1SYCA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sycA00
4K5VA 3D4WA 1STNA 3OWFA 4KD3A 4ODGA 3D4DA 5IGBA 4R8NA 5JAVA 1SNCA 4PMBA 4WRDA 5CR3A 4QMGA 1SNOA 4N9PA 1JOOA 4KY5A 5CV5A 2WACA 3T16A 1F2YA 1SYDA 1EYDA 4KTAA 1A2UA 2LKVA 5IGDA 1STAA 1A3VA 1EQVA 1EY7A 2RDFA 4QB4A 5IGCA 2PQEA 3MZ5A 5J22A 4ZQ3A 4WORA 1EY5A 5IODA 4K5XA 3MEHA 3EVQA 1STGA 4K2LA 3V2TA 3SXHA 2OEOA 3LX0A 4KV6A 1NUCA 1KAAA 2OF1A 5CV6A 4K5WA 2M00A 4K8JA 1KABA 5CV4A 2KQ3A 1KDBA 3SHLA 2EY5A 2PZWA 1F2ZA 4J6HA 2QDBA 3P1HA 4HMIA 5M9OA 4ZUJA 3HEJA 3QOLA 4NDXA 5KYLA 3QB3A 1TR5A 3S9WA 3ITPA 5J39A 3RUZA 4DFAA 5DAUA 4K6DA 4KY7A 2F0VA 1SYFA 2F0PA 2F0MA 4HTHA 3SK4A 1F2MA 3TP6A 1TT2A 2SOBA 4E6IA 5F2DA 1SNQA 5C6AA 3D8GA 4ME5A 5C5MA 4DGZA 4EQPA 5IIFA 1EYCA 3H6MA 4EVOA 3NXWA 1RKNA 3SK5A 5IGFA 1IHZA 2EYLA 4KJOA 4KY6A 1STHA 1SYBA 2F0NA 3C1EA 5EKKA 1EZ8A 5ISRA 3EJIA 1A3UA 3SR1A 3HZXA 2ENBA 5E1FA 1STYA 1ENAA 4RKBA 4KD4A 5JOBA 3C1FA 5KYIA 5I9OA 1KDAA 4NMZA 1JORA 5CV9A 3DHQA 5K5PA 3MVVA 3SK8A 3TMEA 1EYAA 4I65A 4EQOA 3EROA 4IALA 5IGEA 2F0HA 2PZUA 2O4XA 4S3SA 1AEXA 2PW7A 5DEHA 2KHSA 4HMJA 5I6WA 2HQEA 1EY9A 3OSOA 4F8MA 2RBMA 2F0EA 5C4HA 3NHHA 1JOQA 1TQOA 1SNDA 2RKSA 5KGUA 2F3VA 2PYKA 4IUNA 3D6CA 4PNYA 1U9RA 4IZ8A 1EY8A 4K2KA 1ENCA 2F0OA 1KDCA 2F0TA 3SK6A 1EZ6A 5E3FA 4DF7A 2F0DA 2EY6A 2F0JA 2F0WA 2F3WA 2PW5A 2EYPA 2EYMA 4NKLA 3T13A 3TP7A 5EGTA 3BDLA 1JOKA 3TP5A 5I6YA 4ID6A 4PMCA 1EY0A 3MHBA 2F0SA 2F0KA 4MIUA 1A3TA 4N9TA 2PZTA 4TRDA 4YIJA 3VA5A 2EY1A 4J1MA 5I9PA 5C5LA 1SNPA 1STBA 1SYGA 1EY4A 1A2TA 2F0IA 3MXPA 4K8IA 2EYJA 4RKLA 5IOCA 5EKLA 5KRUA 5KIXA 2SNSA 3OMGA 2OXPA 5HGTA 1SYCA 5NUCA 2F0FA 5CV7A 2EY2A 2F0LA 2NUCA 3NUCA 4G57A 4F7XA 5IGGA 1NSNS 5C3WA 2F0GA 4EQNA 3NK9A 4KHVA 4KJNA 5CC4A 5J1ZA 5HURA 3ERQA 4B9WA 3BDCA 2F0UA 3OMCA 3P75A 4K14A 1SYEA 4OL7A 1EY6A 4ZUIA 5C4ZA 4NP5A 3R3OA 2EYOA 3DMUA 4H7BA 3U9OA 5CV8A 3PMFA 5KEEA 5CGKA 3E5SA 5C3XA 3QOJA 2SNMA 4QF4A 2EYHA 4LAAA 4DU9A 2EXZA 3NP8A 4B9XA 3NQTA 2F0QA 1SNMA 2EYFA 1II3A 3TP8A
chains in the Genus database with same CATH superfamily
4K5VA 4KMUC 2A1AA 1ONLA 5AJ3Q 3HOWG 2WACA 3RNUA 3Q8DA 2HHHQ 1IYJB 5IGCA 4DV2Q 2DUDA 2N3SA 5C3EB 4EQ5A 1BF4A 4WORA 1C9OA 4NW2A 4PQXA 2KHJA 4A3FB 1VQKA 4KI0A 2XWBB 1I3QB 1PVOA 1GUTA 1BO0A 2AKWB 1PH3A 3CCQA 1KDBA 2XN9C 3K5MA 4ULLA 5EJWA 5ELFA 4ZYSA 1CTMA 4MTNA 4ZUJA 3CPFA 3S1QH 5CYUA 4L5SA 3JAMi 3TQYA 4BBSB 3RLFA 3S9WA 4A93H 1GUGA 4DR2Q 5ELCA 3GTKH 3TN2A 5ELEA 3S15H 2UUBL 1XMOQ 1IKLA 1ENFA 5IWAQ 1EZ8A 5ISRA 4JI7Q 4O0AA 1DGSA 3HOYG 5IYBG 2K14A 3JAME 4JCVE 2OQKA 2VW9A 1WTWA 3SEBA 4NMZA 3I4NB 5EPLA 4KHZA 4Q0FA 5JVH3 5C0XJ 3DEOA 3HKZB 4Q5VA 5KNDA 1B3QA 2TSSA 1V8QA 1MGSA 3UDIA 1K83B 4A3JH 3S14B 1X3EA 4DAVA 5M5YB 1SROA 1K3RA 2MHVA 2YU9H 3R2TA 3T13A 2JYOA 1G8ZD 4OO1G 2EYMA 1YJNA 5EGTA 1JOKA 2E2IH 2KJXA 4OELB 4PMCA 2F0SA 2QILA 5I9PA 1NJIC 3KFUA 1QVGA 5BR8L 5EPJA 1EY4A 2C5CA 5IOCA 1PZKD 3IKJA 4A3MB 4K0KL 4IN3A 5KIXA 4N8FA 1G51A 3S1RH 2NUCA 1KRSA 2K6AA 2I5LX 2MJ8A 3I4OA 2K05A 1WI5A 5G3LD 3P75A 2B2TA 2IX1A 2JN4A 2J0TD 5KEEA 3U9OA 2RCFA 3E5SA 2Q2UA 3QOJA 2R7ZG 1AP0A 1S40A 3TEHB 4DU9A 5FJ8H 3NP8A 1B44D 2G9HD 1SFOB 5IY0A 3D4WA 4KD3A 1QUQB 2AQ3B 1G6PA 5JAVA 4C3HH 4EX5A 4X3UA 1BR9A 1JOOA 3M7NA 3PO2H 1V1QA 4Y52H 2Q2IA 3HGBA 4UAIA 3K6OA 5I2YA 4X62Q 4C3JG 3CMEA 1YNJD 1TWAB 4A3KB 4K5WA 2A6EC 4DV3Q 2IHFA 4KKSA 1SE2A 4R4TA 1WTRA 2VQFQ 3R2IA 3WDNA 3NBHA 1E1OA 4Y7NB 3GTOB 1CKNB 2JQOA 5J39A 2CW0C 1I4PA 4KY7A 3UDXA 2PQAA 5KGUA 2L9HA 1JJCB 1F2MA 3U4ZA 4A3FG 4GN3B 1N9WA 3AQQA 4YCUA 2UXBL 2ZXRA 4DAYA 2CH4W 2E76C 2OT2A 3D6WA 4DV5Q 3AMUA 3STBD 4QQBX 2NN6H 1A3UA 1T9HA 4BBSG 1B50A 1SN8A 3WOEA 5I9OA 1PRTC 1YNXA 3TMEA 3S16H 4MNOA 2JA6B 1PFSA 2CVRA 1A6XA 2BCOA 4ZKBB 1WFQA 5IYDG 5A2QL 1K8GA 3A8JE 3JAML 4DNRB 1SNDA 5ELNA 5K36H 1O80A 5FKAC 3PO3H 2F3VA 1PRTB 3A55A 1PH8A 2F3IA 2QW7A 2VB2X 2EJFC 3LGJA 3D31A 1PTOF 2CWPA 1VQEA 3R93A 1DOKA 3JC66 1NTGA 4YIJA 1NR4A 3HKZG 3I4LA 3NWTA 1FGUA 5FO9B 2QKIC 3HOWH 2BH2A 5KRUA 3H0GG 1NE3A 5HGTA 4DR4Q 3OHXC 3R8BA 3EN2A 3ERSX 3J7A5 4NXML 4EQNA 4KJNA 2F4VL 4RH6A 3VR3A 4XXEA 3P7JA 5JEAG 3A5UA 3ERQA 2B63G 3BDCA 4DR7L 1MSHA 1E3PA 1ET9A 4PZ8A 5M3MH 3K7AB 2RSOA 2KEEA 4DV4Q 3RMHA 4A3MG 4P74A 4LAAA 3KF8B 1I6HB 4LUZA 1X3FA 1WTHA 1SNMA 1HNWL 1STNA 1O7ZA 4DKAC 1KXLA 1K3BC 1N36L 4JYAQ 4RGNA 1Y1VH 4N9PA 4LF7Q 1XMQQ 1XPOA 1HNZQ 1HZBA 2LKVA 3GTQB 2MFIA 2B2YA 4K2LA 2L15A 4JI6Q 3HOUH 2Z9HA 2OF1A 3W1BA 4CBVA 3J7ZC 5CV4A 4JPBW 3TDQA 2ICEC 4P71A 3CQZH 3I3CA 3L0OA 1XTDA 4AYBE 2AWOA 3M85A 3SK4A 4X65Q 4UP7A 4LF9Q 4OO1H 2A6HC 2K5WA 2F0NA 4FF3A 1GHKA 4DR1Q 4J8QA 1BVSA 3ONAB 5KNBA 1FJGL 1HZAA 2KCMA 4DV0Q 1Y8OB 1EU3A 2YV5A 1HA5A 1TWFH 1SJED 1ET6A 4N8X1 3K81C 1AEXA 3M3YB 1QILA 3OSOA 3Q24A 4MTKA 1IBMQ 1WTOA 1R4PB 4KHPQ 1YNJC 4GNXA 5M5WH 3RZOB 3FDTA 4DPGA 4OHJA 2UUCL 2Y0SG 2F0TA 1KTKA 4DF7A 4UP8A 4H02A 4HR7B 2HT1A 5C4JB 4DAMA 5AJ3L 2HHHL 2IPKD 1CFMA 4B3RL 2JSOA 3CCMA 3CD6A 5EKLA 5ELBA 1NBWA 3KLSX 1V9PA 4F7XA 3TREA 1BCPB 1TU2B 1W6JA 5J1ZA 4HIKA 2PNHA 3S2HB 3OMCA 1EY6A 4OX9Q 4NP5A 4QUFA 1OO9B 3STBC 4B3SQ 3GTKB 2I5MX 5CGKA 4WJ3M 4BBRG 1QB5D 3OIPA 3JAMc 4DUYQ 5HY6A 4DR2L 3U9SA 2OTJA 1FNUA 4IFDG 2B3GA 4CHTB 3HOVG 4PZ7A 1XMOL 2IX0A 1IYVA 3TS2A 5IWAL 1R9TH 4JI7L 3I4MG 2A69D 1UWVA 1LTID 4JI4Q 3MEHA 1D5XC 2N8NA 2JA7G 3CCJA 2JA8B 2DJGC 3DEPA 3K5LA 2E2JH 1AH9A 1DONA 4A3JB 1HR0W 2AQ1B 4OXPA 1YHAA 3VYRA 1VF7A 1PTOC 3E9IA 2BH8A 2HDLA 3NELA 1AZPA 2Z1CA 2P5ZX 1U0LA 1TKWB 4B08A 1UE7A 4A3BB 1TWGH 2BDNA 2JEAI 1PTOB 1H9KA 1R4QB 2K33A 4A3GG 5C4XB 1YNND 1EOVA 1PFBA 3J81c 1O7IA 1STHA 1SYBA 1VCIA 4KY6A 1B9MA 3RLNA 3HOXG 1Q90A 4A3IH 2KBNA 3IRBA 1GOZA 3H0GH 5TSSA 3HKSA 4LMQD 3PV0A 5EKIA 1JORA 3KF6A 3QO2A 4A3DG 4OWWB 2E2HH 2F0HA 3PUXA 5DEHA 3U58A 2JA5B 2HQEA 4FNFA 2B29A 3I55A 2FXQA 2A8VA 1WCMB 5ELOA 5I4DA 4IZ8A 3C2PA 3A56A 1D2BA 3BVZA 3I91A 2EYPA 4CDEC 2KA7A 1LYLA 1LTTD 2F0KA 3WOFA 1A3TA 5IT9E 2ZT9C 2K04A 1CZWA 5BN4A 4X62L 1A2TA 3MXPA 5DNFA 1VQ9A 3NTKA 3BU2A 1SDFA 3FHWA 1YI2A 1X54A 1YVCA 2X69A 1CT1D 4DV3L 1GVPA 1CI3M 3KLWA 2VQFL 5FOBB 4IPDA 1EOTA 3VR5A 3ZYYX 1C4QA 3I2ZA 2VS1A 2NVXH 2QF7A 5C0XH 3FKIB 3QG1A 2NZOA 2N88A 4RMFA 4DK3C 2B2VC 4DV5L 1Z9FA 3G6JB 5DM73 1I4XA 4C3IH 5IE8A 4KY5A 4A3LG 4KTAA 1A2UA 4DV6Q 2WV6D 1P16A 3S16B 3I72A 1N34Q 4OGQC 2E74C 3S24A 4RHRA 1V1PB 1MI2A 3GQBA 1EIGA 2NVTH 4RFBA 5CV6A 3G4SA 4YCVA 4K8JA 2B39A 1PH7A 1ICWA 2R93B 1WOCA 2RA4A 5L37A 3HEJA 2IX3A 1XPUA 4K6DA 3J7AV 1L0WA 3TP6A 2WIIB 3OYYA 2XVSA 3G71A 2EOTA 4O1NA 4DR4L 2R92B 1F9QA 1LT6D 2B2WC 4LUOA 4TSSA 3S2DB 1HH2P 1TWHH 1K8MA 2XIWA 3BJUA 4XYQA 4K6LA 3SK8A 2HCIA 4P72A 5GQOA 4A3BG 1XWEA 4A3CG 1C7YA 2VZAA 3C3LA 2JK8A 5C4XG 2YYZA 5EAYA 5I2XA 2A69C 4DV4L 4DA2A 2PI2A 4BBRH 4JI1Q 1GHJA 4L5QA 1F9SA 4K2KA 1Y1VB 1VF5C 2PMZE 1VQMA 3GTMB 2PW5A 2F3WA 1QNKA 4JYAL 4FP5D 2R7DA 4HIDA 4Z9CB 4LF7L 1XMQL 1RHPA 1HNZL 3I90A 4N9TA 1IL8A 3VR2A 3HOUB 2JA5G 4IFDI 4JOIC 3BS1A 2K7VA 2X6GA 3I4MH 1SE4A 3K80C 4JI6L 3RZDH 2WB1G 2RDGA 5T1GA 3CQZB 3K59A 5C3WA 1TXYA 4YWLA 2B2UA 2JA7H 2PO4A 3AFQA 3G6EA 5IT9L 2XRSD 4UPAA 4JBMA 4ZK9B 1XNRL 4A3EG 1X3PA 3OW2A 4G7OC 1SAPA 4X65L 2OQ0A 3KDFA 4CKCA 1P8LA 4LF9L 2FFKB 1II3A 1L1OA 5IGBA 1Y1WH 1VQLA 3C46A 4WRDA 3T16A 1GO3E 5C44G 4DR1L 5M5XB 4A3GH 1F2YA 2RDHA 2CW0D 4DV0L 2LXJA 2MGSA 1DOLA 1E1TA 3NWSA 2QDLA 4KLKA 4GOPA 3HOXH 1QZHA 2KEDA 3J7AF 1Y14B 2RF4A 2VUMB 1KABA 1MD2D 2PCFB 4AH6A 1IBML 5GADC 4KHPL 1PH1A 1B3AA 1XX8A 3PCOB 1EWHA 4AYBB 1PRTD 3QB3A 1ZKOA 2E75C 1HHVA 3D8GA 2ZJQA 1NMGA 5JEAJ 1RKNA 5IGFA 2MQHA 1AW7A 3U4VA 2R93G 3C1EA 4L5RC 3BYYB 2YTYA 1KD1C 1LLRD 4RKBA 4JI0Q 5JOBA 1AE2A 4DR5Q 1G2SA 5CV9A 1U4LA 4BY7B 3GV3A 4I65A 4OX9L 4U68A 4IUVA 1GM5A 4B3SL 3DXJC 1EWCA 5D14A 4DUYL 5FLXE 2A74C 3NHHA 1UUPA 1XNQQ 4PNYA 1R9TB 1Q46A 2NVYH 2N49A 1DOMA 2CFMA 5EBCA 2F0DA 2O2LD 4APVA 2B2TC 3HS0C 3BDLA 4C2MB 5A2QE 1EY0A 1AZQA 1JB3A 2PZTA 4C1NK 4HAEA 4JI4L 3T1HQ 4H13C 1SYGA 2EYJA 2E2JB 5J3BA 2K5QA 2UXDQ 1OXUA 3DWAA 4LF4Q 1CSQA 5CBEE 3EBEA 1S5ED 1U4MA 4LK1C 