4GOPB

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
122
Chain Sequence
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
total genus 29
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopB00
1WCMH 1Y1WG 1A0IA 3PO3G 1Y1VH 5IYDG 2B3GA 4QGUA 2VQFQ 2ES2A 2HT1A 1VQEA 1YNXA 2EQSA 4P71A 4GN4B 3E9HA 4DPGA 3ULLA 1HR0L 2K75A 4X66Q 1SN8A 5HGQA 1PYSB 3G48A 1YHAA 2MO0A 2HQLA 4X62Q 3I7FA 4DUYQ 1D7QA 1X6OA 1VQ7A 1XNQQ 1CKOA 3HKZG 3GDEA 1ASZA 4POGA 4L5TA 2A8VA 5M3MG 1KIXA 3HOWH 5LMNW 4A3BG 4YWMA 4QJFA 2I5HA 3L2PA 1XMOL 1GM5A 1N32L 4PZ6A 4A76A 4X65Q 3JAMi 3GTPH 2YU9H 1E22A 3HOYH 2VQEL 5GROA 4DV7Q 2VNUD 2GVBA 4LFBQ 2I5MX 1MJEA 2CWAA 3GTLH 3M4PA 4C3HH 1E1OA 2K5HA 2B63H 3HOUH 1YI2A 1PH4A 3LGJA 4JBKA 4GKJL 2PQAB 3KOJA 4LWCA 1XPRA 2JEBI 3GTOH 2R92G 3KDFB 4LFCQ 1ASYA 3D31A 4A3CG 4YWLA 2ZTEA 1XNRL 1PH1A 1JT8A 4YY3L 3M4OH 2CWPA 3J80i 3CPFA 1HNXL 4A3IH 4YHHQ 1CSPA 1QVCA 3K7AH 5C44G 2CCZA 4GOPA 2K4KA 2ZM6L 3U4VA 4HJ8A 3UDFA 3KF6B 2JJQA 1I3QH 2UXDQ 1UWVA 2EXDA 2UXBQ 4UP9A 4R4TA 4BXXH 3KJOA 4JYAQ 1Q12A 1GKHA 4GLAC 4NB3A 2AKWB 4JI5Q 1T9HA 5FJ8G 1MKHA 2BA0A 3STBC 4JI2Q 1N34L 1OXSC 3T1YL 3S2HH 5IYBG 4GLVB 4L5QA 2JA6H 1G51A 3ULPA 1K83H 4R4QA 4DV6Q 2JA7H 3UDIA 1IBML 3PUWA 4KHPL 3Q8DA 3BZKA 3CC2A 3H15A 1X55A 1NJIC 1QUQB 4GLXA 4BY7G 2LSSA 5DLQE 1UE7A 1N9WA 3RNUA 1CKNA 5ELNA 4DR2L 4DUZQ 4PZ7A 2VUMG 2Q2UA 3RZOH 4JOIA 4IJHA 1A8VA 3CMEA 1GD7A 3K0XA 2JK8A 4LF8L 2RHQB 3TQYA 4A3KG 5LMNQ 5EAYA 2UXCQ 1S3OA 3PUXA 1YIJA 3I4NH 5M5WH 1E1TA 3TREA 1W3SA 3KFUA 5IYCG 4L5RC 2AWOA 4QQBX 3DM3A 1KC8C 4JI4L 4A3JH 4DV1L 2NVTH 4BBSG 4DR6Q 3M4QA 4NXMQ 1A63A 4AH6A 1P8LA 4HIKA 1YVCA 4OONA 1YJWA 2OTJA 5K36G 3A5UA 2HHHQ 5GADC 3HOXH 2VQFL 1YHBA 3GD7A 3S1RH 1V9PA 3UE1A 4A3GH 3I2ZA 4GS3A 3EBEA 4LUZA 3A74A 4AIMA 3F2DA 4GOPC 4JG2A 1XPOA 1PH2A 4BA1I 2NN6I 4X66L 1EQQA 2I0QA 2ZJQA 2R93H 2LXJA 2NZHA 2PI2A 3A5ZB 3NEMA 1UE5A 3PCOB 4BBRH 4X62L 4DUYL 2JEAI 4J15A 1Q8KA 1XNQL 1B8AA 2GVAA 2VW9A 4XTCS 3CMAA 1D8LA 1WJJA 2ASBA 3CC7A 1K3RA 1TXYA 4LF7Q 2IX0A 3FKIG 4X65L 2R7DA 3I4MG 3JAMc 3CCEA 1Q46A 4TQUS 5BR8Q 4DV7L 1C7YA 4A75A 5FLXc 2H5XA 1FJGQ 4LFBL 1CKNB 3ER0A 1WYDA 3HOVH 1LUZA 3TRZA 4WJ3M 1HZCA 3HOZG 3FP9A 1CUKA 5IP9H 3OTOQ 1M1KC 3PF4A 2WAQE 5IE8A 4BY1H 5M5YH 5JJLA 2YTVA 3K80C 4R4CA 4A3LH 4AYBE 2OWOA 4C3JH 2DUDA 4HJ5A 4DV2Q 3S16H 4OWTB 3BU2A 2BH8A 4LFCL 4DK3C 4JOIC 1TWFH 2A19A 2N78A 1VCIA 5FLMG 3J81i 1VQHA 1PH3A 3H3VH 1H95A 3PUVA 1VQIA 4OXPA 1YZ6A 4P72A 2F4VL 4A93H 1FGUA 3RLFA 4IFDJ 3J80c 1NBWA 2NZOA 4YHHL 2JA5G 5JEAJ 1VQ4A 3PF5A 3PO2H 2KHJA 4LF9Q 2AHOB 4IPCA 4IO9A 2BA1A 3W1GA 3J81j 1Q82C 2Q2TA 5C4XG 3W5OA 2Z6KC 4A3GG 5C0XJ 3KJPA 3CXCA 4DR1Q 2XTIA 2UXDL 1BBUA 2UXBL 2N49A 3PUYA 1I5FA 4JYAL 1AH9A 2K5NA 4DV4Q 4JI5L 3TEHB 4B3TQ 4JI2L 3RLNA 1IYJB 3HOUG 4LW1A 3D0FA 5M5XH 4LF4Q 4PZ8A 1EOVA 3NENA 2GN5A 3AQQA 2UU9Q 1Y1WH 4DV6L 3PO3H 5IYDH 2L15A 1L1OA 1W2BA 1OTCA 3IRBA 3S1QH 3A0JA 1VQBA 4OO1G 5GAGC 1NTGA 2VS1A 3CCVA 1Q1EA 1YBYA 2Y0SE 4LUOA 2JE6I 5M3FG 2HIXA 1VQ6A 1JJGA 1SMXA 3U4ZA 4DUZL 2Q2IA 2F4VQ 1TWAH 5M3MH 4OO1I 1J6QA 1FVIA 3CQZH 3M3YH 1VQAA 3G71A 1PH9A 4A3BH 2IHEA 2E2JH 3S2DH 1KRSA 2UUAQ 1HZ9A 3H0GG 3ULJA 4HJ7A 4BXXG 3CCMA 1I94Q 3TS2A 4EX5A 1QZGA 1PH8A 4LNQA 4DR7Q 5LMNL 1S72A 2UXCL 5C0XG 4O0AA 3T1HQ 4MNOA 1N36Q 4JV5Q 5IP7G 2KCTA 1X3GA 1SLJA 4APVA 1HH2P 4LFAQ 3TS0A 4R1JA 2OQ0A 1J5EQ 4LF5Q 1Z9FA 2PI2E 3F1ZA 5C0XI 4DNIA 4DR6L 4POFA 2QA4A 4UPAA 4NXML 4DR4Q 1UE1A 1LM0A 2YTYA 4A3FG 3HKSA 2HHHL 2R92H 1Q7YC 1JJ2A 4A3CH 1S40A 1PYBA 1Z47A 4DR3Q 1DGSA 1KL9A 5C4JH 1QZHA 1YJNA 2IY5B 4JI7Q 4IPGA 4HJAA 4OX9Q 1IXRA 4JI3Q 2KBNA 2WP8J 2YV5A 5C44H 1L1OB 1YHQA 3F2CA 4DAMA 4FDBA 2IT1A 1AE2A 4UP8A 4ALPA 3NELA 2NVQH 4LF7L 1IL2A 5H1SE 3CCQA 3OW2A 4A3EG 5C3EG 1NE3A 1OXVA 4GKKL 3RLOA 2FXQA 5BR8L 1TWCH 1SE8A 1VQJA 5FJ8H 1NMGA 1FJGL 2Q2HA 2MQHA 1L1OC 2UUBQ 4Y52H 2OQKA 2N8NA 5IYBH 2K50A 1VQPA 3OTOL 2R7ZG 4IOCA 2VY3A 3S24A 3CW2C 4GOPB 2YTXA 1WI5A 2HIVA 1PH7A 4R4IA 1MIUA 1HNWQ 4DV0Q 4DV2L 4UP7A 2KENA 4B3SQ 4A3DG 1SFOH 1Q1BA 2F3IA 2ZJRA 2D0PA 3BJUA 1VS0A 1EUJA 3ERSX 3J81c 4BY7H 1VQMA 1I6HH 1VQDA 1L2FA 1CKMA 1OXUA 3NBHB 3RR5A 2JA8G 1LTLA 1U0LA 3F2BA 4K0KQ 1UE6A 3W1BA 2WAQG 2VUMH 1VQ8A 3CPWA 2ATWA 4GNXA 3CCSA 3EIVA 4LF9L 3CP0A 4AYBG 2UUCQ 2IHFA 2RHSB 3OYYA 4DV5Q 4IPHA 1MJCA 2V1CC 2MNAA 1TWGH 2D0OA 4DR1L 4DR5Q 4A3KH 2NVXH 4TVAB 3M9BA 2CKZB 3S14H 1C0AA 2ZTDA 2VL6A 1HZAA 4JI6Q 4DV4L 2PNHA 2OTLA 4KLKA 1SR3A 5IYCH 4B3TL 4GKKQ 3K81C 3PUZA 4A3MG 1QVFA 1RIPA 3K7UC 1PHJA 1JB7A 3M7NA 2E2IH 4LF4L 1HJPA 3PIOA 4BBSH 1E7ZA 3RZDH 2UU9L 1NMFA 1C9OA 1Q86C 1HR0W 1WCMG 2K5VA 2ID0A 3U50C 1VQCA 1Y1VG 3L7ZC 5LMUQ 4RG1A 1EFWA 3PSIA 1EQRA 2MFIA 4PMWA 3CAMA 3SGIA 1YJ9A 2CFMA 1V43A 1VQGA 2XGTA 5AJ3Q 4LF6Q 3CD6A 1FL0A 2D62A 4JBJA 1PVOA 1G291 1P16A 2UUAL 3HOWG 3FKIH 2JA9A 2PQAA 2QEXA 1Y14B 3I4MH 1KRTA 5JJKA 2WB1E 3STBD 4JI1Q 3CCRA 1I94L 3KDFA 3I56A 3GTMH 4DR7L 3HOYG 3T1HL 2Y0SG 1N36L 3CCJA 4JV5L 4NXNQ 4GNXB 3ICEA 1N33Q 5IWAQ 1HNZQ 4XIGS 2I5LX 3HOZH 4LFAL 5IY0A 1J5EL 1KD1C 4X64Q 4LF5L 4KHZA 3GTQH 2Z0SA 3B6YA 4DK6C 2K52A 4JC0A 4A4IA 2B63G 2E5LQ 3J7ZC 4RMFA 4B3MQ 1NY4A 4JI8Q 1JJCB 4DKAC 3KF6A 4AQYQ 3KYHC 1K73C 3PV0A 4GNXC 3GTJH 3AFPA 1BBWA 5FLMH 1IBKQ 1UEBA 4DR3L 4IJLA 3G4SA 1PH5A 4HIDA 1OXXK 4JI7L 1QVGA 1GVPA 4OX9L 3FHWA 3EN2A 1VQNA 4JI3L 4HIOA 2JA5H 2YYZA 4A3IG 1X56A 5C4XH 4P73A 4IFDG 1XMQQ 2DGYA 3MEFA 3K8AA 4P75A 5JEAG 1HZBA 5GAEC 2IX1A 1PFSA 1QUQA 4YCUA 1G6PA 4JI0Q 4IFDI 2UUBL 4B3RQ 4IOAA 1OXTA 1IBLQ 2NVYH 4DV3Q 3CF5A 5J3BA 1VQFA 2RF4A 1N8RC 5GQOA 3HKZE 1BKBA 2JA6G 4ME3A 1U5KA 4YCVA 1PV4A 1HNWL 1V1QA 2JA7G 4DV0L 1LYLA 4HIMA 4B3SL 3HFZB 4JBWA 1VQLA 4YWKA 1KHIA 3S17H 3RN2A 1XJVA 1X3FA 1HR0Q 4HJ9A 1O7IA 5M3FH 3AYHB 4QY7A 4K0KL 1TWHH 1B70B 3JC66 3ZJYC 3H0GH 2UUCL 4DV5L 2QGQA 4L5SA 4R4OA 1XMOQ 4DR5L 1N32Q 1L0WA 4OWWB 1PA6A 2VQEQ 1VQ9A 4DR4L 3BZCA 5ELOA 5IP7H 1YITA 1K8GA 1EIYB 3CC4A 4JI6L 2F52A 3I4NG 3MXNB 3S1NH 3PGZA 3F8TA 3I55A 1IZ6A 1PH6A 4A3JG 1VQ5A 4YCWA 1KXLA 4GKJQ 1CSQA 4A3FH 5E7NA 3I4OA 1KAWA 1JE5A 1K0RA 4NPSA 3HOXG 5LMUL 5IT9c 1GO3E 2C35B 5GAHC 3E9IA 3DLLA 1VQOA 1A62A 2RCNA 3KF8B 4H02A 4GN5A 1XNRQ 1WFQA 1WOCA 4YY3Q 2EIFA 2R93G 2ZJPA 3L0OA 4JBMA 1EYGA 5AJ3L 4LF6L 1RL2A 4BBRG 1HNXQ 2K14A 3KLWA 4KI0A 2WFWA 3UE0A 4C2MH 5HY6A 2ZM6Q 2E2HH 4A3EH 5C3EH 1JMCA 4QL5A 1X3EA 3AEVA 5JJIA 2PMZE 2R6GA 4JI1L 1M90C 4P74A 1E3PA 2A1AA 4GN3B 3GTGH 4NXNL 2ALYB 1X54A 1KQSA 2Z6KA 1SRUA 1R9TH 1N33L 4C3IH 2OCEA 2E8GA 4QIWE 5IWAL 4IPDA 1N34Q 3T1YQ 1HNZL 1SROA 1XPUA 1X9NA 2R7ZH 4X64L 2NN6G 3HOVG 4JCVE 2LXKA 5IP9G 4X6AH 1EWIA 4BY1G 3UDGA 2E5LL 4B3ML 4JI8L 4A3LG 4AQYL 4A3DH 2WB1G 1IBMQ 1K8AC 4KHPQ 1E24A 1IBKL 3CCUA 4BA2I 4LUVA 3AFQA 3VDYA 3PIPA 2JQOA 3UDXA 1YEZA 2JA8H 4O2DA 1AE3A 1X65A 2KHIA 2AMCB 4Y7NH 1BVSA 4A93G 2MO1A 2N3SA 2VZAA 3GO5A 4DR2Q 3U58A 1Q81C 3CCLA 3WWVA 3PO2G 3H3VI 1XMQL 3J7A5 4WJ4A 3E0EA 2CQOA 1EIFA 4MZ9A 1B7YB 1XTDA 4LF8Q 2AWNA 2B29A 4MTNA 1VQKA 3GTKH 4OWXB 2KCMA 3M85A 4JI0L 3RN5A 2R7FA 4EQ5A 1I50H 4PG3A 4A3MH 2BH2A 4B3RL 1IBLL 3S15H 4DV3L 4JI4Q 3G6EA 4DV1Q 1K9MC 2ZTCA 4DAYB 4UY8C 3S1MH
chains in the Genus database with same CATH superfamily
5IYDG 1EYCA 4QGUA 2XRSD 1VQEA 2EQSA 4GN4B 1ILPA 2E75C 5HGQA 1I4PA 1PYSB 3G48A 1YHAA 4DUYQ 2HQLA 4R8IA 1X6OA 1CKOA 4POGA 2A8VA 3HOWH 3OOCA 4RGTA 1JCKB 1MSHA 1Q3LA 3JAMi 3HOYH 5EPJA 1TWHB 4CKCA 2VNUD 5IGGA 2RCFA 1B9MA 1H9MA 1DOLA 3LX0A 4GKJL 2QEJC 2A69C 4DXFA 4LFCQ 2CVRA 4H44C 2AQ2B 4K6DA 4YY3L 3M4OH 4A3FB 2NTTA 3OIQA 1RHPA 1HNXL 1CTMA 3C46A 4YHHQ 3DWAA 1PTOC 3K7AH 4IFDH 2H1EA 1K8OA 3W2DA 2ZM6L 3KF6B 4CKEA 1I3QH 1W6KA 2LY7A 1Q12A 4GLAC 4KKUA 2AKWB 2F0LA 3NBHA 3S2HH 4XYQA 4DAPA 3T1YL 4H7BA 2F0TA 2JA6H 4DV6Q 1BUVT 1V8QA 4UAIA 4I65A 4XT3B 3UDIA 3PUWA 4KHPL 4C3IB 4HN7A 4V0BA 1QUQB 5D3IB 1ESFA 1CKNA 4A3DB 1MGSA 2VUMG 3I70A 2PW5A 4JOIA 2JN4A 2IX3A 5FO9B 2JA8B 2JK8A 3ITPA 3PUXA 1YIJA 5M5WH 5DM73 3TP5A 4H0LC 4AYBB 3KFUA 1D5ZC 2AWOA 2EE1A 3DM3A 2F4IA 5DEHA 1LACA 4A3JH 3CRLC 3ERQA 3M7GA 1BOSA 3M4QA 4K14A 4AH6A 5K36G 1A63A 4RH6A 3A5UA 2CHBD 1YHBA 4AIMA 3DEPA 1NR4A 4IUUA 2G9DA 5TSSA 2R93H 4IZ8A 2NZHA 4HSVA 1UE5A 4BBRH 1WCMB 1V1PB 1Q8KA 1Y1VB 3WOEA 1CHQD 1HPCA 1B8AA 5CYUA 5EKIA 1PZJD 1WTOA 2WIIB 2GA4B 3JAML 3CCEA 2O2LD 4TQUS 3KBXA 4FF3A 1CKNB 1WYDA 1DCZA 3HOVH 1GUOA 3KLRA 3FP9A 2RDGA 3OTOQ 3SE0A 3PF4A 4BY1H 5JJLA 5I2XA 2YTVA 2Y0SB 1GXDC 4FVMA 4AYBE 2K5DA 2TSSA 3OMCA 4FF4A 3S16H 4MHEA 2DJGC 1PTOD 3L3OC 2N78A 1PH3A 3TMEA 4C3HB 1H95A 2B63B 4OXPA 4P72A 3E6ZX 4XQJA 1SE4A 1JWSD 3ND9A 1Y8PB 3PO2H 4RHRA 1LABA 4IPCA 3W1GA 3P75A 3J81j 4RWSC 1S5CD 2UXBL 1AH9A 4A3IB 4PMBA 2EJFC 2QKIC 3F2UA 4JI5L 3TEHB 4B3TQ 3Q0AA 1PRTB 2RDHA 4JI2L 1HFNA 1IYJB 4KN7C 3HOUG 3BDLA 5M5XH 4LF4Q 2A6EC 1Y1WH 3D4DA 3PO3H 1PMRA 1W2BA 1JOKA 1BCPD 2VS1A 1Q1EA 1YBYA 2Y0SE 4LUOA 3T16A 1A2TA 2JE6I 2NTSA 1VQ6A 2JA7B 2E76C 1I4XA 2K05A 1TWAH 4OO1I 1J6QA 1FVIA 2B2YC 3M3YH 1PH9A 4A3BH 2KCCA 3OW7A 2IHEA 1EQVA 1KRSA 4UDUC 1HZ9A 2H4OA 3ULJA 1FYCA 1A3UA 2SOBA 2ZT9C 5KYIA 4BXXG 3TS2A 1QZGA 1PH8A 4WJ3M 1E0BA 2VB3X 1EY5A 2UXCL 4ZLTF 4O0AA 3T1HQ 1SLJA 4APVA 4LFAQ 3TS0A 2QDLA 1Z9FA 2MJ8A 5C0XI 1WTQA 1OO9B 4DR6L 4NXML 1XTCD 1UE1A 3I4NB 2R92H 4RKLA 4KK7A 4LMQD 4IUTA 1A3VA 2AQ1B 2J7ZA 5I2YA 1AZQA 1LTTD 2NBFA 5BN5A 4JI3Q 3HOXB 2KBNA 3VYSA 2YV5A 1YHQA 1AE2A 4FF1A 5A2QL 1IL2A 4A3EG 1OXVA 1S5BD 1CI3M 1TWCH 