3KUPA

Crystal structure of the cbx3 chromo shadow domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the CBX3 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 3
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kupA00
1ILQA 4IUQA 5EQ0A 3UI2A 1MI2A 2B2TA 2B2UC 4ZAIA 1IKMA 1SSOA 1F2LA 4IURA 3G7LA 1QG7A 3F2UA 4IUUA 2KEEA 3N52A 4RAUC 1EIHA 1QNKA 3D6WA 1WTPA 2RSNA 2K04A 1WD1A 1WTVA 1KNEA 5DNFA 1J8IA 1DONA 1WTQA 4CJ1B 2EPBA 2CVRA 3I90A 2NZ1D 1DOKA 4RA8A 1EL0A 1O7YA 3H91A 3IL8A 1B50A 2VXWA 2X69A 2KVMA 2NYZD 2B2VA 4QUFA 1WTWA 2NWGA 2H1EA 1BBXC 1XX8A 5EJWA 2B2UA 2DY7A 1E0BA 2N88A 2X6GA 1M8AA 1B53A 5T1GA 1EIGA 1HA6A 1G2TA 2N55A 3HP3A 4XDXA 3TN2A 1WTOA 2XIWA 1RHPA 2FHTA 2HCCA 2J7ZA 1CM9A 2FFKB 3DEOA 2HDMA 1ICWA 5CORA 1X3PA 3KBXA 4ZKCB 4CJ0B 4XT1B 2B2YA 2KOLA 5D65A 4NW2A 1ZXTA 2KEDA 2X6LA 4HAEA 4X3KA 2FINB 1PDQA 2HDLA 2L11A 3DEPA 5JJZA 4O42A 4DN4M 1IL8A 1HUNA 1BO0A 4XT3B 1U4MA 4U68A 1F9RA 1F9PA 1ML0D 3I3CA 1G91A 2L4NA 1WTXA 4X3SA 2JYOA 2K28A 3ONAB 1VMCA 1AZPA 1BF4A 2K03A 2B2TC 5EKIA 1PFNA 1U4PA 1O7ZA 1B3AA 4X3UA 1MSHA 2DY8A 2FMMA 2KUMA 2K05A 2MPMA 2BDNA 2HCIA 2M2LA 1PFMA 1RODA 1RTOA 2MJ8A 3GV6A 1F9SA 1HHVA 2B2VC 2EE1A 2MP1A 1DOMA 2D9UA 1F9QA 2B2WC 3FDTA 4OIJA 4R8IA 1NR2A 3QO2A 1WVLA 1S4ZA 1HRJA 2Q8TA 4MHEA 1ESRA 2K01A 3IFDA 4HSVA 4OIKA 1B4OA 3FPUB 3GV3A 2RSOA 1X32A 1ILPA 2RA4A 1Q3LA 1IKLA 1QE6A 1RTNA 3LWEA 4CJ2C 2Q8RE 1SDFA 2RVLA 4MN3A 3I91A 1EOTA 1AZQA 2HUGA 2L1BA 3DM1A 1X3QA 2JP1A 1PFBA 2B2WA 2MGSA 4HEDA 2L12A 4X3TA 1HFNA 4ZK9B 1WTRA 1MSGA 1G6ZA 2L9HA 4RWSC 3Q6SA 1EQTA 1U4LA 1NAPA 1KNAA 5EPJA 4IUPA 1C8CA 3I8ZA 4UAIA 3TZDA 1HFGA 2B2YC 1RJTA 1XYIA 1WD0A 1TVXA 4QUCA 1G2SA 3MTSA 1DZ1A 1NR4A 3MWYW 1MGSA 5E4WC 3SVMA 5EPKA 1NCVA 2R3ZA 2FJ2A 4LMQD 5COYA 1O80A 5EPLA 1CA5A 1J9OA 1DOLA 5E4XA 4IUTA 2K1BA 1AP0A 4HCSA 1JICA 2EOTA 5CMDA 1A15A 4R9WA 1CA6A 1BNZA 1VMPA 1PLFA 1U4RA 2KECA 2IL8A 3P7JA 2SDFA 1GUWA 5T1IA 5CBAE 5CBEE 5D14A 1HUMA 1LV9A 3KUPA 3R93A 4IUVA 4ZKBB 1SAPA 1B2TA 4ZLTF 5AFWA 1JE4A
chains in the Genus database with same CATH superfamily
1GUNA 1MI2A 2KENA 2K7VA 4G7ZC 4DV3L 5DNFA 4A4IA 2KCMA 4DR7Q 2MNAA 4CJ1B 2K14A 1WTQA 3M3YH 2PPBC 2R6GA 1TR5A 3K59A 5KNDA 3F2CA 3SGIA 5C3EG 5NUCA 4QF4A 1XX8A 4DV1L 1HNZQ 1STYA 2PNRC 1XPOA 2E5LL 4RH6A 4JYAL 3GTOB 1XTDA 4JI8Q 1VQ6A 2K5WA 5I9OA 1SFOB 1JORA 2A68C 4C3HG 3A54A 5DAUA 2KCTA 1FJGQ 2KOLA 5BR8Q 4GNXB 1X56A 2PQAA 4A3BH 3GTGH 4Y7NB 2HQEA 3T56B 1Y14B 1QZHA 1H9MA 1RD9D 1K0SA 1CKNA 2KQ3A 4H13C 1BKBA 4FNFA 1SYEA 1K73C 1QB5D 1N9WA 1G291 5LMUQ 4UHVA 2JA8G 3PIO3 1I4QA 3BG3A 1SBBB 2NZHA 1K28A 3C46A 3FDTA 1S5FD 4PNYA 4A3KG 2CW0C 2C9OA 3K58A 2QCPX 4LF9L 2Z1CA 4LUVA 1ILPA 4DK1A 1ASZA 2HQLA 1L1OC 3QR8A 2RF4A 3TP6A 4MN3A 4HJ9A 2D62A 5IIFA 1Y8PB 2B2WA 3PF4A 1B3QA 5LHY1 1STGA 4UAIA 2A74C 2Z9HA 3MTSA 5CV4A 1CQVA 2R7DA 5HY6A 3SVMA 2WAQG 3HOVH 3NEMA 1BBUA 3F1ZA 1FYCA 1VF7A 1STBA 1YNND 2LSSA 1Z9FA 1EY7A 1AP0A 1IZ6A 1VQAA 3PUWA 1A8VA 5KYIA 5D14A 1A62A 4A3MB 4EQOA 3HOXG 3C2PA 3HOVB 1I4GA 1JE4A 1UEAB 1XJVA 2KBNA 5DM73 3DMUA 4YWLA 2PZTA 4MNOA 1PRTC 3RLFA 2PW5A 1QNKA 1WTPA 1BDOA 3J81c 4BY7H 1OXTA 3C3LA 2RDFA 1D5MC 4OL7A 3S17B 4NB3A 2QDLA 2ZT9C 3AFQA 5ISRA 4GOPC 2BDOA 5CYUA 3EA6A 2I5LX 1B44D 2L15A 4QIWE 1OXVA 2N55A 2L55A 3CCEA 4LUZA 1S5DD 1WTOA 1RKNA 2FHTA 1TWFH 1I94Q 4KK7A 1F2MA 4JI3Q 2KHJA 2ZTEA 1JT8A 3JAMi 1AE2A 1WCMH 2PMZB 3MAQA 4A3EB 4A3FG 5JJZA 5GAEC 3ULJA 1H9SB 2JA6G 2F0LA 1JR0D 1PH5A 3VYUA 1IBMQ 1K83H 2VB2X 4B3MQ 4A3JG 1AZPA 1Q1EA 4BWGB 1BF4A 2ES2A 1SYGA 2HD3A 1N33L 1CQFA 4DAYB 1AE3A 5KNBA 3IAYA 1FNVA 2LY7A 3BVGA 3G6JB 4LW1A 4JBJA 4OIJA 3U4ZA 4R4OA 1PMRA 3F2DA 4M1UB 4DV1Q 3RLNA 1K9MC 4OIKA 3K57A 1VQ5A 3S1MB 2JXMB 2EXDA 5IOCA 1Q90A 2F0HA 1JWMD 1EOVA 2RVLA 1FNWA 3HRZC 5ELFA 4B3SQ 3M4OH 3QOLA 5GROA 3E9HA 5IT9E 2E2IH 3K0XA 4A3JH 3HOZG 3TS2A 5AJ3L 4XYOA 4TRDA 2ZM6Q 2L0CA 3S16H 4IFDG 4OONA 4GN3B 4YCWA 1MJCA 4DKAC 5IYBG 2M9VA 2VQFL 1MKHA 4A3GG 1VQ7A 3CHBD 3KDFA 4K14A 3EFXD 4DR5Q 2G9DA 2KECA 1PH8A 5C4JH 3UDGA 2NVXB 4KHZA 3E3XA 2UXBQ 3ULLA 4A3DH 3J81i 2EYHA 5C0XI 5BR8L 1ILQA 3D3RA 2B2TA 1HA5A 3RZDH 2PQAB 2F52A 4NP5A 1CKOA 4KV6A 2RSNA 5C5LA 1CKMA 1QOHA 3TP8A 4YY3L 2EPBA 4JBWA 1HNXL 2UUAL 1EL0A 4WJ4A 1C48A 1I4RA 3FVQA 4DNIA 2CKZB 2NYZD 4P72A 2H1EA 1XNQQ 1QZGA 3V2TA 3OHXC 5T1GA 2LFNA 3D4RA 4DK6C 1YHQA 1X54A 1RHPA 5JPMC 2IW3A 1FD7D 2DNEA 2RBMA 4K5XA 3HOZB 2EYPA 3H15A 3S1QB 4IOAA 2QKIC 1NUCA 5D65A 3AYHB 1UE6A 4JI2Q 2HHHL 2CFMA 2L11A 3LGJA 4DAYA 4A3IB 5DM63 5ELNA 2Z6BA 4OX9Q 4WRDA 3GO5A 3FKIH 2CW0D 4H44C 4B3TL 2L4NA 4ILWA 1WTXA 5ELOA 2G5DA 3U58A 2JYOA 2K03A 1I4HA 2KUMA 3T13A 2BDNA 4PZ6A 3AB9A 1SNQA 5J22A 1Y1WG 1D6EC 4NXML 1VQ4A 1ENCA 1HR0L 1LTTD 3S14B 2SNSA 5IYDH 3NTKA 3HOVG 4BBRG 2F4VL 3OYYA 1XNQL 4JI4Q 2EZVA 1X3EA 4X62Q 4A3EG 1VS0A 5M5XB 1CFMA 3KF8B 2OQKA 3I8ZA 2UXCQ 5I4DA 1HFGA 1WD0A 1STNA 1LTSD 2JA7G 4FF4A 1IYUA 1MGSA 5E4WC 4QY7A 1NJIC 1KXLA 4O0AA 1MJEA 4HN7A 4I7ZC 2JA9A 3NBHA 4I65A 1EWCA 1GO3E 2EIFA 1L2FA 4JV5L 2P5ZX 3G71A 3CD6A 1HNWL 1XTCD 4ZKBB 1SYBA 4DV7L 4DV3Q 1X55A 2XVSA 3QG1A 2Z0SA 2NTTA 2QA4A 3TZUA 4ZLTF 5EQ0A 3ERQA 1PH9A 5FK9C 3GTKH 2VZAA 1PH3A 1QG7A 1E2WA 4IUUA 2KHSA 4B3SL 4LF7Q 5LMUL 2IT1A 1GKHA 1A3UA 1P16A 3W1GA 2VXWA 2KVMA 5C3EB 1YEZA 1SYFA 5BN3A 3BDOA 3WOEA 4DK3C 1VDZA 2K4KA 2F1MA 3H94A 1L0YB 2IWHA 4QMGA 4IFDI 2HCCA 4UY8C 3CCRA 2B8FA 2NVYH 5I2XA 1SFOH 1O78A 4B9XA 2PZUA 4KN4C 4GKJQ 2R61A 5J3BA 4DV6Q 1ET9A 3VA7A 3V96A 1E7ZA 4TSSA 4DUZL 3DEPA 1VQFA 1VQLA 3CCLA 3R8BA 5GAHC 4DXGA 3BDLA 3SR1A 2IJ0A 4GOPB 3NE5B 3I72A 3CCQA 1SMYD 1U4PA 1LYLA 2G9HD 3I73A 2JA8B 2HT1A 1PFSA 2E2HH 3TQYA 2EE1A 4OXPA 2ENBA 2O5JC 3I4LA 3ZYYX 3NP8A 3SHLA 3UDXA 2YYZA 4U673 1N36L 4LF8L 4DNRB 4BBRH 1SRUA 3MZ5A 2JA7H 1QE6A 3P20A 3R2IA 2XTIA 1EOTA 1EYGA 3WWVA 1KRSA 2L1BA 5A2QL 1PH4A 4OELB 1AW7A 1TKWB 4XXEA 3S1QH 3MXPA 4HCEA 1NAPA 4X66L 5C6AA 4A3FH 2VQEQ 1FL0A 2F0VA 3Q22A 4L5RC 4QUCA 3AEVA 3AU7A 5CV7A 2R3ZA 2PO4A 1S72A 1D5ZC 1LTID 4RKBA 2NZOA 2YU9B 1KDAA 4LWCA 3ND8A 4HMIA 2AWNA 3CXCA 1GOZA 3MXNA 3NUCA 4TQUS 1PTOF 3K7AH 4FXKC 2CQAA 1FGUA 1LT6D 1CTMA 2JA5H 4DAVA 3CC7A 2EY2A 1GM5A 3HOXB 2AQ2B 2EY1A 2A1AA 3T1HL 1K3BC 2CHBD 2A6HD 1D2BA 1EY9A 1Y1VH 1EY4A 2K04A 1I6HH 1KNEA 1XMOQ 1Y69U 3H91A 4LJZC 3PO2B 2F0QA 5CV6A 4P2CB 3MEFA 2B2VA 2MQHA 2EY5A 4A93B 2F0GA 3C1EA 5M9OA 4PMCA 1OO9B 2A68D 4BXXH 3OMGA 2R7FA 4A3MH 2ATWA 1LT4D 2WV6D 1XNRL 1BBWA 1VQNA 3HOWB 1Y1VG 1ICWA 2WB1B 1GUGA 3FKIB 4XT1B 3CMEA 1LTBD 3S2HH 2F0TA 4X3KA 1G8ZD 2NVTH 3TS0A 1PDQA 1V43A 3QB3A 4O42A 1LACA 3UDFA 1IL8A 1HUNA 4LF4Q 5CV5A 4IJHA 3J81E 1SYDA 2KHIA 1EU4A 4BA2I 1LTGD 1Q86C 1W6KA 3K5LA 5J39A 5IGGA 2PMZE 2AMCB 2PYKA 1JB7A 5IYBH 3KYHC 1B4OA 1L1OA 3BJUA 1E24A 3NHHA 1VQKA 2Y0SB 4A3IH 1XPRA 2E2HB 2OTLA 4EVOA 1YITA 4YHHL 2UUBL 4OX9L 1PTOB 2QEJC 3IRBA 4X3TA 1DM0B 3J81L 3M3YB 1WTHA 5I9PA 5HURA 3J7AF 4L5TA 2D0OA 3PO3H 2YTVA 4IN3A 1CHQD 1G51A 4C3HH 5HGQA 3J80E 4JCVE 1EEFD 5M3FH 5KNCA 5M5XH 1QJOA 3HOWH 1IXRA 3CC2A 3L9AX 1YNJC 1Z6HA 3A5UA 5EAYA 3DLLA 4HIKA 1VQ8A 1SLJA 4X64Q 3DM3A 3J7YW 4UPAA 2E2JB 3KUPA 1TWHB 2FMCA 3KBGA 3RZDB 2XRQD 4Y52H 1UEBA 2AUJD 3FPPA 2B2UC 2VQFQ 1SSOA 3K81C 5C3EH 1M1KC 2A6EC 2F03A 3S15B 3SDZA 3I4MG 2I5MX 3ERSX 4QB4A 4QIWB 3E0JA 4PZ8A 1DONA 3A8KE 3RD4A 2NTSA 5KRUA 1MBYA 3C1FA 1XPUA 1B50A 3K7UC 1I50H 1PA6A 4YWKA 2DY7A 3GTPH 1S5ED 1PYWD 2K5DA 4GN5A 1SE2A 3A5ZB 4K5WA 4L8JA 4C3IB 4WJ3M 2A8VA 1G2TA 3HP3A 2IX0A 5M3MG 3G48A 1E2VA 2FFKB 2A69C 3DEOA 3HOZH 5C44B 5JJLA 5K36H 1X3PA 2YU9H 2F0FA 5E3FA 5AJ3Q 2X6LA 2KEDA 1LLRD 1VQ9A 4FXGC 2QILA 3D0FA 4PG3A 1F9RA 3MXGA 1VQEA 4AYBG 1J5EQ 2M00A 1EYAA 1VCIA 1VMCA 1PVOA 1O7ZA 1SNDA 1WYDA 3GV6A 1RODA 3M4QA 4H0LC 1QVGA 3SK4A 4CKEA 4DV4L 1PHJA 2BA0A 3UE0A 3Q0AA 1HJPA 1ESRA 5EGTA 4Y7NH 3VA5A 3MC0B 1CUKA 5G3LF 2KJXA 5C0XH 3H3VH 4GKKQ 2JK8A 1KC8C 2ZXPA 2F0NA 3NWSA 3U4VA 2IX3A 1V8QA 4JI6Q 3M4PA 5C0XJ 2F0DA 2B63H 3KJPA 2DN8A 1GJXA 1SJHD 4RKLA 2BH8A 3A0JA 2K33A 5IGCA 4A3MG 1JOKA 3HEJA 4GKKL 5JJIA 3CP0A 4BXXG 1HZCA 4FF1A 1HNZL 2F0EA 2V1CC 3DWQA 4IQZA 2F4VQ 2EYFA 3K5OA 4PZ7A 3RZOH 5FKAC 1V1PA 1GD7A 1XWEA 5BN5A 2AUKA 1SAPA 4JBKA 2OWOA 4DGZA 1IKMA 4LNQA 1KAWA 1R9TH 1EWHA 5I6YA 1GUOA 2N3SA 5DEHA 1AEXA 4DR6L 5LMNW 5IGEA 5M5YH 5M3MH 1I3QH 2CVRA 1W3SA 3IL8A 2WFWA 3G6EA 3ULPA 1WTWA 3T4AC 1A2TA 2EYOA 1R9TB 3K8AA 5IGDA 1NBWA 4DV2L 1LO5D 4A3DB 1ONLA 3RLOA 2GVAA 3H3VC 3BYYB 3SE0A 4CKBA 2LS01 4BS9A 4K6LA 2XIWA 3KK7A 3T53B 2NBFA 1YI2A 4K2KA 2B2YA 3W2DA 3JC66 1HQRD 1HZ9A 4AQYL 1JC7A 2PCFB 