4GOPB

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
122
Chain Sequence
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
molecule keywords Putative uncharacterized protein
total genus 29
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopB00
4DNIA 3K0XA 1I94L 2HHHL 1B8AA 1EUJA 1X9NA 3KOJA 4DV1Q 2BH2A 3HOYG 3KFUA 3I4MH 3NEMA 3T1YQ 4JBKA 4YWMA 1VQLA 2ZJQA 4YY3Q 1SN8A 1UE6A 4LF8L 1HJPA 1GD7A 3H0GG 3PUWA 5FLMH 4JI6Q 4A3LH 2VQEL 1LM0A 2K5VA 5IYCG 4NB3A 4LF9L 3HOXH 1K73C 4BBSH 2GN5A 3G71A 2JA6G 5IYBG 1PH9A 2KHJA 1S40A 4C3JH 1VQ4A 4BA1I 2R7FA 1CKNA 1IXRA 3A5UA 4ALPA 4LW1A 3U4VA 4GLXA 2OTJA 4YCWA 3WWVA 2YTXA 2UUBL 3M4PA 4GKJL 3AEVA 2JK8A 1EIFA 4DV2L 1SFOH 4KLKA 4LWCA 2UXDQ 2VY3A 4DR2Q 3S1MH 4B3SQ 3A74A 3K7AH 4IOCA 1XJVA 1U5KA 4R4OA 4A3CG 3ULLA 3GTPH 1E7ZA 3CPWA 3IRBA 4AH6A 1LTLA 2K75A 4A3JH 1EQRA 4DK3C 2YYZA 3OW2A 2AHOB 4J15A 3RLOA 4JOIA 3KF6A 3GD7A 4JI5L 4OWWB 3S1QH 3HOWG 1AH9A 1Q1BA 4HIKA 4A3FG 2CQOA 2RF4A 3PUXA 1UE5A 4UPAA 1OXXK 2WAQE 1PH8A 1N33Q 4B3RL 1XNQL 3NELA 1XPOA 1D8LA 1KL9A 2IHEA 4YCUA 4B3ML 3S1RH 4A3BG 2VS1A 2YV5A 1L1OC 4JI4L 3MEFA 1BBWA 1PV4A 4OWXB 5M3FG 1L1OA 1YHBA 4AQYL 1HR0Q 2B63G 3CPFA 1K8GA 1E24A 4JI3L 5IP7G 4LUZA 3KJPA 3HKSA 1S72A 5J3BA 4QGUA 1CSQA 3GTJH 4DUYL 2IX0A 3NENA 4DR1L 3M9BA 1YI2A 1IBLL 2BA0A 3GTMH 4BBSG 4LUVA 2KBNA 4GOPA 1K83H 3G4SA 2JA5G 4DPGA 1KC8C 5LMUQ 2HT1A 1WFQA 2R7ZG 2F52A 1IZ6A 1X6OA 2D62A 2AKWB 5FJ8H 3EBEA 1XTDA 3GTQH 2NVYH 2YTYA 3PO2H 4HJ8A 2EIFA 5AJ3L 1YJNA 1AE2A 1A63A 5LMNL 4UY8C 3M7NA 4JV5L 4GNXC 2ZTDA 2K4KA 2Q2IA 2IY5B 4X65Q 5IWAQ 4AYBE 1Y1WH 1VQ6A 3DM3A 3PO2G 2EQSA 1KAWA 3G6EA 2UXCL 2QA4A 3UE1A 3PIPA 5FJ8G 2BA1A 1K3RA 1XPRA 1GO3E 3PUVA 4NXNL 1VQ5A 5K36G 4DAYB 1VQKA 2ES2A 4X64Q 4DR7L 2WAQG 1VQOA 3A5ZB 1Y1VH 2CWAA 3STBD 1K8AC 2ZM6L 1IBKL 3F8TA 4JV5Q 4C3HH 3CXCA 3FHWA 1IL2A 4DV4L 3HOXG 4IFDI 5IYBH 1M90C 1HNXL 2JA7G 2E2IH 1GVPA 3L2PA 2JEAI 1E3PA 4UP9A 1QZGA 5GAEC 4Y7NH 4JI7Q 3EN2A 4A3GH 2UUAL 2Y0SE 4B3TQ 4KHPL 3STBC 4L5TA 4QY7A 1T9HA 2NZOA 5M5XH 5M5YH 2MNAA 3ULPA 4A3JG 1KD1C 4LFCQ 3J80i 1HH2P 3HOZG 3S16H 2JJQA 3CQZH 3CCRA 3S1NH 1TWFH 4AIMA 2VQFL 1E1OA 2AWOA 2K50A 1J5EL 3M4OH 3PV0A 3CC2A 2F4VL 1XMOQ 2E5LL 4LFBQ 2MO1A 2HIVA 2E2HH 2ZJRA 5C44G 3CMAA 1PH4A 3ER0A 5IP9H 4R4TA 1X54A 5GQOA 4PMWA 4IFDG 3RLNA 1QVCA 3HOWH 5IYDH 3TS2A 5M3MG 3I56A 4DV6Q 3GDEA 3J80c 1PH5A 1VS0A 1NMFA 1N33L 4LUOA 4MNOA 4A3GG 4DV5Q 1XNRL 3AYHB 4OO1I 1VQ9A 1NBWA 2OTLA 2N8NA 1CSPA 1BKBA 3W5OA 4PZ7A 3PIOA 3VDYA 3UDFA 5C3EG 1J5EQ 1UE1A 4BBRG 3J7ZC 4YCVA 4DV5L 4DR3L 4LNQA 3RLFA 4LF7Q 3KLWA 1HZBA 2UUAQ 1CKNB 2K14A 2NVQH 2ID0A 4JOIC 3E0EA 4B3SL 1HNWQ 2C35B 1Q8KA 3AQQA 1N36L 3UE0A 3H3VH 3I4MG 3DLLA 1XMOL 4C3IH 2E5LQ 4LFBL 1LUZA 3EIVA 4DV4Q 1EWIA 4X6AH 1U0LA 1J6QA 2ZM6Q 4DV0Q 1MJCA 3RZOH 4AYBG 4WJ3M 1MIUA 4BY1G 4DK6C 4AQYQ 3F2BA 3PO3H 1FJGL 4EQ5A 1HNZQ 2ZTEA 4HJ7A 4NXNQ 5ELOA 2JA8H 1HZCA 4APVA 5JJLA 1OXVA 3I4OA 3UDXA 4DR5L 4LF5Q 2R92H 1YBYA 2ATWA 1IBKQ 3CP0A 3M4QA 2PNHA 2B3GA 4OWTB 2JA5H 1Q12A 4IPGA 4P75A 4DR7Q 2UXBL 3CMEA 2RHSB 2H5XA 3D31A 4A93H 4P74A 1Y1VG 1KXLA 4R4QA 2KCTA 1R9TH 1Q1EA 1I3QH 2QGQA 4DV6L 5FLMG 1PYSB 4X62Q 3JAMc 1FVIA 1PA6A 5C0XI 1G291 3OTOQ 2LSSA 5C0XJ 3KDFA 1HNZL 1KQSA 1FJGQ 3HOYH 2IX1A 1HNXQ 1L2FA 5IWAL 3GTGH 4DV2Q 1LYLA 1MJEA 2F4VQ 3S17H 1W3SA 5JEAJ 4JI2L 2AWNA 3CF5A 1X3EA 2PI2E 5LMNQ 2VW9A 1OXUA 4GNXB 2ALYB 4JI3Q 3TREA 3AFPA 4A3KG 4LFCL 1VQ8A 2DUDA 4O2DA 3JAMi 4JG2A 1Q7YC 4B3TL 4KHPQ 2WP8J 1VQAA 2PQAB 1Z9FA 3CAMA 3OTOL 3J81j 1HNWL 3HKZG 3ZJYC 4A3EG 2CFMA 3TEHB 4BY7G 4X62L 1KHIA 1QUQA 1FL0A 1GKHA 3I4NG 1TWAH 1IYJB 1VQJA 4Y52H 3CCLA 1PH7A 1TXYA 2RCNA 4QJFA 3U50C 2FXQA 3CC7A 2Q2HA 1GM5A 2YTVA 3CCQA 1ASZA 2UXBQ 2JA7H 4X65L 1B7YB 1X65A 1X3FA 4IPDA 2ASBA 2VUMG 4PZ8A 1WCMH 2WB1E 4LF5L 4OX9L 5AJ3Q 5C3EH 4DR5Q 1XPUA 1JE5A 1TWHH 3I55A 1B70B 4HIDA 4HIOA 3H0GH 4B3RQ 4KI0A 1V43A 1PH2A 1VQIA 1EFWA 1CUKA 4RMFA 4BBRH 3KJOA 4A93G 4A3MH 1TWCH 3PGZA 1V1QA 2CCZA 4X66L 3J7A5 4A75A 4JI5Q 2Y0SG 2KENA 1WCMG 1A62A 2AMCB 4DR1Q 1YNXA 3F1ZA 4GN5A 3SGIA 3ULJA 4DV0L 4OXPA 5IP9G 4YWKA 2PI2A 4LFAL 1YHAA 3G48A 1Y14B 4JC0A 3CCJA 4BY1H 1FGUA 2E2JH 5GROA 4KHZA 1HR0L 4A3IH 1N36Q 3W1GA 1O7IA 1N9WA 1PYBA 1S3OA 1K0RA 3KF8B 4JI1Q 4A76A 4JI4Q 1HZAA 2MO0A 4LF7L 5EAYA 3U4ZA 3J81i 4DR3Q 1IBLQ 3MXNB 1A0IA 3CCSA 2NN6G 2R7ZH 1JJ2A 1NY4A 2VNUD 3E9HA 4DUZL 4BXXH 3HOUH 4GOPC 2NVTH 2VUMH 1BVSA 2D0PA 3D0FA 1QZHA 4JBWA 5C4XG 4K0KQ 1XNRQ 3M3YH 5C4JH 4DAMA 4YWLA 5IE8A 3K8AA 2ZJPA 3UDGA 4DR6L 1CKOA 2NVXH 1M1KC 2N3SA 4POFA 3PCOB 4DR2L 3CCVA 4JI8Q 1PH1A 1Q46A 1SROA 4IPHA 3HFZB 3CCUA 2UUCL 4IFDJ 3GTLH 1EOVA 4GKJQ 3L0OA 2Q2TA 2VQFQ 2UU9Q 3TRZA 1PHJA 4QIWE 2R93G 1YJWA 3PF4A 4R1JA 1JB7A 2JQOA 5IYDG 1L1OB 3HOVH 5M5WH 5C4XH 1KRSA 2HQLA 4LF9Q 2GVAA 4JI7L 2OCEA 2ZTCA 4A3FH 1VQ7A 2VQEQ 1PVOA 2R7DA 5GADC 4YHHL 1OTCA 2WB1G 4A4IA 3S24A 1RIPA 4A3EH 1VQCA 1Y1WG 2UUBQ 4P71A 1YHQA 1YJ9A 2Q2UA 1W2BA 2KHIA 5IT9c 1D7QA 3T1HQ 2I5LX 1NE3A 4BY7H 2JEBI 4IPCA 1VQEA 2N49A 1PFSA 3KF6B 3RZDH 1G6PA 5JJIA 4X64L 3CCEA 3HOZH 1SLJA 3K80C 4DV3L 1UEBA 2N78A 3UDIA 4JI0Q 1PH3A 4TVAB 4MTNA 3W1BA 4GNXA 1N32Q 5C0XG 2Z6KC 4JI6L 3TQYA 2UXCQ 3HOVG 5JJKA 5M3FH 4YY3L 4R4CA 1XNQQ 4HJ9A 1Q86C 3F2DA 1G51A 3GTKH 3T1HL 1PH6A 5JEAG 1N34L 3KDFB 4HJ5A 2Z6KA 3B6YA 1VQNA 2OWOA 1DGSA 2I5HA 1I94Q 2HHHQ 1WOCA 4L5QA 1OXTA 1VCIA 4DV7L 3U58A 2KCMA 4ME3A 5IY0A 1YITA 3NBHB 1XMQL 1QVGA 4L5RC 1WYDA 4PZ6A 3CC4A 2A19A 1ASYA 1V9PA 4GKKL 4A3LG 1C9OA 1UE7A 3RR5A 3K81C 2BH8A 2EXDA 2UU9L 2UXDL 1JMCA 5LMUL 1NMGA 5GAGC 3FKIG 4A3DG 4OONA 1IBML 1TWGH 4A3IG 4QQBX 5C44H 1YVCA 3PSIA 4DUYQ 3BJUA 2VL6A 1SR3A 1VQBA 1SE8A 4P73A 4XIGS 5M3MH 3M85A 1NJIC 1N34Q 5BR8Q 3AFQA 3ICEA 2OQ0A 1Q82C 4LF4L 1L0WA 4GOPB 3HOUG 4POGA 1KRTA 1WI5A 1KIXA 1EIYB 1H95A 1X55A 3H15A 4B3MQ 4P72A 4A3KH 1MKHA 2LXJA 4LF8Q 2Z0SA 4C2MH 3FKIH 4A3DH 3T1YL 1OXSC 4NXMQ 4DR4L 1SMXA 2PMZE 3H3VI 1X56A 4OO1G 4IJLA 1NTGA 5IYCH 1Q81C 2K5NA 2XGTA 3BU2A 4DV1L 1YIJA 1UWVA 1IBMQ 1N8RC 2MFIA 1VQGA 2LXKA 3PUZA 4HJAA 1QUQB 1X3GA 2I0QA 1I5FA 2GVBA 3L7ZC 4R4IA 1P8LA 3LGJA 4LF6L 4QL5A 2F3IA 4GN3B 3K7UC 2JA6H 3S15H 4A3BH 3F2CA 1VQPA 4JYAQ 2I5MX 2DGYA 2IT1A 5BR8L 2XTIA 3BZCA 4LFAQ 4LF6Q 3GO5A 1C7YA 4BXXG 2QEXA 1YZ6A 3JC66 1EQQA 1QVFA 3S2DH 2NN6I 1E1TA 5DLQE 5LMNW 3CCMA 2UUCQ 4WJ4A 1VQDA 4X66Q 4MZ9A 4DKAC 2D0OA 1A8VA 2HIXA 2NZHA 4O0AA 2VZAA 3E9IA 2CWPA 4NXML 4L5SA 1WJJA 1HR0W 4PG3A 2IHFA 4GLAC 4A3CH 4UP8A 4DR6Q 1P16A 1XMQQ 2JE6I 3OYYA 3GTOH 5E7NA 3HKZE 4JI0L 1VQMA 4IJHA 2V1CC 4A3MG 1EYGA 3I4NH 3A0JA 1YEZA 4LF4Q 5HGQA 2OQKA 4JCVE 4IO9A 4DUZQ 2WFWA 2L15A 2A1AA 4FDBA 3CW2C 1JJCB 2PQAA 2B29A 3CD6A 2K5HA 4DR4Q 1BBUA 5HY6A 3J81c 3BZKA 5IP7H 3TS0A 3I7FA 4YHHQ 4JI1L 2R93H 4BA2I 2B63H 1N32L 1VQFA 2JA9A 2RHQB 1I50H 1HZ9A 1VQHA 1E22A 5H1SE 2E8GA 1CKMA 4JBMA 4XTCS 2MQHA 4DV7Q 2JA8G 4JI2Q 4IOAA 5ELNA 4GS3A 1JT8A 4GN4B 3S2HH 4EX5A 1K9MC 3PUYA 3PO3G 4RG1A 4JI8L 3S14H 3PF5A 2CKZB 4GLVB 5GAHC 1SRUA 3Q8DA 3RNUA 4GKKQ 2K52A 2R6GA 4NPSA 1RL2A 4TQUS 5FLXc 3RN2A 4JYAL 4UP7A 3RN5A 3KYHC 1AE3A 2YU9H 3FP9A 1C0AA 4H02A 4OX9Q 1Z47A 3ERSX 1I6HH 2A8VA 4DV3Q 4JBJA 2R92G 4K0KL 4HIMA 3I2ZA 1JJGA
chains in the Genus database with same CATH superfamily
3AB9A 3K0XA 1JOOA 4JW0A 5G3LD 1I94L 2HHHL 3KOJA 2HDMA 3ZYYX 1PTOH 3NHHA 5D3IB 2BH2A 5I2XA 3HOYG 1M4VA 4JBKA 3T1YQ 4DU9A 5D3DA 1SN8A 1UE6A 4LF8L 1HJPA 1GD7A 3H0GG 3PUWA 2XRQD 2F0DA 3L3OC 1K73C 2EYMA 2GN5A 5IYBG 5IT9L 5EPJA 2QKIC 2R7FA 2KQ3A 1CKNA 3A5UA 4GLXA 2F0MA 1RF2D 5J22A 1QNKA 2WV6D 3J81L 2VY3A 3S1MH 4B3SQ 1XJVA 1T5XD 1U5KA 5KNBA 4FYDA 3ULLA 5J1ZA 3ITPA 1GHKA 2A68D 1D1KA 4DK3C 5FO9B 3R3OA 1SNQA 3MXPA 4J15A 3GD7A 2WKCA 1AH9A 1Q1BA 4A3FG 1TS5A 2CQOA 2F0EA 1UE5A 1PH8A 3P7JA 5T1GA 1TIID 5J39A 3NELA 2XRSD 1RODA 2L9HA 1SYCA 2YV5A 2K7VA 4IURA 4FO2A 3MEFA 1HR0Q 3Q6SA 1L1OA 1YHBA 2PW7A 2IX3A 1K8GA 5I4DA 1F2MA 3KJPA 4DR1L 3NENA 4BBSG 3M9BA 3GTMH 4GOPA 2JA5G 1O7ZA 1BF4A 1D2BA 4RA8A 1IZ6A 2EVBA 1MSHA 1B3AA 2AKWB 5FJ8H 2M9VA 4PMCA 3PO2H 2R7ZB 5AJ3L 2BCOA 4UY8C 1PZJD 2DNCA 4BWGB 2IY5B 4IUUA 2EYFA 3P20A 5M3FB 1VQ6A 1SMYC 4CGYB 1MD2D 1K3RA 3EA6A 3M4OB 4DAYB 1VQKA 1U9RA 2ES2A 1GUTA 5EGTA 2VXWA 1Y1VH 2ZM6L 5KEEA 1W6KA 5IYBH 1HNXL 5I6YA 5IGBA 2E2IH 3L2PA 1QZGA 4A3GH 2C5CA 4Z9CB 3GV6A 4KHPL 2KVMA 3STBC 1A2TA 1KD1C 4LFCQ 3J80i 3S16H 5D14A 1Q90A 2JJQA 3CQZH 1NR2A 1TWAB 3FRPB 2B2WC 3PV0A 1TKWB 4DAPA 3CC2A 2F4VL 1XMOQ 4DGZA 3QIAA 3CMAA 1MBYA 5IP9H 4PMWA 1PYWD 1PMRA 3HZXA 3J80c 1FNUA 4LUOA 5C5LA 4DV5Q 5JVG3 4OO1I 2O5JC 1ZYRD 2A74C 3H91A 2N8NA 2PCFB 3W5OA 1PRTB 2FJ2A 4BBRG 1SYFA 1C4QA 2J4XA 4LNQA 1KLUD 4KY5A 3RLFA 3EJIA 3KLWA 3VR2A 5CMDA 2ID0A 3E0EA 1A2UA 3FPPA 4L8JA 4DNTB 4BBSB 3P75A 1LUZA 3EIVA 3KLRA 4RHRA 2F0NA 4DV0Q 3KF8A 3RZOH 2K5WA 3H3VC 3KBGA 4KHVA 4BY1G 3PO3H 3J7AF 2R61A 4LAAA 4HJ7A 5ELOA 3C46A 2JA8H 3MFYA 4R8NA 1ESRA 2V4DA 3K58A 3UDXA 5IIFA 5FK9C 2EY6A 4LF5Q 1PZKD 3TP7A 4KMUC 4DF7A 2A6EC 1SXTA 4P75A 1EY7A 1Y1VG 1R9TH 1FVIA 1R4PB 2K32A 2RQXA 3KDFA 4DV2Q 2B39A 1A3TA 1LYLA 3S2HB 2B2UA 2F4VQ 1SNPA 2NWGA 1QB5D 5JEAJ 2AWNA 2PI2E 2VW9A 1OXUA 1QCBD 3VR5A 4EQOA 4HEDA 3FVQA 4LFCL 1VQ8A 2DUDA 1RD9D 1EYDA 4BY7B 1Q7YC 4KHPQ 2PQAB 4A3MB 3W3AA 1EY8A 1TY2A 2CFMA 1R4QB 1KHIA 4S3SA 1TWAH 4ZK9B 1OO9B 1EY4A 3U50C 1GM5A 4BBRB 3PIO3 2UXBQ 4G7ZC 1EQVA 3TMEA 4X65L 2E2HB 4JK1C 5IGCA 4IPDA 3CU7A 1WCMH 4PZ8A 1XPUA 2XSCA 4CJ1B 