4YHHL

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 11
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4yhhL00
4AIMA 2ES2A 2UU9L 1IBKL 4JV5Q 3S1RH 3A0JA 3GTOH 4DV7L 4A3CG 1QUQA 3F8TA 1FVIA 1PH5A 2IX1A 1BVSA 1Q12A 3M4OH 4IOAA 3HOZH 5JJLA 5C3EG 3T1YL 3PO2G 1T9HA 2HHHL 3F2BA 3OW2A 5IP7G 4L5TA 1N36Q 2F4VL 4DUYQ 1EQQA 2R6GA 1Q82C 3PIOA 3KLWA 3OYYA 3J81c 1SE8A 4POGA 1KIXA 1NBWA 4HJ7A 1KQSA 1K8AC 5DLQE 1E7ZA 5LMNL 5M3FG 1E22A 4OXPA 3HOYG 3TS2A 1H95A 1YNXA 3GTMH 2MO0A 3MEFA 4O0AA 4OWXB 4IOCA 4YY3L 1JJCB 4BXXG 1N33L 3HOWH 1VQJA 2UXCL 4A3LG 2B63H 2WP8J 3JC66 3CCQA 5FJ8H 2RHSB 4FDBA 1PVOA 4JI8L 4C2MH 5FLMG 4JI2L 2PNHA 5C44G 1SMXA 3PF4A 4A3DH 1VQPA 1VQAA 3HKZG 3PUXA 4LF7Q 1IXRA 4GS3A 1K83H 1VQDA 3JAMi 1YZ6A 1CKNB 4GKJL 3CPWA 3FKIG 4YWMA 1WOCA 1Q8KA 3GO5A 2NZHA 1OXTA 1PH7A 4R4OA 1PH3A 1XNQQ 2JK8A 5GAGC 3U58A 4YCUA 3CC7A 1HNZQ 3K81C 1V1QA 4MTNA 4QQBX 3FP9A 1I50H 1OXVA 2K5NA 3CMEA 2VQEQ 1VQOA 2MNAA 1CKNA 4GKKL 1NTGA 5M5XH 1J5EL 4APVA 1CKMA 1V9PA 1HNWQ 1YITA 1Q86C 3GTGH 4A3GG 2CKZB 4KHPQ 4HIKA 1VQNA 2E5LQ 1CSQA 3GTJH 4K0KQ 5JJKA 2E2IH 1NY4A 1Y1VG 4DV2Q 1HZBA 3BZCA 4AQYL 1PH9A 3CCEA 4B3SL 4JI6L 5JEAJ 4A93G 1W2BA 4DAYB 1KXLA 1UE6A 1EIFA 3FHWA 4LF5Q 4P73A 1KRTA 3OTOQ 4NB3A 1GM5A 3HOVH 4BBSH 2IHFA 1YEZA 5M3MH 4HIMA 1XMOL 3I2ZA 5C0XI 4X65L 4YCVA 1PH2A 3RLNA 4BBRH 2WB1E 5IT9c 3KF6A 3S2DH 4TQUS 2YV5A 1L1OB 4XTCS 2CFMA 1YBYA 3KDFA 3BU2A 5EAYA 4EX5A 1VQ7A 1FJGL 4JI4L 1B70B 2N3SA 3CD6A 3Q8DA 4LUOA 5H1SE 1S3OA 1K73C 1EWIA 1SLJA 2RHQB 5IYBH 4JYAL 4P74A 1Q1EA 3PO3G 4DV1L 3J7A5 4PZ6A 1L1OA 1XPRA 2JJQA 3G71A 1G6PA 4QY7A 2GN5A 2B63G 1A0IA 4YHHL 1L0WA 5FJ8G 5LMUL 4OO1I 2VQFQ 4WJ4A 5C0XJ 3G6EA 3MXNB 4NXNL 4DUZL 1JB7A 4QL5A 5FLMH 3S16H 1Q46A 4GOPB 2D62A 1E24A 4IPDA 5J3BA 2DUDA 1A8VA 2YTXA 4HJ8A 1HR0W 4B3RL 3I4NH 4JI1L 5C4JH 3CCRA 3GTPH 1A62A 1HNXQ 1E1OA 5ELOA 3PIPA 3ULJA 4DV3L 4L5RC 2BA0A 3B6YA 5E7NA 3T1YQ 4IFDJ 3CP0A 4JI5L 4GLXA 3D31A 1PH1A 3ICEA 4DK3C 1W3SA 4JI0Q 4PZ7A 3GD7A 2JA6H 4DV6L 1C9OA 3PUZA 4YWKA 5AJ3L 2RF4A 2ZM6Q 2UUBL 4L5SA 4X62Q 2UXBQ 2UXDL 3AFQA 4LFAQ 2QA4A 5GAEC 5IYCH 4DV4Q 4R4CA 4Y52H 4IPCA 3PUWA 1ASZA 1YJWA 2R93H 1RL2A 1VQHA 1EYGA 4A93H 3UDXA 3F2CA 2GVAA 5M3MG 3PSIA 4BBSG 3RZOH 3CCUA 1PFSA 2UUCQ 3E0EA 2I5MX 2WB1G 3BJUA 3L2PA 4X66L 1EUJA 4BBRG 2YU9H 2EIFA 1PYBA 2Z6KA 1AH9A 2AHOB 5GADC 2UUAQ 3CQZH 1P16A 4JOIC 4LNQA 3KFUA 3KJPA 3LGJA 1NMGA 4PZ8A 4DR4Q 3UE0A 1PYSB 5LMNW 2PQAA 2VZAA 1LTLA 4GLVB 5IY0A 5GAHC 3DM3A 3M4QA 1XNRQ 1IBLQ 3NBHB 5IYBG 4OWTB 1X65A 1HH2P 1MJCA 4QJFA 3NELA 3U50C 3BZKA 1E1TA 1WJJA 1YJ9A 1XJVA 1SN8A 4B3ML 4LF6L 1Q7YC 4DR7Q 1LUZA 2E8GA 1HZCA 2CWAA 3PO3H 1EQRA 3H15A 4B3TQ 2NN6G 2ZTCA 3KOJA 1XTDA 3W1GA 5IWAL 2ZJRA 2N8NA 4NXMQ 3F1ZA 1BBUA 1JJ2A 4LFBQ 3KF8B 1R9TH 2D0OA 4YWLA 1FL0A 3STBD 1WFQA 3AYHB 4JI3L 4BA1I 3RNUA 4L5QA 4X64L 1KC8C 1IBMQ 1XMQL 1UE5A 3CF5A 4DV5L 2NVXH 3I4NG 1OXXK 2RCNA 5IE8A 4DR6Q 3G48A 1Q81C 4KHZA 2IHEA 4GNXB 2DGYA 2ASBA 1VCIA 4DR1Q 4DR5Q 3AQQA 1JE5A 3W5OA 1J6QA 1HJPA 2C35B 4O2DA 1I94Q 4OONA 3T1HQ 3E9HA 3G4SA 4P71A 3U4VA 2JA6G 2R7ZH 4JV5L 4JBKA 1IYJB 1D8LA 1VQCA 3J80c 3L0OA 2I0QA 3S1NH 4GNXA 2R7FA 3HOWG 1FJGQ 2HIXA 3CCLA 4A4IA 2YYZA 3HFZB 1L2FA 4MNOA 4RMFA 4EQ5A 2H5XA 5IYCG 4LFCQ 1GO3E 3H3VI 1YI2A 1K0RA 1MKHA 5JJIA 2IX0A 4DR3Q 1LM0A 2AWNA 1WI5A 4DV0Q 1N36L 4LFBL 4DUYL 1UWVA 4DK6C 2JA5H 3HOUH 2R93G 3S2HH 1PH4A 4A3EH 4MZ9A 5C4XH 4YCWA 3KF6B 4HJ5A 2ZJQA 1K8GA 3ULPA 1TWHH 3KDFB 4DNIA 2E2JH 1U5KA 1SR3A 4LF8Q 4A3BH 2YTYA 1VQ8A 2F52A 3S15H 1X3EA 1N32Q 3ERSX 3U4ZA 4A3JH 4DR2Q 4JI7Q 1PH8A 5BR8Q 2YTVA 4ME3A 1N34Q 2B29A 1YHQA 1X55A 1KAWA 1YIJA 1PH6A 3A5UA 3D0FA 2VL6A 5FLXc 4QGUA 1Q1BA 4TVAB 1VQFA 3I56A 2OCEA 3GDEA 4A75A 1B7YB 2OQ0A 4UP9A 1HR0Q 1C7YA 3WWVA 4R4QA 4LWCA 1YHBA 2A1AA 3RZDH 4LF7L 2VUMG 3W1BA 2JA7H 2XTIA 2VNUD 2L15A 2Q2TA 3CCMA 2ZTDA 1QVFA 4IFDI 3E9IA 4LUVA 1OXSC 1X3FA 2N78A 4JG2A 4LF9Q 5M5WH 1XNQL 3S14H 2JEBI 3UDIA 1CUKA 2WAQE 1KD1C 4OWWB 1HNZL 1G51A 3S17H 2KHIA 1N8RC 1X56A 4BY1H 1IZ6A 2VQEL 4KI0A 3CCVA 2LXJA 3CPFA 4R4TA 1VQBA 2Q2UA 4OX9Q 1Z47A 2PI2A 2Z0SA 2R7DA 1HNWL 5IYDG 4KHPL 2UU9Q 1IBKQ 5IP9H 1YVCA 1WCMH 2E5LL 4K0KL 2VS1A 3J81i 4DV7Q 4LF4L 4DV2L 3PUVA 4DAMA 4A3MG 2R7ZG 4LF5L 1V43A 3PUYA 4UP8A 3OTOL 2HHHQ 2K4KA 3TRZA 2F4VQ 3RR5A 2BH2A 2JA9A 5GROA 1L1OC 4JC0A 2LSSA 1B8AA 1VQGA 5LMNQ 4DPGA 2JA5G 2NVTH 3HOUG 1IL2A 4A3EG 1BBWA 3I7FA 4R4IA 3S24A 4YY3Q 5C4XG 1UE7A 1S72A 1C0AA 1WYDA 1GD7A 3J81j 1N33Q 3I4OA 1XPOA 1Y14B 3RN2A 1ASYA 2UXCQ 3SGIA 2KCTA 3UE1A 1TXYA 1DGSA 4JI8Q 2PQAB 2FXQA 4JI2Q 4A3BG 3K80C 3I4MH 1GVPA 2LXKA 2A19A 4A3JG 2K52A 1X54A 3GTKH 4IJHA 4IPHA 1JJGA 3RLFA 2VQFL 3PGZA 1LYLA 2PI2E 5M5YH 4AH6A 2PMZE 4GOPC 3TQYA 3M85A 3M4PA 3PF5A 1KL9A 4GKJQ 3CW2C 3KJOA 3TREA 2AKWB 1S40A 4ALPA 1NE3A 2K14A 2JA7G 3DLLA 2E2HH 2Y0SE 2VUMH 2XGTA 4A76A 2WAQG 3K8AA 2N49A 1VQ5A 2CCZA 1QVGA 4GKKQ 1HZAA 1E3PA 3J7ZC 1HNXL 1J5EQ 3L7ZC 2ATWA 1K3RA 1VQ4A 4BY1G 1VQMA 4JBMA 1FGUA 5JEAG 4JI0L 3CCJA 4AQYQ 4A3IH 1NJIC 2HT1A 1I5FA 2ALYB 4B3SQ 4JI6Q 1AE2A 2KBNA 2OQKA 2ZM6L 1VQKA 2CQOA 4JCVE 4J15A 5IP9G 4X62L 3M3YH 2UXBL 1WCMG 2ZTEA 4A3FH 2Z6KC 4LFAL 1PHJA 5IYDH 4DV4L 1XMOQ 4A3KH 1G291 4X6AH 2MO1A 3NENA 4X65Q 1VQ6A 2QGQA 1OXUA 2NVYH 3EN2A 3UDFA 1M1KC 2JA8H 2AMCB 2B3GA 3TEHB 4A3MH 4PMWA 2UUCL 1NMFA 4LW1A 1VQEA 4BY7H 1TWCH 4Y7NH 3HOXH 1GKHA 2NN6I 2Q2IA 3ULLA 4JI4Q 3PCOB 2JE6I 4JBWA 3AEVA 2UUAL 1VS0A 4H02A 4JBJA 4QIWE 3CXCA 3TS0A 3A5ZB 2IY5B 4JYAQ 2ZJPA 1I3QH 3H0GH 4DR4L 4DV1Q 1CSPA 1VQLA 3NEMA 3I55A 1XNRL 1IBLL 4YHHQ 1TWFH 4XIGS 5C0XG 5LMUQ 2I5LX 2K75A 4HIOA 3KYHC 3CCSA 3I4MG 4DR7L 4NXNQ 4UP7A 4AYBE 4DUZQ 4IO9A 1QZHA 4PG3A 4WJ3M 3GTQH 4B3TL 4HJ9A 4KLKA 2VW9A 5K36G 1Y1WH 1X9NA 4NXML 4GN5A 3STBC 4C3JH 4B3RQ 4IJLA 2BA1A 2KCMA 4HJAA 1PA6A 4JI1Q 2I5HA 2Y0SG 1K9MC 1JT8A 2HQLA 4IFDG 1MJEA 2A8VA 1A63A 4GNXC 4DV3Q 1IBML 3F2DA 3EIVA 4JI5Q 4OO1G 2HIVA 2R92H 4DR6L 1BKBA 2D0PA 1O7IA 3CAMA 4DKAC 4DV6Q 2IT1A 3HOZG 5AJ3Q 4DR1L 4DR5L 2MFIA 4HIDA 3RLOA 1I94L 2UUBQ 2OWOA 4C3IH 4A3CH 2UXDQ 3T1HL 3M9BA 1D7QA 1HZ9A 1YHAA 1KHIA 4C3HH 4A3IG 5C3EH 4IPGA 3RN5A 1YJNA 1SFOH 3PO2H 4LUZA 5IP7H 1AE3A 2MQHA 3K0XA 3CC2A 1CKOA 4P72A 3JAMc 4A3FG 3S1QH 4GLAC 2KENA 1M90C 3M7NA 1VQIA 4LFCL 4LF4Q 4A3KG 2JQOA 2OTLA 3GTLH 4DR3L 4DV0L 1MIUA 2NZOA 4GN3B 1QZGA 1I6HH 5M3FH 2GVBA 1QVCA 3PV0A 2CWPA 4X66Q 2QEXA 2Q2HA 5GQOA 4RG1A 1EIYB 2VY3A 3EBEA 3K7UC 2JA8G 3HOYH 4BY7G 4BXXH 3HOXG 1VQ9A 4A3LH 4BA2I 1U0LA 3K7AH 2EXDA 4A3DG 3IRBA 1KRSA 2BH8A 1SROA 2NVQH 3H3VH 4GN4B 1X6OA 4LF8L 1TWGH 2K5VA 1RIPA 1EOVA 1TWAH 1P8LA 1Z9FA 2AWOA 2KHJA 5C44H 1EFWA 3H0GG 1N32L 4DR2L 4JI7L 4B3MQ 2WFWA 5BR8L 1N34L 4LF6Q 4UY8C 2K50A 3S1MH 5HGQA 4R1JA 3HKZE 4JOIA 2V1CC 3ZJYC 5HY6A 4AYBG 1N9WA 2JEAI 4GOPA 3FKIH 1HR0L 4P75A 5IWAQ 1UE1A 3A74A 2K5HA 2EQSA 1PV4A 3UDGA 5ELNA 3ER0A 4JI3Q 1OTCA 3CC4A 4LF9L 1JMCA 2OTJA 3CMAA 4X64Q 1UEBA 1Y1WG 4NPSA 1XMQQ 3J80i 4DV5Q 1XPUA 4A3GH 3AFPA 1X3GA 1QUQB 1SRUA 4OX9L 4UPAA 3VDYA 4POFA 1Y1VH 2F3IA 3HKSA 2ID0A 3HOVG 2R92G
chains in the Genus database with same CATH superfamily
2UU9L 3GTOH 4TRDA 4HR7B 3MEHA 4TKOB 1CZGA 1QUQA 2JSOA 3F8TA 2IX1A 1JWUD 3HOZH 3GTGB 4JK1C 4RKLA 3DMUA 3F2BA 2MJ8A 1IW7D 1EQQA 2R6GA 3HOUB 3J7AV 3KLWA 3G6JB 5C3WA 3F2UA 1K8AC 1E7ZA 5LMNL 5M3FG 2Z6BA 2MO0A 3MEFA 5FOBB 3HRZC 1R4QB 1ET6A 1VQJA 2EE1A 1LTTD 2UXCL 2L5TA 1SE2A 2B63H 2K5WA 2CQAA 1II3A 5D3DA 1BCPB 2EDGA 4JI8L 4C2MH 3Q24A 1SYGA 2I07B 3K57A 1JOOA 3QWNA 4F8MA 4I7ZC 3PUXA 1PFNA 2FINB 2EJMA 1PTOF 5C3XA 1O7LA 3GO5A 3PQIA 5M5WB 4QQBX 4YCUA 1HNZQ 3K81C 1V1QA 3CMEA 2VQEQ 1S5BD 2MNAA 3TSSA 1KDCA 3MFYA 1HNWQ 4KKUA 1Q86C 1EYAA 2CKZB 1HTPA 2N55A 4A3GG 4KHPQ 2Z4IA 2E5LQ 5JJKA 1NY4A 3PMFA 4DV2Q 2A69D 1D7QA 3CCEA 2D5DA 4DAYB 4LF5Q 4P73A 3P75A 1KRTA 1JOQA 2XN9C 1GM5A 2NYZD 1B9MA 2RDHA 5M3MH 4HIMA 2JA6B 2P5ZX 4HAEA 4BBRH 3KBGA 4XT3B 3KF6A 4TQUS 4XTCS 3FRPB 2CFMA 3LWEA 5EAYA 1SSOA 1VQ7A 2R93B 3Q8DA 1K73C 1IL8A 1EWIA 2F0GA 1LACA 1G6PA 1L1OA 3MWYW 2GN5A 1M8AA 1JCKB 2Z8LA 1ICWA 2VQFQ 3I72A 3M7GA 4WJ4A 1CQVA 2AQ2B 2F0MA 2HDLA 5F2DA 1CT1D 1PTOB 1K8OA 1X3PA 5FLMH 4ULLA 1SXTA 1Q46A 1V8QA 3BS1A 2Y0SB 4IPDA 2K6AA 4HJ8A 4PV1C 1EL0A 3I4NH 5C4JH 1LTGD 3CCRA 3GTPH 2H1EA 1HNXQ 4KMUC 2JXMB 5E7NA 3CP0A 5CBEE 1W3SA 1RTOA 4PZ7A 4YWKA 3I70A 2ZM6Q 3M3YB 2XNAC 2V4DA 5GAEC 3E5SA 4R4CA 4KK7A 5IGGA 3A8KE 1STNA 2LS01 4DK1A 4BBSG 3PSIA 2R7ZB 1PFSA 2L55A 3E0EA 4N8X1 2I5MX 1EUJA 2YU9H 2DY7A 1ET9A 4ZQ3A 1AH9A 2AHOB 1C48A 2XWJB 2HCCA 4KV6A 1PRTC 1EZ6A 2JA5B 1IKMA 5LMNW 2BE5D 2NUCA 4B9WA 2VZAA 1S5ED 2CCZA 1MJCA 3NELA 4RKBA 2O5JC 1LO5D 1LUZA 1HZCA 2EZVA 2QILA 5FKAC 1G91A 4A3BB 4CKCA 4RGTA 2RDGA 2G5DA 1XTDA 3J7AF 3FDTA 2N8NA 1JJ2A 2L4NA 1VDZA 1A15A 5FO7B 1TS2A 1FL0A 1WFQA 5IGEA 4E6IA 1F9QA 1HQRD 4X64L 1UE5A 2NVXH 4DR6Q 1K28A 1V1PA 1A2TA 1Q81C 2F0JA 2IHEA 5EPKA 2WAQB 3KBXA 4K2KA 1VCIA 3S14B 1I94Q 2C35B 2LFNA 2X69A 4P71A 4JV5L 1EOTA 4JBKA 3N6RA 3L0OA 4IQZA 5IYCG 1IW7C 2F0WA 1GO3E 1MKHA 1WCMB 1H9MA 5FK9C 2AWNA 1N36L 3MXUA 2NZ1D 3BVGA 1EY0A 4FF2A 4KN7C 3WDNA 1XYIA 3H91A 2ICEC 2ZJQA 5C4HA 3KDFB 4DNIA 1B3AA 2E2JH 1KDBA 4LF8Q 2YTYA 1VQ8A 2F52A 3U4ZA 2PW5A 4JI7Q 2HD3A 4J1MA 2YTVA 2B29A 3R2IA 3S1MB 1SNOA 2VL6A 2X6LA 1EY6A 4QGUA 1I4QA 3GDEA 1DXMA 4RAUC 5I6YA 4R4QA 2A1AA 3A8IE 4PQXA 4LF7L 3W1BA 2Q2TA 1BF4A 4LUVA 3WOEA 1EEFD 2VXWA 2WAQE 1NAPA 3Q0AA 3NTKA 