1I6HH

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i6hH00
3KDFB 1WJJA 4JI1L 4JI6L 5C4XG 3PUZA 3TEHB 4GOPC 2NN6I 1C0AA 2PQAB 4GS3A 1QZHA 1GVPA 2R93H 1V43A 2N3SA 1E24A 3J80i 3KFUA 4IPHA 3CCMA 1HZBA 1UE5A 4DR2L 1SE8A 2N8NA 1GD7A 4A3KH 5IP7G 1SMXA 4A3FG 2K14A 3TREA 3KF8B 4C3JH 1EQQA 4DV7L 1Q46A 5JJKA 2UXDQ 1VQDA 2B63H 4AIMA 5IYCG 3J7ZC 4KLKA 3H15A 1OXSC 2UUBQ 1B7YB 3PUXA 4MZ9A 3A74A 4BY1G 4YY3Q 3PF4A 3LGJA 3AFPA 2KENA 4JI1Q 4JI6Q 3STBC 3J7A5 3FKIG 4OWTB 2NVTH 1G291 2R92G 4BXXG 2F3IA 4PG3A 4NB3A 3CC2A 4DR4L 3MEFA 4DV6L 4DV1L 2JA6H 5C4XH 4DR2Q 1VQLA 2UUAL 4GNXB 1PH2A 1VQFA 1BBWA 1X55A 2CKZB 4OXPA 5GAHC 4JCVE 4DV7Q 2E2HH 1UE6A 5M3FG 4R4IA 2YTYA 2NVYH 1EFWA 2UUCL 5IP7H 3K7AH 4JBMA 4A3FH 1C7YA 5IYDH 1PV4A 1WOCA 4R1JA 1LTLA 4LF5Q 2KHIA 3HOUG 2I5LX 2IX1A 5IYCH 3I7FA 2BA1A 3UDGA 4TVAB 1JMCA 3HOWG 1E1OA 1EOVA 1XMOL 2QGQA 3D0FA 1HR0W 3RR5A 3T1HL 1N32L 4EX5A 4DR4Q 3A5ZB 1CKMA 4R4OA 4DV6Q 3H0GG 4DV1Q 2VZAA 2HIXA 1TWCH 4R4CA 1UE1A 4OO1G 1PH9A 2UUAQ 1WI5A 1VQHA 5IE8A 2R92H 4BXXH 2K5VA 3D31A 5C3EG 2RF4A 3ERSX 4AH6A 4APVA 4DR3L 2ALYB 2KHJA 5ELOA 4YWMA 2UUCQ 1E22A 3CMEA 3F8TA 1CKOA 2DUDA 5C44H 1J5EQ 5M3FH 4QJFA 2NVXH 3HOZG 1YIJA 1VQ7A 2VL6A 2MNAA 3AQQA 4DAYB 2K5NA 1KC8C 1VQNA 1XMOQ 2BH2A 4BY7G 1IBLL 3OW2A 3HOUH 2WP8J 3PV0A 1N32Q 1PVOA 3OTOL 4JI2L 4HJ7A 1ASZA 1N33L 1L1OA 3W1BA 4HJ9A 1PH3A 3S1MH 4MNOA 1KRSA 4L5TA 1EUJA 3E0EA 4GLAC 4GN5A 3CP0A 4IOCA 3H0GH 2HT1A 2KBNA 4LF8Q 2OTJA 1O7IA 1QUQA 3S24A 1WCMG 4DK3C 3I4OA 3RLFA 4X65L 2F52A 3W5OA 4DPGA 5GADC 4HIMA 4IFDI 4LW1A 3UE0A 4JI4L 1HJPA 3GD7A 1M1KC 2YYZA 4DV2L 2JEBI 1IBLQ 2R6GA 5C0XI 2B29A 5IP9G 3OTOQ 3M7NA 4GNXC 3HOZH 2D0PA 3EBEA 2EXDA 4GN4B 4QIWE 4NXNL 1HZCA 1IBKL 1N33Q 3IRBA 2F4VL 3GTGH 4B3RL 4JV5L 2ZTEA 3GTMH 4WJ4A 1D7QA 3T1YL 4BY7H 3PIPA 5IT9c 1R9TH 4GOPA 5C4JH 4XIGS 1G6PA 2L15A 4A3JG 1PH1A 1PHJA 3GTOH 1B70B 4DKAC 3GDEA 4R4TA 3PO3H 3GO5A 4AYBE 4X65Q 4B3SL 3KOJA 3CCLA 1GO3E 1P16A 1VQIA 5HY6A 1YJNA 3M4OH 3Q8DA 1OXUA 2OQKA 2OCEA 2R7FA 1VQ5A 3H3VI 4JI4Q 4A3BH 1A62A 3CC7A 1BBUA 4HIOA 4UPAA 3I4NH 3KF6A 4DV2Q 1YHBA 2JA7H 4ME3A 1V9PA 4O0AA 4OWWB 4X62L 4GKKQ 4NXNQ 1IBKQ 2Q2IA 4JV5Q 2LXJA 2YTXA 1X9NA 2MO0A 1PFSA 2F4VQ 1CKNA 1OXVA 3NEMA 1E7ZA 3T1YQ 1Z9FA 3G48A 1X54A 1PA6A 1Q12A 4IPDA 4PZ6A 4P74A 1GM5A 2JK8A 3CCQA 1XJVA 4YCVA 1K9MC 1N36L 3CW2C 3J81i 4OONA 4B3SQ 2VUMG 3BU2A 1PH7A 2VY3A 1XNQL 4MTNA 1HNZL 3RZOH 2WAQG 2NZOA 2XGTA 1XPRA 4C3IH 3E9IA 4P75A 5LMNW 1VQ8A 4HJ5A 4PZ7A 1YHQA 4JI7L 3EN2A 1KL9A 2RHSB 3UDFA 1JJCB 1VQEA 5M5XH 4X64L 3CQZH 1HNXL 1VCIA 1N9WA 4A3GG 5FLMG 2MO1A 5K36G 2E2IH 2MQHA 4JYAL 1V1QA 2AKWB 2OWOA 4OX9L 3CF5A 3HKZE 1N36Q 3RN2A 3HKSA 1XNQQ 4JG2A 4AYBG 2K52A 1HNZQ 1CSQA 1EWIA 3I2ZA 1A8VA 3S14H 3PUYA 4LNQA 3RLOA 1Q81C 2R7ZG 4J15A 1T9HA 1JE5A 1TWFH 1CSPA 2VUMH 4C3HH 3JAMc 4A76A 4JI7Q 1FJGL 2Z6KC 3S1NH 3B6YA 1VS0A 5M3MG 4X64Q 1JJ2A 2DGYA 1HNXQ 1KRTA 4DR7L 2E8GA 3M85A 1OTCA 4JBKA 2PQAA 2YV5A 2GVBA 4JYAQ 4L5SA 4BY1H 3K80C 4OX9Q 1RIPA 3KJOA 3U58A 1QVCA 5FLMH 2Q2TA 4DR6L 3AEVA 3FKIH 1XNRL 3L2PA 5JEAG 2MFIA 4TQUS 5JEAJ 1XMQL 1ASYA 1U5KA 3S2HH 3CCRA 5E7NA 3I4MG 1X3EA 2HIVA 2A19A 1IZ6A 2LXKA 3KLWA 3ICEA 1D8LA 2AWNA 2HQLA 4JOIC 1A63A 1SROA 3HOXG 2CWPA 4IOAA 2QEXA 1HR0L 4POFA 2YU9H 1VQMA 1MIUA 2IY5B 2WB1E 1KXLA 4DR7Q 1OXXK 2VQFL 1DGSA 2NVQH 2ZTCA 1QVFA 1YBYA 1K8GA 2NZHA 4O2DA 3F1ZA 3T1HQ 4L5QA 5M3MH 1W2BA 1X65A 4YWKA 3UE1A 4DV5L 2JA5G 4DR6Q 2UXBL 2N49A 2ID0A 2WFWA 2OTLA 3DM3A 1X3GA 3HOWH 3L0OA 1HZAA 4A3MG 1FL0A 3GTPH 1JB7A 5C0XJ 2IX0A 4DR5L 4OWXB 1K0RA 5GAEC 1K3RA 4DR3Q 4A3LG 4A3DG 4K0KL 2ES2A 4DV0L 1Q86C 3S1QH 4BBSG 3J80c 5C3EH 3CCUA 3I4MH 1U0LA 4BBRG 4LFAL 1B8AA 1HR0Q 3M4PA 1PH6A 2JA8G 4IO9A 4DV3L 4A3CG 4NXML 3CD6A 3K81C 3M4QA 1QZGA 3A0JA 3KF6B 3HOXH 1UE7A 5JJIA 1JJGA 2XTIA 3K0XA 4P72A 4DV5Q 4QQBX 5IYBG 2Q2UA 2UXBQ 1HNWL 3K8AA 4P73A 4JI2Q 4DV4L 1NJIC 4B3TL 4DUYL 1NY4A 1Y1WG 3WWVA 1CKNB 3TS2A 2VNUD 2I5MX 2Q2HA 4RG1A 4DR5Q 1PH4A 2JA5H 1J6QA 1MKHA 2JA9A 2YTVA 4LF4L 1PYBA 4BA1I 4DAMA 4GKJL 3G71A 1TWGH 3W1GA 4K0KQ 4IJHA 5GAGC 2B3GA 4DV0Q 4LFBL 4A3IG 4FDBA 1AE3A 2NN6G 1HZ9A 2V1CC 3CCEA 3U50C 2OQ0A 4LFAQ 4X66L 3ULJA 4A3LH 5H1SE 4DV3Q 4NXMQ 1WCMH 2WB1G 1UWVA 4DK6C 1KQSA 1I50H 3S2DH 4X6AH 1Y14B 3ZJYC 4BBRH 1BVSA 3PSIA 4A93G 2CWAA 1K73C 1IL2A 2JA8H 1NE3A 1HNWQ 4GLXA 4B3TQ 4A3CH 2K4KA 3CCJA 4DUYQ 1VQ6A 2H5XA 4HJ8A 1TXYA 3K7UC 3F2DA 2CFMA 2Y0SE 3L7ZC 4PZ8A 1YZ6A 3AYHB 5IP9H 2RCNA 5M5YH 4HIDA 4B3ML 2JE6I 4LF4Q 4POGA 2ASBA 4GKJQ 1GKHA 4PMWA 3RLNA 2AMCB 4HJAA 2AHOB 4LFBQ 3BZCA 5GQOA 3BJUA 4X66Q 2ZJRA 3S1RH 4R4QA 1LYLA 1YJ9A 1XPUA 3CMAA 4A3JH 1EQRA 4A3IH 1Z47A 4LUZA 3A5UA 4L5RC 3GTJH 2K75A 3UDIA 3CPWA 1LUZA 1HH2P 3JC66 4AQYL 3M3YH 5JJLA 1VQGA 4QY7A 1FGUA 4X62Q 2Z6KA 4IPCA 2ZTDA 1Q1EA 3NENA 4A75A 4LUVA 1Y1VG 3I56A 2N78A 1PH8A 2PI2E 1WYDA 4B3MQ 2GN5A 5BR8L 4ALPA 4A93H 1L2FA 3CAMA 1E3PA 2C35B 2ZJQA 1SRUA 4JBWA 4C2MH 1VQOA 2PMZE 5LMNL 4QL5A 1QVGA 5IYDG 4KI0A 1MJCA 3TS0A 3CXCA 3GTKH 4H02A 5M5WH 3FHWA 2CQOA 1NBWA 4XTCS 2UU9L 2RHQB 3M9BA 5IWAL 5FLXc 2QA4A 2IHFA 1KD1C 4B3RQ 5IY0A 3F2CA 4AQYQ 4LF5L 3PGZA 2UXCL 3PIOA 4JOIA 1H95A 3F2BA 2CCZA 5GROA 3KDFA 1W3SA 4QGUA 2PNHA 1S3OA 1YVCA 4DR1L 1IYJB 1X6OA 1VQ4A 2D62A 2Y0SG 5BR8Q 1X56A 3AFQA 1IXRA 1YEZA 2IT1A 4A3GH 4HIKA 4UY8C 1UEBA 3TRZA 1Y1VH 3I55A 2HHHL 1L1OB 1CUKA 2EQSA 5LMNQ 3RZDH 1N34L 5C44G 3U4ZA 2KCTA 3UDXA 4JI0L 2UU9Q 4YWLA 4P71A 3NELA 1QUQB 2K50A 4LUOA 4UP8A 5IWAQ 2UXCQ 1FJGQ 4IPGA 1J5EL 1VQAA 3G6EA 4LF9L 1I3QH 3SGIA 2R7ZH 4DR1Q 3KJPA 1EYGA 1JT8A 3GTQH 3HOYG 4LWCA 4LFCL 4YHHL 5DLQE 2D0OA 4WJ3M 4LF6L 1I6HH 1E1TA 1PYSB 4IFDG 1YI2A 1NMGA 4UP9A 5LMUL 3PUWA 4IFDJ 4BA2I 1KIXA 2HHHQ 3PCOB 2FXQA 3HKZG 4GNXA 1WFQA 4KHZA 1XNRQ 3VDYA 1N34Q 2AWOA 5C0XG 1XMQQ 2ATWA 1VQJA 2R7DA 2ZM6L 1YHAA 3PF5A 4LF8L 4GOPB 4JI0Q 1Q8KA 3PUVA 1AE2A 4JC0A 4RMFA 1TWHH 2Z0SA 4YCWA 1PH5A 3GTLH 3KYHC 3HOVG 4LF9Q 3J81c 1I94L 3TQYA 2I5HA 2JQOA 1L0WA 3CPFA 5AJ3L 2K5HA 4GN3B 1LM0A 4OO1I 2VQFQ 2PI2A 4LFCQ 4YHHQ 3PO2G 1Q7YC 1K83H 1OXTA 4JI3L 4LF6Q 3ER0A 5LMUQ 4JI8L 2I0QA 3PO3G 2E5LL 1KHIA 1YJWA 4NPSA 4YCUA 3HOYH 4Y52H 5FJ8G 4GLVB 5ELNA 1X3FA 5EAYA 2ZM6Q 3S16H 1RL2A 3JAMi 2BA0A 5J3BA 4JI5L 2KCMA 1MJEA 2EIFA 4A3BG 4A3MH 4EQ5A 4DUZL 1TWAH 3I4NG 4A4IA 1S40A 4A3EG 1K8AC 2WAQE 2JA7G 4LF7L 3RNUA 3BZKA 4KHPL 1I94Q 1EIFA 3NBHB 1VQPA 1M90C 5AJ3Q 4A3DH 1SLJA 1AH9A 4JBJA 3ULLA 4BBSH 2BH8A 3MXNB 3CC4A 1IBML 3HOVH 1SR3A 1SN8A 4JI3Q 4GKKL 1L1OC 3OYYA 2R93G 4JI8Q 3DLLA 3S15H 1G51A 3U4VA 4DNIA 2VQEL 5HGQA 1FVIA 3STBD 4DV4Q 3J81j 1YITA 2E5LQ 2E2JH 1VQ9A 3FP9A 4A3KG 3PO2H 4IJLA 2A8VA 3EIVA 2VW9A 1I5FA 1Q82C 1VQCA 2LSSA 2IHEA 3CCSA 5IYBH 3H3VH 3CCVA 2GVAA 4JI5Q 2B63G 1BKBA 1S72A 3S17H 1Y1WH 1SFOH 2JA6G 5FJ8H 4DUZQ 1XPOA 2JJQA 1YNXA 1Q1BA 1VQKA 4LF7Q 4KHPQ 1NTGA 3ULPA 2UXDL 2VS1A 3G4SA 1VQBA 2ZJPA 4Y7NH 2JEAI 4UP7A 4A3EH 2UUBL 1A0IA 1P8LA 1EIYB 1IBMQ 1NMFA 1C9OA 1KAWA 1XTDA 3HFZB 2A1AA 3E9HA 4YY3L 1N8RC 3RN5A 2VQEQ
chains in the Genus database with same CATH superfamily
1JC7A 3Q24A 4JI6L 3A7AB 3PUZA 4FF1A 1QE6A 2ZXPA 1JWSD 1C0AA 4GS3A 2KHSA 2RDGA 1ZEQX 1V43A 1E24A 3J80i 4CDCC 3KFUA 2NZ1D 4IPHA 1HZBA 4A3FB 1GD7A 4CKEA 5IIFA 4C3JH 1EQQA 5JJKA 2MPMA 4DGZA 2RBMA 4KLKA 3H15A 2UUBQ 3GTQB 2K28A 4BY1G 1KDBA 2H4OA 3AFPA 2KENA 4JI1Q 2R92B 3K5NA 4OWTB 2NVTH 3NSWA 1GUGA 2F3IA 4DV1L 2A5HA 2UUAL 3MXPA 2PW5A 2CKZB 4KKTA 3BDLA 5M3FG 3J80E 1SNQA 1TVXA 2EDGA 3EROA 4R4IA 2NVYH 4KY5A 2UUCL 1SE2A 2A69D 2EYJA 4KN7C 4R1JA 1UNSA 2I5LX 4HMJA 4O42A 2PPBC 1BQQT 4KMUC 1JMCA 1A6XA 1UUPA 1E1OA 5G3LD 1LT4D 1BDOA 1AN8A 4DR4Q 1D5MC 4R4OA 4DV6Q 3HS0C 4KD3A 2PNRC 1EU3A 1TWCH 2HIXA 1ZXTA 4RHRA 2J0TD 3V96A 4OO1G 1GJXA 1VQHA 4G57A 4APVA 2ALYB 4I7ZC 3I8ZA 1E22A 1D6EC 1FNWA 1HHVA 5C3XA 4NKLA 1T5EA 5M3FH 1HFGA 2NVXH 3HOZG 1H9RA 2VL6A 1KC8C 1SYCA 1STBA 1TY2A 3NQIA 2E2JB 1XMOQ 4FXGC 1R9TB 4BY7G 1IBLL 3OW2A 4HMIA 4RKBA 1PH3A 4HJ9A 2L9HA 3M4OB 4GN5A 3CP0A 2HCCA 1O7IA 4MN3A 1STNA 4M8AA 3DHQA 2CHBD 1LTSD 3RLFA 2F52A 3W5OA 4DPGA 2A69C 4HIMA 4LAAA 1M1KC 1NR4A 1SNMA 2JEBI 5C0XI 2B29A 2R93B 3M7NA 4GNXC 3HOZH 1CT1D 2EXDA 1N33Q 1NSNS 4JV5L 4WJ4A 1D7QA 2ZTEA 4BY7H 1DM0B 5T1GA 1JB3A 3VYRA 3PIPA 4GOPA 5KNDA 4R4TA 1TKWB 4AYBE 4X65Q 3NK9A 5ELFA 1VQIA 5HY6A 3Q8DA 1OXUA 1A15A 2OQKA 4A3BH 4C56C 4DV2Q 1PXUA 3DEPA 1BCPF 4ME3A 2B8FA 3DMUA 4RHSA 2F4VQ 1PFSA 1OXVA 2PYKA 2EY2A 5I2XA 1Z9FA 3URYA 3G48A 1Q12A 1QJOA 1W6KA 1GM5A 2JK8A 3OHXC 3CCQA 1N36L 4MIUA 3BS1A 3J81i 4MHEA 1WD0A 2VUMG 2WAQG 2WKCA 4JI7L 2RHSB 4CHTB 1SSOA 1TY0A 1VQEA 2VXWA 2K1BA 3FKIB 1GOZA 2MO1A 2WKDA 1KAAA 4OX9L 2D2CC 1TS5A 3TMEA 3HKSA 1F9RA 4HCEA 5KYLA 4ABNA 1CSQA 3S14H 1A8VA 4LNQA 3RLOA 3GQBA 3TP5A 5KGUA 2NVQB 1T9HA 3J81E 1ML0D 1CSPA 1TWFH 2VUMH 3JAMc 1FJGL 1HQRD 4NW2A 1LT3D 3VYTA 1STHA 5LL6S 4X64Q 1HNXQ 2E8GA 2RVLA 3M85A 2KCCA 2F03A 2GVBA 1DOKA 4JYAQ 4FNFA 5EGTA 4DR6L 3GV6A 2EJFC 1QVCA 3ZYYX 4C1NK 3QJYA 1XMQL 4XT3B 1JR0D 3R2IA 4HEDA 4QUFA 3ICEA 4S3SA 4KTAA 2E74C 2F0QA 4RH6A 1B4OA 1H9MA 1HR0L 1F2YA 3D6WA 4DR7Q 3OMGA 4NMZA 1YBYA 3D4DA 4O2DA 1O80A 3T1HQ 5JVH3 2K5WA 2UXBL 2ID0A 1IW7D 1J9OA 3L0OA 3VR5A 1HZAA 4DNTB 4A3MG 3HOWH 4DFAA 4OWXB 2SDFA 4DR3Q 4A3DG 1WCMB 2ES2A 5CORA 1ONLA 1U0LA 1DOLA 4BBRG 3VR3A 4DV3L 4A3CG 4I65A 4NXML 3CD6A 4DK1A 3A0JA 1UE7A 5M5YB 2RKSA 5JJIA 1MBYA 2XTIA 3K0XA 2L4NA 1HNWL 3K8AA 4DV4L 4B3TL 1AP0A 