4XTCS 3CRKC 3VYTA 2E75C 5GAGC 3NTHA 3CMAA 2I46A 3OOCA 2A19A 1Z7TA 4LFAL 3L0OA 1QNUA 1VQPA 1G91A 5IE8A 4FP5D 4AYBB 2R93G 3A8IE 1I50B 5EKIA 3S17H 2JA8H 3OIQA 2K05A 1S3OA 2MJ8A 4HSPA 4IPGA 1PTOC 2D9UA 2SNMA 1RIPA 2RQXA 1NE3A 2Q8TA 3H3VI 3GTGB 3NBIA 1X32A 4UP9A 5LL6S 2VUMB 1IKLA 2KA7A 3CCUA 3DHQA 1ENFA 4LF6L 1LUZA 2IHEA 1IBLL 1IW7C 3R3OA 4J6HA 3SXHA 5H1SE 1IBKL 4ZUIA 4C3IG 5IYDG 4N9PA 4IZ8A 1EEID 2F0WA 5COYA 5E4XA 4IUTA 5ELDA 4WJWA 1Q81C 1Q7YC 4JG2A 1FJGL 1VMPA 3HS0C 4J15A 1DJRD 3STBD 3HKZE 5A2QE 1U9RA 1HNXQ 1X3FA 5JOBA 3BDCA 3VR4A 1LV9A 3K0YA 5IWAL 3NXWA 4Z9CB 4L6TB 1DYQA 3PSIA 3UI2A 5JEAG 1LTAD 4HR7B 1LTRD 4RAUC 4QL5A 1WD1A 2F3WA 1EYDA 4KHPL 5KYLA 1FNUA 1QCBD 1XMQQ 1I3QB 3T1YQ 3LWUA 2NZ1D 1DOKA 1BQQT 1JMCA 3OIPA 1Z47A 3AFPA 3NQIA 4ZQ3A 2XSCA 3BVZA 5FO7B 2NWGA 4F87A 4OO1H 1B53A 1LTLA 4R8NA 2R7ZH 5F2DA 2E2JH 4JI7L 4A75A 2ALYB 1PTOD 3A55A 2J7ZA 3PMFA 3J80i 2BE5C 5C4XH 4RGMA 1F77A 3S2HB 1Y1VB 1QVFA 1V1OA 2VS1A 1SYCA 4Q0FA 3CQZH 5EBDA 1TS4A 1C9OA 4HAEA 2XRSD 3S2DB 3BYTB 3HOXH 2UUCQ 2OF1A 5IGFA 3PO3B 1Y8OB 2CWPA 3EJIA 5JEAJ 3J80L 1IW7D 3J80c 4K0KQ 3S1NH 2ICIA 5C5MA 4X65Q 1IBLQ 1NMFA 4JI1Q 2DJGC 2E2IB 3Q8DA 4A3CG 2K28A 3ONAB 2NVYB 1PFNA 4ZUJA 3PO2H 2PZWA 2HCIA 1OXUA 4IJLA 1AN8A 2CH4W 3S1MH 3L3OC 1VQGA 1M90C 4NXNL 1S4ZA 4KHVA 2R92H 3GTMH 3T51B 2UXBL 1O7IA 1EYCA 2OCEA 5D3DA 1VQDA 1BCPD 3SK8A 3QOJA 1AZQA 3K7AB 1JJ2A 5C44G 1X3QA 1TT2A 2F0SA 4HEDA 4ZK9B 3J81j 2R7ZG 2ZJPA 4IFDJ 3HG9A 5EPJA 4YIJA 2R92B 1VQJA 3LX0A 5LMNL 3U50C 2C35B 1VQIA 4F7XA 5I2YA 4OWXB 4LMQD 3RMHA 5EPLA 1VQCA 1GXDC 2Y0SE 4V0BA 4LF9Q 4KKUA 4X65L 1SN8A 1CA6A 4R9WA 5LL6X 1TWFB 4FO2A 4H7BA 1CZWA 4S3SA 3MHBA 4LF4L 4R1JA 2VUMG 1AFPA 5E7NA 4GLXA 1K8AC 1K0RA 2MFIA 2ZXOA 4IOCA 4A3JB 4JI0Q 3VR6A 4ZAIA 1Q82C 2CQOA 3I4MB 1CI3M 1H95A 2K50A 4LF5L 2NVXH 2ZM6L 1JCKB 3HKSA 3TP7A 1ET6A 1V9PA 1Q8KA 4O1NA 1EUJA 4PMWA 3I4OA 3P75A 4C3JH 3I4MH 1YNXA 3PUZA 4IO9A 4TKOB 5FLXE 4OWTB 2UU9Q 1D8LA 1VF5C 3I2ZA 5KIXA 2RDGA 4MZ9A 4PV1C 4R4TA 4HIMA 1N8RC 1HZAA 1SEBD 2XNAC 2NN6G 3TN2A 1XMOL 4HTHA 2LXKA 3PO3G 1PRTF 2WACA 1E2ZA 1CM9A 3ND9A 4JOIA 3A56A 2F0UA 2HDMA 1B70B 1ZKOA 3K5MA 2KCNA 1BVSA 3HOWG 1C4QA 1NSNS 4LFAQ 4OO1I 3JAMc 1D1KA 4DR6Q 4CHTB 3RUZA 3JAML 5EKLA 4DUZQ 1ML0D 2AKWB 1CK1A 5L37A 4ZCKA 3DWAA 3GP7A 1TWCH 2R93H 3PIPA 4DUYQ 2JE6I 3OTOL 5JVH3 4LFBQ 1X65A 4M8AA 4RCOA 2M2LA 4KI0A 4OHJA 5C44H 1T5XD 2B2VC 2JEAI 3GTQH 1KDCA 5IYCG 1HQMC 3J7AV 1P8LA 1YZ6A 3VR3A 4J1MA 3FPUB 3GV3A 1KQSA 2Z4IA 5ELCA 2NN6I 4GN4B 3HOUG 4KY7A 3E9IA 1SNCA 2L12A 1HFNA 5C3WA 4ME5A 2UXCL 3AQQA 1N32L 5IY0A 3A74A 3S15H 2EJGC 3S1RH 3A8JE 1TVXA 4DPGA 3OW2A 1BOSA 1G2SA 2PI2E 5C4JB 3MWYW 4C1NI 1PYSB 1FVIA 1Y8NB 1EFWA 2FJ2A 3KLSA 4F88A 3VR2A 3I4NG 5FOBB 1B1ZA 1O7LA 3DXJC 2F3VA 3L2PA 4B3RQ 3SK5A 2JSOA 3TMEA 3RN5A 2RKSA 4KLKA 3L7ZC 2UU9L 5CBEE 2BH2A 5HGTA 1E1TA 1N34Q 3M85A 2EYLA 3J7A5 3HZXA 2L5TA 3KJOA 1CT1D 2F0PA 2B39A 1F2LA 1TS2A 5K5PA 2N49A 4HJ7A 4JI8L 4BY1H 3HOYB 2EXZA 4RG1A 2SEBD 1QILA 1YHBA 1TWGH 4TVAB 4ABNA 1EQQA 4EQNA 5IP9G 1KIXA 1E0BA 4X64L 2X6GA 3BU2A 3ITPA 1HA6A 2QF7A 1BXTA 3PV0A 1H9JA 2F0IA 3HOYH 1I4PA 4A3EH 2Z6KC 3CC4A 3I56A 3MVVA 1IYVA 2O2LD 1UE1A 2D0PA 1EY8A 5FLXL 1VQOA 3H09A 5ELEA 3ER0A 1FR3A 4HJ5A 4A3BB 1EFID 3CCMA 2LMCB 4YWMA 4DR4Q 1SMYC 4GS3A 2VW9A 4C3IH 2A6HC 2NB0A 3S2DH 2HIVA 1HR0Q 4DR3Q 5JAVA 2DY8A 2MPMA 4CDFC 5M3FG 4DV5Q 1PFMA 3M9BA 3FEWX 4A3LG 4DV0Q 1IL2A 3OWEB 4LK1C 1KLUD 4DNTB 5DLQE 1N32Q 3CF5A 1TIID 5IYCH 4ULLA 5IWAQ 2PNHA 1JWSD 1EQRA 1JJGA 2WKDA 1SR3A 2RA4A 1Q3LA 1RTNA 4CJ2C 2E5LQ 4JI5Q 1A63A 1TQOA 5D3IB 1CZGA 5C4ZA 3TP5A 4MTNA 1WTRA 4LF5Q 4NDXA 1MSGA 2OTJA 4C56C 1UNSA 3X3NA 5IP7H 4RGOS 4RCNA 2B2YC 4DAMA 4C3JG 4JI1L 4K8IA 5IT9c 4WFN3 3KDFB 3HOUB 4DUYL 1IHZA 1O80A 3GTLH 2GA4B 4N8FA 4JI7Q 2K5HA 4DV7Q 1A15A 3H6MA 3BZDB 1PLFA 2IL8A 3JAME 1GHJA 5ELBA 3E0EA 3HKZG 4AYBE 3GTJH 4IUVA 5AFWA 4LUOA 1WFQA 3G7LA 2YTXA 1OXXK 1FGBD 1KABA 3N52A 5CC4A 5IP9H 4DR2Q 2EJFC 1SE8A 1PRTD 1PH1A 3B6YA 2Z4HA 3G4SA 5IGBA 1S5BD 1NMGA 2F0MA 3TSSA 1B9MA 3GTKB 2VUMH 3TEHB 4DR2L 5FJ8G 3I70A 2AHOB 3W1BA 4A3IG 5CORA 3RN2A 4CGYB 4HJ8A 1A3TA 4DAPA 3EIVA 2JN4A 4NXMQ 3FMCA 4NW2A 1HZBA 2HIXA 2AQ3B 4MIUA 1K8OA 3S16B 4U68A 5FLMG 3RNUA 3CCVA 4A93G 1T9HA 3I3CA 3TBIB 4KN7C 4POFA 4X3UA 1C7YA 2FMMA 4G57A 4KKTA 4KTAA 1J6QA 1PYBA 1RTOA 1TU2B 1HHVA 3OTOQ 2O4XA 4C3HB 1N33Q 4HJAA 3RR5A 1DOMA 2Q2UA 2K32A 2LXJA 3MXUA 3PF5A 4MHEA 4CDCC 1YVCA 1M4VA 2EJMA 2PI2A 4K2LA 4YHHQ 3PO2G 3I91A 1X9NA 2HUGA 3NELA 2JP1A 1E22A 1SNPA 5M3MB 2VQEL 4FVMA 1JJCB 3M4YA 2I0QA 2XWBB 4EQPA 1L0XB 2QDBA 3TZDA 2VNUD 3D31A 1KL9A 1UUPA 1A3VA 1SMXA 2NVQH 3GTJB 3MEHA 4JI6L 4DR4L 1SNMA 4BY7G 1N36Q 4KD4A 2K1BA 2Y0SG 1PZID 3RZOB 1EQVA 2JEBI 3BVMA 3S1NB 3F2BA 1UE5A 3CPFA 3N6RA 1B7YB 1YHAA 3R2TA 1QVCA 3J7ZC 4A3BG 3R93A 3PGZA 4K6DA 4P73A 3URYA 4HMJA 1A6XA 1GUTA 3F2UA 4G4KA 4N9TA 4XQJA 3SEBA 3H0GG 5C3XA 1WTVA 2K5NA 4LFBL 2YV5A 1J8IA 1STHA 2F3IA 4RA8A 5JEAH 1F2ZA 4JOIC 4RFBA 3CRLC 5EJWA 3D8GA 3S14H 1EU3A 4LFCQ 4ODGA 2H4OA 3WOFA 2WAQB 3E5SA 3NK9A 1WJJA 1TS3A 2MUYA 2ICEC 2VL6A 3EN2A 4V190 4RHRA 3QJYA 4LAAA 3CW2C 3NENA 4XIGS 4GNXC 1VQMA 4RHSA 4UP8A 4F8MA 4ZKCB 1SROA 3O13A 2B3GA 3KF6B 2K5QA 2PW7A 3V05A 2JA5B 3HGBA 5C4HA 3GTMB 1U4MA 1SJED 1L0WA 4FXDA 3TRZA 4IFDH 1I4XA 1IBML 4PQXA 4NMZA 3T16A 2IPKD 1D1IA 4AIMA 5GADC 3AMUA 1HTLD 3EVQA 5CV9A 1GHKA 2EDGA 3GD7A 1CHPD 1X3GA 3VR5A 4A3FB 4DV2Q 2Q2TA 2BE5D 4A76A 4XQNA 2JA6H 2ZXRA 3CPWA 5J1ZA 4R4IA 3E6ZX 2D2CC 1SDFA 1I6VC 1WI5A 3DM1A 1HTPA 2VB3X 1XXGA 1CSPA 2J0TD 4NPSA 2BCOA 3K6OA 2RCNA 1C8CA 5KGUA 1XYIA 2K75A 1DXMA 2RHQB 3OPOA 3LNNA 1NR4A 2Z8LA 2WB1E 1NCVA 2R92G 2RHSB 1C0AA 2JQOA 1DOLA 1J9OA 2WP8J 3T1HQ 1SE4A 4FF3A 2K6AA 2E8GA 1TY2A 2B8GA 4OEMB 1WCMG 5T1IA 4DR7L 4LFCL 5I6WA 1CKNB 4BA1I 4GZYC 4IUQA 4DR3L 4DK0A 4A93H 1EY6A 3VYSA 1WOCA 2EYMA 2I07B 2IHFA 3CKIB 3A7AB 1EIHA 3D6WA 1E3PA 4BY1B 3I90A 1PTOH 1Q46A 3KF8A 3F8TA 4P74A 4K0KL 2VY3A 2KCCA 1BUVT 2JJQA 1HR0W 2NVTB 2UUCL 2AWOA 3X3MA 5CR3A 1NY4A 2ZJRA 5C4XB 4CBVA 2LKVA 2E76C 4N8X1 2WAQE 1TWAH 2B29A 1STAA 3STBC 4APVA 5CGKA 1PH7A 4LF6Q 2WIIB 2FINB 2E2DC 1UWVA 2PQEA 3S24A 2B63G 3ICEA 1HNWQ 2UUAQ 4E6IA 4FYDA 2XWJB 3MXNB 4HIOA 1TY0A 2EVBA 2UXDQ 4DA2A 3SK6A 4A3KH 2RDHA 1ENAA 1R4PB 4BBSB 4OGQC 1W2BA 3ZJYC 1NTGA 4B08A 2B2TC 3I55A 4KHPQ 1RCVD 2B2WC 4ME3A 3IFTA 3IKJA 1OXSC 5G3LD 4Q5VA 1HRJA 1PZJD 3IFDA 3MFYA 2RSOA 2I5HA 3LWEA 1I5FA 3OSOA 1KAAA 4RMFA 4AQYQ 1S40A 1TWCB 2R93B 1PRTB 1PFBA 1IYJB 1JWUD 3HFZB 4DR1Q 1HXYD 1EQTA 2DGYA 4LF7L 1BR9A 1JE5A 4WORA 1DZ1A 4G7OC 2BA1A 5EBCA 1TWHH 4KKSA 5EPKA 4X66Q 1SE3A 4OO1G 1EIFA 3PUXA 3I7FA 2DJFC 3DUZA 1YBYA 3GTLB 2F4IA 2Q2IA 2EOTA 5CMDA 2N8NA 4DU9A 4IUNA 1EZ6A 3P7JA 4UP7A 2SDFA 4L5SA 3CU7A 1YJWA 3HKZB 2WKCA 1QWYA 4G7HC 4JV5Q 3FHWA 5M3FB 4GLAC 5FO9B 1S5CD 4ZYSA 4JPBW 2KEEA 3H0GH 2E74C 2A6ED 2UUBQ 1BCPF 1PH2A 1L1OB 2K5VA 1O7YA 1HPCA 2X69A 3GDEA 3T1YL 4ID6A 1PV4A 2JA7B 2CCZA 1SXTA 2ZTDA 3KFUA 5IP7G 2EY6A 4NKLA 3WDNA 4ALPA 4CJ0B 5FO8B 4BBSG 3DWPA 2H5XA 1NNXA 2NVQB 1EY5A 4IPCA 3K80C 1EIYB 4P75A 1HH2P 2C5CA 2OT2A 4JVZA 2TSSA 3QWNA 2QGQA 3TREA 3PCOB 1V1QA 2RCFA 4UDUC 2DNCA 1TWAB 3Q24A 4JI5L 3NBHB 1UAPA 2OEOA 5M5YB 4X3SA 1AH9A 1H9KA 3NSWA 3CAMA 3TDQA 1MSHA 1QUQB 5CV8A 2HHHQ 1ICFB 2MP1A 4BY7B 3Q23A 4KY6A 5C0XG 1U0LA 1YIJA 4A3KB 5EKKA 3QO2A 1J5EL 1T5EA 2K01A 3KF6A 4POGA 1YJ9A 2Q8RE 4RGTA 4A3CH 1VQBA 4DV0L 1K3RA 2MGSA 1TS5A 5TSSA 2CWAA 4EQ5A 1YJNA 1MIUA 5LMNQ 4RWSC 1KNAA 5FLMH 4IUPA 4I7AA 1W6JA 3FKIG 4ZRZA 4A3GB 4DF7A 2AQ1B 3M7NA 3GTPB 1D5XC 1KLGD 1R4QB 2F0JA 1A2UA 2GVBA 4C3JB 2Q2HA 1H9SA 4JBMA 1TWGB 1JICA 1GVPA 1BNZA 4NXNQ 1K83B 2N78A 1LABA 5FJ8H 2IY5B 1Q8IA 1GUWA 5K36G 1II3A 1IBKQ 1D7QA 1EWIA 2NN6H 4JI0L 5GQOA 3M7GA 3A7LA 3UDIA 3BZCA 1JQYD 1PH6A 4IALA 2ID0A 3QIAA 4HIDA 2B2UA 3VDYA 1Y1WB 4AH6A 2N88A 2EQSA 1EIGA 2MHVA 2XGTA 3EQLC 5M5WH 1KD1C 1KRTA 1ASYA 2DUDA 4FF2A 1I6HB 2A69D 3KBXA 3NQTA 2F0OA 1RF2D 4B3RL 3HOUH 3I4NB 5BN4A 1JOOA 3NPPA 4A3GH 1BO0A 3KLWA 4XT3B 3CCJA 3P1HA 3GQBA 1KHIA 1YNJD 3EBEA 3GTQB 5FLXc 3MFGA 2FXQA 4DV6L 1STEA 3PUVA 1B3AA 3CCSA 1VQHA 1F9SA 2OXPA 2J4XA 4RGNA 3OW7A 1F9QA 2A73B 4R8IA 4EGVA 1WVLA 4L5QA 2A5HA 1I94L 4HSVA 1JOQA 2YTYA 1K8GA 1KDBA 4IPDA 4GNXA 3CQZB 3MA2B 3NWTA 4OWWB 2ZTCA 1F2YA 4KY5A 2O5IC 2GN5A 1ESFA 2L9HA 4C1NK 4MTKA 3W3AA 4YCVA 3D6CA 3VYRA 2B63B 4L63B 1RJTA 3D4DA 1XNRQ 1U5KA 5E1FA 1LT3D 2WB1G 4C2MH 1Q12A 2CH4A 2WINB 3HOYG 3PUYA 1QUQA 4K8JA 2ZJQA 4QCLA 4GOPA 5CBAE 4KJOA 1H9RA 2Q8IB 4H02A 1XMQL 5KEEA 4C2MB 4DXFA 4DV5L 1PZKD 1LT5D 2JA6B 1DGSA 2NUCA 1YNNC 4XYQA 4IURA 3BZKA 2TMPA 1TXYA 2V4DA 3EROA 4BY1G 1Q1BA 1PXUA 3M4OB 2SOBA 1GUSA 4JYAQ 3GTOH 1EY0A 4P71A 4X62L 1ZEQX 4KMUC 4YY3Q 3H0GB 4QUFA 1BBXC 4R4CA 5IODA 1M8AA 1MD2D 3D4WA 1V1PB 1K8MA 4PMBA 3BS1A 4DFAA 4XQQA 4DV4Q 4XDXA 1RDPD 1WCMB 2D5DA 1CSQA 5JPNC 1ZYRD 2F0KA 3OWFA 4QGUA 2OQ0A 4DR1L 4R4QA 4FDBA 4DR5L 4QJFA 4GLVB 1ZXTA 4O2DA 2XN9C 2UXDL 2HDLA 3PIOA 4DN4M 3KOJA 4EX5A 1EZ8A 3S1RB 3KLRA 4LF8Q 2Z6KA 1DCZA 1F9PA 1A0IA 2QEXA 4JI2L 1X6OA 3FRPB 2JA5G 5A35A 2EYJA 3I4NH 3U9SA 4JK1C 3UE1A 2K52A 3S9WA 1N34L 1ZYRC 1BCPB 2IX1A 3K5NA 1E1OA 1Y1WH 5M5WB 1NR2A 5JVG3 4K5VA 1SNOA 2MO0A 3OMCA 1B9NA 1LM0A 4CDDC 3KLSX 1KTKA 2MO1A 1BCPC 4JI4L 3PQIA 4BBSH 5JJKA 3W5OA 2BOSA 1G6ZA 3FP9A 4JC0A 4YCUA 3Q6SA 1U4LA 4GKJL 5C4XG 5IT9L 2QW7A 4B3ML 2R7ZB 3U9OA 4CDEC 4QQBX 4X6AH 4JI3L 4JW0A 1CA5A 4KJNA 1MHWC 4KD3A 4B3TQ 4HCSA 1DD2A 4A3LH 4CKCA 4IPHA 1U4RA 4BBRB 4B9WA 1G6PA 3NTIA 1HCZA 1JB3A 1HUMA 1OTCA 4A3DG 1B8AA 3PIP3 1UE7A 1B2TA 4J8QA 2ASBA 1RL2A
