4DV6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv6Q00
2XTIA 4OONA 4BBRG 3J7ZC 1YI2A 1VQDA 4BY1H 3CQZH 2R7FA 3GD7A 1KHIA 4OXPA 4LFBQ 1EYGA 4R4TA 5GAGC 2UXDL 4EX5A 2N3SA 4AH6A 1HR0L 1MKHA 4PZ8A 1JMCA 2VS1A 1UE7A 1L1OB 4JBWA 1NMGA 5M3MG 4X64L 1OTCA 2JA5G 3BU2A 2E8GA 3KOJA 4P71A 1K8AC 2CQOA 2JEBI 1QVGA 1RIPA 2RHQB 3CP0A 3UE1A 2ASBA 1J5EQ 2B63G 1XPUA 1M1KC 4DV2Q 4QIWE 3J7A5 2N78A 1N32Q 3I2ZA 2NZOA 2UU9Q 1GKHA 4IJHA 3U4VA 4JI1L 1EQQA 4KHZA 2MNAA 1I3QH 1IBML 5IYDH 4A3MG 3A74A 1QUQA 3K7AH 1K8GA 1X3FA 4X66L 1ASYA 5FLXc 3HKZE 2QEXA 4LF9Q 5IT9c 1PYSB 4O2DA 5ELNA 2JA9A 3FP9A 1Y14B 2MQHA 5IYBH 5JJKA 4JBMA 1NBWA 1VQCA 1XNRL 5LMNW 2AWNA 1E22A 5FLMG 3CPWA 1YIJA 4JI0L 3S2HH 2VL6A 1X6OA 2K50A 4A3JH 3HOUG 4NB3A 4JI4Q 1VQPA 2ZTCA 1XMOL 1MJEA 4OWWB 5K36G 1EOVA 1TWHH 4QY7A 1KL9A 1AE3A 2VW9A 3T1HL 3I4NG 3PO2H 1IBLQ 4K0KQ 2UXCL 1X55A 2WB1E 3H0GH 1R9TH 3CC2A 1IL2A 4KHPQ 1E1OA 3U50C 5C4XH 3K81C 4LF5L 3CCEA 4DUZQ 1VQIA 4O0AA 3G6EA 3UDFA 3K8AA 3ERSX 3OYYA 3HOXH 4JI7L 4HIOA 5BR8L 2K4KA 1G291 2VQEL 4DR7L 4LNQA 1NE3A 4LUVA 2R6GA 2R92G 4DAYB 4DV1L 4A3LG 4JI2L 3DLLA 5LMNQ 4JC0A 1YVCA 1KIXA 3PV0A 2UUBL 1VQ5A 4NXNQ 3K7UC 1V1QA 1I5FA 3L7ZC 1WFQA 2AMCB 3NBHB 4BY1G 2QGQA 4UP9A 5C0XI 1U0LA 1AE2A 3NELA 4YCWA 1UE5A 2MFIA 4XTCS 5IYCG 3T1YL 4TQUS 2ZJRA 4GN3B 2NVXH 2Z6KA 4DV4Q 1XMQQ 3KF8B 2IT1A 2IHEA 3W5OA 1MIUA 3KDFB 1IZ6A 1UEBA 3PUYA 1W3SA 3AEVA 3AFPA 2LXJA 1MJCA 2A8VA 2QA4A 3RNUA 1J6QA 1G51A 4LUOA 5IP7G 2JA6H 1VQ8A 1YEZA 2WP8J 5IP9H 2RHSB 3B6YA 4UPAA 4GOPB 4NXMQ 4B3RQ 3CW2C 3GDEA 4A3KH 3ULLA 4C3HH 2GN5A 3OTOQ 1AH9A 5IYDG 1WCMH 4XIGS 3HKZG 3FHWA 4B3TQ 1JJCB 4DR5L 4IFDG 2YTYA 1BBUA 2R7DA 5FJ8H 1OXXK 5M5WH 4P73A 1YBYA 2CWAA 5IYBG 2JA7H 1WJJA 4X65Q 4OWTB 1YJWA 1KC8C 1E1TA 4R4QA 4DV5L 2DUDA 4A76A 4DR1L 1N36L 3CD6A 1VQMA 2PMZE 4DK3C 5GQOA 4A3JG 2D62A 1VQBA 2OCEA 1NJIC 2I5HA 2Y0SG 4LFAQ 1YHQA 3PO2G 3JAMc 1PYBA 1Y1WH 5IWAQ 1TWFH 3H0GG 4A3EH 4DR4Q 3RR5A 3PIOA 4DKAC 4DR2Q 3NEMA 3PIPA 1K73C 4LFAL 5C4XG 5LMUQ 3CXCA 2D0OA 1N34L 4WJ3M 3HOXG 1GD7A 2B29A 1KRSA 4LFCL 4GOPA 4DV6L 1GM5A 5LMUL 1VQHA 4JOIC 3CMAA 1HNZL 3MEFA 2F52A 1S72A 2VZAA 4RG1A 4TVAB 4LUZA 1LUZA 1YHAA 1Q86C 1GVPA 1E24A 4X62L 2L15A 4A3BH 1YHBA 4YHHQ 3I4MH 2HQLA 3L2PA 4YWLA 4BA2I 1Y1VH 1OXTA 2KBNA 1BVSA 4GNXC 1X9NA 1VQNA 1KAWA 3JAMi 4JBJA 4DR3Q 1VQ9A 3KLWA 2ZM6Q 2YTVA 2ZTEA 4IPCA 3H3VI 1C0AA 1C9OA 1CKMA 1WOCA 2F3IA 4L5RC 4C2MH 1RL2A 4DR3L 1SLJA 1C7YA 2IX0A 3RLFA 2OQ0A 4IPHA 3S2DH 4LFBL 2BA0A 3RN5A 4A93G 2JA6G 4DUYQ 3GO5A 5IP9G 4APVA 4P72A 4A3KG 4IPGA 1PHJA 1M90C 1I50H 1EQRA 1Z47A 3PO3H 1WCMG 2RF4A 1J5EL 1NMFA 4DV2L 4AQYQ 1N32L 3ULPA 5FJ8G 2N49A 3IRBA 5M5YH 3AFQA 3E9IA 1G6PA 4NPSA 2UU9L 1BKBA 2K5HA 3CCSA 2JA7G 2JEAI 1L0WA 4LF8Q 4YCVA 4IOCA 4OX9Q 2NN6G 1CSPA 3A5ZB 4OWXB 4DPGA 2R93H 1HZBA 5GROA 4A3DH 3HOYH 2CWPA 2GVAA 2E2JH 3A0JA 4LF9L 3S14H 2JA8H 3CCVA 4LF6Q 4B3MQ 1PH5A 1V9PA 1K0RA 1NTGA 4POFA 4DV0Q 2CKZB 4A3EG 1T9HA 5C3EH 2JK8A 3M3YH 1CKOA 1EWIA 1PFSA 1TWAH 1PV4A 1N33Q 2OTJA 2WFWA 1L1OA 1SE8A 4L5TA 4DV0L 4JI4L 1PH7A 4LF7Q 4POGA 2VQFQ 3ULJA 3WWVA 4HIDA 2JE6I 1IBKQ 2HT1A 2N8NA 2EIFA 1IBLL 4K0KL 4KHPL 1FJGQ 1PA6A 4DUZL 4LWCA 4JI3Q 4A3FH 2YTXA 4IJLA 4HJ7A 4HJ9A 4KI0A 4GLAC 2C35B 2NVYH 1QZHA 3I7FA 1FJGL 4JYAQ 2HIVA 2PI2A 4JI5Q 4JI3L 1V43A 2BH8A 2YU9H 1Y1VG 1VCIA 2OQKA 2WAQE 1P8LA 2ALYB 1QVCA 4OO1I 4AYBE 5LMNL 2Q2IA 1VQOA 3EN2A 4NXNL 3KFUA 1XJVA 2LSSA 5JJLA 4IFDJ 1BBWA 2IY5B 3BZCA 3F2DA 1YZ6A 2KHJA 2MO0A 1I94Q 3STBD 1HJPA 5DLQE 4DV4L 4HJ5A 1XMQL 3PCOB 1XPRA 1QZGA 4PZ7A 1N8RC 3GTOH 4LF4Q 1I94L 1XNQQ 4X6AH 1UE1A 3JC66 3PO3G 4DV3Q 4UP8A 3PF4A 1N9WA 2UUCQ 1A62A 1HH2P 4B3RL 4NXML 1A8VA 1Q8KA 2PQAB 1LTLA 4GN4B 3BZKA 4JG2A 4L5QA 3OTOL 5AJ3Q 4B3TL 1LM0A 3PUWA 1VS0A 1Z9FA 1L2FA 2R93G 5GAEC 4A3DG 3GTPH 3HOYG 3UDIA 2B3GA 4BA1I 5IY0A 1PVOA 5GAHC 1IXRA 2JA8G 3F8TA 4MNOA 4DV7Q 4X65L 3J81j 3GTMH 4JI8Q 3CC7A 1WI5A 1Q7YC 3S1NH 3D31A 2VUMH 1EIFA 2JJQA 1JJGA 2K5VA 3HFZB 2WB1G 5C3EG 4DV7L 1KQSA 2UXBQ 1Q12A 3KDFA 1YNXA 3TREA 4GNXB 4PMWA 1UE6A 3CMEA 4IOAA 4YY3Q 3EBEA 5IWAL 2EXDA 2E5LQ 4DR2L 1JE5A 4DR4L 3F2CA 1P16A 1U5KA 2KENA 3K80C 4GN5A 4YY3L 3GTJH 4JI6Q 3E9HA 3S1MH 3I56A 3M4PA 4A3FG 2VY3A 2KHIA 2F4VQ 4C3IH 1OXUA 1KRTA 4Y52H 1YJNA 3STBC 1VQ7A 1TWCH 3CCRA 1NY4A 2YYZA 4DR6Q 4JV5Q 3AYHB 1X56A 1H95A 2UUAQ 2Q2UA 3DM3A 3MXNB 2MO1A 5JJIA 4LW1A 4JBKA 5HGQA 5ELOA 1GO3E 1VQ4A 3HOVH 2RCNA 2BH2A 4JOIA 4YCUA 4HJ8A 4YHHL 2I0QA 2Q2TA 1HNXQ 5M5XH 2AKWB 2DGYA 2ZJPA 2D0PA 2PNHA 3U4ZA 2CCZA 4DAMA 1CKNB 2ZM6L 3RN2A 5HY6A 1HNXL 3PGZA 4C3JH 1FVIA 4HIKA 1Q1EA 3I55A 4R4CA 1PH1A 4B3SQ 3CCLA 3HOWH 2K14A 4BY7H 5C0XG 2NVTH 4BBSH 1SFOH 1X65A 5JEAG 4DUYL 1CSQA 1SRUA 2ID0A 1A63A 1X3EA 1VQKA 3CCQA 3H3VH 5GADC 2UXDQ 3UDXA 4ME3A 2K52A 4HIMA 3PUVA 1HR0Q 1SMXA 1UWVA 3D0FA 5IYCH 1EUJA 1IYJB 4R4IA 4X64Q 1VQ6A 4AQYL 4ALPA 4JCVE 3ER0A 4A4IA 3NENA 4IFDI 3S15H 4A3IH 4LF8L 1WYDA 2VUMG 4OX9L 4GS3A 1S40A 2HHHQ 4RMFA 1TXYA 3K0XA 4IPDA 5IP7H 1XTDA 3BJUA 2ZJQA 2FXQA 4UP7A 4JI1Q 1Y1WG 2HHHL 2A1AA 3UE0A 1IBMQ 1CKNA 4LF6L 1KD1C 4B3ML 3HOZH 3S16H 3S1RH 3SGIA 3F1ZA 4X66Q 3M7NA 2IX1A 1I6HH 1X54A 4QL5A 2CFMA 1N33L 3GTGH 4DNIA 1XNRQ 4A3CH 4HJAA 4JI0Q 3FKIH 4LF7L 2VQFL 2R7ZH 1ASZA 1L1OC 1IBKL 3E0EA 4L5SA 2E2IH 4A3BG 2EQSA 1XMOQ 3I4MG 4WJ4A 1OXSC 4AIMA 3T1HQ 1VQAA 2Q2HA 2UXCQ 4PG3A 3HOVG 2I5MX 4JYAL 4LF5Q 1SR3A 2NZHA 4JI5L 2NVQH 4QQBX 4QJFA 1K9MC 2XGTA 5C44H 1D8LA 1K83H 3RLOA 5M3FH 1YITA 2Y0SE 3W1BA 2E2HH 2KCTA 1JB7A 4JI7Q 4BXXH 5BR8Q 3TS0A 1JJ2A 4IO9A 5C4JH 3F2BA 2VQEQ 1HZ9A 3CF5A 1PH4A 3GTQH 4DR7Q 3L0OA 1E7ZA 1D7QA 4FDBA 3J80c 4JI2Q 4DV1Q 1PH2A 1VQGA 2UUBQ 3HOWG 2Z6KC 4PZ6A 4BY7G 3J81c 1OXVA 4J15A 4BBSG 3KJPA 3OW2A 3CCJA 5E7NA 3U58A 2H5XA 1XPOA 1Q81C 3CCMA 1B7YB 3CC4A 3T1YQ 4A3GH 4LF4L 3S17H 3KJOA 1HNWQ 3TS2A 1XNQL 1KXLA 3GTKH 1B8AA 1PH8A 4YWMA 4DK6C 4DV3L 3G48A 1EIYB 4BBRH 1X3GA 5IE8A 1Q82C 1HNWL 2UUCL 3I4OA 1DGSA 3W1GA 4A75A 2YV5A 3M4OH 3EIVA 4A3IG 1HZAA 2ATWA 2PI2E 1PH3A 3KYHC 2BA1A 2LXKA 3PSIA 5J3BA 3J80i 5AJ3L 4EQ5A 2OWOA 5M3MH 4A93H 3J81i 2NN6I 2JA5H 4UY8C 2VNUD 5EAYA 3TQYA 3HOZG 1O7IA 3RZOH 4P74A 3RZDH 4DR5Q 4MTNA 4JI8L 3S24A 3A5UA 3ZJYC 3H15A 1PH6A 2B63H 3M85A 3AQQA 2IHFA 3KF6B 4H02A 1K3RA 1QVFA 2UXBL 1FL0A 1SN8A 3RLNA 2KCMA 2K5NA 2GVBA 2OTLA 4A3CG 1S3OA 4A3MH 1VQEA 3FKIG 4DV5Q 4DR1Q 1N36Q 2R7ZG 2ES2A 4P75A 1LYLA 4R4OA 2AWOA 1VQFA 2I5LX 1HZCA 3S1QH 1PH9A 2E5LL 4JI6L 2WAQG 4GLVB 5C0XJ 1YJ9A 3ICEA 4AYBG 1JT8A 5JEAJ 3PUXA 2PQAA 4GLXA 3UDGA 4GOPC 2F4VL 3G71A 2AHOB 2ZTDA 5FLMH 5H1SE 3TEHB 4QGUA 3GTLH 3M9BA 4MZ9A 3VDYA 3HOUH 1VQJA 5C44G 5M3FG 3CAMA 4Y7NH 1FGUA 1N34Q 4DR6L 4YWKA 4JV5L 1Q46A 3PUZA 4BXXG 3HKSA 2UUAL 3G4SA 1HR0W 4DV6Q 1W2BA 1EFWA 4LFCQ 3I4NH 2K75A 1HNZQ 2HIXA 2Z0SA 3M4QA 3Q8DA 3CPFA 3LGJA 4X62Q 4GKKQ 4GKJQ 1VQLA 1SROA 1A0IA 1QUQB 1Q1BA 1E3PA 4GNXA 3KF6A 4A3GG 4GKKL 1TWGH 4GKJL 1B70B 4OO1G 1CUKA 2A19A 4KLKA 2R92H 4A3LH 4B3SL 4R1JA 2JQOA 2V1CC 3PF5A 3TRZA 3CCUA
chains in the Genus database with same CATH superfamily
1TS5A 5FO7B 1Y8PB 1B1ZA 1VQDA 4BBRG 5BN3A 3IAYA 3K5OA 1DXMA 2R7FA 3GD7A 3GTQB 1XXGA 4AH6A 1MKHA 4JBWA 1QCBD 3BU2A 4A3GB 4DU9A 5I6WA 2RHQB 3UE1A 2FINB 4HCEA 4HEDA 4ODGA 2N78A 2DNCA 1L0YB 3I2ZA 3J7AF 1AZPA 4BBRB 2UU9Q 1DOLA 1B50A 3I72A 2MJ8A 1RDPD 1I3QH 1IBML 3M4OB 5IYDH 3K7AH 1CM9A 3NE5B 5FLXc 2JA9A 1E0BA 5IYBH 4HMIA 4QCLA 1WTOA 3KLSA 1RF2D 2Q8TA 3CPWA 3RZDB 1CZWA 2N55A 1H9KA 4JI4Q 1KL9A 3T1HL 1LACA 2UXCL 5TSSA 1V1PB 2WB1E 2F0PA 4ZUIA 2F0HA 4DUZQ 4FVMA 1VQIA 3Q0AA 1HTLD 2B2UC 3ERSX 2J4XA 3TN2A 3OYYA 3HOXH 1WTWA 4JI7L 4DNTB 4F8MA 1G291 4LNQA 1F9PA 1NE3A 2R92G 4JI2L 5LMNQ 4JC0A 1KTKA 3PV0A 3MWYW 1FGBD 3A8JE 2QGQA 4KN7C 3T1YL 1AE2A 2NVXH 2ZJRA 1XMQQ 2IT1A 1CA5A 1IZ6A 2KEEA 4RKLA 1JOOA 2EYFA 2R92B 2WACA 4LUOA 5IP7G 2B2TA 5T1GA 2RHSB 1JICA 3JAML 2A74C 3D6WA 4A3KH 3ULLA 4NW2A 3CQZB 4IUTA 2GN5A 1AH9A 1F2LA 4DR5L 2WINB 1DM0B 2WKCA 1LT3D 4FP5D 4HR7B 4DAYA 1OXXK 5CV9A 1O80A 1WJJA 4NKLA 1N36L 2DUDA 4A76A 4DR1L 3CD6A 2PMZE 4A3JG 3PO3B 1VQBA 2OCEA 3SE0A 2EVBA 1NJIC 4LFAQ 1EFID 5IWAQ 3RR5A 3PIOA 4DKAC 2A68D 4DR2Q 5C4XG 1EYAA 3P20A 1N34L 3AU7A 2B29A 4LFCL 4OGQC 4DV6L 4H44C 1S72A 1S5BD 4TVAB 4LUZA 4X62L 2CVRA 4A3BH 3HG9A 4KJNA 4YHHQ 1TWHB 2F0JA 2HQLA 3L2PA 1OXTA 1X9NA 5C4XB 4DR3Q 2ZTEA 1C0AA 4K6LA 4HSPA 2QDBA 4HN7A 3RLFA 4IPHA 1AEXA 3S2DH 5KYIA 4A93G 3IFTA 4LK1C 4XYOA 3K57A 4B08A 1PHJA 1M90C 3T53B 1Z47A 3PO3H 2K28A 1NMFA 1PTOB 3AFQA 3KK7A 2UU9L 1K28A 1BKBA 2F0QA 2PQEA 3CCSA 2PPBC 2JA7G 5KIXA 4LF8Q 4YCVA 4OX9Q 4DPGA 1CSPA 4JVZA 2R93H 4MIUA 3DEOA 1HZBA 3I8ZA 5GROA 1RD9D 2CWPA 3SVMA 3KBXA 3MC0B 1GUNA 1PH5A 1V9PA 4CGYB 4DV0Q 4A3EG 1LTRD 1TWAH 1PFSA 2LS01 1SE8A 1RCVD 4JI4L 4FO2A 1M8AA 1HQRD 1YNJD 2P5ZX 4KD3A 2M9VA 2PNRC 3DWQA 3V96A 3J80E 3WOEA 1B9MA 4KHVA 3J81E 4DUZL 3S1NB 4JI3Q 3CU7A 4WJWA 4KY5A 3Q24A 1E2VA 4KI0A 1K0SA 2C35B 2NVYH 4KD4A 4JYAQ 2HIVA 2PI2A 4JI5Q 1Y1WB 1ENAA 1P8LA 2ALYB 5LMNL 3VR3A 1JOKA 1XJVA 1S4ZA 1NCVA 2A73B 5IGFA 4X3UA 2R61A 3F2DA 1I4GA 1UUPA 1VF7A 3MVVA 1XMQL 3PCOB 1XPRA 1QZGA 2X69A 4LF4Q 1I94L 1NSNS 1V1PA 4DV3Q 4UP8A 4TKOB 1EQVA 2SNSA 4Q5VA 4YIJA 1Q8KA 2MPMA 1L0XB 3U9OA 3BZKA 4L5QA 2Q8IB 4CDDC 5AJ3Q 1VS0A 1Z9FA 3C2PA 3GTPH 1EIHA 3HOYG 1YNJC 1PVOA 2RDHA 4X3KA 1Q7YC 3S1NH 2VUMH 4TSSA 2HCIA 2K5VA 3QOJA 3HFZB 2UXBQ 1MSHA 4MHEA 1H9JA 3TREA 2MGSA 4PMWA 1UE6A 