3KUPA

Crystal structure of the cbx3 chromo shadow domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
PRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromobox protein homolog 3
publication title Crystal Structure of the CBX3 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3kupA00
1RJTA 4HEDA 2K01A 1PLFA 4IURA 2MGSA 1F9PA 4X3TA 2B2UC 1DZ1A 1BBXC 1X32A 2B2WC 1RTNA 3ONAB 2L4NA 1RODA 4IUTA 2Q8TA 1G91A 2HCIA 3DEOA 2CVRA 1JICA 4NW2A 4CJ1B 4DN4M 2B2VA 2EOTA 4LMQD 2XIWA 2KEDA 2KVMA 2DY7A 4OIJA 4MN3A 3KUPA 1ILQA 1M8AA 1RHPA 1WTPA 1QNKA 2RSNA 2B2UA 2DY8A 2NWGA 5EJWA 3IFDA 1TVXA 5T1IA 2BDNA 1S4ZA 1J8IA 1X3QA 2L1BA 4QUCA 2HCCA 2KECA 4ZLTF 3FPUB 2KEEA 3I91A 1WTXA 4XT1B 1XYIA 1J9OA 4CJ0B 5CMDA 3DEPA 1IKLA 1CM9A 1GUWA 1QE6A 1F9RA 2HUGA 3TN2A 1A15A 3IL8A 2JYOA 1O7YA 1WTQA 1ML0D 2N55A 1ZXTA 2B2TA 1CA5A 1MSGA 5CBAE 1WTRA 3LWEA 2EPBA 4IUPA 1WD0A 2MPMA 1G2SA 3DM1A 2Q8RE 4HAEA 2K1BA 2MJ8A 2D9UA 3I3CA 1EIGA 1VMPA 2K03A 3N52A 3H91A 4RAUC 1NR4A 2NYZD 5COYA 3MTSA 2FINB 4X3UA 1B3AA 1MI2A 1F9QA 1SSOA 1HUNA 1WTVA 3UI2A 2B2TC 1O7ZA 2JP1A 4RA8A 1E0BA 5EPKA 4OIKA 1B4OA 1RTOA 1AP0A 1NR2A 3R93A 2SDFA 4R8IA 2HDLA 2FHTA 5E4XA 1U4PA 1HFNA 1AZQA 1X3PA 4ZK9B 1HRJA 1WD1A 1U4MA 3QO2A 4O42A 4ZAIA 2N88A 3P7JA 1VMCA 3TZDA 1KNAA 3G7LA 2L9HA 5JJZA 2KOLA 1C8CA 1ICWA 4MHEA 2M2LA 2RSOA 2X6GA 1ESRA 4XDXA 1DOMA 1CA6A 4HCSA 2L11A 3HP3A 1EQTA 3Q6SA 4XT3B 4IUVA 3KBXA 2EE1A 2J7ZA 2X6LA 2L12A 2RA4A 1G2TA 1NAPA 2R3ZA 2HDMA 1HA6A 1O80A 1BNZA 1EOTA 2K04A 1BO0A 2VXWA 1NCVA 1SAPA 1Q3LA 1U4LA 3D6WA 2K05A 2NZ1D 1MGSA 3I90A 3I8ZA 1XX8A 2FMMA 4HSVA 4R9WA 1ILPA 1WTWA 1AZPA 5EPLA 1WVLA 1KNEA 1F2LA 1PFNA 2B2YC 5D14A 1IL8A 2KUMA 5AFWA 1QG7A 3F2UA 1MSHA 1F9SA 4UAIA 5D65A 2FFKB 4X3SA 4RWSC 4U68A 1G6ZA 1LV9A 5DNFA 5EPJA 3GV6A 1WTOA 1U4RA 2FJ2A 4IUUA 2H1EA 5E4WC 2IL8A 5EKIA 1EL0A 1HHVA 1PFBA 1JE4A 1PDQA 4IUQA 1DOLA 4X3KA 5T1GA 3SVMA 5CBEE 3FDTA 1PFMA 2B2YA 1B53A 5EQ0A 1BF4A 4CJ2C 1B2TA 3GV3A 2B2WA 2X69A 4ZKCB 2RVLA 2B2VC 4QUFA 4ZKBB 3MWYW 2K28A 1B50A 1IKMA 1HFGA 1HUMA 1SDFA 2MP1A 1EIHA 1DONA 1DOKA 5CORA
chains in the Genus database with same CATH superfamily
2E5LL 2Q8IB 2MGSA 2K52A 4RH6A 1RL2A 3PO3H 2VW9A 1E7ZA 1EWIA 4LF7Q 1ENAA 2AHOB 3AFQA 2AQ1B 2NVYB 2DY7A 1XNQQ 1I4XA 4FF2A 1TWHB 2EIFA 3KYHC 4R4OA 1B3QA 3NENA 2VB3X 3HZXA 5JEAJ 2BDNA 4IPDA 1LO5D 4QUCA 5FLMH 3S16B 1HZBA 1OXUA 4X62Q 5CV6A 1HCZA 1ESFA 3CHBD 3MXUA 3GO5A 1LTLA 2GA4B 4RCOA 2IW3A 1BBWA 5KYLA 2F52A 4QY7A 2L0CA 2Z6BA 1STGA 3GTGB 2OTJA 2KQ3A 5COYA 2FINB 4X3UA 1SSOA 4A93B 1SE3A 4GZYC 3DM3A 3FKIB 1I3QH 3K59A 5M3MB 4X65Q 3CF5A 1BCPF 4DR6L 4L5RC 4X64L 4P71A 4DR7L 3CQZB 1UE6A 1D5ZC 5JJZA 2Z9HA 1H9KA 1ICWA 3J7YW 4LF4Q 1PTOB 5FLXE 1E2VA 3KBXA 2EE1A 1A2TA 4YWMA 4A3BG 2XWBB 2PZTA 1XPRA 3IAYA 1Q46A 2D5DA 2RF4A 1MBYA 2Q2HA 4DF7A 5C0XG 2M9VA 3I90A 1J5EQ 3N6RA 3DWPA 4LF5L 1WCMH 1L1OB 1GUGA 2G9HD 3NTHA 2B2YC 3C3LA 3TS0A 5CV5A 2A1AA 1N8RC 1KDCA 5I4DA 1JE4A 5M5YB 3H3VC 1CZGA 1BF4A 5EKLA 3KFUA 1L0WA 5IP9H 3S15H 4WORA 5DAUA 4KY6A 1QOHA 4YY3L 1OXVA 2PNRC 5E7NA 3MA2B 1E3PA 2O2LD 5GQOA 4JI4L 1Y8PB 4KN7C 4EQPA 2WINB 1PYSB 2NVQH 1VQEA 3DEOA 1C0AA 2CVRA 2ATWA 4FF1A 1EYDA 5IYDG 3KLSX 4LMQD 4YWKA 4A3JH 3D8GA 4DA2A 1AW7A 1RHPA 3G6EA 3HOUG 2A6HD 4FO2A 2SOBA 5E1FA 3MVVA 4ZLTF 2EYPA 4ZQ3A 1NNXA 4J1MA 1CM9A 1YNXA 1QE6A 2HUGA 4GOPB 2ZXPA 1VS0A 4PZ6A 3M7NA 4IFDI 4LW1A 3PQIA 3A5ZB 4DV0Q 3H94A 4DV5Q 1YITA 3T1HL 2F0TA 4OO1I 1C9OA 3FHWA 2WIIB 4NP5A 2JP1A 2AWNA 1EU3A 2PYKA 3AFPA 4R8IA 5IE8A 2HDLA 5G3LF 4R1JA 3T53B 1YJNA 1U4PA 2KCMA 4GKKQ 3S1MB 2QCPX 3DLLA 1WD1A 1VQIA 4YIJA 1SYDA 2VY3A 4P75A 1LTAD 3D4DA 5FKAC 1EWHA 1SR3A 4B3TQ 4HIKA 2R93H 5C4ZA 4JV5L 4AIMA 4DR5Q 4LFBQ 5A2QE 3A56A 5M3FH 2WV6D 1PZID 1NAPA 4K0KL 3SE0A 1BNZA 1B70B 1BO0A 1SNMA 2FXQA 2RCNA 1PVOA 4K5WA 3ULLA 3F1ZA 1OXTA 1UUPA 2NBFA 2A74C 4AQYL 2R92H 1LTTD 3Q24A 2PCFB 4L5SA 4OX9Q 3PUWA 3FEWX 3ZYYX 5DNFA 2JE6I 5EPJA 1JWSD 2Y0SE 2ZT9C 1U4RA 1WTOA 2H1EA 4JBWA 1A62A 1Q90A 3HOUB 1ONLA 4MTKA 2MO1A 1F77A 4WJWA 5IP7G 4I65A 1B7YB 3FDTA 3VA7A 3URYA 2ZTEA 4C1NK 2B2WA 3KF6B 4G57A 1UEBA 4J6HA 3AYHB 3BJUA 4OELB 1B50A 1SDFA 4DAYB 2PMZE 1YNJD 3CPFA 1PH3A 1I4QA 1S5ED 4K5XA 3F8TA 5FLMG 4WRDA 4IUTA 3NELA 4DV6L 1AE3A 1YIJA 1N36Q 1TWCB 1SE2A 3M7GA 3W1GA 3WOEA 3CCEA 4V190 2ZJRA 3HOVH 3NE5B 4X66L 1SXTA 1II3A 4OEMB 1SMXA 2JN4A 4K6LA 4BWGB 5C3EH 2BH8A 1GJXA 1AE2A 1F2MA 4KK7A 2HCCA 3BVGA 3T4AC 4A3DB 4UP8A 4QCLA 1CFMA 3I91A 3U50C 1J9OA 5I6YA 2F0LA 2L15A 4YHHQ 2AQ3B 4KHZA 4LFCQ 2JYOA 1ZYRD 5D3DA 2PZUA 2OQKA 3CC7A 1D1IA 4ME5A 1GUNA 2D9UA 4KI0A 3T13A 1LTBD 3CCVA 1JWUD 4DR2L 4A3CG 3BDOA 4PG3A 4A3EG 4OIKA 1B4OA 1RTOA 1XTDA 1NR2A 3R93A 4RKLA 5J22A 1AEXA 2CH4A 5E4XA 1EY6A 1AZQA 4KY7A 2NN6H 4DK1A 3QJYA 3JAMi 1X3PA 3QO2A 5BR8L 4RGNA 3J80i 2B63G 1XTCD 2PMZB 2EYFA 1EQQA 1D7QA 4JVZA 2BA0A 2KOLA 2QEXA 1UAPA 1X3GA 1ESRA 1M1KC 4JC0A 2WAQG 1HNZL 3HP3A 2E5LQ 1HXYD 1K0SA 4L6TB 3CCRA 3HS0C 4G7OC 3KDFB 4HMIA 2GVBA 3I70A 1EOTA 1V1PB 2VXWA 4BXXH 4LF8L 2NZ1D 3H3VI 2FMMA 2EY2A 2WAQE 3G4SA 1YI2A 1Q7YC 1KNEA 5C5LA 1IYJB 2GN5A 3HEJA 1Q86C 2MUYA 2F0DA 4DFAA 3MEHA 2A69D 2NVYH 3CC2A 2E2IH 2IL8A 1TWHH 1FD7D 4V0BA 3VYRA 4X3KA 3E5SA 4X62L 3ULJA 2B2YA 1BXTA 1BCPC 3CC4A 3HG9A 3S16H 1JWMD 3EFXD 4GS3A 1TS4A 3MWYW 4PMCA 4XQNA 1ASZA 4F87A 3K7AH 5IYBH 4DK3C 4HJ9A 1UWVA 4X3TA 4XXEA 1GM5A 1K28A 2E2DC 5JAVA 5JEAG 3V05A 3GTJB 2OEOA 2HCIA 5KNDA 3GTGH 1Y1VB 3UE0A 1B44D 4HSPA 2K50A 3H6MA 4A93H 4A3EB 4DR6Q 4OIJA 1SBBB 4X64Q 4DR7Q 1O7LA 1R4PB 1TVXA 1X54A 2O4XA 3FKIH 3M4OB 3S2DB 1SMYD 3E0EA 5M3MH 3MXNB 4ODGA 4IFDJ 2XWJB 2B63B 1GUWA 3CQZH 2K7VA 3MXNA 5LL6X 1HTLD 2MO0A 5CBAE 2AUKA 2WAQB 1EEFD 4KJNA 1SFOH 1N33L 4LF5Q 3UDGA 1PTOH 2EYMA 4RCNA 4RAUC 3GP7A 2O5JC 1J5EL 5ELNA 1CKMA 2UXDQ 4LUOA 4CBVA 5J3BA 5EPKA 4POGA 2HIVA 1ET6A 2QDLA 3E6ZX 2KHIA 3NBHB 2C35B 5FOBB 4AYBE 4AH6A 4GN5A 5M3FG 4CKCA 2SNMA 1HRJA 1U4MA 2F0MA 1VQ9A 1HR0L 3B6YA 1PHJA 5I6WA 5DLQE 4QJFA 2I5HA 3TS2A 1C8CA 1EYCA 4JI6L 2VQFL 2QW7A 3CCQA 2F0EA 3MFYA 5M5YH 5IT9E 1VQ6A 3HKZG 3JAML 4TQUS 2K04A 3J80L 2PQAB 1SAPA 1Q3LA 1EZ6A 1PA6A 3O13A 4IALA 4X6AH 2K32A 4KD3A 1M90C 3HKZE 5DM63 1KXLA 2JK8A 3D4RA 1HJPA 2PNHA 3L7ZC 3P20A 1PRTD 3OWEB 2ICEC 1A6XA 1E2ZA 1E1TA 1TXYA 1HHVA 2DGYA 3BZDB 3ERQA 4IUQA 3PIP3 5IWAL 4BBSG 2B2VC 1A8VA 3J81c 1IKMA 1BVSA 3T1HQ 1LM0A 5CORA 4DV5L 1B8AA 1FGBD 2J0TD 3VYSA 1E1OA 1RDPD 2CH4W 1F2ZA 5EAYA 4AYBB 4Y52H 1NSNS 4CKEA 3TREA 2HIXA 2EYJA 4A75A 4G7ZC 4DAMA 2XIWA 4GKKL 5C0XH 3BZCA 1SNDA 3BDCA 1QILA 3S1MH 3EVQA 1VQOA 1T5EA 4A3GG 1STYA 1IKLA 4DR5L 3X3NA 1FNVA 2N78A 1D5MC 3CD6A 3MEFA 2IPKD 3M4PA 2ZJPA 3HKZB 2A73B 4M1UB 4DNRB 3OSOA 2RHSB 3KLRA 1CSPA 1Y1WG 1EY7A 3MTSA 2QEJC 4HIMA 4AQYQ 2WFWA 2K33A 4GLVB 3E0JA 3U58A 3NTKA 1LACA 1E0BA 3OPOA 4CKBA 1A3UA 4A3MB 3J7ZC 3CXCA 4C3JB 4EVOA 5IYDH 1BBUA 2N88A 2F0FA 4H7BA 1KAAA 2DJFC 1KNAA 1G8ZD 3SK4A 5CGKA 2M2LA 4JCVE 1D1KA 3HOUH 2F3WA 1SNPA 3K0XA 1XMOQ 2I0QA 3HOWB 3JAMc 4BBSB 4XT3B 5AJ3Q 3NPPA 3HOYG 1G2TA 5FK9C 2KHJA 4DV6Q 4NB3A 2VUMG 3E9IA 2K05A 2ZTCA 1MHWC 2XRSD 3BZKA 1N36L 3LWUA 3R3OA 1H95A 4R8NA 1PTOD 4UAIA 4HIOA 3RLNA 3NQTA 5K36G 3ER0A 5E3FA 1TWCH 2FMCA 2CFMA 2J4XA 4GN3B 2FJ2A 3PF5A 1CQVA 1S5BD 2N3SA 4YHHL 3H0GB 4JYAL 1K8AC 1CK1A 4LFCL 4F8MA 1YNND 3K7UC 4A3DH 2RDFA 4A3GB 1QUQB 2D62A 4H13C 1HUMA 2XGTA 1BCPB 2JSOA 4RG1A 2B2WC 2LY7A 1TWFB 4H44C 4IQZA 4DV2L 1EWCA 1Y1WB 4CJ1B 1Q82C 3T1YQ 1V43A 4PZ7A 1YHBA 1DYQA 2E76C 2PZWA 1C4QA 3L2PA 3CCUA 5GADC 3A5UA 3MC0B 2F0JA 4LNQA 4J15A 1HQMC 4KY5A 1S4ZA 1J8IA 2KCNA 1WJJA 3K0YA 3A8IE 1HNZQ 2F03A 1B9MA 2BH2A 2BE5D 3TN2A 1A15A 1VQHA 3CCSA 2HT1A 2NVTB 4KLKA 4LF8Q 1M4VA 5IP7H 2BDOA 4NXML 1Q81C 4CGYB 1V1QA 5CV8A 1K8OA 3I3CA 1K83B 1EIGA 1PH5A 3HOYB 1BOSA 3TP6A 1NR4A 1MI2A 1HUNA 2E2IB 1W6KA 4FYDA 1FYCA 2VUMB 5CC4A 4EX5A 5CV7A 1WOCA 3VYTA 3VR4A 3EJIA 1YHAA 1EOVA 4LJZC 3K81C 3GTLB 4RFBA 3K7AB 4HJ5A 5JOBA 1VMCA 4LK1C 3PUVA 5JJIA 5LHY1 1HNWQ 1VQBA 3AMUA 3Q6SA 2CWAA 2KBNA 5JVG3 1LUZA 2E8GA 5HGTA 2X6LA 2HDMA 1A0IA 1A3VA 3OW2A 1TR5A 1QNUA 2A6HC 4POFA 4JI7Q 3A0JA 1SE4A 1ZKOA 4R9WA 3KLWA 1VCIA 1K3BC 1Z47A 1BDOA 3GTJH 3EQLC 3GTOB 3NSWA 3RLFA 5JPNC 1Y1VH 2G9DA 4DXGA 1X9NA 1RCVD 4A3CH 2Q2IA 4A3EH 2K5DA 4JBMA 1GUSA 1SFOB 4HJ8A 1DOLA 3QWNA 3PIPA 4LFAL 4K5VA 1B53A 1B2TA 3M4OH 2F0HA 3S2DH 2RVLA 2ZM6L 1N33Q 1K73C 1HNXL 1WTHA 3CRKC 2KENA 5IYCG 1PH4A 2B63H 1I94Q 4UHVA 1EY4A 3CMEA 2MNAA 4DR3L 3I4LA 1SLJA 2UXDL 1UE5A 4FP5D 1JR0D 3OWFA 2LSSA 3PMFA 3GTPB 2B2VA 1EFID 1SNCA 4IFDG 1KD1C 2DJGC 