1J8IA 1X56A 4BY1H 5EKKA 4OX9Q 2PI2A 2Z0SA 2R7DA 3IFDA 4K14A 5IYDG 5HGTA 2A69C 3GQBA 5IP9H 3S1RB 3KK7A 1A3TA 4DV7Q 4ZYSA 1RD9D 1FNUA 1F9SA 4K2LA 3M4OB 2DNEA 2FJ2A 2HHHQ 1W6KA 3VA5A 3E0JA 1BO0A 4R8IA 3S1NB 1ESFA 1DOKA 1L1OC 1B8AA 2NVTH 3HOUG 4CDEC 1QJOA 3NTIA 3S24A 4R4IA 1KABA 5CGKA 1UE7A 4IUVA 4M8AA 3O13A 4YY3Q 3J81j 1S72A 1N33Q 1Y14B 3RN2A 5EKLA 3SGIA 2VB3X 3TZDA 4BY7B 5C0XH 1DYQA 4Y7NB 3K80C 4QIWB 1GVPA 1SNQA 4A3DB 2A19A 4A3JG 2K52A 4IJHA 4IPHA 3I4LA 4C3JG 1KTKA 4GOPC 3M85A 4EQNA 1RKNA 1KL9A 2PW7A 1IYUA 5J22A 1S40A 2JA7G 1AZQA 3QJYA 3A7LA 1JC7A 4OHJA 1I4HA 4A76A 1HFGA 4GKKQ 4RGNA 1ML0D 3VR3A 2ATWA 5AFWA 2F0EA 1SNMA 3VYUA 1E2WA 1FGUA 3GTJB 4JI0L 1A2UA 1SMYC 2HT1A 1I5FA 2OQKA 1I4GA 2EY1A 2TSSA 4LFAL 2HDMA 1PHJA 5FLXE 2LKVA 3ONAB 4IUQA 2WB1B 2NVYH 3BVZA 4PMWA 2UUCL 1PZKD 1EY9A 1NMFA 3HOXH 3S1QB 3ULLA 4JI4Q 4JBJA 4QIWE 3TS0A 3FPUB 2BE5C 2IY5B 4JYAQ 1I6HB 5M3FB 3JAME 4DV1Q 1VQLA 1MSHA 3I55A 1SNCA 4YHHQ 1TWFH 5LL6X 5LMUQ 1IBLL 2VB2X 4DR7L 5EPLA 3I4MG 1D6EC 2WKCA 4NXNQ 4DUZQ 3GTQH 3RD4A 3VR6A 4KLKA 4IUTA 4FXKC 4ZUJA 3QIAA 4GN5A 4B3RQ 2I5HA 1K8MA 2Y0SG 1K9MC 1JT8A 2CW0D 4M1UB 2A8VA 4RFBA 4DV3Q 1D1IA 5CV7A 4JI5Q 4OO1G 2R92H 1BKBA 5DM73 1O7IA 4DKAC 2MPMA 3HOZG 5AJ3Q 3IFTA 4DR1L 1LTBD 2MFIA 2F0NA 3RLOA 2JYOA 2Z4HA 3VR4A 4DAYA 2UXDQ 3T1HL 2OF1A 4A3GB 3RN5A 1BR9A 4P72A 2AUJD 1VQIA 4LFCL 3NQTA 2JQOA 4DR3L 1MIUA 4GZYC 4X66Q 2JA8G 4QUFA 3H09A 2KECA 3SK5A 4BXXH 4IUPA 2L9HA 1PTOD 4F87A 4N9TA 1KRSA 2HUGA 1EY5A 1TWGH 1RIPA 1TWAH 1P8LA 5D14A 1HA5A 3H0GG 2B2VA 4UHVA 4DR2L 4B3MQ 4LF6Q 4HMIA 5EGTA 1NUCA 5K5PA 5IGCA 4LJZC 3FKIH 4HCSA 4P75A 4K8IA 3A74A 3NSWA 1Y8OB 2EQSA 1PV4A 2D2CC 4FVMA 2K7VA 4LF9L 4DGZA 3CMAA 1HUMA 2PCFB 1PMRA 3IL8A 4KTAA 3AFPA 1X3GA 1PZID 2K5QA 4PMCA 4RCOA 4UPAA 1O7YA 1Y1VH 1SE3A 4AIMA 2ES2A 1EWCA 1I50B 4A3CG 5M5XB 2IJ0A 4C3IG 3FEWX 2PNRC 5C3EG 1T9HA 5A2QE 5IP7G 2TMPA 5JVG3 2DNCA 4DUYQ 4L6TB 4H13C 3OYYA 1SE8A 1SYDA 2C9OA 1R4PB 1M4VA 4BBSB 5DLQE 2H4OA 2F3VA 3L9AX 1E22A 4IZ8A 4OXPA 4OWXB 2F0HA 4IOCA 1JJCB 4HCEA 1SBBB 4CGYB 2MP1A 3S2DB 2A74C 2B2YA 5FLMG 2PNHA 1F9RA 5IT9E 1B4OA 3RZDB 1E2VA 2SOBA 2JN4A 1K83H 1AP0A 2B2UA 4YWMA 1Q8KA 4I7AA 2XSCA 4R4OA 2K03A 1QNKA 5GAGC 3CC7A 3U58A 1OXVA 2K5NA 4FF1A 1CKNA 3DEOA 3QO2A 1V9PA 1F2ZA 3GTGH 5BN3A 4XT1B 1VQNA 4LF4Q 3BZCA 4ME5A 4Q5VA 1UE6A 3FHWA 2KQ3A 2F0KA 1EU3A 3HOVH 2IHFA 5C0XI 5IGBA 4F88A 1CA6A 3RLNA 1EY4A 1G6ZA 1NCVA 1TQOA 2IW3A 2F0UA 4Q0FA 3KDFA 1FJGL 2N3SA 4LUOA 5H1SE 1S3OA 2RHQB 1OO9B 3I3CA 1JORA 3OWFA 1D1KA 4PZ6A 3U9OA 4QY7A 4DF7A 3E3XA 3GTKB 2KHSA 5FJ8G 5KNCA 2AQ3B 3C2PA 5KGUA 3QG1A 1F2LA 3OIPA 2NTTA 3MXNB 4QL5A 1WTXA 4BWGB 2WKDA 2ZXPA 3SEBA 2DUDA 1A8VA 2YTXA 1BCPF 3CHBD 1EEID 1C8CA 1SAPA 4JI1L 2CW0C 3QB3A 3C3LA 1DJRD 1T5EA 4K5XA 3ND8A 4DK3C 5C4ZA 1BQQT 2JA6H 1C9OA 3T4AC 2UXBQ 1ONLA 2F0OA 2DJGC 1HRJA 4Z9CB 2QA4A 4DV4Q 1PXUA 4Y52H 4IPCA 4J8QA 1NR2A 2RKSA 3RMHA 1YJWA 1EYGA 3SDZA 4A93H 5EPJA 5FLXL 2R93H 3RZOH 2B2WA 3L2PA 2WB1G 3BJUA 2B2VC 4ZAIA 1PYBA 2OEOA 3VYSA 1PTOC 4LNQA 3KJPA 2KUMA 5D65A 1PTOH 1LTLA 1Z6HA 5KYLA 1XNRQ 5IYBG 3LWUA 1X65A 3U50C 1XJVA 1YJ9A 3JAML 1DZ1A 1EWHA 1TWHB 1Q7YC 2RVLA 4G7ZC 2X6GA 3DUZA 2CWAA 3PO3H 1EQRA 1KAAA 2NN6G 4X3TA 4A3JB 5KIXA 3W1GA 1BBUA 4C3JB 4LFBQ 1F2MA 3KF8B 1RODA 3X3MA 1R9TH 4I65A 4JI3L 1CK1A 4BA1I 1CTMA 3K5LA 1XMQL 4DV5L 2JA7B 3T53B 2ASBA 5EKIA 3EJIA 4DR5Q 3AQQA 3W5OA 1WTWA 1HJPA 1LT6D 4O2DA 2R3ZA 1QNUA 3U4VA 2R7ZH 4CKBA 4GNXA 4JVZA 2YYZA 4RMFA 5JJIA 1K0RA 1DM0B 1WI5A 2E76C 1UWVA 2K04A 2JA5H 3HOYB 1PH4A 2B2YC 3W2DA 4MZ9A 4JPBW 2KVMA 4HJ5A 3GP7A 4WJWA 3ULPA 4OIKA 4X3KA 2ZT9C 2NVQB 5KRUA 1SR3A 4A3BH 5I2XA 1N32Q 1X3EA 2B2UC 3HGBA 5BN4A 4EVOA 5BR8Q 2M9VA 1X55A 1PH6A 5FLXc 3DWQA 1Q1BA 1VQFA 2QKIC 2OCEA 2KCNA 1HR0Q 1C7YA 4LWCA 3DWPA 4O1NA 4ID6A 1EQVA 1VF7A 3OIQA 3I4MB 2ZTDA 1F2YA 3E9IA 2A68D 3FPPA 1OXSC 4JG2A 3S14H 3UI2A 1I6VC 2JEBI 5M5YB 3S17H 1HNZL 4HN7A 2LY7A 5C6AA 1WVLA 1HPCA 1KDAA 1CHPD 1IZ6A 1FYCA 2VQEL 2LXJA 3CPFA 4R4TA 1VQBA 4ZUIA 2Q2UA 3OMGA 1HNWL 1J9OA 4V0BA 2E2HB 4KHPL 4ZRZA 1QWYA 1IBKQ 3GTOB 1WCMH 2E5LL 2VS1A 3DEPA 4DV2L 5IGFA 3HS0C 1EY7A 3HOZB 4MN3A 4LF5L 1SYCA 3Q23A 2F4VQ 1NSNS 3BZDB 5A2QL 1JICA 1SMYD 3SXHA 1HFNA 4U68A 2EY2A 3CRKC 1XWEA 5EBDA 3MVVA 4DPGA 3D3RA 1IL2A 4A3EG 5C4XG 1ESRA 2PYKA 1C0AA 3I4OA 1ASYA 5CMDA 3BYTB 2JA8B 1T5XD 4IUNA 1PFBA 1KLGD 3BVMA 2K01A 4C2MB 1STGA 3BG3A 5I9OA 4JI2Q 4R9WA 3RUZA 2OT2A 2F1MA 1PLFA 3RLFA 2FMMA 2VQFL 3J80E 3H0GB 5CR3A 4N9PA 2KCCA 5K36H 5IT9L 4GKJQ 2WACA 3IKJA 3ZYYX 1G2SA 3KJOA 3A56A 2AKWB 1NE3A 2K14A 4IN3A 2Y0SE 2VUMH 2XGTA 3K8AA 1ENFA 1O78A 4XQQA 1Y69U 1VQ5A 1HZAA 3J7ZC 1HNXL 2ENBA 1J5EQ 1S5DD 1K3RA 1VQ4A 4G7HC 3TP6A 2XRSD 4L63B 4AQYQ 1NJIC 1GUNA 2B2WC 2ALYB 4B3SQ 4JI6Q 2ZM6L 3S1NH 2CQOA 3C1FA 4CDDC 1XMOQ 3A8JE 2MO1A 4DAVA 4X65Q 4KD4A 2QGQA 4C3IB 1OXUA 3NQIA 4K5WA 4X3SA 4BBRB 1AFPA 3AB9A 4A3MH 5C3EB 3S9WA 1STAA 4BY7H 4Y7NH 3URYA 2Q2IA 1EY8A 5JPMC 2DJFC 4JBWA 2KOLA 1VS0A 4H02A 1TY2A 3A5ZB 1SJHD 4XYOA 3OSOA 2ZJPA 1GUTA 1NR4A 4K8JA 1YNJD 4DXFA 5I2YA 2K75A 2F0VA 3NK9A 1QZHA 2BDOA 2ICIA 1GHKA 1NNXA 4HJ9A 1LABA 2VW9A 1I4XA 1Q90A 1U4RA 2BA1A 1FGBD 2KCMA 4U673 1LTAD 1TKWB 4RHSA 1A63A 1S5CD 4GNXC 3F2DA 3J81L 3EIVA 2CH4W 4DR6L 3CAMA 2K5DA 2KEEA 4DV6Q 4HIDA 1I94L 2UUBQ 1HZ9A 1YHAA 1KHIA 4A3IG 4IPGA 3QR8A 1TVXA 5JEAH 4A3FG 3S1QH 4NMZA 4GLAC 2KENA 5KNDA 3T16A 4A3KG 2OTLA 1H9SB 1I6HH 5M3FH 1QVCA 3PV0A 4NP5A 2Q2HA 5GQOA 4RG1A 2EYHA 3EBEA 3K7UC 3SE0A 3TMEA 3HEJA 1H9KA 3K59A 4BA2I 1U0LA 1EQTA 2EXDA 2BH8A 1PRTB 4GN4B 4LF8L 2PO4A 2KHJA 2XRQD 4CDCC 4JI7L 2EJFC 2K50A 1BXTA 3MXNA 4H0LC 4JOIA 2V1CC 2B2TA 5HY6A 3FMCA 1YNND 3Q22A 1CFMA 5IWAQ 2A68C 1D5ZC 4FYDA 4S3SA 5KEEA 2OTJA 1Y1WG 1UEBA 1TS4A 2GA4B 4A3GH 1QUQB 2HCIA 4OX9L 3VDYA 3P1HA 4POFA 3UDIA 5CBAE 2ID0A 3HOVG 4IFDH 2EOTA 3A0JA 3K6OA 3C46A 3TDQA 4DV7L 2QCPX 1PH5A 1FVIA 4IOAA 4C3HG 1EYCA 2BDNA 5JJLA 3T1YL 3PO2G 2HHHL 3OW2A 4L5TA 4O42A 1Q82C 3SK4A 3J81c 4POGA 2K28A 1KQSA 3HOYG 1H95A 1YNXA 2HQEA 3GTMH 3TP7A 4YY3L 1XTCD 1WTOA 3A55A 1QCBD 1WTHA 1HQMC 1N33L 3HOWH 1CHQD 4A3LG 2WP8J 3JC66 1BCPD 1U4MA 5C44G 5CC4A 1MSGA 1IXRA 1UAPA 3JAMi 5CV8A 1LLRD 2F0IA 3KF8A 4ABNA 1WOCA 1OXTA 1XNQQ 4KJOA 1AEXA 5I9PA 1I50H 4DK0A 2XWBB 4FF3A 3S16B 4GKKL 2RDFA 3HP3A 5M5XH 1O80A 1CKMA 1ILQA 1YITA 1EIGA 4DFAA 4K0KQ 2E2IH 1PH9A 4A93G 2RBMA 1EIFA 3I91A 3OTOQ 2PZWA 4NB3A 4BBSH 1YEZA 2OXPA 4FO2A 5J39A 4YCVA 1PH2A 2WB1E 3S2DH 1L1OB 1L0YB 5ELCA 1YBYA 4EX5A 3BU2A 2Q8TA 4JI4L 2G9HD 3K5MA 1SNDA 3CD6A 4J6HA 1SEBD 4JYAL 1YNJC 3PO3G 4DV1L 3WOFA 3PIO3 1XPRA 2JJQA 3G71A 4QCLA 2B63G 3CQZB 4YHHL 1L0WA 5LMUL 1E0BA 3G6EA 1VMCA 4NXNL 4DUZL 1JB7A 2KJXA 3VYTA 3J80L 4GOPB 2D62A 5J3BA 3IAYA 4ZK9B 5T1GA 4B3RL 2EY6A 1HXYD 1A62A 4CJ1B 1E1OA 3PIPA 4DV3L 3B6YA 4OL7A 2E74C 4JI5L 1PH1A 4ZKCB 1STYA 3GD7A 4RGMA 3PUZA 4RWSC 5AJ3L 5IGDA 4X62Q 2UXDL 2JP1A 2QW7A 2EJGC 5IYCH 5TSSA 5EBCA 3PUWA 1RL2A 3F2CA 5M3MG 2L11A 3K5OA 3T13A 4LAAA 1A3VA 3MFGA 3TZUA 4X66L 4BBRG 1K3BC 2EIFA 2EYOA 3NHHA 2E75C 4OGQC 5GADC 2B39A 5DNFA 2UUAQ 2IL8A 4JOIC 2B2TC 2EPBA 3R2TA 3D6CA 4PMBA 1LT5D 4PZ8A 4DR4Q 1PYSB 1MHWC 3S2HB 1I4RA 1DD2A 4A3EB 4GLVB 5GAHC 3DM3A 5C4XB 1TWFB 2F0QA 3NBHB 3LNNA 4OWTB 4L8JA 4CHTB 3I90A 1WJJA 4B3ML 1B44D 4LF6L 1JB3A 1ZYRD 1KNEA 4N8FA 4V190 1YNNC 3OHXC 3H15A 3S15B 4B3TQ 2ZTCA 4CJ2C 5ELFA 2ZJRA 5BN5A 4OEMB 4NXMQ 3F1ZA 1V1PB 1GXDC 2EYMA 3OPOA 1LTSD 2D0OA 1DCZA 4YWLA 4HTHA 2RA4A 3STBD 3AYHB 1IBMQ 4OIJA 3I4NG 1MI2A 3CF5A 1OXXK 1LT3D 5IE8A 2R92B 3G48A 4KY7A 5ISRA 5ELDA 2RSNA 2DGYA 1QE6A 1DONA 3E9HA 3G4SA 5I4DA 3CKIB 1D8LA 1VQCA 3J80c 2I0QA 2R7FA 1FJGQ 2HIXA 3CCLA 4K6LA 4RA8A 4MNOA 1L2FA 4OELB 1S5FD 1YI2A 1LM0A 4DV0Q 5LHY1 4DUYL 3HOUH 5ELBA 3P20A 1K8GA 1TWHH 1X3QA 2E2DC 1GOZA 1BCPC 1TWAB 4A3JH 4ME3A 1N34Q 1YHQA 1KAWA 3A5UA 1STBA 4B9XA 1WTPA 4TVAB 3I56A 3V96A 1B7YB 2OQ0A 3GV3A 2VUMG 2JA7H 2XTIA 2VNUD 2L15A 4IFDI 1Y8NB 3CCMA 4EGVA 4BS9A 1X3FA 2PMZB 3TN2A 5M5WH 1CUKA 1G51A 2KHIA 1UNSA 5JPNC 1KLUD 4KI0A 2C5CA 3TP5A 4C1NK 1BNZA 3EA6A 3D6WA 2QDLA 2UU9Q 2O4XA 3J81i 4LF4L 2J7ZA 4DAMA 4A3MG 1V43A 3PUYA 4KD3A 1F9PA 3VA7A 4A3IB 1H9SA 4X3UA 3SR1A 3C1EA 3RR5A 1STEA 2F0PA 2JA9A 3U9SA 4JC0A 4A3FB 2LSSA 1VQGA 5LMNQ 4A3KB 1BBWA 3I7FA 1TS3A 3I8ZA 1GD7A 2UXCQ 3UE1A 1DGSA 1EYDA 3HG9A 3SK8A 4XQJA 1TWCB 1B3QA 3KLRA 1ZKOA 2PQAB 3NE5B 4JI8Q 2FXQA 3I4MH 2LXKA 3EVQA 1X54A 3PGZA 2PI2E 5M5YH 4AH6A 1I3QB 2F3WA 2PMZE 3TQYA 3M4PA 2D9UA 4IUUA 4RHRA 3CW2C 4ALPA 3DLLA 2E2HH 3DHQA 1ENCA 2KA7A 1HUNA 2N49A 4OO1H 1LTRD 2BOSA 4DAPA 1E3PA 1W6JA 1Z7TA 4BY1G 1Y1WB 5G3LF 4XYQA 4JBMA 5JEAG 3CCJA 1JOKA 2KBNA 4K5VA 3M3YH 2UXBL 5IP9G 1TR5A 4QMGA 3HOVB 2FFKB 4DV4L 5EQ0A 1G291 2F0DA 1VQ6A 2DN8A 3ND9A 1F77A 3UDFA 1M1KC 2JA8H 3DXJC 2B3GA 4C3HB 1SFOB 3PO2B 4FP5D 4LW1A 4DN4M 4HSVA 1GKHA 5C5MA 1SE4A 1BDOA 4EQOA 3PIP3 3K0YA 3PCOB 2K05A 1RCVD 2Z9HA 3GTLB 2MHVA 3TP8A 2I46A 3H0GH 1QG7A 5CYUA 4LMQD 1CI3M 1XNRL 1S4ZA 4DA2A 1B1ZA 4XIGS 5C0XG 1ZYRC 4DNRB 4HIOA 2EXZA 3KYHC 5EJWA 3K7AB 1UUPA 5M9OA 1X32A 4IO9A 4PG3A 2K33A 5C44B 2N88A 5JOBA 2AQ1B 1JR0D 1Y8PB 1X9NA 3STBC 4LFBL 4HJAA 4LK1C 5JJZA 1D5XC 2MGSA 3NUCA 1AW7A 4IFDG 3KLSX 4RCNA 3R3OA 2D0PA 2IT1A 4DR5L 4A3CH 2OWOA 4C3IH 4IALA 4G7OC 2CH4A 2B8GA 1PYWD 5C3EH 1YJNA 3D4RA 4FXGC 1GJXA 3N52A 4LUZA 2EYFA 1AE3A 5IP7H 2MQHA 3VR2A 3CC2A 1CKOA 1XX8A 3JAMc 4ZKBB 4A93B 