3DWPA 2MUYA 2HQEA 5IWAL 5IGCA 3NUCA 4DR2L 1JE5A 3F2CA 5BN5A 2KENA 3GTJH 4JI6Q 3HOYB 4YY3L 1H9SB 4RCOA 3E9HA 1RKNA 3C1EA 3FDTA 1OXUA 4C3IH 1YJNA 2KA7A 2TMPA 1TWCH 3CCRA 4UDUC 2YYZA 4DR6Q 4JV5Q 2NWGA 1H95A 2UUAQ 3AMUA 4LW1A 4JBKA 5HGQA 2EJMA 1GO3E 3MXUA 2RCNA 2BH2A 4JOIA 4YHHL 3A55A 5COYA 2D0PA 5DNFA 1HUNA 1UEAB 4EGVA 4EQPA 1EU4A 3PGZA 4S3SA 1EIGA 1PH1A 2HCCA 4HSVA 1LO5D 2NVTH 1KNEA 1T5XD 4LJZC 4C3HG 1CSQA 1Z7TA 4OELB 3BG3A 5M3FB 1VQKA 3QG1A 3H3VH 3BVZA 4IQZA 4ZKBB 1LT4D 3I73A 5IYCH 1MHWC 4EQOA 1HA6A 4DAPA 1WTHA 3ER0A 2SDFA 1DZ1A 4LF8L 1LTID 3F2UA 4OX9L 1U4PA 1XTDA 2A69C 4JI1Q 2HHHL 1CKNA 1ZKOA 1CTMA 1I6HH 2IX1A 1DCZA 2CFMA 3GTGH 1RTOA 1XNRQ 5E1FA 4HJAA 1ML0D 3SK6A 1J8IA 3OPOA 1MGSA 3I4MG 4WJ4A 1LTTD 1JCKB 3FPUB 2X6LA 4JYAL 4LF5Q 2QW7A 4JI5L 3CHBD 3RLOA 5M3FH 3W1BA 1PFMA 2PCFB 2KCTA 4UAIA 3TS0A 1JJ2A 4FDBA 1VQGA 2UUBQ 1KNAA 4BY7G 4C1NI 1OXVA 3K5MA 4F7XA 4PMCA 1XPOA 1B7YB 3CC4A 3HOUB 1NUCA 4LF4L 1D5ZC 4TRDA 3TS2A 3HP3A 4DV3L 2AQ1B 1Q82C 1UNSA 1DGSA 4ZUJA 2NUCA 5G3LD 2YV5A 5CBAE 4A3IG 1O78A 3I3CA 1U4RA 4NDXA 3BYTB 5J3BA 5AJ3L 4BY7B 1EYCA 4RAUC 2F0OA 3CRKC 5EKLA 4UY8C 3A56A 2F0IA 3HOZG 3RZOH 3JAME 1PH6A 4MTNA 3A5UA 2B63H 1EY8A 2J7ZA 4E6IA 2C5CA 2IHFA 3KF6B 4KY7A 1Y69U 1AP0A 4R9WA 2UXBL 1SN8A 3LWEA 2KCMA 2K5NA 2OTLA 4A3MH 4DV5Q 3FKIG 2R7ZG 2ES2A 4P75A 2AWOA 2I5LX 4JI6L 4GLVB 1PFBA 1G91A 1D5MC 2PZUA 3HOZB 2ZTDA 4ZLTF 4QGUA 3GTLH 3KLSX 3VDYA 1HUMA 4ZCKA 1S5DD 5C44G 3HOUH 4Y7NH 1I4HA 4DR6L 4JV5L 3HKSA 2UUAL 1HR0W 1EFWA 3VR5A 2HIXA 2PZTA 1BCPB 2BE5D 3Q8DA 1LTGD 4GKKQ 1Q3LA 3OW7A 1XYIA 1Q1BA 3DMUA 5EPJA 4XXEA 1O7LA 1AZQA 4KLKA 3FVQA 3IKJA 4ZYSA 2NVQB 3I91A 1D6EC 3PO2B 3CCUA 1LT5D 2E2HB 2CH4W 5C3WA 3SK8A 3PMFA 1NR4A 5C4JB 1DJRD 1GUTA 1EYGA 5IT9L 3P75A 1I4PA 2K7VA 2N3SA 2KQ3A 1NMGA 2G9DA 1DOMA 1OTCA 1K8AC 1EWCA 2A6HC 2K5DA 2JEBI 3CP0A 4DV2Q 1QJOA 4IJHA 4ME5A 4JI1L 3SXHA 2MNAA 3A74A 1RHPA 1KDCA 3HKZE 4KV6A 5ELNA 3FP9A 2B2WA 1HTPA 4JBMA 1NBWA 1XNRL 5LMNW 1YIJA 5FLMG 1TY0A 3N52A 2K50A 4NB3A 5CV6A 1WTPA 5K36G 4OWWB 2Z8LA 5EQ0A 1AE3A 3PO2H 5EPKA 3H0GH 3CC2A 1IL2A 1GUWA 1E1OA 4LF5L 3K81C 3G6EA 4O0AA 1DD2A 3UDFA 4XT3B 2FHTA 3D8GA 3VA7A 2BDOA 1EYDA 3NTKA 2R6GA 4DAYB 1MD2D 2EJGC 1KIXA 2UUBL 4NXNQ 1VQ5A 2B2YA 2RVLA 1ENCA 1WFQA 4UP9A 1U0LA 4YCWA 3NELA 1UE5A 2MFIA 3OWFA 2Z6KA 3QO2A 4DV4Q 2IHEA 5K5PA 1SYDA 2K1BA 1BO0A 3KDFB 5HGTA 1A2TA 4H0LC 4RCNA 2EYOA 2A8VA 2QA4A 3RNUA 1J6QA 2WV6D 1YEZA 2LFNA 5IP9H 4UPAA 1TS4A 2QDLA 4RH6A 5EKKA 3OTOQ 5IYDG 3R2IA 1JJCB 5I4DA 2YTYA 4RGOS 5IYBG 1SJHD 4NMZA 1YJWA 3GP7A 1KC8C 4R4QA 2NN6H 4DV5L 1Y8NB 2PW7A 1EL0A 5GQOA 1O7ZA 1GUSA 3KF8A 2RA4A 3VR2A 3ITPA 1PYBA 1FYCA 1TWFH 1LLRD 3K7AB 3NEMA 5CV5A 1HRJA 2D0OA 4WJ3M 4K2KA 3HOXG 1KRSA 3PIP3 4GOPA 3TP8A 3P1HA 1VQHA 2F52A 3EJIA 4RG1A 2E76C 3DUZA 2K03A 1GVPA 1IKMA 1YHBA 3ONAB 1BVSA 1PRTC 4GNXC 1EEID 1KAWA 3H3VI 3HOXB 2EYLA 1ET9A 2IX0A 1C7YA 1EY5A 3RN5A 4DUYQ 3GO5A 4FYDA 1B2TA 5CMDA 4P72A 4A3KG 1BCPF 2G9HD 3FEWX 5EJWA 2NVXB 2RF4A 3CRLC 2V4DA 4ID6A 5L37A 4DV2L 2K5QA 3BZDB 2N49A 1B53A 4NPSA 3E0JA 2JEAI 3A8IE 3A5ZB 4QUFA 2SNMA 2E2JH 1B44D 1PXUA 1SE2A 3CCVA 4LF6Q 4A3KB 1TVXA 2IPKD 3SK4A 5ELFA 3TP7A 3Q23A 5C3EH 2JK8A 3DXJC 5IODA 1CKOA 1EWIA 1PV4A 2F4IA 3SHLA 2RKSA 1PH7A 5I6YA 2EDGA 2VQFQ 1BOSA 3WWVA 1IBKQ 2HT1A 1STNA 1VDZA 5NUCA 4G7HC 4A3FH 3TDQA 3C1FA 3BS1A 1FJGL 4CBVA 1A3TA 1VQOA 2Q2IA 3EN2A 2B2UA 4NXNL 3KFUA 2LSSA 1H9MA 4HMJA 5IGGA 3BZCA 4IUPA 1YZ6A 2EXZA 3TZDA 1I94Q 1CFMA 1HJPA 4DV4L 3O13A 3T13A 1ENFA 3GTOH 4A3BB 5IOCA 4X6AH 3PQIA 3PO3G 4U68A 3PF4A 1A3VA 1A62A 5C4ZA 1ONLA 2EY5A 4GN4B 1LTLA 2HDLA 4JG2A 3OTOL 3PUWA 3S2DB 2R93G 1L2FA 2NYZD 3UDIA 5IY0A 3HOWB 3HRZC 1IXRA 3F8TA 1IW7C 1XWEA 1A2UA 2C9OA 4IUNA 1V8QA 2JJQA 2XRSD 2XVSA 4DA2A 4DV7L 1KQSA 1Q12A 3KDFA 3NSWA 5CV8A 2O5IC 3CMEA 4KMUC 4YY3Q 4B9XA 3EBEA 2EY2A 2R93B 1GHJA 1RODA 3S1MH 3M4PA 3I90A 2F0UA 2F4VQ 1IL8A 1KAAA 3M4YA 2XN9C 2K32A 3AYHB 4QF4A 4RGMA 1TWAB 1CA6A 4K5XA 1SBBB 2Q2TA 1TKWB 3RD4A 2A5HA 1HHVA 2AKWB 4FXGC 2CCZA 4DAMA 4QUCA 1CKNB 4RKBA 1S5ED 1GUOA 1Q1EA 5C6AA 3MFGA 2MP1A 1JORA 2NVYB 1U9RA 2KECA 3HOWH 2K14A 4M8AA 1C4QA 5LHY1 1SFOH 1UAPA 2AUJD 4DUYL 2ID0A 1A63A 2K04A 3CCQA 1VF5C 2UXDQ 3BVMA 3PUVA 1BQQT 2H4OA 1IYJB 5FK9C 4X64Q 5IT9E 1VQ6A 4QB4A 4JCVE 4A4IA 3NBIA 1MSGA 1I4XA 1STBA 3TSSA 2VUMG 1S40A 2HHHQ 1CI3M 1X32A 4IPDA 5IP7H 3GTKB 3BJUA 2ZJQA 4UP7A 1Y1WG 2A1AA 4LF6L 2B8FA 3S16H 3SGIA 5KNBA 1BUVT 4L6TB 4XQNA 3QIAA 3GTPB 4DNIA 4A3CH 4C3IG 2VQFL 4LMQD 1IBKL 2VUMB 3E0EA 2O5JC 2E2IH 5JAVA 1R4PB 2EQSA 1XMOQ 4MTKA 1VQAA 5FOBB 2A6EC 4O42A 4PMBA 2KEDA 2NZHA 1GHKA 1YITA 1S5CD 2JP1A 3GTJB 1EY4A 4WORA 4BXXH 2VQEQ 3F2BA 4DR7Q 1PZKD 1QWYA 3P7JA 3VYRA 1R4QB 1E7ZA 4C3IB 4DV1Q 3J80c 3TP5A 1PH2A 2EYPA 4KN4C 1TWCB 3NWTA 3J81c 3OMGA 4IN3A 2H5XA 1C48A 4Q0FA 3CCMA 1SYCA 1JE4A 1V1OA 3EFXD 2KCCA 3GTKH 1B8AA 1PH8A 3NP8A 3HS0C 4R8NA 5IE8A 1ESRA 1HNWL 2QCPX 1HZAA 2F0KA 2ATWA 2PI2E 4CJ0B 2NVTB 2F3VA 3NXWA 2OWOA 5M3MH 4A93H 1ICFB 5AFWA 2JA5H 2NN6I 3MTSA 2VNUD 3TQYA 4BY1B 1U4MA 1EWHA 3AQQA 4KKSA 2HUGA 4H02A 2XWJB 1FL0A 3ZYYX 1S3OA 1VQFA 2CHBD 1PH9A 2A69D 2D2CC 2WAQG 4AYBG 2Z4IA 2PZWA 3PUXA 4LAAA 1X3QA 2F4VL 5KGUA 2AHOB 3HGBA 3TEHB 3M9BA 2F0SA 4MZ9A 5I9PA 1I6HB 3MAQA 3QWNA 3CAMA 5M3FG 1FGUA 2F0DA 4FF1A 1W2BA 3I4NH 3GTGB 4RWSC 4G4KA 1KDAA 3NWSA 5EBCA 3LGJA 1VQLA 4DN4M 2WAQB 4AYBB 1E3PA 3S2HB 4GKJL 2K01A 1TWGH 1B70B 2FFKB 1CUKA 3NK9A 4A3LH 4HAEA 2Y0SB 4R1JA 2JQOA 1PTOD 1WD0A 3AB9A 1EZ8A 2XTIA 4OONA 1YI2A 1HXYD 1R9TB 4CHTB 4BY1H 2NTTA 1II3A 1KHIA 4OXPA 4LFBQ 5FLXL 4R4TA 2UXDL 4EX5A 2JYOA 1JMCA 1FR3A 2VS1A 1L1OB 4WRDA 4X64L 4P71A 1IYVA 4CKBA 4K5VA 1QVGA 1XPUA 2ASBA 2B63G 1J5EQ 4DXGA 4CDCC 2NZOA 3QR8A 3GV6A 4KHZA 4A3MG 1ASYA 4IFDH 4O2DA 1F9SA 3CKIB 5KRUA 1NNXA 2JA6B 2WKDA 1VQCA 2XIWA 3E3XA 3RZOB 1E22A 4DK0A 4DK1A 1B3QA 2B63B 2RSNA 5JVH3 3S2HH 2VL6A 3HOUG 3ERQA 1F2MA 4N8X1 2RBMA 1WCMB 2KUMA 5JPMC 1XMOL 5EGTA 1MJEA 3BDLA 2VW9A 4QY7A 3W2DA 4EVOA 4K0KQ 1PYWD 1PTOC 3OIPA 3OSOA 1X55A 2SEBD 4A3MB 1R9TH 1IKLA 4IALA 4KHPQ 2L5TA 3GV3A 1STYA 2FJ2A 4HIOA 2K4KA 1KLGD 2VQEL 4DR7L 4DV1L 1LTAD 3TP6A 1I4RA 3GTLB 1YVCA 1CQFA 1DONA 4Y7NB 3L7ZC 5I2XA 3ND9A 4OIJA 4XTCS 2DNEA 5A35A 2SOBA 5I2YA 3WDNA 2IW3A 3KF8B 3W5OA 2F0VA 1MIUA 1UEBA 3PUYA 3AFPA 2DJGC 3VYSA 1PDQA 5D14A 2KJXA 2JA6H 3MEHA 1VQ8A 2WP8J 4ZQ3A 4GOPB 3CW2C 4IZ8A 4RHRA 2D5DA 1HQMC 4C3HH 5C3XA 1WCMH 3FHWA 1SAPA 4XT1B 2L12A 5FJ8H 1YBYA 2CWAA 4OWTB 2A6HD 2L11A 3T4AC 1E1TA 1JB3A 5A2QL 4DK3C 1AFPA 5FO8B 2D62A 1QNUA 2L9HA 2I5HA 1YHQA 3PO2G 1JQYD 5D3DA 3JAMc 2F0LA 3J7AV 1LTBD 3H0GG 3VA5A 1WTRA 3CXCA 4KTAA 1GD7A 3PIO3 4JW0A 4A3DB 4H7BA 3CMAA 1PFNA 5LMUL 1ZEQX 5CR3A 1LUZA 4N9TA 2CW0C 2L15A 3QJYA 1SNPA 2VB2X 3SDZA 2WB1B 3I70A 3I4MH 1Y1VH 3H0GB 2KBNA 5G3LF 1VQ9A 3KLWA 1PMRA 2YTVA 1C9OA 1CKMA 2F3IA 2K33A 5IGEA 4C2MH 1RL2A 2WIIB 1SLJA 2KOLA 4FF3A 2OQ0A 5KYLA 4LFBL 2BA0A 4F87A 5IP9G 2CH4A 4F88A 3H09A 1I50H 2R3ZA 1EQRA 1J5EL 5I9OA 3ULPA 3IRBA 5M5YH 3SK5A 2K5HA 1E2ZA 1L0WA 2TSSA 2NN6G 3IL8A 1SSOA 4CJ1B 5JJZA 4A3DH 3A54A 4NP5A 3A0JA 2JA8H 2IX3A 1K0RA 1NTGA 4POFA 1T9HA 5DM73 3TMEA 3M3YH 3WOFA 2WFWA 1L1OA 4B9WA 4POGA 1NR2A 4HIDA 2JE6I 4K0KL 2PMZB 3E6ZX 4KHPL 2EY6A 1DYQA 2RQXA 5F2DA 1FJGQ 3GTMB 4HJ9A 4IJLA 4KY6A 5DEHA 4GLAC 2ZXRA 5ISRA 3I7FA 1EY9A 3NTHA 1V43A 2BH8A 3BVGA 3X3NA 2YU9H 1TWFB 1SNOA 1JR0D 2I07B 2OQKA 2WAQE 1QVCA 4AYBE 3MHBA 5JJLA 4IFDJ 4PQXA 4G57A 4DGZA 1BBWA 1A15A 3MXGA 4N8FA 3EVQA 5DLQE 1BF4A 1ESFA 4PZ7A 1N8RC 1EU3A 5CC4A 3I4LA 3T56B 3DM1A 4XYQA 1PRTD 5C0XH 1ILQA 5JEAH 1N9WA 1WTVA 2UUCQ 2X6GA 2Q8RE 2PQAB 1TQOA 4C3JB 2F0TA 1LM0A 5ELBA 2B2VA 5GAEC 2B3GA 4BA1I 3DHQA 4QIWB 4BBSB 4MNOA 4DV7Q 3J81j 3GTMH 3D31A 4I7AA 1QB5D 5C3EG 1F9QA 3URYA 3L3OC 1QE6A 2PW5A 2QKIC 1E2WA 1FNWA 2EXDA 4RHSA 1P16A 1U5KA 4GN5A 2E2JB 3I56A 4RGNA 4A3FG 3C3LA 1KRTA 4Y52H 2CQAA 1F2ZA 1EY6A 3T16A 4L8JA 1VQ7A 1NY4A 1WVLA 4R8IA 5C3EB 4H13C 2G5DA 5JJIA 1VQ4A 1ZYRD 3HOVH 4YCUA 2I0QA 1C8CA 2DGYA 2PNHA 3U4ZA 4FXKC 3RN2A 5HY6A 4P2CB 3K59A 1HNXL 4C3JH 4A3FB 1CHQD 4HIKA 5D65A 1LABA 4B3SQ 3HZXA 3CCLA 4V0BA 4X3TA 4BBSH 2IL8A 1X3EA 3K0YA 4CKEA 3K5NA 5M9OA 5GADC 5ELEA 4I65A 3UDXA 1CHPD 5JVG3 4ME3A 3DWAA 2K52A 4KK7A 1HR0Q 1SMXA 3D0FA 5FLXE 4R4IA 1BCPC 2ENBA 3U9SA 3GTOB 1D5XC 1O7YA 1PZJD 4C56C 3NENA 4IFDI 3MXNA 3S15H 5E4WC 1WYDA 4DF7A 3Q22A 4DAVA 4IUVA 1WTXA 3S17B 2BDNA 4RMFA 1D1KA 3M7GA 2FXQA 3UE0A 2IWHA 3SEBA 3S1RH 4X66Q 2B8GA 1X54A 1TU2B 1STGA 5EKIA 1B9NA 1ZYRC 2Z6BA 3LWUA 1IW7D 4JI0Q 1STAA 3VR4A 4XQQA 3D3RA 4L5SA 4A3BG 4AIMA 1F9RA 1QG7A 3MFYA 3KUPA 1SYGA 4QQBX 3NTIA 4GZYC 1SMYC 2XGTA 1D8LA 1K83H 1SE4A 3KBGA 5BR8Q 3VYTA 4IO9A 3S1MB 1PH4A 3CF5A 3GTQH 3L0OA 1I6VC 3HOWG 3VR6A 2EE1A 1Q90A 1JC7A 3OW2A 3U58A 2F0GA 1Q81C 3W3AA 4OO1H 3A7LA 4A3GH 3S17H 4DFAA 3KJOA 1HNWQ 1KXLA 2M00A 3G48A 1CZGA 2B2TC 2JXMB 1X3GA 4BBRH 2E74C 5CORA 2UUCL 2XSCA 3I4OA 4A75A 1TS2A 2RCFA 1I4QA 3NQIA 3ND8A 1SDFA 5CYUA 3M4OH 5J22A 3EIVA 1IYUA 4KJOA 1PH3A 2BA1A 2J0TD 3J80i 1SFOB 2DJFC 4EQ5A 3J81i 5EAYA 1HA5A 3RZDH 3S24A 3H15A 1G8ZD 3M85A 1GJXA 4K6DA 1QVFA 1TIID 3RLNA 1SXTA 4A3CG 4XDXA 1VQEA 1GUGA 4R4OA 1M4VA 1SNMA 2ZXOA 5A2QE 2F0EA 5C0XJ 3ICEA 1JT8A 3KLRA 5JEAJ 1K3BC 2F0FA 2PQAA 4GLXA 3UDGA 4ILWA 4Z9CB 3G71A 3S16B 2Z4HA 1VQJA 2KHSA 4BXXG 3L9AX 3G4SA 2AQ3B 4M1UB 5BN4A 1HNZQ 2Z0SA 2BCOA 3CPFA 1BNZA 