3KUPA

Crystal structure of the cbx3 chromo shadow domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Chromobox protein homolog 3
publication title Crystal Structure of the CBX3 Chromo Shadow Domain
rcsb
source organism Homo sapiens
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kupA00
1WD0A 1F9PA 4NW2A 1QNKA 2FINB 2K04A 5COYA 5E4WC 2Q8TA 3TZDA 1AZPA 1WVLA 1C8CA 2L9HA 2B2WA 1PDQA 1O7YA 1TVXA 2B2VC 1IKMA 3KBXA 3Q6SA 1BBXC 2N55A 1DZ1A 4ZLTF 5EPKA 1G91A 1RHPA 1RTOA 2B2TC 4ZKBB 1J9OA 2X69A 3SVMA 1CA6A 2X6GA 1BF4A 2HDLA 1S4ZA 5JJZA 2FHTA 4X3KA 1NCVA 2HDMA 4OIJA 2DY7A 2MJ8A 4QUCA 2K03A 1HUNA 2IL8A 2B2TA 1U4LA 1X3QA 1F9SA 3H91A 4XT3B 4CJ2C 4CJ1B 2KOLA 2L11A 1CM9A 2HCIA 2L1BA 2JP1A 1WTOA 3UI2A 2KEEA 2DY8A 1RJTA 4XDXA 3GV6A 3HP3A 1WTPA 1U4PA 3DEOA 1ZXTA 2B2UC 4IUUA 1MSGA 1G2TA 4XT1B 1DOLA 1X3PA 2NZ1D 4X3UA 5EPJA 1B50A 2SDFA 2NWGA 3F2UA 1KNEA 3I3CA 3I90A 1JE4A 3MWYW 4R8IA 2B2YC 4IUPA 1NAPA 1WTVA 4X3SA 2RSNA 3P7JA 2L4NA 4IUQA 2KEDA 5EQ0A 2J7ZA 2RA4A 4OIKA 2B2VA 4ZKCB 5D14A 1DOMA 4RA8A 3FPUB 1WTRA 1EQTA 3IL8A 5CORA 1F9RA 3DEPA 3LWEA 1X32A 5EJWA 2K1BA 5E4XA 1QE6A 1VMPA 1ILPA 1EIHA 2CVRA 1B53A 1SSOA 3GV3A 4ZAIA 1HFNA 4RWSC 1PLFA 3QO2A 4DN4M 2L12A 1NR2A 1U4RA 4IUVA 4CJ0B 1BO0A 3N52A 1KNAA 1AZQA 1U4MA 1MGSA 2EOTA 5T1IA 2FFKB 1JICA 1ILQA 2Q8RE 1DOKA 2B2UA 4HCSA 5CMDA 5T1GA 3D6WA 1PFBA 1VMCA 2JYOA 4IURA 1WD1A 2BDNA 1WTXA 3I91A 5AFWA 1A15A 1O80A 3TN2A 1E0BA 1HUMA 2K05A 4HSVA 5EPLA 1ICWA 2RSOA 1HHVA 4ZK9B 1HFGA 2HCCA 2B2YA 2XIWA 2FMMA 3IFDA 2X6LA 2MGSA 2RVLA 4HEDA 4U68A 5EKIA 1ESRA 4R9WA 1XYIA 2MPMA 3KUPA 5DNFA 1G6ZA 1DONA 1SAPA 1Q3LA 1O7ZA 1RTNA 1PFMA 2H1EA 1J8IA 1MI2A 4UAIA 3MTSA 1EIGA 1EOTA 1QG7A 5D65A 1B4OA 3I8ZA 4MHEA 2N88A 2FJ2A 3FDTA 3ONAB 5CBAE 2R3ZA 2HUGA 3R93A 1B3AA 2M2LA 4MN3A 4X3TA 1PFNA 2EPBA 4HAEA 4RAUC 1F2LA 5CBEE 1M8AA 4QUFA 1CA5A 1HRJA 3DM1A 1G2SA 2KUMA 2VXWA 3G7LA 1IL8A 1SDFA 4O42A 1WTWA 1LV9A 2KVMA 1EL0A 1IKLA 1WTQA 2D9UA 4LMQD 2NYZD 2K28A 2B2WC 2K01A 1F9QA 1NR4A 2EE1A 1MSHA 1RODA 1ML0D 2KECA 2MP1A 4IUTA 1BNZA 1AP0A 1B2TA 1GUWA 1HA6A 1XX8A
chains in the Genus database with same CATH superfamily
3BG3A 1KIXA 1CI3M 1SNPA 3AQQA 5LMNW 1AZPA 2LKVA 1FJGL 2L9HA 3QR8A 1CZGA 3T13A 2JA6G 3K59A 4GNXB 4A3CH 3HKSA 3X3MA 3EVQA 1VCIA 2PI2E 4IOAA 3VDYA 1CA6A 3CKIB 1N32L 4HTHA 1HZBA 5KNDA 4CJ1B 1V8QA 1HTLD 2R93B 4G7OC 5FO8B 3CMEA 1V1OA 1ZXTA 1EYGA 3JAML 1JQYD 1X3PA 5ELCA 1KNEA 3PMFA 4R4OA 2EIFA 4FP5D 5C5LA 1CQVA 4LF4Q 2KEDA 2NVYB 1SYEA 2J7ZA 1TS2A 1I94L 2L5TA 5CORA 1XPRA 4OGQC 2PQAB 1FL0A 1VMPA 2RKSA 1AFPA 1IW7C 4BBRB 4HMJA 2F4VL 1Y14B 2QILA 1GD7A 1TXYA 2ALYB 4JG2A 4OELB 1YNND 1UWVA 1FD7D 5T1IA 3SHLA 3RZDH 1JICA 2WACA 1UE1A 2IHFA 2OCEA 5ELBA 3DMUA 2IT1A 1N34Q 1N9WA 4A3MH 1BDOA 1OXUA 2QGQA 3FPPA 5AFWA 3S16B 1K8AC 4Y7NH 1QVGA 2Y0SG 5C3EG 1A62A 5G3LD 5A2QL 2K50A 1MJEA 2EYLA 1PZJD 4K8IA 1EY5A 5ELDA 4RMFA 2WB1B 2H1EA 1B9MA 1V1QA 1LTLA 1Y69U 1B4OA 4A3LH 4JI7Q 3NELA 3R3OA 5LMNL 2AUJD 1W6KA 2Y0SE 4GLVB 4YHHQ 2E5LL 1S5DD 2BE5C 2VNUD 2F3WA 1S5BD 2PZTA 4A3EB 1PRTB 2D2CC 2MP1A 2KCCA 1AP0A 3PUVA 2R93H 4JI8L 3TMEA 3EJIA 2PW7A 3O13A 1TS3A 3STBC 5IT9E 1WVLA 2CQAA 1PDQA 3I73A 1T5XD 3IKJA 4BWGB 1PH6A 2EY5A 4HJ7A 1PRTF 1ZYRD 3GTJB 1B7YB 3VA7A 1GUSA 2QDBA 3A5UA 3BVZA 2V1CC 5IGDA 4K5WA 1VQDA 2L1BA 4JI1Q 5IP9G 2R92B 1K3BC 4A3DG 1UEBA 4YCUA 4DV7Q 3I7FA 1H9SA 1IBKL 1WCMG 4WRDA 1OTCA 2E2JB 2XNAC 2YV5A 2UXBL 5CR3A 2ATWA 3MXGA 1IBMQ 1SMYC 3PIPA 1N36L 4OWWB 5I4DA 1VQFA 3I55A 3GTGB 5FLXL 2XGTA 2QEJC 5FO9B 3S16H 1E2ZA 5J1ZA 1WTHA 2IPKD 3E6ZX 3MFYA 2A74C 2RBMA 3T53B 4JV5L 4IZ8A 4OXPA 5C3EH 1JT8A 4IUVA 1HQMC 1AZQA 3TREA 4JBWA 1MGSA 3NTKA 4A3JB 1HZ9A 1XMOQ 3U9OA 4M1UB 3I91A 3QJYA 2WKCA 3TN2A 5JPNC 1ICWA 1QCBD 1HFGA 1SJHD 1C48A 2A19A 2F0GA 1NNXA 4HEDA 4J1MA 4A3EH 5IE8A 2WIIB 2ZXPA 2FMCA 4DK6C 4C1NI 4OX9L 3S2DB 1FJGQ 1PV4A 1C9OA 2N8NA 2IWHA 5IYBG 1AN8A 4K6DA 4MHEA 3PGZA 4TQUS 4X3TA 4HR7B 1A2TA 1LT5D 1N32Q 4OO1G 1CA5A 1IYUA 3GTJH 2KUMA 1TWHB 4O42A 4LAAA 1QVCA 1IKLA 2BA1A 1H9RA 1KRSA 4JK1C 4NKLA 2EE1A 4IPCA 4IUTA 3C1EA 2JN4A 3TRZA 3AYHB 5M3MG 2XRSD 1QNKA 2F0WA 3HOXG 4LUOA 1E1OA 2HQEA 4LF6L 4MTKA 4A3DH 1A3UA 1I5FA 3W1GA 1TS5A 1WCMH 3G48A 4A3KG 2X69A 1SN8A 1OO9B 1PMRA 3PSIA 4K2KA 1HTPA 4XIGS 4X65Q 1S5CD 1K0RA 1L1OC 4IPHA 1KDBA 1PZID 1ZEQX 4EVOA 1I94Q 5JJLA 1GHKA 3GTPB 5HGTA 3GTGH 3RZOH 2KEEA 5C0XH 3TS0A 1GUGA 3KF6A 3D4RA 2F4VQ 2A69C 2B2UC 2VUMG 1SYCA 1HA5A 4PMCA 2NWGA 2K14A 3URYA 3BDOA 3K8AA 3C3LA 5BN4A 4A3GG 3PO3G 5IY0A 5IOCA 3OTOL 4H7BA 1BCPB 2DNEA 2MQHA 1EY9A 1LLRD 3HS0C 3PIP3 2OWOA 4HN7A 4P74A 1VQ5A 3DUZA 1B53A 5IGEA 2I0QA 1H95A 2JA7B 3D4DA 1RL2A 1K8OA 1S5FD 1P8LA 1WJJA 2NN6G 1H9JA 3BZCA 3PO2B 1XTCD 1BCPF 2A69D 3S2DH 3MXNB 3J7AF 3HZXA 5FLMG 5LMNQ 1PYWD 4DPGA 5DLQE 2RCFA 1KHIA 1QILA 1VMCA 1TQOA 4BXXG 1WTXA 2E5LQ 1QVFA 1O80A 3ND8A 4RCOA 3S24A 1AH9A 2WAQE 2LMCB 2NVTH 4IN3A 1TWHH 1M4VA 1SLJA 4OO1H 1EY7A 4OHJA 2MFIA 4JI8Q 1HNXL 1Q8KA 1FNVA 1RTNA 3OOCA 2GVAA 5C4XG 1J8IA 1JOOA 5C4XB 2FJ2A 3HOXH 1DJRD 2OEOA 2AQ3B 1D5XC 1SNCA 4C3HG 4BBSB 2KVMA 1WTQA 1SBBB 2BDOA 4K5VA 1N8RC 2A8VA 4RKBA 1VQGA 2IJ0A 1RODA 1IBKQ 3EN2A 1V9PA 5BN3A 5COYA 2UXBQ 2AWNA 3VYTA 4DAMA 1R4QB 1DZ1A 4ZLTF 1J5EL 3NP8A 1CT1D 1XNQQ 1N36Q 2IX3A 4Q0FA 4FVMA 2HDMA 5IGCA 3HOUB 1BBWA 3BZKA 3H91A 3I4NG 1CTMA 3K57A 3T4AC 2BCOA 4DV0L 3UI2A 1HNWQ 4F87A 1N33Q 3I4MG 1STHA 3S1NB 4WJ4A 3ICEA 4JV5Q 1YHAA 3OIPA 1M1KC 1MSGA 4JBJA 1Q86C 1KAWA 1Q81C 5KNCA 4FXDA 4KN4C 3TZUA 1JORA 1UE7A 1EYCA 5IT9c 4B3TL 1GO3E 5CV6A 5FLXE 4JCVE 3R2IA 4P75A 3CHBD 4UP7A 1CSPA 2O5IC 3IL8A 2J0TD 4H02A 3TP5A 4IFDH 1I3QB 1G291 2A6EC 3NWSA 4FXGC 4KD3A 1PH4A 4BXXH 2CVRA 5JJIA 2V4DA 2E74C 1SYGA 4OX9Q 1A0IA 2O4XA 3VR5A 4C3IG 4CKEA 1NBWA 3ERQA 1VQ7A 1ILQA 1KDCA 2C5CA 1NMFA 5C4XH 2BDNA 4OWXB 3UDFA 1HUMA 4JI0L 3H0GG 2HHHQ 4RGMA 4B3MQ 4V0BA 4BBSH 2H4OA 3M3YB 5JEAJ 4ZCKA 5JVG3 2M00A 4DV1L 3GTKB 1PH3A 2EDGA 3NSWA 5C44B 1TT2A 4POFA 5C5MA 1LTRD 1QG7A 3Q0AA 4J8QA 1TS4A 3E0EA 5IGFA 4LF7Q 1SE2A 4LFAL 1F77A 2EPBA 2Z6BA 4KD4A 4NXML 1CKOA 5ELFA 4X62L 3ULLA 3A8IE 2PPBC 2ASBA 2WINB 2WP8J 1PTOB 3HOUH 2MNAA 1Q12A 2NTSA 1GUWA 3NENA 3MFGA 2K04A 2B2WA 3S1NH 5KGUA 1RHPA 2OTLA 2MO0A 3CC4A 1K28A 3A54A 3K7AB 4OWTB 4NPSA 1K8GA 5C4HA 1BF4A 1MJCA 2FHTA 3OTOQ 2MUYA 1NCVA 5J3BA 1LTSD 3S14H 2J4XA 3K5NA 1KXLA 1Y1WB 1K83B 3P75A 4GZYC 2ZTCA 4QY7A 1I3QH 3J7YW 2PMZB 3G6EA 1YIJA 4GN4B 2WFWA 4GLXA 1OXTA 2D62A 2VB2X 4XT1B 4X3UA 4KJOA 3F2UA 3CCQA 4FO2A 5LMUQ 3CPFA 1FR3A 1JE4A 4DAYB 3HRZC 1STBA 3CAMA 2JQOA 3TBIB 4JYAL 4DUZL 1DCZA 3NHHA 4OEMB 4C3IH 1NTGA 4L5TA 1VF5C 2IX1A 2QW7A 1EIHA 1HXYD 4A3CG 1HNXQ 2RHQB 1XPUA 3KFUA 2K5VA 1YI2A 1VQBA 3H0GH 4PV1C 3EQLC 1Y8OB 3L9AX 4P73A 3BS1A 5FK9C 3GTKH 4TSSA 2DGYA 5C44H 5KRUA 2P5ZX 4MIUA 3JAMc 2F1MA 2A73B 3OSOA 4QIWE 3L7ZC 4XXEA 4R4TA 2A6HC 4DF7A 5M5YH 3GTQB 2ZJPA 3QOLA 1FYCA 3CP0A 3M4QA 5JPMC 2F52A 5HURA 2BH2A 3NTHA 1Y1VG 2QKIC 1PTOH 4DK0A 1G6ZA 3D6CA 1V43A 1NY4A 1Y1VB 4GOPA 1EUJA 1J5EQ 5IWAL 3A8KE 3K6OA 1VF7A 1D7QA 1SROA 1GOZA 1PFNA 1M8AA 1TU2B 2I5HA 1SDFA 2TMPA 2YU9B 4DV0Q 2RCNA 1SXTA 4K5XA 1PYSB 1YNJD 2GA4B 1Y1WH 1K83H 3CC2A 2XRQD 3HOYB 3GD7A 1SR3A 2OQ0A 2IY5B 1TVXA 2IHEA 4DK1A 4A3MG 3Q6SA 1VQNA 3IRBA 4ZKBB 4GKKL 4B3TQ 4BY7B 3I4OA 2OTJA 1IYVA 2HDLA 2K6AA 4QUCA 4BA2I 4XT3B 4L6TB 1XXGA 3PQIA 1ENCA 3U4VA 4H13C 4ZUJA 5CYUA 4CGYB 3ZJYC 3A56A 1DOLA 2E2HB 3PUWA 1GXDC 2UUAL 2Q2HA 2XVSA 3K5OA 2ZJRA 2WV6D 5C4ZA 2F03A 1WTVA 2E75C 3AU7A 3J80L 1STYA 2RA4A 4I7ZC 3NBIA 2R93G 2EYPA 1EU4A 3LWEA 1STNA 4ZQ3A 3CCUA 5IGGA 1QE6A 4YIJA 1MKHA 5DM63 2K5HA 4O2DA 1HFNA 3GTQH 4DV1Q 1QB5D 2CWPA 1D5ZC 1YNNC 2F3VA 4GN5A 4LF5Q 3K5MA 4ILWA 1SYBA 4DGZA 1JJ2A 3UDIA 3P1HA 1BO0A 3N52A 2NTTA 1Y1VH 3FMCA 1RKNA 4R4QA 4LFAQ 1GJXA 1GUNA 2AUKA 4NXMQ 1LT3D 4X62Q 3WOFA 5FKAC 1LO5D 1K73C 3PF4A 4IJHA 1FVIA 1BUVT 2Z6KA 4ME3A 4BBRG 1DXMA 2K52A 3X3NA 2Z0SA 2Q2UA 5FLXc 3RNUA 2YU9H 3P20A 1B3QA 2Z1CA 4AYBB 1JWMD 1Q3LA 1HR0L 3T1YL 1EOVA 3GTLB 5M9OA 5IIFA 2UU9L 1YVCA 1KTKA 3FDTA 4KKTA 2F0HA 2HQLA 3HKZB 3CCMA 4RAUC 3DWQA 4UY8C 3S1RB 4BY7H 4K6LA 1II3A 4YCWA 3KDFB 1I4HA 3KJOA 3ITPA 3AFQA 4KK7A 1S72A 2WB1G 2FINB 2Q8TA 3L3OC 5CV9A 1K3RA 3J80i 1ZYRC 3KBXA 1IKMA 5AJ3L 1JR0D 2E2HH 3CW2C 1X56A 4JYAQ 5G3LF 5JJZA 4Z9CB 2RF4A 4R4IA 3DWAA 4A3EG 2K03A 1U4LA 4C1NK 2HCIA 4O1NA 3NBHA 3PIO3 3JAMi 3RN5A 4JI2L 1NSNS 4PZ6A 2R6GA 4WJWA 1O78A 2NB0A 1T9HA 1TKWB 1NE3A 4N8X1 4TRDA 1E7ZA 1D5MC 3A8JE 1B50A 2ID0A 1STAA 4F7XA 1EU3A 3I3CA 1Q7YC 3ERSX 1JJCB 1WFQA 3A5ZB 