3IAYA 1CKNB 4OELB 2Q2HA 1PH4A 4BA1I 3O13A 2KA7A 4G7OC 1F9QA 2B3GA 3MFGA 1PZJD 3SR1A 3GTJB 1C8CA 1HZ9A 4RCOA 1ILPA 4ULLA 1SYFA 2A6HD 4BBRH 5EPJA 1BVSA 3K0YA 3KLSA 2EYFA 4A3CH 3KUPA 3CCJA 4DUYQ 1VQ6A 1IW7C 3I90A 1TXYA 3F2DA 4BS9A 4PZ8A 3L7ZC 2EYOA 1JQYD 1M4VA 2B2WC 2NWGA 2BCOA 2RCNA 3DM1A 4LF4Q 2ASBA 1B9NA 4DXGA 2EPBA 1ESFA 3TZUA 4HJAA 4WFN3 4LFBQ 4DN4M 2ZJRA 3BJUA 3S1RH 3JAME 1YJ9A 3NBHA 4A3JH 3A8JE 3A5UA 2K75A 3UDIA 1HH2P 3JC66 3C2PA 1SNDA 1VQGA 4LK1C 1CA5A 3C3LA 1FGUA 4IPCA 3T4AC 3QO2A 4KY7A 1LABA 4LUVA 3I56A 1PH8A 5EKIA 1WYDA 2C35B 3OW7A 4JPBW 4YIJA 2LKVA 4JBWA 2JYOA 3DUZA 2L11A 1QWYA 2YU9B 3CXCA 5M5WH 3FHWA 3X3MA 3QIAA 2IHFA 2A6HC 4AQYQ 2KECA 5CBAE 3TP8A 3F2BA 2F0VA 3KDFA 4IQZA 3MFYA 3HG9A 2DNEA 5KNBA 3IL8A 1UEAB 5IT9L 4R8IA 3I55A 2HHHL 4L63B 3GTLB 3KF8A 1SNCA 3BVGA 3I91A 3UDXA 3MAQA 4ZCKA 5EBDA 1QUQB 3HOXB 2UXCQ 2Z4HA 3N52A 1AFPA 4FF3A 1ENCA 3G6EA 2XNAC 1IYVA 1ILQA 1BUVT 4ODGA 5FOBB 1EYGA 1JT8A 4LWCA 4NDXA 2JA5B 2D0OA 1I6HH 1YI2A 4BA2I 2TSSA 1AZQA 2FXQA 4GNXA 1XNRQ 2O5JC 3OMCA 4ID6A 2ZM6L 1YHAA 4IALA 4OHJA 4ZKBB 3HOVB 1Q8IA 1TWHH 3I72A 4LF9Q 3Q22A 4F8MA 1L0WA 4GN3B 2VQFQ 1QILA 2PI2A 4PMCA 4LFCQ 2D5DA 4JI3L 4P2CB 2FMMA 4YCUA 1XYIA 4ZAIA 5FJ8G 4GLVB 1X3FA 2K05A 3TSSA 1CHQD 2KCMA 1WD1A 5DNFA 5EKLA 3I4NG 1S40A 4A3EG 4HR7B 5A35A 4DAYA 1AH9A 1SLJA 4JBJA 4BBSH 1LT5D 1SR3A 4JI8Q 3S15H 3U4VA 4F7XA 5HGQA 1FVIA 3H94A 4V190 3FP9A 5EPLA 4C3JB 4IJLA 4OL7A 2Q8RE 3GTKB 4JI5Q 1BKBA 1Y1WH 1SFOH 1PTOH 2NUCA 4L6TB 5FJ8H 1XPOA 1NTGA 3ULPA 3PMFA 2UXDL 5JOBA 2NVTB 4UP7A 4A3EH 5JAVA 1IBMQ 1NMFA 1XTDA 3ONAB 4KN4C 4YY3L 1GUTA 1WJJA 2F0NA 5C4XG 3TEHB 1D5ZC 4GOPC 1EIGA 4UHVA 2F0HA 1WVLA 1QZHA 5J1ZA 1R4QB 2IX3A 5LHY1 3I3CA 3CCMA 1UE5A 2SEBD 1LLRD 5CV9A 2K14A 1NAPA 1Q46A 2CH4A 1PDQA 3J7ZC 3H3VC 1YNJD 2XWJB 3PUXA 5IGBA 4MZ9A 4U68A 3SK6A 4LMQD 3A74A 1VMPA 3LGJA 3P1HA 1AEXA 5D3DA 4Z9CB 3FMCA 4ME5A 4PG3A 1LACA 5E1FA 1LTRD 2F0KA 5C4XH 2F3VA 4DR2Q 1VQLA 1VQFA 5M3FB 4OXPA 4DV7Q 2E2HH 2NVXB 1UE6A 4JVZA 1GXDC 1O7YA 4JBMA 3K7AH 1C7YA 5CMDA 1PV4A 1LTLA 4ILWA 3R93A 3HOUG 3I7FA 2BA1A 4G4KA 3UDGA 4IUNA 2WINB 3HOYB 3BVZA 2PQEA 3BDOA 3T1HL 1VF7A 3A5ZB 1EYDA 1V1PB 4JW0A 1HA6A 4R4CA 2K01A 1PH9A 2K5VA 5C3EG 2RF4A 3ERSX 4F87A 4N8X1 4DR3L 5CV6A 3OOCA 3CMEA 1MSGA 3HP3A 5ELEA 5C5LA 3F8TA 1YNJC 5C44H 3HOZB 1J5EQ 4QJFA 5T1IA 1VQ7A 3D4RA 3HZXA 4BY7B 3PO2B 2BH2A 1N32Q 3HOUH 1PVOA 2MJ8A 3OTOL 1GUSA 2FINB 4HJ7A 1ASZA 1CA6A 3K5LA 1XTCD 1D1IA 2F0MA 1KRSA 4IOCA 1EOTA 5IGDA 4A3BB 2HT1A 2F0OA 1QUQA 1GHJA 4DK3C 4OGQC 1KDAA 1II3A 2ZXOA 2L55A 1LTBD 4HAEA 4IFDI 4LW1A 3UE0A 3GD7A 5IODA 4N8FA 1QG7A 2H1EA 1PFMA 3A8IE 4HTHA 5IP9G 2VB3X 1HTLD 4NXNL 1IBKL 1HZCA 3IRBA 1H9JA 2M9VA 5A2QL 3T1YL 2O5IC 1D2BA 5C4JH 1G6PA 2L15A 1PH1A 2XIWA 3GTOH 1B70B 3PO3H 3FVQA 4J8QA 1GO3E 3VYSA 1YJNA 5FLXE 1TIID 4JI4Q 3H3VI 3T56B 1HCZA 3CC7A 1BBUA 4HIOA 4UPAA 4XYOA 3KF6A 2KJXA 2JA7H 1DXMA 4XQJA 4O0AA 2JA6B 5DEHA 4B3RQ 1E7ZA 4IUTA 4E6IA 1X54A 1PMRA 1EYAA 1PA6A 3S14B 2CVRA 2I07B 3C1FA 5CV5A 1TWFB 2VUMB 4B3SQ 3BU2A 1U4MA 1PH7A 2WAQB 4MTNA 4C3HG 3RZOH 2J7ZA 5CV4A 1FGBD 3E6ZX 3QB3A 1VQ8A 5JVG3 3DWPA 4PZ7A 4HJ5A 2KVMA 3EN2A 1YHQA 2SOBA 3H6MA 1TQOA 1JJCB 4H44C 1GUOA 4A3GG 1ESRA 2MQHA 1S5DD 1V1QA 2AKWB 2PZTA 4RAUC 3CF5A 2F0TA 3NTKA 4IUVA 5NUCA 4N9PA 2DY8A 1B53A 1XNQQ 4JG2A 2K52A 1HNZQ 1EWIA 1D5XC 2WV6D 3I2ZA 3VR6A 1Q81C 2R7ZG 4J15A 1S5CD 4C3HH 4FP5D 1RCVD 3S1NH 3G6JB 1JJ2A 2DGYA 3HOWB 2RDFA 2LS01 2OF1A 2EOTA 4BY1H 2F4IA 3K80C 1RIPA 1DONA 1XNRL 2MFIA 4TQUS 1U5KA 5E7NA 3I4MG 2HIVA 4J1MA 1PZID 2HQLA 3GP7A 4Q0FA 1E0BA 1SROA 1SYDA 1MGSA 1A3VA 5FO8B 3CRKC 3GTGB 1Z7TA 3GTMB 2VQFL 1DGSA 1SJHD 1K8GA 4L5QA 2DJGC 1X65A 4K8IA 4DV5L 3MC0B 1FNUA 1X3GA 4RGNA 3MZ5A 1G6ZA 1FL0A 5ELDA 1TS4A 1K0RA 1CM9A 1BNZA 5GAEC 4K6DA 4K0KL 1I4HA 2X6GA 4OO1H 4EVOA 4BBRB 3I4MH 4LFAL 1H9KA 3A54A 3M4PA 3SK4A 2JA8G 3M4QA 1EWHA 1BR9A 4P72A 4RKLA 4QQBX 5CBEE 5IYBG 5ISRA 4OIJA 3SDZA 2G5DA 2A73B 3WWVA 3TS2A 3LNNA 1GHKA 2I5MX 4RG1A 4DR5Q 4A3JB 4GKJL 4DAMA 3G71A 2ZXRA 2A74C 4K2LA 5GAGC 4DV0Q 1NNXA 1CK1A 4A3IG 4FDBA 2X6LA 4X66L 1CQFA 3ULJA 3CQZB 5L37A 4V0BA 5H1SE 1I4GA 2WB1G 1UWVA 5AFWA 3S2DH 4X6AH 2E2IB 1HA5A 3PSIA 4DA2A 4CDDC 2CWAA 4A93G 2B2VA 2JA8H 1NE3A 2H5XA 3C46A 4DK0A 3AYHB 4B3ML 5KEEA 3PIP3 2AMCB 3RMHA 3K58A 2KQ3A 4J6HA 5GQOA 2PCFB 3SK8A 1I4XA 4A3IH 2Z6BA 3CPWA 3VYUA 3M3YH 4EQNA 1X32A 5JJLA 1U4PA 2Z6KA 4FXDA 2NTTA 2ZTDA 5KNCA 2PI2E 4A93H 5E4XA 3CU7A 2ZJQA 3VA5A 1VQOA 4AYBB 2PMZE 4QL5A 1QVGA 5IYDG 3TS0A 4R9WA 2CQOA 1NBWA 2UU9L 2XRSD 1O78A 1IKMA 1SEBD 3F2CA 1I6HB 3PGZA 4O1NA 5M3MB 4JOIA 2F0EA 3K57A 5GROA 2K5DA 1W3SA 3KBXA 1X6OA 2D62A 2Y0SG 5BR8Q 1B3QA 1IXRA 4ZYSA 2IT1A 5CR3A 3T53B 2KUMA 3TRZA 2EYPA 1L1OB 1CHPD 2B2UC 1TWHB 5LMNQ 2GA4B 4KKSA 1N34L 1QNUA 3U4ZA 2KCTA 2MGSA 4JI0L 4YWLA 4P71A 4UP8A 2K50A 5IWAQ 4TSSA 3K5OA 2LY7A 5FKAC 4IPGA 1J5EL 3A55A 1VQAA 1I3QH 3SGIA 1PRTB 3V2TA 4DR1Q 1QCBD 1K8OA 3GTQH 4KHVA 1A3UA 5E4WC 3J7AF 4ZK9B 3MXUA 3VA7A 1K8MA 4IFDJ 3NXWA 4IZ8A 1TT2A 3CKIB 3PCOB 3NBIA 4QF4A 3VDYA 5C0XG 2ATWA 4FYDA 4DAPA 1VQJA 1F9SA 1EWCA 3PF5A 3J7AV 1Q8KA 2DNCA 4BBSB 5TSSA 4G7HC 3PUVA 2ICEC 1AE2A 1MHWC 1PH5A 2Z0SA 3KYHC 1EZ8A 3S15B 2WIIB 3TQYA 5AJ3L 3CPFA 4CKCA 1JICA 1OO9B 4YHHQ 4B08A 2BDNA 1OXTA 1Q7YC 4LF6Q 3NQTA 3ER0A 5LMUQ 1Y1WB 1PTOB 2E5LL 1KHIA 1YJWA 2HCIA 4NPSA 5ELNA 1A2UA 2F0DA 3EFXD 3JAMi 2HUGA 2EY1A 5J3BA 1MJEA 3QOJA 4EQ5A 4A3MH 4DUZL 4A4IA 5C0XH 5LL6X 2F0LA 3AU7A 3ITPA 3RNUA 4KHPL 1I94Q 3NE5B 1VQPA 4A3DH 4R8NA 1F77A 2LMCB 4ZRZA 4IUQA 3MXNB 3CC4A 1SN8A 3OYYA 2IL8A 2R93G 2VQEL 1YITA 3MEHA 2E2JH 4A3KG 2JN4A 3EIVA 1JCKB 1I5FA 1VQCA 1Q82C 2K03A 5J39A 5COYA 1CZWA 2B39A 3S17H 1STEA 2X69A 4LF7Q 3D8GA 2AUJD 3OWFA 1PFBA 1VQBA 1JOOA 2JEAI 1I4RA 2UUBL 1SYGA 1C9OA 2A1AA 1N8RC 3RN5A 1A2TA 3TP7A 5C4XB 4JI1L 1Y1VB 2QW7A 1KLUD 2NN6I 5DM63 2PQAB 2R93H 1GVPA 2QILA 1FYCA 2SNMA 4H13C 2CW0D 4HCSA 3K7AB 1SE8A 2N8NA 4K2KA 4A3KH 5IP7G 1SMXA 1SJED 1HQMC 2WACA 2K33A 1G91A 1VQDA 5IYCG 4CDEC 1OXSC 1X3PA 4KK7A 3PF4A 4JI6Q 1B1ZA 3J7A5 3FKIG 1ICFB 4BXXG 3KLRA 3CC2A 4DR4L 4G7ZC 3MEFA 1LV9A 4DV6L 3DWQA 1LTTD 2E75C 2CQAA 2VB2X 1PH2A 3V05A 5C44B 1WTVA 1BBWA 1X55A 5EQ0A 5GAHC 1EIHA 4JCVE 1JWUD 2YTYA 4CBVA 5IP7H 3EVQA 5C3WA 3HOUB 3K5MA 2TMPA 4LF5Q 2IX1A 1WTRA 1B3AA 5IYCH 4TVAB 1ZYRD 1XMOL 2L1BA 3D0FA 1EFID 3RR5A 4EX5A 3LX0A 1CKMA 4DU9A 3H0GG 4DV1Q 1AW7A 2VZAA 2CW0C 1UE1A 1D1KA 2UUAQ 5IE8A 4BXXH 1LTGD 3D31A 3FEWX 2JSOA 4AH6A 5I2YA 5CC4A 2UUCQ 2Z4IA 2DN8A 3P20A 1CI3M 2MNAA 4QCLA 1VQNA 2K5QA 1SNPA 3AMUA 1NUCA 1STYA 4IN3A 3PO3B 1N33L 5D65A 1L1OA 1PTOF 3S1MH 4MNOA 1C48A 1EUJA 2NYZD 5I6WA 3H0GH 5EBCA 2KBNA 3U9SA 1WCMG 3R2TA 3OWEB 2HDLA 2JA7B 4X65L 2QKIC 4K8JA 5IGFA 4X3KA 3R8BA 3KK7A 1HJPA 1LT6D 1M8AA 1ZYRC 2YYZA 4IUUA 3DXJC 4DV2L 1IBLQ 2Z1CA 4GN4B 4QIWE 1S5FD 2F4VL 1EEFD 2BDOA 3ND8A 5IT9c 3RZOB 2B2YA 4XIGS 3AB9A 2JXMB 2LFNA 1PHJA 1AZPA 3GDEA 4C3IG 2ZT9C 2QDBA 1K3BC 3CCLA 5DAUA 1P16A 5HGTA 1VQ5A 1B2TA 4K14A 3I4NH 2RDHA 4OWWB 1V9PA 2FHTA 4LJZC 2Q2IA 4JV5Q 4TKOB 2YTXA 1DCZA 2B2TA 2MO0A 1CKNA 3SK5A 5D14A 4PZ6A 1BXTA 1XJVA 1RDPD 1K9MC 2NVYB 1HUNA 4C3HB 4OONA 2Q8TA 3S1NB 3UI2A 2VY3A 3H09A 2B2UA 1XPRA 4C3IH 3E9IA 4P75A 4FO2A 3J80L 5C4ZA 5LMNW 1R4PB 5C6AA 3MXNA 2B2VC 3FDTA 1KL9A 1TR5A 4BY1B 5M5XH 4X64L 2O4XA 1HNXL 1SYBA 1N9WA 1TWCB 1VCIA 2IJ0A 4UAIA 3K59A 3NP8A 1H9SB 1FR3A 4JYAL 2M2LA 2OWOA 3HKZE 5ELCA 3HEJA 1N36Q 1SMYD 1WTQA 2F0JA 2QF7A 1KTKA 2F0WA 3LWEA 1G8ZD 3NWTA 3W3AA 4JI7Q 4K5XA 3OSOA 2Z6KC 2ENBA 3A56A 2PW7A 4QUCA 3B6YA 1VS0A 3LWUA 1Y69U 5BN3A 1HTPA 3PIO3 4DR7L 4WORA 1OTCA 1STGA 3ERQA 3BYTB 2PQAA 1ENAA 2YV5A 2EYHA 4OX9Q 3KJOA 2Q2TA 1WTHA 2Z9HA 5JEAJ 3FPPA 1ASYA 3S2HH 1TS2A 1BO0A 2E76C 4CJ2C 1Z6HA 5I9PA 2ICIA 2A19A 1IZ6A 2LXKA 3KLWA 1XXGA 4B9WA 2AWNA 3DWAA 4JOIC 3TN2A 1MD2D 3HOXG 4OEMB 4IOAA 4XXEA 3CHBD 2YU9H 2P5ZX 1VQMA 3OIPA 1MIUA 2IY5B 1DOMA 2WB1E 1KXLA 1OXXK 2ZTCA 4HN7A 3F1ZA 1LTID 1W2BA 4C1NI 5EJWA 2JA5G 4DR6Q 2SNSA 2N49A 3KLSX 3DM3A 4B9XA 1SMYC 3GTPH 2IX0A 4PV1C 1K3RA 1LTAD 4A3LG 2PZWA 3S1QH 1DJRD 1Q86C 3S2DB 1F2MA 3HRZC 3J80c 5C3EH 1K28A 3CCUA 1HR0Q 2Q8IB 2JA8B 1PH6A 4KY6A 1RD9D 3TDQA 3KBGA 4IO9A 1GUWA 3K81C 1QZGA 1I6VC 3HOXH 2JP1A 1JJGA 4XDXA 4RWSC 2UXBQ 4JI2Q 3DEOA 4DUYL 1NY4A 2HDMA 5KYIA 3IKJA 2JA5H 1SDFA 4IURA 4LF4L 2EYMA 1PYBA 2F3WA 5BN5A 1TWGH 4L8JA 4A3IB 4IJHA 3SVMA 5M9OA 5K5PA 2EXZA 5JPMC 4LFBL 1AE3A 2V1CC 2QCPX 4A3LH 4DV3Q 4NXMQ 1EQTA 4DK6C 1I50H 3ZJYC 4KJOA 1ET6A 3OPOA 2RSOA 1HNWQ 4GLXA 4B3TQ 2K4KA 2Y0SE 3SHLA 1MI2A 5IP9H 2JE6I 1PLFA 1RHPA 3RLNA 2AHOB 1EL0A 3BZCA 4R4QA 1XPUA 1O7ZA 4KJNA 4MTKA 2I46A 4JK1C 1X3QA 4LUZA 3S9WA 2EVBA 1BCPB 1LUZA 3J81L 4AQYL 2B8GA 4QY7A 4X62Q 4KV6A 1Q1EA 2GN5A 4ALPA 3NUCA 4FF4A 1L2FA 1TU2B 1E3PA 2EY5A 3T13A 4C2MH 1O7LA 1MJCA 1I3QB 1WTPA 2MP1A 3GTKH 4H02A 4XTCS 2RHQB 1BBXC 5IOCA 2QA4A 2UXCL 4LF5L 2EY6A 3E5SA 2CCZA 4QGUA 2Y0SB 1YVCA 2K04A 2N55A 1VQ4A 2R61A 1YEZA 1ET9A 2CH4W 4A3GH 1CUKA 3QR8A 2EQSA 4PNYA 3RZDH 3H91A 2MUYA 3D3RA 2Z8LA 5DM73 5I4DA 4CDFC 4LF9L 3BG3A 2R7ZH 4DXFA 1H9SA 3HOYG 4LFCL 4WJ3M 5DLQE 1G2TA 1I4QA 1PYSB 4IFDG 4UP9A 4CGYB 3D4WA 3PUWA 4A3MB 4ZUIA 1SE4A 2D9UA 2XRQD 2HHHQ 3HKZG 4BWGB 1WFQA 4KHZA 3M4YA 2IWHA 1V8QA 3K6OA 4A3DB 2IW3A 3CRLC 4JC0A 3RUZA 2PZUA 1PRTD 4RMFA 1CTMA 4QMGA 3TZDA 3J81c 1VMCA 2JQOA 2NBFA 3PO2G 1K83H 2KOLA 