1SYCA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sycA00
2EY5A 1F2ZA 3SK5A 5C3XA 2F0JA 4EVOA 5EKLA 2F0IA 4LAAA 2F0MA 4IALA 3SHLA 1KDCA 1STNA 4K2LA 1EY9A 3MXPA 1STGA 3PMFA 3VA5A 5ISRA 1EY6A 5CR3A 4NMZA 4NDXA 1A2TA 3DMUA 1EZ8A 3SK4A 4R8NA 4K2KA 1SYDA 3D8GA 1EYAA 3BDLA 1SNPA 2LKVA 3D4DA 3D4WA 3H6MA 2EXZA 4K5XA 2PZTA 4QMGA 1STAA 3TP8A 2EYFA 5J39A 2PZWA 3T16A 4H7BA 3MVVA 3OSOA 5IGFA 2F0UA 2RDFA 3C1FA 4K8IA 3MHBA 1KDBA 4F7XA 2EYHA 4KY7A 2NUCA 4MIUA 4PMCA 1EYDA 5HGTA 1SYGA 1II3A 4I65A 5I6WA 4KD3A 2F0OA 1SYCA 4QF4A 4RKBA 5CV9A 5C4ZA 5F2DA 3EVQA 4B9WA 4KY6A 3BDCA 1SNOA 4ZUJA 1KAAA 4HTHA 1SNMA 3ITPA 3NP8A 4YIJA 5KEEA 5I9PA 1JOQA 2F0NA 2KHSA 5HURA 2EYJA 1NSNS 2F0FA 2F0DA 2WACA 3D6CA 1SNCA 2PYKA 3QOJA 4G57A 1TQOA 4K8JA 4TRDA 5E3FA 5J22A 4KTAA 5CC4A 1F2MA 1SYBA 1EY7A 2SOBA 5C6AA 5KRUA 1SYEA 5CV4A 2F0WA 1SNDA 4IZ8A 4K5WA 3TP7A 5KYLA 5NUCA 5IOCA 4KJOA 5I9OA 5IGBA 2PQEA 5I6YA 2RKSA 3C1EA 2PW7A 3OMGA 2EY6A 4KJNA 1U9RA 4ODGA 5CV5A 3LX0A 3SK6A 3SR1A 2M00A 3OMCA 4KV6A 5J1ZA 4EQOA 3RUZA 5JAVA 3QOLA 3HZXA 4DU9A 5M9OA 1NUCA 4ZQ3A 1JORA 2EY2A 3E5SA 4NKLA 5IIFA 5IGGA 3P75A 4KHVA 3EJIA 5C3WA 5IGCA 5K5PA 1TR5A 2RBMA 4KD4A 3OWFA 3P1HA 5C5LA 1JOKA 1EYCA 4PMBA 5CV6A 1RKNA 2KQ3A 2OF1A 2F0KA 5CV8A 4N9PA 4F8MA 4ME5A 4QB4A 4EQNA 5IGDA 5IODA 2PW5A 5EKKA 5CV7A 1EY4A 5C5MA 2F0PA 2F3WA 3QB3A 5DAUA 2O4XA 5DEHA 2EYOA 4HMIA 5KGUA 4HMJA 5KIXA 3EROA 3U9OA 4EQPA 1EY0A 3NQTA 4NP5A 2EYLA 1A3UA 3NHHA 5CGKA 2OXPA 3R3OA 4J6HA 2F3VA 3T13A 1JOOA 1A2UA 1EY8A 3NUCA 4DF7A 3MEHA 1STHA 4WRDA 4DFAA 1EZ6A 1EY5A 1STBA 5JOBA 5IGEA 4RKLA 4ZUIA 5E1FA 3MZ5A 1ENCA 3DHQA 3NK9A 3NXWA 4K5VA 3SXHA 3TP6A 4J1MA 2F0VA 2SNSA 5C4HA 1IHZA 2EYMA 2F0LA 2F0EA 5KYIA 4K6DA 3ERQA 2F0TA 4E6IA 2PZUA 4IUNA 1KDAA 4OL7A 2F0SA 2SNMA 4ID6A 3HEJA 4N9TA 2F0GA 5EGTA 2HQEA 2OEOA 1F2YA 1STYA 4KY5A 4DGZA 3S9WA 1ENAA 1A3TA 4PNYA 4S3SA 3TP5A 2ENBA 1SNQA 2F0HA 2F0QA 1A3VA 2EY1A 1EQVA 4K14A 3TMEA 1KABA 1AEXA 4WORA 3SK8A 2QDBA 3V2TA 4B9XA 2EYPA 1SYFA 1TT2A
chains in the Genus database with same CATH superfamily
3KLSX 4RCNA 2F1MA 3N6RA 3J81E 3DEOA 4NW2A 5BR8L 1PRTB 1T5XD 2QDLA 3OIPA 4LF8Q 2I5MX 2NZHA 1C4QA 3CCRA 3B6YA 4V0BA 2XNAC 1H9RA 5EKIA 2ZM6L 1UNSA 1X3EA 3MXNB 1BNZA 5JPNC 4LJZC 1SNPA 2E76C 3D4DA 3KFUA 4CKBA 4DV4L 2EJMA 3V96A 1VQFA 1X3PA 3MVVA 4ZLTF 4K8IA 4QJFA 4BXXH 5M5YB 1S5FD 2UUCQ 2EOTA 2HUGA 3F2DA 1BF4A 2M9VA 4AYBG 1QWYA 2E2HB 2UXCL 5C4ZA 1VQ9A 4H44C 1N33Q 2KCCA 2IWHA 2BDOA 1SNMA 3CCUA 2HCIA 1ML0D 2IX3A 4DAMA 1SNCA 1D5ZC 3OW2A 1ZYRC 5M3FH 1WCMG 5C3EB 4X65L 5KYLA 2N78A 4KJOA 3QJYA 2RKSA 3SK6A 5IGEA 1Y14B 1A15A 1J9OA 4HCEA 2MGSA 3D4RA 3S14B 2YV5A 5C3EH 3RD4A 4NKLA 3P75A 1VQ4A 4CJ0B 3WDNA 1IBMQ 4LUVA 3MXNA 1LTAD 4O1NA 2AUKA 3M9BA 2NN6G 1JICA 4A3GB 4KHZA 1PH9A 4EQNA 3ER0A 4KHPL 3H09A 3I4MG 1RODA 4BBRB 2VUMH 1EYGA 3M7GA 4NB3A 1WTVA 2MUYA 4A75A 4A3FB 1U0LA 3KJOA 3NSWA 4BBRG 1PRTF 2EJGC 2B8FA 1TWAH 5FO7B 5ELCA 2L15A 1EY5A 4A3FG 3MXUA 1NY4A 2WIIB 5LMNW 5E4WC 1Y1WH 1QNKA 1YVCA 1TS4A 2PZUA 4OL7A 4IO9A 3UDFA 4CBVA 1JMCA 4DPGA 3G6JB 1G8ZD 2EY1A 4NXML 3K57A 2JA8B 3GV6A 4L5QA 3VR3A 5IYCH 4GKKQ 2CH4W 3GTPB 1KDCA 1I4RA 2PNRC 1EY9A 4IFDH 1PTOD 4RFBA 3VA5A 2JA8G 1YBYA 4NMZA 4DAYB 4HSVA 1V9PA 2JXMB 5LHY1 4IN3A 3H15A 4DR3L 4GOPB 4R9WA 1TY0A 4L5SA 1E1TA 1CUKA 3BZCA 1GUSA 2R61A 2RDFA 3FVQA 3MXGA 3E9HA 1KDBA 2K33A 1LT4D 5JJLA 2VY3A 4GNXB 1XXGA 1F2LA 4J8QA 2ZTEA 3I72A 2E2IH 2BH8A 3UDXA 1GUNA 2HCCA 2VQFQ 4JVZA 5F2DA 1DM0B 5CBAE 3CCEA 3BDCA 1KAAA 5JEAJ 1UE6A 2ZXRA 1GO3E 4AIMA 1DOLA 4WJWA 1LT6D 4I7AA 3CCJA 1UE7A 3HKZB 4X66L 2ASBA 1YNND 3HOYH 1AW7A 1NBWA 2HQLA 5IGBA 4HAEA 2OCEA 3K7UC 3BYYB 1M4VA 1OXXK 4ODGA 3LX0A 4EQOA 2LXKA 2Z6KA 4IJHA 4KLKA 1LTLA 3M85A 3PQIA 5IGCA 2LFNA 3EJIA 1LTRD 1FD7D 2UXCQ 5E7NA 2NVXH 4GOPA 3P1HA 4HJ7A 4H0LC 1PFSA 2NZ1D 5COYA 2WV6D 4OHJA 3CW2C 2KVMA 5GAEC 2NVXB 1J8IA 4A3BB 4JCVE 2EYOA 2UUAL 3H0GH 3PUXA 3HOWB 3U9OA 4IPHA 1B53A 3S16B 1PZJD 4AQYL 1XPOA 4DF7A 5BN5A 4FXKC 2RHQB 2HDMA 3VYSA 1STHA 2UUBQ 2YU9B 5G3LF 2NTTA 3TP6A 1TWCB 2IY5B 1YI2A 4IUNA 1KDAA 3RNUA 4L63B 3BZDB 1B3QA 3PO3G 5A35A 4CDFC 3HOZH 1C0AA 1G291 4X3SA 4X62L 4F87A 2JA6B 1QILA 2VQFL 4CJ1B 1J6QA 2JSOA 3F8TA 1SAPA 4DV1L 3SK4A 1FJGL 2JA6G 5I2XA 1PFBA 1BQQT 3D8GA 3NPPA 3H6MA 1VQGA 4K5XA 3HOVH 2PZTA 1I4XA 1EWIA 4H7BA 4QUCA 2JQOA 3C1FA 4CKEA 3I56A 1FNVA 4RGMA 2NUCA 2RA4A 1VQ8A 4JBWA 1MSGA 5C4XG 2IJ0A 3IAYA 4P73A 5I9PA 4C2MB 1YJNA 5H1SE 3M4OH 1HZAA 3D6CA 5E3FA 1F2MA 3J80L 1EY7A 1PYWD 3GTGB 3OIQA 2VQEQ 1K73C 1BCPF 1MKHA 4DV5Q 1I4QA 2PW7A 1SE4A 2EY6A 1L0WA 3L7ZC 1ILQA 1JC7A 5GAHC 1S5ED 3E5SA 1O80A 3EBEA 1PRTC 5M5WB 4KKTA 4BXXG 4ABNA 1K8MA 4XQNA 4XIGS 3OOCA 4UHVA 2ATWA 2LS01 1H9SA 2B39A 1C7YA 1LTTD 1JWSD 4ME5A 1UUPA 4IUTA 5C5MA 2ZTCA 2TSSA 4HMJA 1ONLA 1VQHA 2G9HD 3X3NA 3MA2B 4V190 3CU7A 1YNNC 4FNFA 1A63A 1SE2A 3A8JE 4KMUC 4WRDA 4YHHL 5E1FA 1I4GA 4LFAQ 2BE5C 4KN7C 2VS1A 3IKJA 1RIPA 2F0SA 2SNMA 4X65Q 2A6HC 1HR0L 2IX1A 1Q90A 1DD2A 1FL0A 5EPLA 3LNNA 1B3AA 1KHIA 3K7AB 4LF5Q 2R93B 2OQKA 3MEFA 1AEXA 5FO8B 1C48A 1CZWA 1U4LA 2DUDA 3CF5A 2R93G 4B3ML 1PH4A 1W6KA 4ZYSA 1Q12A 2HD3A 2KJXA 4MHEA 1KNAA 3L0OA 1A2TA 1XYIA 2WKCA 4JYAQ 2L11A 3EA6A 4R8NA 2YYZA 1L1OA 4BWGB 3VDYA 1ASYA 1GXDC 3D4WA 1D8LA 2CKZB 4A3FH 4JG2A 1LLRD 4X3KA 2RDGA 2B2TA 3HFZB 1N33L 4ALPA 4JI6L 4L5RC 1D1KA 3OTOL 2WAQG 1PH2A 2B8GA 4L6TB 1SNOA 3TQYA 3S1NH 2F0NA 3VR2A 2WAQB 1Y69U 1QZHA 3BG3A 1HNZQ 4HIKA 2KECA 4A3EG 2KCMA 3JAMi 2X6LA 1VF7A 1BBWA 3NWTA 1G51A 5LMUQ 3OMGA 1E3PA 1PH1A 3MFGA 2XRQD 3OMCA 5J1ZA 2ICEC 5I2YA 1CT1D 3BVZA 3J7YW 3Q8DA 1Y8PB 4KHVA 1XJVA 2UXDL 5FLXE 2KEEA 3OWFA 1CZGA 5FJ8H 1V1PB 3DWPA 5EAYA 2MO1A 4PG3A 2ES2A 4UDUC 3HOXH 2A8VA 5IGDA 3RLOA 2NVTH 1FYCA 5EKKA 1ZEQX 3T56B 4DV3Q 1GOZA 4DNIA 4B3RL 2CWPA 3VR4A 3KF6A 5KGUA 2CQOA 5IY0A 1RDPD 3NHHA 1G2TA 3PUVA 4EX5A 4J6HA 2F4VL 1O78A 1CHPD 3HOYG 3CRLC 2WB1E 5DNFA 1F9SA 3J81c 3GTKH 2QF7A 4K5VA 3TSSA 5LMNQ 1UE1A 1YZ6A 2LXJA 4R4IA 4JI7Q 5C4HA 3HOYB 1JWMD 1EQTA 4K6DA 4P71A 2Z9HA 3PF5A 4AQYQ 1I6VC 3RMHA 4B08A 2CW0C 4S3SA 5ELBA 1IXRA 1RTOA 4JPBW 4OWTB 3SK8A 5M3MB 3J80E 1IL2A 3I91A 1EU4A 3UDIA 1AN8A 4Y7NB 2A69D 4OXPA 4JI4Q 2Z1CA 5A2QE 4LF7L 1EEFD 1SBBB 1STGA 4QIWB 5M3MG 4HN7A 5CR3A 2O5JC 3A5ZB 1K3BC 2JA7G 3IFDA 4DKAC 4TVAB 1VQAA 3E3XA 4TSSA 2HDLA 2EYFA 1I3QH 4AYBB 2E2HH 1CKNA 3DEPA 1K83H 1BUVT 4KKSA 3S24A 4IUUA 4X3TA 4XT1B 1I6HH 4XTCS 2B2UC 1DJRD 2DGYA 3PIO3 1XNQQ 1MIUA 3I3CA 4YY3Q 2BA0A 1PTOH 4ZUJA 5C3EG 1HTLD 4G57A 1PH5A 1VQCA 1WTQA 1A62A 3PUZA 4DV3L 1S5DD 3VYUA 1CKMA 2QILA 1S5CD 1SNDA 5IT9L 5G3LD 3A8KE 3WOFA 5I9OA 2PQEA 3NTIA 1VMCA 4LF9L 1U9RA 3A0JA 2E75C 1X6OA 1XX8A 1N34Q 5M9OA 1VQ5A 1SR3A 4RMFA 1P8LA 2RCNA 1CA5A 3HP3A 2VUMG 3CRKC 1Q8IA 1A0IA 3GTQB 2AWOA 1QCBD 1V1OA 2K04A 1MD2D 1EYCA 4BBRH 3HOXB 1VQLA 2F0KA 3CP0A 4F8MA 4N8FA 3GDEA 1HNZL 3DUZA 2F3WA 3UE0A 1EL0A 3Q6SA 2HIXA 4FYDA 4DV5L 4NP5A 3OHXC 3O13A 3PF4A 1Q46A 3K59A 3T13A 2R7FA 1MJCA 1KC8C 4B3SL 2J7ZA 1T5EA 1EZ6A 2XVSA 3ULPA 3DHQA 1YJWA 1KAWA 4BBSB 1N8RC 3C2PA 3ND9A 1AZPA 1JB3A 3AQQA 1DGSA 2UU9Q 1S4ZA 1T9HA 4LF4L 1VS0A 1IKMA 1PH6A 2JA8H 1PYSB 2PMZE 1OXUA 2QEXA 3S9WA 3HKZE 1DXMA 1JQYD 1KXLA 1STEA 3GD7A 2NWGA 3J81i 3V2TA 3K5NA 1TY2A 3AFQA 5EJWA 4ULLA 2H5XA 1N34L 4OELB 2K5DA 4C56C 3RZOB 5C4JB 4QQBX 3PMFA 1XMOQ 1VCIA 1RD9D 4LFCL 4LF6L 4IOAA 1WYDA 1JB7A 4MN3A 1N36Q 1X55A 2XN9C 1TWHH 1QNUA 3HOUG 1AP0A 2XWBB 4RCOA 2E2IB 1PDQA 5JJIA 2EZVA 4F7XA 4YHHQ 3HOUB 3LWUA 4LMQD 1NR4A 1QE6A 5CV9A 1SYCA 3S15B 1B1ZA 2Q2HA 4GNXC 1HZCA 3S1QB 4DR4L 5EQ0A 1IW7D 4KY5A 1NSNS 5KRUA 2K01A 3JAMc 3K5OA 3AU7A 5IOCA 2WAQE 4A3GH 4JI8Q 2Y0SB 3CCVA 3E6ZX 2R7ZH 5L37A 3VA7A 2IX0A 4DV4Q 1R9TB 3S17H 4A3CH 4G4KA 1HNWL 3H0GG 5K5PA 1TR5A 1VQEA 1LM0A 1E2WA 2R7DA 4I7ZC 3NWSA 1K8OA 4DR2L 3J7ZC 1JOKA 5C0XJ 2N55A 2QEJC 3I90A 4FVMA 3H0GB 1LTGD 2OTJA 1XPRA 4HJ8A 1TU2B 1EIGA 1YEZA 2K5VA 1HA5A 4DV7Q 5DAUA 1NMFA 1KLUD 2K14A 4HMIA 1G6PA 1OTCA 1HUNA 2ZTDA 1SE8A 2K1BA 4Q0FA 2EJFC 4AH6A 4A4IA 3R93A 1CA6A 4BA1I 3PO3H 2F4VQ 1XWEA 2UXBQ 4NXNL 3NBHB 3D6WA 1YHBA 1PLFA 2PNHA 2X6GA 2E5LQ 3AMUA 4R4OA 2F03A 1B50A 2GN5A 3K6OA 3RZDH 1C8CA 2HQEA 4ZKCB 5FKAC 3I8ZA 2A68C 4HR7B 3EN2A 3UE1A 4FF3A 1UWVA 3T1HQ 1SNQA 2FMCA 3TMEA 4B9XA 1KD1C 2EYPA 4DR7Q 1PZKD 2EY5A 3BYTB 4EVOA 4X62Q 4C3HH 1LUZA 1FVIA 3SHLA 1ILPA 2XRSD 3IL8A 1BKBA 4K0KQ 2JJQA 3QIAA 2Q2TA 1CTMA 1XMQL 4BA2I 4YWKA 3CMAA 4DV1Q 3K5MA 4OO1I 2N49A 2JA5B 2P5ZX 2I46A 5J39A 1KRTA 1IKLA 1I94L 1WTXA 4A3DB 4JBKA 2B2YA 2F0UA 5BN4A 4R8IA 3TEHB 2JA9A 3NBHA 5C4XB 1L2FA 4BY7B 