1CQFA 4NXNL 1KD1C 4WFN3 1PRTD 3GQBA 2R92G 1BQQT 4WJ3M 2EJGC 4LWCA 1J6QA 2NVYH 2K1BA 4QJFA 2K4KA 4A76A 1QZHA 1C0AA 1Q1EA 4JOIA 3EA6A 3GDEA 2N78A 1T5EA 3M7NA 3U4ZA 1YHQA 4BBRH 1LTID 5H1SE 3DLLA 5DM73 4XQJA 2EOTA 2AKWB 4QB4A 2EZVA 3GTLH 3C46A 1PFBA 2YTVA 3WOEA 5C0XG 4LUVA 4C3JB 4DR5L 1ASYA 2HT1A 1R9TB 3H15A 1X3FA 2HCCA 3MXPA 3S1RH 2RVLA 2PNRC 1O7ZA 4A3JG 3MTSA 1EQVA 4IJLA 4DAYA 3CMAA 4GKKQ 4ODGA 1EZ8A 3S9WA 4DR7L 5KNBA 3S17B 1BBUA 1PA6A 5F2DA 1G51A 4PMBA 1IZ6A 4LF9L 5HGQA 1QUQA 1F2MA 2KHSA 1LT4D 1VQPA 2DN8A 2EXZA 4M8AA 2UUAQ 1NMGA 2RDGA 1DYQA 1RTOA 2B2TC 3M7GA 2YTXA 1MIUA 2JA8B 2EY1A 2DY7A 1JE5A 3N6RA 2UXCL 1JWUD 4LUZA 2KOLA 1GKHA 2CW0D 3TP7A 1WTOA 1X54A 3EIVA 3HGBA 1EYDA 4XDXA 4FF3A 3M4OB 1WTPA 3MHBA 3OPOA 3J7AV 5KEEA 2R92H 2GVBA 4RHRA 3DWPA 3ND9A 1AEXA 2E2JH 1C7YA 2IW3A 3TEHB 3QWNA 3J80E 4LK1C 4IUPA 5GADC 1PZKD 3FKIB 4O0AA 4FDBA 4FXKC 2D0OA 1X32A 4C3JH 4JPBW 4RHSA 5EJWA 5KYIA 1R9TH 4DA2A 4PZ8A 3S15B 3OMGA 1CUKA 1CSQA 3JAME 1YEZA 3T1YQ 3RMHA 2VQEL 1JCKB 3TDQA 3V2TA 1GM5A 3E3XA 2UU9Q 1U0LA 2YTYA 2F0KA 3EROA 4LF8L 1I4QA 2DJGC 3D6WA 3LWUA 2I46A 4A3JH 3R2TA 4NB3A 1VQMA 3L0OA 5C6AA 3S17H 1SNOA 2VQFL 1O7LA 5BR8L 4MZ9A 1GVPA 1PH9A 2VB3X 2JA7G 2BA0A 1L1OB 3A7AB 4K8JA 1YITA 3KF8B 2CCZA 4LFBL 3PO2G 1Z47A 1SAPA 1OXSC 4CKCA 3DM3A 4GNXA 3SDZA 1VQ6A 5AJ3Q 1JOQA 4EQ5A 2R3ZA 4BA1I 2HUGA 4IFDG 2R7ZB 5FJ8H 4HAEA 1SFOB 2JA8H 1EL0A 4EGVA 2D9UA 1V1PB 5A2QE 2R7FA 2KECA 5KYLA 2WAQB 1HA6A 4X66L 3BDLA 5M5WB 2F0OA 4NW2A 3BJUA 1EEID 3U9SA 3M4OH 1I4RA 1IL2A 1MD2D 1JMCA 1HNZL 4F8MA 3F2DA 2B8FA 1EEFD 2EXDA 1XNRL 1STEA 5EPKA 4EQPA 1ENFA 3J81L 1UE6A 1RIPA 1U5KA 4BBSG 1S4ZA 3M4PA 4X3KA 2LSSA 2MJ8A 3I2ZA 2RDHA 4L5RC 2PQAA 1EWIA 1CM9A 2K75A 3PUYA 4LNQA 2I07B 3GTPH 1U4PA 2EQSA 4JI5L 3EFXD 4JI4L 1PH1A 3HOZG 3T51B 1X6OA 1L0WA 4G4KA 1JWSD 2ES2A 4A93B 4Q5VA 1JB3A 1BR9A 4G57A 4R4CA 3HOZB 4CDFC 4UP8A 2Z6KC 3PUXA 4KN7C 3HFZB 1F2YA 1NAPA 1ONLA 2Z8LA 4PZ7A 3CCSA 3HOUG 3P7JA 2AQ2B 1DD2A 3NTIA 4DR5Q 1O7IA 4RA8A 1YJWA 1MBYA 1Y8PB 1CZWA 1XTDA 1LUZA 5EBDA 2CH4A 4BY1B 1UNSA 5IGBA 4YY3L 1ZKOA 4JI6L 1QZGA 4ZUIA 3QIAA 3S1MB 1C4QA 1WI5A 5K36H 2KQ3A 3A55A 2JA7H 1W3SA 2LY7A 4N9PA 2F0LA 3T1HL 2CH4W 1DOKA 4N8FA 3PO2H 2A1AA 4HIDA 3MVVA 2JXMB 1X9NA 3G71A 5D3DA 2R7ZH 1A15A 3SK5A 1VQKA 3R8BA 3WWVA 1Q8IA 5EPLA 2EYHA 4P2CB 3FHWA 1U9RA 2B2YA 1SFOH 4LF9Q 4CBVA 4NP5A 2JA5B 4B3SL 5I9PA 3GTMB 2PCFB 4R9WA 5EKKA 3ZYYX 2I5MX 3J81i 5M5WH 2XTIA 2NUCA 3UE0A 4LFCL 1B9NA 1EIGA 4DFAA 3HOWB 4B9WA 1VQEA 3R93A 3VR4A 1Z9FA 1TR5A 4AIMA 2ZTDA 3GP7A 4UPAA 1XMQL 3EBEA 1YNXA 2PZWA 1CHQD 1EY0A 5C44G 3F2CA 4J6HA 3NWTA 2WKDA 2K5DA 1C8CA 3OYYA 2I5LX 5IYDG 4A3IB 1HPCA 2F0QA 4LF6Q 2Q2IA 3KK7A 3DHQA 2UUCL 2EYFA 3CCVA 2VL6A 3TSSA 4GS3A 3Q23A 4L8JA 1HJPA 1KDAA 3HOZH 2E76C 4KHZA 4JOIC 2SNMA 4OO1I 2Q8IB 5IP7H 3D31A 2L11A 1B8AA 2OQKA 2JP1A 2G5DA 1CK1A 4DAPA 1RF2D 4KTAA 3GV6A 1M90C 3DEOA 2AMCB 4QF4A 2VQEQ 1SMXA 2KHIA 2F0IA 3VA5A 4ZKCB 1PTOD 1Y1WG 1VDZA 3I70A 1I4PA 2VQFQ 2EY2A 5BR8Q 2OXPA 3I4LA 3RLNA 3NUCA 4QL5A 3OWEB 1H9SB 4LFBQ 1QWYA 4DXGA 4RWSC 2JA5H 2L12A 2E8GA 5BN5A 3GTMH 4CJ0B 3H3VC 1U4MA 2VZAA 3PF5A 4KY5A 1TIID 2NBFA 3HOWH 3KJPA 3MXUA 2K33A 2PMZE 1JJGA 3K80C 2NZOA 5CGKA 1EY4A 1SYFA 4DKAC 4YWMA 1HHVA 3J80c 1E22A 2RDFA 1W6JA 4MTNA 5CV7A 4A3FB 1I6HB 1ESFA 4K2LA 2B29A 1PH7A 4IALA 2MPMA 5JVH3 1FGUA 3W3AA 2B63B 1HNZQ 1R4PB 1IBLL 1EQQA 3M3YH 3JC66 4DK3C 4I7AA 2NN6I 1XNRQ 1GUOA 4EQNA 4A3IH 2N88A 3J7A5 1E1TA 3ONAB 1XWEA 4ULLA 5A35A 1I50B 4MN3A 5M3FB 4E6IA 5IYDH 5CBEE 2A68D 3F8TA 1YNJC 3KYHC 5ELEA 1EYAA 2K28A 3A7LA 1KLUD 1ML0D 1B2TA 1EFID 1XX8A 4JI5Q 4KHVA 4JI4Q 3C1FA 2G9HD 4HSPA 2KHJA 1HQRD 4UDUC 5E1FA 3J81E 2EVBA 3SVMA 4DNTB 1LACA 3K5LA 1H9MA 3H94A 4G7ZC 4RGTA 1E3PA 1EQRA 3K7AH 1VQOA 3AMUA 1S40A 3ULPA 3HOYG 2D5DA 3OIQA 2L0CA 4C56C 4YY3Q 3HG9A 2DY8A 1HR0W 4JI6Q 2E2DC 1KC8C 3LX0A 5ELNA 3CRLC 3HOVB 4RCNA 2EYJA 3MXNA 4BY7G 4H44C 3QG1A 4YCVA 3K7UC 1EFWA 3PIOA 3BZDB 4IUQA 2XWBB 3Q8DA 3RR5A 4OIKA 1ICFB 2B2VA 2CWAA 4PQXA 2F0MA 3S2HB 3VR2A 4GKJL 4B3SQ 4F88A 4GNXC 1BKBA 4A3LG 3T16A 3KF6B 3UDGA 3OHXC 1PLFA 2JK8A 4A3FH 3MEFA 4LFCQ 3AFPA 3AEVA 2B63H 4A3BB 5J22A 1I4XA 3BVGA 5I2YA 5LHY1 2EY6A 1I50H 3KLSA 5J39A 1HZAA 5M3FH 4HSVA 3NPPA 4JI0Q 3CQZB 1PH2A 3MC0B 1PXUA 4YWLA 5GAGC 2R61A 4PMWA 2Z9HA 3W5OA 4U68A 3RLOA 1LTAD 2ICIA 1E2VA 1DM0B 1PFMA 4DXFA 4DV6L 2UUCQ 2LXJA 5D65A 2JA6B 3NXWA 1JOKA 5L37A 1X55A 2Z4IA 1KAAA 4QUFA 1VQ9A 1ENAA 1SJED 1F9QA 1EWCA 1RD9D 2H5XA 2PO4A 4AYBG 4HIKA 3E0JA 4DR2L 5GAHC 5CV5A 1JB7A 4K0KL 1CFMA 1AE2A 4MNOA 1O7YA 3HOYH 4HIOA 4XQNA 4UP9A 1HH2P 1G91A 3HOVH 3HKZG 1K9MC 1J9OA 3RD4A 4X65L 3SR1A 3SK6A 3E9HA 2LFNA 4EX5A 2C35B 4C2MB 3FEWX 1A6XA 1HUNA 1SNDA 1X3QA 4DR4L 5I2XA 4AYBE 4KKUA 5I9OA 3SE0A 3S2HH 2N3SA 4NMZA 4KKSA 4PNYA 5K5PA 3A0JA 2BH8A 3KLWA 1VQIA 2KCMA 2VS1A 4IPDA 1G2TA 4L5QA 3HEJA 3HKZE 2NZ1D 2B8GA 1EWHA 2SDFA 1K0SA 4L5SA 1SE3A 4ZYSA 3MWYW 5GROA 2B2YC 3CCRA 1NUCA 3BU2A 1PRTC 2UUBL 4X3SA 4DUZQ 1TY2A 1QOHA 2L4NA 5EQ0A 5ELOA 4A3BH 2EYMA 5DEHA 1GUTA 1PH5A 3VYRA 2O5JC 2QF7A 4HJ9A 1S3OA 4BS9A 2Y0SB 3CQZH 5C3EB 2WB1E 3M4YA 3L2PA 4ZAIA 2K5NA 3NQTA 2LXKA 1IW7D 3TS2A 1IBLQ 4CKBA 4RH6A 4XYQA 1NJIC 1SE4A 5EKLA 2ZT9C 2B3GA 2AQ1B 4HCSA 5CMDA 3SEBA 2JA6H 4IURA 5JAVA 1WD1A 4P71A 3SK8A 2ZM6L 1FNUA 2RQXA 2LS01 3H3VI 4KHPL 2JEBI 4DV2L 4XQQA 2X6LA 3G6JB 3I56A 4JI3L 5EKIA 3NK9A 2K5WA 3IFTA 4RGNA 4IPGA 4NDXA 5IYCG 1MI2A 1VQ4A 2ICEC 5IWAQ 3H09A 3CD6A 1WOCA 2TSSA 5FO7B 1B3AA 4C3JG 4IQZA 1G2SA 2VXWA 1SE8A 4IO9A 2F0UA 3I72A 3FVQA 2NYZD 5C4JB 1TWAB 4C2MH 2JEAI 2B2WC 2BE5D 1Q1BA 2VW9A 5I6YA 4A3DB 1A2UA 4B08A 1KABA 3TZDA 1CKNB 1UUPA 1WCMB 2BOSA 2PZUA 3K0YA 3RN2A 1LTBD 1WYDA 3STBD 1EY6A 2NVQB 1XNQL 3K58A 1PFSA 2HIXA 2XN9C 2L15A 4H0LC 4XYOA 3RZOB 1H9KA 3NQIA 5CV4A 2CW0C 2IL8A 4GKJQ 2ZXOA 2KJXA 5TSSA 2AHOB 1VQCA 1HNWL 3FP9A 5M5XB 4PG3A 5EBCA 1N33L 4CDDC 2N49A 3KLSX 1YBYA 4G7HC 4IUUA 1L0XB 4ZRZA 5FJ8G 1E2WA 5EPJA 2JA8G 2B39A 1B1ZA 4RFBA 1EZ6A 1LTTD 3I90A 4DR6L 2SEBD 2KENA 2RSNA 1SMYD 1E24A 1DOMA 1LABA 3FPUB 3D3RA 5GQOA 3SK4A 4APVA 1EQTA 3J81c 3DEPA 5JEAG 1ILPA 3QB3A 4X6AH 2F0TA 3GV3A 2NZHA 4RKLA 2JE6I 4IUNA 4FF1A 2SNSA 4DV6Q 2UXDL 1KQSA 4IOCA 4GLAC 2OT2A 3ER0A 4TKOB 2QEXA 3FKIG 2O2LD 3IAYA 4DV4L 2NVTB 2PYKA 3H6MA 2JYOA 5IYCH 4HJ5A 2K05A 2M9VA 3WDNA 1SEBD 4KV6A 4ZK9B 2HHHL 2CHBD 4N9TA 4B3ML 1TY0A 2HIVA 2PQEA 2VY3A 3D0FA 4GOPC 1D2BA 4DR2Q 1ET6A 1VQJA 2EJMA 1A3VA 1ESRA 1TWAH 5C4JH 4DUYL 3KUPA 3SXHA 4K0KQ 1AE3A 5EGTA 3W2DA 5IP9H 5M3MB 1HR0Q 3HOXB 4UAIA 2XSCA 4Y52H 3CU7A 1BCPC 1YHBA 3I8ZA 4DNRB 4FF4A 3LGJA 3CCLA 5CBAE 3K0XA 4LF7L 2NVQH 4A3KB 3TQYA 2FXQA 3G7LA 4DR4Q 1LV9A 1TWCB 1EY8A 1UEAB 2F0EA 2C9OA 4DR1L 3U58A 1FGBD 2K01A 5K36G 4FYDA 1MSHA 3QOJA 1BNZA 1YJNA 3A74A 5M5XH 1HZCA 1JC7A 1B44D 4GOPB 4GN3B 2B2VC 1XPOA 2VUMB 1LM0A 4UHVA 2R7ZG 5ISRA 2UUBQ 4CDCC 2YYZA 4HMIA 1BCPD 1D6EC 2DNCA 4DU9A 1SYDA 4A3GB 3ULJA 4OIJA 3PO3B 1KRTA 1G8ZD 1TWGB 1FNWA 2PI2A 5LL6S 1Q90A 2WAQG 1Z6HA 2Q2TA 4JI2Q 3UDXA 4DV5L 3HP3A 5C3XA 5LL6X 3CC7A 1QJOA 2AWOA 2CFMA 3BVMA 3Q22A 3M9BA 5JEAH 1RCVD 1G6PA 1D1KA 2MHVA 3T56B 5LMUL 3OWFA 4ID6A 2DJFC 4OL7A 2K7VA 2Z4HA 1BOSA 4NXNQ 3C2PA 2ZM6Q 5IYBH 1HCZA 4ABNA 3CCJA 4POGA 1WTRA 4KHPQ 1F9RA 3VYSA 4DV2Q 3FKIH 1W2BA 1AW7A 5JOBA 3W1BA 5E4XA 4JI3Q 2F0SA 2F0PA 1SSOA 1MHWC 2PNHA 4QCLA 3QO2A 4A93G 3S15H 3CCEA 3DXJC 2ENBA 2RHSB 1U4RA 4I65A 2K5QA 1KNAA 1L2FA 1EIYB 5FOBB 1IHZA 2CKZB 3D4WA 5M3MH 4DV3L 5IP7G 3TP8A 3V96A 4LJZC 4QMGA 3GTOB 4A3KH 5KIXA 4BY1G 3K81C 3KDFA 4C3HB 3KOJA 3IFDA 1TWCH 2KA7A 1S5ED 2F0JA 5GAEC 1VQHA 5DNFA 3NE5B 1P16A 2F3IA 1ASZA 1ET9A 3CF5A 1PH8A 4RGOS 1PYBA 2F0VA 5E3FA 3MAQA 4K14A 5EAYA 2VUMH 4U673 3OW7A 4DR7Q 1LTGD 3LNNA 1F2LA 3MEHA 3DM1A 1WTWA 1BXTA 1K8MA 5C0XI 2F0NA 2JA5G 4B3RL 5C0XJ 4J15A 4A3GH 3I4NB 3PO3H 1A3TA 1TWGH 4KI0A 1LYLA 4DR3L 1OXXK 2EJFC 3F1ZA 1WD0A 3I4MB 3J81j 4AQYL 2E2IB 3HOWG 4HIMA 2QA4A 5NUCA 4X64L 3BDCA 4DR6Q 1X65A 1KLGD 3S14B 2JA9A 2NN6H 2X6GA 1RDPD 1YJ9A 3KBGA 4JVZA 3E5SA 2F0FA 5FLMH 3J7ZC 2UXCQ 1F9SA 4CJ2C 1BVSA 2GN5A 1EIFA 4XTCS 2OF1A 4P72A 3TP6A 1D1IA 4KLKA 3S1QB 4A3IG 1VQ8A 1PVOA 4R1JA 2UXDQ 5JJKA 4C3IB 1PTOC 4DV4Q 1CKMA 2KCNA 4A93H 4CDEC 1L0YB 2HD3A 2ZXRA 3NEMA 4AH6A 3GTOH 3NBHB 4V190 3H0GB 1GHJA 1IXRA 4DUYQ 4CHTB 2A6ED 4C3HH 1CKNA 4BY1H 3CPWA 4LF5L 4FNFA 4KJNA 3S1MH 2QCPX 1I4GA 1UE5A 2MO1A 2FFKB 1TWFB 1KL9A 2CQOA 4DAVA 3VR6A 3CXCA 4LF8Q 3KLRA 5M5YB 4LW1A 4LF4L 1A63A 1E0BA 2D0PA 2XWJB 4DR1Q 2XIWA 4JC0A 2KBNA 1VS0A 2MGSA 3D8GA 4R8NA 3I4NH 1XYIA 4QQBX 1DONA 1Y8NB 2QDLA 5E7NA 3I4MH 1EOTA 4S3SA 5DAUA 1PTOF 4A75A 1Q82C 5CC4A 2E2IH 2K32A 2A68C 3FRPB 3PCOB 3PUZA 1N34L 5C3WA 3VR3A 4JW0A 3M85A 4HCEA 4A3FG 4LMQD 4L63B 4ALPA 1YZ6A 1PHJA 4DV5Q 1LT6D 4JBKA 1I6VC 4RG1A 3PV0A 3V05A 2B63G 3OW2A 4X66Q 1F9PA 1D8LA 3B6YA 5E4WC 5D3IB 4A4IA 3S1QH 5IT9L 1BBXC 2N55A 1VQLA 5M3FG 1A8VA 2G9DA 2L55A 3G4SA 4JI7L 4IFDI 1VQAA 4IFDJ 5CV8A 4YHHL 4OONA 2B2TA 1Z7TA 2NVXB 4QIWB 1RJTA 3RUZA 4HJ8A 4QGUA 1QUQB 4EQOA 1F2ZA 3RLFA 4DV3Q 4R8IA 4DNIA 2R7DA 5IODA 2PW5A 1QNUA 2A5HA 3GO5A 1TWFH 3AB9A 5D14A 1SNQA 1CHPD 2JSOA 2ZTEA 4JI1L 1L1OA 4KMUC 4WORA 2F0DA 5I6WA 3KF8A 4DV7L 1STGA 3MA2B 3HOVG 2F4IA 4HJAA 2JJQA 3CRKC 4DN4M 2KCTA 5HY6A 3VYUA 4KY7A 1B70B 1NR2A 1OXVA 1X3EA 3T1HQ 3BYTB 3E9IA 2Q8RE 1IBML 2B2UA 4FF2A 5T1GA 1SNMA 1SRUA 4B3RQ 2RSOA 3U50C 1DGSA 1V1PA 2FMMA 2A6HD 4DR3Q 1Q46A 2IX0A 2SOBA 3UE1A 4AQYQ 1IYJB 1I6HH 3RZDB 4X64Q 1UAPA 4A3BG 4TVAB 3MZ5A 4A3MB 4KY6A 2M2LA 1XMOL 4Y7NB 2EYOA 3BYYB 3SGIA 3F2BA 3Q24A 2ZJQA 1HRJA 4JBMA 1IL8A 3OMCA 1XMQQ 1NR4A 3H3VH 1XJVA 1X3GA 2DUDA 4B9XA 4ME5A 4YWKA 2NVXH