1V1PA 1NCVA 4JI8L 3S17B 2I0QA 3MA2B 5IGEA 1KNAA 3HOYH 1F2LA 2V4DA 3MTSA 3ND9A 3S1RB 2ZM6Q 3S16H 1RL2A 4IFDH 2BA0A 4JI5L 4A3BG 1KABA 1TWAH 1KDCA 1BOSA 5C5MA 1K8AC 4XT1B 5JJZA 5FO9B 3G7LA 3VR4A 2RSNA 1EIFA 1ICWA 3NBHB 3JAML 3ULLA 1DYQA 4EQOA 2BH8A 1PTOD 1IBML 4JI3Q 2G9DA 1L1OC 3OIQA 5KRUA 1HFNA 1G51A 1EY6A 3STBD 4A3KB 2RA4A 1VQ9A 3PO2H 3PQIA 3H3VH 5IYBH 4OIKA 1RODA 2C5CA 3CCVA 5M5WB 2DJFC 4U673 2B63G 4HSPA 5J22A 2HD3A 4EGVA 1PRTC 1VQKA 3EA6A 1SXTA 3G4SA 4Y7NH 1TS3A 1FD7D 3HFZB 1JOKA 1RJTA 3E9HA 4PQXA 5A2QE 2JA6G 3KDFB 2B2YC 4GZYC 2N88A 2KCNA 2N3SA 4DR2L 5F2DA 4A3FG 3TREA 3KF8B 3P75A 4DV7L 1HPCA 2UXDQ 2B63H 4AIMA 2AUKA 2FMCA 3FRPB 3SE0A 1PTOC 1B7YB 3MHBA 5CYUA 1SE3A 2B2TC 4YY3Q 2F0SA 3STBC 1C4QA 5E3FA 2XWBB 2C9OA 1G291 1SYEA 2R92G 1I4PA 4NB3A 3GV3A 1YNND 2JA6H 3T51B 3U9OA 4GNXB 4EQPA 4TRDA 4DF7A 1S5ED 1Y8NB 4RGMA 4H7BA 1EFWA 1EY9A 4A3FH 3Q6SA 5IYDH 2KEDA 4RFBA 1WOCA 2KHIA 2XSCA 3S1MB 1PYWD 3HOWG 1EOVA 4M1UB 2QGQA 4XQNA 1HR0W 1N32L 3H0GB 1QNKA 1WI5A 2R92H 2NB0A 2PMZB 1JWMD 1EQVA 3A7LA 1WTXA 1DZ1A 1B9MA 2KHJA 5ELOA 4YWMA 1CKOA 2DUDA 4CKBA 3R3OA 1YIJA 3AQQA 4DAYB 2K5NA 2IPKD 3EJIA 3QOLA 2WP8J 3PV0A 1YNNC 4JI2L 3W1BA 1SFOB 4L5TA 3NTIA 1U9RA 3E0EA 4GLAC 2OTJA 4LF8Q 3T16A 5I9OA 3S24A 3MXGA 3I4NB 3I4OA 4A3EB 2EE1A 5GADC 2K7VA 4JI4L 1LO5D 4I7AA 4RA8A 1RKNA 4PMBA 2R6GA 3OTOQ 2D0PA 3EBEA 4QB4A 3GTGH 4B3RL 3GTMH 3TBIB 1WTOA 5HURA 1R9TH 1G2SA 4C3IB 2F0PA 4A3JG 4DKAC 1A3TA 3GO5A 4WJWA 1E2ZA 4B3SL 3KOJA 3M4OH 5M5XB 2OCEA 2R7FA 1A62A 3IFTA 1ZKOA 1YHBA 4GKKQ 4X62L 4NXNQ 1IBKQ 1Q3LA 2LXJA 1X9NA 3NEMA 3T1YQ 4IUPA 5C4HA 5KIXA 3I4LA 4IPDA 2E2HB 3M7GA 4P74A 1UAPA 4YCVA 2EZVA 1ENFA 3CW2C 4X3UA 2F1MA 1XNQL 2EJMA 1HNZL 2G9HD 2BE5D 2NZOA 2XGTA 4N9TA 3NTHA 3UDFA 1IHZA 1JE4A 3CQZH 1EY7A 5FLMG 5K36G 3SXHA 3S2HB 2E2IH 2F0UA 1PZKD 2QDLA 2R3ZA 1EEID 4WRDA 2MHVA 5G3LF 1WTWA 2F0FA 3WOEA 3RN2A 4AYBG 5D3IB 4NP5A 2XVSA 3PUYA 2K6AA 1JE5A 4K5VA 4RGOS 4FVMA 4A76A 2L0CA 5FK9C 1KNEA 2L12A 5M3MG 1KRTA 3BDCA 1PRTF 3GTPB 4JBKA 4KD4A 4F88A 4L5SA 3U58A 5FLMH 3S1QB 3AEVA 5CV7A 5K36H 3FKIH 5C3EB 3L2PA 5JEAG 5EPKA 3CCRA 1X3EA 2BE5C 2EJGC 1Y8PB 1D8LA 1A63A 1F9PA 2CWPA 2F0IA 2QEXA 3WOFA 4POFA 4K6LA 1S5BD 2NVQH 1QVFA 2NZHA 4RGTA 2RQXA 5M3MH 4YWKA 3UE1A 5C4JB 1TWGB 1K0SA 3GTOB 2WFWA 3F2UA 3NPPA 5CGKA 2OTLA 4ZQ3A 1EY8A 2XN9C 1JB7A 4ZUJA 1U4LA 5C0XJ 4DR5L 1KLGD 5ELBA 4DV0L 1I50B 4DNRB 5JEAH 4BBSG 1L0YB 1B8AA 1FNVA 1NR2A 1VDZA 3SEBA 1SBBB 5FLXL 1CFMA 2KEEA 3MVVA 4KKUA 3KF6B 2O2LD 1B50A 4DV5Q 2Q2UA 1Y8OB 4P73A 1NJIC 4DAVA 3RD4A 1Y1WG 2VNUD 2RCFA 1IL8A 1J6QA 1EZ6A 1MKHA 1T5XD 2JA9A 2YTVA 3J7YW 3I73A 3W1GA 4K0KQ 2FJ2A 3VR2A 2NN6G 3IFDA 3U50C 3CCEA 2OQ0A 4LFAQ 1BF4A 1PFNA 1E2VA 2NTSA 1WCMH 5EKKA 1KQSA 1L0XB 1Y14B 2FFKB 1QB5D 2HQEA 1K73C 1IL2A 2BOSA 4C2MB 4HJ8A 3K7UC 1CQVA 2CFMA 1QOHA 1YZ6A 5M5YH 4HIDA 4POGA 4GKJQ 1GKHA 4PMWA 1HXYD 5I6YA 2PO4A 4ZLTF 4X66Q 5IGGA 2M00A 1LYLA 3CMAA 1XX8A 1EQRA 1Z47A 2NN6H 4L5RC 3GTJH 3C1EA 3BZDB 1IKLA 1MSHA 1S4ZA 4A3GB 4QIWB 1RTOA 3NENA 4A75A 3RZDB 1Y1VG 3QWNA 2N78A 2OT2A 4B3MQ 4X3TA 5BR8L 4X3SA 2OXPA 1RF2D 3CAMA 1SRUA 4FF2A 5LMNL 3Q0AA 3L3OC 4KI0A 1BCPD 2R7ZB 2A68D 3M9BA 5IWAL 5FLXc 3P7JA 1KD1C 5IY0A 2AQ3B 3PIOA 1H95A 1XWEA 4XQQA 4XYQA 3WDNA 2PNHA 1S3OA 4DR1L 3E3XA 1IYJB 2E2DC 1EY0A 1X56A 2F0GA 1B44D 3AFQA 5FO7B 1RTNA 4HIKA 4UY8C 1UEBA 1Y1VH 4ZKCB 3TP6A 4HSVA 3I4MB 5C44G 2A6ED 4UDUC 1IYUA 1SNOA 1JOQA 2UU9Q 3NELA 2OEOA 4FXKC 4LUOA 5JPNC 1FJGQ 1CZGA 1K83B 3FPUB 2AQ1B 5IGCA 3N6RA 3KJPA 2EYLA 1W6JA 4YHHL 3S16B 1V1OA 4LF6L 1E1TA 1Q90A 1NMGA 3HKZB 5LMUL 5IT9E 1F2ZA 1KIXA 1TWAB 4K5WA 1N34Q 2AWOA 1XMQQ 2R7DA 1EU4A 4LF8L 1BCPC 4GOPB 4JI0Q 2A68C 3D6CA 3NWSA 4YCWA 3GTLH 3HOVG 3MWYW 1I94L 2I5HA 1SAPA 2K5HA 4OO1I 1LM0A 4RCNA 3L9AX 3Q23A 3PO3G 1STAA 4Y52H 3HGBA 1GUNA 5EAYA 1EY5A 2A6EC 2B2WA 4Y7NB 3I70A 2EIFA 2L5TA 3QG1A 2WAQE 2JA7G 3M3YB 4LF7L 1HUMA 1U4RA 3BZKA 4Q5VA 2DY7A 1M90C 2WB1B 2J4XA 5AJ3Q 3A8KE 3NHHA 1HRJA 3HOVH 2K32A 4A93B 5CV8A 4GKKL 3BYYB 3E0JA 3DLLA 4DNIA 5BN4A 4DV4Q 2E5LQ 1EY4A 3BVMA 3EQLC 4CJ1B 3J81j 3W2DA 4CJ0B 2A8VA 2VW9A 4H0LC 2LSSA 2IHEA 4C3JG 3CCSA 2B63B 1E2WA 2GVAA 1S72A 1DD2A 4DUZQ 2JJQA 1YNXA 1Q1BA 1J8IA 4KHPQ 1VF5C 2VS1A 2ZJPA 3X3NA 1EYCA 2QEJC 1A0IA 1P8LA 1EIYB 1JORA 2AQ2B 1KAWA 2VQEQ
chains in the Genus database with same CATH topology
3KDFB 1WJJA 4JI1L 4JI6L 5C4XG 3PUZA 3TEHB 4GOPC 2NN6I 1C0AA 2PQAB 4GS3A 1QZHA 1GVPA 2R93H 1V43A 2N3SA 1E24A 3J80i 3KFUA 4IPHA 3CCMA 1HZBA 1UE5A 4DR2L 1SE8A 2N8NA 1GD7A 4A3KH 5IP7G 1SMXA 4A3FG 2K14A 3TREA 3KF8B 4C3JH 1EQQA 4DV7L 1Q46A 5JJKA 2UXDQ 1VQDA 2B63H 4AIMA 5IYCG 3J7ZC 4KLKA 3H15A 1OXSC 2UUBQ 1B7YB 3PUXA 4MZ9A 3A74A 4BY1G 4YY3Q 3PF4A 3LGJA 3AFPA 2KENA 4JI1Q 4JI6Q 3STBC 3J7A5 3FKIG 4OWTB 2NVTH 1G291 2R92G 4BXXG 2F3IA 4PG3A 4NB3A 3CC2A 4DR4L 3MEFA 4DV6L 4DV1L 2JA6H 5C4XH 4DR2Q 1VQLA 2UUAL 4GNXB 1PH2A 1VQFA 1BBWA 1X55A 2CKZB 4OXPA 5GAHC 4JCVE 4DV7Q 2E2HH 1UE6A 5M3FG 4R4IA 2YTYA 2NVYH 1EFWA 2UUCL 5IP7H 3K7AH 4JBMA 4A3FH 1C7YA 5IYDH 1PV4A 1WOCA 4R1JA 1LTLA 4LF5Q 2KHIA 3HOUG 2I5LX 2IX1A 5IYCH 3I7FA 2BA1A 3UDGA 4TVAB 1JMCA 3HOWG 1E1OA 1EOVA 1XMOL 2QGQA 3D0FA 1HR0W 3RR5A 3T1HL 1N32L 4EX5A 4DR4Q 3A5ZB 1CKMA 4R4OA 4DV6Q 3H0GG 4DV1Q 2VZAA 2HIXA 1TWCH 4R4CA 1UE1A 4OO1G 1PH9A 2UUAQ 1WI5A 1VQHA 5IE8A 2R92H 4BXXH 2K5VA 3D31A 5C3EG 2RF4A 3ERSX 4AH6A 4APVA 4DR3L 2ALYB 2KHJA 5ELOA 4YWMA 2UUCQ 1E22A 3CMEA 3F8TA 1CKOA 2DUDA 5C44H 1J5EQ 5M3FH 4QJFA 2NVXH 3HOZG 1YIJA 1VQ7A 2VL6A 2MNAA 3AQQA 4DAYB 2K5NA 1KC8C 1VQNA 1XMOQ 2BH2A 4BY7G 1IBLL 3OW2A 3HOUH 2WP8J 3PV0A 1N32Q 1PVOA 3OTOL 4JI2L 4HJ7A 1ASZA 1N33L 1L1OA 3W1BA 4HJ9A 1PH3A 3S1MH 4MNOA 1KRSA 4L5TA 1EUJA 3E0EA 4GLAC 4GN5A 3CP0A 4IOCA 3H0GH 2HT1A 2KBNA 4LF8Q 2OTJA 1O7IA 1QUQA 3S24A 1WCMG 4DK3C 3I4OA 3RLFA 4X65L 2F52A 3W5OA 4DPGA 5GADC 4HIMA 4IFDI 4LW1A 3UE0A 4JI4L 1HJPA 3GD7A 1M1KC 2YYZA 4DV2L 2JEBI 1IBLQ 2R6GA 5C0XI 2B29A 5IP9G 3OTOQ 3M7NA 4GNXC 3HOZH 2D0PA 3EBEA 2EXDA 4GN4B 4QIWE 4NXNL 1HZCA 1IBKL 1N33Q 3IRBA 2F4VL 3GTGH 4B3RL 4JV5L 2ZTEA 3GTMH 4WJ4A 1D7QA 3T1YL 4BY7H 3PIPA 5IT9c 1R9TH 4GOPA 5C4JH 4XIGS 1G6PA 2L15A 4A3JG 1PH1A 1PHJA 3GTOH 1B70B 4DKAC 3GDEA 4R4TA 3PO3H 3GO5A 4AYBE 4X65Q 4B3SL 3KOJA 3CCLA 1GO3E 1P16A 1VQIA 5HY6A 1YJNA 3M4OH 3Q8DA 1OXUA 2OQKA 2OCEA 2R7FA 1VQ5A 3H3VI 4JI4Q 4A3BH 1A62A 3CC7A 1BBUA 4HIOA 4UPAA 3I4NH 3KF6A 4DV2Q 1YHBA 2JA7H 4ME3A 1V9PA 4O0AA 4OWWB 4X62L 4GKKQ 4NXNQ 1IBKQ 2Q2IA 4JV5Q 2LXJA 2YTXA 1X9NA 2MO0A 1PFSA 2F4VQ 1CKNA 1OXVA 3NEMA 1E7ZA 3T1YQ 1Z9FA 3G48A 1X54A 1PA6A 1Q12A 4IPDA 4PZ6A 4P74A 1GM5A 2JK8A 3CCQA 1XJVA 4YCVA 1K9MC 1N36L 3CW2C 3J81i 4OONA 4B3SQ 2VUMG 3BU2A 1PH7A 2VY3A 1XNQL 4MTNA 1HNZL 3RZOH 2WAQG 2NZOA 2XGTA 1XPRA 4C3IH 3E9IA 4P75A 5LMNW 1VQ8A 4HJ5A 4PZ7A 1YHQA 4JI7L 3EN2A 1KL9A 2RHSB 3UDFA 1JJCB 1VQEA 5M5XH 4X64L 3CQZH 1HNXL 1VCIA 1N9WA 4A3GG 5FLMG 2MO1A 5K36G 2E2IH 2MQHA 4JYAL 1V1QA 2AKWB 2OWOA 4OX9L 3CF5A 3HKZE 1N36Q 3RN2A 3HKSA 1XNQQ 4JG2A 4AYBG 2K52A 1HNZQ 1CSQA 1EWIA 3I2ZA 1A8VA 3S14H 3PUYA 4LNQA 3RLOA 1Q81C 2R7ZG 4J15A 1T9HA 1JE5A 1TWFH 1CSPA 2VUMH 4C3HH 3JAMc 4A76A 4JI7Q 1FJGL 2Z6KC 3S1NH 3B6YA 1VS0A 5M3MG 4X64Q 1JJ2A 2DGYA 1HNXQ 1KRTA 4DR7L 2E8GA 3M85A 1OTCA 4JBKA 2PQAA 2YV5A 2GVBA 4JYAQ 4L5SA 4BY1H 3K80C 4OX9Q 1RIPA 3KJOA 3U58A 1QVCA 5FLMH 2Q2TA 4DR6L 3AEVA 3FKIH 1XNRL 3L2PA 5JEAG 2MFIA 4TQUS 5JEAJ 1XMQL 1ASYA 1U5KA 3S2HH 3CCRA 5E7NA 3I4MG 1X3EA 2HIVA 2A19A 1IZ6A 2LXKA 3KLWA 3ICEA 1D8LA 2AWNA 2HQLA 4JOIC 1A63A 1SROA 3HOXG 2CWPA 4IOAA 2QEXA 1HR0L 4POFA 2YU9H 1VQMA 1MIUA 2IY5B 2WB1E 1KXLA 4DR7Q 1OXXK 2VQFL 1DGSA 2NVQH 2ZTCA 1QVFA 1YBYA 1K8GA 2NZHA 4O2DA 3F1ZA 3T1HQ 4L5QA 5M3MH 1W2BA 1X65A 4YWKA 3UE1A 4DV5L 2JA5G 4DR6Q 2UXBL 2N49A 2ID0A 2WFWA 2OTLA 3DM3A 1X3GA 3HOWH 3L0OA 1HZAA 4A3MG 1FL0A 3GTPH 1JB7A 5C0XJ 2IX0A 4DR5L 4OWXB 1K0RA 5GAEC 1K3RA 4DR3Q 4A3LG 4A3DG 4K0KL 2ES2A 4DV0L 1Q86C 3S1QH 4BBSG 3J80c 5C3EH 3CCUA 3I4MH 1U0LA 4BBRG 4LFAL 1B8AA 1HR0Q 3M4PA 1PH6A 2JA8G 4IO9A 4DV3L 4A3CG 4NXML 3CD6A 3K81C 3M4QA 1QZGA 3A0JA 3KF6B 3HOXH 1UE7A 5JJIA 1JJGA 2XTIA 3K0XA 4P72A 4DV5Q 4QQBX 5IYBG 2Q2UA 2UXBQ 1HNWL 3K8AA 4P73A 4JI2Q 4DV4L 1NJIC 4B3TL 4DUYL 1NY4A 1Y1WG 3WWVA 1CKNB 3TS2A 2VNUD 2I5MX 2Q2HA 4RG1A 4DR5Q 1PH4A 2JA5H 1J6QA 1MKHA 2JA9A 2YTVA 4LF4L 1PYBA 4BA1I 4DAMA 4GKJL 3G71A 1TWGH 3W1GA 4K0KQ 4IJHA 5GAGC 2B3GA 4DV0Q 4LFBL 4A3IG 4FDBA 1AE3A 2NN6G 1HZ9A 2V1CC 3CCEA 3U50C 2OQ0A 4LFAQ 4X66L 3ULJA 4A3LH 5H1SE 4DV3Q 4NXMQ 1WCMH 2WB1G 1UWVA 4DK6C 1KQSA 1I50H 3S2DH 4X6AH 1Y14B 3ZJYC 4BBRH 1BVSA 3PSIA 4A93G 2CWAA 1K73C 1IL2A 2JA8H 1NE3A 1HNWQ 4GLXA 4B3TQ 4A3CH 2K4KA 3CCJA 4DUYQ 1VQ6A 2H5XA 4HJ8A 1TXYA 3K7UC 3F2DA 2CFMA 2Y0SE 3L7ZC 4PZ8A 1YZ6A 3AYHB 5IP9H 2RCNA 5M5YH 4HIDA 4B3ML 2JE6I 4LF4Q 4POGA 2ASBA 4GKJQ 1GKHA 4PMWA 3RLNA 2AMCB 4HJAA 2AHOB 4LFBQ 3BZCA 5GQOA 3BJUA 4X66Q 2ZJRA 3S1RH 4R4QA 1LYLA 1YJ9A 1XPUA 3CMAA 4A3JH 1EQRA 4A3IH 1Z47A 4LUZA 3A5UA 4L5RC 3GTJH 2K75A 3UDIA 3CPWA 1LUZA 1HH2P 3JC66 4AQYL 3M3YH 5JJLA 1VQGA 4QY7A 1FGUA 4X62Q 2Z6KA 4IPCA 2ZTDA 1Q1EA 3NENA 4A75A 4LUVA 1Y1VG 3I56A 2N78A 1PH8A 2PI2E 1WYDA 4B3MQ 2GN5A 5BR8L 4ALPA 4A93H 1L2FA 3CAMA 1E3PA 2C35B 2ZJQA 1SRUA 4JBWA 4C2MH 1VQOA 2PMZE 5LMNL 4QL5A 1QVGA 5IYDG 4KI0A 1MJCA 3TS0A 3CXCA 3GTKH 4H02A 5M5WH 3FHWA 2CQOA 1NBWA 4XTCS 2UU9L 2RHQB 3M9BA 5IWAL 5FLXc 2QA4A 2IHFA 