1I6HH

Rna polymerase ii elongation complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(P*AP*AP*AP*TP*GP*CP*CP*TP*GP*GP*TP*CP*T)-3'
total genus 17
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i6hH00
5LMNQ 4DV0Q 2VY3A 3L0OA 3G6EA 3CC7A 1X6OA 5ELOA 1SLJA 2VUMH 2K52A 4LF4L 1I3QH 1EQRA 2JA6H 4POFA 4IFDG 3E0EA 4DAMA 4IJHA 3PCOB 3STBD 2WB1E 2ID0A 3U4VA 2D0PA 3F1ZA 2VQEQ 4IFDJ 4UY8C 1GO3E 2UU9Q 3ICEA 3HOXH 3HOYH 1GM5A 4JI4L 3GTQH 3HOWH 4DR5L 1K83H 4DR6L 4A3CH 3T1YL 4KHPL 2LXJA 4LFAQ 1UE7A 2LXKA 1PYBA 1TWAH 1N36Q 3RN2A 1HNXL 4X66Q 5JEAJ 1JJCB 4QL5A 4X62Q 4A3IG 5LMUL 2R7FA 3KF6B 3I2ZA 2B63G 3A0JA 2RHSB 5M3MH 4DKAC 4LF8Q 1JMCA 3ZJYC 4GNXA 3AEVA 1WYDA 4A3CG 4DR3Q 3RNUA 1JE5A 3T1YQ 4DUZL 2JA7G 4GOPB 1VQDA 4P72A 3I4NH 4KHPQ 2MO0A 1YVCA 5C3EG 1KQSA 3SGIA 1PHJA 3UDGA 3HOVH 3CC2A 4R4QA 2VQEL 4LF6L 2KHJA 3A5UA 3W1GA 1MIUA 2NVQH 4LF5L 1VQEA 4A3JG 4NXNQ 4C3JH 1IZ6A 4A3DH 3M85A 2R93H 2F3IA 4DV2L 2ASBA 4JI2L 4KLKA 3BJUA 3STBC 1SFOH 4WJ4A 2WAQG 1QVGA 2JA5G 2YU9H 1KRSA 4A3GG 2YV5A 2WB1G 4LW1A 1C9OA 4GNXC 1FJGL 3EBEA 4OX9L 4JI3L 1Y1WG 1M90C 4HJ9A 1L1OA 2UUCL 3M3YH 4DR4L 4YWLA 1X3FA 1RIPA 1NMFA 1VQOA 4A3MG 2CWPA 1E1OA 5IP9H 1TWCH 3PUYA 4P74A 1XNQL 4DV3L 1EWIA 2D62A 3K8AA 1VQ5A 1NMGA 1SRUA 2V1CC 4L5QA 1Y1WH 4BY1H 4A3BG 4DR7Q 1XMOQ 2E8GA 3PO2H 2CWAA 4YHHQ 2VQFQ 1Q82C 3KDFB 3K80C 2UUAQ 5GAGC 1RL2A 3AQQA 1NBWA 2BA0A 1IYJB 4DUYQ 2IX1A 1A62A 2KCTA 2JE6I 3S15H 1B70B 5HGQA 1YHQA 3F2BA 5E7NA 1YJWA 1HZAA 3Q8DA 1E3PA 2LSSA 3FHWA 3NEMA 1YZ6A 1YJNA 5FLMH 1XPRA 1J5EL 2JA7H 4JBMA 3I4NG 4UP7A 4GOPA 5HY6A 1S40A 2VS1A 2F4VL 3CQZH 2A8VA 5IE8A 4GKKL 4LWCA 4LF9L 4R4TA 4DV4Q 2KENA 5FJ8H 2R7ZG 2K75A 1HJPA 1Q1BA 3W1BA 2EXDA 3OTOQ 3CXCA 4A3FG 3B6YA 5IYDG 4R4IA 1K3RA 3F2DA 3RZDH 4JI4Q 1A63A 4JI2Q 3I4MH 1OXSC 1E22A 3H0GG 1O7IA 1L0WA 2CKZB 4JG2A 3J81j 1OXUA 4JBJA 1C0AA 2OCEA 1JJGA 2JEAI 1AH9A 4A93G 1N32Q 4A3LH 2Z0SA 2JQOA 2ES2A 3PUWA 1PH6A 2R7DA 2R93G 2Q2UA 3G71A 1VQMA 3TREA 1S3OA 1ASYA 4DAYB 1D8LA 3PUVA 4TQUS 4DV4L 3CMAA 1P16A 2K5VA 5GAHC 3JAMc 1HH2P 2ZJRA 4GKJQ 2R92H 1IBML 1VQ4A 2Z6KC 2KBNA 1D7QA 2OWOA 1JJ2A 1V1QA 4X6AH 1HNXQ 1T9HA 2I5MX 1OXTA 3I4OA 1VQPA 2E2IH 4TVAB 1HZCA 2QGQA 4EQ5A 1CSPA 2ZTEA 4EX5A 3CMEA 4POGA 4LF7L 1HZ9A 4X64Q 1GD7A 2XGTA 4QIWE 2KCMA 1A8VA 4JOIC 1WCMG 2WFWA 2UUAL 2XTIA 1X65A 5LMNL 3DLLA 2MFIA 1BBWA 3CCMA 3S1QH 4DUYL 1DGSA 1L2FA 3J81c 4A3JH 3HOUG 5M5WH 5DLQE 1N33Q 4JV5Q 2I0QA 4A3FH 2JA8H 3CCRA 3L7ZC 1SMXA 4OO1G 3GTJH 3GTLH 3WWVA 1KD1C 1QZHA 2NVYH 4JI0L 3PF4A 2VW9A 3J7A5 4DV3Q 3I56A 3S1MH 4B3MQ 2BA1A 2GVAA 2UUCQ 2K5NA 2B63H 1L1OB 1QUQB 1N9WA 2UXCQ 1WJJA 3HFZB 1NTGA 1HNZL 4GLAC 1EIYB 1FVIA 4DR5Q 4IPGA 3S14H 1K8AC 3PO3H 4DR6Q 1X55A 4GOPC 4DPGA 1FJGQ 4DV2Q 1H95A 4XIGS 2MO1A 4DV1Q 3VDYA 4JCVE 1CKNB 1VQHA 3KFUA 5JJLA 3KJPA 1GVPA 4A4IA 4LNQA 1OTCA 1PFSA 4BY1G 1YITA 4X64L 1U5KA 1UWVA 2PI2E 3RLOA 4DK6C 1PH2A 3PO2G 5AJ3Q 2N8NA 1QVFA 4O0AA 1PA6A 3CCJA 3S24A 4DV6L 3S2DH 1NE3A 3UE1A 2Z6KA 4GNXB 1VQKA 4MZ9A 3RN5A 1ASZA 4PZ8A 4YY3Q 1KC8C 1HNWQ 3J80i 5LMUQ 1L1OC 4HJ5A 2IX0A 3GO5A 2OQKA 4O2DA 1K9MC 2R92G 2HIXA 4OXPA 5J3BA 5GQOA 3GTKH 2ZTCA 2E5LQ 4DV6Q 3HKZG 2N49A 2RF4A 4R4OA 2JA5H 4A3GH 3FKIG 4IO9A 2NN6G 5AJ3L 1KAWA 1C7YA 1K8GA 1E7ZA 2GN5A 4HIKA 3GTOH 1KXLA 4A93H 4QJFA 1YHBA 1G6PA 2K5HA 1PYSB 1CSQA 4FDBA 1CUKA 1I94L 4LUVA 1PH3A 1LM0A 3JAMi 1PH9A 4BBRG 1PH4A 4YCUA 4DV1L 1WI5A 3IRBA 2PQAA 4A75A 3CD6A 3HOUH 1VQFA 4IPHA 4NB3A 1CKNA 2JJQA 4C3HH 4UPAA 3OTOL 2YTYA 1KIXA 4BA2I 4A3BH 4DR7L 4C3IH 1PVOA 4HIDA 5M3MG 1XMQQ 1Y1VG 1LYLA 1MJCA 3TEHB 3T1HQ 1SE8A 2IHFA 4LFCQ 3H3VI 4JI6Q 1QUQA 1HR0Q 1I5FA 5IP9G 2NN6I 4NXMQ 4NXML 3ER0A 4OO1I 1Q12A 1YEZA 1E1TA 3D31A 1HNWL 1QVCA 3KF6A 5C4XH 2BH8A 1AE3A 1QZGA 4DK3C 3RR5A 2ZM6L 3KDFA 2I5LX 4XTCS 4BBRH 4DV5L 1PH8A 4OWWB 1X3EA 2RHQB 3F8TA 4GN3B 2JA6G 1KL9A 2MQHA 3L2PA 1SR3A 4AQYQ 4OWXB 4PZ6A 4AYBE 1VQ6A 3G4SA 2VUMG 1HR0W 3K7UC 2B29A 3MXNB 4LF7Q 4A3EG 1XMOL 4JI8Q 1UE1A 3S17H 4A3LG 2AWOA 1XNRL 4LUOA 3CPFA 4X65L 3CCVA 3TQYA 4DR2Q 1I94Q 4HJ8A 1JT8A 1X3GA 4R4CA 5C0XG 3J81i 1N34Q 2D0OA 3H0GH 1VQNA 3I4MG 4IPCA 3GD7A 4PG3A 1Q86C 2CCZA 1V9PA 3KLWA 5IYCG 4YCVA 3K81C 1IBMQ 1HZBA 2CFMA 4GKJL 2R7ZH 2PI2A 5LMNW 1EIFA 1V43A 1Q7YC 4L5SA 4AIMA 1IBLL 3GTGH 3CPWA 3A5ZB 3KF8B 4MTNA 1IBKL 4JC0A 2AKWB 2OTLA 3ULPA 5M5XH 1N32L 1XPOA 2Q2TA 2IHEA 5GAEC 2UU9L 2JA8G 4YCWA 1S72A 2MNAA 2K4KA 4BA1I 3U58A 1JB7A 2NVTH 3CF5A 3HOZG 3HKZE 2EIFA 4JOIA 2EQSA 4QY7A 5IY0A 4K0KL 2UUBL 2R6GA 1WFQA 3PIOA 1IL2A 4B3RL 4IOAA 4J15A 1MKHA 2Q2HA 1W3SA 4P73A 4H02A 5C44G 2ZJPA 1HNZQ 2HHHQ 2ZJQA 4JI5Q 2C35B 4AH6A 1YI2A 2OTJA 1Y14B 5M5YH 1VCIA 1YBYA 1Q1EA 2A1AA 2PMZE 3TS0A 4B3TQ 1Y1VH 3S1RH 1N8RC 5BR8Q 1VQ8A 5BR8L 4X62L 1B8AA 1YNXA 3PUZA 1J5EQ 1G291 1Q81C 1NY4A 4UP9A 4GKKQ 4P75A 3S1NH 1EYGA 2F4VQ 3NELA 2NZHA 2UXDQ 1UE6A 2QEXA 1GKHA 4Y52H 2AHOB 4RG1A 1XJVA 1FGUA 2VZAA 2VNUD 2HIVA 1TWFH 3CP0A 3EIVA 3GDEA 3UDFA 3M4OH 4UP8A 4C2MH 4JI7L 4BXXH 1EOVA 1X56A 1N33L 4JV5L 3NBHB 3M7NA 3FKIH 3M4QA 3PGZA 4KHZA 4YHHL 4L5RC 1IXRA 1VQBA 4A3DG 1TWHH 1Q46A 3PO3G 1VQIA 3HOVG 2ZM6Q 1IBKQ 4B3SL 3CAMA 1J6QA 4P71A 5GROA 1OXXK 1XNQQ 1EFWA 2UXCL 5C3EH 1PH5A 3ULJA 2Q2IA 2I5HA 3M9BA 1VQLA 2CQOA 1K73C 2AWNA 1PH7A 1A0IA 3TS2A 2K50A 5FJ8G 4B3TL 3BU2A 1XMQL 5JJIA 1Q8KA 4R1JA 3EN2A 3GTMH 1TWGH 1K0RA 1VS0A 1W2BA 1Z47A 3HKSA 4IJLA 3H15A 3LGJA 5GADC 2ATWA 3AFPA 4APVA 3PV0A 4HJ7A 1BBUA 1XPUA 3E9IA 1YHAA 4MNOA 4PZ7A 3CC4A 3HOYG 4HIMA 5EAYA 4JBKA 1XNRQ 3AFQA 3HOWG 4NXNL 4JI8L 4LF5Q 2VL6A 3HOXG 1U0LA 2QA4A 4LUZA 4LFBL 3KOJA 4Y7NH 3E9HA 2VQFL 4JI7Q 4QQBX 4DV7Q 1P8LA 1PH1A 2YTVA 1BKBA 1OXVA 4PMWA 3W5OA 2UXDL 2HT1A 4LF8L 3RLFA 4RMFA 4DR1Q 5IP7G 1YJ9A 2KHIA 5M3FH 3KYHC 4A3KH 3CCLA 5JJKA 2PNHA 5FLMG 1VQ7A 4GN4B 3S16H 1M1KC 2OQ0A 1X54A 1EQQA 4BY7H 1VQ9A 1G51A 4X66L 4LFAL 4LF9Q 2BH2A 1WOCA 1VQJA 4A76A 4DR4Q 3OYYA 4AYBG 4KI0A 4YY3L 3OW2A 5IYCH 2WP8J 1VQCA 5IYBH 5M3FG 4A3KG 3BZCA 5IP7H 4A3EH 3A74A 2HHHL 3PIPA 1I50H 3M4PA 4JI5L 4GN5A 4X65Q 2UUBQ 2Y0SG 1MJEA 5IT9c 4K0KQ 4DV7L 4B3RQ 3J80c 1Z9FA 4LF4Q 4L5TA 3UE0A 3KJOA 3PSIA 3I55A 2E2HH 4BXXG 5K36G 3J7ZC 3CCUA 4IFDI 1X9NA 4LF6Q 2GVBA 1E24A 2N3SA 3CW2C 3AYHB 4BBSH 5C4XG 5IYBG 4DV0L 1SN8A 2ZTDA 3CCQA 4DV5Q 5IYDH 1WCMH 2YYZA 4DNIA 4DUZQ 1CKMA 1IBLQ 3GTPH 5IWAQ 3BZKA 2E5LL 5FLXc 3RZOH 1R9TH 4JYAL 1BVSA 3I7FA 4IPDA 2F52A 3ULLA 4B3ML 4A3IH 5C0XJ 4HIOA 4DR1L 4WJ3M 4NPSA 2PQAB 2AMCB 2JK8A 2NZOA 4JI1Q 4DR2L 4YWMA 1KHIA 3PF5A 4OX9Q 1SROA 4OWTB 1EUJA 1N34L 3TRZA 1I6HH 2ALYB 3PUXA 4ME3A 3CCSA 3K0XA 4LFBQ 1YIJA 1VQAA 4B3SQ 5H1SE 5ELNA 2WAQE 2UXBQ 2A19A 5C0XI 1TXYA 4BBSG 3G48A 3U50C 4AQYL 4IOCA 2YTXA 2HQLA 3D0FA 2JEBI 3HOZH 1NJIC 1AE2A 3FP9A 3DM3A 4ALPA 2L15A 2H5XA 2DGYA 4JBWA 1PV4A 1LTLA 4OONA 4HJAA 2E2JH 2UXBL 1VQGA 3F2CA 2DUDA 1FL0A 3CCEA 3NENA 2B3GA 2IY5B 2FXQA 4LFCL 2IT1A 3JC66 4DR3L 4A3MH 4JI1L 2K14A 1UE5A 4YWKA 3T1HL 3ERSX 3S2HH 4QGUA 1XTDA 2N78A 4GS3A 5IWAL 4JI6L 2Y0SE 4BY7G 3UDXA 1HR0L 1B7YB 1KRTA 1N36L 4JI0Q 3MEFA 3K7AH 2JA9A 2NVXH 4JYAQ 1CKOA 3RLNA 4JI3Q 4GLVB 3UDIA 4GLXA 5C4JH 3H3VH 1LUZA 2RCNA 5JEAG 5C44H 1UEBA 3U4ZA
chains in the Genus database with same CATH superfamily
2SDFA 5J1ZA 3L0OA 3HOWB 1X6OA 4LF4L 3A7LA 4IFDG 4POFA 4DAMA 3PCOB 4C1NI 3SEBA 4S3SA 3HOWH 2LXJA 2EVBA 4LFAQ 1PYBA 1KDBA 4ZUIA 1H9MA 4X62Q 5LMUL 2B63G 4IUNA 4X3TA 1A3TA 5KIXA 1GOZA 4DKAC 5IGCA 2XVSA 3C1FA 4HCEA 2B39A 4QB4A 3SR1A 1JE5A 4RFBA 3T1YQ 4DUZL 2JA7G 1VQDA 3K58A 2MO0A 1YVCA 1MSGA 1FR3A 2VQEL 4IFDH 1K0SA 1MIUA 3OPOA 1WVLA 4LF5L 2DNEA 2E75C 1IZ6A 3M85A 1HQMC 2F3IA 5ELFA 2ASBA 3I4NB 1CM9A 4WJ4A 2WAQG 1QVGA 4A3GG 4GNXC 2WB1G 3TDQA 3HOZB 3T53B 3EBEA 4OX9L 1W6JA 2UUCL 1E2ZA 3M3YH 4DR4L 3J7YW 1X3FA 1R4PB 1NMFA 1ONLA 4X3KA 5JAVA 1UNSA 4FF4A 4N8FA 3HOXB 1XNQL 1NMGA 5KGUA 5HURA 2VUMB 1NUCA 3K80C 4DUYQ 2IX1A 1VF7A 3S15H 3KBGA 5I6WA 3T16A 2BE5D 1HZAA 5CBEE 3FHWA 2FMMA 4RA8A 3NEMA 2A6ED 5FLMH 1J5EL 4UP7A 4G7OC 2RA4A 4GKKL 4LWCA 2VB2X 2QEJC 3Q24A 1SYGA 2DJGC 2R7ZG 2EXDA 3QB3A 2DY7A 1LTID 1K3RA 3CU7A 3F2DA 3H6MA 3RZDH 1A63A 2A68C 1ILPA 1MI2A 4RAUC 1E22A 2EYLA 1L0WA 5FO7B 3LX0A 3J81j 2E2IB 5K5PA 1PFBA 1C0AA 1AH9A 2MJ8A 1HTPA 2Z0SA 3PUWA 1XX8A 3PMFA 3URYA 1I6VC 1S3OA 3PUVA 1JOKA 2A74C 2K5VA 5GAHC 3JAMc 4RGMA 5CORA 2KBNA 1EIGA 4Q5VA 3DXJC 3G6JB 3GTQB 1T9HA 3I4OA 4ODGA 2L0CA 1HZCA 5K36H 1I4XA 1MGSA 1AEXA 1DXMA 1EIHA 1B53A 1A8VA 1SNQA 5LMNL 2MFIA 3A7AB 4RHSA 1DGSA 2I46A 1HFGA 1HPCA 3J81c 1I4QA 3SK4A 3R93A 3S1MB 4A3FH 3CCRA 3L7ZC 1SMXA 1TS3A 3MAQA 1EY4A 4QF4A 3WWVA 1I50B 5I9PA 5JEAH 2NVYH 3PF4A 2JA8B 4RGTA 3J7A5 4DK1A 4I65A 1RTNA 2PW5A 3I8ZA 4B3MQ 2UUCQ 2E74C 2UXCQ 1N9WA 1SAPA 1WJJA 3S9WA 2SNMA 3S1QB 1NTGA 3GQBA 5JOBA 4F8MA 1V1PB 4DPGA 4DV2Q 4DV1Q 3VDYA 3H94A 2XIWA 4JCVE 5JJLA 4LNQA 1OTCA 2K03A 1EZ8A 4BY1G 4KHVA 2CH4A 2N8NA 1PA6A 3S2DH 2Z6KA 1VQKA 2EPBA 3EQLC 1ASZA 2LFNA 3M3YB 4PZ8A 4IUQA 1UUPA 5LMUQ 3GO5A 2OQKA 5T1GA 1B3AA 3ND8A 5J3BA 1O7ZA 5L37A 2QF7A 1U4MA 1ESFA 2RF4A 2PCFB 4IO9A 3GTOH 2ZXOA 4HIKA 3OOCA 4QJFA 4FDBA 3IFTA 4U68A 2EYFA 3MZ5A 4C3JG 4KKSA 3IKJA 1LM0A 3R8BA 5A2QE 4K2KA 1PH4A 2IWHA 5A35A 4DV1L 3IRBA 4QUFA 2PQAA 3PIP3 3HOUH 1SYFA 3A8KE 1FGBD 1EYDA 5BN4A 3OTOL 3X3NA 3IAYA 4DR7L 4O1NA 3PQIA 2B8FA 2LKVA 2KA7A 1RTOA 1SE8A 2IHFA 1I5FA 4NXMQ 4OO1I 3ER0A 3D31A 3NTKA 2R3ZA 2NUCA 4BBRH 2BDNA 1F9SA 1KL9A 3BYTB 4ZUJA 3CRLC 4OWXB 4PZ6A 