1SYCA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sycA00
5IOCA 4B9XA 5DEHA 3OSOA 3D8GA 5K5PA 2F0IA 2SOBA 3PMFA 3EJIA 1SYGA 4KY5A 2EYHA 2F0VA 4OL7A 4H7BA 4EQOA 5IODA 4RKLA 1SNCA 2EY2A 5I6YA 5KYLA 5CV7A 1KDCA 5KGUA 4ZQ3A 2OXPA 1KAAA 2F0EA 4PMBA 3SXHA 2WACA 4K2LA 1EY9A 5IGBA 1RKNA 3P75A 4KJNA 3V2TA 4K5WA 2F0SA 1F2MA 4EQPA 1STAA 3T16A 5C4ZA 3LX0A 3SR1A 3D6CA 4PNYA 1F2YA 4NMZA 3NQTA 5EKLA 5IGDA 2RDFA 4NDXA 2QDBA 5CR3A 5J39A 4TRDA 2EYLA 3MEHA 1A3TA 3C1FA 4QB4A 3MZ5A 4K8IA 3D4WA 5CV8A 2F0HA 1EY5A 5DAUA 2F0QA 2F0DA 4HMIA 3BDCA 3NHHA 4ZUIA 4ZUJA 1EZ8A 5IGCA 5KRUA 2PZTA 3BDLA 3H6MA 4ME5A 1EQVA 2LKVA 5JAVA 4MIUA 1KABA 1NSNS 1JOKA 3P1HA 5I9OA 5IGEA 1KDBA 5EKKA 3R3OA 2EYMA 3NP8A 4K2KA 4QMGA 3OMGA 1SYBA 4DU9A 4E6IA 2PZWA 5I6WA 4J1MA 2RKSA 4I65A 5CC4A 5E3FA 2EYPA 4J6HA 2F0GA 4NP5A 2PZUA 3S9WA 4WRDA 5C5LA 4F7XA 1EYAA 4IALA 1AEXA 1SNMA 4K14A 4DF7A 5C4HA 4HMJA 3EROA 5KIXA 3NXWA 2PYKA 2SNMA 2HQEA 2F0OA 3NUCA 4KY7A 1TR5A 2F0PA 4K8JA 3OWFA 2PW7A 4KD3A 3EVQA 5C5MA 1JOQA 3QOLA 1EY7A 1ENAA 4ID6A 4S3SA 5F2DA 1STHA 4KTAA 4HTHA 1JOOA 4F8MA 1STYA 2EXZA 2EY1A 4K5XA 2F0NA 1SYDA 2O4XA 2F0JA 1KDAA 4KV6A 3TMEA 1SNOA 3SHLA 3QB3A 3SK6A 2PQEA 1STNA 4G57A 5IIFA 4IZ8A 1ENCA 4KD4A 1IHZA 5C6AA 4DGZA 5J1ZA 1JORA 2F0WA 1EZ6A 4RKBA 5EGTA 3VA5A 5HURA 1SYEA 5J22A 5KYIA 5IGFA 1A2TA 3U9OA 5ISRA 5HGTA 3C1EA 1NUCA 2EY5A 4ODGA 1SNDA 4K5VA 4N9PA 5KEEA 2F0UA 2F0KA 3ERQA 3SK8A 5I9PA 1F2ZA 4LAAA 1SYCA 3DHQA 4IUNA 5CGKA 4N9TA 5JOBA 5IGGA 4WORA 2F0TA 3MHBA 3OMCA 2F0MA 2F3VA 2OF1A 2PW5A 3HEJA 3ITPA 4KHVA 1SNPA 2F3WA 2OEOA 5NUCA 3TP8A 1TT2A 4DFAA 2ENBA 4KJOA 5CV9A 1SYFA 4K6DA 3MXPA 3D4DA 5CV5A 1EY6A 3QOJA 3TP6A 3MVVA 3SK5A 2KHSA 1SNQA 2NUCA 3RUZA 2M00A 3NK9A 4B9WA 1A2UA 3DMUA 1II3A 5M9OA 3E5SA 4R8NA 2EYJA 2F0FA 3SK4A 2F0LA 4EVOA 1EY4A 1EYCA 5C3XA 3T13A 5CV4A 3HZXA 2EYOA 2KQ3A 5E1FA 1EYDA 4PMCA 2SNSA 1EY8A 1STBA 1EY0A 4NKLA 4QF4A 4YIJA 4EQNA 1A3VA 1A3UA 1STGA 2EYFA 1U9RA 2RBMA 2EY6A 3TP7A 3TP5A 5C3WA 1TQOA 5CV6A 4KY6A
chains in the Genus database with same CATH superfamily
1PTOF 2N88A 1VQAA 2IHEA 1IXRA 3ZJYC 1VQCA 2OQ0A 4P2CB 2JA8B 3IFTA 3FKIB 4APVA 1TS3A 1SRUA 4JI5Q 5A2QE 5IYDH 2UXDQ 4KJNA 1PDQA 4O42A 1S40A 4BY7H 1NR2A 1JJCB 4TSSA 1SMYD 3M85A 4YY3L 1NR4A 4OONA 1HA6A 2JA5G 3CCLA 1NCVA 4JI6Q 3S2DH 4KKUA 4TRDA 4HJ5A 3K7AB 2ES2A 1S5DD 2JQOA 1FVIA 5IYBG 2ZXPA 4A3GB 5M3MG 1M1KC 1PLFA 3NEMA 1XMQL 4FXGC 3NQIA 4A76A 4J8QA 1DM0B 3DWAA 2RCFA 1AE2A 3R3OA 2EYMA 2IX3A 1TWAB 1E22A 3VR6A 1W3SA 5FO9B 4DR7Q 5EPJA 3DWPA 4FF2A 2K33A 5T1GA 3B6YA 1XXGA 4GLVB 3DEOA 2JA7B 4IUQA 3PUXA 1EYAA 4IALA 1CTMA 1TVXA 4KKTA 4A3IB 1XPOA 1YJ9A 2EIFA 3FPUB 5KNDA 4GNXA 1ZXTA 3VR3A 5C5MA 3NSWA 1D5ZC 3NELA 3H0GG 4C3HB 2PMZB 2LS01 3MXNB 2A19A 2EXZA 3BVGA 4DK6C 2Q2UA 2WB1E 2VQFQ 3VDYA 1GUGA 2R92H 4RWSC 2PNRC 3TREA 4RKBA 4XQNA 1SYEA 2PNHA 3HKZG 1B44D 2K50A 5ELFA 5KNBA 3ULPA 5FK9C 4CJ0B 1S72A 2DN8A 2EY5A 3E6ZX 4KHZA 5BN4A 1VS0A 1O7LA 2LMCB 1FNWA 4C3JB 4IUVA 3HOVG 3UDFA 3CU7A 4GLXA 4KHPQ 2QCPX 5IT9L 3HG9A 3JAML 1LTGD 2OQKA 1XPRA 4QUFA 2L9HA 3N6RA 3RN2A 1VQJA 1PV4A 3G6JB 2RSNA 2EJMA 3U50C 4Y7NB 3A5ZB 1QJOA 1Y1WB 1A3UA 2G9DA 5DNFA 1AFPA 3M4PA 3CCVA 1PH5A 3PO3G 1C48A 4DAYB 3X3NA 3F2UA 1LTAD 1X3QA 2Q8IB 3CCUA 1HR0Q 4P74A 3J81L 3KFUA 3IFDA 3I4OA 1C9OA 3NWSA 4OIKA 2KEDA 1XJVA 3K80C 4YCVA 1BCPF 1EIFA 1MGSA 3M4YA 2D9UA 3LX0A 4LF4L 1HNXL 1BBUA 1GM5A 4K0KQ 1WD1A 1KNAA 3CCRA 2B8GA 3MZ5A 4HCSA 5LMUL 2CQOA 1L1OC 1X3FA 4GOPA 3U58A 1EOTA 1NSNS 1DCZA 3AU7A 4LNQA 3M3YB 4HEDA 3OIPA 1N32L 2FMMA 1EEFD 5I6WA 1CKMA 1JWUD 3BYTB 4NP5A 2MO1A 2JK8A 5CYUA 1K8MA 2NYZD 3R2IA 1FJGQ 4CJ2C 5IP9G 3C3LA 2KJXA 2R93B 3EVQA 2Z0SA 2NVYB 3QOLA 1MJCA 1RTNA 5FLMH 4LF6L 1IYJB 3TQYA 1ASZA 1IYVA 3L3OC 1LYLA 2ID0A 1K3RA 4LFBL 5JJZA 2HD3A 4B3TL 3C46A 1O80A 4ME3A 4MTKA 3I4MG 2Y0SG 2YU9B 1MKHA 1A2TA 1SE8A 4GN5A 4LW1A 5JOBA 1AP0A 1VMCA 1TWGB 5ELOA 3W2DA 3U9SA 5C0XI 2HHHL 1VQ4A 2ENBA 1MBYA 4I7ZC 2WINB 1C0AA 3PIOA 3TP6A 3A8IE 1IL8A 2NUCA 4B9WA 2IJ0A 1Z7TA 1KRTA 2ICIA 1H95A 1TY2A 2E2DC 2KHIA 1YVCA 3CC7A 5CV4A 3Q8DA 4C3IH 1FNVA 2R7DA 5CBEE 4QF4A 4CKEA 3AFPA 4X66Q 4A93G 1EQRA 5KYIA 3S1MB 3EJIA 2R61A 2EYHA 2V1CC 4BBSG 2B2VA 1LLRD 5KGUA 3A74A 3OW2A 4A3MB 4TVAB 1G2TA 5GQOA 3I4NH 3MXNA 1HNZL 3I73A 4R4IA 1YITA 1EEID 3I70A 4XIGS 1L0YB 2B2UC 3I55A 1PH1A 4FP5D 2EPBA 4MHEA 2IPKD 3BZDB 2AHOB 5E4XA 2ZXOA 2BA1A 5BR8L 3HOXH 1BQQT 5I9OA 5IGEA 4U673 3A56A 4YHHL 2LSSA 4DR4L 4QMGA 4DU9A 4GKKL 1WTXA 1VQNA 2H4OA 3G4SA 2JA5B 2RDGA 1CKOA 5E3FA 2F0GA 4JI1Q 4DR6Q 1BKBA 4OO1I 1EWIA 4QUCA 2NZOA 5IWAQ 3S14H 5M3MB 3NXWA 4OX9Q 3T53B 1U4PA 5I9PA 2E2IH 2RA4A 4KD3A 1X9NA 4ID6A 1EY7A 3RNUA 2B29A 1F2LA 1Y1VH 1K3BC 1P16A 4DAYA 1HR0W 3C2PA 4IZ8A 4KD4A 4A3JH 2A68C 4A3FG 1TIID 4G4KA 3W1GA 3J7ZC 1B50A 1SFOB 2Q8TA 4A3DH 1VQLA 1CA6A 2D2CC 1DOKA 2JA6H 1PFNA 1Z6HA 3H0GB 1F2ZA 3T4AC 4AH6A 5CGKA 4ZRZA 4HCEA 1VQ9A 4JI3L 4DV6L 4LFCL 2IX1A 4FF1A 4LFAL 3KLRA 3J80L 3GTGB 3I56A 3SK5A 2R7ZH 1LTBD 2F4VL 3HKZB 1I4HA 2EYJA 2F0LA 4JYAL 1CZGA 4JW0A 4DFAA 1SN8A 4DV7L 4DR1L 1HTLD 3TP5A 4BA1I 1EIYB 4EQ5A 1NY4A 4A3CH 3HOVB 4JG2A 4DUYQ 3K57A 1MD2D 3OHXC 4IOCA 3GTJH 3T1HL 4MZ9A 4PMWA 2KOLA 4RKLA 3MEFA 4L63B 1SSOA 4ZYSA 1ZYRC 3PSIA 2UUAQ 3AFQA 3K5OA 2F0EA 1PRTC 3RD4A 4TKOB 3PO2H 1KLUD 4JV5L 1P8LA 1BUVT 1RKNA 5K36H 4DV1L 1PH8A 4RCNA 5D3IB 3SR1A 1XNQQ 3GD7A 3NQTA 4BA2I 1KAWA 5T1IA 1VQKA 4LF7L 2ZT9C 1FNUA 2I5MX 5LMNW 1UWVA 4A3BG 4ZUJA 5GROA 2SEBD 3K5MA 4OHJA 2UUCQ 4DV4Q 1PXUA 2IHFA 1KDBA 3AQQA 3NP8A 4LF5Q 2GA4B 3OMGA 4E6IA 2VUMH 3F2DA 4J6HA 3K8AA 3NTHA 5EJWA 1SMYC 4JI7Q 4Q5VA 3FMCA 2Z6KC 2WAQG 1L0WA 4DAVA 3EROA 4JBWA 3WWVA 1KTKA 2L55A 5C4JB 2MJ8A 5F2DA 2MPMA 1MHWC 1UAPA 4L6TB 4K5XA 2ZTEA 3Q24A 5CBAE 3HOZH 4ALPA 3S17H 1BR9A 3FVQA 3X3MA 4X65L 1QB5D 4DGZA 1Y8NB 2VXWA 2AQ1B 4DV3L 4GN3B 1H9JA 1QOHA 4A3LG 3OOCA 3BJUA 3JAMc 1N34Q 3H09A 1CZWA 2VS1A 3PIP3 1GJXA 4DNIA 3CXCA 3MXPA 2FINB 4X64Q 1SNQA 5JEAJ 1S4ZA 3GTKB 3I4MB 1WI5A 2Y0SB 3D0FA 4FF4A 4IFDJ 1I94Q 3GP7A 2SNSA 3BZCA 5C4XG 4NKLA 3GTMH 5EKIA 3NBHB 5CORA 1ET9A 1VQPA 4XXEA 1Q82C 5C44H 3D8GA 4DV0Q 3QJYA 3K7UC 2NB0A 1XTDA 3HOYH 4H7BA 5I6YA 4BBRH 3MWYW 5FO7B 2Q2IA 4DV5L 4BY1H 3ND8A 5FKAC 4EGVA 3CW2C 1NTGA 3P75A 3DEPA 4K5WA 3S1RB 3L7ZC 1BF4A 1UUPA 5C4ZA 1B8AA 1K8AC 3D6CA 4R1JA 3STBC 4A93B 2AQ3B 1EWHA 2MGSA 2OT2A 4IQZA 1IKLA 4BBSB 3CHBD 1PYWD 1R9TH 1AZPA 3EFXD 3I3CA 1CT1D 1EY5A 2N55A 2NVQB 3SE0A 3K0XA 3MXUA 3BDLA 5M5YH 2Z4IA 2DY8A 3A0JA 1H9KA 3CD6A 1IBKL 2K01A 4C2MH 4KLKA 3UDXA 2PI2A 4LWCA 2WKCA 1PHJA 1EIGA 2V4DA 4YWKA 1JB3A 5JVH3 2J7ZA 4DF7A 2SNMA 1EL0A 3HOUH 1TR5A 2UUBQ 1CFMA 2VQEL 3RZOH 1KD1C 2F1MA 2B2YC 4HTHA 5AFWA 5C0XH 1STYA 2EY1A 5LHY1 3K59A 2B2TC 2XSCA 4FDBA 3KLSX 1HJPA 4AQYQ 1R4PB 5EGTA 2O5IC 4RGTA 2J0TD 1PH6A 1J5EL 2VL6A 3U9OA 4RAUC 2WKDA 5HGTA 4WFN3 1NUCA 5EPLA 4JI5L 2F0KA 1B7YB 1EU3A 3H94A 1DOMA 3S24A 4AIMA 2UXDL 1Q8IA 3MHBA 2E2JB 4KHVA 1UE5A 2E2HH 1HFNA 5FLXc 1LTRD 2FMCA 4F87A 3D4DA 1PYBA 2BCOA 3QOJA 4A3FB 4JI6L 1U4LA 2O2LD 3JAME 3TEHB 4QCLA 4JOIC 3T56B 4YIJA 2VNUD 4LJZC 4GOPB 2VB3X 1EWCA 4L5RC 5JVG3 1XNRQ 1EFID 1YHQA 4XQQA 5IODA 1VQ7A 1CK1A 3PV0A 4X6AH 1QZHA 4DR7L 3M4OB 3K0YA 3QWNA 1GVPA 4HIDA 5E7NA 3J81E 4EQPA 4LUZA 2NTTA 3K81C 5JEAG 2QDBA 3M9BA 4OO1H 2QDLA 1ET6A 3MEHA 2B3GA 3C1FA 3WOEA 4IFDG 1F9PA 2VQFL 1I50B 1O78A 1EZ8A 3HOXG 2UXCL 4G7HC 1J6QA 1W6KA 1XTCD 1CKNA 1BOSA 1GUWA 1B53A 3S2DB 4KK7A 1ZKOA 4OWTB 4MNOA 3GTLH 3KK7A 4I65A 2NVTH 2K03A 4KHPL 1X56A 4A3BB 3OIQA 3CPWA 4L8JA 5M3FH 4G7ZC 1E24A 2RCNA 1V1QA 4NXMQ 1BCPD 3NBHA 3HS0C 1B2TA 2XN9C 2JA8H 1JR0D 2ZM6Q 1HCZA 3DUZA 2WAQB 1MSGA 1C4QA 2JA6G 2XGTA 1PFBA 1E2ZA 1W2BA 3J80c 1SYCA 3CCEA 2K32A 4B08A 3F8TA 3ITPA 1H9MA 1GUNA 2AKWB 3FPPA 4K6DA 2NN6H 1D8LA 2HDLA 3PGZA 3AB9A 2KUMA 4AYBB 4A3GH 3RUZA 4K0KL 1II3A 4RH6A 3CCJA 4NXNL 1Z9FA 1TWAH 3BG3A 2EYFA 2RBMA 3A7LA 2OWOA 2EY6A 5FLXE 5C3WA 1O7ZA 4Z9CB 2XIWA 5K5PA 3PMFA 2SOBA 2JA7H 1JJGA 1KXLA 3KUPA 1S5BD 2FFKB 4UY8C 4A3IH 3I4LA 3BVMA 2OXPA 5I2YA 3PO2G 3QIAA 1T5XD 1TKWB 3D4RA 1QUQA 5C4XB 4DUZQ 2ZTDA 1QVGA 2HIXA 2VY3A 2K28A 3STBD 1EYGA 1RIPA 2PMZE 3MC0B 2RDFA 4FO2A 3SEBA 2HUGA 1VQMA 1A3TA 1H9SB 5GAHC 4FNFA 1Y69U 3NE5B 2VW9A 2YYZA 1E1OA 5IGCA 3H6MA 1EQVA 2CH4A 2LKVA 4IN3A 1JOKA 4C3JH 5LMNL 1B70B 4DKAC 1ICWA 2RHQB 2L1BA 1Y8OB 3FP9A 4F7XA 4OWWB 1AEXA 3TDQA 4BXXH 5C4HA 4Y7NH 1X6OA 4XDXA 1I3QB 2BDOA 2N49A 1Y1WH 3JAMi 1K8OA 1DGSA 2B2WC 2QILA 4LF8Q 4R8IA 1A0IA 1STEA 1OO9B 2ZXRA 3FHWA 2NBFA 2PQEA 3TRZA 4X66L 1OXUA 3H91A 2L11A 2F4IA 5CMDA 1DJRD 3FEWX 