5IP9H

Structure of rna polymerase ii-tfiif complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9H00
2RHSB 4DV6Q 4B3SL 3RN2A 4A3IH 3RZOH 4GKJQ 3UDGA 1X3EA 3ZJYC 5C4JH 3I4NH 1HH2P 3I7FA 2R7FA 4A3IG 4DV5Q 2GVAA 3PF5A 1IBLQ 3TS2A 1YBYA 2BA1A 2PNHA 3W1BA 4DV0Q 1QZGA 3K8AA 4LF8Q 2OTJA 2XGTA 1UE1A 4AIMA 3J81i 3D0FA 1K0RA 3JC66 1YJWA 4KHPL 4DK6C 4KHZA 2UU9L 4UP8A 4AYBE 5JEAG 3MXNB 3AQQA 2IX1A 3PIPA 1NMFA 1X6OA 1L1OC 2NVQH 3F2BA 4BBSG 4DKAC 4GLVB 3J81j 1SR3A 4A3FH 3T1YQ 1N33Q 4DR4Q 1T9HA 1OXVA 2CKZB 1KIXA 1HR0L 2ES2A 2JA6H 1L0WA 3UDFA 3A5ZB 4BY1H 4JI5L 4GNXC 4JBWA 4R4CA 1NJIC 2VUMH 1B8AA 2D0OA 1XPRA 1IYJB 1PH4A 2ASBA 5JJLA 1EQQA 2NZOA 3I55A 4IFDG 1MJCA 1N32L 1PH6A 3NEMA 1CSPA 1SLJA 2I5LX 1V9PA 5FJ8H 3G4SA 2QA4A 4X66L 5M3MH 1WCMH 3NENA 1N36Q 1W3SA 5FJ8G 3GD7A 2JA7G 4B3RL 3RLOA 4IPCA 4DR6Q 5M3MG 4TQUS 2ZJRA 1JMCA 4A4IA 1Q8KA 4LFCL 1QUQA 4DR5Q 1I6HH 3PUXA 5JEAJ 1Q46A 1VQIA 3PUVA 5IP9G 3KJPA 2KHJA 4GLAC 1KQSA 2UUBQ 4JV5L 1HJPA 5C0XI 1SFOH 1HNWL 1VQBA 2VZAA 1Q7YC 2UXCQ 3FKIH 1N34L 1V43A 4DV4L 1VQ6A 1LUZA 3FP9A 2I5MX 2WAQG 1L1OB 4KHPQ 1SRUA 2WB1G 3FKIG 2D0PA 2K50A 4P71A 5C4XH 1VQOA 4A3GG 2QGQA 4UP9A 4A76A 4IFDJ 3L2PA 1I94L 2K14A 1K9MC 3H0GG 3GTQH 1A8VA 4JI8L 4IO9A 3WWVA 2E5LQ 1A63A 4LW1A 2KENA 3CW2C 3F1ZA 4IOCA 1HR0Q 3S16H 5IT9c 4JI5Q 4YHHQ 1EYGA 4A3JH 1XNRL 1OXUA 3UDXA 2RCNA 4DV3L 1GVPA 4JYAQ 3OYYA 3PCOB 1HR0W 1YNXA 4LF4Q 1E7ZA 2R92G 1XNQQ 3KDFB 3E0EA 2ID0A 3KF8B 2ATWA 1U0LA 2JEAI 3GDEA 5IYDG 4JC0A 4JBKA 3GTMH 4LF6Q 2B3GA 3J80i 5LMUQ 4B3RQ 2OQ0A 2VW9A 5C44H 2HIXA 3GTOH 2NN6I 3KLWA 4APVA 2B29A 3HOXH 1VQEA 1Q81C 3HOUH 4A93G 5E7NA 1Q12A 1IXRA 1CKOA 4A3CG 3KOJA 5C0XG 4JCVE 5M5XH 1VQKA 3CCMA 3VDYA 4H02A 1HNWQ 4GLXA 1PH5A 2F52A 2VL6A 1BBWA 2MFIA 1KAWA 4PZ7A 4A3EG 4GN3B 3GTJH 4DV4Q 5GROA 3U58A 1IBLL 3HOWH 4JI6Q 1PFSA 1PH3A 1C7YA 4NXML 2V1CC 4DV0L 4A3MH 3GTKH 5GAGC 1L2FA 3HKZE 4HIDA 1RL2A 4LF5L 1OXSC 4EX5A 2HIVA 4AH6A 2AHOB 3CCVA 1YHAA 4DR1Q 4X64L 3CQZH 1Y1WG 1B70B 1FGUA 2JA8H 3K0XA 2UUAL 3M7NA 5C3EG 2E2JH 1XNRQ 2PMZE 2NVTH 3ULJA 4DV3Q 1YVCA 1VQMA 1W2BA 3ULPA 2JA5H 1L1OA 1V1QA 1Z9FA 3L0OA 2ZJPA 4DUYL 1JB7A 1VQ5A 5FLMH 1XMQQ 3CD6A 3TREA 1HNZQ 3S1MH 4AQYL 3OTOL 1WYDA 5H1SE 4XTCS 4QGUA 3UE0A 3HOYH 1TWFH 3CCLA 1TWGH 2ZTCA 1PVOA 1N36L 3HOYG 2K5VA 4JI7Q 2E2IH 1JJ2A 4UY8C 1OXTA 2PQAB 4DR6L 4J15A 1X54A 3CCQA 4PZ6A 4DR5L 5IP7H 2E2HH 1M90C 3KDFA 2WB1E 4OWWB 2D62A 2AKWB 2EIFA 5IP7G 4NXMQ 1AE2A 4O2DA 2UUBL 3I4NG 3GTGH 4P72A 2GN5A 2UXCL 1WOCA 4UPAA 4LF5Q 4JBJA 4NXNL 2Z6KA 1Z47A 4X64Q 4A3BH 4QY7A 1FL0A 1KRTA 5IYBH 3HOVG 1EOVA 2R6GA 2UUAQ 3RNUA 1S3OA 3I4MH 4LWCA 3ERSX 5M5WH 3ULLA 5HY6A 1X9NA 3M4OH 3JAMc 4C2MH 4LF7Q 1K8GA 4OWTB 4P74A 2E5LL 1PYBA 4JI2L 1E22A 3I4MG 5GAHC 4YHHL 3RR5A 4DUYQ 4A3FG 1UWVA 3PO3H 4L5SA 2MO0A 2JA6G 1YHBA 4Y52H 4BY1G 2ZTDA 4R4IA 3OTOQ 4AQYQ 4JYAL 3RLFA 3ICEA 2N3SA 4LF4L 2VUMG 1OTCA 1XNQL 4DR3Q 1EFWA 4LUOA 1N8RC 2KHIA 4LF6L 5LMUL 3E9HA 4OWXB 3I2ZA 4RMFA 2NVXH 1NBWA 4A3LH 1NMGA 1WCMG 2F3IA 2PI2A 3W5OA 1I5FA 3STBC 4A3LG 4YCVA 1VQHA 3CC7A 1P8LA 1WI5A 2I0QA 1PYSB 3K7UC 3KJOA 4B3ML 1TWCH 1OXXK 2VY3A 2IX0A 1K3RA 3HKSA 4C3IH 4X62L 4BXXH 4ALPA 2CWAA 1GKHA 3PUWA 3UE1A 1ASZA 4HJAA 2B63H 1NY4A 4JI6L 1C9OA 4NXNQ 1CKNB 2VQEL 3BZKA 4GN5A 5GAEC 3M4QA 2PQAA 2MNAA 1KL9A 3CPFA 2EXDA 1HNXL 2R93H 4X65Q 5C4XG 1GO3E 5ELNA 1E24A 4GNXB 2N49A 4DR1L 2VQFQ 4GOPC 3I56A 2F4VQ 3HOZH 2KCMA 4JI2Q 4IPGA 1N9WA 2JK8A 4HJ9A 2A19A 2Q2TA 3CC2A 2R93G 4RG1A 4Y7NH 3HOZG 4L5TA 1RIPA 4LFAL 1TWHH 4P75A 5M3FH 1XJVA 1XPOA 1K8AC 4POGA 4A3JG 2YYZA 4R4QA 4OONA 4NB3A 3A0JA 2OTLA 1XMQL 3HOVH 1IBMQ 4NPSA 1HNZL 1WFQA 4JI4L 2K5NA 5FLXc 5EAYA 4A3KH 3EN2A 1MJEA 2YTXA 3K7AH 4IOAA 3BZCA 2NVYH 3EIVA 4GN4B 2K5HA 3M85A 4DR2L 1VQ7A 3U50C 5C44G 4L5QA 4JG2A 4JI7L 1AH9A 2YV5A 3HOXG 4AYBG 3HOUG 2BH2A 4B3MQ 3J7ZC 3K80C 1XMOL 4X62Q 1Y14B 2MQHA 3E9IA 1BBUA 4LF9Q 1D8LA 4BA2I 1SE8A 1HZAA 2N8NA 4YWKA 3L7ZC 5M5YH 1VQ9A 1JT8A 2BH8A 3PV0A 4K0KL 2VQEQ 1TWAH 3A74A 4HJ5A 4GOPB 4DV1Q 1YI2A 3HOWG 4A75A 3S14H 4A3MG 1HNXQ 1TXYA 1UE6A 2HHHL 4BY7H 1XTDA 1UE7A 2OCEA 1AE3A 1G291 3M4PA 4EQ5A 3KYHC 3PO2H 3RZDH 1X3GA 1PH2A 5DLQE 4JI3L 1YHQA 4BY7G 4R4TA 2R7ZG 4LFBL 4JI1L 1Q82C 2UXBQ 1IL2A 4LFAQ 3MEFA 3AEVA 3CCEA 2JA8G 4LF7L 4GKKL 1LYLA 4GS3A 1K73C 3G48A 1HZCA 4MNOA 1LTLA 1CKNA 1XPUA 1Q1EA 5C0XJ 4JI4Q 4OX9L 2JA5G 2PI2E 2BA0A 3FHWA 3NBHB 1E3PA 3CF5A 1U5KA 2XTIA 3G71A 1PH7A 2HT1A 5FLMG 3F2DA 2NN6G 4GNXA 5AJ3Q 4DR3L 3KFUA 3AFPA 4DR2Q 1KC8C 3TEHB 3KF6B 5JJIA 4A3DH 1X55A 2CCZA 1R9TH 1XMOQ 1PH1A 2CQOA 2I5HA 4PMWA 2WAQE 5IY0A 2YU9H 5IYCH 3U4ZA 3OW2A 1M1KC 2A8VA 4K0KQ 1EWIA 3A5UA 1PA6A 1YEZA 5HGQA 2DGYA 1GD7A 5BR8L 1C0AA 2IY5B 3J80c 3PSIA 4PZ8A 5J3BA 2UUCQ 3S1QH 4IFDI 2HHHQ 1FJGQ 5GQOA 4JOIC 4JBMA 1FVIA 2K75A 1VQLA 3S17H 2ALYB 3TRZA 4JI3Q 4DUZL 4LFBQ 4JI1Q 4X65L 4A3BG 5IYBG 2C35B 3G6EA 1PH9A 2Y0SG 1I3QH 1IZ6A 2VQFL 1VQ8A 2F4VL 4GKKQ 3CMEA 3CCSA 1CKMA 4IPHA 1KXLA 3PIOA 3GO5A 2R7DA 1PHJA 1YJ9A 3T1HL 2CWPA 3CPWA 2ZTEA 1KHIA 1NE3A 1P16A 4GOPA 4OO1I 4OX9Q 1NTGA 3D31A 4DV2L 3PO3G 3H3VI 4LUZA 1VQPA 5JJKA 2Q2IA 2EQSA 1IBML 4BBRH 5GADC 1QZHA 4X6AH 1Q86C 4BBSH 1KD1C 3W1GA 1QVGA 1DGSA 1A62A 2VS1A 2ZM6L 3DLLA 1CUKA 2KBNA 4R1JA 3TQYA 4BBRG 2JEBI 1VQFA 3HKZG 4DNIA 3J7A5 4LUVA 2L15A 3S2HH 2K4KA 2JQOA 1SROA 1BKBA 3CCJA 3Q8DA 4O0AA 4HJ8A 4DAYB 1LM0A 1SN8A 1VCIA 5IWAL 5K36G 1X56A 4LF9L 5BR8Q 4DR7Q 3M3YH 3K81C 4BXXG 3KF6A 2JA7H 2WP8J 2Z0SA 2JJQA 1S40A 1MKHA 4DV1L 2B63G 4YWMA 1D7QA 3GTLH 3LGJA 4DUZQ 2OWOA 3S1NH 2NZHA 4FDBA 4B3SQ 1PH8A 5IP9H 3BU2A 2AMCB 4DPGA 3H3VH 3B6YA 2UXBL 4KLKA 3T1HQ 4B3TL 4OO1G 2RF4A 1VQAA 3CCUA 2Z6KC 5LMNL 1VQ4A 1G6PA 3GTPH 2KCTA 4UP7A 4DV2Q 2LSSA 4R4OA 1QVFA 4A3GH 4P73A 5M3FG 1CSQA 2HQLA 2K52A 1EIFA 3AYHB 3RLNA 3J81c 2LXJA 2QEXA 2UU9Q 2CFMA 2ZJQA 3H0GH 4L5RC 3H15A 3M9BA 2ZM6Q 1JE5A 2A1AA 4DV7L 2GVBA 4MTNA 4MZ9A 4C3HH 5AJ3L 4A3KG 3S1RH 4YY3L 3TS0A 1VQNA 4JI0L 2YTYA 4KI0A 1A0IA 1MIUA 1QVCA 4YCUA 3CAMA 4DK3C 5IWAQ 4DAMA 1JJCB 4HIKA 2R92H 3F8TA 1ASYA 1G51A 5IYDH 3CCRA 1VS0A 1IBKL 2UXDL 3IRBA 1PV4A 1N32Q 1YIJA 2N78A 3CP0A 1YITA 3PUYA 1UE5A 3SGIA 1Q1BA 1VQDA 1VQJA 4TVAB 4X66Q 1EQRA 1E1OA 1E1TA 2RHQB 2Y0SE 2UUCL 3DM3A 4ME3A 4A93H 4YCWA 1FJGL 2Q2HA 2JE6I 1J5EL 5IE8A 1B7YB 3PUZA 4LFCQ 4A3CH 1H95A 1SMXA 1YZ6A 4IPDA 1EUJA 4B3TQ 4OXPA 3JAMi 1WJJA 4A3EH 2R7ZH 3PO2G 5LMNQ 4JOIA 4DV6L 4JV5Q 3S15H 4GKJL 1KRSA 5ELOA 2IHEA 1N34Q 3EBEA 4DV5L 4BA1I 2FXQA 1VQCA 3STBD 5LMNW 4LF8L 4QJFA 4YWLA 4WJ3M 2JA9A 2AWOA 4QL5A 4IJHA 4HIOA 4HIMA 4DV7Q 4LNQA 1Y1WH 1I94Q 1HZBA 4YY3Q 1S72A 1X3FA 3CMAA 4JI0Q 4JI8Q 3UDIA 3HFZB 3CXCA 5C3EH 2LXKA 1JJGA 3RN5A 3ER0A 2IHFA 3I4OA 1HZ9A 3PGZA 4IJLA 4A3DG 1BVSA 4WJ4A 3T1YL 1I50H 1VQGA 1N33L 4DR4L 1J6QA 3AFQA 1IBKQ 1QUQB 4PG3A 2UXDQ 3S24A 3F2CA 2AWNA 2H5XA 3CC4A 1UEBA 1Y1VH 2IT1A 1GM5A 3NELA 2MO1A 5IYCG 2DUDA 4POFA 4HJ7A 1EIYB 2OQKA 1Y1VG 4DR7L 2WFWA 2E8GA 4XIGS 2Q2UA 3PF4A 2VNUD 4QIWE 1YJNA 3S2DH 1O7IA 1J5EQ 1X65A 1K83H 3BJUA 4C3JH 3U4VA 4QQBX 2YTVA
chains in the Genus database with same CATH superfamily
3I4LA 4A3KB 2SNMA 1Y8OB 1HH2P 4DV5Q 5C3XA 4DV0Q 3K8AA 2XGTA 1UE1A 4QUFA 5CORA 3J81i 4H13C 2MP1A 4KHPL 4ZRZA 2UU9L 4UP8A 2Z6BA 4X3SA 4DA2A 4K8JA 3K58A 1X6OA 2K05A 3F2BA 3J81j 1SR3A 3TZDA 1DOLA 1T9HA 3S14B 4G4KA 4A93B 3TDQA 1L0WA 3UDFA 4BY1H 1NJIC 3PO2B 2O2LD 3HRZC 1PH4A 1QB5D 2KQ3A 2WKDA 4A3EB 1PH6A 3NEMA 2A5HA 4X66L 3NENA 3PIO3 4Z9CB 3GD7A 4B3RL 3RLOA 2MJ8A 4IPCA 4TQUS 4A4IA 3I70A 2VXWA 4DR5Q 3PUXA 5JEAJ 2CH4A 1Y1WB 1Q46A 1VQIA 4WJWA 5IP9G 1I4GA 2SOBA 2UUBQ 4ZAIA 1SFOH 1HNWL 1VF7A 4ZUJA 5FKAC 1DZ1A 1Y69U 1LUZA 1MI2A 1CZWA 2WAQG 1L1OB 2SEBD 3R3OA 1VQOA 2YU9B 3BDOA 3DWAA 1XWEA 2B2UC 3KLSA 1LTGD 1HR0Q 1RDPD 3R2IA 4JI5Q 4YHHQ 1EYGA 1G2TA 1H9JA 2TMPA 1OXUA 2RCNA 4DV3L 1GVPA 2B2WC 4JYAQ 1STNA 3PCOB 3LWUA 2R92G 1XTCD 3KDFB 1F9QA 3E0EA 4A3IB 4O42A 1U0LA 3Q22A 3GDEA 5IYDG 2ATWA 2F0UA 2OQ0A 3GTOH 4ZQ3A 2B29A 2PQEA 1PXUA 3HOUH 5EBCA 1IXRA 1CKOA 1MBYA 3KOJA 3NHHA 4BBSB 1VQKA 1PH5A 2VL6A 1IKLA 3GTJH 1IL8A 4JI6Q 2NUCA 1PFSA 4FNFA 1PH3A 1C7YA 4A3MH 5IGFA 3GTKH 1L2FA 3HKZE 2I46A 4EX5A 4NDXA 1GXDC 2G9HD 2HIVA 4AH6A 4DR1Q 3MWYW 2CW0C 5TSSA 1SMYC 3TP5A 5NUCA 2N55A 3OHXC 4RFBA 3T51B 1B3AA 3M7NA 1X3PA 3GTLB 5IIFA 1BF4A 1W2BA 2B8GA 2JA5H 2JYOA 3L0OA 4DUYL 1VQ5A 1CTMA 4FF4A 3TREA 1BNZA 3S1MH 1ZYRD 2V4DA 3I90A 5COYA 2ZTCA 1FNVA 1PVOA 1X54A 4KJOA 3CCQA 2E2HH 2JSOA 1VMCA 2EIFA 3I4NG 3IKJA 1NCVA 1V1PB 2GN5A 1WOCA 4FXKC 2Z6KA 4QY7A 2R6GA 4EGVA 3K5LA 5FO8B 1FNWA 3ULLA 3GTMB 3VR2A 4LF7Q 3KLSX 5JVG3 4OWTB 5C44B 5GAHC 3QR8A 4A3FG 1UWVA 1HCZA 4RHSA 2MO0A 4B9XA 4Y52H 3ICEA 3K59A 2KEEA 2N3SA 4LF4L 3NXWA 3TN2A 4ILWA 4GZYC 1EFWA 4LF6L 5LMUL 3NK9A 3I2ZA 3ONAB 5E4WC 1NMGA 1WCMG 1YNJC 5A35A 1I5FA 1JOOA 3STBC 4N8X1 1RKNA 4KV6A 3MC0B 3CC7A 1WI5A 1TWCH 5EJWA 1A2UA 1HXYD 1Y8NB 3PIP3 1GKHA 4HJAA 1SNQA 5KNDA 1KDAA 1V1OA 1AZPA 2F0DA 1S4ZA 4X65Q 4GOPC 4GNXB 3HOZH 3I56A 3SE0A 3HOZG 1TWGB 4IN3A 2OF1A 3RD4A 1RD9D 5FK9C 1XPOA 1K8AC 3A8IE 3HS0C 4A3JG 4R4QA 2ZT9C 4OONA 4MTKA 2F0NA 1STGA 1BCPB 4A3KH 5BN3A 3K7AH 1AP0A 5LL6S 2SNSA 4LMQD 3EIVA 1F9PA 1TS5A 1EY4A 3RUZA 1TU2B 3P20A 3HOXG 5CBEE 2BH2A 3J7ZC 4X62Q 1Y14B 3I4MB 3M4OB 5M5WB 2K7VA 4YWKA 2BH8A 3PV0A 4HJ5A 3A74A 3S14H 1I4RA 1PYWD 4BY7H 4XQJA 1XTDA 1F2ZA 2OCEA 3PO2H 4BY7G 1PH2A 4X3TA 4LFBL 2UXBQ 1IL2A 2LKVA 2RCFA 1U4PA 