5IP9H

Structure of rna polymerase ii-tfiif complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Transcription initiation complex structures elucidate DNA opening.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2016-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5ip9H00
1WYDA 1IBLQ 4NPSA 4YWLA 3S16H 1EIFA 3GDEA 2N49A 4R4CA 4R4OA 5FLXc 1QVFA 2JA8H 4GOPB 3S2HH 1X65A 4JI8L 2F4VQ 1Q81C 1UE7A 2IX0A 4DV7L 2HQLA 2YU9H 5IP7H 4BXXG 1S40A 2RHQB 4A3EH 1JB7A 4JV5L 3U4ZA 1CKMA 4RG1A 2PMZE 2R7FA 1FVIA 3WWVA 4DUZQ 3BZKA 5IYCG 4RMFA 4BA1I 4A3KG 3H0GG 2JA7H 3U58A 4OXPA 1KD1C 5C4XG 2I5MX 4DV5Q 4YWKA 1VQCA 1QUQA 3PIOA 5C44H 1YJ9A 4JI7L 4NXNQ 3RZOH 1JJ2A 3CMEA 3CAMA 1EUJA 2Q2HA 2WB1E 2JE6I 3J7ZC 1PH8A 4ALPA 1HNXQ 2UXCQ 2HIVA 3KDFB 2YYZA 3TREA 4OO1G 2HT1A 5C3EG 3CCUA 3NBHB 5M3FH 3CCJA 3A5UA 4DV6Q 3UDIA 4A3GG 1M1KC 4R4TA 3KJOA 2MNAA 2UUAL 3M7NA 4KHPQ 3AFPA 2N78A 1HR0W 1RL2A 4JI5L 3HOYG 3M4OH 3KYHC 1N9WA 1OXXK 2XTIA 3GTLH 4GLAC 3HKZE 1BKBA 1OXUA 1Y1VG 1YHBA 4A3BH 4UPAA 1G6PA 1Z47A 4DV4L 1X54A 1E22A 2WAQE 3HOZG 5IT9c 4JC0A 1WCMH 1CSQA 1NMFA 1HZCA 1YEZA 3PF4A 2VNUD 1WOCA 1T9HA 4BY1H 4A4IA 4DR6L 2JQOA 4XTCS 4JI4L 1VQIA 3G6EA 5EAYA 5M5YH 5K36G 2VW9A 1E1OA 4DV0L 1VQBA 2YTXA 4JBJA 4JBMA 1J5EL 1CKOA 1VQAA 1PFSA 4YHHL 1G291 4A3EG 4GKKL 1X55A 2Q2TA 3NENA 3VDYA 1VQEA 1XMQQ 2UXDL 5GADC 3GO5A 3CCMA 1WI5A 4OONA 3RLOA 4B3SL 1VQPA 1PH6A 2IX1A 1TXYA 1K83H 2ZM6Q 1N33Q 2JEAI 4APVA 4PZ8A 1Q82C 1Q1EA 1UE5A 3ZJYC 3L2PA 2R6GA 1AH9A 2HHHQ 4YY3Q 4P73A 4DR5L 4DR1Q 2RF4A 1XMOQ 4LF8L 4A3FH 1TWFH 4C3JH 2UUBQ 2VS1A 1ASYA 2WP8J 1QVCA 2LSSA 2PI2A 4AQYQ 3F2CA 3RLFA 4IFDJ 4X66Q 4DR3Q 3S17H 2HIXA 2VQFQ 2AHOB 3OTOL 3CW2C 4A3JG 1VQ7A 4IFDG 1CSPA 3I4OA 4KI0A 2ALYB 4L5TA 3HOUH 2OQ0A 4BBSH 2RHSB 1EFWA 3D0FA 2EIFA 1G51A 1Q7YC 4A3BG 5J3BA 4KHZA 2R93H 1Q12A 2N8NA 4P75A 2GVAA 5IYCH 2IHFA 3H0GH 1Y1WG 1GM5A 3GD7A 1WCMG 5C4XH 3CF5A 4JI3Q 1CKNA 4X62L 2KBNA 4OWXB 2OCEA 5C4JH 4DV2Q 4JYAL 4B3RQ 3B6YA 2I5LX 4IFDI 2C35B 1L1OC 3I7FA 1YI2A 4LF6Q 3J7A5 4DR4Q 4DUZL 2UXBL 2Q2UA 1H95A 3S24A 4MTNA 1X9NA 4HJAA 1GKHA 4DV5L 3TQYA 4LF7Q 1KRSA 1C0AA 1U0LA 2NVYH 4QY7A 4A3GH 2JJQA 2KCTA 4BA2I 4GLXA 3ULLA 4OX9Q 1PV4A 1HJPA 2LXKA 3CQZH 1B70B 2F3IA 3CD6A 4OWWB 3TEHB 4AIMA 4LF5Q 1HNXL 4X6AH 3HOYH 3NELA 2FXQA 3E0EA 5LMNL 4A76A 4HJ9A 1IBMQ 1N36Q 2JA5G 2JK8A 1LYLA 1KL9A 4AH6A 5LMUQ 4R1JA 4A3FG 4B3MQ 4IOAA 3M3YH 2R7ZG 1KC8C 4KHPL 1SR3A 3HOZH 2K75A 2CKZB 2BA0A 5E7NA 2VUMG 3K7UC 3I2ZA 3GTOH 1NE3A 2UUCL 4DV1Q 1X6OA 2BA1A 4TQUS 4EX5A 4LUZA 1E3PA 1VS0A 2CCZA 2E5LQ 1XPUA 1A0IA 3HOUG 1IXRA 1KXLA 4BBSG 1FJGQ 5IYBG 1K9MC 3H15A 1OTCA 4JOIC 1D8LA 2UU9Q 3PGZA 3PUVA 3PUWA 1PH5A 3M9BA 2ATWA 4DK3C 2R93G 4UY8C 5BR8Q 1XNRQ 2OTLA 2VL6A 2VY3A 1PH3A 1VQ5A 1EQQA 3GTGH 3EBEA 4ME3A 3U50C 1PVOA 2YV5A 1K3RA 4A75A 3CXCA 3CCLA 2DUDA 2K50A 4HIDA 3HFZB 5FLMG 4GNXC 3RR5A 1IL2A 1IBKQ 2Y0SG 1V9PA 1OXTA 1YJWA 3FHWA 4QJFA 2OTJA 4FDBA 1HR0L 1L1OB 4DPGA 4LF4Q 3I4NG 2ZM6L 2ZJRA 2PI2E 4OWTB 4A3LH 1I3QH 1Q86C 4L5QA 2Z0SA 3OYYA 4PG3A 2AMCB 4WJ4A 2NN6G 1RIPA 4HIKA 4A3JH 1XMOL 1KQSA 3UDGA 3I56A 2E2IH 3FKIH 1PA6A 5IWAL 1Q46A 5H1SE 2K5VA 3CP0A 4AQYL 1EWIA 1I94Q 1HH2P 2B3GA 4DR3L 1VQMA 4GN3B 4LFCQ 3ULPA 3T1HQ 4OO1I 2KCMA 4DAYB 4JI6L 1NY4A 1Y1WH 3T1YQ 2GVBA 4O0AA 1YHAA 3TRZA 1N34L 4P71A 3UDFA 1LTLA 5ELNA 2A19A 2ASBA 2PNHA 3HKSA 1BBWA 5IYDG 2VQEL 4DUYL 1XJVA 1A8VA 1PH7A 4GLVB 2JA6H 2R92H 1SRUA 2PQAB 4NXMQ 3BU2A 2KHIA 5HGQA 4X64L 2JEBI 3K8AA 3JAMc 4JG2A 1KIXA 4B3RL 2NVQH 2VZAA 3W1GA 4NB3A 1HNZQ 2K14A 4O2DA 3E9HA 3CC4A 5JJIA 4UP9A 3KOJA 4YCVA 4DR7Q 2Q2IA 3DLLA 4DV7Q 4JI2Q 4GOPA 2E2HH 3STBC 4L5RC 2NZOA 3DM3A 4JI1L 1A63A 3L0OA 1D7QA 1IYJB 4LF7L 1VQHA 2Z6KA 2JA5H 2JA9A 3U4VA 2E2JH 1EOVA 4MNOA 2CWPA 1HNWL 2AWOA 3RN2A 4JCVE 4GNXB 2R7ZH 1YHQA 4JI7Q 4A3LG 1MKHA 3PUZA 2VUMH 2LXJA 1K8GA 5ELOA 4QL5A 4HIOA 1V43A 1IBML 4LF9Q 5JJLA 1N32L 5JEAJ 5LMUL 3KF6B 4IJLA 3G48A 1U5KA 3FKIG 5JEAG 3GTKH 3KDFA 5IYBH 1PH2A 1VQJA 1IZ6A 3E9IA 2L15A 1L2FA 5JJKA 1IBLL 1WFQA 3PUXA 4DV1L 3CPWA 1JJGA 4C3HH 1K0RA 4JI5Q 5GQOA 1Q8KA 2E5LL 2F4VL 1EQRA 1TWHH 4UP8A 4GN4B 1FL0A 3CPFA 2UU9L 4JBKA 2B63H 5FJ8G 5FLMH 3PO3H 3PV0A 3S1RH 3KLWA 2GN5A 2Y0SE 5BR8L 1C7YA 2JA6G 4YWMA 1XNRL 1JE5A 2R92G 4LFBQ 1SROA 3TS0A 1QUQB 1E1TA 4DK6C 4L5SA 1VQ4A 1Q1BA 3I4NH 4NXNL 4JI4Q 1SLJA 2YTYA 1HZAA 1MIUA 4DV0Q 4IO9A 3PO2G 1C9OA 3RLNA 4YHHQ 2UXCL 2B29A 1I6HH 4A3DH 3L7ZC 2OWOA 1E24A 4LF4L 2EXDA 3JC66 3A74A 5M5WH 2D0OA 4DV6L 3GTQH 2UXDQ 3F1ZA 2QGQA 4B3SQ 4A3MH 1P16A 3KFUA 3PIPA 4UP7A 1BBUA 1UE1A 4LW1A 2CWAA 3HOXG 3CCQA 4JI0Q 3AEVA 1GD7A 1EIYB 4DR5Q 4DR2Q 3K7AH 4LF8Q 4LUOA 5IYDH 1QZGA 1FGUA 3J80i 3S15H 2V1CC 3T1HL 3H3VH 4HJ5A 1B7YB 1GVPA 3ULJA 1Z9FA 1VCIA 3CC7A 3T1YL 3K81C 1YBYA 2D0PA 1VQKA 1VQDA 3EN2A 1X3EA 3J80c 1NBWA 1YITA 1VQNA 4IPCA 2I0QA 3EIVA 3HOVH 1GO3E 2D62A 4BY7H 1VQ6A 3M85A 3PF5A 2B63G 2MQHA 1XTDA 1DGSA 3MEFA 4MZ9A 3PO3G 4K0KQ 3MXNB 3J81c 1XMQL 1JJCB 2ZTDA 4LFAQ 3AQQA 1VQLA 1HNZL 1W2BA 3PCOB 4A93G 3W5OA 3GTPH 2RCNA 4DR7L 3S1QH 4X62Q 4JI2L 3AFQA 1N33L 4JYAQ 4C2MH 1XNQQ 3G71A 1QVGA 1SN8A 2UXBQ 1KAWA 4HJ7A 1MJEA 1PYSB 3F2DA 2HHHL 4DAMA 4YY3L 3LGJA 1XPRA 1PHJA 2K52A 4QIWE 4DR1L 4X65Q 1X3FA 5M3MH 2CFMA 4A3DG 1S3OA 2UUBL 1QZHA 1X56A 2ES2A 2I5HA 1I50H 2R7DA 4C3IH 4HIMA 3GTJH 5AJ3Q 4GN5A 4IPDA 1NJIC 3UE1A 1B8AA 2BH8A 4JBWA 3G4SA 4DV3Q 4YCWA 1YVCA 4IJHA 4X66L 4A3MG 1R9TH 1KHIA 2VQFL 3CCEA 1VQ8A 2K5HA 4LF9L 5C0XJ 4HJ8A 2YTVA 3J81j 1VQOA 2BH2A 5LMNQ 3M4PA 5C0XG 3KJPA 1YIJA 5IY0A 4WJ3M 2NN6I 1HZ9A 2KENA 3JAMi 4A3CG 1TWCH 3F8TA 4IOCA 5FJ8H 4AYBG 2ZJQA 3IRBA 4R4IA 3K0XA 4YCUA 3CCSA 1M90C 4B3TQ 2ZTCA 5IP9H 3TS2A 1CKNB 2OQKA 3ER0A 4P74A 4JI3L 3OW2A 1HZBA 1VQ9A 3KF8B 1AE2A 2UUCQ 2EQSA 4BBRH 4DV2L 1K8AC 3ICEA 3PUYA 4Y52H 4XIGS 5M5XH 3FP9A 4DR4L 3CC2A 2ID0A 2N3SA 3A5ZB 4JI8Q 2F52A 5IE8A 2ZJPA 4LF6L 3STBD 3HOVG 3I4MH 3PO2H 4BY7G 3UE0A 5C0XI 2ZTEA 1JMCA 4LFBL 1JT8A 4JV5Q 4GKJQ 4LUVA 3S14H 3AYHB 1NTGA 2E8GA 4J15A 2JA8G 3H3VI 4QQBX 2AKWB 5GAEC 3RNUA 4OX9L 3NEMA 5IP7G 3HOWH 1L0WA 1SMXA 4LF5L 4QGUA 1TWAH 2NZHA 2DGYA 3W1BA 2QA4A 1I5FA 2MFIA 3HOXH 4A3IH 1N36L 5M3MG 4B3ML 2JA7G 3S1MH 4IPHA 1KRTA 1HR0Q 3RN5A 1SE8A 1UWVA 2K4KA 5C44G 1L1OA 1EYGA 1S72A 3CCVA 3S1NH 1K73C 2UUAQ 4JI0L 1VQFA 2K5NA 2WB1G 4DR2L 4POGA 3SGIA 1YZ6A 4Y7NH 1ASZA 4DNIA 3UDXA 2KHJA 5IWAQ 1FJGL 4GOPC 5M3FG 1YNXA 1WJJA 5GAHC 3M4QA 2QEXA 4DV4Q 5DLQE 3I55A 5IP9G 1V1QA 4JI6Q 2Z6KC 4LNQA 4A93H 2A1AA 4PMWA 3Q8DA 2A8VA 1VQGA 5GAGC 4BBRG 1N34Q 4BXXH 4DR6Q 1OXSC 3F2BA 3HKZG 3K80C 1TWGH 2VQEQ 5HY6A 4DUYQ 1PH9A 1N8RC 4K0KL 3I4MG 1J5EQ 1IBKL 4LFAL 2MO0A 2WAQG 2H5XA 1A62A 4A3KH 4GKKQ 3ERSX 3BJUA 3S2DH 1SFOH 4X64Q 2PQAA 1MJCA 4BY1G 1CUKA 1XPOA 1XNQL 4LWCA 4H02A 2NVTH 4TVAB 2WFWA 1O7IA 1UEBA 1W3SA 4POFA 4JOIA 1NMGA 1PH1A 4X65L 3HOWG 4JI1Q 1LM0A 4DKAC 1J6QA 5C3EH 4A3IG 1X3GA 3A0JA 5AJ3L 4R4QA 1PYBA 5GROA 1I94L 4PZ7A 2CQOA 1BVSA 4PZ6A 4DV3L 1YJNA 4A3CH 4AYBE 4EQ5A 1HNWQ 1AE3A 4LFCL 3D31A 4GS3A 3CCRA 2MO1A 2IT1A 4GNXA 2XGTA 1P8LA 4P72A 3OTOQ 1PH4A 1LUZA 1UE6A 3GTMH 1Y1VH 1N32Q 4GKJL 1OXVA 3J81i 4B3TL 2IY5B 1Y14B 3PSIA 2AWNA 3KF6A 1E7ZA 4IPGA 4KLKA 3RZDH 3CMAA 2NVXH 5LMNW 2IHEA 4NXML 3BZCA
chains in the Genus database with same CATH superfamily
1IBLQ 4R4OA 3MAQA 4DV7L 2HQLA 4BXXG 3QJYA 1JB7A 4JV5L 3U4ZA 1CKMA 1HFNA 4DUZQ 1O78A 2X6LA 4NP5A 4RMFA 3WDNA 2ZT9C 5C4XG 1KD1C 3WOEA 1FD7D 2K1BA 4YWKA 1I3QB 1VQCA 3PIOA 1BCPB 5C44H 3LX0A 4RCNA 4KKTA 2WB1E 2E2IB 3FKIB 1PH8A 4ALPA 1TS5A 1GUOA 4G7HC 5M3FH 3CCJA 2BE5D 2J4XA 4IFDH 1DXMA 2NTSA 3M4OH 3I4LA 1N9WA 1Q90A 4N9PA 5CV9A 3UI2A 2JA6B 1OXUA 4RHSA 1TS4A 5A2QL 4RAUC 3NBIA 1CSQA 3PF4A 1WOCA 2WINB 4BY1H 4A4IA 2A6HD 1JE4A 1B2TA 1VQIA 4CKCA 5EAYA 5M5YH 1QB5D 2VW9A 1E1OA 2TSSA 2YTXA 4DV0L 4JBMA 2A6ED 1KLGD 1CKOA 4A3EG 1PFSA 2IJ0A 1X55A 3TN2A 2E2JB 2KCCA 4DK0A 3SHLA 5M9OA 3QO2A 3BDLA 2IW3A 5GADC 3MXNA 3R2TA 1VQPA 1TXYA 2ZXRA 3T56B 2RQXA 2R6GA 3E5SA 2L0CA 2RF4A 1XMOQ 1TWFH 1U4MA 2VS1A 1L0XB 2PI2A 3GV3A 3K0YA 3F2CA 1GOZA 4KN4C 5EPKA 2HIXA 4Y7NB 3CW2C 1FNUA 3I4OA 2RDFA 1EQVA 4L5TA 4DXFA 5ELEA 3D0FA 3S1RB 2EIFA 5J3BA 4H13C 1R4QB 5A2QE 2IHFA 1Y1WG 3C46A 1EY5A 5T1IA 2KBNA 1HFGA 1JC7A 2OCEA 4JYAL 1ILPA 3B6YA 3CHBD 3KF8A 2I5LX 3NQTA 4IFDI 2C35B 1H95A 3J7A5 3CU7A 3S2DB 5G3LD 1CQVA 2K03A 2KCNA 3U9SA 2DJFC 2NB0A 2EJGC 4DV5L 4OO1H 4A3GH 2NVTB 2EE1A 2EY1A 2MP1A 1PV4A 2LXKA 3CQZH 1B70B 2F3IA 3HOYH 3K5NA 2FXQA 1SYDA 2JA5G 4AYBB 2F0EA 1UAPA 1KL9A 4AH6A 2R7ZG 4KHPL 5HGTA 1IW7D 4U673 2BA0A 5F2DA 2BA1A 1YNNC 4EX5A 1CA5A 4U68A 1VS0A 4K8JA 3HOUG 1IXRA 2TMPA 1YNJC 2AQ3B 1ET6A 3H15A 2JA8B 3S16B 2UU9Q 3PGZA 3M9BA 3Q23A 4UY8C 4BS9A 2YU9B 4K5WA 1PH3A 2D5DA 3GTGH 3U50C 1K3RA 1GUTA 3HFZB 2Y0SG 1YJWA 3GTJB 1HR0L 3H94A 5IOCA 2PI2E 4XQQA 3A56A 2NN6G 1S4ZA 1AP0A 2FMMA 3HP3A 5CV5A 3UDGA 2CH4A 1F9SA 1DOLA 5H1SE 1A2TA 1HH2P 2B3GA 4DR3L 1KDAA 4LFCQ 3ULPA 3T1HQ 1SNMA 3VR5A 4OO1I 4JI6L 1H9RA 3T1YQ 4O0AA 3T16A 1RCVD 2JN4A 2JSOA 4X3TA 4P71A 4E6IA 3BDCA 1BBWA 3HKSA 2VQEL 1XJVA 1A8VA 1PH7A 5IGFA 1EY9A 1SRUA 4ME5A 2KHIA 4FVMA 4JG2A 3V05A 1XWEA 4LK1C 5C4HA 3BVMA 1HNZQ 4O2DA 5JJIA 4YCVA 2Q2IA 2O4XA 1RDPD 2NZOA 1ML0D 2NTTA 1PFMA 4JI1L 4A3IB 3FMCA 3W2DA 3S1MB 4LF7L 2K6AA 2Z6KA 2JA9A 1RD9D 2O5IC 4YIJA 1K83B 1HNWL 2VXWA 3RN2A 3R2IA 5JPMC 3AU7A 1K8GA 2XVSA 4QL5A 5ELOA 2HCIA 5D3DA 1IBML 1D1KA 2QILA 3SK5A 4LF9Q 3GTKH 2K32A 