1SE8A 2A6HC 5JPMC 1FJGL 2Q2HA 4K5WA 3A7LA 2OXPA 5KIXA 2BOSA 3J81E 1GUNA 5CC4A 2F0SA 2KJXA 4GOPB 2OT2A 2HIVA 3GP7A 1HNWQ 4DV0Q 1QNKA 1Q1BA 2DNCA 3Q23A 4A3MB 1VS0A 1EUJA 3J81c 1CK1A 1OXUA 1BR9A 3F2BA 2KOLA 3A8JE 5L37A 4C3JB 5BN4A 3CP0A 2PCFB 2RHSB 4DAYA 5EGTA 4IPHA 1HRJA 2V1CC 2MNAA 3S14H 3C1EA 1C0AA 1K28A 2L1BA 4Q5VA 1PFBA 1HZAA 3TP8A 4DV4L 4GKKQ 3K81C 1QVFA 1RIPA 1CT1D 1JB7A 1LT5D 4CDCC 1KABA 2E2IH 4J6HA 5KYLA 4BBSH 5EBCA 1J9OA 1DXMA 1ZKOA 1U4PA 4N8X1 2K5VA 3GV6A 3UI2A 1SNCA 1VQCA 1SNMA 1EFWA 4IURA 5IOCA 3NTHA 2K33A 1ML0D 2EJGC 5AJ3Q 5CV5A 4LF6Q 1FL0A 3S1QB 1SNDA 5C5LA 1G91A 3K57A 2PQAA 1SSOA 2XWBB 3I4MH 3STBD 1AW7A 3CCRA 1I94L 3I56A 1WTPA 3SDZA 1WD1A 1N36L 3CCJA 4JV5L 3WDNA 3T56B 1N33Q 2JSOA 3HOZH 1LTAD 1H9SA 1J5EL 4NKLA 3QOLA 3GTQH 1JB3A 2K52A 1SYEA 1FNUA 2E5LQ 4AQYQ 2OF1A 1HTPA 1NR2A 1UEBA 4IJLA 4DGZA 4CDEC 4HIDA 4M1UB 3QO2A 1TS2A 3V2TA 1HCZA 1VQNA 2JA6B 1X56A 1DYQA 4PMCA 3CRKC 3K8AA 2RDFA 1TT2A 1HZBA 1IW7D 5EKLA 2IX1A 2WKDA 4JI0Q 4IFDI 2UUBL 4X3KA 4B3RQ 3TZDA 5GQOA 2K7VA 3HZXA 5NUCA 2EXZA 2NB0A 4HIMA 4B3SL 3I72A 1VQLA 3J7AF 1O7IA 3AYHB 4A3JB 1TWHH 2PMZB 2XVSA 1ZEQX 1B70B 1SFOB 3JC66 3ZJYC 2UUCL 1EWCA 4DV5L 1XMOQ 1K3BC 2F3WA 2BE5D 2L5TA 1YITA 3CC4A 2VUMB 3K0YA 2F52A 3S1NH 1U9RA 2EY2A 2LS01 4BS9A 1TWGB 1PH6A 2NVXB 2MPMA 4YCWA 1ET9A 4PV1C 4A3FH 1ENFA 1VQ8A 4ZRZA 3H09A 5GAHC 1VF5C 3G6JB 3MWYW 4H02A 1WOCA 2ZJPA 2ICEC 2F0HA 3UE0A 1LV9A 4CDFC 3S16B 5JJIA 3AEVA 2BCOA 2PMZE 1JWMD 1F9RA 4NXNL 3MFGA 1SRUA 4C3IH 2OCEA 1HNZL 2A68D 1QWYA 5DNFA 5IP9G 1PRTD 1V1OA 3CU7A 3GTMB 5JVH3 1PZKD 4A3LG 4A3DH 1EWHA 2WB1G 1IBMQ 1K8AC 1A3TA 1E24A 3CCUA 1WD0A 4FO2A 2X69A 2JQOA 4X3UA 2JA8H 1MHWC 1X65A 4A93G 1BVSA 2MO1A 3U58A 2Z4HA 2RSNA 3PO3B 3CCLA 4X3SA 2CQOA 1EIFA 1B7YB 2F0VA 2AWNA 1VQKA 2MGSA 4QUFA 4ABNA 3RN5A 3V05A 1IBLL 3PQIA 1DM0B 3G6EA 4DV1Q 4JPBW 1D6EC 4RGMA 1K9MC 4NDXA 2GVAA 5KNCA 1WCMH 1A0IA 2CW0D 1Y1VH 2B3GA 2HT1A 1JICA 3E9HA 4ODGA 3H94A 4X66Q 1SN8A 1A6XA 1ICWA 4L8JA 2NUCA 1D7QA 3I7FA 1XNQQ 3HKZG 3GDEA 5FOBB 5KEEA 4L5TA 4TSSA 5K5PA 4YWMA 1XXGA 3L2PA 2QF7A 2RKSA 4PZ6A 2HCIA 5CV8A 1E22A 1STGA 5GROA 4DV7Q 2ENBA 1ENAA 2CWAA 1SDFA 3M4PA 4C3HH 1DZ1A 2B63H 1SMYC 5DM63 4LWCA 1TWCB 1PTOB 2R61A 4OIJA 4A3CG 1DONA 4YWLA 1XNRL 2EVBA 1JT8A 2D5DA 1F9QA 3KBGA 2L0CA 5E4XA 4A3IH 1XWEA 5CV4A 1TS3A 2CCZA 4C1NI 2K4KA 5FKAC 1XX8A 3UDFA 2JJQA 5EPLA 1KLUD 2EXDA 2MP1A 4ZK9B 4XXEA 3SK6A 2RQXA 2F0FA 4U673 1FNWA 1T9HA 4C2MB 4S3SA 2IWHA 1N34L 3SHLA 1SEBD 2F1MA 5IYBG 4A3EB 3ULPA 4R4QA 2JA7H 3S14B 1BCPB 3BZKA 3Q8DA 1X55A 4F8MA 5IT9L 4GLXA 4BY7G 1UE7A 1N9WA 3RNUA 5CMDA 5ELNA 1IYVA 4DR2L 4EGVA 2FFKB 2EYMA 1O78A 4ZKBB 1A8VA 4FF2A 3Q6SA 3OSOA 2RHQB 3TQYA 4A3KG 4ME5A 4ZCKA 3I4NH 1E1TA 2F0PA 2PYKA 4DNTB 1JC7A 4G57A 1K0SA 3HP3A 3NPPA 1P8LA 1YJWA 1YVCA 4NMZA 2OTJA 4F87A 2HHHQ 5GADC 3HOXH 2VQFL 1I50B 1V9PA 1F77A 1M4VA 2VB2X 3F2DA 4GS3A 3EBEA 4LUZA 3A74A 3NTKA 1PH2A 4JG2A 5KRUA 2NN6I 1M8AA 4X62L 5ELCA 3BZDB 3K5MA 2EDGA 1JOOA 2K6AA 1D8LA 1WJJA 2LFNA 2PQEA 1LO5D 4X65L 4IQZA 2I07B 1SMYD 5BR8Q 1C7YA 5FLXc 3X3NA 2KA7A 4LFBL 2B2YA 1G2SA 1M1KC 4QCLA 3T4AC 4BWGB 2YU9B 3J80E 3LWEA 4C3JH 2DUDA 5IGEA 3EVQA 4OWTB 2BH8A 1BO0A 3GTLB 2OEOA 1VCIA 2RSOA 4KD4A 1VQHA 5FLMG 3J81i 3H3VH 3PUVA 1VQIA 3I3CA 5E1FA 1FGUA 1MI2A 1NAPA 4EQPA 3J80c 1PDQA 1TKWB 1C4QA 5JEAJ 1VQ4A 4WJWA 3BS1A 2AHOB 2B2VC 4MTKA 2Q2TA 5C4XG 2N55A 4DR1Q 4KV6A 2UXDL 1BBUA 4JYAL 5CBAE 1X3QA 1TU2B 3MXUA 5KNDA 4LW1A 1HTLD 1R4QB 5IYDH 3NE5B 5JJZA 3DMUA 5E4WC 1MD2D 1OTCA 3IRBA 3S1QH 1U4RA 5GAGC 3S1NB 3FEWX 3TP7A 1K83B 5M3FG 4H13C 3U4ZA 4DUZL 2Q2IA 2F4VQ 1Y69U 1FGBD 2HD3A 4KHVA 1WVLA 2UUAQ 5LL6X 5LMNL 1RTNA 5IP7G 2KCTA 3E0JA 1EYAA 1DD2A 4POFA 4XT1B 4UPAA 5C6AA 1I4QA 2YTYA 1JOQA 1S40A 1WTXA 4DR3Q 1LTGD 4KTAA 1DGSA 1KL9A 1VF7A 2NVTB 4IPGA 4HJAA 4OX9Q 4RGOS 4F88A 3S1RB 1RKNA 4UP8A 3NELA 1I4RA 4LF7L 1NCVA 3K5NA 5C3EG 1NE3A 4GKKL 2ZXOA 1F9PA 1SYFA 1L1OC 4Y52H 1ILQA 3NWSA 2K50A 2R7ZG 3P20A 3Q22A 1T5XD 4DV2L 4UP7A 1SFOH 5CR3A 1IKLA 2F3IA 3J81L 3ERSX 1VQMA 3NBHB 1L2FA 1LTLA 1U0LA 4K0KQ 1UE6A 2WB1B 2VUMH 1PXUA 1TY0A 1E2ZA 4KKTA 4LF9L 1ONLA 1TWFB 2IHFA 1ICFB 1TWGH 2D0OA 2NVXH 3T13A 3R93A 4A93B 2CKZB 1QE6A 2ZTDA 1EZ6A 4JI6Q 5ELDA 5C5MA 1RTOA 3PUZA 3J7YW 3K7UC 2N88A 3MVVA 2A69D 3VR6A 2UU9L 5K36H 2PPBC 2EY6A 2M00A 2JP1A 3L7ZC 3SR1A 1SYGA 3NWTA 1EQRA 2EYFA 1AZPA 1V43A 5JPNC 1QJOA 4WORA 2XGTA 2O4XA 2QW7A 3WOFA 2D62A 4QMGA 4DAVA 1KDCA 4XDXA 1G291 1P16A 1KRTA 2WB1E 4JI1Q 3KDFA 3GTMH 4DR7L 1NUCA 3I91A 3HKZB 4KJNA 3CQZB 5IWAQ 4XIGS 2F03A 5IY0A 4LF5L 3C1FA 4X64Q 4J1MA 4JC0A 4RMFA 4B3MQ 1NY4A 1BF4A 4JI8Q 4DKAC 4GNXC 1STBA 1T5EA 1BBWA 1LT6D 1IBKQ 4P2CB 2B2WC 1KLGD 3IL8A 4JI7L 3BVGA 3EN2A 3I90A 1CQFA 2YYZA 3NSWA 2DJFC 1XMQQ 5I6WA 5JEAG 1EY4A 4OL7A 1IYUA 1MSGA 1KDAA 4IOAA 1OXTA 1QB5D 1D5XC 4DV3Q 3HKZE 4ME3A 4YCVA 1PV4A 1V1QA 3K5OA 3DM1A 1GUWA 1KHIA 2L12A 1LTID 5CV7A 1X3FA 5HGTA 1STAA 2QILA 5M9OA 1E2VA 1CFMA 3E5SA 1HQRD 4G4KA 3KLSX 4R4OA 4BY7B 1I6HB 4DR5L 4OWWB 3GQBA 5C3WA 3BZCA 2F0WA 5EJWA 3RMHA 2IPKD 3R8BA 2Z8LA 1PTOH 1WTVA 3D6WA 1D5MC 4N9TA 4A3KB 1VQ5A 4GKJQ 4I7AA 1JE5A 1K0RA 3BDCA 4HTHA 3DWQA 1Z7TA 4YIJA 5LMUL 2C35B 4A3GG 3E9IA 5FK9C 4V190 1WFQA 2QDBA 4YY3Q 2SNMA 5BN3A 1EYGA 1GUSA 1HNXQ 5JOBA 4DN4M 1HQMC 3KLWA 4KI0A 4C2MH 5HURA 2ZM6Q 3BYYB 4JVZA 4A3EH 1JMCA 4QL5A 2CH4W 2C9OA 3OHXC 2R6GA 4QF4A 4ZUJA 1B1ZA 2A1AA 5C3XA 1II3A 1KQSA 2F0JA 4DR4Q 2A6ED 4FXGC 1ASYA 1XPUA 4IPDA 3T1YQ 1X9NA 2KQ3A 5ELBA 2NN6G 4JCVE 2LXKA 4X6AH 2EOTA 3UDGA 4EQNA 3TBIB 4N8FA 4KHPQ 2HDMA 4C1NK 4BA2I 1BXTA 3AFQA 4GZYC 3QJYA 3SK4A 2F0KA 2KHIA 2X6GA 2L11A 2ICIA 3H3VI 3J7A5 5ELEA 1B50A 2B29A 1Q90A 1RODA 4K5XA 3M85A 2EJMA 1I50H 4K8IA 5C4XB 5CORA 5LL6S 5I6YA 4F7XA 1KNEA 1F2LA 2ZTCA 4DAYB 2KEDA 1I6VC 1ZYRC 4RCNA 5COYA 1YNXA 2NVYB 4DPGA 2BDOA 1HR0L 3NXWA 1Q8IA 1B3AA 1VQ7A 2CQAA 1ASZA 4NP5A 3SEBA 5M3MG 1KIXA 5T1IA 2A6HD 3H91A 1GM5A 1N32L 5M3FB 4E6IA 4A76A 2YU9H 1PZID 2VQEL 2GVBA 1SE2A 2I5MX 1MJEA 3GTLH 1E1OA 2K5HA 3N6RA 3HRZC 1WTWA 1PH4A 3LGJA 2PQAB 2XRQD 3KOJA 4N9PA 2VXWA 2EYOA 3D31A 1AN8A 5C4HA 2ZTEA 5EBDA 1EY8A 2CWPA 1NSNS 4O1NA 3P1HA 1H9SB 3J80i 3URYA 1GUTA 2EY5A 1EIHA 1CSPA 1QVCA 3D8GA 1TQOA 5C44G 3NHHA 1DOMA 3U4VA 4HJ8A 2F0EA 4TKOB 2UXBQ 3PMFA 4UP9A 4R4TA 4OGQC 2HUGA 4JI5Q 5FJ8G 1MKHA 4JI2Q 2E2HB 4GLVB 3DUZA 5C3EB 4L5QA 1B53A 1QNUA 1K83H 2O5JC 1SNPA 3CKIB 1R9TB 5A2QE 2R7ZB 2EYPA 1AP0A 2LSSA 2F0OA 3P7JA 5DLQE 3D6CA 2JXMB 4PZ7A 4TRDA 2Q2UA 3RZOH 2MUYA 1S5DD 4IJHA 1NNXA 2F0UA 3CMEA 1GD7A 3BYTB 3K0XA 4LF8L 5EAYA 2UXCQ 1S3OA 1ZYRD 3TREA 1W3SA 5IYCG 2B2VA 4CJ2C 1EY6A 2I46A 1QCBD 4JI4L 2NVTH 4DR6Q 2WKCA 2WACA 4NXMQ 3GTKB 2J0TD 4HAEA 5J22A 3S1RH 3S15B 5IGCA 4GOPC 1XPOA 1EQQA 3EROA 2I0QA 2ZJQA 2FHTA 3A55A 3A5ZB 3PCOB 4DUYL 1O7ZA 4G7ZC 3S1MB 4J15A 2K28A 5I4DA 4XTCS 3CMAA 2ASBA 2PZTA 1K3RA 1EEID 1WTRA 2IX0A 2PW7A 3FKIG 1TY2A 4A75A 5FLXL 2H5XA 3R2IA 1FJGQ 3ER0A 1S5FD 2LKVA 3TZUA 3TRZA 1HZCA 5IP9H 1VMPA 1WTHA 3GTPB 3T53B 4A3LH 1JWUD 4LFCL 1TWFH 1YNJC 1D1IA 3HOUB 4JW0A 1YZ6A 2SEBD 2F4VL 4RFBA 4A93H 4IFDJ 3D4RA 3J80L 2Z9HA 2NZOA 4YHHL 2JA5G 1U4LA 3QOJA 3W5OA 3KJPA 1YNNC 3A8KE 3CXCA 2XTIA 1BBXC 3PUYA 1I5FA 4PNYA 2K5NA 3ND8A 4DV4Q 1EYDA 1PRTF 2L9HA 1EU3A 1EOVA 4IUNA 2GN5A 3AQQA 4DV6L 3MEHA 1L1OA 1VQBA 4OO1G 1NTGA 3NQIA 3FRPB 1CZWA 5G3LF 3MXNA 2HIXA 2K5QA 1JJGA 4ID6A 1A2UA 3CQZH 3G71A 2XIWA 3RD4A 3H0GG 4RA8A 1I94Q 2RA4A 4EX5A 4LNQA 4J8QA 1S72A 5C0XG 4MNOA 1N36Q 1SYBA 4JV5Q 1X3GA 3VA5A 4MN3A 1HH2P 4R1JA 1J5EQ 3F1ZA 2AUJD 4DNIA 3Q24A 3NP8A 1LM0A 3BDOA 4A3CH 1U4MA 3V96A 4RHSA 3MC0B 1EFID 1LTSD 1YJNA 2HQEA 3QWNA 1IXRA 3NUCA 3VR3A 1SYCA 2K03A 1L1OB 3F2CA 4A3GB 4ALPA 1I4GA 4G7OC 5H1SE 1KDBA 4IUVA 3OW2A 4R8NA 2UUBQ 2J4XA 5FO8B 2FINB 2OQKA 5IYBH 5AFWA 5EQ0A 3OTOL 4IOCA 2VY3A 3S24A 3T51B 4R4IA 1MIUA 2KENA 4B3SQ 2ZJRA 2D0PA 3BJUA 3PIO3 4BY7H 1I6HH 3N52A 4IN3A 1VQDA 4CGYB 4B9XA 4FXKC 2WAQG 1C48A 2A5HA 2V4DA 1EL0A 4GNXA 1LLRD 3R3OA 5D3DA 3CCSA 2B8GA 3EIVA 1RF2D 1UNSA 2K01A 2KECA 2UUCQ 2B2WA 3OYYA 4DV5Q 1MJCA 3QIAA 3U9OA 4A3KH 4TVAB 4ZYSA 2AUKA 1VMCA 2PNHA 4B3TL 4JK1C 4A3MG 3OWEB 1STYA 1PHJA 3L9AX 1CQVA 4LF4L 3PIOA 5KGUA 1E7ZA 3D3RA 3ZYYX 3OPOA 4DFAA 1F9SA 3K6OA 1C9OA 4DK0A 5KNBA 1Q86C 3MAQA 2ID0A 2EZVA 4RG1A 3FDTA 3PSIA 1H9RA 1RCVD 3MTSA 3CAMA 3RUZA 3SGIA 2CFMA 1VQGA 1GHKA 1UAPA 3EFXD 2M9VA 4HMJA 2WV6D 3KUPA 4U68A 4ZQ3A 3TN2A 1D2BA 1D1KA 2M2LA 3HGBA 4KY6A 3HOWG 1EQTA 1HFGA 1Y14B 5D14A 1PYWD 2F0DA 3HOYG 1RDPD 3T1HL 4NXNQ 3VA7A 5M3MB 4GNXB 3ICEA 1HNZQ 2I5LX 2E2JB 3S2DB 4LFAL 1KD1C 4KHZA 3B6YA 4DK6C 1O80A 2EYHA 1JJCB 1DJRD 5J39A 3KF6A 3AFPA 5FLMH 1PH5A 3G4SA 1OXXK 4FNFA 1HHVA 1QG7A 3LNNA 1QVGA 1GVPA 5IGBA 3EQLC 2KHSA 4JI3L 2F3VA 3FVQA 4FP5D 2B2UC 5C4XH 4P73A 4IFDG 2KCNA 4Q0FA 1SYDA 3MEFA 1VDZA 2Z1CA 5C4JB 5GAEC 1PFSA 1QUQA 2K04A 5J1ZA 2EYLA 1G6PA 1HXYD 4XYOA 5C44B 1IBLQ 2NVYH 2NVQB 3CF5A 5J3BA 3RZOB 1VQFA 2RF4A 4KY5A 1N8RC 2JA6G 4O42A 3I4LA 1HNWL 3KLSA 4DV0L 1EU4A 4JBWA 4C56C 4YWKA 3MXGA 1XJVA 3X3MA 3ONAB 4ZAIA 4HJ9A 5M3FH 5IGFA 4L63B 4XQQA 2C5CA 2TMPA 1JORA 2Q8RE 3I73A 2PO4A 2B2TC 3IFDA 3A54A 4L5SA 4QIWB 1L0WA 1TS4A 4DR4L 1SNOA 5IP7H 2HCCA 3DEOA 5IGDA 1EIGA 3D4WA 3VYUA 3MXPA 5IT9E 3PGZA 2JYOA 4QUCA 3I55A 1IZ6A 1V1PA 4A3JG 2L4NA 1LT3D 2O5IC 1CSQA 2DN8A 1KAWA 4CDDC 1EY7A 5IT9c 4EQOA 1GO3E 4OIKA 1VQOA 1A62A 4GN5A 1XNRQ 2Q8IB 3RZDB 2EIFA 