4YHHL

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhL00
1Z47A 1MIUA 1L1OC 2PQAA 4KLKA 3B6YA 2K50A 1WFQA 2E5LQ 3K80C 4DV7Q 1NBWA 3I4MH 2OTJA 1N34L 1VQCA 5LMNQ 1K8GA 1QVFA 4LF9L 2JEBI 4HIMA 3S1RH 2CWAA 2D62A 1ASZA 3CC4A 1A0IA 1C0AA 2PQAB 4A3JH 4JI3L 4GN3B 2D0OA 5BR8Q 4GLXA 2VW9A 2DGYA 3GO5A 1VQ8A 4DR7Q 1HJPA 3RLNA 1HR0L 4GN4B 4JBJA 4YWKA 4LF4Q 4KHPL 5JEAG 1LUZA 1PA6A 1VQPA 2VS1A 2Z0SA 1I50H 3ZJYC 4K0KQ 4QIWE 1B8AA 4JBKA 2JEAI 4A3BH 1HZAA 1VQEA 3CPWA 4A3EG 2UXDQ 1L1OA 3DLLA 1YHQA 1K9MC 1KRTA 1E24A 1XPUA 4L5SA 3K0XA 1YITA 5M3MG 1N33Q 5FLXc 3EBEA 1PYBA 4DK3C 2I5MX 4JI4L 3KDFA 1L1OB 3HOVG 4PMWA 1H95A 4LF6L 3NELA 4A76A 3T1HL 2GVAA 1W2BA 3OTOQ 3F1ZA 3FKIH 4IJLA 4DAYB 5GAHC 1PH6A 4IPGA 1PH1A 1NTGA 2A1AA 2R93H 4IOAA 3KDFB 2VUMG 5C4XG 4RG1A 3HOWG 5IP9G 1E3PA 3PIPA 4B3TQ 2EXDA 3BZCA 4AYBE 3CCMA 1VS0A 1AE2A 3PUWA 4QY7A 4OWWB 4DR1L 2ZJQA 2WFWA 3J81i 4A3MG 1IBKL 2YTVA 1EUJA 1N36L 3G4SA 2R7ZH 3CF5A 4DUYL 1HH2P 2I5LX 3TQYA 3RZDH 1YJWA 1HZBA 1TWHH 2K5VA 2OQKA 2KENA 2Q2TA 1YNXA 4YCVA 3CMAA 1U5KA 4DV2Q 3S15H 3KF8B 1N34Q 3PUZA 1PH8A 4AIMA 4LF9Q 2NVXH 1MKHA 1SROA 2XGTA 1GVPA 5M5XH 3UDFA 3UDXA 3HOXG 2B3GA 2N8NA 4DV3Q 4JI3Q 4BA2I 1PH2A 4PZ8A 2WAQG 5IP7G 1CKNB 3J80i 5FLMH 4A3CG 5C0XI 2ZM6L 1FVIA 4R4QA 1IBMQ 4UY8C 4A3GH 5C44H 1HR0Q 3JC66 5K36G 3S17H 4BBRH 1JT8A 1KXLA 4DR3L 1GM5A 4NPSA 2HQLA 4LUVA 3S14H 2UU9L 2K52A 1CKMA 4GLAC 2VZAA 2BH2A 3CCEA 4HJ8A 4X64Q 3KOJA 4DNIA 1YHAA 3RN2A 4IPHA 2E2IH 2JA5G 4MNOA 3TREA 1L0WA 2CFMA 4JI6Q 4FDBA 1HZ9A 3H3VI 2HIXA 5JEAJ 3STBC 1XTDA 2IX0A 1OXTA 1V1QA 1Y1VG 3PV0A 3CW2C 4JI2Q 4B3SL 4JI4Q 2EQSA 2D0PA 4Y7NH 4L5RC 4LF6Q 3EIVA 4IFDI 3T1HQ 4NXNL 4BY1G 4L5QA 3MEFA 3GDEA 2PMZE 4EQ5A 3KLWA 1VCIA 3GTLH 3RN5A 3PCOB 1X56A 1KAWA 2YTXA 4TQUS 1PH4A 1EQQA 1ASYA 3M4OH 5M3FG 2NN6G 1FJGL 1E1TA 2ZTDA 5GADC 4DR1Q 4LF7L 4X65L 4DUZL 1KHIA 1IBKQ 3GTGH 2BA0A 3J81j 3S24A 1EIFA 5ELOA 3JAMi 1Z9FA 1VQJA 3H0GH 5GAGC 2ZJPA 1X9NA 1XNRL 2CQOA 1PHJA 2QGQA 3NEMA 4GLVB 5M5WH 4DV1L 4A93G 4OXPA 3CCRA 3TS0A 3S16H 1VQ7A 1AE3A 2YV5A 3U50C 3AYHB 2OQ0A 2B63G 3H3VH 4A3KG 2UUAL 1YVCA 2YTYA 5M5YH 2JA9A 4O0AA 4A75A 1X3EA 2EIFA 1JMCA 2QA4A 1KIXA 1EYGA 2UUCQ 4DR3Q 3F2CA 2UU9Q 3HOUH 1K0RA 1Y1WG 4JI0Q 2VQFL 4R4TA 1NJIC 3CPFA 1PYSB 4A4IA 4X62Q 4PG3A 4JI7L 4LWCA 1YIJA 1PH3A 4Y52H 3HKZE 4JOIC 4JYAQ 2WB1E 3RLOA 3M3YH 4BY7H 3S1MH 3S2DH 3OYYA 3W5OA 4DK6C 4JC0A 5IYDH 4LUOA 1WI5A 4POFA 4A3IG 4BBSH 1Q86C 4BXXG 4DR2L 4B3SQ 3K8AA 2B29A 3GTJH 1VQKA 3HOVH 1Q8KA 4UP9A 4YWMA 3F8TA 4LFBL 4NXNQ 1WJJA 5LMUL 5LMNW 2K75A 4ALPA 1VQ5A 2NZOA 4C3IH 4A3DG 2UXCL 2JA7H 3L2PA 4DPGA 3BJUA 1X6OA 1C9OA 2K4KA 5IWAL 1Y14B 3CCLA 4LNQA 2VUMH 1XMQQ 5ELNA 3BZKA 5IP9H 4OX9L 1RL2A 3ERSX 3AFQA 1QUQA 4J15A 4AYBG 1HNXL 1FJGQ 4A3JG 4X65Q 3CD6A 3PUXA 2FXQA 4DR4L 2AKWB 1QUQB 2BA1A 4HIKA 3I4NH 4B3ML 2PNHA 3G48A 1XNRQ 3W1GA 3KF6A 1I3QH 4AQYL 3PGZA 1PV4A 2IX1A 1GD7A 2MFIA 5JJKA 2JE6I 2JQOA 2UUBL 4NXML 2JA6H 3KJPA 2MO0A 4A3BG 4P73A 3G6EA 3PO3H 1HNWL 3KF6B 3UE1A 1Q81C 2NN6I 4LFAL 1A62A 1YBYA 2F3IA 4P72A 2F4VL 2CWPA 5IP7H 1G6PA 4NB3A 1CKNA 2RHQB 4DR5L 3K81C 1HZCA 1LTLA 3KYHC 1J6QA 4P74A 1K73C 2R92H 2A8VA 4YHHL 1NMFA 1YZ6A 4OO1G 4OONA 2AWOA 2Y0SE 1CSPA 1KRSA 1V9PA 2ALYB 1SLJA 3FHWA 3HKSA 3PO2H 2VQFQ 3FKIG 1A63A 4OO1I 1VQFA 4QJFA 5AJ3L 2R93G 5IYCH 3A5UA 3DM3A 2NVQH 3HOYH 1I6HH 1U0LA 1J5EL 1Q12A 2KBNA 4A3LH 1OXUA 4KHPQ 1SMXA 1WOCA 1YEZA 1T9HA 4KI0A 1PFSA 4YCWA 4LFCL 3ULJA 5FJ8H 1BBUA 4XIGS 4DR2Q 1SFOH 2KCTA 1G51A 1D8LA 4O2DA 3I56A 4A3FH 2R7ZG 3A0JA 4LFBQ 5LMUQ 1X55A 4JG2A 1UE5A 3S1QH 2UXCQ 2QEXA 4XTCS 2JA8H 2E2JH 4BA1I 1WCMH 3MXNB 3HOZH 1X3GA 3A5ZB 5IWAQ 4EX5A 1TXYA 4DV4L 1BBWA 2OTLA 1X3FA 4GOPC 4LUZA 1KQSA 5C3EH 1HNXQ 2IY5B 1NY4A 3E0EA 3K7UC 1VQGA 1JE5A 1HR0W 2L15A 3U4VA 4C3JH 4LF5L 3J7A5 1N32L 4WJ3M 2E2HH 3CAMA 3W1BA 4DR4Q 2KHIA 1BVSA 5FLMG 3NBHB 5GROA 3CC2A 4A3GG 5HY6A 4QL5A 4B3MQ 2XTIA 5C44G 3CCUA 4DR7L 4IPDA 1VQAA 3J81c 4X66L 3PIOA 4BBRG 3U58A 5DLQE 4AQYQ 2ATWA 3ICEA 5IYBH 1IXRA 4IO9A 1IBLL 5GQOA 4DR6L 4JI1L 3VDYA 1N36Q 4NXMQ 4K0KL 3J7ZC 2ES2A 3S1NH 4DUYQ 2UXBL 1A8VA 4JBWA 1YI2A 2AWNA 4DV0L 4JBMA 3GTMH 1B7YB 3AQQA 3TRZA 1HNWQ 1S40A 1QZHA 5GAEC 2F4VQ 1KL9A 1LM0A 2ZTEA 1XPRA 4P71A 4JI5L 3PUVA 1XNQL 2A19A 3GD7A 1KD1C 4YY3L 3OW2A 2ID0A 1IZ6A 4GOPA 2VQEQ 4JI8L 1QVCA 1E1OA 5EAYA 4YHHQ 4AH6A 2Q2UA 2JK8A 3J80c 4ME3A 3F2DA 1UE7A 1S72A 1Y1WH 3OTOL 3AFPA 1JJ2A 2ZM6Q 4GOPB 3I7FA 1XPOA 1MJEA 3HKZG 4DV6L 2IT1A 1K83H 2K5NA 2WB1G 4L5TA 1B70B 1AH9A 3L0OA 4QQBX 1PH7A 3Q8DA 1VQBA 4YCUA 2I5HA 1PH5A 2N3SA 5IT9c 1VQMA 3CC7A 1E7ZA 1OTCA 4DV5L 1VQOA 1OXSC 4MZ9A 1HNZL 3I2ZA 5C0XG 1VQLA 1NMGA 1UEBA 4OWTB 2GVBA 4A3EH 4R4OA 3PF5A 4R4CA 4RMFA 3H0GG 4C2MH 2IHEA 4IPCA 4QGUA 1EQRA 5M3MH 2LSSA 3BU2A 4LW1A 4DV4Q 3M4QA 4DV2L 1UE1A 2I0QA 4C3HH 1P8LA 3M85A 2ZTCA 2N78A 1QZGA 1I94L 1QVGA 2MQHA 2AMCB 4DV3L 3CCVA 4LF5Q 4HJ5A 1BKBA 1R9TH 1TWFH 1N32Q 1I5FA 1S3OA 1EOVA 4YWLA 2NVYH 3I4MG 1E22A 3ER0A 5C4XH 3H15A 2ZJRA 4GKKL 4H02A 3HOWH 1OXXK 4JV5L 1IBML 3KFUA 4P75A 3CCJA 1JJCB 4X66Q 1JJGA 1X65A 4IJHA 4IFDG 3JAMc 4LF7Q 1SRUA 1IBLQ 4DUZQ 2NVTH 3HOUG 4DR6Q 4JI1Q 4A3MH 2R7DA 2UXBQ 4JOIA 2IHFA 1CUKA 2E8GA 4DV0Q 4LF8L 1VQDA 4X64L 4HJAA 3ULLA 4BY7G 2CCZA 4JI6L 4R1JA 3F2BA 2HHHL 4JI5Q 2R6GA 4UPAA 1XNQQ 5IYDG 4DV1Q 4B3RL 4TVAB 4YY3Q 4BBSG 1N9WA 3LGJA 1Q82C 4JI8Q 1JB7A 4JI2L 2GN5A 3HOXH 2KCMA 2Y0SG 1M90C 3STBD 4UP7A 4GKJL 1KC8C 2UUAQ 5JJIA 1NE3A 3ULPA 1V43A 2JA7G 4A3CH 1PH9A 3K7AH 4DV6Q 3RNUA 2DUDA 1PVOA 4HIDA 3KJOA 3CMEA 2OWOA 2R7FA 4DV5Q 1K3RA 3RLFA 1UWVA 2Q2IA 3E9IA 1CSQA 1HNZQ 1XMOL 4JI7Q 2JA5H 2PI2E 3M7NA 3UDGA 2PI2A 3I4NG 3RR5A 3RZOH 4HIOA 3T1YL 2LXJA 4X6AH 3WWVA 1EWIA 2VL6A 2HT1A 1Q1BA 1FGUA 5E7NA 3CCQA 1Q1EA 1Y1VH 2RF4A 3PSIA 1G291 4GNXC 2MNAA 1D7QA 1VQHA 2ASBA 5C0XJ 2CKZB 4DAMA 1I94Q 2JA6G 2KHJA 1YJNA 1N8RC 4BY1H 1M1KC 1VQ9A 3PO3G 4PZ6A 3UDIA 4HJ9A 3TEHB 5JJLA 3CQZH 3CP0A 3I55A 1SE8A 1Q7YC 4PZ7A 3SGIA 4GKKQ 5H1SE 2E5LL 4DV7L 1O7IA 4JV5Q 2VNUD 2RCNA 3GTPH 4OX9Q 1Q46A 5LMNL 1XJVA 2R92G 2YYZA 2H5XA 5M3FH 3M4PA 1K8AC 2Q2HA 2AHOB 5IY0A 4GS3A 4JCVE 4KHZA 5J3BA 2UUCL 3TS2A 5BR8L 3PO2G 3S2HH 2K5HA 2WAQE 4APVA 3FP9A 4JI0L 1VQIA 3HFZB 2RHSB 2WP8J 4LF8Q 4MTNA 1FL0A 4DKAC 5IYCG 3GTOH 1YHBA 4X62L 3HOYG 1OXVA 4JYAL 2MO1A 3M9BA 3A74A 2VQEL 1VQNA 4A3LG 4IFDJ 2HHHQ 3PF4A 4HJ7A 4LF4L 4GNXA 4B3RQ 3CXCA 3G71A 5FJ8G 5IE8A 4OWXB 2UUBQ 4A93H 2N49A 1L2FA 1RIPA 2JJQA 4WJ4A 1IYJB 1SR3A 4LFAQ 4A3FG 1YJ9A 4GKJQ 1SN8A 1GKHA 2UXDL 4GNXB 2Z6KC 3CCSA 2F52A 3NENA 4A3KH 4IOCA 1EFWA 2B63H 1UE6A 2JA8G 2LXKA 3GTKH 1CKOA 3D0FA 1WCMG 1TWAH 1WYDA 4DR5Q 3HOZG 1P16A 1N33L 3L7ZC 3I4OA 4UP8A 1XMQL 3EN2A 1DGSA 5C3EG 1IL2A 3E9HA 1GO3E 5HGQA 2NZHA 2C35B 5AJ3Q 1VQ4A 1XMOQ 1VQ6A 3GTQH 3UE0A 1J5EQ 3T1YQ 3D31A 1TWCH 2V1CC 4B3TL 4POGA 3PUYA 1X54A 4LFCQ 2K14A 1MJCA 2YU9H 4R4IA 4A3IH 5IYBG 3AEVA 4BXXH 2BH8A 2OCEA 3IRBA 1TWGH 1EIYB 1W3SA 2HIVA 4GN5A 3U4ZA 5C4JH 1LYLA 2VY3A 2Z6KA 1C7YA 4A3DH
chains in the Genus database with same CATH superfamily
2PQAA 4KLKA 2ICIA 1ESFA 5NUCA 1A6XA 1VQCA 4V190 4LF9L 2JEBI 3EVQA 1C0AA 4A3JH 1ICWA 2D0OA 4OEMB 2QEJC 4LMQD 2EYMA 5BR8Q 2DGYA 3D4RA 2EY1A 4A93B 4DR7Q 1LTSD 1U4PA 4KY7A 3S1NB 4JBJA 1DOLA 2F3VA 4LF4Q 5JEAG 3N52A 1VQPA 1PA6A 4QIWE 3W2DA 4ZAIA 4DU9A 1HZAA 1VQEA 1CHQD 3CPWA 3TP5A 1ENFA 3DLLA 1E24A 2R3ZA 1XPUA 2G5DA 2B8GA 5M3MG 1VF7A 2HDMA 4C3HG 3HOVG 1K83B 4LF6L 4A76A 1XTCD 4IJLA 4DAYB 2H1EA 4DNRB 1PH6A 1F9SA 2YU9B 3WOFA 4IOAA 3SE0A 5C4XG 3HOWG 3M7GA 3PIPA 3DEPA 2EXDA 3BZCA 3NQTA 4HN7A 4DA2A 4DR1L 2RDGA 3J81i 1EUJA 3QOJA 4DUYL 2I5LX 1WVLA 2MP1A 3CMAA 3PQIA 5C4ZA 3K57A 5CGKA 1PH8A 4LF9Q 2NVYB 2NVXH 4DV3Q 1GVPA 1IYUA 2K5WA 3RD4A 2F4IA 1Y8NB 2NVTB 3OW7A 1XYIA 3JAME 4A3MB 1FVIA 4A3GH 2A68C 4DF7A 1WTRA 1KXLA 1GM5A 3GQBA 2HCCA 2XSCA 4ODGA 1NR4A 2VZAA 5I4DA 3OOCA 4X64Q 4K14A 4FYDA 2JA5G 2E2IH 1L0WA 2XWJB 4FDBA 1H9MA 5JEAJ 1V1QA 3A7AB 4IQZA 4LF6Q 4DN4M 4NXNL 3TZDA 4EQ5A 1STHA 3KLWA 3GTLH 5M9OA 2CH4A 3X3NA 3PCOB 1O80A 3M4OH 2NN6G 4CGYB 1TWHB 2QCPX 5GADC 4DR1Q 4X65L 2LKVA 5DEHA 4LJZC 4DUZL 1BNZA 2F0QA 1H9SA 1Z9FA 3DWPA 1B9MA 5IT9L 5GAGC 1X9NA 3VR3A 2IX3A 2CQOA 1PHJA 2HDLA 3E0JA 3BG3A 2A6EC 4RCNA 3P1HA 1HPCA 3CRLC 5KRUA 1ICFB 4I7ZC 2OQ0A 2B63G 3S14B 1X3EA 3NSWA 5EKLA 4IFDH 4RCOA 3O13A 5EGTA 2RBMA 5J39A 3TP6A 3J81E 4R4TA 3CPFA 1ESRA 5CV6A 1PYSB 4PG3A 3NTHA 4RGMA 3H3VC 4FXDA 1YNJC 3M3YH 3S1MH 3OYYA 4JC0A 1WI5A 1KABA 4OGQC 3FVQA 4K5WA 3K8AA 3GTJH 2K04A 4IALA 3HKZB 4LFBL 2RQXA 3F8TA 5G3LD 4NXNQ 1WJJA 5LMNW 4ALPA 1VQ5A 4A3DG 4EQPA 3Q0AA 4PV1C 2JA7H 4CDFC 4DPGA 1X6OA 2CHBD 1TT2A 2K4KA 4J8QA 1Y14B 1XMQQ 5ELNA 2NZ1D 4OX9L 5CBEE 1QUQA 4AYBG 1XXGA 5DNFA 4X65Q 5KEEA 4QMGA 3CD6A 1SSOA 4HIKA 1KDBA 2PNHA 3A55A 1WD0A 2DJGC 3W1GA 1TR5A 4AQYL 2JE6I 2JQOA 2F0EA 3KJPA 3I4MB 3S9WA 4NDXA 3G6EA 3KF6B 4RGOS 1Q81C 2NN6I 1YBYA 2G9DA 3UI2A 2WKDA 5IP7H 2MHVA 4DR5L 3KYHC 1HZCA 1LTLA 2FJ2A 2CW0D 4OONA 3PO2H 1KRSA 4BY7B 1SLJA 1NUCA 2AQ1B 4ZUJA 3S2DB 4QJFA 2R93G 4O42A 2NVQH 2B2TC 3SDZA 1I6HH 1J5EL 3C46A 2Y0SB 1SMXA 1AP0A 1QJOA 1T9HA 4KD3A 3ULJA 4LFCL 1O7LA 1SFOH 2IW3A 1D8LA 4KKSA 4O2DA 3I56A 2R7ZG 4LFBQ 1CHPD 3K5NA 2TSSA 1K8MA 2BDNA 3HOZH 1PTOD 3FKIB 2HCIA 2K28A 1TXYA 3DMUA 3NBHA 1GUSA 1STNA 2IY5B 1CFMA 3K7UC 3MEHA 1HR0W 4C3JH 1LTAD 1N32L 1PLFA 3QWNA 1S4ZA 1IYVA 3CC2A 4IUNA 4K2LA 5C44G 2JA6B 3TZUA 