5IYBH 1PTOF 1IZ6A 3E9IA 2L15A 1A3TA 1L2FA 3NBHA 1E0BA 2WIIB 1IBLL 3PUXA 1X32A 5DM63 4OHJA 3CPWA 2Q8IB 3ITPA 3Q22A 1VMCA 4RGOS 2G9DA 1AZPA 2B63H 5FLMH 4ULLA 5C4XB 3VA5A 3KLWA 2HDLA 5BR8L 2R92G 5C4JB 1XNRL 1JE5A 3N52A 2WV6D 4L5SA 2RKSA 1Q1BA 1B53A 1T5XD 4JI4Q 3QWNA 4RGTA 3MA2B 2F03A 2NVYB 3OMCA 3SVMA 5D3IB 3U9OA 1STAA 2EXDA 3BDOA 3GTQH 1XYIA 2SDFA 4XQJA 2K28A 3IFDA 2NBFA 3KLRA 3FDTA 4B3SQ 4A3MH 1EL0A 1KNEA 4IUPA 4UP7A 4LW1A 1RODA 2CWAA 1V8QA 3DXJC 4DR5Q 3M3YB 2QDLA 3RZDB 4NW2A 1QZGA 3S15H 1UEAB 2V1CC 5AFWA 1Z9FA 4FXDA 4I7AA 1SAPA 1GUWA 5T1GA 1VQDA 1NCVA 1NBWA 3J80c 1VQNA 2ICIA 4C3HG 1SJED 4A3EB 2RA4A 4OEMB 1HA5A 4N8FA 1CM9A 1UNSA 3C2PA 2MQHA 4MZ9A 3MEFA 2DY8A 4XT1B 5KNBA 1CHQD 1DZ1A 3S1QH 4X62Q 4JI2L 4C2MH 1SN8A 1F9RA 1QCBD 1KAWA 2UXBQ 4N8X1 1XPRA 2K52A 1IL8A 3ONAB 1B3QA 3HS0C 4A3DG 1F2LA 2HQEA 5J1ZA 4J6HA 2ES2A 2Z8LA 1PRTF 2R7DA 1C48A 4IPDA 2F0WA 1B8AA 3HZXA 4DV3Q 1R9TH 3KK7A 1JB3A 1Q3LA 2BH2A 2BCOA 2Z4HA 1MBYA 5BN3A 3OMGA 3KJPA 2WKCA 1JWUD 2EY5A 2HD3A 3KLSX 3ZYYX 1Y1WB 1M8AA 3NQIA 3K0XA 4R4IA 3H91A 2ZJQA 3TS2A 3ER0A 4P74A 4V190 3OW2A 2EYLA 1KLUD 4BBRH 4DA2A 4Y52H 4H7BA 1TR5A 1RHPA 4HMIA 4XIGS 1NAPA 5M5XH 3FP9A 2ID0A 3HOVG 3STBD 4BY7G 3UE0A 2ZTEA 4JV5Q 2NVQB 2NUCA 2F0GA 4LUVA 3MVVA 3EFXD 1NTGA 3KBXA 4FYDA 3SK8A 1B9MA 1JICA 4O1NA 1U4RA 3G6JB 5L37A 2P5ZX 1L0WA 2JA5B 2DGYA 2DNCA 1II3A 3HOXH 1XXGA 4RH6A 2R7ZB 5M3MG 1WTOA 3OWFA 4G7ZC 2EXZA 5IIFA 1UWVA 4C3IG 5C44G 5CBEE 3J80E 1SMYC 1RTNA 3CCVA 4JI0L 2WB1G 3HOUB 3NWSA 4DR2L 4CJ1B 4POGA 1ASZA 2CH4W 3UDXA 1DCZA 5M3FG 3M4QA 3I55A 2O2LD 5IP9G 2NWGA 3T4AC 4A93H 2A1AA 1DJRD 4DAYA 2A8VA 3QR8A 1PFBA 5EPLA 3MXPA 5C5LA 1I4GA 3F2BA 2Y0SB 1TWGH 5HY6A 4MTKA 4DUYQ 3I4MG 1TT2A 4LFAL 3SK4A 1JWMD 2PQAA 1K8OA 4BY1G 1XPOA 1CK1A 4C1NI 5COYA 2WFWA 4POFA 1SYCA 4JOIA 4X65L 4ZUJA 4DKAC 3P20A 3NTIA 5C3EH 1X3GA 1PYBA 5GROA 4A3CH 4PZ6A 4MIUA 4LFCL 3GTOB 1LUZA 1Y1VH 1OXVA 4B3TL 2IY5B 1HRJA 1SNPA 4KLKA 2NVXH 5LMNW 2IHEA 1EY8A 4YWLA 1PYWD 4KY5A 4JI8L 1UE7A 2IX0A 5K5PA 2Z1CA 1HQRD 3A7AB 1FVIA 3BZKA 1W6KA 3P1HA 2JA7H 4OXPA 3MFYA 4DV5Q 4OIKA 2H1EA 1QUQA 5FO8B 1YJ9A 1QG7A 4NXNQ 3CMEA 2D2CC 1QE6A 2Q2HA 1KNAA 4K2KA 2HIVA 1KDCA 4CKEA 4OO1G 2HT1A 4DV6Q 4A3GG 3A5UA 1AEXA 1M1KC 1AZQA 4R4TA 2MNAA 3GV6A 4QCLA 4KHPQ 1RL2A 4ID6A 3HOYG 1OXXK 5KYIA 3GTLH 1J8IA 2CW0D 2OXPA 3HKZE 2R92B 2K05A 2F0MA 2N88A 2JYOA 1WCMH 1K28A 1T9HA 2OEOA 2E2HB 4XTCS 4JI4L 4HR7B 3G6EA 1MGSA 4JBJA 1U4LA 4ZLTF 1PLFA 4GKKL 1CHPD 1C8CA 2Q2TA 2F0TA 2JXMB 3GO5A 3RLOA 4B3SL 2IX1A 4MN3A 1N33Q 4QMGA 1KABA 4APVA 3R3OA 1Q1EA 4DFAA 3GP7A 2EYOA 4YY3Q 4P73A 4DR5L 4A3FH 4C3JH 2UUBQ 5ELDA 2LSSA 5IGEA 3FPPA 4DR3Q 4C3HB 3TP7A 2VQFQ 1BXTA 2F0JA 1Y8PB 3OTOL 1LT6D 2PPBC 1I6VC 2K04A 4KI0A 2ALYB 3LWEA 2DJGC 4L6TB 4OGQC 1EFWA 4A3BG 2R93H 2DY7A 1BCPD 1Q12A 1K3BC 2LKVA 2GVAA 5IYCH 3H0GH 1CKNA 4X62L 4DV2Q 3V96A 1B44D 2UXBL 1YI2A 4H0LC 3QOJA 1I6HB 3S24A 4MTNA 4A3DB 5EGTA 1X9NA 3Q24A 4RGMA 2B2TC 4LF7Q 3BZDB 4QY7A 1HJPA 4ZKCB 4FF3A 2F3WA 2GA4B 5BN4A 1AN8A 4A76A 1IBMQ 1N36Q 2XWJB 1LYLA 1TS2A 4R1JA 2PW5A 4CDDC 1EYCA 1KC8C 1SR3A 3HOZH 2X69A 3I2ZA 2AQ2B 1NE3A 3F2UA 2Q8TA 5EPJA 1X6OA 3HOVB 2DN8A 4BY7B 1UUPA 5K36H 1A0IA 3D4DA 4BBSG 4M8AA 5I4DA 4QB4A 5DEHA 5IYBG 1K9MC 1E2WA 3OOCA 1NSNS 2L5TA 2QW7A 3GTPB 3A54A 5BR8Q 1XNRQ 2OTLA 2VY3A 2SNSA 4ME3A 4KHVA 1HUMA 2YV5A 4A75A 3CCLA 2DUDA 3MTSA 5FLMG 5M3MB 4GNXC 4KD4A 5EBCA 4CJ0B 1IL2A 5I2XA 1V9PA 1IKLA 4OL7A 4C3IB 2OF1A 5C44B 1BF4A 2ZM6L 2WB1B 4A3LH 5EJWA 1I3QH 4ZRZA 4L5QA 3MFGA 1B3AA 4PG3A 4WJ4A 2QEJC 5KGUA 4A3JH 1JR0D 1KQSA 4QF4A 5M3FB 3J7AF 1JWSD 1QOHA 2F0OA 2E2IH 3FKIH 2K5VA 2SOBA 3O13A 4JVZA 1VQMA 2SEBD 2O5JC 5CORA 2BDOA 3UDFA 1LTLA 2A68C 3I4MB 1BO0A 1NR4A 1EWHA 4DUYL 1Y8NB 1LACA 3TZDA 2JA6H 3S14B 4BY1B 2HDMA 3BU2A 3FVQA 2EOTA 5HGQA 2JEBI 5FK9C 4B3RL 5M5YB 2F1MA 2KVMA 4NB3A 3W1GA 4GOPA 3DLLA 4JI2Q 3DM3A 4K6LA 4KTAA 1A63A 1D7QA 2FINB 4FO2A 5EBDA 4C56C 1VQHA 5KNCA 5EKKA 2E2JH 4Z9CB 2XRSD 4L8JA 3R93A 3ND8A 4JCVE 4GNXB 5EKIA 1PFNA 1V43A 4ZAIA 5JEAJ 4S3SA 5LMUL 1CQFA 3KF6B 2F0DA 4WFN3 1LT3D 1U5KA 5JEAG 1ICFB 3KDFA 4X3UA 1VQJA 5FKAC 5C3XA 5JJKA 3HG9A 1GHKA 1TWHH 4UP8A 4GN4B 4JBKA 1A15A 1HQMC 3PV0A 3S1RH 1DONA 2QF7A 4YWMA 3TS0A 1EIHA 1E1TA 4RHRA 4DU9A 4G4KA 5CGKA 3I4NH 4NXNL 5G3LF 1O7LA 4IO9A 3T13A 1CTMA 2RSOA 1NNXA 4YHHQ 2CQAA 1MHWC 4A3GB 1EYDA 2WACA 3L7ZC 1E24A 2K5WA 4LF4L 1CA6A 3A74A 5M5WH 4KY7A 4DV6L 3F1ZA 4IZ8A 3MXGA 3HOYB 3PIPA 1J9OA 5E4XA 1BBUA 2A69C 2LMCB 3HOXG 4IUQA 2C9OA 4JI0Q 1GD7A 1YNND 1H9JA 2PYKA 4DR2Q 3K7AH 1D1IA 3H3VH 4HJ5A 1YNJD 2F0VA 3BVGA 3PMFA 1VQKA 3EN2A 4HSVA 1ZXTA 3TDQA 2I0QA 3EIVA 4K2LA 1Y69U 2AUKA 2G5DA 3M85A 1B4OA 2A73B 3A8KE 3TSSA 1DGSA 1WTRA 3PO3G 3I73A 3MXNB 3GTGB 1CFMA 3J81c 1VQLA 2ZTDA 1LTRD 4LFAQ 1IYUA 3BVZA 3PCOB 3RZOB 1PZJD 4A93G 5ISRA 3CKIB 4DR7L 1N33L 1QVGA 4LMQD 3F2DA 4YY3L 3LGJA 1PHJA 4V0BA 4QIWE 4X65Q 1KTKA 1LV9A 2CFMA 2B2WA 1I4RA 1CT1D 1QZHA 2UUBL 2B2YA 1I50H 2F0LA 4HIMA 3GTJH 1NJIC 3UE1A 3G4SA 3A55A 4IJHA 2Z9HA 2XN9C 2VQFL 3TP8A 1VQ8A 2K5HA 3K5LA 5C0XJ 4LAAA 1V1PA 2YTVA 3J81j 4A3BB 3J81L 3M4PA 2VB2X 5C0XG 1GHJA 1SNOA 4A3CG 1TWCH 4IOCA 4KKSA 5FJ8H 4B3TQ 3IRBA 1M90C 4PMCA 4BWGB 1F9QA 4G57A 1VQ9A 3KF8B 1AE2A 4DV2L 2J0TD 4JI8Q 3A5ZB 3QIAA 5LL6X 1KAAA 2RVLA 3K5OA 3PO2H 1JMCA 1RJTA 4XYQA 1ET9A 3H3VI 1LTBD 3RNUA 3NUCA 1STYA 1AW7A 3ND9A 3W1BA 4RFBA 1CZWA 2EYHA 4A3IH 1N36L 2XWBB 4EGVA 2RCFA 2JA7G 1JOKA 1NUCA 3S1MH 4IPHA 1LO5D 4EQOA 1SE8A 1EU3A 1BBXC 4HN7A 3S17B 1L1OA 1EYGA 1K0SA 3V2TA 1LT4D 1K73C 4K6DA 4BBSB 2SNMA 4DNIA 1HCZA 2M00A 3J81E 1G6ZA 1I4HA 5GAHC 2QEXA 1PTOD 1PTOC 2Z6KC 3DM1A 3ERQA 4PMWA 3Q8DA 4DXGA 5GAGC 3D3RA 1N34Q 4BXXH 5CR3A 3HKZG 5FO7B 1PH9A 1D5XC 1N8RC 4K0KL 2E2DC 1A62A 4GKKQ 1SFOH 1STHA 2A74C 2KEEA 1O80A 2EZVA 1XNQL 2AQ1B 4H02A 1O7IA 1W3SA 2HUGA 3HOWG 3FEWX 4P2CB 3GTQB 1ZKOA 5AJ3L 4PZ7A 2CQOA 1YJNA 5CC4A 3TP6A 1AE3A 3I8ZA 1MSGA 1SE2A 1P8LA 2EJMA 3MWYW 3OTOQ 1PH4A 3GTMH 3URYA 2QDBA 1N32Q 4C3JG 3J81i 3I70A 3RZDH 1E7ZA 3CMAA 5E4WC 3BZCA 1WYDA 1ENCA 1EIFA 3GDEA 5FLXc 3S2HH 4L63B 2F4VQ 4K5VA 1Q81C 1PTOB 1QWYA 5IP7H 1ENFA 5NUCA 4A3EH 2PMZE 2R7FA 2R3ZA 3WWVA 4RCOA 3S1QB 5IYCG 4A3KG 4BA1I 1HHVA 2I46A 2KJXA 3H0GG 3OIPA 4C2MB 3U58A 3EROA 2I5MX 3CRLC 4EVOA 4KKUA 3RD4A 3VR2A 1C4QA 3CAMA 1EUJA 2JE6I 1HTLD 2LFNA 1D2BA 5FLXL 3CCUA 3NBHB 1PRTD 1E2ZA 2XRQD 1PRTC 2ZXPA 3KJOA 2UUAL 3AFPA 2N78A 5I9OA 5JVH3 1HR0W 2Q8RE 3OIQA 2L4NA 1HPCA 4X3KA 2XTIA 4HEDA 1TVXA 1BKBA 1YHBA 1BQQT 1JQYD 4UPAA 5J39A 1Z47A 3I90A 1X54A 1E22A 2HCCA 2WAQE 3HOZG 1NMFA 1HZCA 5M5XB 4DR6L 2JQOA 5LL6S 1TS3A 4F8MA 5K36G 1VQBA 1J5EL 4OIJA 1VQAA 4YHHL 1Z7TA 2B2UA 2KECA 3N6RA 3J7YW 3VDYA 1XMQQ 2RDGA 3A7LA 2V4DA 1S5BD 1PH6A 4WRDA 3HOXB 2ZM6Q 2RBMA 2E74C 3VYRA 4KY6A 1SMYD 3E3XA 4PZ8A 5D14A 1AH9A 1A6XA 4R8NA 5HURA 5KYLA 2G9HD 5FLXE 3DEOA 1F9PA 4IFDJ 1ONLA 4A3JG 1TQOA 4IFDG 1GJXA 4HAEA 1PRTB 3HOUH 2OQ0A 2MGSA 2RHSB 3PO3B 3NHHA 1S5ED 3T51B 1H9KA 2B2UC 1KDBA 2N8NA 4A93B 4TRDA 3GD7A 3LWUA 1PXUA 1TWGB 4B3RQ 4OWXB 3G7LA 1SYBA 3IKJA 3NSWA 3K5MA 2Q2UA 1D5ZC 4M1UB 5LHY1 1GKHA 3TQYA 3PIO3 1U0LA 2KCTA 4BA2I 4GLXA 4J8QA 3VA7A 3ULLA 5TSSA 4OX9Q 2VB3X 1Z6HA 3TEHB 4WORA 4AIMA 1HNXL 4LF5Q 5C3EB 4X6AH 1G8ZD 4ZQ3A 5IGGA 3E0EA 3PQIA 4HJ9A 5IODA 2JK8A 5LMUQ 1WTPA 2PZWA 2CKZB 1EOTA 3K7UC 1Y1VB 3GTOH 4O42A 4TQUS 4LUZA 1E3PA 2NVXB 1X3QA 1WVLA 4JOIC 2IWHA 1QJOA 1D8LA 1PH5A 3PUWA 2ATWA 4KJNA 2VL6A 4KJOA 1EQQA 4ZKBB 1PVOA 3NE5B 4CDCC 1LTSD 2R61A 1W6JA 2JA7B 4KV6A 1IBKQ 3FHWA 4QJFA 4F7XA 2OTJA 1ESFA 4LF4Q 3I4NG 2F0QA 2ZJRA 1B1ZA 2Z0SA 4B9WA 2AMCB 1RIPA 2PQEA 3H6MA 1PMRA 3NWTA 4I7ZC 1Q46A 3A8IE 4AQYL 4RA8A 3TZUA 3I3CA 4CDFC 2KCMA 4DAYB 2GVBA 3H09A 3HKZB 3TRZA 1N34L 5ELNA 2ASBA 1H9SA 2F0IA 5I6WA 4JW0A 2R92H 3KUPA 2PQAB 4ZK9B 1DD2A 4HTHA 1KIXA 3M4YA 3K8AA 1S5DD 3JAMc 2VZAA 3MC0B 3CC4A 3HOWB 3E9HA 4UP9A 1SEBD 1TWAB 3KOJA 4DR7Q 2E2HH 3L0OA 3MHBA 1V1OA 4KK7A 4UDUC 3VYUA 2AUJD 2AWOA 3MEHA 3DEPA 3DWQA 4IURA 3S1NB 1SNCA 3SE0A 4JI7Q 1Q8IA 3I91A 1MKHA 2IX3A 2VUMH 2LXJA 4XDXA 4HIOA 4C3JB 3L3OC 1SYEA 2B8GA 5JJLA 1N32L 3GQBA 1ZYRD 3JAML 2KHSA 1ZYRC 3G48A 4IJLA 3PIP3 3DUZA 2F0SA 3NXWA 1I4QA 1E2VA 2F0HA 2EJFC 2B2VA 5ELFA 4N9TA 1HTPA 1WFQA 4DV1L 4C3HH 1K0RA 4JK1C 5GQOA 2E5LL 4JI5Q 2F4VL 1IHZA 1EQRA 3VYSA 4RWSC 1RF2D 3CPFA 5DAUA 1BCPF 4ILWA 1EQTA 4A3KB 2EYJA 5FJ8G 3H0GB 3IFTA 1LABA 2ICEC 1C7YA 2F0FA 1QUQB 4FF1A 4DNRB 1WTVA 1VDZA 1SLJA 3W3AA 2KOLA 3PO2G 3RLNA 2B29A 1I6HH 4A3DH 5IGDA 2D0OA 2UXDQ 2QGQA 3KFUA 1UE1A 2PZTA 2RDHA 3CCQA 1EIYB 4LF8Q 4LUOA 2J7ZA 3HOZB 5IYDH 2CHBD 3J7AV 3JAME 3D8GA 4I65A 4XQNA 1X3EA 4RKBA 5CV7A 2EY6A 4F88A 3HOVH 1GO3E 1WTXA 4BY7H 1VQ6A 3PF5A 2B63G 1XTDA 4K0KQ 1XMQL 3AQQA 2I07B 3HEJA 3OHXC 3GTPH 2RCNA 4IUNA 1ENAA 3AFQA 1EFID 1XNQQ 3K59A 1MJEA 5I9PA 2F0KA 3E0JA 3QOLA 5I2YA 1X3FA 5M3MH 1MI2A 1TY2A 5IGCA 1S3OA 4XXEA 1OO9B 2I5HA 4C3IH 4NDXA 4GN5A 5AJ3Q 4JBWA 4A3JB 4YCWA 1ILQA 4XYOA 4A3MG 3M4OB 1O7ZA 4TKOB 1VQOA 1CI3M 1F2ZA 5LMNQ 3CRKC 1YIJA 2A68D 1HZ9A 3JAMi 1LT5D 3BG3A 1JCKB 2ZTCA 2BE5C 5IP9H 4R9WA 1CKNB 4ZYSA 1HZBA 1LTTD 2UUCQ 2EQSA 3ICEA 4PV1C 5IE8A 3I4MH 4LFBL 1JT8A 3S14H 3AYHB 2A6HC 4QQBX 2AKWB 5GAEC 4OX9L 1EYAA 1ESRA 3E6ZX 5IP7G 1SMXA 2A6EC 4LF5L 3A8JE 2QA4A 1TWFB 2K5DA 4DNTB 2K5QA 1FNVA 2A5HA 3FRPB 1KRTA 2K7VA 3RN5A 2K4KA 3H3VC 3IL8A 1MD2D 2UUAQ 4B9XA 1H9MA 1FYCA 5JPNC 1TY0A 2E75C 3SGIA 4Y7NH 