3G4SA 5M5XB 1HR0W 1F77A 3MXNB 2F4IA 3AU7A 1XMOL 4K8JA 3S17H 1WTXA 2AWOA 3NTIA 1KLGD 3CPFA 4LUOA 1FNWA 1DOLA 1JT8A 3J81i 3I4MG 3H0GH 4IPCA 2RDFA 4PG3A 1Q86C 5DM63 1V9PA 4IUPA 3KF8A 4YCVA 1IBMQ 1HZBA 3AMUA 2CFMA 4FP5D 4A3GB 2PI2A 3D8GA 2CVRA 3OMCA 4AIMA 1IBLL 1QNKA 2AKWB 3ULPA 2QKIC 1XPOA 4MN3A 5IGDA 2DNCA 4CDDC 2MNAA 2K4KA 4BA1I 3U58A 5EGTA 3HKZE 4F7XA 4DU9A 1NR2A 2F0EA 2UUBL 1IL2A 4IOAA 2DN8A 3UI2A 4B3TQ 1BR9A 3S1RH 5BR8L 2ZT9C 1YNXA 5LL6S 5EKKA 1EYGA 3NELA 1XJVA 1FGUA 1EYCA 3CP0A 3GTLB 3NBIA 1EY5A 4C2MH 4BXXH 3C46A 3EVQA 3FVQA 1EU3A 4WORA 3DUZA 2H4OA 3PO3G 2Q8RE 4V0BA 3CAMA 1J6QA 5GROA 3NTHA 4DXGA 1S4ZA 3OIQA 5C3EH 2PPBC 2UXCL 3ULJA 2Q2IA 2FJ2A 1HUNA 1PH7A 1A0IA 2A69D 4R8NA 4UHVA 4B3TL 1Q8KA 2PZWA 2RSOA 1K0RA 2EY6A 1W2BA 3HKSA 3V96A 2X69A 4OHJA 2RVLA 1YHAA 3OWFA 4HIMA 5EAYA 4JBKA 3AFQA 2KEEA 4LF5Q 3HOXG 4RKBA 2QDBA 3GTMB 3S14B 3TP8A 1IKLA 4Y7NH 4JI7Q 4KD3A 1PH1A 2UXDL 2HT1A 4IALA 4DR1Q 1AFPA 2KHIA 4IUVA 1VQ7A 4GN4B 3S16H 4BBSB 1RD9D 1JE4A 3V2TA 1V8QA 4X66L 5LHY1 1WOCA 4EGVA 2B63B 1I4RA 4KI0A 1Y69U 3NK9A 5IYCH 2F0KA 5M3FG 1D1IA 2HHHL 4XDXA 4GN5A 2JA7B 2Y0SG 4K0KQ 1Z9FA 4LF4Q 1HRJA 4LF6Q 2GVBA 4BBSH 3P1HA 2ZTDA 1SXTA 1WCMH 1IBLQ 1CKMA 5IWAQ 1PTOH 3RZOH 4DN4M 4JYAL 4B3ML 2F52A 4A3IH 1CT1D 1TR5A 3HGBA 2RCFA 3HG9A 4WJ3M 2D2CC 1XWEA 2JK8A 4RWSC 3T51B 1AW7A 3NPPA 4OWTB 2XNAC 1EWHA 1LT5D 2HDLA 4ME3A 4OL7A 4F88A 1CTMA 5C0XI 3ZYYX 4BBSG 4I7AA 3U50C 5IT9E 2YTXA 1NJIC 3VR6A 1G6ZA 3KUPA 5IIFA 4C3JB 4DNRB 1JQYD 3NQIA 3CCEA 2M2LA 1LT4D 1KDCA 3DWPA 1TS2A 2IY5B 1B4OA 3JC66 4ZLTF 3ERSX 1IYVA 2CHBD 3NE5B 3UDXA 4JI0Q 4CBVA 5C4JH 4BY7B 3TMEA 2RCNA 1UEBA 3S1RB 2Z4IA 3HEJA 2P5ZX 2HD3A 2QCPX 1SLJA 2KECA 1R4QB 1I3QH 1LV9A 1EQRA 3CKIB 4QMGA 2JA6H 3E0EA 1I4PA 4G7HC 4IJHA 2VQEQ 2D0PA 3F1ZA 4IFDJ 4UY8C 1GO3E 2SOBA 4JI4L 3GTQH 2EYJA 4DR5L 4DR6L 4A3CH 3T1YL 5CV6A 4J6HA 3N52A 4X66Q 3MFYA 2R7FA 1RDPD 3A0JA 2RHSB 2B2VC 3P75A 1CQFA 1JR0D 4LF8Q 3TP7A 1JMCA 3ZJYC 4GNXA 1WYDA 2B2TC 1WTVA 4OIJA 4GOPB 4KHPQ 3O13A 4B08A 3KK7A 4FF2A 3W1GA 4BS9A 3SXHA 3OMGA 4DV2L 4JI2L 3GV6A 4LW1A 1C9OA 1FJGL 1CZWA 1C48A 4JI3L 1L1OA 5JVH3 4EVOA 4TKOB 3EA6A 4A3MG 5D3DA 4ZKBB 4BBRB 1LO5D 1RKNA 1TWCH 4ZRZA 5KRUA 4DV3L 2D62A 1WTWA 2EXZA 2F0HA 4HSPA 3S1NB 1F9PA 1CZGA 3I4LA 1SRUA 2JA6B 4JVZA 4A3BG 1LTAD 2E8GA 2CWAA 2VQFQ 5GAGC 2KCTA 4K2LA 3TBIB 1STBA 4CJ1B 5HGQA 1YHQA 5E7NA 5I4DA 3HOUB 1YJNA 2JA7H 4JBMA 4GOPA 2VS1A 5IOCA 1EZ6A 5JPNC 2F4VL 1TKWB 1XXGA 2OT2A 5D3IB 2E2DC 4KY6A 1ZKOA 2WIIB 3W2DA 5IYDG 3E0JA 3I4MH 1OXSC 1O7IA 3HZXA 1A6XA 2CKZB 1JORA 4JG2A 4A93G 1WD0A 1N32Q 4A3LH 2JQOA 2ES2A 4XYOA 1STEA 3S2DB 4TSSA 2R93G 1SMYD 2K7VA 3G71A 1VQMA 1DYQA 3KLSA 2EE1A 1D8LA 2L12A 4TQUS 3CMAA 1Y8NB 5JVG3 1SYBA 1B3QA 3OW7A 1VQ4A 2ZXPA 2F1MA 5JJZA 2Z1CA 2OWOA 1G8ZD 4XQQA 3E5SA 2I5MX 1SE4A 1OXTA 4P2CB 3K59A 2QGQA 4KN4C 2EYPA 4EQ5A 5CBAE 3MWYW 2HQEA 4PMBA 1LTTD 1WCMG 2WFWA 2XTIA 3D3RA 3S1QH 2NZ1D 3ITPA 2EYMA 4FO2A 5M5WH 2B2YA 1N33Q 5FO8B 2JA8H 2PYKA 1WTPA 1JWUD 3GTJH 3GV3A 2IW3A 4JI0L 4HMIA 2VW9A 2C9OA 1CFMA 2GVAA 1QUQB 2A69C 2B2VA 4GLAC 1EIYB 3S14H 4DR5Q 4IPGA 4DR6Q 1K8AC 1ZXTA 3OWEB 1X55A 4K14A 2MO1A 4HEDA 5EKLA 1CKNB 2RSNA 4K5WA 4XXEA 1SNCA 3PO2G 1Y8OB 3TN2A 5A2QL 2K33A 1QVFA 1F2YA 3CCJA 2I07B 3RN5A 4RKLA 5AFWA 1CA6A 1PLFA 4YY3Q 1DM0B 3J80i 1L1OC 1QCBD 2IX0A 4O2DA 2R92G 3S2HB 1LTGD 2HIXA 3KBXA 3PO3B 3J81L 3GTKH 5KYLA 2JA5H 4MTKA 3FKIG 5TSSA 2NN6G 2RQXA 2AUKA 2TMPA 1E7ZA 4MHEA 4IURA 1YHBA 1G6PA 1CSQA 1JWSD 3RZDB 4K8IA 4LUVA 1PH3A 1UEAB 4BBRG 3C1EA 1PRTB 3S17B 1KAAA 3CD6A 1VQFA 4IPHA 4NKLA 2JJQA 4J1MA 2PO4A 3S15B 1IW7D 3M4OB 5F2DA 5M3MG 5EPKA 1Y1VG 1MJCA 1LYLA 3T1HQ 1O78A 4LFCQ 3H3VI 1QUQA 1HR0Q 2M9VA 2K05A 4NXML 1YEZA 1DOMA 1E1TA 1QZGA 1AE3A 2WINB 1EEID 3RR5A 3W3AA 1ICFB 2JP1A 4OWWB 3A56A 1RCVD 4GN3B 2R92B 1GJXA 1F9RA 1K8OA 2MQHA 2NTSA 1VQ6A 2VUMG 2XN9C 3K7UC 2B29A 1UE1A 2LS01 4A3LG 1HHVA 1PTOD 1WTHA 1SNMA 1C4QA 4R4CA 5C0XG 1VQNA 1N34Q 1KDAA 2K01A 3HS0C 3GD7A 3KLWA 4KKTA 5IYCG 3GTOB 4LK1C 1ENAA 4GKJL 2R7ZH 1GUSA 1TIID 4LJZC 1V43A 3GTGH 1GHKA 2R93B 1JOOA 3KF8B 4MTNA 5IGGA 1LABA 3FKIB 2OTLA 1QOHA 3K6OA 5M5XH 1VMCA 1EOTA 2KEDA 1IW7C 1TWFB 1VF5C 3CF5A 1JB7A 3PIO3 2OXPA 2EQSA 4QY7A 5IY0A 2Q8IB 2R6GA 3PIOA 5C4XB 4A3IB 1MKHA 2J7ZA 1W3SA 5C44G 2OTJA 2PQEA 1Y14B 4UAIA 1VCIA 1YBYA 2F0GA 2PMZE 1Y1VH 4H13C 1VQ8A 1B8AA 1CQVA 1I4HA 4UP9A 1MHWC 3S1NH 3ERQA 2E2HB 2NZHA 3NBHA 2AHOB 2VNUD 2HIVA 3GDEA 5C3XA 3N6RA 3M4OH 3RMHA 1X56A 4JV5L 3DEOA 1ET9A 3FKIH 3M4QA 2AQ3B 3BYYB 3D4WA 1VQBA 1SYDA 1TWHH 3BDOA 2ZM6Q 4A93B 4M8AA 1ZYRD 5DAUA 1XNQQ 2CW0C 1KABA 4RHRA 4CJ2C 1TY0A 1K73C 1LLRD 4KN7C 1PXUA 1GUOA 5FJ8G 2N88A 3BU2A 3D4RA 1XMQL 4R1JA 2J0TD 3EN2A 1TWGH 1PRTD 3A54A 4APVA 1BBUA 5EPJA 1SJED 5BN3A 4DAPA 3BVGA 3QOJA 3BVMA 2OF1A 5FLXL 3OSOA 2VL6A 1U0LA 2EY2A 3E9HA 4QQBX 2YTVA 1SBBB 5IP7G 1QG7A 2NB0A 5IT9L 4A3KH 3CCLA 4XYQA 2PNHA 5FLMG 4C3IB 2OQ0A 1LTSD 4A3EB 2K32A 4IZ8A 2BH2A 1VQJA 4XT3B 2F0JA 4K5XA 5C4ZA 1VQCA 5IYBH 4A3EH 1J8IA 3M4PA 4JI5L 1A3UA 4A3MB 1VDZA 4A3KB 5E3FA 4B3RQ 3VR3A 4L5TA 3PSIA 4PQXA 1NAPA 3VR5A 2L55A 1E24A 3GTKB 1SN8A 4DV5Q 1D6EC 1O7YA 2YYZA 4DNIA 3BZDB 3GTPH 2HCIA 3VYUA 3BZKA 3PO2B 5IGBA 1Z7TA 1R9TH 4IPDA 3I7FA 2KHSA 4JK1C 2K5QA 4HIOA 4IUUA 3VA7A 3WOFA 2EYHA 2J4XA 4DR2L 1KHIA 3SK6A 4OX9Q 3TRZA 1I6HH 1EUJA 1N34L 2ALYB 3PUXA 4B3SQ 1VQAA 5H1SE 2A19A 1TXYA 3OIPA 1B44D 3G48A 2N55A 1LT6D 3F2UA 4N8X1 3BS1A 3DM3A 2EY1A 2ICEC 1OO9B 4BWGB 1LTLA 4OONA 1UAPA 2UXBL 1BO0A 3NENA 3I4MB 5CV7A 5E4WC 2B3GA 2FXQA 3HKZB 1D1KA 2R61A 2F0NA 1CK1A 4JI6L 2N78A 4BY7G 2B2UA 1B7YB 1KRTA 3MEFA 5I6YA 5M5WB 1CKOA 1SNPA 4DAVA 4GLVB 2V4DA 1LUZA 4EQPA 1CI3M 4KKUA 4DV0Q 2VY3A 3FMCA 3CC7A 4ME5A 2A68D 5ELOA 4ZCKA 2VUMH 5M5YB 2K52A 4C1NK 3STBD 1B1ZA 1ENCA 3OHXC 5C5MA 3ICEA 3IFDA 2K28A 3HOXH 1GM5A 1K83H 1JB3A 5LL6X 1PRTF 3BVZA 3LNNA 4ZQ3A 3I73A 5JEAJ 5C4HA 2G5DA 4A3IG 3KF6B 3K5OA 2Z9HA 4AYBB 1DJRD 5M3MH 4I7ZC 4XQJA 5CYUA 3I4NH 4P72A 1A3VA 5M9OA 5C3EG 3SGIA 1Q90A 1PHJA 3CC2A 2KHJA 3A5UA 1EQTA 5C3WA 2NVQH 2PZTA 2WKCA 4NXNQ 4XQNA 4JW0A 2PZUA 4K6LA 2R93H 4KLKA 1SFOH 3STBC 4CDCC 2KOLA 2JA5G 2YU9H 1KRSA 2YV5A 1HTLD 5M3MB 3FRPB 3K0YA 1Y1WG 1M90C 4HJ9A 4NMZA 3HOVB 3M4YA 4FVMA 2CWPA 1E1OA 5IP9H 3ND9A 3PUYA 4FXDA 1EWIA 3K8AA 1VQ5A 1KNEA 1FNVA 1U4LA 2L1BA 3DWQA 2V1CC 3MFGA 4BY1H 3NWSA 4DR7Q 1XMOQ 3FDTA 1IYUA 3PO2H 4YHHQ 4CDEC 3KDFB 2EJGC 2AUJD 3HOYB 1IYJB 5EBDA 1A62A 1PMRA 1W6KA 1B70B 1S5FD 3MTSA 1YJWA 1HQRD 3VA5A 1VMPA 1YZ6A 1XPRA 2RDGA 3DM1A 3ONAB 5HY6A 2BDOA 2F0LA 1RHPA 4A3FB 1DONA 3CQZH 1BF4A 3SE0A 4R4TA 1DZ1A 5FJ8H 2K75A 1HJPA 1Q1BA 3W1BA 1ZEQX 3H91A 4JI2Q 1I4GA 1F9QA 3H0GG 1EY9A 1OXUA 4JBJA 2OCEA 2JEAI 2NYZD 4IN3A 3MXUA 2F03A 1HA6A 2Q2UA 1ASYA 3MXGA 4DV4L 5IODA 2L11A 2ZJRA 1WTOA 4GKJQ 5E1FA 3SDZA 2Z6KC 1PFNA 4X6AH 2A5HA 1AN8A 4U673 1QWYA 2E2IH 4TVAB 1B2TA 3RZOB 4OO1H 4LF7L 1HZ9A 4QIWE 5FO9B 2KCMA 2RBMA 2Q8TA 2UUAL 2B2WA 2BOSA 3CCMA 1L2FA 3HOUG 1LTRD 4L8JA 5FKAC 2I0QA 1H9RA 4OO1G 4DK0A 2QW7A 2DJFC 1QZHA 3HP3A 5FOBB 4NW2A 2BA1A 2B63H 2K5NA 5EKIA 3HFZB 1PTOC 3MA2B 2FHTA 1HNZL 1A2UA 1HUMA 1STAA 3QWNA 1FJGQ 3T56B 1EFID 4XIGS 1TVXA 2F0FA 2JN4A 1DD2A 3EROA 3KJPA 4A4IA 5FLXE 1MBYA 1PFSA 3I72A 4YIJA 4H44C 4WJWA 4JPBW 4DK6C 1SEBD 4V190 5KEEA 2A6HD 1S5DD 4O0AA 3S24A 4DV6L 3FPPA 4GNXB 1EL0A 5BN5A 4MZ9A 2F0TA 1A2TA 1B9MA 3J80E 2WKDA 3T13A 4KTAA 3HRZC 2XWBB 1K9MC 3H09A 1U4RA 1SFOB 4QIWB 2MPMA 2ZTCA 5D14A 4DV6Q 2KJXA 3HKZG 2IPKD 2N49A 2NVQB 4CGYB 1C7YA 1CUKA 3K57A 1I94L 3TSSA 1PH9A 2F0QA 4KD4A 4YCUA 4A75A 3MC0B 1LT3D 4NP5A 3VYSA 2EZVA 1DOKA 1G91A 1CKNA 4C3HH 1X32A 4UPAA 2PNRC 2YTYA 1GXDC 1V1PA 4G57A 4QCLA 1BCPC 3TEHB 1U4PA 4JI6Q 3H3VC 4HTHA 3V05A 3QO2A 5IP9G 3T4AC 1TQOA 1QVCA 5C4XH 2BH8A 4DK3C 2O5JC 1PH8A 1X3EA 2F0VA 3F8TA 2JA6G 3SK5A 3L2PA 1SR3A 4AQYQ 4AYBE 2IJ0A 1JOQA 4X3SA 4LF7Q 3KLSX 1TWCB 5C6AA 1EU4A 4X65L 1I94Q 3TQYA 3NP8A 4A3DB 1EY6A 1MSHA 2CCZA 1BUVT 2SNSA 1S5ED 3K81C 2JA5B 2KCCA 3MXPA 1EIFA 4L5SA 1D5ZC 2L4NA 4KV6A 3CPWA 1O7LA 2B8GA 3A5ZB 4HAEA 1TY2A 2B2TA 4JC0A 1IBKL 4R8IA 1BNZA 5GAEC 2F0WA 2UU9L 2JA8G 4YCWA 1HA5A 5G3LD 1TWAB 2K5WA 2NVTH 4OGQC 3VYTA 2EIFA 4K0KL 5EPLA 1CHPD 2EOTA 1WFQA 4J15A 2Q2HA 2ZJPA 2F0IA 4H02A 1SSOA 2HHHQ 2ZJQA 3TP6A 2C35B 4AH6A 1YI2A 3I3CA 3VYRA 2EJMA 3TS0A 5ELDA 3NUCA 1N8RC 1EY0A 4WFN3 1H9SA 1G291 1T5EA 3SK8A 1Q81C 4CKCA 1ESRA 3NHHA 5CV8A 5ISRA 2F4VQ 1UE6A 3NXWA 3P20A 1GKHA 4Y52H 4H7BA 1Q3LA 2QDLA 2WACA 1XTCD 3EIVA 3GTJB 4RGNA 1D5XC 4UP8A 4JI7L 1EOVA 1NCVA 2L9HA 1PYWD 1WD1A 3NBHB 3M7NA 3VR2A 3GP7A 4YHHL 1BXTA 3R2IA 1PFMA 4DGZA 1GHJA 1H9KA 1SYEA 1VQIA 4FYDA 3HOVG 4P71A 1BCPF 1Z6HA 1EFWA 1Y8PB 1K28A 1PH5A 4G4KA 3M9BA 1VQLA 2AWNA 1DCZA 3EFXD 1X3QA 5KNBA 2K1BA 5JJIA 1YNJC 1GUNA 2EY5A 3L3OC 3FEWX 4IJLA 2F0OA 1RF2D 3LGJA 2ATWA 3AFPA 3CRKC 3PV0A 5D65A 4PNYA 5CGKA 4HJ7A 3CC4A 1XPUA 4MNOA 4PZ7A 1J9OA 3HOYG 1M8AA 2NTTA 2MUYA 4F87A 3HOWG 4NXNL 1PTOB 4R9WA 2QA4A 1ET6A 2F3VA 4LUZA 4MIUA 4DXFA 4LFBL 5C5LA 3KOJA 2LMCB 2VQFL 4DV7Q 2L5TA 1BKBA 1OXVA 4PMWA 4GZYC 2CH4W 3BDLA 1EEFD 3KLRA 1E0BA 5IGEA 1YJ9A 1H9SB 5JJKA 3A8JE 3LWUA 1ML0D 1TWHB 1X54A 2HDMA 1VQ9A 1G51A 2KCNA 4LF9Q 1KNAA 1FD7D 4CKEA 4AYBG 4A76A 4DR4Q 1K3BC 1HCZA 3NSWA 2WP8J 4A3KG 4K5VA 5IP7H 2PW7A 3A74A 3PIPA 1I50H 1MD2D 4X65Q 3S16B 2UUBQ 5IT9c 4DV7L 4KY5A 3J80c 4ZYSA 1YNND 4BXXG 2E2JB 3U9OA 1SMYC 2E2HH 4H0LC 