5IP9H

Structure of rna polymerase ii-tfiif complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9H00
4DNIA 5IE8A 2QEXA 1AH9A 1HZCA 5FLMH 4HIKA 1YITA 5IYBH 4DV7L 2EXDA 2OTLA 4DAMA 1CKNB 4BY1G 1PYSB 1NE3A 4JBMA 4A3GH 4GKJQ 5EAYA 3RLNA 4DPGA 2E2JH 1VQLA 2AMCB 3F2CA 3CD6A 3PO2H 4BXXG 1K73C 3EBEA 4AIMA 4JI5Q 2Y0SG 1IYJB 4JOIC 3I7FA 4GN4B 1SN8A 4JBJA 3KJOA 1S72A 1YHQA 2HT1A 4HIOA 4A93G 1JJCB 1OXTA 1IZ6A 3CQZH 4A4IA 4LF8L 1XNQQ 3OW2A 1DGSA 2Q2TA 3OTOQ 4DV4L 2VQEQ 4JV5Q 1UWVA 1PH9A 3VDYA 1EOVA 1RIPA 3HOWG 3E9IA 1VQMA 4IPGA 1HNWQ 3KYHC 1R9TH 2R7ZG 4BA2I 4DR4L 1QUQB 2VW9A 4LFAL 1XNRL 1VQAA 4X62L 3GTLH 4JI7Q 4DK6C 3K81C 5GAEC 1L1OC 4A3MH 1O7IA 4A3CH 5K36G 4HJ9A 5AJ3L 3HOVH 4HIDA 1M90C 1NTGA 4IO9A 1M1KC 4LF8Q 1TWAH 3H0GG 4GNXB 1U0LA 4LF4Q 1OXSC 3PO3G 3I4NH 2ZTCA 2DGYA 5ELNA 1A62A 3PV0A 3UDGA 2UUCQ 5C4XG 5HY6A 4A3KG 2D62A 5M3FG 1Q7YC 1LM0A 1B8AA 2AHOB 1VQ9A 4JI4L 2GVBA 3AEVA 4GOPC 3PIPA 4LFAQ 1G291 4A3DH 1XNRQ 4X62Q 2VQFL 3NEMA 1IBKL 2UXCQ 2VUMH 3CMAA 3UE1A 1TXYA 1CSPA 3CCQA 4KHZA 4DR5L 3I4OA 5AJ3Q 4DV0L 2ZJRA 1Y1VH 4TVAB 1QVCA 3TRZA 1X6OA 3CPWA 1C0AA 1T9HA 4DUZL 1Z9FA 4B3TL 4JBKA 1FJGQ 1TWFH 2QA4A 3RLOA 4A3LH 3L7ZC 1N32L 4NXNL 1VQKA 4DR1L 3E9HA 2PI2E 2NVQH 2ZJPA 1EQQA 2JQOA 3PO2G 3S2HH 1EQRA 3JAMi 4IOCA 4DR7Q 1NY4A 2YYZA 3STBC 1Y14B 4JI4Q 5JJKA 3GTQH 2I5LX 3J80i 1VCIA 2IX1A 1WI5A 2XTIA 3L2PA 1SFOH 4R4CA 3PGZA 4L5SA 2YV5A 2LXJA 3S16H 5GAGC 4DV0Q 3DLLA 4LNQA 4BXXH 2Z6KC 1CSQA 1P16A 4DUZQ 4UP9A 1X3GA 1VS0A 1N32Q 1EYGA 4B3SQ 3TEHB 5M5XH 4A93H 4BBSG 4AQYQ 2JA6G 3CF5A 2B63H 3HKSA 3G6EA 1XMOQ 3U4ZA 4IFDI 4JOIA 2VNUD 4IPDA 1Q8KA 1PH2A 1IXRA 1I6HH 1YHBA 3ULLA 1XPOA 4OO1I 3RZDH 3HOWH 2K50A 2R6GA 3PUYA 4LUVA 4JI1Q 4P74A 3GTMH 2R7ZH 3PUWA 1JE5A 2UUAL 1V43A 3S14H 1SROA 3PUXA 4JI3L 2N8NA 4GN5A 2NVXH 3JAMc 2A1AA 4JI0Q 3A5ZB 1MJEA 2NZOA 3BU2A 4TQUS 1A8VA 3AFPA 3J80c 3S1NH 4KLKA 4UY8C 3A0JA 5GROA 5C0XG 1SLJA 4BY7G 3H0GH 1HZBA 1S40A 1L1OA 1Q46A 1QZGA 1XPUA 2N78A 3PO3H 3K8AA 3F2DA 3GO5A 5ELOA 3FP9A 4GKJL 5C4XH 4DR2L 4A3KH 4YWLA 4DAYB 5H1SE 1YHAA 2A19A 5M3FH 2A8VA 1LTLA 2FXQA 2UUAQ 4JI6Q 3S1RH 2RCNA 4PZ8A 3S24A 4X6AH 1YBYA 3EIVA 2E8GA 2KHJA 4JI5L 4WJ3M 4O0AA 1SE8A 3ERSX 3G48A 1X55A 4GOPA 3KLWA 2D0PA 4IPCA 4BBRG 1XNQL 3OTOL 1A0IA 3HFZB 2NN6G 2VQEL 3TS0A 3H3VH 4JV5L 5LMNQ 4NB3A 2PNHA 4GLAC 1K8AC 4NXMQ 1VQDA 3MXNB 2CQOA 4PZ6A 5M3MG 4DR2Q 3CC4A 3S2DH 1PYBA 1YNXA 1I94Q 4AYBE 1XMQL 3HOZG 1HNWL 3SGIA 2CKZB 4R4TA 1PH3A 3KDFA 2KCMA 2N49A 4JC0A 3RNUA 1N36L 2JJQA 3A74A 3M9BA 4JI7L 1PVOA 2F52A 3GD7A 2Z0SA 1HZAA 3H15A 3FHWA 1C9OA 2B63G 3FKIG 4RMFA 3UDFA 5C44G 1TWCH 1JJGA 3I2ZA 1B7YB 4HJ5A 3T1YL 2R7DA 1OTCA 3ULPA 1V9PA 1CKMA 4LF4L 2ZM6Q 1VQPA 3KFUA 3E0EA 3U58A 4JI2L 1D7QA 4GLXA 2UUCL 1Z47A 4LF9Q 2JEAI 4BBSH 2JEBI 1HNXL 3RN2A 2K75A 1XMQQ 2KBNA 5LMUQ 2JA6H 4APVA 1VQFA 2OTJA 2IHEA 1UE5A 4A3EG 1HZ9A 1E3PA 1WCMG 5JJLA 1X56A 4BA1I 4RG1A 4L5RC 4DV6L 1N36Q 2UU9Q 1FGUA 1Q1BA 1VQ6A 2UXCL 2IY5B 1XJVA 4R4IA 1VQ8A 4LFBL 2EIFA 4QJFA 3TS2A 2KENA 2HIXA 2R93G 3GTGH 4DKAC 3T1YQ 2YTXA 1VQIA 2C35B 1FJGL 3I55A 4AYBG 4L5QA 4JI2Q 3J81i 1VQHA 4GS3A 2UXDQ 3UDXA 1HNXQ 4GLVB 1AE3A 3CCSA 4HIMA 4KI0A 1W2BA 3CCJA 3RN5A 4BY7H 1W3SA 3NBHB 2NVTH 4DR7L 3PUVA 5IP9G 1X9NA 3STBD 4DV6Q 4P72A 3M4OH 1OXXK 1E7ZA 1L2FA 1D8LA 2CWAA 2I5HA 3MEFA 5IWAL 1YJ9A 1EWIA 2ES2A 3TQYA 1OXUA 4R4OA 1EIYB 3M3YH 4LFBQ 1X3FA 4X65Q 5GADC 1UE6A 3PSIA 3KF6B 1KHIA 1OXVA 4OONA 1Q12A 2CFMA 2JA9A 4YHHL 2Q2IA 5JEAG 2AKWB 5IY0A 4B3SL 3HOUG 4DR6L 5IT9c 1A63A 4XTCS 4AQYL 2KCTA 2UUBQ 1B70B 1XMOL 2B3GA 4BBRH 2ZTDA 1E24A 3CPFA 2UXBQ 3PCOB 5IYDG 1KXLA 1SMXA 2JK8A 5IWAQ 4YCUA 3F2BA 4JI1L 3GTJH 1NMFA 5M3MH 4LWCA 4DV1L 1QVGA 3AYHB 3HOZH 3J81c 5HGQA 4GKKQ 4EQ5A 1J6QA 2Q2UA 2OWOA 1QUQA 2F4VL 4JI0L 4A76A 1CUKA 4YHHQ 2PMZE 2WAQG 5LMNW 5FLXc 1X3EA 3KJPA 4A75A 1YJWA 4DR6Q 4YY3L 3UE0A 1KRSA 3RR5A 3M85A 2RF4A 2HHHQ 2JA8G 3FKIH 5C44H 4QL5A 5E7NA 4YWKA 1IBLL 1LUZA 2E5LQ 5IYCG 1JT8A 1I3QH 1WFQA 1EUJA 3F8TA 4LFCL 1GO3E 4JCVE 3AQQA 4B3MQ 1HR0L 2R92G 5JJIA 3I4MG 4A3IG 4DV1Q 4P73A 4LF9L 2ATWA 4JI8Q 1SRUA 1UE1A 5M5WH 4GOPB 4JI6L 2LSSA 4A3EH 1GVPA 1WCMH 5C0XJ 3S1MH 2VL6A 2F4VQ 2BA0A 4OWWB 4OWXB 4LW1A 3IRBA 4JBWA 4O2DA 3AFQA 4B3RQ 4YY3Q 1WJJA 2I0QA 4X66L 1QZHA 4HJ7A 1IBLQ 5FJ8G 2R93H 3DM3A 1ASZA 2JA5G 5GAHC 3Q8DA 5LMNL 4LFCQ 2H5XA 4NXML 1HR0Q 2E2HH 2GVAA 2OCEA 1NBWA 1YI2A 1Q81C 1BVSA 1VQEA 1MJCA 1X54A 4MNOA 1I94L 2IT1A 3B6YA 3HKZE 4XIGS 1C7YA 2DUDA 2ZJQA 2QGQA 4DR3Q 1IL2A 5IP9H 3CCEA 2YTYA 4P75A 2VS1A 3U50C 1KQSA 4LF7Q 3ICEA 3W1GA 3S15H 4X66Q 4UPAA 2AWNA 1N34L 1I5FA 1KC8C 2VY3A 4JYAQ 4UP8A 5C4JH 2ZTEA 2ZM6L 1EFWA 2R7FA 1VQBA 4QY7A 5M5YH 3HOUH 1Q1EA 1WYDA 1Q82C 4OX9Q 3K80C 5LMUL 2PQAA 4OWTB 2MQHA 3J81j 2V1CC 4H02A 3J7ZC 4IFDG 5IP7G 1YIJA 3GTOH 2UU9L 2GN5A 4C3HH 1PA6A 1XPRA 1J5EQ 1HJPA 3LGJA 4X64Q 4OO1G 4GNXC 4HJAA 1PH5A 2B29A 1RL2A 4LUZA 1H95A 4QGUA 2WB1E 1N34Q 4DUYL 2K5VA 2XGTA 3T1HL 1N8RC 2BA1A 1KRTA 4L5TA 1IBMQ 4MTNA 3W1BA 3HKZG 1U5KA 1BKBA 1JMCA 2UXDL 2JA7G 3F1ZA 2Z6KA 1PHJA 2K5HA 2JA8H 1UE7A 1PH1A 2YU9H 2MO1A 3PUZA 4A3JG 5IYCH 4DV3Q 3H3VI 4LF5L 4GN3B 2R92H 4K0KL 3OYYA 1VQ7A 3I4MH 4A3IH 4LF6L 4R1JA 1KAWA 1JJ2A 4X65L 2OQ0A 1PH6A 1VQGA 1PH4A 4DV7Q 4P71A 1BBWA 1N33L 4DUYQ 3EN2A 2F3IA 3T1HQ 3HOYG 1GKHA 4Y7NH 2BH2A 4DV2L 5BR8L 3CCVA 3CP0A 4YWMA 1YJNA 1GM5A 2BH8A 3GTKH 3CXCA 1PV4A 1K3RA 2IHFA 2WAQE 4OXPA 2UUBL 3ULJA 1BBUA 3ZJYC 5FJ8H 1E1OA 2MNAA 3GTPH 4NPSA 4PZ7A 2UXBL 2JA5H 4LF5Q 1FL0A 3WWVA 1CKNA 4YCVA 1PH7A 4A3BG 4K0KQ 2WB1G 1KD1C 4QIWE 5JEAJ 2K52A 2RHSB 3HOXH 3CC7A 3CCRA 1UEBA 5C3EG 3CW2C 4LF6Q 2N3SA 4GKKL 4DK3C 3M7NA 1CKOA 2PI2A 1GD7A 4ALPA 5IYDH 4EX5A 4A3FG 1N33Q 4DV4Q 1Q86C 2ID0A 4DV2Q 2ASBA 5BR8Q 1HR0W 4J15A 1MIUA 4UP7A 1N9WA 4PG3A 2LXKA 3CAMA 3D0FA 2CWPA 2HHHL 2ALYB 2KHIA 2E5LL 1FVIA 2OQKA 1Y1WG 3UDIA 5DLQE 4DR4Q 5GQOA 4PMWA 4B3ML 4IJHA 2NZHA 3W5OA 4LUOA 1YVCA 3RZOH 1G51A 3K7AH 4JI8L 2VZAA 3TREA 5C0XI 4IPHA 4QQBX 2MO0A 5FLMG 1YEZA 4IJLA 4C3JH 5IYBG 1L1OB 1WOCA 5IP7H 1KIXA 3NELA 1NMGA 1SR3A 3M4QA 4JG2A 1ASYA 3J7A5 2Q2HA 1VQ4A 4B3RL 1LYLA 4A3GG 2D0OA 1HNZL 1TWGH 4Y52H 2K5NA 3L0OA 3U4VA 1K9MC 2K4KA 5J3BA 4GNXA 4POGA 3S1QH 4BY1H 1G6PA 2VQFQ 1IBKQ 1K83H 3BZKA 2JA7H 2AWOA 1I50H 4DR5Q 3K7UC 4A3JH 4DR3L 2WP8J 3S17H 3KF8B 3A5UA 2NN6I 1QVFA 4B3TQ 4ME3A 2HIVA 1YZ6A 1MKHA 1VQCA 4LF7L 3G4SA 3PF5A 4NXNQ 1E1TA 3NENA 4DR1Q 1VQ5A 1HNZQ 1K0RA 1VQNA 2PQAB 1PFSA 1P8LA 2IX0A 3BZCA 4FDBA 3KDFB 3PIOA 1EIFA 1NJIC 1PH8A 4DV5L 4JYAL 1K8GA 1VQOA 3KF6A 3D31A 2WFWA 1KL9A 1TWHH 4AH6A 3CCMA 3HOYH 3CC2A 4KHPL 3HOXG 4A3MG 3K0XA 3M4PA 2L15A 4OX9L 4A3CG 4WJ4A 2E2IH 4YCWA 3HOVG 3CCLA 3PF4A 4C3IH 1X65A 4HJ8A 1S3OA 3ER0A 1J5EL 4A3BH 3I56A 3RLFA 4X64L 3G71A 3CCUA 3I4NG 2HQLA 1L0WA 4R4QA 2Y0SE 1AE2A 4C2MH 5C3EH 4IOAA 2K14A 2I5MX 3KOJA 1VQJA 2MFIA 4DV5Q 1JB7A 1HH2P 4A3FH 3CMEA 4IFDJ 1E22A 4A3DG 1IBML 2VUMG 4KHPQ 1XTDA 2NVYH 2EQSA 2RHQB 2CCZA 1Y1VG 4MZ9A 4DV3L 1V1QA 1Y1WH 4POFA 4JI3Q 3JC66 3BJUA 2YTVA 4A3LG 2JE6I 3GDEA
chains in the Genus database with same CATH superfamily
1CHQD 4LJZC 1CK1A 1S5ED 1W6KA 2QEXA 1X3PA 5FLMH 2F0EA 5JPNC 2EXDA 4K5XA 4DAMA 2EYOA 5EPKA 4DAPA 1VMCA 4OGQC 3Q23A 2E2JH 3GTGB 2PQEA 1WTQA 4H44C 1HQMC 3IL8A 3I7FA 4JBJA 4V0BA 3OHXC 1YHQA 2HT1A 1JJCB 2TSSA 3QJYA 4A4IA 4LF8L 1XNQQ 1DXMA 3OW2A 2K5DA 5EPLA 1DGSA 2Q2TA 2EYLA 3H91A 5ELDA 1QJOA 1UWVA 1RDPD 1EOVA 1RIPA 2EZVA 3Q0AA 4IPGA 2OEOA 3KYHC 4BA2I 4ZUJA 1PZJD 4LFAL 1XNRL 1VQAA 3GTLH 4JI7Q 3MXNA 1L0YB 4BBRB 4HJ9A 5AJ3L 3HOVH 4HIDA 4RAUC 4GNXB 2EXZA 5EKIA 2UUCQ 1JWSD 2D62A 2F0IA 3SR1A 5C4HA 3PIPA 2VQFL 2UXCQ 3FKIB 2L11A 1O78A 1SAPA 2ZJRA 5BN4A 5NUCA 3TRZA 1X6OA 2F0NA 3VR6A 1Z9FA 4JBKA 2FMCA 4A3LH 3L7ZC 4NXNL 3E9HA 3TP7A 1WCMB 2EYPA 3S1MB 2JQOA 2RDFA 4DR7Q 3HG9A 3GTQH 1VCIA 1ESFA 1WI5A 4BS9A 4R4CA 2R61A 3DLLA 4DV0Q 1Z6HA 2K5QA 1CSQA 4DUZQ 1GUNA 1N32Q 5M5XH 1ILPA 2B2WC 3G6EA 4H13C 4IFDI 1Q8KA 5KEEA 4JVZA 5I9OA 1TIID 3HOWH 2K50A 2R6GA 1EZ6A 2XVSA 4LUVA 3PIO3 4KKUA 1K28A 4X3SA 1SROA 4JI3L 2NVXH 4TQUS 2D2CC 1ICFB 2HCCA 4HSVA 4IQZA 4DNRB 5GROA 5C0XG 4KK7A 4BY7G 3H0GH 1S40A 1QZGA 2N78A 3FP9A 1U4RA 4A3KH 1OO9B 2A19A 2M2LA 1LTLA 2FXQA 2UUAQ 4JI6Q 2HDLA 2RCNA 1YBYA 2WAQB 2E8GA 4ZK9B 1D2BA 4WJ3M 3FRPB 2JA8B 3SK4A 1KABA 3EFXD 2RBMA 3D4RA 2D0PA 2R92B 4RGOS 1W6JA 3OTOL 3H3VH 3HFZB 2NN6G 2VQEL 3I4MB 2O5JC 4NB3A 2PNHA 4NXMQ 1XYIA 4PZ6A 5CV9A 3S2DH 1YNXA 1I94Q 4ZCKA 1XMQL 5L37A 3SGIA 2KCMA 3M9BA 2F0WA 5LL6S 1PVOA 2LMCB 3GD7A 2Z0SA 1HZAA 3H15A 4I7ZC 1NNXA 2A73B 2JA5B 1JJGA 1WTVA 4LF4L 2RDGA 1CKMA 3T16A 2ZM6Q 3ERQA 1D7QA 2Q8IB 4BBSH 2JEBI 1HNXL 3RN2A 2K75A 1TS2A 3LNNA 4HCEA 5JJLA 1EIHA 2B2WA 4DV6L 2UU9Q 1FGUA 1VQ6A 2IY5B 4LFBL 3X3NA 2HIXA 3SE0A 3T1YQ 2C35B 3BS1A 4Q0FA 1HXYD 4GS3A 2UXDQ 1EY4A 2XSCA 4HIMA 1W2BA 3H94A 3QB3A 3RN5A 3UI2A 3M4OH 1YJ9A 1L2FA 1VF7A 1B9MA 1OXUA 1VDZA 1ET9A 1EIYB 5DNFA 2XRQD 3PSIA 3PIP3 3KF6B 4BY1B 2B2YC 4YHHL 2Q2IA 5IT9c 4AQYL 5DAUA 5BN3A 2B3GA 4DK0A 3QIAA 2WACA 5C3WA 3F2BA 3GTJH 5CBAE 1BXTA 3T53B 1QG7A 1TWHB 2F4VL 3IFDA 3QOJA 1QUQA 1D1IA 1JWUD 1FNWA 2PZUA 1DONA 1CUKA 2PMZE 3MZ5A 1U4PA 5CMDA 1KRSA 4EVOA 3M85A 1TS3A 5C44H 1RODA 1IBLL 4RCNA 2XWJB 5IYCG 1WFQA 1BCPB 1EUJA 3F8TA 4JCVE 4A3IG 3SHLA 1LT5D 5C3EB 4LF9L 4ZUIA 4JI8Q 1UE1A 2LSSA 2EOTA 1GVPA 2SEBD 2BA0A 4LW1A 1Y69U 2SDFA 1B50A 3IRBA 5CV5A 4A3KB 4X66L 1Y1WB 4ZLTF 