B;  4IFD J;  2R7D A;  5FJ8 G;  2UXB L;  5IYB G;  1G51 A;  4OWW B;  3ICE A;  5LMN Q;  5GAD C;  5M3F G;  3D0F A;  5J3B A;  2JA5 G;  1K8A C;  3D31 A;  1B7Y B;  1G6P A;  4UPA A;  4LF8 L;  4NPS A;  1X6O A;  5C4X G;  5JJK A;  1Y1V G;  3MXN B;  3L0O A;  4YHH L;  1YHB A;  1PHJ A;  2YTX A;  1DGS A;  2F52 A;  1N34 L;  2XGT A;  3F1Z A;  4IJH A;  4DR2 L;  1XNR Q;  4B3R Q;  3PUY A;  1CKM A;  1M90 C;  2JA9 A;  4H02 A;  4JI6 L;  1PH3 A;  3RNU A;  3TQY A;  1PA6 A;  4LF7 Q;  3HOY G;  1HZB A;  4A3F H;  1N9W A;  1IBM L;  1PVO A;  1E1O A;  1WCM G;  3RZO H;  2OTJ A;  1PFS A;  2KBN A;  2LXJ A;  1X3G A;  1BBW A;  5IP9 H;  1LTL A;  1KAW A;  1TWA H;  2HT1 A;  2NZO A;  1QUQ B;  4TVA B;  3S2D H;  4GN4 B;  3AFQ A;  1HNW L;  1XTD A;  5C0X I;  5GRO A;  1VQO A;  4QGU A;  2JE6 I;  4DR5 L;  1XPU A;  1A62 A;  1JJ2 A;  4OX9 Q;  2CWP A;  1YJ9 A;  1EFW A;  1HH2 P;  4JYA Q;  2R93 G;  1Q86 C;  4LF4 L;  2CKZ B;  2JEB I;  1B70 B;  4A3J G;  4P74 A;  1N33 Q;  1HJP A;  4LF6 Q;  2Q2T A;  3HOW G;  2GVB A;  1MJE A;  4R4T A;  4LFA Q;  5GAE C;  1YJN A;  4B3S Q;  1YEZ A;  2Y0S E;  3I4N G;  3HOZ H;  2EXD A;  2ES2 A;  3PSI A;  4KLK A;  4DR7 L;  4GLA C;  3PUZ A;  3UE1 A;  3BU2 A;  2VQF L;  4JI3 L;  2HHH Q;  5M3M H;  2DGY A;  3A5U A;  1XNQ Q;  1AE2 A;  2JEA I;  2K52 A;  1X9N A;  2JA7 H;  1Q12 A;  2ZM6 Q;  2ZJP A;  1FJG Q;  5K36 G;  4KI0 A;  4UP9 A;  4L5Q A;  3L2P A;  4NXM Q;  3VDY A;  4BBR G;  1K73 C;  1SN8 A;  3KDF B;  1PV4 A;  4A3L G;  1I3Q H;  1JJC B;  2VQE Q;  4DV4 L;  3PV0 A;  1XNR L;  1PH1 A;  2JA8 H;  4P72 A;  4B3R L;  4Y52 H;  5C44 H;  4HIO A;  4RG1 A;  4OO1 I;  4RMF A;  3TRZ A;  4OON A;  5ELN A;  4DV2 Q;  3AFP A;  4YCV A;  4DAM A;  3STB C;  3IRB A;  1ASY A;  4OWX B;  3OYY A;  4APV A;  1QVC A;  1WOC A;  4PZ7 A;  1QVF A;  4X66 Q;  3OTO L;  5IP7 H;  4GLV B;  2A1A A;  4LF5 L;  2I5H A;  4EQ5 A;  4GOP A;  1K8G A;  1AH9 A;  4DR3 L;  2R92 H;  4AIM A;  4DV7 L;  4JI7 L;  2ZTD A;  4HID A;  3WWV A;  3GTP H;  4JYA L;  4X62 Q;  2NVT H;  2PMZ E;  2UUC Q;  1Q46 A;  4JI2 Q;  3AQQ A;  1HNZ L;  1GD7 A;  