4GKJQ 1T5EA 2E2IB 1ILPA 1DOKA 2A6ED 2F0NA 1SROA 1A0IA 1MBYA 4A3JB 2R92H 1RTNA 4B3SL 2V1CC 3QOLA 4CKCA 1CT1D 3J7ZC 2ICIA 4HCSA 4IUQA 3CQZH 2VXWA 2ZT9C 1BR9A 1KLUD 4OHJA 5GAGC 4U673 1HR0L 4PZ8A 5C5MA 5EPLA 5CV7A 1UE7A 5M3MG 2JA5G 1ICWA 3KOJA 2E8GA 4I7ZC 2CQOA 1K8MA 1RIPA 2LKVA 3J7A5 1M1KC 4QIWE 1LV9A 4K2LA 1N32Q 1GKHA 3U4VA 1EOTA 1EQQA 2OXPA 1QUQA 1SYFA 1K8GA 1X3FA 4X66L 2A68C 2QEXA 4LF9Q 5IT9c 1PYSB 4MN3A 1Y14B 2MQHA 3MXPA 5JJKA 5M3MB 4A93B 2JA5B 4ULLA 3MZ5A 2HDMA 2AWNA 4JI0L 3K6OA 1BXTA 3QB3A 4A3JH 1X6OA 2L55A 2DY7A 1VQPA 2ZTCA 5DM63 1EOVA 2KCNA 1TWHH 3I4NG 3EA6A 1IBLQ 1LTSD 5M5WB 1JWMD 5C4XH 3U50C 2JA7B 2L0CA 3CCEA 3K8AA 5BR8L 1D1IA 4LUVA 4A3LG 3DLLA 4ZAIA 3K7UC 1V1QA 1I5FA 2Z1CA 4A3EB 1AW7A 3NQTA 2AMCB 3RMHA 3NBHB 2VB3X 4BY1G 5C0XI 3I4NB 4RA8A 1HFGA 5IYCG 4TQUS 4GN3B 4ABNA 4G7ZC 3R3OA 1PTOH 2E75C 2B39A 4ZRZA 3AEVA 1W3SA 3H91A 3D4DA 4JPBW 1YNND 2GA4B 1TWGB 2LXJA 1MJCA 1QNKA 4BS9A 1G51A 3MA2B 2ZXPA 4B3RQ 3B6YA 4NXMQ 3GDEA 5KNDA 5IGDA 1A6XA 1IHZA 4J1MA 4B3TQ 4XIGS 3HKZG 2RSOA 5IIFA 2XWBB 5D3IB 4IFDG 1BBUA 2R7DA 5M5WH 4P73A 2JA7H 4X65Q 2K05A 1TT2A 5E4XA 1VQMA 2HD3A 1CQVA 1HFNA 2Y0SG 1HCZA 1Y1WH 3HKZB 2AUKA 4A3EH 4DR4Q 3PIPA 1K73C 2EY1A 3A7AB 4LFAL 5LMUQ 1PLFA 1PZID 4RGTA 5KEEA 1GM5A 5FO9B 5KNCA 4JOIC 1HNZL 3MEFA 3S14B 2VZAA 1YHAA 1Q86C 3BDOA 1E24A 1SE3A 1YNNC 2JN4A 4YWLA 4BA2I 3S9WA 1W6JA 3IFDA 2F1MA 2F03A 1VQNA 3K5LA 3JAMi 4JBJA 2ZM6Q 4IPCA 2FMMA 5JOBA 2I46A 4UHVA 1WOCA 4ZK9B 1G2TA 4L5RC 1SYBA 3V05A 4ZKCB 4DR3L 3X3MA 3T51B 4BWGB 1Q8IA 3E5SA 2JA6G 3RUZA 4APVA 4IPGA 2XRQD 4CDEC 1G6ZA 1WCMG 3LNNA 2F3WA 4AQYQ 1N32L 5FJ8G 1XTCD 1G6PA 3E9IA 4WFN3 2EYHA 4IOCA 4OWXB 5CBEE 2OF1A 3VYUA 1Y8OB 3J7YW 3HOYH 2GVAA 2PYKA 3BDCA 1J9OA 1TS3A 4LF9L 3S14H 1QOHA 4B3MQ 2O4XA 4C3HB 1F77A 3V2TA 2CKZB 4XQJA 1N33Q 2K5WA 1XX8A 2OTJA 4DV0L 4L5TA 4J6HA 4LF7Q 1TR5A 2MHVA 3ULJA 2XNAC 3OOCA 2N8NA 2EIFA 1IBLL 5DAUA 3R93A 1PA6A 1PTOF 1SEBD 4LWCA 3OHXC 2FMCA 2YTXA 4HJ7A 1SYEA 1QZHA 4JI3L 3H6MA 1Y1VG 1VCIA 2IJ0A 5HURA 4OO1I 1TY2A 2N88A 1H9RA 2IY5B 1KDBA 1K8OA 1KABA 2KHJA 1AN8A 2MO0A 2NBFA 2CW0D 3STBD 4HJ5A 2QEJC 4OIKA 1WTQA 4RFBA 4N9PA 1D2BA 4DXFA 1W6KA 1XNQQ 4QMGA 3I4MB 1UE1A 4K8IA 3JC66 1F2YA 1Y1VB 2RDGA 1HH2P 4B3RL 5M5XB 1A8VA 4NXML 3FPPA 4C2MB 4B3TL 2F0MA 3SR1A 4A3DG 1FD7D 1JOQA 1VMPA 5GAHC 2JA8G 3NBHA 3HEJA 1VMCA 4X65L 4JI8Q 1I50B 3CC7A 1WI5A 1EIFA 1JJGA 5C5LA 2WB1G 3H94A 5M5YB 1YNXA 1PRTB 4GNXB 4IOAA 3K58A 1HPCA 2OT2A 2AQ2B 1S5FD 3OWEB 2E5LQ 4DR4L 2E2DC 4A3IB 3K80C 2JA8B 2VY3A 2KHIA 4KKTA 3STBC 4K14A 4FF4A 1SNCA 4EQNA 2OEOA 4FNFA 1B3AA 1X56A 3H3VC 3M3YB 1X3PA 2Q2UA 3D4WA 3DM3A 2MO1A 3MXNB 3FRPB 5LL6X 5ELOA 1G2SA 3Q6SA 4HJ8A 1A3UA 1HNXQ 3BYYB 5FKAC 5M5XH 5J1ZA 2ZJPA 3FKIB 2R7ZB 2ZM6L 3GQBA 2EOTA 3R2TA 3OIQA 3FMCA 1FVIA 2NB0A 4J8QA 1QILA 3I55A 4R4CA 2O2LD 2YU9B 4BY7H 5C0XG 5J39A 1X65A 5JEAG 3DEPA 1SRUA 4IUUA 1B4OA 5C44B 5LL6S 2PO4A 1H9SA 5ELDA 1SJED 4K5WA 3D4RA 4HIMA 3N6RA 1UWVA 1EUJA 2LMCB 4AQYL 4ALPA 2JSOA 1SNDA 4A3IH 4CDFC 4GS3A 1OO9B 2BOSA 1TXYA 3K0XA 4C1NK 3EROA 2KVMA 2B2WC 2DN8A 2EZVA 1IBMQ 3HOZH 1KD1C 4B3ML 2L4NA 3F1ZA 3M7NA 4X3SA 4QL5A 4K8JA 4JK1C 5T1IA 4O1NA 5CGKA 2QILA 1N33L 1EY7A 3J80L 1GOZA 1MI2A 4LF7L 3FKIH 3UI2A 2R7ZH 3J81L 1ASZA 1L1OC 2BE5C 1STHA 1CK1A 5ELCA 5JPNC 1OXSC 3T1HQ 2Q2HA 3TZUA 2UXCQ 4PG3A 3HOVG 2I5MX 1SR3A 2NVQH 4QJFA 1K9MC 3C46A 5C44H 2E2HH 2Y0SE 2QF7A 2B2YC 1JB7A 4JI7Q 3NPPA 5CV4A 3D6CA 5C4JH 4C3JG 1HZ9A 3S1QB 2EPBA 1D7QA 4JI2Q 4FXDA 4OEMB 2F0WA 2Z6KC 4PZ6A 1LT6D 2ICEC 4J15A 3KJPA 4BBSG 3CCJA 5E7NA 1EY0A 5EBDA 2EJFC 4IURA 3T1YQ 5C4HA 3HOVB 1EEFD 1XNQL 1STEA 4YWMA 1RJTA 4DK6C 3OMCA 2EYMA 1EIYB 1JWSD 3EQLC 3W1GA 4KKUA 4OL7A 1SNQA 3KYHC 3PSIA 2LXKA 1BDOA 3G6JB 1WD1A 2B2VC 1BBXC 4L63B 1O7IA 1GXDC 2D9UA 4P74A 4DR5Q 2NTSA 4JI8L 3ZJYC 4HTHA 5E3FA 1ZXTA 1BCPD 1FNVA 1K3RA 1U4LA 4DNRB 2M2LA 2NZ1D 3NHHA 2GVBA 1N36Q 3A8KE 4DR1Q 3S15B 2L1BA 1LYLA 3S1QH 1HZCA 4PNYA 2E5LL 4V190 1YJ9A 3LX0A 2K6AA 1ET6A 2RDFA 4GOPC 5FLMH 5H1SE 3S1RB 1EZ6A 2EYJA 1N34Q 1I3QB 2DY8A 4PV1C 1NAPA 4YWKA 3R8BA 1Q46A 3PUZA 5K36H 4LFCQ 4DV6Q 1JWUD 4G7OC 2K75A 3M4QA 2Z9HA 1EQTA 4FF2A 1Z6HA 4X62Q 4CJ2C 1PRTF 5IGBA 2H1EA 1QUQB 4GNXA 4OO1G 4A3GG 1FNUA 2LY7A 3KF6A 4GKKL 2A19A 1SMYD 3G7LA 3PF5A 3TRZA 3TBIB 1K83B
chains in the Genus database with same CATH topology
2XTIA 4OONA 4BBRG 3J7ZC 1YI2A 1VQDA 4BY1H 3CQZH 2R7FA 3GD7A 1KHIA 4OXPA 4LFBQ 1EYGA 4R4TA 5GAGC 2UXDL 4EX5A 2N3SA 4AH6A 1HR0L 1MKHA 4PZ8A 1JMCA 2VS1A 1UE7A 1L1OB 4JBWA 1NMGA 5M3MG 4X64L 1OTCA 2JA5G 3BU2A 2E8GA 3KOJA 4P71A 1K8AC 2CQOA 2JEBI 1QVGA 1RIPA 2RHQB 3CP0A 3UE1A 2ASBA 1J5EQ 2B63G 1XPUA 1M1KC 4DV2Q 4QIWE 3J7A5 2N78A 1N32Q 3I2ZA 2NZOA 2UU9Q 1GKHA 4IJHA 3U4VA 4JI1L 1EQQA 4KHZA 2MNAA 1I3QH 1IBML 5IYDH 4A3MG 3A74A 1QUQA 3K7AH 1K8GA 1X3FA 4X66L 1ASYA 5FLXc 3HKZE 2QEXA 4LF9Q 5IT9c 1PYSB 4O2DA 5ELNA 2JA9A 3FP9A 1Y14B 2MQHA 5IYBH 5JJKA 4JBMA 1NBWA 1VQCA 1XNRL 5LMNW 2AWNA 1E22A 5FLMG 3CPWA 1YIJA 4JI0L 3S2HH 2VL6A 1X6OA 2K50A 4A3JH 3HOUG 4NB3A 4JI4Q 1VQPA 2ZTCA 1XMOL 1MJEA 4OWWB 5K36G 1EOVA 1TWHH 4QY7A 1KL9A 1AE3A 2VW9A 3T1HL 3I4NG 3PO2H 1IBLQ 4K0KQ 2UXCL 1X55A 2WB1E 3H0GH 1R9TH 3CC2A 1IL2A 4KHPQ 1E1OA 3U50C 5C4XH 3K81C 4LF5L 3CCEA 4DUZQ 1VQIA 4O0AA 3G6EA 3UDFA 3K8AA 3ERSX 3OYYA 3HOXH 4JI7L 4HIOA 5BR8L 2K4KA 1G291 2VQEL 4DR7L 4LNQA 1NE3A 4LUVA 2R6GA 2R92G 4DAYB 4DV1L 4A3LG 4JI2L 3DLLA 5LMNQ 4JC0A 1YVCA 1KIXA 3PV0A 2UUBL 1VQ5A 4NXNQ 3K7UC 1V1QA 1I5FA 3L7ZC 1WFQA 2AMCB 3NBHB 4BY1G 2QGQA 4UP9A 5C0XI 1U0LA 1AE2A 3NELA 4YCWA 1UE5A 2MFIA 4XTCS 5IYCG 3T1YL 4TQUS 2ZJRA 4GN3B 2NVXH 2Z6KA 4DV4Q 1XMQQ 3KF8B 2IT1A 2IHEA 3W5OA 1MIUA 3KDFB 1IZ6A 1UEBA 3PUYA 1W3SA 3AEVA 3AFPA 2LXJA 1MJCA 2A8VA 2QA4A 3RNUA 1J6QA 1G51A 4LUOA 5IP7G 2JA6H 1VQ8A 1YEZA 2WP8J 5IP9H 2RHSB 3B6YA 4UPAA 4GOPB 4NXMQ 4B3RQ 3CW2C 3GDEA 4A3KH 3ULLA 4C3HH 2GN5A 3OTOQ 1AH9A 5IYDG 1WCMH 4XIGS 3HKZG 3FHWA 4B3TQ 1JJCB 4DR5L 4IFDG 2YTYA 1BBUA 2R7DA 5FJ8H 1OXXK 5M5WH 4P73A 1YBYA 2CWAA 5IYBG 2JA7H 1WJJA 4X65Q 4OWTB 1YJWA 1KC8C 1E1TA 4R4QA 4DV5L 2DUDA 4A76A 4DR1L 1N36L 3CD6A 1VQMA 2PMZE 4DK3C 5GQOA 4A3JG 2D62A 1VQBA 2OCEA 1NJIC 2I5HA 2Y0SG 4LFAQ 1YHQA 3PO2G 3JAMc 1PYBA 1Y1WH 5IWAQ 1TWFH 3H0GG 4A3EH 4DR4Q 3RR5A 3PIOA 4DKAC 4DR2Q 3NEMA 3PIPA 1K73C 4LFAL 5C4XG 5LMUQ 3CXCA 2D0OA 1N34L 4WJ3M 3HOXG 1GD7A 2B29A 1KRSA 4LFCL 4GOPA 4DV6L 1GM5A 5LMUL 1VQHA 4JOIC 3CMAA 1HNZL 3MEFA 2F52A 1S72A 2VZAA 4RG1A 4TVAB 4LUZA 1LUZA 1YHAA 1Q86C 1GVPA 1E24A 4X62L 2L15A 4A3BH 1YHBA 4YHHQ 3I4MH 2HQLA 3L2PA 4YWLA 4BA2I 1Y1VH 1OXTA 2KBNA 1BVSA 4GNXC 1X9NA 1VQNA 1KAWA 3JAMi 4JBJA 4DR3Q 1VQ9A 3KLWA 2ZM6Q 2YTVA 2ZTEA 4IPCA 3H3VI 1C0AA 1C9OA 1CKMA 1WOCA 2F3IA 4L5RC 4C2MH 1RL2A 4DR3L 1SLJA 1C7YA 2IX0A 3RLFA 2OQ0A 4IPHA 3S2DH 4LFBL 2BA0A 3RN5A 4A93G 2JA6G 4DUYQ 3GO5A 5IP9G 4APVA 4P72A 4A3KG 4IPGA 1PHJA 1M90C 1I50H 1EQRA 1Z47A 3PO3H 1WCMG 2RF4A 1J5EL 1NMFA 4DV2L 4AQYQ 1N32L 3ULPA 5FJ8G 2N49A 3IRBA 5M5YH 3AFQA 3E9IA 1G6PA 4NPSA 2UU9L 1BKBA 2K5HA 3CCSA 2JA7G 2JEAI 1L0WA 4LF8Q 4YCVA 4IOCA 4OX9Q 2NN6G 1CSPA 3A5ZB 4OWXB 4DPGA 2R93H 1HZBA 5GROA 4A3DH 3HOYH 2CWPA 2GVAA 2E2JH 3A0JA 4LF9L 3S14H 2JA8H 3CCVA 4LF6Q 4B3MQ 1PH5A 1V9PA 1K0RA 1NTGA 4POFA 4DV0Q 2CKZB 4A3EG 1T9HA 5C3EH 2JK8A 3M3YH 1CKOA 1EWIA 1PFSA 1TWAH 1PV4A 1N33Q 2OTJA 2WFWA 1L1OA 1SE8A 4L5TA 4DV0L 4JI4L 1PH7A 4LF7Q 4POGA 2VQFQ 3ULJA 3WWVA 4HIDA 2JE6I 1IBKQ 2HT1A 2N8NA 2EIFA 1IBLL 4K0KL 4KHPL 1FJGQ 1PA6A 4DUZL 4LWCA 4JI3Q 4A3FH 2YTXA 4IJLA 4HJ7A 4HJ9A 4KI0A 4GLAC 2C35B 2NVYH 1QZHA 3I7FA 1FJGL 4JYAQ 2HIVA 2PI2A 4JI5Q 4JI3L 1V43A 2BH8A 2YU9H 1Y1VG 1VCIA 2OQKA 2WAQE 1P8LA 2ALYB 1QVCA 4OO1I 4AYBE 5LMNL 2Q2IA 1VQOA 3EN2A 4NXNL 3KFUA 1XJVA 2LSSA 5JJLA 4IFDJ 1BBWA 2IY5B 3BZCA 3F2DA 1YZ6A 2KHJA 2MO0A 1I94Q 3STBD 1HJPA 5DLQE 4DV4L 4HJ5A 1XMQL 3PCOB 1XPRA 1QZGA 4PZ7A 1N8RC 3GTOH 4LF4Q 1I94L 1XNQQ 4X6AH 1UE1A 3JC66 3PO3G 4DV3Q 4UP8A 3PF4A 1N9WA 2UUCQ 1A62A 1HH2P 4B3RL 4NXML 1A8VA 1Q8KA 2PQAB 1LTLA 4GN4B 3BZKA 4JG2A 4L5QA 3OTOL 5AJ3Q 4B3TL 1LM0A 3PUWA 1VS0A 1Z9FA 1L2FA 2R93G 5GAEC 4A3DG 3GTPH 3HOYG 3UDIA 2B3GA 4BA1I 5IY0A 1PVOA 5GAHC 1IXRA 2JA8G 3F8TA 4MNOA 4DV7Q 4X65L 3J81j 3GTMH 4JI8Q 3CC7A 1WI5A 1Q7YC 3S1NH 3D31A 2VUMH 1EIFA 2JJQA 1JJGA 2K5VA 3HFZB 2WB1G 5C3EG 4DV7L 1KQSA 2UXBQ 1Q12A 3KDFA 1YNXA 3TREA 4GNXB 4PMWA 1UE6A 3CMEA 4IOAA 4YY3Q 3EBEA 5IWAL 2EXDA 2E5LQ 4DR2L 1JE5A 4DR4L 3F2CA 1P16A 1U5KA 2KENA 3K80C 4GN5A 4YY3L 3GTJH 4JI6Q 3E9HA 3S1MH 3I56A 3M4PA 4A3FG 2VY3A 2KHIA 2F4VQ 4C3IH 1OXUA 1KRTA 4Y52H 1YJNA 3STBC 1VQ7A 1TWCH 3CCRA 1NY4A 2YYZA 4DR6Q 4JV5Q 3AYHB 1X56A 1H95A 2UUAQ 2Q2UA 3DM3A 3MXNB 2MO1A 5JJIA 4LW1A 4JBKA 5HGQA 5ELOA 1GO3E 1VQ4A 3HOVH 2RCNA 2BH2A 4JOIA 4YCUA 4HJ8A 4YHHL 2I0QA 2Q2TA 1HNXQ 5M5XH 2AKWB 2DGYA 2ZJPA 2D0PA 2PNHA 3U4ZA 2CCZA 4DAMA 1CKNB 2ZM6L 3RN2A 5HY6A 1HNXL 3PGZA 4C3JH 1FVIA 4HIKA 1Q1EA 3I55A 4R4CA 1PH1A 4B3SQ 3CCLA 3HOWH 2K14A 4BY7H 5C0XG 2NVTH 4BBSH 1SFOH 1X65A 5JEAG 4DUYL 1CSQA 1SRUA 2ID0A 1A63A 1X3EA 1VQKA 3CCQA 3H3VH 5GADC 2UXDQ 3UDXA 4ME3A 2K52A 4HIMA 3PUVA 1HR0Q 1SMXA 1UWVA 3D0FA 5IYCH 1EUJA 1IYJB 4R4IA 4X64Q 1VQ6A 4AQYL 4ALPA 4JCVE 3ER0A 4A4IA 3NENA 4IFDI 3S15H 4A3IH 4LF8L 1WYDA 2VUMG 4OX9L 4GS3A 1S40A 2HHHQ 4RMFA 1TXYA 3K0XA 4IPDA 5IP7H 1XTDA 3BJUA 2ZJQA 2FXQA 4UP7A 4JI1Q 1Y1WG 2HHHL 2A1AA 3UE0A 1IBMQ 1CKNA 4LF6L 1KD1C 