2EJMA 2K01A 2SNMA 4HCSA 4QF4A 4X6AH 1AN8A 1PH5A 2ZJPA 2KENA 4LF8Q 4R8NA 2DY7A 3N52A 4NB3A 4A3IB 1IBLQ 3A8IE 4DV1Q 2K5NA 2QGQA 5LL6S 2E5LQ 4BA2I 3MZ5A 1E0BA 1EFID 2E2HB 3Q0AA 5EBDA 5FLMG 1HZCA 2NVQH 4R9WA 3H91A 2A6HD 1NUCA 1KAAA 3NBHB 4DNTB 3TS0A 3T1YQ 3BZCA 2LSSA 1LT3D 4OWXB 5IT9c 3HOZG 4A3CH 4ALPA 3CP0A 2PQAB 3SVMA 1MJEA 1DXMA 4CJ1B 4DAYB 4JBJA 2D2CC 4IPHA 5IP7G 1TVXA 3I7FA 2WAQE 5D3DA 1KQSA 5IP9G 2CQOA 1N32Q 1BCPF 1M4VA 4KD4A 3PUYA 5KYIA 5LMUQ 1BCPD 4IFDJ 2PI2E 1A15A 2VB3X 3EROA 4A4IA 5I6WA 1TIID 4GKKQ 5C3EG 1SBBB 1WD1A 4F8MA 1RD9D 2BA0A 1LTGD 4X66Q 1JOQA 1I94Q 4CDFC 2SDFA 4NXNQ 1EY8A 4C3IB 3VA7A 1EZ6A 5E3FA 3GTJB 2LS01 1WTVA 2G5DA 3BYTB 4DV6L 2ID0A 5FLXL 5FO7B 3OTOQ 2NVTB 1N34L 5C44H 1EWIA 2L12A 4FXGC 3HRZC 3T56B 4JBWA 2RQXA 3A5ZB 1XYIA 1SMYD 3E3XA 4BY1H 1W6KA 3DLLA 2F0UA 4J15A 1HA6A 5FO8B 2M2LA 2V1CC 2ATWA 3QIAA 3I4NG 2Z6KA 1T5XD 4LFAQ 3AU7A 1PLFA 1D7QA 1PV4A 4R4QA 2G9DA 1PTOD 1Q82C 1VQBA 3O13A 3OWFA 2IWHA 2QCPX 3KLRA 2AUJD 1X3GA 1E22A 1PDQA 1X9NA 3GTPH 2NZ1D 1H9MA 1KHIA 4JC0A 5CV5A 1GJXA 3AEVA 3UDGA 2Q8IB 3MWYW 2PQEA 1I50B 1LTSD 5IODA 3M4OB 3EVQA 5DLQE 2TMPA 4LF5Q 1KNEA 1I4HA 2OEOA 2KECA 1Z7TA 4LUVA 1JQYD 2JE6I 4DK0A 1FNWA 1K0SA 1X65A 1VQJA 2D5DA 1B8AA 4JI1L 3VYTA 5JJLA 1I6VC 3QR8A 4X64Q 2HIVA 1VQIA 2DJFC 1JJGA 2F0VA 2E8GA 2R3ZA 1SNQA 2ZTCA 4O42A 4EQPA 3J81j 2BE5C 4OONA 3H3VC 1UE1A 3NXWA 1K0RA 3RZDB 2IY5B 1CKMA 1FNVA 3HOYH 5IYBH 1JJ2A 1I4RA 2HUGA 4GNXC 1VQDA 2EJGC 3W1GA 1HUNA 3S17B 1JWSD 2LMCB 4R4IA 2C35B 3E0JA 4V0BA 3C1FA 4QUCA 1UAPA 4FXKC 4WFN3 4DUZQ 2WKDA 4UDUC 4GNXB 5E4XA 5ELDA 1PHJA 1C0AA 1CSPA 4A3KG 1Y1WB 4IUUA 3SK6A 1XTCD 1F2LA 4IJHA 1VMPA 3PUWA 1NMFA 2PMZB 1B1ZA 3UE1A 1PYWD 3CCSA 4MIUA 2Z4IA 5M3FB 1K8AC 4RHSA 2WFWA 4IQZA 1PH4A 2K1BA 2ZTEA 1RDPD 2K28A 1F9RA 4H0LC 4G57A 1QJOA 5FLMH 1S5CD 5CC4A 1LT4D 3Q22A 3K7UC 1PA6A 1MBYA 1SE3A 5D65A 3D0FA 4KK7A 4ZUIA 2R7ZH 3LWEA 4XYOA 4PG3A 2A68D 3HOZH 2KOLA 4OEMB 1VDZA 1BQQT 2D0PA 1BCPC 2JA6G 2F1MA 4DV2L 2EYFA 3GTLH 4HIMA 4HIOA 4P75A 1MJCA 4LJZC 1VQFA 1G6ZA 4C3JH 3PUVA 5CORA 3IL8A 5IP7H 2ES2A 3ICEA 3SE0A 4ZQ3A 4JI0L 3S1QB 1EY5A 1BBUA 1SLJA 4DR5L 1ASYA 5IP9H 3V2TA 4YHHQ 2K50A 4A93B 2NWGA 4V190 4FXDA 2M00A 2V4DA 3K5NA 1SSOA 2RHSB 3S15B 3ULPA 2CQAA 1RODA 3SHLA 2PZWA 5C3EH 3HKZE 1VQNA 1RL2A 1W3SA 2NTTA 1YHQA 1XNQL 2ZM6Q 4YWKA 3CAMA 2B8GA 1N33Q 4A3FH 3EIVA 2F0PA 3GTGH 1SMYC 1VQHA 2NZHA 5IIFA 1EIFA 3T1HL 1PH9A 2EYLA 1L0YB 4AIMA 4CJ2C 4G4KA 4BBSH 2K75A 3EJIA 3NBIA 1H9SA 5GAEC 4LF4L 2YU9B 3L9AX 3EFXD 3K5OA 4HCEA 3V05A 4B3TQ 3MA2B 5IYDH 2PW7A 2E2IB 4QGUA 1VS0A 2O5IC 1MSGA 3WWVA 5C4HA 3W2DA 1GD7A 1C8CA 5JJIA 3I4NH 3S1RB 1LO5D 1E7ZA 2ZXOA 4LF8L 2IT1A 3ULJA 1U4RA 3UI2A 1RF2D 4DV1L 3OWEB 1BBWA 1X55A 2E5LL 4XQJA 1SNPA 1IYUA 4RKLA 1K83H 1QOHA 2XRQD 3S14H 3D3RA 4LF6Q 5IGGA 4KN4C 3T1YL 5JEAH 2B63H 1SXTA 1KLUD 3H09A 3W3AA 1IBKQ 1OXVA 4K14A 4GLVB 3S1MH 1BOSA 4KKUA 4H7BA 4C3HB 3CCLA 4A3MH 1YJ9A 1Z6HA 3PO2B 1FL0A 4UY8C 1J8IA 1HQRD 2ALYB 1HFGA 1A62A 1HPCA 4ODGA 3D4DA 4BA1I 5CR3A 4DNIA 4EGVA 1N32L 5IGDA 2A19A 1HUMA 2QEXA 4TQUS 5EPKA 5LMUL 3CRKC 5CBAE 2Y0SE 4JI2Q 4GKKL 2NBFA 1D1IA 3PIOA 4X66L 3SDZA 3L2PA 2GA4B 3K57A 1I94L 4NXNL 3LWUA 1DM0B 1PH6A 1Y69U 2F0MA 5E7NA 1QZGA 4A93G 1BDOA 1TS3A 4HN7A 2Z0SA 4TKOB 4ABNA 4E6IA 3OTOL 4KJOA 1E2ZA 2A68C 4DR3Q 3CC2A 3GTOH 2GVAA 3M9BA 2WAQB 1DYQA 2I5HA 1STYA 3CC7A 3PO3B 2K5HA 1WTXA 1ILPA 1RIPA 3IAYA 2ASBA 2A5HA 4A76A 1QNUA 2K52A 4G7HC 4YWMA 1FVIA 1LUZA 4HSPA 4PV1C 2VL6A 4LFAL 2KVMA 2WINB 3HOWB 4QCLA 1WYDA 1WD0A 4WJWA 1U9RA 4CDCC 2JA8G 4L8JA 1JWUD 2CHBD 4A3JG 3LNNA 2O5JC 1IZ6A 4A75A 3CMAA 2JA6H 3FPPA 5I6YA 2PNRC 2DY8A 1S72A 1H9JA 4J1MA 5C5LA 4K8IA 1E2VA 5M3MB 4LF5L 2LXKA 4HJ7A 1Q12A 2EY2A 4ZRZA 4LFBQ 3MXUA 4O2DA 2F0GA 4X3KA 3RLOA 4OWTB 4HJ5A 4QY7A 1ML0D 2VXWA 3KDFB 2HDMA 4X64L 5D3IB 1L1OB 4IFDH 3A74A 1WJJA 4DAPA 2NB0A 3HOVH 2B2VA 5LMNQ 3NTHA 3HOYB 5M9OA 1SNCA 1WCMG 1JR0D 1SYDA 4QB4A 5J22A 4IOCA 3MXNA 1HNWQ 2FJ2A 1I6HH 4IUTA 4C56C 3E6ZX 2WP8J 4DUZL 3GP7A 4HJAA 4KV6A 4ME3A 1HNXQ 1J5EQ 1Z47A 1MHWC 3VYUA 4OIKA 4RA8A 3NTIA 1KRTA 3GTQH 1HRJA 2GN5A 5A35A 3FPUB 2DN8A 5LHY1 3BDOA 4DFAA 3TRZA 2FHTA 1M1KC 3ER0A 1X6OA 2SOBA 1JICA 5F2DA 4KKTA 1TWFB 4POFA 2F03A 2H5XA 2MPMA 3SK5A 2GVBA 4DV7Q 1JT8A 1B70B 3FKIG 1OXTA 3B6YA 3H3VI 3SR1A 2Z4HA 3HZXA 1EQRA 4JVZA 2NN6G 4A3DH 1D6EC 5M5WB 2R7ZB 2D62A 2UXCQ 1W2BA 2BA1A 3DHQA 3M4PA 3F2DA 5JPNC 2PZUA 1YBYA 3H15A 1HTLD 1EY9A 4CGYB 1JE4A 1NR2A 4IUNA 2IW3A 5GAHC 3MC0B 3T51B 5K36G 4GLAC 4C3JB 2EY6A 2F0JA 4L5TA 2UUAQ 4B3MQ 2R7FA 4AQYQ 3M3YH 1VQ8A 1B4OA 2DNEA 1VQ7A 3RR5A 1FGBD 5HGQA 1S5BD 1NCVA 5FK9C 2F0IA 1LABA 2H4OA 4ZKCB 4YHHL 3RZOH 1VQGA 1TS5A 3OMGA 4X3TA 4DXFA 3MAQA 3PUZA 1NSNS 1ZEQX 4CKEA 5C4JH 1IW7C 4B3RQ 2X6LA 1GUNA 2RVLA 1STEA 1K8OA 4QJFA 2XSCA 2R92G 1CM9A 1VQ4A 2A73B 2EYOA 2ZM6L 1TY0A 1N33L 3GTGB 1HXYD 1Q81C 4RG1A 4ZCKA 1J6QA 5M3MG 3Q23A 2J7ZA 2EXZA 1SMXA 4FF1A 4NPSA 4FF4A 4I7ZC 3MFGA 4JI8Q 3PSIA 4JV5Q 3S2HH 1TS4A 4JI3Q 1G91A 2MP1A 4L6TB 2NTSA 4A3LH 4PMBA 1EU4A 3J80i 1CQVA 4QMGA 1CK1A 3S1NH 1STAA 1A3VA 4CKBA 4RWSC 1Y1VG 4QL5A 3CXCA 1HTPA 2BE5D 1H95A 4IUPA 1HZ9A 1QCBD 4B3TL 2LY7A 2Q8RE 1ILQA 1TWGB 2XGTA 3HOUG 3MEFA 1DCZA 1F2ZA 1O7LA 1T5EA 3J80E 2QA4A 2JJQA 4BXXG 4RGOS 1HR0Q 2WB1E 3KYHC 3H0GB 2JA8H 1YHBA 1O7YA 1ZXTA 4DGZA 1WTPA 2H1EA 3CHBD 4LF6L 2M9VA 2B63B 1V1OA 3EA6A 1X56A 3MFYA 4IPCA 1ENAA 3J81i 3S1MB 4A3BH 5JJZA 1PTOH 1IBKL 3PF4A 5C4XH 1EYAA 1JC7A 4EQOA 3I56A 4IALA 1X32A 2B8FA 2I0QA 3BZKA 4IURA 3TZDA 3F2CA 1IL2A 1ZYRD 4HMJA 3ND8A 5G3LF 1A63A 1H9RA 1PFNA 3TBIB 2MO0A 3A54A 3ZJYC 2AHOB 2L0CA 2MNAA 4XT1B 4XTCS 3FEWX 1WTQA 2VUMG 1EQQA 2F0OA 1KDCA 3J81E 1AE3A 3RN5A 3CW2C 1UEBA 3G7LA 4RAUC 3TP5A 1VQCA 2JA5H 1QVFA 1SRUA 3E0EA 3MHBA 1JB7A 2BDOA 4AYBG 3KUPA 3A7AB 2SEBD 1STBA 2Z6KC 1WCMH 4M1UB 2K32A 4DXGA 4RGTA 2NVXB 2F0FA 3CPWA 4JI2L 3I8ZA 2J4XA 3CU7A 3K0YA 1IXRA 3PIO3 1JE5A 1FD7D 2VQEQ 3GV6A 1SYEA 1PH2A 2L1BA 2F4IA 4A3EH 2XNAC 2R6GA 2YTXA 2EYHA 2CKZB 1EQTA 2FMMA 4BY7G 3NQTA 1N8RC 4JK1C 3CKIB 4XQNA 4DR3L 3FVQA 1TWCH 1YZ6A 3KBGA 1SNOA 5IYCG 1EYDA 1RCVD 1EQVA 1QUQA 3OPOA 2HCCA 3FKIH 1KL9A 3CCEA 2KUMA 1D1KA 5EQ0A 3AB9A 3RD4A 4ZAIA 4JI5Q 4HJ8A 2Y0SB 2B2YC 1PZID 2NN6I 4FVMA 4BWGB 4HMIA 1FR3A 5JJKA 1CHQD 3QOLA 1I4QA 1Y8NB 4P73A 4R4CA 1G2TA 1YIJA 1S5FD 2L11A 4YY3Q 2CWAA 3CCRA 1TWHB 4MN3A 3PF5A 1D5ZC 4ME5A 2FINB 1CKNA 1LTBD 2R93H 4EVOA 4M8AA 3J80L 5JVG3 4HEDA 1EEFD 1KC8C 1PZJD 4PMWA 1PYBA 1CHPD 1DJRD 4LFBL 4RGMA 4BBRB 4A3IG 1LTLA 1OXSC 3PQIA 4CJ0B 4S3SA 4QIWE 1EIYB 1B7YB 3HOVB 4DR6Q 1YJWA 2R92H 1A0IA 5LMNL 2RKSA 1JMCA 3S2DH 3PIPA 1G291 1M8AA 5LMNW 4LFCQ 3I4MB 1HFNA 1Q8KA 4IUQA 1QWYA 1XXGA 2Q2HA 1HCZA 1NNXA 2Z8LA 3L3OC 3MXGA 1CA5A 2JA7B 4TRDA 1VQ5A 3DM1A 1RJTA 1M90C 5COYA 5KNCA 1E24A 3OW7A 5CV7A 3J81L 2UU9Q 1HNXL 3GTMH 1ESRA 1J5EL 1EL0A 2KHIA 5H1SE 5DM63 2D0OA 4B9WA 3M7GA 1S5DD 3QJYA 4RCOA 4G7ZC 3DMUA 3K58A 2EVBA 3PMFA 3TZUA 4A3GB 4FO2A 1PYSB 2KCCA 4BXXH 2RCNA 1I5FA 4GN4B 4LWCA 2EE1A 5C0XG 3HOXB 3BZDB 2KCTA 1B9NA 1XNRQ 4DV7L 1ZYRC 3KF8A 4IJLA 4LW1A 4A3DB 2ICIA 4C3IG 4X3SA 4K5XA 1GUSA 2UXCL 1STGA 4GKJQ 2L4NA 2DNCA 1YITA 2EZVA 2VY3A 2AWNA 2XTIA 4OO1I 1D8LA 1VMCA 1O78A 2KQ3A 5M5XH 2EY5A 1CUKA 3BG3A 1PXUA 1Q1BA 2K03A 3NEMA 1VQPA 2HD3A 5KYLA 1TR5A 1MKHA 1X3QA 3RUZA 5DAUA 1UE5A 1NAPA 2UUAL 4B3ML 4KN7C 5T1IA 1L0XB 2OWOA 5FLXc 1SYFA 3X3NA 4AQYL 4HTHA 2VUMH 2EXDA 1TT2A 2EQSA 4UP9A 1H9SB 3J7YW 2EIFA 4IPGA 3CCUA 1DD2A 3I73A 4LNQA 1Q3LA 3QWNA 3GD7A 3A7LA 1GUOA 5E1FA 1XJVA 1LT5D 2NVYB 3DWQA 3FP9A 2K5DA 3VR6A 4RCNA 2KHSA 4HJ9A 2RBMA 3VDYA 1I3QH 4XIGS 1K73C 3X3MA 2ZJRA 3NSWA 5BN3A 2I07B 4JI8L 4R4OA 3GO5A 1AFPA 4JV5L 3DM3A 1IKMA 4JI3L 4BY7H 4IO9A 3CF5A 3S1NB 2BOSA 2IJ0A 4H44C 3KJPA 2K5VA 3KF6B 3NPPA 2ZXPA 2UXDL 4XT3B 3J80c 2UUBQ 1V43A 1LTAD 5GROA 3NQIA 3F8TA 5IYCH 2SNSA 3K0XA 4R1JA 3NUCA 1VQOA 1EIHA 2CCZA 4I7AA 1TS2A 4C2MH 3KBXA 4DK6C 2EPBA 3TSSA 4YCWA 4OL7A 2OTLA 3R3OA 2MO1A 5CV8A 1Q1EA 2JXMB 1HR0L 1Q8IA 2JP1A 