chains in the Genus database with same CATH topology
3BG3A 1CI3M 1SNPA 1AZPA 2LKVA 2L9HA 1CZGA 3T13A 3K59A 3X3MA 3EVQA 1VCIA 1CA6A 3CKIB 4HTHA 5KNDA 4CJ1B 1V8QA 1HTLD 2R93B 4G7OC 5FO8B 1V1OA 1ZXTA 3JAML 1JQYD 1X3PA 5ELCA 1KNEA 3PMFA 4FP5D 5C5LA 1CQVA 2KEDA 2NVYB 1SYEA 2J7ZA 1TS2A 2L5TA 5CORA 4OGQC 1VMPA 2RKSA 1AFPA 1IW7C 4BBRB 4HMJA 2QILA 1YNND 1FD7D 5T1IA 3SHLA 1JICA 2WACA 5ELBA 3DMUA 2IT1A 1BDOA 1OXUA 3FPPA 5AFWA 3S16B 5G3LD 5A2QL 2EYLA 1PZJD 4K8IA 1EY5A 5ELDA 2WB1B 2H1EA 1B9MA 1Y69U 1B4OA 3R3OA 2AUJD 1W6KA 1S5DD 2BE5C 2VNUD 2F3WA 1S5BD 2PZTA 4A3EB 1PRTB 2D2CC 2MP1A 2KCCA 1AP0A 3PUVA 3TMEA 3EJIA 2PW7A 3O13A 1TS3A 5IT9E 1WVLA 2CQAA 1PDQA 3I73A 1T5XD 3IKJA 4BWGB 2EY5A 1PRTF 1ZYRD 3GTJB 3VA7A 1GUSA 2QDBA 3BVZA 5IGDA 4K5WA 2L1BA 2R92B 1H9SA 4WRDA 2E2JB 2XNAC 5CR3A 3MXGA 1SMYC 5I4DA 3GTGB 5FLXL 2QEJC 5FO9B 1E2ZA 5J1ZA 2IPKD 3E6ZX 3MFYA 2A74C 2RBMA 3T53B 4IZ8A 4IUVA 1HQMC 1AZQA 4JBWA 1MGSA 3NTKA 4A3JB 3U9OA 4M1UB 3I91A 3QJYA 2WKCA 3TN2A 5JPNC 1ICWA 1QCBD 1HFGA 1SJHD 1C48A 2F0GA 4HEDA 4J1MA 2WIIB 2ZXPA 2FMCA 4C1NI 3S2DB 2IWHA 1AN8A 4K6DA 4MHEA 4TQUS 4X3TA 4HR7B 1A2TA 1LT5D 4OO1G 1CA5A 1IYUA 2KUMA 1TWHB 4O42A 4LAAA 1IKLA 2BA1A 1H9RA 4JK1C 4NKLA 2EE1A 4IUTA 3C1EA 2XRSD 1QNKA 2F0WA 2HQEA 1A3UA 1TS5A 2X69A 1OO9B 1PMRA 4K2KA 1HTPA 4XIGS 1S5CD 1KDBA 1PZID 1ZEQX 4EVOA 1GHKA 3GTPB 5HGTA 2KEEA 5C0XH 1GUGA 3D4RA 2A69C 2B2UC 1SYCA 1HA5A 4PMCA 2NWGA 3URYA 3BDOA 3C3LA 5BN4A 5IOCA 4H7BA 1BCPB 2DNEA 1EY9A 1LLRD 3HS0C 3PIP3 4HN7A 3DUZA 1B53A 5IGEA 2JA7B 3D4DA 1K8OA 1S5FD 2NN6G 1H9JA 3PO2B 1XTCD 1BCPF 2A69D 3J7AF 3HZXA 1PYWD 1QILA 1VMCA 1TQOA 1WTXA 1O80A 3ND8A 4RCOA 2LMCB 4IN3A 1M4VA 4OO1H 1EY7A 4OHJA 1FNVA 1RTNA 3OOCA 1J8IA 1JOOA 5C4XB 2FJ2A 1DJRD 2OEOA 2AQ3B 1D5XC 1SNCA 4C3HG 4BBSB 2KVMA 1WTQA 1SBBB 2BDOA 4K5VA 4RKBA 2IJ0A 1RODA 5BN3A 5COYA 2AWNA 3VYTA 1R4QB 1DZ1A 4ZLTF 3NP8A 1CT1D 2IX3A 4Q0FA 4FVMA 2HDMA 5IGCA 3HOUB 3H91A 1CTMA 3K57A 3T4AC 2BCOA 3UI2A 4F87A 1STHA 3S1NB 3OIPA 1MSGA 5KNCA 4FXDA 4KN4C 3TZUA 1JORA 1EYCA 5CV6A 5FLXE 3R2IA 3CHBD 2O5IC 3IL8A 2J0TD 3TP5A 4IFDH 1I3QB 1G291 2A6EC 3NWSA 4FXGC 4KD3A 2CVRA 2V4DA 2E74C 1SYGA 2O4XA 3VR5A 4C3IG 4CKEA 3ERQA 1ILQA 1KDCA 2C5CA 2BDNA 1HUMA 4RGMA 4V0BA 2H4OA 3M3YB 5JEAJ 5JVG3 2M00A 3GTKB 2EDGA 3NSWA 5C44B 1TT2A 5C5MA 1LTRD 1QG7A 3Q0AA 4J8QA 1TS4A 5IGFA 1SE2A 1F77A 2EPBA 4KD4A 5ELFA 2PPBC 3A8IE 2WINB 2WP8J 1PTOB 1Q12A 2NTSA 1GUWA 3MFGA 2K04A 2B2WA 5KGUA 1RHPA 3A54A 3K7AB 1BF4A 5C4HA 2FHTA 2MUYA 1NCVA 1LTSD 2J4XA 3K5NA 1Y1WB 1K83B 3P75A 4GZYC 3J7YW 2PMZB 1OXTA 2D62A 2VB2X 4XT1B 4X3UA 4KJOA 3F2UA 4FO2A 1FR3A 1JE4A 3HRZC 1STBA 3TBIB 1DCZA 3NHHA 1VF5C 2IX1A 1EIHA 1HXYD 4PV1C 3EQLC 1Y8OB 3L9AX 3BS1A 5FK9C 4TSSA 5KRUA 4MIUA 2F1MA 2A73B 3OSOA 3L7ZC 4XXEA 2A6HC 4DF7A 3GTQB 3QOLA 1FYCA 5JPMC 5HURA 3NTHA 2QKIC 1PTOH 4DK0A 1G6ZA 3D6CA 1V43A 1Y1VB 3A8KE 3K6OA 1VF7A 1GOZA 1PFNA 1M8AA 1TU2B 1SDFA 2TMPA 2YU9B 1SXTA 4K5XA 1YNJD 2GA4B 2XRQD 3HOYB 3GD7A 1TVXA 4DK1A 3Q6SA 4ZKBB 4BY7B 1IYVA 2HDLA 2K6AA 4QUCA 4BA2I 4XT3B 4L6TB 1XXGA 1ENCA 4H13C 4ZUJA 5CYUA 4CGYB 3A56A 1DOLA 2E2HB 3PUWA 1GXDC 2XVSA 3K5OA 2WV6D 5C4ZA 2F03A 1WTVA 2E75C 3AU7A 3J80L 1STYA 2RA4A 4I7ZC 3NBIA 2EYPA 1EU4A 3LWEA 1STNA 4ZQ3A 5IGGA 1QE6A 4YIJA 5DM63 1HFNA 1QB5D 1D5ZC 1YNNC 2F3VA 3K5MA 4ILWA 1SYBA 4DGZA 3P1HA 1BO0A 3N52A 2NTTA 3FMCA 1RKNA 1GJXA 1GUNA 2AUKA 1LT3D 3WOFA 5FKAC 1LO5D 1BUVT 1DXMA 3X3NA 3P20A 2Z1CA 4AYBB 1JWMD 1Q3LA 3GTLB 5M9OA 5IIFA 1KTKA 3FDTA 4KKTA 2F0HA 3HKZB 4RAUC 3DWQA 3S1RB 4K6LA 1II3A 1I4HA 3ITPA 4KK7A 2Q8TA 2FINB 3L3OC 5CV9A 1ZYRC 3KBXA 1IKMA 1JR0D 5G3LF 5JJZA 4Z9CB 3DWAA 2K03A 1U4LA 4C1NK 2HCIA 4O1NA 3NBHA 3PIO3 1NSNS 2R6GA 4WJWA 1O78A 2NB0A 1TKWB 4TRDA 1D5MC 3A8JE 1B50A 2ID0A 1STAA 4F7XA 1EU3A 3I3CA 1CQFA 4WFN3 1PRTD 3GQBA 1BQQT 2EJGC 2K1BA 1Q1EA 3EA6A 1T5EA 3M7NA 1LTID 5DM73 4XQJA 2EOTA 4QB4A 2EZVA 3C46A 1PFBA 3WOEA 5C0XG 4C3JB 1R9TB 2HCCA 3MXPA 2RVLA 2PNRC 1O7ZA 3MTSA 1EQVA 4DAYA 4ODGA 1EZ8A 3S9WA 5KNBA 3S17B 5F2DA 4PMBA 1F2MA 2KHSA 1LT4D 2DN8A 2EXZA 4M8AA 2RDGA 1DYQA 1RTOA 2B2TC 3M7GA 2JA8B 2EY1A 2DY7A 3N6RA 1JWUD 2KOLA 2CW0D 3TP7A 1WTOA 3M4OB 3HGBA 1EYDA 4XDXA 4FF3A 1WTPA 3MHBA 3OPOA 3J7AV 5KEEA 4RHRA 3DWPA 3ND9A 1AEXA 2IW3A 3QWNA 3J80E 4LK1C 4IUPA 1PZKD 3FKIB 4FXKC 1X32A 5EJWA 4RHSA 5KYIA 4DA2A 3S15B 3OMGA 3JAME 3RMHA 1JCKB 3TDQA 3V2TA 2F0KA 3EROA 1I4QA 3D6WA 3LWUA 2I46A 3R2TA 5C6AA 1SNOA 1O7LA 2VB3X 2BA0A 3A7AB 4K8JA 1Z47A 1SAPA 1OXSC 4CKCA 3SDZA 1JOQA 2R3ZA 4BA1I 2HUGA 4IFDG 2R7ZB 4HAEA 1SFOB 1EL0A 4EGVA 2D9UA 1V1PB 5A2QE 2KECA 5KYLA 2WAQB 1HA6A 5M5WB 3BDLA 2F0OA 4NW2A 1EEID 3U9SA 1I4RA 1MD2D 4F8MA 2B8FA 1EEFD 1STEA 5EPKA 4EQPA 1ENFA 3J81L 1S4ZA 4X3KA 2MJ8A 2RDHA 1CM9A 3PUYA 2I07B 1U4PA 3EFXD 3T51B 4G4KA 1JWSD 4A93B 4Q5VA 1JB3A 1BR9A 4G57A 3HOZB 3PUXA 4KN7C 1F2YA 1NAPA 1ONLA 2Z8LA 3P7JA 2AQ2B 1DD2A 3NTIA 4RA8A 1MBYA 1Y8PB 1CZWA 5EBDA 4BY1B 1UNSA 5IGBA 1ZKOA 4ZUIA 3QIAA 3S1MB 1C4QA 5K36H 2KQ3A 3A55A 2LY7A 4N9PA 2F0LA 1DOKA 3MVVA 2JXMB 5D3DA 1A15A 3SK5A 3R8BA 1Q8IA 5EPLA 2EYHA 4P2CB 1U9RA 2B2YA 4CBVA 4NP5A 2JA5B 5I9PA 3GTMB 2PCFB 4R9WA 5EKKA 3ZYYX 2NUCA 1B9NA 1EIGA 4DFAA 3HOWB 4B9WA 3R93A 3VR4A 1TR5A 3GP7A 2PZWA 1CHQD 1EY0A 4J6HA 3NWTA 2WKDA 2K5DA 1C8CA 4A3IB 1HPCA 2F0QA 3KK7A 3DHQA 2EYFA 3TSSA 3Q23A 4L8JA 1KDAA 2E76C 4KHZA 2SNMA 4OO1I 2Q8IB 3D31A 2L11A 2JP1A 4DAPA 1CK1A 1RF2D 4KTAA 3GV6A 3DEOA 4QF4A 2F0IA 3VA5A 4ZKCB 1PTOD 1VDZA 3I70A 1I4PA 2EY2A 2OXPA 3I4LA 3NUCA 3OWEB 1H9SB 1QWYA 4DXGA 4RWSC 2L12A 5BN5A 4CJ0B 3H3VC 1U4MA 4KY5A 1TIID 2NBFA 3MXUA 2K33A 5CGKA 1EY4A 1SYFA 1HHVA 2RDFA 1W6JA 5CV7A 4A3FB 1I6HB 1ESFA 4K2LA 4IALA 2MPMA 5JVH3 3W3AA 2B63B 1R4PB 2NN6I 1GUOA 4EQNA 2N88A 3ONAB 1XWEA 4ULLA 5A35A 1I50B 4MN3A 5M3FB 4E6IA 5CBEE 2A68D 1YNJC 5ELEA 1EYAA 2K28A 3A7LA 1KLUD 1ML0D 1B2TA 1EFID 1XX8A 4KHVA 3C1FA 2G9HD 4HSPA 1HQRD 4UDUC 5E1FA 3J81E 2EVBA 3SVMA 4DNTB 1LACA 3K5LA 1H9MA 3H94A 4G7ZC 4RGTA 3AMUA 2D5DA 3OIQA 2L0CA 4C56C 3HG9A 2DY8A 2E2DC 3LX0A 3CRLC 3HOVB 4RCNA 2EYJA 3MXNA 4H44C 3QG1A 3BZDB 4IUQA 2XWBB 4OIKA 2B2VA 4PQXA 2F0MA 3S2HB 3VR2A 4F88A 3T16A 3OHXC 1PLFA 4A3BB 5J22A 1I4XA 3BVGA 5I2YA 5LHY1 2EY6A 5J39A 3KLSA 4HSVA 3NPPA 3CQZB 3MC0B 1PXUA 2R61A 4PMWA 4U68A 1LTAD 2ICIA 1E2VA 1DM0B 1PFMA 4DXFA 5D65A 2JA6B 3NXWA 1JOKA 2Z4IA 1KAAA 4QUFA 1ENAA 1SJED 1F9QA 1EWCA 1RD9D 2PO4A 3E0JA 5CV5A 1CFMA 1O7YA 4XQNA 1G91A 1J9OA 3RD4A 3SR1A 3SK6A 2LFNA 1A6XA 4C2MB 3FEWX 1HUNA 1SNDA 1X3QA 5I2XA 4KKUA 5I9OA 3SE0A 4NMZA 4KKSA 4PNYA 5K5PA 1G2TA 3HEJA 2NZ1D 2B8GA 1EWHA 2SDFA 1SE3A 4ZYSA 3MWYW 2B2YC 1NUCA 1PRTC 4X3SA 1TY2A 1QOHA 2L4NA 5EQ0A 2EYMA 5DEHA 1GUTA 3VYRA 2O5JC 2QF7A 4BS9A 2Y0SB 5C3EB 3M4YA 4ZAIA 3NQTA 1IW7D 4CKBA 4RH6A 4XYQA 1SE4A 5EKLA 2ZT9C 2AQ1B 4HCSA 5CMDA 3SEBA 4IURA 5JAVA 1WD1A 3SK8A 1FNUA 2RQXA 2LS01 2JEBI 4XQQA 2X6LA 3G6JB 5EKIA 3NK9A 2K5WA 3IFTA 4RGNA 4NDXA 1MI2A 2ICEC 3H09A 2TSSA 5FO7B 1B3AA 4C3JG 4IQZA 1G2SA 2VXWA 2F0UA 3I72A 3FVQA 2NYZD 5C4JB 1TWAB 2JEAI 2B2WC 2BE5D 1Q1BA 5I6YA 4A3DB 1A2UA 4B08A 1KABA 3TZDA 1UUPA 1WCMB 2PZUA 2BOSA 3K0YA 1LTBD 1EY6A 2NVQB 3K58A 2XN9C 4H0LC 4XYOA 3RZOB 1H9KA 3NQIA 5CV4A 2CW0C 2IL8A 2ZXOA 2KJXA 5TSSA 5M5XB 5EBCA 3KLSX 4G7HC 4IUUA 1L0XB 4ZRZA 1E2WA 5EPJA 2B39A 1B1ZA 4RFBA 1EZ6A 1LTTD 3I90A 2SEBD 2RSNA 1SMYD 1DOMA 1LABA 3FPUB 3D3RA 3SK4A 1EQTA 3DEPA 5JEAG 1ILPA 3QB3A 2F0TA 3GV3A 4RKLA 2JE6I 4IUNA 