1I6HH

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i6hH00
4YCVA 2AHOB 1VQBA 2Z0SA 4ME3A 4OX9Q 5M3MH 1HNXQ 2ZJQA 4A3MH 4LFAL 3TS2A 1NY4A 2NN6G 4UP9A 1KQSA 1WFQA 1EUJA 1VQHA 3ERSX 4A3IH 1Y1WG 3ULPA 1J5EL 4BBSH 2UXDL 2HHHQ 3A5UA 4JBJA 1X56A 3CMEA 4HIMA 4YWMA 4HJ7A 3RN2A 4AQYQ 2IY5B 5GADC 4A3FH 4B3SL 2JA7H 2UUAQ 2F4VL 3M7NA 4B3RQ 2IHFA 3CF5A 2ZTEA 1PH3A 1PH5A 3J7ZC 1CSPA 1EOVA 1WI5A 2OCEA 3CXCA 1XMQL 3E9IA 5IP7H 2Q2TA 1KRSA 4A3CG 1NE3A 3JAMc 1A0IA 1Q8KA 3AFQA 1B70B 2AMCB 2PI2E 5C3EG 5C44G 2I0QA 4BY7H 1OXUA 3WWVA 4OX9L 2ATWA 3S2HH 1X65A 4A93H 2OQKA 3GD7A 1B8AA 1K3RA 1NTGA 5M3FH 1Q46A 4FDBA 4YCUA 3HKSA 4JI6Q 5ELOA 2VW9A 1G51A 4R4IA 1K73C 3S1MH 2RHSB 4DAYB 4WJ4A 2HHHL 4LF4L 1HR0L 1XPUA 1LM0A 4MNOA 2AWOA 4NB3A 2VQEQ 2JA8G 1N9WA 1PYSB 1N33Q 1CKNA 4AQYL 1L0WA 5GAGC 1SFOH 4DV7L 1UEBA 4GN3B 4B3RL 4HJ9A 2PQAB 2JEBI 3E9HA 4UPAA 5IYCH 2WAQG 3CPWA 1PFSA 3H3VH 5C4JH 1Q1EA 1VQOA 1LTLA 4BY1H 3PF5A 4QJFA 1GD7A 3HOVG 1A63A 2IT1A 4C3IH 5IYBH 1PH9A 1WJJA 3SGIA 1VQDA 3FP9A 2LXKA 4DR1L 3J81j 3H0GG 3CPFA 1E22A 4A3DH 2E2IH 5M3MG 1I50H 4LF9L 1HZ9A 1K83H 2MO1A 3PSIA 4A3MG 2N8NA 4JI6L 3CD6A 1Q1BA 3CC2A 4DR4Q 1BBUA 3NENA 4A3IG 3L0OA 2CCZA 4BBSG 3KJPA 3E0EA 3RN5A 1JJGA 2UU9Q 1G291 3PUZA 3J80c 3J81c 2K5NA 2CQOA 4L5TA 4P75A 1XNQL 1Y14B 5LMUQ 1E24A 1AE2A 3UE0A 2ES2A 4L5RC 2B3GA 4RG1A 1E3PA 3KF8B 4R4QA 4DK3C 4HJ5A 3BJUA 4A76A 2I5LX 2WB1G 3G6EA 2UUCQ 4JI0Q 1X6OA 2K52A 2K75A 3HFZB 5IP7G 3DLLA 4DR5Q 1YJ9A 1ASZA 4NXML 4JI8L 1ASYA 2NVTH 1YZ6A 4GLVB 4L5QA 5J3BA 1CKMA 4BY7G 2UUBQ 5IYDH 3EIVA 2NVQH 1H95A 3W1GA 1Y1VH 1TXYA 2H5XA 3I56A 4A93G 2A1AA 1MJEA 1I6HH 2UXCQ 2CWPA 2EQSA 4GN5A 4X62Q 5M3FG 4IO9A 2VUMH 1JT8A 1HZAA 2YTYA 4DR6L 1VQJA 1VQEA 1C7YA 1IBKQ 2WB1E 4RMFA 4A3JG 3KOJA 1EQQA 4A3CH 4JI7L 1FL0A 4JYAQ 4KHPQ 2R7DA 4X66Q 5EAYA 4HJ8A 5IYCG 5HY6A 1FJGL 1I94L 2JA5G 2GVBA 2NN6I 2I5MX 1EIFA 3HKZG 4DUZQ 1E1OA 1CUKA 1GKHA 4BY1G 3GTLH 4IFDG 1KL9A 3F1ZA 2MQHA 4MTNA 1K9MC 1FGUA 5IYBG 3CCQA 3UDXA 1PYBA 2YU9H 2JA8H 3F2DA 1GO3E 2UUBL 3CCUA 4IOAA 4AIMA 1HH2P 2HIVA 2KCTA 2QGQA 3CAMA 4JI1Q 5C0XI 4PZ6A 5AJ3Q 2ZJPA 3CCRA 4DUYL 2EIFA 2ZTCA 4X62L 1SROA 1WYDA 1IZ6A 4C3JH 1QZGA 4DV6Q 1TWCH 1VQ4A 4POFA 1N32Q 1B7YB 1PA6A 3FKIG 4DV0Q 2L15A 1HZBA 3CP0A 2B63G 1UE1A 5GAHC 1PH1A 5JEAG 4A3DG 3H0GH 3HOZG 1PH2A 1XTDA 1CSQA 2HQLA 4ALPA 3PO2H 4DUZL 1VQPA 3M9BA 4DV2L 4AH6A 1TWHH 2AKWB 1IBLQ 1Z9FA 2IX1A 3KJOA 4HIKA 4JI5Q 3PUWA 4L5SA 4OXPA 4GNXA 2CKZB 4P73A 1OXXK 3OW2A 2JEAI 3I4MH 5IYDG 1JMCA 4Y52H 1TWFH 3RLFA 1Y1VG 2A8VA 3RR5A 5BR8L 2WFWA 4EQ5A 1HZCA 3S1RH 4DV6L 1PH6A 1RIPA 4GNXB 1K8GA 1YHAA 2VUMG 2A19A 4A4IA 1HNWL 3K0XA 1JB7A 1V1QA 4DR2Q 4AYBG 4TVAB 2JQOA 4OWTB 1XMOL 3ICEA 5C4XG 3PUXA 3CC4A 2VY3A 4GKJL 2JA6G 2K4KA 1E1TA 4JI2Q 4GKKQ 1VQ7A 1HNXL 1MIUA 2ZTDA 2Z6KA 2EXDA 1IBLL 5FLMH 2F3IA 1EYGA 3PUVA 4JI5L 3CCJA 2PQAA 1Q86C 4QGUA 3L2PA 2NVYH 4AYBE 2BH2A 4A3JH 1XPOA 2ALYB 1Q12A 3BZCA 3NBHB 2QA4A 4JV5Q 1FVIA 3CCEA 4B3MQ 1M1KC 1X3GA 2UUAL 3JAMi 4YWKA 2JA5H 1SN8A 4NXNQ 2KBNA 2LXJA 3EN2A 1UE5A 3PO3H 1A8VA 2ID0A 1N36Q 1VQNA 2PNHA 4EX5A 4DV4Q 5GAEC 3A5ZB 4WJ3M 5IWAQ 4JC0A 2IX0A 4JOIC 2XTIA 3RLOA 3I4NH 1TWGH 3LGJA 2JK8A 4HIDA 2VQFQ 1GVPA 2R7ZH 1YI2A 1YJWA 3PO2G 4IPGA 1YHQA 2WAQE 4PMWA 1NMGA 1WOCA 4MZ9A 4DK6C 1MKHA 2GN5A 1A62A 2JE6I 3RZDH 1X9NA 1IBMQ 4LF8Q 1C0AA 1UE6A 5FLXc 4LF6Q 1XNRQ 4IPDA 4OO1I 3F8TA 4IPCA 2D62A 2K5HA 3RNUA 2VQEL 2XGTA 4IPHA 3FKIH 1N33L 2B63H 1BBWA 1WCMG 3BU2A 3I4MG 4LNQA 4DV1Q 1YHBA 3HOZH 4JI4Q 1LYLA 1EQRA 1N36L 2N49A 2RF4A 4DV4L 5HGQA 1VQIA 1VQ8A 4UY8C 3PIOA 1L1OB 5H1SE 1QVGA 1XJVA 4LF5Q 3TREA 1JJCB 1HJPA 4YCWA 3S1NH 3KF6A 3S17H 2I5HA 2Q2UA 1S72A 4GS3A 1N34Q 1M90C 1YEZA 3J80i 2PI2A 3J81i 4GNXC 4LF8L 2VNUD 5FLMG 2CWAA 2F52A 3S24A 4DR4L 4LF6L 3KF6B 4X64Q 4X65Q 2UU9L 1SR3A 1P8LA 2GVAA 3K8AA 2R92H 4JI3Q 4QL5A 5C4XH 3U4ZA 3GTOH 3FHWA 3KYHC 3UE1A 1X3FA 3D0FA 5LMUL 4DV1L 2Q2IA 2KHIA 1VQLA 2JA6H 3U4VA 3EBEA 1YITA 5JJLA 1V9PA 1W3SA 4BA2I 3PO3G 4JOIA 3K80C 4A3LH 1PHJA 4POGA 3PIPA 2UUCL 3GDEA 4JI0L 3W5OA 2ASBA 4C2MH 5LMNQ 3T1YQ 3KFUA 4DR5L 2E5LQ 2Z6KC 2LSSA 4KLKA 3HOYH 1PH8A 4IFDJ 5IE8A 3I4NG 3GTQH 1QVCA 1NMFA 4R4TA 1VQ5A 2R7ZG 3F2CA 4DR7Q 3S15H 1S40A 3HKZE 4A3EG 3MXNB 4R1JA 3CQZH 3GTMH 3M4OH 1IBKL 4DPGA 1VQ6A 1YIJA 5K36G 4PZ8A 4JYAL 5GROA 4KHPL 1CKOA 3PUYA 4LFAQ 4X66L 5IP9G 4OWWB 3S16H 4GOPB 1KRTA 3KDFB 1NBWA 4HIOA 2UXDQ 1IL2A 4A3KH 4YWLA 3J7A5 5JEAJ 3I55A 4J15A 3IRBA 2UXBQ 4OONA 5LMNL 2E5LL 4B3SQ 1YJNA 2F4VQ 2K14A 2CFMA 4YHHQ 4O0AA 1WCMH 3L7ZC 4O2DA 5AJ3L 4A3BG 4JI1L 4XIGS 1KD1C 2ZM6Q 1XMQQ 2DGYA 4GN4B 1OXSC 4BBRH 5FJ8H 2KENA 1L1OC 1N32L 1VQMA 4LFBQ 3UDFA 4JBKA 4GLAC 1I3QH 4DV0L 4DAMA 2MO0A 3G48A 2VZAA 3ZJYC 4A75A 4LFCQ 2R92G 2HT1A 3OTOQ 3HOUG 2OTLA 2ZJRA 1PV4A 2UXCL 4LF4Q 1HR0Q 1V43A 4P71A 4B3TQ 2UXBL 2BH8A 2KHJA 1IYJB 3PGZA 1DGSA 4A3LG 2R93H 4DV7Q 3AQQA 2NZHA 4Y7NH 1KXLA 5ELNA 3HOYG 1S3OA 4YHHL 4BXXG 1KHIA 2RHQB 3B6YA 2YV5A 3NELA 4P74A 5C0XG 1Q81C 2R6GA 3PCOB 1PH4A 2ZM6L 2YTXA 4LUOA 1K8AC 2JJQA 3HOWH 5C0XJ 4IOCA 3NEMA 1XPRA 1U0LA 4LF7Q 1YVCA 4DR1Q 1VQFA 4LFBL 1VQGA 2YTVA 3CCSA 4DR2L 4LFCL 4TQUS 2WP8J 4C3HH 4LF9Q 3ER0A 3OTOL 2C35B 3G4SA 4JCVE 4JBWA 2V1CC 3AYHB 4JI2L 4GKKL 1KIXA 1O7IA 4A3KG 4B3TL 4YY3Q 5E7NA 2VS1A 5M5XH 3T1HQ 1E7ZA 3CC7A 1U5KA 3M4QA 1VQ9A 4A3EH 1RL2A 1XNQQ 5M5WH 1EFWA 3GTJH 3D31A 1VCIA 4GOPC 1EIYB 1P16A 3GO5A 4JV5L 4JBMA 5IP9H 1CKNB 1L1OA 4LUZA 1KC8C 1HNZQ 5DLQE 2OWOA 2N3SA 4LWCA 2MNAA 3H3VI 1UWVA 4NXNL 3S2DH 4A3GG 4IFDI 4LF7L 4BBRG 5FJ8G 1L2FA 1OTCA 3TQYA 2HIXA 1D8LA 3CMAA 4JI8Q 3CCMA 4NXMQ 3AEVA 2JA9A 2KCMA 1X54A 3U58A 3CCVA 2N78A 4DV5Q 1MJCA 2AWNA 1I5FA 3STBD 5IWAL 5LMNW 3JC66 3OYYA 4QQBX 2R7FA 3S1QH 2VQFL 2YYZA 1JJ2A 4XTCS 4UP7A 2BA0A 4DR3L 4QIWE 4A3BH 4OWXB 4LW1A 1OXTA 4DR6Q 1KAWA 1T9HA 4YY3L 4H02A 4K0KQ 1N8RC 1IXRA 1VS0A 3T1HL 1IBML 3PV0A 2R93G 3HOXH 1Q82C 4JI7Q 2DUDA 1LUZA 3M4PA 4A3FG 1XNRL 5IY0A 5IT9c 3PF4A 2JA7G 3TS0A 1VQAA 1FJGQ 4DKAC 4GLXA 3K7UC 1BVSA 1SMXA 1I94Q 1D7QA 1NJIC 1QUQA 4LUVA 1R9TH 4HJAA 2BA1A 3HOUH 3H15A 1HNZL 4JG2A 3VDYA 2E2JH 1YNXA 1Y1WH 1VQKA 3GTKH 4B3ML 3HOWG 4JI4L 2PMZE 4KI0A 2B29A 4PG3A 3BZKA 1QVFA 3K81C 1QZHA 1C9OA 4DV3Q 1UE7A 5M5YH 1AE3A 1QUQB 3GTGH 1X3EA 3UDIA 4DV5L 4BA1I 4LF5L 3A74A 3CW2C 4DUYQ 2QEXA 4BXXH 3RLNA 5JJIA 1VQCA 1TWAH 4DNIA 5JJKA 2OQ0A 1N34L 1GM5A 3TEHB 2K5VA 3K7AH 3UDGA 4K0KL 2IHEA 3CCLA 1Z47A 4OO1G 3S14H 4GOPA 1OXVA 3AFPA 3KLWA 3KDFA 4X64L 5C3EH 4X65L 5C44H 2VL6A 3G71A 2OTJA 1AH9A 4QY7A 1PH7A 2D0OA 5GQOA 4DR3Q 1K0RA 3I7FA 4R4CA 4JI3L 4R4OA 1Q7YC 1SRUA 3DM3A 4DV2Q 1EWIA 2E2HH 3GTPH 4UP8A 1X55A 3ULJA 4IJLA 1SE8A 3MEFA 1J5EQ 2FXQA 4KHZA 4DV3L 2Y0SG 4PZ7A 2RCNA 1BKBA 3STBC 1G6PA 4P72A 1HR0W 3I4OA 2NZOA 3T1YL 1JE5A 3Q8DA 3M3YH 3TRZA 4APVA 1W2BA 2D0PA 3M85A 1PVOA 4IJHA 5BR8Q 1YBYA 2Q2HA 3A0JA 3ULLA 3RZOH 1HNWQ 3HOVH 1J6QA 4DR7L 4A3GH 3U50C 2K50A 1SLJA 2MFIA 3W1BA 3HOXG 3F2BA 1XMOQ 2Y0SE 3I2ZA 2E8GA 2NVXH 4GKJQ 4X6AH 4NPSA
chains in the Genus database with same CATH superfamily
2ZJQA 4A3MH 4ODGA 1WCMB 2MUYA 2F0DA 5E4XA 1KQSA 1EUJA 4A3IH 4BBSH 4RGMA 1ILPA 4RH6A 2HHHQ 3A5UA 4JBJA 1X56A 4BBRB 3CMEA 1PTOB 2EPBA 3HEJA 4PMBA 4KKTA 2JA7H 4B3RQ 3TP5A 4F8MA 4QMGA 3CF5A 4CKEA 1PH3A 1PH5A 5FO9B 1WI5A 2F0SA 5IP7H 1KRSA 3JAMc 1BBXC 1A0IA 2XIWA 2AMCB 5C3EG 2ATWA 2D9UA 2LMCB 2JP1A 1MSHA 1Q3LA 1B8AA 1K3RA 2C9OA 4G4KA 4ID6A 1G51A 4WJ4A 2BE5C 4BS9A 1HR0L 2BOSA 2QILA 2AWOA 4OEMB 2JA8G 1L0WA 3ZYYX 5I9PA 1EQTA 1G91A 1ENAA 3E9HA 5IGCA 2WAQG 4C3HB 3H3VH 5C4JH 1VQOA 1LTLA 3IL8A 3PF5A 4QJFA 1GD7A 1KLGD 3HOVG 1SAPA 4K5VA 1HUNA 3SGIA 1DYQA 3J81j 1GXDC 2K5WA 1E22A 3SHLA 5M5WB 3ITPA 4KMUC 2A6HD 4LF9L 4JI6L 3CD6A 5CV6A 4UHVA 4DR4Q 1HXYD 3NENA 5I6YA 1SE2A 3E0EA 2EJGC 4K5WA 4KY6A 4K2LA 1G291 4J1MA 3J80c 3J81c 2PW5A 2CQOA 4L5TA 1XNQL 4QCLA 5LMUQ 2ES2A 3PIP3 1SMYD 2B3GA 3KF8B 2O4XA 3BJUA 2L12A 3TZDA 2K52A 3CHBD 2NVTH 1ASZA 3F2UA 3FVQA 5J3BA 4BY7G 1ZXTA 4ZQ3A 1F2LA 5IYDH 3EIVA 1TXYA 1I6HH 2A1AA 2WKDA 1VF7A 2CWPA 3IFDA 4B9WA 4IO9A 3Q0AA 4KD3A 1HZAA 3OIQA 3DWAA 4A3JG 4A3CH 1FL0A 2EE1A 3GTGB 4HJ8A 2KEDA 5IYCG 1FJGL 4F88A 1EIFA 4KKSA 1E1OA 1CUKA 4BY1G 4IFDG 4FNFA 1ENFA 3I3CA 3SDZA 4CDEC 1FGUA 5IYBG 2F0NA 1GO3E 4AIMA 2ZJPA 4X62L 1O7ZA 1SROA 1TU2B 2A68D 3NTKA 1IZ6A 4C3JH 1VQ4A 2SNMA 1TY2A 4DV0Q 2B63G 5GAHC 3VR5A 5JEAG 4B08A 2VXWA 1PH2A 2HQLA 5J22A 4UDUC 3D3RA 3NTIA 4KY5A 4XDXA 2EXZA 2K05A 3QOJA 1I4QA 3I90A 3PUWA 2ZXRA 1V1PA 5BN5A 4PV1C 5C6AA 1Q8IA 2NVXB 1Y1VG 2A8VA 3RR5A 4EQ5A 1XWEA 4J8QA 1RIPA 4DV6L 1LACA 1JORA 1HNWL 1JB7A 4IUPA 4R8NA 2JQOA 4FO2A 3PUXA 1KABA 2VY3A 4GKJL 2K4KA 1F9SA 2MGSA 1VQ7A 2B2UC 2B2YC 1UUPA 2EXDA 3D4WA 2F3IA 3QR8A 1EYGA 3CCJA 5JJZA 1U4PA 4QGUA 1SBBB 1XPOA 3NBHB 3DEPA 1FVIA 3X3MA 3CCEA 5ISRA 4B3MQ 1SNQA 3S2HB 1D5ZC 4A93B 2KBNA 4KHVA 3EQLC 5M3FB 1QNKA 5KNBA 1VQNA 2CHBD 4EX5A 4DV4Q 4JOIC 3RLOA 1LV9A 2FINB 1D2BA 4KKUA 5J39A 2A5HA 4CBVA 2JA5B 1YHQA 1NMGA 3G6JB 1IBMQ 2GN5A 1JC7A 4HEDA 4LMQD 1AP0A 3KK7A 1DJRD 4ME5A 3MTSA 2VQEL 2XGTA 2BDOA 3FKIH 2F0GA 1VMPA 1H9RA 4ABNA 5IT9E 1YHBA 2E2IB 1FNWA 3U9OA 4JI4Q 1DOMA 1VQ8A 1QVGA 1LTBD 2B2UA 2B2YA 2WIIB 3S1NH 1B3AA 2I5HA 2Q2UA 2H4OA 4GS3A 1N34Q 1YEZA 3Q23A 2IPKD 4OIKA 1ET9A 2PI2A 4GNXC 4LF8L 2UU9L 4RA8A 2GVAA 3U4ZA 3GTOH 1DOKA 2L1BA 4N9TA 1FGBD 1PFNA 1X3FA 3D0FA 4I7AA 3EBEA 1YITA 1W3SA 4BA2I 1EY9A 3PO3G 3OHXC 