3J7ZC 2EYOA 5K36G 5DM73 2EJFC 3J7AF 5J22A 1QILA 3AYHB 5C4XG 5IYBG 4DV0L 1BQQT 3CCQA 2ENBA 5IYDH 4DUZQ 4ILWA 2E5LL 1SDFA 1GUWA 2D5DA 2MP1A 3K5MA 4DR1L 4NPSA 2NZOA 2B2WC 4N9PA 4YWMA 1YIJA 2H1EA 2WAQE 4G7ZC 2UXBQ 4AQYL 1BOSA 2HQLA 3D0FA 2JEBI 2Z8LA 2L15A 5I9OA 5CV4A 3IL8A 1PV4A 1U9RA 1Q8IA 1V1OA 5CV9A 4HJAA 1JWMD 1VQGA 3F2CA 2DUDA 1FL0A 5E4XA 2F3WA 2WB1B 2NVYB 1B9NA 4KY7A 4LFCL 4DR3L 4A3MH 1IKMA 2K14A 3T1HL 1C8CA 2FMCA 2VB3X 5IWAL 2Y0SE 1HR0L 4M1UB 4WRDA 4JYAQ 3CQZB 4ID6A 3RLNA 4DFAA 2G9DA 2C5CA 5KYIA 5JEAG 5C44H 1WTRA 5AJ3L 1QJOA 3U4ZA 2Y0SB 5LMNQ 3G6EA 4DAYA 3QG1A 2WB1E 2ID0A 3U4VA 4CJ0B 2UU9Q 3HOYH 4OELB 3J7AV 4KHPL 1IHZA 4RCNA 4RH6A 1UE7A 2LXKA 1N36Q 1TWAH 5C44B 1HFNA 4BY1B 3RN2A 1HNXL 4A3BB 2F0MA 1JJCB 4QL5A 2HCCA 3I2ZA 2BE5C 1TWGB 3AEVA 4A3CG 4DR3Q 3RNUA 2NVTB 1TS5A 1KQSA 2XWJB 5T1IA 3UDGA 3HOVH 4R4QA 4LF6L 1E2VA 2IL8A 1VQEA 2QILA 4FNFA 4A3JG 1D5MC 4C3JH 2YU9B 1TT2A 4A3DH 3BJUA 2PMZB 3D4DA 3S2HH 1EY8A 3EJIA 1EQVA 3AB9A 4PMCA 3K5NA 4YWLA 2HUGA 4FF3A 1RIPA 3D6CA 1VQOA 4DNTB 1AP0A 4XT1B 1TU2B 5ELCA 4PV1C 4P74A 5C0XH 2X6GA 2F0DA 2A73B 4L5QA 1I3QB 1Y1WH 4CDFC 3Q23A 3I70A 1Q82C 2UUAQ 1WCMB 1QB5D 1RL2A 3AQQA 1NBWA 1GUGA 2BA0A 2XSCA 1PRTC 2JE6I 2D9UA 2ICIA 4B9XA 3F2BA 2M00A 2RKSA 2KUMA 3Q8DA 5EBCA 1E3PA 2LSSA 1KLUD 1F2LA 3I4NG 2DY8A 2JXMB 3U9SA 4EQNA 1S40A 1ZYRC 5KNCA 2AQ2B 2A8VA 5IE8A 4LF9L 4DV4Q 2KENA 2E76C 4KJOA 3OTOQ 3CXCA 4A3FG 3B6YA 2RDHA 4R4IA 2O4XA 1NSNS 4JI4Q 2R7ZB 2XRSD 1PTOF 1RODA 3QOLA 1STYA 1JJGA 4HR7B 1NR4A 4NDXA 1PH6A 2R7DA 4HCSA 4E6IA 1YNNC 3TREA 1E2WA 3L9AX 3R3OA 4DAYB 1P16A 1BDOA 2K6AA 1HH2P 1WTQA 2R92H 1HXYD 3MEHA 1IBML 4ZK9B 1D7QA 2FFKB 1JJ2A 1BCPB 1V1QA 3QJYA 1HNXQ 1VQPA 1QNUA 4IUTA 5COYA 1AZQA 1CSPA 2ZTEA 4EX5A 1T5XD 3CMEA 4POGA 5JPMC 4X64Q 1GD7A 1PDQA 2XGTA 3JAML 4JOIC 1X65A 3DLLA 1BBWA 4DUYL 2JSOA 1F2ZA 4OIKA 4A3JH 3K7AB 2NVXB 5DLQE 2SEBD 4JV5Q 3SHLA 1G2SA 4K6DA 3GTLH 1KD1C 2K5DA 3E6ZX 1SE2A 1XYIA 4DV3Q 3I56A 3S1MH 2F0UA 1YNJD 1L1OB 2X6LA 2G9HD 1ENFA 4Y7NB 3PO3H 1FVIA 4GOPC 1H95A 5DNFA 2CW0D 1Y1WB 1VQHA 3KFUA 1GVPA 1SYCA 5I2XA 2O5IC 1YITA 4X64L 1U5KA 1UWVA 2PI2E 3RLOA 1PH2A 1JICA 3DEPA 5AJ3Q 4TRDA 1FYCA 2GA4B 1NE3A 3UE1A 3NWTA 5ELEA 5CC4A 1KC8C 1R9TB 1HNWQ 1PZKD 5C3EB 4HJ5A 2F0PA 4LAAA 1EY7A 3WOEA 4HN7A 4OXPA 5GQOA 1LACA 2E5LQ 3BDCA 2MHVA 4R4OA 4A3GH 3DHQA 1IL8A 2MGSA 3I90A 4DA2A 1KXLA 1KAWA 1K8GA 2GN5A 3FPUB 3A55A 4A93H 1PYSB 2K5HA 3H0GB 3X3MA 3JAMi 4RGOS 1WI5A 3QIAA 2WV6D 1D2BA 4NB3A 4A3JB 3SVMA 1KIXA 4BA2I 4A3BH 3MVVA 4C3IH 1PVOA 4HIDA 1M4VA 1XMQQ 2NN6I 4ABNA 1STNA 1L0XB 1Q12A 4C3HG 1HNWL 1L0YB 2A6HC 2NBFA 3KF6A 4L63B 1STHA 2ZM6L 3DWAA 2I5LX 3KDFA 4XTCS 4DV5L 3TZDA 2RHQB 4IQZA 3CHBD 4CHTB 3K5LA 4A3EG 4JI8Q 3TZUA 1XNRL 3CCVA 4DR2Q 4LMQD 1ILQA 4HJ8A 1QE6A 1X3GA 2D0OA 3VR4A 1RJTA 3A8IE 2FINB 2VXWA 2ZXRA 2LY7A 2K04A 5EJWA 1TS4A 1STGA 1CHQD 3RD4A 4ZKCB 5LMNW 5IGFA 1Q7YC 3GTGB 1GUTA 1BBXC 2NWGA 5KNDA 1JCKB 4ZAIA 3Q6SA 1N32L 1BCPD 2Q2TA 2IHEA 5CR3A 1S72A 3HOZG 3I91A 4FXGC 3TP5A 4O42A 2AQ1B 4JOIA 1K83B 5HGTA 4KJNA 4B3RL 1AZPA 4P73A 1HNZQ 4JI5Q 5M5YH 1Q1EA 2A1AA 1F2MA 1S5CD 1SJHD 1Y1VB 3BG3A 5BR8Q 3WDNA 4X62L 1H9JA 3PUZA 1J5EQ 4C56C 1NY4A 4C3HB 4GKKQ 1II3A 4P75A 2UXDQ 2QEXA 4RG1A 2VZAA 3M7GA 1TWFH 3UDFA 5EQ0A 2XRQD 1N33L 2KQ3A 3PGZA 4FXKC 5ELBA 4KHZA 4L5RC 1IXRA 4A3DG 1CA5A 1Q46A 3D6WA 5G3LF 1IBKQ 4OEMB 4B3SL 1OXXK 4J8QA 4CKBA 5DEHA 4UDUC 2I5HA 2A6EC 2O2LD 2CQOA 3TS2A 1FNUA 2K50A 5NUCA 4Z9CB 2JYOA 1EYAA 3GTMH 1VS0A 1Z47A 3H15A 5GADC 2CQAA 3E9IA 1X3PA 1XNRQ 2KVMA 4JI8L 1I6HB 4ULLA 1G2TA 3E3XA 2B2YC 1LTBD 4HSVA 1P8LA 4DF7A 3W5OA 3Q22A 2NN6H 4LF8L 3RLFA 4RMFA 1A15A 5M3FH 3KYHC 3GTPB 1M1KC 5FK9C 1JC7A 5C4JB 1EQQA 4BY7H 4QUCA 5CMDA 4LFAL 4Q0FA 2IX3A 3MXNA 3OYYA 4YY3L 3OW2A 2WAQB 5J39A 3Q0AA 2Z6BA 3BZCA 4C2MB 4X3UA 2B2UC 1K8MA 5CV5A 2TSSA 4C3IG 1MJEA 5M3FB 1SE3A 3UE0A 3I55A 3KJOA 4L6TB 3CCUA 4IFDI 1X9NA 3CW2C 2N3SA 2OEOA 3DMUA 3J81E 2F0SA 3QR8A 3C2PA 1PZID 2Z4HA 1EWCA 5FLXc 1SNDA 1S5BD 1SNOA 1BVSA 3ULLA 1O80A 5C0XJ 4EQOA 2AMCB 2PQAB 4JI1Q 3P7JA 3PF5A 1SROA 3MHBA 4N9TA 3CCSA 3K0XA 4LFBQ 1NNXA 5ELNA 4HMJA 3JAME 4IOCA 3HOZH 1PZJD 1AE2A 3FP9A 4ALPA 2EDGA 2H5XA 4B9WA 2DGYA 4JBWA 3RUZA 1ICWA 1KTKA 4FF1A 2E2JH 3LWEA 4RCOA 3C3LA 2IT1A 4KMUC 2BCOA 4YWKA 1UE5A 4JI1L 5I2YA 3NQTA 4QGUA 1XTDA 3R2TA 4GS3A 3G7LA 1N36L 3K7AH 2JA9A 2NVXH 1B50A 4JI3Q 3UDIA 3J80L 4GLXA 3H3VH 4KK7A
chains in the Genus database with same CATH topology
5LMNQ 4DV0Q 2VY3A 3L0OA 3G6EA 3CC7A 1X6OA 5ELOA 1SLJA 2VUMH 2K52A 4LF4L 1I3QH 1EQRA 2JA6H 4POFA 4IFDG 3E0EA 4DAMA 4IJHA 3PCOB 3STBD 2WB1E 2ID0A 3U4VA 2D0PA 3F1ZA 2VQEQ 4IFDJ 4UY8C 1GO3E 2UU9Q 3ICEA 3HOXH 3HOYH 1GM5A 4JI4L 3GTQH 3HOWH 4DR5L 1K83H 4DR6L 4A3CH 3T1YL 4KHPL 2LXJA 4LFAQ 1UE7A 2LXKA 1PYBA 1TWAH 1N36Q 3RN2A 1HNXL 4X66Q 5JEAJ 1JJCB 4QL5A 4X62Q 4A3IG 5LMUL 2R7FA 3KF6B 3I2ZA 2B63G 3A0JA 2RHSB 5M3MH 4DKAC 4LF8Q 1JMCA 3ZJYC 4GNXA 3AEVA 1WYDA 4A3CG 4DR3Q 3RNUA 1JE5A 3T1YQ 4DUZL 2JA7G 4GOPB 1VQDA 4P72A 3I4NH 4KHPQ 2MO0A 1YVCA 5C3EG 1KQSA 3SGIA 1PHJA 3UDGA 3HOVH 3CC2A 4R4QA 2VQEL 4LF6L 2KHJA 3A5UA 3W1GA 1MIUA 2NVQH 4LF5L 1VQEA 4A3JG 4NXNQ 4C3JH 1IZ6A 4A3DH 3M85A 2R93H 2F3IA 4DV2L 2ASBA 4JI2L 4KLKA 3BJUA 3STBC 1SFOH 4WJ4A 2WAQG 1QVGA 2JA5G 2YU9H 1KRSA 4A3GG 2YV5A 2WB1G 4LW1A 1C9OA 4GNXC 1FJGL 3EBEA 4OX9L 4JI3L 1Y1WG 1M90C 4HJ9A 1L1OA 2UUCL 3M3YH 4DR4L 4YWLA 1X3FA 1RIPA 1NMFA 1VQOA 4A3MG 2CWPA 1E1OA 5IP9H 1TWCH 3PUYA 4P74A 1XNQL 4DV3L 1EWIA 2D62A 3K8AA 1VQ5A 1NMGA 1SRUA 2V1CC 4L5QA 1Y1WH 4BY1H 4A3BG 4DR7Q 1XMOQ 2E8GA 3PO2H 2CWAA 4YHHQ 2VQFQ 1Q82C 3KDFB 3K80C 2UUAQ 5GAGC 1RL2A 3AQQA 1NBWA 2BA0A 1IYJB 4DUYQ 2IX1A 1A62A 2KCTA 2JE6I 3S15H 1B70B 5HGQA 1YHQA 3F2BA 5E7NA 1YJWA 1HZAA 3Q8DA 1E3PA 2LSSA 3FHWA 3NEMA 1YZ6A 1YJNA 5FLMH 1XPRA 1J5EL 2JA7H 4JBMA 3I4NG 4UP7A 4GOPA 5HY6A 1S40A 2VS1A 2F4VL 3CQZH 2A8VA 5IE8A 4GKKL 4LWCA 4LF9L 4R4TA 4DV4Q 2KENA 5FJ8H 2R7ZG 2K75A 1HJPA 1Q1BA 3W1BA 2EXDA 3OTOQ 3CXCA 4A3FG 3B6YA 5IYDG 4R4IA 1K3RA 3F2DA 3RZDH 4JI4Q 1A63A 4JI2Q 3I4MH 1OXSC 1E22A 3H0GG 1O7IA 1L0WA 2CKZB 4JG2A 3J81j 1OXUA 4JBJA 1C0AA 2OCEA 1JJGA 2JEAI 1AH9A 4A93G 1N32Q 4A3LH 2Z0SA 2JQOA 2ES2A 3PUWA 1PH6A 2R7DA 2R93G 2Q2UA 3G71A 1VQMA 3TREA 1S3OA 1ASYA 4DAYB 1D8LA 3PUVA 4TQUS 4DV4L 3CMAA 1P16A 2K5VA 5GAHC 3JAMc 1HH2P 2ZJRA 4GKJQ 2R92H 1IBML 1VQ4A 2Z6KC 2KBNA 1D7QA 2OWOA 1JJ2A 1V1QA 4X6AH 1HNXQ 1T9HA 2I5MX 1OXTA 3I4OA 1VQPA 2E2IH 4TVAB 1HZCA 2QGQA 4EQ5A 1CSPA 2ZTEA 4EX5A 3CMEA 4POGA 4LF7L 1HZ9A 4X64Q 1GD7A 2XGTA 4QIWE 2KCMA 1A8VA 4JOIC 1WCMG 2WFWA 2UUAL 2XTIA 1X65A 5LMNL 3DLLA 2MFIA 1BBWA 3CCMA 3S1QH 4DUYL 1DGSA 1L2FA 3J81c 4A3JH 3HOUG 5M5WH 5DLQE 1N33Q 4JV5Q 2I0QA 4A3FH 2JA8H 3CCRA 3L7ZC 1SMXA 4OO1G 3GTJH 3GTLH 3WWVA 1KD1C 1QZHA 2NVYH 4JI0L 3PF4A 2VW9A 3J7A5 4DV3Q 3I56A 3S1MH 4B3MQ 2BA1A 2GVAA 2UUCQ 2K5NA 2B63H 1L1OB 1QUQB 1N9WA 2UXCQ 1WJJA 3HFZB 1NTGA 1HNZL 4GLAC 1EIYB 1FVIA 4DR5Q 4IPGA 3S14H 1K8AC 3PO3H 4DR6Q 1X55A 4GOPC 4DPGA 1FJGQ 4DV2Q 1H95A 4XIGS 2MO1A 4DV1Q 3VDYA 4JCVE 1CKNB 1VQHA 3KFUA 5JJLA 3KJPA 1GVPA 4A4IA 4LNQA 1OTCA 1PFSA 4BY1G 1YITA 4X64L 1U5KA 1UWVA 2PI2E 3RLOA 4DK6C 1PH2A 3PO2G 5AJ3Q 2N8NA 1QVFA 4O0AA 1PA6A 3CCJA 3S24A 4DV6L 3S2DH 1NE3A 3UE1A 2Z6KA 4GNXB 1VQKA 4MZ9A 3RN5A 1ASZA 4PZ8A 4YY3Q 1KC8C 1HNWQ 3J80i 5LMUQ 1L1OC 4HJ5A 2IX0A 3GO5A 2OQKA 4O2DA 1K9MC 2R92G 2HIXA 4OXPA 5J3BA 5GQOA 3GTKH 2ZTCA 2E5LQ 4DV6Q 3HKZG 2N49A 2RF4A 4R4OA 2JA5H 4A3GH 3FKIG 4IO9A 2NN6G 5AJ3L 1KAWA 1C7YA 1K8GA 1E7ZA 2GN5A 4HIKA 3GTOH 1KXLA 4A93H 4QJFA 1YHBA 1G6PA 2K5HA 1PYSB 1CSQA 4FDBA 1CUKA 1I94L 4LUVA 1PH3A 1LM0A 3JAMi 1PH9A 4BBRG 1PH4A 4YCUA 4DV1L 1WI5A 3IRBA 2PQAA 4A75A 3CD6A 3HOUH 1VQFA 4IPHA 4NB3A 1CKNA 2JJQA 4C3HH 4UPAA 3OTOL 2YTYA 1KIXA 4BA2I 4A3BH 4DR7L 4C3IH 1PVOA 4HIDA 5M3MG 1XMQQ 1Y1VG 1LYLA 1MJCA 3TEHB 3T1HQ 1SE8A 2IHFA 4LFCQ 3H3VI 4JI6Q 1QUQA 1HR0Q 1I5FA 5IP9G 2NN6I 4NXMQ 4NXML 3ER0A 4OO1I 1Q12A 1YEZA 1E1TA 3D31A 1HNWL 1QVCA 3KF6A 5C4XH 2BH8A 1AE3A 1QZGA 4DK3C 3RR5A 2ZM6L 3KDFA 2I5LX 4XTCS 4BBRH 4DV5L 1PH8A 4OWWB 1X3EA 2RHQB 3F8TA 4GN3B 2JA6G 1KL9A 2MQHA 3L2PA 1SR3A 4AQYQ 4OWXB 4PZ6A 4AYBE 1VQ6A 3G4SA 2VUMG 1HR0W 3K7UC 2B29A 3MXNB 4LF7Q 4A3EG 1XMOL 4JI8Q 1UE1A 3S17H 4A3LG 2AWOA 1XNRL 4LUOA 3CPFA 4X65L 3CCVA 3TQYA 4DR2Q 1I94Q 4HJ8A 1JT8A 1X3GA 4R4CA 5C0XG 3J81i 1N34Q 2D0OA 3H0GH 1VQNA 3I4MG 4IPCA 3GD7A 4PG3A 1Q86C 2CCZA 1V9PA 3KLWA 5IYCG 4YCVA 3K81C 1IBMQ 1HZBA 2CFMA 4GKJL 2R7ZH 2PI2A 5LMNW 1EIFA 1V43A 1Q7YC 4L5SA 4AIMA 1IBLL 3GTGH 3CPWA 3A5ZB 3KF8B 4MTNA 1IBKL 4JC0A 2AKWB 2OTLA 3ULPA 5M5XH 1N32L 1XPOA 2Q2TA 2IHEA 5GAEC 2UU9L 2JA8G 4YCWA 1S72A 2MNAA 2K4KA 4BA1I 3U58A 1JB7A 2NVTH 3CF5A 3HOZG 3HKZE 2EIFA 4JOIA 2EQSA 4QY7A 5IY0A 4K0KL 2UUBL 2R6GA 1WFQA 3PIOA 1IL2A 4B3RL 4IOAA 4J15A 1MKHA 2Q2HA 1W3SA 4P73A 4H02A 5C44G 2ZJPA 1HNZQ 2HHHQ 2ZJQA 4JI5Q 2C35B 4AH6A 1YI2A 2OTJA 1Y14B 5M5YH 1VCIA 1YBYA 1Q1EA 2A1AA 2PMZE 3TS0A 4B3TQ 1Y1VH 3S1RH 1N8RC 5BR8Q 1VQ8A 5BR8L 4X62L 1B8AA 1YNXA 3PUZA 1J5EQ 1G291 1Q81C 1NY4A 4UP9A 4GKKQ 4P75A 3S1NH 1EYGA 2F4VQ 3NELA 2NZHA 2UXDQ 1UE6A 2QEXA 1GKHA 4Y52H 2AHOB 4RG1A 1XJVA 1FGUA 2VZAA 2VNUD 2HIVA 1TWFH 3CP0A 3EIVA 3GDEA 3UDFA 3M4OH 4UP8A 4C2MH 4JI7L 4BXXH 1EOVA 1X56A 1N33L 4JV5L 3NBHB 3M7NA 3FKIH 3M4QA 3PGZA 4KHZA 4YHHL 4L5RC 1IXRA 1VQBA 4A3DG 1TWHH 1Q46A 3PO3G 1VQIA 3HOVG 2ZM6Q 1IBKQ 4B3SL 3CAMA 