1U4MA 4IPDA 1VQAA 3J81c 4X66L 4BBRG 4AQYQ 5IYBH 1IXRA 2CQAA 4G7OC 1XX8A 3G7LA 1DJRD 4K0KL 2UXBL 3S1NH 1A8VA 4K2KA 2AWNA 1B7YB 2QF7A 5JOBA 1QB5D 3EA6A 4G7HC 3PUVA 2B2VC 2A19A 1PRTC 1SNOA 1E0BA 3VR4A 4RH6A 2EYLA 1SE3A 5C5LA 2Q2UA 2JK8A 2BCOA 3HOYB 4F7XA 1RTOA 3K5MA 3F2DA 4U68A 3S17B 1UE7A 2BDOA 1JJ2A 1TS4A 1UUPA 1XPOA 3ND9A 4OIJA 1MJEA 4DV6L 1K83H 2WB1G 1DOMA 1X3QA 3L0OA 4FXKC 4QQBX 4YCUA 4B9WA 2I5HA 5HGTA 5CMDA 2HQEA 3URYA 3KLSX 3EQLC 3TP8A 5BN3A 2DNEA 5C0XG 5DAUA 1NCVA 4R4CA 4WRDA 4ZQ3A 1I4GA 4IPCA 4QGUA 1EQRA 1Q8IA 1P8LA 2N78A 1SYBA 3J7AV 3CCVA 1PRTB 4HJ5A 1GUOA 1N32Q 2OF1A 5FLXL 2J7ZA 2NVYH 4GKKL 3H15A 3ER0A 3GTGB 1OXXK 4I65A 4FF3A 5CR3A 4X66Q 3NE5B 3T51B 3IKJA 2NVTH 4A3MH 2R7DA 2UXBQ 2F0DA 4O1NA 4LF8L 3I3CA 3BDLA 4NW2A 5D65A 5I9PA 3F2BA 1GOZA 4UPAA 5IYDG 4B3RL 1HRJA 1BF4A 4KK7A 1N9WA 3LGJA 5T1IA 1JB7A 3D4WA 4JI2L 1QE6A 4DK0A 2NTSA 4C3IG 4ULLA 1RHPA 1NE3A 3K6OA 3QB3A 3ULPA 3QJYA 3SR1A 1PH9A 4DV6Q 3RNUA 1PVOA 3Q23A 3KJOA 1WTHA 1K3RA 3NBIA 2Q2IA 2PI2E 3UDGA 2EYOA 3RR5A 1EEFD 2B39A 3HOVB 2OT2A 3WWVA 1EWIA 3FPPA 3MTSA 3E3XA 2RF4A 1Y1VH 2LS01 1D7QA 5C0XJ 3NP8A 1EY7A 5C4XB 1M1KC 3C1EA 2KEEA 1L0YB 3MZ5A 3CQZH 4GKKQ 5ELDA 5JJZA 5LMNL 2R92G 1XJVA 2YYZA 2H5XA 3FDTA 1B53A 1CT1D 4GS3A 2UUCL 3S2HH 4JPBW 2WIIB 1K3BC 4LF8Q 2B2YA 4DKAC 1FL0A 1YHBA 1Y8OB 2MO1A 3PO3B 1HUMA 3NQIA 5D3IB 4GNXA 4B3RQ 5FJ8G 2UUBQ 5T1GA 4OWXB 2N49A 4WJ4A 4A3FG 4LFAQ 1HA5A 1YJ9A 2Z6KC 3CCSA 4H7BA 4A3KH 2CW0C 1WTXA 2F0UA 3D0FA 1WCMG 1CA6A 5LL6S 3D3RA 3IL8A 3EN2A 2JA5B 3EROA 1MI2A 5C3EG 1FNVA 1HTLD 1WTPA 1B1ZA 5HGQA 2NZHA 4KY6A 5AJ3Q 1STBA 2EY2A 3GTQH 1JWUD 1EY4A 3TSSA 4RAUC 2PW7A 3D31A 4B3TL 2F0GA 1X54A 5IGBA 1EOTA 2K14A 4R4IA 4A3IH 2JA8B 4BXXH 3IRBA 2BH8A 1LT6D 3T56B 2FHTA 1OO9B 1PTOC 3Q22A 1D2BA 5C4JH 1R4QB 5D3DA 4RKBA 3I7FA 3SK6A 5EQ0A 3B6YA 3I4MH 2OTJA 1N34L 1QVFA 1YNND 5LMNQ 3BYYB 4BS9A 1I4QA 4HIMA 3S1RH 1ASZA 4UAIA 2D5DA 4GN3B 4HCSA 1SXTA 2VW9A 1TY2A 2CVRA 3GO5A 1VQ8A 1F9RA 1QNKA 1HR0L 4GN4B 1BCPD 4KHPL 2MUYA 1V1OA 4CJ0B 2VS1A 2B63B 2Z0SA 1DD2A 4X3UA 1C48A 1B8AA 1TWAB 3G6JB 1Z6HA 1YHQA 3FPUB 4R8IA 4IUPA 1PTOB 2KCNA 3J80E 2F0HA 3I8ZA 4DAYA 5CYUA 1FD7D 1PYBA 4JI4L 1FYCA 3LWEA 2NYZD 3J7YW 4OO1H 2A73B 3T1HL 3OTOQ 3FKIH 5I9OA 5IOCA 5GAHC 1WD1A 1NTGA 2A1AA 2PCFB 2Z8LA 1BUVT 1TWGB 2E74C 2VUMG 3OWFA 4WORA 4B3TQ 1E3PA 4A3EB 2DY7A 3SEBA 4C2MB 4A3DB 3VR2A 1AE2A 3PUWA 2ZJQA 3K0YA 1IBKL 1ET6A 1N36L 3RUZA 4R8NA 3CF5A 1HZBA 2K5VA 2OQKA 1YNXA 4AYBB 3QR8A 1R9TB 1N34Q 3HS0C 1MKHA 1A63A 3UDFA 3UDXA 3HOXG 5LL6X 2E2DC 1AEXA 4PZ8A 2WAQG 1CKNB 5FLMH 2A6HD 4A3CG 4UY8C 1HR0Q 5BN4A 3JC66 5JAVA 5K36G 1T5EA 3S17H 1ZXTA 4DR3L 4NPSA 2PZWA 3Q24A 5FK9C 4X3KA 3RN2A 4IPHA 2F0PA 4JI6Q 1HZ9A 3H3VI 2EYJA 4JI4Q 2R93B 4B3SL 3K7AB 1E2VA 2D0PA 3T1HQ 2DNCA 2JSOA 4BY1G 3VR6A 4DFAA 3MHBA 4FF4A 2EJMA 1VCIA 3K59A 1X56A 2M2LA 1JORA 5M3FG 3TP7A 3RZDB 2K01A 4RGTA 2ZTDA 4LF7L 3GTGH 1IBKQ 2BA0A 3JAMi 3S15B 4DAVA 1VQJA 1STYA 1C8CA 1STAA 1DONA 3S16B 1XNRL 5M5XB 4KMUC 2EYFA 3NEMA 5M5WH 3GTPB 4HEDA 1AE3A 1EFID 1T5XD 4HTHA 2AUKA 2KJXA 2UUAL 5M5YH 4O0AA 1BR9A 2QA4A 1PDQA 1EYGA 2JN4A 4DR3Q 4UDUC 2F0SA 1JE4A 3HOUH 1K0RA 3SK8A 1Y1WG 4JI0Q 2VQFL 3PIO3 5IGFA 1PH3A 4JOIC 4RWSC 3T53B 2EJGC 2EDGA 1BDOA 1H9RA 3GTKB 2JP1A 2N55A 4B3SQ 2AQ3B 4N9TA 3HOVH 2WB1B 3I91A 4YWMA 1DCZA 4X3TA 1LLRD 2K75A 2NZOA 1MSHA 2B2WC 1TKWB 3L2PA 2Z4HA 3AFQA 3W3AA 2KHSA 4A3JG 3A8KE 3QG1A 1KNAA 3OSOA 5IT9E 3PUXA 3EFXD 4ABNA 1B9NA 3VA7A 1PZJD 1XNRQ 3KF6A 1WTVA 3H6MA 3SXHA 3PGZA 1PV4A 1CM9A 4ZCKA 1VDZA 1YNNC 4ID6A 3PO3H 1HNWL 3DXJC 1HXYD 2A69C 1G6PA 1SYGA 3K81C 3TMEA 4DXFA 2F0LA 5KIXA 3FHWA 1BCPC 1RKNA 2VQFQ 3KUPA 1I50B 4DK1A 3A5UA 3DM3A 1U0LA 4ZKCB 4A3BB 4A3LH 5JPNC 2SNMA 1YEZA 2LY7A 3DM1A 4L8JA 2PPBC 1SYFA 1LT5D 2KCTA 4PMBA 3A0JA 2ZT9C 1F2MA 2V4DA 1I6VC 2JA8H 1UAPA 4KJNA 5E4XA 4BA1I 3MXNB 1SNCA 2XWBB 3A5ZB 1SJED 1KQSA 5COYA 1NY4A 1JE5A 1LACA 2L15A 4LF5L 2B2TA 1BVSA 5GROA 4A3GG 5HY6A 1BCPB 3L3OC 3CCUA 2KOLA 3PIOA 4QUCA 1JR0D 1KLUD 4YIJA 2PMZB 1IBLL 2QDBA 4JI1L 3VDYA 4KTAA 3J7ZC 3I72A 4DUYQ 4Q5VA 2FMCA 1YI2A 1HNWQ 2R92B 4BWGB 2EOTA 4J1MA 5GAEC 1KL9A 1LM0A 4JI5L 1KLGD 2K7VA 4YY3L 2ID0A 1IZ6A 1D1IA 1QVCA 2A6HC 2F0JA 5EAYA 5ISRA 5A2QL 5C6AA 4ME3A 1KDAA 5IGDA 1S72A 1LT3D 3AFPA 2XNAC 1GUNA 2IT1A 2K5NA 1AH9A 1B70B 1F2YA 3Q8DA 4A3FB 3HP3A 1Y8PB 2N3SA 5IT9c 3CC7A 3VYSA 1OTCA 3S1QB 5IODA 1X32A 4MZ9A 1NMGA 1UEBA 4OWTB 4A3EH 3PF5A 1HQRD 4C2MH 2SOBA 2B2VA 5JVH3 2LSSA 4LW1A 4CJ2C 3M4QA 4DV2L 2E2HB 3M85A 1QVGA 1KDCA 1LTBD 4LF5Q 1RTNA 1R9TH 1TWFH 2L1BA 4ZKBB 1EOVA 2RA4A 1JQYD 4H13C 4FXGC 3DUZA 3U9OA 2ZJRA 3X3MA 1A2UA 1IBML 3KFUA 3TBIB 1R4PB 4K5XA 1G2TA 3H0GB 1JJGA 3GTMB 4IFDG 2ZXPA 3JAMc 1SE2A 1IBLQ 4DUZQ 4JI1Q 5A35A 1B44D 1CUKA 4E6IA 2E8GA 1SMYD 4JI5Q 4IUUA 2SNSA 4YY3Q 4G57A 1JC7A 4G7ZC 2GN5A 1CQVA 3FRPB 2Q8TA 3STBD 1KC8C 1Q90A 4OELB 2JA7G 2VB3X 3K7AH 1D1KA 2VXWA 4HIDA 5CV5A 2R7FA 1SJHD 3RLFA 4NMZA 3RMHA 3E9IA 1XMOL 1KAAA 4BBSB 2SEBD 5IGEA 3LWUA 3RZOH 1K8OA 4X6AH 1SYEA 2VB2X 2K1BA 3PSIA 1EY8A 2ASBA 4DAMA 2VUMB 4I7AA 5FLXE 2B2UC 4HJ9A 2K32A 1EQVA 2Q8RE 1SE8A 4DV7L 1IKMA 2RCNA 3GTPH 4OX9Q 1HFGA 2IWHA 3I4NB 3PO2G 5J3BA 1I3QB 2K5HA 4APVA 3A8JE 1VQIA 2RHSB 2AUJD 1H9JA 2I07B 3NTIA 4MTNA 2WKCA 4X62L 4K5VA 1TQOA 4JYAL 3MVVA 3R2IA 4IFDJ 4HJ7A 1KNEA 2MJ8A 3CXCA 1I4XA 3G71A 5J22A 5IE8A 1NSNS 4A93H 2JJQA 1BQQT 1SR3A 1A15A 1SN8A 4IOCA 3GTKH 2TMPA 1CKOA 4PMCA 2EJFC 4DR5Q 2F0OA 3HOZG 1P16A 1N33L 2IPKD 1B3QA 4UP8A 1GO3E 3ZYYX 4C3JG 1XMOQ 5D14A 1J5EQ 1SNPA 3E5SA 1PRTF 2F0NA 1WTWA 4XQQA 4CDEC 3PUYA 4LFCQ 4BY1B 1MJCA 2YU9H 5IYBG 3AEVA 2FMMA 2RKSA 2K6AA 4GN5A 3R2TA 1I4PA 1EY5A 1D6EC 1GUWA 2Z6KA 1C7YA 5K5PA 1Z47A 1MIUA 3VA5A 1L1OC 3KBXA 5J1ZA 3VR5A 2K50A 1WFQA 2LMCB 1A3TA 4DV7Q 4JW0A 1K8GA 2CWAA 1PZID 1D5MC 3GTOB 1PYWD 3MXGA 4GLXA 4ME5A 3BVMA 1GUTA 4XQJA 3RLNA 1QILA 1I50H 3ZJYC 1D5ZC 4K0KQ 4DXGA 4A3BH 2Q8IB 3SK4A 1K9MC 1KRTA 1LV9A 4L5SA 3K0XA 1Y1WB 1N33Q 5FLXc 1HHVA 3T13A 4DK3C 1L1OB 4S3SA 4PMWA 1E2WA 3NELA 3Q6SA 3F1ZA 5CV9A 4C1NK 2E75C 3R8BA 3KDFB 2LFNA 3VYTA 3AU7A 4B08A 3HZXA 5IP9G 1IW7D 2M00A 3MAQA 3CCMA 1VS0A 1VMPA 2PQEA 4A3MG 5M3MB 3G4SA 1HH2P 1EQTA 4C3HB 1A3VA 1YJWA 1TWHH 2KENA 3OPOA 1ILQA 1QCBD 3KF8B 3PUZA 2A5HA 3H94A 1L0XB 2RVLA 3CKIB 2VQEL 3CCLA 3HOWB 2B3GA 1Z7TA 2PZTA 1PH2A 3IFTA 4KKTA 3VYUA 3BVGA 3J80i 1LTGD 5C0XI 2ZM6L 4R4QA 2NBFA 1G8ZD 1NNXA 1STGA 1JT8A 1SMYC 2F3WA 3S14H 5HURA 4JVZA 4LUVA 1CKMA 4GLAC 4F88A 3CCEA 4DNIA 1YHAA 4MNOA 3TREA 2Z6BA 1MBYA 2HIXA 3STBC 1Y1VG 2ICEC 3PV0A 4JI2Q 4ZK9B 1AZQA 2EQSA 3BDOA 2L9HA 4L5QA 3GDEA 3K5OA 1CTMA 2PMZE 5F2DA 4QCLA 4KY5A 1KAWA 2YTXA 1SNDA 2RSOA 3AMUA 4WFN3 1E1TA 1EY9A 4RHSA 1EYAA 1CK1A 3J81j 3S24A 1EIFA 1W6JA 3H0GH 1ENCA 2NVXB 2XVSA 4K6DA 2L0CA 2QGQA 2QW7A 3D6CA 3KLSA 4DV1L 3TS0A 3NWTA 2YV5A 3H3VH 4A3KG 1EY0A 4XYOA 3I90A 2YTYA 4A75A 3H91A 1JMCA 4TKOB 4ZUIA 2E2IB 4K6LA 2UUCQ 2XN9C 4R9WA 4QF4A 1B50A 3F2CA 1IHZA 1NJIC 3IAYA 5CV7A 2EPBA 4JI7L 4LWCA 1EWCA 3NHHA 3WDNA 3HKZE 1QG7A 1YIJA 1LO5D 2GA4B 4BY7H 2M9VA 1CQFA 3S2DH 4OL7A 3W5OA 4DK6C 4BBSH 4A3IG 4BXXG 2JXMB 2B29A 2MPMA 1Q8KA 1RJTA 1EY6A 1RDPD 4V0BA 5LMUL 1WTOA 2UXCL 1ENAA 4IUTA 3BJUA 1RF2D 3V2TA 5IWAL 2VUMH 4LNQA 1HCZA 4PNYA 1RL2A 3TN2A 4J15A 1TWCB 4ILWA 4HSVA 5EPLA 4N8FA 1E2ZA 2FXQA 2EY5A 2BA1A 3I4NH 5EBDA 4B3ML 3G48A 1II3A 2K05A 3BDCA 3NUCA 1I3QH 5I2YA 5DM63 4NXML 2JA6H 1F2LA 2O4XA 3MWYW 4RKLA 4C56C 3D4DA 2B2WA 4H44C 1A62A 1JWMD 2CWPA 2R61A 5E3FA 1AN8A 4XDXA 1RD9D 3MC0B 2X69A 1K73C 1J6QA 4ZYSA 1SE4A 1YZ6A 4OO1G 2AWOA 2Y0SE 1CSPA 4G4KA 3HKSA 3M3YB 3S1MB 4TSSA 3FKIG 1VQFA 5IYCH 3F2UA 3HOYH 5EJWA 2KBNA 1C4QA 2JYOA 4KHPQ 1CI3M 1PFSA 5E4WC 2KVMA 4XIGS 1IL8A 2EYPA 3MXNA 4WJWA 1G51A 1SNMA 2JA7B 4CHTB 5LMUQ 1X55A 1X3PA 2F0KA 4JG2A 2UXCQ 2QEXA 2A6ED 5IWAQ 5FO7B 4EX5A 4DV4L 1BBWA 4MHEA 1X3FA 4GOPC 1EL0A 4CKBA 3K5LA 3U4VA 5FO9B 3PIP3 2EE1A 3J7A5 4WJ3M 3CAMA 2KHIA 5FLMG 1STEA 3VYRA 2DN8A 2XTIA 4B3MQ 4DR7L 2R7ZB 4FP5D 3U58A 1JCKB 2PO4A 5GQOA 1N36Q 4NXMQ 4DR6L 4JBWA 5CBAE 3ITPA 3AQQA 3OHXC 5LHY1 3C3LA 1ML0D 2X6GA 5IGCA 2BOSA 1ZKOA 1XPRA 4P71A 3PO2B 1XNQL 3FEWX 3GD7A 1KD1C 4JI8L 5C44B 3J80c 4ZRZA 1PFBA 3C1FA 4BBRB 3V96A 1Y1WH 4GOPB 3ND8A 2NTTA 1PXUA 1U4LA 1SFOB 1VQBA 5JEAH 1VQOA 1GHKA 2KEDA 4CKEA 1ET9A 2QDLA 3I2ZA 1HNZL 1VQLA 1S5BD 3T4AC 2BE5D 3BS1A 4X3SA 4Y7NB 1UNSA 3QOLA 5M3MH 4C3JB 4DV4Q 2I0QA 5EKKA 3HG9A 4C3HH 2ZTCA 2AMCB 1JB3A 1I4HA 4DV3L 5FO8B 3SHLA 1I5FA 1S3OA 1CA5A 5C4XH 5CV4A 3CU7A 4H02A 3HOWH 3CCJA 1PMRA 1JJCB 3D6WA 1G2SA 1GXDC 1X65A 4LF7Q 1SRUA 1M8AA 3CHBD 3A7LA 4KN4C 3HOUG 4DR6Q 1VQDA 4EGVA 4X64L 3NPPA 3A54A 3OIPA 2CCZA 2HHHL 2SDFA 4U673 1XNQQ 3ONAB 4TVAB 5C4HA 5A2QE 2DJFC 1Q82C 2C9OA 4JI8Q 4FF1A 1EYDA 4ZLTF 1M90C 4GKJL 2UUAQ 5JJIA 3SK5A 3MXPA 1V43A 1Y69U 4RHRA 3TDQA 1JWSD 2DUDA 2K33A 5CC4A 2F0TA 4CBVA 1CZGA 1QNUA 5C5MA 2L4NA 1HNZQ 1CSQA 4KD4A 5I6YA 2JA5H 3M7NA 2X6LA 2WACA 5CV8A 2VL6A 3M4YA 4C3IB 1BCPF 1K28A 3CCQA 1Q1EA 1ILPA 1G291 2MNAA 4FNFA 2CKZB 1MSGA 3PMFA 2KHJA 1YJNA 1N8RC 4HCEA 4DNTB 3PO3G 4KN7C 3TEHB 5JJLA 3NWSA 4HSPA 3CP0A 1Q7YC 1PRTD 1LABA 2XRSD 3SGIA 2E5LL 2J0TD 1Q46A 1AZPA 1BO0A 3NTKA 2NN6H 1F77A 2AHOB 3TS2A 4JCVE 4IUVA 4DAPA 1M4VA 1S5FD 3FP9A 2WP8J 4DGZA 2PNRC 1V8QA 1EIHA 1OXVA 1U9RA 4A3LG 1VQNA 2HHHQ 3PF4A 1B3AA 1RIPA 4IUQA 2B2UA 1V1PB 1F9QA 1EYCA 2EY6A 1GKHA 4GKJQ 