4K2KA 2R93G 3L0OA 1BCPC 2XSCA 5AJ3L 4BBRG 4LF6L 1E2WA 1X32A 3K5LA 2K14A 2WFWA 3QG1A 4R9WA 4B08A 5HY6A 2E2HH 2PNRC 5C3EH 1X3EA 1H9KA 1E3PA 4GN3B 4RKBA 4HEDA 1X54A 2Z6KA 2F0IA 1R9TH 1N33L 1N34Q 1W6JA 4QIWE 2R7ZH 1SROA 3HOVG 2LMCB 3FKIB 1CZGA 1EWIA 4BY1G 2E5LL 4FYDA 3K58A 4AQYL 5ISRA 4CBVA 4LUVA 3J7AV 1IKMA 4O2DA 1AE3A 2AMCB 4Y7NH 2VZAA 2N3SA 3GO5A 4DR2Q 3EJIA 2L55A 1QILA 1Q81C 3GTJB 3QR8A 3PO2G 1STNA 3S9WA 3E0EA 4PQXA 4MZ9A 4WFN3 1BNZA 4KD3A 4MTNA 4HSPA 2IJ0A 3GTKH 2JA5B 4JI0L 2BH2A 2R7FA 4EQ5A 1JE4A 4B3RL 5CV9A 3S15H 2EY1A 5ELFA 3SK5A 4KMUC 3IKJA 1RD9D 4UY8C 4OEMB 3S1MH 1Y1WG 3PO3G 2VQFQ 2ES2A 4P71A 1G8ZD 3ULLA 2K75A 5C4ZA 3HEJA 2MO0A 3DWPA 3SK8A 4X62Q 2BDNA 3S17B 3OMGA 5LMNW 4A3BG 4QJFA 2I5HA 1STHA 1XMOL 4HR7B 4X65Q 3GTPH 2E74C 4LFBQ 1LTBD 2CH4A 5JAVA 3A8IE 3H0GB 2K1BA 3HOUH 1YI2A 2XN9C 1H9JA 5CGKA 4JBKA 3BG3A 1SE3A 1XPRA 2JEBI 3GTOH 1PTOF 3KDFB 2R92G 4CHTB 1SJHD 4DXGA 2KVMA 1O7YA 1PH1A 4K6LA 3CPFA 4DK1A 1KTKA 2G5DA 4GOPA 1EEFD 5JEAH 2UXDQ 1UWVA 4BXXH 3KJOA 4JYAQ 1GKHA 4NB3A 4K2LA 2BA0A 3STBC 1OXSC 1SXTA 1B2TA 1EZ8A 3TP6A 4LJZC 1G51A 3GTGB 1IBML 3IAYA 1BCPF 1A15A 3CC2A 3KK7A 3BVZA 3H15A 1NJIC 3EA6A 3R2TA 5A35A 4RCOA 2SNSA 4DUZQ 3MA2B 2D9UA 3HG9A 4FXDA 2WAQB 5LMNQ 2DY8A 1F2ZA 1PFNA 4L5RC 4QQBX 1IW7C 1KC8C 4DF7A 4DV1L 2EPBA 4BBSG 1L0YB 4HIKA 4OONA 3GD7A 4HCSA 3UE1A 4A3GH 3I2ZA 2F0GA 1EIYB 4BA1I 4X66L 1BDOA 1EY0A 2LXJA 3VR2A 2PI2A 1PFMA 3NEMA 4DU9A 3JAME 4ULLA 4XQNA 1F2YA 2JEAI 1XNQL 2HDLA 2VW9A 3CC7A 1TXYA 4LF7Q 2R7DA 3I4MG 3JAMc 1Q46A 4DV7L 3AB9A 2NYZD 1LUZA 4IUQA 3HOWB 2NN6H 3HOZG 4DNRB 2BE5C 1CUKA 1JR0D 2WAQE 5IE8A 1XYIA 3C2PA 5M5YH 3HOYB 3K80C 4R4CA 3W3AA 2OWOA 3A7AB 3LWUA 4HJ5A 4DV2Q 3BU2A 3NK9A 4DK3C 4JOIC 5I9PA 2A19A 1G6ZA 1F2MA 2K5WA 1GOZA 2PZWA 4MIUA 3RLFA 2Z4IA 4B9WA 1NBWA 1CA5A 3PF5A 5CBEE 2KHJA 4LF9Q 4IO9A 2BA1A 1Q82C 2Z6KC 5C0XJ 1O7LA 3M4OB 4KKSA 2F0QA 1TS5A 2N49A 2P5ZX 3TDQA 4NW2A 5EPKA 2F0MA 3K7AB 3RLNA 1UEAB 3M4YA 3D0FA 4PZ8A 3GV3A 3NENA 1I3QB 4L6TB 2UU9Q 1SJED 2A68C 3IFTA 1Y8NB 2L15A 1PRTC 3A0JA 3S2HB 3CCVA 3MFYA 1J8IA 1TVXA 4ZUIA 2WINB 4QB4A 1SMXA 3SXHA 3H6MA 4K8JA 5M3MH 1VQAA 2XWJB 2Z6BA 5DAUA 2E2JH 2IW3A 3S2DH 4HJ7A 3CCMA 4DR7Q 1LT4D 1S5ED 3C3LA 1EY9A 4LF5Q 2OQ0A 1BQQT 3U9SA 1MBYA 2PI2E 2NWGA 2QA4A 2K32A 5E3FA 4A3FG 2IL8A 3HKSA 1TIID 5M5WB 2HHHL 1Q7YC 1JJ2A 1ZXTA 1PYBA 1Z47A 3NTIA 2CW0C 5C4JH 1QZHA 4UHVA 2IY5B 4JI7Q 4HCEA 2WP8J 4CKBA 5C44H 4DAMA 4FDBA 2IT1A 2NVQH 1LTRD 1Z6HA 3CCQA 2R93B 3HS0C 3VYTA 3RLOA 1DOKA 2FXQA 4BBRB 5BR8L 1VQJA 5FJ8H 1NMGA 2MQHA 3DHQA 1STEA 4Y7NB 2N8NA 4C3IG 1VQPA 3CW2C 1FNVA 2YTXA 1WI5A 1PH7A 4A3DG 2XNAC 5I9OA 3HOVB 4KY7A 3BVMA 4BY1B 4EVOA 1CKMA 3RR5A 2JA8G 5CV6A 3W1BA 3CPWA 2ATWA 3K59A 2MHVA 4AYBG 2NZ1D 2A73B 1IL8A 4RAUC 1CM9A 2RBMA 1HA5A 4DR5Q 4DR1L 3QB3A 3M9BA 2VL6A 1K8MA 2PZUA 1SBBB 2OTLA 4KLKA 1SR3A 5IODA 2B2UA 5IYCH 3PO2B 1IHZA 3M7NA 3H3VC 1AFPA 1HJPA 3RZDH 1NMFA 1ESRA 4RGNA 1HR0W 1WCMG 4G7HC 3U50C 1Y1VG 5LMUQ 1EOTA 2AQ3B 5M5XB 2MFIA 4PMWA 1C8CA 1HUNA 3VR4A 1YJ9A 1KAAA 3MZ5A 1Y1WB 5G3LD 3CD6A 1AEXA 4JBJA 1PVOA 1B44D 3AMUA 2UUAL 3GTOB 3FKIH 2JA9A 2QEXA 5JJKA 4OELB 1QOHA 2Y0SG 1TWAB 2FJ2A 4I7ZC 3M3YB 2B2TA 3VR5A 4A3BB 3A56A 4ZKCB 1HUMA 2Z0SA 4C3HG 2B63G 4A4IA 3J7ZC 1GJXA 4OHJA 1K73C 3KYHC 3PV0A 1Y8OB 3CHBD 4IALA 3GTJH 1SNQA 5IIFA 4DR3L 3FPPA 4OX9L 3FHWA 2E2DC 4M8AA 4HIOA 2JA5H 3NBIA 1R4PB 2R92B 4A3IG 4DA2A 2DGYA 4CJ0B 2SDFA 2KUMA 4P75A 1GUGA 1ET6A 1L0XB 4YCUA 1X3PA 2QCPX 3KF8A 2X6LA 2EYJA 1BKBA 1U5KA 3TSSA 3MHBA 2JA7G 2Q8TA 1LYLA 3HFZB 5T1GA 4OO1H 3S17H 3RN2A 4LAAA 1JQYD 1HR0Q 2ZXPA 2F0NA 4QY7A 4K0KL 3NQTA 3O13A 3H0GH 2QGQA 2FMMA 1N32Q 2ZXRA 5C0XH 1PA6A 2VQEQ 1VQ9A 5ELOA 1K8GA 4WRDA 4JI6L 2B8FA 3I4NG 3FPUB 3MXNB 1PLFA 3F8TA 1TR5A 5LHY1 1B4OA 1KXLA 1YNJD 5E7NA 1RJTA 3I4OA 4NPSA 3HOXG 3SVMA 3DLLA 3I8ZA 1I4HA 2RCNA 3KF8B 5F2DA 1B9NA 1SAPA 4BBSB 2E2IB 3OIPA 2G9HD 1FR3A 4JBMA 2R3ZA 4LK1C 2FMCA 1RL2A 5M5YB 1CHPD 1YNND 4K5VA 4KJOA 3PIP3 1UUPA 4JI1L 1M90C 2D2CC 4P74A 2DY7A 1S4ZA 3GTGH 2ALYB 3FMCA 5D65A 5EKKA 5JVG3 4X3TA 2E8GA 5IWAL 2RVLA 2A74C 4X64L 4KN4C 3I4MB 4B3ML 4JI8L 3VYRA 4C3JG 1IBKL 3HOZB 1KNAA 3OWFA 3VDYA 3PIPA 2B39A 3GTQB 3UDXA 1YEZA 5FLXE 3AU7A 4IUPA 1HA6A 3G7LA 4Z9CB 3WWVA 4CJ1B 2DNEA 1XMQL 4WJ4A 3DXJC 4ILWA 4HMIA 1XTDA 4LF8Q 5FO7B 4OWXB 2KCMA 1FD7D 2KEEA 4A3MH 4PG3A 1B3QA 1ENCA 1CA6A 4DV3L 1G2TA 4JI4Q 3E3XA 1GHJA
chains in the Genus database with same CATH topology
1WCMH 1Y1WG 1A0IA 3PO3G 1Y1VH 5IYDG 2B3GA 4QGUA 2VQFQ 2ES2A 2HT1A 1VQEA 1YNXA 2EQSA 4P71A 4GN4B 3E9HA 4DPGA 3ULLA 1HR0L 2K75A 4X66Q 1SN8A 5HGQA 1PYSB 3G48A 1YHAA 2MO0A 2HQLA 4X62Q 3I7FA 4DUYQ 1D7QA 1X6OA 1VQ7A 1XNQQ 1CKOA 3HKZG 3GDEA 1ASZA 4POGA 4L5TA 2A8VA 5M3MG 1KIXA 3HOWH 5LMNW 4A3BG 4YWMA 4QJFA 2I5HA 3L2PA 1XMOL 1GM5A 1N32L 4PZ6A 4A76A 4X65Q 3JAMi 3GTPH 2YU9H 1E22A 3HOYH 2VQEL 5GROA 4DV7Q 2VNUD 2GVBA 4LFBQ 2I5MX 1MJEA 2CWAA 3GTLH 3M4PA 4C3HH 1E1OA 2K5HA 2B63H 3HOUH 1YI2A 1PH4A 3LGJA 4JBKA 4GKJL 2PQAB 3KOJA 4LWCA 1XPRA 2JEBI 3GTOH 2R92G 3KDFB 4LFCQ 1ASYA 3D31A 4A3CG 4YWLA 2ZTEA 1XNRL 1PH1A 1JT8A 4YY3L 3M4OH 2CWPA 3J80i 3CPFA 1HNXL 4A3IH 4YHHQ 1CSPA 1QVCA 3K7AH 5C44G 2CCZA 4GOPA 2K4KA 2ZM6L 3U4VA 4HJ8A 3UDFA 3KF6B 2JJQA 1I3QH 2UXDQ 1UWVA 2EXDA 2UXBQ 4UP9A 4R4TA 4BXXH 3KJOA 4JYAQ 1Q12A 1GKHA 4GLAC 4NB3A 2AKWB 4JI5Q 1T9HA 5FJ8G 1MKHA 2BA0A 3STBC 4JI2Q 1N34L 1OXSC 3T1YL 3S2HH 5IYBG 4GLVB 4L5QA 2JA6H 1G51A 3ULPA 1K83H 4R4QA 4DV6Q 2JA7H 3UDIA 1IBML 3PUWA 4KHPL 3Q8DA 3BZKA 3CC2A 3H15A 1X55A 1NJIC 1QUQB 4GLXA 4BY7G 2LSSA 5DLQE 1UE7A 1N9WA 3RNUA 1CKNA 5ELNA 4DR2L 4DUZQ 4PZ7A 2VUMG 2Q2UA 3RZOH 4JOIA 4IJHA 1A8VA 3CMEA 1GD7A 3K0XA 2JK8A 4LF8L 2RHQB 3TQYA 4A3KG 5LMNQ 5EAYA 2UXCQ 1S3OA 3PUXA 1YIJA 3I4NH 5M5WH 1E1TA 3TREA 1W3SA 3KFUA 5IYCG 4L5RC 2AWOA 4QQBX 3DM3A 1KC8C 4JI4L 4A3JH 4DV1L 2NVTH 4BBSG 4DR6Q 3M4QA 4NXMQ 1A63A 4AH6A 1P8LA 4HIKA 1YVCA 4OONA 1YJWA 2OTJA 5K36G 3A5UA 2HHHQ 5GADC 3HOXH 2VQFL 1YHBA 3GD7A 3S1RH 1V9PA 3UE1A 4A3GH 3I2ZA 4GS3A 3EBEA 4LUZA 3A74A 4AIMA 3F2DA 4GOPC 4JG2A 1XPOA 1PH2A 4BA1I 2NN6I 4X66L 1EQQA 2I0QA 2ZJQA 2R93H 2LXJA 2NZHA 2PI2A 3A5ZB 3NEMA 1UE5A 3PCOB 4BBRH 4X62L 4DUYL 2JEAI 4J15A 1Q8KA 1XNQL 1B8AA 2GVAA 2VW9A 4XTCS 3CMAA 1D8LA 1WJJA 2ASBA 3CC7A 1K3RA 1TXYA 4LF7Q 2IX0A 3FKIG 4X65L 2R7DA 3I4MG 3JAMc 3CCEA 1Q46A 4TQUS 5BR8Q 4DV7L 1C7YA 4A75A 5FLXc 2H5XA 1FJGQ 4LFBL 1CKNB 3ER0A 1WYDA 3HOVH 1LUZA 3TRZA 4WJ3M 1HZCA 3HOZG 3FP9A 1CUKA 5IP9H 3OTOQ 1M1KC 3PF4A 2WAQE 5IE8A 4BY1H 5M5YH 5JJLA 2YTVA 3K80C 4R4CA 4A3LH 4AYBE 2OWOA 4C3JH 2DUDA 4HJ5A 4DV2Q 3S16H 4OWTB 3BU2A 2BH8A 4LFCL 4DK3C 4JOIC 1TWFH 2A19A 2N78A 1VCIA 5FLMG 3J81i 1VQHA 1PH3A 3H3VH 1H95A 3PUVA 1VQIA 4OXPA 1YZ6A 4P72A 2F4VL 4A93H 1FGUA 3RLFA 4IFDJ 3J80c 1NBWA 2NZOA 4YHHL 2JA5G 5JEAJ 1VQ4A 3PF5A 3PO2H 2KHJA 4LF9Q 2AHOB 4IPCA 4IO9A 2BA1A 3W1GA 3J81j 1Q82C 2Q2TA 5C4XG 3W5OA 2Z6KC 4A3GG 5C0XJ 3KJPA 3CXCA 4DR1Q 2XTIA 2UXDL 1BBUA 2UXBL 2N49A 3PUYA 1I5FA 4JYAL 1AH9A 2K5NA 4DV4Q 4JI5L 3TEHB 4B3TQ 4JI2L 3RLNA 1IYJB 3HOUG 4LW1A 3D0FA 5M5XH 4LF4Q 4PZ8A 1EOVA 3NENA 2GN5A 3AQQA 2UU9Q 1Y1WH 4DV6L 3PO3H 5IYDH 2L15A 1L1OA 1W2BA 1OTCA 3IRBA 3S1QH 3A0JA 1VQBA 4OO1G 5GAGC 1NTGA 2VS1A 3CCVA 1Q1EA 1YBYA 2Y0SE 4LUOA 2JE6I 5M3FG 2HIXA 1VQ6A 1JJGA 1SMXA 3U4ZA 4DUZL 2Q2IA 2F4VQ 1TWAH 5M3MH 4OO1I 1J6QA 1FVIA 3CQZH 3M3YH 1VQAA 3G71A 1PH9A 4A3BH 2IHEA 2E2JH 3S2DH 1KRSA 2UUAQ 1HZ9A 3H0GG 3ULJA 4HJ7A 4BXXG 3CCMA 1I94Q 3TS2A 4EX5A 1QZGA 1PH8A 4LNQA 4DR7Q 5LMNL 1S72A 2UXCL 5C0XG 4O0AA 3T1HQ 4MNOA 1N36Q 4JV5Q 5IP7G 2KCTA 1X3GA 1SLJA 4APVA 1HH2P 4LFAQ 3TS0A 4R1JA 2OQ0A 1J5EQ 4LF5Q 1Z9FA 2PI2E 3F1ZA 5C0XI 4DNIA 4DR6L 4POFA 2QA4A 4UPAA 4NXML 4DR4Q 1UE1A 1LM0A 2YTYA 4A3FG 3HKSA 2HHHL 2R92H 1Q7YC 1JJ2A 4A3CH 1S40A 1PYBA 1Z47A 4DR3Q 1DGSA 1KL9A 5C4JH 1QZHA 1YJNA 2IY5B 4JI7Q 4IPGA 4HJAA 4OX9Q 1IXRA 4JI3Q 2KBNA 2WP8J 2YV5A 5C44H 1L1OB 1YHQA 3F2CA 4DAMA 4FDBA 2IT1A 1AE2A 4UP8A 4ALPA 3NELA 2NVQH 4LF7L 1IL2A 5H1SE 3CCQA 3OW2A 4A3EG 5C3EG 1NE3A 1OXVA 4GKKL 3RLOA 2FXQA 5BR8L 1TWCH 1SE8A 1VQJA 5FJ8H 1NMGA 1FJGL 2Q2HA 2MQHA 1L1OC 2UUBQ 4Y52H 2OQKA 2N8NA 5IYBH 2K50A 1VQPA 3OTOL 2R7ZG 4IOCA 2VY3A 3S24A 3CW2C 4GOPB 2YTXA 1WI5A 2HIVA 1PH7A 4R4IA 1MIUA 1HNWQ 4DV0Q 4DV2L 4UP7A 2KENA 4B3SQ 4A3DG 1SFOH 1Q1BA 2F3IA 2ZJRA 2D0PA 3BJUA 1VS0A 1EUJA 3ERSX 3J81c 4BY7H 1VQMA 1I6HH 1VQDA 1L2FA 1CKMA 1OXUA 3NBHB 3RR5A 2JA8G 1LTLA 1U0LA 3F2BA 4K0KQ 1UE6A 3W1BA 2WAQG 2VUMH 1VQ8A 3CPWA 2ATWA 4GNXA 3CCSA 3EIVA 4LF9L 3CP0A 4AYBG 2UUCQ 2IHFA 2RHSB 3OYYA 4DV5Q 4IPHA 1MJCA 2V1CC 2MNAA 1TWGH 2D0OA 4DR1L 4DR5Q 4A3KH 2NVXH 4TVAB 3M9BA 2CKZB 3S14H 1C0AA 2ZTDA 2VL6A 1HZAA 4JI6Q 4DV4L 2PNHA 2OTLA 4KLKA 1SR3A 5IYCH 4B3TL 4GKKQ 3K81C 3PUZA 4A3MG 1QVFA 1RIPA 3K7UC 1PHJA 1JB7A 3M7NA 2E2IH 4LF4L 1HJPA 3PIOA 4BBSH 1E7ZA 3RZDH 2UU9L 1NMFA 1C9OA 1Q86C 1HR0W 1WCMG 2K5VA 2ID0A 3U50C 1VQCA 1Y1VG 3L7ZC 5LMUQ 4RG1A 1EFWA 3PSIA 1EQRA 2MFIA 4PMWA 3CAMA 3SGIA 1YJ9A 2CFMA 1V43A 1VQGA 2XGTA 5AJ3Q 4LF6Q 3CD6A 1FL0A 2D62A 4JBJA 1PVOA 1G291 1P16A 2UUAL 3HOWG 3FKIH 2JA9A 2PQAA 2QEXA 1Y14B 3I4MH 1KRTA 5JJKA 2WB1E 3STBD 4JI1Q 3CCRA 1I94L 3KDFA 3I56A 3GTMH 4DR7L 3HOYG 3T1HL 2Y0SG 1N36L 3CCJA 4JV5L 4NXNQ 4GNXB 3ICEA 1N33Q 5IWAQ 1HNZQ 4XIGS 2I5LX 3HOZH 4LFAL 5IY0A 1J5EL 1KD1C 4X64Q 4LF5L 4KHZA 3GTQH 2Z0SA 3B6YA 4DK6C 2K52A 4JC0A 4A4IA 2B63G 2E5LQ 3J7ZC 