4GOPB

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
122
Chain Sequence
NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Putative uncharacterized protein
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
total genus 29
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopB00
2MO0A 2Q2HA 2MNAA 1ASYA 2VZAA 2UXCQ 1OXVA 5M5WH 3U4VA 3TQYA 3CCJA 2HT1A 1LM0A 3CXCA 1VQDA 1Y1VH 1JE5A 1E22A 1YHQA 4OXPA 4A3EH 4L5SA 4JI6Q 1GO3E 4JC0A 2ASBA 2E8GA 4NB3A 3CCSA 4KHPL 2ATWA 2V1CC 1R9TH 3BZCA 4JI3L 3LGJA 4LF7Q 2JE6I 5ELOA 1HH2P 2R92G 4QQBX 1EFWA 1O7IA 4EX5A 1EQRA 1KHIA 1WI5A 4A3LH 2PQAA 4GN3B 1VQ5A 4GOPB 3M9BA 3GTJH 1X3FA 2EQSA 2VY3A 4YY3L 2AWOA 3FP9A 4IJLA 4DR5Q 2R7DA 3U58A 1IBML 4UP8A 2Z0SA 4A3MG 1MJCA 2JA7G 2I0QA 2CKZB 1Q7YC 3JAMc 4DV6Q 5GQOA 5FJ8H 3STBC 5C44H 2Z6KA 1D8LA 1UEBA 4EQ5A 1Z47A 4A3JH 4BY7G 5JEAJ 3KF6B 1UE6A 3PSIA 1PV4A 1VQLA 4OWXB 2JA8G 3M4OH 2HIVA 4DAYB 5JEAG 3J81i 3I55A 2R7ZH 3CCRA 4JV5Q 4LFBL 4P74A 1T9HA 4X66Q 1SN8A 4MZ9A 5HGQA 4A3KG 1C7YA 4OO1G 3JC66 3ER0A 2RHQB 2JK8A 3I4OA 3GTQH 3UDXA 4JI1Q 4KLKA 2JQOA 2PMZE 1CUKA 1HR0W 4DPGA 2ZM6L 2CCZA 1NMFA 5M5YH 5GAEC 1KIXA 5LMUL 4DV4L 1PHJA 2ZTCA 2ALYB 3KF8B 4PZ8A 1RIPA 1B7YB 4HIKA 1V1QA 1P16A 1Y1VG 5IYCH 1YNXA 4X65L 4A3EG 2F3IA 3SGIA 2AMCB 3M4QA 4ALPA 3K7AH 4A3IH 2BA0A 3KDFA 4YWLA 4MNOA 4ME3A 2XTIA 2JEBI 4IO9A 4GKJQ 3HOXH 2HIXA 3CCQA 3GTMH 1FGUA 3PUWA 3D0FA 3PUXA 4A3LG 4QL5A 4HJAA 4WJ3M 1X65A 4HJ7A 5EAYA 4GOPA 4C3HH 3CCEA 1HNXL 1UE7A 2UXDQ 1G51A 1JB7A 2NVTH 1N32Q 3TS2A 4OO1I 4P75A 4DR6L 1SMXA 4YHHL 1VQMA 1YITA 3A74A 4R4CA 3H0GH 1G6PA 3GTPH 2WAQG 1HZCA 1XMOL 4HIMA 1PFSA 4A3JG 4DUZQ 1S3OA 3EN2A 4HJ8A 1IBLL 1KD1C 2K14A 3KF6A 1NTGA 2RHSB 2FXQA 1HNWQ 4DV7L 2NN6G 4B3ML 1I50H 4A4IA 2B63H 1DGSA 4JI8L 4NXNQ 3CCLA 4DUYQ 4IPDA 3J7A5 3DLLA 1VQFA 3HOYH 2E2IH 3S1NH 4K0KL 4B3TQ 3J80i 2KCTA 3AQQA 1X9NA 2F52A 2JA5H 2WAQE 3RN2A 2PI2E 1JT8A 2I5MX 3M3YH 2ZTDA 5IYCG 1BVSA 3S2DH 4LUOA 2KBNA 3HKSA 1XPRA 4A3IG 1JJ2A 3S2HH 3G48A 3NENA 5C0XJ 4LF8Q 3TEHB 2WB1G 5C0XG 2A8VA 4A76A 3CAMA 3HOXG 2L15A 2PQAB 4DR2L 1LTLA 1HZBA 2CWPA 1AE3A 3K0XA 4GLAC 3UDGA 1K73C 4GLVB 4QY7A 2VW9A 1VQHA 2QGQA 3CC7A 1E1OA 1XNRL 3CQZH 3GTKH 3G71A 3CCMA 4LFCQ 4AH6A 3CCVA 1X3GA 1SFOH 4LFAQ 5M5XH 3HOVG 3W5OA 3PF4A 1QVGA 1EIYB 1N33L 2WB1E 2C35B 1P8LA 4LF5Q 4UY8C 1W2BA 3H0GG 4DR4Q 4DV0L 1XPUA 3RN5A 2YTVA 2JA6G 4DR7Q 2HHHQ 4DV5L 1EIFA 1HR0Q 2K4KA 3BZKA 3EBEA 4DV1L 5J3BA 3K7UC 3UDIA 4R4QA 1YIJA 2E5LL 3S16H 1MIUA 1N34Q 4BXXG 4H02A 4DR5L 4A3DH 1UE5A 5GADC 1VQCA 2ZJPA 3HOYG 1I6HH 2AWNA 3FHWA 1I94L 1VQNA 2GVAA 1KL9A 4TQUS 5C0XI 4IFDJ 1EOVA 2E2JH 4BA1I 5LMNW 3S24A 3S14H 2JA5G 1VCIA 4IFDG 4R4TA 2OTJA 1TWAH 4UPAA 4JI5Q 1FVIA 1S40A 3MXNB 3KDFB 2NVQH 1Q1BA 2JEAI 4AIMA 5ELNA 1XNQQ 1Y14B 2JA9A 3HOWH 1CSPA 1TWHH 4JI2Q 1L0WA 1YJWA 2UUCL 1V9PA 2DUDA 4GKKL 1EYGA 5JJKA 4QJFA 4GNXC 4DR1Q 5IP7H 1OTCA 1L1OC 2YYZA 4OWTB 5JJLA 2K50A 3PUVA 1J5EQ 1SR3A 1HNZL 1Y1WH 2E2HH 4JBMA 1J6QA 1PH1A 2UUAL 4LF4Q 1OXTA 4JBWA 3OTOL 5IWAQ 4PZ7A 1QVFA 2KCMA 1A8VA 3RZOH 1VQOA 4DK6C 2QA4A 4A3CG 3PO3H 4L5QA 4JYAL 3AFQA 1CKOA 3D31A 1QZHA 4AQYQ 4JOIC 4X62Q 4LF6L 1CSQA 3PUYA 4P71A 1YJ9A 4XTCS 1WFQA 2JJQA 2K5VA 4JI4Q 5AJ3Q 3J81c 3UDFA 3CCUA 1A63A 1GM5A 2D0PA 3S1QH 4AYBG 4IFDI 3E9HA 3S15H 4Y52H 1QVCA 2CFMA 4YCUA 4UP7A 2VQFL 1VQ8A 2VL6A 1IL2A 1YHAA 4RMFA 2UXDL 3CMEA 1PA6A 1Q86C 4JI7L 2K52A 3VDYA 2ES2A 3WWVA 1IZ6A 2EXDA 3PF5A 5HY6A 1XJVA 1G291 1FJGL 3GDEA 1Q1EA 1VS0A 4IPHA 1VQ7A 2I5HA 3H3VH 4JG2A 1X6OA 4AYBE 5BR8L 2WP8J 2F4VL 4C3IH 4YWMA 4IOAA 3NEMA 2PNHA 3T1YL 4DR3L 1TXYA 2UUBL 4X64L 4JI3Q 3L2PA 1N36Q 1TWCH 4WJ4A 2Q2TA 1E1TA 1VQJA 3CW2C 4JBJA 4NXNL 2IHEA 1IXRA 2YTXA 3FKIH 2R6GA 5H1SE 3RLFA 3CP0A 4DKAC 1Y1WG 1IBMQ 2RCNA 4PMWA 1U0LA 4LW1A 4OX9L 2NVXH 1SE8A 1IBKL 1FL0A 1ASZA 3HOZH 2IT1A 1VQ4A 1E3PA 3PO3G 1B70B 3GD7A 1CKMA 3T1HL 2UU9L 4JI0L 5FJ8G 3CC2A 5JJIA 2N8NA 5C44G 3K8AA 1QUQA 1PH5A 3CPFA 1PYSB 2YU9H 2OWOA 4LFBQ 5M3MH 1UWVA 2R7ZG 4B3SL 1C0AA 4QGUA 1VQAA 3GO5A 3NELA 4NXML 5LMNQ 1BBWA 1K83H 1SLJA 4Y7NH 1K3RA 2D62A 5E7NA 3S17H 4LFCL 2ZJQA 4BA2I 5IYBH 4YCVA 1CKNA 3J80c 4DV2L 1JJCB 3GTGH 3RR5A 2ZM6Q 1D7QA 3STBD 4DV4Q 3PV0A 1VQKA 4GN4B 4B3RL 4R1JA 3KFUA 1MJEA 4POGA 1OXUA 4GOPC 3I4NH 3E0EA 3M7NA 3KOJA 1Q8KA 4P72A 3W1BA 1E24A 4DR7L 1VQEA 1WJJA 1RL2A 3OW2A 1VQ6A 4UP9A 1NE3A 1Q81C 3A5ZB 1E7ZA 1GVPA 2H5XA 3HKZG 4A3GH 1NY4A 3W1GA 2UXCL 4IPGA 4L5RC 3FKIG 1XMQQ 2N49A 5M3FH 4DNIA 1N9WA 2HQLA 5GAHC 3KJPA 2VUMH 3A5UA 1HNXQ 5IP9H 1W3SA 2ZTEA 1HZAA 1JJGA 1LYLA 3OYYA 1GD7A 4JI6L 3HOZG 2CQOA 3CMAA 4DR6Q 3I7FA 2BH2A 3KJOA 3F2CA 1XNQL 3RLOA 4C3JH 3DM3A 1XMOQ 2DGYA 1IYJB 5C4JH 1XTDA 3BU2A 4LF7L 3AYHB 1IBLQ 2IX1A 1HJPA 4FDBA 4DV3Q 2XGTA 4IOCA 1KC8C 3J81j 2OTLA 4B3MQ 1L2FA 1KXLA 4JI8Q 2B63G 1SRUA 3RNUA 4PG3A 4LF4L 3H3VI 3F1ZA 2N3SA 4K0KQ 2YTYA 1EWIA 3RLNA 5IYBG 1AE2A 4A75A 2GN5A 5DLQE 2I5LX 2D0OA 4DV6L 1PYBA 1PH7A 5IYDH 4A3BH 2ID0A 5GROA 3I4NG 3M4PA 3RZDH 5FLMH 2YV5A 4OWWB 4GS3A 5FLXc 4JV5L 1VQBA 1KRTA 1S72A 4LF9Q 3PUZA 4X66L 4A3KH 1GKHA 2B3GA 4DR2Q 2K75A 4BY1H 2UXBQ 1KQSA 4A3GG 3CF5A 4JI1L 3PO2H 4JOIA 1XNRQ 4A93H 5K36G 2AHOB 3I2ZA 5M3FG 4OONA 4BBRH 2VUMG 3HOUH 2CWAA 3K81C 5IP9G 1M1KC 1N8RC 5C4XH 3CC4A 4JCVE 1YBYA 3L7ZC 4HJ9A 4HIOA 1VQ9A 2VQEQ 1PH3A 1MKHA 4QIWE 2NZOA 1C9OA 3ULLA 1WYDA 2N78A 1QUQB 3I56A 1YJNA 1N33Q 2BH8A 2LSSA 4GKJL 4DV0Q 1N36L 2OCEA 3UE1A 1B8AA 2R7FA 4DV5Q 1PH6A 1AH9A 2MO1A 3PCOB 1K8AC 1Z9FA 2E5LQ 4DV1Q 1UE1A 1I3QH 1CKNB 4A3DG 4A3FH 3I4MH 1HZ9A 2OQKA 1YI2A 1XPOA 3S1MH 2NVYH 4RG1A 5GAGC 1I94Q 4BBSH 2OQ0A 4LUZA 1N32L 1VQIA 3AEVA 1I5FA 3F8TA 2LXKA 3JAMi 2Q2IA 2IX0A 5IYDG 1PH8A 1WCMH 1PH9A 4A3BG 4DUZL 2VS1A 2IHFA 1YHBA 3ULJA 2R93H 4P73A 4KHPQ 3HOWG 3A0JA 1H95A 5FLMG 1HNWL 2UUCQ 2RF4A 4GKKQ 2Z6KC 4HJ5A 5IE8A 1Q12A 5C3EH 3GTOH 3EIVA 5LMNL 4DUYL 4HIDA 5IP7G 4BY1G 4PZ6A 3ZJYC 2EIFA 1KAWA 4IJHA 1HNZQ 4YY3Q 2KHJA 4B3TL 1EUJA 1SROA 2UUAQ 4A93G 4R4OA 1BKBA 2GVBA 3E9IA 4J15A 3Q8DA 3OTOQ 1VQGA 1K9MC 4BBRG 1TWGH 2PI2A 2Y0SG 1WOCA 4POFA 3HOUG 4DAMA 2KHIA 4JYAQ 3F2DA 4R4IA 4NPSA 5C4XG 1X3EA 4LF6Q 3NBHB 4LF8L 4O0AA 1TWFH 1YZ6A 5IT9c 4X6AH 1V43A 3TREA 1X55A 3G4SA 1U5KA 4IPCA 1YVCA 1X54A 4LWCA 2WFWA 1XMQL 1M90C 2Y0SE 2VQFQ 3KYHC 4A3FG 2K5HA 3I4MG 2A19A 4JI7Q 5LMUQ 4LFAL 4BBSG 2MQHA 3CD6A 3HOVH 4KHZA 4GNXB 1L1OB 3PGZA 3PIOA 4LF5L 1FJGQ 4L5TA 4APVA 4X65Q 4GN5A 1VQPA 4DR4L 3TS0A 4YCWA 3CPWA 4BXXH 1BBUA 3B6YA 1WCMG 4XIGS 5BR8Q 1NMGA 1NJIC 2F4VQ 2JA6H 2R93G 3ULPA 1K0RA 3T1YQ 5IY0A 4DR3Q 4DV3L 1QZGA 4X64Q 1HR0L 3HFZB 2HHHL 2UUBQ 2B29A 1A62A 3ICEA 1Q46A 5C3EG 1OXSC 3J7ZC 1N34L 3U50C 3UE0A 3L0OA 4KI0A 3GTLH 2Q2UA 4OX9Q 4MTNA 1PH4A 1IBKQ 2BA1A 4GLXA 1PH2A 4O2DA 4JI5L 4YHHQ 4JI0Q 4LNQA 3T1HQ 2UU9Q 3M85A 2IY5B 4LUVA 4JI2L 3HKZE 3H15A 3F2BA 2R92H 1X56A 4LF9L 3TRZA 2LXJA 2MFIA 4C2MH 4DR1L 2K5NA 4DV7Q 5M3MG 2NZHA 4B3SQ 2UXBL 2ZJRA 4NXMQ 3PO2G 1J5EL 2AKWB 3K80C 3BJUA 3U4ZA 2A1AA 1NBWA 3G6EA 4A3MH 5IWAL 1YEZA 4DV2Q 4YWKA 1PVOA 2JA7H 3S1RH 1JMCA 3KLWA 4A3CH 1OXXK 2KENA 2NN6I 3MEFA 4DK3C 4B3RQ 2VNUD 3ERSX 2VQEL 4AQYL 4X62L 1KRSA 3AFPA 4GNXA 1Q82C 1K8GA 4BY7H 1L1OA 3IRBA 1LUZA 4TVAB 3PIPA 1EQQA 2JA8H 2QEXA 1A0IA 4JBKA 4JI4L 5AJ3L
chains in the Genus database with same CATH superfamily
1LO5D 4OO1H 2PW7A 1M4VA 1A3VA 2LKVA 1ASYA 2VZAA 1UEAB 2WAQB 5JVH3 3NPPA 1BCPF 4L5SA 2CH4A 3GQBA 4I7ZC 1NNXA 4NB3A 1O7LA 3N52A 4FXDA 3IFTA 2KVMA 4LK1C 5CV5A 2JE6I 2AUJD 3V05A 2GA4B 1WI5A 4GN3B 1VQ5A 2VY3A 2R7DA 5ELEA 5E1FA 4A3MG 1SXTA 4KY5A 1JB3A 1H9SB 3GTMB 2XIWA 4BY7G 3KF6B 4RKLA 2DY7A 3M4OH 2HIVA 4HR7B 3O13A 2R7ZH 3J7AV 4LFBL 1GHJA 3R2IA 4P74A 1T9HA 4X66Q 2KECA 1KLGD 4RFBA 1PXUA 4ME5A 4JI1Q 2JQOA 4NP5A 1CUKA 4ABNA 4UAIA 4DPGA 2CCZA 5C3WA 5IIFA 5IOCA 2QILA 2ZTCA 1CA6A 4MIUA 2F3IA 3KLRA 5J1ZA 4FF2A 2BA0A 1IYVA 2TSSA 3IAYA 2XTIA 2JEBI 5C0XH 2HIXA 3GTMH 3S1NB 2EY2A 3CKIB 2NYZD 1STGA 1J9OA 1EY5A 4QL5A 3VR6A 1ZKOA 4WJ3M 1X65A 3NTIA 2RKSA 4O42A 5EQ0A 2HDMA 2K1BA 4IN3A 4DR6L 4OO1I 1SMXA 3A8IE 1YITA 4K14A 4C2MB 3MFGA 1XMOL 1D1KA 4HIMA 4DUZQ 1S3OA 3NE5B 5JPMC 3H3VC 2Z4IA 3CQZB 5T1GA 4DV7L 1F9QA 2NN6G 4A4IA 5EKLA 2OF1A 3EA6A 4JI8L 3CCLA 1RJTA 4XT1B 4CJ0B 3J7A5 3S1NH 4K0KL 2F3VA 3DMUA 3J80i 2FMMA 2F52A 1DZ1A 2NUCA 2PI2E 2ZXRA 4IFDH 2I5MX 2KQ3A 1BVSA 1SYCA 2F0OA 1JJ2A 5C0XJ 5FO9B 4DXGA 3N6RA 4I65A 4A76A 4OELB 1RHPA 1E2WA 1AE3A 1SDFA 4QY7A 1VQHA 3CQZH 4LFCQ 4OEMB 1NR2A 4IALA 1MSHA 2Z4HA 2EY1A 3HOVG 3TP7A 4DR4Q 3H0GG 4DV0L 1XPUA 1SNMA 5FOBB 2G9HD 1B9MA 3KK7A 3BZKA 4DV1L 5J3BA 3K7UC 3UDIA 3J81E 4H02A 4DR5L 1TS5A 1UE5A 3OW7A 1VQCA 4G57A 1I94L 2GVAA 4IFDJ 3QWNA 4TQUS 5C0XI 4A3JB 4KD3A 3S24A 1VCIA 4R4TA 4UPAA 1H9MA 1S40A 1KLUD 2L5TA 5ELNA 4AIMA 3NWSA 1TWHH 5E3FA 1B4OA 1YJWA 3GTQB 4GKKL 2DUDA 5IT9L 4QJFA 4GNXC 3T13A 4OWTB 1ILQA 4LMQD 3PUVA 4JBMA 5IODA 2UUAL 1OXTA 2O5IC 1JCKB 3OTOL 4PZ7A 1VMCA 1BQQT 3BVZA 2E74C 2F0FA 2D9UA 3D31A 3PUYA 1YJ9A 1O7ZA 2NB0A 1ESFA 2K5VA 3QJYA 5T1IA 1PZJD 2JN4A 3ZYYX 1GM5A 4AYBG 4IFDI 3S15H 3DUZA 1VQ8A 1IL2A 2K05A 1ESRA 2F0GA 2UXDL 4JI7L 2K52A 5LL6X 2IX3A 3T4AC 2YU9B 1Q1EA 3H3VH 1Z6HA 1FGBD 1I50B 2WP8J 4C3IH 3A8KE 2UUBL 4X64L 2E2IB 2B2YA 4WJ4A 3CW2C 1IXRA 3K0YA 1WTRA 1CT1D 2EY6A 3CP0A 4DKAC 1IBMQ 1NSNS 3UI2A 1BR9A 1C48A 4LW1A 4OX9L 2A6HC 1FL0A 1MHWC 1GOZA 1WTQA 1B70B 3T1HL 2UU9L 3CC2A 5J39A 2N8NA 2CQAA 2RBMA 3CPFA 4KY7A 1BXTA 2YU9H 1NCVA 5I9OA 3GTKB 