2UXDL 1EFWA 2B63H 2F52A 2JA8G 2LXKA 1TWAH 2I46A 3I4OA 5DM73 1BBXC 2WINB 1XMQL 3QO2A 1ONLA 1DGSA 2NB0A 1IL2A 1PTOH 3I73A 1VQ4A 1VF5C 3P75A 5EKIA 3UE0A 1Y1VB 1TWCH 2V1CC 2Z9HA 3WOEA 3GV3A 2E2JB 1TWGH 3CQZB 1EIYB 1WCMB 5ELEA 1SYDA 4MIUA 2H4OA 4A3DH 2E76C 5C3EB 1PZKD 2F0VA 3GP7A 2E5LQ 3K80C 3S2HB 1NBWA 1ZYRD 1DYQA 4UHVA 2D62A 1B2TA 3CC4A 1A0IA 2PQAB 4JI3L 2ENBA 1H9KA 5C3XA 1HJPA 4J6HA 4N8X1 3JAML 4K8JA 4YWKA 1LUZA 1EZ8A 3NK9A 4A3KB 1NR2A 2XRQD 4JBKA 2JEAI 2ZXOA 2NUCA 4A3EG 2UXDQ 1L1OA 5I6WA 1SDFA 2AQ2B 1YITA 1TVXA 3EBEA 1O7YA 2I5MX 1EIGA 3T16A 3GTQB 3KDFA 4LK1C 1H95A 1W2BA 2GVAA 1J9OA 1PH1A 2R93H 4IPGA 4A3IB 4RG1A 4OIKA 5C4JB 2KECA 1FNWA 4AYBE 2BE5C 1Q3LA 4OWWB 4QY7A 2WFWA 2YTVA 2Z4IA 3KF8A 2R7ZH 3RZDH 3TQYA 3OMGA 3S1RB 2KA7A 3HRZC 4QB4A 2Q2TA 5TSSA 4MTKA 4YCVA 2RDHA 1U5KA 5ELCA 4DV2Q 3S15H 4AIMA 3MFGA 2EYHA 3S16H 1SROA 2XGTA 5M5XH 4BA2I 1BOSA 4JI3Q 5BN5A 2N8NA 2NWGA 3DWAA 5IP7G 1IBMQ 5C44H 3DEOA 4BBRH 2K5DA 2HQLA 1MGSA 1JOOA 2UU9L 2K52A 3DWQA 2BH2A 3V05A 4HJ8A 4XXEA 3KOJA 3J81L 2CFMA 3HOXB 1QOHA 1JOQA 1XTDA 2WAQB 5ELFA 2IX0A 1OXTA 3CW2C 1CZWA 2HD3A 4Y7NH 4L5RC 3EIVA 4IFDI 1AFPA 2L55A 2KUMA 2IJ0A 3MEFA 4C1NI 1S5ED 4PQXA 1SAPA 3MFYA 3RN5A 4L6TB 2OXPA 4TQUS 1PH4A 1EQQA 1ASYA 3U9SA 1IKLA 2L11A 4RFBA 1FJGL 1MD2D 1KHIA 3K58A 5C0XH 2KCCA 5ELOA 3EJIA 2XIWA 3HGBA 5EBCA 2ZJPA 1LTTD 4GLVB 5FKAC 1H9SB 4A93G 4OXPA 3CCRA 3A8IE 4HMIA 1VQ7A 1ZEQX 2QKIC 5M3FB 4NP5A 3U50C 3AYHB 1HUNA 1YVCA 2JA9A 2EIFA 2D2CC 3MXUA 3R93A 4B9XA 1KIXA 1TIID 3ERQA 2UU9Q 4IN3A 2J4XA 4A4IA 4X62Q 2PYKA 4Y52H 2Z1CA 4QUFA 2WB1E 4JYAQ 1RCVD 3RLOA 5I2XA 1NAPA 3SVMA 5IYDH 4LUOA 4POFA 1Q86C 2QILA 4DR2L 1I4RA 1VQKA 4UP9A 2EVBA 4C3IH 4CJ1B 1JOKA 1TS2A 1K0SA 2L5TA 4QIWB 1HA6A 1C9OA 3LX0A 4P2CB 3BZKA 5IP9H 3ERSX 1HNXL 1FJGQ 1U4RA 1HQMC 4DR4L 5M5WB 2AKWB 1QUQB 5AFWA 3C2PA 2IX1A 4XQNA 3BYTB 1GHJA 1GD7A 2MFIA 5JJKA 2UUBL 4M1UB 1A3UA 1S5DD 5M5YB 1ZYRC 3H09A 2MO0A 4A3BG 1HFNA 4P73A 4HAEA 3UE1A 1B4OA 4LFAL 2F0IA 2F3IA 4P72A 2PZUA 1JICA 4A3JB 2F4VL 4NB3A 3HOUB 1CKNA 2RHQB 4P74A 2R92H 2RSNA 2A8VA 4YHHL 1NMFA 4FVMA 1V9PA 2ALYB 5EPJA 1AW7A 5G3LF 2MGSA 5AJ3L 1O78A 1TS3A 3FMCA 1Q12A 1OXUA 4GZYC 1WOCA 4KI0A 4YCWA 5FJ8H 1BBUA 4DR2Q 4RGNA 4A3FH 4K8IA 2DY8A 4KV6A 5JPMC 1UE5A 3S1QH 4XTCS 4LAAA 2E2JH 3BVZA 1WCMH 1X3GA 4MN3A 2K03A 1XWEA 2OTLA 1HNXQ 1EZ6A 4LUZA 5C3EH 4JK1C 4FF2A 3E0EA 1VQGA 1RODA 3OIQA 2E2HH 3W1BA 4DR4Q 1SNQA 2HUGA 3NBHB 3N6RA 2F1MA 4QL5A 2C5CA 4HR7B 3ICEA 2ATWA 5DLQE 3D8GA 4IO9A 1DM0B 5KNBA 2ES2A 4XT1B 1TS5A 5JVG3 4N9PA 4DV0L 2EZVA 4JBMA 3GTMH 1PFNA 3I70A 3TRZA 3CRKC 2RDFA 1S40A 2KQ3A 1QZHA 2F4VQ 2OEOA 2ZTEA 4FO2A 5C3WA 5E1FA 3OW2A 4F87A 4GOPA 4OHJA 2VQEQ 1E1OA 4YHHQ 4A3GB 3QIAA 4AH6A 2F0FA 2CH4W 4EQOA 1GUGA 3OTOL 2ZM6Q 4RA8A 3HKZG 5EPKA 4L5TA 1PTOF 1PH7A 1PH5A 1VQMA 1E7ZA 1GJXA 3BZDB 4TRDA 4DV5L 1OXSC 4CKCA 2GVBA 2A74C 4R4OA 4RMFA 2RCFA 3DHQA 3H0GG 2WV6D 1VMCA 2IHEA 1S5CD 1DOKA 3A56A 3BU2A 3P7JA 1UE1A 3GTLB 1QZGA 1G6ZA 5FOBB 1I94L 2MQHA 3OWEB 4M8AA 3M4OB 2A69D 4H0LC 2FFKB 1BKBA 1TU2B 4NKLA 5KNCA 4YWLA 3I4MG 1E22A 4JV5L 5KYLA 2F0WA 2O2LD 4P75A 2O5JC 2D9UA 4IJHA 5IIFA 2F0MA 4KHVA 1TY0A 3MA2B 5CORA 1FGBD 1SEBD 1A2TA 2IHFA 4JOIA 2A68D 4DV0Q 4HJAA 1FR3A 3ULLA 2G9HD 4BY7G 4JI6L 5ELBA 4R1JA 2R6GA 3P20A 4DV1Q 5KGUA 1LTID 1QWYA 4BBSG 4KKUA 1KTKA 4Z9CB 3HOXH 2KCMA 2Y0SG 4EQNA 4UP7A 4CDDC 4A3CH 5IGGA 2L12A 4XYQA 5K36H 3LNNA 3NXWA 3GV6A 3CMEA 2OWOA 1O7ZA 4L63B 4DV5Q 1G91A 1UWVA 1D5XC 4JI7Q 4KJOA 4Q0FA 1PFMA 2B2YC 2PI2A 3GTJB 3I4NG 4HIOA 3T1YL 2LXJA 1EU4A 3KBGA 2HT1A 1BXTA 1Q1BA 1EU3A 2B8FA 1FGUA 5E7NA 4GNXC 1TWFB 1VQHA 1I94Q 2JA6G 3KK7A 4BY1H 1VQ9A 4PZ6A 3UDIA 1WTQA 4HMJA 3I55A 4PZ7A 3E6ZX 3I4LA 5H1SE 2EXZA 4XT3B 1O7IA 4JV5Q 2VNUD 1DZ1A 3IFDA 1K8AC 5M3FH 3M4PA 2Q2HA 1MHWC 2N88A 1IW7C 2P5ZX 1LT4D 4KHZA 5IY0A 5BR8L 4IZ8A 2WAQE 3OMCA 4JI0L 3HFZB 5KYIA 1J8IA 5IYCG 3GTOH 2O5IC 3HOYG 3M9BA 3A74A 1V1PA 4LF4L 3J7AF 1SYCA 1LTRD 1L2FA 1F9PA 1YNJD 2K5QA 2FINB 1IYJB 4GNXB 4F8MA 3NENA 4IURA 1UE6A 4CDCC 2F03A 1WYDA 1EEID 3L7ZC 4EVOA 3J80L 2ZXRA 2NVQB 1I6HB 5L37A 3E9HA 3RZOB 3AB9A 2C35B 1F2ZA 1VQ6A 2PW5A 1FNUA 3L9AX 5KNDA 3T1YQ 4POGA 1W6KA 1SBBB 1EWHA 2OCEA 3HEJA 1W3SA 3HOZB 3KLRA 1HTPA 2IL8A 2HIVA 1DXMA 3U4ZA 1LYLA 1UEAB 2VY3A 3R3OA 4OO1I
chains in the Genus database with same CATH topology
1Z47A 1MIUA 1L1OC 2PQAA 4KLKA 3B6YA 2K50A 1WFQA 2E5LQ 3K80C 4DV7Q 1NBWA 3I4MH 2OTJA 1N34L 1VQCA 5LMNQ 1K8GA 1QVFA 4LF9L 2JEBI 4HIMA 3S1RH 2CWAA 2D62A 1ASZA 3CC4A 1A0IA 1C0AA 2PQAB 4A3JH 4JI3L 4GN3B 2D0OA 5BR8Q 4GLXA 2VW9A 2DGYA 3GO5A 1VQ8A 4DR7Q 1HJPA 3RLNA 1HR0L 4GN4B 4JBJA 4YWKA 4LF4Q 4KHPL 5JEAG 1LUZA 1PA6A 1VQPA 2VS1A 2Z0SA 1I50H 3ZJYC 4K0KQ 4QIWE 1B8AA 4JBKA 2JEAI 4A3BH 1HZAA 1VQEA 3CPWA 4A3EG 2UXDQ 1L1OA 3DLLA 1YHQA 1K9MC 1KRTA 1E24A 1XPUA 4L5SA 3K0XA 1YITA 5M3MG 1N33Q 5FLXc 3EBEA 1PYBA 4DK3C 2I5MX 4JI4L 3KDFA 1L1OB 3HOVG 4PMWA 1H95A 4LF6L 3NELA 4A76A 3T1HL 2GVAA 1W2BA 3OTOQ 3F1ZA 3FKIH 4IJLA 4DAYB 5GAHC 1PH6A 4IPGA 1PH1A 1NTGA 2A1AA 2R93H 4IOAA 3KDFB 2VUMG 5C4XG 4RG1A 3HOWG 5IP9G 1E3PA 3PIPA 4B3TQ 2EXDA 3BZCA 4AYBE 3CCMA 1VS0A 1AE2A 3PUWA 4QY7A 4OWWB 4DR1L 2ZJQA 2WFWA 3J81i 4A3MG 1IBKL 2YTVA 1EUJA 1N36L 3G4SA 2R7ZH 3CF5A 4DUYL 1HH2P 2I5LX 3TQYA 3RZDH 1YJWA 1HZBA 1TWHH 2K5VA 2OQKA 2KENA 2Q2TA 1YNXA 4YCVA 3CMAA 1U5KA 4DV2Q 3S15H 3KF8B 1N34Q 3PUZA 1PH8A 4AIMA 4LF9Q 2NVXH 1MKHA 1SROA 2XGTA 1GVPA 5M5XH 3UDFA 3UDXA 3HOXG 2B3GA 2N8NA 4DV3Q 4JI3Q 4BA2I 1PH2A 4PZ8A 2WAQG 5IP7G 1CKNB 3J80i 5FLMH 4A3CG 5C0XI 2ZM6L 1FVIA 4R4QA 1IBMQ 4UY8C 4A3GH 5C44H 1HR0Q 3JC66 5K36G 3S17H 4BBRH 1JT8A 1KXLA 4DR3L 1GM5A 4NPSA 2HQLA 4LUVA 3S14H 2UU9L 2K52A 1CKMA 4GLAC 2VZAA 2BH2A 3CCEA 4HJ8A 4X64Q 3KOJA 4DNIA 1YHAA 3RN2A 4IPHA 2E2IH 2JA5G 4MNOA 3TREA 1L0WA 2CFMA 4JI6Q 4FDBA 1HZ9A 3H3VI 2HIXA 5JEAJ 3STBC 1XTDA 2IX0A 1OXTA 1V1QA 1Y1VG 3PV0A 3CW2C 4JI2Q 4B3SL 4JI4Q 2EQSA 2D0PA 4Y7NH 4L5RC 4LF6Q 3EIVA 4IFDI 3T1HQ 4NXNL 4BY1G 4L5QA 3MEFA 3GDEA 2PMZE 4EQ5A 3KLWA 1VCIA 3GTLH 3RN5A 3PCOB 1X56A 1KAWA 2YTXA 4TQUS 1PH4A 1EQQA 1ASYA 3M4OH 5M3FG 2NN6G 1FJGL 1E1TA 2ZTDA 5GADC 4DR1Q 4LF7L 4X65L 4DUZL 1KHIA 1IBKQ 3GTGH 2BA0A 3J81j 3S24A 1EIFA 5ELOA 3JAMi 1Z9FA 1VQJA 3H0GH 5GAGC 2ZJPA 1X9NA 1XNRL 2CQOA 1PHJA 2QGQA 3NEMA 4GLVB 5M5WH 4DV1L 4A93G 4OXPA 3CCRA 3TS0A 3S16H 1VQ7A 1AE3A 2YV5A 3U50C 3AYHB 2OQ0A 2B63G 3H3VH 4A3KG 2UUAL 1YVCA 2YTYA 5M5YH 2JA9A 4O0AA 4A75A 1X3EA 2EIFA 1JMCA 2QA4A 1KIXA 1EYGA 2UUCQ 4DR3Q 3F2CA 2UU9Q 3HOUH 1K0RA 1Y1WG 4JI0Q 2VQFL 4R4TA 1NJIC 3CPFA 1PYSB 4A4IA 4X62Q 4PG3A 4JI7L 4LWCA 1YIJA 1PH3A 4Y52H 3HKZE 4JOIC 4JYAQ 2WB1E 3RLOA 3M3YH 4BY7H 3S1MH 3S2DH 3OYYA 3W5OA 4DK6C 4JC0A 5IYDH 4LUOA 1WI5A 4POFA 4A3IG 4BBSH 1Q86C 4BXXG 4DR2L 4B3SQ 3K8AA 2B29A 3GTJH 1VQKA 3HOVH 1Q8KA 4UP9A 4YWMA 3F8TA 4LFBL 4NXNQ 1WJJA 5LMUL 5LMNW 2K75A 4ALPA 1VQ5A 2NZOA 4C3IH 4A3DG 2UXCL 2JA7H 3L2PA 4DPGA 3BJUA 1X6OA 1C9OA 2K4KA 5IWAL 1Y14B 3CCLA 4LNQA 2VUMH 1XMQQ 5ELNA 3BZKA 5IP9H 4OX9L 1RL2A 3ERSX 3AFQA 1QUQA 4J15A 4AYBG 1HNXL 1FJGQ 4A3JG 4X65Q 3CD6A 3PUXA 2FXQA 4DR4L 2AKWB 1QUQB 2BA1A 4HIKA 3I4NH 4B3ML 2PNHA 3G48A 1XNRQ 3W1GA 3KF6A 1I3QH 4AQYL 3PGZA 1PV4A 2IX1A 1GD7A 2MFIA 5JJKA 2JE6I 2JQOA 2UUBL 4NXML 2JA6H 3KJPA 2MO0A 4A3BG 4P73A 3G6EA 3PO3H 1HNWL 3KF6B 3UE1A 1Q81C 2NN6I 4LFAL 1A62A 1YBYA 2F3IA 4P72A 2F4VL 2CWPA 5IP7H 1G6PA 4NB3A 1CKNA 2RHQB 4DR5L 3K81C 1HZCA 1LTLA 3KYHC 1J6QA 4P74A 1K73C 2R92H 2A8VA 4YHHL 1NMFA 1YZ6A 4OO1G 4OONA 2AWOA 2Y0SE 1CSPA 1KRSA 1V9PA 2ALYB 1SLJA 3FHWA 3HKSA 3PO2H 2VQFQ 3FKIG 1A63A 4OO1I 1VQFA 4QJFA 5AJ3L 2R93G 5IYCH 3A5UA 3DM3A 2NVQH 3HOYH 1I6HH 1U0LA 1J5EL 1Q12A 2KBNA 4A3LH 1OXUA 4KHPQ 1SMXA 1WOCA 1YEZA 1T9HA 4KI0A 1PFSA 4YCWA 4LFCL 3ULJA 5FJ8H 1BBUA 4XIGS 4DR2Q 1SFOH 2KCTA 1G51A 1D8LA 4O2DA 3I56A 4A3FH 2R7ZG 3A0JA 4LFBQ 5LMUQ 1X55A 4JG2A 1UE5A 3S1QH 2UXCQ 2QEXA 4XTCS 2JA8H 2E2JH 4BA1I 1WCMH 3MXNB 3HOZH 1X3GA 3A5ZB 5IWAQ 4EX5A 1TXYA 4DV4L 1BBWA 2OTLA 1X3FA 4GOPC 4LUZA 1KQSA 5C3EH 1HNXQ 2IY5B 1NY4A 3E0EA 3K7UC 1VQGA 1JE5A 1HR0W 2L15A 3U4VA 4C3JH 4LF5L 3J7A5 1N32L 4WJ3M 2E2HH 3CAMA 3W1BA 4DR4Q 2KHIA 1BVSA 5FLMG 3NBHB 5GROA 3CC2A 4A3GG 5HY6A 4QL5A 4B3MQ 2XTIA 5C44G 3CCUA 4DR7L 4IPDA 1VQAA 3J81c 4X66L 3PIOA 4BBRG 3U58A 5DLQE 4AQYQ 2ATWA 3ICEA 5IYBH 1IXRA 4IO9A 1IBLL 5GQOA 4DR6L 4JI1L 3VDYA 1N36Q 4NXMQ 4K0KL 3J7ZC 2ES2A 3S1NH 4DUYQ 2UXBL 1A8VA 4JBWA 1YI2A 2AWNA 4DV0L 4JBMA 3GTMH 1B7YB 3AQQA 3TRZA 1HNWQ 1S40A 1QZHA 5GAEC 2F4VQ 1KL9A 1LM0A 2ZTEA 1XPRA 4P71A 4JI5L 3PUVA 1XNQL 2A19A 3GD7A 1KD1C 4YY3L 3OW2A 2ID0A 1IZ6A 4GOPA 2VQEQ 4JI8L 1QVCA 1E1OA 5EAYA 4YHHQ 4AH6A 2Q2UA 2JK8A 3J80c 4ME3A 3F2DA 1UE7A 1S72A 1Y1WH 3OTOL 3AFPA 1JJ2A 2ZM6Q 4GOPB 3I7FA 1XPOA 1MJEA 3HKZG 4DV6L 2IT1A 1K83H 2K5NA 2WB1G 4L5TA 1B70B 1AH9A 3L0OA 4QQBX 1PH7A 3Q8DA 1VQBA 4YCUA 2I5HA 1PH5A 2N3SA 5IT9c 1VQMA 3CC7A 1E7ZA 1OTCA 4DV5L 1VQOA 1OXSC 4MZ9A 1HNZL 3I2ZA 5C0XG 1VQLA 1NMGA 1UEBA 4OWTB 2GVBA 4A3EH 4R4OA 3PF5A 4R4CA 4RMFA 3H0GG 4C2MH 2IHEA 4IPCA 4QGUA 1EQRA 5M3MH 2LSSA 3BU2A 4LW1A 4DV4Q 3M4QA 4DV2L 1UE1A 2I0QA 4C3HH 1P8LA 3M85A 2ZTCA 2N78A 1QZGA 1I94L 1QVGA 2MQHA 2AMCB 4DV3L 3CCVA 4LF5Q 4HJ5A 1BKBA 1R9TH 1TWFH 1N32Q 1I5FA 1S3OA 1EOVA 4YWLA 2NVYH 3I4MG 1E22A 3ER0A 5C4XH 3H15A 2ZJRA 4GKKL 4H02A 3HOWH 1OXXK 4JV5L 1IBML 3KFUA 4P75A 3CCJA 1JJCB 4X66Q 1JJGA 1X65A 