1J6QA 4P71A 5GROA 1OXXK 1XNQQ 1EFWA 2UXCL 5C3EH 1PH5A 3ULJA 2Q2IA 2I5HA 3M9BA 1VQLA 2CQOA 1K73C 2AWNA 1PH7A 1A0IA 3TS2A 2K50A 5FJ8G 4B3TL 3BU2A 1XMQL 5JJIA 1Q8KA 4R1JA 3EN2A 3GTMH 1TWGH 1K0RA 1VS0A 1W2BA 1Z47A 3HKSA 4IJLA 3H15A 3LGJA 5GADC 2ATWA 3AFPA 4APVA 3PV0A 4HJ7A 1BBUA 1XPUA 3E9IA 1YHAA 4MNOA 4PZ7A 3CC4A 3HOYG 4HIMA 5EAYA 4JBKA 1XNRQ 3AFQA 3HOWG 4NXNL 4JI8L 4LF5Q 2VL6A 3HOXG 1U0LA 2QA4A 4LUZA 4LFBL 3KOJA 4Y7NH 3E9HA 2VQFL 4JI7Q 4QQBX 4DV7Q 1P8LA 1PH1A 2YTVA 1BKBA 1OXVA 4PMWA 3W5OA 2UXDL 2HT1A 4LF8L 3RLFA 4RMFA 4DR1Q 5IP7G 1YJ9A 2KHIA 5M3FH 3KYHC 4A3KH 3CCLA 5JJKA 2PNHA 5FLMG 1VQ7A 4GN4B 3S16H 1M1KC 2OQ0A 1X54A 1EQQA 4BY7H 1VQ9A 1G51A 4X66L 4LFAL 4LF9Q 2BH2A 1WOCA 1VQJA 4A76A 4DR4Q 3OYYA 4AYBG 4KI0A 4YY3L 3OW2A 5IYCH 2WP8J 1VQCA 5IYBH 5M3FG 4A3KG 3BZCA 5IP7H 4A3EH 3A74A 2HHHL 3PIPA 1I50H 3M4PA 4JI5L 4GN5A 4X65Q 2UUBQ 2Y0SG 1MJEA 5IT9c 4K0KQ 4DV7L 4B3RQ 3J80c 1Z9FA 4LF4Q 4L5TA 3UE0A 3KJOA 3PSIA 3I55A 2E2HH 4BXXG 5K36G 3J7ZC 3CCUA 4IFDI 1X9NA 4LF6Q 2GVBA 1E24A 2N3SA 3CW2C 3AYHB 4BBSH 5C4XG 5IYBG 4DV0L 1SN8A 2ZTDA 3CCQA 4DV5Q 5IYDH 1WCMH 2YYZA 4DNIA 4DUZQ 1CKMA 1IBLQ 3GTPH 5IWAQ 3BZKA 2E5LL 5FLXc 3RZOH 1R9TH 4JYAL 1BVSA 3I7FA 4IPDA 2F52A 3ULLA 4B3ML 4A3IH 5C0XJ 4HIOA 4DR1L 4WJ3M 4NPSA 2PQAB 2AMCB 2JK8A 2NZOA 4JI1Q 4DR2L 4YWMA 1KHIA 3PF5A 4OX9Q 1SROA 4OWTB 1EUJA 1N34L 3TRZA 1I6HH 2ALYB 3PUXA 4ME3A 3CCSA 3K0XA 4LFBQ 1YIJA 1VQAA 4B3SQ 5H1SE 5ELNA 2WAQE 2UXBQ 2A19A 5C0XI 1TXYA 4BBSG 3G48A 3U50C 4AQYL 4IOCA 2YTXA 2HQLA 3D0FA 2JEBI 3HOZH 1NJIC 1AE2A 3FP9A 3DM3A 4ALPA 2L15A 2H5XA 2DGYA 4JBWA 1PV4A 1LTLA 4OONA 4HJAA 2E2JH 2UXBL 1VQGA 3F2CA 2DUDA 1FL0A 3CCEA 3NENA 2B3GA 2IY5B 2FXQA 4LFCL 2IT1A 3JC66 4DR3L 4A3MH 4JI1L 2K14A 1UE5A 4YWKA 3T1HL 3ERSX 3S2HH 4QGUA 1XTDA 2N78A 4GS3A 5IWAL 4JI6L 2Y0SE 4BY7G 3UDXA 1HR0L 1B7YB 1KRTA 1N36L 4JI0Q 3MEFA 3K7AH 2JA9A 2NVXH 4JYAQ 1CKOA 3RLNA 4JI3Q 4GLVB 3UDIA 4GLXA 5C4JH 3H3VH 1LUZA 2RCNA 5JEAG 5C44H 1UEBA 3U4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN Q;  4DV0 Q;  2VY3 A;  3L0O A;  3G6E A;  3CC7 A;  1X6O A;  5ELO A;  1SLJ A;  2VUM H;  2K52 A;  4LF4 L;  1I3Q H;  1EQR A;  2JA6 H;  4POF A;  4IFD G;  3E0E A;  4DAM A;  4IJH A;  3PCO B;  3STB D;  2WB1 E;  2ID0 A;  3U4V A;  2D0P A;  3F1Z A;  2VQE Q;  4IFD J;  4UY8 C;  1GO3 E;  2UU9 Q;  3ICE A;  3HOX H;  3HOY H;  1GM5 A;  4JI4 L;  3GTQ H;  3HOW H;  4DR5 L;  1K83 H;  4DR6 L;  4A3C H;  3T1Y L;  4KHP L;  2LXJ A;  4LFA Q;  1UE7 A;  2LXK A;  1PYB A;  1TWA H;  1N36 Q;  3RN2 A;  1HNX L;  4X66 Q;  5JEA J;  1JJC B;  4QL5 A;  4X62 Q;  4A3I G;  5LMU L;  2R7F A;  3KF6 B;  3I2Z A;  2B63 G;  3A0J A;  2RHS B;  5M3M H;  4DKA C;  4LF8 Q;  1JMC A;  3ZJY C;  4GNX A;  3AEV A;  1WYD A;  4A3C G;  4DR3 Q;  3RNU A;  1JE5 A;  3T1Y Q;  4DUZ L;  2JA7 G;  4GOP B;  1VQD A;  4P72 A;  3I4N H;  4KHP Q;  2MO0 A;  1YVC A;  5C3E G;  1KQS A;  3SGI A;  1PHJ A;  3UDG A;  3HOV H;  3CC2 A;  4R4Q A;  2VQE L;  4LF6 L;  2KHJ A;  3A5U A;  3W1G A;  1MIU A;  2NVQ H;  4LF5 L;  1VQE A;  4A3J G;  4NXN Q;  4C3J H;  1IZ6 A;  4A3D H;  3M85 A;  2R93 H;  2F3I A;  4DV2 L;  2ASB A;  4JI2 L;  4KLK A;  3BJU A;  3STB C;  1SFO H;  4WJ4 A;  2WAQ G;  1QVG A;  2JA5 G;  2YU9 H;  1KRS A;  4A3G G;  2YV5 A;  2WB1 G;  4LW1 A;  1C9O A;  4GNX C;  1FJG L;  3EBE A;  4OX9 L;  4JI3 L;  1Y1W G;  1M90 C;  4HJ9 A;  1L1O A;  2UUC L;  3M3Y H;  4DR4 L;  4YWL A;  1X3F A;  1RIP A;  1NMF A;  1VQO A;  4A3M G;  2CWP A;  1E1O A;  5IP9 H;  1TWC H;  3PUY A;  4P74 A;  1XNQ L;  4DV3 L;  1EWI A;  2D62 A;  3K8A A;  1VQ5 A;  1NMG A;  1SRU A;  2V1C C;  4L5Q A;  1Y1W H;  4BY1 H;  4A3B G;  4DR7 Q;  1XMO Q;  2E8G A;  3PO2 H;  2CWA A;  4YHH Q;  2VQF Q;  1Q82 C;  3KDF B;  3K80 C;  2UUA Q;  5GAG C;  1RL2 A;  3AQQ A;  1NBW A;  2BA0 A;  1IYJ B;  4DUY Q;  2IX1 A;  1A62 A;  2KCT A;  2JE6 I;  3S15 H;  1B70 B;  5HGQ A;  1YHQ A;  3F2B A;  5E7N A;  1YJW A;  1HZA A;  3Q8D A;  1E3P A;  2LSS A;  3FHW A;  3NEM A;  1YZ6 A;  1YJN A;  5FLM H;  1XPR A;  1J5E L;  2JA7 H;  4JBM A;  3I4N G;  4UP7 A;  4GOP A;  5HY6 A;  1S40 A;  2VS1 A;  2F4V L;  3CQZ H;  2A8V A;  5IE8 A;  4GKK L;  4LWC A;  4LF9 L;  4R4T A;  4DV4 Q;  2KEN A;  5FJ8 H;  2R7Z G;  2K75 A;  1HJP A;  1Q1B A;  3W1B A;  2EXD A;  3OTO Q;  3CXC A;  4A3F G;  3B6Y A;  5IYD G;  4R4I A;  1K3R A;  3F2D A;  3RZD H;  4JI4 Q;  1A63 A;  4JI2 Q;  3I4M H;  1OXS C;  1E22 A;  3H0G G;  1O7I A;  1L0W A;  2CKZ B;  4JG2 A;  3J81 j;  1OXU A;  4JBJ A;  1C0A A;  2OCE A;  1JJG A;  2JEA I;  1AH9 A;  4A93 G;  1N32 Q;  4A3L H;  2Z0S A;  2JQO A;  2ES2 A;  3PUW A;  1PH6 A;  2R7D A;  2R93 G;  2Q2U A;  3G71 A;  1VQM A;  3TRE A;  1S3O A;  1ASY A;  4DAY B;  1D8L A;  3PUV A;  4TQU S;  4DV4 L;  3CMA A;  1P16 A;  2K5V A;  5GAH C;  3JAM c;  1HH2 P;  2ZJR A;  4GKJ Q;  2R92 H;  1IBM L;  1VQ4 A;  2Z6K C;  2KBN A;  1D7Q A;  2OWO A;  1JJ2 A;  1V1Q A;  4X6A H;  1HNX Q;  1T9H A;  2I5M X;  1OXT A;  3I4O A;  1VQP A;  2E2I H;  4TVA B;  1HZC A;  2QGQ A;  4EQ5 A;  1CSP A;  2ZTE A;  4EX5 A;  3CME A;  4POG A;  4LF7 L;  1HZ9 A;  4X64 Q;  1GD7 A;  2XGT A;  4QIW E;  2KCM A;  1A8V A;  4JOI C;  1WCM G;  2WFW A;  2UUA L;  2XTI A;  1X65 A;  5LMN L;  3DLL A;  2MFI A;  1BBW A;  3CCM A;  3S1Q H;  4DUY L;  1DGS A;  1L2F A;  3J81 c;  4A3J H;  3HOU G;  5M5W H;  5DLQ E;  1N33 Q;  4JV5 Q;  2I0Q A;  4A3F H;  2JA8 H;  3CCR A;  3L7Z C;  1SMX A;  4OO1 G;  3GTJ H;  3GTL H;  3WWV A;  1KD1 C;  1QZH A;  2NVY H;  4JI0 L;  3PF4 A;  2VW9 A;  3J7A 5;  4DV3 Q;  3I56 A;  3S1M H;  4B3M Q;  2BA1 A;  2GVA A;  2UUC Q;  2K5N A;  2B63 H;  1L1O B;  1QUQ B;  1N9W A;  2UXC Q;  1WJJ A;  3HFZ B;  1NTG A;  1HNZ L;  4GLA C;  1EIY B;  1FVI A;  4DR5 Q;  4IPG A;  3S14 H;  1K8A C;  3PO3 H;  4DR6 Q;  1X55 A;  4GOP C;  4DPG A;  1FJG Q;  4DV2 Q;  1H95 A;  4XIG S;  2MO1 A;  4DV1 Q;  3VDY A;  4JCV E;  1CKN B;  1VQH A;  3KFU A;  5JJL A;  3KJP A;  1GVP A;  4A4I A;  4LNQ A;  1OTC A;  1PFS A;  4BY1 G;  1YIT A;  4X64 L;  1U5K A;  1UWV A;  2PI2 E;  3RLO A;  4DK6 C;  1PH2 A;  3PO2 G;  5AJ3 Q;  2N8N A;  1QVF A;  4O0A A;  1PA6 A;  3CCJ A;  3S24 A;  4DV6 L;  3S2D H;  1NE3 A;  3UE1 A;  2Z6K A;  4GNX B;  1VQK A;  4MZ9 A;  3RN5 A;  1ASZ A;  4PZ8 A;  4YY3 Q;  1KC8 C;  1HNW Q;  3J80 i;  5LMU Q;  1L1O C;  4HJ5 A;  2IX0 A;  3GO5 A;  2OQK A;  4O2D A;  1K9M C;  2R92 G;  2HIX A;  4OXP A;  5J3B A;  5GQO A;  3GTK H;  2ZTC A;  2E5L Q;  4DV6 Q;  3HKZ G;  2N49 A;  2RF4 A;  4R4O A;  2JA5 H;  4A3G H;  3FKI G;  4IO9 A;  2NN6 G;  5AJ3 L;  1KAW A;  1C7Y A;  1K8G A;  1E7Z A;  2GN5 A;  4HIK A;  3GTO H;  1KXL A;  4A93 H;  4QJF A;  1YHB A;  1G6P A;  2K5H A;  1PYS B;  1CSQ A;  4FDB A;  1CUK A;  1I94 L;  4LUV A;  1PH3 A;  1LM0 A;  3JAM i;  1PH9 A;  4BBR G;  1PH4 A;  4YCU A;  4DV1 L;  1WI5 A;  3IRB A;  2PQA A;  4A75 A;  3CD6 A;  3HOU H;  1VQF A;  4IPH A;  4NB3 A;  1CKN A;  2JJQ A;  4C3H H;  4UPA A;  3OTO L;  2YTY A;  1KIX A;  4BA2 I;  4A3B H;  4DR7 L;  4C3I H;  1PVO A;  4HID A;  5M3M G;  1XMQ Q;  1Y1V G;  1LYL A;  1MJC A;  3TEH B;  3T1H Q;  1SE8 A;  2IHF A;  4LFC Q;  3H3V I;  4JI6 Q;  1QUQ A;  1HR0 Q;  1I5F A;  5IP9 G;  2NN6 I;  4NXM Q;  4NXM L;  3ER0 A;  4OO1 I;  1Q12 A;  1YEZ A;  1E1T A;  3D31 A;  1HNW L;  1QVC A;  3KF6 A;  5C4X H;  2BH8 A;  1AE3 A;  1QZG A;  4DK3 C;  3RR5 A;  2ZM6 L;  3KDF A;  2I5L X;  4XTC S;  4BBR H;  4DV5 L;  1PH8 A;  4OWW B;  1X3E A;  2RHQ B;  3F8T A;  4GN3 B;  2JA6 G;  1KL9 A;  2MQH A;  3L2P A;  1SR3 A;  4AQY Q;  4OWX B;  4PZ6 A;  4AYB E;  1VQ6 A;  3G4S A;  2VUM G;  1HR0 W;  3K7U C;  2B29 A;  3MXN B;  4LF7 Q;  4A3E G;  1XMO L;  4JI8 Q;  1UE1 A;  3S17 H;  4A3L G;  2AWO A;  1XNR L;  4LUO A;  3CPF A;  4X65 L;  3CCV A;  3TQY A;  4DR2 Q;  1I94 Q;  4HJ8 A;  1JT8 A;  1X3G A;  4R4C A;  5C0X G;  3J81 i;  1N34 Q;  2D0O A;  3H0G H;  1VQN A;  3I4M G;  4IPC A;  3GD7 A;  4PG3 A;  1Q86 C;  2CCZ A;  1V9P A;  3KLW A;  5IYC G;  4YCV A;  3K81 C;  1IBM Q;  1HZB A;  2CFM A;  4GKJ L;  2R7Z H;  2PI2 A;  5LMN W;  1EIF A;  1V43 A;  1Q7Y C;  4L5S A;  4AIM A;  1IBL L;  3GTG H;  3CPW A;  3A5Z B;  3KF8 B;  4MTN A;  1IBK L;  4JC0 A;  2AKW B;  2OTL A;  3ULP A;  5M5X H;  1N32 L;  1XPO A;  2Q2T A;  2IHE A;  5GAE C;  2UU9 L;  2JA8 G;  4YCW A;  1S72 A;  2MNA A;  2K4K A;  4BA1 I;  3U58 A;  1JB7 A;  2NVT H;  3CF5 A;  3HOZ G;  3HKZ E;  2EIF A;  4JOI A;  2EQS A;  4QY7 A;  5IY0 A;  4K0K L;  2UUB L;  2R6G A;  1WFQ A;  3PIO A;  1IL2 A;  4B3R L;  4IOA A;  4J15 A;  1MKH A;  2Q2H A;  1W3S A;  4P73 A;  4H02 A;  5C44 G;  2ZJP A;  1HNZ Q;  2HHH Q;  2ZJQ A;  4JI5 Q;  2C35 B;  4AH6 A;  1YI2 A;  2OTJ A;  1Y14 B;  5M5Y H;  1VCI A;  1YBY A;  1Q1E A;  2A1A A;  2PMZ E;  3TS0 A;  4B3T Q;  1Y1V H;  3S1R H;  1N8R C;  5BR8 Q;  1VQ8 A;  5BR8 L;  4X62 L;  1B8A A;  1YNX A;  3PUZ A;  1J5E Q;  1G29 1;  1Q81 C;  1NY4 A;  4UP9 A;  4GKK Q;  4P75 A;  3S1N H;  1EYG A;  2F4V Q;  3NEL A;  2NZH A;  2UXD Q;  1UE6 A;  2QEX A;  1GKH A;  4Y52 H;  2AHO B;  4RG1 A;  1XJV A;  1FGU A;  2VZA A;  2VNU D;  2HIV A;  1TWF H;  3CP0 A;  3EIV A;  3GDE A;  3UDF A;  3M4O H;  4UP8 A;  4C2M H;  4JI7 L;  4BXX H;  1EOV A;  1X56 A;  1N33 L;  4JV5 L;  3NBH B;  3M7N A;  3FKI H;  3M4Q A;  3PGZ A;  4KHZ A;  4YHH L;  4L5R C;  1IXR A;  1VQB A;  4A3D G;  1TWH H;  1Q46 A;  3PO3 G;  1VQI A;  3HOV G;  2ZM6 Q;  1IBK Q;  4B3S L;  3CAM A;  1J6Q A;  4P71 A;  5GRO A;  1OXX K;  1XNQ Q;  1EFW A;  2UXC L;  5C3E H;  1PH5 A;  3ULJ A;  2Q2I A;  2I5H A;  3M9B A;  1VQL A;  2CQO A;  1K73 C;  2AWN A;  1PH7 A;  1A0I A;  3TS2 A;  2K50 A;  5FJ8 G;  4B3T L;  3BU2 A;  1XMQ L;  5JJI A;  1Q8K A;  4R1J A;  3EN2 A;  3GTM H;  1TWG H;  1K0R A;  1VS0 A;  1W2B A;  1Z47 A;  3HKS A;  4IJL A;  3H15 A;  3LGJ A;  5GAD C;  2ATW A;  3AFP A;  4APV A;  3PV0 A;  4HJ7 A;  1BBU A;  1XPU A;  3E9I A;  1YHA A;  4MNO A;  4PZ7 A;  3CC4 A;  3HOY G;  4HIM A;  5EAY A;  4JBK A;  1XNR Q;  3AFQ A;  3HOW G;  4NXN L;  4JI8 L;  4LF5 Q;  2VL6 A;  3HOX G;  1U0L A;  2QA4 A;  4LUZ A;  4LFB L;  3KOJ A;  4Y7N H;  3E9H A;  2VQF L;  4JI7 Q;  4QQB X;  4DV7 Q;  1P8L A;  1PH1 A;  2YTV A;  1BKB A;  1OXV A;  4PMW A;  3W5O A;  2UXD L;  2HT1 A;  4LF8 L;  3RLF A;  4RMF A;  4DR1 Q;  5IP7 G;  1YJ9 A;  2KHI A;  5M3F H;  3KYH C;  4A3K H;  3CCL A;  5JJK A;  2PNH A;  5FLM G;  1VQ7 A;  4GN4 B;  3S16 H;  1M1K C;  2OQ0 A;  1X54 A;  1EQQ A;  4BY7 H;  1VQ9 A;  1G51 A;  4X66 L;  4LFA L;  4LF9 Q;  2BH2 A;  1WOC A;  1VQJ A;  4A76 A;  4DR4 Q;  3OYY A;  4AYB G;  4KI0 A;  4YY3 L;  3OW2 A;  5IYC H;  2WP8 J;  1VQC A;  5IYB H;  5M3F G;  4A3K G;  3BZC A;  5IP7 H;  4A3E H;  3A74 A;  2HHH L;  3PIP A;  1I50 H;  3M4P A;  4JI5 L;  4GN5 A;  4X65 Q;  2UUB Q;  2Y0S G;  1MJE A;  5IT9 c;  4K0K Q;  4DV7 L;  4B3R Q;  3J80 c;  1Z9F A;  4LF4 Q;  4L5T A;  3UE0 A;  3KJO A;  3PSI A;  3I55 A;  2E2H H;  4BXX G;  5K36 G;  3J7Z C;  3CCU A;  4IFD I;  1X9N A;  4LF6 Q;  2GVB A;  1E24 A;  2N3S A;  3CW2 C;  3AYH B;  4BBS H;  5C4X G;  5IYB G;  4DV0 L;  1SN8 A;  2ZTD A;  3CCQ A;  4DV5 Q;  5IYD H;  1WCM H;  2YYZ A;  4DNI A;  4DUZ Q;  1CKM A;  1IBL Q;  3GTP H;  5IWA Q;  3BZK A;  2E5L L;  5FLX c;  3RZO H;  1R9T H;  4JYA L;  1BVS A;  3I7F A;  4IPD A;  2F52 A;  3ULL A;  4B3M L;  4A3I H;  5C0X J;  4HIO A;  4DR1 L;  4WJ3 M;  4NPS A;  2PQA B;  2AMC B;  2JK8 A;  2NZO A;  4JI1 Q;  4DR2 L;  4YWM A;  1KHI A;  3PF5 A;  4OX9 Q;  1SRO A;  4OWT B;  1EUJ A;  1N34 L;  3TRZ A;  1I6H H;  2ALY B;  3PUX A;  4ME3 A;  3CCS A;  3K0X A;  4LFB Q;  1YIJ A;  1VQA A;  4B3S Q;  5H1S E;  5ELN A;  2WAQ E;  2UXB Q;  2A19 A;  5C0X I;  1TXY A;  4BBS G;  3G48 A;  3U50 C;  4AQY L;  4IOC A;  2YTX A;  2HQL A;  3D0F A;  2JEB I;  3HOZ H;  1NJI C;  1AE2 A;  3FP9 A;  3DM3 A;  4ALP A;  2L15 A;  2H5X A;  2DGY A;  4JBW A;  1PV4 A;  1LTL A;  4OON A;  4HJA A;  2E2J H;  2UXB L;  1VQG A;  3F2C A;  2DUD A;  1FL0 A;  3CCE A;  3NEN A;  2B3G A;  2IY5 B;  2FXQ A;  4LFC L;  2IT1 A;  3JC6 6;  4DR3 L;  4A3M H;  4JI1 L;  2K14 A;  1UE5 A;  4YWK A;  3T1H L;  3ERS X;  3S2H H;  4QGU A;  1XTD A;  2N78 A;  4GS3 A;  5IWA L;  4JI6 L;  2Y0S E;  4BY7 G;  3UDX A;  1HR0 L;  1B7Y B;  1KRT A;  1N36 L;  4JI0 Q;  3MEF A;  3K7A H;  2JA9 A;  2NVX H;  4JYA Q;  1CKO A;  3RLN A;  4JI3 Q;  4GLV B;  3UDI A;  4GLX A;  5C4J H;  3H3V H;  1LUZ A;  2RCN A;  5JEA G;  5C44 H;  1UEB A;  3U4Z A; 
#chains in the Genus database with same CATH topology
 2SDF A;  5J1Z A;  3L0O A;  3HOW B;  1X6O A;  4LF4 L;  3A7L A;  4IFD G;  4POF A;  4DAM A;  3PCO B;  4C1N I;  3SEB A;  4S3S A;  3HOW H;  2LXJ A;  2EVB A;  4LFA Q;  1PYB A;  1KDB A;  4ZUI A;  1H9M A;  4X62 Q;  5LMU L;  2B63 G;  4IUN A;  4X3T A;  1A3T A;  5KIX A;  1GOZ A;  4DKA C;  5IGC A;  2XVS A;  3C1F A;  4HCE A;  2B39 A;  4QB4 A;  3SR1 A;  1JE5 A;  4RFB A;  3T1Y Q;  4DUZ L;  2JA7 G;  1VQD A;  3K58 A;  2MO0 A;  1YVC A;  1MSG A;  1FR3 A;  2VQE L;  4IFD H;  1K0S A;  1MIU A;  3OPO A;  1WVL A;  4LF5 L;  2DNE A;  2E75 C;  1IZ6 A;  3M85 A;  1HQM C;  2F3I A;  5ELF A;  2ASB A;  3I4N B;  1CM9 A;  4WJ4 A;  2WAQ G;  1QVG A;  4A3G G;  4GNX C;  2WB1 G;  3TDQ A;  3HOZ B;  3T53 B;  3EBE A;  4OX9 L;  1W6J A;  2UUC L;  1E2Z A;  3M3Y H;  4DR4 L;  3J7Y W;  1X3F A;  1R4P B;  1NMF A;  1ONL A;  4X3K A;  5JAV A;  1UNS A;  4FF4 A;  4N8F A;  3HOX B;  1XNQ L;  1NMG A;  5KGU A;  5HUR A;  2VUM B;  1NUC A;  3K80 C;  4DUY Q;  2IX1 A;  1VF7 A;  3S15 H;  3KBG A;  5I6W A;  3T16 A;  2BE5 D;  1HZA A;  5CBE E;  3FHW A;  2FMM A;  4RA8 A;  3NEM A;  2A6E D;  5FLM H;  1J5E L;  4UP7 A;  4G7O C;  2RA4 A;  4GKK L;  4LWC A;  2VB2 X;  2QEJ C;  3Q24 A;  1SYG A;  2DJG C;  2R7Z G;  2EXD A;  3QB3 A;  2DY7 A;  1LTI D;  1K3R A;  3CU7 A;  3F2D A;  3H6M A;  3RZD H;  1A63 A;  2A68 C;  1ILP A;  1MI2 A;  4RAU C;  1E22 A;  2EYL A;  1L0W A;  5FO7 B;  3LX0 A;  3J81 j;  2E2I B;  5K5P A;  1PFB A;  1C0A A;  1AH9 A;  2MJ8 A;  1HTP A;  2Z0S A;  3PUW A;  1XX8 A;  3PMF A;  3URY A;  1I6V C;  1S3O A;  3PUV A;  1JOK A;  2A74 C;  2K5V A;  5GAH C;  3JAM c;  4RGM A;  5COR A;  2KBN A;  1EIG A;  4Q5V A;  3DXJ C;  3G6J B;  3GTQ B;  1T9H A;  3I4O A;  4ODG A;  2L0C A;  1HZC A;  5K36 H;  1I4X A;  1MGS A;  1AEX A;  1DXM A;  1EIH A;  1B53 A;  1A8V A;  1SNQ A;  5LMN L;  2MFI A;  3A7A B;  4RHS A;  1DGS A;  2I46 A;  1HFG A;  1HPC A;  3J81 c;  1I4Q A;  3SK4 A;  3R93 A;  3S1M B;  4A3F H;  3CCR A;  3L7Z C;  1SMX A;  1TS3 A;  3MAQ A;  1EY4 A;  4QF4 A;  3WWV A;  1I50 B;  5I9P A;  5JEA H;  2NVY H;  3PF4 A;  2JA8 B;  4RGT A;  3J7A 5;  4DK1 A;  4I65 A;  1RTN A;  2PW5 A;  3I8Z A;  4B3M Q;  2UUC Q;  2E74 C;  2UXC Q;  1N9W A;  1SAP A;  1WJJ A;  3S9W A;  2SNM A;  3S1Q B;  1NTG A;  3GQB A;  5JOB A;  4F8M A;  1V1P B;  4DPG A;  4DV2 Q;  4DV1 Q;  3VDY A;  3H94 A;  2XIW A;  4JCV E;  5JJL A;  4LNQ A;  1OTC A;  2K03 A;  1EZ8 A;  4BY1 G;  4KHV A;  2CH4 A;  2N8N A;  1PA6 A;  3S2D H;  2Z6K A;  1VQK A;  2EPB A;  3EQL C;  1ASZ A;  2LFN A;  3M3Y B;  4PZ8 A;  4IUQ A;  1UUP A;  5LMU Q;  3GO5 A;  2OQK A;  5T1G A;  1B3A A;  3ND8 A;  5J3B A;  1O7Z A;  5L37 A;  2QF7 A;  1U4M A;  1ESF A;  2RF4 A;  2PCF B;  4IO9 A;  3GTO H;  2ZXO A;  4HIK A;  3OOC A;  4QJF A;  4FDB A;  3IFT A;  4U68 A;  2EYF A;  3MZ5 A;  4C3J G;  4KKS A;  3IKJ A;  1LM0 A;  3R8B A;  5A2Q E;  4K2K A;  1PH4 A;  2IWH A;  5A35 A;  4DV1 L;  3IRB A;  4QUF A;  2PQA A;  3PIP 3;  3HOU H;  1SYF A;  3A8K E;  1FGB D;  1EYD A;  5BN4 A;  3OTO L;  3X3N A;  3IAY A;  4DR7 L;  4O1N A;  3PQI A;  2B8F A;  2LKV A;  2KA7 A;  1RTO A;  1SE8 A;  2IHF A;  1I5F A;  4NXM Q;  4OO1 I;  3ER0 A;  3D31 A;  3NTK A;  2R3Z A;  2NUC A;  4BBR H;  2BDN A;  1F9S A;  1KL9 A;  3BYT B;  4ZUJ A;  3CRL C;  4OWX B;  4PZ6 A;  3G4S A;  5M5X B;  1HR0 W;  1F77 A;  3MXN B;  2F4I A;  3AU7 A;  1XMO L;  4K8J A;  3S17 H;  1WTX A;  2AWO A;  3NTI A;  1KLG D;  3CPF A;  4LUO A;  1FNW A;  1DOL A;  1JT8 A;  3J81 i;  3I4M G;  3H0G H;  4IPC A;  2RDF A;  4PG3 A;  1Q86 C;  5DM6 3;  1V9P A;  4IUP A;  3KF8 A;  4YCV A;  1IBM Q;  1HZB A;  3AMU A;  2CFM A;  4FP5 D;  4A3G B;  2PI2 A;  3D8G A;  2CVR A;  3OMC A;  4AIM A;  1IBL L;  1QNK A;  2AKW B;  3ULP A;  2QKI C;  1XPO A;  4MN3 A;  5IGD A;  2DNC A;  4CDD C;  2MNA A;  2K4K A;  4BA1 I;  3U58 A;  5EGT A;  3HKZ E;  4F7X A;  4DU9 A;  1NR2 A;  2F0E A;  2UUB L;  1IL2 A;  4IOA A;  2DN8 A;  3UI2 A;  4B3T Q;  1BR9 A;  3S1R H;  5BR8 L;  2ZT9 C;  1YNX A;  5LL6 S;  5EKK A;  1EYG A;  3NEL A;  1XJV A;  1FGU A;  1EYC A;  3CP0 A;  3GTL B;  3NBI A;  1EY5 A;  4C2M H;  4BXX H;  3C46 A;  3EVQ A;  3FVQ A;  1EU3 A;  4WOR A;  3DUZ A;  2H4O A;  3PO3 G;  2Q8R E;  4V0B A;  3CAM A;  1J6Q A;  5GRO A;  3NTH A;  4DXG A;  1S4Z A;  3OIQ A;  5C3E H;  2PPB C;  2UXC L;  3ULJ A;  2Q2I A;  2FJ2 A;  1HUN A;  1PH7 A;  1A0I A;  2A69 D;  4R8N A;  4UHV A;  4B3T L;  1Q8K A;  2PZW A;  2RSO A;  1K0R A;  2EY6 A;  1W2B A;  3HKS A;  3V96 A;  2X69 A;  4OHJ A;  2RVL A;  1YHA A;  3OWF A;  4HIM A;  5EAY A;  4JBK A;  3AFQ A;  2KEE A;  4LF5 Q;  3HOX G;  4RKB A;  2QDB A;  3GTM B;  3S14 B;  3TP8 A;  1IKL A;  4Y7N H;  4JI7 Q;  4KD3 A;  1PH1 A;  2UXD L;  2HT1 A;  4IAL A;  4DR1 Q;  1AFP A;  2KHI A;  4IUV A;  1VQ7 A;  4GN4 B;  3S16 H;  4BBS B;  1RD9 D;  1JE4 A;  3V2T A;  1V8Q A;  4X66 L;  5LHY 1;  1WOC A;  4EGV A;  2B63 B;  1I4R A;  4KI0 A;  1Y69 U;  3NK9 A;  5IYC H;  2F0K A;  5M3F G;  1D1I A;  2HHH L;  4XDX A;  4GN5 A;  2JA7 B;  2Y0S G;  4K0K Q;  1Z9F A;  4LF4 Q;  1HRJ A;  4LF6 Q;  2GVB A;  4BBS H;  3P1H A;  2ZTD A;  1SXT A;  1WCM H;  1IBL Q;  1CKM A;  5IWA Q;  1PTO H;  3RZO H;  4DN4 M;  4JYA L;  4B3M L;  2F52 A;  4A3I H;  1CT1 D;  1TR5 A;  3HGB A;  2RCF A;  3HG9 A;  4WJ3 M;  2D2C C;  1XWE A;  2JK8 A;  4RWS C;  3T51 B;  1AW7 A;  3NPP A;  4OWT B;  2XNA C;  1EWH A;  1LT5 D;  2HDL A;  4ME3 A;  4OL7 A;  4F88 A;  1CTM A;  5C0X I;  3ZYY X;  4BBS G;  4I7A A;  3U50 C;  5IT9 E;  2YTX A;  1NJI C;  3VR6 A;  1G6Z A;  3KUP A;  5IIF A;  4C3J B;  4DNR B;  1JQY D;  3NQI A;  3CCE A;  2M2L A;  1LT4 D;  1KDC A;  3DWP A;  1TS2 A;  2IY5 B;  1B4O A;  3JC6 6;  4ZLT F;  3ERS X;  1IYV A;  2CHB D;  3NE5 B;  3UDX A;  4JI0 Q;  4CBV A;  5C4J H;  4BY7 B;  3TME A;  2RCN A;  1UEB A;  3S1R B;  2Z4I A;  3HEJ A;  2P5Z X;  2HD3 A;  2QCP X;  1SLJ A;  2KEC A;  1R4Q B;  1I3Q H;  1LV9 A;  1EQR A;  3CKI B;  4QMG A;  2JA6 H;  3E0E A;  1I4P A;  4G7H C;  4IJH A;  2VQE Q;  2D0P A;  3F1Z A;  4IFD J;  4UY8 C;  1GO3 E;  2SOB A;  4JI4 L;  3GTQ H;  2EYJ A;  4DR5 L;  4DR6 L;  4A3C H;  3T1Y L;  5CV6 A;  4J6H A;  3N52 A;  4X66 Q;  3MFY A;  2R7F A;  1RDP D;  3A0J A;  2RHS B;  2B2V C;  3P75 A;  1CQF A;  1JR0 D;  4LF8 Q;  3TP7 A;  1JMC A;  3ZJY C;  4GNX A;  1WYD A;  2B2T C;  1WTV A;  4OIJ A;  