1SAPA 4MNOA 4O1NA 1STAA 1KABA 3R8BA 2TSSA 5I2XA 4JI4Q 2PI2E 1LTTD 3FHWA 3CF5A 1U5KA 3TSSA 2KJXA 3G71A 3F2DA 1CQVA 4FXDA 4DR3L 4DR2Q 4FO2A 2J7ZA 1HQRD 2EXZA 2B63B 4A3DH 1EOTA 2XWJB 3E5SA 5C4XB 1FGBD 3TP8A 1WD1A 3I91A 2R93B 4G7ZC 2YU9H 5IYCH 3OW2A 4K0KQ 1PA6A 1D5ZC 3I73A 5HGQA 1C0AA 3SVMA 2IY5B 4RGTA 1SYEA 4IFDI 2J0TD 3KBXA 2HHHQ 1O78A 4DK1A 1FVIA 2F4IA 4JBMA 3S17H 1DJRD 5IGCA 3TRZA 4JI3Q 4DUZL 2K5DA 2C35B 2Y0SG 2PZUA 1VQ8A 4MIUA 3CMEA 3CCSA 4IPHA 3PIOA 1O80A 3OIQA 4KJNA 1IW7D 1WTXA 4LK1C 3CPWA 3NSWA 4AYBB 4OO1I 3S9WA 4OX9Q 4DV2L 3PO3G 3H3VI 5JJKA 4BBSH 1DGSA 3CKIB 2VS1A 3DLLA 3TQYA 1VQFA 3HKZG 2N88A 5ELBA 4LUVA 2L15A 1HUNA 1TIID 4DAYB 1LM0A 1SN8A 4TSSA 3J7AF 5BR8Q 4PMCA 3VR5A 3K81C 4BXXG 2JA7H 4DV1L 4YWMA 3D6WA 5BN4A 1F2LA 3LGJA 3GTLH 1G6ZA 2EZVA 2F0TA 2O5JC 3S1NH 3OWEB 1EYCA 5C4ZA 2WV6D 3I72A 1ZYRC 1TWFB 4B3TL 3MAQA 4DAVA 1G6PA 2L55A 4RGMA 5CV9A 5IGGA 1VQ4A 4NP5A 2K5WA 5IOCA 1M8AA 2LSSA 3LNNA 1UNSA 1R9TB 1CSQA 2K52A 3RLNA 1EIFA 2QEXA 2LXJA 2UU9Q 1I4HA 3H0GH 5I9OA 4L5RC 3H15A 4DV7L 2GVBA 4MTNA 4ZKBB 3TS0A 2EYPA 3QOJA 1BDOA 1PRTF 2QW7A 1A0IA 4IUQA 1UUPA 3K6OA 4KMUC 3CAMA 5EPJA 3NPPA 1ASYA 1G51A 1NR2A 4TRDA 1EIGA 2R61A 4X66Q 1WTOA 1E1TA 3GV6A 2UUCL 4YCWA 3A7LA 3Q24A 2JE6I 3DHQA 1J5EL 5I6YA 1A3VA 3PUZA 5FLXL 1YZ6A 2GA4B 3HG9A 4IPDA 3SEBA 3J81E 5IGEA 2R7ZH 4DV6L 3S15H 5ISRA 4GKJL 1PFNA 2EJGC 3SK8A 1V8QA 2AUKA 1HUMA 1JR0D 3AB9A 4BA1I 4ZK9B 5LMNW 2F0FA 1MSGA 4WJ3M 3G7LA 3TZUA 2JA9A 4DGZA 4C3IB 3CMAA 2PCFB 1TKWB 5C3EH 3L9AX 5IGDA 1GUGA 2K01A 1DD2A 1BVSA 3FMCA 5CV5A 3IFTA 1VQGA 3NWSA 3S24A 3F2CA 2AWNA 2H5XA 1Y1VH 2K32A 2IT1A 3BDLA 1TY2A 1GM5A 4WORA 4HJ7A 5K5PA 2DJGC 1Y1VG 2OQKA 2WFWA 1QNUA 5D3DA 1YJNA 5M3FB 1PRTD 4OELB 5EGTA 2IX3A 4C3JH 1EWIA 2Z1CA 4B3SL 2F03A 2G5DA 2AUJD 4C3JG 1CA6A 3RZOH 1X3EA 2RA4A 3I7FA 3PF5A 3TS2A 3TP7A 3A54A 2PNHA 3BDCA 2EYMA 4IUPA 2JN4A 4AIMA 3JC66 1K0RA 4KHZA 5ELDA 1NMFA 5KNCA 3J80L 3PIPA 1T5EA 4DKAC 4RHRA 3HP3A 3T1YQ 1N33Q 1OXVA 2CKZB 1KIXA 2JA6H 1AEXA 2F0PA 4JBWA 1SE4A 2ASBA 1IYJB 2CW0D 3I55A 4IFDG 1MJCA 1K0SA 1PHJA 2AQ3B 2LS01 2QA4A 5M3MH 4XT1B 1ZKOA 2F0JA 3NQTA 1F77A 5M3MG 1JMCA 1H9SA 1Q8KA 2RBMA 4LFCL 2KA7A 1QUQA 1GUOA 2Q8RE 3PUVA 4PV1C 2K1BA 2A73B 4MHEA 3FKIH 1VQ6A 3FKIG 2D0PA 3HEJA 1LTAD 2A6EC 5C4XH 1EIHA 4CDFC 2WINB 1BOSA 3L2PA 2RDGA 4C3HG 1A63A 3S1QB 4IOCA 3F1ZA 5KGUA 5IT9c 3CHBD 3EQLC 1TS2A 2F0GA 2KOLA 2MPMA 2MHVA 3OYYA 1HR0W 1YNXA 4LF4Q 1I3QB 3VYSA 2ID0A 2JEAI 1UEAB 4LF6Q 1Z6HA 1SNDA 2B3GA 5LMUQ 3I4NB 1IW7C 2VW9A 3MEHA 5ELCA 3KLWA 4APVA 4RA8A 1I6VC 5E1FA 5C0XH 1DM0B 1EQVA 2LMCB 4A3CG 5C0XG 1JE4A 2B2YC 1S5CD 4H02A 4PZ7A 1BBWA 2MFIA 2NVQB 4GN3B 4DV4Q 5IT9L 4NXML 4A3FB 2HQEA 4HIDA 2X6GA 4LF5L 2EDGA 1B9NA 1JWUD 1ILQA 2AHOB 4C56C 3Q23A 2JA8H 4KHVA 2UUAL 3ITPA 4FP5D 1XNRQ 2NVTH 1WCMB 2PMZE 4XXEA 1BQQT 3ULPA 1V1QA 1VF5C 2XSCA 1B4OA 1HFGA 1JB7A 2Z8LA 1KNAA 1I6HB 5H1SE 2BOSA 2EYOA 1NUCA 1TWFH 3CCLA 1N36L 1ICWA 4X3UA 2K5VA 3T13A 4UY8C 4A3GB 3VR3A 4J15A 4PZ6A 4YIJA 1H9KA 2WB1E 3KF8A 1S5BD 2MGSA 2AKWB 4O2DA 5C5LA 3SR1A 2NYZD 4UPAA 2FFKB 4JBJA 1HQMC 1Z47A 4X64Q 4A3BH 1KRTA 1FL0A 5IYBH 1F9RA 1S3OA 4B08A 2A74C 1X9NA 4FVMA 5HY6A 3JAMc 4C2MH 4OHJA 1ENAA 1K8GA 4ZUIA 4JI2L 3QIAA 3VR4A 3SDZA 3HOXB 2D9UA 1YHBA 4BY1G 2ZTDA 4AQYQ 3OTOQ 2ZXRA 4IUVA 1XNQL 1GJXA 4DR3Q 1S5DD 1PTOB 2M2LA 4LUOA 4OWXB 4A3LH 2PI2A 2F3IA 3ND8A 1EYAA 1WTVA 4A3LG 4YCVA 4QCLA 2F0SA 1EZ6A 2JXMB 5A2QL 5K36H 4K5VA 1ENCA 3KJOA 2VY3A 1K3RA 3CQZB 4C3IH 3JAML 5C3WA 3UE1A 1ASZA 1STHA 4NXNQ 1CKNB 2VQEL 1BCPF 3M4QA 2PQAA 3CPFA 2LFNA 3DWQA 2IL8A 1SNPA 2N49A 1LTRD 2KCMA 4IPGA 4RG1A 1LT4D 1ENFA 3HOYB 2LY7A 3QWNA 4RGOS 4LFAL 4K5XA 1KLUD 1K83B 1KNEA 3MXUA 1PRTC 5M3FH 1XJVA 4POGA 3DXJC 5D14A 2OTLA 3A0JA 1XMQL 3HOVH 4UDUC 1HNZL 1WFQA 1FYCA 2K5NA 5C4JB 1MJEA 1M4VA 3HZXA 4IOAA 2NVYH 3SK4A 4GN4B 1LLRD 4IUTA 4JG2A 4L5QA 5E3FA 4JI7L 3H6MA 3HOUG 1WTQA 4B3MQ 3K80C 2Y0SB 1BBUA 2RDHA 1ET9A 1EQTA 2WACA 3E0JA 1HZAA 1VQ9A 1JT8A 2A68D 4JK1C 4GOPB 4DV1Q 1KDCA 4A75A 4EVOA 3PO3B 4A3MG 1HNXQ 2VUMB 5CV4A 4KKTA 3FEWX 1A2TA 3LWEA 1AE3A 1G291 4EQ5A 4S3SA 3RZDH 4R4TA 2OXPA 4JI1L 1Q82C 1HA6A 5FLXE 1G91A 3CCEA 4GKKL 2NVXB 1VMPA 1AZQA 2A6HD 2BCOA 4N9TA 3H94A 3C1FA 4MN3A 1BCPD 2JA5G 5L37A 1PH7A 2RSOA 3KFUA 3P1HA 3TEHB 1SE2A 3KF6B 2ENBA 2XRSD 4HMJA 1DOKA 4K14A 1X55A 2CCZA 3GQBA 1XMOQ 2CQOA 4XT3B 4QIWB 2OEOA 1M1KC 4RH6A 5CYUA 5EPKA 1DXMA 1NAPA 5IGBA 1YEZA 3W3AA 2DGYA 2PO4A 3D4RA 1RTOA 2F1MA 3S1QH 3KUPA 4PZ8A 5J3BA 2UUCQ 5I9PA 4F88A 1E2WA 5ELFA 2ALYB 2F0HA 4K2KA 5I4DA 3G6EA 1I3QH 2VQFL 2PZTA 1YJ9A 2CWPA 5KYIA 1NTGA 4DNRB 5EPLA 5JEAH 4K6DA 1VQPA 4ME5A 2M00A 5M5XB 1SYCA 3MXGA 2EQSA 4ID6A 1IBML 4BBRH 1PDQA 2HDLA 3NTHA 4EQPA 1QVGA 3HOWB 5F2DA 2CH4W 2ZM6L 2KBNA 4BBRG 2Z9HA 4DNIA 3J7A5 1TWAB 5HGTA 1LT5D 3J80E 3S2HH 2K4KA 2JQOA 1BKBA 4O0AA 3NBHA 1VCIA 5IWAL 1WTPA 4KKSA 3M3YH 3X3NA 3NTIA 2B2YA 1D1KA 1S40A 1D7QA 2BE5D 3NBIA 4CGYB 4FDBA 4KN7C 5CR3A 4B3SQ 4RCOA 1PH8A 4DPGA 1SNMA 3B6YA 4LAAA 4KLKA 3T1HQ 4V190 1GUWA 1SDFA 2RF4A 1VQAA 3E6ZX 2FHTA 5J22A 5LMNL 1B1ZA 2E2IB 2DNEA 4A3GH 2DY7A 2HQLA 3BYYB 2CFMA 1I4XA 3M9BA 1JE5A 5AJ3L 4MZ9A 3PMFA 4A3KG 1CFMA 4YY3L 4Q5VA 2X69A 4JI0L 4KI0A 4PQXA 4HMIA 4C1NI 2P5ZX 3UI2A 4YCUA 5AFWA 1TVXA 4ABNA 2K5QA 3F8TA 2Q8IB 1JWMD 1IBKL 3IFDA 5LL6X 1PV4A 1YIJA 3CP0A 3SGIA 1Q1BA 1ESFA 1VQJA 1W6KA 1E1OA 2NWGA 1EL0A 4U673 4A93H 5J1ZA 5CMDA 1B7YB 4LFCQ 2KUMA 1LTBD 3NP8A 1WJJA 4A3EH 3PO2G 4JOIA 1CT1D 1L0XB 1PTOH 4ZKCB 5ELOA 4DV5L 1VQCA 1PFMA 3DUZA 4QJFA 1QG7A 2AWOA 2O4XA 4IJHA 4QL5A 4HIMA 1Y1WH 5I6WA 2K28A 4IUNA 3K5MA 4QF4A 3HFZB 3RN5A 3ER0A 4QB4A 3I4OA 1HZ9A 2EYFA 2QILA 4A3DG 2A6ED 4PG3A 2UXDQ 3K57A 1JB3A 5JPNC 5IYCG 2DUDA 4Y7NB 4I7AA 1L0YB 2VNUD 1TWHB 2KCCA 3C1EA 1O7IA 1X65A 1X32A 1K83H 1STBA 3SK6A 3VR6A 4KKUA 1RJTA 2YTVA 2RHSB 1TS3A 4A3IH 3I3CA 1R4PB 3UDGA 1XX8A 3A8JE 3H09A 5D3IB 1JICA 3ZJYC 4C3HB 3V2TA 2R7FA 5C4JH 4A3IG 3S1RB 2QCPX 3A55A 1QZGA 4LF8Q 3W1BA 4CDDC 2OTJA 2L12A 3FPUB 1YJWA 2EYHA 4DK6C 4AYBE 3MXNB 3AQQA 4H7BA 2L5TA 1IHZA 3OIPA 4CJ0B 5M5YB 4BBSG 2KHSA 4GLVB 1CK1A 2A68C 2L9HA 3E3XA 4DR4Q 1CI3M 1HR0L 3MFGA 2ES2A 1EY6A 4JI5L 4GNXC 1RODA 4HEDA 2VUMH 1EQQA 2NZOA 3M4YA 1N32L 5FJ8H 1EEID 3G4SA 1D1IA 4G57A 1N36Q 1W3SA 2C5CA 2A6HC 5FJ8G 2JA7G 1NR4A 4HTHA 2ZJRA 1BCPC 4JVZA 1F2YA 1EY7A 2FJ2A 2K33A 4HSPA 1E2VA 1SSOA 1SYFA 5A2QE 1KQSA 4JV5L 1HJPA 5C0XI 1VQBA 2VZAA 1V43A 3R2TA 4KHPQ 1UAPA 1I4QA 1D6EC 1I50B 4CBVA 2QGQA 4A76A 4IFDJ 1I94L 1EWCA 2L4NA 3H0GG 4CDEC 1A8VA 4JI8L 4IO9A 3WWVA 3K5OA 4G7HC 3CW2C 1WTRA 1EY8A 5EQ0A 3OWFA 1E7ZA 5KNBA 1XNQQ 1HA5A 3GTMH 2QDBA 3J80i 4RKLA 4B3RQ 2L1BA 5C44H 2L11A 3MA2B 4IALA 1SYBA 1Q12A 4KN4C 4JCVE 5M5XH 2IJ0A 1LO5D 1QNKA 2K03A 2F0IA 1HNWQ 4HCSA 2R7ZG 1KAWA 3HOWH 3BG3A 5GROA 1IBLL 5CV8A 1Q3LA 4R9WA 1OXSC 3CCVA 1WD0A 1DOMA 3J7AV 3K0XA 5JAVA 1ZXTA 5DM73 5C3EG 2BE5C 4DV3Q 5DAUA 1CQFA 1MHWC 1BBXC 2X6LA 1L1OA 2C9OA 2ZJPA 5FLMH 1XMQQ 2NN6H 1HNZQ 2CVRA 5JOBA 4DNTB 4QGUA 4XTCS 5T1IA 2EPBA 1K3BC 1TWGH 3GTPB 5IODA 5J39A 2WAQB 4JI7Q 2E2IH 1JJ2A 4DR6L 5JJZA 1WTWA 1Y8PB 5IP7H 4FXGC 4KTAA 3KDFA 4OWWB 2D62A 2F0VA 5IP7G 1K8MA 1O7ZA 2QEJC 3NUCA 4RWSC 2UXCL 4HSVA 3I8ZA 2ZXPA 2R92B 2E76C 1U9RA 4CDCC 2FMMA 1EOVA 3NWTA 3AMUA 3I4MH 3M4OH 4LWCA 3ERSX 5M5WH 2RSNA 2E5LL 4P74A 3I4MG 3KK7A 3GTOB 3RR5A 4DUYQ 3L3OC 4L5SA 2JA6G 3HOUB 3RLFA 1OTCA 1DONA 1CZGA 1ET6A 5JPMC 4CKEA 2KHIA 4RMFA 3EFXD 3W5OA 4A3MB 3GTKB 1J8IA 1LTID 5CC4A 2F3VA 1U4MA 1P8LA 1STYA 2I0QA 4F7XA 1D5XC 4X62L 2HD3A 4DF7A 2CWAA 3PUWA 2B63H 5C6AA 4NKLA 1HPCA 2FMCA 1SNOA 3BZKA 3C3LA 2L0CA 2JA5B 1SBBB 1KL9A 2KCNA 3NQIA 2R93H 5C4XG 2IWHA 3BVGA 1GO3E 5ELNA 1E24A 3WOEA 3S1MB 2VQFQ 2Q2TA 1N9WA 3CC2A 2R93G 2A19A 4Q0FA 4I65A 1IYVA 4Y7NH 3S2DB 4L5TA 1GOZA 1V1PA 1TWHH 3DEPA 4DFAA 4IQZA 2D5DA 2YYZA 5CV6A 1CHPD 1FNUA 4J6HA 4NB3A 3D6CA 1PTOD 4NPSA 2B2VC 3D4WA 1IBMQ 4JI4L 2E2HB 3P7JA 1RCVD 3EN2A 3T56B 4KY5A 3ERQA 4DR2L 1VQ7A 1BXTA 3U50C 5CGKA 2YV5A 3IAYA 2H4OA 4AYBG 4WRDA 4XQQA 2MQHA 3E9IA 1SE8A 5M5YH 5CV7A 1U4LA 1OO9B 4K0KL 4CKBA 1SJED 5CBAE 1YI2A 2EY5A 1UE6A 2HHHL 2A69D 3MZ5A 3M4PA 1X3GA 3QB3A 1SYDA 1PRTB 4JI3L 5FOBB 1YHQA 3MEFA 1B3QA 3AEVA 1HRJA 2JA8G 2F3WA 1K73C 3G48A 3SK5A 4EQOA 1LTLA 1JOKA 1XPUA 4IZ8A 2XRQD 4OX9L 3MTSA 3G6JB 1E3PA 2PW7A 1D2BA 2XTIA 4M8AA 4GNXA 1TWCB 5G3LF 2PMZB 5AJ3Q 3AFPA 1KC8C 3OSOA 3DM1A 5HURA 4DU9A 2EY6A 4ZLTF 3NTKA 1R9TH 1QOHA 1PH1A 4H0LC 2I5HA 1C8CA 3GTQB 1U4RA 3U4ZA 3BZDB 3HOZB 3EA6A 1GD7A 5BR8L 3VYRA 3S16B 3PSIA 4G7OC 3OOCA 4A3JB 3U9SA 4JOIC 2K75A 1K8OA 5M9OA 4LFBQ 5T1GA 1RF2D 4A3BG 5IYBG 5JVH3 2F4VL 2E74C 1KXLA 3K7AB 3GO5A 3C46A 3DMUA 4L63B 1NE3A 5EKKA 4LUZA 2M9VA 1C48A 2Q2IA 2FINB 5GADC 1QZHA 4X6AH 4K5WA 1KD1C 1A62A 1CUKA 2JEBI 2BDOA 1EZ8A 3Q6SA 1B9MA 1MGSA 5EKLA 4CHTB 4LJZC 4RCNA 1SROA 2QDLA 4FF1A 4BY7B 1QE6A 3CCJA 3Q8DA 2PNRC 2NBFA 5K36G 1X56A 4LF9L 2RVLA 4C3IG 2E2JB 5G3LD 3URYA 2G9DA 3EJIA 2Z0SA 2JJQA 3MXPA 1SNCA 1EY5A 4XQNA 4DUZQ 2HCIA 2NZHA 5IP9H 3BU2A 3J7YW 2KEDA 3GTPH 4RGNA 3NE5B 3FRPB 4UP7A 4DV2Q 4A3DB 1QVFA 4R4OA 1Q8IA 5C5MA 4P73A 5M3FG 3U9OA 3J81c 2ZJQA 3MFYA 1QWYA 2NTTA 3HOVG 2BDNA 2A1AA 3GTGB 1VQNA 1QVCA 2XIWA 2EYJA 3S17B 2R92H 4HIKA 4DAMA 5C4HA 1FR3A 1ML0D 5IYDH 3O13A 1VS0A 5KEEA 1N32Q 2N78A 3PUYA 1UE5A 3K0YA 3A8KE 3MXNA 4TVAB 1FD7D 4CJ2C 2Y0SE 4F87A 3DM3A 4ME3A 2B39A 1FJGL 2Q2HA 