4JOIA 2VUMB 3FPUB 4A3LH 3GV6A 3KFUA 3GDEA 4JI0L 4FYDA 3T1YQ 1F2YA 3HOYH 1SNPA 3GTQH 1AEXA 5C4XB 1K8OA 2F0WA 2R7ZG 5K5PA 3F2CA 5C3XA 5DM63 3EFXD 1IKLA 3HKZE 4DF7A 3CQZH 3OPOA 3M4OH 2K04A 4DGZA 1F2ZA 1SYEA 3OIPA 1CKOA 1LT5D 4X66L 1KRTA 3SE0A 3CKIB 1NBWA 5FO7B 3H3VC 1IL2A 4A3KH 3J7A5 1KDAA 1YNND 4PMCA 4Q5VA 3TP7A 3EVQA 1YJNA 2K14A 2E75C 1EWCA 4YHHQ 1XX8A 3S16B 1WCMH 1I4HA 4A3BG 4NP5A 1NNXA 1O7LA 4JI1L 2ZXPA 5CR3A 2ZM6Q 3PO2B 1V8QA 2F0FA 4BBRH 1PTOH 1L1OC 2PYKA 4JBKA 1CT1D 3R2TA 2MO0A 2VZAA 4A75A 5D3IB 3HOUG 1TWFB 2ZJRA 1AFPA 5J1ZA 1HR0Q 3L3OC 4P71A 2F3WA 2BH8A 5IGBA 3J81L 1QG7A 3AQQA 2X6GA 2EY1A 5CBEE 2NZHA 5ELNA 2RHQB 5C0XG 1SNMA 4P74A 1Q81C 2LFNA 2IWHA 1K8AC 4LUOA 1K28A 5C4ZA 2KEEA 3SK6A 3SXHA 3NEMA 5C0XJ 1U0LA 1XPRA 2F0OA 2PZTA 4C3HH 2NVYB 4LF9Q 3OTOL 2HQEA 4JBWA 4JI2L 3NTHA 2DY8A 3A54A 4B3TL 5E7NA 2VS1A 5M9OA 3CC7A 4KK7A 3R8BA 4A3EH 1XNQQ 5M5WH 4OHJA 1VCIA 1RF2D 5IP9H 1L1OA 2N3SA 1BCPB 2MNAA 1UWVA 4NXNL 1Y8PB 3P7JA 5EGTA 3CMAA 3C1FA 3HS0C 1D5MC 4CJ2C 3U58A 2HDMA 3CCVA 3RUZA 1RKNA 2Q8RE 3STBD 5LMNW 4M1UB 1PRTF 3JC66 3OYYA 5CGKA 4QIWE 4EQNA 3HOZB 1T9HA 2NTSA 1H9JA 3T1HL 2DJFC 2JA7G 1FJGQ 1BVSA 1SMXA 4LUVA 1HCZA 3H15A 1E2WA 1UEAB 3HOWG 2PMZE 2B29A 5D14A 3GTGH 4DV5L 2WKCA 1KDBA 4HTHA 3CW2C 3K57A 5COYA 4BXXH 1VDZA 4IUVA 3MVVA 3VR4A 4XQJA 1VQCA 2I07B 2OQ0A 3FRPB 3C1EA 1YNJD 2JA6B 3GTKB 2J4XA 2RVLA 3ND8A 1Z47A 3HG9A 3TBIB 1OXVA 4X65L 1I4PA 2OTJA 2NWGA 1S5BD 2D0OA 5GQOA 1K0RA 4DR3Q 1I4RA 4JI3L 2KECA 5CYUA 2E2HH 1TWAB 3KLSX 1WTWA 1X55A 3C3LA 3TP6A 2EYOA 3S15B 2PPBC 1JE4A 2Y0SG 3BVGA 2F0VA 3K5MA 2D0PA 1PVOA 1YBYA 1JICA 3ULLA 1HNWQ 1B4OA 4DR7L 4DK1A 1U9RA 2LS01 3U50C 3W1BA 3F2BA 2MFIA 3HRZC 2NVXH 4GKJQ 4U68A 4X6AH 1EQVA 4OX9Q 4ME3A 2K28A 1CI3M 4QIWB 1IW7C 3ERSX 1J5EL 2VB3X 2UXDL 1KDCA 1KNAA 4FP5D 2RQXA 4HJ7A 3T51B 3K5OA 4B3SL 3E3XA 2F4VL 4K2KA 2ZTEA 1ZKOA 1EIHA 5I2XA 1DM0B 3LWUA 1EOVA 3TN2A 1L0XB 4A3CG 1NE3A 3W2DA 2R93B 3AFQA 1ESFA 1OXUA 1TS4A 3NWSA 3S2HH 4A93H 3GD7A 1U4RA 5M3FH 4YCUA 1H9KA 2MHVA 2F3VA 5ELOA 2VW9A 1B2TA 4JK1C 4XXEA 4MNOA 2VQEQ 1G2SA 1PYSB 4OO1H 4AQYL 2M2LA 3A55A 2PQAB 1JWSD 3CPWA 1A2UA 1Q1EA 2QDBA 3V96A 3BYYB 1PH9A 4DNRB 3FP9A 2LXKA 1GUWA 2QDLA 3CPFA 3LNNA 2E2IH 5M3MG 4L6TB 2MO1A 1J9OA 4IUTA 3S9WA 1O78A 5IOCA 2F0TA 1LO5D 1F9QA 3RN5A 2UU9Q 1BOSA 3PUZA 4L8JA 4P75A 5JAVA 1A3TA 4PNYA 2NTTA 1E24A 1I50B 2NBFA 5E4WC 4HJ5A 5EBDA 4A76A 1D1KA 3G6EA 2WB1G 4JI0Q 1PTOC 5C5MA 4NXML 4J6HA 4ULLA 1ASYA 1JB3A 3HOXB 2XNAC 2XWJB 4H13C 4L5QA 2UUBQ 1Y8NB 1H95A 3W1GA 2UXCQ 1MJEA 1JOKA 2EQSA 4IURA 2F0UA 2VUMH 1R9TB 2F0PA 1AZQA 2K6AA 1VQEA 3C46A 4ZAIA 3KOJA 2R61A 1QNUA 5M5YB 3HGBA 4X66Q 3H91A 5EAYA 5HY6A 4DFAA 5LL6S 2IW3A 1IYUA 1F9RA 1KL9A 3F1ZA 2SDFA 4HAEA 4MTNA 5FO8B 3CCQA 4V0BA 3UDXA 3VR2A 5C3EB 1DOLA 2HIVA 3CAMA 4DA2A 4A3DG 4JI1Q 4PZ6A 2EIFA 1WYDA 1EY5A 1GOZA 1TT2A 4TRDA 2R3ZA 3M7GA 3FKIG 2KHSA 2L15A 2LKVA 1HPCA 4HSVA 2JA8B 1PH1A 3NPPA 1JQYD 3M3YB 4C56C 3PO2H 4DUZL 1B1ZA 3M9BA 1VQPA 5L37A 3RZOB 4JI5Q 3HOVB 4A3GB 3K5NA 4G57A 2EJFC 3TMEA 5G3LF 4P73A 1OXXK 2F0MA 1CQFA 2QEJC 3D8GA 2JEAI 1SYCA 4Y52H 1TWFH 3RLFA 1AN8A 5EPLA 3S1RH 1K8GA 1FD7D 2V4DA 3K0XA 1V1QA 2AUKA 4AYBG 4B9XA 1STGA 4K14A 4OWTB 1JCKB 1I4XA 3T4AC 4JI2Q 1HNXL 1MIUA 3KBGA 2Z6KA 5CORA 5EKIA 3T53B 1IBLL 2K7VA 2BCOA 3MXGA 2NVYH 3DEOA 1EFID 4DNTB 1Q12A 1VMCA 2QA4A 4LAAA 4BY7B 2DN8A 3DMUA 1M1KC 2EJMA 1PZID 1SN8A 1S5ED 4NXNQ 2LXJA 3AMUA 4MHEA 3P75A 4OIJA 3S1MB 2XTIA 1TWGH 3MXPA 4O1NA 4IPGA 4PMWA 1MKHA 1C0AA 4BY1B 3VYRA 2G5DA 5FLXc 4IPDA 1BXTA 2G9HD 3F8TA 4C3IB 4IPHA 5K36H 3KF8A 1N33L 4UAIA 1BBWA 1WCMG 4DN4M 3I4MG 3BVZA 3HOZH 3K0YA 4P2CB 1LYLA 1N36L 1XXGA 2RF4A 3QJYA 5HGQA 2EYHA 1TVXA 4YCWA 3KF6A 2B63B 3S17H 4XYOA 2VNUD 1UNSA 5G3LD 5FLMG 2F52A 1T5XD 1TIID 4LF6L 3KF6B 1HFGA 1JR0D 4X65Q 1P8LA 4JI3Q 1SJED 1GUTA 3FHWA 3KYHC 3UE1A 4DV1L 2JA6H 2NVQB 2Q2IA 1Y1VB 1M8AA 3KBXA 5JJLA 1W6JA 2ZT9C 1PZKD 1RHPA 2F0HA 2WV6D 4MN3A 3HP3A 5F2DA 5CV4A 4POGA 3PIPA 4DR5L 2CW0C 5KRUA 4IFDJ 3I4NG 1QVCA 4ZCKA 4R4TA 1W6KA 3LX0A 3H09A 3L9AX 4DR7Q 1BR9A 3S15H 1AZPA 3GTLB 1HQRD 4A3EG 3MXNB 4R1JA 3K58A 4C2MB 5EBCA 3ND9A 1ICWA 4I65A 1YIJA 1U4LA 1E2VA 4JYAL 1ICFB 5GROA 5IP9G 2K1BA 4GOPB 4QUCA 3KDFB 2UXDQ 1WVLA 1LTTD 1PZJD 1TQOA 5JEAJ 1S5CD 4OONA 5LMNL 2Q8IB 2E5LL 4B3SQ 3SK5A 2F4VQ 1SYBA 4XYQA 4Z9CB 4C1NK 5KNDA 2EYLA 4O2DA 5EJWA 4EGVA 1EY4A 1D1IA 3H0GB 4XIGS 1KD1C 4FF3A 2Z9HA 3CRLC 4GN4B 4RHSA 1OXSC 4KV6A 3SK4A 5FJ8H 4CJ1B 1TWHB 3SK8A 2L55A 3QO2A 1DXMA 1CZGA 4LFCQ 4ZLTF 3G48A 3ZJYC 2R92G 2HT1A 4CHTB 3NBHA 2UXBL 2R93H 5JPMC 1K3BC 1I3QB 3NK9A 4CJ0B 1S3OA 4BXXG 2K5QA 1KHIA 2PZWA 1IYVA 2YV5A 5EQ0A 1PH4A 2YTXA 1YVCA 1IKMA 1C4QA 1LLRD 3VA5A 4LFBL 1VQGA 2YTVA 3J7YW 3CCSA 1JOQA 2E74C 3ER0A 3G4SA 2C35B 3NP8A 2F1MA 2QKIC 3MZ5A 1K8MA 4GKKL 1SE4A 3BS1A 1O7IA 1TS2A 4YY3Q 2PZUA 3PO3B 3M4QA 1RL2A 4JW0A 3K59A 3D31A 3UI2A 1P16A 4JV5L 3J80E 3J81E 5D3DA 1CKNB 1HNZQ 2R7ZB 1HRJA 1XTCD 2JSOA 4IFDI 1EY6A 3T56B 3W3AA 1UAPA 4LF7L 2F0EA 4V190 1L2FA 4NXMQ 3TQYA 2HIXA 1D8LA 3RZDB 1X54A 1MD2D 2CH4A 5IWAL 1I5FA 2G9DA 3GTJB 1G6ZA 1SSOA 1NR2A 4X3TA 2R7FA 4QQBX 1DONA 2YYZA 1JJ2A 2BA0A 4LW1A 1OXTA 2RKSA 3E5SA 4H02A 1QOHA 3HOXH 5ELBA 4M8AA 2EVBA 2DUDA 4HN7A 5IY0A 1TS5A 1STAA 4WRDA 1EEFD 1R9TH 1T5EA 4HSPA 4RHRA 4JG2A 1QWYA 3OWEB 3VA7A 3VDYA 4A3BB 2XVSA 5AFWA 4PG3A 5CC4A 1QVFA 3K81C 3ONAB 1UE7A 5M5YH 3UDIA 3VYUA 3A8JE 5IGEA 4LF5L 3A74A 4IUUA 3RLNA 3HOUB 2SNSA 5ELEA 1GM5A 1WD0A 4K0KL 1SNOA 4HCEA 4OO1G 3JAML 1EL0A 5A2QL 1G2TA 2KQ3A 3KLWA 1PLFA 5C3EH 2VL6A 1I4GA 1AH9A 2I46A 1Q7YC 1EWIA 3FPPA 4F7XA 3MEFA 5E3FA 1V1OA 4KHZA 4DV3L 3STBC 2N55A 1G6PA 4G7OC 1HR0W 3GTMB 1JE5A 3M3YH 3TRZA 1CQVA 1W2BA 2JXMB 1B9MA 1BCPC 1TY0A 3RZOH 3HOVH 4A3GH 3KLRA 2M00A 1ENCA 1RODA 2Y0SE 2E8GA 4NPSA 4YCVA 2K01A 2Z0SA 3QB3A 1HNXQ 4OL7A 1HTPA 4LFAL 3TS2A 1NY4A 2NN6G 2AQ1B 1WFQA 5FLXL 1Y1WG 3DHQA 2B8FA 2RCFA 2EYMA 4KY7A 1RD9D 1RJTA 3J80L 3A8IE 1TR5A 4RKLA 1YNJC 1ZYRC 1CA5A 1EYCA 3R3OA 2ICIA 3J7ZC 3CXCA 2A69C 2Q2TA 4H44C 1Q8KA 3DWPA 1B70B 2I0QA 5C44G 4BY7H 5TSSA 1X65A 5I9OA 1X3PA 4FDBA 4JI6Q 3HKSA 3R2IA 4R4IA 1K73C 3S1MH 2RHSB 2HHHL 4E6IA 4LF4L 3HOWB 1XPUA 1LM0A 1HHVA 4NB3A 5JVH3 1N9WA 1N33Q 5GAGC 1EYAA 1UEBA 4B3RL 4IUNA 4HJ9A 2JEBI 5IYCH 2WINB 4ZRZA 4ZKCB 1PFSA 4KN4C 1L0YB 4BY1H 3T16A 2J0TD 4C3IH 5IYBH 1WJJA 1ZEQX 2AQ3B 2K32A 3OMCA 2C5CA 1HZ9A 1LABA 3PSIA 4RFBA 4A3MG 5C4JB 1SYDA 1Z6HA 1LT6D 1Q90A 1PFMA 1BBUA 4A3IG 4BBSG 5FOBB 3KJPA 5EKKA 2TMPA 2Y0SB 1RTNA 5JEAH 1Y14B 3UE0A 1AE2A 4L5RC 2Z4IA 4JPBW 3S1QB 5IGGA 1SXTA 2A6EC 2I5LX 1X6OA 5IP7G 4DR5Q 1EY7A 1YZ6A 4GLVB 2GA4B 1CKMA 1Y69U 2NVQH 1Y1VH 3I56A 5BN3A 2MJ8A 4GN5A 4X62Q 2YTYA 1F9PA 3SVMA 1VQJA 4DR6L 2E2JB 3R93A 2WB1E 5JVG3 2WACA 4WFN3 4JYAQ 5E1FA 1A2TA 3BVMA 4ZYSA 2NN6I 3HKZG 1GKHA 3GTLH 1C48A 2MQHA 3QWNA 5JPNC 1PYBA 4IOAA 1LTGD 3CCUA 1BO0A 1RTOA 2QGQA 2KCTA 5C0XI 4DUYL 3CCRA 1QZGA 2K5DA 4DV6Q 1H9SB 3GTPB 4POFA 2PCFB 3MAQA 3A56A 1B7YB 1PRTB 1PA6A 2K33A 1UE1A 3I73A 1E0BA 3H0GH 2EY6A 3HOZG 1XTDA 1CSQA 4AH6A 1TWHH 4DXFA 2DY7A 2IX1A 3DWQA 4HIKA 2KCCA 4H0LC 1MHWC 1D5XC 4OXPA 1WTOA 5HURA 2RA4A 4CDCC 1S5FD 1JWMD 1PRTD 3OMGA 3OW2A 5IYDG 1BUVT 2CQAA 5ELFA 4RGOS 5M3MB 5BR8L 2WFWA 4WORA 4A4IA 2OEOA 5C4HA 1EY8A 2KOLA 4TVAB 3QG1A 5DAUA 2X69A 3H94A 3CC4A 2FHTA 2JA6G 4A3FB 2SEBD 4GKKQ 2ZTDA 2XWBB 3PUVA 2PQAA 1Q86C 2M9VA 2WB1B 3L2PA 4AYBE 1STBA 2L0CA 3BZCA 4JVZA 4JV5Q 4BWGB 4RCNA 4C1NI 3A7AB 1X3GA 3ERQA 2UUAL 3BYTB 2JA5H 4C3JG 2RDGA 1UE5A 3PIO3 3PO3H 4RAUC 1R4PB 2PNHA 5GAEC 2JN4A 4L63B 5EPJA 5IWAQ 3MEHA 1SFOB 1ESRA 2IJ0A 4HIDA 1GVPA 2R7ZH 1YI2A 2L4NA 1YJWA 3PMFA 2CH4W 2KCNA 2WAQE 4DK6C 4MZ9A 4U673 1X9NA 4LF8Q 3RZDH 4KTAA 2B8GA 3IFTA 4YIJA 3P20A 3RNUA 2K5HA 1Y8OB 3NUCA 3BU2A 2F0IA 3MXUA 2D2CC 2EY2A 4IALA 4TKOB 4A3DB 1NR4A 1K83B 3EROA 3NWTA 1EQRA 1QJOA 1F2MA 2N49A 3Q22A 2EYFA 4DV4L 1VQIA 4UY8C 1E2ZA 3PIOA 5H1SE 3P1HA 4X3UA 4LF5Q 3TREA 1JJCB 1EYDA 1HJPA 3MFYA 1SNDA 4IQZA 1S72A 1A6XA 3DUZA 1M90C 1S5DD 2A74C 2L9HA 3SEBA 1B50A 2CWAA 3S24A 1QCBD 1SYGA 4O42A 2EZVA 1SR3A 1SEBD 3K8AA 2EDGA 5C4XH 1PTOF 2B39A 2KHIA 3U4VA 1IW7D 3OSOA 2F4IA 2D5DA 1PHJA 2UUCL 4G7HC 2O5JC 4AYBB 2Z6KC 2LSSA 4KLKA 1HFNA 2B2WC 3VYSA 1PH8A 2L5TA 5IE8A 2A6HC 2PW7A 1NMFA 5C0XH 1VQ5A 4PQXA 4ZUIA 2KA7A 4DK0A 4CKBA 1NAPA 3V05A 4CDDC 5CMDA 4IN3A 3GTMH 5DEHA 1IBKL 4DPGA 1VQ6A 2IX3A 4EQPA 3GTQB 1SMYC 4KHPL 4LFAQ 3S16H 3U9SA 2WAQB 1LTID 4YWLA 4RGTA 3WOFA 3I55A 1TWCB 3IRBA 4J15A 4DXGA 4X3SA 3D4DA 4MTKA 3L7ZC 3IAYA 5AJ3L 3KLSA 4FF4A 2DGYA 5KEEA 2KENA 1N32L 4K6DA 3UDFA 3OTOQ 3I4MB 1VF5C 4QUFA 1PV4A 4KJNA 4LF4Q 2B2WA 1DCZA 2RSOA 4B3TQ 2KUMA 1DGSA 1S4ZA 4NW2A 4A3LG 5CV8A 3E6ZX 1KXLA 3HOYG 1DZ1A 1ML0D 4YHHL 3B6YA 3NELA 2A68C 2FJ2A 2R6GA 4NKLA 2ZM6L 3HOWH 1B9NA 4IOCA 1GUOA 1PTOD 4DR2L 2RDFA 2PQEA 2WP8J 1WTRA 1PXUA 1NCVA 4A3JB 4JCVE 4G7ZC 5KYIA 3NXWA 2V1CC 2QCPX 3NQIA 4A3KG 3T1HQ 1E7ZA 1JWUD 1U5KA 1VQ9A 2LY7A 1FYCA 1GUGA 1EFWA 1RDPD 4XQNA 5C5LA 4GOPC 3I4NB 5FKAC 4JBMA 3MFGA 2OWOA 1BF4A 1KC8C 4DAVA 5DLQE 4A3GG 4LWCA 3N52A 1WTQA 5A35A 4BBRG 4ILWA 3OW7A 3URYA 2ICEC 3CCMA 1SYFA 1OTCA 1RCVD 2F0KA 2KCMA 4A3EB 5DNFA 2N78A 1G8ZD 4DV5Q 1MJCA 4TSSA 2AWNA 3NHHA 5IIFA 5D65A 5DM73 3S1QH 2VQFL 4UP7A 4DR6Q 4OWXB 4KD4A 2HD3A 3D6CA 1N8RC 1IXRA 1VS0A 2NB0A 3PV0A 1Q82C 1XYIA 4QB4A 1LUZA 1XNRL 3PF4A 5IT9c 3TS0A 