4YHHL

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
total genus 11
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhL00
1PH8A 1VQOA 4LFCQ 4GOPA 2UUCL 4IPHA 1YNXA 4LF4Q 2MQHA 4JI1L 4A3MH 1PH7A 1SRUA 4GKJQ 3H15A 1B70B 1E3PA 2WP8J 3HOZG 4K0KL 3G6EA 2Z0SA 3D0FA 4QY7A 2D0OA 4A3JH 1N32Q 1KHIA 4DV6Q 1HZ9A 3E9HA 2ZTCA 1BVSA 1YJ9A 4B3MQ 3CCMA 2K50A 3PCOB 3HOYH 2B29A 3GDEA 4LUVA 3T1YQ 4X62L 4GKKQ 1JJGA 1Y1WH 3FKIH 2D62A 4HJ8A 1SFOH 4BXXH 3GTJH 3M9BA 4BBSH 3F8TA 4JI5Q 4DV1L 4GNXC 3KOJA 3PO2H 3I56A 3JC66 2MO1A 1VQFA 4KHPL 4JI4Q 4A75A 4HJAA 3S1MH 4LFCL 3KJPA 2Q2TA 2K52A 3NENA 4LF4L 4NXML 2JA5H 1P16A 4B3SL 4JYAQ 4GKJL 2HIXA 4DK3C 4A3BH 3B6YA 4X64L 1KRTA 4A93H 3A0JA 3K80C 5DLQE 1PH2A 1VQCA 2IY5B 4DV6L 3PF4A 4B3ML 4A3MG 3CC2A 2NVQH 3M7NA 1EFWA 4BY1G 4DKAC 5IT9c 3T1YL 4A3EG 1OXUA 2ATWA 3GTQH 5M3MH 1IZ6A 3HOXH 1FJGL 2WFWA 1X3GA 2B63H 5JEAJ 3KJOA 1TXYA 1KRSA 1FL0A 3TREA 4A3IH 2IX1A 4IFDG 2NN6I 4GN4B 2ZM6Q 2IHEA 3H0GG 4BXXG 3CMEA 4DR3Q 2K4KA 4EX5A 1Q82C 4A3DG 1KL9A 4DUZQ 4BBSG 4BBRH 4C3IH 1QVCA 1PH6A 2ES2A 4JYAL 4OX9Q 2JEBI 1Q46A 4DV3L 2Y0SG 3RN5A 1PVOA 2OWOA 3E0EA 3I7FA 4L5RC 4WJ3M 2KHJA 3ER0A 1PH9A 4A3BG 1VQKA 4JI6Q 1OXTA 1GO3E 4IPDA 4HJ9A 5C4XH 3CCLA 3CC7A 3PUVA 4LF6Q 1SROA 3EBEA 3ERSX 4OO1G 4DR6Q 3HOUH 2Z6KC 3WWVA 1TWHH 4LF8L 2XTIA 5M3MG 2RHSB 1CKOA 1YVCA 2BA0A 4H02A 2LSSA 3I4OA 4KHZA 4DR3L 4DR4L 1GVPA 3UE1A 4LWCA 2JA7H 1VQIA 3HOWG 3PO3H 2I5LX 2PI2A 4XTCS 3J7ZC 4JC0A 4R4QA 1K8GA 3DM3A 4OX9L 3I4MH 3I4NG 4IPGA 4A4IA 3G71A 1VQMA 2GN5A 4LF5Q 3GTOH 3U4VA 4A3CH 2QGQA 1MKHA 1HNWL 1Q81C 1KXLA 1GD7A 3DLLA 1Q12A 3BJUA 1L2FA 4P71A 5IYBG 4LF9L 5HGQA 2KCTA 4NXNQ 1NY4A 5LMUQ 1YJNA 1Z47A 1KD1C 5GROA 1BKBA 4IJHA 3J81i 4DR6L 5ELOA 1VQ5A 5FLXc 2CWPA 3W1GA 1QUQA 2NZHA 1SR3A 2ID0A 5J3BA 4JI3Q 3AYHB 1L1OB 1VQNA 3BZKA 4OXPA 2RF4A 4GOPB 4OWTB 2I0QA 1WYDA 4JBKA 2Q2IA 2ZJPA 1VQ7A 4LF5L 1Q8KA 4MTNA 3BU2A 3FP9A 5IYCH 5M5WH 3W1BA 3I4MG 4A3GG 4AIMA 2DGYA 1HNZQ 5FJ8H 3J81c 2K75A 2N3SA 3M85A 3S1NH 3D31A 1X56A 1I3QH 4A3FG 1YHAA 1S3OA 2IHFA 4GN3B 2VQEQ 2E8GA 1Q86C 3CW2C 5H1SE 1C9OA 4AQYL 2N78A 3AQQA 1M1KC 3IRBA 1HNXL 4LUOA 2OTJA 5K36G 4JI3L 1VQ9A 4GS3A 4JI2Q 1A62A 5HY6A 4B3TQ 2R93H 3UDGA 4QIWE 3RR5A 4DR7Q 1AE2A 1KAWA 4DV0Q 1XMOQ 5IWAQ 4BY1H 1EYGA 4A3EH 4JOIC 2HHHL 4HIDA 2ZJQA 1X55A 3PUYA 3GO5A 1XTDA 4YHHQ 1D8LA 1YIJA 4JBJA 3L7ZC 1HNZL 1IBKQ 1UE1A 4C3JH 2CFMA 2D0PA 2JA6G 2KHIA 5FLMG 2UXDQ 3T1HQ 4DAYB 5IYCG 3CPFA 3H0GH 4LFAQ 5IP9H 2MNAA 2AHOB 1QZHA 3S1QH 4A3DH 5FJ8G 2VNUD 4PZ6A 5IE8A 3CPWA 1WFQA 2VQEL 2K5VA 1B7YB 2PMZE 5C0XG 3I55A 3M3YH 2HQLA 1JJCB 2UUBQ 3S14H 4JBMA 1XNRQ 4NPSA 1SMXA 1EQQA 4B3TL 2I5HA 1YHQA 4OO1I 4APVA 1XMOL 2K5HA 4DV0L 2NVTH 3A5UA 1VQHA 4LF7Q 2E2IH 1N32L 1CKNA 1VQDA 2RHQB 3ULPA 1SLJA 5IP7G 3CCJA 4QQBX 2R93G 5EAYA 4O0AA 4JOIA 2MFIA 3UE0A 4DV7Q 2VQFQ 2CKZB 4JG2A 1VCIA 1OXSC 3L2PA 3RZOH 1V1QA 1J6QA 4GKKL 3T1HL 2UXDL 3EIVA 2A8VA 4LFAL 2Y0SE 4DR2Q 1DGSA 2CWAA 3PF5A 2BA1A 4IO9A 1PA6A 2NZOA 4JI5L 3HOWH 2UU9Q 1E1TA 1YITA 1K73C 1TWFH 2UUAQ 2C35B 3RLOA 1QVGA 1PYBA 4GNXA 4JI4L 1PYSB 5IP9G 1LYLA 1V9PA 3I4NH 3HOVG 5LMNQ 2UUBL 5M5YH 1Z9FA 1VQJA 1YEZA 2AKWB 2VZAA 4ME3A 4P72A 4QL5A 5E7NA 3NELA 4Y52H 1WCMG 5IYBH 4YY3Q 1XMQQ 3ICEA 2WAQG 1JT8A 4YWLA 1A63A 2VQFL 5GAHC 1H95A 1HH2P 4X65Q 4AYBG 2YV5A 1Q1BA 4GLAC 1PH4A 3S2DH 3E9IA 2CQOA 2BH2A 3CD6A 5JJKA 2UXCQ 2F52A 4A76A 1VQGA 2ZM6L 3EN2A 4TVAB 1I6HH 2RCNA 4RG1A 2YU9H 5C3EH 4PZ8A 5C4JH 4DUZL 4DV4Q 1N36Q 2JA8G 2KCMA 1QUQB 3L0OA 3OYYA 4A3GH 4IFDJ 1Y1VG 3RZDH 2I5MX 2V1CC 1YBYA 1XMQL 4DNIA 2EQSA 1YZ6A 4A3FH 2PQAA 4EQ5A 2H5XA 3KF6A 4DUYQ 4HIKA 4R4OA 3OW2A 1UEBA 1J5EQ 1EUJA 1I50H 3F1ZA 1IBLQ 4JI6L 3JAMc 4LF6L 4GLVB 1HZCA 5AJ3Q 3I2ZA 3TS0A 4UP8A 4A3KG 4DV2Q 1PH3A 4OWWB 2E2JH 3A74A 4MZ9A 1LUZA 1X6OA 4R1JA 1FVIA 1S72A 3AEVA 1N9WA 3F2CA 1HZAA 2F3IA 3TRZA 2Z6KA 5LMNW 1ASZA 3KFUA 1X3EA 3UDXA 1K3RA 1Q7YC 4DV4L 2R92G 1N33Q 1HJPA 5C44H 1X65A 2JA9A 5C3EG 3CMAA 2JA6H 1OXXK 2L15A 2ZTDA 3G48A 3K81C 5C0XI 3PV0A 5FLMH 2A1AA 1VQ6A 3GTGH 4B3RQ 2YYZA 4YWKA 2R7DA 3U58A 1J5EL 3NEMA 1IBLL 1XPOA 1HZBA 3PGZA 1X9NA 3M4OH 4NXNL 4NB3A 5LMUL 4X66Q 4C3HH 5AJ3L 4P73A 3FHWA 1AE3A 2E5LQ 4L5SA 1K0RA 2YTVA 4L5QA 4DV2L 5JJIA 5GADC 1O7IA 2IT1A 4DR5Q 1JB7A 2F4VQ 4UPAA 3K0XA 4LUZA 1K8AC 4A3LG 4JI8Q 2VUMG 4YWMA 4JI1Q 4DV5Q 1NJIC 1HR0Q 2R7ZG 4IOAA 3GTPH 1U0LA 2KENA 1N33L 5IP7H 2EIFA 2LXJA 1MJEA 3CCUA 3CCQA 1VQAA 4IFDI 1UWVA 1E22A 1M90C 4JI0Q 1E1OA 1I5FA 4JBWA 4BA1I 2AWOA 4L5TA 3PIPA 4X62Q 3F2DA 1P8LA 4B3RL 1CKNB 3U50C 5C44G 3A5ZB 3STBC 3CP0A 1XPRA 1EWIA 3S16H 3RLFA 3GTMH 1RIPA 3KDFB 3Q8DA 4YCUA 1I94Q 3PUZA 3HOVH 4ALPA 1X54A 1N34Q 1VQLA 4KHPQ 2JQOA 1S40A 1UE5A 1EIFA 1VS0A 4JI8L 2CCZA 3HKZE 4NXMQ 4B3SQ 4DV5L 4MNOA 4HJ7A 1HR0L 1QVFA 1XPUA 1WCMH 2IX0A 1R9TH 4GNXB 4X64Q 1XNQQ 1VQEA 4JI2L 2AMCB 1SN8A 1PFSA 3J80i 2ASBA 2WB1G 2DUDA 5JEAG 3G4SA 4DR7L 1VQBA 3MEFA 5IWAL 1ASYA 2HIVA 4JI0L 3SGIA 2GVBA 4UY8C 5M3FG 4YHHL 1V43A 3CAMA 3KDFA 3HKSA 3OTOQ 4PMWA 2LXKA 3HKZG 1GM5A 1IBKL 2VW9A 1FJGQ 1JMCA 1IXRA 2OQ0A 1I94L 2OQKA 2JE6I 4QJFA 1N8RC 1SE8A 1N34L 3ZJYC 1GKHA 2WAQE 2JA8H 2A19A 1NBWA 2QA4A 1YI2A 4J15A 2MO0A 3S15H 4TQUS 2JEAI 3S17H 2R7FA 4R4TA 4IOCA 1NTGA 3J80c 1Y1VH 1HR0W 5IY0A 4BY7G 3S2HH 1JJ2A 1T9HA 4AYBE 4LNQA 2HT1A 4POGA 1XNQL 3KLWA 4DV3Q 2ALYB 5GAGC 2QEXA 1G291 1U5KA 1PV4A 1VQ8A 1XNRL 3K7UC 4X6AH 2NVYH 3PIOA 5C0XJ 1L0WA 4LF7L 2VS1A 4OONA 4A3JG 1W3SA 3J7A5 2PNHA 3OTOL 4DV7L 4Y7NH 4A3KH 1IBMQ 1CUKA 1G51A 2PQAB 1UE7A 3KF6B 1CKMA 3HOYG 5IYDH 3MXNB 1TWGH 4PG3A 4DR2L 4LF8Q 4DR1Q 4JV5Q 1Y1WG 3FKIG 1BBUA 3RNUA 4QGUA 4DR4Q 4XIGS 4IJLA 2GVAA 2UU9L 4LFBQ 2R92H 3UDIA 2UUAL 3M4QA 3JAMi 2YTXA 2XGTA 3PO2G 5ELNA 5LMNL 4GLXA 1K9MC 4R4CA 4UP7A 1IYJB 4P75A 5JJLA 1OTCA 4HIMA 2EXDA 1PH5A 2JA5G 4KI0A 3TS2A 5GAEC 4GN5A 3UDFA 5BR8Q 4YY3L 1HNWQ 2ZTEA 1TWCH 1KC8C 4BA2I 4LF9Q 1BBWA 3W5OA 4A93G 4AH6A 4UP9A 2OTLA 3M4PA 1AH9A 1IBML 1PHJA 1EQRA 2KBNA 2VY3A 4X65L 4POFA 3F2BA 3H3VI 2ZJRA 3HFZB 4A3LH 3U4ZA 2FXQA 5GQOA 3S24A 2VUMH 2JJQA 2UXBQ 3AFPA 4DR1L 4JV5L 3PSIA 2R7ZH 3HOXG 2BH8A 4LFBL 2N49A 3K7AH 2B63G 2UXCL 3TQYA 4C2MH 4HIOA 5IYDG 3LGJA 4IPCA 4A3IG 4R4IA 4P74A 1MJCA 3H3VH 3CQZH 4DK6C 4JI7Q 3K8AA 5M5XH 1OXVA 1QZGA 1N36L 2K5NA 1NMFA 1Y14B 1A8VA 2Q2HA 4BBRG 2K14A 1WI5A 1IL2A 2NN6G 3CF5A 1KIXA 5BR8L 1KQSA 1CSPA 1CSQA 1FGUA 3STBD 2N8NA 2AWNA 1D7QA 2NVXH 4DUYL 3GTKH 1NMGA 1MIUA 4HJ5A 4OWXB 3CCSA 4O2DA 4FDBA 2VL6A 1RL2A 1XJVA 1B8AA 1E24A 2UXBL 1L1OC 2B3GA 1VQ4A 4YCVA 1A0IA 2PI2E 1C7YA 5C4XG 4AQYQ 4GOPC 3HOZH 1G6PA 2R6GA 3NBHB 1HNXQ 3TEHB 1LTLA 1JE5A 3J81j 1NE3A 1X3FA 2UUCQ 3HOUG 4JI7L 1C0AA 1EOVA 4KLKA 3RN2A 1TWAH 4K0KQ 3PUXA 4PZ7A 2YTYA 4YCWA 3RLNA 2JA7G 5M3FH 1UE6A 1WOCA 2OCEA 3BZCA 3ULLA 1LM0A 3PO3G 4WJ4A 2HHHQ 1E7ZA 1K83H 4LW1A 4DAMA 1Q1EA 1YJWA 3KF8B 1PH1A 3CC4A 1YHBA 1VQPA 3KYHC 4JCVE 3ULJA 3CCRA 4A3CG 1W2BA 2E2HH 3CXCA 2JK8A 4X66L 1WJJA 4DV1Q 2WB1E 3GD7A 1EIYB 4DPGA 4BY7H 3AFQA 2E5LL 3PUWA 4RMFA 3CCVA 2Q2UA 3GTLH 3S1RH 1L1OA 3CCEA 3VDYA 4DR5L 2F4VL
chains in the Genus database with same CATH superfamily
1VQOA 4FF2A 4GOPA 2KCNA 1DOKA 4JI1L 1JOQA 5EKIA 4ULLA 2HCCA 3I4NB 1SRUA 4K0KL 1CA6A 1KHIA 4DV6Q 1HZ9A 1YJ9A 4UHVA 3CCMA 2K50A 4RH6A 2VXWA 3GDEA 5E3FA 3T1YQ 1Y1WH 1RJTA 5FO7B 1K8MA 3GTJH 4BBSH 1CI3M 3NTKA 3RUZA 3I56A 3S2DB 2PZWA 4HJAA 3NENA 1F77A 1I6HB 4B3SL 1TIID 2H1EA 4XYOA 5G3LF 5ELBA 4DK3C 4DNTB 1IYVA 4X64L 1LLRD 2Z4HA 4A93H 1VQCA 2EXZA 3M7NA 2DNCA 3OIPA 1TWCB 2ATWA 3GTQH 2IJ0A 5M3MH 3ZYYX 2PNRC 2A68C 1X3GA 1RF2D 3SK6A 5JEAJ 3KJOA 3Q6SA 1FL0A 2F1MA 4IFDG 2NN6I 2ZM6Q 4FF3A 3H0GG 2K4KA 4DUZQ 5EJWA 1ENFA 3VYUA 2ES2A 2JEBI 2Q8TA 1PVOA 3O13A 5IGBA 3E0EA 3DEPA 3JAML 4WJ3M 3ER0A 1PH9A 2JA6B 4ZCKA 4A3BG 3I90A 1B9NA 4K6DA 4LF6Q 2F0GA 1SJED 4DR6Q 3OWEB 3HOUH 3J80E 1E0BA 1ONLA 1SNCA 1TWHH 4ZKBB 2WACA 4DFAA 2LSSA 3EFXD 1GVPA 1U4LA 3P1HA 1EY4A 4KHVA 4ZUJA 2AQ1B 1K8GA 3KUPA 3DM3A 4OX9L 3GTPB 3I4NG 1U4PA 1VQMA 2GN5A 2ICEC 3GTOH 4B08A 1KXLA 2F0WA 1GD7A 3FDTA 4P71A 4LF9L 5LMUQ 1YJNA 5CBAE 3S16B 4ZKCB 1BKBA 4CJ1B 5CGKA 2ICIA 4BY7B 1AN8A 2CWPA 1MSGA 3W1GA 1S5FD 2O2LD 1IW7D 1VQNA 2TMPA 3VR4A 4GOPB 1O7ZA 3TP6A 2Q2IA 2WKCA 4A3GG 1SYGA 2DGYA 5BN4A 1HNZQ 2K04A 3S1NH 4FYDA 3D31A 3D4DA 1ET9A 3QOJA 3G6JB 5EGTA 1S3OA 4GN3B 2VQEQ 2E8GA 5JVH3 1Q86C 3CW2C 2N78A 3AQQA 2EY1A 2FJ2A 4JI3L 1A62A 4RGTA 4CGYB 5HY6A 1M4VA 3S2HB 2R93H 4Q0FA 4QIWE 2F03A 3RR5A 1AE2A 4A93B 3MC0B 2ZJQA 1X55A 3GO5A 1XTDA 3OOCA 1Q8IA 2BDOA 4C3JH 2CFMA 2JA6G 2KHIA 2UXDQ 3T1HQ 3GTQB 3J80L 3CPFA 1BF4A 4A3DH 1STHA 2Z6BA 2VNUD 5IE8A 1TWGB 5IGFA 3DM1A 5C0XG 3M3YH 4B9XA 2QW7A 3L9AX 2OT2A 3S9WA 1ILPA 2I5HA 4IUPA 4APVA 1XMOL 2E2IH 3E3XA 2RHQB 1SLJA 4QQBX 4O0AA 3I91A 2WIIB 5COYA 1VCIA 1OXSC 3L2PA 2A8VA 4LFAL 1EY8A 4DR2Q 2BA1A 1PA6A 2NZOA 4JI5L 3HOWH 2UUAQ 1DCZA 1F2YA 4EQNA 5IP9G 3K7AB 1JOKA 2VZAA 1VQJA 2AKWB 4KV6A 4ME3A 1WTVA 3SE0A 1STBA 4YY3Q 1FD7D 3GTOB 4FF1A 1I4XA 4YWLA 2PCFB 1RDPD 2YV5A 1B44D 4QMGA 3BS1A 3EJIA 1AZPA 1MD2D 3CD6A 1EEFD 4A76A 1VQGA 4WORA 5C4ZA 4HEDA 1A3VA 2CW0C 4RG1A 1V1PB 3MA2B 4DV4Q 4IUNA 5LL6S 5L37A 4IFDJ 5CV5A 1CM9A 3DWQA 2F0FA 3BG3A 4TRDA 4CKEA 1YZ6A 4A3FH 1Q3LA 3KF6A 4DUYQ 4HIKA 5FO9B 1EUJA 1I50H 4JPBW 2BCOA 5C6AA 4JI6L 2E2DC 4NKLA 1F2LA 4GLVB 3TS0A 4UP8A 1LTSD 3UI2A 2E2JH 1LUZA 1ILQA 1S72A 3AEVA 3A7LA 3I4LA 3HS0C 1D2BA 2KECA 4RCNA 1HJPA 