3T51B 3PIPA 2YTXA 5HGTA 2AKWB 4R4TA 2I5HA 2PPBC 4DR4Q 1HA6A 1E2ZA 1NAPA 1L1OB 3ITPA 3BJUA 4TRDA 4DR6L 3PO2B 2CWAA 1TQOA 1DONA 4B3TQ 4P2CB 2SOBA 1UEBA 3R2TA 3K8AA 2A6ED 2F0WA 4IZ8A 4K5WA 3OWEB 4IURA 3MC0B 1J5EQ 2BE5D 3BU2A 1HJPA 5GQOA 2EXDA 2A6EC 4OGQC 1SRUA 2D0PA 2EY2A 3HOWG 1RJTA 4QUFA 3KJPA 1WTPA 4HCSA 4ILWA 3DXJC 1EWCA 4PMBA 2ZJQA 4QB4A 2YU9H 4X6AH 3PIP3 4DV0Q 4LUZA 3FKIB 1Q1EA 1EY0A 2EYLA 1SSOA 1PTOB 2Q8IB 4ME3A 5FK9C 1ZYRD 3J80c 3GP7A 5E4XA 2B2TC 3FMCA 2KENA 3SXHA 3WWVA 4DR5Q 1JE4A 1IHZA 1VQOA 3KDFA 4GS3A 4B3SQ 3GTMB 2R93H 1H9KA 5M3FB 4ID6A 1HZ9A 4C3IG 3S1MH 3J7AF 1GUGA 3I4OA 3I70A 1U4PA 3PUYA 4G7HC 4LNQA 2NVQH 5M5XB 5ELDA 4K14A 1EQVA 3JAML 3H3VH 1SYFA 4GLVB 3KOJA 4CDEC 4LAAA 2F0MA 3M7NA 5LL6X 5CMDA 3CC4A 3RN5A 3DMUA 2MQHA 1WI5A 1X3GA 1Y1VB 1WFQA 4OO1G 1FGBD 4X64Q 4QMGA 4RGOS 2CCZA 1OO9B 1O7LA 5FO9B 4LF9Q 1HFNA 1KTKA 1IBKL 2G9DA 4FP5D 3SGIA 4A3EH 2K5QA 3CQZB 1KIXA 2B63H 2CQAA 4I65A 1NJIC 4QF4A 4WFN3 3EVQA 3I73A 4AYBE 4LK1C 1IZ6A 3NP8A 4YIJA 4DK3C 1JOQA 2PQAA 2F0FA 3SK5A 1WTRA 2UXBL 1B4OA 2KCNA 1EWHA 4JI5L 3RLFA 2ALYB 5D3IB 3OYYA 3C1EA 1NMGA 1I5FA 2OQ0A 4NPSA 4N8X1 1Q86C 4O2DA 1KLGD 1QZGA 4QCLA 2K75A 2EQSA 4H13C 3F2CA 4NXNQ 3TN2A 4A93H 1X65A 1O7IA 1RKNA 2OF1A 1EFWA 2VNUD 1HNWQ 3I7FA 4OWXB 4A3IB 1TKWB 1X54A 1CQVA 4HIMA 3P20A 1GUTA 4JI3Q 1V1QA 5KIXA 1X9NA 2DJFC 2OXPA 1K9MC 3H91A 3DM1A 3MEHA 5C44B 3S17B 4A3GG 4C1NI 1ICFB 5DLQE 4RKLA 2WB1G 2QCPX 5LMNL 5IYDH 1ENCA 4BY7H 2R7ZG 5JJZA 2N88A 2ZXPA 4A3CG 4RG1A 4OWWB 2L9HA 2VL6A 3OW7A 1JE5A 3GTQH 4CJ2C 4APVA 1EIHA 4CDCC 5KNDA 5M3MH 2UUBL 1W3SA 2L0CA 3I2ZA 3K7AH 5JEAH 2JA7H 2CFMA 1MJEA 1SE3A 3W3AA 2Z4HA 3DWQA 1F2ZA 3TRZA 3QO2A 2Q8RE 3MFYA 4K2LA 4LFCQ 2KHJA 2J4XA 2GVAA 1PVOA 2K6AA 2WP8J 1U5KA 4WJ3M 2NVYH 2CVRA 5BR8Q 4DN4M 4DAVA 4DA2A 3GTPH 3OSOA 4OX9L 4JV5Q 4TKOB 4A3EB 1PTOC 1Q7YC 4LF4Q 1SLJA 2A69C 3U9SA 4KD3A 3I55A 1QVGA 4B9WA 1EIFA 4KY6A 5ELFA 2Q8TA 1DYQA 2D0OA 1K8GA 3QOJA 1E0BA 2F4IA 4C3HG 5J22A 1QVCA 1SYBA 3GTOH 3S2DB 4IUQA 4GOPC 5NUCA 2DJGC 3SR1A 2M00A 4KV6A 1KL9A 3QOLA 3HZXA 2L5TA 2VZAA 2Y0SE 1PZID 4KD4A 4NXMQ 3F2UA 4X64L 2O2LD 4HIDA 3CXCA 3T4AC 3OTOQ 1B2TA 3L2PA 3AFPA 1MGSA 1EQQA 4A3IH 1ENFA 3KLWA 1EIYB 2F0PA 4WJ4A 1LT3D 3NENA 4A3JB 4LF5L 1HZBA 3GO5A 2RSNA 2B2UA 1NNXA 1Y1VH 1LACA 4DAPA 1ESFA 3S14H 2K5WA 1Q82C 5C44H 4P72A 3TREA 4A3JH 4BBSG 4TQUS 5ELOA 3C3LA 4IFDI 1SDFA 2K50A 1VQMA 1CI3M 2QW7A 3RR5A 3K5LA 4A3BG 1LO5D 4HSPA 1IW7C 1CSQA 1GVPA 1DCZA 1Q81C 3SE0A 2PO4A 2LSSA 2M2LA 5IP7G 2A5HA 1F2YA 2MPMA 1IYJB 2ENBA 1W2BA 2CW0D 1BR9A 4FDBA 1W6JA 3D31A 4YCVA 3R3OA 3HOUH 1CFMA 1WD1A 4LFAL 4U68A 1XNQL 1STNA 3CC7A 3S2HB 1I4HA 3A7AB 1D2BA 1SN8A 2RHSB 1F9QA 1TWFB 1MHWC 2DY7A 1NTGA 2CH4A 4RGNA 1CK1A 3M4PA 4K2KA 1PH8A 3T1YQ 2NVYB 2LKVA 3G7LA 4IFDJ 4XXEA 4UAIA 5I4DA 1GUOA 2WINB 4C3IH 2ICIA 4RAUC 1S72A 1XPUA 1B44D 3QWNA 1HUMA 3W5OA 1SYGA 5AJ3L 1HCZA 2KCTA 1X3QA 1JWUD 2F0OA 3EFXD 3ERSX 4LF7Q 2I5LX 2B2WC 3S1MB 1S5BD 3CCMA 2QKIC 1C9OA 2KHSA 2PYKA 3A55A 2Y0SG 5D14A 1SJHD 4DK0A 5D65A 1SMYD 3GV3A 1OXTA 4JI1Q 4XQJA 5C0XH 1B7YB 1PYBA 1ZXTA 4DNTB 4B3RQ 3I4MB 1PH7A 3S16H 1WOCA 4A3MB 2JEAI 1B9MA 2L55A 1HH2P 1H9JA 1PRTD 2HHHL 3PUWA 4A3MH 2Z4IA 3JAME 2BH2A 4C3JH 1PXUA 1BDOA 1TWCH 3SDZA 5JJKA 4N9PA 1FGUA 1QUQB 1Z47A 5IT9E 1AE2A 1SMXA 3LWEA 2I07B 2SDFA 5LMUL 1X56A 1QJOA 1A3UA 4DR7L 3KBGA 2KUMA 1SROA 5HY6A 5FOBB 5CORA 2HHHQ 1DOKA 1JCKB 2G5DA 3VR6A 2B2YC 1H9SB 1P16A 3NK9A 3A8IE 4OIJA 3BVMA 1CSPA 3DM3A 2F0LA 1QVFA 2FFKB 1GD7A 2F0TA 1EOVA 1BBUA 4YY3L 3HEJA 3D3RA 3SEBA 2PI2E 2F0GA 1RF2D 4ZCKA 1STYA 5FLXL 4JI6Q 3CPWA 3KK7A 2FXQA 5TSSA 2XWJB 2NBFA 2WFWA 3IRBA 4RWSC 2EE1A 2IPKD 2PCFB 2Z6KC 2JA5G 3CMEA 4DV7L 3KDFB 1EY6A 1K3RA 3CAMA 4B3MQ 2JN4A 4A3DG 1SMYC 4DUYQ 4DR2Q 1SYDA 1ZKOA 3H3VI 2N3SA 1Z6HA 4XQQA 2AQ2B 3J81j 4DV2Q 4IOCA 3BDOA 1LYLA 5IYDG 4BY7G 2OT2A 4BS9A 2ID0A 1A6XA 1JR0D 4HIOA 1NE3A 2EYHA 1Q8KA 3AYHB 4Y7NH 4KN4C 5DM73 5M5WH 1SEBD 1I50H 2E2DC 4RH6A 3E0JA 4HTHA 5KEEA 4PZ7A 4JI7L 4BY1G 3HOWH 3HG9A 1F77A 4DR1L 5C6AA 5CV4A 4DV6Q 3S1RB 1NCVA 2PI2A 1V43A 3X3MA 2N8NA 4BY1B 2JP1A 2A74C 1K28A 2WKDA 3RUZA 5JAVA 1YITA 3AEVA 4Z9CB 4DU9A 5GROA 4IQZA 4MTKA 1KRSA 3E9IA 3HS0C 3OPOA 1TXYA 3HRZC 3KBXA 5K36G 3FPPA 3CCLA 3CC2A 2AQ3B 3FKIG 3ND8A 3ZYYX 4LF6Q 1EU3A 2NZOA 2L12A 1VQIA 2PMZB 5ELEA 4CHTB 3E0EA 5FLMG 3S2HH 3K0XA 1VQNA 4IPGA 1GHJA 1UEAB 5DEHA 3SVMA 5M5XH 4QGUA 5EPKA 2O5IC 4FXGC 2KHIA 3URYA 3PO3B 2RF4A 3TS2A 1V1PA 4G7OC 2BA1A 1I6HB 2MO0A 5C0XI 2DY8A 3M4YA 4RA8A 3U4VA 3BZKA 3WOEA 4C3IB 1B70B 2K32A 4J1MA 2F0VA 4HEDA 2SNSA 3ULLA 4E6IA 1AH9A 1SJED 1LV9A 3KF6B 2DNEA 4DXFA 1M90C 2PQAB 2Q2UA 5IT9c 3I4NH 4GN3B 1ENAA 3NEMA 3TP5A 4FO2A 2D5DA 2AHOB 3GQBA 2SEBD 3LGJA 1E2VA 1D5MC 2K28A 3HOVB 4OO1H 3QG1A 3R2IA 1TT2A 3FEWX 3CPFA 4C1NK 4UP9A 1YIJA 2BCOA 1Y1VG 3MXPA 3VYRA 4LUOA 2B63G 1IBML 3F1ZA 2E2JH 1EYAA 3U50C 1DOMA 3EIVA 3J7A5 4DV0L 2K05A 3T16A 4A3BH 4C2MH 3RN2A 2B63B 1BXTA 1VQ6A 3PO2G 3A54A 2EPBA 5IP7H 3DLLA 3K80C 3GTGH 1WVLA 1EYDA 2GVBA 2A6HD 1YJ9A 3Q22A 2JE6I 2XTIA 1ET9A 1PFNA 2C5CA 4A93B 1I3QB 5HURA 2WACA 2XGTA 1TWHB 3S1RH 3G6EA 3K81C 2D2CC 1TVXA 3F2BA 4A93G 1YNJD 1D7QA 4JBJA 5J3BA 1L1OC 4KJNA 1ET6A 2R92H 1X32A 2JEBI 1CQFA 4XYQA 5IGGA 2ZM6Q 1B9NA 1WJJA 1J5EL 5C5LA 3FRPB 2KQ3A 2JYOA 4O0AA 3G48A 3TZUA 1PMRA 4UP8A 4JI4L 3EROA 5CGKA 4O42A 1A2UA 5GADC 1G6ZA 1XNRL 2VQEL 1OXVA 1PHJA 1HXYD 5JOBA 4OONA 5JEAG 4ZUIA 4IUVA 4A3KG 4A3LH 3ULJA 4ZKBB 1SFOH 5KYIA 2F0EA 3CCQA 1F9RA 1HQRD 1TS2A 1CM9A 1EFID 5DM63 4FXDA 4P74A 4DXGA 4QY7A 4X66Q 1XMQQ 3UDGA 4JI5Q 1A3TA 2KEDA 2Z0SA 1RTNA 2F0HA 3GTLB 5BN3A 4WORA 3AB9A 3VR5A 2QDBA 2E5LL 3A5UA 4DR3Q 1K8AC 1KNEA 4JW0A 5IYBG 2Q2IA 1V8QA 3GTJB 3T1HL 1U4MA 4YCUA 3M4OB 4L5TA 1K0RA 3JC66 5KNBA 4KI0A 1VQDA 3A56A 4GKKL 1TWGB 4QL5A 2R6GA 1FNWA 4JBMA 1R4QB 2PZWA 2RVLA 4GKJL 2LY7A 3D0FA 4IPCA 4JI1L 2BDNA 2F3IA 4YCWA 1DZ1A 3CQZH 2K52A 4FF1A 4KY7A 1MI2A 4EGVA 4MNOA 2JK8A 3NTHA 4RKBA 4IUPA 1X3FA 1IBKQ 4QIWE 4DK1A 3PSIA 1GKHA 1AZQA 4FF4A 1O7ZA 4YWMA 5CC4A 4PV1C 5C4JH 2JA5H 3TP7A 2GA4B 4XDXA 2V1CC 1VF5C 4EQPA 5IP9G 4A3IG 3GTKB 2DNCA 2RCFA 1WCMB 4JK1C 3ZJYC 4CGYB 1JORA 1VQPA 3FPUB 3R8BA 3Q0AA 4KHPQ 4Y52H 4IPDA 3G71A 4GZYC 1VMPA 2Z6BA 2RBMA 1HRJA 1WCMH 4JI8L 1WTWA 3HKZG 1XTCD 5C44G 4A3JG 4BBSH 5IODA 2WB1B 2PW5A 2B2VA 3PCOB 5D3DA 4KK7A 2R7ZB 2O4XA 4DR5L 2KOLA 1IBLQ 2I0QA 1QB5D 4GLXA 4BY1H 4FF2A 2E2JB 1N36L 1RHPA 2L4NA 2Z8LA 3N52A 1LTSD 1I50B 1HQMC 4DR1Q 1K0SA 4M1UB 1HR0Q 4UPAA 3I4MH 1HHVA 4GLAC 2VXWA 4N9TA 2QA4A 1HR0W 4ZRZA 2OEOA 2JA7B 3GTLH 2F0QA 2RSOA 1CKOA 2AWNA 4IJLA 1VQBA 5FLMH 4RHRA 1YNJC 1CKNB 4M8AA 5C3XA 1IBLL 2F0IA 4IALA 3A74A 1N9WA 2B3GA 2MFIA 4JOIA 4JC0A 2NN6I 3S1QH 3C46A 4J15A 4B3TL 3BDLA 2UU9L 1PA6A 1I94Q 4DR6Q 2AMCB 1U4RA 2YTVA 4C3HB 1ESRA 4PZ6A 1ICWA 1JJGA 1QUQA 1H95A 4PMWA 1N32Q 2IHFA 4H02A 4MIUA 2OWOA 3I4NG 2TMPA 1JT8A 2RQXA 4POGA 5C0XG 1M1KC 1O7YA 5IWAL 1PFMA 3STBD 3CKIB 3KLRA 1HTPA 2EYJA 2F0DA 4JI2Q 3I4NB 1HFGA 3G4SA 2VUMB 5CYUA 3P7JA 1JJCB 4DNRB 3W1BA 2K03A 4A3MG 2IT1A 1EOTA 2A19A 1FNUA 5A2QL 4F88A 2H1EA 4OX9Q 4C3JG 1WTOA 4JV5L 2KBNA 4ZQ3A 3ICEA 4GKJQ 1E1OA 4C3JB 3S15H 2IW3A 3FHWA 3PO2H 3V05A 1GM5A 4L8JA 4Q5VA 1AE3A 3TBIB 5T1GA 2EIFA 3L9AX 2J0TD 4GNXA 1UAPA 5KNCA 1TWGH 3PIOA 2XIWA 2MNAA 3HGBA 1JOOA 3KF8A 3NUCA 2R92B 1IYUA 3HKSA 3MWYW 4YWLA 4DV6L 3KUPA 4DFAA 1STBA 2B29A 2K5HA 1LTBD 1HNXQ 2KA7A 4LFBQ 2R92G 1E7ZA 1VQ7A 4OEMB 1BCPC 5EBCA 5AJ3Q 1R4PB 1VQJA 3QR8A 4XT3B 4DAYA 1XTDA 4RGTA 3TZDA 3NBIA 3W1GA 1Z7TA 4A3DH 4GN4B 4JI3L 3KYHC 4PZ8A 1Q3LA 1KABA 1TS3A 2ZJRA 4HJAA 2F0JA 3T1YL 4LFBL 5EKLA 1BO0A 3TS0A 2UUAQ 3IFTA 1LABA 5M3FG 1F9PA 1TWFH 1TIID 2ZT9C 4NDXA 4DUYL 2D62A 4R1JA 4CKCA 2HT1A 3W2DA 1FR3A 1BVSA 2BOSA 1STAA 4OIKA 4X3UA 4A3KH 3KF8B 3MAQA 1R9TH 1JJ2A 1RCVD 1QOHA 4XYOA 4DUZQ 4P75A 3MHBA 1GHKA 2L1BA 1PH3A 5EBDA 2NN6H 4PMCA 2JA6H 3TDQA 1XMOL 3U4ZA 2XSCA 1II3A 4HJ5A 2QGQA 3Q24A 2R3ZA 2FINB 3CD6A 5IWAQ 3BS1A 4JI0L 3S1NB 1RL2A 1TWAB 3NQIA 2MJ8A 5HGQA 1SYEA 5K36H 1Y1WB 2RDHA 2E74C 4R4QA 3NE5B 3FKIH 2IHEA 1S3OA 4GN5A 5CV5A 3RLNA 4ZK9B 3NTKA 3M4QA 1NUCA 1Y1WG 2MHVA 4LWCA 2X69A 5C3WA 1AFPA 1YNXA 4HJ9A 3FDTA 2FJ2A 2ZXOA 4LW1A 3T53B 1Y8OB 1D6EC 5CV8A 1LTID 1I4PA 5M5YH 5T1IA 2HIVA 4KKUA 3GTMH 1QG7A 5CV7A 3I4LA 1PV4A 2NVTB 1EY4A 3QB3A 4MTNA 1H9MA 5IYCG 1BOSA 4IFDG 5CBEE 2NVQB 1CHQD 1Z9FA 2AQ1B 2NYZD 2B2VC 4JYAL 2EVBA 2A1AA 4UY8C 2V4DA 3RZOH 4PQXA 5IP9H 3J80i 5IE8A 5JPMC 1GUWA 5JVH3 3FP9A 3NELA 4U673 2CHBD 2NB0A 3BVGA 1TS5A 3ERQA 3PV0A 3GTOB 2E8GA 3S2DH 2A68D 3UI2A 1ASZA 2OTLA 2AUJD 4DGZA 1VQKA 4DUZL 4PNYA 1L0XB 4ZAIA 3J81L 2DN8A 1A3VA 1G91A 4KTAA 3CHBD 2IL8A 1GJXA 1YHQA 1M8AA 4MZ9A 1BCPD 5ISRA 5ELNA 1MSHA 3H3VC 1EZ8A 1MBYA 2EXZA 1B8AA 3TP8A 1Y8NB 5IGFA 1D5XC 2B2WA 1IL8A 1IYVA 2MP1A 1NR2A 5I6WA 3K58A 1UE5A 2C35B 1HPCA 3MTSA 1HNXL 3Q23A 3CCSA 1L0YB 4K8JA 1EEID 5GAGC 5AFWA 3A7LA 3RZDB 1BBXC 1D1IA 1YHAA 1K83B 1SXTA 2VW9A 5I6YA 2C9OA 5JVG3 1S40A 4UP7A 4DK6C 2VB2X 2UUCL 3M3YB 1WTHA 3KLSA 3HOZB 5IIFA 3U58A 2F52A 3ONAB 1BCPB 2D9UA 2FHTA 2K7VA 1EUJA 1A8VA 4DV2L 3M3YH 1OXSC 4K0KL 3STBC 3HOZG 5LL6S 5CV6A 4R4CA 1SFOB 1KQSA 5EPJA 1WD0A 3PGZA 4LF8L 2A73B 4POFA 4A3LG 3NQTA 3VYTA 5FJ8G 1FJGQ 2F3VA 1EY8A 2EDGA 1E22A 4A3KB 3DWAA 2FMMA 3HOXG 2LMCB 1Q1BA 4G7ZC 4JI2L 2UXDQ 5FLXc 4A76A 3MZ5A 3HOVG 2YTYA 3K0YA 3NXWA 2VB3X 2H4OA 1E24A 1PTOF 1EQRA 3J7AV 4K6LA 2EYMA 3H94A 2ZJPA 4JI0Q 3L3OC 1XNRQ 5IYBH 1G2SA 4EQ5A 1N32L 2K4KA 5EGTA 2NTSA 4JOIC 1LT5D 4CDDC 2K5NA 4RHSA 1VDZA 5C4XH 3GTJH 3EQLC