2PQEA 1M90C 3RZOB 2WIIB 3MA2B 3J7YW 2NZOA 1QZGA 4B08A 2GVBA 3HOWG 2QEXA 1EIYB 2VY3A 3H94A 3HZXA 3X3NA 2SDFA 2O5IC 3H3VC 2F0SA 3HOXG 1VQ9A 3IRBA 1SROA 3H3VH 2F0FA 1X6OA 2AWOA 2K5VA 1N32L 1EFWA 1O7ZA 5BR8L 4UY8C 1B9NA 3S1MH 5HGQA 3PO3B 2EY5A 1HTLD 1L0XB 2Q8IB 4AYBG 1N9WA 2JEAI 2B63B 4GOPA 1HR0L 1GUWA 3SK6A 5DM63 2K5HA 1LT4D 1R9TB 1CQFA 4KHVA 5ELNA 1OTCA 1VF5C 1HCZA 1JMCA 4X64Q 4NPSA 3J80i 1UEAB 3ITPA 2A6ED 1SRUA 2L12A 4QB4A 5JVH3 1TT2A 2F3IA 3HKSA 4KY6A 2R92G 1IBKL 4JV5Q 3S1RH 1FNVA 4ODGA 5IODA 1BVSA 1Q12A 3M4OH 2L1BA 4FF4A 1PZJD 1N36Q 2F4VL 3K58A 4EQPA 3PIOA 1KIXA 1NBWA 5JAVA 4HJ7A 4UAIA 5M3MB 4RGOS 3TS2A 4KKTA 2IWHA 4O0AA 3KUPA 4BXXG 3NBHA 3CCQA 5FJ8H 2RHSB 4FDBA 1PVOA 1TU2B 4JI2L 4IURA 1SJED 1SMXA 4A3DH 1VQPA 1VQAA 3HKZG 3E6ZX 3EROA 4LF7Q 4GS3A 1WTQA 1VQDA 1YZ6A 1CKNB 4GKJL 3CPWA 1QILA 1PRTF 3FKIG 2NZHA 1PH7A 1PH3A 2JK8A 3MHBA 4WRDA 4KY5A 3S17B 4MTNA 3FP9A 1JE4A 1VQOA 4K6DA 1JWMD 4WORA 1NTGA 1J5EL 4APVA 3OOCA 4HIKA 3I4NB 1CSQA 3GTJH 5C4JB 4HSPA 1GHJA 1TIID 1Y1VG 1HZBA 4AQYL 3GTPB 4B3SL 4JI6L 5JEAJ 1KXLA 1W2BA 3H6MA 3W3AA 3V2TA 1E2ZA 1XMOL 3I2ZA 2SEBD 4X65L 2QEJC 3I73A 1WD1A 1DOLA 3KLSA 2M2LA 5IT9c 2FMCA 2YV5A 4HMJA 5KNBA 1GUSA 1B70B 2NB0A 2A5HA 1SLJA 5IYBH 4P74A 1Q1EA 5CV5A 3J7A5 2YU9B 5DAUA 1A0IA 3NTHA 4OO1I 1DOMA 4G4KA 4RH6A 1RF2D 1SYEA 1ZEQX 3VR5A 2NN6H 5C0XJ 2EVBA 4TSSA 3S16H 1RDPD 1C4QA 1E24A 3T51B 2VUMB 1HR0W 3BDLA 3CU7A 1SDFA 5ELOA 1V1OA 3ULJA 4L5RC 2BA0A 3T1YQ 4IFDJ 3ICEA 4GLXA 3D31A 3QOLA 5LL6S 4JI0Q 4DV6L 2RF4A 1PFMA 2UUBL 4L5SA 4KKSA 1AN8A 2NVXB 2ZXOA 3AFQA 4LFAQ 1FR3A 1ICFB 2M00A 1ASZA 2BCOA 4CDFC 1VQHA 1EFID 3UDXA 2GVAA 4A3MB 2Z1CA 3CCUA 2UUCQ 2LMCB 3M4YA 2A6HD 4CBVA 3MAQA 5IOCA 2Z6KA 2AUKA 3CQZH 1P16A 1SYBA 3KFUA 3LGJA 1NMGA 1CA5A 3UE0A 3OMCA 2PQAA 5IY0A 3M4QA 5C5LA 1IBLQ 1AZPA 4MIUA 1PDQA 1HH2P 4QJFA 4R8NA 3SVMA 3BZKA 1E1TA 4DR7Q 1SN8A 2R61A 2E8GA 2E2JB 1LTID 3ERQA 3KOJA 2RQXA 4NW2A 1I4PA 5IWAL 3EFXD 3MZ5A 1TS5A 4C56C 1FD7D 4ZLTF 2SNMA 3RNUA 4G57A 2B8FA 4L5QA 5E3FA 5FO8B 1U9RA 1KC8C 2K1BA 2A6EC 3MXPA 2RCNA 2FHTA 1GUOA 1FNWA 4KHZA 4GNXB 4QUCA 4DR1Q 3NXWA 1JE5A 1J6QA 2IPKD 3OW7A 4OONA 3T1HQ 1IYVA 2JA6G 4BY1B 1IYJB 3TBIB 1B53A 1LV9A 3L3OC 2J4XA 4A4IA 3HFZB 5T1IA 3H3VI 4EQ5A 2H5XA 4LFCQ 1BBXC 2IX0A 4DR3Q 4DK6C 2R93G 1EU4A 3R93A 3S2HH 1RJTA 4KJNA 4A3EH 5D3IB 5C4XH 4YCWA 3KF6B 3SHLA 1A6XA 1H9RA 1HHVA 5E1FA 2K32A 1GUGA 4H44C 3DWAA 2MUYA 1U5KA 2IX3A 1HA6A 3S15H 3ERSX 2NVTB 4DR2Q 4FXDA 1PH8A 1TY0A 1YIJA 3D0FA 1JQYD 5CORA 1MBYA 5IIFA 1WTRA 3V05A 2EYLA 4A75A 1IHZA 1Q8IA 2NWGA 5G3LD 4UP9A 3WWVA 3RZDH 1YHBA 4P2CB 1QVFA 2XIWA 1MGSA 2N78A 3GV6A 4LF9Q 1XNQL 2F0LA 1KD1C 1H9JA 4OWWB 1N8RC 4XDXA 2EYPA 3Q6SA 2A73B 3CCVA 1Z47A 1D5MC 1MD2D 1YVCA 4K0KL 2QDBA 3DM1A 3K5NA 1CZWA 3PUVA 3EQLC 1IKLA 3BYYB 2R7ZG 3QOJA 4UP8A 5J1ZA 5KYIA 2K4KA 3OTOL 3TRZA 5CV9A 2QF7A 3NP8A 1WD0A 2BH2A 1EIHA 5GROA 2JA5G 3GTMB 1WYDA 2NVYB 3HOWB 1XPOA 2PZUA 5L37A 2KCTA 1TXYA 1ZXTA 2PZTA 3CRLC 3HOXB 4A3BG 5E4WC 4ZCKA 3GTKH 1JJGA 3R8BA 1LYLA 3PF5A 5ELEA 5COYA 4F7XA 4QF4A 3TREA 3VYRA 1BUVT 4AYBB 1G8ZD 1G2TA 2ZXRA 1WTVA 3OWEB 2J0TD 2WAQG 3GTQB 4YIJA 1QVGA 3L7ZC 3BDCA 1VQMA 3NWTA 2RSOA 4JW0A 2E2IB 4A3IH 3G7LA 3PF4A 3A7AB 1AE2A 1VQKA 4JCVE 4J15A 4X62L 1SNPA 1QOHA 1WCMG 2ZTEA 4A3FH 2Z6KC 5IYDH 1QB5D 3NWSA 3D8GA 4A3KH 1U4PA 1KNAA 4X6AH 3NENA 1STHA 2F03A 2NBFA 3EN2A 2AMCB 2A6HC 3TEHB 5E4XA 4H7BA 2WINB 3BDOA 1VQEA 1ENAA 1RTNA 1TWCH 2NN6I 3NPPA 2JE6I 3AEVA 2UUAL 1RHPA 3CXCA 4MTKA 4DNTB 4DR4L 1I3QH 2F4IA 1CSPA 4WFN3 3NEMA 5FO9B 1K0SA 2I5LX 4KN4C 4CKEA 3CCSA 4UP7A 2CHBD 1SYFA 4AYBE 1D2BA 2XVSA 2L0CA 4WJ3M 1TWGB 4B3TL 1BOSA 5NUCA 5HURA 3T56B 3HKZB 5K36G 4NDXA 1Y1WH 4NXML 4C3JH 4IJLA 4PNYA 1PA6A 4JI1Q 4CJ0B 2HQLA 2G9DA 5DEHA 2KEDA 3FKIB 1MJEA 1IBML 3FVQA 2EYJA 5CV4A 3D4WA 2HIVA 2DY8A 4DXGA 4XQNA 1EZ8A 3LX0A 1CM9A 3M9BA 3P7JA 3D4DA 4C3HH 1SFOH 3PO2H 1VMPA 2PPBC 1Y1VB 3K0XA 3A54A 3M7NA 4FNFA 4NKLA 3GTLH 3NBIA 4DV0L 4GN3B 4DU9A 2CVRA 5CV6A 2CWPA 3HOYH 2RCFA 4C1NI 4BY7G 5I6WA 4A3LH 4HEDA 3K7AH 1PRTD 4A3DG 1B2TA 1A3UA 3AMUA 2NVQH 1Q3LA 1EOVA 1Z9FA 5C44H 1JWSD 2WFWA 4ILWA 1N34L 1U4LA 1XXGA 2F0TA 3J81E 4R1JA 3HKZE 2O2LD 3ZJYC 2Q8RE 1UE1A 4UDUC 5A35A 1B50A 3UDGA 3AU7A 3ER0A 4JI3Q 3CC4A 1ILPA 1XMQQ 4DV5Q 4MHEA 1K83B 1XPUA 2SNSA 3MXGA 2WV6D 3MTSA 4XXEA 2NTSA 3MC0B
chains in the Genus database with same CATH topology
4AIMA 2ES2A 2UU9L 1IBKL 4JV5Q 3S1RH 3A0JA 3GTOH 4DV7L 4A3CG 1QUQA 3F8TA 1FVIA 1PH5A 2IX1A 1BVSA 1Q12A 3M4OH 4IOAA 3HOZH 5JJLA 5C3EG 3T1YL 3PO2G 1T9HA 2HHHL 3F2BA 3OW2A 5IP7G 4L5TA 1N36Q 2F4VL 4DUYQ 1EQQA 2R6GA 1Q82C 3PIOA 3KLWA 3OYYA 3J81c 1SE8A 4POGA 1KIXA 1NBWA 4HJ7A 1KQSA 1K8AC 5DLQE 1E7ZA 5LMNL 5M3FG 1E22A 4OXPA 3HOYG 3TS2A 1H95A 1YNXA 3GTMH 2MO0A 3MEFA 4O0AA 4OWXB 4IOCA 4YY3L 1JJCB 4BXXG 1N33L 3HOWH 1VQJA 2UXCL 4A3LG 2B63H 2WP8J 3JC66 3CCQA 5FJ8H 2RHSB 4FDBA 1PVOA 4JI8L 4C2MH 5FLMG 4JI2L 2PNHA 5C44G 1SMXA 3PF4A 4A3DH 1VQPA 1VQAA 3HKZG 3PUXA 4LF7Q 1IXRA 4GS3A 1K83H 1VQDA 3JAMi 1YZ6A 1CKNB 4GKJL 3CPWA 3FKIG 4YWMA 1WOCA 1Q8KA 3GO5A 2NZHA 1OXTA 1PH7A 4R4OA 1PH3A 1XNQQ 2JK8A 5GAGC 3U58A 4YCUA 3CC7A 1HNZQ 3K81C 1V1QA 4MTNA 4QQBX 3FP9A 1I50H 1OXVA 2K5NA 3CMEA 2VQEQ 1VQOA 2MNAA 1CKNA 4GKKL 1NTGA 5M5XH 1J5EL 4APVA 1CKMA 1V9PA 1HNWQ 1YITA 1Q86C 3GTGH 4A3GG 2CKZB 4KHPQ 4HIKA 1VQNA 2E5LQ 1CSQA 3GTJH 4K0KQ 5JJKA 2E2IH 1NY4A 1Y1VG 4DV2Q 1HZBA 3BZCA 4AQYL 1PH9A 3CCEA 4B3SL 4JI6L 5JEAJ 4A93G 1W2BA 4DAYB 1KXLA 1UE6A 1EIFA 3FHWA 4LF5Q 4P73A 1KRTA 3OTOQ 4NB3A 1GM5A 3HOVH 4BBSH 2IHFA 1YEZA 5M3MH 4HIMA 1XMOL 3I2ZA 5C0XI 4X65L 4YCVA 1PH2A 3RLNA 4BBRH 2WB1E 5IT9c 3KF6A 3S2DH 4TQUS 2YV5A 1L1OB 4XTCS 2CFMA 1YBYA 3KDFA 3BU2A 5EAYA 4EX5A 1VQ7A 1FJGL 4JI4L 1B70B 2N3SA 3CD6A 3Q8DA 4LUOA 5H1SE 1S3OA 1K73C 1EWIA 1SLJA 2RHQB 5IYBH 4JYAL 4P74A 1Q1EA 3PO3G 4DV1L 3J7A5 4PZ6A 1L1OA 1XPRA 2JJQA 3G71A 1G6PA 4QY7A 2GN5A 2B63G 1A0IA 4YHHL 1L0WA 5FJ8G 5LMUL 4OO1I 2VQFQ 4WJ4A 5C0XJ 3G6EA 3MXNB 4NXNL 4DUZL 1JB7A 4QL5A 5FLMH 3S16H 1Q46A 4GOPB 2D62A 1E24A 4IPDA 5J3BA 2DUDA 1A8VA 2YTXA 4HJ8A 1HR0W 4B3RL 3I4NH 4JI1L 5C4JH 3CCRA 3GTPH 1A62A 1HNXQ 1E1OA 5ELOA 3PIPA 3ULJA 4DV3L 4L5RC 2BA0A 3B6YA 5E7NA 3T1YQ 4IFDJ 3CP0A 4JI5L 4GLXA 3D31A 1PH1A 3ICEA 4DK3C 1W3SA 4JI0Q 4PZ7A 3GD7A 2JA6H 4DV6L 1C9OA 3PUZA 4YWKA 5AJ3L 2RF4A 2ZM6Q 2UUBL 4L5SA 4X62Q 2UXBQ 2UXDL 3AFQA 4LFAQ 2QA4A 5GAEC 5IYCH 4DV4Q 4R4CA 4Y52H 4IPCA 3PUWA 1ASZA 1YJWA 2R93H 1RL2A 1VQHA 1EYGA 4A93H 3UDXA 3F2CA 2GVAA 5M3MG 3PSIA 4BBSG 3RZOH 3CCUA 1PFSA 2UUCQ 3E0EA 2I5MX 2WB1G 3BJUA 3L2PA 4X66L 1EUJA 4BBRG 2YU9H 2EIFA 1PYBA 2Z6KA 1AH9A 2AHOB 5GADC 2UUAQ 3CQZH 1P16A 4JOIC 4LNQA 3KFUA 3KJPA 3LGJA 1NMGA 4PZ8A 4DR4Q 3UE0A 1PYSB 5LMNW 2PQAA 2VZAA 1LTLA 4GLVB 5IY0A 5GAHC 3DM3A 3M4QA 1XNRQ 1IBLQ 3NBHB 5IYBG 4OWTB 1X65A 1HH2P 1MJCA 4QJFA 3NELA 3U50C 3BZKA 1E1TA 1WJJA 1YJ9A 1XJVA 1SN8A 4B3ML 4LF6L 1Q7YC 4DR7Q 1LUZA 2E8GA 1HZCA 2CWAA 3PO3H 1EQRA 3H15A 4B3TQ 2NN6G 2ZTCA 3KOJA 1XTDA 3W1GA 5IWAL 2ZJRA 2N8NA 4NXMQ 3F1ZA 1BBUA 1JJ2A 4LFBQ 3KF8B 1R9TH 2D0OA 4YWLA 1FL0A 3STBD 1WFQA 3AYHB 4JI3L 4BA1I 3RNUA 4L5QA 4X64L 1KC8C 1IBMQ 1XMQL 1UE5A 3CF5A 4DV5L 2NVXH 3I4NG 1OXXK 2RCNA 5IE8A 4DR6Q 3G48A 1Q81C 4KHZA 2IHEA 4GNXB 2DGYA 2ASBA 1VCIA 4DR1Q 4DR5Q 3AQQA 1JE5A 3W5OA 1J6QA 1HJPA 2C35B 4O2DA 1I94Q 4OONA 3T1HQ 3E9HA 3G4SA 4P71A 3U4VA 2JA6G 2R7ZH 4JV5L 4JBKA 1IYJB 1D8LA 1VQCA 3J80c 3L0OA 2I0QA 3S1NH 4GNXA 2R7FA 3HOWG 1FJGQ 2HIXA 3CCLA 4A4IA 2YYZA 3HFZB 1L2FA 4MNOA 4RMFA 4EQ5A 2H5XA 5IYCG 4LFCQ 1GO3E 3H3VI 1YI2A 1K0RA 1MKHA 5JJIA 2IX0A 4DR3Q 1LM0A 2AWNA 1WI5A 4DV0Q 1N36L 4LFBL 4DUYL 1UWVA 4DK6C 2JA5H 3HOUH 2R93G 3S2HH 1PH4A 4A3EH 4MZ9A 5C4XH 4YCWA 3KF6B 4HJ5A 2ZJQA 1K8GA 3ULPA 1TWHH 3KDFB 4DNIA 2E2JH 1U5KA 1SR3A 4LF8Q 4A3BH 2YTYA 1VQ8A 2F52A 3S15H 1X3EA 1N32Q 3ERSX 3U4ZA 4A3JH 4DR2Q 4JI7Q 1PH8A 5BR8Q 2YTVA 4ME3A 1N34Q 2B29A 1YHQA 1X55A 1KAWA 1YIJA 1PH6A 3A5UA 3D0FA 2VL6A 5FLXc 4QGUA 1Q1BA 4TVAB 1VQFA 3I56A 2OCEA 3GDEA 4A75A 1B7YB 2OQ0A 4UP9A 1HR0Q 1C7YA 3WWVA 4R4QA 4LWCA 1YHBA 2A1AA 3RZDH 4LF7L 2VUMG 3W1BA 2JA7H 2XTIA 2VNUD 2L15A 2Q2TA 3CCMA 2ZTDA 1QVFA 4IFDI 3E9IA 4LUVA 1OXSC 1X3FA 2N78A 4JG2A 4LF9Q 5M5WH 1XNQL 3S14H 2JEBI 3UDIA 1CUKA 2WAQE 1KD1C 4OWWB 1HNZL 1G51A 3S17H 2KHIA 1N8RC 1X56A 4BY1H 1IZ6A 2VQEL 4KI0A 3CCVA 2LXJA 3CPFA 4R4TA 1VQBA 2Q2UA 4OX9Q 1Z47A 2PI2A 2Z0SA 2R7DA 1HNWL 5IYDG 4KHPL 2UU9Q 1IBKQ 5IP9H 1YVCA 1WCMH 2E5LL 4K0KL 2VS1A 3J81i 4DV7Q 4LF4L 4DV2L 3PUVA 4DAMA 4A3MG 2R7ZG 4LF5L 1V43A 3PUYA 4UP8A 3OTOL 2HHHQ 2K4KA 3TRZA 2F4VQ 3RR5A 2BH2A 2JA9A 5GROA 1L1OC 4JC0A 2LSSA 1B8AA 1VQGA 5LMNQ 4DPGA 2JA5G 2NVTH 3HOUG 1IL2A 4A3EG 1BBWA 3I7FA 4R4IA 3S24A 4YY3Q 5C4XG 1UE7A 1S72A 1C0AA 1WYDA 1GD7A 3J81j 1N33Q 3I4OA 1XPOA 1Y14B 3RN2A 1ASYA 2UXCQ 3SGIA 2KCTA 3UE1A 1TXYA 1DGSA 4JI8Q 2PQAB 2FXQA 4JI2Q 4A3BG 3K80C 3I4MH 1GVPA 2LXKA 2A19A 4A3JG 2K52A 1X54A 3GTKH 4IJHA 4IPHA 1JJGA 3RLFA 2VQFL 3PGZA 1LYLA 2PI2E 5M5YH 4AH6A 2PMZE 4GOPC 3TQYA 3M85A 3M4PA 3PF5A 1KL9A 4GKJQ 3CW2C 3KJOA 3TREA 2AKWB 1S40A 4ALPA 1NE3A 2K14A 2JA7G 3DLLA 2E2HH 2Y0SE 2VUMH 2XGTA 4A76A 2WAQG 3K8AA 2N49A 1VQ5A 2CCZA 1QVGA 4GKKQ 1HZAA 1E3PA 3J7ZC 1HNXL 1J5EQ 3L7ZC 2ATWA 1K3RA 1VQ4A 4BY1G 1VQMA 4JBMA 1FGUA 5JEAG 4JI0L 3CCJA 4AQYQ 4A3IH 1NJIC 2HT1A 1I5FA 2ALYB 4B3SQ 4JI6Q 1AE2A 2KBNA 2OQKA 2ZM6L 1VQKA 2CQOA 4JCVE 4J15A 