3I3CA 5C44H 3CMAA 2L15A 5C0XI 2A1AA 2X69A 1O78A 4A3JB 1SBBB 2F0DA 2R7DA 1HFGA 3NP8A 3U58A 1J5EL 2K7VA 3M4OH 4NXNL 4X66Q 4C3HH 2EJGC 2E5LQ 1AE3A 5JJIA 5GADC 4DR5Q 2IT1A 1JB7A 1GOZA 4UPAA 1K8AC 3BDLA 1E2ZA 4JI1Q 1NJIC 3S1MB 2CVRA 1F9RA 5I4DA 1TS4A 1JWSD 4HCEA 5IP7H 3V05A 2EIFA 1MJEA 1VQAA 2XWJB 1EIGA 4UDUC 5J39A 4KKUA 4L5TA 2NTTA 4HTHA 3PIPA 1P8LA 3U50C 1XPRA 1EWIA 3Q8DA 1TVXA 3NBHA 1BUVT 4BS9A 1NNXA 4NDXA 4XQNA 2JQOA 3HOWB 3KBXA 1EIFA 5JAVA 4FVMA 4B3SQ 1KAAA 4HJ7A 1XPUA 4X3SA 1R9TH 4BBRB 4X64Q 1MI2A 2AMCB 4C3IB 2Z1CA 5JPNC 2ASBA 4IUQA 1AEXA 1SE3A 1FYCA 3KF8A 3R8BA 3J81E 4DR7L 1SXTA 2NYZD 1Y8OB 1IBKL 3HKZG 1MBYA 2A6EC 5KRUA 1JMCA 1IXRA 2OQ0A 2OEOA 1I94L 2BE5C 5C4XB 2EDGA 2X6GA 2HUGA 2JA8H 2A19A 3I72A 3LX0A 5ELFA 4J15A 5M9OA 4IOCA 2LMCB 1HR0W 5IY0A 2K5QA 1JJ2A 1T9HA 2HT1A 4FXDA 1XNRL 3PO3B 4X6AH 2NVYH 5C0XJ 1L0WA 2VS1A 5LL6X 4OONA 2DY7A 4A3JG 1W3SA 2PNHA 2CQAA 4A3KH 4F88A 1B50A 3KF6B 1AZQA 1CKMA 3HOYG 1T5EA 1BBUA 4LFBQ 5KYIA 2XSCA 3IAYA 4K8JA 2NN6H 5LMNL 2PZTA 1K9MC 5JPMC 1IYJB 2RDGA 2OXPA 1I4PA 2ZTEA 4LF9Q 5FKAC 1JOOA 4OIKA 3TP5A 1SYBA 2VY3A 4UAIA 1FNUA 2CH4W 3H3VI 3M4OB 3HFZB 3U4ZA 1V1OA 3AFPA 2L4NA 4C1NK 1C8CA 3KLSA 5KNBA 4A3IG 3CQZH 4DK6C 3NQTA 3J81L 1B1ZA 1R4QB 1Y14B 2EY6A 4BBRG 2Q2HA 2RVLA 1IL2A 4C3IG 4FP5D 3CF5A 2F0LA 3BYYB 5BR8L 2MP1A 2NBFA 1FGUA 1C4QA 2N8NA 4A3EB 1D7QA 1J8IA 2NVXH 3R3OA 1MIUA 4FDBA 1RL2A 2A74C 1E24A 5C4XG 1A0IA 3S1QB 4GOPC 3NBHB 3TEHB 1BO0A 1NE3A 2UUCQ 2F4IA 1LTID 1SYFA 2F0PA 3D4RA 4L63B 2NZ1D 5JVG3 3EVQA 5M3FH 3PO3G 1K83H 2EPBA 2NVTB 3KF8B 1PRTD 3CC4A 2NWGA 1YHBA 3KYHC 1ZXTA 4K14A 2ZXOA 3ULJA 5I2YA 3H91A 3VYRA 4S3SA 4QF4A 2KCCA 3OHXC 3GD7A 3AFQA 3PUWA 4KY5A 4ODGA 1L1OA 2JA8B 2LKVA 1PH8A 4LFCQ 1TWFB 2PPBC 4IPHA 1UAPA 4GKJQ 3HOZG 1NAPA 2PO4A 5F2DA 2Z0SA 3D0FA 2D0OA 4ILWA 2KJXA 1BVSA 3PCOB 3FPUB 2KUMA 1JJGA 4X62L 3FKIH 4WRDA 4HJ8A 1SFOH 2I46A 3ERQA 1PZKD 1EY7A 4IZ8A 1VF7A 3D4WA 3VR6A 3T13A 4DV1L 4GNXC 4JI5Q 2O5JC 1LO5D 3KOJA 5C4HA 1VQFA 4KHPL 3Q23A 3GV3A 4A75A 3KJPA 4F87A 1EU3A 2Q2TA 4LF4L 1IL8A 1P16A 2YU9B 5C3EB 4A3BH 1H9RA 1KRTA 3K80C 5DLQE 1PH2A 1TY0A 3L3OC 3PF4A 5E4WC 5IGCA 4B3ML 4A3MG 2NVQH 4JVZA 4DAYA 5EPJA 2B2UA 1EQVA 5IT9c 4A3EG 1OXUA 3SR1A 1LT5D 2IX1A 4IN3A 2IHEA 4FNFA 5A2QL 3BVMA 4DR3Q 2OF1A 3K59A 5CV8A 3C3LA 4B9WA 4RGNA 4JYAL 5D14A 5ISRA 3RN5A 5ELCA 3T16A 4CJ2C 4J1MA 3I70A 1VQKA 1VMCA 1OXTA 4HJ9A 4IPDA 4JI6Q 2QEJC 3GTGB 2NVXB 2R61A 1KLGD 2F3WA 5FO8B 1SROA 5D3IB 4OO1G 2Z6KC 2RHSB 3VYSA 3I4OA 2JA7H 2F0JA 4C56C 2PI2A 1DXMA 2DJGC 1H9SA 1CZGA 2XN9C 2B39A 4XQJA 4A4IA 2L0CA 3U9OA 4LF5Q 3E5SA 4WJWA 3U4VA 4RCOA 1Q81C 1STEA 4H7BA 4XYQA 2MJ8A 5IYBG 4NXNQ 2RBMA 1Y8NB 4N8FA 5C5MA 2R3ZA 3PQIA 5EKKA 1DOLA 1YNND 2EYFA 1QUQA 1QCBD 1L1OB 1KNEA 3X3NA 2I0QA 1WYDA 2K28A 1VF5C 2EYPA 4MTNA 3I4MG 4AIMA 1EEID 3QR8A 1TS3A 3JAME 2ENBA 1WTQA 1I3QH 3TDQA 2IHFA 3AMUA 1I6VC 2KVMA 1C9OA 3IRBA 4L8JA 4LUOA 4QUCA 2NTSA 4DU9A 1ZYRD 1VQ9A 4B3TQ 1A2UA 3UDGA 4DR7Q 1KAWA 4DV0Q 1DZ1A 4BY1H 2HHHL 1UNSA 5TSSA 2E75C 1D8LA 1YNJC 1YIJA 3L7ZC 1EY5A 1IBKQ 1B2TA 3WDNA 5DEHA 2G9DA 2G5DA 4DAYB 5IYCG 2MNAA 5IP9H 4Y7NB 4K2KA 4PZ6A 4KY7A 3CPWA 2K5VA 4DAPA 4G7OC 2UUBQ 2R92B 4JBMA 3V96A 1HA5A 1XNRQ 1SMXA 4DN4M 4OO1I 1YHQA 2SDFA 1XWEA 3A5UA 4K5XA 1CKNA 1VQDA 2NB0A 4DGZA 3ULPA 1Y69U 4QCLA 2WKDA 1GUSA 4JW0A 5D3DA 2LY7A 2V4DA 3RZOH 2D9UA 1HRJA 1DGSA 1H9KA 2CWAA 3H94A 1VMPA 1G2SA 1D5MC 1E1TA 2RKSA 3RLOA 1QVGA 4GNXA 3TMEA 4JI4L 4K5VA 1LYLA 5LMNQ 5M5YH 4C2MB 4KMUC 1EFID 4XQQA 3NUCA 2O4XA 4K2LA 1H9SB 5IOCA 2WAQG 3VA7A 3MXUA 3R2IA 1JT8A 1K28A 1A63A 2VQFL 5GAHC 3SEBA 4AYBG 4Q5VA 1Q1BA 3Q24A 3GTKB 1EZ6A 4GZYC 1WTWA 3E9IA 1J9OA 1EY0A 1QNKA 5C4JH 4KKSA 1QUQB 1ICFB 3OYYA 3RZDH 4X3UA 1TWAB 1SMYD 2V1CC 3WOEA 1XMQL 4DNIA 2PQAA 1EU4A 1UEBA 3MXNA 4U673 3MAQA 3K58A 3BVGA 1HZCA 3I2ZA 2AUKA 2PQEA 1N9WA 1V1PA 1HZAA 1PDQA 1KDAA 2Z6KA 4N9TA 1X3EA 4KN7C 1K3RA 2R92G 1F9SA 1N33Q 5IGDA 2JA9A 5FLMH 1WVLA 1EYDA 2A6HC 2L5TA 4G57A 1R4PB 2F0KA 1IBLL 3ITPA 4EQOA 1Y1WB 5AJ3L 4L5SA 4I7AA 3GTJB 3NQIA 1K0RA 4DV2L 4BBSB 1F9QA 1X3QA 1PRTF 4A3LG 4JI8Q 4YWMA 3N52A 1U0LA 1UEAB 1ML0D 2FMMA 2A73B 3ONAB 3CCQA 4IFDI 4PQXA 1SYDA 1E22A 1M90C 1E1OA 4JBWA 4B3RL 4X62Q 3F2DA 1CKNB 3PIP3 3STBC 1RHPA 2EYJA 3CP0A 3RLFA 3KDFB 1F2ZA 1SDFA 4RGOS 1TR5A 4OELB 3RD4A 5M3MB 3HOVH 1N34Q 4KHPQ 5EBDA 1SSOA 3FMCA 1UE5A 2M00A 4DV5L 4MNOA 5BN5A 1HR0L 1QVFA 1WCMH 2IX0A 2B2VA 4GNXB 1EZ8A 1VQEA 4JI2L 1BOSA 1SN8A 3J80i 1HCZA 1RTNA 3MEFA 5CORA 1CQFA 4JI0L 3SGIA 1I4GA 2GVBA 3K5MA 1V43A 3CAMA 1ESRA 3HKSA 3OTOQ 1GM5A 2VB3X 2OQKA 2JE6I 4BWGB 1SE8A 1FR3A 1Z6HA 2WAQE 4ZQ3A 3HOUB 1NBWA 2B8FA 3S17H 1TWHB 4F8MA 1Y1VH 4BY7G 1DJRD 1OO9B 4AYBE 5C4JB 1QOHA 3NK9A 1XNQL 2FHTA 1A2TA 3K7UC 1KNAA 1KDCA 3Q22A 4LF7L 1G91A 3J7A5 3IFTA 2PQAB 1UE7A 4H44C 1CT1D 3MXNB 3OPOA 4PG3A 4JV5Q 5NUCA 1Y1WG 4XIGS 3UDIA 1BR9A 1SNQA 1C48A 1GHKA 5ELNA 1ENCA 3EA6A 4HIMA 4DK0A 1PH5A 2K05A 3TS2A 4GN5A 3MFGA 1U4RA 2E76C 1EY6A 1L0YB 2I07B 1BBWA 4A93G 4UP9A 1CHPD 4P2CB 1IBML 1EQRA 4X65L 3F2BA 4YIJA 1A3TA 3S1NB 2ZJRA 4HR7B 5KGUA 5GQOA 2VUMH 3D8GA 4DR1L 3PSIA 2R7ZH 2Z9HA 4OHJA 2UXCL 3TQYA 3LGJA 4P74A 3OIQA 4JI7Q 3K8AA 1IYUA 1LTTD 5M5XH 1OXVA 1NMFA 4FO2A 1GUGA 1IKLA 1WI5A 2R93B 2PMZB 3H6MA 4CDCC 1KIXA 1CSPA 4PMBA 1CSQA 2AWNA 4C3JB 5K5PA 3BYTB 3HGBA 5FK9C 4NP5A 1B8AA 2UXBL 1L1OC 1RD9D 2PI2E 2F0QA 4YCVA 1C7YA 3HOVB 4A3DB 3HOZH 1G6PA 2R6GA 4N8X1 1LTLA 1JE5A 1HUNA 3HOUG 3M3YB 3MVVA 5JEAH 3RN2A 4HN7A 1LT3D 4K0KQ 4PZ7A 2Z4IA 1UE6A 4PNYA 3ULLA 4WJ4A 2HHHQ 2B8GA 1JR0D 1AFPA 2E2IB 2H4OA 3TZUA 1VQPA 3NHHA 1II3A 4DK1A 1SE4A 2E2HH 1WJJA 4DPGA 4RMFA 3GTLH 2Q2UA 2VB2X 2M2LA 2PW7A 2C5CA 1Y1VB 1B3QA 2D2CC 4A3MH 1PH7A 1IW7C 1E3PA 2WP8J 3T53B 3G6EA 1DONA 4QY7A 2P5ZX 2XRSD 1CA5A 1JWMD 2F0HA 2ZTCA 3E9HA 3I73A 2B2UC 1FNWA 4LUVA 3M9BA 3F8TA 1QNUA 3PO2H 3JC66 1PRTB 3IKJA 3CRKC 4JI4Q 2SNMA 3Q0AA 2K52A 1LTGD 2JA5H 4NXML 1JORA 1SNMA 3T4AC 3A0JA 4G7HC 4DV6L 1QJOA 2B2YC 5IIFA 2F0TA 4OO1H 4A3FB 3T1YL 5E4XA 1CHQD 3HOXH 1B53A 1I50B 2B63H 1EIHA 4C3JG 2IX3A 2QF7A 4GN4B 4HSVA 5CYUA 5CC4A 2R7ZB 4BXXG 3CMEA 3K6OA 1Q82C 1BCPD 2E2JB 3QIAA 4A3DG 1JE4A 1KL9A 2KA7A 3CHBD 5EQ0A 3A7AB 3KK7A 1QVCA 4OX9Q 3OW7A 1SNPA 3I7FA 3K5OA 5C44B 4L5RC 3BDOA 3HG9A 1GJXA 3I8ZA 3PUVA 3ERSX 1LT4D 1HQMC 3TSSA 4C3HB 4LF8L 3DEOA 2HDLA 1CKOA 4DR4L 4H02A 4KHZA 1HPCA 3UE1A 2WINB 3HOWG 1VQIA 2AQ3B 1PXUA 4XT3B 4XTCS 3J7ZC 4R4QA 3I4MH 2CH4A 1T5XD 4RA8A 3G71A 1I4HA 2GA4B 2MGSA 2SOBA 2LFNA 4A3CH 1TS2A 3DLLA 3W2DA 1Q12A 1L2FA 5HGQA 2KCTA 1NY4A 2K33A 2K5DA 5GROA 4IJHA 1O7YA 3J81i 4DR6L 5ELOA 1VQ5A 2RSNA 3PMFA 5FLXc 4TKOB 5A35A 2NZHA 5EPLA 4JI3Q 4EVOA 2J0TD 3AYHB 1XYIA 2F0OA 5A2QE 4OXPA 1PFNA 2RF4A 3K0YA 5DNFA 4OWTB 1R9TB 5CV7A 3C1EA 3ND9A 4KN4C 1Q8KA 3BU2A 3FP9A 5IYCH 5M5WH 3W1BA 1CZWA 5EPKA 2XVSA 2K75A 2N3SA 2HDMA 4XT1B 1TQOA 4A3FG 5ELEA 2RA4A 1YHAA 5I2XA 2ZXRA 1HTLD 3KLRA 3U9SA 1DM0B 1M1KC 5K36G 4JI2Q 1WD0A 3HRZC 3ND8A 2K6AA 1ZEQX 3MZ5A 1XMOQ 1HTPA 5CBEE 2NVYB 4ZLTF 4JBJA 1HNZL 1UE1A 3SK4A 1NSNS 2A68D 4IFDH 5J1ZA 3TBIB 4A3KB 3H0GH 4LFAQ 3HOXB 2B63B 3MFYA 5FJ8G 5KNCA 2VQEL 2EYMA 2PMZE 3LNNA 3I55A 4K6LA 3MHBA 5KNDA 1JJCB 3N6RA 3S14H 2C9OA 1D1KA 3MEHA 1CFMA 1VQHA 2L12A 4LF7Q 1N32L 2MHVA 5IP7G 1ET6A 4JOIA 3DWPA 1KLUD 4GKKL 1V1QA 3TP8A 2UXDL 3T1HL 3EIVA 2F0EA 3PF5A 4IO9A 1IHZA 2HCIA 1K73C 2SNSA 2A69D 2C35B 5D65A 1PYBA 5I9PA 1PYSB 1V9PA 3I4NH 5CR3A 2PYKA 3X3MA 3NTIA 1Z9FA 4P72A 1YEZA 3QB3A 5ELDA 1GUOA 3CQZB 1S5DD 1PTOH 4KTAA 1EOTA 4RKLA 2TSSA 2B2YA 2L9HA 1H95A 4X65Q 3NXWA 1E2WA 3KLSX 2RSOA 4CKBA 1SYCA 1PH4A 1Y8PB 3S2DH 2CQOA 5JJKA 2UXCQ 5KIXA 3EN2A 4TVAB 5HURA 1I6HH 1VDZA 2RCNA 3M7GA 2JA8G 2KCMA 4R8NA 4A3GH 2I5MX 4DAVA 5M3FB 3C46A 4I65A 2EQSA 1K83B 2H5XA 3NWTA 4R4OA 1J5EQ 4C1NI 3F1ZA 1G2TA 4MHEA 3JAMc 1A3UA 4A3KG 2SEBD 1PH3A 4OWWB 3C2PA 3A74A 1HUMA 1HFNA 2KHSA 2F0VA 1JQYD 2F3IA 3TRZA 2EYOA 5LMNW 1ASZA 3KFUA 3UDXA 1Q7YC 4DV4L 1QE6A 1LTRD 4DXFA 5C3EG 2JA6H 1OXXK 3G48A 3K81C 3V2TA 3D6CA 3SK8A 2YYZA 1WTXA 2BDNA 4HMJA 3NEMA 1XPOA 4NB3A 5C0XH 3FKIB 3MXGA 1SFOB 4MIUA 4X3KA 2YTVA 4FXGC 1MHWC 2B2VC 2KEEA 1S4ZA 4IOAA 3GTPH 3DUZA 3S14B 2KENA 4A3BB 3CCUA 3IFDA 4H0LC 2N88A 2NVQB 3EROA 1GUWA 4IUVA 3A5ZB 3S16H 1RIPA 4YCUA 3H09A 1I94Q 3PUZA 4O42A 1NR2A 2K01A 4ALPA 1X54A 1H9MA 1WTOA 4ZK9B 1VS0A 1KABA 2CCZA 4NXMQ 4ZYSA 1GUNA 4O1NA 1DD2A 4ZRZA 1STYA 5IT9L 1PFSA 2PW5A 1PTOB 2DUDA 5IWAL 1ASYA 1X32A 2EYLA 2KOLA 5M3FG 4YHHL 2FMCA 3KDFA 5EBCA 1PRTC 2F3VA 2VW9A 3LWEA 3A55A 3D3RA 4QJFA 1N8RC 2QILA 4KD3A 2CW0D 1GKHA 1BQQT 2QA4A 3S15H 3VR5A 2JEAI 5LHY1 3VYTA 3J80c 3S2HH 2JA7B 4POGA 3P75A 2ALYB 5GAGC 2QEXA 1G291 4A3GB 1STAA 3PIOA 5KEEA 1D5XC 1BCPF 3QWNA 3VA5A 2MUYA 1O80A 4DV7L 5DM73 5I6YA 1G51A 3GQBA 3OMGA 1TWGH 2DN8A 4LF8Q 5DM63 3FKIG 4DR4Q 3A54A 4IJLA 2UU9L 2F0IA 1EYCA 1RKNA 3M4QA 3JAMi 2YTXA 5I6WA 3EQLC 1X3PA 4R4CA 4KD4A 4P75A 4EGVA 2EXDA 3TZDA 1QB5D 5BR8Q 2IWHA 2JP1A 1KC8C 3CKIB 3W5OA 4AH6A 4RAUC 1MGSA 3M4PA 1AH9A 3BDCA 1K3BC 1I3QB 3OSOA 5JOBA 2JJQA 3S24A 1U9RA 3K5LA 2BH8A 4LFBL 3K7AH 1TS5A 2L1BA 2A69C 4HIOA 4ID6A 5IYDG 5IGGA 3H3VH 4R4IA 4M8AA 1D5ZC 1O7LA 1N36L 1HXYD 1SAPA 3E0JA 1KQSA 3A8JE 4BY1B 3A8IE 2LS01 1TU2B 2EOTA 4LK1C 4OWXB 2VL6A 1XJVA 2L55A 2B3GA 1VQ4A 4V190 1UUPA 4IQZA 1PTOD 3SVMA 1C0AA 1LTBD 2HQEA 2D5DA 2Y0SB 3PUXA 4IUTA 2YTYA 1WTPA 2Q8IB 2JA7G 1PYWD 1WOCA 