4DV6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a915g
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv6Q00
1NMGA 2Z6KC 4R4CA 3VDYA 3J80i 3CCEA 5C3EH 4LUVA 3A5UA 2NVTH 1GM5A 2R93G 2R7DA 1ASZA 2R7FA 1B8AA 3OYYA 4LF9Q 3M4QA 5M3FG 4OX9L 1VQ5A 1NJIC 3CC2A 2F4VQ 4HJ7A 4GOPB 3F2DA 1WYDA 3GTGH 4A93H 3IRBA 1WCMH 4JCVE 4UP9A 4A3DG 4NB3A 1HNWQ 4EX5A 1B70B 4B3MQ 3M7NA 2UXCL 1EOVA 2EIFA 4C2MH 3KFUA 1NMFA 2D0OA 2K50A 2Q2IA 2ZJQA 5GAGC 3FKIH 5E7NA 4YY3Q 4YWLA 2CQOA 4OWXB 1R9TH 5C44H 4KI0A 1KD1C 5IYBH 3S2HH 2K75A 4DR1Q 4B3RQ 5LMUQ 1V1QA 3CW2C 4JI3L 3ULPA 1Z47A 3PUWA 3PUYA 3PF5A 1OXVA 3AFPA 3TQYA 3RN2A 3CC7A 2I0QA 2Z6KA 4LUZA 4R4IA 4J15A 2PNHA 2HT1A 3FP9A 1A0IA 5JEAG 5LMNL 1HR0Q 4X64L 4GNXB 4IJHA 2HQLA 4C3JH 4B3TQ 4BY7G 4DR4Q 4C3IH 1IBMQ 1L1OC 4PZ7A 5IP9G 4DV5Q 3T1HL 2MFIA 2JA7G 4BXXG 1X3FA 2HIVA 3M4OH 1KXLA 1HJPA 5C0XJ 4DV3Q 3T1YQ 3BZKA 5FLXc 4JI2Q 1XNQQ 4XTCS 1SRUA 1TWFH 5IWAQ 4GLXA 4HJ8A 4GS3A 4X62L 4DUZQ 1PH7A 4LFCQ 1TWCH 3PF4A 1MIUA 2UUCQ 1SMXA 3CD6A 3AYHB 4P71A 2UU9L 3S2DH 3S1QH 1KAWA 3OTOQ 4LF5L 4YWMA 1XMQL 1GKHA 4A3BH 5IYCH 1VQCA 1PH6A 4BY1H 3KLWA 3F8TA 4EQ5A 4A3EG 3GTKH 1TWAH 3HOVH 3KF8B 2F3IA 4Y7NH 1XPOA 4JBKA 1MKHA 3UDXA 3MEFA 2KCTA 3TEHB 1L1OA 1HZAA 5DLQE 5C4XH 1C7YA 3EBEA 2OWOA 1IBLL 4NXNL 2UXBQ 1IXRA 2PI2E 3KF6B 3RLFA 3CQZH 2OTLA 4JBMA 1W3SA 5M5XH 4GKJQ 4X66Q 4Y52H 4AQYQ 3HFZB 4HIMA 2OQKA 4A3LH 5HGQA 3GTQH 1PH2A 1IYJB 3CCMA 4BA2I 3K7UC 2GVBA 4ALPA 3U58A 4A3MH 2E2HH 2MO1A 4IPCA 3A5ZB 1K8GA 2JA8H 3HOUG 3I2ZA 3RN5A 2ZJRA 4GOPC 4JI0Q 4P75A 1HNXQ 1SE8A 2JK8A 1X9NA 2K4KA 4YHHL 2WAQG 3ERSX 2BH8A 3UE1A 1K3RA 1FL0A 2UUBQ 3GD7A 4B3ML 4POGA 3HOYH 3W1GA 1L2FA 3J7ZC 1A62A 4UP7A 5GROA 1Y14B 3D31A 1KC8C 1VQHA 4YY3L 4TVAB 3J80c 4GLVB 1PH5A 2JA5H 2Z0SA 3I4MH 3JAMi 3I4OA 4BBSH 2XTIA 4QL5A 4B3RL 2WB1G 2ID0A 3H0GH 4QY7A 2K5HA 3CCLA 2RHSB 4LFAQ 5M3MH 5C4JH 1G6PA 1YNXA 1XTDA 1KIXA 4GN5A 4GNXC 1HR0L 3U50C 2KHIA 5JJLA 5J3BA 4DR3L 5FJ8G 1SLJA 4OONA 4JBWA 2JEAI 4A3IG 4GOPA 4B3TL 3NELA 4DR4L 4A3JG 1A63A 4JI5L 1WJJA 4YWKA 2GN5A 3S16H 3PO3H 2I5LX 1SROA 3OW2A 1VQ7A 2ES2A 1IL2A 2XGTA 4B3SL 5HY6A 4A3FH 1E1OA 3PO2H 1SR3A 3T1YL 3U4VA 1X65A 2ZTEA 1CKNA 1JE5A 2CFMA 3HKSA 3MXNB 3I4NH 3WWVA 2HHHL 1PVOA 5AJ3Q 2ASBA 2R92G 4HIDA 1C9OA 2E8GA 1VQLA 4A3GG 4A3GH 3CF5A 2DUDA 2YV5A 4ME3A 4JI7L 1K83H 3KOJA 2VQEQ 2YTYA 4DPGA 5ELOA 4GNXA 2K5VA 3GTPH 2GVAA 4A76A 1PH8A 4DR6L 4RG1A 1YJNA 1I5FA 4KLKA 3HOXG 4KHPQ 2D0PA 4PZ8A 4DV4L 2YTVA 4JI6Q 1KL9A 2N3SA 4MNOA 4BBRH 3GTMH 4GN4B 5K36G 3J7A5 4HIOA 1PH4A 4A3CH 3KYHC 4JI1Q 4AYBG 1X6OA 1FJGQ 3AQQA 4GKJL 3L7ZC 3NEMA 4P73A 2ZTCA 2VNUD 1XPUA 4DV2L 1HZ9A 3CMAA 2MQHA 4UPAA 3K80C 2QEXA 1CSQA 1E7ZA 4K0KQ 4BA1I 2EXDA 1CKNB 4HIKA 1N36L 1PYBA 4NXMQ 4DV0Q 4IFDG 3UDIA 4JI0L 1Q1BA 1J5EL 1AE3A 1I3QH 2B63G 3CPFA 3H3VH 4R4TA 4YCWA 1U0LA 2NN6I 4A3KG 1S40A 3HOZH 1OXUA 3CP0A 2N8NA 1VS0A 3G71A 3PUZA 1Y1WG 4PZ6A 2UUAQ 1P8LA 4A75A 1KRSA 2R6GA 5BR8Q 2E2JH 3CMEA 3KF6A 4MZ9A 4DV1L 1OTCA 2R7ZG 4LFBL 2JQOA 1N32Q 1Q7YC 2E5LQ 3GO5A 3HOWH 2EQSA 2I5MX 4R4QA 1VQOA 5M5WH 1XMOQ 4IPHA 2KHJA 4LFAL 3RLOA 1CSPA 1VQJA 4NPSA 1BBUA 2ALYB 5IYDH 1VCIA 1Y1VG 4LF7Q 2OQ0A 2A19A 2VUMH 4QIWE 1JT8A 1YVCA 3PV0A 4IFDI 5FLMG 3S15H 4JYAL 1LM0A 3W5OA 4JV5L 4GN3B 3M3YH 4GKKQ 1L0WA 4L5SA 2Y0SG 1Q8KA 2AWNA 3F1ZA 3JAMc 1D8LA 1I94Q 3E9HA 2WP8J 2OTJA 2NN6G 3FHWA 3STBD 2R93H 4OO1I 2BH2A 4A4IA 3KDFB 3CPWA 3PUVA 2LXKA 5M3FH 4DKAC 4DNIA 1HZCA 2JA5G 2I5HA 3J81i 4DUYQ 5AJ3L 2UXDL 1B7YB 4A3DH 2VQFL 2ZM6L 3H0GG 2PQAB 4DV6L 1AH9A 3PUXA 4JG2A 1VQAA 2Q2UA 1QZHA 4IJLA 1IZ6A 4O0AA 4IO9A 4MTNA 2KENA 5H1SE 2JA6G 1N33Q 4DR5L 1EQQA 1PV4A 3DLLA 4DV0L 1FGUA 3M85A 1N8RC 1TWGH 1Q86C 2VZAA 1HZBA 2A1AA 2RF4A 4KHPL 2CWAA 4LF9L 4WJ4A 1YHAA 1YITA 1XPRA 3CCVA 2F4VL 1X55A 2HIXA 3STBC 5IP7G 1GVPA 1V9PA 3D0FA 4JI1L 3UDGA 1HNWL 1GD7A 4OO1G 2WFWA 4OXPA 4OX9Q 3PCOB 4BY7H 2CWPA 2IX0A 3F2BA 5IP9H 2JA7H 4IOAA 3I56A 4IFDJ 3ULLA 4TQUS 5C0XI 2UXCQ 2WAQE 1PA6A 4FDBA 4DR1L 2JE6I 5LMUL 1PH3A 2QA4A 4LWCA 2ZTDA 4LNQA 3G4SA 3K81C 1G51A 1PH9A 3ZJYC 5JEAJ 4JC0A 2UUAL 5C3EG 3PIPA 3E0EA 4JI3Q 1IBKQ 4O2DA 3B6YA 2YU9H 1WFQA 5BR8L 2D62A 1KRTA 2VS1A 2WB1E 1Q12A 1N32L 1IBML 4A93G 4A3EH 4DV5L 1WCMG 5LMNQ 4IPGA 4X64Q 2LXJA 1N34Q 4DV3L 1UE6A 1XNQL 4JI2L 3ICEA 2VL6A 3CC4A 4LFCL 1O7IA 5IWAL 3FKIG 4DUZL 1VQNA 4IPDA 4LF7L 2UUCL 5C44G 1EYGA 5IYBG 3OTOL 2N49A 4X65Q 1HNZQ 1EFWA 1LTLA 1S72A 1JB7A 3A0JA 1BVSA 3BU2A 1VQIA 3G48A 4JI4Q 1OXSC 2PMZE 1I94L 2UU9Q 4YCUA 1Q46A 1XJVA 4LF5Q 3HKZG 1WOCA 1X3EA 1CKOA 2CKZB 3HOUH 1PH1A 4WJ3M 4P74A 5JJKA 1N9WA 1E1TA 1YIJA 4DV7Q 1KQSA 3SGIA 2KBNA 3CCRA 2UXBL 1UE1A 4H02A 3EN2A 1CUKA 1Q82C 4X66L 3BZCA 4AQYL 2OCEA 1NTGA 1YJWA 4PG3A 2JEBI 3ULJA 1BKBA 3J81c 4AYBE 4DAMA 4A3BG 1YI2A 5IYCG 1EUJA 1VQFA 4LF6Q 1I6HH 4BY1G 4UY8C 1HNXL 1EWIA 2ATWA 3BJUA 3K8AA 5LMNW 1NBWA 4JOIC 3KDFA 3HOVG 4C3HH 3A74A 3LGJA 2UUBL 1XNRQ 2IHEA 5FJ8H 4A3IH 3S1NH 3S17H 4A3JH 2MO0A 1VQDA 3H15A 2A8VA 4YHHQ 1VQ6A 5C4XG 2PQAA 3GDEA 4PMWA 1JJGA 2K5NA 4UP8A 4DR7Q 3AFQA 3K0XA 3TS2A 3PSIA 1E24A 1VQKA 4A3LG 4HJ5A 3TRZA 1RIPA 5GQOA 2R92H 3CCUA 4A3MG 1RL2A 1VQ8A 2ZJPA 3CCSA 2AWOA 1EIFA 1IBKL 4JBJA 1A8VA 2VY3A 4RMFA 2NVXH 2MNAA 2JA8G 5GAEC 3GTJH 4LF4Q 4LF8Q 1LUZA 3NENA 4YCVA 1W2BA 4QJFA 5GADC 1WI5A 2NVQH 1MJEA 4JOIA 4DK3C 3RZOH 4DR3Q 4DR2Q 4AIMA 3KJOA 2Q2HA 1N34L 3NBHB 3HOYG 2YYZA 3DM3A 3HOXH 2F52A 2B3GA 4JI5Q 1TXYA 1EIYB 3I4MG 3EIVA 1YHQA 4B3SQ 1UEBA 2Y0SE 3Q8DA 3TREA 1ASYA 1FVIA 4BBSG 1JMCA 4L5TA 3ER0A 4OWTB 2B29A 4X65L 3I55A 1HNZL 3TS0A 4JI4L 2HHHQ 5M3MG 3J81j 1VQMA 1K73C 2K52A 1UE7A 2VQEL 5ELNA 1X3GA 4JI8Q 3UDFA 1QZGA 3JC66 2IHFA 2KCMA 4POFA 4JI7Q 1M90C 2B63H 4APVA 2AHOB 1AE2A 5IT9c 4A3KH 4JI6L 4DV7L 3PO3G 4DR6Q 1NE3A 1Y1WH 1VQEA 4A3FG 3PO2G 1S3OA 2BA1A 1FJGL 4DV4Q 3K7AH 1G291 1OXTA 1GO3E 1Z9FA 3S14H 3I4NG 2R7ZH 5IE8A 3S1MH 4K0KL 3CCJA 1PFSA 4BXXH 1E22A 1VQ4A 1SFOH 1J6QA 1OXXK 4DK6C 3RLNA 4DV2Q 4NXML 1E3PA 3H3VI 1NY4A 2V1CC 1U5KA 4LF6L 5IY0A 2QGQA 1N36Q 4DAYB 1HR0W 1Y1VH 2N78A 3UE0A 4R4OA 1I50H 4LW1A 4QGUA 2CCZA 1D7QA 1XNRL 2AKWB 5EAYA 2JJQA 5FLMH 1J5EQ 3PGZA 3PIOA 2RCNA 4BBRG 1QVCA 1YBYA 4HJAA 1VQ9A 2E2IH 2IX1A 2NZOA 2BA0A 3CAMA 4GLAC 4A3CG 2DGYA 4DR7L 1Q1EA 1YJ9A 1VQPA 2E5LL 3E9IA 1QUQA 1YEZA 2H5XA 4AH6A 1KHIA 1P16A 2NZHA 4R1JA 1PYSB 4DV1Q 4LFBQ 1VQBA 1LYLA 2JA9A 1XMOL 2AMCB 1X54A 2L15A 3T1HQ 1UWVA 3RR5A 1HH2P 1QVGA 5M5YH 1L1OB 1JJ2A 1EQRA 5GAHC 1T9HA 1YZ6A 1X56A 1CKMA 4KHZA 2NVYH 3F2CA 1YHBA 3CCQA 4IOCA 4P72A 3KJPA 5C0XG 4LF4L 4LF8L 2JA6H 2FXQA 1M1KC 4X62Q 4GKKL 4XIGS 1QVFA 3HOZG 4QQBX 2LSSA 4DR2L 1Q81C 4JV5Q 4JYAQ 1DGSA 3L2PA 1XMQQ 3GTLH 4L5QA 3U4ZA 3G6EA 3RZDH 1PHJA 2PI2A 1C0AA 1TWHH 5IP7H 4DUYL 1BBWA 3HOWG 3I7FA 4L5RC 3RNUA 1JJCB 4HJ9A 3HKZE 3S1RH 2RHQB 3AEVA 3M9BA 2Q2TA 1V43A 1H95A 2UXDQ 4OWWB 2IT1A 3CXCA 1SN8A 3W1BA 1QUQB 2VQFQ 1IBLQ 5IYDG 2ZM6Q 1N33L 1K0RA 2C35B 4LUOA 4NXNQ 3L0OA 4JI8L 4DV6Q 1VQGA 2VUMG 1MJCA 2IY5B 4X6AH 3S24A 2VW9A 1K8AC 3GTOH 1K9MC 4DR5Q 5JJIA 2K14A 2YTXA 3M4PA 1UE5A
chains in the Genus database with same CATH superfamily
2K5WA 3K6OA 3H3VC 3CCEA 2R7FA 3I90A 1B8AA 2K6AA 5I6WA 2F4VQ 5IGDA 4HSVA 4A3DG 2KHSA 3SK5A 3L3OC 2EIFA 1HA6A 1I4RA 1QJOA 2WKCA 4DAVA 2CH4A 1AP0A 4FXDA 2CW0C 2RSNA 4YWLA 3DWAA 5IYBH 1KD1C 2K1BA 3S2HH 1V1QA 4JI3L 3FEWX 1Z47A 3PUWA 3PF5A 1OXVA 3TQYA 1SE3A 1GUOA 4EQPA 3DEOA 4XXEA 4LUZA 2HT1A 2PNHA 1SNMA 5EJWA 1SDFA 2RBMA 3DMUA 4IJHA 1K83B 2IPKD 2HQLA 4B3TQ 4BY7G 4C3IH 1HUNA 5IP9G 1MD2D 2JA7G 3GTPB 1X3FA 1ZKOA 1HJPA 5C0XJ 2Z9HA 4XTCS 3GTMB 2F0FA 1AEXA 3AYHB 2DN8A 3S2DH 1FNVA 1UUPA 3ERQA 4A3BH 2FJ2A 3WOFA 4BY1H 1ET6A 2WB1B 3KLWA 4A3EG 4IUTA 3MXPA 5JPNC 2C5CA 4HTHA 1IKLA 3KLSA 2KCCA 1HZAA 2OWOA 1IBLL 3VYSA 1C8CA 4JBMA 5M5XH 4GKJQ 2OQKA 5HGQA 2M9VA 1PH2A 1IYJB 3CCMA 4ALPA 4KV6A 3U58A 4IPCA 3T4AC 3GV6A 3A5ZB 4IURA 4Q0FA 2K4KA 3MC0B 5FO7B 4A3GB 5IGEA 1ML0D 2HD3A 3GD7A 4NP5A 1QILA 3W1GA 2NVQB 3D31A 4TVAB 4GLVB 4RFBA 2ZXRA 3I4OA 4F88A 4BBSH 2WB1G 1IYVA 1MSHA 5M3MH 1CFMA 1G6PA 1YNXA 1T5EA 2JEAI 4NDXA 5JJZA 1EZ6A 4A3IG 4B3TL 3NELA 1EY9A 4YWKA 2B2VC 3I3CA 3PO3H 1VQ7A 1TWGB 1E1OA 1SR3A 1YNNC 2B2UA 4FVMA 2RKSA 2F3VA 1HRJA 2K05A 5AFWA 1PVOA 2IJ0A 5AJ3Q 3Q22A 3F2UA 4A3GG 5F2DA 2DUDA 5ELOA 2K5VA 3L9AX 3HOXG 1Y1VB 2D0PA 2F0NA 4PZ8A 4JI6Q 5CBEE 1KLGD 1V1OA 3TP8A 1PH4A 3M4YA 4AYBG 3RMHA 1JCKB 2Y0SB 3AQQA 4GKJL 4QMGA 4DV2L 2MQHA 1IKMA 1E7ZA 1SNOA 4BA1I 2EXDA 1HQMC 4M1UB 1ESRA 4DNRB 3TN2A 3VR2A 3UDIA 1SYCA 5C0XH 1J5EL 1NR4A 1PMRA 3HOZH 3CP0A 2N8NA 4CDFC 5C3XA 1Y1WG 2UUAQ 2AUJD 1MHWC 3KF6A 4MZ9A 4DV1L 2E5LQ 3HOWH 3HOUB 1WTOA 4R4QA 1TWHB 1EY8A 4KY7A 3LWEA 5CV9A 4NPSA 3S1RB 1Y1VG 1BOSA 2F1MA 5FLMG 1LM0A 1ENCA 3A8KE 3MEHA 2BCOA 2Y0SG 4G7ZC 2F03A 3WDNA 2OTJA 2NTTA 3BG3A 3OPOA 2BH2A 3CPWA 5M3FH 2I5HA 2E76C 5AJ3L 3NPPA 3I8ZA 1JWSD 1PFMA 4DN4M 2PQAB 3S17B 4DV6L 1QZHA 1IZ6A 4IO9A 5H1SE 1N33Q 1ZXTA 1BF4A 2PMZB 3MVVA 1Q86C 1ENAA 2RF4A 3CRKC 1RCVD 1R9TB 5IGGA 3G6JB 2R92B 2DY8A 2HIXA 5ELBA 1JOKA 5IP7G 2WKDA 4RKBA 1HFNA 5JEAH 2BE5D 1GJXA 1GUWA 1TT2A 3F2BA 2C9OA 2F0JA 3I56A 4IOAA 1F9SA 1S5CD 2UXCQ 2WAQE 4FDBA 3EJIA 4DR1L 1PH3A 1TS3A 3K81C 1G51A 2PW7A 3QIAA 3ZJYC 2UUAL 1QOHA 3PIPA 4CDCC 3DUZA 2YU9H 1MGSA 1EWHA 2P5ZX 2NWGA 1IBML 3KLSX 1TR5A 1U4RA 1WCMG 4X64Q 2BE5C 3C1EA 5BN5A 2N88A 1UE6A 3GTKB 2RA4A 3CC4A 5IWAL 2SOBA 1TU2B 4BS9A 1HNZQ 4RAUC 5C3WA 