2R93H 5FJ8G 3Q8DA 5LMNL 2OXPA 1HR0Q 1HQRD 1B3QA 2OCEA 3E0JA 1NSNS 1HUNA 3B6YA 3HKZE 4XQJA 1SE4A 3BYYB 4FF3A 1PXUA 2JSOA 4HSPA 1KQSA 1YNJD 3W1GA 5J39A 3S15H 3C3LA 3PO2B 1N34L 4EQNA 2R7FA 3WDNA 3HOUH 1Q1EA 1EWCA 3CQZB 1C48A 2MQHA 2B2YA 1GXDC 1SEBD 4C3HH 1I4XA 3LGJA 4K2LA 4GNXC 4LUZA 1IKMA 4QGUA 2WB1E 5KNCA 4A3MB 3CRKC 1B1ZA 1JMCA 2SNMA 2DNCA 3W1BA 3F1ZA 1EY8A 5FO9B 1UE7A 2YU9H 2ZXRA 4G7OC 1RD9D 4GN3B 2HQEA 2F0QA 1GUGA 1RHPA 4R1JA 1XX8A 4X65L 1IW7D 2M9VA 4A3DB 1N33L 4CDDC 2BH2A 3CCVA 3A8JE 1QCBD 2BH8A 4PV1C 1K3RA 2O4XA 2MGSA 4XDXA 2I46A 1E2VA 1E1OA 4PZ7A 1I4QA 2OF1A 3K59A 3WWVA 2ZT9C 2NVQB 3HOXH 3CCRA 2RHSB 1JOQA 3CW2C 1JQYD 2Z6BA 1GD7A 4A3FG 2CW0C 1Q86C 2ID0A 1NUCA 4M8AA 1MIUA 2Z1CA 4UP7A 3VYRA 5GQOA 4IURA 4RFBA 2IX3A 2F0LA 2B63B 5I6YA 2MO0A 5FLMG 4C3JH 4L6TB 3NUCA 1I6HB 5T1GA 5IP7H 1AW7A 1WOCA 5A2QE 1EOTA 1O7YA 4B3RL 3NTHA 3S14B 1BR9A 3FPPA 5CV6A 2K4KA 4GNXA 3D8GA 3S1QH 1JORA 1G2TA 2VQFQ 1STNA 1K83H 1LTGD 1I50H 3RD4A 2EYHA 4A3JH 1Y8NB 4IUQA 2A68D 4DN4M 5EQ0A 3A5UA 1DM0B 2Z4HA 3AU7A 3P20A 4NMZA 4NXNQ 3JAME 1O7ZA 1EEID 1P8LA 1QNKA 3G7LA 5IGEA 4DV5L 1KL9A 5ELFA 3CCMA 2L15A 4OX9L 2D5DA 4E6IA 3HOVG 4CDCC 3PF4A 2IL8A 1J5EL 3ER0A 4A3BH 3I56A 3RLFA 2G9DA 4KY5A 2PCFB 5JPMC 1EY9A 2PNRC 1JB7A 1HH2P 4IFDJ 1E22A 3C2PA 1IBML 4KHPQ 4OEMB 3K5OA 1TWCB 5FO7B 1G91A 2EQSA 1EL0A 1DOMA 1GHJA 4MZ9A 4DV3L 1V1QA 4JI3Q 4R9WA 3BJUA 4A3LG 2KEDA 2JE6I 4DNIA 5IE8A 1HZCA 2SNSA 3BDLA 1AP0A 5AFWA 1BNZA 2PZWA 1CKNB 4BY1G 1NE3A 2L12A 4A3GH 5KNDA 2TMPA 1Q3LA 1I6VC 3F2CA 2CVRA 4KD3A 1SXTA 1S5BD 4RCOA 1ONLA 2B8FA 3DUZA 1C4QA 1J8IA 3M7GA 2RA4A 4K5VA 4BY7B 2WKDA 3LWUA 2X6LA 3OTOQ 4DV4L 2VQEQ 1PH9A 3VDYA 3HOWG 3E9IA 3VR2A 1CHPD 1R9TH 1WD1A 4DR4L 1QUQB 3X3MA 2XNAC 3K6OA 3BDCA 1D1KA 3K81C 4A3CH 4IO9A 3H0GG 5DM73 4LF4Q 1OXSC 2IPKD 2ZXPA 1BCPC 3UDGA 1ZXTA 3A8KE 4A3KG 3D4WA 4L63B 4R8NA 4QUCA 5I2YA 3QOLA 5KGUA 1LM0A 2AHOB 4JI4L 3CRLC 4JK1C 2IWHA 4X62Q 1IBKL 2VUMH 3CMAA 1TXYA 1CSPA 3OOCA 4KHZA 4ZKCB 4DR5L 1HA6A 1Y1VH 2VXWA 4HR7B 4B3TL 3NHHA 2LS01 1TWFH 5CV4A 2EYJA 1IHZA 2F1MA 1VQKA 4DR1L 5D65A 1UEAB 1MD2D 2K6AA 3PO2G 3EQLC 2YYZA 1FNVA 2I5LX 1RKNA 3J80i 3H3VC 1K0SA 2IX1A 2XTIA 4L5SA 2NTSA 2YV5A 4RHSA 3AMUA 5GAGC 3NSWA 2Z6KC 1VS0A 3TEHB 4BBSG 4AQYQ 3CF5A 3U4ZA 2VNUD 5LL6X 1BDOA 5ELBA 1YHBA 3ULLA 4OO1I 4F7XA 4P74A 4TSSA 1HCZA 1RJTA 3PUWA 1EEFD 5KYLA 2PZTA 2N8NA 1WTRA 4DXGA 4OIKA 1DYQA 1MJEA 1SNDA 2GA4B 4IZ8A 3J80c 3AFPA 1ZYRC 5K36H 4KLKA 4UY8C 1WTWA 1SLJA 3GTOB 1HRJA 2A6ED 1XPUA 3PO3H 3K8AA 1I4GA 5ELOA 4DR2L 1TVXA 5EGTA 3TZUA 5M3FH 4FXGC 3S1RH 3S24A 3OIPA 2KHJA 1EYCA 3OW7A 4O0AA 1EYAA 3NQIA 5IGCA 3ERSX 3KLWA 2DNEA 1NAPA 2K33A 1A0IA 4A3IB 1BO0A 1TT2A 2EYFA 5LMNQ 1A3TA 2CQOA 3OMGA 3NK9A 3SXHA 3RNUA 4X3KA 2IW3A 3M4YA 3FHWA 1PFMA 3GTPB 3MXPA 5C44G 3Q6SA 2B63G 3KUPA 1OTCA 3KFUA 3U58A 4GLXA 1Z47A 5E4XA 3V2TA 2HUGA 2OTJA 1VQFA 1BBXC 1E3PA 1X56A 1B9NA 4RG1A 2F03A 1N36Q 3I91A 4FXKC 3D3RA 1VQ8A 4QJFA 4HMIA 2R93G 4DKAC 1FJGL 2L4NA 1VQIA 2YTXA 3R2IA 4J1MA 3OIQA 4XT3B 4AYBG 3I55A 3K7AB 4JI2Q 3RZOB 4KMUC 1SNMA 3UDXA 3CCSA 5FOBB 1W3SA 3VYUA 2F0GA 2NVTH 3STBD 2Z9HA 4FXDA 2NZ1D 4P72A 1OXXK 1E7ZA 2I5HA 1TWGB 3MEFA 2ES2A 1FD7D 4R4OA 3M3YH 5G3LF 1X3FA 3U9OA 4X65Q 4KHVA 1OXVA 1I4RA 1Q12A 2CFMA 1CQVA 2G9HD 4B3SL 2AKWB 5IY0A 3HOUG 1A63A 4RKLA 4XTCS 2KCTA 1WVLA 4K14A 4FF2A 3S17B 1B70B 4KY7A 2ZTDA 1E24A 2J0TD 4QF4A 2Y0SB 4RA8A 5IWAQ 1NMFA 5M3MH 4KTAA 4DV1L 1QVGA 4Z9CB 5C3XA 3HOZH 4DA2A 2L55A 1NR2A 1SDFA 5HGQA 2PW5A 1J6QA 2JXMB 2F0MA 1CI3M 1J9OA 3KJPA 4K8JA 4DR6Q 1BOSA 1EIGA 2NB0A 3NPPA 3RR5A 3HEJA 1IYVA 4YWKA 1M4VA 2DY7A 1I3QH 3DHQA 5JJIA 3AQQA 3KK7A 4C2MB 3D4DA 3FEWX 5EJWA 3NTKA 3SDZA 5M5WH 4GOPB 4A3FB 4A3EH 4CDFC 2CH4A 2VL6A 3NQTA 4WFN3 4OWWB 5K5PA 2NVYB 4B3RQ 4YY3Q 4NW2A 2I0QA 2G5DA 2DJGC 4LFCQ 2H5XA 2L0CA 4I7AA 1SSOA 1XXGA 1NBWA 1LLRD 1Q81C 1BVSA 1VQEA 1MJCA 2K1BA 1C7YA 2E2HH 1ZEQX 3GTMH 2ZJQA 2QGQA 1IL2A 3CCEA 1Z7TA 4FF4A 1TS4A 2WV6D 5G3LD 2F0KA 4P75A 3URYA 1SYFA 3ICEA 2E2JB 1AN8A 1A15A 1A3UA 4UPAA 1I5FA 1SYGA 4UP8A 5C4JH 2ZTEA 4TKOB 5M5YH 3OWFA 1ILQA 5C4ZA 1Q82C 4OX9Q 3J81j 1A6XA 4C3JG 4K8IA 3J7ZC 5IP7G 5IYDH 1J5EQ 1HJPA 2FMMA 1H9SA 4HJAA 1EU4A 2K05A 1ZKOA 2KVMA 3T4AC 4DUYL 1N8RC 3GTLB 2BA1A 1KDAA 3MFYA 4L5TA 1IBMQ 3HOVB 1U5KA 1BKBA 1KAAA 1HA5A 2B39A 2K32A 4KJOA 2K5HA 3BYTB 2BE5D 4ZQ3A 4PQXA 3J7AV 3PUZA 4A3JG 4DV3Q 2K03A 2EVBA 3OYYA 1GUTA 4LF6L 3V05A 4XQNA 2HDMA 4DAYA 5JAVA 1LTSD 1ESRA 3ITPA 1BBWA 3T1HQ 4Y7NH 4O42A 1PTOH 3N52A 1GM5A 3GTKH 1WD0A 2RQXA 4HTHA 1I4PA 1BBUA 1JICA 1SMYD 3T51B 4LF5Q 4A3BG 1CKNA 2F0HA 4JW0A 4YCVA 3ND9A 4K0KQ 2NUCA 1KD1C 2E75C 5JEAJ 4FF1A 3M7NA 1CKOA 3GTQB 2PI2A 2F0TA 2KCNA 3P75A 2QDLA 4DV4Q 4DV2Q 2ASBA 2F3WA 5BR8Q 2F0VA 1ENFA 4F87A 1N9WA 2LXKA 4CKCA 1FVIA 1LABA 3HS0C 4DR4Q 2D9UA 4PMWA 2XIWA 5M5XB 1H9MA 2NZHA 4LUOA 1G51A 3TREA 2VZAA 5C0XI 1YEZA 4IFDH 4U68A 3NELA 3HOWB 1SR3A 4HEDA 1VQ4A 1LYLA 1X32A 4A3GG 1UAPA 4PNYA 3U4VA 1E2ZA 2NVXB 2MUYA 3KLSX 4ODGA 1RTNA 1G6PA 1IBKQ 2JA7H 4DR5Q 3H0GB 2WP8J 3NBHA 5CBEE 2NN6I 3IKJA 1QVFA 4B3TQ 2HIVA 1YZ6A 4LF7L 1VQCA 3G4SA 2ICEC 2VB3X 4DR1Q 1VQ5A 1HNZQ 3R8BA 2PQAB 1K8GA 1PRTF 3D31A 2WFWA 3HOYH 4WORA 1JC7A 1KLUD 3TP6A 1JOKA 3HGBA 4ME5A 4A3CG 4DFAA 2E2IH 4YCWA 3CCLA 1STHA 4C3IH 1JB3A 1LV9A 2NTTA 2PO4A 1S3OA 3S2DB 4X64L 4B9XA 3CCUA 2HQLA 2E76C 1U4MA 4LK1C 2K14A 2I5MX 2BOSA 3CMEA 2VUMG 1YNND 1CZGA 2CCZA 1Y1VG 4M1UB 3J81L 1DCZA 2EPBA 5A2QL 3A56A 2JYOA 4KD4A 4BBSB 1TY2A 1AH9A 3Q24A 5IYBH 5ELEA 4DV7L 4PMCA 2LKVA 2LFNA 3NP8A 1PYSB 5F2DA 4DK1A 2KJXA 3E6ZX 4JBMA 1WTXA 1TR5A 4G4KA 1VQLA 2JN4A 2AMCB 3CD6A 1PTOF 1K73C 3EBEA 2KCCA 3NE5B 3L3OC 4AIMA 2Y0SG 4RGNA 3VR4A 3JAML 5CR3A 1S72A 3GTKB 1XWEA 3TSSA 1OXTA 1PLFA 4KN7C 4TRDA 5CV7A 3VA5A 3H6MA 4IALA 3M4OB 1S5FD 4CJ1B 4K6LA 1TS5A 1VQMA 1PRTD 2FFKB 1T5XD 5IIFA 3K58A 4CHTB 2PPBC 2VW9A 4DK6C 5GAEC 1F2YA 1O7IA 2RKSA 2Z8LA 5K36G 4LF8Q 1TWAH 2IJ0A 3GTJB 1KLGD 4F8MA 3R93A 3I4NH 3PO3G 2DGYA 5ELNA 1A62A 3PV0A 2BE5C 5M3FG 2SOBA 1TU2B 2GVBA 4GOPC 4LFAQ 3NWTA 1XNRQ 4KKSA 1RF2D 3UE1A 5C44B 5I4DA 3I4OA 5AJ3Q 4DV0L 3J81E 4OIJA 3CPWA 2WINB 1C0AA 1T9HA 4DUZL 1FJGQ 1AFPA 1N32L 3HKZB 1S5CD 3DXJC 3RLOA 1MSHA 2PI2E 1KTKA 5FLXE 2ZJPA 4JPBW 3S2HH 1EQRA 2H4OA 3JAMi 4IOCA 1NY4A 1SMYC 5JJKA 2X69A 2QEJC 1EYDA 1PTOD 1D5MC 1SFOH 1KDBA 3PGZA 2MP1A 3S16H 2R93B 4ZRZA 4BXXH 4UP9A 4AYBB 2F0DA 4B3SQ 1G8ZD 5IGDA 2KOLA 5KIXA 1PZID 4A93H 4LAAA 1F2ZA 3HKSA 4NP5A 1WTHA 2RCFA 2BDNA 3OWEB 1XPOA 1H9SB 3RZDH 3PUYA 3S15B 2Z4IA 2MHVA 1V1OA 2R7ZH 3ND8A 1JE5A 2QILA 3A55A 2UUAL 1V43A 1LT4D 3HOUB 3FDTA 5BN5A 2A1AA 3JAMc 3Q22A 3A5ZB 3S1NH 1A8VA 4ULLA 3A0JA 2EJMA 4C3HB 2K04A 4G57A 5CGKA 3GO5A 3F2DA 4GKJL 5C4XH 4YWLA 4DAYB 2FHTA 1LTID 4J6HA 4PZ8A 2KQ3A 4JI5L 2V4DA 1B2TA 2YU9B 3QWNA 4GOPA 4IPCA 3C1FA 3I8ZA 3U9SA 1V8QA 4JV5L 1K8AC 3BG3A 1VQDA 1CM9A 5M3MG 3CC4A 1HNWL 3DWAA 3OSOA 3HOZG 2CKZB 1PH3A 1VMPA 4JC0A 2KECA 4CDEC 2F52A 1YNJC 2MPMA 3BVGA 1LO5D 4RMFA 1SJED 3R2TA 3I2ZA 1G2SA 1B7YB 1F77A 3T1YL 3NTIA 1GUSA 2ENBA 3HOXB 2JEAI 2NYZD 3AB9A 2JA6H 1AZPA 2RDHA 1XMQQ 2AQ1B 3TS2A 1YNNC 3E5SA 3DWQA 4A3EG 1HZ9A 4QUFA 3A7AB 4BA1I 1TY0A 2PW7A 1XJVA 2KA7A 4R4IA 2EIFA 1CFMA 3I70A 4OELB 4IUNA 2KENA 3GTGH 1HFNA 4L5QA 5TSSA 4C3JB 5EBCA 1HNXQ 3NBHB 3PUVA 3FVQA 2A6HD 4DV6Q 2CWAA 3P7JA 4DNTB 1EWIA 5C5LA 3TQYA 4LFBQ 3I4LA 1PDQA 1IW7C 2F0FA 3S1QB 1UE6A 2EY6A 3E3XA 4OONA 2JA9A 1K83B 1I50B 1GUOA 1XTCD 4A3JB 1XMOL 4BBRH 3NBIA 4K6DA 3ONAB 3PCOB 5IYDG 1ICWA 1VF5C 2JK8A 5IGGA 4JI1L 4B08A 1HUMA 3AYHB 1GJXA 2FINB 2B2UC 1JOOA 4OHJA 3OMCA 2OWOA 2X6GA 4JI0L 4YHHQ 1YJWA 4A75A 1EQTA 2R7ZB 5ELCA 1A2TA 3FKIH 3GV3A 4QL5A 5E7NA 4A3BB 4N8X1 1JT8A 3SVMA 3J7AF 1GO3E 1HR0L 1SRUA 1BUVT 1WCMH 5C0XJ 2K28A 3S1MH 2F4VQ 3K0YA 4O2DA 1R4QB 3KLSA 4CKEA 1SNCA 1EFID 1STAA 1M8AA 2C9OA 2J7ZA 1WJJA 4G7HC 2F0SA 1F9RA 4HN7A 1QZHA 1K3BC 1IBLQ 3DM3A 1ASZA 3WOEA 5GAHC 1JR0D 4XYQA 2AUKA 2GVAA 1YI2A 4LF9Q 3TN2A 3EROA 2IT1A 4XIGS 4DU9A 4UHVA 5EPJA 2A68C 5ISRA 5IP9H 2YTYA 1Y8PB 4A3GB 4LF7Q 3TDQA 4X66Q 2DN8A 4C56C 2VY3A 1A2UA 1DZ1A 4S3SA 4QIWB 1EFWA 2DY8A 4ZKBB 1VQBA 3K5LA 4GZYC 5JEAH 5LMUL 5HGTA 2PQAA 4OWTB 3SEBA 2V1CC 2EJGC 2O5IC 4IFDG 2GN5A 1RCVD 4X64Q 1PH5A 1RL2A 5JVH3 1R9TB 4NDXA 5D14A 3FMCA 1N34Q 4QB4A 2PYKA 5M9OA 2XGTA 1KRTA 2B2UA 3HKZG 2JA7G 1U9RA 2RSOA 2Z6KA 1PHJA 2JA8H 1E2WA 2EYMA 1PH1A 5EBDA 3TP8A 3H3VI 3MEHA 2R92H 2Q8RE 4FYDA 3I4MH 2AQ3B 5T1IA 2B2TC 4XT1B 1STEA 1PH6A 1VQGA 1PH4A 2WKCA 3SK6A 4DV7Q 1EY0A 3HOYG 2VUMB 4YWMA 2QF7A 3EVQA 2QW7A 3CXCA 1PV4A 2WAQE 3BDOA 1Y1VB 4OXPA 2UUBL 3ZJYC 2UXBL 4C3IG 1MGSA 4NPSA 1TWFB 2JA5H 3VYSA 1FL0A 1PH7A 2A5HA 1AZQA 3TMEA 2WB1G 1MI2A 4IUTA 3MC0B 2K52A 3MAQA 3CC7A 1UEBA 4F88A 4GKKL 1PYWD 1LTBD 4DK3C 1N33Q 2J4XA 1HR0W 2QDBA 2HHHL 3CAMA 3D0FA 1LT3D 1ET6A 2I07B 2KHIA 2E5LL 1QNUA 4C3HG 4B3ML 1AEXA 1CA6A 2E74C 4IJHA 3W5OA 4C1NK 1GHKA 1V1PA 1F9QA 4QQBX 1I4HA 5IYBG 1C8CA 4N8FA 3D6WA 3M4QA 2Q8TA 4JG2A 3J7A5 4OO1H 2Q2HA 1EWHA 3L0OA 3GQBA 5IGFA 4POGA 5IGBA 5E3FA 2A6HC 4BY1H 5DM63 3BZKA 3K7UC 1STGA 4DR3L 3KF8B 3MWYW 3PO3B 4CBVA 4ME3A 2K01A 3PF5A 5M3FB 1CA5A 2ZXOA 1K0RA 1VQNA 2B2VC 4FDBA 1PFSA 2IX0A 3BZCA 3S1RB 4JYAL 3SK8A 2QCPX 1VQOA 1QE6A 3CU7A 4IUUA 1EY7A 1CTMA 1ML0D 1TWHH 1U4LA 2B2TA 4WJWA 1HFGA 1FNUA 4KHPL 3HOXG 4WJ4A 5DEHA 4ILWA 3I90A 1R4PB 4HJ8A 3I4NG 3I73A 4I65A 2DJFC 5IT9L 