3BZCA 2JYOA 3AU7A 4LW1A 4DAMA 5I9OA 2F0MA 1Q1EA 3VR3A 2A6ED 4XDXA 2BE5D 1ESFA 2A5HA 1W2BA 3CXCA 3RZOB 4DV1Q 3KBGA 2F0UA 3CCVA 4LMQD 3S1RH 3OMCA 3VDYA 1SYEA 2F4VL 1I4RA 2CHBD 4LAAA 2UUCL 3NWSA 3S15B 1YNXA 1YNNC 4LF4Q 2MQHA 5C3WA 4OL7A 2WV6D 1JCKB 1B70B 3H15A 5M5YB 4QB4A 3OWFA 4A3JH 1N32Q 4B3MQ 3F2UA 3M4YA 1S5BD 3MXPA 3HOYH 2K32A 2B29A 4GKKQ 2D62A 4BXXH 3TN2A 4CJ0B 4DXGA 1K0SA 2MO1A 1DOMA 5AFWA 4KY6A 1CQVA 3S1MH 4LFCL 2L11A 1STGA 5CMDA 3WOFA 4ME5A 1BNZA 4X3TA 3P7JA 4JYAQ 1WTHA 4GKJL 1ZYRC 2HIXA 3HZXA 3B6YA 2IY5B 1EY9A 3RZDB 4Z9CB 3CC2A 4IURA 1EFWA 4BY1G 4DKAC 1PFBA 1IZ6A 4KJOA 1FJGL 2XRQD 2WFWA 1TXYA 4H13C 1LT6D 1KRSA 3TREA 4A3IH 5CV4A 4EX5A 4BBSG 4BBRH 1SEBD 4C3IH 3W3AA 3A56A 1PH6A 1Q46A 4DV3L 2Y0SG 1BDOA 2OWOA 3QOLA 3CRLC 1LACA 3D6WA 2KHJA 4DNRB 1GO3E 5C4XH 3CCLA 3CC7A 3CU7A 4RKBA 4CBVA 3EBEA 5CV6A 1JICA 2K03A 2MPMA 1F2MA 3G7LA 3WWVA 2XTIA 1RCVD 1YVCA 5M3MG 2BA0A 4DR3L 4LWCA 2EJMA 1PMRA 2AUJD 2I5LX 3PO3H 4JC0A 2JN4A 5BN3A 4IPGA 3T51B 1B3AA 1BCPB 1XX8A 4R9WA 1JC7A 3HKZB 2QGQA 1MKHA 1HNWL 2M9VA 3BJUA 4JK1C 1KTKA 4PV1C 1GUTA 3GV6A 4ZUIA 4XXEA 2Z8LA 1Z47A 1KD1C 3SHLA 5K36H 1QILA 2F0SA 1M8AA 3NBIA 4RGMA 3S1RB 1SR3A 2ID0A 5J3BA 2N55A 3BZKA 3VR2A 1WCMB 1B4OA 4JBKA 2ZJPA 1VQ7A 4LF5L 1FGBD 2B2WC 4RHRA 1SMYC 1PFMA 3SXHA 5FJ8H 3J81c 3M85A 3HOYB 5CV9A 3HP3A 1X56A 4ABNA 3TP7A 1WTRA 1Z7TA 1K8OA 5C3XA 3NTHA 2O5IC 3K5NA 2RCFA 5H1SE 4QUFA 2IPKD 4AQYL 1HNXL 2OTJA 3S17B 4GS3A 5HGTA 2QKIC 4KK7A 4RHSA 2K5WA 5IWAQ 1GXDC 1EYGA 4A3EH 4JOIC 4HIDA 3J7AV 4YHHQ 3PUYA 3GP7A 4HAEA 2D0PA 4NW2A 3K57A 2J7ZA 5FLMG 1G6ZA 4DA2A 1NUCA 1QZHA 2AHOB 4CDDC 1KDBA 2JSOA 3S1QH 1EWCA 4A3IB 1WFQA 1B7YB 5T1IA 1PTOC 2HQLA 2G9HD 2EY2A 1BXTA 3IL8A 4NPSA 1EQQA 4B3TL 4CKCA 2K5HA 4DV0L 1SE2A 2NVTH 1W6KA 2XIWA 2EVBA 3CCJA 4G7ZC 2R93G 5EAYA 3LWUA 4DV7Q 2MFIA 3UE0A 2VQFQ 2IW3A 2CKZB 1IKMA 4JG2A 1Q90A 4WFN3 2KQ3A 1EWHA 1J6QA 2Q8RE 5G3LD 1NR4A 2Y0SE 4I7ZC 2FINB 2UU9Q 1YITA 2VUMB 1TWFH 5J22A 1HQRD 2EE1A 4CHTB 2UUBL 3HOVG 4OIJA 1SNOA 2JXMB 1HA6A 4QL5A 5E7NA 3NELA 2B2TC 5C5LA 3URYA 5M5XB 1A15A 1TY2A 4Y52H 2EZVA 1WCMG 5KYLA 5IYBH 1XMQQ 3ICEA 4HCSA 3FPPA 1HH2P 1QG7A 1S5CD 4GLAC 4OEMB 2RDHA 3FRPB 2BH2A 2F52A 3R2TA 2ZM6L 3HOZB 2YU9H 5C3EH 4PZ8A 4DUZL 1N36Q 1ENAA 3L0OA 2WB1B 1DYQA 1Y1VG 1ZKOA 3E6ZX 1YBYA 2EY5A 1V8QA 4EQ5A 4HMIA 4E6IA 3OW2A 4FXKC 4J8QA 2EJFC 1IBLQ 3QO2A 4U68A 3RMHA 1BBXC 2DY8A 4LF6L 5AJ3Q 4CDEC 4V0BA 3DMUA 4DV2Q 2E2HB 1ICWA 4MZ9A 1X6OA 4R1JA 1FVIA 3F2CA 3GTLB 3BVZA 1H9JA 1SNDA 4R8IA 4A3MB 4HSPA 1X65A 1YNJD 4PMCA 2ZTDA 1FNVA 1JWUD 1PTOF 2QDBA 3PV0A 1VQ6A 2BOSA 3GTGH 2F0NA 4B3RQ 4YWKA 3C1FA 1HZBA 3PGZA 1X9NA 5LMUL 2ZT9C 4P73A 3FHWA 1STNA 4L5QA 3J7AF 1O7IA 2F4VQ 3K0XA 4LUZA 3PO2B 4FF4A 2VUMG 1AW7A 4DV5Q 2R7ZG 1HR0Q 3T56B 1A6XA 4MTKA 4RFBA 3AB9A 2JA5B 1N33L 1L0XB 2FFKB 2LXJA 1XTCD 1UWVA 4KKTA 4JI0Q 1I5FA 1RTOA 4BA1I 4IALA 1EQTA 2AWOA 4LJZC 4EQPA 2B2WA 5C44G 3GTMH 4NMZA 1TT2A 3P20A 5FLXE 2QCPX 2AQ2B 1EL0A 1PZID 4KJNA 4TSSA 1VQLA 1JB3A 1S40A 2XWBB 4JI8L 3HKZE 1U4MA 4C3HG 1XNQQ 2WB1G 5JEAG 3G4SA 1VQBA 2HIVA 1SJHD 2HD3A 3R93A 4UY8C 1HHVA 3HEJA 3A8KE 4PMWA 2LXKA 1FJGQ 5IGEA 3SDZA 1D1IA 5DAUA 4DF7A 3J7YW 1N34L 1G8ZD 3ZJYC 1YI2A 2MO0A 3FEWX 4TQUS 3FVQA 2R7FA 3BZDB 4R4TA 1NTGA 4LNQA 2KEDA 3KLWA 4DV3Q 1PV4A 1U5KA 1VQ8A 3I4MB 1F9PA 1S5ED 5T1GA 2QDLA 3PIO3 3NE5B 3DWAA 5FOBB 3OTOL 4CDFC 4Y7NH 1IBMQ 4M1UB 1CUKA 2E74C 1NCVA 5JJZA 1QWYA 4N9PA 2NUCA 5IYDH 2X6LA 3NSWA 3DHQA 5EKLA 4DR2L 1LV9A 4DR1Q 3H3VC 3RNUA 4QGUA 1EYAA 2DNEA 2GVAA 2RDFA 3SK5A 3MTSA 2R92H 2UUAL 2RQXA 2XGTA 3PO2G 4GLXA 4K5WA 4UP7A 4OGQC 5JJLA 1OTCA 4RWSC 1MSHA 2EYHA 1LABA 2JA5G 4KI0A 2A6HD 5GAEC 4G4KA 3UDFA 2B2TA 4YY3L 1HNWQ 5IT9E 1TWCH 4BA2I 2ZXPA 5M5WB 5E1FA 2IL8A 5FLXL 2OTLA 1CTMA 5IODA 1PHJA 2KBNA 4QIWB 4POFA 4A3LH 2FXQA 2UXBQ 4JV5L 1I4QA 4MN3A 3HOXG 2N49A 2B63G 2PZUA 4C2MH 4IPCA 1MJCA 1TKWB 1BCPC 4IUUA 1QZGA 2K5NA 3QJYA 1A8VA 2K14A 2NN6G 4ZAIA 2DJFC 3STBD 1W6JA 4DUYL 3GTKH 1NMGA 1AP0A 4F7XA 4HJ5A 3CCSA 4O2DA 3GTMB 3DXJC 3H0GB 1CK1A 4AQYQ 1HNXQ 3J81j 1X3FA 2XNAC 4JI7L 1PZJD 3NPPA 4K8IA 1E2VA 1EOVA 4KLKA 1XXGA 4J6HA 1TWAH 3RLNA 1PLFA 4YCWA 2WAQB 2OCEA 1WD1A 1LM0A 1GHJA 1E7ZA 2K1BA 3MWYW 1LTAD 1YJWA 4AYBB 1PH1A 2J4XA 4L6TB 3QG1A 1B9MA 4JCVE 4A3CG 3CCRA 1D6EC 2JK8A 4X66L 2WB1E 1EIYB 1RODA 4BY7H 2E5LL 3CCEA 4DR5L
chains in the Genus database with same CATH topology
1PH8A 1VQOA 4LFCQ 4GOPA 2UUCL 4IPHA 1YNXA 4LF4Q 2MQHA 4JI1L 4A3MH 1PH7A 1SRUA 4GKJQ 3H15A 1B70B 1E3PA 2WP8J 3HOZG 4K0KL 3G6EA 2Z0SA 3D0FA 4QY7A 2D0OA 4A3JH 1N32Q 1KHIA 4DV6Q 1HZ9A 3E9HA 2ZTCA 1BVSA 1YJ9A 4B3MQ 3CCMA 2K50A 3PCOB 3HOYH 2B29A 3GDEA 4LUVA 3T1YQ 4X62L 4GKKQ 1JJGA 1Y1WH 3FKIH 2D62A 4HJ8A 1SFOH 4BXXH 3GTJH 3M9BA 4BBSH 3F8TA 4JI5Q 4DV1L 4GNXC 3KOJA 3PO2H 3I56A 3JC66 2MO1A 1VQFA 4KHPL 4JI4Q 4A75A 4HJAA 3S1MH 4LFCL 3KJPA 2Q2TA 2K52A 3NENA 4LF4L 4NXML 2JA5H 1P16A 4B3SL 4JYAQ 4GKJL 2HIXA 4DK3C 4A3BH 3B6YA 4X64L 1KRTA 4A93H 3A0JA 3K80C 5DLQE 1PH2A 1VQCA 2IY5B 4DV6L 3PF4A 4B3ML 4A3MG 3CC2A 2NVQH 3M7NA 1EFWA 4BY1G 4DKAC 5IT9c 3T1YL 4A3EG 1OXUA 2ATWA 3GTQH 5M3MH 1IZ6A 3HOXH 1FJGL 2WFWA 1X3GA 2B63H 5JEAJ 3KJOA 1TXYA 1KRSA 1FL0A 3TREA 4A3IH 2IX1A 4IFDG 2NN6I 4GN4B 2ZM6Q 2IHEA 3H0GG 4BXXG 3CMEA 4DR3Q 2K4KA 4EX5A 1Q82C 4A3DG 1KL9A 4DUZQ 4BBSG 4BBRH 4C3IH 1QVCA 1PH6A 2ES2A 4JYAL 4OX9Q 2JEBI 1Q46A 4DV3L 2Y0SG 3RN5A 1PVOA 2OWOA 3E0EA 3I7FA 4L5RC 4WJ3M 2KHJA 3ER0A 1PH9A 4A3BG 1VQKA 4JI6Q 1OXTA 1GO3E 4IPDA 4HJ9A 5C4XH 3CCLA 3CC7A 3PUVA 4LF6Q 1SROA 3EBEA 3ERSX 4OO1G 4DR6Q 3HOUH 2Z6KC 3WWVA 1TWHH 4LF8L 2XTIA 5M3MG 2RHSB 1CKOA 1YVCA 2BA0A 4H02A 2LSSA 3I4OA 4KHZA 4DR3L 4DR4L 1GVPA 3UE1A 4LWCA 2JA7H 1VQIA 3HOWG 3PO3H 2I5LX 2PI2A 4XTCS 3J7ZC 4JC0A 4R4QA 1K8GA 3DM3A 4OX9L 3I4MH 3I4NG 4IPGA 4A4IA 3G71A 1VQMA 2GN5A 4LF5Q 3GTOH 3U4VA 4A3CH 2QGQA 1MKHA 1HNWL 1Q81C 1KXLA 1GD7A 3DLLA 1Q12A 3BJUA 1L2FA 4P71A 5IYBG 4LF9L 5HGQA 2KCTA 4NXNQ 1NY4A 5LMUQ 1YJNA 1Z47A 1KD1C 5GROA 1BKBA 4IJHA 3J81i 4DR6L 5ELOA 1VQ5A 5FLXc 2CWPA 3W1GA 1QUQA 2NZHA 1SR3A 2ID0A 5J3BA 4JI3Q 3AYHB 1L1OB 1VQNA 3BZKA 4OXPA 2RF4A 4GOPB 4OWTB 2I0QA 1WYDA 4JBKA 2Q2IA 2ZJPA 1VQ7A 4LF5L 1Q8KA 4MTNA 3BU2A 3FP9A 5IYCH 5M5WH 3W1BA 3I4MG 4A3GG 4AIMA 2DGYA 1HNZQ 5FJ8H 3J81c 2K75A 2N3SA 3M85A 3S1NH 3D31A 1X56A 1I3QH 4A3FG 1YHAA 1S3OA 2IHFA 4GN3B 2VQEQ 2E8GA 1Q86C 3CW2C 5H1SE 1C9OA 4AQYL 2N78A 3AQQA 1M1KC 3IRBA 1HNXL 4LUOA 2OTJA 5K36G 4JI3L 1VQ9A 4GS3A 4JI2Q 1A62A 5HY6A 4B3TQ 2R93H 3UDGA 4QIWE 3RR5A 4DR7Q 1AE2A 1KAWA 4DV0Q 1XMOQ 5IWAQ 4BY1H 1EYGA 4A3EH 4JOIC 2HHHL 4HIDA 2ZJQA 1X55A 3PUYA 3GO5A 1XTDA 4YHHQ 1D8LA 1YIJA 4JBJA 3L7ZC 1HNZL 1IBKQ 1UE1A 4C3JH 2CFMA 2D0PA 2JA6G 2KHIA 5FLMG 2UXDQ 3T1HQ 4DAYB 5IYCG 3CPFA 3H0GH 4LFAQ 5IP9H 2MNAA 2AHOB 1QZHA 3S1QH 4A3DH 5FJ8G 2VNUD 4PZ6A 5IE8A 3CPWA 1WFQA 2VQEL 2K5VA 1B7YB 2PMZE 5C0XG 3I55A 3M3YH 2HQLA 1JJCB 2UUBQ 3S14H 4JBMA 1XNRQ 4NPSA 1SMXA 1EQQA 4B3TL 2I5HA 1YHQA 4OO1I 4APVA 1XMOL 2K5HA 4DV0L 2NVTH 3A5UA 1VQHA 4LF7Q 2E2IH 1N32L 1CKNA 1VQDA 2RHQB 3ULPA 1SLJA 5IP7G 3CCJA 4QQBX 2R93G 5EAYA 4O0AA 4JOIA 2MFIA 3UE0A 4DV7Q 2VQFQ 2CKZB 4JG2A 1VCIA 1OXSC 3L2PA 3RZOH 1V1QA 1J6QA 4GKKL 3T1HL 2UXDL 3EIVA 2A8VA 4LFAL 2Y0SE 4DR2Q 1DGSA 2CWAA 3PF5A 2BA1A 4IO9A 1PA6A 2NZOA 4JI5L 3HOWH 2UU9Q 1E1TA 1YITA 1K73C 1TWFH 2UUAQ 2C35B 3RLOA 1QVGA 1PYBA 4GNXA 4JI4L 1PYSB 5IP9G 1LYLA 1V9PA 3I4NH 3HOVG 5LMNQ 2UUBL 5M5YH 1Z9FA 1VQJA 1YEZA 2AKWB 2VZAA 4ME3A 4P72A 4QL5A 5E7NA 3NELA 4Y52H 1WCMG 5IYBH 4YY3Q 1XMQQ 3ICEA 2WAQG 1JT8A 4YWLA 1A63A 2VQFL 5GAHC 1H95A 1HH2P 4X65Q 4AYBG 2YV5A 1Q1BA 4GLAC 1PH4A 3S2DH 3E9IA 2CQOA 2BH2A 3CD6A 5JJKA 2UXCQ 2F52A 4A76A 1VQGA 2ZM6L 3EN2A 4TVAB 1I6HH 2RCNA 4RG1A 2YU9H 5C3EH 4PZ8A 5C4JH 4DUZL 4DV4Q 1N36Q 2JA8G 2KCMA 1QUQB 3L0OA 3OYYA 4A3GH 4IFDJ 1Y1VG 3RZDH 2I5MX 2V1CC 1YBYA 1XMQL 4DNIA 2EQSA 1YZ6A 4A3FH 2PQAA 4EQ5A 2H5XA 3KF6A 4DUYQ 4HIKA 4R4OA 3OW2A 1UEBA 1J5EQ 1EUJA 1I50H 3F1ZA 1IBLQ 4JI6L 3JAMc 4LF6L 4GLVB 1HZCA 5AJ3Q 3I2ZA 3TS0A 4UP8A 4A3KG 4DV2Q 1PH3A 4OWWB 2E2JH 3A74A 4MZ9A 1LUZA 1X6OA 4R1JA 1FVIA 1S72A 3AEVA 1N9WA 3F2CA 1HZAA 2F3IA 3TRZA 2Z6KA 5LMNW 1ASZA 3KFUA 1X3EA 3UDXA 1K3RA 1Q7YC 4DV4L 2R92G 1N33Q 1HJPA 5C44H 1X65A 2JA9A 5C3EG 3CMAA 2JA6H 1OXXK 2L15A 2ZTDA 3G48A 3K81C 5C0XI 3PV0A 5FLMH 2A1AA 1VQ6A 3GTGH 4B3RQ 2YYZA 4YWKA 2R7DA 3U58A 1J5EL 3NEMA 1IBLL 1XPOA 1HZBA 3PGZA 1X9NA 3M4OH 4NXNL 4NB3A 5LMUL 4X66Q 4C3HH 5AJ3L 4P73A 3FHWA 1AE3A 2E5LQ 4L5SA 1K0RA 2YTVA 4L5QA 4DV2L 5JJIA 5GADC 1O7IA 2IT1A 4DR5Q 1JB7A 2F4VQ 4UPAA 3K0XA 4LUZA 1K8AC 4A3LG 4JI8Q 2VUMG 4YWMA 4JI1Q 4DV5Q 1NJIC 1HR0Q 2R7ZG 4IOAA 3GTPH 1U0LA 2KENA 1N33L 5IP7H 2EIFA 2LXJA 1MJEA 3CCUA 3CCQA 1VQAA 4IFDI 1UWVA 1E22A 1M90C 4JI0Q 1E1OA 1I5FA 4JBWA 4BA1I 2AWOA 4L5TA 3PIPA 4X62Q 3F2DA 1P8LA 4B3RL 1CKNB 3U50C 5C44G 3A5ZB 3STBC 3CP0A 1XPRA 1EWIA 3S16H 3RLFA 3GTMH 1RIPA 3KDFB 3Q8DA 4YCUA 1I94Q 3PUZA 3HOVH 4ALPA 1X54A 1N34Q 1VQLA 4KHPQ 2JQOA 1S40A 1UE5A 1EIFA 1VS0A 4JI8L 2CCZA 3HKZE 4NXMQ 4B3SQ 4DV5L 4MNOA 4HJ7A 1HR0L 1QVFA 1XPUA 1WCMH 2IX0A 1R9TH 4GNXB 4X64Q 1XNQQ 1VQEA 4JI2L 2AMCB 1SN8A 1PFSA 3J80i 2ASBA 2WB1G 2DUDA 5JEAG 3G4SA 4DR7L 1VQBA 3MEFA 5IWAL 1ASYA 2HIVA 4JI0L 3SGIA 2GVBA 4UY8C 5M3FG 4YHHL 1V43A 3CAMA 3KDFA 3HKSA 3OTOQ 4PMWA 2LXKA 3HKZG 1GM5A 1IBKL 2VW9A 1FJGQ 1JMCA 1IXRA 2OQ0A 1I94L 2OQKA 2JE6I 4QJFA 1N8RC 1SE8A 