5M5WB 5GROA 1HR0Q 1SROA 1VQ7A 1O7IA 3EROA 1WTPA 4L63B 2ASBA 1XPOA 1LTRD 2OT2A 4JI6Q 2VQFQ 4OO1G 5D3IB 4XIGS 1CHQD 3W1BA 1F9RA 1HZAA 2RCFA 1QWYA 4B9XA 1ML0D 1LABA 3RZDB 1MSGA 4GNXC 4XYQA 3BVMA 2SNSA 4IOCA 1PH7A 3PUZA 2K1BA 2MJ8A 1VMPA 3BG3A 2EYLA 3UDFA 1JORA 1AP0A 3GD7A 2MFIA 5CYUA 2FHTA 2IY5B 5JEAH 4WJ4A 3GTKB 1YNJC 4Z9CB 5IWAQ 3M85A 2MQHA 2UUCQ 5IIFA 3RN2A 5IGFA 3U4ZA 1TY2A 4PMWA 1Z6HA 3W2DA 3KF8A 3I72A 4K2KA 3AEVA 2PI2A 1EYAA 1LYLA 1X3EA 3I4MB 1S3OA 3GDEA 1GOZA 4BA1I 3E9HA 2VB2X 4QQBX 1HA6A 4IZ8A 2EDGA 1XX8A 3K5LA 5CR3A 1XWEA 1D5XC 4LF9Q 1QCBD 3GQBA 5D14A 4A3DG 4BY7H 1VF7A 1ZYRC 3K5NA 4KN4C 4Q5VA 1D2BA 1LV9A 1AFPA 2XNAC 4KHVA 3RLOA 4LUZA 2XTIA 1KLGD 1G291 5ELEA 3QOJA 4LF6Q 2K28A 1NJIC 1YJWA 2Y0SG 1DONA 3NBIA 2F0PA 1QZHA 3FPPA 5FO8B 3CAMA 3NEMA 3TSSA 5KIXA 1L2FA 2UUAL 2A19A 1XMQL 1RF2D 5HGQA 3STBD 2E2HB 3J81i 3EA6A 4J8QA 2KEDA 4BA2I 4OGQC 2EJGC 2VQEL 4JG2A 3S9WA 4A3MH 1IBKL 4C3JH 4C3IB 1WTXA 2JA7G 1XMOL 2D2CC 5AJ3L 4UPAA 1VQFA 2EPBA 5L37A 3HOWH 2QGQA 4JBKA 2MPMA 1G2SA 5BN5A 4BBSH 5TSSA 4LUVA 2A69C 4I7ZC 3M3YB 1U0LA 4RGTA 1WTVA 3P1HA 1GVPA 1V1OA 5LMUQ 3LGJA 2A68C 3J7AV 3QB3A 4L8JA 4DK0A 4B3MQ 1G51A 1TWAB 2SDFA 3OIQA 3EBEA 2JEAI 2VNUD 1ICFB 3D0FA 3VYUA 4JYAQ 2KHSA 2NB0A 2WACA 1SYCA 3MHBA 1FNWA 2PQEA 5FLXc 1PH6A 2OTLA 4UP9A 5FO7B 3BU2A 3RR5A 3TEHB 4HIDA 4O1NA 5J1ZA 3H0GH 4IUVA 1QVGA 4DV3Q 1Y1VG 1FR3A 4A3GH 1O80A 4HCEA 3G6JB 4FNFA 2Y0SB 4DV2Q 2D0PA 4I7AA 1NCVA 1STAA 5C4HA 1SMYC 4HSVA 3T1YL 3RZOB 3F2BA 1EY9A 3FRPB 1TWFH 2ZXOA 2RKSA 1Y1WH 1X56A 1GHKA 1GXDC 1S40A 2MHVA 1JJGA 4H0LC 3GV6A 4IUUA 1IW7C 2BCOA 3W5OA 2CQOA 2F0QA 1EEID 3CRLC 4KTAA 2K5NA 4ZKCB 4NXMQ 1A2UA 2JA7B 4QUFA 3EIVA 1TS5A 1NTGA 4DR1L 3OYYA 1YZ6A 2NVTH 1N9WA 1YBYA 2QILA 1A63A 3RMHA 1K83H 4ALPA 3HOYH 1HZ9A 4IJLA 1BQQT 2LXJA 3CCMA 2R7FA 1NMGA 2K5VA 4R4CA 2VUMH 4MN3A 4DNTB 4JOIC 2HHHL 1LT3D 4NKLA 1KC8C 3S14B 4EGVA 1PMRA 4KV6A 1B1ZA 2YYZA 2L1BA 1JE5A 1CKNA 2CW0D 3U4VA 5K36H 3GTLH 3KJPA 1I4RA 2L5TA 4JI1L 3J81L 1HNWL 2EY1A 3HOZG 4KKTA 4EQNA 4C2MB 1K9MC 1I5FA 4U673 2KCCA 2B39A 3VDYA 3NK9A 4JI7L 2DNCA 3MFGA 1HH2P 5M9OA 4GNXB 3JAME 3ZJYC 1X55A 3NP8A 1O7ZA 3PO2G 3L0OA 3J80E 1B9NA 1PYBA 4ZCKA 5JVH3 1KRSA 1T9HA 2NZOA 3Q22A 3ND9A 4GNXA 3CMAA 1KHIA 2TSSA 4LFAQ 4OWTB 3GTOH 4KD4A 3S1NB 2ZM6Q 1HQRD 1STNA 1HNXQ 1G6PA 1CQFA 4FXDA 4ZUIA 3K6OA 4AYBG 4UY8C 4HCSA 1NE3A 4P74A 1Z9FA 4BY7G 4DR3Q 4TKOB 1I94L 2J7ZA 4EQOA 2R3ZA 3CPWA 3PUXA 4C1NI 1EUJA 3D6WA 1S72A 2D0OA 1CI3M 3CCJA 1WVLA 1IL8A 1BR9A 4DXFA 3I4NG 2OWOA 3GTPH 4DU9A 2BOSA 4HN7A 3SHLA 5CV4A 5M5WH 1CHPD 2RHQB 2UXCQ 1EL0A 1NY4A 4ID6A 2QA4A 3Q8DA 1PFMA 3PGZA 2M00A 5IGCA 4GKJL 1IZ6A 1PZKD 2B29A 3NXWA 4LWCA 2CKZB 3HOZB 1DOKA 3K5OA 4A3MG 3RZDH 4R4IA 3ONAB 1DCZA 2UXBL 4C3JG 3V2TA 4RHSA 1JICA 3U9OA 4BBRG 4PMBA 3W3AA 1H9RA 3RD4A 3C1FA 3PO2B 4APVA 1CTMA 3WWVA 1BCPD 2YTYA 4TRDA 2I46A 3HOWG 3A8JE 2WKDA 2NWGA 1OXXK 5T1IA 2UUCL 4DV7L 3JC66 4OONA 3GTKH 3FPUB 2KEEA 4YWLA 3QIAA 2JEBI 1XYIA 4A3KG 2JQOA 3S1QB 3Q0AA 1JJ2A 1FNUA 1PTOC 2CQAA 3DUZA 1CA5A 2QF7A 4CDEC 1UE7A 4BY7B 2JJQA 1PZJD 1Q1EA 1PFSA 4CDDC 1L0YB 4Y7NB 3I4MH 3G48A 3H91A 3OMCA 4A3IB 4OHJA 4OL7A 4LF9L 5IYCH 3CP0A 1LTID 1DD2A 2JXMB 1YNNC 1VQDA 1NBWA 3OOCA 3H0GG 5IOCA 3I55A 4YCVA 3I4NB 1ZEQX 4FDBA 3VR3A 3NHHA 3PF4A 2GVAA 4IFDH 4JPBW 1BKBA 1UEAB 3C1EA 2K6AA 5C4JB 3TZDA 3M4YA 1GD7A 1NUCA 2ZTDA 4PNYA 1N34Q 1UNSA 4LF6L 4OO1H 1HA5A 1GUTA 1EY0A 3A8KE 2L12A 1H9MA 1P16A 3KJOA 2R6GA 2K75A 2UUAQ 3IKJA 1XMQQ 3C46A 3OIPA 1AZPA 4IN3A 2BE5C 2VQEQ 4BBRB 4L5QA 1IBKQ 1CUKA 1SJHD 2E2HH 1G6ZA 5IGBA 1JCKB 4IPCA 1PYWD 2QKIC 2LMCB 2Z4HA 1PFBA 4NXNL 4DKAC 1VQ4A 5F2DA 2JA8G 1TU2B 2R7DA 3T51B 3TP8A 3LX0A 1RKNA 3ND8A 4GOPC 3L9AX 1VF5C 1U9RA 4C3IH 4A3KB 2MP1A 4JW0A 1GHJA 2K5HA 1Q12A 1PV4A 4HEDA 3J7AF 4IURA 3PUYA 3SR1A 1GKHA 4DV1L 1TQOA 5LMUL 2F3VA 5C4XG 4B3ML 5G3LD 4JI2L 3M3YH 1SN8A 4PZ8A 2F3IA 1JOOA 4B3SL 1Q8KA 2A5HA 3HRZC 1FJGQ 1TWAH 5EJWA 3IFDA 3V96A 3R8BA 4OWXB 4RMFA 2NN6I 4DUZQ 1PH9A 1KDBA 1X6OA 4DV3L 2I5LX 4JOIA 1TS3A 1ASYA 2YTXA 4HAEA 4DV4Q 2F1MA 4A4IA 3K57A 1LT4D 2OCEA 4A76A 3NQIA 5GAEC 1F9QA 1RD9D 3R2TA 2NUCA 4RKBA 3IRBA 5IGGA 2DN8A 3ICEA 4JBJA 3RZOH 1KL9A 1HR0W 1XXGA 5LMNQ 4BY1B 1FL0A 1GUOA 2ID0A 3P7JA 4JI5L 3A74A 5CV9A 3G7LA 4HTHA 4DR1Q 3QR8A 4FVMA 2JA8B 1DOMA 3SK6A 3PIO3 2VZAA 2UU9Q 2Z6KA 2XN9C 2F0WA 2RA4A 2JA9A 1CKOA 4HJ7A 2JA7H 1H9SA 2HQLA 4MTNA 1JB3A 4DGZA 2A6ED 1LTSD 1ILPA 4M8AA 3M9BA 2EXDA 4G4KA 3MAQA 4MNOA 2KUMA 5AFWA 2HHHQ 3ULPA 4QMGA 2R7ZG 5C4XB 4KHPL 1IYUA 1IXRA 1VQMA 1VQKA 1EY8A 4YCWA 5M5XH 1R4QB 3FMCA 2VS1A 1EFWA 2ES2A 4JI1Q 2HD3A 3S14H 3PCOB 2N8NA 1CZWA 1V9PA 3A7LA 3H3VH 5C44G 1HFGA 2ICIA 2QDBA 1DXMA 1C7YA 2YU9B 2B2UC 1DZ1A 4ABNA 4C2MH 1W6JA 1MJCA 1I4HA 3S24A 1RTNA 4O0AA 2L4NA 2Q8TA 4N8X1 2AMCB 5I9OA 3OTOL 2AUJD 1GO3E 2EJMA 3RNUA 2BA1A 4YCUA 5DM73 4R4QA 1SE8A 5IODA 3SK5A 4DAVA 3VR6A 1VQJA 3I4MG 1PRTF 3GTQB 1JJCB 4TSSA 2KECA 1TS2A 2PI2E 4ULLA 5HY6A 5C5MA 3SEBA 4CJ0B 3G71A 2KCTA 3S1NH 1WTQA 1YVCA 2B2TA 1WTRA 1X3FA 2KJXA 4O2DA 4CHTB 2JA5G 2Q8RE 1FGUA 3N52A 2JA6G 1HPCA 1TWGB 5EGTA 4C3HG 1KABA 3S1RB 1EQRA 4B3RL 2K5QA 3F2DA 5LL6S 3GTMB 3WOFA 1QJOA 2R7ZB 1LT6D 1WI5A 1STBA 4A3LH 2UXCL 4QL5A 1EIFA 3HOXG 3J81j 4GKJQ 3BYTB 2F0GA 1L1OA 3D6CA 5C6AA 2RSOA 2OF1A 2F0UA 4A3FG 4XDXA 1OXSC 5EKKA 3STBC 3M4QA 4DUYL 2IHEA 4RGOS 1PH2A 1D6EC 3SXHA 5FJ8H 2UXBQ 5C44B 5HURA 1JMCA 2ZXRA 3UDXA 4R4TA 3HOZH 3I8ZA 1VQ8A 1WTWA 1PXUA 3KF8B 4UP7A 2E2JB 4HR7B 4QB4A 4ZYSA 4C3IG 2FFKB 4X3SA 3DMUA 4DV7Q 5KNCA 1XPUA 3I2ZA 5ELFA 3OMGA 3SGIA 3RUZA 1MIUA 3PO2H 5BN4A 3I56A 4NPSA 3A7AB 5FLXL 1Y8OB 3SVMA 5C0XI 2PPBC 2L55A 1Q8IA 2X69A 2TMPA 1EIHA 3S1QH 1N32L 1I50B 3VR2A 2K01A 1PH1A 1F9PA 1YEZA 1O78A 2OQ0A 4JI8Q 1IBML 2JA5B 3Q23A 4FF3A 4K6DA 1VQAA 2JA6B 5KRUA 4NW2A 5ELOA 4Y7NH 4DN4M 4GOPA 4A3BB 4A3IH 4KKUA 3DXJC 4NDXA 5JPMC 2XSCA 1I4GA 4C3HB 2KVMA 1PTOF 1JOKA 2PO4A 3I7FA 5IY0A 4DNIA 2RSNA 1TKWB 1YJ9A 2H4OA 3MZ5A 4Q0FA 2IX3A 1X3QA 2UUBQ 4MZ9A 3I4NH 2E74C 1N34L 3FP9A 3HOXB 3LNNA 5BN3A 5JJLA 1H9JA 4K14A 5C4JH 2RBMA 1O7YA 2XRQD 5H1SE 4A3FB 1I6HB 2KA7A 3LWEA 1SNOA 3PSIA 1HZCA 3ITPA 2Q2TA 2B8FA 2Z4IA 2I5MX 3RN5A 1TT2A 3HGBA 3S17B 2LS01 4PQXA 2RDHA 3X3MA 3U9SA 5J39A 2EYOA 5EBCA 3R2IA 4NXNQ 4E6IA 3BVZA 2ENBA 4BBRH 1R9TB 5I2YA 4N9PA 1CT1D 3F2CA 4ZRZA 1SYBA 1SYFA 4NMZA 2L11A 3PIOA 4P72A 3VA5A 1Y69U 3PO3G 1MJEA 2NVXB 5DEHA 1XNRQ 4H02A 4DV1Q 3S2HB 4A3KH 2EXZA 4JI2Q 2C9OA 2CW0C 3D4WA 3KF6A 1IHZA 4DR4L 4JI0L 1PFNA 1YHQA 4B3SQ 4UDUC 3QOLA 3A54A 2F0IA 3PV0A 4DAYA 4JK1C 1DJRD 1VQGA 2LXKA 3KLSA 1FJGL 4XYOA 3D31A 4WFN3 3K5MA 5A2QL 5T1GA 2Z8LA 3CKIB 2VL6A 4XTCS 4DUZL 4CJ2C 2F0SA 1VQCA 5I9PA 1RIPA 1K3RA 2EY5A 4F7XA 1C48A 3KK7A 3J81E 4DV4L 1X32A 3UDIA 1K8GA 1G91A 2IHFA 4CDCC 3MXPA 1K8MA 2YTVA 1T5XD 4B9WA 2PW5A 5LMNL 2ZJQA 1X65A 2F4VQ 4K8IA 4JI5Q 1M8AA 3TP5A 2B2UA 1DM0B 3TZUA 4BY1H 4FXKC 4XT1B 2IWHA 3SK8A 5CMDA 3DEPA 4IPGA 2P5ZX 2UU9L 2F0KA 4JI3L 1ZXTA 2B8GA 1WCMG 2V1CC 4IUPA 1WD0A 2JA8H 3P75A 5NUCA 1IBLQ 3DM1A 1ENFA 3PO3B 4A3LG 3BDLA 1SYGA 2B3GA 5M5XB 3AQQA 4RGMA 1QB5D 4KHPQ 1CKNB 1VDZA 5C3XA 2F0NA 5KGUA 2DUDA 3HKSA 4C56C 4LF7L 2Z0SA 3KDFA 2WP8J 4XQJA 3NUCA 5FJ8G 1V1PA 4ZK9B 5C4XH 4O42A 4ZAIA 5IP9G 1XNQL 2SEBD 3NWTA 3NWSA 5ELDA 2L9HA 1S5DD 4N9TA 5KYIA 2X6GA 2F0VA 1CA6A 1V8QA 1PRTC 2LFNA 1IL2A 2A68D 2NTSA 2NZHA 4RHRA 4A3JG 2I07B 3OTOQ 4CDFC 1U4LA 3DWQA 1WYDA 3K80C 3H09A 2YU9H 2Z6KC 1I3QB 5C3WA 1Y14B 1QG7A 1MSHA 1F9SA 1EU4A 4LAAA 3CW2C 1A3TA 5C0XJ 3ERSX 1J6QA 2O5IC 1LT5D 3TDQA 5FO9B 4X65L 1KAWA 5CBEE 1D8LA 5EQ0A 2Z1CA 3GTQH 4A3IG 5ELCA 4ZKBB 1SNQA 2EYHA 4LF4L 1RJTA 1VQLA 5ELBA 3BYYB 1ET9A 1WCMB 1BBXC 3OHXC 4B3RQ 4ME3A 3KOJA 2RQXA 1IW7D 2EOTA 1TWGH 3AU7A 1TIID 3CU7A 3AB9A 1VQPA 3S1RH 1I4PA 3KUPA 2R93G 1ILQA 1JB7A 4GLAC 1EYGA 3DHQA 2H5XA 4ZUJA 4TVAB 3GTMH 2EVBA 5KEEA 3J7A5 2R7ZH 4DAPA 1P8LA 3S15B 2EY6A 2AQ2B 2CHBD 4DUYQ 1U5KA 1VQNA 2WKCA 3D3RA 3NBHA 2LKVA 3TRZA 1BUVT 2NVQB 2WB1G 2RDGA 4YY3Q 1CSQA 4N8FA 5IGEA 2R92G 2K03A 2F4IA 4JI4Q 2NYZD 1B3AA 4A3JB 2K5WA 5C44H 2AWOA 3UI2A 2B2TC 3KBGA 3C2PA 1E2WA 1F2YA 2CWPA 2C5CA 1EQVA 4P73A 2WB1E 3OW7A 4QIWE 2E2JH 1Z7TA 4FXGC 2N49A 2PQAA 1KLUD 4L5TA 2XVSA 4FF4A 4XQQA 3VR5A 4MHEA 1FVIA 1N32Q 1E22A 1EQTA 2CCZA 1L0XB 1E24A 5K5PA 1XJVA 1IBMQ 2G5DA 1L1OC 3TMEA 4S3SA 1K0RA 4JI8L 3QG1A 4IOAA 3HOVG 3MXGA 1MGSA 1I50H 4DV0L 1OTCA 5C3EG 1F2LA 3E3XA 2JA5H 1EIYB 2PW7A 5D65A 1S5FD 2JA6H 4A3BH 4U68A 5LMNW 2E75C 1AN8A 2F0OA 2K14A 3WDNA 1WFQA 4C3HH 2R93B 2UUBL 5EKIA 3T56B 4IO9A 1EZ8A 1PDQA 5IT9L 5EBDA 1W3SA 4K8JA 3DWAA 3GV3A 5M3FB 4EQ5A 4JV5Q 2OXPA 4PV1C 1MKHA 3SDZA 4B3TL 3HOXH 1EY5A 4QF4A 4HMJA 4LFBL 4OWWB 1PLFA 4K0KQ 2WB1B 3TBIB 4A3FH 1I6HH 1RODA 2NN6G 1JC7A 1SRUA 4QIWB 4BY1G 4G7HC 4IPHA 2R92B 5I2XA 4BS9A 2AKWB 4OXPA 3HFZB 1NMFA 3S17H 3I4OA 1QNKA 1UE1A 2DY8A 1DGSA 1SJED 3CCLA 1KQSA 2EQSA 2IX1A 1IYVA 4OX9L 2DNEA 2A6EC 3TQYA 2EJFC 1R9TH 1OO9B 3TP7A 1I6VC 4BXXG 1VQ5A 5JJKA 3IL8A 2N55A 4MIUA 3K8AA 1XNRL 4HJAA 2IX0A 4WJ3M 4DR4Q 2NVXH 4JI0Q 4ILWA 5ISRA 3J80c 3S2HH 3HOVB 2IJ0A 4RA8A 3L3OC 4DPGA 1STEA 5C3EB 5KNBA 1PH8A 3A55A 1HTPA 1HFNA 4QGUA 1Y8NB 5GAHC 4X66Q 5A35A 2NTTA 2K4KA 1STHA 1QVFA 2YV5A 5IYBG 3UE1A 3H15A 4F88A 2Q2UA 3K58A 1S5CD 2EZVA 1LTGD 4IJHA 1KTKA 3IFTA 1JOQA 1PRTB 4A93G 2ALYB 1SEBD 4DK6C 4GN4B 2IT1A 2A8VA 2HQEA 4K2LA 1W2BA 1JT8A 4GLXA 4P2CB 5EPLA 5GAGC 4DR2Q 3FKIG 3FVQA 3BS1A 1QUQA 1ENCA 3F2UA 4KKSA 5M3MG 4KJOA 1QZGA 2F4VL 4IUNA 2R61A 3I73A 4RWSC 4B08A 1KRTA 1MD2D 5IT9c 5E4WC 5BR8Q 1KDAA 3T16A 1H9SB 1Q1BA 4JI3Q 1TY0A 1QVCA 5IGDA 3EN2A 3NTIA 1SYEA 1KIXA 1LLRD 1AH9A 4KMUC 2V4DA 1IBLL 1JQYD
