1I6HH

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i6hH00
1LM0A 5FLMH 4A3EH 4ME3A 1BBUA 1N36Q 3HOWG 2Y0SG 3PCOB 1I94L 1SR3A 4BBSH 2UXDL 5C4XG 2JA5G 5M3MH 1E1OA 4IFDI 1EQQA 4JI3L 2E2JH 2E8GA 3HOYH 4GNXB 2UUCQ 4QQBX 5C44H 4X62Q 3H3VH 1IXRA 4EQ5A 1VQBA 3J81j 4LFAQ 3J7ZC 1X3FA 1YHBA 3ER0A 2VZAA 4JI7L 1X6OA 3G48A 4A76A 1EWIA 1ASYA 2YU9H 4JYAQ 2K75A 4BXXH 1VS0A 1H95A 4EX5A 2VQFL 3OW2A 3M7NA 4LW1A 4BBRG 1B70B 3M4QA 4DR6L 5BR8Q 2OQ0A 4KLKA 4R4TA 1YBYA 2WB1E 1HZAA 3KDFA 2NVQH 3HOUH 3EN2A 4P75A 2UUBQ 3A5ZB 3PIOA 4DV0Q 2K14A 3CW2C 3CCLA 4GLXA 1XNQQ 5JJIA 4DUZQ 2LSSA 2EXDA 2EQSA 1QZHA 1KHIA 3CQZH 2HIVA 4Y52H 5M3FG 3H3VI 2K52A 3G4SA 1FJGL 4O0AA 1VQOA 1AE2A 2R7ZG 2R92H 1K9MC 1EYGA 1QUQB 4GS3A 4OX9Q 2CQOA 1KAWA 1Q8KA 4LUOA 1L1OA 3JAMc 1J6QA 4P72A 3PSIA 4DR2L 2KCTA 4DPGA 3T1HL 4K0KL 1GKHA 1XMOL 2CCZA 4QL5A 2IY5B 4LF5L 3PF4A 1ASZA 2E5LL 5FLMG 5GAGC 1NTGA 1YHAA 4HJ8A 5JJLA 3A74A 2N78A 4AIMA 1BKBA 4BBSG 2VY3A 1SFOH 1RIPA 1PH8A 1VQGA 4JI5Q 4RMFA 4YHHL 3G6EA 1PH9A 3HOYG 4A93H 2HHHL 1XPOA 1FVIA 5C44G 2ZTDA 4UY8C 1IBMQ 3S2DH 4P71A 3PO2G 4DR4Q 4JOIC 3CPWA 4DV3L 3I4MH 4ALPA 3CMEA 1XMQQ 4A3LG 4JI8L 4LF8Q 4BXXG 5ELNA 5IY0A 1W2BA 1CKNA 4JI0L 3NELA 4DR1Q 1VQNA 3PUXA 4A3MH 1X65A 1WI5A 1L0WA 3FKIH 1X3GA 2A19A 2ZJQA 3HOUG 5LMNL 3OTOQ 3S1RH 1IBKL 1WCMH 3CCQA 1CSPA 1UE1A 4YY3Q 3CCSA 2IT1A 5AJ3L 3K80C 3M3YH 4OO1I 2LXKA 2PNHA 3S16H 3I4OA 2PQAA 1MKHA 4AQYQ 2R92G 1CKMA 1EUJA 3OYYA 1PV4A 2JA5H 4X62L 3HKZG 3CC4A 2F4VL 5LMNW 2MFIA 1Q81C 2K5NA 2F3IA 3CMAA 2Q2TA 1OXSC 3J80i 4LFAL 1IL2A 1IBLQ 3ICEA 1CUKA 2K4KA 4JYAL 3GTQH 2PMZE 4X64Q 3TREA 5GAHC 4DV5Q 1TWGH 2GVAA 1WYDA 2AWOA 3S17H 1VQJA 1GD7A 2RF4A 4QGUA 2WP8J 3B6YA 5BR8L 2NN6I 3JC66 5M5YH 1JJ2A 1EIFA 1E3PA 4BBRH 2IHEA 2GVBA 2E2HH 2JA9A 5LMUQ 1NMFA 4X65L 3RR5A 5IP7G 4DUZL 2JA8G 2VQEQ 4A93G 4PMWA 1W3SA 1KXLA 3VDYA 1VQ8A 3K0XA 1AH9A 1LUZA 2B3GA 4NXMQ 5HGQA 3I4MG 4DR5Q 2JK8A 4TQUS 4LF7Q 1TWHH 4OX9L 4NPSA 3ZJYC 3DM3A 4PG3A 1UE5A 3HOZG 4R1JA 3FP9A 4UP9A 3S1NH 4DK3C 2R7FA 4HIKA 3FKIG 1TWAH 1Y1VG 1J5EQ 1VQDA 3CXCA 1JE5A 4DUYQ 2DGYA 1P8LA 2Z6KC 3L2PA 1B7YB 3F2DA 1KD1C 1HNWL 2KBNA 1I50H 3DLLA 2JQOA 2PI2E 3I7FA 1JB7A 1IYJB 1VQ9A 4LFCQ 4GNXC 3GTPH 4JI5L 1E24A 3HOVH 1VQFA 4X66Q 3M4PA 1FL0A 1Q7YC 5M5WH 2YV5A 4UPAA 2A8VA 1HJPA 2WB1G 3BJUA 4A4IA 4DAMA 2QA4A 2BH8A 2R7ZH 4B3RL 5IWAQ 2UU9Q 4L5QA 5GQOA 1HNXQ 5C3EG 4LF8L 1A0IA 1WFQA 4HIDA 3PO2H 4DR1L 4A3IG 1NMGA 1YITA 4MZ9A 3S1QH 4DV1Q 1Y1WH 1QZGA 1PH5A 1R9TH 4A3LH 1N33Q 1JJGA 2F52A 2N3SA 2YTYA 4JC0A 4HJ7A 3CAMA 2OCEA 4A3CG 4DV4L 4B3SQ 3OTOL 3U4VA 2GN5A 3ULLA 3J81c 3U4ZA 2PQAB 4YY3L 4JOIA 4A75A 4GOPB 3U50C 1VQ6A 4YCUA 5J3BA 1YI2A 1YZ6A 1K73C 4LF4Q 4JBWA 3RZOH 1VQAA 2NVXH 2MNAA 4AQYL 2KHIA 3PUZA 1NE3A 1N34L 2ID0A 2L15A 1XJVA 1X54A 3KF8B 1Q46A 2QEXA 3S2HH 4H02A 3KF6B 1V43A 4UP7A 1PA6A 4A3KG 1N8RC 2CKZB 1IBLL 2XTIA 1N9WA 4YCWA 4IJLA 4JI6Q 4LF6Q 5IE8A 1C9OA 2Q2HA 1HZBA 1OXUA 4A3GG 3RLOA 1K83H 2B29A 2Y0SE 4AYBG 3I55A 1MJEA 1NBWA 4FDBA 1E1TA 1I3QH 3UDGA 4MNOA 2BA0A 1S40A 3HOXH 3E9IA 1MJCA 1SROA 5FJ8G 1C7YA 1YJ9A 2YYZA 3HOVG 1C0AA 1SMXA 5LMUL 3I2ZA 1SE8A 4XIGS 4YWKA 1UEBA 1Q82C 3K81C 2OQKA 3S24A 4JI2L 3E9HA 5GROA 4OXPA 4A3JG 4NB3A 4GN5A 5IP7H 1HR0Q 4NXML 3PUVA 2JA8H 4DR5L 3STBD 1PH6A 1RL2A 1TWCH 4O2DA 1YIJA 4L5SA 4GKKQ 1Y1WG 2VS1A 2JEAI 4GLAC 1EIYB 3PO3H 4DV6Q 1JT8A 1V1QA 2QGQA 1KIXA 3K8AA 2CWAA 3KYHC 3T1YQ 1J5EL 2HQLA 3A0JA 3HOZH 4DUYL 3MEFA 4JI1L 3F8TA 3KJOA 3GTJH 1Y1VH 2UUAQ 3GD7A 4R4OA 2JEBI 1VQHA 4JV5L 4LFCL 3NEMA 3RN2A 5FLXc 1NY4A 4IJHA 3PGZA 3CF5A 4HJ5A 4X66L 1N36L 3RNUA 1VQPA 2OTLA 2UXDQ 3L7ZC 5ELOA 1YJNA 2ES2A 2KCMA 1Q86C 4JI3Q 2UXBQ 1IBKQ 4KHZA 3HFZB 5IWAL 2UUCL 1BBWA 2Z6KA 4IO9A 5K36G 2D62A 3F1ZA 3S15H 4LF9Q 1PYSB 4GNXA 1OXTA 3M85A 3H15A 4DV1L 3BZKA 4JG2A 5C3EH 4JBKA 4IPHA 2WAQE 1Q12A 3KDFB 3HOXG 4A3IH 4MTNA 3CC2A 1Q1BA 4B3SL 2IX1A 3MXNB 1PH7A 1QVGA 3KFUA 4OWXB 3J7A5 4A3CH 3M9BA 2UUBL 4DV0L 1YJWA 4BY1H 1T9HA 2D0PA 1XNQL 2I5MX 4LWCA 1KRTA 3GTKH 1OTCA 4DKAC 4JBMA 4RG1A 2XGTA 1N32Q 1PFSA 3D0FA 2ZJPA 2BA1A 5JEAG 1L1OB 2R6GA 1SLJA 1VQEA 3STBC 4HIMA 2VUMG 4QJFA 3PO3G 2N49A 2ZTCA 4KHPQ 1TXYA 3PIPA 3JAMi 1VQ7A 3CCVA 2V1CC 4A3KH 2K5HA 1PH3A 4NXNQ 2HT1A 4BA2I 4BA1I 4DR2Q 1QUQA 2VNUD 1D7QA 3KJPA 4A3GH 2KHJA 3GTLH 4K0KQ 1GM5A 2E5LQ 3HKZE 1X3EA 3LGJA 1I5FA 2K50A 1E7ZA 4JI4Q 5FJ8H 3RLNA 1Z9FA 4HJ9A 3UDXA 1HR0L 5DLQE 2HHHQ 4UP8A 4DR7Q 5C0XJ 4JBJA 1SRUA 1K8AC 1IBML 1CKNB 4HJAA 4A3JH 4DR4L 4GKKL 2K5VA 3M4OH 1KL9A 4DV3Q 4DR3Q 1XMQL 4DV2Q 3CPFA 1IZ6A 4B3TQ 5IYBH 2JA6G 2OTJA 1CKOA 2DUDA 4GOPC 4GKJQ 4HIOA 3T1YL 4POFA 2KENA 1HR0W 2UXCQ 4BY7G 4B3MQ 1VCIA 3PV0A 3Q8DA 5LMNQ 4L5RC 1M1KC 3D31A 4BY1G 4TVAB 4C2MH 2AWNA 2EIFA 3ULPA 5AJ3Q 4P74A 3S1MH 2AMCB 1BVSA 4OWTB 3K7UC 1YNXA 3TEHB 3I4NG 4A3DG 1K0RA 3TS2A 2UXBL 1HH2P 4IOCA 1HZ9A 2F4VQ 4R4IA 3TS0A 4LF9L 3UE0A 1VQMA 1XPRA 2ZM6Q 4L5TA 4PZ8A 3J80c 2AKWB 5IP9H 4X64L 3AFPA 4DV5L 5C4JH 1PHJA 1X9NA 1VQLA 1LYLA 3GTGH 3KLWA 1S72A 5JJKA 3F2BA 1EOVA 1U5KA 5C0XG 1PVOA 1LTLA 1U0LA 2JA7G 4PZ6A 1K3RA 1B8AA 2VL6A 2MO1A 3AFQA 3U58A 4X65Q 1Q1EA 3AYHB 1YVCA 1HNZQ 4P73A 2VQEL 4C3HH 4DV7Q 2B63H 1A62A 3CCMA 3CCUA 4C3JH 3UDIA 4IFDG 4GLVB 2MO0A 1N32L 3H0GH 2N8NA 3EIVA 1MIUA 1OXXK 5IT9c 2CWPA 3W5OA 4A3DH 4YCVA 4LF7L 5IYBG 4KHPL 1FGUA 3A5UA 4OONA 4YWLA 5IYDG 3PF5A 4NXNL 2WFWA 2VUMH 1G6PA 4WJ4A 4A3FG 2JE6I 1A63A 2AHOB 3ULJA 1XNRQ 1WOCA 2I5HA 1Z47A 1NJIC 1K8GA 1KC8C 3HKSA 1WJJA 4YWMA 1EQRA 1PH1A 5JEAJ 4LFBQ 1HNWQ 2R93H 5GAEC 4QIWE 4A3EG 4A3BH 3BZCA 1DGSA 1G291 2H5XA 4R4QA 3RLFA 3I56A 3CP0A 5M3MG 2NVYH 4JI4L 2MQHA 1P16A 2WAQG 4IPDA 1I94Q 2ASBA 4AYBE 4DR7L 3WWVA 3TRZA 2IHFA 1UWVA 5M5XH 3W1BA 3CCRA 2NZHA 3CCEA 1JJCB 4DR3L 2UU9L 4B3RQ 5IP9G 4DV2L 1HNXL 1VQ5A 1L2FA 4B3TL 4POGA 1I6HH 3K7AH 4R4CA 2ALYB 4GKJL 2I0QA 4JI7Q 1UE7A 2HIXA 1N33L 1GVPA 4XTCS 2BH2A 2JA6H 1AE3A 1CSQA 2VQFQ 4B3ML 2YTXA 2UXCL 3PUWA 4DV4Q 4DK6C 5IYCH 4JCVE 5GADC 1G51A 3J81i 4DR6Q 5EAYA 2A1AA 2Z0SA 4J15A 4BY7H 2YTVA 4C3IH 3GTOH 1D8LA 1L1OC 3IRBA 3G71A 2B63G 1VQIA 4LF4L 5H1SE 3S14H 4GN4B 3CC7A 3FHWA 3H0GG 2ATWA 4GOPA 3BU2A 4X6AH 4IPGA 5C4XH 3HOWH 3PUYA 1N34Q 3GTMH 1YHQA 1KQSA 1YEZA 2R7DA 1XTDA 2Q2UA 4LUZA 4DAYB 1FJGQ 3I4NH 3NENA 1Y14B 2RHSB 3GDEA 4AH6A 4GN3B 1QVFA 2ZM6L 1KRSA 3UE1A 2CFMA 2PI2A 5HY6A 4LF6L 4PZ7A 1SN8A 4JI6L 3KF6A 1PYBA 2VW9A 1TWFH 3UDFA 2Q2IA 1VQ4A 2R93G 4A3BG 3T1HQ 3NBHB 5E7NA 1XMOQ 2IX0A 4LF5Q 2LXJA 3CD6A 1M90C 4QY7A 1O7IA 1V9PA 1VQCA 2FXQA 2C35B 2RHQB 3RN5A 1HNZL 2JA7H 2RCNA 1X56A 3CCJA 4DV7L 3AEVA 4OO1G 4KI0A 4Y7NH 3E0EA 4JI2Q 1XPUA 1EFWA 2E2IH 1GO3E 4YHHQ 2OWOA 4DNIA 2ZTEA 2I5LX 2NZOA 5M3FH 4APVA 4IPCA 2JJQA 1HZCA 1UE6A 4A3MG 1PH2A 3TQYA 1JMCA 1VQKA 4JI8Q 3EBEA 2NVTH 4DV6L 1XNRL 3F2CA 4IOAA 4JI0Q 2D0OA 3ERSX 3GO5A 3AQQA 1OXVA 3RZDH 4IFDJ 5IYDH 3SGIA 5IYCG 2ZJRA 1WCMG 2NN6G 4JI1Q 1E22A 3W1GA 4A3FH 4LFBL 4OWWB 4WJ3M 4LNQA 2UUAL 4LUVA 1S3OA 1X55A 1A8VA 1QVCA 3L0OA 5C0XI 4JV5Q 1PH4A 3KOJA
chains in the Genus database with same CATH superfamily
1L0XB 2NB0A 4KKSA 2XRSD 1N36Q 5C4XG 2Y0SG 1I94L 3R8BA 3W2DA 4ODGA 4JI3L 1SMYD 4LFAQ 3J7ZC 3PQIA 1X3FA 3M4YA 5CV9A 3J7AV 4JI7L 1X6OA 4A76A 2YU9H 3HOXB 2AQ3B 2VQFL 2M9VA 5FLXE 2ZT9C 2EXZA 3M7NA 4IUNA 4CKBA 4DR6L 5BR8Q 4R4TA 4HN7A 3KDFA 2JA8B 4GLXA 4DUZQ 4XQJA 2EXDA 1TWCB 5M3FG 3ZYYX 1FJGL 1F2LA 1AE2A 2R7ZG 1H9SA 4GS3A 4OX9Q 2CQOA 3HOZB 1KAWA 5K5PA 1J6QA 4KY5A 5IGFA 2KCTA 3P20A 3T1HL 1CI3M 2CCZA 1JB3A 1ZKOA 5JJLA 4HJ8A 2K6AA 2I46A 4AIMA 2X6GA 1RIPA 4JI5Q 1GHJA 4RMFA 1GUTA 4YHHL 2K32A 4OO1H 2WB1B 3T53B 1EFID 4DN4M 4RKLA 2ZTDA 1CA5A 3RUZA 4UY8C 3S2DH 3K5NA 5IODA 1CZGA 2K05A 4JI8L 4A3LG 2Z9HA 4KMUC 1W2BA 1CA6A 4KN7C 5DEHA 1QE6A 1L0WA 1X3GA 2A19A 2SNSA 2X6LA 2PNRC 4BY1B 1CSPA 2DY8A 4X3TA 3K80C 4F87A 3M3YH 1SNOA 2LXKA 3RMHA 3I4OA 2PQAA 1V1OA 1BBXC 1CK1A 4XQNA 3PIO3 3HKZG 2MFIA 4K6LA 3OWFA 4LFAL 3ICEA 4A3GB 3GTLB 2A6ED 3QO2A 5GAHC 1TWGH 1WYDA 2EY5A 1TS3A 5HGTA 2RF4A 1QOHA 2WP8J 4JVZA 4QGUA 5BR8L 5M5YH 3I91A 4BBRH 5LMUQ 1NMFA 1STNA 4IALA 4DUZL 3L3OC 2XWJB 2JA8G 1ICFB 1KXLA 3M4OB 4FXDA 3K0XA 3J80E 4NXMQ 1H9KA 2R61A 3OOCA 4TQUS 4LF7Q 4N9TA 4OX9L 2K01A 2QDLA 1NSNS 1VMCA 3HOZG 3FP9A 3R2TA 3S1NH 4DK3C 2R7FA 4HIKA 2SNMA 1F9RA 3R3OA 5KNBA 5DM63 3CXCA 1GHKA 2QCPX 2KBNA 1I50H 3DLLA 2K1BA 1IYJB 2I07B 4GNXC 3IKJA 5EGTA 3MFYA 4JI5L 1QB5D 1Q8IA 4I7ZC 3M4PA 1ENCA 1FL0A 1C48A 2YV5A 4UPAA 3S9WA 4E6IA 4DAMA 2WB1G 3MC0B 4K5VA 4B3RL 2RDFA 1HNXQ 5CC4A 3GTGB 3PO2H 3DHQA 1NMGA 2KEDA 1N33Q 1JJGA 2F52A 4IUPA 1C8CA 4DV4L 3MXGA 4FXGC 2PQAB 3I8ZA 1DOKA 4A75A 5LHY1 3H0GB 4YCUA 5J3BA 4KHVA 3RZOH 2F0DA 2XN9C 3NHHA 3BDCA 1NE3A 3NSWA 3S2HH 2WV6D 4RA8A 1M8AA 5K36H 1C9OA 4A3GG 1K83H 1XTCD 3I55A 4MTKA 1PFNA 4FDBA 5C4HA 1E1TA 3UDGA 4MNOA 2BA0A 2CQAA 1F9PA 3KK7A 5G3LD 5FJ8G 1YJ9A 1G91A 2YYZA 5LMUL 3NBHA 1VF7A 3QOJA 3C1EA 1Q82C 4NXML 2CH4W 3A8JE 3K7AB 2ICEC 3VYRA 1ESRA 4L5SA 4GKKQ 1LLRD 1NAPA 4RWSC 4KV6A 3T1YQ 5T1GA 2HQLA 3A0JA 4FF2A 3GTOB 4JI1L 3GTJH 3S16B 1Y1VH 2JEBI 3OIPA 2F1MA 3D4DA 3FMCA 3NEMA 4KKTA 3RN2A 4IJHA 3PGZA 3OSOA 2A74C 1SNCA 2OTLA 3NTHA 5ELOA 2ES2A 2E75C 4CDDC 1PFBA 1KNEA 5K36G 1TWFB 2NTSA 1ZXTA 3F1ZA 3S15H 1PYSB 5FKAC 3BZKA 4IPHA 2WAQE 1Q12A 4MTNA 2PQEA 3CC2A 2JA7B 1PH7A 2Q8IB 3I4LA 1FD7D 5IGGA 3J7A5 4O42A 2BDNA 1K3BC 1T9HA 2D0PA 2I5MX 1KRTA 1OTCA 5AFWA 5CGKA 4RG1A 2XGTA 1N32Q 1SLJA 