1EL0A 4KI0A 1I4PA 1LTGD 2CW0C 1EFWA 3KBXA 1PLFA 2F1MA 1MGSA 1IW7C 4A75A 3TZUA 2Y0SG 5C4ZA 4JI5Q 2KENA 1A62A 1YNXA 4DV0L 1QE6A 3G48A 1Y14B 2A73B 4FF4A 4KHZA 4IUTA 1K0RA 3TDQA 3MAQA 2JN4A 5DM63 1PRTF 3R2TA 2R7ZH 3J7AV 4ZYSA 2D0PA 5JAVA 5C4XG 4K0KQ 3M3YH 3LWUA 4DAMA 3UDGA 1CKOA 4C3JB 2NVXH 1M1KC 1WTPA 3BZDB 1ZKOA 1RCVD 2KJXA 1SROA 2DJFC 2UUCL 4KJOA 3BYYB 2RKSA 2CH4W 2Z6BA 1A15A 2R93G 4Q0FA 4R1JA 1E0BA 5IYDG 1JB7A 1L1OB 5M5WH 1FD7D 2J7ZA 1I4XA 2XWJB 1MHWC 2VQEQ 1OTCA 2WB1G 4A4IA 4A3EH 4CDEC 1FYCA 1F77A 5K5PA 4P71A 4FXGC 1B2TA 1HA6A 2KHIA 1D7QA 1WTQA 4BY7H 2JEBI 3VR3A 1VQEA 1PFSA 4RCOA 5JJIA 1WTWA 1SLJA 3DUZA 4EQPA 3UDIA 4DV3L 3HOZH 1PRTC 4TVAB 3W1BA 4JI6L 1UEAB 5JJKA 3HOVG 4R4CA 1WTRA 3T1HL 1X32A 1BR9A 3BVZA 5JEAG 1PH6A 3MXNA 2MP1A 2I5HA 1I94Q 2HHHQ 2IL8A 2E74C 1D5ZC 1H9MA 2E76C 1VCIA 3U58A 1SE2A 1SSOA 5ELDA 2F3WA 1QVGA 1XYIA 4G4KA 2RSNA 4PQXA 4GKKL 1HUMA 1O7YA 2QCPX 2EJMA 2UXDL 3KLSX 1CI3M 4A3DG 1I4GA 3GTQB 1Y1WB 1RTNA 3D6WA 4QQBX 4DUYQ 3PSIA 1SR3A 5BR8Q 1BCPD 3FDTA 1HPCA 1WI5A 3NBHA 1KIXA 2ICEC 5C4HA 4A3KH 2LXJA 2XIWA 4DR4L 1B9MA 1LLRD 1SYDA 1Q81C 3BU2A 4EQNA 1UWVA 1QWYA 2MFIA 3PUZA 1WTXA 1I5FA 2GVBA 1T5EA 5CV6A 5I9PA 4QL5A 2F3IA 3S15H 4A93B 1NSNS 1HA5A 5KNDA 3K7AB 5BR8L 2XTIA 3BZCA 3H0GB 3IKJA 5A35A 1EQQA 3I4LA 1QVFA 3S2DH 2NN6I 4NDXA 2UUCQ 1VQDA 4X66Q 4DKAC 1TR5A 1SYBA 4RCNA 1A8VA 1CK1A 2HIXA 2RBMA 1SAPA 1SNCA 3H6MA 1XXGA 2K01A 3TN2A 3GTOH 4JI0L 3HKZB 2V1CC 5KNCA 3HOWB 4LF4Q 5HGQA 4KN7C 2WFWA 2A1AA 1CA6A 2SEBD 1BBUA 4JPBW 5IP7H 4YHHQ 1SFOB 2R93H 2B63H 5ELBA 5M5XB 1B4OA 1I50H 1AN8A 3K59A 3C3LA 5H1SE 1CKMA 4FNFA 4JBMA 4C1NK 1C48A 1F2ZA 5D65A 3IFDA 2JA8G 1IW7D 2F4IA 2B2TC 4KV6A 5ELNA 5CGKA 1JT8A 2LKVA 3S2HH 4ULLA 4EX5A 1K9MC 3PO3G 1K8MA 1SRUA 1WD0A 4NPSA 4DK1A 4JYAL 4UP7A 3KYHC 2QW7A 2NVTB 4HIMA 2B2VA 1G6ZA 3SR1A 4DNIA 3Q24A 1Y8PB 3M3YB 1B8AA 1CA5A 3KLSA 3NXWA 1PZID 2EYHA 5EBCA 2EYJA 1VQLA 2FFKB 4NKLA 1LT3D 3NWTA 4F87A 5FLMH 1UNSA 3RZDB 2VQEL 2K5VA 5IYCG 2XNAC 2MPMA 3G71A 4C1NI 2M2LA 3O13A 3SXHA 3NBIA 1PH9A 1VQ4A 2A68C 2OTJA 1IXRA 4LW1A 2YTXA 3M4PA 3E3XA 2JK8A 4I65A 4DV2L 1SFOH 5BN4A 4LWCA 2RCFA 3A74A 3K7AH 4R4OA 3GTPH 4DK0A 5F2DA 3IRBA 4AH6A 3OIPA 1EQRA 2YYZA 2AHOB 2B2VC 1XWEA 1G8ZD 3OIQA 4JI5L 3S1QH 1WD1A 3S14B 4C3IG 2EYLA 3HOWG 3MVVA 4K2LA 4A3JB 4TSSA 1XPOA 4IUQA 2IHEA 3ND9A 3TSSA 3GTLB 2EY5A 2K03A 4OWXB 1JC7A 4LUZA 1S72A 1Y8OB 4TRDA 1YI2A 2BE5C 5CC4A 4LUVA 2KBNA 3G4SA 1KC8C 2NBFA 2WAQB 2WACA 3T53B 3D3RA 1EY6A 1DONA 4XQNA 2D62A 2YTYA 2SNMA 1YJNA 3CKIB 1EIGA 2OXPA 2Q2IA 3HOZB 2QILA 1KAWA 2UXCL 3PIPA 4K8IA 1XPRA 4NXNL 5K36G 2MJ8A 3OWFA 1JCKB 4X64Q 2WAQG 4M1UB 4C2MB 4JV5Q 4A3DB 4FVMA 4C3HH 4C56C 1IL2A 4DV4L 1TU2B 2ZT9C 4CJ2C 2EXZA 3LWEA 1LT5D 1BOSA 4UP9A 3QOJA 1EY9A 5EPKA 5GAEC 5AFWA 2UUAL 2Y0SE 4KKTA 2F03A 2MNAA 1HHVA 5CBEE 3ULPA 4A3JG 4NP5A 5CV7A 1HH2P 2OEOA 4WRDA 3BDOA 3CCRA 1VMPA 3G7LA 1E1OA 2K50A 1H9SA 4K14A 2VQFL 3M4OH 1ZYRC 1U4LA 2MO1A 2E2HH 5C44G 5CORA 1SMYD 1B9NA 4RGNA 3HOWH 5IYDH 1DOMA 3PO2B 3IFTA 3FPUB 4MNOA 3EQLC 4A3GG 1XNRL 1CSPA 1J5EQ 2B63B 1U4MA 4F8MA 2F3VA 2WB1B 4CKBA 3J7ZC 1LTRD 1JWMD 4ODGA 4QB4A 4H0LC 1HNWQ 1Q8KA 3TP8A 2KA7A 2E5LQ 4LFBL 1U0LA 2J0TD 1G91A 1STHA 4AQYQ 1H9RA 4O1NA 4NXNQ 2WINB 1IYVA 1HZCA 4APVA 5L37A 2NN6H 4DR5L 1TS2A 4N8X1 2A5HA 1II3A 4JVZA 1IBKQ 3CP0A 4QMGA 4XYQA 3PO3B 4OWTB 1IYUA 2M00A 1Q12A 3OWEB 2JA5H 2Z8LA 1SYGA 2KCTA 1Q1EA 1I3QH 4DV6L 1PYSB 1H9JA 3JAMc 5C0XI 1G291 2EY2A 3OTOQ 2LSSA 4X3SA 5IWAL 1G2SA 2BDOA 2FMMA 4V0BA 4C3HB 4KKUA 2SOBA 1X3EA 2ALYB 4A3KG 1FGBD 1LTAD 3JAMi 3HG9A 2EZVA 3SVMA 1F9RA 4XXEA 3CAMA 3OTOL 3J81j 3HKZG 4HSPA 2XN9C 4X62L 2H1EA 1GKHA 4IN3A 4XDXA 1CHPD 3X3NA 1PH7A 1TXYA 4UDUC 2FXQA 3CC7A 2Q2HA 1ENCA 2YTVA 4MIUA 5EBDA 1W6JA 4OX9L 3F2UA 5AJ3Q 5ELCA 3V2TA 1JE5A 4IZ8A 1TWHH 3I4MB 1QG7A 1I4HA 4B3RQ 1IKMA 3FEWX 4A93G 1CUKA 4RMFA 3VA5A 3KJOA 1TWCH 4HR7B 3F1ZA 4GN5A 3SHLA 5C3EB 1NUCA 4YWKA 2PI2A 1R9TB 5LHY1 1S5CD 4V190 4A3IH 1KDAA 3KF8B 1PTOD 4A76A 1FR3A 4JI4Q 4JI1Q 1DCZA 5CV9A 3U9SA 5JVH3 2MO0A 1EY0A 3R93A 4LF7L 2Q8RE 3J81i 2VB2X 4DR3Q 3MXNB 3E0JA 1A0IA 2HCIA 4CHTB 3ERQA 2L1BA 3S16B 5BN3A 1NY4A 4BXXH 3HOUH 2RDFA 1F2YA 5CV4A 3OMCA 3SK5A 5IE8A 3K8AA 1YNNC 3PIP3 1D1IA 2ZJPA 1STAA 1M8AA 4PV1C 4POFA 1LTBD 3CCVA 5KRUA 1PXUA 5EKIA 3HFZB 3HOXB 3GTLH 1EOVA 4GKJQ 1PFMA 4QIWE 1JR0D 3GP7A 2PQEA 5C0XH 1BXTA 2YU9B 5C4XH 4LF9Q 2RDGA 1H9SB 3VYRA 2E2IB 5GADC 4YHHL 1K28A 1KTKA 2UUBQ 1YJ9A 2Q2UA 1X3PA 5IT9c 3T1HQ 2I5LX 4IPCA 2N49A 3AMUA 2AQ1B 3CCEA 2MUYA 3K80C 5JPMC 1ESFA 4MTNA 1S4ZA 5I6WA 4XQQA 1FNWA 4YY3L 4RFBA 3GTKH 3F2DA 1LTID 3GTJB 2Z6KA 3S1RB 4L63B 2OWOA 1DGSA 3UI2A 1SDFA 1OXTA 1SJHD 4ME3A 5C3XA 4ZRZA 2F0SA 3D6CA 1V9PA 1C9OA 4HCSA 3V05A 3K81C 2BH8A 2E2DC 3CHBD 5JEAH 5LMUL 5GAGC 5CBAE 4CDCC 5CV5A 5C44H 3E5SA 2VL6A 1N34Q 2WIIB 5M3MH 3AFQA 3ICEA 4GZYC 3TBIB 1L0WA 4GOPB 3HOUG 1H95A 3EROA 4B3MQ 3DHQA 2PO4A 2Z0SA 2CW0D 2X6GA 3MHBA 3FKIH 4NXMQ 2Z1CA 1D5XC 4OO1G 1QILA 4UAIA 4IJLA 1WTHA 3D4RA 1Y69U 2XGTA 4RH6A 1N8RC 4KD3A 1VQGA 2LXKA 4ZCKA 1FNVA 3ND8A 2BDNA 2HUGA 2I0QA 4R4IA 3L7ZC 3GV3A 1P8LA 1TWGB 3NTKA 3K7UC 3F2CA 1VF7A 2I5MX 2IT1A 4XQJA 4BXXG 1E1TA 4A3KB 4WJ4A 2D0OA 3EFXD 2NZHA 3I73A 3S1QB 2VZAA 3E9IA 2CWPA 4NXML 1HR0W 4R9WA 4PG3A 5CYUA 4DR6Q 1XMQQ 3K0YA 3OYYA 4I7ZC 3HKZE 5LL6X 2NB0A 2PPBC 2FINB 2DY7A 4LMQD 4A3MG 1EYGA 2F0QA 1V8QA 4JCVE 4K2KA 1CTMA 3CW2C 1EYCA 1JJCB 2PQAA 4IQZA 1TWHB 2EE1A 1S5ED 4DR4Q 4XT1B 4HAEA 3J81c 2LFNA 2ZXOA 1I6HB 4JI1L 4BA2I 1VQFA 3S9WA 1HXYD 2RHQB 2KEDA 1JQYD 2RDHA 2E8GA 5IGFA 4QCLA 2MQHA 4JI2Q 2FMCA 1K3BC 4K6DA 4G7OC 3VR6A 1GUOA 4RG1A 4GLVB 5GAHC 2PMZB 4GKKQ 5EJWA 2ZXRA 2JXMB 5KGUA 3RN2A 1AE3A 2K04A 4H02A 1EYAA 3IL8A 2B2UC 3ERSX 1SJED 4K0KL 3I2ZA 3S24A 4XYOA 1JJGA 1I50B 2EYOA 1D5MC 2R92B 3I4MH 3NEMA 2IJ0A 4KK7A 3CRKC 4JI6Q 2D5DA 1O78A 3KUPA 4OIKA 4LF9L 1JWSD 4BBSH 1NNXA 3S17B 2JA6G 5T1IA 2KHJA 4C3JH 4BA1I 4CKEA 4ALPA 3U4VA 1XX8A 4YCWA 3WWVA 2KEEA 4GKJL 3A56A 1U4RA 4DR2Q 2R3ZA 4EVOA 1HQRD 3OHXC 4A3CG 3CPWA 2L4NA 5I9OA 2E2JB 2KECA 1LTLA 2K75A 2F0IA 4IFDH 4B08A 1ENFA 4RKBA 1SNOA 3RLOA 4JOIA 3SDZA 3QO2A 1WTVA 3DWQA 3PUXA 4UPAA 1N33Q 2WAQE 4B3RL 3GTMB 1KL9A 3S1RH 4JI4L 1L1OC 2A69D 1STEA 5LL6S 1PV4A 1AFPA 4ZKBB 3SK4A 4AQYL 1AZQA 3CPFA 4F7XA 2HD3A 1AZPA 3GTJH 1CSQA 1WVLA 4DUYL 2IX0A 1TWFB 3NP8A 4DPGA 4ZKCB 1WFQA 2DNEA 2F52A 5K36H 1X6OA 3GTQH 3EBEA 4OHJA 2OT2A 2NVYH 4DFAA 3VA7A 4HJ8A 2EIFA 5CV8A 1PTOF 2EJGC 1AE2A 1A63A 5LMNL 5TSSA 4HMJA 2ZTDA 2K4KA 5ELEA 2K05A 5IWAQ 2C9OA 1JICA 1Y1WH 3M7GA 2E75C 2K5QA 5DEHA 5M3MB 3J81E 3UE1A 1EEID 1KNEA 1RKNA 3PUVA 3NSWA 4G7HC 3BVGA 1BQQT 5IGDA 4ZUIA 4DR7L 1VQOA 3QG1A 1TVXA 2CWAA 1IBKL 3S15B 3F8TA 3CXCA 3FHWA 3S1NB 1DXMA 2JEAI 2JA7G 1GVPA 1BUVT 1E3PA 4Y7NH 4RKLA 4B3TQ 1T9HA 2NZOA 2VUMG 1HCZA 4K5WA 4U673 4A3FB 2ENBA 3ONAB 1B3QA 3BDLA 2E5LL 4LFBQ 1PRTD 5IOCA 3MTSA 3JAML 2F0JA 5GQOA 4IFDG 3PQIA 3HS0C 1QVCA 2CH4A 5M3MG 1V1OA 3I56A 3GDEA 1PH5A 1VS0A 1NMFA 1N33L 3AYHB 4RGOS 3Q0AA 5A2QE 1KDBA 1GOZA 1BO0A 1EZ8A 4PZ7A 3PIOA 1UE1A 1WTOA 4FF2A 1STGA 2RVLA 4OELB 3SE0A 1HZBA 2K5DA 1KAAA 4JOIC 2NVQH 4B3SL 2C35B 3UE0A 3DLLA 3D4WA 3C2PA 1IKLA 1EWIA 2MGSA 4X6AH 2ZM6Q 3DMUA 2JSOA 3K5OA 4AYBG 2BE5D 4DK6C 3F2BA 2IW3A 2A6HD 4DXGA 4Y7NB 3KK7A 5BN5A 4N9TA 4KJNA 1VDZA 5JJLA 4K8JA 1DM0B 1OXVA 3I4OA 1YBYA 1E2WA 4MTKA 5E3FA 1JE4A 3M4QA 5HGTA 1EQTA 5ISRA 3GTGB 2B8FA 2F0FA 2UXBL 3CMEA 2RHSB 2JA6B 2H5XA 4P74A 2G9HD 2I46A 2OF1A 1F9SA 3H94A 4R4QA 1TQOA 1PA6A 3DEOA 5FLMG 5IT9E 1CZGA 1HNZL 3J7YW 1KQSA 1FJGQ 5KYLA 1L2FA 4ABNA 1MJEA 1W3SA 1WCMB 4JI2L 1QJOA 2AUKA 5FO7B 3TREA 3C1EA 1TT2A 4KKSA 3C1FA 2L11A 4B3TL 2WP8J 3URYA 1HNWL 4KY7A 4A3EG 1H9KA 4BY7G 4IUVA 3I4NG 1VQJA 5DM73 3CCLA 1JOQA 1G2TA 2RCNA 4QJFA 1ASZA 3CCQA 2JA7H 4AYBB 5E4WC 1B7YB 2K33A 1X3FA 1BBXC 2ASBA 1GXDC 4LF5L 4H7BA 3I55A 1S5FD 1JORA 4BBRH 1QOHA 3PGZA 4A3MH 1MSGA 1V1QA 5I2YA 4H13C 4DN4M 2K6AA 3HRZC 4ZUJA 2AMCB 3SGIA 3ULJA 1STYA 4LFAL 4JC0A 3CCJA 4BY1H 3EVQA 5GROA 2E2JH 2FHTA 2VUMB 3MFGA 3MC0B 4QUFA 1O7IA 1N9WA 1PYBA 1STBA 3H09A 3K5LA 1I4QA 5EAYA 2O5IC 1Q3LA 2HDLA 3U4ZA 1D6EC 2Q8IB 3CCSA 2NVYB 2EDGA 2VNUD 4A3IB 1BVSA 3D0FA 3T13A 4OGQC 2L55A 5C4JH 4WJWA 1KDCA 3I72A 4LJZC 2HCCA 4LK1C 3PCOB 1AEXA 1PH1A 4JI8Q 2JA7B 1Q46A 4IFDJ 1ET6A 3MWYW 4O42A 2UU9Q 3TRZA 1PHJA 3DXJC 1YJWA 3PF4A 2B2WA 2JQOA 2N55A 3NTIA 3HOUB 1KRSA 3A54A 1F9PA 2GVAA 2ZTCA 2OCEA 4B9WA 4A3FH 2SDFA 1PVOA 2R7DA 4R8IA 2B2TA 5G3LF 1RIPA 1VQCA 1NAPA 5DNFA 5KYIA 3NK9A 3D4DA 1W2BA 4FXDA 1NE3A 2F0KA 3JAME 3KF6B 3OW7A 3RZDH 3RZOB 1G6PA 3NQIA 2N78A 1HTPA 4IALA 5C0XG 1VMCA 1EZ6A 3TQYA 4MN3A 1XNQQ 1PFBA 2L0CA 1Q86C 5JOBA 1G51A 3Q23A 4I7AA 5C4XB 3KDFB 1YNND 1V1PB 1CZWA 3FMCA 4DV7L 4BS9A 4CDFC 3GTPB 3NBHB 5M5YB 5FO8B 1K8OA 3T4AC 3QOLA 2DY8A 1I3QB 2EXDA 1NMGA 3QR8A 3FKIG 4OONA 1YVCA 3BJUA 1SE3A 1SE8A 2QEJC 4XIGS 1NJIC 3M85A 1GJXA 1EU4A 2OQ0A 1Q82C 4LF4L 1KRTA 2EYPA 4RGTA 1NR4A 1X55A 3H15A 1MKHA 3J80L 2JA5B 2F0TA 3BYTB 1SMXA 1X56A 5IYCH 3V96A 3L9AX 4DV1L 3OSOA 4WFN3 1AW7A 1YIJA 1Z6HA 1IBMQ 4HJAA 2H4OA 1BCPB 5C4JB 4LF6L 3DM1A 4A3BH 1ONLA 4GN3B 3DWPA 1EFID 1VQPA 4JYAQ 3E6ZX 3P1HA 4HN7A 1O7LA 2PW5A 4ZQ3A 4LF6Q 3GO5A 1IL8A 2QEXA 3JC66 2G5DA 5DLQE 1BDOA 3CCMA 1J8IA 4MZ9A 4O0AA 3WOFA 4L6TB 2XWBB 4L5SA 1LO5D 2PZTA 2F0VA 1P16A 2JE6I 2F0WA 5E7NA 1VQMA 4IJHA 4X3TA 3A0JA 1YEZA 1Y1VB 2OQKA 4IO9A 