chains in the Genus database with same CATH topology
2Q8IB 2MGSA 4RH6A 1ENAA 2AQ1B 2NVYB 2DY7A 1I4XA 4FF2A 1TWHB 2VB3X 3HZXA 5JEAJ 2BDNA 1LO5D 4QUCA 3S16B 1OXUA 5CV6A 1HCZA 1ESFA 3CHBD 3MXUA 3GO5A 2GA4B 4RCOA 2IW3A 5KYLA 2L0CA 1STGA 3GTGB 2KQ3A 5COYA 2FINB 4X3UA 1SSOA 4A93B 1SE3A 4GZYC 3FKIB 3K59A 5M3MB 1BCPF 3CQZB 1D5ZC 5JJZA 1H9KA 1ICWA 3J7YW 1PTOB 5FLXE 1E2VA 3KBXA 2EE1A 1A2TA 2XWBB 2PZTA 3IAYA 2D5DA 1MBYA 4DF7A 5C0XG 2M9VA 3I90A 3N6RA 3DWPA 1GUGA 2G9HD 3NTHA 2B2YC 3C3LA 5CV5A 1KDCA 5I4DA 1JE4A 5M5YB 3H3VC 1CZGA 1BF4A 5EKLA 4WORA 5DAUA 4KY6A 1QOHA 1OXVA 2PNRC 3MA2B 2O2LD 1Y8PB 4KN7C 4EQPA 2WINB 3DEOA 2CVRA 4FF1A 1EYDA 3KLSX 4LMQD 3D8GA 4DA2A 1AW7A 1RHPA 2A6HD 4FO2A 2SOBA 5E1FA 3MVVA 4ZLTF 2EYPA 4ZQ3A 4J1MA 1CM9A 1QE6A 2HUGA 3M7NA 2ZXPA 4IFDI 3H94A 4OO1I 2F0TA 2WIIB 4NP5A 2JP1A 2AWNA 1EU3A 2PYKA 4R8IA 2HDLA 5G3LF 3T53B 1U4PA 3S1MB 2QCPX 1WD1A 4YIJA 1SYDA 1LTAD 3D4DA 5FKAC 1EWHA 5C4ZA 5A2QE 3A56A 2WV6D 1PZID 1NAPA 3SE0A 1BNZA 1BO0A 1SNMA 4K5WA 1OXTA 1UUPA 2NBFA 2A74C 1LTTD 3Q24A 2PCFB 3PUWA 3FEWX 3ZYYX 5DNFA 2JE6I 5EPJA 1JWSD 2ZT9C 1U4RA 1WTOA 2H1EA 4JBWA 3HOUB 1Q90A 1ONLA 1F77A 4WJWA 4I65A 3FDTA 3VA7A 3URYA 4C1NK 2B2WA 4J6HA 4G57A 1B50A 1SDFA 1YNJD 1I4QA 1S5ED 4K5XA 4WRDA 4IUTA 1TWCB 1SE2A 3M7GA 3WOEA 4V190 3NE5B 1SXTA 1II3A 4K6LA 4BWGB 1GJXA 1F2MA 4KK7A 2HCCA 3BVGA 3T4AC 4A3DB 4QCLA 1CFMA 3I91A 1J9OA 5I6YA 2F0LA 2AQ3B 4KHZA 2JYOA 1ZYRD 5D3DA 2PZUA 1D1IA 4ME5A 1GUNA 2D9UA 4KI0A 3T13A 1LTBD 1JWUD 3BDOA 4OIKA 1B4OA 1RTOA 1NR2A 3R93A 4RKLA 5J22A 1AEXA 5E4XA 1EY6A 1AZQA 4KY7A 2NN6H 4DK1A 3QJYA 1X3PA 3QO2A 4RGNA 1XTCD 2PMZB 2EYFA 2BA0A 2KOLA 1UAPA 1ESRA 3HP3A 1HXYD 4L6TB 3HS0C 4G7OC 4HMIA 3I70A 1EOTA 1V1PB 2VXWA 2NZ1D 2FMMA 2EY2A 1KNEA 5C5LA 3HEJA 2MUYA 2F0DA 4DFAA 3MEHA 2A69D 2IL8A 1FD7D 4V0BA 3VYRA 4X3KA 3E5SA 2B2YA 1BXTA 1BCPC 3HG9A 1JWMD 3EFXD 1TS4A 3MWYW 4PMCA 4XQNA 4F87A 4X3TA 4XXEA 2E2DC 5JAVA 5JEAG 3V05A 3GTJB 2OEOA 2HCIA 5KNDA 1Y1VB 1B44D 4HSPA 3H6MA 4A3EB 4OIJA 1SBBB 1O7LA 1R4PB 1TVXA 2O4XA 3M4OB 3S2DB 1SMYD 4ODGA 4IFDJ 2XWJB 2B63B 1GUWA 2K7VA 3MXNA 5LL6X 1HTLD 5CBAE 2AUKA 2WAQB 1EEFD 4KJNA 1PTOH 2EYMA 4RCNA 4RAUC 3GP7A 2O5JC 4CBVA 5EPKA 1ET6A 3E6ZX 5FOBB 4CKCA 2SNMA 1HRJA 1U4MA 2F0MA 5I6WA 1C8CA 1EYCA 2F0EA 3MFYA 5IT9E 3JAML 4TQUS 2K04A 3J80L 1SAPA 1Q3LA 1EZ6A 3O13A 4IALA 2K32A 4KD3A 5DM63 3D4RA 3L7ZC 3P20A 1PRTD 3OWEB 2ICEC 1A6XA 1E2ZA 1HHVA 3BZDB 3ERQA 4IUQA 3PIP3 2B2VC 1IKMA 5CORA 1FGBD 2J0TD 3VYSA 1RDPD 1F2ZA 4AYBB 1NSNS 4CKEA 2EYJA 4G7ZC 2XIWA 5C0XH 1SNDA 3BDCA 1QILA 3EVQA 1T5EA 1STYA 1IKLA 3X3NA 1FNVA 1D5MC 2IPKD 3HKZB 2A73B 4M1UB 4DNRB 3OSOA 3KLRA 1EY7A 3MTSA 2QEJC 2K33A 3E0JA 3NTKA 1LACA 1E0BA 3OPOA 4CKBA 1A3UA 4A3MB 4C3JB 4EVOA 2N88A 2F0FA 4H7BA 1KAAA 1KNAA 1G8ZD 3SK4A 5CGKA 2M2LA 1D1KA 2F3WA 1SNPA 3HOWB 4BBSB 4XT3B 3NPPA 1G2TA 5FK9C 2K05A 2XRSD 3LWUA 3R3OA 4R8NA 1PTOD 4UAIA 3NQTA 5K36G 5E3FA 2FMCA 2J4XA 2FJ2A 1CQVA 1S5BD 3H0GB 1CK1A 4F8MA 1YNND 2RDFA 4A3GB 2D62A 4H13C 1HUMA 1BCPB 2JSOA 2B2WC 2LY7A 1TWFB 4H44C 4IQZA 1EWCA 1Y1WB 4CJ1B 1V43A 1DYQA 2E76C 2PZWA 1C4QA 3MC0B 2F0JA 1HQMC 4KY5A 1S4ZA 1J8IA 2KCNA 3K0YA 2F03A 3A8IE 1B9MA 2BE5D 3TN2A 1A15A 2NVTB 1M4VA 2BDOA 4CGYB 5CV8A 1K8OA 3I3CA 1K83B 1EIGA 3HOYB 1BOSA 3TP6A 1NR4A 1MI2A 1HUNA 2E2IB 1W6KA 4FYDA 1FYCA 2VUMB 5CC4A 5CV7A 3VYTA 3VR4A 3EJIA 4LJZC 3GTLB 4RFBA 3K7AB 5JOBA 1VMCA 4LK1C 3PUVA 5LHY1 3AMUA 3Q6SA 5JVG3 5HGTA 2X6LA 2HDMA 1A3VA 1TR5A 1QNUA 2A6HC 1SE4A 1ZKOA 4R9WA 1VCIA 1Z47A 1BDOA 3EQLC 3GTOB 3NSWA 3RLFA 5JPNC 2G9DA 4DXGA 1RCVD 2K5DA 1GUSA 1SFOB 1DOLA 3QWNA 4K5VA 1B53A 1B2TA 2F0HA 2RVLA 3CRKC 1EY4A 3I4LA 4FP5D 1JR0D 3OWFA 3PMFA 3GTPB 2B2VA 1EFID 1SNCA 4IFDG 5M5WB 3EROA 1WTPA 4L63B 1LTRD 2OT2A 4OO1G 5D3IB 4XIGS 1CHQD 1F9RA 1QWYA 4B9XA 1ML0D 1LABA 3RZDB 1MSGA 4XYQA 3BVMA 2SNSA 3PUZA 2K1BA 2MJ8A 1VMPA 3BG3A 2EYLA 1JORA 1AP0A 3GD7A 5CYUA 2FHTA 5JEAH 3GTKB 1YNJC 4Z9CB 3M85A 5IIFA 5IGFA 1TY2A 4PMWA 1Z6HA 3W2DA 3KF8A 3I72A 4K2KA 1EYAA 3I4MB 1GOZA 4BA1I 2VB2X 1HA6A 4IZ8A 2EDGA 1XX8A 3K5LA 5CR3A 1XWEA 1D5XC 1QCBD 3GQBA 5D14A 1VF7A 1ZYRC 3K5NA 4KN4C 4Q5VA 1D2BA 1LV9A 1AFPA 2XNAC 4KHVA 1KLGD 1G291 5ELEA 3QOJA 2K28A 1DONA 3NBIA 2F0PA 3FPPA 5FO8B 3TSSA 5KIXA 1RF2D 2E2HB 3EA6A 4J8QA 2KEDA 4BA2I 4OGQC 2EJGC 3S9WA 4C3IB 1WTXA 2D2CC 2EPBA 2MPMA 1G2SA 5BN5A 5TSSA 2A69C 4I7ZC 3M3YB 4RGTA 1WTVA 3P1HA 1V1OA 3J7AV 2A68C 3QB3A 4L8JA 4DK0A 1TWAB 2SDFA 3OIQA 2JEAI 2VNUD 3VYUA 2KHSA 2NB0A 2WACA 1SYCA 3MHBA 1FNWA 2PQEA 5FO7B 4O1NA 5J1ZA 4IUVA 1FR3A 1O80A 4HCEA 3G6JB 4FNFA 2Y0SB 1NCVA 1STAA 5C4HA 1SMYC 4HSVA 3RZOB 1EY9A 3FRPB 2ZXOA 2RKSA 1GHKA 1GXDC 2MHVA 4H0LC 3GV6A 4IUUA 1IW7C 2BCOA 2F0QA 1EEID 3CRLC 4KTAA 4ZKCB 1A2UA 2JA7B 4QUFA 1TS5A 2QILA 3RMHA 1BQQT 4MN3A 4DNTB 1LT3D 4NKLA 3S14B 4EGVA 1PMRA 4KV6A 1B1ZA 2YYZA 2L1BA 2CW0D 5K36H 1I4RA 2L5TA 3J81L 2EY1A 4KKTA 4EQNA 4C2MB 4U673 2KCCA 2B39A 3NK9A 2DNCA 3MFGA 5M9OA 3JAME 3NP8A 1O7ZA 3J80E 1B9NA 5JVH3 3Q22A 3ND9A 2TSSA 4KD4A 3S1NB 1HQRD 1STNA 1CQFA 4FXDA 4ZUIA 3K6OA 4HCSA 4TKOB 2J7ZA 4EQOA 2R3ZA 3PUXA 4C1NI 3D6WA 1CI3M 1WVLA 1IL8A 1BR9A 4DXFA 4DU9A 2BOSA 4HN7A 3SHLA 5CV4A 1CHPD 1EL0A 4ID6A 1PFMA 2M00A 5IGCA 1PZKD 3NXWA 3HOZB 1DOKA 3K5OA 3ONAB 1DCZA 4C3JG 3V2TA 4RHSA 1JICA 3U9OA 4PMBA 3W3AA 1H9RA 3RD4A 3C1FA 3PO2B 1CTMA 1BCPD 4TRDA 2I46A 3A8JE 2WKDA 2NWGA 1OXXK 5T1IA 3FPUB 2KEEA 3QIAA 2JEBI 1XYIA 3S1QB 3Q0AA 1FNUA 1PTOC 2CQAA 3DUZA 1CA5A 2QF7A 4BY7B 1PZJD 1Q1EA 4Y7NB 1L0YB 3H91A 3OMCA 4A3IB 4OHJA 4OL7A 1LTID 1DD2A 2JXMB 1YNNC 3OOCA 5IOCA 3I4NB 1ZEQX 3VR3A 3NHHA 4IFDH 1UEAB 3C1EA 2K6AA 5C4JB 3TZDA 3M4YA 1NUCA 4PNYA 1UNSA 4OO1H 1HA5A 1GUTA 1EY0A 3A8KE 2L12A 1H9MA 2R6GA 3IKJA 3C46A 3OIPA 1AZPA 4IN3A 2BE5C 4BBRB 1SJHD 1G6ZA 5IGBA 1JCKB 1PYWD 2QKIC 2LMCB 2Z4HA 1PFBA 5F2DA 1TU2B 3T51B 3TP8A 3LX0A 1RKNA 3ND8A 3L9AX 1VF5C 1U9RA 4A3KB 2MP1A 1GHJA 1Q12A 4HEDA 3J7AF 4IURA 3PUYA 3SR1A 1TQOA 2F3VA 5G3LD 1JOOA 2A5HA 3HRZC 5EJWA 3IFDA 3V96A 3R8BA 2NN6I 1KDBA 1TS3A 4HAEA 2F1MA 3K57A 1LT4D 3NQIA 1F9QA 1RD9D 3R2TA 2NUCA 4RKBA 5IGGA 2DN8A 1XXGA 4BY1B 1GUOA 2ID0A 3P7JA 5CV9A 3G7LA 4HTHA 4FVMA 2JA8B 1DOMA 3SK6A 3PIO3 2XN9C 2F0WA 2RA4A 1H9SA 1JB3A 4DGZA 2A6ED 1LTSD 1ILPA 4M8AA 4G4KA 3MAQA 2KUMA 5AFWA 4QMGA 5C4XB 1IYUA 1EY8A 1R4QB 3FMCA 1CZWA 3A7LA 1HFGA 2ICIA 2QDBA 1DXMA 2YU9B 2B2UC 1DZ1A 4ABNA 1W6JA 1I4HA 1RTNA 2Q8TA 2L4NA 5I9OA 2AUJD 2EJMA 2BA1A 5DM73 5IODA 3SK5A 4DAVA 3VR6A 1PRTF 3GTQB 4TSSA 2KECA 1TS2A 4ULLA 5C5MA 3SEBA 4CJ0B 1WTQA 2B2TA 1WTRA 2KJXA 4CHTB 2Q8RE 3N52A 1HPCA 1TWGB 5EGTA 4C3HG 1KABA 3S1RB 2K5QA 5LL6S 3GTMB 3WOFA 1QJOA 2R7ZB 1LT6D 1STBA 3BYTB 2F0GA 3D6CA 5C6AA 2RSOA 2OF1A 2F0UA 4XDXA 1OXSC 5EKKA 4RGOS 1D6EC 3SXHA 5C44B 5HURA 2ZXRA 3I8ZA 1WTWA 1PXUA 2E2JB 4HR7B 4QB4A 4ZYSA 4C3IG 2FFKB 4X3SA 3DMUA 5KNCA 5ELFA 3OMGA 3RUZA 5BN4A 3A7AB 5FLXL 1Y8OB 3SVMA 5C0XI 2PPBC 2L55A 1Q8IA 2X69A 2TMPA 1EIHA 1I50B 3VR2A 2K01A 1F9PA 1O78A 2JA5B 3Q23A 4FF3A 4K6DA 2JA6B 5KRUA 4NW2A 4DN4M 4A3BB 4KKUA 3DXJC 4NDXA 5JPMC 2XSCA 1I4GA 4C3HB 2KVMA 1PTOF 1JOKA 2PO4A 2RSNA 1TKWB 2H4OA 3MZ5A 4Q0FA 2IX3A 1X3QA 2E74C 3HOXB 3LNNA 5BN3A 1H9JA 4K14A 2RBMA 1O7YA 2XRQD 4A3FB 1I6HB 2KA7A 3LWEA 1SNOA 3ITPA 2B8FA 2Z4IA 1TT2A 3HGBA 3S17B 2LS01 4PQXA 2RDHA 3X3MA 3U9SA 5J39A 2EYOA 5EBCA 3R2IA 4E6IA 3BVZA 2ENBA 1R9TB 5I2YA 4N9PA 1CT1D 4ZRZA 1SYBA 1SYFA 4NMZA 2L11A 1Y69U 3VA5A 2NVXB 5DEHA 