4IJHA 4IFDG 3JAMc 4LF7Q 1SRUA 1IBLQ 4DUZQ 2NVTH 3HOUG 4DR6Q 4JI1Q 4A3MH 2R7DA 2UXBQ 4JOIA 2IHFA 1CUKA 2E8GA 4DV0Q 4LF8L 1VQDA 4X64L 4HJAA 3ULLA 4BY7G 2CCZA 4JI6L 4R1JA 3F2BA 2HHHL 4JI5Q 2R6GA 4UPAA 1XNQQ 5IYDG 4DV1Q 4B3RL 4TVAB 4YY3Q 4BBSG 1N9WA 3LGJA 1Q82C 4JI8Q 1JB7A 4JI2L 2GN5A 3HOXH 2KCMA 2Y0SG 1M90C 3STBD 4UP7A 4GKJL 1KC8C 2UUAQ 5JJIA 1NE3A 3ULPA 1V43A 2JA7G 4A3CH 1PH9A 3K7AH 4DV6Q 3RNUA 2DUDA 1PVOA 4HIDA 3KJOA 3CMEA 2OWOA 2R7FA 4DV5Q 1K3RA 3RLFA 1UWVA 2Q2IA 3E9IA 1CSQA 1HNZQ 1XMOL 4JI7Q 2JA5H 2PI2E 3M7NA 3UDGA 2PI2A 3I4NG 3RR5A 3RZOH 4HIOA 3T1YL 2LXJA 4X6AH 3WWVA 1EWIA 2VL6A 2HT1A 1Q1BA 1FGUA 5E7NA 3CCQA 1Q1EA 1Y1VH 2RF4A 3PSIA 1G291 4GNXC 2MNAA 1D7QA 1VQHA 2ASBA 5C0XJ 2CKZB 4DAMA 1I94Q 2JA6G 2KHJA 1YJNA 1N8RC 4BY1H 1M1KC 1VQ9A 3PO3G 4PZ6A 3UDIA 4HJ9A 3TEHB 5JJLA 3CQZH 3CP0A 3I55A 1SE8A 1Q7YC 4PZ7A 3SGIA 4GKKQ 5H1SE 2E5LL 4DV7L 1O7IA 4JV5Q 2VNUD 2RCNA 3GTPH 4OX9Q 1Q46A 5LMNL 1XJVA 2R92G 2YYZA 2H5XA 5M3FH 3M4PA 1K8AC 2Q2HA 2AHOB 5IY0A 4GS3A 4JCVE 4KHZA 5J3BA 2UUCL 3TS2A 5BR8L 3PO2G 3S2HH 2K5HA 2WAQE 4APVA 3FP9A 4JI0L 1VQIA 3HFZB 2RHSB 2WP8J 4LF8Q 4MTNA 1FL0A 4DKAC 5IYCG 3GTOH 1YHBA 4X62L 3HOYG 1OXVA 4JYAL 2MO1A 3M9BA 3A74A 2VQEL 1VQNA 4A3LG 4IFDJ 2HHHQ 3PF4A 4HJ7A 4LF4L 4GNXA 4B3RQ 3CXCA 3G71A 5FJ8G 5IE8A 4OWXB 2UUBQ 4A93H 2N49A 1L2FA 1RIPA 2JJQA 4WJ4A 1IYJB 1SR3A 4LFAQ 4A3FG 1YJ9A 4GKJQ 1SN8A 1GKHA 2UXDL 4GNXB 2Z6KC 3CCSA 2F52A 3NENA 4A3KH 4IOCA 1EFWA 2B63H 1UE6A 2JA8G 2LXKA 3GTKH 1CKOA 3D0FA 1WCMG 1TWAH 1WYDA 4DR5Q 3HOZG 1P16A 1N33L 3L7ZC 3I4OA 4UP8A 1XMQL 3EN2A 1DGSA 5C3EG 1IL2A 3E9HA 1GO3E 5HGQA 2NZHA 2C35B 5AJ3Q 1VQ4A 1XMOQ 1VQ6A 3GTQH 3UE0A 1J5EQ 3T1YQ 3D31A 1TWCH 2V1CC 4B3TL 4POGA 3PUYA 1X54A 4LFCQ 2K14A 1MJCA 2YU9H 4R4IA 4A3IH 5IYBG 3AEVA 4BXXH 2BH8A 2OCEA 3IRBA 1TWGH 1EIYB 1W3SA 2HIVA 4GN5A 3U4ZA 5C4JH 1LYLA 2VY3A 2Z6KA 1C7YA 4A3DH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z47 A;  1MIU A;  1L1O C;  2PQA A;  4KLK A;  3B6Y A;  2K50 A;  1WFQ A;  2E5L Q;  3K80 C;  4DV7 Q;  1NBW A;  3I4M H;  2OTJ A;  1N34 L;  1VQC A;  5LMN Q;  1K8G A;  1QVF A;  4LF9 L;  2JEB I;  4HIM A;  3S1R H;  2CWA A;  2D62 A;  1ASZ A;  3CC4 A;  1A0I A;  1C0A A;  2PQA B;  4A3J H;  4JI3 L;  4GN3 B;  2D0O A;  5BR8 Q;  4GLX A;  2VW9 A;  2DGY A;  3GO5 A;  1VQ8 A;  4DR7 Q;  1HJP A;  3RLN A;  1HR0 L;  4GN4 B;  4JBJ A;  4YWK A;  4LF4 Q;  4KHP L;  5JEA G;  1LUZ A;  1PA6 A;  1VQP A;  2VS1 A;  2Z0S A;  1I50 H;  3ZJY C;  4K0K Q;  4QIW E;  1B8A A;  4JBK A;  2JEA I;  4A3B H;  1HZA A;  1VQE A;  3CPW A;  4A3E G;  2UXD Q;  1L1O A;  3DLL A;  1YHQ A;  1K9M C;  1KRT A;  1E24 A;  1XPU A;  4L5S A;  3K0X A;  1YIT A;  5M3M G;  1N33 Q;  5FLX c;  3EBE A;  1PYB A;  4DK3 C;  2I5M X;  4JI4 L;  3KDF A;  1L1O B;  3HOV G;  4PMW A;  1H95 A;  4LF6 L;  3NEL A;  4A76 A;  3T1H L;  2GVA A;  1W2B A;  3OTO Q;  3F1Z A;  3FKI H;  4IJL A;  4DAY B;  5GAH C;  1PH6 A;  4IPG A;  1PH1 A;  1NTG A;  2A1A A;  2R93 H;  4IOA A;  3KDF B;  2VUM G;  5C4X G;  4RG1 A;  3HOW G;  5IP9 G;  1E3P A;  3PIP A;  4B3T Q;  2EXD A;  3BZC A;  4AYB E;  3CCM A;  1VS0 A;  1AE2 A;  3PUW A;  4QY7 A;  4OWW B;  4DR1 L;  2ZJQ A;  2WFW A;  3J81 i;  4A3M G;  1IBK L;  2YTV A;  1EUJ A;  1N36 L;  3G4S A;  2R7Z H;  3CF5 A;  4DUY L;  1HH2 P;  2I5L X;  3TQY A;  3RZD H;  1YJW A;  1HZB A;  1TWH H;  2K5V A;  2OQK A;  2KEN A;  2Q2T A;  1YNX A;  4YCV A;  3CMA A;  1U5K A;  4DV2 Q;  3S15 H;  3KF8 B;  1N34 Q;  3PUZ A;  1PH8 A;  4AIM A;  4LF9 Q;  2NVX H;  1MKH A;  1SRO A;  2XGT A;  1GVP A;  5M5X H;  3UDF A;  3UDX A;  3HOX G;  2B3G A;  2N8N A;  4DV3 Q;  4JI3 Q;  4BA2 I;  1PH2 A;  4PZ8 A;  2WAQ G;  5IP7 G;  1CKN B;  3J80 i;  5FLM H;  4A3C G;  5C0X I;  2ZM6 L;  1FVI A;  4R4Q A;  1IBM Q;  4UY8 C;  4A3G H;  5C44 H;  1HR0 Q;  3JC6 6;  5K36 G;  3S17 H;  4BBR H;  1JT8 A;  1KXL A;  4DR3 L;  1GM5 A;  4NPS A;  2HQL A;  4LUV A;  3S14 H;  2UU9 L;  2K52 A;  1CKM A;  4GLA C;  2VZA A;  2BH2 A;  3CCE A;  4HJ8 A;  4X64 Q;  3KOJ A;  4DNI A;  1YHA A;  3RN2 A;  4IPH A;  2E2I H;  2JA5 G;  4MNO A;  3TRE A;  1L0W A;  2CFM A;  4JI6 Q;  4FDB A;  1HZ9 A;  3H3V I;  2HIX A;  5JEA J;  3STB C;  1XTD A;  2IX0 A;  1OXT A;  1V1Q A;  1Y1V G;  3PV0 A;  3CW2 C;  4JI2 Q;  4B3S L;  4JI4 Q;  2EQS A;  2D0P A;  4Y7N H;  4L5R C;  4LF6 Q;  3EIV A;  4IFD I;  3T1H Q;  4NXN L;  4BY1 G;  4L5Q A;  3MEF A;  3GDE A;  2PMZ E;  4EQ5 A;  3KLW A;  1VCI A;  3GTL H;  3RN5 A;  3PCO B;  1X56 A;  1KAW A;  2YTX A;  4TQU S;  1PH4 A;  1EQQ A;  1ASY A;  3M4O H;  5M3F G;  2NN6 G;  1FJG L;  1E1T A;  2ZTD A;  5GAD C;  4DR1 Q;  4LF7 L;  4X65 L;  4DUZ L;  1KHI A;  1IBK Q;  3GTG H;  2BA0 A;  3J81 j;  3S24 A;  1EIF A;  5ELO A;  3JAM i;  1Z9F A;  1VQJ A;  3H0G H;  5GAG C;  2ZJP A;  1X9N A;  1XNR L;  2CQO A;  1PHJ A;  2QGQ A;  3NEM A;  4GLV B;  5M5W H;  4DV1 L;  4A93 G;  4OXP A;  3CCR A;  3TS0 A;  3S16 H;  1VQ7 A;  1AE3 A;  2YV5 A;  3U50 C;  3AYH B;  2OQ0 A;  2B63 G;  3H3V H;  4A3K G;  2UUA L;  1YVC A;  2YTY A;  5M5Y H;  2JA9 A;  4O0A A;  4A75 A;  1X3E A;  2EIF A;  1JMC A;  2QA4 A;  1KIX A;  1EYG A;  2UUC Q;  4DR3 Q;  3F2C A;  2UU9 Q;  3HOU H;  1K0R A;  1Y1W G;  4JI0 Q;  2VQF L;  4R4T A;  1NJI C;  3CPF A;  1PYS B;  4A4I A;  4X62 Q;  4PG3 A;  4JI7 L;  4LWC A;  1YIJ A;  1PH3 A;  4Y52 H;  3HKZ E;  4JOI C;  4JYA Q;  2WB1 E;  3RLO A;  3M3Y H;  4BY7 H;  3S1M H;  3S2D H;  3OYY A;  3W5O A;  4DK6 C;  4JC0 A;  5IYD H;  4LUO A;  1WI5 A;  4POF A;  4A3I G;  4BBS H;  1Q86 C;  4BXX G;  4DR2 L;  4B3S Q;  3K8A A;  2B29 A;  3GTJ H;  1VQK A;  3HOV H;  1Q8K A;  4UP9 A;  4YWM A;  3F8T A;  4LFB L;  4NXN Q;  1WJJ A;  5LMU L;  5LMN W;  2K75 A;  4ALP A;  1VQ5 A;  2NZO A;  4C3I H;  4A3D G;  2UXC L;  2JA7 H;  3L2P A;  4DPG A;  3BJU A;  1X6O A;  1C9O A;  2K4K A;  5IWA L;  1Y14 B;  3CCL A;  4LNQ A;  2VUM H;  1XMQ Q;  5ELN A;  3BZK A;  5IP9 H;  4OX9 L;  1RL2 A;  3ERS X;  3AFQ A;  1QUQ A;  4J15 A;  4AYB G;  1HNX L;  1FJG Q;  4A3J G;  4X65 Q;  3CD6 A;  3PUX A;  2FXQ A;  4DR4 L;  2AKW B;  1QUQ B;  2BA1 A;  4HIK A;  3I4N H;  4B3M L;  2PNH A;  3G48 A;  1XNR Q;  3W1G A;  3KF6 A;  1I3Q H;  4AQY L;  3PGZ A;  1PV4 A;  2IX1 A;  1GD7 A;  2MFI A;  5JJK A;  2JE6 I;  2JQO A;  2UUB L;  4NXM L;  2JA6 H;  3KJP A;  2MO0 A;  4A3B G;  4P73 A;  3G6E A;  3PO3 H;  1HNW L;  3KF6 B;  3UE1 A;  1Q81 C;  2NN6 I;  4LFA L;  1A62 A;  1YBY A;  2F3I A;  4P72 A;  2F4V L;  2CWP A;  5IP7 H;  1G6P A;  4NB3 A;  1CKN A;  2RHQ B;  4DR5 L;  3K81 C;  1HZC A;  1LTL A;  3KYH C;  1J6Q A;  4P74 A;  1K73 C;  2R92 H;  2A8V A;  4YHH L;  1NMF A;  1YZ6 A;  4OO1 G;  4OON A;  2AWO A;  2Y0S E;  1CSP A;  1KRS A;  1V9P A;  2ALY B;  1SLJ A;  3FHW A;  3HKS A;  3PO2 H;  2VQF Q;  3FKI G;  1A63 A;  4OO1 I;  1VQF A;  4QJF A;  5AJ3 L;  2R93 G;  5IYC H;  3A5U A;  3DM3 A;  2NVQ H;  3HOY H;  1I6H H;  1U0L A;  1J5E L;  1Q12 A;  2KBN A;  4A3L H;  1OXU A;  4KHP Q;  1SMX A;  1WOC A;  1YEZ A;  1T9H A;  4KI0 A;  1PFS A;  4YCW A;  4LFC L;  3ULJ A;  5FJ8 H;  1BBU A;  4XIG S;  4DR2 Q;  1SFO H;  2KCT A;  1G51 A;  1D8L A;  4O2D A;  3I56 A;  4A3F H;  2R7Z G;  3A0J A;  4LFB Q;  5LMU Q;  1X55 A;  4JG2 A;  1UE5 A;  3S1Q H;  2UXC Q;  2QEX A;  4XTC S;  2JA8 H;  2E2J H;  4BA1 I;  1WCM H;  3MXN B;  3HOZ H;  1X3G A;  3A5Z B;  5IWA Q;  4EX5 A;  1TXY A;  4DV4 L;  1BBW A;  2OTL A;  1X3F A;  4GOP C;  4LUZ A;  1KQS A;  5C3E H;  1HNX Q;  2IY5 B;  1NY4 A;  3E0E A;  3K7U C;  1VQG A;  1JE5 A;  1HR0 W;  2L15 A;  3U4V A;  4C3J H;  4LF5 L;  3J7A 5;  1N32 L;  4WJ3 M;  2E2H H;  3CAM A;  3W1B A;  4DR4 Q;  2KHI A;  1BVS A;  5FLM G;  3NBH B;  5GRO A;  3CC2 A;  4A3G G;  5HY6 A;  4QL5 A;  4B3M Q;  2XTI A;  5C44 G;  3CCU A;  4DR7 L;  4IPD A;  1VQA A;  3J81 c;  4X66 L;  3PIO A;  4BBR G;  3U58 A;  5DLQ E;  4AQY Q;  2ATW A;  3ICE A;  5IYB H;  1IXR A;  4IO9 A;  1IBL L;  5GQO A;  4DR6 L;  4JI1 L;  3VDY A;  1N36 Q;  4NXM Q;  4K0K L;  3J7Z C;  2ES2 A;  3S1N H;  4DUY Q;  2UXB L;  1A8V A;  4JBW A;  1YI2 A;  2AWN A;  4DV0 L;  4JBM A;  3GTM H;  1B7Y B;  3AQQ A;  3TRZ A;  1HNW Q;  1S40 A;  1QZH A;  5GAE C;  2F4V Q;  1KL9 A;  1LM0 A;  2ZTE A;  1XPR A;  4P71 A;  4JI5 L;  3PUV A;  1XNQ L;  2A19 A;  3GD7 A;  1KD1 C;  4YY3 L;  3OW2 A;  2ID0 A;  1IZ6 A;  4GOP A;  2VQE Q;  4JI8 L;  1QVC A;  1E1O A;  5EAY A;  4YHH Q;  4AH6 A;  2Q2U A;  2JK8 A;  3J80 c;  4ME3 A;  3F2D A;  1UE7 A;  1S72 A;  1Y1W H;  3OTO L;  3AFP A;  1JJ2 A;  2ZM6 Q;  4GOP B;  3I7F A;  1XPO A;  1MJE A;  3HKZ G;  4DV6 L;  2IT1 A;  1K83 H;  2K5N A;  2WB1 G;  4L5T A;  1B70 B;  1AH9 A;  3L0O A;  4QQB X;  1PH7 A;  3Q8D A;  1VQB A;  4YCU A;  2I5H A;  1PH5 A;  2N3S A;  5IT9 c;  1VQM A;  3CC7 A;  1E7Z A;  1OTC A;  4DV5 L;  1VQO A;  1OXS C;  4MZ9 A;  1HNZ L;  3I2Z A;  5C0X G;  1VQL A;  1NMG A;  1UEB A;  4OWT B;  2GVB A;  4A3E H;  4R4O A;  3PF5 A;  4R4C A;  4RMF A;  3H0G G;  4C2M H;  2IHE A;  4IPC A;  4QGU A;  1EQR A;  5M3M H;  2LSS A;  3BU2 A;  4LW1 A;  4DV4 Q;  3M4Q A;  4DV2 L;  1UE1 A;  2I0Q A;  4C3H H;  1P8L A;  3M85 A;  2ZTC A;  2N78 A;  1QZG A;  1I94 L;  1QVG A;  2MQH A;  2AMC B;  4DV3 L;  3CCV A;  4LF5 Q;  4HJ5 A;  1BKB A;  1R9T H;  1TWF H;  1N32 Q;  1I5F A;  1S3O A;  1EOV A;  4YWL A;  2NVY H;  3I4M G;  1E22 A;  3ER0 A;  5C4X H;  3H15 A;  2ZJR A;  4GKK L;  4H02 A;  3HOW H;  1OXX