chains in the Genus database with same CATH topology
1GUNA 1MI2A 2K7VA 4G7ZC 5DNFA 1WTQA 4CJ1B 2PPBC 2R6GA 1TR5A 3K59A 5KNDA 5NUCA 4QF4A 1XX8A 1STYA 2PNRC 4RH6A 3GTOB 2K5WA 5I9OA 1SFOB 1JORA 2A68C 4C3HG 3A54A 5DAUA 2KOLA 4Y7NB 2HQEA 3T56B 1H9MA 1RD9D 2KQ3A 4H13C 4FNFA 1SYEA 1QB5D 1G291 3PIO3 1I4QA 3BG3A 1SBBB 3C46A 3FDTA 1S5FD 4PNYA 2CW0C 2C9OA 3K58A 2QCPX 2Z1CA 1ILPA 4DK1A 3TP6A 4MN3A 2D62A 5IIFA 1Y8PB 2B2WA 5LHY1 1STGA 4UAIA 2A74C 3MTSA 5CV4A 1CQVA 3SVMA 1FYCA 1VF7A 1STBA 1YNND 1EY7A 1AP0A 3PUWA 5KYIA 5D14A 4A3MB 4EQOA 3C2PA 3HOVB 1JE4A 1UEAB 5DM73 3DMUA 2PZTA 1PRTC 3RLFA 2PW5A 1QNKA 1WTPA 1BDOA 1OXTA 3C3LA 2RDFA 1D5MC 4OL7A 3S17B 2ZT9C 5ISRA 2BDOA 5CYUA 3EA6A 1B44D 1OXVA 2N55A 2L55A 1S5DD 1WTOA 1RKNA 2FHTA 4KK7A 1F2MA 2PMZB 3MAQA 4A3EB 5JJZA 1H9SB 2F0LA 1JR0D 3VYUA 2VB2X 1AZPA 1Q1EA 4BWGB 1BF4A 1SYGA 1CQFA 5KNBA 3IAYA 1FNVA 2LY7A 3BVGA 3G6JB 4OIJA 1PMRA 4M1UB 4OIKA 3K57A 3S1MB 2JXMB 5IOCA 1Q90A 2F0HA 1JWMD 2RVLA 1FNWA 3HRZC 5ELFA 3QOLA 5IT9E 4XYOA 4TRDA 2L0CA 4IFDG 2M9VA 3CHBD 4K14A 3EFXD 2G9DA 2KECA 2NVXB 4KHZA 2EYHA 5C0XI 1ILQA 3D3RA 2B2TA 1HA5A 4NP5A 4KV6A 2RSNA 5C5LA 3TP8A 1QOHA 2EPBA 4JBWA 1EL0A 1C48A 1I4RA 3FVQA 2NYZD 2H1EA 3V2TA 3OHXC 5T1GA 2LFNA 3D4RA 1RHPA 5JPMC 2IW3A 1FD7D 2DNEA 2RBMA 4K5XA 3HOZB 2EYPA 3S1QB 2QKIC 1NUCA 5D65A 2L11A 4A3IB 4DAYA 5DM63 4WRDA 3GO5A 2CW0D 4H44C 2L4NA 4ILWA 1WTXA 2JYOA 2K03A 1I4HA 2KUMA 3T13A 2BDNA 3AB9A 1SNQA 5J22A 1D6EC 1ENCA 3S14B 1LTTD 2SNSA 3NTKA 2EZVA 5M5XB 1CFMA 3I8ZA 5I4DA 1HFGA 1WD0A 1STNA 1LTSD 4FF4A 1IYUA 1MGSA 5E4WC 4HN7A 4I7ZC 3NBHA 4I65A 1EWCA 1XTCD 4ZKBB 1SYBA 2XVSA 3QG1A 2NTTA 3TZUA 4ZLTF 5EQ0A 3ERQA 5FK9C 1QG7A 1E2WA 4IUUA 2KHSA 2IT1A 1A3UA 2VXWA 2KVMA 5C3EB 1SYFA 5BN3A 3BDOA 3WOEA 1VDZA 2F1MA 3H94A 2IWHA 1L0YB 4QMGA 4IFDI 2HCCA 2B8FA 5I2XA 1O78A 4B9XA 2PZUA 4KN4C 2R61A 1ET9A 3VA7A 3V96A 4TSSA 3DEPA 3R8BA 4DXGA 3BDLA 3SR1A 2IJ0A 3NE5B 3I72A 1SMYD 1U4PA 2G9HD 3I73A 2JA8B 2EE1A 2ENBA 2O5JC 3I4LA 3ZYYX 3NP8A 3SHLA 2YYZA 4U673 4DNRB 3MZ5A 1QE6A 3P20A 3R2IA 1EOTA 2L1BA 5A2QL 1AW7A 1TKWB 4XXEA 3MXPA 4HCEA 1NAPA 5C6AA 2F0VA 3Q22A 4QUCA 3AU7A 5CV7A 2R3ZA 2PO4A 1D5ZC 1LTID 4RKBA 2YU9B 1KDAA 3ND8A 4HMIA 2AWNA 1GOZA 3MXNA 3NUCA 4TQUS 1PTOF 4FXKC 2CQAA 1LT6D 1CTMA 4DAVA 2EY2A 3HOXB 2AQ2B 2EY1A 2CHBD 2A6HD 1D2BA 1EY9A 1EY4A 2K04A 1KNEA 1Y69U 3H91A 4LJZC 3PO2B 2F0QA 5CV6A 4P2CB 2B2VA 2EY5A 4A93B 2F0GA 3C1EA 5M9OA 4PMCA 1OO9B 2A68D 3OMGA 1LT4D 2WV6D 3HOWB 1ICWA 2WB1B 1GUGA 3FKIB 4XT1B 1LTBD 2F0TA 4X3KA 1G8ZD 1PDQA 1V43A 3QB3A 4O42A 1LACA 1IL8A 1HUNA 5CV5A 3J81E 1SYDA 1EU4A 4BA2I 1LTGD 1W6KA 3K5LA 5J39A 5IGGA 2PYKA 1B4OA 3NHHA 2Y0SB 2E2HB 4EVOA 1PTOB 2QEJC 4X3TA 1DM0B 3J81L 3M3YB 5I9PA 5HURA 3J7AF 4IN3A 1CHQD 3J80E 1EEFD 5KNCA 1QJOA 3L9AX 1YNJC 1Z6HA 3J7YW 2E2JB 3KUPA 1TWHB 2FMCA 3KBGA 3RZDB 2XRQD 2AUJD 3FPPA 2B2UC 1SSOA 2A6EC 2F03A 3S15B 3SDZA 4QB4A 4QIWB 3E0JA 1DONA 3A8KE 3RD4A 2NTSA 5KRUA 1MBYA 3C1FA 1B50A 2DY7A 1S5ED 1PYWD 2K5DA 4L8JA 1SE2A 4C3IB 4K5WA 1G2TA 3HP3A 2IX0A 1E2VA 2FFKB 2A69C 3DEOA 5C44B 5K36H 1X3PA 2F0FA 5E3FA 2X6LA 2KEDA 1LLRD 4FXGC 2QILA 1F9RA 3MXGA 2M00A 1EYAA 1VCIA 1VMCA 1O7ZA 1SNDA 3GV6A 1RODA 4H0LC 3SK4A 4CKEA 2BA0A 3Q0AA 1ESRA 5EGTA 3VA5A 3MC0B 5G3LF 2KJXA 5C0XH 2ZXPA 2F0NA 3NWSA 2IX3A 1V8QA 5C0XJ 2F0DA 2DN8A 1GJXA 1SJHD 4RKLA 2K33A 5IGCA 1JOKA 3HEJA 4FF1A 2F0EA 3DWQA 4IQZA 2EYFA 3K5OA 5FKAC 1V1PA 1XWEA 5BN5A 2AUKA 1SAPA 4DGZA 1IKMA 1EWHA 5I6YA 1GUOA 5DEHA 1AEXA 5IGEA 2CVRA 3IL8A 1WTWA 3T4AC 1A2TA 2EYOA 1R9TB 5IGDA 1LO5D 4A3DB 1ONLA 3H3VC 3BYYB 3SE0A 4CKBA 2LS01 4BS9A 4K6LA 2XIWA 3KK7A 3T53B 2NBFA 4K2KA 2B2YA 3W2DA 1HQRD 1JC7A 2PCFB 4XTCS 3CRKC 3VYTA 2E75C 3NTHA 2I46A 3OOCA 1Z7TA 1QNUA 1G91A 4FP5D 4AYBB 3A8IE 1I50B 5EKIA 3OIQA 2K05A 2MJ8A 4HSPA 1PTOC 2D9UA 2SNMA 2RQXA 2Q8TA 3GTGB 3NBIA 1X32A 5LL6S 2VUMB 1IKLA 2KA7A 3DHQA 1ENFA 1IW7C 3R3OA 4J6HA 3SXHA 4ZUIA 4C3IG 4N9PA 4IZ8A 1EEID 2F0WA 5COYA 5E4XA 4IUTA 5ELDA 4WJWA 1VMPA 3HS0C 1DJRD 5A2QE 1U9RA 5JOBA 3BDCA 3VR4A 1LV9A 3K0YA 3NXWA 4Z9CB 4L6TB 1DYQA 3UI2A 5JEAG 1LTAD 4HR7B 1LTRD 4RAUC 1WD1A 2F3WA 1EYDA 5KYLA 1FNUA 1QCBD 1I3QB 3LWUA 2NZ1D 1DOKA 1BQQT 3OIPA 1Z47A 4ZQ3A 3NQIA 2XSCA 3BVZA 5FO7B 2NWGA 4F87A 4OO1H 1B53A 4R8NA 5F2DA 1PTOD 3A55A 2J7ZA 3PMFA 2BE5C 4RGMA 1F77A 3S2HB 1Y1VB 1V1OA 1SYCA 4Q0FA 5EBDA 1TS4A 4HAEA 2XRSD 3S2DB 3BYTB 2OF1A 5IGFA 3PO3B 1Y8OB 5JEAJ 3EJIA 3J80L 1IW7D 2ICIA 5C5MA 2E2IB 2K28A 3ONAB 2NVYB 1PFNA 4ZUJA 2PZWA 2HCIA 1OXUA 1AN8A 3L3OC 1S4ZA 4KHVA 3T51B 1EYCA 5D3DA 1BCPD 3SK8A 3QOJA 1AZQA 3K7AB 1X3QA 1TT2A 2F0SA 4HEDA 4ZK9B 4IFDJ 3HG9A 5EPJA 4YIJA 2R92B 3LX0A 4F7XA 5I2YA 4LMQD 3RMHA 5EPLA 1GXDC 4V0BA 4KKUA 1CA6A 4R9WA 5LL6X 1TWFB 4FO2A 4H7BA 1CZWA 4S3SA 3MHBA 1AFPA 2ZXOA 4A3JB 3VR6A 4ZAIA 3I4MB 1CI3M 1JCKB 3TP7A 1ET6A 4O1NA 4PMWA 3P75A 3PUZA 4TKOB 5FLXE 1VF5C 5KIXA 2RDGA 4PV1C 1SEBD 2XNAC 2NN6G 3TN2A 4HTHA 1PRTF 2WACA 1E2ZA 1CM9A 3ND9A 3A56A 2F0UA 2HDMA 1ZKOA 3K5MA 2KCNA 1C4QA 1NSNS 4OO1I 1D1KA 4CHTB 3RUZA 3JAML 5EKLA 1ML0D 1CK1A 3DWAA 3GP7A 2JE6I 5JVH3 4M8AA 4RCOA 2M2LA 4KI0A 4OHJA 1T5XD 2B2VC 2JEAI 1KDCA 1HQMC 3J7AV 3VR3A 4J1MA 3FPUB 3GV3A 2Z4IA 5ELCA 2NN6I 4KY7A 1SNCA 2L12A 1HFNA 5C3WA 4ME5A 2EJGC 3A8JE 1TVXA 1BOSA 1G2SA 5C4JB 3MWYW 4C1NI 1Y8NB 2FJ2A 3KLSA 4F88A 3VR2A 5FOBB 1B1ZA 1O7LA 3DXJC 2F3VA 3SK5A 2JSOA 3TMEA 2RKSA 3L7ZC 5CBEE 5HGTA 3M85A 2EYLA 3HZXA 2L5TA 1CT1D 2F0PA 2B39A 1F2LA 1TS2A 5K5PA 3HOYB 2EXZA 2SEBD 1QILA 4ABNA 4EQNA 1E0BA 2X6GA 1HA6A 3ITPA 2QF7A 1BXTA 3PV0A 1H9JA 2F0IA 1I4PA 3MVVA 1IYVA 2O2LD 1EY8A 5FLXL 3H09A 5ELEA 1FR3A 4A3BB 1EFID 2LMCB 1SMYC 2A6HC 2NB0A 5JAVA 2DY8A 2MPMA 1PFMA 3FEWX 3OWEB 4LK1C 1KLUD 4DNTB 1TIID 4ULLA 1JWSD 2WKDA 2RA4A 1Q3LA 1RTNA 4CJ2C 1TQOA 5D3IB 1CZGA 5C4ZA 3TP5A 1WTRA 4NDXA 1MSGA 4C56C 1UNSA 3X3NA 4RGOS 4RCNA 2B2YC 4C3JG 4K8IA 4WFN3 3HOUB 1IHZA 1O80A 2GA4B 1A15A 3H6MA 3BZDB 1PLFA 2IL8A 3JAME 1GHJA 5ELBA 4IUVA 5AFWA 3G7LA 1FGBD 1KABA 1OXXK 3N52A 5CC4A 2EJFC 1PRTD 2Z4HA 5IGBA 1S5BD 2F0MA 3TSSA 1B9MA 3GTKB 3I70A 5CORA 4CGYB 1A3TA 4DAPA 3FMCA 4NW2A 2AQ3B 4MIUA 1K8OA 3S16B 4U68A 3I3CA 3TBIB 4KN7C 4X3UA 2FMMA 4G57A 4KKTA 4KTAA 1RTOA 1TU2B 1HHVA 2O4XA 4C3HB 1DOMA 2K32A 3MXUA 4MHEA 1M4VA 2EJMA 4K2LA 3I91A 2HUGA 2JP1A 1SNPA 5M3MB 4FVMA 3M4YA 2XWBB 4EQPA 1L0XB 2QDBA 3TZDA 2VNUD 3D31A 1UUPA 1A3VA 3GTJB 3MEHA 1SNMA 4KD4A 2K1BA 1PZID 3RZOB 1EQVA 2JEBI 3BVMA 3S1NB 3N6RA 3R2TA 3R93A 4K6DA 3URYA 4HMJA 1A6XA 1GUTA 3F2UA 4G4KA 4N9TA 4XQJA 3SEBA 5C3XA 1WTVA 1J8IA 1STHA 4RA8A 5JEAH 1F2ZA 4RFBA 3CRLC 5EJWA 3D8GA 1EU3A 4ODGA 3WOFA 2H4OA 2WAQB 3E5SA 3NK9A 1TS3A 4V190 2ICEC 2MUYA 4RHRA 3QJYA 4LAAA 4XIGS 4RHSA 4F8MA 4ZKCB 3O13A 2K5QA 2PW7A 3V05A 2JA5B 3HGBA 5C4HA 3GTMB 1U4MA 1SJED 4FXDA 4IFDH 1I4XA 4PQXA 4NMZA 3T16A 2IPKD 1D1IA 3AMUA 1HTLD 3EVQA 5CV9A 1GHKA 2EDGA 3GD7A 1CHPD 3VR5A 4A3FB 2BE5D 4XQNA 2ZXRA 5J1ZA 3E6ZX 2D2CC 1SDFA 1I6VC 3DM1A 1HTPA 2VB3X 1XXGA 2J0TD 2BCOA 3K6OA 1C8CA 5KGUA 1XYIA 1DXMA 3OPOA 3LNNA 1NR4A 2Z8LA 1NCVA 1DOLA 1J9OA 2WP8J 4FF3A 1SE4A 2K6AA 1TY2A 2B8GA 5T1IA 5I6WA 4BA1I 4GZYC 4IUQA 4DK0A 1EY6A 3VYSA 2EYMA 2I07B 3CKIB 3A7AB 1EIHA 3D6WA 4BY1B 3I90A 1PTOH 3KF8A 2KCCA 1BUVT 2NVTB 2AWOA 3X3MA 5CR3A 5C4XB 4CBVA 2LKVA 2E76C 1STAA 5CGKA 2WIIB 2FINB 2E2DC 2PQEA 4E6IA 4FYDA 2XWJB 1TY0A 2EVBA 4DA2A 3SK6A 2RDHA 1ENAA 1R4PB 4BBSB 4OGQC 4B08A 2B2TC 1RCVD 2B2WC 3IFTA 3IKJA 1OXSC 5G3LD 4Q5VA 1HRJA 1PZJD 3IFDA 3MFYA 