3V2TA 1JB7A 4JI4Q 3CQZB 2BDNA 1Q46A 4X3SA 1CKOA 3G7LA 1NUCA 3OHXC 2O5JC 4WRDA 1PH1A 4WJ3M 3Q6SA 1HXYD 1D1IA 3SGIA 2UXBL 4OIJA 3EN2A 1CUKA 3NSWA 3P1HA 1NTGA 3K5MA 5A2QL 4RA8A 1CT1D 1IYUA 2JXMB 1SNQA 1CK1A 2JA5B 1NCVA 1EUJA 1VQFA 3NBHA 2ICEC 5FJ8H 2VB2X 4M8AA 4A3JH 1VQDA 2A8VA 4YHHQ 4R8NA 1PTOF 1PYWD 2K5NA 4UP8A 4B9XA 4FNFA 1PZKD 3K0XA 2A6EC 1E24A 3D4RA 4CJ1B 4A3LG 1PFNA 4K5VA 5GQOA 3CCUA 1EY0A 1RL2A 1SJED 2ZJPA 1VQ8A 3AU7A 3GTJH 4LF4Q 3V05A 4QJFA 5GADC 1B9NA 2A68D 3CRLC 4DR3Q 4XDXA 4EQOA 3W3AA 4FF2A 1D5ZC 1TXYA 2Z4IA 1UEBA 3J80L 1FVIA 2XRSD 4BBRB 4OWTB 2KJXA 1HNZL 3SK4A 2F0UA 4JI4L 2HHHQ 3J81j 1K73C 1KAAA 3M7GA 1X3GA 5EGTA 3TP6A 3JC66 4POFA 3FKIB 4FXGC 5CC4A 1RTNA 1EIHA 2F0VA 5IODA 5C44B 2BA1A 1FJGL 1UAPA 3K7AH 1GO3E 4KD3A 3S14H 3HKZB 1HHVA 5IE8A 1AFPA 1W6KA 3CCJA 1SAPA 1STYA 4BXXH 1SFOH 4DK6C 3VA7A 2WACA 5IY0A 2QGQA 3DWPA 2KVMA 1N36Q 1HR0W 2N78A 3IL8A 3UE0A 4R4OA 1I50H 5I4DA 2AKWB 5CV4A 1ONLA 3PMFA 2ENBA 4BBRG 2VUMB 2BA0A 2NN6H 2X6GA 1Y8PB 1O7ZA 4A3CG 3M3YB 3E9IA 2QEJC 1KHIA 1P16A 1G2SA 1GUGA 5CORA 2NZHA 3MZ5A 4R1JA 4LFBQ 1I6HH 2XSCA 2AMCB 1XMOL 1TWAB 2R93B 5M5YH 1JJ2A 1YZ6A 2X69A 1CKMA 1CQVA 5C4XB 4LF4L 5JAVA 2JA6H 3OIPA 2FXQA 3HP3A 4KN4C 1QVFA 1DZ1A 2M2LA 3URYA 1QG7A 5C6AA 4K5XA 2H1EA 4L5QA 3U4ZA 3GTQB 3I91A 1DJRD 3RZDH 1PHJA 2PI2A 2BOSA 2E2HB 1G91A 2A73B 1JOOA 2JA8B 2K7VA 4L5RC 3UI2A 2DNCA 1H95A 2UXDQ 4OWWB 2IT1A 3CXCA 1SN8A 1QUQB 2ZM6Q 4IFDI 2VUMG 1MJCA 2XN9C 3VR3A 1K8AC 3GTOH 3I4MB 4DR5Q 5JJIA 4J1MA 1LACA 5JVH3 3H09A 3J80i 5C3EH 3A5UA 4ZK9B 2HDMA 1GM5A 2R93G 5C4JB 4LF9Q 4OX9L 1VQ5A 3CC2A 1BBXC 4XYOA 3T16A 4HJ7A 1WYDA 3NQTA 3MHBA 5ELDA 4EX5A 3GP7A 3M7NA 4C2MH 1NMFA 2D0OA 2HCIA 2K50A 2Q2IA 1F77A 4QB4A 2L9HA 1EQTA 3PO2B 3E5SA 4KI0A 4KMUC 4B3RQ 3DEPA 5LMUQ 2KQ3A 1A3VA 3PUYA 2Z6KA 1H9RA 3A56A 1KDBA 1STNA 3FP9A 5LMNL 5KNDA 4C3JH 1L1OC 4DV5Q 3OSOA 4BXXG 4ZUIA 3E3XA 1KXLA 1EWCA 3T1YQ 1O7LA 2WAQB 1XNQQ 4DAYA 1SRUA 5A2QE 2K33A 3PF4A 1MIUA 3MTSA 4TSSA 3CD6A 4RCNA 3S1QH 2GA4B 2K32A 4XQJA 5CV6A 3ONAB 1B1ZA 1HUMA 1LTAD 2NB0A 4RWSC 3T13A 1PH6A 3F8TA 1JE4A 2F0KA 4EQ5A 3KF8B 2F3IA 4Y7NH 1PXUA 1I3QB 3UDXA 3MEFA 2KCTA 3TEHB 5DLQE 1C7YA 2PZTA 2Q8IB 3S1NB 2PI2E 3KF6B 4V0BA 1JB3A 4FF4A 2OTLA 5EPLA 2Q8RE 2PW5A 2FFKB 1H9JA 4G7OC 3HFZB 4HIMA 2KECA 1ICFB 1HCZA 2GVBA 5M5WB 2PYKA 4PNYA 2G5DA 3QOJA 3RN5A 4JI0Q 4P75A 1X9NA 5E4WC 4G7HC 2WAQG 1SYFA 3ERSX 2BH8A 2F0DA 5CYUA 2UUBQ 2OXPA 3IFTA 1SSOA 1KLUD 4POGA 1C4QA 3H91A 2MPMA 1A2UA 3NQIA 3J80E 3J80c 2Z0SA 2J4XA 1TVXA 4QL5A 4B3RL 2ID0A 2NYZD 4CKBA 2RHSB 3A54A 4LFAQ 3J81L 4A3DB 2DJGC 1RJTA 5L37A 4GN5A 1KIXA 1A3UA 3K5NA 3U50C 5JJLA 5C5MA 4GOPA 3PQIA 1A63A 2GN5A 2ES2A 1IL2A 2XGTA 1PZID 1I4GA 2NBFA 5HY6A 4A3FH 3T1YL 3U4VA 3J7AF 4A3KB 1CKNA 1JE5A 2CFMA 2F0OA 2Z6BA 1Q90A 4HIDA 1C9OA 1VQLA 3NTKA 3K59A 2R7ZB 4BY7B 4C56C 4E6IA 4ME3A 1K83H 2VQEQ 4DPGA 3K5LA 4GNXA 3ITPA 3GTPH 4DR6L 1VMCA 1WTWA 1YJNA 1BXTA 1PRTB 2B2TC 5IGCA 2N3SA 4MNOA 3GTMH 2B2WC 4CKCA 4JI1Q 5BN4A 4KKSA 2E2IB 3ND8A 1HZ9A 1FYCA 4UPAA 4JVZA 4MIUA 4A3EB 4K0KQ 3RD4A 5I6YA 4HIKA 4UHVA 1PYBA 2L12A 1CM9A 4DV0Q 4IFDG 4JI0L 5BN3A 1AE3A 3H3VH 4FP5D 3NK9A 4R4TA 4YCWA 2NVYB 4A3KG 2B2YC 3PUZA 4PZ6A 4WJWA 2RSOA 1EEFD 5J1ZA 1PLFA 1CTMA 3CMEA 1OTCA 2R7ZG 1STGA 2NUCA 1TY0A 3R2IA 4LFAL 1VQJA 1BBUA 2PPBC 4LF7Q 2OQ0A 2A19A 4QIWE 4ZQ3A 1YVCA 3S9WA 4KJOA 3W5OA 4GKKQ 1I4QA 1Q8KA 3F1ZA 2PZWA 4RCOA 3SVMA 4ZLTF 1NNXA 1S4ZA 1EIGA 4A4IA 5KNBA 1HZCA 1PDQA 3J81i 1TS4A 1B7YB 1LTSD 1SEBD 4A3IB 2SEBD 3W2DA 1AH9A 1V1PA 1VDZA 4H44C 4MTNA 3LNNA 2RVLA 4DV0L 2E74C 4RKLA 1N8RC 1KDCA 1TWGH 4DK1A 2A1AA 4K2KA 1H9SA 4OGQC 2CWAA 3ND9A 1YHAA 3X3NA 3S2HB 2F4VL 1V9PA 3D0FA 4JI1L 1ICWA 4CDEC 1EOTA 1GD7A 3A7AB 4OO1G 4OXPA 1YNND 2IWHA 1AZPA 2CWPA 3ULLA 1QB5D 2XRQD 5C0XI 4HEDA 3HOXB 4C3IB 4ODGA 4DU9A 4LNQA 4AYBB 3P7JA 5JEAJ 4KY5A 4RGNA 1LABA 2D62A 1B4OA 3S2DB 1KDAA 5E1FA 2Z1CA 2B39A 3H6MA 4A3BB 4IPGA 1LTID 2LXJA 4BY1B 5ISRA 3PIO3 2RQXA 2L0CA 1O7IA 3R2TA 1Y1WB 1BUVT 4LF7L 5IYBG 5D65A 2N49A 1LTLA 1BVSA 1F2LA 1VQIA 3HG9A 3OWEB 1OXSC 2UU9Q 5M5XB 1CA5A 4LF5Q 1WOCA 3HOUH 1SBBB 3MFYA 1TIID 3NWSA 2M00A 4C3IG 1N9WA 1YIJA 1GHJA 1RHPA 1UE1A 3Q23A 1BR9A 5FLXL 1EY6A 1STHA 3J81E 3J81c 4A3BG 4DAMA 3KK7A 4LF6Q 4BY1G 1EWIA 2ATWA 3BJUA 4UDUC 4EGVA 4C3HH 5M3MB 3A74A 1JQYD 3S17H 1Z7TA 3GTLB 3I73A 5DM73 4KKUA 3PO3B 1SNDA 3PSIA 1LO5D 5DM63 1VQKA 1Q8IA 1RIPA 2R92H 1L0YB 4IZ8A 2AWOA 1EIFA 2VY3A 2NVXH 5ELCA 2OEOA 4LF8Q 4YCVA 1MJEA 4JOIA 3KUPA 4XQQA 3RZOH 4ABNA 3KJOA 3BVGA 2Q2HA 2YYZA 1FNUA 4JI5Q 2BDOA 1CZWA 4DNTB 5DEHA 1KNEA 3EIVA 1YHQA 4B3SQ 3SXHA 3Q8DA 5LL6X 4BBSG 1SYGA 2B29A 5M3MG 3I4LA 1WCMB 1UE7A 3CKIB 3D6WA 1F2ZA 1DOKA 1D5MC 1I4HA 4LK1C 4IUNA 1VMPA 4EVOA 1QZGA 2QILA 2IHFA 4JI7Q 1VF7A 2B63H 3OMGA 1FD7D 1H9KA 2AHOB 4JI6L 3PO3G 2EPBA 4K14A 5LHY1 3NHHA 1VQEA 1HTPA 1HPCA 2Z8LA 4DV4Q 3HOZB 1G291 1SYBA 1PFBA 4KTAA 2DJFC 2CHBD 1DM0B 3LX0A 1J6QA 2J0TD 1CA6A 2K28A 4LF6L 1U5KA 1Z6HA 4DAYB 1HQRD 2F0GA 1S5ED 1TWFB 3PGZA 3KBGA 1TWCB 5NUCA 1YBYA 4HJAA 2Q8TA 2E5LL 1YEZA 2H5XA 4XT1B 1VQBA 3M4OH 1QVGA 1UWVA 3RR5A 5HURA 5M3FB 1D2BA 3MFGA 1TY2A 4KHZA 3F2CA 4IOCA 1YHBA 5C0XG 5C4ZA 4LF8L 3HOZG 3LWUA 4CJ0B 4JV5Q 4JYAQ 2EY6A 1DGSA 1XMQQ 2H4OA 4PMBA 3V96A 1BBWA 4DAPA 3HOWG 3I7FA 1Y8OB 3AEVA 2EYLA 5KIXA 1EU4A 1BCPF 2A6ED 3NWTA 2VQFQ 1N33L 1JC7A 1C0AA 2C35B 4NXNQ 4LUOA 3L0OA 3OIQA 1VQGA 1SE4A 2F0SA 1K9MC 3MXGA 2K14A 3N52A 2YTXA 2J7ZA 1UE5A 3JAML 4FXKC 4R4CA 3VDYA 2HQEA 2NVTH 4RGTA 4LUVA 1ASZA 2PO4A 4IUVA 3OYYA 4LJZC 5M3FG 1NJIC 5I2XA 4GOPB 4NW2A 1SJHD 3F2DA 3BDCA 3IRBA 3GTGH 4A93H 4UP9A 5JOBA 4NB3A 4PQXA 1HNWQ 1GXDC 3TDQA 2UXCL 1LTRD 5IGBA 3KFUA 1II3A 5GAGC 1K28A 3FKIH 5E7NA 1NSNS 1STAA 2CQOA 3NTHA 5C44H 2K75A 1LT5D 2F0HA 4MN3A 3BVZA 1DXMA 3RN2A 4KKTA 5FO9B 1TKWB 4R4IA 3H94A 1B3AA 1HR0Q 1A0IA 5JEAG 4X64L 4GNXB 1WTXA 4DR4Q 5G3LD 2F0EA 4PZ7A 4F87A 2HIVA 4QF4A 5K36H 4DV3Q 1WVLA 3J7AV 1UEAB 5FLXc 4JI2Q 2EYMA 4LFCQ 1PH7A 2EY2A 4GS3A 4HJ8A 4DUZQ 2UUCQ 2KEEA 1SMXA 2PNRC 3U9OA 4BWGB 1KAWA 3OTOQ 1A15A 4YWMA 1XMQL 1JR0D 5CV7A 5I2YA 4N9PA 1XXGA 5IYCH 3MA2B 4FF3A 1MBYA 3HOVH 2ZXOA 1TWAH 2L4NA 1K8OA 1GUTA 3MAQA 2MGSA 3EA6A 4ZCKA 2E2DC 4R9WA 1YNJD 3FPUB 5C4XH 5M9OA 4NXNL 1W3SA 1B50A 4X66Q 4DK0A 4AQYQ 3BZDB 3DM1A 3GTQH 3C2PA 1DYQA 4A3MH 4BA2I 2E2HH 2R3ZA 2MO1A 2EYPA 1K8GA 2JA8H 3VR5A 1HNXQ 2JK8A 5EKKA 4O1NA 4YHHL 3UE1A 1FL0A 1EEID 2PCFB 3HOYH 2CQAA 1ILQA 2B2UC 1E2ZA 2F3WA 1A62A 1YNJC 4UP7A 5GROA 1KC8C 3Q24A 1CI3M 3I4MH 5D3DA 2F0IA 4TKOB 3JAMi 2XTIA 1KNAA 4IALA 3H0GH 2K5HA 1Y69U 5C4JH 1SNCA 1V1PB 1EYDA 2I46A 3O13A 1HR0L 4CKEA 4DR3L 5FJ8G 4OONA 1XTCD 4JBWA 2XIWA 5KYLA 3NUCA 4DR4L 4A3JG 1WJJA 1H9SB 1LLRD 3S16H 2I5LX 1SROA 3OW2A 5I9PA 5FKAC 3PO2H 1B9MA 1X65A 2ZTEA 1EL0A 4OIKA 1EYAA 3I4NH 2FHTA 2HHHL 2VXWA 1K8MA 1ZEQX 3K7AB 2EJGC 3S14B 4KD4A 1SFOB 1SYDA 2YTYA 3IFDA 2GVAA 4A76A 3VYRA 1PH8A 4RG1A 4KHPQ 2B2VA 1I50B 5LL6S 1KL9A 4K6LA 4GN4B 5K36G 3KYHC 1X6OA 3L7ZC 3NEMA 3FVQA 1MSGA 3R8BA 3P75A 2VNUD 4B9WA 1A6XA 3CMAA 1JORA 1CSQA 3N6RA 4FO2A 2FMCA 1N36L 1S5DD 1LTTD 4NXMQ 1I6HB 1R4PB 5M5YB 1Q1BA 1I3QH 4KHVA 4KY6A 1U0LA 1S40A 2JP1A 2SNSA 1VS0A 2JA6B 3TP5A 4A75A 1KRSA 5BR8Q 2E2JH 5EQ0A 4LFBL 1T5XD 1X3QA 2JQOA 1N32Q 1Q7YC 4ZKBB 3GO5A 4OEMB 1CHQD 1U4LA 2I5MX 4J8QA 3RZDB 4HCSA 5M5WH 2KHJA 1CSPA 2ALYB 5IYDH 2CH4W 3TBIB 1JT8A 3QJYA 1PRTD 3PV0A 3S15H 5HGTA 3VA5A 4L5SA 3JAME 2AWNA 3JAMc 1D8LA 1I94Q 2AUKA 2NN6G 3STBD 1STEA 2L1BA 4OO1I 3MWYW 1LV9A 5A35A 4DUYQ 2UXDL 1O80A 2EYHA 4A3DH 1ZYRD 2R61A 1HA5A 2EY1A 2ZM6L 3H0GG 3PUXA 4IJLA 4O0AA 2K01A 2JA6G 2KENA 2XWBB 3HRZC 1FGBD 4DR5L 1EQQA 1PV4A 3DLLA 4C2MB 2JN4A 1EFID 1FGUA 3M85A 3HGBA 1PRTC 2VZAA 4Q5VA 3ZYYX 4KHPL 3P20A 2OT2A 4LF9L 2ZT9C 4WJ4A 1YITA 1ESFA 2LKVA 3CCVA 3STBC 2IL8A 1SE2A 3E0JA 4RGMA 4MTKA 1L0XB 1PTOD 3MXNA 2WFWA 3SHLA 3PCOB 4BY7H 1F9PA 4ZYSA 1E2WA 2NZ1D 4RH6A 5IP9H 4NKLA 5J22A 2JA7H 3BS1A 1ZYRC 4C3JB 1S5FD 2RDHA 1PA6A 3WOEA 2JE6I 5LMUL 4RHRA 3QG1A 4JC0A 5C3EG 3R93A 3E0EA 4JI3Q 5KGUA 1IBKQ 1WFQA 2D5DA 5BR8L 2VS1A 4LAAA 3S1QB 2F0QA 1N32L 1S5BD 4DV5L 4A3EH 2EYOA 3EFXD 1PTOC 1N34Q 3D8GA 2K5DA 1X32A 1XNQL 1STBA 1FR3A 2EXZA 2A69C 2VL6A 4CJ2C 2AQ3B 2EJMA 3QB3A 4XT3B 1S72A 3A0JA 3BU2A 3NE5B 5CBAE 1I94L 2PMZE 3S1MB 4YCUA 2ICIA 4JW0A 2CKZB 4KN7C 4C3JG 3K57A 4P74A 1WTRA 5JJKA 2QKIC 4DV7Q 3QOLA 1KQSA 4HMIA 3TSSA 3C3LA 3CCRA 1AW7A 1BQQT 1EU3A 1GOZA 3K5OA 4H02A 1LT3D 1DD2A 1I6VC 1YJWA 1LT6D 5JPMC 2KEDA 3CU7A 2JEBI 1BKBA 1BCPB 3BDLA 2KOLA 3A55A 4X3TA 3K8AA 2RDFA 1NBWA 2MUYA 3KDFA 1QWYA 3LGJA 2UUBL 2F0WA 2DNEA 4A3IH 2MO0A 1D5XC 4TRDA 4PMWA 3GDEA 2D2CC 3AFQA 4A3FB 1Y8NB 1PTOB 3TRZA 2PZUA 3VR4A 4IQZA 2QCPX 3IKJA 4L63B 1IBKL 4A3GH 4JBJA 1A8VA 1RODA 2MNAA 4IUPA 5GAEC 1RDPD 3NENA 2LMCB 1W2BA 5D3IB 1WI5A 2NVQH 4DK3C 2EY5A 1N34L 3NBHB 1U4PA 3CHBD 3HOXH 2F52A 3T56B 1EIYB 5IOCA 3E6ZX 1ASYA 4X3KA 1JMCA 5TSSA 3T51B 1E2VA 2B8FA 3OWFA 1VQMA 2F0MA 2VQEL 2JYOA 1BO0A 4K2LA 2QW7A 1M90C 4APVA 5FO8B 4ILWA 4DV7L 1NE3A 1Y1WH 1CHPD 4A3FG 1R4QB 1OXTA 2HCCA 3AMUA 1KABA 4K0KL 4IUUA 1PFSA 3TP7A 5KYIA 4OELB 1E22A 1VQ4A 2WINB 4DV2Q 4OHJA 2O5IC 2V1CC 1D1KA 4H7BA 3SDZA 4F7XA 4U68A 1Y1VH 1WTPA 2O2LD 1D7QA 2JJQA 5FLMH 1J5EQ 3I70A 3PIOA 1WD0A 1QVCA 2IX1A 2NZOA 1UNSA 2EOTA 1Q1EA 1YJ9A 1VQPA 5FK9C 1QUQA 5CGKA 4UAIA 1D6EC 5CV5A 4DV1Q 1PYSB 4R8IA 3T1HQ 2D9UA 1HH2P 