3S2HB 2EXZA 2C9OA 2CW0C 3D4WA 1IHZA 1PFNA 4UDUC 3QOLA 3A54A 2F0IA 3PV0A 4DAYA 4JK1C 1DJRD 3KLSA 4XYOA 3D31A 4WFN3 3K5MA 5A2QL 5T1GA 2Z8LA 3CKIB 4XTCS 4CJ2C 2F0SA 5I9PA 4F7XA 2EY5A 3J81E 1C48A 3KK7A 1X32A 1G91A 3MXPA 1K8MA 1T5XD 4B9WA 2PW5A 4K8IA 1M8AA 3TP5A 2B2UA 1DM0B 3TZUA 4FXKC 4XT1B 2IWHA 3SK8A 5CMDA 3DEPA 2F0KA 1ZXTA 2B8GA 4IUPA 1WD0A 3P75A 5NUCA 3PO3B 3DM1A 1ENFA 3BDLA 1SYGA 5M5XB 4RGMA 1QB5D 1VDZA 5C3XA 2F0NA 5KGUA 4C56C 2WP8J 4XQJA 3NUCA 1V1PA 4ZK9B 4O42A 4ZAIA 2SEBD 3NWTA 3NWSA 5ELDA 2L9HA 1S5DD 4N9TA 5KYIA 2X6GA 2F0VA 1CA6A 1V8QA 1PRTC 2LFNA 2A68D 2NTSA 4RHRA 2I07B 1U4LA 3DWQA 3H09A 1I3QB 5C3WA 1QG7A 1MSHA 1F9SA 1EU4A 4LAAA 1A3TA 5C0XJ 2O5IC 1LT5D 3TDQA 5FO9B 5CBEE 5EQ0A 2Z1CA 5ELCA 4ZKBB 1SNQA 2EYHA 1RJTA 5ELBA 3BYYB 1ET9A 1WCMB 1BBXC 3OHXC 2RQXA 1IW7D 2EOTA 3AU7A 1TIID 3CU7A 3AB9A 1I4PA 3KUPA 1ILQA 3DHQA 4ZUJA 2EVBA 5KEEA 4DAPA 3S15B 2EY6A 2AQ2B 2CHBD 2WKCA 3D3RA 3NBHA 2LKVA 1BUVT 2NVQB 2RDGA 5IGEA 2K03A 2F4IA 2NYZD 1B3AA 4A3JB 2K5WA 2AWOA 3UI2A 2B2TC 3KBGA 3C2PA 1E2WA 1F2YA 2C5CA 1EQVA 3OW7A 1Z7TA 4FXGC 1KLUD 2XVSA 4FF4A 4XQQA 3VR5A 4MHEA 1EQTA 1L0XB 5K5PA 3TMEA 4S3SA 3QG1A 3MXGA 1MGSA 1F2LA 2PW7A 5D65A 1S5FD 4U68A 2E75C 1AN8A 2F0OA 3WDNA 2R93B 5EKIA 3T56B 1EZ8A 1PDQA 5IT9L 5EBDA 4K8JA 3DWAA 3GV3A 5M3FB 2OXPA 4PV1C 3SDZA 1EY5A 4QF4A 4HMJA 1PLFA 2WB1B 3TBIB 1RODA 2NN6G 1JC7A 4QIWB 4G7HC 2R92B 5I2XA 4BS9A 1QNKA 2DY8A 1SJED 2IX1A 1IYVA 2DNEA 2A6EC 2EJFC 1OO9B 3TP7A 1I6VC 3IL8A 2N55A 4MIUA 2IX0A 4ILWA 5ISRA 3HOVB 2IJ0A 4RA8A 3L3OC 1STEA 5C3EB 5KNBA 3A55A 1HTPA 1HFNA 1Y8NB 5A35A 2NTTA 1STHA 4F88A 3K58A 1S5CD 2EZVA 1LTGD 1KTKA 3IFTA 1JOQA 1PRTB 1SEBD 2IT1A 2HQEA 4K2LA 4P2CB 5EPLA 3FVQA 3BS1A 1ENCA 3F2UA 4KKSA 4KJOA 4IUNA 2R61A 3I73A 4RWSC 4B08A 1MD2D 5E4WC 1KDAA 3T16A 1H9SB 1Q1BA 1TY0A 5IGDA 3NTIA 1SYEA 1LLRD 4KMUC 2V4DA 1JQYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJT A;  4HED A;  2K01 A;  1PLF A;  4IUR A;  2MGS A;  1F9P A;  4X3T A;  2B2U C;  1DZ1 A;  1BBX C;  1X32 A;  2B2W C;  1RTN A;  3ONA B;  2L4N A;  1ROD A;  4IUT A;  2Q8T A;  1G91 A;  2HCI A;  3DEO A;  2CVR A;  1JIC A;  4NW2 A;  4CJ1 B;  4DN4 M;  2B2V A;  2EOT A;  4LMQ D;  2XIW A;  2KED A;  2KVM A;  2DY7 A;  4OIJ A;  4MN3 A;  3KUP A;  1ILQ A;  1M8A A;  1RHP A;  1WTP A;  1QNK A;  2RSN A;  2B2U A;  2DY8 A;  2NWG A;  5EJW A;  3IFD A;  1TVX A;  5T1I A;  2BDN A;  1S4Z A;  1J8I A;  1X3Q A;  2L1B A;  4QUC A;  2HCC A;  2KEC A;  4ZLT F;  3FPU B;  2KEE A;  3I91 A;  1WTX A;  4XT1 B;  1XYI A;  1J9O A;  4CJ0 B;  5CMD A;  3DEP A;  1IKL A;  1CM9 A;  1GUW A;  1QE6 A;  1F9R A;  2HUG A;  3TN2 A;  1A15 A;  3IL8 A;  2JYO A;  1O7Y A;  1WTQ A;  1ML0 D;  2N55 A;  1ZXT A;  2B2T A;  1CA5 A;  1MSG A;  5CBA E;  1WTR A;  3LWE A;  2EPB A;  4IUP A;  1WD0 A;  2MPM A;  1G2S A;  3DM1 A;  2Q8R E;  4HAE A;  2K1B A;  2MJ8 A;  2D9U A;  3I3C A;  1EIG A;  1VMP A;  2K03 A;  3N52 A;  3H91 A;  4RAU C;  1NR4 A;  2NYZ D;  5COY A;  3MTS A;  2FIN B;  4X3U A;  1B3A A;  1MI2 A;  1F9Q A;  1SSO A;  1HUN A;  1WTV A;  3UI2 A;  2B2T C;  1O7Z A;  2JP1 A;  4RA8 A;  1E0B A;  5EPK A;  4OIK A;  1B4O A;  1RTO A;  1AP0 A;  1NR2 A;  3R93 A;  2SDF A;  4R8I A;  2HDL A;  2FHT A;  5E4X A;  1U4P A;  1HFN A;  1AZQ A;  1X3P A;  4ZK9 B;  1HRJ A;  1WD1 A;  1U4M A;  3QO2 A;  4O42 A;  4ZAI A;  2N88 A;  3P7J A;  1VMC A;  3TZD A;  1KNA A;  3G7L A;  2L9H A;  5JJZ A;  2KOL A;  1C8C A;  1ICW A;  4MHE A;  2M2L A;  2RSO A;  2X6G A;  1ESR A;  4XDX A;  1DOM A;  1CA6 A;  4HCS A;  2L11 A;  3HP3 A;  1EQT A;  3Q6S A;  4XT3 B;  4IUV A;  3KBX A;  2EE1 A;  2J7Z A;  2X6L A;  2L12 A;  2RA4 A;  1G2T A;  1NAP A;  2R3Z A;  2HDM A;  1HA6 A;  1O80 A;  1BNZ A;  1EOT A;  2K04 A;  1BO0 A;  2VXW A;  1NCV A;  1SAP A;  1Q3L A;  1U4L A;  3D6W A;  2K05 A;  2NZ1 D;  1MGS A;  3I90 A;  3I8Z A;  1XX8 A;  2FMM A;  4HSV A;  4R9W A;  1ILP A;  1WTW A;  1AZP A;  5EPL A;  1WVL A;  1KNE A;  1F2L A;  1PFN A;  2B2Y C;  5D14 A;  1IL8 A;  2KUM A;  5AFW A;  1QG7 A;  3F2U A;  1MSH A;  1F9S A;  4UAI A;  5D65 A;  2FFK B;  4X3S A;  4RWS C;  4U68 A;  1G6Z A;  1LV9 A;  5DNF A;  5EPJ A;  3GV6 A;  1WTO A;  1U4R A;  2FJ2 A;  4IUU A;  2H1E A;  5E4W C;  2IL8 A;  5EKI A;  1EL0 A;  1HHV A;  1PFB A;  1JE4 A;  1PDQ A;  4IUQ A;  1DOL A;  4X3K A;  5T1G A;  3SVM A;  5CBE E;  3FDT A;  1PFM A;  2B2Y A;  1B53 A;  5EQ0 A;  1BF4 A;  4CJ2 C;  1B2T A;  3GV3 A;  2B2W A;  2X69 A;  4ZKC B;  2RVL A;  2B2V C;  4QUF A;  4ZKB B;  3MWY W;  2K28 A;  1B50 A;  1IKM A;  1HFG A;  1HUM A;  1SDF A;  2MP1 A;  1EIH A;  1DON A;  1DOK A;  5COR A; 
#chains in the Genus database with same CATH topology
 2E5L L;  2Q8I B;  2MGS A;  2K52 A;  4RH6 A;  1RL2 A;  3PO3 H;  2VW9 A;  1E7Z A;  1EWI A;  4LF7 Q;  1ENA A;  2AHO B;  3AFQ A;  2AQ1 B;  2NVY B;  2DY7 A;  1XNQ Q;  1I4X A;  4FF2 A;  1TWH B;  2EIF A;  3KYH C;  4R4O A;  1B3Q A;  3NEN A;  2VB3 X;  3HZX A;  5JEA J;  2BDN A;  4IPD A;  1LO5 D;  4QUC A;  5FLM H;  3S16 B;  1HZB A;  1OXU A;  4X62 Q;  5CV6 A;  1HCZ A;  1ESF A;  3CHB D;  3MXU A;  3GO5 A;  1LTL A;  2GA4 B;  4RCO A;  2IW3 A;  1BBW A;  5KYL A;  2F52 A;  4QY7 A;  2L0C A;  2Z6B A;  1STG A;  3GTG B;  2OTJ A;  2KQ3 A;  5COY A;  2FIN B;  4X3U A;  1SSO A;  4A93 B;  1SE3 A;  4GZY C;  3DM3 A;  3FKI B;  1I3Q H;  3K59 A;  5M3M B;  4X65 Q;  3CF5 A;  1BCP F;  4DR6 L;  4L5R C;  4X64 L;  4P71 A;  4DR7 L;  3CQZ B;  1UE6 A;  1D5Z C;  5JJZ A;  2Z9H A;  1H9K A;  1ICW A;  3J7Y W;  4LF4 Q;  1PTO B;  5FLX E;  1E2V A;  3KBX A;  2EE1 A;  1A2T A;  4YWM A;  4A3B G;  2XWB B;  2PZT A;  1XPR A;  3IAY A;  1Q46 A;  2D5D A;  2RF4 A;  1MBY A;  2Q2H A;  4DF7 A;  5C0X G;  2M9V A;  3I90 A;  1J5E Q;  3N6R A;  3DWP A;  4LF5 L;  1WCM H;  1L1O B;  1GUG A;  2G9H D;  3NTH A;  2B2Y C;  3C3L A;  3TS0 A;  5CV5 A;  2A1A A;  1N8R C;  1KDC A;  5I4D A;  1JE4 A;  5M5Y B;  3H3V C;  1CZG A;  1BF4 A;  5EKL A;  3KFU A;  1L0W A;  5IP9 H;  3S15 H;  4WOR A;  5DAU A;  4KY6 A;  1QOH A;  4YY3 L;  1OXV A;  2PNR C;  5E7N A;  3MA2 B;  1E3P A;  2O2L D;  5GQO A;  4JI4 L;  1Y8P B;  4KN7 C;  4EQP A;  2WIN B;  1PYS B;  2NVQ H;  1VQE A;  3DEO A;  1C0A A;  2CVR A;  2ATW A;  4FF1 A;  1EYD A;  5IYD G;  3KLS X;  4LMQ D;  4YWK A;  4A3J H;  3D8G A;  4DA2 A;  1AW7 A;  1RHP A;  3G6E A;  3HOU G;  2A6H D;  4FO2 A;  2SOB A;  5E1F A;  3MVV A;  4ZLT F;  2EYP A;  4ZQ3 A;  1NNX A;  4J1M A;  1CM9 A;  1YNX A;  1QE6 A;  2HUG A;  4GOP B;  2ZXP A;  1VS0 A;  4PZ6 A;  3M7N A;  4IFD I;  4LW1 A;  3PQI A;  3A5Z B;  4DV0 Q;  3H94 A;  4DV5 Q;  1YIT A;  3T1H L;  2F0T A;  4OO1 I;  1C9O A;  3FHW A;  2WII B;  4NP5 A;  2JP1 A;  2AWN A;  1EU3 A;  2PYK A;  3AFP A;  4R8I A;  5IE8 A;  2HDL A;  5G3L F;  4R1J A;  3T53 B;  1YJN A;  1U4P A;  2KCM A;  4GKK Q;  3S1M B;  2QCP X;  3DLL A;  1WD1 A;  1VQI A;  4YIJ A;  1SYD A;  2VY3 A;  4P75 A;  1LTA D;  3D4D A;  5FKA C;  1EWH A;  1SR3 A;  4B3T Q;  4HIK A;  2R93 H;  5C4Z A;  4JV5 L;  4AIM A;  4DR5 Q;  4LFB Q;  5A2Q E;  3A56 A;  5M3F H;  2WV6 D;  1PZI D;  1NAP A;  4K0K L;  3SE0 A;  1BNZ A;  1B70 B;  1BO0 A;  1SNM A;  2FXQ A;  2RCN A;  1PVO A;  4K5W A;  3ULL A;  3F1Z A;  1OXT A;  1UUP A;  2NBF A;  2A74 C;  4AQY L;  2R92 H;  1LTT D;  3Q24 A;  2PCF B;  4L5S A;  4OX9 Q;  3PUW A;  3FEW X;  3ZYY X;  5DNF A;  2JE6 I;  5EPJ A;  1JWS D;  2Y0S E;  2ZT9 C;  1U4R A;  1WTO A;  2H1E A;  4JBW A;  1A62 A;  1Q90 A;  3HOU B;  1ONL A;  4MTK A;  2MO1 A;  1F77 A;  4WJW A;  5IP7 G;  4I65 A;  1B7Y B;  3FDT A;  3VA7 A;  3URY A;  2ZTE A;  4C1N K;  2B2W A;  3KF6 B;  4G57 A;  1UEB A;  4J6H A;  3AYH B;  3BJU A;  4OEL B;  1B50 A;  1SDF A;  4DAY B;  2PMZ E;  1YNJ D;  3CPF A;  1PH3 A;  1I4Q A;  1S5E D;  4K5X A;  3F8T A;  5FLM G;  4WRD A;  4IUT A;  3NEL A;  4DV6 L;  1AE3 A;  1YIJ A;  1N36 Q;  1TWC B;  1SE2 A;  3M7G A;  3W1G A;  3WOE A;  3CCE A;  4V19 0;  2ZJR A;  3HOV H;  3NE5 B;  4X66 L;  1SXT A;  1II3 A;  4OEM B;  1SMX A;  2JN4 A;  4K6L A;  4BWG B;  5C3E H;  2BH8 A;  1GJX A;  1AE2 A;  1F2M A;  4KK7 A;  2HCC A;  3BVG A;  3T4A C;  4A3D B;  4UP8 A;  4QCL A;  1CFM A;  3I91 A;  3U50 C;  1J9O A;  5I6Y A;  2F0L A;  2L15 A;  4YHH Q;  2AQ3 B;  4KHZ A;  4LFC Q;  2JYO A;  1ZYR D;  5D3D A;  2PZU A;  2OQK A;  3CC7 A;  1D1I A;  4ME5 A;  1GUN A;  2D9U A;  4KI0 A;  3T13 A;  1LTB D;  3CCV A;  1JWU D;  4DR2 L;  4A3C G;  3BDO A;  4PG3 A;  4A3E G;  4OIK A;  1B4O A;  1RTO A;  1XTD A;  1NR2 A;  3R93 A;  4RKL A;  5J22 A;  1AEX A;  2CH4 A;  5E4X A;  1EY6 A;  