4FF1A 2SNSA 2OT2A 4TKOB 2O2LD 3IAYA 2NVTB 2PYKA 3H6MA 2JYOA 2K05A 2M9VA 3WDNA 1SEBD 4KV6A 4ZK9B 2CHBD 4N9TA 1TY0A 2PQEA 1D2BA 1ET6A 2EJMA 1A3VA 1ESRA 3KUPA 3SXHA 5EGTA 3W2DA 5M3MB 3HOXB 4UAIA 2XSCA 3CU7A 1BCPC 3I8ZA 4DNRB 4FF4A 5CBAE 4A3KB 3G7LA 1LV9A 1TWCB 1EY8A 1UEAB 2F0EA 2C9OA 1FGBD 2K01A 5K36G 4FYDA 1MSHA 3QOJA 1BNZA 1JC7A 1B44D 2B2VC 2VUMB 5ISRA 2YYZA 4HMIA 1BCPD 1D6EC 2DNCA 4DU9A 1SYDA 4A3GB 4OIJA 3PO3B 1G8ZD 1TWGB 1FNWA 5LL6S 1Q90A 1Z6HA 3HP3A 5C3XA 5LL6X 1QJOA 2AWOA 3BVMA 3Q22A 5JEAH 1RCVD 1D1KA 2MHVA 3T56B 3OWFA 4ID6A 4OL7A 2K7VA 2Z4HA 1BOSA 3C2PA 1HCZA 4ABNA 1WTRA 1F9RA 3VYSA 1AW7A 5JOBA 5E4XA 2F0SA 2F0PA 1SSOA 4QCLA 3QO2A 3DXJC 2ENBA 1U4RA 4I65A 2K5QA 1KNAA 5FOBB 1IHZA 3D4WA 3TP8A 3V96A 4LJZC 4QMGA 3GTOB 5KIXA 4C3HB 3IFDA 2KA7A 1S5ED 2F0JA 5DNFA 3NE5B 1ET9A 4RGOS 2F0VA 5E3FA 3MAQA 4K14A 4U673 3OW7A 1LTGD 3LNNA 1F2LA 3MEHA 3DM1A 1WTWA 1BXTA 1K8MA 5C0XI 2F0NA 5C0XJ 3I4NB 1A3TA 4KI0A 1OXXK 2EJFC 1WD0A 3I4MB 2E2IB 5NUCA 3BDCA 1KLGD 3S14B 2NN6H 2X6GA 1RDPD 3KBGA 3E5SA 2F0FA 1F9SA 4CJ2C 4XTCS 2OF1A 3TP6A 1D1IA 3S1QB 4C3IB 1PTOC 2KCNA 1L0YB 2ZXRA 4V190 3H0GB 1GHJA 4CHTB 2A6ED 4FNFA 4KJNA 2QCPX 1I4GA 2FFKB 1TWFB 4DAVA 3VR6A 3KLRA 5M5YB 1E0BA 2XWJB 2XIWA 2MGSA 3D8GA 4R8NA 1XYIA 1DONA 1Y8NB 1EOTA 4S3SA 5DAUA 1PTOF 5CC4A 2K32A 2A68C 3FRPB 3PUZA 5C3WA 3VR3A 3M85A 4HCEA 4LMQD 4L63B 1LT6D 1I6VC 3PV0A 3V05A 1F9PA 5E4WC 5D3IB 5IT9L 1BBXC 2N55A 2G9DA 2L55A 4IFDI 4IFDJ 5CV8A 2B2TA 1Z7TA 2NVXB 4QIWB 1RJTA 3RUZA 4EQOA 1F2ZA 3RLFA 4R8IA 5IODA 2PW5A 1QNUA 2A5HA 3GO5A 3AB9A 5D14A 1SNQA 1CHPD 2JSOA 4KMUC 4WORA 2F0DA 5I6WA 3KF8A 1STGA 3MA2B 2F4IA 3CRKC 4DN4M 3VYUA 4KY7A 1NR2A 1OXVA 3BYTB 2Q8RE 2B2UA 4FF2A 5T1GA 1SNMA 2RSOA 1V1PA 2FMMA 2A6HD 2IX0A 2SOBA 3RZDB 1UAPA 3MZ5A 4A3MB 4KY6A 2M2LA 4Y7NB 2EYOA 3BYYB 3Q24A 1HRJA 1IL8A 3OMCA 1NR4A 4B9XA 4ME5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  1F9P A;  4NW2 A;  1QNK A;  2FIN B;  2K04 A;  5COY A;  5E4W C;  2Q8T A;  3TZD A;  1AZP A;  1WVL A;  1C8C A;  2L9H A;  2B2W A;  1PDQ A;  1O7Y A;  1TVX A;  2B2V C;  1IKM A;  3KBX A;  3Q6S A;  1BBX C;  2N55 A;  1DZ1 A;  4ZLT F;  5EPK A;  1G91 A;  1RHP A;  1RTO A;  2B2T C;  4ZKB B;  1J9O A;  2X69 A;  3SVM A;  1CA6 A;  2X6G A;  1BF4 A;  2HDL A;  1S4Z A;  5JJZ A;  2FHT A;  4X3K A;  1NCV A;  2HDM A;  4OIJ A;  2DY7 A;  2MJ8 A;  4QUC A;  2K03 A;  1HUN A;  2IL8 A;  2B2T A;  1U4L A;  1X3Q A;  1F9S A;  3H91 A;  4XT3 B;  4CJ2 C;  4CJ1 B;  2KOL A;  2L11 A;  1CM9 A;  2HCI A;  2L1B A;  2JP1 A;  1WTO A;  3UI2 A;  2KEE A;  2DY8 A;  1RJT A;  4XDX A;  3GV6 A;  3HP3 A;  1WTP A;  1U4P A;  3DEO A;  1ZXT A;  2B2U C;  4IUU A;  1MSG A;  1G2T A;  4XT1 B;  1DOL A;  1X3P A;  2NZ1 D;  4X3U A;  5EPJ A;  1B50 A;  2SDF A;  2NWG A;  3F2U A;  1KNE A;  3I3C A;  3I90 A;  1JE4 A;  3MWY W;  4R8I A;  2B2Y C;  4IUP A;  1NAP A;  1WTV A;  4X3S A;  2RSN A;  3P7J A;  2L4N A;  4IUQ A;  2KED A;  5EQ0 A;  2J7Z A;  2RA4 A;  4OIK A;  2B2V A;  4ZKC B;  5D14 A;  1DOM A;  4RA8 A;  3FPU B;  1WTR A;  1EQT A;  3IL8 A;  5COR A;  1F9R A;  3DEP A;  3LWE A;  1X32 A;  5EJW A;  2K1B A;  5E4X A;  1QE6 A;  1VMP A;  1ILP A;  1EIH A;  2CVR A;  1B53 A;  1SSO A;  3GV3 A;  4ZAI A;  1HFN A;  4RWS C;  1PLF A;  3QO2 A;  4DN4 M;  2L12 A;  1NR2 A;  1U4R A;  4IUV A;  4CJ0 B;  1BO0 A;  3N52 A;  1KNA A;  1AZQ A;  1U4M A;  1MGS A;  2EOT A;  5T1I A;  2FFK B;  1JIC A;  1ILQ A;  2Q8R E;  1DOK A;  2B2U A;  4HCS A;  5CMD A;  5T1G A;  3D6W A;  1PFB A;  1VMC A;  2JYO A;  4IUR A;  1WD1 A;  2BDN A;  1WTX A;  3I91 A;  5AFW A;  1A15 A;  1O80 A;  3TN2 A;  1E0B A;  1HUM A;  2K05 A;  4HSV A;  5EPL A;  1ICW A;  2RSO A;  1HHV A;  4ZK9 B;  1HFG A;  2HCC A;  2B2Y A;  2XIW A;  2FMM A;  3IFD A;  2X6L A;  2MGS A;  2RVL A;  4HED A;  4U68 A;  5EKI A;  1ESR A;  4R9W A;  1XYI A;  2MPM A;  3KUP A;  5DNF A;  1G6Z A;  1DON A;  1SAP A;  1Q3L A;  1O7Z A;  1RTN A;  1PFM A;  2H1E A;  1J8I A;  1MI2 A;  4UAI A;  3MTS A;  1EIG A;  1EOT A;  1QG7 A;  5D65 A;  1B4O A;  3I8Z A;  4MHE A;  2N88 A;  2FJ2 A;  3FDT A;  3ONA B;  5CBA E;  2R3Z A;  2HUG A;  3R93 A;  1B3A A;  2M2L A;  4MN3 A;  4X3T A;  1PFN A;  2EPB A;  4HAE A;  4RAU C;  1F2L A;  5CBE E;  1M8A A;  4QUF A;  1CA5 A;  1HRJ A;  3DM1 A;  1G2S A;  2KUM A;  2VXW A;  3G7L A;  1IL8 A;  1SDF A;  4O42 A;  1WTW A;  1LV9 A;  2KVM A;  1EL0 A;  1IKL A;  1WTQ A;  2D9U A;  4LMQ D;  2NYZ D;  2K28 A;  2B2W C;  2K01 A;  1F9Q A;  1NR4 A;  2EE1 A;  1MSH A;  1ROD A;  1ML0 D;  2KEC A;  2MP1 A;  4IUT A;  1BNZ A;  1AP0 A;  1B2T A;  1GUW A;  1HA6 A;  1XX8 A; 
#chains in the Genus database with same CATH topology
 3BG3 A;  1KIX A;  1CI3 M;  1SNP A;  3AQQ A;  5LMN W;  1AZP A;  2LKV A;  1FJG L;  2L9H A;  3QR8 A;  1CZG A;  3T13 A;  2JA6 G;  3K59 A;  4GNX B;  4A3C H;  3HKS A;  3X3M A;  3EVQ A;  1VCI A;  2PI2 E;  4IOA A;  3VDY A;  1CA6 A;  3CKI B;  1N32 L;  4HTH A;  1HZB A;  5KND A;  4CJ1 B;  1V8Q A;  1HTL D;  2R93 B;  4G7O C;  5FO8 B;  3CME A;  1V1O A;  1ZXT A;  1EYG A;  3JAM L;  1JQY D;  1X3P A;  5ELC A;  1KNE A;  3PMF A;  4R4O A;  2EIF A;  4FP5 D;  5C5L A;  1CQV A;  4LF4 Q;  2KED A;  2NVY B;  1SYE A;  2J7Z A;  1TS2 A;  1I94 L;  2L5T A;  5COR A;  1XPR A;  4OGQ C;  2PQA B;  1FL0 A;  1VMP A;  2RKS A;  1AFP A;  1IW7 C;  4BBR B;  4HMJ A;  2F4V L;  1Y14 B;  2QIL A;  1GD7 A;  1TXY A;  2ALY B;  4JG2 A;  4OEL B;  1YNN D;  1UWV A;  1FD7 D;  5T1I A;  3SHL A;  3RZD H;  1JIC A;  2WAC A;  1UE1 A;  2IHF A;  2OCE A;  5ELB A;  3DMU A;  2IT1 A;  1N34 Q;  1N9W A;  4A3M H;  1BDO A;  1OXU A;  2QGQ A;  3FPP A;  5AFW A;  3S16 B;  1K8A C;  4Y7N H;  1QVG A;  2Y0S G;  5C3E G;  1A62 A;  5G3L D;  5A2Q L;  2K50 A;  1MJE A;  2EYL A;  1PZJ D;  4K8I A;  1EY5 A;  5ELD A;  4RMF A;  2WB1 B;  2H1E A;  1B9M A;  1V1Q A;  1LTL A;  1Y69 U;  1B4O A;  4A3L H;  4JI7 Q;  3NEL A;  3R3O A;  5LMN L;  2AUJ D;  1W6K A;  2Y0S E;  4GLV B;  4YHH Q;  2E5L L;  1S5D D;  2BE5 C;  2VNU D;  2F3W A;  1S5B D;  2PZT A;  4A3E B;  1PRT B;  2D2C C;  2MP1 A;  2KCC A;  1AP0 A;  3PUV A;  2R93 H;  4JI8 L;  3TME A;  3EJI A;  2PW7 A;  3O13 A;  1TS3 A;  3STB C;  5IT9 E;  1WVL A;  2CQA A;  1PDQ A;  3I73 A;  1T5X D;  3IKJ A;  4BWG B;  1PH6 A;  2EY5 A;  4HJ7 A;  1PRT F;  1ZYR D;  3GTJ B;  1B7Y B;  3VA7 A;  1GUS A;  2QDB A;  3A5U A;  3BVZ A;  2V1C C;  5IGD A;  4K5W A;  1VQD A;  2L1B A;  4JI1 Q;  5IP9 G;  2R92 B;  1K3B C;  4A3D G;  1UEB A;  4YCU A;  4DV7 Q;  3I7F A;  1H9S A;  1IBK L;  1WCM G;  4WRD A;  1OTC A;  2E2J B;  2XNA C;  2YV5 A;  2UXB L;  5CR3 A;  2ATW A;  3MXG A;  1IBM Q;  1SMY C;  3PIP A;  1N36 L;  4OWW B;  5I4D A;  1VQF A;  3I55 A;  3GTG B;  5FLX L;  2XGT A;  2QEJ C;  5FO9 B;  3S16 H;  1E2Z A;  5J1Z A;  1WTH A;  2IPK D;  3E6Z X;  3MFY A;  2A74 C;  2RBM A;  3T53 B;  4JV5 L;  4IZ8 A;  4OXP A;  5C3E H;  1JT8 A;  4IUV A;  1HQM C;  1AZQ A;  3TRE A;  4JBW A;  1MGS A;  3NTK A;  4A3J B;  1HZ9 A;  1XMO Q;  3U9O A;  4M1U B;  3I91 A;  3QJY A;  2WKC A;  3TN2 A;  5JPN C;  1ICW A;  1QCB D;  1HFG A;  1SJH D;  1C48 A;  2A19 A;  2F0G A;  1NNX A;  4HED A;  4J1M A;  4A3E H;  5IE8 A;  2WII B;  2ZXP A;  2FMC A;  4DK6 C;  4C1N I;  4OX9 L;  3S2D B;  1FJG Q;  1PV4 A;  1C9O A;  2N8N A;  2IWH A;  5IYB G;  1AN8 A;  4K6D A;  4MHE A;  3PGZ A;  4TQU S;  4X3T A;  4HR7 B;  1A2T A;  1LT5 D;  1N32 Q;  4OO1 G;  1CA5 A;  1IYU A;  3GTJ H;  2KUM A;  1TWH B;  4O42 A;  4LAA A;  1QVC A;  1IKL A;  2BA1 A;  1H9R A;  1KRS A;  4JK1 C;  4NKL A;  2EE1 A;  4IPC A;  4IUT A;  3C1E A;  2JN4 A;  3TRZ A;  3AYH B;  5M3M G;  2XRS D;  1QNK A;  2F0W A;  3HOX G;  4LUO A;  1E1O A;  2HQE A;  4LF6 L;  4MTK A;  4A3D H;  1A3U A;  1I5F A;  3W1G A;  1TS5 A;  1WCM H;  3G48 A;  4A3K G;  2X69 A;  1SN8 A;  1OO9 B;  1PMR A;  3PSI A;  4K2K A;  1HTP A;  4XIG S;  4X65 Q;  1S5C D;  1K0R A;  1L1O C;  4IPH A;  1KDB A;  1PZI D;  1ZEQ X;  4EVO A;  1I94 Q;  5JJL A;  1GHK A;  3GTP B;  5HGT A;  3GTG H;  3RZO H;  2KEE A;  5C0X H;  3TS0 A;  1GUG A;  3KF6 A;  3D4R A;  2F4V Q;  2A69 C;  2B2U C;  2VUM G;  1SYC A;  1HA5 A;  4PMC A;  2NWG A;  2K14 A;  3URY A;  3BDO A;  3K8A A;  3C3L A;  5BN4 A;  4A3G G;  3PO3 G;  5IY0 A;  5IOC A;  3OTO L;  4H7B A;  1BCP B;  2DNE A;  2MQH A;  1EY9 A;  1LLR D;  3HS0 C;  3PIP 3;  2OWO A;  4HN7 A;  4P74 A;  1VQ5 A;  3DUZ A;  1B53 A;  5IGE A;  2I0Q A;  1H95 A;  2JA7 B;  3D4D A;  1RL2 A;  1K8O A;  1S5F D;  1P8L A;  1WJJ A;  2NN6 G;  1H9J A;  3BZC A;  3PO2 B;  1XTC D;  1BCP F;  2A69 