2RSOA 3LWEA 3OSOA 1KAAA 1TWCB 2R93B 1PRTB 1PFBA 1JWUD 1HXYD 1EQTA 1BR9A 1DZ1A 4WORA 4G7OC 2BA1A 5EBCA 4KKSA 5EPKA 4OO1G 1SE3A 3PUXA 3DUZA 3GTLB 2F4IA 2EOTA 5CMDA 4DU9A 4IUNA 1EZ6A 3P7JA 2SDFA 3CU7A 3HKZB 2WKCA 1QWYA 4G7HC 5M3FB 5FO9B 1S5CD 4ZYSA 2KEEA 2E74C 2A6ED 1BCPF 1O7YA 1HPCA 2X69A 4ID6A 2JA7B 1SXTA 2EY6A 4NKLA 3WDNA 4CJ0B 5FO8B 3DWPA 2NVQB 1EY5A 2C5CA 2OT2A 2TSSA 3QWNA 4UDUC 2DNCA 1TWAB 3Q24A 1UAPA 2OEOA 5M5YB 4X3SA 1H9KA 3NSWA 3TDQA 1MSHA 5CV8A 2MP1A 4BY7B 3Q23A 4KY6A 5C0XG 4A3KB 5EKKA 3QO2A 1T5EA 2K01A 2Q8RE 4RGTA 2MGSA 1TS5A 5TSSA 4RWSC 1KNAA 4IUPA 1W6JA 4ZRZA 4A3GB 4DF7A 2AQ1B 3M7NA 3GTPB 1D5XC 1KLGD 1R4QB 2F0JA 1A2UA 4C3JB 1H9SA 1TWGB 1JICA 1BNZA 1K83B 1LABA 1GUWA 1Q8IA 5K36G 1II3A 2NN6H 3M7GA 3A7LA 1JQYD 4IALA 2ID0A 3QIAA 2B2UA 1Y1WB 2N88A 1EIGA 2MHVA 3EQLC 4FF2A 1I6HB 2A69D 3KBXA 3NQTA 2F0OA 1RF2D 3I4NB 5BN4A 1JOOA 3NPPA 1BO0A 4XT3B 3P1HA 3GQBA 1YNJD 3GTQB 3MFGA 1STEA 3PUVA 1B3AA 1F9SA 2OXPA 2J4XA 4RGNA 3OW7A 1F9QA 2A73B 4R8IA 4EGVA 1WVLA 2A5HA 4HSVA 1JOQA 1KDBA 3CQZB 3MA2B 3NWTA 1F2YA 4KY5A 2O5IC 1ESFA 2L9HA 4C1NK 3W3AA 3D6CA 3VYRA 2B63B 4L63B 1RJTA 3D4DA 5E1FA 1LT3D 1Q12A 2WINB 3PUYA 4K8JA 4QCLA 5CBAE 4KJOA 1H9RA 2Q8IB 5KEEA 4C2MB 4DXFA 1PZKD 1LT5D 2JA6B 2NUCA 1YNNC 4XYQA 4IURA 2TMPA 2V4DA 3EROA 1Q1BA 1PXUA 3M4OB 2SOBA 1GUSA 1EY0A 1ZEQX 4KMUC 3H0GB 4QUFA 1BBXC 5IODA 1M8AA 1MD2D 3D4WA 1V1PB 1K8MA 4PMBA 3BS1A 4DFAA 4XQQA 4XDXA 1RDPD 1WCMB 2D5DA 5JPNC 1ZYRD 2F0KA 3OWFA 1ZXTA 2XN9C 2HDLA 4DN4M 1EZ8A 3S1RB 3KLRA 1DCZA 1F9PA 3FRPB 5A35A 2EYJA 3U9SA 4JK1C 3S9WA 1ZYRC 1BCPB 2IX1A 3K5NA 5M5WB 1NR2A 5JVG3 4K5VA 1SNOA 3OMCA 1B9NA 3KLSX 1KTKA 1BCPC 2BOSA 1G6ZA 3Q6SA 1U4LA 5IT9L 2R7ZB 3U9OA 1CA5A 4KJNA 4KD3A 4HCSA 1DD2A 4CKCA 4BBRB 1U4RA 4B9WA 3NTIA 1HCZA 1JB3A 1HUMA 3PIP3 1B2TA 4J8QA 1I4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILQ A;  4IUQ A;  5EQ0 A;  3UI2 A;  1MI2 A;  2B2T A;  2B2U C;  4ZAI A;  1IKM A;  1SSO A;  1F2L A;  4IUR A;  3G7L A;  1QG7 A;  3F2U A;  4IUU A;  2KEE A;  3N52 A;  4RAU C;  1EIH A;  1QNK A;  3D6W A;  1WTP A;  2RSN A;  2K04 A;  1WD1 A;  1WTV A;  1KNE A;  5DNF A;  1J8I A;  1DON A;  1WTQ A;  4CJ1 B;  2EPB A;  2CVR A;  3I90 A;  2NZ1 D;  1DOK A;  4RA8 A;  1EL0 A;  1O7Y A;  3H91 A;  3IL8 A;  1B50 A;  2VXW A;  2X69 A;  2KVM A;  2NYZ D;  2B2V A;  4QUF A;  1WTW A;  2NWG A;  2H1E A;  1BBX C;  1XX8 A;  5EJW A;  2B2U A;  2DY7 A;  1E0B A;  2N88 A;  2X6G A;  1M8A A;  1B53 A;  5T1G A;  1EIG A;  1HA6 A;  1G2T A;  2N55 A;  3HP3 A;  4XDX A;  3TN2 A;  1WTO A;  2XIW A;  1RHP A;  2FHT A;  2HCC A;  2J7Z A;  1CM9 A;  2FFK B;  3DEO A;  2HDM A;  1ICW A;  5COR A;  1X3P A;  3KBX A;  4ZKC B;  4CJ0 B;  4XT1 B;  2B2Y A;  2KOL A;  5D65 A;  4NW2 A;  1ZXT A;  2KED A;  2X6L A;  4HAE A;  4X3K A;  2FIN B;  1PDQ A;  2HDL A;  2L11 A;  3DEP A;  5JJZ A;  4O42 A;  4DN4 M;  1IL8 A;  1HUN A;  1BO0 A;  4XT3 B;  1U4M A;  4U68 A;  1F9R A;  1F9P A;  1ML0 D;  3I3C A;  1G91 A;  2L4N A;  1WTX A;  4X3S A;  2JYO A;  2K28 A;  3ONA B;  1VMC A;  1AZP A;  1BF4 A;  2K03 A;  2B2T C;  5EKI A;  1PFN A;  1U4P A;  1O7Z A;  1B3A A;  4X3U A;  1MSH A;  2DY8 A;  2FMM A;  2KUM A;  2K05 A;  2MPM A;  2BDN A;  2HCI A;  2M2L A;  1PFM A;  1ROD A;  1RTO A;  2MJ8 A;  3GV6 A;  1F9S A;  1HHV A;  2B2V C;  2EE1 A;  2MP1 A;  1DOM A;  2D9U A;  1F9Q A;  2B2W C;  3FDT A;  4OIJ A;  4R8I A;  1NR2 A;  3QO2 A;  1WVL A;  1S4Z A;  1HRJ A;  2Q8T A;  4MHE A;  1ESR A;  2K01 A;  3IFD A;  4HSV A;  4OIK A;  1B4O A;  3FPU B;  3GV3 A;  2RSO A;  1X32 A;  1ILP A;  2RA4 A;  1Q3L A;  1IKL A;  1QE6 A;  1RTN A;  3LWE A;  4CJ2 C;  2Q8R E;  1SDF A;  2RVL A;  4MN3 A;  3I91 A;  1EOT A;  1AZQ A;  2HUG A;  2L1B A;  3DM1 A;  1X3Q A;  2JP1 A;  1PFB A;  2B2W A;  2MGS A;  4HED A;  2L12 A;  4X3T A;  1HFN A;  4ZK9 B;  1WTR A;  1MSG A;  1G6Z A;  2L9H A;  4RWS C;  3Q6S A;  1EQT A;  1U4L A;  1NAP A;  1KNA A;  5EPJ A;  4IUP A;  1C8C A;  3I8Z A;  4UAI A;  3TZD A;  1HFG A;  2B2Y C;  1RJT A;  1XYI A;  1WD0 A;  1TVX A;  4QUC A;  1G2S A;  3MTS A;  1DZ1 A;  1NR4 A;  3MWY W;  1MGS A;  5E4W C;  3SVM A;  5EPK A;  1NCV A;  2R3Z A;  2FJ2 A;  4LMQ D;  5COY A;  1O80 A;  5EPL A;  1CA5 A;  1J9O A;  1DOL A;  5E4X A;  4IUT A;  2K1B A;  1AP0 A;  4HCS A;  1JIC A;  2EOT A;  5CMD A;  1A15 A;  4R9W A;  1CA6 A;  1BNZ A;  1VMP A;  1PLF A;  1U4R A;  2KEC A;  2IL8 A;  3P7J A;  2SDF A;  1GUW A;  5T1I A;  5CBA E;  5CBE E;  5D14 A;  1HUM A;  1LV9 A;  3KUP A;  3R93 A;  4IUV A;  4ZKB B;  1SAP A;  1B2T A;  4ZLT F;  5AFW A;  1JE4 A; 
#chains in the Genus database with same CATH topology
 1GUN A;  1MI2 A;  2KEN A;  2K7V A;  4G7Z C;  4DV3 L;  5DNF A;  4A4I A;  2KCM A;  4DR7 Q;  2MNA A;  4CJ1 B;  2K14 A;  1WTQ A;  3M3Y H;  2PPB C;  2R6G A;  1TR5 A;  3K59 A;  5KND A;  3F2C A;  3SGI A;  5C3E G;  5NUC A;  4QF4 A;  1XX8 A;  4DV1 L;  1HNZ Q;  1STY A;  2PNR C;  1XPO A;  2E5L L;  4RH6 A;  4JYA L;  3GTO B;  1XTD A;  4JI8 Q;  1VQ6 A;  2K5W A;  5I9O A;  1SFO B;  1JOR A;  2A68 C;  4C3H G;  3A54 A;  5DAU A;  2KCT A;  1FJG Q;  2KOL A;  5BR8 Q;  4GNX B;  1X56 A;  2PQA A;  4A3B H;  3GTG H;  4Y7N B;  2HQE A;  3T56 B;  1Y14 B;  1QZH A;  1H9M A;  1RD9 D;  1K0S A;  1CKN A;  2KQ3 A;  4H13 C;  1BKB A;  4FNF A;  1SYE A;  1K73 C;  1QB5 D;  1N9W A;  1G29 1;  5LMU Q;  4UHV A;  2JA8 G;  3PIO 3;  1I4Q A;  3BG3 A;  1SBB B;  2NZH A;  1K28 A;  3C46 A;  3FDT A;  1S5F D;  4PNY A;  4A3K G;  2CW0 C;  2C9O A;  3K58 A;  2QCP X;  4LF9 L;  2Z1C A;  4LUV A;  1ILP A;  4DK1 A;  1ASZ A;  2HQL A;  1L1O C;  3QR8 A;  2RF4 A;  3TP6 A;  4MN3 A;  4HJ9 A;  2D62 A;  5IIF A;  1Y8P B;  2B2W A;  3PF4 A;  1B3Q A;  5LHY 1;  1STG A;  4UAI A;  2A74 C;  2Z9H A;  3MTS A;  5CV4 A;  1CQV A;  2R7D A;  5HY6 A;  3SVM A;  2WAQ G;  3HOV H;  3NEM A;  1BBU A;  3F1Z A;  1FYC A;  1VF7 A;  1STB A;  1YNN D;  2LSS A;  1Z9F A;  1EY7 A;  1AP0 A;  1IZ6 A;  1VQA A;  3PUW A;  1A8V A;  5KYI A;  5D14 A;  1A62 A;  4A3M B;  4EQO A;  3HOX G;  3C2P A;  3HOV B;  1I4G A;  1JE4 A;  1UEA B;  1XJV A;  2KBN A;  5DM7 3;  3DMU A;  4YWL A;  2PZT A;  4MNO A;  1PRT C;  3RLF A;  2PW5 A;  1QNK A;  1WTP A;  1BDO A;  3J81 c;  4BY7 H;  1OXT A;  3C3L A;  2RDF A;  1D5M C;  4OL7 A;  3S17 B;  4NB3 A;  2QDL A;  2ZT9 C;  3AFQ A;  5ISR A;  4GOP C;  2BDO A;  5CYU A;  3EA6 A;  2I5L X;  1B44 D;  2L15 A;  4QIW E;  1OXV A;  2N55 A;  2L55 A;  3CCE A;  4LUZ A;  1S5D D;  1WTO A;  1RKN A;  2FHT A;  1TWF H;  1I94 Q;  4KK7 A;  1F2M A;  4JI3 Q;  2KHJ A;  2ZTE A;  1JT8 A;  3JAM i;  1AE2 A;  1WCM H;  2PMZ B;  3MAQ A;  4A3E B;  4A3F G;  5JJZ A;  5GAE C;  3ULJ A;  1H9S B;  2JA6 G;  2F0L A;  1JR0 D;  1PH5 A;  3VYU A;  1IBM Q;  1K83 H;  2VB2 X;  4B3M Q;  4A3J G;  1AZP A;  1Q1E A;  4BWG B;  1BF4 A;  2ES2 A;  1SYG A;  2HD3 A;  1N33 L;  1CQF A;  4DAY B;  1AE3 A;  5KNB A;  3IAY A;  1FNV A;  2LY7 A;  3BVG A;  3G6J B;  4LW1 A;  4JBJ A;  4OIJ A;  3U4Z A;  4R4O A;  1PMR A;  3F2D A;  4M1U B;  4DV1 Q;  3RLN A;  1K9M C;  4OIK A;  3K57 A;  1VQ5 A;  3S1M B;  2JXM B;  2EXD A;  5IOC A;  1Q90 A;  2F0H A;  1JWM D;  1EOV A;  2RVL A;  1FNW A;  3HRZ C;  5ELF A;  4B3S Q;  3M4O H;  3QOL A;  5GRO A;  3E9H A;  5IT9 E;  2E2I H;  3K0X A;  4A3J H;  3HOZ G;  3TS2 A;  5AJ3 L;  4XYO A;  4TRD A;  2ZM6 Q;  2L0C A;  3S16 H;  4IFD G;  4OON A;  4GN3 B;  4YCW A;  1MJC A;  4DKA C;  5IYB G;  2M9V A;  2VQF L;  1MKH A;  4A3G G;  1VQ7 A;  3CHB D;  3KDF A;  4K14 A;  3EFX D;  4DR5 Q;  2G9D A;  2KEC A;  1PH8 A;  5C4J H;  3UDG A;  2NVX B;  4KHZ A;  3E3X A;  2UXB Q;  3ULL A;  4A3D H;  3J81 i;  2EYH A;  5C0X I;  5BR8 L;  1ILQ A;  3D3R A;  2B2T A;  1HA5 A;  3RZD H;  2PQA B;  2F52 A;  4NP5 A;  1CKO A;  4KV6 A;  2RSN A;  5C5L A;  1CKM A;  1QOH A;  3TP8 A;  4YY3 L;  2EPB A;  4JBW A;  1HNX L;  2UUA L;  1EL0 A;  4WJ4 A;  1C48 A;  1I4R A;  3FVQ A;  4DNI A;  2CKZ B;  2NYZ D;  4P72 A;  2H1E A;  1XNQ Q;  1QZG A;  3V2T A;  3OHX C;  5T1G A;  2LFN A;  3D4R A;  4DK6 C;  1YHQ A;  1X54 A;  1RHP A;  5JPM C;  2IW3 A;  1FD7 D;  2DNE A;  2RBM A;  4K5X A;  3HOZ B;  2EYP A;  3H15 A;  3S1Q B;  4IOA A;  2QKI C;  1NUC A;  5D65 A;  3AYH B;  1UE6 A;  4JI2 Q;  2HHH L;  2CFM A;  2L11 A;  3LGJ A;  4DAY A;  4A3I B;  5DM6 3;  5ELN A;  2Z6B A;  4OX9 Q;  4WRD A;  3GO5 A;  3FKI H;  2CW0 D;  4H44 C;  4B3T L;  2L4N A;  4ILW A;  1WTX A;  5ELO A;  2G5D A;  3U58 A;  2JYO A;  2K03 A;  1I4H A;  2KUM A;  3T13 A;  2BDN A;  4PZ6 A;  3AB9 A;  1SNQ A;  5J22 A;  1Y1W G;  1D6E