1S4ZA 4C1NI 1IBLL 3BVMA 1U4PA 3A0JA 2N78A 2RHQB 2NVQB 1RTNA 5AFWA 1WVLA 4TVAB 3IFTA 4JW0A 1UE6A 4XQQA 5M5YH 3U50C 1Y1WG 2RDFA 1EY7A 5BR8Q 4GLXA 2L5TA 5JPMC 3RN2A 3KLSA 4K0KQ 1GKHA 2I46A 1VQAA 3SXHA 4GS3A 2Z6BA 3SGIA 2MUYA 5M3FG 2AQ2B 2HQLA 3CCVA 1ICFB 3VR4A 1HQMC 2JEBI 1PFMA 4J6HA 2QDBA 3EQLC 4FYDA 4F88A 1LACA 1S3OA 3CRLC 1EFWA 2AMCB 4NDXA 3UDFA 1LTRD 4ILWA 3I70A 4FF2A 1KNAA 2CH4A 3DUZA 3T53B 1Y8PB 1SR3A 2WB1B 4R8IA 5C6AA 1DZ1A 2D9UA 1EEID 3H94A 5GAGC 1EYCA 1IHZA 3NE5B 1K28A 1SFOH 1KAWA 1BBXC 1CZGA 4CDDC 1KDAA 2C9OA 4A3EB 2YTVA 5K5PA 2VQEL 1J9OA 3URYA 3PGZA 3KK7A 3BVGA 1K9MC 2O4XA 1TWAH 4A3KH 1SJHD 4JG2A 1BXTA 3T4AC 4L63B 1VQ6A 2F0EA 1TQOA 5C44B 1IW7D 2PYKA 1TWCB 1Q86C 2F0WA 4Y7NH 2IHEA 4NKLA 2E2DC 4BY1B 4ID6A 1BNZA 3VA5A 2KCNA 1QVCA 1TY2A 2UXBQ 1KIXA 4ZLTF 5C0XI 1D5MC 2OXPA 3P20A 5NUCA 3F2BA 2F0LA 1HJPA 4JI5L 3GTJH 1SE8A 4UHVA 3E9HA 3A8KE 2Q2TA 4MHEA 1FYCA 4GZYC 1B53A 3G48A 5C4ZA 4DK1A 1CA6A 2B2UC 3GTPB 5C3XA 2R61A 3IFDA 4XDXA 4YY3L 1OTCA 2K4KA 4B9XA 3L7ZC 3FRPB 2F0QA 1RTOA 1UEAB 3TP8A 2L55A 3NENA 3MXNB 1JWMD 3OOCA 2QEJC 4FDBA 1BUVT 1ESFA 1LV9A 1L1OC 3UE0A 1B2TA 3M4YA 3LX0A 3FMCA 4DR6L 4NXMQ 3Q6SA 4GOPC 1QE6A 1V1PA 2F4VQ 4MZ9A 2PPBC 3P1HA 3F1ZA 4DR7Q 1I50H 2FMCA 3PIP3 4LFCL 3M4OH 5FJ8G 3ITPA 3K8AA 2ZTDA 4GOPB 1BKBA 1GUWA 3K7AH 4PZ6A 2DGYA 1CQFA 1F77A 4C3HG 5C5MA 4HSVA 2IL8A 3PO2G 3H6MA 3CC4A 4BS9A 1A8VA 2HIXA 4GN5A 1N36Q 5EKKA 1SEBD 2AUKA 2WKCA 3W5OA 5E4WC 2UU9L 2ENBA 1JCKB 2EDGA 1OXXK 5CMDA 3AYHB 1L2FA 3MVVA 2JA9A 1I4GA 1EYGA 1EUJA 5IGEA 2OCEA 2Q8TA 1ASZA 4QIWB 5BN5A 3HFZB 1YNNC 3S17H 1CKOA 3V96A 2XWJB 4U673 1E2WA 3D6CA 4OIJA 3H3VH 2F52A 1ENCA 1GXDC 3VYSA 2B2WA 1MIUA 3M4QA 1UNSA 3TP7A 4DN4M 1YEZA 2A6ED 1NY4A 3DWPA 3MTSA 3GDEA 3KJOA 5LL6X 2EY1A 4F87A 2N55A 2LFNA 3HG9A 1C48A 3HOZB 4GKJL 3ULLA 2VNUD 4WJ4A 2RSNA 2NYZD 1SYCA 1FJGQ 3ND9A 1QG7A 3F2UA 3NK9A 4KHVA 3GTLB 5HURA 1F9PA 3D4RA 1Q7YC 5M3FH 4BY1G 2WAQG 1LM0A 4P2CB 3HP3A 3N6RA 1XPRA 3PO3G 3AFPA 1PMRA 3KOJA 4JOIA 4IOAA 1U5KA 1PRTF 4POGA 3OIQA 4JBKA 2UUCQ 1KLGD
chains in the Genus database with same CATH topology
4K5VA 4KMUC 1ONLA 2WACA 5IGCA 5C3EB 1BF4A 4WORA 4NW2A 4PQXA 4A3FB 4KI0A 2XWBB 1I3QB 1GUTA 1BO0A 1KDBA 2XN9C 3K5MA 4ULLA 5EJWA 5ELFA 4ZYSA 1CTMA 4ZUJA 5CYUA 4BBSB 3RLFA 3S9WA 1GUGA 5ELCA 3TN2A 5ELEA 1IKLA 1ENFA 1EZ8A 5ISRA 3JAME 1WTWA 3SEBA 4NMZA 3I4NB 5EPLA 4KHZA 4Q0FA 5JVH3 5C0XJ 3DEOA 3HKZB 4Q5VA 5KNDA 2TSSA 1V8QA 1MGSA 1K83B 3S14B 4DAVA 5M5YB 2MHVA 3R2TA 3T13A 2JYOA 1G8ZD 4OO1G 2EYMA 5EGTA 1JOKA 2KJXA 4PMCA 2F0SA 2QILA 5I9PA 5EPJA 1EY4A 2C5CA 5IOCA 1PZKD 3IKJA 4A3MB 4IN3A 5KIXA 2NUCA 2K6AA 2MJ8A 2K05A 5G3LD 3P75A 2B2TA 2IX1A 2J0TD 5KEEA 3U9OA 3E5SA 3QOJA 1AP0A 4DU9A 3NP8A 1B44D 2G9HD 1SFOB 3D4WA 4KD3A 2AQ3B 5JAVA 4X3UA 1BR9A 1JOOA 3M7NA 4UAIA 3HGBA 3K6OA 5I2YA 4C3JG 1YNJD 1TWAB 4A3KB 4K5WA 2A6EC 4KKSA 1SE2A 1WTRA 3R2IA 3WDNA 3NBHA 4Y7NB 3GTOB 5J39A 2CW0C 1I4PA 4KY7A 5KGUA 2L9HA 1F2MA 2ZXRA 4DAYA 2E76C 2OT2A 3D6WA 3AMUA 2NN6H 1A3UA 1B50A 5I9OA 3WOEA 1PRTC 3TMEA 2JA6B 2CVRA 1A6XA 2BCOA 4ZKBB 5A2QL 3A8JE 3JAML 4DNRB 1SNDA 5K36H 1O80A 5FKAC 2F3VA 1PRTB 3A55A 2VB2X 2EJFC 3D31A 1PTOF 3R93A 1DOKA 4YIJA 1NR4A 3I4LA 3NWTA 5FO9B 2QKIC 5KRUA 5HGTA 3OHXC 3R8BA 4EQNA 4KJNA 4RH6A 3VR3A 4XXEA 3P7JA 5JEAG 3ERQA 3BDCA 1MSHA 1ET9A 3K7AB 2RSOA 2KEEA 3RMHA 4LAAA 1I6HB 1SNMA 1STNA 1O7ZA 4RGNA 4N9PA 2LKVA 3GTQB 2B2YA 4K2LA 2OF1A 4CBVA 5CV4A 3TDQA 2ICEC 3I3CA 2AWOA 3M85A 3SK4A 4OO1H 2A6HC 2K5WA 2F0NA 4FF3A 1GHKA 4J8QA 5KNBA 3ONAB 1Y8OB 1EU3A 1HA5A 1SJED 1ET6A 1AEXA 3M3YB 1QILA 3OSOA 3Q24A 1WTOA 1R4PB 1YNJC 3RZOB 3FDTA 4OHJA 2F0TA 1KTKA 4DF7A 4HR7B 5C4JB 2IPKD 1CFMA 2JSOA 5EKLA 5ELBA 3KLSX 4F7XA 1BCPB 1TU2B 1W6JA 5J1ZA 3S2HB 3OMCA 1EY6A 4NP5A 4QUFA 1OO9B 3GTKB 5CGKA 1QB5D 3OIPA 3U9SA 1KLGD 1FNUA 4IFDG 4CHTB 2IX0A 1IYVA 2A69D 1LTID 3MEHA 1D5XC 2JA8B 3DEPA 3K5LA 1DONA 4A3JB 2AQ1B 3VYRA 1VF7A 1PTOC 2HDLA 1AZPA 2Z1CA 1TKWB 4B08A 4A3BB 2BDNA 2JEAI 1PTOB 1H9KA 1R4QB 2K33A 5C4XB 1YNND 1PFBA 4KY6A 1STHA 1SYBA 1VCIA 1B9MA 1Q90A 5TSSA 1GOZA 4LMQD 3PV0A 5EKIA 1JORA 3QO2A 2F0HA 3PUXA 5DEHA 2JA5B 2HQEA 4FNFA 1WCMB 5I4DA 4IZ8A 3C2PA 3A56A 1D2BA 3BVZA 3I91A 2EYPA 2KA7A 1LTTD 2F0KA 3WOFA 1A3TA 5IT9E 2ZT9C 2K04A 1CZWA 5BN4A 1A2TA 3MXPA 5DNFA 3NTKA 1SDFA 2X69A 1CT1D 1CI3M 5FOBB 1EOTA 3VR5A 3ZYYX 1C4QA 2QF7A 5C0XH 3FKIB 3QG1A 2N88A 2B2VC 3G6JB 5DM73 1I4XA 4KY5A 4KTAA 1A2UA 2WV6D 3S16B 3I72A 4OGQC 2E74C 4RHRA 1V1PB 1MI2A 3GQBA 1EIGA 4RFBA 5CV6A 4K8JA 2B39A 1ICWA 2R93B 2RA4A 3HEJA 2IX3A 4K6DA 3J7AV 3TP6A 2WIIB 2XVSA 2EOTA 4O1NA 2R92B 1F9QA 1LT6D 2B2WC 4TSSA 3S2DB 1K8MA 2XIWA 4XYQA 4K6LA 3SK8A 2HCIA 1XWEA 3C3LA 2YYZA 5I2XA 2A69C 4DA2A 1GHJA 1F9SA 4K2KA 1Y1VB 1VF5C 3GTMB 2PW5A 2F3WA 1QNKA 4FP5D 4Z9CB 1RHPA 3I90A 4N9TA 1IL8A 3VR2A 3HOUB 4IFDI 3BS1A 2K7VA 2X6GA 1SE4A 2RDGA 5T1GA 3CQZB 3K59A 5C3WA 2B2UA 2PO4A 5IT9L 2XRSD 4ZK9B 1X3PA 4G7OC 1SAPA 4CKCA 2FFKB 1II3A 5IGBA 3C46A 4WRDA 3T16A 5M5XB 1F2YA 2RDHA 2CW0D 2MGSA 1DOLA 3NWSA 2KEDA 3J7AF 2VUMB 1KABA 1MD2D 2PCFB 1B3AA 1XX8A 1EWHA 4AYBB 1PRTD 3QB3A 1ZKOA 2E75C 1HHVA 3D8GA 5JEAJ 1RKNA 5IGFA 1AW7A 3C1EA 3BYYB 1LLRD 4RKBA 5JOBA 1G2SA 5CV9A 1U4LA 4BY7B 3GV3A 4I65A 4U68A 4IUVA 3DXJC 1EWCA 5D14A 5FLXE 2A74C 3NHHA 1UUPA 4PNYA 1R9TB 1DOMA 5EBCA 2F0DA 2O2LD 2B2TC 3HS0C 3BDLA 4C2MB 5A2QE 1EY0A 1AZQA 1JB3A 2PZTA 4C1NK 4HAEA 4H13C 1SYGA 2EYJA 2E2JB 2K5QA 1OXUA 3DWAA 5CBEE 1S5ED 1U4MA 4LK1C 2EJMA 2K01A 2SNMA 4HCSA 4QF4A 1AN8A 4R8NA 2DY7A 3N52A 4A3IB 3A8IE 5LL6S 4BA2I 3MZ5A 1E0BA 1EFID 2E2HB 3Q0AA 5EBDA 4R9WA 3H91A 2A6HD 1NUCA 1KAAA 4DNTB 1LT3D 3SVMA 1DXMA 4CJ1B 2D2CC 1TVXA 5D3DA 1BCPF 1M4VA 4KD4A 3PUYA 5KYIA 1BCPD 4IFDJ 1A15A 2VB3X 3EROA 5I6WA 1TIID 1SBBB 1WD1A 4F8MA 1RD9D 2BA0A 1LTGD 1JOQA 2SDFA 1EY8A 4C3IB 3VA7A 1EZ6A 5E3FA 3GTJB 2LS01 1WTVA 3BYTB 2ID0A 5FLXL 5FO7B 2NVTB 2L12A 4FXGC 3HRZC 3T56B 4JBWA 2RQXA 1XYIA 1SMYD 1W6KA 2F0UA 1HA6A 5FO8B 2M2LA 3QIAA 1T5XD 3AU7A 1PLFA 2G9DA 1PTOD 3OWFA 3O13A 2IWHA 2QCPX 3KLRA 2AUJD 1PDQA 2NZ1D 1H9MA 5CV5A 1GJXA 2Q8IB 3MWYW 2PQEA 1I50B 1LTSD 5IODA 3M4OB 3EVQA 2TMPA 1KNEA 1I4HA 2OEOA 2KECA 1Z7TA 1JQYD 2JE6I 4DK0A 1FNWA 2D5DA 3VYTA 1I6VC 2F0VA 2R3ZA 1SNQA 4O42A 4EQPA 2BE5C 3H3VC 3NXWA 3RZDB 1FNVA 1I4RA 2HUGA 2EJGC 1HUNA 3S17B 1JWSD 2LMCB 3E0JA 4V0BA 3C1FA 4QUCA 1UAPA 4FXKC 4WFN3 2WKDA 4UDUC 5E4XA 5ELDA 1Y1WB 4IUUA 3SK6A 1XTCD 1F2LA 1VMPA 3PUWA 2PMZB 1B1ZA 1PYWD 4MIUA 2Z4IA 5M3FB 4RHSA 4IQZA 2K1BA 1RDPD 2K28A 1F9RA 4H0LC 4G57A 1QJOA 1S5CD 5CC4A 1LT4D 3Q22A 1MBYA 1SE3A 5D65A 4KK7A 4ZUIA 3LWEA 4XYOA 2A68D 2KOLA 1VDZA 1BQQT 1BCPC 2F1MA 2EYFA 4LJZC 1G6ZA 3PUVA 5CORA 3IL8A 3SE0A 4ZQ3A 3S1QB 1EY5A 3V2TA 4A93B 2NWGA 4V190 4FXDA 2M00A 2V4DA 3K5NA 1SSOA 3S15B 2CQAA 1RODA 3SHLA 2PZWA 2NTTA 2B8GA 2F0PA 1SMYC 5IIFA 2EYLA 1L0YB 4CJ2C 4G4KA 3EJIA 3NBIA 1H9SA 2YU9B 3L9AX 3EFXD 3K5OA 4HCEA 3V05A 3MA2B 2PW7A 2E2IB 2O5IC 1MSGA 5C4HA 3W2DA 1C8CA 3S1RB 1LO5D 2ZXOA 2IT1A 1U4RA 3UI2A 1RF2D 3OWEB 4XQJA 1SNPA 1IYUA 4RKLA 1QOHA 2XRQD 3D3RA 5IGGA 4KN4C 5JEAH 1SXTA 1KLUD 3H09A 3W3AA 1OXVA 4K14A 1BOSA 4KKUA 4H7BA 4C3HB 1Z6HA 3PO2B 1J8IA 1HQRD 1HFGA 1HPCA 4ODGA 3D4DA 4BA1I 5CR3A 4EGVA 5IGDA 1HUMA 4TQUS 5EPKA 3CRKC 5CBAE 2NBFA 1D1IA 3SDZA 2GA4B 3K57A 3LWUA 1DM0B 1Y69U 2F0MA 1BDOA 1TS3A 4HN7A 4TKOB 4ABNA 4E6IA 4KJOA 1E2ZA 2A68C 2WAQB 1DYQA 1STYA 3PO3B 1WTXA 1ILPA 3IAYA 2A5HA 1QNUA 4G7HC 4HSPA 4PV1C 2KVMA 2WINB 3HOWB 4QCLA 1WD0A 4WJWA 1U9RA 4L8JA 1JWUD 2CHBD 3LNNA 2O5JC 3FPPA 5I6YA 2PNRC 2DY8A 1H9JA 4J1MA 5C5LA 4K8IA 1E2VA 5M3MB 1Q12A 2EY2A 4ZRZA 3MXUA 2F0GA 4X3KA 1ML0D 2VXWA 2HDMA 5D3IB 4IFDH 4DAPA 2NB0A 2B2VA 3NTHA 3HOYB 5M9OA 1SNCA 1JR0D 1SYDA 4QB4A 5J22A 3MXNA 2FJ2A 4IUTA 4C56C 3E6ZX 2WP8J 3GP7A 4KV6A 1Z47A 3VYUA 4OIKA 4RA8A 3NTIA 1HRJA 5A35A 3FPUB 2DN8A 5LHY1 3BDOA 4DFAA 2FHTA 2SOBA 1JICA 5F2DA 4KKTA 1TWFB 2F03A 2MPMA 3SK5A 1OXTA 3SR1A 2Z4HA 3HZXA 2NN6G 1D6EC 5M5WB 2R7ZB 2D62A 2BA1A 3DHQA 5JPNC 2PZUA 1HTLD 1EY9A 