3GP7A 3ZYYX 3J81L 5IE8A 1H95A 4OEMB 1SMXA 3A56A 4DAYA 4B3TQ 4OXPA 3HKZB 4JV5Q 2XVSA 3A7AB 1BO0A 1YNND 2IHEA 1G2SA 2HDMA 2FXQA 2F0QA 3VYUA 4R8IA 5E4XA 1ICFB 2E75C 2KVMA 4N8FA 1CM9A 4DV7Q 4LNQA 1I94Q 1HHVA 1HZBA 1JCKB 4DXGA 4JI8Q 1B2TA 3UDIA 2AQ1B 1JJGA 1AW7A 4R8NA 2JA7B 3PGZA 2PYKA 4IJLA 3T16A 2AQ2B 3T1YL 4EQNA 1N33L 1H9SB 1J6QA 3AFQA 3S1NB 1QUQB 4C1NK 2EOTA 1UEBA 3ND9A 2EY2A 4BS9A 1W6JA 1EIYB 4DR7L 4XIGS 2Q2UA 4J8QA 4L8JA 4QIWE 3S2DH 1QJOA 1J5EQ 3QOLA 1LABA 4QQBX 1PTOC 4DV6Q 2F0KA 3RN2A 3H0GB 3V05A 4GKJQ 1ESRA 3EROA 3I4NH 2R3ZA 1IBLQ 2GVAA 1YBYA 2BA1A 3BS1A 4FF3A 5KIXA 4OIJA 2PZWA 3DEOA 1BUVT 3D0FA 1KLGD 5JEAG 1C4QA 1JORA 2IX1A 1E2ZA 1L1OC 2NVQH 2Q8TA 2B2VA 1T5XD 2F0EA 4A3FH 1RTNA 3W2DA 4JW0A 3A5ZB 4HN7A 2A69C 2ZXOA 1E0BA 4R4CA 1B8AA 2D0OA 1XPRA 2EY1A 5JJLA 4IUUA 4ZYSA 2R7ZB 1CSPA 1SLJA 2I5LX 1V9PA 3S15B 1WCMH 2PPBC 1SE3A 3LX0A 5EBDA 4DR6Q 1F9SA 4ODGA 5LHY1 1SXTA 1I6HH 2OT2A 1TY0A 3P75A 4HCEA 3KJPA 2KHJA 4GLAC 5C3EB 1Q7YC 2UXCQ 1N34L 4DV4L 3FP9A 2I5MX 2B2TC 1SRUA 2WB1G 1AN8A 2K50A 1STEA 3N52A 4P71A 3T4AC 4CJ1B 4A3GG 4UP9A 4KK7A 3D3RA 1Y1VB 2K14A 1K9MC 3GTQH 4KY6A 2DNCA 1Q90A 2E5LQ 1QCBD 4LW1A 2KENA 1TQOA 1GHKA 3S16H 3VA7A 4A3JH 1XNRL 3UDXA 3WOFA 1LTSD 4C3JB 3KF8B 3D4DA 4JC0A 4JBKA 3RZOB 3EVQA 3FPPA 3H91A 2HIXA 1G8ZD 2NN6I 3HOXH 1VQEA 1Q81C 2IW3A 4A93G 1X3QA 2J4XA 1KTKA 5E7NA 4UHVA 4L6TB 3CCMA 3VDYA 4GLXA 2F52A 4A3EG 4X3KA 2VB2X 3U58A 1H9RA 2NTSA 3BVZA 1EU4A 2V1CC 4DV0L 5GAGC 5IT9E 2JA6B 1RL2A 4QUCA 3OMGA 3DWPA 1LT3D 1YHAA 4X64L 3K5NA 3CQZH 1Y1WG 1B70B 1FGUA 4ZCKA 3BVMA 2E2JH 5M3MB 4F8MA 3ULJA 1B53A 1YVCA 4QMGA 1VQMA 1Z9FA 3T53B 3CD6A 4K6LA 4AQYL 3OTOL 1WYDA 3UE0A 3HOYH 3Q0AA 1NSNS 4DAPA 5DEHA 3GV3A 1GUNA 3HOYG 1VDZA 2CHBD 3FKIB 1OXTA 2PQAB 2Z4IA 4KD4A 4B9WA 1PMRA 4DR5L 1M90C 4KY7A 5KYLA 1Z7TA 4NXMQ 1AE2A 2UUBL 3GTGH 1GUSA 4P72A 2HCCA 4LF5Q 3X3MA 4NXNL 4TKOB 3MHBA 1PFBA 1II3A 2UUAQ 3RNUA 1HTPA 1PYBA 1JC7A 1E22A 1I4PA 2SDFA 1A15A 4YHHL 4K2LA 3PO3H 1PZKD 3FVQA 4R4IA 5EKIA 3D8GA 4JYAL 2B2UA 3SHLA 2VUMG 1EY9A 2MUYA 1N8RC 1YNNC 2B2WA 3E9HA 2NVXH 3MVVA 1NBWA 2K6AA 2IPKD 4V0BA 3SXHA 1XYIA 4E6IA 1VQHA 4NW2A 1JQYD 1PYSB 3K7UC 4B3ML 1OXXK 3HKSA 2IX0A 4BXXH 2JA8B 4ALPA 2VB3X 3CU7A 1ILPA 3JAME 1NY4A 4JI6L 1C9OA 4WFN3 2NVTB 1A3UA 4OIKA 5FO7B 4GN5A 4PMBA 5GAEC 2MNAA 2EXDA 1HNXL 2F4VQ 4DR1L 1GHJA 2EJFC 4JI2Q 1A3TA 2JK8A 2HUGA 2RDFA 4KD3A 4HJ9A 1JWSD 2RQXA 1RIPA 4P75A 5KRUA 1ZEQX 3TBIB 2NZ1D 4BWGB 1A6XA 4HAEA 2F0LA 5FLXc 5EAYA 2YTXA 2ICEC 1EEFD 3BZCA 2K5HA 3M85A 1LACA 5C44G 1EU3A 1AH9A 4RKBA 1XMOL 4A3BB 4LF9Q 1D8LA 4BA2I 4JPBW 3R93A 2N8NA 3L7ZC 4C2MB 2F0OA 4J1MA 2VQEQ 1TWAH 3HOWG 4BY1B 1EYDA 4OGQC 1SYGA 1TXYA 1UE7A 1DCZA 3OMCA 3H3VC 3KYHC 4K8IA 5DLQE 4LFAQ 4LF7L 4H44C 1LYLA 4GS3A 4XYQA 1PZJD 1HZCA 1S5ED 1D5MC 1CKNA 1Q1EA 3IL8A 4RAUC 5C0XJ 2BA0A 3NBHB 1B44D 3TMEA 2HT1A 5D65A 5FLMG 2NN6G 2XWBB 1MD2D 1SFOB 3HGBA 5JJIA 4FF2A 2EVBA 2WIIB 2QKIC 4PMWA 2WAQE 1R4QB 5IY0A 1RHPA 2A8VA 2DJFC 3A5UA 3PQIA 2EYLA 1QILA 3J80c 4I7ZC 1BR9A 1TT2A 2QF7A 1FJGQ 3KLRA 5GQOA 1PTOF 1VQLA 4JI1Q 4X65L 4XDXA 3HOVB 1PH9A 1IZ6A 1SEBD 2B2TA 4GKKQ 3VA5A 3F2UA 1CA5A 1CKMA 2R7DA 1TS4A 2NVYB 3T1HL 3AU7A 4XYOA 5DM63 3QO2A 2ZTEA 1KHIA 1P16A 3V96A 4GOPA 1B50A 1LV9A 3D31A 1WVLA 1KAAA 2XN9C 1J9OA 2NB0A 4PNYA 4DN4M 2JP1A 1Q86C 3CRKC 3W1GA 3GTJB 2WKCA 4R1JA 5FO9B 3TP6A 3CRLC 3N6RA 2DY8A 4HJ8A 4IFDH 1DYQA 1HFNA 3BYTB 2B8FA 1ONLA 2I07B 3RZDB 2KECA 5ELEA 4DR7Q 1SMYD 5DNFA 1PLFA 3WDNA 3KBGA 3KF6A 2WP8J 1MKHA 2F0MA 4HR7B 4DXFA 2B63G 1KDBA 2OWOA 2K04A 4ULLA 4M1UB 4OO1H 1O7LA 1H9MA 2AMCB 4CKCA 3H3VH 4DK0A 2UXBL 4OO1G 3CCUA 2Z6KC 3RMHA 2KCTA 1K28A 4N9PA 2Z4HA 1TR5A 3AYHB 1GUTA 4OL7A 4FYDA 2ZM6Q 4C3HH 5BN5A 1O7YA 1S5FD 4IURA 1WTHA 3S1RH 2YTYA 1PZID 1MIUA 1HTLD 3C2PA 1F2MA 4DK3C 5IWAQ 1JJCB 3QJYA 3CCRA 2UXDL 3IRBA 1EWHA 4U68A 1YITA 2RKSA 1VQDA 1EQRA 2PW5A 2H1EA 2RHQB 3OW7A 2EJMA 1NNXA 2DN8A 4A3CH 2CQAA 1IYUA 1EUJA 3JAMi 4BBRB 5LMNQ 3FDTA 1CHQD 1KRSA 3OPOA 1IKMA 4UAIA 1N34Q 3EBEA 1SJHD 2O5IC 2XNAC 1YNJD 3QG1A 3STBD 4LF8L 3VYTA 3S2HB 4YWLA 1JOQA 1AFPA 4HIOA 1EY0A 4YY3Q 1S72A 1X3FA 4JI0Q 3CXCA 2LXKA 3M3YB 2IHFA 5I2YA 4P2CB 4WJ4A 4DR4L 1I50H 1IBKQ 1XXGA 3CC4A 3NELA 2EE1A 2MO1A 4POFA 2E2DC 4NMZA 2E8GA 1EFID 3PF4A 2D2CC 2F0WA 1MSHA 2ICIA 2WB1B 1LT6D 3M7GA 3BJUA 3U4VA
chains in the Genus database with same CATH topology
2RHSB 4DV6Q 4B3SL 3RN2A 4A3IH 3RZOH 4GKJQ 3UDGA 1X3EA 3ZJYC 5C4JH 3I4NH 1HH2P 3I7FA 2R7FA 4A3IG 4DV5Q 2GVAA 3PF5A 1IBLQ 3TS2A 1YBYA 2BA1A 2PNHA 3W1BA 4DV0Q 1QZGA 3K8AA 4LF8Q 2OTJA 2XGTA 1UE1A 4AIMA 3J81i 3D0FA 1K0RA 3JC66 1YJWA 4KHPL 4DK6C 4KHZA 2UU9L 4UP8A 4AYBE 5JEAG 3MXNB 3AQQA 2IX1A 3PIPA 1NMFA 1X6OA 1L1OC 2NVQH 3F2BA 4BBSG 4DKAC 4GLVB 3J81j 1SR3A 4A3FH 3T1YQ 1N33Q 4DR4Q 1T9HA 1OXVA 2CKZB 1KIXA 1HR0L 2ES2A 2JA6H 1L0WA 3UDFA 3A5ZB 4BY1H 4JI5L 4GNXC 4JBWA 4R4CA 1NJIC 2VUMH 1B8AA 2D0OA 1XPRA 1IYJB 1PH4A 2ASBA 5JJLA 1EQQA 2NZOA 3I55A 4IFDG 1MJCA 1N32L 1PH6A 3NEMA 1CSPA 1SLJA 2I5LX 1V9PA 5FJ8H 3G4SA 2QA4A 4X66L 5M3MH 1WCMH 3NENA 1N36Q 1W3SA 5FJ8G 3GD7A 2JA7G 4B3RL 3RLOA 4IPCA 4DR6Q 5M3MG 4TQUS 2ZJRA 1JMCA 4A4IA 1Q8KA 4LFCL 1QUQA 4DR5Q 1I6HH 3PUXA 5JEAJ 1Q46A 1VQIA 3PUVA 5IP9G 3KJPA 2KHJA 4GLAC 1KQSA 2UUBQ 4JV5L 1HJPA 5C0XI 1SFOH 1HNWL 1VQBA 2VZAA 1Q7YC 2UXCQ 3FKIH 1N34L 1V43A 4DV4L 1VQ6A 1LUZA 3FP9A 2I5MX 2WAQG 1L1OB 4KHPQ 1SRUA 2WB1G 3FKIG 2D0PA 2K50A 4P71A 5C4XH 1VQOA 4A3GG 2QGQA 4UP9A 4A76A 4IFDJ 3L2PA 1I94L 2K14A 1K9MC 3H0GG 3GTQH 1A8VA 4JI8L 4IO9A 3WWVA 2E5LQ 1A63A 4LW1A 2KENA 3CW2C 3F1ZA 4IOCA 1HR0Q 3S16H 5IT9c 4JI5Q 4YHHQ 1EYGA 4A3JH 1XNRL 1OXUA 3UDXA 2RCNA 4DV3L 1GVPA 4JYAQ 3OYYA 3PCOB 1HR0W 1YNXA 4LF4Q 1E7ZA 2R92G 1XNQQ 3KDFB 3E0EA 2ID0A 3KF8B 2ATWA 1U0LA 2JEAI 3GDEA 5IYDG 4JC0A 4JBKA 3GTMH 4LF6Q 2B3GA 3J80i 5LMUQ 4B3RQ 2OQ0A 2VW9A 5C44H 2HIXA 3GTOH 2NN6I 3KLWA 4APVA 2B29A 3HOXH 1VQEA 1Q81C 3HOUH 4A93G 5E7NA 1Q12A 1IXRA 1CKOA 4A3CG 3KOJA 5C0XG 4JCVE 5M5XH 1VQKA 3CCMA 3VDYA 4H02A 1HNWQ 4GLXA 1PH5A 2F52A 2VL6A 1BBWA 2MFIA 1KAWA 4PZ7A 4A3EG 4GN3B 3GTJH 4DV4Q 5GROA 3U58A 1IBLL 3HOWH 4JI6Q 1PFSA 1PH3A 1C7YA 4NXML 2V1CC 4DV0L 4A3MH 3GTKH 5GAGC 1L2FA 3HKZE 4HIDA 1RL2A 4LF5L 1OXSC 4EX5A 2HIVA 4AH6A 2AHOB 3CCVA 1YHAA 4DR1Q 4X64L 3CQZH 1Y1WG 1B70B 1FGUA 2JA8H 3K0XA 2UUAL 3M7NA 5C3EG 2E2JH 1XNRQ 2PMZE 2NVTH 3ULJA 4DV3Q 1YVCA 1VQMA 1W2BA 3ULPA 2JA5H 1L1OA 1V1QA 1Z9FA 3L0OA 2ZJPA 4DUYL 1JB7A 1VQ5A 5FLMH 1XMQQ 3CD6A 3TREA 1HNZQ 3S1MH 4AQYL 3OTOL 1WYDA 5H1SE 4XTCS 4QGUA 3UE0A 3HOYH 1TWFH 3CCLA 1TWGH 2ZTCA 1PVOA 1N36L 3HOYG 2K5VA 4JI7Q 2E2IH 1JJ2A 4UY8C 1OXTA 2PQAB 4DR6L 4J15A 1X54A 3CCQA 4PZ6A 4DR5L 5IP7H 2E2HH 1M90C 3KDFA 2WB1E 4OWWB 2D62A 2AKWB 2EIFA 5IP7G 4NXMQ 1AE2A 4O2DA 2UUBL 3I4NG 3GTGH 4P72A 2GN5A 2UXCL 1WOCA 4UPAA 4LF5Q 4JBJA 4NXNL 2Z6KA 1Z47A 4X64Q 4A3BH 4QY7A 1FL0A 1KRTA 5IYBH 3HOVG 1EOVA 2R6GA 2UUAQ 3RNUA 1S3OA 3I4MH 4LWCA 3ERSX 5M5WH 3ULLA 5HY6A 1X9NA 3M4OH 3JAMc 4C2MH 4LF7Q 1K8GA 4OWTB 4P74A 2E5LL 1PYBA 4JI2L 1E22A 3I4MG 5GAHC 4YHHL 3RR5A 4DUYQ 4A3FG 1UWVA 3PO3H 4L5SA 2MO0A 2JA6G 1YHBA 4Y52H 4BY1G 2ZTDA 4R4IA 3OTOQ 4AQYQ 4JYAL 3RLFA 3ICEA 2N3SA 4LF4L 2VUMG 1OTCA 1XNQL 4DR3Q 1EFWA 4LUOA 1N8RC 2KHIA 4LF6L 5LMUL 3E9HA 4OWXB 3I2ZA 4RMFA 2NVXH 1NBWA 4A3LH 1NMGA 1WCMG 2F3IA 2PI2A 3W5OA 1I5FA 3STBC 4A3LG 4YCVA 1VQHA 3CC7A 1P8LA 1WI5A 2I0QA 1PYSB 3K7UC 3KJOA 4B3ML 1TWCH 1OXXK 2VY3A 2IX0A 1K3RA 3HKSA 4C3IH 4X62L 4BXXH 4ALPA 2CWAA 1GKHA 3PUWA 3UE1A 1ASZA 4HJAA 2B63H 1NY4A 4JI6L 1C9OA 4NXNQ 1CKNB 2VQEL 3BZKA 4GN5A 5GAEC 3M4QA 2PQAA 2MNAA 1KL9A 3CPFA 2EXDA 1HNXL 2R93H 4X65Q 5C4XG 1GO3E 5ELNA 1E24A 4GNXB 2N49A 4DR1L 2VQFQ 4GOPC 3I56A 2F4VQ 3HOZH 2KCMA 4JI2Q 4IPGA 1N9WA 2JK8A 4HJ9A 2A19A 2Q2TA 3CC2A 2R93G 4RG1A 4Y7NH 3HOZG 4L5TA 1RIPA 4LFAL 1TWHH 4P75A 5M3FH 1XJVA 1XPOA 1K8AC 4POGA 4A3JG 2YYZA 4R4QA 4OONA 4NB3A 3A0JA 2OTLA 1XMQL 3HOVH 1IBMQ 4NPSA 1HNZL 1WFQA 4JI4L 2K5NA 5FLXc 5EAYA 4A3KH 3EN2A 1MJEA 2YTXA 3K7AH 4IOAA 3BZCA 2NVYH 3EIVA 4GN4B 2K5HA 3M85A 4DR2L 1VQ7A 3U50C 5C44G 4L5QA 4JG2A 4JI7L 1AH9A 2YV5A 3HOXG 4AYBG 3HOUG 2BH2A 4B3MQ 3J7ZC 3K80C 1XMOL 4X62Q 1Y14B 2MQHA 3E9IA 1BBUA 4LF9Q 1D8LA 4BA2I 1SE8A 1HZAA 2N8NA 4YWKA 3L7ZC 5M5YH 1VQ9A 1JT8A 2BH8A 3PV0A 4K0KL 2VQEQ 1TWAH 3A74A 4HJ5A 4GOPB 4DV1Q 1YI2A 3HOWG 4A75A 3S14H 4A3MG 1HNXQ 1TXYA 1UE6A 2HHHL 4BY7H 1XTDA 1UE7A 2OCEA 1AE3A 1G291 3M4PA 4EQ5A 3KYHC 3PO2H 3RZDH 1X3GA 1PH2A 5DLQE 4JI3L 1YHQA 4BY7G 4R4TA 2R7ZG 4LFBL 4JI1L 1Q82C 2UXBQ 1IL2A 4LFAQ 3MEFA 3AEVA 3CCEA 2JA8G 4LF7L 4GKKL 1LYLA 4GS3A 1K73C 3G48A 1HZCA 4MNOA 1LTLA 1CKNA 1XPUA 1Q1EA 5C0XJ 4JI4Q 4OX9L 2JA5G 2PI2E 2BA0A 3FHWA 3NBHB 1E3PA 3CF5A 1U5KA 2XTIA 3G71A 1PH7A 2HT1A 5FLMG 3F2DA 2NN6G 4GNXA 5AJ3Q 4DR3L 3KFUA 3AFPA 4DR2Q 1KC8C 3TEHB 3KF6B 5JJIA 4A3DH 1X55A 2CCZA 1R9TH 1XMOQ 1PH1A 2CQOA 2I5HA 4PMWA 2WAQE 5IY0A 2YU9H 5IYCH 3U4ZA 3OW2A 1M1KC 2A8VA 4K0KQ 1EWIA 3A5UA 1PA6A 1YEZA 5HGQA 2DGYA 1GD7A 5BR8L 1C0AA 2IY5B 3J80c 3PSIA 4PZ8A 5J3BA 2UUCQ 3S1QH 4IFDI 2HHHQ 1FJGQ 5GQOA 4JOIC 4JBMA 1FVIA 2K75A 1VQLA 3S17H 2ALYB 3TRZA 4JI3Q 4DUZL 4LFBQ 4JI1Q 4X65L 4A3BG 5IYBG 2C35B 3G6EA 1PH9A 2Y0SG 1I3QH 1IZ6A 2VQFL 1VQ8A 2F4VL 4GKKQ 3CMEA 3CCSA 1CKMA 4IPHA 1KXLA 3PIOA 3GO5A 2R7DA 1PHJA 1YJ9A 3T1HL 2CWPA 3CPWA 2ZTEA 1KHIA 1NE3A 1P16A 4GOPA 4OO1I 4OX9Q 1NTGA 3D31A 4DV2L 3PO3G 3H3VI 4LUZA 