4GOPB

Structure and conformational change of a replication protein a heterotrimer bound to ssdna
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
130
structure length
122
Chain Sequence
b'NTLRPVTIRQILNAEQPHPDAEFILDGAELGQLTFVAVVRNISRNATNVAYSVEDGTGQIEVRQWLDASEIRNNVYVRVLGTLKSFQNRRSISSGHMRPVIDYNEVMFHRLEAVHAHLQVTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure and conformational change of a replication protein A heterotrimer bound to ssDNA.
pubmed doi rcsb
source organism Ustilago maydis
molecule tags Dna binding protein/dna
total genus 29
structure length 122
sequence length 130
chains with identical sequence Y
ec nomenclature
pdb deposition date 2012-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gopB00
4IO9A 4BXXG 2NZHA 3TS2A 2AHOB 1KAWA 2NVYH 1HZBA 4GN4B 4A4IA 1YJNA 3D31A 1KQSA 1OXVA 2WAQE 4JCVE 1YEZA 3G6EA 4OX9L 1RIPA 4DV5Q 1HNWL 4DKAC 4GLAC 3KFUA 4JYAQ 5C4XG 1PFSA 1H95A 5IP9H 2N8NA 2JA9A 4JG2A 4DR4L 4DR6Q 2JA7H 4LF5Q 3E9HA 1HNZQ 3I56A 5FJ8G 1U0LA 1K8GA 2RCNA 4A3JG 1OXSC 4X65Q 1YITA 3PGZA 3OTOQ 5ELNA 3G4SA 4A3KG 1VQBA 2E5LQ 2VUMG 4JI6L 3CMAA 1NMFA 3S17H 2VS1A 1WFQA 1WJJA 2I0QA 4POGA 1XPOA 4LF9L 4APVA 5IP7G 1MJCA 2JJQA 4GN5A 2ASBA 2UXCQ 2Z6KC 1RL2A 4POFA 1BBUA 4B3TQ 1B8AA 2H5XA 2WB1G 3CC7A 3PUYA 2JQOA 1TWAH 1VQEA 1S72A 3B6YA 4NXNL 4B3SL 4IFDJ 1PH1A 2JE6I 2R7FA 4OONA 4OWXB 1L2FA 4KI0A 1N36Q 2JK8A 4DV1L 1VQ6A 3JAMc 1CSPA 4A76A 1M1KC 2NN6I 5FLMG 2EXDA 2A19A 1FJGQ 4P74A 4B3MQ 2HT1A 5H1SE 3S14H 4HIOA 3CCUA 1KRSA 5M5WH 1N32L 4P73A 4JI1Q 3UE1A 4A93H 1K83H 3HOXH 3FKIG 3CCMA 1Q7YC 2KBNA 3MXNB 3GTOH 1IYJB 4GKJL 1I6HH 5JJIA 3GTQH 3E9IA 4DV2L 1EYGA 2Q2IA 1XMOQ 4A3GH 5AJ3Q 1JE5A 1HZAA 3PUWA 4JI3L 2YTXA 4DUZL 1JT8A 4LUZA 1JJ2A 4NPSA 2ZM6Q 2ZTEA 1IBLL 4LF7L 4KHPQ 1S3OA 1J5EL 1NE3A 1I94L 4NB3A 2A1AA 2OWOA 4LF8L 2I5HA 2Z6KA 3CP0A 3K0XA 4LWCA 1R9TH 3WWVA 3S1RH 2OQKA 3BZKA 2BH8A 4GS3A 3TQYA 1K9MC 4JI4L 3M4OH 2OTJA 4YCWA 3CPWA 1HNWQ 1VQMA 3HOYG 2R93H 4LF4L 4A93G 4YCUA 1TWFH 3HOXG 5JJLA 2CQOA 4LFBL 3HKZG 3I4MH 3EBEA 2KCTA 3S15H 2ATWA 2R7ZH 3S2DH 4JI0Q 4A3GG 1Q46A 4MTNA 1AE2A 4JI2Q 1N34L 1SMXA 1GKHA 4IOAA 1UWVA 2DGYA 3PSIA 4AH6A 1HR0L 2VY3A 4QIWE 1IBKL 4PZ6A 2IX1A 3AFQA 2C35B 1UE5A 1LUZA 1B7YB 3CXCA 1U5KA 3HOUH 4OWTB 5E7NA 2R92H 2YV5A 4PZ8A 4HIDA 5IYDH 4DV7L 1KD1C 3I2ZA 1P8LA 1PA6A 4DV3L 4X66Q 1MJEA 2R7ZG 4IJHA 3LGJA 1C0AA 4AYBG 1P16A 4R4IA 5IWAQ 5IYBG 4WJ3M 4L5SA 1WCMH 4BY7H 2IX0A 2ZTDA 2JA6G 3A5UA 2OTLA 1CKOA 2Q2HA 2Y0SE 3A5ZB 4K0KL 2RHQB 3I4OA 3L7ZC 2VNUD 4LF6L 3CCRA 3ULLA 1XTDA 4P71A 1N32Q 4YWKA 3DLLA 1VS0A 2WAQG 4YY3Q 3CCVA 4IOCA 1PV4A 4LFCQ 3HOUG 2HIVA 1E1OA 4JV5Q 4GKJQ 2MO1A 3T1HL 2R92G 4R4CA 3KF8B 3D0FA 4Y7NH 5M3FH 4DV2Q 1VQDA 5IYDG 5GADC 3BU2A 4MZ9A 4QL5A 1IBMQ 4JI3Q 1E22A 4DUZQ 4DV6Q 3CC2A 1YHAA 3RZOH 1WCMG 3RLNA 4BY7G 4A3DH 2E2IH 1I5FA 3CPFA 4LW1A 4QY7A 4IJLA 3G71A 1SN8A 2I5MX 3PIOA 4C3HH 4NXML 1Q1BA 3CQZH 2NVXH 1YVCA 5LMNQ 2JEBI 4XTCS 2KCMA 4JI4Q 2UXBL 2YTVA 1EQRA 5LMUL 5IY0A 3UDXA 4YHHQ 1UE6A 3TRZA 1ASZA 5C3EH 1L1OA 3W5OA 4LFBQ 5IYCH 3PF5A 2UU9L 1SLJA 1VQFA 4BA2I 1VQ4A 3K7UC 3TEHB 1XNQQ 4R4OA 2VQEQ 3KJPA 3KOJA 2ZJPA 5M3MH 2UUBQ 4Y52H 2QA4A 3RNUA 3U4ZA 3M85A 1PH5A 2XTIA 3GO5A 4A3DG 4JBJA 4GOPA 4DV0L 1N33Q 1AE3A 2EQSA 2EIFA 2IHEA 1IBKQ 2UXDL 4BBRH 1FVIA 1O7IA 2K75A 3SGIA 4C3IH 2NZOA 4LFAL 3DM3A 2PI2E 3J81j 3S24A 5C3EG 4JBKA 5IP9G 5IYCG 2YTYA 1SFOH 1EFWA 2E2HH 2JA7G 2N3SA 3J80i 5GAGC 1XNRL 2JA5H 3PF4A 4WJ4A 1AH9A 1CKMA 1KXLA 4DV4L 1Y1WH 3PO3H 1DGSA 1UE1A 4GLVB 3KF6A 1I50H 1YJWA 5M3MG 2B3GA 1PH9A 4GKKQ 2VQFQ 3FP9A 1Z47A 4DR3L 3K7AH 2AWOA 1X55A 4LF6Q 1Y14B 1Z9FA 3H0GH 3KLWA 1A62A 2LSSA 4BBRG 2BH2A 1E7ZA 2ZJRA 4JI8L 1J6QA 1VQ7A 2UUAL 5JJKA 4UP7A 4DR5L 4JI5L 1W2BA 3S16H 1KRTA 1VQNA 1VQ8A 3S1NH 2KHIA 3L0OA 2R6GA 1L1OB 1BKBA 2D0OA 3F8TA 2VL6A 2JA5G 1K73C 4PZ7A 5LMNW 4GNXC 2OCEA 5GAEC 4X64L 4HJAA 1Y1WG 3PO3G 4B3RQ 1X54A 2K5HA 4DR2Q 3K8AA 5J3BA 1Q8KA 2LXKA 3PIPA 4L5QA 1EQQA 1TWCH 2A8VA 1HH2P 1W3SA 3H3VH 4YWMA 5ELOA 3H3VI 5C0XJ 4DUYL 3J7ZC 1C7YA 4OX9Q 3H0GG 1N8RC 4H02A 5DLQE 1PH4A 4PMWA 3W1GA 4X62L 3UDGA 3U50C 1HR0W 1MIUA 1YNXA 3RLFA 1LM0A 1HNXL 2HQLA 4MNOA 4R1JA 4YWLA 4DNIA 1IL2A 3CC4A 1GVPA 4LNQA 3NBHB 3ICEA 1EOVA 4JI6Q 2ALYB 4KHZA 3NENA 2Y0SG 5IT9c 3UDFA 3OW2A 1QVFA 4A3MH 4LF9Q 4R4QA 1VQOA 3S1QH 4BA1I 2UXDQ 4DV5L 2BA0A 4LFAQ 3TS0A 4L5RC 4JYAL 2ID0A 2PMZE 1PH2A 2R93G 4DR6L 5JEAJ 3RN5A 3ULPA 4B3SQ 4AQYL 4LF5L 4NXNQ 3AQQA 3GDEA 2VW9A 5FLXc 4QGUA 4GNXA 1HNZL 3I4MG 1GD7A 5C0XI 1TWHH 2DUDA 3ULJA 4DV4Q 1XMQL 5GROA 3HKSA 4DV1Q 4X65L 1SROA 4DR1L 4O0AA 3OTOL 4KLKA 2E5LL 1VQLA 4A3EH 1OTCA 4UY8C 2XGTA 1IXRA 3CAMA 4DR3Q 4J15A 4JOIC 4LUOA 3HOZH 1YZ6A 1QZHA 5GAHC 2OQ0A 5BR8L 4BBSH 4A3MG 2BA1A 4FDBA 1VQ5A 2UXCL 2PQAA 4B3TL 3RN2A 1SRUA 4A3LH 3J7A5 3S2HH 1VCIA 4DR5Q 1M90C 4DK3C 4JI5Q 1G291 1NY4A 3STBD 2QGQA 4PG3A 3J80c 3U4VA 3CCJA 2E8GA 3I55A 5C0XG 2KENA 3H15A 4DR2L 1VQ9A 4R4TA 2D0PA 3GTJH 4JI7L 3CMEA 2NVTH 4BXXH 2FXQA 4X64Q 1BVSA 1HZ9A 4RG1A 1IBLQ 4LF7Q 3W1BA 1J5EQ 1I94Q 3K81C 4B3ML 4EX5A 5K36G 4ALPA 2MO0A 5C4JH 3UE0A 1KL9A 5M5XH 4LF8Q 1A63A 1G6PA 4BY1H 3TREA 4XIGS 2Q2UA 3UDIA 4IPGA 3HOZG 3VDYA 2Z0SA 4JI1L 4BBSG 4HJ8A 4JBMA 1HZCA 1EWIA 1PYSB 2GVBA 4LF4Q 1PH8A 1E1TA 2CFMA 3RR5A 4A3LG 1VQAA 1SE8A 1XMOL 1NTGA 5FJ8H 5AJ3L 1FGUA 5M3FG 2JA8H 4GN3B 3AFPA 1K3RA 1PVOA 1N34Q 2I5LX 2L15A 1HNXQ 1XPRA 4EQ5A 4P72A 4A3KH 1BBWA 2WFWA 4L5TA 2B29A 1E24A 3PUZA 4IPHA 4JOIA 1MKHA 5JEAG 1T9HA 1VQJA 3BJUA 1CKNA 3T1YL 1HR0Q 1VQGA 2MNAA 3KJOA 1JB7A 1NJIC 1Q86C 5IP7H 1QUQA 4BY1G 2F3IA 3J81c 2HIXA 3CCLA 1WOCA 2K4KA 3PUXA 4A75A 1XJVA 2PQAB 4DV7Q 4AQYQ 2AWNA 1PH6A 2NVQH 4JI0L 4DV3Q 1V1QA 1YHQA 2JA8G 4JI2L 3I7FA 2UUCL 1X3GA 1XMQQ 5GQOA 2HHHL 3A74A 1CSQA 5FLMH 2CWPA 4DR1Q 1VQPA 1NBWA 3HFZB 1L0WA 4UPAA 2RHSB 4DR7L 3CD6A 1Q12A 4K0KQ 3CCQA 2IY5B 2VZAA 1IZ6A 3F2CA 1X3FA 2K50A 4TQUS 2N49A 5BR8Q 2MQHA 2R7DA 1UE7A 3FKIH 1VQKA 4DAYB 1JMCA 2AMCB 3G48A 1X56A 2ZTCA 4HJ7A 1OXXK 2D62A 3T1HQ 3EN2A 2B63H 3GTLH 1OXTA 4A3FH 2F4VL 3NELA 4X66L 3GTMH 1YJ9A 5IWAL 3OYYA 1JJGA 1QVCA 1X6OA 4A3IH 4JI7Q 1ASYA 1QZGA 2JEAI 4HIKA 2YU9H 3F2BA 5C44H 3M9BA 4NXMQ 4OWWB 1I3QH 3F1ZA 4A3BH 3U58A 1CKNB 2UXBQ 4GOPB 4UP8A 5LMUQ 3HOYH 4YY3L 3J81i 2RF4A 2WB1E 3KDFA 3EIVA 4LFCL 4JV5L 1X65A 1QUQB 1Q81C 3GTGH 1A0IA 2GN5A 2UU9Q 2IT1A 3PV0A 1YIJA 2B63G 4OO1I 3ERSX 1KC8C 4A3FG 1HJPA 1LTLA 4YCVA 1FL0A 1IBML 4ME3A 4JBWA 4DV6L 3A0JA 1PH3A 4A3IG 1S40A 1PHJA 2NN6G 4IPDA 1XPUA 2N78A 2F52A 1EUJA 4IFDI 4GLXA 3CCSA 2CKZB 3KF6B 3T1YQ 4DV0Q 1QVGA 3E0EA 5C44G 1OXUA 4C3JH 5LMNL 1Q1EA 3F2DA 3RLOA 4A3BG 3AYHB 4IPCA 1KIXA 3PUVA 4YHHL 4X6AH 2LXJA 4O2DA 1Y1VH 3CCEA 3K80C 1JJCB 5HY6A 3ER0A 4HJ9A 2CCZA 4DR4Q 1WYDA 4A3CH 2K14A 1KHIA 1XNRQ 2V1CC 5IYBH 3M3YH 1G51A 1TXYA 2CWAA 2VQEL 2E2JH 1UEBA 1XNQL 4TVAB 2UUCQ 2AKWB 3JAMi 3CF5A 2HHHQ 2UUBL 2JA6H 3HOWH 4OO1G 3FHWA 1YBYA 4OXPA 1K8AC 1WI5A 3GTPH 1X3EA 1N9WA 4IFDG 4DR7Q 1GM5A 1EIFA 4UP9A 1N33L 3ZJYC 1V43A 2ES2A 3S1MH 5EAYA 3I4NH 3PO2H 2WP8J 1GO3E 3IRBA 3GD7A 1VQIA 1Q82C 4JI8Q 3HKZE 1NMGA 2Q2TA 2UUAQ 1B70B 4DPGA 2GVAA 3HOVH 3MEFA 3KDFB 1K0RA 1Y1VG 3JC66 4AIMA 2F4VQ 1L1OC 3STBC 4A3CG 1N36L 3Q8DA 1C9OA 3CW2C 2PI2A 2K5NA 4QQBX 1D8LA 3KYHC 2PNHA 1V9PA 4P75A 1VQCA 3HOWG 2KHJA 4GKKL 1FJGL 2VQFL 1PH7A 1EIYB 1TWGH 3M4PA 2QEXA 4A3EG 1LYLA 3M7NA 2K5VA 3BZCA 2K52A 4DK6C 1YHBA 1VQHA 2IHFA 2MFIA 4QJFA 2ZJQA 3L2PA 1E3PA 4DUYQ 4GOPC 4HJ5A 3I4NG 3PO2G 5C4XH 1YI2A 1SR3A 4JC0A 1PYBA 1CUKA 1D7QA 1X9NA 2YYZA 3NEMA 5IE8A 3M4QA 4DAMA 4X62Q 3HOVG 5HGQA 3PCOB 4HIMA 4AYBE 4A3JH 4LUVA 4C2MH 3RZDH 3AEVA 5M5YH 4GNXB 2VUMH 4RMFA 2ZM6L 3GTKH 4KHPL 4B3RL 1A8VA
chains in the Genus database with same CATH superfamily
3WOFA 1NR2A 1KAWA 1YJNA 4GN4B 3V2TA 3D31A 3NBIA 3RMHA 1YEZA 3G6EA 5FO8B 4DV5Q 3HZXA 4CDFC 4DKAC 4GLAC 5C4XG 4BY7B 1ET9A 1JICA 2JA9A 4DR6Q 3E9HA 1H9SB 2A6HC 3I56A 1DXMA 1U0LA 5FJ8G 3SHLA 2RCNA 1NNXA 2DN8A 3PGZA 1IW7C 1ILPA 1EQTA 1STAA 3S17H 1WFQA 2I0QA 4POGA 5IP7G 2Z6KC 3CC7A 1PFBA 4A3DB 2I07B 3CQZB 4FXKC 4DV1L 1VQ6A 1C8CA 1CSPA 1EIHA 4EQOA 5FLMG 2A19A 2F0UA 2NWGA 3T51B 3HOXH 3CCMA 2F0NA 1CI3M 3GTOH 1QJOA 3E9IA 4DV2L 1EYGA 2J0TD 4A3GH 2FJ2A 2AUKA 3EROA 1HZAA 1QE6A 4BBRB 1SAPA 4LUZA 1JJ2A 2ZM6Q 3FPPA 2I5HA 1SFOB 1S5FD 2OQKA 3BZKA 2BH8A 3IKJA 3M4OH 2OTJA 2JA5B 5DAUA 1SBBB 2L4NA 4YCWA 4LFBL 3HKZG 3EBEA 1WTPA 2KCTA 1YNJC 3K7AB 2ATWA 3S15H 3OIQA 2LKVA 4DK1A 4JI0Q 4IZ8A 2A6ED 1N34L 4JI2Q 1F2MA 4IOAA 1UWVA 4RH6A 2DGYA 3PSIA 3I73A 4I7ZC 3KUPA 3A7AB 3P20A 1LUZA 1Q90A 2RA4A 1HFNA 5E7NA 4GZYC 2RDGA 4HIDA 1PA6A 1B9NA 5D3DA 1P16A 4WJ3M 4K2KA 3QO2A 4L5SA 3M4OB 2ZTDA 2OTLA 1LTAD 2Y0SE 1D5MC 3L7ZC 1S5ED 1FNWA 1BCPD 1TS4A 2X6LA 4P71A 1ILQA 3DLLA 1VS0A 2AQ2B 4LFCQ 1STEA 2HIVA 3NTIA 1F2YA 2MO1A 5EPJA 4GKJQ 3KF8B 5IYDG 1TT2A 2X6GA 4L8JA 5IGFA 1DYQA 3CC2A 3NPPA 1Y8OB 5JEAH 3RZOH 4BY7G 3RLNA 1G2SA 5COYA 2F1MA 5I9OA 4C3HH 1SYEA 1YVCA 4WJWA 4JI4Q 2YTVA 1TWHB 5LMUL 5IY0A 2K5QA 1B2TA 3U9OA 1UE6A 1ASZA 5C3EH 1GXDC 1SNPA 5IYCH 5IOCA 3PF5A 2UU9L 4H44C 2JSOA 2RDHA 3T13A 2XWJB 3TEHB 1PYWD 1PZKD 3HOZB 3KOJA 2QA4A 3RNUA 3M85A 1PH5A 2XTIA 1CQVA 4A3DG 1B50A 2O4XA 2XRQD 1HUNA 2IHEA 4ZUJA 1O7IA 2F0PA 1LT3D 4LFAL 3GV6A 3WOEA 3T4AC 4CDEC 2PI2E 3RZOB 2F0DA 1VMPA 4JBKA 5FLXE 4KTAA 2YTYA 4DR4L 2E2HH 5GAGC 4C3HB 5M5XB 3PF4A 4WORA 4DK0A 2K7VA 1Y1WH 2TMPA 2F0EA 1TIID 1YNND 2B3GA 4GKKQ 1IHZA 3FP9A 1Z47A 4RHSA 1XX8A 2MHVA 2B2UC 