1KD1C 4B3RQ 5IY0A 3F2CA 4AQYQ 4LF5L 3PGZA 2UXCL 3PIOA 4JOIA 1H95A 3F2BA 2CCZA 5GROA 3KDFA 1W3SA 4QGUA 2PNHA 1S3OA 1YVCA 4DR1L 1IYJB 1X6OA 1VQ4A 2D62A 2Y0SG 5BR8Q 1X56A 3AFQA 1IXRA 1YEZA 2IT1A 4A3GH 4HIKA 4UY8C 1UEBA 3TRZA 1Y1VH 3I55A 2HHHL 1L1OB 1CUKA 2EQSA 5LMNQ 3RZDH 1N34L 5C44G 3U4ZA 2KCTA 3UDXA 4JI0L 2UU9Q 4YWLA 4P71A 3NELA 1QUQB 2K50A 4LUOA 4UP8A 5IWAQ 2UXCQ 1FJGQ 4IPGA 1J5EL 1VQAA 3G6EA 4LF9L 1I3QH 3SGIA 2R7ZH 4DR1Q 3KJPA 1EYGA 1JT8A 3GTQH 3HOYG 4LWCA 4LFCL 4YHHL 5DLQE 2D0OA 4WJ3M 4LF6L 1I6HH 1E1TA 1PYSB 4IFDG 1YI2A 1NMGA 4UP9A 5LMUL 3PUWA 4IFDJ 4BA2I 1KIXA 2HHHQ 3PCOB 2FXQA 3HKZG 4GNXA 1WFQA 4KHZA 1XNRQ 3VDYA 1N34Q 2AWOA 5C0XG 1XMQQ 2ATWA 1VQJA 2R7DA 2ZM6L 1YHAA 3PF5A 4LF8L 4GOPB 4JI0Q 1Q8KA 3PUVA 1AE2A 4JC0A 4RMFA 1TWHH 2Z0SA 4YCWA 1PH5A 3GTLH 3KYHC 3HOVG 4LF9Q 3J81c 1I94L 3TQYA 2I5HA 2JQOA 1L0WA 3CPFA 5AJ3L 2K5HA 4GN3B 1LM0A 4OO1I 2VQFQ 2PI2A 4LFCQ 4YHHQ 3PO2G 1Q7YC 1K83H 1OXTA 4JI3L 4LF6Q 3ER0A 5LMUQ 4JI8L 2I0QA 3PO3G 2E5LL 1KHIA 1YJWA 4NPSA 4YCUA 3HOYH 4Y52H 5FJ8G 4GLVB 5ELNA 1X3FA 5EAYA 2ZM6Q 3S16H 1RL2A 3JAMi 2BA0A 5J3BA 4JI5L 2KCMA 1MJEA 2EIFA 4A3BG 4A3MH 4EQ5A 4DUZL 1TWAH 3I4NG 4A4IA 1S40A 4A3EG 1K8AC 2WAQE 2JA7G 4LF7L 3RNUA 3BZKA 4KHPL 1I94Q 1EIFA 3NBHB 1VQPA 1M90C 5AJ3Q 4A3DH 1SLJA 1AH9A 4JBJA 3ULLA 4BBSH 2BH8A 3MXNB 3CC4A 1IBML 3HOVH 1SR3A 1SN8A 4JI3Q 4GKKL 1L1OC 3OYYA 2R93G 4JI8Q 3DLLA 3S15H 1G51A 3U4VA 4DNIA 2VQEL 5HGQA 1FVIA 3STBD 4DV4Q 3J81j 1YITA 2E5LQ 2E2JH 1VQ9A 3FP9A 4A3KG 3PO2H 4IJLA 2A8VA 3EIVA 2VW9A 1I5FA 1Q82C 1VQCA 2LSSA 2IHEA 3CCSA 5IYBH 3H3VH 3CCVA 2GVAA 4JI5Q 2B63G 1BKBA 1S72A 3S17H 1Y1WH 1SFOH 2JA6G 5FJ8H 4DUZQ 1XPOA 2JJQA 1YNXA 1Q1BA 1VQKA 4LF7Q 4KHPQ 1NTGA 3ULPA 2UXDL 2VS1A 3G4SA 1VQBA 2ZJPA 4Y7NH 2JEAI 4UP7A 4A3EH 2UUBL 1A0IA 1P8LA 1EIYB 1IBMQ 1NMFA 1C9OA 1KAWA 1XTDA 3HFZB 2A1AA 3E9HA 4YY3L 1N8RC 3RN5A 2VQEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDF B;  1WJJ A;  4JI1 L;  4JI6 L;  5C4X G;  3PUZ A;  3TEH B;  4GOP C;  2NN6 I;  1C0A A;  2PQA B;  4GS3 A;  1QZH A;  1GVP A;  2R93 H;  1V43 A;  2N3S A;  1E24 A;  3J80 i;  3KFU A;  4IPH A;  3CCM A;  1HZB A;  1UE5 A;  4DR2 L;  1SE8 A;  2N8N A;  1GD7 A;  4A3K H;  5IP7 G;  1SMX A;  4A3F G;  2K14 A;  3TRE A;  3KF8 B;  4C3J H;  1EQQ A;  4DV7 L;  1Q46 A;  5JJK A;  2UXD Q;  1VQD A;  2B63 H;  4AIM A;  5IYC G;  3J7Z C;  4KLK A;  3H15 A;  1OXS C;  2UUB Q;  1B7Y B;  3PUX A;  4MZ9 A;  3A74 A;  4BY1 G;  4YY3 Q;  3PF4 A;  3LGJ A;  3AFP A;  2KEN A;  4JI1 Q;  4JI6 Q;  3STB C;  3J7A 5;  3FKI G;  4OWT B;  2NVT H;  1G29 1;  2R92 G;  4BXX G;  2F3I A;  4PG3 A;  4NB3 A;  3CC2 A;  4DR4 L;  3MEF A;  4DV6 L;  4DV1 L;  2JA6 H;  5C4X H;  4DR2 Q;  1VQL A;  2UUA L;  4GNX B;  1PH2 A;  1VQF A;  1BBW A;  1X55 A;  2CKZ B;  4OXP A;  5GAH C;  4JCV E;  4DV7 Q;  2E2H H;  1UE6 A;  5M3F G;  4R4I A;  2YTY A;  2NVY H;  1EFW A;  2UUC L;  5IP7 H;  3K7A H;  4JBM A;  4A3F H;  1C7Y A;  5IYD H;  1PV4 A;  1WOC A;  4R1J A;  1LTL A;  4LF5 Q;  2KHI A;  3HOU G;  2I5L X;  2IX1 A;  5IYC H;  3I7F A;  2BA1 A;  3UDG A;  4TVA B;  1JMC A;  3HOW G;  1E1O A;  1EOV A;  1XMO L;  2QGQ A;  3D0F A;  1HR0 W;  3RR5 A;  3T1H L;  1N32 L;  4EX5 A;  4DR4 Q;  3A5Z B;  1CKM A;  4R4O A;  4DV6 Q;  3H0G G;  4DV1 Q;  2VZA A;  2HIX A;  1TWC H;  4R4C A;  1UE1 A;  4OO1 G;  1PH9 A;  2UUA Q;  1WI5 A;  1VQH A;  5IE8 A;  2R92 H;  4BXX H;  2K5V A;  3D31 A;  5C3E G;  2RF4 A;  3ERS X;  4AH6 A;  4APV A;  4DR3 L;  2ALY B;  2KHJ A;  5ELO A;  4YWM A;  2UUC Q;  1E22 A;  3CME A;  3F8T A;  1CKO A;  2DUD A;  5C44 H;  1J5E Q;  5M3F H;  4QJF A;  2NVX H;  3HOZ G;  1YIJ A;  1VQ7 A;  2VL6 A;  2MNA A;  3AQQ A;  4DAY B;  2K5N A;  1KC8 C;  1VQN A;  1XMO Q;  2BH2 A;  4BY7 G;  1IBL L;  3OW2 A;  3HOU H;  2WP8 J;  3PV0 A;  1N32 Q;  1PVO A;  3OTO L;  4JI2 L;  4HJ7 A;  1ASZ A;  1N33 L;  1L1O A;  3W1B A;  4HJ9 A;  1PH3 A;  3S1M H;  4MNO A;  1KRS A;  4L5T A;  1EUJ A;  3E0E A;  4GLA C;  4GN5 A;  3CP0 A;  4IOC A;  3H0G H;  2HT1 A;  2KBN A;  4LF8 Q;  2OTJ A;  1O7I A;  1QUQ A;  3S24 A;  1WCM G;  4DK3 C;  3I4O A;  3RLF A;  4X65 L;  2F52 A;  3W5O A;  4DPG A;  5GAD C;  4HIM A;  4IFD I;  4LW1 A;  3UE0 A;  4JI4 L;  1HJP A;  3GD7 A;  1M1K C;  2YYZ A;  4DV2 L;  2JEB I;  1IBL Q;  2R6G A;  5C0X I;  2B29 A;  5IP9 G;  3OTO Q;  3M7N A;  4GNX C;  3HOZ H;  2D0P A;  3EBE A;  2EXD A;  4GN4 B;  4QIW E;  4NXN L;  1HZC A;  1IBK L;  1N33 Q;  3IRB A;  2F4V L;  3GTG H;  4B3R L;  4JV5 L;  2ZTE A;  3GTM H;  4WJ4 A;  1D7Q A;  3T1Y L;  4BY7 H;  3PIP A;  5IT9 c;  1R9T H;  4GOP A;  5C4J H;  4XIG S;  1G6P A;  2L15 A;  4A3J G;  1PH1 A;  1PHJ A;  3GTO H;  1B70 B;  4DKA C;  3GDE A;  4R4T A;  3PO3 H;  3GO5 A;  4AYB E;  4X65 Q;  4B3S L;  3KOJ A;  3CCL A;  1GO3 E;  1P16 A;  1VQI A;  5HY6 A;  1YJN A;  3M4O H;  3Q8D A;  1OXU A;  2OQK A;  2OCE A;  2R7F A;  1VQ5 A;  3H3V I;  4JI4 Q;  4A3B H;  1A62 A;  3CC7 A;  1BBU A;  4HIO A;  4UPA A;  3I4N H;  3KF6 A;  4DV2 Q;  1YHB A;  2JA7 H;  4ME3 A;  1V9P A;  4O0A A;  4OWW B;  4X62 L;  4GKK Q;  4NXN Q;  1IBK Q;  2Q2I A;  4JV5 Q;  2LXJ A;  2YTX A;  1X9N A;  2MO0 A;  1PFS A;  2F4V Q;  1CKN A;  1OXV A;  3NEM A;  1E7Z A;  3T1Y Q;  1Z9F A;  3G48 A;  1X54 A;  1PA6 A;  1Q12 A;  4IPD A;  4PZ6 A;  4P74 A;  1GM5 A;  2JK8 A;  3CCQ A;  1XJV A;  4YCV A;  1K9M C;  1N36 L;  3CW2 C;  3J81 i;  4OON A;  4B3S Q;  2VUM G;  3BU2 A;  1PH7 A;  2VY3 A;  1XNQ L;  4MTN A;  1HNZ L;  3RZO H;  2WAQ G;  2NZO A;  2XGT A;  1XPR A;  4C3I H;  3E9I A;  4P75 A;  5LMN W;  1VQ8 A;  4HJ5 A;  4PZ7 A;  1YHQ A;  4JI7 L;  3EN2 A;  1KL9 A;  2RHS B;  3UDF A;  1JJC B;  1VQE A;  5M5X H;  4X64 L;  3CQZ H;  1HNX L;  1VCI A;  1N9W A;  4A3G G;  5FLM G;  2MO1 A;  5K36 G;  2E2I H;  2MQH A;  4JYA L;  1V1Q A;  2AKW B;  2OWO A;  4OX9 L;  3CF5 A;  3HKZ E;  1N36 Q;  3RN2 A;  3HKS A;  1XNQ Q;  4JG2 A;  4AYB G;  2K52 A;  1HNZ Q;  1CSQ A;  1EWI A;  3I2Z A;  1A8V A;  3S14 H;  3PUY A;  4LNQ A;  3RLO A;  1Q81 C;  2R7Z G;  4J15 A;  1T9H A;  1JE5 A;  1TWF H;  1CSP A;  2VUM H;  4C3H H;  3JAM c;  4A76 A;  4JI7 Q;  1FJG L;  2Z6K C;  3S1N H;  3B6Y A;  1VS0 A;  5M3M G;  4X64 Q;  1JJ2 A;  2DGY A;  1HNX Q;  1KRT A;  4DR7 L;  2E8G A;  3M85 A;  1OTC A;  4JBK A;  2PQA A;  2YV5 A;  2GVB A;  4JYA Q;  4L5S A;  4BY1 H;  3K80 C;  4OX9 Q;  1RIP A;  3KJO A;  3U58 A;  1QVC A;  5FLM H;  2Q2T A;  4DR6 L;  3AEV A;  3FKI H;  1XNR L;  3L2P A;  5JEA G;  2MFI A;  4TQU S;  5JEA J;  1XMQ L;  1ASY A;  1U5K A;  3S2H H;  3CCR A;  5E7N A;  3I4M G;  1X3E A;  2HIV A;  2A19 A;  1IZ6 A;  2LXK A;  3KLW A;  3ICE A;  1D8L A;  2AWN A;  2HQL A;  4JOI C;  1A63 A;  1SRO A;  3HOX G;  2CWP A;  4IOA A;  2QEX A;  1HR0 L;  4POF A;  2YU9 H;  1VQM A;  1MIU A;  2IY5 B;  2WB1 E;  1KXL A;  4DR7 Q;  1OXX K;  2VQF L;  1DGS A;  2NVQ H;  2ZTC A;  1QVF A;  1YBY A;  1K8G A;  2NZH A;  4O2D A;  3F1Z A;  3T1H Q;  4L5Q A;  5M3M H;  1W2B A;  1X65 A;  4YWK A;  3UE1 A;  4DV5 L;  2JA5 G;  4DR6 Q;  2UXB L;  2N49 A;  2ID0 A;  2WFW A;  2OTL A;  3DM3 A;  1X3G A;  3HOW H;  3L0O A;  1HZA A;  4A3M G;  1FL0 A;  3GTP H;  1JB7 A;  5C0X J;  2IX0 A;  4DR5 L;  4OWX B;  1K0R A;  5GAE C;  1K3R A;  4DR3 Q;  4A3L G;  4A3D G;  4K0K L;  2ES2 A;  4DV0 L;  1Q86 C;  3S1Q H;  4BBS G;  3J80 c;  5C3E H;  3CCU A;  3I4M H;  1U0L A;  4BBR G;  4LFA L;  1B8A A;  1HR0 Q;  3M4P A;  1PH6 A;  2JA8 G;  4IO9 A;  4DV3 L;  4A3C G;  4NXM L;  3CD6 A;  3K81 C;  3M4Q A;  1QZG A;  3A0J A;  3KF6 B;  3HOX H;  1UE7 A;  5JJI A;  1JJG A;  2XTI A;  3K0X A;  4P72 A;  4DV5 Q;  4QQB X;  5IYB G;  2Q2U A;  2UXB Q;  1HNW L;  3K8A A;  4P73 A;  4JI2 Q;  4DV4 L;  1NJI C;  4B3T L;  4DUY L;  1NY4 A;  1Y1W G;  3WWV A;  1CKN B;  3TS2 A;  2VNU D;  2I5M X;  2Q2H A;  4RG1 A;  4DR5 Q;  1PH4 A;  2JA5 H;  1J6Q A;  1MKH A;  2JA9 A;  2YTV A;  4LF4 L;  1PYB A;  4BA1 I;  4DAM A;  4GKJ L;  3G71 A;  1TWG H;  3W1G A;  4K0K Q;  4IJH A;  5GAG C;  2B3G A;  4DV0 Q;  4LFB L;  4A3I G;  4FDB A;  1AE3 A;  2NN6 G;  1HZ9 A;  2V1C C;  3CCE A;  3U50 C;  2OQ0 A;  4LFA Q;  4X66 L;  3ULJ A;  4A3L H;  5H1S E;  4DV3 Q;  4NXM Q;  1WCM H;  2WB1 G;  1UWV A;  4DK6 C;  1KQS A;  1I50 H;  3S2D H;  4X6A H;  1Y14 B;  3ZJY C;  4BBR H;  1BVS A;  3PSI A;  4A93 G;  2CWA A;  1K73 C;  1IL2 A;  2JA8 H;  1NE3 A;  1HNW Q;  4GLX A;  4B3T Q;  4A3C H;  2K4K A;  3CCJ A;  4DUY Q;  1VQ6 A;  2H5X A;  4HJ8 A;  1TXY A;  3K7U C;  3F2D A;  2CFM A;  2Y0S E;  3L7Z C;  4PZ8 A;  1YZ6 A;  3AYH B;  5IP9 H;  2RCN A;  5M5Y H;  4HID A;  4B3M L;  2JE6 I;  4LF4 Q;  4POG A;  2ASB A;  4GKJ Q;  1GKH A;  4PMW A;  3RLN A;  2AMC B;  4HJA A;  2AHO B;  4LFB Q;  3BZC A;  5GQO A;  3BJU A;  4X66 Q;  2ZJR A;  3S1R H;  4R4Q A;  1LYL A;  1YJ9 A;  1XPU A;  3CMA A;  4A3J H;  1EQR A;  4A3I H;  1Z47 A;  4LUZ A;  3A5U A;  4L5R C;  3GTJ H;  2K75 A;  3UDI A;  3CPW A;  1LUZ A;  1HH2 P;  3JC6 6;  4AQY L;  3M3Y H;  5JJL A;  1VQG A;  4QY7 A;  1FGU A;  4X62 Q;  2Z6K A;  4IPC A;  2ZTD A;  1Q1E A;  3NEN A;  4A75 A;  4LUV A;  1Y1V G;  3I56 A;  2N78 A;  1PH8 A;  2PI2 E;  1WYD A;  4B3M Q;  2GN5 A;  5BR8 L;  4ALP A;  4A93 H;  1L2F A;  3CAM A;  1E3P A;  2C35 B;  2ZJQ A;  1SRU A;  4JBW A;  4C2M H;  1VQO A;  2PMZ E;  5LMN L;  4QL5 A;  1QVG A;  5IYD G;  4KI0 A;  1MJC A;  3TS0 A;  3CXC A;  3GTK H;  4H02 A;  5M5W H;  3FHW A;  2CQO