3KUPA

Crystal structure of the cbx3 chromo shadow domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the CBX3 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 3
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kupA00
4XT1B 2R3ZA 1LV9A 1QG7A 2J7ZA 1DONA 1MI2A 1NCVA 4CJ2C 1EIHA 2K04A 1F2LA 2XIWA 1EOTA 2B2VC 4IUTA 1J9OA 1O80A 1IKMA 2B2YA 1SAPA 1DZ1A 3H91A 1ILPA 4R8IA 1RTNA 4MHEA 1M8AA 5CMDA 2FINB 4DN4M 1HFGA 2HDMA 2MP1A 2MPMA 2NZ1D 3IL8A 4R9WA 1E0BA 1WD1A 2B2UC 2X6GA 1DOLA 2DY8A 4LMQD 3ONAB 2HCIA 4HCSA 4MN3A 3UI2A 2L12A 3Q6SA 2BDNA 1WD0A 1PFMA 3FPUB 5T1GA 2HUGA 2N55A 2HDLA 5EPJA 2FJ2A 1IKLA 5EQ0A 1EIGA 4CJ1B 1G2SA 2EPBA 1HHVA 1PFBA 1XX8A 1HUMA 1AZQA 1G6ZA 3LWEA 4OIJA 5EKIA 1RJTA 2JYOA 2L9HA 1O7ZA 3D6WA 4IUPA 3F2UA 4X3KA 1PLFA 1RODA 1CM9A 1AP0A 4IUUA 2L1BA 2NYZD 1A15A 4XDXA 1B2TA 1J8IA 1HA6A 1B3AA 1KNEA 2KECA 2B2TC 4OIKA 3I8ZA 1WTVA 1IL8A 1VMCA 2KVMA 5DNFA 5JJZA 5D65A 1F9PA 5EPLA 2KUMA 1X32A 5CBEE 3DM1A 1MSHA 1WTRA 1AZPA 1WTXA 1RTOA 2EOTA 4XT3B 3TN2A 1GUWA 1SSOA 1Q3LA 5AFWA 2K28A 2B2VA 2FMMA 2B2UA 1WTOA 3FDTA 2X6LA 1CA5A 3GV3A 3IFDA 1SDFA 1NR4A 2N88A 3MTSA 2RSNA 1B53A 1S4ZA 1U4PA 2EE1A 1X3QA 2MGSA 2KEEA 4HSVA 1KNAA 2B2TA 4RAUC 4X3UA 1QNKA 2RSOA 1PDQA 2FHTA 4X3TA 4ZK9B 1WTWA 1BNZA 4ZLTF 1G2TA 1G91A 1ESRA 4QUFA 1DOMA 1HUNA 1VMPA 1EL0A 2FFKB 3DEOA 4ZKCB 4CJ0B 2SDFA 1ICWA 2K03A 3KBXA 2K1BA 1F9RA 1NAPA 4RWSC 1PFNA 1X3PA 2CVRA 1WVLA 1MGSA 2KEDA 2L11A 2Q8RE 2RA4A 1B4OA 1ML0D 2DY7A 3G7LA 3HP3A 3I91A 4IUVA 5E4WC 1F9SA 3SVMA 1WTPA 3P7JA 4IURA 4NW2A 3QO2A 2B2WC 2H1EA 1WTQA 2IL8A 3TZDA 5EJWA 1ZXTA 4X3SA 1QE6A 4HAEA 3I90A 1JE4A 2RVLA 1ILQA 1DOKA 5CORA 4UAIA 1B50A 1TVXA 2D9UA 2HCCA 3R93A 1U4RA 5COYA 5T1IA 3I3CA 3KUPA 4ZAIA 4ZKBB 1U4LA 3N52A 2B2WA 3MWYW 4HEDA 3GV6A 3DEPA 4IUQA 1BF4A 5E4XA 4RA8A 4U68A 1O7YA 1CA6A 1EQTA 1XYIA 2M2LA 4QUCA 1BBXC 1NR2A 2JP1A 2K01A 1HFNA 2MJ8A 1JICA 1RHPA 2Q8TA 1F9QA 2X69A 2B2YC 2K05A 4O42A 2L4NA 2KOLA 1C8CA 5EPKA 1BO0A 5CBAE 2NWGA 1MSGA 1U4MA 2VXWA 1HRJA 5D14A
chains in the Genus database with same CATH superfamily
3E3XA 2A68D 4L8JA 3CCSA 4PG3A 5IT9E 2K7VA 2A19A 2UUAQ 3ULLA 2MFIA 2QA4A 1TQOA 2F0EA 1S40A 1LTLA 3OIQA 1GM5A 3HZXA 1YBYA 4A3EH 3K6OA 1X3GA 2CH4A 1JB7A 1JWUD 5JJKA 4QQBX 2SEBD 3NENA 4P74A 2BDNA 1OXSC 2Z1CA 4Y52H 2KCNA 3OYYA 3KFUA 2AQ1B 3DM3A 2AQ2B 1ONLA 2UUBL 1OXXK 4GLAC 4LF9L 5IGDA 3LGJA 2ZTCA 1CM9A 1TWFB 4JPBW 1H9MA 4P72A 5J39A 2ASBA 1Y1VB 3CHBD 3L9AX 2F4VL 3BYTB 2KVMA 3S24A 5D65A 1EQRA 2NVXH 2UU9L 2DJGC 1RD9D 1WTRA 4X62L 2K50A 4KY5A 3T1HL 1PVOA 4XT3B 2GA4B 4A3FG 3OPOA 2NBFA 5BN4A 2D2CC 4PMBA 4P73A 2ATWA 2E2JB 1WTOA 1IBML 5TSSA 5A2QE 3VR5A 1Q12A 3MTSA 3M4OB 1L0WA 1RF2D 1QNKA 4MZ9A 1A62A 1F2YA 4LAAA 4A93G 4QUFA 4IJLA 1DOMA 1Q86C 3S14H 1CKNB 1LTAD 4YY3L 1SROA 2F0UA 1H9JA 2K1BA 3EROA 4YWLA 3KF6B 3ICEA 3UDFA 3F2CA 1F9SA 1W2BA 4KTAA 2G9HD 4NW2A 3J80L 2R92G 2H1EA 1VQBA 3SK6A 4B9WA 4X3SA 4UP9A 4HAEA 1OO9B 2BCOA 1YNND 1ILQA 1YHAA 4UAIA 1A2UA 3FPPA 2RQXA 3L7ZC 3BYYB 2KQ3A 4IPHA 4ZKBB 1L0YB 5E1FA 1SNCA 1EY4A 1RDPD 1TKWB 3RLNA 3GTMB 4JOIC 3QOLA 1CKNA 2NVQB 2EY5A 5C5LA 1KDAA 3OMGA 1TWCH 5CBAE 1W6KA 4QF4A 2VXWA 3S17B 1HRJA 1Z6HA 4XT1B 2E2IH 2K04A 1AFPA 5FLMH 4H7BA 1QOHA 3W5OA 1EWCA 3I56A 1Y1WB 4HCSA 5FLXE 2K4KA 2MQHA 3UI2A 1HZAA 3RNUA 2F0QA 4DK1A 3FPUB 3OIPA 2HIVA 2PPBC 4ME3A 3ZJYC 1GUNA 1YZ6A 1HUMA 3VYSA 3A56A 3SEBA 3CCQA 1PMRA 1G6ZA 5LMUL 4PZ6A 4MIUA 1TS4A 1H9KA 2WINB 5FLXL 1PLFA 1XNRL 4LF5L 4KY6A 2EY2A 4QMGA 2CWAA 1VQOA 4A75A 1KNEA 2GN5A 4UHVA 1WTVA 3HOXG 5C44H 1I3QH 1AN8A 2ICEC 3MXUA 2R7ZG 5JOBA 2UXBQ 2X6LA 3AEVA 2Q2IA 3C1FA 4L5TA 1B8AA 5ELOA 3HKZE 2Q2UA 2RSOA 2CQOA 4NKLA 4ZK9B 4BBRB 1TWGB 4C3HH 1HUNA 2XSCA 3CU7A 1HR0Q 4OGQC 3KLRA 3PO3H 3I4OA 1STAA 5HURA 4B3MQ 1IYJB 5C4XG 2QEJC 4JI2L 4HN7A 5M5YH 4AYBE 4FF1A 2NN6G 4Y7NB 2XVSA 1LLRD 4XQNA 3KJOA 1PFSA 1SBBB 2MHVA 5HGQA 1IW7C 3CCJA 3NEMA 5T1IA 3MFYA 2XN9C 3J7YW 2JEAI 4NPSA 1F2ZA 2PW7A 2OF1A 3GV6A 5E4XA 1EIYB 4C3HG 2M2LA 3ZYYX 3I4MG 1HJPA 4RMFA 1BBXC 1SNQA 5NUCA 3SE0A 1X6OA 2XWJB 3BVGA 3CC7A 3ULPA 5C4XB 2DNCA 4IOCA 2Z6BA 1I4QA 2VS1A 5ELBA 3CCMA 1L1OB 2WB1E 4WRDA 4IUTA 2B2YA 1SAPA 3VYUA 1I50B 3A7AB 4LFCL 1NUCA 5M9OA 1VQ4A 3J80E 1FJGQ 3S2DH 3IL8A 4OELB 1XTDA 4RCOA 5EAYA 2WB1B 3M85A 3V96A 4LW1A 3NELA 1K8GA 1K8OA 1QVCA 1H9SB 1N36L 4DV6Q 1XJVA 2OQ0A 3GO5A 3CRLC 2Y0SE 5FJ8H 1CQVA 5M5WH 2E2IB 1R4PB 4IFDH 4GNXC 1PZJD 3M4QA 4A3IH 4DNRB 4EVOA 2O5IC 4UY8C 3M4PA 1UUPA 2RDHA 2K75A 1PTOB 1VQNA 2EOTA 1P8LA 1X54A 1AW7A 2UUCQ 4LF6Q 5BN5A 5C6AA 1SYGA 4JOIA 1N34L 4A3CH 1CZGA 1N33L 3S1RH 3NBIA 4BY7H 1NR4A 3E9HA 1U4PA 4YIJA 3TREA 5M3MB 2DJFC 1G91A 4B3TL 2LY7A 3U9OA 1I6HH 1PH1A 3LX0A 1SMXA 2FFKB 1UWVA 1QWYA 3H15A 2IPKD 4MTNA 4R8IA 3HP3A 3S1QH 3SVMA 4LF9Q 3RZDH 2OTLA 1EWHA 5EJWA 1KRSA 3NSWA 3I72A 3I90A 2A68C 2A1AA 4DR6L 1BXTA 1CA6A 1VQHA 2K5HA 3PSIA 1XYIA 3T51B 1IXRA 4K6LA 1STYA 2IY5B 2B63H 1LT5D 4OWTB 1PH5A 2E2HB 2NTSA 2C5CA 3K5OA 1A6XA 1YEZA 2IHEA 2K5QA 4DV4L 1PH7A 3K80C 3VA7A 4LF6L 4RHSA 4LUVA 3C46A 1KDCA 1ASZA 3S1QB 3CP0A 2NUCA 4MHEA 1TR5A 2ZJRA 2A8VA 2JSOA 3R3OA 1WOCA 1E0BA 1K83H 1DD2A 5C0XI 3J7ZC 2PI2E 4A3EB 1KL9A 4X6AH 4AIMA 2GVBA 4CJ1B 1PFBA 2M00A 1FD7D 2E75C 4V0BA 1QZHA 3M3YH 1BOSA 2EXZA 1PTOH 1ZEQX 4C3IG 4DR2L 1J8IA 4KJOA 4B9XA 3NE5B 5DNFA 3OTOL 2JA8H 2UXCQ 2MNAA 5EPLA 2M9VA 3TSSA 1TWGH 1WTXA 4PNYA 1T5EA 3TN2A 2R61A 2V1CC 1NE3A 3RMHA 2JA7H 1Z9FA 3P20A 3KDFA 1F77A 4DUYQ 2Q2TA 4G4KA 2KCTA 1FGUA 3JAME 3STBD 2KEEA 3S9WA 2EVBA 3NXWA 4KY7A 4JYAL 1ENCA 2JA9A 4ZLTF 3S2HB 3BJUA 3PF5A 1S5FD 1Y8PB 1DCZA 1I3QB 3PIO3 2SOBA 4BBRG 3HOVH 2EYOA 4JI8Q 4RWSC 5DLQE 3J81c 4BXXH 1VQ8A 2KEDA 2L11A 3PO3G 5DAUA 1WTPA 5C3EH 1M4VA 4GNXB 2JA5B 4F8MA 4LFAL 4RKLA 1OTCA 4JI5Q 1BR9A 2L5TA 1PZID 1D6EC 3KBGA 1IBLL 1TVXA 4JI3Q 1M90C 3PO2H 2F0PA 5FKAC 1VDZA 1CHQD 1EU3A 2K52A 4DR3L 4RA8A 1LYLA 1O7YA 2Z4HA 5DM73 4DR5L 1JORA 1D5MC 4DV3Q 3OTOQ 1VQJA 4A3GG 1PXUA 5K36H 4Y7NH 1N32L 5ELEA 2OTJA 1DONA 4HCEA 1TWAB 4DUZQ 3VA5A 1YJ9A 4GKKQ 1MD2D 4FDBA 1WFQA 1J9OA 1JE5A 1QJOA 4DV5Q 1IBKQ 1WCMH 4WJ3M 4TRDA 3X3NA 1OXTA 1STHA 4ZYSA 1FL0A 2MP1A 2EYHA 2NZ1D 2UUAL 1SR3A 2NZHA 4JBWA 4BXXG 4JYAQ 1DOLA 1VQ9A 2HCIA 3HKZB 1UAPA 4BBRH 1STEA 2K5VA 3VR6A 1GD7A 1XMOL 4DXFA 3PUWA 4JI8L 2KHIA 2PZWA 3P75A 1EY7A 4PZ7A 2KENA 4UP8A 3J7AV 4ALPA 3GTOB 3LWEA 3AFPA 4BY1B 2F0OA 4LF7Q 1LT4D 2JJQA 3ITPA 2VQEL 3Q23A 3W3AA 4JI7Q 4X62Q 1CKOA 2NVYB 1QCBD 3A7LA 5JJZA 5IWAQ 3GTQH 4IFDG 3TRZA 3GTGB 4JW0A 1JJGA 2K28A 5FOBB 4JI4Q 4A76A 4IFDI 1WTHA 2F0DA 4Z9CB 2WV6D 3IFDA 3HKSA 2R7ZH 4LFCQ 5C44G 5KGUA 4X3UA 4C1NK 4NXNL 3WWVA 1MJCA 1VMPA 4A93B 3I7FA 3KF8A 4CJ0B 4C3JB 2KJXA 4GNXA 4LFAQ 2K14A 1N36Q 3QJYA 1YNXA 1VQCA 4JVZA 1PRTC 3S2HH 4KHVA 1NBWA 3FHWA 5C3XA 1VQMA 4JI5L 2VB3X 4L5RC 2LSSA 3GTJH 3PO2G 3MHBA 1E22A 4A4IA 3VR4A 1SE3A 1HXYD 4TSSA 1HQMC 2A6HC 2D0PA 3DLLA 2OWOA 3OWFA 4ZAIA 3H3VI 3G48A 5IYCH 3GTMH 4M1UB 1HH2P 1MIUA 3OWEB 4DV3L 3CPFA 1JMCA 3TP6A 1RL2A 2B29A 4IPGA 2CKZB 3BU2A 2VZAA 2B2YC 1A2TA 1BO0A 5M3MH 2R3ZA 5IP7G 1PRTF 4PMWA 4JI0Q 3CCUA 4FNFA 2BA1A 1F2LA 1TWHB 2ZXOA 1PH9A 3MAQA 2XRQD 4DFAA 1CUKA 1HFGA 3K81C 1UNSA 1Y1WG 1GUOA 2IX0A 2Y0SG 1XMOQ 1VF7A 4NXNQ 2N8NA 3TEHB 1NY4A 4FF2A 5H1SE 3HOZH 2R92H 3A74A 1SEBD 5LMNW 1O7IA 4DV2Q 1X9NA 2BOSA 1U9RA 4ZUJA 4A3JH 4IUUA 1MHWC 1D1IA 3KOJA 3MXPA 2E2HH 2LMCB 2TMPA 3EVQA 4H0LC 1A0IA 3O13A 2ZM6L 1TWFH 4EQNA 5J22A 3HOUG 5IYDH 1I50H 3T1YL 1C7YA 3SGIA 1GKHA 4XXEA 2NTTA 4O0AA 5M3FG 1K3RA 4GS3A 1TWHH 1TS2A 4LJZC 1S4ZA 4FVMA 1X3QA 1TT2A 2CWPA 1KNAA 3HOZB 2PMZE 1WTWA 4L5QA 1G2TA 1BBWA 2V4DA 5GAEC 4DV0L 1PRTB 4KN4C 5FLMG 2B63G 3KLSX 2KHSA 1I6HB 2A6HD 3BZCA 2FXQA 4ZCKA 4FXDA 3I91A 3BG3A 3IAYA 3P7JA 2LXKA 2PMZB 3A55A 4RCNA 1LACA 1NSNS 2VQFQ 4BBSH 1Q81C 3HOYH 2I07B 1X3EA 1N8RC 3BS1A 1QE6A 5LHY1 3R8BA 2HIXA 2RVLA 2F0FA 4K5VA 3S1RB 5CV9A 1B50A 2CH4W 3W1BA 1DM0B 3I4LA 2QKIC 3I4MB 1RCVD 5COYA 1S5ED 3HOZG 3H0GB 4PV1C 1IKMA 2Z4IA 4IUQA 2WAQE 4U68A 5IGCA 3G6JB 1TS3A 1PYSB 3NBHA 4A3MB 4YCVA 3U4VA 3I4NB 1U4MA 1JR0D 4K8JA 5I9OA 2F3IA 3ULJA 2J7ZA 1IZ6A 1TWAH 5E7NA 5M5WB 3GQBA 2PZUA 2RF4A 2JEBI 4RGMA 1YHQA 4K0KL 5J1ZA 4DV7Q 2E5LL 4A93H 2Z0SA 4EQOA 1G8ZD 4HIOA 4ID6A 3CRKC 1C0AA 1VQKA 4YY3Q 3GTPB 2ZXRA 4X64Q 2F0GA 4DV6L 4JG2A 1SMYD 2WIIB 3BDLA 3HOWG 4DR4L 1STGA 2MUYA 2OQKA 1KIXA 5A35A 1IBLQ 3FRPB 1AZQA 4OO1I 5EKIA 1OXVA 2JYOA 2Z6KC 5C3EB 5G3LF 1BBUA 4H13C 4LUOA 1B2TA 4TQUS 4JV5L 5ELCA 1VMCA 2EQSA 1NMGA 2TSSA 2NVYH 4I65A 4F88A 3MC0B 3BZKA 3JC66 4F7XA 1RTOA 