1AZQ A;  4KY7 A;  2NN6 H;  4DK1 A;  3QJY A;  3JAM i;  1X3P A;  3QO2 A;  5BR8 L;  4RGN A;  3J80 i;  2B63 G;  1XTC D;  2PMZ B;  2EYF A;  1EQQ A;  1D7Q A;  4JVZ A;  2BA0 A;  2KOL A;  2QEX A;  1UAP A;  1X3G A;  1ESR A;  1M1K C;  4JC0 A;  2WAQ G;  1HNZ L;  3HP3 A;  2E5L Q;  1HXY D;  1K0S A;  4L6T B;  3CCR A;  3HS0 C;  4G7O C;  3KDF B;  4HMI A;  2GVB A;  3I70 A;  1EOT A;  1V1P B;  2VXW A;  4BXX H;  4LF8 L;  2NZ1 D;  3H3V I;  2FMM A;  2EY2 A;  2WAQ E;  3G4S A;  1YI2 A;  1Q7Y C;  1KNE A;  5C5L A;  1IYJ B;  2GN5 A;  3HEJ A;  1Q86 C;  2MUY A;  2F0D A;  4DFA A;  3MEH A;  2A69 D;  2NVY H;  3CC2 A;  2E2I H;  2IL8 A;  1TWH H;  1FD7 D;  4V0B A;  3VYR A;  4X3K A;  3E5S A;  4X62 L;  3ULJ A;  2B2Y A;  1BXT A;  1BCP C;  3CC4 A;  3HG9 A;  3S16 H;  1JWM D;  3EFX D;  4GS3 A;  1TS4 A;  3MWY W;  4PMC A;  4XQN A;  1ASZ A;  4F87 A;  3K7A H;  5IYB H;  4DK3 C;  4HJ9 A;  1UWV A;  4X3T A;  4XXE A;  1GM5 A;  1K28 A;  2E2D C;  5JAV A;  5JEA G;  3V05 A;  3GTJ B;  2OEO A;  2HCI A;  5KND A;  3GTG H;  1Y1V B;  3UE0 A;  1B44 D;  4HSP A;  2K50 A;  3H6M A;  4A93 H;  4A3E B;  4DR6 Q;  4OIJ A;  1SBB B;  4X64 Q;  4DR7 Q;  1O7L A;  1R4P B;  1TVX A;  1X54 A;  2O4X A;  3FKI H;  3M4O B;  3S2D B;  1SMY D;  3E0E A;  5M3M H;  3MXN B;  4ODG A;  4IFD J;  2XWJ B;  2B63 B;  1GUW A;  3CQZ H;  2K7V A;  3MXN A;  5LL6 X;  1HTL D;  2MO0 A;  5CBA E;  2AUK A;  2WAQ B;  1EEF D;  4KJN A;  1SFO H;  1N33 L;  4LF5 Q;  3UDG A;  1PTO H;  2EYM A;  4RCN A;  4RAU C;  3GP7 A;  2O5J C;  1J5E L;  5ELN A;  1CKM A;  2UXD Q;  4LUO A;  4CBV A;  5J3B A;  5EPK A;  4POG A;  2HIV A;  1ET6 A;  2QDL A;  3E6Z X;  2KHI A;  3NBH B;  2C35 B;  5FOB B;  4AYB E;  4AH6 A;  4GN5 A;  5M3F G;  4CKC A;  2SNM A;  1HRJ A;  1U4M A;  2F0M A;  1VQ9 A;  1HR0 L;  3B6Y A;  1PHJ A;  5I6W A;  5DLQ E;  4QJF A;  2I5H A;  3TS2 A;  1C8C A;  1EYC A;  4JI6 L;  2VQF L;  2QW7 A;  3CCQ A;  2F0E A;  3MFY A;  5M5Y H;  5IT9 E;  1VQ6 A;  3HKZ G;  3JAM L;  4TQU S;  2K04 A;  3J80 L;  2PQA B;  1SAP A;  1Q3L A;  1EZ6 A;  1PA6 A;  3O13 A;  4IAL A;  4X6A H;  2K32 A;  4KD3 A;  1M90 C;  3HKZ E;  5DM6 3;  1KXL A;  2JK8 A;  3D4R A;  1HJP A;  2PNH A;  3L7Z C;  3P20 A;  1PRT D;  3OWE B;  2ICE C;  1A6X A;  1E2Z A;  1E1T A;  1TXY A;  1HHV A;  2DGY A;  3BZD B;  3ERQ A;  4IUQ A;  3PIP 3;  5IWA L;  4BBS G;  2B2V C;  1A8V A;  3J81 c;  1IKM A;  1BVS A;  3T1H Q;  1LM0 A;  5COR A;  4DV5 L;  1B8A A;  1FGB D;  2J0T D;  3VYS A;  1E1O A;  1RDP D;  2CH4 W;  1F2Z A;  5EAY A;  4AYB B;  4Y52 H;  1NSN S;  4CKE A;  3TRE A;  2HIX A;  2EYJ A;  4A75 A;  4G7Z C;  4DAM A;  2XIW A;  4GKK L;  5C0X H;  3BZC A;  1SND A;  3BDC A;  1QIL A;  3S1M H;  3EVQ A;  1VQO A;  1T5E A;  4A3G G;  1STY A;  1IKL A;  4DR5 L;  3X3N A;  1FNV A;  2N78 A;  1D5M C;  3CD6 A;  3MEF A;  2IPK D;  3M4P A;  2ZJP A;  3HKZ B;  2A73 B;  4M1U B;  4DNR B;  3OSO A;  2RHS B;  3KLR A;  1CSP A;  1Y1W G;  1EY7 A;  3MTS A;  2QEJ C;  4HIM A;  4AQY Q;  2WFW A;  2K33 A;  4GLV B;  3E0J A;  3U58 A;  3NTK A;  1LAC A;  1E0B A;  3OPO A;  4CKB A;  1A3U A;  4A3M B;  3J7Z C;  3CXC A;  4C3J B;  4EVO A;  5IYD H;  1BBU A;  2N88 A;  2F0F A;  4H7B A;  1KAA A;  2DJF C;  1KNA A;  1G8Z D;  3SK4 A;  5CGK A;  2M2L A;  4JCV E;  1D1K A;  3HOU H;  2F3W A;  1SNP A;  3K0X A;  1XMO Q;  2I0Q A;  3HOW B;  3JAM c;  4BBS B;  4XT3 B;  5AJ3 Q;  3NPP A;  3HOY G;  1G2T A;  5FK9 C;  2KHJ A;  4DV6 Q;  4NB3 A;  2VUM G;  3E9I A;  2K05 A;  2ZTC A;  1MHW C;  2XRS D;  3BZK A;  1N36 L;  3LWU A;  3R3O A;  1H95 A;  4R8N A;  1PTO D;  4UAI A;  4HIO A;  3RLN A;  3NQT A;  5K36 G;  3ER0 A;  5E3F A;  1TWC H;  2FMC A;  2CFM A;  2J4X A;  4GN3 B;  2FJ2 A;  3PF5 A;  1CQV A;  1S5B D;  2N3S A;  4YHH L;  3H0G B;  4JYA L;  1K8A C;  1CK1 A;  4LFC L;  4F8M A;  1YNN D;  3K7U C;  4A3D H;  2RDF A;  4A3G B;  1QUQ B;  2D62 A;  4H13 C;  1HUM A;  2XGT A;  1BCP B;  2JSO A;  4RG1 A;  2B2W C;  2LY7 A;  1TWF B;  4H44 C;  4IQZ A;  4DV2 L;  1EWC A;  1Y1W B;  4CJ1 B;  1Q82 C;  3T1Y Q;  1V43 A;  4PZ7 A;  1YHB A;  1DYQ A;  2E76 C;  2PZW A;  1C4Q A;  3L2P A;  3CCU A;  5GAD C;  3A5U A;  3MC0 B;  2F0J A;  4LNQ A;  4J15 A;  1HQM C;  4KY5 A;  1S4Z A;  1J8I A;  2KCN A;  1WJJ A;  3K0Y A;  3A8I E;  1HNZ Q;  2F03 A;  1B9M A;  2BH2 A;  2BE5 D;  3TN2 A;  1A15 A;  1VQH A;  3CCS A;  2HT1 A;  2NVT B;  4KLK A;  4LF8 Q;  1M4V A;  5IP7 H;  2BDO A;  4NXM L;  1Q81 C;  4CGY B;  1V1Q A;  5CV8 A;  1K8O A;  3I3C A;  1K83 B;  1EIG A;  1PH5 A;  3HOY B;  1BOS A;  3TP6 A;  1NR4 A;  1MI2 A;  1HUN A;  2E2I B;  1W6K A;  4FYD A;  1FYC A;  2VUM B;  5CC4 A;  4EX5 A;  5CV7 A;  1WOC A;  3VYT A;  3VR4 A;  3EJI A;  1YHA A;  1EOV A;  4LJZ C;  3K81 C;  3GTL B;  4RFB A;  3K7A B;  4HJ5 A;  5JOB A;  1VMC A;  4LK1 C;  3PUV A;  5JJI A;  5LHY 1;  1HNW Q;  1VQB A;  3AMU A;  3Q6S A;  2CWA A;  2KBN A;  5JVG 3;  1LUZ A;  2E8G A;  5HGT A;  2X6L A;  2HDM A;  1A0I A;  1A3V A;  3OW2 A;  1TR5 A;  1QNU A;  2A6H C;  4POF A;  4JI7 Q;  3A0J A;  1SE4 A;  1ZKO A;  4R9W A;  3KLW A;  1VCI A;  1K3B C;  1Z47 A;  1BDO A;  3GTJ H;  3EQL C;  3GTO B;  3NSW A;  3RLF A;  5JPN C;  1Y1V H;  2G9D A;  4DXG A;  1X9N A;  1RCV D;  4A3C H;  2Q2I A;  4A3E H;  2K5D A;  4JBM A;  1GUS A;  1SFO B;  4HJ8 A;  1DOL A;  3QWN A;  3PIP A;  4LFA L;  4K5V A;  1B53 A;  1B2T A;  3M4O H;  2F0H A;  3S2D H;  2RVL A;  2ZM6 L;  1N33 Q;  1K73 C;  1HNX L;  1WTH A;  3CRK C;  2KEN A;  5IYC G;  1PH4 A;  2B63 H;  1I94 Q;  4UHV A;  1EY4 A;  3CME A;  2MNA A;  4DR3 L;  3I4L A;  1SLJ A;  2UXD L;  1UE5 A;  4FP5 D;  1JR0 D;  3OWF A;  2LSS A;  3PMF A;  3GTP B;  2B2V A;  1EFI D;  1SNC A;  4IFD G;  1KD1 C;  2DJG C;  5M5W B;  5GRO A;  1HR0 Q;  1SRO A;  1VQ7 A;  1O7I A;  3ERO A;  1WTP A;  4L63 B;  2ASB A;  1XPO A;  1LTR D;  2OT2 A;  4JI6 Q;  2VQF Q;  4OO1 G;  5D3I B;  4XIG S;  1CHQ D;  3W1B A;  1F9R A;  1HZA A;  2RCF A;  1QWY A;  4B9X A;  1ML0 D;  1LAB A;  3RZD B;  1MSG A;  4GNX C;  4XYQ A;  3BVM A;  2SNS A;  4IOC A;  1PH7 A;  3PUZ A;  2K1B A;  2MJ8 A;  1VMP A;  3BG3 A;  2EYL A;  3UDF A;  1JOR A;  1AP0 A;  3GD7 A;  2MFI A;  5CYU A;  2FHT A;  2IY5 B;  5JEA H;  4WJ4 A;  3GTK B;  1YNJ C;  4Z9C B;  5IWA Q;  3M85 A;  2MQH A;  2UUC Q;  5IIF A;  3RN2 A;  5IGF A;  3U4Z A;  1TY2 A;  4PMW A;  1Z6H A;  3W2D A;  3KF8 A;  3I72 A;  4K2K A;  3AEV A;  2PI2 A;  1EYA A;  1LYL A;  1X3E A;  3I4M B;  1S3O A;  3GDE A;  1GOZ A;  4BA1 I;  3E9H A;  2VB2 X;  4QQB X;  1HA6 A;  4IZ8 A;  2EDG A;  1XX8 A;  3K5L A;  5CR3 A;  1XWE A;  1D5X C;  4LF9 Q;  1QCB D;  3GQB A;  5D14 A;  4A3D G;  4BY7 H;  1VF7 A;  1ZYR C;  3K5N A;  4KN4 C;  4Q5V A;  1D2B A;  1LV9 A;  1AFP A;  2XNA C;  4KHV A;  3RLO A;  4LUZ A;  2XTI A;  1KLG D;  1G29 1;  5ELE A;  3QOJ A;  4LF6 Q;  2K28 A;  1NJI C;  1YJW A;  2Y0S G;  1DON A;  3NBI A;  2F0P A;  1QZH A;  3FPP A;  5FO8 B;  3CAM A;  3NEM A;  3TSS A;  5KIX A;  1L2F A;  2UUA L;  2A19 A;  1XMQ L;  1RF2 D;  5HGQ A;  3STB D;  2E2H B;  3J81 i;  3EA6 A;  4J8Q A;  2KED A;  4BA2 I;  4OGQ C;  2EJG C;  2VQE L;  4JG2 A;  3S9W A;  4A3M H;  1IBK L;  4C3J H;  4C3I B;  1WTX A;  2JA7 G;  1XMO L;  2D2C C;  5AJ3 L;  4UPA A;  1VQF A;  2EPB A;  5L37 A;  3HOW H;  2QGQ A;  4JBK A;  2MPM A;  1G2S A;  5BN5 A;  4BBS H;  5TSS A;  4LUV A;  2A69 C;  4I7Z C;  3M3Y B;  1U0L A;  4RGT A;  1WTV A;  3P1H A;  1GVP A;  1V1O A;  5LMU Q;  3LGJ A;  2A68 C;  3J7A V;  3QB3 A;  4L8J A;  4DK0 A;  4B3M Q;  1G51 A;  1TWA B;  2SDF A;  3OIQ A;  3EBE A;  2JEA I;  2VNU D;  1ICF B;  3D0F A;  3VYU A;  4JYA Q;  2KHS A;  2NB0 A;  2WAC A;  1SYC A;  3MHB A;  1FNW A;  2PQE A;  5FLX c;  1PH6 A;  2OTL A;  4UP9 A;  5FO7 B;  3BU2 A;  3RR5 A;  3TEH B;  4HID A;  4O1N A;  5J1Z A;  3H0G H;  4IUV A;  1QVG A;  4DV3 Q;  1Y1V G;  1FR3 A;  4A3G H;  1O80 A;  4HCE A;  3G6J B;  4FNF A;  2Y0S B;  4DV2 Q;  2D0P A;  4I7A A;  1NCV A;  1STA A;  5C4H A;  1SMY C;  4HSV A;  3T1Y L;  3RZO B;  3F2B A;  1EY9 A;  3FRP B;  1TWF H;  2ZXO A;  2RKS A;  1Y1W H;  1X56 A;  1GHK A;  1GXD C;  1S40 A;  2MHV A;  1JJG A;  4H0L C;  3GV6 A;  4IUU A;  1IW7 C;  2BCO A;  3W5O A;  2CQO A;  2F0Q A;  1EEI D;  3CRL C;  4KTA A;  2K5N A;  4ZKC B;  4NXM Q;  1A2U A;  2JA7 B;  4QUF A;  3EIV A;  1TS5 A;  1NTG A;  4DR1 L;  3OYY A;  1YZ6 A;  2NVT H;  1N9W A;  1YBY A;  2QIL A;  1A63 A;  3RMH A;  1K83 H;  4ALP A;  3HOY H;  1HZ9 A;  4IJL A;  1BQQ T;  2LXJ A;  3CCM A;  2R7F A;  1NMG A;  2K5V A;  4R4C A;  2VUM H;  4MN3 A;  4DNT B;  4JOI C;  2HHH L;  1LT3 D;  4NKL