C;  4NXM L;  1VQ4 A;  1ENC A;  1HR0 L;  1LTT D;  3S14 B;  2SNS A;  5IYD H;  3NTK A;  3HOV G;  4BBR G;  2F4V L;  3OYY A;  1XNQ L;  4JI4 Q;  2EZV A;  1X3E A;  4X62 Q;  4A3E G;  1VS0 A;  5M5X B;  1CFM A;  3KF8 B;  2OQK A;  3I8Z A;  2UXC Q;  5I4D A;  1HFG A;  1WD0 A;  1STN A;  1LTS D;  2JA7 G;  4FF4 A;  1IYU A;  1MGS A;  5E4W C;  4QY7 A;  1NJI C;  1KXL A;  4O0A A;  1MJE A;  4HN7 A;  4I7Z C;  2JA9 A;  3NBH A;  4I65 A;  1EWC A;  1GO3 E;  2EIF A;  1L2F A;  4JV5 L;  2P5Z X;  3G71 A;  3CD6 A;  1HNW L;  1XTC D;  4ZKB B;  1SYB A;  4DV7 L;  4DV3 Q;  1X55 A;  2XVS A;  3QG1 A;  2Z0S A;  2NTT A;  2QA4 A;  3TZU A;  4ZLT F;  5EQ0 A;  3ERQ A;  1PH9 A;  5FK9 C;  3GTK H;  2VZA A;  1PH3 A;  1QG7 A;  1E2W A;  4IUU A;  2KHS A;  4B3S L;  4LF7 Q;  5LMU L;  2IT1 A;  1GKH A;  1A3U A;  1P16 A;  3W1G A;  2VXW A;  2KVM A;  5C3E B;  1YEZ A;  1SYF A;  5BN3 A;  3BDO A;  3WOE A;  4DK3 C;  1VDZ A;  2K4K A;  2F1M A;  3H94 A;  1L0Y B;  2IWH A;  4QMG A;  4IFD I;  2HCC A;  4UY8 C;  3CCR A;  2B8F A;  2NVY H;  5I2X A;  1SFO H;  1O78 A;  4B9X A;  2PZU A;  4KN4 C;  4GKJ Q;  2R61 A;  5J3B A;  4DV6 Q;  1ET9 A;  3VA7 A;  3V96 A;  1E7Z A;  4TSS A;  4DUZ L;  3DEP A;  1VQF A;  1VQL A;  3CCL A;  3R8B A;  5GAH C;  4DXG A;  3BDL A;  3SR1 A;  2IJ0 A;  4GOP B;  3NE5 B;  3I72 A;  3CCQ A;  1SMY D;  1U4P A;  1LYL A;  2G9H D;  3I73 A;  2JA8 B;  2HT1 A;  1PFS A;  2E2H H;  3TQY A;  2EE1 A;  4OXP A;  2ENB A;  2O5J C;  3I4L A;  3ZYY X;  3NP8 A;  3SHL A;  3UDX A;  2YYZ A;  4U67 3;  1N36 L;  4LF8 L;  4DNR B;  4BBR H;  1SRU A;  3MZ5 A;  2JA7 H;  1QE6 A;  3P20 A;  3R2I A;  2XTI A;  1EOT A;  1EYG A;  3WWV A;  1KRS A;  2L1B A;  5A2Q L;  1PH4 A;  4OEL B;  1AW7 A;  1TKW B;  4XXE A;  3S1Q H;  3MXP A;  4HCE A;  1NAP A;  4X66 L;  5C6A A;  4A3F H;  2VQE Q;  1FL0 A;  2F0V A;  3Q22 A;  4L5R C;  4QUC A;  3AEV A;  3AU7 A;  5CV7 A;  2R3Z A;  2PO4 A;  1S72 A;  1D5Z C;  1LTI D;  4RKB A;  2NZO A;  2YU9 B;  1KDA A;  4LWC A;  3ND8 A;  4HMI A;  2AWN A;  3CXC A;  1GOZ A;  3MXN A;  3NUC A;  4TQU S;  1PTO F;  3K7A H;  4FXK C;  2CQA A;  1FGU A;  1LT6 D;  1CTM A;  2JA5 H;  4DAV A;  3CC7 A;  2EY2 A;  1GM5 A;  3HOX B;  2AQ2 B;  2EY1 A;  2A1A A;  3T1H L;  1K3B C;  2CHB D;  2A6H D;  1D2B A;  1EY9 A;  1Y1V H;  1EY4 A;  2K04 A;  1I6H H;  1KNE A;  1XMO Q;  1Y69 U;  3H91 A;  4LJZ C;  3PO2 B;  2F0Q A;  5CV6 A;  4P2C B;  3MEF A;  2B2V A;  2MQH A;  2EY5 A;  4A93 B;  2F0G A;  3C1E A;  5M9O A;  4PMC A;  1OO9 B;  2A68 D;  4BXX H;  3OMG A;  2R7F A;  4A3M H;  2ATW A;  1LT4 D;  2WV6 D;  1XNR L;  1BBW A;  1VQN A;  3HOW B;  1Y1V G;  1ICW A;  2WB1 B;  1GUG A;  3FKI B;  4XT1 B;  3CME A;  1LTB D;  3S2H H;  2F0T A;  4X3K A;  1G8Z D;  2NVT H;  3TS0 A;  1PDQ A;  1V43 A;  3QB3 A;  4O42 A;  1LAC A;  3UDF A;  1IL8 A;  1HUN A;  4LF4 Q;  5CV5 A;  4IJH A;  3J81 E;  1SYD A;  2KHI A;  1EU4 A;  4BA2 I;  1LTG D;  1Q86 C;  1W6K A;  3K5L A;  5J39 A;  5IGG A;  2PMZ E;  2AMC B;  2PYK A;  1JB7 A;  5IYB H;  3KYH C;  1B4O A;  1L1O A;  3BJU A;  1E24 A;  3NHH A;  1VQK A;  2Y0S B;  4A3I H;  1XPR A;  2E2H B;  2OTL A;  4EVO A;  1YIT A;  4YHH L;  2UUB L;  4OX9 L;  1PTO B;  2QEJ C;  3IRB A;  4X3T A;  1DM0 B;  3J81 L;  3M3Y B;  1WTH A;  5I9P A;  5HUR A;  3J7A F;  4L5T A;  2D0O A;  3PO3 H;  2YTV A;  4IN3 A;  1CHQ D;  1G51 A;  4C3H H;  5HGQ A;  3J80 E;  4JCV E;  1EEF D;  5M3F H;  5KNC A;  5M5X H;  1QJO A;  3HOW H;  1IXR A;  3CC2 A;  3L9A X;  1YNJ C;  1Z6H A;  3A5U A;  5EAY A;  3DLL A;  4HIK A;  1VQ8 A;  1SLJ A;  4X64 Q;  3DM3 A;  3J7Y W;  4UPA A;  2E2J B;  3KUP A;  1TWH B;  2FMC A;  3KBG A;  3RZD B;  2XRQ D;  4Y52 H;  1UEB A;  2AUJ D;  3FPP A;  2B2U C;  2VQF Q;  1SSO A;  3K81 C;  5C3E H;  1M1K C;  2A6E C;  2F03 A;  3S15 B;  3SDZ A;  3I4M G;  2I5M X;  3ERS X;  4QB4 A;  4QIW B;  3E0J A;  4PZ8 A;  1DON A;  3A8K E;  3RD4 A;  2NTS A;  5KRU A;  1MBY A;  3C1F A;  1XPU A;  1B50 A;  3K7U C;  1I50 H;  1PA6 A;  4YWK A;  2DY7 A;  3GTP H;  1S5E D;  1PYW D;  2K5D A;  4GN5 A;  1SE2 A;  3A5Z B;  4K5W A;  4L8J A;  4C3I B;  4WJ3 M;  2A8V A;  1G2T A;  3HP3 A;  2IX0 A;  5M3M G;  3G48 A;  1E2V A;  2FFK B;  2A69 C;  3DEO A;  3HOZ H;  5C44 B;  5JJL A;  5K36 H;  1X3P A;  2YU9 H;  2F0F A;  5E3F A;  5AJ3 Q;  2X6L A;  2KED A;  1LLR D;  1VQ9 A;  4FXG C;  2QIL A;  3D0F A;  4PG3 A;  1F9R A;  3MXG A;  1VQE A;  4AYB G;  1J5E Q;  2M00 A;  1EYA A;  1VCI A;  1VMC A;  1PVO A;  1O7Z A;  1SND A;  1WYD A;  3GV6 A;  1ROD A;  3M4Q A;  4H0L C;  1QVG A;  3SK4 A;  4CKE A;  4DV4 L;  1PHJ A;  2BA0 A;  3UE0 A;  3Q0A A;  1HJP A;  1ESR A;  5EGT A;  4Y7N H;  3VA5 A;  3MC0 B;  1CUK A;  5G3L F;  2KJX A;  5C0X H;  3H3V H;  4GKK Q;  2JK8 A;  1KC8 C;  2ZXP A;  2F0N A;  3NWS A;  3U4V A;  2IX3 A;  1V8Q A;  4JI6 Q;  3M4P A;  5C0X J;  2F0D A;  2B63 H;  3KJP A;  2DN8 A;  1GJX A;  1SJH D;  4RKL A;  2BH8 A;  3A0J A;  2K33 A;  5IGC A;  4A3M G;  1JOK A;  3HEJ A;  4GKK L;  5JJI A;  3CP0 A;  4BXX G;  1HZC A;  4FF1 A;  1HNZ L;  2F0E A;  2V1C C;  3DWQ A;  4IQZ A;  2F4V Q;  2EYF A;  3K5O A;  4PZ7 A;  3RZO H;  5FKA C;  1V1P A;  1GD7 A;  1XWE A;  5BN5 A;  2AUK A;  1SAP A;  4JBK A;  2OWO A;  4DGZ A;  1IKM A;  4LNQ A;  1KAW A;  1R9T H;  1EWH A;  5I6Y A;  1GUO A;  2N3S A;  5DEH A;  1AEX A;  4DR6 L;  5LMN W;  5IGE A;  5M5Y H;  5M3M H;  1I3Q H;  2CVR A;  1W3S A;  3IL8 A;  2WFW A;  3G6E A;  3ULP A;  1WTW A;  3T4A C;  1A2T A;  2EYO A;  1R9T B;  3K8A A;  5IGD A;  1NBW A;  4DV2 L;  1LO5 D;  4A3D B;  1ONL A;  3RLO A;  2GVA A;  3H3V C;  3BYY B;  3SE0 A;  4CKB A;  2LS0 1;  4BS9 A;  4K6L A;  2XIW A;  3KK7 A;  3T53 B;  2NBF A;  1YI2 A;  4K2K A;  2B2Y A;  3W2D A;  3JC6 6;  1HQR D;  1HZ9 A;  4AQY L;  1JC7 A;  2PCF B;  4XTC S;  3CRK C;  3VYT A;  2E75 C;  5GAG C;  3NTH A;  3CMA A;  2I46 A;  3OOC A;  2A19 A;  1Z7T A;  4LFA L;  3L0O A;  1QNU A;  1VQP A;  1G91 A;  5IE8 A;  4FP5 D;  4AYB B;  2R93 G;  3A8I E;  1I50 B;  5EKI A;  3S17 H;  2JA8 H;  3OIQ A;  2K05 A;  1S3O A;  2MJ8 A;  4HSP A;  4IPG A;  1PTO C;  2D9U A;  2SNM A;  1RIP A;  2RQX A;  1NE3 A;  2Q8T A;  3H3V I;  3GTG B;  3NBI A;  1X32 A;  4UP9 A;  5LL6 S;  2VUM B;  1IKL A;  2KA7 A;  3CCU A;  3DHQ A;  1ENF A;  4LF6 L;  1LUZ A;  2IHE A;  1IBL L;  1IW7 C;  3R3O A;  4J6H A;  3SXH A;  5H1S E;  1IBK L;  4ZUI A;  4C3I G;  5IYD G;  4N9P A;  4IZ8 A;  1EEI D;  2F0W A;  5COY A;  5E4X A;  4IUT A;  5ELD A;  4WJW A;  1Q81 C;  1Q7Y C;  4JG2 A;  1FJG L;  1VMP A;  3HS0 C;  4J15 A;  1DJR D;  3STB D;  3HKZ E;  5A2Q E;  1U9R A;  1HNX Q;  1X3F A;  5JOB A;  3BDC A;  3VR4 A;  1LV9 A;  3K0Y A;  5IWA L;  3NXW A;  4Z9C B;  4L6T B;  1DYQ A;  3PSI A;  3UI2 A;  5JEA G;  1LTA D;  4HR7 B;  1LTR D;  4RAU C;  4QL5 A;  1WD1 A;  2F3W A;  1EYD A;  4KHP L;  5KYL A;  1FNU A;  1QCB D;  1XMQ Q;  1I3Q B;  3T1Y Q;  3LWU A;  2NZ1 D;  1DOK A;  1BQQ T;  1JMC A;  3OIP A;  1Z47 A;  3AFP A;  3NQI A;  4ZQ3 A;  2XSC A;  3BVZ A;  5FO7 B;  2NWG A;  4F87 A;  4OO1 H;  1B53 A;  1LTL A;  4R8N A;  2R7Z H;  5F2D A;  2E2J H;  4JI7 L;  4A75 A;  2ALY B;  1PTO D;  3A55 A;  2J7Z A;  3PMF A;  3J80 i;  2BE5 C;  5C4X H;  4RGM A;  1F77 A;  3S2H B;  1Y1V B;  1QVF A;  1V1O A;  2VS1 A;  1SYC A;  4Q0F A;  3CQZ H;  5EBD A;  1TS4 A;  1C9O A;  4HAE A;  2XRS D;  3S2D B;  3BYT B;  3HOX H;  2UUC Q;  2OF1 A;  5IGF A;  3PO3 B;  1Y8O B;  2CWP A;  3EJI A;  5JEA J;  3J80 L;  1IW7 D;  3J80 c;  4K0K Q;  3S1N H;  2ICI A;  5C5M A;  4X65 Q;  1IBL Q;  1NMF A;  4JI1 Q;  2DJG C;  2E2I B;  3Q8D A;  4A3C G;  2K28 A;  3ONA B;  2NVY B;  1PFN A;  4ZUJ A;  3PO2 H;  2PZW A;  2HCI A;  1OXU A;  4IJL A;  1AN8 A;  2CH4 W;  3S1M H;  3L3O C;  1VQG A;  1M90 C;  4NXN L;  1S4Z A;  4KHV A;  2R92 H;  3GTM H;  3T51 B;  2UXB L;  1O7I A;  1EYC A;  2OCE A;  5D3D A;  1VQD A;  1BCP D;  3SK8 A;  3QOJ A;  1AZQ A;  3K7A B;  1JJ2 A;  5C44 G;  1X3Q A;  1TT2 A;  2F0S A;  4HED A;  4ZK9 B;  3J81 j;  2R7Z G;  2ZJP A;  4IFD J;  3HG9 A;  5EPJ A;  4YIJ A;  2R92 B;  1VQJ A;  3LX0 A;  5LMN L;  3U50 C;  2C35 B;  1VQI A;  4F7X A;  5I2Y A;  4OWX B;  4LMQ D;  3RMH A;  5EPL A;  1VQC A;  1GXD C;  2Y0S E;  4V0B A;  4LF9 Q;  4KKU A;  4X65 L;  1SN8 A;  1CA6 A;  4R9W A;  5LL6 X;  1TWF B;  4FO2 A;  4H7B A;  1CZW A;  4S3S A;  3MHB A;  4LF4 L;  4R1J A;  2VUM G;  1AFP A;  5E7N A;  4GLX A;  1K8A C;  1K0R A;  2MFI A;  2ZXO A;  4IOC A;  4A3J B;  4JI0 Q;  3VR6 A;  4ZAI A;  1Q82 C;  2CQO A;  3I4M B;  1CI3 M;  1H95 A;  2K50 A;  4LF5 L;  2NVX H;  2ZM6 L;  1JCK B;  