2P5ZX 3RZDB 3PIPA 1SYBA 1VQ7A 4A3FB 3CCVA 3MXPA 2HD3A 2PYKA 4HAEA 2HT1A 4BA2I 1EYDA 1UEAB 5ELCA 3KJPA 1D1IA 3E0JA 3L9AX 4J6HA 1AW7A 3LGJA 1I5FA 1B44D 1Y8OB 2DY7A 3FPUB 3HOYB 3RLNA 2B2UA 3NK9A 5DLQE 2KECA 1JOOA 4DR7Q 4IFDH 1IBML 2PPBC 1E0BA 4DR4L 4GKKL 1IYUA 2K5VA 1C4QA 3Q23A 4B3TQ 4GKJQ 1TU2B 3EQLC 4HIOA 3T1YL 3HOUB 4QCLA 2KENA 1HR0W 2XIWA 5EQ0A 1VCIA 5LMNQ 3Q8DA 2J0TD 4KKUA 4C2MH 3S1MH 4XYQA 2K28A 2R3ZA 5D65A 1HTPA 2EY6A 1HZ9A 1V1PA 3TS0A 3UE0A 1ONLA 3HEJA 5ELEA 4FO2A 5C4JH 1X9NA 4RH6A 3KLWA 3F2BA 1EOVA 1U5KA 1DM0B 4N8FA 2JA7G 5KEEA 4OEMB 2VL6A 3CHBD 3OHXC 4LAAA 2F0OA 1YVCA 3AYHB 1HNZQ 3J7YW 2VQEL 4C3HH 4DV7Q 2NYZD 3CCMA 4IFDG 3UDIA 1WVLA 1N32L 1MIUA 1HUMA 1WTVA 1TKWB 5JEAH 1ILPA 3FKIB 1RD9D 4LK1C 4WJ4A 4A3FG 2JE6I 5EKKA 3NTIA 5IGBA 3HKSA 1WJJA 4HTHA 4LFBQ 2R93H 4A3BH 4R8NA 1DGSA 3CP0A 4AYBE 1LTSD 4DR7L 1RKNA 4RAUC 3GTQB 1UWVA 3S17B 4A3IB 4B3TL 1L2FA 4DK0A 3KBGA 4POGA 2BE5C 2B2WA 4GKJL 5C4ZA 5JJZA 4FF4A 5L37A 1GVPA 2JA6H 3PUWA 3AMUA 1R4PB 1ZYRC 2F0MA 4J15A 4BY7H 4C3IH 1Z7TA 1WD0A 1A3VA 4GN4B 5CORA 1TWHB 4X6AH 2BOSA 3GTMH 3CU7A 3G7LA 2EY1A 4LUZA 4A3DH 3SDZA 4AH6A 1TWAB 1KRSA 2CFMA 2PI2A 1IW7D 5HY6A 4LF6L 1SN8A 3KF6A 1EEFD 2VW9A 1O7LA 1H9MA 3ND8A 2R93G 3GTPB 4A3BG 3H3VC 3HOVB 2FJ2A 5EPJA 5DNFA 2LXJA 5COYA 5M5WB 1VQCA 2E76C 3VR3A 2C35B 2RHQB 1UAPA 4HMJA 4DV7L 4A3JB 3CCJA 1HNZL 2V4DA 3DEOA 4Y7NH 1XPUA 1PMRA 5EBCA 2ZTEA 5I6YA 1A3UA 3JAME 1Y1WB 4APVA 4RGOS 1HZCA 2RCFA 4A3MG 1VQKA 2NVTH 4GZYC 4DV6L 3F2CA 4JI0Q 2D0OA 3ERSX 1RDPD 1QNUA 2ZJRA 4LFBL 1MBYA 1S3OA 1BUVT 4DAVA 4P2CB 1IBKQ 3I3CA 1B50A 1BBUA 3PCOB 2O5IC 2UXDL 2NZ1D 3BDLA 2F4IA 2E2JH 4C1NK 2UUCQ 2CW0C 3H3VH 1EU3A 1X3PA 2F0IA 1I3QB 3ER0A 4BWGB 1EWIA 2K75A 4BXXH 1H95A 5IGDA 3OW2A 5D3IB 2OQ0A 2WB1E 2NVQH 1BR9A 3TMEA 3EN2A 3MXNA 4DA2A 4Q0FA 3CCLA 2LSSA 2KHSA 4CHTB 2VUMB 1I4XA 2IL8A 1K9MC 1EYGA 4QMGA 3AU7A 1IKLA 1EY9A 1L1OA 3TSSA 2HCCA 2BDOA 1LABA 4DPGA 4K0KL 3QJYA 4K2KA 1G8ZD 1ASZA 2E5LL 4K6DA 1SEBD 4JPBW 3A74A 2N78A 3QR8A 5C5LA 2L1BA 3MZ5A 1PTOB 1IYVA 4A93H 1XPOA 1FVIA 2Z6BA 2B2TA 5D14A 4FYDA 4P71A 4QB4A 3V2TA 4JOIC 4DV3L 3I4MH 4ALPA 1XMQQ 1SMYC 4LF8Q 4BXXG 5ELNA 5IY0A 1CKNA 4JI0L 1VQNA 3MTSA 1ESFA 2LS01 1ZEQX 5CV8A 4OIKA 3S1RH 2NN6H 1IBKL 1I4GA 5AJ3L 4OO1I 1VF5C 3X3MA 1SYGA 2A6HD 3C3LA 2FMCA 1CKMA 3OYYA 1PV4A 4A3KB 4XDXA 3BZDB 2F4VL 5LMNW 2EY2A 1QJOA 4X64Q 3D6CA 3TREA 2EVBA 3J81E 1VQJA 1GD7A 2C5CA 4B08A 4V190 3B6YA 3NWTA 3IFDA 3GV3A 1JJ2A 4LMQD 1B3QA 3WOFA 1E3PA 2JA9A 5G3LF 5JVG3 3RR5A 5IP7G 4A93G 2ICIA 1W3SA 4PMWA 3HZXA 3VDYA 1U4LA 1F2MA 2B3GA 3KLSA 3VYTA 3I4MG 4DNTB 4DR5Q 3SVMA 3VA7A 1SYCA 1FNWA 3ZJYC 1DD2A 3W3AA 4UP9A 4OL7A 2IX3A 2F0VA 1PTOD 1TS4A 2KEEA 1JB7A 4LFCQ 3GP7A 1TQOA 1E24A 3K5LA 4X66Q 1Q7YC 2F3VA 3D4WA 5IT9L 1PRTC 2A8VA 3VYSA 4A4IA 1AN8A 3SK8A 2QA4A 2BH8A 4L5QA 4LF8L 1KDAA 1WFQA 1JCKB 3S1QH 4A3LH 4B3SQ 2B63B 1PLFA 4C3JB 4GOPB 1VQ6A 1YI2A 2G5DA 2KHIA 1N34L 1EQVA 1B9NA 2L15A 3KF8B 1Q46A 2QEXA 1V43A 5JAVA 5A2QE 3TZUA 4A3KG 4RCOA 2MJ8A 1N9WA 1X3QA 4JI6Q 5IE8A 1Q3LA 1T5EA 2KQ3A 2QW7A 3EJIA 3Q6SA 4AYBG 3K59A 5ISRA 1MJEA 1J8IA 1NBWA 1HTLD 2K7VA 1GXDC 2L55A 2NVYB 3IFTA 3HOXH 1A15A 4HSVA 1SROA 5J22A 1SNPA 4IUUA 1E2WA 4XIGS 4YWKA 5M5XB 3FRPB 3K81C 5CV6A 2OQKA 1HR0Q 4OXPA 4WJWA 4ZCKA 1I6HB 1S5CD 1HFGA 4XYOA 4DR5L 2JA8H 4PV1C 1AEXA 1RL2A 3K6OA 1TWCH 4O2DA 1EIYB 3NUCA 3K5OA 1DOLA 3DWAA 1I4QA 3KYHC 4ID6A 3HOZH 1XYIA 3F8TA 4R4OA 3D6WA 4LFCL 1CTMA 3HOWB 1NY4A 3CF5A 4G7ZC 4X66L 4DK1A 4I7AA 3RNUA 1N36L 5DM73 1YJNA 1B9MA 4CBVA 1CQFA 2X69A 2Z1CA 5DAUA 4OHJA 3HFZB 3TZDA 1BDOA 5EBDA 3NTKA 1OXTA 4GNXA 5CR3A 1TVXA 4BBRB 1STAA 3KDFB 3HOXG 4B3SL 2IX1A 3MHBA 4R9WA 1LACA 4JW0A 3T4AC 2E2IB 3M9BA 1DONA 1PZID 4C3JG 5C3XA 4BY1H 1AP0A 4LWCA 1L0YB 4XT1B 3DM1A 1H9SB 4JBMA 2IJ0A 3D0FA 1A2TA 2BA1A 2EYMA 1LTRD 1SDFA 4QJFA 2N49A 2ZTCA 1TXYA 4HEDA 3P7JA 3JAMi 1Z6HA 5KNCA 4BA1I 4DR2Q 1QUQA 4LJZC 2KOLA 2ZXOA 2KHJA 4A3GH 3GTLH 2ZXPA 4A3EB 1SNMA 4BBSB 2QF7A 1B4OA 5M3MB 5C0XH 1HQRD 1STGA 2F0QA 4DXFA 5FJ8H 1Z9FA 1K28A 5C44B 1HR0L 1OO9B 2K5WA 2HHHQ 2MHVA 3K0YA 3TP5A 1LT6D 2EYLA 4HJAA 3M4OH 5EKLA 3JAML 1JWSD 3GV6A 2OTJA 3K57A 5IYBH 1CKOA 1EY6A 1SSOA 2EDGA 4WORA 4BS9A 3LNNA 4MN3A 2LMCB 3PV0A 1WD1A 2LY7A 4L5RC 1EIGA 3CQZB 4BY1G 4TVAB 2MPMA 2OT2A 3NBIA 4HR7B 2AMCB 5KIXA 2R92B 4OWTB 4DFAA 1HH2P 4IOCA 4Q5VA 1XXGA 1VQMA 4L5TA 2AKWB 5IP9H 3AFPA 3EROA 2A69D 1VQLA 1LYLA 1PFMA 3GTGH 4ABNA 4RFBA 5JJKA 1SFOB 2L9HA 1WTPA 5C0XG 1U0LA 2MO1A 3U58A 4X65Q 3T56B 3HRZC 2N88A 2MO0A 3H0GH 1B3AA 1STBA 2CWPA 4B9XA 1KLUD 4LF7L 5IYBG 1FGUA 3HGBA 4OONA 5IYDG 1G6PA 3T51B 3ITPA 2AHOB 1XNRQ 1NJIC 2I5HA 1WCMB 3OW7A 3BVZA 4YWMA 1EQRA 5JEAJ 1HNWQ 4A3EG 2K04A 3I56A 3HG9A 1WTQA 3QB3A 4ZUIA 5M3MG 2DJGC 3NQIA 2EOTA 2JA5B 3F2UA 1STEA 5I6WA 3KLRA 3TRZA 2IHFA 3CCRA 2NZHA 3CCEA 1SXTA 1PYWD 5IP9G 1HNXL 3K7AH 2HUGA 2ALYB 4NKLA 2HIXA 3AB9A 1N33L 2KUMA 1I6VC 2E2HB 2E74C 3J81i 1HPCA 5EAYA 5FO7B 3MA2B 3GTOH 1Q90A 1D2BA 1BO0A 1VQIA 1EOTA 2F0KA 3CC7A 3FHWA 3H0GG 4K5XA 4CJ0B 2WACA 4IPGA 4QIWB 3PUYA 2NUCA 3MAQA 2O4XA 3NE5B 2B2YC 1XX8A 2RHSB 3NENA 4I65A 1EEID 4M8AA 4PZ7A 1LTGD 1RODA 2NTTA 1TWFH 4OELB 3SHLA 3K58A 3UDFA 2Q2IA 2VB2X 3NBHB 1MD2D 3J81L 1XMOQ 3CRKC 4LF5Q 4J8QA 3CD6A 1M90C 1V9PA 2FXQA 1RCVD 1LTAD 3RN5A 2JA7H 1X56A 1TS2A 4NMZA 4KI0A 1DCZA 3E0EA 4JI2Q 1EFWA 2H4OA 2NZOA 1R9TB 1UE6A 1HA6A 2QILA 1XNRL 3AQQA 3RZDH 4IQZA 4F8MA 3QG1A 1WCMG 3W1GA 4A3FH 4WRDA 3MFGA 4JV5Q 4LUVA 2NVXB 1A8VA 3R2IA 2HDLA 1PH4A 3KOJA 1LM0A 1TIID 4ME3A 2JA5G 2F0EA 3E6ZX 3HOYH 3SK4A 2B2VC 2J7ZA 4X62Q 4EGVA 3J81j 1F2YA 1YHBA 2EJFC 1IW7C 3G48A 4JYAQ 1IL8A 4HCEA 2KCNA 1VS0A 2F0NA 4FNFA 1F9QA 1B70B 3M4QA 4KLKA 1LTBD 1YBYA 5FLXL 3HOUH 1A3TA 4P75A 1SNQA 2UUBQ 4DV0Q 3CW2C 1XNQQ 1RJTA 2EQSA 1KHIA 2Q8RE 4B9WA 4KTAA 3H3VI 2K52A 1XWEA 3PO3B 4DGZA 1BCPB 1VQOA 4G7OC 4IN3A 1MHWC 3ONAB 4LUOA 3VR4A 3I72A 3NP8A 2RBMA 1LO5D 3PSIA 4U68A 2OXPA 1X32A 3BVGA 4IURA 1GKHA 1XMOL 2IY5B 4LF5L 2RDGA 5GAGC 1PTOF 1BKBA 5BN4A 2VY3A 5EKIA 4KK7A 3HOYG 2IW3A 4ZK9B 1JE4A 1HHVA 3A7AB 5C3EB 4ZKCB 3CPWA 1TS5A 3CMEA 1E2VA 1LTTD 4NP5A 2VB3X 4DR1Q 2L12A 4A3MH 1X65A 1EZ6A 3FKIH 5I9PA 2ZJQA 3HOUG 2DN8A 3GTKB 3TN2A 5LMNL 2O2LD 3OTOQ 3V96A 3DWPA 2PZUA 4YY3Q 3CCSA 4F7XA 1YNJC 1Y69U 2PNHA 3DUZA 1V1PB 1PZKD 4AQYQ 1MGSA 1SYFA 2A5HA 4J1MA 4X62L 3CC4A 4CKEA 1ET9A 2K5NA 3CMAA 1OXSC 3J80i 1IL2A 1K0SA 1CUKA 3A56A 1TT2A 2K4KA 5T1IA 4DAPA 3GTQH 4DV5Q 4JYAL 1U4MA 2GVAA 1G2SA 3S17H 1LTID 1JWMD 1SE3A 2NN6I 2B8FA 3JC66 1CHPD 2DJFC 1TY2A 3DWQA 1EIFA 1BCPD 2GVBA 3EVQA 2QDBA 1CM9A 1SE2A 5E3FA 1VQ8A 2EJGC 3MWYW 2JK8A 5EPKA 1TWHH 3J80L 3FDTA 2F0LA 3DM3A 1DOMA 4QUCA 1UE5A 4DF7A 1EYAA 4MHEA 1SE4A 5F2DA 1QILA 3FKIG 3TBIB 1TWAH 2Z4IA 1J5EQ 2DGYA 1P8LA 2Z6KC 3L2PA 1B7YB 3F2DA 1KD1C 4EQPA 2PMZB 2JQOA 1BOSA 1EY0A 3GTPH 4CGYB 5BN5A 3HOVH 1VQFA 2CH4A 3R93A 3MVVA 2CVRA 5M5WH 2A6HC 3CKIB 3U9OA 1HJPA 3BJUA 5IWAQ 2UU9Q 5C3EG 2WIIB 4HIDA 1IKMA 4DR1L 3OIQA 1SNDA 4A3IG 4MZ9A 1Y1WH 1PH5A 1QZGA 5C3WA 2N3SA 2YTYA 4JC0A 3P75A 2K5QA 4A3CG 3OTOL 4YY3L 4JOIA 3C46A 1YZ6A 4LF4Q 1ML0D 4JBWA 1HUNA 1VQAA 2MNAA 4AQYL 1KAAA 3KF6B 4MIUA 2BE5D 4UP7A 1PA6A 1N8RC 2RKSA 2Q2HA 4DAYA 2B29A 3GQBA 1I3QH 2XVSA 4EQOA 1S40A 3E9IA 2HCIA 1Y8NB 4TRDA 1ENAA 1S5DD 3HOVG 1DYQA 1NR2A 1SE8A 2JN4A 1UEBA 1ENFA 4RHSA 4A3JG 5GROA 2AUJD 4GN5A 5IP7H 1O7ZA 3PUVA 1LT4D 1HQMC 3STBD 1D5ZC 1W6JA 2MP1A 1Y1WG 2VS1A 3NWSA 4GLAC 1JT8A 1KIXA 3K8AA 2CWAA 1J5EL 4PMCA 5KRUA 3FVQA 3S14B 2UUAQ 1BQQT 1PZJD 5C4XB 2Y0SB 1VQPA 3I4NB 3L7ZC 3N52A 2KCMA 3ND9A 4JI3Q 2UXBQ 1D6EC 2F0HA 5IWAL 1BBWA 2UUCL 2D62A 2N55A 1CQVA 1PTOH 4LF9Q 1EY7A 3VR5A 4FF3A 3H15A 5JVH3 4JG2A 3VA5A 1D1KA 4CKCA 3H91A 5D3DA 3K5MA 4KN4C 1Q1BA 2KJXA 3MXNB 3SXHA 1QVGA 3KFUA 3ERQA 2WKDA 3NQTA 2D5DA 5IGCA 1D5XC 5M3FB 2JP1A 4DKAC 2R7ZB 5CYUA 1HXYD 2ZJPA 4JK1C 1CZWA 1L1OB 1V8QA 4HIMA 1VQEA 2VUMG 1KDBA 5LL6X 2PW7A 2F3WA 1A2UA 5ELBA 1KTKA 2V1CC 4A3KH 2K5HA 2VNUD 2AQ1B 1D7QA 1F9SA 2F0TA 4PNYA 3J7AF 2F0PA 5KGUA 2XSCA 1X3EA 2K50A 1E7ZA 2A68D 4KY7A 3SK6A 4CDFC 4JI4Q 1EU4A 4HJ9A 3UDXA 1HCZA 1MSHA 1GUSA 4UP8A 5C0XJ 4JBJA 2B8GA 2YU9B 1CKNB 1KL9A 5CV5A 5KYLA 4NDXA 1XMQL 4UHVA 4DV2Q 3CPFA 2MGSA 4GOPC 3QIAA 2A6EC 4F88A 4POFA 4XT3B 4L6TB 4H0LC 1M1KC 3CRLC 2FFKB 1K8MA 3BS1A 3LX0A 2AWNA 2KVMA 3DMUA 4P74A 4IUQA 1BVSA 4XQQA 5M9OA 1GUWA 3I4NG 1JORA 3HKZB 1B1ZA 3A8KE 2UXBL 3TP8A 1D5MC 4K14A 3A7LA 4R4IA 4LF9L 1XPRA 1II3A 4PZ8A 5JPNC 3TDQA 1PRTB 4X64L 3RD4A 3H09A 1S72A 4UDUC 1E2ZA 4RCNA 1PVOA 1LTLA 1STYA 1B8AA 3AFQA 1Q1EA 3S2DB 4P73A 5FK9C 4EVOA 2B63H 3T13A 4C3JH 1IHZA 4ME5A 4G7HC 4GLVB 2N8NA 1HRJA 5IT9c 2CHBD 3W5OA 4YCVA 4G57A 5HURA 1EL0A 2EYPA 2OF1A 4UAIA 4Z9CB 3ULJA 1SAPA 1NCVA 2A73B 3M3YB 4QIWE 3BZCA 1G291 2ENBA 1WTOA 2NVYH 4ZUJA 4ZKBB 3Q22A 4JI4L 4RGTA 4X3UA 3NXWA 2ASBA 2EJMA 3WWVA 1FYCA 5M5XH 3W1BA 3C2PA 1TWGB 4B3RQ 1JJCB 1B53A 4DV2L 1I6HH 2NBFA 2I0QA 5M5YB 2D9UA 1QG7A 4XTCS 1CSQA 2A69C 5IOCA 1YNND 4DV4Q 1FGBD 4DK6C 4JCVE 5GADC 1JC7A 3OWEB 1EY4A 1D8LA 3IRBA 3G71A 2LFNA 2B63G 2AQ2B 4ULLA 4HMIA 1PRTD 3BU2A 3HOWH 3QOLA 1YHQA 1YEZA 2R7DA 2Q2UA 3S1NB 3Q0AA 1Y14B 2H1EA 3GDEA 4GN3B 4ZRZA 4JI6L 4FF1A 1PYBA 4C56C 1I50B 2Q8TA 1VQ4A 3BYTB 5IGEA 5E7NA 1AZPA 4CDEC 1EY5A 3V05A 4DNRB 2G9HD 3O13A 3I90A 4C1NI 4OO1G 2RCNA 2WINB 1F77A 3FEWX 2E2IH 1GO3E 2OWOA 4DNIA 3PO2B 1HFNA 2XNAC 