2KHJA 5IWAQ 4GOPC 1IKMA 1AFPA 2EPBA 3BYTB 1BNZA 1STEA 3P75A 1TWHB 4XT3B 4LNQA 2FJ2A 2L55A 4BBRG 2F0UA 4DR6Q 1X3PA 1FR3A 1OXSC 2WKDA 3K80C 1G91A 1EWCA 1J5EQ 1IBKL 2MO0A 2WAQG 2K01A 3VR6A 3I4NB 3ERSX 3S2DH 4X64Q 2F3VA 3CQZB 1SYGA 1EY6A 4KN7C 1EIGA 4X3SA 2NVTH 4TVAB 5C3WA 1NMGA 2A69D 1RTOA 5M5WB 1QILA 3EQLC 4R4QA 4AYBE 4HMJA 3SEBA 3CCRA 2XGTA 3K7AB 4DF7A 4WJWA 3X3NA 5BN5A 4IUUA 4GKJL 2FHTA 1Y14B 4DN4M 2AWNA 1SE3A 1IW7C 4HCEA 4RGNA 4Q0FA 2L11A 4NPSA 3S16H 4R4CA 1QVFA 2N49A 2JA8H 2XSCA 5E1FA 3NPPA 4GOPB 1HA6A 1X65A 2EVBA 4ABNA 5I6YA 2YU9H 1S40A 2RHQB 3BS1A 4RG1A 4CHTB 1U9RA 4DGZA 1SE4A 4JI7L 3RZOH 2PO4A 1D5MC 1JJ2A 4QIWB 5DM73 1DYQA 3TBIB 3Q6SA 4DK1A 1F77A 3J7ZC 1HNXQ 1I50B 3C3LA 2UXCQ 3KDFB 2YYZA 3TREA 4IQZA 5E3FA 5C3EG 3UDIA 1IYVA 5FOBB 1STGA 2C5CA 3M7NA 1VMPA 3DHQA 5KNDA 3M7GA 1F2MA 4JI5L 1T5EA 3KYHC 1TWCB 2QCPX 4GLAC 1Y1VG 4A3BH 1G6PA 4DV4L 1I4PA 4ZCKA 4DAPA 3VYTA 1WTHA 3D4WA 5IT9c 4JC0A 5D65A 2VNUD 1YEZA 2B2WC 2B2YC 3PO2B 4IUTA 1WD0A 1PZID 4MHEA 1G291 1QNUA 2D9UA 2E76C 3NENA 1VQEA 2UXDL 4UAIA 3CCMA 1WI5A 4OONA 1LTID 3TP5A 3D4RA 2JEAI 1K83H 5DNFA 1Q82C 1UE5A 5C5MA 3ZJYC 3L2PA 3K57A 2HHHQ 5IT9L 4DR1Q 4LF8L 3GTKB 1RKNA 4FNFA 3KBGA 1ASYA 2WP8J 1QVCA 5A35A 4AQYQ 4G7OC 3I72A 3RLFA 4X66Q 3S17H 2AHOB 1A3VA 2EY2A 2IPKD 1VQ7A 1CSPA 3T53B 1R4PB 1SYFA 4BBSH 2B63B 1G51A 1Q7YC 2IL8A 4KHZA 2EYFA 4P75A 3EJIA 3NP8A 1GM5A 5C4XH 1WCMG 3CF5A 4JI3Q 5C4JH 4R8IA 1K8MA 1EZ8A 4H44C 1DM0B 4CGYB 1L1OC 4DR4Q 3I7FA 4LF6Q 4EQPA 4DUZL 3LNNA 1SFOB 4HJAA 1SNQA 1KRSA 1L0YB 1C0AA 4RKLA 2NVYH 4A3MB 2JJQA 4KMUC 4OELB 2JP1A 5CBAE 3CD6A 1V1PB 1O7YA 4OWWB 3AB9A 1GXDC 2FMCA 1EZ6A 4DAVA 4K5XA 4NKLA 3NELA 5LMNL 3S15B 2F0NA 4A3FG 5IT9E 1WD1A 4B3MQ 4FF2A 2Z4IA 4CBVA 3M3YH 1XX8A 3EVQA 2K75A 3GTMB 5E7NA 2VUMG 1MSHA 2UUCL 1XTCD 2X6GA 3NK9A 3DMUA 4DV1Q 3DWPA 5KEEA 2KEDA 1TIID 2CCZA 2E5LQ 1PDQA 1XPUA 1KXLA 4NMZA 1FJGQ 1SJHD 1OTCA 2PZUA 3S2HB 3PUVA 2R93G 1G2SA 4DK3C 5CV4A 2EYMA 1VQ5A 3EBEA 2PMZB 4UHVA 3SXHA 3CXCA 1I4XA 1PTOH 2K50A 4FP5D 4HIDA 3RR5A 1A3UA 3OPOA 1SBBB 1G2TA 1OXTA 3SR1A 2CVRA 4FDBA 1L1OB 5EKLA 4DPGA 3C1FA 1R9TB 4OWTB 1Q86C 3NTKA 3OYYA 4HIKA 1SNDA 1XMOL 2L9HA 4PQXA 3SDZA 3I56A 4QUFA 1BOSA 5JEAH 3J80L 1PA6A 5IWAL 2MPMA 3CP0A 1EWIA 1STBA 1I94Q 3FPUB 4CJ2C 4GN3B 5FO9B 1B9NA 2BDNA 5J22A 4BBRB 1NY4A 4QUCA 1Y1WH 5CV8A 4KD3A 1YHAA 2A19A 2PNHA 2WAQB 5IYDG 1FNWA 3D6CA 3L9AX 1A2UA 4GLVB 5KRUA 3P7JA 4NXMQ 4TSSA 2XIWA 4X64L 2NVQH 2K14A 3C1EA 2LY7A 4DV7Q 3AMUA 3STBC 4L5RC 1F2YA 3TMEA 3HGBA 1IYJB 2JA5H 2BOSA 3U4VA 2EDGA 1EOVA 4MNOA 2CWPA 2KUMA 2MHVA 2R7ZH 1YHQA 1SXTA 4A3LG 1JOOA 3PUZA 4IALA 2N55A 3NTHA 2NYZD 1LLRD 3FKIG 2ENBA 1PH2A 3BYYB 2NZ1D 1S5FD 4PMBA 1JJGA 5CYUA 1GUGA 1Q8KA 3DWAA 1FL0A 1LTGD 2UU9L 3PO3H 2JA6G 2GN5A 2Y0SE 2KQ3A 4LFBQ 5JOBA 1SROA 4DK6C 1VQ4A 1ICWA 2YTYA 3HRZC 1HZAA 1MIUA 4DV0Q 2NN6H 1C9OA 1JOQA 2UXCL 2OWOA 3JC66 2QKIC 3VR4A 3MZ5A 1P16A 4J1MA 1WTWA 3K6OA 1DOMA 3AEVA 4K14A 5C0XH 1B50A 1HUNA 1FGUA 3J80i 3T1HL 4CDEC 1B7YB 1GVPA 3ULJA 3VR3A 1EY4A 1VCIA 1VF7A 3K81C 1BR9A 3K58A 3QB3A 3CC7A 3T1YL 1YBYA 2D0PA 4CKBA 3EA6A 2FFKB 1YITA 2K33A 4IPCA 3RUZA 2D62A 2F0PA 5JVG3 2B8FA 5JAVA 1JJCB 4ODGA 5ELCA 1HNZL 1W2BA 2M9VA 3W5OA 2EYPA 4LJZC 1SSOA 4JYAQ 1DOKA 2MJ8A 3G71A 1FGBD 4Q5VA 4HJ7A 2H4OA 1PYSB 2HHHL 4DAMA 2OT2A 1TU2B 2PW7A 4DR1L 5C6AA 4JPBW 1X56A 2BH8A 1YVCA 1EEFD 4X66L 1KHIA 3CCEA 4F87A 1EEID 4LF9L 3GTLB 4HJ8A 1ZEQX 1U4PA 4WJ3M 5IY0A 2NN6I 3D6WA 2KENA 3OW7A 3F8TA 4IOAA 4GKJQ 4AYBG 4YCUA 1WCMB 3CCSA 3IAYA 2OQKA 2RSNA 4JI3L 5CV6A 2DNEA 5IGBA 4K8IA 1K8AC 1HXYD 3PUYA 2CW0C 1STNA 4IUVA 3Q0AA 4DR4L 3CC2A 4PNYA 4LF6L 2N3SA 2F52A 5JJZA 2ZJPA 4FXKC 5EQ0A 5C0XI 2B39A 3KLSA 2PNRC 2E8GA 1VF5C 4J15A 2JA8G 2F4IA 3NEMA 2LS01 3HOWH 4GZYC 4QGUA 1TWAH 2NZHA 1I5FA 2MFIA 4A3FB 2L12A 3R8BA 2Z6BA 4B3ML 1GUSA 1HR0Q 3OSOA 2VUMB 2KA7A 2M2LA 4C1NK 1S72A 1M4VA 3MXUA 4FF4A 3S1NH 1D6EC 1VQFA 2K5NA 1EY7A 2B2TA 3OWEB 1TKWB 1YZ6A 1BUVT 1FJGL 3X3MA 2R93B 1YNXA 5CMDA 1WJJA 1S5CD 4DV4Q 5DLQE 1QNKA 1V1QA 4JI6Q 2MUYA 1VQGA 1Y8OB 1EY0A 2VQEQ 1BDOA 4EQNA 1CZGA 1BCPC 1SDFA 4A3KH 2H5XA 4HSPA 2XNAC 1PZKD 1EU4A 3BJUA 1MJCA 1WTQA 1JORA 1CUKA 4IN3A 4LWCA 2B2VC 1UEBA 1PH1A 5ELBA 4JI1Q 1LM0A 4HCSA 3SK6A 4B08A 1J6QA 2ZXOA 4A3IG 2L1BA 3A0JA 1I94L 1HNWQ 1BVSA 1GUNA 4DV3L 4EQ5A 3S9WA 3RMHA 3D31A 4GS3A 3QG1A 5C4ZA 2MO1A 2IT1A 4GNXA 5KIXA 1H9SB 4P72A 1UE6A 4ZUIA 2PCFB 1NR2A 4FXGC 3PSIA 3KF6A 3WOFA 4IPGA 1LTAD 4NXML
chains in the Genus database with same CATH topology
1WYDA 1IBLQ 4NPSA 4YWLA 3S16H 1EIFA 3GDEA 2N49A 4R4CA 4R4OA 5FLXc 1QVFA 2JA8H 4GOPB 3S2HH 1X65A 4JI8L 2F4VQ 1Q81C 1UE7A 2IX0A 4DV7L 2HQLA 2YU9H 5IP7H 4BXXG 1S40A 2RHQB 4A3EH 1JB7A 4JV5L 3U4ZA 1CKMA 4RG1A 2PMZE 2R7FA 1FVIA 3WWVA 4DUZQ 3BZKA 5IYCG 4RMFA 4BA1I 4A3KG 3H0GG 2JA7H 3U58A 4OXPA 1KD1C 5C4XG 2I5MX 4DV5Q 4YWKA 1VQCA 1QUQA 3PIOA 5C44H 1YJ9A 4JI7L 4NXNQ 3RZOH 1JJ2A 3CMEA 3CAMA 1EUJA 2Q2HA 2WB1E 2JE6I 3J7ZC 1PH8A 4ALPA 1HNXQ 2UXCQ 2HIVA 3KDFB 2YYZA 3TREA 4OO1G 2HT1A 5C3EG 3CCUA 3NBHB 5M3FH 3CCJA 3A5UA 4DV6Q 3UDIA 4A3GG 1M1KC 4R4TA 3KJOA 2MNAA 2UUAL 3M7NA 4KHPQ 3AFPA 2N78A 1HR0W 1RL2A 4JI5L 3HOYG 3M4OH 3KYHC 1N9WA 1OXXK 2XTIA 3GTLH 4GLAC 3HKZE 1BKBA 1OXUA 1Y1VG 1YHBA 4A3BH 4UPAA 1G6PA 1Z47A 4DV4L 1X54A 1E22A 2WAQE 3HOZG 5IT9c 4JC0A 1WCMH 1CSQA 1NMFA 1HZCA 1YEZA 3PF4A 2VNUD 1WOCA 1T9HA 4BY1H 4A4IA 4DR6L 2JQOA 4XTCS 4JI4L 1VQIA 3G6EA 5EAYA 5M5YH 5K36G 2VW9A 1E1OA 4DV0L 1VQBA 2YTXA 4JBJA 4JBMA 1J5EL 1CKOA 1VQAA 1PFSA 4YHHL 1G291 4A3EG 4GKKL 1X55A 2Q2TA 3NENA 3VDYA 1VQEA 1XMQQ 2UXDL 5GADC 3GO5A 3CCMA 1WI5A 4OONA 3RLOA 4B3SL 1VQPA 1PH6A 2IX1A 1TXYA 1K83H 2ZM6Q 1N33Q 2JEAI 4APVA 4PZ8A 1Q82C 1Q1EA 1UE5A 3ZJYC 3L2PA 2R6GA 1AH9A 2HHHQ 4YY3Q 4P73A 4DR5L 4DR1Q 2RF4A 1XMOQ 4LF8L 4A3FH 1TWFH 4C3JH 2UUBQ 2VS1A 1ASYA 2WP8J 1QVCA 2LSSA 2PI2A 4AQYQ 3F2CA 3RLFA 4IFDJ 4X66Q 4DR3Q 3S17H 2HIXA 2VQFQ 2AHOB 3OTOL 3CW2C 4A3JG 1VQ7A 4IFDG 1CSPA 3I4OA 4KI0A 2ALYB 4L5TA 3HOUH 2OQ0A 4BBSH 2RHSB 1EFWA 3D0FA 2EIFA 1G51A 1Q7YC 4A3BG 5J3BA 4KHZA 2R93H 1Q12A 2N8NA 4P75A 2GVAA 5IYCH 2IHFA 3H0GH 1Y1WG 1GM5A 3GD7A 1WCMG 5C4XH 3CF5A 4JI3Q 1CKNA 4X62L 2KBNA 4OWXB 2OCEA 5C4JH 4DV2Q 4JYAL 4B3RQ 3B6YA 2I5LX 4IFDI 2C35B 1L1OC 3I7FA 1YI2A 4LF6Q 3J7A5 4DR4Q 4DUZL 2UXBL 2Q2UA 1H95A 3S24A 4MTNA 1X9NA 4HJAA 1GKHA 4DV5L 3TQYA 4LF7Q 1KRSA 1C0AA 1U0LA 2NVYH 4QY7A 4A3GH 2JJQA 2KCTA 4BA2I 4GLXA 3ULLA 4OX9Q 1PV4A 1HJPA 2LXKA 3CQZH 1B70B 2F3IA 3CD6A 4OWWB 3TEHB 4AIMA 4LF5Q 1HNXL 4X6AH 3HOYH 3NELA 2FXQA 3E0EA 5LMNL 4A76A 4HJ9A 1IBMQ 1N36Q 2JA5G 2JK8A 1LYLA 1KL9A 4AH6A 5LMUQ 4R1JA 4A3FG 4B3MQ 4IOAA 3M3YH 2R7ZG 1KC8C 4KHPL 1SR3A 3HOZH 2K75A 2CKZB 2BA0A 5E7NA 2VUMG 3K7UC 3I2ZA 3GTOH 1NE3A 2UUCL 4DV1Q 1X6OA 2BA1A 4TQUS 4EX5A 4LUZA 1E3PA 1VS0A 2CCZA 2E5LQ 1XPUA 1A0IA 3HOUG 1IXRA 1KXLA 4BBSG 1FJGQ 5IYBG 1K9MC 3H15A 1OTCA 4JOIC 1D8LA 2UU9Q 3PGZA 3PUVA 3PUWA 1PH5A 3M9BA 2ATWA 4DK3C 2R93G 4UY8C 5BR8Q 1XNRQ 2OTLA 2VL6A 2VY3A 1PH3A 1VQ5A 1EQQA 3GTGH 3EBEA 4ME3A 3U50C 1PVOA 2YV5A 1K3RA 4A75A 3CXCA 3CCLA 2DUDA 2K50A 4HIDA 3HFZB 5FLMG 4GNXC 3RR5A 1IL2A 1IBKQ 2Y0SG 1V9PA 1OXTA 1YJWA 3FHWA 4QJFA 2OTJA 4FDBA 1HR0L 1L1OB 4DPGA 4LF4Q 3I4NG 2ZM6L 2ZJRA 2PI2E 4OWTB 4A3LH 1I3QH 1Q86C 4L5QA 2Z0SA 3OYYA 4PG3A 2AMCB 4WJ4A 2NN6G 1RIPA 4HIKA 4A3JH 1XMOL 1KQSA 3UDGA 3I56A 2E2IH 3FKIH 1PA6A 5IWAL 1Q46A 5H1SE 2K5VA 3CP0A 4AQYL 1EWIA 1I94Q 1HH2P 2B3GA 4DR3L 1VQMA 4GN3B 4LFCQ 3ULPA 3T1HQ 4OO1I 2KCMA 4DAYB 4JI6L 1NY4A 1Y1WH 3T1YQ 2GVBA 4O0AA 1YHAA 3TRZA 1N34L 4P71A 3UDFA 1LTLA 5ELNA 2A19A 2ASBA 2PNHA 3HKSA 1BBWA 5IYDG 2VQEL 4DUYL 1XJVA 1A8VA 1PH7A 4GLVB 2JA6H 2R92H 1SRUA 2PQAB 4NXMQ 3BU2A 2KHIA 5HGQA 4X64L 2JEBI 3K8AA 3JAMc 4JG2A 1KIXA 4B3RL 2NVQH 2VZAA 3W1GA 4NB3A 1HNZQ 2K14A 4O2DA 3E9HA 3CC4A 5JJIA 4UP9A 3KOJA 4YCVA 4DR7Q 2Q2IA 3DLLA 4DV7Q 4JI2Q 4GOPA 2E2HH 3STBC 4L5RC 2NZOA 3DM3A 4JI1L 1A63A 3L0OA 1D7QA 1IYJB 4LF7L 1VQHA 2Z6KA 2JA5H 2JA9A 3U4VA 2E2JH 1EOVA 4MNOA 2CWPA 1HNWL 2AWOA 3RN2A 4JCVE 4GNXB 2R7ZH 1YHQA 4JI7Q 4A3LG 1MKHA 3PUZA 2VUMH 2LXJA 1K8GA 5ELOA 4QL5A 4HIOA 1V43A 1IBML 4LF9Q 5JJLA 1N32L 5JEAJ 5LMUL 3KF6B 4IJLA 3G48A 1U5KA 3FKIG 5JEAG 3GTKH 3KDFA 5IYBH 1PH2A 1VQJA 1IZ6A 3E9IA 2L15A 1L2FA 5JJKA 1IBLL 1WFQA 3PUXA 4DV1L 3CPWA 1JJGA 4C3HH 1K0RA 4JI5Q 5GQOA 1Q8KA 2E5LL 2F4VL 1EQRA 1TWHH 4UP8A 4GN4B 1FL0A 3CPFA 2UU9L 4JBKA 2B63H 5FJ8G 5FLMH 3PO3H 3PV0A 3S1RH 3KLWA 2GN5A 2Y0SE 5BR8L 1C7YA 2JA6G 4YWMA 1XNRL 1JE5A 2R92G 4LFBQ 1SROA 3TS0A 1QUQB 1E1TA 4DK6C 4L5SA 1VQ4A 1Q1BA 3I4NH 4NXNL 4JI4Q 1SLJA 2YTYA 1HZAA 1MIUA 4DV0Q 4IO9A 3PO2G 1C9OA 3RLNA 4YHHQ 2UXCL 2B29A 1I6HH 4A3DH 3L7ZC 2OWOA 1E24A 4LF4L 2EXDA 3JC66 3A74A 5M5WH 2D0OA 4DV6L 3GTQH 2UXDQ 3F1ZA 2QGQA 4B3SQ 4A3MH 1P16A 3KFUA 3PIPA 4UP7A 1BBUA 1UE1A 4LW1A 2CWAA 3HOXG 3CCQA 4JI0Q 3AEVA 1GD7A 1EIYB 4DR5Q 4DR2Q 3K7AH 4LF8Q 4LUOA 5IYDH 1QZGA 1FGUA 3J80i 3S15H 2V1CC 3T1HL 3H3VH 4HJ5A 1B7YB 1GVPA 3ULJA 1Z9FA 1VCIA 3CC7A 3T1YL 3K81C 1YBYA 2D0PA 1VQKA 1VQDA 3EN2A 1X3EA 3J80c 1NBWA 1YITA 1VQNA 4IPCA 2I0QA 3EIVA 3HOVH 1GO3E 2D62A 4BY7H 1VQ6A 3M85A 3PF5A 2B63G 2MQHA 1XTDA 1DGSA 3MEFA 4MZ9A 3PO3G 4K0KQ 3MXNB 3J81c 1XMQL 1JJCB 2ZTDA 4LFAQ 3AQQA 1VQLA 1HNZL 1W2BA 3PCOB 4A93G 3W5OA 3GTPH 2RCNA 4DR7L 3S1QH 4X62Q 4JI2L 3AFQA 1N33L 4JYAQ 4C2MH 1XNQQ 3G71A 1QVGA 1SN8A 2UXBQ 1KAWA 4HJ7A 1MJEA 1PYSB 3F2DA 2HHHL 4DAMA 