4GOP B;  4KHP Q;  3O13 A;  4B08 A;  3KK7 A;  4FF2 A;  3W1G A;  4BS9 A;  3SXH A;  3OMG A;  4DV2 L;  4JI2 L;  3GV6 A;  4LW1 A;  1C9O A;  1FJG L;  1CZW A;  1C48 A;  4JI3 L;  1L1O A;  5JVH 3;  4EVO A;  4TKO B;  3EA6 A;  4A3M G;  5D3D A;  4ZKB B;  4BBR B;  1LO5 D;  1RKN A;  1TWC H;  4ZRZ A;  5KRU A;  4DV3 L;  2D62 A;  1WTW A;  2EXZ A;  2F0H A;  4HSP A;  3S1N B;  1F9P A;  1CZG A;  3I4L A;  1SRU A;  2JA6 B;  4JVZ A;  4A3B G;  1LTA D;  2E8G A;  2CWA A;  2VQF Q;  5GAG C;  2KCT A;  4K2L A;  3TBI B;  1STB A;  4CJ1 B;  5HGQ A;  1YHQ A;  5E7N A;  5I4D A;  3HOU B;  1YJN A;  2JA7 H;  4JBM A;  4GOP A;  2VS1 A;  5IOC A;  1EZ6 A;  5JPN C;  2F4V L;  1TKW B;  1XXG A;  2OT2 A;  5D3I B;  2E2D C;  4KY6 A;  1ZKO A;  2WII B;  3W2D A;  5IYD G;  3E0J A;  3I4M H;  1OXS C;  1O7I A;  3HZX A;  1A6X A;  2CKZ B;  1JOR A;  4JG2 A;  4A93 G;  1WD0 A;  1N32 Q;  4A3L H;  2JQO A;  2ES2 A;  4XYO A;  1STE A;  3S2D B;  4TSS A;  2R93 G;  1SMY D;  2K7V A;  3G71 A;  1VQM A;  1DYQ A;  3KLS A;  2EE1 A;  1D8L A;  2L12 A;  4TQU S;  3CMA A;  1Y8N B;  5JVG 3;  1SYB A;  1B3Q A;  3OW7 A;  1VQ4 A;  2ZXP A;  2F1M A;  5JJZ A;  2Z1C A;  2OWO A;  1G8Z D;  4XQQ A;  3E5S A;  2I5M X;  1SE4 A;  1OXT A;  4P2C B;  3K59 A;  2QGQ A;  4KN4 C;  2EYP A;  4EQ5 A;  5CBA E;  3MWY W;  2HQE A;  4PMB A;  1LTT D;  1WCM G;  2WFW A;  2XTI A;  3D3R A;  3S1Q H;  2NZ1 D;  3ITP A;  2EYM A;  4FO2 A;  5M5W H;  2B2Y A;  1N33 Q;  5FO8 B;  2JA8 H;  2PYK A;  1WTP A;  1JWU D;  3GTJ H;  3GV3 A;  2IW3 A;  4JI0 L;  4HMI A;  2VW9 A;  2C9O A;  1CFM A;  2GVA A;  1QUQ B;  2A69 C;  2B2V A;  4GLA C;  1EIY B;  3S14 H;  4DR5 Q;  4IPG A;  4DR6 Q;  1K8A C;  1ZXT A;  3OWE B;  1X55 A;  4K14 A;  2MO1 A;  4HED A;  5EKL A;  1CKN B;  2RSN A;  4K5W A;  4XXE A;  1SNC A;  3PO2 G;  1Y8O B;  3TN2 A;  5A2Q L;  2K33 A;  1QVF A;  1F2Y A;  3CCJ A;  2I07 B;  3RN5 A;  4RKL A;  5AFW A;  1CA6 A;  1PLF A;  4YY3 Q;  1DM0 B;  3J80 i;  1L1O C;  1QCB D;  2IX0 A;  4O2D A;  2R92 G;  3S2H B;  1LTG D;  2HIX A;  3KBX A;  3PO3 B;  3J81 L;  3GTK H;  5KYL A;  2JA5 H;  4MTK A;  3FKI G;  5TSS A;  2NN6 G;  2RQX A;  2AUK A;  2TMP A;  1E7Z A;  4MHE A;  4IUR A;  1YHB A;  1G6P A;  1CSQ A;  1JWS D;  3RZD B;  4K8I A;  4LUV A;  1PH3 A;  1UEA B;  4BBR G;  3C1E A;  1PRT B;  3S17 B;  1KAA A;  3CD6 A;  1VQF A;  4IPH A;  4NKL A;  2JJQ A;  4J1M A;  2PO4 A;  3S15 B;  1IW7 D;  3M4O B;  5F2D A;  5M3M G;  5EPK A;  1Y1V G;  1MJC A;  1LYL A;  3T1H Q;  1O78 A;  4LFC Q;  3H3V I;  1QUQ A;  1HR0 Q;  2M9V A;  2K05 A;  4NXM L;  1YEZ A;  1DOM A;  1E1T A;  1QZG A;  1AE3 A;  2WIN B;  1EEI D;  3RR5 A;  3W3A A;  1ICF B;  2JP1 A;  4OWW B;  3A56 A;  1RCV D;  4GN3 B;  2R92 B;  1GJX A;  1F9R A;  1K8O A;  2MQH A;  2NTS A;  1VQ6 A;  2VUM G;  2XN9 C;  3K7U C;  2B29 A;  1UE1 A;  2LS0 1;  4A3L G;  1HHV A;  1PTO D;  1WTH A;  1SNM A;  1C4Q A;  4R4C A;  5C0X G;  1VQN A;  1N34 Q;  1KDA A;  2K01 A;  3HS0 C;  3GD7 A;  3KLW A;  4KKT A;  5IYC G;  3GTO B;  4LK1 C;  1ENA A;  4GKJ L;  2R7Z H;  1GUS A;  1TII D;  4LJZ C;  1V43 A;  3GTG H;  1GHK A;  2R93 B;  1JOO A;  3KF8 B;  4MTN A;  5IGG A;  1LAB A;  3FKI B;  2OTL A;  1QOH A;  3K6O A;  5M5X H;  1VMC A;  1EOT A;  2KED A;  1IW7 C;  1TWF B;  1VF5 C;  3CF5 A;  1JB7 A;  3PIO 3;  2OXP A;  2EQS A;  4QY7 A;  5IY0 A;  2Q8I B;  2R6G A;  3PIO A;  5C4X B;  4A3I B;  1MKH A;  2J7Z A;  1W3S A;  5C44 G;  2OTJ A;  2PQE A;  1Y14 B;  4UAI A;  1VCI A;  1YBY A;  2F0G A;  2PMZ E;  1Y1V H;  4H13 C;  1VQ8 A;  1B8A A;  1CQV A;  1I4H A;  4UP9 A;  1MHW C;  3S1N H;  3ERQ A;  2E2H B;  2NZH A;  3NBH A;  2AHO B;  2VNU D;  2HIV A;  3GDE A;  5C3X A;  3N6R A;  3M4O H;  3RMH A;  1X56 A;  4JV5 L;  3DEO A;  1ET9 A;  3FKI H;  3M4Q A;  2AQ3 B;  3BYY B;  3D4W A;  1VQB A;  1SYD A;  1TWH H;  3BDO A;  2ZM6 Q;  4A93 B;  4M8A A;  1ZYR D;  5DAU A;  1XNQ Q;  2CW0 C;  1KAB A;  4RHR A;  4CJ2 C;  1TY0 A;  1K73 C;  1LLR D;  4KN7 C;  1PXU A;  1GUO A;  5FJ8 G;  2N88 A;  3BU2 A;  3D4R A;  1XMQ L;  4R1J A;  2J0T D;  3EN2 A;  1TWG H;  1PRT D;  3A54 A;  4APV A;  1BBU A;  5EPJ A;  1SJE D;  5BN3 A;  4DAP A;  3BVG A;  3QOJ A;  3BVM A;  2OF1 A;  5FLX L;  3OSO A;  2VL6 A;  1U0L A;  2EY2 A;  3E9H A;  4QQB X;  2YTV A;  1SBB B;  5IP7 G;  1QG7 A;  2NB0 A;  5IT9 L;  4A3K H;  3CCL A;  4XYQ A;  2PNH A;  5FLM G;  4C3I B;  2OQ0 A;  1LTS D;  4A3E B;  2K32 A;  4IZ8 A;  2BH2 A;  1VQJ A;  4XT3 B;  2F0J A;  4K5X A;  5C4Z A;  1VQC A;  5IYB H;  4A3E H;  1J8I A;  3M4P A;  4JI5 L;  1A3U A;  4A3M B;  1VDZ A;  4A3K B;  5E3F A;  4B3R Q;  3VR3 A;  4L5T A;  3PSI A;  4PQX A;  1NAP A;  3VR5 A;  2L55 A;  1E24 A;  3GTK B;  1SN8 A;  4DV5 Q;  1D6E C;  1O7Y A;  2YYZ A;  4DNI A;  3BZD B;  3GTP H;  2HCI A;  3VYU A;  3BZK A;  3PO2 B;  5IGB A;  1Z7T A;  1R9T H;  4IPD A;  3I7F A;  2KHS A;  4JK1 C;  2K5Q A;  4HIO A;  4IUU A;  3VA7 A;  3WOF A;  2EYH A;  2J4X A;  4DR2 L;  1KHI A;  3SK6 A;  4OX9 Q;  3TRZ A;  1I6H H;  1EUJ A;  1N34 L;  2ALY B;  3PUX A;  4B3S Q;  1VQA A;  5H1S E;  2A19 A;  1TXY A;  3OIP A;  1B44 D;  3G48 A;  2N55 A;  1LT6 D;  3F2U A;  4N8X 1;  3BS1 A;  3DM3 A;  2EY1 A;  2ICE C;  1OO9 B;  4BWG B;  1LTL A;  4OON A;  1UAP A;  2UXB L;  1BO0 A;  3NEN A;  3I4M B;  5CV7 A;  5E4W C;  2B3G A;  2FXQ A;  3HKZ B;  1D1K A;  2R61 A;  2F0N A;  1CK1 A;  4JI6 L;  2N78 A;  4BY7 G;  2B2U A;  1B7Y B;  1KRT A;  3MEF A;  5I6Y A;  5M5W B;  1CKO A;  1SNP A;  4DAV A;  4GLV B;  2V4D A;  1LUZ A;  4EQP A;  1CI3 M;  4KKU A;  4DV0 Q;  2VY3 A;  3FMC A;  3CC7 A;  4ME5 A;  2A68 D;  5ELO A;  4ZCK A;  2VUM H;  5M5Y B;  2K52 A;  4C1N K;  3STB D;  1B1Z A;  1ENC A;  3OHX C;  5C5M A;  3ICE A;  3IFD A;  2K28 A;  3HOX H;  1GM5 A;  1K83 H;  1JB3 A;  5LL6 X;  1PRT F;  3BVZ A;  3LNN A;  4ZQ3 A;  3I73 A;  5JEA J;  5C4H A;  2G5D A;  4A3I G;  3KF6 B;  3K5O A;  2Z9H A;  4AYB B;  1DJR D;  5M3M H;  4I7Z C;  4XQJ A;  5CYU A;  3I4N H;  4P72 A;  1A3V A;  5M9O A;  5C3E G;  3SGI A;  1Q90 A;  1PHJ A;  3CC2 A;  2KHJ A;  3A5U A;  1EQT A;  5C3W A;  2NVQ H;  2PZT A;  2WKC A;  4NXN Q;  4XQN A;  4JW0 A;  2PZU A;  4K6L A;  2R93 H;  4KLK A;  1SFO H;  3STB C;  4CDC C;  2KOL A;  2JA5 G;  2YU9 H;  1KRS A;  2YV5 A;  1HTL D;  5M3M B;  3FRP B;  3K0Y A;  1Y1W G;  1M90 C;  4HJ9 A;  4NMZ A;  3HOV B;  3M4Y A;  4FVM A;  2CWP A;  1E1O A;  5IP9 H;  3ND9 A;  3PUY A;  4FXD A;  1EWI A;  3K8A A;  1VQ5 A;  1KNE A;  1FNV A;  1U4L A;  2L1B A;  3DWQ A;  2V1C C;  3MFG A;  4BY1 H;  3NWS A;  4DR7 Q;  1XMO Q;  3FDT A;  1IYU A;  3PO2 H;  4YHH Q;  4CDE C;  3KDF B;  2EJG C;  2AUJ D;  3HOY B;  1IYJ B;  5EBD A;  1A62 A;  1PMR A;  1W6K A;  1B70 B;  1S5F D;  3MTS A;  1YJW A;  1HQR D;  3VA5 A;  1VMP A;  1YZ6 A;  1XPR A;  2RDG A;  3DM1 A;  3ONA B;  5HY6 A;  2BDO A;  2F0L A;  1RHP A;  4A3F B;  1DON A;  3CQZ H;  1BF4 A;  3SE0 A;  4R4T A;  1DZ1 A;  5FJ8 H;  2K75 A;  1HJP A;  1Q1B A;  3W1B A;  1ZEQ X;  3H91 A;  4JI2 Q;  1I4G A;  1F9Q A;  3H0G G;  1EY9 A;  1OXU A;  4JBJ A;  2OCE A;  2JEA I;  2NYZ D;  4IN3 A;  3MXU A;  2F03 A;  1HA6 A;  2Q2U A;  1ASY A;  3MXG A;  4DV4 L;  5IOD A;  2L11 A;  2ZJR A;  1WTO A;  4GKJ Q;  5E1F A;  3SDZ A;  2Z6K C;  1PFN A;  4X6A H;  2A5H A;  1AN8 A;  4U67 3;  1QWY A;  2E2I H;  4TVA B;  1B2T A;  3RZO B;  4OO1 H;  4LF7 L;  1HZ9 A;  4QIW E;  5FO9 B;  2KCM A;  2RBM A;  2Q8T A;  2UUA L;  2B2W A;  2BOS A;  3CCM A;  1L2F A;  3HOU G;  1LTR D;  4L8J A;  5FKA C;  2I0Q A;  1H9R A;  4OO1 G;  4DK0 A;  2QW7 A;  2DJF C;  1QZH A;  3HP3 A;  5FOB B;  4NW2 A;  2BA1 A;  2B63 H;  2K5N A;  5EKI A;  3HFZ B;  1PTO C;  3MA2 B;  2FHT A;  1HNZ L;  1A2U A;  1HUM A;  1STA A;  3QWN A;  1FJG Q;  3T56 B;  1EFI D;  4XIG S;  1TVX A;  2F0F A;  2JN4 A;  1DD2 A;  3ERO A;  3KJP A;  4A4I A;  5FLX E;  1MBY A;  1PFS A;  3I72 A;  4YIJ A;  4H44 C;  4WJW A;  4JPB W;  4DK6 C;  1SEB D;  4V19 0;  5KEE A;  2A6H D;  1S5D D;  4O0A A;  3S24 A;  4DV6 L;  3FPP A;  4GNX B;  1EL0 A;  5BN5 A;  4MZ9 A;  2F0T A;  1A2T A;  1B9M A;  3J80 E;  2WKD A;  3T13 A;  4KTA A;  3HRZ C;  2XWB B;  1K9M C;  3H09 A;  1U4R A;  1SFO B;  4QIW B;  2MPM A;  2ZTC A;  5D14 A;  4DV6 Q;  2KJX A;  3HKZ G;  2IPK D;  2N49 A;  2NVQ B;  4CGY B;  1C7Y A;  1CUK A;  3K57 A;  1I94 L;  3TSS A;  1PH9 A;  2F0Q A;  4KD4 A;  4YCU A;  4A75 A;  3MC0 B;  1LT3 D;  4NP5 A;  3VYS A;  2EZV A;  1DOK A;  1G91 A;  1CKN A;  4C3H H;  1X32 A;  4UPA A;  2PNR C;  2YTY A;  1GXD C;  1V1P A;  4G57 A;  4QCL A;  1BCP C;  3TEH B;  1U4P A;  4JI6 Q;  3H3V C;  4HTH A;  3V05 A;  3QO2 A;  5IP9 G;  3T4A C;  1TQO A;  1QVC A;  5C4X H;  2BH8 A;  4DK3 C;  2O5J C;  1PH8 A;  1X3E A;  2F0V A;  3F8T A;  2JA6 G;  3SK5 A;  3L2P A;  1SR3 A;  4AQY Q;  4AYB E;  2IJ0 A;  1JOQ A;  4X3S A;  4LF7 Q;  3KLS X;  1TWC B;  5C6A A;  1EU4 A;  4X65 L;  1I94 Q;  3TQY A;  3NP8 A;  4A3D B;  1EY6 A;  1MSH A;  2CCZ A;  1BUV T;  2SNS A;  1S5E D;  3K81 C;  2JA5 B;  2KCC A;  3MXP A;  1EIF A;  4L5S A;  1D5Z C;  2L4N A;  4KV6 A;  3CPW A;  1O7L A;  2B8G A;  3A5Z B;  4HAE A;  1TY2 A;  2B2T A;  4JC0 A;  1IBK L;  4R8I A;  1BNZ A;  5GAE C;  2F0W A;  2UU9 L;  2JA8 G;  4YCW A;  1HA5 A;  5G3L D;  1TWA B;  2K5W A;  2NVT H;  4OGQ C;  3VYT A;  2EIF A;  4K0K L;  5EPL A;  1CHP D;  2EOT A;  1WFQ A;  4J15 A;  2Q2H A;  2ZJP A;  2F0I A;  4H02 A;  1SSO A;  2HHH Q;  2ZJQ A;  3TP6 A;  2C35 B;  4AH6 