4CGYB 1JE4A 1NR2A 4IUNA 2IW3A 3MC0B 3T51B 5K36G 4C3JB 2EY6A 2F0JA 1B4OA 2DNEA 1FGBD 1S5BD 1NCVA 5FK9C 2F0IA 1LABA 2H4OA 4ZKCB 3OMGA 1TS5A 4X3TA 4DXFA 3MAQA 3PUZA 1NSNS 1ZEQX 4CKEA 1IW7C 2X6LA 1GUNA 2RVLA 1STEA 1K8OA 2XSCA 1CM9A 2A73B 2EYOA 1TY0A 3GTGB 1HXYD 3Q23A 2J7ZA 2EXZA 4FF1A 4FF4A 4I7ZC 3MFGA 1G91A 1TS4A 2MP1A 4L6TB 2NTSA 4PMBA 1EU4A 1CQVA 4QMGA 1CK1A 1STAA 1A3VA 4CKBA 4RWSC 1HTPA 2BE5D 4IUPA 1QCBD 2LY7A 2Q8RE 1ILQA 1TWGB 1DCZA 1F2ZA 1O7LA 1T5EA 3J80E 4RGOS 3H0GB 1O7YA 1ZXTA 4DGZA 1WTPA 2H1EA 3CHBD 2B63B 2M9VA 1V1OA 3EA6A 3MFYA 1ENAA 3S1MB 5JJZA 1PTOH 1EYAA 1JC7A 4EQOA 4IALA 1X32A 2B8FA 3TZDA 4IURA 1ZYRD 4HMJA 3ND8A 5G3LF 1H9RA 1PFNA 3TBIB 3A54A 2L0CA 4XT1B 4XTCS 3FEWX 1WTQA 2F0OA 1KDCA 3J81E 3G7LA 4RAUC 3TP5A 3MHBA 2BDOA 3KUPA 3A7AB 2SEBD 1STBA 4M1UB 2K32A 4DXGA 4RGTA 2NVXB 2F0FA 3I8ZA 2J4XA 3CU7A 3K0YA 3PIO3 1FD7D 3GV6A 1SYEA 2L1BA 2F4IA 2XNAC 2R6GA 2EYHA 2FMMA 1EQTA 3NQTA 4JK1C 3CKIB 4XQNA 3FVQA 3KBGA 1SNOA 1EYDA 1RCVD 1EQVA 3OPOA 2HCCA 2KUMA 1D1KA 5EQ0A 3AB9A 3RD4A 4ZAIA 2Y0SB 2B2YC 1PZID 2NN6I 4FVMA 4BWGB 4HMIA 1FR3A 1CHQD 3QOLA 1I4QA 1Y8NB 1G2TA 1S5FD 2L11A 1TWHB 4MN3A 1D5ZC 4ME5A 2FINB 1LTBD 4EVOA 4M8AA 3J80L 5JVG3 4HEDA 1EEFD 1PZJD 4PMWA 1CHPD 1DJRD 4RGMA 4BBRB 1OXSC 4CJ0B 4S3SA 3HOVB 2RKSA 1G291 1M8AA 3I4MB 1HFNA 4IUQA 1QWYA 1XXGA 1HCZA 2Z8LA 3L3OC 3MXGA 1CA5A 2JA7B 4TRDA 3DM1A 1RJTA 5COYA 5KNCA 3OW7A 5CV7A 3J81L 1ESRA 1EL0A 5DM63 4B9WA 3M7GA 1S5DD 3QJYA 4RCOA 4G7ZC 3DMUA 3K58A 2EVBA 3PMFA 3TZUA 4A3GB 4FO2A 2KCCA 2EE1A 5C0XG 3HOXB 3BZDB 1B9NA 1ZYRC 3KF8A 4A3DB 2ICIA 4C3IG 4X3SA 4K5XA 1GUSA 1STGA 2L4NA 2DNCA 2EZVA 2AWNA 4OO1I 1VMCA 1O78A 2KQ3A 2EY5A 3BG3A 1PXUA 1Q1BA 2K03A 5KYLA 1TR5A 1X3QA 3RUZA 5DAUA 1NAPA 4KN7C 5T1IA 1L0XB 1SYFA 3X3NA 4HTHA 1TT2A 1H9SB 3J7YW 1DD2A 3I73A 1Q3LA 3QWNA 3GD7A 3A7LA 1GUOA 5E1FA 1LT5D 2NVYB 3DWQA 2K5DA 3VR6A 4RCNA 2KHSA 2RBMA 4XIGS 3X3MA 3NSWA 5BN3A 2I07B 1AFPA 3GO5A 1IKMA 3S1NB 2BOSA 2IJ0A 4H44C 3NPPA 2ZXPA 4XT3B 1V43A 1LTAD 3NQIA 2SNSA 3NUCA 1EIHA 1TS2A 3KBXA 2EPBA 3TSSA 4OL7A 3R3OA 5CV8A 1Q1EA 2JXMB 1Q8IA 2JP1A 1S4ZA 4C1NI 3BVMA 1U4PA 2NVQB 1RTNA 5AFWA 1WVLA 3IFTA 4XQQA 2RDFA 1EY7A 2L5TA 5JPMC 3KLSA 2I46A 3SXHA 2MUYA 2AQ2B 3VR4A 1HQMC 2JEBI 1PFMA 4J6HA 2QDBA 3EQLC 4FYDA 4F88A 1LACA 3CRLC 4NDXA 1LTRD 4ILWA 3I70A 4FF2A 1KNAA 3DUZA 3T53B 1Y8PB 2WB1B 4R8IA 5C6AA 1DZ1A 2D9UA 1EEID 3H94A 1EYCA 1IHZA 3NE5B 1BBXC 1CZGA 1KDAA 2C9OA 4A3EB 5K5PA 1J9OA 3URYA 3KK7A 3BVGA 2O4XA 1SJHD 1BXTA 3T4AC 4L63B 2F0EA 1TQOA 5C44B 1IW7D 2PYKA 1TWCB 2F0WA 4NKLA 2E2DC 4BY1B 4ID6A 1BNZA 3VA5A 2KCNA 1TY2A 4ZLTF 5C0XI 1D5MC 2OXPA 3P20A 5NUCA 2F0LA 3A8KE 4MHEA 1FYCA 4GZYC 1B53A 5C4ZA 4DK1A 1CA6A 2B2UC 3GTPB 5C3XA 2R61A 3IFDA 4XDXA 3L7ZC 3FRPB 2F0QA 1RTOA 1UEAB 3TP8A 2L55A 1JWMD 3OOCA 2QEJC 1BUVT 1ESFA 1LV9A 1B2TA 3M4YA 3LX0A 3FMCA 3Q6SA 1QE6A 1V1PA 2PPBC 3P1HA 2FMCA 3PIP3 3ITPA 1GUWA 1CQFA 4C3HG 1F77A 5C5MA 4HSVA 2IL8A 3H6MA 4BS9A 5EKKA 1SEBD 2AUKA 2WKCA 5E4WC 2ENBA 1JCKB 2EDGA 1OXXK 5CMDA 3MVVA 1I4GA 5IGEA 2Q8TA 4QIWB 5BN5A 1YNNC 3V96A 2XWJB 4U673 1E2WA 3D6CA 4OIJA 3VYSA 1ENCA 1GXDC 2B2WA 1UNSA 3TP7A 4DN4M 2A6ED 3DWPA 3MTSA 5LL6X 2EY1A 4F87A 2N55A 2LFNA 3HG9A 1C48A 3HOZB 2VNUD 2RSNA 2NYZD 1SYCA 3ND9A 1QG7A 3F2UA 3NK9A 4KHVA 3GTLB 5HURA 1F9PA 3D4RA 4P2CB 3HP3A 3N6RA 1PMRA 1PRTF 3OIQA 4B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5V A;  3D4W A;  1STN A;  3OWF A;  4KD3 A;  4ODG A;  3D4D A;  5IGB A;  4R8N A;  5JAV A;  1SNC A;  4PMB A;  4WRD A;  5CR3 A;  4QMG A;  1SNO A;  4N9P A;  1JOO A;  4KY5 A;  5CV5 A;  2WAC A;  3T16 A;  1F2Y A;  1SYD A;  1EYD A;  4KTA A;  1A2U A;  2LKV A;  5IGD A;  1STA A;  1A3V A;  1EQV A;  1EY7 A;  2RDF A;  4QB4 A;  5IGC A;  2PQE A;  3MZ5 A;  5J22 A;  4ZQ3 A;  4WOR A;  1EY5 A;  5IOD A;  4K5X A;  3MEH A;  3EVQ A;  1STG A;  4K2L A;  3V2T A;  3SXH A;  2OEO A;  3LX0 A;  4KV6 A;  1NUC A;  1KAA A;  2OF1 A;  5CV6 A;  4K5W A;  2M00 A;  4K8J A;  1KAB A;  5CV4 A;  2KQ3 A;  1KDB A;  3SHL A;  2EY5 A;  2PZW A;  1F2Z A;  4J6H A;  2QDB A;  3P1H A;  4HMI A;  5M9O A;  4ZUJ A;  3HEJ A;  3QOL A;  4NDX A;  5KYL A;  3QB3 A;  1TR5 A;  3S9W A;  3ITP A;  5J39 A;  3RUZ A;  4DFA A;  5DAU A;  4K6D A;  4KY7 A;  2F0V A;  1SYF A;  2F0P A;  2F0M A;  4HTH A;  3SK4 A;  1F2M A;  3TP6 A;  1TT2 A;  2SOB A;  4E6I A;  5F2D A;  1SNQ A;  5C6A A;  3D8G A;  4ME5 A;  5C5M A;  4DGZ A;  4EQP A;  5IIF A;  1EYC A;  3H6M A;  4EVO A;  3NXW A;  1RKN A;  3SK5 A;  5IGF A;  1IHZ A;  2EYL A;  4KJO A;  4KY6 A;  1STH A;  1SYB A;  2F0N A;  3C1E A;  5EKK A;  1EZ8 A;  5ISR A;  3EJI A;  1A3U A;  3SR1 A;  3HZX A;  2ENB A;  5E1F A;  1STY A;  1ENA A;  4RKB A;  4KD4 A;  5JOB A;  3C1F A;  5KYI A;  5I9O A;  1KDA A;  4NMZ A;  1JOR A;  5CV9 A;  3DHQ A;  5K5P A;  3MVV A;  3SK8 A;  3TME A;  1EYA A;  4I65 A;  4EQO A;  3ERO A;  4IAL A;  5IGE A;  2F0H A;  2PZU A;  2O4X A;  4S3S A;  1AEX A;  2PW7 A;  5DEH A;  2KHS A;  4HMJ A;  5I6W A;  2HQE A;  1EY9 A;  3OSO A;  4F8M A;  2RBM A;  2F0E A;  5C4H A;  3NHH A;  1JOQ A;  1TQO A;  1SND A;  2RKS A;  5KGU A;  2F3V A;  2PYK A;  4IUN A;  3D6C A;  4PNY A;  1U9R A;  4IZ8 A;  1EY8 A;  4K2K A;  1ENC A;  2F0O A;  1KDC A;  2F0T A;  3SK6 A;  1EZ6 A;  5E3F A;  4DF7 A;  2F0D A;  2EY6 A;  2F0J A;  2F0W A;  2F3W A;  2PW5 A;  2EYP A;  2EYM A;  4NKL A;  3T13 A;  3TP7 A;  5EGT A;  3BDL A;  1JOK A;  3TP5 A;  5I6Y A;  4ID6 A;  4PMC A;  1EY0 A;  3MHB A;  2F0S A;  2F0K A;  4MIU A;  1A3T A;  4N9T A;  2PZT A;  4TRD A;  4YIJ A;  3VA5 A;  2EY1 A;  4J1M A;  5I9P A;  5C5L A;  1SNP A;  1STB A;  1SYG A;  1EY4 A;  1A2T A;  2F0I A;  3MXP A;  4K8I A;  2EYJ A;  4RKL A;  5IOC A;  5EKL A;  5KRU A;  5KIX A;  2SNS A;  3OMG A;  2OXP A;  5HGT A;  1SYC A;  5NUC A;  2F0F A;  5CV7 A;  2EY2 A;  2F0L A;  2NUC A;  3NUC A;  4G57 A;  4F7X A;  5IGG A;  1NSN S;  5C3W A;  2F0G A;  4EQN A;  3NK9 A;  4KHV A;  4KJN A;  5CC4 A;  5J1Z A;  5HUR A;  3ERQ A;  4B9W A;  3BDC A;  2F0U A;  3OMC A;  3P75 A;  4K14 A;  1SYE A;  4OL7 A;  1EY6 A;  4ZUI A;  5C4Z A;  4NP5 A;  3R3O A;  2EYO A;  3DMU A;  4H7B A;  3U9O A;  5CV8 A;  3PMF A;  5KEE A;  5CGK A;  3E5S A;  5C3X A;  3QOJ A;  2SNM A;  4QF4 A;  2EYH A;  4LAA A;  4DU9 A;  2EXZ A;  3NP8 A;  4B9X A;  3NQT A;  2F0Q A;  1SNM A;  2EYF A;  1II3 A;  3TP8 A; 
#chains in the Genus database with same CATH topology
 4K5V A;  4KMU C;  2A1A A;  1ONL A;  5AJ3 Q;  3HOW G;  2WAC A;  3RNU A;  3Q8D A;  2HHH Q;  1IYJ B;  5IGC A;  4DV2 Q;  2DUD A;  2N3S A;  5C3E B;  4EQ5 A;  1BF4 A;  4WOR A;  1C9O A;  4NW2 A;  4PQX A;  2KHJ A;  4A3F B;  1VQK A;  4KI0 A;  2XWB B;  1I3Q B;  1PVO A;  1GUT A;  1BO0 A;  2AKW B;  1PH3 A;  3CCQ A;  1KDB A;  2XN9 C;  3K5M A;  4ULL A;  5EJW A;  5ELF A;  4ZYS A;  1CTM A;  4MTN A;  4ZUJ A;  3CPF A;  3S1Q H;  5CYU A;  4L5S A;  3JAM i;  3TQY A;  4BBS B;  3RLF A;  3S9W A;  4A93 H;  1GUG A;  4DR2 Q;  5ELC A;  3GTK H;  3TN2 A;  5ELE A;  3S15 H;  2UUB L;  1XMO Q;  1IKL A;  1ENF A;  5IWA Q;  1EZ8 A;  5ISR A;  4JI7 Q;  4O0A A;  1DGS A;  3HOY G;  5IYB G;  2K14 A;  3JAM E;  4JCV E;  2OQK A;  2VW9 A;  1WTW A;  3SEB A;  4NMZ A;  3I4N B;  5EPL A;  4KHZ A;  4Q0F A;  5JVH 3;  5C0X J;  3DEO A;  3HKZ B;  4Q5V A;  5KND A;  1B3Q A;  2TSS A;  1V8Q A;  1MGS A;  3UDI A;  1K83 B;  4A3J H;  3S14 B;  1X3E A;  4DAV A;  5M5Y B;  1SRO A;  1K3R A;  2MHV A;  2YU9 H;  3R2T A;  3T13 A;  2JYO A;  1G8Z D;  4OO1 G;  2EYM A;  1YJN A;  5EGT A;  1JOK A;  2E2I H;  2KJX A;  4OEL B;  4PMC A;  2F0S A;  2QIL A;  5I9P A;  1NJI C;  3KFU A;  1QVG A;  5BR8 L;  5EPJ A;  1EY4 A;  2C5C A;  5IOC A;  1PZK D;  3IKJ A;  4A3M B;  4K0K L;  4IN3 A;  5KIX A;  4N8F A;  1G51 A;  3S1R H;  2NUC A;  1KRS A;  2K6A A;  2I5L X;  2MJ8 A;  3I4O A;  2K05 A;  1WI5 A;  5G3L D;  3P75 A;  2B2T A;  2IX1 A;  2JN4 A;  2J0T D;  5KEE A;  3U9O A;  2RCF A;  3E5S A;  2Q2U A;  3QOJ A;  2R7Z G;  1AP0 A;  1S40 A;  3TEH B;  4DU9 A;  5FJ8 H;  3NP8 A;  