3AEV A;  4LF6 L;  3K0X A;  3TS0 A;  3J7Z C;  2Q2H A;  1X56 A;  2YU9 H;  1OXV A;  1Q7Y C;  1QVG A;  4P71 A;  4KHP Q;  2WB1 G;  3PIO A;  4LFB L;  1I5F A;  1YZ6 A;  2HHH L;  3K81 C;  2KEN A;  1VS0 A;  1XNQ L;  3GTG H;  4JBJ A;  3T1Y L;  3PF4 A;  1XPR A;  1FJG L;  1N32 L;  4NXM L;  3CW2 C;  2JQO A;  1JMC A;  4A3D H;  2UUB L;  4R4Q A;  4AH6 A;  3RN2 A;  5H1S E;  4HIM A;  4PZ6 A;  3JAM c;  3PO2 G;  5BR8 Q;  4YY3 Q;  1HZ9 A;  3TS2 A;  2VNU D;  1PH2 A;  3BJU A;  4X64 L;  4DPG A;  1O7I A;  3M4O H;  4DR6 L;  4A3M H;  4A93 G;  1C0A A;  4NXN Q;  3UDI A;  4HJA A;  2OCE A;  4A3K G;  4L5S A;  2LXK A;  4BY7 G;  1OTC A;  2OWO A;  3GTM H;  1CSQ A;  4JCV E;  5ELO A;  1L0W A;  1UE7 A;  4DR1 Q;  2UU9 L;  1A63 A;  3KFU A;  1XJV A;  4JI5 Q;  1EQR A;  1Y1W H;  4IPG A;  4MZ9 A;  1SMX A;  2V1C C;  3HKZ G;  4BBS H;  2A19 A;  5IE8 A;  1A8V A;  2ATW A;  1P8L A;  1QUQ A;  4LUZ A;  2WAQ E;  5LMU L;  4B3T L;  3M4Q A;  2QA4 A;  4K0K L;  1TWG H;  2L15 A;  5GQO A;  2E2H H;  2DUD A;  1MKH A;  2PNH A;  2RHQ B;  4DV1 Q;  5C0X G;  1WFQ A;  4X62 L;  1U5K A;  1TWH H;  5M5W H;  1RIP A;  4DUY Q;  2CQO A;  1PH5 A;  4BXX H;  3HOX H;  4FDB A;  2D62 A;  1N36 Q;  3ULL A;  4A3F G;  1IL2 A;  4A3C H;  4A4I A;  2PQA B;  4GNX B;  1Q81 C;  3TRE A;  1JT8 A;  4AQY Q;  2UXC Q;  4DV6 L;  3J81 j;  4DUZ L;  1PYB A;  3GDE A;  2Z6K A;  5IP9 G;  1PH6 A;  3M3Y H;  1NTG A;  1WJJ A;  1IBK Q;  2AWN A;  1BVS A;  1VQL A;  2AMC B;  2Q2I A;  1I94 L;  3BZC A;  4LFC L;  3CD6 A;  1EIF A;  3GTJ H;  3PUX A;  2F3I A;  1SLJ A;  4JBM A;  1UE6 A;  2MO1 A;  1LYL A;  3K80 C;  1YIT A;  1D7Q A;  2KHJ A;  1OXU A;  4X65 L;  4LF9 L;  2WAQ G;  4MNO A;  1IBL Q;  2D0P A;  1VQG A;  3KDF A;  4GS3 A;  2CCZ A;  5DLQ E;  1J5E Q;  2K5N A;  4IJL A;  1LUZ A;  5IYC H;  1UEB A;  1XMO L;  2R6G A;  3F2C A;  1HR0 L;  4A76 A;  3U50 C;  5C3E H;  1CSP A;  3GTQ H;  3HOZ G;  4JI4 L;  4OO1 G;  4A3G H;  1Y1V H;  4ME3 A;  1S40 A;  4JI5 L;  2B29 A;  2JK8 A;  4JI8 L;  4GKJ Q;  3Q8D A;  5M3M G;  2ID0 A;  2VL6 A;  4AYB G;  1C7Y A;  3I4M H;  2I5L X;  1SFO