5IP9G 4X62L 3M3YH 2UXBL 1WCMG 2ZTEA 4A3FH 2Z6KC 4LFAL 1PHJA 5IYDH 4DV4L 1XMOQ 4A3KH 1G291 4X6AH 2MO1A 3NENA 4X65Q 1VQ6A 2QGQA 1OXUA 2NVYH 3EN2A 3UDFA 1M1KC 2JA8H 2AMCB 2B3GA 3TEHB 4A3MH 4PMWA 2UUCL 1NMFA 4LW1A 1VQEA 4BY7H 1TWCH 4Y7NH 3HOXH 1GKHA 2NN6I 2Q2IA 3ULLA 4JI4Q 3PCOB 2JE6I 4JBWA 3AEVA 2UUAL 1VS0A 4H02A 4JBJA 4QIWE 3CXCA 3TS0A 3A5ZB 2IY5B 4JYAQ 2ZJPA 1I3QH 3H0GH 4DR4L 4DV1Q 1CSPA 1VQLA 3NEMA 3I55A 1XNRL 1IBLL 4YHHQ 1TWFH 4XIGS 5C0XG 5LMUQ 2I5LX 2K75A 4HIOA 3KYHC 3CCSA 3I4MG 4DR7L 4NXNQ 4UP7A 4AYBE 4DUZQ 4IO9A 1QZHA 4PG3A 4WJ3M 3GTQH 4B3TL 4HJ9A 4KLKA 2VW9A 5K36G 1Y1WH 1X9NA 4NXML 4GN5A 3STBC 4C3JH 4B3RQ 4IJLA 2BA1A 2KCMA 4HJAA 1PA6A 4JI1Q 2I5HA 2Y0SG 1K9MC 1JT8A 2HQLA 4IFDG 1MJEA 2A8VA 1A63A 4GNXC 4DV3Q 1IBML 3F2DA 3EIVA 4JI5Q 4OO1G 2HIVA 2R92H 4DR6L 1BKBA 2D0PA 1O7IA 3CAMA 4DKAC 4DV6Q 2IT1A 3HOZG 5AJ3Q 4DR1L 4DR5L 2MFIA 4HIDA 3RLOA 1I94L 2UUBQ 2OWOA 4C3IH 4A3CH 2UXDQ 3T1HL 3M9BA 1D7QA 1HZ9A 1YHAA 1KHIA 4C3HH 4A3IG 5C3EH 4IPGA 3RN5A 1YJNA 1SFOH 3PO2H 4LUZA 5IP7H 1AE3A 2MQHA 3K0XA 3CC2A 1CKOA 4P72A 3JAMc 4A3FG 3S1QH 4GLAC 2KENA 1M90C 3M7NA 1VQIA 4LFCL 4LF4Q 4A3KG 2JQOA 2OTLA 3GTLH 4DR3L 4DV0L 1MIUA 2NZOA 4GN3B 1QZGA 1I6HH 5M3FH 2GVBA 1QVCA 3PV0A 2CWPA 4X66Q 2QEXA 2Q2HA 5GQOA 4RG1A 1EIYB 2VY3A 3EBEA 3K7UC 2JA8G 3HOYH 4BY7G 4BXXH 3HOXG 1VQ9A 4A3LH 4BA2I 1U0LA 3K7AH 2EXDA 4A3DG 3IRBA 1KRSA 2BH8A 1SROA 2NVQH 3H3VH 4GN4B 1X6OA 4LF8L 1TWGH 2K5VA 1RIPA 1EOVA 1TWAH 1P8LA 1Z9FA 2AWOA 2KHJA 5C44H 1EFWA 3H0GG 1N32L 4DR2L 4JI7L 4B3MQ 2WFWA 5BR8L 1N34L 4LF6Q 4UY8C 2K50A 3S1MH 5HGQA 4R1JA 3HKZE 4JOIA 2V1CC 3ZJYC 5HY6A 4AYBG 1N9WA 2JEAI 4GOPA 3FKIH 1HR0L 4P75A 5IWAQ 1UE1A 3A74A 2K5HA 2EQSA 1PV4A 3UDGA 5ELNA 3ER0A 4JI3Q 1OTCA 3CC4A 4LF9L 1JMCA 2OTJA 3CMAA 4X64Q 1UEBA 1Y1WG 4NPSA 1XMQQ 3J80i 4DV5Q 1XPUA 4A3GH 3AFPA 1X3GA 1QUQB 1SRUA 4OX9L 4UPAA 3VDYA 4POFA 1Y1VH 2F3IA 3HKSA 2ID0A 3HOVG 2R92G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIM A;  2ES2 A;  2UU9 L;  1IBK L;  4JV5 Q;  3S1R H;  3A0J A;  3GTO H;  4DV7 L;  4A3C G;  1QUQ A;  3F8T A;  1FVI A;  1PH5 A;  2IX1 A;  1BVS A;  1Q12 A;  3M4O H;  4IOA A;  3HOZ H;  5JJL A;  5C3E G;  3T1Y L;  3PO2 G;  1T9H A;  2HHH L;  3F2B A;  3OW2 A;  5IP7 G;  4L5T A;  1N36 Q;  2F4V L;  4DUY Q;  1EQQ A;  2R6G A;  1Q82 C;  3PIO A;  3KLW A;  3OYY A;  3J81 c;  1SE8 A;  4POG A;  1KIX A;  1NBW A;  4HJ7 A;  1KQS A;  1K8A C;  5DLQ E;  1E7Z A;  5LMN L;  5M3F G;  1E22 A;  4OXP A;  3HOY G;  3TS2 A;  1H95 A;  1YNX A;  3GTM H;  2MO0 A;  3MEF A;  4O0A A;  4OWX B;  4IOC A;  4YY3 L;  1JJC B;  4BXX G;  1N33 L;  3HOW H;  1VQJ A;  2UXC L;  4A3L G;  2B63 H;  2WP8 J;  3JC6 6;  3CCQ A;  5FJ8 H;  2RHS B;  4FDB A;  1PVO A;  4JI8 L;  4C2M H;  5FLM G;  4JI2 L;  2PNH A;  5C44 G;  1SMX A;  3PF4 A;  4A3D H;  1VQP A;  1VQA A;  3HKZ G;  3PUX A;  4LF7 Q;  1IXR A;  4GS3 A;  1K83 H;  1VQD A;  3JAM i;  1YZ6 A;  1CKN B;  4GKJ L;  3CPW A;  3FKI G;  4YWM A;  1WOC A;  1Q8K A;  3GO5 A;  2NZH A;  1OXT A;  1PH7 A;  4R4O A;  1PH3 A;  1XNQ Q;  2JK8 A;  5GAG C;  3U58 A;  4YCU A;  3CC7 A;  1HNZ Q;  3K81 C;  1V1Q A;  4MTN A;  4QQB X;  3FP9 A;  1I50 H;  1OXV A;  2K5N A;  3CME A;  2VQE Q;  1VQO A;  2MNA A;  1CKN A;  4GKK L;  1NTG A;  5M5X H;  1J5E L;  4APV A;  1CKM A;  1V9P A;  1HNW Q;  1YIT A;  1Q86 C;  3GTG H;  4A3G G;  2CKZ B;  4KHP Q;  4HIK A;  1VQN A;  2E5L Q;  1CSQ A;  3GTJ H;  4K0K Q;  5JJK A;  2E2I H;  1NY4 A;  1Y1V G;  4DV2 Q;  1HZB A;  3BZC A;  4AQY L;  1PH9 A;  3CCE A;  4B3S L;  4JI6 L;  5JEA J;  4A93 G;  1W2B A;  4DAY B;  1KXL A;  1UE6 A;  1EIF A;  3FHW A;  4LF5 Q;  4P73 A;  1KRT A;  3OTO Q;  4NB3 A;  1GM5 A;  3HOV H;  4BBS H;  2IHF A;  1YEZ A;  5M3M H;  4HIM A;  1XMO L;  3I2Z A;  5C0X I;  4X65 L;  4YCV A;  1PH2 A;  3RLN A;  4BBR H;  2WB1 E;  5IT9 c;  3KF6 A;  3S2D H;  4TQU S;  2YV5 A;  1L1O B;  4XTC S;  2CFM A;  1YBY A;  3KDF A;  3BU2 A;  5EAY A;  4EX5 A;  1VQ7 A;  1FJG L;  4JI4 L;  1B70 B;  2N3S A;  3CD6 A;  3Q8D A;  4LUO A;  5H1S E;  1S3O A;  1K73 C;  1EWI A;  1SLJ A;  2RHQ B;  5IYB H;  4JYA L;  4P74 A;  1Q1E A;  3PO3 G;  4DV1 L;  3J7A 5;  4PZ6 A;  1L1O A;  1XPR A;  2JJQ A;  3G71 A;  1G6P A;  4QY7 A;  2GN5 A;  2B63 G;  1A0I A;  4YHH L;  1L0W A;  5FJ8 G;  5LMU L;  4OO1 I;  2VQF Q;  4WJ4 A;  5C0X J;  3G6E A;  3MXN B;  4NXN L;  4DUZ L;  1JB7 A;  4QL5 A;  5FLM H;  3S16 H;  1Q46 A;  4GOP B;  2D62 A;  1E24 A;  4IPD A;  5J3B A;  2DUD A;  1A8V A;  2YTX A;  4HJ8 A;  1HR0 W;  4B3R L;  3I4N H;  4JI1 L;  5C4J H;  3CCR A;  3GTP H;  1A62 A;  1HNX Q;  1E1O A;  5ELO A;  3PIP A;  3ULJ A;  4DV3 L;  4L5R C;  2BA0 A;  3B6Y A;  5E7N A;  3T1Y Q;  4IFD J;  3CP0 A;  4JI5 L;  4GLX A;  3D31 A;  1PH1 A;  3ICE A;  4DK3 C;  1W3S A;  4JI0 Q;  4PZ7 A;  3GD7 A;  2JA6 H;  4DV6 L;  1C9O A;  3PUZ A;  4YWK A;  5AJ3 L;  2RF4 A;  2ZM6 Q;  2UUB L;  4L5S A;  4X62 Q;  2UXB Q;  2UXD L;  3AFQ A;  4LFA Q;  2QA4 A;  5GAE C;  5IYC H;  4DV4 Q;  4R4C A;  4Y52 H;  4IPC A;  3PUW A;  1ASZ A;  1YJW A;  2R93 H;  1RL2 A;  1VQH A;  1EYG A;  4A93 H;  3UDX A;  3F2C A;  2GVA A;  5M3M G;  3PSI A;  4BBS G;  3RZO H;  3CCU A;  1PFS A;  2UUC Q;  3E0E A;  2I5M X;  2WB1 G;  3BJU A;  3L2P A;  4X66 L;  1EUJ A;  4BBR G;  2YU9 H;  2EIF A;  1PYB A;  2Z6K A;  1AH9 A;  2AHO B;  5GAD C;  2UUA Q;  3CQZ H;  1P16 A;  4JOI C;  4LNQ A;  3KFU A;  3KJP A;  3LGJ A;  1NMG A;  4PZ8 A;  4DR4 Q;  3UE0 A;  1PYS B;  5LMN W;  2PQA A;  2VZA A;  1LTL A;  4GLV B;  5IY0 A;  5GAH C;  3DM3 A;  3M4Q A;  1XNR Q;  1IBL Q;  3NBH B;  5IYB G;  4OWT B;  1X65 A;  1HH2 P;  1MJC A;  4QJF A;  3NEL A;  3U50 C;  3BZK A;  1E1T A;  1WJJ A;  1YJ9 A;  1XJV A;  1SN8 A;  4B3M L;  4LF6 L;  1Q7Y C;  4DR7 Q;  1LUZ A;  2E8G A;  1HZC A;  2CWA A;  3PO3 H;  1EQR A;  3H15 A;  4B3T Q;  2NN6 G;  2ZTC A;  3KOJ A;  1XTD A;  3W1G A;  5IWA L;  2ZJR A;  2N8N A;  4NXM Q;  3F1Z A;  1BBU A;  1JJ2 A;  4LFB Q;  3KF8 B;  1R9T H;  2D0O A;  4YWL A;  1FL0 A;  3STB D;  1WFQ A;  3AYH B;  4JI3 L;  4BA1 I;  3RNU A;  4L5Q A;  4X64 L;  1KC8 C;  1IBM Q;  1XMQ L;  1UE5 A;  3CF5 A;  4DV5 L;  2NVX H;  3I4N G;  1OXX K;  2RCN A;  5IE8 A;  4DR6 Q;  3G48 A;  1Q81 C;  4KHZ A;  2IHE A;  4GNX B;  2DGY A;  2ASB A;  1VCI A;  4DR1 Q;  4DR5 Q;  3AQQ A;  1JE5 A;  3W5O A;  1J6Q A;  1HJP A;  2C35 B;  4O2D A;  1I94 Q;  4OON A;  3T1H Q;  3E9H A;  3G4S A;  4P71 A;  3U4V A;  2JA6 G;  2R7Z H;  4JV5 L;  4JBK A;  1IYJ B;  1D8L A;  1VQC A;  3J80 c;  3L0O A;  2I0Q A;  3S1N H;  4GNX A;  2R7F A;  3HOW G;  1FJG Q;  2HIX A;  3CCL A;  4A4I A;  2YYZ A;  3HFZ B;  1L2F A;  4MNO A;  4RMF A;  4EQ5 A;  2H5X A;  5IYC G;  4LFC Q;  1GO3 E;  3H3V I;  1YI2 A;  1K0R A;  1MKH A;  5JJI A;  2IX0 A;  4DR3 Q;  1LM0 A;  2AWN A;  1WI5 A;  4DV0 Q;  1N36 L;  4LFB L;  4DUY L;  1UWV A;  4DK6 C;  2JA5 H;  3HOU H;  2R93 G;  3S2H H;  1PH4 A;  4A3E H;  4MZ9 A;  5C4X H;  4YCW A;  3KF6 B;  4HJ5 A;  2ZJQ A;  1K8G A;  3ULP A;  1TWH H;  3KDF B;  4DNI A;  2E2J H;  1U5K A;  1SR3 A;  4LF8 Q;  4A3B H;  2YTY A;  1VQ8 A;  2F52 A;  3S15 H;  1X3E A;  1N32 Q;  3ERS X;  3U4Z A;  4A3J H;  4DR2 Q;  4JI7 Q;  1PH8 A;  5BR8 Q;  2YTV A;  4ME3 A;  1N34 Q;  2B29 A;  1YHQ A;  1X55 A;  1KAW A;  1YIJ A;  1PH6 A;  3A5U A;  3D0F A;  2VL6 A;  5FLX c;  4QGU A;  1Q1B A;  4TVA B;  1VQF A;  3I56 A;  2OCE A;  3GDE A;  4A75 A;  1B7Y B;  2OQ0 A;  4UP9 A;  1HR0 Q;  1C7Y A;  3WWV A;  4R4Q A;  4LWC A;  1YHB A;  2A1A A;  3RZD H;  4LF7 L;  2VUM G;  3W1B A;  2JA7 H;  2XTI A;  2VNU D;  2L15 A;  2Q2T A;  3CCM A;  2ZTD A;  1QVF A;  4IFD I;  3E9I A;  4LUV A;  1OXS C;  1X3F A;  2N78 A;  4JG2 A;  4LF9 Q;  5M5W H;  1XNQ L;  3S14 H;  2JEB I;  3UDI A;  1CUK A;  2WAQ E;  1KD1 C;  4OWW B;  1HNZ L;  1G51 A;  3S17 H;  2KHI A;  1N8R C;  1X56 A;  4BY1 H;  1IZ6 A;  2VQE L;  4KI0 A;  3CCV A;  2LXJ A;  3CPF A;  4R4T A;  1VQB A;  2Q2U A;  4OX9 Q;  1Z47 A;  2PI2 A;  2Z0S A;  2R7D A;  1HNW L;  5IYD G;  4KHP L;  2UU9 Q;  1IBK Q;  5IP9 H;  1YVC A;  1WCM H;  2E5L L;  4K0K L;  2VS1 A;  3J81 i;  4DV7 Q;  4LF4 L;  4DV2 L;  3PUV A;  4DAM A;  4A3M G;  2R7Z G;  4LF5 L;  1V43 A;  3PUY A;  4UP8 A;  3OTO L;  2HHH Q;  2K4K A;  3TRZ A;  2F4V Q;  3RR5 A;  2BH2 A;  2JA9 A;  5GRO A;  1L1O C;  4JC0 A;  2LSS A;  1B8A A;  1VQG A;  5LMN Q;  4DPG A;  2JA5 G;  2NVT H;  3HOU G;  1IL2 A;  4A3E G;  1BBW A;  3I7F A;  4R4I A;  3S24 A;  4YY3 Q;  5C4X G;  1UE7 A;  1S72 A;  1C0A A;  1WYD A;  1GD7 A;  3J81 j;  1N33 Q;  3I4O A;  1XPO A;  1Y14 B;  3RN2 A;  1ASY A;  2UXC Q;  3SGI A;  2KCT A;  3UE1 A;  1TXY A;  1DGS A;  4JI8 Q;  2PQA B;  2FXQ A;  4JI2 Q;  4A3B G;  3K80 C;  3I4M H;  1GVP A;  2LXK A;  2A19 A;  4A3J G;  2K52 A;  1X54 A;  3GTK H;  4IJH A;  4IPH A;  1JJG A;  3RLF A;  2VQF L;  3PGZ A;  1LYL A;  2PI2 E;  5M5Y H;  4AH6 A;  2PMZ E;  4GOP C;  3TQY A;  3M85 A;  3M4P A;  3PF5 A;  1KL9 A;  4GKJ Q;  3CW2 C;  3KJO A;  3TRE A;  2AKW B;  1S40 A;  4ALP A;  1NE3 A;  2K14 A;  2JA7 G;  3DLL A;  2E2H H;  2Y0S E;  2VUM H;  2XGT A;  4A76 A;  2WAQ G;  3K8A A;  2N49 A;  1VQ5 A;  2CCZ A;  1QVG A;  4GKK Q;  1HZA A;  1E3P A;  3J7Z C;  1HNX L;  1J5E Q;  3L7Z C;  2ATW A;  1K3R A;  1VQ4 A;  4BY1 G;  1VQM A;  4JBM A;  1FGU A;  5JEA G;  4JI0 L;  3CCJ A;  4AQY Q;  4A3I H;  1NJI C;  2HT1 A;  1I5F A;  2ALY B;  4B3S Q;  4JI6 Q;  1AE2 A;  2KBN