4FXKC 4KY6A 4KD4A 2CQAA 3U9OA 4FDBA 3RD4A 2PYKA 2B29A 2K5HA 1S5DD 3BG3A 5HY6A 3BS1A 1LV9A 3TS0A 3GTOB 4CBVA 2LMCB 1HZ9A 1VQHA 1C8CA 4XT3B 1E22A 1BCPC 5DAUA 4DV7Q 4BY1B 4GS3A 3PUYA 2K1BA 2XVSA 3PF5A 2NTSA 1PFNA 2K52A 2R6GA 4TQUS 3RN5A 2YU9H 1C0AA 1Z47A 4DV3Q 1EY5A 2B8GA 1LTSD 1B44D 1EUJA 3S1MB 1X9NA 4ZAIA 4DV1Q 3VYTA 4EGVA 1DZ1A 2B2YA 3KFUA 4YWMA 2ZJQA 4YY3Q 1RHPA 5EQ0A 3RMHA 3NQTA 4QUCA 1O80A 4A3LH 3MXUA 3A7AB 3NTHA 1LM0A 4KTAA 4NB3A 3HOXH 2VB3X 1ZXTA 2SNSA 1S40A 3MZ5A 3NPPA 2UUBL 5IODA 1JB3A 3AEVA 1EIFA 1RDPD 4KLKA 4FP5D 2UXDQ 5CR3A 2ICIA 3SEBA 4IOCA 1E7ZA 1A3VA 1TS3A 4OEMB 4A3JH 4F88A 1ICFB 3OW2A 4HTHA 3WOEA 3K5NA 1JWUD 3KF6A 4OWWB 3I70A 4OIJA 4DAYA 4HIKA 1I6VC 2F0LA 3VYSA 2RF4A 1OXXK 3NUCA 3MXGA 2A6HC 1XNQL 4H44C 1D8LA 4YCUA 4B3ML 4A3BG 2VS1A 3I8ZA 1SNMA 1BBWA 1E2VA 1LT4D 5M3FG 2B63G 1SBBB 1E24A 5E1FA 4JI3L 5IP7G 2DN8A 3HKSA 5J3BA 4QGUA 3CQZB 5M9OA 2KCNA 1TY0A 1HQMC 4PNYA 2BA0A 1IBLL 2HT1A 1K83H 3QJYA 5LMUQ 4OO1H 1Z7TA 3R8BA 2R7ZG 2L12A 1XTDA 5C44B 2GA4B 2P5ZX 3M7NA 5ELFA 4JV5L 4GNXC 1ET9A 1KNAA 4MHEA 4X65Q 2LY7A 4AYBE 4A3GB 4QIWB 1CM9A 1RTOA 3GQBA 3DM3A 3PO2G 2EQSA 3G6EA 2QA4A 5FJ8G 2BA1A 4N8FA 1GO3E 1VQ5A 2KCCA 4DXFA 3HGBA 1UUPA 3VYUA 4B9XA 2F0HA 1PDQA 1PTOB 2JP1A 2JYOA 3A5ZB 4OL7A 3STBD 1GUGA 3FKIB 1K8AC 1DD2A 2AQ2B 3HOXG 1DOKA 3R2IA 4IFDI 2QDBA 1M90C 1LTTD 4JI7Q 3EN2A 4A3BB 4RWSC 3TP6A 4L5TA 4QY7A 5M5XH 5M5YH 2MHVA 5KIXA 3HOZG 5FKAC 1CFMA 1IHZA 3S1NH 1TWFH 4AIMA 2AWOA 1J5EL 1UAPA 1J9OA 4ME5A 2HIVA 2ZJRA 1PH4A 3ER0A 1U4PA 1X54A 4R4TA 3RLNA 1MI2A 2Z9HA 2NVXB 3TS2A 1ICWA 4DV6Q 3MEHA 5C3WA 2QF7A 4FF3A 1ILQA 3BDCA 1VQ9A 1NBWA 2OTLA 3HOYB 1SE4A 1BKBA 1TS4A 2ZXPA 3VDYA 4N9PA 4NMZA 3UDFA 5C3EG 1STNA 2A6ED 4PMBA 4DV5L 4YCVA 3SK6A 4DR3L 4LF7Q 1EIHA 2K28A 2UUAQ 1CKNB 2K14A 3W2DA 2AUJD 1HTLD 3AQQA 1N36L 4IUNA 3H3VH 3I4MG 3J80E 4HSVA 1XMOL 4C3IH 2RSOA 4DV4Q 3M4YA 3TP5A 4YIJA 4KN4C 1J6QA 1E2ZA 1MJCA 1ILPA 4WJ3M 1MIUA 4J8QA 4CKCA 1FJGL 4EQ5A 1HNZQ 2ZTEA 3TZDA 5FLXL 3GTKB 1QNUA 2A69C 2R92H 2X69A 1GHJA 2ATWA 1KLGD 2PNHA 4M8AA 2B3GA 2TMPA 4IPGA 5IGEA 1PTOC 4DR7Q 1YNJC 4C3HG 3A8IE 3D31A 4A93H 1KXLA 2PZWA 2QGQA 3I90A 2KHSA 3A8KE 4X62Q 2O4XA 5C0XJ 3HOYH 4E6IA 1HNXQ 2IX1A 3GTGH 5JPNC 3S17H 3CF5A 5LMNQ 4GNXB 4JI3Q 1KABA 3AFPA 5COYA 4G57A 4O2DA 4JG2A 1DJRD 3Q22A 2NVQB 1VQAA 3A7LA 2N88A 1Z9FA 3ZJYC 3TEHB 1QUQA 1FL0A 2EPBA 1Q8IA 2NZ1D 3K6OA 1IYJB 1BNZA 4Y52H 1DOLA 1VQNA 1HUNA 4K6LA 1I4RA 1TWCB 1VF5C 3OOCA 4QF4A 1X65A 5E4XA 1GUSA 3I4NB 2EJFC 2LS01 2F0UA 2CVRA 2WB1E 4HMIA 2DJGC 5C3EH 2Q8TA 4DR5Q 1B70B 4HIDA 4HIOA 1DYQA 3H0GH 3X3MA 1PH2A 1V43A 1VQIA 2F0GA 5M5WB 1LACA 3HEJA 1HFNA 1GUWA 3QB3A 2CCZA 1K83B 4X66L 3J7A5 4ID6A 1K0SA 1WCMG 3AU7A 4DR1Q 4OXPA 4CDDC 2Z4IA 5IP9G 2NTTA 1YHAA 3NE5B 1FGUA 3I91A 1HR0L 3A8JE 3W1GA 1N36Q 1S3OA 1HZAA 3G6JB 3D8GA 5NUCA 1V1PA 1IBLQ 2NN6G 1JJ2A 3E9HA 4DUZL 4GOPC 2NVTH 2VUMH 3T16A 4K5VA 4JBWA 1CHQD 1QZHA 4X3UA 2I07B 1XNRQ 4YWLA 5EKLA 1CQVA 4DR6L 3I3CA 2EOTA 1NCVA 2D9UA 2N3SA 5JJZA 4DR2L 5A2QL 4IPHA 3CCUA 1B50A 2NUCA 1YNJD 3L0OA 2Q2TA 2VQFQ 1A6XA 4CJ0B 3HOVH 2HQLA 2O2LD 3N52A 2X6LA 4DA2A 1ZEQX 5FOBB 1VQ7A 4JI7L 4UHVA 5FLXE 1Y1WG 3A55A 1YHQA 3NWSA 3RUZA 3T56B 3WDNA 1S5BD 4DNRB 2IPKD 2F0PA 2KOLA 4X64L 3OPOA 5C6AA 1UEBA 4NW2A 4JI0Q 1N32Q 2G9DA 1PH3A 4GNXA 2Z6KC 3DEPA 3OMGA 2RA4A 2UXCQ 5M3FH 1AP0A 4HJ9A 4DAVA 1N34L 5IGGA 4HJ5A 3B6YA 3T51B 2L5TA 1WOCA 4L5QA 1Y8NB 3S2DB 3N6RA 2CHBD 4K5XA 2KCMA 1GUNA 5IY0A 4FF1A 1YITA 1XMQL 4L5RC 1EEFD 1WYDA 4PZ6A 3CC4A 2A19A 2Z4HA 1ASYA 4A3LG 1UE7A 3RR5A 4RHSA 5EKKA 2UU9L 1JMCA 2PZUA 1IBML 1L0XB 1TWGH 3SK8A 4A3IG 4C3IB 4IUPA 1VQBA 4P73A 3HOVB 2EY1A 4POGA 1EIYB 2KUMA 3HP3A 4P72A 4ZLTF 2R93B 4LF8Q 1JOKA 4C2MH 4A3DH 3T1YL 1OXSC 2F0OA 2PMZE 3QWNA 3H3VI 1NTGA 2AQ3B 2K5NA 1SNDA 2BOSA 2TSSA 4TKOB 1HFGA 2D2CC 1QUQB 1X3GA 2HQEA 4C3JG 3VR4A 3LGJA 1HRJA 1LT6D 4Q5VA 2JA6H 1EU3A 5C5MA 2DGYA 1L0YB 3BVMA 3CRLC 4LFAQ 1C7YA 1EWHA 1YZ6A 5LMNW 2IWHA 1LABA 3LNNA 4WORA 1SYEA 4X3KA 2JA8B 2B2YC 5HURA 1WJJA 1BCPF 2IHFA 4GLAC 4A3CH 1B1ZA 4UP8A 4ILWA 2NYZD 4A3EB 2PNRC 5EPLA 1SEBD 3I4NH 4DUZQ 1F9QA 2L15A 2Y0SB 3CD6A 1EWCA 3LX0A 3IAYA 4HCEA 4J6HA 1XTCD 3BZKA 1CQFA 3I7FA 2WKDA 1N32L 2JA9A 1CT1D 1F2LA 1ENAA 1EOTA 4XTCS 3K57A 4J1MA 1A3UA 4U68A 1X3QA 4IOAA 2QDLA 3K5MA 3PMFA 4GN4B 4JI8L 3S14H 2CKZB 4RGMA 1ML0D 1B53A 3Q8DA 3RNUA 1RL2A 5FLXc 3MA2B 3FP9A 4OX9Q 3DWAA 1RJTA 2A8VA 1I6HH 4JBJA 2R92G 4RAUC 4P2CB
chains in the Genus database with same CATH topology
4DNIA 3K0XA 1I94L 2HHHL 1B8AA 1EUJA 1X9NA 3KOJA 4DV1Q 2BH2A 3HOYG 3KFUA 3I4MH 3NEMA 3T1YQ 4JBKA 4YWMA 1VQLA 2ZJQA 4YY3Q 1SN8A 1UE6A 4LF8L 1HJPA 1GD7A 3H0GG 3PUWA 5FLMH 4JI6Q 4A3LH 2VQEL 1LM0A 2K5VA 5IYCG 4NB3A 4LF9L 3HOXH 1K73C 4BBSH 2GN5A 3G71A 2JA6G 5IYBG 1PH9A 2KHJA 1S40A 4C3JH 1VQ4A 4BA1I 2R7FA 1CKNA 1IXRA 3A5UA 4ALPA 4LW1A 3U4VA 4GLXA 2OTJA 4YCWA 3WWVA 2YTXA 2UUBL 3M4PA 4GKJL 3AEVA 2JK8A 1EIFA 4DV2L 1SFOH 4KLKA 4LWCA 2UXDQ 2VY3A 4DR2Q 3S1MH 4B3SQ 3A74A 3K7AH 4IOCA 1XJVA 1U5KA 4R4OA 4A3CG 3ULLA 3GTPH 1E7ZA 3CPWA 3IRBA 4AH6A 1LTLA 2K75A 4A3JH 1EQRA 4DK3C 2YYZA 3OW2A 2AHOB 4J15A 3RLOA 4JOIA 3KF6A 3GD7A 4JI5L 4OWWB 3S1QH 3HOWG 1AH9A 1Q1BA 4HIKA 4A3FG 2CQOA 2RF4A 3PUXA 1UE5A 4UPAA 1OXXK 2WAQE 1PH8A 1N33Q 4B3RL 1XNQL 3NELA 1XPOA 1D8LA 1KL9A 2IHEA 4YCUA 4B3ML 3S1RH 4A3BG 2VS1A 2YV5A 1L1OC 4JI4L 3MEFA 1BBWA 1PV4A 4OWXB 5M3FG 1L1OA 1YHBA 4AQYL 1HR0Q 2B63G 3CPFA 1K8GA 1E24A 4JI3L 5IP7G 4LUZA 3KJPA 3HKSA 1S72A 5J3BA 4QGUA 1CSQA 3GTJH 4DUYL 2IX0A 3NENA 4DR1L 3M9BA 1YI2A 1IBLL 2BA0A 3GTMH 4BBSG 4LUVA 2KBNA 4GOPA 1K83H 3G4SA 2JA5G 4DPGA 1KC8C 5LMUQ 2HT1A 1WFQA 2R7ZG 2F52A 1IZ6A 1X6OA 2D62A 2AKWB 5FJ8H 3EBEA 1XTDA 3GTQH 2NVYH 2YTYA 3PO2H 4HJ8A 2EIFA 5AJ3L 1YJNA 1AE2A 1A63A 5LMNL 4UY8C 3M7NA 4JV5L 4GNXC 2ZTDA 2K4KA 2Q2IA 2IY5B 4X65Q 5IWAQ 4AYBE 1Y1WH 1VQ6A 3DM3A 3PO2G 2EQSA 1KAWA 3G6EA 2UXCL 2QA4A 3UE1A 3PIPA 5FJ8G 2BA1A 1K3RA 1XPRA 1GO3E 3PUVA 4NXNL 1VQ5A 5K36G 4DAYB 1VQKA 2ES2A 4X64Q 4DR7L 2WAQG 1VQOA 3A5ZB 1Y1VH 2CWAA 3STBD 1K8AC 2ZM6L 1IBKL 3F8TA 4JV5Q 4C3HH 3CXCA 3FHWA 1IL2A 4DV4L 3HOXG 4IFDI 5IYBH 1M90C 1HNXL 2JA7G 2E2IH 1GVPA 3L2PA 2JEAI 1E3PA 4UP9A 1QZGA 5GAEC 4Y7NH 4JI7Q 3EN2A 4A3GH 2UUAL 2Y0SE 4B3TQ 4KHPL 3STBC 4L5TA 4QY7A 1T9HA 2NZOA 5M5XH 5M5YH 2MNAA 3ULPA 4A3JG 1KD1C 4LFCQ 3J80i 1HH2P 3HOZG 3S16H 2JJQA 3CQZH 3CCRA 3S1NH 1TWFH 4AIMA 2VQFL 1E1OA 2AWOA 2K50A 1J5EL 3M4OH 3PV0A 3CC2A 2F4VL 1XMOQ 2E5LL 4LFBQ 2MO1A 2HIVA 2E2HH 2ZJRA 5C44G 3CMAA 1PH4A 3ER0A 5IP9H 4R4TA 1X54A 5GQOA 4PMWA 4IFDG 3RLNA 1QVCA 3HOWH 5IYDH 3TS2A 5M3MG 3I56A 4DV6Q 3GDEA 3J80c 1PH5A 1VS0A 1NMFA 1N33L 4LUOA 4MNOA 4A3GG 4DV5Q 1XNRL 3AYHB 4OO1I 1VQ9A 1NBWA 2OTLA 2N8NA 1CSPA 1BKBA 3W5OA 4PZ7A 3PIOA 3VDYA 3UDFA 5C3EG 1J5EQ 1UE1A 4BBRG 3J7ZC 4YCVA 4DV5L 4DR3L 4LNQA 3RLFA 4LF7Q 3KLWA 1HZBA 2UUAQ 1CKNB 2K14A 2NVQH 2ID0A 4JOIC 3E0EA 4B3SL 1HNWQ 2C35B 1Q8KA 3AQQA 1N36L 3UE0A 3H3VH 3I4MG 3DLLA 1XMOL 4C3IH 2E5LQ 4LFBL 1LUZA 3EIVA 4DV4Q 1EWIA 4X6AH 1U0LA 1J6QA 2ZM6Q 4DV0Q 1MJCA 3RZOH 4AYBG 4WJ3M 1MIUA 4BY1G 4DK6C 4AQYQ 3F2BA 3PO3H 1FJGL 4EQ5A 1HNZQ 2ZTEA 4HJ7A 4NXNQ 5ELOA 2JA8H 1HZCA 4APVA 5JJLA 1OXVA 3I4OA 3UDXA 4DR5L 4LF5Q 2R92H 1YBYA 2ATWA 1IBKQ 3CP0A 3M4QA 2PNHA 2B3GA 4OWTB 2JA5H 1Q12A 4IPGA 4P75A 4DR7Q 2UXBL 3CMEA 2RHSB 2H5XA 3D31A 4A93H 4P74A 1Y1VG 1KXLA 4R4QA 2KCTA 1R9TH 1Q1EA 1I3QH 2QGQA 4DV6L 5FLMG 1PYSB 4X62Q 3JAMc 1FVIA 1PA6A 5C0XI 1G291 3OTOQ 2LSSA 5C0XJ 3KDFA 1HNZL 1KQSA 1FJGQ 3HOYH 2IX1A 1HNXQ 1L2FA 5IWAL 3GTGH 4DV2Q 1LYLA 1MJEA 2F4VQ 3S17H 1W3SA 5JEAJ 4JI2L 2AWNA 3CF5A 1X3EA 2PI2E 5LMNQ 2VW9A 1OXUA 4GNXB 2ALYB 4JI3Q 3TREA 3AFPA 4A3KG 4LFCL 1VQ8A 2DUDA 4O2DA 3JAMi 4JG2A 1Q7YC 4B3TL 4KHPQ 2WP8J 1VQAA 2PQAB 1Z9FA 3CAMA 3OTOL 3J81j 1HNWL 3HKZG 3ZJYC 4A3EG 2CFMA 3TEHB 4BY7G 4X62L 1KHIA 1QUQA 1FL0A 1GKHA 3I4NG 1TWAH 1IYJB 1VQJA 4Y52H 3CCLA 1PH7A 1TXYA 2RCNA 4QJFA 3U50C 2FXQA 3CC7A 2Q2HA 1GM5A 2YTVA 3CCQA 1ASZA 2UXBQ 2JA7H 4X65L 1B7YB 1X65A 1X3FA 4IPDA 2ASBA 2VUMG 4PZ8A 1WCMH 2WB1E 4LF5L 4OX9L 5AJ3Q 5C3EH 4DR5Q 1XPUA 1JE5A 1TWHH 3I55A 1B70B 4HIDA 4HIOA 3H0GH 4B3RQ 4KI0A 1V43A 1PH2A 1VQIA 1EFWA 1CUKA 4RMFA 4BBRH 3KJOA 4A93G 4A3MH 1TWCH 3PGZA 1V1QA 2CCZA 4X66L 3J7A5 4A75A 4JI5Q 2Y0SG 2KENA 1WCMG 1A62A 2AMCB 4DR1Q 1YNXA 3F1ZA 4GN5A 3SGIA 3ULJA 4DV0L 4OXPA 5IP9G 4YWKA 2PI2A 4LFAL 1YHAA 3G48A 1Y14B 4JC0A 3CCJA 4BY1H 1FGUA 2E2JH 5GROA 4KHZA 1HR0L 4A3IH 1N36Q 3W1GA 1O7IA 1N9WA 1PYBA 1S3OA 1K0RA 3KF8B 4JI1Q 4A76A 4JI4Q 1HZAA 2MO0A 4LF7L 5EAYA 3U4ZA 3J81i 4DR3Q 1IBLQ 3MXNB 1A0IA 3CCSA 2NN6G 2R7ZH 1JJ2A 1NY4A 2VNUD 3E9HA 4DUZL 4BXXH 3HOUH 4GOPC 2NVTH 2VUMH 1BVSA 2D0PA 3D0FA 1QZHA 4JBWA 5C4XG 4K0KQ 1XNRQ 3M3YH 5C4JH 4DAMA 4YWLA 5IE8A 3K8AA 2ZJPA 3UDGA 4DR6L 1CKOA 2NVXH 1M1KC 2N3SA 4POFA 3PCOB 4DR2L 3CCVA 4JI8Q 1PH1A 1Q46A 1SROA 4IPHA 3HFZB 3CCUA 2UUCL 4IFDJ 3GTLH 1EOVA 4GKJQ 3L0OA 2Q2TA 2VQFQ 2UU9Q 3TRZA 1PHJA 4QIWE 2R93G 1YJWA 3PF4A 4R1JA 1JB7A 2JQOA 5IYDG 1L1OB 3HOVH 5M5WH 5C4XH 1KRSA 2HQLA 4LF9Q 2GVAA 4JI7L 2OCEA 2ZTCA 4A3FH 1VQ7A 2VQEQ 1PVOA 2R7DA 5GADC 4YHHL 1OTCA 2WB1G 4A4IA 3S24A 1RIPA 4A3EH 1VQCA 1Y1WG 2UUBQ 4P71A 1YHQA 1YJ9A 2Q2UA 1W2BA 2KHIA 5IT9c 1D7QA 3T1HQ 2I5LX 1NE3A 4BY7H 2JEBI 4IPCA 1VQEA 2N49A 1PFSA 3KF6B 3RZDH 1G6PA 5JJIA 4X64L 3CCEA 3HOZH 1SLJA 3K80C 4DV3L 1UEBA 2N78A 3UDIA 4JI0Q 1PH3A 4TVAB 4MTNA 3W1BA 4GNXA 1N32Q 