1N34L 3ZJYC 1GKHA 2WAQE 2JA8H 2A19A 1NBWA 2QA4A 1YI2A 4J15A 2MO0A 3S15H 4TQUS 2JEAI 3S17H 2R7FA 4R4TA 4IOCA 1NTGA 3J80c 1Y1VH 1HR0W 5IY0A 4BY7G 3S2HH 1JJ2A 1T9HA 4AYBE 4LNQA 2HT1A 4POGA 1XNQL 3KLWA 4DV3Q 2ALYB 5GAGC 2QEXA 1G291 1U5KA 1PV4A 1VQ8A 1XNRL 3K7UC 4X6AH 2NVYH 3PIOA 5C0XJ 1L0WA 4LF7L 2VS1A 4OONA 4A3JG 1W3SA 3J7A5 2PNHA 3OTOL 4DV7L 4Y7NH 4A3KH 1IBMQ 1CUKA 1G51A 2PQAB 1UE7A 3KF6B 1CKMA 3HOYG 5IYDH 3MXNB 1TWGH 4PG3A 4DR2L 4LF8Q 4DR1Q 4JV5Q 1Y1WG 3FKIG 1BBUA 3RNUA 4QGUA 4DR4Q 4XIGS 4IJLA 2GVAA 2UU9L 4LFBQ 2R92H 3UDIA 2UUAL 3M4QA 3JAMi 2YTXA 2XGTA 3PO2G 5ELNA 5LMNL 4GLXA 1K9MC 4R4CA 4UP7A 1IYJB 4P75A 5JJLA 1OTCA 4HIMA 2EXDA 1PH5A 2JA5G 4KI0A 3TS2A 5GAEC 4GN5A 3UDFA 5BR8Q 4YY3L 1HNWQ 2ZTEA 1TWCH 1KC8C 4BA2I 4LF9Q 1BBWA 3W5OA 4A93G 4AH6A 4UP9A 2OTLA 3M4PA 1AH9A 1IBML 1PHJA 1EQRA 2KBNA 2VY3A 4X65L 4POFA 3F2BA 3H3VI 2ZJRA 3HFZB 4A3LH 3U4ZA 2FXQA 5GQOA 3S24A 2VUMH 2JJQA 2UXBQ 3AFPA 4DR1L 4JV5L 3PSIA 2R7ZH 3HOXG 2BH8A 4LFBL 2N49A 3K7AH 2B63G 2UXCL 3TQYA 4C2MH 4HIOA 5IYDG 3LGJA 4IPCA 4A3IG 4R4IA 4P74A 1MJCA 3H3VH 3CQZH 4DK6C 4JI7Q 3K8AA 5M5XH 1OXVA 1QZGA 1N36L 2K5NA 1NMFA 1Y14B 1A8VA 2Q2HA 4BBRG 2K14A 1WI5A 1IL2A 2NN6G 3CF5A 1KIXA 5BR8L 1KQSA 1CSPA 1CSQA 1FGUA 3STBD 2N8NA 2AWNA 1D7QA 2NVXH 4DUYL 3GTKH 1NMGA 1MIUA 4HJ5A 4OWXB 3CCSA 4O2DA 4FDBA 2VL6A 1RL2A 1XJVA 1B8AA 1E24A 2UXBL 1L1OC 2B3GA 1VQ4A 4YCVA 1A0IA 2PI2E 1C7YA 5C4XG 4AQYQ 4GOPC 3HOZH 1G6PA 2R6GA 3NBHB 1HNXQ 3TEHB 1LTLA 1JE5A 3J81j 1NE3A 1X3FA 2UUCQ 3HOUG 4JI7L 1C0AA 1EOVA 4KLKA 3RN2A 1TWAH 4K0KQ 3PUXA 4PZ7A 2YTYA 4YCWA 3RLNA 2JA7G 5M3FH 1UE6A 1WOCA 2OCEA 3BZCA 3ULLA 1LM0A 3PO3G 4WJ4A 2HHHQ 1E7ZA 1K83H 4LW1A 4DAMA 1Q1EA 1YJWA 3KF8B 1PH1A 3CC4A 1YHBA 1VQPA 3KYHC 4JCVE 3ULJA 3CCRA 4A3CG 1W2BA 2E2HH 3CXCA 2JK8A 4X66L 1WJJA 4DV1Q 2WB1E 3GD7A 1EIYB 4DPGA 4BY7H 3AFQA 2E5LL 3PUWA 4RMFA 3CCVA 2Q2UA 3GTLH 3S1RH 1L1OA 3CCEA 3VDYA 4DR5L 2F4VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH8 A;  1VQO A;  4LFC Q;  4GOP A;  2UUC L;  4IPH A;  1YNX A;  4LF4 Q;  2MQH A;  4JI1 L;  4A3M H;  1PH7 A;  1SRU A;  4GKJ Q;  3H15 A;  1B70 B;  1E3P A;  2WP8 J;  3HOZ G;  4K0K L;  3G6E A;  2Z0S A;  3D0F A;  4QY7 A;  2D0O A;  4A3J H;  1N32 Q;  1KHI A;  4DV6 Q;  1HZ9 A;  3E9H A;  2ZTC A;  1BVS A;  1YJ9 A;  4B3M Q;  3CCM A;  2K50 A;  3PCO B;  3HOY H;  2B29 A;  3GDE A;  4LUV A;  3T1Y Q;  4X62 L;  4GKK Q;  1JJG A;  1Y1W H;  3FKI H;  2D62 A;  4HJ8 A;  1SFO H;  4BXX H;  3GTJ H;  3M9B A;  4BBS H;  3F8T A;  4JI5 Q;  4DV1 L;  4GNX C;  3KOJ A;  3PO2 H;  3I56 A;  3JC6 6;  2MO1 A;  1VQF A;  4KHP L;  4JI4 Q;  4A75 A;  4HJA A;  3S1M H;  4LFC L;  3KJP A;  2Q2T A;  2K52 A;  3NEN A;  4LF4 L;  4NXM L;  2JA5 H;  1P16 A;  4B3S L;  4JYA Q;  4GKJ L;  2HIX A;  4DK3 C;  4A3B H;  3B6Y A;  4X64 L;  1KRT A;  4A93 H;  3A0J A;  3K80 C;  5DLQ E;  1PH2 A;  1VQC A;  2IY5 B;  4DV6 L;  3PF4 A;  4B3M L;  4A3M G;  3CC2 A;  2NVQ H;  3M7N A;  1EFW A;  4BY1 G;  4DKA C;  5IT9 c;  3T1Y L;  4A3E G;  1OXU A;  2ATW A;  3GTQ H;  5M3M H;  1IZ6 A;  3HOX H;  1FJG L;  2WFW A;  1X3G A;  2B63 H;  5JEA J;  3KJO A;  1TXY A;  1KRS A;  1FL0 A;  3TRE A;  4A3I H;  2IX1 A;  4IFD G;  2NN6 I;  4GN4 B;  2ZM6 Q;  2IHE A;  3H0G G;  4BXX G;  3CME A;  4DR3 Q;  2K4K A;  4EX5 A;  1Q82 C;  4A3D G;  1KL9 A;  4DUZ Q;  4BBS G;  4BBR H;  4C3I H;  1QVC A;  1PH6 A;  2ES2 A;  4JYA L;  4OX9 Q;  2JEB I;  1Q46 A;  4DV3 L;  2Y0S G;  3RN5 A;  1PVO A;  2OWO A;  3E0E A;  3I7F A;  4L5R C;  4WJ3 M;  2KHJ A;  3ER0 A;  1PH9 A;  4A3B G;  1VQK A;  4JI6 Q;  1OXT A;  1GO3 E;  4IPD A;  4HJ9 A;  5C4X H;  3CCL A;  3CC7 A;  3PUV A;  4LF6 Q;  1SRO A;  3EBE A;  3ERS X;  4OO1 G;  4DR6 Q;  3HOU H;  2Z6K C;  3WWV A;  1TWH H;  4LF8 L;  2XTI A;  5M3M G;  2RHS B;  1CKO A;  1YVC A;  2BA0 A;  4H02 A;  2LSS A;  3I4O A;  4KHZ A;  4DR3 L;  4DR4 L;  1GVP A;  3UE1 A;  4LWC A;  2JA7 H;  1VQI A;  3HOW G;  3PO3 H;  2I5L X;  2PI2 A;  4XTC S;  3J7Z C;  4JC0 A;  4R4Q A;  1K8G A;  3DM3 A;  4OX9 L;  3I4M H;  3I4N G;  4IPG A;  4A4I A;  3G71 A;  1VQM A;  2GN5 A;  4LF5 Q;  3GTO H;  3U4V A;  4A3C H;  2QGQ A;  1MKH A;  1HNW L;  1Q81 C;  1KXL A;  1GD7 A;  3DLL A;  1Q12 A;  3BJU A;  1L2F A;  4P71 A;  5IYB G;  4LF9 L;  5HGQ A;  2KCT A;  4NXN Q;  1NY4 A;  5LMU Q;  1YJN A;  1Z47 A;  1KD1 C;  5GRO A;  1BKB A;  4IJH A;  3J81 i;  4DR6 L;  5ELO A;  1VQ5 A;  5FLX c;  2CWP A;  3W1G A;  1QUQ A;  2NZH A;  1SR3 A;  2ID0 A;  5J3B A;  4JI3 Q;  3AYH B;  1L1O B;  1VQN A;  3BZK A;  4OXP A;  2RF4 A;  4GOP B;  4OWT B;  2I0Q A;  1WYD A;  4JBK A;  2Q2I A;  2ZJP A;  1VQ7 A;  4LF5 L;  1Q8K A;  4MTN A;  3BU2 A;  3FP9 A;  5IYC H;  5M5W H;  3W1B A;  3I4M G;  4A3G G;  4AIM A;  2DGY A;  1HNZ Q;  5FJ8 H;  3J81 c;  2K75 A;  2N3S A;  3M85 A;  3S1N H;  3D31 A;  1X56 A;  1I3Q H;  4A3F G;  1YHA A;  1S3O A;  2IHF A;  4GN3 B;  2VQE Q;  2E8G A;  1Q86 C;  3CW2 C;  5H1S E;  1C9O A;  4AQY L;  2N78 A;  3AQQ A;  1M1K C;  3IRB A;  1HNX L;  4LUO A;  2OTJ A;  5K36 G;  4JI3 L;  1VQ9 A;  4GS3 A;  4JI2 Q;  1A62 A;  5HY6 A;  4B3T Q;  2R93 H;  3UDG A;  4QIW E;  3RR5 A;  4DR7 Q;  1AE2 A;  1KAW A;  4DV0 Q;  1XMO Q;  5IWA Q;  4BY1 H;  1EYG A;  4A3E H;  4JOI C;  2HHH L;  4HID A;  2ZJQ A;  1X55 A;  3PUY A;  3GO5 A;  1XTD A;  4YHH Q;  1D8L A;  1YIJ A;  4JBJ A;  3L7Z C;  1HNZ L;  1IBK Q;  1UE1 A;  4C3J H;  2CFM A;  2D0P A;  2JA6 G;  2KHI A;  5FLM G;  2UXD Q;  3T1H Q;  4DAY B;  5IYC G;  3CPF A;  3H0G H;  4LFA Q;  5IP9 H;  2MNA A;  2AHO B;  1QZH A;  3S1Q H;  4A3D H;  5FJ8 G;  2VNU D;  4PZ6 A;  5IE8 A;  3CPW A;  1WFQ A;  2VQE L;  2K5V A;  1B7Y B;  2PMZ E;  5C0X G;  3I55 A;  3M3Y H;  2HQL A;  1JJC B;  2UUB Q;  3S14 H;  4JBM A;  1XNR Q;  4NPS A;  1SMX A;  1EQQ A;  4B3T L;  2I5H A;  1YHQ A;  4OO1 I;  4APV A;  1XMO L;  2K5H A;  4DV0 L;  2NVT H;  3A5U A;  1VQH A;  4LF7 Q;  2E2I H;  1N32 L;  1CKN A;  1VQD A;  2RHQ B;  3ULP A;  1SLJ A;  5IP7 G;  3CCJ A;  4QQB X;  2R93 G;  5EAY A;  4O0A A;  4JOI A;  2MFI A;  3UE0 A;  4DV7 Q;  2VQF Q;  2CKZ B;  4JG2 A;  1VCI A;  1OXS C;  3L2P A;  3RZO H;  1V1Q A;  1J6Q A;  4GKK L;  3T1H L;  2UXD L;  3EIV A;  2A8V A;  4LFA L;  2Y0S E;  4DR2 Q;  1DGS A;  2CWA A;  3PF5 A;  2BA1 A;  4IO9 A;  1PA6 A;  2NZO A;  4JI5 L;  3HOW H;  2UU9 Q;  1E1T A;  1YIT A;  1K73 C;  1TWF H;  2UUA Q;  2C35 B;  3RLO A;  1QVG A;  1PYB A;  4GNX A;  4JI4 L;  1PYS B;  5IP9 G;  1LYL A;  1V9P A;  3I4N H;  3HOV G;  5LMN Q;  2UUB L;  5M5Y H;  1Z9F A;  1VQJ A;  1YEZ A;  2AKW B;  2VZA A;  4ME3 A;  4P72 A;  4QL5 A;  5E7N A;  3NEL A;  4Y52 H;  1WCM G;  5IYB H;  4YY3 Q;  1XMQ Q;  3ICE A;  2WAQ G;  1JT8 A;  4YWL A;  1A63 A;  2VQF L;  5GAH C;  1H95 A;  1HH2 P;  4X65 Q;  4AYB G;  2YV5 A;  1Q1B A;  4GLA C;  1PH4 A;  3S2D H;  3E9I A;  2CQO A;  2BH2 A;  3CD6 A;  5JJK A;  2UXC Q;  2F52 A;  4A76 A;  1VQG A;  2ZM6 L;  3EN2 A;  4TVA B;  1I6H H;  2RCN A;  4RG1 A;  2YU9 H;  5C3E H;  4PZ8 A;  5C4J H;  4DUZ L;  4DV4 Q;  1N36 Q;  2JA8 G;  2KCM A;  1QUQ B;  3L0O A;  3OYY A;  4A3G H;  4IFD J;  1Y1V G;  3RZD H;  2I5M X;  2V1C C;  1YBY A;  1XMQ L;  4DNI A;  2EQS A;  1YZ6 A;  4A3F H;  2PQA A;  4EQ5 A;  2H5X A;  3KF6 A;  4DUY Q;  4HIK A;  4R4O A;  3OW2 A;  1UEB A;  1J5E Q;  1EUJ A;  1I50 H;  3F1Z A;  1IBL Q;  4JI6 L;  3JAM c;  4LF6 L;  4GLV B;  1HZC A;  5AJ3 Q;  3I2Z A;  3TS0 A;  4UP8 A;  4A3K G;  4DV2 Q;  1PH3 A;  4OWW B;  2E2J H;  3A74 A;  4MZ9 A;  1LUZ A;  1X6O A;  4R1J A;  1FVI A;  1S72 A;  3AEV A;  1N9W A;  3F2C A;  1HZA A;  2F3I A;  3TRZ A;  2Z6K A;  5LMN W;  1ASZ A;  3KFU A;  1X3E A;  3UDX A;  1K3R A;  1Q7Y C;  4DV4 L;  2R92 G;  1N33 Q;  1HJP A;  5C44 H;  1X65 A;  2JA9 A;  5C3E G;  3CMA A;  2JA6 H;  1OXX K;  2L15 A;  2ZTD A;  3G48 A;  3K81 C;  5C0X I;  3PV0 A;  5FLM H;  2A1A A;  1VQ6 A;  3GTG H;  4B3R Q;  2YYZ A;  4YWK A;  2R7D A;  3U58 A;  1J5E L;  3NEM A;  1IBL L;  1XPO A;  1HZB A;  3PGZ A;  1X9N A;  3M4O H;  4NXN L;  4NB3 A;  5LMU L;  4X66 Q;  4C3H H;  5AJ3 L;  4P73 A;  3FHW A;  1AE3 A;  2E5L Q;  4L5S A;  1K0R A;  2YTV A;  4L5Q A;  4DV2 L;  5JJI A;  5GAD C;  1O7I A;  2IT1 A;  4DR5 Q;  1JB7 A;  2F4V Q;  4UPA A;  3K0X A;  4LUZ A;  1K8A C;  4A3L G;  4JI8 Q;  2VUM G;  4YWM A;  4JI1 Q;  4DV5 Q;  1NJI C;  1HR0 Q;  2R7Z G;  4IOA A;  3GTP H;  1U0L A;  2KEN A;  1N33 L;  5IP7 H;  2EIF A;  2LXJ A;  1MJE A;  3CCU A;  3CCQ A;  1VQA A;  4IFD I;  1UWV A;  1E22 A;  1M90 C;  4JI0 Q;  1E1O A;  1I5F A;  4JBW A;  4BA1 I;  2AWO A;  4L5T A;  3PIP A;  4X62 Q;  3F2D A;  1P8L A;  4B3R L;  1CKN B;  3U50 C;  5C44 G;  3A5Z B;  3STB C;  3CP0 A;  1XPR A;  1EWI A;  3S16 H;  3RLF A;  3GTM H;  1RIP A;  3KDF B;  3Q8D A;  4YCU A;  1I94 Q;  3PUZ A;  3HOV H;  4ALP A;  1X54 A;  1N34 Q;  1VQL A;  4KHP Q;  2JQO A;  1S40 A;  1UE5 A;  1EIF A;  1VS0 A;  4JI8 L;  2CCZ A;  3HKZ E;  4NXM Q;  4B3S Q;  4DV5 L;  4MNO A;  4HJ7 A;  1HR0 L;  1QVF A;  1XPU A;  1WCM H;  2IX0 A;  1R9T H;  4GNX B;  4X64 Q;  1XNQ Q;  1VQE A;  4JI2 L;  2AMC B;  1SN8 A;  1PFS A;  3J80 i;  2ASB A;  2WB1 G;  2DUD A;  5JEA G;  3G4S A;  4DR7 L;  1VQB A;  3MEF A;  5IWA L;  1ASY A;  2HIV A;  4JI0 L;  3SGI A;  2GVB A;  4UY8 C;  5M3F G;  4YHH L;  1V43 A;  3CAM A;  3KDF A;  3HKS A;  3OTO Q;  4PMW A;  2LXK A;  3HKZ G;  1GM5 A;  1IBK L;  2VW9 A;  1FJG Q;  1JMC A;  1IXR A;  2OQ0 A;  