4RMFA 4B3MQ 1NY4A 4JI8Q 1JJCB 4DKAC 3KF6A 4AQYQ 3KYHC 1K73C 3PV0A 4GNXC 3GTJH 3AFPA 1BBWA 5FLMH 1IBKQ 1UEBA 4DR3L 4IJLA 3G4SA 1PH5A 4HIDA 1OXXK 4JI7L 1QVGA 1GVPA 4OX9L 3FHWA 3EN2A 1VQNA 4JI3L 4HIOA 2JA5H 2YYZA 4A3IG 1X56A 5C4XH 4P73A 4IFDG 1XMQQ 2DGYA 3MEFA 3K8AA 4P75A 5JEAG 1HZBA 5GAEC 2IX1A 1PFSA 1QUQA 4YCUA 1G6PA 4JI0Q 4IFDI 2UUBL 4B3RQ 4IOAA 1OXTA 1IBLQ 2NVYH 4DV3Q 3CF5A 5J3BA 1VQFA 2RF4A 1N8RC 5GQOA 3HKZE 1BKBA 2JA6G 4ME3A 1U5KA 4YCVA 1PV4A 1HNWL 1V1QA 2JA7G 4DV0L 1LYLA 4HIMA 4B3SL 3HFZB 4JBWA 1VQLA 4YWKA 1KHIA 3S17H 3RN2A 1XJVA 1X3FA 1HR0Q 4HJ9A 1O7IA 5M3FH 3AYHB 4QY7A 4K0KL 1TWHH 1B70B 3JC66 3ZJYC 3H0GH 2UUCL 4DV5L 2QGQA 4L5SA 4R4OA 1XMOQ 4DR5L 1N32Q 1L0WA 4OWWB 1PA6A 2VQEQ 1VQ9A 4DR4L 3BZCA 5ELOA 5IP7H 1YITA 1K8GA 1EIYB 3CC4A 4JI6L 2F52A 3I4NG 3MXNB 3S1NH 3PGZA 3F8TA 3I55A 1IZ6A 1PH6A 4A3JG 1VQ5A 4YCWA 1KXLA 4GKJQ 1CSQA 4A3FH 5E7NA 3I4OA 1KAWA 1JE5A 1K0RA 4NPSA 3HOXG 5LMUL 5IT9c 1GO3E 2C35B 5GAHC 3E9IA 3DLLA 1VQOA 1A62A 2RCNA 3KF8B 4H02A 4GN5A 1XNRQ 1WFQA 1WOCA 4YY3Q 2EIFA 2R93G 2ZJPA 3L0OA 4JBMA 1EYGA 5AJ3L 4LF6L 1RL2A 4BBRG 1HNXQ 2K14A 3KLWA 4KI0A 2WFWA 3UE0A 4C2MH 5HY6A 2ZM6Q 2E2HH 4A3EH 5C3EH 1JMCA 4QL5A 1X3EA 3AEVA 5JJIA 2PMZE 2R6GA 4JI1L 1M90C 4P74A 1E3PA 2A1AA 4GN3B 3GTGH 4NXNL 2ALYB 1X54A 1KQSA 2Z6KA 1SRUA 1R9TH 1N33L 4C3IH 2OCEA 2E8GA 4QIWE 5IWAL 4IPDA 1N34Q 3T1YQ 1HNZL 1SROA 1XPUA 1X9NA 2R7ZH 4X64L 2NN6G 3HOVG 4JCVE 2LXKA 5IP9G 4X6AH 1EWIA 4BY1G 3UDGA 2E5LL 4B3ML 4JI8L 4A3LG 4AQYL 4A3DH 2WB1G 1IBMQ 1K8AC 4KHPQ 1E24A 1IBKL 3CCUA 4BA2I 4LUVA 3AFQA 3VDYA 3PIPA 2JQOA 3UDXA 1YEZA 2JA8H 4O2DA 1AE3A 1X65A 2KHIA 2AMCB 4Y7NH 1BVSA 4A93G 2MO1A 2N3SA 2VZAA 3GO5A 4DR2Q 3U58A 1Q81C 3CCLA 3WWVA 3PO2G 3H3VI 1XMQL 3J7A5 4WJ4A 3E0EA 2CQOA 1EIFA 4MZ9A 1B7YB 1XTDA 4LF8Q 2AWNA 2B29A 4MTNA 1VQKA 3GTKH 4OWXB 2KCMA 3M85A 4JI0L 3RN5A 2R7FA 4EQ5A 1I50H 4PG3A 4A3MH 2BH2A 4B3RL 1IBLL 3S15H 4DV3L 4JI4Q 3G6EA 4DV1Q 1K9MC 2ZTCA 4DAYB 4UY8C 3S1MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM H;  1Y1W G;  1A0I A;  3PO3 G;  1Y1V H;  5IYD G;  2B3G A;  4QGU A;  2VQF Q;  2ES2 A;  2HT1 A;  1VQE A;  1YNX A;  2EQS A;  4P71 A;  4GN4 B;  3E9H A;  4DPG A;  3ULL A;  1HR0 L;  2K75 A;  4X66 Q;  1SN8 A;  5HGQ A;  1PYS B;  3G48 A;  1YHA A;  2MO0 A;  2HQL A;  4X62 Q;  3I7F A;  4DUY Q;  1D7Q A;  1X6O A;  1VQ7 A;  1XNQ Q;  1CKO A;  3HKZ G;  3GDE A;  1ASZ A;  4POG A;  4L5T A;  2A8V A;  5M3M G;  1KIX A;  3HOW H;  5LMN W;  4A3B G;  4YWM A;  4QJF A;  2I5H A;  3L2P A;  1XMO L;  1GM5 A;  1N32 L;  4PZ6 A;  4A76 A;  4X65 Q;  3JAM i;  3GTP H;  2YU9 H;  1E22 A;  3HOY H;  2VQE L;  5GRO A;  4DV7 Q;  2VNU D;  2GVB A;  4LFB Q;  2I5M X;  1MJE A;  2CWA A;  3GTL H;  3M4P A;  4C3H H;  1E1O A;  2K5H A;  2B63 H;  3HOU H;  1YI2 A;  1PH4 A;  3LGJ A;  4JBK A;  4GKJ L;  2PQA B;  3KOJ A;  4LWC A;  1XPR A;  2JEB I;  3GTO H;  2R92 G;  3KDF B;  4LFC Q;  1ASY A;  3D31 A;  4A3C G;  4YWL A;  2ZTE A;  1XNR L;  1PH1 A;  1JT8 A;  4YY3 L;  3M4O H;  2CWP A;  3J80 i;  3CPF A;  1HNX L;  4A3I H;  4YHH Q;  1CSP A;  1QVC A;  3K7A H;  5C44 G;  2CCZ A;  4GOP A;  2K4K A;  2ZM6 L;  3U4V A;  4HJ8 A;  3UDF A;  3KF6 B;  2JJQ A;  1I3Q H;  2UXD Q;  1UWV A;  2EXD A;  2UXB Q;  4UP9 A;  4R4T A;  4BXX H;  3KJO A;  4JYA Q;  1Q12 A;  1GKH A;  4GLA C;  4NB3 A;  2AKW B;  4JI5 Q;  1T9H A;  5FJ8 G;  1MKH A;  2BA0 A;  3STB C;  4JI2 Q;  1N34 L;  1OXS C;  3T1Y L;  3S2H H;  5IYB G;  4GLV B;  4L5Q A;  2JA6 H;  1G51 A;  3ULP A;  1K83 H;  4R4Q A;  4DV6 Q;  2JA7 H;  3UDI A;  1IBM L;  3PUW A;  4KHP L;  3Q8D A;  3BZK A;  3CC2 A;  3H15 A;  1X55 A;  1NJI C;  1QUQ B;  4GLX A;  4BY7 G;  2LSS A;  5DLQ E;  1UE7 A;  1N9W A;  3RNU A;  1CKN A;  5ELN A;  4DR2 L;  4DUZ Q;  4PZ7 A;  2VUM G;  2Q2U A;  3RZO H;  4JOI A;  4IJH A;  1A8V A;  3CME A;  1GD7 A;  3K0X A;  2JK8 A;  4LF8 L;  2RHQ B;  3TQY A;  4A3K G;  5LMN Q;  5EAY A;  2UXC Q;  1S3O A;  3PUX A;  1YIJ A;  3I4N H;  5M5W H;  1E1T A;  3TRE A;  1W3S A;  3KFU A;  5IYC G;  4L5R C;  2AWO A;  4QQB X;  3DM3 A;  1KC8 C;  4JI4 L;  4A3J H;  4DV1 L;  2NVT H;  4BBS G;  4DR6 Q;  3M4Q A;  4NXM Q;  1A63 A;  4AH6 A;  1P8L A;  4HIK A;  1YVC A;  4OON A;  1YJW A;  2OTJ A;  5K36 G;  3A5U A;  2HHH Q;  5GAD C;  3HOX H;  2VQF L;  1YHB A;  3GD7 A;  3S1R H;  1V9P A;  3UE1 A;  4A3G H;  3I2Z A;  4GS3 A;  3EBE A;  4LUZ A;  3A74 A;  4AIM A;  3F2D A;  4GOP C;  4JG2 A;  1XPO A;  1PH2 A;  4BA1 I;  2NN6 I;  4X66 L;  1EQQ A;  2I0Q A;  2ZJQ A;  2R93 H;  2LXJ A;  2NZH A;  2PI2 A;  3A5Z B;  3NEM A;  1UE5 A;  3PCO B;  4BBR H;  4X62 L;  4DUY L;  2JEA I;  4J15 A;  1Q8K A;  1XNQ L;  1B8A A;  2GVA A;  2VW9 A;  4XTC S;  3CMA A;  1D8L A;  1WJJ A;  2ASB A;  3CC7 A;  1K3R A;  1TXY A;  4LF7 Q;  2IX0 A;  3FKI G;  4X65 L;  2R7D A;  3I4M G;  3JAM c;  3CCE A;  1Q46 A;  4TQU S;  5BR8 Q;  4DV7 L;  1C7Y A;  4A75 A;  5FLX c;  2H5X A;  1FJG Q;  4LFB L;  1CKN B;  3ER0 A;  1WYD A;  3HOV H;  1LUZ A;  3TRZ A;  4WJ3 M;  1HZC A;  3HOZ G;  3FP9 A;  1CUK A;  5IP9 H;  3OTO Q;  1M1K C;  3PF4 A;  2WAQ E;  5IE8 A;  4BY1 H;  5M5Y H;  5JJL A;  2YTV A;  3K80 C;  4R4C A;  4A3L H;  4AYB E;  2OWO A;  4C3J H;  2DUD A;  4HJ5 A;  4DV2 Q;  3S16 H;  4OWT B;  3BU2 A;  2BH8 A;  4LFC L;  4DK3 C;  4JOI C;  1TWF H;  2A19 A;  2N78 A;  1VCI A;  5FLM G;  3J81 i;  1VQH A;  1PH3 A;  3H3V H;  1H95 A;  3PUV A;  1VQI A;  4OXP A;  1YZ6 A;  4P72 A;  2F4V L;  4A93 H;  1FGU A;  3RLF A;  4IFD J;  3J80 c;  1NBW A;  2NZO A;  4YHH L;  2JA5 G;  5JEA J;  1VQ4 A;  3PF5 A;  3PO2 H;  2KHJ A;  4LF9 Q;  2AHO B;  4IPC A;  4IO9 A;  2BA1 A;  3W1G A;  3J81 j;  1Q82 C;  2Q2T A;  5C4X G;  3W5O A;  2Z6K C;  4A3G G;  5C0X J;  3KJP A;  3CXC A;  4DR1 Q;  2XTI A;  2UXD L;  1BBU A;  2UXB L;  2N49 A;  3PUY A;  1I5F A;  4JYA L;  1AH9 A;  2K5N A;  4DV4 Q;  4JI5 L;  3TEH B;  4B3T Q;  4JI2 L;  3RLN A;  1IYJ B;  3HOU G;  4LW1 A;  3D0F A;  5M5X H;  4LF4 Q;  4PZ8 A;  1EOV A;  3NEN A;  2GN5 A;  3AQQ A;  2UU9 Q;  1Y1W H;  4DV6 L;  3PO3 H;  5IYD H;  2L15 A;  1L1O A;  1W2B A;  1OTC A;  3IRB A;  3S1Q H;  3A0J A;  1VQB A;  4OO1 G;  5GAG C;  1NTG A;  2VS1 A;  3CCV A;  1Q1E A;  1YBY A;  2Y0S E;  4LUO A;  2JE6 I;  5M3F G;  2HIX A;  1VQ6 A;  1JJG A;  1SMX A;  3U4Z A;  4DUZ L;  2Q2I A;  2F4V Q;  1TWA H;  5M3M H;  4OO1 I;  1J6Q A;  1FVI A;  3CQZ H;  3M3Y H;  1VQA A;  3G71 A;  1PH9 A;  4A3B H;  2IHE A;  2E2J H;  3S2D H;  1KRS A;  2UUA Q;  1HZ9 A;  3H0G G;  3ULJ A;  4HJ7 A;  4BXX G;  3CCM A;  1I94 Q;  3TS2 A;  4EX5 A;  1QZG A;  1PH8 A;  4LNQ A;  4DR7 Q;  5LMN L;  1S72 A;  2UXC L;  5C0X G;  4O0A A;  3T1H Q;  4MNO A;  1N36 Q;  4JV5 Q;  5IP7 G;  2KCT A;  1X3G A;  1SLJ A;  4APV A;  1HH2 P;  4LFA Q;  3TS0 A;  4R1J A;  2OQ0 A;  1J5E Q;  4LF5 Q;  1Z9F A;  2PI2 E;  3F1Z A;  5C0X I;  4DNI A;  4DR6 L;  4POF A;  2QA4 A;  4UPA A;  4NXM L;  4DR4 Q;  1UE1 A;  1LM0 A;  2YTY A;  4A3F G;  3HKS A;  2HHH L;  2R92 H;  1Q7Y C;  1JJ2 A;  4A3C H;  1S40 A;  1PYB A;  1Z47 A;  4DR3 Q;  1DGS A;  1KL9 A;  5C4J H;  1QZH A;  1YJN A;  2IY5 B;  4JI7 Q;  4IPG A;  4HJA A;  4OX9 Q;  1IXR A;  4JI3 Q;  2KBN A;  2WP8 J;  2YV5 A;  5C44 H;  1L1O B;  1YHQ A;  3F2C A;  4DAM A;  4FDB A;  2IT1 A;  1AE2 A;  4UP8 A;  4ALP A;  3NEL A;  2NVQ H;  4LF7 L;  1IL2 A;  5H1S E;  3CCQ A;  3OW2 A;  4A3E G;  5C3E G;  1NE3 A;  1OXV A;  4GKK L;  3RLO A;  2FXQ A;  5BR8 L;  1TWC H;  1SE8 A;  1VQJ A;  5FJ8 H;  1NMG A;  1FJG L;  2Q2H A;  2MQH A;  1L1O C;  2UUB Q;  4Y52 H;  2OQK A;  2N8N A;  5IYB H;  2K50 A;  1VQP A;  3OTO L;  2R7Z G;  4IOC A;  2VY3 A;  3S24 A;  3CW2 C;  4GOP B;  2YTX A;  1WI5 A;  2HIV A;  1PH7 A;  4R4I A;  1MIU A;  1HNW Q;  4DV0 Q;  4DV2 L;  4UP7 A;  2KEN A;  4B3S Q;  4A3D G;  1SFO H;  1Q1B A;  2F3I A;  2ZJR A;  2D0P A;  3BJU A;  1VS0 A;  1EUJ A;  3ERS X;  3J81 c;  4BY7 H;  1VQM A;  1I6H H;  1VQD A;  1L2F A;  1CKM A;  1OXU A;  3NBH B;  3RR5 A;  2JA8 G;  1LTL A;  1U0L A;  3F2B A;  4K0K Q;  1UE6 A;  3W1B A;  2WAQ G;  2VUM H;  1VQ8 A;  3CPW A;  2ATW A;  4GNX A;  3CCS A;  3EIV A;  4LF9 L;  3CP0 A;  4AYB G;  2UUC Q;  2IHF A;  2RHS B;  3OYY A;  4DV5 Q;  4IPH A;  1MJC A;  2V1C C;  2MNA A;  1TWG H;  2D0O A;  4DR1 L;  4DR5 Q;  4A3K H;  2NVX H;  4TVA B;  3M9B A;  2CKZ B;  3S14 H;  1C0A A;  2ZTD A;  2VL6 A;  1HZA A;  4JI6 Q;  4DV4 L;  2PNH A;  2OTL A;  4KLK A;  1SR3 A;  5IYC H;  4B3T L;  4GKK Q;  3K81 C;  3PUZ A;  4A3M G;  1QVF A;  1RIP A;  3K7U C;  1PHJ A;  1JB7 A;  3M7N A;  2E2I H;  4LF4 L;  1HJP A;  3PIO A;  4BBS H;  1E7Z A;  3RZD H;  2UU9 L;  1NMF A;  1C9O A;  1Q86 C;  1HR0 W;  1WCM G;  2K5V A;  2ID0 A;  3U50 C;  1VQC A;  1Y1V G;  3L7Z C;  5LMU Q;  4RG1 A;  1EFW A;  3PSI A;  1EQR A;  2MFI A;  4PMW A;  3CAM A;  3SGI A;  1YJ9 A;  2CFM A;  1V43 A;  1VQG A;  2XGT A;  5AJ3 Q;  4LF6 Q;  3CD6 A;  1FL0 A;  2D62 A;  4JBJ A;  1PVO A;  1G29 1;  1P16 A;  2UUA L;  3HOW G;  3FKI H;  2JA9 A;  2PQA A;  2QEX A;  1Y14 B;  3I4M H;  1KRT A;  5JJK A;  2WB1 E;  3STB D;  4JI1 Q;  3CCR A;  1I94 L;  3KDF A;  3I56 A;  3GTM H;  4DR7 L;  3HOY G;  3T1H L;  2Y0S G;  1N36 L;  3CCJ A;  4JV5 L;  4NXN Q;  4GNX B;  3ICE A;  1N33 Q;  5IWA Q;  1HNZ Q;  4XIG S;  2I5L X;  3HOZ H;  4LFA L;  5IY0 A;  1J5E L;  1KD1 C;  4X64 Q;  4LF5 L;  4KHZ A;  3GTQ H;  2Z0S A;  3B6Y A;  4DK6 C;  2K52 A;  4JC0 A;  4A4I A;  2B63 G;  