4B3ML 3HOZH 3S16H 3S1RH 3SGIA 3F1ZA 4X66Q 3M7NA 2IX1A 1I6HH 1X54A 4QL5A 2CFMA 1N33L 3GTGH 4DNIA 1XNRQ 4A3CH 4HJAA 4JI0Q 3FKIH 4LF7L 2VQFL 2R7ZH 1ASZA 1L1OC 1IBKL 3E0EA 4L5SA 2E2IH 4A3BG 2EQSA 1XMOQ 3I4MG 4WJ4A 1OXSC 4AIMA 3T1HQ 1VQAA 2Q2HA 2UXCQ 4PG3A 3HOVG 2I5MX 4JYAL 4LF5Q 1SR3A 2NZHA 4JI5L 2NVQH 4QQBX 4QJFA 1K9MC 2XGTA 5C44H 1D8LA 1K83H 3RLOA 5M3FH 1YITA 2Y0SE 3W1BA 2E2HH 2KCTA 1JB7A 4JI7Q 4BXXH 5BR8Q 3TS0A 1JJ2A 4IO9A 5C4JH 3F2BA 2VQEQ 1HZ9A 3CF5A 1PH4A 3GTQH 4DR7Q 3L0OA 1E7ZA 1D7QA 4FDBA 3J80c 4JI2Q 4DV1Q 1PH2A 1VQGA 2UUBQ 3HOWG 2Z6KC 4PZ6A 4BY7G 3J81c 1OXVA 4J15A 4BBSG 3KJPA 3OW2A 3CCJA 5E7NA 3U58A 2H5XA 1XPOA 1Q81C 3CCMA 1B7YB 3CC4A 3T1YQ 4A3GH 4LF4L 3S17H 3KJOA 1HNWQ 3TS2A 1XNQL 1KXLA 3GTKH 1B8AA 1PH8A 4YWMA 4DK6C 4DV3L 3G48A 1EIYB 4BBRH 1X3GA 5IE8A 1Q82C 1HNWL 2UUCL 3I4OA 1DGSA 3W1GA 4A75A 2YV5A 3M4OH 3EIVA 4A3IG 1HZAA 2ATWA 2PI2E 1PH3A 3KYHC 2BA1A 2LXKA 3PSIA 5J3BA 3J80i 5AJ3L 4EQ5A 2OWOA 5M3MH 4A93H 3J81i 2NN6I 2JA5H 4UY8C 2VNUD 5EAYA 3TQYA 3HOZG 1O7IA 3RZOH 4P74A 3RZDH 4DR5Q 4MTNA 4JI8L 3S24A 3A5UA 3ZJYC 3H15A 1PH6A 2B63H 3M85A 3AQQA 2IHFA 3KF6B 4H02A 1K3RA 1QVFA 2UXBL 1FL0A 1SN8A 3RLNA 2KCMA 2K5NA 2GVBA 2OTLA 4A3CG 1S3OA 4A3MH 1VQEA 3FKIG 4DV5Q 4DR1Q 1N36Q 2R7ZG 2ES2A 4P75A 1LYLA 4R4OA 2AWOA 1VQFA 2I5LX 1HZCA 3S1QH 1PH9A 2E5LL 4JI6L 2WAQG 4GLVB 5C0XJ 1YJ9A 3ICEA 4AYBG 1JT8A 5JEAJ 3PUXA 2PQAA 4GLXA 3UDGA 4GOPC 2F4VL 3G71A 2AHOB 2ZTDA 5FLMH 5H1SE 3TEHB 4QGUA 3GTLH 3M9BA 4MZ9A 3VDYA 3HOUH 1VQJA 5C44G 5M3FG 3CAMA 4Y7NH 1FGUA 1N34Q 4DR6L 4YWKA 4JV5L 1Q46A 3PUZA 4BXXG 3HKSA 2UUAL 3G4SA 1HR0W 4DV6Q 1W2BA 1EFWA 4LFCQ 3I4NH 2K75A 1HNZQ 2HIXA 2Z0SA 3M4QA 3Q8DA 3CPFA 3LGJA 4X62Q 4GKKQ 4GKJQ 1VQLA 1SROA 1A0IA 1QUQB 1Q1BA 1E3PA 4GNXA 3KF6A 4A3GG 4GKKL 1TWGH 4GKJL 1B70B 4OO1G 1CUKA 2A19A 4KLKA 2R92H 4A3LH 4B3SL 4R1JA 2JQOA 2V1CC 3PF5A 3TRZA 3CCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTI A;  4OON A;  4BBR G;  3J7Z C;  1YI2 A;  1VQD A;  4BY1 H;  3CQZ H;  2R7F A;  3GD7 A;  1KHI A;  4OXP A;  4LFB Q;  1EYG A;  4R4T A;  5GAG C;  2UXD L;  4EX5 A;  2N3S A;  4AH6 A;  1HR0 L;  1MKH A;  4PZ8 A;  1JMC A;  2VS1 A;  1UE7 A;  1L1O B;  4JBW A;  1NMG A;  5M3M G;  4X64 L;  1OTC A;  2JA5 G;  3BU2 A;  2E8G A;  3KOJ A;  4P71 A;  1K8A C;  2CQO A;  2JEB I;  1QVG A;  1RIP A;  2RHQ B;  3CP0 A;  3UE1 A;  2ASB A;  1J5E Q;  2B63 G;  1XPU A;  1M1K C;  4DV2 Q;  4QIW E;  3J7A 5;  2N78 A;  1N32 Q;  3I2Z A;  2NZO A;  2UU9 Q;  1GKH A;  4IJH A;  3U4V A;  4JI1 L;  1EQQ A;  4KHZ A;  2MNA A;  1I3Q H;  1IBM L;  5IYD H;  4A3M G;  3A74 A;  1QUQ A;  3K7A H;  1K8G A;  1X3F A;  4X66 L;  1ASY A;  5FLX c;  3HKZ E;  2QEX A;  4LF9 Q;  5IT9 c;  1PYS B;  4O2D A;  5ELN A;  2JA9 A;  3FP9 A;  1Y14 B;  2MQH A;  5IYB H;  5JJK A;  4JBM A;  1NBW A;  1VQC A;  1XNR L;  5LMN W;  2AWN A;  1E22 A;  5FLM G;  3CPW A;  1YIJ A;  4JI0 L;  3S2H H;  2VL6 A;  1X6O A;  2K50 A;  4A3J H;  3HOU G;  4NB3 A;  4JI4 Q;  1VQP A;  2ZTC A;  1XMO L;  1MJE A;  4OWW B;  5K36 G;  1EOV A;  1TWH H;  4QY7 A;  1KL9 A;  1AE3 A;  2VW9 A;  3T1H L;  3I4N G;  3PO2 H;  1IBL Q;  4K0K Q;  2UXC L;  1X55 A;  2WB1 E;  3H0G H;  1R9T H;  3CC2 A;  1IL2 A;  4KHP Q;  1E1O A;  3U50 C;  5C4X H;  3K81 C;  4LF5 L;  3CCE A;  4DUZ Q;  1VQI A;  4O0A A;  3G6E A;  3UDF A;  3K8A A;  3ERS X;  3OYY A;  3HOX H;  4JI7 L;  4HIO A;  5BR8 L;  2K4K A;  1G29 1;  2VQE L;  4DR7 L;  4LNQ A;  1NE3 A;  4LUV A;  2R6G A;  2R92 G;  4DAY B;  4DV1 L;  4A3L G;  4JI2 L;  3DLL A;  5LMN Q;  4JC0 A;  1YVC A;  1KIX A;  3PV0 A;  2UUB L;  1VQ5 A;  4NXN Q;  3K7U C;  1V1Q A;  1I5F A;  3L7Z C;  1WFQ A;  2AMC B;  3NBH B;  4BY1 G;  2QGQ A;  4UP9 A;  5C0X I;  1U0L A;  1AE2 A;  3NEL A;  4YCW A;  1UE5 A;  2MFI A;  4XTC S;  5IYC G;  3T1Y L;  4TQU S;  2ZJR A;  4GN3 B;  2NVX H;  2Z6K A;  4DV4 Q;  1XMQ Q;  3KF8 B;  2IT1 A;  2IHE A;  3W5O A;  1MIU A;  3KDF B;  1IZ6 A;  1UEB A;  3PUY A;  1W3S A;  3AEV A;  3AFP A;  2LXJ A;  1MJC A;  2A8V A;  2QA4 A;  3RNU A;  1J6Q A;  1G51 A;  4LUO A;  5IP7 G;  2JA6 H;  1VQ8 A;  1YEZ A;  2WP8 J;  5IP9 H;  2RHS B;  3B6Y A;  4UPA A;  4GOP B;  4NXM Q;  4B3R Q;  3CW2 C;  3GDE A;  4A3K H;  3ULL A;  4C3H H;  2GN5 A;  3OTO Q;  1AH9 A;  5IYD G;  1WCM H;  4XIG S;  3HKZ G;  3FHW A;  4B3T Q;  1JJC B;  4DR5 L;  4IFD G;  2YTY A;  1BBU A;  2R7D A;  5FJ8 H;  1OXX K;  5M5W H;  4P73 A;  1YBY A;  2CWA A;  5IYB G;  2JA7 H;  1WJJ A;  4X65 Q;  4OWT B;  1YJW A;  1KC8 C;  1E1T A;  4R4Q A;  4DV5 L;  2DUD A;  4A76 A;  4DR1 L;  1N36 L;  3CD6 A;  1VQM A;  2PMZ E;  4DK3 C;  5GQO A;  4A3J G;  2D62 A;  1VQB A;  2OCE A;  1NJI C;  2I5H A;  2Y0S G;  4LFA Q;  1YHQ A;  3PO2 G;  3JAM c;  1PYB A;  1Y1W H;  5IWA Q;  1TWF H;  3H0G G;  4A3E H;  4DR4 Q;  3RR5 A;  3PIO A;  4DKA C;  4DR2 Q;  3NEM A;  3PIP A;  1K73 C;  4LFA L;  5C4X G;  5LMU Q;  3CXC A;  2D0O A;  1N34 L;  4WJ3 M;  3HOX G;  1GD7 A;  2B29 A;  1KRS A;  4LFC L;  4GOP A;  4DV6 L;  1GM5 A;  5LMU L;  1VQH A;  4JOI C;  3CMA A;  1HNZ L;  3MEF A;  2F52 A;  1S72 A;  2VZA A;  4RG1 A;  4TVA B;  4LUZ A;  1LUZ A;  1YHA A;  1Q86 C;  1GVP A;  1E24 A;  4X62 L;  2L15 A;  4A3B H;  1YHB A;  4YHH Q;  3I4M H;  2HQL A;  3L2P A;  4YWL A;  4BA2 I;  1Y1V H;  1OXT A;  2KBN A;  1BVS A;  4GNX C;  1X9N A;  1VQN A;  1KAW A;  3JAM i;  4JBJ A;  4DR3 Q;  1VQ9 A;  3KLW A;  2ZM6 Q;  2YTV A;  2ZTE A;  4IPC A;  3H3V I;  1C0A A;  1C9O A;  1CKM A;  1WOC A;  2F3I A;  4L5R C;  4C2M H;  1RL2 A;  4DR3 L;  1SLJ A;  1C7Y A;  2IX0 A;  3RLF A;  2OQ0 A;  4IPH A;  3S2D H;  4LFB L;  2BA0 A;  3RN5 A;  4A93 G;  2JA6 G;  4DUY Q;  3GO5 A;  5IP9 G;  4APV A;  4P72 A;  4A3K G;  4IPG A;  1PHJ A;  1M90 C;  1I50 H;  1EQR A;  1Z47 A;  3PO3 H;  1WCM G;  2RF4 A;  1J5E L;  1NMF A;  4DV2 L;  4AQY Q;  1N32 L;  3ULP A;  5FJ8 G;  2N49 A;  3IRB A;  5M5Y H;  3AFQ A;  3E9I A;  1G6P A;  4NPS A;  2UU9 L;  1BKB A;  2K5H A;  3CCS A;  2JA7 G;  2JEA I;  1L0W A;  4LF8 Q;  4YCV A;  4IOC A;  4OX9 Q;  2NN6 G;  1CSP A;  3A5Z B;  4OWX B;  4DPG A;  2R93 H;  1HZB A;  5GRO A;  4A3D H;  3HOY H;  2CWP A;  2GVA A;  2E2J H;  3A0J A;  4LF9 L;  3S14 H;  2JA8 H;  3CCV A;  4LF6 Q;  4B3M Q;  1PH5 A;  1V9P A;  1K0R A;  1NTG A;  4POF A;  4DV0 Q;  2CKZ B;  4A3E G;  1T9H A;  5C3E H;  2JK8 A;  3M3Y H;  1CKO A;  1EWI A;  1PFS A;  1TWA H;  1PV4 A;  1N33 Q;  2OTJ A;  2WFW A;  1L1O A;  1SE8 A;  4L5T A;  4DV0 L;  4JI4 L;  1PH7 A;  4LF7 Q;  4POG A;  2VQF Q;  3ULJ A;  3WWV A;  4HID A;  2JE6 I;  1IBK Q;  2HT1 A;  2N8N A;  2EIF A;  1IBL L;  4K0K L;  4KHP L;  1FJG Q;  1PA6 A;  4DUZ L;  4LWC A;  4JI3 Q;  4A3F H;  2YTX A;  4IJL A;  4HJ7 A;  4HJ9 A;  4KI0 A;  4GLA C;  2C35 B;  2NVY H;  1QZH A;  3I7F A;  1FJG L;  4JYA Q;  2HIV A;  2PI2 A;  4JI5 Q;  4JI3 L;  1V43 A;  2BH8 A;  2YU9 H;  1Y1V G;  1VCI A;  2OQK A;  2WAQ E;  1P8L A;  2ALY B;  1QVC A;  4OO1 I;  4AYB E;  5LMN L;  2Q2I A;  1VQO A;  3EN2 A;  4NXN L;  3KFU A;  1XJV A;  2LSS A;  5JJL A;  4IFD J;  1BBW A;  2IY5 B;  3BZC A;  3F2D A;  1YZ6 A;  2KHJ A;  2MO0 A;  1I94 Q;  3STB D;  1HJP A;  5DLQ E;  4DV4 L;  4HJ5 A;  1XMQ L;  3PCO B;  1XPR A;  1QZG A;  4PZ7 A;  1N8R C;  3GTO H;  4LF4 Q;  1I94 L;  1XNQ Q;  4X6A H;  1UE1 A;  3JC6 6;  3PO3 G;  4DV3 Q;  4UP8 A;  3PF4 A;  1N9W A;  2UUC Q;  1A62 A;  1HH2 P;  4B3R L;  4NXM L;  1A8V A;  1Q8K A;  2PQA B;  1LTL A;  4GN4 B;  3BZK A;  4JG2 A;  4L5Q A;  3OTO L;  5AJ3 Q;  4B3T L;  1LM0 A;  3PUW A;  1VS0 A;  1Z9F A;  1L2F A;  2R93 G;  5GAE C;  4A3D G;  3GTP H;  3HOY G;  3UDI A;  2B3G A;  4BA1 I;  5IY0 A;  1PVO A;  5GAH C;  1IXR A;  2JA8 G;  3F8T A;  4MNO A;  4DV7 Q;  4X65 L;  3J81 j;  3GTM H;  4JI8 Q;  3CC7 A;  1WI5 A;  1Q7Y C;  3S1N H;  3D31 A;  2VUM H;  1EIF A;  2JJQ A;  1JJG A;  2K5V A;  3HFZ B;  2WB1 G;  5C3E G;  4DV7 L;  1KQS A;  2UXB Q;  1Q12 A;  3KDF A;  1YNX A;  3TRE A;  4GNX B;  4PMW A;  1UE6 A;  3CME A;  4IOA A;  4YY3 Q;  3EBE A;  5IWA L;  2EXD A;  2E5L Q;  4DR2 L;  1JE5 A;  4DR4 L;  3F2C A;  1P16 A;  1U5K A;  2KEN A;  3K80 C;  4GN5 A;  4YY3 L;  3GTJ H;  4JI6 Q;  3E9H A;  3S1M H;  3I56 A;  3M4P A;  4A3F G;  2VY3 A;  2KHI A;  2F4V Q;  4C3I H;  1OXU A;  1KRT A;  4Y52 H;  1YJN A;  3STB C;  1VQ7 A;  1TWC H;  3CCR A;  1NY4 A;  2YYZ A;  4DR6 Q;  4JV5 Q;  3AYH B;  1X56 A;  1H95 A;  2UUA Q;  2Q2U A;  3DM3 A;  3MXN B;  2MO1 A;  5JJI A;  4LW1 A;  4JBK A;  5HGQ A;  5ELO A;  1GO3 E;  1VQ4 A;  3HOV H;  2RCN A;  2BH2 A;  4JOI A;  4YCU A;  4HJ8 A;  4YHH L;  2I0Q A;  2Q2T A;  1HNX Q;  5M5X H;  2AKW B;  2DGY A;  2ZJP A;  2D0P A;  2PNH A;  3U4Z A;  2CCZ A;  4DAM A;  1CKN B;  2ZM6 L;  3RN2 A;  5HY6 A;  1HNX L;  3PGZ A;  4C3J H;  1FVI A;  4HIK A;  1Q1E A;  3I55 A;  4R4C A;  1PH1 A;  4B3S Q;  3CCL A;  3HOW H;  2K14 A;  4BY7 H;  5C0X G;  2NVT H;  4BBS H;  1SFO H;  1X65 A;  5JEA G;  4DUY L;  1CSQ A;  1SRU A;  2ID0 A;  1A63 A;  1X3E A;  1VQK A;  3CCQ A;  3H3V H;  5GAD C;  2UXD Q;  3UDX A;  4ME3 A;  2K52 A;  4HIM A;  3PUV A;  1HR0 Q;  1SMX A;  1UWV A;  3D0F A;  5IYC H;  1EUJ A;  1IYJ B;  4R4I A;  4X64 Q;  1VQ6 A;  4AQY L;  4ALP A;  4JCV E;  3ER0 A;  4A4I A;  3NEN A;  4IFD I;  3S15 H;  4A3I H;  4LF8 L;  1WYD A;  2VUM G;  4OX9 L;  4GS3 A;  1S40 A;  2HHH Q;  4RMF A;  1TXY A;  3K0X A;  4IPD A;  5IP7 H;  1XTD A;  3BJU A;  2ZJQ A;  2FXQ A;  4UP7 A;  