5ELNA 3ULJA 5ISRA 4JI0Q 3VR5A 2AWNA 2LFNA 4N9PA 2L15A 2DUDA 3J81i 5M5WH 5A2QL 1PZKD 1WTRA 4NW2A 1SNPA 1V1OA 4QQBX 1LT3D 2PO4A 4QIWB 2KCMA 3T1YQ 4H13C 5C3EG 4HJAA 4CGYB 3J80E 1EY4A 2DNEA 3UDIA 1TXYA 5C3XA 5FJ8H 1A3VA 1PFMA 3TP7A 3TZDA 1U0LA 1GXDC 2QW7A 4B9XA 4DK3C 3KJPA 1PH4A 2YTXA 1S5CD 5KYLA 3RZDH 2L0CA 5HY6A 1K8GA 3BU2A 4C3IB 4A3KH 2BH2A 4DR6L 3S1NB 5GADC 2B63G 4IJHA 3TBIB 2K05A 2NVYH 5IWAL 4A75A 4OX9L 1VQIA 3T16A 2K1BA 4A3EG 1Q7YC 1NAPA 3U4VA 1B1ZA 5EQ0A 5ELEA 4QB4A 1KL9A 2XNAC 5CV8A 2Q2TA 2YU9H 2F0QA 2K52A 2KENA 4C56C 3SVMA 2E74C 1QWYA 3HRZC 4CKBA 2ATWA 1HH2P 1OXXK 1TWGH 4YWLA 4H44C 1PH3A 1SEBD 5D65A 1K9MC 1JQYD 2PZUA 1J9OA 1YNXA 4RG1A 1WOCA 2VB2X 2RVLA 1Y8PB 3URYA 3PUWA 1N32Q 1JB7A 1GO3E 3DXJC 4L5SA 3HFZB 1VQ6A 3HOXB 3NUCA 3V05A 1VCIA 4JI2Q 3F2CA 2KCCA 5C0XG 3G6EA 1VQBA 5EAYA 1C7YA 2IL8A 3HOWH 2R6GA 3S1MH 4DNRB 1SNOA 4JBMA 1STNA 4RGOS 1J8IA 2JXMB 1F9QA 5IYCH 4OIJA 3RLOA 4A3MH 2IX0A 2CVRA 2E2IB 1PTOC 1U4RA 5IGFA 4JPBW 4R9WA 2UUAL 4LFBQ 2C5CA 4B3TQ 2CHBD 3DHQA 5IGGA 1Q12A 3OMCA 3GQBA 1AE3A 1Q3LA 2OEOA 4A3JB 2N3SA 2WV6D 3AEVA 3J7AF 4MTNA 1DZ1A 1H9SA 1EQTA 2M00A 3R93A 1V8QA 2HHHQ 2JA6B 1WTHA 1K0RA 2XTIA 1GUSA 4EVOA 1LABA 3RMHA 1G6PA 1FL0A 1BDOA 1OTCA 4BWGB 4DV4L 4DXGA 3G71A 1O7IA 3UDGA 1Y14B 4LF5L 1L1OB 2EOTA 5IYBH 2RSOA 1E3PA 1TU2B 5I2XA 5M3MH 4X62Q 1K83H 1HFGA 4JI7L 3S2HB 3CC2A 1N9WA 3I8ZA 3S16B 1W6JA 1F2MA 4GNXC 3I91A 5AJ3Q 4IO9A 1Q90A 1LV9A 3GTOH 3S1QB 3RLNA 4OO1G 1PZID 1JMCA 1PMRA 4Y52H 4GS3A 5M5XH 1WCMH 4F88A 2ZJPA 3GTQH 1TWFH 3PO2B 4M8AA 1I4RA 2F03A 3FDTA 3NHHA 2NN6I 3H0GH 4FXDA 2QGQA 2P5ZX 4POFA 5IYDG 4H02A 2A5HA 3RLFA 2PZWA 4U68A 4BY7G 2RKSA 1N34L 4LF9Q 1T5EA 1K0SA 2CWPA 3S9WA 3RR5A 4YHHQ 5C5LA 2PI2E 1ESRA 3QO2A 1SNMA 4GKKQ 1Z47A 3BYYB 3E9HA 5JPNC 4X64L 3HKZE 1JE4A 3J80i 1PFSA 4EX5A 1LTTD 3HOVH 3VA7A 4WJ4A 1F9RA 3ULLA 3R2TA 1CHPD 4KV6A 1QILA 1D1KA 1IHZA 3LNNA 4B3MQ 4ZAIA 2CQAA 4DV0L 4X3SA 1FD7D 4OEMB 1CA5A 3C1EA 3K6OA 5KEEA 3S15B 4WJ3M 3O13A 2B8FA 4L5QA 1YIJA 2IWHA 4N8FA 2RHSB 3VR2A 3L2PA 3S17B 3W1BA 1LT6D 1HZBA 2F0MA 3PO3H 1WTOA 1LTSD 2CKZB 1VQOA 1E0BA 4KJOA 1AW7A 1GUOA 4POGA 1BCPC 3I90A 3NTKA 5JJIA 4JI3Q 4DV6Q 2R92G 1V1PB 3ERSX 2Z8LA 3DM1A 1I6HB 2EJFC 3KBXA 4AYBG 1Q8KA 4V0BA 4UP8A 3VA5A 1CM9A 2L4NA 1TQOA 3KJOA 5IT9c 1CKNB 4DV7Q 2ZJQA 2XRSD 5C3EB 4IUTA 2FXQA 1QNKA 4XT3B 4JI8Q 3UE1A 3HKSA 2QF7A 3T1HQ 2NWGA 5IGBA 4DR2Q 3GTMB 2LXJA 1TS2A 1B3AA 2IW3A 1M8AA 5C44B 2A74C 4PZ8A 1D5XC 2UUBL 5IGDA 4JV5Q 4NDXA 4O2DA 5J39A 3J81c 4HJ9A 1LACA 1VQGA 1PH9A 3GV3A 5IP9H 1GHJA 4BY1B 1G91A 3MXGA 1V9PA 3D4WA 2C9OA 1PTOH 2F0HA 4AQYL 1A6XA 1IBLL 2B63B 2E76C 4LF7Q 2YTYA 4B3RL 4ME5A 3TZUA 4JBJA 1SROA 3IL8A 4HIKA 5D14A 2K5QA 4A3EB 5DLQE 2N78A 1X3GA 3D31A 5J3BA 1VQHA 1JWMD 5LL6S 1CSPA 1HTPA 3J7YW 3EBEA 2FJ2A 1IZ6A 3GTKH 3I4MH 1YBYA 2A6ED 1HUMA 3E0EA 1IBML 4HAEA 1OXTA 5M5YB 1HNWQ 1TWCB 2Y0SE 1UE6A 1JOQA 3OWFA 2K5VA 1ENAA 4HSVA 1GKHA 1M4VA 3D6WA 3LWUA 2E5LQ 3TMEA 2O4XA 4KI0A 4HN7A 3QB3A 1EUJA 2CFMA 1L1OA 4PG3A 5DM73 1XNRL 2B2WA 5FOBB 2QA4A 1CHQD 2GVAA 1PTOD 3ND9A 4HR7B 2B2VC 2A69C 4IUUA 3RZOB 4DR5Q 2Z6BA 3S1RH 2AWOA 4P73A 1X54A 4LAAA 3GTPH 4A93H 1JT8A 4O0AA 2F3VA 2PW5A 1QUQB 1RJTA 4OWXB 2X6GA 3UE0A 5FLMG 3Q22A 4BBSH 2EZVA 1B9NA 1PRTB 3KLSA 1SMXA 4CBVA 4X3TA 2NVQH 3CQZB 4JI4Q 1KC8C 3BVZA 3A54A 3Q6SA 3DLLA 1EY8A 2L5TA 2ICEC 1IKMA 4P71A 3TSSA 1KQSA 1X55A 1NJIC 3I7FA 3MFYA 4WJWA 2B39A 2K5NA 2PPBC 2MQHA 1SE2A 3SDZA 4OL7A 5G3LF 2MHVA 3KDFB 1SNCA 2UU9Q 2AUKA 4A3KG 2PCFB 4PZ6A 3E3XA 5JPMC 3ONAB 2E8GA 4FXKC 4LMQD 3K58A 2WP8J 3BZKA 4PZ7A 4K2LA 1EY9A 3E0JA 5IT9E 1U4MA 1YHBA 3J7A5 4J15A 1STAA 4OGQC 4C3IG 3GDEA 4DV5Q 4NMZA 1RHPA 1A8VA 4IURA 4K6LA 4NXML 4HIOA 2KEEA 4TQUS 3G48A 1YJNA 5DAUA 4ZUIA 3VYRA 4DV2Q 3M7GA 1E1TA 2ZM6L 5KRUA 2E75C 2UXBQ 3AMUA 1Q86C 1UEAB 4R4QA 5EKKA 1VQ5A 2E2JH 4B3SQ 4XYOA 3I4NG 4LUOA 4A3FH 1PH7A 1B3QA 1IBKQ 3MAQA 5KIXA 1V1PA 1XMOQ 1WJJA 2HQEA 4DN4M 3PF5A 2I46A 3RN5A 1TWHH 3OTOQ 3U4ZA 3HOWG 4GKJQ 1STHA 1XWEA 2B2UA 2I5LX 1JOOA 4BY7B 2F0NA 2F0JA 1KDAA 3CF5A 4UP7A 5TSSA 3SK6A 1EQQA 1K73C 3M4OH 1RTOA 2X6LA 5BN3A 4CDFC 1D1IA 2DJGC 2AUJD 1QCBD 3WDNA 1EZ6A 1R4QB 5HURA 1YEZA 2KA7A 5J22A 2NVXH 1N33Q 3GO5A 2F0UA 3SK8A 3ERQA 2YV5A 1HQRD 2SDFA 4OELB 1L2FA 2HT1A 1S5ED 2M9VA 4WORA 3EIVA 5I4DA 4DUZL 1AN8A 3OW7A 1J5EQ 4XTCS 1SDFA 3OWEB 2F3WA 1Y1VG 2G9HD 3K5LA 1I50H 1RCVD 3QG1A 4A3JG 1N8RC 3SK4A 3FKIH 3HZXA 2KQ3A 4QY7A 4A3DG 1ENFA 2KBNA 1EY0A 3KF6B 3KBGA 1KHIA 1U9RA 5LL6X 2FHTA 1HR0L 2WB1B 5IOCA 2HCIA 2Z4HA 1T9HA 1F9SA 5D3DA 1N36Q 1LT4D 4EQOA 3EA6A 4A3BH 4RA8A 2WFWA 4KN7C 2R92B 4LK1C 2BE5C 4PMBA 4DR3Q 3K7AH 2R7ZG 1H9RA 1MI2A 1IYUA 1Q1EA 1VDZA 3CKIB 1G6ZA 1C8CA 1TS4A 4A3CG 4RGNA 3CPFA 1WCMG 4LF8L 5CR3A 3MA2B 5EBCA 4JCVE 4ZKCB 3I2ZA 2OCEA 2WAQE 1RD9D 1HHVA 3CMEA 4CDCC 4JI0L 1FJGL 5K36G 1LTID 1FGBD 1PRTF 1X3PA 4C3HH 2UXCQ 1BO0A 2EYPA 4KN4C 5C0XJ 2K14A 4ZKBB 1K28A 4A3LH 5GAEC 2YTVA 4R4CA 4AYBE 3T1YL 1AH9A 1I4PA 2DGYA 2F0OA 4DAMA 3F2BA 2PW7A 2DY7A 2BH8A 2RQXA 4YY3Q 3M4QA 1X3EA 3PCOB 4KTAA 1DOLA 3QR8A 4F8MA 5EPKA 3H3VI 3NENA 2ASBA 3KDFA 2VUMG 1SJED 4NB3A 5COYA 1YNNC 1XMQQ 4P75A 1SE4A 1IW7D 4UAIA 2XRQD 3PIPA 2A69D 3G7LA 2JA9A 5C4XH 1BXTA 4RHSA 3IRBA 4K5VA 2R7FA 2HDMA 4XT1B 3PUZA 4N9TA 3V96A 1BBWA 3SGIA 1AZQA 3P7JA 1VQ8A 1LT5D 5NUCA 2Z6KA 4ZCKA 1QNUA 1SLJA 3HOZG 1EY6A 2EXDA 3J7AV 1WVLA 1A63A 2CW0C 1JJ2A 1QZGA 4UPAA 1FR3A 3VYSA 4GZYC 2XVSA 5M5WB 1DONA 1SXTA 1EYDA 2D62A 4DA2A 3K5NA 2XWBB 5EBDA 1G8ZD 3R8BA 5DM63 3F1ZA 3AYHB 1G51A 4NXNQ 4KY5A 3NPPA 1MSHA 3DM3A 1A15A 4IPHA 4YCWA 5CV7A 3W3AA 1JE5A 1I3QH 4RFBA 4DNTB 4PQXA 2XWJB 1TY0A 3V2TA 2F0SA 3MFGA 3UI2A 3IAYA 1VF7A 4JI2L 1KRSA 1F2YA 2H1EA 3M3YH 3RZDB 4ULLA 1Q1BA 3L0OA 5C44G 4CKCA 4A3KB 4XYQA 2LY7A 1ASYA 3HOYG 2I07B 4HMIA 2F0DA 4BBRG 1YNJD 5GAGC 5JAVA 1QVFA 4BY1G 1KABA 5A35A 4JI1L 1JCKB 2R93H 4CJ1B 3CRLC 2ZTCA 3BS1A 3CRKC 2JJQA 1VQDA 4J1MA 2I5HA 1YHAA 2Q2HA 1EIHA 1BNZA 2NTSA 2G5DA 3E9IA 5LMNQ 5IP7H 5H1SE 4QIWE 2A73B 4K14A 1S3OA 1PYSB 2PYKA 2I0QA 1WTWA 1ML0D 4KY7A 2F0PA 4K8JA 1X32A 3KF6A 2RDHA 1ILQA 4IPCA 4JVZA 3Q0AA 1HNXQ 1NBWA 4LUVA 4LF4Q 3I4NB 2HCCA 1SYDA 2F52A 3SHLA 5LMUQ 4I7AA 2LXKA 1B9MA 5IIFA 2IY5B 4R4TA 5KNCA 5C6AA 5FLXL 1Q46A 4CDEC 3S1NH 2F0WA 2JSOA 1HZCA 2H5XA 4X62L 1L0XB 1KLGD 4ODGA 2K5HA 2A6EC 3HOWB 1HPCA 3HOUG 4IUNA 1E2VA 4C1NK 2OTLA 2MP1A 3H3VC 2AQ2B 2OF1A 4IPDA 1NE3A 3FRPB 1XX8A 5AJ3L 1XYIA 4IOAA 4DK1A 3DMUA 3J81j 3S14B 2B2YA 2J4XA 4YCUA 3M7NA 4DUYL 1V43A 1WTQA 4N8X1 4LF6Q 3PF4A 2B2TA 2A6HC 4PMCA 1JWSD 1YZ6A 5JEAH 1WFQA 4JBKA 1Y1VB 2F0VA 3EN2A 4IFDH 2EY2A 4LF9L 1KDCA 2BE5D 4UHVA 1KAAA 3TS0A 1XNQL 2EQSA 3CAMA 3SXHA 2OTJA 4HJ7A 4A3DB 1JICA 1MIUA 3OYYA 4QJFA 2KHJA 1QVCA 1CI3M 1RL2A 2UUCL 4O1NA 4FYDA 1K83B 2JA5H 1CQVA 1LTLA 2R3ZA 1YJWA 2TMPA 1D2BA 1U5KA 4K8IA 4JOIA 2L12A 4NPSA 2R7ZB 3A8JE 3BDOA 4B3ML 1X65A 2K04A 2K6AA 2PZTA 1IL2A 4MIUA 1FYCA 2PQAB 3KYHC 3GTOB 4FVMA 3KF8B 3NTIA 5M5XB 4FF3A 1WCMB 3GTQB 1TWFB 2JN4A 3GTJB 2K5DA 1HQMC 3VYTA 3CCMA 4BS9A 2EJGC 2K75A 4KKSA 2N8NA 1HNZQ 1BVSA 2BDNA 1NMFA 1I4GA 1E2WA 2KECA 1SFOH 4G7OC 3ZYYX 4XQJA 1SAPA 1HZ9A 5ELDA 1G291 1EU4A 3CP0A 5BN5A 1ICFB 2QEXA 4G57A 1YNND 1ENCA 4HSPA 4DAPA 1CSQA 2MNAA 5J1ZA 1LM0A 4Q0FA 1ESFA 5BR8Q 3CMAA 2K5WA 3GTGH 2KCNA 3S2HH 4JI8L 3S16H 4DR4Q 5E4WC 5M3FG 1RF2D 4CHTB 2F0TA 4DR2L 3S1QH 1UNSA 3D3RA 1I4QA 2HIVA 3DWQA 1SR3A 2VUMB 5CV9A 1PZJD 1I94L 2D0PA 1HZAA 2KHSA 1NNXA 2MO0A 1XPUA 2JA8G 1GHKA 3FKIG 2CW0D 1I5FA 3E5SA 2F0FA 1O7YA 2MFIA 3WOFA 1EYCA 1Q81C 5E1FA 3PUVA 4H0LC 3PO3B 1STGA 4YWMA 2CH4W 5DEHA 4MN3A 3OSOA 2F0IA 4ZLTF 1SYGA 3HOZB 1DXMA 1HA5A 3KOJA 2NN6G 2WB1G 1QE6A 4ZQ3A 4ZK9B 4A3GG 2WACA 2K4KA 4UDUC 4DK0A 2QEJC 4LFCQ 2A8VA 4R4OA 1HNWL 4PNYA 4QL5A 4PV1C 4LFAQ 1YI2A 3CC4A 5EKLA 2VZAA 4GOPC 2E5LL 1S5FD 1ILPA 2F4VQ 1CQFA 2JA7G 4RGMA 4JYAQ 4OXPA 2HQLA 4A4IA 4A3IG 4DR1Q 1KNEA 3BDCA 3S15H 1UEBA 4M1UB 2ALYB 2EDGA 2GN5A 3NBIA 1M90C 5C4JH 1VQEA 4C3HG 3A5UA 4DR5L 4K2KA 3KLWA 1ZEQX 3H3VH 1SYBA 2A1AA 2KVMA 1GOZA 3VR4A 2JYOA 5JJKA 1HUNA 1LO5D 1PTOB 4WRDA 4P72A 1NMGA 3HOYB 5G3LD 4JK1C 1I6VC 2DNCA 1E7ZA 4RHRA 4RMFA 4BBRB 4HMJA 4DV1Q 1I4XA 1I6HH 4JC0A 2CCZA 5HGQA 2X69A 3ICEA 4JI4L 2D5DA 3L9AX 4C3JG 1EOVA 2EE1A 4HIMA 4IUPA 1SE3A 5C3EH 1G2SA 4GLAC 1HXYD 2TSSA 3CCQA 1R9TB 2UU9L 4BXXG 1EFWA 2BOSA 2KCTA 4C1NI 4DPGA 1Y1WG 5ELCA 4GN4B 1WD0A 4EQNA 3HEJA 4RCOA 3OPOA 4QGUA 1D7QA 1TT2A 4C2MB 5IY0A 1SYFA 2MUYA 1LUZA 3NK9A 1WTPA 1ONLA 1A2UA 3PQIA 1TS5A 5M9OA 1DYQA 2B63H 2O5JC 3GTPB 4GNXB 5JJLA 3T13A 2A6HD 2CWAA 1WTVA 2JEBI 2PQAA 4L5TA 3HOUB 1SBBB 4X3UA 4DV2L 1IW7C 3TS2A 1UE1A 4A3EH 2BA0A 1RODA 4X65Q 2UXBL 5CV6A 2M2LA 3KF8A 3MTSA 4B3SL 4V190 5ELBA 4DV3Q 3IKJA 2K7VA 1TWCH 2F3IA 2JEAI 3H15A 4IJLA 1CUKA 2GVBA 1XMOL 1D5MC 4IPGA 5FJ8G 3JC66 1PA6A 3PIO3 3OTOL 4GKJL 3N52A 2EVBA 2E2HB 1PH2A 5IE8A 1PVOA 2EYLA 1BBXC 3PUYA 4KMUC 2Z9HA 1OXSC 3A8KE 1VF5C 4HJ8A 3A55A 1HRJA 3Q23A 2R93G 1KIXA 3P1HA 5FO8B 1VMPA 3EQLC 1N33L 2NZ1D 1IBLQ 5L37A 2A68D 3LWEA 4B3RQ 3I72A 5IP7G 1MJEA 2D0OA 2ZJRA 1RDPD 2QKIC 3CQZH 1WYDA 3VYUA 1JC7A 4IFDI 3LGJA 1GUTA 3CCSA 4S3SA 1IBMQ 3T51B 3NWTA 4DXFA 1YNJC 1BCPB 3TN2A 2Q8RE 4ABNA 4CDDC 3ER0A 1VQFA 2NZHA 1N36L 1JORA 2C35B 4ILWA 4UP9A 1A62A 1TWHB 1SJHD 1SNDA 2AMCB 4DR3L 3GV6A 2Z1CA 4X3KA 1OXVA 1ZYRD 2DJFC 3TP8A 2IT1A 1DD2A 2RF4A 3HGBA 1PRTD 3GTLB 1F77A 2JP1A 2NVTB 5CV5A 1D6EC 3W5OA 3MVVA 2NVXB 2JE6I 5IYCG 2VQEQ 1QG7A 4R8NA 4A3MG 1GD7A 1FGUA 2WIIB 1B4OA 2EYOA 5M3FB 1STBA 3A7AB 3HP3A 5CC4A 1UE7A 3P20A 4KY6A