5C0XG 2Z6KC 4JI6L 3TQYA 2UXCQ 3HOVG 5JJKA 5M3FH 4YY3L 4R4CA 1XNQQ 4HJ9A 1Q86C 3F2DA 1G51A 3GTKH 3T1HL 1PH6A 5JEAG 1N34L 3KDFB 4HJ5A 2Z6KA 3B6YA 1VQNA 2OWOA 1DGSA 2I5HA 1I94Q 2HHHQ 1WOCA 4L5QA 1OXTA 1VCIA 4DV7L 3U58A 2KCMA 4ME3A 5IY0A 1YITA 3NBHB 1XMQL 1QVGA 4L5RC 1WYDA 4PZ6A 3CC4A 2A19A 1ASYA 1V9PA 4GKKL 4A3LG 1C9OA 1UE7A 3RR5A 3K81C 2BH8A 2EXDA 2UU9L 2UXDL 1JMCA 5LMUL 1NMGA 5GAGC 3FKIG 4A3DG 4OONA 1IBML 1TWGH 4A3IG 4QQBX 5C44H 1YVCA 3PSIA 4DUYQ 3BJUA 2VL6A 1SR3A 1VQBA 1SE8A 4P73A 4XIGS 5M3MH 3M85A 1NJIC 1N34Q 5BR8Q 3AFQA 3ICEA 2OQ0A 1Q82C 4LF4L 1L0WA 4GOPB 3HOUG 4POGA 1KRTA 1WI5A 1KIXA 1EIYB 1H95A 1X55A 3H15A 4B3MQ 4P72A 4A3KH 1MKHA 2LXJA 4LF8Q 2Z0SA 4C2MH 3FKIH 4A3DH 3T1YL 1OXSC 4NXMQ 4DR4L 1SMXA 2PMZE 3H3VI 1X56A 4OO1G 4IJLA 1NTGA 5IYCH 1Q81C 2K5NA 2XGTA 3BU2A 4DV1L 1YIJA 1UWVA 1IBMQ 1N8RC 2MFIA 1VQGA 2LXKA 3PUZA 4HJAA 1QUQB 1X3GA 2I0QA 1I5FA 2GVBA 3L7ZC 4R4IA 1P8LA 3LGJA 4LF6L 4QL5A 2F3IA 4GN3B 3K7UC 2JA6H 3S15H 4A3BH 3F2CA 1VQPA 4JYAQ 2I5MX 2DGYA 2IT1A 5BR8L 2XTIA 3BZCA 4LFAQ 4LF6Q 3GO5A 1C7YA 4BXXG 2QEXA 1YZ6A 3JC66 1EQQA 1QVFA 3S2DH 2NN6I 1E1TA 5DLQE 5LMNW 3CCMA 2UUCQ 4WJ4A 1VQDA 4X66Q 4MZ9A 4DKAC 2D0OA 1A8VA 2HIXA 2NZHA 4O0AA 2VZAA 3E9IA 2CWPA 4NXML 4L5SA 1WJJA 1HR0W 4PG3A 2IHFA 4GLAC 4A3CH 4UP8A 4DR6Q 1P16A 1XMQQ 2JE6I 3OYYA 3GTOH 5E7NA 3HKZE 4JI0L 1VQMA 4IJHA 2V1CC 4A3MG 1EYGA 3I4NH 3A0JA 1YEZA 4LF4Q 5HGQA 2OQKA 4JCVE 4IO9A 4DUZQ 2WFWA 2L15A 2A1AA 4FDBA 3CW2C 1JJCB 2PQAA 2B29A 3CD6A 2K5HA 4DR4Q 1BBUA 5HY6A 3J81c 3BZKA 5IP7H 3TS0A 3I7FA 4YHHQ 4JI1L 2R93H 4BA2I 2B63H 1N32L 1VQFA 2JA9A 2RHQB 1I50H 1HZ9A 1VQHA 1E22A 5H1SE 2E8GA 1CKMA 4JBMA 4XTCS 2MQHA 4DV7Q 2JA8G 4JI2Q 4IOAA 5ELNA 4GS3A 1JT8A 4GN4B 3S2HH 4EX5A 1K9MC 3PUYA 3PO3G 4RG1A 4JI8L 3S14H 3PF5A 2CKZB 4GLVB 5GAHC 1SRUA 3Q8DA 3RNUA 4GKKQ 2K52A 2R6GA 4NPSA 1RL2A 4TQUS 5FLXc 3RN2A 4JYAL 4UP7A 3RN5A 3KYHC 1AE3A 2YU9H 3FP9A 1C0AA 4H02A 4OX9Q 1Z47A 3ERSX 1I6HH 2A8VA 4DV3Q 4JBJA 2R92G 4K0KL 4HIMA 3I2ZA 1JJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNI A;  3K0X A;  1I94 L;  2HHH L;  1B8A A;  1EUJ A;  1X9N A;  3KOJ A;  4DV1 Q;  2BH2 A;  3HOY G;  3KFU A;  3I4M H;  3NEM A;  3T1Y Q;  4JBK A;  4YWM A;  1VQL A;  2ZJQ A;  4YY3 Q;  1SN8 A;  1UE6 A;  4LF8 L;  1HJP A;  1GD7 A;  3H0G G;  3PUW A;  5FLM H;  4JI6 Q;  4A3L H;  2VQE L;  1LM0 A;  2K5V A;  5IYC G;  4NB3 A;  4LF9 L;  3HOX H;  1K73 C;  4BBS H;  2GN5 A;  3G71 A;  2JA6 G;  5IYB G;  1PH9 A;  2KHJ A;  1S40 A;  4C3J H;  1VQ4 A;  4BA1 I;  2R7F A;  1CKN A;  1IXR A;  3A5U A;  4ALP A;  4LW1 A;  3U4V A;  4GLX A;  2OTJ A;  4YCW A;  3WWV A;  2YTX A;  2UUB L;  3M4P A;  4GKJ L;  3AEV A;  2JK8 A;  1EIF A;  4DV2 L;  1SFO H;  4KLK A;  4LWC A;  2UXD Q;  2VY3 A;  4DR2 Q;  3S1M H;  4B3S Q;  3A74 A;  3K7A H;  4IOC A;  1XJV A;  1U5K A;  4R4O A;  4A3C G;  3ULL A;  3GTP H;  1E7Z A;  3CPW A;  3IRB A;  4AH6 A;  1LTL A;  2K75 A;  4A3J H;  1EQR A;  4DK3 C;  2YYZ A;  3OW2 A;  2AHO B;  4J15 A;  3RLO A;  4JOI A;  3KF6 A;  3GD7 A;  4JI5 L;  4OWW B;  3S1Q H;  3HOW G;  1AH9 A;  1Q1B A;  4HIK A;  4A3F G;  2CQO A;  2RF4 A;  3PUX A;  1UE5 A;  4UPA A;  1OXX K;  2WAQ E;  1PH8 A;  1N33 Q;  4B3R L;  1XNQ L;  3NEL A;  1XPO A;  1D8L A;  1KL9 A;  2IHE A;  4YCU A;  4B3M L;  3S1R H;  4A3B G;  2VS1 A;  2YV5 A;  1L1O C;  4JI4 L;  3MEF A;  1BBW A;  1PV4 A;  4OWX B;  5M3F G;  1L1O A;  1YHB A;  4AQY L;  1HR0 Q;  2B63 G;  3CPF A;  1K8G A;  1E24 A;  4JI3 L;  5IP7 G;  4LUZ A;  3KJP A;  3HKS A;  1S72 A;  5J3B A;  4QGU A;  1CSQ A;  3GTJ H;  4DUY L;  2IX0 A;  3NEN A;  4DR1 L;  3M9B A;  1YI2 A;  1IBL L;  2BA0 A;  3GTM H;  4BBS G;  4LUV A;  2KBN A;  4GOP A;  1K83 H;  3G4S A;  2JA5 G;  4DPG A;  1KC8 C;  5LMU Q;  2HT1 A;  1WFQ A;  2R7Z G;  2F52 A;  1IZ6 A;  1X6O A;  2D62 A;  2AKW B;  5FJ8 H;  3EBE A;  1XTD A;  3GTQ H;  2NVY H;  2YTY A;  3PO2 H;  4HJ8 A;  2EIF A;  5AJ3 L;  1YJN A;  1AE2 A;  1A63 A;  5LMN L;  4UY8 C;  3M7N A;  4JV5 L;  4GNX C;  2ZTD A;  2K4K A;  2Q2I A;  2IY5 B;  4X65 Q;  5IWA Q;  4AYB E;  1Y1W H;  1VQ6 A;  3DM3 A;  3PO2 G;  2EQS A;  1KAW A;  3G6E A;  2UXC L;  2QA4 A;  3UE1 A;  3PIP A;  5FJ8 G;  2BA1 A;  1K3R A;  1XPR A;  1GO3 E;  3PUV A;  4NXN L;  1VQ5 A;  5K36 G;  4DAY B;  1VQK A;  2ES2 A;  4X64 Q;  4DR7 L;  2WAQ G;  1VQO A;  3A5Z B;  1Y1V H;  2CWA A;  3STB D;  1K8A C;  2ZM6 L;  1IBK L;  3F8T A;  4JV5 Q;  4C3H H;  3CXC A;  3FHW A;  1IL2 A;  4DV4 L;  3HOX G;  4IFD I;  5IYB H;  1M90 C;  1HNX L;  2JA7 G;  2E2I H;  1GVP A;  3L2P A;  2JEA I;  1E3P A;  4UP9 A;  1QZG A;  5GAE C;  4Y7N H;  4JI7 Q;  3EN2 A;  4A3G H;  2UUA L;  2Y0S E;  4B3T Q;  4KHP L;  3STB C;  4L5T A;  4QY7 A;  1T9H A;  2NZO A;  5M5X H;  5M5Y H;  2MNA A;  3ULP A;  4A3J G;  1KD1 C;  4LFC Q;  3J80 i;  1HH2 P;  3HOZ G;  3S16 H;  2JJQ A;  3CQZ H;  3CCR A;  3S1N H;  1TWF H;  4AIM A;  2VQF L;  1E1O A;  2AWO A;  2K50 A;  1J5E L;  3M4O H;  3PV0 A;  3CC2 A;  2F4V L;  1XMO Q;  2E5L L;  4LFB Q;  2MO1 A;  2HIV A;  2E2H H;  2ZJR A;  5C44 G;  3CMA A;  1PH4 A;  3ER0 A;  5IP9 H;  4R4T A;  1X54 A;  5GQO A;  4PMW A;  4IFD G;  3RLN A;  1QVC A;  3HOW H;  5IYD H;  3TS2 A;  5M3M G;  3I56 A;  4DV6 Q;  3GDE A;  3J80 c;  1PH5 A;  1VS0 A;  1NMF A;  1N33 L;  4LUO A;  4MNO A;  4A3G G;  4DV5 Q;  1XNR L;  3AYH B;  4OO1 I;  1VQ9 A;  1NBW A;  2OTL A;  2N8N A;  1CSP A;  1BKB A;  3W5O A;  4PZ7 A;  3PIO A;  3VDY A;  3UDF A;  5C3E G;  1J5E Q;  1UE1 A;  4BBR G;  3J7Z C;  4YCV A;  4DV5 L;  4DR3 L;  4LNQ A;  3RLF A;  4LF7 Q;  3KLW A;  1HZB A;  2UUA Q;  1CKN B;  2K14 A;  2NVQ H;  2ID0 A;  4JOI C;  3E0E A;  4B3S L;  1HNW Q;  2C35 B;  1Q8K A;  3AQQ A;  1N36 L;  3UE0 A;  3H3V H;  3I4M G;  3DLL A;  1XMO L;  4C3I H;  2E5L Q;  4LFB L;  1LUZ A;  3EIV A;  4DV4 Q;  1EWI A;  4X6A H;  1U0L A;  1J6Q A;  2ZM6 Q;  4DV0 Q;  1MJC A;  3RZO H;  4AYB G;  4WJ3 M;  1MIU A;  4BY1 G;  4DK6 C;  4AQY Q;  3F2B A;  3PO3 H;  1FJG L;  4EQ5 A;  1HNZ Q;  2ZTE A;  4HJ7 A;  4NXN Q;  5ELO A;  2JA8 H;  1HZC A;  4APV A;  5JJL A;  1OXV A;  3I4O A;  3UDX A;  4DR5 L;  4LF5 Q;  2R92 H;  1YBY A;  2ATW A;  1IBK Q;  3CP0 A;  3M4Q A;  2PNH A;  2B3G A;  4OWT B;  2JA5 H;  1Q12 A;  4IPG A;  4P75 A;  4DR7 Q;  2UXB L;  3CME A;  2RHS B;  2H5X A;  3D31 A;  4A93 H;  4P74 A;  1Y1V G;  1KXL A;  4R4Q A;  2KCT A;  1R9T H;  1Q1E A;  1I3Q H;  2QGQ A;  4DV6 L;  5FLM G;  1PYS B;  4X62 Q;  3JAM c;  1FVI A;  1PA6 A;  5C0X I;  1G29 1;  3OTO Q;  2LSS A;  5C0X J;  3KDF A;  1HNZ L;  1KQS A;  1FJG Q;  3HOY H;  2IX1 A;  1HNX Q;  1L2F A;  5IWA L;  3GTG H;  4DV2 Q;  1LYL A;  1MJE A;  2F4V Q;  3S17 H;  1W3S A;  5JEA J;  4JI2 L;  2AWN A;  3CF5 A;  1X3E A;  2PI2 E;  5LMN Q;  2VW9 A;  1OXU A;  4GNX B;  2ALY B;  4JI3 Q;  3TRE A;  3AFP A;  4A3K G;  4LFC L;  1VQ8 A;  2DUD A;  4O2D A;  3JAM i;  4JG2 A;  1Q7Y C;  4B3T L;  4KHP Q;  2WP8 J;  1VQA A;  2PQA B;  1Z9F A;  3CAM A;  3OTO L;  3J81 j;  1HNW L;  3HKZ G;  3ZJY C;  4A3E G;  2CFM A;  3TEH B;  4BY7 G;  4X62 L;  1KHI A;  1QUQ A;  1FL0 A;  1GKH A;  3I4N G;  1TWA H;  1IYJ B;  1VQJ A;  4Y52 H;  3CCL A;  1PH7 A;  1TXY A;  2RCN A;  4QJF A;  3U50 C;  2FXQ A;  3CC7 A;  2Q2H A;  1GM5 A;  2YTV A;  3CCQ A;  1ASZ A;  2UXB Q;  2JA7 H;  4X65 L;  1B7Y B;  1X65 A;  1X3F A;  4IPD A;  2ASB A;  2VUM G;  4PZ8 A;  1WCM H;  2WB1 E;  4LF5 L;  4OX9 L;  5AJ3 Q;  5C3E H;  4DR5 Q;  1XPU A;  1JE5 A;  1TWH H;  3I55 A;  1B70 B;  4HID A;  4HIO A;  3H0G H;  4B3R Q;  4KI0 A;  1V43 A;  1PH2 A;  1VQI A;  1EFW A;  1CUK A;  4RMF A;  4BBR H;  3KJO A;  4A93 G;  4A3M H;  1TWC H;  3PGZ A;  1V1Q A;  2CCZ A;  4X66 L;  3J7A 5;  4A75 A;  4JI5 Q;  2Y0S G;  2KEN A;  1WCM G;  1A62 A;  2AMC B;  4DR1 Q;  1YNX A;  3F1Z A;  4GN5 A;  3SGI A;  3ULJ A;  4DV0 L;  4OXP A;  5IP9 G;  4YWK A;  2PI2 A;  4LFA L;  1YHA A;  3G48 A;  1Y14 B;  4JC0 A;  3CCJ A;  4BY1 H;  1FGU A;  2E2J H;  5GRO A;  4KHZ A;  1HR0 L;  4A3I H;  1N36 Q;  3W1G A;  1O7I A;  1N9W A;  1PYB A;  1S3O A;  1K0R A;  3KF8 B;  4JI1 Q;  4A76 A;  4JI4 Q;  1HZA A;  2MO0 A;  4LF7 L;  5EAY A;  3U4Z A;  3J81 i;  4DR3 Q;  1IBL Q;  3MXN B;  1A0I A;  3CCS A;  2NN6 G;  2R7Z H;  1JJ2 A;  1NY4 A;  2VNU D;  3E9H A;  4DUZ L;  4BXX H;  3HOU H;  4GOP C;  2NVT H;  2VUM H;  1BVS A;  2D0P A;  3D0F A;  1QZH A;  4JBW A;  5C4X G;  4K0K Q;  1XNR Q;  3M3Y H;  5C4J H;  4DAM A;  4YWL A;  5IE8 A;  3K8A A;  2ZJP A;  3UDG A;  4DR6 L;  1CKO A;  2NVX H;  1M1K C;  2N3S A;  4POF A;  3PCO B;  4DR2 L;  3CCV A;  4JI8 Q;  1PH1 A;  1Q46 A;  1SRO A;  4IPH A;  3HFZ B;  3CCU A;  2UUC L;  4IFD J;  3GTL H;  1EOV A;  4GKJ Q;  3L0O A;  2Q2T A;  2VQF Q;  2UU9 Q;  3TRZ A;  1PHJ A;  4QIW E;  2R93 G;  1YJW A;  3PF4 A;  4R1J A;  1JB7 A;  2JQO A;  5IYD G;  1L1O B;  3HOV H;  5M5W H;  5C4X H;  1KRS A;  2HQL A;  4LF9 Q;  2GVA A;  4JI7 L;  2OCE A;  2ZTC A;  4A3F H;  1VQ7 A;  2VQE Q;  1PVO A;  2R7D A;  5GAD C;  4YHH L;  1OTC A;  2WB1 G;  4A4I A;  3S24 A;  1RIP A;  4A3E H;  1VQC A;  1Y1W G;  2UUB Q;  4P71 A;  1YHQ A;  1YJ9 A;  2Q2U A;  1W2B A;  2KHI A;  5IT9 c;  1D7Q A;  3T1H Q;  2I5L X;  1NE3 A;  4BY7 H;  2JEB I;  4IPC A;  1VQE A;  2N49 A;  1PFS A;  3KF6 B;  3RZD H;  1G6P A;  5JJI A;  4X64 L;  3CCE A;  3HOZ H;  1SLJ A;  3K80 C;  4DV3 L;  1UEB A;  2N78 A;  3UDI A;  4JI0 Q;  1PH3 A;  4TVA B;  4MTN A;  3W1B A;  4GNX A;  1N32 Q;  