1I94 L;  2OQK A;  2JE6 I;  4QJF A;  1N8R C;  1SE8 A;  1N34 L;  3ZJY C;  1GKH A;  2WAQ E;  2JA8 H;  2A19 A;  1NBW A;  2QA4 A;  1YI2 A;  4J15 A;  2MO0 A;  3S15 H;  4TQU S;  2JEA I;  3S17 H;  2R7F A;  4R4T A;  4IOC A;  1NTG A;  3J80 c;  1Y1V H;  1HR0 W;  5IY0 A;  4BY7 G;  3S2H H;  1JJ2 A;  1T9H A;  4AYB E;  4LNQ A;  2HT1 A;  4POG A;  1XNQ L;  3KLW A;  4DV3 Q;  2ALY B;  5GAG C;  2QEX A;  1G29 1;  1U5K A;  1PV4 A;  1VQ8 A;  1XNR L;  3K7U C;  4X6A H;  2NVY H;  3PIO A;  5C0X J;  1L0W A;  4LF7 L;  2VS1 A;  4OON A;  4A3J G;  1W3S A;  3J7A 5;  2PNH A;  3OTO L;  4DV7 L;  4Y7N H;  4A3K H;  1IBM Q;  1CUK A;  1G51 A;  2PQA B;  1UE7 A;  3KF6 B;  1CKM A;  3HOY G;  5IYD H;  3MXN B;  1TWG H;  4PG3 A;  4DR2 L;  4LF8 Q;  4DR1 Q;  4JV5 Q;  1Y1W G;  3FKI G;  1BBU A;  3RNU A;  4QGU A;  4DR4 Q;  4XIG S;  4IJL A;  2GVA A;  2UU9 L;  4LFB Q;  2R92 H;  3UDI A;  2UUA L;  3M4Q A;  3JAM i;  2YTX A;  2XGT A;  3PO2 G;  5ELN A;  5LMN L;  4GLX A;  1K9M C;  4R4C A;  4UP7 A;  1IYJ B;  4P75 A;  5JJL A;  1OTC A;  4HIM A;  2EXD A;  1PH5 A;  2JA5 G;  4KI0 A;  3TS2 A;  5GAE C;  4GN5 A;  3UDF A;  5BR8 Q;  4YY3 L;  1HNW Q;  2ZTE A;  1TWC H;  1KC8 C;  4BA2 I;  4LF9 Q;  1BBW A;  3W5O A;  4A93 G;  4AH6 A;  4UP9 A;  2OTL A;  3M4P A;  1AH9 A;  1IBM L;  1PHJ A;  1EQR A;  2KBN A;  2VY3 A;  4X65 L;  4POF A;  3F2B A;  3H3V I;  2ZJR A;  3HFZ B;  4A3L H;  3U4Z A;  2FXQ A;  5GQO A;  3S24 A;  2VUM H;  2JJQ A;  2UXB Q;  3AFP A;  4DR1 L;  4JV5 L;  3PSI A;  2R7Z H;  3HOX G;  2BH8 A;  4LFB L;  2N49 A;  3K7A H;  2B63 G;  2UXC L;  3TQY A;  4C2M H;  4HIO A;  5IYD G;  3LGJ A;  4IPC A;  4A3I G;  4R4I A;  4P74 A;  1MJC A;  3H3V H;  3CQZ H;  4DK6 C;  4JI7 Q;  3K8A A;  5M5X H;  1OXV A;  1QZG A;  1N36 L;  2K5N A;  1NMF A;  1Y14 B;  1A8V A;  2Q2H A;  4BBR G;  2K14 A;  1WI5 A;  1IL2 A;  2NN6 G;  3CF5 A;  1KIX A;  5BR8 L;  1KQS A;  1CSP A;  1CSQ A;  1FGU A;  3STB D;  2N8N A;  2AWN A;  1D7Q A;  2NVX H;  4DUY L;  3GTK H;  1NMG A;  1MIU A;  4HJ5 A;  4OWX B;  3CCS A;  4O2D A;  4FDB A;  2VL6 A;  1RL2 A;  1XJV A;  1B8A A;  1E24 A;  2UXB L;  1L1O C;  2B3G A;  1VQ4 A;  4YCV A;  1A0I A;  2PI2 E;  1C7Y A;  5C4X G;  4AQY Q;  4GOP C;  3HOZ H;  1G6P A;  2R6G A;  3NBH B;  1HNX Q;  3TEH B;  1LTL A;  1JE5 A;  3J81 j;  1NE3 A;  1X3F A;  2UUC Q;  3HOU G;  4JI7 L;  1C0A A;  1EOV A;  4KLK A;  3RN2 A;  1TWA H;  4K0K Q;  3PUX A;  4PZ7 A;  2YTY A;  4YCW A;  3RLN A;  2JA7 G;  5M3F H;  1UE6 A;  1WOC A;  2OCE A;  3BZC A;  3ULL A;  1LM0 A;  3PO3 G;  4WJ4 A;  2HHH Q;  1E7Z A;  1K83 H;  4LW1 A;  4DAM A;  1Q1E A;  1YJW A;  3KF8 B;  1PH1 A;  3CC4 A;  1YHB A;  1VQP A;  3KYH C;  4JCV E;  3ULJ A;  3CCR A;  4A3C G;  1W2B A;  2E2H H;  3CXC A;  2JK8 A;  4X66 L;  1WJJ A;  4DV1 Q;  2WB1 E;  3GD7 A;  1EIY B;  4DPG A;  4BY7 H;  3AFQ A;  2E5L L;  3PUW A;  4RMF A;  3CCV A;  2Q2U A;  3GTL H;  3S1R H;  1L1O A;  3CCE A;  3VDY A;  4DR5 L;  2F4V L; 
#chains in the Genus database with same CATH topology
 1VQO A;  4FF2 A;  4GOP A;  2KCN A;  1DOK A;  4JI1 L;  1JOQ A;  5EKI A;  4ULL A;  2HCC A;  3I4N B;  1SRU A;  4K0K L;  1CA6 A;  1KHI A;  4DV6 Q;  1HZ9 A;  1YJ9 A;  4UHV A;  3CCM A;  2K50 A;  4RH6 A;  2VXW A;  3GDE A;  5E3F A;  3T1Y Q;  1Y1W H;  1RJT A;  5FO7 B;  1K8M A;  3GTJ H;  4BBS H;  1CI3 M;  3NTK A;  3RUZ A;  3I56 A;  3S2D B;  2PZW A;  4HJA A;  3NEN A;  1F77 A;  1I6H B;  4B3S L;  1TII D;  2H1E A;  4XYO A;  5G3L F;  5ELB A;  4DK3 C;  4DNT B;  1IYV A;  4X64 L;  1LLR D;  2Z4H A;  4A93 H;  1VQC A;  2EXZ A;  3M7N A;  2DNC A;  3OIP A;  1TWC B;  2ATW A;  3GTQ H;  2IJ0 A;  5M3M H;  3ZYY X;  2PNR C;  2A68 C;  1X3G A;  1RF2 D;  3SK6 A;  5JEA J;  3KJO A;  3Q6S A;  1FL0 A;  2F1M A;  4IFD G;  2NN6 I;  2ZM6 Q;  4FF3 A;  3H0G G;  2K4K A;  4DUZ Q;  5EJW A;  1ENF A;  3VYU A;  2ES2 A;  2JEB I;  2Q8T A;  1PVO A;  3O13 A;  5IGB A;  3E0E A;  3DEP A;  3JAM L;  4WJ3 M;  3ER0 A;  1PH9 A;  2JA6 B;  4ZCK A;  4A3B G;  3I90 A;  1B9N A;  4K6D A;  4LF6 Q;  2F0G A;  1SJE D;  4DR6 Q;  3OWE B;  3HOU H;  3J80 E;  1E0B A;  1ONL A;  1SNC A;  1TWH H;  4ZKB B;  2WAC A;  4DFA A;  2LSS A;  3EFX D;  1GVP A;  1U4L A;  3P1H A;  1EY4 A;  4KHV A;  4ZUJ A;  2AQ1 B;  1K8G A;  3KUP A;  3DM3 A;  4OX9 L;  3GTP B;  3I4N G;  1U4P A;  1VQM A;  2GN5 A;  2ICE C;  3GTO H;  4B08 A;  1KXL A;  2F0W A;  1GD7 A;  3FDT A;  4P71 A;  4LF9 L;  5LMU Q;  1YJN A;  5CBA E;  3S16 B;  4ZKC B;  1BKB A;  4CJ1 B;  5CGK A;  2ICI A;  4BY7 B;  1AN8 A;  2CWP A;  1MSG A;  3W1G A;  1S5F D;  2O2L D;  1IW7 D;  1VQN A;  2TMP A;  3VR4 A;  4GOP B;  1O7Z A;  3TP6 A;  2Q2I A;  2WKC A;  4A3G G;  1SYG A;  2DGY A;  5BN4 A;  1HNZ Q;  2K04 A;  3S1N H;  4FYD A;  3D31 A;  3D4D A;  1ET9 A;  3QOJ A;  3G6J B;  5EGT A;  1S3O A;  4GN3 B;  2VQE Q;  2E8G A;  5JVH 3;  1Q86 C;  3CW2 C;  2N78 A;  3AQQ A;  2EY1 A;  2FJ2 A;  4JI3 L;  1A62 A;  4RGT A;  4CGY B;  5HY6 A;  1M4V A;  3S2H B;  2R93 H;  4Q0F A;  4QIW E;  2F03 A;  3RR5 A;  1AE2 A;  4A93 B;  3MC0 B;  2ZJQ A;  1X55 A;  3GO5 A;  1XTD A;  3OOC A;  1Q8I A;  2BDO A;  4C3J H;  2CFM A;  2JA6 G;  2KHI A;  2UXD Q;  3T1H Q;  3GTQ B;  3J80 L;  3CPF A;  1BF4 A;  4A3D H;  1STH A;  2Z6B A;  2VNU D;  5IE8 A;  1TWG B;  5IGF A;  3DM1 A;  5C0X G;  3M3Y H;  4B9X A;  2QW7 A;  3L9A X;  2OT2 A;  3S9W A;  1ILP A;  2I5H A;  4IUP A;  4APV A;  1XMO L;  2E2I H;  3E3X A;  2RHQ B;  1SLJ A;  4QQB X;  4O0A A;  3I91 A;  2WII B;  5COY A;  1VCI A;  1OXS C;  3L2P A;  2A8V A;  4LFA L;  1EY8 A;  4DR2 Q;  2BA1 A;  1PA6 A;  2NZO A;  4JI5 L;  3HOW H;  2UUA Q;  1DCZ A;  1F2Y A;  4EQN A;  5IP9 G;  3K7A B;  1JOK A;  2VZA A;  1VQJ A;  2AKW B;  4KV6 A;  4ME3 A;  1WTV A;  3SE0 A;  1STB A;  4YY3 Q;  1FD7 D;  3GTO B;  4FF1 A;  1I4X A;  4YWL A;  2PCF B;  1RDP D;  2YV5 A;  1B44 D;  4QMG A;  3BS1 A;  3EJI A;  1AZP A;  1MD2 D;  3CD6 A;  1EEF D;  4A76 A;  1VQG A;  4WOR A;  5C4Z A;  4HED A;  1A3V A;  2CW0 C;  4RG1 A;  1V1P B;  3MA2 B;  4DV4 Q;  4IUN A;  5LL6 S;  5L37 A;  4IFD J;  5CV5 A;  1CM9 A;  3DWQ A;  2F0F A;  3BG3 A;  4TRD A;  4CKE A;  1YZ6 A;  4A3F H;  1Q3L A;  3KF6 A;  4DUY Q;  4HIK A;  5FO9 B;  1EUJ A;  1I50 H;  4JPB W;  2BCO A;  5C6A A;  4JI6 L;  2E2D C;  4NKL A;  1F2L A;  4GLV B;  3TS0 A;  4UP8 A;  1LTS D;  3UI2 A;  2E2J H;  1LUZ A;  1ILQ A;  1S72 A;  3AEV A;  3A7L A;  3I4L A;  3HS0 C;  1D2B A;  2KEC A;  4RCN A;  1HJP A;  3I3C A;  5C44 H;  3CMA A;  2L15 A;  5C0X I;  2A1A A;  2X69 A;  1O78 A;  4A3J B;  1SBB B;  2F0D A;  2R7D A;  1HFG A;  3NP8 A;  3U58 A;  1J5E L;  2K7V A;  3M4O H;  4NXN L;  4X66 Q;  4C3H H;  2EJG C;  2E5L Q;  1AE3 A;  5JJI A;  5GAD C;  4DR5 Q;  2IT1 A;  1JB7 A;  1GOZ A;  4UPA A;  1K8A C;  3BDL A;  1E2Z A;  4JI1 Q;  1NJI C;  3S1M B;  2CVR A;  1F9R A;  5I4D A;  1TS4 A;  1JWS D;  4HCE A;  5IP7 H;  3V05 A;  2EIF A;  1MJE A;  1VQA A;  2XWJ B;  1EIG A;  4UDU C;  5J39 A;  4KKU A;  4L5T A;  2NTT A;  4HTH A;  3PIP A;  1P8L A;  3U50 C;  1XPR A;  1EWI A;  3Q8D A;  1TVX A;  3NBH A;  1BUV T;  4BS9 A;  1NNX A;  4NDX A;  4XQN A;  2JQO A;  3HOW B;  3KBX A;  1EIF A;  5JAV A;  4FVM A;  4B3S Q;  1KAA A;  4HJ7 A;  1XPU A;  4X3S A;  1R9T H;  4BBR B;  4X64 Q;  1MI2 A;  2AMC B;  4C3I B;  2Z1C A;  5JPN C;  2ASB A;  4IUQ A;  1AEX A;  1SE3 A;  1FYC A;  3KF8 A;  3R8B A;  3J81 E;  4DR7 L;  1SXT A;  2NYZ D;  1Y8O B;  1IBK L;  3HKZ G;  1MBY A;  2A6E C;  5KRU A;  1JMC A;  1IXR A;  2OQ0 A;  2OEO A;  1I94 L;  2BE5 C;  5C4X B;  2EDG A;  2X6G A;  2HUG A;  2JA8 H;  2A19 A;  3I72 A;  3LX0 A;  5ELF A;  4J15 A;  5M9O A;  4IOC A;  2LMC B;  1HR0 W;  5IY0 A;  2K5Q A;  1JJ2 A;  1T9H A;  2HT1 A;  4FXD A;  1XNR L;  3PO3 B;  4X6A H;  2NVY H;  5C0X J;  1L0W A;  2VS1 A;  5LL6 X;  4OON A;  2DY7 A;  4A3J G;  1W3S A;  2PNH A;  2CQA A;  4A3K H;  4F88 A;  1B50 A;  3KF6 B;  1AZQ A;  1CKM A;  3HOY G;  1T5E A;  1BBU A;  4LFB Q;  5KYI A;  2XSC A;  3IAY A;  4K8J A;  2NN6 H;  5LMN L;  2PZT A;  1K9M C;  5JPM C;  1IYJ B;  2RDG A;  2OXP A;  1I4P A;  2ZTE A;  4LF9 Q;  5FKA C;  1JOO A;  4OIK A;  3TP5 A;  1SYB A;  2VY3 A;  4UAI A;  1FNU A;  2CH4 W;  3H3V I;  3M4O B;  3HFZ B;  3U4Z A;  1V1O A;  3AFP A;  2L4N A;  4C1N K;  1C8C A;  3KLS A;  5KNB A;  4A3I G;  3CQZ H;  4DK6 C;  3NQT A;  3J81 L;  1B1Z A;  1R4Q B;  1Y14 B;  2EY6 A;  4BBR G;  2Q2H A;  2RVL A;  1IL2 A;  4C3I G;  4FP5 D;  3CF5 A;  2F0L A;  3BYY B;  5BR8 L;  2MP1 A;  2NBF A;  1FGU A;  1C4Q A;  2N8N A;  4A3E B;  1D7Q A;  1J8I A;  2NVX H;  3R3O A;  1MIU A;  4FDB A;  1RL2 A;  2A74 C;  1E24 A;  5C4X G;  1A0I A;  3S1Q B;  4GOP C;  3NBH B;  3TEH B;  1BO0 A;  1NE3 A;  2UUC Q;  2F4I A;  1LTI D;  1SYF A;  2F0P A;  3D4R A;  4L63 B;  2NZ1 D;  5JVG 3;  3EVQ A;  5M3F H;  3PO3 G;  1K83 H;  2EPB A;  2NVT B;  3KF8 B;  1PRT D;  3CC4 A;  2NWG A;  1YHB A;  3KYH C;  1ZXT A;  4K14 A;  2ZXO A;  3ULJ A;  5I2Y A;  3H91 A;  3VYR A;  4S3S A;  4QF4 A;  2KCC A;  3OHX C;  3GD7 A;  3AFQ A;  3PUW A;  4KY5 A;  4ODG A;  1L1O A;  2JA8 B;  2LKV A;  1PH8 A;  4LFC Q;  1TWF B;  2PPB C;  4IPH A;  1UAP A;  4GKJ Q;  3HOZ G;  1NAP A;  2PO4 A;  5F2D A;  2Z0S A;  3D0F A;  2D0O A;  4ILW A;  2KJX A;  1BVS A;  3PCO B;  3FPU B;  2KUM A;  1JJG A;  4X62 L;  3FKI H;  4WRD A;  4HJ8 A;  1SFO H;  2I46 A;  3ERQ A;  1PZK D;  1EY7 A;  4IZ8 A;  1VF7 A;  3D4W A;  3VR6 A;  