2I5LX 4IPCA 1J9OA 3HP3A 1KNAA 3TQYA 4IOAA 3OMGA 3GO5A 1OXVA 4IFDJ 5IYDH 4JI1Q 2PO4A 2B39A 4OWWB 4LNQA 3RZOB 2JSOA 1QNKA 1X55A 1QVCA 2E2DC 5FLMH 1BXTA 4KY6A 4A3EH 3S2HB 3HOWG 1SJHD 4BBSH 1SR3A 4NW2A 5M3MH 1E1OA 4IFDI 1EQQA 2C9OA 2E8GA 4DXGA 5CMDA 4GNXB 1K83B 5C44H 4QQBX 1IXRA 3UI2A 4EQ5A 1VQBA 1KDCA 2VZAA 1SBBB 1ASYA 1U4RA 4EX5A 1MSGA 3BG3A 2KA7A 2AUKA 4LW1A 4BBRG 1RHPA 3PIP3 2RDHA 2XRQD 1HZAA 1TY0A 4ZAIA 1DJRD 1BCPF 2NWGA 3A5ZB 4FVMA 2K14A 4KJNA 3VR2A 3PIOA 5JJIA 1QZHA 3CQZH 2HIVA 4Y52H 2WKCA 1LT5D 3G4SA 4O0AA 1U4PA 3M7GA 2R92H 1EWHA 1EY8A 1QUQB 4H13C 1Q8KA 1ILQA 3JAMc 3GTJB 4P72A 1F2ZA 1Y1VB 3H94A 4DR2L 2L11A 1CHQD 4QL5A 3PF4A 1M4VA 1PXUA 4L8JA 5FLMG 2B2YA 1NTGA 1YHAA 4BBSG 1SFOH 5ELDA 1PH8A 1VQGA 2RSOA 3X3NA 3MXUA 5I2YA 3G6EA 1PH9A 3S15B 2HHHL 2K5DA 5C44G 3KBXA 2IWHA 2F0UA 1IBMQ 4DR4Q 3PO2G 4PMBA 3LWEA 1G6ZA 1A6XA 1JOKA 3NELA 4K2LA 3PUXA 1WI5A 1GUOA 1LV9A 3KLSX 1JICA 3WOEA 1WCMH 5E4WC 1UE1A 3CCQA 2IT1A 2RVLA 4HCSA 3S16H 4OGQC 3G6JB 1MKHA 3OPOA 3NPPA 2FHTA 2R92G 1EUJA 2JA5H 3E5SA 1Q81C 1RF2D 2F3IA 2Q2TA 5LL6S 2JYOA 3URYA 1WTRA 1IBLQ 2EYFA 2PMZE 2XWBB 4YIJA 4ZQ3A 2AWOA 2EYOA 3A55A 1GOZA 2B2VA 2IHEA 2L0CA 4G4KA 3N6RA 4HSPA 2E2HH 4S3SA 4X65L 5IIFA 2EE1A 1BF4A 1BNZA 1U9RA 2VQEQ 1AH9A 1LUZA 5HGQA 1EZ8A 3BDOA 2IPKD 3SE0A 2PCFB 2RA4A 4IUTA 4NPSA 4PG3A 4M1UB 4R1JA 3WDNA 4X3KA 1Y1VG 4C2MB 1VQDA 1JE5A 4DUYQ 3S1MB 1HNWL 1UNSA 2PI2E 3I7FA 3SK5A 1VQ9A 1G2TA 5IT9E 2ZXRA 4O1NA 3IL8A 2EZVA 2PZWA 4CJ2C 5BN3A 5C4JB 1EQTA 5J1ZA 5GQOA 1KLGD 2K33A 5FO9B 1A0IA 2PZTA 1GUNA 1YITA 4DV1Q 1R9TH 2F0SA 5E1FA 4HJ7A 3CAMA 2OCEA 5J39A 3U4VA 2GN5A 3ULLA 4C3HB 3J81c 3U4ZA 4H7BA 3U50C 1BCPC 1JOQA 1H9RA 1NUCA 1K73C 2F0WA 3BVMA 4DU9A 5CBEE 2NVXH 2F0JA 2RQXA 3PUZA 2ID0A 1XJVA 1X54A 4H02A 1R4QB 2CKZB 1IBLL 4N9PA 2XTIA 4N8X1 4YCWA 4IJLA 3SEBA 5JOBA 2OEOA 4LF6Q 1HZBA 1OXUA 2B2UC 3RLOA 5A2QL 2R93B 2Y0SE 4A3BB 2Z4HA 1MJCA 4K8IA 4RGNA 1C7YA 2K03A 1C0AA 1SMXA 3P1HA 3I2ZA 1DXMA 1O80A 1SYDA 1SJED 1B2TA 3S24A 4JI2L 3A54A 3E9HA 2FINB 4NB3A 2DNCA 1PH6A 5CBAE 4A3MB 4KD3A 2JA6B 1YIJA 4L63B 2JEAI 3PO3H 4DV6Q 3I73A 1V1QA 2QGQA 1AZQA 4BY7B 2G9DA 1EIHA 2LKVA 4C3IB 4DUYL 3MEFA 1GUGA 3KJOA 3GD7A 4JV5L 1VQHA 3E3XA 5JPMC 5FLXc 4IZ8A 3GTMB 3A8IE 4HJ5A 4A3DB 4H44C 2UXDQ 1JQYD 2L4NA 1Q86C 4KHZA 3QWNA 2EYJA 2Z6KA 1T5XD 4IO9A 1O78A 2KCCA 1GJXA 1MI2A 1FR3A 3M85A 3EA6A 4DV1L 5C3EH 2M00A 1NNXA 4JBKA 1EWCA 5TSSA 4A3IH 3TP6A 3I70A 1ET6A 4Y7NB 4OWXB 4C3HG 4KD4A 4A3CH 4ZYSA 2UUBL 4DV0L 1YJWA 3GTKH 1XNQL 3SR1A 1LT3D 2NVTB 3T16A 1PFSA 5JEAG 2R6GA 3STBC 1TR5A 2M2LA 3PO3G 4KHPQ 3U9SA 2SEBD 2D2CC 5FOBB 1PH3A 4NXNQ 5I4DA 3TP7A 4EQNA 2QEJC 3EFXD 4K0KQ 1GM5A 2E5LQ 2FMMA 2EPBA 3HKZE 3FPPA 2B2WC 2WAQB 2E2JB 5CV7A 5EPLA 3KUPA 2MUYA 1SRUA 1K8AC 4K8JA 1CFMA 4A3JH 1DZ1A 4DV3Q 4DR3Q 1ICWA 2SOBA 2JA6G 1IZ6A 1AFPA 2DUDA 1FNUA 2NVQB 2RSNA 2UXCQ 4BY7G 4B3MQ 4C3IG 1EYCA 4FXKC 1FNVA 3D31A 1S5FD 2EIFA 3ULPA 5AJ3Q 1WTXA 3DEPA 4RGMA 3K7UC 1YNXA 3TEHB 4A3DG 2HDMA 1K0RA 2SDFA 3TS2A 1PRTF 1CT1D 3BYYB 3C1FA 5FO8B 2F4VQ 1UUPA 4ILWA 2ZM6Q 3J80c 3VYUA 4DV5L 1PHJA 4QUFA 1PDQA 4TKOB 4WFN3 4IUVA 2JXMB 5C5MA 1K8OA 1ZYRD 1H9JA 2EYHA 4PZ6A 1PTOC 1W6KA 1Y8PB 1K3RA 1YNJD 1HA5A 5CV4A 4A93B 4CJ1B 2A68C 5I9OA 4OIJA 1A62A 3CCUA 3I4MB 1O7YA 3OMCA 3EIVA 5KYIA 1OXXK 1QCBD 2F03A 4ZLTF 3HS0C 4KHPL 2GA4B 3A5UA 4YWLA 3PF5A 2VUMH 4NXNL 1S4ZA 2WFWA 2O5JC 1A63A 4K5WA 1WOCA 3PMFA 1Z47A 5I2XA 3S1RB 1K8GA 1KC8C 4QF4A 3D8GA 1PH1A 5GAEC 2H5XA 4R4QA 3RLFA 1WTWA 2MQHA 1SYEA 1P16A 2WAQG 3LWUA 4IPDA 4RKBA 1I94Q 1VDZA 2TSSA 2J4XA 2F0GA 2PW5A 4DR3L 2UU9L 4TSSA 1VQ5A 1JR0D 4R4CA 4JI7Q 1RTOA 1UE7A 3Q24A 2BH2A 2UXCL 1AE3A 3D4RA 2VQFQ 4B3ML 2YTXA 4CDCC 2BCOA 2VXWA 5IYCH 1G51A 1S5ED 4DR6Q 2A1AA 2Z0SA 2YTVA 1L1OC 2HQEA 2L5TA 4LF4L 5H1SE 3D3RA 3S14H 2ATWA 4XXEA 4GOPA 1I4HA 5C4XH 4R8IA 1N34Q 1KQSA 1XTDA 2CW0D 4DAYB 1FJGQ 3I4NH 1QVFA 2ZM6L 3UE1A 3KF8A 4AYBB 2Z8LA 1JWUD 2B2TC 3T1HQ 2IX0A 4KJOA 5NUCA 1I4PA 4QY7A 1O7IA 1STHA 3VR6A 2DNEA 4FP5D 5ELFA 3AEVA 1QWYA 4RHRA 4YHHQ 5C6AA 5A35A 5E4XA 3MEHA 3S1QB 5M3FH 1RTNA 3DXJC 5EJWA 5KNDA 2JJQA 1PH2A 2R7ZH 1KABA 1JMCA 4JI8Q 3EBEA 4V0BA 4U673 1VMPA 1WTHA 3H6MA 1S5BD 3SGIA 5IYCG 3IAYA 2NN6G 1E22A 1I4RA 2F0FA 4WJ3M 1YNNC 2UUAL 5C0XI 2QKIC 3L0OA 4X3SA 4PQXA 1NR4A 2TMPA
chains in the Genus database with same CATH topology
1LM0A 5FLMH 4A3EH 4ME3A 1BBUA 1N36Q 3HOWG 2Y0SG 3PCOB 1I94L 1SR3A 4BBSH 2UXDL 5C4XG 2JA5G 5M3MH 1E1OA 4IFDI 1EQQA 4JI3L 2E2JH 2E8GA 3HOYH 4GNXB 2UUCQ 4QQBX 5C44H 4X62Q 3H3VH 1IXRA 4EQ5A 1VQBA 3J81j 4LFAQ 3J7ZC 1X3FA 1YHBA 3ER0A 2VZAA 4JI7L 1X6OA 3G48A 4A76A 1EWIA 1ASYA 2YU9H 4JYAQ 2K75A 4BXXH 1VS0A 1H95A 4EX5A 2VQFL 3OW2A 3M7NA 4LW1A 4BBRG 1B70B 3M4QA 4DR6L 5BR8Q 2OQ0A 4KLKA 4R4TA 1YBYA 2WB1E 1HZAA 3KDFA 2NVQH 3HOUH 3EN2A 4P75A 2UUBQ 3A5ZB 3PIOA 4DV0Q 2K14A 3CW2C 3CCLA 4GLXA 1XNQQ 5JJIA 4DUZQ 2LSSA 2EXDA 2EQSA 1QZHA 1KHIA 3CQZH 2HIVA 4Y52H 5M3FG 3H3VI 2K52A 3G4SA 1FJGL 4O0AA 1VQOA 1AE2A 2R7ZG 2R92H 1K9MC 1EYGA 1QUQB 4GS3A 4OX9Q 2CQOA 1KAWA 1Q8KA 4LUOA 1L1OA 3JAMc 1J6QA 4P72A 3PSIA 4DR2L 2KCTA 4DPGA 3T1HL 4K0KL 1GKHA 1XMOL 2CCZA 4QL5A 2IY5B 4LF5L 3PF4A 1ASZA 2E5LL 5FLMG 5GAGC 1NTGA 1YHAA 4HJ8A 5JJLA 3A74A 2N78A 4AIMA 1BKBA 4BBSG 2VY3A 1SFOH 1RIPA 1PH8A 1VQGA 4JI5Q 4RMFA 4YHHL 3G6EA 1PH9A 3HOYG 4A93H 2HHHL 1XPOA 1FVIA 5C44G 2ZTDA 4UY8C 1IBMQ 3S2DH 4P71A 3PO2G 4DR4Q 4JOIC 3CPWA 4DV3L 3I4MH 4ALPA 3CMEA 1XMQQ 4A3LG 4JI8L 4LF8Q 4BXXG 5ELNA 5IY0A 1W2BA 1CKNA 4JI0L 3NELA 4DR1Q 1VQNA 3PUXA 4A3MH 1X65A 1WI5A 1L0WA 3FKIH 1X3GA 2A19A 2ZJQA 3HOUG 5LMNL 3OTOQ 3S1RH 1IBKL 1WCMH 3CCQA 1CSPA 1UE1A 4YY3Q 3CCSA 2IT1A 5AJ3L 3K80C 3M3YH 4OO1I 2LXKA 2PNHA 3S16H 3I4OA 2PQAA 1MKHA 4AQYQ 2R92G 1CKMA 1EUJA 3OYYA 1PV4A 2JA5H 4X62L 3HKZG 3CC4A 2F4VL 5LMNW 2MFIA 1Q81C 2K5NA 2F3IA 3CMAA 2Q2TA 1OXSC 3J80i 4LFAL 1IL2A 1IBLQ 3ICEA 1CUKA 2K4KA 4JYAL 3GTQH 2PMZE 4X64Q 3TREA 5GAHC 4DV5Q 1TWGH 2GVAA 1WYDA 2AWOA 3S17H 1VQJA 1GD7A 2RF4A 4QGUA 2WP8J 3B6YA 5BR8L 2NN6I 3JC66 5M5YH 1JJ2A 1EIFA 1E3PA 4BBRH 2IHEA 2GVBA 2E2HH 2JA9A 5LMUQ 1NMFA 4X65L 3RR5A 5IP7G 4DUZL 2JA8G 2VQEQ 4A93G 4PMWA 1W3SA 1KXLA 3VDYA 1VQ8A 3K0XA 1AH9A 1LUZA 2B3GA 4NXMQ 5HGQA 3I4MG 4DR5Q 2JK8A 4TQUS 4LF7Q 1TWHH 4OX9L 4NPSA 3ZJYC 3DM3A 4PG3A 1UE5A 3HOZG 4R1JA 3FP9A 4UP9A 3S1NH 4DK3C 2R7FA 4HIKA 3FKIG 1TWAH 1Y1VG 1J5EQ 1VQDA 3CXCA 1JE5A 4DUYQ 2DGYA 1P8LA 2Z6KC 3L2PA 1B7YB 3F2DA 1KD1C 1HNWL 2KBNA 1I50H 3DLLA 2JQOA 2PI2E 3I7FA 1JB7A 1IYJB 1VQ9A 4LFCQ 4GNXC 3GTPH 4JI5L 1E24A 3HOVH 1VQFA 4X66Q 3M4PA 1FL0A 1Q7YC 5M5WH 2YV5A 4UPAA 2A8VA 1HJPA 2WB1G 3BJUA 4A4IA 4DAMA 2QA4A 2BH8A 2R7ZH 4B3RL 5IWAQ 2UU9Q 4L5QA 5GQOA 1HNXQ 5C3EG 4LF8L 1A0IA 1WFQA 4HIDA 3PO2H 4DR1L 4A3IG 1NMGA 1YITA 4MZ9A 3S1QH 4DV1Q 1Y1WH 1QZGA 1PH5A 1R9TH 4A3LH 1N33Q 1JJGA 2F52A 2N3SA 2YTYA 4JC0A 4HJ7A 3CAMA 2OCEA 4A3CG 4DV4L 4B3SQ 3OTOL 3U4VA 2GN5A 3ULLA 3J81c 3U4ZA 2PQAB 4YY3L 4JOIA 4A75A 4GOPB 3U50C 1VQ6A 4YCUA 5J3BA 1YI2A 1YZ6A 1K73C 4LF4Q 4JBWA 3RZOH 1VQAA 2NVXH 2MNAA 4AQYL 2KHIA 3PUZA 1NE3A 1N34L 2ID0A 2L15A 1XJVA 1X54A 3KF8B 1Q46A 2QEXA 3S2HH 4H02A 3KF6B 1V43A 4UP7A 1PA6A 4A3KG 1N8RC 2CKZB 1IBLL 2XTIA 1N9WA 4YCWA 4IJLA 4JI6Q 4LF6Q 5IE8A 1C9OA 2Q2HA 1HZBA 1OXUA 4A3GG 3RLOA 1K83H 2B29A 2Y0SE 4AYBG 3I55A 1MJEA 1NBWA 4FDBA 1E1TA 1I3QH 3UDGA 4MNOA 2BA0A 1S40A 3HOXH 3E9IA 1MJCA 1SROA 5FJ8G 1C7YA 1YJ9A 2YYZA 3HOVG 1C0AA 1SMXA 5LMUL 3I2ZA 1SE8A 4XIGS 4YWKA 1UEBA 1Q82C 3K81C 2OQKA 3S24A 4JI2L 3E9HA 5GROA 4OXPA 4A3JG 4NB3A 4GN5A 5IP7H 1HR0Q 4NXML 3PUVA 2JA8H 4DR5L 3STBD 1PH6A 1RL2A 1TWCH 4O2DA 1YIJA 4L5SA 4GKKQ 1Y1WG 2VS1A 2JEAI 4GLAC 1EIYB 3PO3H 4DV6Q 1JT8A 1V1QA 2QGQA 1KIXA 3K8AA 2CWAA 3KYHC 3T1YQ 1J5EL 2HQLA 3A0JA 3HOZH 4DUYL 3MEFA 4JI1L 3F8TA 3KJOA 3GTJH 1Y1VH 2UUAQ 3GD7A 4R4OA 2JEBI 1VQHA 4JV5L 4LFCL 3NEMA 3RN2A 5FLXc 1NY4A 4IJHA 3PGZA 3CF5A 4HJ5A 4X66L 1N36L 3RNUA 1VQPA 2OTLA 2UXDQ 3L7ZC 5ELOA 1YJNA 2ES2A 2KCMA 1Q86C 4JI3Q 2UXBQ 1IBKQ 4KHZA 3HFZB 5IWAL 2UUCL 1BBWA 2Z6KA 4IO9A 5K36G 2D62A 3F1ZA 3S15H 4LF9Q 1PYSB 4GNXA 1OXTA 3M85A 3H15A 4DV1L 3BZKA 4JG2A 5C3EH 4JBKA 4IPHA 2WAQE 1Q12A 3KDFB 3HOXG 4A3IH 4MTNA 3CC2A 1Q1BA 4B3SL 2IX1A 3MXNB 1PH7A 1QVGA 3KFUA 4OWXB 3J7A5 4A3CH 3M9BA 2UUBL 4DV0L 1YJWA 4BY1H 1T9HA 2D0PA 1XNQL 2I5MX 4LWCA 1KRTA 3GTKH 1OTCA 4DKAC 4JBMA 4RG1A 2XGTA 1N32Q 1PFSA 3D0FA 2ZJPA 2BA1A 5JEAG 1L1OB 2R6GA 1SLJA 1VQEA 3STBC 4HIMA 2VUMG 4QJFA 3PO3G 2N49A 2ZTCA 4KHPQ 1TXYA 3PIPA 3JAMi 1VQ7A 3CCVA 2V1CC 4A3KH 2K5HA 1PH3A 4NXNQ 2HT1A 4BA2I 4BA1I 4DR2Q 1QUQA 2VNUD 1D7QA 3KJPA 4A3GH 2KHJA 3GTLH 4K0KQ 1GM5A 2E5LQ 3HKZE 1X3EA 3LGJA 1I5FA 2K50A 1E7ZA 4JI4Q 5FJ8H 3RLNA 1Z9FA 4HJ9A 3UDXA 1HR0L 5DLQE 2HHHQ 4UP8A 4DR7Q 5C0XJ 4JBJA 1SRUA 1K8AC 1IBML 1CKNB 4HJAA 4A3JH 4DR4L 4GKKL 2K5VA 3M4OH 1KL9A 4DV3Q 4DR3Q 1XMQL 4DV2Q 3CPFA 1IZ6A 4B3TQ 5IYBH 2JA6G 2OTJA 1CKOA 2DUDA 4GOPC 4GKJQ 4HIOA 3T1YL 4POFA 2KENA 1HR0W 2UXCQ 4BY7G 4B3MQ 1VCIA 3PV0A 3Q8DA 5LMNQ 4L5RC 1M1KC 3D31A 4BY1G 4TVAB 4C2MH 2AWNA 2EIFA 3ULPA 5AJ3Q 4P74A 3S1MH 2AMCB 1BVSA 4OWTB 3K7UC 1YNXA 3TEHB 3I4NG 4A3DG 1K0RA 3TS2A 2UXBL 1HH2P 4IOCA 1HZ9A 2F4VQ 4R4IA 3TS0A 4LF9L 3UE0A 1VQMA 1XPRA 2ZM6Q 4L5TA 4PZ8A 3J80c 2AKWB 5IP9H 4X64L 3AFPA 4DV5L 5C4JH 1PHJA 1X9NA 1VQLA 1LYLA 3GTGH 3KLWA 1S72A 5JJKA 3F2BA 1EOVA 1U5KA 5C0XG 1PVOA 1LTLA 1U0LA 2JA7G 4PZ6A 1K3RA 1B8AA 2VL6A 