1Y14B 1Z9FA 1BCPB 5NUCA 3H0GH 5EJWA 1A62A 2JXMB 4BBRG 1WTRA 1CA6A 1EL0A 1J6QA 1VQ7A 4PV1C 2HCIA 1TY0A 1LO5D 2R6GA 1A3VA 4N8FA 1S4ZA 3Q23A 2JA5G 1EWHA 2EY5A 5LMNW 3SVMA 5J3BA 1Q8KA 2LXKA 1QB5D 5EQ0A 3H3VH 1JQYD 1D6EC 1B3AA 1SNQA 1EYCA 5C0XJ 4DUYL 4TSSA 4H02A 2CQAA 5DLQE 4KKSA 2F03A 4MNOA 2A6EC 5BN3A 4LNQA 3MTSA 3MAQA 4R9WA 4H7BA 2B63B 3T56B 2KCCA 3OPOA 3UDFA 3OW2A 1CQFA 2MP1A 2F0JA 4A3MH 4R4QA 4CJ2C 1QVFA 3S1QH 2UXDQ 4DV5L 2BA0A 2ENBA 2ID0A 2F0SA 4DR6L 4KN7C 3RN5A 2AUJD 4B3SQ 5DNFA 4NP5A 4GNXA 1I4GA 1LTID 1F2ZA 3OMCA 5HGTA 2LFNA 1SROA 4X3TA 4A3EH 1ZYRC 5K36H 3C3LA 5IODA 2F4IA 4LUOA 1YZ6A 1QZHA 5GAHC 1EIGA 2OQ0A 4BBSH 1JR0D 4FDBA 1VQ5A 2WV6D 1F77A 4LAAA 3QR8A 3STBD 3J80c 3CCJA 3AMUA 2D0PA 4ZQ3A 3R3OA 5T1IA 4BXXH 2FXQA 1LTBD 5E1FA 3KLSA 2RKSA 4K5VA 1J5EQ 1I94Q 1DJRD 2K05A 2MO0A 5C4JH 3UE0A 4DAYA 3Q22A 3TREA 3HOZG 3K57A 4IPGA 1MHWC 1PFNA 2Z0SA 1F2LA 1PTOD 1EWIA 2GVBA 1PH8A 3RR5A 3RUZA 4KJNA 1NTGA 4Q5VA 2JA8H 4F7XA 2AQ3B 3I4NB 2I5LX 2L15A 1HNXQ 3KLSX 4A3KH 1BBWA 2A68D 2KHSA 1ZEQX 3PUZA 1MKHA 5JEAG 3MXPA 3NK9A 3K5NA 3VR2A 2XIWA 2MPMA 4C3HG 2A69D 5JJZA 2D2CC 2HIXA 3PUXA 4A75A 1TS5A 1TWGB 2PQAB 2E74C 4DV7Q 4ZCKA 5I2XA 4JI0L 1V1QA 3L3OC 1GOZA 4JI2L 3I7FA 3H3VC 1XMQQ 5GQOA 1EY0A 5A35A 2V4DA 1PTOH 3HFZB 2K1BA 1GUGA 4UPAA 5IGEA 1F9RA 3SR1A 3PQIA 1K28A 2K03A 5BR8Q 2N49A 2MQHA 1UE7A 3FKIH 5M5YB 4J6HA 1X3QA 4A3KB 1BUVT 2VUMB 3G48A 5D14A 2QF7A 3T1HQ 3EN2A 2F0IA 3GTLH 3H91A 1D1KA 3TSSA 4A3FH 2PZUA 2CH4A 3OYYA 4A3IH 1DONA 2P5ZX 2NN6H 3A8JE 4HIKA 2SNSA 3C2PA 1TU2B 3M9BA 4NXMQ 4F88A 2UXBQ 2Z4HA 3HOYH 4LFCL 1X65A 1QUQB 3SK6A 3GTGH 3QG1A 4OO1H 5KYIA 2B63G 1LTLA 1DD2A 1PH3A 3A54A 4QUFA 1XPUA 2N78A 2B2UA 4RGTA 4CBVA 2L1BA 4GLXA 1LV9A 1TWAB 3T1YQ 5BN5A 4FP5D 3GTLB 1HTLD 1D2BA 3R93A 3AYHB 3PIP3 1ML0D 2HQEA 4OEMB 2LXJA 2F0TA 3MFYA 1JJCB 4K6DA 1WYDA 2CWAA 1GJXA 1FYCA 2TSSA 3JAMi 3CF5A 5M5WB 2HHHQ 3HOYB 2EYJA 4A93B 4OXPA 3GTPH 3MWYW 1XTCD 1PTOF 1EEFD 1V43A 1SE4A 3R2IA 1CA5A 2WP8J 1HQMC 3HKZE 3MEHA 2UUAQ 1JCKB 1ICWA 3DEOA 1R9TB 3STBC 2K5WA 1N36L 3JAME 2F0QA 1M8AA 4QQBX 2BDOA 5CC4A 4GKKL 4LK1C 1EIYB 1TWFB 4A3EG 1JORA 1F9PA 1LTSD 4DK6C 2MFIA 2IHFA 2ZJQA 2EOTA 2Z4IA 3L2PA 4KY5A 3I4NG 2B8GA 5C4XH 3VYSA 3SE0A 4F8MA 1PTOC 3VR5A 4S3SA 1F9QA 3NEMA 3M4QA 4DAMA 4X62Q 5DM63 1IYUA 1J9OA 2SDFA 1RTNA 5C3WA 1A15A 3KBGA 4FYDA 4KHPL 1OO9B 2MGSA 3HOUB 4IO9A 4BXXG 2R92B 1PDQA 3HEJA 2L12A 4K5XA 4N9TA 1B3QA 3X3NA 4PNYA 1HNWL 1H95A 4JYAQ 1PFSA 4HSPA 2G5DA 5IP9H 5EPKA 2RDFA 3D6WA 2JA7H 4IURA 5D65A 4IUQA 5DM73 3NSWA 1LT6D 2EZVA 1WTOA 4X65Q 1YITA 4A3KG 2VUMG 1VQBA 1B44D 4DFAA 4Y7NB 1U4LA 2NYZD 5FO9B 1XPOA 4APVA 4CHTB 1EY9A 1HPCA 2F0KA 2JJQA 4GN5A 5IGGA 2ASBA 4POFA 1BBUA 2EYPA 4B3TQ 1B8AA 2F0MA 2H5XA 1EY4A 3PUYA 2JQOA 2E2IB 4B3SL 1PH1A 2O5JC 2F0OA 4OONA 5KYLA 2NVXB 1L2FA 1X32A 2IW3A 1ENAA 2BOSA 3HS0C 1UEAB 4A76A 2EXDA 4P74A 3W3AA 1VMCA 2B2WC 1MBYA 1LT4D 4HIOA 3S14H 3CCUA 3V96A 2CW0D 4JI1Q 3UE1A 3LWEA 1K83H 3FKIG 2KBNA 3MXNB 4KV6A 3GTQH 1HFGA 4M1UB 3FDTA 4DUZL 1JT8A 4ZYSA 1EYAA 1S3OA 3P1HA 1J5EL 1I94L 4NB3A 1CFMA 2PW7A 4BS9A 3CP0A 3K0XA 4H13C 4GS3A 4OIKA 4FF3A 4IQZA 3TQYA 2SEBD 4L6TB 1U9RA 3CPWA 1VQMA 3HOYG 4A93G 4YCUA 1NAPA 1PRTB 5FOBB 3S2DH 1QOHA 1S5BD 4KD4A 3S14B 5IGDA 1GKHA 5FLXL 2XRSD 3ERQA 2EJMA 4AH6A 2BDNA 3GTQB 4IUUA 3HP3A 4N8X1 4K5WA 1B7YB 5C5LA 1U5KA 5EKIA 4OWTB 1HA6A 5CGKA 3IFDA 4PZ8A 5IYDH 4DV7L 1I6VC 1KD1C 3I2ZA 4P2CB 1P8LA 2OXPA 5C0XH 1MJEA 1UAPA 4IJHA 1SEBD 4I65A 1C0AA 2RVLA 4BY7H 2IX0A 5C3XA 2Q2HA 1KLGD 1O7LA 4PMCA 1K8OA 1JOKA 2F0VA 1XWEA 5KGUA 4LF6L 3CCRA 1N32Q 4UHVA 1B1ZA 4RGOS 4CGYB 3CCVA 4IOCA 3HOUG 4R8NA 4C1NK 4JV5Q 3T1HL 2R92G 4QF4A 2F0GA 4DU9A 1IBMQ 4JI3Q 1YHAA 2Q8TA 1AZPA 5KRUA 1RF2D 1TVXA 3M7GA 4LW1A 1EU3A 3TP6A 4A3DH 3G71A 5BN4A 4NXML 3CQZH 1WTWA 2JEBI 4XTCS 2KCMA 2UXBL 1PZID 1AP0A 1KTKA 1SNCA 3UDXA 1KNEA 2CH4W 5KNCA 1K3BC 2KVMA 3D3RA 1SLJA 4JW0A 2ZJPA 4JK1C 2UUBQ 1CT1D 2CHBD 3TZUA 3U4ZA 2ZT9C 3S2HB 3GO5A 2WACA 1ESFA 5IT9E 1AE3A 1EY5A 2D9UA 1IBKQ 4BBRH 2B2TA 4MIUA 2FINB 5ELFA 3GTJB 1H9RA 3QB3A 2NVTB 3DM3A 4HEDA 4G4KA 3SK8A 5IP9G 3U9SA 5I9PA 1SFOH 2JA7G 1AH9A 2JA5H 1CKMA 4DV4L 4IUPA 3EJIA 4BY1B 5JPMC 5M9OA 1DGSA 1UE1A 1I50H 1WTQA 1AW7A 1A2TA 2L5TA 4DN4M 3K7AH 2KUMA 1WTHA 2AWOA 1MSHA 1E2ZA 1J8IA 3KLWA 2LSSA 3MZ5A 1QG7A 5JAVA 1SYCA 1S5DD 2UUAL 3D4RA 3K5OA 4JI5L 3NTKA 5CV5A 1EY8A 1KRTA 1VQNA 4HN7A 1L1OB 1LTRD 1K73C 4GNXC 4X64L 4MHEA 3N6RA 3NQTA 2K33A 3J7AV 3G7LA 3E0JA 5ELOA 3H3VI 3SEBA 3J7ZC 1C7YA 1HQRD 2FMMA 3WDNA 1I50B 2O5IC 4F87A 3TN2A 4X62L 3UDGA 1MIUA 5CV9A 4DNIA 1IL2A 2NTTA 2B2WA 1EY7A 4IFDH 1EOVA 3E5SA 3NENA 1JB3A 2BE5D 1TKWB 4ZUIA 1EZ8A 3NWSA 5DEHA 4LF9Q 1W6KA 3J81E 4L5RC 3H09A 4JYAL 4KHVA 2N55A 2A5HA 5C44B 1RJTA 1TWHH 2DUDA 1BO0A 5GROA 4X65L 4DR1L 1GUNA 4KLKA 1H9KA 2G9HD 3OSOA 1LLRD 2XGTA 4DR3Q 1B4OA 4J15A 3HOZH 1H9MA 3ZYYX 2Q8RE 1B53A 2Z8LA 4B3TL 2QDLA 1SRUA 4DR5Q 1O7ZA 1NY4A 4ABNA 4ZAIA 3U4VA 5C0XG 3H15A 4X3KA 2IJ0A 4R4TA 1ENFA 1L0YB 4RGNA 1BVSA 3UI2A 1Z7TA 3EQLC 4ALPA 2B2VA 4LF8Q 5M5XH 1A63A 2DJFC 4K2LA 4K8IA 2E75C 4JI1L 5C6AA 3IAYA 1HZCA 3MFGA 1E1TA 4A3LG 4CKCA 2DY7A 2XVSA 2XWBB 3VR3A 5ELCA 5LL6S 4GN3B 3AFPA 1K3RA 3S1MB 1PVOA 3PO2B 3T16A 4E6IA 2WFWA 1T9HA 1CKNA 2MNAA 1NUCA 3HOVB 5KEEA 1Q86C 4FXDA 2VB2X 4BY1G 3CCLA 2E2DC 2EXZA 3ITPA 4AQYQ 3ND9A 4DV3Q 1YHQA 1AN8A 2UUCL 3A74A 1IL8A 1WD0A 2F0LA 3KLRA 2RHSB 5L37A 5FK9C 4DR7L 3JAML 1X3PA 4RGMA 3F2CA 5G3LD 2K50A 3RZDB 1KDAA 1BR9A 1VQKA 4X3SA 1EYDA 1X56A 4HJ7A 4QUCA 1OXXK 2D62A 5EKLA 2B63H 4KKTA 1II3A 2NVYB 1QVCA 1X6OA 4JI7Q 3G6JB 1QZGA 2WB1B 2JEAI 1CZWA 1I3QH 4U68A 3F1ZA 3NP8A 5CBAE 4GOPB 3KDFA 3EIVA 4JV5L 2KQ3A 2OEOA 3IFTA 1EOTA 4B08A 1SJHD 2EPBA 1G2TA 4OO1I 4IUTA 3ERSX 1ZKOA 3I8ZA 2F0FA 4YCVA 3TDQA 1IBML 3A0JA 2EY1A 1BCPF 2LY7A 1T5XD 1S40A 4X3UA 1STGA 4XXEA 1O7YA 1GHKA 1QVGA 4FNFA 3E0EA 4EVOA 5C44G 1RKNA 3RLOA 3CRLC 1KIXA 3PUVA 3SDZA 1JWSD 3CCEA 3MC0B 2CCZA 2K14A 3M3YH 2V1CC 5IYBH 1TXYA 1I3QB 3HG9A 2UUBL 4NKLA 3FVQA 2O2LD 1YBYA 1WI5A 1X3EA 1SNDA 4IFDG 1EIFA 1RDPD 4CJ0B 2ES2A 5EAYA 3I4NH 1RODA 1BCPC 3OWEB 1SSOA 3A7LA 3K5MA 1GO3E 3IRBA 3GD7A 1VQIA 1Q82C 4JI8Q 1H9SA 1NMGA 3MEFA 1V1OA 2NZ1D 3JC66 5E4WC 2F4VQ 1EEID 3NUCA 1C9OA 3K59A 1D8LA 1MSGA 1RD9D 2DNCA 1TWGH 3M4PA 4HMJA 1LYLA 2K5VA 3BZCA 1FGBD 1YHBA 2R7ZB 4QJFA 3M3YB 4AYBB 4GOPC 4HJ5A 3PO2G 1HCZA 1PYBA 1IKMA 2YYZA 2FMCA 1STBA 2K01A 3HOVG 3PCOB 4HIMA 4LUVA 2DJGC 4RCOA 5M5YH 2KEEA 2WAQB 1ICFB 2VUMH 2ZM6L 5G3LF 3TS2A 2AHOB 2EVBA 1KQSA 1OXVA 4DNTB 1IYVA 1WCMB 4RHRA 1TS3A 4JG2A 5AFWA 1CM9A 3C1EA 3FPUB 1OXSC 4B9XA 2L11A 4LMQD 2PCFB 3OTOQ 5ELNA 3I90A 1YNNC 2VS1A 3BG3A 2GA4B 4LF9L 5D3IB 2LMCB 1MJCA 3BDOA 5CBEE 4HMIA 2WB1G 1SNMA 1TY2A 1TWAH 1VQEA 1S72A 3B6YA 1WD1A 4IFDJ 2L9HA 2R7FA 4KI0A 5CV6A 4ZLTF 1FJGQ 3OWFA 4B3MQ 5T1GA 1BOSA 5M5WH 4P73A 1QILA 1U4RA 4A93H 4LJZC 5M3MB 5JVG3 1Q7YC 4GKJL 1IYJB 1I6HH 5JJIA 1FD7D 1BQQT 2Q2IA 2L0CA 1XMOQ 5AJ3Q 2IWHA 2ICIA 3SK4A 4B9WA 3PUWA 4DXFA 2YTXA 4NPSA 4C3IB 5ISRA 3AU7A 5HURA 1QNUA 1AEXA 1NE3A 1SYFA 2A1AA 4LF8L 1R9TH 3S1RH 4JI4L 1K9MC 4V190 1CTMA 3PO3B 3KF8A 3MHBA 1TWFH 2PPBC 5JJLA 2CQOA 2KA7A 1A6XA 4QIWB 4DF7A 4MTNA 2JN4A 5IGCA 1LACA 2EYFA 1I6HB 1DOMA 2VY3A 3K5LA 3S16B 4HCEA 4PZ6A 4HSVA 2C35B 4HAEA 4NW2A 2I46A 3HOUH 1VF7A 2HCCA 2R92H 2YV5A 2ZXPA 4DV3L 4X66Q 2R7ZG 3LGJA 1EQVA 4AYBG 5IYBG 3S1RB 3D4WA 2B2YC 3A5UA 4M8AA 4FF1A 2WINB 2RHQB 2VNUD 1SE3A 1XTDA 4DAVA 3HGBA 4YWKA 2E76C 5I6YA 2WAQG 4YY3Q 3MXUA 2B2TC 1WTVA 4Y7NH 4DV2Q 1VQDA 5C5MA 5GADC 3BU2A 1SMYD 4MZ9A 4QL5A 1E22A 2KEDA 4YIJA 4NMZA 1WCMG 2K6AA 4G7HC 2A68C 4QY7A 2Q8IB 2E2IH 4IJLA 4XYOA 1SN8A 2I5MX 3PIOA 1Q1BA 2NVXH 3J7AF 1PXUA 3KBXA 1EQRA 2A69C 1WVLA 1PRTD 4YHHQ 1F9SA 2LS01 3R2TA 4LFBQ 1VQFA 1SYGA 1VQ4A 3TZDA 3FMCA 2SOBA 2VQEQ 3TP5A 2ZXOA 3KJPA 4Y52H 4K8JA 3RD4A 2RQXA 4RA8A 4JBJA 4GOPA 4PQXA 2EQSA 4TKOB 2UXDL 3Q0AA 2NZOA 1KABA 3DWAA 3E3XA 3S24A 1GUTA 2A6HD 4I7AA 1EFWA 1WTXA 2N3SA 3J80i 2IPKD 2JP1A 5IGBA 1IW7D 1YJWA 5M3MG 2KOLA 2VQFQ 4EQPA 5E3FA 1STYA 1X55A 2D5DA 2VB3X 3PMFA 4MTKA 1E7ZA 2C9OA 4C3IG 4JI8L 5JJKA 5CORA 4DNRB 1BF4A 1W2BA 2EY2A 4ILWA 3N52A 3J80E 1VQ8A 4J8QA 3S1NH 5I6WA 3F8TA 5CR3A 2RSNA 3MXGA 2VL6A 4PZ7A 2OCEA 5GAEC 3PO3G 4B3RQ 2K5HA 3K8AA 4OL7A 1EQQA 2A8VA 1HH2P 1W3SA 3VYTA 2NVQB 2WIIB 4YWMA 1CHPD 2XNAC 3VYRA 1FNVA 4OX9Q 4K14A 3HRZC 1PH4A 4PMWA 3DWPA 3VR4A 3W1GA 1G91A 4BWGB 4OGQC 1HR0W 2EYLA 1R4QB 1YNXA 2PNRC 1HNXL 4OIJA 1GVPA 3NBHB 2PMZB 4JI6Q 2ALYB 3S1NB 4BA1I 3GTMB 2B2VC 2WKDA 4LFAQ 5LHY1 2ICEC 3TS0A 1PH2A 4C56C 1YNJD 2YU9B 3ULPA 4NXNQ 3GDEA 2VW9A 5FLXc 4QGUA 5ELEA 1KNAA 4A3BB 1XMQL 2AQ1B 3OTOL 1VQLA 4QB4A 3BVZA 1PRTF 2EE1A 1UUPA 2L55A 1D5XC 5BR8L 4FF4A 2BA1A 4C1NI 2PQAA 4A3LH 3J7A5 3S2HH 4DK3C 4KJOA 1G291 2QGQA 4PG3A 1VQ9A 2E8GA 1BDOA 1I4XA 4DR2L 3GTJH 3CMEA 2NVTH 3L9AX 3CHBD 1HZ9A 4RG1A 4ZRZA 1IBLQ 4HTHA 3W1BA 4LF7Q 4XYQA 4B3ML 4EX5A 2NBFA 1Y1VB 4ODGA 3NTHA 5JPNC 4BY1H 4XIGS 3M4YA 3UDIA 2E2JB 3VDYA 5CV7A 3ONAB 4HJ8A 4JBMA 3HOWB 4LF4Q 1PRTC 2CFMA 4TRDA 1XMOL 2B39A 5AJ3L 5FO7B 1FGUA 2B2YA 1XPRA 3VR6A 4P72A 1E2VA 4JOIA 2QW7A 4XQJA 3T1YL 1HR0Q 1VQGA 2J4XA 3KJOA 1JB7A 1NJIC 4CDDC 3OIPA 1QUQA 1CZGA 2F3IA 1JWUD 3BYTB 1KAAA 2HD3A 2F3WA 1WOCA 2K4KA 3I72A 4G57A 1XJVA 1PH6A 3E6ZX 3OW7A 2HHHL 2EYMA 5EGTA 2CWPA 1VQPA 1LTGD 4FVMA 1L0WA 2FFKB 4K0KQ 2PO4A 2IY5B 1LABA 4G7ZC 4A3JB 4TQUS 2EYHA 2Z1CA 1TR5A 4C2MB 2R7DA 4DAYB 2CW0C 3GTKB 2NTSA 