A;  2OQK A;  2ZM6 L;  1VQK A;  2CQO A;  4JCV E;  4J15 A;  5IP9 G;  4X62 L;  3M3Y H;  2UXB L;  1WCM G;  2ZTE A;  4A3F H;  2Z6K C;  4LFA L;  1PHJ A;  5IYD H;  4DV4 L;  1XMO Q;  4A3K H;  1G29 1;  4X6A H;  2MO1 A;  3NEN A;  4X65 Q;  1VQ6 A;  2QGQ A;  1OXU A;  2NVY H;  3EN2 A;  3UDF A;  1M1K C;  2JA8 H;  2AMC B;  2B3G A;  3TEH B;  4A3M H;  4PMW A;  2UUC L;  1NMF A;  4LW1 A;  1VQE A;  4BY7 H;  1TWC H;  4Y7N H;  3HOX H;  1GKH A;  2NN6 I;  2Q2I A;  3ULL A;  4JI4 Q;  3PCO B;  2JE6 I;  4JBW A;  3AEV A;  2UUA L;  1VS0 A;  4H02 A;  4JBJ A;  4QIW E;  3CXC A;  3TS0 A;  3A5Z B;  2IY5 B;  4JYA Q;  2ZJP A;  1I3Q H;  3H0G H;  4DR4 L;  4DV1 Q;  1CSP A;  1VQL A;  3NEM A;  3I55 A;  1XNR L;  1IBL L;  4YHH Q;  1TWF H;  4XIG S;  5C0X G;  5LMU Q;  2I5L X;  2K75 A;  4HIO A;  3KYH C;  3CCS A;  3I4M G;  4DR7 L;  4NXN Q;  4UP7 A;  4AYB E;  4DUZ Q;  4IO9 A;  1QZH A;  4PG3 A;  4WJ3 M;  3GTQ H;  4B3T L;  4HJ9 A;  4KLK A;  2VW9 A;  5K36 G;  1Y1W H;  1X9N A;  4NXM L;  4GN5 A;  3STB C;  4C3J H;  4B3R Q;  4IJL A;  2BA1 A;  2KCM A;  4HJA A;  1PA6 A;  4JI1 Q;  2I5H A;  2Y0S G;  1K9M C;  1JT8 A;  2HQL A;  4IFD G;  1MJE A;  2A8V A;  1A63 A;  4GNX C;  4DV3 Q;  1IBM L;  3F2D A;  3EIV A;  4JI5 Q;  4OO1 G;  2HIV A;  2R92 H;  4DR6 L;  1BKB A;  2D0P A;  1O7I A;  3CAM A;  4DKA C;  4DV6 Q;  2IT1 A;  3HOZ G;  5AJ3 Q;  4DR1 L;  4DR5 L;  2MFI A;  4HID A;  3RLO A;  1I94 L;  2UUB Q;  2OWO A;  4C3I H;  4A3C H;  2UXD Q;  3T1H L;  3M9B A;  1D7Q A;  1HZ9 A;  1YHA A;  1KHI A;  4C3H H;  4A3I G;  5C3E H;  4IPG A;  3RN5 A;  1YJN A;  1SFO H;  3PO2 H;  4LUZ A;  5IP7 H;  1AE3 A;  2MQH A;  3K0X A;  3CC2 A;  1CKO A;  4P72 A;  3JAM c;  4A3F G;  3S1Q H;  4GLA C;  2KEN A;  1M90 C;  3M7N A;  1VQI A;  4LFC L;  4LF4 Q;  4A3K G;  2JQO A;  2OTL A;  3GTL H;  4DR3 L;  4DV0 L;  1MIU A;  2NZO A;  4GN3 B;  1QZG A;  1I6H H;  5M3F H;  2GVB A;  1QVC A;  3PV0 A;  2CWP A;  4X66 Q;  2QEX A;  2Q2H A;  5GQO A;  4RG1 A;  1EIY B;  2VY3 A;  3EBE A;  3K7U C;  2JA8 G;  3HOY H;  4BY7 G;  4BXX H;  3HOX G;  1VQ9 A;  4A3L H;  4BA2 I;  1U0L A;  3K7A H;  2EXD A;  4A3D G;  3IRB A;  1KRS A;  2BH8 A;  1SRO A;  2NVQ H;  3H3V H;  4GN4 B;  1X6O A;  4LF8 L;  1TWG H;  2K5V A;  1RIP A;  1EOV A;  1TWA H;  1P8L A;  1Z9F A;  2AWO A;  2KHJ A;  5C44 H;  1EFW A;  3H0G G;  1N32 L;  4DR2 L;  4JI7 L;  4B3M Q;  2WFW A;  5BR8 L;  1N34 L;  4LF6 Q;  4UY8 C;  2K50 A;  3S1M H;  5HGQ A;  4R1J A;  3HKZ E;  4JOI A;  2V1C C;  3ZJY C;  5HY6 A;  4AYB G;  1N9W A;  2JEA I;  4GOP A;  3FKI H;  1HR0 L;  4P75 A;  5IWA Q;  1UE1 A;  3A74 A;  2K5H A;  2EQS A;  1PV4 A;  3UDG A;  5ELN A;  3ER0 A;  4JI3 Q;  1OTC A;  3CC4 A;  4LF9 L;  1JMC A;  2OTJ A;  3CMA A;  4X64 Q;  1UEB A;  1Y1W G;  4NPS A;  1XMQ Q;  3J80 i;  4DV5 Q;  1XPU A;  4A3G H;  3AFP A;  1X3G A;  1QUQ B;  1SRU A;  4OX9 L;  4UPA A;  3VDY A;  4POF A;  1Y1V H;  2F3I A;  3HKS A;  2ID0 A;  3HOV G;  2R92 G; 
#chains in the Genus database with same CATH topology
 2UU9 L;  3GTO H;  4TRD A;  4HR7 B;  3MEH A;  4TKO B;  1CZG A;  1QUQ A;  2JSO A;  3F8T A;  2IX1 A;  1JWU D;  3HOZ H;  3GTG B;  4JK1 C;  4RKL A;  3DMU A;  3F2B A;  2MJ8 A;  1IW7 D;  1EQQ A;  2R6G A;  3HOU B;  3J7A V;  3KLW A;  3G6J B;  5C3W A;  3F2U A;  1K8A C;  1E7Z A;  5LMN L;  5M3F G;  2Z6B A;  2MO0 A;  3MEF A;  5FOB B;  3HRZ C;  1R4Q B;  1ET6 A;  1VQJ A;  2EE1 A;  1LTT D;  2UXC L;  2L5T A;  1SE2 A;  2B63 H;  2K5W A;  2CQA A;  1II3 A;  5D3D A;  1BCP B;  2EDG A;  4JI8 L;  4C2M H;  3Q24 A;  1SYG A;  2I07 B;  3K57 A;  1JOO A;  3QWN A;  4F8M A;  4I7Z C;  3PUX A;  1PFN A;  2FIN B;  2EJM A;  1PTO F;  5C3X A;  1O7L A;  3GO5 A;  3PQI A;  5M5W B;  4QQB X;  4YCU A;  1HNZ Q;  3K81 C;  1V1Q A;  3CME A;  2VQE Q;  1S5B D;  2MNA A;  3TSS A;  1KDC A;  3MFY A;  1HNW Q;  4KKU A;  1Q86 C;  1EYA A;  2CKZ B;  1HTP A;  2N55 A;  4A3G G;  4KHP Q;  2Z4I A;  2E5L Q;  5JJK A;  1NY4 A;  3PMF A;  4DV2 Q;  2A69 D;  1D7Q A;  3CCE A;  2D5D A;  4DAY B;  4LF5 Q;  4P73 A;  3P75 A;  1KRT A;  1JOQ A;  2XN9 C;  1GM5 A;  2NYZ D;  1B9M A;  2RDH A;  5M3M H;  4HIM A;  2JA6 B;  2P5Z X;  4HAE A;  4BBR H;  3KBG A;  4XT3 B;  3KF6 A;  4TQU S;  4XTC S;  3FRP B;  2CFM A;  3LWE A;  5EAY A;  1SSO A;  1VQ7 A;  2R93 B;  3Q8D A;  1K73 C;  1IL8 A;  1EWI A;  2F0G A;  1LAC A;  1G6P A;  1L1O A;  3MWY W;  2GN5 A;  1M8A A;  1JCK B;  2Z8L A;  1ICW A;  2VQF Q;  3I72 A;  3M7G A;  4WJ4 A;  1CQV A;  2AQ2 B;  2F0M A;  2HDL A;  5F2D A;  1CT1 D;  1PTO B;  1K8O A;  1X3P A;  5FLM H;  4ULL A;  1SXT A;  1Q46 A;  1V8Q A;  3BS1 A;  2Y0S B;  4IPD A;  2K6A A;  4HJ8 A;  4PV1 C;  1EL0 A;  3I4N H;  5C4J H;  1LTG D;  3CCR A;  3GTP H;  2H1E A;  1HNX Q;  4KMU C;  2JXM B;  5E7N A;  3CP0 A;  5CBE E;  1W3S A;  1RTO A;  4PZ7 A;  4YWK A;  3I70 A;  2ZM6 Q;  3M3Y B;  2XNA C;  2V4D A;  5GAE C;  3E5S A;  4R4C A;  4KK7 A;  5IGG A;  3A8K E;  1STN A;  2LS0 1;  4DK1 A;  4BBS G;  3PSI A;  2R7Z B;  1PFS A;  2L55 A;  3E0E A;  4N8X 1;  2I5M X;  1EUJ A;  2YU9 H;  2DY7 A;  1ET9 A;  4ZQ3 A;  1AH9 A;  2AHO B;  1C48 A;  2XWJ B;  2HCC A;  4KV6 A;  1PRT C;  1EZ6 A;  2JA5 B;  1IKM A;  5LMN W;  2BE5 D;  2NUC A;  4B9W A;  2VZA A;  1S5E D;  2CCZ A;  1MJC A;  3NEL A;  4RKB A;  2O5J C;  1LO5 D;  1LUZ A;  1HZC A;  2EZV A;  2QIL A;  5FKA C;  1G91 A;  4A3B B;  4CKC A;  4RGT A;  2RDG A;  2G5D A;  1XTD A;  3J7A F;  3FDT A;  2N8N A;  1JJ2 A;  2L4N A;  1VDZ A;  1A15 A;  5FO7 B;  1TS2 A;  1FL0 A;  1WFQ A;  5IGE A;  4E6I A;  1F9Q A;  1HQR D;  4X64 L;  1UE5 A;  2NVX H;  4DR6 Q;  1K28 A;  1V1P A;  1A2T A;  1Q81 C;  2F0J A;  2IHE A;  5EPK A;  2WAQ B;  3KBX A;  4K2K A;  1VCI A;  3S14 B;  1I94 Q;  2C35 B;  2LFN A;  2X69 A;  4P71 A;  4JV5 L;  1EOT A;  4JBK A;  3N6R A;  3L0O A;  4IQZ A;  5IYC G;  1IW7 C;  2F0W A;  1GO3 E;  1MKH A;  1WCM B;  1H9M A;  5FK9 C;  2AWN A;  1N36 L;  3MXU A;  2NZ1 D;  3BVG A;  1EY0 A;  4FF2 A;  4KN7 C;  3WDN A;  1XYI A;  3H91 A;  2ICE C;  2ZJQ A;  5C4H A;  3KDF B;  4DNI A;  1B3A A;  2E2J H;  1KDB A;  4LF8 Q;  2YTY A;  1VQ8 A;  2F52 A;  3U4Z A;  2PW5 A;  4JI7 Q;  2HD3 A;  4J1M A;  2YTV A;  2B29 A;  3R2I A;  3S1M B;  1SNO A;  2VL6 A;  2X6L A;  1EY6 A;  4QGU A;  1I4Q A;  3GDE A;  1DXM A;  4RAU C;  5I6Y A;  4R4Q A;  2A1A A;  3A8I E;  4PQX A;  4LF7 L;  3W1B A;  2Q2T A;  1BF4 A;  4LUV A;  3WOE A;  1EEF D;  2VXW A;  2WAQ E;  1NAP A;  3Q0A A;  3NTK A;  1J8I A;  1X56 A;  4BY1 H;  5EKK A;  4OX9 Q;  2PI2 A;  2Z0S A;  2R7D A;  3IFD A;  4K14 A;  5IYD G;  5HGT A;  2A69 C;  3GQB A;  5IP9 H;  3S1R B;  3KK7 A;  1A3T A;  4DV7 Q;  4ZYS A;  1RD9 D;  1FNU A;  1F9S A;  4K2L A;  3M4O B;  2DNE A;  2FJ2 A;  2HHH Q;  1W6K A;  3VA5 A;  3E0J A;  1BO0 A;  4R8I A;  3S1N B;  1ESF A;  1DOK A;  1L1O C;  1B8A A;  2NVT H;  3HOU G;  4CDE C;  1QJO A;  3NTI A;  3S24 A;  4R4I A;  1KAB A;  5CGK A;  1UE7 A;  4IUV A;  4M8A A;  3O13 A;  4YY3 Q;  3J81 j;  1S72 A;  1N33 Q;  1Y14 B;  3RN2 A;  5EKL A;  3SGI A;  2VB3 X;  3TZD A;  4BY7 B;  5C0X H;  1DYQ A;  4Y7N B;  3K80 C;  4QIW B;  1GVP A;  1SNQ A;  4A3D B;  2A19 A;  4A3J G;  2K52 A;  4IJH A;  4IPH A;  3I4L A;  4C3J G;  1KTK A;  4GOP C;  3M85 A;  4EQN A;  1RKN A;  1KL9 A;  2PW7 A;  1IYU A;  5J22 A;  1S40 A;  2JA7 G;  1AZQ A;  3QJY A;  3A7L A;  1JC7 A;  4OHJ A;  1I4H A;  4A76 A;  1HFG A;  4GKK Q;  4RGN A;  1ML0 D;  3VR3 A;  2ATW A;  5AFW A;  2F0E A;  1SNM A;  3VYU A;  1E2W A;  1FGU A;  3GTJ B;  4JI0 L;  1A2U A;  1SMY C;  2HT1 A;  1I5F A;  2OQK A;  1I4G A;  2EY1 A;  2TSS A;  4LFA L;  2HDM A;  1PHJ A;  5FLX E;  2LKV A;  3ONA B;  4IUQ A;  2WB1 B;  2NVY H;  3BVZ A;  4PMW A;  2UUC L;  1PZK D;  1EY9 A;  1NMF A;  3HOX H;  3S1Q B;  3ULL A;  4JI4 Q;  4JBJ A;  4QIW E;  3TS0 A;  3FPU B;  2BE5 C;  2IY5 B;  4JYA Q;  1I6H B;  5M3F B;  3JAM E;  4DV1 Q;  1VQL A;  1MSH A;  3I55 A;  1SNC A;  4YHH Q;  1TWF H;  5LL6 X;  5LMU Q;  1IBL L;  2VB2 X;  4DR7 L;  5EPL A;  3I4M G;  1D6E C;  2WKC A;  4NXN Q;  4DUZ Q;  3GTQ H;  3RD4 A;  3VR6 A;  4KLK A;  4IUT A;  4FXK C;  4ZUJ A;  3QIA A;  4GN5 A;  4B3R Q;  2I5H A;  1K8M A;  2Y0S G;  1K9M C;  1JT8 A;  2CW0 D;  4M1U B;  2A8V A;  4RFB A;  4DV3 Q;  1D1I A;  5CV7 A;  4JI5 Q;  4OO1 G;  2R92 H;  1BKB A;  5DM7 3;  1O7I A;  4DKA C;  2MPM A;  3HOZ G;  5AJ3 Q;  3IFT A;  4DR1 L;  1LTB D;  2MFI A;  2F0N A;  3RLO A;  2JYO A;  2Z4H A;  3VR4 A;  4DAY A;  2UXD Q;  3T1H L;  2OF1 A;  4A3G B;  3RN5 A;  1BR9 A;  4P72 A;  2AUJ D;  1VQI A;  4LFC L;  3NQT A;  2JQO A;  4DR3 L;  1MIU A;  4GZY C;  4X66 Q;  2JA8 G;  4QUF A;  3H09 A;  2KEC A;  3SK5 A;  4BXX H;  4IUP A;  2L9H A;  1PTO D;  4F87 A;  4N9T A;  1KRS A;  2HUG A;  1EY5 A;  1TWG H;  1RIP A;  1TWA H;  1P8L A;  5D14 A;  1HA5 A;  3H0G G;  2B2V A;  4UHV A;  4DR2 L;  4B3M Q;  4LF6 Q;  4HMI A;  5EGT A;  1NUC A;  5K5P A;  5IGC A;  4LJZ C;  3FKI H;  4HCS A;  4P75 A;  4K8I A;  3A74 A;  3NSW A;  1Y8O B;  2EQS A;  1PV4 A;  2D2C C;  4FVM A;  2K7V A;  4LF9 L;  4DGZ A;  3CMA A;  1HUM A;  2PCF B;  1PMR A;  3IL8 A;  4KTA A;  3AFP A;  1X3G A;  1PZI D;  2K5Q A;  4PMC A;  4RCO A;  4UPA A;  1O7Y A;  1Y1V H;  1SE3 A;  4AIM A;  2ES2 A;  1EWC A;  1I50 B;  4A3C G;  5M5X B;  2IJ0 A;  4C3I G;  3FEW X;  2PNR C;  5C3E G;  1T9H A;  5A2Q E;  5IP7 G;  2TMP A;  5JVG 3;  2DNC A;  4DUY Q;  4L6T B;  4H13 C;  3OYY A;  1SE8 