2MO1A 3AFQA 3U58A 4X65Q 1Q1EA 3AYHB 1YVCA 1HNZQ 4P73A 2VQEL 4C3HH 4DV7Q 2B63H 1A62A 3CCMA 3CCUA 4C3JH 3UDIA 4IFDG 4GLVB 2MO0A 1N32L 3H0GH 2N8NA 3EIVA 1MIUA 1OXXK 5IT9c 2CWPA 3W5OA 4A3DH 4YCVA 4LF7L 5IYBG 4KHPL 1FGUA 3A5UA 4OONA 4YWLA 5IYDG 3PF5A 4NXNL 2WFWA 2VUMH 1G6PA 4WJ4A 4A3FG 2JE6I 1A63A 2AHOB 3ULJA 1XNRQ 1WOCA 2I5HA 1Z47A 1NJIC 1K8GA 1KC8C 3HKSA 1WJJA 4YWMA 1EQRA 1PH1A 5JEAJ 4LFBQ 1HNWQ 2R93H 5GAEC 4QIWE 4A3EG 4A3BH 3BZCA 1DGSA 1G291 2H5XA 4R4QA 3RLFA 3I56A 3CP0A 5M3MG 2NVYH 4JI4L 2MQHA 1P16A 2WAQG 4IPDA 1I94Q 2ASBA 4AYBE 4DR7L 3WWVA 3TRZA 2IHFA 1UWVA 5M5XH 3W1BA 3CCRA 2NZHA 3CCEA 1JJCB 4DR3L 2UU9L 4B3RQ 5IP9G 4DV2L 1HNXL 1VQ5A 1L2FA 4B3TL 4POGA 1I6HH 3K7AH 4R4CA 2ALYB 4GKJL 2I0QA 4JI7Q 1UE7A 2HIXA 1N33L 1GVPA 4XTCS 2BH2A 2JA6H 1AE3A 1CSQA 2VQFQ 4B3ML 2YTXA 2UXCL 3PUWA 4DV4Q 4DK6C 5IYCH 4JCVE 5GADC 1G51A 3J81i 4DR6Q 5EAYA 2A1AA 2Z0SA 4J15A 4BY7H 2YTVA 4C3IH 3GTOH 1D8LA 1L1OC 3IRBA 3G71A 2B63G 1VQIA 4LF4L 5H1SE 3S14H 4GN4B 3CC7A 3FHWA 3H0GG 2ATWA 4GOPA 3BU2A 4X6AH 4IPGA 5C4XH 3HOWH 3PUYA 1N34Q 3GTMH 1YHQA 1KQSA 1YEZA 2R7DA 1XTDA 2Q2UA 4LUZA 4DAYB 1FJGQ 3I4NH 3NENA 1Y14B 2RHSB 3GDEA 4AH6A 4GN3B 1QVFA 2ZM6L 1KRSA 3UE1A 2CFMA 2PI2A 5HY6A 4LF6L 4PZ7A 1SN8A 4JI6L 3KF6A 1PYBA 2VW9A 1TWFH 3UDFA 2Q2IA 1VQ4A 2R93G 4A3BG 3T1HQ 3NBHB 5E7NA 1XMOQ 2IX0A 4LF5Q 2LXJA 3CD6A 1M90C 4QY7A 1O7IA 1V9PA 1VQCA 2FXQA 2C35B 2RHQB 3RN5A 1HNZL 2JA7H 2RCNA 1X56A 3CCJA 4DV7L 3AEVA 4OO1G 4KI0A 4Y7NH 3E0EA 4JI2Q 1XPUA 1EFWA 2E2IH 1GO3E 4YHHQ 2OWOA 4DNIA 2ZTEA 2I5LX 2NZOA 5M3FH 4APVA 4IPCA 2JJQA 1HZCA 1UE6A 4A3MG 1PH2A 3TQYA 1JMCA 1VQKA 4JI8Q 3EBEA 2NVTH 4DV6L 1XNRL 3F2CA 4IOAA 4JI0Q 2D0OA 3ERSX 3GO5A 3AQQA 1OXVA 3RZDH 4IFDJ 5IYDH 3SGIA 5IYCG 2ZJRA 1WCMG 2NN6G 4JI1Q 1E22A 3W1GA 4A3FH 4LFBL 4OWWB 4WJ3M 4LNQA 2UUAL 4LUVA 1S3OA 1X55A 1A8VA 1QVCA 3L0OA 5C0XI 4JV5Q 1PH4A 3KOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM0 A;  5FLM H;  4A3E H;  4ME3 A;  1BBU A;  1N36 Q;  3HOW G;  2Y0S G;  3PCO B;  1I94 L;  1SR3 A;  4BBS H;  2UXD L;  5C4X G;  2JA5 G;  5M3M H;  1E1O A;  4IFD I;  1EQQ A;  4JI3 L;  2E2J H;  2E8G A;  3HOY H;  4GNX B;  2UUC Q;  4QQB X;  5C44 H;  4X62 Q;  3H3V H;  1IXR A;  4EQ5 A;  1VQB A;  3J81 j;  4LFA Q;  3J7Z C;  1X3F A;  1YHB A;  3ER0 A;  2VZA A;  4JI7 L;  1X6O A;  3G48 A;  4A76 A;  1EWI A;  1ASY A;  2YU9 H;  4JYA Q;  2K75 A;  4BXX H;  1VS0 A;  1H95 A;  4EX5 A;  2VQF L;  3OW2 A;  3M7N A;  4LW1 A;  4BBR G;  1B70 B;  3M4Q A;  4DR6 L;  5BR8 Q;  2OQ0 A;  4KLK A;  4R4T A;  1YBY A;  2WB1 E;  1HZA A;  3KDF A;  2NVQ H;  3HOU H;  3EN2 A;  4P75 A;  2UUB Q;  3A5Z B;  3PIO A;  4DV0 Q;  2K14 A;  3CW2 C;  3CCL A;  4GLX A;  1XNQ Q;  5JJI A;  4DUZ Q;  2LSS A;  2EXD A;  2EQS A;  1QZH A;  1KHI A;  3CQZ H;  2HIV A;  4Y52 H;  5M3F G;  3H3V I;  2K52 A;  3G4S A;  1FJG L;  4O0A A;  1VQO A;  1AE2 A;  2R7Z G;  2R92 H;  1K9M C;  1EYG A;  1QUQ B;  4GS3 A;  4OX9 Q;  2CQO A;  1KAW A;  1Q8K A;  4LUO A;  1L1O A;  3JAM c;  1J6Q A;  4P72 A;  3PSI A;  4DR2 L;  2KCT A;  4DPG A;  3T1H L;  4K0K L;  1GKH A;  1XMO L;  2CCZ A;  4QL5 A;  2IY5 B;  4LF5 L;  3PF4 A;  1ASZ A;  2E5L L;  5FLM G;  5GAG C;  1NTG A;  1YHA A;  4HJ8 A;  5JJL A;  3A74 A;  2N78 A;  4AIM A;  1BKB A;  4BBS G;  2VY3 A;  1SFO H;  1RIP A;  1PH8 A;  1VQG A;  4JI5 Q;  4RMF A;  4YHH L;  3G6E A;  1PH9 A;  3HOY G;  4A93 H;  2HHH L;  1XPO A;  1FVI A;  5C44 G;  2ZTD A;  4UY8 C;  1IBM Q;  3S2D H;  4P71 A;  3PO2 G;  4DR4 Q;  4JOI C;  3CPW A;  4DV3 L;  3I4M H;  4ALP A;  3CME A;  1XMQ Q;  4A3L G;  4JI8 L;  4LF8 Q;  4BXX G;  5ELN A;  5IY0 A;  1W2B A;  1CKN A;  4JI0 L;  3NEL A;  4DR1 Q;  1VQN A;  3PUX A;  4A3M H;  1X65 A;  1WI5 A;  1L0W A;  3FKI H;  1X3G A;  2A19 A;  2ZJQ A;  3HOU G;  5LMN L;  3OTO Q;  3S1R H;  1IBK L;  1WCM H;  3CCQ A;  1CSP A;  1UE1 A;  4YY3 Q;  3CCS A;  2IT1 A;  5AJ3 L;  3K80 C;  3M3Y H;  4OO1 I;  2LXK A;  2PNH A;  3S16 H;  3I4O A;  2PQA A;  1MKH A;  4AQY Q;  2R92 G;  1CKM A;  1EUJ A;  3OYY A;  1PV4 A;  2JA5 H;  4X62 L;  3HKZ G;  3CC4 A;  2F4V L;  5LMN W;  2MFI A;  1Q81 C;  2K5N A;  2F3I A;  3CMA A;  2Q2T A;  1OXS C;  3J80 i;  4LFA L;  1IL2 A;  1IBL Q;  3ICE A;  1CUK A;  2K4K A;  4JYA L;  3GTQ H;  2PMZ E;  4X64 Q;  3TRE A;  5GAH C;  4DV5 Q;  1TWG H;  2GVA A;  1WYD A;  2AWO A;  3S17 H;  1VQJ A;  1GD7 A;  2RF4 A;  4QGU A;  2WP8 J;  3B6Y A;  5BR8 L;  2NN6 I;  3JC6 6;  5M5Y H;  1JJ2 A;  1EIF A;  1E3P A;  4BBR H;  2IHE A;  2GVB A;  2E2H H;  2JA9 A;  5LMU Q;  1NMF A;  4X65 L;  3RR5 A;  5IP7 G;  4DUZ L;  2JA8 G;  2VQE Q;  4A93 G;  4PMW A;  1W3S A;  1KXL A;  3VDY A;  1VQ8 A;  3K0X A;  1AH9 A;  1LUZ A;  2B3G A;  4NXM Q;  5HGQ A;  3I4M G;  4DR5 Q;  2JK8 A;  4TQU S;  4LF7 Q;  1TWH H;  4OX9 L;  4NPS A;  3ZJY C;  3DM3 A;  4PG3 A;  1UE5 A;  3HOZ G;  4R1J A;  3FP9 A;  4UP9 A;  3S1N H;  4DK3 C;  2R7F A;  4HIK A;  3FKI G;  1TWA H;  1Y1V G;  1J5E Q;  1VQD A;  3CXC A;  1JE5 A;  4DUY Q;  2DGY A;  1P8L A;  2Z6K C;  3L2P A;  1B7Y B;  3F2D A;  1KD1 C;  1HNW L;  2KBN A;  1I50 H;  3DLL A;  2JQO A;  2PI2 E;  3I7F A;  1JB7 A;  1IYJ B;  1VQ9 A;  4LFC Q;  4GNX C;  3GTP H;  4JI5 L;  1E24 A;  3HOV H;  1VQF A;  4X66 Q;  3M4P A;  1FL0 A;  1Q7Y C;  5M5W H;  2YV5 A;  4UPA A;  2A8V A;  1HJP A;  2WB1 G;  3BJU A;  4A4I A;  4DAM A;  2QA4 A;  2BH8 A;  2R7Z H;  4B3R L;  5IWA Q;  2UU9 Q;  4L5Q A;  5GQO A;  1HNX Q;  5C3E G;  4LF8 L;  1A0I A;  1WFQ A;  4HID A;  3PO2 H;  4DR1 L;  4A3I G;  1NMG A;  1YIT A;  4MZ9 A;  3S1Q H;  4DV1 Q;  1Y1W H;  1QZG A;  1PH5 A;  1R9T H;  4A3L H;  1N33 Q;  1JJG A;  2F52 A;  2N3S A;  2YTY A;  4JC0 A;  4HJ7 A;  3CAM A;  2OCE A;  4A3C G;  4DV4 L;  4B3S Q;  3OTO L;  3U4V A;  2GN5 A;  3ULL A;  3J81 c;  3U4Z A;  2PQA B;  4YY3 L;  4JOI A;  4A75 A;  4GOP B;  3U50 C;  1VQ6 A;  4YCU A;  5J3B A;  1YI2 A;  1YZ6 A;  1K73 C;  4LF4 Q;  4JBW A;  3RZO H;  1VQA A;  2NVX H;  2MNA A;  4AQY L;  2KHI A;  3PUZ A;  1NE3 A;  1N34 L;  2ID0 A;  2L15 A;  1XJV A;  1X54 A;  3KF8 B;  1Q46 A;  2QEX A;  3S2H H;  4H02 A;  3KF6 B;  1V43 A;  4UP7 A;  1PA6 A;  4A3K G;  1N8R C;  2CKZ B;  1IBL L;  2XTI A;  1N9W A;  4YCW A;  4IJL A;  4JI6 Q;  4LF6 Q;  5IE8 A;  1C9O A;  2Q2H A;  1HZB A;  1OXU A;  4A3G G;  3RLO A;  1K83 H;  2B29 A;  2Y0S E;  4AYB G;  3I55 A;  1MJE A;  1NBW A;  4FDB A;  1E1T A;  1I3Q H;  3UDG A;  4MNO A;  2BA0 A;  1S40 A;  3HOX H;  3E9I A;  1MJC A;  1SRO A;  5FJ8 G;  1C7Y A;  1YJ9 A;  2YYZ A;  3HOV G;  1C0A A;  1SMX A;  5LMU L;  3I2Z A;  1SE8 A;  4XIG S;  4YWK A;  1UEB A;  1Q82 C;  3K81 C;  2OQK A;  3S24 A;  4JI2 L;  3E9H A;  5GRO A;  4OXP A;  4A3J G;  4NB3 A;  4GN5 A;  5IP7 H;  1HR0 Q;  4NXM L;  3PUV A;  2JA8 H;  4DR5 L;  3STB D;  1PH6 A;  1RL2 A;  1TWC H;  4O2D A;  1YIJ A;  4L5S A;  4GKK Q;  1Y1W G;  2VS1 A;  2JEA I;  4GLA C;  1EIY B;  3PO3 H;  4DV6 Q;  1JT8 A;  1V1Q A;  2QGQ A;  1KIX A;  3K8A A;  2CWA A;  3KYH C;  3T1Y Q;  1J5E L;  2HQL A;  3A0J A;  3HOZ H;  4DUY L;  3MEF A;  4JI1 L;  3F8T A;  3KJO A;  3GTJ H;  1Y1V H;  2UUA Q;  3GD7 A;  4R4O A;  2JEB I;  1VQH A;  4JV5 L;  4LFC L;  3NEM A;  3RN2 A;  5FLX c;  1NY4 A;  4IJH A;  3PGZ A;  3CF5 A;  4HJ5 A;  4X66 L;  1N36 L;  3RNU A;  1VQP A;  2OTL A;  2UXD Q;  3L7Z C;  5ELO A;  1YJN A;  2ES2 A;  2KCM A;  1Q86 C;  4JI3 Q;  2UXB Q;  1IBK Q;  4KHZ A;  3HFZ B;  5IWA L;  2UUC L;  1BBW A;  2Z6K A;  4IO9 A;  5K36 G;  2D62 A;  3F1Z A;  3S15 H;  4LF9 Q;  1PYS B;  4GNX A;  1OXT A;  3M85 A;  3H15 A;  4DV1 L;  3BZK A;  4JG2 A;  5C3E H;  4JBK A;  4IPH A;  2WAQ E;  1Q12 A;  3KDF B;  3HOX G;  4A3I H;  4MTN A;  3CC2 A;  1Q1B A;  4B3S L;  2IX1 A;  3MXN B;  1PH7 A;  1QVG A;  3KFU A;  4OWX B;  3J7A 5;  4A3C H;  3M9B A;  2UUB L;  4DV0 L;  1YJW A;  4BY1 H;  1T9H A;  2D0P A;  1XNQ L;  2I5M X;  4LWC A;  1KRT A;  3GTK H;  1OTC A;  4DKA C;  4JBM A;  4RG1 A;  2XGT A;  1N32 Q;  1PFS A;  3D0F A;  2ZJP A;  2BA1 A;  5JEA G;  1L1O B;  2R6G A;  1SLJ A;  1VQE A;  3STB C;  4HIM A;  2VUM G;  4QJF A;  3PO3 G;  2N49 A;  2ZTC A;  4KHP Q;  1TXY A;  3PIP A;  3JAM i;  1VQ7 A;  3CCV A;  2V1C C;  4A3K H;  2K5H A;  1PH3 A;  4NXN Q;  2HT1 A;  4BA2 I;  4BA1 I;  4DR2 Q;  1QUQ A;  2VNU D;  1D7Q A;  3KJP A;  4A3G H;  2KHJ A;  3GTL H;  4K0K Q;  1GM5 A;  2E5L Q;  3HKZ E;  1X3E A;  3LGJ A;  1I5F A;  2K50 A;  1E7Z A;  4JI4 Q;  5FJ8 H;  3RLN A;  1Z9F A;  4HJ9 A;  3UDX A;  1HR0 L;  5DLQ E;  2HHH Q;  4UP8 A;  4DR7 Q;  5C0X J;  4JBJ A;  1SRU A;  1K8A C;  1IBM L;  1CKN B;  4HJA A;  4A3J H;  4DR4 L;  4GKK L;  2K5V A;  3M4O H;  1KL9 A;  4DV3 Q;  4DR3 Q;  1XMQ L;  4DV2 Q;  3CPF A;  1IZ6 A;  4B3T Q;  5IYB H;  2JA6 G;  2OTJ A;  1CKO A;  2DUD A;  4GOP C;  4GKJ Q;  4HIO A;  3T1Y L;  4POF A;  2KEN A;  1HR0 W;  2UXC Q;  4BY7 G;  4B3M Q;  1VCI A;  3PV0 A;  3Q8D A;  5LMN Q;  4L5R C;  1M1K C;  3D31 A;  4BY1 G;  4TVA B;  4C2M H;  2AWN A;  2EIF A;  3ULP A;  5AJ3 Q;  4P74 A;  3S1M H;  2AMC B;  1BVS A;  4OWT B;  3K7U C;  1YNX A;  3TEH B;  3I4N G;  4A3D G;  1K0R A;  3TS2 A;  2UXB L;  1HH2 P;  4IOC A;  1HZ9 A;  2F4V Q;  4R4I A;  3TS0 A;  4LF9 L;  3UE0 A;  1VQM A;  1XPR A;  2ZM6 Q;  4L5T A;  4PZ8 A;  3J80 c;  2AKW B;  5IP9 H;  4X64 L;  3AFP A;  4DV5 L;  5C4J H;  1PHJ A;  1X9N A;  1VQL A;  1LYL A;  3GTG H;  3KLW A;  1S72 A;  5JJK A;  3F2B A;  1EOV A;  1U5K