2ZTCA 4RWSC 2NUCA 1HRJA 1OXTA 3GP7A 3NELA 4X66L 3BDCA 1L0XB 1ASYA 3TMEA 4R8IA 5C44H 4OWWB 4UP8A 4YY3L 3J81i 2M00A 2WB1E 2M2LA 1Q81C 1KDCA 2XSCA 2F3VA 3PV0A 3S17B 1YIJA 3BYYB 1FL0A 4ME3A 4JBWA 1PHJA 5IIFA 4L63B 3CCSA 3EVQA 3KF6B 5CV8A 1HTPA 4DV0Q 4KY6A 4C3JH 1A3UA 1Q1EA 3F2DA 1SYDA 3OOCA 3NHHA 4FO2A 4A3BG 4IPCA 5EPLA 4YHHL 4X6AH 1I4PA 3K80C 3ER0A 2KCNA 4O42A 4HJ9A 2IL8A 1XNRQ 2VQEL 1UEBA 2AKWB 1EU4A 3C46A 2JA6H 1K8AC 3HOXB 2QEJC 4WRDA 2BCOA 1N9WA 3GTOB 1GM5A 3ZJYC 4A3GB 3S1MH 3PO2H 1O78A 1I4RA 4KN4C 1PFMA 1R4PB 4DPGA 3HOVH 1MD2D 1Y1VG 1V1PB 1L1OC 4C3JB 1V8QA 4A3CG 4J1MA 3CW2C 2K5NA 1ZYRD 4CJ1B 2PNHA 1V9PA 1VQCA 3HOWG 2KHJA 3DHQA 4UDUC 2VQFL 1PH7A 2QEXA 5CV4A 3M7NA 3S15B 1VQHA 5C4HA 1B9MA 2K04A 1EWCA 5J1ZA 4QCLA 2JA6B 1D7QA 1X9NA 1SNOA 3BZDB 3LX0A 1RCVD 1HHVA 3A56A 5IE8A 1GUOA 4AYBE 3W2DA 3RZDH 3CU7A 4XQNA 3CKIB 1D1IA 1GUSA 4B3RL 2R3ZA 2NZHA 1QNKA 3K6OA 4A4IA 2NVYH 1HZBA 2WAQE 3MXNA 4JCVE 3Q6SA 4OX9L 1RIPA 2KJXA 3KFUA 1ZXTA 2N8NA 5LL6X 5EBCA 1T5EA 1HXYD 3R8BA 4LF5Q 1JC7A 1HNZQ 1K8GA 2K28A 4A3JG 1HA5A 3G4SA 2E5LQ 4JI6L 3ND8A 1H9JA 1NMFA 2B8FA 4QMGA 3CMAA 2NB0A 1WJJA 2QKIC 2A73B 3QJYA 3I3CA 2UXCQ 1RL2A 3NE5B 4NXNL 4FF2A 2JE6I 1EZ6A 4OWXB 1CHQD 1N36Q 2JK8A 3NBHA 4ME5A 4DXGA 3JAMc 2OF1A 3BVGA 3BVMA 1M1KC 4RCNA 2NN6I 5C3EB 1SJED 3EFXD 2HT1A 5H1SE 1KRSA 2HDLA 1N32L 1Y8PB 5J22A 4WFN3 3GQBA 4Q0FA 1JWMD 5A2QE 1JE5A 4JI3L 2ZTEA 3F2UA 1K8MA 1UNSA 1IBLL 4LF7L 4KHPQ 2QDBA 2SNMA 4OELB 4XDXA 2OWOA 3NQIA 2Z6KA 4LWCA 1M4VA 2E2HB 1SE2A 1DCZA 3WWVA 3DM1A 2G9DA 2BE5C 2ZXRA 5KNBA 3Q24A 1Y1WB 2J7ZA 1HNWQ 2R93H 1C4QA 4LF4L 3HOXG 3I4MH 5E4XA 4RKLA 2R7ZH 4A3GG 1Q46A 1EFID 1AE2A 1ONLA 4DGZA 2EJGC 3H0GB 1SMXA 4HCSA 1HR0L 4QIWE 1IBKL 3DUZA 2IX1A 4C3JG 3AFQA 1UE5A 1JOQA 2K32A 3CXCA 3AB9A 1NSNS 3J7YW 5JVH3 4NDXA 3VA5A 5KIXA 2Y0SB 4UAIA 1QCBD 1PMRA 3DMUA 3A8KE 5IWAQ 4R4IA 3OHXC 1WCMH 2JA6G 2R93B 1CKOA 1RTOA 3J80L 1E2WA 3URYA 3A5ZB 3I4MB 4K0KL 3I4OA 2PQEA 3ULLA 5JOBA 4KMUC 1A3TA 1PV4A 1E1OA 1NCVA 2PYKA 4R4CA 5M3FH 3D0FA 3DEPA 4A3MB 3S1QB 4DUZQ 4DV6Q 3GV3A 1LT5D 2PZTA 3IL8A 1I5FA 3CPFA 1SDFA 1TS2A 4Z9CB 5LMNQ 3QOLA 3KK7A 2EDGA 3TRZA 1ET6A 1L1OA 4A3EB 3W5OA 4BA2I 3K7UC 2QILA 1JOOA 1S5CD 1AZQA 1XNQQ 4R4OA 4BBSB 5EBDA 5M3MH 1U4PA 4IN3A 4DV0L 3P75A 5M3FB 1Y8NB 1SXTA 1N33Q 2EIFA 3A55A 3A8IE 4XQQA 1FVIA 3SGIA 2K75A 4C3IH 1DM0B 3NWTA 5EKKA 3J81j 2JYOA 5C3EG 2R61A 5IYCG 4DA2A 5C4JB 1XNRL 4WJ4A 1KXLA 2KECA 3PO3H 1ESRA 2VXWA 3KF6A 4GLVB 2F0WA 2WKCA 3H94A 1PH9A 4DR3L 1Q3LA 4IALA 1KLUD 4LF6Q 2JA8B 3SK5A 4KY7A 2H4OA 2HUGA 2BH2A 3I91A 4IUNA 2ZJRA 4CDCC 4UP7A 4DR5L 3S16H 2KHIA 3L0OA 2D0OA 1BKBA 4ZK9B 3LWUA 1Y1WG 4HJAA 4ZKBB 1PZJD 1X54A 4DR2Q 2RSOA 3PIPA 4L5QA 4G7OC 1TWCH 5CMDA 3QIAA 3O13A 2DNEA 1E0BA 3S9WA 3H0GG 3SXHA 1N8RC 4KK7A 1DOLA 1V1PA 4CKEA 3CRKC 1PTOB 2EYOA 5IT9L 4KKUA 3U50C 4U673 3QWNA 1EY6A 3P7JA 5TSSA 3RLFA 1LM0A 2HQLA 2RCFA 1FR3A 4R1JA 4YWLA 5C4ZA 3FKIB 1NR4A 3CC4A 4DAPA 3ICEA 2F0HA 4KHZA 2Y0SG 1PLFA 4A3FB 5IT9c 2DY8A 5F2DA 1VQOA 4A3IB 2PMZE 2R93G 5JEAJ 4LF5L 4AQYL 3I4MG 3AQQA 1TWCB 1HNZL 1GD7A 5C0XI 3ULJA 2IX3A 4DV4Q 4DV1Q 3HKSA 5CYUA 4FXGC 3TBIB 4O0AA 2E5LL 3GTGB 1OTCA 1IXRA 3CAMA 4JOIC 2MUYA 1Z6HA 4XT3B 3D4DA 4A3MG 1VDZA 2UXCL 4ULLA 4V0BA 3RN2A 4N9PA 1VCIA 1MGSA 1M90C 4JI5Q 4PMBA 3H6MA 3I55A 4UY8C 2KENA 1RHPA 4JI7L 4X64Q 4EGVA 1XYIA 3K81C 5K36G 1K0SA 1STHA 1I4QA 3BDLA 1KL9A 3OMGA 1G6PA 1KDBA 2Q2UA 1GHJA 2RBMA 4BBSG 1PYSB 1GUWA 3BS1A 3GTPB 1VQAA 1SE8A 5FJ8H 5M3FG 4ZKCB 3J81L 1DOKA 1N34Q 2C5CA 1D5ZC 4EQ5A 4L5TA 2B29A 1E24A 4IPHA 1Q8IA 1VQJA 3BJUA 3D6CA 5IP7H 5KNDA 3J81c 3PIO3 4OHJA 1MI2A 3QOJA 4K6LA 4O1NA 2AWNA 2NVQH 3T53B 2JA8G 1X3GA 1CSQA 5C4XB 5FLMH 4DR1Q 1NBWA 3FRPB 3CD6A 1Q12A 3CCQA 2VZAA 1IZ6A 4XT1B 2QCPX 1X3FA 1HUMA 1JMCA 2AMCB 4H0LC 1G6ZA 2XN9C 4CKBA 2F4VL 4KD3A 2H1EA 3GTMH 1YJ9A 5IWAL 2PZWA 1JJGA 3X3MA 1BBXC 2HDMA 1CK1A 4RFBA 2YU9H 1C48A 3F2BA 3FEWX 2JA7B 1Y69U 3K58A 4A3BH 3U58A 1CKNB 5LMUQ 1G8ZD 2RF4A 4MN3A 4RKBA 5FKAC 1A0IA 2GN5A 4RAUC 2UU9Q 4JVZA 1I4HA 1QWYA 2IT1A 5I4DA 5ELDA 3MVVA 1KC8C 4A3FG 1HJPA 1STNA 1VF5C 3DXJC 4DV6L 2A74C 2EY6A 3VA7A 4A3IG 5K5PA 2OT2A 2NN6G 4IPDA 1A2UA 1EUJA 1LTTD 2F52A 4IFDI 2CKZB 1OXUA 5LMNL 3TP7A 1O80A 4O2DA 1Y1VH 3I70A 5HY6A 3MA2B 2Z9HA 4DR4Q 2M9VA 5J39A 1KHIA 4A3CH 1TQOA 4OO1G 1G51A 2E2JH 1XNQL 3DWQA 5ELBA 4TVAB 4JPBW 2UUCQ 1W6JA 3D8GA 3HOWH 3FHWA 2Z6BA 1K83B 3HKZB 1BNZA 3K0YA 4DR7Q 2MJ8A 4UP9A 1N33L 2N88A 1SYBA 2X69A 1JE4A 3I4LA 4HR7B 1AFPA 2CVRA 2EJFC 2Q2TA 1B70B 2GVAA 3KDFB 1BXTA 1K0RA 4AIMA 3C1FA 3Q8DA 3NXWA 2PI2A 1SMYC 3KYHC 1FNUA 4P75A 4ID6A 1FJGL 2K5DA 5A2QL 1ENCA 1XXGA 2K52A 5I2YA 3V05A 3S2DB 3EA6A 4IUVA 2PW5A 1E3PA 3LNNA 4DUYQ 1YI2A 1SR3A 4JC0A 1U4MA 1CUKA 3TP8A 1IKLA 4EQNA 1DZ1A 5HGQA 4A3JH 4C2MH 2FHTA 3AEVA 4GNXB 4RMFA 3GTKH 3VYUA 1A8VA
chains in the Genus database with same CATH topology
4IO9A 4BXXG 2NZHA 3TS2A 2AHOB 1KAWA 2NVYH 1HZBA 4GN4B 4A4IA 1YJNA 3D31A 1KQSA 1OXVA 2WAQE 4JCVE 1YEZA 3G6EA 4OX9L 1RIPA 4DV5Q 1HNWL 4DKAC 4GLAC 3KFUA 4JYAQ 5C4XG 1PFSA 1H95A 5IP9H 2N8NA 2JA9A 4JG2A 4DR4L 4DR6Q 2JA7H 4LF5Q 3E9HA 1HNZQ 3I56A 5FJ8G 1U0LA 1K8GA 2RCNA 4A3JG 1OXSC 4X65Q 1YITA 3PGZA 3OTOQ 5ELNA 3G4SA 4A3KG 1VQBA 2E5LQ 2VUMG 4JI6L 3CMAA 1NMFA 3S17H 2VS1A 1WFQA 1WJJA 2I0QA 4POGA 1XPOA 4LF9L 4APVA 5IP7G 1MJCA 2JJQA 4GN5A 2ASBA 2UXCQ 2Z6KC 1RL2A 4POFA 1BBUA 4B3TQ 1B8AA 2H5XA 2WB1G 3CC7A 3PUYA 2JQOA 1TWAH 1VQEA 1S72A 3B6YA 4NXNL 4B3SL 4IFDJ 1PH1A 2JE6I 2R7FA 4OONA 4OWXB 1L2FA 4KI0A 1N36Q 2JK8A 4DV1L 1VQ6A 3JAMc 1CSPA 4A76A 1M1KC 2NN6I 5FLMG 2EXDA 2A19A 1FJGQ 4P74A 4B3MQ 2HT1A 5H1SE 3S14H 4HIOA 3CCUA 1KRSA 5M5WH 1N32L 4P73A 4JI1Q 3UE1A 4A93H 1K83H 3HOXH 3FKIG 3CCMA 1Q7YC 2KBNA 3MXNB 3GTOH 1IYJB 4GKJL 1I6HH 5JJIA 3GTQH 3E9IA 4DV2L 1EYGA 2Q2IA 1XMOQ 4A3GH 5AJ3Q 1JE5A 1HZAA 3PUWA 4JI3L 2YTXA 4DUZL 1JT8A 4LUZA 1JJ2A 4NPSA 2ZM6Q 2ZTEA 1IBLL 4LF7L 4KHPQ 1S3OA 1J5EL 1NE3A 1I94L 4NB3A 2A1AA 2OWOA 4LF8L 2I5HA 2Z6KA 3CP0A 3K0XA 4LWCA 1R9TH 3WWVA 3S1RH 2OQKA 3BZKA 2BH8A 4GS3A 3TQYA 1K9MC 4JI4L 3M4OH 2OTJA 4YCWA 3CPWA 1HNWQ 1VQMA 3HOYG 2R93H 4LF4L 4A93G 4YCUA 1TWFH 3HOXG 5JJLA 2CQOA 4LFBL 3HKZG 3I4MH 3EBEA 2KCTA 3S15H 2ATWA 2R7ZH 3S2DH 4JI0Q 4A3GG 1Q46A 4MTNA 1AE2A 4JI2Q 1N34L 1SMXA 1GKHA 4IOAA 1UWVA 2DGYA 3PSIA 4AH6A 1HR0L 2VY3A 4QIWE 1IBKL 4PZ6A 2IX1A 3AFQA 2C35B 1UE5A 1LUZA 1B7YB 3CXCA 1U5KA 3HOUH 4OWTB 5E7NA 2R92H 2YV5A 4PZ8A 4HIDA 5IYDH 4DV7L 1KD1C 3I2ZA 1P8LA 1PA6A 4DV3L 4X66Q 1MJEA 2R7ZG 4IJHA 3LGJA 1C0AA 4AYBG 1P16A 4R4IA 5IWAQ 5IYBG 4WJ3M 4L5SA 1WCMH 4BY7H 2IX0A 2ZTDA 2JA6G 3A5UA 2OTLA 1CKOA 2Q2HA 2Y0SE 3A5ZB 4K0KL 2RHQB 3I4OA 3L7ZC 2VNUD 4LF6L 3CCRA 3ULLA 1XTDA 4P71A 1N32Q 4YWKA 3DLLA 1VS0A 2WAQG 4YY3Q 3CCVA 4IOCA 1PV4A 4LFCQ 3HOUG 2HIVA 1E1OA 4JV5Q 4GKJQ 2MO1A 3T1HL 2R92G 4R4CA 3KF8B 3D0FA 4Y7NH 5M3FH 4DV2Q 1VQDA 5IYDG 5GADC 3BU2A 4MZ9A 4QL5A 1IBMQ 4JI3Q 1E22A 4DUZQ 4DV6Q 3CC2A 1YHAA 3RZOH 1WCMG 3RLNA 4BY7G 4A3DH 2E2IH 1I5FA 3CPFA 4LW1A 4QY7A 4IJLA 3G71A 1SN8A 2I5MX 3PIOA 4C3HH 4NXML 1Q1BA 3CQZH 2NVXH 1YVCA 5LMNQ 2JEBI 4XTCS 2KCMA 4JI4Q 2UXBL 2YTVA 1EQRA 5LMUL 5IY0A 3UDXA 4YHHQ 1UE6A 3TRZA 1ASZA 5C3EH 1L1OA 3W5OA 4LFBQ 5IYCH 3PF5A 2UU9L 1SLJA 1VQFA 4BA2I 1VQ4A 3K7UC 3TEHB 1XNQQ 4R4OA 2VQEQ 3KJPA 3KOJA 2ZJPA 5M3MH 2UUBQ 4Y52H 2QA4A 3RNUA 3U4ZA 3M85A 1PH5A 2XTIA 3GO5A 4A3DG 4JBJA 4GOPA 4DV0L 1N33Q 1AE3A 2EQSA 2EIFA 2IHEA 1IBKQ 2UXDL 4BBRH 1FVIA 1O7IA 2K75A 3SGIA 4C3IH 2NZOA 4LFAL 3DM3A 2PI2E 3J81j 3S24A 5C3EG 4JBKA 5IP9G 5IYCG 2YTYA 1SFOH 1EFWA 2E2HH 2JA7G 2N3SA 3J80i 5GAGC 1XNRL 2JA5H 3PF4A 4WJ4A 1AH9A 1CKMA 1KXLA 4DV4L 1Y1WH 3PO3H 1DGSA 1UE1A 4GLVB 3KF6A 1I50H 1YJWA 5M3MG 2B3GA 1PH9A 4GKKQ 2VQFQ 3FP9A 1Z47A 4DR3L 3K7AH 2AWOA 1X55A 4LF6Q 1Y14B 1Z9FA 3H0GH 3KLWA 1A62A 2LSSA 4BBRG 2BH2A 1E7ZA 2ZJRA 4JI8L 1J6QA 1VQ7A 2UUAL 5JJKA 4UP7A 4DR5L 4JI5L 1W2BA 3S16H 1KRTA 1VQNA 1VQ8A 3S1NH 2KHIA 3L0OA 2R6GA 1L1OB 1BKBA 2D0OA 3F8TA 2VL6A 2JA5G 1K73C 4PZ7A 5LMNW 4GNXC 2OCEA 5GAEC 4X64L 4HJAA 1Y1WG 3PO3G 4B3RQ 1X54A 2K5HA 4DR2Q 3K8AA 5J3BA 1Q8KA 2LXKA 3PIPA 4L5QA 1EQQA 1TWCH 2A8VA 1HH2P 1W3SA 3H3VH 4YWMA 5ELOA 3H3VI 5C0XJ 4DUYL 3J7ZC 1C7YA 4OX9Q 3H0GG 1N8RC 4H02A 5DLQE 1PH4A 4PMWA 3W1GA 4X62L 3UDGA 3U50C 1HR0W 1MIUA 1YNXA 3RLFA 1LM0A 1HNXL 2HQLA 4MNOA 4R1JA 4YWLA 4DNIA 1IL2A 3CC4A 1GVPA 4LNQA 3NBHB 3ICEA 1EOVA 4JI6Q 2ALYB 4KHZA 3NENA 2Y0SG 5IT9c 3UDFA 3OW2A 1QVFA 4A3MH 4LF9Q 4R4QA 1VQOA 3S1QH 4BA1I 2UXDQ 4DV5L 2BA0A 4LFAQ 3TS0A 4L5RC 4JYAL 2ID0A 2PMZE 1PH2A 2R93G 4DR6L 5JEAJ 3RN5A 3ULPA 4B3SQ 4AQYL 4LF5L 4NXNQ 3AQQA 3GDEA 2VW9A 5FLXc 4QGUA 4GNXA 1HNZL 3I4MG 1GD7A 5C0XI 1TWHH 2DUDA 3ULJA 4DV4Q 1XMQL 5GROA 3HKSA 4DV1Q 4X65L 1SROA 4DR1L 4O0AA 3OTOL 4KLKA 2E5LL 1VQLA 4A3EH 1OTCA 4UY8C 2XGTA 1IXRA 3CAMA 4DR3Q 4J15A 4JOIC 4LUOA 3HOZH 1YZ6A 1QZHA 5GAHC 2OQ0A 5BR8L 4BBSH 4A3MG 2BA1A 4FDBA 1VQ5A 2UXCL 2PQAA 4B3TL 3RN2A 1SRUA 4A3LH 3J7A5 3S2HH 1VCIA 4DR5Q 1M90C 4DK3C 4JI5Q 1G291 1NY4A 3STBD 2QGQA 4PG3A 3J80c 3U4VA 3CCJA 2E8GA 3I55A 5C0XG 2KENA 3H15A 4DR2L 1VQ9A 4R4TA 2D0PA 3GTJH 4JI7L 3CMEA 2NVTH 4BXXH 2FXQA 4X64Q 1BVSA 1HZ9A 4RG1A 1IBLQ 4LF7Q 3W1BA 1J5EQ 1I94Q 3K81C 4B3ML 4EX5A 5K36G 4ALPA 2MO0A 5C4JH 3UE0A 1KL9A 5M5XH 4LF8Q 1A63A 1G6PA 4BY1H 3TREA 4XIGS 2Q2UA 3UDIA 4IPGA 3HOZG 3VDYA 2Z0SA 4JI1L 4BBSG 4HJ8A 4JBMA 1HZCA 1EWIA 1PYSB 2GVBA 4LF4Q 1PH8A 1E1TA 2CFMA 3RR5A 4A3LG 1VQAA 1SE8A 1XMOL 1NTGA 5FJ8H 5AJ3L 1FGUA 