1C0AA 4QGUA 2VUMB 1G6PA 2F0EA 4F88A 2Z6BA 3PIO3 2ZJQA 5M5XB 2ZM6Q 1B3QA 4DV4Q 2KUMA 5D3DA 3KFUA 1MJEA 1QWYA 3TDQA 4POGA 2H4OA 5TSSA 3E0EA 2WINB 1BOSA 3W3AA 1B3AA 1VQEA 4A3DB 1RL2A 1Q81C 1NE3A 5EGTA 1GVPA 4R8NA 3HKZG 2BE5C 1XMQQ 2RCFA 5M3FH 4DNIA 3NUCA 2VUMH 4C3HG 1HNXQ 1IW7C 1HZAA 1T5EA 1JWMD 1JJGA 3OYYA 1EEID 1GD7A 3HOZG 3CMAA 1HXYD 4N9TA 3RLOA 2PYKA 2KJXA 1VMPA 4LF7L 3DXJC 4R9WA 3VA5A 3OIPA 4IOCA 1Y1WB 3J81j 1LACA 4B3MQ 1L2FA 4CDDC 3SR1A 1F2YA 2B63G 3H3VI 3F1ZA 1SE2A 4DF7A 2B2TC 1EWIA 3RLNA 1AE2A 1GUTA 5DLQE 4U68A 3TP8A 2RA4A 2F03A 5IYDH 3VR2A 1WD0A 1Q3LA 1AZQA 4A3BH 2ID0A 5GROA 1R4PB 3M4PA 4GS3A 5FLXc 2EJGC 3BYYB 1ENCA 4DR2Q 3S1MB 4P2CB 3DWPA 3A7AB 3EQLC 4PQXA 4WRDA 3I2ZA 4IUTA 2A69D 2M2LA 3RUZA 2CWAA 5CMDA 2FMCA 3CC4A 1N8RC 2R93B 2VQEQ 1PH3A 4KD4A 2LSSA 1CK1A 2BDOA 5DM63 3FKIB 2P5ZX 1EU3A 1N36L 3D4RA 4ILWA 2R7FA 1PH6A 2KA7A 3BG3A 1CKNB 1LTSD 4A3FH 2OQKA 2B2UA 4IZ8A 1OO9B 3WDNA 3S1MH 2OQ0A 3IFDA 3AEVA 2KHSA 3JAMi 1MGSA 2CHBD 1TIID 1O80A 4ZUJA 2R93H 4KHPQ 3HOWG 2F0KA 1PMRA 1EU4A 4KKSA 3EIVA 1EY6A 3V2TA 4BY1G 4PZ6A 2PZUA 2EIFA 4RWSC 4YY3Q 2KHJA 1WTVA 3K5MA 3E9IA 5JJZA 3I4NB 2K04A 1VQGA 4POFA 3HOUG 5C4XG 3G7LA 4LF6Q 3TP5A 1PTOB 1YZ6A 4DNRB 3TREA 1X55A 3K5LA 1X54A 2WFWA 5J22A 2VQFQ 3H91A 3I4MG 3TZDA 4G7ZC 4C3JB 3HOVH 1E0BA 2ZXPA 2WV6D 4J1MA 2R92B 1FJGQ 4X65Q 1VQPA 1H9SA 2O5JC 4BXXH 3B6YA 4XIGS 2NWGA 1SNCA 3P7JA 2F4VQ 4NMZA 3ULPA 2HHHL 4DV3L 1X3QA 5COYA 2B29A 1A62A 1HRJA 3U50C 3GTLH 2QDLA 1CQVA 1PZID 2Q2UA 3TZUA 1LLRD 1IBKQ 5BN3A 3BVGA 4IUPA 2IY5B 4JI2L 3HKZE 4HCSA 2R92H 4HCEA 2H1EA 1EYAA 2LXJA 4DR1L 5M3MG 4B3SQ 2UXBL 5KYIA 4BBRB 2ZJRA 2JSOA 3NWTA 3BJUA 3U4ZA 3J7YW 1NBWA 1PVOA 1JMCA 3KLWA 1I4PA 2NN6I 2KENA 3MEFA 4B3RQ 2VNUD 4PMBA 4AQYL 2K28A 3R8BA 3AFPA 1K8GA 1SMYC 5ISRA 1L1OA 1LUZA 1XWEA 1A0IA 5AJ3L 5A2QL 2MO0A 1BCPB 3G6JB 4NW2A 1HA6A 3I8ZA 4MN3A 4DN4M 4HMIA 3TQYA 3CCJA 2HT1A 1LM0A 1VDZA 3CXCA 1BUVT 1JE5A 1HCZA 2VXWA 4HTHA 4OXPA 5EJWA 1U4PA 3GV3A 2A73B 2E8GA 1ET9A 3GTOB 2M00A 1B9NA 2D5DA 2V1CC 3BZCA 3LGJA 1I4GA 1HH2P 1O7IA 1KHIA 1RDPD 2BE5D 3V96A 4GOPB 3GTJH 1X3FA 2EQSA 1IW7D 2HCCA 4IJLA 2Z0SA 2M9VA 2I0QA 2CKZB 2EYOA 4DV6Q 2WB1B 3STBC 1I4HA 3HOXB 2Z6KA 4EQ5A 1YNNC 5I6WA 4OWXB 2OXPA 5JEAG 3J81i 4JV5Q 3CCRA 4ZLTF 4MZ9A 4A3KG 3JC66 2JK8A 1LTAD 4DFAA 1CI3M 2PMZE 3Q22A 3OOCA 1KIXA 5LMUL 4RCOA 3ND9A 1P16A 1Y1VG 2LY7A 3E3XA 4A3EG 3SGIA 1YNJD 2AMCB 3M4QA 1U9RA 1X3PA 4GKJQ 3HOXH 2QW7A 3D0FA 3PUXA 2EYJA 4A3LG 3U9SA 3M3YB 4HJAA 1PRTC 4C3HH 1UE7A 4IUQA 3BZDB 5JOBA 1C8CA 3TS2A 4YHHL 1FNWA 3A74A 4A3JG 3WOFA 1T5XD 2K14A 2D2CC 1KD1C 2DY8A 2RHSB 1RTNA 5FLXL 1K3BC 1HPCA 2B63H 1DGSA 4XQNA 4DUYQ 2VB3X 3DLLA 4C1NI 4B3TQ 3C46A 5CV6A 2JA5H 2WAQE 4PV1C 2JA8B 1CHPD 4QF4A 3M3YH 1GHKA 1HFGA 5IYCG 3S2DH 4JPBW 4LUOA 1F2MA 4A3IG 3NENA 4LF8Q 1UUPA 2Q8RE 1STHA 3TEHB 4WJWA 2LMCB 2PW5A 4ZYSA 2A8VA 2X6LA 3NTKA 4GLAC 2EE1A 2Z1CA 3Q23A 1TS4A 4GLVB 1K73C 1MBYA 1E1OA 2VB2X 5IGBA 3VR4A 1X3GA 2BCOA 4IUUA 3OHXC 4LFAQ 2EY5A 1G8ZD 1HTPA 1QVGA 1EIGA 1N33L 4LF5Q 3NBIA 3DWAA 1KDCA 3JAME 4H13C 2JA6G 4DR7Q 3TBIB 4DV5L 1EIFA 4L8JA 3VA7A 1GJXA 2G5DA 3EBEA 1HA5A 1H9RA 2L55A 5IGGA 4R4QA 1YIJA 3CU7A 3X3NA 5GADC 1TY2A 3HOYG 1VQNA 1KL9A 3MTSA 1CA5A 4JI5Q 3M4OB 2R7ZB 3KDFB 1Q1BA 2JEAI 3R2TA 2JA9A 3HOWH 3NQTA 4X3SA 1CSPA 2CVRA 1L0WA 2UUCL 2IWHA 5I6YA 1L1OC 1IYUA 1G2SA 1J5EQ 1SR3A 1HNZL 1CQFA 1PH1A 5NUCA 4JBWA 2KCMA 4TSSA 4A3CG 4L5QA 3AFQA 4X62Q 1KNEA 1TWCB 1CSQA 3A54A 1SYEA 4P71A 2HQEA 4XTCS 1WFQA 1U4MA 2B2VC 3S1QH 1SYGA 4FF3A 2TMPA 2CFMA 3BS1A 1RTOA 2VL6A 3HZXA 3CMEA 1PA6A 2RDHA 4K5XA 4KMUC 1PYWD 1QG7A 2ES2A 2E2DC 4XYOA 1IZ6A 1HFNA 2EXDA 1G291 1O78A 3GDEA 1VQ7A 4O1NA 1X6OA 5BR8L 1EL0A 3NEMA 3T1YL 1K83B 4L6TB 5HURA 3L2PA 5C3XA 1TWCH 4JBJA 2IHEA 1BF4A 4IQZA 1TY0A 4B08A 1Y1WG 2RCNA 1H9KA 5G3LD 3C1EA 2EZVA 1SE8A 1ASZA 2IT1A 3PO3G 4JI0L 5FJ8G 5JJIA 5C44G 1JICA 2LFNA 5HGTA 1PH5A 4LFBQ 5M3MH 2K03A 1VQAA 4NXML 1K83H 1K3RA 2D62A 4LFCL 4BA2I 2RVLA 4YCVA 1CKNA 4DV2L 1JJCB 3RR5A 1E2VA 1D7QA 3STBD 1VQKA 1SNOA 4R1JA 5G3LF 1HQMC 1YNND 4GZYC 1SJHD 1RKNA 1PLFA 5IGCA 5EBCA 1VQ6A 5ELCA 2F1MA 1L0YB 1EY9A 3W1GA 2UXCL 3FKIG 3NTHA 3KUPA 2HQLA 3LNNA 3A5UA 5JVG3 1QJOA 2F0PA 1TWHB 4JI6L 3T53B 2SNMA 4DR6Q 3I7FA 3DM3A 3F2UA 3Q0AA 1XMOQ 2DGYA 1IYJB 1XTDA 1JQYD 2BDNA 3H94A 3KBXA 1HJPA 2OTLA 2DJGC 2Y0SB 4JI8Q 3I4LA 3RNUA 4PG3A 4K0KQ 1JC7A 2YTYA 5IYBG 3P1HA 5C4ZA 2MPMA 2I5LX 3EJIA 3FPPA 2NTTA 3I4NG 3S15B 4Z9CB 4G7OC 2YV5A 1VQBA 1O7YA 2DN8A 3D6WA 4JK1C 5EKIA 3E0JA 3PUZA 4OIKA 4A3KH 2B3GA 4BBSB 4XDXA 4A3GG 3SDZA 2F0UA 4JOIA 5K36G 1DYQA 2WKCA 4OONA 1K8MA 1M1KC 5IP9G 1JOOA 4C3IB 1YBYA 3FEWX 2XRSD 2NZOA 4KHVA 2N78A 1YJNA 3I56A 1CFMA 4C3JG 4DV0Q 4OL7A 2OCEA 1B8AA 4BWGB 4DV1Q 1UE1A 1I3QH 3DEOA 1HZ9A 3K58A 1YI2A 1XPOA 5M9OA 4RG1A 1I94Q 4BBSH 1WTOA 4ZQ3A 1N32L 1IHZA 1VQIA 4CDCC 3CHBD 4HMJA 1AW7A 4RGTA 2IW3A 3MFYA 2VS1A 4P73A 3A0JA 4R8IA 5FLMG 1HNWL 1XTCD 4GKKQ 1DD2A 1U4LA 4HJ5A 5IE8A 4HIDA 2B8FA 3ZJYC 4DAVA 4IJHA 2FHTA 1EUJA 1SROA 5D65A 2UUAQ 3P20A 4A93G 1BKBA 1K9MC 4J15A 3OTOQ 1TS2A 2EYFA 3Q8DA 4BBRG 1TWGH 1D1IA 2EYLA 5KNCA 2RQXA 4DAMA 4R4IA 4NPSA 4CBVA 1GUSA 1NUCA 1SJED 4MTKA 3AU7A 3Q24A 3A8JE 5M3FB 1U5KA 4DK1A 4CKEA 1KNAA 4RGNA 1XMQL 4RGMA 4ZKCB 2I07B 4JI7Q 2MQHA 4FVMA 4KHZA 1I4XA 4GNXB 1TR5A 2J4XA 3PGZA 4J6HA 3TS0A 4U673 1BBUA 5IGFA 1WCMG 4C1NK 1NJIC 1NMGA 2JA6H 1CM9A 1K0RA 3NSWA 4QMGA 1SBBB 2NTSA 5IY0A 4X64Q 1HR0L 3HFZB 2UUBQ 3ICEA 4A3MB 3QOJA 1DONA 5C3EG 1N34L 1Y8PB 1ZEQX 1TT2A 4KI0A 3RMHA 1LTGD 4A3BB 1A3UA 3A7LA 3TP6A 4OX9Q 3E5SA 4O2DA 1B44D 3T1HQ 2UU9Q 4EQNA 3EROA 3NBHA 3H15A 3F2BA 1LT3D 4RKBA 2MFIA 5M5WB 3S9WA 5DNFA 3DWQA 4JW0A 4RH6A 1WTHA 2AKWB 2A1AA 2X69A 5FO7B 3G6EA 4A3MH 5IWAL 3S1RH 4A3CH 4DK3C 2VQEL 1EWHA 2L4NA 1QB5D 1Q82C 1CHQD 4BY7H 3SEBA 4TVAB 1EQQA 1DJRD 4JI4L 1EYCA 3FDTA 4A3FB 2Q2HA 2MNAA 4QB4A 3E6ZX 4OGQC 5CBAE 1HUNA 2N55A 5M5WH 1B2TA 4H0LC 2R61A 1Z7TA 1E22A 4L63B 1XX8A 2A6EC 1G2TA 1KDBA 3OMCA 2ASBA 2JXMB 3CCSA 4RGOS 4KHPL 2ATWA 1R9TH 1Q8IA 4JI3L 2AQ1B 4LF7Q 2DNEA 2JYOA 5ELOA 2RDFA 4E6IA 1JORA 1EFWA 1EQRA 3C2PA 5IT9E 4M8AA 3M9BA 1LTRD 4YY3L 3FP9A 3U58A 4PNYA 4Q0FA 1MJCA 2L0CA 3K7AB 2JA7G 2C9OA 1Q7YC 4FF4A 1K0SA 1QNUA 4K6LA 5GQOA 5FJ8H 5C44H 1D8LA 3I73A 1EZ6A 4XT3B 2B8GA 3PSIA 3P75A 1VQLA 2JA8G 3SK8A 4DAYB 1S5BD 2NN6H 1V1PB 4K6DA 4OO1G 3FMCA 1LTTD 1VF5C 2RHQB 3I4OA 4EVOA 3HOVB 2WIIB 4H7BA 3UDXA 4UDUC 3PO2G 3MEHA 5GAEC 3H0GB 1PHJA 2X6GA 2ALYB 3MXUA 1V1QA 3H6MA 3R93A 4X65L 3K7AH 4YWLA 3KDFA 4ODGA 2QKIC 4IO9A 3OWFA 1KABA 5I9PA 3GTLB 1TS3A 1FGUA 3PUWA 4HJ7A 3CCEA 2PPBC 3D6CA 2B2YC 2IL8A 2NVTH 5C4HA 1RF2D 4NKLA 1VQMA 4R4CA 3BDCA 3H0GH 2WAQG 2R3ZA 2PO4A 1HZCA 4HJ8A 1IBLL 3KF6A 1NTGA 3T51B 3KLSA 4HSVA 4NXNQ 4IPDA 3HGBA 1VQFA 5D14A 2KCTA 3AQQA 1X9NA 3RN2A 1Y8NB 5C5MA 2ZTDA 2CW0C 1SSOA 1ZYRC 3S2HH 4V190 3BDLA 1LTBD 3C3LA 4K2LA 5C0XG 2L15A 2PQAB 1WTPA 1LTLA 1HZBA 2CWPA 3K0XA 5I2YA 3ONAB 2VW9A 5JPNC 1IKLA 1UAPA 2K01A 1Y8OB 3DEPA 3G71A 2A6HD 3CCMA 2F0QA 1XNRL 3CCVA 3I70A 3OMGA 4KJOA 2FFKB 5LHY1 1SFOH 1S5FD 5EKKA 3W5OA 3PF4A 1EIYB 2WB1E 2C35B 1F77A 1P8LA 1W2BA 3RN5A 4QCLA 3GTJB 2HHHQ 2K4KA 1ONLA 2E5LL 4CDEC 1MIUA 4IURA 4LJZC 5ELBA 1A3TA 2ZJPA 1I6HH 1EOVA 5EPJA 2E2JH 5LMNW 1EY0A 3ITPA 4IFDG 1TWAH 1FVIA 3MXNB 2NVQH 1I6VC 1KAAA 1XNQQ 2EJMA 1Y14B 2C5CA 4JI2Q 4YIJA 1V9PA 5JJKA 4DR1Q 1EOTA 1OTCA 2YYZA 5JJLA 2K50A 3VYSA 2E2HH 4LF4Q 3BDOA 1SAPA 1B50A 1A8VA 5I4DA 1VQOA 4DK6C 1II3A 4JYAL 2I46A 1CKOA 5CR3A 3EFXD 3T16A 4AQYQ 1G91A 4KTAA 5AFWA 5D3IB 1GUNA 5C6AA 2JJQA 2L12A 2RSOA 4FO2A 5AJ3Q 3CCUA 3UDFA 1A63A 2D0PA 1FYCA 4C3HB 4YCUA 1KDAA 4C56C 1ICFB 3HOZB 1YHAA 1MD2D 5E4WC 3HG9A 2F0JA 1XJVA 2NZ1D 4NDXA 2B2UC 1VS0A 2I5HA 5CGKA 2B63B 4YWMA 1EQTA 1QNKA 4IOAA 4DR3L 3FRPB 1D5ZC 2Q2TA 1E1TA 1VQJA 2IPKD 2JA5B 1DCZA 5CC4A 5H1SE 4J8QA 1V1OA 3RLFA 4HEDA 1ENFA 3S2DB 4ZAIA 2NVXH 3GV6A 3HOZH 1JWSD 1CKMA 1IL8A 2QDBA 3K6OA 3K8AA 1D2BA 1PYSB 2OWOA 1WVLA 3QR8A 4S3SA 2AQ2B 5LMNQ 3S17H 4Y7NH 1QOHA 1SE4A 3GTGH 3J80c 3PV0A 4GN4B 1BNZA 1GXDC 4P72A 4X3KA 3W1BA 4DR7L 1WJJA 3NK9A 3OW2A 1I4QA 2G9DA 3SE0A 5DAUA 1E7ZA 2H5XA 4KJNA 1NY4A 3CRLC 1RODA 4FP5D 2N49A 1STBA 1TQOA 1N9WA 3KJPA 1W3SA 2ZTEA 2A68C 3HOWB 2ZT9C 1C4QA 2BH2A 4X3UA 4K8JA 3KJOA 3F2CA 4BY1B 1SYFA 2F0NA 3AYHB 2IX1A 4FDBA 4XXEA 1KC8C 3Q6SA 3U9OA 1F2LA 1KXLA 5CBEE 3HOUB 5C4XB 1A6XA 1BO0A 1AN8A 2J0TD 4DNTB 3MVVA 4CDFC 5IGEA 1SNDA 1PYBA 1PH7A 5KNBA 1JR0D 3S1QB 1PRTB 4RHSA 3RZDH 3NXWA 4OWWB 2QEJC 5I2XA 1KRTA 3I4MB 4LF9Q 4X66L 2DNCA 5A2QE 4LAAA 4BY1H 1KQSA 4BS9A 3CF5A 4CJ2C 3QIAA 4JI1L 3L9AX 3PO2H 3D3RA 4ZKBB 5M3FG 2VUMG 3HOUH 2CW0D 5C4XH 4JCVE 1ZYRD 4HIOA 2V4DA 4QIWE 5FO8B 1C9OA 3ULLA 1WTWA 1N33Q 1QUQB 3SHLA 2Q8TA 3M7GA 1STNA 3MXPA 5F2DA 2F3WA 3UE1A 4CGYB 4DV5Q 2MO1A 3PCOB 1K8AC 2LS01 3IL8A 1IKMA 2SOBA 4A3DG 2PCFB 5L37A 3I4MH 3OWEB 1FNVA 1PFMA 5GAGC 3D4DA 2B2WA 3SVMA 1SMYD 1I5FA 3F8TA 5IYDG 3OPOA 5M3MB 4K8IA 1PH9A 4A3BG 1G6ZA 4DUZL 2IHFA 1YHBA 3ULJA 1V8QA 4WFN3 3K59A 5BN4A 2UUCQ 2Z6KC 1Q12A 1BDOA 5IP7G 1DM0B 1GUOA 2HUGA 1KAWA 1HNZQ 3A56A 3MAQA 1CTMA 4R4OA 2GVBA 5ELFA 2MGSA 1A2TA 1J8IA 1WOCA 4QIWB 2XWBB 2KHIA 3F2DA 4EQOA 3WOEA 3D8GA 5FKAC 3OSOA 1S5ED 1EQVA 3HP3A 4EQPA 3MHBA 1V43A 3G4SA 2OEOA 1YVCA 3NQIA 4IPCA 2K32A 4LWCA 4DXFA 1M90C 2Y0SE 4A3FG 2K5HA 4KY6A 2A19A 3CD6A 1L1OB 3PIOA 4L5TA 4APVA 4GN5A 2XVSA 4DR4L 3CPWA 