2E5L Q;  3J7Z C;  4RMF A;  4B3M Q;  1NY4 A;  4JI8 Q;  1JJC B;  4DKA C;  3KF6 A;  4AQY Q;  3KYH C;  1K73 C;  3PV0 A;  4GNX C;  3GTJ H;  3AFP A;  1BBW A;  5FLM H;  1IBK Q;  1UEB A;  4DR3 L;  4IJL A;  3G4S A;  1PH5 A;  4HID A;  1OXX K;  4JI7 L;  1QVG A;  1GVP A;  4OX9 L;  3FHW A;  3EN2 A;  1VQN A;  4JI3 L;  4HIO A;  2JA5 H;  2YYZ A;  4A3I G;  1X56 A;  5C4X H;  4P73 A;  4IFD G;  1XMQ Q;  2DGY A;  3MEF A;  3K8A A;  4P75 A;  5JEA G;  1HZB A;  5GAE C;  2IX1 A;  1PFS A;  1QUQ A;  4YCU A;  1G6P A;  4JI0 Q;  4IFD I;  2UUB L;  4B3R Q;  4IOA A;  1OXT A;  1IBL Q;  2NVY H;  4DV3 Q;  3CF5 A;  5J3B A;  1VQF A;  2RF4 A;  1N8R C;  5GQO A;  3HKZ E;  1BKB A;  2JA6 G;  4ME3 A;  1U5K A;  4YCV A;  1PV4 A;  1HNW L;  1V1Q A;  2JA7 G;  4DV0 L;  1LYL A;  4HIM A;  4B3S L;  3HFZ B;  4JBW A;  1VQL A;  4YWK A;  1KHI A;  3S17 H;  3RN2 A;  1XJV A;  1X3F A;  1HR0 Q;  4HJ9 A;  1O7I A;  5M3F H;  3AYH B;  4QY7 A;  4K0K L;  1TWH H;  1B70 B;  3JC6 6;  3ZJY C;  3H0G H;  2UUC L;  4DV5 L;  2QGQ A;  4L5S A;  4R4O A;  1XMO Q;  4DR5 L;  1N32 Q;  1L0W A;  4OWW B;  1PA6 A;  2VQE Q;  1VQ9 A;  4DR4 L;  3BZC A;  5ELO A;  5IP7 H;  1YIT A;  1K8G A;  1EIY B;  3CC4 A;  4JI6 L;  2F52 A;  3I4N G;  3MXN B;  3S1N H;  3PGZ A;  3F8T A;  3I55 A;  1IZ6 A;  1PH6 A;  4A3J G;  1VQ5 A;  4YCW A;  1KXL A;  4GKJ Q;  1CSQ A;  4A3F H;  5E7N A;  3I4O A;  1KAW A;  1JE5 A;  1K0R A;  4NPS A;  3HOX G;  5LMU L;  5IT9 c;  1GO3 E;  2C35 B;  5GAH C;  3E9I A;  3DLL A;  1VQO A;  1A62 A;  2RCN A;  3KF8 B;  4H02 A;  4GN5 A;  1XNR Q;  1WFQ A;  1WOC A;  4YY3 Q;  2EIF A;  2R93 G;  2ZJP A;  3L0O A;  4JBM A;  1EYG A;  5AJ3 L;  4LF6 L;  1RL2 A;  4BBR G;  1HNX Q;  2K14 A;  3KLW A;  4KI0 A;  2WFW A;  3UE0 A;  4C2M H;  5HY6 A;  2ZM6 Q;  2E2H H;  4A3E H;  5C3E H;  1JMC A;  4QL5 A;  1X3E A;  3AEV A;  5JJI A;  2PMZ E;  2R6G A;  4JI1 L;  1M90 C;  4P74 A;  1E3P A;  2A1A A;  4GN3 B;  3GTG H;  4NXN L;  2ALY B;  1X54 A;  1KQS A;  2Z6K A;  1SRU A;  1R9T H;  1N33 L;  4C3I H;  2OCE A;  2E8G A;  4QIW E;  5IWA L;  4IPD A;  1N34 Q;  3T1Y Q;  1HNZ L;  1SRO A;  1XPU A;  1X9N A;  2R7Z H;  4X64 L;  2NN6 G;  3HOV G;  4JCV E;  2LXK A;  5IP9 G;  4X6A H;  1EWI A;  4BY1 G;  3UDG A;  2E5L L;  4B3M L;  4JI8 L;  4A3L G;  4AQY L;  4A3D H;  2WB1 G;  1IBM Q;  1K8A C;  4KHP Q;  1E24 A;  1IBK L;  3CCU A;  4BA2 I;  4LUV A;  3AFQ A;  3VDY A;  3PIP A;  2JQO A;  3UDX A;  1YEZ A;  2JA8 H;  4O2D A;  1AE3 A;  1X65 A;  2KHI A;  2AMC B;  4Y7N H;  1BVS A;  4A93 G;  2MO1 A;  2N3S A;  2VZA A;  3GO5 A;  4DR2 Q;  3U58 A;  1Q81 C;  3CCL A;  3WWV A;  3PO2 G;  3H3V I;  1XMQ L;  3J7A 5;  4WJ4 A;  3E0E A;  2CQO A;  1EIF A;  4MZ9 A;  1B7Y B;  1XTD A;  4LF8 Q;  2AWN A;  2B29 A;  4MTN A;  1VQK A;  3GTK H;  4OWX B;  2KCM A;  3M85 A;  4JI0 L;  3RN5 A;  2R7F A;  4EQ5 A;  1I50 H;  4PG3 A;  4A3M H;  2BH2 A;  4B3R L;  1IBL L;  3S15 H;  4DV3 L;  4JI4 Q;  3G6E A;  4DV1 Q;  1K9M C;  2ZTC A;  4DAY B;  4UY8 C;  3S1M H; 
#chains in the Genus database with same CATH topology
 5IYD G;  1EYC A;  4QGU A;  2XRS D;  1VQE A;  2EQS A;  4GN4 B;  1ILP A;  2E75 C;  5HGQ A;  1I4P A;  1PYS B;  3G48 A;  1YHA A;  4DUY Q;  2HQL A;  4R8I A;  1X6O A;  1CKO A;  4POG A;  2A8V A;  3HOW H;  3OOC A;  4RGT A;  1JCK B;  1MSH A;  1Q3L A;  3JAM i;  3HOY H;  5EPJ A;  1TWH B;  4CKC A;  2VNU D;  5IGG A;  2RCF A;  1B9M A;  1H9M A;  1DOL A;  3LX0 A;  4GKJ L;  2QEJ C;  2A69 C;  4DXF A;  4LFC Q;  2CVR A;  4H44 C;  2AQ2 B;  4K6D A;  4YY3 L;  3M4O H;  4A3F B;  2NTT A;  3OIQ A;  1RHP A;  1HNX L;  1CTM A;  3C46 A;  4YHH Q;  3DWA A;  1PTO C;  3K7A H;  4IFD H;  2H1E A;  1K8O A;  3W2D A;  2ZM6 L;  3KF6 B;  4CKE A;  1I3Q H;  1W6K A;  2LY7 A;  1Q12 A;  4GLA C;  4KKU A;  2AKW B;  2F0L A;  3NBH A;  3S2H H;  4XYQ A;  4DAP A;  3T1Y L;  4H7B A;  2F0T A;  2JA6 H;  4DV6 Q;  1BUV T;  1V8Q A;  4UAI A;  4I65 A;  4XT3 B;  3UDI A;  3PUW A;  4KHP L;  4C3I B;  4HN7 A;  4V0B A;  1QUQ B;  5D3I B;  1ESF A;  1CKN A;  4A3D B;  1MGS A;  2VUM G;  3I70 A;  2PW5 A;  4JOI A;  2JN4 A;  2IX3 A;  5FO9 B;  2JA8 B;  2JK8 A;  3ITP A;  3PUX A;  1YIJ A;  5M5W H;  5DM7 3;  3TP5 A;  4H0L C;  4AYB B;  3KFU A;  1D5Z C;  2AWO A;  2EE1 A;  3DM3 A;  2F4I A;  5DEH A;  1LAC A;  4A3J H;  3CRL C;  3ERQ A;  3M7G A;  1BOS A;  3M4Q A;  4K14 A;  4AH6 A;  5K36 G;  1A63 A;  4RH6 A;  3A5U A;  2CHB D;  1YHB A;  4AIM A;  3DEP A;  1NR4 A;  4IUU A;  2G9D A;  5TSS A;  2R93 H;  4IZ8 A;  2NZH A;  4HSV A;  1UE5 A;  4BBR H;  1WCM B;  1V1P B;  1Q8K A;  1Y1V B;  3WOE A;  1CHQ D;  1HPC A;  1B8A A;  5CYU A;  5EKI A;  1PZJ D;  1WTO A;  2WII B;  2GA4 B;  3JAM L;  3CCE A;  2O2L D;  4TQU S;  3KBX A;  4FF3 A;  1CKN B;  1WYD A;  1DCZ A;  3HOV H;  1GUO A;  3KLR A;  3FP9 A;  2RDG A;  3OTO Q;  3SE0 A;  3PF4 A;  4BY1 H;  5JJL A;  5I2X A;  2YTV A;  2Y0S B;  1GXD C;  4FVM A;  4AYB E;  2K5D A;  2TSS A;  3OMC A;  4FF4 A;  3S16 H;  4MHE A;  2DJG C;  1PTO D;  3L3O C;  2N78 A;  1PH3 A;  3TME A;  4C3H B;  1H95 A;  2B63 B;  4OXP A;  4P72 A;  3E6Z X;  4XQJ A;  1SE4 A;  1JWS D;  3ND9 A;  1Y8P B;  3PO2 H;  4RHR A;  1LAB A;  4IPC A;  3W1G A;  3P75 A;  3J81 j;  4RWS C;  1S5C D;  2UXB L;  1AH9 A;  4A3I B;  4PMB A;  2EJF C;  2QKI C;  3F2U A;  4JI5 L;  3TEH B;  4B3T Q;  3Q0A A;  1PRT B;  2RDH A;  4JI2 L;  1HFN A;  1IYJ B;  4KN7 C;  3HOU G;  3BDL A;  5M5X H;  4LF4 Q;  2A6E C;  1Y1W H;  3D4D A;  3PO3 H;  1PMR A;  1W2B A;  1JOK A;  1BCP D;  2VS1 A;  1Q1E A;  1YBY A;  2Y0S E;  4LUO A;  3T16 A;  1A2T A;  2JE6 I;  2NTS A;  1VQ6 A;  2JA7 B;  2E76 C;  1I4X A;  2K05 A;  1TWA H;  4OO1 I;  1J6Q A;  1FVI A;  2B2Y C;  3M3Y H;  1PH9 A;  4A3B H;  2KCC A;  3OW7 A;  2IHE A;  1EQV A;  1KRS A;  4UDU C;  1HZ9 A;  2H4O A;  3ULJ A;  1FYC A;  1A3U A;  2SOB A;  2ZT9 C;  5KYI A;  4BXX G;  3TS2 A;  1QZG A;  1PH8 A;  4WJ3 M;  1E0B A;  2VB3 X;  1EY5 A;  2UXC L;  4ZLT F;  4O0A A;  3T1H Q;  1SLJ A;  4APV A;  4LFA Q;  3TS0 A;  2QDL A;  1Z9F A;  2MJ8 A;  5C0X I;  1WTQ A;  1OO9 B;  4DR6 L;  4NXM L;  1XTC D;  1UE1 A;  3I4N B;  2R92 H;  4RKL A;  4KK7 A;  4LMQ D;  4IUT A;  1A3V A;  2AQ1 B;  2J7Z A;  5I2Y A;  1AZQ A;  1LTT D;  2NBF A;  5BN5 A;  4JI3 Q;  3HOX B;  2KBN A;  3VYS A;  2YV5 A;  1YHQ A;  1AE2 A;  4FF1 A;  5A2Q L;  1IL2 A;  4A3E G;  1OXV A;  1S5B D;  1CI3 M;  1TWC H;  1SE8 A;  2A6H C;  5JPM C;  1FJG L;  2Q2H A;  4K5W A;  3A7L A;  2OXP A;  5KIX A;  2BOS A;  3J81 E;  1GUN A;  5CC4 A;  2F0S A;  2KJX A;  4GOP B;  2OT2 A;  2HIV A;  3GP7 A;  1HNW Q;  4DV0 Q;  1QNK A;  1Q1B A;  2DNC A;  3Q23 A;  4A3M B;  1VS0 A;  1EUJ A;  3J81 c;  1CK1 A;  1OXU A;  1BR9 A;  3F2B A;  2KOL A;  3A8J E;  5L37 A;  4C3J B;  5BN4 A;  3CP0 A;  2PCF B;  2RHS B;  4DAY A;  5EGT A;  4IPH A;  1HRJ A;  2V1C C;  2MNA A;  3S14 H;  3C1E A;  1C0A A;  1K28 A;  2L1B A;  4Q5V A;  1PFB A;  1HZA A;  3TP8 A;  4DV4 L;  4GKK Q;  3K81 C;  1QVF A;  1RIP A;  1CT1 D;  1JB7 A;  1LT5 D;  4CDC C;  1KAB A;  2E2I H;  4J6H A;  5KYL A;  4BBS H;  5EBC A;  1J9O A;  1DXM A;  1ZKO A;  1U4P A;  4N8X 1;  2K5V A;  3GV6 A;  3UI2 A;  1SNC A;  1VQC A;  1SNM A;  1EFW A;  4IUR A;  5IOC A;  3NTH A;  2K33 A;  1ML0 D;  2EJG C;  5AJ3 Q;  5CV5 A;  4LF6 Q;  1FL0 A;  3S1Q B;  1SND A;  5C5L A;  1G91 A;  3K57 A;  2PQA A;  1SSO A;  2XWB B;  3I4M H;  3STB D;  1AW7 A;  3CCR A;  1I94 L;  3I56 A;  1WTP A;  3SDZ A;  1WD1 A;  1N36 L;  3CCJ A;  4JV5 L;  3WDN A;  3T56 B;  1N33 Q;  2JSO A;  3HOZ H;  1LTA D;  1H9S A;  1J5E L;  4NKL A;  3QOL A;  3GTQ H;  1JB3 A;  2K52 A;  1SYE A;  1FNU A;  2E5L Q;  4AQY Q;  2OF1 A;  1HTP A;  1NR2 A;  1UEB A;  4IJL A;  4DGZ A;  4CDE C;  4HID A;  4M1U B;  3QO2 A;  1TS2 A;  3V2T A;  1HCZ A;  1VQN A;  2JA6 B;  1X56 A;  1DYQ A;  4PMC A;  3CRK C;  3K8A A;  2RDF A;  1TT2 A;  1HZB A;  1IW7 D;  5EKL A;  2IX1 A;  2WKD A;  4JI0 Q;  4IFD I;  2UUB L;  4X3K A;  4B3R Q;  3TZD A;  5GQO A;  2K7V A;  3HZX A;  5NUC A;  2EXZ A;  2NB0 A;  4HIM A;  4B3S L;  3I72 A;  1VQL A;  3J7A F;  1O7I A;  3AYH B;  4A3J B;  1TWH H;  2PMZ B;  2XVS A;  1ZEQ X;  1B70 B;  1SFO B;  3JC6 6;  3ZJY C;  2UUC L;  1EWC A;  4DV5 L;  1XMO Q;  1K3B C;  2F3W A;  2BE5 D;  2L5T A;  1YIT A;  3CC4 A;  2VUM B;  3K0Y A;  2F52 A;  3S1N H;  1U9R A;  2EY2 A;  2LS0 1;  4BS9 A;  1TWG B;  1PH6 A;  2NVX B;  2MPM A;  4YCW A;  1ET9 A;  4PV1 C;  4A3F H;  1ENF A;  1VQ8 A;  4ZRZ A;  3H09 A;  5GAH C;  1VF5 C;  3G6J B;  3MWY W;  4H02 A;  1WOC A;  2ZJP A;  2ICE C;  2F0H A;  3UE0 A;  1LV9 A;  4CDF C;  3S16 B;  5JJI A;  3AEV A;  2BCO A;  2PMZ E;  1JWM D;  1F9R A;  4NXN L;  3MFG A;  1SRU A;  4C3I H;  2OCE A;  1HNZ L;  2A68 D;  1QWY A;  5DNF A;  5IP9 G;  1PRT D;  1V1O A;  3CU7 A;  3GTM B;  5JVH 3;  1PZK D;  4A3L G;  4A3D H;  1EWH A;  2WB1 G;  1IBM Q;  1K8A C;  1A3T A;  1E24 A;  3CCU A;  1WD0 A;  4FO2 A;  2X69 A;  2JQO A;  4X3U A;  2JA8 H;  1MHW C;  1X65 A;  4A93 G;  1BVS A;  2MO1 A;  3U58 A;  2Z4H A;  2RSN A;  3PO3 B;  3CCL A;  4X3S A;  2CQO A;  1EIF A;  1B7Y B;  2F0V A;  2AWN A;  1VQK A;  2MGS A;  4QUF A;  4ABN A;  3RN5 A;  3V05 A;  1IBL L;  3PQI A;  1DM0 B;  3G6E A;  4DV1 Q;  4JPB W;  1D6E C;  4RGM A;  1K9M C;  4NDX A;  2GVA A;  5KNC A;  1WCM H;  1A0I A;  2CW0 D;  1Y1V H;  2B3G A;  2HT1 A;  1JIC A;  3E9H A;  4ODG A;  3H94 A;  4X66 Q;  1SN8 A;  1A6X A;  1ICW A;  4L8J A;  