4JI1 Q;  1Y1W G;  2HHH L;  2A1A A;  3UE0 A;  1IBM Q;  1CKN A;  4LF6 L;  1KD1 C;  4B3M L;  3HOZ H;  3S16 H;  3S1R H;  3SGI A;  3F1Z A;  4X66 Q;  3M7N A;  2IX1 A;  1I6H H;  1X54 A;  4QL5 A;  2CFM A;  1N33 L;  3GTG H;  4DNI A;  1XNR Q;  4A3C H;  4HJA A;  4JI0 Q;  3FKI H;  4LF7 L;  2VQF L;  2R7Z H;  1ASZ A;  1L1O C;  1IBK L;  3E0E A;  4L5S A;  2E2I H;  4A3B G;  2EQS A;  1XMO Q;  3I4M G;  4WJ4 A;  1OXS C;  4AIM A;  3T1H Q;  1VQA A;  2Q2H A;  2UXC Q;  4PG3 A;  3HOV G;  2I5M X;  4JYA L;  4LF5 Q;  1SR3 A;  2NZH A;  4JI5 L;  2NVQ H;  4QQB X;  4QJF A;  1K9M C;  2XGT A;  5C44 H;  1D8L A;  1K83 H;  3RLO A;  5M3F H;  1YIT A;  2Y0S E;  3W1B A;  2E2H H;  2KCT A;  1JB7 A;  4JI7 Q;  4BXX H;  5BR8 Q;  3TS0 A;  1JJ2 A;  4IO9 A;  5C4J H;  3F2B A;  2VQE Q;  1HZ9 A;  3CF5 A;  1PH4 A;  3GTQ H;  4DR7 Q;  3L0O A;  1E7Z A;  1D7Q A;  4FDB A;  3J80 c;  4JI2 Q;  4DV1 Q;  1PH2 A;  1VQG A;  2UUB Q;  3HOW G;  2Z6K C;  4PZ6 A;  4BY7 G;  3J81 c;  1OXV A;  4J15 A;  4BBS G;  3KJP A;  3OW2 A;  3CCJ A;  5E7N A;  3U58 A;  2H5X A;  1XPO A;  1Q81 C;  3CCM A;  1B7Y B;  3CC4 A;  3T1Y Q;  4A3G H;  4LF4 L;  3S17 H;  3KJO A;  1HNW Q;  3TS2 A;  1XNQ L;  1KXL A;  3GTK H;  1B8A A;  1PH8 A;  4YWM A;  4DK6 C;  4DV3 L;  3G48 A;  1EIY B;  4BBR H;  1X3G A;  5IE8 A;  1Q82 C;  1HNW L;  2UUC L;  3I4O A;  1DGS A;  3W1G A;  4A75 A;  2YV5 A;  3M4O H;  3EIV A;  4A3I G;  1HZA A;  2ATW A;  2PI2 E;  1PH3 A;  3KYH C;  2BA1 A;  2LXK A;  3PSI A;  5J3B A;  3J80 i;  5AJ3 L;  4EQ5 A;  2OWO A;  5M3M H;  4A93 H;  3J81 i;  2NN6 I;  2JA5 H;  4UY8 C;  2VNU D;  5EAY A;  3TQY A;  3HOZ G;  1O7I A;  3RZO H;  4P74 A;  3RZD H;  4DR5 Q;  4MTN A;  4JI8 L;  3S24 A;  3A5U A;  3ZJY C;  3H15 A;  1PH6 A;  2B63 H;  3M85 A;  3AQQ A;  2IHF A;  3KF6 B;  4H02 A;  1K3R A;  1QVF A;  2UXB L;  1FL0 A;  1SN8 A;  3RLN A;  2KCM A;  2K5N A;  2GVB A;  2OTL A;  4A3C G;  1S3O A;  4A3M H;  1VQE A;  3FKI G;  4DV5 Q;  4DR1 Q;  1N36 Q;  2R7Z G;  2ES2 A;  4P75 A;  1LYL A;  4R4O A;  2AWO A;  1VQF A;  2I5L X;  1HZC A;  3S1Q H;  1PH9 A;  2E5L L;  4JI6 L;  2WAQ G;  4GLV B;  5C0X J;  1YJ9 A;  3ICE A;  4AYB G;  1JT8 A;  5JEA J;  3PUX A;  2PQA A;  4GLX A;  3UDG A;  4GOP C;  2F4V L;  3G71 A;  2AHO B;  2ZTD A;  5FLM H;  5H1S E;  3TEH B;  4QGU A;  3GTL H;  3M9B A;  4MZ9 A;  3VDY A;  3HOU H;  1VQJ A;  5C44 G;  5M3F G;  3CAM A;  4Y7N H;  1FGU A;  1N34 Q;  4DR6 L;  4YWK A;  4JV5 L;  1Q46 A;  3PUZ A;  4BXX G;  3HKS A;  2UUA L;  3G4S A;  1HR0 W;  4DV6 Q;  1W2B A;  1EFW A;  4LFC Q;  3I4N H;  2K75 A;  1HNZ Q;  2HIX A;  2Z0S A;  3M4Q A;  3Q8D A;  3CPF A;  3LGJ A;  4X62 Q;  4GKK Q;  4GKJ Q;  1VQL A;  1SRO A;  1A0I A;  1QUQ B;  1Q1B A;  1E3P A;  4GNX A;  3KF6 A;  4A3G G;  4GKK L;  1TWG H;  4GKJ L;  1B70 B;  4OO1 G;  1CUK A;  2A19 A;  4KLK A;  2R92 H;  4A3L H;  4B3S L;  4R1J A;  2JQO A;  2V1C C;  3PF5 A;  3TRZ A;  3CCU A; 
#chains in the Genus database with same CATH topology
 1TS5 A;  5FO7 B;  1Y8P B;  1B1Z A;  1VQD A;  4BBR G;  5BN3 A;  3IAY A;  3K5O A;  1DXM A;  2R7F A;  3GD7 A;  3GTQ B;  1XXG A;  4AH6 A;  1MKH A;  4JBW A;  1QCB D;  3BU2 A;  4A3G B;  4DU9 A;  5I6W A;  2RHQ B;  3UE1 A;  2FIN B;  4HCE A;  4HED A;  4ODG A;  2N78 A;  2DNC A;  1L0Y B;  3I2Z A;  3J7A F;  1AZP A;  4BBR B;  2UU9 Q;  1DOL A;  1B50 A;  3I72 A;  2MJ8 A;  1RDP D;  1I3Q H;  1IBM L;  3M4O B;  5IYD H;  3K7A H;  1CM9 A;  3NE5 B;  5FLX c;  2JA9 A;  1E0B A;  5IYB H;  4HMI A;  4QCL A;  1WTO A;  3KLS A;  1RF2 D;  2Q8T A;  3CPW A;  3RZD B;  1CZW A;  2N55 A;  1H9K A;  4JI4 Q;  1KL9 A;  3T1H L;  1LAC A;  2UXC L;  5TSS A;  1V1P B;  2WB1 E;  2F0P A;  4ZUI A;  2F0H A;  4DUZ Q;  4FVM A;  1VQI A;  3Q0A A;  1HTL D;  2B2U C;  3ERS X;  2J4X A;  3TN2 A;  3OYY A;  3HOX H;  1WTW A;  4JI7 L;  4DNT B;  4F8M A;  1G29 1;  4LNQ A;  1F9P A;  1NE3 A;  2R92 G;  4JI2 L;  5LMN Q;  4JC0 A;  1KTK A;  3PV0 A;  3MWY W;  1FGB D;  3A8J E;  2QGQ A;  4KN7 C;  3T1Y L;  1AE2 A;  2NVX H;  2ZJR A;  1XMQ Q;  2IT1 A;  1CA5 A;  1IZ6 A;  2KEE A;  4RKL A;  1JOO A;  2EYF A;  2R92 B;  2WAC A;  4LUO A;  5IP7 G;  2B2T A;  5T1G A;  2RHS B;  1JIC A;  3JAM L;  2A74 C;  3D6W A;  4A3K H;  3ULL A;  4NW2 A;  3CQZ B;  4IUT A;  2GN5 A;  1AH9 A;  1F2L A;  4DR5 L;  2WIN B;  1DM0 B;  2WKC A;  1LT3 D;  4FP5 D;  4HR7 B;  4DAY A;  1OXX K;  5CV9 A;  1O80 A;  1WJJ A;  4NKL A;  1N36 L;  2DUD A;  4A76 A;  4DR1 L;  3CD6 A;  2PMZ E;  4A3J G;  3PO3 B;  1VQB A;  2OCE A;  3SE0 A;  2EVB A;  1NJI C;  4LFA Q;  1EFI D;  5IWA Q;  3RR5 A;  3PIO A;  4DKA C;  2A68 D;  4DR2 Q;  5C4X G;  1EYA A;  3P20 A;  1N34 L;  3AU7 A;  2B29 A;  4LFC L;  4OGQ C;  4DV6 L;  4H44 C;  1S72 A;  1S5B D;  4TVA B;  4LUZ A;  4X62 L;  2CVR A;  4A3B H;  3HG9 A;  4KJN A;  4YHH Q;  1TWH B;  2F0J A;  2HQL A;  3L2P A;  1OXT A;  1X9N A;  5C4X B;  4DR3 Q;  2ZTE A;  1C0A A;  4K6L A;  4HSP A;  2QDB A;  4HN7 A;  3RLF A;  4IPH A;  1AEX A;  3S2D H;  5KYI A;  4A93 G;  3IFT A;  4LK1 C;  4XYO A;  3K57 A;  4B08 A;  1PHJ A;  1M90 C;  3T53 B;  1Z47 A;  3PO3 H;  2K28 A;  1NMF A;  1PTO B;  3AFQ A;  3KK7 A;  2UU9 L;  1K28 A;  1BKB A;  2F0Q A;  2PQE A;  3CCS A;  2PPB C;  2JA7 G;  5KIX A;  4LF8 Q;  4YCV A;  4OX9 Q;  4DPG A;  1CSP A;  4JVZ A;  2R93 H;  4MIU A;  3DEO A;  1HZB A;  3I8Z A;  5GRO A;  1RD9 D;  2CWP A;  3SVM A;  3KBX A;  3MC0 B;  1GUN A;  1PH5 A;  1V9P A;  4CGY B;  4DV0 Q;  4A3E G;  1LTR D;  1TWA H;  1PFS A;  2LS0 1;  1SE8 A;  1RCV D;  4JI4 L;  4FO2 A;  1M8A A;  1HQR D;  1YNJ D;  2P5Z X;  4KD3 A;  2M9V A;  2PNR C;  3DWQ A;  3V96 A;  3J80 E;  3WOE A;  1B9M A;  4KHV A;  3J81 E;  4DUZ L;  3S1N B;  4JI3 Q;  3CU7 A;  4WJW A;  4KY5 A;  3Q24 A;  1E2V A;  4KI0 A;  1K0S A;  2C35 B;  2NVY H;  4KD4 A;  4JYA Q;  2HIV A;  2PI2 A;  4JI5 Q;  1Y1W B;  1ENA A;  1P8L A;  2ALY B;  5LMN L;  3VR3 A;  1JOK A;  1XJV A;  1S4Z A;  1NCV A;  2A73 B;  5IGF A;  4X3U A;  2R61 A;  3F2D A;  1I4G A;  1UUP A;  1VF7 A;  3MVV A;  1XMQ L;  3PCO B;  1XPR A;  1QZG A;  2X69 A;  4LF4 Q;  1I94 L;  1NSN S;  1V1P A;  4DV3 Q;  4UP8 A;  4TKO B;  1EQV A;  2SNS A;  4Q5V A;  4YIJ A;  1Q8K A;  2MPM A;  1L0X B;  3U9O A;  3BZK A;  4L5Q A;  2Q8I B;  4CDD C;  5AJ3 Q;  1VS0 A;  1Z9F A;  3C2P A;  3GTP H;  1EIH A;  3HOY G;  1YNJ C;  1PVO A;  2RDH A;  4X3K A;  1Q7Y C;  3S1N H;  2VUM H;  4TSS A;  2HCI A;  2K5V A;  3QOJ A;  3HFZ B;  2UXB Q;  1MSH A;  4MHE A;  1H9J A;  3TRE A;  2MGS A;  4PMW A;  1UE6 A;  3DWP A;  2MUY A;  2HQE A;  5IWA L;  5IGC A;  3NUC A;  4DR2 L;  1JE5 A;  3F2C A;  5BN5 A;  2KEN A;  3GTJ H;  4JI6 Q;  3HOY B;  4YY3 L;  1H9S B;  4RCO A;  3E9H A;  1RKN A;  3C1E A;  3FDT A;  1OXU A;  4C3I H;  1YJN A;  2KA7 A;  2TMP A;  1TWC H;  3CCR A;  4UDU C;  2YYZ A;  4DR6 Q;  4JV5 Q;  2NWG A;  1H95 A;  2UUA Q;  3AMU A;  4LW1 A;  4JBK A;  5HGQ A;  2EJM A;  1GO3 E;  3MXU A;  2RCN A;  2BH2 A;  4JOI A;  4YHH L;  3A55 A;  5COY A;  2D0P A;  5DNF A;  1HUN A;  1UEA B;  4EGV A;  4EQP A;  1EU4 A;  3PGZ A;  4S3S A;  1EIG A;  1PH1 A;  2HCC A;  4HSV A;  1LO5 D;  2NVT H;  1KNE A;  1T5X D;  4LJZ C;  4C3H G;  1CSQ A;  1Z7T A;  4OEL B;  3BG3 A;  5M3F B;  1VQK A;  3QG1 A;  3H3V H;  3BVZ A;  4IQZ A;  4ZKB B;  1LT4 D;  3I73 A;  5IYC H;  1MHW C;  4EQO A;  1HA6 A;  4DAP A;  1WTH A;  3ER0 A;  2SDF A;  1DZ1 A;  4LF8 L;  1LTI D;  3F2U A;  4OX9 L;  1U4P A;  1XTD A;  2A69 C;  4JI1 Q;  2HHH L;  1CKN A;  1ZKO A;  1CTM A;  1I6H H;  2IX1 A;  1DCZ A;  2CFM A;  3GTG H;  1RTO A;  1XNR Q;  5E1F A;  4HJA A;  1ML0 D;  3SK6 A;  1J8I A;  3OPO A;  1MGS A;  3I4M G;  4WJ4 A;  1LTT D;  1JCK B;  3FPU B;  2X6L A;  4JYA L;  4LF5 Q;  2QW7 A;  4JI5 L;  3CHB D;  3RLO A;  5M3F H;  3W1B A;  1PFM A;  2PCF B;  2KCT A;  4UAI A;  3TS0 A;  1JJ2 A;  4FDB A;  1VQG A;  2UUB Q;  1KNA A;  4BY7 G;  4C1N I;  1OXV A;  3K5M A;  4F7X A;  4PMC A;  1XPO A;  1B7Y B;  3CC4 A;  3HOU B;  1NUC A;  4LF4 L;  1D5Z C;  4TRD A;  3TS2 A;  3HP3 A;  4DV3 L;  2AQ1 B;  1Q82 C;  1UNS A;  1DGS A;  4ZUJ A;  2NUC A;  5G3L D;  2YV5 A;  5CBA E;  4A3I G;  1O78 A;  3I3C A;  1U4R A;  4NDX A;  3BYT B;  5J3B A;  5AJ3 L;  4BY7 B;  1EYC A;  4RAU C;  2F0O A;  3CRK C;  5EKL A;  4UY8 C;  3A56 A;  2F0I A;  3HOZ G;  3RZO H;  3JAM E;  1PH6 A;  4MTN A;  3A5U A;  2B63 H;  1EY8 A;  2J7Z A;  4E6I A;  2C5C A;  2IHF A;  3KF6 B;  4KY7 A;  1Y69 U;  1AP0 A;  4R9W A;  2UXB L;  1SN8 A;  3LWE A;  2KCM A;  2K5N A;  2OTL A;  4A3M H;  4DV5 Q;  3FKI G;  2R7Z G;  2ES2 A;  4P75 A;  2AWO A;  2I5L X;  4JI6 L;  4GLV B;  1PFB A;  1G91 A;  1D5M C;  2PZU A;  3HOZ B;  2ZTD A;  4ZLT F;  4QGU A;  3GTL H;  3KLS X;  3VDY A;  1HUM A;  4ZCK A;  1S5D D;  5C44 G;  3HOU H;  4Y7N H;  1I4H A;  4DR6 L;  4JV5 L;  3HKS A;  2UUA L;  1HR0 W;  1EFW A;  3VR5 A;  2HIX A;  2PZT A;  1BCP B;  2BE5 D;  3Q8D A;  1LTG D;  4GKK Q;  1Q3L A;  3OW7 A;  1XYI A;  1Q1B A;  3DMU A;  5EPJ A;  4XXE A;  1O7L A;  1AZQ A;  4KLK A;  3FVQ A;  3IKJ A;  4ZYS A;  2NVQ B;  3I91 A;  1D6E C;  3PO2 B;  3CCU A;  1LT5 D;  2E2H B;  2CH4 W;  5C3W A;  3SK8 A;  3PMF A;  1NR4 A;  5C4J B;  1DJR D;  1GUT A;  1EYG A;  5IT9 L;  3P75 A;  1I4P A;  2K7V A;  2N3S A;  2KQ3 A;  1NMG A;  2G9D A;  1DOM A;  1OTC A;  1K8A C;  1EWC A;  2A6H C;  2K5D A;  2JEB I;  3CP0 A;  4DV2 Q;  1QJO A;  4IJH A;  4ME5 A;  4JI1 L;  3SXH A;  2MNA A;  