1HTLD 5NUCA 4GLXA 3K7UC 1D7QA 2BA1A 1A3UA 2E2JH 1VQKA 2B2VC 3GTKH 1FR3A 1EU4A 4FVMA 4KI0A 3BZKA 4RGNA 1C9OA 3NBIA 5HGTA 1O7YA 4C3HG 4DUYQ 2QEXA 2R92B 1R4QB 3MXNA 5JJIA 1TWAH 5JJKA 2YU9B 3I4LA 3TEHB 2K5VA 4GOPA 1BDOA 3AFPA 3KDFA 4X64L 3G71A 4QY7A 3I91A 4R4CA 3DXJC 3GTPH 3ULJA 1KAAA 4C3IG 5IGFA 1J5EQ 3Q24A 2FXQA 2QW7A 4K5XA 2OF1A 3BZDB 2RCNA 3MWYW 1BKBA 3C2PA 3I4OA 2BE5D 2NZOA 3Q8DA 1WD1A 2F0QA 4IJHA 5BR8Q 2E2HB 1II3A 1TKWB 5ELCA 5I6WA 4N8X1 2K50A 1SLJA 3I2ZA 5LL6X 3NSWA 3O13A 4DR3L 1IL8A 2AHOB 1VQBA 2B2VA 1GHKA 5M3MH 3JAME 3AB9A 5A2QE 3GV3A 1STYA 4UP9A 1VQHA 1HA6A 3ULPA 2RSNA 1LT3D 4HIMA 4YWMA 3RN2A 1CHQD 4AQYQ 2IY5B 5GADC 4A3FH 4IZ8A 3A7LA 2UUAQ 3M7NA 2IHFA 3VR6A 3MHBA 1CSPA 1V1PB 2OCEA 1XMQL 2EYJA 3E9IA 1KLUD 4K8IA 4DAYA 1I6VC 2PI2E 3WWVA 1AW7A 4OX9L 1DD2A 4Y7NB 5IGDA 2OQKA 1NTGA 1EEID 1HUMA 1Q46A 4GZYC 4DAYB 3AU7A 1YNNC 1CKNA 1SFOH 2X6LA 4DV7L 5FLXE 4GN3B 4UPAA 3V2TA 1X3QA 2DNCA 1B44D 1A63A 3OWFA 2IT1A 1VQDA 5M5XB 4DR1L 4Q0FA 2NUCA 2E76C 3BDOA 3H0GG 1A15A 2CW0D 4R9WA 4A3DH 1I50H 1K83H 1PMRA 2N8NA 1Q1BA 3CC2A 2DJGC 3DM1A 3KUPA 4I7ZC 3L0OA 2CCZA 3S2DB 5I2YA 1CM9A 2MPMA 1JJGA 2HUGA 4RKBA 4NMZA 2EYPA 2K5NA 2IL8A 3BDCA 4DU9A 2QF7A 1E3PA 4RG1A 4R4QA 4DK3C 3M4YA 1CFMA 2UUCQ 2K75A 3HFZB 3DLLA 1YJ9A 4JI8L 4A93G 4LK1C 2H5XA 3GP7A 1K0SA 1STHA 1SE3A 5M3FG 1JT8A 1GUNA 1Y1WB 1C7YA 4K8JA 2HDLA 1IBKQ 4FXDA 3D6WA 5ELDA 4RMFA 1EQQA 4JI7L 1EU3A 5I4DA 4KHPQ 2R7DA 2NZ1D 2DNEA 1I94L 2JA5G 2GVBA 1QILA 2I5MX 3TZUA 4DUZQ 4RWSC 1K9MC 3K7AB 3QOLA 4ZKBB 4CGYB 3S14B 2JA8H 3F2DA 2UUBL 5C44B 1HH2P 5AJ3Q 2UXCL 1NSNS 4S3SA 2ZTCA 3N6RA 1TWCH 2K03A 1PYWD 2RBMA 1N32Q 1WTPA 2F0LA 1MSGA 1HZBA 1STEA 3CP0A 2PNRC 2HCCA 2AUJD 1ET6A 2L11A 4ALPA 1OO9B 3FMCA 4DV2L 2AKWB 4NDXA 1IBLQ 1Z9FA 3KJOA 1HQMC 1FNVA 1U4MA 1LTSD 4L5SA 4GNXA 2TSSA 1BCPF 2CKZB 2Z4HA 3I4MH 5CV7A 3TDQA 1JMCA 4DAPA 3Q6SA 3CRKC 1HZCA 3BDLA 4A3MB 1PH6A 2VUMG 4GNXB 1YHAA 4HR7B 2A19A 4A3IB 4BBSB 4DR2Q 4XT3B 1XMOL 3ICEA 1QE6A 5C4XG 2H1EA 1GJXA 1E1TA 1LT4D 2JA7B 3S1RB 5FLMH 3J7AF 2VB2X 4JI5L 4EQOA 5IT9L 1QB5D 4X3KA 4FF1A 2BH2A 4A3JH 2ALYB 1M4VA 3FDTA 2F03A 3H6MA 3JAMi 2HCIA 4YWKA 1MGSA 3EN2A 4XT1B 4IFDH 1A8VA 2ID0A 1CK1A 1N36Q 3A5ZB 5KGUA 4WJ3M 2FFKB 4JC0A 2IX0A 3I4NH 3LGJA 3I72A 1JOOA 2JK8A 2VQFQ 2XRSD 1X32A 3PO2G 3HKZB 1WOCA 1A62A 2JE6I 1UE6A 1PRTC 4LF6Q 1XNRQ 4OO1I 4IPCA 2D62A 4ZK9B 3EA6A 1TWGB 4OELB 2B63H 3MC0B 4LNQA 4DV1Q 3RD4A 2FMMA 1STNA 2Z1CA 3WDNA 1L1OB 1XJVA 3FEWX 1Z7TA 2EY5A 3NE5B 3J80i 3J81i 3K6OA 3GQBA 1BCPD 2XRQD 4DR4L 2KVMA 3I70A 4X64Q 5LHY1 2NVTB 4FXGC 4H7BA 3J7AV 2R92H 4QL5A 3S17B 1B3QA 5LMUL 1VQLA 2YU9H 2XN9C 3RMHA 1O80A 1I6HB 1V9PA 5T1GA 3K80C 2Z8LA 3SR1A 2ASBA 1GUSA 4CDFC 3W5OA 4C2MH 5LMNQ 2MP1A 2E5LQ 1H9SA 3BG3A 2RDHA 1ZYRD 4ZUJA 2B2TC 2XSCA 1S40A 5BN4A 2A69D 3A8KE 3G7LA 5K36G 1F77A 3E0JA 4PZ8A 2AQ2B 3PUYA 4OWWB 2OXPA 4LJZC 5KYLA 3TSSA 4HIOA 4CKCA 4HCSA 4C3JB 2UXBQ 3VR3A 5CBAE 4EVOA 3HZXA 5FK9C 2CFMA 3OOCA 4O0AA 4HMIA 3T13A 4WJWA 1XMQQ 1BNZA 1WTVA 2JYOA 2J7ZA 3TP8A 1VQMA 1ILQA 4R8IA 4LFBQ 4GLAC 1I3QH 4DV0L 4DAMA 1A3VA 2ZXOA 3D4RA 2OTLA 1V43A 4QF4A 3PGZA 1IYJB 2KHJA 4F87A 2O5IC 2BDNA 4DV7Q 1CZWA 4KN7C 4Y7NH 2B2TA 1EZ6A 2PO4A 1TS3A 2OT2A 3PCOB 1WTXA 4XQQA 2JJQA 2PMZB 4FXKC 1C8CA 1CHPD 4LF7Q 4DR1Q 2A6ED 1VQFA 2Z6BA 1GHJA 4LFCL 2FMCA 4TQUS 1CA6A 5IODA 3AYHB 4HMJA 1KIXA 4N8FA 3VYTA 4OGQC 1MI2A 3QIAA 5M5XH 2O2LD 1EZ8A 3GTJH 1HA5A 1FNUA 5KIXA 5CV5A 3GO5A 2ENBA 3I8ZA 1EIYB 4LUZA 4B3ML 1WTHA 3H3VI 3S2DH 3IKJA 1EOTA 3X3NA 5FJ8G 3AEVA 5CV9A 4JI8Q 1J8IA 2JA9A 3WOEA 2SOBA 1ONLA 2E2DC 3FKIB 4RCOA 1KTKA 4KJOA 4XTCS 3MA2B 4A3BH 1KAWA 5T1IA 2Q8TA 4YY3L 4K0KQ 1IBML 2CVRA 2R93G 1LTRD 4JI7Q 1EY0A 1KNEA 3M4PA 4A3FG 1EWHA 1VQAA 5EKLA 4DKAC 1I94Q 1NUCA 2F0JA 3S1NB 1NJIC 1QUQA 4HJAA 3HOUH 1H9MA 1HNZL 2NN6H 2A73B 1YNXA 1Y1WH 3LWEA 1IHZA 4JI4L 1LTAD 5C3WA 1SDFA 1QZHA 4DV3Q 1AE3A 1QUQB 1X3EA 4BA1I 3CU7A 1MBYA 4DNIA 3GTOB 1N34L 3K7AH 3UDGA 4K6LA 2IHEA 3CCLA 3S14H 1CTMA 1BQQT 3PQIA 5C44H 5KNCA 1PH7A 1B53A 3I7FA 3HOYB 1PFBA 4R4OA 1SRUA 3DM3A 4DV2Q 3EJIA 1EIGA 1SNCA 4UP8A 4N9PA 4IJLA 1SE8A 4PZ7A 2P5ZX 5EPKA 1PDQA 4P72A 3CQZB 1D6EC 3T1YL 3M4OB 2N88A 4APVA 3NQTA 3M85A 3K5LA 3A0JA 2Q2HA 2KJXA 4FF2A 1J6QA 4A3KB 2EOTA 4IUQA 5JOBA 3HOXG 1XMOQ 2NYZD 1SJHD 4MIUA
chains in the Genus database with same CATH topology
4YCVA 2AHOB 1VQBA 2Z0SA 4ME3A 4OX9Q 5M3MH 1HNXQ 2ZJQA 4A3MH 4LFAL 3TS2A 1NY4A 2NN6G 4UP9A 1KQSA 1WFQA 1EUJA 1VQHA 3ERSX 4A3IH 1Y1WG 3ULPA 1J5EL 4BBSH 2UXDL 2HHHQ 3A5UA 4JBJA 1X56A 3CMEA 4HIMA 4YWMA 4HJ7A 3RN2A 4AQYQ 2IY5B 5GADC 4A3FH 4B3SL 2JA7H 2UUAQ 2F4VL 3M7NA 4B3RQ 2IHFA 3CF5A 2ZTEA 1PH3A 1PH5A 3J7ZC 1CSPA 1EOVA 1WI5A 2OCEA 3CXCA 1XMQL 3E9IA 5IP7H 2Q2TA 1KRSA 4A3CG 1NE3A 3JAMc 1A0IA 1Q8KA 3AFQA 1B70B 2AMCB 2PI2E 5C3EG 5C44G 2I0QA 4BY7H 1OXUA 3WWVA 4OX9L 2ATWA 3S2HH 1X65A 4A93H 2OQKA 3GD7A 1B8AA 1K3RA 1NTGA 5M3FH 1Q46A 4FDBA 4YCUA 3HKSA 4JI6Q 5ELOA 2VW9A 1G51A 4R4IA 1K73C 3S1MH 2RHSB 4DAYB 4WJ4A 2HHHL 4LF4L 1HR0L 1XPUA 1LM0A 4MNOA 2AWOA 4NB3A 2VQEQ 2JA8G 1N9WA 1PYSB 1N33Q 1CKNA 4AQYL 1L0WA 5GAGC 1SFOH 4DV7L 1UEBA 4GN3B 4B3RL 4HJ9A 2PQAB 2JEBI 3E9HA 4UPAA 5IYCH 2WAQG 3CPWA 1PFSA 3H3VH 5C4JH 1Q1EA 1VQOA 1LTLA 4BY1H 3PF5A 4QJFA 1GD7A 3HOVG 1A63A 2IT1A 4C3IH 5IYBH 1PH9A 1WJJA 3SGIA 1VQDA 3FP9A 2LXKA 4DR1L 3J81j 3H0GG 3CPFA 1E22A 4A3DH 2E2IH 5M3MG 1I50H 4LF9L 1HZ9A 1K83H 2MO1A 3PSIA 4A3MG 2N8NA 4JI6L 3CD6A 1Q1BA 3CC2A 4DR4Q 1BBUA 3NENA 4A3IG 3L0OA 2CCZA 4BBSG 3KJPA 3E0EA 3RN5A 1JJGA 2UU9Q 1G291 3PUZA 3J80c 3J81c 2K5NA 2CQOA 4L5TA 4P75A 1XNQL 1Y14B 5LMUQ 1E24A 1AE2A 3UE0A 2ES2A 4L5RC 2B3GA 4RG1A 1E3PA 3KF8B 4R4QA 4DK3C 4HJ5A 3BJUA 4A76A 2I5LX 2WB1G 3G6EA 2UUCQ 4JI0Q 1X6OA 2K52A 2K75A 3HFZB 5IP7G 3DLLA 4DR5Q 1YJ9A 1ASZA 4NXML 4JI8L 1ASYA 2NVTH 1YZ6A 4GLVB 4L5QA 5J3BA 1CKMA 4BY7G 2UUBQ 5IYDH 3EIVA 2NVQH 1H95A 3W1GA 1Y1VH 1TXYA 2H5XA 3I56A 4A93G 2A1AA 1MJEA 1I6HH 2UXCQ 2CWPA 2EQSA 4GN5A 4X62Q 5M3FG 4IO9A 2VUMH 1JT8A 1HZAA 2YTYA 4DR6L 1VQJA 1VQEA 1C7YA 1IBKQ 2WB1E 4RMFA 4A3JG 3KOJA 1EQQA 4A3CH 4JI7L 1FL0A 4JYAQ 4KHPQ 2R7DA 4X66Q 5EAYA 4HJ8A 5IYCG 5HY6A 1FJGL 1I94L 2JA5G 2GVBA 2NN6I 2I5MX 1EIFA 3HKZG 4DUZQ 1E1OA 1CUKA 1GKHA 4BY1G 3GTLH 4IFDG 1KL9A 3F1ZA 2MQHA 4MTNA 1K9MC 1FGUA 5IYBG 3CCQA 3UDXA 1PYBA 2YU9H 2JA8H 3F2DA 1GO3E 2UUBL 3CCUA 4IOAA 4AIMA 1HH2P 2HIVA 2KCTA 2QGQA 3CAMA 4JI1Q 5C0XI 4PZ6A 5AJ3Q 2ZJPA 3CCRA 4DUYL 2EIFA 2ZTCA 4X62L 1SROA 1WYDA 1IZ6A 4C3JH 1QZGA 4DV6Q 1TWCH 1VQ4A 4POFA 1N32Q 1B7YB 1PA6A 3FKIG 4DV0Q 2L15A 1HZBA 3CP0A 2B63G 1UE1A 5GAHC 1PH1A 5JEAG 4A3DG 3H0GH 3HOZG 1PH2A 1XTDA 1CSQA 2HQLA 4ALPA 3PO2H 4DUZL 1VQPA 3M9BA 4DV2L 4AH6A 1TWHH 2AKWB 1IBLQ 1Z9FA 2IX1A 3KJOA 4HIKA 4JI5Q 3PUWA 4L5SA 4OXPA 4GNXA 2CKZB 4P73A 1OXXK 3OW2A 2JEAI 3I4MH 5IYDG 1JMCA 4Y52H 1TWFH 3RLFA 1Y1VG 2A8VA 3RR5A 5BR8L 2WFWA 4EQ5A 1HZCA 3S1RH 4DV6L 1PH6A 1RIPA 4GNXB 1K8GA 1YHAA 2VUMG 2A19A 4A4IA 1HNWL 3K0XA 1JB7A 1V1QA 4DR2Q 4AYBG 4TVAB 2JQOA 4OWTB 1XMOL 3ICEA 5C4XG 3PUXA 3CC4A 2VY3A 4GKJL 2JA6G 2K4KA 1E1TA 4JI2Q 4GKKQ 1VQ7A 1HNXL 1MIUA 2ZTDA 2Z6KA 2EXDA 1IBLL 5FLMH 2F3IA 1EYGA 3PUVA 4JI5L 3CCJA 2PQAA 1Q86C 4QGUA 3L2PA 2NVYH 4AYBE 2BH2A 4A3JH 1XPOA 2ALYB 1Q12A 3BZCA 3NBHB 2QA4A 4JV5Q 1FVIA 3CCEA 4B3MQ 1M1KC 1X3GA 2UUAL 3JAMi 4YWKA 2JA5H 1SN8A 4NXNQ 2KBNA 2LXJA 3EN2A 1UE5A 3PO3H 1A8VA 2ID0A 1N36Q 1VQNA 2PNHA 4EX5A 4DV4Q 5GAEC 3A5ZB 4WJ3M 5IWAQ 4JC0A 2IX0A 4JOIC 2XTIA 3RLOA 3I4NH 1TWGH 3LGJA 2JK8A 4HIDA 2VQFQ 1GVPA 2R7ZH 1YI2A 1YJWA 3PO2G 4IPGA 1YHQA 2WAQE 4PMWA 1NMGA 1WOCA 4MZ9A 4DK6C 1MKHA 2GN5A 1A62A 2JE6I 3RZDH 1X9NA 1IBMQ 4LF8Q 1C0AA 1UE6A 5FLXc 4LF6Q 1XNRQ 4IPDA 4OO1I 3F8TA 4IPCA 2D62A 2K5HA 3RNUA 2VQEL 2XGTA 4IPHA 3FKIH 1N33L 2B63H 1BBWA 1WCMG 3BU2A 3I4MG 4LNQA 4DV1Q 1YHBA 3HOZH 4JI4Q 1LYLA 1EQRA 1N36L 2N49A 2RF4A 4DV4L 5HGQA 1VQIA 1VQ8A 4UY8C 3PIOA 1L1OB 5H1SE 1QVGA 1XJVA 4LF5Q 3TREA 1JJCB 1HJPA 4YCWA 3S1NH 3KF6A 3S17H 2I5HA 2Q2UA 1S72A 4GS3A 1N34Q 1M90C 1YEZA 3J80i 2PI2A 3J81i 4GNXC 4LF8L 2VNUD 5FLMG 2CWAA 2F52A 3S24A 4DR4L 4LF6L 3KF6B 4X64Q 4X65Q 2UU9L 1SR3A 1P8LA 2GVAA 3K8AA 2R92H 4JI3Q 4QL5A 5C4XH 3U4ZA 3GTOH 3FHWA 3KYHC 3UE1A 1X3FA 3D0FA 5LMUL 4DV1L 2Q2IA 2KHIA 1VQLA 2JA6H 3U4VA 3EBEA 1YITA 5JJLA 1V9PA 1W3SA 4BA2I 3PO3G 4JOIA 3K80C 4A3LH 1PHJA 4POGA 3PIPA 2UUCL 3GDEA 4JI0L 3W5OA 2ASBA 4C2MH 5LMNQ 3T1YQ 3KFUA 4DR5L 2E5LQ 2Z6KC 2LSSA 4KLKA 3HOYH 1PH8A 4IFDJ 5IE8A 3I4NG 3GTQH 1QVCA 1NMFA 4R4TA 1VQ5A 2R7ZG 3F2CA 4DR7Q 3S15H 1S40A 3HKZE 4A3EG 3MXNB 4R1JA 3CQZH 3GTMH 3M4OH 1IBKL 4DPGA 1VQ6A 1YIJA 5K36G 4PZ8A 4JYAL 5GROA 4KHPL 1CKOA 3PUYA 4LFAQ 4X66L 5IP9G 4OWWB 3S16H 4GOPB 1KRTA 3KDFB 1NBWA 4HIOA 2UXDQ 1IL2A 4A3KH 4YWLA 3J7A5 5JEAJ 3I55A 4J15A 3IRBA 2UXBQ 4OONA 5LMNL 2E5LL 4B3SQ 1YJNA 2F4VQ 2K14A 2CFMA 4YHHQ 4O0AA 1WCMH 3L7ZC 4O2DA 5AJ3L 4A3BG 4JI1L 4XIGS 1KD1C 2ZM6Q 1XMQQ 2DGYA 4GN4B 1OXSC 4BBRH 5FJ8H 2KENA 1L1OC 1N32L 1VQMA 4LFBQ 3UDFA 4JBKA 4GLAC 1I3QH 4DV0L 4DAMA 2MO0A 3G48A 2VZAA 3ZJYC 4A75A 4LFCQ 2R92G 2HT1A 3OTOQ 3HOUG 2OTLA 2ZJRA 1PV4A 2UXCL 4LF4Q 1HR0Q 1V43A 4P71A 4B3TQ 2UXBL 2BH8A 2KHJA 1IYJB 3PGZA 1DGSA 4A3LG 2R93H 4DV7Q 3AQQA 2NZHA 4Y7NH 1KXLA 5ELNA 3HOYG 1S3OA 4YHHL 4BXXG 1KHIA 2RHQB 3B6YA 2YV5A 3NELA 4P74A 5C0XG 1Q81C 2R6GA 3PCOB 1PH4A 2ZM6L 2YTXA 4LUOA 1K8AC 2JJQA 3HOWH 5C0XJ 4IOCA 3NEMA 1XPRA 1U0LA 4LF7Q 