4GOPB

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
122
Chain Sequence
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
total genus 29
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopB00
1CSQA 3M4QA 4A3DG 4DR1L 2UUBL 4HJ5A 4LFBL 1KRTA 3GTJH 1Q8KA 4X65L 5FJ8G 4IFDG 5K36G 2JA5H 3T1YL 3TQYA 2EXDA 3TRZA 3CC4A 4JOIA 1YJ9A 4PZ8A 1PH9A 2BA0A 3A74A 3JC66 4P71A 5IP7G 3HOYH 2MO0A 3G48A 3CCEA 2EIFA 1K83H 3PUWA 1OXXK 3S15H 2JE6I 5M5WH 4IJLA 4ALPA 1YIJA 2PNHA 4YCVA 2R93G 4KLKA 5LMUQ 1SMXA 1WCMH 1W2BA 5GQOA 3TS2A 2Y0SG 5C4XH 1Y1VG 1TWHH 3GTQH 3ICEA 3H0GH 3S2DH 4YY3L 2JA5G 4B3SL 4DV3Q 2K52A 3NELA 5IYDH 2R7ZH 2Z0SA 3S14H 1MIUA 2PI2E 3EBEA 1PYSB 4L5QA 4B3MQ 3PCOB 3CCSA 3F2BA 4A3KG 2Z6KC 1VQHA 5M3FH 1I3QH 3G71A 4OO1G 4B3TL 1ASZA 3I4NG 4A3JH 5JJKA 1I5FA 4AYBG 4JBKA 1NMFA 3L7ZC 1Y1WG 4GLVB 4A93G 5C4XG 4JI5L 1L0WA 2E5LL 4IPDA 1OXVA 3H0GG 4B3TQ 1AE2A 2BH2A 4HJ9A 1VS0A 3ZJYC 4A3IH 1SFOH 4DR3L 3CW2C 3HKZG 3KF8B 1N33L 2QEXA 2CFMA 4DUZL 3RNUA 1RL2A 2WAQG 5C3EH 1FGUA 1NTGA 4DV4Q 4JI3L 4LFCL 4EQ5A 3CCLA 1SE8A 1DGSA 3MEFA 4DV0Q 1L1OC 1OTCA 1MJCA 4LUVA 4A3JG 2JA7G 1P8LA 1SR3A 3F2CA 3MXNB 4JI3Q 5DLQE 3STBC 3HOUG 3EN2A 1B7YB 1VQOA 2K5NA 1FL0A 3PUVA 4JI1L 2H5XA 4A3IG 3K0XA 2OCEA 1HH2P 3DLLA 4DUYL 1IXRA 4X64L 4HJ8A 3UDGA 4LF8L 4X66Q 5C4JH 2UU9Q 5IT9c 4A3FG 1XNRQ 3BJUA 1GKHA 2R7DA 5LMNL 4LFAL 5GAEC 1LYLA 3CQZH 3ERSX 4HIOA 3VDYA 1N36Q 4MNOA 4BXXH 4JYAL 3J7ZC 1HNWL 2CKZB 1JB7A 4PG3A 2GVBA 4DR7Q 4JI2L 1QUQB 4DV6Q 1VQEA 5C0XI 1EYGA 1LUZA 4HJ7A 1A63A 3J80i 4X62Q 3KOJA 5HGQA 4TVAB 1JT8A 4DR4Q 2ZTCA 1K3RA 1W3SA 1IBLQ 2CCZA 1CSPA 1TWAH 1YHQA 2K4KA 3S1RH 4JI4L 1VQ5A 4OWWB 2NVTH 2AHOB 2WFWA 1HR0L 2Q2HA 3GTKH 3T1HQ 2XTIA 4XIGS 4GNXC 4DKAC 4AIMA 5IYCH 1JJCB 4J15A 5H1SE 1R9TH 4BXXG 3HOXH 4B3RL 3M4OH 3KF6A 4JI8Q 2R7FA 4DV2Q 3HOWG 4JC0A 2MO1A 2AWOA 3M4PA 5IYBG 3CMAA 4HJAA 3S1MH 4JV5Q 3W5OA 3CC2A 3KDFA 2NZOA 1EIYB 4WJ3M 1XNQL 2NVYH 4A3MG 3CC7A 2HHHL 2MNAA 5M5XH 3AQQA 1PH7A 4A3DH 5JJLA 4PMWA 3KFUA 1UE1A 4BY7H 2I5LX 1S72A 1KXLA 2KCMA 3FKIG 1CKNA 3CXCA 2UXCL 5JJIA 4DR5L 3F2DA 3KJOA 5IYCG 3TS0A 1VQ6A 2RF4A 3UE0A 2WB1G 4OX9Q 3GTPH 1SROA 1QVFA 1KAWA 5IP7H 1XTDA 4GOPC 4NXNL 4GKKL 2UXBQ 2E2IH 3CF5A 2VZAA 3RN5A 3S1NH 4OWTB 4YCUA 2R93H 3RLFA 4JI6L 3M3YH 2VQFQ 5GADC 4QGUA 2YTXA 5JEAJ 3ULPA 3CCVA 4RMFA 3NBHB 4YHHL 4BBSG 1Y1VH 2JEAI 3S17H 4BY7G 2DUDA 2OTLA 3PIOA 2JJQA 4LF4L 1JE5A 1I50H 1BBUA 3CD6A 1OXTA 3AFPA 2L15A 2ZM6L 1B70B 4DR1Q 2UUBQ 5M5YH 1NE3A 4LFBQ 4GN5A 4DK3C 1FJGL 4X65Q 1N34L 4APVA 4L5TA 4BA1I 4A3KH 1K8AC 3T1YQ 4R4OA 1BKBA 2ZM6Q 3BZKA 3I4NH 3U50C 3M7NA 4LWCA 4P75A 2OTJA 4GLXA 4DV7L 2PQAA 3J80c 1Y1WH 1M90C 4HIMA 2VQEL 4A93H 2HIXA 2UXDL 5C0XJ 3G6EA 3J81c 2IX1A 4IFDI 3D31A 4QQBX 3RR5A 1NY4A 4DAMA 2K5VA 1YNXA 1IBKL 2KCTA 1Q7YC 1G6PA 2F3IA 2CWPA 4JCVE 4GKJL 1PH5A 4YY3Q 1NMGA 3A5UA 4QY7A 1XMOL 3CCQA 3I7FA 4DV1L 3GTOH 5FLMG 2JA7H 3RLOA 1N32L 1HZBA 3CP0A 2DGYA 2MFIA 4AYBE 5GROA 2UUAL 3S2HH 4A76A 1SLJA 1Q12A 4PZ7A 1E1OA 1D8LA 3PF4A 4LF9L 1VQPA 1WI5A 1YZ6A 3HOUH 3A0JA 1YHBA 4A3CG 2LXKA 5IWAL 3U4VA 3GTLH 3GO5A 3HKZE 1Q1BA 4JBWA 1XMQL 1GD7A 3UDIA 2NN6G 3CCMA 2R6GA 1Z9FA 3PGZA 2BA1A 2WAQE 3I4MH 3KF6B 1PYBA 1QVCA 2NZHA 1ASYA 2E5LQ 3HFZB 4JI5Q 2IHEA 4A3FH 2F4VL 2HT1A 2B63G 3TEHB 3UDFA 3KDFB 4UPAA 4DR3Q 1N33Q 5BR8L 2MQHA 2YV5A 4OO1I 4DNIA 4DUZQ 1PHJA 2ATWA 2XGTA 1U0LA 4R4IA 2HIVA 1U5KA 4JI7L 4LFCQ 2K14A 4KHPL 1CKNB 1UEBA 1KL9A 3K7AH 4UP9A 4L5RC 3M85A 5E7NA 2YTVA 4POFA 3I4MG 3PO3G 2Z6KA 1WOCA 4JI1Q 4A3BG 4JI0L 3I55A 2PMZE 1NBWA 2ZTDA 1VQIA 1PH4A 3PV0A 4DUYQ 1J5EL 4X64Q 4LF8Q 1GO3E 4LUOA 2IX0A 2ALYB 4YWLA 5J3BA 3HOWH 5IYBH 4A4IA 4HIDA 4P74A 4LFAQ 5LMNQ 1J6QA 3AYHB 2RHQB 1VQJA 4A3MH 4JYAQ 1I94L 2LSSA 4R4TA 3DM3A 4K0KL 3G4SA 4DR6L 1TWGH 1YEZA 1HNWQ 4IPGA 3H3VH 1VQ4A 1PV4A 1K8GA 3CAMA 1OXUA 1CUKA 3SGIA 4QIWE 4JI2Q 3J81i 1KD1C 4UY8C 4AQYL 4LNQA 4LF6L 1L1OA 1OXSC 3FKIH 4P73A 3H15A 4LF7L 2YU9H 3E9IA 3U4ZA 3F1ZA 1VQ8A 4B3SQ 3IRBA 1IBML 4JI4Q 1VQCA 4IFDJ 3RZDH 4BY1G 3OW2A 3NEMA 4A75A 1HR0Q 5GAGC 2AKWB 1EIFA 1XPUA 1MKHA 2N3SA 3STBD 2JA6H 3BZCA 2GN5A 4DAYB 4DV5L 1M1KC 3KLWA 2EQSA 4B3RQ 1QZGA 1VQFA 4Y7NH 1AH9A 2QA4A 5LMNW 4DR2L 4NXML 3CCJA 2IHFA 4BBSH 1N8RC 1D7QA 4IOCA 2UUCL 3L2PA 2HHHQ 2VS1A 2WB1E 5IP9G 5IE8A 5GAHC 1S3OA 4R1JA 1EFWA 4JBMA 4X6AH 4PZ6A 4JOIC 4YWKA 2K50A 2JA6G 1EUJA 4DR5Q 2UXCQ 3OTOL 3AEVA 1IYJB 1JJGA 1VQBA 3S24A 1CKOA 2A1AA 3W1GA 1HNXL 4QL5A 1PH6A 1HR0W 2I0QA 1HNZL 3H3VI 2KBNA 4GNXA 4NXNQ 3TREA 1UE5A 4GKKQ 1LTLA 3E9HA 4LF5L 4C3JH 2Q2TA 2A8VA 1VQ7A 4P72A 5ELOA 4JI6Q 5AJ3L 3UE1A 3JAMi 1GVPA 1V43A 2VL6A 1PH3A 4YHHQ 1E1TA 1Q82C 1HZCA 5EAYA 4IO9A 4LF4Q 2I5MX 3ULJA 1YI2A 4A3EG 1IZ6A 4A3GH 5FLMH 1XPRA 3Q8DA 3PSIA 4IJHA 3HOZG 4MTNA 1HJPA 2Y0SE 1PFSA 1X3GA 2Q2IA 3CCRA 1FJGQ 3PUXA 1N34Q 1X65A 4NB3A 2E2JH 1QUQA 4Y52H 2PI2A 1WFQA 3GTGH 4O2DA 2YYZA 3ER0A 3LGJA 4OWXB 3GTMH 4A3CH 3K8AA 3D0FA 4UP8A 5M3MH 1YJWA 4A3LG 4HIKA 4GOPA 3RZOH 4DV7Q 4KHZA 5LMUL 1O7IA 2VQEQ 1X3EA 3KJPA 4R4CA 2JA9A 2B63H 2NVQH 2UXDQ 1EQRA 4DPGA 4A3GG 2ZJQA 1IBKQ 3B6YA 2ZJRA 5C44H 1PH1A 3PF5A 4DV3L 4GN4B 4JG2A 2CWAA 2IT1A 1YJNA 2Q2UA 4GKJQ 1XMOQ 4B3ML 1PVOA 4OXPA 1Q1EA 4DV1Q 1K73C 3GD7A 2D0OA 1VQAA 1L1OB 1PA6A 1N32Q 4DK6C 5M3MG 1VQLA 2UUAQ 1V9PA 4EX5A 2I5HA 2LXJA 4QJFA 2R92H 1BVSA 3S16H 3PO3H 2ID0A 1PH2A 4LF9Q 4WJ4A 2KHJA 4H02A 3W1BA 1G291 1C9OA 1KRSA 5IWAQ 3CCUA 1Q86C 1XMQQ 5JEAG 1KC8C 3HOYG 4A3BH 2JK8A 3A5ZB 4GLAC 1UWVA 4BBRH 3GDEA 2RHSB 5C44G 2E2HH 1K9MC 1A8VA 1WCMG 2JQOA 4ME3A 1X6OA 1MJEA 3PUZA 4YCWA 2F4VQ 3J7A5 4K0KQ 1Z47A 1N9WA 1EWIA 1TWFH 5BR8Q 5HY6A 4DV4L 2JEBI 2A19A 2C35B 5IYDG 2R7ZG 2AWNA 4DV0L 1TXYA 2NN6I 4FDBA 1G51A 2R92G 3FP9A 4JI7Q 1I6HH 1HZ9A 1WJJA 1QVGA 1YHAA 4TQUS 1VQKA 2VUMH 3JAMc 4KHPQ 1VQGA 2JA8H 3S1QH 1XPOA 5M3FG 4BBRG 2YTYA 4BY1H 3UDXA 5FLXc 3PO2H 2VNUD 1TWCH 5C0XG 4AH6A 1UE6A 4GNXB 1C7YA 4JI0Q 4X66L 1H95A 3PIPA 2UU9L 1E22A 2RCNA 1FVIA 3I4OA 4GS3A 1J5EQ 2ES2A 1XNRL 2E8GA 3KYHC 1JJ2A 1X56A 1N36L 2N8NA 2IY5B 4O0AA 2VW9A 3HKSA 3HOVH 5C3EG 2VUMG 2QGQA 3AFQA 1VQNA 4DR7L 1I94Q 1B8AA 2KENA 4XTCS 3CMEA 4L5SA 2JA8G 4NPSA 4OONA 5IP9H 3CPWA 4DV6L 1LM0A 1X9NA 1IL2A 4DR6Q 1XNQQ 1V1QA 5ELNA 4X62L 4C3IH 1A0IA 1P16A 1X55A 2AMCB 2BH8A 2FXQA 3CPFA 4YWMA 5IY0A 4AQYQ 3K7UC 4LF6Q 3PO2G 4DR4L 3L0OA 1IBLL 3EIVA 2PQAB 2HQLA 4LF7Q 1Y14B 1XJVA 1VQMA 1IBMQ 4C2MH 3T1HL 3BU2A 1K0RA 4LW1A 3I56A 1VQDA 4BA2I 1BBWA 1E24A 1CKMA 3E0EA 4GN3B 4R4QA 4GOPB 1EQQA 3PUYA 1L2FA 2OQ0A 1SN8A 4IPHA 1YBYA 4UP7A 4JI8L 1EOVA 3F8TA 1X54A 2V1CC 4DV2L 4DV5Q 1NJIC 1JMCA 4JV5L 2F52A 3HOVG 1SRUA 3I2ZA 4LUZA 4RG1A 3OYYA 4DR2Q 3RN2A 1RIPA 2D62A 3M9BA 4NXMQ 4IOAA 3WWVA 1UE7A 1E7ZA 2ZJPA 2UUCQ 2D0PA 2K75A 3J81j 2N78A 4A3EH 2K5HA 3HOZH 1A62A 3K80C 1YITA 1S40A 2N49A 1Q81C 4OX9L 1AE3A 3OTOQ 1VCIA 3FHWA 3U58A 1Q46A 2ASBA 1HNXQ 5FJ8H 4A3LH 2UXBL 1YVCA 2ZTEA 4IPCA 4KI0A 1QZHA 1GM5A 1HNZQ 1C0AA 2WP8J 3HOXG 2OQKA 2CQOA 2VQFL 1PH8A 2OWOA 4LF5Q 2B3GA 4C3HH 4MZ9A 1X3FA 1KQSA 4JBJA 3NENA 2VY3A 5AJ3Q 3K81C 4POGA 1KIXA 2NVXH 1E3PA 1KHIA 3ULLA 1VQ9A 1T9HA 2B29A 1HZAA 2GVAA 2KHIA 1WYDA 3RLNA
chains in the Genus database with same CATH superfamily
4WFN3 1F2MA 1KABA 4HTHA 3CKIB 5CV7A 4V190 1QB5D 3PO2B 1Q8KA 4IFDG 5K36G 1BOSA 3TQYA 3CC4A 4JOIA 1YJ9A 4KN7C 4C3HG 1PH9A 3X3MA 4P71A 2VB2X 3E3XA 1TS2A 4ALPA 4OO1H 2PNHA 4CJ1B 5LMUQ 3Q22A 5ELFA 3TS2A 5I9PA 1WTXA 1O80A 3ICEA 2F0DA 3S2DH 3BDCA 2JA5G 1MSGA 1STHA 4ZKBB 3MFYA 2A5HA 2PI2E 3EBEA 4C2MB 4L5QA 3PCOB 3CCSA 1HHVA 3E0JA 1VQHA 1JR0D 3J7AF 4AYBG 3K5MA 3T56B 4JBKA 3L7ZC 2JXMB 4JI5L 4NMZA 2E5LL 4G4KA 4IPDA 1AE2A 3EQLC 3ZJYC 4A3IH 1SFOH 3FVQA 1N33L 4KY6A 1NR4A 4DAVA 2PO4A 1IL8A 1RL2A 5C3EH 1NTGA 4JI3L 2K05A 5DEHA 3MEFA 4U673 1MJCA 2F0NA 4S3SA 4RGNA 1CM9A 3GP7A 4CDEC 5KYLA 4LMQD 2MGSA 3D4DA 1VQOA 1PZKD 2NB0A 2NVXB 4A3GB 2XWJB 1J9OA 4JVZA 3UDGA 4LF8L 1D5MC 5DAUA 3TP8A 2AUKA 2F0JA 1LYLA 4Z9CB 1PFMA 3Q6SA 4BXXH 3J7ZC 1JB7A 4DXGA 1KLGD 2GVBA 4JI2L 1U4PA 4ULLA 2EDGA 5C0XI 1PYWD 1EYGA 1A63A 5DM73 5HGQA 5KRUA 1GUGA 4DR4Q 4KV6A 4RFBA 1W3SA 3W3AA 1IBLQ 1TWAH 4KY5A 1VQ5A 3ITPA 3WOFA 1EY0A 2F0EA 4XIGS 4AIMA 3O13A 1DOKA 1JJCB 4J15A 5H1SE 3S2DB 3HOWG 4HCSA 2MO1A 4JC0A 3CMAA 2EY2A 1SXTA 1A2TA 2NZOA 5IGDA 1O7LA 1F9QA 2E76C 2L4NA 4A3DH 2AQ1B 3KFUA 5ELDA 4BY7H 3CXCA 4DA2A 3A8IE 3KJOA 1VQ6A 3C3LA 3UE0A 2K01A 3IL8A 1ZYRC 3HS0C 1SFOB 1XTDA 4QMGA 2L11A 1SYBA 2FHTA 5C3EB 3RN5A 1JC7A 3M3YH 5LL6S 3ULPA 3ND9A 2RDFA 1HQRD 5TSSA 3S17H 3PIOA 2JJQA 2Z6BA 1M4VA 4RH6A 1BBUA 3CD6A 3AFPA 2L15A 4DR1Q 3OIQA 4LFBQ 3QG1A 1CHPD 4X65Q 1G6ZA 4L5TA 3OWEB 3I4NH 2A69C 4LWCA 4GLXA 3J80c 5KIXA 2CHBD 5C0XJ 3J81c 1IBKL 3SK8A 3I72A 4N8X1 1RCVD 1TWAB 2OF1A 1PH5A 1A2UA 1EL0A 2A68D 2IPKD 3CCQA 4DV1L 2JA7H 1HZBA 1Q12A 4PZ7A 1E1OA 3PF4A 2DNEA 3HOUH 1YHBA 1PRTD 4N9PA 4A3CG 5IWAL 3U4VA 3HKZE 3UDIA 1C48A 2WAQE 4HCEA 4U68A 2NZHA 1CA5A 4H13C 4A3DB 4Q0FA 2IHEA 4KK7A 2HT1A 2F4VL 4QUCA 2JSOA 1D5ZC 1GHKA 3UDFA 4BY7B 1I4HA 4UPAA 5BR8L 4OO1I 4DNIA 1CQFA 4IN3A 1SNCA 1TKWB 3DUZA 4FNFA 2EYJA 3VR5A 4DK1A 2F0MA 3D4WA 1BNZA 4JI7L 4LFCQ 5FO9B 1CKNB 1UEBA 5D3DA 3T4AC 4UP9A 3DMUA 3M3YB 5KEEA 1GJXA 4JW0A 4A3BG 2AQ3B 2ZTDA 1PH4A 1J5EL 2O4XA 4E6IA 3CRKC 5IYBH 2ZXOA 1DZ1A 4HIDA 5LMNQ 4K5VA 5A35A 1TY0A 1VQJA 2D5DA 4A3MH 4JYAQ 4K0KL 3G4SA 4DR6L 3H3VH 1K8GA 3CAMA 3I4NB 3SGIA 3DHQA 1BR9A 2LY7A 5C4XB 2KA7A 2B2VC 