4F7XA 5BR8Q 5CV9A 2R93G 5BN5A 1LABA 2XN9C 3T1YQ 1QZGA 1SYBA 1K28A 4TRDA 4DAYA 1V1PA 3J7ZC 5FLXE 5JAVA 3I3CA 3UE0A 4WORA 2J7ZA 2K7VA 2BA1A 2A69C 4JI0Q 4LNQA 2ENBA 3M85A 4FYDA 2K5DA 4LUVA 4A3KB 2MUYA 2N88A 1X56A 2B2TA 3TRZA 1CZGA 2MJ8A 4C2MH 2ZXOA 4DV7Q 2NZHA 1PRTD 4NXMQ 1Y1VB 3K80C 1ET6A 4A3EB 4DV2Q 2Q8IB 2E76C 4DK0A 2K5WA 3PIPA 4RAUC 4JBKA 4BXXG 5JEAH 1EFID 1F9RA 1GUGA 1I3QB 2JP1A 1X32A 5KIXA 1EY8A 2XRQD 1JWUD 2KCNA 1PRTF 2UXCQ 1OXVA 3U4VA 2XWJB 3VR5A 3SK5A 1VQDA 1Y1VH 1YHQA 4A3EH 4JI6Q 1GO3E 4JC0A 1A2UA 4B9XA 3H09A 3LX0A 5DM73 2L1BA 2A5HA 2R92G 4QQBX 3R3OA 4EX5A 5M5YB 4A3LH 1QE6A 2PQAA 2AUKA 2K33A 1Y69U 1TWGB 1AP0A 4DR5Q 2AWOA 3QG1A 1IBML 5CORA 2A68D 4UP8A 3J80L 4ZK9B 4A3IB 5CV4A 4OIJA 3JAMc 1AEXA 2O4XA 1UEBA 1Z47A 4A3JH 1JOKA 3AMUA 5JEAJ 3I90A 1UE6A 1NR4A 1PV4A 4KN4C 3I55A 4ZRZA 1SN8A 5HGQA 1C7YA 2KEEA 3ER0A 1FD7D 1K8OA 3GTQH 1VF7A 1LTID 4KLKA 1HR0W 2ZM6L 3L3OC 1NMFA 5M5YH 4ID6A 4DV4L 4RA8A 3GTPB 3KF8B 1EYDA 4PZ8A 1RIPA 1B7YB 4HIKA 2JA6B 5C5LA 4F87A 5IYCH 1YNXA 2SEBD 1W6KA 3MC0B 4ALPA 4A3IH 3MXNA 2F0VA 4ME3A 4MNOA 2B2WC 2PZTA 3CCQA 3HOYB 1STEA 2L9HA 1WD1A 5EAYA 2HDLA 4GOPA 1HNXL 2UXDQ 1G51A 1FNUA 1JB7A 2F4IA 1N32Q 3DM1A 1EIHA 4QUCA 4P75A 3K57A 2KCCA 3GTPH 3RD4A 1PFSA 3EN2A 4QUFA 4DGZA 1XXGA 4CKBA 1RCVD 2FXQA 1HNWQ 4B3ML 1I50H 3S1RB 2L11A 1PZKD 3QB3A 2E2IH 1S4ZA 3HOYH 1PDQA 4BY7B 1JT8A 2RDGA 4KN7C 2K6AA 2Z9HA 1ILPA 2KBNA 3HKSA 1XPRA 2HD3A 5CV8A 3G48A 2K5QA 5EPLA 4K5WA 3S16B 3K5OA 2WB1G 3CAMA 3HOXG 4RCNA 4DR2L 3J7AF 1CZWA 3UDGA 2QGQA 4FXGC 3CC7A 3S14B 1S5DD 3GTKH 1LV9A 4AH6A 1EEFD 3BYTB 1R9TB 2EPBA 2ICEC 5M5XH 1DOMA 1TVXA 4UY8C 2YTVA 3C1FA 1B1ZA 1LT6D 1HR0Q 3MWYW 3S16H 4A3DH 3RZOB 1N34Q 3PO3B 2F0DA 1PTOC 1JE4A 4N9PA 2AWNA 3FHWA 5KYLA 1RD9D 5C44B 3PIP3 1L0XB 4OHJA 4BA1I 3S14H 2JA5G 3SXHA 1EZ8A 4CHTB 2OTJA 3ND8A 2EXZA 1HUMA 3FPUB 1LT5D 1YNJC 3W2DA 3K5NA 4M1UB 3URYA 1EYGA 5IP7H 4FXKC 1HTLD 4EGVA 1F9PA 1SYDA 3TN2A 1Y1WH 1J6QA 3TMEA 5EPKA 5IWAQ 1QVFA 3RZOH 3A55A 1SNQA 2QA4A 3PO3H 1W6JA 3TSSA 3VR3A 2PNRC 1F2ZA 1QZHA 4JOIC 4LF6L 5DEHA 3PMFA 2QF7A 1SE3A 5FK9C 3J81c 4JI4Q 4IUNA 3E9HA 4Y52H 1QVCA 4UP7A 4V0BA 4CKCA 2NVTB 2VQFL 4RMFA 2SNSA 1Q86C 2EYHA 3VDYA 4XQJA 3WWVA 4Q5VA 3M4YA 3J80E 3PF5A 1FJGL 2OT2A 3I72A 5HY6A 4XYQA 4IPHA 4JG2A 4AYBE 1DOLA 2F4VL 2PNHA 1TXYA 4JI3Q 1N36Q 4NXNL 3VYUA 2YTXA 3FKIH 2R6GA 1MSGA 1ZXTA 3MA2B 5K5PA 4MHEA 4PMWA 1U0LA 4IUVA 5KNDA 4X3TA 3D4WA 1BCPC 3I91A 1IBKL 3S2HB 3CRKC 5CYUA 1VQ4A 1E3PA 3GD7A 4A3GB 1QUQA 5EBDA 5IGDA 4I7AA 1UWVA 4TKOB 4B3SL 2R7ZG 3GP7A 2MHVA 3GO5A 3NELA 4JVZA 1BBWA 1SLJA 1SFOB 5E7NA 2QCPX 2KEDA 5IYBH 1TKWB 2O2LD 4K2KA 3BVMA 3HS0C 4B3RL 1LT4D 5C4JB 1OXUA 2F0MA 4AYBB 4GOPC 3I4NH 3M7NA 3KOJA 1B53A 4H44C 3T56B 1Q8KA 1E24A 1Q90A 2FJ2A 1AFPA 4DA2A 1PFBA 2EOTA 4UP9A 1QILA 1I6HB 1PTOH 3A5ZB 4A3GH 4F8MA 4XQQA 3FVQA 2E2JB 4IPGA 4L5RC 5K36H 1ENAA 2E75C 1TWAB 3QOLA 5GAHC 2NVQB 2KOLA 5IP9H 2FINB 2SDFA 1LYLA 2CQOA 1F9SA 3JAML 1XNQL 1SNPA 4C3JH 1D5XC 5C4JH 3BU2A 3DHQA 1IBLQ 2E2HB 4DV3Q 2XGTA 2F0IA 1NAPA 5KGUA 4A93B 4ZUIA 4PMCA 4CJ1B 1SRUA 4LF4L 2N3SA 2PZWA 4A75A 2DJFC 2GN5A 1ICWA 2D0OA 4DV6L 2NBFA 2XSCA 4KV6A 4HSPA 4N8X1 2F0HA 3HEJA 5FLMH 4JV5L 1A15A 1S5CD 3NP8A 1S72A 1GKHA 1PFNA 2NVYB 2K75A 4ZCKA 2UXBQ 3X3MA 3OIQA 3KLSX 1XNRQ 4A93H 2AHOB 4B9WA 2WKDA 4BBRH 1WCMB 3K81C 2B2VA 3L7ZC 4HJ9A 1VQ9A 1KTKA 1MKHA 3AB9A 2Z8LA 1WYDA 4FF1A 2BH8A 2A74C 3HKZB 5C3EB 1XYIA 4GKJL 4ULLA 1STYA 3LWUA 1AH9A 1HQRD 1D5MC 1Z9FA 3MZ5A 2E5LQ 2NVXB 2F0TA 3MXGA 3NHHA 2ICIA 2NVYH 2XNAC 4G4KA 2HCIA 3KBGA 3VYRA 4LUZA 3SK6A 1BBXC 1TWFB 2LXKA 2Q2IA 4UHVA 3SK4A 2IX0A 1R4QB 1PH8A 1WCMH 1ML0D 1QCBD 1STAA 3S17B 1H95A 4Y7NB 4KKUA 2RF4A 4HN7A 3GTGB 3GTOH 5C3EH 1PTOD 5LMNL 4DUYL 5LL6S 2MP1A 4B3TL 4KKTA 5KEEA 1FR3A 2A6ED 1AZPA 1EY7A 2WACA 2PI2A 2Y0SG 1SEBD 5A35A 3ERQA 4JYAQ 1X3EA 3NBHB 4LF8L 4O0AA 1TWFH 5IT9c 2B39A 4X6AH 2EJFC 2EYMA 1WTXA 3HRZC 2IJ0A 1UNSA 1PTOF 3KYHC 2F0WA 5LMUQ 4LFAL 4BBSG 1DXMA 4LF5L 4KK7A 3LWEA 5KRUA 1MI2A 2AQ3B 2EVBA 4YCWA 2EYPA 1DOKA 4C3IG 2EDGA 4DR3Q 1Q46A 4HAEA 1I4RA 2JA7B 1OXSC 1EY4A 1GUWA 3PQIA 1EWCA 2PMZB 3L0OA 1TU2B 5ELDA 1U4RA 4MTNA 5CV7A 1PH4A 4GLXA 3RZDB 3KF8A 4JI5L 1PH2A 4DU9A 1E2ZA 4YHHQ 1D6EC 2F0LA 1HHVA 4FNFA 4LF9L 2PQEA 3PO2B 3QO2A 3J81L 2K5NA 3IKJA 2RSNA 4RHRA 3EVQA 1J5EL 4N8FA 3VYTA 4K5VA 1BCPD 4G7HC 1M8AA 1YEZA 4YWKA 2JA7H 1JOQA 1OXXK 2BOSA 3ERSX 4X62L 1KRSA 5E4XA 2F0SA 4GNXA 1H9JA 4DAPA 3IRBA 2CH4W 2JA8H 2QEXA
chains in the Genus database with same CATH topology
2MO0A 2Q2HA 2MNAA 1ASYA 2VZAA 2UXCQ 1OXVA 5M5WH 3U4VA 3TQYA 3CCJA 2HT1A 1LM0A 3CXCA 1VQDA 1Y1VH 1JE5A 1E22A 1YHQA 4OXPA 4A3EH 4L5SA 4JI6Q 1GO3E 4JC0A 2ASBA 2E8GA 4NB3A 3CCSA 4KHPL 2ATWA 2V1CC 1R9TH 3BZCA 4JI3L 3LGJA 4LF7Q 2JE6I 5ELOA 1HH2P 2R92G 4QQBX 1EFWA 1O7IA 4EX5A 1EQRA 1KHIA 1WI5A 4A3LH 2PQAA 4GN3B 1VQ5A 4GOPB 3M9BA 3GTJH 1X3FA 2EQSA 2VY3A 4YY3L 2AWOA 3FP9A 4IJLA 4DR5Q 2R7DA 3U58A 1IBML 4UP8A 2Z0SA 4A3MG 1MJCA 2JA7G 2I0QA 2CKZB 1Q7YC 3JAMc 4DV6Q 5GQOA 5FJ8H 3STBC 5C44H 2Z6KA 1D8LA 1UEBA 4EQ5A 1Z47A 4A3JH 4BY7G 5JEAJ 3KF6B 1UE6A 3PSIA 1PV4A 1VQLA 4OWXB 2JA8G 3M4OH 2HIVA 4DAYB 5JEAG 3J81i 3I55A 2R7ZH 3CCRA 4JV5Q 4LFBL 4P74A 1T9HA 4X66Q 1SN8A 4MZ9A 5HGQA 4A3KG 1C7YA 4OO1G 3JC66 3ER0A 2RHQB 2JK8A 3I4OA 3GTQH 3UDXA 4JI1Q 4KLKA 2JQOA 2PMZE 1CUKA 1HR0W 4DPGA 2ZM6L 2CCZA 1NMFA 5M5YH 5GAEC 1KIXA 5LMUL 4DV4L 1PHJA 2ZTCA 2ALYB 3KF8B 4PZ8A 1RIPA 1B7YB 4HIKA 1V1QA 1P16A 1Y1VG 5IYCH 1YNXA 4X65L 4A3EG 2F3IA 3SGIA 2AMCB 3M4QA 4ALPA 3K7AH 4A3IH 2BA0A 3KDFA 4YWLA 4MNOA 4ME3A 2XTIA 2JEBI 4IO9A 4GKJQ 3HOXH 2HIXA 3CCQA 3GTMH 1FGUA 3PUWA 3D0FA 3PUXA 4A3LG 4QL5A 4HJAA 4WJ3M 1X65A 4HJ7A 5EAYA 4GOPA 4C3HH 3CCEA 1HNXL 1UE7A 2UXDQ 1G51A 1JB7A 2NVTH 1N32Q 3TS2A 4OO1I 4P75A 4DR6L 1SMXA 4YHHL 1VQMA 1YITA 3A74A 4R4CA 3H0GH 1G6PA 3GTPH 2WAQG 1HZCA 1XMOL 4HIMA 1PFSA 4A3JG 4DUZQ 1S3OA 3EN2A 4HJ8A 1IBLL 1KD1C 2K14A 3KF6A 1NTGA 2RHSB 2FXQA 1HNWQ 4DV7L 2NN6G 4B3ML 1I50H 4A4IA 2B63H 1DGSA 4JI8L 4NXNQ 3CCLA 4DUYQ 4IPDA 3J7A5 3DLLA 1VQFA 3HOYH 2E2IH 3S1NH 4K0KL 4B3TQ 3J80i 2KCTA 3AQQA 1X9NA 2F52A 2JA5H 2WAQE 3RN2A 2PI2E 1JT8A 2I5MX 3M3YH 2ZTDA 5IYCG 1BVSA 3S2DH 4LUOA 2KBNA 3HKSA 1XPRA 4A3IG 1JJ2A 3S2HH 3G48A 3NENA 5C0XJ 4LF8Q 3TEHB 2WB1G 5C0XG 2A8VA 4A76A 3CAMA 3HOXG 2L15A 2PQAB 4DR2L 1LTLA 1HZBA 2CWPA 1AE3A 3K0XA 4GLAC 3UDGA 1K73C 4GLVB 4QY7A 2VW9A 1VQHA 2QGQA 3CC7A 1E1OA 1XNRL 3CQZH 3GTKH 3G71A 3CCMA 4LFCQ 4AH6A 3CCVA 1X3GA 1SFOH 4LFAQ 5M5XH 3HOVG 3W5OA 3PF4A 1QVGA 1EIYB 1N33L 2WB1E 2C35B 1P8LA 4LF5Q 4UY8C 1W2BA 3H0GG 4DR4Q 4DV0L 1XPUA 3RN5A 2YTVA 2JA6G 4DR7Q 2HHHQ 4DV5L 1EIFA 1HR0Q 2K4KA 3BZKA 3EBEA 4DV1L 5J3BA 3K7UC 3UDIA 4R4QA 1YIJA 2E5LL 3S16H 1MIUA 1N34Q 4BXXG 4H02A 4DR5L 4A3DH 1UE5A 5GADC 1VQCA 2ZJPA 3HOYG 1I6HH 2AWNA 3FHWA 1I94L 1VQNA 2GVAA 1KL9A 4TQUS 5C0XI 4IFDJ 1EOVA 2E2JH 4BA1I 5LMNW 3S24A 3S14H 2JA5G 1VCIA 4IFDG 4R4TA 2OTJA 1TWAH 4UPAA 4JI5Q 1FVIA 1S40A 3MXNB 3KDFB 2NVQH 1Q1BA 2JEAI 4AIMA 5ELNA 1XNQQ 1Y14B 2JA9A 3HOWH 1CSPA 1TWHH 4JI2Q 1L0WA 1YJWA 2UUCL 1V9PA 2DUDA 4GKKL 1EYGA 5JJKA 4QJFA 4GNXC 4DR1Q 5IP7H 1OTCA 1L1OC 2YYZA 4OWTB 5JJLA 2K50A 3PUVA 1J5EQ 1SR3A 1HNZL 1Y1WH 2E2HH 4JBMA 1J6QA 1PH1A 2UUAL 4LF4Q 1OXTA 4JBWA 3OTOL 5IWAQ 4PZ7A 1QVFA 2KCMA 1A8VA 3RZOH 1VQOA 4DK6C 2QA4A 4A3CG 3PO3H 4L5QA 4JYAL 3AFQA 1CKOA 3D31A 1QZHA 4AQYQ 4JOIC 4X62Q 4LF6L 1CSQA 3PUYA 4P71A 1YJ9A 4XTCS 1WFQA 2JJQA 2K5VA 4JI4Q 5AJ3Q 3J81c 3UDFA 3CCUA 1A63A 1GM5A 2D0PA 3S1QH 4AYBG 4IFDI 3E9HA 3S15H 4Y52H 1QVCA 2CFMA 4YCUA 4UP7A 2VQFL 1VQ8A 2VL6A 1IL2A 1YHAA 4RMFA 2UXDL 3CMEA 1PA6A 1Q86C 4JI7L 2K52A 3VDYA 2ES2A 3WWVA 1IZ6A 2EXDA 3PF5A 5HY6A 1XJVA 1G291 1FJGL 3GDEA 1Q1EA 1VS0A 4IPHA 1VQ7A 2I5HA 3H3VH 4JG2A 1X6OA 4AYBE 5BR8L 2WP8J 2F4VL 4C3IH 4YWMA 4IOAA 3NEMA 2PNHA 3T1YL 4DR3L 1TXYA 2UUBL 4X64L 4JI3Q 3L2PA 1N36Q 1TWCH 4WJ4A 2Q2TA 1E1TA 1VQJA 3CW2C 4JBJA 4NXNL 2IHEA 1IXRA 2YTXA 3FKIH 2R6GA 5H1SE 3RLFA 3CP0A 4DKAC 1Y1WG 1IBMQ 2RCNA 4PMWA 1U0LA 4LW1A 4OX9L 2NVXH 1SE8A 1IBKL 1FL0A 1ASZA 3HOZH 2IT1A 1VQ4A 1E3PA 3PO3G 1B70B 3GD7A 1CKMA 3T1HL 2UU9L 4JI0L 5FJ8G 3CC2A 5JJIA 2N8NA 5C44G 3K8AA 1QUQA 1PH5A 3CPFA 1PYSB 2YU9H 2OWOA 4LFBQ 5M3MH 1UWVA 2R7ZG 4B3SL 1C0AA 4QGUA 1VQAA 3GO5A 3NELA 4NXML 5LMNQ 1BBWA 1K83H 1SLJA 4Y7NH 1K3RA 2D62A 5E7NA 3S17H 4LFCL 2ZJQA 4BA2I 5IYBH 4YCVA 1CKNA 3J80c 4DV2L 1JJCB 3GTGH 3RR5A 2ZM6Q 1D7QA 3STBD 4DV4Q 3PV0A 1VQKA 4GN4B 4B3RL 4R1JA 3KFUA 1MJEA 4POGA 1OXUA 4GOPC 3I4NH 3E0EA 3M7NA 3KOJA 1Q8KA 4P72A 3W1BA 1E24A 4DR7L 1VQEA 1WJJA 1RL2A 3OW2A 1VQ6A 4UP9A 1NE3A 1Q81C 3A5ZB 1E7ZA 1GVPA 2H5XA 3HKZG 4A3GH 1NY4A 3W1GA 2UXCL 4IPGA 4L5RC 3FKIG 1XMQQ 2N49A 5M3FH 4DNIA 1N9WA 2HQLA 5GAHC 3KJPA 2VUMH 3A5UA 1HNXQ 5IP9H 1W3SA 2ZTEA 1HZAA 1JJGA 1LYLA 3OYYA 1GD7A 4JI6L 3HOZG 2CQOA 3CMAA 4DR6Q 3I7FA 2BH2A 3KJOA 3F2CA 1XNQL 3RLOA 4C3JH 3DM3A 1XMOQ 2DGYA 1IYJB 5C4JH 1XTDA 3BU2A 4LF7L 3AYHB 1IBLQ 2IX1A 1HJPA 4FDBA 4DV3Q 2XGTA 4IOCA 1KC8C 3J81j 2OTLA 4B3MQ 1L2FA 1KXLA 4JI8Q 2B63G 1SRUA 3RNUA 4PG3A 4LF4L 3H3VI 3F1ZA 2N3SA 4K0KQ 2YTYA 1EWIA 3RLNA 5IYBG 1AE2A 4A75A 2GN5A 5DLQE 2I5LX 2D0OA 4DV6L 1PYBA 1PH7A 5IYDH 4A3BH 2ID0A 5GROA 3I4NG 3M4PA 3RZDH 5FLMH 2YV5A 4OWWB 4GS3A 5FLXc 4JV5L 1VQBA 1KRTA 1S72A 4LF9Q 3PUZA 4X66L 4A3KH 1GKHA 2B3GA 4DR2Q 2K75A 4BY1H 2UXBQ 1KQSA 4A3GG 3CF5A 4JI1L 3PO2H 4JOIA 1XNRQ 4A93H 5K36G 2AHOB 