1YVCA 4DR1Q 1VQFA 4LFBL 1VQGA 2YTVA 3CCSA 4DR2L 4LFCL 4TQUS 2WP8J 4C3HH 4LF9Q 3ER0A 3OTOL 2C35B 3G4SA 4JCVE 4JBWA 2V1CC 3AYHB 4JI2L 4GKKL 1KIXA 1O7IA 4A3KG 4B3TL 4YY3Q 5E7NA 2VS1A 5M5XH 3T1HQ 1E7ZA 3CC7A 1U5KA 3M4QA 1VQ9A 4A3EH 1RL2A 1XNQQ 5M5WH 1EFWA 3GTJH 3D31A 1VCIA 4GOPC 1EIYB 1P16A 3GO5A 4JV5L 4JBMA 5IP9H 1CKNB 1L1OA 4LUZA 1KC8C 1HNZQ 5DLQE 2OWOA 2N3SA 4LWCA 2MNAA 3H3VI 1UWVA 4NXNL 3S2DH 4A3GG 4IFDI 4LF7L 4BBRG 5FJ8G 1L2FA 1OTCA 3TQYA 2HIXA 1D8LA 3CMAA 4JI8Q 3CCMA 4NXMQ 3AEVA 2JA9A 2KCMA 1X54A 3U58A 3CCVA 2N78A 4DV5Q 1MJCA 2AWNA 1I5FA 3STBD 5IWAL 5LMNW 3JC66 3OYYA 4QQBX 2R7FA 3S1QH 2VQFL 2YYZA 1JJ2A 4XTCS 4UP7A 2BA0A 4DR3L 4QIWE 4A3BH 4OWXB 4LW1A 1OXTA 4DR6Q 1KAWA 1T9HA 4YY3L 4H02A 4K0KQ 1N8RC 1IXRA 1VS0A 3T1HL 1IBML 3PV0A 2R93G 3HOXH 1Q82C 4JI7Q 2DUDA 1LUZA 3M4PA 4A3FG 1XNRL 5IY0A 5IT9c 3PF4A 2JA7G 3TS0A 1VQAA 1FJGQ 4DKAC 4GLXA 3K7UC 1BVSA 1SMXA 1I94Q 1D7QA 1NJIC 1QUQA 4LUVA 1R9TH 4HJAA 2BA1A 3HOUH 3H15A 1HNZL 4JG2A 3VDYA 2E2JH 1YNXA 1Y1WH 1VQKA 3GTKH 4B3ML 3HOWG 4JI4L 2PMZE 4KI0A 2B29A 4PG3A 3BZKA 1QVFA 3K81C 1QZHA 1C9OA 4DV3Q 1UE7A 5M5YH 1AE3A 1QUQB 3GTGH 1X3EA 3UDIA 4DV5L 4BA1I 4LF5L 3A74A 3CW2C 4DUYQ 2QEXA 4BXXH 3RLNA 5JJIA 1VQCA 1TWAH 4DNIA 5JJKA 2OQ0A 1N34L 1GM5A 3TEHB 2K5VA 3K7AH 3UDGA 4K0KL 2IHEA 3CCLA 1Z47A 4OO1G 3S14H 4GOPA 1OXVA 3AFPA 3KLWA 3KDFA 4X64L 5C3EH 4X65L 5C44H 2VL6A 3G71A 2OTJA 1AH9A 4QY7A 1PH7A 2D0OA 5GQOA 4DR3Q 1K0RA 3I7FA 4R4CA 4JI3L 4R4OA 1Q7YC 1SRUA 3DM3A 4DV2Q 1EWIA 2E2HH 3GTPH 4UP8A 1X55A 3ULJA 4IJLA 1SE8A 3MEFA 1J5EQ 2FXQA 4KHZA 4DV3L 2Y0SG 4PZ7A 2RCNA 1BKBA 3STBC 1G6PA 4P72A 1HR0W 3I4OA 2NZOA 3T1YL 1JE5A 3Q8DA 3M3YH 3TRZA 4APVA 1W2BA 2D0PA 3M85A 1PVOA 4IJHA 5BR8Q 1YBYA 2Q2HA 3A0JA 3ULLA 3RZOH 1HNWQ 3HOVH 1J6QA 4DR7L 4A3GH 3U50C 2K50A 1SLJA 2MFIA 3W1BA 3HOXG 3F2BA 1XMOQ 2Y0SE 3I2ZA 2E8GA 2NVXH 4GKJQ 4X6AH 4NPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCV A;  2AHO B;  1VQB A;  2Z0S A;  4ME3 A;  4OX9 Q;  5M3M H;  1HNX Q;  2ZJQ A;  4A3M H;  4LFA L;  3TS2 A;  1NY4 A;  2NN6 G;  4UP9 A;  1KQS A;  1WFQ A;  1EUJ A;  1VQH A;  3ERS X;  4A3I H;  1Y1W G;  3ULP A;  1J5E L;  4BBS H;  2UXD L;  2HHH Q;  3A5U A;  4JBJ A;  1X56 A;  3CME A;  4HIM A;  4YWM A;  4HJ7 A;  3RN2 A;  4AQY Q;  2IY5 B;  5GAD C;  4A3F H;  4B3S L;  2JA7 H;  2UUA Q;  2F4V L;  3M7N A;  4B3R Q;  2IHF A;  3CF5 A;  2ZTE A;  1PH3 A;  1PH5 A;  3J7Z C;  1CSP A;  1EOV A;  1WI5 A;  2OCE A;  3CXC A;  1XMQ L;  3E9I A;  5IP7 H;  2Q2T A;  1KRS A;  4A3C G;  1NE3 A;  3JAM c;  1A0I A;  1Q8K A;  3AFQ A;  1B70 B;  2AMC B;  2PI2 E;  5C3E G;  5C44 G;  2I0Q A;  4BY7 H;  1OXU A;  3WWV A;  4OX9 L;  2ATW A;  3S2H H;  1X65 A;  4A93 H;  2OQK A;  3GD7 A;  1B8A A;  1K3R A;  1NTG A;  5M3F H;  1Q46 A;  4FDB A;  4YCU A;  3HKS A;  4JI6 Q;  5ELO A;  2VW9 A;  1G51 A;  4R4I A;  1K73 C;  3S1M H;  2RHS B;  4DAY B;  4WJ4 A;  2HHH L;  4LF4 L;  1HR0 L;  1XPU A;  1LM0 A;  4MNO A;  2AWO A;  4NB3 A;  2VQE Q;  2JA8 G;  1N9W A;  1PYS B;  1N33 Q;  1CKN A;  4AQY L;  1L0W A;  5GAG C;  1SFO H;  4DV7 L;  1UEB A;  4GN3 B;  4B3R L;  4HJ9 A;  2PQA B;  2JEB I;  3E9H A;  4UPA A;  5IYC H;  2WAQ G;  3CPW A;  1PFS A;  3H3V H;  5C4J H;  1Q1E A;  1VQO A;  1LTL A;  4BY1 H;  3PF5 A;  4QJF A;  1GD7 A;  3HOV G;  1A63 A;  2IT1 A;  4C3I H;  5IYB H;  1PH9 A;  1WJJ A;  3SGI A;  1VQD A;  3FP9 A;  2LXK A;  4DR1 L;  3J81 j;  3H0G G;  3CPF A;  1E22 A;  4A3D H;  2E2I H;  5M3M G;  1I50 H;  4LF9 L;  1HZ9 A;  1K83 H;  2MO1 A;  3PSI A;  4A3M G;  2N8N A;  4JI6 L;  3CD6 A;  1Q1B A;  3CC2 A;  4DR4 Q;  1BBU A;  3NEN A;  4A3I G;  3L0O A;  2CCZ A;  4BBS G;  3KJP A;  3E0E A;  3RN5 A;  1JJG A;  2UU9 Q;  1G29 1;  3PUZ A;  3J80 c;  3J81 c;  2K5N A;  2CQO A;  4L5T A;  4P75 A;  1XNQ L;  1Y14 B;  5LMU Q;  1E24 A;  1AE2 A;  3UE0 A;  2ES2 A;  4L5R C;  2B3G A;  4RG1 A;  1E3P A;  3KF8 B;  4R4Q A;  4DK3 C;  4HJ5 A;  3BJU A;  4A76 A;  2I5L X;  2WB1 G;  3G6E A;  2UUC Q;  4JI0 Q;  1X6O A;  2K52 A;  2K75 A;  3HFZ B;  5IP7 G;  3DLL A;  4DR5 Q;  1YJ9 A;  1ASZ A;  4NXM L;  4JI8 L;  1ASY A;  2NVT H;  1YZ6 A;  4GLV B;  4L5Q A;  5J3B A;  1CKM A;  4BY7 G;  2UUB Q;  5IYD H;  3EIV A;  2NVQ H;  1H95 A;  3W1G A;  1Y1V H;  1TXY A;  2H5X A;  3I56 A;  4A93 G;  2A1A A;  1MJE A;  1I6H H;  2UXC Q;  2CWP A;  2EQS A;  4GN5 A;  4X62 Q;  5M3F G;  4IO9 A;  2VUM H;  1JT8 A;  1HZA A;  2YTY A;  4DR6 L;  1VQJ A;  1VQE A;  1C7Y A;  1IBK Q;  2WB1 E;  4RMF A;  4A3J G;  3KOJ A;  1EQQ A;  4A3C H;  4JI7 L;  1FL0 A;  4JYA Q;  4KHP Q;  2R7D A;  4X66 Q;  5EAY A;  4HJ8 A;  5IYC G;  5HY6 A;  1FJG L;  1I94 L;  2JA5 G;  2GVB A;  2NN6 I;  2I5M X;  1EIF A;  3HKZ G;  4DUZ Q;  1E1O A;  1CUK A;  1GKH A;  4BY1 G;  3GTL H;  4IFD G;  1KL9 A;  3F1Z A;  2MQH A;  4MTN A;  1K9M C;  1FGU A;  5IYB G;  3CCQ A;  3UDX A;  1PYB A;  2YU9 H;  2JA8 H;  3F2D A;  1GO3 E;  2UUB L;  3CCU A;  4IOA A;  4AIM A;  1HH2 P;  2HIV A;  2KCT A;  2QGQ A;  3CAM A;  4JI1 Q;  5C0X I;  4PZ6 A;  5AJ3 Q;  2ZJP A;  3CCR A;  4DUY L;  2EIF A;  2ZTC A;  4X62 L;  1SRO A;  1WYD A;  1IZ6 A;  4C3J H;  1QZG A;  4DV6 Q;  1TWC H;  1VQ4 A;  4POF A;  1N32 Q;  1B7Y B;  1PA6 A;  3FKI G;  4DV0 Q;  2L15 A;  1HZB A;  3CP0 A;  2B63 G;  1UE1 A;  5GAH C;  1PH1 A;  5JEA G;  4A3D G;  3H0G H;  3HOZ G;  1PH2 A;  1XTD A;  1CSQ A;  2HQL A;  4ALP A;  3PO2 H;  4DUZ L;  1VQP A;  3M9B A;  4DV2 L;  4AH6 A;  1TWH H;  2AKW B;  1IBL Q;  1Z9F A;  2IX1 A;  3KJO A;  4HIK A;  4JI5 Q;  3PUW A;  4L5S A;  4OXP A;  4GNX A;  2CKZ B;  4P73 A;  1OXX K;  3OW2 A;  2JEA I;  3I4M H;  5IYD G;  1JMC A;  4Y52 H;  1TWF H;  3RLF A;  1Y1V G;  2A8V A;  3RR5 A;  5BR8 L;  2WFW A;  4EQ5 A;  1HZC A;  3S1R H;  4DV6 L;  1PH6 A;  1RIP A;  4GNX B;  1K8G A;  1YHA A;  2VUM G;  2A19 A;  4A4I A;  1HNW L;  3K0X A;  1JB7 A;  1V1Q A;  4DR2 Q;  4AYB G;  4TVA B;  2JQO A;  4OWT B;  1XMO L;  3ICE A;  5C4X G;  3PUX A;  3CC4 A;  2VY3 A;  4GKJ L;  2JA6 G;  2K4K A;  1E1T A;  4JI2 Q;  4GKK Q;  1VQ7 A;  1HNX L;  1MIU A;  2ZTD A;  2Z6K A;  2EXD A;  1IBL L;  5FLM H;  2F3I A;  1EYG A;  3PUV A;  4JI5 L;  3CCJ A;  2PQA A;  1Q86 C;  4QGU A;  3L2P A;  2NVY H;  4AYB E;  2BH2 A;  4A3J H;  1XPO A;  2ALY B;  1Q12 A;  3BZC A;  3NBH B;  2QA4 A;  4JV5 Q;  1FVI A;  3CCE A;  4B3M Q;  1M1K C;  1X3G A;  2UUA L;  3JAM i;  4YWK A;  2JA5 H;  1SN8 A;  4NXN Q;  2KBN A;  2LXJ A;  3EN2 A;  1UE5 A;  3PO3 H;  1A8V A;  2ID0 A;  1N36 Q;  1VQN A;  2PNH A;  4EX5 A;  4DV4 Q;  5GAE C;  3A5Z B;  4WJ3 M;  5IWA Q;  4JC0 A;  2IX0 A;  4JOI C;  2XTI A;  3RLO A;  3I4N H;  1TWG H;  3LGJ A;  2JK8 A;  4HID A;  2VQF Q;  1GVP A;  2R7Z H;  1YI2 A;  1YJW A;  3PO2 G;  4IPG A;  1YHQ A;  2WAQ E;  4PMW A;  1NMG A;  1WOC A;  4MZ9 A;  4DK6 C;  1MKH A;  2GN5 A;  1A62 A;  2JE6 I;  3RZD H;  1X9N A;  1IBM Q;  4LF8 Q;  1C0A A;  1UE6 A;  5FLX c;  4LF6 Q;  1XNR Q;  4IPD A;  4OO1 I;  3F8T A;  4IPC A;  2D62 A;  2K5H A;  3RNU A;  2VQE L;  2XGT A;  4IPH A;  3FKI H;  1N33 L;  2B63 H;  1BBW A;  1WCM G;  3BU2 A;  3I4M G;  4LNQ A;  4DV1 Q;  1YHB A;  3HOZ H;  4JI4 Q;  1LYL A;  1EQR A;  1N36 L;  2N49 A;  2RF4 A;  4DV4 L;  5HGQ A;  1VQI A;  1VQ8 A;  4UY8 C;  3PIO A;  1L1O B;  5H1S E;  1QVG A;  1XJV A;  4LF5 Q;  3TRE A;  1JJC B;  1HJP A;  4YCW A;  3S1N H;  3KF6 A;  3S17 H;  2I5H A;  2Q2U A;  1S72 A;  4GS3 A;  1N34 Q;  1M90 C;  1YEZ A;  3J80 i;  2PI2 A;  3J81 i;  4GNX C;  4LF8 L;  2VNU D;  5FLM G;  2CWA A;  2F52 A;  3S24 A;  4DR4 L;  4LF6 L;  3KF6 B;  4X64 Q;  4X65 Q;  2UU9 L;  1SR3 A;  1P8L A;  2GVA A;  3K8A A;  2R92 H;  4JI3 Q;  4QL5 A;  5C4X H;  3U4Z A;  3GTO H;  3FHW A;  3KYH C;  3UE1 A;  1X3F A;  3D0F A;  5LMU L;  4DV1 L;  2Q2I A;  2KHI A;  1VQL A;  2JA6 H;  3U4V A;  3EBE A;  1YIT A;  5JJL A;  1V9P A;  1W3S A;  4BA2 I;  3PO3 G;  4JOI A;  3K80 C;  4A3L H;  1PHJ A;  4POG A;  3PIP A;  2UUC L;  3GDE A;  4JI0 L;  3W5O A;  2ASB A;  4C2M H;  5LMN Q;  3T1Y Q;  3KFU A;  4DR5 L;  2E5L Q;  2Z6K C;  2LSS A;  4KLK A;  3HOY H;  1PH8 A;  4IFD J;  5IE8 A;  3I4N G;  3GTQ H;  1QVC A;  1NMF A;  4R4T A;  1VQ5 A;  2R7Z G;  3F2C A;  4DR7 Q;  3S15 H;  1S40 A;  3HKZ E;  4A3E G;  3MXN B;  4R1J A;  3CQZ H;  3GTM H;  3M4O H;  1IBK L;  4DPG A;  1VQ6 A;  1YIJ A;  5K36 G;  4PZ8 A;  4JYA L;  5GRO A;  4KHP L;  1CKO A;  3PUY A;  4LFA Q;  4X66 L;  5IP9 G;  4OWW B;  3S16 H;  4GOP B;  1KRT A;  3KDF B;  1NBW A;  4HIO A;  2UXD Q;  1IL2 A;  4A3K H;  4YWL A;  3J7A 5;  5JEA J;  3I55 A;  4J15 A;  3IRB A;  2UXB Q;  4OON A;  5LMN L;  2E5L L;  4B3S Q;  1YJN A;  2F4V Q;  2K14 A;  2CFM A;  4YHH Q;  4O0A A;  1WCM H;  3L7Z C;  4O2D A;  5AJ3 L;  4A3B G;  4JI1 L;  4XIG S;  1KD1 C;  2ZM6 Q;  1XMQ Q;  2DGY A;  4GN4 B;  1OXS C;  4BBR H;  5FJ8 H;  2KEN A;  1L1O C;  1N32 L;  1VQM A;  4LFB Q;  3UDF A;  4JBK A;  4GLA C;  1I3Q H;  4DV0 L;  4DAM A;  2MO0 A;  3G48 A;  2VZA A;  3ZJY C;  4A75 A;  4LFC Q;  2R92 G;  2HT1 A;  3OTO Q;  3HOU G;  2OTL A;  2ZJR A;  1PV4 A;  2UXC L;  4LF4 Q;  1HR0 Q;  1V43 A;  4P71 A;  4B3T Q;  2UXB L;  2BH8 A;  2KHJ A;  1IYJ B;  3PGZ A;  1DGS A;  4A3L G;  2R93 H;  4DV7 Q;  3AQQ A;  2NZH A;  4Y7N H;  1KXL A;  5ELN A;  3HOY G;  1S3O A;  4YHH L;  4BXX G;  1KHI A;  2RHQ B;  3B6Y A;  2YV5 A;  3NEL A;  4P74 A;  5C0X G;  1Q81 C;  2R6G A;  3PCO B;  1PH4 A;  2ZM6 L;  2YTX A;  4LUO