2NUC A;  1D7Q A;  3I7F A;  1XNQ Q;  3HKZ G;  3GDE A;  5FOB B;  5KEE A;  4L5T A;  4TSS A;  5K5P A;  4YWM A;  1XXG A;  3L2P A;  2QF7 A;  2RKS A;  4PZ6 A;  2HCI A;  5CV8 A;  1E22 A;  1STG A;  5GRO A;  4DV7 Q;  2ENB A;  1ENA A;  2CWA A;  1SDF A;  3M4P A;  4C3H H;  1DZ1 A;  2B63 H;  1SMY C;  5DM6 3;  4LWC A;  1TWC B;  1PTO B;  2R61 A;  4OIJ A;  4A3C G;  1DON A;  4YWL A;  1XNR L;  2EVB A;  1JT8 A;  2D5D A;  1F9Q A;  3KBG A;  2L0C A;  5E4X A;  4A3I H;  1XWE A;  5CV4 A;  1TS3 A;  2CCZ A;  4C1N I;  2K4K A;  5FKA C;  1XX8 A;  3UDF A;  2JJQ A;  5EPL A;  1KLU D;  2EXD A;  2MP1 A;  4ZK9 B;  4XXE A;  3SK6 A;  2RQX A;  2F0F A;  4U67 3;  1FNW A;  1T9H A;  4C2M B;  4S3S A;  2IWH A;  1N34 L;  3SHL A;  1SEB D;  2F1M A;  5IYB G;  4A3E B;  3ULP A;  4R4Q A;  2JA7 H;  3S14 B;  1BCP B;  3BZK A;  3Q8D A;  1X55 A;  4F8M A;  5IT9 L;  4GLX A;  4BY7 G;  1UE7 A;  1N9W A;  3RNU A;  5CMD A;  5ELN A;  1IYV A;  4DR2 L;  4EGV A;  2FFK B;  2EYM A;  1O78 A;  4ZKB B;  1A8V A;  4FF2 A;  3Q6S A;  3OSO A;  2RHQ B;  3TQY A;  4A3K G;  4ME5 A;  4ZCK A;  3I4N H;  1E1T A;  2F0P A;  2PYK A;  4DNT B;  1JC7 A;  4G57 A;  1K0S A;  3HP3 A;  3NPP A;  1P8L A;  1YJW A;  1YVC A;  4NMZ A;  2OTJ A;  4F87 A;  2HHH Q;  5GAD C;  3HOX H;  2VQF L;  1I50 B;  1V9P A;  1F77 A;  1M4V A;  2VB2 X;  3F2D A;  4GS3 A;  3EBE A;  4LUZ A;  3A74 A;  3NTK A;  1PH2 A;  4JG2 A;  5KRU A;  2NN6 I;  1M8A A;  4X62 L;  5ELC A;  3BZD B;  3K5M A;  2EDG A;  1JOO A;  2K6A A;  1D8L A;  1WJJ A;  2LFN A;  2PQE A;  1LO5 D;  4X65 L;  4IQZ A;  2I07 B;  1SMY D;  5BR8 Q;  1C7Y A;  5FLX c;  3X3N A;  2KA7 A;  4LFB L;  2B2Y A;  1G2S A;  1M1K C;  4QCL A;  3T4A C;  4BWG B;  2YU9 B;  3J80 E;  3LWE A;  4C3J H;  2DUD A;  5IGE A;  3EVQ A;  4OWT B;  2BH8 A;  1BO0 A;  3GTL B;  2OEO A;  1VCI A;  2RSO A;  4KD4 A;  1VQH A;  5FLM G;  3J81 i;  3H3V H;  3PUV A;  1VQI A;  3I3C A;  5E1F A;  1FGU A;  1MI2 A;  1NAP A;  4EQP A;  3J80 c;  1PDQ A;  1TKW B;  1C4Q A;  5JEA J;  1VQ4 A;  4WJW A;  3BS1 A;  2AHO B;  2B2V C;  4MTK A;  2Q2T A;  5C4X G;  2N55 A;  4DR1 Q;  4KV6 A;  2UXD L;  1BBU A;  4JYA L;  5CBA E;  1X3Q A;  1TU2 B;  3MXU A;  5KND A;  4LW1 A;  1HTL D;  1R4Q B;  5IYD H;  3NE5 B;  5JJZ A;  3DMU A;  5E4W C;  1MD2 D;  1OTC A;  3IRB A;  3S1Q H;  1U4R A;  5GAG C;  3S1N B;  3FEW X;  3TP7 A;  1K83 B;  5M3F G;  4H13 C;  3U4Z A;  4DUZ L;  2Q2I A;  2F4V Q;  1Y69 U;  1FGB D;  2HD3 A;  4KHV A;  1WVL A;  2UUA Q;  5LL6 X;  5LMN L;  1RTN A;  5IP7 G;  2KCT A;  3E0J A;  1EYA A;  1DD2 A;  4POF A;  4XT1 B;  4UPA A;  5C6A A;  1I4Q A;  2YTY A;  1JOQ A;  1S40 A;  1WTX A;  4DR3 Q;  1LTG D;  4KTA A;  1DGS A;  1KL9 A;  1VF7 A;  2NVT B;  4IPG A;  4HJA A;  4OX9 Q;  4RGO S;  4F88 A;  3S1R B;  1RKN A;  4UP8 A;  3NEL A;  1I4R A;  4LF7 L;  1NCV A;  3K5N A;  5C3E G;  1NE3 A;  4GKK L;  2ZXO A;  1F9P A;  1SYF A;  1L1O C;  4Y52 H;  1ILQ A;  3NWS A;  2K50 A;  2R7Z G;  3P20 A;  3Q22 A;  1T5X D;  4DV2 L;  4UP7 A;  1SFO H;  5CR3 A;  1IKL A;  2F3I A;  3J81 L;  3ERS X;  1VQM A;  3NBH B;  1L2F A;  1LTL A;  1U0L A;  4K0K Q;  1UE6 A;  2WB1 B;  2VUM H;  1PXU A;  1TY0 A;  1E2Z A;  4KKT A;  4LF9 L;  1ONL A;  1TWF B;  2IHF A;  1ICF B;  1TWG H;  2D0O A;  2NVX H;  3T13 A;  3R93 A;  4A93 B;  2CKZ B;  1QE6 A;  2ZTD A;  1EZ6 A;  4JI6 Q;  5ELD A;  5C5M A;  1RTO A;  3PUZ A;  3J7Y W;  3K7U C;  2N88 A;  3MVV A;  2A69 D;  3VR6 A;  2UU9 L;  5K36 H;  2PPB C;  2EY6 A;  2M00 A;  2JP1 A;  3L7Z C;  3SR1 A;  1SYG A;  3NWT A;  1EQR A;  2EYF A;  1AZP A;  1V43 A;  5JPN C;  1QJO A;  4WOR A;  2XGT A;  2O4X A;  2QW7 A;  3WOF A;  2D62 A;  4QMG A;  4DAV A;  1KDC A;  4XDX A;  1G29 1;  1P16 A;  1KRT A;  2WB1 E;  4JI1 Q;  3KDF A;  3GTM H;  4DR7 L;  1NUC A;  3I91 A;  3HKZ B;  4KJN A;  3CQZ B;  5IWA Q;  4XIG S;  2F03 A;  5IY0 A;  4LF5 L;  3C1F A;  4X64 Q;  4J1M A;  4JC0 A;  4RMF A;  4B3M Q;  1NY4 A;  1BF4 A;  4JI8 Q;  4DKA C;  4GNX C;  1STB A;  1T5E A;  1BBW A;  1LT6 D;  1IBK Q;  4P2C B;  2B2W C;  1KLG D;  3IL8 A;  4JI7 L;  3BVG A;  3EN2 A;  3I90 A;  1CQF A;  2YYZ A;  3NSW A;  2DJF C;  1XMQ Q;  5I6W A;  5JEA G;  1EY4 A;  4OL7 A;  1IYU A;  1MSG A;  1KDA A;  4IOA A;  1OXT A;  1QB5 D;  1D5X C;  4DV3 Q;  3HKZ E;  4ME3 A;  4YCV A;  1PV4 A;  1V1Q A;  3K5O A;  3DM1 A;  1GUW A;  1KHI A;  2L12 A;  1LTI D;  5CV7 A;  1X3F A;  5HGT A;  1STA A;  2QIL A;  5M9O A;  1E2V A;  1CFM A;  3E5S A;  1HQR D;  4G4K A;  3KLS X;  4R4O A;  4BY7 B;  1I6H B;  4DR5 L;  4OWW B;  3GQB A;  5C3W A;  3BZC A;  2F0W A;  5EJW A;  3RMH A;  2IPK D;  3R8B A;  2Z8L A;  1PTO H;  1WTV A;  3D6W A;  1D5M C;  4N9T A;  4A3K B;  1VQ5 A;  4GKJ Q;  4I7A A;  1JE5 A;  1K0R A;  3BDC A;  4HTH A;  3DWQ A;  1Z7T A;  4YIJ A;  5LMU L;  2C35 B;  4A3G G;  3E9I A;  5FK9 C;  4V19 0;  1WFQ A;  2QDB A;  4YY3 Q;  2SNM A;  5BN3 A;  1EYG A;  1GUS A;  1HNX Q;  5JOB A;  4DN4 M;  1HQM C;  3KLW A;  4KI0 A;  4C2M H;  5HUR A;  2ZM6 Q;  3BYY B;  4JVZ A;  4A3E H;  1JMC A;  4QL5 A;  2CH4 W;  2C9O A;  3OHX C;  2R6G A;  4QF4 A;  4ZUJ A;  1B1Z A;  2A1A A;  5C3X A;  1II3 A;  1KQS A;  2F0J A;  4DR4 Q;  2A6E D;  4FXG C;  1ASY A;  1XPU A;  4IPD A;  3T1Y Q;  1X9N A;  2KQ3 A;  5ELB A;  2NN6 G;  4JCV E;  2LXK A;  4X6A H;  2EOT A;  3UDG A;  4EQN A;  3TBI B;  4N8F A;  4KHP Q;  2HDM A;  4C1N K;  4BA2 I;  1BXT A;  3AFQ A;  4GZY C;  3QJY A;  3SK4 A;  2F0K A;  2KHI A;  2X6G A;  2L11 A;  2ICI A;  3H3V I;  3J7A 5;  5ELE A;  1B50 A;  2B29 A;  1Q90 A;  1ROD A;  4K5X A;  3M85 A;  2EJM A;  1I50 H;  4K8I A;  5C4X B;  5COR A;  5LL6 S;  5I6Y A;  4F7X A;  1KNE A;  1F2L A;  2ZTC A;  4DAY B;  2KED A;  1I6V C;  1ZYR C;  4RCN A;  5COY A;  1YNX A;  2NVY B;  4DPG A;  2BDO A;  1HR0 L;  3NXW A;  1Q8I A;  1B3A A;  1VQ7 A;  2CQA A;  1ASZ A;  4NP5 A;  3SEB A;  5M3M G;  1KIX A;  5T1I A;  2A6H D;  3H91 A;  1GM5 A;  1N32 L;  5M3F B;  4E6I A;  4A76 A;  2YU9 H;  1PZI D;  2VQE L;  2GVB A;  1SE2 A;  2I5M X;  1MJE A;  3GTL H;  1E1O A;  2K5H A;  3N6R A;  3HRZ C;  1WTW A;  1PH4 A;  3LGJ A;  2PQA B;  2XRQ D;  3KOJ A;  4N9P A;  2VXW A;  2EYO A;  3D31 A;  1AN8 A;  5C4H A;  2ZTE A;  5EBD A;  1EY8 A;  2CWP A;  1NSN S;  4O1N A;  3P1H A;  1H9S B;  3J80 i;  3URY A;  1GUT A;  2EY5 A;  1EIH A;  1CSP A;  1QVC A;  3D8G A;  1TQO A;  5C44 G;  3NHH A;  1DOM A;  3U4V A;  4HJ8 A;  2F0E A;  4TKO B;  2UXB Q;  3PMF A;  4UP9 A;  4R4T A;  4OGQ C;  2HUG A;  4JI5 Q;  5FJ8 G;  1MKH A;  4JI2 Q;  2E2H B;  4GLV B;  3DUZ A;  5C3E B;  4L5Q A;  1B53 A;  1QNU A;  1K83 H;  2O5J C;  1SNP A;  3CKI B;  1R9T B;  5A2Q E;  2R7Z B;  2EYP A;  1AP0 A;  2LSS A;  2F0O A;  3P7J A;  5DLQ E;  3D6C A;  2JXM B;  4PZ7 A;  4TRD A;  2Q2U A;  3RZO H;  2MUY A;  1S5D D;  4IJH A;  1NNX A;  2F0U A;  3CME A;  1GD7 A;  3BYT B;  3K0X A;  4LF8 L;  5EAY A;  2UXC Q;  1S3O A;  1ZYR D;  3TRE A;  1W3S A;  5IYC G;  2B2V A;  4CJ2 C;  1EY6 A;  2I46 A;  1QCB D;  4JI4 L;  2NVT H;  4DR6 Q;  2WKC A;  2WAC A;  4NXM Q;  3GTK B;  2J0T D;  4HAE A;  5J22 A;  3S1R H;  3S15 B;  5IGC A;  4GOP C;  1XPO A;  1EQQ A;  3ERO A;  2I0Q A;  2ZJQ A;  2FHT A;  3A55 A;  3A5Z B;  3PCO B;  4DUY L;  1O7Z A;  4G7Z C;  3S1M B;  4J15 A;  2K28 A;  5I4D A;  4XTC S;  3CMA A;  2ASB A;  2PZT A;  1K3R A;  1EEI D;  1WTR A;  2IX0 A;  2PW7 A;  3FKI G;  1TY2 A;  4A75 A;  5FLX L;  2H5X A;  3R2I A;  1FJG Q;  3ER0 A;  1S5F D;  2LKV A;  3TZU A;  3TRZ A;  1HZC A;  5IP9 H;  1VMP A;  1WTH A;  3GTP B;  3T53 B;  4A3L H;  1JWU D;  4LFC L;  1TWF H;  1YNJ C;  1D1I A;  3HOU B;  4JW0 A;  1YZ6 A;  2SEB D;  2F4V L;  4RFB A;  4A93 H;  4IFD J;  3D4R A;  3J80 L;  2Z9H A;  2NZO A;  4YHH L;  2JA5 G;  1U4L A;  3QOJ A;  3W5O A;  3KJP A;  1YNN C;  3A8K E;  3CXC A;  2XTI A;  1BBX C;  3PUY A;  1I5F A;  4PNY A;  2K5N A;  3ND8 A;  4DV4 Q;  1EYD A;  1PRT F;  2L9H A;  1EU3 A;  1EOV A;  4IUN A;  2GN5 A;  3AQQ A;  4DV6 L;  3MEH A;  1L1O A;  1VQB A;  4OO1 G;  1NTG A;  3NQI A;  3FRP B;  1CZW A;  5G3L F;  3MXN A;  2HIX A;  2K5Q A;  1JJG A;  4ID6 A;  1A2U A;  3CQZ H;  3G71 A;  2XIW A;  3RD4 A;  3H0G G;  4RA8 A;  1I94 Q;  2RA4 A;  4EX5 A;  4LNQ A;  4J8Q A;  1S72 A;  5C0X G;  4MNO A;  1N36 Q;  1SYB A;  4JV5 Q;  1X3G A;  3VA5 A;  4MN3 A;  1HH2 P;  4R1J A;  1J5E Q;  3F1Z A;  2AUJ D;  4DNI A;  3Q24 A;  3NP8 A;  1LM0 A;  3BDO A;  4A3C H;  1U4M A;  3V96 A;  4RHS A;  3MC0 B;  1EFI D;  1LTS D;  1YJN A;  2HQE A;  3QWN A;  1IXR A;  3NUC A;  3VR3 A;  1SYC A;  2K03 A;  1L1O B;  3F2C A;  4A3G B;  4ALP A;  1I4G A;  4G7O C;  5H1S E;  1KDB A;  4IUV A;  3OW2 A;  4R8N A;  2UUB Q;  2J4X A;  5FO8 B;  2FIN B;  2OQK A;  5IYB H;  5AFW A;  5EQ0 A;  3OTO L;  4IOC A;  2VY3 A;  3S24 A;  3T51 B;  4R4I A;  1MIU A;  2KEN A;  4B3S Q;  2ZJR A;  2D0P A;  3BJU A;  3PIO 3;  4BY7 H;  1I6H H;  3N52 A;  4IN3 A;  1VQD A;  4CGY B;  4B9X A;  4FXK C;  2WAQ G;  1C48 A;  2A5H A;  2V4D A;  1EL0 A;  4GNX A;  1LLR D;  3R3O A;  5D3D A;  3CCS A;  2B8G A;  3EIV A;  1RF2 D;  1UNS A;  2K01 A;  2KEC A;  2UUC Q;  2B2W A;  3OYY A;  4DV5 Q;  1MJC A;  3QIA A;  3U9O A;  4A3K H;  4TVA B;  4ZYS A;  2AUK A;  1VMC A;  2PNH A;  4B3T L;  4JK1 C;  4A3M G;  3OWE B;  1STY A;  1PHJ A;  3L9A X;  1CQV A;  4LF4 L;  3PIO A;  5KGU A;  1E7Z A;  3D3R A;  3ZYY X;  3OPO A;  4DFA A;  1F9S A;  3K6O A;  1C9O A;  4DK0 A;  5KNB A;  1Q86 C;  3MAQ A;  2ID0 A;  2EZV