1VQPA 5JJKA 2Q2IA 2EQSA 1IBML 4BBRH 5GADC 1QZHA 4X6AH 1Q86C 4BBSH 1KD1C 3W1GA 1QVGA 1DGSA 1A62A 2VS1A 2ZM6L 3DLLA 1CUKA 2KBNA 4R1JA 3TQYA 4BBRG 2JEBI 1VQFA 3HKZG 4DNIA 3J7A5 4LUVA 2L15A 3S2HH 2K4KA 2JQOA 1SROA 1BKBA 3CCJA 3Q8DA 4O0AA 4HJ8A 4DAYB 1LM0A 1SN8A 1VCIA 5IWAL 5K36G 1X56A 4LF9L 5BR8Q 4DR7Q 3M3YH 3K81C 4BXXG 3KF6A 2JA7H 2WP8J 2Z0SA 2JJQA 1S40A 1MKHA 4DV1L 2B63G 4YWMA 1D7QA 3GTLH 3LGJA 4DUZQ 2OWOA 3S1NH 2NZHA 4FDBA 4B3SQ 1PH8A 5IP9H 3BU2A 2AMCB 4DPGA 3H3VH 3B6YA 2UXBL 4KLKA 3T1HQ 4B3TL 4OO1G 2RF4A 1VQAA 3CCUA 2Z6KC 5LMNL 1VQ4A 1G6PA 3GTPH 2KCTA 4UP7A 4DV2Q 2LSSA 4R4OA 1QVFA 4A3GH 4P73A 5M3FG 1CSQA 2HQLA 2K52A 1EIFA 3AYHB 3RLNA 3J81c 2LXJA 2QEXA 2UU9Q 2CFMA 2ZJQA 3H0GH 4L5RC 3H15A 3M9BA 2ZM6Q 1JE5A 2A1AA 4DV7L 2GVBA 4MTNA 4MZ9A 4C3HH 5AJ3L 4A3KG 3S1RH 4YY3L 3TS0A 1VQNA 4JI0L 2YTYA 4KI0A 1A0IA 1MIUA 1QVCA 4YCUA 3CAMA 4DK3C 5IWAQ 4DAMA 1JJCB 4HIKA 2R92H 3F8TA 1ASYA 1G51A 5IYDH 3CCRA 1VS0A 1IBKL 2UXDL 3IRBA 1PV4A 1N32Q 1YIJA 2N78A 3CP0A 1YITA 3PUYA 1UE5A 3SGIA 1Q1BA 1VQDA 1VQJA 4TVAB 4X66Q 1EQRA 1E1OA 1E1TA 2RHQB 2Y0SE 2UUCL 3DM3A 4ME3A 4A93H 4YCWA 1FJGL 2Q2HA 2JE6I 1J5EL 5IE8A 1B7YB 3PUZA 4LFCQ 4A3CH 1H95A 1SMXA 1YZ6A 4IPDA 1EUJA 4B3TQ 4OXPA 3JAMi 1WJJA 4A3EH 2R7ZH 3PO2G 5LMNQ 4JOIA 4DV6L 4JV5Q 3S15H 4GKJL 1KRSA 5ELOA 2IHEA 1N34Q 3EBEA 4DV5L 4BA1I 2FXQA 1VQCA 3STBD 5LMNW 4LF8L 4QJFA 4YWLA 4WJ3M 2JA9A 2AWOA 4QL5A 4IJHA 4HIOA 4HIMA 4DV7Q 4LNQA 1Y1WH 1I94Q 1HZBA 4YY3Q 1S72A 1X3FA 3CMAA 4JI0Q 4JI8Q 3UDIA 3HFZB 3CXCA 5C3EH 2LXKA 1JJGA 3RN5A 3ER0A 2IHFA 3I4OA 1HZ9A 3PGZA 4IJLA 4A3DG 1BVSA 4WJ4A 3T1YL 1I50H 1VQGA 1N33L 4DR4L 1J6QA 3AFQA 1IBKQ 1QUQB 4PG3A 2UXDQ 3S24A 3F2CA 2AWNA 2H5XA 3CC4A 1UEBA 1Y1VH 2IT1A 1GM5A 3NELA 2MO1A 5IYCG 2DUDA 4POFA 4HJ7A 1EIYB 2OQKA 1Y1VG 4DR7L 2WFWA 2E8GA 4XIGS 2Q2UA 3PF4A 2VNUD 4QIWE 1YJNA 3S2DH 1O7IA 1J5EQ 1X65A 1K83H 3BJUA 4C3JH 3U4VA 4QQBX 2YTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHS B;  4DV6 Q;  4B3S L;  3RN2 A;  4A3I H;  3RZO H;  4GKJ Q;  3UDG A;  1X3E A;  3ZJY C;  5C4J H;  3I4N H;  1HH2 P;  3I7F A;  2R7F A;  4A3I G;  4DV5 Q;  2GVA A;  3PF5 A;  1IBL Q;  3TS2 A;  1YBY A;  2BA1 A;  2PNH A;  3W1B A;  4DV0 Q;  1QZG A;  3K8A A;  4LF8 Q;  2OTJ A;  2XGT A;  1UE1 A;  4AIM A;  3J81 i;  3D0F A;  1K0R A;  3JC6 6;  1YJW A;  4KHP L;  4DK6 C;  4KHZ A;  2UU9 L;  4UP8 A;  4AYB E;  5JEA G;  3MXN B;  3AQQ A;  2IX1 A;  3PIP A;  1NMF A;  1X6O A;  1L1O C;  2NVQ H;  3F2B A;  4BBS G;  4DKA C;  4GLV B;  3J81 j;  1SR3 A;  4A3F H;  3T1Y Q;  1N33 Q;  4DR4 Q;  1T9H A;  1OXV A;  2CKZ B;  1KIX A;  1HR0 L;  2ES2 A;  2JA6 H;  1L0W A;  3UDF A;  3A5Z B;  4BY1 H;  4JI5 L;  4GNX C;  4JBW A;  4R4C A;  1NJI C;  2VUM H;  1B8A A;  2D0O A;  1XPR A;  1IYJ B;  1PH4 A;  2ASB A;  5JJL A;  1EQQ A;  2NZO A;  3I55 A;  4IFD G;  1MJC A;  1N32 L;  1PH6 A;  3NEM A;  1CSP A;  1SLJ A;  2I5L X;  1V9P A;  5FJ8 H;  3G4S A;  2QA4 A;  4X66 L;  5M3M H;  1WCM H;  3NEN A;  1N36 Q;  1W3S A;  5FJ8 G;  3GD7 A;  2JA7 G;  4B3R L;  3RLO A;  4IPC A;  4DR6 Q;  5M3M G;  4TQU S;  2ZJR A;  1JMC A;  4A4I A;  1Q8K A;  4LFC L;  1QUQ A;  4DR5 Q;  1I6H H;  3PUX A;  5JEA J;  1Q46 A;  1VQI A;  3PUV A;  5IP9 G;  3KJP A;  2KHJ A;  4GLA C;  1KQS A;  2UUB Q;  4JV5 L;  1HJP A;  5C0X I;  1SFO H;  1HNW L;  1VQB A;  2VZA A;  1Q7Y C;  2UXC Q;  3FKI H;  1N34 L;  1V43 A;  4DV4 L;  1VQ6 A;  1LUZ A;  3FP9 A;  2I5M X;  2WAQ G;  1L1O B;  4KHP Q;  1SRU A;  2WB1 G;  3FKI G;  2D0P A;  2K50 A;  4P71 A;  5C4X H;  1VQO A;  4A3G G;  2QGQ A;  4UP9 A;  4A76 A;  4IFD J;  3L2P A;  1I94 L;  2K14 A;  1K9M C;  3H0G G;  3GTQ H;  1A8V A;  4JI8 L;  4IO9 A;  3WWV A;  2E5L Q;  1A63 A;  4LW1 A;  2KEN A;  3CW2 C;  3F1Z A;  4IOC A;  1HR0 Q;  3S16 H;  5IT9 c;  4JI5 Q;  4YHH Q;  1EYG A;  4A3J H;  1XNR L;  1OXU A;  3UDX A;  2RCN A;  4DV3 L;  1GVP A;  4JYA Q;  3OYY A;  3PCO B;  1HR0 W;  1YNX A;  4LF4 Q;  1E7Z A;  2R92 G;  1XNQ Q;  3KDF B;  3E0E A;  2ID0 A;  3KF8 B;  2ATW A;  1U0L A;  2JEA I;  3GDE A;  5IYD G;  4JC0 A;  4JBK A;  3GTM H;  4LF6 Q;  2B3G A;  3J80 i;  5LMU Q;  4B3R Q;  2OQ0 A;  2VW9 A;  5C44 H;  2HIX A;  3GTO H;  2NN6 I;  3KLW A;  4APV A;  2B29 A;  3HOX H;  1VQE A;  1Q81 C;  3HOU H;  4A93 G;  5E7N A;  1Q12 A;  1IXR A;  1CKO A;  4A3C G;  3KOJ A;  5C0X G;  4JCV E;  5M5X H;  1VQK A;  3CCM A;  3VDY A;  4H02 A;  1HNW Q;  4GLX A;  1PH5 A;  2F52 A;  2VL6 A;  1BBW A;  2MFI A;  1KAW A;  4PZ7 A;  4A3E G;  4GN3 B;  3GTJ H;  4DV4 Q;  5GRO A;  3U58 A;  1IBL L;  3HOW H;  4JI6 Q;  1PFS A;  1PH3 A;  1C7Y A;  4NXM L;  2V1C C;  4DV0 L;  4A3M H;  3GTK H;  5GAG C;  1L2F A;  3HKZ E;  4HID A;  1RL2 A;  4LF5 L;  1OXS C;  4EX5 A;  2HIV A;  4AH6 A;  2AHO B;  3CCV A;  1YHA A;  4DR1 Q;  4X64 L;  3CQZ H;  1Y1W G;  1B70 B;  1FGU A;  2JA8 H;  3K0X A;  2UUA L;  3M7N A;  5C3E G;  2E2J H;  1XNR Q;  2PMZ E;  2NVT H;  3ULJ A;  4DV3 Q;  1YVC A;  1VQM A;  1W2B A;  3ULP A;  2JA5 H;  1L1O A;  1V1Q A;  1Z9F A;  3L0O A;  2ZJP A;  4DUY L;  1JB7 A;  1VQ5 A;  5FLM H;  1XMQ Q;  3CD6 A;  3TRE A;  1HNZ Q;  3S1M H;  4AQY L;  3OTO L;  1WYD A;  5H1S E;  4XTC S;  4QGU A;  3UE0 A;  3HOY H;  1TWF H;  3CCL A;  1TWG H;  2ZTC A;  1PVO A;  1N36 L;  3HOY G;  2K5V A;  4JI7 Q;  2E2I H;  1JJ2 A;  4UY8 C;  1OXT A;  2PQA B;  4DR6 L;  4J15 A;  1X54 A;  3CCQ A;  4PZ6 A;  4DR5 L;  5IP7 H;  2E2H H;  1M90 C;  3KDF A;  2WB1 E;  4OWW B;  2D62 A;  2AKW B;  2EIF A;  5IP7 G;  4NXM Q;  1AE2 A;  4O2D A;  2UUB L;  3I4N G;  3GTG H;  4P72 A;  2GN5 A;  2UXC L;  1WOC A;  4UPA A;  4LF5 Q;  4JBJ A;  4NXN L;  2Z6K A;  1Z47 A;  4X64 Q;  4A3B H;  4QY7 A;  1FL0 A;  1KRT A;  5IYB H;  3HOV G;  1EOV A;  2R6G A;  2UUA Q;  3RNU A;  1S3O A;  3I4M H;  4LWC A;  3ERS X;  5M5W H;  3ULL A;  5HY6 A;  1X9N A;  3M4O H;  3JAM c;  4C2M H;  4LF7 Q;  1K8G A;  4OWT B;  4P74 A;  2E5L L;  1PYB A;  4JI2 L;  1E22 A;  3I4M G;  5GAH C;  4YHH L;  3RR5 A;  4DUY Q;  4A3F G;  1UWV A;  3PO3 H;  4L5S A;  2MO0 A;  2JA6 G;  1YHB A;  4Y52 H;  4BY1 G;  2ZTD A;  4R4I A;  3OTO Q;  4AQY Q;  4JYA L;  3RLF A;  3ICE A;  2N3S A;  4LF4 L;  2VUM G;  1OTC A;  1XNQ L;  4DR3 Q;  1EFW A;  4LUO A;  1N8R C;  2KHI A;  4LF6 L;  5LMU L;  3E9H A;  4OWX B;  3I2Z A;  4RMF A;  2NVX H;  1NBW A;  4A3L H;  1NMG A;  1WCM G;  2F3I A;  2PI2 A;  3W5O A;  1I5F A;  3STB C;  4A3L G;  4YCV A;  1VQH A;  3CC7 A;  1P8L A;  1WI5 A;  2I0Q A;  1PYS B;  3K7U C;  3KJO A;  4B3M L;  1TWC H;  1OXX K;  2VY3 A;  2IX0 A;  1K3R A;  3HKS A;  4C3I H;  4X62 L;  4BXX H;  4ALP A;  2CWA A;  1GKH A;  3PUW A;  3UE1 A;  1ASZ A;  4HJA A;  2B63 H;  1NY4 A;  4JI6 L;  1C9O A;  4NXN Q;  1CKN B;  2VQE L;  3BZK A;  4GN5 A;  5GAE C;  3M4Q A;  2PQA A;  2MNA A;  1KL9 A;  3CPF A;  2EXD A;  1HNX L;  2R93 H;  4X65 Q;  5C4X G;  1GO3 E;  5ELN A;  1E24 A;  4GNX B;  2N49 A;  4DR1 L;  2VQF Q;  4GOP C;  3I56 A;  2F4V Q;  3HOZ H;  2KCM A;  4JI2 Q;  4IPG A;  1N9W A;  2JK8 A;  4HJ9 A;  2A19 A;  2Q2T A;  3CC2 A;  2R93 G;  4RG1 A;  4Y7N H;  3HOZ G;  4L5T A;  1RIP A;  4LFA L;  1TWH H;  4P75 A;  5M3F H;  1XJV A;  1XPO A;  1K8A C;  4POG A;  4A3J G;  2YYZ A;  4R4Q A;  4OON A;  4NB3 A;  3A0J A;  2OTL A;  1XMQ L;  3HOV H;  1IBM Q;  4NPS A;  1HNZ L;  1WFQ A;  4JI4 L;  2K5N A;  5FLX c;  5EAY A;  4A3K H;  3EN2 A;  1MJE A;  2YTX A;  3K7A H;  4IOA A;  3BZC A;  2NVY H;  3EIV A;  4GN4 B;  2K5H A;  3M85 A;  4DR2 L;  1VQ7 A;  3U50 C;  5C44 G;  4L5Q A;  4JG2 A;  4JI7 L;  1AH9 A;  2YV5 A;  3HOX G;  4AYB G;  3HOU G;  2BH2 A;  4B3M Q;  3J7Z C;  3K80 C;  1XMO L;  4X62 Q;  1Y14 B;  2MQH A;  3E9I A;  1BBU A;  4LF9 Q;  1D8L A;  4BA2 I;  1SE8 A;  1HZA A;  2N8N A;  4YWK A;  3L7Z C;  5M5Y H;  1VQ9 A;  1JT8 A;  2BH8 A;  3PV0 A;  4K0K L;  2VQE Q;  1TWA H;  3A74 A;  4HJ5 A;  4GOP B;  4DV1 Q;  1YI2 A;  3HOW G;  4A75 A;  3S14 H;  4A3M G;  1HNX Q;  1TXY A;  1UE6 A;  2HHH L;  4BY7 H;  1XTD A;  1UE7 A;  2OCE A;  1AE3 A;  1G29 1;  3M4P A;  4EQ5 A;  3KYH C;  3PO2 H;  3RZD H;  1X3G A;  1PH2 A;  5DLQ E;  4JI3 L;  1YHQ A;  4BY7 G;  4R4T A;  2R7Z G;  4LFB L;  4JI1 L;  1Q82 C;  2UXB Q;  1IL2 A;  4LFA Q;  3MEF A;  3AEV A;  3CCE A;  2JA8 G;  4LF7 L;  4GKK L;  1LYL A;  4GS3 A;  1K73 C;  3G48 A;  1HZC A;  4MNO A;  1LTL A;  1CKN A;  1XPU A;  1Q1E A;  5C0X J;  4JI4 Q;  4OX9 L;  2JA5 G;  2PI2 E;  2BA0 A;  3FHW A;  3NBH B;  1E3P A;  3CF5 A;  1U5K A;  2XTI A;  3G71 A;  1PH7 A;  2HT1 A;  5FLM G;  3F2D A;  2NN6 G;  4GNX A;  5AJ3 Q;  4DR3 L;  3KFU A;  3AFP A;  4DR2 Q;  1KC8 C;  3TEH B;  3KF6 B;  5JJI A;  4A3D H;  1X55 A;  2CCZ A;  1R9T H;  1XMO Q;  1PH1 A;  2CQO A;  2I5H A;  4PMW A;  2WAQ E;  5IY0 A;  2YU9 H;  5IYC H;  3U4Z A;  3OW2 A;  1M1K C;  2A8V A;  4K0K Q;  1EWI A;  3A5U A;  1PA6 A;  1YEZ A;  5HGQ A;  2DGY A;  1GD7 A;  5BR8 L;  1C0A A;  2IY5 B;  3J80 c;  3PSI A;  4PZ8 A;  5J3B A;  2UUC Q;  3S1Q H;  4IFD I;  2HHH Q;  1FJG Q;  5GQO A;  4JOI C;  4JBM A;  1FVI A;  2K75 A;  1VQL A;  3S17 H;  2ALY B;  3TRZ A;  4JI3 Q;  4DUZ L;  4LFB Q;  4JI1 Q;  4X65 L;  4A3B G;  5IYB G;  2C35 B;  3G6E A;  1PH9 A;  2Y0S G;  1I3Q H;  1IZ6 A;  2VQF L;  1VQ8 A;  2F4V L;  4GKK Q;  3CME A;  3CCS A;  1CKM A;  4IPH A;  1KXL A;  3PIO A;  3GO5 A;  2R7D A;  1PHJ A;  1YJ9 A;  3T1H L;  2CWP A;  3CPW A;  2ZTE A;  1KHI A;  1NE3 A;  1P16 A;  4GOP A;  4OO1 I;  4OX9 