chains in the Genus database with same CATH topology
3KLSX 4RCNA 2F1MA 3N6RA 3J81E 3DEOA 4NW2A 1PRTB 1T5XD 3OIPA 1C4QA 4V0BA 2XNAC 1H9RA 5EKIA 1BNZA 1UNSA 5JPNC 4LJZC 1SNPA 2E76C 3D4DA 4CKBA 2EJMA 3V96A 1X3PA 3MVVA 4ZLTF 4K8IA 5M5YB 1S5FD 2EOTA 2HUGA 1BF4A 2M9VA 1QWYA 2E2HB 5C4ZA 4H44C 2KCCA 2IWHA 2BDOA 1SNMA 2HCIA 1ML0D 2IX3A 1SNCA 1D5ZC 1ZYRC 5C3EB 5KYLA 4KJOA 3QJYA 2RKSA 3SK6A 5IGEA 1A15A 1J9OA 4HCEA 2MGSA 3D4RA 3S14B 3RD4A 4NKLA 3P75A 4CJ0B 3WDNA 3MXNA 1LTAD 4O1NA 2AUKA 2NN6G 1JICA 4A3GB 4KHZA 4EQNA 3H09A 1RODA 4BBRB 3M7GA 1WTVA 2MUYA 4A3FB 3NSWA 1PRTF 2EJGC 2B8FA 5FO7B 5ELCA 1EY5A 3MXUA 2WIIB 5E4WC 1QNKA 1TS4A 2PZUA 4OL7A 4CBVA 3G6JB 1G8ZD 2EY1A 3K57A 2JA8B 3GV6A 3VR3A 3GTPB 1KDCA 1I4RA 2PNRC 1EY9A 4IFDH 1PTOD 4RFBA 3VA5A 4NMZA 4HSVA 2JXMB 5LHY1 4IN3A 4R9WA 1TY0A 1GUSA 2R61A 2RDFA 3FVQA 3MXGA 1KDBA 2K33A 1LT4D 1XXGA 1F2LA 4J8QA 3I72A 1GUNA 2HCCA 5F2DA 1DM0B 5CBAE 3BDCA 1KAAA 5JEAJ 2ZXRA 1DOLA 4WJWA 1LT6D 3HKZB 1YNND 1AW7A 5IGBA 4HAEA 3BYYB 1M4VA 1OXXK 4ODGA 3LX0A 4EQOA 3M85A 5IGCA 2LFNA 3EJIA 1LTRD 1FD7D 3P1HA 4H0LC 2NZ1D 5COYA 2WV6D 4OHJA 2KVMA 2NVXB 1J8IA 4A3BB 2EYOA 3PUXA 3HOWB 3U9OA 1B53A 3S16B 1PZJD 4DF7A 5BN5A 4FXKC 2HDMA 3VYSA 1STHA 2YU9B 5G3LF 2NTTA 3TP6A 1TWCB 4IUNA 1KDAA 4L63B 3BZDB 5A35A 1G291 4X3SA 4F87A 2JA6B 1QILA 4CJ1B 2JSOA 1SAPA 3SK4A 5I2XA 1PFBA 1BQQT 3D8GA 3NPPA 3H6MA 4K5XA 2PZTA 1I4XA 4H7BA 4QUCA 3C1FA 4CKEA 1FNVA 4RGMA 2NUCA 2RA4A 4JBWA 1MSGA 2IJ0A 3IAYA 5I9PA 4C2MB 3D6CA 5E3FA 1F2MA 3J80L 1EY7A 1PYWD 3GTGB 3OIQA 1BCPF 1I4QA 2PW7A 1SE4A 2EY6A 3L7ZC 1ILQA 1JC7A 1S5ED 3E5SA 1O80A 1PRTC 5M5WB 4KKTA 4ABNA 1K8MA 4XQNA 4XIGS 3OOCA 2LS01 1H9SA 2B39A 1LTTD 1JWSD 4ME5A 1UUPA 4IUTA 5C5MA 2TSSA 4HMJA 1ONLA 2G9HD 3X3NA 3MA2B 4V190 3CU7A 1YNNC 4FNFA 1SE2A 3A8JE 4KMUC 4WRDA 5E1FA 1I4GA 2BE5C 4KN7C 3IKJA 2F0SA 2SNMA 2A6HC 2IX1A 1Q90A 1DD2A 5EPLA 1B3AA 3LNNA 2R93B 3K7AB 1AEXA 5FO8B 1C48A 1CZWA 1U4LA 1W6KA 4ZYSA 1Q12A 2KJXA 4MHEA 1KNAA 1XYIA 1A2TA 2WKCA 2L11A 3EA6A 4R8NA 2YYZA 4BWGB 1GXDC 3D4WA 1LLRD 4X3KA 2RDGA 2B2TA 1D1KA 2B8GA 4L6TB 1SNOA 2F0NA 3VR2A 2WAQB 1Y69U 3BG3A 2KECA 2X6LA 1VF7A 3NWTA 3OMGA 3MFGA 2XRQD 3OMCA 5J1ZA 2ICEC 5I2YA 1CT1D 3BVZA 3J7YW 1Y8PB 4KHVA 5FLXE 2KEEA 3OWFA 1CZGA 1V1PB 3DWPA 4UDUC 5IGDA 1FYCA 5EKKA 1ZEQX 3T56B 1GOZA 3VR4A 5KGUA 1RDPD 3NHHA 1G2TA 3PUVA 4J6HA 1O78A 1CHPD 3CRLC 5DNFA 1F9SA 2QF7A 4K5VA 3TSSA 3HOYB 5C4HA 1JWMD 1EQTA 4K6DA 1I6VC 3RMHA 4B08A 2CW0C 4S3SA 5ELBA 1RTOA 3SK8A 3J80E 5M3MB 3I91A 1EU4A 1AN8A 4Y7NB 2A69D 2Z1CA 5A2QE 1EEFD 1SBBB 1STGA 4QIWB 4HN7A 5CR3A 2O5JC 3IFDA 4TSSA 2HDLA 2EYFA 4AYBB 3DEPA 1BUVT 4KKSA 4IUUA 4X3TA 4XT1B 4XTCS 2B2UC 1DJRD 3PIO3 3I3CA 2BA0A 1PTOH 4ZUJA 1HTLD 4G57A 1WTQA 3PUZA 1S5DD 3VYUA 2QILA 1S5CD 1SNDA 5IT9L 5G3LD 3A8KE 3WOFA 5I9OA 2PQEA 3NTIA 1VMCA 1U9RA 2E75C 1XX8A 5M9OA 1CA5A 3HP3A 3CRKC 1Q8IA 3GTQB 2AWOA 1QCBD 1V1OA 2K04A 1MD2D 1EYCA 3HOXB 2F0KA 4F8MA 3DUZA 2F3WA 1EL0A 3Q6SA 4FYDA 4NP5A 3OHXC 3O13A 3K59A 3T13A 2J7ZA 1T5EA 1EZ6A 2XVSA 3DHQA 4BBSB 3C2PA 3ND9A 1AZPA 1JB3A 1S4ZA 1IKMA 1OXUA 3S9WA 1DXMA 1JQYD 1STEA 3GD7A 2NWGA 3V2TA 3K5NA 1TY2A 5EJWA 4ULLA 2K5DA 4C56C 3RZOB 5C4JB 3PMFA 1VCIA 1RD9D 4MN3A 2XN9C 1QNUA 1AP0A 2XWBB 4RCOA 2E2IB 1PDQA 2EZVA 4F7XA 3HOUB 3LWUA 4LMQD 1NR4A 1QE6A 5CV9A 1SYCA 3S15B 1B1ZA 3S1QB 5KRUA 1IW7D 4KY5A 1NSNS 5EQ0A 2K01A 3K5OA 3AU7A 5IOCA 2Y0SB 3E6ZX 3VA7A 2IX0A 1R9TB 4G4KA 5K5PA 1TR5A 1E2WA 4I7ZC 3NWSA 1K8OA 1JOKA 5C0XJ 2N55A 2QEJC 3I90A 4FVMA 3H0GB 1LTGD 1TU2B 1EIGA 1HA5A 5DAUA 1KLUD 4HMIA 1HUNA 2K1BA 4Q0FA 2EJFC 3R93A 1CA6A 4BA1I 1XWEA 3D6WA 1PLFA 2X6GA 3AMUA 2F03A 1B50A 3K6OA 1C8CA 2HQEA 4ZKCB 5FKAC 3I8ZA 2A68C 4HR7B 4FF3A 1SNQA 2FMCA 3TMEA 4B9XA 2EYPA 1PZKD 2EY5A 3BYTB 4EVOA 3SHLA 1ILPA 2XRSD 3IL8A 3QIAA 1CTMA 4BA2I 3K5MA 4OO1I 2JA5B 2I46A 5J39A 1IKLA 1WTXA 4A3DB 2B2YA 2F0UA 5BN4A 4R8IA 3NBHA 5C4XB 4BY7B 3T51B 5HGTA 2PPBC 1HA6A 1E2ZA 1NAPA 3ITPA 4TRDA 3PO2B 1TQOA 1DONA 4P2CB 2SOBA 3R2TA 2A6ED 2F0WA 4IZ8A 3OWEB 4K5WA 3MC0B 4IURA 2BE5D 2A6EC 4OGQC 2EY2A 1RJTA 4QUFA 1WTPA 4HCSA 4ILWA 3DXJC 1EWCA 4PMBA 4QB4A 3PIP3 3FKIB 1Q1EA 1EY0A 2EYLA 1SSOA 1PTOB 2Q8IB 5FK9C 1ZYRD 3GP7A 5E4XA 2B2TC 3FMCA 3SXHA 1JE4A 1IHZA 3GTMB 1H9KA 5M3FB 4ID6A 4C3IG 3J7AF 1GUGA 3I70A 3PUYA 1U4PA 4G7HC 5M5XB 5ELDA 1EQVA 4K14A 3JAML 1SYFA 4LAAA 2F0MA 3M7NA 5LL6X 5CMDA 3DMUA 1Y1VB 4OO1G 1FGBD 4QMGA 4RGOS 1OO9B 1O7LA 5FO9B 1HFNA 1KTKA 2G9DA 4FP5D 2K5QA 3CQZB 2CQAA 4I65A 4QF4A 4WFN3 3EVQA 3I73A 4LK1C 4YIJA 3NP8A 1JOQA 2F0FA 3SK5A 1WTRA 1B4OA 2KCNA 1EWHA 3RLFA 5D3IB 3C1EA 1KLGD 4QCLA 4H13C 3TN2A 1RKNA 2OF1A 2VNUD 4A3IB 1TKWB 1CQVA 3P20A 1GUTA 5KIXA 2OXPA 3H91A 3DM1A 3MEHA 5C44B 3S17B 4C1NI 4RKLA 2QCPX 1ENCA 5JJZA 2N88A 2ZXPA 2L9HA 3OW7A 4CJ2C 1EIHA 5KNDA 2L0CA 5JEAH 1SE3A 3W3AA 2Z4HA 3DWQA 1F2ZA 3QO2A 2Q8RE 3MFYA 4K2LA 2J4XA 2K6AA 2WP8J 2CVRA 4DN4M 4DAVA 4DA2A 3OSOA 4TKOB 4A3EB 1PTOC 2A69C 3U9SA 4KD3A 4B9WA 4KY6A 5ELFA 2Q8TA 1DYQA 3QOJA 1E0BA 2F4IA 4C3HG 5J22A 1SYBA 3S2DB 4IUQA 5NUCA 3SR1A 2M00A 4KV6A 3QOLA 3HZXA 2L5TA 1PZID 4KD4A 3F2UA 2O2LD 3T4AC 1B2TA 1MGSA 1ENFA 2F0PA 1LT3D 4A3JB 3GO5A 2RSNA 2B2UA 1LACA 4DAPA 1ESFA 2K5WA 4TQUS 3C3LA 4IFDI 1SDFA 1CI3M 3K5LA 1LO5D 4HSPA 1IW7C 1DCZA 3SE0A 2PO4A 2M2LA 2A5HA 1F2YA 2MPMA 2ENBA 2CW0D 1BR9A 1W6JA 3D31A 3R3OA 1CFMA 1WD1A 4U68A 1STNA 3S2HB 1I4HA 3A7AB 1D2BA 1F9QA 1TWFB 2DY7A 4RGNA 1CK1A 4K2KA 2NVYB 2LKVA 3G7LA 4IFDJ 4XXEA 4UAIA 5I4DA 1GUOA 2WINB 2ICIA 4RAUC 1B44D 3QWNA 1HUMA 1SYGA 1HCZA 1X3QA 1JWUD 2F0OA 3EFXD 2B2WC 3S1MB 1S5BD 2QKIC 2KHSA 2PYKA 3A55A 5D14A 1SJHD 4DK0A 5D65A 1SMYD 3GV3A 1OXTA 4XQJA 5C0XH 1ZXTA 4DNTB 3I4MB 4A3MB 2JEAI 1B9MA 2L55A 1H9JA 1PRTD 3PUWA 2Z4IA 3JAME 1PXUA 1BDOA 3SDZA 4N9PA 1Z47A 5IT9E 3LWEA 2I07B 2SDFA 1QJOA 1A3UA 3KBGA 2KUMA 5FOBB 5CORA 1DOKA 1JCKB 3VR6A 2B2YC 1H9SB 3NK9A 3A8IE 4OIJA 3BVMA 2F0LA 2FFKB 2F0TA 3HEJA 3D3RA 3SEBA 2F0GA 1RF2D 1STYA 5FLXL 3KK7A 5TSSA 2XWJB 2NBFA 4RWSC 2EE1A 2IPKD 2PCFB 1EY6A 1SMYC 1SYDA 1ZKOA 1Z6HA 4XQQA 2AQ2B 3BDOA 2OT2A 4BS9A 2ID0A 1A6XA 1JR0D 2EYHA 4KN4C 5DM73 1SEBD 2E2DC 4RH6A 3E0JA 4HTHA 5KEEA 3HG9A 1F77A 5C6AA 5CV4A 3S1RB 1NCVA 3X3MA 1V43A 4BY1B 2JP1A 2A74C 2WKDA 3RUZA 5JAVA 4Z9CB 4DU9A 4IQZA 3HS0C 3OPOA 3HRZC 3KBXA 5K36G 3FPPA 2AQ3B 3ND8A 3ZYYX 1EU3A 5ELEA 2L12A 2PMZB 4CHTB 1GHJA 1UEAB 5DEHA 3SVMA 5EPKA 2O5IC 4FXGC 3URYA 3PO3B 1V1PA 4G7OC 2BA1A 1I6HB 5C0XI 2DY8A 3M4YA 4RA8A 3WOEA 4C3IB 2K32A 4J1MA 2F0VA 2SNSA 4HEDA 4E6IA 1SJED 1LV9A 2DNEA 4DXFA 1ENAA 3TP5A 4FO2A 2D5DA 3GQBA 2SEBD 1E2VA 1D5MC 2K28A 3HOVB 4OO1H 3QG1A 3R2IA 1TT2A 3FEWX 4C1NK 2BCOA 3MXPA 3VYRA 1EYAA 1DOMA 2K05A 3T16A 2B63B 1BXTA 3A54A 2EPBA 1WVLA 1EYDA 2A6HD 3Q22A 2JE6I 1ET9A 1PFNA 2C5CA 4A93B 1I3QB 5HURA 2WACA 1TWHB 2D2CC 1TVXA 1YNJD 4KJNA 1ET6A 1X32A 2JEBI 1CQFA 4XYQA 5IGGA 1B9NA 5C5LA 3FRPB 2KQ3A 2JYOA 3TZUA 1PMRA 3EROA 5CGKA 4O42A 1A2UA 1G6ZA 1OXVA 1HXYD 5JOBA 5JEAG 4ZUIA 4IUVA 4ZKBB 5KYIA 2F0EA 1F9RA 1HQRD 1TS2A 1CM9A 1EFID 5DM63 4FXDA 4DXGA 1A3TA 2KEDA 1RTNA 2F0HA 3GTLB 5BN3A 4WORA 3AB9A 3VR5A 2QDBA 1KNEA 1V8QA 3GTJB 1U4MA 3M4OB 5KNBA 4KI0A 3A56A 1TWGB 2R6GA 1FNWA 1R4QB 2PZWA 2RVLA 2LY7A 2BDNA 1DZ1A 4FF1A 4KY7A 1MI2A 4EGVA 3NTHA 4RKBA 4IUPA 4DK1A 1AZQA 4FF4A 1O7ZA 5CC4A 4PV1C 3TP7A 2GA4B 4XDXA 4EQPA 1VF5C 3GTKB 2DNCA 1WCMB 4JK1C 4CGYB 1JORA 3FPUB 3R8BA 3Q0AA 4GZYC 1VMPA 2RBMA 1HRJA 1WTWA 1XTCD 5IODA 2WB1B 2PW5A 2B2VA 5D3DA 4KK7A 2R7ZB 2O4XA 2KOLA 1QB5D 4FF2A 2E2JB 1RHPA 2L4NA 2Z8LA 3N52A 1LTSD 1I50B 1HQMC 4M1UB 1HHVA 2VXWA 4N9TA 