4YHHL

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 11
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhL00
3K0XA 4HJ5A 4JYAL 4DV7Q 4P71A 4LFBL 3I7FA 4DK6C 2Z0SA 1K3RA 4UP8A 1EIFA 4DV2Q 1XNRL 4XIGS 2A1AA 2UXBQ 1VQFA 3CPFA 5M3MG 5IYCH 2E5LQ 4R4TA 4LUZA 3PUXA 4R4QA 4XTCS 2ZTCA 3ULJA 4BY7H 3TREA 2IX1A 4X66L 4DR7Q 2R7DA 4IPGA 3T1YQ 3EBEA 4LF9Q 1Q81C 4MZ9A 2HT1A 1KRSA 3AEVA 1EOVA 1OXUA 5HY6A 2QA4A 1N33L 1HR0W 1Q8KA 4JOIC 1PH6A 1YHBA 2KHJA 1OTCA 2PQAA 2JEAI 4A93G 2CQOA 1PHJA 4HIMA 4LF8L 2JA6G 1FL0A 4JBWA 4YWKA 4DV3L 4A3MH 1QVGA 1SN8A 1CSPA 3CCVA 3S1RH 4HJAA 1PH7A 4LF5Q 4GLVB 1D7QA 4HIDA 5FJ8G 3H3VH 5ELOA 4AQYQ 2LSSA 1N34L 4ME3A 2YV5A 1PYBA 2ZTEA 3CCUA 3TS2A 2UUAL 2N49A 5GADC 4OX9L 4RG1A 3CXCA 2I5LX 4BXXH 3AQQA 1TWAH 4JYAQ 3RLNA 2ZTDA 2AWNA 2R93G 1YBYA 2AWOA 4DR1L 3ZJYC 1KAWA 1VQCA 4MTNA 4A3CH 3E9HA 3J81i 4JBJA 3T1HL 2JK8A 3I56A 2JJQA 4KI0A 2F3IA 4YWMA 1Y1VG 1NMGA 1HNWQ 2IX0A 4X64L 1VQMA 3RNUA 1FVIA 3OYYA 4APVA 3T1YL 1CUKA 2QGQA 4A3JH 3TRZA 1L1OB 4O2DA 1X54A 1U5KA 4A3EH 2JA8H 2VUMH 1VQ5A 4PZ6A 1E1TA 5FJ8H 5GAHC 4R4CA 3PSIA 4QIWE 4DR3L 1EYGA 3S2DH 2UUCQ 1N32Q 1VQBA 4HIOA 1Q1EA 1XMQQ 2VW9A 1AE2A 1J6QA 1YIJA 4B3RL 4NPSA 3ICEA 4OWTB 1VQPA 4X65Q 2WAQE 4LFCL 4H02A 1N34Q 4UP9A 4B3SL 4QQBX 3PUVA 5DLQE 2HQLA 3F8TA 4X62L 3PO3G 5GQOA 4PMWA 2NVXH 2UXCQ 4JI4L 4JC0A 4DR2L 2CWAA 4HJ9A 5M3MH 5IYCG 4O0AA 1UE7A 4DV0Q 3MXNB 4OO1G 3PIOA 5LMUQ 1XPUA 1XTDA 5C44G 3H3VI 5ELNA 5IWAL 4GOPB 1L1OA 1K8GA 2JA5G 3GTOH 1X65A 1VQ9A 4LF7L 1HNWL 3CW2C 2OQ0A 3E9IA 4JCVE 4AIMA 4A3MG 3I4NH 1OXXK 3JC66 1E3PA 1X3GA 2PMZE 2I5MX 2YU9H 1CKNA 4IJLA 2MQHA 3AFQA 4C2MH 1BBWA 4LF7Q 5IT9c 3CMAA 2B63G 2E2IH 1YHQA 1MIUA 3SGIA 2GVAA 1H95A 3PUYA 3S14H 2PQAB 2RHQB 2MO0A 1HZAA 2ZJRA 3ER0A 1MJEA 4P75A 3H0GG 3PO2H 3OTOL 3M4PA 1Y1WH 3RZDH 5C3EH 1JJCB 2R93H 3E0EA 2R7ZH 4X65L 1YVCA 4UY8C 4X6AH 2NZHA 2VZAA 2DGYA 2PI2A 4R1JA 3M3YH 4BY7G 1EIYB 4YY3Q 4Y52H 1XMOL 4B3SQ 1VQLA 1OXTA 5C0XJ 4JI6Q 4GKJL 4FDBA 2K5VA 3HOUG 1VQAA 5FLMH 2R6GA 1N36L 4OWXB 4IOCA 4GLXA 3HOWG 1GD7A 4DR2Q 1P8LA 1X3EA 5LMNL 3RLOA 1U0LA 4MNOA 4DV0L 4DR5Q 1HH2P 1QZGA 1KIXA 3GTLH 2OTLA 2JA6H 4JI3L 3UDFA 3KDFA 3CCMA 4A93H 1Q7YC 3CCQA 3ULLA 1BKBA 1W3SA 2GVBA 2IHFA 3CCRA 2A19A 2JA8G 4KLKA 1A8VA 1UE5A 3TEHB 3GTGH 2YTVA 2FXQA 2HIVA 3CPWA 3CF5A 1NBWA 1VQ6A 4DV1Q 2UXDQ 1KHIA 1TXYA 2D0OA 1YZ6A 4QGUA 2NN6I 2EQSA 4OONA 4DUZQ 1K0RA 1QUQA 1KXLA 1V9PA 3J81j 1G291 5E7NA 1X6OA 1Q12A 4P72A 4LF4Q 3PGZA 3CMEA 3I4MH 1VQ7A 2BA1A 1PFSA 4DAMA 4JBMA 4JI8L 4DR4L 3HKZE 2CCZA 2E2HH 1X56A 4EX5A 1SRUA 1IBLQ 1VQ4A 4YCWA 3S1MH 3U58A 2VNUD 4PZ7A 1B8AA 5M3FH 2QEXA 3IRBA 1JMCA 1SROA 1TWHH 3S2HH 2CKZB 1J5EQ 2Q2IA 4A3GH 4DUYQ 3M4OH 2R7FA 3WWVA 1YJWA 4JBKA 3KOJA 4JI0Q 4DV5L 3FP9A 5GROA 2L15A 1UEBA 4L5SA 4DR5L 5AJ3L 1BBUA 5IP9H 2VQFL 4IO9A 4JI7Q 2YTYA 1SE8A 4YWLA 4JI3Q 2E8GA 5H1SE 4AH6A 4HJ8A 4DV7L 4JI5Q 4BA2I 4A3IG 4LFBQ 3S24A 2IY5B 2MO1A 2MFIA 4LUVA 1Y1WG 4B3ML 1SR3A 1NE3A 3I2ZA 2K5NA 2E5LL 4DV1L 3BU2A 1PA6A 4NXNL 2UUBL 4POFA 1SMXA 4DR7L 4DK3C 1QZHA 1W2BA 1PH2A 2D0PA 2YYZA 2VQEL 3BJUA 4A3IH 1YITA 4C3HH 3HOZH 3GTQH 3EIVA 4RMFA 2ZM6Q 2NVTH 3D0FA 4LF4L 1D8LA 4A3DH 3M85A 4A3EG 5M5YH 2JA5H 4OWWB 2PI2E 4JI8Q 4NB3A 4DR4Q 1PVOA 2IT1A 4DV3Q 1I6HH 3DLLA 2I0QA 2K75A 4BBRH 4B3TQ 3VDYA 2Q2UA 1QVFA 1VQOA 3K7UC 4ALPA 3HOWH 1J5EL 1N8RC 1IBKQ 3S16H 2WFWA 4AQYL 1EWIA 1IZ6A 4IJHA 4GN3B 2B3GA 4JI0L 4DV5Q 4A3KG 1WCMH 2EIFA 3AYHB 4P74A 1JJ2A 2YTXA 3K8AA 5JJIA 3CCLA 1CKOA 3H0GH 3PO2G 1AH9A 1X55A 2HIXA 3UE1A 5HGQA 1UWVA 2HHHQ 4JI5L 1FJGL 2H5XA 5C3EG 1VQEA 2DUDA 4DR1Q 4GLAC 4LNQA 4C3JH 4HJ7A 1JE5A 2ES2A 4Y7NH 4BBSG 2RF4A 1VQDA 4NXNQ 3RN5A 4X64Q 1DGSA 3ULPA 4DNIA 4A3LG 1YJNA 4L5TA 3FKIG 4YCVA 4AYBG 4IPHA 3CAMA 3M7NA 3UDIA 1NY4A 4AYBE 3F2DA 3HOUH 2CWPA 2WB1E 4LW1A 3U4ZA 3S1QH 4WJ4A 1JJGA 4A75A 4DV6L 2ZM6L 1I94L 5C44H 2AHOB 3RR5A 3GTJH 1C7YA 3KFUA 2F52A 3F2BA 5JJLA 5IE8A 4A3KH 2JA7G 1VQKA 1N32L 5FLMG 3PF4A 4B3TL 4KHPL 1NJIC 4B3RQ 1EUJA 2KCTA 1EFWA 1HR0Q 3PUZA 4LFCQ 2K52A 2OQKA 3DM3A 1M1KC 4OO1I 3HOYG 2RHSB 3KF6B 1HZ9A 2UU9L 1K73C 2WB1G 4X62Q 2N8NA 4A3FH 3G4SA 4DV4Q 5GAGC 2ATWA 4JI4Q 1UE6A 1FJGQ 1Q82C 4JI2Q 3L0OA 1IXRA 4A4IA 5IYDG 1VQIA 5M5WH 1TWGH 3JAMc 4DV2L 4POGA 3HOVH 3HOYH 5IWAQ 1EQRA 1GKHA 1HZCA 2IHEA 4DAYB 1IL2A 3S1NH 1OXVA 5IYDH 4LWCA 2N78A 2Y0SE 1CKNB 2A8VA 3TQYA 1I5FA 1Q1BA 1IYJB 1Y1VH 5GAEC 4A3FG 4X66Q 3NEMA 4BY1G 1X3FA 3GDEA 4LF9L 5IP7H 4QJFA 3STBC 4JV5L 1PH3A 2K4KA 2MNAA 2WP8J 1A63A 4OXPA 4J15A 5J3BA 1E22A 3KF6A 1I94Q 3Q8DA 3HOXH 2OTJA 3L2PA 5JEAJ 3HOXG 1VQGA 1LUZA 2F4VL 2CFMA 1L1OC 4GKKL 1WFQA 3OTOQ 3CCJA 1QUQB 1HJPA 4LF5L 4KHZA 3J81c 4KHPQ 3UDXA 4BXXG 1XPRA 3HFZB 1PH1A 3H15A 1P16A 1YJ9A 1PH4A 1HR0L 5JJKA 2V1CC 2BH8A 4YY3L 3CD6A 2NN6G 4DKAC 1FGUA 4JI6L 3J80c 1K83H 3RN2A 1NTGA 2UU9Q 1RL2A 4LUOA 3S15H 3FKIH 3MEFA 4OX9Q 4UPAA 4DV4L 1VCIA 4LF6L 3PO3H 2JA9A 1XNQQ 4JI2L 3K81C 4YCUA 1JB7A 1E24A 1AE3A 4GN5A 1Q86C 2VUMG 3T1HQ 2K5HA 1LTLA 3TS0A 1ASZA 3NENA 3KF8B 3GTMH 4K0KL 3B6YA 1O7IA 3KYHC 1WOCA 5FLXc 3FHWA 4IPCA 3D31A 2R92G 3CQZH 3A5ZB 4JV5Q 2WAQG 2R92H 3F1ZA 1XPOA 1V1QA 2EXDA 1EQQA 2UXDL 3KJPA 1N9WA 3ERSX 2KHIA 1PV4A 4DUZL 2VY3A 5BR8Q 1KD1C 4DR3Q 4BBRG 2F4VQ 2UUCL 4WJ3M 4GKKQ 2VL6A 3HKSA 3J7A5 1XMQL 4JG2A 2LXKA 1YNXA 1KL9A 1TWCH 3I4OA 3A74A 1NMFA 1HNXQ 3CC2A 2Z6KC 3W1GA 3HKZG 1VQHA 2XTIA 1KQSA 3G71A 1IBMQ 2ID0A 2RCNA 4GN4B 4A3DG 1HZBA 1I3QH 1Q46A 1IBLL 2OCEA 2D62A 1CSQA 4QL5A 3W1BA 3NELA 3CC7A 1ASYA 3HOZG 1SFOH 3OW2A 3NBHB 1B70B 1PYSB 4HIKA 4DUYL 4LF6Q 2UXCL 2R7ZG 1Z9FA 3G6EA 1XNQL 3LGJA 4L5QA 3RLFA 5LMUL 1VS0A 2PNHA 3PCOB 4YHHL 2VQFQ 4NXML 4A3BG 2B63H 1WCMG 3JAMi 3GTKH 4L5RC 1C9OA 2E2JH 1A62A 3A0JA 1BVSA 5C0XG 1KRTA 1K8AC 2K14A 2ZJQA 5M5XH 4GNXA 4DR6Q 4IFDI 4PG3A 1JT8A 2AKWB 4B3MQ 3L7ZC 2Y0SG 1TWFH 1S72A 4IOAA 5C4XG 5JEAG 4K0KQ 5LMNW 1HNZQ 1WI5A 4TQUS 3F2CA 2UUBQ 3PIPA 3KJOA 1VQJA 2JE6I 1SLJA 2JQOA 2JEBI 2Z6KA 2VQEQ 3J7ZC 1WYDA 5BR8L 4PZ8A 2OWOA 5M3FG 3UE0A 1PH9A 2Q2TA 4A3JG 1T9HA 2I5HA 3S17H 1G6PA 2KENA 1KC8C 1HNXL 1IBML 3I4MG 1MKHA 4BA1I 1S40A 1RIPA 1PH5A 1E7ZA 1V43A 1XJVA 3K80C 4BY1H 1XMOQ 3PUWA 4C3IH 1GM5A 2JA7H 2NVQH 2BH2A 1GVPA 2KBNA 5IYBG 1S3OA 5C4JH 1YEZA 4LFAL 4GKJQ 4JOIA 2BA0A 2AMCB 3GO5A 1N36Q 1IBKL 3EN2A 3HOVG 2N3SA 4JI1L 3CCSA 5LMNQ 1A0IA 1WJJA 2B29A 4UP7A 3AFPA 4YHHQ 4NXMQ 4IFDJ 3CP0A 3U4VA 1QVCA 5IP9G 3I55A 3I4NG 4GOPA 5K36G 2HHHL 1R9TH 2C35B 4R4IA 3GTPH 3PV0A 4DR6L 1Z47A 3BZKA 4A3GG 1XNRQ 2UXBL 5C4XH 1Y14B 2Q2HA 2LXJA 3KDFB 1MJCA 3G48A 4DPGA 3BZCA 1B7YB 1HNZL 4QY7A 4EQ5A 4P73A 1CKMA 3CCEA 1LM0A 1GO3E 1VQNA 3CC4A 3PF5A 3J80i 4A3LH 5IY0A 3A5UA 3UDGA 3W5OA 1UE1A 3K7AH 2ZJPA 1X9NA 1PH8A 4GS3A 1G51A 1VQ8A 2K50A 1YI2A 1E1OA 4DV6Q 1YHAA 1N33Q 3STBD 4A76A 2ALYB 1M90C 3GD7A 4A3CG 2KCMA 2GN5A 5EAYA 1L0WA 4A3BH 2ASBA 4GOPC 4LF8Q 4IFDG 3M4QA 1LYLA 5IYBH 5C0XI 4GNXC 5IP7G 2VS1A 3RZOH 4LFAQ 2NVYH 3KLWA 4IPDA 1I50H 2NZOA 3U50C 1OXSC 4R4OA 4JI1Q 2XGTA 4TVAB 5AJ3Q 1L2FA 1K9MC 2UUAQ 4BBSH 3M9BA 4JI7L 4GNXB 1C0AA
chains in the Genus database with same CATH superfamily
4JYAL 2B2YA 4DV7Q 4N8X1 3I7FA 4IUQA 2Z0SA 1SMYC 1A2UA 4UP8A 5NUCA 1S4ZA 2CW0D 4KY7A 1SAPA 1BOSA 2ZTCA 4MTKA 3ULJA 1DJRD 2PPBC 4LF9Q 4RA8A 2HT1A 2EJGC 2XN9C 2XRQD 1N33L 3K5OA 1Q8KA 2KHJA 2IWHA 1G8ZD 1PHJA 2JA6G 1D5ZC 1GXDC 1SN8A 5FLXE 3S1RH 2BDOA 2BE5C 1BR9A 3NPPA 5ELOA 3S2DB 1TKWB 2B8GA 1WD1A 3TS2A 3CCUA 2N49A 3SR1A 3AQQA 4JYAQ 1YBYA 1STAA 4MTNA 2EYFA 4ZCKA 3J81i 1EZ8A 4JBJA 2JJQA 4KI0A 4YWMA 3QIAA 5AFWA 2K5WA 1FVIA 3OYYA 1CUKA 3LWEA 3TRZA 4A3JH 2NVYB 1X54A 2Z4IA 1HXYD 1SE4A 2P5ZX 2VUMH 5G3LF 1E1TA 5FJ8H 5L37A 1FYCA 1JB3A 1EIGA 3X3MA 3LWUA 1N32Q 1AE2A 1CFMA 3ICEA 2EYPA 3I4LA 2WAQE 2BCOA 4EQOA 4HSPA 2HQLA 1QJOA 1JWUD 2O2LD 2UXCQ 4JI4L 4QIWB 4V0BA 1V8QA 2F3WA 3MXNB 3RUZA 5LMUQ 5IWAL 2FHTA 1KAAA 4CHTB 1SNMA 1VDZA 4LF7L 1BNZA 3CW2C 2OQ0A 3E9IA 4JCVE 3SK5A 4AIMA 3JC66 4IJLA 4EQNA 1E2WA 5C4JB 3OIQA 1BBWA 5K5PA 5IT9c 3CMAA 2OEOA 1NR2A 2AQ3B 1HZAA 2ZJRA 5CC4A 3M4PA 5C4HA 1JOKA 5C3EH 1KLGD 3I4NB 4CKEA 1V1PA 1YVCA 4UY8C 2VZAA 4R1JA 2PI2A 2H1EA 2PMZB 1VQLA 3HOUG 1MGSA 5FLMH 2R6GA 1N36L 4OWXB 2A69C 1X32A 1PTOF 4MNOA 3X3NA 1FR3A 1HH2P 4UHVA 1HUNA 4DFAA 1I4GA 3R2TA 3TN2A 2B2TA 1I4RA 2WIIB 4QUFA 1TS4A 2A5HA 4K2KA 1UE5A 4EVOA 3I91A 3CPWA 1NBWA 1R9TB 2CW0C 1PTOB 4RGOS 4XQQA 1QUQA 1X6OA 4P72A 1MD2D 2K32A 3PGZA 1LT4D 1EU4A 5KNBA 3HKZE 4X3UA 1SRUA 2VNUD 1VQ4A 2QEXA 3S2HH 2Q2IA 3HOWB 3M4OH 4BBRB 4JI0Q 4FP5D 1RF2D 1BBUA 1EY8A 2YTYA 1G2TA 2G5DA 1I4HA 5H1SE 4AH6A 4LFBQ 4JI5Q 4BA2I 4A3IG 3S24A 4A3DB 2WV6D 4M8AA 4RHRA 3J80E 5IGDA 3FKIB 1F2MA 1K83B 3DEPA 2B63B 2UUBL 4DK3C 1W2BA 1TS2A 2D0PA 2YYZA 5I6YA 4A3IH 1YITA 4CJ1B 3HOZH 2PZTA 3I8ZA 2ZM6Q 2NVTH 1YNNC 2SDFA 1ESRA 4OWWB 2IT1A 4DAYA 2X6LA 1KABA 4DV3Q 2I0QA 2K75A 4UAIA 4B3TQ 1DOMA 5F2DA 3K7UC 1PMRA 4X3TA 4HCSA 1N8RC 2WFWA 4IJHA 2B3GA 4JI0L 4HN7A 2L11A 3E0JA 1WCMH 4BWGB 3BVGA 4RFBA 3Q24A 1JJ2A 2IPKD 2A68D 1AH9A 3UE1A 1UWVA 4JI5L 1FJGL 5C3EG 1MI2A 4ZRZA 5EKIA 1BUVT 3ITPA 3K6OA 2KCCA 1WTVA 4NW2A 2RF4A 5JOBA 5IGCA 4DNIA 3QR8A 3QJYA 2FMCA 4AYBG 1U4RA 4IFDH 2PZUA 2CWPA 1OO9B 5EGTA 2ZM6L 1B50A 1HUMA 3S15B 2AHOB 3TMEA 4A93B 2EPBA 1IW7D 2JA7G 2B8FA 1Q8IA 4B3TL 4K8JA 4KHPL 4FO2A 2Y0SB 1TQOA 2KCTA 2OQKA 3DM3A 1M1KC 4S3SA 2C5CA 1HZ9A 1S5CD 2XWBB 4DV4Q 2Z4HA 3HG9A 5GAGC 3P20A 5CV5A 1FJGQ 3VR4A 