4O42A 4JI4Q 1HR0Q 1EIFA 3BDOA 4IZ8A 2N3SA 5BN4A 1RJTA 3BZCA 3MXGA 1ILPA 1QZGA 2A6HC 3GV6A 1VQFA 1MSHA 1STBA 4FVMA 1WTRA 2Z4HA 2QA4A 3OHXC 5LMNW 2JA7B 4HAEA 2IHFA 4BBSH 4IOCA 3L2PA 3I91A 3DXJC 3HOUB 1B2TA 2O5JC 2EZVA 3K5NA 5I2YA 5EGTA 1FNUA 3A8JE 4JBMA 1EU3A 4PZ6A 4JOIC 2K50A 2UXCQ 4DR5Q 1EYDA 5CV6A 4KKSA 3VR3A 1ML0D 3W1GA 1PH6A 1HR0W 2RVLA 3J80E 1UE5A 1LTLA 3M4YA 4C3JH 3J81E 2Q2TA 4ID6A 3JAMi 5FO7B 4YHHQ 1SYFA 1HQMC 4IO9A 1RTOA 4UAIA 3ULJA 1YI2A 4A3EG 4QIWB 2A6HD 1T5XD 3D3RA 3Q8DA 3PSIA 4IJHA 3V96A 1ONLA 3HZXA 1X3GA 3CCRA 1F9PA 4IUPA 4NB3A 1SNPA 1NNXA 1U4LA 3ER0A 3GTMH 3RUZA 4R8NA 4A3LG 2EVBA 1IKLA 5IGBA 4HIKA 4A3MB 1CK1A 3RZOH 3IFTA 2O2LD 4FXKC 1BCPC 5JEAH 4DPGA 2RBMA 1JCKB 1DONA 4O1NA 3MWYW 5DNFA 1EFID 4LJZC 3K0YA 4B3ML 4OXPA 1CA6A 1E0BA 1PLFA 5KYIA 1VQAA 1L1OB 1IHZA 1PA6A 1JORA 5M3MG 2UUAQ 1O7YA 1B50A 2I5HA 3PO3H 1BVSA 2ID0A 1RTNA 4NDXA 4WJ4A 1EZ6A 1LT4D 5K5PA 1C9OA 1KRSA 1Q86C 4BBSB 1GUNA 3OPOA 5C44G 3KK7A 2E2HH 1SE2A 3OSOA 1Z47A 1RF2D 1AFPA 5IYDG 2AWNA 3BVMA 4ZYSA 1G51A 1CFMA 1HZ9A 2KUMA 2PCFB 1BCPD 5J22A 4J1MA 5G3LF 2JN4A 4C3JB 3OW7A 1LV9A 1SYEA 2YTYA 4BBRG 2M9VA 5FLXc 3NE5B 4AH6A 4GNXB 4JI0Q 1H95A 2UU9L 1E22A 1FVIA 3N52A 1XNRL 1VDZA 1H9MA 2KVMA 1SDFA 3KYHC 1JJ2A 2N8NA 4O0AA 3J80L 1E2WA 2DY8A 1I94Q 4L5SA 3HOVH 3AU7A 3T16A 3CPWA 1LM0A 2PYKA 5FOBB 1IL2A 1XNQQ 4X62L 1PFBA 3GTMB 4C3IH 3CPFA 1X55A 2BH8A 2FXQA 3MFGA 4JK1C 4YWMA 1WTOA 1D2BA 2EYHA 2IW3A 3EIVA 1XJVA 2OXPA 1CHQD 1RD9D 4LW1A 1K0RA 3SVMA 4BA2I 1BBWA 3L9AX 4WJWA 1EQQA 3PUYA 2OQ0A 4IPHA 4JI8L 5C5LA 4DV5Q 1X54A 2V1CC 1NJIC 4JV5L 2F52A 3A7LA 5IGEA 2KCNA 2SNSA 3MTSA 2O5IC 3OYYA 2D62A 4KKUA 4QCLA 1K8MA 2K75A 4KD4A 3VYTA 3PO3B 5IGFA 3HOZH 1IW7C 1GUSA 2N49A 1Q81C 4OX9L 2E2HB 3CHBD 1I4RA 3HOXG 4CKEA 2CQOA 4WRDA 2VQFL 4C3HH 4OELB 2VY3A 3K81C 4G57A 1E3PA 1KHIA 3EA6A 1EEFD 2GVAA 1RHPA 3GTJH 1WYDA 5JPNC 2UUBL 3R8BA 3E6ZX 5FJ8G 2JA5H 1MBYA 2EXDA 4P2CB 1PTOC 4PZ8A 2BA0A 3HOYH 2MO0A 3CCEA 1STNA 3PUWA 1OXXK 3S15H 4IJLA 4YCVA 4CGYB 4KLKA 3HOVB 1KLUD 3DWPA 5BN3A 1WTVA 1HUNA 2WINB 3ZYYX 1Y1VG 5F2DA 3BDLA 3GTQH 1F2YA 5L37A 1MHWC 2K52A 3CRLC 5IGCA 4IUTA 1JWMD 1TR5A 3DM1A 4A3KG 1WD0A 5M3FH 1I3QH 3G71A 4B3TL 5FLXE 4DK0A 4DFAA 2HD3A 4ILWA 1Y1WG 4A93G 2D2CC 1EYAA 5JPMC 4ZCKA 1XXGA 1JWSD 4HJ9A 2BDNA 4DR3L 3CW2C 3HKZG 3HOZB 2WAQG 3R3OA 4C56C 1HXYD 4EQ5A 3CCLA 1DGSA 4DV0Q 2PNRC 2F0FA 1OTCA 4LUVA 1P8LA 2F0VA 4ODGA 2EPBA 1PMRA 4JI3Q 5CR3A 3STBC 2A73B 3PUVA 4HR7B 1TS5A 4X3KA 3K0XA 2OCEA 1H9KA 4DUYL 1IXRA 2G5DA 4X64L 3GTJB 2RQXA 1I4QA 5DM63 1EWCA 3BS1A 1GKHA 4ZLTF 4LFAL 1A3UA 3C1EA 1N36Q 2JA5B 1HNWL 5C5MA 1EY4A 4DV6Q 1I4GA 1LUZA 4HJ7A 3HOYB 2B2WA 3S15B 2ZTCA 4B9XA 1YHQA 3QO2A 3S1RH 3LNNA 4MIUA 3BZDB 4DKAC 3GTQB 4B3RL 2F03A 1GXDC 2EXZA 5I4DA 3OIPA 4XQJA 3CC2A 1SNOA 4WJ3M 1TVXA 3CC7A 1DD2A 2MNAA 3AQQA 1I3QB 5M3FB 1PH7A 5CYUA 1SBBB 3HG9A 2I5LX 1B9NA 2KCMA 5EJWA 1CKNA 5IYCG 3TS0A 2RF4A 5M9OA 1SROA 4DXFA 1QVFA 1J8IA 5IP7H 2ICIA 4NXNL 1R4QB 3CF5A 2VUMB 2VZAA 2R93H 2QW7A 2RDHA 2YTXA 5JEAJ 3PIO3 3KLSA 2JEAI 2DUDA 1JE5A 2QILA 5M5YH 1LTBD 2A74C 1N34L 3KUPA 3SXHA 3T1YQ 1PTOF 2PW5A 4OIJA 1HFNA 1BKBA 1ET9A 3BZKA 1FD7D 4P75A 2OTJA 2VQEL 4PQXA 3NK9A 2JP1A 2HIXA 4MTKA 3G6EA 2IX1A 4IFDI 1EU4A 3V05A 3R93A 2IWHA 3NXWA 2K32A 4GKJL 3S1RB 4YY3Q 3A5UA 4BWGB 4QY7A 4KHVA 4C1NI 2EYPA 2XRQD 5FLMG 1X3QA 4A76A 1SLJA 1D8LA 1TIID 1WTHA 1WTWA 1VQPA 2EYMA 3FPPA 1Y8PB 3GO5A 5CV9A 1Q1BA 1XWEA 2NN6G 3VR6A 1Z9FA 2BA1A 4K5WA 5NUCA 1ASYA 4A3FH 2M00A 2B63G 3KDFB 1JWUD 2LFNA 4CDFC 1DYQA 3H6MA 3NBIA 1NUCA 2MQHA 4DUZQ 2B8GA 3K5OA 4CHTB 1LABA 5EKKA 2K14A 4KHPL 2XVSA 1KL9A 3K7AH 1AEXA 1ICFB 4L5RC 2CQAA 2R93B 4L6TB 2YTVA 4POFA 1LTID 4CJ0B 4RKLA 2FINB 4K8JA 2Y0SB 4JI1Q 2RSOA 2PMZE 1B44D 1EY5A 2IX0A 2ALYB 5M5YB 4A4IA 2QCPX 3MAQA 2RHQB 2WKDA 3K58A 2LSSA 3MZ5A 1JOQA 3Q24A 4TRDA 1CUKA 4QIWE 1KD1C 5C4ZA 4AQYL 4LF6L 1L1OA 1OXSC 1G2TA 3FKIH 4J8QA 4P73A 3H15A 2WKCA 3F1ZA 4B3SQ 1STYA 4IFDJ 1VQCA 2SDFA 1NCVA 4HN7A 3OW2A 3NEMA 2AKWB 2GN5A 3HGBA 4Y7NH 3DEOA 1B3AA 2X6GA 4NXML 1F2LA 1N8RC 2HHHQ 1I6VC 5IP9G 5IE8A 3KF8A 2SNMA 3EJIA 2DJGC 4R1JA 4A3IB 3V2TA 4X6AH 2I46A 4YWKA 2JA6G 1PRTB 3RMHA 3OTOL 1JJGA 1IYJB 3SR1A 1VQBA 2CW0C 4A3FB 2P5ZX 3G7LA 5CV5A 1HNZL 2M2LA 2KBNA 4PMCA 2RDGA 4GNXA 3TREA 4GKKQ 2BE5C 1HUMA 4P72A 5ELOA 3GQBA 4JI6Q 1S5CD 5AJ3L 1T5EA 1GVPA 4TKOB 5CGKA 1PH3A 3K7AB 5EAYA 1EQTA 4LF4Q 1IZ6A 2F0UA 1B3QA 4MTNA 2Q2IA 3DEPA 1FJGQ 2E75C 4Y52H 1QUQA 1U9RA 1WFQA 2IJ0A 3GTGH 3LGJA 1X32A 4XQQA 2Q8RE 1NSNS 3K8AA 5M3MH 2VXWA 4M1UB 1ZYRD 4DV7Q 5LMUL 1X3EA 1NAPA 3RD4A 2UXDQ 1STAA 2NVQH 2CW0D 4A3GG 3IKJA 5ELEA 3FKIB 2ZJQA 2ZJRA 4OHJA 5C44H 3QIAA 2CWAA 2WB1B 1YJNA 1SYCA 4KN4C 1XMOQ 1Q1EA 1K73C 1MD2D 1WD1A 1S5FD 2ICEC 1N32Q 4DK6C 5E4XA 4EX5A 1H9RA 4LF9Q 1PH2A 3JAME 4Y7NB 3C46A 4ZUJA 3W1BA 1KNEA 3QOJA 1XMQQ 1KC8C 4CBVA 3A5ZB 2A69D 4BBRH 1K0SA 3PUZA 4YCWA 1BF4A 4EGVA 2BCOA 1K28A 1N9WA 1EWIA 1TWFH 4OIKA 2B2WC 1I6HH 1Z6HA 1YHAA 4TQUS 1VQKA 1ESFA 3S17B 1EY7A 2F0TA 5C3WA 4RCOA 1SYDA 4ME5A 4XQNA 1AN8A 3UDXA 4RA8A 4BY1H 2VNUD 1B1ZA 2K5WA 1TWCH 1S4ZA 2RCNA 2K33A 2ES2A 2DJFC 2VW9A 3ERQA 5C3EG 1VQNA 3AFQA 1OO9B 3N6RA 3CMEA 2KENA 2JA8G 5JJLA 4OONA 3GTGB 3MXUA 2F0SA 1HCZA 5ELNA 3OMCA 1SE3A 1P16A 4QF4A 4DR4L 1WTPA 3K7UC 3U9SA 1IBLL 1FGBD 4DN4M 1KDCA 4LF7Q 1IBMQ 1VQDA 5G3LD 4GN3B 2QEJC 4GOPB 1VF5C 1SEBD 2WIIB 1L0XB 1QCBD 2TSSA 4K6DA 4DR2Q 3M9BA 5JOBA 1B9MA 2KJXA 2ZJPA 2UUCQ 3J81j 5LL6X 2K5HA 1DOMA 1IYVA 3K80C 3QJYA 1YITA 2HDLA 4BBRB 4EVOA 4H0LC 1YNNC 3FHWA 1Q46A 2ASBA 1HNXQ 5FJ8H 1LT6D 1TWFB 1BQQT 3Q0AA 4LF5Q 1EQVA 2B3GA 2PZWA 2PZUA 3URYA 2RSNA 3NENA 4ZQ3A 1I6HB 1CZWA 3ULLA 1VQ9A 1L0YB 1YIJA 2G9DA 3TSSA 4A3DG 5CV4A 4DR1L 4BY1B 4LFBL 1TWCB 4X65L 1A3VA 4DGZA 2F4IA 3T53B 1JICA 1FNVA 1LACA 2HDMA 4BS9A 3HEJA 3G48A 4I7ZC 1SMYC 2JE6I 5M5WH 2FMMA 3H94A 5A2QE 3C2PA 5FKAC 5J39A 1WCMH 3TP7A 5GQOA 5ISRA 1TWHH 1Q90A 4MN3A 4R8IA 4DV3Q 3NELA 4DF7A 2R7ZH 2Z0SA 3S14H 1MIUA 3BYTB 1PYSB 2QKIC 3LWEA 2EYFA 1SE4A 3I4NG 2E2DC 1G91A 1I5FA 1G2SA 5C4XG 2F0OA 4OGQC 3H3VC 1LLRD 1UAPA 4LK1C 4B3TQ 3H0GG 3K6OA 2BH2A 5J1ZA 3KF8B 3W2DA 1V1OA 5IT9E 3RNUA 3TP5A 4DV4Q 1SMYD 4LFCL 1TQOA 4FF3A 1TS4A 1MI2A 1EOTA 1L1OC 1UNSA 2RA4A 4A3JG 2JA7G 1HTLD 1SR3A 3F2CA 1RKNA 3HOUG 1B7YB 2EYLA 4EQPA 1FL0A 4IURA 2H5XA 4JPBW 4HJ8A 2F0PA 4X66Q 5C4JH 1C8CA 1Q3LA 3BJUA 5LMNL 5GAEC 3J81L 3CQZH 3ERSX 4JYAL 2CKZB 1EY9A 2EY5A 3RZOB 5CORA 2J4XA 4DR7Q 1HPCA 1QUQB 1VQEA 3J80i 3KOJA 1LTTD 4TVAB 2K6AA 5M5WB 1K3RA 1CSPA 2NVTH 2K4KA 4G7ZC 4JI4L 1WCMB 1ZXTA 2AHOB 1HR0L 2PQEA 2Q2HA 2EY1A 3T1HQ 4GNXC 1TWHB 1Z7TA 2Q8TA 5IYCH 1R9TH 1A6XA 5HGTA 4ABNA 3K5LA 2R7ZB 5EPLA 4DV2Q 1LO5D 1CQVA 2AWOA 3M4PA 3MHBA 5IYBG 3S14B 3KDFA 1EIYB 4PMBA 2NVYH 4A3MG 1IKMA 3A8KE 1D1IA 4HSPA 4RKBA 4H7BA 5EKLA 5A2QL 4IFDH 2UXCL 5K36H 4DR5L 4FXDA 3TP6A 1DM0B 2KEEA 4L63B 1A15A 1PXUA 1EY6A 1KAWA 2UXBQ 2C9OA 1STGA 2E2IH 1CI3M 5I9OA 3S1NH 4OWTB 4YCUA 1YNJC 2Z9HA 3T13A 1DXMA 3I70A 3NBHB 4YHHL 4BBSG 1ESRA 1AZQA 3SE0A 1OXTA 1QJOA 3NP8A 1F9SA 2ZM6L 1B70B 1GHJA 1BDOA 1ILQA 3I4LA 4DK3C 4APVA 4BA1I 4R4OA 5C4JB 4KKTA 1IW7D 3U50C 3I3CA 5EQ0A 1PFNA 5KNBA 3CQZB 1UUPA 4C3IB 2PQAA 1XTCD 1V1PA 2C5CA 4HIMA 1RDPD 4IUUA 2B8FA 2FMCA 2RKSA 3D31A 2KHSA 3RR5A 2NN6H 4DAMA 1ENCA 2K5VA 1JE4A 2KCTA 1Q7YC 3EFXD 2F3IA 2VB3X 2CWPA 4JCVE 1SYGA 2L5TA 2L1BA 3GTOH 3FRPB 2F0QA 3RLOA 3SK5A 2DGYA 2UUAL 5GROA 3P1HA 4QUFA 1R9TB 2E74C 4K2KA 1YZ6A 3TZDA 3A0JA 2LXKA 3GTLH 4IQZA 1GD7A 4C1NK 2NVYB 1PTOD 3K59A 4CJ2C 3KF6B 1PYBA 1QVCA 4JI5Q 2E5LQ 3HFZB 2XSCA 1W6KA 2F0GA 3TEHB 2LMCB 3BVGA 1N33Q 4XYQA 3SDZA 2XGTA 5EBDA 1PZID 4R4IA 4C3HB 4X3TA 1ZKOA 5KNCA 2E2IB 3S1NB 1HTPA 3M85A 5E7NA 3I4MG 3PO3G 4PNYA 2Z6KA 4GZYC 1WOCA 4JI0L 3I55A 1NBWA 3PV0A 3VYRA 3C1FA 4LF8Q 1GO3E 4LUOA 3HOWH 1VMPA 1U4RA 4CKBA 4XT3B 5CV8A 4P74A 3AYHB 1G8ZD 1I94L 4R4TA 1JB3A 1YEZA 4IPGA 2KCCA 2LS01 1VQ4A 1PV4A 1OXUA 1XNQL 4JI2Q 4LNQA 4AYBB 4MHEA 3SK4A 2EJGC 5GAGC 5C3XA 4RGOS 1XPUA 2XNAC 1MKHA 3STBD 2J0TD 2JA6H 4EQOA 4DAYB 4DV5L 4IALA 2EQSA 3KBXA 2A6EC 1AH9A 3GTOB 5CBAE 2DN8A 3CCJA 5HURA 1D7QA 3D6CA 2WB1E 2B2YA 3NUCA 5GAHC 3VR4A 3GTLB 2G9HD 1S3OA 1EFWA 4IUNA 5E3FA 3X3NA 1EUJA 4WORA 3VR2A 3MVVA 4QL5A 1JOOA 4N8FA 5FLXL 5T1GA 5CC4A 1VQ7A 4ZKCB 5EPJA 2K7VA 1V43A 1S5ED 1E1TA 4B08A 1HZCA 1SJHD 1Q82C 3OMGA 1GUWA 1TS3A 3J7YW 1CTMA 3TDQA 4A3GH 2B2UA 3HOZG 1Y69U 1PFSA 3PUXA 2KEDA 2E2JH 2PI2A 3HOWB 4O2DA 4FP5D 4A3CH 4OWXB 3D0FA 4UP8A 2ZXPA 5I2XA 4GOPA 4KHZA 4RGMA 4M8AA 2DY7A 3IAYA 1O7ZA 4R4CA 3F2UA 2JA9A 1EQRA 1FYCA 1IBKQ 3B6YA 5I6YA 1X3PA 5KNDA 1PH1A 1UEAB 4GN4B 5D65A 1CT1D 4JG2A 5ELBA 2IT1A 4EQNA 1PVOA 4DV1Q 2KQ3A 2JA6B 3A55A 2DNCA 1VQLA 1V9PA 1QNUA 2EY6A 4QJFA 1C4QA 3VA7A 4H02A 5JJIA 1G291 5IWAQ 3HOYG 3CCUA 4A3BH 3GV3A 3GDEA 2RHSB 1EEID 1K9MC 2K28A 2Z8LA 1EIHA 4ME3A 1X6OA 4DNTB 3J7A5 2F4VQ 3T51B 5D14A 4CDDC 2HQEA 5BR8Q 2JEBI 3ONAB 2NYZD 4DV0L 2NN6I 2BDOA 2WV6D 1DOLA 3NWTA 4FDBA 4KD3A 4B9WA 2R92G 2HCCA 4JI7Q 5IGGA 4ZK9B 1QVGA 1B53A 3JAMc 2JA8H 2NZ1D 1XPOA 1GOZA 2CH4A 5M3FG 4KTAA 2TMPA 1BUVT 1SAPA 3HRZC 2Z1CA 2CH4W 5C0XG 1UE6A 3PIPA 3I4OA 1J5EQ 1BXTA 2XRSD 1N36L 2IL8A 2IY5B 3HKSA 2VUMG 2QGQA 2E2JB 4K0KQ 4XTCS 4DR6Q 4NPSA 4DV6L 1X9NA 3IFDA 1V1QA 1A0IA 3E5SA 1LTRD 2AMCB 3PO2G 1PZJD 2PQAB 2L9HA 1V1PB 2QF7A 1VQMA 4G7OC 2X69A 5KGUA 3KBGA 3I56A 3FDTA 1E24A 1CKMA 3NQTA 4R4QA 