A;  1NBW A;  4XTC S;  2UU9 L;  2RHQ B;  3M9B A;  5IWA L;  5FLX c;  2QA4 A;  2IHF A;  1KD1 C;  4B3R Q;  5IY0 A;  3F2C A;  4AQY Q;  4LF5 L;  3PGZ A;  2UXC L;  3PIO A;  4JOI A;  1H95 A;  3F2B A;  2CCZ A;  5GRO A;  3KDF A;  1W3S A;  4QGU A;  2PNH A;  1S3O A;  1YVC A;  4DR1 L;  1IYJ B;  1X6O A;  1VQ4 A;  2D62 A;  2Y0S G;  5BR8 Q;  1X56 A;  3AFQ A;  1IXR A;  1YEZ A;  2IT1 A;  4A3G H;  4HIK A;  4UY8 C;  1UEB A;  3TRZ A;  1Y1V H;  3I55 A;  2HHH L;  1L1O B;  1CUK A;  2EQS A;  5LMN Q;  3RZD H;  1N34 L;  5C44 G;  3U4Z A;  2KCT A;  3UDX A;  4JI0 L;  2UU9 Q;  4YWL A;  4P71 A;  3NEL A;  1QUQ B;  2K50 A;  4LUO A;  4UP8 A;  5IWA Q;  2UXC Q;  1FJG Q;  4IPG A;  1J5E L;  1VQA A;  3G6E A;  4LF9 L;  1I3Q H;  3SGI A;  2R7Z H;  4DR1 Q;  3KJP A;  1EYG A;  1JT8 A;  3GTQ H;  3HOY G;  4LWC A;  4LFC L;  4YHH L;  5DLQ E;  2D0O A;  4WJ3 M;  4LF6 L;  1I6H H;  1E1T A;  1PYS B;  4IFD G;  1YI2 A;  1NMG A;  4UP9 A;  5LMU L;  3PUW A;  4IFD J;  4BA2 I;  1KIX A;  2HHH Q;  3PCO B;  2FXQ A;  3HKZ G;  4GNX A;  1WFQ A;  4KHZ A;  1XNR Q;  3VDY A;  1N34 Q;  2AWO A;  5C0X G;  1XMQ Q;  2ATW A;  1VQJ A;  2R7D A;  2ZM6 L;  1YHA A;  3PF5 A;  4LF8 L;  4GOP B;  4JI0 Q;  1Q8K A;  3PUV A;  1AE2 A;  4JC0 A;  4RMF A;  1TWH H;  2Z0S A;  4YCW A;  1PH5 A;  3GTL H;  3KYH C;  3HOV G;  4LF9 Q;  3J81 c;  1I94 L;  3TQY A;  2I5H A;  2JQO A;  1L0W A;  3CPF A;  5AJ3 L;  2K5H A;  4GN3 B;  1LM0 A;  4OO1 I;  2VQF Q;  2PI2 A;  4LFC Q;  4YHH Q;  3PO2 G;  1Q7Y C;  1K83 H;  1OXT A;  4JI3 L;  4LF6 Q;  3ER0 A;  5LMU Q;  4JI8 L;  2I0Q A;  3PO3 G;  2E5L L;  1KHI A;  1YJW A;  4NPS A;  4YCU A;  3HOY H;  4Y52 H;  5FJ8 G;  4GLV B;  5ELN A;  1X3F A;  5EAY A;  2ZM6 Q;  3S16 H;  1RL2 A;  3JAM i;  2BA0 A;  5J3B A;  4JI5 L;  2KCM A;  1MJE A;  2EIF A;  4A3B G;  4A3M H;  4EQ5 A;  4DUZ L;  1TWA H;  3I4N G;  4A4I A;  1S40 A;  4A3E G;  1K8A C;  2WAQ E;  2JA7 G;  4LF7 L;  3RNU A;  3BZK A;  4KHP L;  1I94 Q;  1EIF A;  3NBH B;  1VQP A;  1M90 C;  5AJ3 Q;  4A3D H;  1SLJ A;  1AH9 A;  4JBJ A;  3ULL A;  4BBS H;  2BH8 A;  3MXN B;  3CC4 A;  1IBM L;  3HOV H;  1SR3 A;  1SN8 A;  4JI3 Q;  4GKK L;  1L1O C;  3OYY A;  2R93 G;  4JI8 Q;  3DLL A;  3S15 H;  1G51 A;  3U4V A;  4DNI A;  2VQE L;  5HGQ A;  1FVI A;  3STB D;  4DV4 Q;  3J81 j;  1YIT A;  2E5L Q;  2E2J H;  1VQ9 A;  3FP9 A;  4A3K G;  3PO2 H;  4IJL A;  2A8V A;  3EIV A;  2VW9 A;  1I5F A;  1Q82 C;  1VQC A;  2LSS A;  2IHE A;  3CCS A;  5IYB H;  3H3V H;  3CCV A;  2GVA A;  4JI5 Q;  2B63 G;  1BKB A;  1S72 A;  3S17 H;  1Y1W H;  1SFO H;  2JA6 G;  5FJ8 H;  4DUZ Q;  1XPO A;  2JJQ A;  1YNX A;  1Q1B A;  1VQK A;  4LF7 Q;  4KHP Q;  1NTG A;  3ULP A;  2UXD L;  2VS1 A;  3G4S A;  1VQB A;  2ZJP A;  4Y7N H;  2JEA I;  4UP7 A;  4A3E H;  2UUB L;  1A0I A;  1P8L A;  1EIY B;  1IBM Q;  1NMF A;  1C9O A;  1KAW A;  1XTD A;  3HFZ B;  2A1A A;  3E9H A;  4YY3 L;  1N8R C;  3RN5 A;  2VQE Q; 
#chains in the Genus database with same CATH topology
 1JC7 A;  3Q24 A;  4JI6 L;  3A7A B;  3PUZ A;  4FF1 A;  1QE6 A;  2ZXP A;  1JWS D;  1C0A A;  4GS3 A;  2KHS A;  2RDG A;  1ZEQ X;  1V43 A;  1E24 A;  3J80 i;  4CDC C;  3KFU A;  2NZ1 D;  4IPH A;  1HZB A;  4A3F B;  1GD7 A;  4CKE A;  5IIF A;  4C3J H;  1EQQ A;  5JJK A;  2MPM A;  4DGZ A;  2RBM A;  4KLK A;  3H15 A;  2UUB Q;  3GTQ B;  2K28 A;  4BY1 G;  1KDB A;  2H4O A;  3AFP A;  2KEN A;  4JI1 Q;  2R92 B;  3K5N A;  4OWT B;  2NVT H;  3NSW A;  1GUG A;  2F3I A;  4DV1 L;  2A5H A;  2UUA L;  3MXP A;  2PW5 A;  2CKZ B;  4KKT A;  3BDL A;  5M3F G;  3J80 E;  1SNQ A;  1TVX A;  2EDG A;  3ERO A;  4R4I A;  2NVY H;  4KY5 A;  2UUC L;  1SE2 A;  2A69 D;  2EYJ A;  4KN7 C;  4R1J A;  1UNS A;  2I5L X;  4HMJ A;  4O42 A;  2PPB C;  1BQQ T;  4KMU C;  1JMC A;  1A6X A;  1UUP A;  1E1O A;  5G3L D;  1LT4 D;  1BDO A;  1AN8 A;  4DR4 Q;  1D5M C;  4R4O A;  4DV6 Q;  3HS0 C;  4KD3 A;  2PNR C;  1EU3 A;  1TWC H;  2HIX A;  1ZXT A;  4RHR A;  2J0T D;  3V96 A;  4OO1 G;  1GJX A;  1VQH A;  4G57 A;  4APV A;  2ALY B;  4I7Z C;  3I8Z A;  1E22 A;  1D6E C;  1FNW A;  1HHV A;  5C3X A;  4NKL A;  1T5E A;  5M3F H;  1HFG A;  2NVX H;  3HOZ G;  1H9R A;  2VL6 A;  1KC8 C;  1SYC A;  1STB A;  1TY2 A;  3NQI A;  2E2J B;  1XMO Q;  4FXG C;  1R9T B;  4BY7 G;  1IBL L;  3OW2 A;  4HMI A;  4RKB A;  1PH3 A;  4HJ9 A;  2L9H A;  3M4O B;  4GN5 A;  3CP0 A;  2HCC A;  1O7I A;  4MN3 A;  1STN A;  4M8A A;  3DHQ A;  2CHB D;  1LTS D;  3RLF A;  2F52 A;  3W5O A;  4DPG A;  2A69 C;  4HIM A;  4LAA A;  1M1K C;  1NR4 A;  1SNM A;  2JEB I;  5C0X I;  2B29 A;  2R93 B;  3M7N A;  4GNX C;  3HOZ H;  1CT1 D;  2EXD A;  1N33 Q;  1NSN S;  4JV5 L;  4WJ4 A;  1D7Q A;  2ZTE A;  4BY7 H;  1DM0 B;  5T1G A;  1JB3 A;  3VYR A;  3PIP A;  4GOP A;  5KND A;  4R4T A;  1TKW B;  4AYB E;  4X65 Q;  3NK9 A;  5ELF A;  1VQI A;  5HY6 A;  3Q8D A;  1OXU A;  1A15 A;  2OQK A;  4A3B H;  4C56 C;  4DV2 Q;  1PXU A;  3DEP A;  1BCP F;  4ME3 A;  2B8F A;  3DMU A;  4RHS A;  2F4V Q;  1PFS A;  1OXV A;  2PYK A;  2EY2 A;  5I2X A;  1Z9F A;  3URY A;  3G48 A;  1Q12 A;  1QJO A;  1W6K A;  1GM5 A;  2JK8 A;  3OHX C;  3CCQ A;  1N36 L;  4MIU A;  3BS1 A;  3J81 i;  4MHE A;  1WD0 A;  2VUM G;  2WAQ G;  2WKC A;  4JI7 L;  2RHS B;  4CHT B;  1SSO A;  1TY0 A;  1VQE A;  2VXW A;  2K1B A;  3FKI B;  1GOZ A;  2MO1 A;  2WKD A;  1KAA A;  4OX9 L;  2D2C C;  1TS5 A;  3TME A;  3HKS A;  1F9R A;  4HCE A;  5KYL A;  4ABN A;  1CSQ A;  3S14 H;  1A8V A;  4LNQ A;  3RLO A;  3GQB A;  3TP5 A;  5KGU A;  2NVQ B;  1T9H A;  3J81 E;  1ML0 D;  1CSP A;  1TWF H;  2VUM H;  3JAM c;  1FJG L;  1HQR D;  4NW2 A;  1LT3 D;  3VYT A;  1STH A;  5LL6 S;  4X64 Q;  1HNX Q;  2E8G A;  2RVL A;  3M85 A;  2KCC A;  2F03 A;  2GVB A;  1DOK A;  4JYA Q;  4FNF A;  5EGT A;  4DR6 L;  3GV6 A;  2EJF C;  1QVC A;  3ZYY X;  4C1N K;  3QJY A;  1XMQ L;  4XT3 B;  1JR0 D;  3R2I A;  4HED A;  4QUF A;  3ICE A;  4S3S A;  4KTA A;  2E74 C;  2F0Q A;  4RH6 A;  1B4O A;  1H9M A;  1HR0 L;  1F2Y A;  3D6W A;  4DR7 Q;  3OMG A;  4NMZ A;  1YBY A;  3D4D A;  4O2D A;  1O80 A;  3T1H Q;  5JVH 3;  2K5W A;  2UXB L;  2ID0 A;  1IW7 D;  1J9O A;  3L0O A;  3VR5 A;  1HZA A;  4DNT B;  4A3M G;  3HOW H;  4DFA A;  4OWX B;  2SDF A;  4DR3 Q;  4A3D G;  1WCM B;  2ES2 A;  5COR A;  1ONL A;  1U0L A;  1DOL A;  4BBR G;  3VR3 A;  4DV3 L;  4A3C G;  4I65 A;  4NXM L;  3CD6 A;  4DK1 A;  3A0J A;  1UE7 A;  5M5Y B;  2RKS A;  5JJI A;  1MBY A;  2XTI A;  3K0X A;  2L4N A;  1HNW L;  3K8A A;  4DV4 L;  4B3T L;  1AP0 A;  3IAY A;  1CKN B;  4OEL B;  2Q2H A;  1PH4 A;  4BA1 I;  3O13 A;  2KA7 A;  4G7O C;  1F9Q A;  2B3G A;  3MFG A;  1PZJ D;  3SR1 A;  3GTJ B;  1C8C A;  1HZ9 A;  4RCO A;  1ILP A;  4ULL A;  1SYF A;  2A6H D;  4BBR H;  5EPJ A;  1BVS A;  3K0Y A;  3KLS A;  2EYF A;  4A3C H;  3KUP A;  3CCJ A;  4DUY Q;  1VQ6 A;  1IW7 C;  3I90 A;  1TXY A;  3F2D A;  4BS9 A;  4PZ8 A;  3L7Z C;  2EYO A;  1JQY D;  1M4V A;  2B2W C;  2NWG A;  2BCO A;  2RCN A;  3DM1 A;  4LF4 Q;  2ASB A;  1B9N A;  4DXG A;  2EPB A;  1ESF A;  3TZU A;  4HJA A;  4WFN 3;  4LFB Q;  4DN4 M;  2ZJR A;  3BJU A;  3S1R H;  3JAM E;  1YJ9 A;  3NBH A;  4A3J H;  3A8J E;  3A5U A;  2K75 A;  3UDI A;  1HH2 P;  3JC6 6;  3C2P A;  1SND A;  1VQG A;  4LK1 C;  1CA5 A;  3C3L A;  1FGU A;  4IPC A;  3T4A C;  3QO2 A;  4KY7 A;  1LAB A;  4LUV A;  3I56 A;  1PH8 A;  5EKI A;  1WYD A;  2C35 B;  3OW7 A;  4JPB W;  4YIJ A;  2LKV A;  4JBW A;  2JYO A;  3DUZ A;  2L11 A;  1QWY A;  2YU9 B;  3CXC A;  5M5W H;  3FHW A;  3X3M A;  3QIA A;  2IHF A;  2A6H C;  4AQY Q;  2KEC A;  5CBA E;  3TP8 A;  3F2B A;  2F0V A;  3KDF A;  4IQZ A;  3MFY A;  3HG9 A;  2DNE A;  5KNB A;  3IL8 A;  1UEA B;  5IT9 L;  4R8I A;  3I55 A;  2HHH L;  4L63 B;  3GTL B;  3KF8 A;  1SNC A;  3BVG A;  3I91 A;  3UDX A;  3MAQ A;  4ZCK A;  5EBD A;  1QUQ B;  3HOX B;  2UXC Q;  2Z4H A;  3N52 A;  1AFP A;  4FF3 A;  1ENC A;  3G6E A;  2XNA C;  1IYV A;  1ILQ A;  1BUV T;  4ODG A;  5FOB B;  1EYG A;  1JT8 A;  4LWC A;  4NDX A;  2JA5 B;  2D0O A;  1I6H H;  1YI2 A;  4BA2 I;  2TSS A;  1AZQ A;  2FXQ A;  4GNX A;  1XNR Q;  2O5J C;  3OMC A;  4ID6 A;  2ZM6 L;  1YHA A;  4IAL A;  4OHJ A;  4ZKB B;  3HOV B;  1Q8I A;  1TWH H;  3I72 A;  4LF9 Q;  3Q22 A;  4F8M A;  1L0W A;  4GN3 B;  2VQF Q;  1QIL A;  2PI2 A;  4PMC A;  4LFC Q;  2D5D A;  4JI3 L;  4P2C B;  2FMM A;  4YCU A;  1XYI A;  4ZAI A;  5FJ8 G;  4GLV B;  1X3F A;  2K05 A;  3TSS A;  1CHQ D;  2KCM A;  1WD1 A;  5DNF A;  5EKL A;  3I4N G;  1S40 A;  4A3E G;  4HR7 B;  5A35 A;  4DAY A;  1AH9 A;  1SLJ A;  4JBJ A;  4BBS H;  1LT5 D;  1SR3 A;  4JI8 Q;  3S15 H;  3U4V A;  4F7X A;  5HGQ A;  1FVI A;  3H94 A;  4V19 0;  3FP9 A;  5EPL A;  4C3J B;  4IJL A;  4OL7 A;  2Q8R E;  3GTK B;  4JI5 Q;  1BKB A;  1Y1W H;  1SFO H;  1PTO H;  2NUC A;  4L6T B;  5FJ8 H;  1XPO A;  1NTG A;  3ULP A;  3PMF A;  2UXD L;  5JOB A;  2NVT B;  4UP7 A;  4A3E H;  5JAV A;  1IBM Q;  1NMF A;  1XTD A;  3ONA B;  4KN4 C;  4YY3 L;  1GUT A;  1WJJ A;  2F0N A;  5C4X G;  3TEH B;  1D5Z C;  4GOP C;  1EIG A;  4UHV A;  2F0H A;  1WVL A;  1QZH A;  5J1Z A;  1R4Q B;  2IX3 A;  5LHY 1;  3I3C A;  3CCM A;  1UE5 A;  2SEB D;  1LLR D;  5CV9 A;  2K14 A;  1NAP A;  1Q46 A;  2CH4 A;  1PDQ A;  3J7Z C;  3H3V C;  1YNJ D;  2XWJ B;  3PUX A;  5IGB A;  4MZ9 A;  4U68 A;  3SK6 A;  4LMQ D;  3A74 A;  1VMP A;  3LGJ A;  3P1H A;  1AEX A;  5D3D A;  4Z9C B;  3FMC A;  