4POGA 2NVQB 5ELCA 5IYDH 1I4XA 4ZQ3A 2Y0SE 4XYOA 1FNVA 3U9OA 1I5FA 3HZXA 1Q1BA 1Y1VH 3C1FA 5GAEC 2SEBD 3TP6A 3HOVB 3NEMA 4RKLA 1X3FA 4XT3B 4NDXA 4NP5A 5D14A 3KBXA 4OXPA 5J3BA 1E22A 4B9XA 3KF6A 3Q8DA 3HOXG 3F2UA 4WORA 5M3MB 1LT3D 1FNWA 3D6WA 4QB4A 4KHPQ 4BXXG 5J1ZA 4DNTB 3HFZB 3KLSX 1CQFA 1STHA 2E2JB 2HCIA 1PYWD 2EXZA 4A3KB 4YY3L 3MXGA 4KJOA 1RJTA 3FMCA 5BN4A 1JOQA 4DV4L 2XNAC 2JA9A 2RSNA 3KBGA 2RDFA 4IUNA 1BXTA 2K5HA 3BVMA 3KF8B 3GTMH 4K0KL 1G6ZA 5JVG3 1AFPA 3A5ZB 4L63B 2R92H 1EQQA 1F2YA 4BS9A 4OIJA 1NNXA 3C3LA 1B44D 3D4DA 4IALA 2AQ2B 5KIXA 4JG2A 1KL9A 1TWCH 1TWAB 3CC2A 2Z6KC 3DEOA 5CV6A 1I6HB 4A3DG 2RCNA 1T5EA 1HZBA 5I2YA 1XYIA 4DK1A 4C3HG 3I70A 4QL5A 3W1BA 3CC7A 2B2WA 3HOZG 1SFOH 4Q0FA 4HIKA 3PO3B 4DUYL 3T16A 2KCNA 3TP7A 2OXPA 2VQFQ 4YHHL 1STNA 4K0KQ 1C9OA 2ZJQA 3A0JA 3QG1A 1BVSA 2NTTA 5M5XH 3R2IA 2AKWB 2ENBA 2F0DA 3C1EA 2Y0SG 1TWFH 1S72A 5LMNW 2XWJB 5E4XA 3PIPA 4BY7B 2MP1A 2Z6KA 2H4OA 3J7ZC 1PH9A 4K6DA 4Q5VA 2Q2TA 3CKIB 3S17H 4KKTA 3C2PA 1EYDA 3S1MB 2QEJC 3VYUA 3PUWA 4C3IH 2JA7H 2BH2A 2KBNA 5IYBG 4GKJQ 4LFAL 4LK1C 1H9JA 2JYOA 4A3FB 2N3SA 1CM9A 1F77A 2B29A 2MHVA 4UP7A 4YHHQ 4CDEC 3CP0A 1SYBA 1YNND 1JICA 3GTPH 3H3VC 3PV0A 1WTQA 2IX3A 5JPNC 1B9NA 1PZKD 1SE3A 1GUOA 1A6XA 2L5TA 4DPGA 4QY7A 4P73A 2A74C 3CCEA 3NBIA 1LM0A 1VQNA 1QNUA 3G6JB 1KDAA 1X9NA 1PH8A 2BOSA 4GS3A 1G51A 3S1QB 4A3CG 4B08A 5EAYA 4LF8Q 3VR3A 1LYLA 1H9RA 4GNXC 3RZOH 4LFAQ 1A3VA 3URYA 3PQIA 3VR5A 4R4OA 4J6HA 3L9AX 3KUPA 2XGTA 4TVAB 5AJ3Q 4FVMA 3VR6A 1K9MC 2UUAQ 4BBSH 4IURA 4GNXB 1C0AA 1ENFA 1GJXA 5J39A 1ZKOA 5KYLA 4XIGS 1L0YB 5M3MG 2E5LQ 4LUZA 1M4VA 4R4QA 4DR7Q 4X66L 3H94A 4FF1A 1KRSA 3BYYB 5M9OA 1EWHA 1EOVA 5HY6A 1WTWA 1SYGA 4A93G 2QDBA 4LF8L 1FL0A 3MXPA 4A3MH 3CCVA 1CT1D 1PH7A 2J4XA 2MUYA 4HJAA 4LF5Q 4GLVB 1D7QA 4HIDA 3D4RA 4EQPA 2YV5A 4HMIA 3MEHA 2UUAL 5GADC 4OX9L 1SXTA 2IW3A 5IODA 3CXCA 3RLNA 4HMJA 2K7VA 4XT1B 3E9HA 1CHPD 2JK8A 3I73A 3I56A 3T1HL 2F3IA 2RDGA 4BBSB 2JSOA 1HNWQ 3IL8A 1QOHA 4APVA 3V05A 4O2DA 1XWEA 3KF8A 2EYLA 4A3EH 1VQ5A 4PZ6A 1BCPD 1MHWC 3PSIA 4DR3L 3R93A 3ERQA 1VQBA 2RVLA 4HAEA 1XMQQ 1B2TA 1J6QA 4NPSA 4OWTB 1VQPA 3M7GA 2TSSA 4UP9A 2F0IA 3DWPA 3AMUA 3PO3G 5GQOA 1WD0A 2CQAA 4JC0A 4NMZA 4DR2L 4HJ9A 1JC7A 5IYCG 1UE7A 5IT9L 4OO1G 3A8JE 1XTDA 5C44G 4K5VA 4GOPB 2LY7A 3GTOH 1QWYA 1X65A 4ZKBB 1VQ9A 2SOBA 1HNWL 3Q22A 4C1NI 1OXXK 1STGA 5HURA 1X3GA 2YU9H 1CKNA 3NQTA 2BE5D 1DYQA 1A3UA 2E2IH 4TKOB 3D4WA 1MIUA 3W3AA 3PUYA 1LTBD 1U4PA 1ML0D 2MO0A 2RHQB 1SEBD 1FD7D 1MJEA 3PO2H 4QMGA 3K5MA 2QF7A 2YU9B 4FYDA 1Y1WH 4DAPA 3E0EA 5KRUA 2DGYA 3N52A 4PQXA 1OXTA 2K5VA 5TSSA 3NTHA 4U68A 5FO8B 1TWFB 4GLXA 2AQ1B 4ULLA 3HOWG 2DY8A 4DR2Q 4DR5Q 1KIXA 2OTLA 1IL8A 4KN4C 5KGUA 5E1FA 3FVQA 2QCPX 3CCMA 1WTRA 5C44B 3CCQA 3ULLA 1BKBA 3NXWA 1W3SA 2IHFA 1LTSD 3FRPB 3HOUB 2HIVA 1VQ6A 1HTLD 2N55A 3TP5A 1XTCD 4OONA 4UDUC 4DUZQ 4Y7NB 1BCPC 1KXLA 3J81j 2KJXA 1EWCA 2HD3A 4TSSA 1TWCB 3CMEA 1VQ7A 2CHBD 3S9WA 2BA1A 2CCZA 3QOJA 3EVQA 1SSOA 4P2CB 2E2HH 3FEWX 2WAQB 1DCZA 3K5LA 2PZWA 2R92B 2CKZB 3P1HA 3QOLA 4U673 2R7FA 4JBKA 3KOJA 4L5SA 4DR5L 3GTMB 1AZQA 5IP9H 5CBAE 4JI7Q 5EPLA 5ISRA 4YWLA 2E8GA 5C0XH 4CKCA 5ELDA 3GTQB 1B1ZA 5ELEA 2F0GA 2K5NA 1Y69U 1PA6A 4NXNL 1VMCA 1XX8A 1SMXA 3E6ZX 1QZHA 4KKUA 2VQEL 1I4PA 3BJUA 5FLXL 3GTQH 2F0SA 1KNEA 3BG3A 2B2UC 3BDOA 3D0FA 4A3EG 3V96A 5A2QE 1VMPA 2B2WC 4Z9CB 1JWMD 1QCBD 1SJHD 1GHKA 5BN5A 1VQOA 3OWEB 4RGMA 1HHVA 1MBYA 2DNEA 3S16H 1PRTC 1EWIA 1SBBB 1IZ6A 4AQYL 4P74A 2YTXA 3MFYA 5JJIA 2D9UA 1CKOA 4KD3A 1WVLA 2V4DA 3PO2G 2ICIA 5HGQA 2HHHQ 3DXJC 2H5XA 5DEHA 1B9MA 2F0HA 3H09A 4DR1Q 2DUDA 4GLAC 4KKSA 4HJ7A 3TZDA 5EBCA 4Y7NH 4BBSG 1CK1A 4H0LC 4NXNQ 4X64Q 3ULPA 1V1OA 1ZYRC 3FKIG 3WOEA 3M7NA 1NY4A 2KQ3A 3F2DA 2B2VA 3HOUH 1UAPA 3S1QH 1JJGA 1LACA 5C44H 5A2QL 1JORA 3RR5A 2Q8RE 2XIWA 3LNNA 2F52A 5JJLA 5FLMG 1NJIC 4B3RQ 3JAML 1EFWA 3PUZA 4LFCQ 5T1IA 1F9SA 1EY0A 1V1PB 2KEDA 1S5ED 2WB1G 4X62Q 2N8NA 4DU9A 2SNSA 4A3FH 3G4SA 1UE6A 3FPPA 5C6AA 3L0OA 4G7OC 5IYDG 4FF4A 1VQIA 3PO2B 2JA7B 2LKVA 3HOYH 1IL2A 1AN8A 1HZCA 4HCEA 2N78A 2A8VA 2E2IB 5T1GA 3TQYA 1SMYD 3HOYB 4LF9L 3GDEA 4JV5L 3SVMA 2L4NA 4PMCA 3SXHA 1A63A 3EFXD 4RGNA 2VB2X 3MXNA 1BQQT 2J0TD 3OMGA 2OTJA 4IUUA 1LUZA 2CFMA 4GKKL 1Y8PB 1J9OA 3OTOQ 3CCJA 1QUQB 3MFGA 3UDXA 3H15A 1P16A 4R8NA 5JJKA 1FGUA 4JI6L 3J80c 1JR0D 1K83H 3RN2A 3FKIH 4I7AA 4I7ZC 4UPAA 5KNDA 3PO3H 1XNQQ 2IJ0A 1E24A 1AE3A 4GN5A 5IIFA 2VUMG 1LABA 2F0OA 1LTLA 3TS0A 1GUWA 3NENA 2EYOA 1O7IA 1R4PB 1WOCA 3FHWA 4IPCA 3D31A 2R92G 4JV5Q 3JAME 1PRTB 2WAQG 4KK7A 2UXDL 2EXDA 4F8MA 4KY6A 2O5JC 2KHIA 2VY3A 2QKIC 1KD1C 2HCCA 1PRTF 4GKKQ 2VL6A 3HKSA 3S16B 1MSGA 2LXKA 1TS5A 1NMFA 1CZWA 1IBMQ 3G71A 2Q8TA 4O1NA 3R3OA 1S5FD 1IBLL 1GUSA 1HTPA 2NWGA 2D62A 2OCEA 1PFMA 1RODA 4KMUC 1B70B 3VYTA 1SNOA 4G57A 3EQLC 2UXCL 2R7ZG 3G6EA 1XNQL 1B4OA 4L5QA 4K8IA 1LV9A 5LMUL 2ZXRA 4FNFA 4L5RC 2E2JH 4LF7Q 5C0XG 1H95A 4DR6Q 1KRTA 1TY2A 4IFDI 2QILA 4B3MQ 2RCFA 1STYA 1EIHA 4IOAA 4KY5A 4G4KA 2NYZD 5DAUA 2F0UA 2JE6I 1SLJA 5D65A 3J81E 4IUTA 2VXWA 4YIJA 2O4XA 3QWNA 1BBXC 2OWOA 3Q6SA 3P7JA 4OL7A 4I65A 2FFKB 1IBML 1D1KA 1MKHA 1PLFA 1Y1VB 1S40A 2F0KA 1TIID 1XJVA 2E2HB 4R8IA 2F03A 1GM5A 2NVQH 5ELBA 5C4JH 1N36Q 3BS1A 1IBKL 3M4YA 3EN2A 4DNRB 3HOVG 2EY2A 3OHXC 3CCSA 2D2CC 1A15A 5IP9G 3I55A 3BYTB 2C35B 4DR6L 4R9WA 5K36H 3BZKA 1XNRQ 2UXBL 3DMUA 2D5DA 1ONLA 2Q2HA 3KDFB 3BZCA 2HDMA 1B7YB 2NN6H 2K33A 2B2TC 1D2BA 1HPCA 2J7ZA 3MXUA 5I6WA 3J80i 3W5OA 1UE1A 2ZJPA 2B2VC 1YI2A 4C3JG 4DV6Q 3GTPB 1M90C 2ALYB 4F7XA 1HFNA 2KCMA 2A6EC 2GN5A 1L0WA 4QUCA 1RKNA 4OEMB 4GOPC 1SJED 2F0LA 3VA5A 3M4QA 2VUMB 1Y1WB 2NVYH 2NZOA 1EZ6A 4CDDC 3NUCA 1OXSC 4C3IB 1WTOA 1EEID 3K0XA 4LFBL 2EJFC 1DONA 1K3RA 1QILA 1EIFA 4KTAA 4DV2Q 1XNRL 2UXBQ 3KK7A 3HEJA 1VQFA 3CPFA 5IYCH 2WKCA 4R4TA 3GTOB 4BY7H 3TREA 2R61A 2IX1A 2R7DA 1SNDA 1UEAB 4MZ9A 3AEVA 4ID6A 3S1RB 3HOZB 1RCVD 2LFNA 1ICFB 4JOIC 1YHBA 1A2TA 2PQAA 4KHVA 3L3OC 2CQOA 1JQYD 4DK0A 4HIMA 3NBHA 4YWKA 4DV3L 4RGTA 2KOLA 1CSPA 5HGTA 2L12A 1F2LA 4OIKA 4RCNA 2A68C 2WB1B 4RG1A 4A3EB 2L0CA 1TWAH 2AWNA 1DOLA 1KAWA 1VQCA 5I4DA 3BVZA 4RKBA 5EKLA 5G3LD 1DXMA 1Y1VG 1RTNA 1NMGA 2IX0A 1I50B 4L6TB 4DN4M 1I4QA 3A8KE 3IAYA 1F9PA 1PTOH 4R4CA 4A3BB 3T53B 2QW7A 3GP7A 2UUCQ 4HIOA 1QB5D 1YIJA 4V190 4X65Q 4A3MB 3K7AB 5CR3A 2K5QA 4H02A 4QQBX 3PUVA 4MN3A 2HQEA 3NQIA 1W6JA 4CJ0B 2CWAA 3MTSA 4M1UB 5M3MH 4O0AA 1XPUA 3H3VI 3E5SA 5EKKA 1K8GA 2JA5G 4IUPA 1LT6D 5JPMC 1LLRD 3I4NH 1E3PA 4CDFC 2I07B 3AFQA 3SHLA 1CTMA 5I9PA 3DWAA 4IQZA 1LT5D 2E2DC 2GVAA 2PQAB 1F2ZA 1IW7C 1K28A 5LL6X 1PFBA 1BF4A 1ET6A 3RZOB 2SNMA 1BCPF 4X65L 1WTPA 4X6AH 2NZHA 3PMFA 4BY7G 2X69A 4YY3Q 1XMOL 3K5NA 1ZXTA 2RKSA 3MA2B 1VQAA 1HCZA 5EPJA 2A73B 2K28A 2ZT9C 2B2UA 1X3EA 5LMNL 3RLOA 1QZGA 3KLSA 5CV4A 2JA6H 4JI3L 2L55A 3KDFA 3OSOA 4A93H 1D5XC 1Q7YC 1YNJD 4XXEA 4ZUJA 2GVBA 2A19A 2JA8G 4KLKA 2F0VA 1O80A 3TEHB 2G9HD 1PTOD 3CF5A 2D0OA 4QGUA 2EE1A 4OHJA 1VF7A 4C3IG 5JJZA 3U9SA 3EA6A 2EYHA 1Q12A 4LF4Q 3I90A 1L0XB 4A3JB 1TVXA 1AZPA 1PFSA 4F88A 4DR4L 5C4ZA 1WCMB 4EX5A 3S1MH 3IRBA 1JMCA 1T5XD 5CBEE 3S17B 1J5EQ 3I72A 4DUYQ 2EVBA 4DV5L 5GROA 4DXGA 2PNRC 1E2ZA 3K57A 2K6AA 2VQFL 1SE8A 4ODGA 4JI3Q 3D6CA 4FXKC 1SE2A 4DV7L 5IGBA 4OELB 2NVTB 1BDOA 3NWTA 2XVSA 5M5XB 1NE3A 3I2ZA 4A3IB 1CZGA 3BU2A 3J7YW 4POFA 2WKDA 1LTID 5D3DA 4ZLTF 2NBFA 4C3HH 2CVRA 1O7ZA 3HGBA 1BCPB 3EIVA 4LF4L 2KHSA 1D8LA 1SFOB 4A3DH 2KVMA 3M85A 2JA5H 2O5IC 2PI2E 4DR4Q 1EFID 4MIUA 3DLLA 1I6HH 1QVFA 4BBRH 2Z9HA 1ENAA 3J81L 3HOWH 3M4OB 3HS0C 1UUPA 3T13A 1J5EL 3S2HB 1EY9A 4F87A 4AYBB 4DV5Q 4K5XA 1RHPA 3S1NB 3CCLA 1X55A 2HIXA 1TWGB 1SDFA 5EQ0A 1ZYRD 5I2XA 3NE5B 5BN3A 1TR5A 2ZXPA 2PCFB 4ZAIA 1HQMC 2CH4A 2DY7A 3ONAB 2RSOA 2ES2A 5FOBB 1VQDA 2F0WA 3RN5A 1DGSA 4A3LG 1YJNA 4L5TA 4YCVA 4IPHA 3CAMA 1X3QA 3UDIA 3VYRA 5I9OA 1TT2A 2WB1E 3U4ZA 4A75A 1I94L 4OGQC 3PIO3 4JPBW 3F2BA 5IE8A 4A3KH 1VQKA 1N32L 3OOCA 3HKZB 5C4XB 3Q0AA 4FXDA 1STBA 4H7BA 1RTOA 1CI3M 1S5DD 2K52A 4N8FA 2RHSB 1K73C 3R8BA 3NK9A 1IYUA 3NP8A 1O7LA 2ATWA 5C3EB 4JI4Q 3RD4A 1Q82C 4A4IA 5JEAH 1KTKA 3JAMc 3RMHA 3K58A 1CA6A 2A6HC 3HOVH 3H0GB 1PZJD 1EQRA 4DAYB 2IHEA 5IWAQ 4BY1B 4LWCA 3J7AF 4G7ZC 2F0JA 2WACA 1NUCA 4X3SA 1IYJB 2DJFC 2ICEC 4X66Q 5IP7H 3STBC 1PH3A 2WP8J 2MJ8A 3MVVA 4J15A 1I94Q 1IKLA 2DN8A 1WTHA 4K14A 3L2PA 5M5YB 1VQGA 1L1OC 1WFQA 1XXGA 1Q3LA 3LX0A 1PFNA 1HJPA 4LF5L 4KHZA 1XPRA 2KEEA 1PH1A 1PH4A 2G9DA 5D3IB 2F0EA 5CGKA 3CD6A 4LJZC 1RL2A 4LUOA 3BZDB 4DAVA 3S15H 3MEFA 5C5LA 4OX9Q 4H13C 5C3XA 4JK1C 1DZ1A 2GA4B 2EYMA 4YCUA 1JB7A 2PW5A 3TSSA 3T1HQ 1FNUA 1IHZA 1I3QB 1ASZA 1U4MA 3MAQA 4LAAA 1B3AA 3B6YA 3WOFA 5FLXc 3A7LA 4A3GB 3EJIA 5FK9C 3GV6A 1TWHB 1V1QA 3D3RA 3MC0B 3ERSX 1PZID 1ZEQX 2X6GA 4DR3Q 2RBMA 1K0SA 1SNCA 4WJ3M 1GUGA 3T4AC 1XMQL 3I4OA 2K05A 3A74A 1HNXQ 2XSCA 3W1GA 1VQHA 2XTIA 2ID0A 4CGYB 1PXUA 1Q46A 1U4LA 1CSQA 2K01A 3NELA 1ASYA 5IGFA 1G91A 3HP3A 1ENCA 3OW2A 3NBHB 1PYSB 4DA2A 2A69D 3BDCA 2Z6BA 3LGJA 1Z7TA 1AEXA 1VS0A 2Z8LA 3DUZA 3PCOB 4NXML 2B63H 1WCMG 1U9RA 3GTKH 3GTLB 1A62A 1LTRD 4ZK9B 2K14A 3IFTA 5IGEA 4GNXA 1K8OA 4PG3A 4RCOA 5C4XG 5JEAG 1WI5A 2I46A 3F2CA 2UUBQ 1HA6A 1TU2B 5CORA 3Q23A 1WYDA 1KDCA 4PZ8A 2R7ZB 5M3FG 3UE0A 1STEA 2R93B 3GV3A 4A3JG 2I5HA 2KENA 3OPOA 1KC8C 1HNXL 3S14B 3BDLA 1E7ZA 1FGBD 3K80C 4QCLA 2E75C 3VR2A 1S3OA 2AUKA 1YEZA 3CU7A 3NSWA 2B39A 3IKJA 3GO5A 2FJ2A 1H9KA 2LS01 3A7AB 1A0IA 2KECA 3TDQA 3E3XA 3AFPA 4J1MA 4NXMQ 3U4VA 4IZ8A 5A35A 5K36G 1R9TH 2WINB 4N9TA 1Z47A 1H9SB 2NVXB 3CHBD 4MHEA 1MJCA 3G48A 4ZYSA 4LMQD 5FO7B 1B53A 4HEDA 4FF2A 3PF5A 2EY6A 4A3LH 3UDGA 1H9SA 2F4IA 2M2LA 5EPKA 3H91A 1VQ8A 2TMPA 3T51B 1E1OA 1YHAA 3STBD 3GD7A 5IOCA 1LTTD 4DXFA 2MPMA 3DM1A 5ELFA 4IFDG 5IGGA 2Q8IB 5C0XI 2JA8B 2A6HD 2VS1A 5IP7G 1ILPA 1NCVA 3TZUA 3KLWA 4E6IA 1HQRD 1TY0A 2RDHA 1H9MA 1ET9A 3SK6A 1L2FA 4JI7L 2KUMA 3P75A 1IKMA 4WRDA 4HJ5A 4P71A 4DK6C 2EZVA 1NAPA 2EY1A 2A1AA 1EU3A 3SK4A 3DWQA 1CA5A 3PUXA 4JW0A 4XTCS 4IPGA 3T1YQ 2F3VA 2A6ED 3EBEA 1Q81C 2L9HA 3ZYYX 2K03A 4PMBA 1OXUA 2QA4A 1HR0W 2QDLA 1PH6A 1OTCA 3ND9A 2JEAI 2F1MA 2PW7A 2JN4A 5EJWA 4PNYA 4B9WA 4JBWA 3KLRA 5JVH3 1QVGA 1D5MC 4QF4A 3J7AV 5LHY1 5FJ8G 3H3VH 4AQYQ 2LSSA 1N34L 1GUNA 4ME3A 1B3QA 1PYBA 2ZTEA 2I5LX 2B2YC 4BXXH 5C5MA 2ZTDA 1DD2A 2R93G 2AWOA 4KJNA 1EY4A 3D8GA 3ZJYC 4DR1L 4A3CH 5KYIA 2PQEA 4X64L 1VQMA 3RNUA 3T1YL 1SNQA 4O42A 2QGQA 1PDQA 4NKLA 1L1OB 1S5BD 1U5KA 2K1BA 1DOKA 1GUTA 2JA8H 2DJGC 5GAHC 4QIWE 1ESFA 1AP0A 1EYGA 3S2DH 1Q1EA 2VW9A 4K6LA 3HRZC 4ABNA 4B3RL 2NUCA 4ILWA 3FDTA 3VYSA 1EL0A 1KNAA 4LFCL 1N34Q 1JOOA 4B3SL 4PV1C 5DLQE 3F8TA 4X62L 3AU7A 2KA7A 4PMWA 2NVXH 3A54A 4DV0Q 3PIOA 4KV6A 2JP1A 5ELNA 2FINB 5FO9B 1L1OA 3HOXB 2IL8A 5COYA 4A3MG 2PMZE 2I5MX 3I3CA 2MQHA 4C2MH 2B63G 1YHQA 3SGIA 1O7YA 3S14H 3ER0A 4P75A 3H0GG 4H44C 4C56C 3A55A 3OTOL 3RZDH 2NTSA 1JJCB 2R93H 3WDNA 5KEEA 2R7ZH 3MWYW 1EQTA 3SDZA 3M3YH 1HFGA 1HRJA 1EIYB 2BDNA 4Y52H 1C4QA 4B3SQ 4N9PA 5C0XJ 4JI6Q 4GKJL 4FDBA 1EEFD 4IOCA 2DNCA 4HSVA 1GD7A 1P8LA 1U0LA 4DV0L 3GTLH 3GTKB 2HDLA 2K5DA 3UDFA 3A8IE 3GTJB 1C8CA 4RH6A 3CCRA 1A8VA 3N6RA 3GTGH 2YTVA 2EDGA 2FXQA 4DV1Q 2UXDQ 4J8QA 1KHIA 1TXYA 4KD4A 1YZ6A 3OIPA 5EBDA 2NN6I 3W2DA 2EQSA 4FF3A 1LTAD 4XDXA 1EYAA 1K0RA 1V9PA 4C3JB 4RAUC 1G291 1KDBA 5E7NA 2HUGA 3I4MH 1SYEA 4DAMA 4JBMA 4JI8L 3MZ5A 2N88A 1X56A 2RQXA 1IBLQ 4YCWA 3U58A 4PZ7A 1F9RA 1B8AA 5M3FH 1EOTA 1SROA 1TWHH 1NSNS 4DGZA 3T56B 4A3GH 3K0YA 3WWVA 1YJWA 3FP9A 2L15A 1KLUD 1UEBA 5AJ3L 4IO9A 1HA5A 4FXGC 1SYFA 4HJ8A 2IY5B 2MO1A 2MFIA 4LUVA 1Y1WG 4B3ML 1SR3A 2Z1CA 2R3ZA 2E5LL 4DV1L 4DR7L 1ICWA 4ME5A 4G7HC 1PH2A 4IUVA 2F0MA 2E76C 2MGSA 1Q90A 4RMFA 3OWFA 2OT2A 4CDCC 5M5YH 4JI8Q 4NB3A 1PVOA 5E4WC 3VDYA 2Q2UA 1EY7A 4ALPA 3SEBA 5JAVA 1D1IA 3NHHA 1IBKQ 4GN3B 1DM0B 4A3KG 1A3TA 2EIFA 3AYHB 5CMDA 3K8AA 3H0GH 4WJWA 3I4MB 2C9OA 3CQZB 1VQEA 4LNQA 1K8MA 4C3JH 1JE5A 4IN3A 2PYKA 5DM63 1AW7A 2ZXOA 2RA4A 1GOZA 1NR4A 1JWSD 4AYBE 5C3WA 3GTGB 4LW1A 4WJ4A 4DV6L 1QNKA 1TS3A 3GTJH 1C7YA 3KFUA 1W6KA 2F0TA 1Y8NB 3PF4A 2F0FA 1BO0A 1EUJA 5DM73 3FPUB 1HR0Q 4OO1I 3DHQA 3HOYG 3KF6B 2UU9L 3A56A 3M3YB 3TBIB 5IT9E 1CHQD 4JI2Q 1O78A 1IXRA 5M5WH 4DV2L 1TWGH 1GKHA 3IFDA 3S1NH 1G2SA 1OXVA 1CKNB 3OW7A 3CRKC 1EQVA 4A3FG 4BY1G 5M5WB 3SK8A 4QJFA 2K4KA 2M00A 3O13A 2MNAA 1JE4A 3HOXH 5CYUA 3J80L 4CJ2C 4GZYC 5JEAJ 2JA5B 1Z6HA 2F4VL 2AUJD 4XQJA 1MSHA 3J81c 1YJ9A 4C3HB 1HR0L 2V1CC 2BH8A 2VB3X 2NN6G 4DKAC 5J22A 2UU9Q 1NTGA 4X3KA 1K3BC 4XQNA 1VCIA 4LF6L 4JI2L 3K81C 1Q86C 4WFN3 4OO1H 2LMCB 4HTHA 3KYHC 3CQZH 1SYDA 1E2VA 2F0PA 3F1ZA 1XPOA 4L8JA 3KJPA 3NWSA 1N9WA 1PV4A 4DUZL 3ND8A 5BR8Q 4BBRG 4CBVA 2F4VQ 2UUCL 3J7A5 1YNXA 3HKZG 1KQSA 2JXMB 4GN4B 1J8IA 2F0QA 1F9QA 1I3QH 3QO2A 1PRTD 2FMMA 3QB3A 1UNSA 4CKBA 1D6EC 3NTKA 4LF6Q 1IYVA 2OF1A 1Z9FA 3RLFA 2EJMA 2PNHA 4A3BG 1JCKB 2JA6B 1RDPD 3JAMi 2K04A 2F0NA 1K8AC 3GQBA 1JT8A 2L1BA 2PO4A 3L7ZC 4K5WA 1HNZQ 4TQUS 4EGVA 3KJOA 1CQVA 1VQJA 2JQOA 4TRDA 2JEBI 2VQEQ 1WTXA 3EROA 5BR8L 4RWSC 1T9HA 4C1NK 3OMCA 1G6PA 3K59A 2CH4W 2NB0A 1II3A 5M3FB 3I4MG 4BA1I 1RIPA 1PH5A 3CRLC 1V43A 1X3PA 5CV9A 2M9VA 5KNCA 4BY1H 1XMOQ 1GVPA 1SNPA 5CV7A 2EYJA 4JOIA 2BA0A 2AMCB 4ZKCB 3PIP3 3VA7A 1E0BA 4JI1L 3C46A 5LMNQ 1WJJA 4ZUIA 4IFDJ 1M8AA 1QVCA 5CV8A 3I4NG 4GOPA 2HHHL 1SYCA 1EY6A 4R4IA 3NTIA 4A3GG 5C4XH 1Y8OB 1Y14B 2EY5A 2LXJA 1LO5D 3H6MA 1HNZL 4EQ5A 1VF5C 4HR7B 3MHBA 1CKMA 1C48A 3G7LA 3UI2A 1GO3E 4DF7A 3V2TA 3CC4A 4K2LA 5IY0A 3A5UA 2E74C 1PTOC 3K7AH 4RHSA 5DNFA 1EYCA 1GHJA 2K50A 5E3FA 1EY5A 1YNJC 1N33Q 4A76A 3AB9A 1ILQA 1QG7A 1QE6A 1I6VC 4A3BH 2ASBA 2XRSD 5IYBH 2NZ1D 1LTGD 5LL6S 3RZDB 4IPDA 4XYQA 4KN7C 1I50H 3U50C 1R4QB 3TP8A 2EOTA 4JI1Q 3SE0A 1RD9D 3M9BA 4JVZA 5FKAC 4C2MB
chains in the Genus database with same CATH topology
3K0XA 4HJ5A 4JYAL 4DV7Q 4P71A 4LFBL 3I7FA 4DK6C 2Z0SA 1K3RA 4UP8A 1EIFA 4DV2Q 1XNRL 4XIGS 2A1AA 2UXBQ 1VQFA 3CPFA 5M3MG 5IYCH 2E5LQ 4R4TA 4LUZA 3PUXA 4R4QA 4XTCS 2ZTCA 3ULJA 4BY7H 3TREA 2IX1A 4X66L 4DR7Q 2R7DA 4IPGA 3T1YQ 3EBEA 4LF9Q 1Q81C 4MZ9A 2HT1A 1KRSA 3AEVA 1EOVA 1OXUA 5HY6A 2QA4A 1N33L 1HR0W 1Q8KA 4JOIC 1PH6A 1YHBA 2KHJA 1OTCA 2PQAA 2JEAI 4A93G 2CQOA 1PHJA 4HIMA 4LF8L 2JA6G 1FL0A 4JBWA 4YWKA 4DV3L 4A3MH 1QVGA 1SN8A 1CSPA 3CCVA 3S1RH 4HJAA 1PH7A 4LF5Q 4GLVB 1D7QA 4HIDA 5FJ8G 3H3VH 5ELOA 4AQYQ 2LSSA 1N34L 4ME3A 2YV5A 1PYBA 2ZTEA 3CCUA 3TS2A 2UUAL 2N49A 5GADC 4OX9L 4RG1A 3CXCA 2I5LX 4BXXH 3AQQA 1TWAH 4JYAQ 3RLNA 2ZTDA 2AWNA 2R93G 1YBYA 2AWOA 4DR1L 3ZJYC 1KAWA 1VQCA 4MTNA 4A3CH 3E9HA 3J81i 4JBJA 3T1HL 2JK8A 3I56A 2JJQA 4KI0A 2F3IA 4YWMA 1Y1VG 1NMGA 1HNWQ 2IX0A 4X64L 1VQMA 3RNUA 1FVIA 3OYYA 4APVA 3T1YL 1CUKA 2QGQA 4A3JH 3TRZA 1L1OB 4O2DA 1X54A 1U5KA 4A3EH 2JA8H 2VUMH 1VQ5A 4PZ6A 1E1TA 5FJ8H 5GAHC 4R4CA 3PSIA 4QIWE 4DR3L 1EYGA 3S2DH 2UUCQ 1N32Q 1VQBA 4HIOA 1Q1EA 1XMQQ 2VW9A 1AE2A 1J6QA 1YIJA 4B3RL 4NPSA 3ICEA 4OWTB 1VQPA 4X65Q 2WAQE 4LFCL 4H02A 1N34Q 4UP9A 4B3SL 4QQBX 3PUVA 5DLQE 2HQLA 3F8TA 4X62L 3PO3G 5GQOA 4PMWA 2NVXH 2UXCQ 4JI4L 4JC0A 4DR2L 2CWAA 4HJ9A 5M3MH 5IYCG 4O0AA 1UE7A 4DV0Q 3MXNB 4OO1G 3PIOA 5LMUQ 1XPUA 1XTDA 5C44G 3H3VI 5ELNA 5IWAL 4GOPB 1L1OA 1K8GA 2JA5G 3GTOH 1X65A 1VQ9A 4LF7L 1HNWL 3CW2C 2OQ0A 3E9IA 4JCVE 4AIMA 4A3MG 3I4NH 1OXXK 3JC66 1E3PA 1X3GA 2PMZE 2I5MX 2YU9H 1CKNA 4IJLA 2MQHA 3AFQA 4C2MH 1BBWA 4LF7Q 5IT9c 3CMAA 2B63G 2E2IH 1YHQA 1MIUA 3SGIA 2GVAA 1H95A 3PUYA 3S14H 2PQAB 2RHQB 2MO0A 1HZAA 2ZJRA 3ER0A 1MJEA 4P75A 3H0GG 3PO2H 3OTOL 3M4PA 1Y1WH 3RZDH 5C3EH 1JJCB 2R93H 3E0EA 2R7ZH 4X65L 1YVCA 4UY8C 4X6AH 2NZHA 2VZAA 2DGYA 2PI2A 4R1JA 3M3YH 4BY7G 1EIYB 4YY3Q 4Y52H 1XMOL 4B3SQ 1VQLA 1OXTA 5C0XJ 4JI6Q 4GKJL 4FDBA 2K5VA 3HOUG 1VQAA 5FLMH 2R6GA 1N36L 4OWXB 4IOCA 4GLXA 3HOWG 1GD7A 4DR2Q 1P8LA 1X3EA 5LMNL 3RLOA 1U0LA 4MNOA 4DV0L 4DR5Q 1HH2P 1QZGA 1KIXA 3GTLH 2OTLA 2JA6H 4JI3L 3UDFA 3KDFA 3CCMA 4A93H 1Q7YC 3CCQA 3ULLA 1BKBA 1W3SA 2GVBA 2IHFA 3CCRA 2A19A 2JA8G 4KLKA 1A8VA 1UE5A 3TEHB 3GTGH 2YTVA 2FXQA 2HIVA 3CPWA 3CF5A 1NBWA 1VQ6A 4DV1Q 2UXDQ 1KHIA 1TXYA 2D0OA 1YZ6A 4QGUA 2NN6I 2EQSA 4OONA 4DUZQ 1K0RA 1QUQA 1KXLA 1V9PA 3J81j 1G291 5E7NA 1X6OA 1Q12A 4P72A 4LF4Q 3PGZA 3CMEA 3I4MH 1VQ7A 2BA1A 1PFSA 4DAMA 4JBMA 4JI8L 4DR4L 3HKZE 2CCZA 2E2HH 1X56A 4EX5A 1SRUA 1IBLQ 1VQ4A 4YCWA 3S1MH 3U58A 2VNUD 4PZ7A 1B8AA 5M3FH 2QEXA 3IRBA 1JMCA 1SROA 1TWHH 3S2HH 2CKZB 1J5EQ 2Q2IA 4A3GH 4DUYQ 3M4OH 2R7FA 3WWVA 1YJWA 4JBKA 3KOJA 4JI0Q 4DV5L 3FP9A 5GROA 2L15A 1UEBA 4L5SA 4DR5L 5AJ3L 1BBUA 5IP9H 2VQFL 4IO9A 4JI7Q 2YTYA 1SE8A 4YWLA 4JI3Q 2E8GA 5H1SE 4AH6A 4HJ8A 4DV7L 4JI5Q 4BA2I 4A3IG 4LFBQ 3S24A 2IY5B 2MO1A 2MFIA 4LUVA 1Y1WG 4B3ML 1SR3A 1NE3A 3I2ZA 2K5NA 2E5LL 4DV1L 3BU2A 1PA6A 4NXNL 2UUBL 4POFA 1SMXA 4DR7L 4DK3C 1QZHA 1W2BA 1PH2A 2D0PA 2YYZA 2VQEL 3BJUA 4A3IH 1YITA 4C3HH 3HOZH 3GTQH 3EIVA 4RMFA 2ZM6Q 2NVTH 3D0FA 4LF4L 1D8LA 4A3DH 3M85A 4A3EG 5M5YH 2JA5H 4OWWB 2PI2E 4JI8Q 4NB3A 4DR4Q 1PVOA 2IT1A 4DV3Q 1I6HH 3DLLA 2I0QA 2K75A 4BBRH 4B3TQ 3VDYA 2Q2UA 1QVFA 1VQOA 3K7UC 4ALPA 3HOWH 1J5EL 1N8RC 1IBKQ 3S16H 2WFWA 4AQYL 1EWIA 1IZ6A 4IJHA 4GN3B 2B3GA 4JI0L 4DV5Q 4A3KG 1WCMH 2EIFA 3AYHB 4P74A 1JJ2A 2YTXA 3K8AA 5JJIA 3CCLA 1CKOA 3H0GH 3PO2G 1AH9A 1X55A 2HIXA 3UE1A 5HGQA 1UWVA 2HHHQ 4JI5L 1FJGL 2H5XA 5C3EG 1VQEA 2DUDA 4DR1Q 4GLAC 4LNQA 4C3JH 4HJ7A 1JE5A 2ES2A 4Y7NH 4BBSG 2RF4A 1VQDA 4NXNQ 3RN5A 4X64Q 1DGSA 3ULPA 4DNIA 4A3LG 1YJNA 4L5TA 3FKIG 4YCVA 4AYBG 4IPHA 3CAMA 3M7NA 3UDIA 1NY4A 4AYBE 3F2DA 3HOUH 2CWPA 2WB1E 4LW1A 3U4ZA 3S1QH 4WJ4A 1JJGA 4A75A 4DV6L 2ZM6L 1I94L 5C44H 2AHOB 3RR5A 3GTJH 1C7YA 3KFUA 2F52A 3F2BA 5JJLA 5IE8A 4A3KH 2JA7G 1VQKA 1N32L 5FLMG 3PF4A 4B3TL 4KHPL 1NJIC 4B3RQ 1EUJA 2KCTA 1EFWA 1HR0Q 3PUZA 4LFCQ 2K52A 2OQKA 3DM3A 1M1KC 4OO1I 3HOYG 2RHSB 3KF6B 1HZ9A 2UU9L 1K73C 2WB1G 4X62Q 2N8NA 4A3FH 3G4SA 4DV4Q 5GAGC 2ATWA 4JI4Q 1UE6A 1FJGQ 1Q82C 4JI2Q 3L0OA 1IXRA 4A4IA 5IYDG 1VQIA 5M5WH 1TWGH 3JAMc 4DV2L 4POGA 3HOVH 3HOYH 5IWAQ 1EQRA 1GKHA 1HZCA 2IHEA 4DAYB 1IL2A 3S1NH 1OXVA 5IYDH 4LWCA 2N78A 2Y0SE 1CKNB 2A8VA 3TQYA 1I5FA 1Q1BA 1IYJB 1Y1VH 5GAEC 4A3FG 4X66Q 3NEMA 4BY1G 1X3FA 3GDEA 4LF9L 5IP7H 4QJFA 3STBC 4JV5L 1PH3A 2K4KA 2MNAA 2WP8J 1A63A 4OXPA 4J15A 5J3BA 1E22A 3KF6A 1I94Q 3Q8DA 3HOXH 2OTJA 3L2PA 5JEAJ 3HOXG 1VQGA 1LUZA 2F4VL 2CFMA 1L1OC 4GKKL 1WFQA 3OTOQ 3CCJA 1QUQB 1HJPA 4LF5L 4KHZA 3J81c 4KHPQ 3UDXA 4BXXG 1XPRA 3HFZB 1PH1A 3H15A 1P16A 1YJ9A 1PH4A 1HR0L 5JJKA 2V1CC 2BH8A 4YY3L 3CD6A 2NN6G 4DKAC 1FGUA 4JI6L 3J80c 1K83H 3RN2A 1NTGA 2UU9Q 1RL2A 4LUOA 3S15H 3FKIH 3MEFA 4OX9Q 4UPAA 4DV4L 1VCIA 4LF6L 3PO3H 2JA9A 1XNQQ 4JI2L 3K81C 4YCUA 1JB7A 1E24A 1AE3A 4GN5A 1Q86C 2VUMG 3T1HQ 2K5HA 1LTLA 3TS0A 1ASZA 3NENA 3KF8B 3GTMH 4K0KL 3B6YA 1O7IA 3KYHC 1WOCA 5FLXc 3FHWA 4IPCA 3D31A 2R92G 3CQZH 3A5ZB 