2OT2A 4HEDA 2F3VA 1EOVA 2HCIA 1JMCA 1D1KA 1FR3A 3MEHA 4IOAA 1UE7A 1E7ZA 2D0PA 1CZGA 2N78A 3G6JB 4A3EH 2N55A 4K14A 2JYOA 1A62A 4A3BB 1SSOA 1S40A 1SJED 3AB9A 1H9SB 2BOSA 2B39A 1F9RA 4FXGC 3U58A 4A3LH 4UDUC 2ZTEA 4IPCA 4KI0A 4OL7A 1C0AA 2WP8J 2OQKA 1PH8A 4R9WA 4PV1C 4MZ9A 1X3FA 4JBJA 1MGSA 1LT3D 4POGA 1A3TA 2A68C 1GUTA 5BN5A 2JA8B 3RLNA 1CSQA 3M4QA 4UHVA 3NTKA 4V0BA 4HJ5A 5E1FA 1KRTA 1KAAA 3DWQA 1PRTC 2MUYA 3T1YL 3TRZA 3U9OA 2EOTA 4XYOA 1GUOA 4LAAA 2NTTA 3A74A 3JC66 2SOBA 4XXEA 5IP7G 3FEWX 2EIFA 1K83H 2R93G 2FJ2A 4X3SA 2EJMA 1SMXA 1W2BA 1F77A 2Y0SG 4X3UA 3P20A 2BE5D 5C4XH 2QDLA 3H0GH 4YY3L 5IYDH 1R4PB 1LT5D 3L3OC 3VYUA 5I6WA 4HMIA 4B3MQ 4YIJA 3F2BA 2Z6KC 4OO1G 2N88A 1ASZA 4A3JH 5JJKA 1KNAA 1XYIA 4RCNA 1NMFA 4GLVB 1L0WA 2KECA 1OXVA 1ENFA 4A3EB 1VS0A 1E2ZA 4I7AA 2QEXA 3NBHA 2CFMA 4DUZL 3NWSA 3ND8A 1FGUA 1IYUA 1I4XA 5EKIA 2F0HA 1SE8A 5EBCA 5CMDA 2B2TA 2EYOA 3R2TA 3MXNB 5DLQE 4J6HA 3EN2A 3QWNA 1QE6A 2K5NA 4JI1L 4A3IG 3KLRA 1WTQA 1HH2P 3DLLA 2UU9Q 5IT9c 4K5XA 4A3FG 1XNRQ 2CVRA 2R7DA 3EVQA 3VDYA 4HIOA 1LTGD 4MNOA 5M3MB 4PG3A 5JVH3 2B2YC 4RWSC 3CU7A 3I90A 4TSSA 2PW7A 3PMFA 4K6LA 1ENAA 4X62Q 2NVQB 1H9JA 1JT8A 1K83B 2LKVA 1VMCA 2V4DA 2L55A 3MXPA 4KJNA 5C44B 2CCZA 4B3SL 4OWWB 3KLSX 1EWHA 2WFWA 3QR8A 4RHSA 3QOLA 1U4MA 3SHLA 3GTKH 2XTIA 3H0GB 3HOXH 4BXXG 5EPKA 3M4OH 3KF6A 4JI8Q 2R7FA 4HJAA 2NBFA 3S1MH 1QNKA 1TT2A 3W5OA 5CBEE 4JV5Q 1BO0A 1O78A 3BYYB 5COYA 3M7GA 2D9UA 2F3WA 2HHHL 5M5XH 1AP0A 4I65A 2B2UC 2L12A 4PMWA 4A3JB 3A7AB 1UE1A 4ZUIA 1SNMA 1S72A 1KXLA 3FKIG 3F2DA 1VF7A 3D8GA 2WB1G 3PQIA 4OX9Q 3GTPH 4GOPC 4GKKL 3JAML 2ZT9C 2AUJD 4FYDA 3RLFA 4JI6L 2VQFQ 5GADC 1II3A 4QGUA 3NPPA 3CCVA 5FK9C 4DNRB 3EROA 2PMZB 4RMFA 1BCPB 1Y1VH 4BY7G 2OTLA 4LF4L 3I73A 1I50H 1SNDA 2F0KA 2HUGA 2UUBQ 1NE3A 4N9TA 1TU2B 1PRTF 4GN5A 1FJGL 1K8AC 4A3KH 2Z4IA 2ZM6Q 3QB3A 1K8OA 3WDNA 3M7NA 1QOHA 1AW7A 1KDAA 2ENBA 4DV7L 1Y1WH 1YNND 1M90C 4A93H 4DAYA 2K03A 2UXDL 4QQBX 1NY4A 1ZEQX 1W6JA 1YNXA 4CKCA 4DAPA 3H91A 2MJ8A 1EY8A 2KOLA 1G6PA 2R61A 1NMGA 1XMOL 3I7FA 3TBIB 3D4RA 3GTKB 1N32L 5JJZA 3CP0A 4AYBE 2MFIA 3S2HH 3D6WA 3HOXB 4L8JA 3M4OB 4LF9L 1WI5A 3S1MB 2GA4B 4JBWA 1XMQL 1B4OA 1DJRD 3CCMA 2R3ZA 2R6GA 4H44C 3NQIA 3PGZA 4K2LA 3I4MH 2K04A 5M5XB 3BVZA 1ET6A 1PTOH 3A56A 3NTIA 4DR3Q 1S5BD 2YV5A 2QDBA 3BG3A 1PHJA 2ATWA 4FF4A 1V8QA 3MC0B 1M8AA 1U0LA 3GTPB 2HIVA 1U5KA 1HRJA 1STEA 1QWYA 1E2VA 4QB4A 1HA6A 4RAUC 1Y1VB 1LTSD 1VQIA 3VA5A 1I50B 3H09A 4DUYQ 4X64Q 4YWLA 5J3BA 4LFAQ 5FO8B 4FF2A 1J6QA 1S5DD 1EZ8A 2EJFC 3DM3A 4A3KB 1HNWQ 4F7XA 1TWGH 3MA2B 5AFWA 3J81i 4UY8C 1JQYD 2K5DA 2X6LA 4HMJA 2K1BA 1Y1WB 4LF7L 4A93B 2YU9H 2XN9C 3E9IA 3U4ZA 1VQ8A 3IRBA 3SEBA 1IBML 3RZDH 4BY1G 1QG7A 3NHHA 4A75A 3HKZB 3TZUA 1NR2A 1PDQA 5E4WC 2WAQB 1M1KC 3KLWA 4B3RQ 4DR2L 3AMUA 1KDBA 3S2HB 5LHY1 2UUCL 2PPBC 3Q23A 2XWBB 3OOCA 2VS1A 2L0CA 4G7HC 1SNQA 4DU9A 1EIGA 4NP5A 3I4MB 4F8MA 3AEVA 2IX3A 3S24A 1CKOA 2A1AA 4ZRZA 1EYCA 1HNXL 1PTOB 2I0QA 1ICWA 3S9WA 2I07B 3H3VI 4NKLA 4NXNQ 4F87A 3E9HA 4LF5L 5IODA 2A8VA 5IOCA 3HP3A 2RCFA 3UE1A 2VL6A 3LWUA 3P75A 2I5MX 4RHRA 2ZXRA 3NSWA 5IT9L 5FLMH 4IUQA 1F2ZA 1XPRA 1DCZA 1K3BC 1HJPA 2Y0SE 1HFGA 4XT1B 1N34Q 1X65A 4C3JG 2YYZA 4KJOA 4F88A 2SEBD 1YJWA 3R2IA 1Q8IA 3K57A 1O7IA 1TWGB 3NTHA 2VQEQ 3KJPA 3OWFA 2NVTB 2FFKB 2B63H 3LX0A 3FMCA 1YNJD 2F0IA 2NTSA 2YU9B 3PF5A 4DV3L 3A54A 1BCPF 4KY7A 2Q2UA 2B2TC 2EE1A 4FF1A 1TY2A 4GKJQ 3RZDB 3GD7A 2D0OA 2LXJA 1H9SA 2R92H 3S16H 3P7JA 2KHJA 3TN2A 2F1MA 2PZTA 5JEAG 1QILA 2JK8A 4GLAC 1UWVA 2WACA 4HSVA 4FO2A 1A8VA 1JOKA 1LTAD 1WCMG 2JQOA 2H1EA 1Y8OB 1MJEA 5JVG3 5C0XH 5T1IA 1AZPA 3I8ZA 4K8IA 4ZAIA 3VYSA 5HY6A 4DV4L 2A19A 2C35B 2R7ZG 4NW2A 5ELCA 1TXYA 5C6AA 3FP9A 1WJJA 5D3IB 2VUMH 4KHPQ 1VQGA 3S1QH 2Q8IB 3PIP3 3DWAA 3PO2H 1D5XC 2NWGA 1C7YA 4KMUC 4RGTA 4X66L 4GS3A 1I4PA 2E8GA 2NUCA 1X56A 2J7ZA 3FPUB 1XX8A 4CDCC 4DR7L 1B8AA 5IP9H 1D6EC 1FNWA 1Y8NB 5IY0A 4AQYQ 2XIWA 4LF6Q 3L0OA 2HQLA 1Y14B 2B63B 4C2MH 3T1HL 3BU2A 4XDXA 1WVLA 3E0EA 4Q5VA 2K5QA 3J7AV 1L2FA 1SN8A 4UP7A 1YBYA 5JAVA 3F8TA 4DV2L 3TMEA 3SK6A 2MPMA 3HOVG 1SRUA 3I2ZA 2OEOA 4LUZA 4RG1A 4C3IG 3RN2A 1RIPA 4NXMQ 5C4HA 3WWVA 2R92B 3S16B 1BBXC 2F0WA 5IIFA 2AQ2B 2H4OA 2MP1A 1RODA 3MXNA 4OEMB 1AE3A 3OTOQ 1VCIA 4IUVA 2B2VA 2MHVA 2UXBL 1KTKA 1YVCA 1QZHA 1GM5A 1HNZQ 2OWOA 1KQSA 5AJ3Q 3UI2A 1KIXA 2NVXH 2F0LA 1T9HA 2B29A 1HZAA 2A6ED 3WOEA 2KHIA 3S1QB 1HA5A
chains in the Genus database with same CATH topology
1CSQA 3M4QA 4A3DG 4DR1L 2UUBL 4HJ5A 4LFBL 1KRTA 3GTJH 1Q8KA 4X65L 5FJ8G 4IFDG 5K36G 2JA5H 3T1YL 3TQYA 2EXDA 3TRZA 3CC4A 4JOIA 1YJ9A 4PZ8A 1PH9A 2BA0A 3A74A 3JC66 4P71A 5IP7G 3HOYH 2MO0A 3G48A 3CCEA 2EIFA 1K83H 3PUWA 1OXXK 3S15H 2JE6I 5M5WH 4IJLA 4ALPA 1YIJA 2PNHA 4YCVA 2R93G 4KLKA 5LMUQ 1SMXA 1WCMH 1W2BA 5GQOA 3TS2A 2Y0SG 5C4XH 1Y1VG 1TWHH 3GTQH 3ICEA 3H0GH 3S2DH 4YY3L 2JA5G 4B3SL 4DV3Q 2K52A 3NELA 5IYDH 2R7ZH 2Z0SA 3S14H 1MIUA 2PI2E 3EBEA 1PYSB 4L5QA 4B3MQ 3PCOB 3CCSA 3F2BA 4A3KG 2Z6KC 1VQHA 5M3FH 1I3QH 3G71A 4OO1G 4B3TL 1ASZA 3I4NG 4A3JH 5JJKA 1I5FA 4AYBG 4JBKA 1NMFA 3L7ZC 1Y1WG 4GLVB 4A93G 5C4XG 4JI5L 1L0WA 2E5LL 4IPDA 1OXVA 3H0GG 4B3TQ 1AE2A 2BH2A 4HJ9A 1VS0A 3ZJYC 4A3IH 1SFOH 4DR3L 3CW2C 3HKZG 3KF8B 1N33L 2QEXA 2CFMA 4DUZL 3RNUA 1RL2A 2WAQG 5C3EH 1FGUA 1NTGA 4DV4Q 4JI3L 4LFCL 4EQ5A 3CCLA 1SE8A 1DGSA 3MEFA 4DV0Q 1L1OC 1OTCA 1MJCA 4LUVA 4A3JG 2JA7G 1P8LA 1SR3A 3F2CA 3MXNB 4JI3Q 5DLQE 3STBC 3HOUG 3EN2A 1B7YB 1VQOA 2K5NA 1FL0A 3PUVA 4JI1L 2H5XA 4A3IG 3K0XA 2OCEA 1HH2P 3DLLA 4DUYL 1IXRA 4X64L 4HJ8A 3UDGA 4LF8L 4X66Q 5C4JH 2UU9Q 5IT9c 4A3FG 1XNRQ 3BJUA 1GKHA 2R7DA 5LMNL 4LFAL 5GAEC 1LYLA 3CQZH 3ERSX 4HIOA 3VDYA 1N36Q 4MNOA 4BXXH 4JYAL 3J7ZC 1HNWL 2CKZB 1JB7A 4PG3A 2GVBA 4DR7Q 4JI2L 1QUQB 4DV6Q 1VQEA 5C0XI 1EYGA 1LUZA 4HJ7A 1A63A 3J80i 4X62Q 3KOJA 5HGQA 4TVAB 1JT8A 4DR4Q 2ZTCA 1K3RA 1W3SA 1IBLQ 2CCZA 1CSPA 1TWAH 1YHQA 2K4KA 3S1RH 4JI4L 1VQ5A 4OWWB 2NVTH 2AHOB 2WFWA 1HR0L 2Q2HA 3GTKH 3T1HQ 2XTIA 4XIGS 4GNXC 4DKAC 4AIMA 5IYCH 1JJCB 4J15A 5H1SE 1R9TH 4BXXG 3HOXH 4B3RL 3M4OH 3KF6A 4JI8Q 2R7FA 4DV2Q 3HOWG 4JC0A 2MO1A 2AWOA 3M4PA 5IYBG 3CMAA 4HJAA 3S1MH 4JV5Q 3W5OA 3CC2A 3KDFA 2NZOA 1EIYB 4WJ3M 1XNQL 2NVYH 4A3MG 3CC7A 2HHHL 2MNAA 5M5XH 3AQQA 1PH7A 4A3DH 5JJLA 4PMWA 3KFUA 1UE1A 4BY7H 2I5LX 1S72A 1KXLA 2KCMA 3FKIG 1CKNA 3CXCA 2UXCL 5JJIA 4DR5L 3F2DA 3KJOA 5IYCG 3TS0A 1VQ6A 2RF4A 3UE0A 2WB1G 4OX9Q 3GTPH 1SROA 1QVFA 1KAWA 5IP7H 1XTDA 4GOPC 4NXNL 4GKKL 2UXBQ 2E2IH 3CF5A 2VZAA 3RN5A 3S1NH 4OWTB 4YCUA 2R93H 3RLFA 4JI6L 3M3YH 2VQFQ 5GADC 4QGUA 2YTXA 5JEAJ 3ULPA 3CCVA 4RMFA 3NBHB 4YHHL 4BBSG 1Y1VH 2JEAI 3S17H 4BY7G 2DUDA 2OTLA 3PIOA 2JJQA 4LF4L 1JE5A 1I50H 1BBUA 3CD6A 1OXTA 3AFPA 2L15A 2ZM6L 1B70B 4DR1Q 2UUBQ 5M5YH 1NE3A 4LFBQ 4GN5A 4DK3C 1FJGL 4X65Q 1N34L 4APVA 4L5TA 4BA1I 4A3KH 1K8AC 3T1YQ 4R4OA 1BKBA 2ZM6Q 3BZKA 3I4NH 3U50C 3M7NA 4LWCA 4P75A 2OTJA 4GLXA 4DV7L 2PQAA 3J80c 1Y1WH 1M90C 4HIMA 2VQEL 4A93H 2HIXA 2UXDL 5C0XJ 3G6EA 3J81c 2IX1A 4IFDI 3D31A 4QQBX 3RR5A 1NY4A 4DAMA 2K5VA 1YNXA 1IBKL 2KCTA 1Q7YC 1G6PA 2F3IA 2CWPA 4JCVE 4GKJL 1PH5A 4YY3Q 1NMGA 3A5UA 4QY7A 1XMOL 3CCQA 3I7FA 4DV1L 3GTOH 5FLMG 2JA7H 3RLOA 1N32L 1HZBA 3CP0A 2DGYA 2MFIA 4AYBE 5GROA 2UUAL 3S2HH 4A76A 1SLJA 1Q12A 4PZ7A 1E1OA 1D8LA 3PF4A 4LF9L 1VQPA 1WI5A 1YZ6A 3HOUH 3A0JA 1YHBA 4A3CG 2LXKA 5IWAL 3U4VA 3GTLH 3GO5A 3HKZE 1Q1BA 4JBWA 1XMQL 1GD7A 3UDIA 2NN6G 3CCMA 2R6GA 1Z9FA 3PGZA 2BA1A 2WAQE 3I4MH 3KF6B 1PYBA 1QVCA 2NZHA 1ASYA 2E5LQ 3HFZB 4JI5Q 2IHEA 4A3FH 2F4VL 2HT1A 2B63G 3TEHB 3UDFA 3KDFB 4UPAA 4DR3Q 1N33Q 5BR8L 2MQHA 2YV5A 4OO1I 4DNIA 4DUZQ 1PHJA 2ATWA 2XGTA 1U0LA 4R4IA 2HIVA 1U5KA 4JI7L 4LFCQ 2K14A 4KHPL 1CKNB 1UEBA 1KL9A 3K7AH 4UP9A 4L5RC 3M85A 5E7NA 2YTVA 4POFA 3I4MG 3PO3G 2Z6KA 1WOCA 4JI1Q 4A3BG 4JI0L 3I55A 2PMZE 1NBWA 2ZTDA 1VQIA 1PH4A 3PV0A 4DUYQ 1J5EL 4X64Q 4LF8Q 1GO3E 4LUOA 2IX0A 2ALYB 4YWLA 5J3BA 3HOWH 5IYBH 4A4IA 4HIDA 4P74A 4LFAQ 5LMNQ 1J6QA 3AYHB 2RHQB 1VQJA 4A3MH 4JYAQ 1I94L 2LSSA 4R4TA 3DM3A 4K0KL 3G4SA 4DR6L 1TWGH 1YEZA 1HNWQ 4IPGA 3H3VH 1VQ4A 1PV4A 1K8GA 3CAMA 1OXUA 1CUKA 3SGIA 4QIWE 4JI2Q 3J81i 1KD1C 4UY8C 4AQYL 4LNQA 4LF6L 1L1OA 1OXSC 3FKIH 4P73A 3H15A 4LF7L 2YU9H 3E9IA 3U4ZA 3F1ZA 1VQ8A 4B3SQ 3IRBA 1IBML 4JI4Q 1VQCA 4IFDJ 3RZDH 4BY1G 3OW2A 3NEMA 4A75A 1HR0Q 5GAGC 2AKWB 1EIFA 1XPUA 1MKHA 2N3SA 3STBD 2JA6H 3BZCA 2GN5A 4DAYB 4DV5L 1M1KC 3KLWA 2EQSA 4B3RQ 1QZGA 1VQFA 4Y7NH 1AH9A 2QA4A 5LMNW 4DR2L 4NXML 3CCJA 2IHFA 4BBSH 1N8RC 1D7QA 4IOCA 2UUCL 3L2PA 2HHHQ 2VS1A 2WB1E 5IP9G 5IE8A 5GAHC 1S3OA 4R1JA 1EFWA 4JBMA 4X6AH 4PZ6A 4JOIC 4YWKA 2K50A 2JA6G 1EUJA 4DR5Q 2UXCQ 3OTOL 3AEVA 1IYJB 1JJGA 1VQBA 3S24A 1CKOA 2A1AA 3W1GA 1HNXL 4QL5A 1PH6A 1HR0W 2I0QA 1HNZL 3H3VI 2KBNA 4GNXA 4NXNQ 3TREA 1UE5A 4GKKQ 1LTLA 3E9HA 4LF5L 4C3JH 2Q2TA 2A8VA 1VQ7A 4P72A 5ELOA 4JI6Q 5AJ3L 3UE1A 3JAMi 1GVPA 1V43A 2VL6A 1PH3A 4YHHQ 1E1TA 1Q82C 1HZCA 5EAYA 4IO9A 4LF4Q 2I5MX 3ULJA 1YI2A 4A3EG 1IZ6A 4A3GH 5FLMH 1XPRA 3Q8DA 3PSIA 4IJHA 3HOZG 4MTNA 1HJPA 2Y0SE 1PFSA 1X3GA 2Q2IA 3CCRA 1FJGQ 3PUXA 1N34Q 1X65A 4NB3A 2E2JH 1QUQA 4Y52H 2PI2A 1WFQA 3GTGH 4O2DA 2YYZA 3ER0A 3LGJA 4OWXB 3GTMH 4A3CH 3K8AA 3D0FA 4UP8A 5M3MH 1YJWA 4A3LG 4HIKA 4GOPA 3RZOH 4DV7Q 4KHZA 5LMUL 1O7IA 2VQEQ 1X3EA 3KJPA 4R4CA 2JA9A 2B63H 2NVQH 2UXDQ 1EQRA 4DPGA 4A3GG 2ZJQA 1IBKQ 3B6YA 2ZJRA 5C44H 1PH1A 3PF5A 4DV3L 4GN4B 4JG2A 