chains in the Genus database with same CATH topology
1PTOF 2N88A 4P2CB 2JA8B 3IFTA 3FKIB 1TS3A 5A2QE 4KJNA 1PDQA 4O42A 1NR2A 4TSSA 1SMYD 3M85A 1NR4A 1HA6A 1NCVA 4KKUA 4TRDA 3K7AB 1S5DD 2ZXPA 4A3GB 1PLFA 4FXGC 3NQIA 4J8QA 1DM0B 3DWAA 3R3OA 2EYMA 2IX3A 1TWAB 3VR6A 5FO9B 5EPJA 3DWPA 4FF2A 2K33A 5T1GA 1XXGA 3DEOA 2JA7B 4IUQA 3PUXA 1EYAA 4IALA 1CTMA 1TVXA 4KKTA 4A3IB 3FPUB 5KNDA 1ZXTA 3VR3A 5C5MA 3NSWA 1D5ZC 4C3HB 2PMZB 2LS01 2EXZA 3BVGA 1GUGA 4RWSC 2PNRC 4RKBA 4XQNA 1SYEA 1B44D 5ELFA 5KNBA 5FK9C 4CJ0B 2DN8A 2EY5A 3E6ZX 4KHZA 5BN4A 1O7LA 2LMCB 1FNWA 4C3JB 4IUVA 3CU7A 2QCPX 5IT9L 3HG9A 3JAML 1LTGD 4QUFA 2L9HA 3N6RA 3G6JB 2RSNA 2EJMA 4Y7NB 1QJOA 1Y1WB 1A3UA 2G9DA 5DNFA 1AFPA 1C48A 3X3NA 3F2UA 1LTAD 1X3QA 2Q8IB 3J81L 3IFDA 3NWSA 4OIKA 2KEDA 1BCPF 1MGSA 3M4YA 2D9UA 3LX0A 1WD1A 1KNAA 2B8GA 3MZ5A 4HCSA 1EOTA 1NSNS 1DCZA 3AU7A 3M3YB 4HEDA 3OIPA 2FMMA 1EEFD 5I6WA 1JWUD 3BYTB 4NP5A 5CYUA 1K8MA 2NYZD 3R2IA 4CJ2C 3C3LA 2KJXA 2R93B 3EVQA 3QOLA 2NVYB 1RTNA 1IYVA 3L3OC 2ID0A 5JJZA 3C46A 1O80A 2YU9B 1A2TA 5JOBA 1AP0A 1VMCA 1TWGB 3W2DA 3U9SA 5C0XI 2ENBA 1MBYA 4I7ZC 2WINB 3TP6A 3A8IE 1IL8A 2NUCA 4B9WA 2IJ0A 1Z7TA 2ICIA 1TY2A 2E2DC 5CV4A 5CBEE 1FNVA 4QF4A 4CKEA 5KYIA 3S1MB 3EJIA 2R61A 2EYHA 2B2VA 1LLRD 5KGUA 4A3MB 1G2TA 3MXNA 3I73A 1EEID 3I70A 4XIGS 1L0YB 2B2UC 4FP5D 2EPBA 4MHEA 2IPKD 3BZDB 5E4XA 2ZXOA 2BA1A 1BQQT 5I9OA 5IGEA 4U673 3A56A 4QMGA 4DU9A 1WTXA 2H4OA 2JA5B 2RDGA 5E3FA 2F0GA 4OO1I 4QUCA 5M3MB 3NXWA 3T53B 1U4PA 5I9PA 2RA4A 4KD3A 4ID6A 1EY7A 1F2LA 4DAYA 3C2PA 4IZ8A 4KD4A 2A68C 1TIID 4G4KA 1B50A 1SFOB 2Q8TA 1CA6A 2D2CC 1DOKA 1PFNA 1Z6HA 3H0GB 1F2ZA 3T4AC 5CGKA 4ZRZA 4HCEA 2IX1A 4FF1A 3KLRA 3J80L 3GTGB 3SK5A 1LTBD 3HKZB 1I4HA 2EYJA 2F0LA 1CZGA 4DFAA 1HTLD 3TP5A 4BA1I 3HOVB 3K57A 1MD2D 3OHXC 4PMWA 2KOLA 4RKLA 4L63B 1SSOA 4ZYSA 1ZYRC 3K5OA 2F0EA 1PRTC 3RD4A 4TKOB 1KLUD 1BUVT 1RKNA 5K36H 4RCNA 5D3IB 3SR1A 3GD7A 3NQTA 4BA2I 5T1IA 2ZT9C 1FNUA 4ZUJA 2SEBD 3K5MA 4OHJA 1PXUA 1KDBA 3NP8A 2GA4B 3OMGA 4E6IA 4J6HA 3NTHA 5EJWA 1SMYC 4Q5VA 3FMCA 4DAVA 3EROA 4JBWA 1KTKA 2L55A 5C4JB 2MJ8A 5F2DA 2MPMA 1UAPA 4L6TB 4K5XA 3Q24A 5CBAE 1BR9A 3FVQA 3X3MA 1QB5D 4DGZA 1Y8NB 2VXWA 2AQ1B 1H9JA 1QOHA 3OOCA 3H09A 1CZWA 3PIP3 1GJXA 3MXPA 2FINB 1SNQA 5JEAJ 1S4ZA 3GTKB 3I4MB 2Y0SB 4FF4A 4IFDJ 3GP7A 2SNSA 4NKLA 5EKIA 5CORA 1ET9A 4XXEA 3D8GA 3QJYA 2NB0A 4H7BA 5I6YA 3MWYW 5FO7B 3ND8A 5FKAC 4EGVA 3P75A 3DEPA 4K5WA 3S1RB 3L7ZC 1BF4A 1UUPA 5C4ZA 3D6CA 4A93B 2AQ3B 1EWHA 2MGSA 2OT2A 4IQZA 1IKLA 4BBSB 3CHBD 1PYWD 1AZPA 3EFXD 3I3CA 1CT1D 1EY5A 2N55A 2NVQB 3SE0A 3MXUA 3BDLA 2Z4IA 2DY8A 1H9KA 2K01A 2WKCA 1EIGA 2V4DA 1JB3A 5JVH3 2J7ZA 4DF7A 2SNMA 1EL0A 1TR5A 1CFMA 2F1MA 2B2YC 4HTHA 5AFWA 5C0XH 1STYA 2EY1A 5LHY1 3K59A 2B2TC 2XSCA 3KLSX 1R4PB 5EGTA 2O5IC 4RGTA 2J0TD 3U9OA 4RAUC 2WKDA 5HGTA 4WFN3 1NUCA 5EPLA 2F0KA 1EU3A 3H94A 1DOMA 1Q8IA 3MHBA 2E2JB 4KHVA 1HFNA 1LTRD 2FMCA 4F87A 3D4DA 2BCOA 3QOJA 4A3FB 1U4LA 2O2LD 3JAME 4QCLA 3T56B 4YIJA 2VNUD 4LJZC 2VB3X 1EWCA 5JVG3 1EFID 4XQQA 5IODA 1CK1A 3PV0A 3M4OB 3K0YA 3QWNA 3J81E 4EQPA 2NTTA 5JEAG 2QDBA 4OO1H 1ET6A 3MEHA 3C1FA 3WOEA 4IFDG 1F9PA 1I50B 1O78A 1EZ8A 4G7HC 1W6KA 1XTCD 1BOSA 1GUWA 1B53A 3S2DB 4KK7A 1ZKOA 3KK7A 4I65A 2K03A 4A3BB 3OIQA 4L8JA 4G7ZC 1BCPD 3NBHA 3HS0C 1B2TA 2XN9C 1JR0D 1HCZA 3DUZA 2WAQB 1MSGA 1C4QA 1PFBA 1E2ZA 1SYCA 2K32A 4B08A 3ITPA 1H9MA 1GUNA 3FPPA 4K6DA 2NN6H 2HDLA 3AB9A 2KUMA 4AYBB 3RUZA 1II3A 4RH6A 3BG3A 2EYFA 2RBMA 3A7LA 2EY6A 5FLXE 5C3WA 1O7ZA 4Z9CB 2XIWA 5K5PA 3PMFA 2SOBA 3KUPA 1S5BD 2FFKB 3I4LA 3BVMA 2OXPA 5I2YA 3QIAA 1T5XD 1TKWB 3D4RA 5C4XB 2K28A 3MC0B 2RDFA 4FO2A 3SEBA 2HUGA 1A3TA 1H9SB 4FNFA 1Y69U 3NE5B 2YYZA 5IGCA 3H6MA 1EQVA 2LKVA 4IN3A 1JOKA 1ICWA 2L1BA 1Y8OB 4F7XA 1AEXA 3TDQA 5C4HA 4XDXA 1I3QB 2BDOA 1K8OA 2B2WC 2QILA 4R8IA 1STEA 1OO9B 2ZXRA 2NBFA 2PQEA 1OXUA 3H91A 2L11A 2F4IA 5CMDA 1DJRD 3FEWX 5ISRA 3VR5A 2AWNA 2LFNA 4N9PA 5A2QL 1PZKD 1WTRA 4NW2A 1SNPA 1V1OA 1LT3D 2PO4A 4QIWB 4H13C 4CGYB 3J80E 1EY4A 2DNEA 5C3XA 1A3VA 1PFMA 3TP7A 3TZDA 1GXDC 4B9XA 1S5CD 5KYLA 2L0CA 4C3IB 3S1NB 3TBIB 2K05A 3T16A 2K1BA 1NAPA 1B1ZA 5EQ0A 5ELEA 4QB4A 2XNAC 5CV8A 2F0QA 4C56C 3SVMA 2E74C 1QWYA 3HRZC 4CKBA 1OXXK 4H44C 1SEBD 5D65A 1JQYD 2PZUA 1J9OA 2VB2X 2RVLA 1Y8PB 3URYA 3PUWA 3DXJC 3HOXB 3NUCA 3V05A 1VCIA 2KCCA 5C0XG 2IL8A 2R6GA 4DNRB 1SNOA 1STNA 4RGOS 1J8IA 2JXMB 1F9QA 4OIJA 2IX0A 2CVRA 2E2IB 1PTOC 1U4RA 5IGFA 4R9WA 2C5CA 2CHBD 3DHQA 5IGGA 1Q12A 3OMCA 3GQBA 1Q3LA 2OEOA 4A3JB 2WV6D 3J7AF 1DZ1A 1H9SA 1EQTA 2M00A 3R93A 1V8QA 2JA6B 1GUSA 4EVOA 1LABA 3RMHA 1BDOA 4BWGB 4DXGA 2EOTA 2RSOA 1TU2B 5I2XA 1HFGA 3S2HB 3I8ZA 3S16B 1W6JA 1F2MA 3I91A 1Q90A 1LV9A 3S1QB 4OO1G 1PZID 1PMRA 4F88A 3PO2B 4M8AA 1I4RA 2F03A 3FDTA 3NHHA 2NN6I 4FXDA 2A5HA 3RLFA 2PZWA 4U68A 2RKSA 1T5EA 3S9WA 5C5LA 1ESRA 3QO2A 1SNMA 1Z47A 3BYYB 5JPNC 1JE4A 1LTTD 3VA7A 1F9RA 3R2TA 1CHPD 4KV6A 1QILA 1D1KA 1IHZA 3LNNA 4ZAIA 2CQAA 4X3SA 1FD7D 1CA5A 3C1EA 3K6OA 5KEEA 3S15B 3O13A 2B8FA 2IWHA 3VR2A 3S17B 1LT6D 2F0MA 1WTOA 1LTSD 1E0BA 4KJOA 1AW7A 1GUOA 1BCPC 3I90A 3NTKA 1V1PB 2Z8LA 3DM1A 1I6HB 2EJFC 3KBXA 4V0BA 3VA5A 1CM9A 2L4NA 1TQOA 2XRSD 5C3EB 4IUTA 1QNKA 4XT3B 2QF7A 2NWGA 5IGBA 3GTMB 1TS2A 1B3AA 2IW3A 1M8AA 5C44B 2A74C 1D5XC 5IGDA 4NDXA 5J39A 1LACA 3GV3A 1GHJA 4BY1B 1G91A 3MXGA 3D4WA 2C9OA 1PTOH 2F0HA 1A6XA 2B63B 2E76C 4ME5A 3TZUA 3IL8A 5D14A 2K5QA 4A3EB 3D31A 1JWMD 5LL6S 1HTPA 3J7YW 2FJ2A 2A6ED 1HUMA 4HAEA 1OXTA 5M5YB 1TWCB 1JOQA 3OWFA 1ENAA 4HSVA 1M4VA 3D6WA 3LWUA 3TMEA 2O4XA 4KI0A 4HN7A 3QB3A 5DM73 2B2WA 5FOBB 1CHQD 1PTOD 3ND9A 4HR7B 2B2VC 2A69C 4IUUA 3RZOB 2AWOA 4LAAA 2F3VA 2PW5A 1RJTA 2X6GA 3Q22A 2EZVA 1B9NA 1PRTB 3KLSA 4CBVA 4X3TA 3CQZB 3BVZA 3A54A 3Q6SA 1EY8A 2L5TA 2ICEC 1IKMA 3TSSA 3MFYA 4WJWA 2B39A 2PPBC 1SE2A 3SDZA 4OL7A 5G3LF 2MHVA 1SNCA 2AUKA 2PCFB 5JPMC 3ONAB 4FXKC 4LMQD 3K58A 2WP8J 4K2LA 1EY9A 3E0JA 5IT9E 1U4MA 1STAA 4OGQC 4C3IG 4NMZA 1RHPA 4IURA 4K6LA 2KEEA 4TQUS 5DAUA 4ZUIA 3VYRA 3M7GA 5KRUA 2E75C 3AMUA 1UEAB 5EKKA 4XYOA 3MAQA 5KIXA 1V1PA 2HQEA 4DN4M 2I46A 1STHA 1XWEA 2B2UA 1JOOA 4BY7B 2F0NA 2F0JA 1KDAA 5TSSA 3SK6A 1RTOA 2X6LA 5BN3A 1D1IA 2AUJD 1QCBD 3WDNA 1EZ6A 1R4QB 5HURA 2KA7A 5J22A 3GO5A 2F0UA 3SK8A 3ERQA 1HQRD 2SDFA 1S5ED 2M9VA 4WORA 5I4DA 1AN8A 3OW7A 4XTCS 1SDFA 3OWEB 2F3WA 2G9HD 3K5LA 1RCVD 3QG1A 3SK4A 3HZXA 2KQ3A 1ENFA 1EY0A 3KBGA 1U9RA 5LL6X 2FHTA 2WB1B 5IOCA 2HCIA 2Z4HA 1F9SA 5D3DA 1LT4D 4EQOA 3EA6A 4RA8A 4KN7C 2R92B 4LK1C 2BE5C 4PMBA 1H9RA 1MI2A 1IYUA 1Q1EA 1VDZA 3CKIB 1G6ZA 1C8CA 1TS4A 4RGNA 5CR3A 3MA2B 5EBCA 4ZKCB 1RD9D 1HHVA 5K36G 1LTID 1FGBD 1PRTF 1X3PA 1BO0A 2EYPA 4KN4C 5C0XJ 4ZKBB 1I4PA 2F0OA 2PW7A 2DY7A 2RQXA 4KTAA 1DOLA 4F8MA 5EPKA 1SJED 5COYA 1YNNC 1SE4A 1IW7D 4UAIA 2XRQD 2A69D 3G7LA 1BXTA 4RHSA 4K5VA 2HDMA 4XT1B 3PUZA 4N9TA 3V96A 1AZQA 3P7JA 1LT5D 5NUCA 1QNUA 1EY6A 3J7AV 1WVLA 2CW0C 1FR3A 3VYSA 4GZYC 2XVSA 5M5WB 1DONA 1SXTA 1EYDA 2D62A 4DA2A 3K5NA 2XWBB 5EBDA 1G8ZD 3R8BA 5DM63 4KY5A 3NPPA 1MSHA 1A15A 5CV7A 3W3AA 4RFBA 4DNTB 4PQXA 2XWJB 1TY0A 3V2TA 2F0SA 3MFGA 3UI2A 3IAYA 1VF7A 1F2YA 2H1EA 3RZDB 4ULLA 1Q1BA 4CKCA 4A3KB 4XYQA 2LY7A 2I07B 4HMIA 2F0DA 1YNJD 5JAVA 1KABA 5A35A 1JCKB 4CJ1B 3CRLC 3BS1A 3CRKC 4J1MA 1EIHA 1BNZA 2NTSA 2A73B 4K14A 2PYKA 1WTWA 1ML0D 4KY7A 2F0PA 4K8JA 1X32A 2RDHA 1ILQA 3Q0AA 3I4NB 2HCCA 1SYDA 3SHLA 1B9MA 5IIFA 5KNCA 5C6AA 5FLXL 2F0WA 2JSOA 1L0XB 1KLGD 4ODGA 2A6EC 3HOWB 1HPCA 4IUNA 1E2VA 4C1NK 2MP1A 3H3VC 2AQ2B 2OF1A 3FRPB 1XX8A 1XYIA 4DK1A 3DMUA 3S14B 2B2YA 2J4XA 3M7NA 