Q;  1NTG A;  3D31 A;  4DV2 L;  3PO3 G;  3H3V I;  4LUZ A;  1VQP A;  5JJK A;  2Q2I A;  2EQS A;  1IBM L;  4BBR H;  5GAD C;  1QZH A;  4X6A H;  1Q86 C;  4BBS H;  1KD1 C;  3W1G A;  1QVG A;  1DGS A;  1A62 A;  2VS1 A;  2ZM6 L;  3DLL A;  1CUK A;  2KBN A;  4R1J A;  3TQY A;  4BBR G;  2JEB I;  1VQF A;  3HKZ G;  4DNI A;  3J7A 5;  4LUV A;  2L15 A;  3S2H H;  2K4K A;  2JQO A;  1SRO A;  1BKB A;  3CCJ A;  3Q8D A;  4O0A A;  4HJ8 A;  4DAY B;  1LM0 A;  1SN8 A;  1VCI A;  5IWA L;  5K36 G;  1X56 A;  4LF9 L;  5BR8 Q;  4DR7 Q;  3M3Y H;  3K81 C;  4BXX G;  3KF6 A;  2JA7 H;  2WP8 J;  2Z0S A;  2JJQ A;  1S40 A;  1MKH A;  4DV1 L;  2B63 G;  4YWM A;  1D7Q A;  3GTL H;  3LGJ A;  4DUZ Q;  2OWO A;  3S1N H;  2NZH A;  4FDB A;  4B3S Q;  1PH8 A;  5IP9 H;  3BU2 A;  2AMC B;  4DPG A;  3H3V H;  3B6Y A;  2UXB L;  4KLK A;  3T1H Q;  4B3T L;  4OO1 G;  2RF4 A;  1VQA A;  3CCU A;  2Z6K C;  5LMN L;  1VQ4 A;  1G6P A;  3GTP H;  2KCT A;  4UP7 A;  4DV2 Q;  2LSS A;  4R4O A;  1QVF A;  4A3G H;  4P73 A;  5M3F G;  1CSQ A;  2HQL A;  2K52 A;  1EIF A;  3AYH B;  3RLN A;  3J81 c;  2LXJ A;  2QEX A;  2UU9 Q;  2CFM A;  2ZJQ A;  3H0G H;  4L5R C;  3H15 A;  3M9B A;  2ZM6 Q;  1JE5 A;  2A1A A;  4DV7 L;  2GVB A;  4MTN A;  4MZ9 A;  4C3H H;  5AJ3 L;  4A3K G;  3S1R H;  4YY3 L;  3TS0 A;  1VQN A;  4JI0 L;  2YTY A;  4KI0 A;  1A0I A;  1MIU A;  1QVC A;  4YCU A;  3CAM A;  4DK3 C;  5IWA Q;  4DAM A;  1JJC B;  4HIK A;  2R92 H;  3F8T A;  1ASY A;  1G51 A;  5IYD H;  3CCR A;  1VS0 A;  1IBK L;  2UXD L;  3IRB A;  1PV4 A;  1N32 Q;  1YIJ A;  2N78 A;  3CP0 A;  1YIT A;  3PUY A;  1UE5 A;  3SGI A;  1Q1B A;  1VQD A;  1VQJ A;  4TVA B;  4X66 Q;  1EQR A;  1E1O A;  1E1T A;  2RHQ B;  2Y0S E;  2UUC L;  3DM3 A;  4ME3 A;  4A93 H;  4YCW A;  1FJG L;  2Q2H A;  2JE6 I;  1J5E L;  5IE8 A;  1B7Y B;  3PUZ A;  4LFC Q;  4A3C H;  1H95 A;  1SMX A;  1YZ6 A;  4IPD A;  1EUJ A;  4B3T Q;  4OXP A;  3JAM i;  1WJJ A;  4A3E H;  2R7Z H;  3PO2 G;  5LMN Q;  4JOI A;  4DV6 L;  4JV5 Q;  3S15 H;  4GKJ L;  1KRS A;  5ELO A;  2IHE A;  1N34 Q;  3EBE A;  4DV5 L;  4BA1 I;  2FXQ A;  1VQC A;  3STB D;  5LMN W;  4LF8 L;  4QJF A;  4YWL A;  4WJ3 M;  2JA9 A;  2AWO A;  4QL5 A;  4IJH A;  4HIO A;  4HIM A;  4DV7 Q;  4LNQ A;  1Y1W H;  1I94 Q;  1HZB A;  4YY3 Q;  1S72 A;  1X3F A;  3CMA A;  4JI0 Q;  4JI8 Q;  3UDI A;  3HFZ B;  3CXC A;  5C3E H;  2LXK A;  1JJG A;  3RN5 A;  3ER0 A;  2IHF A;  3I4O A;  1HZ9 A;  3PGZ A;  4IJL A;  4A3D G;  1BVS A;  4WJ4 A;  3T1Y L;  1I50 H;  1VQG A;  1N33 L;  4DR4 L;  1J6Q A;  3AFQ A;  1IBK Q;  1QUQ B;  4PG3 A;  2UXD Q;  3S24 A;  3F2C A;  2AWN A;  2H5X A;  3CC4 A;  1UEB A;  1Y1V H;  2IT1 A;  1GM5 A;  3NEL A;  2MO1 A;  5IYC G;  2DUD A;  4POF A;  4HJ7 A;  1EIY B;  2OQK A;  1Y1V G;  4DR7 L;  2WFW A;  2E8G A;  4XIG S;  2Q2U A;  3PF4 A;  2VNU D;  4QIW E;  1YJN A;  3S2D H;  1O7I A;  1J5E Q;  1X65 A;  1K83 H;  3BJU A;  4C3J H;  3U4V A;  4QQB X;  2YTV A; 
#chains in the Genus database with same CATH topology
 3I4L A;  4A3K B;  2SNM A;  1Y8O B;  1HH2 P;  4DV5 Q;  5C3X A;  4DV0 Q;  3K8A A;  2XGT A;  1UE1 A;  4QUF A;  5COR A;  3J81 i;  4H13 C;  2MP1 A;  4KHP L;  4ZRZ A;  2UU9 L;  4UP8 A;  2Z6B A;  4X3S A;  4DA2 A;  4K8J A;  3K58 A;  1X6O A;  2K05 A;  3F2B A;  3J81 j;  1SR3 A;  3TZD A;  1DOL A;  1T9H A;  3S14 B;  4G4K A;  4A93 B;  3TDQ A;  1L0W A;  3UDF A;  4BY1 H;  1NJI C;  3PO2 B;  2O2L D;  3HRZ C;  1PH4 A;  1QB5 D;  2KQ3 A;  2WKD A;  4A3E B;  1PH6 A;  3NEM A;  2A5H A;  4X66 L;  3NEN A;  3PIO 3;  4Z9C B;  3GD7 A;  4B3R L;  3RLO A;  2MJ8 A;  4IPC A;  4TQU S;  4A4I A;  3I70 A;  2VXW A;  4DR5 Q;  3PUX A;  5JEA J;  2CH4 A;  1Y1W B;  1Q46 A;  1VQI A;  4WJW A;  5IP9 G;  1I4G A;  2SOB A;  2UUB Q;  4ZAI A;  1SFO H;  1HNW L;  1VF7 A;  4ZUJ A;  5FKA C;  1DZ1 A;  1Y69 U;  1LUZ A;  1MI2 A;  1CZW A;  2WAQ G;  1L1O B;  2SEB D;  3R3O A;  1VQO A;  2YU9 B;  3BDO A;  3DWA A;  1XWE A;  2B2U C;  3KLS A;  1LTG D;  1HR0 Q;  1RDP D;  3R2I A;  4JI5 Q;  4YHH Q;  1EYG A;  1G2T A;  1H9J A;  2TMP A;  1OXU A;  2RCN A;  4DV3 L;  1GVP A;  2B2W C;  4JYA Q;  1STN A;  3PCO B;  3LWU A;  2R92 G;  1XTC D;  3KDF B;  1F9Q A;  3E0E A;  4A3I B;  4O42 A;  1U0L A;  3Q22 A;  3GDE A;  5IYD G;  2ATW A;  2F0U A;  2OQ0 A;  3GTO H;  4ZQ3 A;  2B29 A;  2PQE A;  1PXU A;  3HOU H;  5EBC A;  1IXR A;  1CKO A;  1MBY A;  3KOJ A;  3NHH A;  4BBS B;  1VQK A;  1PH5 A;  2VL6 A;  1IKL A;  3GTJ H;  1IL8 A;  4JI6 Q;  2NUC A;  1PFS A;  4FNF A;  1PH3 A;  1C7Y A;  4A3M H;  5IGF A;  3GTK H;  1L2F A;  3HKZ E;  2I46 A;  4EX5 A;  4NDX A;  1GXD C;  2G9H D;  2HIV A;  4AH6 A;  4DR1 Q;  3MWY W;  2CW0 C;  5TSS A;  1SMY C;  3TP5 A;  5NUC A;  2N55 A;  3OHX C;  4RFB A;  3T51 B;  1B3A A;  3M7N A;  1X3P A;  3GTL B;  5IIF A;  1BF4 A;  1W2B A;  2B8G A;  2JA5 H;  2JYO A;  3L0O A;  4DUY L;  1VQ5 A;  1CTM A;  4FF4 A;  3TRE A;  1BNZ A;  3S1M H;  1ZYR D;  2V4D A;  3I90 A;  5COY A;  2ZTC A;  1FNV A;  1PVO A;  1X54 A;  4KJO A;  3CCQ A;  2E2H H;  2JSO A;  1VMC A;  2EIF A;  3I4N G;  3IKJ A;  1NCV A;  1V1P B;  2GN5 A;  1WOC A;  4FXK C;  2Z6K A;  4QY7 A;  2R6G A;  4EGV A;  3K5L A;  5FO8 B;  1FNW A;  3ULL A;  3GTM B;  3VR2 A;  4LF7 Q;  3KLS X;  5JVG 3;  4OWT B;  5C44 B;  5GAH C;  3QR8 A;  4A3F G;  1UWV A;  1HCZ A;  4RHS A;  2MO0 A;  4B9X A;  4Y52 H;  3ICE A;  3K59 A;  2KEE A;  2N3S A;  4LF4 L;  3NXW A;  3TN2 A;  4ILW A;  4GZY C;  1EFW A;  4LF6 L;  5LMU L;  3NK9 A;  3I2Z A;  3ONA B;  5E4W C;  1NMG A;  1WCM G;  1YNJ C;  5A35 A;  1I5F A;  1JOO A;  3STB C;  4N8X 1;  1RKN A;  4KV6 A;  3MC0 B;  3CC7 A;  1WI5 A;  1TWC H;  5EJW A;  1A2U A;  1HXY D;  1Y8N B;  3PIP 3;  1GKH A;  4HJA A;  1SNQ A;  5KND A;  1KDA A;  1V1O A;  1AZP A;  2F0D A;  1S4Z A;  4X65 Q;  4GOP C;  4GNX B;  3HOZ H;  3I56 A;  3SE0 A;  3HOZ G;  1TWG B;  4IN3 A;  2OF1 A;  3RD4 A;  1RD9 D;  5FK9 C;  1XPO A;  1K8A C;  3A8I E;  3HS0 C;  4A3J G;  4R4Q A;  2ZT9 C;  4OON A;  4MTK A;  2F0N A;  1STG A;  1BCP B;  4A3K H;  5BN3 A;  3K7A H;  1AP0 A;  5LL6 S;  2SNS A;  4LMQ D;  3EIV A;  1F9P A;  1TS5 A;  1EY4 A;  3RUZ A;  1TU2 B;  3P20 A;  3HOX G;  5CBE E;  2BH2 A;  3J7Z C;  4X62 Q;  1Y14 B;  3I4M B;  3M4O B;  5M5W B;  2K7V A;  4YWK A;  2BH8 A;  3PV0 A;  4HJ5 A;  3A74 A;  3S14 H;  1I4R A;  1PYW D;  4BY7 H;  4XQJ A;  1XTD A;  1F2Z A;  2OCE A;  3PO2 H;  4BY7 G;  1PH2 A;  4X3T A;  4LFB L;  2UXB Q;  1IL2 A;  2LKV A;  2RCF A;  1U4P A;  1SAP A;  4MNO A;  4O1N A;  1STA A;  1KAB A;  3R8B A;  2TSS A;  5I2X A;  4JI4 Q;  2PI2 E;  1LTT D;  3FHW A;  3CF5 A;  1U5K A;  3TSS A;  2KJX A;  3G71 A;  3F2D A;  1CQV A;  4FXD A;  4DR3 L;  4DR2 Q;  4FO2 A;  2J7Z A;  1HQR D;  2EXZ A;  2B63 B;  4A3D H;  1EOT A;  2XWJ B;  3E5S A;  5C4X B;  1FGB D;  3TP8 A;  1WD1 A;  3I91 A;  2R93 B;  4G7Z C;  2YU9 H;  5IYC H;  3OW2 A;  4K0K Q;  1PA6 A;  1D5Z C;  3I73 A;  5HGQ A;  1C0A A;  3SVM A;  2IY5 B;  4RGT A;  1SYE A;  4IFD I;  2J0T D;  3KBX A;  2HHH Q;  1O78 A;  4DK1 A;  1FVI A;  2F4I A;  4JBM A;  3S17 H;  1DJR D;  5IGC A;  3TRZ A;  4JI3 Q;  4DUZ L;  2K5D A;  2C35 B;  2Y0S G;  2PZU A;  1VQ8 A;  4MIU A;  3CME A;  3CCS A;  4IPH A;  3PIO A;  1O80 A;  3OIQ A;  4KJN A;  1IW7 D;  1WTX A;  4LK1 C;  3CPW A;  3NSW A;  4AYB B;  4OO1 I;  3S9W A;  4OX9 Q;  4DV2 L;  3PO3 G;  3H3V I;  5JJK A;  4BBS H;  1DGS A;  3CKI B;  2VS1 A;  3DLL A;  3TQY A;  1VQF A;  3HKZ G;  2N88 A;  5ELB A;  4LUV A;  2L15 A;  1HUN A;  1TII D;  4DAY B;  1LM0 A;  1SN8 A;  4TSS A;  3J7A F;  5BR8 Q;  4PMC A;  3VR5 A;  3K81 C;  4BXX G;  2JA7 H;  4DV1 L;  4YWM A;  3D6W A;  5BN4 A;  1F2L A;  3LGJ A;  3GTL H;  1G6Z A;  2EZV A;  2F0T A;  2O5J C;  3S1N H;  3OWE B;  1EYC A;  5C4Z A;  2WV6 D;  3I72 A;  1ZYR C;  1TWF B;  4B3T L;  3MAQ A;  4DAV A;  1G6P A;  2L55 A;  4RGM A;  5CV9 A;  5IGG A;  1VQ4 A;  4NP5 A;  2K5W A;  5IOC A;  1M8A A;  2LSS A;  3LNN A;  1UNS A;  1R9T B;  1CSQ A;  2K52 A;  3RLN A;  1EIF A;  2QEX A;  2LXJ A;  2UU9 Q;  1I4H A;  3H0G H;  5I9O A;  4L5R C;  3H15 A;  4DV7 L;  2GVB A;  4MTN A;  4ZKB B;  3TS0 A;  2EYP A;  3QOJ A;  1BDO A;  1PRT F;  2QW7 A;  1A0I A;  4IUQ A;  1UUP A;  3K6O A;  4KMU C;  3CAM A;  5EPJ A;  3NPP A;  1ASY A;  1G51 A;  1NR2 A;  4TRD A;  1EIG A;  2R61 A;  4X66 Q;  1WTO A;  1E1T A;  3GV6 A;  2UUC L;  4YCW A;  3A7L A;  3Q24 A;  2JE6 I;  3DHQ A;  1J5E L;  5I6Y A;  1A3V A;  3PUZ A;  5FLX L;  1YZ6 A;  2GA4 B;  3HG9 A;  4IPD A;  3SEB A;  3J81 E;  5IGE A;  2R7Z H;  4DV6 L;  3S15 H;  5ISR A;  4GKJ L;  1PFN A;  2EJG C;  3SK8 A;  1V8Q A;  2AUK A;  1HUM A;  1JR0 D;  3AB9 A;  4BA1 I;  4ZK9 B;  5LMN W;  2F0F A;  1MSG A;  4WJ3 M;  3G7L A;  3TZU A;  2JA9 A;  4DGZ A;  4C3I B;  3CMA A;  2PCF B;  1TKW B;  5C3E H;  3L9A X;  5IGD A;  1GUG A;  2K01 A;  1DD2 A;  1BVS A;  3FMC A;  5CV5 A;  3IFT A;  1VQG A;  3NWS A;  3S24 A;  3F2C A;  2AWN A;  2H5X A;  1Y1V H;  2K32 A;  2IT1 A;  3BDL A;  1TY2 A;  1GM5 A;  4WOR A;  4HJ7 A;  5K5P A;  2DJG C;  1Y1V G;  2OQK A;  2WFW A;  1QNU A;  5D3D A;  1YJN A;  5M3F B;  1PRT D;  4OEL B;  5EGT A;  2IX3 A;  4C3J H;  1EWI A;  2Z1C A;  4B3S L;  2F03 A;  2G5D A;  2AUJ D;  4C3J G;  1CA6 A;  3RZO H;  1X3E A;  2RA4 A;  3I7F A;  3PF5 A;  3TS2 A;  3TP7 A;  3A54 A;  2PNH A;  3BDC A;  2EYM A;  4IUP A;  2JN4 A;  4AIM A;  3JC6 6;  1K0R A;  4KHZ A;  5ELD A;  1NMF A;  5KNC