4YY3L 3LGJA 1XPRA 1PHJA 2K52A 4QIWE 4DR1L 4X65Q 1X3FA 5M3MH 2CFMA 4A3DG 1S3OA 2UUBL 1QZHA 1X56A 2ES2A 2I5HA 1I50H 2R7DA 4C3IH 4HIMA 3GTJH 5AJ3Q 4GN5A 4IPDA 1NJIC 3UE1A 1B8AA 2BH8A 4JBWA 3G4SA 4DV3Q 4YCWA 1YVCA 4IJHA 4X66L 4A3MG 1R9TH 1KHIA 2VQFL 3CCEA 1VQ8A 2K5HA 4LF9L 5C0XJ 4HJ8A 2YTVA 3J81j 1VQOA 2BH2A 5LMNQ 3M4PA 5C0XG 3KJPA 1YIJA 5IY0A 4WJ3M 2NN6I 1HZ9A 2KENA 3JAMi 4A3CG 1TWCH 3F8TA 4IOCA 5FJ8H 4AYBG 2ZJQA 3IRBA 4R4IA 3K0XA 4YCUA 3CCSA 1M90C 4B3TQ 2ZTCA 5IP9H 3TS2A 1CKNB 2OQKA 3ER0A 4P74A 4JI3L 3OW2A 1HZBA 1VQ9A 3KF8B 1AE2A 2UUCQ 2EQSA 4BBRH 4DV2L 1K8AC 3ICEA 3PUYA 4Y52H 4XIGS 5M5XH 3FP9A 4DR4L 3CC2A 2ID0A 2N3SA 3A5ZB 4JI8Q 2F52A 5IE8A 2ZJPA 4LF6L 3STBD 3HOVG 3I4MH 3PO2H 4BY7G 3UE0A 5C0XI 2ZTEA 1JMCA 4LFBL 1JT8A 4JV5Q 4GKJQ 4LUVA 3S14H 3AYHB 1NTGA 2E8GA 4J15A 2JA8G 3H3VI 4QQBX 2AKWB 5GAEC 3RNUA 4OX9L 3NEMA 5IP7G 3HOWH 1L0WA 1SMXA 4LF5L 4QGUA 1TWAH 2NZHA 2DGYA 3W1BA 2QA4A 1I5FA 2MFIA 3HOXH 4A3IH 1N36L 5M3MG 4B3ML 2JA7G 3S1MH 4IPHA 1KRTA 1HR0Q 3RN5A 1SE8A 1UWVA 2K4KA 5C44G 1L1OA 1EYGA 1S72A 3CCVA 3S1NH 1K73C 2UUAQ 4JI0L 1VQFA 2K5NA 2WB1G 4DR2L 4POGA 3SGIA 1YZ6A 4Y7NH 1ASZA 4DNIA 3UDXA 2KHJA 5IWAQ 1FJGL 4GOPC 5M3FG 1YNXA 1WJJA 5GAHC 3M4QA 2QEXA 4DV4Q 5DLQE 3I55A 5IP9G 1V1QA 4JI6Q 2Z6KC 4LNQA 4A93H 2A1AA 4PMWA 3Q8DA 2A8VA 1VQGA 5GAGC 4BBRG 1N34Q 4BXXH 4DR6Q 1OXSC 3F2BA 3HKZG 3K80C 1TWGH 2VQEQ 5HY6A 4DUYQ 1PH9A 1N8RC 4K0KL 3I4MG 1J5EQ 1IBKL 4LFAL 2MO0A 2WAQG 2H5XA 1A62A 4A3KH 4GKKQ 3ERSX 3BJUA 3S2DH 1SFOH 4X64Q 2PQAA 1MJCA 4BY1G 1CUKA 1XPOA 1XNQL 4LWCA 4H02A 2NVTH 4TVAB 2WFWA 1O7IA 1UEBA 1W3SA 4POFA 4JOIA 1NMGA 1PH1A 4X65L 3HOWG 4JI1Q 1LM0A 4DKAC 1J6QA 5C3EH 4A3IG 1X3GA 3A0JA 5AJ3L 4R4QA 1PYBA 5GROA 1I94L 4PZ7A 2CQOA 1BVSA 4PZ6A 4DV3L 1YJNA 4A3CH 4AYBE 4EQ5A 1HNWQ 1AE3A 4LFCL 3D31A 4GS3A 3CCRA 2MO1A 2IT1A 4GNXA 2XGTA 1P8LA 4P72A 3OTOQ 1PH4A 1LUZA 1UE6A 3GTMH 1Y1VH 1N32Q 4GKJL 1OXVA 3J81i 4B3TL 2IY5B 1Y14B 3PSIA 2AWNA 3KF6A 1E7ZA 4IPGA 4KLKA 3RZDH 3CMAA 2NVXH 5LMNW 2IHEA 4NXML 3BZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYD A;  1IBL Q;  4NPS A;  4YWL A;  3S16 H;  1EIF A;  3GDE A;  2N49 A;  4R4C A;  4R4O A;  5FLX c;  1QVF A;  2JA8 H;  4GOP B;  3S2H H;  1X65 A;  4JI8 L;  2F4V Q;  1Q81 C;  1UE7 A;  2IX0 A;  4DV7 L;  2HQL A;  2YU9 H;  5IP7 H;  4BXX G;  1S40 A;  2RHQ B;  4A3E H;  1JB7 A;  4JV5 L;  3U4Z A;  1CKM A;  4RG1 A;  2PMZ E;  2R7F A;  1FVI A;  3WWV A;  4DUZ Q;  3BZK A;  5IYC G;  4RMF A;  4BA1 I;  4A3K G;  3H0G G;  2JA7 H;  3U58 A;  4OXP A;  1KD1 C;  5C4X G;  2I5M X;  4DV5 Q;  4YWK A;  1VQC A;  1QUQ A;  3PIO A;  5C44 H;  1YJ9 A;  4JI7 L;  4NXN Q;  3RZO H;  1JJ2 A;  3CME A;  3CAM A;  1EUJ A;  2Q2H A;  2WB1 E;  2JE6 I;  3J7Z C;  1PH8 A;  4ALP A;  1HNX Q;  2UXC Q;  2HIV A;  3KDF B;  2YYZ A;  3TRE A;  4OO1 G;  2HT1 A;  5C3E G;  3CCU A;  3NBH B;  5M3F H;  3CCJ A;  3A5U A;  4DV6 Q;  3UDI A;  4A3G G;  1M1K C;  4R4T A;  3KJO A;  2MNA A;  2UUA L;  3M7N A;  4KHP Q;  3AFP A;  2N78 A;  1HR0 W;  1RL2 A;  4JI5 L;  3HOY G;  3M4O H;  3KYH C;  1N9W A;  1OXX K;  2XTI A;  3GTL H;  4GLA C;  3HKZ E;  1BKB A;  1OXU A;  1Y1V G;  1YHB A;  4A3B H;  4UPA A;  1G6P A;  1Z47 A;  4DV4 L;  1X54 A;  1E22 A;  2WAQ E;  3HOZ G;  5IT9 c;  4JC0 A;  1WCM H;  1CSQ A;  1NMF A;  1HZC A;  1YEZ A;  3PF4 A;  2VNU D;  1WOC A;  1T9H A;  4BY1 H;  4A4I A;  4DR6 L;  2JQO A;  4XTC S;  4JI4 L;  1VQI A;  3G6E A;  5EAY A;  5M5Y H;  5K36 G;  2VW9 A;  1E1O A;  4DV0 L;  1VQB A;  2YTX A;  4JBJ A;  4JBM A;  1J5E L;  1CKO A;  1VQA A;  1PFS A;  4YHH L;  1G29 1;  4A3E G;  4GKK L;  1X55 A;  2Q2T A;  3NEN A;  3VDY A;  1VQE A;  1XMQ Q;  2UXD L;  5GAD C;  3GO5 A;  3CCM A;  1WI5 A;  4OON A;  3RLO A;  4B3S L;  1VQP A;  1PH6 A;  2IX1 A;  1TXY A;  1K83 H;  2ZM6 Q;  1N33 Q;  2JEA I;  4APV A;  4PZ8 A;  1Q82 C;  1Q1E A;  1UE5 A;  3ZJY C;  3L2P A;  2R6G A;  1AH9 A;  2HHH Q;  4YY3 Q;  4P73 A;  4DR5 L;  4DR1 Q;  2RF4 A;  1XMO Q;  4LF8 L;  4A3F H;  1TWF H;  4C3J H;  2UUB Q;  2VS1 A;  1ASY A;  2WP8 J;  1QVC A;  2LSS A;  2PI2 A;  4AQY Q;  3F2C A;  3RLF A;  4IFD J;  4X66 Q;  4DR3 Q;  3S17 H;  2HIX A;  2VQF Q;  2AHO B;  3OTO L;  3CW2 C;  4A3J G;  1VQ7 A;  4IFD G;  1CSP A;  3I4O A;  4KI0 A;  2ALY B;  4L5T A;  3HOU H;  2OQ0 A;  4BBS H;  2RHS B;  1EFW A;  3D0F A;  2EIF A;  1G51 A;  1Q7Y C;  4A3B G;  5J3B A;  4KHZ A;  2R93 H;  1Q12 A;  2N8N A;  4P75 A;  2GVA A;  5IYC H;  2IHF A;  3H0G H;  1Y1W G;  1GM5 A;  3GD7 A;  1WCM G;  5C4X H;  3CF5 A;  4JI3 Q;  1CKN A;  4X62 L;  2KBN A;  4OWX B;  2OCE A;  5C4J H;  4DV2 Q;  4JYA L;  4B3R Q;  3B6Y A;  2I5L X;  4IFD I;  2C35 B;  1L1O C;  3I7F A;  1YI2 A;  4LF6 Q;  3J7A 5;  4DR4 Q;  4DUZ L;  2UXB L;  2Q2U A;  1H95 A;  3S24 A;  4MTN A;  1X9N A;  4HJA A;  1GKH A;  4DV5 L;  3TQY A;  4LF7 Q;  1KRS A;  1C0A A;  1U0L A;  2NVY H;  4QY7 A;  4A3G H;  2JJQ A;  2KCT A;  4BA2 I;  4GLX A;  3ULL A;  4OX9 Q;  1PV4 A;  1HJP A;  2LXK A;  3CQZ H;  1B70 B;  2F3I A;  3CD6 A;  4OWW B;  3TEH B;  4AIM A;  4LF5 Q;  1HNX L;  4X6A H;  3HOY H;  3NEL A;  2FXQ A;  3E0E A;  5LMN L;  4A76 A;  4HJ9 A;  1IBM Q;  1N36 Q;  2JA5 G;  2JK8 A;  1LYL A;  1KL9 A;  4AH6 A;  5LMU Q;  4R1J A;  4A3F G;  4B3M Q;  4IOA A;  3M3Y H;  2R7Z G;  1KC8 C;  4KHP L;  1SR3 A;  3HOZ H;  2K75 A;  2CKZ B;  2BA0 A;  5E7N A;  2VUM G;  3K7U C;  3I2Z A;  3GTO H;  1NE3 A;  2UUC L;  4DV1 Q;  1X6O A;  2BA1 A;  4TQU S;  4EX5 A;  4LUZ A;  1E3P A;  1VS0 A;  2CCZ A;  2E5L Q;  1XPU A;  1A0I A;  3HOU G;  1IXR A;  1KXL A;  4BBS G;  1FJG Q;  5IYB G;  1K9M C;  3H15 A;  1OTC A;  4JOI C;  1D8L A;  2UU9 Q;  3PGZ A;  3PUV A;  3PUW A;  1PH5 A;  3M9B A;  2ATW A;  4DK3 C;  2R93 G;  4UY8 C;  5BR8 Q;  1XNR Q;  2OTL A;  2VL6 A;  2VY3 A;  1PH3 A;  1VQ5 A;  1EQQ A;  3GTG H;  3EBE A;  4ME3 A;  3U50 C;  1PVO A;  2YV5 A;  1K3R A;  4A75 A;  3CXC A;  3CCL A;  2DUD A;  2K50 A;  4HID A;  3HFZ B;  5FLM G;  4GNX C;  3RR5 A;  1IL2 A;  1IBK Q;  2Y0S G;  1V9P A;  1OXT A;  1YJW A;  3FHW A;  4QJF A;  2OTJ A;  4FDB A;  1HR0 L;  1L1O B;  4DPG A;  4LF4 Q;  3I4N G;  2ZM6 L;  2ZJR A;  2PI2 E;  4OWT B;  4A3L H;  1I3Q H;  1Q86 C;  4L5Q A;  2Z0S A;  3OYY A;  4PG3 A;  2AMC B;  4WJ4 A;  2NN6 G;  1RIP A;  4HIK A;  4A3J H;  1XMO L;  1KQS A;  3UDG A;  3I56 A;  2E2I H;  3FKI H;  1PA6 A;  5IWA L;  1Q46 A;  5H1S E;  2K5V A;  3CP0 A;  4AQY L;  1EWI A;  1I94 Q;  1HH2 P;  2B3G A;  4DR3 L;  1VQM A;  4GN3 B;  4LFC Q;  3ULP A;  3T1H Q;  4OO1 I;  2KCM A;  4DAY B;  4JI6 L;  1NY4 A;  1Y1W H;  3T1Y Q;  2GVB A;  4O0A A;  1YHA A;  3TRZ A;  1N34 L;  4P71 A;  3UDF A;  1LTL A;  5ELN A;  2A19 A;  2ASB A;  2PNH A;  3HKS A;  1BBW A;  5IYD G;  2VQE L;  4DUY L;  1XJV A;  1A8V A;  1PH7 A;  4GLV B;  2JA6 H;  2R92 H;  1SRU A;  2PQA B;  4NXM Q;  3BU2 A;  2KHI A;  5HGQ A;  4X64 L;  2JEB I;  3K8A A;  3JAM c;  4JG2 A;  1KIX A;  4B3R L;  2NVQ H;  2VZA A;  3W1G A;  4NB3 A;  1HNZ Q;  2K14 A;  4O2D A;  3E9H A;  3CC4 A;  5JJI A;  4UP9 A;  3KOJ A;  4YCV A;  4DR7 Q;  2Q2I A;  3DLL A;  4DV7 Q;  4JI2 Q;  4GOP A;  2E2H H;  3STB C;  4L5R C;  2NZO A;  3DM3 A;  4JI1 L;  1A63 A;  3L0O A;  1D7Q A;  1IYJ B;  4LF7 L;  1VQH A;  2Z6K A;  2JA5 H;  2JA9 A;  3U4V A;  2E2J H;  1EOV A;  4MNO A;  2CWP A;  1HNW L;  2AWO A;  3RN2 A;  4JCV E;  4GNX B;  2R7Z H;  1YHQ A;  4JI7 Q;  4A3L G;  1MKH A;  3PUZ A;  2VUM H;  2LXJ A;  1K8G A;  5ELO A;  4QL5 A;  4HIO A;  1V43 A;  1IBM L;  4LF9 Q;  5JJL A;  1N32 L;  5JEA J;  5LMU L;  3KF6 B;  4IJL A;  3G48 A;  1U5K A;  3FKI G;  5JEA G;  3GTK H;  3KDF A;  5IYB H;  1PH2 A;  1VQJ A;  1IZ6 A;  3E9I A;  2L15 A;  1L2F A;  5JJK A;  1IBL L;  1WFQ A;  3PUX A;  4DV1 L;  3CPW A;  1JJG A;  4C3H H;  1K0R A;  4JI5 Q;  5GQO A;  1Q8K A;  2E5L L;  2F4V L;  1EQR A;  1TWH H;  4UP8 A;  4GN4 B;  1FL0 A;  3CPF A;  2UU9 L;  4JBK A;  2B63 H;  5FJ8 G;  5FLM H;  3PO3 H;  3PV0 A;  3S1R H;  3KLW A;  2GN5 A;  2Y0S E;  5BR8 L;  1C7Y A;  2JA6 G;  4YWM A;  1XNR L;  1JE5 A;  2R92 G;  4LFB Q;  1SRO A;  3TS0 A;  1QUQ B;  1E1T A;  4DK6 C;  4L5S A;  1VQ4 A;  1Q1B A;  3I4N H;  4NXN L;  4JI4 Q;  1SLJ A;  2YTY A;  1HZA A;  1MIU A;  4DV0 Q;  4IO9 A;  3PO2 G;  1C9O A;  3RLN A;  4YHH Q;  2UXC L;  2B29 A;  1I6H H;  4A3D H;  3L7Z C;  2OWO A;  1E24 A;  4LF4 L;  2EXD A;  3JC6 6;  3A74 A;  5M5W H;  2D0O A;  4DV6 L;  3GTQ H;  2UXD Q;  3F1Z A;  2QGQ A;  4B3S Q;  4A3M H;  1P16 A;  3KFU A;  3PIP A;  4UP7 A;  1BBU A;  1UE1 A;  4LW1 A;  2CWA A;  3HOX G;  3CCQ A;  4JI0 Q;  3AEV A;  1GD7 A;  1EIY B;  4DR5 Q;  4DR2 Q;  3K7A H;  4LF8 Q;  4LUO A;  5IYD H;  1QZG A;  1FGU A;  3J80 i;  3S15 H;  2V1C C;  3T1H L;  3H3V H;  4HJ5 A;  1B7Y B;  1GVP A;  3ULJ A;  1Z9F A;  1VCI A;  3CC7 A;  3T1Y L;  3K81 C;  1YBY A;  2D0P A;  1VQK A;  1VQD A;  3EN2 A;  1X3E A;  3J80 c;  1NBW A;  1YIT A;  1VQN A;  4IPC A;  2I0Q A;  3EIV A;  3HOV H;  1GO3 E;  2D62 A;  4BY7 H;  1VQ6 A;  3M85 A;  3PF5 A;  2B63 G;  2MQH A;  1XTD A;  1DGS A;  3MEF A;  4MZ9 A;  3PO3 G;  4K0K Q;  3MXN B;  3J81 c;  1XMQ L;  1JJC B;  2ZTD A;  4LFA Q;  3AQQ A;  1VQL A;  1HNZ L;  1W2B A;  3PCO B;  4A93 G;  3W5O A;  3GTP H;  2RCN A;  4DR7 L;  3S1Q H;  4X62 Q;  4JI2 L;  3AFQ A;  1N33 L;  4JYA Q;  4C2M H;  1XNQ Q;  3G71 A;  1QVG A;  1SN8 A;  2UXB Q;  1KAW A;  4HJ7 A;  1MJE A;  1PYS B;  3F2D A;  2HHH L;  4DAM A;  4YY3 L;  3LGJ A;  1XPR A;  1PHJ A;  2K52 A;  4QIW E;  4DR1 L;  4X65 Q;  1X3F A;  5M3M H;  2CFM A;  4A3D G;  1S3O A;  2UUB L;  1QZH A;  1X56 A;  2ES2 A;  2I5H A;  1I50 H;  2R7D A;  4C3I H;  4HIM A;  3GTJ H;  5AJ3 Q;  4GN5 A;  4IPD A;  1NJI C;  3UE1 A;  1B8A A;  2BH8 A;  4JBW A;  3G4S A;  4DV3 Q;  4YCW A;  1YVC A;  4IJH A;  4X66 L;  4A3M G;  1R9T H;  1KHI A;  2VQF L;  3CCE A;  1VQ8 A;  2K5H A;  4LF9 L;  5C0X J;  4HJ8 A;  2YTV A;  3J81 j;  1VQO A;  2BH2 A;  5LMN Q;  3M4P A;  5C0X G;  3KJP A;  1YIJ A;  5IY0 A;  4WJ3 M;  2NN6 I;  1HZ9 A;  2KEN A;  3JAM i;  4A3C G;  1TWC H;  3F8T A;  4IOC A;  5FJ8 H;  4AYB G;  2ZJQ A;  3IRB A;  4R4I A;  3K0X A;  4YCU A;  3CCS A;  1M90 C;  4B3T Q;  2ZTC A;  5IP9 H;  3TS2 A;  1CKN B;  2OQK A;  3ER0 A;  4P74 A;  4JI3 L;  3OW2 A;  1HZB A;  1VQ9 A;  3KF8 B;  1AE2 A;  2UUC Q;  2EQS A;  4BBR H;  4DV2 L;  1K8A C;  3ICE A;  3PUY A;  4Y52 H;  4XIG S;  5M5X H;  3FP9 A;  4DR4 L;  3CC2 A;  2ID0 A;  2N3S A;  3A5Z B;  4JI8 Q;  2F52 A;  5IE8 A;  2ZJP A;  4LF6 L;  3STB D;  3HOV G;  3I4M H;  3PO2 H;  4BY7 G;  3UE0 A;  5C0X I;  2ZTE A;  1JMC A;  4LFB L;  1JT8 A;  4JV5 Q;  4GKJ Q;  4LUV A;  3S14 H;  3AYH B;  1NTG A;  2E8G A;  4J15 A;  2JA8 G;  3H3V I;  4QQB X;  2AKW B;  5GAE C;  3RNU A;  4OX9 L;  3NEM A;  5IP7 G;  3HOW H;  1L0W A;  1SMX A;  4LF5 L;  4QGU A;  1TWA H;  2NZH A;  2DGY A;  3W1B A;  2QA4 A;  1I5F A;  2MFI A;  3HOX H;  4A3I H;  1N36 L;  5M3M G;  4B3M L;  2JA7 G;  3S1M H;  4IPH A;  1KRT A;  1HR0 Q;  3RN5 A;  1SE8 A;  1UWV A;  2K4K A;  5C44 G;  1L1O A;  1EYG A;  1S72 A;  3CCV A;  3S1N H;  1K73 C;  2UUA Q;  4JI0 L;  1VQF A;  2K5N A;  2WB1 G;  4DR2 L;  4POG A;  3SGI A;  1YZ6 A;  4Y7N H;  1ASZ A;  4DNI A;  3UDX A;  2KHJ A;  5IWA Q;  1FJG L;  4GOP C;  5M3F G;  1YNX A;  1WJJ A;  5GAH C;  3M4Q A;  2QEX A;  4DV4 Q;  5DLQ E;  3I55 A;  5IP9 G;  1V1Q A;  4JI6 Q;  2Z6K C;  4LNQ A;  4A93 H;  2A1A A;  4PMW A;  3Q8D A;  2A8V A;  1VQG A;  5GAG C;  4BBR G;  1N34 Q;  4BXX H;  4DR6 Q;  1OXS C;  3F2B A;  3HKZ G;  3K80 C;  1TWG H;  2VQE Q;  5HY6 A;  4DUY Q;  1PH9 A;  1N8R C;  4K0K L;  3I4M G;  1J5E Q;  1IBK L;  4LFA L;  2MO0 A;  2WAQ G;  2H5X A;  1A62 A;  4A3K H;  4GKK Q;  3ERS X;  3BJU A;  3S2D H;  1SFO H;  4X64 Q;  2PQA A;  1MJC A;  4BY1 G;  1CUK A;  1XPO A;  1XNQ L;  4LWC A;  4H02 A;  2NVT H;  4TVA B;  2WFW A;  1O7I A;  1UEB A;  1W3S A;  4POF A;  4JOI A;  1NMG A;  1PH1 A;  4X65 L;  3HOW G;  4JI1 Q;  1LM0 A;  4DKA C;  1J6Q A;  5C3E H;  4A3I G;  1X3G A;  3A0J A;  5AJ3 L;  4R4Q A;  1PYB A;  5GRO A;  1I94 L;  4PZ7 A;  2CQO A;  1BVS A;  4PZ6 A;  4DV3 L;  1YJN A;  4A3C H;  4AYB E;  4EQ5 A;  1HNW Q;  1AE3 A;  4LFC L;  3D31 A;  4GS3 A;  3CCR A;  2MO1 A;  2IT1 A;  4GNX A;  2XGT A;  1P8L A;  4P72 A;  3OTO Q;  1PH4 A;  1LUZ A;  1UE6 A;  3GTM H;  1Y1V H;  1N32 Q;  4GKJ L;  1OXV A;  3J81 i;  4B3T L;  2IY5 B;  1Y14 B;  3PSI A;  2AWN A;  3KF6 A;  1E7Z A;  4IPG A;  4KLK A;  3RZD H;  3CMA A;  2NVX H;  5LMN W;  2IHE A;  4NXM L;  3BZC A; 
#chains in the Genus database with same CATH topology
 1IBL Q;  4R4O A;  3MAQ A;  4DV7 L;  2HQL A;  4BXX G;  3QJY A;  1JB7 A;  4JV5 L;  3U4Z A;  1CKM A;  1HFN A;  4DUZ Q;  1O78 A;  2X6L A;  4NP5 A;  4RMF A;  3WDN A;  2ZT9 C;  5C4X G;  1KD1 C;  3WOE A;  1FD7 D;  2K1B A;  4YWK A;  1I3Q B;  1VQC A;  3PIO A;  1BCP B;  5C44 H;  3LX0 A;  4RCN A;  4KKT A;  2WB1 E;  2E2I B;  3FKI B;  1PH8 A;  4ALP A;  1TS5 A;  1GUO A;  4G7H C;  5M3F H;  3CCJ A;  2BE5 D;  2J4X A;  4IFD H;  1DXM A;  2NTS A;  3M4O H;  3I4L A;  1N9W A;  1Q90 A;  4N9P A;  5CV9 A;  3UI2 A;  2JA6 B;  1OXU A;  4RHS A;  1TS4 A;  5A2Q L;  4RAU C;  3NBI A;  1CSQ A;  3PF4 A;  1WOC A;  2WIN B;  4BY1 H;  4A4I A;  2A6H D;  1JE4 A;  1B2T A;  1VQI A;  4CKC A;  5EAY A;  5M5Y H;  1QB5 D;  2VW9 A;  1E1O A;  2TSS A;  2YTX A;  4DV0 L;  4JBM A;  2A6E D;  1KLG D;  1CKO A;  4A3E G;  1PFS A;  2IJ0 A;  1X55 A;  3TN2 A;  2E2J B;  2KCC A;  4DK0 A;  3SHL A;  5M9O A;  3QO2 A;  3BDL A;  2IW3 A;  5GAD C;  3MXN A;  3R2T A;  1VQP A;  1TXY A;  2ZXR A;  3T56 B;  2RQX A;  2R6G A;  3E5S A;  2L0C A;  2RF4 A;  1XMO Q;  1TWF H;  1U4M A;  2VS1 A;  1L0X B;  2PI2 A;  3GV3 A;  3K0Y A;  3F2C A;  1GOZ A;  4KN4 C;  5EPK A;  2HIX A;  4Y7N B;  3CW2 C;  1FNU A;  3I4O A;  2RDF A;  1EQV A;  4L5T A;  4DXF A;  5ELE A;  3D0F A;  3S1R B;  2EIF A;  5J3B A;  4H13 C;  1R4Q B;  5A2Q E;  2IHF A;  1Y1W G;  3C46 A;  1EY5 A;  5T1I A;  2KBN A;  1HFG A;  1JC7 A;  2OCE A;  4JYA L;  1ILP A;  3B6Y A;  3CHB D;  3KF8 A;  2I5L X;  3NQT A;  4IFD I;  2C35 B;  1H95 A;  3J7A 5;  3CU7 A;  3S2D B;  5G3L D;  1CQV A;  2K03 A;  2KCN A;  3U9S A;  2DJF C;  2NB0 A;  2EJG C;  4DV5 L;  4OO1 H;  4A3G H;  2NVT B;  2EE1 A;  2EY1 A;  2MP1 A;  1PV4 A;  2LXK A;  3CQZ H;  1B70 B;  2F3I A;  3HOY H;  3K5N A;  2FXQ A;  1SYD A;  2JA5 G;  4AYB B;  2F0E A;  1UAP A;  1KL9 A;  4AH6 A;  2R7Z G;  4KHP L;  5HGT A;  1IW7 D;  4U67 3;  2BA0 A;  5F2D A;  2BA1 A;  1YNN C;  4EX5 A;  1CA5 A;  4U68 A;  1VS0 A;  4K8J A;  3HOU G;  1IXR A;  2TMP A;  1YNJ C;  2AQ3 B;  1ET6 A;  3H15 A;  2JA8 B;  3S16 B;  2UU9 Q;  3PGZ A;  3M9B A;  3Q23 A;  4UY8 C;  4BS9 A;  2YU9 B;  4K5W A;  1PH3 A;  2D5D A;  3GTG H;  3U50 C;  1K3R A;  1GUT A;  3HFZ B;  2Y0S G;  1YJW A;  3GTJ B;  1HR0 L;  3H94 A;  5IOC A;  2PI2 E;  4XQQ A;  3A56 A;  2NN6 G;  1S4Z A;  1AP0 A;  2FMM A;  3HP3 A;  5CV5 A;  3UDG A;  2CH4 A;  1F9S A;  1DOL A;  5H1S E;  1A2T A;  1HH2 P;  2B3G A;  4DR3 L;  1KDA A;  4LFC Q;  3ULP A;  3T1H Q;  1SNM A;  3VR5 A;  4OO1 I;  4JI6 L;  1H9R A;  3T1Y Q;  4O0A A;  3T16 A;  1RCV D;  2JN4 A;  2JSO A;  4X3T A;  4P71 A;  4E6I A;  3BDC A;  1BBW A;  3HKS A;  2VQE L;  1XJV A;  1A8V A;  1PH7 A;  5IGF A;  1EY9 A;  1SRU A;  4ME5 A;  2KHI A;  4FVM A;  4JG2 A;  3V05 A;  1XWE A;  4LK1 C;  5C4H A;  3BVM A;  1HNZ Q;  4O2D A;  5JJI A;  4YCV A;  2Q2I A;  2O4X A;  1RDP D;  2NZO A;  1ML0 D;  2NTT A;  1PFM A;  4JI1 L;  4A3I B;  3FMC A;  3W2D A;  3S1M B;  4LF7 L;  2K6A A;  2Z6K A;  2JA9 A;  1RD9 D;  2O5I C;  4YIJ A;  1K83 B;  1HNW L;  2VXW A;  3RN2 A;  3R2I A;  5JPM C;  3AU7 A;  1K8G A;  2XVS A;  4QL5 A;  5ELO A;  2HCI A;  5D3D A;  1IBM L;  1D1K A;  2QIL A;  3SK5 A;  4LF9 Q;  3GTK H;  2K32 A;  5IYB H;  1PTO F;  1IZ6 A;  3E9I A;  2L15 A;  1A3T A;  1L2F A;  3NBH A;  1E0B A;  2WII B;  1IBL L;  3PUX A;  1X32 A;  5DM6 3;  4OHJ A;  3CPW A;  2Q8I B;  3ITP A;  3Q22 A;  1VMC A;  4RGO S;  2G9D A;  1AZP A;  2B63 H;  5FLM H;  4ULL A;  5C4X B;  3VA5 A;  3KLW A;  2HDL A;  5BR8 L;  2R92 G;  5C4J B;  1XNR L;  1JE5 A;  3N52 A;  2WV6 D;  4L5S A;  2RKS A;  1Q1B A;  1B53 A;  1T5X D;  4JI4 Q;  3QWN A;  4RGT A;  3MA2 B;  2F03 A;  2NVY B;  3OMC A;  3SVM A;  5D3I B;  3U9O A;  1STA A;  2EXD A;  3BDO A;  3GTQ H;  1XYI A;  2SDF A;  4XQJ A;  2K28 A;  3IFD A;  2NBF A;  3KLR A;  3FDT A;  4B3S Q;  4A3M H;  1EL0 A;  1KNE A;  4IUP A;  4UP7 A;  4LW1 A;  1ROD A;  2CWA A;  1V8Q A;  3DXJ C;  4DR5 Q;  3M3Y B;  2QDL A;  3RZD B;  4NW2 A;  1QZG A;  3S15 H;  1UEA B;  2V1C C;  5AFW A;  1Z9F A;  4FXD A;  4I7A A;  1SAP A;  1GUW A;  5T1G A;  1VQD A;  1NCV A;  1NBW A;  3J80 c;  1VQN A;  2ICI A;  4C3H G;  1SJE D;  4A3E B;  2RA4 A;  4OEM B;  1HA5 A;  4N8F A;  1CM9 A;  1UNS A;  3C2P A;  2MQH A;  4MZ9 A;  3MEF A;  2DY8 A;  4XT1 B;  5KNB A;  1CHQ D;  1DZ1 A;  3S1Q H;  4X62 Q;  4JI2 L;  4C2M H;  1SN8 A;  1F9R A;  1QCB D;  1KAW A;  2UXB Q;  4N8X 1;  1XPR A;  2K52 A;  1IL8 A;  3ONA B;  1B3Q A;  3HS0 C;  4A3D G;  1F2L A;  2HQE A;  5J1Z A;  4J6H A;  2ES2 A;  2Z8L A;  1PRT F;  2R7D A;  1C48 A;  4IPD A;  2F0W A;  1B8A A;  3HZX A;  4DV3 Q;  1R9T H;  3KK7 A;  1JB3 A;  1Q3L A;  2BH2 A;  2BCO A;  2Z4H A;  1MBY A;  5BN3 A;  3OMG A;  3KJP A;  2WKC A;  1JWU D;  2EY5 A;  2HD3 A;  3KLS X;  3ZYY X;  1Y1W B;  1M8A A;  3NQI A;  3K0X A;  4R4I A;  3H91 A;  2ZJQ A;  3TS2 A;  3ER0 A;  4P74 A;  4V19 0;  3OW2 A;  2EYL A;  1KLU D;  4BBR H;  4DA2 A;  4Y52 H;  4H7B A;  1TR5 A;  1RHP A;  4HMI A;  4XIG S;  1NAP A;  5M5X H;  3FP9 A;  2ID0 A;  3HOV G;  3STB D;  4BY7 G;  3UE0 A;  2ZTE A;  4JV5 Q;  2NVQ B;  2NUC A;  2F0G A;  4LUV A;  3MVV A;  3EFX D;  1NTG A;  3KBX A;  4FYD A;  3SK8 A;  1B9M A;  1JIC A;  4O1N A;  1U4R A;  3G6J B;  5L37 A;  2P5Z X;  1L0W A;  2JA5 B;  2DGY A;  2DNC A;  1II3 A;  3HOX H;  1XXG A;  4RH6 A;  2R7Z B;  5M3M G;  1WTO A;  3OWF A;  4G7Z C;  2EXZ A;  5IIF A;  1UWV A;  4C3I G;  5C44 G;  5CBE E;  3J80 E;  1SMY C;  1RTN A;  3CCV A;  4JI0 L;  2WB1 G;  3HOU B;  3NWS A;  4DR2 L;  4CJ1 B;  4POG A;  1ASZ A;  2CH4 W;  3UDX A;  1DCZ A;  5M3F G;  3M4Q A;  3I55 A;  2O2L D;  5IP9 G;  2NWG A;  3T4A C;  4A93 H;  2A1A A;  1DJR D;  4DAY A;  2A8V A;  3QR8 A;  1PFB A;  5EPL A;  3MXP A;  5C5L A;  1I4G A;  3F2B A;  2Y0S B;  1TWG H;  5HY6 A;  4MTK A;  4DUY Q;  3I4M G;  1TT2 A;  4LFA L;  3SK4 A;  1JWM D;  2PQA A;  1K8O A;  4BY1 G;  1XPO A;  1CK1 A;  4C1N I;  5COY A;  2WFW A;  4POF A;  1SYC A;  4JOI A;  4X65 L;  4ZUJ A;  4DKA C;  3P20 A;  3NTI A;  5C3E H;  1X3G A;  1PYB A;  5GRO A;  4A3C H;  4PZ6 A;  4MIU A;  4LFC L;  3GTO B;  1LUZ A;  1Y1V H;  1OXV A;  4B3T L;  2IY5 B;  1HRJ A;  1SNP A;  4KLK A;  2NVX H;  5LMN W;  2IHE A;  1EY8 A;  4YWL A;  1PYW D;  4KY5 A;  4JI8 L;  1UE7 A;  2IX0 A;  5K5P A;  2Z1C A;  1HQR D;  3A7A B;  