1V43A 1WTQA 2B2TA 2A6HC 4PMCA 1JWSD 5JEAH 1Y1VB 2F0VA 4IFDH 2EY2A 1KDCA 2BE5D 1KAAA 3SXHA 4A3DB 1JICA 1CI3M 4O1NA 4FYDA 1K83B 1CQVA 2R3ZA 2TMPA 1D2BA 4K8IA 2L12A 2R7ZB 3A8JE 3BDOA 2K04A 2K6AA 2PZTA 4MIUA 1FYCA 3GTOB 4FVMA 3NTIA 5M5XB 4FF3A 1WCMB 3GTQB 1TWFB 3GTJB 2K5DA 1HQMC 3VYTA 4BS9A 2EJGC 4KKSA 2BDNA 1I4GA 1E2WA 2KECA 4G7OC 3ZYYX 4XQJA 1SAPA 5ELDA 1G291 1EU4A 5BN5A 4G57A 1YNND 1ENCA 4HSPA 4DAPA 5J1ZA 4Q0FA 1ESFA 2K5WA 2KCNA 5E4WC 1RF2D 4CHTB 2F0TA 1UNSA 3D3RA 1I4QA 3DWQA 2VUMB 5CV9A 1PZJD 2KHSA 1GHKA 2CW0D 3E5SA 2F0FA 1O7YA 3WOFA 1EYCA 5E1FA 3PUVA 4H0LC 3PO3B 1STGA 5DEHA 4MN3A 3OSOA 2F0IA 4ZLTF 1SYGA 3HOZB 1DXMA 1HA5A 2NN6G 1QE6A 4ZQ3A 4ZK9B 2WACA 4UDUC 4DK0A 2QEJC 4PNYA 4PV1C 5EKLA 1S5FD 1ILPA 1CQFA 4RGMA 1KNEA 3BDCA 4M1UB 2EDGA 3NBIA 4C3HG 4K2KA 1ZEQX 1SYBA 2KVMA 1GOZA 3VR4A 2JYOA 1HUNA 1LO5D 1PTOB 4WRDA 3HOYB 5G3LD 4JK1C 1I6VC 2DNCA 4RHRA 4BBRB 4HMJA 1I4XA 2X69A 2D5DA 3L9AX 4C3JG 2EE1A 4IUPA 1SE3A 1G2SA 1HXYD 2TSSA 1R9TB 2BOSA 4C1NI 5ELCA 1WD0A 4EQNA 3HEJA 4RCOA 3OPOA 1TT2A 4C2MB 1SYFA 2MUYA 3NK9A 1WTPA 1ONLA 1A2UA 1TS5A 5M9OA 1DYQA 2O5JC 3GTPB 3T13A 2A6HD 1WTVA 2JEBI 3HOUB 1SBBB 4X3UA 1IW7C 2BA0A 1RODA 5CV6A 2M2LA 3KF8A 3MTSA 4V190 5ELBA 3IKJA 2K7VA 2JEAI 1D5MC 3PIO3 3N52A 2EVBA 2E2HB 2EYLA 1BBXC 3PUYA 4KMUC 1OXSC 3A8KE 1VF5C 3A55A 1HRJA 3Q23A 3P1HA 5FO8B 1VMPA 3EQLC 2NZ1D 2A68D 3LWEA 3I72A 1RDPD 2QKIC 3VYUA 1JC7A 4IFDI 1GUTA 4S3SA 3T51B 3NWTA 4DXFA 1YNJC 1BCPB 3TN2A 2Q8RE 4ABNA 1JORA 4ILWA 1TWHB 1SJHD 1SNDA 3GV6A 2Z1CA 4X3KA 1OXVA 1ZYRD 3TP8A 2IT1A 1DD2A 3HGBA 1PRTD 3GTLB 1F77A 2JP1A 2NVTB 5CV5A 1D6EC 3MVVA 2NVXB 2JE6I 1QG7A 4R8NA 2WIIB 1B4OA 2EYOA 5M3FB 1STBA 3A7AB 3HP3A 5CC4A 3P20A 4KY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IOC A;  4B9X A;  5DEH A;  3OSO A;  3D8G A;  5K5P A;  2F0I A;  2SOB A;  3PMF A;  3EJI A;  1SYG A;  4KY5 A;  2EYH A;  2F0V A;  4OL7 A;  4H7B A;  4EQO A;  5IOD A;  4RKL A;  1SNC A;  2EY2 A;  5I6Y A;  5KYL A;  5CV7 A;  1KDC A;  5KGU A;  4ZQ3 A;  2OXP A;  1KAA A;  2F0E A;  4PMB A;  3SXH A;  2WAC A;  4K2L A;  1EY9 A;  5IGB A;  1RKN A;  3P75 A;  4KJN A;  3V2T A;  4K5W A;  2F0S A;  1F2M A;  4EQP A;  1STA A;  3T16 A;  5C4Z A;  3LX0 A;  3SR1 A;  3D6C A;  4PNY A;  1F2Y A;  4NMZ A;  3NQT A;  5EKL A;  5IGD A;  2RDF A;  4NDX A;  2QDB A;  5CR3 A;  5J39 A;  4TRD A;  2EYL A;  3MEH A;  1A3T A;  3C1F A;  4QB4 A;  3MZ5 A;  4K8I A;  3D4W A;  5CV8 A;  2F0H A;  1EY5 A;  5DAU A;  2F0Q A;  2F0D A;  4HMI A;  3BDC A;  3NHH A;  4ZUI A;  4ZUJ A;  1EZ8 A;  5IGC A;  5KRU A;  2PZT A;  3BDL A;  3H6M A;  4ME5 A;  1EQV A;  2LKV A;  5JAV A;  4MIU A;  1KAB A;  1NSN S;  1JOK A;  3P1H A;  5I9O A;  5IGE A;  1KDB A;  5EKK A;  3R3O A;  2EYM A;  3NP8 A;  4K2K A;  4QMG A;  3OMG A;  1SYB A;  4DU9 A;  4E6I A;  2PZW A;  5I6W A;  4J1M A;  2RKS A;  4I65 A;  5CC4 A;  5E3F A;  2EYP A;  4J6H A;  2F0G A;  4NP5 A;  2PZU A;  3S9W A;  4WRD A;  5C5L A;  4F7X A;  1EYA A;  4IAL A;  1AEX A;  1SNM A;  4K14 A;  4DF7 A;  5C4H A;  4HMJ A;  3ERO A;  5KIX A;  3NXW A;  2PYK A;  2SNM A;  2HQE A;  2F0O A;  3NUC A;  4KY7 A;  1TR5 A;  2F0P A;  4K8J A;  3OWF A;  2PW7 A;  4KD3 A;  3EVQ A;  5C5M A;  1JOQ A;  3QOL A;  1EY7 A;  1ENA A;  4ID6 A;  4S3S A;  5F2D A;  1STH A;  4KTA A;  4HTH A;  1JOO A;  4F8M A;  1STY A;  2EXZ A;  2EY1 A;  4K5X A;  2F0N A;  1SYD A;  2O4X A;  2F0J A;  1KDA A;  4KV6 A;  3TME A;  1SNO A;  3SHL A;  3QB3 A;  3SK6 A;  2PQE A;  1STN A;  4G57 A;  5IIF A;  4IZ8 A;  1ENC A;  4KD4 A;  1IHZ A;  5C6A A;  4DGZ A;  5J1Z A;  1JOR A;  2F0W A;  1EZ6 A;  4RKB A;  5EGT A;  3VA5 A;  5HUR A;  1SYE A;  5J22 A;  5KYI A;  5IGF A;  1A2T A;  3U9O A;  5ISR A;  5HGT A;  3C1E A;  1NUC A;  2EY5 A;  4ODG A;  1SND A;  4K5V A;  4N9P A;  5KEE A;  2F0U A;  2F0K A;  3ERQ A;  3SK8 A;  5I9P A;  1F2Z A;  4LAA A;  1SYC A;  3DHQ A;  4IUN A;  5CGK A;  4N9T A;  5JOB A;  5IGG A;  4WOR A;  2F0T A;  3MHB A;  3OMC A;  2F0M A;  2F3V A;  2OF1 A;  2PW5 A;  3HEJ A;  3ITP A;  4KHV A;  1SNP A;  2F3W A;  2OEO A;  5NUC A;  3TP8 A;  1TT2 A;  4DFA A;  2ENB A;  4KJO A;  5CV9 A;  1SYF A;  4K6D A;  3MXP A;  3D4D A;  5CV5 A;  1EY6 A;  3QOJ A;  3TP6 A;  3MVV A;  3SK5 A;  2KHS A;  1SNQ A;  2NUC A;  3RUZ A;  2M00 A;  3NK9 A;  4B9W A;  1A2U A;  3DMU A;  1II3 A;  5M9O A;  3E5S A;  4R8N A;  2EYJ A;  2F0F A;  3SK4 A;  2F0L A;  4EVO A;  1EY4 A;  1EYC A;  5C3X A;  3T13 A;  5CV4 A;  3HZX A;  2EYO A;  2KQ3 A;  5E1F A;  1EYD A;  4PMC A;  2SNS A;  1EY8 A;  1STB A;  1EY0 A;  4NKL A;  4QF4 A;  4YIJ A;  4EQN A;  1A3V A;  1A3U A;  1STG A;  2EYF A;  1U9R A;  2RBM A;  2EY6 A;  3TP7 A;  3TP5 A;  5C3W A;  1TQO A;  5CV6 A;  4KY6 A; 
#chains in the Genus database with same CATH topology
 1PTO F;  2N88 A;  1VQA A;  2IHE A;  1IXR A;  3ZJY C;  1VQC A;  2OQ0 A;  4P2C B;  2JA8 B;  3IFT A;  3FKI B;  4APV A;  1TS3 A;  1SRU A;  4JI5 Q;  5A2Q E;  5IYD H;  2UXD Q;  4KJN A;  1PDQ A;  4O42 A;  1S40 A;  4BY7 H;  1NR2 A;  1JJC B;  4TSS A;  1SMY D;  3M85 A;  4YY3 L;  1NR4 A;  4OON A;  1HA6 A;  2JA5 G;  3CCL A;  1NCV A;  4JI6 Q;  3S2D H;  4KKU A;  4TRD A;  4HJ5 A;  3K7A B;  2ES2 A;  1S5D D;  2JQO A;  1FVI A;  5IYB G;  2ZXP A;  4A3G B;  5M3M G;  1M1K C;  1PLF A;  3NEM A;  1XMQ L;  4FXG C;  3NQI A;  4A76 A;  4J8Q A;  1DM0 B;  3DWA A;  2RCF A;  1AE2 A;  3R3O A;  2EYM A;  2IX3 A;  1TWA B;  1E22 A;  3VR6 A;  1W3S A;  5FO9 B;  4DR7 Q;  5EPJ A;  3DWP A;  4FF2 A;  2K33 A;  5T1G A;  3B6Y A;  1XXG A;  4GLV B;  3DEO A;  2JA7 B;  4IUQ A;  3PUX A;  1EYA A;  4IAL A;  1CTM A;  1TVX A;  4KKT A;  4A3I B;  1XPO A;  1YJ9 A;  2EIF A;  3FPU B;  5KND A;  4GNX A;  1ZXT A;  3VR3 A;  5C5M A;  3NSW A;  1D5Z C;  3NEL A;  3H0G G;  4C3H B;  2PMZ B;  2LS0 1;  3MXN B;  2A19 A;  2EXZ A;  3BVG A;  4DK6 C;  2Q2U A;  2WB1 E;  2VQF Q;  3VDY A;  1GUG A;  2R92 H;  4RWS C;  2PNR C;  3TRE A;  4RKB A;  4XQN A;  1SYE A;  2PNH A;  3HKZ G;  1B44 D;  2K50 A;  5ELF A;  5KNB A;  3ULP A;  5FK9 C;  4CJ0 B;  1S72 A;  2DN8 A;  2EY5 A;  3E6Z X;  4KHZ A;  5BN4 A;  1VS0 A;  1O7L A;  2LMC B;  1FNW A;  4C3J B;  4IUV A;  3HOV G;  3UDF A;  3CU7 A;  4GLX A;  4KHP Q;  2QCP X;  5IT9 L;  3HG9 A;  3JAM L;  1LTG D;  2OQK A;  1XPR A;  4QUF A;  2L9H A;  3N6R A;  3RN2 A;  1VQJ A;  1PV4 A;  3G6J B;  2RSN A;  2EJM A;  3U50 C;  4Y7N B;  3A5Z B;  1QJO A;  1Y1W B;  1A3U A;  2G9D A;  5DNF A;  1AFP A;  3M4P A;  3CCV A;  1PH5 A;  3PO3 G;  1C48 A;  4DAY B;  3X3N A;  3F2U A;  1LTA D;  1X3Q A;  2Q8I B;  3CCU A;  1HR0 Q;  4P74 A;  3J81 L;  3KFU A;  3IFD A;  3I4O A;  1C9O A;  3NWS A;  4OIK A;  2KED A;  1XJV A;  3K80 C;  4YCV A;  1BCP F;  1EIF A;  1MGS A;  3M4Y A;  2D9U A;  3LX0 A;  4LF4 L;  1HNX L;  1BBU A;  1GM5 A;  4K0K Q;  1WD1 A;  1KNA A;  3CCR A;  2B8G A;  3MZ5 A;  4HCS A;  5LMU L;  2CQO A;  1L1O C;  1X3F A;  4GOP A;  3U58 A;  1EOT A;  1NSN S;  1DCZ A;  3AU7 A;  4LNQ A;  3M3Y B;  4HED A;  3OIP A;  1N32 L;  2FMM A;  1EEF D;  5I6W A;  1CKM A;  1JWU D;  3BYT B;  4NP5 A;  2MO1 A;  2JK8 A;  5CYU A;  1K8M A;  2NYZ D;  3R2I A;  1FJG Q;  4CJ2 C;  5IP9 G;  3C3L A;  2KJX A;  2R93 B;  3EVQ A;  2Z0S A;  2NVY B;  3QOL A;  1MJC A;  1RTN A;  5FLM H;  4LF6 L;  1IYJ B;  3TQY A;  1ASZ A;  1IYV A;  3L3O C;  1LYL A;  2ID0 A;  1K3R A;  4LFB L;  5JJZ A;  2HD3 A;  4B3T L;  3C46 A;  1O80 A;  4ME3 A;  4MTK A;  3I4M G;  2Y0S G;  2YU9 B;  1MKH A;  1A2T A;  1SE8 A;  4GN5 A;  4LW1 A;  5JOB A;  1AP0 A;  1VMC A;  1TWG B;  5ELO A;  3W2D A;  3U9S A;  5C0X I;  2HHH L;  1VQ4 A;  2ENB A;  1MBY A;  4I7Z C;  2WIN B;  1C0A A;  3PIO A;  3TP6 A;  3A8I E;  1IL8 A;  2NUC A;  4B9W A;  2IJ0 A;  1Z7T A;  1KRT A;  2ICI A;  1H95 A;  1TY2 A;  2E2D C;  2KHI A;  1YVC A;  3CC7 A;  5CV4 A;  3Q8D A;  4C3I H;  1FNV A;  2R7D A;  5CBE E;  4QF4 A;  4CKE A;  3AFP A;  4X66 Q;  4A93 G;  1EQR A;  5KYI A;  3S1M B;  3EJI A;  2R61 A;  2EYH A;  2V1C C;  4BBS G;  2B2V A;  1LLR D;  5KGU A;  3A74 A;  3OW2 A;  4A3M B;  4TVA B;  1G2T A;  5GQO A;  3I4N H;  3MXN A;  1HNZ L;  3I73 A;  4R4I A;  1YIT A;  1EEI D;  3I70 A;  4XIG S;  1L0Y B;  2B2U C;  3I55 A;  1PH1 A;  4FP5 D;  2EPB A;  4MHE A;  2IPK D;  3BZD B;  2AHO B;  5E4X A;  2ZXO A;  2BA1 A;  5BR8 L;  3HOX H;  1BQQ T;  5I9O A;  5IGE A;  4U67 3;  3A56 A;  4YHH L;  2LSS A;  4DR4 L;  4QMG A;  4DU9 A;  4GKK L;  1WTX A;  1VQN A;  2H4O A;  3G4S A;  2JA5 B;  2RDG A;  1CKO A;  5E3F A;  2F0G A;  4JI1 Q;  4DR6 Q;  1BKB A;  4OO1 I;  1EWI A;  4QUC A;  2NZO A;  5IWA Q;  3S14 H;  