3HOXH 4RGTA 1SSOA 2OCEA 2RKSA 2NVTB 4RFBA 1OXUA 2ICIA 3GTOH 1HTLD 2F0KA 1KABA 2ZXPA 1SNMA 3K0XA 3EBEA 2F1MA 3H09A 1BCPC 3CPWA 2JA7B 4R4TA 5CV5A 4HSVA 1LTSD 4JI1Q 2WKDA 4ULLA 2VB2X 2UXDQ 4JBJA 2Q2HA 4HSPA 4CGYB 2D62A 1UE5A 1LO5D 5BR8L 1NAPA 4ABNA 1V1PB 3Q24A 4HIMA 1HCZA 1ML0D 3D4RA 4QL5A 3UDIA 3RN5A 3C1EA 2O4XA 1HQRD 1PH4A 1VS0A 3F1ZA 3M9BA 5M5XB 4DR4Q 2CHBD 4KD3A 4KI0A 2HCCA 4I7ZC 5IWAL 3CCEA 2O2LD 3TDQA 3MWYW 5CYUA 1XNRQ 1ET9A 3KYHC 4JV5Q 4DXGA 3GTQB 5J3BA 1KQSA 1HFNA 4C3IH 5CGKA 4O42A 4R8NA 4DAVA 1C8CA 5I2XA 4YCWA 5ELNA 1R9TH 4CJ2C 3NBHB 1Y8OB 4K0KQ 1L2FA 1EYDA 2EZVA 2JN4A 1ESFA 3ND8A 4CDEC 1HNWQ 2OXPA 3GD7A 1G6PA 3E0EA 4POFA 5KRUA 4JI1L 5EGTA 2PZTA 3EFXD 1I94Q 1PH8A 1BVSA 3NUCA 3QWNA 3DXJC 4KN7C 4X66L 3NTKA 4YHHL 2OEOA 4LNQA 3CF5A 2PI2A 2WAQB 3I70A 1BUVT 1CKMA 4GKJL 3HOYB 1XX8A 4ZUIA 4LFBQ 4EQPA 2VNUD 2AKWB 3KDFB 4M8AA 2NYZD 1C4QA 4XDXA 2UUBQ 3HOXB 3MEHA 3CCRA 1EYCA 2KECA 2QILA 3QIAA 5C0XH 2JXMB 2F0WA 2JA8B 1F9PA 3AYHB 2R6GA 5CBEE 1S72A 1MSHA 4GOPA 4FYDA 1Y8NB 1SE4A 1XPRA 4C1NI 1EIFA 1Y69U 5IP9G 1XMQQ 3HOUB 3C2PA 3UE1A 1VQ7A 4OWWB 2PQAB 3PV0A 1VQPA 1ICFB 3QG1A 3JAMi 1CZWA 1RIPA 4NP5A 3SR1A 1IL2A 3PUYA 2RCNA 4IJHA 5BR8Q 4KV6A 3GTLH 3HOVB 1SE8A 1TU2B 3I73A 3D4WA 2K03A 2JA8G 5EBDA 2Q8RE 1B4OA 2DY7A 1JC7A 2JE6I 4YWKA 1UEBA 4LUZA 3M4OH 2A5HA 1K0SA 3RN2A 2IX1A 4KLKA 1X3FA 4X65L 2C9OA 2ZTEA 1U4LA 2VY3A 3A8IE 4JK1C 3OOCA 2ZM6Q 2YTYA 4DNTB 2F0HA 3S2DB 1NR2A 3K5MA 1MBYA 1JICA 1RHPA 4B08A 4A3IG 2X69A 2RCFA 4K8IA 1G51A 4OXPA 4A3MG 4KK7A 1H9RA 4FO2A 4K2LA 3HOUH 1N32Q 3V05A 1ZYRC 2Z8LA 4N9PA 1YVCA 3TS0A 5AJ3L 2XGTA 4BA1I 1I94L 3L0OA 5C4JH 2A6ED 5F2DA 4HJ8A 1SFOH 4OONA 3PUXA 2NB0A 3E5SA 3PMFA 4YHHQ 1T5XD 4A3JG 4DU9A 1JQYD 1J6QA 1S5BD 3TP7A 3W2DA 1WYDA 2QCPX 1YNNC 1GUSA 2A69D 1JWMD 4FF3A 4K14A 4IO9A 2XNAC 2L9HA 1LT6D 2E76C 2R7DA 4LF4Q 1I4GA 1RODA 1ZKOA 5I4DA 4C3JH 4A3KG 3FKIB 1LTRD 2R93G 1EY6A 2B2TC 3I8ZA 1TY0A 4OL7A 3G6EA 3OW7A 2BE5C 1JT8A 5FLXc 3PUZA 2XWBB 2Y0SB 3K5NA 3MFGA 5EBCA 2AHOB 1QVFA 5C5MA 4J15A 1J5EQ 2I5MX 3H6MA 3HG9A 2R7ZB 3FMCA 1YI2A 5L37A 1L1OA 4HMIA 5I9PA 3E9IA 4DV7L 2WFWA 3NQTA 1D8LA 5EKKA 3SK5A 5C4XH 1K73C 4KHPL 1D1KA 1UE7A 4WJWA 1K3BC 1SNOA 4I7AA 2NN6I 4QB4A 4Q0FA 3SDZA 1CK1A 4YWMA 1MKHA 4Q5VA 1IHZA 3PF4A 5GAGC 1WCMG 1Y14B 3H0GG 4AYBG 3S1NB 3C3LA 4DA2A 5KNBA 1Q46A 2I0QA 1R4QB 4QIWB 1TS5A 2D0OA 1E2ZA 4DF7A 4LF5Q 2QW7A 5M5XH 1AH9A 1ENFA 2L0CA 2VUMB 2F0MA 4G7HC 1Q1BA 1YNJD 1VQIA 1VQ5A 5DM63 3V2TA 3I3CA 3KUPA 1CI3M 4AYBB 2Z9HA 5KYLA 3ERSX 4DR2Q 1JCKB 3CQZB 5FO9B 3NHHA 3CC2A 1WCMB 1VCIA 5CR3A 1MJEA 1HZBA 2PCFB 5M5YB 1LTBD 3CCLA 4A3GB 3DWQA 2JQOA 4DKAC 5AJ3Q 5LMNL 2CQAA 1DXMA 1S5CD 4IN3A 3CXCA 3CQZH 4R9WA 1Q90A 1EYAA 3J80i 4L63B 1WD1A 2IJ0A 4B3ML 1LTTD 2LFNA 2JA6B 2B3GA 3S15B 5ELDA 4GN5A 2WB1G 2E8GA 1PZKD 1EFID 3P1HA 1EIGA 1KAWA 4DGZA 1KHIA 4HIDA 1Q1EA 4IUPA 3SXHA 2QDBA 3RZOH 1B3AA 2JA6G 5C44B 2K5DA 3NP8A 2IT1A 3DUZA 3CC4A 4UDUC 2HT1A 1X32A 1BDOA 5ISRA 1J5EL 2HHHL 4DR3Q 4O1NA 2SNMA 4A3FB 1I4RA 4GN3B 1I4XA 1YITA 1CA5A 1SDFA 1VQLA 1HNXL 3L3OC 3U58A 2WP8J 1D5XC 4TVAB 2ZJPA 3PUVA 5IP9H 4A3GH 3QOJA 5I2YA 5M3FB 3U9SA 2EYMA 2ID0A 5LL6S 1ICWA 3H3VH 3KBXA 3DHQA 1X3PA 3DWPA 4GKJQ 1QZGA 2KHJA 4DAYB 2VUMG 3HGBA 3Q0AA 5IGBA 1TIID 3G4SA 3HRZC 3BDOA 1EQVA 3TP5A 3KLWA 4QCLA 3J7A5 1TXYA 3R2IA 2PNRC 3R93A 5LMUQ 1U4RA 2E2DC 1L1OC 4EGVA 1JJ2A 3DEPA 3S1NH 4KKUA 1E2VA 2KCMA 4JI7L 3DMUA 2Q8TA 1KRTA 1CFMA 1H95A 4HJAA 5LMNQ 2GVAA 3M7GA 1LV9A 1PTOC 4JI4L 2XIWA 1EOTA 4IUNA 4HR7B 4DV4Q 1PRTD 1O80A 1O78A 1LTGD 1DZ1A 1HNXQ 3HFZB 2KA7A 2IWHA 1PV4A 2I5LX 5CMDA 2O5JC 2C35B 1SRUA 2BE5D 4JBKA 5D3IB 3RLOA 2WACA 4NXMQ 3NPPA 4A3LG 4X64L 3CMEA 2DY8A 4MN3A 4DK3C 1ASYA 1W3SA 1M1KC 2ZJQA 1IYVA 4GLVB 1HR0L 4JI6L 1KDBA 1PA6A 2LS01 4JBMA 4R4QA 2HDLA 3H94A 2FJ2A 1IKLA 5EQ0A 4A3CG 4JC0A 4A3DB 3Q22A 3D6WA 1O7ZA 2N78A 1PTOF 5HGTA 4HIKA 2F0VA 2ZTDA 3MVVA 1A15A 3I4NH 2K6AA 1TWCB 3F2DA 3QR8A 1GUTA 1IL8A 1K8AC 3Q8DA 2ALYB 1YIJA 5M3MG 2NVQH 2KUMA 2A6EC 3DM1A 1SJED 1UEAB 5JPMC 1SFOB 2KCCA 2B39A 5CV6A 5FJ8G 3PIP3 5AFWA 1IW7D 1QB5D 4A3DG 1A3VA 2B2VA 1PYBA 3RLFA 5IYDG 4H44C 1EY5A 2IW3A 4DAMA 4GOPC 1WJJA 3SK4A 1HPCA 1B53A 2MO1A 2UXDL 3LWUA 2B2TA 4DUYL 4RAUC 1PDQA 4MNOA 1BNZA 4KKTA 4CDFC 1EY9A 4DV1Q 1CSQA 2QGQA 5IYBG 2VW9A 2J0TD 4IPCA 1IYUA 4JI2Q 4P2CB 2CVRA 1WVLA 4GN4B 3E0JA 4IZ8A 3GP7A 1KC8C 4IUVA 3S1MB 5E4WC 4G7ZC 3K0YA 5HY6A 2BH8A 2N3SA 1WTQA 1GXDC 3W1GA 1I4PA 1JE4A 3PIOA 2PYKA 2UXCL 5IT9L 5BN3A 2D9UA 2AMCB 5I6YA 1B70B 3KF6A 4HMJA 3J80c 2UU9Q 4EX5A 1BQQT 3MA2B 2CW0C 1SNDA 4JI3L 5FO7B 1YJNA 4WORA 4V190 1EWIA 5FK9C 4U673 1U5KA 5IP7H 1TY2A 4DR5Q 3WOEA 2NWGA 5G3LD 4ME5A 3RR5A 3AMUA 4A3JB 3AB9A 1NCVA 1AE3A 3CMAA 2EDGA 3RZDB 1N34Q 2B2VC 1HZCA 4DAYA 1LABA 3S1MH 1FNWA 1Y1VG 1KTKA 2B8GA 3A5ZB 3U50C 4DUZL 4KD4A 1M8AA 2A74C 2HDMA 4J1MA 4IALA 3GTLB 3A0JA 1KLGD 3CKIB 2IHFA 3Q6SA 1GVPA 1E2WA 5C4JB 1LM0A 1STNA 2N55A 5JJIA 1PTOD 1VQGA 4BY1H 1K9MC 2EXDA 2EPBA 1FGBD 4R4CA 4A3BG 4JCVE 4OIJA 2K5WA 4XTCS 3HOYG 1K0RA 2R93B 4N8FA 1X55A 3F2UA 3OMCA 1HA6A 4LF7L 1LT3D 3UE0A 5K36G 1B1ZA 4G57A 4LF8Q 1QUQA 1SYDA 2KBNA 2NZOA 1AZPA 2B8FA 3HOWB 3CCVA 1GUWA 1N33Q 3OW2A 1HR0W 2OT2A 2FMMA 3FDTA 4A3DH 4S3SA 2N88A 2DUDA 5FO8B 2NVTH 5JAVA 3A54A 1SE2A 1R9TB 4R4IA 4HTHA 3K7AB 1ESRA 1B44D 5IOCA 2N49A 4IPDA 5KEEA 4B3SQ 3ND9A 3WOFA 1XTCD 5IIFA 1DGSA 1BCPD 2PQEA 2RA4A 1JOQA 3EN2A 1E24A 3EIVA 1V43A 2JK8A 2YU9H 4L6TB 4DR1L 4J6HA 3GTKH 1II3A 1ZXTA 1SYCA 4DNIA 4L5SA 2VQEQ 5C0XJ 5CORA 2YU9B 5D3DA 3K8AA 4J8QA 1RKNA 4PZ8A 1NJIC 4UP7A 2K32A 1SYFA 1UE6A 2UXBL 2MJ8A 5E3FA 4OHJA 3FEWX 2L4NA 2CFMA 4K5XA 1VQAA 4F87A 2EJGC 4QGUA 1V1QA 1EIHA 3PGZA 1ET6A 3BVZA 2QEXA 1VQ6A 1K8MA 4BY7G 3OSOA 1FNUA 2RHSB 2MPMA 1E1TA 3R2TA 5C0XG 2B2UC 3BDCA 4IOAA 3J81E 1PYWD 2EYFA 4RG1A 1PFMA 2BH2A 2VUMH 4EQ5A 5C3EG 1G2SA 4BA2I 3EJIA 4A3FH 3JAMc 2AWOA 2G9DA 1DJRD 4OEMB 3A5UA 2L15A 4LF8L 1E1OA 1EUJA 3D0FA 1NNXA 3NQIA 2LXJA 4GOPB 4LF4L 4C3IB 2I46A 3T4AC 4KMUC 1LTID 1VQEA 1PH6A 1E7ZA 1JOKA 2HQEA 1BCPB 1V9PA 1F2MA 4QJFA 3RZOB 1K83B 2WAQG 4H02A 1IBMQ 3CD6A 2QDLA 1XWEA 2MO0A 1Q82C 1E3PA 3PO2B 1EFWA 3T1HQ 3CW2C 2JA7G 4CBVA 1HTPA 3TZUA 5JEAG 3KK7A 1GJXA 3ER0A 1B3QA 1NMFA 1YJWA 3T1YQ 2EE1A 4A3BH 2MGSA 1A8VA 5ELFA 3S15H 2J4XA 3E6ZX 2JA6H 2F3VA 5IGEA 1S5DD 1EY0A 3UDXA 2B63B 4KHPQ 1HNWL 1A3TA 2NVXB 3MEFA 2Z6KA 3RUZA 2SDFA 1EQQA 4DV0Q 1JB3A 1PFNA 5IY0A 1CQFA 5K5PA 5JVG3 2EYJA 4NDXA 1Q7YC 3T56B 4IURA 2AUJD 2H4OA 2B2WC 4KJNA 4C56C 2YV5A 3VYRA 3NK9A 4OWXB 4LWCA 2EIFA 1WI5A 3T13A 2R92B 4LFBL 1I5FA 3EQLC 4R4OA 2EJMA 1BF4A 3N52A 4TKOB 5LL6X 1Z47A 4NMZA 2RDGA 1HNZQ 2JP1A 3X3MA 1H9SA 1F9QA 2K05A 2BDOA 5IYCG 2A73B 2F0JA 4MTKA 2D5DA 2ES2A 4DV5L 1IBKL 1SYBA 4K6DA 3KLSA 3T53B 4A3KH 1ENAA 1NTGA 2ZT9C 3AQQA 1BCPF 1D7QA 3H91A 1SXTA 1RTNA 2F0LA 3N6RA 2F0NA 3VR3A 1SYEA 4LMQD 4ILWA 1B9NA 3I2ZA 5DEHA 2VQFL 3SHLA 5KNDA 3VYTA 4XYQA 3TMEA 2HUGA 3IFTA 5CV8A 1A63A 4DAPA 2F52A 5JJLA 2WKCA 2YTXA 1KD1C 2E2JH 1RJTA 1Q8KA 1SJHD 1AP0A 5CV4A 1CSPA 1QVGA 4BY1G 1PH3A 3VDYA 3K58A 3SK8A 4OIKA 1EY8A 3MXGA 3NWTA 2HHHQ 3A8JE 3L2PA 5GROA 4GKKL 4X65Q 1B9MA 4RGNA 2I5HA 1Q3LA 4A3BB 1HNZL 3B6YA 3GV3A 4XQJA 1W6JA 1FVIA 3K59A 1CT1D 2RSNA 4A3KB 5JVH3 4BBSB 1LUZA 4X3TA 1GOZA 5EKLA 3GTGH 1HZ9A 5A2QL 2PQAA 1EL0A 1GHKA 4DR7L 4A3LH 2CCZA 1MGSA 2AUKA 2XTIA 2IX3A 4UPAA 3QO2A 1JOOA 2XRSD 1V1OA 3TZDA 3TS2A 4HJ7A 5KYIA 2RHQB 1GUGA 4BY7B 2P5ZX 3KJPA 2QF7A 4CKBA 3URYA 1D2BA 1C9OA 2G5DA 4PQXA 2B2WA 3T16A 4C2MH 3PO3B 2YTVA 3RD4A 1HA5A 2KOLA 1GHJA 4A3IB 3OHXC 2DGYA 5M3FH 1XXGA 3H3VC 1KXLA 1MI2A 3FVQA 1EZ6A 2HQLA 2PNHA 3GTJB 2RDFA 4IQZA 1FJGL 4O2DA 1DYQA 1ILPA 4OO1H 2DN8A 1BKBA 1V1PA 3U4ZA 2FINB 4DN4M 4B3SL 4WJ4A 4JI6Q 1CHPD 2X6GA 3ONAB 1Q8IA 2L12A 2EY1A 2NN6H 5C3WA 2EY6A 4NXML 1GO3E 5T1GA 4R1JA 4LK1C 4CHTB 4FF4A 3D8GA 1JJCB 1T9HA 2K33A 4X66Q 1HHVA 4N8X1 3GTKB 3F8TA 3AFQA 1XNQQ 2R7FA 1X65A 2JA5H 1U0LA 1JWSD 2A69C 4X3KA 5IT9c 3M4YA 1A3UA 2L1BA 5CV7A 4DPGA 4KKSA 1EOVA 3ERQA 4FXGC 5C4ZA 1QUQB 2K5NA 1EZ8A 4C3JG 1AEXA 5CC4A 1Z7TA 4POGA 5IGFA 2Q8IB 1EEFD 2JA5G 2FMCA 4CKEA 1I6VC 3DWAA 3M7NA 4A3EG 1S3OA 2B2UA 5GADC 2VL6A 2UUCL 1ZYRD 1STBA 2ENBA 2SNSA 4RKBA 3HS0C 4BBSG 3TQYA 4B3TQ 2F03A 5JEAH 2LKVA 2F0TA 4DV1L 4OX9L 3S17H 2FHTA 1EYGA 4DR7Q 1FNVA 3BZDB 5JEAJ 3F2BA 3MZ5A 4QY7A 5KIXA 5IGGA 3DEOA 2E74C 4FXKC 4DK6C 4ZKCB 4KHZA 4YCUA 3G71A 1F9RA 5KNCA 1K28A 3J81L 3TBIB 3STBC 4BS9A 1EU4A 1EEID 3G7LA 3PCOB 4C3HB 1N9WA 5IODA 3K57A 1KAAA 2F3WA 3BVMA 3K7UC 1L0XB 2IL8A 4CDCC 3GDEA 4PMCA 1KLUD 4B3RQ 4DR6Q 3J7AF 4P71A 3GTPH 1YHBA 4WFN3 4GZYC 1XNQL 4P75A 4CKCA 3NTIA 3TP8A 1D5ZC 4HEDA 3HKZG 4QIWE 4ZRZA 3WDNA 3D3RA 4ODGA 4XIGS 1I4HA 3S14B 4RHRA 3J81i 1XMQL 4E6IA 5EPKA 1MSGA 3K7AH 3MXNB 1QG7A 4GLXA 4HJ5A 1SMYC 3D4DA 4RH6A 4APVA 2F0SA 2E5LQ 3PIPA 4HJ9A 4K2KA 4OX9Q 4DK0A 3HOWH 2BA0A 3KF8B 3QB3A 4ZQ3A 3H0GH 1Y1WH 3AU7A 1P16A 1WD0A 2EYPA 4CDDC 1Y1VH 5C4HA 5EPJA 3M3YB 4G7OC 1YNJC 1VQDA 4NB3A 1B7YB 1UE1A 2PO4A 3VR2A 1SNPA 1FYCA 3JAML 4AQYL 1VQFA 3D31A 2AQ3B 1PHJA 1QILA 2F0IA 4RGOS 2AWNA 2PW5A 3EA6A 3HEJA 3MXNA 2YYZA 1AE2A 3FKIG 4OO1G 3IRBA 5JPNC 4JI0L 2R93H 4IFDJ 1PH2A 2H5XA 5GAHC 3K5LA 4XYOA 1CTMA 3NTHA 5GQOA 2EJFC 2HD3A 2RBMA 5I6WA 4K5WA 2F4IA 3IKJA 4XQQA 1C48A 1V8QA 5IYBH 1O7LA 1SN8A 2CW0D 4AH6A 4BWGB 3A8KE 2DNEA 2L55A 4DV2L 3D6CA 3CAMA 3LNNA 4B3RL 4FP5D 3S16B 1VF5C 5IE8A 1XPOA 4N9TA 3FP9A 1FR3A 2F4VQ 3NWSA 1DOKA 4DR1Q 3S16H 1QNUA 4A3MH 3HOVG 3PQIA 3UDGA 4AQYQ 4C2MB 1EQTA 3I55A 1SLJA 2K01A 3I4MH 3I4NG 1XPUA 3FKIH 3J81j 1G291 2EYLA 4QUCA 5D14A 1X56A