3A74 A;  1RHP A;  1KDC A;  3HKZ E;  4KV6 A;  5ELN A;  3FP9 A;  2B2W A;  1HTP A;  4JBM A;  1NBW A;  1XNR L;  5LMN W;  1YIJ A;  5FLM G;  1TY0 A;  3N52 A;  2K50 A;  4NB3 A;  5CV6 A;  1WTP A;  5K36 G;  4OWW B;  2Z8L A;  5EQ0 A;  1AE3 A;  3PO2 H;  5EPK A;  3H0G H;  3CC2 A;  1IL2 A;  1GUW A;  1E1O A;  4LF5 L;  3K81 C;  3G6E A;  4O0A A;  1DD2 A;  3UDF A;  4XT3 B;  2FHT A;  3D8G A;  3VA7 A;  2BDO A;  1EYD A;  3NTK A;  2R6G A;  4DAY B;  1MD2 D;  2EJG C;  1KIX A;  2UUB L;  4NXN Q;  1VQ5 A;  2B2Y A;  2RVL A;  1ENC A;  1WFQ A;  4UP9 A;  1U0L A;  4YCW A;  3NEL A;  1UE5 A;  2MFI A;  3OWF A;  2Z6K A;  3QO2 A;  4DV4 Q;  2IHE A;  5K5P A;  1SYD A;  2K1B A;  1BO0 A;  3KDF B;  5HGT A;  1A2T A;  4H0L C;  4RCN A;  2EYO A;  2A8V A;  2QA4 A;  3RNU A;  1J6Q A;  2WV6 D;  1YEZ A;  2LFN A;  5IP9 H;  4UPA A;  1TS4 A;  2QDL A;  4RH6 A;  5EKK A;  3OTO Q;  5IYD G;  3R2I A;  1JJC B;  5I4D A;  2YTY A;  4RGO S;  5IYB G;  1SJH D;  4NMZ A;  1YJW A;  3GP7 A;  1KC8 C;  4R4Q A;  2NN6 H;  4DV5 L;  1Y8N B;  2PW7 A;  1EL0 A;  5GQO A;  1O7Z A;  1GUS A;  3KF8 A;  2RA4 A;  3VR2 A;  3ITP A;  1PYB A;  1FYC A;  1TWF H;  1LLR D;  3K7A B;  3NEM A;  5CV5 A;  1HRJ A;  2D0O A;  4WJ3 M;  4K2K A;  3HOX G;  1KRS A;  3PIP 3;  4GOP A;  3TP8 A;  3P1H A;  1VQH A;  2F52 A;  3EJI A;  4RG1 A;  2E76 C;  3DUZ A;  2K03 A;  1GVP A;  1IKM A;  1YHB A;  3ONA B;  1BVS A;  1PRT C;  4GNX C;  1EEI D;  1KAW A;  3H3V I;  3HOX B;  2EYL A;  1ET9 A;  2IX0 A;  1C7Y A;  1EY5 A;  3RN5 A;  4DUY Q;  3GO5 A;  4FYD A;  1B2T A;  5CMD A;  4P72 A;  4A3K G;  1BCP F;  2G9H D;  3FEW X;  5EJW A;  2NVX B;  2RF4 A;  3CRL C;  2V4D A;  4ID6 A;  5L37 A;  4DV2 L;  2K5Q A;  3BZD B;  2N49 A;  1B53 A;  4NPS A;  3E0J A;  2JEA I;  3A8I E;  3A5Z B;  4QUF A;  2SNM A;  2E2J H;  1B44 D;  1PXU A;  1SE2 A;  3CCV A;  4LF6 Q;  4A3K B;  1TVX A;  2IPK D;  3SK4 A;  5ELF A;  3TP7 A;  3Q23 A;  5C3E H;  2JK8 A;  3DXJ C;  5IOD A;  1CKO A;  1EWI A;  1PV4 A;  2F4I A;  3SHL A;  2RKS A;  1PH7 A;  5I6Y A;  2EDG A;  2VQF Q;  1BOS A;  3WWV A;  1IBK Q;  2HT1 A;  1STN A;  1VDZ A;  5NUC A;  4G7H C;  4A3F H;  3TDQ A;  3C1F A;  3BS1 A;  1FJG L;  4CBV A;  1A3T A;  1VQO A;  2Q2I A;  3EN2 A;  2B2U A;  4NXN L;  3KFU A;  2LSS A;  1H9M A;  4HMJ A;  5IGG A;  3BZC A;  4IUP A;  1YZ6 A;  2EXZ A;  3TZD A;  1I94 Q;  1CFM A;  1HJP A;  4DV4 L;  3O13 A;  3T13 A;  1ENF A;  3GTO H;  4A3B B;  5IOC A;  4X6A H;  3PQI A;  3PO3 G;  4U68 A;  3PF4 A;  1A3V A;  1A62 A;  5C4Z A;  1ONL A;  2EY5 A;  4GN4 B;  1LTL A;  2HDL A;  4JG2 A;  3OTO L;  3PUW A;  3S2D B;  2R93 G;  1L2F A;  2NYZ D;  3UDI A;  5IY0 A;  3HOW B;  3HRZ C;  1IXR A;  3F8T A;  1IW7 C;  1XWE A;  1A2U A;  2C9O A;  4IUN A;  1V8Q A;  2JJQ A;  2XRS D;  2XVS A;  4DA2 A;  4DV7 L;  1KQS A;  1Q12 A;  3KDF A;  3NSW A;  5CV8 A;  2O5I C;  3CME A;  4KMU C;  4YY3 Q;  4B9X A;  3EBE A;  2EY2 A;  2R93 B;  1GHJ A;  1ROD A;  3S1M H;  3M4P A;  3I90 A;  2F0U A;  2F4V Q;  1IL8 A;  1KAA A;  3M4Y A;  2XN9 C;  2K32 A;  3AYH B;  4QF4 A;  4RGM A;  1TWA B;  1CA6 A;  4K5X A;  1SBB B;  2Q2T A;  1TKW B;  3RD4 A;  2A5H A;  1HHV A;  2AKW B;  4FXG C;  2CCZ A;  4DAM A;  4QUC A;  1CKN B;  4RKB A;  1S5E D;  1GUO A;  1Q1E A;  5C6A A;  3MFG A;  2MP1 A;  1JOR A;  2NVY B;  1U9R A;  2KEC A;  3HOW H;  2K14 A;  4M8A A;  1C4Q A;  5LHY 1;  1SFO H;  1UAP A;  2AUJ D;  4DUY L;  2ID0 A;  1A63 A;  2K04 A;  3CCQ A;  1VF5 C;  2UXD Q;  3BVM A;  3PUV A;  1BQQ T;  2H4O A;  1IYJ B;  5FK9 C;  4X64 Q;  5IT9 E;  1VQ6 A;  4QB4 A;  4JCV E;  4A4I A;  3NBI A;  1MSG A;  1I4X A;  1STB A;  3TSS A;  2VUM G;  1S40 A;  2HHH Q;  1CI3 M;  1X32 A;  4IPD A;  5IP7 H;  3GTK B;  3BJU A;  2ZJQ A;  4UP7 A;  1Y1W G;  2A1A A;  4LF6 L;  2B8F A;  3S16 H;  3SGI A;  5KNB A;  1BUV T;  4L6T B;  4XQN A;  3QIA A;  3GTP B;  4DNI A;  4A3C H;  4C3I G;  2VQF L;  4LMQ D;  1IBK L;  2VUM B;  3E0E A;  2O5J C;  2E2I H;  5JAV A;  1R4P B;  2EQS A;  1XMO Q;  4MTK A;  1VQA A;  5FOB B;  2A6E C;  4O42 A;  4PMB A;  2KED A;  2NZH A;  1GHK A;  1YIT A;  1S5C D;  2JP1 A;  3GTJ B;  1EY4 A;  4WOR A;  4BXX H;  2VQE Q;  3F2B A;  4DR7 Q;  1PZK D;  1QWY A;  3P7J A;  3VYR A;  1R4Q B;  1E7Z A;  4C3I B;  4DV1 Q;  3J80 c;  3TP5 A;  1PH2 A;  2EYP A;  4KN4 C;  1TWC B;  3NWT A;  3J81 c;  3OMG A;  4IN3 A;  2H5X A;  1C48 A;  4Q0F A;  3CCM A;  1SYC A;  1JE4 A;  1V1O A;  3EFX D;  2KCC A;  3GTK H;  1B8A A;  1PH8 A;  3NP8 A;  3HS0 C;  4R8N A;  5IE8 A;  1ESR A;  1HNW L;  2QCP X;  1HZA A;  2F0K A;  2ATW A;  2PI2 E;  4CJ0 B;  2NVT B;  2F3V A;  3NXW A;  2OWO A;  5M3M H;  4A93 H;  1ICF B;  5AFW A;  2JA5 H;  2NN6 I;  3MTS A;  2VNU D;  3TQY A;  4BY1 B;  1U4M A;  1EWH A;  3AQQ A;  4KKS A;  2HUG A;  4H02 A;  2XWJ B;  1FL0 A;  3ZYY X;  1S3O A;  1VQF A;  2CHB D;  1PH9 A;  2A69 D;  2D2C C;  2WAQ G;  4AYB G;  2Z4I A;  2PZW A;  3PUX A;  4LAA A;  1X3Q A;  2F4V L;  5KGU A;  2AHO B;  3HGB A;  3TEH B;  3M9B A;  2F0S A;  4MZ9 A;  5I9P A;  1I6H B;  3MAQ A;  3QWN A;  3CAM A;  5M3F G;  1FGU A;  2F0D A;  4FF1 A;  1W2B A;  3I4N H;  3GTG B;  4RWS C;  4G4K A;  1KDA A;  3NWS A;  5EBC A;  3LGJ A;  1VQL A;  4DN4 M;  2WAQ B;  4AYB B;  1E3P A;  3S2H B;  4GKJ L;  2K01 A;  1TWG H;  1B70 B;  2FFK B;  1CUK A;  3NK9 A;  4A3L H;  4HAE A;  2Y0S B;  4R1J A;  2JQO A;  1PTO D;  1WD0 A;  3AB9 A;  1EZ8 A;  2XTI A;  4OON A;  1YI2 A;  1HXY D;  1R9T B;  4CHT B;  4BY1 H;  2NTT A;  1II3 A;  1KHI A;  4OXP A;  4LFB Q;  5FLX L;  4R4T A;  2UXD L;  4EX5 A;  2JYO A;  1JMC A;  1FR3 A;  2VS1 A;  1L1O B;  4WRD A;  4X64 L;  4P71 A;  1IYV A;  4CKB A;  4K5V A;  1QVG A;  1XPU A;  2ASB A;  2B63 G;  1J5E Q;  4DXG A;  4CDC C;  2NZO A;  3QR8 A;  3GV6 A;  4KHZ A;  4A3M G;  1ASY A;  4IFD H;  4O2D A;  1F9S A;  3CKI B;  5KRU A;  1NNX A;  2JA6 B;  2WKD A;  1VQC A;  2XIW A;  3E3X A;  3RZO B;  1E22 A;  4DK0 A;  4DK1 A;  1B3Q A;  2B63 B;  2RSN A;  5JVH 3;  3S2H H;  2VL6 A;  3HOU G;  3ERQ A;  1F2M A;  4N8X 1;  2RBM A;  1WCM B;  2KUM A;  5JPM C;  1XMO L;  5EGT A;  1MJE A;  3BDL A;  2VW9 A;  4QY7 A;  3W2D A;  4EVO A;  4K0K Q;  1PYW D;  1PTO C;  3OIP A;  3OSO A;  1X55 A;  2SEB D;  4A3M B;  1R9T H;  1IKL A;  4IAL A;  4KHP Q;  2L5T A;  3GV3 A;  1STY A;  2FJ2 A;  4HIO A;  2K4K A;  1KLG D;  2VQE L;  4DR7 L;  4DV1 L;  1LTA D;  3TP6 A;  1I4R A;  3GTL B;  1YVC A;  1CQF A;  1DON A;  4Y7N B;  3L7Z C;  5I2X A;  3ND9 A;  4OIJ A;  4XTC S;  2DNE A;  5A35 A;  2SOB A;  5I2Y A;  3WDN A;  2IW3 A;  3KF8 B;  3W5O A;  2F0V A;  1MIU A;  1UEB A;  3PUY A;  3AFP A;  2DJG C;  3VYS A;  1PDQ A;  5D14 A;  2KJX A;  2JA6 H;  3MEH A;  1VQ8 A;  2WP8 J;  4ZQ3 A;  4GOP B;  3CW2 C;  4IZ8 A;  4RHR A;  2D5D A;  1HQM C;  4C3H H;  5C3X A;  1WCM H;  3FHW A;  1SAP A;  4XT1 B;  2L12 A;  5FJ8 H;  1YBY A;  2CWA A;  4OWT B;  2A6H D;  2L11 A;  3T4A C;  1E1T A;  1JB3 A;  5A2Q L;  4DK3 C;  1AFP A;  5FO8 B;  2D62 A;  1QNU A;  2L9H A;  2I5H A;  1YHQ A;  3PO2 G;  1JQY D;  5D3D A;  3JAM c;  2F0L A;  3J7A V;  1LTB D;  3H0G G;  3VA5 A;  1WTR A;  3CXC A;  4KTA A;  1GD7 A;  3PIO 3;  4JW0 A;  4A3D B;  4H7B A;  3CMA A;  1PFN A;  5LMU L;  1ZEQ X;  5CR3 A;  1LUZ A;  4N9T A;  2CW0 C;  2L15 A;  3QJY A;  1SNP A;  2VB2 X;  3SDZ A;  2WB1 B;  3I70 A;  3I4M H;  1Y1V H;  3H0G B;  2KBN A;  5G3L F;  1VQ9 A;  3KLW A;  1PMR A;  2YTV A;  1C9O A;  1CKM A;  2F3I A;  2K33 A;  5IGE A;  4C2M H;  1RL2 A;  2WII B;  1SLJ A;  2KOL A;  4FF3 A;  2OQ0 A;  5KYL A;  4LFB L;  2BA0 A;  4F87 A;  5IP9 G;  2CH4 A;  4F88 A;  3H09 A;  1I50 H;  2R3Z A;  1EQR A;  1J5E L;  5I9O A;  3ULP A;  3IRB A;  5M5Y H;  3SK5 A;  2K5H A;  1E2Z A;  1L0W A;  2TSS A;  2NN6 G;  3IL8 A;  1SSO A;  4CJ1 B;  5JJZ A;  4A3D H;  3A54 A;  4NP5 A;  3A0J A;  2JA8 H;  2IX3 A;  1K0R A;  1NTG A;  4POF A;  1T9H A;  5DM7 3;  3TME A;  3M3Y H;  3WOF A;  2WFW A;  1L1O A;  4B9W A;  4POG A;  1NR2 A;  4HID A;  2JE6 I;  4K0K L;  2PMZ B;  3E6Z X;  4KHP L;  2EY6 A;  1DYQ A;  2RQX A;  5F2D A;  1FJG Q;  3GTM B;  4HJ9 A;  4IJL A;  4KY6 A;  5DEH A;  4GLA C;  2ZXR A;  5ISR A;  3I7F A;  1EY9 A;  3NTH A;  1V43 A;  2BH8 A;  3BVG A;  3X3N A;  2YU9 H;  1TWF B;  1SNO A;  1JR0 D;  2I07 B;  2OQK A;  2WAQ E;  1QVC A;  4AYB E;  3MHB A;  5JJL A;  4IFD J;  4PQX A;  4G57 A;  4DGZ A;  1BBW A;  1A15 A;  3MXG A;  4N8F A;  3EVQ A;  5DLQ E;  1BF4 A;  1ESF A;  4PZ7 A;  1N8R C;  1EU3 A;  5CC4 A;  3I4L A;  3T56 B;  3DM1 A;  4XYQ A;  1PRT D;  5C0X H;  1ILQ A;  5JEA H;  1N9W A;  1WTV A;  2UUC Q;  2X6G A;  2Q8R E;  2PQA B;  1TQO A;  4C3J B;  2F0T A;  1LM0 A;  5ELB A;  2B2V A;  5GAE C;  2B3G A;  4BA1 I;  3DHQ A;  4QIW B;  4BBS B;  4MNO A;  4DV7 Q;  3J81 j;  3GTM H;  3D31 A;  4I7A A;  1QB5 D;  5C3E G;  1F9Q A;  3URY A;  3L3O C;  1QE6 A;  2PW5 A;  2QKI C;  1E2W A;  1FNW A;  2EXD A;  4RHS A;  1P16 A;  1U5K A;  4GN5 A;  2E2J B;  3I56 A;  4RGN A;  4A3F G;  3C3L A;  1KRT A;  4Y52 H;  2CQA A;  1F2Z A;  1EY6 A;  3T16 A;  4L8J A;  1VQ7 A;  1NY4 A;  1WVL A;  4R8I A;  5C3E B;  4H13 C;  2G5D A;  5JJI A;  1VQ4 A;  1ZYR D;  3HOV H;  4YCU A;  2I0Q A;  1C8C A;  2DGY A;  2PNH A;  3U4Z A;  4FXK C;  3RN2 A;  5HY6 A;  4P2C B;  3K59 A;  1HNX L;  4C3J H;  4A3F B;  1CHQ D;  4HIK A;  5D65 A;  1LAB A;  4B3S Q;  3HZX A;  3CCL A;  4V0B A;  4X3T A;  4BBS H;  2IL8 A;  1X3E A;  3K0Y A;  4CKE A;  3K5N