A;  3J80 L;  3PIP A;  1T5E A;  4DKA C;  4RHR A;  3HP3 A;  3T1Y Q;  1N33 Q;  1OXV A;  2CKZ B;  1KIX A;  2JA6 H;  1AEX A;  2F0P A;  4JBW A;  1SE4 A;  2ASB A;  1IYJ B;  2CW0 D;  3I55 A;  4IFD G;  1MJC A;  1K0S A;  1PHJ A;  2AQ3 B;  2LS0 1;  2QA4 A;  5M3M H;  4XT1 B;  1ZKO A;  2F0J A;  3NQT A;  1F77 A;  5M3M G;  1JMC A;  1H9S A;  1Q8K A;  2RBM A;  4LFC L;  2KA7 A;  1QUQ A;  1GUO A;  2Q8R E;  3PUV A;  4PV1 C;  2K1B A;  2A73 B;  4MHE A;  3FKI H;  1VQ6 A;  3FKI G;  2D0P A;  3HEJ A;  1LTA D;  2A6E C;  5C4X H;  1EIH A;  4CDF C;  2WIN B;  1BOS A;  3L2P A;  2RDG A;  4C3H G;  1A63 A;  3S1Q B;  4IOC A;  3F1Z A;  5KGU A;  5IT9 c;  3CHB D;  3EQL C;  1TS2 A;  2F0G A;  2KOL A;  2MPM A;  2MHV A;  3OYY A;  1HR0 W;  1YNX A;  4LF4 Q;  1I3Q B;  3VYS A;  2ID0 A;  2JEA I;  1UEA B;  4LF6 Q;  1Z6H A;  1SND A;  2B3G A;  5LMU Q;  3I4N B;  1IW7 C;  2VW9 A;  3MEH A;  5ELC A;  3KLW A;  4APV A;  4RA8 A;  1I6V C;  5E1F A;  5C0X H;  1DM0 B;  1EQV A;  2LMC B;  4A3C G;  5C0X G;  1JE4 A;  2B2Y C;  1S5C D;  4H02 A;  4PZ7 A;  1BBW A;  2MFI A;  2NVQ B;  4GN3 B;  4DV4 Q;  5IT9 L;  4NXM L;  4A3F B;  2HQE A;  4HID A;  2X6G A;  4LF5 L;  2EDG A;  1B9N A;  1JWU D;  1ILQ A;  2AHO B;  4C56 C;  3Q23 A;  2JA8 H;  4KHV A;  2UUA L;  3ITP A;  4FP5 D;  1XNR Q;  2NVT H;  1WCM B;  2PMZ E;  4XXE A;  1BQQ T;  3ULP A;  1V1Q A;  1VF5 C;  2XSC A;  1B4O A;  1HFG A;  1JB7 A;  2Z8L A;  1KNA A;  1I6H B;  5H1S E;  2BOS A;  2EYO A;  1NUC A;  1TWF H;  3CCL A;  1N36 L;  1ICW A;  4X3U A;  2K5V A;  3T13 A;  4UY8 C;  4A3G B;  3VR3 A;  4J15 A;  4PZ6 A;  4YIJ A;  1H9K A;  2WB1 E;  3KF8 A;  1S5B D;  2MGS A;  2AKW B;  4O2D A;  5C5L A;  3SR1 A;  2NYZ D;  4UPA A;  2FFK B;  4JBJ A;  1HQM C;  1Z47 A;  4X64 Q;  4A3B H;  1KRT A;  1FL0 A;  5IYB H;  1F9R A;  1S3O A;  4B08 A;  2A74 C;  1X9N A;  4FVM A;  5HY6 A;  3JAM c;  4C2M H;  4OHJ A;  1ENA A;  1K8G A;  4ZUI A;  4JI2 L;  3QIA A;  3VR4 A;  3SDZ A;  3HOX B;  2D9U A;  1YHB A;  4BY1 G;  2ZTD A;  4AQY Q;  3OTO Q;  2ZXR A;  4IUV A;  1XNQ L;  1GJX A;  4DR3 Q;  1S5D D;  1PTO B;  2M2L A;  4LUO A;  4OWX B;  4A3L H;  2PI2 A;  2F3I A;  3ND8 A;  1EYA A;  1WTV A;  4A3L G;  4YCV A;  4QCL A;  2F0S A;  1EZ6 A;  2JXM B;  5A2Q L;  5K36 H;  4K5V A;  1ENC A;  3KJO A;  2VY3 A;  1K3R A;  3CQZ B;  4C3I H;  3JAM L;  5C3W A;  3UE1 A;  1ASZ A;  1STH A;  4NXN Q;  1CKN B;  2VQE L;  1BCP F;  3M4Q A;  2PQA A;  3CPF A;  2LFN A;  3DWQ A;  2IL8 A;  1SNP A;  2N49 A;  1LTR D;  2KCM A;  4IPG A;  4RG1 A;  1LT4 D;  1ENF A;  3HOY B;  2LY7 A;  3QWN A;  4RGO S;  4LFA L;  4K5X A;  1KLU D;  1K83 B;  1KNE A;  3MXU A;  1PRT C;  5M3F H;  1XJV A;  4POG A;  3DXJ C;  5D14 A;  2OTL A;  3A0J A;  1XMQ L;  3HOV H;  4UDU C;  1HNZ L;  1WFQ A;  1FYC A;  2K5N A;  5C4J B;  1MJE A;  1M4V A;  3HZX A;  4IOA A;  2NVY H;  3SK4 A;  4GN4 B;  1LLR D;  4IUT A;  4JG2 A;  4L5Q A;  5E3F A;  4JI7 L;  3H6M A;  3HOU G;  1WTQ A;  4B3M Q;  3K80 C;  2Y0S B;  1BBU A;  2RDH A;  1ET9 A;  1EQT A;  2WAC A;  3E0J A;  1HZA A;  1VQ9 A;  1JT8 A;  2A68 D;  4JK1 C;  4GOP B;  4DV1 Q;  1KDC A;  4A75 A;  4EVO A;  3PO3 B;  4A3M G;  1HNX Q;  2VUM B;  5CV4 A;  4KKT A;  3FEW X;  1A2T A;  3LWE A;  1AE3 A;  1G29 1;  4EQ5 A;  4S3S A;  3RZD H;  4R4T A;  2OXP A;  4JI1 L;  1Q82 C;  1HA6 A;  5FLX E;  1G91 A;  3CCE A;  4GKK L;  2NVX B;  1VMP A;  1AZQ A;  2A6H D;  2BCO A;  4N9T A;  3H94 A;  3C1F A;  4MN3 A;  1BCP D;  2JA5 G;  5L37 A;  1PH7 A;  2RSO A;  3KFU A;  3P1H A;  3TEH B;  1SE2 A;  3KF6 B;  2ENB A;  2XRS D;  4HMJ A;  1DOK A;  4K14 A;  1X55 A;  2CCZ A;  3GQB A;  1XMO Q;  2CQO A;  4XT3 B;  4QIW B;  2OEO A;  1M1K C;  4RH6 A;  5CYU A;  5EPK A;  1DXM A;  1NAP A;  5IGB A;  1YEZ A;  3W3A A;  2DGY A;  2PO4 A;  3D4R A;  1RTO A;  2F1M A;  3S1Q H;  3KUP A;  4PZ8 A;  5J3B A;  2UUC Q;  5I9P A;  4F88 A;  1E2W A;  5ELF A;  2ALY B;  2F0H A;  4K2K A;  5I4D A;  3G6E A;  1I3Q H;  2VQF L;  2PZT A;  1YJ9 A;  2CWP A;  5KYI A;  1NTG A;  4DNR B;  5EPL A;  5JEA H;  4K6D A;  1VQP A;  4ME5 A;  2M00 A;  5M5X B;  1SYC A;  3MXG A;  2EQS A;  4ID6 A;  1IBM L;  4BBR H;  1PDQ A;  2HDL A;  3NTH A;  4EQP A;  1QVG A;  3HOW B;  5F2D A;  2CH4 W;  2ZM6 L;  2KBN A;  4BBR G;  2Z9H A;  4DNI A;  3J7A 5;  1TWA B;  5HGT A;  1LT5 D;  3J80 E;  3S2H H;  2K4K A;  2JQO A;  1BKB A;  4O0A A;  3NBH A;  1VCI A;  5IWA L;  1WTP A;  4KKS A;  3M3Y H;  3X3N A;  3NTI A;  2B2Y A;  1D1K A;  1S40 A;  1D7Q A;  2BE5 D;  3NBI A;  4CGY B;  4FDB A;  4KN7 C;  5CR3 A;  4B3S Q;  4RCO A;  1PH8 A;  4DPG A;  1SNM A;  3B6Y A;  4LAA A;  4KLK A;  3T1H Q;  4V19 0;  1GUW A;  1SDF A;  2RF4 A;  1VQA A;  3E6Z X;  2FHT A;  5J22 A;  5LMN L;  1B1Z A;  2E2I B;  2DNE A;  4A3G H;  2DY7 A;  2HQL A;  3BYY B;  2CFM A;  1I4X A;  3M9B A;  1JE5 A;  5AJ3 L;  4MZ9 A;  3PMF A;  4A3K G;  1CFM A;  4YY3 L;  4Q5V A;  2X69 A;  4JI0 L;  4KI0 A;  4PQX A;  4HMI A;  4C1N I;  2P5Z X;  3UI2 A;  4YCU A;  5AFW A;  1TVX A;  4ABN A;  2K5Q A;  3F8T A;  2Q8I B;  1JWM D;  1IBK L;  3IFD A;  5LL6 X;  1PV4 A;  1YIJ A;  3CP0 A;  3SGI A;  1Q1B A;  1ESF A;  1VQJ A;  1W6K A;  1E1O A;  2NWG A;  1EL0 A;  4U67 3;  4A93 H;  5J1Z A;  5CMD A;  1B7Y B;  4LFC Q;  2KUM A;  1LTB D;  3NP8 A;  1WJJ A;  4A3E H;  3PO2 G;  4JOI A;  1CT1 D;  1L0X B;  1PTO H;  4ZKC B;  5ELO A;  4DV5 L;  1VQC A;  1PFM A;  3DUZ A;  4QJF A;  1QG7 A;  2AWO A;  2O4X A;  4IJH A;  4QL5 A;  4HIM A;  1Y1W H;  5I6W A;  2K28 A;  4IUN A;  3K5M A;  4QF4 A;  3HFZ B;  3RN5 A;  3ER0 A;  4QB4 A;  3I4O A;  1HZ9 A;  2EYF A;  2QIL A;  4A3D G;  2A6E D;  4PG3 A;  2UXD Q;  3K57 A;  1JB3 A;  5JPN C;  5IYC G;  2DUD A;  4Y7N B;  4I7A A;  1L0Y B;  2VNU D;  1TWH B;  2KCC A;  3C1E A;  1O7I A;  1X65 A;  1X32 A;  1K83 H;  1STB A;  3SK6 A;  3VR6 A;  4KKU A;  1RJT A;  2YTV A;  2RHS B;  1TS3 A;  4A3I H;  3I3C A;  1R4P B;  3UDG A;  1XX8 A;  3A8J E;  3H09 A;  5D3I B;  1JIC A;  3ZJY C;  4C3H B;  3V2T A;  2R7F A;  5C4J H;  4A3I G;  3S1R B;  2QCP X;  3A55 A;  1QZG A;  4LF8 Q;  3W1B A;  4CDD C;  2OTJ A;  2L12 A;  3FPU B;  1YJW A;  2EYH A;  4DK6 C;  4AYB E;  3MXN B;  3AQQ A;  4H7B A;  2L5T A;  1IHZ A;  3OIP A;  4CJ0 B;  5M5Y B;  4BBS G;  2KHS A;  4GLV B;  1CK1 A;  2A68 C;  2L9H A;  3E3X A;  4DR4 Q;  1CI3 M;  1HR0 L;  3MFG A;  2ES2 A;  1EY6 A;  4JI5 L;  4GNX C;  1ROD A;  4HED A;  2VUM H;  1EQQ A;  2NZO A;  3M4Y A;  1N32 L;  5FJ8 H;  1EEI D;  3G4S A;  1D1I A;  4G57 A;  1N36 Q;  1W3S A;  2C5C A;  2A6H C;  5FJ8 G;  2JA7 G;  1NR4 A;  4HTH A;  2ZJR A;  1BCP C;  4JVZ A;  1F2Y A;  1EY7 A;  2FJ2 A;  2K33 A;  4HSP A;  1E2V A;  1SSO A;  1SYF A;  5A2Q E;  1KQS A;  4JV5 L;  1HJP A;  5C0X I;  1VQB A;  2VZA A;  1V43 A;  3R2T A;  4KHP Q;  1UAP A;  1I4Q A;  1D6E C;  1I50 B;  4CBV A;  2QGQ A;  4A76 A;  4IFD J;  1I94 L;  1EWC A;  2L4N A;  3H0G G;  4CDE C;  1A8V A;  4JI8 L;  4IO9 A;  3WWV A;  3K5O A;  4G7H C;  3CW2 C;  1WTR A;  1EY8 A;  5EQ0 A;  3OWF A;  1E7Z A;  5KNB A;  1XNQ Q;  1HA5 A;  3GTM H;  2QDB A;  3J80 i;  4RKL A;  4B3R Q;  2L1B A;  5C44 H;  2L11 A;  3MA2 B;  4IAL A;  1SYB A;  1Q12 A;  4KN4 C;  4JCV E;  5M5X H;  2IJ0 A;  1LO5 D;  1QNK A;  2K03 A;  2F0I A;  1HNW Q;  4HCS A;  2R7Z G;  1KAW A;  3HOW H;  3BG3 A;  5GRO A;  1IBL L;  5CV8 A;  1Q3L A;  4R9W A;  1OXS C;  3CCV A;  1WD0 A;  1DOM A;  3J7A V;  3K0X A;  5JAV A;  1ZXT A;  5DM7 3;  5C3E G;  2BE5 C;  4DV3 Q;  5DAU A;  1CQF A;  1MHW C;  1BBX C;  2X6L A;  1L1O A;  2C9O A;  2ZJP A;  5FLM H;  1XMQ Q;  2NN6 H;  1HNZ Q;  2CVR A;  5JOB A;  4DNT B;  4QGU A;  4XTC S;  5T1I A;  2EPB A;  1K3B C;  1TWG H;  3GTP B;  5IOD A;  5J39 A;  2WAQ B;  4JI7 Q;  2E2I H;  1JJ2 A;  4DR6 L;  5JJZ A;  1WTW A;  1Y8P B;  5IP7 H;  4FXG C;  4KTA A;  3KDF A;  4OWW B;  2D62 A;  2F0V A;  5IP7 G;  1K8M A;  1O7Z A;  2QEJ C;  3NUC A;  4RWS C;  2UXC L;  4HSV A;  3I8Z A;  2ZXP A;  2R92 B;  2E76 C;  1U9R A;  4CDC C;  2FMM A;  1EOV A;  3NWT A;  3AMU A;  3I4M H;  3M4O H;  4LWC A;  3ERS X;  5M5W H;  2RSN A;  2E5L L;  4P74 A;  3I4M G;  3KK7 A;  3GTO B;  3RR5 A;  4DUY Q;  3L3O C;  4L5S A;  2JA6 G;  3HOU B;  3RLF A;  1OTC A;  1DON A;  1CZG A;  1ET6 A;  5JPM C;  4CKE A;  2KHI A;  4RMF A;  3EFX D;  3W5O A;  4A3M B;  3GTK B;  1J8I A;  1LTI D;  5CC4 A;  2F3V A;  1U4M A;  1P8L A;  1STY A;  2I0Q A;  4F7X A;  1D5X C;  4X62 L;  2HD3 A;  4DF7 A;  2CWA A;  3PUW A;  2B63 H;  5C6A A;  4NKL A;  1HPC A;  2FMC A;  1SNO A;  3BZK A;  3C3L A;  2L0C A;  2JA5 B;  1SBB B;  1KL9 A;  2KCN A;  3NQI A;  2R93 H;  5C4X G;  2IWH A;  3BVG A;  1GO3 E;  5ELN A;  1E24 A;  3WOE A;  3S1M B;  2VQF Q;  2Q2T A;  1N9W A;  3CC2 A;  2R93 G;  2A19 A;  4Q0F A;  4I65 A;  1IYV A;  4Y7N H;  3S2D B;  4L5T A;  1GOZ A;  1V1P A;  1TWH H;  3DEP A;  4DFA A;  4IQZ A;  2D5D A;  2YYZ A;  5CV6 A;  1CHP D;  1FNU A;  4J6H A;  4NB3 A;  3D6C A;  1PTO D;  4NPS A;  2B2V C;  3D4W A;  1IBM Q;  4JI4 L;  2E2H B;  3P7J A;  1RCV D;  3EN2 A;  3T56 B;  4KY5 A;  3ERQ A;  4DR2 L;  1VQ7 A;  1BXT A;  3U50 C;  5CGK A;  2YV5 A;  3IAY A;  2H4O A;  4AYB G;  4WRD A;  4XQQ A;  2MQH A;  3E9I A;  1SE8 A;  5M5Y H;  5CV7 A;  1U4L A;  1OO9 B;  4K0K L;  4CKB A;  1SJE D;  5CBA E;  1YI2 A;  2EY5 A;  1UE6 A;  2HHH L;  2A69 D;  3MZ5 A;  3M4P A;  1X3G A;  3QB3 A;  1SYD A;  1PRT B;  4JI3 L;  5FOB B;  1YHQ A;  3MEF A;  1B3Q A;  3AEV