4JV5Q 2WAQG 2R92H 3F1ZA 1XPOA 1V1QA 2EXDA 1EQQA 2UXDL 3KJPA 1N9WA 3ERSX 2KHIA 1PV4A 4DUZL 2VY3A 5BR8Q 1KD1C 4DR3Q 4BBRG 2F4VQ 2UUCL 4WJ3M 4GKKQ 2VL6A 3HKSA 3J7A5 1XMQL 4JG2A 2LXKA 1YNXA 1KL9A 1TWCH 3I4OA 3A74A 1NMFA 1HNXQ 3CC2A 2Z6KC 3W1GA 3HKZG 1VQHA 2XTIA 1KQSA 3G71A 1IBMQ 2ID0A 2RCNA 4GN4B 4A3DG 1HZBA 1I3QH 1Q46A 1IBLL 2OCEA 2D62A 1CSQA 4QL5A 3W1BA 3NELA 3CC7A 1ASYA 3HOZG 1SFOH 3OW2A 3NBHB 1B70B 1PYSB 4HIKA 4DUYL 4LF6Q 2UXCL 2R7ZG 1Z9FA 3G6EA 1XNQL 3LGJA 4L5QA 3RLFA 5LMUL 1VS0A 2PNHA 3PCOB 4YHHL 2VQFQ 4NXML 4A3BG 2B63H 1WCMG 3JAMi 3GTKH 4L5RC 1C9OA 2E2JH 1A62A 3A0JA 1BVSA 5C0XG 1KRTA 1K8AC 2K14A 2ZJQA 5M5XH 4GNXA 4DR6Q 4IFDI 4PG3A 1JT8A 2AKWB 4B3MQ 3L7ZC 2Y0SG 1TWFH 1S72A 4IOAA 5C4XG 5JEAG 4K0KQ 5LMNW 1HNZQ 1WI5A 4TQUS 3F2CA 2UUBQ 3PIPA 3KJOA 1VQJA 2JE6I 1SLJA 2JQOA 2JEBI 2Z6KA 2VQEQ 3J7ZC 1WYDA 5BR8L 4PZ8A 2OWOA 5M3FG 3UE0A 1PH9A 2Q2TA 4A3JG 1T9HA 2I5HA 3S17H 1G6PA 2KENA 1KC8C 1HNXL 1IBML 3I4MG 1MKHA 4BA1I 1S40A 1RIPA 1PH5A 1E7ZA 1V43A 1XJVA 3K80C 4BY1H 1XMOQ 3PUWA 4C3IH 1GM5A 2JA7H 2NVQH 2BH2A 1GVPA 2KBNA 5IYBG 1S3OA 5C4JH 1YEZA 4LFAL 4GKJQ 4JOIA 2BA0A 2AMCB 3GO5A 1N36Q 1IBKL 3EN2A 3HOVG 2N3SA 4JI1L 3CCSA 5LMNQ 1A0IA 1WJJA 2B29A 4UP7A 3AFPA 4YHHQ 4NXMQ 4IFDJ 3CP0A 3U4VA 1QVCA 5IP9G 3I55A 3I4NG 4GOPA 5K36G 2HHHL 1R9TH 2C35B 4R4IA 3GTPH 3PV0A 4DR6L 1Z47A 3BZKA 4A3GG 1XNRQ 2UXBL 5C4XH 1Y14B 2Q2HA 2LXJA 3KDFB 1MJCA 3G48A 4DPGA 3BZCA 1B7YB 1HNZL 4QY7A 4EQ5A 4P73A 1CKMA 3CCEA 1LM0A 1GO3E 1VQNA 3CC4A 3PF5A 3J80i 4A3LH 5IY0A 3A5UA 3UDGA 3W5OA 1UE1A 3K7AH 2ZJPA 1X9NA 1PH8A 4GS3A 1G51A 1VQ8A 2K50A 1YI2A 1E1OA 4DV6Q 1YHAA 1N33Q 3STBD 4A76A 2ALYB 1M90C 3GD7A 4A3CG 2KCMA 2GN5A 5EAYA 1L0WA 4A3BH 2ASBA 4GOPC 4LF8Q 4IFDG 3M4QA 1LYLA 5IYBH 5C0XI 4GNXC 5IP7G 2VS1A 3RZOH 4LFAQ 2NVYH 3KLWA 4IPDA 1I50H 2NZOA 3U50C 1OXSC 4R4OA 4JI1Q 2XGTA 4TVAB 5AJ3Q 1L2FA 1K9MC 2UUAQ 4BBSH 3M9BA 4JI7L 4GNXB 1C0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0X A;  4HJ5 A;  4JYA L;  4DV7 Q;  4P71 A;  4LFB L;  3I7F A;  4DK6 C;  2Z0S A;  1K3R A;  4UP8 A;  1EIF A;  4DV2 Q;  1XNR L;  4XIG S;  2A1A A;  2UXB Q;  1VQF A;  3CPF A;  5M3M G;  5IYC H;  2E5L Q;  4R4T A;  4LUZ A;  3PUX A;  4R4Q A;  4XTC S;  2ZTC A;  3ULJ A;  4BY7 H;  3TRE A;  2IX1 A;  4X66 L;  4DR7 Q;  2R7D A;  4IPG A;  3T1Y Q;  3EBE A;  4LF9 Q;  1Q81 C;  4MZ9 A;  2HT1 A;  1KRS A;  3AEV A;  1EOV A;  1OXU A;  5HY6 A;  2QA4 A;  1N33 L;  1HR0 W;  1Q8K A;  4JOI C;  1PH6 A;  1YHB A;  2KHJ A;  1OTC A;  2PQA A;  2JEA I;  4A93 G;  2CQO A;  1PHJ A;  4HIM A;  4LF8 L;  2JA6 G;  1FL0 A;  4JBW A;  4YWK A;  4DV3 L;  4A3M H;  1QVG A;  1SN8 A;  1CSP A;  3CCV A;  3S1R H;  4HJA A;  1PH7 A;  4LF5 Q;  4GLV B;  1D7Q A;  4HID A;  5FJ8 G;  3H3V H;  5ELO A;  4AQY Q;  2LSS A;  1N34 L;  4ME3 A;  2YV5 A;  1PYB A;  2ZTE A;  3CCU A;  3TS2 A;  2UUA L;  2N49 A;  5GAD C;  4OX9 L;  4RG1 A;  3CXC A;  2I5L X;  4BXX H;  3AQQ A;  1TWA H;  4JYA Q;  3RLN A;  2ZTD A;  2AWN A;  2R93 G;  1YBY A;  2AWO A;  4DR1 L;  3ZJY C;  1KAW A;  1VQC A;  4MTN A;  4A3C H;  3E9H A;  3J81 i;  4JBJ A;  3T1H L;  2JK8 A;  3I56 A;  2JJQ A;  4KI0 A;  2F3I A;  4YWM A;  1Y1V G;  1NMG A;  1HNW Q;  2IX0 A;  4X64 L;  1VQM A;  3RNU A;  1FVI A;  3OYY A;  4APV A;  3T1Y L;  1CUK A;  2QGQ A;  4A3J H;  3TRZ A;  1L1O B;  4O2D A;  1X54 A;  1U5K A;  4A3E H;  2JA8 H;  2VUM H;  1VQ5 A;  4PZ6 A;  1E1T A;  5FJ8 H;  5GAH C;  4R4C A;  3PSI A;  4QIW E;  4DR3 L;  1EYG A;  3S2D H;  2UUC Q;  1N32 Q;  1VQB A;  4HIO A;  1Q1E A;  1XMQ Q;  2VW9 A;  1AE2 A;  1J6Q A;  1YIJ A;  4B3R L;  4NPS A;  3ICE A;  4OWT B;  1VQP A;  4X65 Q;  2WAQ E;  4LFC L;  4H02 A;  1N34 Q;  4UP9 A;  4B3S L;  4QQB X;  3PUV A;  5DLQ E;  2HQL A;  3F8T A;  4X62 L;  3PO3 G;  5GQO A;  4PMW A;  2NVX H;  2UXC Q;  4JI4 L;  4JC0 A;  4DR2 L;  2CWA A;  4HJ9 A;  5M3M H;  5IYC G;  4O0A A;  1UE7 A;  4DV0 Q;  3MXN B;  4OO1 G;  3PIO A;  5LMU Q;  1XPU A;  1XTD A;  5C44 G;  3H3V I;  5ELN A;  5IWA L;  4GOP B;  1L1O A;  1K8G A;  2JA5 G;  3GTO H;  1X65 A;  1VQ9 A;  4LF7 L;  1HNW L;  3CW2 C;  2OQ0 A;  3E9I A;  4JCV E;  4AIM A;  4A3M G;  3I4N H;  1OXX K;  3JC6 6;  1E3P A;  1X3G A;  2PMZ E;  2I5M X;  2YU9 H;  1CKN A;  4IJL A;  2MQH A;  3AFQ A;  4C2M H;  1BBW A;  4LF7 Q;  5IT9 c;  3CMA A;  2B63 G;  2E2I H;  1YHQ A;  1MIU A;  3SGI A;  2GVA A;  1H95 A;  3PUY A;  3S14 H;  2PQA B;  2RHQ B;  2MO0 A;  1HZA A;  2ZJR A;  3ER0 A;  1MJE A;  4P75 A;  3H0G G;  3PO2 H;  3OTO L;  3M4P A;  1Y1W H;  3RZD H;  5C3E H;  1JJC B;  2R93 H;  3E0E A;  2R7Z H;  4X65 L;  1YVC A;  4UY8 C;  4X6A H;  2NZH A;  2VZA A;  2DGY A;  2PI2 A;  4R1J A;  3M3Y H;  4BY7 G;  1EIY B;  4YY3 Q;  4Y52 H;  1XMO L;  4B3S Q;  1VQL A;  1OXT A;  5C0X J;  4JI6 Q;  4GKJ L;  4FDB A;  2K5V A;  3HOU G;  1VQA A;  5FLM H;  2R6G A;  1N36 L;  4OWX B;  4IOC A;  4GLX A;  3HOW G;  1GD7 A;  4DR2 Q;  1P8L A;  1X3E A;  5LMN L;  3RLO A;  1U0L A;  4MNO A;  4DV0 L;  4DR5 Q;  1HH2 P;  1QZG A;  1KIX A;  3GTL H;  2OTL A;  2JA6 H;  4JI3 L;  3UDF A;  3KDF A;  3CCM A;  4A93 H;  1Q7Y C;  3CCQ A;  3ULL A;  1BKB A;  1W3S A;  2GVB A;  2IHF A;  3CCR A;  2A19 A;  2JA8 G;  4KLK A;  1A8V A;  1UE5 A;  3TEH B;  3GTG H;  2YTV A;  2FXQ A;  2HIV A;  3CPW A;  3CF5 A;  1NBW A;  1VQ6 A;  4DV1 Q;  2UXD Q;  1KHI A;  1TXY A;  2D0O A;  1YZ6 A;  4QGU A;  2NN6 I;  2EQS A;  4OON A;  4DUZ Q;  1K0R A;  1QUQ A;  1KXL A;  1V9P A;  3J81 j;  1G29 1;  5E7N A;  1X6O A;  1Q12 A;  4P72 A;  4LF4 Q;  3PGZ A;  3CME A;  3I4M H;  1VQ7 A;  2BA1 A;  1PFS A;  4DAM A;  4JBM A;  4JI8 L;  4DR4 L;  3HKZ E;  2CCZ A;  2E2H H;  1X56 A;  4EX5 A;  1SRU A;  1IBL Q;  1VQ4 A;  4YCW A;  3S1M H;  3U58 A;  2VNU D;  4PZ7 A;  1B8A A;  5M3F H;  2QEX A;  3IRB A;  1JMC A;  1SRO A;  1TWH H;  3S2H H;  2CKZ B;  1J5E Q;  2Q2I A;  4A3G H;  4DUY Q;  3M4O H;  2R7F A;  3WWV A;  1YJW A;  4JBK A;  3KOJ A;  4JI0 Q;  4DV5 L;  3FP9 A;  5GRO A;  2L15 A;  1UEB A;  4L5S A;  4DR5 L;  5AJ3 L;  1BBU A;  5IP9 H;  2VQF L;  4IO9 A;  4JI7 Q;  2YTY A;  1SE8 A;  4YWL A;  4JI3 Q;  2E8G A;  5H1S E;  4AH6 A;  4HJ8 A;  4DV7 L;  4JI5 Q;  4BA2 I;  4A3I G;  4LFB Q;  3S24 A;  2IY5 B;  2MO1 A;  2MFI A;  4LUV A;  1Y1W G;  4B3M L;  1SR3 A;  1NE3 A;  3I2Z A;  2K5N A;  2E5L L;  4DV1 L;  3BU2 A;  1PA6 A;  4NXN L;  2UUB L;  4POF A;  1SMX A;  4DR7 L;  4DK3 C;  1QZH A;  1W2B A;  1PH2 A;  2D0P A;  2YYZ A;  2VQE L;  3BJU A;  4A3I H;  1YIT A;  4C3H H;  3HOZ H;  3GTQ H;  3EIV A;  4RMF A;  2ZM6 Q;  2NVT H;  3D0F A;  4LF4 L;  1D8L A;  4A3D H;  3M85 A;  4A3E G;  5M5Y H;  2JA5 H;  4OWW B;  2PI2 E;  4JI8 Q;  4NB3 A;  4DR4 Q;  1PVO A;  2IT1 A;  4DV3 Q;  1I6H H;  3DLL A;  2I0Q A;  2K75 A;  4BBR H;  4B3T Q;  3VDY A;  2Q2U A;  1QVF A;  1VQO A;  3K7U C;  4ALP A;  3HOW H;  1J5E L;  1N8R C;  1IBK Q;  3S16 H;  2WFW A;  4AQY L;  1EWI A;  1IZ6 A;  4IJH A;  4GN3 B;  2B3G A;  4JI0 L;  4DV5 Q;  4A3K G;  1WCM H;  2EIF A;  3AYH B;  4P74 A;  1JJ2 A;  2YTX A;  3K8A A;  5JJI A;  3CCL A;  1CKO A;  3H0G H;  3PO2 G;  1AH9 A;  1X55 A;  2HIX A;  3UE1 A;  5HGQ A;  1UWV A;  2HHH Q;  4JI5 L;  1FJG L;  2H5X A;  5C3E G;  1VQE A;  2DUD A;  4DR1 Q;  4GLA C;  4LNQ A;  4C3J H;  4HJ7 A;  1JE5 A;  2ES2 A;  4Y7N H;  4BBS G;  2RF4 A;  1VQD A;  4NXN Q;  3RN5 A;  4X64 Q;  1DGS A;  3ULP A;  4DNI A;  4A3L G;  1YJN A;  4L5T A;  3FKI G;  4YCV A;  4AYB G;  4IPH A;  3CAM A;  3M7N A;  3UDI A;  1NY4 A;  4AYB E;  3F2D A;  3HOU H;  2CWP A;  2WB1 E;  4LW1 A;  3U4Z A;  3S1Q H;  4WJ4 A;  1JJG A;  4A75 A;  4DV6 L;  2ZM6 L;  1I94 L;  5C44 H;  2AHO B;  3RR5 A;  3GTJ H;  1C7Y A;  3KFU A;  2F52 A;  3F2B A;  5JJL A;  5IE8 A;  4A3K H;  2JA7 G;  1VQK A;  1N32 L;  5FLM G;  3PF4 A;  4B3T L;  4KHP L;  1NJI C;  4B3R Q;  1EUJ A;  2KCT A;  1EFW A;  1HR0 Q;  3PUZ A;  4LFC Q;  2K52 A;  2OQK A;  3DM3 A;  1M1K C;  4OO1 I;  3HOY G;  2RHS B;  3KF6 B;  1HZ9 A;  2UU9 L;  1K73 C;  2WB1 G;  4X62 Q;  2N8N A;  4A3F H;  3G4S A;  4DV4 Q;  5GAG C;  2ATW A;  4JI4 Q;  1UE6 A;  1FJG Q;  1Q82 C;  4JI2 Q;  3L0O A;  1IXR A;  4A4I A;  5IYD G;  1VQI A;  5M5W H;  1TWG H;  3JAM c;  4DV2 L;  4POG A;  3HOV H;  3HOY H;  5IWA Q;  1EQR A;  1GKH A;  1HZC A;  2IHE A;  4DAY B;  1IL2 A;  3S1N H;  1OXV A;  5IYD H;  4LWC A;  2N78 A;  2Y0S E;  1CKN B;  2A8V A;  3TQY A;  1I5F A;  1Q1B A;  1IYJ B;  1Y1V H;  5GAE C;  4A3F G;  4X66 Q;  3NEM A;  4BY1 G;  1X3F A;  3GDE A;  4LF9 L;  5IP7 H;  4QJF A;  3STB C;  4JV5 L;  1PH3 A;  2K4K A;  2MNA A;  2WP8 J;  1A63 A;  4OXP A;  4J15 A;  5J3B A;  1E22 A;  3KF6 A;  1I94 Q;  3Q8D A;  3HOX H;  2OTJ A;  3L2P A;  5JEA J;  3HOX G;  1VQG A;  1LUZ A;  2F4V L;  2CFM A;  1L1O C;  4GKK L;  1WFQ A;  3OTO Q;  3CCJ A;  1QUQ B;  1HJP A;  4LF5 L;  4KHZ A;  3J81 c;  4KHP Q;  3UDX A;  4BXX G;  1XPR A;  3HFZ B;  1PH1 A;  3H15 A;  1P16 A;  1YJ9 A;  1PH4 A;  1HR0 L;  5JJK A;  2V1C C;  2BH8 A;  4YY3 L;  3CD6 A;  2NN6 G;  4DKA C;  1FGU A;  4JI6 L;  3J80 c;  1K83 H;  3RN2 A;  1NTG A;  2UU9 Q;  1RL2 A;  4LUO A;  3S15 H;  3FKI H;  3MEF A;  4OX9 Q;  4UPA A;  4DV4 L;  1VCI A;  4LF6 L;  3PO3 H;  2JA9 A;  1XNQ Q;  4JI2 L;  3K81 C;  4YCU A;  1JB7 A;  1E24 A;  1AE3 A;  4GN5 A;  1Q86 C;  2VUM G;  3T1H Q;  2K5H A;  1LTL A;  3TS0 A;  1ASZ A;  3NEN A;  3KF8 B;  3GTM H;  4K0K L;  3B6Y A;  1O7I A;  3KYH C;  1WOC A;  5FLX