A;  5M9O A;  5GAD C;  5ELE A;  4I65 A;  3UDX A;  1CHP D;  5JVG 3;  4ME3 A;  3DWA A;  2K52 A;  4KK7 A;  1HR0 Q;  1SMX A;  3D0F A;  5FLX E;  4R4I A;  1BCP C;  2ENB A;  3U9S A;  3GTO B;  1D5X C;  1O7Y A;  1PZJ D;  4C56 C;  3NEN A;  4IFD I;  3MXN A;  3S15 H;  5E4W C;  1WYD A;  4DF7 A;  3Q22 A;  4DAV A;  4IUV A;  1WTX A;  3S17 B;  2BDN A;  4RMF A;  1D1K A;  3M7G A;  2FXQ A;  3UE0 A;  2IWH A;  3SEB A;  3S1R H;  4X66 Q;  2B8G A;  1X54 A;  1TU2 B;  1STG A;  5EKI A;  1B9N A;  1ZYR C;  2Z6B A;  3LWU A;  1IW7 D;  4JI0 Q;  1STA A;  3VR4 A;  4XQQ A;  3D3R A;  4L5S A;  4A3B G;  4AIM A;  1F9R A;  1QG7 A;  3MFY A;  3KUP A;  1SYG A;  4QQB X;  3NTI A;  4GZY C;  1SMY C;  2XGT A;  1D8L A;  1K83 H;  1SE4 A;  3KBG A;  5BR8 Q;  3VYT A;  4IO9 A;  3S1M B;  1PH4 A;  3CF5 A;  3GTQ H;  3L0O A;  1I6V C;  3HOW G;  3VR6 A;  2EE1 A;  1Q90 A;  1JC7 A;  3OW2 A;  3U58 A;  2F0G A;  1Q81 C;  3W3A A;  4OO1 H;  3A7L A;  4A3G H;  3S17 H;  4DFA A;  3KJO A;  1HNW Q;  1KXL A;  2M00 A;  3G48 A;  1CZG A;  2B2T C;  2JXM B;  1X3G A;  4BBR H;  2E74 C;  5COR A;  2UUC L;  2XSC A;  3I4O A;  4A75 A;  1TS2 A;  2RCF A;  1I4Q A;  3NQI A;  3ND8 A;  1SDF A;  5CYU A;  3M4O H;  5J22 A;  3EIV A;  1IYU A;  4KJO A;  1PH3 A;  2BA1 A;  2J0T D;  3J80 i;  1SFO B;  2DJF C;  4EQ5 A;  3J81 i;  5EAY A;  1HA5 A;  3RZD H;  3S24 A;  3H15 A;  1G8Z D;  3M85 A;  1GJX A;  4K6D A;  1QVF A;  1TII D;  3RLN A;  1SXT A;  4A3C G;  4XDX A;  1VQE A;  1GUG A;  4R4O A;  1M4V A;  1SNM A;  2ZXO A;  5A2Q E;  2F0E A;  5C0X J;  3ICE A;  1JT8 A;  3KLR A;  5JEA J;  1K3B C;  2F0F A;  2PQA A;  4GLX A;  3UDG A;  4ILW A;  4Z9C B;  3G71 A;  3S16 B;  2Z4H A;  1VQJ A;  2KHS A;  4BXX G;  3L9A X;  3G4S A;  2AQ3 B;  4M1U B;  5BN4 A;  1HNZ Q;  2Z0S A;  2BCO A;  3CPF A;  1BNZ A;  4GKJ Q;  1T5E A;  2E2I B;  1ILP A;  1DOK A;  2A6E D;  2F0N A;  1SRO A;  1A0I A;  1MBY A;  4A3J B;  2R92 H;  1RTN A;  4B3S L;  2V1C C;  3QOL A;  4CKC A;  1CT1 D;  3J7Z C;  2ICI A;  4HCS A;  4IUQ A;  3CQZ H;  2VXW A;  2ZT9 C;  1BR9 A;  1KLU D;  4OHJ A;  5GAG C;  4U67 3;  1HR0 L;  4PZ8 A;  5C5M A;  5EPL A;  5CV7 A;  1UE7 A;  5M3M G;  2JA5 G;  1ICW A;  3KOJ A;  2E8G A;  4I7Z C;  2CQO A;  1K8M A;  1RIP A;  2LKV A;  3J7A 5;  1M1K C;  4QIW E;  1LV9 A;  4K2L A;  1N32 Q;  1GKH A;  3U4V A;  1EOT A;  1EQQ A;  2OXP A;  1QUQ A;  1SYF A;  1K8G A;  1X3F A;  4X66 L;  2A68 C;  2QEX A;  4LF9 Q;  5IT9 c;  1PYS B;  4MN3 A;  1Y14 B;  2MQH A;  3MXP A;  5JJK A;  5M3M B;  4A93 B;  2JA5 B;  4ULL A;  3MZ5 A;  2HDM A;  2AWN A;  4JI0 L;  3K6O A;  1BXT A;  3QB3 A;  4A3J H;  1X6O A;  2L55 A;  2DY7 A;  1VQP A;  2ZTC A;  5DM6 3;  1EOV A;  2KCN A;  1TWH H;  3I4N G;  3EA6 A;  1IBL Q;  1LTS D;  5M5W B;  1JWM D;  5C4X H;  3U50 C;  2JA7 B;  2L0C A;  3CCE A;  3K8A A;  5BR8 L;  1D1I A;  4LUV A;  4A3L G;  3DLL A;  4ZAI A;  3K7U C;  1V1Q A;  1I5F A;  2Z1C A;  4A3E B;  1AW7 A;  3NQT A;  2AMC B;  3RMH A;  3NBH B;  2VB3 X;  4BY1 G;  5C0X I;  3I4N B;  4RA8 A;  1HFG A;  5IYC G;  4TQU S;  4GN3 B;  4ABN A;  4G7Z C;  3R3O A;  1PTO H;  2E75 C;  2B39 A;  4ZRZ A;  3AEV A;  1W3S A;  3H91 A;  3D4D A;  4JPB W;  1YNN D;  2GA4 B;  1TWG B;  2LXJ A;  1MJC A;  1QNK A;  4BS9 A;  1G51 A;  3MA2 B;  2ZXP A;  4B3R Q;  3B6Y A;  4NXM Q;  3GDE A;  5KND A;  5IGD A;  1A6X A;  1IHZ A;  4J1M A;  4B3T Q;  4XIG S;  3HKZ G;  2RSO A;  5IIF A;  2XWB B;  5D3I B;  4IFD G;  1BBU A;  2R7D A;  5M5W H;  4P73 A;  2JA7 H;  4X65 Q;  2K05 A;  1TT2 A;  5E4X A;  1VQM A;  2HD3 A;  1CQV A;  1HFN A;  2Y0S G;  1HCZ A;  1Y1W H;  3HKZ B;  2AUK A;  4A3E H;  4DR4 Q;  3PIP A;  1K73 C;  2EY1 A;  3A7A B;  4LFA L;  5LMU Q;  1PLF A;  1PZI D;  4RGT A;  5KEE A;  1GM5 A;  5FO9 B;  5KNC A;  4JOI C;  1HNZ L;  3MEF A;  3S14 B;  2VZA A;  1YHA A;  1Q86 C;  3BDO A;  1E24 A;  1SE3 A;  1YNN C;  2JN4 A;  4YWL A;  4BA2 I;  3S9W A;  1W6J A;  3IFD A;  2F1M A;  2F03 A;  1VQN A;  3K5L A;  3JAM i;  4JBJ A;  2ZM6 Q;  4IPC A;  2FMM A;  5JOB A;  2I46 A;  4UHV A;  1WOC A;  4ZK9 B;  1G2T A;  4L5R C;  1SYB A;  3V05 A;  4ZKC B;  4DR3 L;  3X3M A;  3T51 B;  4BWG B;  1Q8I A;  3E5S A;  2JA6 G;  3RUZ A;  4APV A;  4IPG A;  2XRQ D;  4CDE C;  1G6Z A;  1WCM G;  3LNN A;  2F3W A;  4AQY Q;  1N32 L;  5FJ8 G;  1XTC D;  1G6P A;  3E9I A;  4WFN 3;  2EYH A;  4IOC A;  4OWX B;  5CBE E;  2OF1 A;  3VYU A;  1Y8O B;  3J7Y W;  3HOY H;  2GVA A;  2PYK A;  3BDC A;  1J9O A;  1TS3 A;  4LF9 L;  3S14 H;  1QOH A;  4B3M Q;  2O4X A;  4C3H B;  1F77 A;  3V2T A;  2CKZ B;  4XQJ A;  1N33 Q;  2K5W A;  1XX8 A;  2OTJ A;  4DV0 L;  4L5T A;  4J6H A;  4LF7 Q;  1TR5 A;  2MHV A;  3ULJ A;  2XNA C;  3OOC A;  2N8N A;  2EIF A;  1IBL L;  5DAU A;  3R93 A;  1PA6 A;  1PTO F;  1SEB D;  4LWC A;  3OHX C;  2FMC A;  2YTX A;  4HJ7 A;  1SYE A;  1QZH A;  4JI3 L;  3H6M A;  1Y1V G;  1VCI A;  2IJ0 A;  5HUR A;  4OO1 I;  1TY2 A;  2N88 A;  1H9R A;  2IY5 B;  1KDB A;  1K8O A;  1KAB A;  2KHJ A;  1AN8 A;  2MO0 A;  2NBF A;  2CW0 D;  3STB D;  4HJ5 A;  2QEJ C;  4OIK A;  1WTQ A;  4RFB A;  4N9P A;  1D2B A;  4DXF A;  1W6K A;  1XNQ Q;  4QMG A;  3I4M B;  1UE1 A;  4K8I A;  3JC6 6;  1F2Y A;  1Y1V B;  2RDG A;  1HH2 P;  4B3R L;  5M5X B;  1A8V A;  4NXM L;  3FPP A;  4C2M B;  4B3T L;  2F0M A;  3SR1 A;  4A3D G;  1FD7 D;  1JOQ A;  1VMP A;  5GAH C;  2JA8 G;  3NBH A;  3HEJ A;  1VMC A;  4X65 L;  4JI8 Q;  1I50 B;  3CC7 A;  1WI5 A;  1EIF A;  1JJG A;  5C5L A;  2WB1 G;  3H94 A;  5M5Y B;  1YNX A;  1PRT B;  4GNX B;  4IOA A;  3K58 A;  1HPC A;  2OT2 A;  2AQ2 B;  1S5F D;  3OWE B;  2E5L Q;  4DR4 L;  2E2D C;  4A3I B;  3K80 C;  2JA8 B;  2VY3 A;  2KHI A;  4KKT A;  3STB C;  4K14 A;  4FF4 A;  1SNC A;  4EQN A;  2OEO A;  4FNF A;  1B3A A;  1X56 A;  3H3V C;  3M3Y B;  1X3P A;  2Q2U A;  3D4W A;  3DM3 A;  2MO1 A;  3MXN B;  3FRP B;  5LL6 X;  5ELO A;  1G2S A;  3Q6S A;  4HJ8 A;  1A3U A;  1HNX Q;  3BYY B;  5FKA C;  5M5X H;  5J1Z A;  2ZJP A;  3FKI B;  2R7Z B;  2ZM6 L;  3GQB A;  2EOT A;  3R2T A;  3OIQ A;  3FMC A;  1FVI A;  2NB0 A;  4J8Q A;  1QIL A;  3I55 A;  4R4C A;  2O2L D;  2YU9 B;  4BY7 H;  5C0X G;  5J39 A;  1X65 A;  5JEA G;  3DEP A;  1SRU A;  4IUU A;  1B4O A;  5C44 B;  5LL6 S;  2PO4 A;  1H9S A;  5ELD A;  1SJE D;  4K5W A;  3D4R A;  4HIM A;  3N6R A;  1UWV A;  1EUJ A;  2LMC B;  4AQY L;  4ALP A;  2JSO A;  1SND A;  4A3I H;  4CDF C;  4GS3 A;  1OO9 B;  2BOS A;  1TXY A;  3K0X A;  4C1N K;  3ERO A;  2KVM A;  2B2W C;  2DN8 A;  2EZV A;  1IBM Q;  3HOZ H;  1KD1 C;  4B3M L;  2L4N A;  3F1Z A;  3M7N A;  4X3S A;  4QL5 A;  4K8J A;  4JK1 C;  5T1I A;  4O1N A;  5CGK A;  2QIL A;  1N33 L;  1EY7 A;  3J80 L;  1GOZ A;  1MI2 A;  4LF7 L;  3FKI H;  3UI2 A;  2R7Z H;  3J81 L;  1ASZ A;  1L1O C;  2BE5 C;  1STH A;  1CK1 A;  5ELC A;  5JPN C;  1OXS C;  3T1H Q;  2Q2H A;  3TZU A;  2UXC Q;  4PG3 A;  3HOV G;  2I5M X;  1SR3 A;  2NVQ H;  4QJF A;  1K9M C;  3C46 A;  5C44 H;  2E2H H;  2Y0S E;  2QF7 A;  2B2Y C;  1JB7 A;  4JI7 Q;  3NPP A;  5CV4 A;  3D6C A;  5C4J H;  4C3J G;  1HZ9 A;  3S1Q B;  2EPB A;  1D7Q A;  4JI2 Q;  4FXD A;  4OEM B;  2F0W A;  2Z6K C;  4PZ6 A;  1LT6 D;  2ICE C;  4J15 A;  3KJP A;  4BBS G;  3CCJ A;  5E7N A;  1EY0 A;  5EBD A;  2EJF C;  4IUR A;  3T1Y Q;  5C4H A;  3HOV B;  1EEF D;  1XNQ L;  1STE A;  4YWM A;  1RJT A;  4DK6 C;  3OMC A;  2EYM A;  1EIY B;  1JWS D;  3EQL C;  3W1G A;  4KKU A;  4OL7 A;  1SNQ A;  3KYH C;  3PSI A;  2LXK A;  1BDO A;  3G6J B;  1WD1 A;  2B2V C;  1BBX C;  4L63 B;  1O7I A;  1GXD C;  2D9U A;  4P74 A;  4DR5 Q;  2NTS A;  4JI8 L;  3ZJY C;  4HTH A;  5E3F A;  1ZXT A;  1BCP D;  1FNV A;  1K3R A;  1U4L A;  4DNR B;  2M2L A;  2NZ1 D;  3NHH A;  2GVB A;  1N36 Q;  3A8K E;  4DR1 Q;  3S15 B;  2L1B A;  1LYL A;  3S1Q H;  1HZC A;  4PNY A;  2E5L L;  4V19 0;  1YJ9 A;  3LX0 A;  2K6A A;  1ET6 A;  2RDF A;  4GOP C;  5FLM H;  5H1S E;  3S1R B;  1EZ6 A;  2EYJ A;  1N34 Q;  1I3Q B;  2DY8 A;  4PV1 C;  1NAP A;  4YWK A;  3R8B A;  1Q46 A;  3PUZ A;  5K36 H;  4LFC Q;  4DV6 Q;  1JWU D;  4G7O C;  2K75 A;  3M4Q A;  2Z9H A;  1EQT A;  4FF2 A;  1Z6H A;  4X62 Q;  4CJ2 C;  1PRT F;  5IGB A;  2H1E A;  1QUQ B;  4GNX A;  4OO1 G;  4A3G G;  1FNU A;  2LY7 A;  3KF6 A;  4GKK L;  2A19 A;  1SMY D;  3G7L A;  3PF5 A;  3TRZ A;  3TBI B;  1K83 B; 
#chains in the Genus database with same CATH homology