4O42A 4RHSA 1TQOA 3CCQA 4P72A 4I65A 4GKKL 4X62Q 1AN8A 4QQBX 3KBXA 4ZRZA 3A8JE 3GTLH 4K5WA 3QO2A 1LTGD 1BNZA 1GHKA 1FNWA 5G3LF 1TWHH 4G4KA 5T1IA 5IP7H 3RNUA 1JJCB 4HJ9A 3HKZE 3S1RH 2Q2TA 1V43A 3W1BA 3KLRA 1SNPA 4JK1C 1K0RA 4HR7B 2IY5B 4DV6Q 2TSSA 4X6AH 3NBIA 3D4WA 5DNFA 1NMGA 2Z6KC 4BBSB 4G57A 3A7LA 1H9MA 4L6TB 2R7DA 3M4QA 2I07B 5CV8A 1WCMH 4JCVE 1B70B 4B3MQ 1EOVA 5KNCA 2X6LA 2ZJQA 1TS5A 4YY3Q 2HDLA 4HSPA 4OWXB 1R9TH 4DR1Q 4DGZA 3CW2C 5I9OA 3ULPA 3KF8A 3AFPA 3CC7A 2I0QA 2K04A 4J15A 3U9SA 4CGYB 2AQ1B 1M4VA 2A74C 2XNAC 2EYJA 4ZAIA 1A3TA 2WIIB 4ME5A 4H13C 1IBMQ 3T1HL 5D14A 2MFIA 4F8MA 3D3RA 1F9QA 2TMPA 3BZKA 1TWFH 5IWAQ 4GLXA 4X62L 1TWCH 3DHQA 4P71A 2UU9L 2FMMA 4HN7A 4KJNA 5JVG3 4LF5L 4WFN3 1GKHA 2EJFC 1RKNA 4IUQA 1BDOA 1VQCA 2EYFA 4DXFA 4HCEA 3GTKH 1EY4A 1XPOA 4JBKA 1MKHA 1K0SA 1L1OA 2JSOA 4C3HB 3EBEA 4GZYC 2UXBQ 1IXRA 3RLFA 3CQZH 4X3UA 3SR1A 3D4DA 4Y52H 4FYDA 1I4XA 4A3LH 5E3FA 3HOWB 3K7UC 3BYYB 2ZXPA 3HOUG 1EYCA 3I2ZA 2ZJRA 4GOPC 1QNUA 1SE8A 2L5TA 3HS0C 4QUFA 4IN3A 2NVXB 1K3RA 1K3BC 2VB3X 4B3ML 3J7ZC 1L2FA 3RZOB 1Y14B 4K6DA 1VQHA 4YY3L 1PH5A 2JA5H 1M8AA 4U673 2G9DA 3NXWA 3NP8A 1JOQA 4QUCA 3CCLA 1RTOA 1XTDA 1VF5C 1SMYD 1EY5A 3RUZA 4GNXC 3GQBA 1WTHA 4C3HG 2KHIA 1MI2A 5J3BA 1DCZA 1SLJA 2QDLA 2EE1A 4HMJA 4ULLA 4JI5L 3PIP3 4B3SL 2B63B 2QDBA 5ELEA 4N8FA 1ILPA 3HKSA 2B8GA 3MXNB 3WWVA 2LFNA 4J6HA 2XWJB 2ASBA 1LTBD 5CMDA 2R92G 2E8GA 4KK7A 2IX3A 5C4HA 4CDDC 1PRTF 3K58A 1V8QA 3CF5A 4QIWB 2YV5A 4PV1C 4JI7L 3KOJA 1SMYC 1IL8A 1I5FA 4KLKA 2KUMA 1GUNA 4DV4L 2YTVA 5EBDA 4BBRH 1B2TA 1IW7D 4B08A 3J7A5 4HIOA 4JPBW 2KA7A 4A3CH 2YU9B 4ID6A 1FJGQ 4P73A 1B3QA 2ZTCA 1XPUA 2QEXA 3K80C 2OF1A 3BYTB 4LMQD 1CKNB 2AQ2B 3T53B 3M4OB 2Z4HA 3Q0AA 2B63G 3CPFA 3SEBA 3QR8A 2NN6I 5IT9L 1OXUA 1JWMD 3G71A 2O4XA 1P8LA 2B2TA 2R6GA 4N8X1 3K0YA 1IW7C 3DWQA 2B2WA 1ET9A 2EQSA 1VQOA 2LY7A 3X3MA 5FLXE 1XMOQ 2KCNA 2EDGA 4IPHA 3RLOA 2PQEA 2SDFA 1VCIA 1LT4D 1OO9B 2VUMH 2RDGA 1W6JA 4NMZA 3EQLC 4JYAL 4JV5L 3QWNA 4H0LC 4GN3B 3M3YH 4XYQA 1L0WA 1F2MA 1NR2A 2A5HA 2B2YA 1HTLD 2WP8J 3E9HA 2F0LA 2MHVA 3FHWA 3DXJC 3FRPB 5KEEA 2E75C 3OW7A 3OMCA 2R93H 3VYTA 3KDFB 3PUVA 1QCBD 2LXKA 4DKAC 4DNIA 2JA5G 2NVTB 3HEJA 1XWEA 2VQFL 3NTIA 4A3JB 3GTGB 4JG2A 1JICA 4A93B 1VQAA 5EKLA 2Q2UA 2SNMA 2EVBA 2MP1A 1GUSA 2HUGA 5T1GA 3FPPA 1HZBA 2LS01 2A68C 4YIJA 1XPRA 1X55A 1GVPA 4CBVA 3UDGA 3GTJB 1HNWL 4OX9Q 1EY7A 3HZXA 4EQNA 2IX0A 3MXUA 4IFDJ 1F9RA 4TQUS 4N9TA 2G9HD 1G6ZA 1O78A 2QA4A 4LWCA 2ZTDA 4I7AA 3G4SA 1PH9A 5IGFA 3TZUA 4O2DA 3B6YA 1A2TA 1KRTA 2L11A 2WB1E 1QNKA 1Q12A 2L55A 4A93G 5LMNQ 1EQVA 4DV3L 1SYEA 5KRUA 4RGOS 4JI2L 3VYUA 3ICEA 3SE0A 3HOVB 4LFCL 3FKIG 4DUZL 1VQNA 4IPDA 2UUCL 5C44G 1EYGA 2RCFA 3OTOL 3EROA 4X65Q 4K8IA 1EFWA 4HAEA 3G48A 1XX8A 1CQFA 1XJVA 3HKZG 1IHZA 1X3EA 5ELFA 1SXTA 4A3MB 1E1TA 5C5LA 1AZQA 2KBNA 1J9OA 4L8JA 1Q82C 1DOMA 3BZCA 4X66L 4C1NI 2FINB 4AQYL 2OCEA 3J7YW 1Q3LA 3HOYB 4PG3A 3ULJA 3OOCA 3TZDA 4AYBE 1XYIA 1YI2A 1G2TA 4WORA 5IYCG 5COYA 2F0PA 3D6CA 4UY8C 1HNXL 3H0GB 3HOVG 5LMNW 4JOIC 1XNRQ 2IHEA 3S1NH 1J8IA 3H15A 1VQ6A 5C4XG 3BDOA 2PQAA 2K03A 1JJGA 4C1NK 1U9RA 4DR7Q 2QF7A 3S16B 3TS2A 2MJ8A 2A6HD 4HJ5A 5EPJA 5EPKA 2F0TA 4A3MG 4ZUJA 3CCSA 1B53A 3I4NB 5FOBB 1PZJD 4RMFA 5IIFA 2JA8G 4DFAA 1LUZA 3A8IE 4XQNA 1DONA 1ENFA 3FMCA 4DR2Q 4AIMA 1F2YA 3HOYG 3GTOB 3DM3A 2B3GA 2EZVA 3I4MG 5C3EB 2Y0SE 3TREA 1U4MA 5J39A 4L5TA 1BCPD 3ER0A 4X65L 3VR6A 3I55A 3TS0A 2A6HC 2K52A 3R3OA 5ELNA 3SK8A 4JI8Q 1CZGA 3UDFA 4DF7A 4IFDH 2KCMA 3C1FA 4DA2A 1B44D 5IT9E 1AE2A 5IT9c 4A3KH 1G8ZD 3C46A 4DR6Q 2DY7A 4V190 3PO2G 1S3OA 4QCLA 4I7ZC 2CVRA 1WD1A 1Z9FA 3I4NG 2R7ZH 1NAPA 2A69D 1O7YA 3S1MH 2E2JB 1BCPC 1C48A 1OXXK 3RLNA 4NXML 1E3PA 3H3VI 1NY4A 1EZ8A 1HFGA 4PMCA 2IW3A 5EBCA 2CCZA 4QGUA 4LW1A 1XNRL 1RF2D 5EAYA 2RCNA 2F4IA 2NTSA 1VQ9A 2E2IH 3S15B 1X3PA 3CAMA 4GLAC 2DGYA 4DR7L 5E4XA 4AH6A 1QE6A 2XVSA 1KTKA 4S3SA 4DXGA 2JA9A 1LYLA 5CR3A 1WTQA 1X54A 2L15A 4Y7NB 1L1OB 1EQRA 3BVMA 4CHTB 1T9HA 3AB9A 5GAHC 1X56A 3FDTA 2NVYH 3KJPA 1TS2A 1I4PA 1M1KC 2WV6D 4XIGS 3TMEA 1DOLA 2LSSA 4DR2L 1Q81C 1JWUD 3L2PA 4ZKCB 5K5PA 4K8JA 3G6EA 4Z9CB 4OL7A 4DUYL 1PTOH 2N55A 1E0BA 4FF1A 4OO1H 2RHQB 3M9BA 4MHEA 2CW0D 5EKIA 1IBLQ 5IYDG 2K5QA 3IAYA 4JI8L 5DAUA 3I72A 2V4DA 3EVQA 3S24A 1WTVA 3GV3A 2JA7B 2VW9A 4P2CB 1RD9D 4QY7A 3SK6A 3M4PA
chains in the Genus database with same CATH topology
1NMGA 2Z6KC 4R4CA 3VDYA 3J80i 3CCEA 5C3EH 4LUVA 3A5UA 2NVTH 1GM5A 2R93G 2R7DA 1ASZA 2R7FA 1B8AA 3OYYA 4LF9Q 3M4QA 5M3FG 4OX9L 1VQ5A 1NJIC 3CC2A 2F4VQ 4HJ7A 4GOPB 3F2DA 1WYDA 3GTGH 4A93H 3IRBA 1WCMH 4JCVE 4UP9A 4A3DG 4NB3A 1HNWQ 4EX5A 1B70B 4B3MQ 3M7NA 2UXCL 1EOVA 2EIFA 4C2MH 3KFUA 1NMFA 2D0OA 2K50A 2Q2IA 2ZJQA 5GAGC 3FKIH 5E7NA 4YY3Q 4YWLA 2CQOA 4OWXB 1R9TH 5C44H 4KI0A 1KD1C 5IYBH 3S2HH 2K75A 4DR1Q 4B3RQ 5LMUQ 1V1QA 3CW2C 4JI3L 3ULPA 1Z47A 3PUWA 3PUYA 3PF5A 1OXVA 3AFPA 3TQYA 3RN2A 3CC7A 2I0QA 2Z6KA 4LUZA 4R4IA 4J15A 2PNHA 2HT1A 3FP9A 1A0IA 5JEAG 5LMNL 1HR0Q 4X64L 4GNXB 4IJHA 2HQLA 4C3JH 4B3TQ 4BY7G 4DR4Q 4C3IH 1IBMQ 1L1OC 4PZ7A 5IP9G 4DV5Q 3T1HL 2MFIA 2JA7G 4BXXG 1X3FA 2HIVA 3M4OH 1KXLA 1HJPA 5C0XJ 4DV3Q 3T1YQ 3BZKA 5FLXc 4JI2Q 1XNQQ 4XTCS 1SRUA 1TWFH 5IWAQ 4GLXA 4HJ8A 4GS3A 4X62L 4DUZQ 1PH7A 4LFCQ 1TWCH 3PF4A 1MIUA 2UUCQ 1SMXA 3CD6A 3AYHB 4P71A 2UU9L 3S2DH 3S1QH 1KAWA 3OTOQ 4LF5L 4YWMA 1XMQL 1GKHA 4A3BH 5IYCH 1VQCA 1PH6A 4BY1H 3KLWA 3F8TA 4EQ5A 4A3EG 3GTKH 1TWAH 3HOVH 3KF8B 2F3IA 4Y7NH 1XPOA 4JBKA 1MKHA 3UDXA 3MEFA 2KCTA 3TEHB 1L1OA 1HZAA 5DLQE 5C4XH 1C7YA 3EBEA 2OWOA 1IBLL 4NXNL 2UXBQ 1IXRA 2PI2E 3KF6B 3RLFA 3CQZH 2OTLA 4JBMA 1W3SA 5M5XH 4GKJQ 4X66Q 4Y52H 4AQYQ 3HFZB 4HIMA 2OQKA 4A3LH 5HGQA 3GTQH 1PH2A 1IYJB 3CCMA 4BA2I 3K7UC 2GVBA 4ALPA 3U58A 4A3MH 2E2HH 2MO1A 4IPCA 3A5ZB 1K8GA 2JA8H 3HOUG 3I2ZA 3RN5A 2ZJRA 4GOPC 4JI0Q 4P75A 1HNXQ 1SE8A 2JK8A 1X9NA 2K4KA 4YHHL 2WAQG 3ERSX 2BH8A 3UE1A 1K3RA 1FL0A 2UUBQ 3GD7A 4B3ML 4POGA 3HOYH 3W1GA 1L2FA 3J7ZC 1A62A 4UP7A 5GROA 1Y14B 3D31A 1KC8C 1VQHA 4YY3L 4TVAB 3J80c 4GLVB 1PH5A 2JA5H 2Z0SA 3I4MH 3JAMi 3I4OA 4BBSH 2XTIA 4QL5A 4B3RL 2WB1G 2ID0A 3H0GH 4QY7A 2K5HA 3CCLA 2RHSB 4LFAQ 5M3MH 5C4JH 1G6PA 1YNXA 1XTDA 1KIXA 4GN5A 4GNXC 1HR0L 3U50C 2KHIA 5JJLA 5J3BA 4DR3L 5FJ8G 1SLJA 4OONA 4JBWA 2JEAI 4A3IG 4GOPA 4B3TL 3NELA 4DR4L 4A3JG 1A63A 4JI5L 1WJJA 4YWKA 2GN5A 3S16H 3PO3H 2I5LX 1SROA 3OW2A 1VQ7A 2ES2A 1IL2A 2XGTA 4B3SL 5HY6A 4A3FH 1E1OA 3PO2H 1SR3A 3T1YL 3U4VA 1X65A 2ZTEA 1CKNA 1JE5A 2CFMA 3HKSA 3MXNB 3I4NH 3WWVA 2HHHL 1PVOA 5AJ3Q 2ASBA 2R92G 4HIDA 1C9OA 2E8GA 1VQLA 4A3GG 4A3GH 3CF5A 2DUDA 2YV5A 4ME3A 4JI7L 1K83H 3KOJA 2VQEQ 2YTYA 4DPGA 5ELOA 4GNXA 2K5VA 3GTPH 2GVAA 4A76A 1PH8A 4DR6L 4RG1A 1YJNA 1I5FA 4KLKA 3HOXG 4KHPQ 2D0PA 4PZ8A 4DV4L 2YTVA 4JI6Q 1KL9A 2N3SA 4MNOA 4BBRH 3GTMH 4GN4B 5K36G 3J7A5 4HIOA 1PH4A 4A3CH 3KYHC 4JI1Q 4AYBG 1X6OA 1FJGQ 3AQQA 4GKJL 3L7ZC 3NEMA 4P73A 2ZTCA 2VNUD 1XPUA 4DV2L 1HZ9A 3CMAA 2MQHA 4UPAA 3K80C 2QEXA 1CSQA 1E7ZA 4K0KQ 4BA1I 2EXDA 1CKNB 4HIKA 1N36L 1PYBA 4NXMQ 4DV0Q 4IFDG 3UDIA 4JI0L 1Q1BA 1J5EL 1AE3A 1I3QH 2B63G 3CPFA 3H3VH 4R4TA 4YCWA 1U0LA 2NN6I 4A3KG 1S40A 3HOZH 1OXUA 3CP0A 2N8NA 1VS0A 3G71A 3PUZA 1Y1WG 4PZ6A 2UUAQ 1P8LA 4A75A 1KRSA 2R6GA 5BR8Q 2E2JH 3CMEA 3KF6A 4MZ9A 4DV1L 1OTCA 2R7ZG 4LFBL 2JQOA 1N32Q 1Q7YC 2E5LQ 3GO5A 3HOWH 2EQSA 2I5MX 4R4QA 1VQOA 5M5WH 1XMOQ 4IPHA 2KHJA 4LFAL 3RLOA 1CSPA 1VQJA 4NPSA 1BBUA 2ALYB 5IYDH 1VCIA 1Y1VG 4LF7Q 2OQ0A 2A19A 2VUMH 4QIWE 1JT8A 1YVCA 3PV0A 4IFDI 5FLMG 3S15H 4JYAL 1LM0A 3W5OA 4JV5L 4GN3B 3M3YH 4GKKQ 1L0WA 4L5SA 2Y0SG 1Q8KA 2AWNA 3F1ZA 3JAMc 1D8LA 1I94Q 3E9HA 2WP8J 2OTJA 2NN6G 3FHWA 3STBD 2R93H 4OO1I 2BH2A 4A4IA 3KDFB 3CPWA 3PUVA 2LXKA 5M3FH 4DKAC 4DNIA 1HZCA 2JA5G 2I5HA 3J81i 4DUYQ 5AJ3L 2UXDL 1B7YB 4A3DH 2VQFL 2ZM6L 3H0GG 2PQAB 4DV6L 1AH9A 3PUXA 4JG2A 1VQAA 2Q2UA 1QZHA 4IJLA 1IZ6A 4O0AA 4IO9A 4MTNA 2KENA 5H1SE 2JA6G 1N33Q 4DR5L 1EQQA 1PV4A 3DLLA 4DV0L 1FGUA 3M85A 1N8RC 1TWGH 1Q86C 2VZAA 1HZBA 2A1AA 2RF4A 4KHPL 2CWAA 4LF9L 4WJ4A 1YHAA 1YITA 1XPRA 3CCVA 2F4VL 1X55A 2HIXA 3STBC 5IP7G 1GVPA 1V9PA 3D0FA 4JI1L 3UDGA 1HNWL 1GD7A 4OO1G 2WFWA 4OXPA 4OX9Q 3PCOB 4BY7H 2CWPA 2IX0A 3F2BA 5IP9H 2JA7H 4IOAA 3I56A 4IFDJ 3ULLA 4TQUS 5C0XI 2UXCQ 2WAQE 1PA6A 4FDBA 4DR1L 2JE6I 5LMUL 1PH3A 2QA4A 4LWCA 2ZTDA 4LNQA 3G4SA 3K81C 1G51A 1PH9A 3ZJYC 5JEAJ 4JC0A 2UUAL 5C3EG 3PIPA 3E0EA 4JI3Q 1IBKQ 4O2DA 3B6YA 2YU9H 1WFQA 5BR8L 2D62A 1KRTA 2VS1A 2WB1E 1Q12A 1N32L 1IBML 4A93G 4A3EH 4DV5L 1WCMG 5LMNQ 4IPGA 4X64Q 2LXJA 1N34Q 4DV3L 1UE6A 1XNQL 4JI2L 3ICEA 2VL6A 3CC4A 4LFCL 1O7IA 5IWAL 3FKIG 4DUZL 1VQNA 4IPDA 4LF7L 2UUCL 5C44G 1EYGA 5IYBG 3OTOL 2N49A 4X65Q 1HNZQ 1EFWA 1LTLA 1S72A 1JB7A 3A0JA 1BVSA 3BU2A 1VQIA 3G48A 4JI4Q 1OXSC 2PMZE 1I94L 2UU9Q 4YCUA 1Q46A 1XJVA 4LF5Q 3HKZG 1WOCA 1X3EA 1CKOA 2CKZB 3HOUH 1PH1A 4WJ3M 4P74A 5JJKA 1N9WA 1E1TA 1YIJA 4DV7Q 1KQSA 3SGIA 2KBNA 3CCRA 2UXBL 1UE1A 4H02A 3EN2A 1CUKA 1Q82C 4X66L 3BZCA 4AQYL 2OCEA 1NTGA 1YJWA 4PG3A 2JEBI 3ULJA 1BKBA 3J81c 4AYBE 4DAMA 4A3BG 1YI2A 5IYCG 1EUJA 1VQFA 4LF6Q 1I6HH 4BY1G 4UY8C 1HNXL 1EWIA 2ATWA 3BJUA 3K8AA 5LMNW 1NBWA 4JOIC 3KDFA 3HOVG 4C3HH 3A74A 3LGJA 2UUBL 1XNRQ 2IHEA 5FJ8H 4A3IH 3S1NH 3S17H 4A3JH 2MO0A 1VQDA 3H15A 2A8VA 4YHHQ 1VQ6A 5C4XG 2PQAA 3GDEA 4PMWA 1JJGA 2K5NA 4UP8A 4DR7Q 3AFQA 3K0XA 3TS2A 3PSIA 1E24A 1VQKA 4A3LG 4HJ5A 3TRZA 