4ME5 A;  4PG3 A;  1LAC A;  5E1F A;  1LTR D;  2F0K A;  5C4X H;  2F3V A;  4DR2 Q;  1VQL A;  1VQF A;  5M3F B;  4OXP A;  4DV7 Q;  2E2H H;  2NVX B;  1UE6 A;  4JVZ A;  1GXD C;  1O7Y A;  4JBM A;  3K7A H;  1C7Y A;  5CMD A;  1PV4 A;  1LTL A;  4ILW A;  3R93 A;  3HOU G;  3I7F A;  2BA1 A;  4G4K A;  3UDG A;  4IUN A;  2WIN B;  3HOY B;  3BVZ A;  2PQE A;  3BDO A;  3T1H L;  1VF7 A;  3A5Z B;  1EYD A;  1V1P B;  4JW0 A;  1HA6 A;  4R4C A;  2K01 A;  1PH9 A;  2K5V A;  5C3E G;  2RF4 A;  3ERS X;  4F87 A;  4N8X 1;  4DR3 L;  5CV6 A;  3OOC A;  3CME A;  1MSG A;  3HP3 A;  5ELE A;  5C5L A;  3F8T A;  1YNJ C;  5C44 H;  3HOZ B;  1J5E Q;  4QJF A;  5T1I A;  1VQ7 A;  3D4R A;  3HZX A;  4BY7 B;  3PO2 B;  2BH2 A;  1N32 Q;  3HOU H;  1PVO A;  2MJ8 A;  3OTO L;  1GUS A;  2FIN B;  4HJ7 A;  1ASZ A;  1CA6 A;  3K5L A;  1XTC D;  1D1I A;  2F0M A;  1KRS A;  4IOC A;  1EOT A;  5IGD A;  4A3B B;  2HT1 A;  2F0O A;  1QUQ A;  1GHJ A;  4DK3 C;  4OGQ C;  1KDA A;  1II3 A;  2ZXO A;  2L55 A;  1LTB D;  4HAE A;  4IFD I;  4LW1 A;  3UE0 A;  3GD7 A;  5IOD A;  4N8F A;  1QG7 A;  2H1E A;  1PFM A;  3A8I E;  4HTH A;  5IP9 G;  2VB3 X;  1HTL D;  4NXN L;  1IBK L;  1HZC A;  3IRB A;  1H9J A;  2M9V A;  5A2Q L;  3T1Y L;  2O5I C;  1D2B A;  5C4J H;  1G6P A;  2L15 A;  1PH1 A;  2XIW A;  3GTO H;  1B70 B;  3PO3 H;  3FVQ A;  4J8Q A;  1GO3 E;  3VYS A;  1YJN A;  5FLX E;  1TII D;  4JI4 Q;  3H3V I;  3T56 B;  1HCZ A;  3CC7 A;  1BBU A;  4HIO A;  4UPA A;  4XYO A;  3KF6 A;  2KJX A;  2JA7 H;  1DXM A;  4XQJ A;  4O0A A;  2JA6 B;  5DEH A;  4B3R Q;  1E7Z A;  4IUT A;  4E6I A;  1X54 A;  1PMR A;  1EYA A;  1PA6 A;  3S14 B;  2CVR A;  2I07 B;  3C1F A;  5CV5 A;  1TWF B;  2VUM B;  4B3S Q;  3BU2 A;  1U4M A;  1PH7 A;  2WAQ B;  4MTN A;  4C3H G;  3RZO H;  2J7Z A;  5CV4 A;  1FGB D;  3E6Z X;  3QB3 A;  1VQ8 A;  5JVG 3;  3DWP A;  4PZ7 A;  4HJ5 A;  2KVM A;  3EN2 A;  1YHQ A;  2SOB A;  3H6M A;  1TQO A;  1JJC B;  4H44 C;  1GUO A;  4A3G G;  1ESR A;  2MQH A;  1S5D D;  1V1Q A;  2AKW B;  2PZT A;  4RAU C;  3CF5 A;  2F0T A;  3NTK A;  4IUV A;  5NUC A;  4N9P A;  2DY8 A;  1B53 A;  1XNQ Q;  4JG2 A;  2K52 A;  1HNZ Q;  1EWI A;  1D5X C;  2WV6 D;  3I2Z A;  3VR6 A;  1Q81 C;  2R7Z G;  4J15 A;  1S5C D;  4C3H H;  4FP5 D;  1RCV D;  3S1N H;  3G6J B;  1JJ2 A;  2DGY A;  3HOW B;  2RDF A;  2LS0 1;  2OF1 A;  2EOT A;  4BY1 H;  2F4I A;  3K80 C;  1RIP A;  1DON A;  1XNR L;  2MFI A;  4TQU S;  1U5K A;  5E7N A;  3I4M G;  2HIV A;  4J1M A;  1PZI D;  2HQL A;  3GP7 A;  4Q0F A;  1E0B A;  1SRO A;  1SYD A;  1MGS A;  1A3V A;  5FO8 B;  3CRK C;  3GTG B;  1Z7T A;  3GTM B;  2VQF L;  1DGS A;  1SJH D;  1K8G A;  4L5Q A;  2DJG C;  1X65 A;  4K8I A;  4DV5 L;  3MC0 B;  1FNU A;  1X3G A;  4RGN A;  3MZ5 A;  1G6Z A;  1FL0 A;  5ELD A;  1TS4 A;  1K0R A;  1CM9 A;  1BNZ A;  5GAE C;  4K6D A;  4K0K L;  1I4H A;  2X6G A;  4OO1 H;  4EVO A;  4BBR B;  3I4M H;  4LFA L;  1H9K A;  3A54 A;  3M4P A;  3SK4 A;  2JA8 G;  3M4Q A;  1EWH A;  1BR9 A;  4P72 A;  4RKL A;  4QQB X;  5CBE E;  5IYB G;  5ISR A;  4OIJ A;  3SDZ A;  2G5D A;  2A73 B;  3WWV A;  3TS2 A;  3LNN A;  1GHK A;  2I5M X;  4RG1 A;  4DR5 Q;  4A3J B;  4GKJ L;  4DAM A;  3G71 A;  2ZXR A;  2A74 C;  4K2L A;  5GAG C;  4DV0 Q;  1NNX A;  1CK1 A;  4A3I G;  4FDB A;  2X6L A;  4X66 L;  1CQF A;  3ULJ A;  3CQZ B;  5L37 A;  4V0B A;  5H1S E;  1I4G A;  2WB1 G;  1UWV A;  5AFW A;  3S2D H;  4X6A H;  2E2I B;  1HA5 A;  3PSI A;  4DA2 A;  4CDD C;  2CWA A;  4A93 G;  2B2V A;  2JA8 H;  1NE3 A;  2H5X A;  3C46 A;  4DK0 A;  3AYH B;  4B3M L;  5KEE A;  3PIP 3;  2AMC B;  3RMH A;  3K58 A;  2KQ3 A;  4J6H A;  5GQO A;  2PCF B;  3SK8 A;  1I4X A;  4A3I H;  2Z6B A;  3CPW A;  3VYU A;  3M3Y H;  4EQN A;  1X32 A;  5JJL A;  1U4P A;  2Z6K A;  4FXD A;  2NTT A;  2ZTD A;  5KNC A;  2PI2 E;  4A93 H;  5E4X A;  3CU7 A;  2ZJQ A;  3VA5 A;  1VQO A;  4AYB B;  2PMZ E;  4QL5 A;  1QVG A;  5IYD G;  3TS0 A;  4R9W A;  2CQO A;  1NBW A;  2UU9 L;  2XRS D;  1O78 A;  1IKM A;  1SEB D;  3F2C A;  1I6H B;  3PGZ A;  4O1N A;  5M3M B;  4JOI A;  2F0E A;  3K57 A;  5GRO A;  2K5D A;  1W3S A;  3KBX A;  1X6O A;  2D62 A;  2Y0S G;  5BR8 Q;  1B3Q A;  1IXR A;  4ZYS A;  2IT1 A;  5CR3 A;  3T53 B;  2KUM A;  3TRZ A;  2EYP A;  1L1O B;  1CHP D;  2B2U C;  1TWH B;  5LMN Q;  2GA4 B;  4KKS A;  1N34 L;  1QNU A;  3U4Z A;  2KCT A;  2MGS A;  4JI0 L;  4YWL A;  4P71 A;  4UP8 A;  2K50 A;  5IWA Q;  4TSS A;  3K5O A;  2LY7 A;  5FKA C;  4IPG A;  1J5E L;  3A55 A;  1VQA A;  1I3Q H;  3SGI A;  1PRT B;  3V2T A;  4DR1 Q;  1QCB D;  1K8O A;  3GTQ H;  4KHV A;  1A3U A;  5E4W C;  3J7A F;  4ZK9 B;  3MXU A;  3VA7 A;  1K8M A;  4IFD J;  3NXW A;  4IZ8 A;  1TT2 A;  3CKI B;  3PCO B;  3NBI A;  4QF4 A;  3VDY A;  5C0X G;  2ATW A;  4FYD A;  4DAP A;  1VQJ A;  1F9S A;  1EWC A;  3PF5 A;  3J7A V;  1Q8K A;  2DNC A;  4BBS B;  5TSS A;  4G7H C;  3PUV A;  2ICE C;  1AE2 A;  1MHW C;  1PH5 A;  2Z0S A;  3KYH C;  1EZ8 A;  3S15 B;  2WII B;  3TQY A;  5AJ3 L;  3CPF A;  4CKC A;  1JIC A;  1OO9 B;  4YHH Q;  4B08 A;  2BDN A;  1OXT A;  1Q7Y C;  4LF6 Q;  3NQT A;  3ER0 A;  5LMU Q;  1Y1W B;  1PTO B;  2E5L L;  1KHI A;  1YJW A;  2HCI A;  4NPS A;  5ELN A;  1A2U A;  2F0D A;  3EFX D;  3JAM i;  2HUG A;  2EY1 A;  5J3B A;  1MJE A;  3QOJ A;  4EQ5 A;  4A3M H;  4DUZ L;  4A4I A;  5C0X H;  5LL6 X;  2F0L A;  3AU7 A;  3ITP A;  3RNU A;  4KHP L;  1I94 Q;  3NE5 B;  1VQP A;  4A3D H;  4R8N A;  1F77 A;  2LMC B;  4ZRZ A;  4IUQ A;  3MXN B;  3CC4 A;  1SN8 A;  3OYY A;  2IL8 A;  2R93 G;  2VQE L;  1YIT A;  3MEH A;  2E2J H;  4A3K G;  2JN4 A;  3EIV A;  1JCK B;  1I5F A;  1VQC A;  1Q82 C;  2K03 A;  5J39 A;  5COY A;  1CZW A;  2B39 A;  3S17 H;  1STE A;  2X69 A;  4LF7 Q;  3D8G A;  2AUJ D;  3OWF A;  1PFB A;  1VQB A;  1JOO A;  2JEA I;  1I4R A;  2UUB L;  1SYG A;  1C9O A;  2A1A A;  1N8R C;  3RN5 A;  1A2T A;  3TP7 A;  5C4X B;  4JI1 L;  1Y1V B;  2QW7 A;  1KLU D;  2NN6 I;  5DM6 3;  2PQA B;  2R93 H;  1GVP A;  2QIL A;  1FYC A;  2SNM A;  4H13 C;  2CW0 D;  4HCS A;  3K7A B;  1SE8 A;  2N8N A;  4K2K A;  4A3K H;  5IP7 G;  1SMX A;  1SJE D;  1HQM C;  2WAC A;  2K33 A;  1G91 A;  1VQD A;  5IYC G;  4CDE C;  1OXS C;  1X3P A;  4KK7 A;  3PF4 A;  4JI6 Q;  1B1Z A;  3J7A 5;  3FKI G;  1ICF B;  4BXX G;  3KLR A;  3CC2 A;  4DR4 L;  4G7Z C;  3MEF A;  1LV9 A;  4DV6 L;  3DWQ A;  1LTT D;  2E75 C;  2CQA A;  2VB2 X;  1PH2 A;  3V05 A;  5C44 B;  1WTV A;  1BBW A;  1X55 A;  5EQ0 A;  5GAH C;  1EIH A;  4JCV E;  1JWU D;  2YTY A;  4CBV A;  5IP7 H;  3EVQ A;  5C3W A;  3HOU B;  3K5M A;  2TMP A;  4LF5 Q;  2IX1 A;  1WTR A;  1B3A A;  5IYC H;  4TVA B;  1ZYR D;  1XMO L;  2L1B A;  3D0F A;  1EFI D;  3RR5 A;  4EX5 A;  3LX0 A;  1CKM A;  4DU9 A;  3H0G G;  4DV1 Q;  1AW7 A;  2VZA A;  2CW0 C;  1UE1 A;  1D1K A;  2UUA Q;  5IE8 A;  4BXX H;  1LTG D;  3D31 A;  3FEW X;  2JSO A;  4AH6 A;  5I2Y A;  5CC4 A;  2UUC Q;  2Z4I A;  2DN8 A;  3P20 A;  1CI3 M;  2MNA A;  4QCL A;  1VQN A;  2K5Q A;  1SNP A;  3AMU A;  1NUC A;  1STY A;  4IN3 A;  3PO3 B;  1N33 L;  5D65 A;  1L1O A;  1PTO F;  3S1M H;  4MNO A;  1C48 A;  1EUJ A;  2NYZ D;  5I6W A;  3H0G H;  5EBC A;  2KBN A;  3U9S A;  1WCM G;  3R2T A;  3OWE B;  2HDL A;  2JA7 B;  4X65 L;  2QKI C;  4K8J A;  5IGF A;  4X3K A;  3R8B A;  3KK7 A;  1HJP A;  1LT6 D;  1M8A A;  1ZYR C;  2YYZ A;  4IUU A;  3DXJ C;  4DV2 L;  1IBL Q;  2Z1C A;  4GN4 B;  4QIW E;  1S5F D;  2F4V L;  1EEF D;  2BDO A;  3ND8 A;  5IT9 c;  3RZO B;  2B2Y A;  4XIG S;  3AB9 A;  2JXM B;  2LFN A;  1PHJ A;  1AZP A;  3GDE A;  4C3I G;  2ZT9 C;  2QDB A;  1K3B C;  3CCL A;  5DAU A;  1P16 A;  5HGT A;  1VQ5 A;  1B2T A;  4K14 A;  3I4N H;  2RDH A;  4OWW B;  1V9P A;  2FHT A;  4LJZ C;  2Q2I A;  4JV5 Q;  4TKO B;  2YTX A;  1DCZ A;  2B2T A;  2MO0 A;  1CKN A;  3SK5 A;  5D14 A;  4PZ6 A;  1BXT A;  1XJV A;  1RDP D;  1K9M C;  2NVY B;  1HUN A;  4C3H B;  4OON A;  2Q8T A;  3S1N B;  3UI2 A;  2VY3 A;  3H09 A;  2B2U A;  1XPR A;  4C3I H;  3E9I A;  4P75 A;  4FO2 A;  3J80 L;  5C4Z A;  5LMN W;  1R4P B;  5C6A A;  3MXN A;  2B2V C;  3FDT A;  1KL9 A;  1TR5 A;  4BY1 B;  5M5X H;  4X64 L;  2O4X A;  1HNX L;  1SYB A;  1N9W A;  1TWC B;  1VCI A;  2IJ0 A;  4UAI A;  3K59 A;  3NP8 A;  1H9S B;  1FR3 A;  4JYA L;  2M2L A;  2OWO A;  3HKZ E;  5ELC A;  3HEJ A;  1N36 Q;  1SMY D;  1WTQ A;  2F0J A;  2QF7 A;  1KTK A;  2F0W A;  3LWE A;  1G8Z D;  3NWT A;  3W3A A;  4JI7 Q;  4K5X A;  3OSO A;  2Z6K C;  2ENB A;  3A56 A;  2PW7 A;  4QUC A;  3B6Y A;  1VS0 A;  3LWU A;  1Y69 U;  5BN3 A;  1HTP A;  3PIO 3;  4DR7 L;  4WOR A;  1OTC A;  1STG A;  3ERQ A;  3BYT B;  2PQA A;  1ENA A;  2YV5 A;  2EYH A;  4OX9 Q;  3KJO A;  2Q2T A;  1WTH A;  2Z9H A;  5JEA J;  3FPP A;  1ASY A;  3S2H H;  1TS2 A;  1BO0 A;  2E76 C;  4CJ2 C;  1Z6H A;  5I9P A;  2ICI A;  2A19 A;  1IZ6 A;  2LXK A;  3KLW A;  1XXG A;  4B9W A;  2AWN A;  3DWA A;  4JOI C;  3TN2 A;  1MD2 D;  3HOX G;  4OEM B;  4IOA A;  4XXE A;  3CHB D;  2YU9 H;  2P5Z X;  1VQM A;  3OIP A;  1MIU A;  2IY5 B;  1DOM A;  2WB1 E;  1KXL A;  1OXX K;  2ZTC A;  4HN7 A;  3F1Z A;  1LTI D;  1W2B A;  4C1N I;  5EJW A;  2JA5 G;  4DR6 Q;  2SNS A;  2N49 A;  3KLS X;  3DM3 A;  4B9X A;  1SMY C;  3GTP H;  2IX0 A;  4PV1 C;  1K3R A;  1LTA D;  4A3L G;  2PZW A;  3S1Q H;  1DJR D;  1Q86 C;  3S2D B;  1F2M A;  3HRZ C;  3J80 c;  5C3E H;  1K28 A;  3CCU A;  1HR0 Q;  2Q8I B;  2JA8 B;  1PH6 