K;  4JV5 L;  1IBM L;  3KFU A;  4P75 A;  3CCJ A;  1JJC B;  4X66 Q;  1JJG A;  1X65 A;  4IJH A;  4IFD G;  3JAM c;  4LF7 Q;  1SRU A;  1IBL Q;  4DUZ Q;  2NVT H;  3HOU G;  4DR6 Q;  4JI1 Q;  4A3M H;  2R7D A;  2UXB Q;  4JOI A;  2IHF A;  1CUK A;  2E8G A;  4DV0 Q;  4LF8 L;  1VQD A;  4X64 L;  4HJA A;  3ULL A;  4BY7 G;  2CCZ A;  4JI6 L;  4R1J A;  3F2B A;  2HHH L;  4JI5 Q;  2R6G A;  4UPA A;  1XNQ Q;  5IYD G;  4DV1 Q;  4B3R L;  4TVA B;  4YY3 Q;  4BBS G;  1N9W A;  3LGJ A;  1Q82 C;  4JI8 Q;  1JB7 A;  4JI2 L;  2GN5 A;  3HOX H;  2KCM A;  2Y0S G;  1M90 C;  3STB D;  4UP7 A;  4GKJ L;  1KC8 C;  2UUA Q;  5JJI A;  1NE3 A;  3ULP A;  1V43 A;  2JA7 G;  4A3C H;  1PH9 A;  3K7A H;  4DV6 Q;  3RNU A;  2DUD A;  1PVO A;  4HID A;  3KJO A;  3CME A;  2OWO A;  2R7F A;  4DV5 Q;  1K3R A;  3RLF A;  1UWV A;  2Q2I A;  3E9I A;  1CSQ A;  1HNZ Q;  1XMO L;  4JI7 Q;  2JA5 H;  2PI2 E;  3M7N A;  3UDG A;  2PI2 A;  3I4N G;  3RR5 A;  3RZO H;  4HIO A;  3T1Y L;  2LXJ A;  4X6A H;  3WWV A;  1EWI A;  2VL6 A;  2HT1 A;  1Q1B A;  1FGU A;  5E7N A;  3CCQ A;  1Q1E A;  1Y1V H;  2RF4 A;  3PSI A;  1G29 1;  4GNX C;  2MNA A;  1D7Q A;  1VQH A;  2ASB A;  5C0X J;  2CKZ B;  4DAM A;  1I94 Q;  2JA6 G;  2KHJ A;  1YJN A;  1N8R C;  4BY1 H;  1M1K C;  1VQ9 A;  3PO3 G;  4PZ6 A;  3UDI A;  4HJ9 A;  3TEH B;  5JJL A;  3CQZ H;  3CP0 A;  3I55 A;  1SE8 A;  1Q7Y C;  4PZ7 A;  3SGI A;  4GKK Q;  5H1S E;  2E5L L;  4DV7 L;  1O7I A;  4JV5 Q;  2VNU D;  2RCN A;  3GTP H;  4OX9 Q;  1Q46 A;  5LMN L;  1XJV A;  2R92 G;  2YYZ A;  2H5X A;  5M3F H;  3M4P A;  1K8A C;  2Q2H A;  2AHO B;  5IY0 A;  4GS3 A;  4JCV E;  4KHZ A;  5J3B A;  2UUC L;  3TS2 A;  5BR8 L;  3PO2 G;  3S2H H;  2K5H A;  2WAQ E;  4APV A;  3FP9 A;  4JI0 L;  1VQI A;  3HFZ B;  2RHS B;  2WP8 J;  4LF8 Q;  4MTN A;  1FL0 A;  4DKA C;  5IYC G;  3GTO H;  1YHB A;  4X62 L;  3HOY G;  1OXV A;  4JYA L;  2MO1 A;  3M9B A;  3A74 A;  2VQE L;  1VQN A;  4A3L G;  4IFD J;  2HHH Q;  3PF4 A;  4HJ7 A;  4LF4 L;  4GNX A;  4B3R Q;  3CXC A;  3G71 A;  5FJ8 G;  5IE8 A;  4OWX B;  2UUB Q;  4A93 H;  2N49 A;  1L2F A;  1RIP A;  2JJQ A;  4WJ4 A;  1IYJ B;  1SR3 A;  4LFA Q;  4A3F G;  1YJ9 A;  4GKJ Q;  1SN8 A;  1GKH A;  2UXD L;  4GNX B;  2Z6K C;  3CCS A;  2F52 A;  3NEN A;  4A3K H;  4IOC A;  1EFW A;  2B63 H;  1UE6 A;  2JA8 G;  2LXK A;  3GTK H;  1CKO A;  3D0F A;  1WCM G;  1TWA H;  1WYD A;  4DR5 Q;  3HOZ G;  1P16 A;  1N33 L;  3L7Z C;  3I4O A;  4UP8 A;  1XMQ L;  3EN2 A;  1DGS A;  5C3E G;  1IL2 A;  3E9H A;  1GO3 E;  5HGQ A;  2NZH A;  2C35 B;  5AJ3 Q;  1VQ4 A;  1XMO Q;  1VQ6 A;  3GTQ H;  3UE0 A;  1J5E Q;  3T1Y Q;  3D31 A;  1TWC H;  2V1C C;  4B3T L;  4POG A;  3PUY A;  1X54 A;  4LFC Q;  2K14 A;  1MJC A;  2YU9 H;  4R4I A;  4A3I H;  5IYB G;  3AEV A;  4BXX H;  2BH8 A;  2OCE A;  3IRB A;  1TWG H;  1EIY B;  1W3S A;  2HIV A;  4GN5 A;  3U4Z A;  5C4J H;  1LYL A;  2VY3 A;  2Z6K A;  1C7Y A;  4A3D H; 
#chains in the Genus database with same CATH topology
 2PQA A;  4KLK A;  2ICI A;  1ESF A;  5NUC A;  1A6X A;  1VQC A;  4V19 0;  4LF9 L;  2JEB I;  3EVQ A;  1C0A A;  4A3J H;  1ICW A;  2D0O A;  4OEM B;  2QEJ C;  4LMQ D;  2EYM A;  5BR8 Q;  2DGY A;  3D4R A;  2EY1 A;  4A93 B;  4DR7 Q;  1LTS D;  1U4P A;  4KY7 A;  3S1N B;  4JBJ A;  1DOL A;  2F3V A;  4LF4 Q;  5JEA G;  3N52 A;  1VQP A;  1PA6 A;  4QIW E;  3W2D A;  4ZAI A;  4DU9 A;  1HZA A;  1VQE A;  1CHQ D;  3CPW A;  3TP5 A;  1ENF A;  3DLL A;  1E24 A;  2R3Z A;  1XPU A;  2G5D A;  2B8G A;  5M3M G;  1VF7 A;  2HDM A;  4C3H G;  3HOV G;  1K83 B;  4LF6 L;  4A76 A;  1XTC D;  4IJL A;  4DAY B;  2H1E A;  4DNR B;  1PH6 A;  1F9S A;  2YU9 B;  3WOF A;  4IOA A;  3SE0 A;  5C4X G;  3HOW G;  3M7G A;  3PIP A;  3DEP A;  2EXD A;  3BZC A;  3NQT A;  4HN7 A;  4DA2 A;  4DR1 L;  2RDG A;  3J81 i;  1EUJ A;  3QOJ A;  4DUY L;  2I5L X;  1WVL A;  2MP1 A;  3CMA A;  3PQI A;  5C4Z A;  3K57 A;  5CGK A;  1PH8 A;  4LF9 Q;  2NVY B;  2NVX H;  4DV3 Q;  1GVP A;  1IYU A;  2K5W A;  3RD4 A;  2F4I A;  1Y8N B;  2NVT B;  3OW7 A;  1XYI A;  3JAM E;  4A3M B;  1FVI A;  4A3G H;  2A68 C;  4DF7 A;  1WTR A;  1KXL A;  1GM5 A;  3GQB A;  2HCC A;  2XSC A;  4ODG A;  1NR4 A;  2VZA A;  5I4D A;  3OOC A;  4X64 Q;  4K14 A;  4FYD A;  2JA5 G;  2E2I H;  1L0W A;  2XWJ B;  4FDB A;  1H9M A;  5JEA J;  1V1Q A;  3A7A B;  4IQZ A;  4LF6 Q;  4DN4 M;  4NXN L;  3TZD A;  4EQ5 A;  1STH A;  3KLW A;  3GTL H;  5M9O A;  2CH4 A;  3X3N A;  3PCO B;  1O80 A;  3M4O H;  2NN6 G;  4CGY B;  1TWH B;  2QCP X;  5GAD C;  4DR1 Q;  4X65 L;  2LKV A;  5DEH A;  4LJZ C;  4DUZ L;  1BNZ A;  2F0Q A;  1H9S A;  1Z9F A;  3DWP A;  1B9M A;  5IT9 L;  5GAG C;  1X9N A;  3VR3 A;  2IX3 A;  2CQO A;  1PHJ A;  2HDL A;  3E0J A;  3BG3 A;  2A6E C;  4RCN A;  3P1H A;  1HPC A;  3CRL C;  5KRU A;  1ICF B;  4I7Z C;  2OQ0 A;  2B63 G;  3S14 B;  1X3E A;  3NSW A;  5EKL A;  4IFD H;  4RCO A;  3O13 A;  5EGT A;  2RBM A;  5J39 A;  3TP6 A;  3J81 E;  4R4T A;  3CPF A;  1ESR A;  5CV6 A;  1PYS B;  4PG3 A;  3NTH A;  4RGM A;  3H3V C;  4FXD A;  1YNJ C;  3M3Y H;  3S1M H;  3OYY A;  4JC0 A;  1WI5 A;  1KAB A;  4OGQ C;  3FVQ A;  4K5W A;  3K8A A;  3GTJ H;  2K04 A;  4IAL A;  3HKZ B;  4LFB L;  2RQX A;  3F8T A;  5G3L D;  4NXN Q;  1WJJ A;  5LMN W;  4ALP A;  1VQ5 A;  4A3D G;  4EQP A;  3Q0A A;  4PV1 C;  2JA7 H;  4CDF C;  4DPG A;  1X6O A;  2CHB D;  1TT2 A;  2K4K A;  4J8Q A;  1Y14 B;  1XMQ Q;  5ELN A;  2NZ1 D;  4OX9 L;  5CBE E;  1QUQ A;  4AYB G;  1XXG A;  5DNF A;  4X65 Q;  5KEE A;  4QMG A;  3CD6 A;  1SSO A;  4HIK A;  1KDB A;  2PNH A;  3A55 A;  1WD0 A;  2DJG C;  3W1G A;  1TR5 A;  4AQY L;  2JE6 I;  2JQO A;  2F0E A;  3KJP A;  3I4M B;  3S9W A;  4NDX A;  3G6E A;  3KF6 B;  4RGO S;  1Q81 C;  2NN6 I;  1YBY A;  2G9D A;  3UI2 A;  2WKD A;  5IP7 H;  2MHV A;  4DR5 L;  3KYH C;  1HZC A;  1LTL A;  2FJ2 A;  2CW0 D;  4OON A;  3PO2 H;  1KRS A;  4BY7 B;  1SLJ A;  1NUC A;  2AQ1 B;  4ZUJ A;  3S2D B;  4QJF A;  2R93 G;  4O42 A;  2NVQ H;  2B2T C;  3SDZ A;  1I6H H;  1J5E L;  3C46 A;  2Y0S B;  1SMX A;  1AP0 A;  1QJO A;  1T9H A;  4KD3 A;  3ULJ A;  4LFC L;  1O7L A;  1SFO H;  2IW3 A;  1D8L A;  4KKS A;  4O2D A;  3I56 A;  2R7Z G;  4LFB Q;  1CHP D;  3K5N A;  2TSS A;  1K8M A;  2BDN A;  3HOZ H;  1PTO D;  3FKI B;  2HCI A;  2K28 A;  1TXY A;  3DMU A;  3NBH A;  1GUS A;  1STN A;  2IY5 B;  1CFM A;  3K7U C;  3MEH A;  1HR0 W;  4C3J H;  1LTA D;  1N32 L;  1PLF A;  3QWN A;  1S4Z A;  1IYV A;  3CC2 A;  4IUN A;  4K2L A;  5C44 G;  2JA6 B;  3TZU A;  1U4M A;  4IPD A;  1VQA A;  3J81 c;  4X66 L;  4BBR G;  4AQY Q;  5IYB H;  1IXR A;  2CQA A;  4G7O C;  1XX8 A;  3G7L A;  1DJR D;  4K0K L;  2UXB L;  3S1N H;  1A8V A;  4K2K A;  2AWN A;  1B7Y B;  2QF7 A;  5JOB A;  1QB5 D;  3EA6 A;  4G7H C;  3PUV A;  2B2V C;  2A19 A;  1PRT C;  1SNO A;  1E0B A;  3VR4 A;  4RH6 A;  2EYL A;  1SE3 A;  5C5L A;  2Q2U A;  2JK8 A;  2BCO A;  3HOY B;  4F7X A;  1RTO A;  3K5M A;  3F2D A;  4U68 A;  3S17 B;  1UE7 A;  2BDO A;  1JJ2 A;  1TS4 A;  1UUP A;  1XPO A;  3ND9 A;  4OIJ A;  1MJE A;  4DV6 L;  1K83 H;  2WB1 G;  1DOM A;  1X3Q A;  3L0O A;  4FXK C;  4QQB X;  4YCU A;  4B9W A;  2I5H A;  5HGT A;  5CMD A;  2HQE A;  3URY A;  3KLS X;  3EQL C;  3TP8 A;  5BN3 A;  2DNE A;  5C0X G;  5DAU A;  1NCV A;  4R4C A;  4WRD A;  4ZQ3 A;  1I4G A;  4IPC A;  4QGU A;  1EQR A;  1Q8I A;  1P8L A;  2N78 A;  1SYB A;  3J7A V;  3CCV A;  1PRT B;  4HJ5 A;  1GUO A;  1N32 Q;  2OF1 A;  5FLX L;  2J7Z A;  2NVY H;  4GKK L;  3H15 A;  3ER0 A;  3GTG B;  1OXX K;  4I65 A;  4FF3 A;  5CR3 A;  4X66 Q;  3NE5 B;  3T51 B;  3IKJ A;  2NVT H;  4A3M H;  2R7D A;  2UXB Q;  2F0D A;  4O1N A;  4LF8 L;  3I3C A;  3BDL A;  4NW2 A;  5D65 A;  5I9P A;  3F2B A;  1GOZ A;  4UPA A;  5IYD G;  4B3R L;  1HRJ A;  1BF4 A;  4KK7 A;  1N9W A;  3LGJ A;  5T1I A;  1JB7 A;  3D4W A;  4JI2 L;  1QE6 A;  4DK0 A;  2NTS A;  4C3I G;  4ULL A;  1RHP A;  1NE3 A;  3K6O A;  3QB3 A;  3ULP A;  3QJY A;  3SR1 A;  1PH9 A;  4DV6 Q;  3RNU A;  1PVO A;  3Q23 A;  3KJO A;  1WTH A;  1K3R A;  3NBI A;  2Q2I A;  2PI2 E;  3UDG A;  2EYO A;  3RR5 A;  1EEF D;  2B39 A;  3HOV B;  2OT2 A;  3WWV A;  1EWI A;  3FPP A;  3MTS A;  3E3X A;  2RF4 A;  1Y1V H;  2LS0 1;  1D7Q A;  5C0X J;  3NP8 A;  1EY7 A;  5C4X B;  1M1K C;  3C1E A;  2KEE A;  1L0Y B;  3MZ5 A;  3CQZ H;  4GKK Q;  5ELD A;  5JJZ A;  5LMN L;  2R92 G;  1XJV A;  2YYZ A;  2H5X A;  3FDT A;  1B53 A;  1CT1 D;  4GS3 A;  2UUC L;  3S2H H;  4JPB W;  2WII B;  1K3B C;  4LF8 Q;  2B2Y A;  4DKA C;  1FL0 A;  1YHB A;  1Y8O B;  2MO1 A;  3PO3 B;  1HUM A;  3NQI A;  5D3I B;  4GNX A;  4B3R Q;  5FJ8 G;  2UUB Q;  5T1G A;  4OWX B;  2N49 A;  4WJ4 A;  4A3F G;  4LFA Q;  1HA5 A;  1YJ9 A;  2Z6K C;  3CCS A;  4H7B A;  4A3K H;  2CW0 C;  1WTX A;  2F0U A;  3D0F A;  1WCM G;  1CA6 A;  5LL6 S;  3D3R A;  3IL8 A;  3EN2 A;  2JA5 B;  3ERO A;  1MI2 A;  5C3E G;  1FNV A;  1HTL D;  1WTP A;  1B1Z A;  5HGQ A;  2NZH A;  4KY6 A;  5AJ3 Q;  1STB A;  2EY2 A;  3GTQ H;  1JWU D;  1EY4 A;  3TSS A;  4RAU C;  2PW7 A;  3D31 A;  4B3T L;  2F0G A;  1X54 A;  5IGB A;  1EOT A;  2K14 A;  4R4I A;  4A3I H;  2JA8 B;  4BXX H;  3IRB A;  2BH8 A;  1LT6 D;  3T56 B;  2FHT A;  1OO9 B;  1PTO C;  3Q22 A;  1D2B A;  5C4J H;  1R4Q B;  5D3D A;  4RKB A;  3I7F A;  3SK6 A;  5EQ0 A;  3B6Y A;  3I4M H;  2OTJ A;  1N34 L;  1QVF A;  1YNN D;  5LMN Q;  3BYY B;  4BS9 A;  1I4Q A;  4HIM A;  