D;  3S2D H;  3MXN B;  3J7A F;  3HZX A;  5FLM G;  5LMN Q;  1PYW D;  4DPG A;  5DLQ E;  2RCF A;  1KHI A;  1QIL A;  1VMC A;  1TQO A;  4BXX G;  1WTX A;  2E5L Q;  1QVF A;  1O80 A;  3ND8 A;  4RCO A;  3S24 A;  1AH9 A;  2WAQ E;  2LMC B;  2NVT H;  4IN3 A;  1TWH H;  1M4V A;  1SLJ A;  4OO1 H;  1EY7 A;  4OHJ A;  2MFI A;  4JI8 Q;  1HNX L;  1Q8K A;  1FNV A;  1RTN A;  3OOC A;  2GVA A;  5C4X G;  1J8I A;  1JOO A;  5C4X B;  2FJ2 A;  3HOX H;  1DJR D;  2OEO A;  2AQ3 B;  1D5X C;  1SNC A;  4C3H G;  4BBS B;  2KVM A;  1WTQ A;  1SBB B;  2BDO A;  4K5V A;  1N8R C;  2A8V A;  4RKB A;  1VQG A;  2IJ0 A;  1ROD A;  1IBK Q;  3EN2 A;  1V9P A;  5BN3 A;  5COY A;  2UXB Q;  2AWN A;  3VYT A;  4DAM A;  1R4Q B;  1DZ1 A;  4ZLT F;  1J5E L;  3NP8 A;  1CT1 D;  1XNQ Q;  1N36 Q;  2IX3 A;  4Q0F A;  4FVM A;  2HDM A;  5IGC A;  3HOU B;  1BBW A;  3BZK A;  3H91 A;  3I4N G;  1CTM A;  3K57 A;  3T4A C;  2BCO A;  4DV0 L;  3UI2 A;  1HNW Q;  4F87 A;  1N33 Q;  3I4M G;  1STH A;  3S1N B;  4WJ4 A;  3ICE A;  4JV5 Q;  1YHA A;  3OIP A;  1M1K C;  1MSG A;  4JBJ A;  1Q86 C;  1KAW A;  1Q81 C;  5KNC A;  4FXD A;  4KN4 C;  3TZU A;  1JOR A;  1UE7 A;  1EYC A;  5IT9 c;  4B3T L;  1GO3 E;  5CV6 A;  5FLX E;  4JCV E;  3R2I A;  4P75 A;  3CHB D;  4UP7 A;  1CSP A;  2O5I C;  3IL8 A;  2J0T D;  4H02 A;  3TP5 A;  4IFD H;  1I3Q B;  1G29 1;  2A6E C;  3NWS A;  4FXG C;  4KD3 A;  1PH4 A;  4BXX H;  2CVR A;  5JJI A;  2V4D A;  2E74 C;  1SYG A;  4OX9 Q;  1A0I A;  2O4X A;  3VR5 A;  4C3I G;  4CKE A;  1NBW A;  3ERQ A;  1VQ7 A;  1ILQ A;  1KDC A;  2C5C A;  1NMF A;  5C4X H;  2BDN A;  4OWX B;  3UDF A;  1HUM A;  4JI0 L;  3H0G G;  2HHH Q;  4RGM A;  4B3M Q;  4V0B A;  4BBS H;  2H4O A;  3M3Y B;  5JEA J;  4ZCK A;  5JVG 3;  2M00 A;  4DV1 L;  3GTK B;  1PH3 A;  2EDG A;  3NSW A;  5C44 B;  1TT2 A;  4POF A;  5C5M A;  1LTR D;  1QG7 A;  3Q0A A;  4J8Q A;  1TS4 A;  3E0E A;  5IGF A;  4LF7 Q;  1SE2 A;  4LFA L;  1F77 A;  2EPB A;  2Z6B A;  4KD4 A;  4NXM L;  1CKO A;  5ELF A;  4X62 L;  3ULL A;  3A8I E;  2PPB C;  2ASB A;  2WIN B;  2WP8 J;  1PTO B;  3HOU H;  2MNA A;  1Q12 A;  2NTS A;  1GUW A;  3NEN A;  3MFG A;  2K04 A;  2B2W A;  3S1N H;  5KGU A;  1RHP A;  2OTL A;  2MO0 A;  3CC4 A;  1K28 A;  3A54 A;  3K7A B;  4OWT B;  4NPS A;  1K8G A;  5C4H A;  1BF4 A;  1MJC A;  2FHT A;  3OTO Q;  2MUY A;  1NCV A;  5J3B A;  1LTS D;  3S14 H;  2J4X A;  3K5N A;  1KXL A;  1Y1W B;  1K83 B;  3P75 A;  4GZY C;  2ZTC A;  4QY7 A;  1I3Q H;  3J7Y W;  2PMZ B;  3G6E A;  1YIJ A;  4GN4 B;  2WFW A;  4GLX A;  1OXT A;  2D62 A;  2VB2 X;  4XT1 B;  4X3U A;  4KJO A;  3F2U A;  3CCQ A;  4FO2 A;  5LMU Q;  3CPF A;  1FR3 A;  1JE4 A;  4DAY B;  3HRZ C;  1STB A;  3CAM A;  2JQO A;  3TBI B;  4JYA L;  4DUZ L;  1DCZ A;  3NHH A;  4OEM B;  4C3I H;  1NTG A;  4L5T A;  1VF5 C;  2IX1 A;  2QW7 A;  1EIH A;  1HXY D;  4A3C G;  1HNX Q;  2RHQ B;  1XPU A;  3KFU A;  2K5V A;  1YI2 A;  1VQB A;  3H0G H;  4PV1 C;  3EQL C;  1Y8O B;  3L9A X;  4P73 A;  3BS1 A;  5FK9 C;  3GTK H;  4TSS A;  2DGY A;  5C44 H;  5KRU A;  2P5Z X;  4MIU A;  3JAM c;  2F1M A;  2A73 B;  3OSO A;  4QIW E;  3L7Z C;  4XXE A;  4R4T A;  2A6H C;  4DF7 A;  5M5Y H;  3GTQ B;  2ZJP A;  3QOL A;  1FYC A;  3CP0 A;  3M4Q A;  5JPM C;  2F52 A;  5HUR A;  2BH2 A;  3NTH A;  1Y1V G;  2QKI C;  1PTO H;  4DK0 A;  1G6Z A;  3D6C A;  1V43 A;  1NY4 A;  1Y1V B;  4GOP A;  1EUJ A;  1J5E Q;  5IWA L;  3A8K E;  3K6O A;  1VF7 A;  1D7Q A;  1SRO A;  1GOZ A;  1PFN A;  1M8A A;  1TU2 B;  2I5H A;  1SDF A;  2TMP A;  2YU9 B;  4DV0 Q;  2RCN A;  1SXT A;  4K5X A;  1PYS B;  1YNJ D;  2GA4 B;  1Y1W H;  1K83 H;  3CC2 A;  2XRQ D;  3HOY B;  3GD7 A;  1SR3 A;  2OQ0 A;  2IY5 B;  1TVX A;  2IHE A;  4DK1 A;  4A3M G;  3Q6S A;  1VQN A;  3IRB A;  4ZKB B;  4GKK L;  4B3T Q;  4BY7 B;  3I4O A;  2OTJ A;  1IYV A;  2HDL A;  2K6A A;  4QUC A;  4BA2 I;  4XT3 B;  4L6T B;  1XXG A;  3PQI A;  1ENC A;  3U4V A;  4H13 C;  4ZUJ A;  5CYU A;  4CGY B;  3ZJY C;  3A56 A;  1DOL A;  2E2H B;  3PUW A;  1GXD C;  2UUA L;  2Q2H A;  2XVS A;  3K5O A;  2ZJR A;  2WV6 D;  5C4Z A;  2F03 A;  1WTV A;  2E75 C;  3AU7 A;  3J80 L;  1STY A;  2RA4 A;  4I7Z C;  3NBI A;  2R93 G;  2EYP A;  1EU4 A;  3LWE A;  1STN A;  4ZQ3 A;  3CCU A;  5IGG A;  1QE6 A;  4YIJ A;  1MKH A;  5DM6 3;  2K5H A;  4O2D A;  1HFN A;  3GTQ H;  4DV1 Q;  1QB5 D;  2CWP A;  1D5Z C;  1YNN C;  2F3V A;  4GN5 A;  4LF5 Q;  3K5M A;  4ILW A;  1SYB A;  4DGZ A;  1JJ2 A;  3UDI A;  3P1H A;  1BO0 A;  3N52 A;  2NTT A;  1Y1V H;  3FMC A;  1RKN A;  4R4Q A;  4LFA Q;  1GJX A;  1GUN A;  2AUK A;  4NXM Q;  1LT3 D;  4X62 Q;  3WOF A;  5FKA C;  1LO5 D;  1K73 C;  3PF4 A;  4IJH A;  1FVI A;  1BUV T;  2Z6K A;  4ME3 A;  4BBR G;  1DXM A;  2K52 A;  3X3N A;  2Z0S A;  2Q2U A;  5FLX c;  3RNU A;  2YU9 H;  3P20 A;  1B3Q A;  2Z1C A;  4AYB B;  1JWM D;  1Q3L A;  1HR0 L;  3T1Y L;  1EOV A;  3GTL B;  5M9O A;  5IIF A;  2UU9 L;  1YVC A;  1KTK A;  3FDT A;  4KKT A;  2F0H A;  2HQL A;  3HKZ B;  3CCM A;  4RAU C;  3DWQ A;  4UY8 C;  3S1R B;  4BY7 H;  4K6L A;  1II3 A;  4YCW A;  3KDF B;  1I4H A;  3KJO A;  3ITP A;  3AFQ A;  4KK7 A;  1S72 A;  2WB1 G;  2FIN B;  2Q8T A;  3L3O C;  5CV9 A;  1K3R A;  3J80 i;  1ZYR C;  3KBX A;  1IKM A;  5AJ3 L;  1JR0 D;  2E2H H;  3CW2 C;  1X56 A;  4JYA Q;  5G3L F;  5JJZ A;  4Z9C B;  2RF4 A;  4R4I A;  3DWA A;  4A3E G;  2K03 A;  1U4L A;  4C1N K;  2HCI A;  4O1N A;  3NBH A;  3PIO 3;  3JAM i;  3RN5 A;  4JI2 L;  1NSN S;  4PZ6 A;  2R6G A;  4WJW A;  1O78 A;  2NB0 A;  1T9H A;  1TKW B;  1NE3 A;  4N8X 1;  4TRD A;  1E7Z A;  1D5M C;  3A8J E;  1B50 A;  2ID0 A;  1STA A;  4F7X A;  1EU3 A;  3I3C A;  1Q7Y C;  3ERS X;  1JJC B;  1WFQ A;  3A5Z B;  1CQF A;  4NXN L;  1KD1 C;  4WFN 3;  1PRT D;  3GQB A;  2R92 G;  1BQQ T;  4WJ3 M;  2EJG C;  4LWC A;  1J6Q A;  2NVY H;  2K1B A;  4QJF A;  2K4K A;  4A76 A;  1QZH A;  1C0A A;  1Q1E A;  4JOI A;  3EA6 A;  3GDE A;  2N78 A;  1T5E A;  3M7N A;  3U4Z A;  1YHQ A;  4BBR H;  1LTI D;  5H1S E;  3DLL A;  5DM7 3;  4XQJ A;  2EOT A;  2AKW B;  4QB4 A;  2EZV A;  3GTL H;  3C46 A;  1PFB A;  2YTV A;  3WOE A;  5C0X G;  4LUV A;  4C3J B;  4DR5 L;  1ASY A;  2HT1 A;  1R9T B;  3H15 A;  1X3F A;  2HCC A;  3MXP A;  3S1R H;  2RVL A;  2PNR C;  1O7Z A;  4A3J G;  3MTS A;  1EQV A;  4IJL A;  4DAY A;  3CMA A;  4GKK Q;  4ODG A;  1EZ8 A;  3S9W A;  4DR7 L;  5KNB A;  3S17 B;  1BBU A;  1PA6 A;  5F2D A;  1G51 A;  4PMB A;  1IZ6 A;  4LF9 L;  5HGQ A;  1QUQ A;  1F2M A;  2KHS A;  1LT4 D;  1VQP A;  2DN8 A;  2EXZ A;  4M8A A;  2UUA Q;  1NMG A;  2RDG A;  1DYQ A;  1RTO A;  2B2T C;  3M7G A;  2YTX A;  1MIU A;  2JA8 B;  2EY1 A;  2DY7 A;  1JE5 A;  3N6R A;  2UXC L;  1JWU D;  4LUZ A;  2KOL A;  1GKH A;  2CW0 D;  3TP7 A;  1WTO A;  1X54 A;  3EIV A;  3HGB A;  1EYD A;  4XDX A;  4FF3 A;  3M4O B;  1WTP A;  3MHB A;  3OPO A;  3J7A V;  5KEE A;  2R92 H;  2GVB A;  4RHR A;  3DWP A;  3ND9 A;  1AEX A;  2E2J H;  1C7Y A;  2IW3 A;  3TEH B;  3QWN A;  3J80 E;  4LK1 C;  4IUP A;  5GAD C;  1PZK D;  3FKI B;  4O0A A;  4FDB A;  4FXK C;  2D0O A;  1X32 A;  4C3J H;  4JPB W;  4RHS A;  5EJW A;  5KYI A;  1R9T H;  4DA2 A;  4PZ8 A;  3S15 B;  3OMG A;  1CUK A;  1CSQ A;  3JAM E;  1YEZ A;  3T1Y Q;  3RMH A;  2VQE L;  1JCK B;  3TDQ A;  3V2T A;  1GM5 A;  3E3X A;  2UU9 Q;  1U0L A;  2YTY A;  2F0K A;  3ERO A;  4LF8 L;  1I4Q A;  2DJG C;  3D6W A;  3LWU A;  2I46 A;  4A3J H;  3R2T A;  4NB3 A;  1VQM A;  3L0O A;  5C6A A;  3S17 H;  1SNO A;  2VQF L;  1O7L A;  5BR8 L;  4MZ9 A;  1GVP A;  1PH9 A;  2VB3 X;  2JA7 G;  2BA0 A;  1L1O B;  3A7A B;  4K8J A;  1YIT A;  3KF8 B;  2CCZ A;  4LFB L;  3PO2 G;  1Z47 A;  1SAP A;  1OXS C;  4CKC A;  3DM3 A;  4GNX A;  3SDZ A;  1VQ6 A;  5AJ3 Q;  1JOQ A;  4EQ5 A;  2R3Z A;  4BA1 I;  2HUG A;  4IFD G;  2R7Z B;  5FJ8 H;  4HAE A;  1SFO B;  2JA8 H;  1EL0 A;  4EGV A;  2D9U A;  1V1P B;  5A2Q E;  2R7F A;  2KEC A;  5KYL A;  2WAQ B;  1HA6 A;  4X66 L;  3BDL A;  5M5W B;  2F0O A;  4NW2 A;  3BJU A;  1EEI D;  3U9S A;  3M4O H;  1I4R A;  1IL2 A;  1MD2 D;  1JMC A;  1HNZ L;  4F8M A;  3F2D A;  2B8F A;  1EEF D;  2EXD A;  1XNR L;  1STE A;  5EPK A;  4EQP A;  1ENF A;  3J81 L;  1UE6 A;  1RIP A;  1U5K A;  4BBS G;  1S4Z A;  3M4P A;  4X3K A;  2LSS A;  2MJ8 A;  3I2Z A;  2RDH A;  4L5R C;  2PQA A;  1EWI A;  1CM9 A;  2K75 A;  3PUY A;  4LNQ A;  2I07 B;  3GTP H;  1U4P A;  2EQS A;  4JI5 L;  3EFX D;  4JI4 L;  1PH1 A;  3HOZ G;  3T51 B;  1X6O A;  1L0W A;  4G4K A;  1JWS D;  2ES2 A;  4A93 B;  4Q5V A;  1JB3 A;  1BR9 A;  4G57 A;  4R4C A;  3HOZ B;  4CDF