2CWAA 2IT1A 1YJNA 2Q2UA 4GKJQ 1XMOQ 4B3ML 1PVOA 4OXPA 1Q1EA 4DV1Q 1K73C 3GD7A 2D0OA 1VQAA 1L1OB 1PA6A 1N32Q 4DK6C 5M3MG 1VQLA 2UUAQ 1V9PA 4EX5A 2I5HA 2LXJA 4QJFA 2R92H 1BVSA 3S16H 3PO3H 2ID0A 1PH2A 4LF9Q 4WJ4A 2KHJA 4H02A 3W1BA 1G291 1C9OA 1KRSA 5IWAQ 3CCUA 1Q86C 1XMQQ 5JEAG 1KC8C 3HOYG 4A3BH 2JK8A 3A5ZB 4GLAC 1UWVA 4BBRH 3GDEA 2RHSB 5C44G 2E2HH 1K9MC 1A8VA 1WCMG 2JQOA 4ME3A 1X6OA 1MJEA 3PUZA 4YCWA 2F4VQ 3J7A5 4K0KQ 1Z47A 1N9WA 1EWIA 1TWFH 5BR8Q 5HY6A 4DV4L 2JEBI 2A19A 2C35B 5IYDG 2R7ZG 2AWNA 4DV0L 1TXYA 2NN6I 4FDBA 1G51A 2R92G 3FP9A 4JI7Q 1I6HH 1HZ9A 1WJJA 1QVGA 1YHAA 4TQUS 1VQKA 2VUMH 3JAMc 4KHPQ 1VQGA 2JA8H 3S1QH 1XPOA 5M3FG 4BBRG 2YTYA 4BY1H 3UDXA 5FLXc 3PO2H 2VNUD 1TWCH 5C0XG 4AH6A 1UE6A 4GNXB 1C7YA 4JI0Q 4X66L 1H95A 3PIPA 2UU9L 1E22A 2RCNA 1FVIA 3I4OA 4GS3A 1J5EQ 2ES2A 1XNRL 2E8GA 3KYHC 1JJ2A 1X56A 1N36L 2N8NA 2IY5B 4O0AA 2VW9A 3HKSA 3HOVH 5C3EG 2VUMG 2QGQA 3AFQA 1VQNA 4DR7L 1I94Q 1B8AA 2KENA 4XTCS 3CMEA 4L5SA 2JA8G 4NPSA 4OONA 5IP9H 3CPWA 4DV6L 1LM0A 1X9NA 1IL2A 4DR6Q 1XNQQ 1V1QA 5ELNA 4X62L 4C3IH 1A0IA 1P16A 1X55A 2AMCB 2BH8A 2FXQA 3CPFA 4YWMA 5IY0A 4AQYQ 3K7UC 4LF6Q 3PO2G 4DR4L 3L0OA 1IBLL 3EIVA 2PQAB 2HQLA 4LF7Q 1Y14B 1XJVA 1VQMA 1IBMQ 4C2MH 3T1HL 3BU2A 1K0RA 4LW1A 3I56A 1VQDA 4BA2I 1BBWA 1E24A 1CKMA 3E0EA 4GN3B 4R4QA 4GOPB 1EQQA 3PUYA 1L2FA 2OQ0A 1SN8A 4IPHA 1YBYA 4UP7A 4JI8L 1EOVA 3F8TA 1X54A 2V1CC 4DV2L 4DV5Q 1NJIC 1JMCA 4JV5L 2F52A 3HOVG 1SRUA 3I2ZA 4LUZA 4RG1A 3OYYA 4DR2Q 3RN2A 1RIPA 2D62A 3M9BA 4NXMQ 4IOAA 3WWVA 1UE7A 1E7ZA 2ZJPA 2UUCQ 2D0PA 2K75A 3J81j 2N78A 4A3EH 2K5HA 3HOZH 1A62A 3K80C 1YITA 1S40A 2N49A 1Q81C 4OX9L 1AE3A 3OTOQ 1VCIA 3FHWA 3U58A 1Q46A 2ASBA 1HNXQ 5FJ8H 4A3LH 2UXBL 1YVCA 2ZTEA 4IPCA 4KI0A 1QZHA 1GM5A 1HNZQ 1C0AA 2WP8J 3HOXG 2OQKA 2CQOA 2VQFL 1PH8A 2OWOA 4LF5Q 2B3GA 4C3HH 4MZ9A 1X3FA 1KQSA 4JBJA 3NENA 2VY3A 5AJ3Q 3K81C 4POGA 1KIXA 2NVXH 1E3PA 1KHIA 3ULLA 1VQ9A 1T9HA 2B29A 1HZAA 2GVAA 2KHIA 1WYDA 3RLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSQ A;  3M4Q A;  4A3D G;  4DR1 L;  2UUB L;  4HJ5 A;  4LFB L;  1KRT A;  3GTJ H;  1Q8K A;  4X65 L;  5FJ8 G;  4IFD G;  5K36 G;  2JA5 H;  3T1Y L;  3TQY A;  2EXD A;  3TRZ A;  3CC4 A;  4JOI A;  1YJ9 A;  4PZ8 A;  1PH9 A;  2BA0 A;  3A74 A;  3JC6 6;  4P71 A;  5IP7 G;  3HOY H;  2MO0 A;  3G48 A;  3CCE A;  2EIF A;  1K83 H;  3PUW A;  1OXX K;  3S15 H;  2JE6 I;  5M5W H;  4IJL A;  4ALP A;  1YIJ A;  2PNH A;  4YCV A;  2R93 G;  4KLK A;  5LMU Q;  1SMX A;  1WCM H;  1W2B A;  5GQO A;  3TS2 A;  2Y0S G;  5C4X H;  1Y1V G;  1TWH H;  3GTQ H;  3ICE A;  3H0G H;  3S2D H;  4YY3 L;  2JA5 G;  4B3S L;  4DV3 Q;  2K52 A;  3NEL A;  5IYD H;  2R7Z H;  2Z0S A;  3S14 H;  1MIU A;  2PI2 E;  3EBE A;  1PYS B;  4L5Q A;  4B3M Q;  3PCO B;  3CCS A;  3F2B A;  4A3K G;  2Z6K C;  1VQH A;  5M3F H;  1I3Q H;  3G71 A;  4OO1 G;  4B3T L;  1ASZ A;  3I4N G;  4A3J H;  5JJK A;  1I5F A;  4AYB G;  4JBK A;  1NMF A;  3L7Z C;  1Y1W G;  4GLV B;  4A93 G;  5C4X G;  4JI5 L;  1L0W A;  2E5L L;  4IPD A;  1OXV A;  3H0G G;  4B3T Q;  1AE2 A;  2BH2 A;  4HJ9 A;  1VS0 A;  3ZJY C;  4A3I H;  1SFO H;  4DR3 L;  3CW2 C;  3HKZ G;  3KF8 B;  1N33 L;  2QEX A;  2CFM A;  4DUZ L;  3RNU A;  1RL2 A;  2WAQ G;  5C3E H;  1FGU A;  1NTG A;  4DV4 Q;  4JI3 L;  4LFC L;  4EQ5 A;  3CCL A;  1SE8 A;  1DGS A;  3MEF A;  4DV0 Q;  1L1O C;  1OTC A;  1MJC A;  4LUV A;  4A3J G;  2JA7 G;  1P8L A;  1SR3 A;  3F2C A;  3MXN B;  4JI3 Q;  5DLQ E;  3STB C;  3HOU G;  3EN2 A;  1B7Y B;  1VQO A;  2K5N A;  1FL0 A;  3PUV A;  4JI1 L;  2H5X A;  4A3I G;  3K0X A;  2OCE A;  1HH2 P;  3DLL A;  4DUY L;  1IXR A;  4X64 L;  4HJ8 A;  3UDG A;  4LF8 L;  4X66 Q;  5C4J H;  2UU9 Q;  5IT9 c;  4A3F G;  1XNR Q;  3BJU A;  1GKH A;  2R7D A;  5LMN L;  4LFA L;  5GAE C;  1LYL A;  3CQZ H;  3ERS X;  4HIO A;  3VDY A;  1N36 Q;  4MNO A;  4BXX H;  4JYA L;  3J7Z C;  1HNW L;  2CKZ B;  1JB7 A;  4PG3 A;  2GVB A;  4DR7 Q;  4JI2 L;  1QUQ B;  4DV6 Q;  1VQE A;  5C0X I;  1EYG A;  1LUZ A;  4HJ7 A;  1A63 A;  3J80 i;  4X62 Q;  3KOJ A;  5HGQ A;  4TVA B;  1JT8 A;  4DR4 Q;  2ZTC A;  1K3R A;  1W3S A;  1IBL Q;  2CCZ A;  1CSP A;  1TWA H;  1YHQ A;  2K4K A;  3S1R H;  4JI4 L;  1VQ5 A;  4OWW B;  2NVT H;  2AHO B;  2WFW A;  1HR0 L;  2Q2H A;  3GTK H;  3T1H Q;  2XTI A;  4XIG S;  4GNX C;  4DKA C;  4AIM A;  5IYC H;  1JJC B;  4J15 A;  5H1S E;  1R9T H;  4BXX G;  3HOX H;  4B3R L;  3M4O H;  3KF6 A;  4JI8 Q;  2R7F A;  4DV2 Q;  3HOW G;  4JC0 A;  2MO1 A;  2AWO A;  3M4P A;  5IYB G;  3CMA A;  4HJA A;  3S1M H;  4JV5 Q;  3W5O A;  3CC2 A;  3KDF A;  2NZO A;  1EIY B;  4WJ3 M;  1XNQ L;  2NVY H;  4A3M G;  3CC7 A;  2HHH L;  2MNA A;  5M5X H;  3AQQ A;  1PH7 A;  4A3D H;  5JJL A;  4PMW A;  3KFU A;  1UE1 A;  4BY7 H;  2I5L X;  1S72 A;  1KXL A;  2KCM A;  3FKI G;  1CKN A;  3CXC A;  2UXC L;  5JJI A;  4DR5 L;  3F2D A;  3KJO A;  5IYC G;  3TS0 A;  1VQ6 A;  2RF4 A;  3UE0 A;  2WB1 G;  4OX9 Q;  3GTP H;  1SRO A;  1QVF A;  1KAW A;  5IP7 H;  1XTD A;  4GOP C;  4NXN L;  4GKK L;  2UXB Q;  2E2I H;  3CF5 A;  2VZA A;  3RN5 A;  3S1N H;  4OWT B;  4YCU A;  2R93 H;  3RLF A;  4JI6 L;  3M3Y H;  2VQF Q;  5GAD C;  4QGU A;  2YTX A;  5JEA J;  3ULP A;  3CCV A;  4RMF A;  3NBH B;  4YHH L;  4BBS G;  1Y1V H;  2JEA I;  3S17 H;  4BY7 G;  2DUD A;  2OTL A;  3PIO A;  2JJQ A;  4LF4 L;  1JE5 A;  1I50 H;  1BBU A;  3CD6 A;  1OXT A;  3AFP A;  2L15 A;  2ZM6 L;  1B70 B;  4DR1 Q;  2UUB Q;  5M5Y H;  1NE3 A;  4LFB Q;  4GN5 A;  4DK3 C;  1FJG L;  4X65 Q;  1N34 L;  4APV A;  4L5T A;  4BA1 I;  4A3K H;  1K8A C;  3T1Y Q;  4R4O A;  1BKB A;  2ZM6 Q;  3BZK A;  3I4N H;  3U50 C;  3M7N A;  4LWC A;  4P75 A;  2OTJ A;  4GLX A;  4DV7 L;  2PQA A;  3J80 c;  1Y1W H;  1M90 C;  4HIM A;  2VQE L;  4A93 H;  2HIX A;  2UXD L;  5C0X J;  3G6E A;  3J81 c;  2IX1 A;  4IFD I;  3D31 A;  4QQB X;  3RR5 A;  1NY4 A;  4DAM A;  2K5V A;  1YNX A;  1IBK L;  2KCT A;  1Q7Y C;  1G6P A;  2F3I A;  2CWP A;  4JCV E;  4GKJ L;  1PH5 A;  4YY3 Q;  1NMG A;  3A5U A;  4QY7 A;  1XMO L;  3CCQ A;  3I7F A;  4DV1 L;  3GTO H;  5FLM G;  2JA7 H;  3RLO A;  1N32 L;  1HZB A;  3CP0 A;  2DGY A;  2MFI A;  4AYB E;  5GRO A;  2UUA L;  3S2H H;  4A76 A;  1SLJ A;  1Q12 A;  4PZ7 A;  1E1O A;  1D8L A;  3PF4 A;  4LF9 L;  1VQP A;  1WI5 A;  1YZ6 A;  3HOU H;  3A0J A;  1YHB A;  4A3C G;  2LXK A;  5IWA L;  3U4V A;  3GTL H;  3GO5 A;  3HKZ E;  1Q1B A;  4JBW A;  1XMQ L;  1GD7 A;  3UDI A;  2NN6 G;  3CCM A;  2R6G A;  1Z9F A;  3PGZ A;  2BA1 A;  2WAQ E;  3I4M H;  3KF6 B;  1PYB A;  1QVC A;  2NZH A;  1ASY A;  2E5L Q;  3HFZ B;  4JI5 Q;  2IHE A;  4A3F H;  2F4V L;  2HT1 A;  2B63 G;  3TEH B;  3UDF A;  3KDF B;  4UPA A;  4DR3 Q;  1N33 Q;  5BR8 L;  2MQH A;  2YV5 A;  4OO1 I;  4DNI A;  4DUZ Q;  1PHJ A;  2ATW A;  2XGT A;  1U0L A;  4R4I A;  2HIV A;  1U5K A;  4JI7 L;  4LFC Q;  2K14 A;  4KHP L;  1CKN B;  1UEB A;  1KL9 A;  3K7A H;  4UP9 A;  4L5R C;  3M85 A;  5E7N A;  2YTV A;  4POF A;  3I4M G;  3PO3 G;  2Z6K A;  1WOC A;  4JI1 Q;  4A3B G;  4JI0 L;  3I55 A;  2PMZ E;  1NBW A;  2ZTD A;  1VQI A;  1PH4 A;  3PV0 A;  4DUY Q;  1J5E L;  4X64 Q;  4LF8 Q;  1GO3 E;  4LUO A;  2IX0 A;  2ALY B;  4YWL A;  5J3B A;  3HOW H;  5IYB H;  4A4I A;  4HID A;  4P74 A;  4LFA Q;  5LMN Q;  1J6Q A;  3AYH B;  2RHQ B;  1VQJ A;  4A3M H;  4JYA Q;  1I94 L;  2LSS A;  4R4T A;  3DM3 A;  4K0K L;  3G4S A;  4DR6 L;  1TWG H;  1YEZ A;  1HNW Q;  4IPG A;  3H3V H;  1VQ4 A;  1PV4 A;  1K8G A;  3CAM A;  1OXU A;  1CUK A;  3SGI A;  4QIW E;  4JI2 Q;  3J81 i;  1KD1 C;  4UY8 C;  4AQY L;  4LNQ A;  4LF6 L;  1L1O A;  1OXS C;  3FKI H;  4P73 A;  3H15 A;  4LF7 L;  2YU9 H;  3E9I A;  3U4Z A;  3F1Z A;  1VQ8 A;  4B3S Q;  3IRB A;  1IBM L;  4JI4 Q;  1VQC A;  4IFD J;  3RZD H;  4BY1 G;  3OW2 A;  3NEM A;  4A75 A;  1HR0 Q;  5GAG C;  2AKW B;  1EIF A;  1XPU A;  1MKH A;  2N3S A;  3STB D;  2JA6 H;  3BZC A;  2GN5 A;  4DAY B;  4DV5 L;  1M1K C;  3KLW A;  2EQS A;  4B3R Q;  1QZG A;  1VQF A;  4Y7N H;  1AH9 A;  2QA4 A;  5LMN W;  4DR2 L;  4NXM L;  3CCJ A;  2IHF A;  4BBS H;  1N8R C;  1D7Q A;  4IOC A;  2UUC L;  3L2P A;  2HHH Q;  2VS1 A;  2WB1 E;  5IP9 G;  5IE8 A;  5GAH C;  1S3O A;  4R1J A;  1EFW A;  4JBM A;  4X6A H;  4PZ6 A;  4JOI C;  4YWK A;  2K50 A;  2JA6 G;  1EUJ A;  4DR5 Q;  2UXC Q;  3OTO L;  3AEV A;  1IYJ B;  1JJG A;  1VQB A;  3S24 A;  1CKO A;  2A1A A;  3W1G A;  1HNX L;  4QL5 A;  1PH6 A;  1HR0 W;  2I0Q A;  1HNZ L;  3H3V I;  2KBN A;  4GNX A;  4NXN Q;  3TRE A;  1UE5 A;  4GKK Q;  1LTL A;  3E9H A;  4LF5 L;  4C3J H;  2Q2T A;  2A8V A;  1VQ7 A;  4P72 A;  5ELO A;  4JI6 Q;  5AJ3 L;  3UE1 A;  3JAM i;  1GVP A;  1V43 A;  2VL6 A;  1PH3 A;  4YHH Q;  1E1T A;  1Q82 C;  1HZC A;  5EAY A;  4IO9 A;  4LF4 Q;  2I5M X;  3ULJ A;  1YI2 A;  4A3E G;  1IZ6 A;  4A3G H;  5FLM H;  1XPR A;  3Q8D A;  3PSI A;  4IJH A;  3HOZ G;  4MTN A;  1HJP A;  2Y0S E;  1PFS A;  1X3G A;  2Q2I A;  3CCR A;  1FJG Q;  3PUX A;  1N34 Q;  1X65 A;  4NB3 A;  2E2J H;  1QUQ A;  4Y52 H;  2PI2 A;  1WFQ A;  3GTG H;  4O2D A;  2YYZ A;  3ER0 A;  3LGJ A;  4OWX B;  3GTM H;  4A3C H;  3K8A A;  3D0F A;  4UP8 A;  5M3M H;  1YJW A;  4A3L G;  4HIK A;  4GOP A;  3RZO H;  4DV7 Q;  4KHZ A;  5LMU L;  1O7I A;  2VQE Q;  1X3E A;  3KJP A;  4R4C A;  2JA9 A;  2B63 H;  2NVQ H;  2UXD Q;  1EQR A;  4DPG A;  4A3G G;  2ZJQ A;  1IBK Q;  3B6Y A;  2ZJR A;  5C44 H;  1PH1 A;  3PF5 A;  4DV3 