A;  5C0X G;  1PVO A;  1LTL A;  1U0L A;  2JA7 G;  4PZ6 A;  1K3R A;  1B8A A;  2VL6 A;  2MO1 A;  3AFQ A;  3U58 A;  4X65 Q;  1Q1E A;  3AYH B;  1YVC A;  1HNZ Q;  4P73 A;  2VQE L;  4C3H H;  4DV7 Q;  2B63 H;  1A62 A;  3CCM A;  3CCU A;  4C3J H;  3UDI A;  4IFD G;  4GLV B;  2MO0 A;  1N32 L;  3H0G H;  2N8N A;  3EIV A;  1MIU A;  1OXX K;  5IT9 c;  2CWP A;  3W5O A;  4A3D H;  4YCV A;  4LF7 L;  5IYB G;  4KHP L;  1FGU A;  3A5U A;  4OON A;  4YWL A;  5IYD G;  3PF5 A;  4NXN L;  2WFW A;  2VUM H;  1G6P A;  4WJ4 A;  4A3F G;  2JE6 I;  1A63 A;  2AHO B;  3ULJ A;  1XNR Q;  1WOC A;  2I5H A;  1Z47 A;  1NJI C;  1K8G A;  1KC8 C;  3HKS A;  1WJJ A;  4YWM A;  1EQR A;  1PH1 A;  5JEA J;  4LFB Q;  1HNW Q;  2R93 H;  5GAE C;  4QIW E;  4A3E G;  4A3B H;  3BZC A;  1DGS A;  1G29 1;  2H5X A;  4R4Q A;  3RLF A;  3I56 A;  3CP0 A;  5M3M G;  2NVY H;  4JI4 L;  2MQH A;  1P16 A;  2WAQ G;  4IPD A;  1I94 Q;  2ASB A;  4AYB E;  4DR7 L;  3WWV A;  3TRZ A;  2IHF A;  1UWV A;  5M5X H;  3W1B A;  3CCR A;  2NZH A;  3CCE A;  1JJC B;  4DR3 L;  2UU9 L;  4B3R Q;  5IP9 G;  4DV2 L;  1HNX L;  1VQ5 A;  1L2F A;  4B3T L;  4POG A;  1I6H H;  3K7A H;  4R4C A;  2ALY B;  4GKJ L;  2I0Q A;  4JI7 Q;  1UE7 A;  2HIX A;  1N33 L;  1GVP A;  4XTC S;  2BH2 A;  2JA6 H;  1AE3 A;  1CSQ A;  2VQF Q;  4B3M L;  2YTX A;  2UXC L;  3PUW A;  4DV4 Q;  4DK6 C;  5IYC H;  4JCV E;  5GAD C;  1G51 A;  3J81 i;  4DR6 Q;  5EAY A;  2A1A A;  2Z0S A;  4J15 A;  4BY7 H;  2YTV A;  4C3I H;  3GTO H;  1D8L A;  1L1O C;  3IRB A;  3G71 A;  2B63 G;  1VQI A;  4LF4 L;  5H1S E;  3S14 H;  4GN4 B;  3CC7 A;  3FHW A;  3H0G G;  2ATW A;  4GOP A;  3BU2 A;  4X6A H;  4IPG A;  5C4X H;  3HOW H;  3PUY A;  1N34 Q;  3GTM H;  1YHQ A;  1KQS A;  1YEZ A;  2R7D A;  1XTD A;  2Q2U A;  4LUZ A;  4DAY B;  1FJG Q;  3I4N H;  3NEN A;  1Y14 B;  2RHS B;  3GDE A;  4AH6 A;  4GN3 B;  1QVF A;  2ZM6 L;  1KRS A;  3UE1 A;  2CFM A;  2PI2 A;  5HY6 A;  4LF6 L;  4PZ7 A;  1SN8 A;  4JI6 L;  3KF6 A;  1PYB A;  2VW9 A;  1TWF H;  3UDF A;  2Q2I A;  1VQ4 A;  2R93 G;  4A3B G;  3T1H Q;  3NBH B;  5E7N A;  1XMO Q;  2IX0 A;  4LF5 Q;  2LXJ A;  3CD6 A;  1M90 C;  4QY7 A;  1O7I A;  1V9P A;  1VQC A;  2FXQ A;  2C35 B;  2RHQ B;  3RN5 A;  1HNZ L;  2JA7 H;  2RCN A;  1X56 A;  3CCJ A;  4DV7 L;  3AEV A;  4OO1 G;  4KI0 A;  4Y7N H;  3E0E A;  4JI2 Q;  1XPU A;  1EFW A;  2E2I H;  1GO3 E;  4YHH Q;  2OWO A;  4DNI A;  2ZTE A;  2I5L X;  2NZO A;  5M3F H;  4APV A;  4IPC A;  2JJQ A;  1HZC A;  1UE6 A;  4A3M G;  1PH2 A;  3TQY A;  1JMC A;  1VQK A;  4JI8 Q;  3EBE A;  2NVT H;  4DV6 L;  1XNR L;  3F2C A;  4IOA A;  4JI0 Q;  2D0O A;  3ERS X;  3GO5 A;  3AQQ A;  1OXV A;  3RZD H;  4IFD J;  5IYD H;  3SGI A;  5IYC G;  2ZJR A;  1WCM G;  2NN6 G;  4JI1 Q;  1E22 A;  3W1G A;  4A3F H;  4LFB L;  4OWW B;  4WJ3 M;  4LNQ A;  2UUA L;  4LUV A;  1S3O A;  1X55 A;  1A8V A;  1QVC A;  3L0O A;  5C0X I;  4JV5 Q;  1PH4 A;  3KOJ A; 
#chains in the Genus database with same CATH topology
 1L0X B;  2NB0 A;  4KKS A;  2XRS D;  1N36 Q;  5C4X G;  2Y0S G;  1I94 L;  3R8B A;  3W2D A;  4ODG A;  4JI3 L;  1SMY D;  4LFA Q;  3J7Z C;  3PQI A;  1X3F A;  3M4Y A;  5CV9 A;  3J7A V;  4JI7 L;  1X6O A;  4A76 A;  2YU9 H;  3HOX B;  2AQ3 B;  2VQF L;  2M9V A;  5FLX E;  2ZT9 C;  2EXZ A;  3M7N A;  4IUN A;  4CKB A;  4DR6 L;  5BR8 Q;  4R4T A;  4HN7 A;  3KDF A;  2JA8 B;  4GLX A;  4DUZ Q;  4XQJ A;  2EXD A;  1TWC B;  5M3F G;  3ZYY X;  1FJG L;  1F2L A;  1AE2 A;  2R7Z G;  1H9S A;  4GS3 A;  4OX9 Q;  2CQO A;  3HOZ B;  1KAW A;  5K5P A;  1J6Q A;  4KY5 A;  5IGF A;  2KCT A;  3P20 A;  3T1H L;  1CI3 M;  2CCZ A;  1JB3 A;  1ZKO A;  5JJL A;  4HJ8 A;  2K6A A;  2I46 A;  4AIM A;  2X6G A;  1RIP A;  4JI5 Q;  1GHJ A;  4RMF A;  1GUT A;  4YHH L;  2K32 A;  4OO1 H;  2WB1 B;  3T53 B;  1EFI D;  4DN4 M;  4RKL A;  2ZTD A;  1CA5 A;  3RUZ A;  4UY8 C;  3S2D H;  3K5N A;  5IOD A;  1CZG A;  2K05 A;  4JI8 L;  4A3L G;  2Z9H A;  4KMU C;  1W2B A;  1CA6 A;  4KN7 C;  5DEH A;  1QE6 A;  1L0W A;  1X3G A;  2A19 A;  2SNS A;  2X6L A;  2PNR C;  4BY1 B;  1CSP A;  2DY8 A;  4X3T A;  3K80 C;  4F87 A;  3M3Y H;  1SNO A;  2LXK A;  3RMH A;  3I4O A;  2PQA A;  1V1O A;  1BBX C;  1CK1 A;  4XQN A;  3PIO 3;  3HKZ G;  2MFI A;  4K6L A;  3OWF A;  4LFA L;  3ICE A;  4A3G B;  3GTL B;  2A6E D;  3QO2 A;  5GAH C;  1TWG H;  1WYD A;  2EY5 A;  1TS3 A;  5HGT A;  2RF4 A;  1QOH A;  2WP8 J;  4JVZ A;  4QGU A;  5BR8 L;  5M5Y H;  3I91 A;  4BBR H;  5LMU Q;  1NMF A;  1STN A;  4IAL A;  4DUZ L;  3L3O C;  2XWJ B;  2JA8 G;  1ICF B;  1KXL A;  3M4O B;  4FXD A;  3K0X A;  3J80 E;  4NXM Q;  1H9K A;  2R61 A;  3OOC A;  4TQU S;  4LF7 Q;  4N9T A;  4OX9 L;  2K01 A;  2QDL A;  1NSN S;  1VMC A;  3HOZ G;  3FP9 A;  3R2T A;  3S1N H;  4DK3 C;  2R7F A;  4HIK A;  2SNM A;  1F9R A;  3R3O A;  5KNB A;  5DM6 3;  3CXC A;  1GHK A;  2QCP X;  2KBN A;  1I50 H;  3DLL A;  2K1B A;  1IYJ B;  2I07 B;  4GNX C;  3IKJ A;  5EGT A;  3MFY A;  4JI5 L;  1QB5 D;  1Q8I A;  4I7Z C;  3M4P A;  1ENC A;  1FL0 A;  1C48 A;  2YV5 A;  4UPA A;  3S9W A;  4E6I A;  4DAM A;  2WB1 G;  3MC0 B;  4K5V A;  4B3R L;  2RDF A;  1HNX Q;  5CC4 A;  3GTG B;  3PO2 H;  3DHQ A;  1NMG A;  2KED A;  1N33 Q;  1JJG A;  2F52 A;  4IUP A;  1C8C A;  4DV4 L;  3MXG A;  4FXG C;  2PQA B;  3I8Z A;  1DOK A;  4A75 A;  5LHY 1;  3H0G B;  4YCU A;  5J3B A;  4KHV A;  3RZO H;  2F0D A;  2XN9 C;  3NHH A;  3BDC A;  1NE3 A;  3NSW A;  3S2H H;  2WV6 D;  4RA8 A;  1M8A A;  5K36 H;  1C9O A;  4A3G G;  1K83 H;  1XTC D;  3I55 A;  4MTK A;  1PFN A;  4FDB A;  5C4H A;  1E1T A;  3UDG A;  4MNO A;  2BA0 A;  2CQA A;  1F9P A;  3KK7 A;  5G3L D;  5FJ8 G;  1YJ9 A;  1G91 A;  2YYZ A;  5LMU L;  3NBH A;  1VF7 A;  3QOJ A;  3C1E A;  1Q82 C;  4NXM L;  2CH4 W;  3A8J E;  3K7A B;  2ICE C;  3VYR A;  1ESR A;  4L5S A;  4GKK Q;  1LLR D;  1NAP A;  4RWS C;  4KV6 A;  3T1Y Q;  5T1G A;  2HQL A;  3A0J A;  4FF2 A;  3GTO B;  4JI1 L;  3GTJ H;  3S16 B;  1Y1V H;  2JEB I;  3OIP A;  2F1M A;  3D4D A;  3FMC A;  3NEM A;  4KKT A;  3RN2 A;  4IJH A;  3PGZ A;  3OSO A;  2A74 C;  1SNC A;  2OTL A;  3NTH A;  5ELO A;  2ES2 A;  2E75 C;  4CDD C;  1PFB A;  1KNE A;  5K36 G;  1TWF B;  2NTS A;  1ZXT A;  3F1Z A;  3S15 H;  1PYS B;  5FKA C;  3BZK A;  4IPH A;  2WAQ E;  1Q12 A;  4MTN A;  2PQE A;  3CC2 A;  2JA7 B;  1PH7 A;  2Q8I B;  3I4L A;  1FD7 D;  5IGG A;  3J7A 5;  4O42 A;  2BDN A;  1K3B C;  1T9H A;  2D0P A;  2I5M X;  1KRT A;  1OTC A;  5AFW A;  5CGK A;  4RG1 A;  2XGT A;  1N32 Q;  1SLJ A;  2P5Z X;  3RZD B;  3PIP A;  1SYB A;  1VQ7 A;  4A3F B;  3CCV A;  3MXP A;  2HD3 A;  2PYK A;  4HAE A;  2HT1 A;  4BA2 I;  1EYD A;  1UEA B;  5ELC A;  3KJP A;  1D1I A;  3E0J A;  3L9A X;  4J6H A;  1AW7 A;  3LGJ A;  1I5F A;  1B44 D;  1Y8O B;  2DY7 A;  3FPU B;  3HOY B;  3RLN A;  2B2U A;  3NK9 A;  5DLQ E;  2KEC A;  1JOO A;  4DR7 Q;  4IFD H;  1IBM L;  2PPB C;  1E0B A;  4DR4 L;  4GKK L;  1IYU A;  2K5V A;  1C4Q A;  3Q23 A;  4B3T Q;  4GKJ Q;  1TU2 B;  3EQL C;  4HIO A;  3T1Y L;  3HOU B;  4QCL A;  2KEN A;  1HR0 W;  2XIW A;  5EQ0 A;  1VCI A;  5LMN Q;  3Q8D A;  2J0T D;  4KKU A;  4C2M H;  3S1M H;  4XYQ A;  2K28 A;  2R3Z A;  5D65 A;  1HTP A;  2EY6 A;  1HZ9 A;  1V1P A;  3TS0 A;  3UE0 A;  1ONL A;  3HEJ A;  5ELE A;  4FO2 A;  5C4J H;  1X9N A;  4RH6 A;  3KLW A;  3F2B A;  1EOV A;  1U5K A;  1DM0 B;  4N8F A;  2JA7 G;  5KEE A;  4OEM B;  2VL6 A;  3CHB D;  3OHX C;  4LAA A;  2F0O A;  1YVC A;  3AYH B;  1HNZ Q;  3J7Y W;  2VQE L;  4C3H H;  4DV7 Q;  2NYZ D;  3CCM A;  4IFD G;  3UDI A;  1WVL A;  1N32 L;  1MIU A;  1HUM A;  1WTV A;  1TKW B;  5JEA H;  1ILP A;  3FKI B;  1RD9 D;  4LK1 C;  4WJ4 A;  4A3F G;  2JE6 I;  5EKK A;  3NTI A;  5IGB A;  3HKS A;  1WJJ A;  4HTH A;  4LFB Q;  2R93 H;  4A3B H;  4R8N A;  1DGS A;  3CP0 A;  4AYB E;  1LTS D;  4DR7 L;  1RKN A;  4RAU C;  3GTQ B;  1UWV A;  3S17 B;  4A3I B;  4B3T L;  1L2F A;  4DK0 A;  3KBG A;  4POG A;  2BE5 C;  2B2W A;  4GKJ L;  5C4Z A;  5JJZ A;  4FF4 A;  5L37 A;  1GVP A;  2JA6 H;  3PUW A;  3AMU A;  1R4P B;  1ZYR C;  2F0M A;  4J15 A;  4BY7 H;  4C3I H;  1Z7T A;  1WD0 A;  1A3V A;  4GN4 B;  5COR A;  1TWH B;  4X6A H;  2BOS A;  3GTM H;  3CU7 A;  3G7L A;  2EY1 A;  4LUZ A;  4A3D H;  3SDZ A;  4AH6 A;  1TWA B;  1KRS A;  2CFM A;  2PI2 A;  1IW7 D;  5HY6 A;  4LF6 L;  1SN8 A;  3KF6 A;  1EEF D;  2VW9 A;  1O7L A;  1H9M A;  3ND8 A;  2R93 G;  3GTP B;  4A3B G;  3H3V C;  3HOV B;  2FJ2 A;  5EPJ A;  5DNF A;  2LXJ A;  5COY A;  5M5W B;  1VQC A;  2E76 C;  3VR3 A;  2C35 B;  2RHQ B;  1UAP A;  4HMJ A;  4DV7 L;  4A3J B;  3CCJ A;  1HNZ L;  2V4D A;  3DEO A;  4Y7N H;  1XPU A;  1PMR A;  5EBC A;  2ZTE A;  5I6Y A;  1A3U A;  3JAM E;  1Y1W B;  4APV A;  4RGO S;  1HZC A;  2RCF A;  4A3M G;  1VQK A;  2NVT H;  4GZY C;  4DV6 L;  3F2C A;  4JI0 Q;  2D0O A;  3ERS X;  1RDP D;  1QNU A;  2ZJR A;  4LFB L;  1MBY A;  1S3O A;  1BUV T;  4DAV A;  4P2C B;  1IBK Q;  3I3C A;  1B50 A;  1BBU A;  3PCO B;  2O5I C;  2UXD L;  2NZ1 D;  3BDL A;  2F4I A;  2E2J H;  4C1N K;  2UUC Q;  2CW0 C;  3H3V H;  1EU3 A;  1X3P A;  2F0I A;  1I3Q B;  3ER0 A;  4BWG B;  1EWI A;  2K75 A;  4BXX H;  1H95 A;  5IGD A;  3OW2 A;  5D3I B;  2OQ0 A;  2WB1 E;  2NVQ H;  1BR9 A;  3TME A;  3EN2 A;  3MXN A;  4DA2 A;  4Q0F A;  3CCL A;  2LSS A;  2KHS A;  4CHT B;  2VUM B;  1I4X A;  2IL8 A;  1K9M C;  1EYG A;  4QMG A;  3AU7 A;  1IKL A;  1EY9 A;  