4UAIA 1AE2A 5CV8A 5CC4A 5C3EH 4IOAA 1VQJA 4DV5Q 4XQQA 1SE2A 1F9PA 3RMHA 3CKIB 5J22A 5COYA 3H09A 4K5WA 1Y1WH 3JC66 1JE4A 2YTVA 1HPCA 2KHSA 1LT6D 4HIKA 4KJNA 3ZYYX 1YITA 2OTLA 1NR4A 3MTSA 2A6EC 3IFTA 2QKIC 1WTPA 4GKJQ 5EAYA 4KY6A 3RLNA 1DD2A 2HCIA 4DPGA 3PO2H 4BXXG 4JI5Q 1IYJB 2VB2X 4JOIC 5JJZA 4GN4B 1SN8A 3KJOA 4K2KA 3BZDB 4HIOA 4A93G 3CQZH 1IZ6A 2NVTB 1CT1D 4NKLA 4ID6A 5FO8B 2CW0D 4KKTA 4JV5Q 3M3YB 3N6RA 1HNWQ 3KBXA 4UDUC 2R7ZG 3EJIA 4IUPA 3DMUA 4X62L 2B2VA 1SYDA 1L1OC 4A3MH 5E4WC 3DEOA 2F0OA 5CYUA 3R3OA 1CQFA 1M90C 1NTGA 1M1KC 1U0LA 5M3MB 1EY5A 2L5TA 2ZTCA 5HURA 5I2XA 3HOZB 5C4XG 5HY6A 5IT9E 4FNFA 1TQOA 1Q7YC 3TP5A 1B8AA 4N9PA 1VQ9A 3AEVA 4PMBA 1NCVA 1G291 4A3DH 4IUVA 3NEMA 3CCQA 4H7BA 2AQ2B 3NXWA 1B4OA 1I3QB 4TVAB 1QVCA 2QA4A 1JCKB 5M5WB 5D3IB 2NVQH 4A3EB 1EQQA 4JI4Q 3STBC 1Y14B 3F2UA 5J1ZA 3W2DA 3L2PA 2LXJA 1X3QA 4LNQA 1P16A 1MBYA 5C5MA 1X3GA 5EKLA 1EYGA 1H9JA 2E2HB 1WTOA 3GTMB 5IODA 4LMQD 1EU3A 2JA6G 3P1HA 2B63H 1XMOQ 2MJ8A 1BCPF 4JOIA 3A7LA 4IPDA 1PH2A 1IXRA 1PRTB 1I6HH 4JI1Q 2XRSD 3WOFA 5C4JB 1S4ZA 3S14H 5M5YB 1H9KA 1TKWB 2E2DC 3PUXA 3IAYA 4GN5A 2RSNA 1DOKA 2N55A 4JI0Q 2NZOA 3BU2A 4CGYB 3BVMA 3BVZA 1HZBA 5E1FA 1CZWA 1L1OA 1Q46A 1RTOA 4HCSA 4X3UA 1SNPA 3S9WA 1EZ8A 4Q5VA 4G7ZC 5H1SE 1YHAA 2A8VA 4MTKA 1PMRA 4BWGB 4X6AH 1A3VA 3EIVA 2LY7A 1SE8A 5FLXL 3KBGA 2N88A 1LACA 1Y8OB 4EQPA 3G48A 3K57A 1X55A 1IKLA 1KNEA 4BBRG 1XNQL 4OL7A 3O13A 3TS0A 1B3AA 2OT2A 4GLAC 4KV6A 3MXNB 4DR2Q 2CH4W 1PYBA 2H1EA 3G6JB 4AYBE 1FGBD 2NWGA 4R4TA 2F4IA 2L9HA 3KDFA 2N49A 4X3TA 1B53A 1SYCA 4Y7NB 1PTOB 1N36L 2JJQA 3A74A 4JI7L 4DGZA 5KRUA 4KN4C 1C9OA 4B9WA 2FJ2A 3FKIG 3UDFA 1SYEA 1TWCH 3HRZC 4DXFA 4HJ5A 2R7DA 3MVVA 3ULPA 1V9PA 3PQIA 1VQPA 3E0EA 2RVLA 2WIIB 4JI2L 2EJFC 2UUCL 1BCPD 1V1PB 5JOBA 1B44D 3VR5A 2KBNA 1ENAA 5LMUQ 3MXGA 2F3VA 2PMZB 2IHEA 4APVA 1UE5A 1WCMG 4H0LC 2JP1A 4L5RC 1Q1BA 2UXCL 2A69D 1T5EA 1PFNA 4XXEA 1DOLA 1Q8IA 1EQVA 2EDGA 2HD3A 4RGTA 3J81i 1VQHA 4RKBA 3VA7A 4GLVB 1AE3A 5C0XH 4KI0A 3CCJA 4BY7H 4DR7L 2R3ZA 1X9NA 5IP9G 4EGVA 2F0UA 2CQAA 5IWAL 1D8LA 4RHRA 1IYUA 2EE1A 4MHEA 3DM1A 5GADC 1KHIA 1SYBA 1G6ZA 5JEAG 2A74C 4DR6L 2JA7B 3J7YW 3RUZA 3HP3A 1LTAD 2UUBQ 3DWPA 4P2CB 5I6WA 3C1EA 3CPFA 2UXBQ 2ICIA 3QR8A 3A54A 2NN6H 1KXLA 1SMXA 4YCUA 4LWCA 2L1BA 3K5MA 3J81c 1SNQA 3HOYB 4GKKQ 4EQ5A 2Q2UA 4A76A 1K8OA 5LMNW 2WAQG 5FLXc 1X3EA 3LX0A 4RH6A 2E2IB 4YY3L 3UE0A 2HHHQ 1ZYRD 2RF4A 2JA8G 4C3IB 3K5NA 1D6EC 5KYIA 4WRDA 1JWMD 1S5DD 1LUZA 2E5LQ 2KUMA 1KNAA 2K5WA 2WB1B 4LFCL 2R92G 1FR3A 4B3MQ 3I4MG 5LHY1 3I72A 4DV1Q 3VYTA 4P73A 2ATWA 4CJ0B 3L9AX 3LWEA 4JI6L 1SE3A 2CHBD 3QG1A 1L0XB 4HMJA 4OWXB 4JBWA 3AFQA 5JVG3 4HJ7A 4CJ2C 2JA5G 4NXML 3GP7A 1SNOA 4RWSC 1F2LA 1I94L 1X54A 4MNOA 1O80A 1D5ZC 2DUDA 4J8QA 3W3AA 4FVMA 4DR3Q 4QMGA 5C6AA 3U50C 2VS1A 2C5CA 1Q90A 2AWNA 1KC8C 4JYAQ 3KF8A 2ZM6L 3TBIB 4QY7A 4CKBA 1QB5D 1WYDA 3K80C 3TZDA 4H02A 4R8IA 1YIJA 3MXUA 3GTOH 2UU9L 1PA6A 2XN9C 1XPRA 4V190 2F0JA 4OO1G 2B29A 1H95A 4ABNA 4QCLA 2K5VA 3T1HL 4YIJA 4ZYSA 4MTNA 2P5ZX 1O7LA 2UXDL 1EY6A 3VR3A 1IL8A 1TWAB 2MO1A 5IOCA 5IYCH 4LF5L 2KEEA 3I4NB 3V96A 4K0KL 1LTTD 1VQ7A 4DF7A 1MSGA 4A3IH 1SJHD 3NWSA 1KAWA 3MFGA 3J80L 1JJ2A 2OQ0A 4P71A 1STBA 1HHVA 4DUYQ 3EN2A 2F3IA 1GKHA 4DV2L 5BR8L 3CP0A 1QWYA 1YJNA 3MA2B 2F0PA 2IHFA 3T56B 5A35A 1II3A 3ULJA 2MNAA 5FJ8H 3GTPH 3I3CA 3DEPA 3T13A 5D3DA 3SK5A 1HTLD 4QIWE 4LF6Q 1ENCA 1E0BA 5C3EG 3S2HB 2N3SA 3KLRA 4ALPA 4EX5A 1SFOB 3S16B 4J15A 1STYA 1PRTC 1K8MA 4PG3A 4EQOA 2CWPA 2ALYB 1SBBB 1H9RA 4O1NA 5EKKA 2OQKA 1Y1WG 4RGMA 4HAEA 3UDIA 5DLQE 1GOZA 4A93B 2A69C 1YVCA 2M00A 3RZOH 3K7AH 4JI8L 5I9PA 1DJRD 4IPHA 4ZAIA 4IJLA 1BF4A 4IN3A 1MHWC 1L1OB 3FPUB 1KIXA 3RZDB 4FO2A 1NMGA 5FK9C 1ASYA 2D0OA 1HNZL 1TWGH 4Y52H 2K5NA 2EY5A 2K7VA 1K9MC 3D6CA 5J3BA 1HTPA 2NBFA 3QO2A 1KDCA 1PZKD 3S1NB 1QOHA 2AWOA 1LTRD 2EY1A 3S17H 1UNSA 3A8IE 5C4XB 1MKHA 1FYCA 1E1TA 3NENA 4L8JA 1PH8A 3PIOA 1NJIC 4U673 3KDFB 5FKAC 1EIFA 5KNBA 3J80E 3KF6A 4AH6A 3CC2A 1PTOC 4A3MG 3K0XA 3M4PA 1GUWA 1QILA 4N9TA 1UUPA 1D5XC 1X65A 1BQQT 1PFBA 4XYOA 1F9SA 2XWBB 2AUJD 3G71A 3OPOA 3GV6A 2BCOA 5CORA 4FP5D 1L0WA 4R4QA 2Y0SE 4MN3A 4C2MH 3CHBD 3KOJA 2MFIA 3MHBA 2B8GA 2O2LD 4MIUA 4A3FH 4A3DG 4C1NI 2EY2A 3PMFA 4DAVA 1XTDA 2NVYH 2RHQB 3EA6A 4POFA 3HZXA 1F2MA 3C46A 3GDEA 2BDOA 2JA6B
chains in the Genus database with same CATH topology
4DNIA 5IE8A 2QEXA 1AH9A 1HZCA 5FLMH 4HIKA 1YITA 5IYBH 4DV7L 2EXDA 2OTLA 4DAMA 1CKNB 4BY1G 1PYSB 1NE3A 4JBMA 4A3GH 4GKJQ 5EAYA 3RLNA 4DPGA 2E2JH 1VQLA 2AMCB 3F2CA 3CD6A 3PO2H 4BXXG 1K73C 3EBEA 4AIMA 4JI5Q 2Y0SG 1IYJB 4JOIC 3I7FA 4GN4B 1SN8A 4JBJA 3KJOA 1S72A 1YHQA 2HT1A 4HIOA 4A93G 1JJCB 1OXTA 1IZ6A 3CQZH 4A4IA 4LF8L 1XNQQ 3OW2A 1DGSA 2Q2TA 3OTOQ 4DV4L 2VQEQ 4JV5Q 1UWVA 1PH9A 3VDYA 1EOVA 1RIPA 3HOWG 3E9IA 1VQMA 4IPGA 1HNWQ 3KYHC 1R9TH 2R7ZG 4BA2I 4DR4L 1QUQB 2VW9A 4LFAL 1XNRL 1VQAA 4X62L 3GTLH 4JI7Q 4DK6C 3K81C 5GAEC 1L1OC 4A3MH 1O7IA 4A3CH 5K36G 4HJ9A 5AJ3L 3HOVH 4HIDA 1M90C 1NTGA 4IO9A 1M1KC 4LF8Q 1TWAH 3H0GG 4GNXB 1U0LA 4LF4Q 1OXSC 3PO3G 3I4NH 2ZTCA 2DGYA 5ELNA 1A62A 3PV0A 3UDGA 2UUCQ 5C4XG 5HY6A 4A3KG 2D62A 5M3FG 1Q7YC 1LM0A 1B8AA 2AHOB 1VQ9A 4JI4L 2GVBA 3AEVA 4GOPC 3PIPA 4LFAQ 1G291 4A3DH 1XNRQ 4X62Q 2VQFL 3NEMA 1IBKL 2UXCQ 2VUMH 3CMAA 3UE1A 1TXYA 1CSPA 3CCQA 4KHZA 4DR5L 3I4OA 5AJ3Q 4DV0L 2ZJRA 1Y1VH 4TVAB 1QVCA 3TRZA 1X6OA 3CPWA 1C0AA 1T9HA 4DUZL 1Z9FA 4B3TL 4JBKA 1FJGQ 1TWFH 2QA4A 3RLOA 4A3LH 3L7ZC 1N32L 4NXNL 1VQKA 4DR1L 3E9HA 2PI2E 2NVQH 2ZJPA 1EQQA 2JQOA 3PO2G 3S2HH 1EQRA 3JAMi 4IOCA 4DR7Q 1NY4A 2YYZA 3STBC 1Y14B 4JI4Q 5JJKA 3GTQH 2I5LX 3J80i 1VCIA 2IX1A 1WI5A 2XTIA 3L2PA 1SFOH 4R4CA 3PGZA 4L5SA 2YV5A 2LXJA 3S16H 5GAGC 4DV0Q 3DLLA 4LNQA 4BXXH 2Z6KC 1CSQA 1P16A 4DUZQ 4UP9A 1X3GA 1VS0A 1N32Q 1EYGA 4B3SQ 3TEHB 5M5XH 4A93H 4BBSG 4AQYQ 2JA6G 3CF5A 2B63H 3HKSA 3G6EA 1XMOQ 3U4ZA 4IFDI 4JOIA 2VNUD 4IPDA 1Q8KA 1PH2A 1IXRA 1I6HH 1YHBA 3ULLA 1XPOA 4OO1I 3RZDH 3HOWH 2K50A 2R6GA 3PUYA 4LUVA 4JI1Q 4P74A 3GTMH 2R7ZH 3PUWA 1JE5A 2UUAL 1V43A 3S14H 1SROA 3PUXA 4JI3L 2N8NA 4GN5A 2NVXH 3JAMc 2A1AA 4JI0Q 3A5ZB 1MJEA 2NZOA 3BU2A 4TQUS 1A8VA 3AFPA 3J80c 3S1NH 4KLKA 4UY8C 3A0JA 5GROA 5C0XG 1SLJA 4BY7G 3H0GH 1HZBA 1S40A 1L1OA 1Q46A 1QZGA 1XPUA 2N78A 3PO3H 3K8AA 3F2DA 3GO5A 5ELOA 3FP9A 4GKJL 5C4XH 4DR2L 4A3KH 4YWLA 4DAYB 5H1SE 1YHAA 2A19A 5M3FH 2A8VA 1LTLA 2FXQA 2UUAQ 4JI6Q 3S1RH 2RCNA 4PZ8A 3S24A 4X6AH 1YBYA 3EIVA 2E8GA 2KHJA 4JI5L 4WJ3M 4O0AA 1SE8A 3ERSX 3G48A 1X55A 4GOPA 3KLWA 2D0PA 4IPCA 4BBRG 1XNQL 3OTOL 1A0IA 3HFZB 2NN6G 2VQEL 3TS0A 3H3VH 4JV5L 5LMNQ 4NB3A 2PNHA 4GLAC 1K8AC 4NXMQ 1VQDA 3MXNB 2CQOA 4PZ6A 5M3MG 4DR2Q 3CC4A 3S2DH 1PYBA 1YNXA 1I94Q 4AYBE 1XMQL 3HOZG 1HNWL 3SGIA 2CKZB 4R4TA 1PH3A 3KDFA 2KCMA 2N49A 4JC0A 3RNUA 1N36L 2JJQA 3A74A 3M9BA 4JI7L 1PVOA 2F52A 3GD7A 2Z0SA 1HZAA 3H15A 3FHWA 1C9OA 2B63G 3FKIG 4RMFA 3UDFA 5C44G 1TWCH 1JJGA 3I2ZA 1B7YB 4HJ5A 3T1YL 2R7DA 1OTCA 3ULPA 1V9PA 1CKMA 4LF4L 2ZM6Q 1VQPA 3KFUA 3E0EA 3U58A 4JI2L 1D7QA 4GLXA 2UUCL 1Z47A 4LF9Q 2JEAI 4BBSH 2JEBI 1HNXL 3RN2A 2K75A 1XMQQ 2KBNA 5LMUQ 2JA6H 4APVA 1VQFA 2OTJA 2IHEA 1UE5A 4A3EG 1HZ9A 1E3PA 1WCMG 5JJLA 1X56A 4BA1I 4RG1A 4L5RC 4DV6L 1N36Q 2UU9Q 1FGUA 1Q1BA 1VQ6A 2UXCL 2IY5B 1XJVA 4R4IA 1VQ8A 4LFBL 2EIFA 4QJFA 3TS2A 2KENA 2HIXA 2R93G 3GTGH 4DKAC 3T1YQ 2YTXA 1VQIA 2C35B 1FJGL 3I55A 4AYBG 4L5QA 4JI2Q 3J81i 1VQHA 4GS3A 2UXDQ 3UDXA 1HNXQ 4GLVB 1AE3A 3CCSA 4HIMA 4KI0A 1W2BA 3CCJA 3RN5A 4BY7H 1W3SA 3NBHB 2NVTH 4DR7L 3PUVA 5IP9G 1X9NA 3STBD 4DV6Q 4P72A 3M4OH 1OXXK 1E7ZA 1L2FA 1D8LA 2CWAA 2I5HA 3MEFA 5IWAL 1YJ9A 1EWIA 2ES2A 3TQYA 1OXUA 4R4OA 1EIYB 3M3YH 4LFBQ 1X3FA 4X65Q 5GADC 1UE6A 3PSIA 3KF6B 1KHIA 1OXVA 4OONA 1Q12A 2CFMA 2JA9A 4YHHL 2Q2IA 5JEAG 2AKWB 5IY0A 4B3SL 3HOUG 4DR6L 5IT9c 1A63A 4XTCS 4AQYL 2KCTA 2UUBQ 1B70B 1XMOL 2B3GA 4BBRH 2ZTDA 1E24A 3CPFA 2UXBQ 3PCOB 5IYDG 1KXLA 1SMXA 2JK8A 5IWAQ 4YCUA 3F2BA 4JI1L 3GTJH 1NMFA 5M3MH 4LWCA 4DV1L 1QVGA 3AYHB 3HOZH 3J81c 5HGQA 4GKKQ 4EQ5A 1J6QA 2Q2UA 2OWOA 1QUQA 2F4VL 4JI0L 4A76A 1CUKA 4YHHQ 2PMZE 2WAQG 5LMNW 5FLXc 1X3EA 3KJPA 4A75A 1YJWA 4DR6Q 4YY3L 3UE0A 1KRSA 3RR5A 3M85A 2RF4A 2HHHQ 2JA8G 3FKIH 5C44H 4QL5A 5E7NA 4YWKA 1IBLL 1LUZA 2E5LQ 5IYCG 1JT8A 1I3QH 1WFQA 1EUJA 3F8TA 4LFCL 1GO3E 4JCVE 3AQQA 4B3MQ 1HR0L 2R92G 5JJIA 3I4MG 4A3IG 4DV1Q 4P73A 4LF9L 2ATWA 4JI8Q 1SRUA 1UE1A 5M5WH 4GOPB 4JI6L 2LSSA 4A3EH 1GVPA 1WCMH 5C0XJ 3S1MH 2VL6A 2F4VQ 2BA0A 4OWWB 4OWXB 4LW1A 3IRBA 4JBWA 4O2DA 3AFQA 4B3RQ 4YY3Q 1WJJA 2I0QA 4X66L 1QZHA 4HJ7A 1IBLQ 5FJ8G 2R93H 3DM3A 1ASZA 2JA5G 5GAHC 3Q8DA 5LMNL 4LFCQ 2H5XA 4NXML 1HR0Q 2E2HH 2GVAA 2OCEA 1NBWA 1YI2A 1Q81C 1BVSA 1VQEA 1MJCA 1X54A 4MNOA 1I94L 2IT1A 3B6YA 3HKZE 4XIGS 1C7YA 2DUDA 2ZJQA 2QGQA 4DR3Q 1IL2A 5IP9H 3CCEA 2YTYA 4P75A 2VS1A 3U50C 1KQSA 4LF7Q 3ICEA 3W1GA 3S15H 4X66Q 4UPAA 2AWNA 1N34L 1I5FA 1KC8C 2VY3A 4JYAQ 4UP8A 5C4JH 2ZTEA 2ZM6L 1EFWA 2R7FA 1VQBA 4QY7A 5M5YH 3HOUH 1Q1EA 1WYDA 1Q82C 4OX9Q 3K80C 5LMUL 2PQAA 4OWTB 2MQHA 3J81j 2V1CC 4H02A 3J7ZC 4IFDG 5IP7G 1YIJA 3GTOH 2UU9L 2GN5A 4C3HH 1PA6A 1XPRA 1J5EQ 1HJPA 3LGJA 4X64Q 4OO1G 4GNXC 4HJAA 1PH5A 2B29A 1RL2A 4LUZA 1H95A 4QGUA 2WB1E 1N34Q 4DUYL 2K5VA 2XGTA 3T1HL 1N8RC 2BA1A 1KRTA 4L5TA 1IBMQ 4MTNA 3W1BA 3HKZG 1U5KA 1BKBA 1JMCA 2UXDL 2JA7G 3F1ZA 2Z6KA 1PHJA 2K5HA 2JA8H 1UE7A 1PH1A 2YU9H 2MO1A 