A;  1YI2 A;  3I3C A;  3VYR A;  2EJM A;  3TS0 A;  5ELD A;  3NUC A;  1N8R C;  1EY0 A;  4WFN 3;  1H9S A;  1G29 1;  1T5E A;  3SK8 A;  1Q81 C;  4CKC A;  1ESR A;  3NHH A;  5CV8 A;  5ISR A;  2F4V Q;  1UE6 A;  3NXW A;  3P20 A;  1GKH A;  4Y52 H;  4H7B A;  1Q3L A;  2QDL A;  2WAC A;  1XTC D;  3EIV A;  3GTJ B;  4RGN A;  1D5X C;  4UP8 A;  4JI7 L;  1EOV A;  1NCV A;  2L9H A;  1PYW D;  1WD1 A;  3NBH B;  3M7N A;  3VR2 A;  3GP7 A;  4YHH L;  1BXT A;  3R2I A;  1PFM A;  4DGZ A;  1GHJ A;  1H9K A;  1SYE A;  1VQI A;  4FYD A;  3HOV G;  4P71 A;  1BCP F;  1Z6H A;  1EFW A;  1Y8P B;  1K28 A;  1PH5 A;  4G4K A;  3M9B A;  1VQL A;  2AWN A;  1DCZ A;  3EFX D;  1X3Q A;  5KNB A;  2K1B A;  5JJI A;  1YNJ C;  1GUN A;  2EY5 A;  3L3O C;  3FEW X;  4IJL A;  2F0O A;  1RF2 D;  3LGJ A;  2ATW A;  3AFP A;  3CRK C;  3PV0 A;  5D65 A;  4PNY A;  5CGK A;  4HJ7 A;  3CC4 A;  1XPU A;  4MNO A;  4PZ7 A;  1J9O A;  3HOY G;  1M8A A;  2NTT A;  2MUY A;  4F87 A;  3HOW G;  4NXN L;  1PTO B;  4R9W A;  2QA4 A;  1ET6 A;  2F3V A;  4LUZ A;  4MIU A;  4DXF A;  4LFB L;  5C5L A;  3KOJ A;  2LMC B;  2VQF L;  4DV7 Q;  2L5T A;  1BKB A;  1OXV A;  4PMW A;  4GZY C;  2CH4 W;  3BDL A;  1EEF D;  3KLR A;  1E0B A;  5IGE A;  1YJ9 A;  1H9S B;  5JJK A;  3A8J E;  3LWU A;  1ML0 D;  1TWH B;  1X54 A;  2HDM A;  1VQ9 A;  1G51 A;  2KCN A;  4LF9 Q;  1KNA A;  1FD7 D;  4CKE A;  4AYB G;  4A76 A;  4DR4 Q;  1K3B C;  1HCZ A;  3NSW A;  2WP8 J;  4A3K G;  4K5V A;  5IP7 H;  2PW7 A;  3A74 A;  3PIP A;  1I50 H;  1MD2 D;  4X65 Q;  3S16 B;  2UUB Q;  5IT9 c;  4DV7 L;  4KY5 A;  3J80 c;  4ZYS A;  1YNN D;  4BXX G;  2E2J B;  3U9O A;  1SMY C;  2E2H H;  4H0L C;  3J7Z C;  2EYO A;  5K36 G;  5DM7 3;  2EJF C;  3J7A F;  5J22 A;  1QIL A;  3AYH B;  5C4X G;  5IYB G;  4DV0 L;  1BQQ T;  3CCQ A;  2ENB A;  5IYD H;  4DUZ Q;  4ILW A;  2E5L L;  1SDF A;  1GUW A;  2D5D A;  2MP1 A;  3K5M A;  4DR1 L;  4NPS A;  2NZO A;  2B2W C;  4N9P A;  4YWM A;  1YIJ A;  2H1E A;  2WAQ E;  4G7Z C;  2UXB Q;  4AQY L;  1BOS A;  2HQL A;  3D0F A;  2JEB I;  2Z8L A;  2L15 A;  5I9O A;  5CV4 A;  3IL8 A;  1PV4 A;  1U9R A;  1Q8I A;  1V1O A;  5CV9 A;  4HJA A;  1JWM D;  1VQG A;  3F2C A;  2DUD A;  1FL0 A;  5E4X A;  2F3W A;  2WB1 B;  2NVY B;  1B9N A;  4KY7 A;  4LFC L;  4DR3 L;  4A3M H;  1IKM A;  2K14 A;  3T1H L;  1C8C A;  2FMC A;  2VB3 X;  5IWA L;  2Y0S E;  1HR0 L;  4M1U B;  4WRD A;  4JYA Q;  3CQZ B;  4ID6 A;  3RLN A;  4DFA A;  2G9D A;  2C5C A;  5KYI A;  5JEA G;  5C44 H;  1WTR A;  5AJ3 L;  1QJO A;  3U4Z A;  2Y0S B;  5LMN Q;  3G6E A;  4DAY A;  3QG1 A;  2WB1 E;  2ID0 A;  3U4V A;  4CJ0 B;  2UU9 Q;  3HOY H;  4OEL B;  3J7A V;  4KHP L;  1IHZ A;  4RCN A;  4RH6 A;  1UE7 A;  2LXK A;  1N36 Q;  1TWA H;  5C44 B;  1HFN A;  4BY1 B;  3RN2 A;  1HNX L;  4A3B B;  2F0M A;  1JJC B;  4QL5 A;  2HCC A;  3I2Z A;  2BE5 C;  1TWG B;  3AEV A;  4A3C G;  4DR3 Q;  3RNU A;  2NVT B;  1TS5 A;  1KQS A;  2XWJ B;  5T1I A;  3UDG A;  3HOV H;  4R4Q A;  4LF6 L;  1E2V A;  2IL8 A;  1VQE A;  2QIL A;  4FNF A;  4A3J G;  1D5M C;  4C3J H;  2YU9 B;  1TT2 A;  4A3D H;  3BJU A;  2PMZ B;  3D4D A;  3S2H H;  1EY8 A;  3EJI A;  1EQV A;  3AB9 A;  4PMC A;  3K5N A;  4YWL A;  2HUG A;  4FF3 A;  1RIP A;  3D6C A;  1VQO A;  4DNT B;  1AP0 A;  4XT1 B;  1TU2 B;  5ELC A;  4PV1 C;  4P74 A;  5C0X H;  2X6G A;  2F0D A;  2A73 B;  4L5Q A;  1I3Q B;  1Y1W H;  4CDF C;  3Q23 A;  3I70 A;  1Q82 C;  2UUA Q;  1WCM B;  1QB5 D;  1RL2 A;  3AQQ A;  1NBW A;  1GUG A;  2BA0 A;  2XSC A;  1PRT C;  2JE6 I;  2D9U A;  2ICI A;  4B9X A;  3F2B A;  2M00 A;  2RKS A;  2KUM A;  3Q8D A;  5EBC A;  1E3P A;  2LSS A;  1KLU D;  1F2L A;  3I4N G;  2DY8 A;  2JXM B;  3U9S A;  4EQN A;  1S40 A;  1ZYR C;  5KNC A;  2AQ2 B;  2A8V A;  5IE8 A;  4LF9 L;  4DV4 Q;  2KEN A;  2E76 C;  4KJO A;  3OTO Q;  3CXC A;  4A3F G;  3B6Y A;  2RDH A;  4R4I A;  2O4X A;  1NSN S;  4JI4 Q;  2R7Z B;  2XRS D;  1PTO F;  1ROD A;  3QOL A;  1STY A;  1JJG A;  4HR7 B;  1NR4 A;  4NDX A;  1PH6 A;  2R7D A;  4HCS A;  4E6I A;  1YNN C;  3TRE A;  1E2W A;  3L9A X;  3R3O A;  4DAY B;  1P16 A;  1BDO A;  2K6A A;  1HH2 P;  1WTQ A;  2R92 H;  1HXY D;  3MEH A;  1IBM L;  4ZK9 B;  1D7Q A;  2FFK B;  1JJ2 A;  1BCP B;  1V1Q A;  3QJY A;  1HNX Q;  1VQP A;  1QNU A;  4IUT A;  5COY A;  1AZQ A;  1CSP A;  2ZTE A;  4EX5 A;  1T5X D;  3CME A;  4POG A;  5JPM C;  4X64 Q;  1GD7 A;  1PDQ A;  2XGT A;  3JAM L;  4JOI C;  1X65 A;  3DLL A;  1BBW A;  4DUY L;  2JSO A;  1F2Z A;  4OIK A;  4A3J H;  3K7A B;  2NVX B;  5DLQ E;  2SEB D;  4JV5 Q;  3SHL A;  1G2S A;  4K6D A;  3GTL H;  1KD1 C;  2K5D A;  3E6Z X;  1SE2 A;  1XYI A;  4DV3 Q;  3I56 A;  3S1M H;  2F0U A;  1YNJ D;  1L1O B;  2X6L A;  2G9H D;  1ENF A;  4Y7N B;  3PO3 H;  1FVI A;  4GOP C;  1H95 A;  5DNF A;  2CW0 D;  1Y1W B;  1VQH A;  3KFU A;  1GVP A;  1SYC A;  5I2X A;  2O5I C;  1YIT A;  4X64 L;  1U5K A;  1UWV A;  2PI2 E;  3RLO A;  1PH2 A;  1JIC A;  3DEP A;  5AJ3 Q;  4TRD A;  1FYC A;  2GA4 B;  1NE3 A;  3UE1 A;  3NWT A;  5ELE A;  5CC4 A;  1KC8 C;  1R9T B;  1HNW Q;  1PZK D;  5C3E B;  4HJ5 A;  2F0P A;  4LAA A;  1EY7 A;  3WOE A;  4HN7 A;  4OXP A;  5GQO A;  1LAC A;  2E5L Q;  3BDC A;  2MHV A;  4R4O A;  4A3G H;  3DHQ A;  1IL8 A;  2MGS A;  3I90 A;  4DA2 A;  1KXL A;  1KAW A;  1K8G A;  2GN5 A;  3FPU B;  3A55 A;  4A93 H;  1PYS B;  2K5H A;  3H0G B;  3X3M A;  3JAM i;  4RGO S;  1WI5 A;  3QIA A;  2WV6 D;  1D2B A;  4NB3 A;  4A3J B;  3SVM A;  1KIX A;  4BA2 I;  4A3B H;  3MVV A;  4C3I H;  1PVO A;  4HID A;  1M4V A;  1XMQ Q;  2NN6 I;  4ABN A;  1STN A;  1L0X B;  1Q12 A;  4C3H G;  1HNW L;  1L0Y B;  2A6H C;  2NBF A;  3KF6 A;  4L63 B;  1STH A;  2ZM6 L;  3DWA A;  2I5L X;  3KDF A;  4XTC S;  4DV5 L;  3TZD A;  2RHQ B;  4IQZ A;  3CHB D;  4CHT B;  3K5L A;  4A3E G;  4JI8 Q;  3TZU A;  1XNR L;  3CCV A;  4DR2 Q;  4LMQ D;  1ILQ A;  4HJ8 A;  1QE6 A;  1X3G A;  2D0O A;  3VR4 A;  1RJT A;  3A8I E;  2FIN B;  2VXW A;  2ZXR A;  2LY7 A;  2K04 A;  5EJW A;  1TS4 A;  1STG A;  1CHQ D;  3RD4 A;  4ZKC B;  5LMN W;  5IGF A;  1Q7Y C;  3GTG B;  1GUT A;  1BBX C;  2NWG A;  5KND A;  1JCK B;  4ZAI A;  3Q6S A;  1N32 L;  1BCP D;  2Q2T A;  2IHE A;  5CR3 A;  1S72 A;  3HOZ G;  3I91 A;  4FXG C;  3TP5 A;  4O42 A;  2AQ1 B;  4JOI A;  1K83 B;  5HGT A;  4KJN A;  4B3R L;  1AZP A;  4P73 A;  1HNZ Q;  4JI5 Q;  5M5Y H;  1Q1E A;  2A1A A;  1F2M A;  1S5C D;  1SJH D;  1Y1V B;  3BG3 A;  5BR8 Q;  3WDN A;  4X62 L;  1H9J A;  3PUZ A;  1J5E Q;  4C56 C;  1NY4 A;  4C3H B;  4GKK Q;  1II3 A;  4P75 A;  2UXD Q;  2QEX A;  4RG1 A;  2VZA A;  3M7G A;  1TWF H;  3UDF A;  5EQ0 A;  2XRQ D;  1N33 L;  2KQ3 A;  3PGZ A;  4FXK C;  5ELB A;  4KHZ A;  4L5R C;  1IXR A;  4A3D G;  1CA5 A;  1Q46 A;  3D6W A;  5G3L F;  1IBK Q;  4OEM B;  4B3S L;  1OXX K;  4J8Q A;  4CKB A;  5DEH A;  4UDU C;  2I5H A;  2A6E C;  2O2L D;  2CQO A;  3TS2 A;  1FNU A;  2K50 A;  5NUC A;  4Z9C B;  2JYO A;  1EYA A;  3GTM H;  1VS0 A;  1Z47 A;  3H15 A;  5GAD C;  2CQA A;  3E9I A;  1X3P A;  1XNR Q;  2KVM A;  4JI8 L;  1I6H B;  4ULL A;  1G2T A;  3E3X A;  2B2Y C;  1LTB D;  4HSV A;  1P8L A;  4DF7 A;  3W5O A;  3Q22 A;  2NN6 H;  4LF8 L;  3RLF A;  4RMF A;  1A15 A;  5M3F H;  3KYH C;  3GTP B;  1M1K C;  5FK9 C;  1JC7 A;  5C4J B;  1EQQ A;  4BY7 H;  4QUC A;  5CMD A;  4LFA L;  4Q0F A;  2IX3 A;  3MXN A;  3OYY A;  4YY3 L;  3OW2 A;  2WAQ B;  5J39 A;  3Q0A A;  2Z6B A;  3BZC A;  4C2M B;  4X3U A;  2B2U C;  1K8M A;  5CV5 A;  2TSS A;  4C3I G;  1MJE A;  5M3F B;  1SE3 A;  3UE0 A;  3I55 A;  3KJO A;  4L6T B;  3CCU A;  4IFD I;  1X9N A;  3CW2 C;  2N3S A;  2OEO A;  3DMU A;  3J81 E;  2F0S A;  3QR8 A;  3C2P A;  1PZI D;  2Z4H A;  1EWC A;  5FLX c;  1SND A;  1S5B D;  1SNO A;  1BVS A;  3ULL A;  1O80 A;  5C0X J;  4EQO A;  2AMC B;  2PQA B;  4JI1 Q;  3P7J A;  3PF5 A;  1SRO A;  3MHB A;  4N9T A;  3CCS A;  3K0X A;  4LFB Q;  1NNX A;  5ELN A;  4HMJ A;  3JAM E;  4IOC A;  3HOZ H;  1PZJ D;  1AE2 A;  3FP9 A;  4ALP A;  2EDG A;  2H5X A;  4B9W A;  2DGY A;  4JBW A;  3RUZ A;  1ICW A;  1KTK A;  4FF1 A;  2E2J H;  3LWE A;  4RCO A;  3C3L A;  2IT1 A;  4KMU C;  2BCO A;  4YWK A;  1UE5 A;  4JI1 L;  5I2Y A;  3NQT A;  4QGU A;  1XTD A;  3R2T A;  4GS3 A;  3G7L A;  1N36 L;  3K7A H;  2JA9 A;  2NVX H;  1B50 A;  4JI3 Q;  3UDI A;  3J80 L;  4GLX A;  3H3V H;  4KK7 A; 
#chains in the Genus database with same CATH homology