C;  4UP8 A;  2Z6K C;  3PUX A;  4KN7 C;  3HFZ B;  1F2Y A;  1NAP A;  1ONL A;  2Z8L A;  4PZ7 A;  3CCS A;  3HOU G;  3P7J A;  2AQ2 B;  1DD2 A;  3NTI A;  4DR5 Q;  1O7I A;  4RA8 A;  1YJW A;  1MBY A;  1Y8P B;  1CZW A;  1XTD A;  1LUZ A;  5EBD A;  2CH4 A;  4BY1 B;  1UNS A;  5IGB A;  4YY3 L;  1ZKO A;  4JI6 L;  1QZG A;  4ZUI A;  3QIA A;  3S1M B;  1C4Q A;  1WI5 A;  5K36 H;  2KQ3 A;  3A55 A;  2JA7 H;  1W3S A;  2LY7 A;  4N9P A;  2F0L A;  3T1H L;  2CH4 W;  1DOK A;  4N8F A;  3PO2 H;  2A1A A;  4HID A;  3MVV A;  2JXM B;  1X9N A;  3G71 A;  5D3D A;  2R7Z H;  1A15 A;  3SK5 A;  1VQK A;  3R8B A;  3WWV A;  1Q8I A;  5EPL A;  2EYH A;  4P2C B;  3FHW A;  1U9R A;  2B2Y A;  1SFO H;  4LF9 Q;  4CBV A;  4NP5 A;  2JA5 B;  4B3S L;  5I9P A;  3GTM B;  2PCF B;  4R9W A;  5EKK A;  3ZYY X;  2I5M X;  3J81 i;  5M5W H;  2XTI A;  2NUC A;  3UE0 A;  4LFC L;  1B9N A;  1EIG A;  4DFA A;  3HOW B;  4B9W A;  1VQE A;  3R93 A;  3VR4 A;  1Z9F A;  1TR5 A;  4AIM A;  2ZTD A;  3GP7 A;  4UPA A;  1XMQ L;  3EBE A;  1YNX A;  2PZW A;  1CHQ D;  1EY0 A;  5C44 G;  3F2C A;  4J6H A;  3NWT A;  2WKD A;  2K5D A;  1C8C A;  3OYY A;  2I5L X;  5IYD G;  4A3I B;  1HPC A;  2F0Q A;  4LF6 Q;  2Q2I A;  3KK7 A;  3DHQ A;  2UUC L;  2EYF A;  3CCV A;  2VL6 A;  3TSS A;  4GS3 A;  3Q23 A;  4L8J A;  1HJP A;  1KDA A;  3HOZ H;  2E76 C;  4KHZ A;  4JOI C;  2SNM A;  4OO1 I;  2Q8I B;  5IP7 H;  3D31 A;  2L11 A;  1B8A A;  2OQK A;  2JP1 A;  2G5D A;  1CK1 A;  4DAP A;  1RF2 D;  4KTA A;  3GV6 A;  1M90 C;  3DEO A;  2AMC B;  4QF4 A;  2VQE Q;  1SMX A;  2KHI A;  2F0I A;  3VA5 A;  4ZKC B;  1PTO D;  1Y1W G;  1VDZ A;  3I70 A;  1I4P A;  2VQF Q;  2EY2 A;  5BR8 Q;  2OXP A;  3I4L A;  3RLN A;  3NUC A;  4QL5 A;  3OWE B;  1H9S B;  4LFB Q;  1QWY A;  4DXG A;  4RWS C;  2JA5 H;  2L12 A;  2E8G A;  5BN5 A;  3GTM H;  4CJ0 B;  3H3V C;  1U4M A;  2VZA A;  3PF5 A;  4KY5 A;  1TII D;  2NBF A;  3HOW H;  3KJP A;  3MXU A;  2K33 A;  2PMZ E;  1JJG A;  3K80 C;  2NZO A;  5CGK A;  1EY4 A;  1SYF A;  4DKA C;  4YWM A;  1HHV A;  3J80 c;  1E22 A;  2RDF A;  1W6J A;  4MTN A;  5CV7 A;  4A3F B;  1I6H B;  1ESF A;  4K2L A;  2B29 A;  1PH7 A;  4IAL A;  2MPM A;  5JVH 3;  1FGU A;  3W3A A;  2B63 B;  1HNZ Q;  1R4P B;  1IBL L;  1EQQ A;  3M3Y H;  3JC6 6;  4DK3 C;  4I7A A;  2NN6 I;  1XNR Q;  1GUO A;  4EQN A;  4A3I H;  2N88 A;  3J7A 5;  1E1T A;  3ONA B;  1XWE A;  4ULL A;  5A35 A;  1I50 B;  4MN3 A;  5M3F B;  4E6I A;  5IYD H;  5CBE E;  2A68 D;  3F8T A;  1YNJ C;  3KYH C;  5ELE A;  1EYA A;  2K28 A;  3A7L A;  1KLU D;  1ML0 D;  1B2T A;  1EFI D;  1XX8 A;  4JI5 Q;  4KHV A;  4JI4 Q;  3C1F A;  2G9H D;  4HSP A;  2KHJ A;  1HQR D;  4UDU C;  5E1F A;  3J81 E;  2EVB A;  3SVM A;  4DNT B;  1LAC A;  3K5L A;  1H9M A;  3H94 A;  4G7Z C;  4RGT A;  1E3P A;  1EQR A;  3K7A H;  1VQO A;  3AMU A;  1S40 A;  3ULP A;  3HOY G;  2D5D A;  3OIQ A;  2L0C A;  4C56 C;  4YY3 Q;  3HG9 A;  2DY8 A;  1HR0 W;  4JI6 Q;  2E2D C;  1KC8 C;  3LX0 A;  5ELN A;  3CRL C;  3HOV B;  4RCN A;  2EYJ A;  3MXN A;  4BY7 G;  4H44 C;  3QG1 A;  4YCV A;  3K7U C;  1EFW A;  3PIO A;  3BZD B;  4IUQ A;  2XWB B;  3Q8D A;  3RR5 A;  4OIK A;  1ICF B;  2B2V A;  2CWA A;  4PQX A;  2F0M A;  3S2H B;  3VR2 A;  4GKJ L;  4B3S Q;  4F88 A;  4GNX C;  1BKB A;  4A3L G;  3T16 A;  3KF6 B;  3UDG A;  3OHX C;  1PLF A;  2JK8 A;  4A3F H;  3MEF A;  4LFC Q;  3AFP A;  3AEV A;  2B63 H;  4A3B B;  5J22 A;  1I4X A;  3BVG A;  5I2Y A;  5LHY 1;  2EY6 A;  1I50 H;  3KLS A;  5J39 A;  1HZA A;  5M3F H;  4HSV A;  3NPP A;  4JI0 Q;  3CQZ B;  1PH2 A;  3MC0 B;  1PXU A;  4YWL A;  5GAG C;  2R61 A;  4PMW A;  2Z9H A;  3W5O A;  4U68 A;  3RLO A;  1LTA D;  2ICI A;  1E2V A;  1DM0 B;  1PFM A;  4DXF A;  4DV6 L;  2UUC Q;  2LXJ A;  5D65 A;  2JA6 B;  3NXW A;  1JOK A;  5L37 A;  1X55 A;  2Z4I A;  1KAA A;  4QUF A;  1VQ9 A;  1ENA A;  1SJE D;  1F9Q A;  1EWC A;  1RD9 D;  2H5X A;  2PO4 A;  4AYB G;  4HIK A;  3E0J A;  4DR2 L;  5GAH C;  5CV5 A;  1JB7 A;  4K0K L;  1CFM A;  1AE2 A;  4MNO A;  1O7Y A;  3HOY H;  4HIO A;  4XQN A;  4UP9 A;  1HH2 P;  1G91 A;  3HOV H;  3HKZ G;  1K9M C;  1J9O A;  3RD4 A;  4X65 L;  3SR1 A;  3SK6 A;  3E9H A;  2LFN A;  4EX5 A;  2C35 B;  4C2M B;  3FEW X;  1A6X A;  1HUN A;  1SND A;  1X3Q A;  4DR4 L;  5I2X A;  4AYB E;  4KKU A;  5I9O A;  3SE0 A;  3S2H H;  2N3S A;  4NMZ A;  4KKS A;  4PNY A;  5K5P A;  3A0J A;  2BH8 A;  3KLW A;  1VQI A;  2KCM A;  2VS1 A;  4IPD A;  1G2T A;  4L5Q A;  3HEJ A;  3HKZ E;  2NZ1 D;  2B8G A;  1EWH A;  2SDF A;  1K0S A;  4L5S A;  1SE3 A;  4ZYS A;  3MWY W;  5GRO A;  2B2Y C;  3CCR A;  1NUC A;  3BU2 A;  1PRT C;  2UUB L;  4X3S A;  4DUZ Q;  1TY2 A;  1QOH A;  2L4N A;  5EQ0 A;  5ELO A;  4A3B H;  2EYM A;  5DEH A;  1GUT A;  1PH5 A;  3VYR A;  2O5J C;  2QF7 A;  4HJ9 A;  1S3O A;  4BS9 A;  2Y0S B;  3CQZ H;  5C3E B;  2WB1 E;  3M4Y A;  3L2P A;  4ZAI A;  2K5N A;  3NQT A;  2LXK A;  1IW7 D;  3TS2 A;  1IBL Q;  4CKB A;  4RH6 A;  4XYQ A;  1NJI C;  1SE4 A;  5EKL A;  2ZT9 C;  2B3G A;  2AQ1 B;  4HCS A;  5CMD A;  3SEB A;  2JA6 H;  4IUR A;  5JAV A;  1WD1 A;  4P71 A;  3SK8 A;  2ZM6 L;  1FNU A;  2RQX A;  2LS0 1;  3H3V I;  4KHP L;  2JEB I;  4DV2 L;  4XQQ A;  2X6L A;  3G6J B;  3I56 A;  4JI3 L;  5EKI A;  3NK9 A;  2K5W A;  3IFT A;  4RGN A;  4IPG A;  4NDX A;  5IYC G;  1MI2 A;  1VQ4 A;  2ICE C;  5IWA Q;  3H09 A;  3CD6 A;  1WOC A;  2TSS A;  5FO7 B;  1B3A A;  4C3J G;  4IQZ A;  1G2S A;  2VXW A;  1SE8 A;  4IO9 A;  2F0U A;  3I72 A;  3FVQ A;  2NYZ D;  5C4J B;  1TWA B;  4C2M H;  2JEA I;  2B2W C;  2BE5 D;  1Q1B A;  2VW9 A;  5I6Y A;  4A3D B;  1A2U A;  4B08 A;  1KAB A;  3TZD A;  1CKN B;  1UUP A;  1WCM B;  2BOS A;  2PZU A;  3K0Y A;  3RN2 A;  1LTB D;  1WYD A;  3STB D;  1EY6 A;  2NVQ B;  1XNQ L;  3K58 A;  1PFS A;  2HIX A;  2XN9 C;  2L15 A;  4H0L C;  4XYO A;  3RZO B;  1H9K A;  3NQI A;  5CV4 A;  2CW0 C;  2IL8 A;  4GKJ Q;  2ZXO A;  2KJX A;  5TSS A;  2AHO B;  1VQC A;  1HNW L;  3FP9 A;  5M5X B;  4PG3 A;  5EBC A;  1N33 L;  4CDD C;  2N49 A;  3KLS X;  1YBY A;  4G7H C;  4IUU A;  1L0X B;  4ZRZ A;  5FJ8 G;  1E2W A;  5EPJ A;  2JA8 G;  2B39 A;  1B1Z A;  4RFB A;  1EZ6 A;  1LTT D;  3I90 A;  4DR6 L;  2SEB D;  2KEN A;  2RSN A;  1SMY D;  1E24 A;  1DOM A;  1LAB A;  3FPU B;  3D3R A;  5GQO A;  3SK4 A;  4APV A;  1EQT A;  3J81 c;  3DEP A;  5JEA G;  1ILP A;  3QB3 A;  4X6A H;  2F0T A;  3GV3 A;  2NZH A;  4RKL A;  2JE6 I;  4IUN A;  4FF1 A;  2SNS A;  4DV6 Q;  2UXD L;  1KQS A;  4IOC A;  4GLA C;  2OT2 A;  3ER0 A;  4TKO B;  2QEX A;  3FKI G;  2O2L D;  3IAY A;  4DV4 L;  2NVT B;  2PYK A;  3H6M A;  2JYO A;  5IYC H;  4HJ5 A;  2K05 A;  2M9V A;  3WDN A;  1SEB D;  4KV6 A;  4ZK9 B;  2HHH L;  2CHB D;  4N9T A;  4B3M L;  1TY0 A;  2HIV A;  2PQE A;  2VY3 A;  3D0F A;  4GOP C;  1D2B A;  4DR2 Q;  1ET6 A;  1VQJ A;  2EJM A;  1A3V A;  1ESR A;  1TWA H;  5C4J H;  4DUY L;  3KUP A;  3SXH A;  4K0K Q;  1AE3 A;  5EGT A;  3W2D A;  5IP9 H;  5M3M B;  1HR0 Q;  3HOX B;  4UAI A;  2XSC A;  4Y52 H;  3CU7 A;  1BCP C;  1YHB A;  3I8Z A;  4DNR B;  4FF4 A;  3LGJ A;  3CCL A;  5CBA E;  3K0X A;  4LF7 L;  2NVQ H;  4A3K B;  3TQY A;  2FXQ A;  3G7L A;  4DR4 Q;  1LV9 A;  1TWC B;  1EY8 A;  1UEA B;  2F0E A;  2C9O A;  4DR1 L;  3U58 A;  1FGB D;  2K01 A;  5K36 G;  4FYD A;  1MSH A;  3QOJ A;  1BNZ A;  1YJN A;  3A74 A;  5M5X H;  1HZC A;  1JC7 A;  1B44 D;  4GOP B;  4GN3 B;  2B2V C;  1XPO A;  2VUM B;  1LM0 A;  4UHV A;  2R7Z G;  5ISR A;  2UUB Q;  4CDC C;  2YYZ A;  4HMI A;  1BCP D;  1D6E C;  2DNC A;  4DU9 A;  1SYD A;  4A3G B;  3ULJ A;  4OIJ A;  3PO3 B;  1KRT A;  1G8Z D;  1TWG B;  1FNW A;  2PI2 A;  5LL6 S;  1Q90 A;  2WAQ G;  1Z6H A;  2Q2T A;  4JI2 Q;  3UDX A;  4DV5 L;  3HP3 A;  5C3X A;  5LL6 X;  3CC7 A;  1QJO A;  2AWO A;  2CFM A;  3BVM A;  3Q22 A;  3M9B A;  5JEA H;  1RCV D;  1G6P A;  1D1K A;  2MHV A;  3T56 B;  5LMU L;  3OWF A;  4ID6 A;  2DJF C;  4OL7 A;  2K7V A;  2Z4H A;  1BOS A;  4NXN Q;  3C2P A;  2ZM6 Q;  5IYB H;  1HCZ A;  4ABN A;  3CCJ A;  4POG A;  1WTR A;  4KHP Q;  1F9R A;  3VYS A;  4DV2 Q;  3FKI H;  1W2B A;  1AW7 A;  5JOB A;  3W1B A;  5E4X A;  4JI3 Q;  2F0S A;  2F0P A;  1SSO A;  1MHW C;  2PNH A;  4QCL A;  3QO2 A;  4A93 G;  3S15 H;  3CCE A;  3DXJ C;  2ENB A;  2RHS B;  1U4R A;  4I65 A;  2K5Q A;  1KNA A;  1L2F A;  1EIY B;  5FOB B;  1IHZ A;  2CKZ B;  3D4W A;  5M3M H;  4DV3 L;  5IP7 G;  3TP8 A;  3V96 A;  4LJZ C;  4QMG A;  3GTO B;  4A3K H;  5KIX A;  4BY1 G;  3K81 C;  3KDF A;  4C3H B;  3KOJ A;  3IFD A;  1TWC H;  2KA7 A;  1S5E D;  2F0J A;  5GAE C;  