A;  1SYD A;  2C9O A;  1R4P B;  1M4V A;  4BBS B;  5DLQ E;  2H4O A;  2F3V A;  3L9A X;  1E22 A;  4IZ8 A;  4OXP A;  4OWX B;  2F0H A;  4IOC A;  1JJC B;  4HCE A;  1SBB B;  4CGY B;  2MP1 A;  3S2D B;  2A74 C;  2B2Y A;  5FLM G;  2PNH A;  1F9R A;  5IT9 E;  1B4O A;  3RZD B;  1E2V A;  2SOB A;  2JN4 A;  1K83 H;  1AP0 A;  2B2U A;  4YWM A;  1Q8K A;  4I7A A;  2XSC A;  4R4O A;  2K03 A;  1QNK A;  5GAG C;  3CC7 A;  3U58 A;  1OXV A;  2K5N A;  4FF1 A;  1CKN A;  3DEO A;  3QO2 A;  1V9P A;  1F2Z A;  3GTG H;  5BN3 A;  4XT1 B;  1VQN A;  4LF4 Q;  3BZC A;  4ME5 A;  4Q5V A;  1UE6 A;  3FHW A;  2KQ3 A;  2F0K A;  1EU3 A;  3HOV H;  2IHF A;  5C0X I;  5IGB A;  4F88 A;  1CA6 A;  3RLN A;  1EY4 A;  1G6Z A;  1NCV A;  1TQO A;  2IW3 A;  2F0U A;  4Q0F A;  3KDF A;  1FJG L;  2N3S A;  4LUO A;  5H1S E;  1S3O A;  2RHQ B;  1OO9 B;  3I3C A;  1JOR A;  3OWF A;  1D1K A;  4PZ6 A;  3U9O A;  4QY7 A;  4DF7 A;  3E3X A;  3GTK B;  2KHS A;  5FJ8 G;  5KNC A;  2AQ3 B;  3C2P A;  5KGU A;  3QG1 A;  1F2L A;  3OIP A;  2NTT A;  3MXN B;  4QL5 A;  1WTX A;  4BWG B;  2WKD A;  2ZXP A;  3SEB A;  2DUD A;  1A8V A;  2YTX A;  1BCP F;  3CHB D;  1EEI D;  1C8C A;  1SAP A;  4JI1 L;  2CW0 C;  3QB3 A;  3C3L A;  1DJR D;  1T5E A;  4K5X A;  3ND8 A;  4DK3 C;  5C4Z A;  1BQQ T;  2JA6 H;  1C9O A;  3T4A C;  2UXB Q;  1ONL A;  2F0O A;  2DJG C;  1HRJ A;  4Z9C B;  2QA4 A;  4DV4 Q;  1PXU A;  4Y52 H;  4IPC A;  4J8Q A;  1NR2 A;  2RKS A;  3RMH A;  1YJW A;  1EYG A;  3SDZ A;  4A93 H;  5EPJ A;  5FLX L;  2R93 H;  3RZO H;  2B2W A;  3L2P A;  2WB1 G;  3BJU A;  2B2V C;  4ZAI A;  1PYB A;  2OEO A;  3VYS A;  1PTO C;  4LNQ A;  3KJP A;  2KUM A;  5D65 A;  1PTO H;  1LTL A;  1Z6H A;  5KYL A;  1XNR Q;  5IYB G;  3LWU A;  1X65 A;  3U50 C;  1XJV A;  1YJ9 A;  3JAM L;  1DZ1 A;  1EWH A;  1TWH B;  1Q7Y C;  2RVL A;  4G7Z C;  2X6G A;  3DUZ A;  2CWA A;  3PO3 H;  1EQR A;  1KAA A;  2NN6 G;  4X3T A;  4A3J B;  5KIX A;  3W1G A;  1BBU A;  4C3J B;  4LFB Q;  1F2M A;  3KF8 B;  1ROD A;  3X3M A;  1R9T H;  4I65 A;  4JI3 L;  1CK1 A;  4BA1 I;  1CTM A;  3K5L A;  1XMQ L;  4DV5 L;  2JA7 B;  3T53 B;  2ASB A;  5EKI A;  3EJI A;  4DR5 Q;  3AQQ A;  3W5O A;  1WTW A;  1HJP A;  1LT6 D;  4O2D A;  2R3Z A;  1QNU A;  3U4V A;  2R7Z H;  4CKB A;  4GNX A;  4JVZ A;  2YYZ A;  4RMF A;  5JJI A;  1K0R A;  1DM0 B;  1WI5 A;  2E76 C;  1UWV A;  2K04 A;  2JA5 H;  3HOY B;  1PH4 A;  2B2Y C;  3W2D A;  4MZ9 A;  4JPB W;  2KVM A;  4HJ5 A;  3GP7 A;  4WJW A;  3ULP A;  4OIK A;  4X3K A;  2ZT9 C;  2NVQ B;  5KRU A;  1SR3 A;  4A3B H;  5I2X A;  1N32 Q;  1X3E A;  2B2U C;  3HGB A;  5BN4 A;  4EVO A;  5BR8 Q;  2M9V A;  1X55 A;  1PH6 A;  5FLX c;  3DWQ A;  1Q1B A;  1VQF A;  2QKI C;  2OCE A;  2KCN A;  1HR0 Q;  1C7Y A;  4LWC A;  3DWP A;  4O1N A;  4ID6 A;  1EQV A;  1VF7 A;  3OIQ A;  3I4M B;  2ZTD A;  1F2Y A;  3E9I A;  2A68 D;  3FPP A;  1OXS C;  4JG2 A;  3S14 H;  3UI2 A;  1I6V C;  2JEB I;  5M5Y B;  3S17 H;  1HNZ L;  4HN7 A;  2LY7 A;  5C6A A;  1WVL A;  1HPC A;  1KDA A;  1CHP D;  1IZ6 A;  1FYC A;  2VQE L;  2LXJ A;  3CPF A;  4R4T A;  1VQB A;  4ZUI A;  2Q2U A;  3OMG A;  1HNW L;  1J9O A;  4V0B A;  2E2H B;  4KHP L;  4ZRZ A;  1QWY A;  1IBK Q;  3GTO B;  1WCM H;  2E5L L;  2VS1 A;  3DEP A;  4DV2 L;  5IGF A;  3HS0 C;  1EY7 A;  3HOZ B;  4MN3 A;  4LF5 L;  1SYC A;  3Q23 A;  2F4V Q;  1NSN S;  3BZD B;  5A2Q L;  1JIC A;  1SMY D;  3SXH A;  1HFN A;  4U68 A;  2EY2 A;  3CRK C;  1XWE A;  5EBD A;  3MVV A;  4DPG A;  3D3R A;  1IL2 A;  4A3E G;  5C4X G;  1ESR A;  2PYK A;  1C0A A;  3I4O A;  1ASY A;  5CMD A;  3BYT B;  2JA8 B;  1T5X D;  4IUN A;  1PFB A;  1KLG D;  3BVM A;  2K01 A;  4C2M B;  1STG A;  3BG3 A;  5I9O A;  4JI2 Q;  4R9W A;  3RUZ A;  2OT2 A;  2F1M A;  1PLF A;  3RLF A;  2FMM A;  2VQF L;  3J80 E;  3H0G B;  5CR3 A;  4N9P A;  2KCC A;  5K36 H;  5IT9 L;  4GKJ Q;  2WAC A;  3IKJ A;  3ZYY X;  1G2S A;  3KJO A;  3A56 A;  2AKW B;  1NE3 A;  2K14 A;  4IN3 A;  2Y0S E;  2VUM H;  2XGT A;  3K8A A;  1ENF A;  1O78 A;  4XQQ A;  1Y69 U;  1VQ5 A;  1HZA A;  3J7Z C;  1HNX L;  2ENB A;  1J5E Q;  1S5D D;  1K3R A;  1VQ4 A;  4G7H C;  3TP6 A;  2XRS D;  4L63 B;  4AQY Q;  1NJI C;  1GUN A;  2B2W C;  2ALY B;  4B3S Q;  4JI6 Q;  2ZM6 L;  3S1N H;  2CQO A;  3C1F A;  4CDD C;  1XMO Q;  3A8J E;  2MO1 A;  4DAV A;  4X65 Q;  4KD4 A;  2QGQ A;  4C3I B;  1OXU A;  3NQI A;  4K5W A;  4X3S A;  4BBR B;  1AFP A;  3AB9 A;  4A3M H;  5C3E B;  3S9W A;  1STA A;  4BY7 H;  4Y7N H;  3URY A;  2Q2I A;  1EY8 A;  5JPM C;  2DJF C;  4JBW A;  2KOL A;  1VS0 A;  4H02 A;  1TY2 A;  3A5Z B;  1SJH D;  4XYO A;  3OSO A;  2ZJP A;  1GUT A;  1NR4 A;  4K8J A;  1YNJ D;  4DXF A;  5I2Y A;  2K75 A;  2F0V A;  3NK9 A;  1QZH A;  2BDO A;  2ICI A;  1GHK A;  1NNX A;  4HJ9 A;  1LAB A;  2VW9 A;  1I4X A;  1Q90 A;  1U4R A;  2BA1 A;  1FGB D;  2KCM A;  4U67 3;  1LTA D;  1TKW B;  4RHS A;  1A63 A;  1S5C D;  4GNX C;  3F2D A;  3J81 L;  3EIV A;  2CH4 W;  4DR6 L;  3CAM A;  2K5D A;  2KEE A;  4DV6 Q;  4HID A;  1I94 L;  2UUB Q;  1HZ9 A;  1YHA A;  1KHI A;  4A3I G;  4IPG A;  3QR8 A;  1TVX A;  5JEA H;  4A3F G;  3S1Q H;  4NMZ A;  4GLA C;  2KEN A;  5KND A;  3T16 A;  4A3K G;  2OTL A;  1H9S B;  1I6H H;  5M3F H;  1QVC A;  3PV0 A;  4NP5 A;  2Q2H A;  5GQO A;  4RG1 A;  2EYH A;  3EBE A;  3K7U C;  3SE0 A;  3TME A;  3HEJ A;  1H9K A;  3K59 A;  4BA2 I;  1U0L A;  1EQT A;  2EXD A;  2BH8 A;  1PRT B;  4GN4 B;  4LF8 L;  2PO4 A;  2KHJ A;  2XRQ D;  4CDC C;  4JI7 L;  2EJF C;  2K50 A;  1BXT A;  3MXN A;  4H0L C;  4JOI A;  2V1C C;  2B2T A;  5HY6 A;  3FMC A;  1YNN D;  3Q22 A;  1CFM A;  5IWA Q;  2A68 C;  1D5Z C;  4FYD A;  4S3S A;  5KEE A;  2OTJ A;  1Y1W G;  1UEB A;  1TS4 A;  2GA4 B;  4A3G H;  1QUQ B;  2HCI A;  4OX9 L;  3VDY A;  3P1H A;  4POF A;  3UDI A;  5CBA E;  2ID0 A;  3HOV G;  4IFD H;  2EOT A;  3A0J A;  3K6O A;  3C46 A;  3TDQ A;  4DV7 L;  2QCP X;  1PH5 A;  1FVI A;  4IOA A;  4C3H G;  1EYC A;  2BDN A;  5JJL A;  3T1Y L;  3PO2 G;  2HHH L;  3OW2 A;  4L5T A;  4O42 A;  1Q82 C;  3SK4 A;  3J81 c;  4POG A;  2K28 A;  1KQS A;  3HOY G;  1H95 A;  1YNX A;  2HQE A;  3GTM H;  3TP7 A;  4YY3 L;  1XTC D;  1WTO A;  3A55 A;  1QCB D;  1WTH A;  1HQM C;  1N33 L;  3HOW H;  1CHQ D;  4A3L G;  2WP8 J;  3JC6 6;  1BCP D;  1U4M A;  5C44 G;  5CC4 A;  1MSG A;  1IXR A;  1UAP A;  3JAM i;  5CV8 A;  1LLR D;  2F0I A;  3KF8 A;  4ABN A;  1WOC A;  1OXT A;  1XNQ Q;  4KJO A;  1AEX A;  5I9P A;  1I50 H;  4DK0 A;  2XWB B;  4FF3 A;  3S16 B;  4GKK L;  2RDF A;  3HP3 A;  5M5X H;  1O80 A;  1CKM A;  1ILQ A;  1YIT A;  1EIG A;  4DFA A;  4K0K Q;  2E2I H;  1PH9 A;  4A93 G;  2RBM A;  1EIF A;  3I91 A;  3OTO Q;  2PZW A;  4NB3 A;  4BBS H;  1YEZ A;  2OXP A;  4FO2 A;  5J39 A;  4YCV A;  1PH2 A;  2WB1 E;  3S2D H;  1L1O B;  1L0Y B;  5ELC A;  1YBY A;  4EX5 A;  3BU2 A;  2Q8T A;  4JI4 L;  2G9H D;  3K5M A;  1SND A;  3CD6 A;  4J6H A;  1SEB D;  4JYA L;  1YNJ C;  3PO3 G;  4DV1 L;  3WOF A;  3PIO 3;  1XPR A;  2JJQ A;  3G71 A;  4QCL A;  2B63 G;  3CQZ B;  4YHH L;  1L0W A;  5LMU L;  1E0B A;  3G6E A;  1VMC A;  4NXN L;  4DUZ L;  1JB7 A;  2KJX A;  3VYT A;  3J80 L;  4GOP B;  2D62 A;  5J3B A;  3IAY A;  4ZK9 B;  5T1G A;  4B3R L;  2EY6 A;  1HXY D;  1A62 A;  4CJ1 B;  1E1O A;  3PIP A;  4DV3 L;  3B6Y A;  4OL7 A;  2E74 C;  4JI5 L;  1PH1 A;  4ZKC B;  1STY A;  3GD7 A;  4RGM A;  3PUZ A;  4RWS C;  5AJ3 L;  5IGD A;  4X62 Q;  2UXD L;  2JP1 A;  2QW7 A;  2EJG C;  5IYC H;  5TSS A;  5EBC A;  3PUW A;  1RL2 A;  3F2C A;  5M3M G;  2L11 A;  3K5O A;  3T13 A;  4LAA A;  1A3V A;  3MFG A;  3TZU A;  4X66 L;  4BBR G;  1K3B C;  2EIF A;  2EYO A;  3NHH A;  2E75 C;  4OGQ C;  5GAD C;  2B39 A;  5DNF A;  2UUA Q;  2IL8 A;  4JOI C;  2B2T C;  2EPB A;  3R2T A;  3D6C A;  4PMB A;  1LT5 D;  4PZ8 A;  4DR4 Q;  1PYS B;  1MHW C;  3S2H B;  1I4R A;  1DD2 A;  4A3E B;  4GLV B;  5GAH C;  3DM3 A;  5C4X B;  1TWF B;  2F0Q A;  3NBH B;  3LNN A;  4OWT B;  4L8J A;  4CHT B;  3I90 A;  1WJJ A;  4B3M L;  1B44 D;  4LF6 L;  1JB3 A;  1ZYR D;  1KNE A;  4N8F A;  4V19 0;  1YNN C;  3OHX C;  3H15 A;  3S15 B;  4B3T Q;  2ZTC A;  4CJ2 C;  5ELF A;  2ZJR A;  5BN5 A;  4OEM B;  4NXM Q;  3F1Z A;  1V1P B;  1GXD C;  2EYM A;  3OPO A;  1LTS D;  2D0O A;  1DCZ A;  4YWL A;  4HTH A;  2RA4 A;  3STB D;  3AYH B;  1IBM Q;  4OIJ A;  3I4N G;  1MI2 A;  3CF5 A;  1OXX K;  1LT3 D;  5IE8 A;  2R92 B;  3G48 A;  4KY7 A;  5ISR A;  5ELD A;  2RSN A;  2DGY A;  1QE6 A;  1DON A;  3E9H A;  3G4S A;  5I4D A;  3CKI B;  1D8L A;  1VQC A;  3J80 c;  2I0Q A;  2R7F A;  1FJG Q;  2HIX A;  3CCL A;  4K6L A;  4RA8 A;  4MNO A;  1L2F A;  4OEL B;  1S5F D;  1YI2 A;  1LM0 A;  4DV0 Q;  5LHY 1;  4DUY L;  3HOU H;  5ELB A;  3P20 A;  1K8G A;  1TWH H;  1X3Q A;  2E2D C;  1GOZ A;  1BCP C;  1TWA B;  4A3J H;  4ME3 A;  1N34 Q;  1YHQ A;  1KAW A;  3A5U A;  1STB A;  4B9X A;  1WTP A;  4TVA B;  3I56 A;  3V96 A;  1B7Y B;  2OQ0 A;  3GV3 A;  2VUM G;  2JA7 H;  2XTI A;  2VNU D;  2L15 A;  4IFD I;  1Y8N B;  3CCM A;  4EGV A;  4BS9 A;  1X3F A;  2PMZ B;  3TN2 A;  5M5W H;  1CUK A;  1G51 A;  2KHI A;  1UNS A;  5JPN C;  1KLU D;  4KI0 A;  2C5C A;  3TP5 A;  4C1N K;  1BNZ A;  3EA6 A;  3D6W A;  2QDL A;  2UU9 Q;  2O4X A;  3J81 i;  4LF4 L;  2J7Z A;  4DAM A;  4A3M G;  1V43 A;  3PUY A;  4KD3 A;  1F9P A;  3VA7 A;  4A3I B;  1H9S A;  4X3U A;  3SR1 A;  3C1E A;  3RR5 A;  1STE A;  2F0P A;  2JA9 A;  3U9S A;  