H;  5FLM G;  2JA7 G;  3PUV A;  5JJI A;  4O2D A;  1NBW A;  3EBE A;  2QEX A;  1S72 A;  1E7Z A;  3ERS X;  1HNX Q;  1GM5 A;  3S14 H;  3J80 i;  1KHI A;  1Q82 C;  5LMN L;  1V1Q A;  2E2J H;  1HZA A;  1EUJ A;  3L7Z C;  4P73 A;  1NY4 A;  3ZJY C;  3CCR A;  4A75 A;  4NB3 A;  4UP8 A;  3W5O A;  5C44 G;  4C2M H;  1K9M C;  1H95 A;  1PH9 A;  1X54 A;  4P75 A;  3KF8 B;  4JBW A;  1Y14 B;  2BH2 A;  3CCL A;  3RLF A;  4JI0 Q;  4POG A;  3K8A A;  2UXC L;  2WB1 E;  5IWA Q;  1VQ9 A;  3EIV A;  5IP7 G;  2IX0 A;  4IOA A;  1PH7 A;  3HOU H;  4LF7 L;  1Z47 A;  4DV0 Q;  3B6Y A;  1WI5 A;  2OTL A;  2R92 G;  3NEN A;  3T1H Q;  1V43 A;  4C3I H;  3E9I A;  3HOV H;  5AJ3 Q;  3PO3 H;  3KF6 B;  2N3S A;  3CCM A;  1RL2 A;  3M4P A;  4PZ8 A;  1N8R C;  2NVX H;  1L1O C;  3U4Z A;  1LM0 A;  2IT1 A;  2VW9 A;  1SRU A;  1GVP A;  1J5E L;  2XTI A;  3A74 A;  1X3F A;  3U4V A;  4HIK A;  4DV3 Q;  4OX9 L;  2HQL A;  4EX5 A;  3K7A H;  4C3H H;  2PI2 A;  4GNX C;  1V9P A;  3PGZ A;  4R1J A;  3U58 A;  1N33 L;  1IZ6 A;  4MTN A;  2ASB A;  2IHF A;  2K5V A;  4BBR H;  4GKJ L;  4B3M Q;  4A3L H;  4HJ5 A;  4ALP A;  2JA6 H;  3NEM A;  4WJ3 M;  4X6A H;  3H3V H;  3STB D;  4HJ8 A;  3HKZ E;  2LSS A;  4LFA L;  4B3S L;  4DNI A;  1CKN A;  2K4K A;  1EYG A;  4JV5 Q;  1NJI C;  1JE5 A;  3UE0 A;  1HNX L;  4QY7 A;  3H15 A;  4DV5 Q;  1CKO A;  1SE8 A;  2B63 H;  3S17 H;  4IPC A;  5E7N A;  1EIY B;  3DM3 A;  2ZM6 L;  2UXB Q;  4QL5 A;  2VUM H;  2N78 A;  3RN5 A;  4OWT B;  3CCV A;  4A3M G;  3CC4 A;  1VCI A;  2WP8 J;  3J81 i;  3KJO A;  3K7U C;  3CF5 A;  4QJF A;  1FVI A;  2F4V Q;  2N8N A;  4JI0 L;  1R9T H;  4LF8 Q;  2VQE L;  1EQQ A;  3H3V I;  2EIF A;  1TXY A;  4YHH Q;  2PQA A;  4GNX A;  4TQU S;  5IWA L;  1Y1W G;  4DAY B;  3A5Z B;  3RZD H;  1N34 Q;  3M7N A;  4BBS G;  4DV2 L;  4IPD A;  4DR2 Q;  2NVY H;  2PI2 E;  2YYZ A;  1XMQ Q;  4JI6 Q;  4QIW E;  1CUK A;  1VQ8 A;  5JEA G;  4Y7N H;  4R4I A;  1K83 H;  5HY6 A;  3H0G H;  4GN5 A;  2BH8 A;  4X66 L;  1IBM Q;  3J7A 5;  2NZH A;  5C0X J;  3S1R H;  1VQ4 A;  4UY8 C;  4BA2 I;  4DR4 Q;  4GKK Q;  4BY1 H;  3SGI