L;  4GN4 B;  4JG2 A;  2CWA A;  2IT1 A;  1YJN A;  2Q2U A;  4GKJ Q;  1XMO Q;  4B3M L;  1PVO A;  4OXP A;  1Q1E A;  4DV1 Q;  1K73 C;  3GD7 A;  2D0O A;  1VQA A;  1L1O B;  1PA6 A;  1N32 Q;  4DK6 C;  5M3M G;  1VQL A;  2UUA Q;  1V9P A;  4EX5 A;  2I5H A;  2LXJ A;  4QJF A;  2R92 H;  1BVS A;  3S16 H;  3PO3 H;  2ID0 A;  1PH2 A;  4LF9 Q;  4WJ4 A;  2KHJ A;  4H02 A;  3W1B A;  1G29 1;  1C9O A;  1KRS A;  5IWA Q;  3CCU A;  1Q86 C;  1XMQ Q;  5JEA G;  1KC8 C;  3HOY G;  4A3B H;  2JK8 A;  3A5Z B;  4GLA C;  1UWV A;  4BBR H;  3GDE A;  2RHS B;  5C44 G;  2E2H H;  1K9M C;  1A8V A;  1WCM G;  2JQO A;  4ME3 A;  1X6O A;  1MJE A;  3PUZ A;  4YCW A;  2F4V Q;  3J7A 5;  4K0K Q;  1Z47 A;  1N9W A;  1EWI A;  1TWF H;  5BR8 Q;  5HY6 A;  4DV4 L;  2JEB I;  2A19 A;  2C35 B;  5IYD G;  2R7Z G;  2AWN A;  4DV0 L;  1TXY A;  2NN6 I;  4FDB A;  1G51 A;  2R92 G;  3FP9 A;  4JI7 Q;  1I6H H;  1HZ9 A;  1WJJ A;  1QVG A;  1YHA A;  4TQU S;  1VQK A;  2VUM H;  3JAM c;  4KHP Q;  1VQG A;  2JA8 H;  3S1Q H;  1XPO A;  5M3F G;  4BBR G;  2YTY A;  4BY1 H;  3UDX A;  5FLX c;  3PO2 H;  2VNU D;  1TWC H;  5C0X G;  4AH6 A;  1UE6 A;  4GNX B;  1C7Y A;  4JI0 Q;  4X66 L;  1H95 A;  3PIP A;  2UU9 L;  1E22 A;  2RCN A;  1FVI A;  3I4O A;  4GS3 A;  1J5E Q;  2ES2 A;  1XNR L;  2E8G A;  3KYH C;  1JJ2 A;  1X56 A;  1N36 L;  2N8N A;  2IY5 B;  4O0A A;  2VW9 A;  3HKS A;  3HOV H;  5C3E G;  2VUM G;  2QGQ A;  3AFQ A;  1VQN A;  4DR7 L;  1I94 Q;  1B8A A;  2KEN A;  4XTC S;  3CME A;  4L5S A;  2JA8 G;  4NPS A;  4OON A;  5IP9 H;  3CPW A;  4DV6 L;  1LM0 A;  1X9N A;  1IL2 A;  4DR6 Q;  1XNQ Q;  1V1Q A;  5ELN A;  4X62 L;  4C3I H;  1A0I A;  1P16 A;  1X55 A;  2AMC B;  2BH8 A;  2FXQ A;  3CPF A;  4YWM A;  5IY0 A;  4AQY Q;  3K7U C;  4LF6 Q;  3PO2 G;  4DR4 L;  3L0O A;  1IBL L;  3EIV A;  2PQA B;  2HQL A;  4LF7 Q;  1Y14 B;  1XJV A;  1VQM A;  1IBM Q;  4C2M H;  3T1H L;  3BU2 A;  1K0R A;  4LW1 A;  3I56 A;  1VQD A;  4BA2 I;  1BBW A;  1E24 A;  1CKM A;  3E0E A;  4GN3 B;  4R4Q A;  4GOP B;  1EQQ A;  3PUY A;  1L2F A;  2OQ0 A;  1SN8 A;  4IPH A;  1YBY A;  4UP7 A;  4JI8 L;  1EOV A;  3F8T A;  1X54 A;  2V1C C;  4DV2 L;  4DV5 Q;  1NJI C;  1JMC A;  4JV5 L;  2F52 A;  3HOV G;  1SRU A;  3I2Z A;  4LUZ A;  4RG1 A;  3OYY A;  4DR2 Q;  3RN2 A;  1RIP A;  2D62 A;  3M9B A;  4NXM Q;  4IOA A;  3WWV A;  1UE7 A;  1E7Z A;  2ZJP A;  2UUC Q;  2D0P A;  2K75 A;  3J81 j;  2N78 A;  4A3E H;  2K5H A;  3HOZ H;  1A62 A;  3K80 C;  1YIT A;  1S40 A;  2N49 A;  1Q81 C;  4OX9 L;  1AE3 A;  3OTO Q;  1VCI A;  3FHW A;  3U58 A;  1Q46 A;  2ASB A;  1HNX Q;  5FJ8 H;  4A3L H;  2UXB L;  1YVC A;  2ZTE A;  4IPC A;  4KI0 A;  1QZH A;  1GM5 A;  1HNZ Q;  1C0A A;  2WP8 J;  3HOX G;  2OQK A;  2CQO A;  2VQF L;  1PH8 A;  2OWO A;  4LF5 Q;  2B3G A;  4C3H H;  4MZ9 A;  1X3F A;  1KQS A;  4JBJ A;  3NEN A;  2VY3 A;  5AJ3 Q;  3K81 C;  4POG A;  1KIX A;  2NVX H;  1E3P A;  1KHI A;  3ULL A;  1VQ9 A;  1T9H A;  2B29 A;  1HZA A;  2GVA A;  2KHI A;  1WYD A;  3RLN A; 
#chains in the Genus database with same CATH topology
 4WFN 3;  1F2M A;  1KAB A;  4HTH A;  3CKI B;  5CV7 A;  4V19 0;  1QB5 D;  3PO2 B;  1Q8K A;  4IFD G;  5K36 G;  1BOS A;  3TQY A;  3CC4 A;  4JOI A;  1YJ9 A;  4KN7 C;  4C3H G;  1PH9 A;  3X3M A;  4P71 A;  2VB2 X;  3E3X A;  1TS2 A;  4ALP A;  4OO1 H;  2PNH A;  4CJ1 B;  5LMU Q;  3Q22 A;  5ELF A;  3TS2 A;  5I9P A;  1WTX A;  1O80 A;  3ICE A;  2F0D A;  3S2D H;  3BDC A;  2JA5 G;  1MSG A;  1STH A;  4ZKB B;  3MFY A;  2A5H A;  2PI2 E;  3EBE A;  4C2M B;  4L5Q A;  3PCO B;  3CCS A;  1HHV A;  3E0J A;  1VQH A;  1JR0 D;  3J7A F;  4AYB G;  3K5M A;  3T56 B;  4JBK A;  3L7Z C;  2JXM B;  4JI5 L;  4NMZ A;  2E5L L;  4G4K A;  4IPD A;  1AE2 A;  3EQL C;  3ZJY C;  4A3I H;  1SFO H;  3FVQ A;  1N33 L;  4KY6 A;  1NR4 A;  4DAV A;  2PO4 A;  1IL8 A;  1RL2 A;  5C3E H;  1NTG A;  4JI3 L;  2K05 A;  5DEH A;  3MEF A;  4U67 3;  1MJC A;  2F0N A;  4S3S A;  4RGN A;  1CM9 A;  3GP7 A;  4CDE C;  5KYL A;  4LMQ D;  2MGS A;  3D4D A;  1VQO A;  1PZK D;  2NB0 A;  2NVX B;  4A3G B;  2XWJ B;  1J9O A;  4JVZ A;  3UDG A;  4LF8 L;  1D5M C;  5DAU A;  3TP8 A;  2AUK A;  2F0J A;  1LYL A;  4Z9C B;  1PFM A;  3Q6S A;  4BXX H;  3J7Z C;  1JB7 A;  4DXG A;  1KLG D;  2GVB A;  4JI2 L;  1U4P A;  4ULL A;  2EDG A;  5C0X I;  1PYW D;  1EYG A;  1A63 A;  5DM7 3;  5HGQ A;  5KRU A;  1GUG A;  4DR4 Q;  4KV6 A;  4RFB A;  1W3S A;  3W3A A;  1IBL Q;  1TWA H;  4KY5 A;  1VQ5 A;  3ITP A;  3WOF A;  1EY0 A;  2F0E A;  4XIG S;  4AIM A;  3O13 A;  1DOK A;  1JJC B;  4J15 A;  5H1S E;  3S2D B;  3HOW G;  4HCS A;  2MO1 A;  4JC0 A;  3CMA A;  2EY2 A;  1SXT A;  1A2T A;  2NZO A;  5IGD A;  1O7L A;  1F9Q A;  2E76 C;  2L4N A;  4A3D H;  2AQ1 B;  3KFU A;  5ELD A;  4BY7 H;  3CXC A;  4DA2 A;  3A8I E;  3KJO A;  1VQ6 A;  3C3L A;  3UE0 A;  2K01 A;  3IL8 A;  1ZYR C;  3HS0 C;  1SFO B;  1XTD A;  4QMG A;  2L11 A;  1SYB A;  2FHT A;  5C3E B;  3RN5 A;  1JC7 A;  3M3Y H;  5LL6 S;  3ULP A;  3ND9 A;  2RDF A;  1HQR D;  5TSS A;  3S17 H;  3PIO A;  2JJQ A;  2Z6B A;  1M4V A;  4RH6 A;  1BBU A;  3CD6 A;  3AFP A;  2L15 A;  4DR1 Q;  3OIQ A;  4LFB Q;  3QG1 A;  1CHP D;  4X65 Q;  1G6Z A;  4L5T A;  3OWE B;  3I4N H;  2A69 C;  4LWC A;  4GLX A;  3J80 c;  5KIX A;  2CHB D;  5C0X J;  3J81 c;  1IBK L;  3SK8 A;  3I72 A;  4N8X 1;  1RCV D;  1TWA B;  2OF1 A;  1PH5 A;  1A2U A;  1EL0 A;  2A68 D;  2IPK D;  3CCQ A;  4DV1 L;  2JA7 H;  1HZB A;  1Q12 A;  4PZ7 A;  1E1O A;  3PF4 A;  2DNE A;  3HOU H;  1YHB A;  1PRT D;  4N9P A;  4A3C G;  5IWA L;  3U4V A;  3HKZ E;  3UDI A;  1C48 A;  2WAQ E;  4HCE A;  4U68 A;  2NZH A;  1CA5 A;  4H13 C;  4A3D B;  4Q0F A;  2IHE A;  4KK7 A;  2HT1 A;  2F4V L;  4QUC A;  2JSO A;  1D5Z C;  1GHK A;  3UDF A;  4BY7 B;  1I4H A;  4UPA A;  5BR8 L;  4OO1 I;  4DNI A;  1CQF A;  4IN3 A;  1SNC A;  1TKW B;  3DUZ A;  4FNF A;  2EYJ A;  3VR5 A;  4DK1 A;  2F0M A;  3D4W A;  1BNZ A;  4JI7 L;  4LFC Q;  5FO9 B;  1CKN B;  1UEB A;  5D3D A;  3T4A C;  4UP9 A;  3DMU A;  3M3Y B;  5KEE A;  1GJX A;  4JW0 A;  4A3B G;  2AQ3 B;  2ZTD A;  1PH4 A;  1J5E L;  2O4X A;  4E6I A;  3CRK C;  5IYB H;  2ZXO A;  1DZ1 A;  4HID A;  5LMN Q;  4K5V A;  5A35 A;  1TY0 A;  1VQJ A;  2D5D A;  4A3M H;  4JYA Q;  4K0K L;  3G4S A;  4DR6 L;  3H3V H;  1K8G A;  3CAM A;  3I4N B;  3SGI A;  3DHQ A;  1BR9 A;  2LY7 A;  5C4X B;  2KA7 A;  2B2V C;  4O42 A;  4JI4 Q;  1HR0 Q;  1EIF A;  3BDO A;  4IZ8 A;  2N3S A;  5BN4 A;  1RJT A;  3BZC A;  3MXG A;  1ILP A;  1QZG A;  2A6H C;  3GV6 A;  1VQF A;  1MSH A;  1STB A;  4FVM A;  1WTR A;  2Z4H A;  2QA4 A;  3OHX C;  5LMN W;  2JA7 B;  4HAE A;  2IHF A;  4BBS H;  4IOC A;  3L2P A;  3I91 A;  3DXJ C;  3HOU B;  1B2T A;  2O5J C;  2EZV A;  3K5N A;  5I2Y A;  5EGT A;  1FNU A;  3A8J E;  4JBM A;  1EU3 A;  4PZ6 A;  4JOI C;  2K50 A;  2UXC Q;  4DR5 Q;  1EYD A;  5CV6 A;  4KKS A;  3VR3 A;  1ML0 D;  3W1G A;  1PH6 A;  1HR0 W;  2RVL A;  3J80 E;  1UE5 A;  1LTL A;  3M4Y A;  4C3J H;  3J81 E;  2Q2T A;  4ID6 A;  3JAM i;  5FO7 B;  4YHH Q;  1SYF A;  1HQM C;  4IO9 A;  1RTO A;  4UAI A;  3ULJ A;  1YI2 A;  4A3E G;  4QIW B;  2A6H D;  1T5X D;  3D3R A;  3Q8D A;  3PSI A;  4IJH A;  3V96 A;  1ONL A;  3HZX A;  1X3G A;  3CCR A;  1F9P A;  4IUP A;  4NB3 A;  1SNP A;  1NNX A;  1U4L A;  3ER0 A;  3GTM H;  3RUZ A;  4R8N A;  4A3L G;  2EVB A;  1IKL A;  5IGB A;  4HIK A;  4A3M B;  1CK1 A;  3RZO H;  3IFT A;  2O2L D;  4FXK C;  1BCP C;  5JEA H;  4DPG A;  2RBM A;  1JCK B;  1DON A;  4O1N A;  3MWY W;  5DNF A;  1EFI D;  4LJZ C;  3K0Y A;  4B3M L;  4OXP A;  1CA6 A;  1E0B A;  1PLF A;  5KYI A;  1VQA A;  1L1O B;  1IHZ A;  1PA6 A;  1JOR A;  5M3M G;  2UUA Q;  1O7Y A;  1B50 A;  2I5H A;  3PO3 H;  1BVS A;  2ID0 A;  1RTN A;  4NDX A;  4WJ4 A;  1EZ6 A;  1LT4 D;  5K5P A;  1C9O A;  1KRS A;  1Q86 C;  4BBS B;  1GUN A;  3OPO A;  5C44 G;  3KK7 A;  2E2H H;  1SE2 A;  3OSO A;  1Z47 A;  1RF2 D;  1AFP A;  5IYD G;  2AWN A;  3BVM A;  4ZYS A;  1G51 A;  1CFM A;  1HZ9 A;  2KUM A;  2PCF B;  1BCP D;  5J22 A;  4J1M A;  5G3L F;  2JN4 A;  4C3J B;  3OW7 A;  1LV9 A;  1SYE A;  2YTY A;  4BBR G;  2M9V A;  5FLX c;  3NE5 B;  4AH6 A;  4GNX B;  4JI0 Q;  1H95 A;  2UU9 L;  1E22 A;  1FVI A;  3N52 A;  1XNR L;  1VDZ A;  1H9M A;  2KVM A;  1SDF A;  3KYH C;  1JJ2 A;  2N8N A;  4O0A A;  3J80 L;  1E2W A;  2DY8 A;  1I94 Q;  4L5S A;  3HOV H;  3AU7 A;  3T16 A;  3CPW A;  1LM0 A;  2PYK A;  5FOB B;  1IL2 A;  1XNQ Q;  4X62 L;  1PFB A;  3GTM B;  4C3I H;  3CPF A;  1X55 A;  2BH8 A;  2FXQ A;  3MFG A;  4JK1 C;  4YWM A;  1WTO A;  1D2B A;  2EYH A;  2IW3 A;  3EIV A;  1XJV A;  2OXP A;  1CHQ D;  1RD9 D;  4LW1 A;  1K0R A;  3SVM A;  4BA2 I;  1BBW A;  3L9A X;  4WJW A;  1EQQ A;  3PUY A;  2OQ0 A;  4IPH A;  4JI8 L;  5C5L A;  4DV5 Q;  1X54 A;  2V1C C;  1NJI C;  4JV5 L;  2F52 A;  3A7L A;  5IGE A;  2KCN A;  2SNS A;  3MTS A;  2O5I C;  3OYY A;  2D62 A;  4KKU A;  4QCL A;  1K8M A;  2K75 A;  4KD4 A;  3VYT A;  3PO3 B;  5IGF A;  3HOZ H;  1IW7 C;  1GUS A;  2N49 A;  1Q81 C;  4OX9 L;  2E2H B;  3CHB D;  1I4R A;  3HOX G;  4CKE A;  2CQO A;  4WRD A;  2VQF L;  4C3H H;  4OEL B;  2VY3 A;  3K81 C;  4G57 A;  1E3P A;  1KHI A;  3EA6 A;  1EEF D;  2GVA A;  1RHP A;  3GTJ H;  1WYD A;  5JPN C;  2UUB L;  3R8B A;  3E6Z X;  5FJ8 G;  2JA5 H;  1MBY A;  2EXD A;  4P2C B;  1PTO C;  4PZ8 A;  2BA0 A;  3HOY H;  2MO0 A;  3CCE A;  1STN A;  3PUW A;  1OXX K;  3S15 H;  4IJL A;  4YCV A;  4CGY B;  4KLK A;  3HOV B;  1KLU D;  3DWP A;  5BN3 A;  1WTV A;  1HUN A;  2WIN B;  3ZYY X;  1Y1V G;  5F2D A;  3BDL A;  3GTQ H;  1F2Y A;  5L37 A;  1MHW C;  2K52 A;  3CRL C;  5IGC A;  4IUT A;  1JWM D;  1TR5 A;  3DM1 A;  4A3K G;  1WD0 A;  5M3F H;  1I3Q H;  3G71 A;  4B3T L;  5FLX E;  4DK0 A;  4DFA A;  2HD3 A;  4ILW A;  1Y1W G;  4A93 G;  2D2C C;  1EYA A;  5JPM C;  4ZCK A;  1XXG A;  1JWS D;  4HJ9 A;  2BDN A;  4DR3 L;  3CW2 C;  3HKZ G;  3HOZ B;  2WAQ G;  3R3O A;  4C56 C;  1HXY D;  4EQ5 A;  3CCL A;  1DGS A;  4DV0 Q;  2PNR C;  2F0F A;  1OTC A;  4LUV A;  1P8L A;  2F0V A;  4ODG A;  2EPB A;  1PMR A;  4JI3 Q;  5CR3 A;  3STB C;  2A73 B;  3PUV A;  4HR7 B;  1TS5 A;  4X3K A;  3K0X A;  2OCE A;  1H9K A;  4DUY L;  1IXR A;  2G5D A;  4X64 L;  3GTJ B;  2RQX A;  1I4Q A;  5DM6 3;  1EWC A;  3BS1 A;  1GKH A;  4ZLT F;  4LFA L;  1A3U A;  3C1E A;  1N36 Q;  2JA5 B;  1HNW L;  5C5M A;  1EY4 A;  4DV6 Q;  1I4G A;  1LUZ A;  4HJ7 A;  3HOY B;  2B2W A;  3S15 B;  2ZTC A;  4B9X A;  1YHQ A;  3QO2 A;  3S1R H;  3LNN A;  4MIU A;  3BZD B;  4DKA C;  3GTQ B;  4B3R L;  2F03 A;  1GXD C;  2EXZ A;  5I4D A;  3OIP A;  4XQJ A;  3CC2 A;  1SNO A;  4WJ3 M;  1TVX A;  3CC7 A;  1DD2 A;  2MNA A;  3AQQ A;  1I3Q B;  5M3F B;  1PH7 A;  5CYU A;  1SBB B;  3HG9 A;  2I5L X;  1B9N A;  2KCM A;  5EJW A;  1CKN A;  5IYC G;  3TS0 A;  2RF4 A;  5M9O A;  1SRO A;  4DXF A;  1QVF A;  1J8I A;  5IP7 H;  2ICI A;  4NXN L;  1R4Q B;  3CF5 A;  2VUM B;  2VZA A;  2R93 H;  2QW7 A;  2RDH A;  2YTX A;  5JEA J;  3PIO 3;  3KLS A;  2JEA I;  2DUD A;  1JE5 A;  2QIL A;  5M5Y H;  1LTB D;  2A74 C;  1N34 L;  3KUP A;  3SXH A;  3T1Y Q;  1PTO F;  2PW5 A;  4OIJ A;  1HFN A;  1BKB A;  1ET9 A;  3BZK A;  1FD7 D;  4P75 A;  2OTJ A;  2VQE L;  4PQX A;  3NK9 A;  2JP1 A;  2HIX A;  4MTK A;  3G6E A;  2IX1 A;  4IFD I;  1EU4 A;  3V05 A;  3R93 A;  2IWH A;  3NXW A;  2K32 A;  4GKJ L;  3S1R B;  4YY3 Q;  3A5U A;  4BWG B;  4QY7 A;  4KHV A;  4C1N I;  2EYP A;  2XRQ D;  5FLM G;  1X3Q A;  4A76 A;  1SLJ A;  1D8L A;  1TII D;  1WTH A;  1WTW A;  1VQP A;  2EYM A;  3FPP A;  1Y8P B;  3GO5 A;  5CV9 A;  1Q1B A;  1XWE A;  2NN6 G;  3VR6 A;  1Z9F A;  2BA1 A;  4K5W A;  5NUC A;  1ASY A;  4A3F H;  2M00 A;  2B63 G;  3KDF B;  1JWU D;  2LFN A;  4CDF C;  1DYQ A;  3H6M A;  3NBI A;  1NUC A;  2MQH A;  4DUZ Q;  2B8G A;  3K5O A;  4CHT B;  1LAB A;  5EKK A;  2K14 A;  4KHP L;  2XVS A;  1KL9 A;  3K7A H;  1AEX A;  1ICF B;  4L5R C;  2CQA A;  2R93 B;  4L6T B;  2YTV A;  4POF A;  1LTI D;  4CJ0 B;  4RKL A;  2FIN B;  4K8J A;  2Y0S B;  4JI1 Q;  2RSO A;  2PMZ E;  1B44 D;  1EY5 A;  2IX0 A;  2ALY B;  5M5Y B;  4A4I A;  2QCP X;  3MAQ A;  2RHQ B;  2WKD A;  3K58 A;  2LSS A;  3MZ5 A;  1JOQ A;  3Q24 A;  4TRD A;  1CUK A;  4QIW E;  1KD1 C;  5C4Z A;  4AQY L;  4LF6 L;  1L1O A;  1OXS C;  1G2T A;  3FKI H;  4J8Q A;  4P73 A;  3H15 A;  2WKC A;  3F1Z A;  4B3S Q;  1STY A;  4IFD J;  1VQC A;  2SDF A;  1NCV A;  4HN7 A;  3OW2 A;  3NEM A;  2AKW B;  2GN5 A;  3HGB A;  4Y7N H;  3DEO A;  1B3A A;  2X6G A;  4NXM L;  1F2L A;  1N8R C;  2HHH Q;  1I6V C;  5IP9 G;  5IE8 A;  3KF8 A;  2SNM A;  3EJI A;  2DJG C;  4R1J A;  4A3I B;  3V2T A;  4X6A H;  2I46 A;  4YWK A;  2JA6 G;  1PRT B;  3RMH A;  3OTO L;  1JJG A;  1IYJ B;  3SR1 A;  1VQB A;  2CW0 C;  4A3F B;  2P5Z X;  3G7L A;  5CV5 A;  1HNZ L;  2M2L A;  2KBN A;  4PMC A;  2RDG A;  4GNX A;  3TRE A;  4GKK Q;  2BE5 C;  1HUM A;  4P72 A;  5ELO A;  3GQB A;  4JI6 Q;  1S5C D;  5AJ3 L;  1T5E A;  1GVP A;  4TKO B;  5CGK A;  1PH3 A;  3K7A B;  5EAY A;  1EQT A;  4LF4 Q;  1IZ6 A;  2F0U A;  1B3Q A;  4MTN A;  2Q2I A;  3DEP A;  1FJG Q;  2E75 C;  4Y52 H;  1QUQ A;  1U9R A;  1WFQ A;  2IJ0 A;  3GTG H;  3LGJ A;  1X32 A;  4XQQ A;  2Q8R E;  1NSN S;  3K8A A;  5M3M H;  2VXW A;  4M1U B;  1ZYR D;  4DV7 Q;  5LMU L;  1X3E A;  1NAP A;  3RD4 A;  2UXD Q;  1STA A;  2NVQ H;  2CW0 D;  4A3G G;  3IKJ A;  5ELE A;  3FKI B;  2ZJQ A;  2ZJR A;  4OHJ A;  5C44 H;  3QIA A;  2CWA A;  2WB1 B;  1YJN A;  1SYC A;  4KN4 C;  1XMO Q;  1Q1E A;  1K73 C;  1MD2 D;  1WD1 A;  1S5F D;  2ICE C;  1N32 Q;  4DK6 C;  5E4X A;  4EX5 A;  1H9R A;  4LF9 Q;  1PH2 A;  3JAM E;  4Y7N B;  3C46 A;  4ZUJ A;  3W1B A;  1KNE A;  3QOJ A;  1XMQ Q;  1KC8 C;  4CBV A;  3A5Z B;  2A69 D;  4BBR H;  1K0S A;  3PUZ A;  4YCW A;  1BF4 A;  4EGV A;  2BCO A;  1K28 A;  1N9W A;  1EWI A;  1TWF H;  4OIK A;  2B2W C;  1I6H H;  1Z6H A;  1YHA A;  4TQU S;  1VQK A;  1ESF A;  3S17 B;  1EY7 A;  2F0T A;  5C3W A;  4RCO A;  1SYD A;  4ME5 A;  4XQN A;  1AN8 A;  3UDX A;  4RA8 A;  4BY1 H;  2VNU D;  1B1Z A;  2K5W A;  1TWC H;  1S4Z A;  2RCN A;  2K33 A;  2ES2 A;  2DJF C;  2VW9 A;  3ERQ A;  5C3E G;  1VQN A;  3AFQ A;  1OO9 B;  3N6R A;  3CME A;  2KEN A;  2JA8 G;  5JJL A;  4OON A;  3GTG B;  3MXU A;  2F0S A;  1HCZ A;  5ELN A;  3OMC A;  1SE3 A;  1P16 A;  4QF4 A;  4DR4 L;  1WTP A;  3K7U C;  3U9S A;  1IBL L;  1FGB D;  4DN4 M;  1KDC A;  4LF7 Q;  1IBM Q;  1VQD A;  5G3L D;  4GN3 B;  2QEJ C;  4GOP B;  1VF5 C;  1SEB D;  2WII B;  1L0X B;  1QCB D;  2TSS A;  4K6D A;  4DR2 Q;  3M9B A;  5JOB A;  1B9M A;  2KJX A;  2ZJP A;  2UUC Q;  3J81 j;  5LL6 X;  2K5H A;  1DOM A;  1IYV A;  3K80 C;  3QJY A;  1YIT A;  2HDL A;  4BBR B;  4EVO A;  4H0L C;  1YNN C;  3FHW A;  1Q46 A;  2ASB A;  1HNX Q;  5FJ8 H;  1LT6 D;  1TWF B;  1BQQ T;  3Q0A A;  4LF5 Q;  1EQV A;  2B3G A;  2PZW A;  2PZU A;  3URY A;  2RSN A;  3NEN A;  4ZQ3 A;  1I6H B;  1CZW A;  3ULL A;  1VQ9 A;  1L0Y B;  1YIJ A;  2G9D A;  3TSS A;  4A3D G;  5CV4 A;  4DR1 L;  4BY1 B;  4LFB L;  1TWC B;  4X65 L;  1A3V A;  4DGZ A;  2F4I A;  3T53 B;  1JIC A;  1FNV A;  1LAC A;  2HDM A;  4BS9 A;  3HEJ A;  3G48 A;  4I7Z C;  1SMY C;  2JE6 I;  5M5W H;  2FMM A;  3H94 A;  5A2Q E;  3C2P A;  5FKA C;  5J39 A;  1WCM H;  3TP7 A;  5GQO A;  5ISR A;  1TWH H;  1Q90 A;  4MN3 A;  4R8I A;  4DV3 Q;  3NEL A;  4DF7 A;  2R7Z H;  2Z0S A;  3S14 H;  1MIU A;  3BYT B;  1PYS B;  2QKI C;  3LWE A;  2EYF A;  1SE4 A;  3I4N G;  2E2D C;  1G91 A;  1I5F A;  1G2S A;  5C4X G;  2F0O A;  4OGQ C;  3H3V C;  1LLR D;  1UAP A;  4LK1 C;  4B3T Q;  3H0G G;  3K6O A;  2BH2 A;  5J1Z A;  3KF8 B;  3W2D A;  1V1O A;  5IT9 E;  3RNU A;  3TP5 A;  4DV4 Q;  1SMY D;  4LFC L;  1TQO A;  4FF3 A;  1TS4 A;  1MI2 A;  1EOT A;  1L1O C;  1UNS A;  2RA4 A;  4A3J G;  2JA7 G;  1HTL D;  1SR3 A;  3F2C A;  1RKN A;  3HOU G;  1B7Y B;  2EYL A;  4EQP A;  1FL0 A;  4IUR A;  2H5X A;  4JPB W;  4HJ8 A;  2F0P A;  4X66 Q;  5C4J H;  1C8C A;  1Q3L A;  3BJU A;  5LMN L;  5GAE C;  3J81 L;  3CQZ H;  3ERS X;  4JYA L;  2CKZ B;  1EY9 A;  2EY5 A;  3RZO B;  5COR A;  2J4X A;  4DR7 Q;  1HPC A;  1QUQ B;  1VQE A;  3J80 i;  3KOJ A;  1LTT D;  4TVA B;  2K6A A;  5M5W B;  1K3R A;  1CSP A;  2NVT H;  2K4K A;  4G7Z C;  4JI4 L;  1WCM B;  1ZXT A;  2AHO B;  1HR0 L;  2PQE A;  2Q2H A;  2EY1 A;  3T1H Q;  4GNX C;  1TWH B;  1Z7T A;  2Q8T A;  5IYC H;  1R9T H;  1A6X A;  5HGT A;  4ABN A;  3K5L A;  2R7Z B;  5EPL A;  4DV2 Q;  1LO5 D;  1CQV A;  2AWO A;  3M4P A;  3MHB A;  5IYB G;  3S14 B;  3KDF A;  1EIY B;  4PMB A;  2NVY H;  4A3M G;  1IKM A;  3A8K E;  1D1I A;  4HSP A;  4RKB A;  4H7B A;  5EKL A;  5A2Q L;  4IFD H;  2UXC L;  5K36 H;  4DR5 L;  4FXD A;  3TP6 A;  1DM0 B;  2KEE A;  4L63 B;  1A15 A;  1PXU A;  1EY6 A;  1KAW A;  2UXB Q;  2C9O A;  1STG A;  2E2I H;  1CI3 M;  5I9O A;  3S1N H;  4OWT B;  4YCU A;  1YNJ C;  2Z9H A;  3T13 A;  1DXM A;  3I70 A;  3NBH B;  4YHH L;  4BBS G;  1ESR A;  1AZQ A;  3SE0 A;  1OXT A;  1QJO A;  3NP8 A;  1F9S A;  2ZM6 L;  1B70 B;  1GHJ A;  1BDO A;  1ILQ A;  3I4L A;  4DK3 C;  4APV A;  4BA1 I;  4R4O A;  5C4J B;  4KKT A;  1IW7 D;  3U50 C;  3I3C A;  5EQ0 A;  1PFN A;  5KNB A;  3CQZ B;  1UUP A;  4C3I B;  2PQA A;  1XTC D;  1V1P A;  2C5C A;  4HIM A;  1RDP D;  4IUU A;  2B8F A;  2FMC A;  2RKS A;  3D31 A;  2KHS A;  3RR5 A;  2NN6 H;  4DAM A;  1ENC A;  2K5V A;  1JE4 A;  2KCT A;  1Q7Y C;  3EFX D;  2F3I A;  2VB3 X;  2CWP A;  4JCV E;  1SYG A;  2L5T A;  2L1B A;  3GTO H;  3FRP B;  2F0Q A;  3RLO A;  3SK5 A;  2DGY A;  2UUA L;  5GRO A;  3P1H A;  4QUF A;  1R9T B;  2E74 C;  4K2K A;  1YZ6 A;  3TZD A;  3A0J A;  2LXK A;  3GTL H;  4IQZ A;  1GD7 A;  4C1N K;  2NVY B;  1PTO D;  3K59 A;  4CJ2 C;  3KF6 B;  1PYB A;  1QVC A;  4JI5 Q;  2E5L Q;  3HFZ B;  2XSC A;  1W6K A;  2F0G A;  3TEH B;  2LMC B;  3BVG A;  1N33 Q;  4XYQ A;  3SDZ A;  2XGT A;  5EBD A;  1PZI D;  4R4I A;  4C3H B;  4X3T A;  1ZKO A;  5KNC A;  2E2I B;  3S1N B;  1HTP A;  3M85 A;  5E7N A;  3I4M G;  3PO3 G;  4PNY A;  2Z6K A;  4GZY C;  1WOC A;  4JI0 L;  3I55 A;  1NBW A;  3PV0 A;  3VYR A;  3C1F A;  4LF8 Q;  1GO3 E;  4LUO A;  3HOW H;  1VMP A;  1U4R A;  4CKB A;  4XT3 B;  5CV8 A;  4P74 A;  3AYH B;  1G8Z D;  1I94 L;  4R4T A;  1JB3 A;  1YEZ A;  4IPG A;  2KCC A;  2LS0 1;  1VQ4 A;  1PV4 A;  1OXU A;  1XNQ L;  4JI2 Q;  4LNQ A;  4AYB B;  4MHE A;  3SK4 A;  2EJG C;  5GAG C;  5C3X A;  4RGO S;  1XPU A;  2XNA C;  1MKH A;  3STB D;  2J0T D;  2JA6 H;  4EQO A;  4DAY B;  4DV5 L;  4IAL A;  2EQS A;  3KBX A;  2A6E C;  1AH9 A;  3GTO B;  5CBA E;  2DN8 A;  3CCJ A;  5HUR A;  1D7Q A;  3D6C A;  2WB1 E;  2B2Y A;  3NUC A;  5GAH C;  3VR4 A;  3GTL B;  2G9H D;  1S3O A;  1EFW A;  4IUN A;  5E3F A;  3X3N A;  1EUJ A;  4WOR A;  3VR2 A;  3MVV A;  4QL5 A;  1JOO A;  4N8F A;  5FLX L;  5T1G A;  5CC4 A;  1VQ7 