3PUZA 4A3JG 5IYCH 4DV3Q 3H3VI 4LF5L 4GN3B 2R92H 4K0KL 3OYYA 1VQ7A 3I4MH 4A3IH 4LF6L 4R1JA 1KAWA 1JJ2A 4X65L 2OQ0A 1PH6A 1VQGA 1PH4A 4DV7Q 4P71A 1BBWA 1N33L 4DUYQ 3EN2A 2F3IA 3T1HQ 3HOYG 1GKHA 4Y7NH 2BH2A 4DV2L 5BR8L 3CCVA 3CP0A 4YWMA 1YJNA 1GM5A 2BH8A 3GTKH 3CXCA 1PV4A 1K3RA 2IHFA 2WAQE 4OXPA 2UUBL 3ULJA 1BBUA 3ZJYC 5FJ8H 1E1OA 2MNAA 3GTPH 4NPSA 4PZ7A 2UXBL 2JA5H 4LF5Q 1FL0A 3WWVA 1CKNA 4YCVA 1PH7A 4A3BG 4K0KQ 2WB1G 1KD1C 4QIWE 5JEAJ 2K52A 2RHSB 3HOXH 3CC7A 3CCRA 1UEBA 5C3EG 3CW2C 4LF6Q 2N3SA 4GKKL 4DK3C 3M7NA 1CKOA 2PI2A 1GD7A 4ALPA 5IYDH 4EX5A 4A3FG 1N33Q 4DV4Q 1Q86C 2ID0A 4DV2Q 2ASBA 5BR8Q 1HR0W 4J15A 1MIUA 4UP7A 1N9WA 4PG3A 2LXKA 3CAMA 3D0FA 2CWPA 2HHHL 2ALYB 2KHIA 2E5LL 1FVIA 2OQKA 1Y1WG 3UDIA 5DLQE 4DR4Q 5GQOA 4PMWA 4B3ML 4IJHA 2NZHA 3W5OA 4LUOA 1YVCA 3RZOH 1G51A 3K7AH 4JI8L 2VZAA 3TREA 5C0XI 4IPHA 4QQBX 2MO0A 5FLMG 1YEZA 4IJLA 4C3JH 5IYBG 1L1OB 1WOCA 5IP7H 1KIXA 3NELA 1NMGA 1SR3A 3M4QA 4JG2A 1ASYA 3J7A5 2Q2HA 1VQ4A 4B3RL 1LYLA 4A3GG 2D0OA 1HNZL 1TWGH 4Y52H 2K5NA 3L0OA 3U4VA 1K9MC 2K4KA 5J3BA 4GNXA 4POGA 3S1QH 4BY1H 1G6PA 2VQFQ 1IBKQ 1K83H 3BZKA 2JA7H 2AWOA 1I50H 4DR5Q 3K7UC 4A3JH 4DR3L 2WP8J 3S17H 3KF8B 3A5UA 2NN6I 1QVFA 4B3TQ 4ME3A 2HIVA 1YZ6A 1MKHA 1VQCA 4LF7L 3G4SA 3PF5A 4NXNQ 1E1TA 3NENA 4DR1Q 1VQ5A 1HNZQ 1K0RA 1VQNA 2PQAB 1PFSA 1P8LA 2IX0A 3BZCA 4FDBA 3KDFB 3PIOA 1EIFA 1NJIC 1PH8A 4DV5L 4JYAL 1K8GA 1VQOA 3KF6A 3D31A 2WFWA 1KL9A 1TWHH 4AH6A 3CCMA 3HOYH 3CC2A 4KHPL 3HOXG 4A3MG 3K0XA 3M4PA 2L15A 4OX9L 4A3CG 4WJ4A 2E2IH 4YCWA 3HOVG 3CCLA 3PF4A 4C3IH 1X65A 4HJ8A 1S3OA 3ER0A 1J5EL 4A3BH 3I56A 3RLFA 4X64L 3G71A 3CCUA 3I4NG 2HQLA 1L0WA 4R4QA 2Y0SE 1AE2A 4C2MH 5C3EH 4IOAA 2K14A 2I5MX 3KOJA 1VQJA 2MFIA 4DV5Q 1JB7A 1HH2P 4A3FH 3CMEA 4IFDJ 1E22A 4A3DG 1IBML 2VUMG 4KHPQ 1XTDA 2NVYH 2EQSA 2RHQB 2CCZA 1Y1VG 4MZ9A 4DV3L 1V1QA 1Y1WH 4POFA 4JI3Q 3JC66 3BJUA 2YTVA 4A3LG 2JE6I 3GDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNI A;  5IE8 A;  2QEX A;  1AH9 A;  1HZC A;  5FLM H;  4HIK A;  1YIT A;  5IYB H;  4DV7 L;  2EXD A;  2OTL A;  4DAM A;  1CKN B;  4BY1 G;  1PYS B;  1NE3 A;  4JBM A;  4A3G H;  4GKJ Q;  5EAY A;  3RLN A;  4DPG A;  2E2J H;  1VQL A;  2AMC B;  3F2C A;  3CD6 A;  3PO2 H;  4BXX G;  1K73 C;  3EBE A;  4AIM A;  4JI5 Q;  2Y0S G;  1IYJ B;  4JOI C;  3I7F A;  4GN4 B;  1SN8 A;  4JBJ A;  3KJO A;  1S72 A;  1YHQ A;  2HT1 A;  4HIO A;  4A93 G;  1JJC B;  1OXT A;  1IZ6 A;  3CQZ H;  4A4I A;  4LF8 L;  1XNQ Q;  3OW2 A;  1DGS A;  2Q2T A;  3OTO Q;  4DV4 L;  2VQE Q;  4JV5 Q;  1UWV A;  1PH9 A;  3VDY A;  1EOV A;  1RIP A;  3HOW G;  3E9I A;  1VQM A;  4IPG A;  1HNW Q;  3KYH C;  1R9T H;  2R7Z G;  4BA2 I;  4DR4 L;  1QUQ B;  2VW9 A;  4LFA L;  1XNR L;  1VQA A;  4X62 L;  3GTL H;  4JI7 Q;  4DK6 C;  3K81 C;  5GAE C;  1L1O C;  4A3M H;  1O7I A;  4A3C H;  5K36 G;  4HJ9 A;  5AJ3 L;  3HOV H;  4HID A;  1M90 C;  1NTG A;  4IO9 A;  1M1K C;  4LF8 Q;  1TWA H;  3H0G G;  4GNX B;  1U0L A;  4LF4 Q;  1OXS C;  3PO3 G;  3I4N H;  2ZTC A;  2DGY A;  5ELN A;  1A62 A;  3PV0 A;  3UDG A;  2UUC Q;  5C4X G;  5HY6 A;  4A3K G;  2D62 A;  5M3F G;  1Q7Y C;  1LM0 A;  1B8A A;  2AHO B;  1VQ9 A;  4JI4 L;  2GVB A;  3AEV A;  4GOP C;  3PIP A;  4LFA Q;  1G29 1;  4A3D H;  1XNR Q;  4X62 Q;  2VQF L;  3NEM A;  1IBK L;  2UXC Q;  2VUM H;  3CMA A;  3UE1 A;  1TXY A;  1CSP A;  3CCQ A;  4KHZ A;  4DR5 L;  3I4O A;  5AJ3 Q;  4DV0 L;  2ZJR A;  1Y1V H;  4TVA B;  1QVC A;  3TRZ A;  1X6O A;  3CPW A;  1C0A A;  1T9H A;  4DUZ L;  1Z9F A;  4B3T L;  4JBK A;  1FJG Q;  1TWF H;  2QA4 A;  3RLO A;  4A3L H;  3L7Z C;  1N32 L;  4NXN L;  1VQK A;  4DR1 L;  3E9H A;  2PI2 E;  2NVQ H;  2ZJP A;  1EQQ A;  2JQO A;  3PO2 G;  3S2H H;  1EQR A;  3JAM i;  4IOC A;  4DR7 Q;  1NY4 A;  2YYZ A;  3STB C;  1Y14 B;  4JI4 Q;  5JJK A;  3GTQ H;  2I5L X;  3J80 i;  1VCI A;  2IX1 A;  1WI5 A;  2XTI A;  3L2P A;  1SFO H;  4R4C A;  3PGZ A;  4L5S A;  2YV5 A;  2LXJ A;  3S16 H;  5GAG C;  4DV0 Q;  3DLL A;  4LNQ A;  4BXX H;  2Z6K C;  1CSQ A;  1P16 A;  4DUZ Q;  4UP9 A;  1X3G A;  1VS0 A;  1N32 Q;  1EYG A;  4B3S Q;  3TEH B;  5M5X H;  4A93 H;  4BBS G;  4AQY Q;  2JA6 G;  3CF5 A;  2B63 H;  3HKS A;  3G6E A;  1XMO Q;  3U4Z A;  4IFD I;  4JOI A;  2VNU D;  4IPD A;  1Q8K A;  1PH2 A;  1IXR A;  1I6H H;  1YHB A;  3ULL A;  1XPO A;  4OO1 I;  3RZD H;  3HOW H;  2K50 A;  2R6G A;  3PUY A;  4LUV A;  4JI1 Q;  4P74 A;  3GTM H;  2R7Z H;  3PUW A;  1JE5 A;  2UUA L;  1V43 A;  3S14 H;  1SRO A;  3PUX A;  4JI3 L;  2N8N A;  4GN5 A;  2NVX H;  3JAM c;  2A1A A;  4JI0 Q;  3A5Z B;  1MJE A;  2NZO A;  3BU2 A;  4TQU S;  1A8V A;  3AFP A;  3J80 c;  3S1N H;  4KLK A;  4UY8 C;  3A0J A;  5GRO A;  5C0X G;  1SLJ A;  4BY7 G;  3H0G H;  1HZB A;  1S40 A;  1L1O A;  1Q46 A;  1QZG A;  1XPU A;  2N78 A;  3PO3 H;  3K8A A;  3F2D A;  3GO5 A;  5ELO A;  3FP9 A;  4GKJ L;  5C4X H;  4DR2 L;  4A3K H;  4YWL A;  4DAY B;  5H1S E;  1YHA A;  2A19 A;  5M3F H;  2A8V A;  1LTL A;  2FXQ A;  2UUA Q;  4JI6 Q;  3S1R H;  2RCN A;  4PZ8 A;  3S24 A;  4X6A H;  1YBY A;  3EIV A;  2E8G A;  2KHJ A;  4JI5 L;  4WJ3 M;  4O0A A;  1SE8 A;  3ERS X;  3G48 A;  1X55 A;  4GOP A;  3KLW A;  2D0P A;  4IPC A;  4BBR G;  1XNQ L;  3OTO L;  1A0I A;  3HFZ B;  2NN6 G;  2VQE L;  3TS0 A;  3H3V H;  4JV5 L;  5LMN Q;  4NB3 A;  2PNH A;  4GLA C;  1K8A C;  4NXM Q;  1VQD A;  3MXN B;  2CQO A;  4PZ6 A;  5M3M G;  4DR2 Q;  3CC4 A;  3S2D H;  1PYB A;  1YNX A;  1I94 Q;  4AYB E;  1XMQ L;  3HOZ G;  1HNW L;  3SGI A;  2CKZ B;  4R4T A;  1PH3 A;  3KDF A;  2KCM A;  2N49 A;  4JC0 A;  3RNU A;  1N36 L;  2JJQ A;  3A74 A;  3M9B A;  4JI7 L;  1PVO A;  2F52 A;  3GD7 A;  2Z0S A;  1HZA A;  3H15 A;  3FHW A;  1C9O A;  2B63 G;  3FKI G;  4RMF A;  3UDF A;  5C44 G;  1TWC H;  1JJG A;  3I2Z A;  1B7Y B;  4HJ5 A;  3T1Y L;  2R7D A;  1OTC A;  3ULP A;  1V9P A;  1CKM A;  4LF4 L;  2ZM6 Q;  1VQP A;  3KFU A;  3E0E A;  3U58 A;  4JI2 L;  1D7Q A;  4GLX A;  2UUC L;  1Z47 A;  4LF9 Q;  2JEA I;  4BBS H;  2JEB I;  1HNX L;  3RN2 A;  2K75 A;  1XMQ Q;  2KBN A;  5LMU Q;  2JA6 H;  4APV A;  1VQF A;  2OTJ A;  2IHE A;  1UE5 A;  4A3E G;  1HZ9 A;  1E3P A;  1WCM G;  5JJL A;  1X56 A;  4BA1 I;  4RG1 A;  4L5R C;  4DV6 L;  1N36 Q;  2UU9 Q;  1FGU A;  1Q1B A;  1VQ6 A;  2UXC L;  2IY5 B;  1XJV A;  4R4I A;  1VQ8 A;  4LFB L;  2EIF A;  4QJF A;  3TS2 A;  2KEN A;  2HIX A;  2R93 G;  3GTG H;  4DKA C;  3T1Y Q;  2YTX A;  1VQI A;  2C35 B;  1FJG L;  3I55 A;  4AYB G;  4L5Q A;  4JI2 Q;  3J81 i;  1VQH A;  4GS3 A;  2UXD Q;  3UDX A;  1HNX Q;  4GLV B;  1AE3 A;  3CCS A;  4HIM A;  4KI0 A;  1W2B A;  3CCJ A;  3RN5 A;  4BY7 H;  1W3S A;  3NBH B;  2NVT H;  4DR7 L;  3PUV A;  5IP9 G;  1X9N A;  3STB D;  4DV6 Q;  4P72 A;  3M4O H;  1OXX K;  1E7Z A;  1L2F A;  1D8L A;  2CWA A;  2I5H A;  3MEF A;  5IWA L;  1YJ9 A;  1EWI A;  2ES2 A;  3TQY A;  1OXU A;  4R4O A;  1EIY B;  3M3Y H;  4LFB Q;  1X3F A;  4X65 Q;  5GAD C;  1UE6 A;  3PSI A;  3KF6 B;  1KHI A;  1OXV A;  4OON A;  1Q12 A;  2CFM A;  2JA9 A;  4YHH L;  2Q2I A;  5JEA G;  2AKW B;  5IY0 A;  4B3S L;  3HOU G;  4DR6 L;  5IT9 c;  1A63 A;  4XTC S;  4AQY L;  2KCT A;  2UUB Q;  1B70 B;  1XMO L;  2B3G A;  4BBR H;  2ZTD A;  1E24 A;  3CPF A;  2UXB Q;  3PCO B;  5IYD G;  1KXL A;  1SMX A;  2JK8 A;  5IWA Q;  4YCU A;  3F2B A;  4JI1 L;  3GTJ H;  1NMF A;  5M3M H;  4LWC A;  4DV1 L;  1QVG A;  3AYH B;  3HOZ H;  3J81 c;  5HGQ A;  4GKK Q;  4EQ5 A;  1J6Q A;  2Q2U A;  2OWO A;  1QUQ A;  2F4V L;  4JI0 L;  4A76 A;  1CUK A;  4YHH Q;  2PMZ E;  2WAQ G;  5LMN W;  5FLX c;  1X3E A;  3KJP A;  4A75 A;  1YJW A;  4DR6 Q;  4YY3 L;  3UE0 A;  1KRS A;  3RR5 A;  3M85 A;  2RF4 A;  2HHH Q;  2JA8 G;  3FKI H;  5C44 H;  4QL5 A;  5E7N A;  4YWK A;  1IBL L;  1LUZ A;  2E5L Q;  5IYC G;  1JT8 A;  1I3Q H;  1WFQ A;  1EUJ A;  3F8T A;  4LFC L;  1GO3 E;  4JCV E;  3AQQ A;  4B3M Q;  1HR0 L;  2R92 G;  5JJI A;  3I4M G;  4A3I G;  4DV1 Q;  4P73 A;  4LF9 L;  2ATW A;  4JI8 Q;  1SRU A;  1UE1 A;  5M5W H;  4GOP B;  4JI6 L;  2LSS A;  4A3E H;  1GVP A;  1WCM H;  5C0X J;  3S1M H;  2VL6 A;  2F4V Q;  2BA0 A;  4OWW B;  4OWX B;  4LW1 A;  3IRB A;  4JBW A;  4O2D A;  3AFQ A;  4B3R Q;  4YY3 Q;  1WJJ A;  2I0Q A;  4X66 L;  1QZH A;  4HJ7 A;  1IBL Q;  5FJ8 G;  2R93 H;  3DM3 A;  1ASZ A;  2JA5 G;  5GAH C;  3Q8D A;  5LMN L;  4LFC Q;  2H5X A;  4NXM L;  1HR0 Q;  2E2H H;  2GVA A;  2OCE A;  1NBW A;  1YI2 A;  1Q81 C;  1BVS A;  1VQE A;  1MJC A;  1X54 A;  4MNO A;  1I94 L;  2IT1 A;  3B6Y A;  3HKZ E;  4XIG S;  1C7Y A;  2DUD A;  2ZJQ A;  2QGQ A;  4DR3 Q;  1IL2 A;  5IP9 H;  3CCE A;  2YTY A;  4P75 A;  2VS1 A;  3U50 C;  1KQS A;  4LF7 Q;  3ICE A;  3W1G A;  3S15 H;  4X66 Q;  4UPA A;  2AWN A;  1N34 L;  1I5F A;  1KC8 C;  2VY3 A;  4JYA Q;  4UP8 A;  5C4J H;  2ZTE A;  2ZM6 L;  1EFW A;  2R7F A;  1VQB A;  4QY7 A;  5M5Y H;  3HOU H;  1Q1E A;  1WYD A;  1Q82 C;  4OX9 Q;  3K80 C;  5LMU L;  2PQA A;  4OWT B;  2MQH A;  3J81 j;  2V1C C;  4H02 A;  3J7Z C;  4IFD G;  5IP7 G;  1YIJ A;  3GTO H;  2UU9 L;  2GN5 A;  4C3H H;  1PA6 A;  1XPR A;  1J5E Q;  1HJP A;  3LGJ A;  4X64 Q;  4OO1 G;  4GNX C;  4HJA A;  1PH5 A;  2B29 A;  1RL2 A;  4LUZ A;  1H95 A;  4QGU A;  2WB1 E;  1N34 Q;  4DUY L;  2K5V A;  2XGT A;  3T1H L;  1N8R C;  2BA1 A;  1KRT A;  4L5T A;  1IBM Q;  4MTN A;  3W1B A;  3HKZ G;  1U5K A;  1BKB A;  1JMC A;  2UXD L;  2JA7 G;  3F1Z A;  2Z6K A;  1PHJ A;  2K5H A;  2JA8 H;  1UE7 A;  1PH1 A;  2YU9 H;  2MO1 A;  3PUZ A;  4A3J G;  5IYC H;  4DV3 Q;  3H3V I;  4LF5 L;  4GN3 B;  2R92 H;  4K0K L;  3OYY A;  1VQ7 A;  3I4M H;  4A3I H;  4LF6 L;  4R1J A;  1KAW A;  1JJ2 A;  4X65 L;  2OQ0 A;  1PH6 A;  1VQG A;  1PH4 A;  4DV7 Q;  4P71 A;  1BBW A;  1N33 L;  4DUY Q;  3EN2 A;  2F3I A;  3T1H Q;  3HOY G;  1GKH A;  4Y7N H;  2BH2 A;  4DV2 L;  5BR8 L;  3CCV A;  3CP0 A;  4YWM A;  1YJN A;  1GM5 A;  2BH8 A;  3GTK H;  3CXC A;  1PV4 A;  1K3R A;  2IHF A;  2WAQ E;  4OXP A;  2UUB L;  3ULJ A;  1BBU A;  3ZJY C;  5FJ8 H;  1E1O A;  2MNA A;  3GTP H;  4NPS A;  4PZ7 A;  2UXB L;  2JA5 H;  4LF5 Q;  1FL0 A;  3WWV A;  1CKN A;  4YCV A;  1PH7 A;  4A3B G;  4K0K Q;  2WB1 G;  1KD1 C;  4QIW E;  5JEA J;  2K52 A;  2RHS B;  3HOX H;  3CC7 A;  3CCR A;  1UEB A;  5C3E G;  3CW2 C;  4LF6 Q;  2N3S A;  4GKK L;  4DK3 C;  3M7N A;  1CKO A;  2PI2 A;  1GD7 A;  4ALP A;  5IYD H;  4EX5 A;  4A3F G;  1N33 Q;  4DV4 Q;  1Q86 C;  2ID0 A;  4DV2 Q;  2ASB A;  5BR8 Q;  1HR0 W;  4J15 A;  1MIU A;  4UP7 A;  1N9W A;  4PG3 A;  2LXK A;  3CAM A;  3D0F A;  2CWP A;  2HHH L;  2ALY B;  2KHI A;  2E5L L;  1FVI A;  2OQK A;  1Y1W G;  3UDI A;  5DLQ E;  4DR4 Q;  5GQO A;  4PMW A;  4B3M L;  4IJH A;  2NZH A;  3W5O A;  4LUO A;  1YVC A;  3RZO H;  1G51 A;  3K7A H;  4JI8 L;  2VZA A;  3TRE A;  5C0X I;  4IPH A;  4QQB X;  2MO0 A;  5FLM G;  1YEZ A;  4IJL A;  4C3J H;  5IYB G;  1L1O B;  1WOC A;  5IP7 H;  1KIX A;  3NEL A;  1NMG A;  1SR3 A;  3M4Q A;  4JG2 A;  1ASY A;  3J7A 5;  2Q2H A;  1VQ4 A;  4B3R L;  1LYL A;  4A3G G;  2D0O A;  1HNZ L;  1TWG H;  4Y52 H;  2K5N A;  3L0O A;  3U4V A;  1K9M C;  2K4K A;  5J3B A;  4GNX A;  4POG A;  3S1Q H;  4BY1 H;  1G6P A;  2VQF Q;  1IBK Q;  1K83 H;  3BZK A;  2JA7 H;  2AWO A;  1I50 H;  4DR5 Q;  3K7U C;  4A3J H;  4DR3 L;  2WP8 J;  3S17 H;  3KF8 B;  3A5U A;  2NN6 I;  1QVF A;  4B3T Q;  4ME3 A;  2HIV A;  1YZ6 A;  1MKH A;  1VQC A;  4LF7 L;  3G4S A;  3PF5 A;  4NXN Q;  1E1T A;  3NEN A;  4DR1 Q;  1VQ5 A;  1HNZ Q;  1K0R A;  1VQN A;  2PQA B;  1PFS A;  1P8L A;  2IX0 A;  3BZC A;  4FDB A;  3KDF B;  3PIO A;  1EIF A;  1NJI C;  1PH8 A;  4DV5 L;  4JYA L;  1K8G A;  1VQO A;  3KF6 A;  3D31 A;  2WFW A;  1KL9 A;  1TWH H;  4AH6 A;  3CCM A;  3HOY H;  3CC2 A;  4KHP L;  3HOX G;  4A3M G;  3K0X A;  3M4P A;  2L15 A;  4OX9 L;  4A3C G;  4WJ4 A;  2E2I H;  4YCW A;  3HOV G;  3CCL A;  3PF4 A;  4C3I H;  1X65 A;  4HJ8 A;  1S3O A;  3ER0 A;  1J5E L;  4A3B H;  3I56 A;  3RLF A;  4X64 L;  3G71 A;  3CCU A;  3I4N G;  2HQL A;  1L0W A;  4R4Q A;  2Y0S E;  1AE2 A;  4C2M H;  5C3E H;  4IOA A;  2K14 A;  2I5M X;  3KOJ A;  1VQJ A;  2MFI A;  4DV5 Q;  1JB7 A;  1HH2 P;  4A3F H;  3CME A;  4IFD J;  1E22 A;  4A3D G;  1IBM L;  2VUM G;  4KHP Q;  1XTD A;  2NVY H;  2EQS A;  2RHQ B;  2CCZ A;  1Y1V G;  4MZ9 A;  4DV3 L;  1V1Q A;  1Y1W H;  4POF A;  4JI3 Q;  3JC6 6;  3BJU A;  2YTV A;  4A3L G;  2JE6 I;  3GDE A; 
#chains in the Genus database with same CATH topology
 1CHQ D;  4LJZ C;  1CK1 A;  1S5E D;  1W6K A;  2QEX A;  1X3P A;  5FLM H;  2F0E A;  5JPN C;  2EXD A;  4K5X A;  4DAM A;  2EYO A;  5EPK A;  4DAP A;  1VMC A;  4OGQ C;  3Q23 A;  2E2J H;  3GTG B;  2PQE A;  1WTQ A;  4H44 C;  1HQM C;  3IL8 A;  3I7F A;  4JBJ A;  4V0B A;  3OHX C;  1YHQ A;  2HT1 A;  1JJC B;  2TSS A;  3QJY A;  4A4I A;  4LF8 L;  1XNQ Q;  1DXM A;  3OW2 A;  2K5D A;  5EPL A;  1DGS A;  2Q2T A;  2EYL A;  3H91 A;  5ELD A;  1QJO A;  1UWV A;  1RDP D;  1EOV A;  1RIP A;  2EZV A;  3Q0A A;  4IPG A;  2OEO A;  3KYH C;  4BA2 I;  4ZUJ A;  1PZJ D;  4LFA L;  1XNR L;  1VQA A;  3GTL H;  4JI7 Q;  3MXN A;  1L0Y B;  4BBR B;  4HJ9 A;  5AJ3 L;  3HOV H;  4HID A;  4RAU C;  4GNX B;  2EXZ A;  5EKI A;  2UUC Q;  1JWS D;  2D62 A;  2F0I A;  3SR1 A;  5C4H A;  3PIP A;  2VQF L;  2UXC Q;  3FKI B;  2L11 A;  1O78 A;  1SAP A;  2ZJR A;  5BN4 A;  5NUC A;  3TRZ A;  1X6O A;  2F0N A;  3VR6 A;  1Z9F A;  4JBK A;  2FMC A;  4A3L H;  3L7Z C;  4NXN L;  3E9H A;  3TP7 A;  1WCM B;  2EYP A;  3S1M B;  2JQO A;  2RDF A;  4DR7 Q;  3HG9 A;  3GTQ H;  1VCI A;  1ESF A;  1WI5 A;  4BS9 A;  4R4C A;  2R61 A;  3DLL A;  4DV0 Q;  1Z6H A;  2K5Q A;  1CSQ A;  4DUZ Q;  1GUN A;  1N32 Q;  5M5X H;  1ILP A;  2B2W C;  3G6E A;  4H13 C;  4IFD I;  1Q8K A;  5KEE A;  4JVZ A;  5I9O A;  1TII D;  3HOW H;  2K50 A;  2R6G A;  1EZ6 A;  2XVS A;  4LUV A;  3PIO 3;  4KKU A;  1K28 A;  4X3S A;  1SRO A;  4JI3 L;  2NVX H;  4TQU S;  2D2C C;  1ICF B;  2HCC A;  4HSV A;  4IQZ A;  4DNR B;  5GRO A;  5C0X G;  4KK7 A;  4BY7 G;  3H0G H;  1S40 A;  1QZG A;  2N78 A;  3FP9 A;  1U4R A;  4A3K H;  1OO9 B;  2A19 A;  2M2L A;  1LTL A;  2FXQ A;  2UUA Q;  4JI6 Q;  2HDL A;  2RCN A;  1YBY A;  2WAQ B;  2E8G A;  4ZK9 B;  1D2B A;  4WJ3 M;  3FRP B;  2JA8 B;  3SK4 A;  1KAB A;  3EFX D;  2RBM A;  3D4R A;  2D0P A;  2R92 B;  4RGO S;  1W6J A;  3OTO L;  3H3V H;  3HFZ B;  2NN6 G;  2VQE L;  3I4M B;  2O5J C;  4NB3 A;  2PNH A;  4NXM Q;  1XYI A;  4PZ6 A;  5CV9 A;  3S2D H;  1YNX A;  1I94 Q;  4ZCK A;  1XMQ L;  5L37 A;  3SGI A;  2KCM A;  3M9B A;  2F0W A;  5LL6 S;  1PVO A;  2LMC B;  3GD7 A;  2Z0S A;  1HZA A;  3H15 A;  4I7Z C;  1NNX A;  2A73 B;  2JA5 B;  1JJG A;  1WTV A;  4LF4 L;  2RDG A;  1CKM A;  3T16 A;  2ZM6 Q;  3ERQ A;  1D7Q A;  2Q8I B;  4BBS H;  2JEB I;  1HNX L;  3RN2 A;  2K75 A;  1TS2 A;  3LNN A;  4HCE A;  5JJL A;  1EIH A;  2B2W A;  4DV6 L;  2UU9 Q;  1FGU A;  1VQ6 A;  2IY5 B;  4LFB L;  3X3N A;  2HIX A;  3SE0 A;  3T1Y Q;  2C35 B;  3BS1 A;  4Q0F A;  1HXY D;  4GS3 A;  2UXD Q;  1EY4 A;  2XSC A;  4HIM A;  1W2B A;  3H94 A;  3QB3 A;  3RN5 A;  3UI2 A;  3M4O H;  1YJ9 A;  1L2F A;  1VF7 A;  1B9M A;  1OXU A;  1VDZ A;  1ET9 A;  1EIY B;  5DNF A;  2XRQ D;  3PSI A;  3PIP 3;  3KF6 B;  4BY1 B;  2B2Y C;  4YHH L;  2Q2I A;  5IT9 c;  4AQY L;  5DAU A;  5BN3 A;  2B3G A;  4DK0 A;  3QIA A;  2WAC A;  5C3W A;  3F2B A;  3GTJ H;  5CBA E;  1BXT A;  3T53 B;  1QG7 A;  1TWH B;  2F4V L;  3IFD A;  3QOJ A;  1QUQ A;  1D1I A;  1JWU D;  1FNW A;  2PZU A;  1DON A;  1CUK A;  2PMZ E;  3MZ5 A;  1U4P A;  5CMD A;  1KRS A;  4EVO A;  3M85 A;  1TS3 A;  5C44 H;  1ROD A;  1IBL L;  4RCN A;  2XWJ B;  5IYC G;  1WFQ A;  1BCP B;  1EUJ A;  3F8T A;  4JCV E;  4A3I G;  3SHL A;  1LT5 D;  5C3E B;  4LF9 L;  4ZUI A;  4JI8 Q;  1UE1 A;  2LSS A;  2EOT A;  1GVP A;  2SEB D;  2BA0 A;  4LW1 A;  1Y69 U;  2SDF A;  1B50 A;  3IRB A;  5CV5 A;  4A3K B;  4X66 L;  1Y1W B;  4ZLT F;  2R93 H;  5FJ8 G;  3Q8D A;  5LMN L;  2OXP A;  1HR0 Q;  1HQR D;  1B3Q A;  2OCE A;  3E0J A;  1NSN S;  1HUN A;  3B6Y A;  3HKZ E;  4XQJ A;  1SE4 A;  3BYY B;  4FF3 A;  1PXU A;  2JSO A;  4HSP A;  1KQS A;  1YNJ D;  3W1G A;  5J39 A;  3S15 H;  3C3L A;  3PO2 B;  1N34 L;  4EQN A;  2R7F A;  3WDN A;  3HOU H;  1Q1E A;  1EWC A;  3CQZ B;  1C48 A;  2MQH A;  2B2Y A;  1GXD C;  1SEB D;  4C3H H;  1I4X A;  3LGJ A;  4K2L A;  4GNX C;  4LUZ A;  1IKM A;  4QGU A;  2WB1 E;  5KNC A;  4A3M B;  3CRK C;  1B1Z A;  1JMC A;  2SNM A;  2DNC A;  3W1B A;  3F1Z A;  1EY8 A;  5FO9 B;  1UE7 A;  2YU9 H;  2ZXR A;  4G7O C;  1RD9 D;  4GN3 B;  2HQE A;  2F0Q A;  1GUG A;  1RHP A;  4R1J A;  1XX8 A;  4X65 L;  1IW7 D;  2M9V A;  4A3D B;  1N33 L;  4CDD C;  2BH2 A;  3CCV A;  3A8J E;  1QCB D;  2BH8 A;  4PV1 C;  1K3R A;  2O4X A;  2MGS A;  4XDX A;  2I46 A;  1E2V A;  1E1O A;  4PZ7 A;  1I4Q A;  2OF1 A;  3K59 A;  3WWV A;  2ZT9 C;  2NVQ B;  3HOX H;  3CCR A;  2RHS B;  1JOQ A;  3CW2 C;  1JQY D;  2Z6B A;  1GD7 A;  4A3F G;  2CW0 C;  1Q86 C;  2ID0 A;  1NUC A;  4M8A A;  1MIU A;  2Z1C A;  4UP7 A;  3VYR A;  5GQO A;  4IUR A;  4RFB A;  2IX3 A;  2F0L A;  2B63 B;  5I6Y A;  2MO0 A;  5FLM G;  4C3J H;  4L6T B;  3NUC A;  1I6H B;  5T1G A;  5IP7 H;  1AW7 A;  1WOC A;  5A2Q E;  1EOT A;  1O7Y A;  4B3R L;  3NTH A;  3S14 B;  1BR9 A;  3FPP A;  5CV6 A;  2K4K A;  4GNX A;  3D8G A;  3S1Q H;  1JOR A;  1G2T A;  2VQF Q;  1STN A;  1K83 H;  1LTG D;  1I50 H;  3RD4 A;  2EYH A;  4A3J H;  1Y8N B;  4IUQ A;  2A68 D;  4DN4 M;  5EQ0 A;  3A5U A;  1DM0 B;  2Z4H A;  3AU7 A;  3P20 A;  4NMZ A;  4NXN Q;  3JAM E;  1O7Z A;  1EEI D;  1P8L A;  1QNK A;  3G7L A;  5IGE A;  4DV5 L;  1KL9 A;  5ELF A;  3CCM A;  2L15 A;  4OX9 L;  2D5D A;  4E6I A;  3HOV G;  4CDC C;  3PF4 A;  2IL8 A;  1J5E L;  3ER0 A;  4A3B H;  3I56 A;  3RLF A;  2G9D A;  4KY5 A;  2PCF B;  5JPM C;  1EY9 A;  2PNR C;  1JB7 A;  1HH2 P;  4IFD J;  1E22 A;  3C2P A;  1IBM L;  4KHP Q;  4OEM B;  3K5O A;  1TWC B;  5FO7 B;  1G91 A;  2EQS A;  1EL0 A;  1DOM A;  1GHJ A;  4MZ9 A;  4DV3 L;  1V1Q A;  4JI3 Q;  4R9W A;  3BJU A;  4A3L G;  2KED A;  2JE6 I;  4DNI A;  5IE8 A;  1HZC A;  2SNS A;  3BDL A;  1AP0 A;  5AFW A;  1BNZ A;  2PZW A;  1CKN B;  4BY1 G;  1NE3 A;  2L12 A;  4A3G H;  5KND A;  2TMP A;  1Q3L A;  1I6V C;  3F2C A;  2CVR A;  4KD3 A;  1SXT A;  1S5B D;  4RCO A;  1ONL A;  2B8F A;  3DUZ A;  1C4Q A;  1J8I A;  3M7G A;  2RA4 A;  4K5V A;  4BY7 B;  2WKD A;  3LWU A;  2X6L A;  3OTO Q;  4DV4 L;  2VQE Q;  1PH9 A;  3VDY A;  3HOW G;  3E9I A;  3VR2 A;  1CHP D;  1R9T H;  1WD1 A;  4DR4 L;  1QUQ B;  3X3M A;  2XNA C;  3K6O A;  3BDC A;  1D1K A;  3K81 C;  4A3C H;  4IO9 A;  3H0G G;  5DM7 3;  4LF4 Q;  1OXS C;  2IPK D;  2ZXP A;  1BCP C;  3UDG A;  1ZXT A;  3A8K E;  4A3K G;  3D4W A;  4L63 B;  4R8N A;  4QUC A;  5I2Y A;  3QOL A;  5KGU A;  1LM0 A;  2AHO B;  4JI4 L;  3CRL C;  4JK1 