chains in the Genus database with same CATH topology
4L8JA 2A68D 5IT9E 2K7VA 1TQOA 2F0EA 3OIQA 3HZXA 3K6OA 1JWUD 2SEBD 2BDNA 1OXSC 2Z1CA 2KCNA 2AQ1B 2AQ2B 1ONLA 1OXXK 5IGDA 1TWFB 1CM9A 1H9MA 5J39A 1Y1VB 3CHBD 3L9AX 3BYTB 2KVMA 5D65A 1RD9D 1WTRA 4KY5A 4XT3B 2GA4B 3OPOA 2NBFA 5BN4A 2D2CC 4PMBA 2E2JB 1WTOA 5TSSA 5A2QE 3VR5A 1Q12A 3MTSA 3M4OB 1RF2D 1QNKA 1F2YA 4LAAA 4QUFA 1DOMA 1LTAD 2F0UA 1H9JA 2K1BA 3EROA 1F9SA 4KTAA 2G9HD 4NW2A 3J80L 2H1EA 3SK6A 4B9WA 4X3SA 4HAEA 1OO9B 2BCOA 1YNND 1ILQA 4UAIA 1A2UA 3FPPA 2RQXA 3L7ZC 3BYYB 2KQ3A 4ZKBB 1L0YB 5E1FA 1SNCA 1EY4A 1RDPD 1TKWB 3GTMB 3QOLA 2NVQB 2EY5A 5C5LA 1KDAA 3OMGA 5CBAE 1W6KA 4QF4A 2VXWA 3S17B 1HRJA 1Z6HA 4XT1B 2K04A 1AFPA 4H7BA 1QOHA 1EWCA 1Y1WB 4HCSA 5FLXE 3UI2A 2F0QA 4DK1A 3FPUB 3OIPA 2PPBC 1GUNA 1HUMA 3VYSA 3A56A 3SEBA 1PMRA 1G6ZA 4MIUA 1TS4A 1H9KA 2WINB 5FLXL 1PLFA 4KY6A 2EY2A 4QMGA 1KNEA 1WTVA 1AN8A 2ICEC 3MXUA 5JOBA 2X6LA 3C1FA 2RSOA 4NKLA 4ZK9B 4BBRB 1TWGB 1HUNA 2XSCA 3CU7A 4OGQC 3KLRA 1STAA 5HURA 2QEJC 4HN7A 4FF1A 2NN6G 4Y7NB 2XVSA 1LLRD 4XQNA 1SBBB 2MHVA 1IW7C 5T1IA 3MFYA 2XN9C 3J7YW 2JEAI 1F2ZA 2PW7A 2OF1A 3GV6A 5E4XA 4C3HG 2M2LA 3ZYYX 1BBXC 1SNQA 5NUCA 3SE0A 2XWJB 3BVGA 5C4XB 2DNCA 1I4QA 5ELBA 4WRDA 4IUTA 2B2YA 1SAPA 3VYUA 1I50B 3A7AB 1NUCA 5M9OA 3J80E 3IL8A 4RCOA 2WB1B 3M85A 3V96A 1K8OA 1H9SB 3GO5A 3CRLC 1CQVA 2E2IB 1R4PB 4IFDH 1PZJD 4DNRB 4EVOA 2O5IC 1UUPA 2RDHA 1PTOB 2EOTA 1AW7A 5BN5A 5C6AA 1SYGA 1CZGA 3NBIA 1NR4A 1U4PA 4YIJA 5M3MB 1G91A 2LY7A 3U9OA 3LX0A 2FFKB 1QWYA 2IPKD 4R8IA 3HP3A 3SVMA 1EWHA 5EJWA 3NSWA 3I72A 3I90A 2A68C 1BXTA 1CA6A 1XYIA 3T51B 4K6LA 1STYA 1LT5D 2E2HB 2NTSA 2C5CA 3K5OA 1A6XA 2K5QA 3VA7A 4RHSA 3C46A 1KDCA 3S1QB 2NUCA 4MHEA 1TR5A 2JSOA 3R3OA 1E0BA 1DD2A 5C0XI 4A3EB 4CJ1B 1PFBA 2M00A 1FD7D 2E75C 4V0BA 1BOSA 2EXZA 1PTOH 1ZEQX 4C3IG 1J8IA 4KJOA 4B9XA 3NE5B 5DNFA 5EPLA 2M9VA 3TSSA 1WTXA 4PNYA 1T5EA 3TN2A 2R61A 3RMHA 3P20A 1F77A 4G4KA 3JAME 2KEEA 3S9WA 2EVBA 3NXWA 4KY7A 3S2HB 1ENCA 4ZLTF 1S5FD 1Y8PB 1DCZA 1I3QB 3PIO3 2SOBA 2EYOA 4RWSC 2KEDA 2L11A 5DAUA 1WTPA 1M4VA 2JA5B 4F8MA 4RKLA 1BR9A 2L5TA 1PZID 1D6EC 3KBGA 1TVXA 2F0PA 5FKAC 1VDZA 1CHQD 1EU3A 4RA8A 1O7YA 2Z4HA 5DM73 1JORA 1D5MC 1PXUA 5K36H 5ELEA 1DONA 4HCEA 1TWAB 3VA5A 1MD2D 1J9OA 1QJOA 4TRDA 3X3NA 1OXTA 1STHA 4ZYSA 2MP1A 2EYHA 2NZ1D 4JBWA 1DOLA 2HCIA 3HKZB 1UAPA 1STEA 3VR6A 4DXFA 3PUWA 2PZWA 3P75A 1EY7A 3GTOB 3J7AV 3LWEA 4BY1B 2F0OA 1LT4D 3ITPA 3Q23A 3W3AA 2NVYB 1QCBD 3A7LA 5JJZA 4IFDG 3GTGB 2K28A 5FOBB 4IFDI 4Z9CB 2F0DA 2WV6D 3IFDA 5KGUA 4X3UA 4C1NK 1VMPA 4A93B 3KF8A 4CJ0B 4C3JB 2KJXA 3QJYA 1PRTC 4KHVA 5C3XA 2VB3X 3MHBA 3VR4A 1SE3A 1HXYD 4TSSA 1HQMC 2A6HC 3OWFA 4ZAIA 4M1UB 3OWEB 3TP6A 2B2YC 1A2TA 1BO0A 2R3ZA 1PRTF 4PMWA 4FNFA 2BA1A 1F2LA 1TWHB 2ZXOA 3MAQA 2XRQD 4DFAA 1HFGA 1UNSA 1GUOA 2IX0A 1VF7A 4FF2A 1SEBD 2BOSA 1U9RA 4ZUJA 4IUUA 1D1IA 3MXPA 2LMCB 2TMPA 3EVQA 4H0LC 3O13A 4EQNA 5J22A 4XXEA 2NTTA 1TS2A 4LJZC 1S4ZA 4FVMA 1X3QA 1TT2A 3HOZB 1KNAA 1WTWA 1G2TA 2V4DA 1PRTB 4KN4C 3KLSX 2KHSA 1I6HB 2A6HD 4FXDA 3I91A 3BG3A 3IAYA 3P7JA 2PMZB 3A55A 4RCNA 1LACA 1NSNS 2I07B 3BS1A 1QE6A 5LHY1 3R8BA 2RVLA 2F0FA 4K5VA 3S1RB 5CV9A 1B50A 1DM0B 3I4LA 2QKIC 3I4MB 1RCVD 5COYA 1S5ED 3H0GB 4PV1C 1IKMA 2Z4IA 4IUQA 4U68A 5IGCA 3G6JB 1TS3A 3NBHA 4A3MB 3I4NB 1U4MA 1JR0D 4K8JA 5I9OA 2J7ZA 5M5WB 3GQBA 2PZUA 2JEBI 4RGMA 5J1ZA 4EQOA 1G8ZD 4ID6A 3CRKC 3GTPB 2ZXRA 2F0GA 1SMYD 2WIIB 3BDLA 1STGA 2MUYA 5A35A 4OO1I 3FRPB 1AZQA 5EKIA 1OXVA 2JYOA 5C3EB 5G3LF 4H13C 1B2TA 4TQUS 5ELCA 1VMCA 2TSSA 4I65A 4F88A 3MC0B 4F7XA 1RTOA 4RGTA 1SSOA 2RKSA 2NVTB 4RFBA 1OXUA 2ICIA 1HTLD 2F0KA 1KABA 2ZXPA 1SNMA 3H09A 2F1MA 1BCPC 2JA7B 5CV5A 4HSVA 1LTSD 2WKDA 4ULLA 2VB2X 4HSPA 4CGYB 2D62A 1LO5D 1NAPA 4ABNA 1V1PB 3Q24A 1HCZA 1ML0D 3D4RA 3C1EA 2O4XA 1HQRD 5M5XB 2CHBD 4KD3A 4KI0A 2HCCA 4I7ZC 2O2LD 3TDQA 3MWYW 5CYUA 1ET9A 4DXGA 3GTQB 1HFNA 5CGKA 4O42A 1C8CA 4R8NA 4DAVA 5I2XA 4CJ2C 1Y8OB 1EYDA 2EZVA 1ESFA 3ND8A 2OXPA 3GD7A 5KRUA 5EGTA 2PZTA 3EFXD 3NUCA 3QWNA 3DXJC 4KN7C 3NTKA 2OEOA 2WAQB 3I70A 1BUVT 3HOYB 1XX8A 4ZUIA 4EQPA 2VNUD 4M8AA 2NYZD 1C4QA 4XDXA 3HOXB 3MEHA 1EYCA 2KECA 2QILA 3QIAA 5C0XH 2JXMB 2F0WA 2JA8B 1F9PA 2R6GA 5CBEE 1MSHA 4FYDA 1Y8NB 1SE4A 4C1NI 1Y69U 3HOUB 3C2PA 3PV0A 3QG1A 1CZWA 4NP5A 3SR1A 3PUYA 4KV6A 3HOVB 1TU2B 3I73A 3D4WA 2K03A 5EBDA 2Q8RE 1B4OA 2DY7A 1JC7A 2JE6I 2A5HA 2IX1A 2C9OA 1U4LA 3A8IE 4JK1C 3OOCA 4DNTB 2F0HA 3S2DB 1NR2A 3K5MA 1MBYA 1JICA 1RHPA 4B08A 2X69A 4K8IA 4KK7A 1H9RA 4FO2A 4K2LA 3V05A 1ZYRC 2Z8LA 4N9PA 4BA1I 2A6ED 5F2DA 3PUXA 2NB0A 3E5SA 3PMFA 1T5XD 4DU9A 1JQYD 1S5BD 3TP7A 3W2DA 2QCPX 1YNNC 1GUSA 2A69D 1JWMD 4FF3A 4K14A 2XNAC 2L9HA 1LT6D 2E76C 1I4GA 1RODA 1ZKOA 5I4DA 3FKIB 1LTRD 1EY6A 2B2TC 3I8ZA 1TY0A 4OL7A 3OW7A 2BE5C 3PUZA 2XWBB 2Y0SB 3K5NA 3MFGA 5EBCA 5C5MA 3H6MA 3HG9A 2R7ZB 3FMCA 4HMIA 5I9PA 3NQTA 5EKKA 3SK5A 1D1KA 4WJWA 1SNOA 4QB4A 2NN6I 4Q0FA 3SDZA 1CK1A 4Q5VA 1IHZA 3S1NB 3C3LA 4DA2A 5KNBA 1R4QB 4QIWB 1TS5A 1E2ZA 4DF7A 1ENFA 2L0CA 2VUMB 2F0MA 4G7HC 1Q1BA 1YNJD 5DM63 3V2TA 3I3CA 3KUPA 1CI3M 4AYBB 5KYLA 1JCKB 3CQZB 5FO9B 3NHHA 1WCMB 1VCIA 5CR3A 2PCFB 5M5YB 1LTBD 4A3GB 3DWQA 2CQAA 1DXMA 1S5CD 4IN3A 4R9WA 1Q90A 1EYAA 4L63B 1WD1A 2IJ0A 1LTTD 2LFNA 2JA6B 3S15B 5ELDA 1PZKD 1EFID 3P1HA 1EIGA 4DGZA 1Q1EA 4IUPA 3SXHA 2QDBA 1B3AA 5C44B 2K5DA 3NP8A 2IT1A 3DUZA 4UDUC 1X32A 1BDOA 5ISRA 4O1NA 2SNMA 4A3FB 1I4RA 1I4XA 1CA5A 1SDFA 3L3OC 2WP8J 1D5XC 3PUVA 3QOJA 5I2YA 5M3FB 3U9SA 2EYMA 2ID0A 5LL6S 1ICWA 3KBXA 3DHQA 1X3PA 3DWPA 3HGBA 3Q0AA 5IGBA 1TIID 3HRZC 3BDOA 1EQVA 3TP5A 4QCLA 3R2IA 2PNRC 3R93A 1U4RA 2E2DC 4EGVA 3DEPA 4KKUA 1E2VA 3DMUA 2Q8TA 1CFMA 3M7GA 1LV9A 1PTOC 2XIWA 1EOTA 4HR7B 4IUNA 1PRTD 1O80A 1O78A 1LTGD 1DZ1A 2KA7A 2IWHA 5CMDA 2O5JC 2BE5D 5D3IB 2WACA 3NPPA 2DY8A 4MN3A 1IYVA 1KDBA 2LS01 2HDLA 3H94A 2FJ2A 1IKLA 5EQ0A 4A3DB 3Q22A 3D6WA 1O7ZA 1PTOF 5HGTA 2F0VA 3MVVA 1A15A 2K6AA 1TWCB 1GUTA 1IL8A 2KUMA 2A6EC 3DM1A 1SJED 1UEAB 5JPMC 1SFOB 2KCCA 2B39A 5CV6A 3PIP3 5AFWA 1IW7D 1QB5D 1A3VA 2B2VA 3RLFA 4H44C 1EY5A 2IW3A 3SK4A 1HPCA 1B53A 3LWUA 2B2TA 4RAUC 1PDQA 1BNZA 4KKTA 1EY9A 2J0TD 1IYUA 4P2CB 2CVRA 1WVLA 3E0JA 3GP7A 4IZ8A 4IUVA 3S1MB 5E4WC 4G7ZC 3K0YA 1WTQA 1GXDC 1I4PA 1JE4A 2PYKA 5IT9L 5BN3A 2D9UA 5I6YA 4HMJA 1BQQT 3MA2B 2CW0C 1SNDA 5FO7B 4WORA 4V190 5FK9C 4U673 1TY2A 3WOEA 2NWGA 5G3LD 4ME5A 3AMUA 4A3JB 3AB9A 1NCVA 2EDGA 3RZDB 2B2VC 4DAYA 1LABA 1FNWA 1KTKA 2B8GA 4KD4A 1M8AA 2A74C 2HDMA 4J1MA 4IALA 3GTLB 1KLGD 3CKIB 3Q6SA 1E2WA 5C4JB 1STNA 2N55A 1PTOD 2EPBA 1FGBD 4OIJA 2K5WA 4XTCS 2R93B 3F2UA 3OMCA 1HA6A 1LT3D 5K36G 1B1ZA 4G57A 1SYDA 1AZPA 2B8FA 3HOWB 1GUWA 2OT2A 2FMMA 3FDTA 4S3SA 2N88A 5FO8B 5JAVA 3A54A 1SE2A 1R9TB 4HTHA 3K7AB 1ESRA 5IOCA 1B44D 5KEEA 3ND9A 3WOFA 1XTCD 5IIFA 1BCPD 2PQEA 2RA4A 1JOQA 1V43A 4L6TB 4J6HA 1II3A 1ZXTA 1SYCA 5C0XJ 5CORA 2YU9B 5D3DA 1RKNA 4J8QA 2K32A 1SYFA 2MJ8A 5E3FA 4OHJA 3FEWX 2L4NA 4F87A 4K5XA 2EJGC 1EIHA 1ET6A 3BVZA 1K8MA 3OSOA 1FNUA 2MPMA 3R2TA 5C0XG 2B2UC 3BDCA 3J81E 1PYWD 2EYFA 1PFMA 1G2SA 4BA2I 3EJIA 2AWOA 2G9DA 1DJRD 3NQIA 4C3IB 2I46A 3T4AC 4KMUC 1LTID 1JOKA 2HQEA 1BCPB 1F2MA 3RZOB 1K83B 1XWEA 3PO2B 4CBVA 1HTPA 3TZUA 5JEAG 3KK7A 1GJXA 2EE1A 2MGSA 5ELFA 2J4XA 3E6ZX 2F3VA 5IGEA 1S5DD 1EY0A 2B63B 2NVXB 1A3TA 3RUZA 2SDFA 1JB3A 1PFNA 5K5PA 1CQFA 5JVG3 2EYJA 4NDXA 3T56B 4IURA 2AUJD 2H4OA 2B2WC 4KJNA 4C56C 3VYRA 3NK9A 3T13A 2R92B 3EQLC 2EJMA 1BF4A 3N52A 