A;  1KC8 C;  3S14 B;  4EGV A;  1PMR A;  4KV6 A;  1B1Z A;  2YYZ A;  2L1B A;  1JE5 A;  1CKN A;  2CW0 D;  3U4V A;  5K36 H;  3GTL H;  3KJP A;  1I4R A;  2L5T A;  4JI1 L;  3J81 L;  1HNW L;  2EY1 A;  3HOZ G;  4KKT A;  4EQN A;  4C2M B;  1K9M C;  1I5F A;  4U67 3;  2KCC A;  2B39 A;  3VDY A;  3NK9 A;  4JI7 L;  2DNC A;  3MFG A;  1HH2 P;  5M9O A;  4GNX B;  3JAM E;  3ZJY C;  1X55 A;  3NP8 A;  1O7Z A;  3PO2 G;  3L0O A;  3J80 E;  1B9N A;  1PYB A;  4ZCK A;  5JVH 3;  1KRS A;  1T9H A;  2NZO A;  3Q22 A;  3ND9 A;  4GNX A;  3CMA A;  1KHI A;  2TSS A;  4LFA Q;  4OWT B;  3GTO H;  4KD4 A;  3S1N B;  2ZM6 Q;  1HQR D;  1STN A;  1HNX Q;  1G6P A;  1CQF A;  4FXD A;  4ZUI A;  3K6O A;  4AYB G;  4UY8 C;  4HCS A;  1NE3 A;  4P74 A;  1Z9F A;  4BY7 G;  4DR3 Q;  4TKO B;  1I94 L;  2J7Z A;  4EQO A;  2R3Z A;  3CPW A;  3PUX A;  4C1N I;  1EUJ A;  3D6W A;  1S72 A;  2D0O A;  1CI3 M;  3CCJ A;  1WVL A;  1IL8 A;  1BR9 A;  4DXF A;  3I4N G;  2OWO A;  3GTP H;  4DU9 A;  2BOS A;  4HN7 A;  3SHL A;  5CV4 A;  5M5W H;  1CHP D;  2RHQ B;  2UXC Q;  1EL0 A;  1NY4 A;  4ID6 A;  2QA4 A;  3Q8D A;  1PFM A;  3PGZ A;  2M00 A;  5IGC A;  4GKJ L;  1IZ6 A;  1PZK D;  2B29 A;  3NXW A;  4LWC A;  2CKZ B;  3HOZ B;  1DOK A;  3K5O A;  4A3M G;  3RZD H;  4R4I A;  3ONA B;  1DCZ A;  2UXB L;  4C3J G;  3V2T A;  4RHS A;  1JIC A;  3U9O A;  4BBR G;  4PMB A;  3W3A A;  1H9R A;  3RD4 A;  3C1F A;  3PO2 B;  4APV A;  1CTM A;  3WWV A;  1BCP D;  2YTY A;  4TRD A;  2I46 A;  3HOW G;  3A8J E;  2WKD A;  2NWG A;  1OXX K;  5T1I A;  2UUC L;  4DV7 L;  3JC6 6;  4OON A;  3GTK H;  3FPU B;  2KEE A;  4YWL A;  3QIA A;  2JEB I;  1XYI A;  4A3K G;  2JQO A;  3S1Q B;  3Q0A A;  1JJ2 A;  1FNU A;  1PTO C;  2CQA A;  3DUZ A;  1CA5 A;  2QF7 A;  4CDE C;  1UE7 A;  4BY7 B;  2JJQ A;  1PZJ D;  1Q1E A;  1PFS A;  4CDD C;  1L0Y B;  4Y7N B;  3I4M H;  3G48 A;  3H91 A;  3OMC A;  4A3I B;  4OHJ A;  4OL7 A;  4LF9 L;  5IYC H;  3CP0 A;  1LTI D;  1DD2 A;  2JXM B;  1YNN C;  1VQD A;  1NBW A;  3OOC A;  3H0G G;  5IOC A;  3I55 A;  4YCV A;  3I4N B;  1ZEQ X;  4FDB A;  3VR3 A;  3NHH A;  3PF4 A;  2GVA A;  4IFD H;  4JPB W;  1BKB A;  1UEA B;  3C1E A;  2K6A A;  5C4J B;  3TZD A;  3M4Y A;  1GD7 A;  1NUC A;  2ZTD A;  4PNY A;  1N34 Q;  1UNS A;  4LF6 L;  4OO1 H;  1HA5 A;  1GUT A;  1EY0 A;  3A8K E;  2L12 A;  1H9M A;  1P16 A;  3KJO A;  2R6G A;  2K75 A;  2UUA Q;  3IKJ A;  1XMQ Q;  3C46 A;  3OIP A;  1AZP A;  4IN3 A;  2BE5 C;  2VQE Q;  4BBR B;  4L5Q A;  1IBK Q;  1CUK A;  1SJH D;  2E2H H;  1G6Z A;  5IGB A;  1JCK B;  4IPC A;  1PYW D;  2QKI C;  2LMC B;  2Z4H A;  1PFB A;  4NXN L;  4DKA C;  1VQ4 A;  5F2D A;  2JA8 G;  1TU2 B;  2R7D A;  3T51 B;  3TP8 A;  3LX0 A;  1RKN A;  3ND8 A;  4GOP C;  3L9A X;  1VF5 C;  1U9R A;  4C3I H;  4A3K B;  2MP1 A;  4JW0 A;  1GHJ A;  2K5H A;  1Q12 A;  1PV4 A;  4HED A;  3J7A F;  4IUR A;  3PUY A;  3SR1 A;  1GKH A;  4DV1 L;  1TQO A;  5LMU L;  2F3V A;  5C4X G;  4B3M L;  5G3L D;  4JI2 L;  3M3Y H;  1SN8 A;  4PZ8 A;  2F3I A;  1JOO A;  4B3S L;  1Q8K A;  2A5H A;  3HRZ C;  1FJG Q;  1TWA H;  5EJW A;  3IFD A;  3V96 A;  3R8B A;  4OWX B;  4RMF A;  2NN6 I;  4DUZ Q;  1PH9 A;  1KDB A;  1X6O A;  4DV3 L;  2I5L X;  4JOI A;  1TS3 A;  1ASY A;  2YTX A;  4HAE A;  4DV4 Q;  2F1M A;  4A4I A;  3K57 A;  1LT4 D;  2OCE A;  4A76 A;  3NQI A;  5GAE C;  1F9Q A;  1RD9 D;  3R2T A;  2NUC A;  4RKB A;  3IRB A;  5IGG A;  2DN8 A;  3ICE A;  4JBJ A;  3RZO H;  1KL9 A;  1HR0 W;  1XXG A;  5LMN Q;  4BY1 B;  1FL0 A;  1GUO A;  2ID0 A;  3P7J A;  4JI5 L;  3A74 A;  5CV9 A;  3G7L A;  4HTH A;  4DR1 Q;  3QR8 A;  4FVM A;  2JA8 B;  1DOM A;  3SK6 A;  3PIO 3;  2VZA A;  2UU9 Q;  2Z6K A;  2XN9 C;  2F0W A;  2RA4 A;  2JA9 A;  1CKO A;  4HJ7 A;  2JA7 H;  1H9S A;  2HQL A;  4MTN A;  1JB3 A;  4DGZ A;  2A6E D;  1LTS D;  1ILP A;  4M8A A;  3M9B A;  2EXD A;  4G4K A;  3MAQ A;  4MNO A;  2KUM A;  5AFW A;  2HHH Q;  3ULP A;  4QMG A;  2R7Z G;  5C4X B;  4KHP L;  1IYU A;  1IXR A;  1VQM A;  1VQK A;  1EY8 A;  4YCW A;  5M5X H;  1R4Q B;  3FMC A;  2VS1 A;  1EFW A;  2ES2 A;  4JI1 Q;  2HD3 A;  3S14 H;  3PCO B;  2N8N A;  1CZW A;  1V9P A;  3A7L A;  3H3V H;  5C44 G;  1HFG A;  2ICI A;  2QDB A;  1DXM A;  1C7Y A;  2YU9 B;  2B2U C;  1DZ1 A;  4ABN A;  4C2M H;  1W6J A;  1MJC A;  1I4H A;  3S24 A;  1RTN A;  4O0A A;  2L4N A;  2Q8T A;  4N8X 1;  2AMC B;  5I9O A;  3OTO L;  2AUJ D;  1GO3 E;  2EJM A;  3RNU A;  2BA1 A;  4YCU A;  5DM7 3;  4R4Q A;  1SE8 A;  5IOD A;  3SK5 A;  4DAV A;  3VR6 A;  1VQJ A;  3I4M G;  1PRT F;  3GTQ B;  1JJC B;  4TSS A;  2KEC A;  1TS2 A;  2PI2 E;  4ULL A;  5HY6 A;  5C5M A;  3SEB A;  4CJ0 B;  3G71 A;  2KCT A;  3S1N H;  1WTQ A;  1YVC A;  2B2T A;  1WTR A;  1X3F A;  2KJX A;  4O2D A;  4CHT B;  2JA5 G;  2Q8R E;  1FGU A;  3N52 A;  2JA6 G;  1HPC A;  1TWG B;  5EGT A;  4C3H G;  1KAB A;  3S1R B;  1EQR A;  4B3R L;  2K5Q A;  3F2D A;  5LL6 S;  3GTM B;  3WOF A;  1QJO A;  2R7Z B;  1LT6 D;  1WI5 A;  1STB A;  4A3L H;  2UXC L;  4QL5 A;  1EIF A;  3HOX G;  3J81 j;  4GKJ Q;  3BYT B;  2F0G A;  1L1O A;  3D6C A;  5C6A A;  2RSO A;  2OF1 A;  2F0U A;  4A3F G;  4XDX A;  1OXS C;  5EKK A;  3STB C;  3M4Q A;  4DUY L;  2IHE A;  4RGO S;  1PH2 A;  1D6E C;  3SXH A;  5FJ8 H;  2UXB Q;  5C44 B;  5HUR A;  1JMC A;  2ZXR A;  3UDX A;  4R4T A;  3HOZ H;  3I8Z A;  1VQ8 A;  1WTW A;  1PXU A;  3KF8 B;  4UP7 A;  2E2J B;  4HR7 B;  4QB4 A;  4ZYS A;  4C3I G;  2FFK B;  4X3S A;  3DMU A;  4DV7 Q;  5KNC A;  1XPU A;  3I2Z A;  5ELF A;  3OMG A;  3SGI A;  3RUZ A;  1MIU A;  3PO2 H;  5BN4 A;  3I56 A;  4NPS A;  3A7A B;  5FLX L;  1Y8O B;  3SVM A;  5C0X I;  2PPB C;  2L55 A;  1Q8I A;  2X69 A;  2TMP A;  1EIH A;  3S1Q H;  1N32 L;  1I50 B;  3VR2 A;  2K01 A;  1PH1 A;  1F9P A;  1YEZ A;  1O78 A;  2OQ0 A;  4JI8 Q;  1IBM L;  2JA5 B;  3Q23 A;  4FF3 A;  4K6D A;  1VQA A;  2JA6 B;  5KRU A;  4NW2 A;  5ELO A;  4Y7N H;  4DN4 M;  4GOP A;  4A3B B;  4A3I H;  4KKU A;  3DXJ C;  4NDX A;  5JPM C;  2XSC A;  1I4G A;  4C3H B;  2KVM A;  1PTO F;  1JOK A;  2PO4 A;  3I7F A;  5IY0 A;  4DNI A;  2RSN A;  1TKW B;  1YJ9 A;  2H4O A;  3MZ5 A;  4Q0F A;  2IX3 A;  1X3Q A;  2UUB Q;  4MZ9 A;  3I4N H;  2E74 C;  1N34 L;  3FP9 A;  3HOX B;  3LNN A;  5BN3 A;  5JJL A;  1H9J A;  4K14 A;  5C4J H;  2RBM A;  1O7Y A;  2XRQ D;  5H1S E;  4A3F B;  1I6H B;  2KA7 A;  3LWE A;  1SNO A;  3PSI A;  1HZC A;  3ITP A;  2Q2T A;  2B8F A;  2Z4I A;  2I5M X;  3RN5 A;  1TT2 A;  3HGB A;  3S17 B;  2LS0 1;  4PQX A;  2RDH A;  3X3M A;  3U9S A;  5J39 A;  2EYO A;  5EBC A;  3R2I A;  4NXN Q;  4E6I A;  3BVZ A;  2ENB A;  4BBR H;  1R9T B;  5I2Y A;  4N9P A;  1CT1 D;  3F2C A;  4ZRZ A;  1SYB A;  1SYF A;  4NMZ A;  2L11 A;  3PIO A;  4P72 A;  3VA5 A;  1Y69 U;  3PO3 G;  1MJE A;  2NVX B;  5DEH A;  1XNR Q;  4H02 A;  4DV1 Q;  3S2H B;  4A3K H;  2EXZ A;  4JI2 Q;  2C9O A;  2CW0 C;  3D4W A;  3KF6 A;  1IHZ A;  4DR4 L;  4JI0 L;  1PFN A;  1YHQ A;  4B3S Q;  4UDU C;  3QOL A;  3A54 A;  2F0I A;  3PV0 A;  4DAY A;  4JK1 C;  1DJR D;  1VQG A;  2LXK A;  3KLS A;  1FJG L;  4XYO A;  3D31 A;  4WFN 3;  3K5M A;  5A2Q L;  5T1G A;  2Z8L A;  3CKI B;  2VL6 A;  4XTC S;  4DUZ L;  4CJ2 C;  2F0S A;  1VQC A;  5I9P A;  1RIP A;  1K3R A;  2EY5 A;  4F7X A;  1C48 A;  3KK7 A;  3J81 E;  4DV4 L;  1X32 A;  3UDI A;  1K8G A;  1G91 A;  2IHF A;  4CDC C;  3MXP A;  1K8M A;  2YTV A;  1T5X D;  4B9W A;  2PW5 A;  5LMN L;  2ZJQ A;  1X65 A;  2F4V Q;  4K8I A;  4JI5 Q;  1M8A A;  3TP5 A;  2B2U A;  1DM0 B;  3TZU A;  4BY1 H;  4FXK C;  4XT1 B;  2IWH A;  3SK8 A;  5CMD A;  3DEP A;  4IPG A;  2P5Z X;  2UU9 L;  2F0K A;  4JI3 L;  1ZXT A;  2B8G A;  1WCM G;  2V1C C;  4IUP A;  1WD0 A;  2JA8 H;  3P75 A;  5NUC A;  1IBL Q;  3DM1 A;  1ENF A;  3PO3 B;  4A3L G;  3BDL A;  1SYG A;  2B3G A;  5M5X B;  3AQQ A;  4RGM A;  1QB5 D;  4KHP Q;  1CKN B;  1VDZ A;  5C3X A;  2F0N A;  5KGU A;  2DUD A;  3HKS A;  4C56 C;  4LF7 L;  2Z0S A;  3KDF A;  2WP8 J;  4XQJ A;  3NUC A;  5FJ8 G;  1V1P A;  4ZK9 B;  5C4X H;  4O42 A;  4ZAI A;  5IP9 G;  1XNQ L;  2SEB D;  3NWT A;  3NWS A;  5ELD A;  2L9H A;  1S5D D;  4N9T A;  5KYI A;  2X6G A;  2F0V A;  1CA6 A;  1V8Q A;  1PRT C;  2LFN A;  1IL2 A;  2A68 D;  2NTS A;  2NZH A;  4RHR A;  4A3J G;  2I07 B;  3OTO Q;  4CDF C;  1U4L A;  3DWQ A;  1WYD A;  3K80 C;  3H09 A;  2YU9 H;  2Z6K C;  1I3Q B;  5C3W A;  1Y14 B;  1QG7 A;  1MSH A;  1F9S A;  1EU4 A;  4LAA A;  3CW2 C;  1A3T A;  5C0X J;  3ERS X;  1J6Q A;  2O5I C;  1LT5 D;  3TDQ A;  5FO9 B;  4X65 L;  1KAW A;  5CBE E;  1D8L A;  5EQ0 A;  2Z1C A;  3GTQ H;  