A;  1K8A C;  2JJQ A;  3HOW H;  5C0X J;  4IOC A;  3NEM A;  1XPR A;  1U0L A;  4LF7 Q;  1YVC A;  4DR1 Q;  1VQF A;  4LFB L;  1VQG A;  2YTV A;  3CCS A;  4DR2 L;  4LFC L;  4TQU S;  2WP8 J;  4C3H H;  4LF9 Q;  3ER0 A;  3OTO L;  2C35 B;  3G4S A;  4JCV E;  4JBW A;  2V1C C;  3AYH B;  4JI2 L;  4GKK L;  1KIX A;  1O7I A;  4A3K G;  4B3T L;  4YY3 Q;  5E7N A;  2VS1 A;  5M5X H;  3T1H Q;  1E7Z A;  3CC7 A;  1U5K A;  3M4Q A;  1VQ9 A;  4A3E H;  1RL2 A;  1XNQ Q;  5M5W H;  1EFW A;  3GTJ H;  3D31 A;  1VCI A;  4GOP C;  1EIY B;  1P16 A;  3GO5 A;  4JV5 L;  4JBM A;  5IP9 H;  1CKN B;  1L1O A;  4LUZ A;  1KC8 C;  1HNZ Q;  5DLQ E;  2OWO A;  2N3S A;  4LWC A;  2MNA A;  3H3V I;  1UWV A;  4NXN L;  3S2D H;  4A3G G;  4IFD I;  4LF7 L;  4BBR G;  5FJ8 G;  1L2F A;  1OTC A;  3TQY A;  2HIX A;  1D8L A;  3CMA A;  4JI8 Q;  3CCM A;  4NXM Q;  3AEV A;  2JA9 A;  2KCM A;  1X54 A;  3U58 A;  3CCV A;  2N78 A;  4DV5 Q;  1MJC A;  2AWN A;  1I5F A;  3STB D;  5IWA L;  5LMN W;  3JC6 6;  3OYY A;  4QQB X;  2R7F A;  3S1Q H;  2VQF L;  2YYZ A;  1JJ2 A;  4XTC S;  4UP7 A;  2BA0 A;  4DR3 L;  4QIW E;  4A3B H;  4OWX B;  4LW1 A;  1OXT A;  4DR6 Q;  1KAW A;  1T9H A;  4YY3 L;  4H02 A;  4K0K Q;  1N8R C;  1IXR A;  1VS0 A;  3T1H L;  1IBM L;  3PV0 A;  2R93 G;  3HOX H;  1Q82 C;  4JI7 Q;  2DUD A;  1LUZ A;  3M4P A;  4A3F G;  1XNR L;  5IY0 A;  5IT9 c;  3PF4 A;  2JA7 G;  3TS0 A;  1VQA A;  1FJG Q;  4DKA C;  4GLX A;  3K7U C;  1BVS A;  1SMX A;  1I94 Q;  1D7Q A;  1NJI C;  1QUQ A;  4LUV A;  1R9T H;  4HJA A;  2BA1 A;  3HOU H;  3H15 A;  1HNZ L;  4JG2 A;  3VDY A;  2E2J H;  1YNX A;  1Y1W H;  1VQK A;  3GTK H;  4B3M L;  3HOW G;  4JI4 L;  2PMZ E;  4KI0 A;  2B29 A;  4PG3 A;  3BZK A;  1QVF A;  3K81 C;  1QZH A;  1C9O A;  4DV3 Q;  1UE7 A;  5M5Y H;  1AE3 A;  1QUQ B;  3GTG H;  1X3E A;  3UDI A;  4DV5 L;  4BA1 I;  4LF5 L;  3A74 A;  3CW2 C;  4DUY Q;  2QEX A;  4BXX H;  3RLN A;  5JJI A;  1VQC A;  1TWA H;  4DNI A;  5JJK A;  2OQ0 A;  1N34 L;  1GM5 A;  3TEH B;  2K5V A;  3K7A H;  3UDG A;  4K0K L;  2IHE A;  3CCL A;  1Z47 A;  4OO1 G;  3S14 H;  4GOP A;  1OXV A;  3AFP A;  3KLW A;  3KDF A;  4X64 L;  5C3E H;  4X65 L;  5C44 H;  2VL6 A;  3G71 A;  2OTJ A;  1AH9 A;  4QY7 A;  1PH7 A;  2D0O A;  5GQO A;  4DR3 Q;  1K0R A;  3I7F A;  4R4C A;  4JI3 L;  4R4O A;  1Q7Y C;  1SRU A;  3DM3 A;  4DV2 Q;  1EWI A;  2E2H H;  3GTP H;  4UP8 A;  1X55 A;  3ULJ A;  4IJL A;  1SE8 A;  3MEF A;  1J5E Q;  2FXQ A;  4KHZ A;  4DV3 L;  2Y0S G;  4PZ7 A;  2RCN A;  1BKB A;  3STB C;  1G6P A;  4P72 A;  1HR0 W;  3I4O A;  2NZO A;  3T1Y L;  1JE5 A;  3Q8D A;  3M3Y H;  3TRZ A;  4APV A;  1W2B A;  2D0P A;  3M85 A;  1PVO A;  4IJH A;  5BR8 Q;  1YBY A;  2Q2H A;  3A0J A;  3ULL A;  3RZO H;  1HNW Q;  3HOV H;  1J6Q A;  4DR7 L;  4A3G H;  3U50 C;  2K50 A;  1SLJ A;  2MFI A;  3W1B A;  3HOX G;  3F2B A;  1XMO Q;  2Y0S E;  3I2Z A;  2E8G A;  2NVX H;  4GKJ Q;  4X6A H;  4NPS A; 
#chains in the Genus database with same CATH topology
 2ZJQ A;  4A3M H;  4ODG A;  1WCM B;  2MUY A;  2F0D A;  5E4X A;  1KQS A;  1EUJ A;  4A3I H;  4BBS H;  4RGM A;  1ILP A;  4RH6 A;  2HHH Q;  3A5U A;  4JBJ A;  1X56 A;  4BBR B;  3CME A;  1PTO B;  2EPB A;  3HEJ A;  4PMB A;  4KKT A;  2JA7 H;  4B3R Q;  3TP5 A;  4F8M A;  4QMG A;  3CF5 A;  4CKE A;  1PH3 A;  1PH5 A;  5FO9 B;  1WI5 A;  2F0S A;  5IP7 H;  1KRS A;  3JAM c;  1BBX C;  1A0I A;  2XIW A;  2AMC B;  5C3E G;  2ATW A;  2D9U A;  2LMC B;  2JP1 A;  1MSH A;  1Q3L A;  1B8A A;  1K3R A;  2C9O A;  4G4K A;  4ID6 A;  1G51 A;  4WJ4 A;  2BE5 C;  4BS9 A;  1HR0 L;  2BOS A;  2QIL A;  2AWO A;  4OEM B;  2JA8 G;  1L0W A;  3ZYY X;  5I9P A;  1EQT A;  1G91 A;  1ENA A;  3E9H A;  5IGC A;  2WAQ G;  4C3H B;  3H3V H;  5C4J H;  1VQO A;  1LTL A;  3IL8 A;  3PF5 A;  4QJF A;  1GD7 A;  1KLG D;  3HOV G;  1SAP A;  4K5V A;  1HUN A;  3SGI A;  1DYQ A;  3J81 j;  1GXD C;  2K5W A;  1E22 A;  3SHL A;  5M5W B;  3ITP A;  4KMU C;  2A6H D;  4LF9 L;  4JI6 L;  3CD6 A;  5CV6 A;  4UHV A;  4DR4 Q;  1HXY D;  3NEN A;  5I6Y A;  1SE2 A;  3E0E A;  2EJG C;  4K5W A;  4KY6 A;  4K2L A;  1G29 1;  4J1M A;  3J80 c;  3J81 c;  2PW5 A;  2CQO A;  4L5T A;  1XNQ L;  4QCL A;  5LMU Q;  2ES2 A;  3PIP 3;  1SMY D;  2B3G A;  3KF8 B;  2O4X A;  3BJU A;  2L12 A;  3TZD A;  2K52 A;  3CHB D;  2NVT H;  1ASZ A;  3F2U A;  3FVQ A;  5J3B A;  4BY7 G;  1ZXT A;  4ZQ3 A;  1F2L A;  5IYD H;  3EIV A;  1TXY A;  1I6H H;  2A1A A;  2WKD A;  1VF7 A;  2CWP A;  3IFD A;  4B9W A;  4IO9 A;  3Q0A A;  4KD3 A;  1HZA A;  3OIQ A;  3DWA A;  4A3J G;  4A3C H;  1FL0 A;  2EE1 A;  3GTG B;  4HJ8 A;  2KED A;  5IYC G;  1FJG L;  4F88 A;  1EIF A;  4KKS A;  1E1O A;  1CUK A;  4BY1 G;  4IFD G;  4FNF A;  1ENF A;  3I3C A;  3SDZ A;  4CDE C;  1FGU A;  5IYB G;  2F0N A;  1GO3 E;  4AIM A;  2ZJP A;  4X62 L;  1O7Z A;  1SRO A;  1TU2 B;  2A68 D;  3NTK A;  1IZ6 A;  4C3J H;  1VQ4 A;  2SNM A;  1TY2 A;  4DV0 Q;  2B63 G;  5GAH C;  3VR5 A;  5JEA G;  4B08 A;  2VXW A;  1PH2 A;  2HQL A;  5J22 A;  4UDU C;  3D3R A;  3NTI A;  4KY5 A;  4XDX A;  2EXZ A;  2K05 A;  3QOJ A;  1I4Q A;  3I90 A;  3PUW A;  2ZXR A;  1V1P A;  5BN5 A;  4PV1 C;  5C6A A;  1Q8I A;  2NVX B;  1Y1V G;  2A8V A;  3RR5 A;  4EQ5 A;  1XWE A;  4J8Q A;  1RIP A;  4DV6 L;  1LAC A;  1JOR A;  1HNW L;  1JB7 A;  4IUP A;  4R8N A;  2JQO A;  4FO2 A;  3PUX A;  1KAB A;  2VY3 A;  4GKJ L;  2K4K A;  1F9S A;  2MGS A;  1VQ7 A;  2B2U C;  2B2Y C;  1UUP A;  2EXD A;  3D4W A;  2F3I A;  3QR8 A;  1EYG A;  3CCJ A;  5JJZ A;  1U4P A;  4QGU A;  1SBB B;  1XPO A;  3NBH B;  3DEP A;  1FVI A;  3X3M A;  3CCE A;  5ISR A;  4B3M Q;  1SNQ A;  3S2H B;  1D5Z C;  4A93 B;  2KBN A;  4KHV A;  3EQL C;  5M3F B;  1QNK A;  5KNB A;  1VQN A;  2CHB D;  4EX5 A;  4DV4 Q;  4JOI C;  3RLO A;  1LV9 A;  2FIN B;  1D2B A;  4KKU A;  5J39 A;  2A5H A;  4CBV A;  2JA5 B;  1YHQ A;  1NMG A;  3G6J B;  1IBM Q;  2GN5 A;  1JC7 A;  4HED A;  4LMQ D;  1AP0 A;  3KK7 A;  1DJR D;  4ME5 A;  3MTS A;  2VQE L;  2XGT A;  2BDO A;  3FKI H;  2F0G A;  1VMP A;  1H9R A;  4ABN A;  5IT9 E;  1YHB A;  2E2I B;  1FNW A;  3U9O A;  4JI4 Q;  1DOM A;  1VQ8 A;  1QVG A;  1LTB D;  2B2U A;  2B2Y A;  2WII B;  3S1N H;  1B3A A;  2I5H A;  2Q2U A;  2H4O A;  4GS3 A;  1N34 Q;  1YEZ A;  3Q23 A;  2IPK D;  4OIK A;  1ET9 A;  2PI2 A;  4GNX C;  4LF8 L;  2UU9 L;  4RA8 A;  2GVA A;  3U4Z A;  3GTO H;  1DOK A;  2L1B A;  4N9T A;  1FGB D;  1PFN A;  1X3F A;  3D0F A;  4I7A A;  3EBE A;  1YIT A;  1W3S A;  4BA2 I;  1EY9 A;  3PO3 G;  3OHX C;  4JOI A;  2VUM B;  3FPU B;  4A3L H;  3GV6 A;  3KFU A;  3GDE A;  4JI0 L;  4FYD A;  3T1Y Q;  1F2Y A;  3HOY H;  1SNP A;  3GTQ H;  1AEX A;  5C4X B;  1K8O A;  2F0W A;  2R7Z G;  5K5P A;  3F2C A;  5C3X A;  5DM6 3;  3EFX D;  1IKL A;  3HKZ E;  4DF7 A;  3CQZ H;  3OPO A;  3M4O H;  2K04 A;  4DGZ A;  1F2Z A;  1SYE A;  3OIP A;  1CKO A;  1LT5 D;  4X66 L;  1KRT A;  3SE0 A;  3CKI B;  1NBW A;  5FO7 B;  3H3V C;  1IL2 A;  4A3K H;  3J7A 5;  1KDA A;  1YNN D;  4PMC A;  4Q5V A;  3TP7 A;  3EVQ A;  1YJN A;  2K14 A;  2E75 C;  1EWC A;  4YHH Q;  1XX8 A;  3S16 B;  1WCM H;  1I4H A;  4A3B G;  4NP5 A;  1NNX A;  1O7L A;  4JI1 L;  2ZXP A;  5CR3 A;  2ZM6 Q;  3PO2 B;  1V8Q A;  2F0F A;  4BBR H;  1PTO H;  1L1O C;  2PYK A;  4JBK A;  1CT1 D;  3R2T A;  2MO0 A;  2VZA A;  4A75 A;  5D3I B;  3HOU G;  1TWF B;  2ZJR A;  1AFP A;  5J1Z A;  1HR0 Q;  3L3O C;  4P71 A;  2F3W A;  2BH8 A;  5IGB A;  3J81 L;  1QG7 A;  3AQQ A;  2X6G A;  2EY1 A;  5CBE E;  2NZH A;  5ELN A;  2RHQ B;  5C0X G;  1SNM A;  4P74 A;  1Q81 C;  2LFN A;  2IWH A;  1K8A C;  4LUO A;  1K28 A;  5C4Z A;  2KEE A;  3SK6 A;  3SXH A;  3NEM A;  5C0X J;  1U0L A;  1XPR A;  2F0O A;  2PZT A;  4C3H H;  2NVY B;  4LF9 Q;  3OTO L;  2HQE A;  4JBW A;  4JI2 L;  3NTH A;  2DY8 A;  3A54 A;  4B3T L;  5E7N A;  2VS1 A;  5M9O A;  3CC7 A;  4KK7 A;  3R8B A;  4A3E H;  1XNQ Q;  5M5W H;  4OHJ A;  1VCI A;  1RF2 D;  5IP9 H;  1L1O A;  2N3S A;  1BCP B;  2MNA A;  1UWV A;  4NXN L;  1Y8P B;  3P7J A;  5EGT A;  3CMA A;  3C1F A;  3HS0 C;  1D5M C;  4CJ2 C;  3U58 A;  2HDM A;  3CCV A;  3RUZ A;  1RKN A;  2Q8R E;  3STB D;  5LMN W;  4M1U B;  1PRT F;  3JC6 6;  3OYY A;  5CGK A;  4QIW E;  4EQN A;  3HOZ B;  1T9H A;  2NTS A;  1H9J A;  3T1H L;  2DJF C;  2JA7 G;  1FJG Q;  1BVS A;  1SMX A;  4LUV A;  1HCZ A;  3H15 A;  1E2W A;  1UEA B;  3HOW G;  2PMZ E;  2B29 A;  5D14 A;  3GTG H;  4DV5 L;  2WKC A;  1KDB A;  4HTH A;  3CW2 C;  3K57 A;  5COY A;  4BXX H;  1VDZ A;  4IUV A;  3MVV A;  3VR4 A;  4XQJ A;  1VQC A;  2I07 B;  2OQ0 A;  3FRP B;  3C1E A;  1YNJ D;  2JA6 B;  3GTK B;  2J4X A;  2RVL A;  3ND8 A;  1Z47 A;  3HG9 A;  3TBI B;  1OXV A;  4X65 L;  1I4P A;  2OTJ A;  2NWG A;  1S5B D;  2D0O A;  5GQO A;  1K0R A;  4DR3 Q;  1I4R A;  4JI3 L;  2KEC A;  5CYU A;  2E2H H;  1TWA B;  3KLS X;  1WTW A;  1X55 A;  3C3L A;  3TP6 A;  2EYO A;  3S15 B;  2PPB C;  1JE4 A;  2Y0S G;  3BVG A;  2F0V A;  3K5M A;  2D0P A;  1PVO A;  1YBY A;  1JIC A;  3ULL A;  1HNW Q;  1B4O A;  4DR7 L;  4DK1 A;  1U9R A;  2LS0 1;  3U50 C;  3W1B A;  3F2B A;  2MFI A;  3HRZ C;  2NVX H;  4GKJ Q;  4U68 A;  4X6A H;  1EQV A;  4OX9 Q;  4ME3 A;  2K28 A;  1CI3 M;  4QIW B;  1IW7 C;  3ERS X;  1J5E L;  2VB3 X;  2UXD L;  1KDC A;  1KNA A;  4FP5 D;  2RQX A;  4HJ7 A;  3T51 B;  3K5O A;  4B3S L;  3E3X A;  2F4V L;  4K2K A;  2ZTE A;  1ZKO A;  1EIH A;  5I2X A;  1DM0 B;  