4ZRZA 2OEOA 2JA7B 2F0QA 2RSOA 2AWNA 4RHRA 1YNJC 5C3XA 4M8AA 2F0IA 4IALA 2NN6I 3C46A 3BDLA 1U4RA 4C3HB 1ESRA 1ICWA 4PMWA 4MIUA 2TMPA 2RQXA 5C0XG 1O7YA 1PFMA 3CKIB 3KLRA 1HTPA 2EYJA 2F0DA 3I4NB 1HFGA 2VUMB 5CYUA 3P7JA 4DNRB 2K03A 2IT1A 1EOTA 1FNUA 5A2QL 4F88A 2H1EA 4C3JG 1WTOA 4ZQ3A 4C3JB 2IW3A 3V05A 4L8JA 4Q5VA 3TBIB 5T1GA 3L9AX 2J0TD 1UAPA 5KNCA 2XIWA 3HGBA 1JOOA 3KF8A 3NUCA 2R92B 1IYUA 3MWYW 3KUPA 4DFAA 1STBA 1LTBD 2KA7A 1BCPC 5EBCA 1R4PB 4XT3B 4DAYA 4RGTA 3TZDA 3NBIA 1Z7TA 1Q3LA 1KABA 1TS3A 2F0JA 5EKLA 1BO0A 3IFTA 1LABA 1F9PA 2ZT9C 1TIID 4NDXA 2D62A 4CKCA 3W2DA 1FR3A 2BOSA 1STAA 4OIKA 4X3UA 3MAQA 1RCVD 1QOHA 4XYOA 3MHBA 1GHKA 2L1BA 5EBDA 2NN6H 4PMCA 3TDQA 2XSCA 1II3A 3Q24A 2R3ZA 2FINB 3BS1A 3S1NB 1TWAB 3NQIA 2MJ8A 1SYEA 5K36H 1Y1WB 2RDHA 2E74C 3NE5B 5CV5A 4ZK9B 3NTKA 1NUCA 2MHVA 2X69A 5C3WA 1AFPA 3FDTA 2FJ2A 2ZXOA 3T53B 1Y8OB 1D6EC 5CV8A 1LTID 1I4PA 5T1IA 4KKUA 1QG7A 5CV7A 3I4LA 2NVTB 1EY4A 3QB3A 1H9MA 1BOSA 4IFDG 5CBEE 2NVQB 1CHQD 2AQ1B 2NYZD 2B2VC 2EVBA 2V4DA 4PQXA 5JPMC 1GUWA 5JVH3 4U673 2CHBD 2NB0A 3BVGA 1TS5A 3ERQA 3PV0A 3GTOB 2A68D 3UI2A 2AUJD 4DGZA 4PNYA 1L0XB 4ZAIA 3J81L 2DN8A 1A3VA 1G91A 4KTAA 3CHBD 2IL8A 1GJXA 1M8AA 1BCPD 5ISRA 1MSHA 3H3VC 1EZ8A 1MBYA 2EXZA 3TP8A 1Y8NB 5IGFA 1D5XC 2B2WA 1IL8A 1IYVA 2MP1A 1NR2A 5I6WA 3K58A 1HPCA 3MTSA 3Q23A 1L0YB 4K8JA 1EEID 5AFWA 3A7LA 3RZDB 1BBXC 1D1IA 1K83B 1SXTA 5I6YA 2C9OA 5JVG3 2VB2X 3M3YB 3KLSA 3HOZB 5IIFA 3ONAB 1BCPB 2D9UA 2FHTA 2K7VA 1OXSC 5LL6S 5CV6A 1SFOB 5EPJA 1WD0A 2A73B 3NQTA 3VYTA 2F3VA 1EY8A 2EDGA 4A3KB 3DWAA 2FMMA 2LMCB 1Q1BA 4G7ZC 3MZ5A 3K0YA 3NXWA 2VB3X 2H4OA 1PTOF 3J7AV 2EYMA 3H94A 4K6LA 3L3OC 1G2SA 5EGTA 2NTSA 1LT5D 4RHSA 1VDZA 3EQLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY5 A;  1F2Z A;  3SK5 A;  5C3X A;  2F0J A;  4EVO A;  5EKL A;  2F0I A;  4LAA A;  2F0M A;  4IAL A;  3SHL A;  1KDC A;  1STN A;  4K2L A;  1EY9 A;  3MXP A;  1STG A;  3PMF A;  3VA5 A;  5ISR A;  1EY6 A;  5CR3 A;  4NMZ A;  4NDX A;  1A2T A;  3DMU A;  1EZ8 A;  3SK4 A;  4R8N A;  4K2K A;  1SYD A;  3D8G A;  1EYA A;  3BDL A;  1SNP A;  2LKV A;  3D4D A;  3D4W A;  3H6M A;  2EXZ A;  4K5X A;  2PZT A;  4QMG A;  1STA A;  3TP8 A;  2EYF A;  5J39 A;  2PZW A;  3T16 A;  4H7B A;  3MVV A;  3OSO A;  5IGF A;  2F0U A;  2RDF A;  3C1F A;  4K8I A;  3MHB A;  1KDB A;  4F7X A;  2EYH A;  4KY7 A;  2NUC A;  4MIU A;  4PMC A;  1EYD A;  5HGT A;  1SYG A;  1II3 A;  4I65 A;  5I6W A;  4KD3 A;  2F0O A;  1SYC A;  4QF4 A;  4RKB A;  5CV9 A;  5C4Z A;  5F2D A;  3EVQ A;  4B9W A;  4KY6 A;  3BDC A;  1SNO A;  4ZUJ A;  1KAA A;  4HTH A;  1SNM A;  3ITP A;  3NP8 A;  4YIJ A;  5KEE A;  5I9P A;  1JOQ A;  2F0N A;  2KHS A;  5HUR A;  2EYJ A;  1NSN S;  2F0F A;  2F0D A;  2WAC A;  3D6C A;  1SNC A;  2PYK A;  3QOJ A;  4G57 A;  1TQO A;  4K8J A;  4TRD A;  5E3F A;  5J22 A;  4KTA A;  5CC4 A;  1F2M A;  1SYB A;  1EY7 A;  2SOB A;  5C6A A;  5KRU A;  1SYE A;  5CV4 A;  2F0W A;  1SND A;  4IZ8 A;  4K5W A;  3TP7 A;  5KYL A;  5NUC A;  5IOC A;  4KJO A;  5I9O A;  5IGB A;  2PQE A;  5I6Y A;  2RKS A;  3C1E A;  2PW7 A;  3OMG A;  2EY6 A;  4KJN A;  1U9R A;  4ODG A;  5CV5 A;  3LX0 A;  3SK6 A;  3SR1 A;  2M00 A;  3OMC A;  4KV6 A;  5J1Z A;  4EQO A;  3RUZ A;  5JAV A;  3QOL A;  3HZX A;  4DU9 A;  5M9O A;  1NUC A;  4ZQ3 A;  1JOR A;  2EY2 A;  3E5S A;  4NKL A;  5IIF A;  5IGG A;  3P75 A;  4KHV A;  3EJI A;  5C3W A;  5IGC A;  5K5P A;  1TR5 A;  2RBM A;  4KD4 A;  3OWF A;  3P1H A;  5C5L A;  1JOK A;  1EYC A;  4PMB A;  5CV6 A;  1RKN A;  2KQ3 A;  2OF1 A;  2F0K A;  5CV8 A;  4N9P A;  4F8M A;  4ME5 A;  4QB4 A;  4EQN A;  5IGD A;  5IOD A;  2PW5 A;  5EKK A;  5CV7 A;  1EY4 A;  5C5M A;  2F0P A;  2F3W A;  3QB3 A;  5DAU A;  2O4X A;  5DEH A;  2EYO A;  4HMI A;  5KGU A;  4HMJ A;  5KIX A;  3ERO A;  3U9O A;  4EQP A;  1EY0 A;  3NQT A;  4NP5 A;  2EYL A;  1A3U A;  3NHH A;  5CGK A;  2OXP A;  3R3O A;  4J6H A;  2F3V A;  3T13 A;  1JOO A;  1A2U A;  1EY8 A;  3NUC A;  4DF7 A;  3MEH A;  1STH A;  4WRD A;  4DFA A;  1EZ6 A;  1EY5 A;  1STB A;  5JOB A;  5IGE A;  4RKL A;  4ZUI A;  5E1F A;  3MZ5 A;  1ENC A;  3DHQ A;  3NK9 A;  3NXW A;  4K5V A;  3SXH A;  3TP6 A;  4J1M A;  2F0V A;  2SNS A;  5C4H A;  1IHZ A;  2EYM A;  2F0L A;  2F0E A;  5KYI A;  4K6D A;  3ERQ A;  2F0T A;  4E6I A;  2PZU A;  4IUN A;  1KDA A;  4OL7 A;  2F0S A;  2SNM A;  4ID6 A;  3HEJ A;  4N9T A;  2F0G A;  5EGT A;  2HQE A;  2OEO A;  1F2Y A;  1STY A;  4KY5 A;  4DGZ A;  3S9W A;  1ENA A;  1A3T A;  4PNY A;  4S3S A;  3TP5 A;  2ENB A;  1SNQ A;  2F0H A;  2F0Q A;  1A3V A;  2EY1 A;  1EQV A;  4K14 A;  3TME A;  1KAB A;  1AEX A;  4WOR A;  3SK8 A;  2QDB A;  3V2T A;  4B9X A;  2EYP A;  1SYF A;  1TT2 A; 
#chains in the Genus database with same CATH topology
 3KLS X;  4RCN A;  2F1M A;  3N6R A;  3J81 E;  3DEO A;  4NW2 A;  5BR8 L;  1PRT B;  1T5X D;  2QDL A;  3OIP A;  4LF8 Q;  2I5M X;  2NZH A;  1C4Q A;  3CCR A;  3B6Y A;  4V0B A;  2XNA C;  1H9R A;  5EKI A;  2ZM6 L;  1UNS A;  1X3E A;  3MXN B;  1BNZ A;  5JPN C;  4LJZ C;  1SNP A;  2E76 C;  3D4D A;  3KFU A;  4CKB A;  4DV4 L;  2EJM A;  3V96 A;  1VQF A;  1X3P A;  3MVV A;  4ZLT F;  4K8I A;  4QJF A;  4BXX H;  5M5Y B;  1S5F D;  2UUC Q;  2EOT A;  2HUG A;  3F2D A;  1BF4 A;  2M9V A;  4AYB G;  1QWY A;  2E2H B;  2UXC L;  5C4Z A;  1VQ9 A;  4H44 C;  1N33 Q;  2KCC A;  2IWH A;  2BDO A;  1SNM A;  3CCU A;  2HCI A;  1ML0 D;  2IX3 A;  4DAM A;  1SNC A;  1D5Z C;  3OW2 A;  1ZYR C;  5M3F H;  1WCM G;  5C3E B;  4X65 L;  5KYL A;  2N78 A;  4KJO A;  3QJY A;  2RKS A;  3SK6 A;  5IGE A;  1Y14 B;  1A15 A;  1J9O A;  4HCE A;  2MGS A;  3D4R A;  3S14 B;  2YV5 A;  5C3E H;  3RD4 A;  4NKL A;  3P75 A;  1VQ4 A;  4CJ0 B;  3WDN A;  1IBM Q;  4LUV A;  3MXN A;  1LTA D;  4O1N A;  2AUK A;  3M9B A;  2NN6 G;  1JIC A;  4A3G B;  4KHZ A;  1PH9 A;  4EQN A;  3ER0 A;  4KHP L;  3H09 A;  3I4M G;  1ROD A;  4BBR B;  2VUM H;  1EYG A;  3M7G A;  4NB3 A;  1WTV A;  2MUY A;  4A75 A;  4A3F B;  1U0L A;  3KJO A;  3NSW A;  4BBR G;  1PRT F;  2EJG C;  2B8F A;  1TWA H;  5FO7 B;  5ELC A;  2L15 A;  1EY5 A;  4A3F G;  3MXU A;  1NY4 A;  2WII B;  5LMN W;  5E4W C;  1Y1W H;  1QNK A;  1YVC A;  1TS4 A;  2PZU A;  4OL7 A;  4IO9 A;  3UDF A;  4CBV A;  1JMC A;  4DPG A;  3G6J B;  1G8Z D;  2EY1 A;  4NXM L;  3K57 A;  2JA8 B;  3GV6 A;  4L5Q A;  3VR3 A;  5IYC H;  4GKK Q;  2CH4 W;  3GTP B;  1KDC A;  1I4R A;  2PNR C;  1EY9 A;  4IFD H;  1PTO D;  4RFB A;  3VA5 A;  2JA8 G;  1YBY A;  4NMZ A;  4DAY B;  4HSV A;  1V9P A;  2JXM B;  5LHY 1;  4IN3 A;  3H15 A;  4DR3 L;  4GOP B;  4R9W A;  1TY0 A;  4L5S A;  1E1T A;  1CUK A;  3BZC A;  1GUS A;  2R61 A;  2RDF A;  3FVQ A;  3MXG A;  3E9H A;  1KDB A;  2K33 A;  1LT4 D;  5JJL A;  2VY3 A;  4GNX B;  1XXG A;  1F2L A;  4J8Q A;  2ZTE A;  3I72 A;  2E2I H;  2BH8 A;  3UDX A;  1GUN A;  2HCC A;  2VQF Q;  4JVZ A;  5F2D A;  1DM0 B;  5CBA E;  3CCE A;  3BDC A;  1KAA A;  5JEA J;  1UE6 A;  2ZXR A;  1GO3 E;  4AIM A;  1DOL A;  4WJW A;  1LT6 D;  4I7A A;  3CCJ A;  1UE7 A;  3HKZ B;  4X66 L;  2ASB A;  1YNN D;  3HOY H;  1AW7 A;  1NBW A;  2HQL A;  5IGB A;  4HAE A;  2OCE A;  3K7U C;  3BYY B;  1M4V A;  1OXX K;  4ODG A;  3LX0 A;  4EQO A;  2LXK A;  2Z6K A;  4IJH A;  4KLK A;  1LTL A;  3M85 A;  3PQI A;  5IGC A;  2LFN A;  3EJI A;  1LTR D;  1FD7 D;  2UXC Q;  5E7N A;  2NVX H;  4GOP A;  3P1H A;  4HJ7 A;  4H0L C;  1PFS A;  2NZ1 D;  5COY A;  2WV6 D;  4OHJ A;  3CW2 C;  2KVM A;  5GAE C;  2NVX B;  1J8I A;  4A3B B;  4JCV E;  2EYO A;  2UUA L;  3H0G H;  3PUX A;  3HOW B;  3U9O A;  4IPH A;  1B53 A;  3S16 B;  1PZJ D;  4AQY L;  1XPO A;  4DF7 A;  5BN5 A;  4FXK C;  2RHQ B;  2HDM A;  3VYS A;  1STH A;  2UUB Q;  2YU9 B;  5G3L F;  2NTT A;  3TP6 A;  1TWC B;  2IY5 B;  1YI2 A;  4IUN A;  1KDA A;  3RNU A;  4L63 B;  3BZD B;  1B3Q A;  3PO3 G;  5A35 A;  4CDF C;  3HOZ H;  1C0A A;  1G29 1;  4X3S A;  4X62 L;  4F87 A;  2JA6 B;  1QIL A;  2VQF L;  4CJ1 B;  1J6Q A;  2JSO A;  3F8T A;  1SAP A;  4DV1 L;  3SK4 A;  1FJG L;  2JA6 G;  5I2X A;  1PFB A;  1BQQ T;  3D8G A;  3NPP A;  3H6M A;  1VQG A;  4K5X A;  3HOV H;  2PZT A;  1I4X A;  1EWI A;  4H7B A;  4QUC A;  2JQO A;  3C1F A;  4CKE A;  3I56 A;  1FNV A;  4RGM A;  2NUC A;  2RA4 A;  1VQ8 A;  4JBW A;  1MSG A;  5C4X G;  2IJ0 A;  3IAY A;  4P73 A;  5I9P A;  4C2M B;  1YJN A;  5H1S E;  3M4O H;  1HZA A;  3D6C A;  5E3F A;  1F2M A;  3J80 L;  1EY7 A;  1PYW D;  3GTG B;  3OIQ A;  2VQE Q;  1K73 C;  1BCP F;  1MKH A;  4DV5 Q;  1I4Q A;  2PW7 A;  1SE4 A;  2EY6 A;  1L0W A;  3L7Z C;  1ILQ A;  