3I2ZA 5M3FG 4OONA 4BBRH 2VUMG 3HOUH 2CWAA 3K81C 5IP9G 1M1KC 1N8RC 5C4XH 3CC4A 4JCVE 1YBYA 3L7ZC 4HJ9A 4HIOA 1VQ9A 2VQEQ 1PH3A 1MKHA 4QIWE 2NZOA 1C9OA 3ULLA 1WYDA 2N78A 1QUQB 3I56A 1YJNA 1N33Q 2BH8A 2LSSA 4GKJL 4DV0Q 1N36L 2OCEA 3UE1A 1B8AA 2R7FA 4DV5Q 1PH6A 1AH9A 2MO1A 3PCOB 1K8AC 1Z9FA 2E5LQ 4DV1Q 1UE1A 1I3QH 1CKNB 4A3DG 4A3FH 3I4MH 1HZ9A 2OQKA 1YI2A 1XPOA 3S1MH 2NVYH 4RG1A 5GAGC 1I94Q 4BBSH 2OQ0A 4LUZA 1N32L 1VQIA 3AEVA 1I5FA 3F8TA 2LXKA 3JAMi 2Q2IA 2IX0A 5IYDG 1PH8A 1WCMH 1PH9A 4A3BG 4DUZL 2VS1A 2IHFA 1YHBA 3ULJA 2R93H 4P73A 4KHPQ 3HOWG 3A0JA 1H95A 5FLMG 1HNWL 2UUCQ 2RF4A 4GKKQ 2Z6KC 4HJ5A 5IE8A 1Q12A 5C3EH 3GTOH 3EIVA 5LMNL 4DUYL 4HIDA 5IP7G 4BY1G 4PZ6A 3ZJYC 2EIFA 1KAWA 4IJHA 1HNZQ 4YY3Q 2KHJA 4B3TL 1EUJA 1SROA 2UUAQ 4A93G 4R4OA 1BKBA 2GVBA 3E9IA 4J15A 3Q8DA 3OTOQ 1VQGA 1K9MC 4BBRG 1TWGH 2PI2A 2Y0SG 1WOCA 4POFA 3HOUG 4DAMA 2KHIA 4JYAQ 3F2DA 4R4IA 4NPSA 5C4XG 1X3EA 4LF6Q 3NBHB 4LF8L 4O0AA 1TWFH 1YZ6A 5IT9c 4X6AH 1V43A 3TREA 1X55A 3G4SA 1U5KA 4IPCA 1YVCA 1X54A 4LWCA 2WFWA 1XMQL 1M90C 2Y0SE 2VQFQ 3KYHC 4A3FG 2K5HA 3I4MG 2A19A 4JI7Q 5LMUQ 4LFAL 4BBSG 2MQHA 3CD6A 3HOVH 4KHZA 4GNXB 1L1OB 3PGZA 3PIOA 4LF5L 1FJGQ 4L5TA 4APVA 4X65Q 4GN5A 1VQPA 4DR4L 3TS0A 4YCWA 3CPWA 4BXXH 1BBUA 3B6YA 1WCMG 4XIGS 5BR8Q 1NMGA 1NJIC 2F4VQ 2JA6H 2R93G 3ULPA 1K0RA 3T1YQ 5IY0A 4DR3Q 4DV3L 1QZGA 4X64Q 1HR0L 3HFZB 2HHHL 2UUBQ 2B29A 1A62A 3ICEA 1Q46A 5C3EG 1OXSC 3J7ZC 1N34L 3U50C 3UE0A 3L0OA 4KI0A 3GTLH 2Q2UA 4OX9Q 4MTNA 1PH4A 1IBKQ 2BA1A 4GLXA 1PH2A 4O2DA 4JI5L 4YHHQ 4JI0Q 4LNQA 3T1HQ 2UU9Q 3M85A 2IY5B 4LUVA 4JI2L 3HKZE 3H15A 3F2BA 2R92H 1X56A 4LF9L 3TRZA 2LXJA 2MFIA 4C2MH 4DR1L 2K5NA 4DV7Q 5M3MG 2NZHA 4B3SQ 2UXBL 2ZJRA 4NXMQ 3PO2G 1J5EL 2AKWB 3K80C 3BJUA 3U4ZA 2A1AA 1NBWA 3G6EA 4A3MH 5IWAL 1YEZA 4DV2Q 4YWKA 1PVOA 2JA7H 3S1RH 1JMCA 3KLWA 4A3CH 1OXXK 2KENA 2NN6I 3MEFA 4DK3C 4B3RQ 2VNUD 3ERSX 2VQEL 4AQYL 4X62L 1KRSA 3AFPA 4GNXA 1Q82C 1K8GA 4BY7H 1L1OA 3IRBA 1LUZA 4TVAB 3PIPA 1EQQA 2JA8H 2QEXA 1A0IA 4JBKA 4JI4L 5AJ3L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MO0 A;  2Q2H A;  2MNA A;  1ASY A;  2VZA A;  2UXC Q;  1OXV A;  5M5W H;  3U4V A;  3TQY A;  3CCJ A;  2HT1 A;  1LM0 A;  3CXC A;  1VQD A;  1Y1V H;  1JE5 A;  1E22 A;  1YHQ A;  4OXP A;  4A3E H;  4L5S A;  4JI6 Q;  1GO3 E;  4JC0 A;  2ASB A;  2E8G A;  4NB3 A;  3CCS A;  4KHP L;  2ATW A;  2V1C C;  1R9T H;  3BZC A;  4JI3 L;  3LGJ A;  4LF7 Q;  2JE6 I;  5ELO A;  1HH2 P;  2R92 G;  4QQB X;  1EFW A;  1O7I A;  4EX5 A;  1EQR A;  1KHI A;  1WI5 A;  4A3L H;  2PQA A;  4GN3 B;  1VQ5 A;  4GOP B;  3M9B A;  3GTJ H;  1X3F A;  2EQS A;  2VY3 A;  4YY3 L;  2AWO A;  3FP9 A;  4IJL A;  4DR5 Q;  2R7D A;  3U58 A;  1IBM L;  4UP8 A;  2Z0S A;  4A3M G;  1MJC A;  2JA7 G;  2I0Q A;  2CKZ B;  1Q7Y C;  3JAM c;  4DV6 Q;  5GQO A;  5FJ8 H;  3STB C;  5C44 H;  2Z6K A;  1D8L A;  1UEB A;  4EQ5 A;  1Z47 A;  4A3J H;  4BY7 G;  5JEA J;  3KF6 B;  1UE6 A;  3PSI A;  1PV4 A;  1VQL A;  4OWX B;  2JA8 G;  3M4O H;  2HIV A;  4DAY B;  5JEA G;  3J81 i;  3I55 A;  2R7Z H;  3CCR A;  4JV5 Q;  4LFB L;  4P74 A;  1T9H A;  4X66 Q;  1SN8 A;  4MZ9 A;  5HGQ A;  4A3K G;  1C7Y A;  4OO1 G;  3JC6 6;  3ER0 A;  2RHQ B;  2JK8 A;  3I4O A;  3GTQ H;  3UDX A;  4JI1 Q;  4KLK A;  2JQO A;  2PMZ E;  1CUK A;  1HR0 W;  4DPG A;  2ZM6 L;  2CCZ A;  1NMF A;  5M5Y H;  5GAE C;  1KIX A;  5LMU L;  4DV4 L;  1PHJ A;  2ZTC A;  2ALY B;  3KF8 B;  4PZ8 A;  1RIP A;  1B7Y B;  4HIK A;  1V1Q A;  1P16 A;  1Y1V G;  5IYC H;  1YNX A;  4X65 L;  4A3E G;  2F3I A;  3SGI A;  2AMC B;  3M4Q A;  4ALP A;  3K7A H;  4A3I H;  2BA0 A;  3KDF A;  4YWL A;  4MNO A;  4ME3 A;  2XTI A;  2JEB I;  4IO9 A;  4GKJ Q;  3HOX H;  2HIX A;  3CCQ A;  3GTM H;  1FGU A;  3PUW A;  3D0F A;  3PUX A;  4A3L G;  4QL5 A;  4HJA A;  4WJ3 M;  1X65 A;  4HJ7 A;  5EAY A;  4GOP A;  4C3H H;  3CCE A;  1HNX L;  1UE7 A;  2UXD Q;  1G51 A;  1JB7 A;  2NVT H;  1N32 Q;  3TS2 A;  4OO1 I;  4P75 A;  4DR6 L;  1SMX A;  4YHH L;  1VQM A;  1YIT A;  3A74 A;  4R4C A;  3H0G H;  1G6P A;  3GTP H;  2WAQ G;  1HZC A;  1XMO L;  4HIM A;  1PFS A;  4A3J G;  4DUZ Q;  1S3O A;  3EN2 A;  4HJ8 A;  1IBL L;  1KD1 C;  2K14 A;  3KF6 A;  1NTG A;  2RHS B;  2FXQ A;  1HNW Q;  4DV7 L;  2NN6 G;  4B3M L;  1I50 H;  4A4I A;  2B63 H;  1DGS A;  4JI8 L;  4NXN Q;  3CCL A;  4DUY Q;  4IPD A;  3J7A 5;  3DLL A;  1VQF A;  3HOY H;  2E2I H;  3S1N H;  4K0K L;  4B3T Q;  3J80 i;  2KCT A;  3AQQ A;  1X9N A;  2F52 A;  2JA5 H;  2WAQ E;  3RN2 A;  2PI2 E;  1JT8 A;  2I5M X;  3M3Y H;  2ZTD A;  5IYC G;  1BVS A;  3S2D H;  4LUO A;  2KBN A;  3HKS A;  1XPR A;  4A3I G;  1JJ2 A;  3S2H H;  3G48 A;  3NEN A;  5C0X J;  4LF8 Q;  3TEH B;  2WB1 G;  5C0X G;  2A8V A;  4A76 A;  3CAM A;  3HOX G;  2L15 A;  2PQA B;  4DR2 L;  1LTL A;  1HZB A;  2CWP A;  1AE3 A;  3K0X A;  4GLA C;  3UDG A;  1K73 C;  4GLV B;  4QY7 A;  2VW9 A;  1VQH A;  2QGQ A;  3CC7 A;  1E1O A;  1XNR L;  3CQZ H;  3GTK H;  3G71 A;  3CCM A;  4LFC Q;  4AH6 A;  3CCV A;  1X3G A;  1SFO H;  4LFA Q;  5M5X H;  3HOV G;  3W5O A;  3PF4 A;  1QVG A;  1EIY B;  1N33 L;  2WB1 E;  2C35 B;  1P8L A;  4LF5 Q;  4UY8 C;  1W2B A;  3H0G G;  4DR4 Q;  4DV0 L;  1XPU A;  3RN5 A;  2YTV A;  2JA6 G;  4DR7 Q;  2HHH Q;  4DV5 L;  1EIF A;  1HR0 Q;  2K4K A;  3BZK A;  3EBE A;  4DV1 L;  5J3B A;  3K7U C;  3UDI A;  4R4Q A;  1YIJ A;  2E5L L;  3S16 H;  1MIU A;  1N34 Q;  4BXX G;  4H02 A;  4DR5 L;  4A3D H;  1UE5 A;  5GAD C;  1VQC A;  2ZJP A;  3HOY G;  1I6H H;  2AWN A;  3FHW A;  1I94 L;  1VQN A;  2GVA A;  1KL9 A;  4TQU S;  5C0X I;  4IFD J;  1EOV A;  2E2J H;  4BA1 I;  5LMN W;  3S24 A;  3S14 H;  2JA5 G;  1VCI A;  4IFD G;  4R4T A;  2OTJ A;  1TWA H;  4UPA A;  4JI5 Q;  1FVI A;  1S40 A;  3MXN B;  3KDF B;  2NVQ H;  1Q1B A;  2JEA I;  4AIM A;  5ELN A;  1XNQ Q;  1Y14 B;  2JA9 A;  3HOW H;  1CSP A;  1TWH H;  4JI2 Q;  1L0W A;  1YJW A;  2UUC L;  1V9P A;  2DUD A;  4GKK L;  1EYG A;  5JJK A;  4QJF A;  4GNX C;  4DR1 Q;  5IP7 H;  1OTC A;  1L1O C;  2YYZ A;  4OWT B;  5JJL A;  2K50 A;  3PUV A;  1J5E Q;  1SR3 A;  1HNZ L;  1Y1W H;  2E2H H;  4JBM A;  1J6Q A;  1PH1 A;  2UUA L;  4LF4 Q;  1OXT A;  4JBW A;  3OTO L;  5IWA Q;  4PZ7 A;  1QVF A;  2KCM A;  1A8V A;  3RZO H;  1VQO A;  4DK6 C;  2QA4 A;  4A3C G;  3PO3 H;  4L5Q A;  4JYA L;  3AFQ A;  1CKO A;  3D31 A;  1QZH A;  4AQY Q;  4JOI C;  4X62 Q;  4LF6 L;  1CSQ A;  3PUY A;  4P71 A;  1YJ9 A;  4XTC S;  1WFQ A;  2JJQ A;  2K5V A;  4JI4 Q;  5AJ3 Q;  3J81 c;  3UDF A;  3CCU A;  1A63 A;  1GM5 A;  2D0P A;  3S1Q H;  4AYB G;  4IFD I;  3E9H A;  3S15 H;  4Y52 H;  1QVC A;  2CFM A;  4YCU A;  4UP7 A;  2VQF L;  1VQ8 A;  2VL6 A;  1IL2 A;  1YHA A;  4RMF A;  2UXD L;  3CME A;  1PA6 A;  1Q86 C;  4JI7 L;  2K52 A;  3VDY A;  2ES2 A;  3WWV A;  1IZ6 A;  2EXD A;  3PF5 A;  5HY6 A;  1XJV A;  1G29 1;  1FJG L;  3GDE A;  1Q1E A;  1VS0 A;  4IPH A;  1VQ7 A;  2I5H A;  3H3V H;  4JG2 A;  1X6O A;  4AYB E;  5BR8 L;  2WP8 J;  2F4V L;  4C3I H;  4YWM A;  4IOA A;  3NEM A;  2PNH A;  3T1Y L;  4DR3 L;  1TXY A;  2UUB L;  4X64 L;  4JI3 Q;  3L2P A;  1N36 Q;  1TWC H;  4WJ4 A;  2Q2T A;  1E1T A;  1VQJ A;  3CW2 C;  4JBJ A;  4NXN L;  2IHE A;  1IXR A;  2YTX A;  3FKI H;  2R6G A;  5H1S E;  3RLF A;  3CP0 A;  4DKA C;  1Y1W G;  1IBM Q;  2RCN A;  4PMW A;  1U0L A;  4LW1 A;  4OX9 L;  2NVX H;  1SE8 A;  1IBK L;  1FL0 A;  1ASZ A;  3HOZ H;  2IT1 A;  1VQ4 A;  1E3P A;  3PO3 G;  1B70 B;  3GD7 A;  1CKM A;  3T1H L;  2UU9 L;  4JI0 L;  5FJ8 G;  3CC2 A;  5JJI A;  2N8N A;  5C44 G;  3K8A A;  1QUQ A;  1PH5 A;  3CPF A;  1PYS B;  2YU9 H;  2OWO A;  4LFB Q;  5M3M H;  1UWV A;  2R7Z G;  4B3S L;  1C0A A;  4QGU A;  1VQA A;  3GO5 A;  3NEL A;  4NXM L;  5LMN Q;  1BBW A;  1K83 H;  1SLJ A;  4Y7N H;  1K3R A;  2D62 A;  5E7N A;  3S17 H;  4LFC L;  2ZJQ A;  4BA2 I;  5IYB H;  4YCV A;  1CKN A;  3J80 c;  4DV2 L;  1JJC B;  3GTG H;  3RR5 A;  2ZM6 Q;  1D7Q A;  3STB D;  4DV4 Q;  3PV0 A;  1VQK A;  4GN4 B;  4B3R L;  4R1J A;  3KFU A;  1MJE A;  4POG A;  1OXU A;  4GOP C;  3I4N H;  3E0E A;  3M7N A;  3KOJ A;  1Q8K A;  4P72 A;  3W1B A;  1E24 A;  4DR7 L;  1VQE A;  1WJJ A;  1RL2 A;  3OW2 A;  1VQ6 A;  4UP9 A;  1NE3 A;  1Q81 C;  3A5Z B;  1E7Z A;  1GVP A;  2H5X A;  3HKZ G;  4A3G H;  1NY4 A;  3W1G A;  2UXC L;  4IPG A;  4L5R C;  3FKI G;  1XMQ Q;  2N49 A;  5M3F H;  4DNI A;  1N9W A;  2HQL A;  5GAH C;  3KJP A;  2VUM H;  3A5U A;  1HNX Q;  5IP9 H;  1W3S A;  2ZTE A;  1HZA A;  1JJG A;  1LYL A;  3OYY A;  1GD7 A;  4JI6 L;  3HOZ G;  2CQO A;  3CMA A;  4DR6 Q;  3I7F A;  2BH2 A;  3KJO A;  3F2C A;  1XNQ L;  3RLO A;  4C3J H;  3DM3 A;  1XMO Q;  2DGY A;  1IYJ B;  5C4J H;  1XTD A;  3BU2 A;  4LF7 L;  3AYH B;  1IBL Q;  2IX1 A;  1HJP A;  4FDB A;  4DV3 Q;  2XGT A;  4IOC A;  1KC8 C;  3J81 j;  2OTL A;  4B3M Q;  1L2F A;  1KXL A;  4JI8 Q;  2B63 G;  1SRU A;  3RNU A;  4PG3 A;  4LF4 L;  3H3V I;  3F1Z A;  2N3S A;  4K0K Q;  2YTY A;  1EWI A;  3RLN A;  5IYB G;  1AE2 A;  4A75 A;  2GN5 A;  5DLQ E;  2I5L X;  2D0O A;  4DV6 L;  1PYB A;  1PH7 A;  5IYD H;  4A3B H;  2ID0 A;  5GRO A;  3I4N G;  3M4P A;  3RZD H;  5FLM H;  2YV5 A;  4OWW B;  4GS3 A;  5FLX c;  4JV5 L;  1VQB A;  1KRT A;  1S72 A;  4LF9 Q;  3PUZ A;  4X66 L;  4A3K H;  1GKH A;  2B3G A;  4DR2 Q;  2K75 A;  4BY1 H;  2UXB Q;  1KQS A;  4A3G G;  3CF5 A;  4JI1 L;  3PO2 H;  4JOI A;  1XNR Q;  4A93 H;  5K36 G;  2AHO B;  3I2Z A;  5M3F G;  