C;  2IWH A;  4X62 Q;  1IBK L;  2VUM H;  3CMA A;  1TXY A;  1CSP A;  3OOC A;  4KHZ A;  4ZKC B;  4DR5 L;  1HA6 A;  1Y1V H;  2VXW A;  4HR7 B;  4B3T L;  3NHH A;  2LS0 1;  1TWF H;  5CV4 A;  2EYJ A;  1IHZ A;  2F1M A;  1VQK A;  4DR1 L;  5D65 A;  1UEA B;  1MD2 D;  2K6A A;  3PO2 G;  3EQL C;  2YYZ A;  1FNV A;  2I5L X;  1RKN A;  3J80 i;  3H3V C;  1K0S A;  2IX1 A;  2XTI A;  4L5S A;  2NTS A;  2YV5 A;  4RHS A;  3AMU A;  5GAG C;  3NSW A;  2Z6K C;  1VS0 A;  3TEH B;  4BBS G;  4AQY Q;  3CF5 A;  3U4Z A;  2VNU D;  5LL6 X;  1BDO A;  5ELB A;  1YHB A;  3ULL A;  4OO1 I;  4F7X A;  4P74 A;  4TSS A;  1HCZ A;  1RJT A;  3PUW A;  1EEF D;  5KYL A;  2PZT A;  2N8N A;  1WTR A;  4DXG A;  4OIK A;  1DYQ A;  1MJE A;  1SND A;  2GA4 B;  4IZ8 A;  3J80 c;  3AFP A;  1ZYR C;  5K36 H;  4KLK A;  4UY8 C;  1WTW A;  1SLJ A;  3GTO B;  1HRJ A;  2A6E D;  1XPU A;  3PO3 H;  3K8A A;  1I4G A;  5ELO A;  4DR2 L;  1TVX A;  5EGT A;  3TZU A;  5M3F H;  4FXG C;  3S1R H;  3S24 A;  3OIP A;  2KHJ A;  1EYC A;  3OW7 A;  4O0A A;  1EYA A;  3NQI A;  5IGC A;  3ERS X;  3KLW A;  2DNE A;  1NAP A;  2K33 A;  1A0I A;  4A3I B;  1BO0 A;  1TT2 A;  2EYF A;  5LMN Q;  1A3T A;  2CQO A;  3OMG A;  3NK9 A;  3SXH A;  3RNU A;  4X3K A;  2IW3 A;  3M4Y A;  3FHW A;  1PFM A;  3GTP B;  3MXP A;  5C44 G;  3Q6S A;  2B63 G;  3KUP A;  1OTC A;  3KFU A;  3U58 A;  4GLX A;  1Z47 A;  5E4X A;  3V2T A;  2HUG A;  2OTJ A;  1VQF A;  1BBX C;  1E3P A;  1X56 A;  1B9N A;  4RG1 A;  2F03 A;  1N36 Q;  3I91 A;  4FXK C;  3D3R A;  1VQ8 A;  4QJF A;  4HMI A;  2R93 G;  4DKA C;  1FJG L;  2L4N A;  1VQI A;  2YTX A;  3R2I A;  4J1M A;  3OIQ A;  4XT3 B;  4AYB G;  3I55 A;  3K7A B;  4JI2 Q;  3RZO B;  4KMU C;  1SNM A;  3UDX A;  3CCS A;  5FOB B;  1W3S A;  3VYU A;  2F0G A;  2NVT H;  3STB D;  2Z9H A;  4FXD A;  2NZ1 D;  4P72 A;  1OXX K;  1E7Z A;  2I5H A;  1TWG B;  3MEF A;  2ES2 A;  1FD7 D;  4R4O A;  3M3Y H;  5G3L F;  1X3F A;  3U9O A;  4X65 Q;  4KHV A;  1OXV A;  1I4R A;  1Q12 A;  2CFM A;  1CQV A;  2G9H D;  4B3S L;  2AKW B;  5IY0 A;  3HOU G;  1A63 A;  4RKL A;  4XTC S;  2KCT A;  1WVL A;  4K14 A;  4FF2 A;  3S17 B;  1B70 B;  4KY7 A;  2ZTD A;  1E24 A;  2J0T D;  4QF4 A;  2Y0S B;  4RA8 A;  5IWA Q;  1NMF A;  5M3M H;  4KTA A;  4DV1 L;  1QVG A;  4Z9C B;  5C3X A;  3HOZ H;  4DA2 A;  2L55 A;  1NR2 A;  1SDF A;  5HGQ A;  2PW5 A;  1J6Q A;  2JXM B;  2F0M A;  1CI3 M;  1J9O A;  3KJP A;  4K8J A;  4DR6 Q;  1BOS A;  1EIG A;  2NB0 A;  3NPP A;  3RR5 A;  3HEJ A;  1IYV A;  4YWK A;  1M4V A;  2DY7 A;  1I3Q H;  3DHQ A;  5JJI A;  3AQQ A;  3KK7 A;  4C2M B;  3D4D A;  3FEW X;  5EJW A;  3NTK A;  3SDZ A;  5M5W H;  4GOP B;  4A3F B;  4A3E H;  4CDF C;  2CH4 A;  2VL6 A;  3NQT A;  4WFN 3;  4OWW B;  5K5P A;  2NVY B;  4B3R Q;  4YY3 Q;  4NW2 A;  2I0Q A;  2G5D A;  2DJG C;  4LFC Q;  2H5X A;  2L0C A;  4I7A A;  1SSO A;  1XXG A;  1NBW A;  1LLR D;  1Q81 C;  1BVS A;  1VQE A;  1MJC A;  2K1B A;  1C7Y A;  2E2H H;  1ZEQ X;  3GTM H;  2ZJQ A;  2QGQ A;  1IL2 A;  3CCE A;  1Z7T A;  4FF4 A;  1TS4 A;  2WV6 D;  5G3L D;  2F0K A;  4P75 A;  3URY A;  1SYF A;  3ICE A;  2E2J B;  1AN8 A;  1A15 A;  1A3U A;  4UPA A;  1I5F A;  1SYG A;  4UP8 A;  5C4J H;  2ZTE A;  4TKO B;  5M5Y H;  3OWF A;  1ILQ A;  5C4Z A;  1Q82 C;  4OX9 Q;  3J81 j;  1A6X A;  4C3J G;  4K8I A;  3J7Z C;  5IP7 G;  5IYD H;  1J5E Q;  1HJP A;  2FMM A;  1H9S A;  4HJA A;  1EU4 A;  2K05 A;  1ZKO A;  2KVM A;  3T4A C;  4DUY L;  1N8R C;  3GTL B;  2BA1 A;  1KDA A;  3MFY A;  4L5T A;  1IBM Q;  3HOV B;  1U5K A;  1BKB A;  1KAA A;  1HA5 A;  2B39 A;  2K32 A;  4KJO A;  2K5H A;  3BYT B;  2BE5 D;  4ZQ3 A;  4PQX A;  3J7A V;  3PUZ A;  4A3J G;  4DV3 Q;  2K03 A;  2EVB A;  3OYY A;  1GUT A;  4LF6 L;  3V05 A;  4XQN A;  2HDM A;  4DAY A;  5JAV A;  1LTS D;  1ESR A;  3ITP A;  1BBW A;  3T1H Q;  4Y7N H;  4O42 A;  1PTO H;  3N52 A;  1GM5 A;  3GTK H;  1WD0 A;  2RQX A;  4HTH A;  1I4P A;  1BBU A;  1JIC A;  1SMY D;  3T51 B;  4LF5 Q;  4A3B G;  1CKN A;  2F0H A;  4JW0 A;  4YCV A;  3ND9 A;  4K0K Q;  2NUC A;  1KD1 C;  2E75 C;  5JEA J;  4FF1 A;  3M7N A;  1CKO A;  3GTQ B;  2PI2 A;  2F0T A;  2KCN A;  3P75 A;  2QDL A;  4DV4 Q;  4DV2 Q;  2ASB A;  2F3W A;  5BR8 Q;  2F0V A;  1ENF A;  4F87 A;  1N9W A;  2LXK A;  4CKC A;  1FVI A;  1LAB A;  3HS0 C;  4DR4 Q;  2D9U A;  4PMW A;  2XIW A;  5M5X B;  1H9M A;  2NZH A;  4LUO A;  1G51 A;  3TRE A;  2VZA A;  5C0X I;  1YEZ A;  4IFD H;  4U68 A;  3NEL A;  3HOW B;  1SR3 A;  4HED A;  1VQ4 A;  1LYL A;  1X32 A;  4A3G G;  1UAP A;  4PNY A;  3U4V A;  1E2Z A;  2NVX B;  2MUY A;  3KLS X;  4ODG A;  1RTN A;  1G6P A;  1IBK Q;  2JA7 H;  4DR5 Q;  3H0G B;  2WP8 J;  3NBH A;  5CBE E;  2NN6 I;  3IKJ A;  1QVF A;  4B3T Q;  2HIV A;  1YZ6 A;  4LF7 L;  1VQC A;  3G4S A;  2ICE C;  2VB3 X;  4DR1 Q;  1VQ5 A;  1HNZ Q;  3R8B A;  2PQA B;  1K8G A;  1PRT F;  3D31 A;  2WFW A;  3HOY H;  4WOR A;  1JC7 A;  1KLU D;  3TP6 A;  1JOK A;  3HGB A;  4ME5 A;  4A3C G;  4DFA A;  2E2I H;  4YCW A;  3CCL A;  1STH A;  4C3I H;  1JB3 A;  1LV9 A;  2NTT A;  2PO4 A;  1S3O A;  3S2D B;  4X64 L;  4B9X A;  3CCU A;  2HQL A;  2E76 C;  1U4M A;  4LK1 C;  2K14 A;  2I5M X;  2BOS A;  3CME A;  2VUM G;  1YNN D;  1CZG A;  2CCZ A;  1Y1V G;  4M1U B;  3J81 L;  1DCZ A;  2EPB A;  5A2Q L;  3A56 A;  2JYO A;  4KD4 A;  4BBS B;  1TY2 A;  1AH9 A;  3Q24 A;  5IYB H;  5ELE A;  4DV7 L;  4PMC A;  2LKV A;  2LFN A;  3NP8 A;  1PYS B;  5F2D A;  4DK1 A;  2KJX A;  3E6Z X;  4JBM A;  1WTX A;  1TR5 A;  4G4K A;  1VQL A;  2JN4 A;  2AMC B;  3CD6 A;  1PTO F;  1K73 C;  3EBE A;  2KCC A;  3NE5 B;  3L3O C;  4AIM A;  2Y0S G;  4RGN A;  3VR4 A;  3JAM L;  5CR3 A;  1S72 A;  3GTK B;  1XWE A;  3TSS A;  1OXT A;  1PLF A;  4KN7 C;  4TRD A;  5CV7 A;  3VA5 A;  3H6M A;  4IAL A;  3M4O B;  1S5F D;  4CJ1 B;  4K6L A;  1TS5 A;  1VQM A;  1PRT D;  2FFK B;  1T5X D;  5IIF A;  3K58 A;  4CHT B;  2PPB C;  2VW9 A;  4DK6 C;  5GAE C;  1F2Y A;  1O7I A;  2RKS A;  2Z8L A;  5K36 G;  4LF8 Q;  1TWA H;  2IJ0 A;  3GTJ B;  1KLG D;  4F8M A;  3R93 A;  3I4N H;  3PO3 G;  2DGY A;  5ELN A;  1A62 A;  3PV0 A;  2BE5 C;  5M3F G;  2SOB A;  1TU2 B;  2GVB A;  4GOP C;  4LFA Q;  3NWT A;  1XNR Q;  4KKS A;  1RF2 D;  3UE1 A;  5C44 B;  5I4D A;  3I4O A;  5AJ3 Q;  4DV0 L;  3J81 E;  4OIJ A;  3CPW A;  2WIN B;  1C0A A;  1T9H A;  4DUZ L;  1FJG Q;  1AFP A;  1N32 L;  3HKZ B;  1S5C D;  3DXJ C;  3RLO A;  1MSH A;  2PI2 E;  1KTK A;  5FLX E;  2ZJP A;  4JPB W;  3S2H H;  1EQR A;  2H4O A;  3JAM i;  4IOC A;  1NY4 A;  1SMY C;  5JJK A;  2X69 A;  2QEJ C;  1EYD A;  1PTO D;  1D5M C;  1SFO H;  1KDB A;  3PGZ A;  2MP1 A;  3S16 H;  2R93 B;  4ZRZ A;  4BXX H;  4UP9 A;  4AYB B;  2F0D A;  4B3S Q;  1G8Z D;  5IGD A;  2KOL A;  5KIX A;  1PZI D;  4A93 H;  4LAA A;  1F2Z A;  3HKS A;  4NP5 A;  1WTH A;  2RCF A;  2BDN A;  3OWE B;  1XPO A;  1H9S B;  3RZD H;  3PUY A;  3S15 B;  2Z4I A;  2MHV A;  1V1O A;  2R7Z H;  3ND8 A;  1JE5 A;  2QIL A;  3A55 A;  2UUA L;  1V43 A;  1LT4 D;  3HOU B;  3FDT A;  5BN5 A;  2A1A A;  3JAM c;  3Q22 A;  3A5Z B;  3S1N H;  1A8V A;  4ULL A;  3A0J A;  2EJM A;  4C3H B;  2K04 A;  4G57 A;  5CGK A;  3GO5 A;  3F2D A;  4GKJ L;  5C4X H;  4YWL A;  4DAY B;  2FHT A;  1LTI D;  4J6H A;  4PZ8 A;  2KQ3 A;  4JI5 L;  2V4D A;  1B2T A;  2YU9 B;  3QWN A;  4GOP A;  4IPC A;  3C1F A;  3I8Z A;  3U9S A;  1V8Q A;  4JV5 L;  1K8A C;  3BG3 A;  1VQD A;  1CM9 A;  5M3M G;  3CC4 A;  1HNW L;  3DWA A;  3OSO A;  3HOZ G;  2CKZ B;  1PH3 A;  1VMP A;  4JC0 A;  2KEC A;  4CDE C;  2F52 A;  1YNJ C;  2MPM A;  3BVG A;  1LO5 D;  4RMF A;  1SJE D;  3R2T A;  3I2Z A;  1G2S A;  1B7Y B;  1F77 A;  3T1Y L;  3NTI A;  1GUS A;  2ENB A;  3HOX B;  2JEA I;  2NYZ D;  3AB9 A;  2JA6 H;  1AZP A;  2RDH A;  1XMQ Q;  2AQ1 B;  3TS2 A;  1YNN C;  3E5S A;  3DWQ A;  4A3E G;  1HZ9 A;  4QUF A;  3A7A B;  4BA1 I;  1TY0 A;  2PW7 A;  1XJV A;  2KA7 A;  4R4I A;  2EIF A;  1CFM A;  3I70 A;  4OEL B;  4IUN A;  2KEN A;  3GTG H;  1HFN A;  4L5Q A;  5TSS A;  4C3J B;  5EBC A;  1HNX Q;  3NBH B;  3PUV A;  3FVQ A;  2A6H D;  4DV6 Q;  2CWA A;  3P7J A;  4DNT B;  1EWI A;  5C5L A;  3TQY A;  4LFB Q;  3I4L A;  1PDQ A;  1IW7 C;  2F0F A;  3S1Q B;  1UE6 A;  2EY6 A;  3E3X A;  4OON A;  2JA9 A;  1K83 B;  1I50 B;  1GUO A;  1XTC D;  4A3J B;  1XMO L;  4BBR H;  3NBI A;  4K6D A;  3ONA B;  3PCO B;  5IYD G;  1ICW A;  1VF5 C;  2JK8 A;  5IGG A;  4JI1 L;  4B08 A;  1HUM A;  3AYH B;  1GJX A;  2FIN B;  2B2U C;  1JOO A;  4OHJ A;  3OMC A;  2OWO A;  2X6G A;  4JI0 L;  4YHH Q;  1YJW A;  4A75 A;  1EQT A;  2R7Z B;  5ELC A;  1A2T A;  3FKI H;  3GV3 A;  4QL5 A;  5E7N A;  4A3B B;  4N8X 1;  1JT8 A;  3SVM A;  3J7A F;  1GO3 E;  1HR0 L;  1SRU A;  1BUV T;  1WCM H;  5C0X J;  2K28 A;  3S1M H;  2F4V Q;  3K0Y A;  4O2D A;  1R4Q B;  3KLS A;  4CKE A;  1SNC A;  1EFI D;  1STA A;  1M8A A;  2C9O A;  2J7Z A;  1WJJ A;  4G7H C;  2F0S A;  1F9R A;  4HN7 A;  1QZH A;  1K3B C;  1IBL Q;  3DM3 A;  1ASZ A;  3WOE A;  5GAH C;  1JR0 D;  4XYQ A;  2AUK A;  2GVA A;  1YI2 A;  4LF9 Q;  3TN2 A;  3ERO A;  2IT1 A;  4XIG S;  4DU9 A;  4UHV A;  5EPJ A;  2A68 C;  5ISR A;  5IP9 H;  2YTY A;  1Y8P B;  4A3G B;  4LF7 Q;  3TDQ A;  4X66 Q;  2DN8 A;  4C56 C;  2VY3 A;  1A2U A;  1DZ1 A;  4S3S A;  4QIW B;  1EFW A;  2DY8 A;  4ZKB B;  1VQB A;  3K5L A;  4GZY C;  5JEA H;  5LMU L;  5HGT A;  2PQA A;  4OWT B;  3SEB A;  2V1C C;  2EJG C;  2O5I