4TKOB 5LL6X 1Z47A 4NMZA 2RDGA 2JP1A 3X3MA 1H9SA 1F9QA 2K05A 2BDOA 2A73B 2F0JA 2D5DA 1SYBA 4K6DA 3KLSA 3T53B 1ENAA 2ZT9C 1BCPF 3H91A 1SXTA 1RTNA 2F0LA 3N6RA 2F0NA 3VR3A 1SYEA 4LMQD 4ILWA 1B9NA 5DEHA 3SHLA 5KNDA 3VYTA 4XYQA 3TMEA 2HUGA 3IFTA 5CV8A 4DAPA 2WKCA 1RJTA 1SJHD 1AP0A 5CV4A 3K58A 3SK8A 4OIKA 1EY8A 3MXGA 3NWTA 3A8JE 1B9MA 4RGNA 1Q3LA 4A3BB 3GV3A 4XQJA 1W6JA 3K59A 1CT1D 2RSNA 4A3KB 5JVH3 4BBSB 4X3TA 1GOZA 5EKLA 5A2QL 1EL0A 1GHKA 1MGSA 2AUKA 2IX3A 3QO2A 1JOOA 2XRSD 1V1OA 3TZDA 5KYIA 1GUGA 4BY7B 2QF7A 4CKBA 3URYA 1D2BA 4PQXA 2B2WA 3T16A 3PO3B 3RD4A 1HA5A 2KOLA 1GHJA 4A3IB 3OHXC 1XXGA 3H3VC 1MI2A 3FVQA 1EZ6A 3GTJB 2RDFA 4IQZA 1DYQA 1ILPA 4OO1H 2DN8A 1V1PA 2FINB 4DN4M 1CHPD 2X6GA 3ONAB 1Q8IA 2L12A 2EY1A 2NN6H 5C3WA 2EY6A 5T1GA 4LK1C 4FF4A 4CHTB 3D8GA 2K33A 1HHVA 3GTKB 1JWSD 2A69C 4X3KA 3M4YA 1A3UA 2L1BA 5CV7A 4KKSA 3ERQA 4FXGC 5C4ZA 1EZ8A 4C3JG 1AEXA 5CC4A 1Z7TA 5IGFA 2Q8IB 1EEFD 2FMCA 4CKEA 1I6VC 3DWAA 3M7NA 2B2UA 1ZYRD 1STBA 2ENBA 2SNSA 4RKBA 3HS0C 2F03A 5JEAH 2LKVA 2F0TA 2FHTA 1FNVA 3BZDB 5JEAJ 3MZ5A 5KIXA 5IGGA 3DEOA 2E74C 4FXKC 4ZKCB 4KHZA 1F9RA 5KNCA 3J81L 3TBIB 4BS9A 4C3HB 5IODA 1EU4A 1EEID 3G7LA 3K57A 1KAAA 2F3WA 3BVMA 1L0XB 2IL8A 4PMCA 1KLUD 3J7AF 4WFN3 4GZYC 4CKCA 3NTIA 3TP8A 1D5ZC 4HEDA 4ZRZA 3WDNA 3D3RA 4ODGA 4XIGS 1I4HA 3S14B 4RHRA 4E6IA 5EPKA 1MSGA 1QG7A 1SMYC 3D4DA 4RH6A 2F0SA 4K2KA 4DK0A 2BA0A 3QB3A 4ZQ3A 3AU7A 1WD0A 2EYPA 5C4HA 5EPJA 3M3YB 4G7OC 1YNJC 2PO4A 3VR2A 1SNPA 1FYCA 3JAML 3D31A 2AQ3B 1QILA 2F0IA 4RGOS 2AWNA 2PW5A 3EA6A 3HEJA 3MXNA 2YYZA 4OO1G 5JPNC 4IFDJ 3K5LA 4XYOA 1CTMA 3NTHA 2EJFC 2RBMA 5I6WA 4K5WA 2F4IA 3IKJA 4XQQA 1C48A 1V8QA 1O7LA 2CW0D 4BWGB 3A8KE 2DNEA 2L55A 3D6CA 3LNNA 4FP5D 3S16B 1VF5C 4N9TA 1FR3A 3NWSA 1DOKA 1QNUA 4C2MB 1EQTA 2K01A 1G291 2EYLA 4QUCA 5D14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT1 B;  2R3Z A;  1LV9 A;  1QG7 A;  2J7Z A;  1DON A;  1MI2 A;  1NCV A;  4CJ2 C;  1EIH A;  2K04 A;  1F2L A;  2XIW A;  1EOT A;  2B2V C;  4IUT A;  1J9O A;  1O80 A;  1IKM A;  2B2Y A;  1SAP A;  1DZ1 A;  3H91 A;  1ILP A;  4R8I A;  1RTN A;  4MHE A;  1M8A A;  5CMD A;  2FIN B;  4DN4 M;  1HFG A;  2HDM A;  2MP1 A;  2MPM A;  2NZ1 D;  3IL8 A;  4R9W A;  1E0B A;  1WD1 A;  2B2U C;  2X6G A;  1DOL A;  2DY8 A;  4LMQ D;  3ONA B;  2HCI A;  4HCS A;  4MN3 A;  3UI2 A;  2L12 A;  3Q6S A;  2BDN A;  1WD0 A;  1PFM A;  3FPU B;  5T1G A;  2HUG A;  2N55 A;  2HDL A;  5EPJ A;  2FJ2 A;  1IKL A;  5EQ0 A;  1EIG A;  4CJ1 B;  1G2S A;  2EPB A;  1HHV A;  1PFB A;  1XX8 A;  1HUM A;  1AZQ A;  1G6Z A;  3LWE A;  4OIJ A;  5EKI A;  1RJT A;  2JYO A;  2L9H A;  1O7Z A;  3D6W A;  4IUP A;  3F2U A;  4X3K A;  1PLF A;  1ROD A;  1CM9 A;  1AP0 A;  4IUU A;  2L1B A;  2NYZ D;  1A15 A;  4XDX A;  1B2T A;  1J8I A;  1HA6 A;  1B3A A;  1KNE A;  2KEC A;  2B2T C;  4OIK A;  3I8Z A;  1WTV A;  1IL8 A;  1VMC A;  2KVM A;  5DNF A;  5JJZ A;  5D65 A;  1F9P A;  5EPL A;  2KUM A;  1X32 A;  5CBE E;  3DM1 A;  1MSH A;  1WTR A;  1AZP A;  1WTX A;  1RTO A;  2EOT A;  4XT3 B;  3TN2 A;  1GUW A;  1SSO A;  1Q3L A;  5AFW A;  2K28 A;  2B2V A;  2FMM A;  2B2U A;  1WTO A;  3FDT A;  2X6L A;  1CA5 A;  3GV3 A;  3IFD A;  1SDF A;  1NR4 A;  2N88 A;  3MTS A;  2RSN A;  1B53 A;  1S4Z A;  1U4P A;  2EE1 A;  1X3Q A;  2MGS A;  2KEE A;  4HSV A;  1KNA A;  2B2T A;  4RAU C;  4X3U A;  1QNK A;  2RSO A;  1PDQ A;  2FHT A;  4X3T A;  4ZK9 B;  1WTW A;  1BNZ A;  4ZLT F;  1G2T A;  1G91 A;  1ESR A;  4QUF A;  1DOM A;  1HUN A;  1VMP A;  1EL0 A;  2FFK B;  3DEO A;  4ZKC B;  4CJ0 B;  2SDF A;  1ICW A;  2K03 A;  3KBX A;  2K1B A;  1F9R A;  1NAP A;  4RWS C;  1PFN A;  1X3P A;  2CVR A;  1WVL A;  1MGS A;  2KED A;  2L11 A;  2Q8R E;  2RA4 A;  1B4O A;  1ML0 D;  2DY7 A;  3G7L A;  3HP3 A;  3I91 A;  4IUV A;  5E4W C;  1F9S A;  3SVM A;  1WTP A;  3P7J A;  4IUR A;  4NW2 A;  3QO2 A;  2B2W C;  2H1E A;  1WTQ A;  2IL8 A;  3TZD A;  5EJW A;  1ZXT A;  4X3S A;  1QE6 A;  4HAE A;  3I90 A;  1JE4 A;  2RVL A;  1ILQ A;  1DOK A;  5COR A;  4UAI A;  1B50 A;  1TVX A;  2D9U A;  2HCC A;  3R93 A;  1U4R A;  5COY A;  5T1I A;  3I3C A;  3KUP A;  4ZAI A;  4ZKB B;  1U4L A;  3N52 A;  2B2W A;  3MWY W;  4HED A;  3GV6 A;  3DEP A;  4IUQ A;  1BF4 A;  5E4X A;  4RA8 A;  4U68 A;  1O7Y A;  1CA6 A;  1EQT A;  1XYI A;  2M2L A;  4QUC A;  1BBX C;  1NR2 A;  2JP1 A;  2K01 A;  1HFN A;  2MJ8 A;  1JIC A;  1RHP A;  2Q8T A;  1F9Q A;  2X69 A;  2B2Y C;  2K05 A;  4O42 A;  2L4N A;  2KOL A;  1C8C A;  5EPK A;  1BO0 A;  5CBA E;  2NWG A;  1MSG A;  1U4M A;  2VXW A;  1HRJ A;  5D14 A; 
#chains in the Genus database with same CATH topology
 3E3X A;  2A68 D;  4L8J A;  3CCS A;  4PG3 A;  5IT9 E;  2K7V A;  2A19 A;  2UUA Q;  3ULL A;  2MFI A;  2QA4 A;  1TQO A;  2F0E A;  1S40 A;  1LTL A;  3OIQ A;  1GM5 A;  3HZX A;  1YBY A;  4A3E H;  3K6O A;  1X3G A;  2CH4 A;  1JB7 A;  1JWU D;  5JJK A;  4QQB X;  2SEB D;  3NEN A;  4P74 A;  2BDN A;  1OXS C;  2Z1C A;  4Y52 H;  2KCN A;  3OYY A;  3KFU A;  2AQ1 B;  3DM3 A;  2AQ2 B;  1ONL A;  2UUB L;  1OXX K;  4GLA C;  4LF9 L;  5IGD A;  3LGJ A;  2ZTC A;  1CM9 A;  1TWF B;  4JPB W;  1H9M A;  4P72 A;  5J39 A;  2ASB A;  1Y1V B;  3CHB D;  3L9A X;  2F4V L;  3BYT B;  2KVM A;  3S24 A;  5D65 A;  1EQR A;  2NVX H;  2UU9 L;  2DJG C;  1RD9 D;  1WTR A;  4X62 L;  2K50 A;  4KY5 A;  3T1H L;  1PVO A;  4XT3 B;  2GA4 B;  4A3F G;  3OPO A;  2NBF A;  5BN4 A;  2D2C C;  4PMB A;  4P73 A;  2ATW A;  2E2J B;  1WTO A;  1IBM L;  5TSS A;  5A2Q E;  3VR5 A;  1Q12 A;  3MTS A;  3M4O B;  1L0W A;  1RF2 D;  1QNK A;  4MZ9 A;  1A62 A;  1F2Y A;  4LAA A;  4A93 G;  4QUF A;  4IJL A;  1DOM A;  1Q86 C;  3S14 H;  1CKN B;  1LTA D;  4YY3 L;  1SRO A;  2F0U A;  1H9J A;  2K1B A;  3ERO A;  4YWL A;  3KF6 B;  3ICE A;  3UDF A;  3F2C A;  1F9S A;  1W2B A;  4KTA A;  2G9H D;  4NW2 A;  3J80 L;  2R92 G;  2H1E A;  1VQB A;  3SK6 A;  4B9W A;  4X3S A;  4UP9 A;  4HAE A;  1OO9 B;  2BCO A;  1YNN D;  1ILQ A;  1YHA A;  4UAI A;  1A2U A;  3FPP A;  2RQX A;  3L7Z C;  3BYY B;  2KQ3 A;  4IPH A;  4ZKB B;  1L0Y B;  5E1F A;  1SNC A;  1EY4 A;  1RDP D;  1TKW B;  3RLN A;  3GTM B;  4JOI C;  3QOL A;  1CKN A;  2NVQ B;  2EY5 A;  5C5L A;  1KDA A;  3OMG A;  1TWC H;  5CBA E;  1W6K A;  4QF4 A;  2VXW A;  3S17 B;  1HRJ A;  1Z6H A;  4XT1 B;  2E2I H;  2K04 A;  1AFP A;  5FLM H;  4H7B A;  1QOH A;  3W5O A;  1EWC A;  3I56 A;  1Y1W B;  4HCS A;  5FLX E;  2K4K A;  2MQH A;  3UI2 A;  1HZA A;  3RNU A;  2F0Q A;  4DK1 A;  3FPU B;  3OIP A;  2HIV A;  2PPB C;  4ME3 A;  3ZJY C;  1GUN A;  1YZ6 A;  1HUM A;  3VYS A;  3A56 A;  3SEB A;  3CCQ A;  1PMR A;  1G6Z A;  5LMU L;  4PZ6 A;  4MIU A;  1TS4 A;  1H9K A;  2WIN B;  5FLX L;  1PLF A;  1XNR L;  4LF5 L;  4KY6 A;  2EY2 A;  4QMG A;  2CWA A;  1VQO A;  4A75 A;  1KNE A;  2GN5 A;  4UHV A;  1WTV A;  3HOX G;  5C44 H;  1I3Q H;  1AN8 A;  2ICE C;  3MXU A;  2R7Z G;  5JOB A;  2UXB Q;  2X6L A;  3AEV A;  2Q2I A;  3C1F A;  4L5T A;  1B8A A;  5ELO A;  3HKZ E;  2Q2U A;  2RSO A;  2CQO A;  4NKL A;  4ZK9 B;  4BBR B;  1TWG B;  4C3H H;  1HUN A;  2XSC A;  3CU7 A;  1HR0 Q;  4OGQ C;  3KLR A;  3PO3 H;  3I4O A;  1STA A;  5HUR A;  4B3M Q;  1IYJ B;  5C4X G;  2QEJ C;  4JI2 L;  4HN7 A;  5M5Y H;  4AYB E;  4FF1 A;  2NN6 G;  4Y7N B;  2XVS A;  1LLR D;  4XQN A;  3KJO A;  1PFS A;  1SBB B;  2MHV A;  5HGQ A;  1IW7 C;  3CCJ A;  3NEM A;  5T1I A;  3MFY A;  2XN9 C;  3J7Y W;  2JEA I;  4NPS A;  1F2Z A;  2PW7 A;  2OF1 A;  3GV6 A;  5E4X A;  1EIY B;  4C3H G;  2M2L A;  3ZYY X;  3I4M G;  1HJP A;  4RMF A;  1BBX C;  1SNQ A;  5NUC A;  3SE0 A;  1X6O A;  2XWJ B;  3BVG A;  3CC7 A;  3ULP A;  5C4X B;  2DNC A;  4IOC A;  2Z6B A;  1I4Q A;  2VS1 A;  5ELB A;  3CCM A;  1L1O B;  2WB1 E;  4WRD A;  4IUT A;  2B2Y A;  1SAP A;  3VYU A;  1I50 B;  3A7A B;  4LFC L;  1NUC A;  5M9O A;  1VQ4 A;  3J80 E;  1FJG Q;  3S2D H;  3IL8 A;  4OEL B;  1XTD A;  4RCO A;  5EAY A;  2WB1 B;  3M85 A;  3V96 A;  4LW1 A;  3NEL A;  1K8G A;  1K8O A;  1QVC A;  1H9S B;  1N36 L;  4DV6 Q;  1XJV A;  2OQ0 A;  3GO5 A;  3CRL C;  2Y0S E;  5FJ8 H;  1CQV A;  5M5W H;  2E2I B;  1R4P B;  4IFD H;  4GNX C;  1PZJ D;  3M4Q A;  4A3I H;  4DNR B;  4EVO A;  2O5I C;  4UY8 C;  3M4P A;  1UUP A;  2RDH A;  2K75 A;  1PTO B;  1VQN A;  2EOT A;  1P8L A;  1X54 A;  1AW7 A;  2UUC Q;  4LF6 Q;  5BN5 A;  5C6A A;  1SYG A;  4JOI A;  1N34 L;  4A3C H;  1CZG A;  1N33 L;  3S1R H;  3NBI A;  4BY7 H;  1NR4 A;  3E9H A;  1U4P A;  4YIJ A;  3TRE A;  5M3M B;  2DJF C;  1G91 A;  4B3T L;  2LY7 A;  3U9O A;  1I6H H;  