1VQH A;  5DNF A;  3NE5 B;  1P16 A;  2F3I A;  1ASZ A;  1ET9 A;  3CF5 A;  1PH8 A;  4RGO S;  1PYB A;  2F0V A;  5E3F A;  3MAQ A;  4K14 A;  5EAY A;  2VUM H;  4U67 3;  3OW7 A;  4DR7 Q;  1LTG D;  3LNN A;  1F2L A;  3MEH A;  3DM1 A;  1WTW A;  1BXT A;  1K8M A;  5C0X I;  2F0N A;  2JA5 G;  4B3R L;  5C0X J;  4J15 A;  4A3G H;  3I4N B;  3PO3 H;  1A3T A;  1TWG H;  4KI0 A;  1LYL A;  4DR3 L;  1OXX K;  2EJF C;  3F1Z A;  1WD0 A;  3I4M B;  3J81 j;  4AQY L;  2E2I B;  3HOW G;  4HIM A;  2QA4 A;  5NUC A;  4X64 L;  3BDC A;  4DR6 Q;  1X65 A;  1KLG D;  3S14 B;  2JA9 A;  2NN6 H;  2X6G A;  1RDP D;  1YJ9 A;  3KBG A;  4JVZ A;  3E5S A;  2F0F A;  5FLM H;  3J7Z C;  2UXC Q;  1F9S A;  4CJ2 C;  1BVS A;  2GN5 A;  1EIF A;  4XTC S;  2OF1 A;  4P72 A;  3TP6 A;  1D1I A;  4KLK A;  3S1Q B;  4A3I G;  1VQ8 A;  1PVO A;  4R1J A;  2UXD Q;  5JJK A;  4C3I B;  1PTO C;  4DV4 Q;  1CKM A;  2KCN A;  4A93 H;  4CDE C;  1L0Y B;  2HD3 A;  2ZXR A;  3NEM A;  4AH6 A;  3GTO H;  3NBH B;  4V19 0;  3H0G B;  1GHJ A;  1IXR A;  4DUY Q;  4CHT B;  2A6E D;  4C3H H;  1CKN A;  4BY1 H;  3CPW A;  4LF5 L;  4FNF A;  4KJN A;  3S1M H;  2QCP X;  1I4G A;  1UE5 A;  2MO1 A;  2FFK B;  1TWF B;  1KL9 A;  2CQO A;  4DAV A;  3VR6 A;  3CXC A;  4LF8 Q;  3KLR A;  5M5Y B;  4LW1 A;  4LF4 L;  1A63 A;  1E0B A;  2D0P A;  2XWJ B;  4DR1 Q;  2XIW A;  4JC0 A;  2KBN A;  1VS0 A;  2MGS A;  3D8G A;  4R8N A;  3I4N H;  1XYI A;  4QQB X;  1DON A;  1Y8N B;  2QDL A;  5E7N A;  3I4M H;  1EOT A;  4S3S A;  5DAU A;  1PTO F;  4A75 A;  1Q82 C;  5CC4 A;  2E2I H;  2K32 A;  2A68 C;  3FRP B;  3PCO B;  3PUZ A;  1N34 L;  5C3W A;  3VR3 A;  4JW0 A;  3M85 A;  4HCE A;  4A3F G;  4LMQ D;  4L63 B;  4ALP A;  1YZ6 A;  1PHJ A;  4DV5 Q;  1LT6 D;  4JBK A;  1I6V C;  4RG1 A;  3PV0 A;  3V05 A;  2B63 G;  3OW2 A;  4X66 Q;  1F9P A;  1D8L A;  3B6Y A;  5E4W C;  5D3I B;  4A4I A;  3S1Q H;  5IT9 L;  1BBX C;  2N55 A;  1VQL A;  5M3F G;  1A8V A;  2G9D A;  2L55 A;  3G4S A;  4JI7 L;  4IFD I;  1VQA A;  4IFD J;  5CV8 A;  4YHH L;  4OON A;  2B2T A;  1Z7T A;  2NVX B;  4QIW B;  1RJT A;  3RUZ A;  4HJ8 A;  4QGU A;  1QUQ B;  4EQO A;  1F2Z A;  3RLF A;  4DV3 Q;  4R8I A;  4DNI A;  2R7D A;  5IOD A;  2PW5 A;  1QNU A;  2A5H A;  3GO5 A;  1TWF H;  3AB9 A;  5D14 A;  1SNQ A;  1CHP D;  2JSO A;  2ZTE A;  4JI1 L;  1L1O A;  4KMU C;  4WOR A;  2F0D A;  5I6W A;  3KF8 A;  4DV7 L;  1STG A;  3MA2 B;  3HOV G;  2F4I A;  4HJA A;  2JJQ A;  3CRK C;  4DN4 M;  2KCT A;  5HY6 A;  3VYU A;  4KY7 A;  1B70 B;  1NR2 A;  1OXV A;  1X3E A;  3T1H Q;  3BYT B;  3E9I A;  2Q8R E;  1IBM L;  2B2U A;  4FF2 A;  5T1G A;  1SNM A;  1SRU A;  4B3R Q;  2RSO A;  3U50 C;  1DGS A;  1V1P A;  2FMM A;  2A6H D;  4DR3 Q;  1Q46 A;  2IX0 A;  2SOB A;  3UE1 A;  4AQY Q;  1IYJ B;  1I6H H;  3RZD B;  4X64 Q;  1UAP A;  4A3B G;  4TVA B;  3MZ5 A;  4A3M B;  4KY6 A;  2M2L A;  1XMO L;  4Y7N B;  2EYO A;  3BYY B;  3SGI A;  3F2B A;  3Q24 A;  2ZJQ A;  1HRJ A;  4JBM A;  1IL8 A;  3OMC A;  1XMQ Q;  1NR4 A;  3H3V H;  1XJV A;  1X3G A;  2DUD A;  4B9X A;  4ME5 A;  4YWK A;  2NVX H; 
#chains in the Genus database with same CATH homology
 3BG3 A;  1CI3 M;  1SNP A;  1AZP A;  2LKV A;  2L9H A;  1CZG A;  3T13 A;  3K59 A;  3X3M A;  3EVQ A;  1VCI A;  1CA6 A;  3CKI B;  4HTH A;  5KND A;  4CJ1 B;  1V8Q A;  1HTL D;  2R93 B;  4G7O C;  5FO8 B;  1V1O A;  1ZXT A;  3JAM L;  1JQY D;  1X3P A;  5ELC A;  1KNE A;  3PMF A;  4FP5 D;  5C5L A;  1CQV A;  2KED A;  2NVY B;  1SYE A;  2J7Z A;  1TS2 A;  2L5T A;  5COR A;  4OGQ C;  1VMP A;  2RKS A;  1AFP A;  1IW7 C;  4BBR B;  4HMJ A;  2QIL A;  1YNN D;  1FD7 D;  5T1I A;  3SHL A;  1JIC A;  2WAC A;  5ELB A;  3DMU A;  2IT1 A;  1BDO A;  1OXU A;  3FPP A;  5AFW A;  3S16 B;  5G3L D;  5A2Q L;  2EYL A;  1PZJ D;  4K8I A;  1EY5 A;  5ELD A;  2WB1 B;  2H1E A;  1B9M A;  1Y69 U;  1B4O A;  3R3O A;  2AUJ D;  1W6K A;  1S5D D;  2BE5 C;  2VNU D;  2F3W A;  1S5B D;  2PZT A;  4A3E B;  1PRT B;  2D2C C;  2MP1 A;  2KCC A;  1AP0 A;  3PUV A;  3TME A;  3EJI A;  2PW7 A;  3O13 A;  1TS3 A;  5IT9 E;  1WVL A;  2CQA A;  1PDQ A;  3I73 A;  1T5X D;  3IKJ A;  4BWG B;  2EY5 A;  1PRT F;  1ZYR D;  3GTJ B;  3VA7 A;  1GUS A;  2QDB A;  3BVZ A;  5IGD A;  4K5W A;  2L1B A;  2R92 B;  1H9S A;  4WRD A;  2E2J B;  2XNA C;  5CR3 A;  3MXG A;  1SMY C;  5I4D A;  3GTG B;  5FLX L;  2QEJ C;  5FO9 B;  1E2Z A;  5J1Z A;  2IPK D;  3E6Z X;  3MFY A;  2A74 C;  2RBM A;  3T53 B;  4IZ8 A;  4IUV A;  1HQM C;  1AZQ A;  4JBW A;  1MGS A;  3NTK A;  4A3J B;  3U9O A;  4M1U B;  3I91 A;  3QJY A;  2WKC A;  3TN2 A;  5JPN C;  1ICW A;  1QCB D;  1HFG A;  1SJH D;  1C48 A;  2F0G A;  4HED A;  4J1M A;  2WII B;  2ZXP A;  2FMC A;  4C1N I;  3S2D B;  2IWH A;  1AN8 A;  4K6D A;  4MHE A;  4TQU S;  4X3T A;  4HR7 B;  1A2T A;  1LT5 D;  4OO1 G;  1CA5 A;  1IYU A;  2KUM A;  1TWH B;  4O42 A;  4LAA A;  1IKL A;  2BA1 A;  1H9R A;  4JK1 C;  4NKL A;  2EE1 A;  4IUT A;  3C1E A;  2XRS D;  1QNK A;  2F0W A;  2HQE A;  1A3U A;  1TS5 A;  2X69 A;  1OO9 B;  1PMR A;  4K2K A;  1HTP A;  4XIG S;  1S5C D;  1KDB A;  1PZI D;  1ZEQ X;  4EVO A;  1GHK A;  3GTP B;  5HGT A;  2KEE A;  5C0X H;  1GUG A;  3D4R A;  2A69 C;  2B2U C;  1SYC A;  1HA5 A;  4PMC A;  2NWG A;  3URY A;  3BDO A;  3C3L A;  5BN4 A;  5IOC A;  4H7B A;  1BCP B;  2DNE A;  1EY9 A;  1LLR D;  3HS0 C;  3PIP 3;  4HN7 A;  3DUZ A;  1B53 A;  5IGE A;  2JA7 B;  3D4D A;  1K8O A;  1S5F D;  2NN6 G;  1H9J A;  3PO2 B;  1XTC D;  1BCP F;  2A69 D;  3J7A F;  3HZX A;  1PYW D;  1QIL A;  1VMC A;  1TQO A;  1WTX A;  1O80 A;  3ND8 A;  4RCO A;  2LMC B;  4IN3 A;  1M4V A;  4OO1 H;  1EY7 A;  4OHJ A;  1FNV A;  1RTN A;  3OOC A;  1J8I A;  1JOO A;  5C4X B;  2FJ2 A;  1DJR D;  2OEO A;  2AQ3 B;  1D5X C;  1SNC A;  4C3H G;  4BBS B;  2KVM A;  1WTQ A;  1SBB B;  2BDO A;  4K5V A;  4RKB A;  2IJ0 A;  1ROD A;  5BN3 A;  5COY A;  2AWN A;  3VYT A;  1R4Q B;  1DZ1 A;  4ZLT F;  3NP8 A;  1CT1 D;  2IX3 A;  4Q0F A;  4FVM A;  2HDM A;  5IGC A;  3HOU B;  3H91 A;  1CTM A;  3K57 A;  3T4A C;  2BCO A;  3UI2 A;  4F87 A;  1STH A;  3S1N B;  3OIP A;  1MSG A;  5KNC A;  4FXD A;  4KN4 C;  3TZU A;  1JOR A;  1EYC A;  5CV6 A;  5FLX E;  3R2I A;  3CHB D;  2O5I C;  3IL8 A;  2J0T D;  3TP5 A;  4IFD H;  1I3Q B;  1G29 1;  2A6E C;  3NWS A;  4FXG C;  4KD3 A;  2CVR A;  2V4D A;  2E74 C;  1SYG A;  2O4X A;  3VR5 A;  4C3I G;  4CKE A;  3ERQ A;  1ILQ A;  1KDC A;  2C5C A;  2BDN A;  1HUM A;  4RGM A;  4V0B A;  2H4O A;  3M3Y B;  5JEA J;  5JVG 3;  2M00 A;  3GTK B;  2EDG A;  3NSW A;  5C44 B;  1TT2 A;  5C5M A;  1LTR D;  1QG7 A;  3Q0A A;  4J8Q A;  1TS4 A;  5IGF A;  1SE2 A;  1F77 A;  2EPB A;  4KD4 A;  5ELF A;  2PPB C;  3A8I E;  2WIN B;  2WP8 J;  1PTO B;  1Q12 A;  2NTS A;  1GUW A;  3MFG A;  2K04 A;  2B2W A;  5KGU A;  1RHP A;  3A54 A;  3K7A B;  1BF4 A;  5C4H A;  2FHT A;  2MUY A;  1NCV A;  1LTS D;  2J4X A;  3K5N A;  1Y1W B;  1K83 B;  3P75 A;  4GZY C;  3J7Y W;  2PMZ B;  1OXT A;  2D62 A;  2VB2 X;  4XT1 B;  4X3U A;  4KJO A;  3F2U A;  4FO2 A;  1FR3 A;  1JE4 A;  3HRZ C;  1STB A;  3TBI B;  1DCZ A;  3NHH A;  1VF5 C;  2IX1 A;  1EIH A;  1HXY D;  4PV1 C;  3EQL C;  1Y8O B;  3L9A X;  3BS1 A;  5FK9 C;  4TSS A;  5KRU A;  4MIU A;  2F1M A;  2A73 B;  3OSO A;  3L7Z C;  4XXE A;  2A6H C;  4DF7 A;  3GTQ B;  3QOL A;  1FYC A;  5JPM C;  5HUR A;  3NTH A;  2QKI C;  1PTO H;  4DK0 A;  1G6Z A;  3D6C A;  1V43 A;  1Y1V B;  3A8K E;  3K6O A;  1VF7 A;  1GOZ A;  1PFN A;  1M8A A;  1TU2 B;  1SDF A;  2TMP A;  2YU9 B;  1SXT A;  4K5X A;  1YNJ D;  2GA4 B;  2XRQ D;  3HOY B;  3GD7 A;  1TVX A;  4DK1 A;  3Q6S A;  4ZKB B;  4BY7 B;  1IYV A;  2HDL A;  2K6A A;  4QUC A;  4BA2 I;  4XT3 B;  4L6T B;  1XXG A;  1ENC A;  4H13 C;  4ZUJ A;  5CYU A;  4CGY B;  3A56 A;  1DOL A;  2E2H B;  3PUW A;  1GXD C;  2XVS A;  3K5O A;  2WV6 D;  5C4Z A;  2F03 A;  1WTV A;  2E75 C;  3AU7 A;  3J80 L;  1STY A;  2RA4 A;  4I7Z C;  3NBI A;  2EYP A;  1EU4 A;  3LWE A;  1STN A;  4ZQ3 A;  5IGG A;  1QE6 A;  4YIJ A;  5DM6 3;  1HFN A;  1QB5 D;  1D5Z C;  1YNN C;  2F3V A;  3K5M A;  4ILW A;  1SYB A;  4DGZ A;  3P1H A;  1BO0 A;  3N52 A;  2NTT A;  3FMC A;  1RKN A;  1GJX A;  1GUN A;  2AUK A;  1LT3 D;  3WOF A;  5FKA C;  1LO5 D;  1BUV T;  1DXM A;  3X3N A;  3P20 A;  2Z1C A;  4AYB B;  1JWM D;  1Q3L A;  3GTL B;  5M9O A;  5IIF A;  1KTK A;  3FDT A;  4KKT A;  2F0H A;  3HKZ B;  4RAU C;  3DWQ A;  3S1R B;  4K6L A;  1II3 A;  1I4H A;  3ITP A;  4KK7 A;  2Q8T A;  2FIN B;  3L3O C;  5CV9 A;  1ZYR C;  3KBX A;  1IKM A;  1JR0 D;  5G3L F;  5JJZ A;  4Z9C B;  3DWA