3T13 A;  4DV1 L;  4GNX C;  4JI5 Q;  2O5J C;  1LO5 D;  3KOJ A;  5C4H A;  1VQF A;  4KHP L;  3Q23 A;  3GV3 A;  4A75 A;  3KJP A;  4F87 A;  1EU3 A;  2Q2T A;  4LF4 L;  1IL8 A;  1P16 A;  2YU9 B;  5C3E B;  4A3B H;  1H9R A;  1KRT A;  3K80 C;  5DLQ E;  1PH2 A;  1TY0 A;  3L3O C;  3PF4 A;  5E4W C;  5IGC A;  4B3M L;  4A3M G;  2NVQ H;  4JVZ A;  4DAY A;  5EPJ A;  2B2U A;  1EQV A;  5IT9 c;  4A3E G;  1OXU A;  3SR1 A;  1LT5 D;  2IX1 A;  4IN3 A;  2IHE A;  4FNF A;  5A2Q L;  3BVM A;  4DR3 Q;  2OF1 A;  3K59 A;  5CV8 A;  3C3L A;  4B9W A;  4RGN A;  4JYA L;  5D14 A;  5ISR A;  3RN5 A;  5ELC A;  3T16 A;  4CJ2 C;  4J1M A;  3I70 A;  1VQK A;  1VMC A;  1OXT A;  4HJ9 A;  4IPD A;  4JI6 Q;  2QEJ C;  3GTG B;  2NVX B;  2R61 A;  1KLG D;  2F3W A;  5FO8 B;  1SRO A;  5D3I B;  4OO1 G;  2Z6K C;  2RHS B;  3VYS A;  3I4O A;  2JA7 H;  2F0J A;  4C56 C;  2PI2 A;  1DXM A;  2DJG C;  1H9S A;  1CZG A;  2XN9 C;  2B39 A;  4XQJ A;  4A4I A;  2L0C A;  3U9O A;  4LF5 Q;  3E5S A;  4WJW A;  3U4V A;  4RCO A;  1Q81 C;  1STE A;  4H7B A;  4XYQ A;  2MJ8 A;  5IYB G;  4NXN Q;  2RBM A;  1Y8N B;  4N8F A;  5C5M A;  2R3Z A;  3PQI A;  5EKK A;  1DOL A;  1YNN D;  2EYF A;  1QUQ A;  1QCB D;  1L1O B;  1KNE A;  3X3N A;  2I0Q A;  1WYD A;  2K28 A;  1VF5 C;  2EYP A;  4MTN A;  3I4M G;  4AIM A;  1EEI D;  3QR8 A;  1TS3 A;  3JAM E;  2ENB A;  1WTQ A;  1I3Q H;  3TDQ A;  2IHF A;  3AMU A;  1I6V C;  2KVM A;  1C9O A;  3IRB A;  4L8J A;  4LUO A;  4QUC A;  2NTS A;  4DU9 A;  1ZYR D;  1VQ9 A;  4B3T Q;  1A2U A;  3UDG A;  4DR7 Q;  1KAW A;  4DV0 Q;  1DZ1 A;  4BY1 H;  2HHH L;  1UNS A;  5TSS A;  2E75 C;  1D8L A;  1YNJ C;  1YIJ A;  3L7Z C;  1EY5 A;  1IBK Q;  1B2T A;  3WDN A;  5DEH A;  2G9D A;  2G5D A;  4DAY B;  5IYC G;  2MNA A;  5IP9 H;  4Y7N B;  4K2K A;  4PZ6 A;  4KY7 A;  3CPW A;  2K5V A;  4DAP A;  4G7O C;  2UUB Q;  2R92 B;  4JBM A;  3V96 A;  1HA5 A;  1XNR Q;  1SMX A;  4DN4 M;  4OO1 I;  1YHQ A;  2SDF A;  1XWE A;  3A5U A;  4K5X A;  1CKN A;  1VQD A;  2NB0 A;  4DGZ A;  3ULP A;  1Y69 U;  4QCL A;  2WKD A;  1GUS A;  4JW0 A;  5D3D A;  2LY7 A;  2V4D A;  3RZO H;  2D9U A;  1HRJ A;  1DGS A;  1H9K A;  2CWA A;  3H94 A;  1VMP A;  1G2S A;  1D5M C;  1E1T A;  2RKS A;  3RLO A;  1QVG A;  4GNX A;  3TME A;  4JI4 L;  4K5V A;  1LYL A;  5LMN Q;  5M5Y H;  4C2M B;  4KMU C;  1EFI D;  4XQQ A;  3NUC A;  2O4X A;  4K2L A;  1H9S B;  5IOC A;  2WAQ G;  3VA7 A;  3MXU A;  3R2I A;  1JT8 A;  1K28 A;  1A63 A;  2VQF L;  5GAH C;  3SEB A;  4AYB G;  4Q5V A;  1Q1B A;  3Q24 A;  3GTK B;  1EZ6 A;  4GZY C;  1WTW A;  3E9I A;  1J9O A;  1EY0 A;  1QNK A;  5C4J H;  4KKS A;  1QUQ B;  1ICF B;  3OYY A;  3RZD H;  4X3U A;  1TWA B;  1SMY D;  2V1C C;  3WOE A;  1XMQ L;  4DNI A;  2PQA A;  1EU4 A;  1UEB A;  3MXN A;  4U67 3;  3MAQ A;  3K58 A;  3BVG A;  1HZC A;  3I2Z A;  2AUK A;  2PQE A;  1N9W A;  1V1P A;  1HZA A;  1PDQ A;  1KDA A;  2Z6K A;  4N9T A;  1X3E A;  4KN7 C;  1K3R A;  2R92 G;  1F9S A;  1N33 Q;  5IGD A;  2JA9 A;  5FLM H;  1WVL A;  1EYD A;  2A6H C;  2L5T A;  4G57 A;  1R4P B;  2F0K A;  1IBL L;  3ITP A;  4EQO A;  1Y1W B;  5AJ3 L;  4L5S A;  4I7A A;  3GTJ B;  3NQI A;  1K0R A;  4DV2 L;  4BBS B;  1F9Q A;  1X3Q A;  1PRT F;  4A3L G;  4JI8 Q;  4YWM A;  3N52 A;  1U0L A;  1UEA B;  1ML0 D;  2FMM A;  2A73 B;  3ONA B;  3CCQ A;  4IFD I;  4PQX A;  1SYD A;  1E22 A;  1M90 C;  1E1O A;  4JBW A;  4B3R L;  4X62 Q;  3F2D A;  1CKN B;  3PIP 3;  3STB C;  1RHP A;  2EYJ A;  3CP0 A;  3RLF A;  3KDF B;  1F2Z A;  1SDF A;  4RGO S;  1TR5 A;  4OEL B;  3RD4 A;  5M3M B;  3HOV H;  1N34 Q;  4KHP Q;  5EBD A;  1SSO A;  3FMC A;  1UE5 A;  2M00 A;  4DV5 L;  4MNO A;  5BN5 A;  1HR0 L;  1QVF A;  1WCM H;  2IX0 A;  2B2V A;  4GNX B;  1EZ8 A;  1VQE A;  4JI2 L;  1BOS A;  1SN8 A;  3J80 i;  1HCZ A;  1RTN A;  3MEF A;  5COR A;  1CQF A;  4JI0 L;  3SGI A;  1I4G A;  2GVB A;  3K5M A;  1V43 A;  3CAM A;  1ESR A;  3HKS A;  3OTO Q;  1GM5 A;  2VB3 X;  2OQK A;  2JE6 I;  4BWG B;  1SE8 A;  1FR3 A;  1Z6H A;  2WAQ E;  4ZQ3 A;  3HOU B;  1NBW A;  2B8F A;  3S17 H;  1TWH B;  4F8M A;  1Y1V H;  4BY7 G;  1DJR D;  1OO9 B;  4AYB E;  5C4J B;  1QOH A;  3NK9 A;  1XNQ L;  2FHT A;  1A2T A;  3K7U C;  1KNA A;  1KDC A;  3Q22 A;  4LF7 L;  1G91 A;  3J7A 5;  3IFT A;  2PQA B;  1UE7 A;  4H44 C;  1CT1 D;  3MXN B;  3OPO A;  4PG3 A;  4JV5 Q;  5NUC A;  1Y1W G;  4XIG S;  3UDI A;  1BR9 A;  1SNQ A;  1C48 A;  1GHK A;  5ELN A;  1ENC A;  3EA6 A;  4HIM A;  4DK0 A;  1PH5 A;  2K05 A;  3TS2 A;  4GN5 A;  3MFG A;  1U4R A;  2E76 C;  1EY6 A;  1L0Y B;  2I07 B;  1BBW A;  4A93 G;  4UP9 A;  1CHP D;  4P2C B;  1IBM L;  1EQR A;  4X65 L;  3F2B A;  4YIJ A;  1A3T A;  3S1N B;  2ZJR A;  4HR7 B;  5KGU A;  5GQO A;  2VUM H;  3D8G A;  4DR1 L;  3PSI A;  2R7Z H;  2Z9H A;  4OHJ A;  2UXC L;  3TQY A;  3LGJ A;  4P74 A;  3OIQ A;  4JI7 Q;  3K8A A;  1IYU A;  1LTT D;  5M5X H;  1OXV A;  1NMF A;  4FO2 A;  1GUG A;  1IKL A;  1WI5 A;  2R93 B;  2PMZ B;  3H6M A;  4CDC C;  1KIX A;  1CSP A;  4PMB A;  1CSQ A;  2AWN A;  4C3J B;  5K5P A;  3BYT B;  3HGB A;  5FK9 C;  4NP5 A;  1B8A A;  2UXB L;  1L1O C;  1RD9 D;  2PI2 E;  2F0Q A;  4YCV A;  1C7Y A;  3HOV B;  4A3D B;  3HOZ H;  1G6P A;  2R6G A;  4N8X 1;  1LTL A;  1JE5 A;  1HUN A;  3HOU G;  3M3Y B;  3MVV A;  5JEA H;  3RN2 A;  4HN7 A;  1LT3 D;  4K0K Q;  4PZ7 A;  2Z4I A;  1UE6 A;  4PNY A;  3ULL A;  4WJ4 A;  2HHH Q;  2B8G A;  1JR0 D;  1AFP A;  2E2I B;  2H4O A;  3TZU A;  1VQP A;  3NHH A;  1II3 A;  4DK1 A;  1SE4 A;  2E2H H;  1WJJ A;  4DPG A;  4RMF A;  3GTL H;  2Q2U A;  2VB2 X;  2M2L A;  2PW7 A;  2C5C A;  1Y1V B;  1B3Q A;  2D2C C;  4A3M H;  1PH7 A;  1IW7 C;  1E3P A;  2WP8 J;  3T53 B;  3G6E A;  1DON A;  4QY7 A;  2P5Z X;  2XRS D;  1CA5 A;  1JWM D;  2F0H A;  2ZTC A;  3E9H A;  3I73 A;  2B2U C;  1FNW A;  4LUV A;  3M9B A;  3F8T A;  1QNU A;  3PO2 H;  3JC6 6;  1PRT B;  3IKJ A;  3CRK C;  4JI4 Q;  2SNM A;  3Q0A A;  2K52 A;  1LTG D;  2JA5 H;  4NXM L;  1JOR A;  1SNM A;  3T4A C;  3A0J A;  4G7H C;  4DV6 L;  1QJO A;  2B2Y C;  5IIF A;  2F0T A;  4OO1 H;  4A3F B;  3T1Y L;  5E4X A;  1CHQ D;  3HOX H;  1B53 A;  1I50 B;  2B63 H;  1EIH A;  4C3J G;  2IX3 A;  2QF7 A;  4GN4 B;  4HSV A;  5CYU A;  5CC4 A;  2R7Z B;  4BXX G;  3CME A;  3K6O A;  1Q82 C;  1BCP D;  2E2J B;  3QIA A;  4A3D G;  1JE4 A;  1KL9 A;  2KA7 A;  3CHB D;  5EQ0 A;  3A7A B;  3KK7 A;  1QVC A;  4OX9 Q;  3OW7 A;  1SNP A;  3I7F A;  3K5O A;  5C44 B;  4L5R C;  3BDO A;  3HG9 A;  1GJX A;  3I8Z A;  3PUV A;  3ERS X;  1LT4 D;  1HQM C;  3TSS A;  4C3H B;  4LF8 L;  3DEO A;  2HDL A;  1CKO A;  4DR4 L;  4H02 A;  4KHZ A;  1HPC A;  3UE1 A;  2WIN B;  3HOW G;  1VQI A;  2AQ3 B;  1PXU A;  4XT3 B;  4XTC S;  3J7Z C;  4R4Q A;  3I4M H;  2CH4 A;  1T5X D;  4RA8 A;  3G71 A;  1I4H A;  2GA4 B;  2MGS A;  2SOB A;  2LFN A;  4A3C H;  1TS2 A;  3DLL A;  3W2D A;  1Q12 A;  1L2F A;  5HGQ A;  2KCT A;  1NY4 A;  2K33 A;  2K5D A;  5GRO A;  4IJH A;  1O7Y A;  3J81 i;  4DR6 L;  5ELO A;  1VQ5 A;  2RSN A;  3PMF A;  5FLX c;  4TKO B;  5A35 A;  2NZH A;  5EPL A;  4JI3 Q;  4EVO A;  2J0T D;  3AYH B;  1XYI A;  2F0O A;  5A2Q E;  4OXP A;  1PFN A;  2RF4 A;  3K0Y A;  5DNF A;  4OWT B;  1R9T B;  5CV7 A;  3C1E A;  3ND9 A;  4KN4 C;  1Q8K A;  3BU2 A;  3FP9 A;  5IYC H;  5M5W H;  3W1B A;  1CZW A;  5EPK A;  2XVS A;  2K75 A;  2N3S A;  2HDM A;  4XT1 B;  1TQO A;  4A3F G;  5ELE A;  2RA4 A;  1YHA A;  5I2X A;  2ZXR A;  1HTL D;  3KLR A;  3U9S A;  1DM0 B;  1M1K C;  5K36 G;  4JI2 Q;  1WD0 A;  3HRZ C;  3ND8 A;  2K6A A;  1ZEQ X;  3MZ5 A;  1XMO Q;  1HTP A;  5CBE E;  2NVY B;  4ZLT F;  4JBJ A;  1HNZ L;  1UE1 A;  3SK4 A;  1NSN S;  2A68 D;  4IFD H;  5J1Z A;  3TBI B;  4A3K B;  3H0G H;  4LFA Q;  3HOX B;  2B63 B;  3MFY A;  5FJ8 G;  5KNC A;  2VQE L;  2EYM A;  2PMZ E;  3LNN A;  3I55 A;  4K6L A;  3MHB A;  5KND A;  1JJC B;  3N6R A;  3S14 H;  2C9O A;  1D1K A;  3MEH A;  1CFM A;  1VQH A;  2L12 A;  4LF7 Q;  1N32 L;  2MHV A;  5IP7 G;  1ET6 A;  4JOI A;  3DWP A;  1KLU D;  4GKK L;  1V1Q A;  3TP8 A;  2UXD L;  3T1H L;  3EIV A;  2F0E A;  3PF5 A;  4IO9 A;  1IHZ A;  2HCI A;  1K73 C;  2SNS A;  2A69 D;  2C35 B;  5D65 A;  1PYB A;  5I9P A;  1PYS B;  1V9P A;  3I4N H;  5CR3 A;  2PYK A;  3X3M A;  3NTI A;  1Z9F A;  4P72 A;  1YEZ A;  3QB3 A;  5ELD A;  1GUO A;  3CQZ B;  1S5D D;  1PTO H;  4KTA A;  1EOT A;  4RKL A;  2TSS A;  2B2Y A;  2L9H A;  1H95 A;  4X65 Q;  3NXW A;  1E2W A;  3KLS X;  2RSO A;  4CKB A;  1SYC A;  1PH4 A;  1Y8P B;  3S2D H;  2CQO A;  5JJK A;  2UXC Q;  5KIX A;  3EN2 A;  4TVA B;  5HUR A;  1I6H H;  1VDZ A;  2RCN A;  3M7G A;  2JA8 G;  2KCM A;  4R8N A;  4A3G H;  2I5M X;  4DAV A;  5M3F B;  3C46 A;  4I65 A;  2EQS A;  1K83 B;  2H5X A;  3NWT A;  4R4O A;  1J5E Q;  4C1N I;  3F1Z A;  1G2T A;  4MHE A;  3JAM c;  1A3U A;  4A3K G;  2SEB D;  1PH3 A;  4OWW B;  3C2P A;  3A74 A;  1HUM A;  1HFN A;  2KHS A;  2F0V A;  1JQY D;  2F3I A;  3TRZ A;  2EYO A;  5LMN W;  1ASZ A;  3KFU A;  3UDX A;  1Q7Y C;  4DV4 L;  1QE6 A;  1LTR D;  4DXF A;  5C3E G;  2JA6 H;  1OXX K;  3G48 A;  3K81 C;  3V2T A;  3D6C A;  3SK8 A;  2YYZ A;  1WTX A;  2BDN A;  4HMJ A;  3NEM A;  1XPO A;  4NB3 A;  5C0X H;  3FKI B;  3MXG A;  1SFO B;  4MIU A;  4X3K A;  2YTV A;  4FXG C;  1MHW C;  2B2V C;  2KEE A;  1S4Z A;  4IOA A;  3GTP H;  3DUZ A;  3S14 B;  2KEN A;  4A3B B;  3CCU A;  3IFD A;  4H0L C;  2N88 A;  2NVQ B;  3ERO