3HKS A;  3TP7 A;  1ET6 A;  1V9P A;  1Q8K A;  4O1N A;  1EUJ A;  4PMW A;  3I4O A;  3P75 A;  4C3J H;  3I4M H;  1YNX A;  3PUZ A;  4IO9 A;  4TKO B;  5FLX E;  4OWT B;  2UU9 Q;  1D8L A;  1VF5 C;  3I2Z A;  5KIX A;  2RDG A;  4MZ9 A;  4PV1 C;  4R4T A;  4HIM A;  1N8R C;  1HZA A;  1SEB D;  2XNA C;  2NN6 G;  3TN2 A;  1XMO L;  4HTH A;  2LXK A;  3PO3 G;  1PRT F;  2WAC A;  1E2Z A;  1CM9 A;  3ND9 A;  4JOI A;  3A56 A;  2F0U A;  2HDM A;  1B70 B;  1ZKO A;  3K5M A;  2KCN A;  1BVS A;  3HOW G;  1C4Q A;  1NSN S;  4LFA Q;  4OO1 I;  3JAM c;  1D1K A;  4DR6 Q;  4CHT B;  3RUZ A;  3JAM L;  5EKL A;  4DUZ Q;  1ML0 D;  2AKW B;  1CK1 A;  5L37 A;  4ZCK A;  3DWA A;  3GP7 A;  1TWC H;  2R93 H;  3PIP A;  4DUY Q;  2JE6 I;  3OTO L;  5JVH 3;  4LFB Q;  1X65 A;  4M8A A;  4RCO A;  2M2L A;  4KI0 A;  4OHJ A;  5C44 H;  1T5X D;  2B2V C;  2JEA I;  3GTQ H;  1KDC A;  5IYC G;  1HQM C;  3J7A V;  1P8L A;  1YZ6 A;  3VR3 A;  4J1M A;  3FPU B;  3GV3 A;  1KQS A;  2Z4I A;  5ELC A;  2NN6 I;  4GN4 B;  3HOU G;  4KY7 A;  3E9I A;  1SNC A;  2L12 A;  1HFN A;  5C3W A;  4ME5 A;  2UXC L;  3AQQ A;  1N32 L;  5IY0 A;  3A74 A;  3S15 H;  2EJG C;  3S1R H;  3A8J E;  1TVX A;  4DPG A;  3OW2 A;  1BOS A;  1G2S A;  2PI2 E;  5C4J B;  3MWY W;  4C1N I;  1PYS B;  1FVI A;  1Y8N B;  1EFW A;  2FJ2 A;  3KLS A;  4F88 A;  3VR2 A;  3I4N G;  5FOB B;  1B1Z A;  1O7L A;  3DXJ C;  2F3V A;  3L2P A;  4B3R Q;  3SK5 A;  2JSO A;  3TME A;  3RN5 A;  2RKS A;  4KLK A;  3L7Z C;  2UU9 L;  5CBE E;  2BH2 A;  5HGT A;  1E1T A;  1N34 Q;  3M85 A;  2EYL A;  3J7A 5;  3HZX A;  2L5T A;  3KJO A;  1CT1 D;  2F0P A;  2B39 A;  1F2L A;  1TS2 A;  5K5P A;  2N49 A;  4HJ7 A;  4JI8 L;  4BY1 H;  3HOY B;  2EXZ A;  4RG1 A;  2SEB D;  1QIL A;  1YHB A;  1TWG H;  4TVA B;  4ABN A;  1EQQ A;  4EQN A;  5IP9 G;  1KIX A;  1E0B A;  4X64 L;  2X6G A;  3BU2 A;  3ITP A;  1HA6 A;  2QF7 A;  1BXT A;  3PV0 A;  1H9J A;  2F0I A;  3HOY H;  1I4P A;  4A3E H;  2Z6K C;  3CC4 A;  3I56 A;  3MVV A;  1IYV A;  2O2L D;  1UE1 A;  2D0P A;  1EY8 A;  5FLX L;  1VQO A;  3H09 A;  5ELE A;  3ER0 A;  1FR3 A;  4HJ5 A;  4A3B B;  1EFI D;  3CCM A;  2LMC B;  4YWM A;  4DR4 Q;  1SMY C;  4GS3 A;  2VW9 A;  4C3I H;  2A6H C;  2NB0 A;  3S2D H;  2HIV A;  1HR0 Q;  4DR3 Q;  5JAV A;  2DY8 A;  2MPM A;  4CDF C;  5M3F G;  4DV5 Q;  1PFM A;  3M9B A;  3FEW X;  4A3L G;  4DV0 Q;  1IL2 A;  3OWE B;  4LK1 C;  1KLU D;  4DNT B;  5DLQ E;  1N32 Q;  3CF5 A;  1TII D;  5IYC H;  4ULL A;  5IWA Q;  2PNH A;  1JWS D;  1EQR A;  1JJG A;  2WKD A;  1SR3 A;  2RA4 A;  1Q3L A;  1RTN A;  4CJ2 C;  2E5L Q;  4JI5 Q;  1A63 A;  1TQO A;  5D3I B;  1CZG A;  5C4Z A;  3TP5 A;  4MTN A;  1WTR A;  4LF5 Q;  4NDX A;  1MSG A;  2OTJ A;  4C56 C;  1UNS A;  3X3N A;  5IP7 H;  4RGO S;  4RCN A;  2B2Y C;  4DAM A;  4C3J G;  4JI1 L;  4K8I A;  5IT9 c;  4WFN 3;  3KDF B;  3HOU B;  4DUY L;  1IHZ A;  1O80 A;  3GTL H;  2GA4 B;  4N8F A;  4JI7 Q;  2K5H A;  4DV7 Q;  1A15 A;  3H6M A;  3BZD B;  1PLF A;  2IL8 A;  3JAM E;  1GHJ A;  5ELB A;  3E0E A;  3HKZ G;  4AYB E;  3GTJ H;  4IUV A;  5AFW A;  4LUO A;  1WFQ A;  3G7L A;  2YTX A;  1OXX K;  1FGB D;  1KAB A;  3N52 A;  5CC4 A;  5IP9 H;  4DR2 Q;  2EJF C;  1SE8 A;  1PRT D;  1PH1 A;  3B6Y A;  2Z4H A;  3G4S A;  5IGB A;  1S5B D;  1NMG A;  2F0M A;  3TSS A;  1B9M A;  3GTK B;  2VUM H;  3TEH B;  4DR2 L;  5FJ8 G;  3I70 A;  2AHO B;  3W1B A;  4A3I G;  5COR A;  3RN2 A;  4CGY B;  4HJ8 A;  1A3T A;  4DAP A;  3EIV A;  2JN4 A;  4NXM Q;  3FMC A;  4NW2 A;  1HZB A;  2HIX A;  2AQ3 B;  4MIU A;  1K8O A;  3S16 B;  4U68 A;  5FLM G;  3RNU A;  3CCV A;  4A93 G;  1T9H A;  3I3C A;  3TBI B;  4KN7 C;  4POF A;  4X3U A;  1C7Y A;  2FMM A;  4G57 A;  4KKT A;  4KTA A;  1J6Q A;  1PYB A;  1RTO A;  1TU2 B;  1HHV A;  3OTO Q;  2O4X A;  4C3H B;  1N33 Q;  4HJA A;  3RR5 A;  1DOM A;  2Q2U A;  2K32 A;  2LXJ A;  3MXU A;  3PF5 A;  4MHE A;  4CDC C;  1YVC A;  1M4V A;  2EJM A;  2PI2 A;  4K2L A;  4YHH Q;  3PO2 G;  3I91 A;  1X9N A;  2HUG A;  3NEL A;  2JP1 A;  1E22 A;  1SNP A;  5M3M B;  2VQE L;  4FVM A;  1JJC B;  3M4Y A;  2I0Q A;  2XWB B;  4EQP A;  1L0X B;  2QDB A;  3TZD A;  2VNU D;  3D31 A;  1KL9 A;  1UUP A;  1A3V A;  1SMX A;  2NVQ H;  3GTJ B;  3MEH A;  4JI6 L;  4DR4 L;  1SNM A;  4BY7 G;  1N36 Q;  4KD4 A;  2K1B A;  2Y0S G;  1PZI D;  3RZO B;  1EQV A;  2JEB I;  3BVM A;  3S1N B;  3F2B A;  1UE5 A;  3CPF A;  3N6R A;  1B7Y B;  1YHA A;  3R2T A;  1QVC A;  3J7Z C;  4A3B G;  3R93 A;  3PGZ A;  4K6D A;  4P73 A;  3URY A;  4HMJ A;  1A6X A;  1GUT A;  3F2U A;  4G4K A;  4N9T A;  4XQJ A;  3SEB A;  3H0G G;  5C3X A;  1WTV A;  2K5N A;  4LFB L;  2YV5 A;  1J8I A;  1STH A;  2F3I A;  4RA8 A;  5JEA H;  1F2Z A;  4JOI C;  4RFB A;  3CRL C;  5EJW A;  3D8G A;  3S14 H;  1EU3 A;  4LFC Q;  4ODG A;  2H4O A;  3WOF A;  2WAQ B;  3E5S A;  3NK9 A;  1WJJ A;  1TS3 A;  2MUY A;  2ICE C;  2VL6 A;  3EN2 A;  4V19 0;  4RHR A;  3QJY A;  4LAA A;  3CW2 C;  3NEN A;  4XIG S;  4GNX C;  1VQM A;  4RHS A;  4UP8 A;  4F8M A;  4ZKC B;  1SRO A;  3O13 A;  2B3G A;  3KF6 B;  2K5Q A;  2PW7 A;  3V05 A;  2JA5 B;  3HGB A;  5C4H A;  3GTM B;  1U4M A;  1SJE D;  1L0W A;  4FXD A;  3TRZ A;  4IFD H;  1I4X A;  1IBM L;  4PQX A;  4NMZ A;  3T16 A;  2IPK D;  1D1I A;  4AIM A;  5GAD C;  3AMU A;  1HTL D;  3EVQ A;  5CV9 A;  1GHK A;  2EDG A;  3GD7 A;  1CHP D;  1X3G A;  3VR5 A;  4A3F B;  4DV2 Q;  2Q2T A;  2BE5 D;  4A76 A;  4XQN A;  2JA6 H;  2ZXR A;  3CPW A;  5J1Z A;  4R4I A;  3E6Z X;  2D2C C;  1SDF A;  1I6V C;  1WI5 A;  3DM1 A;  1HTP A;  2VB3 X;  1XXG A;  1CSP A;  2J0T D;  4NPS A;  2BCO A;  3K6O A;  2RCN A;  1C8C A;  5KGU A;  1XYI A;  2K75 A;  1DXM A;  2RHQ B;  3OPO A;  3LNN A;  1NR4 A;  2Z8L A;  2WB1 E;  1NCV A;  2R92 G;  2RHS B;  1C0A A;  2JQO A;  1DOL A;  1J9O A;  2WP8 J;  3T1H Q;  1SE4 A;  4FF3 A;  2K6A A;  2E8G A;  1TY2 A;  2B8G A;  4OEM B;  1WCM G;  5T1I A;  4DR7 L;  4LFC L;  5I6W A;  1CKN B;  4BA1 I;  4GZY C;  4IUQ A;  4DR3 L;  4DK0 A;  4A93 H;  1EY6 A;  3VYS A;  1WOC A;  2EYM A;  2I07 B;  2IHF A;  3CKI B;  3A7A B;  1EIH A;  3D6W A;  1E3P A;  4BY1 B;  3I90 A;  1PTO H;  1Q46 A;  3KF8 A;  3F8T A;  4P74 A;  4K0K L;  2VY3 A;  2KCC A;  1BUV T;  2JJQ A;  1HR0 W;  2NVT B;  2UUC L;  2AWO A;  3X3M A;  5CR3 A;  1NY4 A;  2ZJR A;  5C4X B;  4CBV A;  2LKV A;  2E76 C;  4N8X 1;  2WAQ E;  1TWA H;  2B29 A;  1STA A;  3STB C;  4APV A;  5CGK A;  1PH7 A;  4LF6 Q;  2WII B;  2FIN B;  2E2D C;  1UWV A;  2PQE A;  3S24 A;  2B63 G;  3ICE A;  1HNW Q;  2UUA Q;  4E6I A;  4FYD A;  2XWJ B;  3MXN B;  4HIO A;  1TY0 A;  2EVB A;  2UXD Q;  4DA2 A;  3SK6 A;  4A3K H;  2RDH A;  1ENA A;  1R4P B;  4BBS B;  4OGQ C;  1W2B A;  3ZJY C;  1NTG A;  4B08 A;  2B2T C;  3I55 A;  4KHP Q;  1RCV D;  2B2W C;  4ME3 A;  3IFT A;  3IKJ A;  1OXS C;  5G3L D;  4Q5V A;  1HRJ A;  1PZJ D;  3IFD A;  3MFY A;  2RSO A;  2I5H A;  3LWE A;  1I5F A;  3OSO A;  1KAA A;  4RMF A;  4AQY Q;  1S40 A;  1TWC B;  2R93 B;  1PRT B;  1PFB A;  1IYJ B;  1JWU D;  3HFZ B;  4DR1 Q;  1HXY D;  1EQT A;  2DGY A;  4LF7 L;  1BR9 A;  1JE5 A;  4WOR A;  1DZ1 A;  4G7O C;  2BA1 A;  5EBC A;  1TWH H;  4KKS A;  5EPK A;  4X66 Q;  1SE3 A;  4OO1 G;  1EIF A;  3PUX A;  3I7F A;  2DJF C;  3DUZ A;  1YBY A;  3GTL B;  2F4I A;  2Q2I A;  2EOT A;  5CMD A;  2N8N A;  4DU9 A;  4IUN A;  1EZ6 A;  3P7J A;  4UP7 A;  2SDF A;  4L5S A;  3CU7 A;  1YJW A;  3HKZ B;  2WKC A;  1QWY A;  4G7H C;  4JV5 Q;  3FHW A;  5M3F B;  4GLA C;  5FO9 B;  1S5C D;  4ZYS A;  4JPB W;  2KEE A;  3H0G H;  2E74 C;  2A6E D;  2UUB Q;  1BCP F;  1PH2 A;  1L1O B;  2K5V A;  1O7Y A;  1HPC A;  2X69 A;  3GDE A;  3T1Y L;  4ID6 A;  1PV4 A;  2JA7 B;  2CCZ A;  1SXT A;  2ZTD A;  3KFU A;  5IP7 G;  2EY6 A;  4NKL A;  3WDN A;  4ALP A;  4CJ0 B;  5FO8 B;  4BBS G;  3DWP A;  2H5X A;  1NNX A;  2NVQ B;  1EY5 A;  4IPC A;  3K80 C;  1EIY B;  4P75 A;  1HH2 P;  2C5C A;  2OT2 A;  4JVZ A;  2TSS A;  3QWN A;  2QGQ A;  3TRE A;  3PCO B;  1V1Q A;  2RCF A;  4UDU C;  2DNC A;  1TWA B;  3Q24 A;  4JI5 L;  3NBH B;  1UAP A;  2OEO A;  5M5Y B;  4X3S A;  1AH9 A;  1H9K A;  3NSW A;  3CAM A;  3TDQ A;  1MSH A;  1QUQ B;  5CV8 A;  2HHH Q;  1ICF B;  2MP1 A;  4BY7 B;  3Q23 A;  4KY6 A;  5C0X G;  1U0L A;  1YIJ A;  4A3K B;  5EKK A;  3QO2 A;  1J5E L;  1T5E A;  2K01 A;  3KF6 A;  4POG A;  1YJ9 A;  2Q8R E;  4RGT A;  4A3C H;  1VQB A;  4DV0 L;  1K3R A;  2MGS A;  1TS5 A;  5TSS A;  2CWA A;  4EQ5 A;  1YJN A;  1MIU A;  5LMN Q;  4RWS C;  1KNA A;  5FLM H;  4IUP A;  4I7A A;  1W6J A;  3FKI G;  4ZRZ A;  4A3G B;  4DF7 