1RIPA 5GQOA 2R92H 3CCUA 4A3MG 1RL2A 1VQ8A 2ZJPA 3CCSA 2AWOA 1EIFA 1IBKL 4JBJA 1A8VA 2VY3A 4RMFA 2NVXH 2MNAA 2JA8G 5GAEC 3GTJH 4LF4Q 4LF8Q 1LUZA 3NENA 4YCVA 1W2BA 4QJFA 5GADC 1WI5A 2NVQH 1MJEA 4JOIA 4DK3C 3RZOH 4DR3Q 4DR2Q 4AIMA 3KJOA 2Q2HA 1N34L 3NBHB 3HOYG 2YYZA 3DM3A 3HOXH 2F52A 2B3GA 4JI5Q 1TXYA 1EIYB 3I4MG 3EIVA 1YHQA 4B3SQ 1UEBA 2Y0SE 3Q8DA 3TREA 1ASYA 1FVIA 4BBSG 1JMCA 4L5TA 3ER0A 4OWTB 2B29A 4X65L 3I55A 1HNZL 3TS0A 4JI4L 2HHHQ 5M3MG 3J81j 1VQMA 1K73C 2K52A 1UE7A 2VQEL 5ELNA 1X3GA 4JI8Q 3UDFA 1QZGA 3JC66 2IHFA 2KCMA 4POFA 4JI7Q 1M90C 2B63H 4APVA 2AHOB 1AE2A 5IT9c 4A3KH 4JI6L 4DV7L 3PO3G 4DR6Q 1NE3A 1Y1WH 1VQEA 4A3FG 3PO2G 1S3OA 2BA1A 1FJGL 4DV4Q 3K7AH 1G291 1OXTA 1GO3E 1Z9FA 3S14H 3I4NG 2R7ZH 5IE8A 3S1MH 4K0KL 3CCJA 1PFSA 4BXXH 1E22A 1VQ4A 1SFOH 1J6QA 1OXXK 4DK6C 3RLNA 4DV2Q 4NXML 1E3PA 3H3VI 1NY4A 2V1CC 1U5KA 4LF6L 5IY0A 2QGQA 1N36Q 4DAYB 1HR0W 1Y1VH 2N78A 3UE0A 4R4OA 1I50H 4LW1A 4QGUA 2CCZA 1D7QA 1XNRL 2AKWB 5EAYA 2JJQA 5FLMH 1J5EQ 3PGZA 3PIOA 2RCNA 4BBRG 1QVCA 1YBYA 4HJAA 1VQ9A 2E2IH 2IX1A 2NZOA 2BA0A 3CAMA 4GLAC 4A3CG 2DGYA 4DR7L 1Q1EA 1YJ9A 1VQPA 2E5LL 3E9IA 1QUQA 1YEZA 2H5XA 4AH6A 1KHIA 1P16A 2NZHA 4R1JA 1PYSB 4DV1Q 4LFBQ 1VQBA 1LYLA 2JA9A 1XMOL 2AMCB 1X54A 2L15A 3T1HQ 1UWVA 3RR5A 1HH2P 1QVGA 5M5YH 1L1OB 1JJ2A 1EQRA 5GAHC 1T9HA 1YZ6A 1X56A 1CKMA 4KHZA 2NVYH 3F2CA 1YHBA 3CCQA 4IOCA 4P72A 3KJPA 5C0XG 4LF4L 4LF8L 2JA6H 2FXQA 1M1KC 4X62Q 4GKKL 4XIGS 1QVFA 3HOZG 4QQBX 2LSSA 4DR2L 1Q81C 4JV5Q 4JYAQ 1DGSA 3L2PA 1XMQQ 3GTLH 4L5QA 3U4ZA 3G6EA 3RZDH 1PHJA 2PI2A 1C0AA 1TWHH 5IP7H 4DUYL 1BBWA 3HOWG 3I7FA 4L5RC 3RNUA 1JJCB 4HJ9A 3HKZE 3S1RH 2RHQB 3AEVA 3M9BA 2Q2TA 1V43A 1H95A 2UXDQ 4OWWB 2IT1A 3CXCA 1SN8A 3W1BA 1QUQB 2VQFQ 1IBLQ 5IYDG 2ZM6Q 1N33L 1K0RA 2C35B 4LUOA 4NXNQ 3L0OA 4JI8L 4DV6Q 1VQGA 2VUMG 1MJCA 2IY5B 4X6AH 3S24A 2VW9A 1K8AC 3GTOH 1K9MC 4DR5Q 5JJIA 2K14A 2YTXA 3M4PA 1UE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMG A;  2Z6K C;  4R4C A;  3VDY A;  3J80 i;  3CCE A;  5C3E H;  4LUV A;  3A5U A;  2NVT H;  1GM5 A;  2R93 G;  2R7D A;  1ASZ A;  2R7F A;  1B8A A;  3OYY A;  4LF9 Q;  3M4Q A;  5M3F G;  4OX9 L;  1VQ5 A;  1NJI C;  3CC2 A;  2F4V Q;  4HJ7 A;  4GOP B;  3F2D A;  1WYD A;  3GTG H;  4A93 H;  3IRB A;  1WCM H;  4JCV E;  4UP9 A;  4A3D G;  4NB3 A;  1HNW Q;  4EX5 A;  1B70 B;  4B3M Q;  3M7N A;  2UXC L;  1EOV A;  2EIF A;  4C2M H;  3KFU A;  1NMF A;  2D0O A;  2K50 A;  2Q2I A;  2ZJQ A;  5GAG C;  3FKI H;  5E7N A;  4YY3 Q;  4YWL A;  2CQO A;  4OWX B;  1R9T H;  5C44 H;  4KI0 A;  1KD1 C;  5IYB H;  3S2H H;  2K75 A;  4DR1 Q;  4B3R Q;  5LMU Q;  1V1Q A;  3CW2 C;  4JI3 L;  3ULP A;  1Z47 A;  3PUW A;  3PUY A;  3PF5 A;  1OXV A;  3AFP A;  3TQY A;  3RN2 A;  3CC7 A;  2I0Q A;  2Z6K A;  4LUZ A;  4R4I A;  4J15 A;  2PNH A;  2HT1 A;  3FP9 A;  1A0I A;  5JEA G;  5LMN L;  1HR0 Q;  4X64 L;  4GNX B;  4IJH A;  2HQL A;  4C3J H;  4B3T Q;  4BY7 G;  4DR4 Q;  4C3I H;  1IBM Q;  1L1O C;  4PZ7 A;  5IP9 G;  4DV5 Q;  3T1H L;  2MFI A;  2JA7 G;  4BXX G;  1X3F A;  2HIV A;  3M4O H;  1KXL A;  1HJP A;  5C0X J;  4DV3 Q;  3T1Y Q;  3BZK A;  5FLX c;  4JI2 Q;  1XNQ Q;  4XTC S;  1SRU A;  1TWF H;  5IWA Q;  4GLX A;  4HJ8 A;  4GS3 A;  4X62 L;  4DUZ Q;  1PH7 A;  4LFC Q;  1TWC H;  3PF4 A;  1MIU A;  2UUC Q;  1SMX A;  3CD6 A;  3AYH B;  4P71 A;  2UU9 L;  3S2D H;  3S1Q H;  1KAW A;  3OTO Q;  4LF5 L;  4YWM A;  1XMQ L;  1GKH A;  4A3B H;  5IYC H;  1VQC A;  1PH6 A;  4BY1 H;  3KLW A;  3F8T A;  4EQ5 A;  4A3E G;  3GTK H;  1TWA H;  3HOV H;  3KF8 B;  2F3I A;  4Y7N H;  1XPO A;  4JBK A;  1MKH A;  3UDX A;  3MEF A;  2KCT A;  3TEH B;  1L1O A;  1HZA A;  5DLQ E;  5C4X H;  1C7Y A;  3EBE A;  2OWO A;  1IBL L;  4NXN L;  2UXB Q;  1IXR A;  2PI2 E;  3KF6 B;  3RLF A;  3CQZ H;  2OTL A;  4JBM A;  1W3S A;  5M5X H;  4GKJ Q;  4X66 Q;  4Y52 H;  4AQY Q;  3HFZ B;  4HIM A;  2OQK A;  4A3L H;  5HGQ A;  3GTQ H;  1PH2 A;  1IYJ B;  3CCM A;  4BA2 I;  3K7U C;  2GVB A;  4ALP A;  3U58 A;  4A3M H;  2E2H H;  2MO1 A;  4IPC A;  3A5Z B;  1K8G A;  2JA8 H;  3HOU G;  3I2Z A;  3RN5 A;  2ZJR A;  4GOP C;  4JI0 Q;  4P75 A;  1HNX Q;  1SE8 A;  2JK8 A;  1X9N A;  2K4K A;  4YHH L;  2WAQ G;  3ERS X;  2BH8 A;  3UE1 A;  1K3R A;  1FL0 A;  2UUB Q;  3GD7 A;  4B3M L;  4POG A;  3HOY H;  3W1G A;  1L2F A;  3J7Z C;  1A62 A;  4UP7 A;  5GRO A;  1Y14 B;  3D31 A;  1KC8 C;  1VQH A;  4YY3 L;  4TVA B;  3J80 c;  4GLV B;  1PH5 A;  2JA5 H;  2Z0S A;  3I4M H;  3JAM i;  3I4O A;  4BBS H;  2XTI A;  4QL5 A;  4B3R L;  2WB1 G;  2ID0 A;  3H0G H;  4QY7 A;  2K5H A;  3CCL A;  2RHS B;  4LFA Q;  5M3M H;  5C4J H;  1G6P A;  1YNX A;  1XTD A;  1KIX A;  4GN5 A;  4GNX C;  1HR0 L;  3U50 C;  2KHI A;  5JJL A;  5J3B A;  4DR3 L;  5FJ8 G;  1SLJ A;  4OON A;  4JBW A;  2JEA I;  4A3I G;  4GOP A;  4B3T L;  3NEL A;  4DR4 L;  4A3J G;  1A63 A;  4JI5 L;  1WJJ A;  4YWK A;  2GN5 A;  3S16 H;  3PO3 H;  2I5L X;  1SRO A;  3OW2 A;  1VQ7 A;  2ES2 A;  1IL2 A;  2XGT A;  4B3S L;  5HY6 A;  4A3F H;  1E1O A;  3PO2 H;  1SR3 A;  3T1Y L;  3U4V A;  1X65 A;  2ZTE A;  1CKN A;  1JE5 A;  2CFM A;  3HKS A;  3MXN B;  3I4N H;  3WWV A;  2HHH L;  1PVO A;  5AJ3 Q;  2ASB A;  2R92 G;  4HID A;  1C9O A;  2E8G A;  1VQL A;  4A3G G;  4A3G H;  3CF5 A;  2DUD A;  2YV5 A;  4ME3 A;  4JI7 L;  1K83 H;  3KOJ A;  2VQE Q;  2YTY A;  4DPG A;  5ELO A;  4GNX A;  2K5V A;  3GTP H;  2GVA A;  4A76 A;  1PH8 A;  4DR6 L;  4RG1 A;  1YJN A;  1I5F A;  4KLK A;  3HOX G;  4KHP Q;  2D0P A;  4PZ8 A;  4DV4 L;  2YTV A;  4JI6 Q;  1KL9 A;  2N3S A;  4MNO A;  4BBR H;  3GTM H;  4GN4 B;  5K36 G;  3J7A 5;  4HIO A;  1PH4 A;  4A3C H;  3KYH C;  4JI1 Q;  4AYB G;  1X6O A;  1FJG Q;  3AQQ A;  4GKJ L;  3L7Z C;  3NEM A;  4P73 A;  2ZTC A;  2VNU D;  1XPU A;  4DV2 L;  1HZ9 A;  3CMA A;  2MQH A;  4UPA A;  3K80 C;  2QEX A;  1CSQ A;  1E7Z A;  4K0K Q;  4BA1 I;  2EXD A;  1CKN B;  4HIK A;  1N36 L;  1PYB A;  4NXM Q;  4DV0 Q;  4IFD G;  3UDI A;  4JI0 L;  1Q1B A;  1J5E L;  1AE3 A;  1I3Q H;  2B63 G;  3CPF A;  3H3V H;  4R4T A;  4YCW A;  1U0L A;  2NN6 I;  4A3K G;  1S40 A;  3HOZ H;  1OXU A;  3CP0 A;  2N8N A;  1VS0 A;  3G71 A;  3PUZ A;  1Y1W G;  4PZ6 A;  2UUA Q;  1P8L A;  4A75 A;  1KRS A;  2R6G A;  5BR8 Q;  2E2J H;  3CME A;  3KF6 A;  4MZ9 A;  4DV1 L;  1OTC A;  2R7Z G;  4LFB L;  2JQO A;  1N32 Q;  1Q7Y C;  2E5L Q;  3GO5 A;  3HOW H;  2EQS A;  2I5M X;  4R4Q A;  1VQO A;  5M5W H;  1XMO Q;  4IPH A;  2KHJ A;  4LFA L;  3RLO A;  1CSP A;  1VQJ A;  4NPS A;  1BBU A;  2ALY B;  5IYD H;  1VCI A;  1Y1V G;  4LF7 Q;  2OQ0 A;  2A19 A;  2VUM H;  4QIW E;  1JT8 A;  1YVC A;  3PV0 A;  4IFD I;  5FLM G;  3S15 H;  4JYA L;  1LM0 A;  3W5O A;  4JV5 L;  4GN3 B;  3M3Y H;  4GKK Q;  1L0W A;  4L5S A;  2Y0S G;  1Q8K A;  2AWN A;  3F1Z A;  3JAM c;  1D8L A;  1I94 Q;  3E9H A;  2WP8 J;  2OTJ A;  2NN6 G;  3FHW A;  3STB D;  2R93 H;  4OO1 I;  2BH2 A;  4A4I A;  3KDF B;  3CPW A;  3PUV A;  2LXK A;  5M3F H;  4DKA C;  4DNI A;  1HZC A;  2JA5 G;  2I5H A;  3J81 i;  4DUY Q;  5AJ3 L;  2UXD L;  1B7Y B;  4A3D H;  2VQF L;  2ZM6 L;  3H0G G;  2PQA B;  4DV6 L;  1AH9 A;  3PUX A;  4JG2 A;  1VQA A;  2Q2U A;  1QZH A;  4IJL A;  1IZ6 A;  4O0A A;  4IO9 A;  4MTN A;  2KEN A;  5H1S E;  2JA6 G;  1N33 Q;  4DR5 L;  1EQQ A;  1PV4 A;  3DLL A;  4DV0 L;  1FGU A;  3M85 A;  1N8R C;  1TWG H;  1Q86 C;  2VZA A;  1HZB A;  2A1A A;  2RF4 A;  4KHP L;  2CWA A;  4LF9 L;  4WJ4 A;  1YHA A;  1YIT A;  1XPR A;  3CCV A;  2F4V L;  1X55 A;  2HIX A;  3STB C;  5IP7 G;  1GVP A;  1V9P A;  3D0F A;  4JI1 L;  3UDG A;  1HNW L;  1GD7 A;  4OO1 G;  2WFW A;  4OXP A;  4OX9 Q;  3PCO B;  4BY7 H;  2CWP A;  2IX0 A;  3F2B A;  5IP9 H;  2JA7 H;  4IOA A;  3I56 A;  4IFD J;  3ULL A;  4TQU S;  5C0X I;  2UXC Q;  2WAQ E;  1PA6 A;  4FDB A;  4DR1 L;  2JE6 I;  5LMU L;  1PH3 A;  2QA4 A;  4LWC A;  2ZTD A;  4LNQ A;  3G4S A;  3K81 C;  1G51 A;  1PH9 A;  3ZJY C;  5JEA J;  4JC0 A;  2UUA L;  5C3E G;  3PIP A;  3E0E A;  4JI3 Q;  1IBK Q;  4O2D A;  3B6Y A;  2YU9 H;  1WFQ A;  5BR8 L;  2D62 A;  1KRT A;  2VS1 A;  2WB1 E;  1Q12 A;  1N32 L;  1IBM L;  4A93 G;  4A3E H;  4DV5 L;  1WCM G;  5LMN Q;  4IPG A;  4X64 Q;  2LXJ A;  1N34 Q;  4DV3 L;  1UE6 A;  1XNQ L;  4JI2 L;  3ICE A;  2VL6 A;  3CC4 A;  4LFC L;  1O7I A;  5IWA L;  3FKI G;  4DUZ L;  1VQN A;  4IPD A;  4LF7 L;  2UUC L;  5C44 G;  1EYG A;  5IYB G;  3OTO L;  2N49 A;  4X65 Q;  1HNZ Q;  1EFW A;  1LTL A;  1S72 A;  1JB7 A;  3A0J A;  1BVS A;  3BU2 A;  1VQI A;  3G48 A;  4JI4 Q;  1OXS C;  2PMZ E;  1I94 L;  2UU9 Q;  4YCU A;  1Q46 A;  1XJV A;  4LF5 Q;  3HKZ G;  1WOC A;  1X3E A;  1CKO A;  2CKZ B;  3HOU H;  1PH1 A;  4WJ3 M;  4P74 A;  5JJK A;  1N9W A;  1E1T A;  1YIJ A;  4DV7 Q;  1KQS A;  3SGI A;  2KBN A;  3CCR A;  2UXB L;  1UE1 A;  4H02 A;  3EN2 A;  1CUK A;  1Q82 C;  4X66 L;  3BZC A;  4AQY L;  2OCE A;  1NTG A;  1YJW A;  4PG3 A;  2JEB I;  3ULJ A;  1BKB A;  3J81 c;  4AYB E;  4DAM A;  4A3B G;  1YI2 A;  5IYC G;  1EUJ A;  1VQF A;  4LF6 Q;  1I6H H;  4BY1 G;  4UY8 C;  1HNX L;  1EWI A;  2ATW A;  3BJU A;  3K8A A;  5LMN W;  1NBW A;  4JOI C;  3KDF A;  3HOV G;  4C3H H;  3A74 A;  3LGJ A;  2UUB L;  1XNR Q;  2IHE A;  5FJ8 H;  4A3I H;  3S1N H;  3S17 H;  4A3J H;  2MO0 A;  1VQD A;  3H15 A;  2A8V A;  4YHH Q;  1VQ6 A;  5C4X G;  2PQA A;  3GDE A;  4PMW A;  1JJG A;  2K5N A;  4UP8 A;  4DR7 Q;  3AFQ A;  3K0X A;  3TS2 