1L1O A;  3TSS A;  2HCC A;  2BDO A;  1LAB A;  4DPG A;  4K0K L;  3QJY A;  4K2K A;  1G8Z D;  1ASZ A;  2E5L L;  4K6D A;  1SEB D;  4JPB W;  3A74 A;  2N78 A;  3QR8 A;  5C5L A;  2L1B A;  3MZ5 A;  1PTO B;  1IYV A;  4A93 H;  1XPO A;  1FVI A;  2Z6B A;  2B2T A;  5D14 A;  4FYD A;  4P71 A;  4QB4 A;  3V2T A;  4JOI C;  4DV3 L;  3I4M H;  4ALP A;  1XMQ Q;  1SMY C;  4LF8 Q;  4BXX G;  5ELN A;  5IY0 A;  1CKN A;  4JI0 L;  1VQN A;  3MTS A;  1ESF A;  2LS0 1;  1ZEQ X;  5CV8 A;  4OIK A;  3S1R H;  2NN6 H;  1IBK L;  1I4G A;  5AJ3 L;  4OO1 I;  1VF5 C;  3X3M A;  1SYG A;  2A6H D;  3C3L A;  2FMC A;  1CKM A;  3OYY A;  1PV4 A;  4A3K B;  4XDX A;  3BZD B;  2F4V L;  5LMN W;  2EY2 A;  1QJO A;  4X64 Q;  3D6C A;  3TRE A;  2EVB A;  3J81 E;  1VQJ A;  1GD7 A;  2C5C A;  4B08 A;  4V19 0;  3B6Y A;  3NWT A;  3IFD A;  3GV3 A;  1JJ2 A;  4LMQ D;  1B3Q A;  3WOF A;  1E3P A;  2JA9 A;  5G3L F;  5JVG 3;  3RR5 A;  5IP7 G;  4A93 G;  2ICI A;  1W3S A;  4PMW A;  3HZX A;  3VDY A;  1U4L A;  1F2M A;  2B3G A;  3KLS A;  3VYT A;  3I4M G;  4DNT B;  4DR5 Q;  3SVM A;  3VA7 A;  1SYC A;  1FNW A;  3ZJY C;  1DD2 A;  3W3A A;  4UP9 A;  4OL7 A;  2IX3 A;  2F0V A;  1PTO D;  1TS4 A;  2KEE A;  1JB7 A;  4LFC Q;  3GP7 A;  1TQO A;  1E24 A;  3K5L A;  4X66 Q;  1Q7Y C;  2F3V A;  3D4W A;  5IT9 L;  1PRT C;  2A8V A;  3VYS A;  4A4I A;  1AN8 A;  3SK8 A;  2QA4 A;  2BH8 A;  4L5Q A;  4LF8 L;  1KDA A;  1WFQ A;  1JCK B;  3S1Q H;  4A3L H;  4B3S Q;  2B63 B;  1PLF A;  4C3J B;  4GOP B;  1VQ6 A;  1YI2 A;  2G5D A;  2KHI A;  1N34 L;  1EQV A;  1B9N A;  2L15 A;  3KF8 B;  1Q46 A;  2QEX A;  1V43 A;  5JAV A;  5A2Q E;  3TZU A;  4A3K G;  4RCO A;  2MJ8 A;  1N9W A;  1X3Q A;  4JI6 Q;  5IE8 A;  1Q3L A;  1T5E A;  2KQ3 A;  2QW7 A;  3EJI A;  3Q6S A;  4AYB G;  3K59 A;  5ISR A;  1MJE A;  1J8I A;  1NBW A;  1HTL D;  2K7V A;  1GXD C;  2L55 A;  2NVY B;  3IFT A;  3HOX H;  1A15 A;  4HSV A;  1SRO A;  5J22 A;  1SNP A;  4IUU A;  1E2W A;  4XIG S;  4YWK A;  5M5X B;  3FRP B;  3K81 C;  5CV6 A;  2OQK A;  1HR0 Q;  4OXP A;  4WJW A;  4ZCK A;  1I6H B;  1S5C D;  1HFG A;  4XYO A;  4DR5 L;  2JA8 H;  4PV1 C;  1AEX A;  1RL2 A;  3K6O A;  1TWC H;  4O2D A;  1EIY B;  3NUC A;  3K5O A;  1DOL A;  3DWA A;  1I4Q A;  3KYH C;  4ID6 A;  3HOZ H;  1XYI A;  3F8T A;  4R4O A;  3D6W A;  4LFC L;  1CTM A;  3HOW B;  1NY4 A;  3CF5 A;  4G7Z C;  4X66 L;  4DK1 A;  4I7A A;  3RNU A;  1N36 L;  5DM7 3;  1YJN A;  1B9M A;  4CBV A;  1CQF A;  2X69 A;  2Z1C A;  5DAU A;  4OHJ A;  3HFZ B;  3TZD A;  1BDO A;  5EBD A;  3NTK A;  1OXT A;  4GNX A;  5CR3 A;  1TVX A;  4BBR B;  1STA A;  3KDF B;  3HOX G;  4B3S L;  2IX1 A;  3MHB A;  4R9W A;  1LAC A;  4JW0 A;  3T4A C;  2E2I B;  3M9B A;  1DON A;  1PZI D;  4C3J G;  5C3X A;  4BY1 H;  1AP0 A;  4LWC A;  1L0Y B;  4XT1 B;  3DM1 A;  1H9S B;  4JBM A;  2IJ0 A;  3D0F A;  1A2T A;  2BA1 A;  2EYM A;  1LTR D;  1SDF A;  4QJF A;  2N49 A;  2ZTC A;  1TXY A;  4HED A;  3P7J A;  3JAM i;  1Z6H A;  5KNC A;  4BA1 I;  4DR2 Q;  1QUQ A;  4LJZ C;  2KOL A;  2ZXO A;  2KHJ A;  4A3G H;  3GTL H;  2ZXP A;  4A3E B;  1SNM A;  4BBS B;  2QF7 A;  1B4O A;  5M3M B;  5C0X H;  1HQR D;  1STG A;  2F0Q A;  4DXF A;  5FJ8 H;  1Z9F A;  1K28 A;  5C44 B;  1HR0 L;  1OO9 B;  2K5W A;  2HHH Q;  2MHV A;  3K0Y A;  3TP5 A;  1LT6 D;  2EYL A;  4HJA A;  3M4O H;  5EKL A;  3JAM L;  1JWS D;  3GV6 A;  2OTJ A;  3K57 A;  5IYB H;  1CKO A;  1EY6 A;  1SSO A;  2EDG A;  4WOR A;  4BS9 A;  3LNN A;  4MN3 A;  2LMC B;  3PV0 A;  1WD1 A;  2LY7 A;  4L5R C;  1EIG A;  3CQZ B;  4BY1 G;  4TVA B;  2MPM A;  2OT2 A;  3NBI A;  4HR7 B;  2AMC B;  5KIX A;  2R92 B;  4OWT B;  4DFA A;  1HH2 P;  4IOC A;  4Q5V A;  1XXG A;  1VQM A;  4L5T A;  2AKW B;  5IP9 H;  3AFP A;  3ERO A;  2A69 D;  1VQL A;  1LYL A;  1PFM A;  3GTG H;  4ABN A;  4RFB A;  5JJK A;  1SFO B;  2L9H A;  1WTP A;  5C0X G;  1U0L A;  2MO1 A;  3U58 A;  4X65 Q;  3T56 B;  3HRZ C;  2N88 A;  2MO0 A;  3H0G H;  1B3A A;  1STB A;  2CWP A;  4B9X A;  1KLU D;  4LF7 L;  5IYB G;  1FGU A;  3HGB A;  4OON A;  5IYD G;  1G6P A;  3T51 B;  3ITP A;  2AHO B;  1XNR Q;  1NJI C;  2I5H A;  1WCM B;  3OW7 A;  3BVZ A;  4YWM A;  1EQR A;  5JEA J;  1HNW Q;  4A3E G;  2K04 A;  3I56 A;  3HG9 A;  1WTQ A;  3QB3 A;  4ZUI A;  5M3M G;  2DJG C;  3NQI A;  2EOT A;  2JA5 B;  3F2U A;  1STE A;  5I6W A;  3KLR A;  3TRZ A;  2IHF A;  3CCR A;  2NZH A;  3CCE A;  1SXT A;  1PYW D;  5IP9 G;  1HNX L;  3K7A H;  2HUG A;  2ALY B;  4NKL A;  2HIX A;  3AB9 A;  1N33 L;  2KUM A;  1I6V C;  2E2H B;  2E74 C;  3J81 i;  1HPC A;  5EAY A;  5FO7 B;  3MA2 B;  3GTO H;  1Q90 A;  1D2B A;  1BO0 A;  1VQI A;  1EOT A;  2F0K A;  3CC7 A;  3FHW A;  3H0G G;  4K5X A;  4CJ0 B;  2WAC A;  4IPG A;  4QIW B;  3PUY A;  2NUC A;  3MAQ A;  2O4X A;  3NE5 B;  2B2Y C;  1XX8 A;  2RHS B;  3NEN A;  4I65 A;  1EEI D;  4M8A A;  4PZ7 A;  1LTG D;  1ROD A;  2NTT A;  1TWF H;  4OEL B;  3SHL A;  3K58 A;  3UDF A;  2Q2I A;  2VB2 X;  3NBH B;  1MD2 D;  3J81 L;  1XMO Q;  3CRK C;  4LF5 Q;  4J8Q A;  3CD6 A;  1M90 C;  1V9P A;  2FXQ A;  1RCV D;  1LTA D;  3RN5 A;  2JA7 H;  1X56 A;  1TS2 A;  4NMZ A;  4KI0 A;  1DCZ A;  3E0E A;  4JI2 Q;  1EFW A;  2H4O A;  2NZO A;  1R9T B;  1UE6 A;  1HA6 A;  2QIL A;  1XNR L;  3AQQ A;  3RZD H;  4IQZ A;  4F8M A;  3QG1 A;  1WCM G;  3W1G A;  4A3F H;  4WRD A;  3MFG A;  4JV5 Q;  4LUV A;  2NVX B;  1A8V A;  3R2I A;  2HDL A;  1PH4 A;  3KOJ A;  1LM0 A;  1TII D;  4ME3 A;  2JA5 G;  2F0E A;  3E6Z X;  3HOY H;  3SK4 A;  2B2V C;  2J7Z A;  4X62 Q;  4EGV A;  3J81 j;  1F2Y A;  1YHB A;  2EJF C;  1IW7 C;  3G48 A;  4JYA Q;  1IL8 A;  4HCE A;  2KCN A;  1VS0 A;  2F0N A;  4FNF A;  1F9Q A;  1B70 B;  3M4Q A;  4KLK A;  1LTB D;  1YBY A;  5FLX L;  3HOU H;  1A3T A;  4P75 A;  1SNQ A;  2UUB Q;  4DV0 Q;  3CW2 C;  1XNQ Q;  1RJT A;  2EQS A;  1KHI A;  2Q8R E;  4B9W A;  4KTA A;  3H3V I;  2K52 A;  1XWE A;  3PO3 B;  4DGZ A;  1BCP B;  1VQO A;  4G7O C;  4IN3 A;  1MHW C;  3ONA B;  4LUO A;  3VR4 A;  3I72 A;  3NP8 A;  2RBM A;  1LO5 D;  3PSI A;  4U68 A;  2OXP A;  1X32 A;  3BVG A;  4IUR A;  1GKH A;  1XMO L;  2IY5 B;  4LF5 L;  2RDG A;  5GAG C;  1PTO F;  1BKB A;  5BN4 A;  2VY3 A;  5EKI A;  4KK7 A;  3HOY G;  2IW3 A;  4ZK9 B;  1JE4 A;  1HHV A;  3A7A B;  5C3E B;  4ZKC B;  3CPW A;  1TS5 A;  3CME A;  1E2V A;  1LTT D;  4NP5 A;  2VB3 X;  4DR1 Q;  2L12 A;  4A3M H;  1X65 A;  1EZ6 A;  3FKI H;  5I9P A;  2ZJQ A;  3HOU G;  2DN8 A;  3GTK B;  3TN2 A;  5LMN L;  2O2L D;  3OTO Q;  3V96 A;  3DWP A;  2PZU A;  4YY3 Q;  3CCS A;  4F7X A;  1YNJ C;  1Y69 U;  2PNH A;  3DUZ A;  1V1P B;  1PZK D;  4AQY Q;  1MGS A;  1SYF A;  2A5H A;  4J1M A;  4X62 L;  3CC4 A;  4CKE A;  1ET9 A;  2K5N A;  3CMA A;  1OXS C;  3J80 i;  1IL2 A;  1K0S A;  1CUK A;  3A56 A;  1TT2 A;  2K4K A;  5T1I A;  4DAP A;  3GTQ H;  4DV5 Q;  4JYA L;  1U4M A;  2GVA A;  1G2S A;  3S17 H;  1LTI D;  1JWM D;  1SE3 A;  2NN6 I;  2B8F A;  3JC6 6;  1CHP D;  2DJF C;  1TY2 A;  3DWQ A;  1EIF A;  1BCP D;  2GVB A;  3EVQ A;  2QDB A;  1CM9 A;  1SE2 A;  5E3F A;  1VQ8 A;  2EJG C;  3MWY W;  2JK8 A;  5EPK A;  1TWH H;  3J80 L;  3FDT A;  2F0L A;  3DM3 A;  1DOM A;  4QUC A;  1UE5 A;  4DF7 A;  1EYA A;  4MHE A;  1SE4 A;  5F2D A;  1QIL A;  3FKI G;  3TBI B;  1TWA H;  2Z4I A;  1J5E Q;  2DGY A;  1P8L A;  2Z6K C;  3L2P A;  1B7Y B;  3F2D A;  1KD1 C;  4EQP A;  2PMZ B;  2JQO A;  1BOS A;  1EY0 A;  3GTP H;  4CGY B;  5BN5 A;  3HOV H;  1VQF A;  2CH4 A;  3R93 A;  3MVV A;  2CVR A;  5M5W H;  2A6H C;  3CKI B;  3U9O A;  1HJP A;  3BJU A;  5IWA Q;  2UU9 Q;  5C3E G;  2WII B;  4HID A;  1IKM A;  4DR1 L;  3OIQ A;  1SND A;  4A3I G;  4MZ9 A;  1Y1W H;  1PH5 A;  1QZG A;  5C3W A;  2N3S A;  2YTY A;  4JC0 A;  3P75 A;  2K5Q A;  4A3C G;  3OTO L;  4YY3 L;  4JOI A;  3C46 A;  1YZ6 A;  4LF4 Q;  1ML0 D;  4JBW A;  1HUN A;  1VQA A;  2MNA A;  4AQY L;  1KAA A;  3KF6 B;  4MIU A;  2BE5 D;  4UP7 A;  1PA6 A;  1N8R C;  2RKS A;  2Q2H A;  4DAY A;  2B29 A;  3GQB A;  1I3Q H;  2XVS A;  4EQO A;  1S40 A;  3E9I A;  2HCI A;  1Y8N B;  4TRD A;  1ENA A;  1S5D D;  3HOV G;  1DYQ A;  1NR2 A;  1SE8 A;  2JN4 A;  1UEB A;  1ENF A;  4RHS A;  4A3J G;  5GRO A;  2AUJ D;  4GN5 A;  5IP7 H;  1O7Z A;  3PUV A;  1LT4 D;  1HQM C;  3STB D;  1D5Z C;  1W6J A;  2MP1 A;  1Y1W G;  2VS1 A;  3NWS A;  4GLA C;  1JT8 A;  1KIX A;  3K8A A;  2CWA A;  1J5E L;  4PMC A;  5KRU A;  3FVQ A;  3S14 B;  2UUA Q;  1BQQ T;  1PZJ D;  5C4X B;  2Y0S B;  1VQP A;  3I4N B;  3L7Z C;  3N52 A;  2KCM A;  3ND9 A;  4JI3 Q;  2UXB Q;  1D6E C;  2F0H A;  5IWA L;  1BBW A;  2UUC L;  2D62 A;  2N55 A;  1CQV A;  1PTO H;  4LF9 Q;  1EY7 A;  3VR5 A;  4FF3 A;  3H15 A;  5JVH 3;  4JG2 A;  3VA5 A;  1D1K A;  4CKC A;  3H91 A;  5D3D A;  3K5M A;  4KN4 C;  1Q1B A;  2KJX A;  3MXN B;  3SXH A;  1QVG A;  3KFU A;  3ERQ A;  2WKD A;  3NQT A;  2D5D A;  5IGC A;  1D5X C;  5M3F B;  2JP1 A;  4DKA C;  2R7Z B;  5CYU A;  1HXY D;  2ZJP A;  4JK1 C;  1CZW A;  1L1O B;  1V8Q A;  4HIM A;  1VQE A;  2VUM G;  1KDB A;  5LL6 X;  2PW7 A;  2F3W A;  1A2U A;  5ELB A;  1KTK A;  2V1C C;  4A3K H;  2K5H A;  2VNU D;  2AQ1 B;  1D7Q A;  1F9S A;  2F0T A;  4PNY A;  3J7A F;  2F0P A;  5KGU A;  2XSC A;  1X3E A;  2K50 A;  1E7Z A;  2A68 D;  4KY7 A;  3SK6 A;  4CDF C;  4JI4 Q;  1EU4 A;  4HJ9 A;  3UDX A;  1HCZ A;  1MSH A;  1GUS A;  4UP8 A;  5C0X J;  4JBJ A;  2B8G A;  2YU9 B;  1CKN B;  1KL9 A;  5CV5 A;  5KYL A;  4NDX A;  1XMQ L;  4UHV A;  4DV2 Q;  3CPF A;  2MGS A;  4GOP C;  3QIA A;  2A6E C;  4F88 A;  4POF A;  4XT3 B;  4L6T B;  4H0L C;  1M1K C;  3CRL C;  2FFK B;  1K8M A;  3BS1 A;  3LX0 A;  2AWN A;  2KVM A;  3DMU A;  4P74 A;  4IUQ A;  1BVS A;  4XQQ A;  5M9O A;  1GUW A;  3I4N G;  1JOR A;  3HKZ B;  1B1Z A;  3A8K E;  2UXB L;  3TP8 A;  1D5M C;  4K14 A;  3A7L A;  4R4I A;  4LF9 L;  1XPR A;  1II3 A;  4PZ8 A;  5JPN C;  3TDQ A;  1PRT B;  4X64 L;  3RD4 A;  3H09 A;  1S72 A;  4UDU C;  1E2Z A;  4RCN A;  1PVO A;  1LTL A;  1STY A;  1B8A A;  3AFQ A;  1Q1E A;  3S2D B;  4P73 A;  5FK9 C;  4EVO A;  2B63 H;  3T13 A;  4C3J H;  1IHZ A;  4ME5 A;  4G7H C;  4GLV B;  2N8N A;  1HRJ A;  5IT9 c;  2CHB D;  3W5O A;  4YCV A;  4G57 A;  5HUR A;  1EL0 A;  2EYP A;  2OF1 A;  4UAI A;  4Z9C B;  3ULJ A;  1SAP A;  1NCV A;  2A73 B;  3M3Y B;  4QIW E;  3BZC A;  1G29 1;  2ENB A;  1WTO A;  2NVY H;  4ZUJ A;  4ZKB B;  3Q22 A;  4JI4 L;  4RGT A;  4X3U A;  3NXW A;  2ASB A;  2EJM A;  3WWV A;  1FYC A;  5M5X H;  3W1B A;  3C2P A;  1TWG B;  4B3R Q;  1JJC B;  1B53 A;  4DV2 L;  1I6H H;  2NBF A;  2I0Q A;  5M5Y B;  2D9U A;  1QG7 A;  4XTC S;  1CSQ A;  2A69 C;  5IOC A;  1YNN D;  4DV4 Q;  1FGB D;  4DK6 C;  4JCV E;  5GAD C;  1JC7 A;  3OWE B;  1EY4 A;  1D8L A;  3IRB A;  3G71 A;  2LFN A;  2B63 G;  2AQ2 B;  4ULL A;  4HMI A;  1PRT D;  3BU2 A;  3HOW H;  3QOL A;  1YHQ A;  1YEZ A;  2R7D A;  2Q2U A;  3S1N B;  3Q0A A;  1Y14 B;  2H1E A;  3GDE A;  4GN3 B;  4ZRZ A;  4JI6 L;  4FF1 A;  1PYB A;  4C56 C;  1I50 B;  2Q8T A;  1VQ4 A;  3BYT B;  5IGE A;  5E7N A;  1AZP A;  4CDE C;  1EY5 A;  3V05 A;  4DNR B;  2G9H D;  3O13 A;  3I90 A;  4C1N I;  4OO1 G;  2RCN A;  2WIN B;  1F77 A;  3FEW X;  2E2I H;  1GO3 E;  2OWO A;  4DNI A;  3PO2 B;  1HFN A;  2XNA C;  2I5L X;  4IPC A;  1J9O A;  3HP3 A;  1KNA A;  3TQY A;  4IOA A;  3OMG A;  3GO5 A;  1OXV A;  4IFD J;  5IYD H;  4JI1 Q;  2PO4 A;  2B39 A;  4OWW B;  4LNQ A;  3RZO B;  2JSO A;  1QNK A;  1X55 A;  1QVC A;  2E2D C;  5FLM H;  1BXT A;  4KY6 A;  4A3E H;  3S2H B;  3HOW G;  1SJH D;  4BBS H;  1SR3 A;  4NW2 A;  5M3M H;  1E1O A;  4IFD I;  1EQQ A;  2C9O A;  2E8G A;  4DXG A;  5CMD A;  4GNX B;  1K83 B;  5C44 H;  4QQB X;  1IXR A;  3UI2 A;  4EQ5 A;  1VQB A;  1KDC A;  2VZA A;  1SBB B;  1ASY A;  1U4R A;  4EX5 A;  1MSG A;  3BG3 A;  2KA7 A;  2AUK A;  4LW1 A;  4BBR G;  1RHP A;  3PIP 3;  2RDH A;  2XRQ D;  1HZA A;  1TY0 A;  4ZAI A;  1DJR D;  1BCP F;  2NWG A;  3A5Z B;  4FVM A;  2K14 A;  4KJN A;  3VR2 A;  3PIO A;  5JJI A;  1QZH A;  3CQZ H;  2HIV A;  4Y52 H;  2WKC A;  1LT5 D;  3G4S A;  4O0A A;  1U4P A;  3M7G A;  2R92 H;  1EWH A;  1EY8 A;  1QUQ B;  4H13 C;  1Q8K A;  1ILQ A;  3JAM c;  3GTJ B;  4P72 A;  1F2Z A;  1Y1V B;  3H94 A;  4DR2 L;  2L11 A;  1CHQ D;  4QL5 A;  3PF4 A;  1M4V A;  1PXU A;  4L8J A;  5FLM G;  2B2Y A;  1NTG A;  1YHA A;  4BBS G;  1SFO H;  5ELD A;  1PH8 A;  1VQG A;  2RSO A;  3X3N A;  3MXU A;  5I2Y A;  3G6E A;  1PH9 A;  3S15 B;  2HHH L;  2K5D A;  5C44 G;  3KBX A;  2IWH A;  2F0U A;  1IBM Q;  4DR4 Q;  3PO2 G;  4PMB A;  3LWE A;  1G6Z A;  1A6X A;  1JOK A;  3NEL A;  4K2L A;  3PUX A;  1WI5 A;  1GUO A;  1LV9 A;  3KLS X;  1JIC A;  3WOE A;  1WCM H;  5E4W C;  1UE1 A;  3CCQ A;  2IT1 A;  2RVL A;  4HCS A;  3S16 H;  4OGQ C;  3G6J B;  1MKH A;  3OPO A;  3NPP A;  2FHT A;  2R92 G;  1EUJ A;  2JA5 H;  3E5S A;  1Q81 C;  1RF2 D;  2F3I A;  2Q2T A;  5LL6 S;  2JYO A;  3URY A;  1WTR A;  1IBL Q;  2EYF A;  2PMZ E;  2XWB B;  4YIJ A;  4ZQ3 A;  2AWO A;  2EYO A;  3A55 A;  1GOZ A;  2B2V A;  2IHE A;  2L0C A;  4G4K A;  3N6R A;  4HSP A;  2E2H H;  4S3S A;  4X65 L;  5IIF A;  2EE1 A;  1BF4 A;  1BNZ A;  1U9R A;  2VQE Q;  1AH9 A;  1LUZ A;  5HGQ A;  1EZ8 A;  3BDO A;  2IPK D;  3SE0 A;  2PCF B;  2RA4 A;  4IUT A;  4NPS A;  4PG3 A;  4M1U B;  4R1J A;  3WDN A;  4X3K A;  1Y1V G;  4C2M B;  1VQD A;  1JE5 A;  4DUY Q;  3S1M B;  1HNW L;  1UNS A;  2PI2 E;  3I7F A;  3SK5 A;  1VQ9 A;  1G2T A;  5IT9 E;  2ZXR A;  4O1N A;  3IL8 A;  2EZV A;  2PZW A;  4CJ2 C;  5BN3 A;  5C4J B;  1EQT A;  5J1Z A;  5GQO A;  1KLG D;  2K33 A;  5FO9 B;  1A0I A;  2PZT A;  1GUN A;  1YIT A;  4DV1 Q;  1R9T H;  2F0S A;  5E1F A;  4HJ7 A;  3CAM A;  2OCE A;  5J39 A;  3U4V A;  2GN5 A;  3ULL A;  4C3H B;  3J81 c;  3U4Z A;  4H7B A;  3U50 C;  1BCP C;  1JOQ A;  1H9R A;  1NUC A;  1K73 C;  2F0W A;  3BVM A;  4DU9 A;  5CBE E;  2NVX H;  2F0J A;  2RQX A;  3PUZ A;  2ID0 A;  1XJV A;  1X54 A;  4H02 A;  1R4Q B;  2CKZ B;  1IBL L;  4N9P A;  2XTI A;  4N8X 1;  4YCW A;  4IJL A;  3SEB A;  5JOB A;  2OEO A;  4LF6 Q;  1HZB A;  1OXU A;  2B2U C;  3RLO A;  5A2Q L;  2R93 B;  2Y0S E;  4A3B B;  2Z4H A;  1MJC A;  4K8I A;  4RGN A;  1C7Y A;  2K03 A;  1C0A A;  1SMX A;  3P1H A;  3I2Z A;  1DXM A;  1O80 A;  1SYD A;  1SJE D;  1B2T A;  3S24 A;  4JI2 L;  3A54 A;  3E9H A;  2FIN B;  4NB3 A;  2DNC A;  1PH6 A;  5CBA E;  4A3M B;  4KD3 A;  2JA6 B;  1YIJ A;  4L63 B;  2JEA I;  3PO3 H;  4DV6 Q;  3I73 A;  1V1Q A;  2QGQ A;  1AZQ A;  4BY7 B;  2G9D A;  1EIH A;  2LKV A;  4C3I B;  4DUY L;  3MEF A;  1GUG A;  3KJO A;  3GD7 A;  4JV5 L;  1VQH A;  3E3X A;  5JPM C;  5FLX c;  4IZ8 A;  3GTM B;  3A8I E;  4HJ5 A;  4A3D B;  4H44 C;  2UXD Q;  1JQY D;  2L4N A;  1Q86 C;  4KHZ A;  3QWN A;  2EYJ A;  2Z6K A;  1T5X D;  4IO9 A;  1O78 A;  2KCC A;  1GJX A;  1MI2 A;  1FR3 A;  3M85 A;  3EA6 A;  4DV1 L;  5C3E H;  2M00 A;  1NNX A;  4JBK A;  1EWC A;  5TSS A;  4A3I H;  3TP6 A;  3I70 A;  1ET6 A;  4Y7N B;  4OWX B;  4C3H G;  4KD4 A;  4A3C H;  4ZYS A;  2UUB L;  4DV0 L;  1YJW A;  3GTK H;  1XNQ L;  3SR1 A;  1LT3 D;  2NVT B;  3T16 A;  1PFS A;  5JEA G;  2R6G A;  3STB C;  1TR5 A;  2M2L A;  3PO3 G;  4KHP Q;  3U9S A;  2SEB D;  2D2C C;  5FOB B;  1PH3 A;  4NXN Q;  5I4D A;  3TP7 A;  4EQN A;  2QEJ C;  3EFX D;  4K0K Q;  1GM5 A;  2E5L Q;  2FMM A;  2EPB A;  3HKZ E;  3FPP A;  2B2W C;  2WAQ B;  2E2J B;  5CV7 A;  5EPL A;  3KUP A;  2MUY A;  1SRU A;  1K8A C;  4K8J A;  1CFM A;  4A3J H;  1DZ1 A;  4DV3 Q;  4DR3 Q;  1ICW A;  2SOB A;  2JA6 G;  1IZ6 A;  1AFP A;  2DUD A;  1FNU A;  2NVQ B;  2RSN A;  2UXC Q;  4BY7 G;  4B3M Q;  4C3I G;  1EYC A;  4FXK C;  1FNV A;  3D31 A;  1S5F D;  2EIF A;  3ULP A;  5AJ3 Q;  1WTX A;  3DEP A;  4RGM A;  3K7U C;  1YNX A;  3TEH B;  4A3D G;  2HDM A;  1K0R A;  2SDF A;  3TS2 A;  1PRT F;  1CT1 D;  3BYY B;  3C1F A;  5FO8 B;  2F4V Q;  1UUP A;  4ILW A;  2ZM6 Q;  3J80 c;  3VYU A;  4DV5 L;  1PHJ A;  4QUF A;  1PDQ A;  4TKO B;  4WFN 3;  4IUV A;  2JXM B;  5C5M A;  1K8O A;  1ZYR D;  1H9J A;  2EYH A;  4PZ6 A;  1PTO C;  1W6K A;  1Y8P B;  1K3R A;  1YNJ D;  1HA5 A;  5CV4 A;  4A93 B;  4CJ1 B;  2A68 C;  5I9O A;  4OIJ A;  1A62 A;  3CCU A;  3I4M B;  1O7Y A;  3OMC A;  3EIV A;  5KYI A;  1OXX K;  1QCB D;  2F03 A;  4ZLT F;  3HS0 C;  4KHP L;  2GA4 B;  3A5U A;  4YWL A;  3PF5 A;  2VUM H;  4NXN L;  1S4Z A;  2WFW A;  2O5J C;  1A63 A;  4K5W A;  1WOC A;  3PMF A;  1Z47 A;  5I2X A;  3S1R B;  1K8G A;  1KC8 C;  4QF4 A;  3D8G A;  1PH1 A;  5GAE C;  2H5X A;  4R4Q A;  3RLF A;  1WTW A;  2MQH A;  1SYE A;  1P16 A;  2WAQ G;  3LWU A;  4IPD A;  4RKB A;  1I94 Q;  1VDZ A;  2TSS A;  2J4X A;  2F0G A;  2PW5 A;  4DR3 L;  2UU9 L;  4TSS A;  1VQ5 A;  1JR0 D;  4R4C A;  4JI7 Q;  1RTO A;  1UE7 A;  3Q24 A;  2BH2 A;  2UXC L;  1AE3 A;  3D4R A;  2VQF Q;  4B3M L;  2YTX A;  4CDC C;  2BCO A;  2VXW A;  5IYC H;  1G51 A;  1S5E D;  4DR6 Q;  2A1A A;  2Z0S A;  2YTV A;  1L1O C;  2HQE A;  2L5T A;  4LF4 L;  5H1S E;  3D3R A;  3S14 H;  2ATW A;  4XXE A;  4GOP A;  1I4H A;  5C4X H;  4R8I A;  1N34 Q;  1KQS A;  1XTD A;  2CW0 D;  4DAY B;  1FJG Q;  3I4N H;  1QVF A;  2ZM6 L;  3UE1 A;  3KF8 A;  4AYB B;  2Z8L A;  1JWU D;  2B2T C;  3T1H Q;  2IX0 A;  4KJO A;  5NUC A;  1I4P A;  4QY7 A;  1O7I A;  1STH A;  3VR6 A;  2DNE A;  4FP5 D;  5ELF A;  3AEV A;  1QWY A;  4RHR A;  4YHH Q;  5C6A A;  5A35 A;  5E4X A;  3MEH A;  3S1Q B;  5M3F H;  1RTN A;  3DXJ C;  5EJW A;  5KND A;  2JJQ A;  1PH2 A;  2R7Z H;  1KAB A;  1JMC A;  4JI8 Q;  3EBE A;  4V0B A;  4U67 3;  1VMP A;  1WTH A;  3H6M A;  1S5B D;  3SGI A;  5IYC G;  3IAY A;  2NN6 G;  1E22 A;  1I4R A;  2F0F A;  4WJ3 M;  1YNN C;  2UUA L;  5C0X I;  2QKI C;  3L0O A;  4X3S A;  4PQX A;  1NR4 A;  2TMP A; 
#chains in the Genus database with same CATH homology