5M3M B;  3NXW A;  4OX9 Q;  3T53 B;  1U4P A;  5I9P A;  2E2I H;  2RA4 A;  4KD3 A;  1X9N A;  4ID6 A;  1EY7 A;  3RNU A;  2B29 A;  1F2L A;  1Y1V H;  1K3B C;  1P16 A;  4DAY A;  1HR0 W;  3C2P A;  4IZ8 A;  4KD4 A;  4A3J H;  2A68 C;  4A3F G;  1TII D;  4G4K A;  3W1G A;  3J7Z C;  1B50 A;  1SFO B;  2Q8T A;  4A3D H;  1VQL A;  1CA6 A;  2D2C C;  1DOK A;  2JA6 H;  1PFN A;  1Z6H A;  3H0G B;  1F2Z A;  3T4A C;  4AH6 A;  5CGK A;  4ZRZ A;  4HCE A;  1VQ9 A;  4JI3 L;  4DV6 L;  4LFC L;  2IX1 A;  4FF1 A;  4LFA L;  3KLR A;  3J80 L;  3GTG B;  3I56 A;  3SK5 A;  2R7Z H;  1LTB D;  2F4V L;  3HKZ B;  1I4H A;  2EYJ A;  2F0L A;  4JYA L;  1CZG A;  4JW0 A;  4DFA A;  1SN8 A;  4DV7 L;  4DR1 L;  1HTL D;  3TP5 A;  4BA1 I;  1EIY B;  4EQ5 A;  1NY4 A;  4A3C H;  3HOV B;  4JG2 A;  4DUY Q;  3K57 A;  1MD2 D;  3OHX C;  4IOC A;  3GTJ H;  3T1H L;  4MZ9 A;  4PMW A;  2KOL A;  4RKL A;  3MEF A;  4L63 B;  1SSO A;  4ZYS A;  1ZYR C;  3PSI A;  2UUA Q;  3AFQ A;  3K5O A;  2F0E A;  1PRT C;  3RD4 A;  4TKO B;  3PO2 H;  1KLU D;  4JV5 L;  1P8L A;  1BUV T;  1RKN A;  5K36 H;  4DV1 L;  1PH8 A;  4RCN A;  5D3I B;  3SR1 A;  1XNQ Q;  3GD7 A;  3NQT A;  4BA2 I;  1KAW A;  5T1I A;  1VQK A;  4LF7 L;  2ZT9 C;  1FNU A;  2I5M X;  5LMN W;  1UWV A;  4A3B G;  4ZUJ A;  5GRO A;  2SEB D;  3K5M A;  4OHJ A;  2UUC Q;  4DV4 Q;  1PXU A;  2IHF A;  1KDB A;  3AQQ A;  3NP8 A;  4LF5 Q;  2GA4 B;  3OMG A;  4E6I A;  2VUM H;  3F2D A;  4J6H A;  3K8A A;  3NTH A;  5EJW A;  1SMY C;  4JI7 Q;  4Q5V A;  3FMC A;  2Z6K C;  2WAQ G;  1L0W A;  4DAV A;  3ERO A;  4JBW A;  3WWV A;  1KTK A;  2L55 A;  5C4J B;  2MJ8 A;  5F2D A;  2MPM A;  1MHW C;  1UAP A;  4L6T B;  4K5X A;  2ZTE A;  3Q24 A;  5CBA E;  3HOZ H;  4ALP A;  3S17 H;  1BR9 A;  3FVQ A;  3X3M A;  4X65 L;  1QB5 D;  4DGZ A;  1Y8N B;  2VXW A;  2AQ1 B;  4DV3 L;  4GN3 B;  1H9J A;  1QOH A;  4A3L G;  3OOC A;  3BJU A;  3JAM c;  1N34 Q;  3H09 A;  1CZW A;  2VS1 A;  3PIP 3;  1GJX A;  4DNI A;  3CXC A;  3MXP A;  2FIN B;  4X64 Q;  1SNQ A;  5JEA J;  1S4Z A;  3GTK B;  3I4M B;  1WI5 A;  2Y0S B;  3D0F A;  4FF4 A;  4IFD J;  1I94 Q;  3GP7 A;  2SNS A;  3BZC A;  5C4X G;  4NKL A;  3GTM H;  5EKI A;  3NBH B;  5COR A;  1ET9 A;  1VQP A;  4XXE A;  1Q82 C;  5C44 H;  3D8G A;  4DV0 Q;  3QJY A;  3K7U C;  2NB0 A;  1XTD A;  3HOY H;  4H7B A;  5I6Y A;  4BBR H;  3MWY W;  5FO7 B;  2Q2I A;  4DV5 L;  4BY1 H;  3ND8 A;  5FKA C;  4EGV A;  3CW2 C;  1NTG A;  3P75 A;  3DEP A;  4K5W A;  3S1R B;  3L7Z C;  1BF4 A;  1UUP A;  5C4Z A;  1B8A A;  1K8A C;  3D6C A;  4R1J A;  3STB C;  4A93 B;  2AQ3 B;  1EWH A;  2MGS A;  2OT2 A;  4IQZ A;  1IKL A;  4BBS B;  3CHB D;  1PYW D;  1R9T H;  1AZP A;  3EFX D;  3I3C A;  1CT1 D;  1EY5 A;  2N55 A;  2NVQ B;  3SE0 A;  3K0X A;  3MXU A;  3BDL A;  5M5Y H;  2Z4I A;  2DY8 A;  3A0J A;  1H9K A;  3CD6 A;  1IBK L;  2K01 A;  4C2M H;  4KLK A;  3UDX A;  2PI2 A;  4LWC A;  2WKC A;  1PHJ A;  1EIG A;  2V4D A;  4YWK A;  1JB3 A;  5JVH 3;  2J7Z A;  4DF7 A;  2SNM A;  1EL0 A;  3HOU H;  1TR5 A;  2UUB Q;  1CFM A;  2VQE L;  3RZO H;  1KD1 C;  2F1M A;  2B2Y C;  4HTH A;  5AFW A;  5C0X H;  1STY A;  2EY1 A;  5LHY 1;  3K59 A;  2B2T C;  2XSC A;  4FDB A;  3KLS X;  1HJP A;  4AQY Q;  1R4P B;  5EGT A;  2O5I C;  4RGT A;  2J0T D;  1PH6 A;  1J5E L;  2VL6 A;  3U9O A;  4RAU C;  2WKD A;  5HGT A;  4WFN 3;  1NUC A;  5EPL A;  4JI5 L;  2F0K A;  1B7Y B;  1EU3 A;  3H94 A;  1DOM A;  3S24 A;  4AIM A;  2UXD L;  1Q8I A;  3MHB A;  2E2J B;  4KHV A;  1UE5 A;  2E2H H;  1HFN A;  5FLX c;  1LTR D;  2FMC A;  4F87 A;  3D4D A;  1PYB A;  2BCO A;  3QOJ A;  4A3F B;  4JI6 L;  1U4L A;  2O2L D;  3JAM E;  3TEH B;  4QCL A;  4JOI C;  3T56 B;  4YIJ A;  2VNU D;  4LJZ C;  4GOP B;  2VB3 X;  1EWC A;  4L5R C;  5JVG 3;  1XNR Q;  1EFI D;  1YHQ A;  4XQQ A;  5IOD A;  1VQ7 A;  1CK1 A;  3PV0 A;  4X6A H;  1QZH A;  4DR7 L;  3M4O B;  3K0Y A;  3QWN A;  1GVP A;  4HID A;  5E7N A;  3J81 E;  4EQP A;  4LUZ A;  2NTT A;  3K81 C;  5JEA G;  2QDB A;  3M9B A;  4OO1 H;  2QDL A;  1ET6 A;  3MEH A;  2B3G A;  3C1F A;  3WOE A;  4IFD G;  1F9P A;  2VQF L;  1I50 B;  1O78 A;  1EZ8 A;  3HOX G;  2UXC L;  4G7H C;  1J6Q A;  1W6K A;  1XTC D;  1CKN A;  1BOS A;  1GUW A;  1B53 A;  3S2D B;  4KK7 A;  1ZKO A;  4OWT B;  4MNO A;  3GTL H;  3KK7 A;  4I65 A;  2NVT H;  2K03 A;  4KHP L;  1X56 A;  4A3B B;  3OIQ A;  3CPW A;  4L8J A;  5M3F H;  4G7Z C;  1E24 A;  2RCN A;  1V1Q A;  4NXM Q;  1BCP D;  3NBH A;  3HS0 C;  1B2T A;  2XN9 C;  2JA8 H;  1JR0 D;  2ZM6 Q;  1HCZ A;  3DUZ A;  2WAQ B;  1MSG A;  1C4Q A;  2JA6 G;  2XGT A;  1PFB A;  1E2Z A;  1W2B A;  3J80 c;  1SYC A;  3CCE A;  2K32 A;  4B08 A;  3F8T A;  3ITP A;  1H9M A;  1GUN A;  2AKW B;  3FPP A;  4K6D A;  2NN6 H;  1D8L A;  2HDL A;  3PGZ A;  3AB9 A;  2KUM A;  4AYB B;  4A3G H;  3RUZ A;  4K0K L;  1II3 A;  4RH6 A;  3CCJ A;  4NXN L;  1Z9F A;  1TWA H;  3BG3 A;  2EYF A;  2RBM A;  3A7L A;  2OWO A;  2EY6 A;  5FLX E;  5C3W A;  1O7Z A;  4Z9C B;  2XIW A;  5K5P A;  3PMF A;  2SOB A;  2JA7 H;  1JJG A;  1KXL A;  3KUP A;  1S5B D;  2FFK B;  4UY8 C;  4A3I H;  3I4L A;  3BVM A;  2OXP A;  5I2Y A;  3PO2 G;  3QIA A;  1T5X D;  1TKW B;  3D4R A;  1QUQ A;  5C4X B;  4DUZ Q;  2ZTD A;  1QVG A;  2HIX A;  2VY3 A;  2K28 A;  3STB D;  1EYG A;  1RIP A;  2PMZ E;  3MC0 B;  2RDF A;  4FO2 A;  3SEB A;  2HUG A;  1VQM A;  1A3T A;  1H9S B;  5GAH C;  4FNF A;  1Y69 U;  3NE5 B;  2VW9 A;  2YYZ A;  1E1O A;  5IGC A;  3H6M A;  1EQV A;  2CH4 A;  2LKV A;  4IN3 A;  1JOK A;  4C3J H;  5LMN L;  1B70 B;  4DKA C;  1ICW A;  2RHQ B;  2L1B A;  1Y8O B;  3FP9 A;  4F7X A;  4OWW B;  1AEX A;  3TDQ A;  4BXX H;  5C4H A;  4Y7N H;  1X6O A;  4XDX A;  1I3Q B;  2BDO A;  2N49 A;  1Y1W H;  3JAM i;  1K8O A;  1DGS A;  2B2W C;  2QIL A;  4LF8 Q;  4R8I A;  1A0I A;  1STE A;  1OO9 B;  2ZXR A;  3FHW A;  2NBF A;  2PQE A;  3TRZ A;  4X66 L;  1OXU A;  3H91 A;  2L11 A;  2F4I A;  5CMD A;  1DJR D;  3FEW X;  5ELN A;  3ULJ A;  5ISR A;  4JI0 Q;  3VR5 A;  2AWN A;  2LFN A;  4N9P A;  2L15 A;  2DUD A;  3J81 i;  5M5W H;  5A2Q L;  1PZK D;  1WTR A;  4NW2 A;  1SNP A;  1V1O A;  4QQB X;  1LT3 D;  2PO4 A;  4QIW B;  2KCM A;  3T1Y Q;  4H13 C;  5C3E G;  4HJA A;  4CGY B;  3J80 E;  1EY4 A;  2DNE A;  3UDI A;  1TXY A;  5C3X A;  5FJ8 H;  1A3V A;  1PFM A;  3TP7 A;  3TZD A;  1U0L A;  1GXD C;  2QW7 A;  4B9X A;  4DK3 C;  3KJP A;  1PH4 A;  2YTX A;  1S5C D;  5KYL A;  3RZD H;  2L0C A;  5HY6 A;  1K8G A;  3BU2 A;  4C3I B;  4A3K H;  2BH2 A;  4DR6 L;  3S1N B;  5GAD C;  2B63 G;  4IJH A;  3TBI B;  2K05 A;  2NVY H;  5IWA L;  4A75 A;  4OX9 L;  1VQI A;  3T16 A;  2K1B A;  4A3E G;  1Q7Y C;  1NAP A;  3U4V A;  1B1Z A;  5EQ0 A;  5ELE A;  4QB4 A;  1KL9 A;  2XNA C;  5CV8 A;  2Q2T A;  2YU9 H;  2F0Q A;  2K52 A;  2KEN A;  4C56 C;  3SVM A;  2E74 C;  1QWY A;  3HRZ C;  4CKB A;  2ATW A;  1HH2 P;  1OXX K;  1TWG H;  4YWL A;  4H44 C;  1PH3 A;  1SEB D;  5D65 A;  1K9M C;  1JQY D;  2PZU A;  1J9O A;  1YNX A;  4RG1 A;  1WOC A;  2VB2 X;  2RVL A;  1Y8P B;  3URY A;  3PUW A;  1N32 Q;  1JB7 A;  1GO3 E;  3DXJ C;  4L5S A;  3HFZ B;  1VQ6 A;  3HOX B;  3NUC A;  3V05 A;  1VCI A;  4JI2 Q;  3F2C A;  2KCC A;  5C0X G;  3G6E A;  1VQB A;  5EAY A;  1C7Y A;  2IL8 A;  3HOW H;  2R6G A;  3S1M H;  4DNR B;  1SNO A;  4JBM A;  1STN A;  4RGO S;  1J8I A;  2JXM B;  1F9Q A;  5IYC H;  4OIJ A;  3RLO A;  4A3M H;  2IX0 A;  2CVR A;  2E2I B;  1PTO C;  1U4R A;  5IGF A;  4JPB W;  4R9W A;  2UUA L;  4LFB Q;  2C5C A;  4B3T Q;  2CHB D;  3DHQ A;  5IGG A;  1Q12 A;  3OMC A;  3GQB A;  1AE3 A;  1Q3L A;  2OEO A;  4A3J B;  2N3S A;  2WV6 D;  3AEV A;  3J7A F;  4MTN A;  1DZ1 A;  1H9S A;  1EQT A;  2M00 A;  3R93 A;  1V8Q A;  2HHH Q;  2JA6 B;  1WTH A;  1K0R A;  2XTI A;  1GUS A;  4EVO A;  1LAB A;  3RMH A;  1G6P A;  1FL0 A;  1BDO A;  1OTC A;  4BWG B;  4DV4 L;  4DXG A;  3G71 A;  1O7I A;  3UDG A;  1Y14 B;  4LF5 L;  1L1O B;  2EOT A;  5IYB H;  2RSO A;  1E3P A;  1TU2 B;  5I2X A;  5M3M H;  4X62 Q;  1K83 H;  1HFG A;  4JI7 L;  3S2H B;  3CC2 A;  1N9W A;  3I8Z A;  3S16 B;  1W6J A;  1F2M A;  4GNX C;  3I91 A;  5AJ3 Q;  4IO9 A;  1Q90 A;  1LV9 A;  3GTO H;  3S1Q B;  3RLN A;  4OO1 G;  1PZI D;  1JMC A;  1PMR A;  4Y52 H;  4GS3 A;  5M5X H;  1WCM H;  4F88 A;  2ZJP A;  3GTQ H;  1TWF H;  3PO2 B;  4M8A A;  1I4R A;  2F03 A;  3FDT A;  3NHH A;  2NN6 I;  3H0G H;  4FXD A;  2QGQ A;  2P5Z X;  4POF A;  5IYD G;  4H02 A;  2A5H A;  3RLF A;  2PZW A;  4U68 A;  4BY7 G;  2RKS A;  1N34 L;  4LF9 Q;  1T5E A;  1K0S A;  2CWP A;  3S9W A;  3RR5 A;  4YHH Q;  5C5L A;  2PI2 E;  1ESR