A;  1GUW A;  4IUV A;  3A5Z B;  3S16 H;  1RIP A;  4YCU A;  3H09 A;  1I94 Q;  3PUZ A;  4O42 A;  1NR2 A;  2K01 A;  4ALP A;  1X54 A;  1H9M A;  1WTO A;  4ZK9 B;  1VS0 A;  1KAB A;  2CCZ A;  4NXM Q;  4ZYS A;  1GUN A;  4O1N A;  1DD2 A;  4ZRZ A;  1STY A;  5IT9 L;  1PFS A;  2PW5 A;  1PTO B;  2DUD A;  5IWA L;  1ASY A;  1X32 A;  2EYL A;  2KOL A;  5M3F G;  4YHH L;  2FMC A;  3KDF A;  5EBC A;  1PRT C;  2F3V A;  2VW9 A;  3LWE A;  3A55 A;  3D3R A;  4QJF A;  1N8R C;  2QIL A;  4KD3 A;  2CW0 D;  1GKH A;  1BQQ T;  2QA4 A;  3S15 H;  3VR5 A;  2JEA I;  5LHY 1;  3VYT A;  3J80 c;  3S2H H;  2JA7 B;  4POG A;  3P75 A;  2ALY B;  5GAG C;  2QEX A;  1G29 1;  4A3G B;  1STA A;  3PIO A;  5KEE A;  1D5X C;  1BCP F;  3QWN A;  3VA5 A;  2MUY A;  1O80 A;  4DV7 L;  5DM7 3;  5I6Y A;  1G51 A;  3GQB A;  3OMG A;  1TWG H;  2DN8 A;  4LF8 Q;  5DM6 3;  3FKI G;  4DR4 Q;  3A54 A;  4IJL A;  2UU9 L;  2F0I A;  1EYC A;  1RKN A;  3M4Q A;  3JAM i;  2YTX A;  5I6W A;  3EQL C;  1X3P A;  4R4C A;  4KD4 A;  4P75 A;  4EGV A;  2EXD A;  3TZD A;  1QB5 D;  5BR8 Q;  2IWH A;  2JP1 A;  1KC8 C;  3CKI B;  3W5O A;  4AH6 A;  4RAU C;  1MGS A;  3M4P A;  1AH9 A;  3BDC A;  1K3B C;  1I3Q B;  3OSO A;  5JOB A;  2JJQ A;  3S24 A;  1U9R A;  3K5L A;  2BH8 A;  4LFB L;  3K7A H;  1TS5 A;  2L1B A;  2A69 C;  4HIO A;  4ID6 A;  5IYD G;  5IGG A;  3H3V H;  4R4I A;  4M8A A;  1D5Z C;  1O7L A;  1N36 L;  1HXY D;  1SAP A;  3E0J A;  1KQS A;  3A8J E;  4BY1 B;  3A8I E;  2LS0 1;  1TU2 B;  2EOT A;  4LK1 C;  4OWX B;  2VL6 A;  1XJV A;  2L55 A;  2B3G A;  1VQ4 A;  4V19 0;  1UUP A;  4IQZ A;  1PTO D;  3SVM A;  1C0A A;  1LTB D;  2HQE A;  2D5D A;  2Y0S B;  3PUX A;  4IUT A;  2YTY A;  1WTP A;  2Q8I B;  2JA7 G;  1PYW D;  1WOC A;  3BZC A;  2JYO A;  3AU7 A;  4LW1 A;  4DAM A;  5I9O A;  2F0M A;  1Q1E A;  3VR3 A;  2A6E D;  4XDX A;  2BE5 D;  1ESF A;  2A5H A;  1W2B A;  3CXC A;  3RZO B;  4DV1 Q;  3KBG A;  2F0U A;  3CCV A;  4LMQ D;  3S1R H;  3OMC A;  3VDY A;  1SYE A;  2F4V L;  1I4R A;  2CHB D;  4LAA A;  2UUC L;  3NWS A;  3S15 B;  1YNX A;  1YNN C;  4LF4 Q;  2MQH A;  5C3W A;  4OL7 A;  2WV6 D;  1JCK B;  1B70 B;  3H15 A;  5M5Y B;  4QB4 A;  3OWF A;  4A3J H;  1N32 Q;  4B3M Q;  3F2U A;  3M4Y A;  1S5B D;  3MXP A;  3HOY H;  2K32 A;  2B29 A;  4GKK Q;  2D62 A;  4BXX H;  3TN2 A;  4CJ0 B;  4DXG A;  1K0S A;  2MO1 A;  1DOM A;  5AFW A;  4KY6 A;  1CQV A;  3S1M H;  4LFC L;  2L11 A;  1STG A;  5CMD A;  3WOF A;  4ME5 A;  1BNZ A;  4X3T A;  3P7J A;  4JYA Q;  1WTH A;  4GKJ L;  1ZYR C;  2HIX A;  3HZX A;  3B6Y A;  2IY5 B;  1EY9 A;  3RZD B;  4Z9C B;  3CC2 A;  4IUR A;  1EFW A;  4BY1 G;  4DKA C;  1PFB A;  1IZ6 A;  4KJO A;  1FJG L;  2XRQ D;  2WFW A;  1TXY A;  4H13 C;  1LT6 D;  1KRS A;  3TRE A;  4A3I H;  5CV4 A;  4EX5 A;  4BBS G;  4BBR H;  1SEB D;  4C3I H;  3W3A A;  3A56 A;  1PH6 A;  1Q46 A;  4DV3 L;  2Y0S G;  1BDO A;  2OWO A;  3QOL A;  3CRL C;  1LAC A;  3D6W A;  2KHJ A;  4DNR B;  1GO3 E;  5C4X H;  3CCL A;  3CC7 A;  3CU7 A;  4RKB A;  4CBV A;  3EBE A;  5CV6 A;  1JIC A;  2K03 A;  2MPM A;  1F2M A;  3G7L A;  3WWV A;  2XTI A;  1RCV D;  1YVC A;  5M3M G;  2BA0 A;  4DR3 L;  4LWC A;  2EJM A;  1PMR A;  2AUJ D;  2I5L X;  3PO3 H;  4JC0 A;  2JN4 A;  5BN3 A;  4IPG A;  3T51 B;  1B3A A;  1BCP B;  1XX8 A;  4R9W A;  1JC7 A;  3HKZ B;  2QGQ A;  1MKH A;  1HNW L;  2M9V A;  3BJU A;  4JK1 C;  1KTK A;  4PV1 C;  1GUT A;  3GV6 A;  4ZUI A;  4XXE A;  2Z8L A;  1Z47 A;  1KD1 C;  3SHL A;  5K36 H;  1QIL A;  2F0S A;  1M8A A;  3NBI A;  4RGM A;  3S1R B;  1SR3 A;  2ID0 A;  5J3B A;  2N55 A;  3BZK A;  3VR2 A;  1WCM B;  1B4O A;  4JBK A;  2ZJP A;  1VQ7 A;  4LF5 L;  1FGB D;  2B2W C;  4RHR A;  1SMY C;  1PFM A;  3SXH A;  5FJ8 H;  3J81 c;  3M85 A;  3HOY B;  5CV9 A;  3HP3 A;  1X56 A;  4ABN A;  3TP7 A;  1WTR A;  1Z7T A;  1K8O A;  5C3X A;  3NTH A;  2O5I C;  3K5N A;  2RCF A;  5H1S E;  4QUF A;  2IPK D;  4AQY L;  1HNX L;  2OTJ A;  3S17 B;  4GS3 A;  5HGT A;  2QKI C;  4KK7 A;  4RHS A;  2K5W A;  5IWA Q;  1GXD C;  1EYG A;  4A3E H;  4JOI C;  4HID A;  3J7A V;  4YHH Q;  3PUY A;  3GP7 A;  4HAE A;  2D0P A;  4NW2 A;  3K57 A;  2J7Z A;  5FLM G;  1G6Z A;  4DA2 A;  1NUC A;  1QZH A;  2AHO B;  4CDD C;  1KDB A;  2JSO A;  3S1Q H;  1EWC A;  4A3I B;  1WFQ A;  1B7Y B;  5T1I A;  1PTO C;  2HQL A;  2G9H D;  2EY2 A;  1BXT A;  3IL8 A;  4NPS A;  1EQQ A;  4B3T L;  4CKC A;  2K5H A;  4DV0 L;  1SE2 A;  2NVT H;  1W6K A;  2XIW A;  2EVB A;  3CCJ A;  4G7Z C;  2R93 G;  5EAY A;  3LWU A;  4DV7 Q;  2MFI A;  3UE0 A;  2VQF Q;  2IW3 A;  2CKZ B;  1IKM A;  4JG2 A;  1Q90 A;  4WFN 3;  2KQ3 A;  1EWH A;  1J6Q A;  2Q8R E;  5G3L D;  1NR4 A;  2Y0S E;  4I7Z C;  2FIN B;  2UU9 Q;  1YIT A;  2VUM B;  1TWF H;  5J22 A;  1HQR D;  2EE1 A;  4CHT B;  2UUB L;  3HOV G;  4OIJ A;  1SNO A;  2JXM B;  1HA6 A;  4QL5 A;  5E7N A;  3NEL A;  2B2T C;  5C5L A;  3URY A;  5M5X B;  1A15 A;  1TY2 A;  4Y52 H;  2EZV A;  1WCM G;  5KYL A;  5IYB H;  1XMQ Q;  3ICE A;  4HCS A;  3FPP A;  1HH2 P;  1QG7 A;  1S5C D;  4GLA C;  4OEM B;  2RDH A;  3FRP B;  2BH2 A;  2F52 A;  3R2T A;  2ZM6 L;  3HOZ B;  2YU9 H;  5C3E H;  4PZ8 A;  4DUZ L;  1N36 Q;  1ENA A;  3L0O A;  2WB1 B;  1DYQ A;  1Y1V G;  1ZKO A;  3E6Z X;  1YBY A;  2EY5 A;  1V8Q A;  4EQ5 A;  4HMI A;  4E6I A;  3OW2 A;  4FXK C;  4J8Q A;  2EJF C;  1IBL Q;  3QO2 A;  4U68 A;  3RMH A;  1BBX C;  2DY8 A;  4LF6 L;  5AJ3 Q;  4CDE C;  4V0B A;  3DMU A;  4DV2 Q;  2E2H B;  1ICW A;  4MZ9 A;  1X6O A;  4R1J A;  1FVI A;  3F2C A;  3GTL B;  3BVZ A;  1H9J A;  1SND A;  4R8I A;  4A3M B;  4HSP A;  1X65 A;  1YNJ D;  4PMC A;  2ZTD A;  1FNV A;  1JWU D;  1PTO F;  2QDB A;  3PV0 A;  1VQ6 A;  2BOS A;  3GTG H;  2F0N A;  4B3R Q;  4YWK A;  3C1F A;  1HZB A;  3PGZ A;  1X9N A;  5LMU L;  2ZT9 C;  4P73 A;  3FHW A;  1STN A;  4L5Q A;  3J7A F;  1O7I A;  2F4V Q;  3K0X A;  4LUZ A;  3PO2 B;  4FF4 A;  2VUM G;  1AW7 A;  4DV5 Q;  2R7Z G;  1HR0 Q;  3T56 B;  1A6X A;  4MTK A;  4RFB A;  3AB9 A;  2JA5 B;  1N33 L;  1L0X B;  2FFK B;  2LXJ A;  1XTC D;  1UWV A;  4KKT A;  4JI0 Q;  1I5F A;  1RTO A;  4BA1 I;  4IAL A;  1EQT A;  2AWO A;  4LJZ C;  4EQP A;  2B2W A;  5C44 G;  3GTM H;  4NMZ A;  1TT2 A;  3P20 A;  5FLX E;  2QCP X;  2AQ2 B;  1EL0 A;  1PZI D;  4KJN A;  4TSS A;  1VQL A;  1JB3 A;  1S40 A;  2XWB B;  4JI8 L;  3HKZ E;  1U4M A;  4C3H G;  1XNQ Q;  2WB1 G;  5JEA G;  3G4S A;  1VQB A;  2HIV A;  1SJH D;  2HD3 A;  3R93 A;  4UY8 C;  1HHV A;  3HEJ A;  3A8K E;  4PMW A;  2LXK A;  1FJG Q;  5IGE A;  3SDZ A;  1D1I A;  5DAU A;  4DF7 A;  3J7Y W;  1N34 L;  1G8Z D;  3ZJY C;  1YI2 A;  2MO0 A;  3FEW X;  4TQU S;  3FVQ A;  2R7F A;  3BZD B;  4R4T A;  1NTG A;  4LNQ A;  2KED A;  3KLW A;  4DV3 Q;  1PV4 A;  1U5K A;  1VQ8 A;  3I4M B;  1F9P A;  1S5E D;  5T1G A;  2QDL A;  3PIO 3;  3NE5 B;  3DWA A;  5FOB B;  3OTO L;  4CDF C;  4Y7N H;  1IBM Q;  4M1U B;  1CUK A;  2E74 C;  1NCV A;  5JJZ A;  1QWY A;  4N9P A;  2NUC A;  5IYD H;  2X6L A;  3NSW A;  3DHQ A;  5EKL A;  4DR2 L;  1LV9 A;  4DR1 Q;  3H3V C;  3RNU A;  4QGU A;  1EYA A;  2DNE A;  2GVA A;  2RDF A;  3SK5 A;  3MTS A;  2R92 H;  2UUA L;  2RQX A;  2XGT A;  3PO2 G;  4GLX A;  4K5W A;  4UP7 A;  4OGQ C;  5JJL A;  1OTC A;  4RWS C;  1MSH A;  2EYH A;  1LAB A;  2JA5 G;  4KI0 A;  2A6H D;  5GAE C;  4G4K A;  3UDF A;  2B2T A;  4YY3 L;  1HNW Q;  5IT9 E;  1TWC H;  4BA2 I;  2ZXP A;  5M5W B;  5E1F A;  2IL8 A;  5FLX L;  2OTL A;  1CTM A;  5IOD A;  1PHJ A;  2KBN A;  4QIW B;  4POF A;  4A3L H;  2FXQ A;  2UXB Q;  4JV5 L;  1I4Q A;  4MN3 A;  3HOX G;  2N49 A;  2B63 G;  2PZU A;  4C2M H;  4IPC A;  1MJC A;  1TKW B;  1BCP C;  4IUU A;  1QZG A;  2K5N A;  3QJY A;  1A8V A;  2K14 A;  2NN6 G;  4ZAI A;  2DJF C;  3STB D;  1W6J A;  4DUY L;  3GTK H;  1NMG A;  1AP0 A;  4F7X A;  4HJ5 A;  3CCS A;  4O2D A;  3GTM B;  3DXJ C;  3H0G B;  1CK1 A;  4AQY Q;  1HNX Q;  3J81 j;  1X3F A;  2XNA C;  4JI7 L;  1PZJ D;  3NPP A;  4K8I A;  1E2V A;  1EOV A;  4KLK A;  1XXG A;  4J6H A;  1TWA H;  3RLN A;  1PLF A;  4YCW A;  2WAQ B;  2OCE A;  1WD1 A;  1LM0 A;  1GHJ A;  1E7Z A;  2K1B A;  3MWY W;  1LTA D;  1YJW A;  4AYB B;  1PH1 A;  2J4X A;  4L6T B;  3QG1 A;  1B9M A;  4JCV E;  4A3C G;  3CCR A;  1D6E C;  2JK8 A;  4X66 L;  2WB1 E;  1EIY B;  1ROD A;  4BY7 H;  2E5L L;  3CCE A;  4DR5 L; 
#chains in the Genus database with same CATH homology