1PH1 A;  3LX0 A;  1SMX A;  2FFK B;  1UWV A;  1QWY A;  3H15 A;  2IPK D;  4MTN A;  4R8I A;  3HP3 A;  3S1Q H;  3SVM A;  4LF9 Q;  3RZD H;  2OTL A;  1EWH A;  5EJW A;  1KRS A;  3NSW A;  3I72 A;  3I90 A;  2A68 C;  2A1A A;  4DR6 L;  1BXT A;  1CA6 A;  1VQH A;  2K5H A;  3PSI A;  1XYI A;  3T51 B;  1IXR A;  4K6L A;  1STY A;  2IY5 B;  2B63 H;  1LT5 D;  4OWT B;  1PH5 A;  2E2H B;  2NTS A;  2C5C A;  3K5O A;  1A6X A;  1YEZ A;  2IHE A;  2K5Q A;  4DV4 L;  1PH7 A;  3K80 C;  3VA7 A;  4LF6 L;  4RHS A;  4LUV A;  3C46 A;  1KDC A;  1ASZ A;  3S1Q B;  3CP0 A;  2NUC A;  4MHE A;  1TR5 A;  2ZJR A;  2A8V A;  2JSO A;  3R3O A;  1WOC A;  1E0B A;  1K83 H;  1DD2 A;  5C0X I;  3J7Z C;  2PI2 E;  4A3E B;  1KL9 A;  4X6A H;  4AIM A;  2GVB A;  4CJ1 B;  1PFB A;  2M00 A;  1FD7 D;  2E75 C;  4V0B A;  1QZH A;  3M3Y H;  1BOS A;  2EXZ A;  1PTO H;  1ZEQ X;  4C3I G;  4DR2 L;  1J8I A;  4KJO A;  4B9X A;  3NE5 B;  5DNF A;  3OTO L;  2JA8 H;  2UXC Q;  2MNA A;  5EPL A;  2M9V A;  3TSS A;  1TWG H;  1WTX A;  4PNY A;  1T5E A;  3TN2 A;  2R61 A;  2V1C C;  1NE3 A;  3RMH A;  2JA7 H;  1Z9F A;  3P20 A;  3KDF A;  1F77 A;  4DUY Q;  2Q2T A;  4G4K A;  2KCT A;  1FGU A;  3JAM E;  3STB D;  2KEE A;  3S9W A;  2EVB A;  3NXW A;  4KY7 A;  4JYA L;  1ENC A;  2JA9 A;  4ZLT F;  3S2H B;  3BJU A;  3PF5 A;  1S5F D;  1Y8P B;  1DCZ A;  1I3Q B;  3PIO 3;  2SOB A;  4BBR G;  3HOV H;  2EYO A;  4JI8 Q;  4RWS C;  5DLQ E;  3J81 c;  4BXX H;  1VQ8 A;  2KED A;  2L11 A;  3PO3 G;  5DAU A;  1WTP A;  5C3E H;  1M4V A;  4GNX B;  2JA5 B;  4F8M A;  4LFA L;  4RKL A;  1OTC A;  4JI5 Q;  1BR9 A;  2L5T A;  1PZI D;  1D6E C;  3KBG A;  1IBL L;  1TVX A;  4JI3 Q;  1M90 C;  3PO2 H;  2F0P A;  5FKA C;  1VDZ A;  1CHQ D;  1EU3 A;  2K52 A;  4DR3 L;  4RA8 A;  1LYL A;  1O7Y A;  2Z4H A;  5DM7 3;  4DR5 L;  1JOR A;  1D5M C;  4DV3 Q;  3OTO Q;  1VQJ A;  4A3G G;  1PXU A;  5K36 H;  4Y7N H;  1N32 L;  5ELE A;  2OTJ A;  1DON A;  4HCE A;  1TWA B;  4DUZ Q;  3VA5 A;  1YJ9 A;  4GKK Q;  1MD2 D;  4FDB A;  1WFQ A;  1J9O A;  1JE5 A;  1QJO A;  4DV5 Q;  1IBK Q;  1WCM H;  4WJ3 M;  4TRD A;  3X3N A;  1OXT A;  1STH A;  4ZYS A;  1FL0 A;  2MP1 A;  2EYH A;  2NZ1 D;  2UUA L;  1SR3 A;  2NZH A;  4JBW A;  4BXX G;  4JYA Q;  1DOL A;  1VQ9 A;  2HCI A;  3HKZ B;  1UAP A;  4BBR H;  1STE A;  2K5V A;  3VR6 A;  1GD7 A;  1XMO L;  4DXF A;  3PUW A;  4JI8 L;  2KHI A;  2PZW A;  3P75 A;  1EY7 A;  4PZ7 A;  2KEN A;  4UP8 A;  3J7A V;  4ALP A;  3GTO B;  3LWE A;  3AFP A;  4BY1 B;  2F0O A;  4LF7 Q;  1LT4 D;  2JJQ A;  3ITP A;  2VQE L;  3Q23 A;  3W3A A;  4JI7 Q;  4X62 Q;  1CKO A;  2NVY B;  1QCB D;  3A7L A;  5JJZ A;  5IWA Q;  3GTQ H;  4IFD G;  3TRZ A;  3GTG B;  4JW0 A;  1JJG A;  2K28 A;  5FOB B;  4JI4 Q;  4A76 A;  4IFD I;  1WTH A;  2F0D A;  4Z9C B;  2WV6 D;  3IFD A;  3HKS A;  2R7Z H;  4LFC Q;  5C44 G;  5KGU A;  4X3U A;  4C1N K;  4NXN L;  3WWV A;  1MJC A;  1VMP A;  4A93 B;  3I7F A;  3KF8 A;  4CJ0 B;  4C3J B;  2KJX A;  4GNX A;  4LFA Q;  2K14 A;  1N36 Q;  3QJY A;  1YNX A;  1VQC A;  4JVZ A;  1PRT C;  3S2H H;  4KHV A;  1NBW A;  3FHW A;  5C3X A;  1VQM A;  4JI5 L;  2VB3 X;  4L5R C;  2LSS A;  3GTJ H;  3PO2 G;  3MHB A;  1E22 A;  4A4I A;  3VR4 A;  1SE3 A;  1HXY D;  4TSS A;  1HQM C;  2A6H C;  2D0P A;  3DLL A;  2OWO A;  3OWF A;  4ZAI A;  3H3V I;  3G48 A;  5IYC H;  3GTM H;  4M1U B;  1HH2 P;  1MIU A;  3OWE B;  4DV3 L;  3CPF A;  1JMC A;  3TP6 A;  1RL2 A;  2B29 A;  4IPG A;  2CKZ B;  3BU2 A;  2VZA A;  2B2Y C;  1A2T A;  1BO0 A;  5M3M H;  2R3Z A;  5IP7 G;  1PRT F;  4PMW A;  4JI0 Q;  3CCU A;  4FNF A;  2BA1 A;  1F2L A;  1TWH B;  2ZXO A;  1PH9 A;  3MAQ A;  2XRQ D;  4DFA A;  1CUK A;  1HFG A;  3K81 C;  1UNS A;  1Y1W G;  1GUO A;  2IX0 A;  2Y0S G;  1XMO Q;  1VF7 A;  4NXN Q;  2N8N A;  3TEH B;  1NY4 A;  4FF2 A;  5H1S E;  3HOZ H;  2R92 H;  3A74 A;  1SEB D;  5LMN W;  1O7I A;  4DV2 Q;  1X9N A;  2BOS A;  1U9R A;  4ZUJ A;  4A3J H;  4IUU A;  1MHW C;  1D1I A;  3KOJ A;  3MXP A;  2E2H H;  2LMC B;  2TMP A;  3EVQ A;  4H0L C;  1A0I A;  3O13 A;  2ZM6 L;  1TWF H;  4EQN A;  5J22 A;  3HOU G;  5IYD H;  1I50 H;  3T1Y L;  1C7Y A;  3SGI A;  1GKH A;  4XXE A;  2NTT A;  4O0A A;  5M3F G;  1K3R A;  4GS3 A;  1TWH H;  1TS2 A;  4LJZ C;  1S4Z A;  4FVM A;  1X3Q A;  1TT2 A;  2CWP A;  1KNA A;  3HOZ B;  2PMZ E;  1WTW A;  4L5Q A;  1G2T A;  1BBW A;  2V4D A;  5GAE C;  4DV0 L;  1PRT B;  4KN4 C;  5FLM G;  2B63 G;  3KLS X;  2KHS A;  1I6H B;  2A6H D;  3BZC A;  2FXQ A;  4ZCK A;  4FXD A;  3I91 A;  3BG3 A;  3IAY A;  3P7J A;  2LXK A;  2PMZ B;  3A55 A;  4RCN A;  1LAC A;  1NSN S;  2VQF Q;  4BBS H;  1Q81 C;  3HOY H;  2I07 B;  1X3E A;  1N8R C;  3BS1 A;  1QE6 A;  5LHY 1;  3R8B A;  2HIX A;  2RVL A;  2F0F A;  4K5V A;  3S1R B;  5CV9 A;  1B50 A;  2CH4 W;  3W1B A;  1DM0 B;  3I4L A;  2QKI C;  3I4M B;  1RCV D;  5COY A;  1S5E D;  3HOZ G;  3H0G B;  4PV1 C;  1IKM A;  2Z4I A;  4IUQ A;  2WAQ E;  4U68 A;  5IGC A;  3G6J B;  1TS3 A;  1PYS B;  3NBH A;  4A3M B;  4YCV A;  3U4V A;  3I4N B;  1U4M A;  1JR0 D;  4K8J A;  5I9O A;  2F3I A;  3ULJ A;  2J7Z A;  1IZ6 A;  1TWA H;  5E7N A;  5M5W B;  3GQB A;  2PZU A;  2RF4 A;  2JEB I;  4RGM A;  1YHQ A;  4K0K L;  5J1Z A;  4DV7 Q;  2E5L L;  4A93 H;  2Z0S A;  4EQO A;  1G8Z D;  4HIO A;  4ID6 A;  3CRK C;  1C0A A;  1VQK A;  4YY3 Q;  3GTP B;  2ZXR A;  4X64 Q;  2F0G A;  4DV6 L;  4JG2 A;  1SMY D;  2WII B;  3BDL A;  3HOW G;  4DR4 L;  1STG A;  2MUY A;  2OQK A;  1KIX A;  5A35 A;  1IBL Q;  3FRP B;  1AZQ A;  4OO1 I;  5EKI A;  1OXV A;  2JYO A;  2Z6K C;  5C3E B;  5G3L F;  1BBU A;  4H13 C;  4LUO A;  1B2T A;  4TQU S;  4JV5 L;  5ELC A;  1VMC A;  2EQS A;  1NMG A;  2TSS A;  2NVY H;  4I65 A;  4F88 A;  3MC0 B;  3BZK A;  3JC6 6;  4F7X A;  1RTO A;  3HOX H;  4RGT A;  1SSO A;  2OCE A;  2RKS A;  2NVT B;  4RFB A;  1OXU A;  2ICI A;  3GTO H;  1HTL D;  2F0K A;  1KAB A;  2ZXP A;  1SNM A;  3K0X A;  3EBE A;  2F1M A;  3H09 A;  1BCP C;  3CPW A;  2JA7 B;  4R4T A;  5CV5 A;  4HSV A;  1LTS D;  4JI1 Q;  2WKD A;  4ULL A;  2VB2 X;  2UXD Q;  4JBJ A;  2Q2H A;  4HSP A;  4CGY B;  2D62 A;  1UE5 A;  1LO5 D;  5BR8 L;  1NAP A;  4ABN A;  1V1P B;  3Q24 A;  4HIM A;  1HCZ A;  1ML0 D;  3D4R A;  4QL5 A;  3UDI A;  3RN5 A;  3C1E A;  2O4X A;  1HQR D;  1PH4 A;  1VS0 A;  3F1Z A;  3M9B A;  5M5X B;  4DR4 Q;  2CHB D;  4KD3 A;  4KI0 A;  2HCC A;  4I7Z C;  5IWA L;  3CCE A;  2O2L D;  3TDQ A;  3MWY W;  5CYU A;  1XNR Q;  1ET9 A;  3KYH C;  4JV5 Q;  4DXG A;  3GTQ B;  5J3B A;  1KQS A;  1HFN A;  4C3I H;  5CGK A;  4O42 A;  4R8N A;  4DAV A;  1C8C A;  5I2X A;  4YCW A;  5ELN A;  1R9T H;  4CJ2 C;  3NBH B;  1Y8O B;  4K0K Q;  1L2F A;  1EYD A;  2EZV A;  2JN4 A;  1ESF A;  3ND8 A;  4CDE C;  1HNW Q;  2OXP A;  3GD7 A;  1G6P A;  3E0E A;  4POF A;  5KRU A;  4JI1 L;  5EGT A;  2PZT A;  3EFX D;  1I94 Q;  1PH8 A;  1BVS A;  3NUC A;  3QWN A;  3DXJ C;  4KN7 C;  4X66 L;  3NTK A;  4YHH L;  2OEO A;  4LNQ A;  3CF5 A;  2PI2 A;  2WAQ B;  3I70 A;  1BUV T;  1CKM A;  4GKJ L;  3HOY B;  1XX8 A;  4ZUI A;  4LFB Q;  4EQP A;  2VNU D;  2AKW B;  3KDF B;  4M8A A;  2NYZ D;  1C4Q A;  4XDX A;  2UUB Q;  3HOX B;  3MEH A;  3CCR A;  1EYC A;  2KEC A;  2QIL A;  3QIA A;  5C0X H;  2JXM B;  2F0W A;  2JA8 B;  1F9P A;  3AYH B;  2R6G A;  5CBE E;  1S72 A;  1MSH A;  4GOP A;  4FYD A;  1Y8N B;  1SE4 A;  1XPR A;  4C1N I;  1EIF A;  1Y69 U;  5IP9 G;  1XMQ Q;  3HOU B;  3C2P A;  3UE1 A;  1VQ7 A;  4OWW B;  2PQA B;  3PV0 A;  1VQP A;  1ICF B;  3QG1 A;  3JAM i;  1CZW A;  1RIP A;  4NP5 A;  3SR1 A;  1IL2 A;  3PUY A;  2RCN A;  4IJH A;  5BR8 Q;  4KV6 A;  3GTL H;  3HOV B;  1SE8 A;  1TU2 B;  3I73 A;  3D4W A;  2K03 A;  2JA8 G;  5EBD A;  2Q8R E;  1B4O A;  2DY7 A;  1JC7 A;  2JE6 I;  4YWK A;  1UEB A;  4LUZ A;  3M4O H;  2A5H A;  1K0S A;  3RN2 A;  2IX1 A;  4KLK A;  1X3F A;  4X65 L;  2C9O A;  2ZTE A;  1U4L A;  2VY3 A;  3A8I E;  4JK1 C;  3OOC A;  2ZM6 Q;  2YTY A;  4DNT B;  2F0H A;  3S2D B;  1NR2 A;  3K5M A;  1MBY A;  1JIC A;  1RHP A;  4B08 A;  4A3I G;  2X69 A;  2RCF A;  4K8I A;  1G51 A;  4OXP A;  4A3M G;  4KK7 A;  1H9R A;  4FO2 A;  4K2L A;  3HOU H;  1N32 Q;  3V05 A;  1ZYR C;  2Z8L A;  4N9P A;  1YVC A;  3TS0 A;  5AJ3 L;  2XGT A;  4BA1 I;  1I94 L;  3L0O A;  5C4J H;  2A6E D;  5F2D A;  4HJ8 A;  1SFO H;  4OON A;  3PUX A;  2NB0 A;  3E5S A;  3PMF A;  4YHH Q;  1T5X D;  4A3J G;  4DU9 A;  1JQY D;  1J6Q A;  1S5B D;  3TP7 A;  3W2D A;  1WYD A;  2QCP X;  1YNN C;  1GUS A;  2A69 D;  1JWM D;  4FF3 A;  4K14 A;  4IO9 A;  2XNA C;  2L9H A;  1LT6 D;  2E76 