1JC7 A;  5GAH C;  1S5E D;  3E5S A;  1O80 A;  3EBE A;  1PRT C;  5M5W B;  4KKT A;  4BXX G;  4ABN A;  1K8M A;  4XQN A;  4XIG S;  3OOC A;  4UHV A;  2ATW A;  2LS0 1;  1H9S A;  2B39 A;  1C7Y A;  1LTT D;  1JWS D;  4ME5 A;  1UUP A;  4IUT A;  5C5M A;  2ZTC A;  2TSS A;  4HMJ A;  1ONL A;  1VQH A;  2G9H D;  3X3N A;  3MA2 B;  4V19 0;  3CU7 A;  1YNN C;  4FNF A;  1A63 A;  1SE2 A;  3A8J E;  4KMU C;  4WRD A;  4YHH L;  5E1F A;  1I4G A;  4LFA Q;  2BE5 C;  4KN7 C;  2VS1 A;  3IKJ A;  1RIP A;  2F0S A;  2SNM A;  4X65 Q;  2A6H C;  1HR0 L;  2IX1 A;  1Q90 A;  1DD2 A;  1FL0 A;  5EPL A;  3LNN A;  1B3A A;  1KHI A;  3K7A B;  4LF5 Q;  2R93 B;  2OQK A;  3MEF A;  1AEX A;  5FO8 B;  1C48 A;  1CZW A;  1U4L A;  2DUD A;  3CF5 A;  2R93 G;  4B3M L;  1PH4 A;  1W6K A;  4ZYS A;  1Q12 A;  2HD3 A;  2KJX A;  4MHE A;  1KNA A;  3L0O A;  1A2T A;  1XYI A;  2WKC A;  4JYA Q;  2L11 A;  3EA6 A;  4R8N A;  2YYZ A;  1L1O A;  4BWG B;  3VDY A;  1ASY A;  1GXD C;  3D4W A;  1D8L A;  2CKZ B;  4A3F H;  4JG2 A;  1LLR D;  4X3K A;  2RDG A;  2B2T A;  3HFZ B;  1N33 L;  4ALP A;  4JI6 L;  4L5R C;  1D1K A;  3OTO L;  2WAQ G;  1PH2 A;  2B8G A;  4L6T B;  1SNO A;  3TQY A;  3S1N H;  2F0N A;  3VR2 A;  2WAQ B;  1Y69 U;  1QZH A;  3BG3 A;  1HNZ Q;  4HIK A;  2KEC A;  4A3E G;  2KCM A;  3JAM i;  2X6L A;  1VF7 A;  1BBW A;  3NWT A;  1G51 A;  5LMU Q;  3OMG A;  1E3P A;  1PH1 A;  3MFG A;  2XRQ D;  3OMC A;  5J1Z A;  2ICE C;  5I2Y A;  1CT1 D;  3BVZ A;  3J7Y W;  3Q8D A;  1Y8P B;  4KHV A;  1XJV A;  2UXD L;  5FLX E;  2KEE A;  3OWF A;  1CZG A;  5FJ8 H;  1V1P B;  3DWP A;  5EAY A;  2MO1 A;  4PG3 A;  2ES2 A;  4UDU C;  3HOX H;  2A8V A;  5IGD A;  3RLO A;  2NVT H;  1FYC A;  5EKK A;  1ZEQ X;  3T56 B;  4DV3 Q;  1GOZ A;  4DNI A;  4B3R L;  2CWP A;  3VR4 A;  3KF6 A;  5KGU A;  2CQO A;  5IY0 A;  1RDP D;  3NHH A;  1G2T A;  3PUV A;  4EX5 A;  4J6H A;  2F4V L;  1O78 A;  1CHP D;  3HOY G;  3CRL C;  2WB1 E;  5DNF A;  1F9S A;  3J81 c;  3GTK H;  2QF7 A;  4K5V A;  3TSS A;  5LMN Q;  1UE1 A;  1YZ6 A;  2LXJ A;  4R4I A;  4JI7 Q;  5C4H A;  3HOY B;  1JWM D;  1EQT A;  4K6D A;  4P71 A;  2Z9H A;  3PF5 A;  4AQY Q;  1I6V C;  3RMH A;  4B08 A;  2CW0 C;  4S3S A;  5ELB A;  1IXR A;  1RTO A;  4JPB W;  4OWT B;  3SK8 A;  5M3M B;  3J80 E;  1IL2 A;  3I91 A;  1EU4 A;  3UDI A;  1AN8 A;  4Y7N B;  2A69 D;  4OXP A;  4JI4 Q;  2Z1C A;  5A2Q E;  4LF7 L;  1EEF D;  1SBB B;  1STG A;  4QIW B;  5M3M G;  4HN7 A;  5CR3 A;  2O5J C;  3A5Z B;  1K3B C;  2JA7 G;  3IFD A;  4DKA C;  4TVA B;  1VQA A;  3E3X A;  4TSS A;  2HDL A;  2EYF A;  1I3Q H;  4AYB B;  2E2H H;  1CKN A;  3DEP A;  1K83 H;  1BUV T;  4KKS A;  3S24 A;  4IUU A;  4X3T A;  4XT1 B;  1I6H H;  4XTC S;  2B2U C;  1DJR D;  2DGY A;  3PIO 3;  1XNQ Q;  1MIU A;  3I3C A;  4YY3 Q;  2BA0 A;  1PTO H;  4ZUJ A;  5C3E G;  1HTL D;  4G57 A;  1PH5 A;  1VQC A;  1WTQ A;  1A62 A;  3PUZ A;  4DV3 L;  1S5D D;  3VYU A;  1CKM A;  2QIL A;  1S5C D;  1SND A;  5IT9 L;  5G3L D;  3A8K E;  3WOF A;  5I9O A;  2PQE A;  3NTI A;  1VMC A;  4LF9 L;  1U9R A;  3A0J A;  2E75 C;  1X6O A;  1XX8 A;  1N34 Q;  5M9O A;  1VQ5 A;  1SR3 A;  4RMF A;  1P8L A;  2RCN A;  1CA5 A;  3HP3 A;  2VUM G;  3CRK C;  1Q8I A;  1A0I A;  3GTQ B;  2AWO A;  1QCB D;  1V1O A;  2K04 A;  1MD2 D;  1EYC A;  4BBR H;  3HOX B;  1VQL A;  2F0K A;  3CP0 A;  4F8M A;  4N8F A;  3GDE A;  1HNZ L;  3DUZ A;  2F3W A;  3UE0 A;  1EL0 A;  3Q6S A;  2HIX A;  4FYD A;  4DV5 L;  4NP5 A;  3OHX C;  3O13 A;  3PF4 A;  1Q46 A;  3K59 A;  3T13 A;  2R7F A;  1MJC A;  1KC8 C;  4B3S L;  2J7Z A;  1T5E A;  1EZ6 A;  2XVS A;  3ULP A;  3DHQ A;  1YJW A;  1KAW A;  4BBS B;  1N8R C;  3C2P A;  3ND9 A;  1AZP A;  1JB3 A;  3AQQ A;  1DGS A;  2UU9 Q;  1S4Z A;  1T9H A;  4LF4 L;  1VS0 A;  1IKM A;  1PH6 A;  2JA8 H;  1PYS B;  2PMZ E;  1OXU A;  2QEX A;  3S9W A;  3HKZ E;  1DXM A;  1JQY D;  1KXL A;  1STE A;  3GD7 A;  2NWG A;  3J81 i;  3V2T A;  3K5N A;  1TY2 A;  3AFQ A;  5EJW A;  4ULL A;  2H5X A;  1N34 L;  4OEL B;  2K5D A;  4C56 C;  3RZO B;  5C4J B;  4QQB X;  3PMF A;  1XMO Q;  1VCI A;  1RD9 D;  4LFC L;  4LF6 L;  4IOA A;  1WYD A;  1JB7 A;  4MN3 A;  1N36 Q;  1X55 A;  2XN9 C;  1TWH H;  1QNU A;  3HOU G;  1AP0 A;  2XWB B;  4RCO A;  2E2I B;  1PDQ A;  5JJI A;  2EZV A;  4F7X A;  4YHH Q;  3HOU B;  3LWU A;  4LMQ D;  1NR4 A;  1QE6 A;  5CV9 A;  1SYC A;  3S15 B;  1B1Z A;  2Q2H A;  4GNX C;  1HZC A;  3S1Q B;  4DR4 L;  5EQ0 A;  1IW7 D;  4KY5 A;  1NSN S;  5KRU A;  2K01 A;  3JAM c;  3K5O A;  3AU7 A;  5IOC A;  2WAQ E;  4A3G H;  4JI8 Q;  2Y0S B;  3CCV A;  3E6Z X;  2R7Z H;  5L37 A;  3VA7 A;  2IX0 A;  4DV4 Q;  1R9T B;  3S17 H;  4A3C H;  4G4K A;  1HNW L;  3H0G G;  5K5P A;  1TR5 A;  1VQE A;  1LM0 A;  1E2W A;  2R7D A;  4I7Z C;  3NWS A;  1K8O A;  4DR2 L;  3J7Z C;  1JOK A;  5C0X J;  2N55 A;  2QEJ C;  3I90 A;  4FVM A;  3H0G B;  1LTG D;  2OTJ A;  1XPR A;  4HJ8 A;  1TU2 B;  1EIG A;  1YEZ A;  2K5V A;  1HA5 A;  4DV7 Q;  5DAU A;  1NMF A;  1KLU D;  2K14 A;  4HMI A;  1G6P A;  1OTC A;  1HUN A;  2ZTD A;  1SE8 A;  2K1B A;  4Q0F A;  2EJF C;  4AH6 A;  4A4I A;  3R93 A;  1CA6 A;  4BA1 I;  3PO3 H;  2F4V Q;  1XWE A;  2UXB Q;  4NXN L;  3NBH B;  3D6W A;  1YHB A;  1PLF A;  2PNH A;  2X6G A;  2E5L Q;  3AMU A;  4R4O A;  2F03 A;  1B50 A;  2GN5 A;  3K6O A;  3RZD H;  1C8C A;  2HQE A;  4ZKC B;  5FKA C;  3I8Z A;  2A68 C;  4HR7 B;  3EN2 A;  3UE1 A;  4FF3 A;  1UWV A;  3T1H Q;  1SNQ A;  2FMC A;  3TME A;  4B9X A;  1KD1 C;  2EYP A;  4DR7 Q;  1PZK D;  2EY5 A;  3BYT B;  4EVO A;  4X62 Q;  4C3H H;  1LUZ A;  1FVI A;  3SHL A;  1ILP A;  2XRS D;  3IL8 A;  1BKB A;  4K0K Q;  2JJQ A;  3QIA A;  2Q2T A;  1CTM A;  1XMQ L;  4BA2 I;  4YWK A;  3CMA A;  4DV1 Q;  3K5M A;  4OO1 I;  2N49 A;  2JA5 B;  2P5Z X;  2I46 A;  5J39 A;  1KRT A;  1IKL A;  1I94 L;  1WTX A;  4A3D B;  4JBK A;  2B2Y A;  2F0U A;  5BN4 A;  4R8I A;  3TEH B;  2JA9 A;  3NBH A;  5C4X B;  1L2F A;  4BY7 B;  3T51 B;  3PIP A;  2YTX A;  5HGT A;  2AKW B;  4R4T A;  2I5H A;  2PPB C;  4DR4 Q;  1HA6 A;  1E2Z A;  1NAP A;  1L1O B;  3ITP A;  3BJU A;  4TRD A;  4DR6 L;  3PO2 B;  2CWA A;  1TQO A;  1DON A;  4B3T Q;  4P2C B;  2SOB A;  1UEB A;  3R2T A;  3K8A A;  2A6E D;  2F0W A;  4IZ8 A;  4K5W A;  3OWE B;  4IUR A;  3MC0 B;  1J5E Q;  2BE5 D;  3BU2 A;  1HJP A;  5GQO A;  2EXD A;  2A6E C;  4OGQ C;  1SRU A;  2D0P A;  2EY2 A;  3HOW G;  1RJT A;  4QUF A;  3KJP A;  1WTP A;  4HCS A;  4ILW A;  3DXJ C;  1EWC A;  4PMB A;  2ZJQ A;  4QB4 A;  2YU9 H;  4X6A H;  3PIP 3;  4DV0 Q;  4LUZ A;  3FKI B;  1Q1E A;  1EY0 A;  2EYL A;  1SSO A;  1PTO B;  2Q8I B;  4ME3 A;  5FK9 C;  1ZYR D;  3J80 c;  3GP7 A;  5E4X A;  2B2T C;  3FMC A;  2KEN A;  3SXH A;  3WWV A;  4DR5 Q;  1JE4 A;  1IHZ A;  1VQO A;  3KDF A;  4GS3 A;  4B3S Q;  3GTM B;  2R93 H;  1H9K A;  5M3F B;  4ID6 A;  1HZ9 A;  4C3I G;  3S1M H;  3J7A F;  1GUG A;  3I4O A;  3I70 A;  1U4P A;  3PUY A;  4G7H C;  4LNQ A;  2NVQ H;  5M5X B;  5ELD A;  4K14 A;  1EQV A;  3JAM L;  3H3V H;  1SYF A;  4GLV B;  3KOJ A;  4CDE C;  4LAA A;  2F0M A;  3M7N A;  5LL6 X;  5CMD A;  3CC4 A;  3RN5 A;  3DMU A;  2MQH A;  1WI5 A;  1X3G A;  1Y1V B;  1WFQ A;  4OO1 G;  1FGB D;  4X64 Q;  4QMG A;  4RGO S;  2CCZ A;  1OO9 B;  1O7L A;  5FO9 B;  4LF9 Q;  1HFN A;  1KTK A;  1IBK L;  2G9D A;  4FP5 D;  3SGI A;  4A3E H;  2K5Q A;  3CQZ B;  1KIX A;  2B63 H;  2CQA A;  4I65 A;  1NJI C;  4QF4 A;  4WFN 3;  3EVQ A;  3I73 A;  4AYB E;  4LK1 C;  1IZ6 A;  3NP8 A;  4YIJ A;  4DK3 C;  1JOQ A;  2PQA A;  2F0F A;  3SK5 A;  1WTR A;  2UXB L;  1B4O A;  2KCN A;  1EWH A;  4JI5 L;  3RLF A;  2ALY B;  5D3I B;  3OYY A;  3C1E A;  1NMG A;  1I5F A;  2OQ0 A;  4NPS A;  4N8X 1;  1Q86 C;  4O2D A;  1KLG D;  1QZG A;  4QCL A;  2K75 A;  2EQS A;  4H13 C;  3F2C A;  4NXN Q;  3TN2 A;  4A93 H;  1X65 A;  1O7I A;  1RKN A;  2OF1 A;  1EFW A;  2VNU D;  1HNW Q;  3I7F A;  4OWX B;  4A3I B;  1TKW B;  1X54 A;  1CQV A;  4HIM A;  3P20 A;  1GUT A;  4JI3 Q;  1V1Q A;  5KIX A;  1X9N A;  2DJF C;  2OXP A;  1K9M C;  3H91 A;  3DM1 A;  3MEH A;  5C44 B;  3S17 B;  4A3G G;  4C1N I;  1ICF B;  5DLQ E;  4RKL A;  2WB1 G;  2QCP X;  5LMN L;  5IYD H;  1ENC A;  4BY7 H;  2R7Z G;  5JJZ A;  2N88 A;  2ZXP A;  4A3C G;  4RG1 A;  4OWW B;  2L9H A;  2VL6 A;  3OW7 A;  1JE5 A;  3GTQ H;  4CJ2 C;  4APV A;  1EIH A;  4CDC C;  5KND A;  5M3M H;  2UUB L;  1W3S A;  2L0C A;  3I2Z A;  3K7A H;  5JEA H;  2JA7 H;  2CFM A;  1MJE A;  1SE3 A;  3W3A A;  2Z4H A;  3DWQ A;  1F2Z A;  3TRZ A;  3QO2 A;  2Q8R E;  3MFY A;  4K2L A;  4LFC Q;  2KHJ A;  2J4X A;  2GVA A;  1PVO