3S1R H;  1ASZ A;  4UAI A;  2D5D A;  4GN3 B;  4HCS A;  1SXT A;  2VW9 A;  1TY2 A;  2CVR A;  3GO5 A;  1VQ8 A;  1F9R A;  1QNK A;  1HR0 L;  4GN4 B;  1BCP D;  4KHP L;  2MUY A;  1V1O A;  4CJ0 B;  2VS1 A;  2B63 B;  2Z0S A;  1DD2 A;  4X3U A;  1C48 A;  1B8A A;  1TWA B;  3G6J B;  1Z6H A;  1YHQ A;  3FPU B;  4R8I A;  4IUP A;  1PTO B;  2KCN A;  3J80 E;  2F0H A;  3I8Z A;  4DAY A;  5CYU A;  1FD7 D;  1PYB A;  4JI4 L;  1FYC A;  3LWE A;  2NYZ D;  3J7Y W;  4OO1 H;  2A73 B;  3T1H L;  3OTO Q;  3FKI H;  5I9O A;  5IOC A;  5GAH C;  1WD1 A;  1NTG A;  2A1A A;  2PCF B;  2Z8L A;  1BUV T;  1TWG B;  2E74 C;  2VUM G;  3OWF A;  4WOR A;  4B3T Q;  1E3P A;  4A3E B;  2DY7 A;  3SEB A;  4C2M B;  4A3D B;  3VR2 A;  1AE2 A;  3PUW A;  2ZJQ A;  3K0Y A;  1IBK L;  1ET6 A;  1N36 L;  3RUZ A;  4R8N A;  3CF5 A;  1HZB A;  2K5V A;  2OQK A;  1YNX A;  4AYB B;  3QR8 A;  1R9T B;  1N34 Q;  3HS0 C;  1MKH A;  1A63 A;  3UDF A;  3UDX A;  3HOX G;  5LL6 X;  2E2D C;  1AEX A;  4PZ8 A;  2WAQ G;  1CKN B;  5FLM H;  2A6H D;  4A3C G;  4UY8 C;  1HR0 Q;  5BN4 A;  3JC6 6;  5JAV A;  5K36 G;  1T5E A;  3S17 H;  1ZXT A;  4DR3 L;  4NPS A;  2PZW A;  3Q24 A;  5FK9 C;  4X3K A;  3RN2 A;  4IPH A;  2F0P A;  4JI6 Q;  1HZ9 A;  3H3V I;  2EYJ A;  4JI4 Q;  2R93 B;  4B3S L;  3K7A B;  1E2V A;  2D0P A;  3T1H Q;  2DNC A;  2JSO A;  4BY1 G;  3VR6 A;  4DFA A;  3MHB A;  4FF4 A;  2EJM A;  1VCI A;  3K59 A;  1X56 A;  2M2L A;  1JOR A;  5M3F G;  3TP7 A;  3RZD B;  2K01 A;  4RGT A;  2ZTD A;  4LF7 L;  3GTG H;  1IBK Q;  2BA0 A;  3JAM i;  3S15 B;  4DAV A;  1VQJ A;  1STY A;  1C8C A;  1STA A;  1DON A;  3S16 B;  1XNR L;  5M5X B;  4KMU C;  2EYF A;  3NEM A;  5M5W H;  3GTP B;  4HED A;  1AE3 A;  1EFI D;  1T5X D;  4HTH A;  2AUK A;  2KJX A;  2UUA L;  5M5Y H;  4O0A A;  1BR9 A;  2QA4 A;  1PDQ A;  1EYG A;  2JN4 A;  4DR3 Q;  4UDU C;  2F0S A;  1JE4 A;  3HOU H;  1K0R A;  3SK8 A;  1Y1W G;  4JI0 Q;  2VQF L;  3PIO 3;  5IGF A;  1PH3 A;  4JOI C;  4RWS C;  3T53 B;  2EJG C;  2EDG A;  1BDO A;  1H9R A;  3GTK B;  2JP1 A;  2N55 A;  4B3S Q;  2AQ3 B;  4N9T A;  3HOV H;  2WB1 B;  3I91 A;  4YWM A;  1DCZ A;  4X3T A;  1LLR D;  2K75 A;  2NZO A;  1MSH A;  2B2W C;  1TKW B;  3L2P A;  2Z4H A;  3AFQ A;  3W3A A;  2KHS A;  4A3J G;  3A8K E;  3QG1 A;  1KNA A;  3OSO A;  5IT9 E;  3PUX A;  3EFX D;  4ABN A;  1B9N A;  3VA7 A;  1PZJ D;  1XNR Q;  3KF6 A;  1WTV A;  3H6M A;  3SXH A;  3PGZ A;  1PV4 A;  1CM9 A;  4ZCK A;  1VDZ A;  1YNN C;  4ID6 A;  3PO3 H;  1HNW L;  3DXJ C;  1HXY D;  2A69 C;  1G6P A;  1SYG A;  3K81 C;  3TME A;  4DXF A;  2F0L A;  5KIX A;  3FHW A;  1BCP C;  1RKN A;  2VQF Q;  3KUP A;  1I50 B;  4DK1 A;  3A5U A;  3DM3 A;  1U0L A;  4ZKC B;  4A3B B;  4A3L H;  5JPN C;  2SNM A;  1YEZ A;  2LY7 A;  3DM1 A;  4L8J A;  2PPB C;  1SYF A;  1LT5 D;  2KCT A;  4PMB A;  3A0J A;  2ZT9 C;  1F2M A;  2V4D A;  1I6V C;  2JA8 H;  1UAP A;  4KJN A;  5E4X A;  4BA1 I;  3MXN B;  1SNC A;  2XWB B;  3A5Z B;  1SJE D;  1KQS A;  5COY A;  1NY4 A;  1JE5 A;  1LAC A;  2L15 A;  4LF5 L;  2B2T A;  1BVS A;  5GRO A;  4A3G G;  5HY6 A;  1BCP B;  3L3O C;  3CCU A;  2KOL A;  3PIO A;  4QUC A;  1JR0 D;  1KLU D;  4YIJ A;  2PMZ B;  1IBL L;  2QDB A;  4JI1 L;  3VDY A;  4KTA A;  3J7Z C;  3I72 A;  4DUY Q;  4Q5V A;  2FMC A;  1YI2 A;  1HNW Q;  2R92 B;  4BWG B;  2EOT A;  4J1M A;  5GAE C;  1KL9 A;  1LM0 A;  4JI5 L;  1KLG D;  2K7V A;  4YY3 L;  2ID0 A;  1IZ6 A;  1D1I A;  1QVC A;  2A6H C;  2F0J A;  5EAY A;  5ISR A;  5A2Q L;  5C6A A;  4ME3 A;  1KDA A;  5IGD A;  1S72 A;  1LT3 D;  3AFP A;  2XNA C;  1GUN A;  2IT1 A;  2K5N A;  1AH9 A;  1B70 B;  1F2Y A;  3Q8D A;  4A3F B;  3HP3 A;  1Y8P B;  2N3S A;  5IT9 c;  3CC7 A;  3VYS A;  1OTC A;  3S1Q B;  5IOD A;  1X32 A;  4MZ9 A;  1NMG A;  1UEB A;  4OWT B;  4A3E H;  3PF5 A;  1HQR D;  4C2M H;  2SOB A;  2B2V A;  5JVH 3;  2LSS A;  4LW1 A;  4CJ2 C;  3M4Q A;  4DV2 L;  2E2H B;  3M85 A;  1QVG A;  1KDC A;  1LTB D;  4LF5 Q;  1RTN A;  1R9T H;  1TWF H;  2L1B A;  4ZKB B;  1EOV A;  2RA4 A;  1JQY D;  4H13 C;  4FXG C;  3DUZ A;  3U9O A;  2ZJR A;  3X3M A;  1A2U A;  1IBM L;  3KFU A;  3TBI B;  1R4P B;  4K5X A;  1G2T A;  3H0G B;  1JJG A;  3GTM B;  4IFD G;  2ZXP A;  3JAM c;  1SE2 A;  1IBL Q;  4DUZ Q;  4JI1 Q;  5A35 A;  1B44 D;  1CUK A;  4E6I A;  2E8G A;  1SMY D;  4JI5 Q;  4IUU A;  2SNS A;  4YY3 Q;  4G57 A;  1JC7 A;  4G7Z C;  2GN5 A;  1CQV A;  3FRP B;  2Q8T A;  3STB D;  1KC8 C;  1Q90 A;  4OEL B;  2JA7 G;  2VB3 X;  3K7A H;  1D1K A;  2VXW A;  4HID A;  5CV5 A;  2R7F A;  1SJH D;  3RLF A;  4NMZ A;  3RMH A;  3E9I A;  1XMO L;  1KAA A;  4BBS B;  2SEB D;  5IGE A;  3LWU A;  3RZO H;  1K8O A;  4X6A H;  1SYE A;  2VB2 X;  2K1B A;  3PSI A;  1EY8 A;  2ASB A;  4DAM A;  2VUM B;  4I7A A;  5FLX E;  2B2U C;  4HJ9 A;  2K32 A;  1EQV A;  2Q8R E;  1SE8 A;  4DV7 L;  1IKM A;  2RCN A;  3GTP H;  4OX9 Q;  1HFG A;  2IWH A;  3I4N B;  3PO2 G;  5J3B A;  1I3Q B;  2K5H A;  4APV A;  3A8J E;  1VQI A;  2RHS B;  2AUJ D;  1H9J A;  2I07 B;  3NTI A;  4MTN A;  2WKC A;  4X62 L;  4K5V A;  1TQO A;  4JYA L;  3MVV A;  3R2I A;  4IFD J;  4HJ7 A;  1KNE A;  2MJ8 A;  3CXC A;  1I4X A;  3G71 A;  5J22 A;  5IE8 A;  1NSN S;  4A93 H;  2JJQ A;  1BQQ T;  1SR3 A;  1A15 A;  1SN8 A;  4IOC A;  3GTK H;  2TMP A;  1CKO A;  4PMC A;  2EJF C;  4DR5 Q;  2F0O A;  3HOZ G;  1P16 A;  1N33 L;  2IPK D;  1B3Q A;  4UP8 A;  1GO3 E;  3ZYY X;  4C3J G;  1XMO Q;  5D14 A;  1J5E Q;  1SNP A;  3E5S A;  1PRT F;  2F0N A;  1WTW A;  4XQQ A;  4CDE C;  3PUY A;  4LFC Q;  4BY1 B;  1MJC A;  2YU9 H;  5IYB G;  3AEV A;  2FMM A;  2RKS A;  2K6A A;  4GN5 A;  3R2T A;  1I4P A;  1EY5 A;  1D6E C;  1GUW A;  2Z6K A;  1C7Y A;  5K5P A;  1Z47 A;  1MIU A;  3VA5 A;  1L1O C;  3KBX A;  5J1Z A;  3VR5 A;  2K50 A;  1WFQ A;  2LMC B;  1A3T A;  4DV7 Q;  4JW0 A;  1K8G A;  2CWA A;  1PZI D;  1D5M C;  3GTO B;  1PYW D;  3MXG A;  4GLX A;  4ME5 A;  3BVM A;  1GUT A;  4XQJ A;  3RLN A;  1QIL A;  1I50 H;  3ZJY C;  1D5Z C;  4K0K Q;  4DXG A;  4A3B H;  2Q8I B;  3SK4 A;  1K9M C;  1KRT A;  1LV9 A;  4L5S A;  3K0X A;  1Y1W B;  1N33 Q;  5FLX c;  1HHV A;  3T13 A;  4DK3 C;  1L1O B;  4S3S A;  4PMW A;  1E2W A;  3NEL A;  3Q6S A;  3F1Z A;  5CV9 A;  4C1N K;  2E75 C;  3R8B A;  3KDF B;  2LFN A;  3VYT A;  3AU7 A;  4B08 A;  3HZX A;  5IP9 G;  1IW7 D;  2M00 A;  3MAQ A;  3CCM A;  1VS0 A;  1VMP A;  2PQE A;  4A3M G;  5M3M B;  3G4S A;  1HH2 P;  1EQT A;  4C3H B;  1A3V A;  1YJW A;  1TWH H;  2KEN A;  3OPO A;  1ILQ A;  1QCB D;  3KF8 B;  3PUZ A;  2A5H A;  3H94 A;  1L0X B;  2RVL A;  3CKI B;  2VQE L;  3CCL A;  3HOW B;  2B3G A;  1Z7T A;  2PZT A;  1PH2 A;  3IFT A;  4KKT A;  3VYU A;  3BVG A;  3J80 i;  1LTG D;  5C0X I;  2ZM6 L;  4R4Q A;  2NBF A;  1G8Z D;  1NNX A;  1STG A;  1JT8 A;  1SMY C;  2F3W A;  3S14 H;  5HUR A;  4JVZ A;  4LUV A;  1CKM A;  4GLA C;  4F88 A;  3CCE A;  4DNI A;  1YHA A;  4MNO A;  3TRE A;  2Z6B A;  1MBY A;  2HIX A;  3STB C;  1Y1V G;  2ICE C;  3PV0 A;  4JI2 Q;  4ZK9 B;  1AZQ A;  2EQS A;  3BDO A;  2L9H A;  4L5Q A;  3GDE A;  3K5O A;  1CTM A;  2PMZ E;  5F2D A;  4QCL A;  4KY5 A;  1KAW A;  2YTX A;  1SND A;  2RSO A;  3AMU A;  4WFN 3;  1E1T A;  1EY9 A;  4RHS A;  1EYA A;  1CK1 A;  3J81 j;  3S24 A;  1EIF A;  1W6J A;  3H0G H;  1ENC A;  2NVX B;  2XVS A;  4K6D A;  2L0C A;  2QGQ A;  2QW7 A;  3D6C A;  3KLS A;  4DV1 L;  3TS0 A;  3NWT A;  2YV5 A;  3H3V H;  4A3K G;  1EY0 A;  4XYO A;  3I90 A;  2YTY A;  4A75 A;  3H91 A;  1JMC A;  4TKO B;  4ZUI A;  2E2I B;  4K6L A;  2UUC Q;  2XN9 C;  4R9W A;  4QF4 A;  1B50 A;  3F2C A;  1IHZ A;  1NJI C;  3IAY A;  5CV7 A;  2EPB A;  4JI7 L;  4LWC A;  1EWC A;  3NHH A;  3WDN A;  3HKZ E;  1QG7 A;  1YIJ A;  1LO5 D;  2GA4 B;  4BY7 H;  2M9V A;  1CQF A;  3S2D H;  4OL7 A;  3W5O A;  4DK6 C;  4BBS H;  4A3I G;  4BXX G;  2JXM B;  2B29 A;  2MPM A;  1Q8K A;  1RJT A;  1EY6 A;  1RDP D;  4V0B A;  5LMU L;  1WTO A;  2UXC L;  1ENA A;  4IUT A;  3BJU A;  1RF2 D;  3V2T A;  5IWA L;  2VUM H;  4LNQ A;  1HCZ A;  4PNY A;  1RL2 A;  3TN2 A;  4J15 A;  1TWC B;  4ILW A;  4HSV A;  5EPL A;  4N8F A;  1E2Z A;  2FXQ A;  2EY5 A;  2BA1 A;  3I4N H;  5EBD A;  4B3M L;  3G48 A;  1II3 A;  2K05 A;  3BDC A;  3NUC A;  1I3Q H;  5I2Y A;  5DM6 3;  4NXM L;  2JA6 H;  1F2L A;  2O4X A;  3MWY W;  4RKL A;  4C56 C;  3D4D A;  2B2W A;  4H44 C;  1A62 A;  1JWM D;  2CWP A;  2R61 A;  5E3F A;  1AN8 A;  4XDX A;  1RD9 D;  3MC0 B;  2X69 A;  1K73 C;  1J6Q A;  4ZYS A;  1SE4 A;  1YZ6 A;  4OO1 G;  2AWO A;  2Y0S E;  1CSP A;  4G4K A;  3HKS A;  3M3Y B;  3S1M B;  4TSS A;  3FKI G;  1VQF A;  5IYC H;  3F2U A;  3HOY H;  5EJW A;  2KBN A;  1C4Q A;  2JYO A;  4KHP Q;  1CI3 M;  1PFS A;  5E4W C;  2KVM A;  4XIG S;  1IL8 A;  2EYP A;  3MXN A;  4WJW A;  1G51 A;  1SNM A;  2JA7 B;  4CHT B;  5LMU Q;  1X55 A;  1X3P A;  2F0K A;  4JG2 A;  2UXC Q;  2QEX A;  2A6E D;  5IWA Q;  5FO7 B;  4EX5 A;  4DV4 L;  1BBW A;  4MHE A;  1X3F A;  4GOP C;  1EL0 A;  4CKB A;  3K5L A;  3U4V A;  5FO9 B;  3PIP 3;  2EE1 A;  3J7A 5;  4WJ3 M;  3CAM A;  2KHI A;  5FLM G;  1STE A;  3VYR A;  2DN8 A;  2XTI A;  4B3M Q;  4DR7 L;  2R7Z B;  4FP5 D;  3U58 A;  1JCK B;  2PO4 A;  5GQO A;  1N36 Q;  4NXM Q;  4DR6 L;  4JBW A;  5CBA E;  3ITP A;  3AQQ A;  3OHX C;  5LHY 1;  3C3L A;  1ML0 D;  2X6G A;  5IGC A;  2BOS A;  1ZKO A;  1XPR A;  4P71 A;  3PO2 B;  1XNQ L;  3FEW X;  3GD7 A;  1KD1 C;  4JI8 L;  