A;  4DK3 C;  1GO3 E;  3EN2 A;  1W3S A;  4C3J H;  2NN6 I;  3S1M H;  2QGQ A;  3F8T A;  3CC7 A;  1KC8 C;  4BXX G;  3S2H H;  3FKI H;  1C9O A;  1OXX K;  4A3C G;  2BA0 A;  4LUV A;  3KLW A;  1L1O B;  4DR5 Q;  2MQH A;  2UUC L;  4XIG S;  4JI2 L;  3S15 H;  5HGQ A;  1E24 A;  3F2B A;  2AHO B;  1FL0 A;  2MFI A;  2MNA A;  4LF4 Q;  1HZC A;  2K5H A;  4AYB E;  4LWC A;  4JC0 A;  5GAH C;  2UUA Q;  4KHP L;  1D8L A;  2E2I H;  3F2D A;  2KCM A;  2K14 A;  4JV5 L;  4DV5 L;  2ZJQ A;  4A3E H;  2HIX A;  1VQP A;  4HJ9 A;  3KOJ A;  3CCE A;  2IHE A;  5IYD H;  1X65 A;  1KXL A;  4A3I H;  3AYH B;  4DR7 Q;  2VQF Q;  3FP9 A;  4JI3 Q;  3TEH B;  5IYC G;  2IX1 A;  2R7F A;  4DKA C;  3ULP A;  2R7Z H;  2AKW B;  3RLN A;  4A3B H;  2F4V L;  5C3E G;  1MIU A;  1UE1 A;  4QQB X;  4IFD G;  2N49 A;  5FJ8 H;  4R4C A;  3I2Z A;  5BR8 L;  4YY3 L;  2GVA A;  2A8V A;  1MJC A;  4A3G G;  4L5T A;  1A0I A;  5IYB H;  3I7F A;  3NEL A;  3A0J A;  1Q1B A;  1VQA A;  4YWL A;  3J80 c;  5M3F H;  3S1N H;  4NXN L;  1M1K C;  4DV4 Q;  2JA5 H;  4JBK A;  1VQ6 A;  3I4M G;  1VQE A;  1I50 H;  3BZK A;  3PIP A;  1VQB A;  4JG2 A;  2UXD Q;  1KL9 A;  2CFM A;  1XMQ L;  1VQ7 A;  4DR1 L;  1L2F A;  5C4X H;  5FLX c;  4YWM A;  4HJ7 A;  2Q2U A;  1HR0 W;  1K0R A;  2I5M X;  1E3P A;  4R4O A;  1SR3 A;  4BA1 I;  4GKK L;  4DR4 L;  1YBY A;  2ALY B;  3KF6 A;  2Z0S A;  4IOC A;  5JJL A;  3OTO Q;  2CWA A;  1P16 A;  2FXQ A;  4LF5 Q;  1T9H A;  3KYH C;  1VQ5 A;  3HOY H;  1YHA A;  4DV1 L;  3CCU A;  3CQZ H;  1WCM H;  1J6Q A;  2AWO A;  2VY3 A;  4DR3 Q;  4DV7 Q;  4JI7 Q;  2JA8 G;  4YCW A;  1Q8K A;  3E0E A;  4IFD I;  3CCS A;  4DUY L;  3PUW A;  1KQS A;  4DK6 C;  1AE3 A;  3HOU G;  2ZTE A;  4YWK A;  5LMN W;  3UDG A;  1N36 L;  1HNZ Q;  3CMA A;  5M5X H;  1TWC H;  3CXC A;  2UUA L;  3S24 A;  2IY5 B;  4AQY L;  1KIX A;  3GO5 A;  3HOV G;  1VQF A;  3PO3 G;  2WFW A;  3PCO B;  1WYD A;  2H5X A;  2ZJR A;  3M85 A;  2R93 H;  3M9B A;  1W2B A;  1IBK L;  1OXT A;  1X55 A;  2YTV A;  4A3J H;  3G6E A;  4LFB Q;  2YV5 A;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...