A;  4KY6 A;  1RD9 D;  3TDQ A;  3KBG A;  4IO9 A;  1GUW A;  3K81 C;  1QZG A;  1I6V C;  3HOX H;  2JP1 A;  1JJG A;  4XDX A;  4RWS C;  2UXB Q;  4JI2 Q;  3DEO A;  4DUY L;  1NY4 A;  2HDM A;  5KYI A;  3IKJ A;  2JA5 H;  1SDF A;  4IUR A;  4LF4 L;  2EYM A;  1PYB A;  2F3W A;  5BN5 A;  1TWG H;  4L8J A;  4A3I B;  4IJH A;  3SVM A;  5M9O A;  5K5P A;  2EXZ A;  5JPM C;  4LFB L;  1AE3 A;  2V1C C;  2QCP X;  4A3L H;  4DV3 Q;  4NXM Q;  1EQT A;  4DK6 C;  1I50 H;  3ZJY C;  4KJO A;  1ET6 A;  3OPO A;  2RSO A;  1HNW Q;  4GLX A;  4B3T Q;  2K4K A;  2Y0S E;  3SHL A;  1MI2 A;  5IP9 H;  2JE6 I;  1PLF A;  1RHP A;  3RLN A;  2AHO B;  1EL0 A;  3BZC A;  4R4Q A;  1XPU A;  1O7Z A;  4KJN A;  4MTK A;  2I46 A;  4JK1 C;  1X3Q A;  4LUZ A;  3S9W A;  2EVB A;  1BCP B;  1LUZ A;  3J81 L;  4AQY L;  2B8G A;  4QY7 A;  4X62 Q;  4KV6 A;  1Q1E A;  2GN5 A;  4ALP A;  3NUC A;  4FF4 A;  1L2F A;  1TU2 B;  1E3P A;  2EY5 A;  3T13 A;  4C2M H;  1O7L A;  1MJC A;  1I3Q B;  1WTP A;  2MP1 A;  3GTK H;  4H02 A;  4XTC S;  2RHQ B;  1BBX C;  5IOC A;  2QA4 A;  2UXC L;  4LF5 L;  2EY6 A;  3E5S A;  2CCZ A;  4QGU A;  2Y0S B;  1YVC A;  2K04 A;  2N55 A;  1VQ4 A;  2R61 A;  1YEZ A;  1ET9 A;  2CH4 W;  4A3G H;  1CUK A;  3QR8 A;  2EQS A;  4PNY A;  3RZD H;  3H91 A;  2MUY A;  3D3R A;  2Z8L A;  5DM7 3;  5I4D A;  4CDF C;  4LF9 L;  3BG3 A;  2R7Z H;  4DXF A;  1H9S A;  3HOY G;  4LFC L;  4WJ3 M;  5DLQ E;  1G2T A;  1I4Q A;  1PYS B;  4IFD G;  4UP9 A;  4CGY B;  3D4W A;  3PUW A;  4A3M B;  4ZUI A;  1SE4 A;  2D9U A;  2XRQ D;  2HHH Q;  3HKZ G;  4BWG B;  1WFQ A;  4KHZ A;  3M4Y A;  2IWH A;  1V8Q A;  3K6O A;  4A3D B;  2IW3 A;  3CRL C;  4JC0 A;  3RUZ A;  2PZU A;  1PRT D;  4RMF A;  1CTM A;  4QMG A;  3TZD A;  3J81 c;  1VMC A;  2JQO A;  2NBF A;  3PO2 G;  1K83 H;  2KOL A;  1V1P A;  1NCV A;  4JI8 L;  3S17 B;  2I0Q A;  3MA2 B;  5IGE A;  1KNA A;  3HOY H;  1F2L A;  2V4D A;  3MTS A;  3ND9 A;  3S1R B;  2ZM6 Q;  3S16 H;  1RL2 A;  4IFD H;  2BA0 A;  4JI5 L;  4A3B G;  1KAB A;  1TWA H;  1KDC A;  1BOS A;  5C5M A;  1K8A C;  4XT1 B;  5JJZ A;  5FO9 B;  3G7L A;  3VR4 A;  2RSN A;  1EIF A;  1ICW A;  3NBH B;  3JAM L;  3ULL A;  1DYQ A;  4EQO A;  2BH8 A;  1PTO D;  1IBM L;  4JI3 Q;  2G9D A;  1L1O C;  3OIQ A;  5KRU A;  1HFN A;  1G51 A;  1EY6 A;  3STB D;  4A3K B;  2RA4 A;  1VQ9 A;  3PO2 H;  3PQI A;  3H3V H;  5IYB H;  4OIK A;  1ROD A;  2C5C A;  3CCV A;  5M5W B;  2DJF C;  4U67 3;  2B63 G;  4HSP A;  5J22 A;  2HD3 A;  4EGV A;  1PRT C;  1VQK A;  3EA6 A;  1SXT A;  3G4S A;  4Y7N H;  1TS3 A;  1FD7 D;  3HFZ B;  1JOK A;  1RJT A;  3E9H A;  4PQX A;  5A2Q E;  2JA6 G;  3KDF B;  2B2Y C;  4GZY C;  2N88 A;  2KCN A;  2N3S A;  4DR2 L;  5F2D A;  4A3F G;  3TRE A;  3KF8 B;  3P75 A;  4DV7 L;  1HPC A;  2UXD Q;  2B63 H;  4AIM A;  2AUK A;  2FMC A;  3FRP B;  3SE0 A;  1PTO C;  1B7Y B;  3MHB A;  5CYU A;  1SE3 A;  2B2T C;  4YY3 Q;  2F0S A;  3STB C;  1C4Q A;  5E3F A;  2XWB B;  2C9O A;  1G29 1;  1SYE A;  2R92 G;  1I4P A;  4NB3 A;  3GV3 A;  1YNN D;  2JA6 H;  3T51 B;  3U9O A;  4GNX B;  4EQP A;  4TRD A;  4DF7 A;  1S5E D;  1Y8N B;  4RGM A;  4H7B A;  1EFW A;  1EY9 A;  4A3F H;  3Q6S A;  5IYD H;  2KED A;  4RFB A;  1WOC A;  2KHI A;  2XSC A;  3S1M B;  1PYW D;  3HOW G;  1EOV A;  4M1U B;  2QGQ A;  4XQN A;  1HR0 W;  1N32 L;  3H0G B;  1QNK A;  1WI5 A;  2R92 H;  2NB0 A;  2PMZ B;  1JWM D;  1EQV A;  3A7L A;  1WTX A;  1DZ1 A;  1B9M A;  2KHJ A;  5ELO A;  4YWM A;  1CKO A;  2DUD A;  4CKB A;  3R3O A;  1YIJ A;  3AQQ A;  4DAY B;  2K5N A;  2IPK D;  3EJI A;  3QOL A;  2WP8 J;  3PV0 A;  1YNN C;  4JI2 L;  3W1B A;  1SFO B;  4L5T A;  3NTI A;  1U9R A;  3E0E A;  4GLA C;  2OTJ A;  4LF8 Q;  3T16 A;  5I9O A;  3S24 A;  3MXG A;  3I4N B;  3I4O A;  4A3E B;  2EE1 A;  5GAD C;  2K7V A;  4JI4 L;  1LO5 D;  4I7A A;  4RA8 A;  1RKN A;  4PMB A;  2R6G A;  3OTO Q;  2D0P A;  3EBE A;  4QB4 A;  3GTG H;  4B3R L;  3GTM H;  3TBI B;  1WTO A;  5HUR A;  1R9T H;  1G2S A;  4C3I B;  2F0P A;  4A3J G;  4DKA C;  1A3T A;  3GO5 A;  4WJW A;  1E2Z A;  4B3S L;  3KOJ A;  3M4O H;  5M5X B;  2OCE A;  2R7F A;  1A62 A;  3IFT A;  1ZKO A;  1YHB A;  4GKK Q;  4X62 L;  4NXN Q;  1IBK Q;  1Q3L A;  2LXJ A;  1X9N A;  3NEM A;  3T1Y Q;  4IUP A;  5C4H A;  5KIX A;  3I4L A;  4IPD A;  2E2H B;  3M7G A;  4P74 A;  1UAP A;  4YCV A;  2EZV A;  1ENF A;  3CW2 C;  4X3U A;  2F1M A;  1XNQ L;  2EJM A;  1HNZ L;  2G9H D;  2BE5 D;  2NZO A;  2XGT A;  4N9T A;  3NTH A;  3UDF A;  1IHZ A;  1JE4 A;  3CQZ H;  1EY7 A;  5FLM G;  5K36 G;  3SXH A;  3S2H B;  2E2I H;  2F0U A;  1PZK D;  2QDL A;  2R3Z A;  1EEI D;  4WRD A;  2MHV A;  5G3L F;  1WTW A;  2F0F A;  3WOE A;  3RN2 A;  4AYB G;  5D3I B;  4NP5 A;  2XVS A;  3PUY A;  2K6A A;  1JE5 A;  4K5V A;  4RGO S;  4FVM A;  4A76 A;  2L0C A;  5FK9 C;  1KNE A;  2L12 A;  5M3M G;  1KRT A;  3BDC A;  1PRT F;  3GTP B;  4JBK A;  4KD4 A;  4F88 A;  4L5S A;  3U58 A;  5FLM H;  3S1Q B;  3AEV A;  5CV7 A;  5K36 H;  3FKI H;  5C3E B;  3L2P A;  5JEA G;  5EPK A;  3CCR A;  1X3E A;  2BE5 C;  2EJG C;  1Y8P B;  1D8L A;  1A63 A;  1F9P A;  2CWP A;  2F0I A;  2QEX A;  3WOF A;  4POF A;  4K6L A;  1S5B D;  2NVQ H;  1QVF A;  2NZH A;  4RGT A;  2RQX A;  5M3M H;  4YWK A;  3UE1 A;  5C4J B;  1TWG B;  1K0S A;  3GTO B;  2WFW A;  3F2U A;  3NPP A;  5CGK A;  2OTL A;  4ZQ3 A;  1EY8 A;  2XN9 C;  1JB7 A;  4ZUJ A;  1U4L A;  5C0X J;  4DR5 L;  1KLG D;  5ELB A;  4DV0 L;  1I50 B;  4DNR B;  5JEA H;  4BBS G;  1L0Y B;  1B8A A;  1FNV A;  1NR2 A;  1VDZ A;  3SEB A;  1SBB B;  5FLX L;  1CFM A;  2KEE A;  3MVV A;  4KKU A;  3KF6 B;  2O2L D;  1B50 A;  4DV5 Q;  2Q2U A;  1Y8O B;  4P73 A;  1NJI C;  4DAV A;  3RD4 A;  1Y1W G;  2VNU D;  2RCF A;  1IL8 A;  1J6Q A;  1EZ6 A;  1MKH A;  1T5X D;  2JA9 A;  2YTV A;  3J7Y W;  3I73 A;  3W1G A;  4K0K Q;  2FJ2 A;  3VR2 A;  2NN6 G;  3IFD A;  3U50 C;  3CCE A;  2OQ0 A;  4LFA Q;  1BF4 A;  1PFN A;  1E2V A;  2NTS A;  1WCM H;  5EKK A;  1KQS A;  1L0X B;  1Y14 B;  2FFK B;  1QB5 D;  2HQE A;  1K73 C;  1IL2 A;  2BOS A;  4C2M B;  4HJ8 A;  3K7U C;  1CQV A;  2CFM A;  1QOH A;  1YZ6 A;  5M5Y H;  4HID A;  4POG A;  4GKJ Q;  1GKH A;  4PMW A;  1HXY D;  5I6Y A;  2PO4 A;  4ZLT F;  4X66 Q;  5IGG A;  2M00 A;  1LYL A;  3CMA A;  1XX8 A;  1EQR A;  1Z47 A;  2NN6 H;  4L5R C;  3GTJ H;  3C1E A;  3BZD B;  1IKL A;  1MSH A;  1S4Z A;  4A3G B;  4QIW B;  1RTO A;  3NEN A;  4A75 A;  3RZD B;  1Y1V G;  3QWN A;  2N78 A;  2OT2 A;  4B3M Q;  4X3T A;  5BR8 L;  4X3S A;  2OXP A;  1RF2 D;  3CAM A;  1SRU A;  4FF2 A;  5LMN L;  3Q0A A;  3L3O C;  4KI0 A;  1BCP D;  2R7Z B;  2A68 D;  3M9B A;  5IWA L;  5FLX c;  3P7J A;  1KD1 C;  5IY0 A;  2AQ3 B;  3PIO A;  1H95 A;  1XWE A;  4XQQ A;  4XYQ A;  3WDN A;  2PNH A;  1S3O A;  4DR1 L;  3E3X A;  1IYJ B;  2E2D C;  1EY0 A;  1X56 A;  2F0G A;  1B44 D;  3AFQ A;  5FO7 B;  1RTN A;  4HIK A;  4UY8 C;  1UEB A;  1Y1V H;  4ZKC B;  3TP6 A;  4HSV A;  3I4M B;  5C44 G;  2A6E D;  4UDU C;  1IYU A;  1SNO A;  1JOQ A;  2UU9 Q;  3NEL A;  2OEO A;  4FXK C;  4LUO A;  5JPN C;  1FJG Q;  1CZG A;  1K83 B;  3FPU B;  2AQ1 B;  5IGC A;  3N6R A;  3KJP A;  2EYL A;  1W6J A;  4YHH L;  3S16 B;  1V1O A;  4LF6 L;  1E1T A;  1Q90 A;  1NMG A;  3HKZ B;  5LMU L;  5IT9 E;  1F2Z A;  1KIX A;  1TWA B;  4K5W A;  1N34 Q;  2AWO A;  1XMQ Q;  2R7D A;  1EU4 A;  4LF8 L;  1BCP C;  4GOP B;  4JI0 Q;  2A68 C;  3D6C A;  3NWS A;  4YCW A;  3GTL H;  3HOV G;  3MWY W;  1I94 L;  2I5H A;  1SAP A;  2K5H A;  4OO1 I;  1LM0 A;  4RCN A;  3L9A X;  3Q23 A;  3PO3 G;  1STA A;  4Y52 H;  3HGB A;  1GUN A;  5EAY A;  1EY5 A;  2A6E C;  2B2W A;  4Y7N B;  3I70 A;  2EIF A;  2L5T A;  3QG1 A;  2WAQ E;  2JA7 G;  3M3Y B;  4LF7 L;  1HUM A;  1U4R A;  3BZK A;  4Q5V A;  2DY7 A;  1M90 C;  2WB1 B;  2J4X A;  5AJ3 Q;  3A8K E;  3NHH A;  1HRJ A;  3HOV H;  2K32 A;  4A93 B;  5CV8 A;  4GKK L;  3BYY B;  3E0J A;  3DLL A;  4DNI A;  5BN4 A;  4DV4 Q;  2E5L Q;  1EY4 A;  3BVM A;  3EQL C;  4CJ1 B;  3J81 j;  3W2D A;  4CJ0 B;  2A8V A;  2VW9 A;  4H0L C;  2LSS A;  2IHE A;  4C3J G;  3CCS A;  2B63 B;  1E2W A;  2GVA A;  1S72 A;  1DD2 A;  4DUZ Q;  2JJQ A;  1YNX A;  1Q1B A;  1J8I A;  4KHP Q;  1VF5 C;  2VS1 A;  2ZJP A;  3X3N A;  1EYC A;  2QEJ C;  1A0I A;  1P8L A;  1EIY B;  1JOR A;  2AQ2 B;  1KAW A;  2VQE Q; 
#chains in the Genus database with same CATH homology