4OON A;  4BBR H;  2VUM G;  3HOU H;  2CWA A;  3K81 C;  5IP9 G;  1M1K C;  1N8R C;  5C4X H;  3CC4 A;  4JCV E;  1YBY A;  3L7Z C;  4HJ9 A;  4HIO A;  1VQ9 A;  2VQE Q;  1PH3 A;  1MKH A;  4QIW E;  2NZO A;  1C9O A;  3ULL A;  1WYD A;  2N78 A;  1QUQ B;  3I56 A;  1YJN A;  1N33 Q;  2BH8 A;  2LSS A;  4GKJ L;  4DV0 Q;  1N36 L;  2OCE A;  3UE1 A;  1B8A A;  2R7F A;  4DV5 Q;  1PH6 A;  1AH9 A;  2MO1 A;  3PCO B;  1K8A C;  1Z9F A;  2E5L Q;  4DV1 Q;  1UE1 A;  1I3Q H;  1CKN B;  4A3D G;  4A3F H;  3I4M H;  1HZ9 A;  2OQK A;  1YI2 A;  1XPO A;  3S1M H;  2NVY H;  4RG1 A;  5GAG C;  1I94 Q;  4BBS H;  2OQ0 A;  4LUZ A;  1N32 L;  1VQI A;  3AEV A;  1I5F A;  3F8T A;  2LXK A;  3JAM i;  2Q2I A;  2IX0 A;  5IYD G;  1PH8 A;  1WCM H;  1PH9 A;  4A3B G;  4DUZ L;  2VS1 A;  2IHF A;  1YHB A;  3ULJ A;  2R93 H;  4P73 A;  4KHP Q;  3HOW G;  3A0J A;  1H95 A;  5FLM G;  1HNW L;  2UUC Q;  2RF4 A;  4GKK Q;  2Z6K C;  4HJ5 A;  5IE8 A;  1Q12 A;  5C3E H;  3GTO H;  3EIV A;  5LMN L;  4DUY L;  4HID A;  5IP7 G;  4BY1 G;  4PZ6 A;  3ZJY C;  2EIF A;  1KAW A;  4IJH A;  1HNZ Q;  4YY3 Q;  2KHJ A;  4B3T L;  1EUJ A;  1SRO A;  2UUA Q;  4A93 G;  4R4O A;  1BKB A;  2GVB A;  3E9I A;  4J15 A;  3Q8D A;  3OTO Q;  1VQG A;  1K9M C;  4BBR G;  1TWG H;  2PI2 A;  2Y0S G;  1WOC A;  4POF A;  3HOU G;  4DAM A;  2KHI A;  4JYA Q;  3F2D A;  4R4I A;  4NPS A;  5C4X G;  1X3E A;  4LF6 Q;  3NBH B;  4LF8 L;  4O0A A;  1TWF H;  1YZ6 A;  5IT9 c;  4X6A H;  1V43 A;  3TRE A;  1X55 A;  3G4S A;  1U5K A;  4IPC A;  1YVC A;  1X54 A;  4LWC A;  2WFW A;  1XMQ L;  1M90 C;  2Y0S E;  2VQF Q;  3KYH C;  4A3F G;  2K5H A;  3I4M G;  2A19 A;  4JI7 Q;  5LMU Q;  4LFA L;  4BBS G;  2MQH A;  3CD6 A;  3HOV H;  4KHZ A;  4GNX B;  1L1O B;  3PGZ A;  3PIO A;  4LF5 L;  1FJG Q;  4L5T A;  4APV A;  4X65 Q;  4GN5 A;  1VQP A;  4DR4 L;  3TS0 A;  4YCW A;  3CPW A;  4BXX H;  1BBU A;  3B6Y A;  1WCM G;  4XIG S;  5BR8 Q;  1NMG A;  1NJI C;  2F4V Q;  2JA6 H;  2R93 G;  3ULP A;  1K0R A;  3T1Y Q;  5IY0 A;  4DR3 Q;  4DV3 L;  1QZG A;  4X64 Q;  1HR0 L;  3HFZ B;  2HHH L;  2UUB Q;  2B29 A;  1A62 A;  3ICE A;  1Q46 A;  5C3E G;  1OXS C;  3J7Z C;  1N34 L;  3U50 C;  3UE0 A;  3L0O A;  4KI0 A;  3GTL H;  2Q2U A;  4OX9 Q;  4MTN A;  1PH4 A;  1IBK Q;  2BA1 A;  4GLX A;  1PH2 A;  4O2D A;  4JI5 L;  4YHH Q;  4JI0 Q;  4LNQ A;  3T1H Q;  2UU9 Q;  3M85 A;  2IY5 B;  4LUV A;  4JI2 L;  3HKZ E;  3H15 A;  3F2B A;  2R92 H;  1X56 A;  4LF9 L;  3TRZ A;  2LXJ A;  2MFI A;  4C2M H;  4DR1 L;  2K5N A;  4DV7 Q;  5M3M G;  2NZH A;  4B3S Q;  2UXB L;  2ZJR A;  4NXM Q;  3PO2 G;  1J5E L;  2AKW B;  3K80 C;  3BJU A;  3U4Z A;  2A1A A;  1NBW A;  3G6E A;  4A3M H;  5IWA L;  1YEZ A;  4DV2 Q;  4YWK A;  1PVO A;  2JA7 H;  3S1R H;  1JMC A;  3KLW A;  4A3C H;  1OXX K;  2KEN A;  2NN6 I;  3MEF A;  4DK3 C;  4B3R Q;  2VNU D;  3ERS X;  2VQE L;  4AQY L;  4X62 L;  1KRS A;  3AFP A;  4GNX A;  1Q82 C;  1K8G A;  4BY7 H;  1L1O A;  3IRB A;  1LUZ A;  4TVA B;  3PIP A;  1EQQ A;  2JA8 H;  2QEX A;  1A0I A;  4JBK A;  4JI4 L;  5AJ3 L; 
#chains in the Genus database with same CATH topology
 1LO5 D;  4OO1 H;  2PW7 A;  1M4V A;  1A3V A;  2LKV A;  1ASY A;  2VZA A;  1UEA B;  2WAQ B;  5JVH 3;  3NPP A;  1BCP F;  4L5S A;  2CH4 A;  3GQB A;  4I7Z C;  1NNX A;  4NB3 A;  1O7L A;  3N52 A;  4FXD A;  3IFT A;  2KVM A;  4LK1 C;  5CV5 A;  2JE6 I;  2AUJ D;  3V05 A;  2GA4 B;  1WI5 A;  4GN3 B;  1VQ5 A;  2VY3 A;  2R7D A;  5ELE A;  5E1F A;  4A3M G;  1SXT A;  4KY5 A;  1JB3 A;  1H9S B;  3GTM B;  2XIW A;  4BY7 G;  3KF6 B;  4RKL A;  2DY7 A;  3M4O H;  2HIV A;  4HR7 B;  3O13 A;  2R7Z H;  3J7A V;  4LFB L;  1GHJ A;  3R2I A;  4P74 A;  1T9H A;  4X66 Q;  2KEC A;  1KLG D;  4RFB A;  1PXU A;  4ME5 A;  4JI1 Q;  2JQO A;  4NP5 A;  1CUK A;  4ABN A;  4UAI A;  4DPG A;  2CCZ A;  5C3W A;  5IIF A;  5IOC A;  2QIL A;  2ZTC A;  1CA6 A;  4MIU A;  2F3I A;  3KLR A;  5J1Z A;  4FF2 A;  2BA0 A;  1IYV A;  2TSS A;  3IAY A;  2XTI A;  2JEB I;  5C0X H;  2HIX A;  3GTM H;  3S1N B;  2EY2 A;  3CKI B;  2NYZ D;  1STG A;  1J9O A;  1EY5 A;  4QL5 A;  3VR6 A;  1ZKO A;  4WJ3 M;  1X65 A;  3NTI A;  2RKS A;  4O42 A;  5EQ0 A;  2HDM A;  2K1B A;  4IN3 A;  4DR6 L;  4OO1 I;  1SMX A;  3A8I E;  1YIT A;  4K14 A;  4C2M B;  3MFG A;  1XMO L;  1D1K A;  4HIM A;  4DUZ Q;  1S3O A;  3NE5 B;  5JPM C;  3H3V C;  2Z4I A;  3CQZ B;  5T1G A;  4DV7 L;  1F9Q A;  2NN6 G;  4A4I A;  5EKL A;  2OF1 A;  3EA6 A;  4JI8 L;  3CCL A;  1RJT A;  4XT1 B;  4CJ0 B;  3J7A 5;  3S1N H;  4K0K L;  2F3V A;  3DMU A;  3J80 i;  2FMM A;  2F52 A;  1DZ1 A;  2NUC A;  2PI2 E;  2ZXR A;  4IFD H;  2I5M X;  2KQ3 A;  1BVS A;  1SYC A;  2F0O A;  1JJ2 A;  5C0X J;  5FO9 B;  4DXG A;  3N6R A;  4I65 A;  4A76 A;  4OEL B;  1RHP A;  1E2W A;  1AE3 A;  1SDF A;  4QY7 A;  1VQH A;  3CQZ H;  4LFC Q;  4OEM B;  1NR2 A;  4IAL A;  1MSH A;  2Z4H A;  2EY1 A;  3HOV G;  3TP7 A;  4DR4 Q;  3H0G G;  4DV0 L;  1XPU A;  1SNM A;  5FOB B;  2G9H D;  1B9M A;  3KK7 A;  3BZK A;  4DV1 L;  5J3B A;  3K7U C;  3UDI A;  3J81 E;  4H02 A;  4DR5 L;  1TS5 A;  1UE5 A;  3OW7 A;  1VQC A;  4G57 A;  1I94 L;  2GVA A;  4IFD J;  3QWN A;  4TQU S;  5C0X I;  4A3J B;  4KD3 A;  3S24 A;  1VCI A;  4R4T A;  4UPA A;  1H9M A;  1S40 A;  1KLU D;  2L5T A;  5ELN A;  4AIM A;  3NWS A;  1TWH H;  5E3F A;  1B4O A;  1YJW A;  3GTQ B;  4GKK L;  2DUD A;  5IT9 L;  4QJF A;  4GNX C;  3T13 A;  4OWT B;  1ILQ A;  4LMQ D;  3PUV A;  4JBM A;  5IOD A;  2UUA L;  1OXT A;  2O5I C;  1JCK B;  3OTO L;  4PZ7 A;  1VMC A;  1BQQ T;  3BVZ A;  2E74 C;  2F0F A;  2D9U A;  3D31 A;  3PUY A;  1YJ9 A;  1O7Z A;  2NB0 A;  1ESF A;  2K5V A;  3QJY A;  5T1I A;  1PZJ D;  2JN4 A;  3ZYY X;  1GM5 A;  4AYB G;  4IFD I;  3S15 H;  3DUZ A;  1VQ8 A;  1IL2 A;  2K05 A;  1ESR A;  2F0G A;  2UXD L;  4JI7 L;  2K52 A;  5LL6 X;  2IX3 A;  3T4A C;  2YU9 B;  1Q1E A;  3H3V H;  1Z6H A;  1FGB D;  1I50 B;  2WP8 J;  4C3I H;  3A8K E;  2UUB L;  4X64 L;  2E2I B;  2B2Y A;  4WJ4 A;  3CW2 C;  1IXR A;  3K0Y A;  1WTR A;  1CT1 D;  2EY6 A;  3CP0 A;  4DKA C;  1IBM Q;  1NSN S;  3UI2 A;  1BR9 A;  1C48 A;  4LW1 A;  4OX9 L;  2A6H C;  1FL0 A;  1MHW C;  1GOZ A;  1WTQ A;  1B70 B;  3T1H L;  2UU9 L;  3CC2 A;  5J39 A;  2N8N A;  2CQA A;  2RBM A;  3CPF A;  4KY7 A;  1BXT A;  2YU9 H;  1NCV A;  5I9O A;  3GTK B;  1C0A A;  4QGU A;  2VUM B;  1G6P A;  2F0E A;  4F88 A;  2Z6B A;  3PIO 3;  2ZJQ A;  5M5X B;  2ZM6 Q;  1B3Q A;  4DV4 Q;  2KUM A;  5D3D A;  3KFU A;  1MJE A;  1QWY A;  3TDQ A;  4POG A;  2H4O A;  5TSS A;  3E0E A;  2WIN B;  1BOS A;  3W3A A;  1B3A A;  1VQE A;  4A3D B;  1RL2 A;  1Q81 C;  1NE3 A;  5EGT A;  1GVP A;  4R8N A;  3HKZ G;  2BE5 C;  1XMQ Q;  2RCF A;  5M3F H;  4DNI A;  3NUC A;  2VUM H;  4C3H G;  1HNX Q;  1IW7 C;  1HZA A;  1T5E A;  1JWM D;  1JJG A;  3OYY A;  1EEI D;  1GD7 A;  3HOZ G;  3CMA A;  1HXY D;  4N9T A;  3RLO A;  2PYK A;  2KJX A;  1VMP A;  4LF7 L;  3DXJ C;  4R9W A;  3VA5 A;  3OIP A;  4IOC A;  1Y1W B;  3J81 j;  1LAC A;  4B3M Q;  1L2F A;  4CDD C;  3SR1 A;  1F2Y A;  2B63 G;  3H3V I;  3F1Z A;  1SE2 A;  4DF7 A;  2B2T C;  1EWI A;  3RLN A;  1AE2 A;  1GUT A;  5DLQ E;  4U68 A;  3TP8 A;  2RA4 A;  2F03 A;  5IYD H;  3VR2 A;  1WD0 A;  1Q3L A;  1AZQ A;  4A3B H;  2ID0 A;  5GRO A;  1R4P B;  3M4P A;  4GS3 A;  5FLX c;  2EJG C;  3BYY B;  1ENC A;  4DR2 Q;  3S1M B;  4P2C B;  3DWP A;  3A7A B;  3EQL C;  4PQX A;  4WRD A;  3I2Z A;  4IUT A;  2A69 D;  2M2L A;  3RUZ A;  2CWA A;  5CMD A;  2FMC A;  3CC4 A;  1N8R C;  2R93 B;  2VQE Q;  1PH3 A;  4KD4 A;  2LSS A;  1CK1 A;  2BDO A;  5DM6 3;  3FKI B;  2P5Z X;  1EU3 A;  1N36 L;  3D4R A;  4ILW A;  2R7F A;  1PH6 A;  2KA7 A;  3BG3 A;  1CKN B;  1LTS D;  4A3F H;  2OQK A;  2B2U A;  4IZ8 A;  1OO9 B;  3WDN A;  3S1M H;  2OQ0 A;  3IFD A;  3AEV A;  2KHS A;  3JAM i;  1MGS A;  2CHB D;  1TII D;  1O80 A;  4ZUJ A;  2R93 H;  4KHP Q;  3HOW G;  2F0K A;  1PMR A;  1EU4 A;  4KKS A;  3EIV A;  1EY6 A;  3V2T A;  4BY1 G;  4PZ6 A;  2PZU A;  2EIF A;  4RWS C;  4YY3 Q;  2KHJ A;  1WTV A;  3K5M A;  3E9I A;  5JJZ A;  3I4N B;  2K04 A;  1VQG A;  4POF A;  3HOU G;  5C4X G;  3G7L A;  4LF6 Q;  3TP5 A;  1PTO B;  1YZ6 A;  4DNR B;  3TRE A;  1X55 A;  3K5L A;  1X54 A;  2WFW A;  5J22 A;  2VQF Q;  3H91 A;  3I4M G;  3TZD A;  4G7Z C;  4C3J B;  3HOV H;  1E0B A;  2ZXP A;  2WV6 D;  4J1M A;  2R92 B;  1FJG Q;  4X65 Q;  1VQP A;  1H9S A;  2O5J C;  4BXX H;  3B6Y A;  4XIG S;  2NWG A;  1SNC A;  3P7J A;  2F4V Q;  4NMZ A;  3ULP A;  2HHH L;  4DV3 L;  1X3Q A;  5COY A;  2B29 A;  1A62 A;  1HRJ A;  3U50 C;  3GTL H;  2QDL A;  1CQV A;  1PZI D;  2Q2U A;  3TZU A;  1LLR D;  1IBK Q;  5BN3 A;  3BVG A;  4IUP A;  2IY5 B;  4JI2 L;  3HKZ E;  4HCS A;  2R92 H;  4HCE A;  2H1E A;  1EYA A;  2LXJ A;  4DR1 L;  5M3M G;  4B3S Q;  2UXB L;  5KYI A;  4BBR B;  2ZJR A;  2JSO A;  3NWT A;  3BJU A;  3U4Z A;  3J7Y W;  1NBW A;  1PVO A;  1JMC A;  3KLW A;  1I4P A;  2NN6 I;  2KEN A;  3MEF A;  4B3R Q;  2VNU D;  4PMB A;  4AQY L;  2K28 A;  3R8B A;  3AFP A;  1K8G A;  1SMY C;  5ISR A;  1L1O A;  1LUZ A;  1XWE A;  1A0I A;  5AJ3 L;  5A2Q L;  2MO0 A;  1BCP B;  3G6J B;  4NW2 A;  1HA6 A;  3I8Z A;  4MN3 A;  4DN4 M;  4HMI A;  3TQY A;  3CCJ A;  2HT1 A;  1LM0 A;  1VDZ A;  3CXC A;  1BUV T;  1JE5 A;  1HCZ A;  2VXW A;  4HTH A;  4OXP A;  5EJW A;  1U4P A;  3GV3 A;  2A73 B;  2E8G A;  1ET9 A;  3GTO B;  2M00 A;  1B9N A;  2D5D A;  2V1C C;  3BZC A;  3LGJ A;  1I4G A;  1HH2 P;  1O7I A;  1KHI A;  1RDP D;  2BE5 D;  3V96 A;  4GOP B;  3GTJ H;  1X3F A;  2EQS A;  1IW7 D;  2HCC A;  4IJL A;  2Z0S A;  2M9V A;  2I0Q A;  2CKZ B;  2EYO A;  4DV6 Q;  2WB1 B;  3STB C;  1I4H A;  3HOX B;  2Z6K A;  4EQ5 A;  1YNN C;  5I6W A;  4OWX B;  2OXP A;  5JEA G;  3J81 i;  4JV5 Q;  3CCR A;  4ZLT F;  4MZ9 A;  4A3K G;  3JC6 6;  2JK8 A;  1LTA D;  4DFA A;  1CI3 M;  2PMZ E;  3Q22 A;  3OOC A;  1KIX A;  5LMU L;  4RCO A;  3ND9 A;  1P16 A;  1Y1V G;  2LY7 A;  3E3X A;  4A3E G;  3SGI A;  1YNJ D;  2AMC B;  3M4Q A;  1U9R A;  1X3P A;  4GKJ Q;  3HOX H;  2QW7 A;  3D0F A;  3PUX A;  2EYJ A;  4A3L G;  3U9S A;  3M3Y B;  4HJA A;  1PRT C;  4C3H H;  1UE7 A;  4IUQ A;  3BZD B;  5JOB A;  1C8C A;  3TS2 A;  4YHH L;  1FNW A;  3A74 A;  4A3J G;  3WOF A;  1T5X D;  2K14 A;  2D2C C;  1KD1 C;  2DY8 A;  2RHS B;  1RTN A;  5FLX L;  1K3B C;  1HPC A;  2B63 H;  1DGS A;  4XQN A;  4DUY Q;  2VB3 X;  3DLL A;  4C1N I;  4B3T Q;  3C46 A;  5CV6 A;  2JA5 H;  2WAQ E;  4PV1 C;  2JA8 B;  1CHP D;  4QF4 A;  3M3Y H;  1GHK A;  1HFG A;  5IYC G;  3S2D H;  4JPB W;  4LUO A;  1F2M A;  4A3I G;  3NEN A;  4LF8 Q;  1UUP A;  2Q8R E;  1STH A;  3TEH B;  4WJW A;  2LMC B;  2PW5 A;  4ZYS A;  2A8V A;  2X6L A;  3NTK A;  4GLA C;  2EE1 A;  2Z1C A;  3Q23 A;  1TS4 A;  4GLV B;  1K73 C;  1MBY A;  1E1O A;  2VB2 X;  5IGB A;  3VR4 A;  1X3G A;  2BCO A;  4IUU A;  3OHX C;  4LFA Q;  2EY5 A;  1G8Z D;  1HTP A;  1QVG A;  1EIG A;  1N33 L;  4LF5 Q;  3NBI A;  3DWA A;  1KDC A;  3JAM E;  4H13 C;  2JA6 G;  4DR7 Q;  3TBI B;  4DV5 L;  1EIF A;  4L8J A;  3VA7 A;  1GJX A;  2G5D A;  3EBE A;  1HA5 A;  1H9R A;  2L55 A;  5IGG A;  4R4Q A;  1YIJ A;  3CU7 A;  3X3N A;  5GAD C;  1TY2 A;  3HOY G;  1VQN A;  1KL9 A;  3MTS A;  1CA5 A;  4JI5 Q;  3M4O B;  2R7Z B;  3KDF B;  1Q1B A;  2JEA I;  3R2T A;  2JA9 A;  3HOW H;  3NQT A;  4X3S A;  1CSP A;  2CVR A;  1L0W A;  2UUC L;  2IWH A;  5I6Y A;  1L1O C;  1IYU A;  1G2S A;  1J5E Q;  1SR3 A;  1HNZ L;  1CQF A;  1PH1 A;  5NUC A;  4JBW A;  2KCM A;  4TSS A;  4A3C G;  4L5Q A;  3AFQ A;  4X62 Q;  1KNE A;  1TWC B;  1CSQ A;  3A54 A;  1SYE A;  4P71 A;  2HQE A;  4XTC S;  1WFQ A;  1U4M A;  2B2V C;  3S1Q H;  1SYG A;  4FF3 A;  2TMP A;  2CFM A;  3BS1 A;  1RTO A;  2VL6 A;  3HZX A;  3CME A;  1PA6 A;  2RDH A;  4K5X A;  4KMU C;  1PYW D;  1QG7 A;  2ES2 A;  2E2D C;  4XYO A;  1IZ6 A;  1HFN A;  2EXD A;  1G29 1;  1O78 A;  3GDE A;  1VQ7 A;  4O1N A;  1X6O A;  5BR8 L;  1EL0 A;  3NEM A;  3T1Y L;  1K83 B;  4L6T B;  5HUR A;  3L2P A;  5C3X A;  1TWC H;  4JBJ A;  2IHE A;  1BF4 A;  4IQZ A;  1TY0 A;  4B08 A;  1Y1W G;  2RCN A;  1H9K A;  5G3L D;  3C1E A;  2EZV A;  1SE8 A;  1ASZ A;  2IT1 A;  3PO3 G;  4JI0 L;  5FJ8 G;  5JJI A;  5C44 G;  1JIC A;  2LFN A;  5HGT A;  1PH5 A;  4LFB Q;  5M3M H;  2K03 A;  1VQA A;  4NXM L;  1K83 H;  1K3R A;  2D62 A;  4LFC L;  4BA2 I;  2RVL A;  4YCV A;  1CKN A;  4DV2 L;  1JJC B;  3RR5 A;  1E2V A;  1D7Q A;  3STB D;  1VQK A;  1SNO A;  4R1J A;  5G3L F;  1HQM C;  1YNN D;  4GZY C;  1SJH D;  1RKN A;  1PLF A;  5IGC A;  5EBC A;  1VQ6 A;  5ELC A;  2F1M A;  1L0Y B;  1EY9 A;  3W1G A;  2UXC L;  3FKI G;  3NTH A;  3KUP A;  2HQL A;  3LNN A;  3A5U A;  5JVG 3;  1QJO A;  2F0P A;  1TWH B;  4JI6 L;  3T53 B;  2SNM A;  4DR6 Q;  3I7F A;  3DM3 A;  3F2U A;  3Q0A A;  1XMO Q;  2DGY A;  1IYJ B;  1XTD A;  1JQY D;  2BDN A;  3H94 A;  3KBX A;  1HJP A;  2OTL A;  2DJG C;  2Y0S B;  4JI8 Q;  3I4L A;  3RNU A;  4PG3 A;  4K0K Q;  1JC7 A;  2YTY A;  5IYB G;  3P1H A;  5C4Z A;  2MPM A;  2I5L X;  3EJI A;  3FPP A;  2NTT A;  3I4N G;  3S15 B;  4Z9C B;  4G7O C;  2YV5 A;  1VQB A;  1O7Y A;  2DN8 A;  3D6W A;  4JK1 C;  5EKI A;  3E0J A;  3PUZ A;  4OIK A;  4A3K H;  2B3G A;  4BBS B;  4XDX A;  4A3G G;  3SDZ A;  2F0U A;  4JOI A;  5K36 G;  1DYQ A;  2WKC A;  4OON A;  1K8M A;  1M1K C;  5IP9 G;  1JOO A;  4C3I B;  1YBY A;  3FEW X;  2XRS D;  2NZO A;  4KHV A;  2N78 A;  1YJN A;  3I56 A;  1CFM A;  4C3J G;  4DV0 Q;  4OL7 A;  2OCE A;  1B8A A;  4BWG B;  4DV1 Q;  1UE1 A;  1I3Q H;  3DEO A;  1HZ9 A;  3K58 A;  1YI2 A;  1XPO A;  5M9O A;  4RG1 A;  1I94 Q;  4BBS H;  1WTO A;  4ZQ3 A;  1N32 L;  1IHZ A;  1VQI A;  4CDC C;  3CHB D;  4HMJ A;  1AW7 A;  4RGT A;  2IW3 A;  3MFY A;  2VS1 A;  4P73 A;  3A0J A;  4R8I A;  5FLM G;  1HNW L;  1XTC D;  4GKK Q;  1DD2 A;  1U4L A;  4HJ5 A;  5IE8 A;  4HID A;  2B8F A;  3ZJY C;  4DAV A;  4IJH A;  2FHT A;  1EUJ A;  1SRO A;  5D65 A;  2UUA Q;  3P20 A;  4A93 G;  1BKB A;  1K9M C;  4J15 A;  3OTO Q;  1TS2 A;  2EYF A;  3Q8D A;  4BBR G;  1TWG H;  1D1I A;  2EYL A;  5KNC A;  2RQX A;  4DAM A;  4R4I A;  4NPS A;  4CBV A;  1GUS A;  1NUC A;  1SJE D;  4MTK A;  3AU7 A;  3Q24 A;  3A8J E;  5M3F B;  1U5K A;  4DK1 A;  4CKE A;  1KNA A;  4RGN A;  1XMQ L;  4RGM A;  4ZKC B;  2I07 B;  4JI7 Q;  2MQH A;  4FVM A;  4KHZ A;  1I4X A;  4GNX B;  1TR5 A;  2J4X A;  3PGZ A;  4J6H A;  3TS0 A;  4U67 3;  1BBU A;  5IGF A;  1WCM G;  4C1N K;  1NJI C;  1NMG A;  2JA6 H;  1CM9 A;  1K0R A;  3NSW A;  4QMG A;  1SBB B;  2NTS A;  5IY0 A;  4X64 Q;  1HR0 L;  3HFZ B;  2UUB Q;  3ICE A;  4A3M B;  3QOJ A;  1DON A;  5C3E G;  1N34 L;  1Y8P B;  1ZEQ X;  1TT2 A;  4KI0 A;  3RMH A;  1LTG D;  4A3B B;  1A3U A;  3A7L A;  3TP6 A;  4OX9 Q;  3E5S A;  4O2D A;  1B44 D;  3T1H Q;  2UU9 Q;  4EQN A;  3ERO A;  3NBH A;  3H15 A;  3F2B A;  1LT3 D;  4RKB A;  2MFI A;  5M5W B;  3S9W A;  5DNF A;  3DWQ A;  4JW0 A;  4RH6 A;  1WTH A;  2AKW B;  2A1A A;  2X69 A;  5FO7 B;  3G6E A;  4A3M H;  5IWA L;  3S1R H;  4A3C H;  4DK3 C;  2VQE L;  1EWH A;  2L4N A;  1QB5 D;  1Q82 C;  1CHQ D;  4BY7 H;  3SEB A;  4TVA B;  1EQQ A;  1DJR D;  4JI4 L;  1EYC A;  3FDT A;  4A3F B;  2Q2H A;  2MNA A;  4QB4 A;  3E6Z X;  4OGQ C;  5CBA E;  1HUN A;  2N55 A;  5M5W H;  1B2T A;  4H0L C;  2R61 A;  1Z7T A;  1E22 A;  4L63 B;  1XX8 A;  2A6E C;  1G2T A;  1KDB A;  3OMC A;  2ASB A;  2JXM B;  3CCS A;  4RGO S;  4KHP L;  2ATW A;  1R9T H;  1Q8I A;  4JI3 L;  2AQ1 B;  4LF7 Q;  2DNE A;  2JYO A;  5ELO A;  2RDF A;  4E6I A;  1JOR A;  1EFW A;  1EQR A;  3C2P A;  5IT9 E;  4M8A A;  3M9B A;  1LTR D;  4YY3 L;  3FP9 A;  3U58 A;  4PNY A;  4Q0F A;  1MJC A;  2L0C A;  3K7A B;  2JA7 G;  2C9O A;  1Q7Y C;  4FF4 A;  1K0S A;  1QNU A;  4K6L A;  5GQO A;  5FJ8 H;  5C44 H;  1D8L A;  3I73 A;  1EZ6 A;  4XT3 B;  2B8G A;  3PSI A;  3P75 A;  1VQL A;  2JA8 G;  3SK8 A;  4DAY B;  1S5B D;  2NN6 H;  1V1P B;  4K6D A;  4OO1 G;  3FMC A;  1LTT D;  1VF5 C;  2RHQ B;  3I4O A;  4EVO A;  3HOV B;  2WII B;  4H7B A;  3UDX A;  4UDU C;  3PO2 G;  3MEH A;  5GAE C;  3H0G B;  1PHJ A;  2X6G A;  2ALY B;  3MXU A;  1V1Q A;  3H6M A;  3R93 A;  4X65 L;  3K7A H;  4YWL A;  3KDF A;  4ODG A;  2QKI C;  4IO9 A;  3OWF A;  1KAB A;  5I9P A;  3GTL B;  1TS3 A;  1FGU A;  3PUW A;  4HJ7 A;  3CCE A;  2PPB C;  3D6C A;  2B2Y C;  2IL8 A;  2NVT H;  5C4H A;  1RF2 D;  4NKL A;  1VQM A;  4R4C A;  3BDC A;  3H0G H;  2WAQ G;  2R3Z A;  2PO4 A;  1HZC A;  4HJ8 A;  1IBL L;  3KF6 A;  1NTG A;  3T51 B;  3KLS A;  4HSV A;  4NXN Q;  4IPD A;  3HGB A;  1VQF A;  5D14 A;  2KCT A;  3AQQ A;  1X9N A;  3RN2 A;  1Y8N B;  5C5M A;  2ZTD A;  2CW0 C;  1SSO A;  1ZYR C;  3S2H H;  4V19 0;  3BDL A;  1LTB D;  3C3L A;  4K2L A;  5C0X G;  2L15 A;  2PQA B;  1WTP A;  1LTL A;  1HZB A;  2CWP A;  3K0X A;  5I2Y A;  3ONA B;  2VW9 A;  5JPN C;  1IKL A;  1UAP A;  2K01 A;  1Y8O B;  3DEP A;  3G71 A;  2A6H D;  3CCM A;  2F0Q A;  1XNR L;  3CCV A;  3I70 A;  3OMG A;  4KJO A;  2FFK B;  5LHY 1;  1SFO H;  1S5F D;  5EKK A;  3W5O A;  3PF4 A;  1EIY B;  2WB1 E;  2C35 B;  1F77 A;  1P8L A;  1W2B A;  3RN5 A;  4QCL A;  3GTJ B;  2HHH Q;  2K4K A;  1ONL A;  2E5L L;  4CDE C;  1MIU A;  4IUR A;  4LJZ C;  5ELB A;  1A3T A;  2ZJP A;  1I6H H;  1EOV A;  5EPJ A;  2E2J H;  5LMN W;  1EY0 A;  3ITP A;  4IFD G;  1TWA H;  1FVI A;  3MXN B;  2NVQ H;  1I6V C;  1KAA A;  1XNQ Q;  2EJM A;  1Y14 B;  2C5C A;  4JI2 Q;  4YIJ A;  1V9P A;  5JJK A;  4DR1 Q;  1EOT A;  1OTC A;  2YYZ A;  5JJL A;  2K50 A;  3VYS A;  2E2H H;  4LF4 Q;  3BDO A;  1SAP A;  1B50 A;  1A8V A;  5I4D A;  1VQO A;  4DK6 C;  1II3 A;  4JYA L;  2I46 A;  1CKO A;  5CR3 A;  3EFX D;  3T16 A;  4AQY Q;  1G91 A;  4KTA A;  5AFW A;  5D3I B;  1GUN A;  5C6A A;  2JJQ A;  2L12 A;  2RSO A;  4FO2 A;  5AJ3 Q;  3CCU A;  3UDF A;  1A63 A;  2D0P A;  1FYC A;  4C3H B;  4YCU A;  1KDA A;  4C56 C;  1ICF B;  3HOZ B;  1YHA A;  1MD2 D;  5E4W C;  3HG9 A;  2F0J A;  1XJV A;  2NZ1 D;  4NDX A;  2B2U C;  1VS0 A;  2I5H A;  5CGK A;  2B63 B;  4YWM A;  1EQT A;  1QNK A;  4IOA A;  4DR3 L;  3FRP B;  1D5Z C;  2Q2T A;  1E1T A;  1VQJ A;  2IPK D;  2JA5 B;  1DCZ A;  5CC4 A;  5H1S E;  4J8Q A;  1V1O A;  3RLF A;  4HED A;  1ENF A;  3S2D B;  4ZAI A;  2NVX H;  3GV6 A;  3HOZ H;  1JWS D;  1CKM A;  1IL8 A;  2QDB A;  3K6O A;  3K8A A;  1D2B A;  1PYS B;  2OWO A;  1WVL A;  3QR8 A;  4S3S A;  2AQ2 B;  5LMN Q;  3S17 H;  4Y7N H;  1QOH A;  1SE4 A;  3GTG H;  3J80 c;  3PV0 A;  4GN4 B;  1BNZ A;  1GXD C;  4P72 A;  4X3K A;  3W1B A;  4DR7 L;  1WJJ A;  3NK9 A;  3OW2 A;  1I4Q A;  2G9D A;  3SE0 A;  5DAU A;  1E7Z A;  2H5X A;  4KJN A;  1NY4 A;  3CRL C;  1ROD A;  4FP5 D;  2N49 A;  1STB A;  1TQO A;  1N9W A;  3KJP A;  1W3S A;  2ZTE A;  2A68 C;  3HOW B;  2ZT9 C;  1C4Q A;  2BH2 A;  4X3U A;  4K8J A;  3KJO A;  3F2C A;  4BY1 B;  1SYF A;  2F0N A;  3AYH B;  2IX1 A;  4FDB A;  4XXE A;  1KC8 