A;  4ZKC B;  5EPJ A;  2K7V A;  1V43 A;  1S5E D;  1E1T A;  4B08 A;  1HZC A;  1SJH D;  1Q82 C;  3OMG A;  1GUW A;  1TS3 A;  3J7Y W;  1CTM A;  3TDQ A;  4A3G H;  2B2U A;  3HOZ G;  1Y69 U;  1PFS A;  3PUX A;  2KED A;  2E2J H;  2PI2 A;  3HOW B;  4O2D A;  4FP5 D;  4A3C H;  4OWX B;  3D0F A;  4UP8 A;  2ZXP A;  5I2X A;  4GOP A;  4KHZ A;  4RGM A;  4M8A A;  2DY7 A;  3IAY A;  1O7Z A;  4R4C A;  3F2U A;  2JA9 A;  1EQR A;  1FYC A;  1IBK Q;  3B6Y A;  5I6Y A;  1X3P A;  5KND A;  1PH1 A;  1UEA B;  4GN4 B;  5D65 A;  1CT1 D;  4JG2 A;  5ELB A;  2IT1 A;  4EQN A;  1PVO A;  4DV1 Q;  2KQ3 A;  2JA6 B;  3A55 A;  2DNC A;  1VQL A;  1V9P A;  1QNU A;  2EY6 A;  4QJF A;  1C4Q A;  3VA7 A;  4H02 A;  5JJI A;  1G29 1;  5IWA Q;  3HOY G;  3CCU A;  4A3B H;  3GV3 A;  3GDE A;  2RHS B;  1EEI D;  1K9M C;  2K28 A;  2Z8L A;  1EIH A;  4ME3 A;  1X6O A;  4DNT B;  3J7A 5;  2F4V Q;  3T51 B;  5D14 A;  4CDD C;  2HQE A;  5BR8 Q;  2JEB I;  3ONA B;  2NYZ D;  4DV0 L;  2NN6 I;  2BDO A;  2WV6 D;  1DOL A;  3NWT A;  4FDB A;  4KD3 A;  4B9W A;  2R92 G;  2HCC A;  4JI7 Q;  5IGG A;  4ZK9 B;  1QVG A;  1B53 A;  3JAM c;  2JA8 H;  2NZ1 D;  1XPO A;  1GOZ A;  2CH4 A;  5M3F G;  4KTA A;  2TMP A;  1BUV T;  1SAP A;  3HRZ C;  2Z1C A;  2CH4 W;  5C0X G;  1UE6 A;  3PIP A;  3I4O A;  1J5E Q;  1BXT A;  2XRS D;  1N36 L;  2IL8 A;  2IY5 B;  3HKS A;  2VUM G;  2QGQ A;  2E2J B;  4K0K Q;  4XTC S;  4DR6 Q;  4NPS A;  4DV6 L;  1X9N A;  3IFD A;  1V1Q A;  1A0I A;  3E5S A;  1LTR D;  2AMC B;  3PO2 G;  1PZJ D;  2PQA B;  2L9H A;  1V1P B;  2QF7 A;  1VQM A;  4G7O C;  2X69 A;  5KGU A;  3KBG A;  3I56 A;  3FDT A;  1E24 A;  1CKM A;  3NQT A;  4R4Q A;  2OT2 A;  4HED A;  2F3V A;  1EOV A;  2HCI A;  1JMC A;  1D1K A;  1FR3 A;  3MEH A;  4IOA A;  1UE7 A;  1E7Z A;  2D0P A;  1CZG A;  2N78 A;  3G6J B;  4A3E H;  2N55 A;  4K14 A;  2JYO A;  1A62 A;  4A3B B;  1SSO A;  1S40 A;  1SJE D;  3AB9 A;  1H9S B;  2BOS A;  2B39 A;  1F9R A;  4FXG C;  3U58 A;  4A3L H;  4UDU C;  2ZTE A;  4IPC A;  4KI0 A;  4OL7 A;  1C0A A;  2WP8 J;  2OQK A;  1PH8 A;  4R9W A;  4PV1 C;  4MZ9 A;  1X3F A;  4JBJ A;  1MGS A;  1LT3 D;  4POG A;  1A3T A;  2A68 C;  1GUT A;  5BN5 A;  2JA8 B;  3RLN A;  1CSQ A;  3M4Q A;  4UHV A;  3NTK A;  4V0B A;  4HJ5 A;  5E1F A;  1KRT A;  1KAA A;  3DWQ A;  1PRT C;  2MUY A;  3T1Y L;  3TRZ A;  3U9O A;  2EOT A;  4XYO A;  1GUO A;  4LAA A;  2NTT A;  3A74 A;  3JC6 6;  2SOB A;  4XXE A;  5IP7 G;  3FEW X;  2EIF A;  1K83 H;  2R93 G;  2FJ2 A;  4X3S A;  2EJM A;  1SMX A;  1W2B A;  1F77 A;  2Y0S G;  4X3U A;  3P20 A;  2BE5 D;  5C4X H;  2QDL A;  3H0G H;  4YY3 L;  5IYD H;  1R4P B;  1LT5 D;  3L3O C;  3VYU A;  5I6W A;  4HMI A;  4B3M Q;  4YIJ A;  3F2B A;  2Z6K C;  4OO1 G;  2N88 A;  1ASZ A;  4A3J H;  5JJK A;  1KNA A;  1XYI A;  4RCN A;  1NMF A;  4GLV B;  1L0W A;  2KEC A;  1OXV A;  1ENF A;  4A3E B;  1VS0 A;  1E2Z A;  4I7A A;  2QEX A;  3NBH A;  2CFM A;  4DUZ L;  3NWS A;  3ND8 A;  1FGU A;  1IYU A;  1I4X A;  5EKI A;  2F0H A;  1SE8 A;  5EBC A;  5CMD A;  2B2T A;  2EYO A;  3R2T A;  3MXN B;  5DLQ E;  4J6H A;  3EN2 A;  3QWN A;  1QE6 A;  2K5N A;  4JI1 L;  4A3I G;  3KLR A;  1WTQ A;  1HH2 P;  3DLL A;  2UU9 Q;  5IT9 c;  4K5X A;  4A3F G;  1XNR Q;  2CVR A;  2R7D A;  3EVQ A;  3VDY A;  4HIO A;  1LTG D;  4MNO A;  5M3M B;  4PG3 A;  5JVH 3;  2B2Y C;  4RWS C;  3CU7 A;  3I90 A;  4TSS A;  2PW7 A;  3PMF A;  4K6L A;  1ENA A;  4X62 Q;  2NVQ B;  1H9J A;  1JT8 A;  1K83 B;  2LKV A;  1VMC A;  2V4D A;  2L55 A;  3MXP A;  4KJN A;  5C44 B;  2CCZ A;  4B3S L;  4OWW B;  3KLS X;  1EWH A;  2WFW A;  3QR8 A;  4RHS A;  3QOL A;  1U4M A;  3SHL A;  3GTK H;  2XTI A;  3H0G B;  3HOX H;  4BXX G;  5EPK A;  3M4O H;  3KF6 A;  4JI8 Q;  2R7F A;  4HJA A;  2NBF A;  3S1M H;  1QNK A;  1TT2 A;  3W5O A;  5CBE E;  4JV5 Q;  1BO0 A;  1O78 A;  3BYY B;  5COY A;  3M7G A;  2D9U A;  2F3W A;  2HHH L;  5M5X H;  1AP0 A;  4I65 A;  2B2U C;  2L12 A;  4PMW A;  4A3J B;  3A7A B;  1UE1 A;  4ZUI A;  1SNM A;  1S72 A;  1KXL A;  3FKI G;  3F2D A;  1VF7 A;  3D8G A;  2WB1 G;  3PQI A;  4OX9 Q;  3GTP H;  4GOP C;  4GKK L;  3JAM L;  2ZT9 C;  2AUJ D;  4FYD A;  3RLF A;  4JI6 L;  2VQF Q;  5GAD C;  1II3 A;  4QGU A;  3NPP A;  3CCV A;  5FK9 C;  4DNR B;  3ERO A;  2PMZ B;  4RMF A;  1BCP B;  1Y1V H;  4BY7 G;  2OTL A;  4LF4 L;  3I73 A;  1I50 H;  1SND A;  2F0K A;  2HUG A;  2UUB Q;  1NE3 A;  4N9T A;  1TU2 B;  1PRT F;  4GN5 A;  1FJG L;  1K8A C;  4A3K H;  2Z4I A;  2ZM6 Q;  3QB3 A;  1K8O A;  3WDN A;  3M7N A;  1QOH A;  1AW7 A;  1KDA A;  2ENB A;  4DV7 L;  1Y1W H;  1YNN D;  1M90 C;  4A93 H;  4DAY A;  2K03 A;  2UXD L;  4QQB X;  1NY4 A;  1ZEQ X;  1W6J A;  1YNX A;  4CKC A;  4DAP A;  3H91 A;  2MJ8 A;  1EY8 A;  2KOL A;  1G6P A;  2R61 A;  1NMG A;  1XMO L;  3I7F A;  3TBI B;  3D4R A;  3GTK B;  1N32 L;  5JJZ A;  3CP0 A;  4AYB E;  2MFI A;  3S2H H;  3D6W A;  3HOX B;  4L8J A;  3M4O B;  4LF9 L;  1WI5 A;  3S1M B;  2GA4 B;  4JBW A;  1XMQ L;  1B4O A;  1DJR D;  3CCM A;  2R3Z A;  2R6G A;  4H44 C;  3NQI A;  3PGZ A;  4K2L A;  3I4M H;  2K04 A;  5M5X B;  3BVZ A;  1ET6 A;  1PTO H;  3A56 A;  3NTI A;  4DR3 Q;  1S5B D;  2YV5 A;  2QDB A;  3BG3 A;  1PHJ A;  2ATW A;  4FF4 A;  1V8Q A;  3MC0 B;  1M8A A;  1U0L A;  3GTP B;  2HIV A;  1U5K A;  1HRJ A;  1STE A;  1QWY A;  1E2V A;  4QB4 A;  1HA6 A;  4RAU C;  1Y1V B;  1LTS D;  1VQI A;  3VA5 A;  1I50 B;  3H09 A;  4DUY Q;  4X64 Q;  4YWL A;  5J3B A;  4LFA Q;  5FO8 B;  4FF2 A;  1J6Q A;  1S5D D;  1EZ8 A;  2EJF C;  3DM3 A;  4A3K B;  1HNW Q;  4F7X A;  1TWG H;  3MA2 B;  5AFW A;  3J81 i;  4UY8 C;  1JQY D;  2K5D A;  2X6L A;  4HMJ A;  2K1B A;  1Y1W B;  4LF7 L;  4A93 B;  2YU9 H;  2XN9 C;  3E9I A;  3U4Z A;  1VQ8 A;  3IRB A;  3SEB A;  1IBM L;  3RZD H;  4BY1 G;  1QG7 A;  3NHH A;  4A75 A;  3HKZ B;  3TZU A;  1NR2 A;  1PDQ A;  5E4W C;  2WAQ B;  1M1K C;  3KLW A;  4B3R Q;  4DR2 L;  3AMU A;  1KDB A;  3S2H B;  5LHY 1;  2UUC L;  2PPB C;  3Q23 A;  2XWB B;  3OOC A;  2VS1 A;  2L0C A;  4G7H C;  1SNQ A;  4DU9 A;  1EIG A;  4NP5 A;  3I4M B;  4F8M A;  3AEV A;  2IX3 A;  3S24 A;  1CKO A;  2A1A A;  4ZRZ A;  1EYC A;  1HNX L;  1PTO B;  2I0Q A;  1ICW A;  3S9W A;  2I07 B;  3H3V I;  4NKL A;  4NXN Q;  4F87 A;  3E9H A;  4LF5 L;  5IOD A;  2A8V A;  5IOC A;  3HP3 A;  2RCF A;  3UE1 A;  2VL6 A;  3LWU A;  3P75 A;  2I5M X;  4RHR A;  2ZXR A;  3NSW A;  5IT9 L;  5FLM H;  4IUQ A;  1F2Z A;  1XPR A;  1DCZ A;  1K3B C;  1HJP A;  2Y0S E;  1HFG A;  4XT1 B;  1N34 Q;  1X65 A;  4C3J G;  2YYZ A;  4KJO A;  4F88 A;  2SEB D;  1YJW A;  3R2I A;  1Q8I A;  3K57 A;  1O7I A;  1TWG B;  3NTH A;  2VQE Q;  3KJP A;  3OWF A;  2NVT B;  2FFK B;  2B63 H;  3LX0 A;  3FMC A;  1YNJ D;  2F0I A;  2NTS A;  2YU9 B;  3PF5 A;  4DV3 L;  3A54 A;  1BCP F;  4KY7 A;  2Q2U A;  2B2T C;  2EE1 A;  4FF1 A;  1TY2 A;  4GKJ Q;  3RZD B;  3GD7 A;  2D0O A;  2LXJ A;  1H9S A;  2R92 H;  3S16 H;  3P7J A;  2KHJ A;  3TN2 A;  2F1M A;  2PZT A;  5JEA G;  1QIL A;  2JK8 A;  4GLA C;  1UWV A;  2WAC A;  4HSV A;  4FO2 A;  1A8V A;  1JOK A;  1LTA D;  1WCM G;  2JQO A;  2H1E A;  1Y8O B;  1MJE A;  5JVG 3;  5C0X H;  5T1I A;  1AZP A;  3I8Z A;  4K8I A;  4ZAI A;  3VYS A;  5HY6 A;  4DV4 L;  2A19 A;  2C35 B;  2R7Z G;  4NW2 A;  5ELC A;  1TXY A;  5C6A A;  3FP9 A;  1WJJ A;  5D3I B;  2VUM H;  4KHP Q;  1VQG A;  3S1Q H;  2Q8I B;  3PIP 3;  3DWA A;  3PO2 H;  1D5X C;  2NWG A;  1C7Y A;  4KMU C;  4RGT A;  4X66 L;  4GS3 A;  1I4P A;  2E8G A;  2NUC A;  1X56 A;  2J7Z A;  3FPU B;  1XX8 A;  4CDC C;  4DR7 L;  1B8A A;  5IP9 H;  1D6E C;  1FNW A;  1Y8N B;  5IY0 A;  4AQY Q;  2XIW A;  4LF6 Q;  3L0O A;  2HQL A;  1Y14 B;  2B63 B;  4C2M H;  3T1H L;  3BU2 A;  4XDX A;  1WVL A;  3E0E A;  4Q5V A;  2K5Q A;  3J7A V;  1L2F A;  1SN8 A;  4UP7 A;  1YBY A;  5JAV A;  3F8T A;  4DV2 L;  3TME A;  3SK6 A;  2MPM A;  3HOV G;  1SRU A;  3I2Z A;  2OEO A;  4LUZ A;  4RG1 A;  4C3I G;  3RN2 A;  1RIP A;  4NXM Q;  5C4H A;  3WWV A;  2R92 B;  3S16 B;  1BBX C;  2F0W A;  5IIF A;  2AQ2 B;  2H4O A;  2MP1 A;  1ROD A;  3MXN A;  4OEM B;  1AE3 A;  3OTO Q;  1VCI A;  4IUV A;  2B2V A;  2MHV A;  2UXB L;  1KTK A;  1YVC A;  1QZH A;  1GM5 A;  1HNZ Q;  2OWO A;  1KQS A;  5AJ3 Q;  3UI2 A;  1KIX A;  2NVX H;  2F0L A;  1T9H A;  2B29 A;  1HZA A;  2A6E D;  3WOE A;  2KHI A;  3S1Q B;  1HA5 A; 
#chains in the Genus database with same CATH homology