5M3FG 2JA8H 4GN3B 3AFPA 1K3RA 1PVOA 1N34Q 2I5LX 2L15A 1HNXQ 1XPRA 4EQ5A 4P72A 4A3KH 1BBWA 2WFWA 4L5TA 2B29A 1E24A 3PUZA 4IPHA 4JOIA 1MKHA 5JEAG 1T9HA 1VQJA 3BJUA 1CKNA 3T1YL 1HR0Q 1VQGA 2MNAA 3KJOA 1JB7A 1NJIC 1Q86C 5IP7H 1QUQA 4BY1G 2F3IA 3J81c 2HIXA 3CCLA 1WOCA 2K4KA 3PUXA 4A75A 1XJVA 2PQAB 4DV7Q 4AQYQ 2AWNA 1PH6A 2NVQH 4JI0L 4DV3Q 1V1QA 1YHQA 2JA8G 4JI2L 3I7FA 2UUCL 1X3GA 1XMQQ 5GQOA 2HHHL 3A74A 1CSQA 5FLMH 2CWPA 4DR1Q 1VQPA 1NBWA 3HFZB 1L0WA 4UPAA 2RHSB 4DR7L 3CD6A 1Q12A 4K0KQ 3CCQA 2IY5B 2VZAA 1IZ6A 3F2CA 1X3FA 2K50A 4TQUS 2N49A 5BR8Q 2MQHA 2R7DA 1UE7A 3FKIH 1VQKA 4DAYB 1JMCA 2AMCB 3G48A 1X56A 2ZTCA 4HJ7A 1OXXK 2D62A 3T1HQ 3EN2A 2B63H 3GTLH 1OXTA 4A3FH 2F4VL 3NELA 4X66L 3GTMH 1YJ9A 5IWAL 3OYYA 1JJGA 1QVCA 1X6OA 4A3IH 4JI7Q 1ASYA 1QZGA 2JEAI 4HIKA 2YU9H 3F2BA 5C44H 3M9BA 4NXMQ 4OWWB 1I3QH 3F1ZA 4A3BH 3U58A 1CKNB 2UXBQ 4GOPB 4UP8A 5LMUQ 3HOYH 4YY3L 3J81i 2RF4A 2WB1E 3KDFA 3EIVA 4LFCL 4JV5L 1X65A 1QUQB 1Q81C 3GTGH 1A0IA 2GN5A 2UU9Q 2IT1A 3PV0A 1YIJA 2B63G 4OO1I 3ERSX 1KC8C 4A3FG 1HJPA 1LTLA 4YCVA 1FL0A 1IBML 4ME3A 4JBWA 4DV6L 3A0JA 1PH3A 4A3IG 1S40A 1PHJA 2NN6G 4IPDA 1XPUA 2N78A 2F52A 1EUJA 4IFDI 4GLXA 3CCSA 2CKZB 3KF6B 3T1YQ 4DV0Q 1QVGA 3E0EA 5C44G 1OXUA 4C3JH 5LMNL 1Q1EA 3F2DA 3RLOA 4A3BG 3AYHB 4IPCA 1KIXA 3PUVA 4YHHL 4X6AH 2LXJA 4O2DA 1Y1VH 3CCEA 3K80C 1JJCB 5HY6A 3ER0A 4HJ9A 2CCZA 4DR4Q 1WYDA 4A3CH 2K14A 1KHIA 1XNRQ 2V1CC 5IYBH 3M3YH 1G51A 1TXYA 2CWAA 2VQEL 2E2JH 1UEBA 1XNQL 4TVAB 2UUCQ 2AKWB 3JAMi 3CF5A 2HHHQ 2UUBL 2JA6H 3HOWH 4OO1G 3FHWA 1YBYA 4OXPA 1K8AC 1WI5A 3GTPH 1X3EA 1N9WA 4IFDG 4DR7Q 1GM5A 1EIFA 4UP9A 1N33L 3ZJYC 1V43A 2ES2A 3S1MH 5EAYA 3I4NH 3PO2H 2WP8J 1GO3E 3IRBA 3GD7A 1VQIA 1Q82C 4JI8Q 3HKZE 1NMGA 2Q2TA 2UUAQ 1B70B 4DPGA 2GVAA 3HOVH 3MEFA 3KDFB 1K0RA 1Y1VG 3JC66 4AIMA 2F4VQ 1L1OC 3STBC 4A3CG 1N36L 3Q8DA 1C9OA 3CW2C 2PI2A 2K5NA 4QQBX 1D8LA 3KYHC 2PNHA 1V9PA 4P75A 1VQCA 3HOWG 2KHJA 4GKKL 1FJGL 2VQFL 1PH7A 1EIYB 1TWGH 3M4PA 2QEXA 4A3EG 1LYLA 3M7NA 2K5VA 3BZCA 2K52A 4DK6C 1YHBA 1VQHA 2IHFA 2MFIA 4QJFA 2ZJQA 3L2PA 1E3PA 4DUYQ 4GOPC 4HJ5A 3I4NG 3PO2G 5C4XH 1YI2A 1SR3A 4JC0A 1PYBA 1CUKA 1D7QA 1X9NA 2YYZA 3NEMA 5IE8A 3M4QA 4DAMA 4X62Q 3HOVG 5HGQA 3PCOB 4HIMA 4AYBE 4A3JH 4LUVA 4C2MH 3RZDH 3AEVA 5M5YH 4GNXB 2VUMH 4RMFA 2ZM6L 3GTKH 4KHPL 4B3RL 1A8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 A;  4BXX G;  2NZH A;  3TS2 A;  2AHO B;  1KAW A;  2NVY H;  1HZB A;  4GN4 B;  4A4I A;  1YJN A;  3D31 A;  1KQS A;  1OXV A;  2WAQ E;  4JCV E;  1YEZ A;  3G6E A;  4OX9 L;  1RIP A;  4DV5 Q;  1HNW L;  4DKA C;  4GLA C;  3KFU A;  4JYA Q;  5C4X G;  1PFS A;  1H95 A;  5IP9 H;  2N8N A;  2JA9 A;  4JG2 A;  4DR4 L;  4DR6 Q;  2JA7 H;  4LF5 Q;  3E9H A;  1HNZ Q;  3I56 A;  5FJ8 G;  1U0L A;  1K8G A;  2RCN A;  4A3J G;  1OXS C;  4X65 Q;  1YIT A;  3PGZ A;  3OTO Q;  5ELN A;  3G4S A;  4A3K G;  1VQB A;  2E5L Q;  2VUM G;  4JI6 L;  3CMA A;  1NMF A;  3S17 H;  2VS1 A;  1WFQ A;  1WJJ A;  2I0Q A;  4POG A;  1XPO A;  4LF9 L;  4APV A;  5IP7 G;  1MJC A;  2JJQ A;  4GN5 A;  2ASB A;  2UXC Q;  2Z6K C;  1RL2 A;  4POF A;  1BBU A;  4B3T Q;  1B8A A;  2H5X A;  2WB1 G;  3CC7 A;  3PUY A;  2JQO A;  1TWA H;  1VQE A;  1S72 A;  3B6Y A;  4NXN L;  4B3S L;  4IFD J;  1PH1 A;  2JE6 I;  2R7F A;  4OON A;  4OWX B;  1L2F A;  4KI0 A;  1N36 Q;  2JK8 A;  4DV1 L;  1VQ6 A;  3JAM c;  1CSP A;  4A76 A;  1M1K C;  2NN6 I;  5FLM G;  2EXD A;  2A19 A;  1FJG Q;  4P74 A;  4B3M Q;  2HT1 A;  5H1S E;  3S14 H;  4HIO A;  3CCU A;  1KRS A;  5M5W H;  1N32 L;  4P73 A;  4JI1 Q;  3UE1 A;  4A93 H;  1K83 H;  3HOX H;  3FKI G;  3CCM A;  1Q7Y C;  2KBN A;  3MXN B;  3GTO H;  1IYJ B;  4GKJ L;  1I6H H;  5JJI A;  3GTQ H;  3E9I A;  4DV2 L;  1EYG A;  2Q2I A;  1XMO Q;  4A3G H;  5AJ3 Q;  1JE5 A;  1HZA A;  3PUW A;  4JI3 L;  2YTX A;  4DUZ L;  1JT8 A;  4LUZ A;  1JJ2 A;  4NPS A;  2ZM6 Q;  2ZTE A;  1IBL L;  4LF7 L;  4KHP Q;  1S3O A;  1J5E L;  1NE3 A;  1I94 L;  4NB3 A;  2A1A A;  2OWO A;  4LF8 L;  2I5H A;  2Z6K A;  3CP0 A;  3K0X A;  4LWC A;  1R9T H;  3WWV A;  3S1R H;  2OQK A;  3BZK A;  2BH8 A;  4GS3 A;  3TQY A;  1K9M C;  4JI4 L;  3M4O H;  2OTJ A;  4YCW A;  3CPW A;  1HNW Q;  1VQM A;  3HOY G;  2R93 H;  4LF4 L;  4A93 G;  4YCU A;  1TWF H;  3HOX G;  5JJL A;  2CQO A;  4LFB L;  3HKZ G;  3I4M H;  3EBE A;  2KCT A;  3S15 H;  2ATW A;  2R7Z H;  3S2D H;  4JI0 Q;  4A3G G;  1Q46 A;  4MTN A;  1AE2 A;  4JI2 Q;  1N34 L;  1SMX A;  1GKH A;  4IOA A;  1UWV A;  2DGY A;  3PSI A;  4AH6 A;  1HR0 L;  2VY3 A;  4QIW E;  1IBK L;  4PZ6 A;  2IX1 A;  3AFQ A;  2C35 B;  1UE5 A;  1LUZ A;  1B7Y B;  3CXC A;  1U5K A;  3HOU H;  4OWT B;  5E7N A;  2R92 H;  2YV5 A;  4PZ8 A;  4HID A;  5IYD H;  4DV7 L;  1KD1 C;  3I2Z A;  1P8L A;  1PA6 A;  4DV3 L;  4X66 Q;  1MJE A;  2R7Z G;  4IJH A;  3LGJ A;  1C0A A;  4AYB G;  1P16 A;  4R4I A;  5IWA Q;  5IYB G;  4WJ3 M;  4L5S A;  1WCM H;  4BY7 H;  2IX0 A;  2ZTD A;  2JA6 G;  3A5U A;  2OTL A;  1CKO A;  2Q2H A;  2Y0S E;  3A5Z B;  4K0K L;  2RHQ B;  3I4O A;  3L7Z C;  2VNU D;  4LF6 L;  3CCR A;  3ULL A;  1XTD A;  4P71 A;  1N32 Q;  4YWK A;  3DLL A;  1VS0 A;  2WAQ G;  4YY3 Q;  3CCV A;  4IOC A;  1PV4 A;  4LFC Q;  3HOU G;  2HIV A;  1E1O A;  4JV5 Q;  4GKJ Q;  2MO1 A;  3T1H L;  2R92 G;  4R4C A;  3KF8 B;  3D0F A;  4Y7N H;  5M3F H;  4DV2 Q;  1VQD A;  5IYD G;  5GAD C;  3BU2 A;  4MZ9 A;  4QL5 A;  1IBM Q;  4JI3 Q;  1E22 A;  4DUZ Q;  4DV6 Q;  3CC2 A;  1YHA A;  3RZO H;  1WCM G;  3RLN A;  4BY7 G;  4A3D H;  2E2I H;  1I5F A;  3CPF A;  4LW1 A;  4QY7 A;  4IJL A;  3G71 A;  1SN8 A;  2I5M X;  3PIO A;  4C3H H;  4NXM L;  1Q1B A;  3CQZ H;  2NVX H;  1YVC A;  5LMN Q;  2JEB I;  4XTC S;  2KCM A;  4JI4 Q;  2UXB L;  2YTV A;  1EQR A;  5LMU L;  5IY0 A;  3UDX A;  4YHH Q;  1UE6 A;  3TRZ A;  1ASZ A;  5C3E H;  1L1O A;  3W5O A;  4LFB Q;  5IYC H;  3PF5 A;  2UU9 L;  1SLJ A;  1VQF A;  4BA2 I;  1VQ4 A;  3K7U C;  3TEH B;  1XNQ Q;  4R4O A;  2VQE Q;  3KJP A;  3KOJ A;  2ZJP A;  5M3M H;  2UUB Q;  4Y52 H;  2QA4 A;  3RNU A;  3U4Z A;  3M85 A;  1PH5 A;  2XTI A;  3GO5 A;  4A3D G;  4JBJ A;  4GOP A;  4DV0 L;  1N33 Q;  1AE3 A;  2EQS A;  2EIF A;  2IHE A;  1IBK Q;  2UXD L;  4BBR H;  1FVI A;  1O7I A;  2K75 A;  3SGI A;  4C3I H;  2NZO A;  4LFA L;  3DM3 A;  2PI2 E;  3J81 j;  3S24 A;  5C3E G;  4JBK A;  5IP9 G;  5IYC G;  2YTY A;  1SFO H;  1EFW A;  2E2H H;  2JA7 G;  2N3S A;  3J80 i;  5GAG C;  1XNR L;  2JA5 H;  3PF4 A;  4WJ4 A;  1AH9 A;  1CKM A;  1KXL A;  4DV4 L;  1Y1W H;  3PO3 H;  1DGS A;  1UE1 A;  4GLV B;  3KF6 A;  1I50 H;  1YJW A;  5M3M G;  2B3G A;  1PH9 A;  4GKK Q;  2VQF Q;  3FP9 A;  1Z47 A;  4DR3 L;  3K7A H;  2AWO A;  1X55 A;  4LF6 Q;  1Y14 B;  1Z9F A;  3H0G H;  3KLW A;  1A62 A;  2LSS A;  4BBR G;  2BH2 A;  1E7Z A;  2ZJR A;  4JI8 L;  1J6Q A;  1VQ7 A;  2UUA L;  5JJK A;  4UP7 A;  4DR5 L;  4JI5 L;  1W2B A;  3S16 H;  1KRT A;  1VQN A;  1VQ8 A;  3S1N H;  2KHI A;  3L0O A;  2R6G A;  1L1O B;  1BKB A;  2D0O A;  3F8T A;  2VL6 A;  2JA5 G;  1K73 C;  4PZ7 A;  5LMN W;  4GNX C;  2OCE A;  5GAE C;  4X64 L;  4HJA A;  1Y1W G;  3PO3 G;  4B3R Q;  1X54 A;  2K5H A;  4DR2 Q;  3K8A A;  5J3B A;  1Q8K A;  2LXK A;  3PIP A;  4L5Q A;  1EQQ A;  1TWC H;  2A8V A;  1HH2 P;  1W3S A;  3H3V H;  4YWM A;  5ELO A;  3H3V I;  5C0X J;  4DUY L;  3J7Z C;  1C7Y A;  4OX9 Q;  3H0G G;  1N8R C;  4H02 A;  5DLQ E;  1PH4 A;  4PMW A;  3W1G A;  4X62 L;  3UDG A;  3U50 C;  1HR0 W;  1MIU A;  1YNX A;  3RLF A;  1LM0 A;  1HNX L;  2HQL A;  4MNO A;  4R1J A;  4YWL A;  4DNI A;  1IL2 A;  3CC4 A;  1GVP A;  4LNQ A;  3NBH B;  3ICE A;  1EOV A;  4JI6 Q;  2ALY B;  4KHZ A;  3NEN A;  2Y0S G;  5IT9 c;  3UDF A;  3OW2 A;  1QVF A;  4A3M H;  4LF9 Q;  4R4Q A;  1VQO A;  3S1Q H;  4BA1 I;  2UXD Q;  4DV5 L;  2BA0 A;  4LFA Q;  3TS0 A;  4L5R C;  4JYA L;  2ID0 A;  2PMZ E;  1PH2 A;  2R93 G;  4DR6 L;  5JEA J;  3RN5 A;  3ULP A;  4B3S Q;  4AQY L;  4LF5 L;  4NXN Q;  3AQQ A;  3GDE A;  2VW9 A;  5FLX c;  4QGU A;  4GNX A;  1HNZ L;  3I4M G;  1GD7 A;  5C0X I;  1TWH H;  2DUD A;  3ULJ A;  4DV4 Q;  1XMQ L;  5GRO A;  3HKS A;  4DV1 Q;  4X65 L;  1SRO A;  4DR1 L;  4O0A A;  3OTO L;  4KLK A;  2E5L L;  1VQL A;  4A3E H;  1OTC A;  4UY8 C;  2XGT A;  1IXR A;  3CAM A;  4DR3 Q;  4J15 A;  4JOI C;  4LUO A;  3HOZ H;  1YZ6 A;  1QZH A;  5GAH C;  2OQ0 A;  5BR8 L;  4BBS H;  4A3M G;  2BA1 A;  4FDB A;  1VQ5 A;  2UXC L;  2PQA A;  4B3T L;  3RN2 A;  1SRU A;  4A3L H;  3J7A 5;  3S2H H;  1VCI A;  4DR5 Q;  1M90 C;  4DK3 C;  4JI5 Q;  1G29 1;  1NY4 A;  3STB D;  2QGQ A;  4PG3 A;  3J80 c;  3U4V A;  3CCJ A;  2E8G A;  3I55 A;  5C0X G;  2KEN A;  3H15 A;  4DR2 L;  1VQ9 A;  4R4T A;  2D0P A;  3GTJ H;  4JI7 L;  3CME A;  2NVT H;  4BXX H;  2FXQ A;  4X64 Q;  1BVS A;  1HZ9 A;  4RG1 A;  1IBL Q;  4LF7 Q;  3W1B A;  1J5E Q;  1I94 Q;  3K81 C;  4B3M L;  4EX5 A;  5K36 G;  4ALP A;  2MO0 A;  5C4J H;  3UE0 A;  1KL9 A;  5M5X H;  4LF8 Q;  1A63 A;  1G6P A;  4BY1 H;  3TRE A;  4XIG S;  2Q2U A;  3UDI A;  4IPG A;  3HOZ G;  3VDY A;  2Z0S A;  4JI1 L;  4BBS G;  4HJ8 A;  4JBM A;  1HZC A;  1EWI A;  1PYS B;  2GVB A;  4LF4 Q;  1PH8 A;  1E1T A;  2CFM A;  3RR5 A;  4A3L G;  1VQA A;  1SE8 A;  1XMO L;  1NTG A;  5FJ8 H;  5AJ3 L;  1FGU A;  5M3F G;  2JA8 H;  4GN3 B;  3AFP A;  1K3R A;  1PVO A;  1N34 Q;  2I5L X;  2L15 A;  1HNX Q;  1XPR A;  4EQ5 A;  4P72 A;  4A3K H;  1BBW A;  2WFW A;  4L5T A;  2B29 A;  1E24 A;  3PUZ A;  4IPH A;  4JOI A;  1MKH A;  5JEA G;  