A;  3PSI A;  1E24 A;  1VQK A;  4A3L G;  4HJ5 A;  3TRZ A;  1RIP A;  5GQO A;  2R92 H;  3CCU A;  4A3M G;  1RL2 A;  1VQ8 A;  2ZJP A;  3CCS A;  2AWO A;  1EIF A;  1IBK L;  4JBJ A;  1A8V A;  2VY3 A;  4RMF A;  2NVX H;  2MNA A;  2JA8 G;  5GAE C;  3GTJ H;  4LF4 Q;  4LF8 Q;  1LUZ A;  3NEN A;  4YCV A;  1W2B A;  4QJF A;  5GAD C;  1WI5 A;  2NVQ H;  1MJE A;  4JOI A;  4DK3 C;  3RZO H;  4DR3 Q;  4DR2 Q;  4AIM A;  3KJO A;  2Q2H A;  1N34 L;  3NBH B;  3HOY G;  2YYZ A;  3DM3 A;  3HOX H;  2F52 A;  2B3G A;  4JI5 Q;  1TXY A;  1EIY B;  3I4M G;  3EIV A;  1YHQ A;  4B3S Q;  1UEB A;  2Y0S E;  3Q8D A;  3TRE A;  1ASY A;  1FVI A;  4BBS G;  1JMC A;  4L5T A;  3ER0 A;  4OWT B;  2B29 A;  4X65 L;  3I55 A;  1HNZ L;  3TS0 A;  4JI4 L;  2HHH Q;  5M3M G;  3J81 j;  1VQM A;  1K73 C;  2K52 A;  1UE7 A;  2VQE L;  5ELN A;  1X3G A;  4JI8 Q;  3UDF A;  1QZG A;  3JC6 6;  2IHF A;  2KCM A;  4POF A;  4JI7 Q;  1M90 C;  2B63 H;  4APV A;  2AHO B;  1AE2 A;  5IT9 c;  4A3K H;  4JI6 L;  4DV7 L;  3PO3 G;  4DR6 Q;  1NE3 A;  1Y1W H;  1VQE A;  4A3F G;  3PO2 G;  1S3O A;  2BA1 A;  1FJG L;  4DV4 Q;  3K7A H;  1G29 1;  1OXT A;  1GO3 E;  1Z9F A;  3S14 H;  3I4N G;  2R7Z H;  5IE8 A;  3S1M H;  4K0K L;  3CCJ A;  1PFS A;  4BXX H;  1E22 A;  1VQ4 A;  1SFO H;  1J6Q A;  1OXX K;  4DK6 C;  3RLN A;  4DV2 Q;  4NXM L;  1E3P A;  3H3V I;  1NY4 A;  2V1C C;  1U5K A;  4LF6 L;  5IY0 A;  2QGQ A;  1N36 Q;  4DAY B;  1HR0 W;  1Y1V H;  2N78 A;  3UE0 A;  4R4O A;  1I50 H;  4LW1 A;  4QGU A;  2CCZ A;  1D7Q A;  1XNR L;  2AKW B;  5EAY A;  2JJQ A;  5FLM H;  1J5E Q;  3PGZ A;  3PIO A;  2RCN A;  4BBR G;  1QVC A;  1YBY A;  4HJA A;  1VQ9 A;  2E2I H;  2IX1 A;  2NZO A;  2BA0 A;  3CAM A;  4GLA C;  4A3C G;  2DGY A;  4DR7 L;  1Q1E A;  1YJ9 A;  1VQP A;  2E5L L;  3E9I A;  1QUQ A;  1YEZ A;  2H5X A;  4AH6 A;  1KHI A;  1P16 A;  2NZH A;  4R1J A;  1PYS B;  4DV1 Q;  4LFB Q;  1VQB A;  1LYL A;  2JA9 A;  1XMO L;  2AMC B;  1X54 A;  2L15 A;  3T1H Q;  1UWV A;  3RR5 A;  1HH2 P;  1QVG A;  5M5Y H;  1L1O B;  1JJ2 A;  1EQR A;  5GAH C;  1T9H A;  1YZ6 A;  1X56 A;  1CKM A;  4KHZ A;  2NVY H;  3F2C A;  1YHB A;  3CCQ A;  4IOC A;  4P72 A;  3KJP A;  5C0X G;  4LF4 L;  4LF8 L;  2JA6 H;  2FXQ A;  1M1K C;  4X62 Q;  4GKK L;  4XIG S;  1QVF A;  3HOZ G;  4QQB X;  2LSS A;  4DR2 L;  1Q81 C;  4JV5 Q;  4JYA Q;  1DGS A;  3L2P A;  1XMQ Q;  3GTL H;  4L5Q A;  3U4Z A;  3G6E A;  3RZD H;  1PHJ A;  2PI2 A;  1C0A A;  1TWH H;  5IP7 H;  4DUY L;  1BBW A;  3HOW G;  3I7F A;  4L5R C;  3RNU A;  1JJC B;  4HJ9 A;  3HKZ E;  3S1R H;  2RHQ B;  3AEV A;  3M9B A;  2Q2T A;  1V43 A;  1H95 A;  2UXD Q;  4OWW B;  2IT1 A;  3CXC A;  1SN8 A;  3W1B A;  1QUQ B;  2VQF Q;  1IBL Q;  5IYD G;  2ZM6 Q;  1N33 L;  1K0R A;  2C35 B;  4LUO A;  4NXN Q;  3L0O A;  4JI8 L;  4DV6 Q;  1VQG A;  2VUM G;  1MJC A;  2IY5 B;  4X6A H;  3S24 A;  2VW9 A;  1K8A C;  3GTO H;  1K9M C;  4DR5 Q;  5JJI A;  2K14 A;  2YTX A;  3M4P A;  1UE5 A; 
#chains in the Genus database with same CATH topology
 2K5W A;  3K6O A;  3H3V C;  3CCE A;  2R7F A;  3I90 A;  1B8A A;  2K6A A;  5I6W A;  2F4V Q;  5IGD A;  4HSV A;  4A3D G;  2KHS A;  3SK5 A;  3L3O C;  2EIF A;  1HA6 A;  1I4R A;  1QJO A;  2WKC A;  4DAV A;  2CH4 A;  1AP0 A;  4FXD A;  2CW0 C;  2RSN A;  4YWL A;  3DWA A;  5IYB H;  1KD1 C;  2K1B A;  3S2H H;  1V1Q A;  4JI3 L;  3FEW X;  1Z47 A;  3PUW A;  3PF5 A;  1OXV A;  3TQY A;  1SE3 A;  1GUO A;  4EQP A;  3DEO A;  4XXE A;  4LUZ A;  2HT1 A;  2PNH A;  1SNM A;  5EJW A;  1SDF A;  2RBM A;  3DMU A;  4IJH A;  1K83 B;  2IPK D;  2HQL A;  4B3T Q;  4BY7 G;  4C3I H;  1HUN A;  5IP9 G;  1MD2 D;  2JA7 G;  3GTP B;  1X3F A;  1ZKO A;  1HJP A;  5C0X J;  2Z9H A;  4XTC S;  3GTM B;  2F0F A;  1AEX A;  3AYH B;  2DN8 A;  3S2D H;  1FNV A;  1UUP A;  3ERQ A;  4A3B H;  2FJ2 A;  3WOF A;  4BY1 H;  1ET6 A;  2WB1 B;  3KLW A;  4A3E G;  4IUT A;  3MXP A;  5JPN C;  2C5C A;  4HTH A;  1IKL A;  3KLS A;  2KCC A;  1HZA A;  2OWO A;  1IBL L;  3VYS A;  1C8C A;  4JBM A;  5M5X H;  4GKJ Q;  2OQK A;  5HGQ A;  2M9V A;  1PH2 A;  1IYJ B;  3CCM A;  4ALP A;  4KV6 A;  3U58 A;  4IPC A;  3T4A C;  3GV6 A;  3A5Z B;  4IUR A;  4Q0F A;  2K4K A;  3MC0 B;  5FO7 B;  4A3G B;  5IGE A;  1ML0 D;  2HD3 A;  3GD7 A;  4NP5 A;  1QIL A;  3W1G A;  2NVQ B;  3D31 A;  4TVA B;  4GLV B;  4RFB A;  2ZXR A;  3I4O A;  4F88 A;  4BBS H;  2WB1 G;  1IYV A;  1MSH A;  5M3M H;  1CFM A;  1G6P A;  1YNX A;  1T5E A;  2JEA I;  4NDX A;  5JJZ A;  1EZ6 A;  4A3I G;  4B3T L;  3NEL A;  1EY9 A;  4YWK A;  2B2V C;  3I3C A;  3PO3 H;  1VQ7 A;  1TWG B;  1E1O A;  1SR3 A;  1YNN C;  2B2U A;  4FVM A;  2RKS A;  2F3V A;  1HRJ A;  2K05 A;  5AFW A;  1PVO A;  2IJ0 A;  5AJ3 Q;  3Q22 A;  3F2U A;  4A3G G;  5F2D A;  2DUD A;  5ELO A;  2K5V A;  3L9A X;  3HOX G;  1Y1V B;  2D0P A;  2F0N A;  4PZ8 A;  4JI6 Q;  5CBE E;  1KLG D;  1V1O A;  3TP8 A;  1PH4 A;  3M4Y A;  4AYB G;  3RMH A;  1JCK B;  2Y0S B;  3AQQ A;  4GKJ L;  4QMG A;  4DV2 L;  2MQH A;  1IKM A;  1E7Z A;  1SNO A;  4BA1 I;  2EXD A;  1HQM C;  4M1U B;  1ESR A;  4DNR B;  3TN2 A;  3VR2 A;  3UDI A;  1SYC A;  5C0X H;  1J5E L;  1NR4 A;  1PMR A;  3HOZ H;  3CP0 A;  2N8N A;  4CDF C;  5C3X A;  1Y1W G;  2UUA Q;  2AUJ D;  1MHW C;  3KF6 A;  4MZ9 A;  4DV1 L;  2E5L Q;  3HOW H;  3HOU B;  1WTO A;  4R4Q A;  1TWH B;  1EY8 A;  4KY7 A;  3LWE A;  5CV9 A;  4NPS A;  3S1R B;  1Y1V G;  1BOS A;  2F1M A;  5FLM G;  1LM0 A;  1ENC A;  3A8K E;  3MEH A;  2BCO A;  2Y0S G;  4G7Z C;  2F03 A;  3WDN A;  2OTJ A;  2NTT A;  3BG3 A;  3OPO A;  2BH2 A;  3CPW A;  5M3F H;  2I5H A;  2E76 C;  5AJ3 L;  3NPP A;  3I8Z A;  1JWS D;  1PFM A;  4DN4 M;  2PQA B;  3S17 B;  4DV6 L;  1QZH A;  1IZ6 A;  4IO9 A;  5H1S E;  1N33 Q;  1ZXT A;  1BF4 A;  2PMZ B;  3MVV A;  1Q86 C;  1ENA A;  2RF4 A;  3CRK C;  1RCV D;  1R9T B;  5IGG A;  3G6J B;  2R92 B;  2DY8 A;  2HIX A;  5ELB A;  1JOK A;  5IP7 G;  2WKD A;  4RKB A;  1HFN A;  5JEA H;  2BE5 D;  1GJX A;  1GUW A;  1TT2 A;  3F2B A;  2C9O A;  2F0J A;  3I56 A;  4IOA A;  1F9S A;  1S5C D;  2UXC Q;  2WAQ E;  4FDB A;  3EJI A;  4DR1 L;  1PH3 A;  1TS3 A;  3K81 C;  1G51 A;  2PW7 A;  3QIA A;  3ZJY C;  2UUA L;  1QOH A;  3PIP A;  4CDC C;  3DUZ A;  2YU9 H;  1MGS A;  1EWH A;  2P5Z X;  2NWG A;  1IBM L;  3KLS X;  1TR5 A;  1U4R A;  1WCM G;  4X64 Q;  2BE5 C;  3C1E A;  5BN5 A;  2N88 A;  1UE6 A;  3GTK B;  2RA4 A;  3CC4 A;  5IWA L;  2SOB A;  1TU2 B;  4BS9 A;  1HNZ Q;  4RAU C;  5C3W A;  3V2T A;  1JB7 A;  4JI4 Q;  3CQZ B;  2BDN A;  1Q46 A;  4X3S A;  1CKO A;  3G7L A;  1NUC A;  3OHX C;  2O5J C;  4WRD A;  1PH1 A;  4WJ3 M;  3Q6S A;  1HXY D;  1D1I A;  3SGI A;  2UXB L;  4OIJ A;  3EN2 A;  1CUK A;  3NSW A;  3P1H A;  1NTG A;  3K5M A;  5A2Q L;  4RA8 A;  1CT1 D;  1IYU A;  2JXM B;  1SNQ A;  1CK1 A;  2JA5 B;  1NCV A;  1EUJ A;  1VQF A;  3NBH A;  2ICE C;  5FJ8 H;  2VB2 X;  4M8A A;  4A3J H;  1VQD A;  2A8V A;  4YHH Q;  4R8N A;  1PTO F;  1PYW D;  2K5N A;  4UP8 A;  4B9X A;  4FNF A;  1PZK D;  3K0X A;  2A6E C;  1E24 A;  3D4R A;  4CJ1 B;  4A3L G;  1PFN A;  4K5V A;  5GQO A;  3CCU A;  1EY0 A;  1RL2 A;  1SJE D;  2ZJP A;  1VQ8 A;  3AU7 A;  3GTJ H;  4LF4 Q;  3V05 A;  4QJF A;  5GAD C;  1B9N A;  2A68 D;  3CRL C;  4DR3 Q;  4XDX A;  4EQO A;  3W3A A;  4FF2 A;  1D5Z C;  1TXY A;  2Z4I A;  1UEB A;  3J80 L;  1FVI A;  2XRS D;  4BBR B;  4OWT B;  2KJX A;  1HNZ L;  3SK4 A;  2F0U A;  4JI4 L;  2HHH Q;  3J81 j;  1K73 C;  1KAA A;  3M7G A;  1X3G A;  5EGT A;  3TP6 A;  3JC6 6;  4POF A;  3FKI B;  4FXG C;  5CC4 A;  1RTN A;  1EIH A;  2F0V A;  5IOD A;  5C44 B;  2BA1 A;  1FJG L;  1UAP A;  3K7A H;  1GO3 E;  4KD3 A;  3S14 H;  3HKZ B;  1HHV A;  5IE8 A;  1AFP A;  1W6K A;  3CCJ A;  1SAP A;  1STY A;  4BXX H;  1SFO H;  4DK6 C;  3VA7 A;  2WAC A;  5IY0 A;  2QGQ A;  3DWP A;  2KVM A;  1N36 Q;  1HR0 W;  2N78 A;  3IL8 A;  3UE0 A;  4R4O A;  1I50 H;  5I4D A;  2AKW B;  5CV4 A;  1ONL A;  3PMF A;  2ENB A;  4BBR G;  2VUM B;  2BA0 A;  2NN6 H;  2X6G A;  1Y8P B;  1O7Z A;  4A3C G;  3M3Y B;  3E9I A;  2QEJ C;  1KHI A;  1P16 A;  1G2S A;  1GUG A;  5COR A;  2NZH A;  3MZ5 A;  4R1J A;  4LFB Q;  1I6H H;  2XSC A;  2AMC B;  1XMO L;  1TWA B;  2R93 B;  5M5Y H;  1JJ2 A;  1YZ6 A;  2X69 A;  1CKM A;  1CQV A;  5C4X B;  4LF4 L;  5JAV A;  2JA6 H;  3OIP A;  2FXQ A;  3HP3 A;  4KN4 C;  1QVF A;  1DZ1 A;  2M2L A;  3URY A;  1QG7 A;  5C6A A;  4K5X A;  2H1E A;  4L5Q A;  3U4Z A;  3GTQ B;  3I91 A;  1DJR D;  3RZD H;  1PHJ A;  2PI2 A;  2BOS A;  2E2H B;  1G91 A;  2A73 B;  1JOO A;  2JA8 B;  2K7V A;  4L5R C;  3UI2 A;  2DNC A;  1H95 A;  2UXD Q;  4OWW B;  2IT1 A;  3CXC A;  1SN8 A;  1QUQ B;  2ZM6 Q;  4IFD I;  2VUM G;  1MJC A;  2XN9 C;  3VR3 A;  1K8A C;  3GTO H;  3I4M B;  4DR5 Q;  5JJI A;  4J1M A;  1LAC A;  5JVH 3;  3H09 A;  3J80 i;  5C3E H;  3A5U A;  4ZK9 B;  2HDM A;  1GM5 A;  2R93 G;  5C4J B;  4LF9 Q;  4OX9 L;  1VQ5 A;  3CC2 A;  1BBX C;  4XYO A;  3T16 A;  4HJ7 A;  1WYD A;  3NQT A;  3MHB A;  5ELD A;  4EX5 A;  3GP7 A;  3M7N A;  4C2M H;  1NMF A;  2D0O A;  2HCI A;  2K50 A;  2Q2I A;  1F77 A;  4QB4 A;  2L9H A;  1EQT A;  3PO2 B;  3E5S A;  4KI0 A;  4KMU C;  4B3R Q;  3DEP A;  5LMU Q;  2KQ3 A;  1A3V A;  3PUY A;  2Z6K A;  1H9R A;  3A56 A;  1KDB A;  1STN A;  3FP9 A;  5LMN L;  5KND A;  4C3J H;  1L1O C;  4DV5 Q;  3OSO A;  4BXX G;  4ZUI A;  3E3X A;  1KXL A;  1EWC A;  3T1Y Q;  1O7L A;  2WAQ B;  1XNQ Q;  4DAY A;  1SRU A;  5A2Q E;  2K33 A;  3PF4 A;  1MIU A;  3MTS A;  4TSS A;  3CD6 A;  4RCN A;  3S1Q H;  2GA4 B;  2K32 A;  4XQJ A;  5CV6 A;  3ONA B;  1B1Z A;  1HUM A;  1LTA D;  2NB0 A;  4RWS C;  3T13 A;  1PH6 A;  3F8T A;  1JE4 A;  2F0K A;  4EQ5 A;  3KF8 B;  2F3I A;  4Y7N H;  1PXU A;  1I3Q B;  3UDX A;  3MEF A;  2KCT A;  3TEH B;  5DLQ E;  1C7Y A;  2PZT A;  2Q8I B;  3S1N B;  2PI2 E;  3KF6 B;  4V0B A;  1JB3 A;  4FF4 A;  2OTL A;  5EPL A;  2Q8R E;  2PW5 A;  2FFK B;  1H9J A;  4G7O C;  3HFZ B;  4HIM A;  2KEC A;  1ICF B;  1HCZ A;  2GVB A;  5M5W B;  2PYK A;  4PNY A;  2G5D A;  3QOJ A;  3RN5 A;  4JI0 Q;  4P75 A;  1X9N A;  5E4W C;  4G7H C;  2WAQ G;  1SYF A;  3ERS X;  2BH8 A;  2F0D A;  5CYU A;  2UUB Q;  2OXP A;  3IFT A;  1SSO A;  1KLU D;  4POG A;  1C4Q A;  3H91 A;  2MPM A;  1A2U A;  3NQI A;  3J80 E;  3J80 c;  2Z0S A;  2J4X A;  1TVX A;  4QL5 A;  4B3R L;  2ID0 A;  2NYZ D;  4CKB A;  2RHS B;  3A54 A;  4LFA Q;  3J81 L;  4A3D B;  2DJG C;  1RJT A;  5L37 A;  4GN5 A;  1KIX A;  1A3U A;  3K5N A;  3U50 C;  5JJL A;  5C5M A;  4GOP A;  3PQI A;  1A63 A;  2GN5 A;  2ES2 A;  1IL2 A;  2XGT A;  1PZI D;  1I4G A;  2NBF A;  5HY6 A;  4A3F H;  3T1Y L;  3U4V A;  3J7A F;  4A3K B;  1CKN A;  1JE5 A;  2CFM A;  2F0O A;  2Z6B A;  1Q90 A;  4HID A;  1C9O A;  1VQL A;  3NTK A;  3K59 A;  2R7Z B;  4BY7 B;  4C56 C;  4E6I A;  4ME3 A;  1K83 H;  2VQE Q;  4DPG A;  3K5L A;  4GNX A;  3ITP A;  3GTP H;  4DR6 L;  1VMC A;  1WTW A;  1YJN A;  1BXT A;  1PRT B;  2B2T C;  5IGC A;  2N3S A;  4MNO A;  3GTM H;  2B2W C;  4CKC A;  4JI1 Q;  5BN4 A;  4KKS A;  2E2I B;  3ND8 A;  1HZ9 A;  1FYC A;  4UPA A;  4JVZ A;  4MIU A;  4A3E B;  4K0K Q;  3RD4 A;  5I6Y A;  4HIK A;  4UHV A;  1PYB A;  2L12 A;  1CM9 A;  4DV0 Q;  4IFD G;  4JI0 L;  5BN3 A;  1AE3 A;  3H3V H;  4FP5 D;  3NK9 A;  4R4T A;  4YCW A;  2NVY B;  4A3K G;  2B2Y C;  3PUZ A;  4PZ6 A;  4WJW A;  2RSO A;  1EEF D;  5J1Z A;  1PLF A;  1CTM A;  3CME A;  1OTC A;  2R7Z G;  1STG A;  2NUC A;  1TY0 A;  3R2I A;  4LFA L;  1VQJ A;  1BBU A;  2PPB C;  4LF7 Q;  2OQ0 A;  2A19 A;  4QIW E;  4ZQ3 A;  1YVC A;  3S9W A;  4KJO A;  3W5O A;  4GKK Q;  1I4Q A;  1Q8K A;  3F1Z A;  2PZW A;  4RCO A;  3SVM A;  4ZLT F;  1NNX A;  1S4Z A;  1EIG A;  4A4I A;  5KNB A;  1HZC A;  1PDQ A;  3J81 i;  1TS4 A;  1B7Y B;  1LTS D;  1SEB D;  4A3I B;  2SEB D;  3W2D A;  1AH9 A;  1V1P A;  1VDZ A;  4H44 C;  4MTN A;  3LNN A;  2RVL A;  4DV0 L;  2E74 C;  4RKL A;  1N8R C;  1KDC A;  1TWG H;  4DK1 A;  2A1A A;  4K2K A;  1H9S A;  4OGQ C;  2CWA A;  3ND9 A;  1YHA A;  3X3N A;  3S2H B;  2F4V L;  1V9P A;  3D0F A;  4JI1 L;  1ICW A;  4CDE C;  1EOT A;  1GD7 A;  3A7A B;  4OO1 G;  4OXP A;  1YNN D;  2IWH A;  1AZP A;  2CWP A;  3ULL A;  1QB5 D;  2XRQ D;  5C0X I;  4HED A;  3HOX B;  4C3I B;  4ODG A;  4DU9 A;  4LNQ A;  4AYB B;  3P7J A;  5JEA J;  4KY5 A;  4RGN A;  1LAB A;  2D62 A;  1B4O A;  3S2D B;  1KDA A;  5E1F A;  2Z1C A;  2B39 A;  3H6M A;  4A3B B;  4IPG A;  1LTI D;  2LXJ A;  4BY1 B;  5ISR A;  3PIO 3;  2RQX A;  2L0C A;  1O7I A;  3R2T A;  1Y1W B;  1BUV T;  4LF7 L;  5IYB G;  5D65 A;  2N49 A;  1LTL A;  1BVS A;  1F2L A;  1VQI A;  3HG9 A;  3OWE B;  1OXS C;  2UU9 Q;  5M5X B;  1CA5 A;  4LF5 Q;  1WOC A;  3HOU H;  1SBB B;  3MFY A;  1TII D;  3NWS A;  2M00 A;  4C3I G;  1N9W A;  1YIJ A;  1GHJ A;  1RHP A;  1UE1 A;  3Q23 A;  1BR9 A;  5FLX L;  1EY6 A;  1STH A;  3J81 E;  3J81 c;  4A3B G;  4DAM A;  3KK7 A;  4LF6 Q;  4BY1 G;  1EWI A;  2ATW A;  3BJU A;  4UDU C;  4EGV A;  4C3H H;  5M3M B;  3A74 A;  1JQY D;  3S17 H;  1Z7T A;  3GTL B;  3I73 A;  5DM7 3;  4KKU A;  3PO3 B;  1SND A;  3PSI A;  1LO5 D;  5DM6 3;  1VQK A;  1Q8I A;  1RIP A;  2R92 H;  1L0Y B;  4IZ8 A;  2AWO A;  1EIF A;  2VY3 A;  2NVX H;  5ELC A;  2OEO A;  4LF8 Q;  4YCV A;  1MJE A;  4JOI A;  3KUP A;  4XQQ A;  3RZO H;  4ABN A;  3KJO A;  3BVG A;  2Q2H A;  2YYZ A;  1FNU A;  4JI5 Q;  2BDO A;  1CZW A;  4DNT B;  5DEH A;  1KNE A;  3EIV A;  1YHQ A;  4B3S Q;  3SXH A;  3Q8D A;  5LL6 X;  4BBS G;  1SYG A;  2B29 A;  5M3M G;  3I4L A;  1WCM B;  1UE7 A;  3CKI B;  3D6W A;  1F2Z A;  1DOK A;  1D5M C;  1I4H A;  4LK1 C;  4IUN A;  1VMP A;  4EVO A;  1QZG A;  2QIL A;  2IHF A;  4JI7 Q;  1VF7 A;  2B63 H;  3OMG A;  1FD7 D;  1H9K A;  2AHO B;  4JI6 L;  3PO3 G;  2EPB A;  4K14 A;  5LHY 1;  3NHH A;  1VQE A;  1HTP A;  1HPC A;  2Z8L A;  4DV4 Q;  3HOZ B;  1G29 1;  1SYB A;  1PFB A;  4KTA A;  2DJF C;  2CHB D;  1DM0 B;  3LX0 A;  1J6Q A;  2J0T D;  1CA6 A;  2K28 A;  4LF6 L;  1U5K A;  1Z6H A;  4DAY B;  1HQR D;  2F0G A;  1S5E D;  1TWF B;  3PGZ A;  3KBG A;  1TWC B;  5NUC A;  1YBY A;  4HJA A;  2Q8T A;  2E5L L;  1YEZ A;  2H5X A;  4XT1 B;  1VQB A;  3M4O H;  1QVG A;  1UWV A;  3RR5 A;  5HUR A;  5M3F B;  1D2B A;  3MFG A;  1TY2 A;  4KHZ A;  3F2C A;  4IOC A;  1YHB A;  5C0X G;  5C4Z A;  4LF8 L;  3HOZ G;  3LWU A;  4CJ0 B;  4JV5 Q;  4JYA Q;  2EY6 A;  1DGS A;  1XMQ Q;  2H4O A;  4PMB A;  3V96 A;  1BBW A;  4DAP A;  3HOW G;  3I7F A;  1Y8O B;  3AEV A;  2EYL A;  5KIX A;  1EU4 A;  1BCP F;  2A6E D;  3NWT A;  2VQF Q;  1N33 L;  1JC7 A;  1C0A A;  2C35 B;  4NXN Q;  4LUO A;  3L0O A;  3OIQ A;  1VQG A;  1SE4 A;  2F0S A;  1K9M C;  3MXG A;  2K14 A;  3N52 A;  2YTX A;  2J7Z A;  1UE5 A;  3JAM L;  4FXK C;  4R4C A;  3VDY A;  2HQE A;  2NVT H;  4RGT A;  4LUV A;  1ASZ A;  2PO4 A;  4IUV A;  3OYY A;  4LJZ C;  5M3F G;  1NJI C;  5I2X A;  4GOP B;  4NW2 A;  1SJH D;  3F2D A;  3BDC A;  3IRB A;  3GTG H;  4A93 H;  4UP9 A;  5JOB A;  4NB3 A;  4PQX A;  1HNW Q;  1GXD C;  3TDQ A;  2UXC L;  1LTR D;  5IGB A;  3KFU A;  1II3 A;  5GAG C;  1K28 A;  3FKI H;  5E7N A;  1NSN S;  1STA A;  2CQO A;  3NTH A;  5C44 H;  2K75 A;  1LT5 D;  2F0H A;  4MN3 A;  3BVZ A;  1DXM A;  3RN2 A;  4KKT A;  5FO9 B;  1TKW B;  4R4I A;  3H94 A;  1B3A A;  1HR0 Q;  1A0I A;  5JEA G;  4X64 L;  4GNX B;  1WTX A;  4DR4 Q;  5G3L D;  2F0E A;  4PZ7 A;  4F87 A;  2HIV A;  4QF4 A;  5K36 H;  4DV3 Q;  1WVL A;  3J7A V;  1UEA B;  5FLX c;  4JI2 Q;  2EYM A;  4LFC Q;  1PH7 A;  2EY2 A;  4GS3 A;  4HJ8 A;  4DUZ Q;  2UUC Q;  2KEE A;  1SMX A;  2PNR C;  3U9O A;  4BWG B;  1KAW A;  3OTO Q;  1A15 A;  4YWM A;  1XMQ L;  1JR0 D;  5CV7 A;  5I2Y A;  4N9P A;  1XXG A;  5IYC H;  3MA2 B;  4FF3 A;  1MBY A;  3HOV H;  2ZXO A;  1TWA H;  2L4N A;  1K8O A;  1GUT A;  3MAQ A;  2MGS A;  3EA6 A;  4ZCK A;  2E2D C;  4R9W A;  1YNJ D;  3FPU B;  5C4X H;  5M9O A;  4NXN L;  1W3S A;  1B50 A;  4X66 Q;  4DK0 A;  4AQY Q;  3BZD B;  3DM1 A;  3GTQ H;  3C2P A;  1DYQ A;  4A3M H;  4BA2 I;  2E2H H;  2R3Z A;  2MO1 A;  2EYP A;  1K8G A;  2JA8 H;  3VR5 A;  1HNX Q;  2JK8 A;  5EKK A;  4O1N A;  4YHH L;  3UE1 A;  1FL0 A;  1EEI D;  2PCF B;  3HOY H;  2CQA A;  1ILQ A;  2B2U C;  1E2Z A;  2F3W A;  1A62 A;  1YNJ C;  4UP7 A;  5GRO A;  1KC8 C;  3Q24 A;  1CI3 M;  3I4M H;  5D3D A;  2F0I A;  4TKO B;  3JAM i;  2XTI A;  1KNA A;  4IAL A;  3H0G H;  2K5H A;  1Y69 U;  5C4J H;  1SNC A;  1V1P B;  1EYD A;  2I46 A;  3O13 A;  1HR0 L;  4CKE A;  4DR3 L;  5FJ8 G;  4OON A;  1XTC D;  4JBW A;  2XIW A;  5KYL A;  3NUC A;  4DR4 L;  4A3J G;  1WJJ A;  1H9S B;  1LLR D;  3S16 H;  2I5L X;  1SRO A;  3OW2 A;  5I9P A;  5FKA C;  3PO2 H;  1B9M A;  1X65 A;  2ZTE A;  1EL0 A;  4OIK A;  1EYA A;  3I4N H;  2FHT A;  2HHH L;  2VXW A;  1K8M A;  1ZEQ X;  3K7A B;  2EJG C;  3S14 B;  4KD4 A;  1SFO B;  1SYD A;  2YTY A;  3IFD A;  2GVA A;  4A76 A;  3VYR A;  1PH8 A;  4RG1 A;  4KHP Q;  2B2V A;  1I50 B;  5LL6 S;  1KL9 A;  4K6L A;  4GN4 B;  5K36 G;  3KYH C;  1X6O A;  3L7Z C;  3NEM A;  3FVQ A;  1MSG A;  3R8B A;  3P75 A;  2VNU D;  4B9W A;  1A6X A;  3CMA A;  1JOR A;  1CSQ A;  3N6R A;  4FO2 A;  2FMC A;  1N36 L;  1S5D D;  1LTT D;  4NXM Q;  1I6H B;  1R4P B;  5M5Y B;  1Q1B A;  1I3Q H;  4KHV A;  4KY6 A;  1U0L A;  1S40 A;  2JP1 A;  2SNS A;  1VS0 A;  2JA6 B;  3TP5 A;  4A75 A;  1KRS A;  5BR8 Q;  2E2J H;  5EQ0 A;  4LFB L;  1T5X D;  1X3Q A;  2JQO A;  1N32 Q;  1Q7Y C;  4ZKB B;  3GO5 A;  4OEM B;  1CHQ D;  1U4L A;  2I5M X;  4J8Q A;  3RZD B;  4HCS A;  5M5W H;  2KHJ A;  1CSP A;  2ALY B;  5IYD H;  2CH4 W;  3TBI B;  1JT8 A;  3QJY A;  1PRT D;  3PV0 A;  3S15 H;  5HGT A;  3VA5 A;  4L5S A;  3JAM E;  2AWN A;  3JAM c;  1D8L A;  1I94 Q;  2AUK A;  2NN6 G;  3STB D;  1STE A;  2L1B A;  4OO1 I;  3MWY W;  1LV9 A;  5A35 A;  4DUY Q;  2UXD L;  1O80 A;  2EYH A;  4A3D H;  1ZYR D;  2R61 A;  1HA5 A;  2EY1 A;  2ZM6 L;  3H0G G;  3PUX A;  4IJL A;  4O0A A;  2K01 A;  2JA6 G;  2KEN A;  2XWB B;  3HRZ C;  1FGB D;  4DR5 L;  1EQQ A;  1PV4 A;  3DLL A;  4C2M B;  2JN4 A;  1EFI D;  1FGU A;  3M85 A;  3HGB A;  1PRT C;  2VZA A;  4Q5V A;  3ZYY X;  4KHP L;  3P20 A;  2OT2 A;  4LF9 L;  2ZT9 C;  4WJ4 A;  1YIT A;  1ESF A;  2LKV A;  3CCV A;  3STB C;  2IL8 A;  1SE2 A;  3E0J A;  4RGM A;  4MTK A;  1L0X B;  1PTO D;  3MXN A;  2WFW A;  3SHL A;  3PCO B;  4BY7 H;  1F9P A;  4ZYS A;  1E2W A;  2NZ1 D;  4RH6 A;  5IP9 H;  4NKL A;  5J22 A;  2JA7 H;  3BS1 A;  1ZYR C;  4C3J B;  1S5F D;  2RDH A;  1PA6 A;  3WOE A;  2JE6 I;  5LMU L;  4RHR A;  3QG1 A;  4JC0 A;  5C3E G;  3R93 A;  3E0E A;  4JI3 Q;  5KGU A;  1IBK Q;  1WFQ A;  2D5D A;  5BR8 L;  2VS1 A;  4LAA A;  3S1Q B;  2F0Q A;  1N32 L;  1S5B D;  4DV5 L;  4A3E H;  2EYO A;  3EFX D;  1PTO C;  1N34 Q;  3D8G A;  2K5D A;  1X32 A;  1XNQ L;  1STB A;  1FR3 A;  2EXZ A;  2A69 C;  2VL6 A;  4CJ2 C;  