1B44 D;  2G9H D;  1SFO B;  5IY0 A;  3D4W A;  4KD3 A;  1QUQ B;  2AQ3 B;  1G6P A;  5JAV A;  4C3H H;  4EX5 A;  4X3U A;  1BR9 A;  1JOO A;  3M7N A;  3PO2 H;  1V1Q A;  4Y52 H;  2Q2I A;  3HGB A;  4UAI A;  3K6O A;  5I2Y A;  4X62 Q;  4C3J G;  3CME A;  1YNJ D;  1TWA B;  4A3K B;  4K5W A;  2A6E C;  4DV3 Q;  2IHF A;  4KKS A;  1SE2 A;  4R4T A;  1WTR A;  2VQF Q;  3R2I A;  3WDN A;  3NBH A;  1E1O A;  4Y7N B;  3GTO B;  1CKN B;  2JQO A;  5J39 A;  2CW0 C;  1I4P A;  4KY7 A;  3UDX A;  2PQA A;  5KGU A;  2L9H A;  1JJC B;  1F2M A;  3U4Z A;  4A3F G;  4GN3 B;  1N9W A;  3AQQ A;  4YCU A;  2UXB L;  2ZXR A;  4DAY A;  2CH4 W;  2E76 C;  2OT2 A;  3D6W A;  4DV5 Q;  3AMU A;  3STB D;  4QQB X;  2NN6 H;  1A3U A;  1T9H A;  4BBS G;  1B50 A;  1SN8 A;  3WOE A;  5I9O A;  1PRT C;  1YNX A;  3TME A;  3S16 H;  4MNO A;  2JA6 B;  1PFS A;  2CVR A;  1A6X A;  2BCO A;  4ZKB B;  1WFQ A;  5IYD G;  5A2Q L;  1K8G A;  3A8J E;  3JAM L;  4DNR B;  1SND A;  5ELN A;  5K36 H;  1O80 A;  5FKA C;  3PO3 H;  2F3V A;  1PRT B;  3A55 A;  1PH8 A;  2F3I A;  2QW7 A;  2VB2 X;  2EJF C;  3LGJ A;  3D31 A;  1PTO F;  2CWP A;  1VQE A;  3R93 A;  1DOK A;  3JC6 6;  1NTG A;  4YIJ A;  1NR4 A;  3HKZ G;  3I4L A;  3NWT A;  1FGU A;  5FO9 B;  2QKI C;  3HOW H;  2BH2 A;  5KRU A;  3H0G G;  1NE3 A;  5HGT A;  4DR4 Q;  3OHX C;  3R8B A;  3EN2 A;  3ERS X;  3J7A 5;  4NXM L;  4EQN A;  4KJN A;  2F4V L;  4RH6 A;  3VR3 A;  4XXE A;  3P7J A;  5JEA G;  3A5U A;  3ERQ A;  2B63 G;  3BDC A;  4DR7 L;  1MSH A;  1E3P A;  1ET9 A;  4PZ8 A;  5M3M H;  3K7A B;  2RSO A;  2KEE A;  4DV4 Q;  3RMH A;  4A3M G;  4P74 A;  4LAA A;  3KF8 B;  1I6H B;  4LUZ A;  1X3F A;  1WTH A;  1SNM A;  1HNW L;  1STN A;  1O7Z A;  4DKA C;  1KXL A;  1K3B C;  1N36 L;  4JYA Q;  4RGN A;  1Y1V H;  4N9P A;  4LF7 Q;  1XMQ Q;  1XPO A;  1HNZ Q;  1HZB A;  2LKV A;  3GTQ B;  2MFI A;  2B2Y A;  4K2L A;  2L15 A;  4JI6 Q;  3HOU H;  2Z9H A;  2OF1 A;  3W1B A;  4CBV A;  3J7Z C;  5CV4 A;  4JPB W;  3TDQ A;  2ICE C;  4P71 A;  3CQZ H;  3I3C A;  3L0O A;  1XTD A;  4AYB E;  2AWO A;  3M85 A;  3SK4 A;  4X65 Q;  4UP7 A;  4LF9 Q;  4OO1 H;  2A6H C;  2K5W A;  2F0N A;  4FF3 A;  1GHK A;  4DR1 Q;  4J8Q A;  1BVS A;  3ONA B;  5KNB A;  1FJG L;  1HZA A;  2KCM A;  4DV0 Q;  1Y8O B;  1EU3 A;  2YV5 A;  1HA5 A;  1TWF H;  1SJE D;  1ET6 A;  4N8X 1;  3K81 C;  1AEX A;  3M3Y B;  1QIL A;  3OSO A;  3Q24 A;  4MTK A;  1IBM Q;  1WTO A;  1R4P B;  4KHP Q;  1YNJ C;  4GNX A;  5M5W H;  3RZO B;  3FDT A;  4DPG A;  4OHJ A;  2UUC L;  2Y0S G;  2F0T A;  1KTK A;  4DF7 A;  4UP8 A;  4H02 A;  4HR7 B;  2HT1 A;  5C4J B;  4DAM A;  5AJ3 L;  2HHH L;  2IPK D;  1CFM A;  4B3R L;  2JSO A;  3CCM A;  3CD6 A;  5EKL A;  5ELB A;  1NBW A;  3KLS X;  1V9P A;  4F7X A;  3TRE A;  1BCP B;  1TU2 B;  1W6J A;  5J1Z A;  4HIK A;  2PNH A;  3S2H B;  3OMC A;  1EY6 A;  4OX9 Q;  4NP5 A;  4QUF A;  1OO9 B;  3STB C;  4B3S Q;  3GTK B;  2I5M X;  5CGK A;  4WJ3 M;  4BBR G;  1QB5 D;  3OIP A;  3JAM c;  4DUY Q;  5HY6 A;  4DR2 L;  3U9S A;  2OTJ A;  1FNU A;  4IFD G;  2B3G A;  4CHT B;  3HOV G;  4PZ7 A;  1XMO L;  2IX0 A;  1IYV A;  3TS2 A;  5IWA L;  1R9T H;  4JI7 L;  3I4M G;  2A69 D;  1UWV A;  1LTI D;  4JI4 Q;  3MEH A;  1D5X C;  2N8N A;  2JA7 G;  3CCJ A;  2JA8 B;  2DJG C;  3DEP A;  3K5L A;  2E2J H;  1AH9 A;  1DON A;  4A3J B;  1HR0 W;  2AQ1 B;  4OXP A;  1YHA A;  3VYR A;  1VF7 A;  1PTO C;  3E9I A;  2BH8 A;  2HDL A;  3NEL A;  1AZP A;  2Z1C A;  2P5Z X;  1U0L A;  1TKW B;  4B08 A;  1UE7 A;  4A3B B;  1TWG H;  2BDN A;  2JEA I;  1PTO B;  1H9K A;  1R4Q B;  2K33 A;  4A3G G;  5C4X B;  1YNN D;  1EOV A;  1PFB A;  3J81 c;  1O7I A;  1STH A;  1SYB A;  1VCI A;  4KY6 A;  1B9M A;  3RLN A;  3HOX G;  1Q90 A;  4A3I H;  2KBN A;  3IRB A;  1GOZ A;  3H0G H;  5TSS A;  3HKS A;  4LMQ D;  3PV0 A;  5EKI A;  1JOR A;  3KF6 A;  3QO2 A;  4A3D G;  4OWW B;  2E2H H;  2F0H A;  3PUX A;  5DEH A;  3U58 A;  2JA5 B;  2HQE A;  4FNF A;  2B29 A;  3I55 A;  2FXQ A;  2A8V A;  1WCM B;  5ELO A;  5I4D A;  4IZ8 A;  3C2P A;  3A56 A;  1D2B A;  3BVZ A;  3I91 A;  2EYP A;  4CDE C;  2KA7 A;  1LYL A;  1LTT D;  2F0K A;  3WOF A;  1A3T A;  5IT9 E;  2ZT9 C;  2K04 A;  1CZW A;  5BN4 A;  4X62 L;  1A2T A;  3MXP A;  5DNF A;  1VQ9 A;  3NTK A;  3BU2 A;  1SDF A;  3FHW A;  1YI2 A;  1X54 A;  1YVC A;  2X69 A;  1CT1 D;  4DV3 L;  1GVP A;  1CI3 M;  3KLW A;  2VQF L;  5FOB B;  4IPD A;  1EOT A;  3VR5 A;  3ZYY X;  1C4Q A;  3I2Z A;  2VS1 A;  2NVX H;  2QF7 A;  5C0X H;  3FKI B;  3QG1 A;  2NZO A;  2N88 A;  4RMF A;  4DK3 C;  2B2V C;  4DV5 L;  1Z9F A;  3G6J B;  5DM7 3;  1I4X A;  4C3I H;  5IE8 A;  4KY5 A;  4A3L G;  4KTA A;  1A2U A;  4DV6 Q;  2WV6 D;  1P16 A;  3S16 B;  3I72 A;  1N34 Q;  4OGQ C;  2E74 C;  3S24 A;  4RHR A;  1V1P B;  1MI2 A;  3GQB A;  1EIG A;  2NVT H;  4RFB A;  5CV6 A;  3G4S A;  4YCV A;  4K8J A;  2B39 A;  1PH7 A;  1ICW A;  2R93 B;  1WOC A;  2RA4 A;  5L37 A;  3HEJ A;  2IX3 A;  1XPU A;  4K6D A;  3J7A V;  1L0W A;  3TP6 A;  2WII B;  3OYY A;  2XVS A;  3G71 A;  2EOT A;  4O1N A;  4DR4 L;  2R92 B;  1F9Q A;  1LT6 D;  2B2W C;  4LUO A;  4TSS A;  3S2D B;  1HH2 P;  1TWH H;  1K8M A;  2XIW A;  3BJU A;  4XYQ A;  4K6L A;  3SK8 A;  2HCI A;  4P72 A;  5GQO A;  4A3B G;  1XWE A;  4A3C G;  1C7Y A;  2VZA A;  3C3L A;  2JK8 A;  5C4X G;  2YYZ A;  5EAY A;  5I2X A;  2A69 C;  4DV4 L;  4DA2 A;  2PI2 A;  4BBR H;  4JI1 Q;  1GHJ A;  4L5Q A;  1F9S A;  4K2K A;  1Y1V B;  1VF5 C;  2PMZ E;  1VQM A;  3GTM B;  2PW5 A;  2F3W A;  1QNK A;  4JYA L;  4FP5 D;  2R7D A;  4HID A;  4Z9C B;  4LF7 L;  1XMQ L;  1RHP A;  1HNZ L;  3I90 A;  4N9T A;  1IL8 A;  3VR2 A;  3HOU B;  2JA5 G;  4IFD I;  4JOI C;  3BS1 A;  2K7V A;  2X6G A;  3I4M H;  1SE4 A;  3K80 C;  4JI6 L;  3RZD H;  2WB1 G;  2RDG A;  5T1G A;  3CQZ B;  3K59 A;  5C3W A;  1TXY A;  4YWL A;  2B2U A;  2JA7 H;  2PO4 A;  3AFQ A;  3G6E A;  5IT9 L;  2XRS D;  4UPA A;  4JBM A;  4ZK9 B;  1XNR L;  4A3E G;  1X3P A;  3OW2 A;  4G7O C;  1SAP A;  4X65 L;  2OQ0 A;  3KDF A;  4CKC A;  1P8L A;  4LF9 L;  2FFK B;  1II3 A;  1L1O A;  5IGB A;  1Y1W H;  1VQL A;  3C46 A;  4WRD A;  3T16 A;  1GO3 E;  5C44 G;  4DR1 L;  5M5X B;  4A3G H;  1F2Y A;  2RDH A;  2CW0 D;  4DV0 L;  2LXJ A;  2MGS A;  1DOL A;  1E1T A;  3NWS A;  2QDL A;  4KLK A;  4GOP A;  3HOX H;  1QZH A;  2KED A;  3J7A F;  1Y14 B;  2RF4 A;  2VUM B;  1KAB A;  1MD2 D;  2PCF B;  4AH6 A;  1IBM L;  5GAD C;  4KHP L;  1PH1 A;  1B3A A;  1XX8 A;  3PCO B;  1EWH A;  4AYB B;  1PRT D;  3QB3 A;  1ZKO A;  2E75 C;  1HHV A;  3D8G A;  2ZJQ A;  1NMG A;  5JEA J;  1RKN A;  5IGF A;  2MQH A;  1AW7 A;  3U4V A;  2R93 G;  3C1E A;  4L5R C;  3BYY B;  2YTY A;  1KD1 C;  1LLR D;  4RKB A;  4JI0 Q;  5JOB A;  1AE2 A;  4DR5 Q;  1G2S A;  5CV9 A;  1U4L A;  4BY7 B;  3GV3 A;  4I65 A;  4OX9 L;  4U68 A;  4IUV A;  1GM5 A;  4B3S L;  3DXJ C;  1EWC A;  5D14 A;  4DUY L;  5FLX E;  2A74 C;  3NHH A;  1UUP A;  1XNQ Q;  4PNY A;  1R9T B;  1Q46 A;  2NVY H;  2N49 A;  1DOM A;  2CFM A;  5EBC A;  2F0D A;  2O2L D;  4APV A;  2B2T C;  3HS0 C;  3BDL A;  4C2M B;  5A2Q E;  1EY0 A;  1AZQ A;  1JB3 A;  2PZT A;  4C1N K;  4HAE A;  4JI4 L;  3T1H Q;  4H13 C;  1SYG A;  2EYJ A;  2E2J B;  5J3B A;  2K5Q A;  2UXD Q;  1OXU A;  3DWA A;  4LF4 Q;  1CSQ A;  5CBE E;  3EBE A;  1S5E D;  1U4M A;  4LK1 C;  2EJM A;  2K01 A;  2SNM A;  4HCS A;  4QF4 A;  4X6A H;  1AN8 A;  1PH5 A;  2ZJP A;  2KEN A;  4LF8 Q;  4R8N A;  2DY7 A;  3N52 A;  4NB3 A;  4A3I B;  1IBL Q;  3A8I E;  4DV1 Q;  2K5N A;  2QGQ A;  5LL6 S;  2E5L Q;  4BA2 I;  3MZ5 A;  1E0B A;  1EFI D;  2E2H B;  3Q0A A;  5EBD A;  5FLM G;  1HZC A;  2NVQ H;  4R9W A;  3H91 A;  2A6H D;  1NUC A;  1KAA A;  3NBH B;  4DNT B;  3TS0 A;  3T1Y Q;  3BZC A;  2LSS A;  1LT3 D;  4OWX B;  5IT9 c;  3HOZ G;  4A3C H;  4ALP A;  3CP0 A;  2PQA B;  3SVM A;  1MJE A;  1DXM A;  4CJ1 B;  4DAY B;  4JBJ A;  2D2C C;  4IPH A;  5IP7 G;  1TVX A;  3I7F A;  2WAQ E;  5D3D A;  1KQS A;  5IP9 G;  2CQO A;  1N32 Q;  1BCP F;  1M4V A;  4KD4 A;  3PUY A;  5KYI A;  5LMU