1T9H A;  1VQJ A;  3BJU A;  1CKN A;  3T1Y L;  1HR0 Q;  1VQG A;  2MNA A;  3KJO A;  1JB7 A;  1NJI C;  1Q86 C;  5IP7 H;  1QUQ A;  4BY1 G;  2F3I A;  3J81 c;  2HIX A;  3CCL A;  1WOC A;  2K4K A;  3PUX A;  4A75 A;  1XJV A;  2PQA B;  4DV7 Q;  4AQY Q;  2AWN A;  1PH6 A;  2NVQ H;  4JI0 L;  4DV3 Q;  1V1Q A;  1YHQ A;  2JA8 G;  4JI2 L;  3I7F A;  2UUC L;  1X3G A;  1XMQ Q;  5GQO A;  2HHH L;  3A74 A;  1CSQ A;  5FLM H;  2CWP A;  4DR1 Q;  1VQP A;  1NBW A;  3HFZ B;  1L0W A;  4UPA A;  2RHS B;  4DR7 L;  3CD6 A;  1Q12 A;  4K0K Q;  3CCQ A;  2IY5 B;  2VZA A;  1IZ6 A;  3F2C A;  1X3F A;  2K50 A;  4TQU S;  2N49 A;  5BR8 Q;  2MQH A;  2R7D A;  1UE7 A;  3FKI H;  1VQK A;  4DAY B;  1JMC A;  2AMC B;  3G48 A;  1X56 A;  2ZTC A;  4HJ7 A;  1OXX K;  2D62 A;  3T1H Q;  3EN2 A;  2B63 H;  3GTL H;  1OXT A;  4A3F H;  2F4V L;  3NEL A;  4X66 L;  3GTM H;  1YJ9 A;  5IWA L;  3OYY A;  1JJG A;  1QVC A;  1X6O A;  4A3I H;  4JI7 Q;  1ASY A;  1QZG A;  2JEA I;  4HIK A;  2YU9 H;  3F2B A;  5C44 H;  3M9B A;  4NXM Q;  4OWW B;  1I3Q H;  3F1Z A;  4A3B H;  3U58 A;  1CKN B;  2UXB Q;  4GOP B;  4UP8 A;  5LMU Q;  3HOY H;  4YY3 L;  3J81 i;  2RF4 A;  2WB1 E;  3KDF A;  3EIV A;  4LFC L;  4JV5 L;  1X65 A;  1QUQ B;  1Q81 C;  3GTG H;  1A0I A;  2GN5 A;  2UU9 Q;  2IT1 A;  3PV0 A;  1YIJ A;  2B63 G;  4OO1 I;  3ERS X;  1KC8 C;  4A3F G;  1HJP A;  1LTL A;  4YCV A;  1FL0 A;  1IBM L;  4ME3 A;  4JBW A;  4DV6 L;  3A0J A;  1PH3 A;  4A3I G;  1S40 A;  1PHJ A;  2NN6 G;  4IPD A;  1XPU A;  2N78 A;  2F52 A;  1EUJ A;  4IFD I;  4GLX A;  3CCS A;  2CKZ B;  3KF6 B;  3T1Y Q;  4DV0 Q;  1QVG A;  3E0E A;  5C44 G;  1OXU A;  4C3J H;  5LMN L;  1Q1E A;  3F2D A;  3RLO A;  4A3B G;  3AYH B;  4IPC A;  1KIX A;  3PUV A;  4YHH L;  4X6A H;  2LXJ A;  4O2D A;  1Y1V H;  3CCE A;  3K80 C;  1JJC B;  5HY6 A;  3ER0 A;  4HJ9 A;  2CCZ A;  4DR4 Q;  1WYD A;  4A3C H;  2K14 A;  1KHI A;  1XNR Q;  2V1C C;  5IYB H;  3M3Y H;  1G51 A;  1TXY A;  2CWA A;  2VQE L;  2E2J H;  1UEB A;  1XNQ L;  4TVA B;  2UUC Q;  2AKW B;  3JAM i;  3CF5 A;  2HHH Q;  2UUB L;  2JA6 H;  3HOW H;  4OO1 G;  3FHW A;  1YBY A;  4OXP A;  1K8A C;  1WI5 A;  3GTP H;  1X3E A;  1N9W A;  4IFD G;  4DR7 Q;  1GM5 A;  1EIF A;  4UP9 A;  1N33 L;  3ZJY C;  1V43 A;  2ES2 A;  3S1M H;  5EAY A;  3I4N H;  3PO2 H;  2WP8 J;  1GO3 E;  3IRB A;  3GD7 A;  1VQI A;  1Q82 C;  4JI8 Q;  3HKZ E;  1NMG A;  2Q2T A;  2UUA Q;  1B70 B;  4DPG A;  2GVA A;  3HOV H;  3MEF A;  3KDF B;  1K0R A;  1Y1V G;  3JC6 6;  4AIM A;  2F4V Q;  1L1O C;  3STB C;  4A3C G;  1N36 L;  3Q8D A;  1C9O A;  3CW2 C;  2PI2 A;  2K5N A;  4QQB X;  1D8L A;  3KYH C;  2PNH A;  1V9P A;  4P75 A;  1VQC A;  3HOW G;  2KHJ A;  4GKK L;  1FJG L;  2VQF L;  1PH7 A;  1EIY B;  1TWG H;  3M4P A;  2QEX A;  4A3E G;  1LYL A;  3M7N A;  2K5V A;  3BZC A;  2K52 A;  4DK6 C;  1YHB A;  1VQH A;  2IHF A;  2MFI A;  4QJF A;  2ZJQ A;  3L2P A;  1E3P A;  4DUY Q;  4GOP C;  4HJ5 A;  3I4N G;  3PO2 G;  5C4X H;  1YI2 A;  1SR3 A;  4JC0 A;  1PYB A;  1CUK A;  1D7Q A;  1X9N A;  2YYZ A;  3NEM A;  5IE8 A;  3M4Q A;  4DAM A;  4X62 Q;  3HOV G;  5HGQ A;  3PCO B;  4HIM A;  4AYB E;  4A3J H;  4LUV A;  4C2M H;  3RZD H;  3AEV A;  5M5Y H;  4GNX B;  2VUM H;  4RMF A;  2ZM6 L;  3GTK H;  4KHP L;  4B3R L;  1A8V A; 
#chains in the Genus database with same CATH topology
 3WOF A;  1NR2 A;  1KAW A;  1YJN A;  4GN4 B;  3V2T A;  3D31 A;  3NBI A;  3RMH A;  1YEZ A;  3G6E A;  5FO8 B;  4DV5 Q;  3HZX A;  4CDF C;  4DKA C;  4GLA C;  5C4X G;  4BY7 B;  1ET9 A;  1JIC A;  2JA9 A;  4DR6 Q;  3E9H A;  1H9S B;  2A6H C;  3I56 A;  1DXM A;  1U0L A;  5FJ8 G;  3SHL A;  2RCN A;  1NNX A;  2DN8 A;  3PGZ A;  1IW7 C;  1ILP A;  1EQT A;  1STA A;  3S17 H;  1WFQ A;  2I0Q A;  4POG A;  5IP7 G;  2Z6K C;  3CC7 A;  1PFB A;  4A3D B;  2I07 B;  3CQZ B;  4FXK C;  4DV1 L;  1VQ6 A;  1C8C A;  1CSP A;  1EIH A;  4EQO A;  5FLM G;  2A19 A;  2F0U A;  2NWG A;  3T51 B;  3HOX H;  3CCM A;  2F0N A;  1CI3 M;  3GTO H;  1QJO A;  3E9I A;  4DV2 L;  1EYG A;  2J0T D;  4A3G H;  2FJ2 A;  2AUK A;  3ERO A;  1HZA A;  1QE6 A;  4BBR B;  1SAP A;  4LUZ A;  1JJ2 A;  2ZM6 Q;  3FPP A;  2I5H A;  1SFO B;  1S5F D;  2OQK A;  3BZK A;  2BH8 A;  3IKJ A;  3M4O H;  2OTJ A;  2JA5 B;  5DAU A;  1SBB B;  2L4N A;  4YCW A;  4LFB L;  3HKZ G;  3EBE A;  1WTP A;  2KCT A;  1YNJ C;  3K7A B;  2ATW A;  3S15 H;  3OIQ A;  2LKV A;  4DK1 A;  4JI0 Q;  4IZ8 A;  2A6E D;  1N34 L;  4JI2 Q;  1F2M A;  4IOA A;  1UWV A;  4RH6 A;  2DGY A;  3PSI A;  3I73 A;  4I7Z C;  3KUP A;  3A7A B;  3P20 A;  1LUZ A;  1Q90 A;  2RA4 A;  1HFN A;  5E7N A;  4GZY C;  2RDG A;  4HID A;  1PA6 A;  1B9N A;  5D3D A;  1P16 A;  4WJ3 M;  4K2K A;  3QO2 A;  4L5S A;  3M4O B;  2ZTD A;  2OTL A;  1LTA D;  2Y0S E;  1D5M C;  3L7Z C;  1S5E D;  1FNW A;  1BCP D;  1TS4 A;  2X6L A;  4P71 A;  1ILQ A;  3DLL A;  1VS0 A;  2AQ2 B;  4LFC Q;  1STE A;  2HIV A;  3NTI A;  1F2Y A;  2MO1 A;  5EPJ A;  4GKJ Q;  3KF8 B;  5IYD G;  1TT2 A;  2X6G A;  4L8J A;  5IGF A;  1DYQ A;  3CC2 A;  3NPP A;  1Y8O B;  5JEA H;  3RZO H;  4BY7 G;  3RLN A;  1G2S A;  5COY A;  2F1M A;  5I9O A;  4C3H H;  1SYE A;  1YVC A;  4WJW A;  4JI4 Q;  2YTV A;  1TWH B;  5LMU L;  5IY0 A;  2K5Q A;  1B2T A;  3U9O A;  1UE6 A;  1ASZ A;  5C3E H;  1GXD C;  1SNP A;  5IYC H;  5IOC A;  3PF5 A;  2UU9 L;  4H44 C;  2JSO A;  2RDH A;  3T13 A;  2XWJ B;  3TEH B;  1PYW D;  1PZK D;  3HOZ B;  3KOJ A;  2QA4 A;  3RNU A;  3M85 A;  1PH5 A;  2XTI A;  1CQV A;  4A3D G;  1B50 A;  2O4X A;  2XRQ D;  1HUN A;  2IHE A;  4ZUJ A;  1O7I A;  2F0P A;  1LT3 D;  4LFA L;  3GV6 A;  3WOE A;  3T4A C;  4CDE C;  2PI2 E;  3RZO B;  2F0D A;  1VMP A;  4JBK A;  5FLX E;  4KTA A;  2YTY A;  4DR4 L;  2E2H H;  5GAG C;  4C3H B;  5M5X B;  3PF4 A;  4WOR A;  4DK0 A;  2K7V A;  1Y1W H;  2TMP A;  2F0E A;  1TII D;  1YNN D;  2B3G A;  4GKK Q;  1IHZ A;  3FP9 A;  1Z47 A;  4RHS A;  1XX8 A;  2MHV A;  2B2U C;  1Y14 B;  1Z9F A;  1BCP B;  5NUC A;  3H0G H;  5EJW A;  1A62 A;  2JXM B;  4BBR G;  1WTR A;  1CA6 A;  1EL0 A;  1J6Q A;  1VQ7 A;  4PV1 C;  2HCI A;  1TY0 A;  1LO5 D;  2R6G A;  1A3V A;  4N8F A;  1S4Z A;  3Q23 A;  2JA5 G;  1EWH A;  2EY5 A;  5LMN W;  3SVM A;  5J3B A;  1Q8K A;  2LXK A;  1QB5 D;  5EQ0 A;  3H3V H;  1JQY D;  1D6E C;  1B3A A;  1SNQ A;  1EYC A;  5C0X J;  4DUY L;  4TSS A;  4H02 A;  2CQA A;  5DLQ E;  4KKS A;  2F03 A;  4MNO A;  2A6E C;  5BN3 A;  4LNQ A;  3MTS A;  3MAQ A;  4R9W A;  4H7B A;  2B63 B;  3T56 B;  2KCC A;  3OPO A;  3UDF A;  3OW2 A;  1CQF A;  2MP1 A;  2F0J A;  4A3M H;  4R4Q A;  4CJ2 C;  1QVF A;  3S1Q H;  2UXD Q;  4DV5 L;  2BA0 A;  2ENB A;  2ID0 A;  2F0S A;  4DR6 L;  4KN7 C;  3RN5 A;  2AUJ D;  4B3S Q;  5DNF A;  4NP5 A;  4GNX A;  1I4G A;  1LTI D;  1F2Z A;  3OMC A;  5HGT A;  2LFN A;  1SRO A;  4X3T A;  4A3E H;  1ZYR C;  5K36 H;  3C3L A;  5IOD A;  2F4I A;  4LUO A;  1YZ6 A;  1QZH A;  5GAH C;  1EIG A;  2OQ0 A;  4BBS H;  1JR0 D;  4FDB A;  1VQ5 A;  2WV6 D;  1F77 A;  4LAA A;  3QR8 A;  3STB D;  3J80 c;  3CCJ A;  3AMU A;  2D0P A;  4ZQ3 A;  3R3O A;  5T1I A;  4BXX H;  2FXQ A;  1LTB D;  5E1F A;  3KLS A;  2RKS A;  4K5V A;  1J5E Q;  1I94 Q;  1DJR D;  2K05 A;  2MO0 A;  5C4J H;  3UE0 A;  4DAY A;  3Q22 A;  3TRE A;  3HOZ G;  3K57 A;  4IPG A;  1MHW C;  1PFN A;  2Z0S A;  1F2L A;  1PTO D;  1EWI A;  2GVB A;  1PH8 A;  3RR5 A;  3RUZ A;  4KJN A;  1NTG A;  4Q5V A;  2JA8 H;  4F7X A;  2AQ3 B;  3I4N B;  2I5L X;  2L15 A;  1HNX Q;  3KLS X;  4A3K H;  1BBW A;  2A68 D;  2KHS A;  1ZEQ X;  3PUZ A;  1MKH A;  5JEA G;  3MXP A;  3NK9 A;  3K5N A;  3VR2 A;  2XIW A;  2MPM A;  4C3H G;  2A69 D;  5JJZ A;  2D2C C;  2HIX A;  3PUX A;  4A75 A;  1TS5 A;  1TWG B;  2PQA B;  2E74 C;  4DV7 Q;  4ZCK A;  5I2X A;  4JI0 L;  1V1Q A;  3L3O C;  1GOZ A;  4JI2 L;  3I7F A;  3H3V C;  1XMQ Q;  5GQO A;  1EY0 A;  5A35 A;  2V4D A;  1PTO H;  3HFZ B;  2K1B A;  1GUG A;  4UPA A;  5IGE A;  1F9R A;  3SR1 A;  3PQI A;  1K28 A;  2K03 A;  5BR8 Q;  2N49 A;  2MQH A;  1UE7 A;  3FKI H;  5M5Y B;  4J6H A;  1X3Q A;  4A3K B;  1BUV T;  2VUM B;  3G48 A;  5D14 A;  2QF7 A;  3T1H Q;  3EN2 A;  2F0I A;  3GTL H;  3H91 A;  1D1K A;  3TSS A;  4A3F H;  2PZU A;  2CH4 A;  3OYY A;  4A3I H;  1DON A;  2P5Z X;  2NN6 H;  3A8J E;  4HIK A;  2SNS A;  3C2P A;  1TU2 B;  3M9B A;  4NXM Q;  4F88 A;  2UXB Q;  2Z4H A;  3HOY H;  4LFC L;  1X65 A;  1QUQ B;  3SK6 A;  3GTG H;  3QG1 A;  4OO1 H;  5KYI A;  2B63 G;  1LTL A;  1DD2 A;  1PH3 A;  3A54 A;  4QUF A;  1XPU A;  2N78 A;  2B2U A;  4RGT A;  4CBV A;  2L1B A;  4GLX A;  1LV9 A;  1TWA B;  3T1Y Q;  5BN5 A;  4FP5 D;  3GTL B;  1HTL D;  1D2B A;  3R93 A;  3AYH B;  3PIP 3;  1ML0 D;  2HQE A;  4OEM B;  2LXJ A;  2F0T A;  3MFY A;  1JJC B;  4K6D A;  1WYD A;  2CWA A;  1GJX A;  1FYC A;  2TSS A;  3JAM i;  3CF5 A;  5M5W B;  2HHH Q;  3HOY B;  2EYJ A;  4A93 B;  4OXP A;  3GTP H;  3MWY W;  1XTC D;  1PTO F;  1EEF D;  1V43 A;  1SE4 A;  3R2I A;  1CA5 A;  2WP8 J;  1HQM C;  3HKZ E;  3MEH A;  2UUA Q;  1JCK B;  1ICW A;  3DEO A;  1R9T B;  3STB C;  2K5W A;  1N36 L;  3JAM E;  2F0Q A;  1M8A A;  4QQB X;  2BDO A;  5CC4 A;  4GKK L;  4LK1 C;  1EIY B;  1TWF B;  4A3E G;  1JOR A;  1F9P A;  1LTS D;  4DK6 C;  2MFI A;  2IHF A;  2ZJQ A;  2EOT A;  2Z4I A;  3L2P A;  4KY5 A;  3I4N G;  2B8G A;  5C4X H;  3VYS A;  3SE0 A;  4F8M A;  1PTO C;  3VR5 A;  4S3S A;  1F9Q A;  3NEM A;  3M4Q A;  4DAM A;  4X62 Q;  5DM6 3;  1IYU A;  1J9O A;  2SDF A;  1RTN A;  5C3W A;  1A15 A;  3KBG