5C0X G;  2Z6K C;  4JI6 L;  3TQY A;  2UXC Q;  3HOV G;  5JJK A;  5M3F H;  4YY3 L;  4R4C A;  1XNQ Q;  4HJ9 A;  1Q86 C;  3F2D A;  1G51 A;  3GTK H;  3T1H L;  1PH6 A;  5JEA G;  1N34 L;  3KDF B;  4HJ5 A;  2Z6K A;  3B6Y A;  1VQN A;  2OWO A;  1DGS A;  2I5H A;  1I94 Q;  2HHH Q;  1WOC A;  4L5Q A;  1OXT A;  1VCI A;  4DV7 L;  3U58 A;  2KCM A;  4ME3 A;  5IY0 A;  1YIT A;  3NBH B;  1XMQ L;  1QVG A;  4L5R C;  1WYD A;  4PZ6 A;  3CC4 A;  2A19 A;  1ASY A;  1V9P A;  4GKK L;  4A3L G;  1C9O A;  1UE7 A;  3RR5 A;  3K81 C;  2BH8 A;  2EXD A;  2UU9 L;  2UXD L;  1JMC A;  5LMU L;  1NMG A;  5GAG C;  3FKI G;  4A3D G;  4OON A;  1IBM L;  1TWG H;  4A3I G;  4QQB X;  5C44 H;  1YVC A;  3PSI A;  4DUY Q;  3BJU A;  2VL6 A;  1SR3 A;  1VQB A;  1SE8 A;  4P73 A;  4XIG S;  5M3M H;  3M85 A;  1NJI C;  1N34 Q;  5BR8 Q;  3AFQ A;  3ICE A;  2OQ0 A;  1Q82 C;  4LF4 L;  1L0W A;  4GOP B;  3HOU G;  4POG A;  1KRT A;  1WI5 A;  1KIX A;  1EIY B;  1H95 A;  1X55 A;  3H15 A;  4B3M Q;  4P72 A;  4A3K H;  1MKH A;  2LXJ A;  4LF8 Q;  2Z0S A;  4C2M H;  3FKI H;  4A3D H;  3T1Y L;  1OXS C;  4NXM Q;  4DR4 L;  1SMX A;  2PMZ E;  3H3V I;  1X56 A;  4OO1 G;  4IJL A;  1NTG A;  5IYC H;  1Q81 C;  2K5N A;  2XGT A;  3BU2 A;  4DV1 L;  1YIJ A;  1UWV A;  1IBM Q;  1N8R C;  2MFI A;  1VQG A;  2LXK A;  3PUZ A;  4HJA A;  1QUQ B;  1X3G A;  2I0Q A;  1I5F A;  2GVB A;  3L7Z C;  4R4I A;  1P8L A;  3LGJ A;  4LF6 L;  4QL5 A;  2F3I A;  4GN3 B;  3K7U C;  2JA6 H;  3S15 H;  4A3B H;  3F2C A;  1VQP A;  4JYA Q;  2I5M X;  2DGY A;  2IT1 A;  5BR8 L;  2XTI A;  3BZC A;  4LFA Q;  4LF6 Q;  3GO5 A;  1C7Y A;  4BXX G;  2QEX A;  1YZ6 A;  3JC6 6;  1EQQ A;  1QVF A;  3S2D H;  2NN6 I;  1E1T A;  5DLQ E;  5LMN W;  3CCM A;  2UUC Q;  4WJ4 A;  1VQD A;  4X66 Q;  4MZ9 A;  4DKA C;  2D0O A;  1A8V A;  2HIX A;  2NZH A;  4O0A A;  2VZA A;  3E9I A;  2CWP A;  4NXM L;  4L5S A;  1WJJ A;  1HR0 W;  4PG3 A;  2IHF A;  4GLA C;  4A3C H;  4UP8 A;  4DR6 Q;  1P16 A;  1XMQ Q;  2JE6 I;  3OYY A;  3GTO H;  5E7N A;  3HKZ E;  4JI0 L;  1VQM A;  4IJH A;  2V1C C;  4A3M G;  1EYG A;  3I4N H;  3A0J A;  1YEZ A;  4LF4 Q;  5HGQ A;  2OQK A;  4JCV E;  4IO9 A;  4DUZ Q;  2WFW A;  2L15 A;  2A1A A;  4FDB A;  3CW2 C;  1JJC B;  2PQA A;  2B29 A;  3CD6 A;  2K5H A;  4DR4 Q;  1BBU A;  5HY6 A;  3J81 c;  3BZK A;  5IP7 H;  3TS0 A;  3I7F A;  4YHH Q;  4JI1 L;  2R93 H;  4BA2 I;  2B63 H;  1N32 L;  1VQF A;  2JA9 A;  2RHQ B;  1I50 H;  1HZ9 A;  1VQH A;  1E22 A;  5H1S E;  2E8G A;  1CKM A;  4JBM A;  4XTC S;  2MQH A;  4DV7 Q;  2JA8 G;  4JI2 Q;  4IOA A;  5ELN A;  4GS3 A;  1JT8 A;  4GN4 B;  3S2H H;  4EX5 A;  1K9M C;  3PUY A;  3PO3 G;  4RG1 A;  4JI8 L;  3S14 H;  3PF5 A;  2CKZ B;  4GLV B;  5GAH C;  1SRU A;  3Q8D A;  3RNU A;  4GKK Q;  2K52 A;  2R6G A;  4NPS A;  1RL2 A;  4TQU S;  5FLX c;  3RN2 A;  4JYA L;  4UP7 A;  3RN5 A;  3KYH C;  1AE3 A;  2YU9 H;  3FP9 A;  1C0A A;  4H02 A;  4OX9 Q;  1Z47 A;  3ERS X;  1I6H H;  2A8V A;  4DV3 Q;  4JBJ A;  2R92 G;  4K0K L;  4HIM A;  3I2Z A;  1JJG A; 
#chains in the Genus database with same CATH topology
 3AB9 A;  3K0X A;  1JOO A;  4JW0 A;  5G3L D;  1I94 L;  2HHH L;  3KOJ A;  2HDM A;  3ZYY X;  1PTO H;  3NHH A;  5D3I B;  2BH2 A;  5I2X A;  3HOY G;  1M4V A;  4JBK A;  3T1Y Q;  4DU9 A;  5D3D A;  1SN8 A;  1UE6 A;  4LF8 L;  1HJP A;  1GD7 A;  3H0G G;  3PUW A;  2XRQ D;  2F0D A;  3L3O C;  1K73 C;  2EYM A;  2GN5 A;  5IYB G;  5IT9 L;  5EPJ A;  2QKI C;  2R7F A;  2KQ3 A;  1CKN A;  3A5U A;  4GLX A;  2F0M A;  1RF2 D;  5J22 A;  1QNK A;  2WV6 D;  3J81 L;  2VY3 A;  3S1M H;  4B3S Q;  1XJV A;  1T5X D;  1U5K A;  5KNB A;  4FYD A;  3ULL A;  5J1Z A;  3ITP A;  1GHK A;  2A68 D;  1D1K A;  4DK3 C;  5FO9 B;  3R3O A;  1SNQ A;  3MXP A;  4J15 A;  3GD7 A;  2WKC A;  1AH9 A;  1Q1B A;  4A3F G;  1TS5 A;  2CQO A;  2F0E A;  1UE5 A;  1PH8 A;  3P7J A;  5T1G A;  1TII D;  5J39 A;  3NEL A;  2XRS D;  1ROD A;  2L9H A;  1SYC A;  2YV5 A;  2K7V A;  4IUR A;  4FO2 A;  3MEF A;  1HR0 Q;  3Q6S A;  1L1O A;  1YHB A;  2PW7 A;  2IX3 A;  1K8G A;  5I4D A;  1F2M A;  3KJP A;  4DR1 L;  3NEN A;  4BBS G;  3M9B A;  3GTM H;  4GOP A;  2JA5 G;  1O7Z A;  1BF4 A;  1D2B A;  4RA8 A;  1IZ6 A;  2EVB A;  1MSH A;  1B3A A;  2AKW B;  5FJ8 H;  2M9V A;  4PMC A;  3PO2 H;  2R7Z B;  5AJ3 L;  2BCO A;  4UY8 C;  1PZJ D;  2DNC A;  4BWG B;  2IY5 B;  4IUU A;  2EYF A;  3P20 A;  5M3F B;  1VQ6 A;  1SMY C;  4CGY B;  1MD2 D;  1K3R A;  3EA6 A;  3M4O B;  4DAY B;  1VQK A;  1U9R A;  2ES2 A;  1GUT A;  5EGT A;  2VXW A;  1Y1V H;  2ZM6 L;  5KEE A;  1W6K A;  5IYB H;  1HNX L;  5I6Y A;  5IGB A;  2E2I H;  3L2P A;  1QZG A;  4A3G H;  2C5C A;  4Z9C B;  3GV6 A;  4KHP L;  2KVM A;  3STB C;  1A2T A;  1KD1 C;  4LFC Q;  3J80 i;  3S16 H;  5D14 A;  1Q90 A;  2JJQ A;  3CQZ H;  1NR2 A;  1TWA B;  3FRP B;  2B2W C;  3PV0 A;  1TKW B;  4DAP A;  3CC2 A;  2F4V L;  1XMO Q;  4DGZ A;  3QIA A;  3CMA A;  1MBY A;  5IP9 H;  4PMW A;  1PYW D;  1PMR A;  3HZX A;  3J80 c;  1FNU A;  4LUO A;  5C5L A;  4DV5 Q;  5JVG 3;  4OO1 I;  2O5J C;  1ZYR D;  2A74 C;  3H91 A;  2N8N A;  2PCF B;  3W5O A;  1PRT B;  2FJ2 A;  4BBR G;  1SYF A;  1C4Q A;  2J4X A;  4LNQ A;  1KLU D;  4KY5 A;  3RLF A;  3EJI A;  3KLW A;  3VR2 A;  5CMD A;  2ID0 A;  3E0E A;  1A2U A;  3FPP A;  4L8J A;  4DNT B;  4BBS B;  3P75 A;  1LUZ A;  3EIV A;  3KLR A;  4RHR A;  2F0N A;  4DV0 Q;  3KF8 A;  3RZO H;  2K5W A;  3H3V C;  3KBG A;  4KHV A;  4BY1 G;  3PO3 H;  3J7A F;  2R61 A;  4LAA A;  4HJ7 A;  5ELO A;  3C46 A;  2JA8 H;  3MFY A;  4R8N A;  1ESR A;  2V4D A;  3K58 A;  3UDX A;  5IIF A;  5FK9 C;  2EY6 A;  4LF5 Q;  1PZK D;  3TP7 A;  4KMU C;  4DF7 A;  2A6E C;  1SXT A;  4P75 A;  1EY7 A;  1Y1V G;  1R9T H;  1FVI A;  1R4P B;  2K32 A;  2RQX A;  3KDF A;  4DV2 Q;  2B39 A;  1A3T A;  1LYL A;  3S2H B;  2B2U A;  2F4V Q;  1SNP A;  2NWG A;  1QB5 D;  5JEA J;  2AWN A;  2PI2 E;  2VW9 A;  1OXU A;  1QCB D;  3VR5 A;  4EQO A;  4HED A;  3FVQ A;  4LFC L;  1VQ8 A;  2DUD A;  1RD9 D;  1EYD A;  4BY7 B;  1Q7Y C;  4KHP Q;  2PQA B;  4A3M B;  3W3A A;  1EY8 A;  1TY2 A;  2CFM A;  1R4Q B;  1KHI A;  4S3S A;  1TWA H;  4ZK9 B;  1OO9 B;  1EY4 A;  3U50 C;  1GM5 A;  4BBR B;  3PIO 3;  2UXB Q;  4G7Z C;  1EQV A;  3TME A;  4X65 L;  2E2H B;  4JK1 C;  5IGC A;  4IPD A;  3CU7 A;  1WCM H;  4PZ8 A;  1XPU A;  2XSC A;  4CJ1 B;  1EL0 A;  4KI0 A;  1I4P A;  1LTG D;  2CW0 C;  1EFW A;  3KBX A;  1PLF A;  2F1M A;  1MGS A;  1IW7 C;  4A75 A;  3TZU A;  2Y0S G;  5C4Z A;  4JI5 Q;  2KEN A;  1A62 A;  1YNX A;  4DV0 L;  1QE6 A;  3G48 A;  1Y14 B;  2A73 B;  4FF4 A;  4KHZ A;  4IUT A;  1K0R A;  3TDQ A;  3MAQ A;  2JN4 A;  5DM6 3;  1PRT F;  3R2T A;  2R7Z H;  3J7A V;  4ZYS A;  2D0P A;  5JAV A;  5C4X G;  4K0K Q;  3M3Y H;  3LWU A;  4DAM A;  3UDG A;  1CKO A;  4C3J B;  2NVX H;  1M1K C;  1WTP A;  3BZD B;  1ZKO A;  1RCV D;  2KJX A;  1SRO A;  2DJF C;  2UUC L;  4KJO A;  3BYY B;  2RKS A;  2CH4 W;  2Z6B A;  1A15 A;  2R93 G;  4Q0F A;  4R1J A;  1E0B A;  5IYD G;  1JB7 A;  1L1O B;  5M5W H;  1FD7 D;  2J7Z A;  1I4X A;  2XWJ B;  1MHW C;  2VQE Q;  1OTC A;  2WB1 G;  4A4I A;  4A3E H;  4CDE C;  1FYC A;  1F77 A;  5K5P A;  4P71 A;  4FXG C;  1B2T A;  1HA6 A;  2KHI A;  1D7Q A;  1WTQ A;  4BY7 H;  2JEB I;  3VR3 A;  1VQE A;  1PFS A;  4RCO A;  5JJI A;  1WTW A;  1SLJ A;  3DUZ A;  4EQP A;  3UDI A;  4DV3 L;  3HOZ H;  1PRT C;  4TVA B;  3W1B A;  4JI6 L;  1UEA B;  5JJK A;  3HOV G;  4R4C A;  1WTR A;  3T1H L;  1X32 A;  1BR9 A;  3BVZ A;  5JEA G;  1PH6 A;  3MXN A;  2MP1 A;  2I5H A;  1I94 Q;  2HHH Q;  2IL8 A;  2E74 C;  1D5Z C;  1H9M A;  2E76 C;  1VCI A;  3U58 A;  1SE2 A;  1SSO A;  5ELD A;  2F3W A;  1QVG A;  1XYI A;  4G4K A;  2RSN A;  4PQX A;  4GKK L;  1HUM A;  1O7Y A;  2QCP X;  2EJM A;  2UXD L;  3KLS X;  1CI3 M;  4A3D G;  1I4G A;  3GTQ B;  1Y1W B;  1RTN A;  3D6W A;  4QQB X;  4DUY Q;  3PSI A;  1SR3 A;  5BR8 Q;  1BCP D;  3FDT A;  1HPC A;  1WI5 A;  3NBH A;  1KIX A;  2ICE C;  5C4H A;  4A3K H;  2LXJ A;  2XIW A;  4DR4 L;  1B9M A;  1LLR D;  1SYD A;  1Q81 C;  3BU2 A;  4EQN A;  1UWV A;  1QWY A;  2MFI A;  3PUZ A;  1WTX A;  1I5F A;  2GVB A;  1T5E A;  5CV6 A;  5I9P A;  4QL5 A;  2F3I A;  3S15 H;  4A93 B;  1NSN S;  1HA5 A;  5KND A;  3K7A B;  5BR8 L;  2XTI A;  3BZC A;  3H0G B;  3IKJ A;  5A35 A;  1EQQ A;  3I4L A;  1QVF A;  3S2D H;  2NN6 I;  4NDX A;  2UUC Q;  1VQD A;  4X66 Q;  4DKA C;  1TR5 A;  1SYB A;  4RCN A;  1A8V A;  1CK1 A;  2HIX A;  2RBM A;  1SAP A;  1SNC A;  3H6M A;  1XXG A;  2K01 A;  3TN2 A;  3GTO H;  4JI0 L;  3HKZ B;  2V1C C;  5KNC A;  3HOW B;  4LF4 Q;  5HGQ A;  4KN7 C;  2WFW A;  2A1A A;  1CA6 A;  2SEB D;  1BBU A;  4JPB W;  5IP7 H;  4YHH Q;  1SFO B;  2R93 H;  2B63 H;  5ELB A;  5M5X B;  1B4O A;  1I50 H;  1AN8 A;  3K59 A;  3C3L A;  5H1S E;  1CKM A;  4FNF A;  4JBM A;  4C1N K;  1C48 A;  1F2Z A;  5D65 A;  3IFD A;  2JA8 G;  1IW7 D;  2F4I A;  2B2T C;  4KV6 A;  5ELN A;  5CGK A;  1JT8 A;  2LKV A;  3S2H H;  4ULL A;  4EX5 A;  1K9M C;  3PO3 G;  1K8M A;  1SRU A;  1WD0 A;  4NPS A;  4DK1 A;  4JYA L;  4UP7 A;  3KYH C;  2QW7 A;  2NVT B;  4HIM A;  2B2V A;  1G6Z A;  3SR1 A;  4DNI A;  3Q24 A;  1Y8P B;  3M3Y B;  1B8A A;  1CA5 A;  3KLS A;  3NXW A;  1PZI D;  2EYH A;  5EBC A;  2EYJ A;  1VQL A;  2FFK B;  4NKL A;  1LT3 D;  3NWT A;  4F87 A;  5FLM H;  1UNS A;  3RZD B;  2VQE L;  2K5V A;  5IYC G;  2XNA C;  2MPM A;  3G71 A;  4C1N I;  2M2L A;  