Q;  1BCP D;  4IFD J;  2PI2 E;  1A15 A;  2VB3 X;  3ERO A;  4A4I A;  5I6W A;  1TII D;  4GKK Q;  5C3E G;  1SBB B;  1WD1 A;  4F8M A;  1RD9 D;  2BA0 A;  1LTG D;  4X66 Q;  1JOQ A;  1I94 Q;  4CDF C;  2SDF A;  4NXN Q;  1EY8 A;  4C3I B;  3VA7 A;  1EZ6 A;  5E3F A;  3GTJ B;  2LS0 1;  1WTV A;  2G5D A;  3BYT B;  4DV6 L;  2ID0 A;  5FLX L;  5FO7 B;  3OTO Q;  2NVT B;  1N34 L;  5C44 H;  1EWI A;  2L12 A;  4FXG C;  3HRZ C;  3T56 B;  4JBW A;  2RQX A;  3A5Z B;  1XYI A;  1SMY D;  3E3X A;  4BY1 H;  1W6K A;  3DLL A;  2F0U A;  4J15 A;  1HA6 A;  5FO8 B;  2M2L A;  2V1C C;  2ATW A;  3QIA A;  3I4N G;  2Z6K A;  1T5X D;  4LFA Q;  3AU7 A;  1PLF A;  1D7Q A;  1PV4 A;  4R4Q A;  2G9D A;  1PTO D;  1Q82 C;  1VQB A;  3O13 A;  3OWF A;  2IWH A;  2QCP X;  3KLR A;  2AUJ D;  1X3G A;  1E22 A;  1PDQ A;  1X9N A;  3GTP H;  2NZ1 D;  1H9M A;  1KHI A;  4JC0 A;  5CV5 A;  1GJX A;  3AEV A;  3UDG A;  2Q8I B;  3MWY W;  2PQE A;  1I50 B;  1LTS D;  5IOD A;  3M4O B;  3EVQ A;  5DLQ E;  2TMP A;  4LF5 Q;  1KNE A;  1I4H A;  2OEO A;  2KEC A;  1Z7T A;  4LUV A;  1JQY D;  2JE6 I;  4DK0 A;  1FNW A;  1K0S A;  1X65 A;  1VQJ A;  2D5D A;  1B8A A;  4JI1 L;  3VYT A;  5JJL A;  1I6V C;  3QR8 A;  4X64 Q;  2HIV A;  1VQI A;  2DJF C;  1JJG A;  2F0V A;  2E8G A;  2R3Z A;  1SNQ A;  2ZTC A;  4O42 A;  4EQP A;  3J81 j;  2BE5 C;  4OON A;  3H3V C;  1UE1 A;  3NXW A;  1K0R A;  3RZD B;  2IY5 B;  1CKM A;  1FNV A;  3HOY H;  5IYB H;  1JJ2 A;  1I4R A;  2HUG A;  4GNX C;  1VQD A;  2EJG C;  3W1G A;  1HUN A;  3S17 B;  1JWS D;  2LMC B;  4R4I A;  2C35 B;  3E0J A;  4V0B A;  3C1F A;  4QUC A;  1UAP A;  4FXK C;  4WFN 3;  4DUZ Q;  2WKD A;  4UDU C;  4GNX B;  5E4X A;  5ELD A;  1PHJ A;  1C0A A;  1CSP A;  4A3K G;  1Y1W B;  4IUU A;  3SK6 A;  1XTC D;  1F2L A;  4IJH A;  1VMP A;  3PUW A;  1NMF A;  2PMZ B;  1B1Z A;  3UE1 A;  1PYW D;  3CCS A;  4MIU A;  2Z4I A;  5M3F B;  1K8A C;  4RHS A;  2WFW A;  4IQZ A;  1PH4 A;  2K1B A;  2ZTE A;  1RDP D;  2K28 A;  1F9R A;  4H0L C;  4G57 A;  1QJO A;  5FLM H;  1S5C D;  5CC4 A;  1LT4 D;  3Q22 A;  3K7U C;  1PA6 A;  1MBY A;  1SE3 A;  5D65 A;  3D0F A;  4KK7 A;  4ZUI A;  2R7Z H;  3LWE A;  4XYO A;  4PG3 A;  2A68 D;  3HOZ H;  2KOL A;  4OEM B;  1VDZ A;  1BQQ T;  2D0P A;  1BCP C;  2JA6 G;  2F1M A;  4DV2 L;  2EYF A;  3GTL H;  4HIM A;  4HIO A;  4P75 A;  1MJC A;  4LJZ C;  1VQF A;  1G6Z A;  4C3J H;  3PUV A;  5COR A;  3IL8 A;  5IP7 H;  2ES2 A;  3ICE A;  3SE0 A;  4ZQ3 A;  4JI0 L;  3S1Q B;  1EY5 A;  1BBU A;  1SLJ A;  4DR5 L;  1ASY A;  5IP9 H;  3V2T A;  4YHH Q;  2K50 A;  4A93 B;  2NWG A;  4V19 0;  4FXD A;  2M00 A;  2V4D A;  3K5N A;  1SSO A;  2RHS B;  3S15 B;  3ULP A;  2CQA A;  1ROD A;  3SHL A;  2PZW A;  5C3E H;  3HKZ E;  1VQN A;  1RL2 A;  1W3S A;  2NTT A;  1YHQ A;  1XNQ L;  2ZM6 Q;  4YWK A;  3CAM A;  2B8G A;  1N33 Q;  4A3F H;  3EIV A;  2F0P A;  3GTG H;  1SMY C;  1VQH A;  2NZH A;  5IIF A;  1EIF A;  3T1H L;  1PH9 A;  2EYL A;  1L0Y B;  4AIM A;  4CJ2 C;  4G4K A;  4BBS H;  2K75 A;  3EJI A;  3NBI A;  1H9S A;  5GAE C;  4LF4 L;  2YU9 B;  3L9A X;  3EFX D;  3K5O A;  4HCE A;  3V05 A;  4B3T Q;  3MA2 B;  5IYD H;  2PW7 A;  2E2I B;  4QGU A;  1VS0 A;  2O5I C;  1MSG A;  3WWV A;  5C4H A;  3W2D A;  1GD7 A;  1C8C A;  5JJI A;  3I4N H;  3S1R B;  1LO5 D;  1E7Z A;  2ZXO A;  4LF8 L;  2IT1 A;  3ULJ A;  1U4R A;  3UI2 A;  1RF2 D;  4DV1 L;  3OWE B;  1BBW A;  1X55 A;  2E5L L;  4XQJ A;  1SNP A;  1IYU A;  4RKL A;  1K83 H;  1QOH A;  2XRQ D;  3S14 H;  3D3R A;  4LF6 Q;  5IGG A;  4KN4 C;  3T1Y L;  5JEA H;  2B63 H;  1SXT A;  1KLU D;  3H09 A;  3W3A A;  1IBK Q;  1OXV A;  4K14 A;  4GLV B;  3S1M H;  1BOS A;  4KKU A;  4H7B A;  4C3H B;  3CCL A;  4A3M H;  1YJ9 A;  1Z6H A;  3PO2 B;  1FL0 A;  4UY8 C;  1J8I A;  1HQR D;  2ALY B;  1HFG A;  1A62 A;  1HPC A;  4ODG A;  3D4D A;  4BA1 I;  5CR3 A;  4DNI A;  4EGV A;  1N32 L;  5IGD A;  2A19 A;  1HUM A;  2QEX A;  4TQU S;  5EPK A;  5LMU L;  3CRK C;  5CBA E;  2Y0S E;  4JI2 Q;  4GKK L;  2NBF A;  1D1I A;  3PIO A;  4X66 L;  3SDZ A;  3L2P A;  2GA4 B;  3K57 A;  1I94 L;  4NXN L;  3LWU A;  1DM0 B;  1PH6 A;  1Y69 U;  2F0M A;  5E7N A;  1QZG A;  4A93 G;  1BDO A;  1TS3 A;  4HN7 A;  2Z0S A;  4TKO B;  4ABN A;  4E6I A;  3OTO L;  4KJO A;  1E2Z A;  2A68 C;  4DR3 Q;  3CC2 A;  3GTO H;  2GVA A;  3M9B A;  2WAQ B;  1DYQ A;  2I5H A;  1STY A;  3CC7 A;  3PO3 B;  2K5H A;  1WTX A;  1ILP A;  1RIP A;  3IAY A;  2ASB A;  2A5H A;  4A76 A;  1QNU A;  2K52 A;  4G7H C;  4YWM A;  1FVI A;  1LUZ A;  4HSP A;  4PV1 C;  2VL6 A;  4LFA L;  2KVM A;  2WIN B;  3HOW B;  4QCL A;  1WYD A;  1WD0 A;  4WJW A;  1U9R A;  4CDC C;  2JA8 G;  4L8J A;  1JWU D;  2CHB D;  4A3J G;  3LNN A;  2O5J C;  1IZ6 A;  4A75 A;  3CMA A;  2JA6 H;  3FPP A;  5I6Y A;  2PNR C;  2DY8 A;  1S72 A;  1H9J A;  4J1M A;  5C5L A;  4K8I A;  1E2V A;  5M3M B;  4LF5 L;  2LXK A;  4HJ7 A;  1Q12 A;  2EY2 A;  4ZRZ A;  4LFB Q;  3MXU A;  4O2D A;  2F0G A;  4X3K A;  3RLO A;  4OWT B;  4HJ5 A;  4QY7 A;  1ML0 D;  2VXW A;  3KDF B;  2HDM A;  4X64 L;  5D3I B;  1L1O B;  4IFD H;  3A74 A;  1WJJ A;  4DAP A;  2NB0 A;  3HOV H;  2B2V A;  5LMN Q;  3NTH A;  3HOY B;  5M9O A;  1SNC A;  1WCM G;  1JR0 D;  1SYD A;  4QB4 A;  5J22 A;  4IOC A;  3MXN A;  1HNW Q;  2FJ2 A;  1I6H H;  4IUT A;  4C56 C;  3E6Z X;  2WP8 J;  4DUZ L;  3GP7 A;  4HJA A;  4KV6 A;  4ME3 A;  1HNX Q;  1J5E Q;  1Z47 A;  1MHW C;  3VYU A;  4OIK A;  4RA8 A;  3NTI A;  1KRT A;  3GTQ H;  1HRJ A;  2GN5 A;  5A35 A;  3FPU B;  2DN8 A;  5LHY 1;  3BDO A;  4DFA A;  3TRZ A;  2FHT A;  1M1K C;  3ER0 A;  1X6O A;  2SOB A;  1JIC A;  5F2D A;  4KKT A;  1TWF B;  4POF A;  2F03 A;  2H5X A;  2MPM A;  3SK5 A;  2GVB A;  4DV7 Q;  1JT8 A;  1B70 B;  3FKI G;  1OXT A;  3B6Y A;  3H3V I;  3SR1 A;  2Z4H A;  3HZX A;  1EQR A;  4JVZ A;  2NN6 G;  4A3D H;  1D6E C;  5M5W B;  2R7Z B;  2D62 A;  2UXC Q;  1W2B A;  2BA1 A;  3DHQ A;  3M4P A;  3F2D A;  5JPN C;  2PZU A;  1YBY A;  3H15 A;  1HTL D;  1EY9 A;  4CGY B;  1JE4 A;  1NR2 A;  4IUN A;  2IW3 A;  5GAH C;  3MC0 B;  3T51 B;  5K36 G;  4GLA C;  4C3J B;  2EY6 A;  2F0J A;  4L5T A;  2UUA Q;  4B3M Q;  2R7F A;  4AQY Q;  3M3Y H;  1VQ8 A;  1B4O A;  2DNE A;  1VQ7 A;  3RR5 A;  1FGB D;  5HGQ A;  1S5B D;  1NCV A;  5FK9 C;  2F0I A;  1LAB A;  2H4O A;  4ZKC B;  4YHH L;  3RZO H;  1VQG A;  1TS5 A;  3OMG A;  4X3T A;  4DXF A;  3MAQ A;  3PUZ A;  1NSN S;  1ZEQ X;  4CKE A;  5C4J H;  1IW7 C;  4B3R Q;  2X6L A;  1GUN A;  2RVL A;  1STE A;  1K8O A;  4QJF A;  2XSC A;  2R92 G;  1CM9 A;  1VQ4 A;  2A73 B;  2EYO A;  2ZM6 L;  1TY0 A;  1N33 L;  3GTG B;  1HXY D;  1Q81 C;  4RG1 A;  4ZCK A;  1J6Q A;  5M3M G;  3Q23 A;  2J7Z A;  2EXZ A;  1SMX A;  4FF1 A;  4NPS A;  4FF4 A;  4I7Z C;  3MFG A;  4JI8 Q;  3PSI A;  4JV5 Q;  3S2H H;  1TS4 A;  4JI3 Q;  1G91 A;  2MP1 A;  4L6T B;  2NTS A;  4A3L H;  4PMB A;  1EU4 A;  3J80 i;  1CQV A;  4QMG A;  1CK1 A;  3S1N H;  1STA A;  1A3V A;  4CKB A;  4RWS C;  1Y1V G;  4QL5 A;  3CXC A;  1HTP A;  2BE5 D;  1H95 A;  4IUP A;  1HZ9 A;  1QCB D;  4B3T L;  2LY7 A;  2Q8R E;  1ILQ A;  1TWG B;  2XGT A;  3HOU G;  3MEF A;  1DCZ A;  1F2Z A;  1O7L A;  1T5E A;  3J80 E;  2QA4 A;  2JJQ A;  4BXX G;  4RGO S;  1HR0 Q;  2WB1 E;  3KYH C;  3H0G B;  2JA8 H;  1YHB A;  1O7Y A;  1ZXT A;  4DGZ A;  1WTP A;  2H1E A;  3CHB D;  4LF6 L;  2M9V A;  2B63 B;  1V1O A;  3EA6 A;  1X56 A;  3MFY A;  4IPC A;  1ENA A;  3J81 i;  3S1M B;  4A3B H;  5JJZ A;  1PTO H;  1IBK L;  3PF4 A;  5C4X H;  1EYA A;  1JC7 A;  4EQO A;  3I56 A;  4IAL A;  1X32 A;  2B8F A;  2I0Q A;  3BZK A;  4IUR A;  3TZD A;  3F2C A;  1IL2 A;  1ZYR D;  4HMJ A;  3ND8 A;  5G3L F;  1A63 A;  1H9R A;  1PFN A;  3TBI B;  2MO0 A;  3A54 A;  3ZJY C;  2AHO B;  2L0C A;  2MNA A;  4XT1 B;  4XTC S;  3FEW X;  1WTQ A;  2VUM G;  1EQQ A;  2F0O A;  1KDC A;  3J81 E;  1AE3 A;  3RN5 A;  3CW2 C;  1UEB A;  3G7L A;  4RAU C;  3TP5 A;  1VQC A;  2JA5 H;  1QVF A;  1SRU A;  3E0E A;  3MHB A;  1JB7 A;  2BDO A;  4AYB G;  3KUP A;  3A7A B;  2SEB D;  1STB A;  