A;  4FYD A;  4KHP L;  1OO9 B;  2MGS A;  3HOU B;  4IO9 A;  4BXX G;  2R92 B;  1PDQ A;  3HEJ A;  2L12 A;  4K5X A;  4N9T A;  1B3Q A;  3X3N A;  4PNY A;  1HNW L;  1H95 A;  4JYA Q;  1PFS A;  4HSP A;  2G5D A;  5IP9 H;  5EPK A;  2RDF A;  3D6W A;  2JA7 H;  4IUR A;  5D65 A;  4IUQ A;  5DM7 3;  3NSW A;  1LT6 D;  2EZV A;  1WTO A;  4X65 Q;  1YIT A;  4A3K G;  2VUM G;  1VQB A;  1B44 D;  4DFA A;  4Y7N B;  1U4L A;  2NYZ D;  5FO9 B;  1XPO A;  4APV A;  4CHT B;  1EY9 A;  1HPC A;  2F0K A;  2JJQ A;  4GN5 A;  5IGG A;  2ASB A;  4POF A;  1BBU A;  2EYP A;  4B3T Q;  1B8A A;  2F0M A;  2H5X A;  1EY4 A;  3PUY A;  2JQO A;  2E2I B;  4B3S L;  1PH1 A;  2O5J C;  2F0O A;  4OON A;  5KYL A;  2NVX B;  1L2F A;  1X32 A;  2IW3 A;  1ENA A;  2BOS A;  3HS0 C;  1UEA B;  4A76 A;  2EXD A;  4P74 A;  3W3A A;  1VMC A;  2B2W C;  1MBY A;  1LT4 D;  4HIO A;  3S14 H;  3CCU A;  3V96 A;  2CW0 D;  4JI1 Q;  3UE1 A;  3LWE A;  1K83 H;  3FKI G;  2KBN A;  3MXN B;  4KV6 A;  3GTQ H;  1HFG A;  4M1U B;  3FDT A;  4DUZ L;  1JT8 A;  4ZYS A;  1EYA A;  1S3O A;  3P1H A;  1J5E L;  1I94 L;  4NB3 A;  1CFM A;  2PW7 A;  4BS9 A;  3CP0 A;  3K0X A;  4H13 C;  4GS3 A;  4OIK A;  4FF3 A;  4IQZ A;  3TQY A;  2SEB D;  4L6T B;  1U9R A;  3CPW A;  1VQM A;  3HOY G;  4A93 G;  4YCU A;  1NAP A;  1PRT B;  5FOB B;  3S2D H;  1QOH A;  1S5B D;  4KD4 A;  3S14 B;  5IGD A;  1GKH A;  5FLX L;  2XRS D;  3ERQ A;  2EJM A;  4AH6 A;  2BDN A;  3GTQ B;  4IUU A;  3HP3 A;  4N8X 1;  4K5W A;  1B7Y B;  5C5L A;  1U5K A;  5EKI A;  4OWT B;  1HA6 A;  5CGK A;  3IFD A;  4PZ8 A;  5IYD H;  4DV7 L;  1I6V C;  1KD1 C;  3I2Z A;  4P2C B;  1P8L A;  2OXP A;  5C0X H;  1MJE A;  1UAP A;  4IJH A;  1SEB D;  4I65 A;  1C0A A;  2RVL A;  4BY7 H;  2IX0 A;  5C3X A;  2Q2H A;  1KLG D;  1O7L A;  4PMC A;  1K8O A;  1JOK A;  2F0V A;  1XWE A;  5KGU A;  4LF6 L;  3CCR A;  1N32 Q;  4UHV A;  1B1Z A;  4RGO S;  4CGY B;  3CCV A;  4IOC A;  3HOU G;  4R8N A;  4C1N K;  4JV5 Q;  3T1H L;  2R92 G;  4QF4 A;  2F0G A;  4DU9 A;  1IBM Q;  4JI3 Q;  1YHA A;  2Q8T A;  1AZP A;  5KRU A;  1RF2 D;  1TVX A;  3M7G A;  4LW1 A;  1EU3 A;  3TP6 A;  4A3D H;  3G71 A;  5BN4 A;  4NXM L;  3CQZ H;  1WTW A;  2JEB I;  4XTC S;  2KCM A;  2UXB L;  1PZI D;  1AP0 A;  1KTK A;  1SNC A;  3UDX A;  1KNE A;  2CH4 W;  5KNC A;  1K3B C;  2KVM A;  3D3R A;  1SLJ A;  4JW0 A;  2ZJP A;  4JK1 C;  2UUB Q;  1CT1 D;  2CHB D;  3TZU A;  3U4Z A;  2ZT9 C;  3S2H B;  3GO5 A;  2WAC A;  1ESF A;  5IT9 E;  1AE3 A;  1EY5 A;  2D9U A;  1IBK Q;  4BBR H;  2B2T A;  4MIU A;  2FIN B;  5ELF A;  3GTJ B;  1H9R A;  3QB3 A;  2NVT B;  3DM3 A;  4HED A;  4G4K A;  3SK8 A;  5IP9 G;  3U9S A;  5I9P A;  1SFO H;  2JA7 G;  1AH9 A;  2JA5 H;  1CKM A;  4DV4 L;  4IUP A;  3EJI A;  4BY1 B;  5JPM C;  5M9O A;  1DGS A;  1UE1 A;  1I50 H;  1WTQ A;  1AW7 A;  1A2T A;  2L5T A;  4DN4 M;  3K7A H;  2KUM A;  1WTH A;  2AWO A;  1MSH A;  1E2Z A;  1J8I A;  3KLW A;  2LSS A;  3MZ5 A;  1QG7 A;  5JAV A;  1SYC A;  1S5D D;  2UUA L;  3D4R A;  3K5O A;  4JI5 L;  3NTK A;  5CV5 A;  1EY8 A;  1KRT A;  1VQN A;  4HN7 A;  1L1O B;  1LTR D;  1K73 C;  4GNX C;  4X64 L;  4MHE A;  3N6R A;  3NQT A;  2K33 A;  3J7A V;  3G7L A;  3E0J A;  5ELO A;  3H3V I;  3SEB A;  3J7Z C;  1C7Y A;  1HQR D;  2FMM A;  3WDN A;  1I50 B;  2O5I C;  4F87 A;  3TN2 A;  4X62 L;  3UDG A;  1MIU A;  5CV9 A;  4DNI A;  1IL2 A;  2NTT A;  2B2W A;  1EY7 A;  4IFD H;  1EOV A;  3E5S A;  3NEN A;  1JB3 A;  2BE5 D;  1TKW B;  4ZUI A;  1EZ8 A;  3NWS A;  5DEH A;  4LF9 Q;  1W6K A;  3J81 E;  4L5R C;  3H09 A;  4JYA L;  4KHV A;  2N55 A;  2A5H A;  5C44 B;  1RJT A;  1TWH H;  2DUD A;  1BO0 A;  5GRO A;  4X65 L;  4DR1 L;  1GUN A;  4KLK A;  1H9K A;  2G9H D;  3OSO A;  1LLR D;  2XGT A;  4DR3 Q;  1B4O A;  4J15 A;  3HOZ H;  1H9M A;  3ZYY X;  2Q8R E;  1B53 A;  2Z8L A;  4B3T L;  2QDL A;  1SRU A;  4DR5 Q;  1O7Z A;  1NY4 A;  4ABN A;  4ZAI A;  3U4V A;  5C0X G;  3H15 A;  4X3K A;  2IJ0 A;  4R4T A;  1ENF A;  1L0Y B;  4RGN A;  1BVS A;  3UI2 A;  1Z7T A;  3EQL C;  4ALP A;  2B2V A;  4LF8 Q;  5M5X H;  1A63 A;  2DJF C;  4K2L A;  4K8I A;  2E75 C;  4JI1 L;  5C6A A;  3IAY A;  1HZC A;  3MFG A;  1E1T A;  4A3L G;  4CKC A;  2DY7 A;  2XVS A;  2XWB B;  3VR3 A;  5ELC A;  5LL6 S;  4GN3 B;  3AFP A;  1K3R A;  3S1M B;  1PVO A;  3PO2 B;  3T16 A;  4E6I A;  2WFW A;  1T9H A;  1CKN A;  2MNA A;  1NUC A;  3HOV B;  5KEE A;  1Q86 C;  4FXD A;  2VB2 X;  4BY1 G;  3CCL A;  2E2D C;  2EXZ A;  3ITP A;  4AQY Q;  3ND9 A;  4DV3 Q;  1YHQ A;  1AN8 A;  2UUC L;  3A74 A;  1IL8 A;  1WD0 A;  2F0L A;  3KLR A;  2RHS B;  5L37 A;  5FK9 C;  4DR7 L;  3JAM L;  1X3P A;  4RGM A;  3F2C A;  5G3L D;  2K50 A;  3RZD B;  1KDA A;  1BR9 A;  1VQK A;  4X3S A;  1EYD A;  1X56 A;  4HJ7 A;  4QUC A;  1OXX K;  2D62 A;  5EKL A;  2B63 H;  4KKT A;  1II3 A;  2NVY B;  1QVC A;  1X6O A;  4JI7 Q;  3G6J B;  1QZG A;  2WB1 B;  2JEA I;  1CZW A;  1I3Q H;  4U68 A;  3F1Z A;  3NP8 A;  5CBA E;  4GOP B;  3KDF A;  3EIV A;  4JV5 L;  2KQ3 A;  2OEO A;  3IFT A;  1EOT A;  4B08 A;  1SJH D;  2EPB A;  1G2T A;  4OO1 I;  4IUT A;  3ERS X;  1ZKO A;  3I8Z A;  2F0F A;  4YCV A;  3TDQ A;  1IBM L;  3A0J A;  2EY1 A;  1BCP F;  2LY7 A;  1T5X D;  1S40 A;  4X3U A;  1STG A;  4XXE A;  1O7Y A;  1GHK A;  1QVG A;  4FNF A;  3E0E A;  4EVO A;  5C44 G;  1RKN A;  3RLO A;  3CRL C;  1KIX A;  3PUV A;  3SDZ A;  1JWS D;  3CCE A;  3MC0 B;  2CCZ A;  2K14 A;  3M3Y H;  2V1C C;  5IYB H;  1TXY A;  1I3Q B;  3HG9 A;  2UUB L;  4NKL A;  3FVQ A;  2O2L D;  1YBY A;  1WI5 A;  1X3E A;  1SND A;  4IFD G;  1EIF A;  1RDP D;  4CJ0 B;  2ES2 A;  5EAY A;  3I4N H;  1ROD A;  1BCP C;  3OWE B;  1SSO A;  3A7L A;  3K5M A;  1GO3 E;  3IRB A;  3GD7 A;  1VQI A;  1Q82 C;  4JI8 Q;  1H9S A;  1NMG A;  3MEF A;  1V1O A;  2NZ1 D;  3JC6 6;  5E4W C;  2F4V Q;  1EEI D;  3NUC A;  1C9O A;  3K59 A;  1D8L A;  1MSG A;  1RD9 D;  2DNC A;  1TWG H;  3M4P A;  4HMJ A;  1LYL A;  2K5V A;  3BZC A;  1FGB D;  1YHB A;  2R7Z B;  4QJF A;  3M3Y B;  4AYB B;  4GOP C;  4HJ5 A;  3PO2 G;  1HCZ A;  1PYB A;  1IKM A;  2YYZ A;  2FMC A;  1STB A;  2K01 A;  3HOV G;  3PCO B;  4HIM A;  4LUV A;  2DJG C;  4RCO A;  5M5Y H;  2KEE A;  2WAQ B;  1ICF B;  2VUM H;  2ZM6 L;  5G3L F;  3TS2 A;  2AHO B;  2EVB A;  1KQS A;  1OXV A;  4DNT B;  1IYV A;  1WCM B;  4RHR A;  1TS3 A;  4JG2 A;  5AFW A;  1CM9 A;  3C1E A;  3FPU B;  1OXS C;  4B9X A;  2L11 A;  4LMQ D;  2PCF B;  3OTO Q;  5ELN A;  3I90 A;  1YNN C;  2VS1 A;  3BG3 A;  2GA4 B;  4LF9 L;  5D3I B;  2LMC B;  1MJC A;  3BDO A;  5CBE E;  4HMI A;  2WB1 G;  1SNM A;  1TY2 A;  1TWA H;  1VQE A;  1S72 A;  3B6Y A;  1WD1 A;  4IFD J;  2L9H A;  2R7F A;  4KI0 A;  5CV6 A;  4ZLT F;  1FJG Q;  3OWF A;  4B3M Q;  5T1G A;  1BOS A;  5M5W H;  4P73 A;  1QIL A;  1U4R A;  4A93 H;  4LJZ C;  5M3M B;  5JVG 3;  1Q7Y C;  4GKJ L;  1IYJ B;  1I6H H;  5JJI A;  1FD7 D;  1BQQ T;  2Q2I A;  2L0C A;  1XMO Q;  5AJ3 Q;  2IWH A;  2ICI A;  3SK4 A;  4B9W A;  3PUW A;  4DXF A;  2YTX A;  4NPS A;  4C3I B;  5ISR A;  3AU7 A;  5HUR A;  1QNU A;  1AEX A;  1NE3 A;  1SYF A;  2A1A A;  4LF8 L;  1R9T H;  3S1R H;  4JI4 L;  1K9M C;  4V19 0;  1CTM A;  3PO3 B;  3KF8 A;  3MHB A;  1TWF H;  2PPB C;  5JJL A;  2CQO A;  2KA7 A;  1A6X A;  4QIW B;  4DF7 A;  4MTN A;  2JN4 A;  5IGC A;  1LAC A;  2EYF A;  1I6H B;  1DOM A;  2VY3 A;  3K5L A;  3S16 B;  4HCE A;  4PZ6 A;  4HSV A;  2C35 B;  4HAE A;  4NW2 A;  2I46 A;  3HOU H;  1VF7 A;  2HCC A;  2R92 H;  2YV5 A;  2ZXP A;  4DV3 L;  4X66 Q;  2R7Z G;  3LGJ A;  1EQV A;  4AYB G;  5IYB G;  3S1R B;  3D4W A;  2B2Y C;  3A5U A;  4M8A A;  4FF1 A;  2WIN B;  2RHQ B;  2VNU D;  1SE3 A;  1XTD A;  4DAV A;  3HGB A;  4YWK A;  2E76 C;  5I6Y A;  2WAQ G;  4YY3 Q;  3MXU A;  2B2T C;  1WTV A;  4Y7N H;  4DV2 Q;  1VQD A;  5C5M A;  5GAD C;  3BU2 A;  1SMY D;  4MZ9 A;  4QL5 A;  1E22 A;  2KED A;  4YIJ A;  4NMZ A;  1WCM G;  2K6A A;  4G7H C;  2A68 C;  4QY7 A;  2Q8I B;  2E2I H;  4IJL A;  4XYO A;  1SN8 A;  2I5M X;  3PIO A;  1Q1B A;  2NVX H;  3J7A F;  1PXU A;  3KBX A;  1EQR A;  2A69 C;  1WVL A;  1PRT D;  4YHH Q;  1F9S A;  2LS0 1;  3R2T A;  4LFB Q;  1VQF A;  1SYG A;  1VQ4 A;  3TZD A;  3FMC A;  2SOB A;  2VQE Q;  3TP5 A;  2ZXO A;  3KJP A;  4Y52 H;  4K8J A;  3RD4 A;  2RQX A;  4RA8 A;  4JBJ A;  4GOP A;  4PQX A;  2EQS A;  4TKO B;  2UXD L;  3Q0A A;  2NZO A;  1KAB A;  3DWA A;  3E3X A;  3S24 A;  1GUT A;  2A6H D;  4I7A A;  1EFW A;  1WTX A;  2N3S A;  3J80 i;  2IPK D;  2JP1 A;  5IGB A;  1IW7 D;  1YJW A;  5M3M G;  2KOL A;  2VQF Q;  4EQP A;  5E3F A;  1STY A;  1X55 A;  2D5D A;  2VB3 X;  3PMF A;  4MTK A;  1E7Z A;  2C9O A;  4C3I G;  4JI8 L;  5JJK A;  5COR A;  4DNR B;  1BF4 A;  1W2B A;  2EY2 A;  4ILW A;  3N52 A;  3J80 E;  1VQ8 A;  4J8Q A;  3S1N H;  5I6W A;  3F8T A;  5CR3 A;  2RSN A;  3MXG A;  2VL6 A;  4PZ7 A;  2OCE A;  5GAE C;  3PO3 G;  4B3R Q;  2K5H A;  3K8A A;  4OL7 A;  1EQQ A;  2A8V A;  1HH2 P;  1W3S A;  3VYT A;  2NVQ B;  2WII B;  4YWM A;  1CHP D;  2XNA C;  3VYR A;  1FNV A;  4OX9 Q;  4K14 A;  3HRZ C;  1PH4 A;  4PMW A;  3DWP A;  3VR4 A;  3W1G A;  1G91 A;  4BWG B;  4OGQ C;  1HR0 W;  2EYL A;  1R4Q B;  1YNX A;  2PNR C;  1HNX L;  4OIJ A;  1GVP A;  3NBH B;  2PMZ B;  4JI6 Q;  2ALY B;  3S1N B;  4BA1 I;  3GTM B;  2B2V C;  2WKD A;  4LFA Q;  5LHY 1;  2ICE C;  3TS0 A;  1PH2 A;  4C56 C;  1YNJ D;  2YU9 B;  3ULP A;  4NXN Q;  3GDE A;  2VW9 A;  5FLX c;  4QGU A;  5ELE A;  1KNA A;  4A3B B;  1XMQ L;  2AQ1 B;  3OTO L;  