3O13 A;  3SXH A;  3NBI A;  1PH9 A;  1VQ4 A;  2A68 C;  2OTJ A;  1IXR A;  4LW1 A;  2YTX A;  3M4P A;  3E3X A;  2JK8 A;  4I65 A;  4DV2 L;  1SFO H;  5BN4 A;  4LWC A;  2RCF A;  3A74 A;  3K7A H;  4R4O A;  3GTP H;  4DK0 A;  5F2D A;  3IRB A;  4AH6 A;  3OIP A;  1EQR A;  2YYZ A;  2AHO B;  2B2V C;  1XWE A;  1G8Z D;  3OIQ A;  4JI5 L;  3S1Q H;  1WD1 A;  3S14 B;  4C3I G;  2EYL A;  3HOW G;  3MVV A;  4K2L A;  4A3J B;  4TSS A;  1XPO A;  4IUQ A;  2IHE A;  3ND9 A;  3TSS A;  3GTL B;  2EY5 A;  2K03 A;  4OWX B;  1JC7 A;  4LUZ A;  1S72 A;  1Y8O B;  4TRD A;  1YI2 A;  2BE5 C;  5CC4 A;  4LUV A;  2KBN A;  3G4S A;  1KC8 C;  2NBF A;  2WAQ B;  2WAC A;  3T53 B;  3D3R A;  1EY6 A;  1DON A;  4XQN A;  2D62 A;  2YTY A;  2SNM A;  1YJN A;  3CKI B;  1EIG A;  2OXP A;  2Q2I A;  3HOZ B;  2QIL A;  1KAW A;  2UXC L;  3PIP A;  4K8I A;  1XPR A;  4NXN L;  5K36 G;  2MJ8 A;  3OWF A;  1JCK B;  4X64 Q;  2WAQ G;  4M1U B;  4C2M B;  4JV5 Q;  4A3D B;  4FVM A;  4C3H H;  4C56 C;  1IL2 A;  4DV4 L;  1TU2 B;  2ZT9 C;  4CJ2 C;  2EXZ A;  3LWE A;  1LT5 D;  1BOS A;  4UP9 A;  3QOJ A;  1EY9 A;  5EPK A;  5GAE C;  5AFW A;  2UUA L;  2Y0S E;  4KKT A;  2F03 A;  2MNA A;  1HHV A;  5CBE E;  3ULP A;  4A3J G;  4NP5 A;  5CV7 A;  1HH2 P;  2OEO A;  4WRD A;  3BDO A;  3CCR A;  1VMP A;  3G7L A;  1E1O A;  2K50 A;  1H9S A;  4K14 A;  2VQF L;  3M4O H;  1ZYR C;  1U4L A;  2MO1 A;  2E2H H;  5C44 G;  5COR A;  1SMY D;  1B9N A;  4RGN A;  3HOW H;  5IYD H;  1DOM A;  3PO2 B;  3IFT A;  3FPU B;  4MNO A;  3EQL C;  4A3G G;  1XNR L;  1CSP A;  1J5E Q;  2B63 B;  1U4M A;  4F8M A;  2F3V A;  2WB1 B;  4CKB A;  3J7Z C;  1LTR D;  1JWM D;  4ODG A;  4QB4 A;  4H0L C;  1HNW Q;  1Q8K A;  3TP8 A;  2KA7 A;  2E5L Q;  4LFB L;  1U0L A;  2J0T D;  1G91 A;  1STH A;  4AQY Q;  1H9R A;  4O1N A;  4NXN Q;  2WIN B;  1IYV A;  1HZC A;  4APV A;  5L37 A;  2NN6 H;  4DR5 L;  1TS2 A;  4N8X 1;  2A5H A;  1II3 A;  4JVZ A;  1IBK Q;  3CP0 A;  4QMG A;  4XYQ A;  3PO3 B;  4OWT B;  1IYU A;  2M00 A;  1Q12 A;  3OWE B;  2JA5 H;  2Z8L A;  1SYG A;  2KCT A;  1Q1E A;  1I3Q H;  4DV6 L;  1PYS B;  1H9J A;  3JAM c;  5C0X I;  1G29 1;  2EY2 A;  3OTO Q;  2LSS A;  4X3S A;  5IWA L;  1G2S A;  2BDO A;  2FMM A;  4V0B A;  4C3H B;  4KKU A;  2SOB A;  1X3E A;  2ALY B;  4A3K G;  1FGB D;  1LTA D;  3JAM i;  3HG9 A;  2EZV A;  3SVM A;  1F9R A;  4XXE A;  3CAM A;  3OTO L;  3J81 j;  3HKZ G;  4HSP A;  2XN9 C;  4X62 L;  2H1E A;  1GKH A;  4IN3 A;  4XDX A;  1CHP D;  3X3N A;  1PH7 A;  1TXY A;  4UDU C;  2FXQ A;  3CC7 A;  2Q2H A;  1ENC A;  2YTV A;  4MIU A;  5EBD A;  1W6J A;  4OX9 L;  3F2U A;  5AJ3 Q;  5ELC A;  3V2T A;  1JE5 A;  4IZ8 A;  1TWH H;  3I4M B;  1QG7 A;  1I4H A;  4B3R Q;  1IKM A;  3FEW X;  4A93 G;  1CUK A;  4RMF A;  3VA5 A;  3KJO A;  1TWC H;  4HR7 B;  3F1Z A;  4GN5 A;  3SHL A;  5C3E B;  1NUC A;  4YWK A;  2PI2 A;  1R9T B;  5LHY 1;  1S5C D;  4V19 0;  4A3I H;  1KDA A;  3KF8 B;  1PTO D;  4A76 A;  1FR3 A;  4JI4 Q;  4JI1 Q;  1DCZ A;  5CV9 A;  3U9S A;  5JVH 3;  2MO0 A;  1EY0 A;  3R93 A;  4LF7 L;  2Q8R E;  3J81 i;  2VB2 X;  4DR3 Q;  3MXN B;  3E0J A;  1A0I A;  2HCI A;  4CHT B;  3ERQ A;  2L1B A;  3S16 B;  5BN3 A;  1NY4 A;  4BXX H;  3HOU H;  2RDF A;  1F2Y A;  5CV4 A;  3OMC A;  3SK5 A;  5IE8 A;  3K8A A;  1YNN C;  3PIP 3;  1D1I A;  2ZJP A;  1STA A;  1M8A A;  4PV1 C;  4POF A;  1LTB D;  3CCV A;  5KRU A;  1PXU A;  5EKI A;  3HFZ B;  3HOX B;  3GTL H;  1EOV A;  4GKJ Q;  1PFM A;  4QIW E;  1JR0 D;  3GP7 A;  2PQE A;  5C0X H;  1BXT A;  2YU9 B;  5C4X H;  4LF9 Q;  2RDG A;  1H9S B;  3VYR A;  2E2I B;  5GAD C;  4YHH L;  1K28 A;  1KTK A;  2UUB Q;  1YJ9 A;  2Q2U A;  1X3P A;  5IT9 c;  3T1H Q;  2I5L X;  4IPC A;  2N49 A;  3AMU A;  2AQ1 B;  3CCE A;  2MUY A;  3K80 C;  5JPM C;  1ESF A;  4MTN A;  1S4Z A;  5I6W A;  4XQQ A;  1FNW A;  4YY3 L;  4RFB A;  3GTK H;  3F2D A;  1LTI D;  3GTJ B;  2Z6K A;  3S1R B;  4L63 B;  2OWO A;  1DGS A;  3UI2 A;  1SDF A;  1OXT A;  1SJH D;  4ME3 A;  5C3X A;  4ZRZ A;  2F0S A;  3D6C A;  1V9P A;  1C9O A;  4HCS A;  3V05 A;  3K81 C;  2BH8 A;  2E2D C;  3CHB D;  5JEA H;  5LMU L;  5GAG C;  5CBA E;  4CDC C;  5CV5 A;  5C44 H;  3E5S A;  2VL6 A;  1N34 Q;  2WII B;  5M3M H;  3AFQ A;  3ICE A;  4GZY C;  3TBI B;  1L0W A;  4GOP B;  3HOU G;  1H95 A;  3ERO A;  4B3M Q;  3DHQ A;  2PO4 A;  2Z0S A;  2CW0 D;  2X6G A;  3MHB A;  3FKI H;  4NXM Q;  2Z1C A;  1D5X C;  4OO1 G;  1QIL A;  4UAI A;  4IJL A;  1WTH A;  3D4R A;  1Y69 U;  2XGT A;  4RH6 A;  1N8R C;  4KD3 A;  1VQG A;  2LXK A;  4ZCK A;  1FNV A;  3ND8 A;  2BDN A;  2HUG A;  2I0Q A;  4R4I A;  3L7Z C;  3GV3 A;  1P8L A;  1TWG B;  3NTK A;  3K7U C;  3F2C A;  1VF7 A;  2I5M X;  2IT1 A;  4XQJ A;  4BXX G;  1E1T A;  4A3K B;  4WJ4 A;  2D0O A;  3EFX D;  2NZH A;  3I73 A;  3S1Q B;  2VZA A;  3E9I A;  2CWP A;  4NXM L;  1HR0 W;  4R9W A;  4PG3 A;  5CYU A;  4DR6 Q;  1XMQ Q;  3K0Y A;  3OYY A;  4I7Z C;  3HKZ E;  5LL6 X;  2NB0 A;  2PPB C;  2FIN B;  2DY7 A;  4LMQ D;  4A3M G;  1EYG A;  2F0Q A;  1V8Q A;  4JCV E;  4K2K A;  1CTM A;  3CW2 C;  1EYC A;  1JJC B;  2PQA A;  4IQZ A;  1TWH B;  2EE1 A;  1S5E D;  4DR4 Q;  4XT1 B;  4HAE A;  3J81 c;  2LFN A;  2ZXO A;  1I6H B;  4JI1 L;  4BA2 I;  1VQF A;  3S9W A;  1HXY D;  2RHQ B;  2KED A;  1JQY D;  2RDH A;  2E8G A;  5IGF A;  4QCL A;  2MQH A;  4JI2 Q;  2FMC A;  1K3B C;  4K6D A;  4G7O C;  3VR6 A;  1GUO A;  4RG1 A;  4GLV B;  5GAH C;  2PMZ B;  4GKK Q;  5EJW A;  2ZXR A;  2JXM B;  5KGU A;  3RN2 A;  1AE3 A;  2K04 A;  4H02 A;  1EYA A;  3IL8 A;  2B2U C;  3ERS X;  1SJE D;  4K0K L;  3I2Z A;  3S24 A;  4XYO A;  1JJG A;  1I50 B;  2EYO A;  1D5M C;  2R92 B;  3I4M H;  3NEM A;  2IJ0 A;  4KK7 A;  3CRK C;  4JI6 Q;  2D5D A;  1O78 A;  3KUP A;  4OIK A;  4LF9 L;  1JWS D;  4BBS H;  1NNX A;  3S17 B;  2JA6 G;  5T1I A;  2KHJ A;  4C3J H;  4BA1 I;  4CKE A;  4ALP A;  3U4V A;  1XX8 A;  4YCW A;  3WWV A;  2KEE A;  4GKJ L;  3A56 A;  1U4R A;  4DR2 Q;  2R3Z A;  4EVO A;  1HQR D;  3OHX C;  4A3C G;  3CPW A;  2L4N A;  5I9O A;  2E2J B;  2KEC A;  1LTL A;  2K75 A;  2F0I A;  4IFD H;  4B08 A;  1ENF A;  4RKB A;  1SNO A;  3RLO A;  4JOI A;  3SDZ A;  3QO2 A;  1WTV A;  3DWQ A;  3PUX A;  4UPA A;  1N33 Q;  2WAQ E;  4B3R L;  3GTM B;  1KL9 A;  3S1R H;  4JI4 L;  1L1O C;  2A69 D;  1STE A;  5LL6 S;  1PV4 A;  1AFP A;  4ZKB B;  3SK4 A;  4AQY L;  1AZQ A;  3CPF A;  4F7X A;  2HD3 A;  1AZP A;  3GTJ H;  1CSQ A;  1WVL A;  4DUY L;  2IX0 A;  1TWF B;  3NP8 A;  4DPG A;  4ZKC B;  1WFQ A;  2DNE A;  2F52 A;  5K36 H;  1X6O A;  3GTQ H;  3EBE A;  4OHJ A;  2OT2 A;  2NVY H;  4DFA A;  3VA7 A;  4HJ8 A;  2EIF A;  5CV8 A;  1PTO F;  2EJG C;  1AE2 A;  1A63 A;  5LMN L;  5TSS A;  4HMJ A;  2ZTD A;  2K4K A;  5ELE A;  2K05 A;  5IWA Q;  2C9O A;  1JIC A;  1Y1W H;  3M7G A;  2E75 C;  2K5Q A;  5DEH A;  5M3M B;  3J81 E;  3UE1 A;  1EEI D;  1KNE A;  1RKN A;  3PUV A;  3NSW A;  4G7H C;  3BVG A;  1BQQ T;  5IGD A;  4ZUI A;  4DR7 L;  1VQO A;  3QG1 A;  1TVX A;  2CWA A;  1IBK L;  3S15 B;  3F8T A;  3CXC A;  3FHW A;  3S1N B;  1DXM A;  2JEA I;  2JA7 G;  1GVP A;  1BUV T;  1E3P A;  4Y7N H;  4RKL A;  4B3T Q;  1T9H A;  2NZO A;  2VUM G;  1HCZ A;  4K5W A;  4U67 3;  4A3F B;  2ENB A;  3ONA B;  1B3Q A;  3BDL A;  2E5L L;  4LFB Q;  1PRT D;  5IOC A;  3MTS A;  3JAM L;  2F0J A;  5GQO A;  4IFD G;  3PQI A;  3HS0 C;  1QVC A;  2CH4 A;  5M3M G;  1V1O A;  3I56 A;  3GDE A;  1PH5 A;  1VS0 A;  1NMF A;  1N33 L;  3AYH B;  4RGO S;  3Q0A A;  5A2Q E;  1KDB A;  1GOZ A;  1BO0 A;  1EZ8 A;  4PZ7 A;  3PIO A;  1UE1 A;  1WTO A;  4FF2 A;  1STG A;  2RVL A;  4OEL B;  3SE0 A;  1HZB A;  2K5D A;  1KAA A;  4JOI C;  2NVQ H;  4B3S L;  2C35 B;  3UE0 A;  3DLL A;  3D4W A;  3C2P A;  1IKL A;  1EWI A;  2MGS A;  4X6A H;  2ZM6 Q;  3DMU A;  2JSO A;  3K5O A;  4AYB G;  2BE5 D;  4DK6 C;  3F2B A;  2IW3 A;  2A6H D;  4DXG A;  4Y7N B;  3KK7 A;  5BN5 A;  4N9T A;  4KJN A;  1VDZ A;  5JJL A;  4K8J A;  1DM0 B;  1OXV A;  3I4O A;  1YBY A;  1E2W A;  4MTK A;  5E3F A;  1JE4 A;  3M4Q A;  5HGT A;  1EQT A;  5ISR A;  3GTG B;  2B8F A;  2F0F A;  2UXB L;  3CME A;  2RHS B;  2JA6 B;  2H5X A;  4P74 A;  2G9H D;  2I46 A;  2OF1 A;  1F9S A;  3H94 A;  4R4Q A;  1TQO A;  1PA6 A;  3DEO A;  5FLM G;  5IT9 E;  1CZG A;  1HNZ L;  3J7Y W;  1KQS A;  1FJG Q;  5KYL A;  1L2F A;  4ABN A;  1MJE A;  1W3S A;  1WCM B;  4JI2 L;  1QJO A;  2AUK A;  5FO7 B;  3TRE A;  3C1E A;  1TT2 A;  4KKS A;  3C1F A;  2L11 A;  4B3T L;  2WP8 J;  3URY A;  1HNW L;  4KY7 A;  4A3E G;  1H9K A;  4BY7 G;  4IUV A;  3I4N G;  1VQJ A;  5DM7 3;  3CCL A;  1JOQ A;  1G2T A;  2RCN A;  4QJF A;  1ASZ A;  3CCQ A;  2JA7 H;  4AYB B;  5E4W C;  1B7Y B;  2K33 A;  1X3F A;  1BBX C;  2ASB A;  1GXD C;  4LF5 L;  4H7B A;  3I55 A;  1S5F D;  1JOR A;  4BBR H;  1QOH A;  3PGZ A;  4A3M H;  1MSG A;  1V1Q A;  5I2Y A;  4H13 C;  4DN4 M;  2K6A A;  3HRZ C;  4ZUJ A;  2AMC B;  3SGI A;  3ULJ A;  1STY A;  4LFA L;  4JC0 A;  3CCJ A;  4BY1 H;  3EVQ A;  5GRO A;  2E2J H;  2FHT A;  2VUM B;  3MFG A;  3MC0 B;  4QUF A;  1O7I A;  1N9W A;  1PYB A;  1STB A;  3H09 A;  3K5L A;  1I4Q A;  5EAY A;  2O5I C;  1Q3L A;  2HDL A;  3U4Z A;  1D6E C;  2Q8I B;  3CCS A;  2NVY B;  2EDG A;  2VNU D;  4A3I B;  1BVS A;  3D0F A;  3T13 A;  4OGQ C;  2L55 A;  5C4J H;  4WJW A;  1KDC A;  3I72 A;  4LJZ C;  2HCC A;  4LK1 C;  3PCO B;  1AEX A;  1PH1 A;  4JI8 Q;  2JA7 B;  1Q46 A;  4IFD J;  1ET6 A;  