A;  3QO2 A;  1SNM A;  4GKK Q;  1Z47 A;  3BYY B;  3E9H A;  5JPN C;  4X64 L;  3HKZ E;  1JE4 A;  3J80 i;  1PFS A;  4EX5 A;  1LTT D;  3HOV H;  3VA7 A;  4WJ4 A;  1F9R A;  3ULL A;  3R2T A;  1CHP D;  4KV6 A;  1QIL A;  1D1K A;  1IHZ A;  3LNN A;  4B3M Q;  4ZAI A;  2CQA A;  4DV0 L;  4X3S A;  1FD7 D;  4OEM B;  1CA5 A;  3C1E A;  3K6O A;  5KEE A;  3S15 B;  4WJ3 M;  3O13 A;  2B8F A;  4L5Q A;  1YIJ A;  2IWH A;  4N8F A;  2RHS B;  3VR2 A;  3L2P A;  3S17 B;  3W1B A;  1LT6 D;  1HZB A;  2F0M A;  3PO3 H;  1WTO A;  1LTS D;  2CKZ B;  1VQO A;  1E0B A;  4KJO A;  1AW7 A;  1GUO A;  4POG A;  1BCP C;  3I90 A;  3NTK A;  5JJI A;  4JI3 Q;  4DV6 Q;  2R92 G;  1V1P B;  3ERS X;  2Z8L A;  3DM1 A;  1I6H B;  2EJF C;  3KBX A;  4AYB G;  1Q8K A;  4V0B A;  4UP8 A;  3VA5 A;  1CM9 A;  2L4N A;  1TQO A;  3KJO A;  5IT9 c;  1CKN B;  4DV7 Q;  2ZJQ A;  2XRS D;  5C3E B;  4IUT A;  2FXQ A;  1QNK A;  4XT3 B;  4JI8 Q;  3UE1 A;  3HKS A;  2QF7 A;  3T1H Q;  2NWG A;  5IGB A;  4DR2 Q;  3GTM B;  2LXJ A;  1TS2 A;  1B3A A;  2IW3 A;  1M8A A;  5C44 B;  2A74 C;  4PZ8 A;  1D5X C;  2UUB L;  5IGD A;  4JV5 Q;  4NDX A;  4O2D A;  5J39 A;  3J81 c;  4HJ9 A;  1LAC A;  1VQG A;  1PH9 A;  3GV3 A;  5IP9 H;  1GHJ A;  4BY1 B;  1G91 A;  3MXG A;  1V9P A;  3D4W A;  2C9O A;  1PTO H;  2F0H A;  4AQY L;  1A6X A;  1IBL L;  2B63 B;  2E76 C;  4LF7 Q;  2YTY A;  4B3R L;  4ME5 A;  3TZU A;  4JBJ A;  1SRO A;  3IL8 A;  4HIK A;  5D14 A;  2K5Q A;  4A3E B;  5DLQ E;  2N78 A;  1X3G A;  3D31 A;  5J3B A;  1VQH A;  1JWM D;  5LL6 S;  1CSP A;  1HTP A;  3J7Y W;  3EBE A;  2FJ2 A;  1IZ6 A;  3GTK H;  3I4M H;  1YBY A;  2A6E D;  1HUM A;  3E0E A;  1IBM L;  4HAE A;  1OXT A;  5M5Y B;  1HNW Q;  1TWC B;  2Y0S E;  1UE6 A;  1JOQ A;  3OWF A;  2K5V A;  1ENA A;  4HSV A;  1GKH A;  1M4V A;  3D6W A;  3LWU A;  2E5L Q;  3TME A;  2O4X A;  4KI0 A;  4HN7 A;  3QB3 A;  1EUJ A;  2CFM A;  1L1O A;  4PG3 A;  5DM7 3;  1XNR L;  2B2W A;  5FOB B;  2QA4 A;  1CHQ D;  2GVA A;  1PTO D;  3ND9 A;  4HR7 B;  2B2V C;  2A69 C;  4IUU A;  3RZO B;  4DR5 Q;  2Z6B A;  3S1R H;  2AWO A;  4P73 A;  1X54 A;  4LAA A;  3GTP H;  4A93 H;  1JT8 A;  4O0A A;  2F3V A;  2PW5 A;  1QUQ B;  1RJT A;  4OWX B;  2X6G A;  3UE0 A;  5FLM G;  3Q22 A;  4BBS H;  2EZV A;  1B9N A;  1PRT B;  3KLS A;  1SMX A;  4CBV A;  4X3T A;  2NVQ H;  3CQZ B;  4JI4 Q;  1KC8 C;  3BVZ A;  3A54 A;  3Q6S A;  3DLL A;  1EY8 A;  2L5T A;  2ICE C;  1IKM A;  4P71 A;  3TSS A;  1KQS A;  1X55 A;  1NJI C;  3I7F A;  3MFY A;  4WJW A;  2B39 A;  2K5N A;  2PPB C;  2MQH A;  1SE2 A;  3SDZ A;  4OL7 A;  5G3L F;  2MHV A;  3KDF B;  1SNC A;  2UU9 Q;  2AUK A;  4A3K G;  2PCF B;  4PZ6 A;  3E3X A;  5JPM C;  3ONA B;  2E8G A;  4FXK C;  4LMQ D;  3K58 A;  2WP8 J;  3BZK A;  4PZ7 A;  4K2L A;  1EY9 A;  3E0J A;  5IT9 E;  1U4M A;  1YHB A;  3J7A 5;  4J15 A;  1STA A;  4OGQ C;  4C3I G;  3GDE A;  4DV5 Q;  4NMZ A;  1RHP A;  1A8V A;  4IUR A;  4K6L A;  4NXM L;  4HIO A;  2KEE A;  4TQU S;  3G48 A;  1YJN A;  5DAU A;  4ZUI A;  3VYR A;  4DV2 Q;  3M7G A;  1E1T A;  2ZM6 L;  5KRU A;  2E75 C;  2UXB Q;  3AMU A;  1Q86 C;  1UEA B;  4R4Q A;  5EKK A;  1VQ5 A;  2E2J H;  4B3S Q;  4XYO A;  3I4N G;  4LUO A;  4A3F H;  1PH7 A;  1B3Q A;  1IBK Q;  3MAQ A;  5KIX A;  1V1P A;  1XMO Q;  1WJJ A;  2HQE A;  4DN4 M;  3PF5 A;  2I46 A;  3RN5 A;  1TWH H;  3OTO Q;  3U4Z A;  3HOW G;  4GKJ Q;  1STH A;  1XWE A;  2B2U A;  2I5L X;  1JOO A;  4BY7 B;  2F0N A;  2F0J A;  1KDA A;  3CF5 A;  4UP7 A;  5TSS A;  3SK6 A;  1EQQ A;  1K73 C;  3M4O H;  1RTO A;  2X6L A;  5BN3 A;  4CDF C;  1D1I A;  2DJG C;  2AUJ D;  1QCB D;  3WDN A;  1EZ6 A;  1R4Q B;  5HUR A;  1YEZ A;  2KA7 A;  5J22 A;  2NVX H;  1N33 Q;  3GO5 A;  2F0U A;  3SK8 A;  3ERQ A;  2YV5 A;  1HQR D;  2SDF A;  4OEL B;  1L2F A;  2HT1 A;  1S5E D;  2M9V A;  4WOR A;  3EIV A;  5I4D A;  4DUZ L;  1AN8 A;  3OW7 A;  1J5E Q;  4XTC S;  1SDF A;  3OWE B;  2F3W A;  1Y1V G;  2G9H D;  3K5L A;  1I50 H;  1RCV D;  3QG1 A;  4A3J G;  1N8R C;  3SK4 A;  3FKI H;  3HZX A;  2KQ3 A;  4QY7 A;  4A3D G;  1ENF A;  2KBN A;  1EY0 A;  3KF6 B;  3KBG A;  1KHI A;  1U9R A;  5LL6 X;  2FHT A;  1HR0 L;  2WB1 B;  5IOC A;  2HCI A;  2Z4H A;  1T9H A;  1F9S A;  5D3D A;  1N36 Q;  1LT4 D;  4EQO A;  3EA6 A;  4A3B H;  4RA8 A;  2WFW A;  4KN7 C;  2R92 B;  4LK1 C;  2BE5 C;  4PMB A;  4DR3 Q;  3K7A H;  2R7Z G;  1H9R A;  1MI2 A;  1IYU A;  1Q1E A;  1VDZ A;  3CKI B;  1G6Z A;  1C8C A;  1TS4 A;  4A3C G;  4RGN A;  3CPF A;  1WCM G;  4LF8 L;  5CR3 A;  3MA2 B;  5EBC A;  4JCV E;  4ZKC B;  3I2Z A;  2OCE A;  2WAQ E;  1RD9 D;  1HHV A;  3CME A;  4CDC C;  4JI0 L;  1FJG L;  5K36 G;  1LTI D;  1FGB D;  1PRT F;  1X3P A;  4C3H H;  2UXC Q;  1BO0 A;  2EYP A;  4KN4 C;  5C0X J;  2K14 A;  4ZKB B;  1K28 A;  4A3L H;  5GAE C;  2YTV A;  4R4C A;  4AYB E;  3T1Y L;  1AH9 A;  1I4P A;  2DGY A;  2F0O A;  4DAM A;  3F2B A;  2PW7 A;  2DY7 A;  2BH8 A;  2RQX A;  4YY3 Q;  3M4Q A;  1X3E A;  3PCO B;  4KTA A;  1DOL A;  3QR8 A;  4F8M A;  5EPK A;  3H3V I;  3NEN A;  2ASB A;  3KDF A;  2VUM G;  1SJE D;  4NB3 A;  5COY A;  1YNN C;  1XMQ Q;  4P75 A;  1SE4 A;  1IW7 D;  4UAI A;  2XRQ D;  3PIP A;  2A69 D;  3G7L A;  2JA9 A;  5C4X H;  1BXT A;  4RHS A;  3IRB A;  4K5V A;  2R7F A;  2HDM A;  4XT1 B;  3PUZ A;  4N9T A;  3V96 A;  1BBW A;  3SGI A;  1AZQ A;  3P7J A;  1VQ8 A;  1LT5 D;  5NUC A;  2Z6K A;  4ZCK A;  1QNU A;  1SLJ A;  3HOZ G;  1EY6 A;  2EXD A;  3J7A V;  1WVL A;  1A63 A;  2CW0 C;  1JJ2 A;  1QZG A;  4UPA A;  1FR3 A;  3VYS A;  4GZY C;  2XVS A;  5M5W B;  1DON A;  1SXT A;  1EYD A;  2D62 A;  4DA2 A;  3K5N A;  2XWB B;  5EBD A;  1G8Z D;  3R8B A;  5DM6 3;  3F1Z A;  3AYH B;  1G51 A;  4NXN Q;  4KY5 A;  3NPP A;  1MSH A;  3DM3 A;  1A15 A;  4IPH A;  4YCW A;  5CV7 A;  3W3A A;  1JE5 A;  1I3Q H;  4RFB A;  4DNT B;  4PQX A;  2XWJ B;  1TY0 A;  3V2T A;  2F0S A;  3MFG A;  3UI2 A;  3IAY A;  1VF7 A;  4JI2 L;  1KRS A;  1F2Y A;  2H1E A;  3M3Y H;  3RZD B;  4ULL A;  1Q1B A;  3L0O A;  5C44 G;  4CKC A;  4A3K B;  4XYQ A;  2LY7 A;  1ASY A;  3HOY G;  2I07 B;  4HMI A;  2F0D A;  4BBR G;  1YNJ D;  5GAG C;  5JAV A;  1QVF A;  4BY1 G;  1KAB A;  5A35 A;  4JI1 L;  1JCK B;  2R93 H;  4CJ1 B;  3CRL C;  2ZTC A;  3BS1 A;  3CRK C;  2JJQ A;  1VQD A;  4J1M A;  2I5H A;  1YHA A;  2Q2H A;  1EIH A;  1BNZ A;  2NTS A;  2G5D A;  3E9I A;  5LMN Q;  5IP7 H;  5H1S E;  4QIW E;  2A73 B;  4K14 A;  1S3O A;  1PYS B;  2PYK A;  2I0Q A;  1WTW A;  1ML0 D;  4KY7 A;  2F0P A;  4K8J A;  1X32 A;  3KF6 A;  2RDH A;  1ILQ A;  4IPC A;  4JVZ A;  3Q0A A;  1HNX Q;  1NBW A;  4LUV A;  4LF4 Q;  3I4N B;  2HCC A;  1SYD A;  2F52 A;  3SHL A;  5LMU Q;  4I7A A;  2LXK A;  1B9M A;  5IIF A;  2IY5 B;  4R4T A;  5KNC A;  5C6A A;  5FLX L;  1Q46 A;  4CDE C;  3S1N H;  2F0W A;  2JSO A;  1HZC A;  2H5X A;  4X62 L;  1L0X B;  1KLG D;  4ODG A;  2K5H A;  2A6E C;  3HOW B;  1HPC A;  3HOU G;  4IUN A;  1E2V A;  4C1N K;  2OTL A;  2MP1 A;  3H3V C;  2AQ2 B;  2OF1 A;  4IPD A;  1NE3 A;  3FRP B;  1XX8 A;  5AJ3 L;  1XYI A;  4IOA A;  4DK1 A;  3DMU A;  3J81 j;  3S14 B;  2B2Y A;  2J4X A;  4YCU A;  3M7N A;  4DUY L;  1V43 A;  1WTQ A;  4N8X 1;  4LF6 Q;  3PF4 A;  2B2T A;  2A6H C;  4PMC A;  1JWS D;  1YZ6 A;  5JEA H;  1WFQ A;  4JBK A;  1Y1V B;  2F0V A;  3EN2 A;  4IFD H;  2EY2 A;  4LF9 L;  1KDC A;  2BE5 D;  4UHV A;  1KAA A;  3TS0 A;  1XNQ L;  2EQS A;  3CAM A;  3SXH A;  2OTJ A;  4HJ7 A;  4A3D B;  1JIC A;  1MIU A;  3OYY A;  4QJF A;  2KHJ A;  1QVC A;  1CI3 M;  1RL2 A;  2UUC L;  4O1N A;  4FYD A;  1K83 B;  2JA5 H;  1CQV A;  1LTL A;  2R3Z A;  1YJW A;  2TMP A;  1D2B A;  1U5K A;  4K8I A;  4JOI A;  2L12 A;  4NPS A;  2R7Z B;  3A8J E;  3BDO A;  4B3M L;  1X65 A;  2K04 A;  2K6A A;  2PZT A;  1IL2 A;  4MIU A;  1FYC A;  2PQA B;  3KYH C;  3GTO B;  4FVM A;  3KF8 B;  3NTI A;  5M5X B;  4FF3 A;  1WCM B;  3GTQ B;  1TWF B;  2JN4 A;  3GTJ B;  2K5D A;  1HQM C;  3VYT A;  3CCM A;  4BS9 A;  2EJG C;  2K75 A;  4KKS A;  2N8N A;  1HNZ Q;  1BVS A;  2BDN A;  1NMF A;  1I4G A;  1E2W A;  2KEC A;  1SFO H;  4G7O C;  3ZYY X;  4XQJ A;  1SAP A;  1HZ9 A;  5ELD A;  1G29 1;  1EU4 A;  3CP0 A;  5BN5 A;  1ICF B;  2QEX A;  4G57 A;  1YNN D;  1ENC A;  4HSP A;  4DAP A;  1CSQ A;  2MNA A;  5J1Z A;  1LM0 A;  4Q0F A;  1ESF A;  5BR8 Q;  3CMA A;  2K5W A;  3GTG H;  2KCN A;  3S2H H;  4JI8 L;  3S16 H;  4DR4 Q;  5E4W C;  5M3F G;  1RF2 D;  4CHT B;  2F0T A;  4DR2 L;  3S1Q H;  1UNS A;  3D3R A;  1I4Q A;  2HIV A;  3DWQ A;  1SR3 A;  2VUM B;  5CV9 A;  1PZJ D;  1I94 L;  2D0P A;  1HZA A;  2KHS A;  1NNX A;  2MO0 A;  