C;  3Q6S A;  3U9O A;  1F2L A;  1KXL A;  5CBE E;  3HOU B;  5C4X B;  1A6X A;  1BO0 A;  1AN8 A;  2J0T D;  4DNT B;  3MVV A;  4CDF C;  5IGE A;  1SND A;  1PYB A;  1PH7 A;  5KNB A;  1JR0 D;  3S1Q B;  1PRT B;  4RHS A;  3RZD H;  3NXW A;  4OWW B;  2QEJ C;  5I2X A;  1KRT A;  3I4M B;  4LF9 Q;  4X66 L;  2DNC A;  5A2Q E;  4LAA A;  4BY1 H;  1KQS A;  4BS9 A;  3CF5 A;  4CJ2 C;  3QIA A;  4JI1 L;  3L9A X;  3PO2 H;  3D3R A;  4ZKB B;  5M3F G;  2VUM G;  3HOU H;  2CW0 D;  5C4X H;  4JCV E;  1ZYR D;  4HIO A;  2V4D A;  4QIW E;  5FO8 B;  1C9O A;  3ULL A;  1WTW A;  1N33 Q;  1QUQ B;  3SHL A;  2Q8T A;  3M7G A;  1STN A;  3MXP A;  5F2D A;  2F3W A;  3UE1 A;  4CGY B;  4DV5 Q;  2MO1 A;  3PCO B;  1K8A C;  2LS0 1;  3IL8 A;  1IKM A;  2SOB A;  4A3D G;  2PCF B;  5L37 A;  3I4M H;  3OWE B;  1FNV A;  1PFM A;  5GAG C;  3D4D A;  2B2W A;  3SVM A;  1SMY D;  1I5F A;  3F8T A;  5IYD G;  3OPO A;  5M3M B;  4K8I A;  1PH9 A;  4A3B G;  1G6Z A;  4DUZ L;  2IHF A;  1YHB A;  3ULJ A;  1V8Q A;  4WFN 3;  3K59 A;  5BN4 A;  2UUC Q;  2Z6K C;  1Q12 A;  1BDO A;  5IP7 G;  1DM0 B;  1GUO A;  2HUG A;  1KAW A;  1HNZ Q;  3A56 A;  3MAQ A;  1CTM A;  4R4O A;  2GVB A;  5ELF A;  2MGS A;  1A2T A;  1J8I A;  1WOC A;  4QIW B;  2XWB B;  2KHI A;  3F2D A;  4EQO A;  3WOE A;  3D8G A;  5FKA C;  3OSO A;  1S5E D;  1EQV A;  3HP3 A;  4EQP A;  3MHB A;  1V43 A;  3G4S A;  2OEO A;  1YVC A;  3NQI A;  4IPC A;  2K32 A;  4LWC A;  4DXF A;  1M90 C;  2Y0S E;  4A3F G;  2K5H A;  4KY6 A;  2A19 A;  3CD6 A;  1L1O B;  3PIO A;  4L5T A;  4APV A;  4GN5 A;  2XVS A;  4DR4 L;  3CPW A;  4F7X A;  5BR8 Q;  5CV9 A;  2R93 G;  5BN5 A;  1LAB A;  2XN9 C;  3T1Y Q;  1QZG A;  1SYB A;  1K28 A;  4TRD A;  4DAY A;  1V1P A;  3J7Z C;  5FLX E;  5JAV A;  3I3C A;  3UE0 A;  4WOR A;  2J7Z A;  2K7V A;  2BA1 A;  2A69 C;  4JI0 Q;  4LNQ A;  2ENB A;  3M85 A;  4FYD A;  2K5D A;  4LUV A;  4A3K B;  2MUY A;  2N88 A;  1X56 A;  2B2T A;  3TRZ A;  1CZG A;  2MJ8 A;  4C2M H;  2ZXO A;  4DV7 Q;  2NZH A;  1PRT D;  4NXM Q;  1Y1V B;  3K80 C;  1ET6 A;  4A3E B;  4DV2 Q;  2Q8I B;  2E76 C;  4DK0 A;  2K5W A;  3PIP A;  4RAU C;  4JBK A;  4BXX G;  5JEA H;  1EFI D;  1F9R A;  1GUG A;  1I3Q B;  2JP1 A;  1X32 A;  5KIX A;  1EY8 A;  2XRQ D;  1JWU D;  2KCN A;  1PRT F;  2UXC Q;  1OXV A;  3U4V A;  2XWJ B;  3VR5 A;  3SK5 A;  1VQD A;  1Y1V H;  1YHQ A;  4A3E H;  4JI6 Q;  1GO3 E;  4JC0 A;  1A2U A;  4B9X A;  3H09 A;  3LX0 A;  5DM7 3;  2L1B A;  2A5H A;  2R92 G;  4QQB X;  3R3O A;  4EX5 A;  5M5Y B;  4A3L H;  1QE6 A;  2PQA A;  2AUK A;  2K33 A;  1Y69 U;  1TWG B;  1AP0 A;  4DR5 Q;  2AWO A;  3QG1 A;  1IBM L;  5COR A;  2A68 D;  4UP8 A;  3J80 L;  4ZK9 B;  4A3I B;  5CV4 A;  4OIJ A;  3JAM c;  1AEX A;  2O4X A;  1UEB A;  1Z47 A;  4A3J H;  1JOK A;  3AMU A;  5JEA J;  3I90 A;  1UE6 A;  1NR4 A;  1PV4 A;  4KN4 C;  3I55 A;  4ZRZ A;  1SN8 A;  5HGQ A;  1C7Y A;  2KEE A;  3ER0 A;  1FD7 D;  1K8O A;  3GTQ H;  1VF7 A;  1LTI D;  4KLK A;  1HR0 W;  2ZM6 L;  3L3O C;  1NMF A;  5M5Y H;  4ID6 A;  4DV4 L;  4RA8 A;  3GTP B;  3KF8 B;  1EYD A;  4PZ8 A;  1RIP A;  1B7Y B;  4HIK A;  2JA6 B;  5C5L A;  4F87 A;  5IYC H;  1YNX A;  2SEB D;  1W6K A;  3MC0 B;  4ALP A;  4A3I H;  3MXN A;  2F0V A;  4ME3 A;  4MNO A;  2B2W C;  2PZT A;  3CCQ A;  3HOY B;  1STE A;  2L9H A;  1WD1 A;  5EAY A;  2HDL A;  4GOP A;  1HNX L;  2UXD Q;  1G51 A;  1FNU A;  1JB7 A;  2F4I A;  1N32 Q;  3DM1 A;  1EIH A;  4QUC A;  4P75 A;  3K57 A;  2KCC A;  3GTP H;  3RD4 A;  1PFS A;  3EN2 A;  4QUF A;  4DGZ A;  1XXG A;  4CKB A;  1RCV D;  2FXQ A;  1HNW Q;  4B3M L;  1I50 H;  3S1R B;  2L11 A;  1PZK D;  3QB3 A;  2E2I H;  1S4Z A;  3HOY H;  1PDQ A;  4BY7 B;  1JT8 A;  2RDG A;  4KN7 C;  2K6A A;  2Z9H A;  1ILP A;  2KBN A;  3HKS A;  1XPR A;  2HD3 A;  5CV8 A;  3G48 A;  2K5Q A;  5EPL A;  4K5W A;  3S16 B;  3K5O A;  2WB1 G;  3CAM A;  3HOX G;  4RCN A;  4DR2 L;  3J7A F;  1CZW A;  3UDG A;  2QGQ A;  4FXG C;  3CC7 A;  3S14 B;  1S5D D;  3GTK H;  1LV9 A;  4AH6 A;  1EEF D;  3BYT B;  1R9T B;  2EPB A;  2ICE C;  5M5X H;  1DOM A;  1TVX A;  4UY8 C;  2YTV A;  3C1F A;  1B1Z A;  1LT6 D;  1HR0 Q;  3MWY W;  3S16 H;  4A3D H;  3RZO B;  1N34 Q;  3PO3 B;  2F0D A;  1PTO C;  1JE4 A;  4N9P A;  2AWN A;  3FHW A;  5KYL A;  1RD9 D;  5C44 B;  3PIP 3;  1L0X B;  4OHJ A;  4BA1 I;  3S14 H;  2JA5 G;  3SXH A;  1EZ8 A;  4CHT B;  2OTJ A;  3ND8 A;  2EXZ A;  1HUM A;  3FPU B;  1LT5 D;  1YNJ C;  3W2D A;  3K5N A;  4M1U B;  3URY A;  1EYG A;  5IP7 H;  4FXK C;  1HTL D;  4EGV A;  1F9P A;  1SYD A;  3TN2 A;  1Y1W H;  1J6Q A;  3TME A;  5EPK A;  5IWA Q;  1QVF A;  3RZO H;  3A55 A;  1SNQ A;  2QA4 A;  3PO3 H;  1W6J A;  3TSS A;  3VR3 A;  2PNR C;  1F2Z A;  1QZH A;  4JOI C;  4LF6 L;  5DEH A;  3PMF A;  2QF7 A;  1SE3 A;  5FK9 C;  3J81 c;  4JI4 Q;  4IUN A;  3E9H A;  4Y52 H;  1QVC A;  4UP7 A;  4V0B A;  4CKC A;  2NVT B;  2VQF L;  4RMF A;  2SNS A;  1Q86 C;  2EYH A;  3VDY A;  4XQJ A;  3WWV A;  4Q5V A;  3M4Y A;  3J80 E;  3PF5 A;  1FJG L;  2OT2 A;  3I72 A;  5HY6 A;  4XYQ A;  4IPH A;  4JG2 A;  4AYB E;  1DOL A;  2F4V L;  2PNH A;  1TXY A;  4JI3 Q;  1N36 Q;  4NXN L;  3VYU A;  2YTX A;  3FKI H;  2R6G A;  1MSG A;  1ZXT A;  3MA2 B;  5K5P A;  4MHE A;  4PMW A;  1U0L A;  4IUV A;  5KND A;  4X3T A;  3D4W A;  1BCP C;  3I91 A;  1IBK L;  3S2H B;  3CRK C;  5CYU A;  1VQ4 A;  1E3P A;  3GD7 A;  4A3G B;  1QUQ A;  5EBD A;  5IGD A;  4I7A A;  1UWV A;  4TKO B;  4B3S L;  2R7Z G;  3GP7 A;  2MHV A;  3GO5 A;  3NEL A;  4JVZ A;  1BBW A;  1SLJ A;  1SFO B;  5E7N A;  2QCP X;  2KED A;  5IYB H;  1TKW B;  2O2L D;  4K2K A;  3BVM A;  3HS0 C;  4B3R L;  1LT4 D;  5C4J B;  1OXU A;  2F0M A;  4AYB B;  4GOP C;  3I4N H;  3M7N A;  3KOJ A;  1B53 A;  4H44 C;  3T56 B;  1Q8K A;  1E24 A;  1Q90 A;  2FJ2 A;  1AFP A;  4DA2 A;  1PFB A;  2EOT A;  4UP9 A;  1QIL A;  1I6H B;  1PTO H;  3A5Z B;  4A3G H;  4F8M A;  4XQQ A;  3FVQ A;  2E2J B;  4IPG A;  4L5R C;  5K36 H;  1ENA A;  2E75 C;  1TWA B;  3QOL A;  5GAH C;  2NVQ B;  2KOL A;  5IP9 H;  2FIN B;  2SDF A;  1LYL A;  2CQO A;  1F9S A;  3JAM L;  1XNQ L;  1SNP A;  4C3J H;  1D5X C;  5C4J H;  3BU2 A;  3DHQ A;  1IBL Q;  2E2H B;  4DV3 Q;  2XGT A;  2F0I A;  1NAP A;  5KGU A;  4A93 B;  4ZUI A;  4PMC A;  4CJ1 B;  1SRU A;  4LF4 L;  2N3S A;  2PZW A;  4A75 A;  2DJF C;  2GN5 A;  1ICW A;  2D0O A;  4DV6 L;  2NBF A;  2XSC A;  4KV6 A;  4HSP A;  4N8X 1;  2F0H A;  3HEJ A;  5FLM H;  4JV5 L;  1A15 A;  1S5C D;  3NP8 A;  1S72 A;  1GKH A;  1PFN A;  2NVY B;  2K75 A;  4ZCK A;  2UXB Q;  3X3M A;  3OIQ A;  3KLS X;  1XNR Q;  4A93 H;  2AHO B;  4B9W A;  2WKD A;  4BBR H;  1WCM B;  3K81 C;  2B2V A;  3L7Z C;  4HJ9 A;  1VQ9 A;  1KTK A;  1MKH A;  3AB9 A;  2Z8L A;  1WYD A;  4FF1 A;  2BH8 A;  2A74 C;  3HKZ B;  5C3E B;  1XYI A;  4GKJ L;  4ULL A;  1STY A;  3LWU A;  1AH9 A;  1HQR D;  1D5M C;  1Z9F A;  3MZ5 A;  2E5L Q;  2NVX B;  2F0T A;  3MXG A;  3NHH A;  2ICI A;  2NVY H;  2XNA C;  4G4K A;  2HCI A;  3KBG A;  3VYR A;  4LUZ A;  3SK6 A;  1BBX C;  1TWF B;  2LXK A;  2Q2I A;  4UHV A;  3SK4 A;  2IX0 A;  1R4Q B;  1PH8 A;  1WCM H;  1ML0 D;  1QCB D;  1STA A;  3S17 B;  1H95 A;  4Y7N B;  4KKU A;  2RF4 A;  4HN7 A;  3GTG B;  3GTO H;  5C3E H;  1PTO D;  5LMN L;  4DUY L;  5LL6 S;  2MP1 A;  4B3T L;  4KKT A;  5KEE A;  1FR3 A;  2A6E D;  1AZP A;  1EY7 A;  2WAC A;  2PI2 A;  2Y0S G;  1SEB D;  5A35 A;  3ERQ A;  4JYA Q;  1X3E A;  3NBH B;  4LF8 L;  4O0A A;  1TWF H;  5IT9 c;  2B39 A;  4X6A H;  2EJF C;  2EYM A;  1WTX A;  3HRZ C;  2IJ0 A;  1UNS A;  1PTO F;  3KYH C;  2F0W A;  5LMU Q;  4LFA L;  4BBS G;  1DXM A;  4LF5 L;  4KK7 A;  3LWE A;  5KRU A;  1MI2 A;  2AQ3 B;  2EVB A;  4YCW A;  2EYP A;  1DOK A;  4C3I G;  2EDG A;  4DR3 Q;  1Q46 A;  4HAE A;  1I4R A;  2JA7 B;  1OXS C;  1EY4 A;  1GUW A;  3PQI A;  1EWC A;  2PMZ B;  3L0O A;  1TU2 B;  5ELD A;  1U4R A;  4MTN A;  5CV7 A;  1PH4 A;  4GLX A;  3RZD B;  3KF8 A;  4JI5 L;  1PH2 A;  4DU9 A;  1E2Z A;  4YHH Q;  1D6E C;  2F0L A;  1HHV A;  4FNF A;  4LF9 L;  2PQE A;  3PO2 B;  3QO2 A;  3J81 L;  2K5N A;  3IKJ A;  2RSN A;  4RHR A;  3EVQ A;  1J5E L;  4N8F A;  3VYT A;  4K5V A;  1BCP D;  4G7H C;  1M8A A;  1YEZ A;  4YWK A;  2JA7 H;  1JOQ A;  1OXX K;  2BOS A;  3ERS X;  4X62 L;  1KRS A;  5E4X A;  2F0S A;  4GNX A;  1H9J A;  4DAP A;  3IRB A;  2CH4 W;  2JA8 H;  2QEX A; 
#chains in the Genus database with same CATH homology