4A3I G;  5ELC A;  4ZKB B;  1SNQ A;  2EYH A;  4LF4 L;  1RJT A;  1VQL A;  5ELB A;  3BYY B;  1ET9 A;  1WCM B;  1BBX C;  3OHX C;  4B3R Q;  4ME3 A;  3KOJ A;  2RQX A;  1IW7 D;  2EOT A;  1TWG H;  3AU7 A;  1TII D;  3CU7 A;  3AB9 A;  1VQP A;  3S1R H;  1I4P A;  3KUP A;  2R93 G;  1ILQ A;  1JB7 A;  4GLA C;  1EYG A;  3DHQ A;  2H5X A;  4ZUJ A;  4TVA B;  3GTM H;  2EVB A;  5KEE A;  3J7A 5;  2R7Z H;  4DAP A;  1P8L A;  3S15 B;  2EY6 A;  2AQ2 B;  2CHB D;  4DUY Q;  1U5K A;  1VQN A;  2WKC A;  3D3R A;  3NBH A;  2LKV A;  3TRZ A;  1BUV T;  2NVQ B;  2WB1 G;  2RDG A;  4YY3 Q;  1CSQ A;  4N8F A;  5IGE A;  2R92 G;  2K03 A;  2F4I A;  4JI4 Q;  2NYZ D;  1B3A A;  4A3J B;  2K5W A;  5C44 H;  2AWO A;  3UI2 A;  2B2T C;  3KBG A;  3C2P A;  1E2W A;  1F2Y A;  2CWP A;  2C5C A;  1EQV A;  4P73 A;  2WB1 E;  3OW7 A;  4QIW E;  2E2J H;  1Z7T A;  4FXG C;  2N49 A;  2PQA A;  1KLU D;  4L5T A;  2XVS A;  4FF4 A;  4XQQ A;  3VR5 A;  4MHE A;  1FVI A;  1N32 Q;  1E22 A;  1EQT A;  2CCZ A;  1L0X B;  1E24 A;  5K5P A;  1XJV A;  1IBM Q;  2G5D A;  1L1O C;  3TME A;  4S3S A;  1K0R A;  4JI8 L;  3QG1 A;  4IOA A;  3HOV G;  3MXG A;  1MGS A;  1I50 H;  4DV0 L;  1OTC A;  5C3E G;  1F2L A;  3E3X A;  2JA5 H;  1EIY B;  2PW7 A;  5D65 A;  1S5F D;  2JA6 H;  4A3B H;  4U68 A;  5LMN W;  2E75 C;  1AN8 A;  2F0O A;  2K14 A;  3WDN A;  1WFQ A;  4C3H H;  2R93 B;  2UUB L;  5EKI A;  3T56 B;  4IO9 A;  1EZ8 A;  1PDQ A;  5IT9 L;  5EBD A;  1W3S A;  4K8J A;  3DWA A;  3GV3 A;  5M3F B;  4EQ5 A;  4JV5 Q;  2OXP A;  4PV1 C;  1MKH A;  3SDZ A;  4B3T L;  3HOX H;  1EY5 A;  4QF4 A;  4HMJ A;  4LFB L;  4OWW B;  1PLF A;  4K0K Q;  2WB1 B;  3TBI B;  4A3F H;  1I6H H;  1ROD A;  2NN6 G;  1JC7 A;  1SRU A;  4QIW B;  4BY1 G;  4G7H C;  4IPH A;  2R92 B;  5I2X A;  4BS9 A;  2AKW B;  4OXP A;  3HFZ B;  1NMF A;  3S17 H;  3I4O A;  1QNK A;  1UE1 A;  2DY8 A;  1DGS A;  1SJE D;  3CCL A;  1KQS A;  2EQS A;  2IX1 A;  1IYV A;  4OX9 L;  2DNE A;  2A6E C;  3TQY A;  2EJF C;  1R9T H;  1OO9 B;  3TP7 A;  1I6V C;  4BXX G;  1VQ5 A;  5JJK A;  3IL8 A;  2N55 A;  4MIU A;  3K8A A;  1XNR L;  4HJA A;  2IX0 A;  4WJ3 M;  4DR4 Q;  2NVX H;  4JI0 Q;  4ILW A;  5ISR A;  3J80 c;  3S2H H;  3HOV B;  2IJ0 A;  4RA8 A;  3L3O C;  4DPG A;  1STE A;  5C3E B;  5KNB A;  1PH8 A;  3A55 A;  1HTP A;  1HFN A;  4QGU A;  1Y8N B;  5GAH C;  4X66 Q;  5A35 A;  2NTT A;  2K4K A;  1STH A;  1QVF A;  2YV5 A;  5IYB G;  3UE1 A;  3H15 A;  4F88 A;  2Q2U A;  3K58 A;  1S5C D;  2EZV A;  1LTG D;  4IJH A;  1KTK A;  3IFT A;  1JOQ A;  1PRT B;  4A93 G;  2ALY B;  1SEB D;  4DK6 C;  4GN4 B;  2IT1 A;  2A8V A;  2HQE A;  4K2L A;  1W2B A;  1JT8 A;  4GLX A;  4P2C B;  5EPL A;  5GAG C;  4DR2 Q;  3FKI G;  3FVQ A;  3BS1 A;  1QUQ A;  1ENC A;  3F2U A;  4KKS A;  5M3M G;  4KJO A;  1QZG A;  2F4V L;  4IUN A;  2R61 A;  3I73 A;  4RWS C;  4B08 A;  1KRT A;  1MD2 D;  5IT9 c;  5E4W C;  5BR8 Q;  1KDA A;  3T16 A;  1H9S B;  1Q1B A;  4JI3 Q;  1TY0 A;  1QVC A;  5IGD A;  3EN2 A;  3NTI A;  1SYE A;  1KIX A;  1LLR D;  1AH9 A;  4KMU C;  2V4D A;  1IBL L;  1JQY D; 
#chains in the Genus database with same CATH homology
 2Q8I B;  2MGS A;  4RH6 A;  1ENA A;  2AQ1 B;  2NVY B;  2DY7 A;  1I4X A;  4FF2 A;  1TWH B;  2VB3 X;  3HZX A;  5JEA J;  2BDN A;  1LO5 D;  4QUC A;  3S16 B;  1OXU A;  5CV6 A;  1HCZ A;  1ESF A;  3CHB D;  3MXU A;  3GO5 A;  2GA4 B;  4RCO A;  2IW3 A;  5KYL A;  2L0C A;  1STG A;  3GTG B;  2KQ3 A;  5COY A;  2FIN B;  4X3U A;  1SSO A;  4A93 B;  1SE3 A;  4GZY C;  3FKI B;  3K59 A;  5M3M B;  1BCP F;  3CQZ B;  1D5Z C;  5JJZ A;  1H9K A;  1ICW A;  3J7Y W;  1PTO B;  5FLX E;  1E2V A;  3KBX A;  2EE1 A;  1A2T A;  2XWB B;  2PZT A;  3IAY A;  2D5D A;  1MBY A;  4DF7 A;  5C0X G;  2M9V A;  3I90 A;  3N6R A;  3DWP A;  1GUG A;  2G9H D;  3NTH A;  2B2Y C;  3C3L A;  5CV5 A;  1KDC A;  5I4D A;  1JE4 A;  5M5Y B;  3H3V C;  1CZG A;  1BF4 A;  5EKL A;  4WOR A;  5DAU A;  4KY6 A;  1QOH A;  1OXV A;  2PNR C;  3MA2 B;  2O2L D;  1Y8P B;  4KN7 C;  4EQP A;  2WIN B;  3DEO A;  2CVR A;  4FF1 A;  1EYD A;  3KLS X;  4LMQ D;  3D8G A;  4DA2 A;  1AW7 A;  1RHP A;  2A6H D;  4FO2 A;  2SOB A;  5E1F A;  3MVV A;  4ZLT F;  2EYP A;  4ZQ3 A;  4J1M A;  1CM9 A;  1QE6 A;  2HUG A;  3M7N A;  2ZXP A;  4IFD I;  3H94 A;  4OO1 I;  2F0T A;  2WII B;  4NP5 A;  2JP1 A;  2AWN A;  1EU3 A;  2PYK A;  4R8I A;  2HDL A;  5G3L F;  3T53 B;  1U4P A;  3S1M B;  2QCP X;  1WD1 A;  4YIJ A;  1SYD A;  1LTA D;  3D4D A;  5FKA C;  1EWH A;  5C4Z A;  5A2Q E;  3A56 A;  2WV6 D;  1PZI D;  1NAP A;  3SE0 A;  1BNZ A;  1BO0 A;  1SNM A;  4K5W A;  1OXT A;  1UUP A;  2NBF A;  2A74 C;  1LTT D;  3Q24 A;  2PCF B;  3PUW A;  3FEW X;  3ZYY X;  5DNF A;  2JE6 I;  5EPJ A;  1JWS D;  2ZT9 C;  1U4R A;  1WTO A;  2H1E A;  4JBW A;  3HOU B;  1Q90 A;  1ONL A;  1F77 A;  4WJW A;  4I65 A;  3FDT A;  3VA7 A;  3URY A;  4C1N K;  2B2W A;  4J6H A;  4G57 A;  1B50 A;  1SDF A;  1YNJ D;  1I4Q A;  1S5E D;  4K5X A;  4WRD A;  4IUT A;  1TWC B;  1SE2 A;  3M7G A;  3WOE A;  4V19 0;  3NE5 B;  1SXT A;  1II3 A;  4K6L A;  4BWG B;  1GJX A;  1F2M A;  4KK7 A;  2HCC A;  3BVG A;  3T4A C;  4A3D B;  4QCL A;  1CFM A;  3I91 A;  1J9O A;  5I6Y A;  2F0L A;  2AQ3 B;  4KHZ A;  2JYO A;  1ZYR D;  5D3D A;  2PZU A;  1D1I A;  4ME5 A;  1GUN A;  2D9U A;  4KI0 A;  3T13 A;  1LTB D;  1JWU D;  3BDO A;  4OIK A;  1B4O A;  1RTO A;  1NR2 A;  3R93 A;  4RKL A;  5J22 A;  1AEX A;  5E4X A;  1EY6 A;  1AZQ A;  4KY7 A;  2NN6 H;  4DK1 A;  3QJY A;  1X3P A;  3QO2 A;  4RGN A;  1XTC D;  2PMZ B;  2EYF A;  2BA0 A;  2KOL A;  1UAP A;  1ESR A;  3HP3 A;  1HXY D;  4L6T B;  3HS0 C;  4G7O C;  4HMI A;  3I70 A;  1EOT A;  1V1P B;  2VXW A;  2NZ1 D;  2FMM A;  2EY2 A;  1KNE A;  5C5L A;  3HEJ A;  2MUY A;  2F0D A;  4DFA A;  3MEH A;  2A69 D;  2IL8 A;  1FD7 D;  4V0B A;  3VYR A;  4X3K A;  3E5S A;  2B2Y A;  1BXT A;  1BCP C;  3HG9 A;  1JWM D;  3EFX D;  1TS4 A;  3MWY W;  4PMC A;  4XQN A;  4F87 A;  4X3T A;  4XXE A;  2E2D C;  5JAV A;  5JEA G;  3V05 A;  3GTJ B;  2OEO A;  2HCI A;  5KND A;  1Y1V B;  1B44 D;  4HSP A;  3H6M A;  4A3E B;  4OIJ A;  1SBB B;  1O7L A;  1R4P B;  1TVX A;  2O4X A;  3M4O B;  3S2D B;  1SMY D;  4ODG A;  4IFD J;  2XWJ B;  2B63 B;  1GUW A;  2K7V A;  3MXN A;  5LL6 X;  1HTL D;  5CBA E;  2AUK A;  2WAQ B;  1EEF D;  4KJN A;  1PTO H;  2EYM A;  4RCN A;  4RAU C;  3GP7 A;  2O5J C;  4CBV A;  5EPK A;  1ET6 A;  3E6Z X;  5FOB B;  4CKC A;  2SNM A;  1HRJ A;  1U4M A;  2F0M A;  5I6W A;  1C8C A;  1EYC A;  2F0E A;  3MFY A;  5IT9 E;  3JAM L;  4TQU S;  2K04 A;  3J80 L;  1SAP A;  1Q3L A;  1EZ6 A;  3O13 A;  4IAL A;  2K32 A;  4KD3 A;  5DM6 3;  3D4R A;  3L7Z C;  3P20 A;  1PRT D;  3OWE B;  2ICE C;  1A6X A;  1E2Z A;  1HHV A;  3BZD B;  3ERQ A;  4IUQ A;  3PIP 3;  2B2V C;  1IKM A;  5COR A;  1FGB D;  2J0T D;  3VYS A;  1RDP D;  1F2Z A;  4AYB B;  1NSN S;  4CKE A;  2EYJ A;  4G7Z C;  2XIW A;  5C0X H;  1SND A;  3BDC A;  1QIL A;  3EVQ A;  1T5E A;  1STY A;  1IKL A;  3X3N A;  1FNV A;  1D5M C;  2IPK D;  3HKZ B;  2A73 B;  4M1U B;  4DNR B;  3OSO A;  3KLR A;  1EY7 A;  3MTS A;  2QEJ C;  2K33 A;  3E0J A;  3NTK A;  1LAC A;  1E0B A;  3OPO A;  4CKB A;  1A3U A;  4A3M B;  4C3J B;  4EVO A;  2N88 A;  2F0F A;  4H7B A;  1KAA A;  1KNA A;  1G8Z D;  3SK4 A;  5CGK A;  2M2L A;  1D1K A;  2F3W A;  1SNP A;  3HOW B;  4BBS B;  4XT3 B;  3NPP A;  1G2T A;  5FK9 C;  2K05 A;  2XRS D;  3LWU A;  3R3O A;  4R8N A;  1PTO D;  4UAI A;  3NQT A;  5K36 G;  5E3F A;  2FMC A;  2J4X A;  2FJ2 A;  1CQV A;  1S5B D;  3H0G B;  1CK1 A;  4F8M A;  1YNN D;  2RDF A;  4A3G B;  2D62 A;  4H13 C;  1HUM A;  1BCP B;  2JSO A;  2B2W C;  2LY7 A;  1TWF B;  4H44 C;  4IQZ A;  1EWC A;  1Y1W B;  4CJ1 B;  1V43 A;  1DYQ A;  2E76 C;  2PZW A;  1C4Q A;  3MC0 B;  2F0J A;  1HQM C;  4KY5 A;  1S4Z A;  1J8I A;  2KCN A;  3K0Y A;  2F03 A;  3A8I E;  1B9M A;  2BE5 D;  3TN2 A;  1A15 A;  2NVT B;  1M4V A;  2BDO A;  4CGY B;  5CV8 A;  1K8O A;  3I3C A;  1K83 B;  1EIG A;  3HOY B;  1BOS A;  3TP6 A;  1NR4 A;  1MI2 A;  1HUN A;  2E2I B;  1W6K A;  4FYD A;  1FYC A;  2VUM B;  5CC4 A;  5CV7 A;  3VYT A;  3VR4 A;  3EJI A;  4LJZ C;  3GTL B;  4RFB A;  3K7A B;  5JOB A;  1VMC A;  4LK1 C;  3PUV A;  5LHY 1;  3AMU A;  3Q6S A;  5JVG 3;  5HGT A;  2X6L A;  2HDM A;  1A3V A;  1TR5 A;  1QNU A;  2A6H C;  1SE4 A;  1ZKO A;  4R9W A;  1VCI A;  1Z47 A;  1BDO A;  3EQL C;  3GTO B;  3NSW A;  3RLF A;  5JPN C;  2G9D A;  4DXG A;  1RCV D;  2K5D A;  1GUS A;  1SFO B;  1DOL A;  3QWN A;  4K5V A;  1B53 A;  1B2T A;  2F0H A;  2RVL A;  