3LWU A;  1EOV A;  3TN2 A;  1L0X B;  4A3C G;  1NE3 A;  3W2D A;  2R93 B;  3AFQ A;  1ESF A;  1OXU A;  1TS4 A;  3NWS A;  3S2H H;  4A93 H;  3GD7 A;  1U4R A;  5M3F H;  4YCU A;  1H9K A;  2MHV A;  2F3V A;  5ELO A;  2VW9 A;  1B2T A;  4JK1 C;  4XXE A;  4MNO A;  2VQE Q;  1G2S A;  1PYS B;  4OO1 H;  4AQY L;  2M2L A;  3A55 A;  2PQA B;  1JWS D;  3CPW A;  1A2U A;  1Q1E A;  2QDB A;  3V96 A;  3BYY B;  1PH9 A;  4DNR B;  3FP9 A;  2LXK A;  1GUW A;  2QDL A;  3CPF A;  3LNN A;  2E2I H;  5M3M G;  4L6T B;  2MO1 A;  1J9O A;  4IUT A;  3S9W A;  1O78 A;  5IOC A;  2F0T A;  1LO5 D;  1F9Q A;  3RN5 A;  2UU9 Q;  1BOS A;  3PUZ A;  4L8J A;  4P75 A;  5JAV A;  1A3T A;  4PNY A;  2NTT A;  1E24 A;  1I50 B;  2NBF A;  5E4W C;  4HJ5 A;  5EBD A;  4A76 A;  1D1K A;  3G6E A;  2WB1 G;  4JI0 Q;  1PTO C;  5C5M A;  4NXM L;  4J6H A;  4ULL A;  1ASY A;  1JB3 A;  3HOX B;  2XNA C;  2XWJ B;  4H13 C;  4L5Q A;  2UUB Q;  1Y8N B;  1H95 A;  3W1G A;  2UXC Q;  1MJE A;  1JOK A;  2EQS A;  4IUR A;  2F0U A;  2VUM H;  1R9T B;  2F0P A;  1AZQ A;  2K6A A;  1VQE A;  3C46 A;  4ZAI A;  3KOJ A;  2R61 A;  1QNU A;  5M5Y B;  3HGB A;  4X66 Q;  3H91 A;  5EAY A;  5HY6 A;  4DFA A;  5LL6 S;  2IW3 A;  1IYU A;  1F9R A;  1KL9 A;  3F1Z A;  2SDF A;  4HAE A;  4MTN A;  5FO8 B;  3CCQ A;  4V0B A;  3UDX A;  3VR2 A;  5C3E B;  1DOL A;  2HIV A;  3CAM A;  4DA2 A;  4A3D G;  4JI1 Q;  4PZ6 A;  2EIF A;  1WYD A;  1EY5 A;  1GOZ A;  1TT2 A;  4TRD A;  2R3Z A;  3M7G A;  3FKI G;  2KHS A;  2L15 A;  2LKV A;  1HPC A;  4HSV A;  2JA8 B;  1PH1 A;  3NPP A;  1JQY D;  3M3Y B;  4C56 C;  3PO2 H;  4DUZ L;  1B1Z A;  3M9B A;  1VQP A;  5L37 A;  3RZO B;  4JI5 Q;  3HOV B;  4A3G B;  3K5N A;  4G57 A;  2EJF C;  3TME A;  5G3L F;  4P73 A;  1OXX K;  2F0M A;  1CQF A;  2QEJ C;  3D8G A;  2JEA I;  1SYC A;  4Y52 H;  1TWF H;  3RLF A;  1AN8 A;  5EPL A;  3S1R H;  1K8G A;  1FD7 D;  2V4D A;  3K0X A;  1V1Q A;  2AUK A;  4AYB G;  4B9X A;  1STG A;  4K14 A;  4OWT B;  1JCK B;  1I4X A;  3T4A C;  4JI2 Q;  1HNX L;  1MIU A;  3KBG A;  2Z6K A;  5COR A;  5EKI A;  3T53 B;  1IBL L;  2K7V A;  2BCO A;  3MXG A;  2NVY H;  3DEO A;  1EFI D;  4DNT B;  1Q12 A;  1VMC A;  2QA4 A;  4LAA A;  4BY7 B;  2DN8 A;  3DMU A;  1M1K C;  2EJM A;  1PZI D;  1SN8 A;  1S5E D;  4NXN Q;  2LXJ A;  3AMU A;  4MHE A;  3P75 A;  4OIJ A;  3S1M B;  2XTI A;  1TWG H;  3MXP A;  4O1N A;  4IPG A;  4PMW A;  1MKH A;  1C0A A;  4BY1 B;  3VYR A;  2G5D A;  5FLX c;  4IPD A;  1BXT A;  2G9H D;  3F8T A;  4C3I B;  4IPH A;  5K36 H;  3KF8 A;  1N33 L;  4UAI A;  1BBW A;  1WCM G;  4DN4 M;  3I4M G;  3BVZ A;  3HOZ H;  3K0Y A;  4P2C B;  1LYL A;  1N36 L;  1XXG A;  2RF4 A;  3QJY A;  5HGQ A;  2EYH A;  1TVX A;  4YCW A;  3KF6 A;  2B63 B;  3S17 H;  4XYO A;  2VNU D;  1UNS A;  5G3L D;  5FLM G;  2F52 A;  1T5X D;  1TII D;  4LF6 L;  3KF6 B;  1HFG A;  1JR0 D;  4X65 Q;  1P8L A;  4JI3 Q;  1SJE D;  1GUT A;  3FHW A;  3KYH C;  3UE1 A;  4DV1 L;  2JA6 H;  2NVQ B;  2Q2I A;  1Y1V B;  1M8A A;  3KBX A;  5JJL A;  1W6J A;  2ZT9 C;  1PZK D;  1RHP A;  2F0H A;  2WV6 D;  4MN3 A;  3HP3 A;  5F2D A;  5CV4 A;  4POG A;  3PIP A;  4DR5 L;  2CW0 C;  5KRU A;  4IFD J;  3I4N G;  1QVC A;  4ZCK A;  4R4T A;  1W6K A;  3LX0 A;  3H09 A;  3L9A X;  4DR7 Q;  1BR9 A;  3S15 H;  1AZP A;  3GTL B;  1HQR D;  4A3E G;  3MXN B;  4R1J A;  3K58 A;  4C2M B;  5EBC A;  3ND9 A;  1ICW A;  4I65 A;  1YIJ A;  1U4L A;  1E2V A;  4JYA L;  1ICF B;  5GRO A;  5IP9 G;  2K1B A;  4GOP B;  4QUC A;  3KDF B;  2UXD Q;  1WVL A;  1LTT D;  1PZJ D;  1TQO A;  5JEA J;  1S5C D;  4OON A;  5LMN L;  2Q8I B;  2E5L L;  4B3S Q;  3SK5 A;  2F4V Q;  1SYB A;  4XYQ A;  4Z9C B;  4C1N K;  5KND A;  2EYL A;  4O2D A;  5EJW A;  4EGV A;  1EY4 A;  1D1I A;  3H0G B;  4XIG S;  1KD1 C;  4FF3 A;  2Z9H A;  3CRL C;  4GN4 B;  4RHS A;  1OXS C;  4KV6 A;  3SK4 A;  5FJ8 H;  4CJ1 B;  1TWH B;  3SK8 A;  2L55 A;  3QO2 A;  1DXM A;  1CZG A;  4LFC Q;  4ZLT F;  3G48 A;  3ZJY C;  2R92 G;  2HT1 A;  4CHT B;  3NBH A;  2UXB L;  2R93 H;  5JPM C;  1K3B C;  1I3Q B;  3NK9 A;  4CJ0 B;  1S3O A;  4BXX G;  2K5Q A;  1KHI A;  2PZW A;  1IYV A;  2YV5 A;  5EQ0 A;  1PH4 A;  2YTX A;  1YVC A;  1IKM A;  1C4Q A;  1LLR D;  3VA5 A;  4LFB L;  1VQG A;  2YTV A;  3J7Y W;  3CCS A;  1JOQ A;  2E74 C;  3ER0 A;  3G4S A;  2C35 B;  3NP8 A;  2F1M A;  2QKI C;  3MZ5 A;  1K8M A;  4GKK L;  1SE4 A;  3BS1 A;  1O7I A;  1TS2 A;  4YY3 Q;  2PZU A;  3PO3 B;  3M4Q A;  1RL2 A;  4JW0 A;  3K59 A;  3D31 A;  3UI2 A;  1P16 A;  4JV5 L;  3J80 E;  3J81 E;  5D3D A;  1CKN B;  1HNZ Q;  2R7Z B;  1HRJ A;  1XTC D;  2JSO A;  4IFD I;  1EY6 A;  3T56 B;  3W3A A;  1UAP A;  4LF7 L;  2F0E A;  4V19 0;  1L2F A;  4NXM Q;  3TQY A;  2HIX A;  1D8L A;  3RZD B;  1X54 A;  1MD2 D;  2CH4 A;  5IWA L;  1I5F A;  2G9D A;  3GTJ B;  1G6Z A;  1SSO A;  1NR2 A;  4X3T A;  2R7F A;  4QQB X;  1DON A;  2YYZ A;  1JJ2 A;  2BA0 A;  4LW1 A;  1OXT A;  2RKS A;  3E5S A;  4H02 A;  1QOH A;  3HOX H;  5ELB A;  4M8A A;  2EVB A;  2DUD A;  4HN7 A;  5IY0 A;  1TS5 A;  1STA A;  4WRD A;  1EEF D;  1R9T H;  1T5E A;  4HSP A;  4RHR A;  4JG2 A;  1QWY A;  3OWE B;  3VA7 A;  3VDY A;  4A3B B;  2XVS A;  5AFW A;  4PG3 A;  5CC4 A;  1QVF A;  3K81 C;  3ONA B;  1UE7 A;  5M5Y H;  3UDI A;  3VYU A;  3A8J E;  5IGE A;  4LF5 L;  3A74 A;  4IUU A;  3RLN A;  3HOU B;  2SNS A;  5ELE A;  1GM5 A;  1WD0 A;  4K0K L;  1SNO A;  4HCE A;  4OO1 G;  3JAM L;  1EL0 A;  5A2Q L;  1G2T A;  2KQ3 A;  3KLW A;  1PLF A;  5C3E H;  2VL6 A;  1I4G A;  1AH9 A;  2I46 A;  1Q7Y C;  1EWI A;  3FPP A;  4F7X A;  3MEF A;  5E3F A;  1V1O A;  4KHZ A;  4DV3 L;  3STB C;  2N55 A;  1G6P A;  4G7O C;  1HR0 W;  3GTM B;  1JE5 A;  3M3Y H;  3TRZ A;  1CQV A;  1W2B A;  2JXM B;  1B9M A;  1BCP C;  1TY0 A;  3RZO H;  3HOV H;  4A3G H;  3KLR A;  2M00 A;  1ENC A;  1ROD A;  2Y0S E;  2E8G A;  4NPS A;  4YCV A;  2K01 A;  2Z0S A;  3QB3 A;  1HNX Q;  4OL7 A;  1HTP A;  4LFA L;  3TS2 A;  1NY4 A;  2NN6 G;  2AQ1 B;  1WFQ A;  5FLX L;  1Y1W G;  3DHQ A;  2B8F A;  2RCF A;  2EYM A;  4KY7 A;  1RD9 D;  1RJT A;  3J80 L;  3A8I E;  1TR5 A;  4RKL A;  1YNJ C;  1ZYR C;  1CA5 A;  1EYC A;  3R3O A;  2ICI A;  3J7Z C;  3CXC A;  2A69 C;  2Q2T A;  4H44 C;  1Q8K A;  3DWP A;  1B70 B;  2I0Q A;  5C44 G;  4BY7 H;  5TSS A;  1X65 A;  5I9O A;  1X3P A;  4FDB A;  4JI6 Q;  3HKS A;  3R2I A;  4R4I A;  1K73 C;  3S1M H;  2RHS B;  2HHH L;  4E6I A;  4LF4 L;  3HOW B;  1XPU A;  1LM0 A;  1HHV A;  4NB3 A;  5JVH 3;  1N9W A;  1N33 Q;  5GAG C;  1EYA A;  1UEB A;  4B3R L;  4IUN A;  4HJ9 A;  2JEB I;  5IYC H;  2WIN B;  4ZRZ A;  4ZKC B;  1PFS A;  4KN4 C;  1L0Y B;  4BY1 H;  3T16 A;  2J0T D;  4C3I H;  5IYB H;  1WJJ A;  1ZEQ X;  2AQ3 B;  2K32 A;  3OMC A;  2C5C A;  1HZ9 A;  1LAB A;  3PSI A;  4RFB A;  4A3M G;  5C4J B;  1SYD A;  1Z6H A;  1LT6 D;  1Q90 A;  1PFM A;  1BBU A;  4A3I G;  4BBS G;  5FOB B;  3KJP A;  5EKK A;  2TMP A;  2Y0S B;  1RTN A;  5JEA H;  1Y14 B;  3UE0 A;  1AE2 A;  4L5R C;  2Z4I A;  4JPB W;  3S1Q B;  5IGG A;  1SXT A;  2A6E C;  2I5L X;  1X6O A;  5IP7 G;  4DR5 Q;  1EY7 A;  1YZ6 A;  4GLV B;  2GA4 B;  1CKM A;  1Y69 U;  2NVQ H;  1Y1V H;  3I56 A;  5BN3 A;  2MJ8 A;  4GN5 A;  4X62 Q;  2YTY A;  1F9P A;  3SVM A;  1VQJ A;  4DR6 L;  2E2J B;  3R93 A;  2WB1 E;  5JVG 3;  2WAC A;  4WFN 3;  4JYA Q;  5E1F A;  1A2T A;  3BVM A;  4ZYS A;  2NN6 I;  3HKZ G;  1GKH A;  3GTL H;  1C48 A;  2MQH A;  3QWN A;  5JPN C;  1PYB A;  4IOA A;  1LTG D;  3CCU A;  1BO0 A;  1RTO A;  2QGQ A;  2KCT A;  5C0X I;  4DUY L;  3CCR A;  1QZG A;  2K5D A;  4DV6 Q;  1H9S B;  3GTP B;  4POF A;  2PCF B;  3MAQ A;  3A56 A;  1B7Y B;  1PRT B;  1PA6 A;  2K33 A;  1UE1 A;  3I73 A;  1E0B A;  3H0G H;  2EY6 A;  3HOZ G;  1XTD A;  1CSQ A;  4AH6 A;  1TWH H;  4DXF A;  2DY7 A;  2IX1 A;  3DWQ A;  4HIK A;  2KCC A;  4H0L C;  1MHW C;  1D5X C;  4OXP A;  1WTO A;  5HUR A;  2RA4 A;  4CDC C;  1S5F D;  1JWM D;  1PRT D;  3OMG A;  3OW2 A;  5IYD G;  1BUV T;  2CQA A;  5ELF A;  4RGO S;  5M3M B;  5BR8 L;  2WFW A;  4WOR A;  4A4I A;  2OEO A;  5C4H A;  1EY8 A;  2KOL A;  4TVA B;  3QG1 A;  5DAU A;  2X69 A;  3H94 A;  3CC4 A;  2FHT A;  2JA6 G;  4A3F B;  2SEB D;  4GKK Q;  2ZTD A;  2XWB B;  3PUV A;  2PQA A;  1Q86 C;  2M9V A;  2WB1 B;  3L2P A;  4AYB E;  1STB A;  2L0C A;  3BZC A;  4JVZ A;  4JV5 Q;  4BWG B;  4RCN A;  4C1N I;  3A7A B;  1X3G A;  3ERQ A;  2UUA L;  3BYT B;  2JA5 H;  4C3J G;  2RDG A;  1UE5 A;  3PIO 3;  3PO3 H;  4RAU C;  1R4P B;  2PNH A;  5GAE C;  2JN4 A;  4L63 B;  5EPJ A;  5IWA Q;  3MEH A;  1SFO B;  1ESR A;  2IJ0 A;  4HID A;  1GVP A;  2R7Z H;  1YI2 A;  2L4N A;  1YJW A;  3PMF A;  2CH4 W;  2KCN A;  2WAQ E;  4DK6 C;  4MZ9 A;  4U67 3;  1X9N A;  4LF8 Q;  3RZD H;  4KTA A;  2B8G A;  3IFT A;  4YIJ A;  3P20 A;  3RNU A;  2K5H A;  1Y8O B;  3NUC A;  3BU2 A;  2F0I A;  3MXU A;  2D2C C;  2EY2 A;  4IAL A;  4TKO B;  4A3D B;  1NR4 A;  1K83 B;  3ERO A;  3NWT A;  1EQR A;  1QJO A;  1F2M A;  2N49 A;  3Q22 A;  2EYF A;  4DV4 L;  1VQI A;  4UY8 C;  1E2Z A;  3PIO A;  5H1S E;  3P1H A;  4X3U A;  4LF5 Q;  3TRE A;  1JJC B;  1EYD A;  1HJP A;  3MFY A;  1SND A;  4IQZ A;  1S72 A;  1A6X A;  3DUZ A;  1M90 C;  1S5D D;  2A74 C;  2L9H A;  3SEB A;  1B50 A;  2CWA A;  3S24 A;  1QCB D;  1SYG A;  4O42 A;  2EZV A;  1SR3 A;  1SEB D;  3K8A A;  2EDG A;  5C4X H;  1PTO F;  2B39 A;  2KHI A;  3U4V A;  1IW7 D;  3OSO A;  2F4I A;  2D5D