A;  2AQ1 B;  3M7N A;  3GTP B;  1D5X C;  1KLG D;  1R4Q B;  2F0J A;  1A2U A;  2GVB A;  4C3J B;  2Q2H A;  1H9S A;  4JBM A;  1TWG B;  1JIC A;  1GVP A;  1BNZ A;  4NXN Q;  1K83 B;  2N78 A;  1LAB A;  5FJ8 H;  2IY5 B;  1Q8I A;  1GUW A;  5K36 G;  1II3 A;  1IBK Q;  1D7Q A;  1EWI A;  2NN6 H;  4JI0 L;  5GQO A;  3M7G A;  3A7L A;  3UDI A;  3BZC A;  1JQY D;  1PH6 A;  4IAL A;  2ID0 A;  3QIA A;  4HID A;  2B2U A;  3VDY A;  1Y1W B;  4AH6 A;  2N88 A;  2EQS A;  1EIG A;  2MHV A;  2XGT A;  3EQL C;  5M5W H;  1KD1 C;  1KRT A;  1ASY A;  2DUD A;  4FF2 A;  1I6H B;  2A69 D;  3KBX A;  3NQT A;  2F0O A;  1RF2 D;  4B3R L;  3HOU H;  3I4N B;  5BN4 A;  1JOO A;  3NPP A;  4A3G H;  1BO0 A;  3KLW A;  4XT3 B;  3CCJ A;  3P1H A;  3GQB A;  1KHI A;  1YNJ D;  3EBE A;  3GTQ B;  5FLX c;  3MFG A;  2FXQ A;  4DV6 L;  1STE A;  3PUV A;  1B3A A;  3CCS A;  1VQH A;  1F9S A;  2OXP A;  2J4X A;  4RGN A;  3OW7 A;  1F9Q A;  2A73 B;  4R8I A;  4EGV A;  1WVL A;  4L5Q A;  2A5H A;  1I94 L;  4HSV A;  1JOQ A;  2YTY A;  1K8G A;  1KDB A;  4IPD A;  4GNX A;  3CQZ B;  3MA2 B;  3NWT A;  4OWW B;  2ZTC A;  1F2Y A;  4KY5 A;  2O5I C;  2GN5 A;  1ESF A;  2L9H A;  4C1N K;  4MTK A;  3W3A A;  4YCV A;  3D6C A;  3VYR A;  2B63 B;  4L63 B;  1RJT A;  3D4D A;  1XNR Q;  1U5K A;  5E1F A;  1LT3 D;  2WB1 G;  4C2M H;  1Q12 A;  2CH4 A;  2WIN B;  3HOY G;  3PUY A;  1QUQ A;  4K8J A;  2ZJQ A;  4QCL A;  4GOP A;  5CBA E;  4KJO A;  1H9R A;  2Q8I B;  4H02 A;  1XMQ L;  5KEE A;  4C2M B;  4DXF A;  4DV5 L;  1PZK D;  1LT5 D;  2JA6 B;  1DGS A;  2NUC A;  1YNN C;  4XYQ A;  4IUR A;  3BZK A;  2TMP A;  1TXY A;  2V4D A;  3ERO A;  4BY1 G;  1Q1B A;  1PXU A;  3M4O B;  2SOB A;  1GUS A;  4JYA Q;  3GTO H;  1EY0 A;  4P71 A;  4X62 L;  1ZEQ X;  4KMU C;  4YY3 Q;  3H0G B;  4QUF A;  1BBX C;  4R4C A;  5IOD A;  1M8A A;  1MD2 D;  3D4W A;  1V1P B;  1K8M A;  4PMB A;  3BS1 A;  4DFA A;  4XQQ A;  4DV4 Q;  4XDX A;  1RDP D;  1WCM B;  2D5D A;  1CSQ A;  5JPN C;  1ZYR D;  2F0K A;  3OWF A;  4QGU A;  2OQ0 A;  4DR1 L;  4R4Q A;  4FDB A;  4DR5 L;  4QJF A;  4GLV B;  1ZXT A;  4O2D A;  2XN9 C;  2UXD L;  2HDL A;  3PIO A;  4DN4 M;  3KOJ A;  4EX5 A;  1EZ8 A;  3S1R B;  3KLR A;  4LF8 Q;  2Z6K A;  1DCZ A;  1F9P A;  1A0I A;  2QEX A;  4JI2 L;  1X6O A;  3FRP B;  2JA5 G;  5A35 A;  2EYJ A;  3I4N H;  3U9S A;  4JK1 C;  3UE1 A;  2K52 A;  3S9W A;  1N34 L;  1ZYR C;  1BCP B;  2IX1 A;  3K5N A;  1E1O A;  1Y1W H;  5M5W B;  1NR2 A;  5JVG 3;  4K5V A;  1SNO A;  2MO0 A;  3OMC A;  1B9N A;  1LM0 A;  4CDD C;  3KLS X;  1KTK A;  2MO1 A;  1BCP C;  4JI4 L;  3PQI A;  4BBS H;  5JJK A;  3W5O A;  2BOS A;  1G6Z A;  3FP9 A;  4JC0 A;  4YCU A;  3Q6S A;  1U4L A;  4GKJ L;  5C4X G;  5IT9 L;  2QW7 A;  4B3M L;  2R7Z B;  3U9O A;  4CDE C;  4QQB X;  4X6A H;  4JI3 L;  4JW0 A;  1CA5 A;  4KJN A;  1MHW C;  4KD3 A;  4B3T Q;  4HCS A;  1DD2 A;  4A3L H;  4CKC A;  4IPH A;  1U4R A;  4BBR B;  4B9W A;  1G6P A;  3NTI A;  1HCZ A;  1JB3 A;  1HUM A;  1OTC A;  4A3D G;  1B8A A;  3PIP 3;  1UE7 A;  1B2T A;  4J8Q A;  2ASB A;  1RL2 A; 
#chains in the Genus database with same CATH homology
 1GUN A;  1MI2 A;  2K7V A;  4G7Z C;  5DNF A;  1WTQ A;  4CJ1 B;  2PPB C;  2R6G A;  1TR5 A;  3K59 A;  5KND A;  5NUC A;  4QF4 A;  1XX8 A;  1STY A;  2PNR C;  4RH6 A;  3GTO B;  2K5W A;  5I9O A;  1SFO B;  1JOR A;  2A68 C;  4C3H G;  3A54 A;  5DAU A;  2KOL A;  4Y7N B;  2HQE A;  3T56 B;  1H9M A;  1RD9 D;  2KQ3 A;  4H13 C;  4FNF A;  1SYE A;  1QB5 D;  1G29 1;  3PIO 3;  1I4Q A;  3BG3 A;  1SBB B;  3C46 A;  3FDT A;  1S5F D;  4PNY A;  2CW0 C;  2C9O A;  3K58 A;  2QCP X;  2Z1C A;  1ILP A;  4DK1 A;  3TP6 A;  4MN3 A;  2D62 A;  5IIF A;  1Y8P B;  2B2W A;  5LHY 1;  1STG A;  4UAI A;  2A74 C;  3MTS A;  5CV4 A;  1CQV A;  3SVM A;  1FYC A;  1VF7 A;  1STB A;  1YNN D;  1EY7 A;  1AP0 A;  3PUW A;  5KYI A;  5D14 A;  4A3M B;  4EQO A;  3C2P A;  3HOV B;  1JE4 A;  1UEA B;  5DM7 3;  3DMU A;  2PZT A;  1PRT C;  3RLF A;  2PW5 A;  1QNK A;  1WTP A;  1BDO A;  1OXT A;  3C3L A;  2RDF A;  1D5M C;  4OL7 A;  3S17 B;  2ZT9 C;  5ISR A;  2BDO A;  5CYU A;  3EA6 A;  1B44 D;  1OXV A;  2N55 A;  2L55 A;  1S5D D;  1WTO A;  1RKN A;  2FHT A;  4KK7 A;  1F2M A;  2PMZ B;  3MAQ A;  4A3E B;  5JJZ A;  1H9S B;  2F0L A;  1JR0 D;  3VYU A;  2VB2 X;  1AZP A;  1Q1E A;  4BWG B;  1BF4 A;  1SYG A;  1CQF A;  5KNB A;  3IAY A;  1FNV A;  2LY7 A;  3BVG A;  3G6J B;  4OIJ A;  1PMR A;  4M1U B;  4OIK A;  3K57 A;  3S1M B;  2JXM B;  5IOC A;  1Q90 A;  2F0H A;  1JWM D;  2RVL A;  1FNW A;  3HRZ C;  5ELF A;  3QOL A;  5IT9 E;  4XYO A;  4TRD A;  2L0C A;  4IFD G;  2M9V A;  3CHB D;  4K14 A;  3EFX D;  2G9D A;  2KEC A;  2NVX B;  4KHZ A;  2EYH A;  5C0X I;  1ILQ A;  3D3R A;  2B2T A;  1HA5 A;  4NP5 A;  4KV6 A;  2RSN A;  5C5L A;  3TP8 A;  1QOH A;  2EPB A;  4JBW A;  1EL0 A;  1C48 A;  1I4R A;  3FVQ A;  2NYZ D;  2H1E A;  3V2T A;  3OHX C;  5T1G A;  2LFN A;  3D4R A;  1RHP A;  5JPM C;  2IW3 A;  1FD7 D;  2DNE A;  2RBM A;  4K5X A;  3HOZ B;  2EYP A;  3S1Q B;  2QKI C;  1NUC A;  5D65 A;  2L11 A;  4A3I B;  4DAY A;  5DM6 3;  4WRD A;  3GO5 A;  2CW0 D;  4H44 C;  2L4N A;  4ILW A;  1WTX A;  2JYO A;  2K03 A;  1I4H A;  2KUM A;  3T13 A;  2BDN A;  3AB9 A;  1SNQ A;  5J22 A;  1D6E C;  1ENC A;  3S14 B;  1LTT D;  2SNS A;  3NTK A;  2EZV A;  5M5X B;  1CFM A;  3I8Z A;  5I4D A;  1HFG A;  1WD0 A;  1STN A;  1LTS D;  4FF4 A;  1IYU A;  1MGS A;  5E4W C;  4HN7 A;  4I7Z C;  3NBH A;  4I65 A;  1EWC A;  1XTC D;  4ZKB B;  1SYB A;  2XVS A;  3QG1 A;  2NTT A;  3TZU A;  4ZLT F;  5EQ0 A;  3ERQ A;  5FK9 C;  1QG7 A;  1E2W A;  4IUU A;  2KHS A;  2IT1 A;  1A3U A;  2VXW A;  2KVM A;  5C3E B;  1SYF A;  5BN3 A;  3BDO A;  3WOE A;  1VDZ A;  2F1M A;  3H94 A;  2IWH A;  1L0Y B;  4QMG A;  4IFD I;  2HCC A;  2B8F A;  5I2X A;  1O78 A;  4B9X A;  2PZU A;  4KN4 C;  2R61 A;  1ET9 A;  3VA7 A;  3V96 A;  4TSS A;  3DEP A;  3R8B A;  4DXG A;  3BDL A;  3SR1 A;  2IJ0 A;  3NE5 B;  3I72 A;  1SMY D;  1U4P A;  2G9H D;  3I73 A;  2JA8 B;  2EE1 A;  2ENB A;  2O5J C;  3I4L A;  3ZYY X;  3NP8 A;  3SHL A;  2YYZ A;  4U67 3;  4DNR B;  3MZ5 A;  1QE6 A;  3P20 A;  3R2I A;  1EOT A;  2L1B A;  5A2Q L;  1AW7 A;  1TKW B;  4XXE A;  3MXP A;  4HCE A;  1NAP A;  5C6A A;  2F0V A;  3Q22 A;  4QUC A;  3AU7 A;  5CV7 A;  2R3Z A;  2PO4 A;  1D5Z C;  1LTI D;  4RKB A;  2YU9 B;  1KDA A;  3ND8 A;  4HMI A;  2AWN A;  1GOZ A;  3MXN A;  3NUC A;  4TQU S;  1PTO F;  4FXK C;  2CQA A;  1LT6 D;  1CTM A;  4DAV A;  2EY2 A;  3HOX B;  2AQ2 B;  2EY1 A;  2CHB D;  2A6H D;  1D2B A;  1EY9 A;  1EY4 A;  2K04 A;  1KNE A;  1Y69 U;  3H91 A;  4LJZ C;  3PO2 B;  2F0Q A;  5CV6 A;  4P2C B;  2B2V A;  2EY5 A;  4A93 B;  2F0G A;  3C1E A;  5M9O A;  4PMC A;  1OO9 B;  2A68 D;  3OMG A;  1LT4 D;  2WV6 D;  3HOW B;  1ICW A;  2WB1 B;  1GUG A;  3FKI B;  4XT1 B;  1LTB D;  2F0T A;  4X3K A;  1G8Z D;  1PDQ A;  1V43 A;  3QB3 A;  4O42 A;  1LAC A;  1IL8 A;  1HUN A;  5CV5 A;  3J81 E;  1SYD A;  1EU4 A;  4BA2 I;  1LTG D;  1W6K A;  3K5L A;  5J39 A;  5IGG A;  2PYK A;  1B4O A;  3NHH A;  2Y0S B;  2E2H B;  4EVO A;  1PTO B;  2QEJ C;  4X3T A;  1DM0 B;  3J81 L;  3M3Y B;  5I9P A;  5HUR A;  3J7A F;  4IN3 A;  1CHQ D;  3J80 E;  1EEF D;  5KNC A;  1QJO A;  3L9A X;  1YNJ C;  1Z6H A;  3J7Y W;  2E2J B;  3KUP A;  1TWH B;  2FMC A;  3KBG A;  3RZD B;  2XRQ D;  2AUJ D;  3FPP A;  2B2U C;  1SSO A;  2A6E C;  2F03 A;  3S15 B;  3SDZ A;  4QB4 A;  4QIW B;  3E0J A;  1DON A;  3A8K E;  3RD4 A;  2NTS A;  5KRU A;  1MBY A;  3C1F A;  1B50 A;  2DY7 A;  1S5E D;  1PYW D;  2K5D A;  4L8J A;  1SE2 A;  4C3I B;  4K5W A;  1G2T A;  3HP3 A;  2IX0 A;  1E2V A;  2FFK B;  2A69 C;  3DEO A;  5C44 B;  5K36 H;  1X3P A;  2F0F A;  5E3F A;  2X6L A;  2KED A;  1LLR D;  4FXG C;  2QIL A;  1F9R A;  3MXG A;  2M00 A;  1EYA A;  1VCI A;  1VMC A;  1O7Z A;  1SND A;  3GV6 A;  1ROD A;  4H0L C;  3SK4 A;  4CKE A;  2BA0 A;  3Q0A A;  1ESR A;  5EGT A;  3VA5 A;  3MC0 B;  5G3L F;  2KJX A;  5C0X H;  2ZXP A;  2F0N A;  3NWS A;  2IX3 A;  1V8Q A;  5C0X J;  2F0D A;  2DN8 A;  1GJX A;  1SJH D;  4RKL A;  2K33 A;  5IGC A;  1JOK A;  3HEJ A;  4FF1 A;  2F0E A;  3DWQ A;  4IQZ A;  2EYF A;  3K5O A;  5FKA C;  1V1P A;  1XWE A;  5BN5 A;  2AUK A;  1SAP A;  4DGZ A;  1IKM A;  1EWH A;  5I6Y A;  1GUO A;  5DEH A;  1AEX A;  5IGE A;  2CVR A;  3IL8 A;  1WTW A;  3T4A C;  1A2T A;  2EYO A;  1R9T B;  5IGD A;  1LO5 D;  4A3D B;  1ONL A;  3H3V C;  3BYY B;  3SE0 A;  4CKB A;  2LS0 1;  4BS9 A;  4K6L A;  2XIW A;  3KK7 A;  3T53 B;  2NBF A;  4K2K A;  