 2MO0 A;  2Q2H A;  2MNA A;  1ASY A;  2VZA A;  2UXC Q;  1OXV A;  5M5W H;  3U4V A;  3TQY A;  3CCJ A;  2HT1 A;  1LM0 A;  3CXC A;  1VQD A;  1Y1V H;  1JE5 A;  1E22 A;  1YHQ A;  4OXP A;  4A3E H;  4L5S A;  4JI6 Q;  1GO3 E;  4JC0 A;  2ASB A;  2E8G A;  4NB3 A;  3CCS A;  4KHP L;  2ATW A;  2V1C C;  1R9T H;  3BZC A;  4JI3 L;  3LGJ A;  4LF7 Q;  2JE6 I;  5ELO A;  1HH2 P;  2R92 G;  4QQB X;  1EFW A;  1O7I A;  4EX5 A;  1EQR A;  1KHI A;  1WI5 A;  4A3L H;  2PQA A;  4GN3 B;  1VQ5 A;  4GOP B;  3M9B A;  3GTJ H;  1X3F A;  2EQS A;  2VY3 A;  4YY3 L;  2AWO A;  3FP9 A;  4IJL A;  4DR5 Q;  2R7D A;  3U58 A;  1IBM L;  4UP8 A;  2Z0S A;  4A3M G;  1MJC A;  2JA7 G;  2I0Q A;  2CKZ B;  1Q7Y C;  3JAM c;  4DV6 Q;  5GQO A;  5FJ8 H;  3STB C;  5C44 H;  2Z6K A;  1D8L A;  1UEB A;  4EQ5 A;  1Z47 A;  4A3J H;  4BY7 G;  5JEA J;  3KF6 B;  1UE6 A;  3PSI A;  1PV4 A;  1VQL A;  4OWX B;  2JA8 G;  3M4O H;  2HIV A;  4DAY B;  5JEA G;  3J81 i;  3I55 A;  2R7Z H;  3CCR A;  4JV5 Q;  4LFB L;  4P74 A;  1T9H A;  4X66 Q;  1SN8 A;  4MZ9 A;  5HGQ A;  4A3K G;  1C7Y A;  4OO1 G;  3JC6 6;  3ER0 A;  2RHQ B;  2JK8 A;  3I4O A;  3GTQ H;  3UDX A;  4JI1 Q;  4KLK A;  2JQO A;  2PMZ E;  1CUK A;  1HR0 W;  4DPG A;  2ZM6 L;  2CCZ A;  1NMF A;  5M5Y H;  5GAE C;  1KIX A;  5LMU L;  4DV4 L;  1PHJ A;  2ZTC A;  2ALY B;  3KF8 B;  4PZ8 A;  1RIP A;  1B7Y B;  4HIK A;  1V1Q A;  1P16 A;  1Y1V G;  5IYC H;  1YNX A;  4X65 L;  4A3E G;  2F3I A;  3SGI A;  2AMC B;  3M4Q A;  4ALP A;  3K7A H;  4A3I H;  2BA0 A;  3KDF A;  4YWL A;  4MNO A;  4ME3 A;  2XTI A;  2JEB I;  4IO9 A;  4GKJ Q;  3HOX H;  2HIX A;  3CCQ A;  3GTM H;  1FGU A;  3PUW A;  3D0F A;  3PUX A;  4A3L G;  4QL5 A;  4HJA A;  4WJ3 M;  1X65 A;  4HJ7 A;  5EAY A;  4GOP A;  4C3H H;  3CCE A;  1HNX L;  1UE7 A;  2UXD Q;  1G51 A;  1JB7 A;  2NVT H;  1N32 Q;  3TS2 A;  4OO1 I;  4P75 A;  4DR6 L;  1SMX A;  4YHH L;  1VQM A;  1YIT A;  3A74 A;  4R4C A;  3H0G H;  1G6P A;  3GTP H;  2WAQ G;  1HZC A;  1XMO L;  4HIM A;  1PFS A;  4A3J G;  4DUZ Q;  1S3O A;  3EN2 A;  4HJ8 A;  1IBL L;  1KD1 C;  2K14 A;  3KF6 A;  1NTG A;  2RHS B;  2FXQ A;  1HNW Q;  4DV7 L;  2NN6 G;  4B3M L;  1I50 H;  4A4I A;  2B63 H;  1DGS A;  4JI8 L;  4NXN Q;  3CCL A;  4DUY Q;  4IPD A;  3J7A 5;  3DLL A;  1VQF A;  3HOY H;  2E2I H;  3S1N H;  4K0K L;  4B3T Q;  3J80 i;  2KCT A;  3AQQ A;  1X9N A;  2F52 A;  2JA5 H;  2WAQ E;  3RN2 A;  2PI2 E;  1JT8 A;  2I5M X;  3M3Y H;  2ZTD A;  5IYC G;  1BVS A;  3S2D H;  4LUO A;  2KBN A;  3HKS A;  1XPR A;  4A3I G;  1JJ2 A;  3S2H H;  3G48 A;  3NEN A;  5C0X J;  4LF8 Q;  3TEH B;  2WB1 G;  5C0X G;  2A8V A;  4A76 A;  3CAM A;  3HOX G;  2L15 A;  2PQA B;  4DR2 L;  1LTL A;  1HZB A;  2CWP A;  1AE3 A;  3K0X A;  4GLA C;  3UDG A;  1K73 C;  4GLV B;  4QY7 A;  2VW9 A;  1VQH A;  2QGQ A;  3CC7 A;  1E1O A;  1XNR L;  3CQZ H;  3GTK H;  3G71 A;  3CCM A;  4LFC Q;  4AH6 A;  3CCV A;  1X3G A;  1SFO H;  4LFA Q;  5M5X H;  3HOV G;  3W5O A;  3PF4 A;  1QVG A;  1EIY B;  1N33 L;  2WB1 E;  2C35 B;  1P8L A;  4LF5 Q;  4UY8 C;  1W2B A;  3H0G G;  4DR4 Q;  4DV0 L;  1XPU A;  3RN5 A;  2YTV A;  2JA6 G;  4DR7 Q;  2HHH Q;  4DV5 L;  1EIF A;  1HR0 Q;  2K4K A;  3BZK A;  3EBE A;  4DV1 L;  5J3B A;  3K7U C;  3UDI A;  4R4Q A;  1YIJ A;  2E5L L;  3S16 H;  1MIU A;  1N34 Q;  4BXX G;  4H02 A;  4DR5 L;  4A3D H;  1UE5 A;  5GAD C;  1VQC A;  2ZJP A;  3HOY G;  1I6H H;  2AWN A;  3FHW A;  1I94 L;  1VQN A;  2GVA A;  1KL9 A;  4TQU S;  5C0X I;  4IFD J;  1EOV A;  2E2J H;  4BA1 I;  5LMN W;  3S24 A;  3S14 H;  2JA5 G;  1VCI A;  4IFD G;  4R4T A;  2OTJ A;  1TWA H;  4UPA A;  4JI5 Q;  1FVI A;  1S40 A;  3MXN B;  3KDF B;  2NVQ H;  1Q1B A;  2JEA I;  4AIM A;  5ELN A;  1XNQ Q;  1Y14 B;  2JA9 A;  3HOW H;  1CSP A;  1TWH H;  4JI2 Q;  1L0W A;  1YJW A;  2UUC L;  1V9P A;  2DUD A;  4GKK L;  1EYG A;  5JJK A;  4QJF A;  4GNX C;  4DR1 Q;  5IP7 H;  1OTC A;  1L1O C;  2YYZ A;  4OWT B;  5JJL A;  2K50 A;  3PUV A;  1J5E Q;  1SR3 A;  1HNZ L;  1Y1W H;  2E2H H;  4JBM A;  1J6Q A;  1PH1 A;  2UUA L;  4LF4 Q;  1OXT A;  4JBW A;  3OTO L;  5IWA Q;  4PZ7 A;  1QVF A;  2KCM A;  1A8V A;  3RZO H;  1VQO A;  4DK6 C;  2QA4 A;  4A3C G;  3PO3 H;  4L5Q A;  4JYA L;  3AFQ A;  1CKO A;  3D31 A;  1QZH A;  4AQY Q;  4JOI C;  4X62 Q;  4LF6 L;  1CSQ A;  3PUY A;  4P71 A;  1YJ9 A;  4XTC S;  1WFQ A;  2JJQ A;  2K5V A;  4JI4 Q;  5AJ3 Q;  3J81 c;  3UDF A;  3CCU A;  1A63 A;  1GM5 A;  2D0P A;  3S1Q H;  4AYB G;  4IFD I;  3E9H A;  3S15 H;  4Y52 H;  1QVC A;  2CFM A;  4YCU A;  4UP7 A;  2VQF L;  1VQ8 A;  2VL6 A;  1IL2 A;  1YHA A;  4RMF A;  2UXD L;  3CME A;  1PA6 A;  1Q86 C;  4JI7 L;  2K52 A;  3VDY A;  2ES2 A;  3WWV A;  1IZ6 A;  2EXD A;  3PF5 A;  5HY6 A;  1XJV A;  1G29 1;  1FJG L;  3GDE A;  1Q1E A;  1VS0 A;  4IPH A;  1VQ7 A;  2I5H A;  3H3V H;  4JG2 A;  1X6O A;  4AYB E;  5BR8 L;  2WP8 J;  2F4V L;  4C3I H;  4YWM A;  4IOA A;  3NEM A;  2PNH A;  3T1Y L;  4DR3 L;  1TXY A;  2UUB L;  4X64 L;  4JI3 Q;  3L2P A;  1N36 Q;  1TWC H;  4WJ4 A;  2Q2T A;  1E1T A;  1VQJ A;  3CW2 C;  4JBJ A;  4NXN L;  2IHE A;  1IXR A;  2YTX A;  3FKI H;  2R6G A;  5H1S E;  3RLF A;  3CP0 A;  4DKA C;  1Y1W G;  1IBM Q;  2RCN A;  4PMW A;  1U0L A;  4LW1 A;  4OX9 L;  2NVX H;  1SE8 A;  1IBK L;  1FL0 A;  1ASZ A;  3HOZ H;  2IT1 A;  1VQ4 A;  1E3P A;  3PO3 G;  1B70 B;  3GD7 A;  1CKM A;  3T1H L;  2UU9 L;  4JI0 L;  5FJ8 G;  3CC2 A;  5JJI A;  2N8N A;  5C44 G;  3K8A A;  1QUQ A;  1PH5 A;  3CPF A;  1PYS B;  2YU9 H;  2OWO A;  4LFB Q;  5M3M H;  1UWV A;  2R7Z G;  4B3S L;  1C0A A;  4QGU A;  1VQA A;  3GO5 A;  3NEL A;  4NXM L;  5LMN Q;  1BBW A;  1K83 H;  1SLJ A;  4Y7N H;  1K3R A;  2D62 A;  5E7N A;  3S17 H;  4LFC L;  2ZJQ A;  4BA2 I;  5IYB H;  4YCV A;  1CKN A;  3J80 c;  4DV2 L;  1JJC B;  3GTG H;  3RR5 A;  2ZM6 Q;  1D7Q A;  3STB D;  4DV4 Q;  3PV0 A;  1VQK A;  4GN4 B;  4B3R L;  4R1J A;  3KFU A;  1MJE A;  4POG A;  1OXU A;  4GOP C;  3I4N H;  3E0E A;  3M7N A;  3KOJ A;  1Q8K A;  4P72 A;  3W1B A;  1E24 A;  4DR7 L;  1VQE A;  1WJJ A;  1RL2 A;  3OW2 A;  1VQ6 A;  4UP9 A;  1NE3 A;  1Q81 C;  3A5Z B;  1E7Z A;  1GVP A;  2H5X A;  3HKZ G;  4A3G H;  1NY4 A;  3W1G A;  2UXC L;  4IPG A;  4L5R C;  3FKI G;  1XMQ Q;  2N49 A;  5M3F H;  4DNI A;  1N9W A;  2HQL A;  5GAH C;  3KJP A;  2VUM H;  3A5U A;  1HNX Q;  5IP9 H;  1W3S A;  2ZTE A;  1HZA A;  1JJG A;  1LYL A;  3OYY A;  1GD7 A;  4JI6 L;  3HOZ G;  2CQO A;  3CMA A;  4DR6 Q;  3I7F A;  2BH2 A;  3KJO A;  3F2C A;  1XNQ L;  3RLO A;  4C3J H;  3DM3 A;  1XMO Q;  2DGY A;  1IYJ B;  5C4J H;  1XTD A;  3BU2 A;  4LF7 L;  3AYH B;  1IBL Q;  2IX1 A;  1HJP A;  4FDB A;  4DV3 Q;  2XGT A;  4IOC A;  1KC8 C;  3J81 j;  2OTL A;  4B3M Q;  1L2F A;  1KXL A;  4JI8 Q;  2B63 G;  1SRU A;  3RNU A;  4PG3 A;  4LF4 L;  3H3V I;  3F1Z A;  2N3S A;  4K0K Q;  2YTY A;  1EWI A;  3RLN A;  5IYB G;  1AE2 A;  4A75 A;  2GN5 A;  5DLQ E;  2I5L X;  2D0O A;  4DV6 L;  1PYB A;  1PH7 A;  5IYD H;  4A3B H;  2ID0 A;  5GRO A;  3I4N G;  3M4P A;  3RZD H;  5FLM H;  2YV5 A;  4OWW B;  4GS3 A;  5FLX c;  4JV5 L;  1VQB A;  1KRT A;  1S72 A;  4LF9 Q;  3PUZ A;  4X66 L;  4A3K H;  1GKH A;  2B3G A;  4DR2 Q;  2K75 A;  4BY1 H;  2UXB Q;  1KQS A;  4A3G G;  3CF5 A;  4JI1 L;  3PO2 H;  4JOI A;  1XNR Q;  4A93 H;  5K36 G;  2AHO B;  3I2Z A;  5M3F G;  4OON A;  4BBR H;  2VUM G;  3HOU H;  2CWA A;  3K81 C;  5IP9 G;  1M1K C;  1N8R C;  5C4X H;  3CC4 A;  4JCV E;  1YBY A;  3L7Z C;  4HJ9 A;  4HIO A;  1VQ9 A;  2VQE Q;  1PH3 A;  1MKH A;  4QIW E;  2NZO A;  1C9O A;  3ULL A;  1WYD A;  2N78 A;  1QUQ B;  3I56 A;  1YJN A;  1N33 Q;  2BH8 A;  2LSS A;  4GKJ L;  4DV0 Q;  1N36 L;  2OCE A;  3UE1 A;  1B8A A;  2R7F A;  4DV5 Q;  1PH6 A;  1AH9 A;  2MO1 A;  3PCO B;  1K8A C;  1Z9F A;  2E5L Q;  4DV1 Q;  1UE1 A;  1I3Q H;  1CKN B;  4A3D G;  4A3F H;  3I4M H;  1HZ9 A;  2OQK A;  1YI2 A;  1XPO A;  3S1M H;  2NVY H;  4RG1 A;  5GAG C;  1I94 Q;  4BBS H;  2OQ0 A;  4LUZ A;  1N32 L;  1VQI A;  3AEV A;  1I5F A;  3F8T A;  2LXK A;  3JAM i;  2Q2I A;  2IX0 A;  5IYD G;  1PH8 A;  1WCM H;  1PH9 A;  4A3B G;  4DUZ L;  2VS1 A;  2IHF A;  1YHB A;  3ULJ A;  2R93 H;  4P73 A;  4KHP Q;  3HOW G;  3A0J A;  1H95 A;  5FLM G;  1HNW L;  2UUC Q;  2RF4 A;  4GKK Q;  2Z6K C;  4HJ5 A;  5IE8 A;  1Q12 A;  5C3E H;  3GTO H;  3EIV A;  5LMN L;  4DUY L;  4HID A;  5IP7 G;  4BY1 G;  4PZ6 A;  3ZJY C;  2EIF A;  1KAW A;  4IJH A;  1HNZ Q;  4YY3 Q;  2KHJ A;  4B3T L;  1EUJ A;  1SRO A;  2UUA Q;  4A93 G;  4R4O A;  1BKB A;  2GVB A;  3E9I A;  4J15 A;  3Q8D A;  3OTO Q;  1VQG A;  1K9M C;  4BBR G;  1TWG H;  2PI2 A;  2Y0S G;  1WOC A;  4POF A;  3HOU G;  4DAM A;  2KHI A;  4JYA Q;  3F2D A;  4R4I A;  4NPS A;  5C4X G;  1X3E A;  4LF6 Q;  3NBH B;  4LF8 L;  4O0A A;  1TWF H;  1YZ6 A;  5IT9 c;  4X6A H;  1V43 A;  3TRE A;  1X55 A;  3G4S A;  1U5K A;  4IPC A;  1YVC A;  1X54 A;  4LWC A;  2WFW A;  1XMQ L;  1M90 C;  2Y0S E;  2VQF Q;  3KYH C;  4A3F G;  2K5H A;  3I4M G;  2A19 A;  4JI7 Q;  5LMU Q;  4LFA L;  4BBS G;  2MQH A;  3CD6 A;  3HOV H;  4KHZ A;  4GNX B;  1L1O B;  3PGZ A;  3PIO A;  4LF5 L;  1FJG Q;  4L5T A;  4APV A;  4X65 Q;  4GN5 A;  1VQP A;  4DR4 L;  3TS0 A;  4YCW A;  3CPW A;  4BXX H;  1BBU A;  3B6Y A;  1WCM G;  4XIG S;  5BR8 Q;  1NMG A;  1NJI C;  2F4V Q;  2JA6 H;  2R93 G;  3ULP A;  1K0R A;  3T1Y Q;  5IY0 A;  4DR3 Q;  4DV3 L;  1QZG A;  4X64 Q;  1HR0 L;  3HFZ B;  2HHH L;  2UUB Q;  2B29 A;  1A62 A;  3ICE A;  1Q46 A;  5C3E G;  1OXS C;  3J7Z C;  1N34 L;  3U50 C;  3UE0 A;  3L0O A;  4KI0 A;  3GTL H;  2Q2U A;  4OX9 Q;  4MTN A;  1PH4 A;  1IBK Q;  2BA1 A;  4GLX A;  1PH2 A;  4O2D A;  4JI5 L;  4YHH Q;  4JI0 Q;  4LNQ A;  3T1H Q;  2UU9 Q;  3M85 A;  2IY5 B;  4LUV A;  4JI2 L;  3HKZ E;  3H15 A;  3F2B A;  2R92 H;  1X56 A;  4LF9 L;  3TRZ A;  2LXJ A;  2MFI A;  4C2M H;  4DR1 L;  2K5N A;  4DV7 Q;  5M3M G;  2NZH A;  4B3S Q;  2UXB L;  2ZJR A;  4NXM Q;  3PO2 G;  1J5E L;  2AKW B;  3K80 C;  3BJU A;  3U4Z A;  2A1A A;  1NBW A;  3G6E A;  4A3M H;  5IWA L;  1YEZ A;  4DV2 Q;  4YWK A;  1PVO A;  2JA7 H;  3S1R H;  1JMC A;  3KLW A;  4A3C H;  1OXX K;  2KEN A;  2NN6 I;  3MEF A;  4DK3 C;  4B3R Q;  2VNU D;  3ERS X;  2VQE L;  4AQY L;  4X62 L;  1KRS A;  3AFP A;  4GNX A;  1Q82 C;  1K8G A;  4BY7 H;  1L1O A;  3IRB A;  1LUZ A;  4TVA B;  3PIP A;  1EQQ A;  2JA8 H;  2QEX A;  1A0I A;  4JBK A;  4JI4 L;  5AJ3 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...