C;  2R7D A;  4LF4 Q;  1I4G A;  1ROD A;  1ZKO A;  5I4D A;  4C3J H;  4A3K G;  3FKI B;  1LTR D;  2R93 G;  1EY6 A;  2B2T C;  3I8Z A;  1TY0 A;  4OL7 A;  3G6E A;  3OW7 A;  2BE5 C;  1JT8 A;  5FLX c;  3PUZ A;  2XWB B;  2Y0S B;  3K5N A;  3MFG A;  5EBC A;  2AHO B;  1QVF A;  5C5M A;  4J15 A;  1J5E Q;  2I5M X;  3H6M A;  3HG9 A;  2R7Z B;  3FMC A;  1YI2 A;  5L37 A;  1L1O A;  4HMI A;  5I9P A;  3E9I A;  4DV7 L;  2WFW A;  3NQT A;  1D8L A;  5EKK A;  3SK5 A;  5C4X H;  1K73 C;  4KHP L;  1D1K A;  1UE7 A;  4WJW A;  1K3B C;  1SNO A;  4I7A A;  2NN6 I;  4QB4 A;  4Q0F A;  3SDZ A;  1CK1 A;  4YWM A;  1MKH A;  4Q5V A;  1IHZ A;  3PF4 A;  5GAG C;  1WCM G;  1Y14 B;  3H0G G;  4AYB G;  3S1N B;  3C3L A;  4DA2 A;  5KNB A;  1Q46 A;  2I0Q A;  1R4Q B;  4QIW B;  1TS5 A;  2D0O A;  1E2Z A;  4DF7 A;  4LF5 Q;  2QW7 A;  5M5X H;  1AH9 A;  1ENF A;  2L0C A;  2VUM B;  2F0M A;  4G7H C;  1Q1B A;  1YNJ D;  1VQI A;  1VQ5 A;  5DM6 3;  3V2T A;  3I3C A;  3KUP A;  1CI3 M;  4AYB B;  2Z9H A;  5KYL A;  3ERS X;  4DR2 Q;  1JCK B;  3CQZ B;  5FO9 B;  3NHH A;  3CC2 A;  1WCM B;  1VCI A;  5CR3 A;  1MJE A;  1HZB A;  2PCF B;  5M5Y B;  1LTB D;  3CCL A;  4A3G B;  3DWQ A;  2JQO A;  4DKA C;  5AJ3 Q;  5LMN L;  2CQA A;  1DXM A;  1S5C D;  4IN3 A;  3CXC A;  3CQZ H;  4R9W A;  1Q90 A;  1EYA A;  3J80 i;  4L63 B;  1WD1 A;  2IJ0 A;  4B3M L;  1LTT D;  2LFN A;  2JA6 B;  2B3G A;  3S15 B;  5ELD A;  4GN5 A;  2WB1 G;  2E8G A;  1PZK D;  1EFI D;  3P1H A;  1EIG A;  1KAW A;  4DGZ A;  1KHI A;  4HID A;  1Q1E A;  4IUP A;  3SXH A;  2QDB A;  3RZO H;  1B3A A;  2JA6 G;  5C44 B;  2K5D A;  3NP8 A;  2IT1 A;  3DUZ A;  3CC4 A;  4UDU C;  2HT1 A;  1X32 A;  1BDO A;  5ISR A;  1J5E L;  2HHH L;  4DR3 Q;  4O1N A;  2SNM A;  4A3F B;  1I4R A;  4GN3 B;  1I4X A;  1YIT A;  1CA5 A;  1SDF A;  1VQL A;  1HNX L;  3L3O C;  3U58 A;  2WP8 J;  1D5X C;  4TVA B;  2ZJP A;  3PUV A;  5IP9 H;  4A3G H;  3QOJ A;  5I2Y A;  5M3F B;  3U9S A;  2EYM A;  2ID0 A;  5LL6 S;  1ICW A;  3H3V H;  3KBX A;  3DHQ A;  1X3P A;  3DWP A;  4GKJ Q;  1QZG A;  2KHJ A;  4DAY B;  2VUM G;  3HGB A;  3Q0A A;  5IGB A;  1TII D;  3G4S A;  3HRZ C;  3BDO A;  1EQV A;  3TP5 A;  3KLW A;  4QCL A;  3J7A 5;  1TXY A;  3R2I A;  2PNR C;  3R93 A;  5LMU Q;  1U4R A;  2E2D C;  1L1O C;  4EGV A;  1JJ2 A;  3DEP A;  3S1N H;  4KKU A;  1E2V A;  2KCM A;  4JI7 L;  3DMU A;  2Q8T A;  1KRT A;  1CFM A;  1H95 A;  4HJA A;  5LMN Q;  2GVA A;  3M7G A;  1LV9 A;  1PTO C;  4JI4 L;  2XIW A;  1EOT A;  4IUN A;  4HR7 B;  4DV4 Q;  1PRT D;  1O80 A;  1O78 A;  1LTG D;  1DZ1 A;  1HNX Q;  3HFZ B;  2KA7 A;  2IWH A;  1PV4 A;  2I5L X;  5CMD A;  2O5J C;  2C35 B;  1SRU A;  2BE5 D;  4JBK A;  5D3I B;  3RLO A;  2WAC A;  4NXM Q;  3NPP A;  4A3L G;  4X64 L;  3CME A;  2DY8 A;  4MN3 A;  4DK3 C;  1ASY A;  1W3S A;  1M1K C;  2ZJQ A;  1IYV A;  4GLV B;  1HR0 L;  4JI6 L;  1KDB A;  1PA6 A;  2LS0 1;  4JBM A;  4R4Q A;  2HDL A;  3H94 A;  2FJ2 A;  1IKL A;  5EQ0 A;  4A3C G;  4JC0 A;  4A3D B;  3Q22 A;  3D6W A;  1O7Z A;  2N78 A;  1PTO F;  5HGT A;  4HIK A;  2F0V A;  2ZTD A;  3MVV A;  1A15 A;  3I4N H;  2K6A A;  1TWC B;  3F2D A;  3QR8 A;  1GUT A;  1IL8 A;  1K8A C;  3Q8D A;  2ALY B;  1YIJ A;  5M3M G;  2NVQ H;  2KUM A;  2A6E C;  3DM1 A;  1SJE D;  1UEA B;  5JPM C;  1SFO B;  2KCC A;  2B39 A;  5CV6 A;  5FJ8 G;  3PIP 3;  5AFW A;  1IW7 D;  1QB5 D;  4A3D G;  1A3V A;  2B2V A;  1PYB A;  3RLF A;  5IYD G;  4H44 C;  1EY5 A;  2IW3 A;  4DAM A;  4GOP C;  1WJJ A;  3SK4 A;  1HPC A;  1B53 A;  2MO1 A;  2UXD L;  3LWU A;  2B2T A;  4DUY L;  4RAU C;  1PDQ A;  4MNO A;  1BNZ A;  4KKT A;  4CDF C;  1EY9 A;  4DV1 Q;  1CSQ A;  2QGQ A;  5IYB G;  2VW9 A;  2J0T D;  4IPC A;  1IYU A;  4JI2 Q;  4P2C B;  2CVR A;  1WVL A;  4GN4 B;  3E0J A;  4IZ8 A;  3GP7 A;  1KC8 C;  4IUV A;  3S1M B;  5E4W C;  4G7Z C;  3K0Y A;  5HY6 A;  2BH8 A;  2N3S A;  1WTQ A;  1GXD C;  3W1G A;  1I4P A;  1JE4 A;  3PIO A;  2PYK A;  2UXC L;  5IT9 L;  5BN3 A;  2D9U A;  2AMC B;  5I6Y A;  1B70 B;  3KF6 A;  4HMJ A;  3J80 c;  2UU9 Q;  4EX5 A;  1BQQ T;  3MA2 B;  2CW0 C;  1SND A;  4JI3 L;  5FO7 B;  1YJN A;  4WOR A;  4V19 0;  1EWI A;  5FK9 C;  4U67 3;  1U5K A;  5IP7 H;  1TY2 A;  4DR5 Q;  3WOE A;  2NWG A;  5G3L D;  4ME5 A;  3RR5 A;  3AMU A;  4A3J B;  3AB9 A;  1NCV A;  1AE3 A;  3CMA A;  2EDG A;  3RZD B;  1N34 Q;  2B2V C;  1HZC A;  4DAY A;  1LAB A;  3S1M H;  1FNW A;  1Y1V G;  1KTK A;  2B8G A;  3A5Z B;  3U50 C;  4DUZ L;  4KD4 A;  1M8A A;  2A74 C;  2HDM A;  4J1M A;  4IAL A;  3GTL B;  3A0J A;  1KLG D;  3CKI B;  2IHF A;  3Q6S A;  1GVP A;  1E2W A;  5C4J B;  1LM0 A;  1STN A;  2N55 A;  5JJI A;  1PTO D;  1VQG A;  4BY1 H;  1K9M C;  2EXD A;  2EPB A;  1FGB D;  4R4C A;  4A3B G;  4JCV E;  4OIJ A;  2K5W A;  4XTC S;  3HOY G;  1K0R A;  2R93 B;  4N8F A;  1X55 A;  3F2U A;  3OMC A;  1HA6 A;  4LF7 L;  1LT3 D;  3UE0 A;  5K36 G;  1B1Z A;  4G57 A;  4LF8 Q;  1QUQ A;  1SYD A;  2KBN A;  2NZO A;  1AZP A;  2B8F A;  3HOW B;  3CCV A;  1GUW A;  1N33 Q;  3OW2 A;  1HR0 W;  2OT2 A;  2FMM A;  3FDT A;  4A3D H;  4S3S A;  2N88 A;  2DUD A;  5FO8 B;  2NVT H;  5JAV A;  3A54 A;  1SE2 A;  1R9T B;  4R4I A;  4HTH A;  3K7A B;  1ESR A;  1B44 D;  5IOC A;  2N49 A;  4IPD A;  5KEE A;  4B3S Q;  3ND9 A;  3WOF A;  1XTC D;  5IIF A;  1DGS A;  1BCP D;  2PQE A;  2RA4 A;  1JOQ A;  3EN2 A;  1E24 A;  3EIV A;  1V43 A;  2JK8 A;  2YU9 H;  4L6T B;  4DR1 L;  4J6H A;  3GTK H;  1II3 A;  1ZXT A;  1SYC A;  4DNI A;  4L5S A;  2VQE Q;  5C0X J;  5COR A;  2YU9 B;  5D3D A;  3K8A A;  4J8Q A;  1RKN A;  4PZ8 A;  1NJI C;  4UP7 A;  2K32 A;  1SYF A;  1UE6 A;  2UXB L;  2MJ8 A;  5E3F A;  4OHJ A;  3FEW X;  2L4N A;  2CFM A;  4K5X A;  1VQA A;  4F87 A;  2EJG C;  4QGU A;  1V1Q A;  1EIH A;  3PGZ A;  1ET6 A;  3BVZ A;  2QEX A;  1VQ6 A;  1K8M A;  4BY7 G;  3OSO A;  1FNU A;  2RHS B;  2MPM A;  1E1T A;  3R2T A;  5C0X G;  2B2U C;  3BDC A;  4IOA A;  3J81 E;  1PYW D;  2EYF A;  4RG1 A;  1PFM A;  2BH2 A;  2VUM H;  4EQ5 A;  5C3E G;  1G2S A;  4BA2 I;  3EJI A;  4A3F H;  3JAM c;  2AWO A;  2G9D A;  1DJR D;  4OEM B;  3A5U A;  2L15 A;  4LF8 L;  1E1O A;  1EUJ A;  3D0F A;  1NNX A;  3NQI A;  2LXJ A;  4GOP B;  4LF4 L;  4C3I B;  2I46 A;  3T4A C;  4KMU C;  1LTI D;  1VQE A;  1PH6 A;  1E7Z A;  1JOK A;  2HQE A;  1BCP B;  1V9P A;  1F2M A;  4QJF A;  3RZO B;  1K83 B;  2WAQ G;  4H02 A;  1IBM Q;  3CD6 A;  2QDL A;  1XWE A;  2MO0 A;  1Q82 C;  1E3P A;  3PO2 B;  1EFW A;  3T1H Q;  3CW2 C;  2JA7 G;  4CBV A;  1HTP A;  3TZU A;  5JEA G;  3KK7 A;  1GJX A;  3ER0 A;  1B3Q A;  1NMF A;  1YJW A;  3T1Y Q;  2EE1 A;  4A3B H;  2MGS A;  1A8V A;  5ELF A;  3S15 H;  2J4X A;  3E6Z X;  2JA6 H;  2F3V A;  5IGE A;  1S5D D;  1EY0 A;  3UDX A;  2B63 B;  4KHP Q;  1HNW L;  1A3T A;  2NVX B;  3MEF A;  2Z6K A;  3RUZ A;  2SDF A;  1EQQ A;  4DV0 Q;  1JB3 A;  1PFN A;  5IY0 A;  1CQF A;  5K5P A;  5JVG 3;  2EYJ A;  4NDX A;  1Q7Y C;  3T56 B;  4IUR A;  2AUJ D;  2H4O A;  2B2W C;  4KJN A;  4C56 C;  2YV5 A;  3VYR A;  3NK9 A;  4OWX B;  4LWC A;  2EIF A;  1WI5 A;  3T13 A;  2R92 B;  4LFB L;  1I5F A;  3EQL C;  4R4O A;  2EJM A;  1BF4 A;  3N52 A;  4TKO B;  5LL6 X;  1Z47 A;  4NMZ A;  2RDG A;  1HNZ Q;  2JP1 A;  3X3M A;  1H9S A;  1F9Q A;  2K05 A;  2BDO A;  5IYC G;  2A73 B;  2F0J A;  4MTK A;  2D5D A;  2ES2 A;  4DV5 L;  1IBK L;  1SYB A;  4K6D A;  3KLS A;  3T53 B;  4A3K H;  1ENA A;  1NTG A;  2ZT9 C;  3AQQ A;  1BCP F;  1D7Q A;  3H91 A;  1SXT A;  1RTN A;  2F0L A;  3N6R A;  2F0N A;  3VR3 A;  1SYE A;  4LMQ D;  4ILW A;  1B9N A;  3I2Z A;  5DEH A;  2VQF L;  3SHL A;  5KND A;  3VYT A;  4XYQ A;  3TME A;  2HUG A;  3IFT A;  5CV8 A;  1A63 A;  4DAP A;  2F52 A;  5JJL A;  2WKC A;  2YTX A;  1KD1 C;  2E2J H;  1RJT A;  1Q8K A;  1SJH D;  1AP0 A;  5CV4 A;  1CSP A;  1QVG A;  4BY1 G;  1PH3 A;  3VDY A;  3K58 A;  3SK8 A;  4OIK A;  1EY8 A;  3MXG A;  3NWT A;  2HHH Q;  3A8J E;  3L2P A;  5GRO A;  4GKK L;  4X65 Q;  1B9M A;  4RGN A;  2I5H A;  1Q3L A;  4A3B B;  1HNZ L;  3B6Y A;  3GV3 A;  4XQJ A;  1W6J A;  1FVI A;  3K59 A;  1CT1 D;  2RSN A;  4A3K B;  5JVH 3;  4BBS B;  1LUZ A;  4X3T A;  1GOZ A;  5EKL A;  3GTG H;  1HZ9 A;  5A2Q L;  2PQA A;  1EL0 A;  1GHK A;  4DR7 L;  4A3L H;  2CCZ A;  1MGS A;  2AUK A;  2XTI A;  2IX3 A;  4UPA A;  3QO2 A;  1JOO A;  2XRS D;  1V1O A;  3TZD A;  3TS2 A;  4HJ7 A;  5KYI A;  2RHQ B;  1GUG A;  4BY7 B;  2P5Z X;  3KJP A;  2QF7 A;  4CKB A;  3URY A;  1D2B A;  1C9O A;  2G5D A;  4PQX A;  2B2W A;  3T16 A;  4C2M H;  3PO3 B;  2YTV A;  3RD4 A;  1HA5 A;  2KOL A;  