1XPU A;  2JA8 G;  1GHK A;  3FKI G;  2CW0 D;  1I5F A;  3E5S A;  2F0F A;  1O7Y A;  2MFI A;  3WOF A;  1EYC A;  1Q81 C;  5E1F A;  3PUV A;  4H0L C;  3PO3 B;  1STG A;  4YWM A;  2CH4 W;  5DEH A;  4MN3 A;  3OSO A;  2F0I A;  4ZLT F;  1SYG A;  3HOZ B;  1DXM A;  1HA5 A;  3KOJ A;  2NN6 G;  2WB1 G;  1QE6 A;  4ZQ3 A;  4ZK9 B;  4A3G G;  2WAC A;  2K4K A;  4UDU C;  4DK0 A;  2QEJ C;  4LFC Q;  2A8V A;  4R4O A;  1HNW L;  4PNY A;  4QL5 A;  4PV1 C;  4LFA Q;  1YI2 A;  3CC4 A;  5EKL A;  2VZA A;  4GOP C;  2E5L L;  1S5F D;  1ILP A;  2F4V Q;  1CQF A;  2JA7 G;  4RGM A;  4JYA Q;  4OXP A;  2HQL A;  4A4I A;  4A3I G;  4DR1 Q;  1KNE A;  3BDC A;  3S15 H;  1UEB A;  4M1U B;  2ALY B;  2EDG A;  2GN5 A;  3NBI A;  1M90 C;  5C4J H;  1VQE A;  4C3H G;  3A5U A;  4DR5 L;  4K2K A;  3KLW A;  1ZEQ X;  3H3V H;  1SYB A;  2A1A A;  2KVM A;  1GOZ A;  3VR4 A;  2JYO A;  5JJK A;  1HUN A;  1LO5 D;  1PTO B;  4WRD A;  4P72 A;  1NMG A;  3HOY B;  5G3L D;  4JK1 C;  1I6V C;  2DNC A;  1E7Z A;  4RHR A;  4RMF A;  4BBR B;  4HMJ A;  4DV1 Q;  1I4X A;  1I6H H;  4JC0 A;  2CCZ A;  5HGQ A;  2X69 A;  3ICE A;  4JI4 L;  2D5D A;  3L9A X;  4C3J G;  1EOV A;  2EE1 A;  4HIM A;  4IUP A;  1SE3 A;  5C3E H;  1G2S A;  4GLA C;  1HXY D;  2TSS A;  3CCQ A;  1R9T B;  2UU9 L;  4BXX G;  1EFW A;  2BOS A;  2KCT A;  4C1N I;  4DPG A;  1Y1W G;  5ELC A;  4GN4 B;  1WD0 A;  4EQN A;  3HEJ A;  4RCO A;  3OPO A;  4QGU A;  1D7Q A;  1TT2 A;  4C2M B;  5IY0 A;  1SYF A;  2MUY A;  1LUZ A;  3NK9 A;  1WTP A;  1ONL A;  1A2U A;  3PQI A;  1TS5 A;  5M9O A;  1DYQ A;  2B63 H;  2O5J C;  3GTP B;  4GNX B;  5JJL A;  3T13 A;  2A6H D;  2CWA A;  1WTV A;  2JEB I;  2PQA A;  4L5T A;  3HOU B;  1SBB B;  4X3U A;  4DV2 L;  1IW7 C;  3TS2 A;  1UE1 A;  4A3E H;  2BA0 A;  1ROD A;  4X65 Q;  2UXB L;  5CV6 A;  2M2L A;  3KF8 A;  3MTS A;  4B3S L;  4V19 0;  5ELB A;  4DV3 Q;  3IKJ A;  2K7V A;  1TWC H;  2F3I A;  2JEA I;  3H15 A;  4IJL A;  1CUK A;  2GVB A;  1XMO L;  1D5M C;  4IPG A;  5FJ8 G;  3JC6 6;  1PA6 A;  3PIO 3;  3OTO L;  4GKJ L;  3N52 A;  2EVB A;  2E2H B;  1PH2 A;  5IE8 A;  1PVO A;  2EYL A;  1BBX C;  3PUY A;  4KMU C;  2Z9H A;  1OXS C;  3A8K E;  1VF5 C;  4HJ8 A;  3A55 A;  1HRJ A;  3Q23 A;  2R93 G;  1KIX A;  3P1H A;  5FO8 B;  1VMP A;  3EQL C;  1N33 L;  2NZ1 D;  1IBL Q;  5L37 A;  2A68 D;  3LWE A;  4B3R Q;  3I72 A;  5IP7 G;  1MJE A;  2D0O A;  2ZJR A;  1RDP D;  2QKI C;  3CQZ H;  1WYD A;  3VYU A;  1JC7 A;  4IFD I;  3LGJ A;  1GUT A;  3CCS A;  4S3S A;  1IBM Q;  3T51 B;  3NWT A;  4DXF A;  1YNJ C;  1BCP B;  3TN2 A;  2Q8R E;  4ABN A;  4CDD C;  3ER0 A;  1VQF A;  2NZH A;  1N36 L;  1JOR A;  2C35 B;  4ILW A;  4UP9 A;  1A62 A;  1TWH B;  1SJH D;  1SND A;  2AMC B;  4DR3 L;  3GV6 A;  2Z1C A;  4X3K A;  1OXV A;  1ZYR D;  2DJF C;  3TP8 A;  2IT1 A;  1DD2 A;  2RF4 A;  3HGB A;  1PRT D;  3GTL B;  1F77 A;  2JP1 A;  2NVT B;  5CV5 A;  1D6E C;  3W5O A;  3MVV A;  2NVX B;  2JE6 I;  5IYC G;  2VQE Q;  1QG7 A;  4R8N A;  4A3M G;  1GD7 A;  1FGU A;  2WII B;  1B4O A;  2EYO A;  5M3F B;  1STB A;  3A7A B;  3HP3 A;  5CC4 A;  1UE7 A;  3P20 A;  4KY6 A; 
#chains in the Genus database with same CATH homology
 1PTO F;  2N88 A;  4P2C B;  2JA8 B;  3IFT A;  3FKI B;  1TS3 A;  5A2Q E;  4KJN A;  1PDQ A;  4O42 A;  1NR2 A;  4TSS A;  1SMY D;  3M85 A;  1NR4 A;  1HA6 A;  1NCV A;  4KKU A;  4TRD A;  3K7A B;  1S5D D;  2ZXP A;  4A3G B;  1PLF A;  4FXG C;  3NQI A;  4J8Q A;  1DM0 B;  3DWA A;  3R3O A;  2EYM A;  2IX3 A;  1TWA B;  3VR6 A;  5FO9 B;  5EPJ A;  3DWP A;  4FF2 A;  2K33 A;  5T1G A;  1XXG A;  3DEO A;  2JA7 B;  4IUQ A;  3PUX A;  1EYA A;  4IAL A;  1CTM A;  1TVX A;  4KKT A;  4A3I B;  3FPU B;  5KND A;  1ZXT A;  3VR3 A;  5C5M A;  3NSW A;  1D5Z C;  4C3H B;  2PMZ B;  2LS0 1;  2EXZ A;  3BVG A;  1GUG A;  4RWS C;  2PNR C;  4RKB A;  4XQN A;  1SYE A;  1B44 D;  5ELF A;  5KNB A;  5FK9 C;  4CJ0 B;  2DN8 A;  2EY5 A;  3E6Z X;  4KHZ A;  5BN4 A;  1O7L A;  2LMC B;  1FNW A;  4C3J B;  4IUV A;  3CU7 A;  2QCP X;  5IT9 L;  3HG9 A;  3JAM L;  1LTG D;  4QUF A;  2L9H A;  3N6R A;  3G6J B;  2RSN A;  2EJM A;  4Y7N B;  1QJO A;  1Y1W B;  1A3U A;  2G9D A;  5DNF A;  1AFP A;  1C48 A;  3X3N A;  3F2U A;  1LTA D;  1X3Q A;  2Q8I B;  3J81 L;  3IFD A;  3NWS A;  4OIK A;  2KED A;  1BCP F;  1MGS A;  3M4Y A;  2D9U A;  3LX0 A;  1WD1 A;  1KNA A;  2B8G A;  3MZ5 A;  4HCS A;  1EOT A;  1NSN S;  1DCZ A;  3AU7 A;  3M3Y B;  4HED A;  3OIP A;  2FMM A;  1EEF D;  5I6W A;  1JWU D;  3BYT B;  4NP5 A;  5CYU A;  1K8M A;  2NYZ D;  3R2I A;  4CJ2 C;  3C3L A;  2KJX A;  2R93 B;  3EVQ A;  3QOL A;  2NVY B;  1RTN A;  1IYV A;  3L3O C;  2ID0 A;  5JJZ A;  3C46 A;  1O80 A;  2YU9 B;  1A2T A;  5JOB A;  1AP0 A;  1VMC A;  1TWG B;  3W2D A;  3U9S A;  5C0X I;  2ENB A;  1MBY A;  4I7Z C;  2WIN B;  3TP6 A;  3A8I E;  1IL8 A;  2NUC A;  4B9W A;  2IJ0 A;  1Z7T A;  2ICI A;  1TY2 A;  2E2D C;  5CV4 A;  5CBE E;  1FNV A;  4QF4 A;  4CKE A;  5KYI A;  3S1M B;  3EJI A;  2R61 A;  2EYH A;  2B2V A;  1LLR D;  5KGU A;  4A3M B;  1G2T A;  3MXN A;  3I73 A;  1EEI D;  3I70 A;  4XIG S;  1L0Y B;  2B2U C;  4FP5 D;  2EPB A;  4MHE A;  2IPK D;  3BZD B;  5E4X A;  2ZXO A;  2BA1 A;  1BQQ T;  5I9O A;  5IGE A;  4U67 3;  3A56 A;  4QMG A;  4DU9 A;  1WTX A;  2H4O A;  2JA5 B;  2RDG A;  5E3F A;  2F0G A;  4OO1 I;  4QUC A;  5M3M B;  3NXW A;  3T53 B;  1U4P A;  5I9P A;  2RA4 A;  4KD3 A;  4ID6 A;  1EY7 A;  1F2L A;  4DAY A;  3C2P A;  4IZ8 A;  4KD4 A;  2A68 C;  1TII D;  4G4K A;  1B50 A;  1SFO B;  2Q8T A;  1CA6 A;  2D2C C;  1DOK A;  1PFN A;  1Z6H A;  3H0G B;  1F2Z A;  3T4A C;  5CGK A;  4ZRZ A;  4HCE A;  2IX1 A;  4FF1 A;  3KLR A;  3J80 L;  3GTG B;  3SK5 A;  1LTB D;  3HKZ B;  1I4H A;  2EYJ A;  2F0L A;  1CZG A;  4DFA A;  1HTL D;  3TP5 A;  4BA1 I;  3HOV B;  3K57 A;  1MD2 D;  3OHX C;  4PMW A;  2KOL A;  4RKL A;  4L63 B;  1SSO A;  4ZYS A;  1ZYR C;  3K5O A;  2F0E A;  1PRT C;  3RD4 A;  4TKO B;  1KLU D;  1BUV T;  1RKN A;  5K36 H;  4RCN A;  5D3I B;  3SR1 A;  3GD7 A;  3NQT A;  4BA2 I;  5T1I A;  2ZT9 C;  1FNU A;  4ZUJ A;  2SEB D;  3K5M A;  4OHJ A;  1PXU A;  1KDB A;  3NP8 A;  2GA4 B;  3OMG A;  4E6I A;  4J6H A;  3NTH A;  5EJW A;  1SMY C;  4Q5V A;  3FMC A;  4DAV A;  3ERO A;  4JBW A;  1KTK A;  2L55 A;  5C4J B;  2MJ8 A;  5F2D A;  2MPM A;  1UAP A;  4L6T B;  4K5X A;  3Q24 A;  5CBA E;  1BR9 A;  3FVQ A;  3X3M A;  1QB5 D;  4DGZ A;  1Y8N B;  2VXW A;  2AQ1 B;  1H9J A;  1QOH A;  3OOC A;  3H09 A;  1CZW A;  3PIP 3;  1GJX A;  3MXP A;  2FIN B;  1SNQ A;  5JEA J;  1S4Z A;  3GTK B;  3I4M B;  2Y0S B;  4FF4 A;  4IFD J;  3GP7 A;  2SNS A;  4NKL A;  5EKI A;  5COR A;  1ET9 A;  4XXE A;  3D8G A;  3QJY A;  2NB0 A;  4H7B A;  5I6Y A;  3MWY W;  5FO7 B;  3ND8 A;  5FKA C;  4EGV A;  3P75 A;  3DEP A;  4K5W A;  3S1R B;  3L7Z C;  1BF4 A;  1UUP A;  5C4Z A;  3D6C A;  4A93 B;  2AQ3 B;  1EWH A;  2MGS A;  2OT2 A;  4IQZ A;  1IKL A;  4BBS B;  3CHB D;  1PYW D;  1AZP A;  3EFX D;  3I3C A;  1CT1 D;  1EY5 A;  2N55 A;  2NVQ B;  3SE0 A;  3MXU A;  3BDL A;  2Z4I A;  2DY8 A;  1H9K A;  2K01 A;  2WKC A;  1EIG A;  2V4D A;  1JB3 A;  5JVH 3;  2J7Z A;  4DF7 A;  2SNM A;  1EL0 A;  1TR5 A;  1CFM A;  2F1M A;  2B2Y C;  4HTH A;  5AFW A;  5C0X H;  1STY A;  2EY1 A;  5LHY 1;  3K59 A;  2B2T C;  2XSC A;  3KLS X;  1R4P B;  5EGT A;  2O5I C;  4RGT A;  2J0T D;  3U9O A;  4RAU C;  2WKD A;  5HGT A;  4WFN 3;  1NUC A;  5EPL A;  2F0K A;  1EU3 A;  3H94 A;  1DOM A;  1Q8I A;  3MHB A;  2E2J B;  4KHV A;  1HFN A;  1LTR D;  2FMC A;  4F87 A;  3D4D A;  2BCO A;  3QOJ A;  4A3F B;  1U4L A;  2O2L D;  3JAM E;  4QCL A;  3T56 B;  4YIJ A;  2VNU D;  4LJZ C;  2VB3 X;  1EWC A;  5JVG 3;  1EFI D;  4XQQ A;  5IOD A;  1CK1 A;  3PV0 A;  3M4O B;  3K0Y A;  3QWN A;  3J81 E;  4EQP A;  2NTT A;  5JEA G;  2QDB A;  4OO1 H;  1ET6 A;  3MEH A;  3C1F A;  3WOE A;  4IFD G;  1F9P A;  1I50 B;  1O78 A;  1EZ8 A;  4G7H C;  1W6K A;  1XTC D;  1BOS A;  1GUW A;  1B53 A;  3S2D B;  4KK7 A;  1ZKO A;  3KK7 A;  4I65 A;  2K03 A;  4A3B B;  3OIQ A;  4L8J A;  4G7Z C;  1BCP D;  3NBH A;  3HS0 C;  1B2T A;  2XN9 C;  1JR0 D;  1HCZ A;  3DUZ A;  2WAQ B;  1MSG A;  1C4Q A;  1PFB A;  1E2Z A;  1SYC A;  2K32 A;  4B08 A;  3ITP A;  1H9M A;  1GUN A;  3FPP A;  4K6D A;  2NN6 H;  2HDL A;  3AB9 A;  2KUM A;  4AYB B;  3RUZ A;  1II3 A;  4RH6 A;  3BG3 A;  2EYF A;  2RBM A;  3A7L A;  2EY6 A;  5FLX E;  5C3W A;  1O7Z A;  4Z9C B;  2XIW A;  5K5P A;  3PMF A;  2SOB A;  3KUP A;  1S5B D;  2FFK B;  3I4L A;  3BVM A;  2OXP A;  5I2Y A;  3QIA A;  1T5X D;  1TKW B;  3D4R A;  5C4X B;  