 1LM0 A;  5FLM H;  4A3E H;  4ME3 A;  1BBU A;  1N36 Q;  3HOW G;  2Y0S G;  3PCO B;  1I94 L;  1SR3 A;  4BBS H;  2UXD L;  5C4X G;  2JA5 G;  5M3M H;  1E1O A;  4IFD I;  1EQQ A;  4JI3 L;  2E2J H;  2E8G A;  3HOY H;  4GNX B;  2UUC Q;  4QQB X;  5C44 H;  4X62 Q;  3H3V H;  1IXR A;  4EQ5 A;  1VQB A;  3J81 j;  4LFA Q;  3J7Z C;  1X3F A;  1YHB A;  3ER0 A;  2VZA A;  4JI7 L;  1X6O A;  3G48 A;  4A76 A;  1EWI A;  1ASY A;  2YU9 H;  4JYA Q;  2K75 A;  4BXX H;  1VS0 A;  1H95 A;  4EX5 A;  2VQF L;  3OW2 A;  3M7N A;  4LW1 A;  4BBR G;  1B70 B;  3M4Q A;  4DR6 L;  5BR8 Q;  2OQ0 A;  4KLK A;  4R4T A;  1YBY A;  2WB1 E;  1HZA A;  3KDF A;  2NVQ H;  3HOU H;  3EN2 A;  4P75 A;  2UUB Q;  3A5Z B;  3PIO A;  4DV0 Q;  2K14 A;  3CW2 C;  3CCL A;  4GLX A;  1XNQ Q;  5JJI A;  4DUZ Q;  2LSS A;  2EXD A;  2EQS A;  1QZH A;  1KHI A;  3CQZ H;  2HIV A;  4Y52 H;  5M3F G;  3H3V I;  2K52 A;  3G4S A;  1FJG L;  4O0A A;  1VQO A;  1AE2 A;  2R7Z G;  2R92 H;  1K9M C;  1EYG A;  1QUQ B;  4GS3 A;  4OX9 Q;  2CQO A;  1KAW A;  1Q8K A;  4LUO A;  1L1O A;  3JAM c;  1J6Q A;  4P72 A;  3PSI A;  4DR2 L;  2KCT A;  4DPG A;  3T1H L;  4K0K L;  1GKH A;  1XMO L;  2CCZ A;  4QL5 A;  2IY5 B;  4LF5 L;  3PF4 A;  1ASZ A;  2E5L L;  5FLM G;  5GAG C;  1NTG A;  1YHA A;  4HJ8 A;  5JJL A;  3A74 A;  2N78 A;  4AIM A;  1BKB A;  4BBS G;  2VY3 A;  1SFO H;  1RIP A;  1PH8 A;  1VQG A;  4JI5 Q;  4RMF A;  4YHH L;  3G6E A;  1PH9 A;  3HOY G;  4A93 H;  2HHH L;  1XPO A;  1FVI A;  5C44 G;  2ZTD A;  4UY8 C;  1IBM Q;  3S2D H;  4P71 A;  3PO2 G;  4DR4 Q;  4JOI C;  3CPW A;  4DV3 L;  3I4M H;  4ALP A;  3CME A;  1XMQ Q;  4A3L G;  4JI8 L;  4LF8 Q;  4BXX G;  5ELN A;  5IY0 A;  1W2B A;  1CKN A;  4JI0 L;  3NEL A;  4DR1 Q;  1VQN A;  3PUX A;  4A3M H;  1X65 A;  1WI5 A;  1L0W A;  3FKI H;  1X3G A;  2A19 A;  2ZJQ A;  3HOU G;  5LMN L;  3OTO Q;  3S1R H;  1IBK L;  1WCM H;  3CCQ A;  1CSP A;  1UE1 A;  4YY3 Q;  3CCS A;  2IT1 A;  5AJ3 L;  3K80 C;  3M3Y H;  4OO1 I;  2LXK A;  2PNH A;  3S16 H;  3I4O A;  2PQA A;  1MKH A;  4AQY Q;  2R92 G;  1CKM A;  1EUJ A;  3OYY A;  1PV4 A;  2JA5 H;  4X62 L;  3HKZ G;  3CC4 A;  2F4V L;  5LMN W;  2MFI A;  1Q81 C;  2K5N A;  2F3I A;  3CMA A;  2Q2T A;  1OXS C;  3J80 i;  4LFA L;  1IL2 A;  1IBL Q;  3ICE A;  1CUK A;  2K4K A;  4JYA L;  3GTQ H;  2PMZ E;  4X64 Q;  3TRE A;  5GAH C;  4DV5 Q;  1TWG H;  2GVA A;  1WYD A;  2AWO A;  3S17 H;  1VQJ A;  1GD7 A;  2RF4 A;  4QGU A;  2WP8 J;  3B6Y A;  5BR8 L;  2NN6 I;  3JC6 6;  5M5Y H;  1JJ2 A;  1EIF A;  1E3P A;  4BBR H;  2IHE A;  2GVB A;  2E2H H;  2JA9 A;  5LMU Q;  1NMF A;  4X65 L;  3RR5 A;  5IP7 G;  4DUZ L;  2JA8 G;  2VQE Q;  4A93 G;  4PMW A;  1W3S A;  1KXL A;  3VDY A;  1VQ8 A;  3K0X A;  1AH9 A;  1LUZ A;  2B3G A;  4NXM Q;  5HGQ A;  3I4M G;  4DR5 Q;  2JK8 A;  4TQU S;  4LF7 Q;  1TWH H;  4OX9 L;  4NPS A;  3ZJY C;  3DM3 A;  4PG3 A;  1UE5 A;  3HOZ G;  4R1J A;  3FP9 A;  4UP9 A;  3S1N H;  4DK3 C;  2R7F A;  4HIK A;  3FKI G;  1TWA H;  1Y1V G;  1J5E Q;  1VQD A;  3CXC A;  1JE5 A;  4DUY Q;  2DGY A;  1P8L A;  2Z6K C;  3L2P A;  1B7Y B;  3F2D A;  1KD1 C;  1HNW L;  2KBN A;  1I50 H;  3DLL A;  2JQO A;  2PI2 E;  3I7F A;  1JB7 A;  1IYJ B;  1VQ9 A;  4LFC Q;  4GNX C;  3GTP H;  4JI5 L;  1E24 A;  3HOV H;  1VQF A;  4X66 Q;  3M4P A;  1FL0 A;  1Q7Y C;  5M5W H;  2YV5 A;  4UPA A;  2A8V A;  1HJP A;  2WB1 G;  3BJU A;  4A4I A;  4DAM A;  2QA4 A;  2BH8 A;  2R7Z H;  4B3R L;  5IWA Q;  2UU9 Q;  4L5Q A;  5GQO A;  1HNX Q;  5C3E G;  4LF8 L;  1A0I A;  1WFQ A;  4HID A;  3PO2 H;  4DR1 L;  4A3I G;  1NMG A;  1YIT A;  4MZ9 A;  3S1Q H;  4DV1 Q;  1Y1W H;  1QZG A;  1PH5 A;  1R9T H;  4A3L H;  1N33 Q;  1JJG A;  2F52 A;  2N3S A;  2YTY A;  4JC0 A;  4HJ7 A;  3CAM A;  2OCE A;  4A3C G;  4DV4 L;  4B3S Q;  3OTO L;  3U4V A;  2GN5 A;  3ULL A;  3J81 c;  3U4Z A;  2PQA B;  4YY3 L;  4JOI A;  4A75 A;  4GOP B;  3U50 C;  1VQ6 A;  4YCU A;  5J3B A;  1YI2 A;  1YZ6 A;  1K73 C;  4LF4 Q;  4JBW A;  3RZO H;  1VQA A;  2NVX H;  2MNA A;  4AQY L;  2KHI A;  3PUZ A;  1NE3 A;  1N34 L;  2ID0 A;  2L15 A;  1XJV A;  1X54 A;  3KF8 B;  1Q46 A;  2QEX A;  3S2H H;  4H02 A;  3KF6 B;  1V43 A;  4UP7 A;  1PA6 A;  4A3K G;  1N8R C;  2CKZ B;  1IBL L;  2XTI A;  1N9W A;  4YCW A;  4IJL A;  4JI6 Q;  4LF6 Q;  5IE8 A;  1C9O A;  2Q2H A;  1HZB A;  1OXU A;  4A3G G;  3RLO A;  1K83 H;  2B29 A;  2Y0S E;  4AYB G;  3I55 A;  1MJE A;  1NBW A;  4FDB A;  1E1T A;  1I3Q H;  3UDG A;  4MNO A;  2BA0 A;  1S40 A;  3HOX H;  3E9I A;  1MJC A;  1SRO A;  5FJ8 G;  1C7Y A;  1YJ9 A;  2YYZ A;  3HOV G;  1C0A A;  1SMX A;  5LMU L;  3I2Z A;  1SE8 A;  4XIG S;  4YWK A;  1UEB A;  1Q82 C;  3K81 C;  2OQK A;  3S24 A;  4JI2 L;  3E9H A;  5GRO A;  4OXP A;  4A3J G;  4NB3 A;  4GN5 A;  5IP7 H;  1HR0 Q;  4NXM L;  3PUV A;  2JA8 H;  4DR5 L;  3STB D;  1PH6 A;  1RL2 A;  1TWC H;  4O2D A;  1YIJ A;  4L5S A;  4GKK Q;  1Y1W G;  2VS1 A;  2JEA I;  4GLA C;  1EIY B;  3PO3 H;  4DV6 Q;  1JT8 A;  1V1Q A;  2QGQ A;  1KIX A;  3K8A A;  2CWA A;  3KYH C;  3T1Y Q;  1J5E L;  2HQL A;  3A0J A;  3HOZ H;  4DUY L;  3MEF A;  4JI1 L;  3F8T A;  3KJO A;  3GTJ H;  1Y1V H;  2UUA Q;  3GD7 A;  4R4O A;  2JEB I;  1VQH A;  4JV5 L;  4LFC L;  3NEM A;  3RN2 A;  5FLX c;  1NY4 A;  4IJH A;  3PGZ A;  3CF5 A;  4HJ5 A;  4X66 L;  1N36 L;  3RNU A;  1VQP A;  2OTL A;  2UXD Q;  3L7Z C;  5ELO A;  1YJN A;  2ES2 A;  2KCM A;  1Q86 C;  4JI3 Q;  2UXB Q;  1IBK Q;  4KHZ A;  3HFZ B;  5IWA L;  2UUC L;  1BBW A;  2Z6K A;  4IO9 A;  5K36 G;  2D62 A;  3F1Z A;  3S15 H;  4LF9 Q;  1PYS B;  4GNX A;  1OXT A;  3M85 A;  3H15 A;  4DV1 L;  3BZK A;  4JG2 A;  5C3E H;  4JBK A;  4IPH A;  2WAQ E;  1Q12 A;  3KDF B;  3HOX G;  4A3I H;  4MTN A;  3CC2 A;  1Q1B A;  4B3S L;  2IX1 A;  3MXN B;  1PH7 A;  1QVG A;  3KFU A;  4OWX B;  3J7A 5;  4A3C H;  3M9B A;  2UUB L;  4DV0 L;  1YJW A;  4BY1 H;  1T9H A;  2D0P A;  1XNQ L;  2I5M X;  4LWC A;  1KRT A;  3GTK H;  1OTC A;  4DKA C;  4JBM A;  4RG1 A;  2XGT A;  1N32 Q;  1PFS A;  3D0F A;  2ZJP A;  2BA1 A;  5JEA G;  1L1O B;  2R6G A;  1SLJ A;  1VQE A;  3STB C;  4HIM A;  2VUM G;  4QJF A;  3PO3 G;  2N49 A;  2ZTC A;  4KHP Q;  1TXY A;  3PIP A;  3JAM i;  1VQ7 A;  3CCV A;  2V1C C;  4A3K H;  2K5H A;  1PH3 A;  4NXN Q;  2HT1 A;  4BA2 I;  4BA1 I;  4DR2 Q;  1QUQ A;  2VNU D;  1D7Q A;  3KJP A;  4A3G H;  2KHJ A;  3GTL H;  4K0K Q;  1GM5 A;  2E5L Q;  3HKZ E;  1X3E A;  3LGJ A;  1I5F A;  2K50 A;  1E7Z A;  4JI4 Q;  5FJ8 H;  3RLN A;  1Z9F A;  4HJ9 A;  3UDX A;  1HR0 L;  5DLQ E;  2HHH Q;  4UP8 A;  4DR7 Q;  5C0X J;  4JBJ A;  1SRU A;  1K8A C;  1IBM L;  1CKN B;  4HJA A;  4A3J H;  4DR4 L;  4GKK L;  2K5V A;  3M4O H;  1KL9 A;  4DV3 Q;  4DR3 Q;  1XMQ L;  4DV2 Q;  3CPF A;  1IZ6 A;  4B3T Q;  5IYB H;  2JA6 G;  2OTJ A;  1CKO A;  2DUD A;  4GOP C;  4GKJ Q;  4HIO A;  3T1Y L;  4POF A;  2KEN A;  1HR0 W;  2UXC Q;  4BY7 G;  4B3M Q;  1VCI A;  3PV0 A;  3Q8D A;  5LMN Q;  4L5R C;  1M1K C;  3D31 A;  4BY1 G;  4TVA B;  4C2M H;  2AWN A;  2EIF A;  3ULP A;  5AJ3 Q;  4P74 A;  3S1M H;  2AMC B;  1BVS A;  4OWT B;  3K7U C;  1YNX A;  3TEH B;  3I4N G;  4A3D G;  1K0R A;  3TS2 A;  2UXB L;  1HH2 P;  4IOC A;  1HZ9 A;  2F4V Q;  4R4I A;  3TS0 A;  4LF9 L;  3UE0 A;  1VQM A;  1XPR A;  2ZM6 Q;  4L5T A;  4PZ8 A;  3J80 c;  2AKW B;  5IP9 H;  4X64 L;  3AFP A;  4DV5 L;  5C4J H;  1PHJ A;  1X9N A;  1VQL A;  1LYL A;  3GTG H;  3KLW A;  1S72 A;  5JJK A;  3F2B A;  1EOV A;  1U5K A;  5C0X G;  1PVO A;  1LTL A;  1U0L A;  2JA7 G;  4PZ6 A;  1K3R A;  1B8A A;  2VL6 A;  2MO1 A;  3AFQ A;  3U58 A;  4X65 Q;  1Q1E A;  3AYH B;  1YVC A;  1HNZ Q;  4P73 A;  2VQE L;  4C3H H;  4DV7 Q;  2B63 H;  1A62 A;  3CCM A;  3CCU A;  4C3J H;  3UDI A;  4IFD G;  4GLV B;  2MO0 A;  1N32 L;  3H0G H;  2N8N A;  3EIV A;  1MIU A;  1OXX K;  5IT9 c;  2CWP A;  3W5O A;  4A3D H;  4YCV A;  4LF7 L;  5IYB G;  4KHP L;  1FGU A;  3A5U A;  4OON A;  4YWL A;  5IYD G;  3PF5 A;  4NXN L;  2WFW A;  2VUM H;  1G6P A;  4WJ4 A;  4A3F G;  2JE6 I;  1A63 A;  2AHO B;  3ULJ A;  1XNR Q;  1WOC A;  2I5H A;  1Z47 A;  1NJI C;  1K8G A;  1KC8 C;  3HKS A;  1WJJ A;  4YWM A;  1EQR A;  1PH1 A;  5JEA J;  4LFB Q;  1HNW Q;  2R93 H;  5GAE C;  4QIW E;  4A3E G;  4A3B H;  3BZC A;  1DGS A;  1G29 1;  2H5X A;  4R4Q A;  3RLF A;  3I56 A;  3CP0 A;  5M3M G;  2NVY H;  4JI4 L;  2MQH A;  1P16 A;  2WAQ G;  4IPD A;  1I94 Q;  2ASB A;  4AYB E;  4DR7 L;  3WWV A;  3TRZ A;  2IHF A;  1UWV A;  5M5X H;  3W1B A;  3CCR A;  2NZH A;  3CCE A;  1JJC B;  4DR3 L;  2UU9 L;  4B3R Q;  5IP9 G;  4DV2 L;  1HNX L;  1VQ5 A;  1L2F A;  4B3T L;  4POG A;  1I6H H;  3K7A H;  4R4C A;  2ALY B;  4GKJ L;  2I0Q A;  4JI7 Q;  1UE7 A;  2HIX A;  1N33 L;  1GVP A;  4XTC S;  2BH2 A;  2JA6 H;  1AE3 A;  1CSQ A;  2VQF Q;  4B3M L;  2YTX A;  2UXC L;  3PUW A;  4DV4 Q;  4DK6 C;  5IYC H;  4JCV E;  5GAD C;  1G51 A;  3J81 i;  4DR6 Q;  5EAY A;  2A1A A;  2Z0S A;  4J15 A;  4BY7 H;  2YTV A;  4C3I H;  3GTO H;  1D8L A;  1L1O C;  3IRB A;  3G71 A;  2B63 G;  1VQI A;  4LF4 L;  5H1S E;  3S14 H;  4GN4 B;  3CC7 A;  3FHW A;  3H0G G;  2ATW A;  4GOP A;  3BU2 A;  4X6A H;  4IPG A;  5C4X H;  3HOW H;  3PUY A;  1N34 Q;  3GTM H;  1YHQ A;  1KQS A;  1YEZ A;  2R7D A;  1XTD A;  2Q2U A;  4LUZ A;  4DAY B;  1FJG Q;  3I4N H;  3NEN A;  1Y14 B;  2RHS B;  3GDE A;  4AH6 A;  4GN3 B;  1QVF A;  2ZM6 L;  1KRS A;  3UE1 A;  2CFM A;  2PI2 A;  5HY6 A;  4LF6 L;  4PZ7 A;  1SN8 A;  4JI6 L;  3KF6 A;  1PYB A;  2VW9 A;  1TWF H;  3UDF A;  2Q2I A;  1VQ4 A;  2R93 G;  4A3B G;  3T1H Q;  3NBH B;  5E7N A;  1XMO Q;  2IX0 A;  4LF5 Q;  2LXJ A;  3CD6 A;  1M90 C;  4QY7 A;  1O7I A;  1V9P A;  1VQC A;  2FXQ A;  2C35 B;  2RHQ B;  3RN5 A;  1HNZ L;  2JA7 H;  2RCN A;  1X56 A;  3CCJ A;  4DV7 L;  3AEV A;  4OO1 G;  4KI0 A;  4Y7N H;  3E0E A;  4JI2 Q;  1XPU A;  1EFW A;  2E2I H;  1GO3 E;  4YHH Q;  2OWO A;  4DNI A;  2ZTE A;  2I5L X;  2NZO A;  5M3F H;  4APV A;  4IPC A;  2JJQ A;  1HZC A;  1UE6 A;  4A3M G;  1PH2 A;  3TQY A;  1JMC A;  1VQK A;  4JI8 Q;  3EBE A;  2NVT H;  4DV6 L;  1XNR L;  3F2C A;  4IOA A;  4JI0 Q;  2D0O A;  3ERS X;  3GO5 A;  3AQQ A;  1OXV A;  3RZD H;  4IFD J;  5IYD H;  3SGI A;  5IYC G;  2ZJR A;  1WCM G;  2NN6 G;  4JI1 Q;  1E22 A;  3W1G A;  4A3F H;  4LFB L;  4OWW B;  4WJ3 M;  4LNQ A;  2UUA L;  4LUV A;  1S3O A;  1X55 A;  1A8V A;  1QVC A;  3L0O A;  5C0X I;  4JV5 Q;  1PH4 A;  3KOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...