2AQ3 B;  2EJM A;  3QB3 A;  4XT3 B;  1S72 A;  3A0J A;  3BU2 A;  3NE5 B;  5CBA E;  1I94 L;  2PMZ E;  3S1M B;  4YCU A;  2ICI A;  4JW0 A;  2CKZ B;  4KN7 C;  4C3J G;  3K57 A;  4P74 A;  1WTR A;  5JJK A;  2QKI C;  4DV7 Q;  3QOL A;  1KQS A;  4HMI A;  3TSS A;  3C3L A;  3CCR A;  1AW7 A;  1BQQ T;  1EU3 A;  1GOZ A;  3K5O A;  4H02 A;  1LT3 D;  1DD2 A;  1I6V C;  1YJW A;  1LT6 D;  5JPM C;  2KED A;  3CU7 A;  2JEB I;  1BKB A;  1BCP B;  3BDL A;  2KOL A;  3A55 A;  4X3T A;  3K8A A;  2RDF A;  1NBW A;  2MUY A;  3KDF A;  1QWY A;  3LGJ A;  2UUB L;  2F0W A;  2DNE A;  4A3I H;  2MO0 A;  1D5X C;  4TRD A;  4PMW A;  3GDE A;  2D2C C;  3AFQ A;  4A3F B;  1Y8N B;  1PTO B;  3TRZ A;  2PZU A;  3VR4 A;  4IQZ A;  2QCP X;  3IKJ A;  4L63 B;  1IBK L;  4A3G H;  4JBJ A;  1A8V A;  1ROD A;  2MNA A;  4IUP A;  5GAE C;  1RDP D;  3NEN A;  2LMC B;  1W2B A;  5D3I B;  1WI5 A;  2NVQ H;  4DK3 C;  2EY5 A;  1N34 L;  3NBH B;  1U4P A;  3CHB D;  3HOX H;  2F52 A;  3T56 B;  1EIY B;  5IOC A;  3E6Z X;  1ASY A;  4X3K A;  1JMC A;  5TSS A;  3T51 B;  1E2V A;  2B8F A;  3OWF A;  1VQM A;  2F0M A;  2VQE L;  2JYO A;  1BO0 A;  4K2L A;  2QW7 A;  1M90 C;  4APV A;  5FO8 B;  4ILW A;  4DV7 L;  1NE3 A;  1Y1W H;  1CHP D;  4A3F G;  1R4Q B;  1OXT A;  2HCC A;  3AMU A;  1KAB A;  4K0K L;  4IUU A;  1PFS A;  3TP7 A;  5KYI A;  4OEL B;  1E22 A;  1VQ4 A;  2WIN B;  4DV2 Q;  4OHJ A;  2O5I C;  2V1C C;  1D1K A;  4H7B A;  3SDZ A;  4F7X A;  4U68 A;  1Y1V H;  1WTP A;  2O2L D;  1D7Q A;  2JJQ A;  5FLM H;  1J5E Q;  3I70 A;  3PIO A;  1WD0 A;  1QVC A;  2IX1 A;  2NZO A;  1UNS A;  2EOT A;  1Q1E A;  1YJ9 A;  1VQP A;  5FK9 C;  1QUQ A;  5CGK A;  4UAI A;  1D6E C;  5CV5 A;  4DV1 Q;  1PYS B;  4R8I A;  3T1H Q;  2D9U A;  1HH2 P;  4O42 A;  4RHS A;  1TQO A;  3CCQ A;  4P72 A;  4I65 A;  4GKK L;  4X62 Q;  1AN8 A;  4QQB X;  3KBX A;  4ZRZ A;  3A8J E;  3GTL H;  4K5W A;  3QO2 A;  1LTG D;  1BNZ A;  1GHK A;  1FNW A;  5G3L F;  1TWH H;  4G4K A;  5T1I A;  5IP7 H;  3RNU A;  1JJC B;  4HJ9 A;  3HKZ E;  3S1R H;  2Q2T A;  1V43 A;  3W1B A;  3KLR A;  1SNP A;  4JK1 C;  1K0R A;  4HR7 B;  2IY5 B;  4DV6 Q;  2TSS A;  4X6A H;  3NBI A;  3D4W A;  5DNF A;  1NMG A;  2Z6K C;  4BBS B;  4G57 A;  3A7L A;  1H9M A;  4L6T B;  2R7D A;  3M4Q A;  2I07 B;  5CV8 A;  1WCM H;  4JCV E;  1B70 B;  4B3M Q;  1EOV A;  5KNC A;  2X6L A;  2ZJQ A;  1TS5 A;  4YY3 Q;  2HDL A;  4HSP A;  4OWX B;  1R9T H;  4DR1 Q;  4DGZ A;  3CW2 C;  5I9O A;  3ULP A;  3KF8 A;  3AFP A;  3CC7 A;  2I0Q A;  2K04 A;  4J15 A;  3U9S A;  4CGY B;  2AQ1 B;  1M4V A;  2A74 C;  2XNA C;  2EYJ A;  4ZAI A;  1A3T A;  2WII B;  4ME5 A;  4H13 C;  1IBM Q;  3T1H L;  5D14 A;  2MFI A;  4F8M A;  3D3R A;  1F9Q A;  2TMP A;  3BZK A;  1TWF H;  5IWA Q;  4GLX A;  4X62 L;  1TWC H;  3DHQ A;  4P71 A;  2UU9 L;  2FMM A;  4HN7 A;  4KJN A;  5JVG 3;  4LF5 L;  4WFN 3;  1GKH A;  2EJF C;  1RKN A;  4IUQ A;  1BDO A;  1VQC A;  2EYF A;  4DXF A;  4HCE A;  3GTK H;  1EY4 A;  1XPO A;  4JBK A;  1MKH A;  1K0S A;  1L1O A;  2JSO A;  4C3H B;  3EBE A;  4GZY C;  2UXB Q;  1IXR A;  3RLF A;  3CQZ H;  4X3U A;  3SR1 A;  3D4D A;  4Y52 H;  4FYD A;  1I4X A;  4A3L H;  5E3F A;  3HOW B;  3K7U C;  3BYY B;  2ZXP A;  3HOU G;  1EYC A;  3I2Z A;  2ZJR A;  4GOP C;  1QNU A;  1SE8 A;  2L5T A;  3HS0 C;  4QUF A;  4IN3 A;  2NVX B;  1K3R A;  1K3B C;  2VB3 X;  4B3M L;  3J7Z C;  1L2F A;  3RZO B;  1Y14 B;  4K6D A;  1VQH A;  4YY3 L;  1PH5 A;  2JA5 H;  1M8A A;  4U67 3;  2G9D A;  3NXW A;  3NP8 A;  1JOQ A;  4QUC A;  3CCL A;  1RTO A;  1XTD A;  1VF5 C;  1SMY D;  1EY5 A;  3RUZ A;  4GNX C;  3GQB A;  1WTH A;  4C3H G;  2KHI A;  1MI2 A;  5J3B A;  1DCZ A;  1SLJ A;  2QDL A;  2EE1 A;  4HMJ A;  4ULL A;  4JI5 L;  3PIP 3;  4B3S L;  2B63 B;  2QDB A;  5ELE A;  4N8F A;  1ILP A;  3HKS A;  2B8G A;  3MXN B;  3WWV A;  2LFN A;  4J6H A;  2XWJ B;  2ASB A;  1LTB D;  5CMD A;  2R92 G;  2E8G A;  4KK7 A;  2IX3 A;  5C4H A;  4CDD C;  1PRT F;  3K58 A;  1V8Q A;  3CF5 A;  4QIW B;  2YV5 A;  4PV1 C;  4JI7 L;  3KOJ A;  1SMY C;  1IL8 A;  1I5F A;  4KLK A;  2KUM A;  1GUN A;  4DV4 L;  2YTV A;  5EBD A;  4BBR H;  1B2T A;  1IW7 D;  4B08 A;  3J7A 5;  4HIO A;  4JPB W;  2KA7 A;  4A3C H;  2YU9 B;  4ID6 A;  1FJG Q;  4P73 A;  1B3Q A;  2ZTC A;  1XPU A;  2QEX A;  3K80 C;  2OF1 A;  3BYT B;  4LMQ D;  1CKN B;  2AQ2 B;  3T53 B;  3M4O B;  2Z4H A;  3Q0A A;  2B63 G;  3CPF A;  3SEB A;  3QR8 A;  2NN6 I;  5IT9 L;  1OXU A;  1JWM D;  3G71 A;  2O4X A;  1P8L A;  2B2T A;  2R6G A;  4N8X 1;  3K0Y A;  1IW7 C;  3DWQ A;  2B2W A;  1ET9 A;  2EQS A;  1VQO A;  2LY7 A;  3X3M A;  5FLX E;  1XMO Q;  2KCN A;  2EDG A;  4IPH A;  3RLO A;  2PQE A;  2SDF A;  1VCI A;  1LT4 D;  1OO9 B;  2VUM H;  2RDG A;  1W6J A;  4NMZ A;  3EQL C;  4JYA L;  4JV5 L;  3QWN A;  4H0L C;  4GN3 B;  3M3Y H;  4XYQ A;  1L0W A;  1F2M A;  1NR2 A;  2A5H A;  2B2Y A;  1HTL D;  2WP8 J;  3E9H A;  2F0L A;  2MHV A;  3FHW A;  3DXJ C;  3FRP B;  5KEE A;  2E75 C;  3OW7 A;  3OMC A;  2R93 H;  3VYT A;  3KDF B;  3PUV A;  1QCB D;  2LXK A;  4DKA C;  4DNI A;  2JA5 G;  2NVT B;  3HEJ A;  1XWE A;  2VQF L;  3NTI A;  4A3J B;  3GTG B;  4JG2 A;  1JIC A;  4A93 B;  1VQA A;  5EKL A;  2Q2U A;  2SNM A;  2EVB A;  2MP1 A;  1GUS A;  2HUG A;  5T1G A;  3FPP A;  1HZB A;  2LS0 1;  2A68 C;  4YIJ A;  1XPR A;  1X55 A;  1GVP A;  4CBV A;  3UDG A;  3GTJ B;  1HNW L;  4OX9 Q;  1EY7 A;  3HZX A;  4EQN A;  2IX0 A;  3MXU A;  4IFD J;  1F9R A;  4TQU S;  4N9T A;  2G9H D;  1G6Z A;  1O78 A;  2QA4 A;  4LWC A;  2ZTD A;  4I7A A;  3G4S A;  1PH9 A;  5IGF A;  3TZU A;  4O2D A;  3B6Y A;  1A2T A;  1KRT A;  2L11 A;  2WB1 E;  1QNK A;  1Q12 A;  2L55 A;  4A93 G;  5LMN Q;  1EQV A;  4DV3 L;  1SYE A;  5KRU A;  4RGO S;  4JI2 L;  3VYU A;  3ICE A;  3SE0 A;  3HOV B;  4LFC L;  3FKI G;  4DUZ L;  1VQN A;  4IPD A;  2UUC L;  5C44 G;  1EYG A;  2RCF A;  3OTO L;  3ERO A;  4X65 Q;  4K8I A;  1EFW A;  4HAE A;  3G48 A;  1XX8 A;  1CQF A;  1XJV A;  3HKZ G;  1IHZ A;  1X3E A;  5ELF A;  1SXT A;  4A3M B;  1E1T A;  5C5L A;  1AZQ A;  2KBN A;  1J9O A;  4L8J A;  1Q82 C;  1DOM A;  3BZC A;  4X66 L;  4C1N I;  2FIN B;  4AQY L;  2OCE A;  3J7Y W;  1Q3L A;  3HOY B;  4PG3 A;  3ULJ A;  3OOC A;  3TZD A;  4AYB E;  1XYI A;  1YI2 A;  1G2T A;  4WOR A;  5IYC G;  5COY A;  2F0P A;  3D6C A;  4UY8 C;  1HNX L;  3H0G B;  3HOV G;  5LMN W;  4JOI C;  1XNR Q;  2IHE A;  3S1N H;  1J8I A;  3H15 A;  1VQ6 A;  5C4X G;  3BDO A;  2PQA A;  2K03 A;  1JJG A;  4C1N K;  1U9R A;  4DR7 Q;  2QF7 A;  3S16 B;  3TS2 A;  2MJ8 A;  2A6H D;  4HJ5 A;  5EPJ A;  5EPK A;  2F0T A;  4A3M G;  4ZUJ A;  3CCS A;  1B53 A;  3I4N B;  5FOB B;  1PZJ D;  4RMF A;  5IIF A;  2JA8 G;  4DFA A;  1LUZ A;  3A8I E;  4XQN A;  1DON A;  1ENF A;  3FMC A;  4DR2 Q;  4AIM A;  1F2Y A;  3HOY G;  3GTO B;  3DM3 A;  2B3G A;  2EZV A;  3I4M G;  5C3E B;  2Y0S E;  3TRE A;  1U4M A;  5J39 A;  4L5T A;  1BCP D;  3ER0 A;  4X65 L;  3VR6 A;  3I55 A;  3TS0 A;  2A6H C;  2K52 A;  3R3O A;  5ELN A;  3SK8 A;  4JI8 Q;  1CZG A;  3UDF A;  4DF7 A;  4IFD H;  2KCM A;  3C1F A;  4DA2 A;  1B44 D;  5IT9 E;  1AE2 A;  5IT9 c;  4A3K H;  1G8Z D;  3C46 A;  4DR6 Q;  2DY7 A;  4V19 0;  3PO2 G;  1S3O A;  4QCL A;  4I7Z C;  2CVR A;  1WD1 A;  1Z9F A;  3I4N G;  2R7Z H;  1NAP A;  2A69 D;  1O7Y A;  3S1M H;  2E2J B;  1BCP C;  1C48 A;  1OXX K;  3RLN A;  4NXM L;  1E3P A;  3H3V I;  1NY4 A;  1EZ8 A;  1HFG A;  4PMC A;  2IW3 A;  5EBC A;  2CCZ A;  4QGU A;  4LW1 A;  1XNR L;  1RF2 D;  5EAY A;  2RCN A;  2F4I A;  2NTS A;  1VQ9 A;  2E2I H;  3S15 B;  1X3P A;  3CAM A;  4GLA C;  2DGY A;  4DR7 L;  5E4X A;  4AH6 A;  1QE6 A;  2XVS A;  1KTK A;  4S3S A;  4DXG A;  2JA9 A;  1LYL A;  5CR3 A;  1WTQ A;  1X54 A;  2L15 A;  4Y7N B;  1L1O B;  1EQR A;  3BVM A;  4CHT B;  1T9H A;  3AB9 A;  5GAH C;  1X56 A;  3FDT A;  2NVY H;  3KJP A;  1TS2 A;  1I4P A;  1M1K C;  2WV6 D;  4XIG S;  3TME A;  1DOL A;  2LSS A;  4DR2 L;  1Q81 C;  1JWU D;  3L2P A;  4ZKC B;  5K5P A;  4K8J A;  3G6E A;  4Z9C B;  4OL7 A;  4DUY L;  1PTO H;  2N55 A;  1E0B A;  4FF1 A;  4OO1 H;  2RHQ B;  3M9B A;  4MHE A;  2CW0 D;  5EKI A;  1IBL Q;  5IYD G;  2K5Q A;  3IAY A;  4JI8 L;  5DAU A;  3I72 A;  2V4D A;  3EVQ A;  3S24 A;  1WTV A;  3GV3 A;  2JA7 B;  2VW9 A;  4P2C B;  1RD9 D;  4QY7 A;  3SK6 A;  3M4P A; 
#chains in the Genus database with same CATH homology