 1PH8 A;  1VQO A;  4LFC Q;  4GOP A;  2UUC L;  4IPH A;  1YNX A;  4LF4 Q;  2MQH A;  4JI1 L;  4A3M H;  1PH7 A;  1SRU A;  4GKJ Q;  3H15 A;  1B70 B;  1E3P A;  2WP8 J;  3HOZ G;  4K0K L;  3G6E A;  2Z0S A;  3D0F A;  4QY7 A;  2D0O A;  4A3J H;  1N32 Q;  1KHI A;  4DV6 Q;  1HZ9 A;  3E9H A;  2ZTC A;  1BVS A;  1YJ9 A;  4B3M Q;  3CCM A;  2K50 A;  3PCO B;  3HOY H;  2B29 A;  3GDE A;  4LUV A;  3T1Y Q;  4X62 L;  4GKK Q;  1JJG A;  1Y1W H;  3FKI H;  2D62 A;  4HJ8 A;  1SFO H;  4BXX H;  3GTJ H;  3M9B A;  4BBS H;  3F8T A;  4JI5 Q;  4DV1 L;  4GNX C;  3KOJ A;  3PO2 H;  3I56 A;  3JC6 6;  2MO1 A;  1VQF A;  4KHP L;  4JI4 Q;  4A75 A;  4HJA A;  3S1M H;  4LFC L;  3KJP A;  2Q2T A;  2K52 A;  3NEN A;  4LF4 L;  4NXM L;  2JA5 H;  1P16 A;  4B3S L;  4JYA Q;  4GKJ L;  2HIX A;  4DK3 C;  4A3B H;  3B6Y A;  4X64 L;  1KRT A;  4A93 H;  3A0J A;  3K80 C;  5DLQ E;  1PH2 A;  1VQC A;  2IY5 B;  4DV6 L;  3PF4 A;  4B3M L;  4A3M G;  3CC2 A;  2NVQ H;  3M7N A;  1EFW A;  4BY1 G;  4DKA C;  5IT9 c;  3T1Y L;  4A3E G;  1OXU A;  2ATW A;  3GTQ H;  5M3M H;  1IZ6 A;  3HOX H;  1FJG L;  2WFW A;  1X3G A;  2B63 H;  5JEA J;  3KJO A;  1TXY A;  1KRS A;  1FL0 A;  3TRE A;  4A3I H;  2IX1 A;  4IFD G;  2NN6 I;  4GN4 B;  2ZM6 Q;  2IHE A;  3H0G G;  4BXX G;  3CME A;  4DR3 Q;  2K4K A;  4EX5 A;  1Q82 C;  4A3D G;  1KL9 A;  4DUZ Q;  4BBS G;  4BBR H;  4C3I H;  1QVC A;  1PH6 A;  2ES2 A;  4JYA L;  4OX9 Q;  2JEB I;  1Q46 A;  4DV3 L;  2Y0S G;  3RN5 A;  1PVO A;  2OWO A;  3E0E A;  3I7F A;  4L5R C;  4WJ3 M;  2KHJ A;  3ER0 A;  1PH9 A;  4A3B G;  1VQK A;  4JI6 Q;  1OXT A;  1GO3 E;  4IPD A;  4HJ9 A;  5C4X H;  3CCL A;  3CC7 A;  3PUV A;  4LF6 Q;  1SRO A;  3EBE A;  3ERS X;  4OO1 G;  4DR6 Q;  3HOU H;  2Z6K C;  3WWV A;  1TWH H;  4LF8 L;  2XTI A;  5M3M G;  2RHS B;  1CKO A;  1YVC A;  2BA0 A;  4H02 A;  2LSS A;  3I4O A;  4KHZ A;  4DR3 L;  4DR4 L;  1GVP A;  3UE1 A;  4LWC A;  2JA7 H;  1VQI A;  3HOW G;  3PO3 H;  2I5L X;  2PI2 A;  4XTC S;  3J7Z C;  4JC0 A;  4R4Q A;  1K8G A;  3DM3 A;  4OX9 L;  3I4M H;  3I4N G;  4IPG A;  4A4I A;  3G71 A;  1VQM A;  2GN5 A;  4LF5 Q;  3GTO H;  3U4V A;  4A3C H;  2QGQ A;  1MKH A;  1HNW L;  1Q81 C;  1KXL A;  1GD7 A;  3DLL A;  1Q12 A;  3BJU A;  1L2F A;  4P71 A;  5IYB G;  4LF9 L;  5HGQ A;  2KCT A;  4NXN Q;  1NY4 A;  5LMU Q;  1YJN A;  1Z47 A;  1KD1 C;  5GRO A;  1BKB A;  4IJH A;  3J81 i;  4DR6 L;  5ELO A;  1VQ5 A;  5FLX c;  2CWP A;  3W1G A;  1QUQ A;  2NZH A;  1SR3 A;  2ID0 A;  5J3B A;  4JI3 Q;  3AYH B;  1L1O B;  1VQN A;  3BZK A;  4OXP A;  2RF4 A;  4GOP B;  4OWT B;  2I0Q A;  1WYD A;  4JBK A;  2Q2I A;  2ZJP A;  1VQ7 A;  4LF5 L;  1Q8K A;  4MTN A;  3BU2 A;  3FP9 A;  5IYC H;  5M5W H;  3W1B A;  3I4M G;  4A3G G;  4AIM A;  2DGY A;  1HNZ Q;  5FJ8 H;  3J81 c;  2K75 A;  2N3S A;  3M85 A;  3S1N H;  3D31 A;  1X56 A;  1I3Q H;  4A3F G;  1YHA A;  1S3O A;  2IHF A;  4GN3 B;  2VQE Q;  2E8G A;  1Q86 C;  3CW2 C;  5H1S E;  1C9O A;  4AQY L;  2N78 A;  3AQQ A;  1M1K C;  3IRB A;  1HNX L;  4LUO A;  2OTJ A;  5K36 G;  4JI3 L;  1VQ9 A;  4GS3 A;  4JI2 Q;  1A62 A;  5HY6 A;  4B3T Q;  2R93 H;  3UDG A;  4QIW E;  3RR5 A;  4DR7 Q;  1AE2 A;  1KAW A;  4DV0 Q;  1XMO Q;  5IWA Q;  4BY1 H;  1EYG A;  4A3E H;  4JOI C;  2HHH L;  4HID A;  2ZJQ A;  1X55 A;  3PUY A;  3GO5 A;  1XTD A;  4YHH Q;  1D8L A;  1YIJ A;  4JBJ A;  3L7Z C;  1HNZ L;  1IBK Q;  1UE1 A;  4C3J H;  2CFM A;  2D0P A;  2JA6 G;  2KHI A;  5FLM G;  2UXD Q;  3T1H Q;  4DAY B;  5IYC G;  3CPF A;  3H0G H;  4LFA Q;  5IP9 H;  2MNA A;  2AHO B;  1QZH A;  3S1Q H;  4A3D H;  5FJ8 G;  2VNU D;  4PZ6 A;  5IE8 A;  3CPW A;  1WFQ A;  2VQE L;  2K5V A;  1B7Y B;  2PMZ E;  5C0X G;  3I55 A;  3M3Y H;  2HQL A;  1JJC B;  2UUB Q;  3S14 H;  4JBM A;  1XNR Q;  4NPS A;  1SMX A;  1EQQ A;  4B3T L;  2I5H A;  1YHQ A;  4OO1 I;  4APV A;  1XMO L;  2K5H A;  4DV0 L;  2NVT H;  3A5U A;  1VQH A;  4LF7 Q;  2E2I H;  1N32 L;  1CKN A;  1VQD A;  2RHQ B;  3ULP A;  1SLJ A;  5IP7 G;  3CCJ A;  4QQB X;  2R93 G;  5EAY A;  4O0A A;  4JOI A;  2MFI A;  3UE0 A;  4DV7 Q;  2VQF Q;  2CKZ B;  4JG2 A;  1VCI A;  1OXS C;  3L2P A;  3RZO H;  1V1Q A;  1J6Q A;  4GKK L;  3T1H L;  2UXD L;  3EIV A;  2A8V A;  4LFA L;  2Y0S E;  4DR2 Q;  1DGS A;  2CWA A;  3PF5 A;  2BA1 A;  4IO9 A;  1PA6 A;  2NZO A;  4JI5 L;  3HOW H;  2UU9 Q;  1E1T A;  1YIT A;  1K73 C;  1TWF H;  2UUA Q;  2C35 B;  3RLO A;  1QVG A;  1PYB A;  4GNX A;  4JI4 L;  1PYS B;  5IP9 G;  1LYL A;  1V9P A;  3I4N H;  3HOV G;  5LMN Q;  2UUB L;  5M5Y H;  1Z9F A;  1VQJ A;  1YEZ A;  2AKW B;  2VZA A;  4ME3 A;  4P72 A;  4QL5 A;  5E7N A;  3NEL A;  4Y52 H;  1WCM G;  5IYB H;  4YY3 Q;  1XMQ Q;  3ICE A;  2WAQ G;  1JT8 A;  4YWL A;  1A63 A;  2VQF L;  5GAH C;  1H95 A;  1HH2 P;  4X65 Q;  4AYB G;  2YV5 A;  1Q1B A;  4GLA C;  1PH4 A;  3S2D H;  3E9I A;  2CQO A;  2BH2 A;  3CD6 A;  5JJK A;  2UXC Q;  2F52 A;  4A76 A;  1VQG A;  2ZM6 L;  3EN2 A;  4TVA B;  1I6H H;  2RCN A;  4RG1 A;  2YU9 H;  5C3E H;  4PZ8 A;  5C4J H;  4DUZ L;  4DV4 Q;  1N36 Q;  2JA8 G;  2KCM A;  1QUQ B;  3L0O A;  3OYY A;  4A3G H;  4IFD J;  1Y1V G;  3RZD H;  2I5M X;  2V1C C;  1YBY A;  1XMQ L;  4DNI A;  2EQS A;  1YZ6 A;  4A3F H;  2PQA A;  4EQ5 A;  2H5X A;  3KF6 A;  4DUY Q;  4HIK A;  4R4O A;  3OW2 A;  1UEB A;  1J5E Q;  1EUJ A;  1I50 H;  3F1Z A;  1IBL Q;  4JI6 L;  3JAM c;  4LF6 L;  4GLV B;  1HZC A;  5AJ3 Q;  3I2Z A;  3TS0 A;  4UP8 A;  4A3K G;  4DV2 Q;  1PH3 A;  4OWW B;  2E2J H;  3A74 A;  4MZ9 A;  1LUZ A;  1X6O A;  4R1J A;  1FVI A;  1S72 A;  3AEV A;  1N9W A;  3F2C A;  1HZA A;  2F3I A;  3TRZ A;  2Z6K A;  5LMN W;  1ASZ A;  3KFU A;  1X3E A;  3UDX A;  1K3R A;  1Q7Y C;  4DV4 L;  2R92 G;  1N33 Q;  1HJP A;  5C44 H;  1X65 A;  2JA9 A;  5C3E G;  3CMA A;  2JA6 H;  1OXX K;  2L15 A;  2ZTD A;  3G48 A;  3K81 C;  5C0X I;  3PV0 A;  5FLM H;  2A1A A;  1VQ6 A;  3GTG H;  4B3R Q;  2YYZ A;  4YWK A;  2R7D A;  3U58 A;  1J5E L;  3NEM A;  1IBL L;  1XPO A;  1HZB A;  3PGZ A;  1X9N A;  3M4O H;  4NXN L;  4NB3 A;  5LMU L;  4X66 Q;  4C3H H;  5AJ3 L;  4P73 A;  3FHW A;  1AE3 A;  2E5L Q;  4L5S A;  1K0R A;  2YTV A;  4L5Q A;  4DV2 L;  5JJI A;  5GAD C;  1O7I A;  2IT1 A;  4DR5 Q;  1JB7 A;  2F4V Q;  4UPA A;  3K0X A;  4LUZ A;  1K8A C;  4A3L G;  4JI8 Q;  2VUM G;  4YWM A;  4JI1 Q;  4DV5 Q;  1NJI C;  1HR0 Q;  2R7Z G;  4IOA A;  3GTP H;  1U0L A;  2KEN A;  1N33 L;  5IP7 H;  2EIF A;  2LXJ A;  1MJE A;  3CCU A;  3CCQ A;  1VQA A;  4IFD I;  1UWV A;  1E22 A;  1M90 C;  4JI0 Q;  1E1O A;  1I5F A;  4JBW A;  4BA1 I;  2AWO A;  4L5T A;  3PIP A;  4X62 Q;  3F2D A;  1P8L A;  4B3R L;  1CKN B;  3U50 C;  5C44 G;  3A5Z B;  3STB C;  3CP0 A;  1XPR A;  1EWI A;  3S16 H;  3RLF A;  3GTM H;  1RIP A;  3KDF B;  3Q8D A;  4YCU A;  1I94 Q;  3PUZ A;  3HOV H;  4ALP A;  1X54 A;  1N34 Q;  1VQL A;  4KHP Q;  2JQO A;  1S40 A;  1UE5 A;  1EIF A;  1VS0 A;  4JI8 L;  2CCZ A;  3HKZ E;  4NXM Q;  4B3S Q;  4DV5 L;  4MNO A;  4HJ7 A;  1HR0 L;  1QVF A;  1XPU A;  1WCM H;  2IX0 A;  1R9T H;  4GNX B;  4X64 Q;  1XNQ Q;  1VQE A;  4JI2 L;  2AMC B;  1SN8 A;  1PFS A;  3J80 i;  2ASB A;  2WB1 G;  2DUD A;  5JEA G;  3G4S A;  4DR7 L;  1VQB A;  3MEF A;  5IWA L;  1ASY A;  2HIV A;  4JI0 L;  3SGI A;  2GVB A;  4UY8 C;  5M3F G;  4YHH L;  1V43 A;  3CAM A;  3KDF A;  3HKS A;  3OTO Q;  4PMW A;  2LXK A;  3HKZ G;  1GM5 A;  1IBK L;  2VW9 A;  1FJG Q;  1JMC A;  1IXR A;  2OQ0 A;  1I94 L;  2OQK A;  2JE6 I;  4QJF A;  1N8R C;  1SE8 A;  1N34 L;  3ZJY C;  1GKH A;  2WAQ E;  2JA8 H;  2A19 A;  1NBW A;  2QA4 A;  1YI2 A;  4J15 A;  2MO0 A;  3S15 H;  4TQU S;  2JEA I;  3S17 H;  2R7F A;  4R4T A;  4IOC A;  1NTG A;  3J80 c;  1Y1V H;  1HR0 W;  5IY0 A;  4BY7 G;  3S2H H;  1JJ2 A;  1T9H A;  4AYB E;  4LNQ A;  2HT1 A;  4POG A;  1XNQ L;  3KLW A;  4DV3 Q;  2ALY B;  5GAG C;  2QEX A;  1G29 1;  1U5K A;  1PV4 A;  1VQ8 A;  1XNR L;  3K7U C;  4X6A H;  2NVY H;  3PIO A;  5C0X J;  1L0W A;  4LF7 L;  2VS1 A;  4OON A;  4A3J G;  1W3S A;  3J7A 5;  2PNH A;  3OTO L;  4DV7 L;  4Y7N H;  4A3K H;  1IBM Q;  1CUK A;  1G51 A;  2PQA B;  1UE7 A;  3KF6 B;  1CKM A;  3HOY G;  5IYD H;  3MXN B;  1TWG H;  4PG3 A;  4DR2 L;  4LF8 Q;  4DR1 Q;  4JV5 Q;  1Y1W G;  3FKI G;  1BBU A;  3RNU A;  4QGU A;  4DR4 Q;  4XIG S;  4IJL A;  2GVA A;  2UU9 L;  4LFB Q;  2R92 H;  3UDI A;  2UUA L;  3M4Q A;  3JAM i;  2YTX A;  2XGT A;  3PO2 G;  5ELN A;  5LMN L;  4GLX A;  1K9M C;  4R4C A;  4UP7 A;  1IYJ B;  4P75 A;  5JJL A;  1OTC A;  4HIM A;  2EXD A;  1PH5 A;  2JA5 G;  4KI0 A;  3TS2 A;  5GAE C;  4GN5 A;  3UDF A;  5BR8 Q;  4YY3 L;  1HNW Q;  2ZTE A;  1TWC H;  1KC8 C;  4BA2 I;  4LF9 Q;  1BBW A;  3W5O A;  4A93 G;  4AH6 A;  4UP9 A;  2OTL A;  3M4P A;  1AH9 A;  1IBM L;  1PHJ A;  1EQR A;  2KBN A;  2VY3 A;  4X65 L;  4POF A;  3F2B A;  3H3V I;  2ZJR A;  3HFZ B;  4A3L H;  3U4Z A;  2FXQ A;  5GQO A;  3S24 A;  2VUM H;  2JJQ A;  2UXB Q;  3AFP A;  4DR1 L;  4JV5 L;  3PSI A;  2R7Z H;  3HOX G;  2BH8 A;  4LFB L;  2N49 A;  3K7A H;  2B63 G;  2UXC L;  3TQY A;  4C2M H;  4HIO A;  5IYD G;  3LGJ A;  4IPC A;  4A3I G;  4R4I A;  4P74 A;  1MJC A;  3H3V H;  3CQZ H;  4DK6 C;  4JI7 Q;  3K8A A;  5M5X H;  1OXV A;  1QZG A;  1N36 L;  2K5N A;  1NMF A;  1Y14 B;  1A8V A;  2Q2H A;  4BBR G;  2K14 A;  1WI5 A;  1IL2 A;  2NN6 G;  3CF5 A;  1KIX A;  5BR8 L;  1KQS A;  1CSP A;  1CSQ A;  1FGU A;  3STB D;  2N8N A;  2AWN A;  1D7Q A;  2NVX H;  4DUY L;  3GTK H;  1NMG A;  1MIU A;  4HJ5 A;  4OWX B;  3CCS A;  4O2D A;  4FDB A;  2VL6 A;  1RL2 A;  1XJV A;  1B8A A;  1E24 A;  2UXB L;  1L1O C;  2B3G A;  1VQ4 A;  4YCV A;  1A0I A;  2PI2 E;  1C7Y A;  5C4X G;  4AQY Q;  4GOP C;  3HOZ H;  1G6P A;  2R6G A;  3NBH B;  1HNX Q;  3TEH B;  1LTL A;  1JE5 A;  3J81 j;  1NE3 A;  1X3F A;  2UUC Q;  3HOU G;  4JI7 L;  1C0A A;  1EOV A;  4KLK A;  3RN2 A;  1TWA H;  4K0K Q;  3PUX A;  4PZ7 A;  2YTY A;  4YCW A;  3RLN A;  2JA7 G;  5M3F H;  1UE6 A;  1WOC A;  2OCE A;  3BZC A;  3ULL A;  1LM0 A;  3PO3 G;  4WJ4 A;  2HHH Q;  1E7Z A;  1K83 H;  4LW1 A;  4DAM A;  1Q1E A;  1YJW A;  3KF8 B;  1PH1 A;  3CC4 A;  1YHB A;  1VQP A;  3KYH C;  4JCV E;  3ULJ A;  3CCR A;  4A3C G;  1W2B A;  2E2H H;  3CXC A;  2JK8 A;  4X66 L;  1WJJ A;  4DV1 Q;  2WB1 E;  3GD7 A;  1EIY B;  4DPG A;  4BY7 H;  3AFQ A;  2E5L L;  3PUW A;  4RMF A;  3CCV A;  2Q2U A;  3GTL H;  3S1R H;  1L1O A;  3CCE A;  3VDY A;  4DR5 L;  2F4V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...