3CRK C;  1EY4 A;  3I4L A;  4FP5 D;  1JR0 D;  3OWF A;  3PMF A;  3GTP B;  2B2V A;  1EFI D;  1SNC A;  4IFD G;  5M5W B;  3ERO A;  1WTP A;  4L63 B;  1LTR D;  2OT2 A;  4OO1 G;  5D3I B;  4XIG S;  1CHQ D;  1F9R A;  1QWY A;  4B9X A;  1ML0 D;  1LAB A;  3RZD B;  1MSG A;  4XYQ A;  3BVM A;  2SNS A;  3PUZ A;  2K1B A;  2MJ8 A;  1VMP A;  3BG3 A;  2EYL A;  1JOR A;  1AP0 A;  3GD7 A;  5CYU A;  2FHT A;  5JEA H;  3GTK B;  1YNJ C;  4Z9C B;  3M85 A;  5IIF A;  5IGF A;  1TY2 A;  4PMW A;  1Z6H A;  3W2D A;  3KF8 A;  3I72 A;  4K2K A;  1EYA A;  3I4M B;  1GOZ A;  4BA1 I;  2VB2 X;  1HA6 A;  4IZ8 A;  2EDG A;  1XX8 A;  3K5L A;  5CR3 A;  1XWE A;  1D5X C;  1QCB D;  3GQB A;  5D14 A;  1VF7 A;  1ZYR C;  3K5N A;  4KN4 C;  4Q5V A;  1D2B A;  1LV9 A;  1AFP A;  2XNA C;  4KHV A;  1KLG D;  1G29 1;  5ELE A;  3QOJ A;  2K28 A;  1DON A;  3NBI A;  2F0P A;  3FPP A;  5FO8 B;  3TSS A;  5KIX A;  1RF2 D;  2E2H B;  3EA6 A;  4J8Q A;  2KED A;  4BA2 I;  4OGQ C;  2EJG C;  3S9W A;  4C3I B;  1WTX A;  2D2C C;  2EPB A;  2MPM A;  1G2S A;  5BN5 A;  5TSS A;  2A69 C;  4I7Z C;  3M3Y B;  4RGT A;  1WTV A;  3P1H A;  1V1O A;  3J7A V;  2A68 C;  3QB3 A;  4L8J A;  4DK0 A;  1TWA B;  2SDF A;  3OIQ A;  2JEA I;  2VNU D;  3VYU A;  2KHS A;  2NB0 A;  2WAC A;  1SYC A;  3MHB A;  1FNW A;  2PQE A;  5FO7 B;  4O1N A;  5J1Z A;  4IUV A;  1FR3 A;  1O80 A;  4HCE A;  3G6J B;  4FNF A;  2Y0S B;  1NCV A;  1STA A;  5C4H A;  1SMY C;  4HSV A;  3RZO B;  1EY9 A;  3FRP B;  2ZXO A;  2RKS A;  1GHK A;  1GXD C;  2MHV A;  4H0L C;  3GV6 A;  4IUU A;  1IW7 C;  2BCO A;  2F0Q A;  1EEI D;  3CRL C;  4KTA A;  4ZKC B;  1A2U A;  2JA7 B;  4QUF A;  1TS5 A;  2QIL A;  3RMH A;  1BQQ T;  4MN3 A;  4DNT B;  1LT3 D;  4NKL A;  3S14 B;  4EGV A;  1PMR A;  4KV6 A;  1B1Z A;  2YYZ A;  2L1B A;  2CW0 D;  5K36 H;  1I4R A;  2L5T A;  3J81 L;  2EY1 A;  4KKT A;  4EQN A;  4C2M B;  4U67 3;  2KCC A;  2B39 A;  3NK9 A;  2DNC A;  3MFG A;  5M9O A;  3JAM E;  3NP8 A;  1O7Z A;  3J80 E;  1B9N A;  5JVH 3;  3Q22 A;  3ND9 A;  2TSS A;  4KD4 A;  3S1N B;  1HQR D;  1STN A;  1CQF A;  4FXD A;  4ZUI A;  3K6O A;  4HCS A;  4TKO B;  2J7Z A;  4EQO A;  2R3Z A;  3PUX A;  4C1N I;  3D6W A;  1CI3 M;  1WVL A;  1IL8 A;  1BR9 A;  4DXF A;  4DU9 A;  2BOS A;  4HN7 A;  3SHL A;  5CV4 A;  1CHP D;  1EL0 A;  4ID6 A;  1PFM A;  2M00 A;  5IGC A;  1PZK D;  3NXW A;  3HOZ B;  1DOK A;  3K5O A;  3ONA B;  1DCZ A;  4C3J G;  3V2T A;  4RHS A;  1JIC A;  3U9O A;  4PMB A;  3W3A A;  1H9R A;  3RD4 A;  3C1F A;  3PO2 B;  1CTM A;  1BCP D;  4TRD A;  2I46 A;  3A8J E;  2WKD A;  2NWG A;  1OXX K;  5T1I A;  3FPU B;  2KEE A;  3QIA A;  2JEB I;  1XYI A;  3S1Q B;  3Q0A A;  1FNU A;  1PTO C;  2CQA A;  3DUZ A;  1CA5 A;  2QF7 A;  4BY7 B;  1PZJ D;  1Q1E A;  4Y7N B;  1L0Y B;  3H91 A;  3OMC A;  4A3I B;  4OHJ A;  4OL7 A;  1LTI D;  1DD2 A;  2JXM B;  1YNN C;  3OOC A;  5IOC A;  3I4N B;  1ZEQ X;  3VR3 A;  3NHH A;  4IFD H;  1UEA B;  3C1E A;  2K6A A;  5C4J B;  3TZD A;  3M4Y A;  1NUC A;  4PNY A;  1UNS A;  4OO1 H;  1HA5 A;  1GUT A;  1EY0 A;  3A8K E;  2L12 A;  1H9M A;  2R6G A;  3IKJ A;  3C46 A;  3OIP A;  1AZP A;  4IN3 A;  2BE5 C;  4BBR B;  1SJH D;  1G6Z A;  5IGB A;  1JCK B;  1PYW D;  2QKI C;  2LMC B;  2Z4H A;  1PFB A;  5F2D A;  1TU2 B;  3T51 B;  3TP8 A;  3LX0 A;  1RKN A;  3ND8 A;  3L9A X;  1VF5 C;  1U9R A;  4A3K B;  2MP1 A;  1GHJ A;  1Q12 A;  4HED A;  3J7A F;  4IUR A;  3PUY A;  3SR1 A;  1TQO A;  2F3V A;  5G3L D;  1JOO A;  2A5H A;  3HRZ C;  5EJW A;  3IFD A;  3V96 A;  3R8B A;  2NN6 I;  1KDB A;  1TS3 A;  4HAE A;  2F1M A;  3K57 A;  1LT4 D;  3NQI A;  1F9Q A;  1RD9 D;  3R2T A;  2NUC A;  4RKB A;  5IGG A;  2DN8 A;  1XXG A;  4BY1 B;  1GUO A;  2ID0 A;  3P7J A;  5CV9 A;  3G7L A;  4HTH A;  4FVM A;  2JA8 B;  1DOM A;  3SK6 A;  3PIO 3;  2XN9 C;  2F0W A;  2RA4 A;  1H9S A;  1JB3 A;  4DGZ A;  2A6E D;  1LTS D;  1ILP A;  4M8A A;  4G4K A;  3MAQ A;  2KUM A;  5AFW A;  4QMG A;  5C4X B;  1IYU A;  1EY8 A;  1R4Q B;  3FMC A;  1CZW A;  3A7L A;  1HFG A;  2ICI A;  2QDB A;  1DXM A;  2YU9 B;  2B2U C;  1DZ1 A;  4ABN A;  1W6J A;  1I4H A;  1RTN A;  2Q8T A;  2L4N A;  5I9O A;  2AUJ D;  2EJM A;  2BA1 A;  5DM7 3;  5IOD A;  3SK5 A;  4DAV A;  3VR6 A;  1PRT F;  3GTQ B;  4TSS A;  2KEC A;  1TS2 A;  4ULL A;  5C5M A;  3SEB A;  4CJ0 B;  1WTQ A;  2B2T A;  1WTR A;  2KJX A;  4CHT B;  2Q8R E;  3N52 A;  1HPC A;  1TWG B;  5EGT A;  4C3H G;  1KAB A;  3S1R B;  2K5Q A;  5LL6 S;  3GTM B;  3WOF A;  1QJO A;  2R7Z B;  1LT6 D;  1STB A;  3BYT B;  2F0G A;  3D6C A;  5C6A A;  2RSO A;  2OF1 A;  2F0U A;  4XDX A;  1OXS C;  5EKK A;  4RGO S;  1D6E C;  3SXH A;  5C44 B;  5HUR A;  2ZXR A;  3I8Z A;  1WTW A;  1PXU A;  2E2J B;  4HR7 B;  4QB4 A;  4ZYS A;  4C3I G;  2FFK B;  4X3S A;  3DMU A;  5KNC A;  5ELF A;  3OMG A;  3RUZ A;  5BN4 A;  3A7A B;  5FLX L;  1Y8O B;  3SVM A;  5C0X I;  2PPB C;  2L55 A;  1Q8I A;  2X69 A;  2TMP A;  1EIH A;  1I50 B;  3VR2 A;  2K01 A;  1F9P A;  1O78 A;  2JA5 B;  3Q23 A;  4FF3 A;  4K6D A;  2JA6 B;  5KRU A;  4NW2 A;  4DN4 M;  4A3B B;  4KKU A;  3DXJ C;  4NDX A;  5JPM C;  2XSC A;  1I4G A;  4C3H B;  2KVM A;  1PTO F;  1JOK A;  2PO4 A;  2RSN A;  1TKW B;  2H4O A;  3MZ5 A;  4Q0F A;  2IX3 A;  1X3Q A;  2E74 C;  3HOX B;  3LNN A;  5BN3 A;  1H9J A;  4K14 A;  2RBM A;  1O7Y A;  2XRQ D;  4A3F B;  1I6H B;  2KA7 A;  3LWE A;  1SNO A;  3ITP A;  2B8F A;  2Z4I A;  1TT2 A;  3HGB A;  3S17 B;  2LS0 1;  4PQX A;  2RDH A;  3X3M A;  3U9S A;  5J39 A;  2EYO A;  5EBC A;  3R2I A;  4E6I A;  3BVZ A;  2ENB A;  1R9T B;  5I2Y A;  4N9P A;  1CT1 D;  4ZRZ A;  1SYB A;  1SYF A;  4NMZ A;  2L11 A;  1Y69 U;  3VA5 A;  2NVX B;  5DEH A;  3S2H B;  2EXZ A;  2C9O A;  2CW0 C;  3D4W A;  1IHZ A;  1PFN A;  4UDU C;  3QOL A;  3A54 A;  2F0I A;  3PV0 A;  4DAY A;  4JK1 C;  1DJR D;  3KLS A;  4XYO A;  3D31 A;  4WFN 3;  3K5M A;  5A2Q L;  5T1G A;  2Z8L A;  3CKI B;  4XTC S;  4CJ2 C;  2F0S A;  5I9P A;  4F7X A;  2EY5 A;  3J81 E;  1C48 A;  3KK7 A;  1X32 A;  1G91 A;  3MXP A;  1K8M A;  1T5X D;  4B9W A;  2PW5 A;  4K8I A;  1M8A A;  3TP5 A;  2B2U A;  1DM0 B;  3TZU A;  4FXK C;  4XT1 B;  2IWH A;  3SK8 A;  5CMD A;  3DEP A;  2F0K A;  1ZXT A;  2B8G A;  4IUP A;  1WD0 A;  3P75 A;  5NUC A;  3PO3 B;  3DM1 A;  1ENF A;  3BDL A;  1SYG A;  5M5X B;  4RGM A;  1QB5 D;  1VDZ A;  5C3X A;  2F0N A;  5KGU A;  4C56 C;  2WP8 J;  4XQJ A;  3NUC A;  1V1P A;  4ZK9 B;  4O42 A;  4ZAI A;  2SEB D;  3NWT A;  3NWS A;  5ELD A;  2L9H A;  1S5D D;  4N9T A;  5KYI A;  2X6G A;  2F0V A;  1CA6 A;  1V8Q A;  1PRT C;  2LFN A;  2A68 D;  2NTS A;  4RHR A;  2I07 B;  1U4L A;  3DWQ A;  3H09 A;  1I3Q B;  5C3W A;  1QG7 A;  1MSH A;  1F9S A;  1EU4 A;  4LAA A;  1A3T A;  5C0X J;  2O5I C;  1LT5 D;  3TDQ A;  5FO9 B;  5CBE E;  5EQ0 A;  2Z1C A;  5ELC A;  4ZKB B;  1SNQ A;  2EYH A;  1RJT A;  5ELB A;  3BYY B;  1ET9 A;  1WCM B;  1BBX C;  3OHX C;  2RQX A;  1IW7 D;  2EOT A;  3AU7 A;  1TII D;  3CU7 A;  3AB9 A;  1I4P A;  3KUP A;  1ILQ A;  3DHQ A;  4ZUJ A;  2EVB A;  5KEE A;  4DAP A;  3S15 B;  2EY6 A;  2AQ2 B;  2CHB D;  2WKC A;  3D3R A;  3NBH A;  2LKV A;  1BUV T;  2NVQ B;  2RDG A;  5IGE A;  2K03 A;  2F4I A;  2NYZ D;  1B3A A;  4A3J B;  2K5W A;  2AWO A;  3UI2 A;  2B2T C;  3KBG A;  3C2P A;  1E2W A;  1F2Y A;  2C5C A;  1EQV A;  3OW7 A;  1Z7T A;  4FXG C;  1KLU D;  2XVS A;  4FF4 A;  4XQQ A;  3VR5 A;  4MHE A;  1EQT A;  1L0X B;  5K5P A;  3TME A;  4S3S A;  3QG1 A;  3MXG A;  1MGS A;  1F2L A;  2PW7 A;  5D65 A;  1S5F D;  4U68 A;  2E75 C;  1AN8 A;  2F0O A;  3WDN A;  2R93 B;  5EKI A;  3T56 B;  1EZ8 A;  1PDQ A;  5IT9 L;  5EBD A;  4K8J A;  3DWA A;  3GV3 A;  5M3F B;  2OXP A;  4PV1 C;  3SDZ A;  1EY5 A;  4QF4 A;  4HMJ A;  1PLF A;  2WB1 B;  3TBI B;  1ROD A;  2NN6 G;  1JC7 A;  4QIW B;  4G7H C;  2R92 B;  5I2X A;  4BS9 A;  1QNK A;  2DY8 A;  1SJE D;  2IX1 A;  1IYV A;  2DNE A;  2A6E C;  2EJF C;  1OO9 B;  3TP7 A;  1I6V C;  3IL8 A;  2N55 A;  4MIU A;  2IX0 A;  4ILW A;  5ISR A;  3HOV B;  2IJ0 A;  4RA8 A;  3L3O C;  1STE A;  5C3E B;  5KNB A;  3A55 A;  1HTP A;  1HFN A;  1Y8N B;  5A35 A;  2NTT A;  1STH A;  4F88 A;  3K58 A;  1S5C D;  2EZV A;  1LTG D;  1KTK A;  3IFT A;  1JOQ A;  1PRT B;  1SEB D;  2IT1 A;  2HQE A;  4K2L A;  4P2C B;  5EPL A;  3FVQ A;  3BS1 A;  1ENC A;  3F2U A;  4KKS A;  4KJO A;  4IUN A;  2R61 A;  3I73 A;  4RWS C;  4B08 A;  1MD2 D;  5E4W C;  1KDA A;  3T16 A;  1H9S B;  1Q1B A;  1TY0 A;  5IGD A;  3NTI A;  1SYE A;  1LLR D;  4KMU C;  2V4D A;  1JQY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...