A;  2K6A A;  2WP8 J;  1U5K A;  4WJ3 M;  2NVY H;  2CVR A;  5BR8 Q;  4DN4 M;  4DAV A;  4DA2 A;  3GTP H;  3OSO A;  4OX9 L;  4JV5 Q;  4TKO B;  4A3E B;  1PTO C;  1Q7Y C;  4LF4 Q;  1SLJ A;  2A69 C;  3U9S A;  4KD3 A;  3I55 A;  1QVG A;  4B9W A;  1EIF A;  4KY6 A;  5ELF A;  2Q8T A;  1DYQ A;  2D0O A;  1K8G A;  3QOJ A;  1E0B A;  2F4I A;  4C3H G;  5J22 A;  1QVC A;  1SYB A;  3GTO H;  3S2D B;  4IUQ A;  4GOP C;  5NUC A;  2DJG C;  3SR1 A;  2M00 A;  4KV6 A;  1KL9 A;  3QOL A;  3HZX A;  2L5T A;  2VZA A;  2Y0S E;  1PZI D;  4KD4 A;  4NXM Q;  3F2U A;  4X64 L;  2O2L D;  4HID A;  3CXC A;  3T4A C;  3OTO Q;  1B2T A;  3L2P A;  3AFP A;  1MGS A;  1EQQ A;  4A3I H;  1ENF A;  3KLW A;  1EIY B;  2F0P A;  4WJ4 A;  1LT3 D;  3NEN A;  4A3J B;  4LF5 L;  1HZB A;  3GO5 A;  2RSN A;  2B2U A;  1NNX A;  1Y1V H;  1LAC A;  4DAP A;  1ESF A;  3S14 H;  2K5W A;  1Q82 C;  5C44 H;  4P72 A;  3TRE A;  4A3J H;  4BBS G;  4TQU S;  5ELO A;  3C3L A;  4IFD I;  1SDF A;  2K50 A;  1VQM A;  1CI3 M;  2QW7 A;  3RR5 A;  3K5L A;  4A3B G;  1LO5 D;  4HSP A;  1IW7 C;  1CSQ A;  1GVP A;  1DCZ A;  1Q81 C;  3SE0 A;  2PO4 A;  2LSS A;  2M2L A;  5IP7 G;  2A5H A;  1F2Y A;  2MPM A;  1IYJ B;  2ENB A;  1W2B A;  2CW0 D;  1BR9 A;  4FDB A;  1W6J A;  3D31 A;  4YCV A;  3R3O A;  3HOU H;  1CFM A;  1WD1 A;  4LFA L;  4U68 A;  1XNQ L;  1STN A;  3CC7 A;  3S2H B;  1I4H A;  3A7A B;  1D2B A;  1SN8 A;  2RHS B;  1F9Q A;  1TWF B;  1MHW C;  2DY7 A;  1NTG A;  2CH4 A;  4RGN A;  1CK1 A;  3M4P A;  4K2K A;  1PH8 A;  3T1Y Q;  2NVY B;  2LKV A;  3G7L A;  4IFD J;  4XXE A;  4UAI A;  5I4D A;  1GUO A;  2WIN B;  4C3I H;  2ICI A;  4RAU C;  1S72 A;  1XPU A;  1B44 D;  3QWN A;  1HUM A;  3W5O A;  1SYG A;  5AJ3 L;  1HCZ A;  2KCT A;  1X3Q A;  1JWU D;  2F0O A;  3EFX D;  3ERS X;  4LF7 Q;  2I5L X;  2B2W C;  3S1M B;  1S5B D;  3CCM A;  2QKI C;  1C9O A;  2KHS A;  2PYK A;  3A55 A;  2Y0S G;  5D14 A;  1SJH D;  4DK0 A;  5D65 A;  1SMY D;  3GV3 A;  1OXT A;  4JI1 Q;  4XQJ A;  5C0X H;  1B7Y B;  1PYB A;  1ZXT A;  4DNT B;  4B3R Q;  3I4M B;  1PH7 A;  3S16 H;  1WOC A;  4A3M B;  2JEA I;  1B9M A;  2L55 A;  1HH2 P;  1H9J A;  1PRT D;  2HHH L;  3PUW A;  4A3M H;  2Z4I A;  3JAM E;  2BH2 A;  4C3J H;  1PXU A;  1BDO A;  1TWC H;  3SDZ A;  5JJK A;  4N9P A;  1FGU A;  1QUQ B;  1Z47 A;  5IT9 E;  1AE2 A;  1SMX A;  3LWE A;  2I07 B;  2SDF A;  5LMU L;  1X56 A;  1QJO A;  1A3U A;  4DR7 L;  3KBG A;  2KUM A;  1SRO A;  5HY6 A;  5FOB B;  5COR A;  2HHH Q;  1DOK A;  1JCK B;  2G5D A;  3VR6 A;  2B2Y C;  1H9S B;  1P16 A;  3NK9 A;  3A8I E;  4OIJ A;  3BVM A;  1CSP A;  3DM3 A;  2F0L A;  1QVF A;  2FFK B;  1GD7 A;  2F0T A;  1EOV A;  1BBU A;  4YY3 L;  3HEJ A;  3D3R A;  3SEB A;  2PI2 E;  2F0G A;  1RF2 D;  4ZCK A;  1STY A;  5FLX L;  4JI6 Q;  3CPW A;  3KK7 A;  2FXQ A;  5TSS A;  2XWJ B;  2NBF A;  2WFW A;  3IRB A;  4RWS C;  2EE1 A;  2IPK D;  2PCF B;  2Z6K C;  2JA5 G;  3CME A;  4DV7 L;  3KDF B;  1EY6 A;  1K3R A;  3CAM A;  4B3M Q;  2JN4 A;  4A3D G;  1SMY C;  4DUY Q;  4DR2 Q;  1SYD A;  1ZKO A;  3H3V I;  2N3S A;  1Z6H A;  4XQQ A;  2AQ2 B;  3J81 j;  4DV2 Q;  4IOC A;  3BDO A;  1LYL A;  5IYD G;  4BY7 G;  2OT2 A;  4BS9 A;  2ID0 A;  1A6X A;  1JR0 D;  4HIO A;  1NE3 A;  2EYH A;  1Q8K A;  3AYH B;  4Y7N H;  4KN4 C;  5DM7 3;  5M5W H;  1SEB D;  1I50 H;  2E2D C;  4RH6 A;  3E0J A;  4HTH A;  5KEE A;  4PZ7 A;  4JI7 L;  4BY1 G;  3HOW H;  3HG9 A;  1F77 A;  4DR1 L;  5C6A A;  5CV4 A;  4DV6 Q;  3S1R B;  1NCV A;  2PI2 A;  1V43 A;  3X3M A;  2N8N A;  4BY1 B;  2JP1 A;  2A74 C;  1K28 A;  2WKD A;  3RUZ A;  5JAV A;  1YIT A;  3AEV A;  4Z9C B;  4DU9 A;  5GRO A;  4IQZ A;  4MTK A;  1KRS A;  3E9I A;  3HS0 C;  3OPO A;  1TXY A;  3HRZ C;  3KBX A;  5K36 G;  3FPP A;  3CCL A;  3CC2 A;  2AQ3 B;  3FKI G;  3ND8 A;  3ZYY X;  4LF6 Q;  1EU3 A;  2NZO A;  2L12 A;  1VQI A;  2PMZ B;  5ELE A;  4CHT B;  3E0E A;  5FLM G;  3S2H H;  3K0X A;  1VQN A;  4IPG A;  1GHJ A;  1UEA B;  5DEH A;  3SVM A;  5M5X H;  4QGU A;  5EPK A;  2O5I C;  4FXG C;  2KHI A;  3URY A;  3PO3 B;  2RF4 A;  3TS2 A;  1V1P A;  4G7O C;  2BA1 A;  1I6H B;  2MO0 A;  5C0X I;  2DY8 A;  3M4Y A;  4RA8 A;  3U4V A;  3BZK A;  3WOE A;  4C3I B;  1B70 B;  2K32 A;  4J1M A;  2F0V A;  4HED A;  2SNS A;  3ULL A;  4E6I A;  1AH9 A;  1SJE D;  1LV9 A;  3KF6 B;  2DNE A;  4DXF A;  1M90 C;  2PQA B;  2Q2U A;  5IT9 c;  3I4N H;  4GN3 B;  1ENA A;  3NEM A;  3TP5 A;  4FO2 A;  2D5D A;  2AHO B;  3GQB A;  2SEB D;  3LGJ A;  1E2V A;  1D5M C;  2K28 A;  3HOV B;  4OO1 H;  3QG1 A;  3R2I A;  1TT2 A;  3FEW X;  3CPF A;  4C1N K;  4UP9 A;  1YIJ A;  2BCO A;  1Y1V G;  3MXP A;  3VYR A;  4LUO A;  2B63 G;  1IBM L;  3F1Z A;  2E2J H;  1EYA A;  3U50 C;  1DOM A;  3EIV A;  3J7A 5;  4DV0 L;  2K05 A;  3T16 A;  4A3B H;  4C2M H;  3RN2 A;  2B63 B;  1BXT A;  1VQ6 A;  3PO2 G;  3A54 A;  2EPB A;  5IP7 H;  3DLL A;  3K80 C;  3GTG H;  1WVL A;  1EYD A;  2GVB A;  2A6H D;  1YJ9 A;  3Q22 A;  2JE6 I;  2XTI A;  1ET9 A;  1PFN A;  2C5C A;  4A93 B;  1I3Q B;  5HUR A;  2WAC A;  2XGT A;  1TWH B;  3S1R H;  3G6E A;  3K81 C;  2D2C C;  1TVX A;  3F2B A;  4A93 G;  1YNJ D;  1D7Q A;  4JBJ A;  5J3B A;  1L1O C;  4KJN A;  1ET6 A;  2R92 H;  1X32 A;  2JEB I;  1CQF A;  4XYQ A;  5IGG A;  2ZM6 Q;  1B9N A;  1WJJ A;  1J5E L;  5C5L A;  3FRP B;  2KQ3 A;  2JYO A;  4O0A A;  3G48 A;  3TZU A;  1PMR A;  4UP8 A;  4JI4 L;  3ERO A;  5CGK A;  4O42 A;  1A2U A;  5GAD C;  1G6Z A;  1XNR L;  2VQE L;  1OXV A;  1PHJ A;  1HXY D;  5JOB A;  4OON A;  5JEA G;  4ZUI A;  4IUV A;  4A3K G;  4A3L H;  3ULJ A;  4ZKB B;  1SFO H;  5KYI A;  2F0E A;  3CCQ A;  1F9R A;  1HQR D;  1TS2 A;  1CM9 A;  1EFI D;  5DM6 3;  4FXD A;  4P74 A;  4DXG A;  4QY7 A;  4X66 Q;  1XMQ Q;  3UDG A;  4JI5 Q;  1A3T A;  2KED A;  2Z0S A;  1RTN A;  2F0H A;  3GTL B;  5BN3 A;  4WOR A;  3AB9 A;  3VR5 A;  2QDB A;  2E5L L;  3A5U A;  4DR3 Q;  1K8A C;  1KNE A;  4JW0 A;  5IYB G;  2Q2I A;  1V8Q A;  3GTJ B;  3T1H L;  1U4M A;  4YCU A;  3M4O B;  4L5T A;  1K0R A;  3JC6 6;  5KNB A;  4KI0 A;  1VQD A;  3A56 A;  4GKK L;  1TWG B;  4QL5 A;  2R6G A;  1FNW A;  4JBM A;  1R4Q B;  2PZW A;  2RVL A;  4GKJ L;  2LY7 A;  3D0F A;  4IPC A;  4JI1 L;  2BDN A;  2F3I A;  4YCW A;  1DZ1 A;  3CQZ H;  2K52 A;  4FF1 A;  4KY7 A;  1MI2 A;  4EGV A;  4MNO A;  2JK8 A;  3NTH A;  4RKB A;  4IUP A;  1X3F A;  1IBK Q;  4QIW E;  4DK1 A;  3PSI A;  1GKH A;  1AZQ A;  4FF4 A;  1O7Z A;  4YWM A;  5CC4 A;  4PV1 C;  5C4J H;  2JA5 H;  3TP7 A;  2GA4 B;  4XDX A;  2V1C C;  1VF5 C;  4EQP A;  5IP9 G;  4A3I G;  3GTK B;  2DNC A;  2RCF A;  1WCM B;  4JK1 C;  3ZJY C;  4CGY B;  1JOR A;  1VQP A;  3FPU B;  3R8B A;  3Q0A A;  4KHP Q;  4Y52 H;  4IPD A;  3G71 A;  4GZY C;  1VMP A;  2Z6B A;  2RBM A;  1HRJ A;  1WCM H;  4JI8 L;  1WTW A;  3HKZ G;  1XTC D;  5C44 G;  4A3J G;  4BBS H;  5IOD A;  2WB1 B;  2PW5 A;  2B2V A;  3PCO B;  5D3D A;  4KK7 A;  2R7Z B;  2O4X A;  4DR5 L;  2KOL A;  1IBL Q;  2I0Q A;  1QB5 D;  4GLX A;  4BY1 H;  4FF2 A;  2E2J B;  1N36 L;  1RHP A;  2L4N A;  2Z8L A;  3N52 A;  1LTS D;  1I50 B;  1HQM C;  4DR1 Q;  1K0S A;  4M1U B;  1HR0 Q;  4UPA A;  3I4M H;  1HHV A;  4GLA C;  2VXW A;  4N9T A;  2QA4 A;  1HR0 W;  4ZRZ A;  2OEO A;  2JA7 B;  3GTL H;  2F0Q A;  2RSO A;  1CKO A;  2AWN A;  4IJL A;  1VQB A;  5FLM H;  4RHR A;  1YNJ C;  1CKN B;  4M8A A;  5C3X A;  1IBL L;  2F0I A;  4IAL A;  3A74 A;  1N9W A;  2B3G A;  2MFI A;  4JOI A;  4JC0 A;  2NN6 I;  3S1Q H;  3C46 A;  4J15 A;  4B3T L;  3BDL A;  2UU9 L;  1PA6 A;  1I94 Q;  4DR6 Q;  2AMC B;  1U4R A;  2YTV A;  4C3H B;  1ESR A;  4PZ6 A;  1ICW A;  1JJG A;  1QUQ A;  1H95 A;  4PMW A;  1N32 Q;  2IHF A;  4H02 A;  4MIU A;  2OWO A;  3I4N G;  2TMP A;  1JT8 A;  2RQX A;  4POG A;  5C0X G;  1M1K C;  1O7Y A;  5IWA L;  1PFM A;  3STB D;  3CKI B;  3KLR A;  1HTP A;  2EYJ A;  2F0D A;  4JI2 Q;  3I4N B;  1HFG A;  3G4S A;  2VUM B;  5CYU A;  3P7J A;  1JJC B;  4DNR B;  3W1B A;  2K03 A;  4A3M G;  2IT1 A;  1EOT A;  2A19 A;  1FNU A;  5A2Q L;  4F88 A;  2H1E A;  4OX9 Q;  4C3J G;  1WTO A;  4JV5 L;  2KBN A;  4ZQ3 A;  3ICE A;  4GKJ Q;  1E1O A;  4C3J B;  3S15 H;  2IW3 A;  3FHW A;  3PO2 H;  3V05 A;  1GM5 A;  4L8J A;  4Q5V A;  1AE3 A;  3TBI B;  5T1G A;  2EIF A;  3L9A X;  2J0T D;  4GNX A;  1UAP A;  5KNC A;  1TWG H;  3PIO A;  2XIW A;  2MNA A;  3HGB A;  1JOO A;  3KF8 A;  3NUC A;  2R92 B;  1IYU A;  3HKS A;  3MWY W;  4YWL A;  4DV6 L;  3KUP A;  4DFA A;  1STB A;  2B29 A;  2K5H A;  1LTB D;  1HNX Q;  2KA7 A;  4LFB Q;  2R92 G;  1E7Z A;  1VQ7 A;  4OEM B;  1BCP C;  5EBC A;  5AJ3 Q;  