2Z6K C;  1WCM H;  4M1U B;  2K32 A;  4DXG A;  4RGT A;  2NVX B;  2F0F A;  3CPW A;  4JI2 L;  3I8Z A;  2J4X A;  3CU7 A;  3K0Y A;  1IXR A;  3PIO 3;  1JE5 A;  1FD7 D;  2VQE Q;  3GV6 A;  1SYE A;  1PH2 A;  2L1B A;  2F4I A;  4A3E H;  2XNA C;  2R6G A;  2YTX A;  2EYH A;  2CKZ B;  1EQT A;  2FMM A;  4BY7 G;  3NQT A;  1N8R C;  4JK1 C;  3CKI B;  4XQN A;  4DR3 L;  3FVQ A;  1TWC H;  1YZ6 A;  3KBG A;  1SNO A;  5IYC G;  1EYD A;  1RCV D;  1EQV A;  1QUQ A;  3OPO A;  2HCC A;  3FKI H;  1KL9 A;  3CCE A;  2KUM A;  1D1K A;  5EQ0 A;  3AB9 A;  3RD4 A;  4ZAI A;  4JI5 Q;  4HJ8 A;  2Y0S B;  2B2Y C;  1PZI D;  2NN6 I;  4FVM A;  4BWG B;  4HMI A;  1FR3 A;  5JJK A;  1CHQ D;  3QOL A;  1I4Q A;  1Y8N B;  4P73 A;  4R4C A;  1G2T A;  1YIJ A;  1S5F D;  2L11 A;  4YY3 Q;  2CWA A;  3CCR A;  1TWH B;  4MN3 A;  3PF5 A;  1D5Z C;  4ME5 A;  2FIN B;  1CKN A;  1LTB D;  2R93 H;  4EVO A;  4M8A A;  3J80 L;  5JVG 3;  4HED A;  1EEF D;  1KC8 C;  1PZJ D;  4PMW A;  1PYB A;  1CHP D;  1DJR D;  4LFB L;  4RGM A;  4BBR B;  4A3I G;  1LTL A;  1OXS C;  3PQI A;  4CJ0 B;  4S3S A;  4QIW E;  1EIY B;  1B7Y B;  3HOV B;  4DR6 Q;  1YJW A;  2R92 H;  1A0I A;  5LMN L;  2RKS A;  1JMC A;  3S2D H;  3PIP A;  1G29 1;  1M8A A;  5LMN W;  4LFC Q;  3I4M B;  1HFN A;  1Q8K A;  4IUQ A;  1QWY A;  1XXG A;  2Q2H A;  1HCZ A;  1NNX A;  2Z8L A;  3L3O C;  3MXG A;  1CA5 A;  2JA7 B;  4TRD A;  1VQ5 A;  3DM1 A;  1RJT A;  1M90 C;  5COY A;  5KNC A;  1E24 A;  3OW7 A;  5CV7 A;  3J81 L;  2UU9 Q;  1HNX L;  3GTM H;  1ESR A;  1J5E L;  1EL0 A;  2KHI A;  5H1S E;  5DM6 3;  2D0O A;  4B9W A;  3M7G A;  1S5D D;  3QJY A;  4RCO A;  4G7Z C;  3DMU A;  3K58 A;  2EVB A;  3PMF A;  3TZU A;  4A3G B;  4FO2 A;  1PYS B;  2KCC A;  4BXX H;  2RCN A;  1I5F A;  4GN4 B;  4LWC A;  2EE1 A;  5C0X G;  3HOX B;  3BZD B;  2KCT A;  1B9N A;  1XNR Q;  4DV7 L;  1ZYR C;  3KF8 A;  4IJL A;  4LW1 A;  4A3D B;  2ICI A;  4C3I G;  4X3S A;  4K5X A;  1GUS A;  2UXC L;  1STG A;  4GKJ Q;  2L4N A;  2DNC A;  1YIT A;  2EZV A;  2VY3 A;  2AWN A;  2XTI A;  4OO1 I;  1D8L A;  1VMC A;  1O78 A;  2KQ3 A;  5M5X H;  2EY5 A;  1CUK A;  3BG3 A;  1PXU A;  1Q1B A;  2K03 A;  3NEM A;  1VQP A;  2HD3 A;  5KYL A;  1TR5 A;  1MKH A;  1X3Q A;  3RUZ A;  5DAU A;  1UE5 A;  1NAP A;  2UUA L;  4B3M L;  4KN7 C;  5T1I A;  1L0X B;  2OWO A;  5FLX c;  1SYF A;  3X3N A;  4AQY L;  4HTH A;  2VUM H;  2EXD A;  1TT2 A;  2EQS A;  4UP9 A;  1H9S B;  3J7Y W;  2EIF A;  4IPG A;  3CCU A;  1DD2 A;  3I73 A;  4LNQ A;  1Q3L A;  3QWN A;  3GD7 A;  3A7L A;  1GUO A;  5E1F A;  1XJV A;  1LT5 D;  2NVY B;  3DWQ A;  3FP9 A;  2K5D A;  3VR6 A;  4RCN A;  2KHS A;  4HJ9 A;  2RBM A;  3VDY A;  1I3Q H;  4XIG S;  1K73 C;  3X3M A;  2ZJR A;  3NSW A;  5BN3 A;  2I07 B;  4JI8 L;  4R4O A;  3GO5 A;  1AFP A;  4JV5 L;  3DM3 A;  1IKM A;  4JI3 L;  4BY7 H;  4IO9 A;  3CF5 A;  3S1N B;  2BOS A;  2IJ0 A;  4H44 C;  3KJP A;  2K5V A;  3KF6 B;  3NPP A;  2ZXP A;  2UXD L;  4XT3 B;  3J80 c;  2UUB Q;  1V43 A;  1LTA D;  5GRO A;  3NQI A;  3F8T A;  5IYC H;  2SNS A;  3K0X A;  4R1J A;  3NUC A;  1VQO A;  1EIH A;  2CCZ A;  4I7A A;  1TS2 A;  4C2M H;  3KBX A;  4DK6 C;  2EPB A;  3TSS A;  4YCW A;  4OL7 A;  2OTL A;  3R3O A;  2MO1 A;  5CV8 A;  1Q1E A;  2JXM B;  1HR0 L;  1Q8I A;  2JP1 A;  1S4Z A;  4C1N I;  1IBL L;  3BVM A;  1U4P A;  3A0J A;  2N78 A;  2RHQ B;  2NVQ B;  1RTN A;  5AFW A;  1WVL A;  4TVA B;  3IFT A;  4JW0 A;  1UE6 A;  4XQQ A;  5M5Y H;  3U50 C;  1Y1W G;  2RDF A;  1EY7 A;  5BR8 Q;  4GLX A;  2L5T A;  5JPM C;  3RN2 A;  3KLS A;  4K0K Q;  1GKH A;  2I46 A;  1VQA A;  3SXH A;  4GS3 A;  2Z6B A;  3SGI A;  2MUY A;  5M3F G;  2AQ2 B;  2HQL A;  3CCV A;  1ICF B;  3VR4 A;  1HQM C;  2JEB I;  1PFM A;  4J6H A;  2QDB A;  3EQL C;  4FYD A;  4F88 A;  1LAC A;  1S3O A;  3CRL C;  1EFW A;  2AMC B;  4NDX A;  3UDF A;  1LTR D;  4ILW A;  3I70 A;  4FF2 A;  1KNA A;  2CH4 A;  3DUZ A;  3T53 B;  1Y8P B;  1SR3 A;  2WB1 B;  4R8I A;  5C6A A;  1DZ1 A;  2D9U A;  1EEI D;  3H94 A;  5GAG C;  1EYC A;  1IHZ A;  3NE5 B;  1K28 A;  1SFO H;  1KAW A;  1BBX C;  1CZG A;  4CDD C;  1KDA A;  2C9O A;  4A3E B;  2YTV A;  5K5P A;  2VQE L;  1J9O A;  3URY A;  3PGZ A;  3KK7 A;  3BVG A;  1K9M C;  2O4X A;  1TWA H;  4A3K H;  1SJH D;  4JG2 A;  1BXT A;  3T4A C;  4L63 B;  1VQ6 A;  2F0E A;  1TQO A;  5C44 B;  1IW7 D;  2PYK A;  1TWC B;  1Q86 C;  2F0W A;  4Y7N H;  2IHE A;  4NKL A;  2E2D C;  4BY1 B;  4ID6 A;  1BNZ A;  3VA5 A;  2KCN A;  1QVC A;  1TY2 A;  2UXB Q;  1KIX A;  4ZLT F;  5C0X I;  1D5M C;  2OXP A;  3P20 A;  5NUC A;  3F2B A;  2F0L A;  1HJP A;  4JI5 L;  3GTJ H;  1SE8 A;  4UHV A;  3E9H A;  3A8K E;  2Q2T A;  4MHE A;  1FYC A;  4GZY C;  1B53 A;  3G48 A;  5C4Z A;  4DK1 A;  1CA6 A;  2B2U C;  3GTP B;  5C3X A;  2R61 A;  3IFD A;  4XDX A;  4YY3 L;  1OTC A;  2K4K A;  4B9X A;  3L7Z C;  3FRP B;  2F0Q A;  1RTO A;  1UEA B;  3TP8 A;  2L55 A;  3NEN A;  3MXN B;  1JWM D;  3OOC A;  2QEJ C;  4FDB A;  1BUV T;  1ESF A;  1LV9 A;  1L1O C;  3UE0 A;  1B2T A;  3M4Y A;  3LX0 A;  3FMC A;  4DR6 L;  4NXM Q;  3Q6S A;  4GOP C;  1QE6 A;  1V1P A;  2F4V Q;  4MZ9 A;  2PPB C;  3P1H A;  3F1Z A;  4DR7 Q;  1I50 H;  2FMC A;  3PIP 3;  4LFC L;  3M4O H;  5FJ8 G;  3ITP A;  3K8A A;  2ZTD A;  4GOP B;  1BKB A;  1GUW A;  3K7A H;  4PZ6 A;  2DGY A;  1CQF A;  1F77 A;  4C3H G;  5C5M A;  4HSV A;  2IL8 A;  3PO2 G;  3H6M A;  3CC4 A;  4BS9 A;  1A8V A;  2HIX A;  4GN5 A;  1N36 Q;  5EKK A;  1SEB D;  2AUK A;  2WKC A;  3W5O A;  5E4W C;  2UU9 L;  2ENB A;  1JCK B;  2EDG A;  1OXX K;  5CMD A;  3AYH B;  1L2F A;  3MVV A;  2JA9 A;  1I4G A;  1EYG A;  1EUJ A;  5IGE A;  2OCE A;  2Q8T A;  1ASZ A;  4QIW B;  5BN5 A;  3HFZ B;  1YNN C;  3S17 H;  1CKO A;  3V96 A;  2XWJ B;  4U67 3;  1E2W A;  3D6C A;  4OIJ A;  3H3V H;  2F52 A;  1ENC A;  1GXD C;  3VYS A;  2B2W A;  1MIU A;  3M4Q A;  1UNS A;  3TP7 A;  4DN4 M;  1YEZ A;  2A6E D;  1NY4 A;  3DWP A;  3MTS A;  3GDE A;  3KJO A;  5LL6 X;  2EY1 A;  4F87 A;  2N55 A;  2LFN A;  3HG9 A;  1C48 A;  3HOZ B;  4GKJ L;  3ULL A;  2VNU D;  4WJ4 A;  2RSN A;  2NYZ D;  1SYC A;  1FJG Q;  3ND9 A;  1QG7 A;  3F2U A;  3NK9 A;  4KHV A;  3GTL B;  5HUR A;  1F9P A;  3D4R A;  1Q7Y C;  5M3F H;  4BY1 G;  2WAQ G;  1LM0 A;  4P2C B;  3HP3 A;  3N6R A;  1XPR A;  3PO3 G;  3AFP A;  1PMR A;  3KOJ A;  4JOI A;  4IOA A;  1U5K A;  1PRT F;  4POG A;  3OIQ A;  4JBK A;  2UUC Q;  1KLG D; 
#chains in the Genus database with same CATH homology
 4K5V A;  4KMU C;  1ONL A;  2WAC A;  5IGC A;  5C3E B;  1BF4 A;  4WOR A;  4NW2 A;  4PQX A;  4A3F B;  4KI0 A;  2XWB B;  1I3Q B;  1GUT A;  1BO0 A;  1KDB A;  2XN9 C;  3K5M A;  4ULL A;  5EJW A;  5ELF A;  4ZYS A;  1CTM A;  4ZUJ A;  5CYU A;  4BBS B;  3RLF A;  3S9W A;  1GUG A;  5ELC A;  3TN2 A;  5ELE A;  1IKL A;  1ENF A;  1EZ8 A;  5ISR A;  3JAM E;  1WTW A;  3SEB A;  4NMZ A;  3I4N B;  5EPL A;  4KHZ A;  4Q0F A;  5JVH 3;  5C0X J;  3DEO A;  3HKZ B;  4Q5V A;  5KND A;  2TSS A;  1V8Q A;  1MGS A;  1K83 B;  3S14 B;  4DAV A;  5M5Y B;  2MHV A;  3R2T A;  3T13 A;  2JYO A;  1G8Z D;  4OO1 G;  2EYM A;  5EGT A;  1JOK A;  2KJX A;  4PMC A;  2F0S A;  2QIL A;  5I9P A;  5EPJ A;  1EY4 A;  2C5C A;  5IOC A;  1PZK D;  3IKJ A;  4A3M B;  4IN3 A;  5KIX A;  2NUC A;  2K6A A;  2MJ8 A;  2K05 A;  5G3L D;  3P75 A;  2B2T A;  2IX1 A;  2J0T D;  5KEE A;  3U9O A;  3E5S A;  3QOJ A;  1AP0 A;  4DU9 A;  3NP8 A;  1B44 D;  2G9H D;  1SFO B;  3D4W A;  4KD3 A;  2AQ3 B;  5JAV A;  4X3U A;  1BR9 A;  1JOO A;  3M7N A;  4UAI A;  3HGB A;  3K6O A;  5I2Y A;  4C3J G;  1YNJ D;  1TWA B;  4A3K B;  4K5W A;  2A6E C;  4KKS A;  1SE2 A;  1WTR A;  3R2I A;  3WDN A;  3NBH A;  4Y7N B;  3GTO B;  5J39 A;  2CW0 C;  1I4P A;  4KY7 A;  5KGU A;  2L9H A;  1F2M A;  2ZXR A;  4DAY A;  2E76 C;  2OT2 A;  3D6W A;  3AMU A;  2NN6 H;  1A3U A;  1B50 A;  5I9O A;  3WOE A;  1PRT C;  3TME A;  2JA6 B;  2CVR A;  1A6X A;  2BCO A;  4ZKB B;  5A2Q L;  3A8J E;  3JAM L;  4DNR B;  1SND A;  5K36 H;  1O80 A;  5FKA C;  2F3V A;  1PRT B;  3A55 A;  