1GHJ A;  4A3I B;  3OHX C;  2DGY A;  5M3F H;  1XXG A;  3H3V C;  1KXL A;  1MI2 A;  3FVQ A;  1EZ6 A;  2HQL A;  2PNH A;  3GTJ B;  2RDF A;  4IQZ A;  1FJG L;  4O2D A;  1DYQ A;  1ILP A;  4OO1 H;  2DN8 A;  1BKB A;  1V1P A;  3U4Z A;  2FIN B;  4DN4 M;  4B3S L;  4WJ4 A;  4JI6 Q;  1CHP D;  2X6G A;  3ONA B;  1Q8I A;  2L12 A;  2EY1 A;  2NN6 H;  5C3W A;  2EY6 A;  4NXM L;  1GO3 E;  5T1G A;  4R1J A;  4LK1 C;  4CHT B;  4FF4 A;  3D8G A;  1JJC B;  1T9H A;  2K33 A;  4X66 Q;  1HHV A;  4N8X 1;  3GTK B;  3F8T A;  3AFQ A;  1XNQ Q;  2R7F A;  1X65 A;  2JA5 H;  1U0L A;  1JWS D;  2A69 C;  4X3K A;  5IT9 c;  3M4Y A;  1A3U A;  2L1B A;  5CV7 A;  4DPG A;  4KKS A;  1EOV A;  3ERQ A;  4FXG C;  5C4Z A;  1QUQ B;  2K5N A;  1EZ8 A;  4C3J G;  1AEX A;  5CC4 A;  1Z7T A;  4POG A;  5IGF A;  2Q8I B;  1EEF D;  2JA5 G;  2FMC A;  4CKE A;  1I6V C;  3DWA A;  3M7N A;  4A3E G;  1S3O A;  2B2U A;  5GAD C;  2VL6 A;  2UUC L;  1ZYR D;  1STB A;  2ENB A;  2SNS A;  4RKB A;  3HS0 C;  4BBS G;  3TQY A;  4B3T Q;  2F03 A;  5JEA H;  2LKV A;  2F0T A;  4DV1 L;  4OX9 L;  3S17 H;  2FHT A;  1EYG A;  4DR7 Q;  1FNV A;  3BZD B;  5JEA J;  3F2B A;  3MZ5 A;  4QY7 A;  5KIX A;  5IGG A;  3DEO A;  2E74 C;  4FXK C;  4DK6 C;  4ZKC B;  4KHZ A;  4YCU A;  3G71 A;  1F9R A;  5KNC A;  1K28 A;  3J81 L;  3TBI B;  3STB C;  4BS9 A;  1EU4 A;  1EEI D;  3G7L A;  3PCO B;  4C3H B;  1N9W A;  5IOD A;  3K57 A;  1KAA A;  2F3W A;  3BVM A;  3K7U C;  1L0X B;  2IL8 A;  4CDC C;  3GDE A;  4PMC A;  1KLU D;  4B3R Q;  4DR6 Q;  3J7A F;  4P71 A;  3GTP H;  1YHB A;  4WFN 3;  4GZY C;  1XNQ L;  4P75 A;  4CKC A;  3NTI A;  3TP8 A;  1D5Z C;  4HED A;  3HKZ G;  4QIW E;  4ZRZ A;  3WDN A;  3D3R A;  4ODG A;  4XIG S;  1I4H A;  3S14 B;  4RHR A;  3J81 i;  1XMQ L;  4E6I A;  5EPK A;  1MSG A;  3K7A H;  3MXN B;  1QG7 A;  4GLX A;  4HJ5 A;  1SMY C;  3D4D A;  4RH6 A;  4APV A;  2F0S A;  2E5L Q;  3PIP A;  4HJ9 A;  4K2K A;  4OX9 Q;  4DK0 A;  3HOW H;  2BA0 A;  3KF8 B;  3QB3 A;  4ZQ3 A;  3H0G H;  1Y1W H;  3AU7 A;  1P16 A;  1WD0 A;  2EYP A;  4CDD C;  1Y1V H;  5C4H A;  5EPJ A;  3M3Y B;  4G7O C;  1YNJ C;  1VQD A;  4NB3 A;  1B7Y B;  1UE1 A;  2PO4 A;  3VR2 A;  1SNP A;  1FYC A;  3JAM L;  4AQY L;  1VQF A;  3D31 A;  2AQ3 B;  1PHJ A;  1QIL A;  2F0I A;  4RGO S;  2AWN A;  2PW5 A;  3EA6 A;  3HEJ A;  3MXN A;  2YYZ A;  1AE2 A;  3FKI G;  4OO1 G;  3IRB A;  5JPN C;  4JI0 L;  2R93 H;  4IFD J;  1PH2 A;  2H5X A;  5GAH C;  3K5L A;  4XYO A;  1CTM A;  3NTH A;  5GQO A;  2EJF C;  2HD3 A;  2RBM A;  5I6W A;  4K5W A;  2F4I A;  3IKJ A;  4XQQ A;  1C48 A;  1V8Q A;  5IYB H;  1O7L A;  1SN8 A;  2CW0 D;  4AH6 A;  4BWG B;  3A8K E;  2DNE A;  2L55 A;  4DV2 L;  3D6C A;  3CAM A;  3LNN A;  4B3R L;  4FP5 D;  3S16 B;  1VF5 C;  5IE8 A;  1XPO A;  4N9T A;  3FP9 A;  1FR3 A;  2F4V Q;  3NWS A;  1DOK A;  4DR1 Q;  3S16 H;  1QNU A;  4A3M H;  3HOV G;  3PQI A;  3UDG A;  4AQY Q;  4C2M B;  1EQT A;  3I55 A;  1SLJ A;  2K01 A;  3I4M H;  3I4N G;  1XPU A;  3FKI H;  3J81 j;  1G29 1;  2EYL A;  4QUC A;  5D14 A;  1X56 A; 
#chains in the Genus database with same CATH homology
 4L8J A;  2A68 D;  5IT9 E;  2K7V A;  1TQO A;  2F0E A;  3OIQ A;  3HZX A;  3K6O A;  1JWU D;  2SEB D;  2BDN A;  1OXS C;  2Z1C A;  2KCN A;  2AQ1 B;  2AQ2 B;  1ONL A;  1OXX K;  5IGD A;  1TWF B;  1CM9 A;  1H9M A;  5J39 A;  1Y1V B;  3CHB D;  3L9A X;  3BYT B;  2KVM A;  5D65 A;  1RD9 D;  1WTR A;  4KY5 A;  4XT3 B;  2GA4 B;  3OPO A;  2NBF A;  5BN4 A;  2D2C C;  4PMB A;  2E2J B;  1WTO A;  5TSS A;  5A2Q E;  3VR5 A;  1Q12 A;  3MTS A;  3M4O B;  1RF2 D;  1QNK A;  1F2Y A;  4LAA A;  4QUF A;  1DOM A;  1LTA D;  2F0U A;  1H9J A;  2K1B A;  3ERO A;  1F9S A;  4KTA A;  2G9H D;  4NW2 A;  3J80 L;  2H1E A;  3SK6 A;  4B9W A;  4X3S A;  4HAE A;  1OO9 B;  2BCO A;  1YNN D;  1ILQ A;  4UAI A;  1A2U A;  3FPP A;  2RQX A;  3L7Z C;  3BYY B;  2KQ3 A;  4ZKB B;  1L0Y B;  5E1F A;  1SNC A;  1EY4 A;  1RDP D;  1TKW B;  3GTM B;  3QOL A;  2NVQ B;  2EY5 A;  5C5L A;  1KDA A;  3OMG A;  5CBA E;  1W6K A;  4QF4 A;  2VXW A;  3S17 B;  1HRJ A;  1Z6H A;  4XT1 B;  2K04 A;  1AFP A;  4H7B A;  1QOH A;  1EWC A;  1Y1W B;  4HCS A;  5FLX E;  3UI2 A;  2F0Q A;  4DK1 A;  3FPU B;  3OIP A;  2PPB C;  1GUN A;  1HUM A;  3VYS A;  3A56 A;  3SEB A;  1PMR A;  1G6Z A;  4MIU A;  1TS4 A;  1H9K A;  2WIN B;  5FLX L;  1PLF A;  4KY6 A;  2EY2 A;  4QMG A;  1KNE A;  1WTV A;  1AN8 A;  2ICE C;  3MXU A;  5JOB A;  2X6L A;  3C1F A;  2RSO A;  4NKL A;  4ZK9 B;  4BBR B;  1TWG B;  1HUN A;  2XSC A;  3CU7 A;  4OGQ C;  3KLR A;  1STA A;  5HUR A;  2QEJ C;  4HN7 A;  4FF1 A;  2NN6 G;  4Y7N B;  2XVS A;  1LLR D;  4XQN A;  1SBB B;  2MHV A;  1IW7 C;  5T1I A;  3MFY A;  2XN9 C;  3J7Y W;  2JEA I;  1F2Z A;  2PW7 A;  2OF1 A;  3GV6 A;  5E4X A;  4C3H G;  2M2L A;  3ZYY X;  1BBX C;  1SNQ A;  5NUC A;  3SE0 A;  2XWJ B;  3BVG A;  5C4X B;  2DNC A;  1I4Q A;  5ELB A;  4WRD A;  4IUT A;  2B2Y A;  1SAP A;  3VYU A;  1I50 B;  3A7A B;  1NUC A;  5M9O A;  3J80 E;  3IL8 A;  4RCO A;  2WB1 B;  3M85 A;  3V96 A;  1K8O A;  1H9S B;  3GO5 A;  3CRL C;  1CQV A;  2E2I B;  1R4P B;  4IFD H;  1PZJ D;  4DNR B;  4EVO A;  2O5I C;  1UUP A;  2RDH A;  1PTO B;  2EOT A;  1AW7 A;  5BN5 A;  5C6A A;  1SYG A;  1CZG A;  3NBI A;  1NR4 A;  1U4P A;  4YIJ A;  5M3M B;  1G91 A;  2LY7 A;  3U9O A;  3LX0 A;  2FFK B;  1QWY A;  2IPK D;  4R8I A;  3HP3 A;  3SVM A;  1EWH A;  5EJW A;  3NSW A;  3I72 A;  3I90 A;  2A68 C;  1BXT A;  1CA6 A;  1XYI A;  3T51 B;  4K6L A;  1STY A;  1LT5 D;  2E2H B;  2NTS A;  2C5C A;  3K5O A;  1A6X A;  2K5Q A;  3VA7 A;  4RHS A;  3C46 A;  1KDC A;  3S1Q B;  2NUC A;  4MHE A;  1TR5 A;  2JSO A;  3R3O A;  1E0B A;  1DD2 A;  5C0X I;  4A3E B;  4CJ1 B;  1PFB A;  2M00 A;  1FD7 D;  2E75 C;  4V0B A;  1BOS A;  2EXZ A;  1PTO H;  1ZEQ X;  4C3I G;  1J8I A;  4KJO A;  4B9X A;  3NE5 B;  5DNF A;  5EPL A;  2M9V A;  3TSS A;  1WTX A;  4PNY A;  1T5E A;  3TN2 A;  2R61 A;  3RMH A;  3P20 A;  1F77 A;  4G4K A;  3JAM E;  2KEE A;  3S9W A;  2EVB A;  3NXW A;  4KY7 A;  3S2H B;  1ENC A;  4ZLT F;  1S5F D;  1Y8P B;  1DCZ A;  1I3Q B;  3PIO 3;  2SOB A;  2EYO A;  4RWS C;  2KED A;  2L11 A;  5DAU A;  1WTP A;  1M4V A;  2JA5 B;  4F8M A;  4RKL A;  1BR9 A;  2L5T A;  1PZI D;  1D6E C;  3KBG A;  1TVX A;  2F0P A;  5FKA C;  1VDZ A;  1CHQ D;  1EU3 A;  4RA8 A;  1O7Y A;  2Z4H A;  5DM7 3;  1JOR A;  1D5M C;  1PXU A;  5K36 H;  5ELE A;  1DON A;  4HCE A;  1TWA B;  3VA5 A;  1MD2 D;  1J9O A;  1QJO A;  4TRD A;  3X3N A;  1OXT A;  1STH A;  4ZYS A;  2MP1 A;  2EYH A;  2NZ1 D;  4JBW A;  1DOL A;  2HCI A;  3HKZ B;  1UAP A;  1STE A;  3VR6 A;  4DXF A;  3PUW A;  2PZW A;  3P75 A;  1EY7 A;  3GTO B;  3J7A V;  3LWE A;  4BY1 B;  2F0O A;  1LT4 D;  3ITP A;  3Q23 A;  3W3A A;  2NVY B;  1QCB D;  3A7L A;  5JJZ A;  4IFD G;  3GTG B;  2K28 A;  5FOB B;  4IFD I;  4Z9C B;  2F0D A;  2WV6 D;  3IFD A;  5KGU A;  4X3U A;  4C1N K;  1VMP A;  4A93 B;  3KF8 A;  4CJ0 B;  4C3J B;  2KJX A;  3QJY A;  1PRT C;  4KHV A;  5C3X A;  2VB3 X;  3MHB A;  3VR4 A;  1SE3 A;  1HXY D;  4TSS A;  1HQM C;  2A6H C;  3OWF A;  4ZAI A;  4M1U B;  3OWE B;  3TP6 A;  2B2Y C;  1A2T A;  1BO0 A;  2R3Z A;  1PRT F;  4PMW A;  4FNF A;  2BA1 A;  1F2L A;  1TWH B;  2ZXO A;  3MAQ A;  2XRQ D;  4DFA A;  1HFG A;  1UNS A;  1GUO A;  2IX0 A;  1VF7 A;  4FF2 A;  1SEB D;  2BOS A;  1U9R A;  4ZUJ A;  4IUU A;  1D1I A;  3MXP A;  2LMC B;  2TMP A;  3EVQ A;  4H0L C;  3O13 A;  4EQN A;  5J22 A;  4XXE A;  2NTT A;  1TS2 A;  4LJZ C;  1S4Z A;  4FVM A;  1X3Q A;  1TT2 A;  3HOZ B;  1KNA A;  1WTW A;  1G2T A;  2V4D A;  1PRT B;  4KN4 C;  3KLS X;  2KHS A;  1I6H B;  2A6H D;  4FXD A;  3I91 A;  3BG3 A;  3IAY A;  3P7J A;  2PMZ B;  3A55 A;  4RCN A;  1LAC A;  1NSN S;  2I07 B;  3BS1 A;  1QE6 A;  5LHY 1;  3R8B A;  2RVL A;  2F0F A;  4K5V A;  3S1R B;  5CV9 A;  1B50 A;  1DM0 B;  3I4L A;  2QKI C;  3I4M B;  1RCV D;  5COY A;  1S5E D;  3H0G B;  4PV1 C;  1IKM A;  2Z4I A;  4IUQ A;  4U68 A;  5IGC A;  3G6J B;  1TS3 A;  3NBH A;  4A3M B;  3I4N B;  1U4M A;  1JR0 D;  4K8J A;  5I9O A;  2J7Z A;  5M5W B;  3GQB A;  2PZU A;  2JEB I;  4RGM A;  5J1Z A;  4EQO A;  1G8Z D;  4ID6 A;  3CRK C;  3GTP B;  2ZXR A;  2F0G A;  1SMY D;  2WII B;  3BDL A;  1STG A;  2MUY A;  5A35 A;  4OO1 I;  3FRP B;  1AZQ A;  5EKI A;  1OXV A;  2JYO A;  5C3E B;  5G3L F;  4H13 C;  1B2T A;  4TQU S;  5ELC A;  1VMC A;  2TSS A;  4I65 A;  4F88 A;  3MC0 B;  4F7X A;  1RTO A;  4RGT A;  1SSO A;  2RKS A;  2NVT B;  4RFB A;  1OXU A;  2ICI A;  1HTL D;  2F0K A;  