3MWY W;  4O42 A;  2UU9 Q;  3TRZ A;  1PHJ A;  3DXJ C;  1YJW A;  3PF4 A;  2B2W A;  2JQO A;  2N55 A;  3NTI A;  3HOU B;  1KRS A;  3A54 A;  1F9P A;  2GVA A;  2ZTC A;  2OCE A;  4B9W A;  4A3F H;  2SDF A;  1PVO A;  2R7D A;  4R8I A;  2B2T A;  5G3L F;  1RIP A;  1VQC A;  1NAP A;  5DNF A;  5KYI A;  3NK9 A;  3D4D A;  1W2B A;  4FXD A;  1NE3 A;  2F0K A;  3JAM E;  3KF6 B;  3OW7 A;  3RZD H;  3RZO B;  1G6P A;  3NQI A;  2N78 A;  1HTP A;  4IAL A;  5C0X G;  1VMC A;  1EZ6 A;  3TQY A;  4MN3 A;  1XNQ Q;  1PFB A;  2L0C A;  1Q86 C;  5JOB A;  1G51 A;  3Q23 A;  4I7A A;  5C4X B;  3KDF B;  1YNN D;  1V1P B;  1CZW A;  3FMC A;  4DV7 L;  4BS9 A;  4CDF C;  3GTP B;  3NBH B;  5M5Y B;  5FO8 B;  1K8O A;  3T4A C;  3QOL A;  2DY8 A;  1I3Q B;  2EXD A;  1NMG A;  3QR8 A;  3FKI G;  4OON A;  1YVC A;  3BJU A;  1SE3 A;  1SE8 A;  2QEJ C;  4XIG S;  1NJI C;  3M85 A;  1GJX A;  1EU4 A;  2OQ0 A;  1Q82 C;  4LF4 L;  1KRT A;  2EYP A;  4RGT A;  1NR4 A;  1X55 A;  3H15 A;  1MKH A;  3J80 L;  2JA5 B;  2F0T A;  3BYT B;  1SMX A;  1X56 A;  5IYC H;  3V96 A;  3L9A X;  4DV1 L;  3OSO A;  4WFN 3;  1AW7 A;  1YIJ A;  1Z6H A;  1IBM Q;  4HJA A;  2H4O A;  1BCP B;  5C4J B;  4LF6 L;  3DM1 A;  4A3B H;  1ONL A;  4GN3 B;  3DWP A;  1EFI D;  1VQP A;  4JYA Q;  3E6Z X;  3P1H A;  4HN7 A;  1O7L A;  2PW5 A;  4ZQ3 A;  4LF6 Q;  3GO5 A;  1IL8 A;  2QEX A;  3JC6 6;  2G5D A;  5DLQ E;  1BDO A;  3CCM A;  1J8I A;  4MZ9 A;  4O0A A;  3WOF A;  4L6T B;  2XWB B;  4L5S A;  1LO5 D;  2PZT A;  2F0V A;  1P16 A;  2JE6 I;  2F0W A;  5E7N A;  1VQM A;  4IJH A;  4X3T A;  3A0J A;  1YEZ A;  1Y1V B;  2OQK A;  4IO9 A;  4FXK C;  4KY6 A;  4KD4 A;  2CQA A;  3U9O A;  4FDB A;  3RD4 A;  2PYK A;  2B29 A;  2K5H A;  1S5D D;  3BG3 A;  5HY6 A;  3BS1 A;  1LV9 A;  3TS0 A;  3GTO B;  4CBV A;  2LMC B;  1HZ9 A;  1VQH A;  1C8C A;  4XT3 B;  1E22 A;  1BCP C;  5DAU A;  4DV7 Q;  4BY1 B;  4GS3 A;  3PUY A;  2K1B A;  2XVS A;  3PF5 A;  2NTS A;  1PFN A;  2K52 A;  2R6G A;  4TQU S;  3RN5 A;  2YU9 H;  1C0A A;  1Z47 A;  4DV3 Q;  1EY5 A;  2B8G A;  1LTS D;  1B44 D;  1EUJ A;  3S1M B;  1X9N A;  4ZAI A;  4DV1 Q;  3VYT A;  4EGV A;  1DZ1 A;  2B2Y A;  3KFU A;  4YWM A;  2ZJQ A;  4YY3 Q;  1RHP A;  5EQ0 A;  3RMH A;  3NQT A;  4QUC A;  1O80 A;  4A3L H;  3MXU A;  3A7A B;  3NTH A;  1LM0 A;  4KTA A;  4NB3 A;  3HOX H;  2VB3 X;  1ZXT A;  2SNS A;  1S40 A;  3MZ5 A;  3NPP A;  2UUB L;  5IOD A;  1JB3 A;  3AEV A;  1EIF A;  1RDP D;  4KLK A;  4FP5 D;  2UXD Q;  5CR3 A;  2ICI A;  3SEB A;  4IOC A;  1E7Z A;  1A3V A;  1TS3 A;  4OEM B;  4A3J H;  4F88 A;  1ICF B;  3OW2 A;  4HTH A;  3WOE A;  3K5N A;  1JWU D;  3KF6 A;  4OWW B;  3I70 A;  4OIJ A;  4DAY A;  4HIK A;  1I6V C;  2F0L A;  3VYS A;  2RF4 A;  1OXX K;  3NUC A;  3MXG A;  2A6H C;  1XNQ L;  4H44 C;  1D8L A;  4YCU A;  4B3M L;  4A3B G;  2VS1 A;  3I8Z A;  1SNM A;  1BBW A;  1E2V A;  1LT4 D;  5M3F G;  2B63 G;  1SBB B;  1E24 A;  5E1F A;  4JI3 L;  5IP7 G;  2DN8 A;  3HKS A;  5J3B A;  4QGU A;  3CQZ B;  5M9O A;  2KCN A;  1TY0 A;  1HQM C;  4PNY A;  2BA0 A;  1IBL L;  2HT1 A;  1K83 H;  3QJY A;  5LMU Q;  4OO1 H;  1Z7T A;  3R8B A;  2R7Z G;  2L12 A;  1XTD A;  5C44 B;  2GA4 B;  2P5Z X;  3M7N A;  5ELF A;  4JV5 L;  4GNX C;  1ET9 A;  1KNA A;  4MHE A;  4X65 Q;  2LY7 A;  4AYB E;  4A3G B;  4QIW B;  1CM9 A;  1RTO A;  3GQB A;  3DM3 A;  3PO2 G;  2EQS A;  3G6E A;  2QA4 A;  5FJ8 G;  2BA1 A;  4N8F A;  1GO3 E;  1VQ5 A;  2KCC A;  4DXF A;  3HGB A;  1UUP A;  3VYU A;  4B9X A;  2F0H A;  1PDQ A;  1PTO B;  2JP1 A;  2JYO A;  3A5Z B;  4OL7 A;  3STB D;  1GUG A;  3FKI B;  1K8A C;  1DD2 A;  2AQ2 B;  3HOX G;  1DOK A;  3R2I A;  4IFD I;  2QDB A;  1M90 C;  1LTT D;  4JI7 Q;  3EN2 A;  4A3B B;  4RWS C;  3TP6 A;  4L5T A;  4QY7 A;  5M5X H;  5M5Y H;  2MHV A;  5KIX A;  3HOZ G;  5FKA C;  1CFM A;  1IHZ A;  3S1N H;  1TWF H;  4AIM A;  2AWO A;  1J5E L;  1UAP A;  1J9O A;  4ME5 A;  2HIV A;  2ZJR A;  1PH4 A;  3ER0 A;  1U4P A;  1X54 A;  4R4T A;  3RLN A;  1MI2 A;  2Z9H A;  2NVX B;  3TS2 A;  1ICW A;  4DV6 Q;  3MEH A;  5C3W A;  2QF7 A;  4FF3 A;  1ILQ A;  3BDC A;  1VQ9 A;  1NBW A;  2OTL A;  3HOY B;  1SE4 A;  1BKB A;  1TS4 A;  2ZXP A;  3VDY A;  4N9P A;  4NMZ A;  3UDF A;  5C3E G;  1STN A;  2A6E D;  4PMB A;  4DV5 L;  4YCV A;  3SK6 A;  4DR3 L;  4LF7 Q;  1EIH A;  2K28 A;  2UUA Q;  1CKN B;  2K14 A;  3W2D A;  2AUJ D;  1HTL D;  3AQQ A;  1N36 L;  4IUN A;  3H3V H;  3I4M G;  3J80 E;  4HSV A;  1XMO L;  4C3I H;  2RSO A;  4DV4 Q;  3M4Y A;  3TP5 A;  4YIJ A;  4KN4 C;  1J6Q A;  1E2Z A;  1MJC A;  1ILP A;  4WJ3 M;  1MIU A;  4J8Q A;  4CKC A;  1FJG L;  4EQ5 A;  1HNZ Q;  2ZTE A;  3TZD A;  5FLX L;  3GTK B;  1QNU A;  2A69 C;  2R92 H;  2X69 A;  1GHJ A;  2ATW A;  1KLG D;  2PNH A;  4M8A A;  2B3G A;  2TMP A;  4IPG A;  5IGE A;  1PTO C;  4DR7 Q;  1YNJ C;  4C3H G;  3A8I E;  3D31 A;  4A93 H;  1KXL A;  2PZW A;  2QGQ A;  3I90 A;  2KHS A;  3A8K E;  4X62 Q;  2O4X A;  5C0X J;  3HOY H;  4E6I A;  1HNX Q;  2IX1 A;  3GTG H;  5JPN C;  3S17 H;  3CF5 A;  5LMN Q;  4GNX B;  4JI3 Q;  1KAB A;  3AFP A;  5COY A;  4G57 A;  4O2D A;  4JG2 A;  1DJR D;  3Q22 A;  2NVQ B;  1VQA A;  3A7L A;  2N88 A;  1Z9F A;  3ZJY C;  3TEH B;  1QUQ A;  1FL0 A;  2EPB A;  1Q8I A;  2NZ1 D;  3K6O A;  1IYJ B;  1BNZ A;  4Y52 H;  1DOL A;  1VQN A;  1HUN A;  4K6L A;  1I4R A;  1TWC B;  1VF5 C;  3OOC A;  4QF4 A;  1X65 A;  5E4X A;  1GUS A;  3I4N B;  2EJF C;  2LS0 1;  2F0U A;  2CVR A;  2WB1 E;  4HMI A;  2DJG C;  5C3E H;  2Q8T A;  4DR5 Q;  1B70 B;  4HID A;  4HIO A;  1DYQ A;  3H0G H;  3X3M A;  1PH2 A;  1V43 A;  1VQI A;  2F0G A;  5M5W B;  1LAC A;  3HEJ A;  1HFN A;  1GUW A;  3QB3 A;  2CCZ A;  1K83 B;  4X66 L;  3J7A 5;  4ID6 A;  1K0S A;  1WCM G;  3AU7 A;  4DR1 Q;  4OXP A;  4CDD C;  2Z4I A;  5IP9 G;  2NTT A;  1YHA A;  3NE5 B;  1FGU A;  3I91 A;  1HR0 L;  3A8J E;  3W1G A;  1N36 Q;  1S3O A;  1HZA A;  3G6J B;  3D8G A;  5NUC A;  1V1P A;  1IBL Q;  2NN6 G;  1JJ2 A;  3E9H A;  4DUZ L;  4GOP C;  2NVT H;  2VUM H;  3T16 A;  4K5V A;  4JBW A;  1CHQ D;  1QZH A;  4X3U A;  2I07 B;  1XNR Q;  4YWL A;  5EKL A;  1CQV A;  4DR6 L;  3I3C A;  2EOT A;  1NCV A;  2D9U A;  2N3S A;  5JJZ A;  4DR2 L;  5A2Q L;  4IPH A;  3CCU A;  1B50 A;  2NUC A;  1YNJ D;  3L0O A;  2Q2T A;  2VQF Q;  1A6X A;  4CJ0 B;  3HOV H;  2HQL A;  2O2L D;  3N52 A;  2X6L A;  4DA2 A;  1ZEQ X;  5FOB B;  1VQ7 A;  4JI7 L;  4UHV A;  5FLX E;  1Y1W G;  3A55 A;  1YHQ A;  3NWS A;  3RUZ A;  3T56 B;  3WDN A;  1S5B D;  4DNR B;  2IPK D;  2F0P A;  2KOL A;  4X64 L;  3OPO A;  5C6A A;  1UEB A;  4NW2 A;  4JI0 Q;  1N32 Q;  2G9D A;  1PH3 A;  4GNX A;  2Z6K C;  3DEP A;  3OMG A;  2RA4 A;  2UXC Q;  5M3F H;  1AP0 A;  4HJ9 A;  4DAV A;  1N34 L;  5IGG A;  4HJ5 A;  3B6Y A;  3T51 B;  2L5T A;  1WOC A;  4L5Q A;  1Y8N B;  3S2D B;  3N6R A;  2CHB D;  4K5X A;  2KCM A;  1GUN A;  5IY0 A;  4FF1 A;  1YIT A;  1XMQ L;  4L5R C;  1EEF D;  1WYD A;  4PZ6 A;  3CC4 A;  2A19 A;  2Z4H A;  1ASY A;  4A3L G;  1UE7 A;  3RR5 A;  4RHS A;  5EKK A;  2UU9 L;  1JMC A;  2PZU A;  1IBM L;  1L0X B;  1TWG H;  3SK8 A;  4A3I G;  4C3I B;  4IUP A;  1VQB A;  4P73 A;  3HOV B;  2EY1 A;  4POG A;  1EIY B;  2KUM A;  3HP3 A;  4P72 A;  4ZLT F;  2R93 B;  4LF8 Q;  1JOK A;  4C2M H;  4A3D H;  3T1Y L;  1OXS C;  2F0O A;  2PMZ E;  3QWN A;  3H3V I;  1NTG A;  2AQ3 B;  2K5N A;  1SND A;  2BOS A;  2TSS A;  4TKO B;  1HFG A;  2D2C C;  1QUQ B;  1X3G A;  2HQE A;  4C3J G;  3VR4 A;  3LGJ A;  1HRJ A;  1LT6 D;  4Q5V A;  2JA6 H;  1EU3 A;  5C5M A;  2DGY A;  1L0Y B;  3BVM A;  3CRL C;  4LFA Q;  1C7Y A;  1EWH A;  1YZ6 A;  5LMN W;  2IWH A;  1LAB A;  3LNN A;  4WOR A;  1SYE A;  4X3K A;  2JA8 B;  2B2Y C;  5HUR A;  1WJJ A;  1BCP F;  2IHF A;  4GLA C;  4A3C H;  1B1Z A;  4UP8 A;  4ILW A;  2NYZ D;  4A3E B;  2PNR C;  5EPL A;  1SEB D;  3I4N H;  4DUZ Q;  1F9Q A;  2L15 A;  2Y0S B;  3CD6 A;  1EWC A;  3LX0 A;  3IAY A;  4HCE A;  4J6H A;  1XTC D;  3BZK A;  1CQF A;  3I7F A;  2WKD A;  1N32 L;  2JA9 A;  1CT1 D;  1F2L A;  1ENA A;  1EOT A;  4XTC S;  3K57 A;  4J1M A;  1A3U A;  4U68 A;  1X3Q A;  4IOA A;  2QDL A;  3K5M A;  3PMF A;  4GN4 B;  4JI8 L;  3S14 H;  2CKZ B;  4RGM A;  1ML0 D;  1B53 A;  3Q8D A;  3RNU A;  1RL2 A;  5FLX c;  3MA2 B;  3FP9 A;  4OX9 Q;  3DWA A;  1RJT A;  2A8V A;  1I6H H;  4JBJ A;  2R92 G;  4RAU C;  4P2C B; 
#chains in the Genus database with same CATH homology