C;  4IFD G;  2GN5 A;  1RCV D;  4X64 Q;  1PH5 A;  1RL2 A;  5JVH 3;  1R9T B;  4NDX A;  5D14 A;  3FMC A;  1N34 Q;  4QB4 A;  2PYK A;  5M9O A;  2XGT A;  1KRT A;  2B2U A;  3HKZ G;  2JA7 G;  1U9R A;  2RSO A;  2Z6K A;  1PHJ A;  2JA8 H;  1E2W A;  2EYM A;  1PH1 A;  5EBD A;  3TP8 A;  3H3V I;  3MEH A;  2R92 H;  2Q8R E;  4FYD A;  3I4M H;  2AQ3 B;  5T1I A;  2B2T C;  4XT1 B;  1STE A;  1PH6 A;  1VQG A;  1PH4 A;  2WKC A;  3SK6 A;  4DV7 Q;  1EY0 A;  3HOY G;  2VUM B;  4YWM A;  2QF7 A;  3EVQ A;  2QW7 A;  3CXC A;  1PV4 A;  2WAQ E;  3BDO A;  1Y1V B;  4OXP A;  2UUB L;  3ZJY C;  2UXB L;  4C3I G;  1MGS A;  4NPS A;  1TWF B;  2JA5 H;  3VYS A;  1FL0 A;  1PH7 A;  2A5H A;  1AZQ A;  3TME A;  2WB1 G;  1MI2 A;  4IUT A;  3MC0 B;  2K52 A;  3MAQ A;  3CC7 A;  1UEB A;  4F88 A;  4GKK L;  1PYW D;  1LTB D;  4DK3 C;  1N33 Q;  2J4X A;  1HR0 W;  2QDB A;  2HHH L;  3CAM A;  3D0F A;  1LT3 D;  1ET6 A;  2I07 B;  2KHI A;  2E5L L;  1QNU A;  4C3H G;  4B3M L;  1AEX A;  1CA6 A;  2E74 C;  4IJH A;  3W5O A;  4C1N K;  1GHK A;  1V1P A;  1F9Q A;  4QQB X;  1I4H A;  5IYB G;  1C8C A;  4N8F A;  3D6W A;  3M4Q A;  2Q8T A;  4JG2 A;  3J7A 5;  4OO1 H;  2Q2H A;  1EWH A;  3L0O A;  3GQB A;  5IGF A;  4POG A;  5IGB A;  5E3F A;  2A6H C;  4BY1 H;  5DM6 3;  3BZK A;  3K7U C;  1STG A;  4DR3 L;  3KF8 B;  3MWY W;  3PO3 B;  4CBV A;  4ME3 A;  2K01 A;  3PF5 A;  5M3F B;  1CA5 A;  2ZXO A;  1K0R A;  1VQN A;  2B2V C;  4FDB A;  1PFS A;  2IX0 A;  3BZC A;  3S1R B;  4JYA L;  3SK8 A;  2QCP X;  1VQO A;  1QE6 A;  3CU7 A;  4IUU A;  1EY7 A;  1CTM A;  1ML0 D;  1TWH H;  1U4L A;  2B2T A;  4WJW A;  1HFG A;  1FNU A;  4KHP L;  3HOX G;  4WJ4 A;  5DEH A;  4ILW A;  3I90 A;  1R4P B;  4HJ8 A;  3I4N G;  3I73 A;  4I65 A;  2DJF C;  5IT9 L;  4UAI A;  1AE2 A;  5CV8 A;  5CC4 A;  5C3E H;  4IOA A;  1VQJ A;  4DV5 Q;  4XQQ A;  1SE2 A;  1F9P A;  3RMH A;  3CKI B;  5J22 A;  5COY A;  3H09 A;  4K5W A;  1Y1W H;  3JC6 6;  1JE4 A;  2YTV A;  1HPC A;  2KHS A;  1LT6 D;  4HIK A;  4KJN A;  3ZYY X;  1YIT A;  2OTL A;  1NR4 A;  3MTS A;  2A6E C;  3IFT A;  2QKI C;  1WTP A;  4GKJ Q;  5EAY A;  4KY6 A;  3RLN A;  1DD2 A;  2HCI A;  4DPG A;  3PO2 H;  4BXX G;  4JI5 Q;  1IYJ B;  2VB2 X;  4JOI C;  5JJZ A;  4GN4 B;  1SN8 A;  3KJO A;  4K2K A;  3BZD B;  4HIO A;  4A93 G;  3CQZ H;  1IZ6 A;  2NVT B;  1CT1 D;  4NKL A;  4ID6 A;  5FO8 B;  2CW0 D;  4KKT A;  4JV5 Q;  3M3Y B;  3N6R A;  1HNW Q;  3KBX A;  4UDU C;  2R7Z G;  3EJI A;  4IUP A;  3DMU A;  4X62 L;  2B2V A;  1SYD A;  1L1O C;  4A3M H;  5E4W C;  3DEO A;  2F0O A;  5CYU A;  3R3O A;  1CQF A;  1M90 C;  1NTG A;  1M1K C;  1U0L A;  5M3M B;  1EY5 A;  2L5T A;  2ZTC A;  5HUR A;  5I2X A;  3HOZ B;  5C4X G;  5HY6 A;  5IT9 E;  4FNF A;  1TQO A;  1Q7Y C;  3TP5 A;  1B8A A;  4N9P A;  1VQ9 A;  3AEV A;  4PMB A;  1NCV A;  1G29 1;  4A3D H;  4IUV A;  3NEM A;  3CCQ A;  4H7B A;  2AQ2 B;  3NXW A;  1B4O A;  1I3Q B;  4TVA B;  1QVC A;  2QA4 A;  1JCK B;  5M5W B;  5D3I B;  2NVQ H;  4A3E B;  1EQQ A;  4JI4 Q;  3STB C;  1Y14 B;  3F2U A;  5J1Z A;  3W2D A;  3L2P A;  2LXJ A;  1X3Q A;  4LNQ A;  1P16 A;  1MBY A;  5C5M A;  1X3G A;  5EKL A;  1EYG A;  1H9J A;  2E2H B;  1WTO A;  3GTM B;  5IOD A;  4LMQ D;  1EU3 A;  2JA6 G;  3P1H A;  2B63 H;  1XMO Q;  2MJ8 A;  1BCP F;  4JOI A;  3A7L A;  4IPD A;  1PH2 A;  1IXR A;  1PRT B;  1I6H H;  4JI1 Q;  2XRS D;  3WOF A;  5C4J B;  1S4Z A;  3S14 H;  5M5Y B;  1H9K A;  1TKW B;  2E2D C;  3PUX A;  3IAY A;  4GN5 A;  2RSN A;  1DOK A;  2N55 A;  4JI0 Q;  2NZO A;  3BU2 A;  4CGY B;  3BVM A;  3BVZ A;  1HZB A;  5E1F A;  1CZW A;  1L1O A;  1Q46 A;  1RTO A;  4HCS A;  4X3U A;  1SNP A;  3S9W A;  1EZ8 A;  4Q5V A;  4G7Z C;  5H1S E;  1YHA A;  2A8V A;  4MTK A;  1PMR A;  4BWG B;  4X6A H;  1A3V A;  3EIV A;  2LY7 A;  1SE8 A;  5FLX L;  3KBG A;  2N88 A;  1LAC A;  1Y8O B;  4EQP A;  3G48 A;  3K57 A;  1X55 A;  1IKL A;  1KNE A;  4BBR G;  1XNQ L;  4OL7 A;  3O13 A;  3TS0 A;  1B3A A;  2OT2 A;  4GLA C;  4KV6 A;  3MXN B;  4DR2 Q;  2CH4 W;  1PYB A;  2H1E A;  3G6J B;  4AYB E;  1FGB D;  2NWG A;  4R4T A;  2F4I A;  2L9H A;  3KDF A;  2N49 A;  4X3T A;  1B53 A;  1SYC A;  4Y7N B;  1PTO B;  1N36 L;  2JJQ A;  3A74 A;  4JI7 L;  4DGZ A;  5KRU A;  4KN4 C;  1C9O A;  4B9W A;  2FJ2 A;  3FKI G;  3UDF A;  1SYE A;  1TWC H;  3HRZ C;  4DXF A;  4HJ5 A;  2R7D A;  3MVV A;  3ULP A;  1V9P A;  3PQI A;  1VQP A;  3E0E A;  2RVL A;  2WII B;  4JI2 L;  2EJF C;  2UUC L;  1BCP D;  1V1P B;  5JOB A;  1B44 D;  3VR5 A;  2KBN A;  1ENA A;  5LMU Q;  3MXG A;  2F3V A;  2PMZ B;  2IHE A;  4APV A;  1UE5 A;  1WCM G;  4H0L C;  2JP1 A;  4L5R C;  1Q1B A;  2UXC L;  2A69 D;  1T5E A;  1PFN A;  4XXE A;  1DOL A;  1Q8I A;  1EQV A;  2EDG A;  2HD3 A;  4RGT A;  3J81 i;  1VQH A;  4RKB A;  3VA7 A;  4GLV B;  1AE3 A;  5C0X H;  4KI0 A;  3CCJ A;  4BY7 H;  4DR7 L;  2R3Z A;  1X9N A;  5IP9 G;  4EGV A;  2F0U A;  2CQA A;  5IWA L;  1D8L A;  4RHR A;  1IYU A;  2EE1 A;  4MHE A;  3DM1 A;  5GAD C;  1KHI A;  1SYB A;  1G6Z A;  5JEA G;  2A74 C;  4DR6 L;  2JA7 B;  3J7Y W;  3RUZ A;  3HP3 A;  1LTA D;  2UUB Q;  3DWP A;  4P2C B;  5I6W A;  3C1E A;  3CPF A;  2UXB Q;  2ICI A;  3QR8 A;  3A54 A;  2NN6 H;  1KXL A;  1SMX A;  4YCU A;  4LWC A;  2L1B A;  3K5M A;  3J81 c;  1SNQ A;  3HOY B;  4GKK Q;  4EQ5 A;  2Q2U A;  4A76 A;  1K8O A;  5LMN W;  2WAQ G;  5FLX c;  1X3E A;  3LX0 A;  4RH6 A;  2E2I B;  4YY3 L;  3UE0 A;  2HHH Q;  1ZYR D;  2RF4 A;  2JA8 G;  4C3I B;  3K5N A;  1D6E C;  5KYI A;  4WRD A;  1JWM D;  1S5D D;  1LUZ A;  2E5L Q;  2KUM A;  1KNA A;  2K5W A;  2WB1 B;  4LFC L;  2R92 G;  1FR3 A;  4B3M Q;  3I4M G;  5LHY 1;  3I72 A;  4DV1 Q;  3VYT A;  4P73 A;  2ATW A;  4CJ0 B;  3L9A X;  3LWE A;  4JI6 L;  1SE3 A;  2CHB D;  3QG1 A;  1L0X B;  4HMJ A;  4OWX B;  4JBW A;  3AFQ A;  5JVG 3;  4HJ7 A;  4CJ2 C;  2JA5 G;  4NXM L;  3GP7 A;  1SNO A;  4RWS C;  1F2L A;  1I94 L;  1X54 A;  4MNO A;  1O80 A;  1D5Z C;  2DUD A;  4J8Q A;  3W3A A;  4FVM A;  4DR3 Q;  4QMG A;  5C6A A;  3U50 C;  2VS1 A;  2C5C A;  1Q90 A;  2AWN A;  1KC8 C;  4JYA Q;  3KF8 A;  2ZM6 L;  3TBI B;  4QY7 A;  4CKB A;  1QB5 D;  1WYD A;  3K80 C;  3TZD A;  4H02 A;  4R8I A;  1YIJ A;  3MXU A;  3GTO H;  2UU9 L;  1PA6 A;  2XN9 C;  1XPR A;  4V19 0;  2F0J A;  4OO1 G;  2B29 A;  1H95 A;  4ABN A;  4QCL A;  2K5V A;  3T1H L;  4YIJ A;  4ZYS A;  4MTN A;  2P5Z X;  1O7L A;  2UXD L;  1EY6 A;  3VR3 A;  1IL8 A;  1TWA B;  2MO1 A;  5IOC A;  5IYC H;  4LF5 L;  2KEE A;  3I4N B;  3V96 A;  4K0K L;  1LTT D;  1VQ7 A;  4DF7 A;  1MSG A;  4A3I H;  1SJH D;  3NWS A;  1KAW A;  3MFG A;  3J80 L;  1JJ2 A;  2OQ0 A;  4P71 A;  1STB A;  1HHV A;  4DUY Q;  3EN2 A;  2F3I A;  1GKH A;  4DV2 L;  5BR8 L;  3CP0 A;  1QWY A;  1YJN A;  3MA2 B;  2F0P A;  2IHF A;  3T56 B;  5A35 A;  1II3 A;  3ULJ A;  2MNA A;  5FJ8 H;  3GTP H;  3I3C A;  3DEP A;  3T13 A;  5D3D A;  3SK5 A;  1HTL D;  4QIW E;  4LF6 Q;  1ENC A;  1E0B A;  5C3E G;  3S2H B;  2N3S A;  3KLR A;  4ALP A;  4EX5 A;  1SFO B;  3S16 B;  4J15 A;  1STY A;  1PRT C;  1K8M A;  4PG3 A;  4EQO A;  2CWP A;  2ALY B;  1SBB B;  1H9R A;  4O1N A;  5EKK A;  2OQK A;  1Y1W G;  4RGM A;  4HAE A;  3UDI A;  5DLQ E;  1GOZ A;  4A93 B;  2A69 C;  1YVC A;  2M00 A;  3RZO H;  3K7A H;  4JI8 L;  5I9P A;  1DJR D;  4IPH A;  4ZAI A;  4IJL A;  1BF4 A;  4IN3 A;  1MHW C;  1L1O B;  3FPU B;  1KIX A;  3RZD B;  4FO2 A;  1NMG A;  5FK9 C;  1ASY A;  2D0O A;  1HNZ L;  1TWG H;  4Y52 H;  2K5N A;  2EY5 A;  2K7V A;  1K9M C;  3D6C A;  5J3B A;  1HTP A;  2NBF A;  3QO2 A;  1KDC A;  1PZK D;  3S1N B;  1QOH A;  2AWO A;  1LTR D;  2EY1 A;  3S17 H;  1UNS A;  3A8I E;  5C4X B;  1MKH A;  1FYC A;  1E1T A;  3NEN A;  4L8J A;  1PH8 A;  3PIO A;  1NJI C;  4U67 3;  3KDF B;  5FKA C;  1EIF A;  5KNB A;  3J80 E;  3KF6 A;  4AH6 A;  3CC2 A;  1PTO C;  4A3M G;  3K0X A;  3M4P A;  1GUW A;  1QIL A;  4N9T A;  1UUP A;  1D5X C;  1X65 A;  1BQQ T;  1PFB A;  4XYO A;  1F9S A;  2XWB B;  2AUJ D;  3G71 A;  3OPO A;  3GV6 A;  2BCO A;  5COR A;  4FP5 D;  1L0W A;  4R4Q A;  2Y0S E;  4MN3 A;  4C2M H;  3CHB D;  3KOJ A;  2MFI A;  3MHB A;  2B8G A;  2O2L D;  4MIU A;  4A3F H;  4A3D G;  4C1N I;  2EY2 A;  3PMF A;  4DAV A;  1XTD A;  2NVY H;  2RHQ B;  3EA6 A;  4POF A;  3HZX A;  1F2M A;  3C46 A;  3GDE A;  2BDO A;  2JA6 B; 
#chains in the Genus database with same CATH homology