1FVI A;  3BZK A;  1W6K A;  3P1H A;  2JA7 H;  4OXP A;  3MFY A;  4DV5 Q;  4OIK A;  2H1E A;  1QUQ A;  5FO8 B;  1YJ9 A;  1QG7 A;  4NXN Q;  3CME A;  2D2C C;  1QE6 A;  2Q2H A;  1KNA A;  4K2K A;  2HIV A;  1KDC A;  4CKE A;  4OO1 G;  2HT1 A;  4DV6 Q;  4A3G G;  3A5U A;  1AEX A;  1M1K C;  1AZQ A;  4R4T A;  2MNA A;  3GV6 A;  4QCL A;  4KHP Q;  1RL2 A;  4ID6 A;  3HOY G;  1OXX K;  5KYI A;  3GTL H;  1J8I A;  2CW0 D;  2OXP A;  3HKZ E;  2R92 B;  2K05 A;  2F0M A;  2N88 A;  2JYO A;  1WCM H;  1K28 A;  1T9H A;  2OEO A;  2E2H B;  4XTC S;  4JI4 L;  4HR7 B;  3G6E A;  1MGS A;  4JBJ A;  1U4L A;  4ZLT F;  1PLF A;  4GKK L;  1CHP D;  1C8C A;  2Q2T A;  2F0T A;  2JXM B;  3GO5 A;  3RLO A;  4B3S L;  2IX1 A;  4MN3 A;  1N33 Q;  4QMG A;  1KAB A;  4APV A;  3R3O A;  1Q1E A;  4DFA A;  3GP7 A;  2EYO A;  4YY3 Q;  4P73 A;  4DR5 L;  4A3F H;  4C3J H;  2UUB Q;  5ELD A;  2LSS A;  5IGE A;  3FPP A;  4DR3 Q;  4C3H B;  3TP7 A;  2VQF Q;  1BXT A;  2F0J A;  1Y8P B;  3OTO L;  1LT6 D;  2PPB C;  1I6V C;  2K04 A;  4KI0 A;  2ALY B;  3LWE A;  2DJG C;  4L6T B;  4OGQ C;  1EFW A;  4A3B G;  2R93 H;  2DY7 A;  1BCP D;  1Q12 A;  1K3B C;  2LKV A;  2GVA A;  5IYC H;  3H0G H;  1CKN A;  4X62 L;  4DV2 Q;  3V96 A;  1B44 D;  2UXB L;  1YI2 A;  4H0L C;  3QOJ A;  1I6H B;  3S24 A;  4MTN A;  4A3D B;  5EGT A;  1X9N A;  3Q24 A;  4RGM A;  2B2T C;  4LF7 Q;  3BZD B;  4QY7 A;  1HJP A;  4ZKC B;  4FF3 A;  2F3W A;  2GA4 B;  5BN4 A;  1AN8 A;  4A76 A;  1IBM Q;  1N36 Q;  2XWJ B;  1LYL A;  1TS2 A;  4R1J A;  2PW5 A;  4CDD C;  1EYC A;  1KC8 C;  1SR3 A;  3HOZ H;  2X69 A;  3I2Z A;  2AQ2 B;  1NE3 A;  3F2U A;  2Q8T A;  5EPJ A;  1X6O A;  3HOV B;  2DN8 A;  4BY7 B;  1UUP A;  5K36 H;  1A0I A;  3D4D A;  4BBS G;  4M8A A;  5I4D A;  4QB4 A;  5DEH A;  5IYB G;  1K9M C;  1E2W A;  3OOC A;  1NSN S;  2L5T A;  2QW7 A;  3GTP B;  3A54 A;  5BR8 Q;  1XNR Q;  2OTL A;  2VY3 A;  2SNS A;  4ME3 A;  4KHV A;  1HUM A;  2YV5 A;  4A75 A;  3CCL A;  2DUD A;  3MTS A;  5FLM G;  5M3M B;  4GNX C;  4KD4 A;  5EBC A;  4CJ0 B;  1IL2 A;  5I2X A;  1V9P A;  1IKL A;  4OL7 A;  4C3I B;  2OF1 A;  5C44 B;  1BF4 A;  2ZM6 L;  2WB1 B;  4A3L H;  5EJW A;  1I3Q H;  4ZRZ A;  4L5Q A;  3MFG A;  1B3A A;  4PG3 A;  4WJ4 A;  2QEJ C;  5KGU A;  4A3J H;  1JR0 D;  1KQS A;  4QF4 A;  5M3F B;  3J7A F;  1JWS D;  1QOH A;  2F0O A;  2E2I H;  3FKI H;  2K5V A;  2SOB A;  3O13 A;  4JVZ A;  1VQM A;  2SEB D;  2O5J C;  5COR A;  2BDO A;  3UDF A;  1LTL A;  2A68 C;  3I4M B;  1BO0 A;  1NR4 A;  1EWH A;  4DUY L;  1Y8N B;  1LAC A;  3TZD A;  2JA6 H;  3S14 B;  4BY1 B;  2HDM A;  3BU2 A;  3FVQ A;  2EOT A;  5HGQ A;  2JEB I;  5FK9 C;  4B3R L;  5M5Y B;  2F1M A;  2KVM A;  4NB3 A;  3W1G A;  4GOP A;  3DLL A;  4JI2 Q;  3DM3 A;  4K6L A;  4KTA A;  1A63 A;  1D7Q A;  2FIN B;  4FO2 A;  5EBD A;  4C56 C;  1VQH A;  5KNC A;  5EKK A;  2E2J H;  4Z9C B;  2XRS D;  4L8J A;  3R93 A;  3ND8 A;  4JCV E;  4GNX B;  5EKI A;  1PFN A;  1V43 A;  4ZAI A;  5JEA J;  4S3S A;  5LMU L;  1CQF A;  3KF6 B;  2F0D A;  4WFN 3;  1LT3 D;  1U5K A;  5JEA G;  1ICF B;  3KDF A;  4X3U A;  1VQJ A;  5FKA C;  5C3X A;  5JJK A;  3HG9 A;  1GHK A;  1TWH H;  4UP8 A;  4GN4 B;  4JBK A;  1A15 A;  1HQM C;  3PV0 A;  3S1R H;  1DON A;  2QF7 A;  4YWM A;  3TS0 A;  1EIH A;  1E1T A;  4RHR A;  4DU9 A;  4G4K A;  5CGK A;  3I4N H;  4NXN L;  5G3L F;  1O7L A;  4IO9 A;  3T13 A;  1CTM A;  2RSO A;  1NNX A;  4YHH Q;  2CQA A;  1MHW C;  4A3G B;  1EYD A;  2WAC A;  3L7Z C;  1E24 A;  2K5W A;  4LF4 L;  1CA6 A;  3A74 A;  5M5W H;  4KY7 A;  4DV6 L;  3F1Z A;  4IZ8 A;  3MXG A;  3HOY B;  3PIP A;  1J9O A;  5E4X A;  1BBU A;  2A69 C;  2LMC B;  3HOX G;  4IUQ A;  2C9O A;  4JI0 Q;  1GD7 A;  1YNN D;  1H9J A;  2PYK A;  4DR2 Q;  3K7A H;  1D1I A;  3H3V H;  4HJ5 A;  1YNJ D;  2F0V A;  3BVG A;  3PMF A;  1VQK A;  3EN2 A;  4HSV A;  1ZXT A;  3TDQ A;  2I0Q A;  3EIV A;  4K2L A;  1Y69 U;  2AUK A;  2G5D A;  3M85 A;  1B4O A;  2A73 B;  3A8K E;  3TSS A;  1DGS A;  1WTR A;  3PO3 G;  3I73 A;  3MXN B;  3GTG B;  1CFM A;  3J81 c;  1VQL A;  2ZTD A;  1LTR D;  4LFA Q;  1IYU A;  3BVZ A;  3PCO B;  3RZO B;  1PZJ D;  4A93 G;  5ISR A;  3CKI B;  4DR7 L;  1N33 L;  1QVG A;  4LMQ D;  3F2D A;  4YY3 L;  3LGJ A;  1PHJ A;  4V0B A;  4QIW E;  4X65 Q;  1KTK A;  1LV9 A;  2CFM A;  2B2W A;  1I4R A;  1CT1 D;  1QZH A;  2UUB L;  2B2Y A;  1I50 H;  2F0L A;  4HIM A;  3GTJ H;  1NJI C;  3UE1 A;  3G4S A;  3A55 A;  4IJH A;  2Z9H A;  2XN9 C;  2VQF L;  3TP8 A;  1VQ8 A;  2K5H A;  3K5L A;  5C0X J;  4LAA A;  1V1P A;  2YTV A;  3J81 j;  4A3B B;  3J81 L;  3M4P A;  2VB2 X;  5C0X G;  1GHJ A;  1SNO A;  4A3C G;  1TWC H;  4IOC A;  4KKS A;  5FJ8 H;  4B3T Q;  3IRB A;  1M90 C;  4PMC A;  4BWG B;  1F9Q A;  4G57 A;  1VQ9 A;  3KF8 B;  1AE2 A;  4DV2 L;  2J0T D;  4JI8 Q;  3A5Z B;  3QIA A;  5LL6 X;  1KAA A;  2RVL A;  3K5O A;  3PO2 H;  1JMC A;  1RJT A;  4XYQ A;  1ET9 A;  3H3V I;  1LTB D;  3RNU A;  3NUC A;  1STY A;  1AW7 A;  3ND9 A;  3W1B A;  4RFB A;  1CZW A;  2EYH A;  4A3I H;  1N36 L;  2XWB B;  4EGV A;  2RCF A;  2JA7 G;  1JOK A;  1NUC A;  3S1M H;  4IPH A;  1LO5 D;  4EQO A;  1SE8 A;  1EU3 A;  1BBX C;  4HN7 A;  3S17 B;  1L1O A;  1EYG A;  1K0S A;  3V2T A;  1LT4 D;  1K73 C;  4K6D A;  4BBS B;  2SNM A;  4DNI A;  1HCZ A;  2M00 A;  3J81 E;  1G6Z A;  1I4H A;  5GAH C;  2QEX A;  1PTO D;  1PTO C;  2Z6K C;  3DM1 A;  3ERQ A;  4PMW A;  3Q8D A;  4DXG A;  5GAG C;  3D3R A;  1N34 Q;  4BXX H;  5CR3 A;  3HKZ G;  5FO7 B;  1PH9 A;  1D5X C;  1N8R C;  4K0K L;  2E2D C;  1A62 A;  4GKK Q;  1SFO H;  1STH A;  2A74 C;  2KEE A;  1O80 A;  2EZV A;  1XNQ L;  2AQ1 B;  4H02 A;  1O7I A;  1W3S A;  2HUG A;  3HOW G;  3FEW X;  4P2C B;  3GTQ B;  1ZKO A;  5AJ3 L;  4PZ7 A;  2CQO A;  1YJN A;  5CC4 A;  3TP6 A;  1AE3 A;  3I8Z A;  1MSG A;  1SE2 A;  1P8L A;  2EJM A;  3MWY W;  3OTO Q;  1PH4 A;  3GTM H;  3URY A;  2QDB A;  1N32 Q;  4C3J G;  3J81 i;  3I70 A;  3RZD H;  1E7Z A;  3CMA A;  5E4W C;  3BZC A;  1WYD A;  1ENC A;  1EIF A;  3GDE A;  5FLX c;  3S2H H;  4L63 B;  2F4V Q;  4K5V A;  1Q81 C;  1PTO B;  1QWY A;  5IP7 H;  1ENF A;  5NUC A;  4A3E H;  2PMZ E;  2R7F A;  2R3Z A;  3WWV A;  4RCO A;  3S1Q B;  5IYC G;  4A3K G;  4BA1 I;  1HHV A;  2I46 A;  2KJX A;  3H0G G;  3OIP A;  4C2M B;  3U58 A;  3ERO A;  2I5M X;  3CRL C;  4EVO A;  4KKU A;  3RD4 A;  3VR2 A;  1C4Q A;  3CAM A;  1EUJ A;  2JE6 I;  1HTL D;  2LFN A;  1D2B A;  5FLX L;  3CCU A;  3NBH B;  1PRT D;  1E2Z A;  2XRQ D;  1PRT C;  2ZXP A;  3KJO A;  2UUA L;  3AFP A;  2N78 A;  5I9O A;  5JVH 3;  1HR0 W;  2Q8R E;  3OIQ A;  2L4N A;  1HPC A;  4X3K A;  2XTI A;  4HED A;  1TVX A;  1BKB A;  1YHB A;  1BQQ T;  1JQY D;  4UPA A;  5J39 A;  1Z47 A;  3I90 A;  1X54 A;  1E22 A;  2HCC A;  2WAQ E;  3HOZ G;  1NMF A;  1HZC A;  5M5X B;  4DR6 L;  2JQO A;  5LL6 S;  1TS3 A;  4F8M A;  5K36 G;  1VQB A;  1J5E L;  4OIJ A;  1VQA A;  4YHH L;  1Z7T A;  2B2U A;  2KEC A;  3N6R A;  3J7Y W;  3VDY A;  1XMQ Q;  2RDG A;  3A7L A;  2V4D A;  1S5B D;  1PH6 A;  4WRD A;  3HOX B;  2ZM6 Q;  2RBM A;  2E74 C;  3VYR A;  4KY6 A;  1SMY D;  3E3X A;  4PZ8 A;  5D14 A;  1AH9 A;  1A6X A;  4R8N A;  5HUR A;  5KYL A;  2G9H D;  5FLX E;  3DEO A;  1F9P A;  4IFD J;  1ONL A;  4A3J G;  1TQO A;  4IFD G;  1GJX A;  4HAE A;  1PRT B;  3HOU H;  2OQ0 A;  2MGS A;  2RHS B;  3PO3 B;  3NHH A;  1S5E D;  3T51 B;  1H9K A;  2B2U C;  1KDB A;  2N8N A;  4A93 B;  4TRD A;  3GD7 A;  3LWU A;  1PXU A;  1TWG B;  4B3R Q;  4OWX B;  3G7L A;  1SYB A;  3IKJ A;  3NSW A;  3K5M A;  2Q2U A;  1D5Z C;  4M1U B;  5LHY 1;  1GKH A;  3TQY A;  3PIO 3;  1U0L A;  2KCT A;  4BA2 I;  4GLX A;  4J8Q A;  3VA7 A;  3ULL A;  5TSS A;  4OX9 Q;  2VB3 X;  1Z6H A;  3TEH B;  4WOR A;  4AIM A;  1HNX L;  4LF5 Q;  5C3E B;  4X6A H;  1G8Z D;  4ZQ3 A;  5IGG A;  3E0E A;  3PQI A;  4HJ9 A;  5IOD A;  2JK8 A;  5LMU Q;  1WTP A;  2PZW A;  2CKZ B;  1EOT A;  3K7U C;  1Y1V B;  3GTO H;  4O42 A;  4TQU S;  4LUZ A;  1E3P A;  2NVX B;  1X3Q A;  1WVL A;  4JOI C;  2IWH A;  1QJO A;  1D8L A;  1PH5 A;  3PUW A;  2ATW A;  4KJN A;  2VL6 A;  4KJO A;  1EQQ A;  4ZKB B;  1PVO A;  3NE5 B;  4CDC C;  1LTS D;  2R61 A;  1W6J A;  2JA7 B;  4KV6 A;  1IBK Q;  3FHW A;  4QJF A;  4F7X A;  2OTJ A;  1ESF A;  4LF4 Q;  3I4N G;  2F0Q A;  2ZJR A;  1B1Z A;  2Z0S A;  4B9W A;  2AMC B;  1RIP A;  2PQE A;  3H6M A;  1PMR A;  3NWT A;  4I7Z C;  1Q46 A;  3A8I E;  4AQY L;  4RA8 A;  3TZU A;  3I3C A;  4CDF C;  2KCM A;  4DAY B;  2GVB A;  3H09 A;  3HKZ B;  3TRZ A;  1N34 L;  5ELN A;  2ASB A;  1H9S A;  2F0I A;  5I6W A;  4JW0 A;  2R92 H;  3KUP A;  2PQA B;  4ZK9 B;  1DD2 A;  4HTH A;  1KIX A;  3M4Y A;  3K8A A;  1S5D D;  3JAM c;  2VZA A;  3MC0 B;  3CC4 A;  3HOW B;  3E9H A;  4UP9 A;  1SEB D;  1TWA B;  3KOJ A;  4DR7 Q;  2E2H H;  3L0O A;  3MHB A;  1V1O A;  4KK7 A;  4UDU C;  3VYU A;  2AUJ D;  2AWO A;  3MEH A;  3DEP A;  3DWQ A;  4IUR A;  3S1N B;  1SNC A;  3SE0 A;  4JI7 Q;  1Q8I A;  3I91 A;  1MKH A;  2IX3 A;  2VUM H;  2LXJ A;  4XDX A;  4HIO A;  4C3J B;  3L3O C;  1SYE A;  2B8G A;  5JJL A;  1N32 L;  3GQB A;  1ZYR D;  3JAM L;  2KHS A;  1ZYR C;  3G48 A;  4IJL A;  3PIP 3;  3DUZ A;  2F0S A;  3NXW A;  1I4Q A;  1E2V A;  2F0H A;  2EJF C;  2B2V A;  5ELF A;  4N9T A;  1HTP A;  1WFQ A;  4DV1 L;  4C3H H;  1K0R A;  4JK1 C;  5GQO A;  2E5L L;  4JI5 Q;  2F4V L;  1IHZ A;  1EQR A;  3VYS A;  4RWS C;  1RF2 D;  3CPF A;  5DAU A;  1BCP