A;  1PHJ A;  2UUC L;  4G7H C;  2O5J C;  4AYB B;  2Z6K C;  2LSS A;  4KLK A;  1HFN A;  2B2W C;  3VYS A;  1PH8 A;  2L5T A;  5IE8 A;  2A6H C;  2PW7 A;  1NMF A;  5C0X H;  1VQ5 A;  4PQX A;  4ZUI A;  2KA7 A;  4DK0 A;  4CKB A;  1NAP A;  3V05 A;  4CDD C;  5CMD A;  4IN3 A;  3GTM H;  5DEH A;  1IBK L;  4DPG A;  1VQ6 A;  2IX3 A;  4EQP A;  3GTQ B;  1SMY C;  4KHP L;  4LFA Q;  3S16 H;  3U9S A;  2WAQ B;  1LTI D;  4YWL A;  4RGT A;  3WOF A;  3I55 A;  1TWC B;  3IRB A;  4J15 A;  4DXG A;  4X3S A;  3D4D A;  4MTK A;  3L7Z C;  3IAY A;  5AJ3 L;  3KLS A;  4FF4 A;  2DGY A;  5KEE A;  2KEN A;  1N32 L;  4K6D A;  3UDF A;  3OTO Q;  3I4M B;  1VF5 C;  4QUF A;  1PV4 A;  4KJN A;  4LF4 Q;  2B2W A;  1DCZ A;  2RSO A;  4B3T Q;  2KUM A;  1DGS A;  1S4Z A;  4NW2 A;  4A3L G;  5CV8 A;  3E6Z X;  1KXL A;  3HOY G;  1DZ1 A;  1ML0 D;  4YHH L;  3B6Y A;  3NEL A;  2A68 C;  2FJ2 A;  2R6G A;  4NKL A;  2ZM6 L;  3HOW H;  1B9N A;  4IOC A;  1GUO A;  1PTO D;  4DR2 L;  2RDF A;  2PQE A;  2WP8 J;  1WTR A;  1PXU A;  1NCV A;  4A3J B;  4JCV E;  4G7Z C;  5KYI A;  3NXW A;  2V1C C;  2QCP X;  3NQI A;  4A3K G;  3T1H Q;  1E7Z A;  1JWU D;  1U5K A;  1VQ9 A;  2LY7 A;  1FYC A;  1GUG A;  1EFW A;  1RDP D;  4XQN A;  5C5L A;  4GOP C;  3I4N B;  5FKA C;  4JBM A;  3MFG A;  2OWO A;  1BF4 A;  1KC8 C;  4DAV A;  5DLQ E;  4A3G G;  4LWC A;  3N52 A;  1WTQ A;  5A35 A;  4BBR G;  4ILW A;  3OW7 A;  3URY A;  2ICE C;  3CCM A;  1SYF A;  1OTC A;  1RCV D;  2F0K A;  2KCM A;  4A3E B;  5DNF A;  2N78 A;  1G8Z D;  4DV5 Q;  1MJC A;  4TSS A;  2AWN A;  3NHH A;  5IIF A;  5D65 A;  5DM7 3;  3S1Q H;  2VQF L;  4UP7 A;  4DR6 Q;  4OWX B;  4KD4 A;  2HD3 A;  3D6C A;  1N8R C;  1IXR A;  1VS0 A;  2NB0 A;  3PV0 A;  1Q82 C;  1XYI A;  4QB4 A;  1LUZ A;  1XNR L;  3PF4 A;  5IT9 c;  3TS0 A;  1HTL D;  5NUC A;  4GLX A;  3K7U C;  1D7Q A;  2BA1 A;  1A3U A;  2E2J H;  1VQK A;  2B2V C;  3GTK H;  1FR3 A;  1EU4 A;  4FVM A;  4KI0 A;  3BZK A;  4RGN A;  1C9O A;  3NBI A;  5HGT A;  1O7Y A;  4C3H G;  4DUY Q;  2QEX A;  2R92 B;  1R4Q B;  3MXN A;  5JJI A;  1TWA H;  5JJK A;  2YU9 B;  3I4L A;  3TEH B;  2K5V A;  4GOP A;  1BDO A;  3AFP A;  3KDF A;  4X64 L;  3G71 A;  4QY7 A;  3I91 A;  4R4C A;  3DXJ C;  3GTP H;  3ULJ A;  1KAA A;  4C3I G;  5IGF A;  1J5E Q;  3Q24 A;  2FXQ A;  2QW7 A;  4K5X A;  2OF1 A;  3BZD B;  2RCN A;  3MWY W;  1BKB A;  3C2P A;  3I4O A;  2BE5 D;  2NZO A;  3Q8D A;  1WD1 A;  2F0Q A;  4IJH A;  5BR8 Q;  2E2H B;  1II3 A;  1TKW B;  5ELC A;  5I6W A;  4N8X 1;  2K50 A;  1SLJ A;  3I2Z A;  5LL6 X;  3NSW A;  3O13 A;  4DR3 L;  1IL8 A;  2AHO B;  1VQB A;  2B2V A;  1GHK A;  5M3M H;  3JAM E;  3AB9 A;  5A2Q E;  3GV3 A;  1STY A;  4UP9 A;  1VQH A;  1HA6 A;  3ULP A;  2RSN A;  1LT3 D;  4HIM A;  4YWM A;  3RN2 A;  1CHQ D;  4AQY Q;  2IY5 B;  5GAD C;  4A3F H;  4IZ8 A;  3A7L A;  2UUA Q;  3M7N A;  2IHF A;  3VR6 A;  3MHB A;  1CSP A;  1V1P B;  2OCE A;  1XMQ L;  2EYJ A;  3E9I A;  1KLU D;  4K8I A;  4DAY A;  1I6V C;  2PI2 E;  3WWV A;  1AW7 A;  4OX9 L;  1DD2 A;  4Y7N B;  5IGD A;  2OQK A;  1NTG A;  1EEI D;  1HUM A;  1Q46 A;  4GZY C;  4DAY B;  3AU7 A;  1YNN C;  1CKN A;  1SFO H;  2X6L A;  4DV7 L;  5FLX E;  4GN3 B;  4UPA A;  3V2T A;  1X3Q A;  2DNC A;  1B44 D;  1A63 A;  3OWF A;  2IT1 A;  1VQD A;  5M5X B;  4DR1 L;  4Q0F A;  2NUC A;  2E76 C;  3BDO A;  3H0G G;  1A15 A;  2CW0 D;  4R9W A;  4A3D H;  1I50 H;  1K83 H;  1PMR A;  2N8N A;  1Q1B A;  3CC2 A;  2DJG C;  3DM1 A;  3KUP A;  4I7Z C;  3L0O A;  2CCZ A;  3S2D B;  5I2Y A;  1CM9 A;  2MPM A;  1JJG A;  2HUG A;  4RKB A;  4NMZ A;  2EYP A;  2K5N A;  2IL8 A;  3BDC A;  4DU9 A;  2QF7 A;  1E3P A;  4RG1 A;  4R4Q A;  4DK3 C;  3M4Y A;  1CFM A;  2UUC Q;  2K75 A;  3HFZ B;  3DLL A;  1YJ9 A;  4JI8 L;  4A93 G;  4LK1 C;  2H5X A;  3GP7 A;  1K0S A;  1STH A;  1SE3 A;  5M3F G;  1JT8 A;  1GUN A;  1Y1W B;  1C7Y A;  4K8J A;  2HDL A;  1IBK Q;  4FXD A;  3D6W A;  5ELD A;  4RMF A;  1EQQ A;  4JI7 L;  1EU3 A;  5I4D A;  4KHP Q;  2R7D A;  2NZ1 D;  2DNE A;  1I94 L;  2JA5 G;  2GVB A;  1QIL A;  2I5M X;  3TZU A;  4DUZ Q;  4RWS C;  1K9M C;  3K7A B;  3QOL A;  4ZKB B;  4CGY B;  3S14 B;  2JA8 H;  3F2D A;  2UUB L;  5C44 B;  1HH2 P;  5AJ3 Q;  2UXC L;  1NSN S;  4S3S A;  2ZTC A;  3N6R A;  1TWC H;  2K03 A;  1PYW D;  2RBM A;  1N32 Q;  1WTP A;  2F0L A;  1MSG A;  1HZB A;  1STE A;  3CP0 A;  2PNR C;  2HCC A;  2AUJ D;  1ET6 A;  2L11 A;  4ALP A;  1OO9 B;  3FMC A;  4DV2 L;  2AKW B;  4NDX A;  1IBL Q;  1Z9F A;  3KJO A;  1HQM C;  1FNV A;  1U4M A;  1LTS D;  4L5S A;  4GNX A;  2TSS A;  1BCP F;  2CKZ B;  2Z4H A;  3I4M H;  5CV7 A;  3TDQ A;  1JMC A;  4DAP A;  3Q6S A;  3CRK C;  1HZC A;  3BDL A;  4A3M B;  1PH6 A;  2VUM G;  4GNX B;  1YHA A;  4HR7 B;  2A19 A;  4A3I B;  4BBS B;  4DR2 Q;  4XT3 B;  1XMO L;  3ICE A;  1QE6 A;  5C4X G;  2H1E A;  1GJX A;  1E1T A;  1LT4 D;  2JA7 B;  3S1R B;  5FLM H;  3J7A F;  2VB2 X;  4JI5 L;  4EQO A;  5IT9 L;  1QB5 D;  4X3K A;  4FF1 A;  2BH2 A;  4A3J H;  2ALY B;  1M4V A;  3FDT A;  2F03 A;  3H6M A;  3JAM i;  2HCI A;  4YWK A;  1MGS A;  3EN2 A;  4XT1 B;  4IFD H;  1A8V A;  2ID0 A;  1CK1 A;  1N36 Q;  3A5Z B;  5KGU A;  4WJ3 M;  2FFK B;  4JC0 A;  2IX0 A;  3I4N H;  3LGJ A;  3I72 A;  1JOO A;  2JK8 A;  2VQF Q;  2XRS D;  1X32 A;  3PO2 G;  3HKZ B;  1WOC A;  1A62 A;  2JE6 I;  1UE6 A;  1PRT C;  4LF6 Q;  1XNR Q;  4OO1 I;  4IPC A;  2D62 A;  4ZK9 B;  3EA6 A;  1TWG B;  4OEL B;  2B63 H;  3MC0 B;  4LNQ A;  4DV1 Q;  3RD4 A;  2FMM A;  1STN A;  2Z1C A;  3WDN A;  1L1O B;  1XJV A;  3FEW X;  1Z7T A;  2EY5 A;  3NE5 B;  3J80 i;  3J81 i;  3K6O A;  3GQB A;  1BCP D;  2XRQ D;  4DR4 L;  2KVM A;  3I70 A;  4X64 Q;  5LHY 1;  2NVT B;  4FXG C;  4H7B A;  3J7A V;  2R92 H;  4QL5 A;  3S17 B;  1B3Q A;  5LMU L;  1VQL A;  2YU9 H;  2XN9 C;  3RMH A;  1O80 A;  1I6H B;  1V9P A;  5T1G A;  3K80 C;  2Z8L A;  3SR1 A;  2ASB A;  1GUS A;  4CDF C;  3W5O A;  4C2M H;  5LMN Q;  2MP1 A;  2E5L Q;  1H9S A;  3BG3 A;  2RDH A;  1ZYR D;  4ZUJ A;  2B2T C;  2XSC A;  1S40 A;  5BN4 A;  2A69 D;  3A8K E;  3G7L A;  5K36 G;  1F77 A;  3E0J A;  4PZ8 A;  2AQ2 B;  3PUY A;  4OWW B;  2OXP A;  4LJZ C;  5KYL A;  3TSS A;  4HIO A;  4CKC A;  4HCS A;  4C3J B;  2UXB Q;  3VR3 A;  5CBA E;  4EVO A;  3HZX A;  5FK9 C;  2CFM A;  3OOC A;  4O0A A;  4HMI A;  3T13 A;  4WJW A;  1XMQ Q;  1BNZ A;  1WTV A;  2JYO A;  2J7Z A;  3TP8 A;  1VQM A;  1ILQ A;  4R8I A;  4LFB Q;  4GLA C;  1I3Q H;  4DV0 L;  4DAM A;  1A3V A;  2ZXO A;  3D4R A;  2OTL A;  1V43 A;  4QF4 A;  3PGZ A;  1IYJ B;  2KHJ A;  4F87 A;  2O5I C;  2BDN A;  4DV7 Q;  1CZW A;  4KN7 C;  4Y7N H;  2B2T A;  1EZ6 A;  2PO4 A;  1TS3 A;  2OT2 A;  3PCO B;  1WTX A;  4XQQ A;  2JJQ A;  2PMZ B;  4FXK C;  1C8C A;  1CHP D;  4LF7 Q;  4DR1 Q;  2A6E D;  1VQF A;  2Z6B A;  1GHJ A;  4LFC L;  2FMC A;  4TQU S;  1CA6 A;  5IOD A;  3AYH B;  4HMJ A;  1KIX A;  4N8F A;  3VYT A;  4OGQ C;  1MI2 A;  3QIA A;  5M5X H;  2O2L D;  1EZ8 A;  3GTJ H;  1HA5 A;  1FNU A;  5KIX A;  5CV5 A;  3GO5 A;  2ENB A;  3I8Z A;  1EIY B;  4LUZ A;  4B3M L;  1WTH A;  3H3V I;  3S2D H;  3IKJ A;  1EOT A;  3X3N A;  5FJ8 G;  3AEV A;  5CV9 A;  4JI8 Q;  1J8I A;  2JA9 A;  3WOE A;  2SOB A;  1ONL A;  2E2D C;  3FKI B;  4RCO A;  1KTK A;  4KJO A;  4XTC S;  3MA2 B;  4A3B H;  1KAW A;  5T1I A;  2Q8T A;  4YY3 L;  4K0K Q;  1IBM L;  2CVR A;  2R93 G;  1LTR D;  4JI7 Q;  1EY0 A;  1KNE A;  3M4P A;  4A3F G;  1EWH A;  1VQA A;  5EKL A;  4DKA C;  1I94 Q;  1NUC A;  2F0J A;  3S1N B;  1NJI C;  1QUQ A;  4HJA A;  3HOU H;  1H9M A;  1HNZ L;  2NN6 H;  2A73 B;  1YNX A;  1Y1W H;  3LWE A;  1IHZ A;  4JI4 L;  1LTA D;  5C3W A;  1SDF A;  1QZH A;  4DV3 Q;  1AE3 A;  1QUQ B;  1X3E A;  4BA1 I;  3CU7 A;  1MBY A;  4DNI A;  3GTO B;  1N34 L;  3K7A H;  3UDG A;  4K6L A;  2IHE A;  3CCL A;  3S14 H;  1CTM A;  1BQQ T;  3PQI A;  5C44 H;  5KNC A;  1PH7 A;  1B53 A;  3I7F A;  3HOY B;  1PFB A;  4R4O A;  1SRU A;  3DM3 A;  4DV2 Q;  3EJI A;  1EIG A;  1SNC A;  4UP8 A;  4N9P A;  4IJL A;  1SE8 A;  4PZ7 A;  2P5Z X;  5EPK A;  1PDQ A;  4P72 A;  3CQZ B;  1D6E C;  3T1Y L;  3M4O B;  2N88 A;  4APV A;  3NQT A;  3M85 A;  3K5L A;  3A0J A;  2Q2H A;  2KJX A;  4FF2 A;  1J6Q A;  4A3K B;  2EOT A;  4IUQ A;  5JOB A;  3HOX G;  1XMO Q;  2NYZ D;  1SJH D;  4MIU A; 
#chains in the Genus database with same CATH homology