1VQL A;  4QB4 A;  3BVZ A;  1PRT F;  2EE1 A;  1UUP A;  2L55 A;  1D5X C;  5BR8 L;  4FF4 A;  2BA1 A;  4C1N I;  2PQA A;  4A3L H;  3J7A 5;  3S2H H;  4DK3 C;  4KJO A;  1G29 1;  2QGQ A;  4PG3 A;  1VQ9 A;  2E8G A;  1BDO A;  1I4X A;  4DR2 L;  3GTJ H;  3CME A;  2NVT H;  3L9A X;  3CHB D;  1HZ9 A;  4RG1 A;  4ZRZ A;  1IBL Q;  4HTH A;  3W1B A;  4LF7 Q;  4XYQ A;  4B3M L;  4EX5 A;  2NBF A;  1Y1V B;  4ODG A;  3NTH A;  5JPN C;  4BY1 H;  4XIG S;  3M4Y A;  3UDI A;  2E2J B;  3VDY A;  5CV7 A;  3ONA B;  4HJ8 A;  4JBM A;  3HOW B;  4LF4 Q;  1PRT C;  2CFM A;  4TRD A;  1XMO L;  2B39 A;  5AJ3 L;  5FO7 B;  1FGU A;  2B2Y A;  1XPR A;  3VR6 A;  4P72 A;  1E2V A;  4JOI A;  2QW7 A;  4XQJ A;  3T1Y L;  1HR0 Q;  1VQG A;  2J4X A;  3KJO A;  1JB7 A;  1NJI C;  4CDD C;  3OIP A;  1QUQ A;  1CZG A;  2F3I A;  1JWU D;  3BYT B;  1KAA A;  2HD3 A;  2F3W A;  1WOC A;  2K4K A;  3I72 A;  4G57 A;  1XJV A;  1PH6 A;  3E6Z X;  3OW7 A;  2HHH L;  2EYM A;  5EGT A;  2CWP A;  1VQP A;  1LTG D;  4FVM A;  1L0W A;  2FFK B;  4K0K Q;  2PO4 A;  2IY5 B;  1LAB A;  4G7Z C;  4A3J B;  4TQU S;  2EYH A;  2Z1C A;  1TR5 A;  4C2M B;  2R7D A;  4DAY B;  2CW0 C;  3GTK B;  2NTS A;  2ZTC A;  4RWS C;  2NUC A;  1HRJ A;  1OXT A;  3GP7 A;  3NEL A;  4X66 L;  3BDC A;  1L0X B;  1ASY A;  3TME A;  4R8I A;  5C44 H;  4OWW B;  4UP8 A;  4YY3 L;  3J81 i;  2M00 A;  2WB1 E;  2M2L A;  1Q81 C;  1KDC A;  2XSC A;  2F3V A;  3PV0 A;  3S17 B;  1YIJ A;  3BYY B;  1FL0 A;  4ME3 A;  4JBW A;  1PHJ A;  5IIF A;  4L63 B;  3CCS A;  3EVQ A;  3KF6 B;  5CV8 A;  1HTP A;  4DV0 Q;  4KY6 A;  4C3J H;  1A3U A;  1Q1E A;  3F2D A;  1SYD A;  3OOC A;  3NHH A;  4FO2 A;  4A3B G;  4IPC A;  5EPL A;  4YHH L;  4X6A H;  1I4P A;  3K80 C;  3ER0 A;  2KCN A;  4O42 A;  4HJ9 A;  2IL8 A;  1XNR Q;  2VQE L;  1UEB A;  2AKW B;  1EU4 A;  3C46 A;  2JA6 H;  1K8A C;  3HOX B;  2QEJ C;  4WRD A;  2BCO A;  1N9W A;  3GTO B;  1GM5 A;  3ZJY C;  4A3G B;  3S1M H;  3PO2 H;  1O78 A;  1I4R A;  4KN4 C;  1PFM A;  1R4P B;  4DPG A;  3HOV H;  1MD2 D;  1Y1V G;  1V1P B;  1L1O C;  4C3J B;  1V8Q A;  4A3C G;  4J1M A;  3CW2 C;  2K5N A;  1ZYR D;  4CJ1 B;  2PNH A;  1V9P A;  1VQC A;  3HOW G;  2KHJ A;  3DHQ A;  4UDU C;  2VQF L;  1PH7 A;  2QEX A;  5CV4 A;  3M7N A;  3S15 B;  1VQH A;  5C4H A;  1B9M A;  2K04 A;  1EWC A;  5J1Z A;  4QCL A;  2JA6 B;  1D7Q A;  1X9N A;  1SNO A;  3BZD B;  3LX0 A;  1RCV D;  1HHV A;  3A56 A;  5IE8 A;  1GUO A;  4AYB E;  3W2D A;  3RZD H;  3CU7 A;  4XQN A;  3CKI B;  1D1I A;  1GUS A;  4B3R L;  2R3Z A;  2NZH A;  1QNK A;  3K6O A;  4A4I A;  2NVY H;  1HZB A;  2WAQ E;  3MXN A;  4JCV E;  3Q6S A;  4OX9 L;  1RIP A;  2KJX A;  3KFU A;  1ZXT A;  2N8N A;  5LL6 X;  5EBC A;  1T5E A;  1HXY D;  3R8B A;  4LF5 Q;  1JC7 A;  1HNZ Q;  1K8G A;  2K28 A;  4A3J G;  1HA5 A;  3G4S A;  2E5L Q;  4JI6 L;  3ND8 A;  1H9J A;  1NMF A;  2B8F A;  4QMG A;  3CMA A;  2NB0 A;  1WJJ A;  2QKI C;  2A73 B;  3QJY A;  3I3C A;  2UXC Q;  1RL2 A;  3NE5 B;  4NXN L;  4FF2 A;  2JE6 I;  1EZ6 A;  4OWX B;  1CHQ D;  1N36 Q;  2JK8 A;  3NBH A;  4ME5 A;  4DXG A;  3JAM c;  2OF1 A;  3BVG A;  3BVM A;  1M1K C;  4RCN A;  2NN6 I;  5C3E B;  1SJE D;  3EFX D;  2HT1 A;  5H1S E;  1KRS A;  2HDL A;  1N32 L;  1Y8P B;  5J22 A;  4WFN 3;  3GQB A;  4Q0F A;  1JWM D;  5A2Q E;  1JE5 A;  4JI3 L;  2ZTE A;  3F2U A;  1K8M A;  1UNS A;  1IBL L;  4LF7 L;  4KHP Q;  2QDB A;  2SNM A;  4OEL B;  4XDX A;  2OWO A;  3NQI A;  2Z6K A;  4LWC A;  1M4V A;  2E2H B;  1SE2 A;  1DCZ A;  3WWV A;  3DM1 A;  2G9D A;  2BE5 C;  2ZXR A;  5KNB A;  3Q24 A;  1Y1W B;  2J7Z A;  1HNW Q;  2R93 H;  1C4Q A;  4LF4 L;  3HOX G;  3I4M H;  5E4X A;  4RKL A;  2R7Z H;  4A3G G;  1Q46 A;  1EFI D;  1AE2 A;  1ONL A;  4DGZ A;  2EJG C;  3H0G B;  1SMX A;  4HCS A;  1HR0 L;  4QIW E;  1IBK L;  3DUZ A;  2IX1 A;  4C3J G;  3AFQ A;  1UE5 A;  1JOQ A;  2K32 A;  3CXC A;  3AB9 A;  1NSN S;  3J7Y W;  5JVH 3;  4NDX A;  3VA5 A;  5KIX A;  2Y0S B;  4UAI A;  1QCB D;  1PMR A;  3DMU A;  3A8K E;  5IWA Q;  4R4I A;  3OHX C;  1WCM H;  2JA6 G;  2R93 B;  1CKO A;  1RTO A;  3J80 L;  1E2W A;  3URY A;  3A5Z B;  3I4M B;  4K0K L;  3I4O A;  2PQE A;  3ULL A;  5JOB A;  4KMU C;  1A3T A;  1PV4 A;  1E1O A;  1NCV A;  2PYK A;  4R4C A;  5M3F H;  3D0F A;  3DEP A;  4A3M B;  3S1Q B;  4DUZ Q;  4DV6 Q;  3GV3 A;  1LT5 D;  2PZT A;  3IL8 A;  1I5F A;  3CPF A;  1SDF A;  1TS2 A;  4Z9C B;  5LMN Q;  3QOL A;  3KK7 A;  2EDG A;  3TRZ A;  1ET6 A;  1L1O A;  4A3E B;  3W5O A;  4BA2 I;  3K7U C;  2QIL A;  1JOO A;  1S5C D;  1AZQ A;  1XNQ Q;  4R4O A;  4BBS B;  5EBD A;  5M3M H;  1U4P A;  4IN3 A;  4DV0 L;  3P75 A;  5M3F B;  1Y8N B;  1SXT A;  1N33 Q;  2EIF A;  3A55 A;  3A8I E;  4XQQ A;  1FVI A;  3SGI A;  2K75 A;  4C3I H;  1DM0 B;  3NWT A;  5EKK A;  3J81 j;  2JYO A;  5C3E G;  2R61 A;  5IYC G;  4DA2 A;  5C4J B;  1XNR L;  4WJ4 A;  1KXL A;  2KEC A;  3PO3 H;  1ESR A;  2VXW A;  3KF6 A;  4GLV B;  2F0W A;  2WKC A;  3H94 A;  1PH9 A;  4DR3 L;  1Q3L A;  4IAL A;  1KLU D;  4LF6 Q;  2JA8 B;  3SK5 A;  4KY7 A;  2H4O A;  2HUG A;  2BH2 A;  3I91 A;  4IUN A;  2ZJR A;  4CDC C;  4UP7 A;  4DR5 L;  3S16 H;  2KHI A;  3L0O A;  2D0O A;  1BKB A;  4ZK9 B;  3LWU A;  1Y1W G;  4HJA A;  4ZKB B;  1PZJ D;  1X54 A;  4DR2 Q;  2RSO A;  3PIP A;  4L5Q A;  4G7O C;  1TWC H;  5CMD A;  3QIA A;  3O13 A;  2DNE A;  1E0B A;  3S9W A;  3H0G G;  3SXH A;  1N8R C;  4KK7 A;  1DOL A;  1V1P A;  4CKE A;  3CRK C;  1PTO B;  2EYO A;  5IT9 L;  4KKU A;  3U50 C;  4U67 3;  3QWN A;  1EY6 A;  3P7J A;  5TSS A;  3RLF A;  1LM0 A;  2HQL A;  2RCF A;  1FR3 A;  4R1J A;  4YWL A;  5C4Z A;  3FKI B;  1NR4 A;  3CC4 A;  4DAP A;  3ICE A;  2F0H A;  4KHZ A;  2Y0S G;  1PLF A;  4A3F B;  5IT9 c;  2DY8 A;  5F2D A;  1VQO A;  4A3I B;  2PMZ E;  2R93 G;  5JEA J;  4LF5 L;  4AQY L;  3I4M G;  3AQQ A;  1TWC B;  1HNZ L;  1GD7 A;  5C0X I;  3ULJ A;  2IX3 A;  4DV4 Q;  4DV1 Q;  3HKS A;  5CYU A;  4FXG C;  3TBI B;  4O0A A;  2E5L L;  3GTG B;  1OTC A;  1IXR A;  3CAM A;  4JOI C;  2MUY A;  1Z6H A;  4XT3 B;  3D4D A;  4A3M G;  1VDZ A;  2UXC L;  4ULL A;  4V0B A;  3RN2 A;  4N9P A;  1VCI A;  1MGS A;  1M90 C;  4JI5 Q;  4PMB A;  3H6M A;  3I55 A;  4UY8 C;  2KEN A;  1RHP A;  4JI7 L;  4X64 Q;  4EGV A;  1XYI A;  3K81 C;  5K36 G;  1K0S A;  1STH A;  1I4Q A;  3BDL A;  1KL9 A;  3OMG A;  1G6P A;  1KDB A;  2Q2U A;  1GHJ A;  2RBM A;  4BBS G;  1PYS B;  1GUW A;  3BS1 A;  3GTP B;  1VQA A;  1SE8 A;  5FJ8 H;  5M3F G;  4ZKC B;  3J81 L;  1DOK A;  1N34 Q;  2C5C A;  1D5Z C;  4EQ5 A;  4L5T A;  2B29 A;  1E24 A;  4IPH A;  1Q8I A;  1VQJ A;  3BJU A;  3D6C A;  5IP7 H;  5KND A;  3J81 c;  3PIO 3;  4OHJ A;  1MI2 A;  3QOJ A;  4K6L A;  4O1N A;  2AWN A;  2NVQ H;  3T53 B;  2JA8 G;  1X3G A;  1CSQ A;  5C4X B;  5FLM H;  4DR1 Q;  1NBW A;  3FRP B;  3CD6 A;  1Q12 A;  3CCQ A;  2VZA A;  1IZ6 A;  4XT1 B;  2QCP X;  1X3F A;  1HUM A;  1JMC A;  2AMC B;  4H0L C;  1G6Z A;  2XN9 C;  4CKB A;  2F4V L;  4KD3 A;  2H1E A;  3GTM H;  1YJ9 A;  5IWA L;  2PZW A;  1JJG A;  3X3M A;  1BBX C;  2HDM A;  1CK1 A;  4RFB A;  2YU9 H;  1C48 A;  3F2B A;  3FEW X;  2JA7 B;  1Y69 U;  3K58 A;  4A3B H;  3U58 A;  1CKN B;  5LMU Q;  1G8Z D;  2RF4 A;  4MN3 A;  4RKB A;  5FKA C;  1A0I A;  2GN5 A;  4RAU C;  2UU9 Q;  4JVZ A;  1I4H A;  1QWY A;  2IT1 A;  5I4D A;  5ELD A;  3MVV A;  1KC8 C;  4A3F G;  1HJP A;  1STN A;  1VF5 C;  3DXJ C;  4DV6 L;  2A74 C;  2EY6 A;  3VA7 A;  4A3I G;  5K5P A;  2OT2 A;  2NN6 G;  4IPD A;  1A2U A;  1EUJ A;  1LTT D;  2F52 A;  4IFD I;  2CKZ B;  1OXU A;  5LMN L;  3TP7 A;  1O80 A;  4O2D A;  1Y1V H;  3I70 A;  5HY6 A;  3MA2 B;  2Z9H A;  4DR4 Q;  2M9V A;  5J39 A;  1KHI A;  4A3C H;  1TQO A;  4OO1 G;  1G51 A;  2E2J H;  1XNQ L;  3DWQ A;  5ELB A;  4TVA B;  4JPB W;  2UUC Q;  1W6J A;  3D8G A;  3HOW H;  3FHW A;  2Z6B A;  1K83 B;  3HKZ B;  1BNZ A;  3K0Y A;  4DR7 Q;  2MJ8 A;  4UP9 A;  1N33 L;  2N88 A;  1SYB A;  2X69 A;  1JE4 A;  3I4L A;  4HR7 B;  1AFP A;  2CVR A;  2EJF C;  2Q2T A;  1B70 B;  2GVA A;  3KDF B;  1BXT A;  1K0R A;  4AIM A;  3C1F A;  3Q8D A;  3NXW A;  2PI2 A;  1SMY C;  3KYH C;  1FNU A;  4P75 A;  4ID6 A;  1FJG L;  2K5D A;  5A2Q L;  1ENC A;  1XXG A;  2K52 A;  5I2Y A;  3V05 A;  3S2D B;  3EA6 A;  4IUV A;  2PW5 A;  1E3P A;  3LNN A;  4DUY Q;  1YI2 A;  1SR3 A;  4JC0 A;  1U4M A;  1CUK A;  3TP8 A;  1IKL A;  4EQN A;  1DZ1 A;  5HGQ A;  4A3J H;  4C2M H;  2FHT A;  3AEV A;  4GNX B;  4RMF A;  3GTK H;  3VYU A;  1A8V A; 
#chains in the Genus database with same CATH homology