 1CSQ A;  3M4Q A;  4A3D G;  4DR1 L;  2UUB L;  4HJ5 A;  4LFB L;  1KRT A;  3GTJ H;  1Q8K A;  4X65 L;  5FJ8 G;  4IFD G;  5K36 G;  2JA5 H;  3T1Y L;  3TQY A;  2EXD A;  3TRZ A;  3CC4 A;  4JOI A;  1YJ9 A;  4PZ8 A;  1PH9 A;  2BA0 A;  3A74 A;  3JC6 6;  4P71 A;  5IP7 G;  3HOY H;  2MO0 A;  3G48 A;  3CCE A;  2EIF A;  1K83 H;  3PUW A;  1OXX K;  3S15 H;  2JE6 I;  5M5W H;  4IJL A;  4ALP A;  1YIJ A;  2PNH A;  4YCV A;  2R93 G;  4KLK A;  5LMU Q;  1SMX A;  1WCM H;  1W2B A;  5GQO A;  3TS2 A;  2Y0S G;  5C4X H;  1Y1V G;  1TWH H;  3GTQ H;  3ICE A;  3H0G H;  3S2D H;  4YY3 L;  2JA5 G;  4B3S L;  4DV3 Q;  2K52 A;  3NEL A;  5IYD H;  2R7Z H;  2Z0S A;  3S14 H;  1MIU A;  2PI2 E;  3EBE A;  1PYS B;  4L5Q A;  4B3M Q;  3PCO B;  3CCS A;  3F2B A;  4A3K G;  2Z6K C;  1VQH A;  5M3F H;  1I3Q H;  3G71 A;  4OO1 G;  4B3T L;  1ASZ A;  3I4N G;  4A3J H;  5JJK A;  1I5F A;  4AYB G;  4JBK A;  1NMF A;  3L7Z C;  1Y1W G;  4GLV B;  4A93 G;  5C4X G;  4JI5 L;  1L0W A;  2E5L L;  4IPD A;  1OXV A;  3H0G G;  4B3T Q;  1AE2 A;  2BH2 A;  4HJ9 A;  1VS0 A;  3ZJY C;  4A3I H;  1SFO H;  4DR3 L;  3CW2 C;  3HKZ G;  3KF8 B;  1N33 L;  2QEX A;  2CFM A;  4DUZ L;  3RNU A;  1RL2 A;  2WAQ G;  5C3E H;  1FGU A;  1NTG A;  4DV4 Q;  4JI3 L;  4LFC L;  4EQ5 A;  3CCL A;  1SE8 A;  1DGS A;  3MEF A;  4DV0 Q;  1L1O C;  1OTC A;  1MJC A;  4LUV A;  4A3J G;  2JA7 G;  1P8L A;  1SR3 A;  3F2C A;  3MXN B;  4JI3 Q;  5DLQ E;  3STB C;  3HOU G;  3EN2 A;  1B7Y B;  1VQO A;  2K5N A;  1FL0 A;  3PUV A;  4JI1 L;  2H5X A;  4A3I G;  3K0X A;  2OCE A;  1HH2 P;  3DLL A;  4DUY L;  1IXR A;  4X64 L;  4HJ8 A;  3UDG A;  4LF8 L;  4X66 Q;  5C4J H;  2UU9 Q;  5IT9 c;  4A3F G;  1XNR Q;  3BJU A;  1GKH A;  2R7D A;  5LMN L;  4LFA L;  5GAE C;  1LYL A;  3CQZ H;  3ERS X;  4HIO A;  3VDY A;  1N36 Q;  4MNO A;  4BXX H;  4JYA L;  3J7Z C;  1HNW L;  2CKZ B;  1JB7 A;  4PG3 A;  2GVB A;  4DR7 Q;  4JI2 L;  1QUQ B;  4DV6 Q;  1VQE A;  5C0X I;  1EYG A;  1LUZ A;  4HJ7 A;  1A63 A;  3J80 i;  4X62 Q;  3KOJ A;  5HGQ A;  4TVA B;  1JT8 A;  4DR4 Q;  2ZTC A;  1K3R A;  1W3S A;  1IBL Q;  2CCZ A;  1CSP A;  1TWA H;  1YHQ A;  2K4K A;  3S1R H;  4JI4 L;  1VQ5 A;  4OWW B;  2NVT H;  2AHO B;  2WFW A;  1HR0 L;  2Q2H A;  3GTK H;  3T1H Q;  2XTI A;  4XIG S;  4GNX C;  4DKA C;  4AIM A;  5IYC H;  1JJC B;  4J15 A;  5H1S E;  1R9T H;  4BXX G;  3HOX H;  4B3R L;  3M4O H;  3KF6 A;  4JI8 Q;  2R7F A;  4DV2 Q;  3HOW G;  4JC0 A;  2MO1 A;  2AWO A;  3M4P A;  5IYB G;  3CMA A;  4HJA A;  3S1M H;  4JV5 Q;  3W5O A;  3CC2 A;  3KDF A;  2NZO A;  1EIY B;  4WJ3 M;  1XNQ L;  2NVY H;  4A3M G;  3CC7 A;  2HHH L;  2MNA A;  5M5X H;  3AQQ A;  1PH7 A;  4A3D H;  5JJL A;  4PMW A;  3KFU A;  1UE1 A;  4BY7 H;  2I5L X;  1S72 A;  1KXL A;  2KCM A;  3FKI G;  1CKN A;  3CXC A;  2UXC L;  5JJI A;  4DR5 L;  3F2D A;  3KJO A;  5IYC G;  3TS0 A;  1VQ6 A;  2RF4 A;  3UE0 A;  2WB1 G;  4OX9 Q;  3GTP H;  1SRO A;  1QVF A;  1KAW A;  5IP7 H;  1XTD A;  4GOP C;  4NXN L;  4GKK L;  2UXB Q;  2E2I H;  3CF5 A;  2VZA A;  3RN5 A;  3S1N H;  4OWT B;  4YCU A;  2R93 H;  3RLF A;  4JI6 L;  3M3Y H;  2VQF Q;  5GAD C;  4QGU A;  2YTX A;  5JEA J;  3ULP A;  3CCV A;  4RMF A;  3NBH B;  4YHH L;  4BBS G;  1Y1V H;  2JEA I;  3S17 H;  4BY7 G;  2DUD A;  2OTL A;  3PIO A;  2JJQ A;  4LF4 L;  1JE5 A;  1I50 H;  1BBU A;  3CD6 A;  1OXT A;  3AFP A;  2L15 A;  2ZM6 L;  1B70 B;  4DR1 Q;  2UUB Q;  5M5Y H;  1NE3 A;  4LFB Q;  4GN5 A;  4DK3 C;  1FJG L;  4X65 Q;  1N34 L;  4APV A;  4L5T A;  4BA1 I;  4A3K H;  1K8A C;  3T1Y Q;  4R4O A;  1BKB A;  2ZM6 Q;  3BZK A;  3I4N H;  3U50 C;  3M7N A;  4LWC A;  4P75 A;  2OTJ A;  4GLX A;  4DV7 L;  2PQA A;  3J80 c;  1Y1W H;  1M90 C;  4HIM A;  2VQE L;  4A93 H;  2HIX A;  2UXD L;  5C0X J;  3G6E A;  3J81 c;  2IX1 A;  4IFD I;  3D31 A;  4QQB X;  3RR5 A;  1NY4 A;  4DAM A;  2K5V A;  1YNX A;  1IBK L;  2KCT A;  1Q7Y C;  1G6P A;  2F3I A;  2CWP A;  4JCV E;  4GKJ L;  1PH5 A;  4YY3 Q;  1NMG A;  3A5U A;  4QY7 A;  1XMO L;  3CCQ A;  3I7F A;  4DV1 L;  3GTO H;  5FLM G;  2JA7 H;  3RLO A;  1N32 L;  1HZB A;  3CP0 A;  2DGY A;  2MFI A;  4AYB E;  5GRO A;  2UUA L;  3S2H H;  4A76 A;  1SLJ A;  1Q12 A;  4PZ7 A;  1E1O A;  1D8L A;  3PF4 A;  4LF9 L;  1VQP A;  1WI5 A;  1YZ6 A;  3HOU H;  3A0J A;  1YHB A;  4A3C G;  2LXK A;  5IWA L;  3U4V A;  3GTL H;  3GO5 A;  3HKZ E;  1Q1B A;  4JBW A;  1XMQ L;  1GD7 A;  3UDI A;  2NN6 G;  3CCM A;  2R6G A;  1Z9F A;  3PGZ A;  2BA1 A;  2WAQ E;  3I4M H;  3KF6 B;  1PYB A;  1QVC A;  2NZH A;  1ASY A;  2E5L Q;  3HFZ B;  4JI5 Q;  2IHE A;  4A3F H;  2F4V L;  2HT1 A;  2B63 G;  3TEH B;  3UDF A;  3KDF B;  4UPA A;  4DR3 Q;  1N33 Q;  5BR8 L;  2MQH A;  2YV5 A;  4OO1 I;  4DNI A;  4DUZ Q;  1PHJ A;  2ATW A;  2XGT A;  1U0L A;  4R4I A;  2HIV A;  1U5K A;  4JI7 L;  4LFC Q;  2K14 A;  4KHP L;  1CKN B;  1UEB A;  1KL9 A;  3K7A H;  4UP9 A;  4L5R C;  3M85 A;  5E7N A;  2YTV A;  4POF A;  3I4M G;  3PO3 G;  2Z6K A;  1WOC A;  4JI1 Q;  4A3B G;  4JI0 L;  3I55 A;  2PMZ E;  1NBW A;  2ZTD A;  1VQI A;  1PH4 A;  3PV0 A;  4DUY Q;  1J5E L;  4X64 Q;  4LF8 Q;  1GO3 E;  4LUO A;  2IX0 A;  2ALY B;  4YWL A;  5J3B A;  3HOW H;  5IYB H;  4A4I A;  4HID A;  4P74 A;  4LFA Q;  5LMN Q;  1J6Q A;  3AYH B;  2RHQ B;  1VQJ A;  4A3M H;  4JYA Q;  1I94 L;  2LSS A;  4R4T A;  3DM3 A;  4K0K L;  3G4S A;  4DR6 L;  1TWG H;  1YEZ A;  1HNW Q;  4IPG A;  3H3V H;  1VQ4 A;  1PV4 A;  1K8G A;  3CAM A;  1OXU A;  1CUK A;  3SGI A;  4QIW E;  4JI2 Q;  3J81 i;  1KD1 C;  4UY8 C;  4AQY L;  4LNQ A;  4LF6 L;  1L1O A;  1OXS C;  3FKI H;  4P73 A;  3H15 A;  4LF7 L;  2YU9 H;  3E9I A;  3U4Z A;  3F1Z A;  1VQ8 A;  4B3S Q;  3IRB A;  1IBM L;  4JI4 Q;  1VQC A;  4IFD J;  3RZD H;  4BY1 G;  3OW2 A;  3NEM A;  4A75 A;  1HR0 Q;  5GAG C;  2AKW B;  1EIF A;  1XPU A;  1MKH A;  2N3S A;  3STB D;  2JA6 H;  3BZC A;  2GN5 A;  4DAY B;  4DV5 L;  1M1K C;  3KLW A;  2EQS A;  4B3R Q;  1QZG A;  1VQF A;  4Y7N H;  1AH9 A;  2QA4 A;  5LMN W;  4DR2 L;  4NXM L;  3CCJ A;  2IHF A;  4BBS H;  1N8R C;  1D7Q A;  4IOC A;  2UUC L;  3L2P A;  2HHH Q;  2VS1 A;  2WB1 E;  5IP9 G;  5IE8 A;  5GAH C;  1S3O A;  4R1J A;  1EFW A;  4JBM A;  4X6A H;  4PZ6 A;  4JOI C;  4YWK A;  2K50 A;  2JA6 G;  1EUJ A;  4DR5 Q;  2UXC Q;  3OTO L;  3AEV A;  1IYJ B;  1JJG A;  1VQB A;  3S24 A;  1CKO A;  2A1A A;  3W1G A;  1HNX L;  4QL5 A;  1PH6 A;  1HR0 W;  2I0Q A;  1HNZ L;  3H3V I;  2KBN A;  4GNX A;  4NXN Q;  3TRE A;  1UE5 A;  4GKK Q;  1LTL A;  3E9H A;  4LF5 L;  4C3J H;  2Q2T A;  2A8V A;  1VQ7 A;  4P72 A;  5ELO A;  4JI6 Q;  5AJ3 L;  3UE1 A;  3JAM i;  1GVP A;  1V43 A;  2VL6 A;  1PH3 A;  4YHH Q;  1E1T A;  1Q82 C;  1HZC A;  5EAY A;  4IO9 A;  4LF4 Q;  2I5M X;  3ULJ A;  1YI2 A;  4A3E G;  1IZ6 A;  4A3G H;  5FLM H;  1XPR A;  3Q8D A;  3PSI A;  4IJH A;  3HOZ G;  4MTN A;  1HJP A;  2Y0S E;  1PFS A;  1X3G A;  2Q2I A;  3CCR A;  1FJG Q;  3PUX A;  1N34 Q;  1X65 A;  4NB3 A;  2E2J H;  1QUQ A;  4Y52 H;  2PI2 A;  1WFQ A;  3GTG H;  4O2D A;  2YYZ A;  3ER0 A;  3LGJ A;  4OWX B;  3GTM H;  4A3C H;  3K8A A;  3D0F A;  4UP8 A;  5M3M H;  1YJW A;  4A3L G;  4HIK A;  4GOP A;  3RZO H;  4DV7 Q;  4KHZ A;  5LMU L;  1O7I A;  2VQE Q;  1X3E A;  3KJP A;  4R4C A;  2JA9 A;  2B63 H;  2NVQ H;  2UXD Q;  1EQR A;  4DPG A;  4A3G G;  2ZJQ A;  1IBK Q;  3B6Y A;  2ZJR A;  5C44 H;  1PH1 A;  3PF5 A;  4DV3 L;  4GN4 B;  4JG2 A;  2CWA A;  2IT1 A;  1YJN A;  2Q2U A;  4GKJ Q;  1XMO Q;  4B3M L;  1PVO A;  4OXP A;  1Q1E A;  4DV1 Q;  1K73 C;  3GD7 A;  2D0O A;  1VQA A;  1L1O B;  1PA6 A;  1N32 Q;  4DK6 C;  5M3M G;  1VQL A;  2UUA Q;  1V9P A;  4EX5 A;  2I5H A;  2LXJ A;  4QJF A;  2R92 H;  1BVS A;  3S16 H;  3PO3 H;  2ID0 A;  1PH2 A;  4LF9 Q;  4WJ4 A;  2KHJ A;  4H02 A;  3W1B A;  1G29 1;  1C9O A;  1KRS A;  5IWA Q;  3CCU A;  1Q86 C;  1XMQ Q;  5JEA G;  1KC8 C;  3HOY G;  4A3B H;  2JK8 A;  3A5Z B;  4GLA C;  1UWV A;  4BBR H;  3GDE A;  2RHS B;  5C44 G;  2E2H H;  1K9M C;  1A8V A;  1WCM G;  2JQO A;  4ME3 A;  1X6O A;  1MJE A;  3PUZ A;  4YCW A;  2F4V Q;  3J7A 5;  4K0K Q;  1Z47 A;  1N9W A;  1EWI A;  1TWF H;  5BR8 Q;  5HY6 A;  4DV4 L;  2JEB I;  2A19 A;  2C35 B;  5IYD G;  2R7Z G;  2AWN A;  4DV0 L;  1TXY A;  2NN6 I;  4FDB A;  1G51 A;  2R92 G;  3FP9 A;  4JI7 Q;  1I6H H;  1HZ9 A;  1WJJ A;  1QVG A;  1YHA A;  4TQU S;  1VQK A;  2VUM H;  3JAM c;  4KHP Q;  1VQG A;  2JA8 H;  3S1Q H;  1XPO A;  5M3F G;  4BBR G;  2YTY A;  4BY1 H;  3UDX A;  5FLX c;  3PO2 H;  2VNU D;  1TWC H;  5C0X G;  4AH6 A;  1UE6 A;  4GNX B;  1C7Y A;  4JI0 Q;  4X66 L;  1H95 A;  3PIP A;  2UU9 L;  1E22 A;  2RCN A;  1FVI A;  3I4O A;  4GS3 A;  1J5E Q;  2ES2 A;  1XNR L;  2E8G A;  3KYH C;  1JJ2 A;  1X56 A;  1N36 L;  2N8N A;  2IY5 B;  4O0A A;  2VW9 A;  3HKS A;  3HOV H;  5C3E G;  2VUM G;  2QGQ A;  3AFQ A;  1VQN A;  4DR7 L;  1I94 Q;  1B8A A;  2KEN A;  4XTC S;  3CME A;  4L5S A;  2JA8 G;  4NPS A;  4OON A;  5IP9 H;  3CPW A;  4DV6 L;  1LM0 A;  1X9N A;  1IL2 A;  4DR6 Q;  1XNQ Q;  1V1Q A;  5ELN A;  4X62 L;  4C3I H;  1A0I A;  1P16 A;  1X55 A;  2AMC B;  2BH8 A;  2FXQ A;  3CPF A;  4YWM A;  5IY0 A;  4AQY Q;  3K7U C;  4LF6 Q;  3PO2 G;  4DR4 L;  3L0O A;  1IBL L;  3EIV A;  2PQA B;  2HQL A;  4LF7 Q;  1Y14 B;  1XJV A;  1VQM A;  1IBM Q;  4C2M H;  3T1H L;  3BU2 A;  1K0R A;  4LW1 A;  3I56 A;  1VQD A;  4BA2 I;  1BBW A;  1E24 A;  1CKM A;  3E0E A;  4GN3 B;  4R4Q A;  4GOP B;  1EQQ A;  3PUY A;  1L2F A;  2OQ0 A;  1SN8 A;  4IPH A;  1YBY A;  4UP7 A;  4JI8 L;  1EOV A;  3F8T A;  1X54 A;  2V1C C;  4DV2 L;  4DV5 Q;  1NJI C;  1JMC A;  4JV5 L;  2F52 A;  3HOV G;  1SRU A;  3I2Z A;  4LUZ A;  4RG1 A;  3OYY A;  4DR2 Q;  3RN2 A;  1RIP A;  2D62 A;  3M9B A;  4NXM Q;  4IOA A;  3WWV A;  1UE7 A;  1E7Z A;  2ZJP A;  2UUC Q;  2D0P A;  2K75 A;  3J81 j;  2N78 A;  4A3E H;  2K5H A;  3HOZ H;  1A62 A;  3K80 C;  1YIT A;  1S40 A;  2N49 A;  1Q81 C;  4OX9 L;  1AE3 A;  3OTO Q;  1VCI A;  3FHW A;  3U58 A;  1Q46 A;  2ASB A;  1HNX Q;  5FJ8 H;  4A3L H;  2UXB L;  1YVC A;  2ZTE A;  4IPC A;  4KI0 A;  1QZH A;  1GM5 A;  1HNZ Q;  1C0A A;  2WP8 J;  3HOX G;  2OQK A;  2CQO A;  2VQF L;  1PH8 A;  2OWO A;  4LF5 Q;  2B3G A;  4C3H H;  4MZ9 A;  1X3F A;  1KQS A;  4JBJ A;  3NEN A;  2VY3 A;  5AJ3 Q;  3K81 C;  4POG A;  1KIX A;  2NVX H;  1E3P A;  1KHI A;  3ULL A;  1VQ9 A;  1T9H A;  2B29 A;  1HZA A;  2GVA A;  2KHI A;  1WYD A;  3RLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...