4JC0 A;  4A3F B;  2LSS A;  1VQG A;  5LMN Q;  4A3K B;  1BBW A;  3I7F A;  1TS3 A;  3I8Z A;  1GD7 A;  2UXC Q;  3UE1 A;  1DGS A;  1EYD A;  3HG9 A;  3SK8 A;  4XQJ A;  1TWC B;  1B3Q A;  3KLR A;  1ZKO A;  2PQA B;  3NE5 B;  4JI8 Q;  2FXQ A;  3I4M H;  2LXK A;  3EVQ A;  1X54 A;  3PGZ A;  2PI2 E;  5M5Y H;  4AH6 A;  1I3Q B;  2F3W A;  2PMZ E;  3TQY A;  3M4P A;  2D9U A;  4IUU A;  4RHR A;  3CW2 C;  4ALP A;  3DLL A;  2E2H H;  3DHQ A;  1ENC A;  2KA7 A;  1HUN A;  2N49 A;  4OO1 H;  1LTR D;  2BOS A;  4DAP A;  1E3P A;  1W6J A;  1Z7T A;  4BY1 G;  1Y1W B;  5G3L F;  4XYQ A;  4JBM A;  5JEA G;  3CCJ A;  1JOK A;  2KBN A;  4K5V A;  3M3Y H;  2UXB L;  5IP9 G;  1TR5 A;  4QMG A;  3HOV B;  2FFK B;  4DV4 L;  5EQ0 A;  1G29 1;  2F0D A;  1VQ6 A;  2DN8 A;  3ND9 A;  1F77 A;  3UDF A;  1M1K C;  2JA8 H;  3DXJ C;  2B3G A;  4C3H B;  1SFO B;  3PO2 B;  4FP5 D;  4LW1 A;  4DN4 M;  4HSV A;  1GKH A;  5C5M A;  1SE4 A;  1BDO A;  4EQO A;  3PIP 3;  3K0Y A;  3PCO B;  2K05 A;  1RCV D;  2Z9H A;  3GTL B;  2MHV A;  3TP8 A;  2I46 A;  3H0G H;  1QG7 A;  5CYU A;  4LMQ D;  1CI3 M;  1XNR L;  1S4Z A;  4DA2 A;  1B1Z A;  4XIG S;  5C0X G;  1ZYR C;  4DNR B;  4HIO A;  2EXZ A;  3KYH C;  5EJW A;  3K7A B;  1UUP A;  5M9O A;  1X32 A;  4IO9 A;  4PG3 A;  2K33 A;  5C44 B;  2N88 A;  5JOB A;  2AQ1 B;  1JR0 D;  1Y8P B;  1X9N A;  3STB C;  4LFB L;  4HJA A;  4LK1 C;  5JJZ A;  1D5X C;  2MGS A;  3NUC A;  1AW7 A;  4IFD G;  3KLS X;  4RCN A;  3R3O A;  2D0P A;  2IT1 A;  4DR5 L;  4A3C H;  2OWO A;  4C3I H;  4IAL A;  4G7O C;  2CH4 A;  2B8G A;  1PYW D;  5C3E H;  1YJN A;  3D4R A;  4FXG C;  1GJX A;  3N52 A;  4LUZ A;  2EYF A;  1AE3 A;  5IP7 H;  2MQH A;  3VR2 A;  3CC2 A;  1CKO A;  1XX8 A;  3JAM c;  4ZKB B;  4A93 B;  2PQE A;  1M90 C;  3RZO B;  2WII B;  3MA2 B;  3J7Y W;  2NZO A;  1QZG A;  4B08 A;  2GVB A;  3HOW G;  2QEX A;  1EIY B;  2VY3 A;  3H94 A;  3HZX A;  3X3N A;  2SDF A;  2O5I C;  3H3V C;  2F0S A;  3HOX G;  1VQ9 A;  3IRB A;  1SRO A;  3H3V H;  2F0F A;  1X6O A;  2AWO A;  2K5V A;  1N32 L;  1EFW A;  1O7Z A;  5BR8 L;  4UY8 C;  1B9N A;  3S1M H;  5HGQ A;  3PO3 B;  2EY5 A;  1HTL D;  1L0X B;  2Q8I B;  4AYB G;  1N9W A;  2JEA I;  2B63 B;  4GOP A;  1HR0 L;  1GUW A;  3SK6 A;  5DM6 3;  2K5H A;  1LT4 D;  1R9T B;  1CQF A;  4KHV A;  5ELN A;  1OTC A;  1VF5 C;  1HCZ A;  1JMC A;  4X64 Q;  4NPS A;  3J80 i;  1UEA B;  3ITP A;  2A6E D;  1SRU A;  2L12 A;  4QB4 A;  5JVH 3;  1TT2 A;  2F3I A;  3HKS A;  4KY6 A;  2R92 G;  1IBK L;  4JV5 Q;  3S1R H;  1FNV A;  4ODG A;  5IOD A;  1BVS A;  1Q12 A;  3M4O H;  2L1B A;  4FF4 A;  1PZJ D;  1N36 Q;  2F4V L;  3K58 A;  4EQP A;  3PIO A;  1KIX A;  1NBW A;  5JAV A;  4HJ7 A;  4UAI A;  5M3M B;  4RGO S;  3TS2 A;  4KKT A;  2IWH A;  4O0A A;  3KUP A;  4BXX G;  3NBH A;  3CCQ A;  5FJ8 H;  2RHS B;  4FDB A;  1PVO A;  1TU2 B;  4JI2 L;  4IUR A;  1SJE D;  1SMX A;  4A3D H;  1VQP A;  1VQA A;  3HKZ G;  3E6Z X;  3ERO A;  4LF7 Q;  4GS3 A;  1WTQ A;  1VQD A;  1YZ6 A;  1CKN B;  4GKJ L;  3CPW A;  1QIL A;  1PRT F;  3FKI G;  2NZH A;  1PH7 A;  1PH3 A;  2JK8 A;  3MHB A;  4WRD A;  4KY5 A;  3S17 B;  4MTN A;  3FP9 A;  1JE4 A;  1VQO A;  4K6D A;  1JWM D;  4WOR A;  1NTG A;  1J5E L;  4APV A;  3OOC A;  4HIK A;  3I4N B;  1CSQ A;  3GTJ H;  5C4J B;  4HSP A;  1GHJ A;  1TII D;  1Y1V G;  1HZB A;  4AQY L;  3GTP B;  4B3S L;  4JI6 L;  5JEA J;  1KXL A;  1W2B A;  3H6M A;  3W3A A;  3V2T A;  1E2Z A;  1XMO L;  3I2Z A;  2SEB D;  4X65 L;  2QEJ C;  3I73 A;  1WD1 A;  1DOL A;  3KLS A;  2M2L A;  5IT9 c;  2FMC A;  2YV5 A;  4HMJ A;  5KNB A;  1GUS A;  1B70 B;  2NB0 A;  2A5H A;  1SLJ A;  5IYB H;  4P74 A;  1Q1E A;  5CV5 A;  3J7A 5;  2YU9 B;  5DAU A;  1A0I A;  3NTH A;  4OO1 I;  1DOM A;  4G4K A;  4RH6 A;  1RF2 D;  1SYE A;  1ZEQ X;  3VR5 A;  2NN6 H;  5C0X J;  2EVB A;  4TSS A;  3S16 H;  1RDP D;  1C4Q A;  1E24 A;  3T51 B;  2VUM B;  1HR0 W;  3BDL A;  3CU7 A;  1SDF A;  5ELO A;  1V1O A;  3ULJ A;  4L5R C;  2BA0 A;  3T1Y Q;  4IFD J;  3ICE A;  4GLX A;  3D31 A;  3QOL A;  5LL6 S;  4JI0 Q;  4DV6 L;  2RF4 A;  1PFM A;  2UUB L;  4L5S A;  4KKS A;  1AN8 A;  2NVX B;  2ZXO A;  3AFQ A;  4LFA Q;  1FR3 A;  1ICF B;  2M00 A;  1ASZ A;  2BCO A;  4CDF C;  1VQH A;  1EFI D;  3UDX A;  2GVA A;  4A3M B;  2Z1C A;  3CCU A;  2UUC Q;  2LMC B;  3M4Y A;  2A6H D;  4CBV A;  3MAQ A;  5IOC A;  2Z6K A;  2AUK A;  3CQZ H;  1P16 A;  1SYB A;  3KFU A;  3LGJ A;  1NMG A;  1CA5 A;  3UE0 A;  3OMC A;  2PQA A;  5IY0 A;  3M4Q A;  5C5L A;  1IBL Q;  1AZP A;  4MIU A;  1PDQ A;  1HH2 P;  4QJF A;  4R8N A;  3SVM A;  3BZK A;  1E1T A;  4DR7 Q;  1SN8 A;  2R61 A;  2E8G A;  2E2J B;  1LTI D;  3ERQ A;  3KOJ A;  2RQX A;  4NW2 A;  1I4P A;  5IWA L;  3EFX D;  3MZ5 A;  1TS5 A;  4C56 C;  1FD7 D;  4ZLT F;  2SNM A;  3RNU A;  4G57 A;  2B8F A;  4L5Q A;  5E3F A;  5FO8 B;  1U9R A;  1KC8 C;  2K1B A;  2A6E C;  3MXP A;  2RCN A;  2FHT A;  1GUO A;  1FNW A;  4KHZ A;  4GNX B;  4QUC A;  4DR1 Q;  3NXW A;  1JE5 A;  1J6Q A;  2IPK D;  3OW7 A;  4OON A;  3T1H Q;  1IYV A;  2JA6 G;  4BY1 B;  1IYJ B;  3TBI B;  1B53 A;  1LV9 A;  3L3O C;  2J4X A;  4A4I A;  3HFZ B;  5T1I A;  3H3V I;  4EQ5 A;  2H5X A;  4LFC Q;  1BBX C;  2IX0 A;  4DR3 Q;  4DK6 C;  2R93 G;  1EU4 A;  3R93 A;  3S2H H;  1RJT A;  4KJN A;  4A3E H;  5D3I B;  5C4X H;  4YCW A;  3KF6 B;  3SHL A;  1A6X A;  1H9R A;  1HHV A;  5E1F A;  2K32 A;  1GUG A;  4H44 C;  3DWA A;  2MUY A;  1U5K A;  2IX3 A;  1HA6 A;  3S15 H;  3ERS X;  2NVT B;  4DR2 Q;  4FXD A;  1PH8 A;  1TY0 A;  1YIJ A;  3D0F A;  1JQY D;  5COR A;  1MBY A;  5IIF A;  1WTR A;  3V05 A;  2EYL A;  4A75 A;  1IHZ A;  1Q8I A;  2NWG A;  5G3L D;  4UP9 A;  3WWV A;  3RZD H;  1YHB A;  4P2C B;  1QVF A;  2XIW A;  1MGS A;  2N78 A;  3GV6 A;  4LF9 Q;  1XNQ L;  2F0L A;  1KD1 C;  1H9J A;  4OWW B;  1N8R C;  4XDX A;  2EYP A;  3Q6S A;  2A73 B;  3CCV A;  1Z47 A;  1D5M C;  1MD2 D;  1YVC A;  4K0K L;  2QDB A;  3DM1 A;  3K5N A;  1CZW A;  3PUV A;  3EQL C;  1IKL A;  3BYY B;  2R7Z G;  3QOJ A;  4UP8 A;  5J1Z A;  5KYI A;  2K4K A;  3OTO L;  3TRZ A;  5CV9 A;  2QF7 A;  3NP8 A;  1WD0 A;  2BH2 A;  1EIH A;  5GRO A;  2JA5 G;  3GTM B;  1WYD A;  2NVY B;  3HOW B;  1XPO A;  2PZU A;  5L37 A;  2KCT A;  1TXY A;  1ZXT A;  2PZT A;  3CRL C;  3HOX B;  4A3B G;  5E4W C;  4ZCK A;  3GTK H;  1JJG A;  3R8B A;  1LYL A;  3PF5 A;  5ELE A;  5COY A;  4F7X A;  4QF4 A;  3TRE A;  3VYR A;  1BUV T;  4AYB B;  1G8Z D;  1G2T A;  2ZXR A;  1WTV A;  3OWE B;  2J0T D;  2WAQ G;  3GTQ B;  4YIJ A;  1QVG A;  3L7Z C;  3BDC A;  1VQM A;  3NWT A;  2RSO A;  4JW0 A;  2E2I B;  4A3I H;  3G7L A;  3PF4 A;  3A7A B;  1AE2 A;  1VQK A;  4JCV E;  4J15 A;  4X62 L;  1SNP A;  1QOH A;  1WCM G;  2ZTE A;  4A3F H;  2Z6K C;  5IYD H;  1QB5 D;  3NWS A;  3D8G A;  4A3K H;  1U4P A;  1KNA A;  4X6A H;  3NEN A;  1STH A;  2F03 A;  2NBF A;  3EN2 A;  2AMC B;  2A6H C;  3TEH B;  5E4X A;  4H7B A;  2WIN B;  3BDO A;  1VQE A;  1ENA A;  1RTN A;  1TWC H;  2NN6 I;  3NPP A;  2JE6 I;  3AEV A;  2UUA L;  1RHP A;  3CXC A;  4MTK A;  4DNT B;  4DR4 L;  1I3Q H;  2F4I A;  1CSP A;  4WFN 3;  3NEM A;  5FO9 B;  1K0S A;  2I5L X;  4KN4 C;  4CKE A;  3CCS A;  4UP7 A;  2CHB D;  1SYF A;  4AYB E;  1D2B A;  2XVS A;  2L0C A;  4WJ3 M;  1TWG B;  4B3T L;  1BOS A;  5NUC A;  5HUR A;  3T56 B;  3HKZ B;  5K36 G;  4NDX A;  1Y1W H;  4NXM L;  4C3J H;  4IJL A;  4PNY A;  1PA6 A;  4JI1 Q;  4CJ0 B;  2HQL A;  2G9D A;  5DEH A;  2KED A;  3FKI B;  1MJE A;  1IBM L;  3FVQ A;  2EYJ A;  5CV4 A;  3D4W A;  2HIV A;  2DY8 A;  4DXG A;  4XQN A;  1EZ8 A;  3LX0 A;  1CM9 A;  3M9B A;  3P7J A;  3D4D A;  4C3H H;  1SFO H;  3PO2 H;  1VMP A;  2PPB C;  1Y1V B;  3K0X A;  3A54 A;  3M7N A;  4FNF A;  4NKL A;  3GTL H;  3NBI A;  4DV0 L;  4GN3 B;  4DU9 A;  2CVR A;  5CV6 A;  2CWP A;  3HOY H;  2RCF A;  4C1N I;  4BY7 G;  5I6W A;  4A3L H;  4HED A;  3K7A H;  1PRT D;  4A3D G;  1B2T A;  1A3U A;  3AMU A;  2NVQ H;  1Q3L A;  1EOV A;  1Z9F A;  5C44 H;  1JWS D;  2WFW A;  4ILW A;  1N34 L;  1U4L A;  1XXG A;  2F0T A;  3J81 E;  4R1J A;  3HKZ E;  2O2L D;  3ZJY C;  2Q8R E;  1UE1 A;  4UDU C;  5A35 A;  1B50 A;  3UDG A;  3AU7 A;  3ER0 A;  4JI3 Q;  3CC4 A;  1ILP A;  1XMQ Q;  4DV5 Q;  4MHE A;  1K83 B;  1XPU A;  2SNS A;  3MXG A;  2WV6 D;  3MTS A;  4XXE A;  2NTS A;  3MC0 B; 
#chains in the Genus database with same CATH homology