c;  3FHW A;  4IPC A;  3D31 A;  2R92 G;  3CQZ H;  3A5Z B;  4JV5 Q;  2WAQ G;  2R92 H;  3F1Z A;  1XPO A;  1V1Q A;  2EXD A;  1EQQ A;  2UXD L;  3KJP A;  1N9W A;  3ERS X;  2KHI A;  1PV4 A;  4DUZ L;  2VY3 A;  5BR8 Q;  1KD1 C;  4DR3 Q;  4BBR G;  2F4V Q;  2UUC L;  4WJ3 M;  4GKK Q;  2VL6 A;  3HKS A;  3J7A 5;  1XMQ L;  4JG2 A;  2LXK A;  1YNX A;  1KL9 A;  1TWC H;  3I4O A;  3A74 A;  1NMF A;  1HNX Q;  3CC2 A;  2Z6K C;  3W1G A;  3HKZ G;  1VQH A;  2XTI A;  1KQS A;  3G71 A;  1IBM Q;  2ID0 A;  2RCN A;  4GN4 B;  4A3D G;  1HZB A;  1I3Q H;  1Q46 A;  1IBL L;  2OCE A;  2D62 A;  1CSQ A;  4QL5 A;  3W1B A;  3NEL A;  3CC7 A;  1ASY A;  3HOZ G;  1SFO H;  3OW2 A;  3NBH B;  1B70 B;  1PYS B;  4HIK A;  4DUY L;  4LF6 Q;  2UXC L;  2R7Z G;  1Z9F A;  3G6E A;  1XNQ L;  3LGJ A;  4L5Q A;  3RLF A;  5LMU L;  1VS0 A;  2PNH A;  3PCO B;  4YHH L;  2VQF Q;  4NXM L;  4A3B G;  2B63 H;  1WCM G;  3JAM i;  3GTK H;  4L5R C;  1C9O A;  2E2J H;  1A62 A;  3A0J A;  1BVS A;  5C0X G;  1KRT A;  1K8A C;  2K14 A;  2ZJQ A;  5M5X H;  4GNX A;  4DR6 Q;  4IFD I;  4PG3 A;  1JT8 A;  2AKW B;  4B3M Q;  3L7Z C;  2Y0S G;  1TWF H;  1S72 A;  4IOA A;  5C4X G;  5JEA G;  4K0K Q;  5LMN W;  1HNZ Q;  1WI5 A;  4TQU S;  3F2C A;  2UUB Q;  3PIP A;  3KJO A;  1VQJ A;  2JE6 I;  1SLJ A;  2JQO A;  2JEB I;  2Z6K A;  2VQE Q;  3J7Z C;  1WYD A;  5BR8 L;  4PZ8 A;  2OWO A;  5M3F G;  3UE0 A;  1PH9 A;  2Q2T A;  4A3J G;  1T9H A;  2I5H A;  3S17 H;  1G6P A;  2KEN A;  1KC8 C;  1HNX L;  1IBM L;  3I4M G;  1MKH A;  4BA1 I;  1S40 A;  1RIP A;  1PH5 A;  1E7Z A;  1V43 A;  1XJV A;  3K80 C;  4BY1 H;  1XMO Q;  3PUW A;  4C3I H;  1GM5 A;  2JA7 H;  2NVQ H;  2BH2 A;  1GVP A;  2KBN A;  5IYB G;  1S3O A;  5C4J H;  1YEZ A;  4LFA L;  4GKJ Q;  4JOI A;  2BA0 A;  2AMC B;  3GO5 A;  1N36 Q;  1IBK L;  3EN2 A;  3HOV G;  2N3S A;  4JI1 L;  3CCS A;  5LMN Q;  1A0I A;  1WJJ A;  2B29 A;  4UP7 A;  3AFP A;  4YHH Q;  4NXM Q;  4IFD J;  3CP0 A;  3U4V A;  1QVC A;  5IP9 G;  3I55 A;  3I4N G;  4GOP A;  5K36 G;  2HHH L;  1R9T H;  2C35 B;  4R4I A;  3GTP H;  3PV0 A;  4DR6 L;  1Z47 A;  3BZK A;  4A3G G;  1XNR Q;  2UXB L;  5C4X H;  1Y14 B;  2Q2H A;  2LXJ A;  3KDF B;  1MJC A;  3G48 A;  4DPG A;  3BZC A;  1B7Y B;  1HNZ L;  4QY7 A;  4EQ5 A;  4P73 A;  1CKM A;  3CCE A;  1LM0 A;  1GO3 E;  1VQN A;  3CC4 A;  3PF5 A;  3J80 i;  4A3L H;  5IY0 A;  3A5U A;  3UDG A;  3W5O A;  1UE1 A;  3K7A H;  2ZJP A;  1X9N A;  1PH8 A;  4GS3 A;  1G51 A;  1VQ8 A;  2K50 A;  1YI2 A;  1E1O A;  4DV6 Q;  1YHA A;  1N33 Q;  3STB D;  4A76 A;  2ALY B;  1M90 C;  3GD7 A;  4A3C G;  2KCM A;  2GN5 A;  5EAY A;  1L0W A;  4A3B H;  2ASB A;  4GOP C;  4LF8 Q;  4IFD G;  3M4Q A;  1LYL A;  5IYB H;  5C0X I;  4GNX C;  5IP7 G;  2VS1 A;  3RZO H;  4LFA Q;  2NVY H;  3KLW A;  4IPD A;  1I50 H;  2NZO A;  3U50 C;  1OXS C;  4R4O A;  4JI1 Q;  2XGT A;  4TVA B;  5AJ3 Q;  1L2F A;  1K9M C;  2UUA Q;  4BBS H;  3M9B A;  4JI7 L;  4GNX B;  1C0A A; 
#chains in the Genus database with same CATH topology
 4JYA L;  2B2Y A;  4DV7 Q;  4N8X 1;  3I7F A;  4IUQ A;  2Z0S A;  1SMY C;  1A2U A;  4UP8 A;  5NUC A;  1S4Z A;  2CW0 D;  4KY7 A;  1SAP A;  1BOS A;  2ZTC A;  4MTK A;  3ULJ A;  1DJR D;  2PPB C;  4LF9 Q;  4RA8 A;  2HT1 A;  2EJG C;  2XN9 C;  2XRQ D;  1N33 L;  3K5O A;  1Q8K A;  2KHJ A;  2IWH A;  1G8Z D;  1PHJ A;  2JA6 G;  1D5Z C;  1GXD C;  1SN8 A;  5FLX E;  3S1R H;  2BDO A;  2BE5 C;  1BR9 A;  3NPP A;  5ELO A;  3S2D B;  1TKW B;  2B8G A;  1WD1 A;  3TS2 A;  3CCU A;  2N49 A;  3SR1 A;  3AQQ A;  4JYA Q;  1YBY A;  1STA A;  4MTN A;  2EYF A;  4ZCK A;  3J81 i;  1EZ8 A;  4JBJ A;  2JJQ A;  4KI0 A;  4YWM A;  3QIA A;  5AFW A;  2K5W A;  1FVI A;  3OYY A;  1CUK A;  3LWE A;  3TRZ A;  4A3J H;  2NVY B;  1X54 A;  2Z4I A;  1HXY D;  1SE4 A;  2P5Z X;  2VUM H;  5G3L F;  1E1T A;  5FJ8 H;  5L37 A;  1FYC A;  1JB3 A;  1EIG A;  3X3M A;  3LWU A;  1N32 Q;  1AE2 A;  1CFM A;  3ICE A;  2EYP A;  3I4L A;  2WAQ E;  2BCO A;  4EQO A;  4HSP A;  2HQL A;  1QJO A;  1JWU D;  2O2L D;  2UXC Q;  4JI4 L;  4QIW B;  4V0B A;  1V8Q A;  2F3W A;  3MXN B;  3RUZ A;  5LMU Q;  5IWA L;  2FHT A;  1KAA A;  4CHT B;  1SNM A;  1VDZ A;  4LF7 L;  1BNZ A;  3CW2 C;  2OQ0 A;  3E9I A;  4JCV E;  3SK5 A;  4AIM A;  3JC6 6;  4IJL A;  4EQN A;  1E2W A;  5C4J B;  3OIQ A;  1BBW A;  5K5P A;  5IT9 c;  3CMA A;  2OEO A;  1NR2 A;  2AQ3 B;  1HZA A;  2ZJR A;  5CC4 A;  3M4P A;  5C4H A;  1JOK A;  5C3E H;  1KLG D;  3I4N B;  4CKE A;  1V1P A;  1YVC A;  4UY8 C;  2VZA A;  4R1J A;  2PI2 A;  2H1E A;  2PMZ B;  1VQL A;  3HOU G;  1MGS A;  5FLM H;  2R6G A;  1N36 L;  4OWX B;  2A69 C;  1X32 A;  1PTO F;  4MNO A;  3X3N A;  1FR3 A;  1HH2 P;  4UHV A;  1HUN A;  4DFA A;  1I4G A;  3R2T A;  3TN2 A;  2B2T A;  1I4R A;  2WII B;  4QUF A;  1TS4 A;  2A5H A;  4K2K A;  1UE5 A;  4EVO A;  3I91 A;  3CPW A;  1NBW A;  1R9T B;  2CW0 C;  1PTO B;  4RGO S;  4XQQ A;  1QUQ A;  1X6O A;  4P72 A;  1MD2 D;  2K32 A;  3PGZ A;  1LT4 D;  1EU4 A;  5KNB A;  3HKZ E;  4X3U A;  1SRU A;  2VNU D;  1VQ4 A;  2QEX A;  3S2H H;  2Q2I A;  3HOW B;  3M4O H;  4BBR B;  4JI0 Q;  4FP5 D;  1RF2 D;  1BBU A;  1EY8 A;  2YTY A;  1G2T A;  2G5D A;  1I4H A;  5H1S E;  4AH6 A;  4LFB Q;  4JI5 Q;  4BA2 I;  4A3I G;  3S24 A;  4A3D B;  2WV6 D;  4M8A A;  4RHR A;  3J80 E;  5IGD A;  3FKI B;  1F2M A;  1K83 B;  3DEP A;  2B63 B;  2UUB L;  4DK3 C;  1W2B A;  1TS2 A;  2D0P A;  2YYZ A;  5I6Y A;  4A3I H;  1YIT A;  4CJ1 B;  3HOZ H;  2PZT A;  3I8Z A;  2ZM6 Q;  2NVT H;  1YNN C;  2SDF A;  1ESR A;  4OWW B;  2IT1 A;  4DAY A;  2X6L A;  1KAB A;  4DV3 Q;  2I0Q A;  2K75 A;  4UAI A;  4B3T Q;  1DOM A;  5F2D A;  3K7U C;  1PMR A;  4X3T A;  4HCS A;  1N8R C;  2WFW A;  4IJH A;  2B3G A;  4JI0 L;  4HN7 A;  2L11 A;  3E0J A;  1WCM H;  4BWG B;  3BVG A;  4RFB A;  3Q24 A;  1JJ2 A;  2IPK D;  2A68 D;  1AH9 A;  3UE1 A;  1UWV A;  4JI5 L;  1FJG L;  5C3E G;  1MI2 A;  4ZRZ A;  5EKI A;  1BUV T;  3ITP A;  3K6O A;  2KCC A;  1WTV A;  4NW2 A;  2RF4 A;  5JOB A;  5IGC A;  4DNI A;  3QR8 A;  3QJY A;  2FMC A;  4AYB G;  1U4R A;  4IFD H;  2PZU A;  2CWP A;  1OO9 B;  5EGT A;  2ZM6 L;  1B50 A;  1HUM A;  3S15 B;  2AHO B;  3TME A;  4A93 B;  2EPB A;  1IW7 D;  2JA7 G;  2B8F A;  1Q8I A;  4B3T L;  4K8J A;  4KHP L;  4FO2 A;  2Y0S B;  1TQO A;  2KCT A;  2OQK A;  3DM3 A;  1M1K C;  4S3S A;  2C5C A;  1HZ9 A;  1S5C D;  2XWB B;  4DV4 Q;  2Z4H A;  3HG9 A;  5GAG C;  3P20 A;  5CV5 A;  1FJG Q;  3VR4 A;  4POG A;  2NVQ B;  5ELC A;  5IYD H;  1I4X A;  4ZQ3 A;  2Y0S E;  4XYO A;  1FNV A;  3U9O A;  1I5F A;  3HZX A;  1Q1B A;  1Y1V H;  3C1F A;  5GAE C;  2SEB D;  3TP6 A;  3HOV B;  3NEM A;  4RKL A;  1X3F A;  4XT3 B;  4NDX A;  4NP5 A;  5D14 A;  3KBX A;  4OXP A;  5J3B A;  1E22 A;  4B9X A;  3KF6 A;  3Q8D A;  3HOX G;  3F2U A;  4WOR A;  5M3M B;  1LT3 D;  1FNW A;  3D6W A;  4QB4 A;  4KHP Q;  4BXX G;  5J1Z A;  4DNT B;  3HFZ B;  3KLS X;  1CQF A;  1STH A;  2E2J B;  2HCI A;  1PYW D;  2EXZ A;  4A3K B;  4YY3 L;  3MXG A;  4KJO A;  1RJT A;  3FMC A;  5BN4 A;  1JOQ A;  4DV4 L;  2XNA C;  2JA9 A;  2RSN A;  3KBG A;  2RDF A;  4IUN A;  1BXT A;  2K5H A;  3BVM A;  3KF8 B;  3GTM H;  4K0K L;  1G6Z A;  5JVG 3;  1AFP A;  3A5Z B;  4L63 B;  2R92 H;  1EQQ A;  1F2Y A;  4BS9 A;  4OIJ A;  1NNX A;  3C3L A;  1B44 D;  3D4D A;  4IAL A;  2AQ2 B;  5KIX A;  4JG2 A;  1KL9 A;  1TWC H;  1TWA B;  3CC2 A;  2Z6K C;  3DEO A;  5CV6 A;  1I6H B;  4A3D G;  2RCN A;  1T5E A;  1HZB A;  5I2Y A;  1XYI A;  4DK1 A;  4C3H G;  3I70 A;  4QL5 A;  3W1B A;  3CC7 A;  2B2W A;  3HOZ G;  1SFO H;  4Q0F A;  4HIK A;  3PO3 B;  4DUY L;  3T16 A;  2KCN A;  3TP7 A;  2OXP A;  2VQF Q;  4YHH L;  1STN A;  4K0K Q;  1C9O A;  2ZJQ A;  3A0J A;  3QG1 A;  1BVS A;  2NTT A;  5M5X H;  3R2I A;  2AKW B;  2ENB A;  2F0D A;  3C1E A;  2Y0S G;  1TWF H;  1S72 A;  5LMN W;  2XWJ B;  5E4X A;  3PIP A;  4BY7 B;  2MP1 A;  2Z6K A;  2H4O A;  3J7Z C;  1PH9 A;  4K6D A;  4Q5V A;  2Q2T A;  3CKI B;  3S17 H;  4KKT A;  3C2P A;  1EYD A;  3S1M B;  2QEJ C;  3VYU A;  3PUW A;  4C3I H;  2JA7 H;  2BH2 A;  2KBN A;  5IYB G;  4GKJ Q;  4LFA L;  4LK1 C;  1H9J A;  2JYO A;  4A3F B;  2N3S A;  1CM9 A;  1F77 A;  2B29 A;  2MHV A;  4UP7 A;  4YHH Q;  4CDE C;  3CP0 A;  1SYB A;  1YNN D;  1JIC A;  3GTP H;  3H3V C;  3PV0 A;  1WTQ A;  2IX3 A;  5JPN C;  1B9N A;  1PZK D;  1SE3 A;  1GUO A;  1A6X A;  2L5T A;  4DPG A;  4QY7 A;  4P73 A;  2A74 C;  3CCE A;  3NBI A;  1LM0 A;  1VQN A;  1QNU A;  3G6J B;  1KDA A;  1X9N A;  1PH8 A;  2BOS A;  4GS3 A;  1G51 A;  3S1Q B;  4A3C G;  4B08 A;  5EAY A;  4LF8 Q;  3VR3 A;  1LYL A;  1H9R A;  4GNX C;  3RZO H;  4LFA Q;  1A3V A;  3URY A;  3PQI A;  3VR5 A;  4R4O A;  4J6H A;  3L9A X;  3KUP A;  2XGT A;  4TVA B;  5AJ3 Q;  4FVM A;  3VR6 A;  1K9M C;  2UUA Q;  4BBS H;  4IUR A;  4GNX B;  1C0A A;  1ENF A;  1GJX A;  5J39 A;  1ZKO A;  5KYL A;  4XIG S;  1L0Y B;  5M3M G;  2E5L Q;  4LUZ A;  1M4V A;  4R4Q A;  4DR7 Q;  4X66 L;  3H94 A;  4FF1 A;  1KRS A;  3BYY B;  5M9O A;  1EWH A;  1EOV A;  5HY6 A;  1WTW A;  1SYG A;  4A93 G;  2QDB A;  4LF8 L;  1FL0 A;  3MXP A;  4A3M H;  3CCV A;  1CT1 D;  1PH7 A;  2J4X A;  2MUY A;  4HJA A;  4LF5 Q;  4GLV B;  1D7Q A;  4HID A;  3D4R A;  4EQP A;  2YV5 A;  4HMI A;  3MEH A;  2UUA L;  5GAD C;  4OX9 L;  1SXT A;  2IW3 A;  5IOD A;  3CXC A;  3RLN A;  4HMJ A;  2K7V A;  4XT1 B;  3E9H A;  1CHP D;  2JK8 A;  3I73 