1R4P B;  1VQJ A;  3QR8 A;  4XT3 B;  4DAY A;  1XTD A;  4RGT A;  3TZD A;  3NBI A;  3W1G A;  1Z7T A;  4A3D H;  4GN4 B;  4JI3 L;  3KYH C;  4PZ8 A;  1Q3L A;  1KAB A;  1TS3 A;  2ZJR A;  4HJA A;  2F0J A;  3T1Y L;  4LFB L;  5EKL A;  1BO0 A;  3TS0 A;  2UUA Q;  3IFT A;  1LAB A;  5M3F G;  1F9P A;  1TWF H;  1TII D;  2ZT9 C;  4NDX A;  4DUY L;  2D62 A;  4R1J A;  4CKC A;  2HT1 A;  3W2D A;  1FR3 A;  1BVS A;  2BOS A;  1STA A;  4OIK A;  4X3U A;  4A3K H;  3KF8 B;  3MAQ A;  1R9T H;  1JJ2 A;  1RCV D;  1QOH A;  4XYO A;  4DUZ Q;  4P75 A;  3MHB A;  1GHK A;  2L1B A;  1PH3 A;  5EBD A;  2NN6 H;  4PMC A;  2JA6 H;  3TDQ A;  1XMO L;  3U4Z A;  2XSC A;  1II3 A;  4HJ5 A;  2QGQ A;  3Q24 A;  2R3Z A;  2FIN B;  3CD6 A;  5IWA Q;  3BS1 A;  4JI0 L;  3S1N B;  1RL2 A;  1TWA B;  3NQI A;  2MJ8 A;  5HGQ A;  1SYE A;  5K36 H;  1Y1W B;  2RDH A;  2E74 C;  4R4Q A;  3NE5 B;  3FKI H;  2IHE A;  1S3O A;  4GN5 A;  5CV5 A;  3RLN A;  4ZK9 B;  3NTK A;  3M4Q A;  1NUC A;  1Y1W G;  2MHV A;  4LWC A;  2X69 A;  5C3W A;  1AFP A;  1YNX A;  4HJ9 A;  3FDT A;  2FJ2 A;  2ZXO A;  4LW1 A;  3T53 B;  1Y8O B;  1D6E C;  5CV8 A;  1LTI D;  1I4P A;  5M5Y H;  5T1I A;  2HIV A;  4KKU A;  3GTM H;  1QG7 A;  5CV7 A;  3I4L A;  1PV4 A;  2NVT B;  1EY4 A;  3QB3 A;  4MTN A;  1H9M A;  5IYC G;  1BOS A;  4IFD G;  5CBE E;  2NVQ B;  1CHQ D;  1Z9F A;  2AQ1 B;  2NYZ D;  2B2V C;  4JYA L;  2EVB A;  2A1A A;  4UY8 C;  2V4D A;  3RZO H;  4PQX A;  5IP9 H;  3J80 i;  5IE8 A;  5JPM C;  1GUW A;  5JVH 3;  3FP9 A;  3NEL A;  4U67 3;  2CHB D;  2NB0 A;  3BVG A;  1TS5 A;  3ERQ A;  3PV0 A;  3GTO B;  2E8G A;  3S2D H;  2A68 D;  3UI2 A;  1ASZ A;  2OTL A;  2AUJ D;  4DGZ A;  1VQK A;  4DUZ L;  4PNY A;  1L0X B;  4ZAI A;  3J81 L;  2DN8 A;  1A3V A;  1G91 A;  4KTA A;  3CHB D;  2IL8 A;  1GJX A;  1YHQ A;  1M8A A;  4MZ9 A;  1BCP D;  5ISR A;  5ELN A;  1MSH A;  3H3V C;  1EZ8 A;  1MBY A;  2EXZ A;  1B8A A;  3TP8 A;  1Y8N B;  5IGF A;  1D5X C;  2B2W A;  1IL8 A;  1IYV A;  2MP1 A;  1NR2 A;  5I6W A;  3K58 A;  1UE5 A;  2C35 B;  1HPC A;  3MTS A;  1HNX L;  3Q23 A;  3CCS A;  1L0Y B;  4K8J A;  1EEI D;  5GAG C;  5AFW A;  3A7L A;  3RZD B;  1BBX C;  1D1I A;  1YHA A;  1K83 B;  1SXT A;  2VW9 A;  5I6Y A;  2C9O A;  5JVG 3;  1S40 A;  4UP7 A;  4DK6 C;  2VB2 X;  2UUC L;  3M3Y B;  1WTH A;  3KLS A;  3HOZ B;  5IIF A;  3U58 A;  2F52 A;  3ONA B;  1BCP B;  2D9U A;  2FHT A;  2K7V A;  1EUJ A;  1A8V A;  4DV2 L;  3M3Y H;  1OXS C;  4K0K L;  3STB C;  3HOZ G;  5LL6 S;  5CV6 A;  4R4C A;  1SFO B;  1KQS A;  5EPJ A;  1WD0 A;  3PGZ A;  4LF8 L;  2A73 B;  4POF A;  4A3L G;  3NQT A;  3VYT A;  5FJ8 G;  1FJG Q;  2F3V A;  1EY8 A;  2EDG A;  1E22 A;  4A3K B;  3DWA A;  2FMM A;  3HOX G;  2LMC B;  1Q1B A;  4G7Z C;  4JI2 L;  2UXD Q;  5FLX c;  4A76 A;  3MZ5 A;  3HOV G;  2YTY A;  3K0Y A;  3NXW A;  2VB3 X;  2H4O A;  1E24 A;  1PTO F;  1EQR A;  3J7A V;  4K6L A;  2EYM A;  3H94 A;  2ZJP A;  4JI0 Q;  3L3O C;  1XNR Q;  5IYB H;  1G2S A;  4EQ5 A;  1N32 L;  2K4K A;  5EGT A;  2NTS A;  4JOI C;  1LT5 D;  4CDD C;  2K5N A;  4RHS A;  1VDZ A;  5C4X H;  3GTJ H;  3EQL C; 
#chains in the Genus database with same CATH homology
 3KLS X;  4RCN A;  2F1M A;  3N6R A;  3J81 E;  3DEO A;  4NW2 A;  1PRT B;  1T5X D;  3OIP A;  1C4Q A;  4V0B A;  2XNA C;  1H9R A;  5EKI A;  1BNZ A;  1UNS A;  5JPN C;  4LJZ C;  1SNP A;  2E76 C;  3D4D A;  4CKB A;  2EJM A;  3V96 A;  1X3P A;  3MVV A;  4ZLT F;  4K8I A;  5M5Y B;  1S5F D;  2EOT A;  2HUG A;  1BF4 A;  2M9V A;  1QWY A;  2E2H B;  5C4Z A;  4H44 C;  2KCC A;  2IWH A;  2BDO A;  1SNM A;  2HCI A;  1ML0 D;  2IX3 A;  1SNC A;  1D5Z C;  1ZYR C;  5C3E B;  5KYL A;  4KJO A;  3QJY A;  2RKS A;  3SK6 A;  5IGE A;  1A15 A;  1J9O A;  4HCE A;  2MGS A;  3D4R A;  3S14 B;  3RD4 A;  4NKL A;  3P75 A;  4CJ0 B;  3WDN A;  3MXN A;  1LTA D;  4O1N A;  2AUK A;  2NN6 G;  1JIC A;  4A3G B;  4KHZ A;  4EQN A;  3H09 A;  1ROD A;  4BBR B;  3M7G A;  1WTV A;  2MUY A;  4A3F B;  3NSW A;  1PRT F;  2EJG C;  2B8F A;  5FO7 B;  5ELC A;  1EY5 A;  3MXU A;  2WII B;  5E4W C;  1QNK A;  1TS4 A;  2PZU A;  4OL7 A;  4CBV A;  3G6J B;  1G8Z D;  2EY1 A;  3K57 A;  2JA8 B;  3GV6 A;  3VR3 A;  3GTP B;  1KDC A;  1I4R A;  2PNR C;  1EY9 A;  4IFD H;  1PTO D;  4RFB A;  3VA5 A;  4NMZ A;  4HSV A;  2JXM B;  5LHY 1;  4IN3 A;  4R9W A;  1TY0 A;  1GUS A;  2R61 A;  2RDF A;  3FVQ A;  3MXG A;  1KDB A;  2K33 A;  1LT4 D;  1XXG A;  1F2L A;  4J8Q A;  3I72 A;  1GUN A;  2HCC A;  5F2D A;  1DM0 B;  5CBA E;  3BDC A;  1KAA A;  5JEA J;  2ZXR A;  1DOL A;  4WJW A;  1LT6 D;  3HKZ B;  1YNN D;  1AW7 A;  5IGB A;  4HAE A;  3BYY B;  1M4V A;  1OXX K;  4ODG A;  3LX0 A;  4EQO A;  3M85 A;  5IGC A;  2LFN A;  3EJI A;  1LTR D;  1FD7 D;  3P1H A;  4H0L C;  2NZ1 D;  5COY A;  2WV6 D;  4OHJ A;  2KVM A;  2NVX B;  1J8I A;  4A3B B;  2EYO A;  3PUX A;  3HOW B;  3U9O A;  1B53 A;  3S16 B;  1PZJ D;  4DF7 A;  5BN5 A;  4FXK C;  2HDM A;  3VYS A;  1STH A;  2YU9 B;  5G3L F;  2NTT A;  3TP6 A;  1TWC B;  4IUN A;  1KDA A;  4L63 B;  3BZD B;  5A35 A;  1G29 1;  4X3S A;  4F87 A;  2JA6 B;  1QIL A;  4CJ1 B;  2JSO A;  1SAP A;  3SK4 A;  5I2X A;  1PFB A;  1BQQ T;  3D8G A;  3NPP A;  3H6M A;  4K5X A;  2PZT A;  1I4X A;  4H7B A;  4QUC A;  3C1F A;  4CKE A;  1FNV A;  4RGM A;  2NUC A;  2RA4 A;  4JBW A;  1MSG A;  2IJ0 A;  3IAY A;  5I9P A;  4C2M B;  3D6C A;  5E3F A;  1F2M A;  3J80 L;  1EY7 A;  1PYW D;  3GTG B;  3OIQ A;  1BCP F;  1I4Q A;  2PW7 A;  1SE4 A;  2EY6 A;  3L7Z C;  1ILQ A;  1JC7 A;  1S5E D;  3E5S A;  1O80 A;  1PRT C;  5M5W B;  4KKT A;  4ABN A;  1K8M A;  4XQN A;  4XIG S;  3OOC A;  2LS0 1;  1H9S A;  2B39 A;  1LTT D;  1JWS D;  4ME5 A;  1UUP A;  4IUT A;  5C5M A;  2TSS A;  4HMJ A;  1ONL A;  2G9H D;  3X3N A;  3MA2 B;  4V19 0;  3CU7 A;  1YNN C;  4FNF A;  1SE2 A;  3A8J E;  4KMU C;  4WRD A;  5E1F A;  1I4G A;  2BE5 C;  4KN7 C;  3IKJ A;  2F0S A;  2SNM A;  2A6H C;  2IX1 A;  1Q90 A;  1DD2 A;  5EPL A;  1B3A A;  3LNN A;  2R93 B;  3K7A B;  1AEX A;  5FO8 B;  1C48 A;  1CZW A;  1U4L A;  1W6K A;  4ZYS A;  1Q12 A;  2KJX A;  4MHE A;  1KNA A;  1XYI A;  1A2T A;  2WKC A;  2L11 A;  3EA6 A;  4R8N A;  2YYZ A;  4BWG B;  1GXD C;  3D4W A;  1LLR D;  4X3K A;  2RDG A;  2B2T A;  1D1K A;  2B8G A;  4L6T B;  1SNO A;  2F0N A;  3VR2 A;  2WAQ B;  1Y69 U;  3BG3 A;  2KEC A;  2X6L A;  1VF7 A;  3NWT A;  3OMG A;  3MFG A;  2XRQ D;  3OMC A;  5J1Z A;  2ICE C;  5I2Y A;  1CT1 D;  3BVZ A;  3J7Y W;  1Y8P B;  4KHV A;  5FLX E;  2KEE A;  3OWF A;  1CZG A;  1V1P B;  3DWP A;  4UDU C;  5IGD A;  1FYC A;  5EKK A;  1ZEQ X;  3T56 B;  1GOZ A;  3VR4 A;  5KGU A;  1RDP D;  3NHH A;  1G2T A;  3PUV A;  4J6H A;  1O78 A;  1CHP D;  3CRL C;  5DNF A;  1F9S A;  2QF7 A;  4K5V A;  3TSS A;  3HOY B;  5C4H A;  1JWM D;  1EQT A;  4K6D A;  1I6V C;  3RMH A;  4B08 A;  2CW0 C;  4S3S A;  5ELB A;  1RTO A;  3SK8 A;  3J80 E;  5M3M B;  3I91 A;  1EU4 A;  1AN8 A;  4Y7N B;  2A69 D;  2Z1C A;  5A2Q E;  1EEF D;  1SBB B;  1STG A;  4QIW B;  4HN7 A;  5CR3 A;  2O5J C;  3IFD A;  4TSS A;  2HDL A;  2EYF A;  4AYB B;  3DEP A;  1BUV T;  4KKS A;  4IUU A;  4X3T A;  4XT1 B;  4XTC S;  2B2U C;  1DJR D;  3PIO 3;  3I3C A;  2BA0 A;  1PTO H;  4ZUJ A;  1HTL D;  4G57 A;  1WTQ A;  3PUZ A;  1S5D D;  3VYU A;  2QIL A;  1S5C D;  1SND A;  5IT9 L;  5G3L D;  3A8K E;  3WOF A;  5I9O A;  2PQE A;  3NTI A;  1VMC A;  1U9R A;  2E75 C;  1XX8 A;  5M9O A;  1CA5 A;  3HP3 A;  3CRK C;  1Q8I A;  3GTQ B;  2AWO A;  1QCB D;  1V1O A;  2K04 A;  1MD2 D;  1EYC A;  3HOX B;  2F0K A;  4F8M A;  3DUZ A;  2F3W A;  1EL0 A;  3Q6S A;  4FYD A;  4NP5 A;  3OHX C;  3O13 A;  3K59 A;  3T13 A;  2J7Z A;  1T5E A;  1EZ6 A;  2XVS A;  3DHQ A;  4BBS B;  3C2P A;  3ND9 A;  1AZP A;  1JB3 A;  1S4Z A;  1IKM A;  1OXU A;  3S9W A;  1DXM A;  1JQY D;  1STE A;  3GD7 A;  2NWG A;  3V2T A;  3K5N A;  1TY2 A;  5EJW A;  4ULL A;  2K5D A;  4C56 C;  3RZO B;  5C4J B;  3PMF A;  1VCI A;  1RD9 D;  4MN3 A;  2XN9 C;  1QNU A;  1AP0 A;  2XWB B;  4RCO A;  2E2I B;  1PDQ A;  2EZV A;  4F7X A;  3HOU B;  3LWU A;  4LMQ D;  1NR4 A;  1QE6 A;  5CV9 A;  1SYC A;  3S15 B;  1B1Z A;  3S1Q B;  5KRU A;  1IW7 D;  4KY5 A;  1NSN S;  5EQ0 A;  2K01 A;  3K5O A;  3AU7 A;  5IOC A;  2Y0S B;  3E6Z X;  3VA7 A;  2IX0 A;  1R9T B;  4G4K A;  5K5P A;  1TR5 A;  1E2W A;  4I7Z C;  3NWS A;  1K8O A;  1JOK A;  5C0X J;  2N55 A;  2QEJ C;  3I90 A;  4FVM A;  3H0G B;  1LTG D;  1TU2 B;  1EIG A;  1HA5 A;  5DAU A;  1KLU D;  4HMI A;  1HUN A;  2K1B A;  4Q0F A;  2EJF C;  3R93 A;  1CA6 A;  4BA1 I;  1XWE A;  3D6W A;  1PLF A;  2X6G