A;  4RG1 A;  3FDT A;  3PSI A;  1H9R A;  1RCV D;  3MTS A;  3CAM A;  3RUZ A;  3SGI A;  2CFM A;  1VQG A;  1GHK A;  1UAP A;  3EFX D;  2M9V A;  4HMJ A;  2WV6 D;  3KUP A;  4U68 A;  4ZQ3 A;  3TN2 A;  1D2B A;  1D1K A;  2M2L A;  3HGB A;  4KY6 A;  3HOW G;  1EQT A;  1HFG A;  1Y14 B;  5D14 A;  1PYW D;  2F0D A;  3HOY G;  1RDP D;  3T1H L;  4NXN Q;  3VA7 A;  5M3M B;  4GNX B;  3ICE A;  1HNZ Q;  2I5L X;  2E2J B;  3S2D B;  4LFA L;  1KD1 C;  4KHZ A;  3B6Y A;  4DK6 C;  1O80 A;  2EYH A;  1JJC B;  1DJR D;  5J39 A;  3KF6 A;  3AFP A;  5FLM H;  1PH5 A;  3G4S A;  1OXX K;  4FNF A;  1HHV A;  1QG7 A;  3LNN A;  1QVG A;  1GVP A;  5IGB A;  3EQL C;  2KHS A;  4JI3 L;  2F3V A;  3FVQ A;  4FP5 D;  2B2U C;  5C4X H;  4P73 A;  4IFD G;  2KCN A;  4Q0F A;  1SYD A;  3MEF A;  1VDZ A;  2Z1C A;  5C4J B;  5GAE C;  1PFS A;  1QUQ A;  2K04 A;  5J1Z A;  2EYL A;  1G6P A;  1HXY D;  4XYO A;  5C44 B;  1IBL Q;  2NVY H;  2NVQ B;  3CF5 A;  5J3B A;  3RZO B;  1VQF A;  2RF4 A;  4KY5 A;  1N8R C;  2JA6 G;  4O42 A;  3I4L A;  1HNW L;  3KLS A;  4DV0 L;  1EU4 A;  4JBW A;  4C56 C;  4YWK A;  3MXG A;  1XJV A;  3X3M A;  3ONA B;  4ZAI A;  4HJ9 A;  5M3F H;  5IGF A;  4L63 B;  4XQQ A;  2C5C A;  2TMP A;  1JOR A;  2Q8R E;  3I73 A;  2PO4 A;  2B2T C;  3IFD A;  3A54 A;  4L5S A;  4QIW B;  1L0W A;  1TS4 A;  4DR4 L;  1SNO A;  5IP7 H;  2HCC A;  3DEO A;  5IGD A;  1EIG A;  3D4W A;  3VYU A;  3MXP A;  5IT9 E;  3PGZ A;  2JYO A;  4QUC A;  3I55 A;  1IZ6 A;  1V1P A;  4A3J G;  2L4N A;  1LT3 D;  2O5I C;  1CSQ A;  2DN8 A;  1KAW A;  4CDD C;  1EY7 A;  5IT9 c;  4EQO A;  1GO3 E;  4OIK A;  1VQO A;  1A62 A;  4GN5 A;  1XNR Q;  2Q8I B;  3RZD B;  2EIF A;  4K2K A;  2R93 G;  3L0O A;  1BCP C;  2XSC A;  5AJ3 L;  4BBR G;  4LF6 L;  1E2W A;  1X32 A;  3K5L A;  2K14 A;  2WFW A;  3QG1 A;  4R9W A;  4B08 A;  5HY6 A;  2E2H H;  2PNR C;  5C3E H;  1X3E A;  1H9K A;  1E3P A;  4GN3 B;  4RKB A;  4HED A;  1X54 A;  2Z6K A;  2F0I A;  1R9T H;  1N33 L;  1N34 Q;  1W6J A;  4QIW E;  2R7Z H;  1SRO A;  3HOV G;  2LMC B;  3FKI B;  1CZG A;  1EWI A;  4BY1 G;  2E5L L;  4FYD A;  3K58 A;  4AQY L;  5ISR A;  4CBV A;  4LUV A;  3J7A V;  1IKM A;  4O2D A;  1AE3 A;  2AMC B;  4Y7N H;  2VZA A;  2N3S A;  3GO5 A;  4DR2 Q;  3EJI A;  2L55 A;  1QIL A;  1Q81 C;  3GTJ B;  3QR8 A;  3PO2 G;  1STN A;  3S9W A;  3E0E A;  4PQX A;  4MZ9 A;  4WFN 3;  1BNZ A;  4KD3 A;  4MTN A;  4HSP A;  2IJ0 A;  3GTK H;  2JA5 B;  4JI0 L;  2BH2 A;  2R7F A;  4EQ5 A;  1JE4 A;  4B3R L;  5CV9 A;  3S15 H;  2EY1 A;  5ELF A;  3SK5 A;  4KMU C;  3IKJ A;  1RD9 D;  4UY8 C;  4OEM B;  3S1M H;  1Y1W G;  3PO3 G;  2VQF Q;  2ES2 A;  4P71 A;  1G8Z D;  3ULL A;  2K75 A;  5C4Z A;  3HEJ A;  2MO0 A;  3DWP A;  3SK8 A;  4X62 Q;  2BDN A;  3S17 B;  3OMG A;  5LMN W;  4A3B G;  4QJF A;  2I5H A;  1STH A;  1XMO L;  4HR7 B;  4X65 Q;  3GTP H;  2E74 C;  4LFB Q;  1LTB D;  2CH4 A;  5JAV A;  3A8I E;  3H0G B;  2K1B A;  3HOU H;  1YI2 A;  2XN9 C;  1H9J A;  5CGK A;  4JBK A;  3BG3 A;  1SE3 A;  1XPR A;  2JEB I;  3GTO H;  1PTO F;  3KDF B;  2R92 G;  4CHT B;  1SJH D;  4DXG A;  2KVM A;  1O7Y A;  1PH1 A;  4K6L A;  3CPF A;  4DK1 A;  1KTK A;  2G5D A;  4GOP A;  1EEF D;  5JEA H;  2UXD Q;  1UWV A;  4BXX H;  3KJO A;  4JYA Q;  1GKH A;  4NB3 A;  4K2L A;  2BA0 A;  3STB C;  1OXS C;  1SXT A;  1B2T A;  1EZ8 A;  3TP6 A;  4LJZ C;  1G51 A;  3GTG B;  1IBM L;  3IAY A;  1BCP F;  1A15 A;  3CC2 A;  3KK7 A;  3BVZ A;  3H15 A;  1NJI C;  3EA6 A;  3R2T A;  5A35 A;  4RCO A;  2SNS A;  4DUZ Q;  3MA2 B;  2D9U A;  3HG9 A;  4FXD A;  2WAQ B;  5LMN Q;  2DY8 A;  1F2Z A;  1PFN A;  4L5R C;  4QQB X;  1IW7 C;  1KC8 C;  4DF7 A;  4DV1 L;  2EPB A;  4BBS G;  1L0Y B;  4HIK A;  4OON A;  3GD7 A;  4HCS A;  3UE1 A;  4A3G H;  3I2Z A;  2F0G A;  1EIY B;  4BA1 I;  4X66 L;  1BDO A;  1EY0 A;  2LXJ A;  3VR2 A;  2PI2 A;  1PFM A;  3NEM A;  4DU9 A;  3JAM E;  4ULL A;  4XQN A;  1F2Y A;  2JEA I;  1XNQ L;  2HDL A;  2VW9 A;  3CC7 A;  1TXY A;  4LF7 Q;  2R7D A;  3I4M G;  3JAM c;  1Q46 A;  4DV7 L;  3AB9 A;  2NYZ D;  1LUZ A;  4IUQ A;  3HOW B;  2NN6 H;  3HOZ G;  4DNR B;  2BE5 C;  1CUK A;  1JR0 D;  2WAQ E;  5IE8 A;  1XYI A;  3C2P A;  5M5Y H;  3HOY B;  3K80 C;  4R4C A;  3W3A A;  2OWO A;  3A7A B;  3LWU A;  4HJ5 A;  4DV2 Q;  3BU2 A;  3NK9 A;  4DK3 C;  4JOI C;  5I9P A;  2A19 A;  1G6Z A;  1F2M A;  2K5W A;  1GOZ A;  2PZW A;  4MIU A;  3RLF A;  2Z4I A;  4B9W A;  1NBW A;  1CA5 A;  3PF5 A;  5CBE E;  2KHJ A;  4LF9 Q;  4IO9 A;  2BA1 A;  1Q82 C;  2Z6K C;  5C0X J;  1O7L A;  3M4O B;  4KKS A;  2F0Q A;  1TS5 A;  2N49 A;  2P5Z X;  3TDQ A;  4NW2 A;  5EPK A;  2F0M A;  3K7A B;  3RLN A;  1UEA B;  3M4Y A;  3D0F A;  4PZ8 A;  3GV3 A;  3NEN A;  1I3Q B;  4L6T B;  2UU9 Q;  1SJE D;  2A68 C;  3IFT A;  1Y8N B;  2L15 A;  1PRT C;  3A0J A;  3S2H B;  3CCV A;  3MFY A;  1J8I A;  1TVX A;  4ZUI A;  2WIN B;  4QB4 A;  1SMX A;  3SXH A;  3H6M A;  4K8J A;  5M3M H;  1VQA A;  2XWJ B;  2Z6B A;  5DAU A;  2E2J H;  2IW3 A;  3S2D H;  4HJ7 A;  3CCM A;  4DR7 Q;  1LT4 D;  1S5E D;  3C3L A;  1EY9 A;  4LF5 Q;  2OQ0 A;  1BQQ T;  3U9S A;  1MBY A;  2PI2 E;  2NWG A;  2QA4 A;  2K32 A;  5E3F A;  4A3F G;  2IL8 A;  3HKS A;  1TII D;  5M5W B;  2HHH L;  1Q7Y C;  1JJ2 A;  1ZXT A;  1PYB A;  1Z47 A;  3NTI A;  2CW0 C;  5C4J H;  1QZH A;  4UHV A;  2IY5 B;  4JI7 Q;  4HCE A;  2WP8 J;  4CKB A;  5C44 H;  4DAM A;  4FDB A;  2IT1 A;  2NVQ H;  1LTR D;  1Z6H A;  3CCQ A;  2R93 B;  3HS0 C;  3VYT A;  3RLO A;  1DOK A;  2FXQ A;  4BBR B;  5BR8 L;  1VQJ A;  5FJ8 H;  1NMG A;  2MQH A;  3DHQ A;  1STE A;  4Y7N B;  2N8N A;  4C3I G;  1VQP A;  3CW2 C;  1FNV A;  2YTX A;  1WI5 A;  1PH7 A;  4A3D G;  2XNA C;  5I9O A;  3HOV B;  4KY7 A;  3BVM A;  4BY1 B;  4EVO A;  1CKM A;  3RR5 A;  2JA8 G;  5CV6 A;  3W1B A;  3CPW A;  2ATW A;  3K59 A;  2MHV A;  4AYB G;  2NZ1 D;  2A73 B;  1IL8 A;  4RAU C;  1CM9 A;  2RBM A;  1HA5 A;  4DR5 Q;  4DR1 L;  3QB3 A;  3M9B A;  2VL6 A;  1K8M A;  2PZU A;  1SBB B;  2OTL A;  4KLK A;  1SR3 A;  5IOD A;  2B2U A;  5IYC H;  3PO2 B;  1IHZ A;  3M7N A;  3H3V C;  1AFP A;  1HJP A;  3RZD H;  1NMF A;  1ESR A;  4RGN A;  1HR0 W;  1WCM G;  4G7H C;  3U50 C;  1Y1V G;  5LMU Q;  1EOT A;  2AQ3 B;  5M5X B;  2MFI A;  4PMW A;  1C8C A;  1HUN A;  3VR4 A;  1YJ9 A;  1KAA A;  3MZ5 A;  1Y1W B;  5G3L D;  3CD6 A;  1AEX A;  4JBJ A;  1PVO A;  1B44 D;  3AMU A;  2UUA L;  3GTO B;  3FKI H;  2JA9 A;  2QEX A;  5JJK A;  4OEL B;  1QOH A;  2Y0S G;  1TWA B;  2FJ2 A;  4I7Z C;  3M3Y B;  2B2T A;  3VR5 A;  4A3B B;  3A56 A;  4ZKC B;  1HUM A;  2Z0S A;  4C3H G;  2B63 G;  4A4I A;  3J7Z C;  1GJX A;  4OHJ A;  1K73 C;  3KYH C;  3PV0 A;  1Y8O B;  3CHB D;  4IAL A;  3GTJ H;  1SNQ A;  5IIF A;  4DR3 L;  3FPP A;  4OX9 L;  3FHW A;  2E2D C;  4M8A A;  4HIO A;  2JA5 H;  3NBI A;  1R4P B;  2R92 B;  4A3I G;  4DA2 A;  2DGY A;  4CJ0 B;  2SDF A;  2KUM A;  4P75 A;  1GUG A;  1ET6 A;  1L0X B;  4YCU A;  1X3P A;  2QCP X;  3KF8 A;  2X6L A;  2EYJ A;  1BKB A;  1U5K A;  3TSS A;  3MHB A;  2JA7 G;  2Q8T A;  1LYL A;  3HFZ B;  5T1G A;  4OO1 H;  3S17 H;  3RN2 A;  4LAA A;  1JQY D;  1HR0 Q;  2ZXP A;  2F0N A;  4QY7 A;  4K0K L;  3NQT A;  3O13 A;  3H0G H;  2QGQ A;  2FMM A;  1N32 Q;  2ZXR A;  5C0X H;  1PA6 A;  2VQE Q;  1VQ9 A;  5ELO A;  1K8G A;  4WRD A;  4JI6 L;  2B8F A;  3I4N G;  3FPU B;  3MXN B;  1PLF A;  3F8T A;  1TR5 A;  5LHY 1;  1B4O A;  1KXL A;  1YNJ D;  5E7N A;  1RJT A;  3I4O A;  4NPS A;  3HOX G;  3SVM A;  3DLL A;  3I8Z A;  1I4H A;  2RCN A;  3KF8 B;  5F2D A;  1B9N A;  1SAP A;  4BBS B;  2E2I B;  3OIP A;  2G9H D;  1FR3 A;  4JBM A;  2R3Z A;  4LK1 C;  2FMC A;  1RL2 A;  5M5Y B;  1CHP D;  1YNN D;  4K5V A;  4KJO A;  3PIP 3;  1UUP A;  4JI1 L;  1M90 C;  2D2C C;  4P74 A;  2DY7 A;  1S4Z A;  3GTG H;  2ALY B;  3FMC A;  5D65 A;  5EKK A;  5JVG 3;  4X3T A;  2E8G A;  5IWA L;  2RVL A;  2A74 C;  4X64 L;  4KN4 C;  3I4M B;  4B3M L;  4JI8 L;  3VYR A;  4C3J G;  1IBK L;  3HOZ B;  1KNA A;  3OWF A;  3VDY A;  3PIP A;  2B39 A;  3GTQ B;  3UDX A;  1YEZ A;  5FLX E;  3AU7 A;  4IUP A;  1HA6 A;  3G7L A;  4Z9C B;  3WWV A;  4CJ1 B;  2DNE A;  1XMQ L;  4WJ4 A;  3DXJ C;  4ILW A;  4HMI A;  1XTD A;  4LF8 Q;  5FO7 B;  4OWX B;  2KCM A;  1FD7 D;  2KEE A;  4A3M H;  4PG3 A;  1B3Q A;  1ENC A;  1CA6 A;  4DV3 L;  1G2T A;  4JI4 Q;  3E3X A;  1GHJ A; 
#chains in the Genus database with same CATH homology