A;  3I56 A;  3T1H L;  2F3I A;  2RDG A;  4BBS B;  2JSO A;  1HNW Q;  3IL8 A;  1QOH A;  4APV A;  3V05 A;  4O2D A;  1XWE A;  3KF8 A;  2EYL A;  4A3E H;  1VQ5 A;  4PZ6 A;  1BCP D;  1MHW C;  3PSI A;  4DR3 L;  3R93 A;  3ERQ A;  1VQB A;  2RVL A;  4HAE A;  1XMQ Q;  1B2T A;  1J6Q A;  4NPS A;  4OWT B;  1VQP A;  3M7G A;  2TSS A;  4UP9 A;  2F0I A;  3DWP A;  3AMU A;  3PO3 G;  5GQO A;  1WD0 A;  2CQA A;  4JC0 A;  4NMZ A;  4DR2 L;  4HJ9 A;  1JC7 A;  5IYC G;  1UE7 A;  5IT9 L;  4OO1 G;  3A8J E;  1XTD A;  5C44 G;  4K5V A;  4GOP B;  2LY7 A;  3GTO H;  1QWY A;  1X65 A;  4ZKB B;  1VQ9 A;  2SOB A;  1HNW L;  3Q22 A;  4C1N I;  1OXX K;  1STG A;  5HUR A;  1X3G A;  2YU9 H;  1CKN A;  3NQT A;  2BE5 D;  1DYQ A;  1A3U A;  2E2I H;  4TKO B;  3D4W A;  1MIU A;  3W3A A;  3PUY A;  1LTB D;  1U4P A;  1ML0 D;  2MO0 A;  2RHQ B;  1SEB D;  1FD7 D;  1MJE A;  3PO2 H;  4QMG A;  3K5M A;  2QF7 A;  2YU9 B;  4FYD A;  1Y1W H;  4DAP A;  3E0E A;  5KRU A;  2DGY A;  3N52 A;  4PQX A;  1OXT A;  2K5V A;  5TSS A;  3NTH A;  4U68 A;  5FO8 B;  1TWF B;  4GLX A;  2AQ1 B;  4ULL A;  3HOW G;  2DY8 A;  4DR2 Q;  4DR5 Q;  1KIX A;  2OTL A;  1IL8 A;  4KN4 C;  5KGU A;  5E1F A;  3FVQ A;  2QCP X;  3CCM A;  1WTR A;  5C44 B;  3CCQ A;  3ULL A;  1BKB A;  3NXW A;  1W3S A;  2IHF A;  1LTS D;  3FRP B;  3HOU B;  2HIV A;  1VQ6 A;  1HTL D;  2N55 A;  3TP5 A;  1XTC D;  4OON A;  4UDU C;  4DUZ Q;  4Y7N B;  1BCP C;  1KXL A;  3J81 j;  2KJX A;  1EWC A;  2HD3 A;  4TSS A;  1TWC B;  3CME A;  1VQ7 A;  2CHB D;  3S9W A;  2BA1 A;  2CCZ A;  3QOJ A;  3EVQ A;  1SSO A;  4P2C B;  2E2H H;  3FEW X;  2WAQ B;  1DCZ A;  3K5L A;  2PZW A;  2R92 B;  2CKZ B;  3P1H A;  3QOL A;  4U67 3;  2R7F A;  4JBK A;  3KOJ A;  4L5S A;  4DR5 L;  3GTM B;  1AZQ A;  5IP9 H;  5CBA E;  4JI7 Q;  5EPL A;  5ISR A;  4YWL A;  2E8G A;  5C0X H;  4CKC A;  5ELD A;  3GTQ B;  1B1Z A;  5ELE A;  2F0G A;  2K5N A;  1Y69 U;  1PA6 A;  4NXN L;  1VMC A;  1XX8 A;  1SMX A;  3E6Z X;  1QZH A;  4KKU A;  2VQE L;  1I4P A;  3BJU A;  5FLX L;  3GTQ H;  2F0S A;  1KNE A;  3BG3 A;  2B2U C;  3BDO A;  3D0F A;  4A3E G;  3V96 A;  5A2Q E;  1VMP A;  2B2W C;  4Z9C B;  1JWM D;  1QCB D;  1SJH D;  1GHK A;  5BN5 A;  1VQO A;  3OWE B;  4RGM A;  1HHV A;  1MBY A;  2DNE A;  3S16 H;  1PRT C;  1EWI A;  1SBB B;  1IZ6 A;  4AQY L;  4P74 A;  2YTX A;  3MFY A;  5JJI A;  2D9U A;  1CKO A;  4KD3 A;  1WVL A;  2V4D A;  3PO2 G;  2ICI A;  5HGQ A;  2HHH Q;  3DXJ C;  2H5X A;  5DEH A;  1B9M A;  2F0H A;  3H09 A;  4DR1 Q;  2DUD A;  4GLA C;  4KKS A;  4HJ7 A;  3TZD A;  5EBC A;  4Y7N H;  4BBS G;  1CK1 A;  4H0L C;  4NXN Q;  4X64 Q;  3ULP A;  1V1O A;  1ZYR C;  3FKI G;  3WOE A;  3M7N A;  1NY4 A;  2KQ3 A;  3F2D A;  2B2V A;  3HOU H;  1UAP A;  3S1Q H;  1JJG A;  1LAC A;  5C44 H;  5A2Q L;  1JOR A;  3RR5 A;  2Q8R E;  2XIW A;  3LNN A;  2F52 A;  5JJL A;  5FLM G;  1NJI C;  4B3R Q;  3JAM L;  1EFW A;  3PUZ A;  4LFC Q;  5T1I A;  1F9S A;  1EY0 A;  1V1P B;  2KED A;  1S5E D;  2WB1 G;  4X62 Q;  2N8N A;  4DU9 A;  2SNS A;  4A3F H;  3G4S A;  1UE6 A;  3FPP A;  5C6A A;  3L0O A;  4G7O C;  5IYD G;  4FF4 A;  1VQI A;  3PO2 B;  2JA7 B;  2LKV A;  3HOY H;  1IL2 A;  1AN8 A;  1HZC A;  4HCE A;  2N78 A;  2A8V A;  2E2I B;  5T1G A;  3TQY A;  1SMY D;  3HOY B;  4LF9 L;  3GDE A;  4JV5 L;  3SVM A;  2L4N A;  4PMC A;  3SXH A;  1A63 A;  3EFX D;  4RGN A;  2VB2 X;  3MXN A;  1BQQ T;  2J0T D;  3OMG A;  2OTJ A;  4IUU A;  1LUZ A;  2CFM A;  4GKK L;  1Y8P B;  1J9O A;  3OTO Q;  3CCJ A;  1QUQ B;  3MFG A;  3UDX A;  3H15 A;  1P16 A;  4R8N A;  5JJK A;  1FGU A;  4JI6 L;  3J80 c;  1JR0 D;  1K83 H;  3RN2 A;  3FKI H;  4I7A A;  4I7Z C;  4UPA A;  5KND A;  3PO3 H;  1XNQ Q;  2IJ0 A;  1E24 A;  1AE3 A;  4GN5 A;  5IIF A;  2VUM G;  1LAB A;  2F0O A;  1LTL A;  3TS0 A;  1GUW A;  3NEN A;  2EYO A;  1O7I A;  1R4P B;  1WOC A;  3FHW A;  4IPC A;  3D31 A;  2R92 G;  4JV5 Q;  3JAM E;  1PRT B;  2WAQ G;  4KK7 A;  2UXD L;  2EXD A;  4F8M A;  4KY6 A;  2O5J C;  2KHI A;  2VY3 A;  2QKI C;  1KD1 C;  2HCC A;  1PRT F;  4GKK Q;  2VL6 A;  3HKS A;  3S16 B;  1MSG A;  2LXK A;  1TS5 A;  1NMF A;  1CZW A;  1IBM Q;  3G71 A;  2Q8T A;  4O1N A;  3R3O A;  1S5F D;  1IBL L;  1GUS A;  1HTP A;  2NWG A;  2D62 A;  2OCE A;  1PFM A;  1ROD A;  4KMU C;  1B70 B;  3VYT A;  1SNO A;  4G57 A;  3EQL C;  2UXC L;  2R7Z G;  3G6E A;  1XNQ L;  1B4O A;  4L5Q A;  4K8I A;  1LV9 A;  5LMU L;  2ZXR A;  4FNF A;  4L5R C;  2E2J H;  4LF7 Q;  5C0X G;  1H95 A;  4DR6 Q;  1KRT A;  1TY2 A;  4IFD I;  2QIL A;  4B3M Q;  2RCF A;  1STY A;  1EIH A;  4IOA A;  4KY5 A;  4G4K A;  2NYZ D;  5DAU A;  2F0U A;  2JE6 I;  1SLJ A;  5D65 A;  3J81 E;  4IUT A;  2VXW A;  4YIJ A;  2O4X A;  3QWN A;  1BBX C;  2OWO A;  3Q6S A;  3P7J A;  4OL7 A;  4I65 A;  2FFK B;  1IBM L;  1D1K A;  1MKH A;  1PLF A;  1Y1V B;  1S40 A;  2F0K A;  1TII D;  1XJV A;  2E2H B;  4R8I A;  2F03 A;  1GM5 A;  2NVQ H;  5ELB A;  5C4J H;  1N36 Q;  3BS1 A;  1IBK L;  3M4Y A;  3EN2 A;  4DNR B;  3HOV G;  2EY2 A;  3OHX C;  3CCS A;  2D2C C;  1A15 A;  5IP9 G;  3I55 A;  3BYT B;  2C35 B;  4DR6 L;  4R9W A;  5K36 H;  3BZK A;  1XNR Q;  2UXB L;  3DMU A;  2D5D A;  1ONL A;  2Q2H A;  3KDF B;  3BZC A;  2HDM A;  1B7Y B;  2NN6 H;  2K33 A;  2B2T C;  1D2B A;  1HPC A;  2J7Z A;  3MXU A;  5I6W A;  3J80 i;  3W5O A;  1UE1 A;  2ZJP A;  2B2V C;  1YI2 A;  4C3J G;  4DV6 Q;  3GTP B;  1M90 C;  2ALY B;  4F7X A;  1HFN A;  2KCM A;  2A6E C;  2GN5 A;  1L0W A;  4QUC A;  1RKN A;  4OEM B;  4GOP C;  1SJE D;  2F0L A;  3VA5 A;  3M4Q A;  2VUM B;  1Y1W B;  2NVY H;  2NZO A;  1EZ6 A;  4CDD C;  3NUC A;  1OXS C;  4C3I B;  1WTO A;  1EEI D;  3K0X A;  4LFB L;  2EJF C;  1DON A;  1K3R A;  1QIL A;  1EIF A;  4KTA A;  4DV2 Q;  1XNR L;  2UXB Q;  3KK7 A;  3HEJ A;  1VQF A;  3CPF A;  5IYC H;  2WKC A;  4R4T A;  3GTO B;  4BY7 H;  3TRE A;  2R61 A;  2IX1 A;  2R7D A;  1SND A;  1UEA B;  4MZ9 A;  3AEV A;  4ID6 A;  3S1R B;  3HOZ B;  1RCV D;  2LFN A;  1ICF B;  4JOI C;  1YHB A;  1A2T A;  2PQA A;  4KHV A;  3L3O C;  2CQO A;  1JQY D;  4DK0 A;  4HIM A;  3NBH A;  4YWK A;  4DV3 L;  4RGT A;  2KOL A;  1CSP A;  5HGT A;  2L12 A;  1F2L A;  4OIK A;  4RCN A;  2A68 C;  2WB1 B;  4RG1 A;  4A3E B;  2L0C A;  1TWA H;  2AWN A;  1DOL A;  1KAW A;  1VQC A;  5I4D A;  3BVZ A;  4RKB A;  5EKL A;  5G3L D;  1DXM A;  1Y1V G;  1RTN A;  1NMG A;  2IX0 A;  1I50 B;  4L6T B;  4DN4 M;  1I4Q A;  3A8K E;  3IAY A;  1F9P A;  1PTO H;  4R4C A;  4A3B B;  3T53 B;  2QW7 A;  3GP7 A;  2UUC Q;  4HIO A;  1QB5 D;  1YIJ A;  4V19 0;  4X65 Q;  4A3M B;  3K7A B;  5CR3 A;  2K5Q A;  4H02 A;  4QQB X;  3PUV A;  4MN3 A;  2HQE A;  3NQI A;  1W6J A;  4CJ0 B;  2CWA A;  3MTS A;  4M1U B;  5M3M H;  4O0A A;  1XPU A;  3H3V I;  3E5S A;  5EKK A;  1K8G A;  2JA5 G;  4IUP A;  1LT6 D;  5JPM C;  1LLR D;  3I4N H;  1E3P A;  4CDF C;  2I07 B;  3AFQ A;  3SHL A;  1CTM A;  5I9P A;  3DWA A;  4IQZ A;  1LT5 D;  2E2D C;  2GVA A;  2PQA B;  1F2Z A;  1IW7 C;  1K28 A;  5LL6 X;  1PFB A;  1BF4 A;  1ET6 A;  3RZO B;  2SNM A;  1BCP F;  4X65 L;  1WTP A;  4X6A H;  2NZH A;  3PMF A;  4BY7 G;  2X69 A;  4YY3 Q;  1XMO L;  3K5N A;  1ZXT A;  2RKS A;  3MA2 B;  1VQA A;  1HCZ A;  5EPJ A;  2A73 B;  2K28 A;  2ZT9 C;  2B2U A;  1X3E A;  5LMN L;  3RLO A;  1QZG A;  3KLS A;  5CV4 A;  2JA6 H;  4JI3 L;  2L55 A;  3KDF A;  3OSO A;  4A93 H;  1D5X C;  1Q7Y C;  1YNJ D;  4XXE A;  4ZUJ A;  2GVB A;  2A19 A;  2JA8 G;  4KLK A;  2F0V A;  1O80 A;  3TEH B;  2G9H D;  1PTO D;  3CF5 A;  2D0O A;  4QGU A;  2EE1 A;  4OHJ A;  1VF7 A;  4C3I G;  5JJZ A;  3U9S A;  3EA6 A;  2EYH A;  1Q12 A;  4LF4 Q;  3I90 A;  1L0X B;  4A3J B;  1TVX A;  1AZP A;  1PFS A;  4F88 A;  4DR4 L;  5C4Z A;  1WCM B;  4EX5 A;  3S1M H;  3IRB A;  1JMC A;  1T5X D;  5CBE E;  3S17 B;  1J5E Q;  3I72 A;  4DUY Q;  2EVB A;  4DV5 L;  5GRO A;  4DXG A;  2PNR C;  1E2Z A;  3K57 A;  2K6A A;  2VQF L;  1SE8 A;  4ODG A;  4JI3 Q;  3D6C A;  4FXK C;  1SE2 A;  4DV7 L;  5IGB A;  4OEL B;  2NVT B;  1BDO A;  3NWT A;  2XVS A;  5M5X B;  1NE3 A;  3I2Z A;  4A3I B;  1CZG A;  3BU2 A;  3J7Y W;  4POF A;  2WKD A;  1LTI D;  5D3D A;  4ZLT F;  2NBF A;  4C3H H;  2CVR A;  1O7Z A;  3HGB A;  1BCP B;  3EIV A;  4LF4 L;  2KHS A;  1D8L A;  1SFO B;  4A3D H;  2KVM A;  3M85 A;  2JA5 H;  2O5I C;  2PI2 E;  4DR4 Q;  1EFI D;  4MIU A;  3DLL A;  1I6H H;  1QVF A;  4BBR H;  2Z9H A;  1ENA A;  3J81 L;  3HOW H;  3M4O B;  3HS0 C;  1UUP A;  3T13 A;  1J5E L;  3S2H B;  1EY9 A;  4F87 A;  4AYB B;  4DV5 Q;  4K5X A;  1RHP A;  3S1N B;  3CCL A;  1X55 A;  2HIX A;  1TWG B;  1SDF A;  5EQ0 A;  1ZYR D;  5I2X A;  3NE5 B;  5BN3 A;  1TR5 A;  2ZXP A;  2PCF B;  4ZAI A;  1HQM C;  2CH4 A;  2DY7 A;  3ONA B;  2RSO A;  2ES2 A;  5FOB B;  1VQD A;  2F0W A;  3RN5 A;  1DGS A;  4A3L G;  1YJN A;  4L5T A;  4YCV A;  4IPH A;  3CAM A;  1X3Q A;  3UDI A;  3VYR A;  5I9O A;  1TT2 A;  2WB1 E;  3U4Z A;  4A75 A;  1I94 L;  4OGQ C;  3PIO 3;  4JPB W;  3F2B A;  5IE8 A;  4A3K H;  1VQK A;  1N32 L;  3OOC A;  3HKZ B;  5C4X B;  3Q0A A;  4FXD A;  1STB A;  4H7B A;  1RTO A;  1CI3 M;  1S5D D;  2K52 A;  4N8F A;  2RHS B;  1K73 C;  3R8B A;  3NK9 A;  1IYU A;  3NP8 A;  1O7L A;  2ATW A;  5C3E B;  4JI4 Q;  3RD4 A;  1Q82 C;  4A4I A;  5JEA H;  1KTK A;  3JAM c;  3RMH A;  3K58 A;  1CA6 A;  2A6H C;  3HOV H;  3H0G B;  1PZJ D;  1EQR A;  4DAY B;  2IHE A;  5IWA Q;  4BY1 B;  4LWC A;  3J7A F;  