A;  2K03 A;  1U4L A;  4C1N K;  2HCI A;  4O1N A;  3NBH A;  3PIO 3;  1NSN S;  2R6G A;  4WJW A;  1O78 A;  2NB0 A;  1TKW B;  4TRD A;  1D5M C;  3A8J E;  1B50 A;  2ID0 A;  1STA A;  4F7X A;  1EU3 A;  3I3C A;  1CQF A;  4WFN 3;  1PRT D;  3GQB A;  1BQQ T;  2EJG C;  2K1B A;  1Q1E A;  3EA6 A;  1T5E A;  3M7N A;  1LTI D;  5DM7 3;  4XQJ A;  2EOT A;  4QB4 A;  2EZV A;  3C46 A;  1PFB A;  3WOE A;  5C0X G;  4C3J B;  1R9T B;  2HCC A;  3MXP A;  2RVL A;  2PNR C;  1O7Z A;  3MTS A;  1EQV A;  4DAY A;  4ODG A;  1EZ8 A;  3S9W A;  5KNB A;  3S17 B;  5F2D A;  4PMB A;  1F2M A;  2KHS A;  1LT4 D;  2DN8 A;  2EXZ A;  4M8A A;  2RDG A;  1DYQ A;  1RTO A;  2B2T C;  3M7G A;  2JA8 B;  2EY1 A;  2DY7 A;  3N6R A;  1JWU D;  2KOL A;  2CW0 D;  3TP7 A;  1WTO A;  3M4O B;  3HGB A;  1EYD A;  4XDX A;  4FF3 A;  1WTP A;  3MHB A;  3OPO A;  3J7A V;  5KEE A;  4RHR A;  3DWP A;  3ND9 A;  1AEX A;  2IW3 A;  3QWN A;  3J80 E;  4LK1 C;  4IUP A;  1PZK D;  3FKI B;  4FXK C;  1X32 A;  5EJW A;  4RHS A;  5KYI A;  4DA2 A;  3S15 B;  3OMG A;  3JAM E;  3RMH A;  1JCK B;  3TDQ A;  3V2T A;  2F0K A;  3ERO A;  1I4Q A;  3D6W A;  3LWU A;  2I46 A;  3R2T A;  5C6A A;  1SNO A;  1O7L A;  2VB3 X;  2BA0 A;  3A7A B;  4K8J A;  1Z47 A;  1SAP A;  1OXS C;  4CKC A;  3SDZ A;  1JOQ A;  2R3Z A;  4BA1 I;  2HUG A;  4IFD G;  2R7Z B;  4HAE A;  1SFO B;  1EL0 A;  4EGV A;  2D9U A;  1V1P B;  5A2Q E;  2KEC A;  5KYL A;  2WAQ B;  1HA6 A;  5M5W B;  3BDL A;  2F0O A;  4NW2 A;  1EEI D;  3U9S A;  1I4R A;  1MD2 D;  4F8M A;  2B8F A;  1EEF D;  1STE A;  5EPK A;  4EQP A;  1ENF A;  3J81 L;  1S4Z A;  4X3K A;  2MJ8 A;  2RDH A;  1CM9 A;  3PUY A;  2I07 B;  1U4P A;  3EFX D;  3T51 B;  4G4K A;  1JWS D;  4A93 B;  4Q5V A;  1JB3 A;  1BR9 A;  4G57 A;  3HOZ B;  3PUX A;  4KN7 C;  1F2Y A;  1NAP A;  1ONL A;  2Z8L A;  3P7J A;  2AQ2 B;  1DD2 A;  3NTI A;  4RA8 A;  1MBY A;  1Y8P B;  1CZW A;  5EBD A;  4BY1 B;  1UNS A;  5IGB A;  1ZKO A;  4ZUI A;  3QIA A;  3S1M B;  1C4Q A;  5K36 H;  2KQ3 A;  3A55 A;  2LY7 A;  4N9P A;  2F0L A;  1DOK A;  3MVV A;  2JXM B;  5D3D A;  1A15 A;  3SK5 A;  3R8B A;  1Q8I A;  5EPL A;  2EYH A;  4P2C B;  1U9R A;  2B2Y A;  4CBV A;  4NP5 A;  2JA5 B;  5I9P A;  3GTM B;  2PCF B;  4R9W A;  5EKK A;  3ZYY X;  2NUC A;  1B9N A;  1EIG A;  4DFA A;  3HOW B;  4B9W A;  3R93 A;  3VR4 A;  1TR5 A;  3GP7 A;  2PZW A;  1CHQ D;  1EY0 A;  4J6H A;  3NWT A;  2WKD A;  2K5D A;  1C8C A;  4A3I B;  1HPC A;  2F0Q A;  3KK7 A;  3DHQ A;  2EYF A;  3TSS A;  3Q23 A;  4L8J A;  1KDA A;  2E76 C;  4KHZ A;  2SNM A;  4OO1 I;  2Q8I B;  3D31 A;  2L11 A;  2JP1 A;  4DAP A;  1CK1 A;  1RF2 D;  4KTA A;  3GV6 A;  3DEO A;  4QF4 A;  2F0I A;  3VA5 A;  4ZKC B;  1PTO D;  1VDZ A;  3I70 A;  1I4P A;  2EY2 A;  2OXP A;  3I4L A;  3NUC A;  3OWE B;  1H9S B;  1QWY A;  4DXG A;  4RWS C;  2L12 A;  5BN5 A;  4CJ0 B;  3H3V C;  1U4M A;  4KY5 A;  1TII D;  2NBF A;  3MXU A;  2K33 A;  5CGK A;  1EY4 A;  1SYF A;  1HHV A;  2RDF A;  1W6J A;  5CV7 A;  4A3F B;  1I6H B;  1ESF A;  4K2L A;  4IAL A;  2MPM A;  5JVH 3;  3W3A A;  2B63 B;  1R4P B;  2NN6 I;  1GUO A;  4EQN A;  2N88 A;  3ONA B;  1XWE A;  4ULL A;  5A35 A;  1I50 B;  4MN3 A;  5M3F B;  4E6I A;  5CBE E;  2A68 D;  1YNJ C;  5ELE A;  1EYA A;  2K28 A;  3A7L A;  1KLU D;  1ML0 D;  1B2T A;  1EFI D;  1XX8 A;  4KHV A;  3C1F A;  2G9H D;  4HSP A;  1HQR D;  4UDU C;  5E1F A;  3J81 E;  2EVB A;  3SVM A;  4DNT B;  1LAC A;  3K5L A;  1H9M A;  3H94 A;  4G7Z C;  4RGT A;  3AMU A;  2D5D A;  3OIQ A;  2L0C A;  4C56 C;  3HG9 A;  2DY8 A;  2E2D C;  3LX0 A;  3CRL C;  3HOV B;  4RCN A;  2EYJ A;  3MXN A;  4H44 C;  3QG1 A;  3BZD B;  4IUQ A;  2XWB B;  4OIK A;  2B2V A;  4PQX A;  2F0M A;  3S2H B;  3VR2 A;  4F88 A;  3T16 A;  3OHX C;  1PLF A;  4A3B B;  5J22 A;  1I4X A;  3BVG A;  5I2Y A;  5LHY 1;  2EY6 A;  5J39 A;  3KLS A;  4HSV A;  3NPP A;  3CQZ B;  3MC0 B;  1PXU A;  2R61 A;  4PMW A;  4U68 A;  1LTA D;  2ICI A;  1E2V A;  1DM0 B;  1PFM A;  4DXF A;  5D65 A;  2JA6 B;  3NXW A;  1JOK A;  2Z4I A;  1KAA A;  4QUF A;  1ENA A;  1SJE D;  1F9Q A;  1EWC A;  1RD9 D;  2PO4 A;  3E0J A;  5CV5 A;  1CFM A;  1O7Y A;  4XQN A;  1G91 A;  1J9O A;  3RD4 A;  3SR1 A;  3SK6 A;  2LFN A;  1A6X A;  4C2M B;  3FEW X;  1HUN A;  1SND A;  1X3Q A;  5I2X A;  4KKU A;  5I9O A;  3SE0 A;  4NMZ A;  4KKS A;  4PNY A;  5K5P A;  1G2T A;  3HEJ A;  2NZ1 D;  2B8G A;  1EWH A;  2SDF A;  1SE3 A;  4ZYS A;  3MWY W;  2B2Y C;  1NUC A;  1PRT C;  4X3S A;  1TY2 A;  1QOH A;  2L4N A;  5EQ0 A;  2EYM A;  5DEH A;  1GUT A;  3VYR A;  2O5J C;  2QF7 A;  4BS9 A;  2Y0S B;  5C3E B;  3M4Y A;  4ZAI A;  3NQT A;  1IW7 D;  4CKB A;  4RH6 A;  4XYQ A;  1SE4 A;  5EKL A;  2ZT9 C;  2AQ1 B;  4HCS A;  5CMD A;  3SEB A;  4IUR A;  5JAV A;  1WD1 A;  3SK8 A;  1FNU A;  2RQX A;  2LS0 1;  2JEB I;  4XQQ A;  2X6L A;  3G6J B;  5EKI A;  3NK9 A;  2K5W A;  3IFT A;  4RGN A;  4NDX A;  1MI2 A;  2ICE C;  3H09 A;  2TSS A;  5FO7 B;  1B3A A;  4C3J G;  4IQZ A;  1G2S A;  2VXW A;  2F0U A;  3I72 A;  3FVQ A;  2NYZ D;  5C4J B;  1TWA B;  2JEA I;  2B2W C;  2BE5 D;  1Q1B A;  5I6Y A;  4A3D B;  1A2U A;  4B08 A;  1KAB A;  3TZD A;  1UUP A;  1WCM B;  2PZU A;  2BOS A;  3K0Y A;  1LTB D;  1EY6 A;  2NVQ B;  3K58 A;  2XN9 C;  4H0L C;  4XYO A;  3RZO B;  1H9K A;  3NQI A;  5CV4 A;  2CW0 C;  2IL8 A;  2ZXO A;  2KJX A;  5TSS A;  5M5X B;  5EBC A;  3KLS X;  4G7H C;  4IUU A;  1L0X B;  4ZRZ A;  1E2W A;  5EPJ A;  2B39 A;  1B1Z A;  4RFB A;  1EZ6 A;  1LTT D;  3I90 A;  2SEB D;  2RSN A;  1SMY D;  1DOM A;  1LAB A;  3FPU B;  3D3R A;  3SK4 A;  1EQT A;  3DEP A;  5JEA G;  1ILP A;  3QB3 A;  2F0T A;  3GV3 A;  4RKL A;  2JE6 I;  4IUN A;  4FF1 A;  2SNS A;  2OT2 A;  4TKO B;  2O2L D;  3IAY A;  2NVT B;  2PYK A;  3H6M A;  2JYO A;  2K05 A;  2M9V A;  3WDN A;  1SEB D;  4KV6 A;  4ZK9 B;  2CHB D;  4N9T A;  1TY0 A;  2PQE A;  1D2B A;  1ET6 A;  2EJM A;  1A3V A;  1ESR A;  3KUP A;  3SXH A;  5EGT A;  3W2D A;  5M3M B;  3HOX B;  4UAI A;  2XSC A;  3CU7 A;  1BCP C;  3I8Z A;  4DNR B;  4FF4 A;  5CBA E;  4A3K B;  3G7L A;  1LV9 A;  1TWC B;  1EY8 A;  1UEA B;  2F0E A;  2C9O A;  1FGB D;  2K01 A;  5K36 G;  4FYD A;  1MSH A;  3QOJ A;  1BNZ A;  1JC7 A;  1B44 D;  2B2V C;  2VUM B;  5ISR A;  2YYZ A;  4HMI A;  1BCP D;  1D6E C;  2DNC A;  4DU9 A;  1SYD A;  4A3G B;  4OIJ A;  3PO3 B;  1G8Z D;  1TWG B;  1FNW A;  5LL6 S;  1Q90 A;  1Z6H A;  3HP3 A;  5C3X A;  5LL6 X;  1QJO A;  2AWO A;  3BVM A;  3Q22 A;  5JEA H;  1RCV D;  1D1K A;  2MHV A;  3T56 B;  3OWF A;  4ID6 A;  4OL7 A;  2K7V A;  2Z4H A;  1BOS A;  3C2P A;  1HCZ A;  4ABN A;  1WTR A;  1F9R A;  3VYS A;  1AW7 A;  5JOB A;  5E4X A;  2F0S A;  2F0P A;  1SSO A;  4QCL A;  3QO2 A;  3DXJ C;  2ENB A;  1U4R A;  4I65 A;  2K5Q A;  1KNA A;  5FOB B;  1IHZ A;  3D4W A;  3TP8 A;  3V96 A;  4LJZ C;  4QMG A;  3GTO B;  5KIX A;  4C3H B;  3IFD A;  2KA7 A;  1S5E D;  2F0J A;  5DNF A;  3NE5 B;  1ET9 A;  4RGO S;  2F0V A;  5E3F A;  3MAQ A;  4K14 A;  4U67 3;  3OW7 A;  1LTG D;  3LNN A;  1F2L A;  3MEH A;  3DM1 A;  1WTW A;  1BXT A;  1K8M A;  5C0X I;  2F0N A;  5C0X J;  3I4N B;  1A3T A;  4KI0 A;  1OXX K;  2EJF C;  1WD0 A;  3I4M B;  2E2I B;  5NUC A;  3BDC A;  1KLG D;  3S14 B;  2NN6 H;  2X6G A;  1RDP D;  3KBG A;  3E5S A;  2F0F A;  1F9S A;  4CJ2 C;  4XTC S;  2OF1 A;  3TP6 A;  1D1I A;  3S1Q B;  4C3I B;  1PTO C;  2KCN A;  1L0Y B;  2ZXR A;  4V19 0;  3H0G B;  1GHJ A;  4CHT B;  2A6E D;  4FNF A;  4KJN A;  2QCP X;  1I4G A;  2FFK B;  1TWF B;  4DAV A;  3VR6 A;  3KLR A;  5M5Y B;  1E0B A;  2XWJ B;  2XIW A;  2MGS A;  3D8G A;  4R8N A;  1XYI A;  1DON A;  1Y8N B;  1EOT A;  4S3S A;  5DAU A;  1PTO F;  5CC4 A;  2K32 A;  2A68 C;  3FRP B;  3PUZ A;  5C3W A;  3VR3 A;  3M85 A;  4HCE A;  4LMQ D;  4L63 B;  1LT6 D;  1I6V C;  3PV0 A;  3V05 A;  1F9P A;  5E4W C;  5D3I B;  5IT9 L;  1BBX C;  2N55 A;  2G9D A;  2L55 A;  4IFD I;  4IFD J;  5CV8 A;  2B2T A;  1Z7T A;  2NVX B;  4QIW B;  1RJT A;  3RUZ A;  4EQO A;  1F2Z A;  3RLF A;  4R8I A;  5IOD A;  2PW5 A;  1QNU A;  2A5H A;  3GO5 A;  3AB9 A;  5D14 A;  1SNQ A;  1CHP D;  2JSO A;  4KMU C;  4WOR A;  2F0D A;  5I6W A;  3KF8 A;  1STG A;  3MA2 B;  2F4I A;  3CRK C;  4DN4 M;  3VYU A;  4KY7 A;  1NR2 A;  1OXV A;  3BYT B;  2Q8R E;  2B2U A;  4FF2 A;  5T1G A;  1SNM A;  2RSO A;  1V1P A;  2FMM A;  2A6H D;  2IX0 A;  2SOB A;  3RZD B;  1UAP A;  3MZ5 A;  4A3M B;  4KY6 A;  2M2L A;  4Y7N B;  2EYO A;  3BYY B;  3Q24 A;  1HRJ A;  1IL8 A;  3OMC A;  1NR4 A;  4B9X A;  4ME5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...