2B2Y A;  3W2D A;  1HQR D;  1JC7 A;  2PCF B;  4XTC S;  3CRK C;  3VYT A;  2E75 C;  3NTH A;  2I46 A;  3OOC A;  1Z7T A;  1QNU A;  1G91 A;  4FP5 D;  4AYB B;  3A8I E;  1I50 B;  5EKI A;  3OIQ A;  2K05 A;  2MJ8 A;  4HSP A;  1PTO C;  2D9U A;  2SNM A;  2RQX A;  2Q8T A;  3GTG B;  3NBI A;  1X32 A;  5LL6 S;  2VUM B;  1IKL A;  2KA7 A;  3DHQ A;  1ENF A;  1IW7 C;  3R3O A;  4J6H A;  3SXH A;  4ZUI A;  4C3I G;  4N9P A;  4IZ8 A;  1EEI D;  2F0W A;  5COY A;  5E4X A;  4IUT A;  5ELD A;  4WJW A;  1VMP A;  3HS0 C;  1DJR D;  5A2Q E;  1U9R A;  5JOB A;  3BDC A;  3VR4 A;  1LV9 A;  3K0Y A;  3NXW A;  4Z9C B;  4L6T B;  1DYQ A;  3UI2 A;  5JEA G;  1LTA D;  4HR7 B;  1LTR D;  4RAU C;  1WD1 A;  2F3W A;  1EYD A;  5KYL A;  1FNU A;  1QCB D;  1I3Q B;  3LWU A;  2NZ1 D;  1DOK A;  1BQQ T;  3OIP A;  1Z47 A;  4ZQ3 A;  3NQI A;  2XSC A;  3BVZ A;  5FO7 B;  2NWG A;  4F87 A;  4OO1 H;  1B53 A;  4R8N A;  5F2D A;  1PTO D;  3A55 A;  2J7Z A;  3PMF A;  2BE5 C;  4RGM A;  1F77 A;  3S2H B;  1Y1V B;  1V1O A;  1SYC A;  4Q0F A;  5EBD A;  1TS4 A;  4HAE A;  2XRS D;  3S2D B;  3BYT B;  2OF1 A;  5IGF A;  3PO3 B;  1Y8O B;  5JEA J;  3EJI A;  3J80 L;  1IW7 D;  2ICI A;  5C5M A;  2E2I B;  2K28 A;  3ONA B;  2NVY B;  1PFN A;  4ZUJ A;  2PZW A;  2HCI A;  1OXU A;  1AN8 A;  3L3O C;  1S4Z A;  4KHV A;  3T51 B;  1EYC A;  5D3D A;  1BCP D;  3SK8 A;  3QOJ A;  1AZQ A;  3K7A B;  1X3Q A;  1TT2 A;  2F0S A;  4HED A;  4ZK9 B;  4IFD J;  3HG9 A;  5EPJ A;  4YIJ A;  2R92 B;  3LX0 A;  4F7X A;  5I2Y A;  4LMQ D;  3RMH A;  5EPL A;  1GXD C;  4V0B A;  4KKU A;  1CA6 A;  4R9W A;  5LL6 X;  1TWF B;  4FO2 A;  4H7B A;  1CZW A;  4S3S A;  3MHB A;  1AFP A;  2ZXO A;  4A3J B;  3VR6 A;  4ZAI A;  3I4M B;  1CI3 M;  1JCK B;  3TP7 A;  1ET6 A;  4O1N A;  4PMW A;  3P75 A;  3PUZ A;  4TKO B;  5FLX E;  1VF5 C;  5KIX A;  2RDG A;  4PV1 C;  1SEB D;  2XNA C;  2NN6 G;  3TN2 A;  4HTH A;  1PRT F;  2WAC A;  1E2Z A;  1CM9 A;  3ND9 A;  3A56 A;  2F0U A;  2HDM A;  1ZKO A;  3K5M A;  2KCN A;  1C4Q A;  1NSN S;  4OO1 I;  1D1K A;  4CHT B;  3RUZ A;  3JAM L;  5EKL A;  1ML0 D;  1CK1 A;  3DWA A;  3GP7 A;  2JE6 I;  5JVH 3;  4M8A A;  4RCO A;  2M2L A;  4KI0 A;  4OHJ A;  1T5X D;  2B2V C;  2JEA I;  1KDC A;  1HQM C;  3J7A V;  3VR3 A;  4J1M A;  3FPU B;  3GV3 A;  2Z4I A;  5ELC A;  2NN6 I;  4KY7 A;  1SNC A;  2L12 A;  1HFN A;  5C3W A;  4ME5 A;  2EJG C;  3A8J E;  1TVX A;  1BOS A;  1G2S A;  5C4J B;  3MWY W;  4C1N I;  1Y8N B;  2FJ2 A;  3KLS A;  4F88 A;  3VR2 A;  5FOB B;  1B1Z A;  1O7L A;  3DXJ C;  2F3V A;  3SK5 A;  2JSO A;  3TME A;  2RKS A;  3L7Z C;  5CBE E;  5HGT A;  3M85 A;  2EYL A;  3HZX A;  2L5T A;  1CT1 D;  2F0P A;  2B39 A;  1F2L A;  1TS2 A;  5K5P A;  3HOY B;  2EXZ A;  2SEB D;  1QIL A;  4ABN A;  4EQN A;  1E0B A;  2X6G A;  1HA6 A;  3ITP A;  2QF7 A;  1BXT A;  3PV0 A;  1H9J A;  2F0I A;  1I4P A;  3MVV A;  1IYV A;  2O2L D;  1EY8 A;  5FLX L;  3H09 A;  5ELE A;  1FR3 A;  4A3B B;  1EFI D;  2LMC B;  1SMY C;  2A6H C;  2NB0 A;  5JAV A;  2DY8 A;  2MPM A;  1PFM A;  3FEW X;  3OWE B;  4LK1 C;  1KLU D;  4DNT B;  1TII D;  4ULL A;  1JWS D;  2WKD A;  2RA4 A;  1Q3L A;  1RTN A;  4CJ2 C;  1TQO A;  5D3I B;  1CZG A;  5C4Z A;  3TP5 A;  1WTR A;  4NDX A;  1MSG A;  4C56 C;  1UNS A;  3X3N A;  4RGO S;  4RCN A;  2B2Y C;  4C3J G;  4K8I A;  4WFN 3;  3HOU B;  1IHZ A;  1O80 A;  2GA4 B;  1A15 A;  3H6M A;  3BZD B;  1PLF A;  2IL8 A;  3JAM E;  1GHJ A;  5ELB A;  4IUV A;  5AFW A;  3G7L A;  1FGB D;  1KAB A;  1OXX K;  3N52 A;  5CC4 A;  2EJF C;  1PRT D;  2Z4H A;  5IGB A;  1S5B D;  2F0M A;  3TSS A;  1B9M A;  3GTK B;  3I70 A;  5COR A;  4CGY B;  1A3T A;  4DAP A;  3FMC A;  4NW2 A;  2AQ3 B;  4MIU A;  1K8O A;  3S16 B;  4U68 A;  3I3C A;  3TBI B;  4KN7 C;  4X3U A;  2FMM A;  4G57 A;  4KKT A;  4KTA A;  1RTO A;  1TU2 B;  1HHV A;  2O4X A;  4C3H B;  1DOM A;  2K32 A;  3MXU A;  4MHE A;  1M4V A;  2EJM A;  4K2L A;  3I91 A;  2HUG A;  2JP1 A;  1SNP A;  5M3M B;  4FVM A;  3M4Y A;  2XWB B;  4EQP A;  1L0X B;  2QDB A;  3TZD A;  2VNU D;  3D31 A;  1UUP A;  1A3V A;  3GTJ B;  3MEH A;  1SNM A;  4KD4 A;  2K1B A;  1PZI D;  3RZO B;  1EQV A;  2JEB I;  3BVM A;  3S1N B;  3N6R A;  3R2T A;  3R93 A;  4K6D A;  3URY A;  4HMJ A;  1A6X A;  1GUT A;  3F2U A;  4G4K A;  4N9T A;  4XQJ A;  3SEB A;  5C3X A;  1WTV A;  1J8I A;  1STH A;  4RA8 A;  5JEA H;  1F2Z A;  4RFB A;  3CRL C;  5EJW A;  3D8G A;  1EU3 A;  4ODG A;  3WOF A;  2H4O A;  2WAQ B;  3E5S A;  3NK9 A;  1TS3 A;  4V19 0;  2ICE C;  2MUY A;  4RHR A;  3QJY A;  4LAA A;  4XIG S;  4RHS A;  4F8M A;  4ZKC B;  3O13 A;  2K5Q A;  2PW7 A;  3V05 A;  2JA5 B;  3HGB A;  5C4H A;  3GTM B;  1U4M A;  1SJE D;  4FXD A;  4IFD H;  1I4X A;  4PQX A;  4NMZ A;  3T16 A;  2IPK D;  1D1I A;  3AMU A;  1HTL D;  3EVQ A;  5CV9 A;  1GHK A;  2EDG A;  3GD7 A;  1CHP D;  3VR5 A;  4A3F B;  2BE5 D;  4XQN A;  2ZXR A;  5J1Z A;  3E6Z X;  2D2C C;  1SDF A;  1I6V C;  3DM1 A;  1HTP A;  2VB3 X;  1XXG A;  2J0T D;  2BCO A;  3K6O A;  1C8C A;  5KGU A;  1XYI A;  1DXM A;  3OPO A;  3LNN A;  1NR4 A;  2Z8L A;  1NCV A;  1DOL A;  1J9O A;  2WP8 J;  4FF3 A;  1SE4 A;  2K6A A;  1TY2 A;  2B8G A;  5T1I A;  5I6W A;  4BA1 I;  4GZY C;  4IUQ A;  4DK0 A;  1EY6 A;  3VYS A;  2EYM A;  2I07 B;  3CKI B;  3A7A B;  1EIH A;  3D6W A;  4BY1 B;  3I90 A;  1PTO H;  3KF8 A;  2KCC A;  1BUV T;  2NVT B;  2AWO A;  3X3M A;  5CR3 A;  5C4X B;  4CBV A;  2LKV A;  2E76 C;  1STA A;  5CGK A;  2WII B;  2FIN B;  2E2D C;  2PQE A;  4E6I A;  4FYD A;  2XWJ B;  1TY0 A;  2EVB A;  4DA2 A;  3SK6 A;  2RDH A;  1ENA A;  1R4P B;  4BBS B;  4OGQ C;  4B08 A;  2B2T C;  1RCV D;  2B2W C;  3IFT A;  3IKJ A;  1OXS C;  5G3L D;  4Q5V A;  1HRJ A;  1PZJ D;  3IFD A;  3MFY A;  2RSO A;  3LWE A;  3OSO A;  1KAA A;  1TWC B;  2R93 B;  1PRT B;  1PFB A;  1JWU D;  1HXY D;  1EQT A;  1BR9 A;  1DZ1 A;  4WOR A;  4G7O C;  2BA1 A;  5EBC A;  4KKS A;  5EPK A;  4OO1 G;  1SE3 A;  3PUX A;  3DUZ A;  3GTL B;  2F4I A;  2EOT A;  5CMD A;  4DU9 A;  4IUN A;  1EZ6 A;  3P7J A;  2SDF A;  3CU7 A;  3HKZ B;  2WKC A;  1QWY A;  4G7H C;  5M3F B;  5FO9 B;  1S5C D;  4ZYS A;  2KEE A;  2E74 C;  2A6E D;  1BCP F;  1O7Y A;  1HPC A;  2X69 A;  4ID6 A;  2JA7 B;  1SXT A;  2EY6 A;  4NKL A;  3WDN A;  4CJ0 B;  5FO8 B;  3DWP A;  2NVQ B;  1EY5 A;  2C5C A;  2OT2 A;  2TSS A;  3QWN A;  4UDU C;  2DNC A;  1TWA B;  3Q24 A;  1UAP A;  2OEO A;  5M5Y B;  4X3S A;  1H9K A;  3NSW A;  3TDQ A;  1MSH A;  5CV8 A;  2MP1 A;  4BY7 B;  3Q23 A;  4KY6 A;  5C0X G;  4A3K B;  5EKK A;  3QO2 A;  1T5E A;  2K01 A;  2Q8R E;  4RGT A;  2MGS A;  1TS5 A;  5TSS A;  4RWS C;  1KNA A;  4IUP A;  1W6J A;  4ZRZ A;  4A3G B;  4DF7 A;  2AQ1 B;  3M7N A;  3GTP B;  1D5X C;  1KLG D;  1R4Q B;  2F0J A;  1A2U A;  4C3J B;  1H9S A;  1TWG B;  1JIC A;  1BNZ A;  1K83 B;  1LAB A;  1GUW A;  1Q8I A;  5K36 G;  1II3 A;  2NN6 H;  3M7G A;  3A7L A;  1JQY D;  4IAL A;  2ID0 A;  3QIA A;  2B2U A;  1Y1W B;  2N88 A;  1EIG A;  2MHV A;  3EQL C;  4FF2 A;  1I6H B;  2A69 D;  3KBX A;  3NQT A;  2F0O A;  1RF2 D;  3I4N B;  5BN4 A;  1JOO A;  3NPP A;  1BO0 A;  4XT3 B;  3P1H A;  3GQB A;  1YNJ D;  3GTQ B;  3MFG A;  1STE A;  3PUV A;  1B3A A;  1F9S A;  2OXP A;  2J4X A;  4RGN A;  3OW7 A;  1F9Q A;  2A73 B;  4R8I A;  4EGV A;  1WVL A;  2A5H A;  4HSV A;  1JOQ A;  1KDB A;  3CQZ B;  3MA2 B;  3NWT A;  1F2Y A;  4KY5 A;  2O5I C;  1ESF A;  2L9H A;  4C1N K;  3W3A A;  3D6C A;  3VYR A;  2B63 B;  4L63 B;  1RJT A;  3D4D A;  5E1F A;  1LT3 D;  1Q12 A;  2WIN B;  3PUY A;  4K8J A;  4QCL A;  5CBA E;  4KJO A;  1H9R A;  2Q8I B;  5KEE A;  4C2M B;  4DXF A;  1PZK D;  1LT5 D;  2JA6 B;  2NUC A;  1YNN C;  4XYQ A;  4IUR A;  2TMP A;  2V4D A;  3ERO A;  1Q1B A;  1PXU A;  3M4O B;  2SOB A;  1GUS A;  1EY0 A;  1ZEQ X;  4KMU C;  3H0G B;  4QUF A;  1BBX C;  5IOD A;  1M8A A;  1MD2 D;  3D4W A;  1V1P B;  1K8M A;  4PMB A;  3BS1 A;  4DFA A;  4XQQ A;  4XDX A;  1RDP D;  1WCM B;  2D5D A;  5JPN C;  1ZYR D;  2F0K A;  3OWF A;  1ZXT A;  2XN9 C;  2HDL A;  4DN4 M;  1EZ8 A;  3S1R B;  3KLR A;  1DCZ A;  1F9P A;  3FRP B;  5A35 A;  2EYJ A;  3U9S A;  4JK1 C;  3S9W A;  1ZYR C;  1BCP B;  2IX1 A;  3K5N A;  5M5W B;  1NR2 A;  5JVG 3;  4K5V A;  1SNO A;  3OMC A;  1B9N A;  3KLS X;  1KTK A;  1BCP C;  2BOS A;  1G6Z A;  3Q6S A;  1U4L A;  5IT9 L;  2R7Z B;  3U9O A;  1CA5 A;  4KJN A;  4KD3 A;  4HCS A;  1DD2 A;  4CKC A;  4BBR B;  1U4R A;  4B9W A;  3NTI A;  1HCZ A;  1JB3 A;  1HUM A;  3PIP 3;  1B2T A;  4J8Q A;  1I4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...