4G7Z C;  2F0J A;  2WAC A;  1NUC A;  4X3S A;  1IYJ B;  2DJF C;  2ICE C;  4X66 Q;  5IP7 H;  3STB C;  1PH3 A;  2WP8 J;  2MJ8 A;  3MVV A;  4J15 A;  1I94 Q;  1IKL A;  2DN8 A;  1WTH A;  4K14 A;  3L2P A;  5M5Y B;  1VQG A;  1L1O C;  1WFQ A;  1XXG A;  1Q3L A;  3LX0 A;  1PFN A;  1HJP A;  4LF5 L;  4KHZ A;  1XPR A;  2KEE A;  1PH1 A;  1PH4 A;  2G9D A;  5D3I B;  2F0E A;  5CGK A;  3CD6 A;  4LJZ C;  1RL2 A;  4LUO A;  3BZD B;  4DAV A;  3S15 H;  3MEF A;  5C5L A;  4OX9 Q;  4H13 C;  5C3X A;  4JK1 C;  1DZ1 A;  2GA4 B;  2EYM A;  4YCU A;  1JB7 A;  2PW5 A;  3TSS A;  3T1H Q;  1FNU A;  1IHZ A;  1I3Q B;  1ASZ A;  1U4M A;  3MAQ A;  4LAA A;  1B3A A;  3B6Y A;  3WOF A;  5FLX c;  3A7L A;  4A3G B;  3EJI A;  5FK9 C;  3GV6 A;  1TWH B;  1V1Q A;  3D3R A;  3MC0 B;  3ERS X;  1PZI D;  1ZEQ X;  2X6G A;  4DR3 Q;  2RBM A;  1K0S A;  1SNC A;  4WJ3 M;  1GUG A;  3T4A C;  1XMQ L;  3I4O A;  2K05 A;  3A74 A;  1HNX Q;  2XSC A;  3W1G A;  1VQH A;  2XTI A;  2ID0 A;  4CGY B;  1PXU A;  1Q46 A;  1U4L A;  1CSQ A;  2K01 A;  3NEL A;  1ASY A;  5IGF A;  1G91 A;  3HP3 A;  1ENC A;  3OW2 A;  3NBH B;  1PYS B;  4DA2 A;  2A69 D;  3BDC A;  2Z6B A;  3LGJ A;  1Z7T A;  1AEX A;  1VS0 A;  2Z8L A;  3DUZ A;  3PCO B;  4NXM L;  2B63 H;  1WCM G;  1U9R A;  3GTK H;  3GTL B;  1A62 A;  1LTR D;  4ZK9 B;  2K14 A;  3IFT A;  5IGE A;  4GNX A;  1K8O A;  4PG3 A;  4RCO A;  5C4X G;  5JEA G;  1WI5 A;  2I46 A;  3F2C A;  2UUB Q;  1HA6 A;  1TU2 B;  5COR A;  3Q23 A;  1WYD A;  1KDC A;  4PZ8 A;  2R7Z B;  5M3F G;  3UE0 A;  1STE A;  2R93 B;  3GV3 A;  4A3J G;  2I5H A;  2KEN A;  3OPO A;  1KC8 C;  1HNX L;  3S14 B;  3BDL A;  1E7Z A;  1FGB D;  3K80 C;  4QCL A;  2E75 C;  3VR2 A;  1S3O A;  2AUK A;  1YEZ A;  3CU7 A;  3NSW A;  2B39 A;  3IKJ A;  3GO5 A;  2FJ2 A;  1H9K A;  2LS0 1;  3A7A B;  1A0I A;  2KEC A;  3TDQ A;  3E3X A;  3AFP A;  4J1M A;  4NXM Q;  3U4V A;  4IZ8 A;  5A35 A;  5K36 G;  1R9T H;  2WIN B;  4N9T A;  1Z47 A;  1H9S B;  2NVX B;  3CHB D;  4MHE A;  1MJC A;  3G48 A;  4ZYS A;  4LMQ D;  5FO7 B;  1B53 A;  4HED A;  4FF2 A;  3PF5 A;  2EY6 A;  4A3L H;  3UDG A;  1H9S A;  2F4I A;  2M2L A;  5EPK A;  3H91 A;  1VQ8 A;  2TMP A;  3T51 B;  1E1O A;  1YHA A;  3STB D;  3GD7 A;  5IOC A;  1LTT D;  4DXF A;  2MPM A;  3DM1 A;  5ELF A;  4IFD G;  5IGG A;  2Q8I B;  5C0X I;  2JA8 B;  2A6H D;  2VS1 A;  5IP7 G;  1ILP A;  1NCV A;  3TZU A;  3KLW A;  4E6I A;  1HQR D;  1TY0 A;  2RDH A;  1H9M A;  1ET9 A;  3SK6 A;  1L2F A;  4JI7 L;  2KUM A;  3P75 A;  1IKM A;  4WRD A;  4HJ5 A;  4P71 A;  4DK6 C;  2EZV A;  1NAP A;  2EY1 A;  2A1A A;  1EU3 A;  3SK4 A;  3DWQ A;  1CA5 A;  3PUX A;  4JW0 A;  4XTC S;  4IPG A;  3T1Y Q;  2F3V A;  2A6E D;  3EBE A;  1Q81 C;  2L9H A;  3ZYY X;  2K03 A;  4PMB A;  1OXU A;  2QA4 A;  1HR0 W;  2QDL A;  1PH6 A;  1OTC A;  3ND9 A;  2JEA I;  2F1M A;  2PW7 A;  2JN4 A;  5EJW A;  4PNY A;  4B9W A;  4JBW A;  3KLR A;  5JVH 3;  1QVG A;  1D5M C;  4QF4 A;  3J7A V;  5LHY 1;  5FJ8 G;  3H3V H;  4AQY Q;  2LSS A;  1N34 L;  1GUN A;  4ME3 A;  1B3Q A;  1PYB A;  2ZTE A;  2I5L X;  2B2Y C;  4BXX H;  5C5M A;  2ZTD A;  1DD2 A;  2R93 G;  2AWO A;  4KJN A;  1EY4 A;  3D8G A;  3ZJY C;  4DR1 L;  4A3C H;  5KYI A;  2PQE A;  4X64 L;  1VQM A;  3RNU A;  3T1Y L;  1SNQ A;  4O42 A;  2QGQ A;  1PDQ A;  4NKL A;  1L1O B;  1S5B D;  1U5K A;  2K1B A;  1DOK A;  1GUT A;  2JA8 H;  2DJG C;  5GAH C;  4QIW E;  1ESF A;  1AP0 A;  1EYG A;  3S2D H;  1Q1E A;  2VW9 A;  4K6L A;  3HRZ C;  4ABN A;  4B3R L;  2NUC A;  4ILW A;  3FDT A;  3VYS A;  1EL0 A;  1KNA A;  4LFC L;  1N34 Q;  1JOO A;  4B3S L;  4PV1 C;  5DLQ E;  3F8T A;  4X62 L;  3AU7 A;  2KA7 A;  4PMW A;  2NVX H;  3A54 A;  4DV0 Q;  3PIO A;  4KV6 A;  2JP1 A;  5ELN A;  2FIN B;  5FO9 B;  1L1O A;  3HOX B;  2IL8 A;  5COY A;  4A3M G;  2PMZ E;  2I5M X;  3I3C A;  2MQH A;  4C2M H;  2B63 G;  1YHQ A;  3SGI A;  1O7Y A;  3S14 H;  3ER0 A;  4P75 A;  3H0G G;  4H44 C;  4C56 C;  3A55 A;  3OTO L;  3RZD H;  2NTS A;  1JJC B;  2R93 H;  3WDN A;  5KEE A;  2R7Z H;  3MWY W;  1EQT A;  3SDZ A;  3M3Y H;  1HFG A;  1HRJ A;  1EIY B;  2BDN A;  4Y52 H;  1C4Q A;  4B3S Q;  4N9P A;  5C0X J;  4JI6 Q;  4GKJ L;  4FDB A;  1EEF D;  4IOC A;  2DNC A;  4HSV A;  1GD7 A;  1P8L A;  1U0L A;  4DV0 L;  3GTL H;  3GTK B;  2HDL A;  2K5D A;  3UDF A;  3A8I E;  3GTJ B;  1C8C A;  4RH6 A;  3CCR A;  1A8V A;  3N6R A;  3GTG H;  2YTV A;  2EDG A;  2FXQ A;  4DV1 Q;  2UXD Q;  4J8Q A;  1KHI A;  1TXY A;  4KD4 A;  1YZ6 A;  3OIP A;  5EBD A;  2NN6 I;  3W2D A;  2EQS A;  4FF3 A;  1LTA D;  4XDX A;  1EYA A;  1K0R A;  1V9P A;  4C3J B;  4RAU C;  1G29 1;  1KDB A;  5E7N A;  2HUG A;  3I4M H;  1SYE A;  4DAM A;  4JBM A;  4JI8 L;  3MZ5 A;  2N88 A;  1X56 A;  2RQX A;  1IBL Q;  4YCW A;  3U58 A;  4PZ7 A;  1F9R A;  1B8A A;  5M3F H;  1EOT A;  1SRO A;  1TWH H;  1NSN S;  4DGZ A;  3T56 B;  4A3G H;  3K0Y A;  3WWV A;  1YJW A;  3FP9 A;  2L15 A;  1KLU D;  1UEB A;  5AJ3 L;  4IO9 A;  1HA5 A;  4FXG C;  1SYF A;  4HJ8 A;  2IY5 B;  2MO1 A;  2MFI A;  4LUV A;  1Y1W G;  4B3M L;  1SR3 A;  2Z1C A;  2R3Z A;  2E5L L;  4DV1 L;  4DR7 L;  1ICW A;  4ME5 A;  4G7H C;  1PH2 A;  4IUV A;  2F0M A;  2E76 C;  2MGS A;  1Q90 A;  4RMF A;  3OWF A;  2OT2 A;  4CDC C;  5M5Y H;  4JI8 Q;  4NB3 A;  1PVO A;  5E4W C;  3VDY A;  2Q2U A;  1EY7 A;  4ALP A;  3SEB A;  5JAV A;  1D1I A;  3NHH A;  1IBK Q;  4GN3 B;  1DM0 B;  4A3K G;  1A3T A;  2EIF A;  3AYH B;  5CMD A;  3K8A A;  3H0G H;  4WJW A;  3I4M B;  2C9O A;  3CQZ B;  1VQE A;  4LNQ A;  1K8M A;  4C3J H;  1JE5 A;  4IN3 A;  2PYK A;  5DM6 3;  1AW7 A;  2ZXO A;  2RA4 A;  1GOZ A;  1NR4 A;  1JWS D;  4AYB E;  5C3W A;  3GTG B;  4LW1 A;  4WJ4 A;  4DV6 L;  1QNK A;  1TS3 A;  3GTJ H;  1C7Y A;  3KFU A;  1W6K A;  2F0T A;  1Y8N B;  3PF4 A;  2F0F A;  1BO0 A;  1EUJ A;  5DM7 3;  3FPU B;  1HR0 Q;  4OO1 I;  3DHQ A;  3HOY G;  3KF6 B;  2UU9 L;  3A56 A;  3M3Y B;  3TBI B;  5IT9 E;  1CHQ D;  4JI2 Q;  1O78 A;  1IXR A;  5M5W H;  4DV2 L;  1TWG H;  1GKH A;  3IFD A;  3S1N H;  1G2S A;  1OXV A;  1CKN B;  3OW7 A;  3CRK C;  1EQV A;  4A3F G;  4BY1 G;  5M5W B;  3SK8 A;  4QJF A;  2K4K A;  2M00 A;  3O13 A;  2MNA A;  1JE4 A;  3HOX H;  5CYU A;  3J80 L;  4CJ2 C;  4GZY C;  5JEA J;  2JA5 B;  1Z6H A;  2F4V L;  2AUJ D;  4XQJ A;  1MSH A;  3J81 c;  1YJ9 A;  4C3H B;  1HR0 L;  2V1C C;  2BH8 A;  2VB3 X;  2NN6 G;  4DKA C;  5J22 A;  2UU9 Q;  1NTG A;  4X3K A;  1K3B C;  4XQN A;  1VCI A;  4LF6 L;  4JI2 L;  3K81 C;  1Q86 C;  4WFN 3;  4OO1 H;  2LMC B;  4HTH A;  3KYH C;  3CQZ H;  1SYD A;  1E2V A;  2F0P A;  3F1Z A;  1XPO A;  4L8J A;  3KJP A;  3NWS A;  1N9W A;  1PV4 A;  4DUZ L;  3ND8 A;  5BR8 Q;  4BBR G;  4CBV A;  2F4V Q;  2UUC L;  3J7A 5;  1YNX A;  3HKZ G;  1KQS A;  2JXM B;  4GN4 B;  1J8I A;  2F0Q A;  1F9Q A;  1I3Q H;  3QO2 A;  1PRT D;  2FMM A;  3QB3 A;  1UNS A;  4CKB A;  1D6E C;  3NTK A;  4LF6 Q;  1IYV A;  2OF1 A;  1Z9F A;  3RLF A;  2EJM A;  2PNH A;  4A3B G;  1JCK B;  2JA6 B;  1RDP D;  3JAM i;  2K04 A;  2F0N A;  1K8A C;  3GQB A;  1JT8 A;  2L1B A;  2PO4 A;  3L7Z C;  4K5W A;  1HNZ Q;  4TQU S;  4EGV A;  3KJO A;  1CQV A;  1VQJ A;  2JQO A;  4TRD A;  2JEB I;  2VQE Q;  1WTX A;  3ERO A;  5BR8 L;  4RWS C;  1T9H A;  4C1N K;  3OMC A;  1G6P A;  3K59 A;  2CH4 W;  2NB0 A;  1II3 A;  5M3F B;  3I4M G;  4BA1 I;  1RIP A;  1PH5 A;  3CRL C;  1V43 A;  1X3P A;  5CV9 A;  2M9V A;  5KNC A;  4BY1 H;  1XMO Q;  1GVP A;  1SNP A;  5CV7 A;  2EYJ A;  4JOI A;  2BA0 A;  2AMC B;  4ZKC B;  3PIP 3;  3VA7 A;  1E0B A;  4JI1 L;  3C46 A;  5LMN Q;  1WJJ A;  4ZUI A;  4IFD J;  1M8A A;  1QVC A;  5CV8 A;  3I4N G;  4GOP A;  2HHH L;  1SYC A;  1EY6 A;  4R4I A;  3NTI A;  4A3G G;  5C4X H;  1Y8O B;  1Y14 B;  2EY5 A;  2LXJ A;  1LO5 D;  3H6M A;  1HNZ L;  4EQ5 A;  1VF5 C;  4HR7 B;  3MHB A;  1CKM A;  1C48 A;  3G7L A;  3UI2 A;  1GO3 E;  4DF7 A;  3V2T A;  3CC4 A;  4K2L A;  5IY0 A;  3A5U A;  2E74 C;  1PTO C;  3K7A H;  4RHS A;  5DNF A;  1EYC A;  1GHJ A;  2K50 A;  5E3F A;  1EY5 A;  1YNJ C;  1N33 Q;  4A76 A;  3AB9 A;  1ILQ A;  1QG7 A;  1QE6 A;  1I6V C;  4A3B H;  2ASB A;  2XRS D;  5IYB H;  2NZ1 D;  1LTG D;  5LL6 S;  3RZD B;  4IPD A;  4XYQ A;  4KN7 C;  1I50 H;  3U50 C;  1R4Q B;  3TP8 A;  2EOT A;  4JI1 Q;  3SE0 A;  1RD9 D;  3M9B A;  4JVZ A;  5FKA C;  4C2M B; 
#chains in the Genus database with same CATH homology