A;  1HRJ A;  2JA8 G;  2F3W A;  1K73 C;  3G48 A;  3SK5 A;  4EQO A;  1LTL A;  1JOK A;  1XPU A;  4IZ8 A;  2XRQ D;  4OX9 L;  3MTS A;  3G6J B;  1E3P A;  2PW7 A;  1D2B A;  2XTI A;  4M8A A;  4GNX A;  1TWC B;  5G3L F;  2PMZ B;  5AJ3 Q;  3AFP A;  1KC8 C;  3OSO A;  3DM1 A;  5HUR A;  4DU9 A;  2EY6 A;  4ZLT F;  3NTK A;  1R9T H;  1QOH A;  1PH1 A;  4H0L C;  2I5H A;  1C8C A;  3GTQ B;  1U4R A;  3U4Z A;  3BZD B;  3HOZ B;  3EA6 A;  1GD7 A;  5BR8 L;  3VYR A;  3S16 B;  3PSI A;  4G7O C;  3OOC A;  4A3J B;  3U9S A;  4JOI C;  2K75 A;  1K8O A;  5M9O A;  4LFB Q;  5T1G A;  1RF2 D;  4A3B G;  5IYB G;  5JVH 3;  2F4V L;  2E74 C;  1KXL A;  3K7A B;  3GO5 A;  3C46 A;  3DMU A;  4L63 B;  1NE3 A;  5EKK A;  4LUZ A;  2M9V A;  1C48 A;  2Q2I A;  2FIN B;  5GAD C;  1QZH A;  4X6A H;  4K5W A;  1KD1 C;  1A62 A;  1CUK A;  2JEB I;  2BDO A;  1EZ8 A;  3Q6S A;  1B9M A;  1MGS A;  5EKL A;  4CHT B;  4LJZ C;  4RCN A;  1SRO A;  2QDL A;  4FF1 A;  4BY7 B;  1QE6 A;  3CCJ A;  3Q8D A;  2PNR C;  2NBF A;  5K36 G;  1X56 A;  4LF9 L;  2RVL A;  4C3I G;  2E2J B;  5G3L D;  3URY A;  2G9D A;  3EJI A;  2Z0S A;  2JJQ A;  3MXP A;  1SNC A;  1EY5 A;  4XQN A;  4DUZ Q;  2HCI A;  2NZH A;  5IP9 H;  3BU2 A;  3J7Y W;  2KED A;  3GTP H;  4RGN A;  3NE5 B;  3FRP B;  4UP7 A;  4DV2 Q;  4A3D B;  1QVF A;  4R4O A;  1Q8I A;  5C5M A;  4P73 A;  5M3F G;  3U9O A;  3J81 c;  2ZJQ A;  3MFY A;  1QWY A;  2NTT A;  3HOV G;  2BDN A;  2A1A A;  3GTG B;  1VQN A;  1QVC A;  2XIW A;  2EYJ A;  3S17 B;  2R92 H;  4HIK A;  4DAM A;  5C4H A;  1FR3 A;  1ML0 D;  5IYD H;  3O13 A;  1VS0 A;  5KEE A;  1N32 Q;  2N78 A;  3PUY A;  1UE5 A;  3K0Y A;  3A8K E;  3MXN A;  4TVA B;  1FD7 D;  4CJ2 C;  2Y0S E;  4F87 A;  3DM3 A;  4ME3 A;  2B39 A;  1FJG L;  2Q2H A;  3GP7 A;  3ZYY X;  3J81 L;  5IE8 A;  1H95 A;  4OEM B;  1SMX A;  3A56 A;  4DAY A;  4B3T Q;  4OXP A;  3HKZ B;  4JV5 Q;  2XVS A;  3A7A B;  1BO0 A;  1YNN D;  2IHE A;  1G2S A;  2HDM A;  2FXQ A;  2F0Q A;  3VYU A;  4R8I A;  5E4X A;  1ICF B;  2E75 C;  2KVM A;  4N8F A;  1CM9 A;  4DV7 Q;  4LNQ A;  1I94 Q;  1HHV A;  1HZB A;  1JCK B;  4DXG A;  4JI8 Q;  1B2T A;  3UDI A;  2AQ1 B;  1JJG A;  1AW7 A;  4R8N A;  2JA7 B;  3PGZ A;  2PYK A;  4IJL A;  3T16 A;  2AQ2 B;  3T1Y L;  4EQN A;  1N33 L;  1H9S B;  1J6Q A;  3AFQ A;  3S1N B;  1QUQ B;  4C1N K;  2EOT A;  1UEB A;  3ND9 A;  2EY2 A;  4BS9 A;  1W6J A;  1EIY B;  4DR7 L;  4XIG S;  2Q2U A;  4J8Q A;  4L8J A;  4QIW E;  3S2D H;  1QJO A;  1J5E Q;  3QOL A;  1LAB A;  4QQB X;  1PTO C;  4DV6 Q;  2F0K A;  3RN2 A;  3H0G B;  3V05 A;  4GKJ Q;  1ESR A;  3ERO A;  3I4N H;  2R3Z A;  1IBL Q;  2GVA A;  1YBY A;  2BA1 A;  3BS1 A;  4FF3 A;  5KIX A;  4OIJ A;  2PZW A;  3DEO A;  1BUV T;  3D0F A;  1KLG D;  5JEA G;  1C4Q A;  1JOR A;  2IX1 A;  1E2Z A;  1L1O C;  2NVQ H;  2Q8T A;  2B2V A;  1T5X D;  2F0E A;  4A3F H;  1RTN A;  3W2D A;  4JW0 A;  3A5Z B;  4HN7 A;  2A69 C;  2ZXO A;  1E0B A;  4R4C A;  1B8A A;  2D0O A;  1XPR A;  2EY1 A;  5JJL A;  4IUU A;  4ZYS A;  2R7Z B;  1CSP A;  1SLJ A;  2I5L X;  1V9P A;  3S15 B;  1WCM H;  2PPB C;  1SE3 A;  3LX0 A;  5EBD A;  4DR6 Q;  1F9S A;  4ODG A;  5LHY 1;  1SXT A;  1I6H H;  2OT2 A;  1TY0 A;  3P75 A;  4HCE A;  3KJP A;  2KHJ A;  4GLA C;  5C3E B;  1Q7Y C;  2UXC Q;  1N34 L;  4DV4 L;  3FP9 A;  2I5M X;  2B2T C;  1SRU A;  2WB1 G;  1AN8 A;  2K50 A;  1STE A;  3N52 A;  4P71 A;  3T4A C;  4CJ1 B;  4A3G G;  4UP9 A;  4KK7 A;  3D3R A;  1Y1V B;  2K14 A;  1K9M C;  3GTQ H;  4KY6 A;  2DNC A;  1Q90 A;  2E5L Q;  1QCB D;  4LW1 A;  2KEN A;  1TQO A;  1GHK A;  3S16 H;  3VA7 A;  4A3J H;  1XNR L;  3UDX A;  3WOF A;  1LTS D;  4C3J B;  3KF8 B;  3D4D A;  4JC0 A;  4JBK A;  3RZO B;  3EVQ A;  3FPP A;  3H91 A;  2HIX A;  1G8Z D;  2NN6 I;  3HOX H;  1VQE A;  1Q81 C;  2IW3 A;  4A93 G;  1X3Q A;  2J4X A;  1KTK A;  5E7N A;  4UHV A;  4L6T B;  3CCM A;  3VDY A;  4GLX A;  2F52 A;  4A3E G;  4X3K A;  2VB2 X;  3U58 A;  1H9R A;  2NTS A;  3BVZ A;  1EU4 A;  2V1C C;  4DV0 L;  5GAG C;  5IT9 E;  2JA6 B;  1RL2 A;  4QUC A;  3OMG A;  3DWP A;  1LT3 D;  1YHA A;  4X64 L;  3K5N A;  3CQZ H;  1Y1W G;  1B70 B;  1FGU A;  4ZCK A;  3BVM A;  2E2J H;  5M3M B;  4F8M A;  3ULJ A;  1B53 A;  1YVC A;  4QMG A;  1VQM A;  1Z9F A;  3T53 B;  3CD6 A;  4K6L A;  4AQY L;  3OTO L;  1WYD A;  3UE0 A;  3HOY H;  3Q0A A;  1NSN S;  4DAP A;  5DEH A;  3GV3 A;  1GUN A;  3HOY G;  1VDZ A;  2CHB D;  3FKI B;  1OXT A;  2PQA B;  2Z4I A;  4KD4 A;  4B9W A;  1PMR A;  4DR5 L;  1M90 C;  4KY7 A;  5KYL A;  1Z7T A;  4NXM Q;  1AE2 A;  2UUB L;  3GTG H;  1GUS A;  4P72 A;  2HCC A;  4LF5 Q;  3X3M A;  4NXN L;  4TKO B;  3MHB A;  1PFB A;  1II3 A;  2UUA Q;  3RNU A;  1HTP A;  1PYB A;  1JC7 A;  1E22 A;  1I4P A;  2SDF A;  1A15 A;  4YHH L;  4K2L A;  3PO3 H;  1PZK D;  3FVQ A;  4R4I A;  5EKI A;  3D8G A;  4JYA L;  2B2U A;  3SHL A;  2VUM G;  1EY9 A;  2MUY A;  1N8R C;  1YNN C;  2B2W A;  3E9H A;  2NVX H;  3MVV A;  1NBW A;  2K6A A;  2IPK D;  4V0B A;  3SXH A;  1XYI A;  4E6I A;  1VQH A;  4NW2 A;  1JQY D;  1PYS B;  3K7U C;  4B3M L;  1OXX K;  3HKS A;  2IX0 A;  4BXX H;  2JA8 B;  4ALP A;  2VB3 X;  3CU7 A;  1ILP A;  3JAM E;  1NY4 A;  4JI6 L;  1C9O A;  4WFN 3;  2NVT B;  1A3U A;  4OIK A;  5FO7 B;  4GN5 A;  4PMB A;  5GAE C;  2MNA A;  2EXD A;  1HNX L;  2F4V Q;  4DR1 L;  1GHJ A;  2EJF C;  4JI2 Q;  1A3T A;  2JK8 A;  2HUG A;  2RDF A;  4KD3 A;  4HJ9 A;  1JWS D;  2RQX A;  1RIP A;  4P75 A;  5KRU A;  1ZEQ X;  3TBI B;  2NZ1 D;  4BWG B;  1A6X A;  4HAE A;  2F0L A;  5FLX c;  5EAY A;  2YTX A;  2ICE C;  1EEF D;  3BZC A;  2K5H A;  3M85 A;  1LAC A;  5C44 G;  1EU3 A;  1AH9 A;  4RKB A;  1XMO L;  4A3B B;  4LF9 Q;  1D8L A;  4BA2 I;  4JPB W;  3R93 A;  2N8N A;  3L7Z C;  4C2M B;  2F0O A;  4J1M A;  2VQE Q;  1TWA H;  3HOW G;  4BY1 B;  1EYD A;  4OGQ C;  1SYG A;  1TXY A;  1UE7 A;  1DCZ A;  3OMC A;  3H3V C;  3KYH C;  4K8I A;  5DLQ E;  4LFA Q;  4LF7 L;  4H44 C;  1LYL A;  4GS3 A;  4XYQ A;  1PZJ D;  1HZC A;  1S5E D;  1D5M C;  1CKN A;  1Q1E A;  3IL8 A;  4RAU C;  5C0X J;  2BA0 A;  3NBH B;  1B44 D;  3TME A;  2HT1 A;  5D65 A;  5FLM G;  2NN6 G;  2XWB B;  1MD2 D;  1SFO B;  3HGB A;  5JJI A;  4FF2 A;  2EVB A;  2WII B;  2QKI C;  4PMW A;  2WAQ E;  1R4Q B;  5IY0 A;  1RHP A;  2A8V A;  2DJF C;  3A5U A;  3PQI A;  2EYL A;  1QIL A;  3J80 c;  4I7Z C;  1BR9 A;  1TT2 A;  2QF7 A;  1FJG Q;  3KLR A;  5GQO A;  1PTO F;  1VQL A;  4JI1 Q;  4X65 L;  4XDX A;  3HOV B;  1PH9 A;  1IZ6 A;  1SEB D;  2B2T A;  4GKK Q;  3VA5 A;  3F2U A;  1CA5 A;  1CKM A;  2R7D A;  1TS4 A;  2NVY B;  3T1H L;  3AU7 A;  4XYO A;  5DM6 3;  3QO2 A;  2ZTE A;  1KHI A;  1P16 A;  3V96 A;  4GOP A;  1B50 A;  1LV9 A;  3D31 A;  1WVL A;  1KAA A;  2XN9 C;  1J9O A;  2NB0 A;  4PNY A;  4DN4 M;  2JP1 A;  1Q86 C;  3CRK C;  3W1G A;  3GTJ B;  2WKC A;  4R1J A;  5FO9 B;  3TP6 A;  3CRL C;  3N6R A;  2DY8 A;  4HJ8 A;  4IFD H;  1DYQ A;  1HFN A;  3BYT B;  2B8F A;  1ONL A;  2I07 B;  3RZD B;  2KEC A;  5ELE A;  4DR7 Q;  1SMY D;  5DNF A;  1PLF A;  3WDN A;  3KBG A;  3KF6 A;  2WP8 J;  1MKH A;  2F0M A;  4HR7 B;  4DXF A;  2B63 G;  1KDB A;  2OWO A;  2K04 A;  4ULL A;  4M1U B;  4OO1 H;  1O7L A;  1H9M A;  2AMC B;  4CKC A;  3H3V H;  4DK0 A;  2UXB L;  4OO1 G;  3CCU A;  2Z6K C;  3RMH A;  2KCT A;  1K28 A;  4N9P A;  2Z4H A;  1TR5 A;  3AYH B;  1GUT A;  4OL7 A;  4FYD A;  2ZM6 Q;  4C3H H;  5BN5 A;  1O7Y A;  1S5F D;  4IUR A;  1WTH A;  3S1R H;  2YTY A;  1PZI D;  1MIU A;  1HTL D;  3C2P A;  1F2M A;  4DK3 C;  5IWA Q;  1JJC B;  3QJY A;  3CCR A;  2UXD L;  3IRB A;  1EWH A;  4U68 A;  1YIT A;  2RKS A;  1VQD A;  1EQR A;  2PW5 A;  2H1E A;  2RHQ B;  3OW7 A;  2EJM A;  1NNX A;  2DN8 A;  4A3C H;  2CQA A;  1IYU A;  1EUJ A;  3JAM i;  4BBR B;  5LMN Q;  3FDT A;  1CHQ D;  1KRS A;  3OPO A;  1IKM A;  4UAI A;  1N34 Q;  3EBE A;  1SJH D;  2O5I C;  2XNA C;  1YNJ D;  3QG1 A;  3STB D;  4LF8 L;  3VYT A;  3S2H B;  4YWL A;  1JOQ A;  1AFP A;  4HIO A;  1EY0 A;  4YY3 Q;  1S72 A;  1X3F A;  4JI0 Q;  3CXC A;  2LXK A;  3M3Y B;  2IHF A;  5I2Y A;  4P2C B;  4WJ4 A;  4DR4 L;  1I50 H;  1IBK Q;  1XXG A;  3CC4 A;  3NEL A;  2EE1 A;  2MO1 A;  4POF A;  2E2D C;  4NMZ A;  2E8G A;  1EFI D;  3PF4 A;  2D2C C;  2F0W A;  1MSH A;  2ICI A;  2WB1 B;  1LT6 D;  3M7G A;  3BJU A;  3U4V A; 
#chains in the Genus database with same CATH homology