1KAB A;  2ZXP A;  1SNM A;  3H09 A;  2F1M A;  1BCP C;  2JA7 B;  5CV5 A;  4HSV A;  1LTS D;  2WKD A;  4ULL A;  2VB2 X;  4HSP A;  4CGY B;  2D62 A;  1LO5 D;  1NAP A;  4ABN A;  1V1P B;  3Q24 A;  1HCZ A;  1ML0 D;  3D4R A;  3C1E A;  2O4X A;  1HQR D;  5M5X B;  2CHB D;  4KD3 A;  4KI0 A;  2HCC A;  4I7Z C;  2O2L D;  3TDQ A;  3MWY W;  5CYU A;  1ET9 A;  4DXG A;  3GTQ B;  1HFN A;  5CGK A;  4O42 A;  1C8C A;  4R8N A;  4DAV A;  5I2X A;  4CJ2 C;  1Y8O B;  1EYD A;  2EZV A;  1ESF A;  3ND8 A;  2OXP A;  3GD7 A;  5KRU A;  5EGT A;  2PZT A;  3EFX D;  3NUC A;  3QWN A;  3DXJ C;  4KN7 C;  3NTK A;  2OEO A;  2WAQ B;  3I70 A;  1BUV T;  3HOY B;  1XX8 A;  4ZUI A;  4EQP A;  2VNU D;  4M8A A;  2NYZ D;  1C4Q A;  4XDX A;  3HOX B;  3MEH A;  1EYC A;  2KEC A;  2QIL A;  3QIA A;  5C0X H;  2JXM B;  2F0W A;  2JA8 B;  1F9P A;  2R6G A;  5CBE E;  1MSH A;  4FYD A;  1Y8N B;  1SE4 A;  4C1N I;  1Y69 U;  3HOU B;  3C2P A;  3PV0 A;  3QG1 A;  1CZW A;  4NP5 A;  3SR1 A;  3PUY A;  4KV6 A;  3HOV B;  1TU2 B;  3I73 A;  3D4W A;  2K03 A;  5EBD A;  2Q8R E;  1B4O A;  2DY7 A;  1JC7 A;  2JE6 I;  2A5H A;  2IX1 A;  2C9O A;  1U4L A;  3A8I E;  4JK1 C;  3OOC A;  4DNT B;  2F0H A;  3S2D B;  1NR2 A;  3K5M A;  1MBY A;  1JIC A;  1RHP A;  4B08 A;  2X69 A;  4K8I A;  4KK7 A;  1H9R A;  4FO2 A;  4K2L A;  3V05 A;  1ZYR C;  2Z8L A;  4N9P A;  4BA1 I;  2A6E D;  5F2D A;  3PUX A;  2NB0 A;  3E5S A;  3PMF A;  1T5X D;  4DU9 A;  1JQY D;  1S5B D;  3TP7 A;  3W2D A;  2QCP X;  1YNN C;  1GUS A;  2A69 D;  1JWM D;  4FF3 A;  4K14 A;  2XNA C;  2L9H A;  1LT6 D;  2E76 C;  1I4G A;  1ROD A;  1ZKO A;  5I4D A;  3FKI B;  1LTR D;  1EY6 A;  2B2T C;  3I8Z A;  1TY0 A;  4OL7 A;  3OW7 A;  2BE5 C;  3PUZ A;  2XWB B;  2Y0S B;  3K5N A;  3MFG A;  5EBC A;  5C5M A;  3H6M A;  3HG9 A;  2R7Z B;  3FMC A;  4HMI A;  5I9P A;  3NQT A;  5EKK A;  3SK5 A;  1D1K A;  4WJW A;  1SNO A;  4QB4 A;  2NN6 I;  4Q0F A;  3SDZ A;  1CK1 A;  4Q5V A;  1IHZ A;  3S1N B;  3C3L A;  4DA2 A;  5KNB A;  1R4Q B;  4QIW B;  1TS5 A;  1E2Z A;  4DF7 A;  1ENF A;  2L0C A;  2VUM B;  2F0M A;  4G7H C;  1Q1B A;  1YNJ D;  5DM6 3;  3V2T A;  3I3C A;  3KUP A;  1CI3 M;  4AYB B;  5KYL A;  1JCK B;  3CQZ B;  5FO9 B;  3NHH A;  1WCM B;  1VCI A;  5CR3 A;  2PCF B;  5M5Y B;  1LTB D;  4A3G B;  3DWQ A;  2CQA A;  1DXM A;  1S5C D;  4IN3 A;  4R9W A;  1Q90 A;  1EYA A;  4L63 B;  1WD1 A;  2IJ0 A;  1LTT D;  2LFN A;  2JA6 B;  3S15 B;  5ELD A;  1PZK D;  1EFI D;  3P1H A;  1EIG A;  4DGZ A;  1Q1E A;  4IUP A;  3SXH A;  2QDB A;  1B3A A;  5C44 B;  2K5D A;  3NP8 A;  2IT1 A;  3DUZ A;  4UDU C;  1X32 A;  1BDO A;  5ISR A;  4O1N A;  2SNM A;  4A3F B;  1I4R A;  1I4X A;  1CA5 A;  1SDF A;  3L3O C;  2WP8 J;  1D5X C;  3PUV A;  3QOJ A;  5I2Y A;  5M3F B;  3U9S A;  2EYM A;  2ID0 A;  5LL6 S;  1ICW A;  3KBX A;  3DHQ A;  1X3P A;  3DWP A;  3HGB A;  3Q0A A;  5IGB A;  1TII D;  3HRZ C;  3BDO A;  1EQV A;  3TP5 A;  4QCL A;  3R2I A;  2PNR C;  3R93 A;  1U4R A;  2E2D C;  4EGV A;  3DEP A;  4KKU A;  1E2V A;  3DMU A;  2Q8T A;  1CFM A;  3M7G A;  1LV9 A;  1PTO C;  2XIW A;  1EOT A;  4HR7 B;  4IUN A;  1PRT D;  1O80 A;  1O78 A;  1LTG D;  1DZ1 A;  2KA7 A;  2IWH A;  5CMD A;  2O5J C;  2BE5 D;  5D3I B;  2WAC A;  3NPP A;  2DY8 A;  4MN3 A;  1IYV A;  1KDB A;  2LS0 1;  2HDL A;  3H94 A;  2FJ2 A;  1IKL A;  5EQ0 A;  4A3D B;  3Q22 A;  3D6W A;  1O7Z A;  1PTO F;  5HGT A;  2F0V A;  3MVV A;  1A15 A;  2K6A A;  1TWC B;  1GUT A;  1IL8 A;  2KUM A;  2A6E C;  3DM1 A;  1SJE D;  1UEA B;  5JPM C;  1SFO B;  2KCC A;  2B39 A;  5CV6 A;  3PIP 3;  5AFW A;  1IW7 D;  1QB5 D;  1A3V A;  2B2V A;  3RLF A;  4H44 C;  1EY5 A;  2IW3 A;  3SK4 A;  1HPC A;  1B53 A;  3LWU A;  2B2T A;  4RAU C;  1PDQ A;  1BNZ A;  4KKT A;  1EY9 A;  2J0T D;  1IYU A;  4P2C B;  2CVR A;  1WVL A;  3E0J A;  3GP7 A;  4IZ8 A;  4IUV A;  3S1M B;  5E4W C;  4G7Z C;  3K0Y A;  1WTQ A;  1GXD C;  1I4P A;  1JE4 A;  2PYK A;  5IT9 L;  5BN3 A;  2D9U A;  5I6Y A;  4HMJ A;  1BQQ T;  3MA2 B;  2CW0 C;  1SND A;  5FO7 B;  4WOR A;  4V19 0;  5FK9 C;  4U67 3;  1TY2 A;  3WOE A;  2NWG A;  5G3L D;  4ME5 A;  3AMU A;  4A3J B;  3AB9 A;  1NCV A;  2EDG A;  3RZD B;  2B2V C;  4DAY A;  1LAB A;  1FNW A;  1KTK A;  2B8G A;  4KD4 A;  1M8A A;  2A74 C;  2HDM A;  4J1M A;  4IAL A;  3GTL B;  1KLG D;  3CKI B;  3Q6S A;  1E2W A;  5C4J B;  1STN A;  2N55 A;  1PTO D;  2EPB A;  1FGB D;  4OIJ A;  2K5W A;  4XTC S;  2R93 B;  3F2U A;  3OMC A;  1HA6 A;  1LT3 D;  5K36 G;  1B1Z A;  4G57 A;  1SYD A;  1AZP A;  2B8F A;  3HOW B;  1GUW A;  2OT2 A;  2FMM A;  3FDT A;  4S3S A;  2N88 A;  5FO8 B;  5JAV A;  3A54 A;  1SE2 A;  1R9T B;  4HTH A;  3K7A B;  1ESR A;  5IOC A;  1B44 D;  5KEE A;  3ND9 A;  3WOF A;  1XTC D;  5IIF A;  1BCP D;  2PQE A;  2RA4 A;  1JOQ A;  1V43 A;  4L6T B;  4J6H A;  1II3 A;  1ZXT A;  1SYC A;  5C0X J;  5COR A;  2YU9 B;  5D3D A;  1RKN A;  4J8Q A;  2K32 A;  1SYF A;  2MJ8 A;  5E3F A;  4OHJ A;  3FEW X;  2L4N A;  4F87 A;  4K5X A;  2EJG C;  1EIH A;  1ET6 A;  3BVZ A;  1K8M A;  3OSO A;  1FNU A;  2MPM A;  3R2T A;  5C0X G;  2B2U C;  3BDC A;  3J81 E;  1PYW D;  2EYF A;  1PFM A;  1G2S A;  4BA2 I;  3EJI A;  2AWO A;  2G9D A;  1DJR D;  3NQI A;  4C3I B;  2I46 A;  3T4A C;  4KMU C;  1LTI D;  1JOK A;  2HQE A;  1BCP B;  1F2M A;  3RZO B;  1K83 B;  1XWE A;  3PO2 B;  4CBV A;  1HTP A;  3TZU A;  5JEA G;  3KK7 A;  1GJX A;  2EE1 A;  2MGS A;  5ELF A;  2J4X A;  3E6Z X;  2F3V A;  5IGE A;  1S5D D;  1EY0 A;  2B63 B;  2NVX B;  1A3T A;  3RUZ A;  2SDF A;  1JB3 A;  1PFN A;  5K5P A;  1CQF A;  5JVG 3;  2EYJ A;  4NDX A;  3T56 B;  4IUR A;  2AUJ D;  2H4O A;  2B2W C;  4KJN A;  4C56 C;  3VYR A;  3NK9 A;  3T13 A;  2R92 B;  3EQL C;  2EJM A;  1BF4 A;  3N52 A;  4TKO B;  5LL6 X;  1Z47 A;  4NMZ A;  2RDG A;  2JP1 A;  3X3M A;  1H9S A;  1F9Q A;  2K05 A;  2BDO A;  2A73 B;  2F0J A;  2D5D A;  1SYB A;  4K6D A;  3KLS A;  3T53 B;  1ENA A;  2ZT9 C;  1BCP F;  3H91 A;  1SXT A;  1RTN A;  2F0L A;  3N6R A;  2F0N A;  3VR3 A;  1SYE A;  4LMQ D;  4ILW A;  1B9N A;  5DEH A;  3SHL A;  5KND A;  3VYT A;  4XYQ A;  3TME A;  2HUG A;  3IFT A;  5CV8 A;  4DAP A;  2WKC A;  1RJT A;  1SJH D;  1AP0 A;  5CV4 A;  3K58 A;  3SK8 A;  4OIK A;  1EY8 A;  3MXG A;  3NWT A;  3A8J E;  1B9M A;  4RGN A;  1Q3L A;  4A3B B;  3GV3 A;  4XQJ A;  1W6J A;  3K59 A;  1CT1 D;  2RSN A;  4A3K B;  5JVH 3;  4BBS B;  4X3T A;  1GOZ A;  5EKL A;  5A2Q L;  1EL0 A;  1GHK A;  1MGS A;  2AUK A;  2IX3 A;  3QO2 A;  1JOO A;  2XRS D;  1V1O A;  3TZD A;  5KYI A;  1GUG A;  4BY7 B;  2QF7 A;  4CKB A;  3URY A;  1D2B A;  4PQX A;  2B2W A;  3T16 A;  3PO3 B;  3RD4 A;  1HA5 A;  2KOL A;  1GHJ A;  4A3I B;  3OHX C;  1XXG A;  3H3V C;  1MI2 A;  3FVQ A;  1EZ6 A;  3GTJ B;  2RDF A;  4IQZ A;  1DYQ A;  1ILP A;  4OO1 H;  2DN8 A;  1V1P A;  2FIN B;  4DN4 M;  1CHP D;  2X6G A;  3ONA B;  1Q8I A;  2L12 A;  2EY1 A;  2NN6 H;  5C3W A;  2EY6 A;  5T1G A;  4LK1 C;  4FF4 A;  4CHT B;  3D8G A;  2K33 A;  1HHV A;  3GTK B;  1JWS D;  2A69 C;  4X3K A;  3M4Y A;  1A3U A;  2L1B A;  5CV7 A;  4KKS A;  3ERQ A;  4FXG C;  5C4Z A;  1EZ8 A;  4C3J G;  1AEX A;  5CC4 A;  1Z7T A;  5IGF A;  2Q8I B;  1EEF D;  2FMC A;  4CKE A;  1I6V C;  3DWA A;  3M7N A;  2B2U A;  1ZYR D;  1STB A;  2ENB A;  2SNS A;  4RKB A;  3HS0 C;  2F03 A;  5JEA H;  2LKV A;  2F0T A;  2FHT A;  1FNV A;  3BZD B;  5JEA J;  3MZ5 A;  5KIX A;  5IGG A;  3DEO A;  2E74 C;  4FXK C;  4ZKC B;  4KHZ A;  1F9R A;  5KNC A;  3J81 L;  3TBI B;  4BS9 A;  4C3H B;  5IOD A;  1EU4 A;  1EEI D;  3G7L A;  3K57 A;  1KAA A;  2F3W A;  3BVM A;  1L0X B;  2IL8 A;  4PMC A;  1KLU D;  3J7A F;  4WFN 3;  4GZY C;  4CKC A;  3NTI A;  3TP8 A;  1D5Z C;  4HED A;  4ZRZ A;  3WDN A;  3D3R A;  4ODG A;  4XIG S;  1I4H A;  3S14 B;  4RHR A;  4E6I A;  5EPK A;  1MSG A;  1QG7 A;  1SMY C;  3D4D A;  4RH6 A;  2F0S A;  4K2K A;  4DK0 A;  2BA0 A;  3QB3 A;  4ZQ3 A;  3AU7 A;  1WD0 A;  2EYP A;  5C4H A;  5EPJ A;  3M3Y B;  4G7O C;  1YNJ C;  2PO4 A;  3VR2 A;  1SNP A;  1FYC A;  3JAM L;  3D31 A;  2AQ3 B;  1QIL A;  2F0I A;  4RGO S;  2AWN A;  2PW5 A;  3EA6 A;  3HEJ A;  3MXN A;  2YYZ A;  4OO1 G;  5JPN C;  4IFD J;  3K5L A;  4XYO A;  1CTM A;  3NTH A;  2EJF C;  2RBM A;  5I6W A;  4K5W A;  2F4I A;  3IKJ A;  4XQQ A;  1C48 A;  1V8Q A;  1O7L A;  2CW0 D;  4BWG B;  3A8K E;  2DNE A;  2L55 A;  3D6C A;  3LNN A;  4FP5 D;  3S16 B;  1VF5 C;  4N9T A;  1FR3 A;  3NWS A;  1DOK A;  1QNU A;  4C2M B;  1EQT A;  2K01 A;  1G29 1;  2EYL A;  4QUC A;  5D14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...