5C44 B;  3J80 c;  4ZRZ A;  1PFB A;  3C1F A;  4BBR B;  3V96 A;  1Y1W H;  4GOP B;  3ND8 A;  2NTT A;  1PXU A;  1U4L A;  1SFO B;  1VQB A;  5JEA H;  1VQO A;  1GHK A;  2KED A;  4CKE A;  1ET9 A;  2QDL A;  3I2Z A;  1HNZ L;  1VQL A;  1S5B D;  3T4A C;  2BE5 D;  3BS1 A;  4X3S A;  4Y7N B;  1UNS A;  3QOL A;  5M3M H;  4C3J B;  4DV4 Q;  2I0Q A;  5EKK A;  3HG9 A;  4C3H H;  2ZTC A;  2AMC B;  1JB3 A;  1I4H A;  4DV3 L;  5FO8 B;  3SHL A;  1I5F A;  1S3O A;  1CA5 A;  5C4X H;  5CV4 A;  3CU7 A;  4H02 A;  3HOW H;  3CCJ A;  1PMR A;  1JJC B;  3D6W A;  1G2S A;  1GXD C;  1X65 A;  4LF7 Q;  1SRU A;  1M8A A;  3CHB D;  3A7L A;  4KN4 C;  3HOU G;  4DR6 Q;  1VQD A;  4EGV A;  4X64 L;  3NPP A;  3A54 A;  3OIP A;  2CCZ A;  2HHH L;  2SDF A;  4U67 3;  1XNQ Q;  3ONA B;  4TVA B;  5C4H A;  5A2Q E;  2DJF C;  1Q82 C;  2C9O A;  4JI8 Q;  4FF1 A;  1EYD A;  4ZLT F;  1M90 C;  4GKJ L;  2UUA Q;  5JJI A;  3SK5 A;  3MXP A;  1V43 A;  1Y69 U;  4RHR A;  3TDQ A;  1JWS D;  2DUD A;  2K33 A;  5CC4 A;  2F0T A;  4CBV A;  1CZG A;  1QNU A;  5C5M A;  2L4N A;  1HNZ Q;  1CSQ A;  4KD4 A;  5I6Y A;  2JA5 H;  3M7N A;  2X6L A;  2WAC A;  5CV8 A;  2VL6 A;  3M4Y A;  4C3I B;  1BCP F;  1K28 A;  3CCQ A;  1Q1E A;  1ILP A;  1G29 1;  2MNA A;  4FNF A;  2CKZ B;  1MSG A;  3PMF A;  2KHJ A;  1YJN A;  1N8R C;  4HCE A;  4DNT B;  3PO3 G;  4KN7 C;  3TEH B;  5JJL A;  3NWS A;  4HSP A;  3CP0 A;  1Q7Y C;  1PRT D;  1LAB A;  2XRS D;  3SGI A;  2E5L L;  2J0T D;  1Q46 A;  1AZP A;  1BO0 A;  3NTK A;  2NN6 H;  1F77 A;  2AHO B;  3TS2 A;  4JCV E;  4IUV A;  4DAP A;  1M4V A;  1S5F D;  3FP9 A;  2WP8 J;  4DGZ A;  2PNR C;  1V8Q A;  1EIH A;  1OXV A;  1U9R A;  4A3L G;  1VQN A;  2HHH Q;  3PF4 A;  1B3A A;  1RIP A;  4IUQ A;  2B2U A;  1V1P B;  1F9Q A;  1EYC A;  2EY6 A;  1GKH A;  4GKJ Q;  2UXD L;  1EFW A;  2B63 H;  2F52 A;  2JA8 G;  2LXK A;  1TWA H;  2I46 A;  3I4O A;  5DM7 3;  1BBX C;  2WIN B;  1XMQ L;  3QO2 A;  1ONL A;  1DGS A;  2NB0 A;  1IL2 A;  1PTO H;  3I73 A;  1VQ4 A;  1VF5 C;  3P75 A;  5EKI A;  3UE0 A;  1Y1V B;  1TWC H;  2V1C C;  2Z9H A;  3WOE A;  3GV3 A;  2E2J B;  1TWG H;  3CQZ B;  1EIY B;  1WCM B;  5ELE A;  1SYD A;  4MIU A;  2H4O A;  4A3D H;  2E76 C;  5C3E B;  1PZK D;  2F0V A;  3GP7 A;  2E5L Q;  3K80 C;  3S2H B;  1NBW A;  1ZYR D;  1DYQ A;  4UHV A;  2D62 A;  1B2T A;  3CC4 A;  1A0I A;  2PQA B;  4JI3 L;  2ENB A;  1H9K A;  5C3X A;  1HJP A;  4J6H A;  4N8X 1;  3JAM L;  4K8J A;  4YWK A;  1LUZ A;  1EZ8 A;  3NK9 A;  4A3K B;  1NR2 A;  2XRQ D;  4JBK A;  2JEA I;  2ZXO A;  2NUC A;  4A3E G;  2UXD Q;  1L1O A;  5I6W A;  1SDF A;  2AQ2 B;  1YIT A;  1TVX A;  3EBE A;  1O7Y A;  2I5M X;  1EIG A;  3T16 A;  3GTQ B;  3KDF A;  4LK1 C;  1H95 A;  1W2B A;  2GVA A;  1J9O A;  1PH1 A;  2R93 H;  4IPG A;  4A3I B;  4RG1 A;  4OIK A;  5C4J B;  2KEC A;  1FNW A;  4AYB E;  2BE5 C;  1Q3L A;  4OWW B;  4QY7 A;  2WFW A;  2YTV A;  2Z4I A;  3KF8 A;  2R7Z H;  3RZD H;  3TQY A;  3OMG A;  3S1R B;  2KA7 A;  3HRZ C;  4QB4 A;  2Q2T A;  5TSS A;  4MTK A;  4YCV A;  2RDH A;  1U5K A;  5ELC A;  4DV2 Q;  3S15 H;  4AIM A;  3MFG A;  2EYH A;  3S16 H;  1SRO A;  2XGT A;  5M5X H;  4BA2 I;  1BOS A;  4JI3 Q;  5BN5 A;  2N8N A;  2NWG A;  3DWA A;  5IP7 G;  1IBM Q;  5C44 H;  3DEO A;  4BBR H;  2K5D A;  2HQL A;  1MGS A;  1JOO A;  2UU9 L;  2K52 A;  3DWQ A;  2BH2 A;  3V05 A;  4HJ8 A;  4XXE A;  3KOJ A;  3J81 L;  2CFM A;  3HOX B;  1QOH A;  1JOQ A;  1XTD A;  2WAQ B;  5ELF A;  2IX0 A;  1OXT A;  3CW2 C;  1CZW A;  2HD3 A;  4Y7N H;  4L5R C;  3EIV A;  4IFD I;  1AFP A;  2L55 A;  2KUM A;  2IJ0 A;  3MEF A;  4C1N I;  1S5E D;  4PQX A;  1SAP A;  3MFY A;  3RN5 A;  4L6T B;  2OXP A;  4TQU S;  1PH4 A;  1EQQ A;  1ASY A;  3U9S A;  1IKL A;  2L11 A;  4RFB A;  1FJG L;  1MD2 D;  1KHI A;  3K58 A;  5C0X H;  2KCC A;  5ELO A;  3EJI A;  2XIW A;  3HGB A;  5EBC A;  2ZJP A;  1LTT D;  4GLV B;  5FKA C;  1H9S B;  4A93 G;  4OXP A;  3CCR A;  3A8I E;  4HMI A;  1VQ7 A;  1ZEQ X;  2QKI C;  5M3F B;  4NP5 A;  3U50 C;  3AYH B;  1HUN A;  1YVC A;  2JA9 A;  2EIF A;  2D2C C;  3MXU A;  3R93 A;  4B9X A;  1KIX A;  1TII D;  3ERQ A;  2UU9 Q;  4IN3 A;  2J4X A;  4A4I A;  4X62 Q;  2PYK A;  4Y52 H;  2Z1C A;  4QUF A;  2WB1 E;  4JYA Q;  1RCV D;  3RLO A;  5I2X A;  1NAP A;  3SVM A;  5IYD H;  4LUO A;  4POF A;  1Q86 C;  2QIL A;  4DR2 L;  1I4R A;  1VQK A;  4UP9 A;  2EVB A;  4C3I H;  4CJ1 B;  1JOK A;  1TS2 A;  1K0S A;  2L5T A;  4QIW B;  1HA6 A;  1C9O A;  3LX0 A;  4P2C B;  3BZK A;  5IP9 H;  3ERS X;  1HNX L;  1FJG Q;  1U4R A;  1HQM C;  4DR4 L;  5M5W B;  2AKW B;  1QUQ B;  5AFW A;  3C2P A;  2IX1 A;  4XQN A;  3BYT B;  1GHJ A;  1GD7 A;  2MFI A;  5JJK A;  2UUB L;  4M1U B;  1A3U A;  1S5D D;  5M5Y B;  1ZYR C;  3H09 A;  2MO0 A;  4A3B G;  1HFN A;  4P73 A;  4HAE A;  3UE1 A;  1B4O A;  4LFA L;  2F0I A;  2F3I A;  4P72 A;  2PZU A;  1JIC A;  4A3J B;  2F4V L;  4NB3 A;  3HOU B;  1CKN A;  2RHQ B;  4P74 A;  2R92 H;  2RSN A;  2A8V A;  4YHH L;  1NMF A;  4FVM A;  1V9P A;  2ALY B;  5EPJ A;  1AW7 A;  5G3L F;  2MGS A;  5AJ3 L;  1O78 A;  1TS3 A;  3FMC A;  1Q12 A;  1OXU A;  4GZY C;  1WOC A;  4KI0 A;  4YCW A;  5FJ8 H;  1BBU A;  4DR2 Q;  4RGN A;  4A3F H;  4K8I A;  2DY8 A;  4KV6 A;  5JPM C;  1UE5 A;  3S1Q H;  4XTC S;  4LAA A;  2E2J H;  3BVZ A;  1WCM H;  1X3G A;  4MN3 A;  2K03 A;  1XWE A;  2OTL A;  1HNX Q;  1EZ6 A;  4LUZ A;  5C3E H;  4JK1 C;  4FF2 A;  3E0E A;  1VQG A;  1ROD A;  3OIQ A;  2E2H H;  3W1B A;  4DR4 Q;  1SNQ A;  2HUG A;  3NBH B;  3N6R A;  2F1M A;  4QL5 A;  2C5C A;  4HR7 B;  3ICE A;  2ATW A;  5DLQ E;  3D8G A;  4IO9 A;  1DM0 B;  5KNB A;  2ES2 A;  4XT1 B;  1TS5 A;  5JVG 3;  4N9P A;  4DV0 L;  2EZV A;  4JBM A;  3GTM H;  1PFN A;  3I70 A;  3TRZ A;  3CRK C;  2RDF A;  1S40 A;  2KQ3 A;  1QZH A;  2F4V Q;  2OEO A;  2ZTE A;  4FO2 A;  5C3W A;  5E1F A;  3OW2 A;  4F87 A;  4GOP A;  4OHJ A;  2VQE Q;  1E1O A;  4YHH Q;  4A3G B;  3QIA A;  4AH6 A;  2F0F A;  2CH4 W;  4EQO A;  1GUG A;  3OTO L;  2ZM6 Q;  4RA8 A;  3HKZ G;  5EPK A;  4L5T A;  1PTO F;  1PH7 A;  1PH5 A;  1VQM A;  1E7Z A;  1GJX A;  3BZD B;  4TRD A;  4DV5 L;  1OXS C;  4CKC A;  2GVB A;  2A74 C;  4R4O A;  4RMF A;  2RCF A;  3DHQ A;  3H0G G;  2WV6 D;  1VMC A;  2IHE A;  1S5C D;  1DOK A;  3A56 A;  3BU2 A;  3P7J A;  1UE1 A;  3GTL B;  1QZG A;  1G6Z A;  5FOB B;  1I94 L;  2MQH A;  3OWE B;  4M8A A;  3M4O B;  2A69 D;  4H0L C;  2FFK B;  1BKB A;  1TU2 B;  4NKL A;  5KNC A;  4YWL A;  3I4M G;  1E22 A;  4JV5 L;  5KYL A;  2F0W A;  2O2L D;  4P75 A;  2O5J C;  2D9U A;  4IJH A;  5IIF A;  2F0M A;  4KHV A;  1TY0 A;  3MA2 B;  5COR A;  1FGB D;  1SEB D;  1A2T A;  2IHF A;  4JOI A;  2A68 D;  4DV0 Q;  4HJA A;  1FR3 A;  3ULL A;  2G9H D;  4BY7 G;  4JI6 L;  5ELB A;  4R1J A;  2R6G A;  3P20 A;  4DV1 Q;  5KGU A;  1LTI D;  1QWY A;  4BBS G;  4KKU A;  1KTK A;  4Z9C B;  3HOX H;  2KCM A;  2Y0S G;  4EQN A;  4UP7 A;  4CDD C;  4A3C H;  5IGG A;  2L12 A;  4XYQ A;  5K36 H;  3LNN A;  3NXW A;  3GV6 A;  3CME A;  2OWO A;  1O7Z A;  4L63 B;  4DV5 Q;  1G91 A;  1UWV A;  1D5X C;  4JI7 Q;  4KJO A;  4Q0F A;  1PFM A;  2B2Y C;  2PI2 A;  3GTJ B;  3I4N G;  4HIO A;  3T1Y L;  2LXJ A;  1EU4 A;  3KBG A;  2HT1 A;  1BXT A;  1Q1B A;  1EU3 A;  2B8F A;  1FGU A;  5E7N A;  4GNX C;  1TWF B;  1VQH A;  1I94 Q;  2JA6 G;  3KK7 A;  4BY1 H;  1VQ9 A;  4PZ6 A;  3UDI A;  1WTQ A;  4HMJ A;  3I55 A;  4PZ7 A;  3E6Z X;  3I4L A;  5H1S E;  2EXZ A;  4XT3 B;  1O7I A;  4JV5 Q;  2VNU D;  1DZ1 A;  3IFD A;  1K8A C;  5M3F H;  3M4P A;  2Q2H A;  1MHW C;  2N88 A;  1IW7 C;  2P5Z X;  1LT4 D;  4KHZ A;  5IY0 A;  5BR8 L;  4IZ8 A;  2WAQ E;  3OMC A;  4JI0 L;  3HFZ B;  5KYI A;  1J8I A;  5IYC G;  3GTO H;  2O5I C;  3HOY G;  3M9B A;  3A74 A;  1V1P A;  4LF4 L;  3J7A F;  1SYC A;  1LTR D;  1L2F A;  1F9P A;  1YNJ D;  2K5Q A;  2FIN B;  1IYJ B;  4GNX B;  4F8M A;  3NEN A;  4IUR A;  1UE6 A;  4CDC C;  2F03 A;  1WYD A;  1EEI D;  3L7Z C;  4EVO A;  3J80 L;  2ZXR A;  2NVQ B;  1I6H B;  5L37 A;  3E9H A;  3RZO B;  3AB9 A;  2C35 B;  1F2Z A;  1VQ6 A;  2PW5 A;  1FNU A;  3L9A X;  5KND A;  3T1Y Q;  4POG A;  1W6K A;  1SBB B;  1EWH A;  2OCE A;  3HEJ A;  1W3S A;  3HOZ B;  3KLR A;  1HTP A;  2IL8 A;  2HIV A;  1DXM A;  3U4Z A;  1LYL A;  1UEA B;  2VY3 A;  3R3O A;  4OO1 I; 
#chains in the Genus database with same CATH homology