 1WCM H;  1Y1W G;  1A0I A;  3PO3 G;  1Y1V H;  5IYD G;  2B3G A;  4QGU A;  2VQF Q;  2ES2 A;  2HT1 A;  1VQE A;  1YNX A;  2EQS A;  4P71 A;  4GN4 B;  3E9H A;  4DPG A;  3ULL A;  1HR0 L;  2K75 A;  4X66 Q;  1SN8 A;  5HGQ A;  1PYS B;  3G48 A;  1YHA A;  2MO0 A;  2HQL A;  4X62 Q;  3I7F A;  4DUY Q;  1D7Q A;  1X6O A;  1VQ7 A;  1XNQ Q;  1CKO A;  3HKZ G;  3GDE A;  1ASZ A;  4POG A;  4L5T A;  2A8V A;  5M3M G;  1KIX A;  3HOW H;  5LMN W;  4A3B G;  4YWM A;  4QJF A;  2I5H A;  3L2P A;  1XMO L;  1GM5 A;  1N32 L;  4PZ6 A;  4A76 A;  4X65 Q;  3JAM i;  3GTP H;  2YU9 H;  1E22 A;  3HOY H;  2VQE L;  5GRO A;  4DV7 Q;  2VNU D;  2GVB A;  4LFB Q;  2I5M X;  1MJE A;  2CWA A;  3GTL H;  3M4P A;  4C3H H;  1E1O A;  2K5H A;  2B63 H;  3HOU H;  1YI2 A;  1PH4 A;  3LGJ A;  4JBK A;  4GKJ L;  2PQA B;  3KOJ A;  4LWC A;  1XPR A;  2JEB I;  3GTO H;  2R92 G;  3KDF B;  4LFC Q;  1ASY A;  3D31 A;  4A3C G;  4YWL A;  2ZTE A;  1XNR L;  1PH1 A;  1JT8 A;  4YY3 L;  3M4O H;  2CWP A;  3J80 i;  3CPF A;  1HNX L;  4A3I H;  4YHH Q;  1CSP A;  1QVC A;  3K7A H;  5C44 G;  2CCZ A;  4GOP A;  2K4K A;  2ZM6 L;  3U4V A;  4HJ8 A;  3UDF A;  3KF6 B;  2JJQ A;  1I3Q H;  2UXD Q;  1UWV A;  2EXD A;  2UXB Q;  4UP9 A;  4R4T A;  4BXX H;  3KJO A;  4JYA Q;  1Q12 A;  1GKH A;  4GLA C;  4NB3 A;  2AKW B;  4JI5 Q;  1T9H A;  5FJ8 G;  1MKH A;  2BA0 A;  3STB C;  4JI2 Q;  1N34 L;  1OXS C;  3T1Y L;  3S2H H;  5IYB G;  4GLV B;  4L5Q A;  2JA6 H;  1G51 A;  3ULP A;  1K83 H;  4R4Q A;  4DV6 Q;  2JA7 H;  3UDI A;  1IBM L;  3PUW A;  4KHP L;  3Q8D A;  3BZK A;  3CC2 A;  3H15 A;  1X55 A;  1NJI C;  1QUQ B;  4GLX A;  4BY7 G;  2LSS A;  5DLQ E;  1UE7 A;  1N9W A;  3RNU A;  1CKN A;  5ELN A;  4DR2 L;  4DUZ Q;  4PZ7 A;  2VUM G;  2Q2U A;  3RZO H;  4JOI A;  4IJH A;  1A8V A;  3CME A;  1GD7 A;  3K0X A;  2JK8 A;  4LF8 L;  2RHQ B;  3TQY A;  4A3K G;  5LMN Q;  5EAY A;  2UXC Q;  1S3O A;  3PUX A;  1YIJ A;  3I4N H;  5M5W H;  1E1T A;  3TRE A;  1W3S A;  3KFU A;  5IYC G;  4L5R C;  2AWO A;  4QQB X;  3DM3 A;  1KC8 C;  4JI4 L;  4A3J H;  4DV1 L;  2NVT H;  4BBS G;  4DR6 Q;  3M4Q A;  4NXM Q;  1A63 A;  4AH6 A;  1P8L A;  4HIK A;  1YVC A;  4OON A;  1YJW A;  2OTJ A;  5K36 G;  3A5U A;  2HHH Q;  5GAD C;  3HOX H;  2VQF L;  1YHB A;  3GD7 A;  3S1R H;  1V9P A;  3UE1 A;  4A3G H;  3I2Z A;  4GS3 A;  3EBE A;  4LUZ A;  3A74 A;  4AIM A;  3F2D A;  4GOP C;  4JG2 A;  1XPO A;  1PH2 A;  4BA1 I;  2NN6 I;  4X66 L;  1EQQ A;  2I0Q A;  2ZJQ A;  2R93 H;  2LXJ A;  2NZH A;  2PI2 A;  3A5Z B;  3NEM A;  1UE5 A;  3PCO B;  4BBR H;  4X62 L;  4DUY L;  2JEA I;  4J15 A;  1Q8K A;  1XNQ L;  1B8A A;  2GVA A;  2VW9 A;  4XTC S;  3CMA A;  1D8L A;  1WJJ A;  2ASB A;  3CC7 A;  1K3R A;  1TXY A;  4LF7 Q;  2IX0 A;  3FKI G;  4X65 L;  2R7D A;  3I4M G;  3JAM c;  3CCE A;  1Q46 A;  4TQU S;  5BR8 Q;  4DV7 L;  1C7Y A;  4A75 A;  5FLX c;  2H5X A;  1FJG Q;  4LFB L;  1CKN B;  3ER0 A;  1WYD A;  3HOV H;  1LUZ A;  3TRZ A;  4WJ3 M;  1HZC A;  3HOZ G;  3FP9 A;  1CUK A;  5IP9 H;  3OTO Q;  1M1K C;  3PF4 A;  2WAQ E;  5IE8 A;  4BY1 H;  5M5Y H;  5JJL A;  2YTV A;  3K80 C;  4R4C A;  4A3L H;  4AYB E;  2OWO A;  4C3J H;  2DUD A;  4HJ5 A;  4DV2 Q;  3S16 H;  4OWT B;  3BU2 A;  2BH8 A;  4LFC L;  4DK3 C;  4JOI C;  1TWF H;  2A19 A;  2N78 A;  1VCI A;  5FLM G;  3J81 i;  1VQH A;  1PH3 A;  3H3V H;  1H95 A;  3PUV A;  1VQI A;  4OXP A;  1YZ6 A;  4P72 A;  2F4V L;  4A93 H;  1FGU A;  3RLF A;  4IFD J;  3J80 c;  1NBW A;  2NZO A;  4YHH L;  2JA5 G;  5JEA J;  1VQ4 A;  3PF5 A;  3PO2 H;  2KHJ A;  4LF9 Q;  2AHO B;  4IPC A;  4IO9 A;  2BA1 A;  3W1G A;  3J81 j;  1Q82 C;  2Q2T A;  5C4X G;  3W5O A;  2Z6K C;  4A3G G;  5C0X J;  3KJP A;  3CXC A;  4DR1 Q;  2XTI A;  2UXD L;  1BBU A;  2UXB L;  2N49 A;  3PUY A;  1I5F A;  4JYA L;  1AH9 A;  2K5N A;  4DV4 Q;  4JI5 L;  3TEH B;  4B3T Q;  4JI2 L;  3RLN A;  1IYJ B;  3HOU G;  4LW1 A;  3D0F A;  5M5X H;  4LF4 Q;  4PZ8 A;  1EOV A;  3NEN A;  2GN5 A;  3AQQ A;  2UU9 Q;  1Y1W H;  4DV6 L;  3PO3 H;  5IYD H;  2L15 A;  1L1O A;  1W2B A;  1OTC A;  3IRB A;  3S1Q H;  3A0J A;  1VQB A;  4OO1 G;  5GAG C;  1NTG A;  2VS1 A;  3CCV A;  1Q1E A;  1YBY A;  2Y0S E;  4LUO A;  2JE6 I;  5M3F G;  2HIX A;  1VQ6 A;  1JJG A;  1SMX A;  3U4Z A;  4DUZ L;  2Q2I A;  2F4V Q;  1TWA H;  5M3M H;  4OO1 I;  1J6Q A;  1FVI A;  3CQZ H;  3M3Y H;  1VQA A;  3G71 A;  1PH9 A;  4A3B H;  2IHE A;  2E2J H;  3S2D H;  1KRS A;  2UUA Q;  1HZ9 A;  3H0G G;  3ULJ A;  4HJ7 A;  4BXX G;  3CCM A;  1I94 Q;  3TS2 A;  4EX5 A;  1QZG A;  1PH8 A;  4LNQ A;  4DR7 Q;  5LMN L;  1S72 A;  2UXC L;  5C0X G;  4O0A A;  3T1H Q;  4MNO A;  1N36 Q;  4JV5 Q;  5IP7 G;  2KCT A;  1X3G A;  1SLJ A;  4APV A;  1HH2 P;  4LFA Q;  3TS0 A;  4R1J A;  2OQ0 A;  1J5E Q;  4LF5 Q;  1Z9F A;  2PI2 E;  3F1Z A;  5C0X I;  4DNI A;  4DR6 L;  4POF A;  2QA4 A;  4UPA A;  4NXM L;  4DR4 Q;  1UE1 A;  1LM0 A;  2YTY A;  4A3F G;  3HKS A;  2HHH L;  2R92 H;  1Q7Y C;  1JJ2 A;  4A3C H;  1S40 A;  1PYB A;  1Z47 A;  4DR3 Q;  1DGS A;  1KL9 A;  5C4J H;  1QZH A;  1YJN A;  2IY5 B;  4JI7 Q;  4IPG A;  4HJA A;  4OX9 Q;  1IXR A;  4JI3 Q;  2KBN A;  2WP8 J;  2YV5 A;  5C44 H;  1L1O B;  1YHQ A;  3F2C A;  4DAM A;  4FDB A;  2IT1 A;  1AE2 A;  4UP8 A;  4ALP A;  3NEL A;  2NVQ H;  4LF7 L;  1IL2 A;  5H1S E;  3CCQ A;  3OW2 A;  4A3E G;  5C3E G;  1NE3 A;  1OXV A;  4GKK L;  3RLO A;  2FXQ A;  5BR8 L;  1TWC H;  1SE8 A;  1VQJ A;  5FJ8 H;  1NMG A;  1FJG L;  2Q2H A;  2MQH A;  1L1O C;  2UUB Q;  4Y52 H;  2OQK A;  2N8N A;  5IYB H;  2K50 A;  1VQP A;  3OTO L;  2R7Z G;  4IOC A;  2VY3 A;  3S24 A;  3CW2 C;  4GOP B;  2YTX A;  1WI5 A;  2HIV A;  1PH7 A;  4R4I A;  1MIU A;  1HNW Q;  4DV0 Q;  4DV2 L;  4UP7 A;  2KEN A;  4B3S Q;  4A3D G;  1SFO H;  1Q1B A;  2F3I A;  2ZJR A;  2D0P A;  3BJU A;  1VS0 A;  1EUJ A;  3ERS X;  3J81 c;  4BY7 H;  1VQM A;  1I6H H;  1VQD A;  1L2F A;  1CKM A;  1OXU A;  3NBH B;  3RR5 A;  2JA8 G;  1LTL A;  1U0L A;  3F2B A;  4K0K Q;  1UE6 A;  3W1B A;  2WAQ G;  2VUM H;  1VQ8 A;  3CPW A;  2ATW A;  4GNX A;  3CCS A;  3EIV A;  4LF9 L;  3CP0 A;  4AYB G;  2UUC Q;  2IHF A;  2RHS B;  3OYY A;  4DV5 Q;  4IPH A;  1MJC A;  2V1C C;  2MNA A;  1TWG H;  2D0O A;  4DR1 L;  4DR5 Q;  4A3K H;  2NVX H;  4TVA B;  3M9B A;  2CKZ B;  3S14 H;  1C0A A;  2ZTD A;  2VL6 A;  1HZA A;  4JI6 Q;  4DV4 L;  2PNH A;  2OTL A;  4KLK A;  1SR3 A;  5IYC H;  4B3T L;  4GKK Q;  3K81 C;  3PUZ A;  4A3M G;  1QVF A;  1RIP A;  3K7U C;  1PHJ A;  1JB7 A;  3M7N A;  2E2I H;  4LF4 L;  1HJP A;  3PIO A;  4BBS H;  1E7Z A;  3RZD H;  2UU9 L;  1NMF A;  1C9O A;  1Q86 C;  1HR0 W;  1WCM G;  2K5V A;  2ID0 A;  3U50 C;  1VQC A;  1Y1V G;  3L7Z C;  5LMU Q;  4RG1 A;  1EFW A;  3PSI A;  1EQR A;  2MFI A;  4PMW A;  3CAM A;  3SGI A;  1YJ9 A;  2CFM A;  1V43 A;  1VQG A;  2XGT A;  5AJ3 Q;  4LF6 Q;  3CD6 A;  1FL0 A;  2D62 A;  4JBJ A;  1PVO A;  1G29 1;  1P16 A;  2UUA L;  3HOW G;  3FKI H;  2JA9 A;  2PQA A;  2QEX A;  1Y14 B;  3I4M H;  1KRT A;  5JJK A;  2WB1 E;  3STB D;  4JI1 Q;  3CCR A;  1I94 L;  3KDF A;  3I56 A;  3GTM H;  4DR7 L;  3HOY G;  3T1H L;  2Y0S G;  1N36 L;  3CCJ A;  4JV5 L;  4NXN Q;  4GNX B;  3ICE A;  1N33 Q;  5IWA Q;  1HNZ Q;  4XIG S;  2I5L X;  3HOZ H;  4LFA L;  5IY0 A;  1J5E L;  1KD1 C;  4X64 Q;  4LF5 L;  4KHZ A;  3GTQ H;  2Z0S A;  3B6Y A;  4DK6 C;  2K52 A;  4JC0 A;  4A4I A;  2B63 G;  2E5L Q;  3J7Z C;  4RMF A;  4B3M Q;  1NY4 A;  4JI8 Q;  1JJC B;  4DKA C;  3KF6 A;  4AQY Q;  3KYH C;  1K73 C;  3PV0 A;  4GNX C;  3GTJ H;  3AFP A;  1BBW A;  5FLM H;  1IBK Q;  1UEB A;  4DR3 L;  4IJL A;  3G4S A;  1PH5 A;  4HID A;  1OXX K;  4JI7 L;  1QVG A;  1GVP A;  4OX9 L;  3FHW A;  3EN2 A;  1VQN A;  4JI3 L;  4HIO A;  2JA5 H;  2YYZ A;  4A3I G;  1X56 A;  5C4X H;  4P73 A;  4IFD G;  1XMQ Q;  2DGY A;  3MEF A;  3K8A A;  4P75 A;  5JEA G;  1HZB A;  5GAE C;  2IX1 A;  1PFS A;  1QUQ A;  4YCU A;  1G6P A;  4JI0 Q;  4IFD I;  2UUB L;  4B3R Q;  4IOA A;  1OXT A;  1IBL Q;  2NVY H;  4DV3 Q;  3CF5 A;  5J3B A;  1VQF A;  2RF4 A;  1N8R C;  5GQO A;  3HKZ E;  1BKB A;  2JA6 G;  4ME3 A;  1U5K A;  4YCV A;  1PV4 A;  1HNW L;  1V1Q A;  2JA7 G;  4DV0 L;  1LYL A;  4HIM A;  4B3S L;  3HFZ B;  4JBW A;  1VQL A;  4YWK A;  1KHI A;  3S17 H;  3RN2 A;  1XJV A;  1X3F A;  1HR0 Q;  4HJ9 A;  1O7I A;  5M3F H;  3AYH B;  4QY7 A;  4K0K L;  1TWH H;  1B70 B;  3JC6 6;  3ZJY C;  3H0G H;  2UUC L;  4DV5 L;  2QGQ A;  4L5S A;  4R4O A;  1XMO Q;  4DR5 L;  1N32 Q;  1L0W A;  4OWW B;  1PA6 A;  2VQE Q;  1VQ9 A;  4DR4 L;  3BZC A;  5ELO A;  5IP7 H;  1YIT A;  1K8G A;  1EIY B;  3CC4 A;  4JI6 L;  2F52 A;  3I4N G;  3MXN B;  3S1N H;  3PGZ A;  3F8T A;  3I55 A;  1IZ6 A;  1PH6 A;  4A3J G;  1VQ5 A;  4YCW A;  1KXL A;  4GKJ Q;  1CSQ A;  4A3F H;  5E7N A;  3I4O A;  1KAW A;  1JE5 A;  1K0R A;  4NPS A;  3HOX G;  5LMU L;  5IT9 c;  1GO3 E;  2C35 B;  5GAH C;  3E9I A;  3DLL A;  1VQO A;  1A62 A;  2RCN A;  3KF8 B;  4H02 A;  4GN5 A;  1XNR Q;  1WFQ A;  1WOC A;  4YY3 Q;  2EIF A;  2R93 G;  2ZJP A;  3L0O A;  4JBM A;  1EYG A;  5AJ3 L;  4LF6 L;  1RL2 A;  4BBR G;  1HNX Q;  2K14 A;  3KLW A;  4KI0 A;  2WFW A;  3UE0 A;  4C2M H;  5HY6 A;  2ZM6 Q;  2E2H H;  4A3E H;  5C3E H;  1JMC A;  4QL5 A;  1X3E A;  3AEV A;  5JJI A;  2PMZ E;  2R6G A;  4JI1 L;  1M90 C;  4P74 A;  1E3P A;  2A1A A;  4GN3 B;  3GTG H;  4NXN L;  2ALY B;  1X54 A;  1KQS A;  2Z6K A;  1SRU A;  1R9T H;  1N33 L;  4C3I H;  2OCE A;  2E8G A;  4QIW E;  5IWA L;  4IPD A;  1N34 Q;  3T1Y Q;  1HNZ L;  1SRO A;  1XPU A;  1X9N A;  2R7Z H;  4X64 L;  2NN6 G;  3HOV G;  4JCV E;  2LXK A;  5IP9 G;  4X6A H;  1EWI A;  4BY1 G;  3UDG A;  2E5L L;  4B3M L;  4JI8 L;  4A3L G;  4AQY L;  4A3D H;  2WB1 G;  1IBM Q;  1K8A C;  4KHP Q;  1E24 A;  1IBK L;  3CCU A;  4BA2 I;  4LUV A;  3AFQ A;  3VDY A;  3PIP A;  2JQO A;  3UDX A;  1YEZ A;  2JA8 H;  4O2D A;  1AE3 A;  1X65 A;  2KHI A;  2AMC B;  4Y7N H;  1BVS A;  4A93 G;  2MO1 A;  2N3S A;  2VZA A;  3GO5 A;  4DR2 Q;  3U58 A;  1Q81 C;  3CCL A;  3WWV A;  3PO2 G;  3H3V I;  1XMQ L;  3J7A 5;  4WJ4 A;  3E0E A;  2CQO A;  1EIF A;  4MZ9 A;  1B7Y B;  1XTD A;  4LF8 Q;  2AWN A;  2B29 A;  4MTN A;  1VQK A;  3GTK H;  4OWX B;  2KCM A;  3M85 A;  4JI0 L;  3RN5 A;  2R7F A;  4EQ5 A;  1I50 H;  4PG3 A;  4A3M H;  2BH2 A;  4B3R L;  1IBL L;  3S15 H;  4DV3 L;  4JI4 Q;  3G6E A;  4DV1 Q;  1K9M C;  2ZTC A;  4DAY B;  4UY8 C;  3S1M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...