2K28 A;  3MC0 B;  2RDF A;  4FO2 A;  3SEB A;  2HUG A;  1A3T A;  1H9S B;  4FNF A;  1Y69 U;  3NE5 B;  2YYZ A;  5IGC A;  3H6M A;  1EQV A;  2LKV A;  4IN3 A;  1JOK A;  1ICW A;  2L1B A;  1Y8O B;  4F7X A;  1AEX A;  3TDQ A;  5C4H A;  4XDX A;  1I3Q B;  2BDO A;  1K8O A;  2B2W C;  2QIL A;  4R8I A;  1STE A;  1OO9 B;  2ZXR A;  2NBF A;  2PQE A;  1OXU A;  3H91 A;  2L11 A;  2F4I A;  5CMD A;  1DJR D;  3FEW X;  5ISR A;  3VR5 A;  2AWN A;  2LFN A;  4N9P A;  5A2Q L;  1PZK D;  1WTR A;  4NW2 A;  1SNP A;  1V1O A;  1LT3 D;  2PO4 A;  4QIW B;  4H13 C;  4CGY B;  3J80 E;  1EY4 A;  2DNE A;  5C3X A;  1A3V A;  1PFM A;  3TP7 A;  3TZD A;  1GXD C;  4B9X A;  1S5C D;  5KYL A;  2L0C A;  4C3I B;  3S1N B;  3TBI B;  2K05 A;  3T16 A;  2K1B A;  1NAP A;  1B1Z A;  5EQ0 A;  5ELE A;  4QB4 A;  2XNA C;  5CV8 A;  2F0Q A;  4C56 C;  3SVM A;  2E74 C;  1QWY A;  3HRZ C;  4CKB A;  1OXX K;  4H44 C;  1SEB D;  5D65 A;  1JQY D;  2PZU A;  1J9O A;  2VB2 X;  2RVL A;  1Y8P B;  3URY A;  3PUW A;  3DXJ C;  3HOX B;  3NUC A;  3V05 A;  1VCI A;  2KCC A;  5C0X G;  2IL8 A;  2R6G A;  4DNR B;  1SNO A;  1STN A;  4RGO S;  1J8I A;  2JXM B;  1F9Q A;  4OIJ A;  2IX0 A;  2CVR A;  2E2I B;  1PTO C;  1U4R A;  5IGF A;  4R9W A;  2C5C A;  2CHB D;  3DHQ A;  5IGG A;  1Q12 A;  3OMC A;  3GQB A;  1Q3L A;  2OEO A;  4A3J B;  2WV6 D;  3J7A F;  1DZ1 A;  1H9S A;  1EQT A;  2M00 A;  3R93 A;  1V8Q A;  2JA6 B;  1GUS A;  4EVO A;  1LAB A;  3RMH A;  1BDO A;  4BWG B;  4DXG A;  2EOT A;  2RSO A;  1TU2 B;  5I2X A;  1HFG A;  3S2H B;  3I8Z A;  3S16 B;  1W6J A;  1F2M A;  3I91 A;  1Q90 A;  1LV9 A;  3S1Q B;  4OO1 G;  1PZI D;  1PMR A;  4F88 A;  3PO2 B;  4M8A A;  1I4R A;  2F03 A;  3FDT A;  3NHH A;  2NN6 I;  4FXD A;  2A5H A;  3RLF A;  2PZW A;  4U68 A;  2RKS A;  1T5E A;  3S9W A;  5C5L A;  1ESR A;  3QO2 A;  1SNM A;  1Z47 A;  3BYY B;  5JPN C;  1JE4 A;  1LTT D;  3VA7 A;  1F9R A;  3R2T A;  1CHP D;  4KV6 A;  1QIL A;  1D1K A;  1IHZ A;  3LNN A;  4ZAI A;  2CQA A;  4X3S A;  1FD7 D;  1CA5 A;  3C1E A;  3K6O A;  5KEE A;  3S15 B;  3O13 A;  2B8F A;  2IWH A;  3VR2 A;  3S17 B;  1LT6 D;  2F0M A;  1WTO A;  1LTS D;  1E0B A;  4KJO A;  1AW7 A;  1GUO A;  1BCP C;  3I90 A;  3NTK A;  1V1P B;  2Z8L A;  3DM1 A;  1I6H B;  2EJF C;  3KBX A;  4V0B A;  3VA5 A;  1CM9 A;  2L4N A;  1TQO A;  2XRS D;  5C3E B;  4IUT A;  1QNK A;  4XT3 B;  2QF7 A;  2NWG A;  5IGB A;  3GTM B;  1TS2 A;  1B3A A;  2IW3 A;  1M8A A;  5C44 B;  2A74 C;  1D5X C;  5IGD A;  4NDX A;  5J39 A;  1LAC A;  3GV3 A;  1GHJ A;  4BY1 B;  1G91 A;  3MXG A;  3D4W A;  2C9O A;  1PTO H;  2F0H A;  1A6X A;  2B63 B;  2E76 C;  4ME5 A;  3TZU A;  3IL8 A;  5D14 A;  2K5Q A;  4A3E B;  3D31 A;  1JWM D;  5LL6 S;  1HTP A;  3J7Y W;  2FJ2 A;  2A6E D;  1HUM A;  4HAE A;  1OXT A;  5M5Y B;  1TWC B;  1JOQ A;  3OWF A;  1ENA A;  4HSV A;  1M4V A;  3D6W A;  3LWU A;  3TME A;  2O4X A;  4KI0 A;  4HN7 A;  3QB3 A;  5DM7 3;  2B2W A;  5FOB B;  1CHQ D;  1PTO D;  3ND9 A;  4HR7 B;  2B2V C;  2A69 C;  4IUU A;  3RZO B;  2AWO A;  4LAA A;  2F3V A;  2PW5 A;  1RJT A;  2X6G A;  3Q22 A;  2EZV A;  1B9N A;  1PRT B;  3KLS A;  4CBV A;  4X3T A;  3CQZ B;  3BVZ A;  3A54 A;  3Q6S A;  1EY8 A;  2L5T A;  2ICE C;  1IKM A;  3TSS A;  3MFY A;  4WJW A;  2B39 A;  2PPB C;  1SE2 A;  3SDZ A;  4OL7 A;  5G3L F;  2MHV A;  1SNC A;  2AUK A;  2PCF B;  5JPM C;  3ONA B;  4FXK C;  4LMQ D;  3K58 A;  2WP8 J;  4K2L A;  1EY9 A;  3E0J A;  5IT9 E;  1U4M A;  1STA A;  4OGQ C;  4C3I G;  4NMZ A;  1RHP A;  4IUR A;  4K6L A;  2KEE A;  4TQU S;  5DAU A;  4ZUI A;  3VYR A;  3M7G A;  5KRU A;  2E75 C;  3AMU A;  1UEA B;  5EKK A;  4XYO A;  3MAQ A;  5KIX A;  1V1P A;  2HQE A;  4DN4 M;  2I46 A;  1STH A;  1XWE A;  2B2U A;  1JOO A;  4BY7 B;  2F0N A;  2F0J A;  1KDA A;  5TSS A;  3SK6 A;  1RTO A;  2X6L A;  5BN3 A;  1D1I A;  2AUJ D;  1QCB D;  3WDN A;  1EZ6 A;  1R4Q B;  5HUR A;  2KA7 A;  5J22 A;  3GO5 A;  2F0U A;  3SK8 A;  3ERQ A;  1HQR D;  2SDF A;  1S5E D;  2M9V A;  4WOR A;  5I4D A;  1AN8 A;  3OW7 A;  4XTC S;  1SDF A;  3OWE B;  2F3W A;  2G9H D;  3K5L A;  1RCV D;  3QG1 A;  3SK4 A;  3HZX A;  2KQ3 A;  1ENF A;  1EY0 A;  3KBG A;  1U9R A;  5LL6 X;  2FHT A;  2WB1 B;  5IOC A;  2HCI A;  2Z4H A;  1F9S A;  5D3D A;  1LT4 D;  4EQO A;  3EA6 A;  4RA8 A;  4KN7 C;  2R92 B;  4LK1 C;  2BE5 C;  4PMB A;  1H9R A;  1MI2 A;  1IYU A;  1Q1E A;  1VDZ A;  3CKI B;  1G6Z A;  1C8C A;  1TS4 A;  4RGN A;  5CR3 A;  3MA2 B;  5EBC A;  4ZKC B;  1RD9 D;  1HHV A;  5K36 G;  1LTI D;  1FGB D;  1PRT F;  1X3P A;  1BO0 A;  2EYP A;  4KN4 C;  5C0X J;  4ZKB B;  1I4P A;  2F0O A;  2PW7 A;  2DY7 A;  2RQX A;  4KTA A;  1DOL A;  4F8M A;  5EPK A;  1SJE D;  5COY A;  1YNN C;  1SE4 A;  1IW7 D;  4UAI A;  2XRQ D;  2A69 D;  3G7L A;  1BXT A;  4RHS A;  4K5V A;  2HDM A;  4XT1 B;  3PUZ A;  4N9T A;  3V96 A;  1AZQ A;  3P7J A;  1LT5 D;  5NUC A;  1QNU A;  1EY6 A;  3J7A V;  1WVL A;  2CW0 C;  1FR3 A;  3VYS A;  4GZY C;  2XVS A;  5M5W B;  1DON A;  1SXT A;  1EYD A;  2D62 A;  4DA2 A;  3K5N A;  2XWB B;  5EBD A;  1G8Z D;  3R8B A;  5DM6 3;  4KY5 A;  3NPP A;  1MSH A;  1A15 A;  5CV7 A;  3W3A A;  4RFB A;  4DNT B;  4PQX A;  2XWJ B;  1TY0 A;  3V2T A;  2F0S A;  3MFG A;  3UI2 A;  3IAY A;  1VF7 A;  1F2Y A;  2H1E A;  3RZD B;  4ULL A;  1Q1B A;  4CKC A;  4A3K B;  4XYQ A;  2LY7 A;  2I07 B;  4HMI A;  2F0D A;  1YNJ D;  5JAV A;  1KAB A;  5A35 A;  1JCK B;  4CJ1 B;  3CRL C;  3BS1 A;  3CRK C;  4J1M A;  1EIH A;  1BNZ A;  2NTS A;  2A73 B;  4K14 A;  2PYK A;  1WTW A;  1ML0 D;  4KY7 A;  2F0P A;  4K8J A;  1X32 A;  2RDH A;  1ILQ A;  3Q0A A;  3I4N B;  2HCC A;  1SYD A;  3SHL A;  1B9M A;  5IIF A;  5KNC A;  5C6A A;  5FLX L;  2F0W A;  2JSO A;  1L0X B;  1KLG D;  4ODG A;  2A6E C;  3HOW B;  1HPC A;  4IUN A;  1E2V A;  4C1N K;  2MP1 A;  3H3V C;  2AQ2 B;  2OF1 A;  3FRP B;  1XX8 A;  1XYI A;  4DK1 A;  3DMU A;  3S14 B;  2B2Y A;  2J4X A;  3M7N A;  1V43 A;  1WTQ A;  2B2T A;  2A6H C;  4PMC A;  1JWS D;  5JEA H;  1Y1V B;  2F0V A;  4IFD H;  2EY2 A;  1KDC A;  2BE5 D;  1KAA A;  3SXH A;  4A3D B;  1JIC A;  1CI3 M;  4O1N A;  4FYD A;  1K83 B;  1CQV A;  2R3Z A;  2TMP A;  1D2B A;  4K8I A;  2L12 A;  2R7Z B;  3A8J E;  3BDO A;  2K04 A;  2K6A A;  2PZT A;  4MIU A;  1FYC A;  3GTO B;  4FVM A;  3NTI A;  5M5X B;  4FF3 A;  1WCM B;  3GTQ B;  1TWF B;  3GTJ B;  2K5D A;  1HQM C;  3VYT A;  4BS9 A;  2EJG C;  4KKS A;  2BDN A;  1I4G A;  1E2W A;  2KEC A;  4G7O C;  3ZYY X;  4XQJ A;  1SAP A;  5ELD A;  1G29 1;  1EU4 A;  5BN5 A;  4G57 A;  1YNN D;  1ENC A;  4HSP A;  4DAP A;  5J1Z A;  4Q0F A;  1ESF A;  2K5W A;  2KCN A;  5E4W C;  1RF2 D;  4CHT B;  2F0T A;  1UNS A;  3D3R A;  1I4Q A;  3DWQ A;  2VUM B;  5CV9 A;  1PZJ D;  2KHS A;  1GHK A;  2CW0 D;  3E5S A;  2F0F A;  1O7Y A;  3WOF A;  1EYC A;  5E1F A;  3PUV A;  4H0L C;  3PO3 B;  1STG A;  5DEH A;  4MN3 A;  3OSO A;  2F0I A;  4ZLT F;  1SYG A;  3HOZ B;  1DXM A;  1HA5 A;  2NN6 G;  1QE6 A;  4ZQ3 A;  4ZK9 B;  2WAC A;  4UDU C;  4DK0 A;  2QEJ C;  4PNY A;  4PV1 C;  5EKL A;  1S5F D;  1ILP A;  1CQF A;  4RGM A;  1KNE A;  3BDC A;  4M1U B;  2EDG A;  3NBI A;  4C3H G;  4K2K A;  1ZEQ X;  1SYB A;  2KVM A;  1GOZ A;  3VR4 A;  2JYO A;  1HUN A;  1LO5 D;  1PTO B;  4WRD A;  3HOY B;  5G3L D;  4JK1 C;  1I6V C;  2DNC A;  4RHR A;  4BBR B;  4HMJ A;  1I4X A;  2X69 A;  2D5D A;  3L9A X;  4C3J G;  2EE1 A;  4IUP A;  1SE3 A;  1G2S A;  1HXY D;  2TSS A;  1R9T B;  2BOS A;  4C1N I;  5ELC A;  1WD0 A;  4EQN A;  3HEJ A;  4RCO A;  3OPO A;  1TT2 A;  4C2M B;  1SYF A;  2MUY A;  3NK9 A;  1WTP A;  1ONL A;  1A2U A;  1TS5 A;  5M9O A;  1DYQ A;  2O5J C;  3GTP B;  3T13 A;  2A6H D;  1WTV A;  2JEB I;  3HOU B;  1SBB B;  4X3U A;  1IW7 C;  2BA0 A;  1ROD A;  5CV6 A;  2M2L A;  3KF8 A;  3MTS A;  4V19 0;  5ELB A;  3IKJ A;  2K7V A;  2JEA I;  1D5M C;  3PIO 3;  3N52 A;  2EVB A;  2E2H B;  2EYL A;  1BBX C;  3PUY A;  4KMU C;  1OXS C;  3A8K E;  1VF5 C;  3A55 A;  1HRJ A;  3Q23 A;  3P1H A;  5FO8 B;  1VMP A;  3EQL C;  2NZ1 D;  2A68 D;  3LWE A;  3I72 A;  1RDP D;  2QKI C;  3VYU A;  1JC7 A;  4IFD I;  1GUT A;  4S3S A;  3T51 B;  3NWT A;  4DXF A;  1YNJ C;  1BCP B;  3TN2 A;  2Q8R E;  4ABN A;  1JOR A;  4ILW A;  1TWH B;  1SJH D;  1SND A;  3GV6 A;  2Z1C A;  4X3K A;  1OXV A;  1ZYR D;  3TP8 A;  2IT1 A;  1DD2 A;  3HGB A;  1PRT D;  3GTL B;  1F77 A;  2JP1 A;  2NVT B;  5CV5 A;  1D6E C;  3MVV A;  2NVX B;  2JE6 I;  1QG7 A;  4R8N A;  2WII B;  1B4O A;  2EYO A;  5M3F B;  1STB A;  3A7A B;  3HP3 A;  5CC4 A;  3P20 A;  4KY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...