 4IO9 A;  4BXX G;  2NZH A;  3TS2 A;  2AHO B;  1KAW A;  2NVY H;  1HZB A;  4GN4 B;  4A4I A;  1YJN A;  3D31 A;  1KQS A;  1OXV A;  2WAQ E;  4JCV E;  1YEZ A;  3G6E A;  4OX9 L;  1RIP A;  4DV5 Q;  1HNW L;  4DKA C;  4GLA C;  3KFU A;  4JYA Q;  5C4X G;  1PFS A;  1H95 A;  5IP9 H;  2N8N A;  2JA9 A;  4JG2 A;  4DR4 L;  4DR6 Q;  2JA7 H;  4LF5 Q;  3E9H A;  1HNZ Q;  3I56 A;  5FJ8 G;  1U0L A;  1K8G A;  2RCN A;  4A3J G;  1OXS C;  4X65 Q;  1YIT A;  3PGZ A;  3OTO Q;  5ELN A;  3G4S A;  4A3K G;  1VQB A;  2E5L Q;  2VUM G;  4JI6 L;  3CMA A;  1NMF A;  3S17 H;  2VS1 A;  1WFQ A;  1WJJ A;  2I0Q A;  4POG A;  1XPO A;  4LF9 L;  4APV A;  5IP7 G;  1MJC A;  2JJQ A;  4GN5 A;  2ASB A;  2UXC Q;  2Z6K C;  1RL2 A;  4POF A;  1BBU A;  4B3T Q;  1B8A A;  2H5X A;  2WB1 G;  3CC7 A;  3PUY A;  2JQO A;  1TWA H;  1VQE A;  1S72 A;  3B6Y A;  4NXN L;  4B3S L;  4IFD J;  1PH1 A;  2JE6 I;  2R7F A;  4OON A;  4OWX B;  1L2F A;  4KI0 A;  1N36 Q;  2JK8 A;  4DV1 L;  1VQ6 A;  3JAM c;  1CSP A;  4A76 A;  1M1K C;  2NN6 I;  5FLM G;  2EXD A;  2A19 A;  1FJG Q;  4P74 A;  4B3M Q;  2HT1 A;  5H1S E;  3S14 H;  4HIO A;  3CCU A;  1KRS A;  5M5W H;  1N32 L;  4P73 A;  4JI1 Q;  3UE1 A;  4A93 H;  1K83 H;  3HOX H;  3FKI G;  3CCM A;  1Q7Y C;  2KBN A;  3MXN B;  3GTO H;  1IYJ B;  4GKJ L;  1I6H H;  5JJI A;  3GTQ H;  3E9I A;  4DV2 L;  1EYG A;  2Q2I A;  1XMO Q;  4A3G H;  5AJ3 Q;  1JE5 A;  1HZA A;  3PUW A;  4JI3 L;  2YTX A;  4DUZ L;  1JT8 A;  4LUZ A;  1JJ2 A;  4NPS A;  2ZM6 Q;  2ZTE A;  1IBL L;  4LF7 L;  4KHP Q;  1S3O A;  1J5E L;  1NE3 A;  1I94 L;  4NB3 A;  2A1A A;  2OWO A;  4LF8 L;  2I5H A;  2Z6K A;  3CP0 A;  3K0X A;  4LWC A;  1R9T H;  3WWV A;  3S1R H;  2OQK A;  3BZK A;  2BH8 A;  4GS3 A;  3TQY A;  1K9M C;  4JI4 L;  3M4O H;  2OTJ A;  4YCW A;  3CPW A;  1HNW Q;  1VQM A;  3HOY G;  2R93 H;  4LF4 L;  4A93 G;  4YCU A;  1TWF H;  3HOX G;  5JJL A;  2CQO A;  4LFB L;  3HKZ G;  3I4M H;  3EBE A;  2KCT A;  3S15 H;  2ATW A;  2R7Z H;  3S2D H;  4JI0 Q;  4A3G G;  1Q46 A;  4MTN A;  1AE2 A;  4JI2 Q;  1N34 L;  1SMX A;  1GKH A;  4IOA A;  1UWV A;  2DGY A;  3PSI A;  4AH6 A;  1HR0 L;  2VY3 A;  4QIW E;  1IBK L;  4PZ6 A;  2IX1 A;  3AFQ A;  2C35 B;  1UE5 A;  1LUZ A;  1B7Y B;  3CXC A;  1U5K A;  3HOU H;  4OWT B;  5E7N A;  2R92 H;  2YV5 A;  4PZ8 A;  4HID A;  5IYD H;  4DV7 L;  1KD1 C;  3I2Z A;  1P8L A;  1PA6 A;  4DV3 L;  4X66 Q;  1MJE A;  2R7Z G;  4IJH A;  3LGJ A;  1C0A A;  4AYB G;  1P16 A;  4R4I A;  5IWA Q;  5IYB G;  4WJ3 M;  4L5S A;  1WCM H;  4BY7 H;  2IX0 A;  2ZTD A;  2JA6 G;  3A5U A;  2OTL A;  1CKO A;  2Q2H A;  2Y0S E;  3A5Z B;  4K0K L;  2RHQ B;  3I4O A;  3L7Z C;  2VNU D;  4LF6 L;  3CCR A;  3ULL A;  1XTD A;  4P71 A;  1N32 Q;  4YWK A;  3DLL A;  1VS0 A;  2WAQ G;  4YY3 Q;  3CCV A;  4IOC A;  1PV4 A;  4LFC Q;  3HOU G;  2HIV A;  1E1O A;  4JV5 Q;  4GKJ Q;  2MO1 A;  3T1H L;  2R92 G;  4R4C A;  3KF8 B;  3D0F A;  4Y7N H;  5M3F H;  4DV2 Q;  1VQD A;  5IYD G;  5GAD C;  3BU2 A;  4MZ9 A;  4QL5 A;  1IBM Q;  4JI3 Q;  1E22 A;  4DUZ Q;  4DV6 Q;  3CC2 A;  1YHA A;  3RZO H;  1WCM G;  3RLN A;  4BY7 G;  4A3D H;  2E2I H;  1I5F A;  3CPF A;  4LW1 A;  4QY7 A;  4IJL A;  3G71 A;  1SN8 A;  2I5M X;  3PIO A;  4C3H H;  4NXM L;  1Q1B A;  3CQZ H;  2NVX H;  1YVC A;  5LMN Q;  2JEB I;  4XTC S;  2KCM A;  4JI4 Q;  2UXB L;  2YTV A;  1EQR A;  5LMU L;  5IY0 A;  3UDX A;  4YHH Q;  1UE6 A;  3TRZ A;  1ASZ A;  5C3E H;  1L1O A;  3W5O A;  4LFB Q;  5IYC H;  3PF5 A;  2UU9 L;  1SLJ A;  1VQF A;  4BA2 I;  1VQ4 A;  3K7U C;  3TEH B;  1XNQ Q;  4R4O A;  2VQE Q;  3KJP A;  3KOJ A;  2ZJP A;  5M3M H;  2UUB Q;  4Y52 H;  2QA4 A;  3RNU A;  3U4Z A;  3M85 A;  1PH5 A;  2XTI A;  3GO5 A;  4A3D G;  4JBJ A;  4GOP A;  4DV0 L;  1N33 Q;  1AE3 A;  2EQS A;  2EIF A;  2IHE A;  1IBK Q;  2UXD L;  4BBR H;  1FVI A;  1O7I A;  2K75 A;  3SGI A;  4C3I H;  2NZO A;  4LFA L;  3DM3 A;  2PI2 E;  3J81 j;  3S24 A;  5C3E G;  4JBK A;  5IP9 G;  5IYC G;  2YTY A;  1SFO H;  1EFW A;  2E2H H;  2JA7 G;  2N3S A;  3J80 i;  5GAG C;  1XNR L;  2JA5 H;  3PF4 A;  4WJ4 A;  1AH9 A;  1CKM A;  1KXL A;  4DV4 L;  1Y1W H;  3PO3 H;  1DGS A;  1UE1 A;  4GLV B;  3KF6 A;  1I50 H;  1YJW A;  5M3M G;  2B3G A;  1PH9 A;  4GKK Q;  2VQF Q;  3FP9 A;  1Z47 A;  4DR3 L;  3K7A H;  2AWO A;  1X55 A;  4LF6 Q;  1Y14 B;  1Z9F A;  3H0G H;  3KLW A;  1A62 A;  2LSS A;  4BBR G;  2BH2 A;  1E7Z A;  2ZJR A;  4JI8 L;  1J6Q A;  1VQ7 A;  2UUA L;  5JJK A;  4UP7 A;  4DR5 L;  4JI5 L;  1W2B A;  3S16 H;  1KRT A;  1VQN A;  1VQ8 A;  3S1N H;  2KHI A;  3L0O A;  2R6G A;  1L1O B;  1BKB A;  2D0O A;  3F8T A;  2VL6 A;  2JA5 G;  1K73 C;  4PZ7 A;  5LMN W;  4GNX C;  2OCE A;  5GAE C;  4X64 L;  4HJA A;  1Y1W G;  3PO3 G;  4B3R Q;  1X54 A;  2K5H A;  4DR2 Q;  3K8A A;  5J3B A;  1Q8K A;  2LXK A;  3PIP A;  4L5Q A;  1EQQ A;  1TWC H;  2A8V A;  1HH2 P;  1W3S A;  3H3V H;  4YWM A;  5ELO A;  3H3V I;  5C0X J;  4DUY L;  3J7Z C;  1C7Y A;  4OX9 Q;  3H0G G;  1N8R C;  4H02 A;  5DLQ E;  1PH4 A;  4PMW A;  3W1G A;  4X62 L;  3UDG A;  3U50 C;  1HR0 W;  1MIU A;  1YNX A;  3RLF A;  1LM0 A;  1HNX L;  2HQL A;  4MNO A;  4R1J A;  4YWL A;  4DNI A;  1IL2 A;  3CC4 A;  1GVP A;  4LNQ A;  3NBH B;  3ICE A;  1EOV A;  4JI6 Q;  2ALY B;  4KHZ A;  3NEN A;  2Y0S G;  5IT9 c;  3UDF A;  3OW2 A;  1QVF A;  4A3M H;  4LF9 Q;  4R4Q A;  1VQO A;  3S1Q H;  4BA1 I;  2UXD Q;  4DV5 L;  2BA0 A;  4LFA Q;  3TS0 A;  4L5R C;  4JYA L;  2ID0 A;  2PMZ E;  1PH2 A;  2R93 G;  4DR6 L;  5JEA J;  3RN5 A;  3ULP A;  4B3S Q;  4AQY L;  4LF5 L;  4NXN Q;  3AQQ A;  3GDE A;  2VW9 A;  5FLX c;  4QGU A;  4GNX A;  1HNZ L;  3I4M G;  1GD7 A;  5C0X I;  1TWH H;  2DUD A;  3ULJ A;  4DV4 Q;  1XMQ L;  5GRO A;  3HKS A;  4DV1 Q;  4X65 L;  1SRO A;  4DR1 L;  4O0A A;  3OTO L;  4KLK A;  2E5L L;  1VQL A;  4A3E H;  1OTC A;  4UY8 C;  2XGT A;  1IXR A;  3CAM A;  4DR3 Q;  4J15 A;  4JOI C;  4LUO A;  3HOZ H;  1YZ6 A;  1QZH A;  5GAH C;  2OQ0 A;  5BR8 L;  4BBS H;  4A3M G;  2BA1 A;  4FDB A;  1VQ5 A;  2UXC L;  2PQA A;  4B3T L;  3RN2 A;  1SRU A;  4A3L H;  3J7A 5;  3S2H H;  1VCI A;  4DR5 Q;  1M90 C;  4DK3 C;  4JI5 Q;  1G29 1;  1NY4 A;  3STB D;  2QGQ A;  4PG3 A;  3J80 c;  3U4V A;  3CCJ A;  2E8G A;  3I55 A;  5C0X G;  2KEN A;  3H15 A;  4DR2 L;  1VQ9 A;  4R4T A;  2D0P A;  3GTJ H;  4JI7 L;  3CME A;  2NVT H;  4BXX H;  2FXQ A;  4X64 Q;  1BVS A;  1HZ9 A;  4RG1 A;  1IBL Q;  4LF7 Q;  3W1B A;  1J5E Q;  1I94 Q;  3K81 C;  4B3M L;  4EX5 A;  5K36 G;  4ALP A;  2MO0 A;  5C4J H;  3UE0 A;  1KL9 A;  5M5X H;  4LF8 Q;  1A63 A;  1G6P A;  4BY1 H;  3TRE A;  4XIG S;  2Q2U A;  3UDI A;  4IPG A;  3HOZ G;  3VDY A;  2Z0S A;  4JI1 L;  4BBS G;  4HJ8 A;  4JBM A;  1HZC A;  1EWI A;  1PYS B;  2GVB A;  4LF4 Q;  1PH8 A;  1E1T A;  2CFM A;  3RR5 A;  4A3L G;  1VQA A;  1SE8 A;  1XMO L;  1NTG A;  5FJ8 H;  5AJ3 L;  1FGU A;  5M3F G;  2JA8 H;  4GN3 B;  3AFP A;  1K3R A;  1PVO A;  1N34 Q;  2I5L X;  2L15 A;  1HNX Q;  1XPR A;  4EQ5 A;  4P72 A;  4A3K H;  1BBW A;  2WFW A;  4L5T A;  2B29 A;  1E24 A;  3PUZ A;  4IPH A;  4JOI A;  1MKH A;  5JEA G;  1T9H A;  1VQJ A;  3BJU A;  1CKN A;  3T1Y L;  1HR0 Q;  1VQG A;  2MNA A;  3KJO A;  1JB7 A;  1NJI C;  1Q86 C;  5IP7 H;  1QUQ A;  4BY1 G;  2F3I A;  3J81 c;  2HIX A;  3CCL A;  1WOC A;  2K4K A;  3PUX A;  4A75 A;  1XJV A;  2PQA B;  4DV7 Q;  4AQY Q;  2AWN A;  1PH6 A;  2NVQ H;  4JI0 L;  4DV3 Q;  1V1Q A;  1YHQ A;  2JA8 G;  4JI2 L;  3I7F A;  2UUC L;  1X3G A;  1XMQ Q;  5GQO A;  2HHH L;  3A74 A;  1CSQ A;  5FLM H;  2CWP A;  4DR1 Q;  1VQP A;  1NBW A;  3HFZ B;  1L0W A;  4UPA A;  2RHS B;  4DR7 L;  3CD6 A;  1Q12 A;  4K0K Q;  3CCQ A;  2IY5 B;  2VZA A;  1IZ6 A;  3F2C A;  1X3F A;  2K50 A;  4TQU S;  2N49 A;  5BR8 Q;  2MQH A;  2R7D A;  1UE7 A;  3FKI H;  1VQK A;  4DAY B;  1JMC A;  2AMC B;  3G48 A;  1X56 A;  2ZTC A;  4HJ7 A;  1OXX K;  2D62 A;  3T1H Q;  3EN2 A;  2B63 H;  3GTL H;  1OXT A;  4A3F H;  2F4V L;  3NEL A;  4X66 L;  3GTM H;  1YJ9 A;  5IWA L;  3OYY A;  1JJG A;  1QVC A;  1X6O A;  4A3I H;  4JI7 Q;  1ASY A;  1QZG A;  2JEA I;  4HIK A;  2YU9 H;  3F2B A;  5C44 H;  3M9B A;  4NXM Q;  4OWW B;  1I3Q H;  3F1Z A;  4A3B H;  3U58 A;  1CKN B;  2UXB Q;  4GOP B;  4UP8 A;  5LMU Q;  3HOY H;  4YY3 L;  3J81 i;  2RF4 A;  2WB1 E;  3KDF A;  3EIV A;  4LFC L;  4JV5 L;  1X65 A;  1QUQ B;  1Q81 C;  3GTG H;  1A0I A;  2GN5 A;  2UU9 Q;  2IT1 A;  3PV0 A;  1YIJ A;  2B63 G;  4OO1 I;  3ERS X;  1KC8 C;  4A3F G;  1HJP A;  1LTL A;  4YCV A;  1FL0 A;  1IBM L;  4ME3 A;  4JBW A;  4DV6 L;  3A0J A;  1PH3 A;  4A3I G;  1S40 A;  1PHJ A;  2NN6 G;  4IPD A;  1XPU A;  2N78 A;  2F52 A;  1EUJ A;  4IFD I;  4GLX A;  3CCS A;  2CKZ B;  3KF6 B;  3T1Y Q;  4DV0 Q;  1QVG A;  3E0E A;  5C44 G;  1OXU A;  4C3J H;  5LMN L;  1Q1E A;  3F2D A;  3RLO A;  4A3B G;  3AYH B;  4IPC A;  1KIX A;  3PUV A;  4YHH L;  4X6A H;  2LXJ A;  4O2D A;  1Y1V H;  3CCE A;  3K80 C;  1JJC B;  5HY6 A;  3ER0 A;  4HJ9 A;  2CCZ A;  4DR4 Q;  1WYD A;  4A3C H;  2K14 A;  1KHI A;  1XNR Q;  2V1C C;  5IYB H;  3M3Y H;  1G51 A;  1TXY A;  2CWA A;  2VQE L;  2E2J H;  1UEB A;  1XNQ L;  4TVA B;  2UUC Q;  2AKW B;  3JAM i;  3CF5 A;  2HHH Q;  2UUB L;  2JA6 H;  3HOW H;  4OO1 G;  3FHW A;  1YBY A;  4OXP A;  1K8A C;  1WI5 A;  3GTP H;  1X3E A;  1N9W A;  4IFD G;  4DR7 Q;  1GM5 A;  1EIF A;  4UP9 A;  1N33 L;  3ZJY C;  1V43 A;  2ES2 A;  3S1M H;  5EAY A;  3I4N H;  3PO2 H;  2WP8 J;  1GO3 E;  3IRB A;  3GD7 A;  1VQI A;  1Q82 C;  4JI8 Q;  3HKZ E;  1NMG A;  2Q2T A;  2UUA Q;  1B70 B;  4DPG A;  2GVA A;  3HOV H;  3MEF A;  3KDF B;  1K0R A;  1Y1V G;  3JC6 6;  4AIM A;  2F4V Q;  1L1O C;  3STB C;  4A3C G;  1N36 L;  3Q8D A;  1C9O A;  3CW2 C;  2PI2 A;  2K5N A;  4QQB X;  1D8L A;  3KYH C;  2PNH A;  1V9P A;  4P75 A;  1VQC A;  3HOW G;  2KHJ A;  4GKK L;  1FJG L;  2VQF L;  1PH7 A;  1EIY B;  1TWG H;  3M4P A;  2QEX A;  4A3E G;  1LYL A;  3M7N A;  2K5V A;  3BZC A;  2K52 A;  4DK6 C;  1YHB A;  1VQH A;  2IHF A;  2MFI A;  4QJF A;  2ZJQ A;  3L2P A;  1E3P A;  4DUY Q;  4GOP C;  4HJ5 A;  3I4N G;  3PO2 G;  5C4X H;  1YI2 A;  1SR3 A;  4JC0 A;  1PYB A;  1CUK A;  1D7Q A;  1X9N A;  2YYZ A;  3NEM A;  5IE8 A;  3M4Q A;  4DAM A;  4X62 Q;  3HOV G;  5HGQ A;  3PCO B;  4HIM A;  4AYB E;  4A3J H;  4LUV A;  4C2M H;  3RZD H;  3AEV A;  5M5Y H;  4GNX B;  2VUM H;  4RMF A;  2ZM6 L;  3GTK H;  4KHP L;  4B3R L;  1A8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...