 3K0X A;  4HJ5 A;  4JYA L;  4DV7 Q;  4P71 A;  4LFB L;  3I7F A;  4DK6 C;  2Z0S A;  1K3R A;  4UP8 A;  1EIF A;  4DV2 Q;  1XNR L;  4XIG S;  2A1A A;  2UXB Q;  1VQF A;  3CPF A;  5M3M G;  5IYC H;  2E5L Q;  4R4T A;  4LUZ A;  3PUX A;  4R4Q A;  4XTC S;  2ZTC A;  3ULJ A;  4BY7 H;  3TRE A;  2IX1 A;  4X66 L;  4DR7 Q;  2R7D A;  4IPG A;  3T1Y Q;  3EBE A;  4LF9 Q;  1Q81 C;  4MZ9 A;  2HT1 A;  1KRS A;  3AEV A;  1EOV A;  1OXU A;  5HY6 A;  2QA4 A;  1N33 L;  1HR0 W;  1Q8K A;  4JOI C;  1PH6 A;  1YHB A;  2KHJ A;  1OTC A;  2PQA A;  2JEA I;  4A93 G;  2CQO A;  1PHJ A;  4HIM A;  4LF8 L;  2JA6 G;  1FL0 A;  4JBW A;  4YWK A;  4DV3 L;  4A3M H;  1QVG A;  1SN8 A;  1CSP A;  3CCV A;  3S1R H;  4HJA A;  1PH7 A;  4LF5 Q;  4GLV B;  1D7Q A;  4HID A;  5FJ8 G;  3H3V H;  5ELO A;  4AQY Q;  2LSS A;  1N34 L;  4ME3 A;  2YV5 A;  1PYB A;  2ZTE A;  3CCU A;  3TS2 A;  2UUA L;  2N49 A;  5GAD C;  4OX9 L;  4RG1 A;  3CXC A;  2I5L X;  4BXX H;  3AQQ A;  1TWA H;  4JYA Q;  3RLN A;  2ZTD A;  2AWN A;  2R93 G;  1YBY A;  2AWO A;  4DR1 L;  3ZJY C;  1KAW A;  1VQC A;  4MTN A;  4A3C H;  3E9H A;  3J81 i;  4JBJ A;  3T1H L;  2JK8 A;  3I56 A;  2JJQ A;  4KI0 A;  2F3I A;  4YWM A;  1Y1V G;  1NMG A;  1HNW Q;  2IX0 A;  4X64 L;  1VQM A;  3RNU A;  1FVI A;  3OYY A;  4APV A;  3T1Y L;  1CUK A;  2QGQ A;  4A3J H;  3TRZ A;  1L1O B;  4O2D A;  1X54 A;  1U5K A;  4A3E H;  2JA8 H;  2VUM H;  1VQ5 A;  4PZ6 A;  1E1T A;  5FJ8 H;  5GAH C;  4R4C A;  3PSI A;  4QIW E;  4DR3 L;  1EYG A;  3S2D H;  2UUC Q;  1N32 Q;  1VQB A;  4HIO A;  1Q1E A;  1XMQ Q;  2VW9 A;  1AE2 A;  1J6Q A;  1YIJ A;  4B3R L;  4NPS A;  3ICE A;  4OWT B;  1VQP A;  4X65 Q;  2WAQ E;  4LFC L;  4H02 A;  1N34 Q;  4UP9 A;  4B3S L;  4QQB X;  3PUV A;  5DLQ E;  2HQL A;  3F8T A;  4X62 L;  3PO3 G;  5GQO A;  4PMW A;  2NVX H;  2UXC Q;  4JI4 L;  4JC0 A;  4DR2 L;  2CWA A;  4HJ9 A;  5M3M H;  5IYC G;  4O0A A;  1UE7 A;  4DV0 Q;  3MXN B;  4OO1 G;  3PIO A;  5LMU Q;  1XPU A;  1XTD A;  5C44 G;  3H3V I;  5ELN A;  5IWA L;  4GOP B;  1L1O A;  1K8G A;  2JA5 G;  3GTO H;  1X65 A;  1VQ9 A;  4LF7 L;  1HNW L;  3CW2 C;  2OQ0 A;  3E9I A;  4JCV E;  4AIM A;  4A3M G;  3I4N H;  1OXX K;  3JC6 6;  1E3P A;  1X3G A;  2PMZ E;  2I5M X;  2YU9 H;  1CKN A;  4IJL A;  2MQH A;  3AFQ A;  4C2M H;  1BBW A;  4LF7 Q;  5IT9 c;  3CMA A;  2B63 G;  2E2I H;  1YHQ A;  1MIU A;  3SGI A;  2GVA A;  1H95 A;  3PUY A;  3S14 H;  2PQA B;  2RHQ B;  2MO0 A;  1HZA A;  2ZJR A;  3ER0 A;  1MJE A;  4P75 A;  3H0G G;  3PO2 H;  3OTO L;  3M4P A;  1Y1W H;  3RZD H;  5C3E H;  1JJC B;  2R93 H;  3E0E A;  2R7Z H;  4X65 L;  1YVC A;  4UY8 C;  4X6A H;  2NZH A;  2VZA A;  2DGY A;  2PI2 A;  4R1J A;  3M3Y H;  4BY7 G;  1EIY B;  4YY3 Q;  4Y52 H;  1XMO L;  4B3S Q;  1VQL A;  1OXT A;  5C0X J;  4JI6 Q;  4GKJ L;  4FDB A;  2K5V A;  3HOU G;  1VQA A;  5FLM H;  2R6G A;  1N36 L;  4OWX B;  4IOC A;  4GLX A;  3HOW G;  1GD7 A;  4DR2 Q;  1P8L A;  1X3E A;  5LMN L;  3RLO A;  1U0L A;  4MNO A;  4DV0 L;  4DR5 Q;  1HH2 P;  1QZG A;  1KIX A;  3GTL H;  2OTL A;  2JA6 H;  4JI3 L;  3UDF A;  3KDF A;  3CCM A;  4A93 H;  1Q7Y C;  3CCQ A;  3ULL A;  1BKB A;  1W3S A;  2GVB A;  2IHF A;  3CCR A;  2A19 A;  2JA8 G;  4KLK A;  1A8V A;  1UE5 A;  3TEH B;  3GTG H;  2YTV A;  2FXQ A;  2HIV A;  3CPW A;  3CF5 A;  1NBW A;  1VQ6 A;  4DV1 Q;  2UXD Q;  1KHI A;  1TXY A;  2D0O A;  1YZ6 A;  4QGU A;  2NN6 I;  2EQS A;  4OON A;  4DUZ Q;  1K0R A;  1QUQ A;  1KXL A;  1V9P A;  3J81 j;  1G29 1;  5E7N A;  1X6O A;  1Q12 A;  4P72 A;  4LF4 Q;  3PGZ A;  3CME A;  3I4M H;  1VQ7 A;  2BA1 A;  1PFS A;  4DAM A;  4JBM A;  4JI8 L;  4DR4 L;  3HKZ E;  2CCZ A;  2E2H H;  1X56 A;  4EX5 A;  1SRU A;  1IBL Q;  1VQ4 A;  4YCW A;  3S1M H;  3U58 A;  2VNU D;  4PZ7 A;  1B8A A;  5M3F H;  2QEX A;  3IRB A;  1JMC A;  1SRO A;  1TWH H;  3S2H H;  2CKZ B;  1J5E Q;  2Q2I A;  4A3G H;  4DUY Q;  3M4O H;  2R7F A;  3WWV A;  1YJW A;  4JBK A;  3KOJ A;  4JI0 Q;  4DV5 L;  3FP9 A;  5GRO A;  2L15 A;  1UEB A;  4L5S A;  4DR5 L;  5AJ3 L;  1BBU A;  5IP9 H;  2VQF L;  4IO9 A;  4JI7 Q;  2YTY A;  1SE8 A;  4YWL A;  4JI3 Q;  2E8G A;  5H1S E;  4AH6 A;  4HJ8 A;  4DV7 L;  4JI5 Q;  4BA2 I;  4A3I G;  4LFB Q;  3S24 A;  2IY5 B;  2MO1 A;  2MFI A;  4LUV A;  1Y1W G;  4B3M L;  1SR3 A;  1NE3 A;  3I2Z A;  2K5N A;  2E5L L;  4DV1 L;  3BU2 A;  1PA6 A;  4NXN L;  2UUB L;  4POF A;  1SMX A;  4DR7 L;  4DK3 C;  1QZH A;  1W2B A;  1PH2 A;  2D0P A;  2YYZ A;  2VQE L;  3BJU A;  4A3I H;  1YIT A;  4C3H H;  3HOZ H;  3GTQ H;  3EIV A;  4RMF A;  2ZM6 Q;  2NVT H;  3D0F A;  4LF4 L;  1D8L A;  4A3D H;  3M85 A;  4A3E G;  5M5Y H;  2JA5 H;  4OWW B;  2PI2 E;  4JI8 Q;  4NB3 A;  4DR4 Q;  1PVO A;  2IT1 A;  4DV3 Q;  1I6H H;  3DLL A;  2I0Q A;  2K75 A;  4BBR H;  4B3T Q;  3VDY A;  2Q2U A;  1QVF A;  1VQO A;  3K7U C;  4ALP A;  3HOW H;  1J5E L;  1N8R C;  1IBK Q;  3S16 H;  2WFW A;  4AQY L;  1EWI A;  1IZ6 A;  4IJH A;  4GN3 B;  2B3G A;  4JI0 L;  4DV5 Q;  4A3K G;  1WCM H;  2EIF A;  3AYH B;  4P74 A;  1JJ2 A;  2YTX A;  3K8A A;  5JJI A;  3CCL A;  1CKO A;  3H0G H;  3PO2 G;  1AH9 A;  1X55 A;  2HIX A;  3UE1 A;  5HGQ A;  1UWV A;  2HHH Q;  4JI5 L;  1FJG L;  2H5X A;  5C3E G;  1VQE A;  2DUD A;  4DR1 Q;  4GLA C;  4LNQ A;  4C3J H;  4HJ7 A;  1JE5 A;  2ES2 A;  4Y7N H;  4BBS G;  2RF4 A;  1VQD A;  4NXN Q;  3RN5 A;  4X64 Q;  1DGS A;  3ULP A;  4DNI A;  4A3L G;  1YJN A;  4L5T A;  3FKI G;  4YCV A;  4AYB G;  4IPH A;  3CAM A;  3M7N A;  3UDI A;  1NY4 A;  4AYB E;  3F2D A;  3HOU H;  2CWP A;  2WB1 E;  4LW1 A;  3U4Z A;  3S1Q H;  4WJ4 A;  1JJG A;  4A75 A;  4DV6 L;  2ZM6 L;  1I94 L;  5C44 H;  2AHO B;  3RR5 A;  3GTJ H;  1C7Y A;  3KFU A;  2F52 A;  3F2B A;  5JJL A;  5IE8 A;  4A3K H;  2JA7 G;  1VQK A;  1N32 L;  5FLM G;  3PF4 A;  4B3T L;  4KHP L;  1NJI C;  4B3R Q;  1EUJ A;  2KCT A;  1EFW A;  1HR0 Q;  3PUZ A;  4LFC Q;  2K52 A;  2OQK A;  3DM3 A;  1M1K C;  4OO1 I;  3HOY G;  2RHS B;  3KF6 B;  1HZ9 A;  2UU9 L;  1K73 C;  2WB1 G;  4X62 Q;  2N8N A;  4A3F H;  3G4S A;  4DV4 Q;  5GAG C;  2ATW A;  4JI4 Q;  1UE6 A;  1FJG Q;  1Q82 C;  4JI2 Q;  3L0O A;  1IXR A;  4A4I A;  5IYD G;  1VQI A;  5M5W H;  1TWG H;  3JAM c;  4DV2 L;  4POG A;  3HOV H;  3HOY H;  5IWA Q;  1EQR A;  1GKH A;  1HZC A;  2IHE A;  4DAY B;  1IL2 A;  3S1N H;  1OXV A;  5IYD H;  4LWC A;  2N78 A;  2Y0S E;  1CKN B;  2A8V A;  3TQY A;  1I5F A;  1Q1B A;  1IYJ B;  1Y1V H;  5GAE C;  4A3F G;  4X66 Q;  3NEM A;  4BY1 G;  1X3F A;  3GDE A;  4LF9 L;  5IP7 H;  4QJF A;  3STB C;  4JV5 L;  1PH3 A;  2K4K A;  2MNA A;  2WP8 J;  1A63 A;  4OXP A;  4J15 A;  5J3B A;  1E22 A;  3KF6 A;  1I94 Q;  3Q8D A;  3HOX H;  2OTJ A;  3L2P A;  5JEA J;  3HOX G;  1VQG A;  1LUZ A;  2F4V L;  2CFM A;  1L1O C;  4GKK L;  1WFQ A;  3OTO Q;  3CCJ A;  1QUQ B;  1HJP A;  4LF5 L;  4KHZ A;  3J81 c;  4KHP Q;  3UDX A;  4BXX G;  1XPR A;  3HFZ B;  1PH1 A;  3H15 A;  1P16 A;  1YJ9 A;  1PH4 A;  1HR0 L;  5JJK A;  2V1C C;  2BH8 A;  4YY3 L;  3CD6 A;  2NN6 G;  4DKA C;  1FGU A;  4JI6 L;  3J80 c;  1K83 H;  3RN2 A;  1NTG A;  2UU9 Q;  1RL2 A;  4LUO A;  3S15 H;  3FKI H;  3MEF A;  4OX9 Q;  4UPA A;  4DV4 L;  1VCI A;  4LF6 L;  3PO3 H;  2JA9 A;  1XNQ Q;  4JI2 L;  3K81 C;  4YCU A;  1JB7 A;  1E24 A;  1AE3 A;  4GN5 A;  1Q86 C;  2VUM G;  3T1H Q;  2K5H A;  1LTL A;  3TS0 A;  1ASZ A;  3NEN A;  3KF8 B;  3GTM H;  4K0K L;  3B6Y A;  1O7I A;  3KYH C;  1WOC A;  5FLX c;  3FHW A;  4IPC A;  3D31 A;  2R92 G;  3CQZ H;  3A5Z B;  4JV5 Q;  2WAQ G;  2R92 H;  3F1Z A;  1XPO A;  1V1Q A;  2EXD A;  1EQQ A;  2UXD L;  3KJP A;  1N9W A;  3ERS X;  2KHI A;  1PV4 A;  4DUZ L;  2VY3 A;  5BR8 Q;  1KD1 C;  4DR3 Q;  4BBR G;  2F4V Q;  2UUC L;  4WJ3 M;  4GKK Q;  2VL6 A;  3HKS A;  3J7A 5;  1XMQ L;  4JG2 A;  2LXK A;  1YNX A;  1KL9 A;  1TWC H;  3I4O A;  3A74 A;  1NMF A;  1HNX Q;  3CC2 A;  2Z6K C;  3W1G A;  3HKZ G;  1VQH A;  2XTI A;  1KQS A;  3G71 A;  1IBM Q;  2ID0 A;  2RCN A;  4GN4 B;  4A3D G;  1HZB A;  1I3Q H;  1Q46 A;  1IBL L;  2OCE A;  2D62 A;  1CSQ A;  4QL5 A;  3W1B A;  3NEL A;  3CC7 A;  1ASY A;  3HOZ G;  1SFO H;  3OW2 A;  3NBH B;  1B70 B;  1PYS B;  4HIK A;  4DUY L;  4LF6 Q;  2UXC L;  2R7Z G;  1Z9F A;  3G6E A;  1XNQ L;  3LGJ A;  4L5Q A;  3RLF A;  5LMU L;  1VS0 A;  2PNH A;  3PCO B;  4YHH L;  2VQF Q;  4NXM L;  4A3B G;  2B63 H;  1WCM G;  3JAM i;  3GTK H;  4L5R C;  1C9O A;  2E2J H;  1A62 A;  3A0J A;  1BVS A;  5C0X G;  1KRT A;  1K8A C;  2K14 A;  2ZJQ A;  5M5X H;  4GNX A;  4DR6 Q;  4IFD I;  4PG3 A;  1JT8 A;  2AKW B;  4B3M Q;  3L7Z C;  2Y0S G;  1TWF H;  1S72 A;  4IOA A;  5C4X G;  5JEA G;  4K0K Q;  5LMN W;  1HNZ Q;  1WI5 A;  4TQU S;  3F2C A;  2UUB Q;  3PIP A;  3KJO A;  1VQJ A;  2JE6 I;  1SLJ A;  2JQO A;  2JEB I;  2Z6K A;  2VQE Q;  3J7Z C;  1WYD A;  5BR8 L;  4PZ8 A;  2OWO A;  5M3F G;  3UE0 A;  1PH9 A;  2Q2T A;  4A3J G;  1T9H A;  2I5H A;  3S17 H;  1G6P A;  2KEN A;  1KC8 C;  1HNX L;  1IBM L;  3I4M G;  1MKH A;  4BA1 I;  1S40 A;  1RIP A;  1PH5 A;  1E7Z A;  1V43 A;  1XJV A;  3K80 C;  4BY1 H;  1XMO Q;  3PUW A;  4C3I H;  1GM5 A;  2JA7 H;  2NVQ H;  2BH2 A;  1GVP A;  2KBN A;  5IYB G;  1S3O A;  5C4J H;  1YEZ A;  4LFA L;  4GKJ Q;  4JOI A;  2BA0 A;  2AMC B;  3GO5 A;  1N36 Q;  1IBK L;  3EN2 A;  3HOV G;  2N3S A;  4JI1 L;  3CCS A;  5LMN Q;  1A0I A;  1WJJ A;  2B29 A;  4UP7 A;  3AFP A;  4YHH Q;  4NXM Q;  4IFD J;  3CP0 A;  3U4V A;  1QVC A;  5IP9 G;  3I55 A;  3I4N G;  4GOP A;  5K36 G;  2HHH L;  1R9T H;  2C35 B;  4R4I A;  3GTP H;  3PV0 A;  4DR6 L;  1Z47 A;  3BZK A;  4A3G G;  1XNR Q;  2UXB L;  5C4X H;  1Y14 B;  2Q2H A;  2LXJ A;  3KDF B;  1MJC A;  3G48 A;  4DPG A;  3BZC A;  1B7Y B;  1HNZ L;  4QY7 A;  4EQ5 A;  4P73 A;  1CKM A;  3CCE A;  1LM0 A;  1GO3 E;  1VQN A;  3CC4 A;  3PF5 A;  3J80 i;  4A3L H;  5IY0 A;  3A5U A;  3UDG A;  3W5O A;  1UE1 A;  3K7A H;  2ZJP A;  1X9N A;  1PH8 A;  4GS3 A;  1G51 A;  1VQ8 A;  2K50 A;  1YI2 A;  1E1O A;  4DV6 Q;  1YHA A;  1N33 Q;  3STB D;  4A76 A;  2ALY B;  1M90 C;  3GD7 A;  4A3C G;  2KCM A;  2GN5 A;  5EAY A;  1L0W A;  4A3B H;  2ASB A;  4GOP C;  4LF8 Q;  4IFD G;  3M4Q A;  1LYL A;  5IYB H;  5C0X I;  4GNX C;  5IP7 G;  2VS1 A;  3RZO H;  4LFA Q;  2NVY H;  3KLW A;  4IPD A;  1I50 H;  2NZO A;  3U50 C;  1OXS C;  4R4O A;  4JI1 Q;  2XGT A;  4TVA B;  5AJ3 Q;  1L2F A;  1K9M C;  2UUA Q;  4BBS H;  3M9B A;  4JI7 L;  4GNX B;  1C0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...