 4DNI A;  3K0X A;  1I94 L;  2HHH L;  1B8A A;  1EUJ A;  1X9N A;  3KOJ A;  4DV1 Q;  2BH2 A;  3HOY G;  3KFU A;  3I4M H;  3NEM A;  3T1Y Q;  4JBK A;  4YWM A;  1VQL A;  2ZJQ A;  4YY3 Q;  1SN8 A;  1UE6 A;  4LF8 L;  1HJP A;  1GD7 A;  3H0G G;  3PUW A;  5FLM H;  4JI6 Q;  4A3L H;  2VQE L;  1LM0 A;  2K5V A;  5IYC G;  4NB3 A;  4LF9 L;  3HOX H;  1K73 C;  4BBS H;  2GN5 A;  3G71 A;  2JA6 G;  5IYB G;  1PH9 A;  2KHJ A;  1S40 A;  4C3J H;  1VQ4 A;  4BA1 I;  2R7F A;  1CKN A;  1IXR A;  3A5U A;  4ALP A;  4LW1 A;  3U4V A;  4GLX A;  2OTJ A;  4YCW A;  3WWV A;  2YTX A;  2UUB L;  3M4P A;  4GKJ L;  3AEV A;  2JK8 A;  1EIF A;  4DV2 L;  1SFO H;  4KLK A;  4LWC A;  2UXD Q;  2VY3 A;  4DR2 Q;  3S1M H;  4B3S Q;  3A74 A;  3K7A H;  4IOC A;  1XJV A;  1U5K A;  4R4O A;  4A3C G;  3ULL A;  3GTP H;  1E7Z A;  3CPW A;  3IRB A;  4AH6 A;  1LTL A;  2K75 A;  4A3J H;  1EQR A;  4DK3 C;  2YYZ A;  3OW2 A;  2AHO B;  4J15 A;  3RLO A;  4JOI A;  3KF6 A;  3GD7 A;  4JI5 L;  4OWW B;  3S1Q H;  3HOW G;  1AH9 A;  1Q1B A;  4HIK A;  4A3F G;  2CQO A;  2RF4 A;  3PUX A;  1UE5 A;  4UPA A;  1OXX K;  2WAQ E;  1PH8 A;  1N33 Q;  4B3R L;  1XNQ L;  3NEL A;  1XPO A;  1D8L A;  1KL9 A;  2IHE A;  4YCU A;  4B3M L;  3S1R H;  4A3B G;  2VS1 A;  2YV5 A;  1L1O C;  4JI4 L;  3MEF A;  1BBW A;  1PV4 A;  4OWX B;  5M3F G;  1L1O A;  1YHB A;  4AQY L;  1HR0 Q;  2B63 G;  3CPF A;  1K8G A;  1E24 A;  4JI3 L;  5IP7 G;  4LUZ A;  3KJP A;  3HKS A;  1S72 A;  5J3B A;  4QGU A;  1CSQ A;  3GTJ H;  4DUY L;  2IX0 A;  3NEN A;  4DR1 L;  3M9B A;  1YI2 A;  1IBL L;  2BA0 A;  3GTM H;  4BBS G;  4LUV A;  2KBN A;  4GOP A;  1K83 H;  3G4S A;  2JA5 G;  4DPG A;  1KC8 C;  5LMU Q;  2HT1 A;  1WFQ A;  2R7Z G;  2F52 A;  1IZ6 A;  1X6O A;  2D62 A;  2AKW B;  5FJ8 H;  3EBE A;  1XTD A;  3GTQ H;  2NVY H;  2YTY A;  3PO2 H;  4HJ8 A;  2EIF A;  5AJ3 L;  1YJN A;  1AE2 A;  1A63 A;  5LMN L;  4UY8 C;  3M7N A;  4JV5 L;  4GNX C;  2ZTD A;  2K4K A;  2Q2I A;  2IY5 B;  4X65 Q;  5IWA Q;  4AYB E;  1Y1W H;  1VQ6 A;  3DM3 A;  3PO2 G;  2EQS A;  1KAW A;  3G6E A;  2UXC L;  2QA4 A;  3UE1 A;  3PIP A;  5FJ8 G;  2BA1 A;  1K3R A;  1XPR A;  1GO3 E;  3PUV A;  4NXN L;  1VQ5 A;  5K36 G;  4DAY B;  1VQK A;  2ES2 A;  4X64 Q;  4DR7 L;  2WAQ G;  1VQO A;  3A5Z B;  1Y1V H;  2CWA A;  3STB D;  1K8A C;  2ZM6 L;  1IBK L;  3F8T A;  4JV5 Q;  4C3H H;  3CXC A;  3FHW A;  1IL2 A;  4DV4 L;  3HOX G;  4IFD I;  5IYB H;  1M90 C;  1HNX L;  2JA7 G;  2E2I H;  1GVP A;  3L2P A;  2JEA I;  1E3P A;  4UP9 A;  1QZG A;  5GAE C;  4Y7N H;  4JI7 Q;  3EN2 A;  4A3G H;  2UUA L;  2Y0S E;  4B3T Q;  4KHP L;  3STB C;  4L5T A;  4QY7 A;  1T9H A;  2NZO A;  5M5X H;  5M5Y H;  2MNA A;  3ULP A;  4A3J G;  1KD1 C;  4LFC Q;  3J80 i;  1HH2 P;  3HOZ G;  3S16 H;  2JJQ A;  3CQZ H;  3CCR A;  3S1N H;  1TWF H;  4AIM A;  2VQF L;  1E1O A;  2AWO A;  2K50 A;  1J5E L;  3M4O H;  3PV0 A;  3CC2 A;  2F4V L;  1XMO Q;  2E5L L;  4LFB Q;  2MO1 A;  2HIV A;  2E2H H;  2ZJR A;  5C44 G;  3CMA A;  1PH4 A;  3ER0 A;  5IP9 H;  4R4T A;  1X54 A;  5GQO A;  4PMW A;  4IFD G;  3RLN A;  1QVC A;  3HOW H;  5IYD H;  3TS2 A;  5M3M G;  3I56 A;  4DV6 Q;  3GDE A;  3J80 c;  1PH5 A;  1VS0 A;  1NMF A;  1N33 L;  4LUO A;  4MNO A;  4A3G G;  4DV5 Q;  1XNR L;  3AYH B;  4OO1 I;  1VQ9 A;  1NBW A;  2OTL A;  2N8N A;  1CSP A;  1BKB A;  3W5O A;  4PZ7 A;  3PIO A;  3VDY A;  3UDF A;  5C3E G;  1J5E Q;  1UE1 A;  4BBR G;  3J7Z C;  4YCV A;  4DV5 L;  4DR3 L;  4LNQ A;  3RLF A;  4LF7 Q;  3KLW A;  1HZB A;  2UUA Q;  1CKN B;  2K14 A;  2NVQ H;  2ID0 A;  4JOI C;  3E0E A;  4B3S L;  1HNW Q;  2C35 B;  1Q8K A;  3AQQ A;  1N36 L;  3UE0 A;  3H3V H;  3I4M G;  3DLL A;  1XMO L;  4C3I H;  2E5L Q;  4LFB L;  1LUZ A;  3EIV A;  4DV4 Q;  1EWI A;  4X6A H;  1U0L A;  1J6Q A;  2ZM6 Q;  4DV0 Q;  1MJC A;  3RZO H;  4AYB G;  4WJ3 M;  1MIU A;  4BY1 G;  4DK6 C;  4AQY Q;  3F2B A;  3PO3 H;  1FJG L;  4EQ5 A;  1HNZ Q;  2ZTE A;  4HJ7 A;  4NXN Q;  5ELO A;  2JA8 H;  1HZC A;  4APV A;  5JJL A;  1OXV A;  3I4O A;  3UDX A;  4DR5 L;  4LF5 Q;  2R92 H;  1YBY A;  2ATW A;  1IBK Q;  3CP0 A;  3M4Q A;  2PNH A;  2B3G A;  4OWT B;  2JA5 H;  1Q12 A;  4IPG A;  4P75 A;  4DR7 Q;  2UXB L;  3CME A;  2RHS B;  2H5X A;  3D31 A;  4A93 H;  4P74 A;  1Y1V G;  1KXL A;  4R4Q A;  2KCT A;  1R9T H;  1Q1E A;  1I3Q H;  2QGQ A;  4DV6 L;  5FLM G;  1PYS B;  4X62 Q;  3JAM c;  1FVI A;  1PA6 A;  5C0X I;  1G29 1;  3OTO Q;  2LSS A;  5C0X J;  3KDF A;  1HNZ L;  1KQS A;  1FJG Q;  3HOY H;  2IX1 A;  1HNX Q;  1L2F A;  5IWA L;  3GTG H;  4DV2 Q;  1LYL A;  1MJE A;  2F4V Q;  3S17 H;  1W3S A;  5JEA J;  4JI2 L;  2AWN A;  3CF5 A;  1X3E A;  2PI2 E;  5LMN Q;  2VW9 A;  1OXU A;  4GNX B;  2ALY B;  4JI3 Q;  3TRE A;  3AFP A;  4A3K G;  4LFC L;  1VQ8 A;  2DUD A;  4O2D A;  3JAM i;  4JG2 A;  1Q7Y C;  4B3T L;  4KHP Q;  2WP8 J;  1VQA A;  2PQA B;  1Z9F A;  3CAM A;  3OTO L;  3J81 j;  1HNW L;  3HKZ G;  3ZJY C;  4A3E G;  2CFM A;  3TEH B;  4BY7 G;  4X62 L;  1KHI A;  1QUQ A;  1FL0 A;  1GKH A;  3I4N G;  1TWA H;  1IYJ B;  1VQJ A;  4Y52 H;  3CCL A;  1PH7 A;  1TXY A;  2RCN A;  4QJF A;  3U50 C;  2FXQ A;  3CC7 A;  2Q2H A;  1GM5 A;  2YTV A;  3CCQ A;  1ASZ A;  2UXB Q;  2JA7 H;  4X65 L;  1B7Y B;  1X65 A;  1X3F A;  4IPD A;  2ASB A;  2VUM G;  4PZ8 A;  1WCM H;  2WB1 E;  4LF5 L;  4OX9 L;  5AJ3 Q;  5C3E H;  4DR5 Q;  1XPU A;  1JE5 A;  1TWH H;  3I55 A;  1B70 B;  4HID A;  4HIO A;  3H0G H;  4B3R Q;  4KI0 A;  1V43 A;  1PH2 A;  1VQI A;  1EFW A;  1CUK A;  4RMF A;  4BBR H;  3KJO A;  4A93 G;  4A3M H;  1TWC H;  3PGZ A;  1V1Q A;  2CCZ A;  4X66 L;  3J7A 5;  4A75 A;  4JI5 Q;  2Y0S G;  2KEN A;  1WCM G;  1A62 A;  2AMC B;  4DR1 Q;  1YNX A;  3F1Z A;  4GN5 A;  3SGI A;  3ULJ A;  4DV0 L;  4OXP A;  5IP9 G;  4YWK A;  2PI2 A;  4LFA L;  1YHA A;  3G48 A;  1Y14 B;  4JC0 A;  3CCJ A;  4BY1 H;  1FGU A;  2E2J H;  5GRO A;  4KHZ A;  1HR0 L;  4A3I H;  1N36 Q;  3W1G A;  1O7I A;  1N9W A;  1PYB A;  1S3O A;  1K0R A;  3KF8 B;  4JI1 Q;  4A76 A;  4JI4 Q;  1HZA A;  2MO0 A;  4LF7 L;  5EAY A;  3U4Z A;  3J81 i;  4DR3 Q;  1IBL Q;  3MXN B;  1A0I A;  3CCS A;  2NN6 G;  2R7Z H;  1JJ2 A;  1NY4 A;  2VNU D;  3E9H A;  4DUZ L;  4BXX H;  3HOU H;  4GOP C;  2NVT H;  2VUM H;  1BVS A;  2D0P A;  3D0F A;  1QZH A;  4JBW A;  5C4X G;  4K0K Q;  1XNR Q;  3M3Y H;  5C4J H;  4DAM A;  4YWL A;  5IE8 A;  3K8A A;  2ZJP A;  3UDG A;  4DR6 L;  1CKO A;  2NVX H;  1M1K C;  2N3S A;  4POF A;  3PCO B;  4DR2 L;  3CCV A;  4JI8 Q;  1PH1 A;  1Q46 A;  1SRO A;  4IPH A;  3HFZ B;  3CCU A;  2UUC L;  4IFD J;  3GTL H;  1EOV A;  4GKJ Q;  3L0O A;  2Q2T A;  2VQF Q;  2UU9 Q;  3TRZ A;  1PHJ A;  4QIW E;  2R93 G;  1YJW A;  3PF4 A;  4R1J A;  1JB7 A;  2JQO A;  5IYD G;  1L1O B;  3HOV H;  5M5W H;  5C4X H;  1KRS A;  2HQL A;  4LF9 Q;  2GVA A;  4JI7 L;  2OCE A;  2ZTC A;  4A3F H;  1VQ7 A;  2VQE Q;  1PVO A;  2R7D A;  5GAD C;  4YHH L;  1OTC A;  2WB1 G;  4A4I A;  3S24 A;  1RIP A;  4A3E H;  1VQC A;  1Y1W G;  2UUB Q;  4P71 A;  1YHQ A;  1YJ9 A;  2Q2U A;  1W2B A;  2KHI A;  5IT9 c;  1D7Q A;  3T1H Q;  2I5L X;  1NE3 A;  4BY7 H;  2JEB I;  4IPC A;  1VQE A;  2N49 A;  1PFS A;  3KF6 B;  3RZD H;  1G6P A;  5JJI A;  4X64 L;  3CCE A;  3HOZ H;  1SLJ A;  3K80 C;  4DV3 L;  1UEB A;  2N78 A;  3UDI A;  4JI0 Q;  1PH3 A;  4TVA B;  4MTN A;  3W1B A;  4GNX A;  1N32 Q;  5C0X G;  2Z6K C;  4JI6 L;  3TQY A;  2UXC Q;  3HOV G;  5JJK A;  5M3F H;  4YY3 L;  4R4C A;  1XNQ Q;  4HJ9 A;  1Q86 C;  3F2D A;  1G51 A;  3GTK H;  3T1H L;  1PH6 A;  5JEA G;  1N34 L;  3KDF B;  4HJ5 A;  2Z6K A;  3B6Y A;  1VQN A;  2OWO A;  1DGS A;  2I5H A;  1I94 Q;  2HHH Q;  1WOC A;  4L5Q A;  1OXT A;  1VCI A;  4DV7 L;  3U58 A;  2KCM A;  4ME3 A;  5IY0 A;  1YIT A;  3NBH B;  1XMQ L;  1QVG A;  4L5R C;  1WYD A;  4PZ6 A;  3CC4 A;  2A19 A;  1ASY A;  1V9P A;  4GKK L;  4A3L G;  1C9O A;  1UE7 A;  3RR5 A;  3K81 C;  2BH8 A;  2EXD A;  2UU9 L;  2UXD L;  1JMC A;  5LMU L;  1NMG A;  5GAG C;  3FKI G;  4A3D G;  4OON A;  1IBM L;  1TWG H;  4A3I G;  4QQB X;  5C44 H;  1YVC A;  3PSI A;  4DUY Q;  3BJU A;  2VL6 A;  1SR3 A;  1VQB A;  1SE8 A;  4P73 A;  4XIG S;  5M3M H;  3M85 A;  1NJI C;  1N34 Q;  5BR8 Q;  3AFQ A;  3ICE A;  2OQ0 A;  1Q82 C;  4LF4 L;  1L0W A;  4GOP B;  3HOU G;  4POG A;  1KRT A;  1WI5 A;  1KIX A;  1EIY B;  1H95 A;  1X55 A;  3H15 A;  4B3M Q;  4P72 A;  4A3K H;  1MKH A;  2LXJ A;  4LF8 Q;  2Z0S A;  4C2M H;  3FKI H;  4A3D H;  3T1Y L;  1OXS C;  4NXM Q;  4DR4 L;  1SMX A;  2PMZ E;  3H3V I;  1X56 A;  4OO1 G;  4IJL A;  1NTG A;  5IYC H;  1Q81 C;  2K5N A;  2XGT A;  3BU2 A;  4DV1 L;  1YIJ A;  1UWV A;  1IBM Q;  1N8R C;  2MFI A;  1VQG A;  2LXK A;  3PUZ A;  4HJA A;  1QUQ B;  1X3G A;  2I0Q A;  1I5F A;  2GVB A;  3L7Z C;  4R4I A;  1P8L A;  3LGJ A;  4LF6 L;  4QL5 A;  2F3I A;  4GN3 B;  3K7U C;  2JA6 H;  3S15 H;  4A3B H;  3F2C A;  1VQP A;  4JYA Q;  2I5M X;  2DGY A;  2IT1 A;  5BR8 L;  2XTI A;  3BZC A;  4LFA Q;  4LF6 Q;  3GO5 A;  1C7Y A;  4BXX G;  2QEX A;  1YZ6 A;  3JC6 6;  1EQQ A;  1QVF A;  3S2D H;  2NN6 I;  1E1T A;  5DLQ E;  5LMN W;  3CCM A;  2UUC Q;  4WJ4 A;  1VQD A;  4X66 Q;  4MZ9 A;  4DKA C;  2D0O A;  1A8V A;  2HIX A;  2NZH A;  4O0A A;  2VZA A;  3E9I A;  2CWP A;  4NXM L;  4L5S A;  1WJJ A;  1HR0 W;  4PG3 A;  2IHF A;  4GLA C;  4A3C H;  4UP8 A;  4DR6 Q;  1P16 A;  1XMQ Q;  2JE6 I;  3OYY A;  3GTO H;  5E7N A;  3HKZ E;  4JI0 L;  1VQM A;  4IJH A;  2V1C C;  4A3M G;  1EYG A;  3I4N H;  3A0J A;  1YEZ A;  4LF4 Q;  5HGQ A;  2OQK A;  4JCV E;  4IO9 A;  4DUZ Q;  2WFW A;  2L15 A;  2A1A A;  4FDB A;  3CW2 C;  1JJC B;  2PQA A;  2B29 A;  3CD6 A;  2K5H A;  4DR4 Q;  1BBU A;  5HY6 A;  3J81 c;  3BZK A;  5IP7 H;  3TS0 A;  3I7F A;  4YHH Q;  4JI1 L;  2R93 H;  4BA2 I;  2B63 H;  1N32 L;  1VQF A;  2JA9 A;  2RHQ B;  1I50 H;  1HZ9 A;  1VQH A;  1E22 A;  5H1S E;  2E8G A;  1CKM A;  4JBM A;  4XTC S;  2MQH A;  4DV7 Q;  2JA8 G;  4JI2 Q;  4IOA A;  5ELN A;  4GS3 A;  1JT8 A;  4GN4 B;  3S2H H;  4EX5 A;  1K9M C;  3PUY A;  3PO3 G;  4RG1 A;  4JI8 L;  3S14 H;  3PF5 A;  2CKZ B;  4GLV B;  5GAH C;  1SRU A;  3Q8D A;  3RNU A;  4GKK Q;  2K52 A;  2R6G A;  4NPS A;  1RL2 A;  4TQU S;  5FLX c;  3RN2 A;  4JYA L;  4UP7 A;  3RN5 A;  3KYH C;  1AE3 A;  2YU9 H;  3FP9 A;  1C0A A;  4H02 A;  4OX9 Q;  1Z47 A;  3ERS X;  1I6H H;  2A8V A;  4DV3 Q;  4JBJ A;  2R92 G;  4K0K L;  4HIM A;  3I2Z A;  1JJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...