 2XTI A;  4OON A;  4BBR G;  3J7Z C;  1YI2 A;  1VQD A;  4BY1 H;  3CQZ H;  2R7F A;  3GD7 A;  1KHI A;  4OXP A;  4LFB Q;  1EYG A;  4R4T A;  5GAG C;  2UXD L;  4EX5 A;  2N3S A;  4AH6 A;  1HR0 L;  1MKH A;  4PZ8 A;  1JMC A;  2VS1 A;  1UE7 A;  1L1O B;  4JBW A;  1NMG A;  5M3M G;  4X64 L;  1OTC A;  2JA5 G;  3BU2 A;  2E8G A;  3KOJ A;  4P71 A;  1K8A C;  2CQO A;  2JEB I;  1QVG A;  1RIP A;  2RHQ B;  3CP0 A;  3UE1 A;  2ASB A;  1J5E Q;  2B63 G;  1XPU A;  1M1K C;  4DV2 Q;  4QIW E;  3J7A 5;  2N78 A;  1N32 Q;  3I2Z A;  2NZO A;  2UU9 Q;  1GKH A;  4IJH A;  3U4V A;  4JI1 L;  1EQQ A;  4KHZ A;  2MNA A;  1I3Q H;  1IBM L;  5IYD H;  4A3M G;  3A74 A;  1QUQ A;  3K7A H;  1K8G A;  1X3F A;  4X66 L;  1ASY A;  5FLX c;  3HKZ E;  2QEX A;  4LF9 Q;  5IT9 c;  1PYS B;  4O2D A;  5ELN A;  2JA9 A;  3FP9 A;  1Y14 B;  2MQH A;  5IYB H;  5JJK A;  4JBM A;  1NBW A;  1VQC A;  1XNR L;  5LMN W;  2AWN A;  1E22 A;  5FLM G;  3CPW A;  1YIJ A;  4JI0 L;  3S2H H;  2VL6 A;  1X6O A;  2K50 A;  4A3J H;  3HOU G;  4NB3 A;  4JI4 Q;  1VQP A;  2ZTC A;  1XMO L;  1MJE A;  4OWW B;  5K36 G;  1EOV A;  1TWH H;  4QY7 A;  1KL9 A;  1AE3 A;  2VW9 A;  3T1H L;  3I4N G;  3PO2 H;  1IBL Q;  4K0K Q;  2UXC L;  1X55 A;  2WB1 E;  3H0G H;  1R9T H;  3CC2 A;  1IL2 A;  4KHP Q;  1E1O A;  3U50 C;  5C4X H;  3K81 C;  4LF5 L;  3CCE A;  4DUZ Q;  1VQI A;  4O0A A;  3G6E A;  3UDF A;  3K8A A;  3ERS X;  3OYY A;  3HOX H;  4JI7 L;  4HIO A;  5BR8 L;  2K4K A;  1G29 1;  2VQE L;  4DR7 L;  4LNQ A;  1NE3 A;  4LUV A;  2R6G A;  2R92 G;  4DAY B;  4DV1 L;  4A3L G;  4JI2 L;  3DLL A;  5LMN Q;  4JC0 A;  1YVC A;  1KIX A;  3PV0 A;  2UUB L;  1VQ5 A;  4NXN Q;  3K7U C;  1V1Q A;  1I5F A;  3L7Z C;  1WFQ A;  2AMC B;  3NBH B;  4BY1 G;  2QGQ A;  4UP9 A;  5C0X I;  1U0L A;  1AE2 A;  3NEL A;  4YCW A;  1UE5 A;  2MFI A;  4XTC S;  5IYC G;  3T1Y L;  4TQU S;  2ZJR A;  4GN3 B;  2NVX H;  2Z6K A;  4DV4 Q;  1XMQ Q;  3KF8 B;  2IT1 A;  2IHE A;  3W5O A;  1MIU A;  3KDF B;  1IZ6 A;  1UEB A;  3PUY A;  1W3S A;  3AEV A;  3AFP A;  2LXJ A;  1MJC A;  2A8V A;  2QA4 A;  3RNU A;  1J6Q A;  1G51 A;  4LUO A;  5IP7 G;  2JA6 H;  1VQ8 A;  1YEZ A;  2WP8 J;  5IP9 H;  2RHS B;  3B6Y A;  4UPA A;  4GOP B;  4NXM Q;  4B3R Q;  3CW2 C;  3GDE A;  4A3K H;  3ULL A;  4C3H H;  2GN5 A;  3OTO Q;  1AH9 A;  5IYD G;  1WCM H;  4XIG S;  3HKZ G;  3FHW A;  4B3T Q;  1JJC B;  4DR5 L;  4IFD G;  2YTY A;  1BBU A;  2R7D A;  5FJ8 H;  1OXX K;  5M5W H;  4P73 A;  1YBY A;  2CWA A;  5IYB G;  2JA7 H;  1WJJ A;  4X65 Q;  4OWT B;  1YJW A;  1KC8 C;  1E1T A;  4R4Q A;  4DV5 L;  2DUD A;  4A76 A;  4DR1 L;  1N36 L;  3CD6 A;  1VQM A;  2PMZ E;  4DK3 C;  5GQO A;  4A3J G;  2D62 A;  1VQB A;  2OCE A;  1NJI C;  2I5H A;  2Y0S G;  4LFA Q;  1YHQ A;  3PO2 G;  3JAM c;  1PYB A;  1Y1W H;  5IWA Q;  1TWF H;  3H0G G;  4A3E H;  4DR4 Q;  3RR5 A;  3PIO A;  4DKA C;  4DR2 Q;  3NEM A;  3PIP A;  1K73 C;  4LFA L;  5C4X G;  5LMU Q;  3CXC A;  2D0O A;  1N34 L;  4WJ3 M;  3HOX G;  1GD7 A;  2B29 A;  1KRS A;  4LFC L;  4GOP A;  4DV6 L;  1GM5 A;  5LMU L;  1VQH A;  4JOI C;  3CMA A;  1HNZ L;  3MEF A;  2F52 A;  1S72 A;  2VZA A;  4RG1 A;  4TVA B;  4LUZ A;  1LUZ A;  1YHA A;  1Q86 C;  1GVP A;  1E24 A;  4X62 L;  2L15 A;  4A3B H;  1YHB A;  4YHH Q;  3I4M H;  2HQL A;  3L2P A;  4YWL A;  4BA2 I;  1Y1V H;  1OXT A;  2KBN A;  1BVS A;  4GNX C;  1X9N A;  1VQN A;  1KAW A;  3JAM i;  4JBJ A;  4DR3 Q;  1VQ9 A;  3KLW A;  2ZM6 Q;  2YTV A;  2ZTE A;  4IPC A;  3H3V I;  1C0A A;  1C9O A;  1CKM A;  1WOC A;  2F3I A;  4L5R C;  4C2M H;  1RL2 A;  4DR3 L;  1SLJ A;  1C7Y A;  2IX0 A;  3RLF A;  2OQ0 A;  4IPH A;  3S2D H;  4LFB L;  2BA0 A;  3RN5 A;  4A93 G;  2JA6 G;  4DUY Q;  3GO5 A;  5IP9 G;  4APV A;  4P72 A;  4A3K G;  4IPG A;  1PHJ A;  1M90 C;  1I50 H;  1EQR A;  1Z47 A;  3PO3 H;  1WCM G;  2RF4 A;  1J5E L;  1NMF A;  4DV2 L;  4AQY Q;  1N32 L;  3ULP A;  5FJ8 G;  2N49 A;  3IRB A;  5M5Y H;  3AFQ A;  3E9I A;  1G6P A;  4NPS A;  2UU9 L;  1BKB A;  2K5H A;  3CCS A;  2JA7 G;  2JEA I;  1L0W A;  4LF8 Q;  4YCV A;  4IOC A;  4OX9 Q;  2NN6 G;  1CSP A;  3A5Z B;  4OWX B;  4DPG A;  2R93 H;  1HZB A;  5GRO A;  4A3D H;  3HOY H;  2CWP A;  2GVA A;  2E2J H;  3A0J A;  4LF9 L;  3S14 H;  2JA8 H;  3CCV A;  4LF6 Q;  4B3M Q;  1PH5 A;  1V9P A;  1K0R A;  1NTG A;  4POF A;  4DV0 Q;  2CKZ B;  4A3E G;  1T9H A;  5C3E H;  2JK8 A;  3M3Y H;  1CKO A;  1EWI A;  1PFS A;  1TWA H;  1PV4 A;  1N33 Q;  2OTJ A;  2WFW A;  1L1O A;  1SE8 A;  4L5T A;  4DV0 L;  4JI4 L;  1PH7 A;  4LF7 Q;  4POG A;  2VQF Q;  3ULJ A;  3WWV A;  4HID A;  2JE6 I;  1IBK Q;  2HT1 A;  2N8N A;  2EIF A;  1IBL L;  4K0K L;  4KHP L;  1FJG Q;  1PA6 A;  4DUZ L;  4LWC A;  4JI3 Q;  4A3F H;  2YTX A;  4IJL A;  4HJ7 A;  4HJ9 A;  4KI0 A;  4GLA C;  2C35 B;  2NVY H;  1QZH A;  3I7F A;  1FJG L;  4JYA Q;  2HIV A;  2PI2 A;  4JI5 Q;  4JI3 L;  1V43 A;  2BH8 A;  2YU9 H;  1Y1V G;  1VCI A;  2OQK A;  2WAQ E;  1P8L A;  2ALY B;  1QVC A;  4OO1 I;  4AYB E;  5LMN L;  2Q2I A;  1VQO A;  3EN2 A;  4NXN L;  3KFU A;  1XJV A;  2LSS A;  5JJL A;  4IFD J;  1BBW A;  2IY5 B;  3BZC A;  3F2D A;  1YZ6 A;  2KHJ A;  2MO0 A;  1I94 Q;  3STB D;  1HJP A;  5DLQ E;  4DV4 L;  4HJ5 A;  1XMQ L;  3PCO B;  1XPR A;  1QZG A;  4PZ7 A;  1N8R C;  3GTO H;  4LF4 Q;  1I94 L;  1XNQ Q;  4X6A H;  1UE1 A;  3JC6 6;  3PO3 G;  4DV3 Q;  4UP8 A;  3PF4 A;  1N9W A;  2UUC Q;  1A62 A;  1HH2 P;  4B3R L;  4NXM L;  1A8V A;  1Q8K A;  2PQA B;  1LTL A;  4GN4 B;  3BZK A;  4JG2 A;  4L5Q A;  3OTO L;  5AJ3 Q;  4B3T L;  1LM0 A;  3PUW A;  1VS0 A;  1Z9F A;  1L2F A;  2R93 G;  5GAE C;  4A3D G;  3GTP H;  3HOY G;  3UDI A;  2B3G A;  4BA1 I;  5IY0 A;  1PVO A;  5GAH C;  1IXR A;  2JA8 G;  3F8T A;  4MNO A;  4DV7 Q;  4X65 L;  3J81 j;  3GTM H;  4JI8 Q;  3CC7 A;  1WI5 A;  1Q7Y C;  3S1N H;  3D31 A;  2VUM H;  1EIF A;  2JJQ A;  1JJG A;  2K5V A;  3HFZ B;  2WB1 G;  5C3E G;  4DV7 L;  1KQS A;  2UXB Q;  1Q12 A;  3KDF A;  1YNX A;  3TRE A;  4GNX B;  4PMW A;  1UE6 A;  3CME A;  4IOA A;  4YY3 Q;  3EBE A;  5IWA L;  2EXD A;  2E5L Q;  4DR2 L;  1JE5 A;  4DR4 L;  3F2C A;  1P16 A;  1U5K A;  2KEN A;  3K80 C;  4GN5 A;  4YY3 L;  3GTJ H;  4JI6 Q;  3E9H A;  3S1M H;  3I56 A;  3M4P A;  4A3F G;  2VY3 A;  2KHI A;  2F4V Q;  4C3I H;  1OXU A;  1KRT A;  4Y52 H;  1YJN A;  3STB C;  1VQ7 A;  1TWC H;  3CCR A;  1NY4 A;  2YYZ A;  4DR6 Q;  4JV5 Q;  3AYH B;  1X56 A;  1H95 A;  2UUA Q;  2Q2U A;  3DM3 A;  3MXN B;  2MO1 A;  5JJI A;  4LW1 A;  4JBK A;  5HGQ A;  5ELO A;  1GO3 E;  1VQ4 A;  3HOV H;  2RCN A;  2BH2 A;  4JOI A;  4YCU A;  4HJ8 A;  4YHH L;  2I0Q A;  2Q2T A;  1HNX Q;  5M5X H;  2AKW B;  2DGY A;  2ZJP A;  2D0P A;  2PNH A;  3U4Z A;  2CCZ A;  4DAM A;  1CKN B;  2ZM6 L;  3RN2 A;  5HY6 A;  1HNX L;  3PGZ A;  4C3J H;  1FVI A;  4HIK A;  1Q1E A;  3I55 A;  4R4C A;  1PH1 A;  4B3S Q;  3CCL A;  3HOW H;  2K14 A;  4BY7 H;  5C0X G;  2NVT H;  4BBS H;  1SFO H;  1X65 A;  5JEA G;  4DUY L;  1CSQ A;  1SRU A;  2ID0 A;  1A63 A;  1X3E A;  1VQK A;  3CCQ A;  3H3V H;  5GAD C;  2UXD Q;  3UDX A;  4ME3 A;  2K52 A;  4HIM A;  3PUV A;  1HR0 Q;  1SMX A;  1UWV A;  3D0F A;  5IYC H;  1EUJ A;  1IYJ B;  4R4I A;  4X64 Q;  1VQ6 A;  4AQY L;  4ALP A;  4JCV E;  3ER0 A;  4A4I A;  3NEN A;  4IFD I;  3S15 H;  4A3I H;  4LF8 L;  1WYD A;  2VUM G;  4OX9 L;  4GS3 A;  1S40 A;  2HHH Q;  4RMF A;  1TXY A;  3K0X A;  4IPD A;  5IP7 H;  1XTD A;  3BJU A;  2ZJQ A;  2FXQ A;  4UP7 A;  4JI1 Q;  1Y1W G;  2HHH L;  2A1A A;  3UE0 A;  1IBM Q;  1CKN A;  4LF6 L;  1KD1 C;  4B3M L;  3HOZ H;  3S16 H;  3S1R H;  3SGI A;  3F1Z A;  4X66 Q;  3M7N A;  2IX1 A;  1I6H H;  1X54 A;  4QL5 A;  2CFM A;  1N33 L;  3GTG H;  4DNI A;  1XNR Q;  4A3C H;  4HJA A;  4JI0 Q;  3FKI H;  4LF7 L;  2VQF L;  2R7Z H;  1ASZ A;  1L1O C;  1IBK L;  3E0E A;  4L5S A;  2E2I H;  4A3B G;  2EQS A;  1XMO Q;  3I4M G;  4WJ4 A;  1OXS C;  4AIM A;  3T1H Q;  1VQA A;  2Q2H A;  2UXC Q;  4PG3 A;  3HOV G;  2I5M X;  4JYA L;  4LF5 Q;  1SR3 A;  2NZH A;  4JI5 L;  2NVQ H;  4QQB X;  4QJF A;  1K9M C;  2XGT A;  5C44 H;  1D8L A;  1K83 H;  3RLO A;  5M3F H;  1YIT A;  2Y0S E;  3W1B A;  2E2H H;  2KCT A;  1JB7 A;  4JI7 Q;  4BXX H;  5BR8 Q;  3TS0 A;  1JJ2 A;  4IO9 A;  5C4J H;  3F2B A;  2VQE Q;  1HZ9 A;  3CF5 A;  1PH4 A;  3GTQ H;  4DR7 Q;  3L0O A;  1E7Z A;  1D7Q A;  4FDB A;  3J80 c;  4JI2 Q;  4DV1 Q;  1PH2 A;  1VQG A;  2UUB Q;  3HOW G;  2Z6K C;  4PZ6 A;  4BY7 G;  3J81 c;  1OXV A;  4J15 A;  4BBS G;  3KJP A;  3OW2 A;  3CCJ A;  5E7N A;  3U58 A;  2H5X A;  1XPO A;  1Q81 C;  3CCM A;  1B7Y B;  3CC4 A;  3T1Y Q;  4A3G H;  4LF4 L;  3S17 H;  3KJO A;  1HNW Q;  3TS2 A;  1XNQ L;  1KXL A;  3GTK H;  1B8A A;  1PH8 A;  4YWM A;  4DK6 C;  4DV3 L;  3G48 A;  1EIY B;  4BBR H;  1X3G A;  5IE8 A;  1Q82 C;  1HNW L;  2UUC L;  3I4O A;  1DGS A;  3W1G A;  4A75 A;  2YV5 A;  3M4O H;  3EIV A;  4A3I G;  1HZA A;  2ATW A;  2PI2 E;  1PH3 A;  3KYH C;  2BA1 A;  2LXK A;  3PSI A;  5J3B A;  3J80 i;  5AJ3 L;  4EQ5 A;  2OWO A;  5M3M H;  4A93 H;  3J81 i;  2NN6 I;  2JA5 H;  4UY8 C;  2VNU D;  5EAY A;  3TQY A;  3HOZ G;  1O7I A;  3RZO H;  4P74 A;  3RZD H;  4DR5 Q;  4MTN A;  4JI8 L;  3S24 A;  3A5U A;  3ZJY C;  3H15 A;  1PH6 A;  2B63 H;  3M85 A;  3AQQ A;  2IHF A;  3KF6 B;  4H02 A;  1K3R A;  1QVF A;  2UXB L;  1FL0 A;  1SN8 A;  3RLN A;  2KCM A;  2K5N A;  2GVB A;  2OTL A;  4A3C G;  1S3O A;  4A3M H;  1VQE A;  3FKI G;  4DV5 Q;  4DR1 Q;  1N36 Q;  2R7Z G;  2ES2 A;  4P75 A;  1LYL A;  4R4O A;  2AWO A;  1VQF A;  2I5L X;  1HZC A;  3S1Q H;  1PH9 A;  2E5L L;  4JI6 L;  2WAQ G;  4GLV B;  5C0X J;  1YJ9 A;  3ICE A;  4AYB G;  1JT8 A;  5JEA J;  3PUX A;  2PQA A;  4GLX A;  3UDG A;  4GOP C;  2F4V L;  3G71 A;  2AHO B;  2ZTD A;  5FLM H;  5H1S E;  3TEH B;  4QGU A;  3GTL H;  3M9B A;  4MZ9 A;  3VDY A;  3HOU H;  1VQJ A;  5C44 G;  5M3F G;  3CAM A;  4Y7N H;  1FGU A;  1N34 Q;  4DR6 L;  4YWK A;  4JV5 L;  1Q46 A;  3PUZ A;  4BXX G;  3HKS A;  2UUA L;  3G4S A;  1HR0 W;  4DV6 Q;  1W2B A;  1EFW A;  4LFC Q;  3I4N H;  2K75 A;  1HNZ Q;  2HIX A;  2Z0S A;  3M4Q A;  3Q8D A;  3CPF A;  3LGJ A;  4X62 Q;  4GKK Q;  4GKJ Q;  1VQL A;  1SRO A;  1A0I A;  1QUQ B;  1Q1B A;  1E3P A;  4GNX A;  3KF6 A;  4A3G G;  4GKK L;  1TWG H;  4GKJ L;  1B70 B;  4OO1 G;  1CUK A;  2A19 A;  4KLK A;  2R92 H;  4A3L H;  4B3S L;  4R1J A;  2JQO A;  2V1C C;  3PF5 A;  3TRZ A;  3CCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...