 1NMG A;  2Z6K C;  4R4C A;  3VDY A;  3J80 i;  3CCE A;  5C3E H;  4LUV A;  3A5U A;  2NVT H;  1GM5 A;  2R93 G;  2R7D A;  1ASZ A;  2R7F A;  1B8A A;  3OYY A;  4LF9 Q;  3M4Q A;  5M3F G;  4OX9 L;  1VQ5 A;  1NJI C;  3CC2 A;  2F4V Q;  4HJ7 A;  4GOP B;  3F2D A;  1WYD A;  3GTG H;  4A93 H;  3IRB A;  1WCM H;  4JCV E;  4UP9 A;  4A3D G;  4NB3 A;  1HNW Q;  4EX5 A;  1B70 B;  4B3M Q;  3M7N A;  2UXC L;  1EOV A;  2EIF A;  4C2M H;  3KFU A;  1NMF A;  2D0O A;  2K50 A;  2Q2I A;  2ZJQ A;  5GAG C;  3FKI H;  5E7N A;  4YY3 Q;  4YWL A;  2CQO A;  4OWX B;  1R9T H;  5C44 H;  4KI0 A;  1KD1 C;  5IYB H;  3S2H H;  2K75 A;  4DR1 Q;  4B3R Q;  5LMU Q;  1V1Q A;  3CW2 C;  4JI3 L;  3ULP A;  1Z47 A;  3PUW A;  3PUY A;  3PF5 A;  1OXV A;  3AFP A;  3TQY A;  3RN2 A;  3CC7 A;  2I0Q A;  2Z6K A;  4LUZ A;  4R4I A;  4J15 A;  2PNH A;  2HT1 A;  3FP9 A;  1A0I A;  5JEA G;  5LMN L;  1HR0 Q;  4X64 L;  4GNX B;  4IJH A;  2HQL A;  4C3J H;  4B3T Q;  4BY7 G;  4DR4 Q;  4C3I H;  1IBM Q;  1L1O C;  4PZ7 A;  5IP9 G;  4DV5 Q;  3T1H L;  2MFI A;  2JA7 G;  4BXX G;  1X3F A;  2HIV A;  3M4O H;  1KXL A;  1HJP A;  5C0X J;  4DV3 Q;  3T1Y Q;  3BZK A;  5FLX c;  4JI2 Q;  1XNQ Q;  4XTC S;  1SRU A;  1TWF H;  5IWA Q;  4GLX A;  4HJ8 A;  4GS3 A;  4X62 L;  4DUZ Q;  1PH7 A;  4LFC Q;  1TWC H;  3PF4 A;  1MIU A;  2UUC Q;  1SMX A;  3CD6 A;  3AYH B;  4P71 A;  2UU9 L;  3S2D H;  3S1Q H;  1KAW A;  3OTO Q;  4LF5 L;  4YWM A;  1XMQ L;  1GKH A;  4A3B H;  5IYC H;  1VQC A;  1PH6 A;  4BY1 H;  3KLW A;  3F8T A;  4EQ5 A;  4A3E G;  3GTK H;  1TWA H;  3HOV H;  3KF8 B;  2F3I A;  4Y7N H;  1XPO A;  4JBK A;  1MKH A;  3UDX A;  3MEF A;  2KCT A;  3TEH B;  1L1O A;  1HZA A;  5DLQ E;  5C4X H;  1C7Y A;  3EBE A;  2OWO A;  1IBL L;  4NXN L;  2UXB Q;  1IXR A;  2PI2 E;  3KF6 B;  3RLF A;  3CQZ H;  2OTL A;  4JBM A;  1W3S A;  5M5X H;  4GKJ Q;  4X66 Q;  4Y52 H;  4AQY Q;  3HFZ B;  4HIM A;  2OQK A;  4A3L H;  5HGQ A;  3GTQ H;  1PH2 A;  1IYJ B;  3CCM A;  4BA2 I;  3K7U C;  2GVB A;  4ALP A;  3U58 A;  4A3M H;  2E2H H;  2MO1 A;  4IPC A;  3A5Z B;  1K8G A;  2JA8 H;  3HOU G;  3I2Z A;  3RN5 A;  2ZJR A;  4GOP C;  4JI0 Q;  4P75 A;  1HNX Q;  1SE8 A;  2JK8 A;  1X9N A;  2K4K A;  4YHH L;  2WAQ G;  3ERS X;  2BH8 A;  3UE1 A;  1K3R A;  1FL0 A;  2UUB Q;  3GD7 A;  4B3M L;  4POG A;  3HOY H;  3W1G A;  1L2F A;  3J7Z C;  1A62 A;  4UP7 A;  5GRO A;  1Y14 B;  3D31 A;  1KC8 C;  1VQH A;  4YY3 L;  4TVA B;  3J80 c;  4GLV B;  1PH5 A;  2JA5 H;  2Z0S A;  3I4M H;  3JAM i;  3I4O A;  4BBS H;  2XTI A;  4QL5 A;  4B3R L;  2WB1 G;  2ID0 A;  3H0G H;  4QY7 A;  2K5H A;  3CCL A;  2RHS B;  4LFA Q;  5M3M H;  5C4J H;  1G6P A;  1YNX A;  1XTD A;  1KIX A;  4GN5 A;  4GNX C;  1HR0 L;  3U50 C;  2KHI A;  5JJL A;  5J3B A;  4DR3 L;  5FJ8 G;  1SLJ A;  4OON A;  4JBW A;  2JEA I;  4A3I G;  4GOP A;  4B3T L;  3NEL A;  4DR4 L;  4A3J G;  1A63 A;  4JI5 L;  1WJJ A;  4YWK A;  2GN5 A;  3S16 H;  3PO3 H;  2I5L X;  1SRO A;  3OW2 A;  1VQ7 A;  2ES2 A;  1IL2 A;  2XGT A;  4B3S L;  5HY6 A;  4A3F H;  1E1O A;  3PO2 H;  1SR3 A;  3T1Y L;  3U4V A;  1X65 A;  2ZTE A;  1CKN A;  1JE5 A;  2CFM A;  3HKS A;  3MXN B;  3I4N H;  3WWV A;  2HHH L;  1PVO A;  5AJ3 Q;  2ASB A;  2R92 G;  4HID A;  1C9O A;  2E8G A;  1VQL A;  4A3G G;  4A3G H;  3CF5 A;  2DUD A;  2YV5 A;  4ME3 A;  4JI7 L;  1K83 H;  3KOJ A;  2VQE Q;  2YTY A;  4DPG A;  5ELO A;  4GNX A;  2K5V A;  3GTP H;  2GVA A;  4A76 A;  1PH8 A;  4DR6 L;  4RG1 A;  1YJN A;  1I5F A;  4KLK A;  3HOX G;  4KHP Q;  2D0P A;  4PZ8 A;  4DV4 L;  2YTV A;  4JI6 Q;  1KL9 A;  2N3S A;  4MNO A;  4BBR H;  3GTM H;  4GN4 B;  5K36 G;  3J7A 5;  4HIO A;  1PH4 A;  4A3C H;  3KYH C;  4JI1 Q;  4AYB G;  1X6O A;  1FJG Q;  3AQQ A;  4GKJ L;  3L7Z C;  3NEM A;  4P73 A;  2ZTC A;  2VNU D;  1XPU A;  4DV2 L;  1HZ9 A;  3CMA A;  2MQH A;  4UPA A;  3K80 C;  2QEX A;  1CSQ A;  1E7Z A;  4K0K Q;  4BA1 I;  2EXD A;  1CKN B;  4HIK A;  1N36 L;  1PYB A;  4NXM Q;  4DV0 Q;  4IFD G;  3UDI A;  4JI0 L;  1Q1B A;  1J5E L;  1AE3 A;  1I3Q H;  2B63 G;  3CPF A;  3H3V H;  4R4T A;  4YCW A;  1U0L A;  2NN6 I;  4A3K G;  1S40 A;  3HOZ H;  1OXU A;  3CP0 A;  2N8N A;  1VS0 A;  3G71 A;  3PUZ A;  1Y1W G;  4PZ6 A;  2UUA Q;  1P8L A;  4A75 A;  1KRS A;  2R6G A;  5BR8 Q;  2E2J H;  3CME A;  3KF6 A;  4MZ9 A;  4DV1 L;  1OTC A;  2R7Z G;  4LFB L;  2JQO A;  1N32 Q;  1Q7Y C;  2E5L Q;  3GO5 A;  3HOW H;  2EQS A;  2I5M X;  4R4Q A;  1VQO A;  5M5W H;  1XMO Q;  4IPH A;  2KHJ A;  4LFA L;  3RLO A;  1CSP A;  1VQJ A;  4NPS A;  1BBU A;  2ALY B;  5IYD H;  1VCI A;  1Y1V G;  4LF7 Q;  2OQ0 A;  2A19 A;  2VUM H;  4QIW E;  1JT8 A;  1YVC A;  3PV0 A;  4IFD I;  5FLM G;  3S15 H;  4JYA L;  1LM0 A;  3W5O A;  4JV5 L;  4GN3 B;  3M3Y H;  4GKK Q;  1L0W A;  4L5S A;  2Y0S G;  1Q8K A;  2AWN A;  3F1Z A;  3JAM c;  1D8L A;  1I94 Q;  3E9H A;  2WP8 J;  2OTJ A;  2NN6 G;  3FHW A;  3STB D;  2R93 H;  4OO1 I;  2BH2 A;  4A4I A;  3KDF B;  3CPW A;  3PUV A;  2LXK A;  5M3F H;  4DKA C;  4DNI A;  1HZC A;  2JA5 G;  2I5H A;  3J81 i;  4DUY Q;  5AJ3 L;  2UXD L;  1B7Y B;  4A3D H;  2VQF L;  2ZM6 L;  3H0G G;  2PQA B;  4DV6 L;  1AH9 A;  3PUX A;  4JG2 A;  1VQA A;  2Q2U A;  1QZH A;  4IJL A;  1IZ6 A;  4O0A A;  4IO9 A;  4MTN A;  2KEN A;  5H1S E;  2JA6 G;  1N33 Q;  4DR5 L;  1EQQ A;  1PV4 A;  3DLL A;  4DV0 L;  1FGU A;  3M85 A;  1N8R C;  1TWG H;  1Q86 C;  2VZA A;  1HZB A;  2A1A A;  2RF4 A;  4KHP L;  2CWA A;  4LF9 L;  4WJ4 A;  1YHA A;  1YIT A;  1XPR A;  3CCV A;  2F4V L;  1X55 A;  2HIX A;  3STB C;  5IP7 G;  1GVP A;  1V9P A;  3D0F A;  4JI1 L;  3UDG A;  1HNW L;  1GD7 A;  4OO1 G;  2WFW A;  4OXP A;  4OX9 Q;  3PCO B;  4BY7 H;  2CWP A;  2IX0 A;  3F2B A;  5IP9 H;  2JA7 H;  4IOA A;  3I56 A;  4IFD J;  3ULL A;  4TQU S;  5C0X I;  2UXC Q;  2WAQ E;  1PA6 A;  4FDB A;  4DR1 L;  2JE6 I;  5LMU L;  1PH3 A;  2QA4 A;  4LWC A;  2ZTD A;  4LNQ A;  3G4S A;  3K81 C;  1G51 A;  1PH9 A;  3ZJY C;  5JEA J;  4JC0 A;  2UUA L;  5C3E G;  3PIP A;  3E0E A;  4JI3 Q;  1IBK Q;  4O2D A;  3B6Y A;  2YU9 H;  1WFQ A;  5BR8 L;  2D62 A;  1KRT A;  2VS1 A;  2WB1 E;  1Q12 A;  1N32 L;  1IBM L;  4A93 G;  4A3E H;  4DV5 L;  1WCM G;  5LMN Q;  4IPG A;  4X64 Q;  2LXJ A;  1N34 Q;  4DV3 L;  1UE6 A;  1XNQ L;  4JI2 L;  3ICE A;  2VL6 A;  3CC4 A;  4LFC L;  1O7I A;  5IWA L;  3FKI G;  4DUZ L;  1VQN A;  4IPD A;  4LF7 L;  2UUC L;  5C44 G;  1EYG A;  5IYB G;  3OTO L;  2N49 A;  4X65 Q;  1HNZ Q;  1EFW A;  1LTL A;  1S72 A;  1JB7 A;  3A0J A;  1BVS A;  3BU2 A;  1VQI A;  3G48 A;  4JI4 Q;  1OXS C;  2PMZ E;  1I94 L;  2UU9 Q;  4YCU A;  1Q46 A;  1XJV A;  4LF5 Q;  3HKZ G;  1WOC A;  1X3E A;  1CKO A;  2CKZ B;  3HOU H;  1PH1 A;  4WJ3 M;  4P74 A;  5JJK A;  1N9W A;  1E1T A;  1YIJ A;  4DV7 Q;  1KQS A;  3SGI A;  2KBN A;  3CCR A;  2UXB L;  1UE1 A;  4H02 A;  3EN2 A;  1CUK A;  1Q82 C;  4X66 L;  3BZC A;  4AQY L;  2OCE A;  1NTG A;  1YJW A;  4PG3 A;  2JEB I;  3ULJ A;  1BKB A;  3J81 c;  4AYB E;  4DAM A;  4A3B G;  1YI2 A;  5IYC G;  1EUJ A;  1VQF A;  4LF6 Q;  1I6H H;  4BY1 G;  4UY8 C;  1HNX L;  1EWI A;  2ATW A;  3BJU A;  3K8A A;  5LMN W;  1NBW A;  4JOI C;  3KDF A;  3HOV G;  4C3H H;  3A74 A;  3LGJ A;  2UUB L;  1XNR Q;  2IHE A;  5FJ8 H;  4A3I H;  3S1N H;  3S17 H;  4A3J H;  2MO0 A;  1VQD A;  3H15 A;  2A8V A;  4YHH Q;  1VQ6 A;  5C4X G;  2PQA A;  3GDE A;  4PMW A;  1JJG A;  2K5N A;  4UP8 A;  4DR7 Q;  3AFQ A;  3K0X A;  3TS2 A;  3PSI A;  1E24 A;  1VQK A;  4A3L G;  4HJ5 A;  3TRZ A;  1RIP A;  5GQO A;  2R92 H;  3CCU A;  4A3M G;  1RL2 A;  1VQ8 A;  2ZJP A;  3CCS A;  2AWO A;  1EIF A;  1IBK L;  4JBJ A;  1A8V A;  2VY3 A;  4RMF A;  2NVX H;  2MNA A;  2JA8 G;  5GAE C;  3GTJ H;  4LF4 Q;  4LF8 Q;  1LUZ A;  3NEN A;  4YCV A;  1W2B A;  4QJF A;  5GAD C;  1WI5 A;  2NVQ H;  1MJE A;  4JOI A;  4DK3 C;  3RZO H;  4DR3 Q;  4DR2 Q;  4AIM A;  3KJO A;  2Q2H A;  1N34 L;  3NBH B;  3HOY G;  2YYZ A;  3DM3 A;  3HOX H;  2F52 A;  2B3G A;  4JI5 Q;  1TXY A;  1EIY B;  3I4M G;  3EIV A;  1YHQ A;  4B3S Q;  1UEB A;  2Y0S E;  3Q8D A;  3TRE A;  1ASY A;  1FVI A;  4BBS G;  1JMC A;  4L5T A;  3ER0 A;  4OWT B;  2B29 A;  4X65 L;  3I55 A;  1HNZ L;  3TS0 A;  4JI4 L;  2HHH Q;  5M3M G;  3J81 j;  1VQM A;  1K73 C;  2K52 A;  1UE7 A;  2VQE L;  5ELN A;  1X3G A;  4JI8 Q;  3UDF A;  1QZG A;  3JC6 6;  2IHF A;  2KCM A;  4POF A;  4JI7 Q;  1M90 C;  2B63 H;  4APV A;  2AHO B;  1AE2 A;  5IT9 c;  4A3K H;  4JI6 L;  4DV7 L;  3PO3 G;  4DR6 Q;  1NE3 A;  1Y1W H;  1VQE A;  4A3F G;  3PO2 G;  1S3O A;  2BA1 A;  1FJG L;  4DV4 Q;  3K7A H;  1G29 1;  1OXT A;  1GO3 E;  1Z9F A;  3S14 H;  3I4N G;  2R7Z H;  5IE8 A;  3S1M H;  4K0K L;  3CCJ A;  1PFS A;  4BXX H;  1E22 A;  1VQ4 A;  1SFO H;  1J6Q A;  1OXX K;  4DK6 C;  3RLN A;  4DV2 Q;  4NXM L;  1E3P A;  3H3V I;  1NY4 A;  2V1C C;  1U5K A;  4LF6 L;  5IY0 A;  2QGQ A;  1N36 Q;  4DAY B;  1HR0 W;  1Y1V H;  2N78 A;  3UE0 A;  4R4O A;  1I50 H;  4LW1 A;  4QGU A;  2CCZ A;  1D7Q A;  1XNR L;  2AKW B;  5EAY A;  2JJQ A;  5FLM H;  1J5E Q;  3PGZ A;  3PIO A;  2RCN A;  4BBR G;  1QVC A;  1YBY A;  4HJA A;  1VQ9 A;  2E2I H;  2IX1 A;  2NZO A;  2BA0 A;  3CAM A;  4GLA C;  4A3C G;  2DGY A;  4DR7 L;  1Q1E A;  1YJ9 A;  1VQP A;  2E5L L;  3E9I A;  1QUQ A;  1YEZ A;  2H5X A;  4AH6 A;  1KHI A;  1P16 A;  2NZH A;  4R1J A;  1PYS B;  4DV1 Q;  4LFB Q;  1VQB A;  1LYL A;  2JA9 A;  1XMO L;  2AMC B;  1X54 A;  2L15 A;  3T1H Q;  1UWV A;  3RR5 A;  1HH2 P;  1QVG A;  5M5Y H;  1L1O B;  1JJ2 A;  1EQR A;  5GAH C;  1T9H A;  1YZ6 A;  1X56 A;  1CKM A;  4KHZ A;  2NVY H;  3F2C A;  1YHB A;  3CCQ A;  4IOC A;  4P72 A;  3KJP A;  5C0X G;  4LF4 L;  4LF8 L;  2JA6 H;  2FXQ A;  1M1K C;  4X62 Q;  4GKK L;  4XIG S;  1QVF A;  3HOZ G;  4QQB X;  2LSS A;  4DR2 L;  1Q81 C;  4JV5 Q;  4JYA Q;  1DGS A;  3L2P A;  1XMQ Q;  3GTL H;  4L5Q A;  3U4Z A;  3G6E A;  3RZD H;  1PHJ A;  2PI2 A;  1C0A A;  1TWH H;  5IP7 H;  4DUY L;  1BBW A;  3HOW G;  3I7F A;  4L5R C;  3RNU A;  1JJC B;  4HJ9 A;  3HKZ E;  3S1R H;  2RHQ B;  3AEV A;  3M9B A;  2Q2T A;  1V43 A;  1H95 A;  2UXD Q;  4OWW B;  2IT1 A;  3CXC A;  1SN8 A;  3W1B A;  1QUQ B;  2VQF Q;  1IBL Q;  5IYD G;  2ZM6 Q;  1N33 L;  1K0R A;  2C35 B;  4LUO A;  4NXN Q;  3L0O A;  4JI8 L;  4DV6 Q;  1VQG A;  2VUM G;  1MJC A;  2IY5 B;  4X6A H;  3S24 A;  2VW9 A;  1K8A C;  3GTO H;  1K9M C;  4DR5 Q;  5JJI A;  2K14 A;  2YTX A;  3M4P A;  1UE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...