 4YCV A;  2AHO B;  1VQB A;  2Z0S A;  4ME3 A;  4OX9 Q;  5M3M H;  1HNX Q;  2ZJQ A;  4A3M H;  4LFA L;  3TS2 A;  1NY4 A;  2NN6 G;  4UP9 A;  1KQS A;  1WFQ A;  1EUJ A;  1VQH A;  3ERS X;  4A3I H;  1Y1W G;  3ULP A;  1J5E L;  4BBS H;  2UXD L;  2HHH Q;  3A5U A;  4JBJ A;  1X56 A;  3CME A;  4HIM A;  4YWM A;  4HJ7 A;  3RN2 A;  4AQY Q;  2IY5 B;  5GAD C;  4A3F H;  4B3S L;  2JA7 H;  2UUA Q;  2F4V L;  3M7N A;  4B3R Q;  2IHF A;  3CF5 A;  2ZTE A;  1PH3 A;  1PH5 A;  3J7Z C;  1CSP A;  1EOV A;  1WI5 A;  2OCE A;  3CXC A;  1XMQ L;  3E9I A;  5IP7 H;  2Q2T A;  1KRS A;  4A3C G;  1NE3 A;  3JAM c;  1A0I A;  1Q8K A;  3AFQ A;  1B70 B;  2AMC B;  2PI2 E;  5C3E G;  5C44 G;  2I0Q A;  4BY7 H;  1OXU A;  3WWV A;  4OX9 L;  2ATW A;  3S2H H;  1X65 A;  4A93 H;  2OQK A;  3GD7 A;  1B8A A;  1K3R A;  1NTG A;  5M3F H;  1Q46 A;  4FDB A;  4YCU A;  3HKS A;  4JI6 Q;  5ELO A;  2VW9 A;  1G51 A;  4R4I A;  1K73 C;  3S1M H;  2RHS B;  4DAY B;  4WJ4 A;  2HHH L;  4LF4 L;  1HR0 L;  1XPU A;  1LM0 A;  4MNO A;  2AWO A;  4NB3 A;  2VQE Q;  2JA8 G;  1N9W A;  1PYS B;  1N33 Q;  1CKN A;  4AQY L;  1L0W A;  5GAG C;  1SFO H;  4DV7 L;  1UEB A;  4GN3 B;  4B3R L;  4HJ9 A;  2PQA B;  2JEB I;  3E9H A;  4UPA A;  5IYC H;  2WAQ G;  3CPW A;  1PFS A;  3H3V H;  5C4J H;  1Q1E A;  1VQO A;  1LTL A;  4BY1 H;  3PF5 A;  4QJF A;  1GD7 A;  3HOV G;  1A63 A;  2IT1 A;  4C3I H;  5IYB H;  1PH9 A;  1WJJ A;  3SGI A;  1VQD A;  3FP9 A;  2LXK A;  4DR1 L;  3J81 j;  3H0G G;  3CPF A;  1E22 A;  4A3D H;  2E2I H;  5M3M G;  1I50 H;  4LF9 L;  1HZ9 A;  1K83 H;  2MO1 A;  3PSI A;  4A3M G;  2N8N A;  4JI6 L;  3CD6 A;  1Q1B A;  3CC2 A;  4DR4 Q;  1BBU A;  3NEN A;  4A3I G;  3L0O A;  2CCZ A;  4BBS G;  3KJP A;  3E0E A;  3RN5 A;  1JJG A;  2UU9 Q;  1G29 1;  3PUZ A;  3J80 c;  3J81 c;  2K5N A;  2CQO A;  4L5T A;  4P75 A;  1XNQ L;  1Y14 B;  5LMU Q;  1E24 A;  1AE2 A;  3UE0 A;  2ES2 A;  4L5R C;  2B3G A;  4RG1 A;  1E3P A;  3KF8 B;  4R4Q A;  4DK3 C;  4HJ5 A;  3BJU A;  4A76 A;  2I5L X;  2WB1 G;  3G6E A;  2UUC Q;  4JI0 Q;  1X6O A;  2K52 A;  2K75 A;  3HFZ B;  5IP7 G;  3DLL A;  4DR5 Q;  1YJ9 A;  1ASZ A;  4NXM L;  4JI8 L;  1ASY A;  2NVT H;  1YZ6 A;  4GLV B;  4L5Q A;  5J3B A;  1CKM A;  4BY7 G;  2UUB Q;  5IYD H;  3EIV A;  2NVQ H;  1H95 A;  3W1G A;  1Y1V H;  1TXY A;  2H5X A;  3I56 A;  4A93 G;  2A1A A;  1MJE A;  1I6H H;  2UXC Q;  2CWP A;  2EQS A;  4GN5 A;  4X62 Q;  5M3F G;  4IO9 A;  2VUM H;  1JT8 A;  1HZA A;  2YTY A;  4DR6 L;  1VQJ A;  1VQE A;  1C7Y A;  1IBK Q;  2WB1 E;  4RMF A;  4A3J G;  3KOJ A;  1EQQ A;  4A3C H;  4JI7 L;  1FL0 A;  4JYA Q;  4KHP Q;  2R7D A;  4X66 Q;  5EAY A;  4HJ8 A;  5IYC G;  5HY6 A;  1FJG L;  1I94 L;  2JA5 G;  2GVB A;  2NN6 I;  2I5M X;  1EIF A;  3HKZ G;  4DUZ Q;  1E1O A;  1CUK A;  1GKH A;  4BY1 G;  3GTL H;  4IFD G;  1KL9 A;  3F1Z A;  2MQH A;  4MTN A;  1K9M C;  1FGU A;  5IYB G;  3CCQ A;  3UDX A;  1PYB A;  2YU9 H;  2JA8 H;  3F2D A;  1GO3 E;  2UUB L;  3CCU A;  4IOA A;  4AIM A;  1HH2 P;  2HIV A;  2KCT A;  2QGQ A;  3CAM A;  4JI1 Q;  5C0X I;  4PZ6 A;  5AJ3 Q;  2ZJP A;  3CCR A;  4DUY L;  2EIF A;  2ZTC A;  4X62 L;  1SRO A;  1WYD A;  1IZ6 A;  4C3J H;  1QZG A;  4DV6 Q;  1TWC H;  1VQ4 A;  4POF A;  1N32 Q;  1B7Y B;  1PA6 A;  3FKI G;  4DV0 Q;  2L15 A;  1HZB A;  3CP0 A;  2B63 G;  1UE1 A;  5GAH C;  1PH1 A;  5JEA G;  4A3D G;  3H0G H;  3HOZ G;  1PH2 A;  1XTD A;  1CSQ A;  2HQL A;  4ALP A;  3PO2 H;  4DUZ L;  1VQP A;  3M9B A;  4DV2 L;  4AH6 A;  1TWH H;  2AKW B;  1IBL Q;  1Z9F A;  2IX1 A;  3KJO A;  4HIK A;  4JI5 Q;  3PUW A;  4L5S A;  4OXP A;  4GNX A;  2CKZ B;  4P73 A;  1OXX K;  3OW2 A;  2JEA I;  3I4M H;  5IYD G;  1JMC A;  4Y52 H;  1TWF H;  3RLF A;  1Y1V G;  2A8V A;  3RR5 A;  5BR8 L;  2WFW A;  4EQ5 A;  1HZC A;  3S1R H;  4DV6 L;  1PH6 A;  1RIP A;  4GNX B;  1K8G A;  1YHA A;  2VUM G;  2A19 A;  4A4I A;  1HNW L;  3K0X A;  1JB7 A;  1V1Q A;  4DR2 Q;  4AYB G;  4TVA B;  2JQO A;  4OWT B;  1XMO L;  3ICE A;  5C4X G;  3PUX A;  3CC4 A;  2VY3 A;  4GKJ L;  2JA6 G;  2K4K A;  1E1T A;  4JI2 Q;  4GKK Q;  1VQ7 A;  1HNX L;  1MIU A;  2ZTD A;  2Z6K A;  2EXD A;  1IBL L;  5FLM H;  2F3I A;  1EYG A;  3PUV A;  4JI5 L;  3CCJ A;  2PQA A;  1Q86 C;  4QGU A;  3L2P A;  2NVY H;  4AYB E;  2BH2 A;  4A3J H;  1XPO A;  2ALY B;  1Q12 A;  3BZC A;  3NBH B;  2QA4 A;  4JV5 Q;  1FVI A;  3CCE A;  4B3M Q;  1M1K C;  1X3G A;  2UUA L;  3JAM i;  4YWK A;  2JA5 H;  1SN8 A;  4NXN Q;  2KBN A;  2LXJ A;  3EN2 A;  1UE5 A;  3PO3 H;  1A8V A;  2ID0 A;  1N36 Q;  1VQN A;  2PNH A;  4EX5 A;  4DV4 Q;  5GAE C;  3A5Z B;  4WJ3 M;  5IWA Q;  4JC0 A;  2IX0 A;  4JOI C;  2XTI A;  3RLO A;  3I4N H;  1TWG H;  3LGJ A;  2JK8 A;  4HID A;  2VQF Q;  1GVP A;  2R7Z H;  1YI2 A;  1YJW A;  3PO2 G;  4IPG A;  1YHQ A;  2WAQ E;  4PMW A;  1NMG A;  1WOC A;  4MZ9 A;  4DK6 C;  1MKH A;  2GN5 A;  1A62 A;  2JE6 I;  3RZD H;  1X9N A;  1IBM Q;  4LF8 Q;  1C0A A;  1UE6 A;  5FLX c;  4LF6 Q;  1XNR Q;  4IPD A;  4OO1 I;  3F8T A;  4IPC A;  2D62 A;  2K5H A;  3RNU A;  2VQE L;  2XGT A;  4IPH A;  3FKI H;  1N33 L;  2B63 H;  1BBW A;  1WCM G;  3BU2 A;  3I4M G;  4LNQ A;  4DV1 Q;  1YHB A;  3HOZ H;  4JI4 Q;  1LYL A;  1EQR A;  1N36 L;  2N49 A;  2RF4 A;  4DV4 L;  5HGQ A;  1VQI A;  1VQ8 A;  4UY8 C;  3PIO A;  1L1O B;  5H1S E;  1QVG A;  1XJV A;  4LF5 Q;  3TRE A;  1JJC B;  1HJP A;  4YCW A;  3S1N H;  3KF6 A;  3S17 H;  2I5H A;  2Q2U A;  1S72 A;  4GS3 A;  1N34 Q;  1M90 C;  1YEZ A;  3J80 i;  2PI2 A;  3J81 i;  4GNX C;  4LF8 L;  2VNU D;  5FLM G;  2CWA A;  2F52 A;  3S24 A;  4DR4 L;  4LF6 L;  3KF6 B;  4X64 Q;  4X65 Q;  2UU9 L;  1SR3 A;  1P8L A;  2GVA A;  3K8A A;  2R92 H;  4JI3 Q;  4QL5 A;  5C4X H;  3U4Z A;  3GTO H;  3FHW A;  3KYH C;  3UE1 A;  1X3F A;  3D0F A;  5LMU L;  4DV1 L;  2Q2I A;  2KHI A;  1VQL A;  2JA6 H;  3U4V A;  3EBE A;  1YIT A;  5JJL A;  1V9P A;  1W3S A;  4BA2 I;  3PO3 G;  4JOI A;  3K80 C;  4A3L H;  1PHJ A;  4POG A;  3PIP A;  2UUC L;  3GDE A;  4JI0 L;  3W5O A;  2ASB A;  4C2M H;  5LMN Q;  3T1Y Q;  3KFU A;  4DR5 L;  2E5L Q;  2Z6K C;  2LSS A;  4KLK A;  3HOY H;  1PH8 A;  4IFD J;  5IE8 A;  3I4N G;  3GTQ H;  1QVC A;  1NMF A;  4R4T A;  1VQ5 A;  2R7Z G;  3F2C A;  4DR7 Q;  3S15 H;  1S40 A;  3HKZ E;  4A3E G;  3MXN B;  4R1J A;  3CQZ H;  3GTM H;  3M4O H;  1IBK L;  4DPG A;  1VQ6 A;  1YIJ A;  5K36 G;  4PZ8 A;  4JYA L;  5GRO A;  4KHP L;  1CKO A;  3PUY A;  4LFA Q;  4X66 L;  5IP9 G;  4OWW B;  3S16 H;  4GOP B;  1KRT A;  3KDF B;  1NBW A;  4HIO A;  2UXD Q;  1IL2 A;  4A3K H;  4YWL A;  3J7A 5;  5JEA J;  3I55 A;  4J15 A;  3IRB A;  2UXB Q;  4OON A;  5LMN L;  2E5L L;  4B3S Q;  1YJN A;  2F4V Q;  2K14 A;  2CFM A;  4YHH Q;  4O0A A;  1WCM H;  3L7Z C;  4O2D A;  5AJ3 L;  4A3B G;  4JI1 L;  4XIG S;  1KD1 C;  2ZM6 Q;  1XMQ Q;  2DGY A;  4GN4 B;  1OXS C;  4BBR H;  5FJ8 H;  2KEN A;  1L1O C;  1N32 L;  1VQM A;  4LFB Q;  3UDF A;  4JBK A;  4GLA C;  1I3Q H;  4DV0 L;  4DAM A;  2MO0 A;  3G48 A;  2VZA A;  3ZJY C;  4A75 A;  4LFC Q;  2R92 G;  2HT1 A;  3OTO Q;  3HOU G;  2OTL A;  2ZJR A;  1PV4 A;  2UXC L;  4LF4 Q;  1HR0 Q;  1V43 A;  4P71 A;  4B3T Q;  2UXB L;  2BH8 A;  2KHJ A;  1IYJ B;  3PGZ A;  1DGS A;  4A3L G;  2R93 H;  4DV7 Q;  3AQQ A;  2NZH A;  4Y7N H;  1KXL A;  5ELN A;  3HOY G;  1S3O A;  4YHH L;  4BXX G;  1KHI A;  2RHQ B;  3B6Y A;  2YV5 A;  3NEL A;  4P74 A;  5C0X G;  1Q81 C;  2R6G A;  3PCO B;  1PH4 A;  2ZM6 L;  2YTX A;  4LUO A;  1K8A C;  2JJQ A;  3HOW H;  5C0X J;  4IOC A;  3NEM A;  1XPR A;  1U0L A;  4LF7 Q;  1YVC A;  4DR1 Q;  1VQF A;  4LFB L;  1VQG A;  2YTV A;  3CCS A;  4DR2 L;  4LFC L;  4TQU S;  2WP8 J;  4C3H H;  4LF9 Q;  3ER0 A;  3OTO L;  2C35 B;  3G4S A;  4JCV E;  4JBW A;  2V1C C;  3AYH B;  4JI2 L;  4GKK L;  1KIX A;  1O7I A;  4A3K G;  4B3T L;  4YY3 Q;  5E7N A;  2VS1 A;  5M5X H;  3T1H Q;  1E7Z A;  3CC7 A;  1U5K A;  3M4Q A;  1VQ9 A;  4A3E H;  1RL2 A;  1XNQ Q;  5M5W H;  1EFW A;  3GTJ H;  3D31 A;  1VCI A;  4GOP C;  1EIY B;  1P16 A;  3GO5 A;  4JV5 L;  4JBM A;  5IP9 H;  1CKN B;  1L1O A;  4LUZ A;  1KC8 C;  1HNZ Q;  5DLQ E;  2OWO A;  2N3S A;  4LWC A;  2MNA A;  3H3V I;  1UWV A;  4NXN L;  3S2D H;  4A3G G;  4IFD I;  4LF7 L;  4BBR G;  5FJ8 G;  1L2F A;  1OTC A;  3TQY A;  2HIX A;  1D8L A;  3CMA A;  4JI8 Q;  3CCM A;  4NXM Q;  3AEV A;  2JA9 A;  2KCM A;  1X54 A;  3U58 A;  3CCV A;  2N78 A;  4DV5 Q;  1MJC A;  2AWN A;  1I5F A;  3STB D;  5IWA L;  5LMN W;  3JC6 6;  3OYY A;  4QQB X;  2R7F A;  3S1Q H;  2VQF L;  2YYZ A;  1JJ2 A;  4XTC S;  4UP7 A;  2BA0 A;  4DR3 L;  4QIW E;  4A3B H;  4OWX B;  4LW1 A;  1OXT A;  4DR6 Q;  1KAW A;  1T9H A;  4YY3 L;  4H02 A;  4K0K Q;  1N8R C;  1IXR A;  1VS0 A;  3T1H L;  1IBM L;  3PV0 A;  2R93 G;  3HOX H;  1Q82 C;  4JI7 Q;  2DUD A;  1LUZ A;  3M4P A;  4A3F G;  1XNR L;  5IY0 A;  5IT9 c;  3PF4 A;  2JA7 G;  3TS0 A;  1VQA A;  1FJG Q;  4DKA C;  4GLX A;  3K7U C;  1BVS A;  1SMX A;  1I94 Q;  1D7Q A;  1NJI C;  1QUQ A;  4LUV A;  1R9T H;  4HJA A;  2BA1 A;  3HOU H;  3H15 A;  1HNZ L;  4JG2 A;  3VDY A;  2E2J H;  1YNX A;  1Y1W H;  1VQK A;  3GTK H;  4B3M L;  3HOW G;  4JI4 L;  2PMZ E;  4KI0 A;  2B29 A;  4PG3 A;  3BZK A;  1QVF A;  3K81 C;  1QZH A;  1C9O A;  4DV3 Q;  1UE7 A;  5M5Y H;  1AE3 A;  1QUQ B;  3GTG H;  1X3E A;  3UDI A;  4DV5 L;  4BA1 I;  4LF5 L;  3A74 A;  3CW2 C;  4DUY Q;  2QEX A;  4BXX H;  3RLN A;  5JJI A;  1VQC A;  1TWA H;  4DNI A;  5JJK A;  2OQ0 A;  1N34 L;  1GM5 A;  3TEH B;  2K5V A;  3K7A H;  3UDG A;  4K0K L;  2IHE A;  3CCL A;  1Z47 A;  4OO1 G;  3S14 H;  4GOP A;  1OXV A;  3AFP A;  3KLW A;  3KDF A;  4X64 L;  5C3E H;  4X65 L;  5C44 H;  2VL6 A;  3G71 A;  2OTJ A;  1AH9 A;  4QY7 A;  1PH7 A;  2D0O A;  5GQO A;  4DR3 Q;  1K0R A;  3I7F A;  4R4C A;  4JI3 L;  4R4O A;  1Q7Y C;  1SRU A;  3DM3 A;  4DV2 Q;  1EWI A;  2E2H H;  3GTP H;  4UP8 A;  1X55 A;  3ULJ A;  4IJL A;  1SE8 A;  3MEF A;  1J5E Q;  2FXQ A;  4KHZ A;  4DV3 L;  2Y0S G;  4PZ7 A;  2RCN A;  1BKB A;  3STB C;  1G6P A;  4P72 A;  1HR0 W;  3I4O A;  2NZO A;  3T1Y L;  1JE5 A;  3Q8D A;  3M3Y H;  3TRZ A;  4APV A;  1W2B A;  2D0P A;  3M85 A;  1PVO A;  4IJH A;  5BR8 Q;  1YBY A;  2Q2H A;  3A0J A;  3ULL A;  3RZO H;  1HNW Q;  3HOV H;  1J6Q A;  4DR7 L;  4A3G H;  3U50 C;  2K50 A;  1SLJ A;  2MFI A;  3W1B A;  3HOX G;  3F2B A;  1XMO Q;  2Y0S E;  3I2Z A;  2E8G A;  2NVX H;  4GKJ Q;  4X6A H;  4NPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...