A;  3AMU A;  2F03 A;  1B50 A;  3K6O A;  1C8C A;  2HQE A;  4ZKC B;  5FKA C;  3I8Z A;  2A68 C;  4HR7 B;  4FF3 A;  1SNQ A;  2FMC A;  3TME A;  4B9X A;  2EYP A;  1PZK D;  2EY5 A;  3BYT B;  4EVO A;  3SHL A;  1ILP A;  2XRS D;  3IL8 A;  3QIA A;  1CTM A;  4BA2 I;  3K5M A;  4OO1 I;  2JA5 B;  2I46 A;  5J39 A;  1IKL A;  1WTX A;  4A3D B;  2B2Y A;  2F0U A;  5BN4 A;  4R8I A;  3NBH A;  5C4X B;  4BY7 B;  3T51 B;  5HGT A;  2PPB C;  1HA6 A;  1E2Z A;  1NAP A;  3ITP A;  4TRD A;  3PO2 B;  1TQO A;  1DON A;  4P2C B;  2SOB A;  3R2T A;  2A6E D;  2F0W A;  4IZ8 A;  3OWE B;  4K5W A;  3MC0 B;  4IUR A;  2BE5 D;  2A6E C;  4OGQ C;  2EY2 A;  1RJT A;  4QUF A;  1WTP A;  4HCS A;  4ILW A;  3DXJ C;  1EWC A;  4PMB A;  4QB4 A;  3PIP 3;  3FKI B;  1Q1E A;  1EY0 A;  2EYL A;  1SSO A;  1PTO B;  2Q8I B;  5FK9 C;  1ZYR D;  3GP7 A;  5E4X A;  2B2T C;  3FMC A;  3SXH A;  1JE4 A;  1IHZ A;  3GTM B;  1H9K A;  5M3F B;  4ID6 A;  4C3I G;  3J7A F;  1GUG A;  3I70 A;  3PUY A;  1U4P A;  4G7H C;  5M5X B;  5ELD A;  1EQV A;  4K14 A;  3JAM L;  1SYF A;  4LAA A;  2F0M A;  3M7N A;  5LL6 X;  5CMD A;  3DMU A;  1Y1V B;  4OO1 G;  1FGB D;  4QMG A;  4RGO S;  1OO9 B;  1O7L A;  5FO9 B;  1HFN A;  1KTK A;  2G9D A;  4FP5 D;  2K5Q A;  3CQZ B;  2CQA A;  4I65 A;  4QF4 A;  4WFN 3;  3EVQ A;  3I73 A;  4LK1 C;  4YIJ A;  3NP8 A;  1JOQ A;  2F0F A;  3SK5 A;  1WTR A;  1B4O A;  2KCN A;  1EWH A;  3RLF A;  5D3I B;  3C1E A;  1KLG D;  4QCL A;  4H13 C;  3TN2 A;  1RKN A;  2OF1 A;  2VNU D;  4A3I B;  1TKW B;  1CQV A;  3P20 A;  1GUT A;  5KIX A;  2OXP A;  3H91 A;  3DM1 A;  3MEH A;  5C44 B;  3S17 B;  4C1N I;  4RKL A;  2QCP X;  1ENC A;  5JJZ A;  2N88 A;  2ZXP A;  2L9H A;  3OW7 A;  4CJ2 C;  1EIH A;  5KND A;  2L0C A;  5JEA H;  1SE3 A;  3W3A A;  2Z4H A;  3DWQ A;  1F2Z A;  3QO2 A;  2Q8R E;  3MFY A;  4K2L A;  2J4X A;  2K6A A;  2WP8 J;  2CVR A;  4DN4 M;  4DAV A;  4DA2 A;  3OSO A;  4TKO B;  4A3E B;  1PTO C;  2A69 C;  3U9S A;  4KD3 A;  4B9W A;  4KY6 A;  5ELF A;  2Q8T A;  1DYQ A;  3QOJ A;  1E0B A;  2F4I A;  4C3H G;  5J22 A;  1SYB A;  3S2D B;  4IUQ A;  5NUC A;  3SR1 A;  2M00 A;  4KV6 A;  3QOL A;  3HZX A;  2L5T A;  1PZI D;  4KD4 A;  3F2U A;  2O2L D;  3T4A C;  1B2T A;  1MGS A;  1ENF A;  2F0P A;  1LT3 D;  4A3J B;  3GO5 A;  2RSN A;  2B2U A;  1LAC A;  4DAP A;  1ESF A;  2K5W A;  4TQU S;  3C3L A;  4IFD I;  1SDF A;  1CI3 M;  3K5L A;  1LO5 D;  4HSP A;  1IW7 C;  1DCZ A;  3SE0 A;  2PO4 A;  2M2L A;  2A5H A;  1F2Y A;  2MPM A;  2ENB A;  2CW0 D;  1BR9 A;  1W6J A;  3D31 A;  3R3O A;  1CFM A;  1WD1 A;  4U68 A;  1STN A;  3S2H B;  1I4H A;  3A7A B;  1D2B A;  1F9Q A;  1TWF B;  2DY7 A;  4RGN A;  1CK1 A;  4K2K A;  2NVY B;  2LKV A;  3G7L A;  4IFD J;  4XXE A;  4UAI A;  5I4D A;  1GUO A;  2WIN B;  2ICI A;  4RAU C;  1B44 D;  3QWN A;  1HUM A;  1SYG A;  1HCZ A;  1X3Q A;  1JWU D;  2F0O A;  3EFX D;  2B2W C;  3S1M B;  1S5B D;  2QKI C;  2KHS A;  2PYK A;  3A55 A;  5D14 A;  1SJH D;  4DK0 A;  5D65 A;  1SMY D;  3GV3 A;  1OXT A;  4XQJ A;  5C0X H;  1ZXT A;  4DNT B;  3I4M B;  4A3M B;  2JEA I;  1B9M A;  2L55 A;  1H9J A;  1PRT D;  3PUW A;  2Z4I A;  3JAM E;  1PXU A;  1BDO A;  3SDZ A;  4N9P A;  1Z47 A;  5IT9 E;  3LWE A;  2I07 B;  2SDF A;  1QJO A;  1A3U A;  3KBG A;  2KUM A;  5FOB B;  5COR A;  1DOK A;  1JCK B;  3VR6 A;  2B2Y C;  1H9S B;  3NK9 A;  3A8I E;  4OIJ A;  3BVM A;  2F0L A;  2FFK B;  2F0T A;  3HEJ A;  3D3R A;  3SEB A;  2F0G A;  1RF2 D;  1STY A;  5FLX L;  3KK7 A;  5TSS A;  2XWJ B;  2NBF A;  4RWS C;  2EE1 A;  2IPK D;  2PCF B;  1EY6 A;  1SMY C;  1SYD A;  1ZKO A;  1Z6H A;  4XQQ A;  2AQ2 B;  3BDO A;  2OT2 A;  4BS9 A;  2ID0 A;  1A6X A;  1JR0 D;  2EYH A;  4KN4 C;  5DM7 3;  1SEB D;  2E2D C;  4RH6 A;  3E0J A;  4HTH A;  5KEE A;  3HG9 A;  1F77 A;  5C6A A;  5CV4 A;  3S1R B;  1NCV A;  3X3M A;  1V43 A;  4BY1 B;  2JP1 A;  2A74 C;  2WKD A;  3RUZ A;  5JAV A;  4Z9C B;  4DU9 A;  4IQZ A;  3HS0 C;  3OPO A;  3HRZ C;  3KBX A;  5K36 G;  3FPP A;  2AQ3 B;  3ND8 A;  3ZYY X;  1EU3 A;  5ELE A;  2L12 A;  2PMZ B;  4CHT B;  1GHJ A;  1UEA B;  5DEH A;  3SVM A;  5EPK A;  2O5I C;  4FXG C;  3URY A;  3PO3 B;  1V1P A;  4G7O C;  2BA1 A;  1I6H B;  5C0X I;  2DY8 A;  3M4Y A;  4RA8 A;  3WOE A;  4C3I B;  2K32 A;  4J1M A;  2F0V A;  2SNS A;  4HED A;  4E6I A;  1SJE D;  1LV9 A;  2DNE A;  4DXF A;  1ENA A;  3TP5 A;  4FO2 A;  2D5D A;  3GQB A;  2SEB D;  1E2V A;  1D5M C;  2K28 A;  3HOV B;  4OO1 H;  3QG1 A;  3R2I A;  1TT2 A;  3FEW X;  4C1N K;  2BCO A;  3MXP A;  3VYR A;  1EYA A;  1DOM A;  2K05 A;  3T16 A;  2B63 B;  1BXT A;  3A54 A;  2EPB A;  1WVL A;  1EYD A;  2A6H D;  3Q22 A;  2JE6 I;  1ET9 A;  1PFN A;  2C5C A;  4A93 B;  1I3Q B;  5HUR A;  2WAC A;  1TWH B;  2D2C C;  1TVX A;  1YNJ D;  4KJN A;  1ET6 A;  1X32 A;  2JEB I;  1CQF A;  4XYQ A;  5IGG A;  1B9N A;  5C5L A;  3FRP B;  2KQ3 A;  2JYO A;  3TZU A;  1PMR A;  3ERO A;  5CGK A;  4O42 A;  1A2U A;  1G6Z A;  1OXV A;  1HXY D;  5JOB A;  5JEA G;  4ZUI A;  4IUV A;  4ZKB B;  5KYI A;  2F0E A;  1F9R A;  1HQR D;  1TS2 A;  1CM9 A;  1EFI D;  5DM6 3;  4FXD A;  4DXG A;  1A3T A;  2KED A;  1RTN A;  2F0H A;  3GTL B;  5BN3 A;  4WOR A;  3AB9 A;  3VR5 A;  2QDB A;  1KNE A;  1V8Q A;  3GTJ B;  1U4M A;  3M4O B;  5KNB A;  4KI0 A;  3A56 A;  1TWG B;  2R6G A;  1FNW A;  1R4Q B;  2PZW A;  2RVL A;  2LY7 A;  2BDN A;  1DZ1 A;  4FF1 A;  4KY7 A;  1MI2 A;  4EGV A;  3NTH A;  4RKB A;  4IUP A;  4DK1 A;  1AZQ A;  4FF4 A;  1O7Z A;  5CC4 A;  4PV1 C;  3TP7 A;  2GA4 B;  4XDX A;  4EQP A;  1VF5 C;  3GTK B;  2DNC A;  1WCM B;  4JK1 C;  4CGY B;  1JOR A;  3FPU B;  3R8B A;  3Q0A A;  4GZY C;  1VMP A;  2RBM A;  1HRJ A;  1WTW A;  1XTC D;  5IOD A;  2WB1 B;  2PW5 A;  2B2V A;  5D3D A;  4KK7 A;  2R7Z B;  2O4X A;  2KOL A;  1QB5 D;  4FF2 A;  2E2J B;  1RHP A;  2L4N A;  2Z8L A;  3N52 A;  1LTS D;  1I50 B;  1HQM C;  4M1U B;  1HHV A;  2VXW A;  4N9T A;  4ZRZ A;  2OEO A;  2JA7 B;  2F0Q A;  2RSO A;  2AWN A;  4RHR A;  1YNJ C;  5C3X A;  4M8A A;  2F0I A;  4IAL A;  2NN6 I;  3C46 A;  3BDL A;  1U4R A;  4C3H B;  1ESR A;  1ICW A;  4PMW A;  4MIU A;  2TMP A;  2RQX A;  5C0X G;  1O7Y A;  1PFM A;  3CKI B;  3KLR A;  1HTP A;  2EYJ A;  2F0D A;  3I4N B;  1HFG A;  2VUM B;  5CYU A;  3P7J A;  4DNR B;  2K03 A;  2IT1 A;  1EOT A;  1FNU A;  5A2Q L;  4F88 A;  2H1E A;  4C3J G;  1WTO A;  4ZQ3 A;  4C3J B;  2IW3 A;  3V05 A;  4L8J A;  4Q5V A;  3TBI B;  5T1G A;  3L9A X;  2J0T D;  1UAP A;  5KNC A;  2XIW A;  3HGB A;  1JOO A;  3KF8 A;  3NUC A;  2R92 B;  1IYU A;  3MWY W;  3KUP A;  4DFA A;  1STB A;  1LTB D;  2KA7 A;  1BCP C;  5EBC A;  1R4P B;  4XT3 B;  4DAY A;  4RGT A;  3TZD A;  3NBI A;  1Z7T A;  1Q3L A;  1KAB A;  1TS3 A;  2F0J A;  5EKL A;  1BO0 A;  3IFT A;  1LAB A;  1F9P A;  2ZT9 C;  1TII D;  4NDX A;  2D62 A;  4CKC A;  3W2D A;  1FR3 A;  2BOS A;  1STA A;  4OIK A;  4X3U A;  3MAQ A;  1RCV D;  1QOH A;  4XYO A;  3MHB A;  1GHK A;  2L1B A;  5EBD A;  2NN6 H;  4PMC A;  3TDQ A;  2XSC A;  1II3 A;  3Q24 A;  2R3Z A;  2FIN B;  3BS1 A;  3S1N B;  1TWA B;  3NQI A;  2MJ8 A;  1SYE A;  5K36 H;  1Y1W B;  2RDH A;  2E74 C;  3NE5 B;  5CV5 A;  4ZK9 B;  3NTK A;  1NUC A;  2MHV A;  2X69 A;  5C3W A;  1AFP A;  3FDT A;  2FJ2 A;  2ZXO A;  3T53 B;  1Y8O B;  1D6E C;  5CV8 A;  1LTI D;  1I4P A;  5T1I A;  4KKU A;  1QG7 A;  5CV7 A;  3I4L A;  2NVT B;  1EY4 A;  3QB3 A;  1H9M A;  1BOS A;  4IFD G;  5CBE E;  2NVQ B;  1CHQ D;  2AQ1 B;  2NYZ D;  2B2V C;  2EVB A;  2V4D A;  4PQX A;  5JPM C;  1GUW A;  5JVH 3;  4U67 3;  2CHB D;  2NB0 A;  3BVG A;  1TS5 A;  3ERQ A;  3PV0 A;  3GTO B;  2A68 D;  3UI2 A;  2AUJ D;  4DGZ A;  4PNY A;  1L0X B;  4ZAI A;  3J81 L;  2DN8 A;  1A3V A;  1G91 A;  4KTA A;  3CHB D;  2IL8 A;  1GJX A;  1M8A A;  1BCP D;  5ISR A;  1MSH A;  3H3V C;  1EZ8 A;  1MBY A;  2EXZ A;  3TP8 A;  1Y8N B;  5IGF A;  1D5X C;  2B2W A;  1IL8 A;  1IYV A;  2MP1 A;  1NR2 A;  5I6W A;  3K58 A;  1HPC A;  3MTS A;  3Q23 A;  1L0Y B;  4K8J A;  1EEI D;  5AFW A;  3A7L A;  3RZD B;  1BBX C;  1D1I A;  1K83 B;  1SXT A;  5I6Y A;  2C9O A;  5JVG 3;  2VB2 X;  3M3Y B;  3KLS A;  3HOZ B;  5IIF A;  3ONA B;  1BCP B;  2D9U A;  2FHT A;  2K7V A;  1OXS C;  5LL6 S;  5CV6 A;  1SFO B;  5EPJ A;  1WD0 A;  2A73 B;  3NQT A;  3VYT A;  2F3V A;  1EY8 A;  2EDG A;  4A3K B;  3DWA A;  2FMM A;  2LMC B;  1Q1B A;  4G7Z C;  3MZ5 A;  3K0Y A;  3NXW A;  2VB3 X;  2H4O A;  1PTO F;  3J7A V;  2EYM A;  3H94 A;  4K6L A;  3L3O C;  1G2S A;  5EGT A;  2NTS A;  1LT5 D;  4RHS A;  1VDZ A;  3EQL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...