 1Z47 A;  1MIU A;  1L1O C;  2PQA A;  4KLK A;  3B6Y A;  2K50 A;  1WFQ A;  2E5L Q;  3K80 C;  4DV7 Q;  1NBW A;  3I4M H;  2OTJ A;  1N34 L;  1VQC A;  5LMN Q;  1K8G A;  1QVF A;  4LF9 L;  2JEB I;  4HIM A;  3S1R H;  2CWA A;  2D62 A;  1ASZ A;  3CC4 A;  1A0I A;  1C0A A;  2PQA B;  4A3J H;  4JI3 L;  4GN3 B;  2D0O A;  5BR8 Q;  4GLX A;  2VW9 A;  2DGY A;  3GO5 A;  1VQ8 A;  4DR7 Q;  1HJP A;  3RLN A;  1HR0 L;  4GN4 B;  4JBJ A;  4YWK A;  4LF4 Q;  4KHP L;  5JEA G;  1LUZ A;  1PA6 A;  1VQP A;  2VS1 A;  2Z0S A;  1I50 H;  3ZJY C;  4K0K Q;  4QIW E;  1B8A A;  4JBK A;  2JEA I;  4A3B H;  1HZA A;  1VQE A;  3CPW A;  4A3E G;  2UXD Q;  1L1O A;  3DLL A;  1YHQ A;  1K9M C;  1KRT A;  1E24 A;  1XPU A;  4L5S A;  3K0X A;  1YIT A;  5M3M G;  1N33 Q;  5FLX c;  3EBE A;  1PYB A;  4DK3 C;  2I5M X;  4JI4 L;  3KDF A;  1L1O B;  3HOV G;  4PMW A;  1H95 A;  4LF6 L;  3NEL A;  4A76 A;  3T1H L;  2GVA A;  1W2B A;  3OTO Q;  3F1Z A;  3FKI H;  4IJL A;  4DAY B;  5GAH C;  1PH6 A;  4IPG A;  1PH1 A;  1NTG A;  2A1A A;  2R93 H;  4IOA A;  3KDF B;  2VUM G;  5C4X G;  4RG1 A;  3HOW G;  5IP9 G;  1E3P A;  3PIP A;  4B3T Q;  2EXD A;  3BZC A;  4AYB E;  3CCM A;  1VS0 A;  1AE2 A;  3PUW A;  4QY7 A;  4OWW B;  4DR1 L;  2ZJQ A;  2WFW A;  3J81 i;  4A3M G;  1IBK L;  2YTV A;  1EUJ A;  1N36 L;  3G4S A;  2R7Z H;  3CF5 A;  4DUY L;  1HH2 P;  2I5L X;  3TQY A;  3RZD H;  1YJW A;  1HZB A;  1TWH H;  2K5V A;  2OQK A;  2KEN A;  2Q2T A;  1YNX A;  4YCV A;  3CMA A;  1U5K A;  4DV2 Q;  3S15 H;  3KF8 B;  1N34 Q;  3PUZ A;  1PH8 A;  4AIM A;  4LF9 Q;  2NVX H;  1MKH A;  1SRO A;  2XGT A;  1GVP A;  5M5X H;  3UDF A;  3UDX A;  3HOX G;  2B3G A;  2N8N A;  4DV3 Q;  4JI3 Q;  4BA2 I;  1PH2 A;  4PZ8 A;  2WAQ G;  5IP7 G;  1CKN B;  3J80 i;  5FLM H;  4A3C G;  5C0X I;  2ZM6 L;  1FVI A;  4R4Q A;  1IBM Q;  4UY8 C;  4A3G H;  5C44 H;  1HR0 Q;  3JC6 6;  5K36 G;  3S17 H;  4BBR H;  1JT8 A;  1KXL A;  4DR3 L;  1GM5 A;  4NPS A;  2HQL A;  4LUV A;  3S14 H;  2UU9 L;  2K52 A;  1CKM A;  4GLA C;  2VZA A;  2BH2 A;  3CCE A;  4HJ8 A;  4X64 Q;  3KOJ A;  4DNI A;  1YHA A;  3RN2 A;  4IPH A;  2E2I H;  2JA5 G;  4MNO A;  3TRE A;  1L0W A;  2CFM A;  4JI6 Q;  4FDB A;  1HZ9 A;  3H3V I;  2HIX A;  5JEA J;  3STB C;  1XTD A;  2IX0 A;  1OXT A;  1V1Q A;  1Y1V G;  3PV0 A;  3CW2 C;  4JI2 Q;  4B3S L;  4JI4 Q;  2EQS A;  2D0P A;  4Y7N H;  4L5R C;  4LF6 Q;  3EIV A;  4IFD I;  3T1H Q;  4NXN L;  4BY1 G;  4L5Q A;  3MEF A;  3GDE A;  2PMZ E;  4EQ5 A;  3KLW A;  1VCI A;  3GTL H;  3RN5 A;  3PCO B;  1X56 A;  1KAW A;  2YTX A;  4TQU S;  1PH4 A;  1EQQ A;  1ASY A;  3M4O H;  5M3F G;  2NN6 G;  1FJG L;  1E1T A;  2ZTD A;  5GAD C;  4DR1 Q;  4LF7 L;  4X65 L;  4DUZ L;  1KHI A;  1IBK Q;  3GTG H;  2BA0 A;  3J81 j;  3S24 A;  1EIF A;  5ELO A;  3JAM i;  1Z9F A;  1VQJ A;  3H0G H;  5GAG C;  2ZJP A;  1X9N A;  1XNR L;  2CQO A;  1PHJ A;  2QGQ A;  3NEM A;  4GLV B;  5M5W H;  4DV1 L;  4A93 G;  4OXP A;  3CCR A;  3TS0 A;  3S16 H;  1VQ7 A;  1AE3 A;  2YV5 A;  3U50 C;  3AYH B;  2OQ0 A;  2B63 G;  3H3V H;  4A3K G;  2UUA L;  1YVC A;  2YTY A;  5M5Y H;  2JA9 A;  4O0A A;  4A75 A;  1X3E A;  2EIF A;  1JMC A;  2QA4 A;  1KIX A;  1EYG A;  2UUC Q;  4DR3 Q;  3F2C A;  2UU9 Q;  3HOU H;  1K0R A;  1Y1W G;  4JI0 Q;  2VQF L;  4R4T A;  1NJI C;  3CPF A;  1PYS B;  4A4I A;  4X62 Q;  4PG3 A;  4JI7 L;  4LWC A;  1YIJ A;  1PH3 A;  4Y52 H;  3HKZ E;  4JOI C;  4JYA Q;  2WB1 E;  3RLO A;  3M3Y H;  4BY7 H;  3S1M H;  3S2D H;  3OYY A;  3W5O A;  4DK6 C;  4JC0 A;  5IYD H;  4LUO A;  1WI5 A;  4POF A;  4A3I G;  4BBS H;  1Q86 C;  4BXX G;  4DR2 L;  4B3S Q;  3K8A A;  2B29 A;  3GTJ H;  1VQK A;  3HOV H;  1Q8K A;  4UP9 A;  4YWM A;  3F8T A;  4LFB L;  4NXN Q;  1WJJ A;  5LMU L;  5LMN W;  2K75 A;  4ALP A;  1VQ5 A;  2NZO A;  4C3I H;  4A3D G;  2UXC L;  2JA7 H;  3L2P A;  4DPG A;  3BJU A;  1X6O A;  1C9O A;  2K4K A;  5IWA L;  1Y14 B;  3CCL A;  4LNQ A;  2VUM H;  1XMQ Q;  5ELN A;  3BZK A;  5IP9 H;  4OX9 L;  1RL2 A;  3ERS X;  3AFQ A;  1QUQ A;  4J15 A;  4AYB G;  1HNX L;  1FJG Q;  4A3J G;  4X65 Q;  3CD6 A;  3PUX A;  2FXQ A;  4DR4 L;  2AKW B;  1QUQ B;  2BA1 A;  4HIK A;  3I4N H;  4B3M L;  2PNH A;  3G48 A;  1XNR Q;  3W1G A;  3KF6 A;  1I3Q H;  4AQY L;  3PGZ A;  1PV4 A;  2IX1 A;  1GD7 A;  2MFI A;  5JJK A;  2JE6 I;  2JQO A;  2UUB L;  4NXM L;  2JA6 H;  3KJP A;  2MO0 A;  4A3B G;  4P73 A;  3G6E A;  3PO3 H;  1HNW L;  3KF6 B;  3UE1 A;  1Q81 C;  2NN6 I;  4LFA L;  1A62 A;  1YBY A;  2F3I A;  4P72 A;  2F4V L;  2CWP A;  5IP7 H;  1G6P A;  4NB3 A;  1CKN A;  2RHQ B;  4DR5 L;  3K81 C;  1HZC A;  1LTL A;  3KYH C;  1J6Q A;  4P74 A;  1K73 C;  2R92 H;  2A8V A;  4YHH L;  1NMF A;  1YZ6 A;  4OO1 G;  4OON A;  2AWO A;  2Y0S E;  1CSP A;  1KRS A;  1V9P A;  2ALY B;  1SLJ A;  3FHW A;  3HKS A;  3PO2 H;  2VQF Q;  3FKI G;  1A63 A;  4OO1 I;  1VQF A;  4QJF A;  5AJ3 L;  2R93 G;  5IYC H;  3A5U A;  3DM3 A;  2NVQ H;  3HOY H;  1I6H H;  1U0L A;  1J5E L;  1Q12 A;  2KBN A;  4A3L H;  1OXU A;  4KHP Q;  1SMX A;  1WOC A;  1YEZ A;  1T9H A;  4KI0 A;  1PFS A;  4YCW A;  4LFC L;  3ULJ A;  5FJ8 H;  1BBU A;  4XIG S;  4DR2 Q;  1SFO H;  2KCT A;  1G51 A;  1D8L A;  4O2D A;  3I56 A;  4A3F H;  2R7Z G;  3A0J A;  4LFB Q;  5LMU Q;  1X55 A;  4JG2 A;  1UE5 A;  3S1Q H;  2UXC Q;  2QEX A;  4XTC S;  2JA8 H;  2E2J H;  4BA1 I;  1WCM H;  3MXN B;  3HOZ H;  1X3G A;  3A5Z B;  5IWA Q;  4EX5 A;  1TXY A;  4DV4 L;  1BBW A;  2OTL A;  1X3F A;  4GOP C;  4LUZ A;  1KQS A;  5C3E H;  1HNX Q;  2IY5 B;  1NY4 A;  3E0E A;  3K7U C;  1VQG A;  1JE5 A;  1HR0 W;  2L15 A;  3U4V A;  4C3J H;  4LF5 L;  3J7A 5;  1N32 L;  4WJ3 M;  2E2H H;  3CAM A;  3W1B A;  4DR4 Q;  2KHI A;  1BVS A;  5FLM G;  3NBH B;  5GRO A;  3CC2 A;  4A3G G;  5HY6 A;  4QL5 A;  4B3M Q;  2XTI A;  5C44 G;  3CCU A;  4DR7 L;  4IPD A;  1VQA A;  3J81 c;  4X66 L;  3PIO A;  4BBR G;  3U58 A;  5DLQ E;  4AQY Q;  2ATW A;  3ICE A;  5IYB H;  1IXR A;  4IO9 A;  1IBL L;  5GQO A;  4DR6 L;  4JI1 L;  3VDY A;  1N36 Q;  4NXM Q;  4K0K L;  3J7Z C;  2ES2 A;  3S1N H;  4DUY Q;  2UXB L;  1A8V A;  4JBW A;  1YI2 A;  2AWN A;  4DV0 L;  4JBM A;  3GTM H;  1B7Y B;  3AQQ A;  3TRZ A;  1HNW Q;  1S40 A;  1QZH A;  5GAE C;  2F4V Q;  1KL9 A;  1LM0 A;  2ZTE A;  1XPR A;  4P71 A;  4JI5 L;  3PUV A;  1XNQ L;  2A19 A;  3GD7 A;  1KD1 C;  4YY3 L;  3OW2 A;  2ID0 A;  1IZ6 A;  4GOP A;  2VQE Q;  4JI8 L;  1QVC A;  1E1O A;  5EAY A;  4YHH Q;  4AH6 A;  2Q2U A;  2JK8 A;  3J80 c;  4ME3 A;  3F2D A;  1UE7 A;  1S72 A;  1Y1W H;  3OTO L;  3AFP A;  1JJ2 A;  2ZM6 Q;  4GOP B;  3I7F A;  1XPO A;  1MJE A;  3HKZ G;  4DV6 L;  2IT1 A;  1K83 H;  2K5N A;  2WB1 G;  4L5T A;  1B70 B;  1AH9 A;  3L0O A;  4QQB X;  1PH7 A;  3Q8D A;  1VQB A;  4YCU A;  2I5H A;  1PH5 A;  2N3S A;  5IT9 c;  1VQM A;  3CC7 A;  1E7Z A;  1OTC A;  4DV5 L;  1VQO A;  1OXS C;  4MZ9 A;  1HNZ L;  3I2Z A;  5C0X G;  1VQL A;  1NMG A;  1UEB A;  4OWT B;  2GVB A;  4A3E H;  4R4O A;  3PF5 A;  4R4C A;  4RMF A;  3H0G G;  4C2M H;  2IHE A;  4IPC A;  4QGU A;  1EQR A;  5M3M H;  2LSS A;  3BU2 A;  4LW1 A;  4DV4 Q;  3M4Q A;  4DV2 L;  1UE1 A;  2I0Q A;  4C3H H;  1P8L A;  3M85 A;  2ZTC A;  2N78 A;  1QZG A;  1I94 L;  1QVG A;  2MQH A;  2AMC B;  4DV3 L;  3CCV A;  4LF5 Q;  4HJ5 A;  1BKB A;  1R9T H;  1TWF H;  1N32 Q;  1I5F A;  1S3O A;  1EOV A;  4YWL A;  2NVY H;  3I4M G;  1E22 A;  3ER0 A;  5C4X H;  3H15 A;  2ZJR A;  4GKK L;  4H02 A;  3HOW H;  1OXX K;  4JV5 L;  1IBM L;  3KFU A;  4P75 A;  3CCJ A;  1JJC B;  4X66 Q;  1JJG A;  1X65 A;  4IJH A;  4IFD G;  3JAM c;  4LF7 Q;  1SRU A;  1IBL Q;  4DUZ Q;  2NVT H;  3HOU G;  4DR6 Q;  4JI1 Q;  4A3M H;  2R7D A;  2UXB Q;  4JOI A;  2IHF A;  1CUK A;  2E8G A;  4DV0 Q;  4LF8 L;  1VQD A;  4X64 L;  4HJA A;  3ULL A;  4BY7 G;  2CCZ A;  4JI6 L;  4R1J A;  3F2B A;  2HHH L;  4JI5 Q;  2R6G A;  4UPA A;  1XNQ Q;  5IYD G;  4DV1 Q;  4B3R L;  4TVA B;  4YY3 Q;  4BBS G;  1N9W A;  3LGJ A;  1Q82 C;  4JI8 Q;  1JB7 A;  4JI2 L;  2GN5 A;  3HOX H;  2KCM A;  2Y0S G;  1M90 C;  3STB D;  4UP7 A;  4GKJ L;  1KC8 C;  2UUA Q;  5JJI A;  1NE3 A;  3ULP A;  1V43 A;  2JA7 G;  4A3C H;  1PH9 A;  3K7A H;  4DV6 Q;  3RNU A;  2DUD A;  1PVO A;  4HID A;  3KJO A;  3CME A;  2OWO A;  2R7F A;  4DV5 Q;  1K3R A;  3RLF A;  1UWV A;  2Q2I A;  3E9I A;  1CSQ A;  1HNZ Q;  1XMO L;  4JI7 Q;  2JA5 H;  2PI2 E;  3M7N A;  3UDG A;  2PI2 A;  3I4N G;  3RR5 A;  3RZO H;  4HIO A;  3T1Y L;  2LXJ A;  4X6A H;  3WWV A;  1EWI A;  2VL6 A;  2HT1 A;  1Q1B A;  1FGU A;  5E7N A;  3CCQ A;  1Q1E A;  1Y1V H;  2RF4 A;  3PSI A;  1G29 1;  4GNX C;  2MNA A;  1D7Q A;  1VQH A;  2ASB A;  5C0X J;  2CKZ B;  4DAM A;  1I94 Q;  2JA6 G;  2KHJ A;  1YJN A;  1N8R C;  4BY1 H;  1M1K C;  1VQ9 A;  3PO3 G;  4PZ6 A;  3UDI A;  4HJ9 A;  3TEH B;  5JJL A;  3CQZ H;  3CP0 A;  3I55 A;  1SE8 A;  1Q7Y C;  4PZ7 A;  3SGI A;  4GKK Q;  5H1S E;  2E5L L;  4DV7 L;  1O7I A;  4JV5 Q;  2VNU D;  2RCN A;  3GTP H;  4OX9 Q;  1Q46 A;  5LMN L;  1XJV A;  2R92 G;  2YYZ A;  2H5X A;  5M3F H;  3M4P A;  1K8A C;  2Q2H A;  2AHO B;  5IY0 A;  4GS3 A;  4JCV E;  4KHZ A;  5J3B A;  2UUC L;  3TS2 A;  5BR8 L;  3PO2 G;  3S2H H;  2K5H A;  2WAQ E;  4APV A;  3FP9 A;  4JI0 L;  1VQI A;  3HFZ B;  2RHS B;  2WP8 J;  4LF8 Q;  4MTN A;  1FL0 A;  4DKA C;  5IYC G;  3GTO H;  1YHB A;  4X62 L;  3HOY G;  1OXV A;  4JYA L;  2MO1 A;  3M9B A;  3A74 A;  2VQE L;  1VQN A;  4A3L G;  4IFD J;  2HHH Q;  3PF4 A;  4HJ7 A;  4LF4 L;  4GNX A;  4B3R Q;  3CXC A;  3G71 A;  5FJ8 G;  5IE8 A;  4OWX B;  2UUB Q;  4A93 H;  2N49 A;  1L2F A;  1RIP A;  2JJQ A;  4WJ4 A;  1IYJ B;  1SR3 A;  4LFA Q;  4A3F G;  1YJ9 A;  4GKJ Q;  1SN8 A;  1GKH A;  2UXD L;  4GNX B;  2Z6K C;  3CCS A;  2F52 A;  3NEN A;  4A3K H;  4IOC A;  1EFW A;  2B63 H;  1UE6 A;  2JA8 G;  2LXK A;  3GTK H;  1CKO A;  3D0F A;  1WCM G;  1TWA H;  1WYD A;  4DR5 Q;  3HOZ G;  1P16 A;  1N33 L;  3L7Z C;  3I4O A;  4UP8 A;  1XMQ L;  3EN2 A;  1DGS A;  5C3E G;  1IL2 A;  3E9H A;  1GO3 E;  5HGQ A;  2NZH A;  2C35 B;  5AJ3 Q;  1VQ4 A;  1XMO Q;  1VQ6 A;  3GTQ H;  3UE0 A;  1J5E Q;  3T1Y Q;  3D31 A;  1TWC H;  2V1C C;  4B3T L;  4POG A;  3PUY A;  1X54 A;  4LFC Q;  2K14 A;  1MJC A;  2YU9 H;  4R4I A;  4A3I H;  5IYB G;  3AEV A;  4BXX H;  2BH8 A;  2OCE A;  3IRB A;  1TWG H;  1EIY B;  1W3S A;  2HIV A;  4GN5 A;  3U4Z A;  5C4J H;  1LYL A;  2VY3 A;  2Z6K A;  1C7Y A;  4A3D H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...