 4AIM A;  2ES2 A;  2UU9 L;  1IBK L;  4JV5 Q;  3S1R H;  3A0J A;  3GTO H;  4DV7 L;  4A3C G;  1QUQ A;  3F8T A;  1FVI A;  1PH5 A;  2IX1 A;  1BVS A;  1Q12 A;  3M4O H;  4IOA A;  3HOZ H;  5JJL A;  5C3E G;  3T1Y L;  3PO2 G;  1T9H A;  2HHH L;  3F2B A;  3OW2 A;  5IP7 G;  4L5T A;  1N36 Q;  2F4V L;  4DUY Q;  1EQQ A;  2R6G A;  1Q82 C;  3PIO A;  3KLW A;  3OYY A;  3J81 c;  1SE8 A;  4POG A;  1KIX A;  1NBW A;  4HJ7 A;  1KQS A;  1K8A C;  5DLQ E;  1E7Z A;  5LMN L;  5M3F G;  1E22 A;  4OXP A;  3HOY G;  3TS2 A;  1H95 A;  1YNX A;  3GTM H;  2MO0 A;  3MEF A;  4O0A A;  4OWX B;  4IOC A;  4YY3 L;  1JJC B;  4BXX G;  1N33 L;  3HOW H;  1VQJ A;  2UXC L;  4A3L G;  2B63 H;  2WP8 J;  3JC6 6;  3CCQ A;  5FJ8 H;  2RHS B;  4FDB A;  1PVO A;  4JI8 L;  4C2M H;  5FLM G;  4JI2 L;  2PNH A;  5C44 G;  1SMX A;  3PF4 A;  4A3D H;  1VQP A;  1VQA A;  3HKZ G;  3PUX A;  4LF7 Q;  1IXR A;  4GS3 A;  1K83 H;  1VQD A;  3JAM i;  1YZ6 A;  1CKN B;  4GKJ L;  3CPW A;  3FKI G;  4YWM A;  1WOC A;  1Q8K A;  3GO5 A;  2NZH A;  1OXT A;  1PH7 A;  4R4O A;  1PH3 A;  1XNQ Q;  2JK8 A;  5GAG C;  3U58 A;  4YCU A;  3CC7 A;  1HNZ Q;  3K81 C;  1V1Q A;  4MTN A;  4QQB X;  3FP9 A;  1I50 H;  1OXV A;  2K5N A;  3CME A;  2VQE Q;  1VQO A;  2MNA A;  1CKN A;  4GKK L;  1NTG A;  5M5X H;  1J5E L;  4APV A;  1CKM A;  1V9P A;  1HNW Q;  1YIT A;  1Q86 C;  3GTG H;  4A3G G;  2CKZ B;  4KHP Q;  4HIK A;  1VQN A;  2E5L Q;  1CSQ A;  3GTJ H;  4K0K Q;  5JJK A;  2E2I H;  1NY4 A;  1Y1V G;  4DV2 Q;  1HZB A;  3BZC A;  4AQY L;  1PH9 A;  3CCE A;  4B3S L;  4JI6 L;  5JEA J;  4A93 G;  1W2B A;  4DAY B;  1KXL A;  1UE6 A;  1EIF A;  3FHW A;  4LF5 Q;  4P73 A;  1KRT A;  3OTO Q;  4NB3 A;  1GM5 A;  3HOV H;  4BBS H;  2IHF A;  1YEZ A;  5M3M H;  4HIM A;  1XMO L;  3I2Z A;  5C0X I;  4X65 L;  4YCV A;  1PH2 A;  3RLN A;  4BBR H;  2WB1 E;  5IT9 c;  3KF6 A;  3S2D H;  4TQU S;  2YV5 A;  1L1O B;  4XTC S;  2CFM A;  1YBY A;  3KDF A;  3BU2 A;  5EAY A;  4EX5 A;  1VQ7 A;  1FJG L;  4JI4 L;  1B70 B;  2N3S A;  3CD6 A;  3Q8D A;  4LUO A;  5H1S E;  1S3O A;  1K73 C;  1EWI A;  1SLJ A;  2RHQ B;  5IYB H;  4JYA L;  4P74 A;  1Q1E A;  3PO3 G;  4DV1 L;  3J7A 5;  4PZ6 A;  1L1O A;  1XPR A;  2JJQ A;  3G71 A;  1G6P A;  4QY7 A;  2GN5 A;  2B63 G;  1A0I A;  4YHH L;  1L0W A;  5FJ8 G;  5LMU L;  4OO1 I;  2VQF Q;  4WJ4 A;  5C0X J;  3G6E A;  3MXN B;  4NXN L;  4DUZ L;  1JB7 A;  4QL5 A;  5FLM H;  3S16 H;  1Q46 A;  4GOP B;  2D62 A;  1E24 A;  4IPD A;  5J3B A;  2DUD A;  1A8V A;  2YTX A;  4HJ8 A;  1HR0 W;  4B3R L;  3I4N H;  4JI1 L;  5C4J H;  3CCR A;  3GTP H;  1A62 A;  1HNX Q;  1E1O A;  5ELO A;  3PIP A;  3ULJ A;  4DV3 L;  4L5R C;  2BA0 A;  3B6Y A;  5E7N A;  3T1Y Q;  4IFD J;  3CP0 A;  4JI5 L;  4GLX A;  3D31 A;  1PH1 A;  3ICE A;  4DK3 C;  1W3S A;  4JI0 Q;  4PZ7 A;  3GD7 A;  2JA6 H;  4DV6 L;  1C9O A;  3PUZ A;  4YWK A;  5AJ3 L;  2RF4 A;  2ZM6 Q;  2UUB L;  4L5S A;  4X62 Q;  2UXB Q;  2UXD L;  3AFQ A;  4LFA Q;  2QA4 A;  5GAE C;  5IYC H;  4DV4 Q;  4R4C A;  4Y52 H;  4IPC A;  3PUW A;  1ASZ A;  1YJW A;  2R93 H;  1RL2 A;  1VQH A;  1EYG A;  4A93 H;  3UDX A;  3F2C A;  2GVA A;  5M3M G;  3PSI A;  4BBS G;  3RZO H;  3CCU A;  1PFS A;  2UUC Q;  3E0E A;  2I5M X;  2WB1 G;  3BJU A;  3L2P A;  4X66 L;  1EUJ A;  4BBR G;  2YU9 H;  2EIF A;  1PYB A;  2Z6K A;  1AH9 A;  2AHO B;  5GAD C;  2UUA Q;  3CQZ H;  1P16 A;  4JOI C;  4LNQ A;  3KFU A;  3KJP A;  3LGJ A;  1NMG A;  4PZ8 A;  4DR4 Q;  3UE0 A;  1PYS B;  5LMN W;  2PQA A;  2VZA A;  1LTL A;  4GLV B;  5IY0 A;  5GAH C;  3DM3 A;  3M4Q A;  1XNR Q;  1IBL Q;  3NBH B;  5IYB G;  4OWT B;  1X65 A;  1HH2 P;  1MJC A;  4QJF A;  3NEL A;  3U50 C;  3BZK A;  1E1T A;  1WJJ A;  1YJ9 A;  1XJV A;  1SN8 A;  4B3M L;  4LF6 L;  1Q7Y C;  4DR7 Q;  1LUZ A;  2E8G A;  1HZC A;  2CWA A;  3PO3 H;  1EQR A;  3H15 A;  4B3T Q;  2NN6 G;  2ZTC A;  3KOJ A;  1XTD A;  3W1G A;  5IWA L;  2ZJR A;  2N8N A;  4NXM Q;  3F1Z A;  1BBU A;  1JJ2 A;  4LFB Q;  3KF8 B;  1R9T H;  2D0O A;  4YWL A;  1FL0 A;  3STB D;  1WFQ A;  3AYH B;  4JI3 L;  4BA1 I;  3RNU A;  4L5Q A;  4X64 L;  1KC8 C;  1IBM Q;  1XMQ L;  1UE5 A;  3CF5 A;  4DV5 L;  2NVX H;  3I4N G;  1OXX K;  2RCN A;  5IE8 A;  4DR6 Q;  3G48 A;  1Q81 C;  4KHZ A;  2IHE A;  4GNX B;  2DGY A;  2ASB A;  1VCI A;  4DR1 Q;  4DR5 Q;  3AQQ A;  1JE5 A;  3W5O A;  1J6Q A;  1HJP A;  2C35 B;  4O2D A;  1I94 Q;  4OON A;  3T1H Q;  3E9H A;  3G4S A;  4P71 A;  3U4V A;  2JA6 G;  2R7Z H;  4JV5 L;  4JBK A;  1IYJ B;  1D8L A;  1VQC A;  3J80 c;  3L0O A;  2I0Q A;  3S1N H;  4GNX A;  2R7F A;  3HOW G;  1FJG Q;  2HIX A;  3CCL A;  4A4I A;  2YYZ A;  3HFZ B;  1L2F A;  4MNO A;  4RMF A;  4EQ5 A;  2H5X A;  5IYC G;  4LFC Q;  1GO3 E;  3H3V I;  1YI2 A;  1K0R A;  1MKH A;  5JJI A;  2IX0 A;  4DR3 Q;  1LM0 A;  2AWN A;  1WI5 A;  4DV0 Q;  1N36 L;  4LFB L;  4DUY L;  1UWV A;  4DK6 C;  2JA5 H;  3HOU H;  2R93 G;  3S2H H;  1PH4 A;  4A3E H;  4MZ9 A;  5C4X H;  4YCW A;  3KF6 B;  4HJ5 A;  2ZJQ A;  1K8G A;  3ULP A;  1TWH H;  3KDF B;  4DNI A;  2E2J H;  1U5K A;  1SR3 A;  4LF8 Q;  4A3B H;  2YTY A;  1VQ8 A;  2F52 A;  3S15 H;  1X3E A;  1N32 Q;  3ERS X;  3U4Z A;  4A3J H;  4DR2 Q;  4JI7 Q;  1PH8 A;  5BR8 Q;  2YTV A;  4ME3 A;  1N34 Q;  2B29 A;  1YHQ A;  1X55 A;  1KAW A;  1YIJ A;  1PH6 A;  3A5U A;  3D0F A;  2VL6 A;  5FLX c;  4QGU A;  1Q1B A;  4TVA B;  1VQF A;  3I56 A;  2OCE A;  3GDE A;  4A75 A;  1B7Y B;  2OQ0 A;  4UP9 A;  1HR0 Q;  1C7Y A;  3WWV A;  4R4Q A;  4LWC A;  1YHB A;  2A1A A;  3RZD H;  4LF7 L;  2VUM G;  3W1B A;  2JA7 H;  2XTI A;  2VNU D;  2L15 A;  2Q2T A;  3CCM A;  2ZTD A;  1QVF A;  4IFD I;  3E9I A;  4LUV A;  1OXS C;  1X3F A;  2N78 A;  4JG2 A;  4LF9 Q;  5M5W H;  1XNQ L;  3S14 H;  2JEB I;  3UDI A;  1CUK A;  2WAQ E;  1KD1 C;  4OWW B;  1HNZ L;  1G51 A;  3S17 H;  2KHI A;  1N8R C;  1X56 A;  4BY1 H;  1IZ6 A;  2VQE L;  4KI0 A;  3CCV A;  2LXJ A;  3CPF A;  4R4T A;  1VQB A;  2Q2U A;  4OX9 Q;  1Z47 A;  2PI2 A;  2Z0S A;  2R7D A;  1HNW L;  5IYD G;  4KHP L;  2UU9 Q;  1IBK Q;  5IP9 H;  1YVC A;  1WCM H;  2E5L L;  4K0K L;  2VS1 A;  3J81 i;  4DV7 Q;  4LF4 L;  4DV2 L;  3PUV A;  4DAM A;  4A3M G;  2R7Z G;  4LF5 L;  1V43 A;  3PUY A;  4UP8 A;  3OTO L;  2HHH Q;  2K4K A;  3TRZ A;  2F4V Q;  3RR5 A;  2BH2 A;  2JA9 A;  5GRO A;  1L1O C;  4JC0 A;  2LSS A;  1B8A A;  1VQG A;  5LMN Q;  4DPG A;  2JA5 G;  2NVT H;  3HOU G;  1IL2 A;  4A3E G;  1BBW A;  3I7F A;  4R4I A;  3S24 A;  4YY3 Q;  5C4X G;  1UE7 A;  1S72 A;  1C0A A;  1WYD A;  1GD7 A;  3J81 j;  1N33 Q;  3I4O A;  1XPO A;  1Y14 B;  3RN2 A;  1ASY A;  2UXC Q;  3SGI A;  2KCT A;  3UE1 A;  1TXY A;  1DGS A;  4JI8 Q;  2PQA B;  2FXQ A;  4JI2 Q;  4A3B G;  3K80 C;  3I4M H;  1GVP A;  2LXK A;  2A19 A;  4A3J G;  2K52 A;  1X54 A;  3GTK H;  4IJH A;  4IPH A;  1JJG A;  3RLF A;  2VQF L;  3PGZ A;  1LYL A;  2PI2 E;  5M5Y H;  4AH6 A;  2PMZ E;  4GOP C;  3TQY A;  3M85 A;  3M4P A;  3PF5 A;  1KL9 A;  4GKJ Q;  3CW2 C;  3KJO A;  3TRE A;  2AKW B;  1S40 A;  4ALP A;  1NE3 A;  2K14 A;  2JA7 G;  3DLL A;  2E2H H;  2Y0S E;  2VUM H;  2XGT A;  4A76 A;  2WAQ G;  3K8A A;  2N49 A;  1VQ5 A;  2CCZ A;  1QVG A;  4GKK Q;  1HZA A;  1E3P A;  3J7Z C;  1HNX L;  1J5E Q;  3L7Z C;  2ATW A;  1K3R A;  1VQ4 A;  4BY1 G;  1VQM A;  4JBM A;  1FGU A;  5JEA G;  4JI0 L;  3CCJ A;  4AQY Q;  4A3I H;  1NJI C;  2HT1 A;  1I5F A;  2ALY B;  4B3S Q;  4JI6 Q;  1AE2 A;  2KBN A;  2OQK A;  2ZM6 L;  1VQK A;  2CQO A;  4JCV E;  4J15 A;  5IP9 G;  4X62 L;  3M3Y H;  2UXB L;  1WCM G;  2ZTE A;  4A3F H;  2Z6K C;  4LFA L;  1PHJ A;  5IYD H;  4DV4 L;  1XMO Q;  4A3K H;  1G29 1;  4X6A H;  2MO1 A;  3NEN A;  4X65 Q;  1VQ6 A;  2QGQ A;  1OXU A;  2NVY H;  3EN2 A;  3UDF A;  1M1K C;  2JA8 H;  2AMC B;  2B3G A;  3TEH B;  4A3M H;  4PMW A;  2UUC L;  1NMF A;  4LW1 A;  1VQE A;  4BY7 H;  1TWC H;  4Y7N H;  3HOX H;  1GKH A;  2NN6 I;  2Q2I A;  3ULL A;  4JI4 Q;  3PCO B;  2JE6 I;  4JBW A;  3AEV A;  2UUA L;  1VS0 A;  4H02 A;  4JBJ A;  4QIW E;  3CXC A;  3TS0 A;  3A5Z B;  2IY5 B;  4JYA Q;  2ZJP A;  1I3Q H;  3H0G H;  4DR4 L;  4DV1 Q;  1CSP A;  1VQL A;  3NEM A;  3I55 A;  1XNR L;  1IBL L;  4YHH Q;  1TWF H;  4XIG S;  5C0X G;  5LMU Q;  2I5L X;  2K75 A;  4HIO A;  3KYH C;  3CCS A;  3I4M G;  4DR7 L;  4NXN Q;  4UP7 A;  4AYB E;  4DUZ Q;  4IO9 A;  1QZH A;  4PG3 A;  4WJ3 M;  3GTQ H;  4B3T L;  4HJ9 A;  4KLK A;  2VW9 A;  5K36 G;  1Y1W H;  1X9N A;  4NXM L;  4GN5 A;  3STB C;  4C3J H;  4B3R Q;  4IJL A;  2BA1 A;  2KCM A;  4HJA A;  1PA6 A;  4JI1 Q;  2I5H A;  2Y0S G;  1K9M C;  1JT8 A;  2HQL A;  4IFD G;  1MJE A;  2A8V A;  1A63 A;  4GNX C;  4DV3 Q;  1IBM L;  3F2D A;  3EIV A;  4JI5 Q;  4OO1 G;  2HIV A;  2R92 H;  4DR6 L;  1BKB A;  2D0P A;  1O7I A;  3CAM A;  4DKA C;  4DV6 Q;  2IT1 A;  3HOZ G;  5AJ3 Q;  4DR1 L;  4DR5 L;  2MFI A;  4HID A;  3RLO A;  1I94 L;  2UUB Q;  2OWO A;  4C3I H;  4A3C H;  2UXD Q;  3T1H L;  3M9B A;  1D7Q A;  1HZ9 A;  1YHA A;  1KHI A;  4C3H H;  4A3I G;  5C3E H;  4IPG A;  3RN5 A;  1YJN A;  1SFO H;  3PO2 H;  4LUZ A;  5IP7 H;  1AE3 A;  2MQH A;  3K0X A;  3CC2 A;  1CKO A;  4P72 A;  3JAM c;  4A3F G;  3S1Q H;  4GLA C;  2KEN A;  1M90 C;  3M7N A;  1VQI A;  4LFC L;  4LF4 Q;  4A3K G;  2JQO A;  2OTL A;  3GTL H;  4DR3 L;  4DV0 L;  1MIU A;  2NZO A;  4GN3 B;  1QZG A;  1I6H H;  5M3F H;  2GVB A;  1QVC A;  3PV0 A;  2CWP A;  4X66 Q;  2QEX A;  2Q2H A;  5GQO A;  4RG1 A;  1EIY B;  2VY3 A;  3EBE A;  3K7U C;  2JA8 G;  3HOY H;  4BY7 G;  4BXX H;  3HOX G;  1VQ9 A;  4A3L H;  4BA2 I;  1U0L A;  3K7A H;  2EXD A;  4A3D G;  3IRB A;  1KRS A;  2BH8 A;  1SRO A;  2NVQ H;  3H3V H;  4GN4 B;  1X6O A;  4LF8 L;  1TWG H;  2K5V A;  1RIP A;  1EOV A;  1TWA H;  1P8L A;  1Z9F A;  2AWO A;  2KHJ A;  5C44 H;  1EFW A;  3H0G G;  1N32 L;  4DR2 L;  4JI7 L;  4B3M Q;  2WFW A;  5BR8 L;  1N34 L;  4LF6 Q;  4UY8 C;  2K50 A;  3S1M H;  5HGQ A;  4R1J A;  3HKZ E;  4JOI A;  2V1C C;  3ZJY C;  5HY6 A;  4AYB G;  1N9W A;  2JEA I;  4GOP A;  3FKI H;  1HR0 L;  4P75 A;  5IWA Q;  1UE1 A;  3A74 A;  2K5H A;  2EQS A;  1PV4 A;  3UDG A;  5ELN A;  3ER0 A;  4JI3 Q;  1OTC A;  3CC4 A;  4LF9 L;  1JMC A;  2OTJ A;  3CMA A;  4X64 Q;  1UEB A;  1Y1W G;  4NPS A;  1XMQ Q;  3J80 i;  4DV5 Q;  1XPU A;  4A3G H;  3AFP A;  1X3G A;  1QUQ B;  1SRU A;  4OX9 L;  4UPA A;  3VDY A;  4POF A;  1Y1V H;  2F3I A;  3HKS A;  2ID0 A;  3HOV G;  2R92 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...