 4DNI A;  5IE8 A;  2QEX A;  1AH9 A;  1HZC A;  5FLM H;  4HIK A;  1YIT A;  5IYB H;  4DV7 L;  2EXD A;  2OTL A;  4DAM A;  1CKN B;  4BY1 G;  1PYS B;  1NE3 A;  4JBM A;  4A3G H;  4GKJ Q;  5EAY A;  3RLN A;  4DPG A;  2E2J H;  1VQL A;  2AMC B;  3F2C A;  3CD6 A;  3PO2 H;  4BXX G;  1K73 C;  3EBE A;  4AIM A;  4JI5 Q;  2Y0S G;  1IYJ B;  4JOI C;  3I7F A;  4GN4 B;  1SN8 A;  4JBJ A;  3KJO A;  1S72 A;  1YHQ A;  2HT1 A;  4HIO A;  4A93 G;  1JJC B;  1OXT A;  1IZ6 A;  3CQZ H;  4A4I A;  4LF8 L;  1XNQ Q;  3OW2 A;  1DGS A;  2Q2T A;  3OTO Q;  4DV4 L;  2VQE Q;  4JV5 Q;  1UWV A;  1PH9 A;  3VDY A;  1EOV A;  1RIP A;  3HOW G;  3E9I A;  1VQM A;  4IPG A;  1HNW Q;  3KYH C;  1R9T H;  2R7Z G;  4BA2 I;  4DR4 L;  1QUQ B;  2VW9 A;  4LFA L;  1XNR L;  1VQA A;  4X62 L;  3GTL H;  4JI7 Q;  4DK6 C;  3K81 C;  5GAE C;  1L1O C;  4A3M H;  1O7I A;  4A3C H;  5K36 G;  4HJ9 A;  5AJ3 L;  3HOV H;  4HID A;  1M90 C;  1NTG A;  4IO9 A;  1M1K C;  4LF8 Q;  1TWA H;  3H0G G;  4GNX B;  1U0L A;  4LF4 Q;  1OXS C;  3PO3 G;  3I4N H;  2ZTC A;  2DGY A;  5ELN A;  1A62 A;  3PV0 A;  3UDG A;  2UUC Q;  5C4X G;  5HY6 A;  4A3K G;  2D62 A;  5M3F G;  1Q7Y C;  1LM0 A;  1B8A A;  2AHO B;  1VQ9 A;  4JI4 L;  2GVB A;  3AEV A;  4GOP C;  3PIP A;  4LFA Q;  1G29 1;  4A3D H;  1XNR Q;  4X62 Q;  2VQF L;  3NEM A;  1IBK L;  2UXC Q;  2VUM H;  3CMA A;  3UE1 A;  1TXY A;  1CSP A;  3CCQ A;  4KHZ A;  4DR5 L;  3I4O A;  5AJ3 Q;  4DV0 L;  2ZJR A;  1Y1V H;  4TVA B;  1QVC A;  3TRZ A;  1X6O A;  3CPW A;  1C0A A;  1T9H A;  4DUZ L;  1Z9F A;  4B3T L;  4JBK A;  1FJG Q;  1TWF H;  2QA4 A;  3RLO A;  4A3L H;  3L7Z C;  1N32 L;  4NXN L;  1VQK A;  4DR1 L;  3E9H A;  2PI2 E;  2NVQ H;  2ZJP A;  1EQQ A;  2JQO A;  3PO2 G;  3S2H H;  1EQR A;  3JAM i;  4IOC A;  4DR7 Q;  1NY4 A;  2YYZ A;  3STB C;  1Y14 B;  4JI4 Q;  5JJK A;  3GTQ H;  2I5L X;  3J80 i;  1VCI A;  2IX1 A;  1WI5 A;  2XTI A;  3L2P A;  1SFO H;  4R4C A;  3PGZ A;  4L5S A;  2YV5 A;  2LXJ A;  3S16 H;  5GAG C;  4DV0 Q;  3DLL A;  4LNQ A;  4BXX H;  2Z6K C;  1CSQ A;  1P16 A;  4DUZ Q;  4UP9 A;  1X3G A;  1VS0 A;  1N32 Q;  1EYG A;  4B3S Q;  3TEH B;  5M5X H;  4A93 H;  4BBS G;  4AQY Q;  2JA6 G;  3CF5 A;  2B63 H;  3HKS A;  3G6E A;  1XMO Q;  3U4Z A;  4IFD I;  4JOI A;  2VNU D;  4IPD A;  1Q8K A;  1PH2 A;  1IXR A;  1I6H H;  1YHB A;  3ULL A;  1XPO A;  4OO1 I;  3RZD H;  3HOW H;  2K50 A;  2R6G A;  3PUY A;  4LUV A;  4JI1 Q;  4P74 A;  3GTM H;  2R7Z H;  3PUW A;  1JE5 A;  2UUA L;  1V43 A;  3S14 H;  1SRO A;  3PUX A;  4JI3 L;  2N8N A;  4GN5 A;  2NVX H;  3JAM c;  2A1A A;  4JI0 Q;  3A5Z B;  1MJE A;  2NZO A;  3BU2 A;  4TQU S;  1A8V A;  3AFP A;  3J80 c;  3S1N H;  4KLK A;  4UY8 C;  3A0J A;  5GRO A;  5C0X G;  1SLJ A;  4BY7 G;  3H0G H;  1HZB A;  1S40 A;  1L1O A;  1Q46 A;  1QZG A;  1XPU A;  2N78 A;  3PO3 H;  3K8A A;  3F2D A;  3GO5 A;  5ELO A;  3FP9 A;  4GKJ L;  5C4X H;  4DR2 L;  4A3K H;  4YWL A;  4DAY B;  5H1S E;  1YHA A;  2A19 A;  5M3F H;  2A8V A;  1LTL A;  2FXQ A;  2UUA Q;  4JI6 Q;  3S1R H;  2RCN A;  4PZ8 A;  3S24 A;  4X6A H;  1YBY A;  3EIV A;  2E8G A;  2KHJ A;  4JI5 L;  4WJ3 M;  4O0A A;  1SE8 A;  3ERS X;  3G48 A;  1X55 A;  4GOP A;  3KLW A;  2D0P A;  4IPC A;  4BBR G;  1XNQ L;  3OTO L;  1A0I A;  3HFZ B;  2NN6 G;  2VQE L;  3TS0 A;  3H3V H;  4JV5 L;  5LMN Q;  4NB3 A;  2PNH A;  4GLA C;  1K8A C;  4NXM Q;  1VQD A;  3MXN B;  2CQO A;  4PZ6 A;  5M3M G;  4DR2 Q;  3CC4 A;  3S2D H;  1PYB A;  1YNX A;  1I94 Q;  4AYB E;  1XMQ L;  3HOZ G;  1HNW L;  3SGI A;  2CKZ B;  4R4T A;  1PH3 A;  3KDF A;  2KCM A;  2N49 A;  4JC0 A;  3RNU A;  1N36 L;  2JJQ A;  3A74 A;  3M9B A;  4JI7 L;  1PVO A;  2F52 A;  3GD7 A;  2Z0S A;  1HZA A;  3H15 A;  3FHW A;  1C9O A;  2B63 G;  3FKI G;  4RMF A;  3UDF A;  5C44 G;  1TWC H;  1JJG A;  3I2Z A;  1B7Y B;  4HJ5 A;  3T1Y L;  2R7D A;  1OTC A;  3ULP A;  1V9P A;  1CKM A;  4LF4 L;  2ZM6 Q;  1VQP A;  3KFU A;  3E0E A;  3U58 A;  4JI2 L;  1D7Q A;  4GLX A;  2UUC L;  1Z47 A;  4LF9 Q;  2JEA I;  4BBS H;  2JEB I;  1HNX L;  3RN2 A;  2K75 A;  1XMQ Q;  2KBN A;  5LMU Q;  2JA6 H;  4APV A;  1VQF A;  2OTJ A;  2IHE A;  1UE5 A;  4A3E G;  1HZ9 A;  1E3P A;  1WCM G;  5JJL A;  1X56 A;  4BA1 I;  4RG1 A;  4L5R C;  4DV6 L;  1N36 Q;  2UU9 Q;  1FGU A;  1Q1B A;  1VQ6 A;  2UXC L;  2IY5 B;  1XJV A;  4R4I A;  1VQ8 A;  4LFB L;  2EIF A;  4QJF A;  3TS2 A;  2KEN A;  2HIX A;  2R93 G;  3GTG H;  4DKA C;  3T1Y Q;  2YTX A;  1VQI A;  2C35 B;  1FJG L;  3I55 A;  4AYB G;  4L5Q A;  4JI2 Q;  3J81 i;  1VQH A;  4GS3 A;  2UXD Q;  3UDX A;  1HNX Q;  4GLV B;  1AE3 A;  3CCS A;  4HIM A;  4KI0 A;  1W2B A;  3CCJ A;  3RN5 A;  4BY7 H;  1W3S A;  3NBH B;  2NVT H;  4DR7 L;  3PUV A;  5IP9 G;  1X9N A;  3STB D;  4DV6 Q;  4P72 A;  3M4O H;  1OXX K;  1E7Z A;  1L2F A;  1D8L A;  2CWA A;  2I5H A;  3MEF A;  5IWA L;  1YJ9 A;  1EWI A;  2ES2 A;  3TQY A;  1OXU A;  4R4O A;  1EIY B;  3M3Y H;  4LFB Q;  1X3F A;  4X65 Q;  5GAD C;  1UE6 A;  3PSI A;  3KF6 B;  1KHI A;  1OXV A;  4OON A;  1Q12 A;  2CFM A;  2JA9 A;  4YHH L;  2Q2I A;  5JEA G;  2AKW B;  5IY0 A;  4B3S L;  3HOU G;  4DR6 L;  5IT9 c;  1A63 A;  4XTC S;  4AQY L;  2KCT A;  2UUB Q;  1B70 B;  1XMO L;  2B3G A;  4BBR H;  2ZTD A;  1E24 A;  3CPF A;  2UXB Q;  3PCO B;  5IYD G;  1KXL A;  1SMX A;  2JK8 A;  5IWA Q;  4YCU A;  3F2B A;  4JI1 L;  3GTJ H;  1NMF A;  5M3M H;  4LWC A;  4DV1 L;  1QVG A;  3AYH B;  3HOZ H;  3J81 c;  5HGQ A;  4GKK Q;  4EQ5 A;  1J6Q A;  2Q2U A;  2OWO A;  1QUQ A;  2F4V L;  4JI0 L;  4A76 A;  1CUK A;  4YHH Q;  2PMZ E;  2WAQ G;  5LMN W;  5FLX c;  1X3E A;  3KJP A;  4A75 A;  1YJW A;  4DR6 Q;  4YY3 L;  3UE0 A;  1KRS A;  3RR5 A;  3M85 A;  2RF4 A;  2HHH Q;  2JA8 G;  3FKI H;  5C44 H;  4QL5 A;  5E7N A;  4YWK A;  1IBL L;  1LUZ A;  2E5L Q;  5IYC G;  1JT8 A;  1I3Q H;  1WFQ A;  1EUJ A;  3F8T A;  4LFC L;  1GO3 E;  4JCV E;  3AQQ A;  4B3M Q;  1HR0 L;  2R92 G;  5JJI A;  3I4M G;  4A3I G;  4DV1 Q;  4P73 A;  4LF9 L;  2ATW A;  4JI8 Q;  1SRU A;  1UE1 A;  5M5W H;  4GOP B;  4JI6 L;  2LSS A;  4A3E H;  1GVP A;  1WCM H;  5C0X J;  3S1M H;  2VL6 A;  2F4V Q;  2BA0 A;  4OWW B;  4OWX B;  4LW1 A;  3IRB A;  4JBW A;  4O2D A;  3AFQ A;  4B3R Q;  4YY3 Q;  1WJJ A;  2I0Q A;  4X66 L;  1QZH A;  4HJ7 A;  1IBL Q;  5FJ8 G;  2R93 H;  3DM3 A;  1ASZ A;  2JA5 G;  5GAH C;  3Q8D A;  5LMN L;  4LFC Q;  2H5X A;  4NXM L;  1HR0 Q;  2E2H H;  2GVA A;  2OCE A;  1NBW A;  1YI2 A;  1Q81 C;  1BVS A;  1VQE A;  1MJC A;  1X54 A;  4MNO A;  1I94 L;  2IT1 A;  3B6Y A;  3HKZ E;  4XIG S;  1C7Y A;  2DUD A;  2ZJQ A;  2QGQ A;  4DR3 Q;  1IL2 A;  5IP9 H;  3CCE A;  2YTY A;  4P75 A;  2VS1 A;  3U50 C;  1KQS A;  4LF7 Q;  3ICE A;  3W1G A;  3S15 H;  4X66 Q;  4UPA A;  2AWN A;  1N34 L;  1I5F A;  1KC8 C;  2VY3 A;  4JYA Q;  4UP8 A;  5C4J H;  2ZTE A;  2ZM6 L;  1EFW A;  2R7F A;  1VQB A;  4QY7 A;  5M5Y H;  3HOU H;  1Q1E A;  1WYD A;  1Q82 C;  4OX9 Q;  3K80 C;  5LMU L;  2PQA A;  4OWT B;  2MQH A;  3J81 j;  2V1C C;  4H02 A;  3J7Z C;  4IFD G;  5IP7 G;  1YIJ A;  3GTO H;  2UU9 L;  2GN5 A;  4C3H H;  1PA6 A;  1XPR A;  1J5E Q;  1HJP A;  3LGJ A;  4X64 Q;  4OO1 G;  4GNX C;  4HJA A;  1PH5 A;  2B29 A;  1RL2 A;  4LUZ A;  1H95 A;  4QGU A;  2WB1 E;  1N34 Q;  4DUY L;  2K5V A;  2XGT A;  3T1H L;  1N8R C;  2BA1 A;  1KRT A;  4L5T A;  1IBM Q;  4MTN A;  3W1B A;  3HKZ G;  1U5K A;  1BKB A;  1JMC A;  2UXD L;  2JA7 G;  3F1Z A;  2Z6K A;  1PHJ A;  2K5H A;  2JA8 H;  1UE7 A;  1PH1 A;  2YU9 H;  2MO1 A;  3PUZ A;  4A3J G;  5IYC H;  4DV3 Q;  3H3V I;  4LF5 L;  4GN3 B;  2R92 H;  4K0K L;  3OYY A;  1VQ7 A;  3I4M H;  4A3I H;  4LF6 L;  4R1J A;  1KAW A;  1JJ2 A;  4X65 L;  2OQ0 A;  1PH6 A;  1VQG A;  1PH4 A;  4DV7 Q;  4P71 A;  1BBW A;  1N33 L;  4DUY Q;  3EN2 A;  2F3I A;  3T1H Q;  3HOY G;  1GKH A;  4Y7N H;  2BH2 A;  4DV2 L;  5BR8 L;  3CCV A;  3CP0 A;  4YWM A;  1YJN A;  1GM5 A;  2BH8 A;  3GTK H;  3CXC A;  1PV4 A;  1K3R A;  2IHF A;  2WAQ E;  4OXP A;  2UUB L;  3ULJ A;  1BBU A;  3ZJY C;  5FJ8 H;  1E1O A;  2MNA A;  3GTP H;  4NPS A;  4PZ7 A;  2UXB L;  2JA5 H;  4LF5 Q;  1FL0 A;  3WWV A;  1CKN A;  4YCV A;  1PH7 A;  4A3B G;  4K0K Q;  2WB1 G;  1KD1 C;  4QIW E;  5JEA J;  2K52 A;  2RHS B;  3HOX H;  3CC7 A;  3CCR A;  1UEB A;  5C3E G;  3CW2 C;  4LF6 Q;  2N3S A;  4GKK L;  4DK3 C;  3M7N A;  1CKO A;  2PI2 A;  1GD7 A;  4ALP A;  5IYD H;  4EX5 A;  4A3F G;  1N33 Q;  4DV4 Q;  1Q86 C;  2ID0 A;  4DV2 Q;  2ASB A;  5BR8 Q;  1HR0 W;  4J15 A;  1MIU A;  4UP7 A;  1N9W A;  4PG3 A;  2LXK A;  3CAM A;  3D0F A;  2CWP A;  2HHH L;  2ALY B;  2KHI A;  2E5L L;  1FVI A;  2OQK A;  1Y1W G;  3UDI A;  5DLQ E;  4DR4 Q;  5GQO A;  4PMW A;  4B3M L;  4IJH A;  2NZH A;  3W5O A;  4LUO A;  1YVC A;  3RZO H;  1G51 A;  3K7A H;  4JI8 L;  2VZA A;  3TRE A;  5C0X I;  4IPH A;  4QQB X;  2MO0 A;  5FLM G;  1YEZ A;  4IJL A;  4C3J H;  5IYB G;  1L1O B;  1WOC A;  5IP7 H;  1KIX A;  3NEL A;  1NMG A;  1SR3 A;  3M4Q A;  4JG2 A;  1ASY A;  3J7A 5;  2Q2H A;  1VQ4 A;  4B3R L;  1LYL A;  4A3G G;  2D0O A;  1HNZ L;  1TWG H;  4Y52 H;  2K5N A;  3L0O A;  3U4V A;  1K9M C;  2K4K A;  5J3B A;  4GNX A;  4POG A;  3S1Q H;  4BY1 H;  1G6P A;  2VQF Q;  1IBK Q;  1K83 H;  3BZK A;  2JA7 H;  2AWO A;  1I50 H;  4DR5 Q;  3K7U C;  4A3J H;  4DR3 L;  2WP8 J;  3S17 H;  3KF8 B;  3A5U A;  2NN6 I;  1QVF A;  4B3T Q;  4ME3 A;  2HIV A;  1YZ6 A;  1MKH A;  1VQC A;  4LF7 L;  3G4S A;  3PF5 A;  4NXN Q;  1E1T A;  3NEN A;  4DR1 Q;  1VQ5 A;  1HNZ Q;  1K0R A;  1VQN A;  2PQA B;  1PFS A;  1P8L A;  2IX0 A;  3BZC A;  4FDB A;  3KDF B;  3PIO A;  1EIF A;  1NJI C;  1PH8 A;  4DV5 L;  4JYA L;  1K8G A;  1VQO A;  3KF6 A;  3D31 A;  2WFW A;  1KL9 A;  1TWH H;  4AH6 A;  3CCM A;  3HOY H;  3CC2 A;  4KHP L;  3HOX G;  4A3M G;  3K0X A;  3M4P A;  2L15 A;  4OX9 L;  4A3C G;  4WJ4 A;  2E2I H;  4YCW A;  3HOV G;  3CCL A;  3PF4 A;  4C3I H;  1X65 A;  4HJ8 A;  1S3O A;  3ER0 A;  1J5E L;  4A3B H;  3I56 A;  3RLF A;  4X64 L;  3G71 A;  3CCU A;  3I4N G;  2HQL A;  1L0W A;  4R4Q A;  2Y0S E;  1AE2 A;  4C2M H;  5C3E H;  4IOA A;  2K14 A;  2I5M X;  3KOJ A;  1VQJ A;  2MFI A;  4DV5 Q;  1JB7 A;  1HH2 P;  4A3F H;  3CME A;  4IFD J;  1E22 A;  4A3D G;  1IBM L;  2VUM G;  4KHP Q;  1XTD A;  2NVY H;  2EQS A;  2RHQ B;  2CCZ A;  1Y1V G;  4MZ9 A;  4DV3 L;  1V1Q A;  1Y1W H;  4POF A;  4JI3 Q;  3JC6 6;  3BJU A;  2YTV A;  4A3L G;  2JE6 I;  3GDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...