F;  4ILW A;  1EQT A;  4A3K B;  2EYJ A;  5FJ8 G;  3H0G B;  3IFT A;  1LAB A;  2ICE C;  1C7Y A;  2F0F A;  1QUQ B;  4FF1 A;  4DNR B;  1WTV A;  1VDZ A;  1SLJ A;  3W3A A;  2KOL A;  3PO2 G;  3RLN A;  2B29 A;  1I6H H;  4A3D H;  5IGD A;  2D0O A;  2UXD Q;  2QGQ A;  3KFU A;  1UE1 A;  2PZT A;  2RDH A;  3CCQ A;  1EIY B;  4LF8 Q;  4LUO A;  2J7Z A;  3HOZ B;  5IYD H;  2CHB D;  3J7A V;  3JAM E;  3D8G A;  4I65 A;  4XQN A;  1X3E A;  4RKB A;  5CV7 A;  2EY6 A;  4F88 A;  3HOV H;  1GO3 E;  1WTX A;  4BY7 H;  1VQ6 A;  3PF5 A;  2B63 G;  1XTD A;  4K0K Q;  1XMQ L;  3AQQ A;  2I07 B;  3HEJ A;  3OHX C;  3GTP H;  2RCN A;  4IUN A;  1ENA A;  3AFQ A;  1EFI D;  1XNQ Q;  3K59 A;  1MJE A;  5I9P A;  2F0K A;  3E0J A;  3QOL A;  5I2Y A;  1X3F A;  5M3M H;  1MI2 A;  1TY2 A;  5IGC A;  1S3O A;  4XXE A;  1OO9 B;  2I5H A;  4C3I H;  4NDX A;  4GN5 A;  5AJ3 Q;  4JBW A;  4A3J B;  4YCW A;  1ILQ A;  4XYO A;  4A3M G;  3M4O B;  1O7Z A;  4TKO B;  1VQO A;  1CI3 M;  1F2Z A;  5LMN Q;  3CRK C;  1YIJ A;  2A68 D;  1HZ9 A;  3JAM i;  1LT5 D;  3BG3 A;  1JCK B;  2ZTC A;  2BE5 C;  5IP9 H;  4R9W A;  1CKN B;  4ZYS A;  1HZB A;  1LTT D;  2UUC Q;  2EQS A;  3ICE A;  4PV1 C;  5IE8 A;  3I4M H;  4LFB L;  1JT8 A;  3S14 H;  3AYH B;  2A6H C;  4QQB X;  2AKW B;  5GAE C;  4OX9 L;  1EYA A;  1ESR A;  3E6Z X;  5IP7 G;  1SMX A;  2A6E C;  4LF5 L;  3A8J E;  2QA4 A;  1TWF B;  2K5D A;  4DNT B;  2K5Q A;  1FNV A;  2A5H A;  3FRP B;  1KRT A;  2K7V A;  3RN5 A;  2K4K A;  3H3V C;  3IL8 A;  1MD2 D;  2UUA Q;  4B9X A;  1H9M A;  1FYC A;  5JPN C;  1TY0 A;  2E75 C;  3SGI A;  4Y7N H;  2KHJ A;  5IWA Q;  4GOP C;  1IKM A;  1AFP A;  2EPB A;  3BYT B;  1BNZ A;  1STE A;  3P75 A;  1TWH B;  4XT3 B;  4LNQ A;  2FJ2 A;  2L55 A;  4BBR G;  2F0U A;  4DR6 Q;  1X3P A;  1FR3 A;  1OXS C;  2WKD A;  3K80 C;  1G91 A;  1EWC A;  1J5E Q;  1IBK L;  2MO0 A;  2WAQ G;  2K01 A;  3VR6 A;  3I4N B;  3ERS X;  3S2D H;  4X64 Q;  2F3V A;  3CQZ B;  1SYG A;  1EY6 A;  4KN7 C;  1EIG A;  4X3S A;  2NVT H;  4TVA B;  5C3W A;  1NMG A;  2A69 D;  1RTO A;  5M5W B;  1QIL A;  3EQL C;  4R4Q A;  4AYB E;  4HMJ A;  3SEB A;  3CCR A;  2XGT A;  3K7A B;  4DF7 A;  4WJW A;  3X3N A;  5BN5 A;  4IUU A;  4GKJ L;  2FHT A;  1Y14 B;  4DN4 M;  2AWN A;  1SE3 A;  1IW7 C;  4HCE A;  4RGN A;  4Q0F A;  2L11 A;  4NPS A;  3S16 H;  4R4C A;  1QVF A;  2N49 A;  2JA8 H;  2XSC A;  5E1F A;  3NPP A;  4GOP B;  1HA6 A;  1X65 A;  2EVB A;  4ABN A;  5I6Y A;  2YU9 H;  1S40 A;  2RHQ B;  3BS1 A;  4RG1 A;  4CHT B;  1U9R A;  4DGZ A;  1SE4 A;  4JI7 L;  3RZO H;  2PO4 A;  1D5M C;  1JJ2 A;  4QIW B;  5DM7 3;  1DYQ A;  3TBI B;  3Q6S A;  4DK1 A;  1F77 A;  3J7Z C;  1HNX Q;  1I50 B;  3C3L A;  2UXC Q;  3KDF B;  2YYZ A;  3TRE A;  4IQZ A;  5E3F A;  5C3E G;  3UDI A;  1IYV A;  5FOB B;  1STG A;  2C5C A;  3M7N A;  1VMP A;  3DHQ A;  5KND A;  3M7G A;  1F2M A;  4JI5 L;  1T5E A;  3KYH C;  1TWC B;  2QCP X;  4GLA C;  1Y1V G;  4A3B H;  1G6P A;  4DV4 L;  1I4P A;  4ZCK A;  4DAP A;  3VYT A;  1WTH A;  3D4W A;  5IT9 c;  4JC0 A;  5D65 A;  2VNU D;  1YEZ A;  2B2W C;  2B2Y C;  3PO2 B;  4IUT A;  1WD0 A;  1PZI D;  4MHE A;  1G29 1;  1QNU A;  2D9U A;  2E76 C;  3NEN A;  1VQE A;  2UXD L;  4UAI A;  3CCM A;  1WI5 A;  4OON A;  1LTI D;  3TP5 A;  3D4R A;  2JEA I;  1K83 H;  5DNF A;  1Q82 C;  1UE5 A;  5C5M A;  3ZJY C;  3L2P A;  3K57 A;  2HHH Q;  5IT9 L;  4DR1 Q;  4LF8 L;  3GTK B;  1RKN A;  4FNF A;  3KBG A;  1ASY A;  2WP8 J;  1QVC A;  5A35 A;  4AQY Q;  4G7O C;  3I72 A;  3RLF A;  4X66 Q;  3S17 H;  2AHO B;  1A3V A;  2EY2 A;  2IPK D;  1VQ7 A;  1CSP A;  3T53 B;  1R4P B;  1SYF A;  4BBS H;  2B63 B;  1G51 A;  1Q7Y C;  2IL8 A;  4KHZ A;  2EYF A;  4P75 A;  3EJI A;  3NP8 A;  1GM5 A;  5C4X H;  1WCM G;  3CF5 A;  4JI3 Q;  5C4J H;  4R8I A;  1K8M A;  1EZ8 A;  4H44 C;  1DM0 B;  4CGY B;  1L1O C;  4DR4 Q;  3I7F A;  4LF6 Q;  4EQP A;  4DUZ L;  3LNN A;  1SFO B;  4HJA A;  1SNQ A;  1KRS A;  1L0Y B;  1C0A A;  4RKL A;  2NVY H;  4A3M B;  2JJQ A;  4KMU C;  4OEL B;  2JP1 A;  5CBA E;  3CD6 A;  1V1P B;  1O7Y A;  4OWW B;  3AB9 A;  1GXD C;  2FMC A;  1EZ6 A;  4DAV A;  4K5X A;  4NKL A;  3NEL A;  5LMN L;  3S15 B;  2F0N A;  4A3F G;  5IT9 E;  1WD1 A;  4B3M Q;  4FF2 A;  2Z4I A;  4CBV A;  3M3Y H;  1XX8 A;  3EVQ A;  2K75 A;  3GTM B;  5E7N A;  2VUM G;  1MSH A;  2UUC L;  1XTC D;  2X6G A;  3NK9 A;  3DMU A;  4DV1 Q;  3DWP A;  5KEE A;  2KED A;  1TII D;  2CCZ A;  2E5L Q;  1PDQ A;  1XPU A;  1KXL A;  4NMZ A;  1FJG Q;  1SJH D;  1OTC A;  2PZU A;  3S2H B;  3PUV A;  2R93 G;  1G2S A;  4DK3 C;  5CV4 A;  2EYM A;  1VQ5 A;  3EBE A;  2PMZ B;  4UHV A;  3SXH A;  3CXC A;  1I4X A;  1PTO H;  2K50 A;  4FP5 D;  4HID A;  3RR5 A;  1A3U A;  3OPO A;  1SBB B;  1G2T A;  1OXT A;  3SR1 A;  2CVR A;  4FDB A;  1L1O B;  5EKL A;  4DPG A;  3C1F A;  1R9T B;  4OWT B;  1Q86 C;  3NTK A;  3OYY A;  4HIK A;  1SND A;  1XMO L;  2L9H A;  4PQX A;  3SDZ A;  3I56 A;  4QUF A;  1BOS A;  5JEA H;  3J80 L;  1PA6 A;  5IWA L;  2MPM A;  3CP0 A;  1EWI A;  1STB A;  1I94 Q;  3FPU B;  4CJ2 C;  4GN3 B;  5FO9 B;  1B9N A;  2BDN A;  5J22 A;  4BBR B;  1NY4 A;  4QUC A;  1Y1W H;  5CV8 A;  4KD3 A;  1YHA A;  2A19 A;  2PNH A;  2WAQ B;  5IYD G;  1FNW A;  3D6C A;  3L9A X;  1A2U A;  4GLV B;  5KRU A;  3P7J A;  4NXM Q;  4TSS A;  2XIW A;  4X64 L;  2NVQ H;  2K14 A;  3C1E A;  2LY7 A;  4DV7 Q;  3AMU A;  3STB C;  4L5R C;  1F2Y A;  3TME A;  3HGB A;  1IYJ B;  2JA5 H;  2BOS A;  3U4V A;  2EDG A;  1EOV A;  4MNO A;  2CWP A;  2KUM A;  2MHV A;  2R7Z H;  1YHQ A;  1SXT A;  4A3L G;  1JOO A;  3PUZ A;  4IAL A;  2N55 A;  3NTH A;  2NYZ D;  1LLR D;  3FKI G;  2ENB A;  1PH2 A;  3BYY B;  2NZ1 D;  1S5F D;  4PMB A;  1JJG A;  5CYU A;  1GUG A;  1Q8K A;  3DWA A;  1FL0 A;  1LTG D;  2UU9 L;  3PO3 H;  2JA6 G;  2GN5 A;  2Y0S E;  2KQ3 A;  4LFB Q;  5JOB A;  1SRO A;  4DK6 C;  1VQ4 A;  1ICW A;  2YTY A;  3HRZ C;  1HZA A;  1MIU A;  4DV0 Q;  2NN6 H;  1C9O A;  1JOQ A;  2UXC L;  2OWO A;  3JC6 6;  2QKI C;  3VR4 A;  3MZ5 A;  1P16 A;  4J1M A;  1WTW A;  3K6O A;  1DOM A;  3AEV A;  4K14 A;  5C0X H;  1B50 A;  1HUN A;  1FGU A;  3J80 i;  3T1H L;  4CDE C;  1B7Y B;  1GVP A;  3ULJ A;  3VR3 A;  1EY4 A;  1VCI A;  1VF7 A;  3K81 C;  1BR9 A;  3K58 A;  3QB3 A;  3CC7 A;  3T1Y L;  1YBY A;  2D0P A;  4CKB A;  3EA6 A;  2FFK B;  1YIT A;  2K33 A;  4IPC A;  3RUZ A;  2D62 A;  2F0P A;  5JVG 3;  2B8F A;  5JAV A;  1JJC B;  4ODG A;  5ELC A;  1HNZ L;  1W2B A;  2M9V A;  3W5O A;  2EYP A;  4LJZ C;  1SSO A;  4JYA Q;  1DOK A;  2MJ8 A;  3G71 A;  1FGB D;  4Q5V A;  4HJ7 A;  2H4O A;  1PYS B;  2HHH L;  4DAM A;  2OT2 A;  1TU2 B;  2PW7 A;  4DR1 L;  5C6A A;  4JPB W;  1X56 A;  2BH8 A;  1YVC A;  1EEF D;  4X66 L;  1KHI A;  3CCE A;  4F87 A;  1EEI D;  4LF9 L;  3GTL B;  4HJ8 A;  1ZEQ X;  1U4P A;  4WJ3 M;  5IY0 A;  2NN6 I;  3D6W A;  2KEN A;  3OW7 A;  3F8T A;  4IOA A;  4GKJ Q;  4AYB G;  4YCU A;  1WCM B;  3CCS A;  3IAY A;  2OQK A;  2RSN A;  4JI3 L;  5CV6 A;  2DNE A;  5IGB A;  4K8I A;  1K8A C;  1HXY D;  3PUY A;  2CW0 C;  1STN A;  4IUV A;  3Q0A A;  4DR4 L;  3CC2 A;  4PNY A;  4LF6 L;  2N3S A;  2F52 A;  5JJZ A;  2ZJP A;  4FXK C;  5EQ0 A;  5C0X I;  2B39 A;  3KLS A;  2PNR C;  2E8G A;  1VF5 C;  4J15 A;  2JA8 G;  2F4I A;  3NEM A;  2LS0 1;  3HOW H;  4GZY C;  4QGU A;  1TWA H;  2NZH A;  1I5F A;  2MFI A;  4A3F B;  2L12 A;  3R8B A;  2Z6B A;  4B3M L;  1GUS A;  1HR0 Q;  3OSO A;  2VUM B;  2KA7 A;  2M2L A;  4C1N K;  1S72 A;  1M4V A;  3MXU A;  4FF4 A;  3S1N H;  1D6E C;  1VQF A;  2K5N A;  1EY7 A;  2B2T A;  3OWE B;  1TKW B;  1YZ6 A;  1BUV T;  1FJG L;  3X3M A;  2R93 B;  1YNX A;  5CMD A;  1WJJ A;  1S5C D;  4DV4 Q;  5DLQ E;  1QNK A;  1V1Q A;  4JI6 Q;  2MUY A;  1VQG A;  1Y8O B;  1EY0 A;  2VQE Q;  1BDO A;  4EQN A;  1CZG A;  1BCP C;  1SDF A;  4A3K H;  2H5X A;  4HSP A;  2XNA C;  1PZK D;  1EU4 A;  3BJU A;  1MJC A;  1WTQ A;  1JOR A;  1CUK A;  4IN3 A;  4LWC A;  2B2V C;  1UEB A;  1PH1 A;  5ELB A;  4JI1 Q;  1LM0 A;  4HCS A;  3SK6 A;  4B08 A;  1J6Q A;  2ZXO A;  4A3I G;  2L1B A;  3A0J A;  1I94 L;  1HNW Q;  1BVS A;  1GUN A;  4DV3 L;  4EQ5 A;  3S9W A;  3RMH A;  3D31 A;  4GS3 A;  3QG1 A;  5C4Z A;  2MO1 A;  2IT1 A;  4GNX A;  5KIX A;  1H9S B;  4P72 A;  1UE6 A;  4ZUI A;  2PCF B;  1NR2 A;  4FXG C;  3PSI A;  3KF6 A;  3WOF A;  4IPG A;  1LTA D;  4NXM L; 
#chains in the Genus database with same CATH homology