 5LMN Q;  4DV0 Q;  2VY3 A;  3L0O A;  3G6E A;  3CC7 A;  1X6O A;  5ELO A;  1SLJ A;  2VUM H;  2K52 A;  4LF4 L;  1I3Q H;  1EQR A;  2JA6 H;  4POF A;  4IFD G;  3E0E A;  4DAM A;  4IJH A;  3PCO B;  3STB D;  2WB1 E;  2ID0 A;  3U4V A;  2D0P A;  3F1Z A;  2VQE Q;  4IFD J;  4UY8 C;  1GO3 E;  2UU9 Q;  3ICE A;  3HOX H;  3HOY H;  1GM5 A;  4JI4 L;  3GTQ H;  3HOW H;  4DR5 L;  1K83 H;  4DR6 L;  4A3C H;  3T1Y L;  4KHP L;  2LXJ A;  4LFA Q;  1UE7 A;  2LXK A;  1PYB A;  1TWA H;  1N36 Q;  3RN2 A;  1HNX L;  4X66 Q;  5JEA J;  1JJC B;  4QL5 A;  4X62 Q;  4A3I G;  5LMU L;  2R7F A;  3KF6 B;  3I2Z A;  2B63 G;  3A0J A;  2RHS B;  5M3M H;  4DKA C;  4LF8 Q;  1JMC A;  3ZJY C;  4GNX A;  3AEV A;  1WYD A;  4A3C G;  4DR3 Q;  3RNU A;  1JE5 A;  3T1Y Q;  4DUZ L;  2JA7 G;  4GOP B;  1VQD A;  4P72 A;  3I4N H;  4KHP Q;  2MO0 A;  1YVC A;  5C3E G;  1KQS A;  3SGI A;  1PHJ A;  3UDG A;  3HOV H;  3CC2 A;  4R4Q A;  2VQE L;  4LF6 L;  2KHJ A;  3A5U A;  3W1G A;  1MIU A;  2NVQ H;  4LF5 L;  1VQE A;  4A3J G;  4NXN Q;  4C3J H;  1IZ6 A;  4A3D H;  3M85 A;  2R93 H;  2F3I A;  4DV2 L;  2ASB A;  4JI2 L;  4KLK A;  3BJU A;  3STB C;  1SFO H;  4WJ4 A;  2WAQ G;  1QVG A;  2JA5 G;  2YU9 H;  1KRS A;  4A3G G;  2YV5 A;  2WB1 G;  4LW1 A;  1C9O A;  4GNX C;  1FJG L;  3EBE A;  4OX9 L;  4JI3 L;  1Y1W G;  1M90 C;  4HJ9 A;  1L1O A;  2UUC L;  3M3Y H;  4DR4 L;  4YWL A;  1X3F A;  1RIP A;  1NMF A;  1VQO A;  4A3M G;  2CWP A;  1E1O A;  5IP9 H;  1TWC H;  3PUY A;  4P74 A;  1XNQ L;  4DV3 L;  1EWI A;  2D62 A;  3K8A A;  1VQ5 A;  1NMG A;  1SRU A;  2V1C C;  4L5Q A;  1Y1W H;  4BY1 H;  4A3B G;  4DR7 Q;  1XMO Q;  2E8G A;  3PO2 H;  2CWA A;  4YHH Q;  2VQF Q;  1Q82 C;  3KDF B;  3K80 C;  2UUA Q;  5GAG C;  1RL2 A;  3AQQ A;  1NBW A;  2BA0 A;  1IYJ B;  4DUY Q;  2IX1 A;  1A62 A;  2KCT A;  2JE6 I;  3S15 H;  1B70 B;  5HGQ A;  1YHQ A;  3F2B A;  5E7N A;  1YJW A;  1HZA A;  3Q8D A;  1E3P A;  2LSS A;  3FHW A;  3NEM A;  1YZ6 A;  1YJN A;  5FLM H;  1XPR A;  1J5E L;  2JA7 H;  4JBM A;  3I4N G;  4UP7 A;  4GOP A;  5HY6 A;  1S40 A;  2VS1 A;  2F4V L;  3CQZ H;  2A8V A;  5IE8 A;  4GKK L;  4LWC A;  4LF9 L;  4R4T A;  4DV4 Q;  2KEN A;  5FJ8 H;  2R7Z G;  2K75 A;  1HJP A;  1Q1B A;  3W1B A;  2EXD A;  3OTO Q;  3CXC A;  4A3F G;  3B6Y A;  5IYD G;  4R4I A;  1K3R A;  3F2D A;  3RZD H;  4JI4 Q;  1A63 A;  4JI2 Q;  3I4M H;  1OXS C;  1E22 A;  3H0G G;  1O7I A;  1L0W A;  2CKZ B;  4JG2 A;  3J81 j;  1OXU A;  4JBJ A;  1C0A A;  2OCE A;  1JJG A;  2JEA I;  1AH9 A;  4A93 G;  1N32 Q;  4A3L H;  2Z0S A;  2JQO A;  2ES2 A;  3PUW A;  1PH6 A;  2R7D A;  2R93 G;  2Q2U A;  3G71 A;  1VQM A;  3TRE A;  1S3O A;  1ASY A;  4DAY B;  1D8L A;  3PUV A;  4TQU S;  4DV4 L;  3CMA A;  1P16 A;  2K5V A;  5GAH C;  3JAM c;  1HH2 P;  2ZJR A;  4GKJ Q;  2R92 H;  1IBM L;  1VQ4 A;  2Z6K C;  2KBN A;  1D7Q A;  2OWO A;  1JJ2 A;  1V1Q A;  4X6A H;  1HNX Q;  1T9H A;  2I5M X;  1OXT A;  3I4O A;  1VQP A;  2E2I H;  4TVA B;  1HZC A;  2QGQ A;  4EQ5 A;  1CSP A;  2ZTE A;  4EX5 A;  3CME A;  4POG A;  4LF7 L;  1HZ9 A;  4X64 Q;  1GD7 A;  2XGT A;  4QIW E;  2KCM A;  1A8V A;  4JOI C;  1WCM G;  2WFW A;  2UUA L;  2XTI A;  1X65 A;  5LMN L;  3DLL A;  2MFI A;  1BBW A;  3CCM A;  3S1Q H;  4DUY L;  1DGS A;  1L2F A;  3J81 c;  4A3J H;  3HOU G;  5M5W H;  5DLQ E;  1N33 Q;  4JV5 Q;  2I0Q A;  4A3F H;  2JA8 H;  3CCR A;  3L7Z C;  1SMX A;  4OO1 G;  3GTJ H;  3GTL H;  3WWV A;  1KD1 C;  1QZH A;  2NVY H;  4JI0 L;  3PF4 A;  2VW9 A;  3J7A 5;  4DV3 Q;  3I56 A;  3S1M H;  4B3M Q;  2BA1 A;  2GVA A;  2UUC Q;  2K5N A;  2B63 H;  1L1O B;  1QUQ B;  1N9W A;  2UXC Q;  1WJJ A;  3HFZ B;  1NTG A;  1HNZ L;  4GLA C;  1EIY B;  1FVI A;  4DR5 Q;  4IPG A;  3S14 H;  1K8A C;  3PO3 H;  4DR6 Q;  1X55 A;  4GOP C;  4DPG A;  1FJG Q;  4DV2 Q;  1H95 A;  4XIG S;  2MO1 A;  4DV1 Q;  3VDY A;  4JCV E;  1CKN B;  1VQH A;  3KFU A;  5JJL A;  3KJP A;  1GVP A;  4A4I A;  4LNQ A;  1OTC A;  1PFS A;  4BY1 G;  1YIT A;  4X64 L;  1U5K A;  1UWV A;  2PI2 E;  3RLO A;  4DK6 C;  1PH2 A;  3PO2 G;  5AJ3 Q;  2N8N A;  1QVF A;  4O0A A;  1PA6 A;  3CCJ A;  3S24 A;  4DV6 L;  3S2D H;  1NE3 A;  3UE1 A;  2Z6K A;  4GNX B;  1VQK A;  4MZ9 A;  3RN5 A;  1ASZ A;  4PZ8 A;  4YY3 Q;  1KC8 C;  1HNW Q;  3J80 i;  5LMU Q;  1L1O C;  4HJ5 A;  2IX0 A;  3GO5 A;  2OQK A;  4O2D A;  1K9M C;  2R92 G;  2HIX A;  4OXP A;  5J3B A;  5GQO A;  3GTK H;  2ZTC A;  2E5L Q;  4DV6 Q;  3HKZ G;  2N49 A;  2RF4 A;  4R4O A;  2JA5 H;  4A3G H;  3FKI G;  4IO9 A;  2NN6 G;  5AJ3 L;  1KAW A;  1C7Y A;  1K8G A;  1E7Z A;  2GN5 A;  4HIK A;  3GTO H;  1KXL A;  4A93 H;  4QJF A;  1YHB A;  1G6P A;  2K5H A;  1PYS B;  1CSQ A;  4FDB A;  1CUK A;  1I94 L;  4LUV A;  1PH3 A;  1LM0 A;  3JAM i;  1PH9 A;  4BBR G;  1PH4 A;  4YCU A;  4DV1 L;  1WI5 A;  3IRB A;  2PQA A;  4A75 A;  3CD6 A;  3HOU H;  1VQF A;  4IPH A;  4NB3 A;  1CKN A;  2JJQ A;  4C3H H;  4UPA A;  3OTO L;  2YTY A;  1KIX A;  4BA2 I;  4A3B H;  4DR7 L;  4C3I H;  1PVO A;  4HID A;  5M3M G;  1XMQ Q;  1Y1V G;  1LYL A;  1MJC A;  3TEH B;  3T1H Q;  1SE8 A;  2IHF A;  4LFC Q;  3H3V I;  4JI6 Q;  1QUQ A;  1HR0 Q;  1I5F A;  5IP9 G;  2NN6 I;  4NXM Q;  4NXM L;  3ER0 A;  4OO1 I;  1Q12 A;  1YEZ A;  1E1T A;  3D31 A;  1HNW L;  1QVC A;  3KF6 A;  5C4X H;  2BH8 A;  1AE3 A;  1QZG A;  4DK3 C;  3RR5 A;  2ZM6 L;  3KDF A;  2I5L X;  4XTC S;  4BBR H;  4DV5 L;  1PH8 A;  4OWW B;  1X3E A;  2RHQ B;  3F8T A;  4GN3 B;  2JA6 G;  1KL9 A;  2MQH A;  3L2P A;  1SR3 A;  4AQY Q;  4OWX B;  4PZ6 A;  4AYB E;  1VQ6 A;  3G4S A;  2VUM G;  1HR0 W;  3K7U C;  2B29 A;  3MXN B;  4LF7 Q;  4A3E G;  1XMO L;  4JI8 Q;  1UE1 A;  3S17 H;  4A3L G;  2AWO A;  1XNR L;  4LUO A;  3CPF A;  4X65 L;  3CCV A;  3TQY A;  4DR2 Q;  1I94 Q;  4HJ8 A;  1JT8 A;  1X3G A;  4R4C A;  5C0X G;  3J81 i;  1N34 Q;  2D0O A;  3H0G H;  1VQN A;  3I4M G;  4IPC A;  3GD7 A;  4PG3 A;  1Q86 C;  2CCZ A;  1V9P A;  3KLW A;  5IYC G;  4YCV A;  3K81 C;  1IBM Q;  1HZB A;  2CFM A;  4GKJ L;  2R7Z H;  2PI2 A;  5LMN W;  1EIF A;  1V43 A;  1Q7Y C;  4L5S A;  4AIM A;  1IBL L;  3GTG H;  3CPW A;  3A5Z B;  3KF8 B;  4MTN A;  1IBK L;  4JC0 A;  2AKW B;  2OTL A;  3ULP A;  5M5X H;  1N32 L;  1XPO A;  2Q2T A;  2IHE A;  5GAE C;  2UU9 L;  2JA8 G;  4YCW A;  1S72 A;  2MNA A;  2K4K A;  4BA1 I;  3U58 A;  1JB7 A;  2NVT H;  3CF5 A;  3HOZ G;  3HKZ E;  2EIF A;  4JOI A;  2EQS A;  4QY7 A;  5IY0 A;  4K0K L;  2UUB L;  2R6G A;  1WFQ A;  3PIO A;  1IL2 A;  4B3R L;  4IOA A;  4J15 A;  1MKH A;  2Q2H A;  1W3S A;  4P73 A;  4H02 A;  5C44 G;  2ZJP A;  1HNZ Q;  2HHH Q;  2ZJQ A;  4JI5 Q;  2C35 B;  4AH6 A;  1YI2 A;  2OTJ A;  1Y14 B;  5M5Y H;  1VCI A;  1YBY A;  1Q1E A;  2A1A A;  2PMZ E;  3TS0 A;  4B3T Q;  1Y1V H;  3S1R H;  1N8R C;  5BR8 Q;  1VQ8 A;  5BR8 L;  4X62 L;  1B8A A;  1YNX A;  3PUZ A;  1J5E Q;  1G29 1;  1Q81 C;  1NY4 A;  4UP9 A;  4GKK Q;  4P75 A;  3S1N H;  1EYG A;  2F4V Q;  3NEL A;  2NZH A;  2UXD Q;  1UE6 A;  2QEX A;  1GKH A;  4Y52 H;  2AHO B;  4RG1 A;  1XJV A;  1FGU A;  2VZA A;  2VNU D;  2HIV A;  1TWF H;  3CP0 A;  3EIV A;  3GDE A;  3UDF A;  3M4O H;  4UP8 A;  4C2M H;  4JI7 L;  4BXX H;  1EOV A;  1X56 A;  1N33 L;  4JV5 L;  3NBH B;  3M7N A;  3FKI H;  3M4Q A;  3PGZ A;  4KHZ A;  4YHH L;  4L5R C;  1IXR A;  1VQB A;  4A3D G;  1TWH H;  1Q46 A;  3PO3 G;  1VQI A;  3HOV G;  2ZM6 Q;  1IBK Q;  4B3S L;  3CAM A;  1J6Q A;  4P71 A;  5GRO A;  1OXX K;  1XNQ Q;  1EFW A;  2UXC L;  5C3E H;  1PH5 A;  3ULJ A;  2Q2I A;  2I5H A;  3M9B A;  1VQL A;  2CQO A;  1K73 C;  2AWN A;  1PH7 A;  1A0I A;  3TS2 A;  2K50 A;  5FJ8 G;  4B3T L;  3BU2 A;  1XMQ L;  5JJI A;  1Q8K A;  4R1J A;  3EN2 A;  3GTM H;  1TWG H;  1K0R A;  1VS0 A;  1W2B A;  1Z47 A;  3HKS A;  4IJL A;  3H15 A;  3LGJ A;  5GAD C;  2ATW A;  3AFP A;  4APV A;  3PV0 A;  4HJ7 A;  1BBU A;  1XPU A;  3E9I A;  1YHA A;  4MNO A;  4PZ7 A;  3CC4 A;  3HOY G;  4HIM A;  5EAY A;  4JBK A;  1XNR Q;  3AFQ A;  3HOW G;  4NXN L;  4JI8 L;  4LF5 Q;  2VL6 A;  3HOX G;  1U0L A;  2QA4 A;  4LUZ A;  4LFB L;  3KOJ A;  4Y7N H;  3E9H A;  2VQF L;  4JI7 Q;  4QQB X;  4DV7 Q;  1P8L A;  1PH1 A;  2YTV A;  1BKB A;  1OXV A;  4PMW A;  3W5O A;  2UXD L;  2HT1 A;  4LF8 L;  3RLF A;  4RMF A;  4DR1 Q;  5IP7 G;  1YJ9 A;  2KHI A;  5M3F H;  3KYH C;  4A3K H;  3CCL A;  5JJK A;  2PNH A;  5FLM G;  1VQ7 A;  4GN4 B;  3S16 H;  1M1K C;  2OQ0 A;  1X54 A;  1EQQ A;  4BY7 H;  1VQ9 A;  1G51 A;  4X66 L;  4LFA L;  4LF9 Q;  2BH2 A;  1WOC A;  1VQJ A;  4A76 A;  4DR4 Q;  3OYY A;  4AYB G;  4KI0 A;  4YY3 L;  3OW2 A;  5IYC H;  2WP8 J;  1VQC A;  5IYB H;  5M3F G;  4A3K G;  3BZC A;  5IP7 H;  4A3E H;  3A74 A;  2HHH L;  3PIP A;  1I50 H;  3M4P A;  4JI5 L;  4GN5 A;  4X65 Q;  2UUB Q;  2Y0S G;  1MJE A;  5IT9 c;  4K0K Q;  4DV7 L;  4B3R Q;  3J80 c;  1Z9F A;  4LF4 Q;  4L5T A;  3UE0 A;  3KJO A;  3PSI A;  3I55 A;  2E2H H;  4BXX G;  5K36 G;  3J7Z C;  3CCU A;  4IFD I;  1X9N A;  4LF6 Q;  2GVB A;  1E24 A;  2N3S A;  3CW2 C;  3AYH B;  4BBS H;  5C4X G;  5IYB G;  4DV0 L;  1SN8 A;  2ZTD A;  3CCQ A;  4DV5 Q;  5IYD H;  1WCM H;  2YYZ A;  4DNI A;  4DUZ Q;  1CKM A;  1IBL Q;  3GTP H;  5IWA Q;  3BZK A;  2E5L L;  5FLX c;  3RZO H;  1R9T H;  4JYA L;  1BVS A;  3I7F A;  4IPD A;  2F52 A;  3ULL A;  4B3M L;  4A3I H;  5C0X J;  4HIO A;  4DR1 L;  4WJ3 M;  4NPS A;  2PQA B;  2AMC B;  2JK8 A;  2NZO A;  4JI1 Q;  4DR2 L;  4YWM A;  1KHI A;  3PF5 A;  4OX9 Q;  1SRO A;  4OWT B;  1EUJ A;  1N34 L;  3TRZ A;  1I6H H;  2ALY B;  3PUX A;  4ME3 A;  3CCS A;  3K0X A;  4LFB Q;  1YIJ A;  1VQA A;  4B3S Q;  5H1S E;  5ELN A;  2WAQ E;  2UXB Q;  2A19 A;  5C0X I;  1TXY A;  4BBS G;  3G48 A;  3U50 C;  4AQY L;  4IOC A;  2YTX A;  2HQL A;  3D0F A;  2JEB I;  3HOZ H;  1NJI C;  1AE2 A;  3FP9 A;  3DM3 A;  4ALP A;  2L15 A;  2H5X A;  2DGY A;  4JBW A;  1PV4 A;  1LTL A;  4OON A;  4HJA A;  2E2J H;  2UXB L;  1VQG A;  3F2C A;  2DUD A;  1FL0 A;  3CCE A;  3NEN A;  2B3G A;  2IY5 B;  2FXQ A;  4LFC L;  2IT1 A;  3JC6 6;  4DR3 L;  4A3M H;  4JI1 L;  2K14 A;  1UE5 A;  4YWK A;  3T1H L;  3ERS X;  3S2H H;  4QGU A;  1XTD A;  2N78 A;  4GS3 A;  5IWA L;  4JI6 L;  2Y0S E;  4BY7 G;  3UDX A;  1HR0 L;  1B7Y B;  1KRT A;  1N36 L;  4JI0 Q;  3MEF A;  3K7A H;  2JA9 A;  2NVX H;  4JYA Q;  1CKO A;  3RLN A;  4JI3 Q;  4GLV B;  3UDI A;  4GLX A;  5C4J H;  3H3V H;  1LUZ A;  2RCN A;  5JEA G;  5C44 H;  1UEB A;  3U4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...