 2RHS B;  4DV6 Q;  4B3S L;  3RN2 A;  4A3I H;  3RZO H;  4GKJ Q;  3UDG A;  1X3E A;  3ZJY C;  5C4J H;  3I4N H;  1HH2 P;  3I7F A;  2R7F A;  4A3I G;  4DV5 Q;  2GVA A;  3PF5 A;  1IBL Q;  3TS2 A;  1YBY A;  2BA1 A;  2PNH A;  3W1B A;  4DV0 Q;  1QZG A;  3K8A A;  4LF8 Q;  2OTJ A;  2XGT A;  1UE1 A;  4AIM A;  3J81 i;  3D0F A;  1K0R A;  3JC6 6;  1YJW A;  4KHP L;  4DK6 C;  4KHZ A;  2UU9 L;  4UP8 A;  4AYB E;  5JEA G;  3MXN B;  3AQQ A;  2IX1 A;  3PIP A;  1NMF A;  1X6O A;  1L1O C;  2NVQ H;  3F2B A;  4BBS G;  4DKA C;  4GLV B;  3J81 j;  1SR3 A;  4A3F H;  3T1Y Q;  1N33 Q;  4DR4 Q;  1T9H A;  1OXV A;  2CKZ B;  1KIX A;  1HR0 L;  2ES2 A;  2JA6 H;  1L0W A;  3UDF A;  3A5Z B;  4BY1 H;  4JI5 L;  4GNX C;  4JBW A;  4R4C A;  1NJI C;  2VUM H;  1B8A A;  2D0O A;  1XPR A;  1IYJ B;  1PH4 A;  2ASB A;  5JJL A;  1EQQ A;  2NZO A;  3I55 A;  4IFD G;  1MJC A;  1N32 L;  1PH6 A;  3NEM A;  1CSP A;  1SLJ A;  2I5L X;  1V9P A;  5FJ8 H;  3G4S A;  2QA4 A;  4X66 L;  5M3M H;  1WCM H;  3NEN A;  1N36 Q;  1W3S A;  5FJ8 G;  3GD7 A;  2JA7 G;  4B3R L;  3RLO A;  4IPC A;  4DR6 Q;  5M3M G;  4TQU S;  2ZJR A;  1JMC A;  4A4I A;  1Q8K A;  4LFC L;  1QUQ A;  4DR5 Q;  1I6H H;  3PUX A;  5JEA J;  1Q46 A;  1VQI A;  3PUV A;  5IP9 G;  3KJP A;  2KHJ A;  4GLA C;  1KQS A;  2UUB Q;  4JV5 L;  1HJP A;  5C0X I;  1SFO H;  1HNW L;  1VQB A;  2VZA A;  1Q7Y C;  2UXC Q;  3FKI H;  1N34 L;  1V43 A;  4DV4 L;  1VQ6 A;  1LUZ A;  3FP9 A;  2I5M X;  2WAQ G;  1L1O B;  4KHP Q;  1SRU A;  2WB1 G;  3FKI G;  2D0P A;  2K50 A;  4P71 A;  5C4X H;  1VQO A;  4A3G G;  2QGQ A;  4UP9 A;  4A76 A;  4IFD J;  3L2P A;  1I94 L;  2K14 A;  1K9M C;  3H0G G;  3GTQ H;  1A8V A;  4JI8 L;  4IO9 A;  3WWV A;  2E5L Q;  1A63 A;  4LW1 A;  2KEN A;  3CW2 C;  3F1Z A;  4IOC A;  1HR0 Q;  3S16 H;  5IT9 c;  4JI5 Q;  4YHH Q;  1EYG A;  4A3J H;  1XNR L;  1OXU A;  3UDX A;  2RCN A;  4DV3 L;  1GVP A;  4JYA Q;  3OYY A;  3PCO B;  1HR0 W;  1YNX A;  4LF4 Q;  1E7Z A;  2R92 G;  1XNQ Q;  3KDF B;  3E0E A;  2ID0 A;  3KF8 B;  2ATW A;  1U0L A;  2JEA I;  3GDE A;  5IYD G;  4JC0 A;  4JBK A;  3GTM H;  4LF6 Q;  2B3G A;  3J80 i;  5LMU Q;  4B3R Q;  2OQ0 A;  2VW9 A;  5C44 H;  2HIX A;  3GTO H;  2NN6 I;  3KLW A;  4APV A;  2B29 A;  3HOX H;  1VQE A;  1Q81 C;  3HOU H;  4A93 G;  5E7N A;  1Q12 A;  1IXR A;  1CKO A;  4A3C G;  3KOJ A;  5C0X G;  4JCV E;  5M5X H;  1VQK A;  3CCM A;  3VDY A;  4H02 A;  1HNW Q;  4GLX A;  1PH5 A;  2F52 A;  2VL6 A;  1BBW A;  2MFI A;  1KAW A;  4PZ7 A;  4A3E G;  4GN3 B;  3GTJ H;  4DV4 Q;  5GRO A;  3U58 A;  1IBL L;  3HOW H;  4JI6 Q;  1PFS A;  1PH3 A;  1C7Y A;  4NXM L;  2V1C C;  4DV0 L;  4A3M H;  3GTK H;  5GAG C;  1L2F A;  3HKZ E;  4HID A;  1RL2 A;  4LF5 L;  1OXS C;  4EX5 A;  2HIV A;  4AH6 A;  2AHO B;  3CCV A;  1YHA A;  4DR1 Q;  4X64 L;  3CQZ H;  1Y1W G;  1B70 B;  1FGU A;  2JA8 H;  3K0X A;  2UUA L;  3M7N A;  5C3E G;  2E2J H;  1XNR Q;  2PMZ E;  2NVT H;  3ULJ A;  4DV3 Q;  1YVC A;  1VQM A;  1W2B A;  3ULP A;  2JA5 H;  1L1O A;  1V1Q A;  1Z9F A;  3L0O A;  2ZJP A;  4DUY L;  1JB7 A;  1VQ5 A;  5FLM H;  1XMQ Q;  3CD6 A;  3TRE A;  1HNZ Q;  3S1M H;  4AQY L;  3OTO L;  1WYD A;  5H1S E;  4XTC S;  4QGU A;  3UE0 A;  3HOY H;  1TWF H;  3CCL A;  1TWG H;  2ZTC A;  1PVO A;  1N36 L;  3HOY G;  2K5V A;  4JI7 Q;  2E2I H;  1JJ2 A;  4UY8 C;  1OXT A;  2PQA B;  4DR6 L;  4J15 A;  1X54 A;  3CCQ A;  4PZ6 A;  4DR5 L;  5IP7 H;  2E2H H;  1M90 C;  3KDF A;  2WB1 E;  4OWW B;  2D62 A;  2AKW B;  2EIF A;  5IP7 G;  4NXM Q;  1AE2 A;  4O2D A;  2UUB L;  3I4N G;  3GTG H;  4P72 A;  2GN5 A;  2UXC L;  1WOC A;  4UPA A;  4LF5 Q;  4JBJ A;  4NXN L;  2Z6K A;  1Z47 A;  4X64 Q;  4A3B H;  4QY7 A;  1FL0 A;  1KRT A;  5IYB H;  3HOV G;  1EOV A;  2R6G A;  2UUA Q;  3RNU A;  1S3O A;  3I4M H;  4LWC A;  3ERS X;  5M5W H;  3ULL A;  5HY6 A;  1X9N A;  3M4O H;  3JAM c;  4C2M H;  4LF7 Q;  1K8G A;  4OWT B;  4P74 A;  2E5L L;  1PYB A;  4JI2 L;  1E22 A;  3I4M G;  5GAH C;  4YHH L;  3RR5 A;  4DUY Q;  4A3F G;  1UWV A;  3PO3 H;  4L5S A;  2MO0 A;  2JA6 G;  1YHB A;  4Y52 H;  4BY1 G;  2ZTD A;  4R4I A;  3OTO Q;  4AQY Q;  4JYA L;  3RLF A;  3ICE A;  2N3S A;  4LF4 L;  2VUM G;  1OTC A;  1XNQ L;  4DR3 Q;  1EFW A;  4LUO A;  1N8R C;  2KHI A;  4LF6 L;  5LMU L;  3E9H A;  4OWX B;  3I2Z A;  4RMF A;  2NVX H;  1NBW A;  4A3L H;  1NMG A;  1WCM G;  2F3I A;  2PI2 A;  3W5O A;  1I5F A;  3STB C;  4A3L G;  4YCV A;  1VQH A;  3CC7 A;  1P8L A;  1WI5 A;  2I0Q A;  1PYS B;  3K7U C;  3KJO A;  4B3M L;  1TWC H;  1OXX K;  2VY3 A;  2IX0 A;  1K3R A;  3HKS A;  4C3I H;  4X62 L;  4BXX H;  4ALP A;  2CWA A;  1GKH A;  3PUW A;  3UE1 A;  1ASZ A;  4HJA A;  2B63 H;  1NY4 A;  4JI6 L;  1C9O A;  4NXN Q;  1CKN B;  2VQE L;  3BZK A;  4GN5 A;  5GAE C;  3M4Q A;  2PQA A;  2MNA A;  1KL9 A;  3CPF A;  2EXD A;  1HNX L;  2R93 H;  4X65 Q;  5C4X G;  1GO3 E;  5ELN A;  1E24 A;  4GNX B;  2N49 A;  4DR1 L;  2VQF Q;  4GOP C;  3I56 A;  2F4V Q;  3HOZ H;  2KCM A;  4JI2 Q;  4IPG A;  1N9W A;  2JK8 A;  4HJ9 A;  2A19 A;  2Q2T A;  3CC2 A;  2R93 G;  4RG1 A;  4Y7N H;  3HOZ G;  4L5T A;  1RIP A;  4LFA L;  1TWH H;  4P75 A;  5M3F H;  1XJV A;  1XPO A;  1K8A C;  4POG A;  4A3J G;  2YYZ A;  4R4Q A;  4OON A;  4NB3 A;  3A0J A;  2OTL A;  1XMQ L;  3HOV H;  1IBM Q;  4NPS A;  1HNZ L;  1WFQ A;  4JI4 L;  2K5N A;  5FLX c;  5EAY A;  4A3K H;  3EN2 A;  1MJE A;  2YTX A;  3K7A H;  4IOA A;  3BZC A;  2NVY H;  3EIV A;  4GN4 B;  2K5H A;  3M85 A;  4DR2 L;  1VQ7 A;  3U50 C;  5C44 G;  4L5Q A;  4JG2 A;  4JI7 L;  1AH9 A;  2YV5 A;  3HOX G;  4AYB G;  3HOU G;  2BH2 A;  4B3M Q;  3J7Z C;  3K80 C;  1XMO L;  4X62 Q;  1Y14 B;  2MQH A;  3E9I A;  1BBU A;  4LF9 Q;  1D8L A;  4BA2 I;  1SE8 A;  1HZA A;  2N8N A;  4YWK A;  3L7Z C;  5M5Y H;  1VQ9 A;  1JT8 A;  2BH8 A;  3PV0 A;  4K0K L;  2VQE Q;  1TWA H;  3A74 A;  4HJ5 A;  4GOP B;  4DV1 Q;  1YI2 A;  3HOW G;  4A75 A;  3S14 H;  4A3M G;  1HNX Q;  1TXY A;  1UE6 A;  2HHH L;  4BY7 H;  1XTD A;  1UE7 A;  2OCE A;  1AE3 A;  1G29 1;  3M4P A;  4EQ5 A;  3KYH C;  3PO2 H;  3RZD H;  1X3G A;  1PH2 A;  5DLQ E;  4JI3 L;  1YHQ A;  4BY7 G;  4R4T A;  2R7Z G;  4LFB L;  4JI1 L;  1Q82 C;  2UXB Q;  1IL2 A;  4LFA Q;  3MEF A;  3AEV A;  3CCE A;  2JA8 G;  4LF7 L;  4GKK L;  1LYL A;  4GS3 A;  1K73 C;  3G48 A;  1HZC A;  4MNO A;  1LTL A;  1CKN A;  1XPU A;  1Q1E A;  5C0X J;  4JI4 Q;  4OX9 L;  2JA5 G;  2PI2 E;  2BA0 A;  3FHW A;  3NBH B;  1E3P A;  3CF5 A;  1U5K A;  2XTI A;  3G71 A;  1PH7 A;  2HT1 A;  5FLM G;  3F2D A;  2NN6 G;  4GNX A;  5AJ3 Q;  4DR3 L;  3KFU A;  3AFP A;  4DR2 Q;  1KC8 C;  3TEH B;  3KF6 B;  5JJI A;  4A3D H;  1X55 A;  2CCZ A;  1R9T H;  1XMO Q;  1PH1 A;  2CQO A;  2I5H A;  4PMW A;  2WAQ E;  5IY0 A;  2YU9 H;  5IYC H;  3U4Z A;  3OW2 A;  1M1K C;  2A8V A;  4K0K Q;  1EWI A;  3A5U A;  1PA6 A;  1YEZ A;  5HGQ A;  2DGY A;  1GD7 A;  5BR8 L;  1C0A A;  2IY5 B;  3J80 c;  3PSI A;  4PZ8 A;  5J3B A;  2UUC Q;  3S1Q H;  4IFD I;  2HHH Q;  1FJG Q;  5GQO A;  4JOI C;  4JBM A;  1FVI A;  2K75 A;  1VQL A;  3S17 H;  2ALY B;  3TRZ A;  4JI3 Q;  4DUZ L;  4LFB Q;  4JI1 Q;  4X65 L;  4A3B G;  5IYB G;  2C35 B;  3G6E A;  1PH9 A;  2Y0S G;  1I3Q H;  1IZ6 A;  2VQF L;  1VQ8 A;  2F4V L;  4GKK Q;  3CME A;  3CCS A;  1CKM A;  4IPH A;  1KXL A;  3PIO A;  3GO5 A;  2R7D A;  1PHJ A;  1YJ9 A;  3T1H L;  2CWP A;  3CPW A;  2ZTE A;  1KHI A;  1NE3 A;  1P16 A;  4GOP A;  4OO1 I;  4OX9 Q;  1NTG A;  3D31 A;  4DV2 L;  3PO3 G;  3H3V I;  4LUZ A;  1VQP A;  5JJK A;  2Q2I A;  2EQS A;  1IBM L;  4BBR H;  5GAD C;  1QZH A;  4X6A H;  1Q86 C;  4BBS H;  1KD1 C;  3W1G A;  1QVG A;  1DGS A;  1A62 A;  2VS1 A;  2ZM6 L;  3DLL A;  1CUK A;  2KBN A;  4R1J A;  3TQY A;  4BBR G;  2JEB I;  1VQF A;  3HKZ G;  4DNI A;  3J7A 5;  4LUV A;  2L15 A;  3S2H H;  2K4K A;  2JQO A;  1SRO A;  1BKB A;  3CCJ A;  3Q8D A;  4O0A A;  4HJ8 A;  4DAY B;  1LM0 A;  1SN8 A;  1VCI A;  5IWA L;  5K36 G;  1X56 A;  4LF9 L;  5BR8 Q;  4DR7 Q;  3M3Y H;  3K81 C;  4BXX G;  3KF6 A;  2JA7 H;  2WP8 J;  2Z0S A;  2JJQ A;  1S40 A;  1MKH A;  4DV1 L;  2B63 G;  4YWM A;  1D7Q A;  3GTL H;  3LGJ A;  4DUZ Q;  2OWO A;  3S1N H;  2NZH A;  4FDB A;  4B3S Q;  1PH8 A;  5IP9 H;  3BU2 A;  2AMC B;  4DPG A;  3H3V H;  3B6Y A;  2UXB L;  4KLK A;  3T1H Q;  4B3T L;  4OO1 G;  2RF4 A;  1VQA A;  3CCU A;  2Z6K C;  5LMN L;  1VQ4 A;  1G6P A;  3GTP H;  2KCT A;  4UP7 A;  4DV2 Q;  2LSS A;  4R4O A;  1QVF A;  4A3G H;  4P73 A;  5M3F G;  1CSQ A;  2HQL A;  2K52 A;  1EIF A;  3AYH B;  3RLN A;  3J81 c;  2LXJ A;  2QEX A;  2UU9 Q;  2CFM A;  2ZJQ A;  3H0G H;  4L5R C;  3H15 A;  3M9B A;  2ZM6 Q;  1JE5 A;  2A1A A;  4DV7 L;  2GVB A;  4MTN A;  4MZ9 A;  4C3H H;  5AJ3 L;  4A3K G;  3S1R H;  4YY3 L;  3TS0 A;  1VQN A;  4JI0 L;  2YTY A;  4KI0 A;  1A0I A;  1MIU A;  1QVC A;  4YCU A;  3CAM A;  4DK3 C;  5IWA Q;  4DAM A;  1JJC B;  4HIK A;  2R92 H;  3F8T A;  1ASY A;  1G51 A;  5IYD H;  3CCR A;  1VS0 A;  1IBK L;  2UXD L;  3IRB A;  1PV4 A;  1N32 Q;  1YIJ A;  2N78 A;  3CP0 A;  1YIT A;  3PUY A;  1UE5 A;  3SGI A;  1Q1B A;  1VQD A;  1VQJ A;  4TVA B;  4X66 Q;  1EQR A;  1E1O A;  1E1T A;  2RHQ B;  2Y0S E;  2UUC L;  3DM3 A;  4ME3 A;  4A93 H;  4YCW A;  1FJG L;  2Q2H A;  2JE6 I;  1J5E L;  5IE8 A;  1B7Y B;  3PUZ A;  4LFC Q;  4A3C H;  1H95 A;  1SMX A;  1YZ6 A;  4IPD A;  1EUJ A;  4B3T Q;  4OXP A;  3JAM i;  1WJJ A;  4A3E H;  2R7Z H;  3PO2 G;  5LMN Q;  4JOI A;  4DV6 L;  4JV5 Q;  3S15 H;  4GKJ L;  1KRS A;  5ELO A;  2IHE A;  1N34 Q;  3EBE A;  4DV5 L;  4BA1 I;  2FXQ A;  1VQC A;  3STB D;  5LMN W;  4LF8 L;  4QJF A;  4YWL A;  4WJ3 M;  2JA9 A;  2AWO A;  4QL5 A;  4IJH A;  4HIO A;  4HIM A;  4DV7 Q;  4LNQ A;  1Y1W H;  1I94 Q;  1HZB A;  4YY3 Q;  1S72 A;  1X3F A;  3CMA A;  4JI0 Q;  4JI8 Q;  3UDI A;  3HFZ B;  3CXC A;  5C3E H;  2LXK A;  1JJG A;  3RN5 A;  3ER0 A;  2IHF A;  3I4O A;  1HZ9 A;  3PGZ A;  4IJL A;  4A3D G;  1BVS A;  4WJ4 A;  3T1Y L;  1I50 H;  1VQG A;  1N33 L;  4DR4 L;  1J6Q A;  3AFQ A;  1IBK Q;  1QUQ B;  4PG3 A;  2UXD Q;  3S24 A;  3F2C A;  2AWN A;  2H5X A;  3CC4 A;  1UEB A;  1Y1V H;  2IT1 A;  1GM5 A;  3NEL A;  2MO1 A;  5IYC G;  2DUD A;  4POF A;  4HJ7 A;  1EIY B;  2OQK A;  1Y1V G;  4DR7 L;  2WFW A;  2E8G A;  4XIG S;  2Q2U A;  3PF4 A;  2VNU D;  4QIW E;  1YJN A;  3S2D H;  1O7I A;  1J5E Q;  1X65 A;  1K83 H;  3BJU A;  4C3J H;  3U4V A;  4QQB X;  2YTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...