 1WYD A;  1IBL Q;  4NPS A;  4YWL A;  3S16 H;  1EIF A;  3GDE A;  2N49 A;  4R4C A;  4R4O A;  5FLX c;  1QVF A;  2JA8 H;  4GOP B;  3S2H H;  1X65 A;  4JI8 L;  2F4V Q;  1Q81 C;  1UE7 A;  2IX0 A;  4DV7 L;  2HQL A;  2YU9 H;  5IP7 H;  4BXX G;  1S40 A;  2RHQ B;  4A3E H;  1JB7 A;  4JV5 L;  3U4Z A;  1CKM A;  4RG1 A;  2PMZ E;  2R7F A;  1FVI A;  3WWV A;  4DUZ Q;  3BZK A;  5IYC G;  4RMF A;  4BA1 I;  4A3K G;  3H0G G;  2JA7 H;  3U58 A;  4OXP A;  1KD1 C;  5C4X G;  2I5M X;  4DV5 Q;  4YWK A;  1VQC A;  1QUQ A;  3PIO A;  5C44 H;  1YJ9 A;  4JI7 L;  4NXN Q;  3RZO H;  1JJ2 A;  3CME A;  3CAM A;  1EUJ A;  2Q2H A;  2WB1 E;  2JE6 I;  3J7Z C;  1PH8 A;  4ALP A;  1HNX Q;  2UXC Q;  2HIV A;  3KDF B;  2YYZ A;  3TRE A;  4OO1 G;  2HT1 A;  5C3E G;  3CCU A;  3NBH B;  5M3F H;  3CCJ A;  3A5U A;  4DV6 Q;  3UDI A;  4A3G G;  1M1K C;  4R4T A;  3KJO A;  2MNA A;  2UUA L;  3M7N A;  4KHP Q;  3AFP A;  2N78 A;  1HR0 W;  1RL2 A;  4JI5 L;  3HOY G;  3M4O H;  3KYH C;  1N9W A;  1OXX K;  2XTI A;  3GTL H;  4GLA C;  3HKZ E;  1BKB A;  1OXU A;  1Y1V G;  1YHB A;  4A3B H;  4UPA A;  1G6P A;  1Z47 A;  4DV4 L;  1X54 A;  1E22 A;  2WAQ E;  3HOZ G;  5IT9 c;  4JC0 A;  1WCM H;  1CSQ A;  1NMF A;  1HZC A;  1YEZ A;  3PF4 A;  2VNU D;  1WOC A;  1T9H A;  4BY1 H;  4A4I A;  4DR6 L;  2JQO A;  4XTC S;  4JI4 L;  1VQI A;  3G6E A;  5EAY A;  5M5Y H;  5K36 G;  2VW9 A;  1E1O A;  4DV0 L;  1VQB A;  2YTX A;  4JBJ A;  4JBM A;  1J5E L;  1CKO A;  1VQA A;  1PFS A;  4YHH L;  1G29 1;  4A3E G;  4GKK L;  1X55 A;  2Q2T A;  3NEN A;  3VDY A;  1VQE A;  1XMQ Q;  2UXD L;  5GAD C;  3GO5 A;  3CCM A;  1WI5 A;  4OON A;  3RLO A;  4B3S L;  1VQP A;  1PH6 A;  2IX1 A;  1TXY A;  1K83 H;  2ZM6 Q;  1N33 Q;  2JEA I;  4APV A;  4PZ8 A;  1Q82 C;  1Q1E A;  1UE5 A;  3ZJY C;  3L2P A;  2R6G A;  1AH9 A;  2HHH Q;  4YY3 Q;  4P73 A;  4DR5 L;  4DR1 Q;  2RF4 A;  1XMO Q;  4LF8 L;  4A3F H;  1TWF H;  4C3J H;  2UUB Q;  2VS1 A;  1ASY A;  2WP8 J;  1QVC A;  2LSS A;  2PI2 A;  4AQY Q;  3F2C A;  3RLF A;  4IFD J;  4X66 Q;  4DR3 Q;  3S17 H;  2HIX A;  2VQF Q;  2AHO B;  3OTO L;  3CW2 C;  4A3J G;  1VQ7 A;  4IFD G;  1CSP A;  3I4O A;  4KI0 A;  2ALY B;  4L5T A;  3HOU H;  2OQ0 A;  4BBS H;  2RHS B;  1EFW A;  3D0F A;  2EIF A;  1G51 A;  1Q7Y C;  4A3B G;  5J3B A;  4KHZ A;  2R93 H;  1Q12 A;  2N8N A;  4P75 A;  2GVA A;  5IYC H;  2IHF A;  3H0G H;  1Y1W G;  1GM5 A;  3GD7 A;  1WCM G;  5C4X H;  3CF5 A;  4JI3 Q;  1CKN A;  4X62 L;  2KBN A;  4OWX B;  2OCE A;  5C4J H;  4DV2 Q;  4JYA L;  4B3R Q;  3B6Y A;  2I5L X;  4IFD I;  2C35 B;  1L1O C;  3I7F A;  1YI2 A;  4LF6 Q;  3J7A 5;  4DR4 Q;  4DUZ L;  2UXB L;  2Q2U A;  1H95 A;  3S24 A;  4MTN A;  1X9N A;  4HJA A;  1GKH A;  4DV5 L;  3TQY A;  4LF7 Q;  1KRS A;  1C0A A;  1U0L A;  2NVY H;  4QY7 A;  4A3G H;  2JJQ A;  2KCT A;  4BA2 I;  4GLX A;  3ULL A;  4OX9 Q;  1PV4 A;  1HJP A;  2LXK A;  3CQZ H;  1B70 B;  2F3I A;  3CD6 A;  4OWW B;  3TEH B;  4AIM A;  4LF5 Q;  1HNX L;  4X6A H;  3HOY H;  3NEL A;  2FXQ A;  3E0E A;  5LMN L;  4A76 A;  4HJ9 A;  1IBM Q;  1N36 Q;  2JA5 G;  2JK8 A;  1LYL A;  1KL9 A;  4AH6 A;  5LMU Q;  4R1J A;  4A3F G;  4B3M Q;  4IOA A;  3M3Y H;  2R7Z G;  1KC8 C;  4KHP L;  1SR3 A;  3HOZ H;  2K75 A;  2CKZ B;  2BA0 A;  5E7N A;  2VUM G;  3K7U C;  3I2Z A;  3GTO H;  1NE3 A;  2UUC L;  4DV1 Q;  1X6O A;  2BA1 A;  4TQU S;  4EX5 A;  4LUZ A;  1E3P A;  1VS0 A;  2CCZ A;  2E5L Q;  1XPU A;  1A0I A;  3HOU G;  1IXR A;  1KXL A;  4BBS G;  1FJG Q;  5IYB G;  1K9M C;  3H15 A;  1OTC A;  4JOI C;  1D8L A;  2UU9 Q;  3PGZ A;  3PUV A;  3PUW A;  1PH5 A;  3M9B A;  2ATW A;  4DK3 C;  2R93 G;  4UY8 C;  5BR8 Q;  1XNR Q;  2OTL A;  2VL6 A;  2VY3 A;  1PH3 A;  1VQ5 A;  1EQQ A;  3GTG H;  3EBE A;  4ME3 A;  3U50 C;  1PVO A;  2YV5 A;  1K3R A;  4A75 A;  3CXC A;  3CCL A;  2DUD A;  2K50 A;  4HID A;  3HFZ B;  5FLM G;  4GNX C;  3RR5 A;  1IL2 A;  1IBK Q;  2Y0S G;  1V9P A;  1OXT A;  1YJW A;  3FHW A;  4QJF A;  2OTJ A;  4FDB A;  1HR0 L;  1L1O B;  4DPG A;  4LF4 Q;  3I4N G;  2ZM6 L;  2ZJR A;  2PI2 E;  4OWT B;  4A3L H;  1I3Q H;  1Q86 C;  4L5Q A;  2Z0S A;  3OYY A;  4PG3 A;  2AMC B;  4WJ4 A;  2NN6 G;  1RIP A;  4HIK A;  4A3J H;  1XMO L;  1KQS A;  3UDG A;  3I56 A;  2E2I H;  3FKI H;  1PA6 A;  5IWA L;  1Q46 A;  5H1S E;  2K5V A;  3CP0 A;  4AQY L;  1EWI A;  1I94 Q;  1HH2 P;  2B3G A;  4DR3 L;  1VQM A;  4GN3 B;  4LFC Q;  3ULP A;  3T1H Q;  4OO1 I;  2KCM A;  4DAY B;  4JI6 L;  1NY4 A;  1Y1W H;  3T1Y Q;  2GVB A;  4O0A A;  1YHA A;  3TRZ A;  1N34 L;  4P71 A;  3UDF A;  1LTL A;  5ELN A;  2A19 A;  2ASB A;  2PNH A;  3HKS A;  1BBW A;  5IYD G;  2VQE L;  4DUY L;  1XJV A;  1A8V A;  1PH7 A;  4GLV B;  2JA6 H;  2R92 H;  1SRU A;  2PQA B;  4NXM Q;  3BU2 A;  2KHI A;  5HGQ A;  4X64 L;  2JEB I;  3K8A A;  3JAM c;  4JG2 A;  1KIX A;  4B3R L;  2NVQ H;  2VZA A;  3W1G A;  4NB3 A;  1HNZ Q;  2K14 A;  4O2D A;  3E9H A;  3CC4 A;  5JJI A;  4UP9 A;  3KOJ A;  4YCV A;  4DR7 Q;  2Q2I A;  3DLL A;  4DV7 Q;  4JI2 Q;  4GOP A;  2E2H H;  3STB C;  4L5R C;  2NZO A;  3DM3 A;  4JI1 L;  1A63 A;  3L0O A;  1D7Q A;  1IYJ B;  4LF7 L;  1VQH A;  2Z6K A;  2JA5 H;  2JA9 A;  3U4V A;  2E2J H;  1EOV A;  4MNO A;  2CWP A;  1HNW L;  2AWO A;  3RN2 A;  4JCV E;  4GNX B;  2R7Z H;  1YHQ A;  4JI7 Q;  4A3L G;  1MKH A;  3PUZ A;  2VUM H;  2LXJ A;  1K8G A;  5ELO A;  4QL5 A;  4HIO A;  1V43 A;  1IBM L;  4LF9 Q;  5JJL A;  1N32 L;  5JEA J;  5LMU L;  3KF6 B;  4IJL A;  3G48 A;  1U5K A;  3FKI G;  5JEA G;  3GTK H;  3KDF A;  5IYB H;  1PH2 A;  1VQJ A;  1IZ6 A;  3E9I A;  2L15 A;  1L2F A;  5JJK A;  1IBL L;  1WFQ A;  3PUX A;  4DV1 L;  3CPW A;  1JJG A;  4C3H H;  1K0R A;  4JI5 Q;  5GQO A;  1Q8K A;  2E5L L;  2F4V L;  1EQR A;  1TWH H;  4UP8 A;  4GN4 B;  1FL0 A;  3CPF A;  2UU9 L;  4JBK A;  2B63 H;  5FJ8 G;  5FLM H;  3PO3 H;  3PV0 A;  3S1R H;  3KLW A;  2GN5 A;  2Y0S E;  5BR8 L;  1C7Y A;  2JA6 G;  4YWM A;  1XNR L;  1JE5 A;  2R92 G;  4LFB Q;  1SRO A;  3TS0 A;  1QUQ B;  1E1T A;  4DK6 C;  4L5S A;  1VQ4 A;  1Q1B A;  3I4N H;  4NXN L;  4JI4 Q;  1SLJ A;  2YTY A;  1HZA A;  1MIU A;  4DV0 Q;  4IO9 A;  3PO2 G;  1C9O A;  3RLN A;  4YHH Q;  2UXC L;  2B29 A;  1I6H H;  4A3D H;  3L7Z C;  2OWO A;  1E24 A;  4LF4 L;  2EXD A;  3JC6 6;  3A74 A;  5M5W H;  2D0O A;  4DV6 L;  3GTQ H;  2UXD Q;  3F1Z A;  2QGQ A;  4B3S Q;  4A3M H;  1P16 A;  3KFU A;  3PIP A;  4UP7 A;  1BBU A;  1UE1 A;  4LW1 A;  2CWA A;  3HOX G;  3CCQ A;  4JI0 Q;  3AEV A;  1GD7 A;  1EIY B;  4DR5 Q;  4DR2 Q;  3K7A H;  4LF8 Q;  4LUO A;  5IYD H;  1QZG A;  1FGU A;  3J80 i;  3S15 H;  2V1C C;  3T1H L;  3H3V H;  4HJ5 A;  1B7Y B;  1GVP A;  3ULJ A;  1Z9F A;  1VCI A;  3CC7 A;  3T1Y L;  3K81 C;  1YBY A;  2D0P A;  1VQK A;  1VQD A;  3EN2 A;  1X3E A;  3J80 c;  1NBW A;  1YIT A;  1VQN A;  4IPC A;  2I0Q A;  3EIV A;  3HOV H;  1GO3 E;  2D62 A;  4BY7 H;  1VQ6 A;  3M85 A;  3PF5 A;  2B63 G;  2MQH A;  1XTD A;  1DGS A;  3MEF A;  4MZ9 A;  3PO3 G;  4K0K Q;  3MXN B;  3J81 c;  1XMQ L;  1JJC B;  2ZTD A;  4LFA Q;  3AQQ A;  1VQL A;  1HNZ L;  1W2B A;  3PCO B;  4A93 G;  3W5O A;  3GTP H;  2RCN A;  4DR7 L;  3S1Q H;  4X62 Q;  4JI2 L;  3AFQ A;  1N33 L;  4JYA Q;  4C2M H;  1XNQ Q;  3G71 A;  1QVG A;  1SN8 A;  2UXB Q;  1KAW A;  4HJ7 A;  1MJE A;  1PYS B;  3F2D A;  2HHH L;  4DAM A;  4YY3 L;  3LGJ A;  1XPR A;  1PHJ A;  2K52 A;  4QIW E;  4DR1 L;  4X65 Q;  1X3F A;  5M3M H;  2CFM A;  4A3D G;  1S3O A;  2UUB L;  1QZH A;  1X56 A;  2ES2 A;  2I5H A;  1I50 H;  2R7D A;  4C3I H;  4HIM A;  3GTJ H;  5AJ3 Q;  4GN5 A;  4IPD A;  1NJI C;  3UE1 A;  1B8A A;  2BH8 A;  4JBW A;  3G4S A;  4DV3 Q;  4YCW A;  1YVC A;  4IJH A;  4X66 L;  4A3M G;  1R9T H;  1KHI A;  2VQF L;  3CCE A;  1VQ8 A;  2K5H A;  4LF9 L;  5C0X J;  4HJ8 A;  2YTV A;  3J81 j;  1VQO A;  2BH2 A;  5LMN Q;  3M4P A;  5C0X G;  3KJP A;  1YIJ A;  5IY0 A;  4WJ3 M;  2NN6 I;  1HZ9 A;  2KEN A;  3JAM i;  4A3C G;  1TWC H;  3F8T A;  4IOC A;  5FJ8 H;  4AYB G;  2ZJQ A;  3IRB A;  4R4I A;  3K0X A;  4YCU A;  3CCS A;  1M90 C;  4B3T Q;  2ZTC A;  5IP9 H;  3TS2 A;  1CKN B;  2OQK A;  3ER0 A;  4P74 A;  4JI3 L;  3OW2 A;  1HZB A;  1VQ9 A;  3KF8 B;  1AE2 A;  2UUC Q;  2EQS A;  4BBR H;  4DV2 L;  1K8A C;  3ICE A;  3PUY A;  4Y52 H;  4XIG S;  5M5X H;  3FP9 A;  4DR4 L;  3CC2 A;  2ID0 A;  2N3S A;  3A5Z B;  4JI8 Q;  2F52 A;  5IE8 A;  2ZJP A;  4LF6 L;  3STB D;  3HOV G;  3I4M H;  3PO2 H;  4BY7 G;  3UE0 A;  5C0X I;  2ZTE A;  1JMC A;  4LFB L;  1JT8 A;  4JV5 Q;  4GKJ Q;  4LUV A;  3S14 H;  3AYH B;  1NTG A;  2E8G A;  4J15 A;  2JA8 G;  3H3V I;  4QQB X;  2AKW B;  5GAE C;  3RNU A;  4OX9 L;  3NEM A;  5IP7 G;  3HOW H;  1L0W A;  1SMX A;  4LF5 L;  4QGU A;  1TWA H;  2NZH A;  2DGY A;  3W1B A;  2QA4 A;  1I5F A;  2MFI A;  3HOX H;  4A3I H;  1N36 L;  5M3M G;  4B3M L;  2JA7 G;  3S1M H;  4IPH A;  1KRT A;  1HR0 Q;  3RN5 A;  1SE8 A;  1UWV A;  2K4K A;  5C44 G;  1L1O A;  1EYG A;  1S72 A;  3CCV A;  3S1N H;  1K73 C;  2UUA Q;  4JI0 L;  1VQF A;  2K5N A;  2WB1 G;  4DR2 L;  4POG A;  3SGI A;  1YZ6 A;  4Y7N H;  1ASZ A;  4DNI A;  3UDX A;  2KHJ A;  5IWA Q;  1FJG L;  4GOP C;  5M3F G;  1YNX A;  1WJJ A;  5GAH C;  3M4Q A;  2QEX A;  4DV4 Q;  5DLQ E;  3I55 A;  5IP9 G;  1V1Q A;  4JI6 Q;  2Z6K C;  4LNQ A;  4A93 H;  2A1A A;  4PMW A;  3Q8D A;  2A8V A;  1VQG A;  5GAG C;  4BBR G;  1N34 Q;  4BXX H;  4DR6 Q;  1OXS C;  3F2B A;  3HKZ G;  3K80 C;  1TWG H;  2VQE Q;  5HY6 A;  4DUY Q;  1PH9 A;  1N8R C;  4K0K L;  3I4M G;  1J5E Q;  1IBK L;  4LFA L;  2MO0 A;  2WAQ G;  2H5X A;  1A62 A;  4A3K H;  4GKK Q;  3ERS X;  3BJU A;  3S2D H;  1SFO H;  4X64 Q;  2PQA A;  1MJC A;  4BY1 G;  1CUK A;  1XPO A;  1XNQ L;  4LWC A;  4H02 A;  2NVT H;  4TVA B;  2WFW A;  1O7I A;  1UEB A;  1W3S A;  4POF A;  4JOI A;  1NMG A;  1PH1 A;  4X65 L;  3HOW G;  4JI1 Q;  1LM0 A;  4DKA C;  1J6Q A;  5C3E H;  4A3I G;  1X3G A;  3A0J A;  5AJ3 L;  4R4Q A;  1PYB A;  5GRO A;  1I94 L;  4PZ7 A;  2CQO A;  1BVS A;  4PZ6 A;  4DV3 L;  1YJN A;  4A3C H;  4AYB E;  4EQ5 A;  1HNW Q;  1AE3 A;  4LFC L;  3D31 A;  4GS3 A;  3CCR A;  2MO1 A;  2IT1 A;  4GNX A;  2XGT A;  1P8L A;  4P72 A;  3OTO Q;  1PH4 A;  1LUZ A;  1UE6 A;  3GTM H;  1Y1V H;  1N32 Q;  4GKJ L;  1OXV A;  3J81 i;  4B3T L;  2IY5 B;  1Y14 B;  3PSI A;  2AWN A;  3KF6 A;  1E7Z A;  4IPG A;  4KLK A;  3RZD H;  3CMA A;  2NVX H;  5LMN W;  2IHE A;  4NXM L;  3BZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...