 3KDF B;  1WJJ A;  4JI1 L;  4JI6 L;  5C4X G;  3PUZ A;  3TEH B;  4GOP C;  2NN6 I;  1C0A A;  2PQA B;  4GS3 A;  1QZH A;  1GVP A;  2R93 H;  1V43 A;  2N3S A;  1E24 A;  3J80 i;  3KFU A;  4IPH A;  3CCM A;  1HZB A;  1UE5 A;  4DR2 L;  1SE8 A;  2N8N A;  1GD7 A;  4A3K H;  5IP7 G;  1SMX A;  4A3F G;  2K14 A;  3TRE A;  3KF8 B;  4C3J H;  1EQQ A;  4DV7 L;  1Q46 A;  5JJK A;  2UXD Q;  1VQD A;  2B63 H;  4AIM A;  5IYC G;  3J7Z C;  4KLK A;  3H15 A;  1OXS C;  2UUB Q;  1B7Y B;  3PUX A;  4MZ9 A;  3A74 A;  4BY1 G;  4YY3 Q;  3PF4 A;  3LGJ A;  3AFP A;  2KEN A;  4JI1 Q;  4JI6 Q;  3STB C;  3J7A 5;  3FKI G;  4OWT B;  2NVT H;  1G29 1;  2R92 G;  4BXX G;  2F3I A;  4PG3 A;  4NB3 A;  3CC2 A;  4DR4 L;  3MEF A;  4DV6 L;  4DV1 L;  2JA6 H;  5C4X H;  4DR2 Q;  1VQL A;  2UUA L;  4GNX B;  1PH2 A;  1VQF A;  1BBW A;  1X55 A;  2CKZ B;  4OXP A;  5GAH C;  4JCV E;  4DV7 Q;  2E2H H;  1UE6 A;  5M3F G;  4R4I A;  2YTY A;  2NVY H;  1EFW A;  2UUC L;  5IP7 H;  3K7A H;  4JBM A;  4A3F H;  1C7Y A;  5IYD H;  1PV4 A;  1WOC A;  4R1J A;  1LTL A;  4LF5 Q;  2KHI A;  3HOU G;  2I5L X;  2IX1 A;  5IYC H;  3I7F A;  2BA1 A;  3UDG A;  4TVA B;  1JMC A;  3HOW G;  1E1O A;  1EOV A;  1XMO L;  2QGQ A;  3D0F A;  1HR0 W;  3RR5 A;  3T1H L;  1N32 L;  4EX5 A;  4DR4 Q;  3A5Z B;  1CKM A;  4R4O A;  4DV6 Q;  3H0G G;  4DV1 Q;  2VZA A;  2HIX A;  1TWC H;  4R4C A;  1UE1 A;  4OO1 G;  1PH9 A;  2UUA Q;  1WI5 A;  1VQH A;  5IE8 A;  2R92 H;  4BXX H;  2K5V A;  3D31 A;  5C3E G;  2RF4 A;  3ERS X;  4AH6 A;  4APV A;  4DR3 L;  2ALY B;  2KHJ A;  5ELO A;  4YWM A;  2UUC Q;  1E22 A;  3CME A;  3F8T A;  1CKO A;  2DUD A;  5C44 H;  1J5E Q;  5M3F H;  4QJF A;  2NVX H;  3HOZ G;  1YIJ A;  1VQ7 A;  2VL6 A;  2MNA A;  3AQQ A;  4DAY B;  2K5N A;  1KC8 C;  1VQN A;  1XMO Q;  2BH2 A;  4BY7 G;  1IBL L;  3OW2 A;  3HOU H;  2WP8 J;  3PV0 A;  1N32 Q;  1PVO A;  3OTO L;  4JI2 L;  4HJ7 A;  1ASZ A;  1N33 L;  1L1O A;  3W1B A;  4HJ9 A;  1PH3 A;  3S1M H;  4MNO A;  1KRS A;  4L5T A;  1EUJ A;  3E0E A;  4GLA C;  4GN5 A;  3CP0 A;  4IOC A;  3H0G H;  2HT1 A;  2KBN A;  4LF8 Q;  2OTJ A;  1O7I A;  1QUQ A;  3S24 A;  1WCM G;  4DK3 C;  3I4O A;  3RLF A;  4X65 L;  2F52 A;  3W5O A;  4DPG A;  5GAD C;  4HIM A;  4IFD I;  4LW1 A;  3UE0 A;  4JI4 L;  1HJP A;  3GD7 A;  1M1K C;  2YYZ A;  4DV2 L;  2JEB I;  1IBL Q;  2R6G A;  5C0X I;  2B29 A;  5IP9 G;  3OTO Q;  3M7N A;  4GNX C;  3HOZ H;  2D0P A;  3EBE A;  2EXD A;  4GN4 B;  4QIW E;  4NXN L;  1HZC A;  1IBK L;  1N33 Q;  3IRB A;  2F4V L;  3GTG H;  4B3R L;  4JV5 L;  2ZTE A;  3GTM H;  4WJ4 A;  1D7Q A;  3T1Y L;  4BY7 H;  3PIP A;  5IT9 c;  1R9T H;  4GOP A;  5C4J H;  4XIG S;  1G6P A;  2L15 A;  4A3J G;  1PH1 A;  1PHJ A;  3GTO H;  1B70 B;  4DKA C;  3GDE A;  4R4T A;  3PO3 H;  3GO5 A;  4AYB E;  4X65 Q;  4B3S L;  3KOJ A;  3CCL A;  1GO3 E;  1P16 A;  1VQI A;  5HY6 A;  1YJN A;  3M4O H;  3Q8D A;  1OXU A;  2OQK A;  2OCE A;  2R7F A;  1VQ5 A;  3H3V I;  4JI4 Q;  4A3B H;  1A62 A;  3CC7 A;  1BBU A;  4HIO A;  4UPA A;  3I4N H;  3KF6 A;  4DV2 Q;  1YHB A;  2JA7 H;  4ME3 A;  1V9P A;  4O0A A;  4OWW B;  4X62 L;  4GKK Q;  4NXN Q;  1IBK Q;  2Q2I A;  4JV5 Q;  2LXJ A;  2YTX A;  1X9N A;  2MO0 A;  1PFS A;  2F4V Q;  1CKN A;  1OXV A;  3NEM A;  1E7Z A;  3T1Y Q;  1Z9F A;  3G48 A;  1X54 A;  1PA6 A;  1Q12 A;  4IPD A;  4PZ6 A;  4P74 A;  1GM5 A;  2JK8 A;  3CCQ A;  1XJV A;  4YCV A;  1K9M C;  1N36 L;  3CW2 C;  3J81 i;  4OON A;  4B3S Q;  2VUM G;  3BU2 A;  1PH7 A;  2VY3 A;  1XNQ L;  4MTN A;  1HNZ L;  3RZO H;  2WAQ G;  2NZO A;  2XGT A;  1XPR A;  4C3I H;  3E9I A;  4P75 A;  5LMN W;  1VQ8 A;  4HJ5 A;  4PZ7 A;  1YHQ A;  4JI7 L;  3EN2 A;  1KL9 A;  2RHS B;  3UDF A;  1JJC B;  1VQE A;  5M5X H;  4X64 L;  3CQZ H;  1HNX L;  1VCI A;  1N9W A;  4A3G G;  5FLM G;  2MO1 A;  5K36 G;  2E2I H;  2MQH A;  4JYA L;  1V1Q A;  2AKW B;  2OWO A;  4OX9 L;  3CF5 A;  3HKZ E;  1N36 Q;  3RN2 A;  3HKS A;  1XNQ Q;  4JG2 A;  4AYB G;  2K52 A;  1HNZ Q;  1CSQ A;  1EWI A;  3I2Z A;  1A8V A;  3S14 H;  3PUY A;  4LNQ A;  3RLO A;  1Q81 C;  2R7Z G;  4J15 A;  1T9H A;  1JE5 A;  1TWF H;  1CSP A;  2VUM H;  4C3H H;  3JAM c;  4A76 A;  4JI7 Q;  1FJG L;  2Z6K C;  3S1N H;  3B6Y A;  1VS0 A;  5M3M G;  4X64 Q;  1JJ2 A;  2DGY A;  1HNX Q;  1KRT A;  4DR7 L;  2E8G A;  3M85 A;  1OTC A;  4JBK A;  2PQA A;  2YV5 A;  2GVB A;  4JYA Q;  4L5S A;  4BY1 H;  3K80 C;  4OX9 Q;  1RIP A;  3KJO A;  3U58 A;  1QVC A;  5FLM H;  2Q2T A;  4DR6 L;  3AEV A;  3FKI H;  1XNR L;  3L2P A;  5JEA G;  2MFI A;  4TQU S;  5JEA J;  1XMQ L;  1ASY A;  1U5K A;  3S2H H;  3CCR A;  5E7N A;  3I4M G;  1X3E A;  2HIV A;  2A19 A;  1IZ6 A;  2LXK A;  3KLW A;  3ICE A;  1D8L A;  2AWN A;  2HQL A;  4JOI C;  1A63 A;  1SRO A;  3HOX G;  2CWP A;  4IOA A;  2QEX A;  1HR0 L;  4POF A;  2YU9 H;  1VQM A;  1MIU A;  2IY5 B;  2WB1 E;  1KXL A;  4DR7 Q;  1OXX K;  2VQF L;  1DGS A;  2NVQ H;  2ZTC A;  1QVF A;  1YBY A;  1K8G A;  2NZH A;  4O2D A;  3F1Z A;  3T1H Q;  4L5Q A;  5M3M H;  1W2B A;  1X65 A;  4YWK A;  3UE1 A;  4DV5 L;  2JA5 G;  4DR6 Q;  2UXB L;  2N49 A;  2ID0 A;  2WFW A;  2OTL A;  3DM3 A;  1X3G A;  3HOW H;  3L0O A;  1HZA A;  4A3M G;  1FL0 A;  3GTP H;  1JB7 A;  5C0X J;  2IX0 A;  4DR5 L;  4OWX B;  1K0R A;  5GAE C;  1K3R A;  4DR3 Q;  4A3L G;  4A3D G;  4K0K L;  2ES2 A;  4DV0 L;  1Q86 C;  3S1Q H;  4BBS G;  3J80 c;  5C3E H;  3CCU A;  3I4M H;  1U0L A;  4BBR G;  4LFA L;  1B8A A;  1HR0 Q;  3M4P A;  1PH6 A;  2JA8 G;  4IO9 A;  4DV3 L;  4A3C G;  4NXM L;  3CD6 A;  3K81 C;  3M4Q A;  1QZG A;  3A0J A;  3KF6 B;  3HOX H;  1UE7 A;  5JJI A;  1JJG A;  2XTI A;  3K0X A;  4P72 A;  4DV5 Q;  4QQB X;  5IYB G;  2Q2U A;  2UXB Q;  1HNW L;  3K8A A;  4P73 A;  4JI2 Q;  4DV4 L;  1NJI C;  4B3T L;  4DUY L;  1NY4 A;  1Y1W G;  3WWV A;  1CKN B;  3TS2 A;  2VNU D;  2I5M X;  2Q2H A;  4RG1 A;  4DR5 Q;  1PH4 A;  2JA5 H;  1J6Q A;  1MKH A;  2JA9 A;  2YTV A;  4LF4 L;  1PYB A;  4BA1 I;  4DAM A;  4GKJ L;  3G71 A;  1TWG H;  3W1G A;  4K0K Q;  4IJH A;  5GAG C;  2B3G A;  4DV0 Q;  4LFB L;  4A3I G;  4FDB A;  1AE3 A;  2NN6 G;  1HZ9 A;  2V1C C;  3CCE A;  3U50 C;  2OQ0 A;  4LFA Q;  4X66 L;  3ULJ A;  4A3L H;  5H1S E;  4DV3 Q;  4NXM Q;  1WCM H;  2WB1 G;  1UWV A;  4DK6 C;  1KQS A;  1I50 H;  3S2D H;  4X6A H;  1Y14 B;  3ZJY C;  4BBR H;  1BVS A;  3PSI A;  4A93 G;  2CWA A;  1K73 C;  1IL2 A;  2JA8 H;  1NE3 A;  1HNW Q;  4GLX A;  4B3T Q;  4A3C H;  2K4K A;  3CCJ A;  4DUY Q;  1VQ6 A;  2H5X A;  4HJ8 A;  1TXY A;  3K7U C;  3F2D A;  2CFM A;  2Y0S E;  3L7Z C;  4PZ8 A;  1YZ6 A;  3AYH B;  5IP9 H;  2RCN A;  5M5Y H;  4HID A;  4B3M L;  2JE6 I;  4LF4 Q;  4POG A;  2ASB A;  4GKJ Q;  1GKH A;  4PMW A;  3RLN A;  2AMC B;  4HJA A;  2AHO B;  4LFB Q;  3BZC A;  5GQO A;  3BJU A;  4X66 Q;  2ZJR A;  3S1R H;  4R4Q A;  1LYL A;  1YJ9 A;  1XPU A;  3CMA A;  4A3J H;  1EQR A;  4A3I H;  1Z47 A;  4LUZ A;  3A5U A;  4L5R C;  3GTJ H;  2K75 A;  3UDI A;  3CPW A;  1LUZ A;  1HH2 P;  3JC6 6;  4AQY L;  3M3Y H;  5JJL A;  1VQG A;  4QY7 A;  1FGU A;  4X62 Q;  2Z6K A;  4IPC A;  2ZTD A;  1Q1E A;  3NEN A;  4A75 A;  4LUV A;  1Y1V G;  3I56 A;  2N78 A;  1PH8 A;  2PI2 E;  1WYD A;  4B3M Q;  2GN5 A;  5BR8 L;  4ALP A;  4A93 H;  1L2F A;  3CAM A;  1E3P A;  2C35 B;  2ZJQ A;  1SRU A;  4JBW A;  4C2M H;  1VQO A;  2PMZ E;  5LMN L;  4QL5 A;  1QVG A;  5IYD G;  4KI0 A;  1MJC A;  3TS0 A;  3CXC A;  3GTK H;  4H02 A;  5M5W H;  3FHW A;  2CQO A;  1NBW A;  4XTC S;  2UU9 L;  2RHQ B;  3M9B A;  5IWA L;  5FLX c;  2QA4 A;  2IHF A;  1KD1 C;  4B3R Q;  5IY0 A;  3F2C A;  4AQY Q;  4LF5 L;  3PGZ A;  2UXC L;  3PIO A;  4JOI A;  1H95 A;  3F2B A;  2CCZ A;  5GRO A;  3KDF A;  1W3S A;  4QGU A;  2PNH A;  1S3O A;  1YVC A;  4DR1 L;  1IYJ B;  1X6O A;  1VQ4 A;  2D62 A;  2Y0S G;  5BR8 Q;  1X56 A;  3AFQ A;  1IXR A;  1YEZ A;  2IT1 A;  4A3G H;  4HIK A;  4UY8 C;  1UEB A;  3TRZ A;  1Y1V H;  3I55 A;  2HHH L;  1L1O B;  1CUK A;  2EQS A;  5LMN Q;  3RZD H;  1N34 L;  5C44 G;  3U4Z A;  2KCT A;  3UDX A;  4JI0 L;  2UU9 Q;  4YWL A;  4P71 A;  3NEL A;  1QUQ B;  2K50 A;  4LUO A;  4UP8 A;  5IWA Q;  2UXC Q;  1FJG Q;  4IPG A;  1J5E L;  1VQA A;  3G6E A;  4LF9 L;  1I3Q H;  3SGI A;  2R7Z H;  4DR1 Q;  3KJP A;  1EYG A;  1JT8 A;  3GTQ H;  3HOY G;  4LWC A;  4LFC L;  4YHH L;  5DLQ E;  2D0O A;  4WJ3 M;  4LF6 L;  1I6H H;  1E1T A;  1PYS B;  4IFD G;  1YI2 A;  1NMG A;  4UP9 A;  5LMU L;  3PUW A;  4IFD J;  4BA2 I;  1KIX A;  2HHH Q;  3PCO B;  2FXQ A;  3HKZ G;  4GNX A;  1WFQ A;  4KHZ A;  1XNR Q;  3VDY A;  1N34 Q;  2AWO A;  5C0X G;  1XMQ Q;  2ATW A;  1VQJ A;  2R7D A;  2ZM6 L;  1YHA A;  3PF5 A;  4LF8 L;  4GOP B;  4JI0 Q;  1Q8K A;  3PUV A;  1AE2 A;  4JC0 A;  4RMF A;  1TWH H;  2Z0S A;  4YCW A;  1PH5 A;  3GTL H;  3KYH C;  3HOV G;  4LF9 Q;  3J81 c;  1I94 L;  3TQY A;  2I5H A;  2JQO A;  1L0W A;  3CPF A;  5AJ3 L;  2K5H A;  4GN3 B;  1LM0 A;  4OO1 I;  2VQF Q;  2PI2 A;  4LFC Q;  4YHH Q;  3PO2 G;  1Q7Y C;  1K83 H;  1OXT A;  4JI3 L;  4LF6 Q;  3ER0 A;  5LMU Q;  4JI8 L;  2I0Q A;  3PO3 G;  2E5L L;  1KHI A;  1YJW A;  4NPS A;  4YCU A;  3HOY H;  4Y52 H;  5FJ8 G;  4GLV B;  5ELN A;  1X3F A;  5EAY A;  2ZM6 Q;  3S16 H;  1RL2 A;  3JAM i;  2BA0 A;  5J3B A;  4JI5 L;  2KCM A;  1MJE A;  2EIF A;  4A3B G;  4A3M H;  4EQ5 A;  4DUZ L;  1TWA H;  3I4N G;  4A4I A;  1S40 A;  4A3E G;  1K8A C;  2WAQ E;  2JA7 G;  4LF7 L;  3RNU A;  3BZK A;  4KHP L;  1I94 Q;  1EIF A;  3NBH B;  1VQP A;  1M90 C;  5AJ3 Q;  4A3D H;  1SLJ A;  1AH9 A;  4JBJ A;  3ULL A;  4BBS H;  2BH8 A;  3MXN B;  3CC4 A;  1IBM L;  3HOV H;  1SR3 A;  1SN8 A;  4JI3 Q;  4GKK L;  1L1O C;  3OYY A;  2R93 G;  4JI8 Q;  3DLL A;  3S15 H;  1G51 A;  3U4V A;  4DNI A;  2VQE L;  5HGQ A;  1FVI A;  3STB D;  4DV4 Q;  3J81 j;  1YIT A;  2E5L Q;  2E2J H;  1VQ9 A;  3FP9 A;  4A3K G;  3PO2 H;  4IJL A;  2A8V A;  3EIV A;  2VW9 A;  1I5F A;  1Q82 C;  1VQC A;  2LSS A;  2IHE A;  3CCS A;  5IYB H;  3H3V H;  3CCV A;  2GVA A;  4JI5 Q;  2B63 G;  1BKB A;  1S72 A;  3S17 H;  1Y1W H;  1SFO H;  2JA6 G;  5FJ8 H;  4DUZ Q;  1XPO A;  2JJQ A;  1YNX A;  1Q1B A;  1VQK A;  4LF7 Q;  4KHP Q;  1NTG A;  3ULP A;  2UXD L;  2VS1 A;  3G4S A;  1VQB A;  2ZJP A;  4Y7N H;  2JEA I;  4UP7 A;  4A3E H;  2UUB L;  1A0I A;  1P8L A;  1EIY B;  1IBM Q;  1NMF A;  1C9O A;  1KAW A;  1XTD A;  3HFZ B;  2A1A A;  3E9H A;  4YY3 L;  1N8R C;  3RN5 A;  2VQE Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...