2VB2 X;  2EJF C;  3D31 A;  1PTO F;  3R93 A;  1DOK A;  4YIJ A;  1NR4 A;  3I4L A;  3NWT A;  5FO9 B;  2QKI C;  5KRU A;  5HGT A;  3OHX C;  3R8B A;  4EQN A;  4KJN A;  4RH6 A;  3VR3 A;  4XXE A;  3P7J A;  5JEA G;  3ERQ A;  3BDC A;  1MSH A;  1ET9 A;  3K7A B;  2RSO A;  2KEE A;  3RMH A;  4LAA A;  1I6H B;  1SNM A;  1STN A;  1O7Z A;  4RGN A;  4N9P A;  2LKV A;  3GTQ B;  2B2Y A;  4K2L A;  2OF1 A;  4CBV A;  5CV4 A;  3TDQ A;  2ICE C;  3I3C A;  2AWO A;  3M85 A;  3SK4 A;  4OO1 H;  2A6H C;  2K5W A;  2F0N A;  4FF3 A;  1GHK A;  4J8Q A;  5KNB A;  3ONA B;  1Y8O B;  1EU3 A;  1HA5 A;  1SJE D;  1ET6 A;  1AEX A;  3M3Y B;  1QIL A;  3OSO A;  3Q24 A;  1WTO A;  1R4P B;  1YNJ C;  3RZO B;  3FDT A;  4OHJ A;  2F0T A;  1KTK A;  4DF7 A;  4HR7 B;  5C4J B;  2IPK D;  1CFM A;  2JSO A;  5EKL A;  5ELB A;  3KLS X;  4F7X A;  1BCP B;  1TU2 B;  1W6J A;  5J1Z A;  3S2H B;  3OMC A;  1EY6 A;  4NP5 A;  4QUF A;  1OO9 B;  3GTK B;  5CGK A;  1QB5 D;  3OIP A;  3U9S A;  1KLG D;  1FNU A;  4IFD G;  4CHT B;  2IX0 A;  1IYV A;  2A69 D;  1LTI D;  3MEH A;  1D5X C;  2JA8 B;  3DEP A;  3K5L A;  1DON A;  4A3J B;  2AQ1 B;  3VYR A;  1VF7 A;  1PTO C;  2HDL A;  1AZP A;  2Z1C A;  1TKW B;  4B08 A;  4A3B B;  2BDN A;  2JEA I;  1PTO B;  1H9K A;  1R4Q B;  2K33 A;  5C4X B;  1YNN D;  1PFB A;  4KY6 A;  1STH A;  1SYB A;  1VCI A;  1B9M A;  1Q90 A;  5TSS A;  1GOZ A;  4LMQ D;  3PV0 A;  5EKI A;  1JOR A;  3QO2 A;  2F0H A;  3PUX A;  5DEH A;  2JA5 B;  2HQE A;  4FNF A;  1WCM B;  5I4D A;  4IZ8 A;  3C2P A;  3A56 A;  1D2B A;  3BVZ A;  3I91 A;  2EYP A;  2KA7 A;  1LTT D;  2F0K A;  3WOF A;  1A3T A;  5IT9 E;  2ZT9 C;  2K04 A;  1CZW A;  5BN4 A;  1A2T A;  3MXP A;  5DNF A;  3NTK A;  1SDF A;  2X69 A;  1CT1 D;  1CI3 M;  5FOB B;  1EOT A;  3VR5 A;  3ZYY X;  1C4Q A;  2QF7 A;  5C0X H;  3FKI B;  3QG1 A;  2N88 A;  2B2V C;  3G6J B;  5DM7 3;  1I4X A;  4KY5 A;  4KTA A;  1A2U A;  2WV6 D;  3S16 B;  3I72 A;  4OGQ C;  2E74 C;  4RHR A;  1V1P B;  1MI2 A;  3GQB A;  1EIG A;  4RFB A;  5CV6 A;  4K8J A;  2B39 A;  1ICW A;  2R93 B;  2RA4 A;  3HEJ A;  2IX3 A;  4K6D A;  3J7A V;  3TP6 A;  2WII B;  2XVS A;  2EOT A;  4O1N A;  2R92 B;  1F9Q A;  1LT6 D;  2B2W C;  4TSS A;  3S2D B;  1K8M A;  2XIW A;  4XYQ A;  4K6L A;  3SK8 A;  2HCI A;  1XWE A;  3C3L A;  2YYZ A;  5I2X A;  2A69 C;  4DA2 A;  1GHJ A;  1F9S A;  4K2K A;  1Y1V B;  1VF5 C;  3GTM B;  2PW5 A;  2F3W A;  1QNK A;  4FP5 D;  4Z9C B;  1RHP A;  3I90 A;  4N9T A;  1IL8 A;  3VR2 A;  3HOU B;  4IFD I;  3BS1 A;  2K7V A;  2X6G A;  1SE4 A;  2RDG A;  5T1G A;  3CQZ B;  3K59 A;  5C3W A;  2B2U A;  2PO4 A;  5IT9 L;  2XRS D;  4ZK9 B;  1X3P A;  4G7O C;  1SAP A;  4CKC A;  2FFK B;  1II3 A;  5IGB A;  3C46 A;  4WRD A;  3T16 A;  5M5X B;  1F2Y A;  2RDH A;  2CW0 D;  2MGS A;  1DOL A;  3NWS A;  2KED A;  3J7A F;  2VUM B;  1KAB A;  1MD2 D;  2PCF B;  1B3A A;  1XX8 A;  1EWH A;  4AYB B;  1PRT D;  3QB3 A;  1ZKO A;  2E75 C;  1HHV A;  3D8G A;  5JEA J;  1RKN A;  5IGF A;  1AW7 A;  3C1E A;  3BYY B;  1LLR D;  4RKB A;  5JOB A;  1G2S A;  5CV9 A;  1U4L A;  4BY7 B;  3GV3 A;  4I65 A;  4U68 A;  4IUV A;  3DXJ C;  1EWC A;  5D14 A;  5FLX E;  2A74 C;  3NHH A;  1UUP A;  4PNY A;  1R9T B;  1DOM A;  5EBC A;  2F0D A;  2O2L D;  2B2T C;  3HS0 C;  3BDL A;  4C2M B;  5A2Q E;  1EY0 A;  1AZQ A;  1JB3 A;  2PZT A;  4C1N K;  4HAE A;  4H13 C;  1SYG A;  2EYJ A;  2E2J B;  2K5Q A;  1OXU A;  3DWA A;  5CBE E;  1S5E D;  1U4M A;  4LK1 C;  2EJM A;  2K01 A;  2SNM A;  4HCS A;  4QF4 A;  1AN8 A;  4R8N A;  2DY7 A;  3N52 A;  4A3I B;  3A8I E;  5LL6 S;  4BA2 I;  3MZ5 A;  1E0B A;  1EFI D;  2E2H B;  3Q0A A;  5EBD A;  4R9W A;  3H91 A;  2A6H D;  1NUC A;  1KAA A;  4DNT B;  1LT3 D;  3SVM A;  1DXM A;  4CJ1 B;  2D2C C;  1TVX A;  5D3D A;  1BCP F;  1M4V A;  4KD4 A;  3PUY A;  5KYI A;  1BCP D;  4IFD J;  1A15 A;  2VB3 X;  3ERO A;  5I6W A;  1TII D;  1SBB B;  1WD1 A;  4F8M A;  1RD9 D;  2BA0 A;  1LTG D;  1JOQ A;  2SDF A;  1EY8 A;  4C3I B;  3VA7 A;  1EZ6 A;  5E3F A;  3GTJ B;  2LS0 1;  1WTV A;  3BYT B;  2ID0 A;  5FLX L;  5FO7 B;  2NVT B;  2L12 A;  4FXG C;  3HRZ C;  3T56 B;  4JBW A;  2RQX A;  1XYI A;  1SMY D;  1W6K A;  2F0U A;  1HA6 A;  5FO8 B;  2M2L A;  3QIA A;  1T5X D;  3AU7 A;  1PLF A;  2G9D A;  1PTO D;  3OWF A;  3O13 A;  2IWH A;  2QCP X;  3KLR A;  2AUJ D;  1PDQ A;  2NZ1 D;  1H9M A;  5CV5 A;  1GJX A;  2Q8I B;  3MWY W;  2PQE A;  1I50 B;  1LTS D;  5IOD A;  3M4O B;  3EVQ A;  2TMP A;  1KNE A;  1I4H A;  2OEO A;  2KEC A;  1Z7T A;  1JQY D;  2JE6 I;  4DK0 A;  1FNW A;  2D5D A;  3VYT A;  1I6V C;  2F0V A;  2R3Z A;  1SNQ A;  4O42 A;  4EQP A;  2BE5 C;  3H3V C;  3NXW A;  3RZD B;  1FNV A;  1I4R A;  2HUG A;  2EJG C;  1HUN A;  3S17 B;  1JWS D;  2LMC B;  3E0J A;  4V0B A;  3C1F A;  4QUC A;  1UAP A;  4FXK C;  4WFN 3;  2WKD A;  4UDU C;  5E4X A;  5ELD A;  1Y1W B;  4IUU A;  3SK6 A;  1XTC D;  1F2L A;  1VMP A;  3PUW A;  2PMZ B;  1B1Z A;  1PYW D;  4MIU A;  2Z4I A;  5M3F B;  4RHS A;  4IQZ A;  2K1B A;  1RDP D;  2K28 A;  1F9R A;  4H0L C;  4G57 A;  1QJO A;  1S5C D;  5CC4 A;  1LT4 D;  3Q22 A;  1MBY A;  1SE3 A;  5D65 A;  4KK7 A;  4ZUI A;  3LWE A;  4XYO A;  2A68 D;  2KOL A;  1VDZ A;  1BQQ T;  1BCP C;  2F1M A;  2EYF A;  4LJZ C;  1G6Z A;  3PUV A;  5COR A;  3IL8 A;  3SE0 A;  4ZQ3 A;  3S1Q B;  1EY5 A;  3V2T A;  4A93 B;  2NWG A;  4V19 0;  4FXD A;  2M00 A;  2V4D A;  3K5N A;  1SSO A;  3S15 B;  2CQA A;  1ROD A;  3SHL A;  2PZW A;  2NTT A;  2B8G A;  2F0P A;  1SMY C;  5IIF A;  2EYL A;  1L0Y B;  4CJ2 C;  4G4K A;  3EJI A;  3NBI A;  1H9S A;  2YU9 B;  3L9A X;  3EFX D;  3K5O A;  4HCE A;  3V05 A;  3MA2 B;  2PW7 A;  2E2I B;  2O5I C;  1MSG A;  5C4H A;  3W2D A;  1C8C A;  3S1R B;  1LO5 D;  2ZXO A;  2IT1 A;  1U4R A;  3UI2 A;  1RF2 D;  3OWE B;  4XQJ A;  1SNP A;  1IYU A;  4RKL A;  1QOH A;  2XRQ D;  3D3R A;  5IGG A;  4KN4 C;  5JEA H;  1SXT A;  1KLU D;  3H09 A;  3W3A A;  1OXV A;  4K14 A;  1BOS A;  4KKU A;  4H7B A;  4C3H B;  1Z6H A;  3PO2 B;  1J8I A;  1HQR D;  1HFG A;  1HPC A;  4ODG A;  3D4D A;  4BA1 I;  5CR3 A;  4EGV A;  5IGD A;  1HUM A;  4TQU S;  5EPK A;  3CRK C;  5CBA E;  2NBF A;  1D1I A;  3SDZ A;  2GA4 B;  3K57 A;  3LWU A;  1DM0 B;  1Y69 U;  2F0M A;  1BDO A;  1TS3 A;  4HN7 A;  4TKO B;  4ABN A;  4E6I A;  4KJO A;  1E2Z A;  2A68 C;  2WAQ B;  1DYQ A;  1STY A;  3PO3 B;  1WTX A;  1ILP A;  3IAY A;  2A5H A;  1QNU A;  4G7H C;  4HSP A;  4PV1 C;  2KVM A;  2WIN B;  3HOW B;  4QCL A;  1WD0 A;  4WJW A;  1U9R A;  4L8J A;  1JWU D;  2CHB D;  3LNN A;  2O5J C;  3FPP A;  5I6Y A;  2PNR C;  2DY8 A;  1H9J A;  4J1M A;  5C5L A;  4K8I A;  1E2V A;  5M3M B;  1Q12 A;  2EY2 A;  4ZRZ A;  3MXU A;  2F0G A;  4X3K A;  1ML0 D;  2VXW A;  2HDM A;  5D3I B;  4IFD H;  4DAP A;  2NB0 A;  2B2V A;  3NTH A;  3HOY B;  5M9O A;  1SNC A;  1JR0 D;  1SYD A;  4QB4 A;  5J22 A;  3MXN A;  2FJ2 A;  4IUT A;  4C56 C;  3E6Z X;  2WP8 J;  3GP7 A;  4KV6 A;  1Z47 A;  3VYU A;  4OIK A;  4RA8 A;  3NTI A;  1HRJ A;  5A35 A;  3FPU B;  2DN8 A;  5LHY 1;  3BDO A;  4DFA A;  2FHT A;  2SOB A;  1JIC A;  5F2D A;  4KKT A;  1TWF B;  2F03 A;  2MPM A;  3SK5 A;  1OXT A;  3SR1 A;  2Z4H A;  3HZX A;  2NN6 G;  1D6E C;  5M5W B;  2R7Z B;  2D62 A;  2BA1 A;  3DHQ A;  5JPN C;  2PZU A;  1HTL D;  1EY9 A;  4CGY B;  1JE4 A;  1NR2 A;  4IUN A;  2IW3 A;  3MC0 B;  3T51 B;  5K36 G;  4C3J B;  2EY6 A;  2F0J A;  1B4O A;  2DNE A;  1FGB D;  1S5B D;  1NCV A;  5FK9 C;  2F0I A;  1LAB A;  2H4O A;  4ZKC B;  3OMG A;  1TS5 A;  4X3T A;  4DXF A;  3MAQ A;  3PUZ A;  1NSN S;  1ZEQ X;  4CKE A;  1IW7 C;  2X6L A;  1GUN A;  2RVL A;  1STE A;  1K8O A;  2XSC A;  1CM9 A;  2A73 B;  2EYO A;  1TY0 A;  3GTG B;  1HXY D;  3Q23 A;  2J7Z A;  2EXZ A;  4FF1 A;  4FF4 A;  4I7Z C;  3MFG A;  1G91 A;  1TS4 A;  2MP1 A;  4L6T B;  2NTS A;  4PMB A;  1EU4 A;  1CQV A;  4QMG A;  1CK1 A;  1STA A;  1A3V A;  4CKB A;  4RWS C;  1HTP A;  2BE5 D;  4IUP A;  1QCB D;  2LY7 A;  2Q8R E;  1ILQ A;  1TWG B;  1DCZ A;  1F2Z A;  1O7L A;  1T5E A;  3J80 E;  4RGO S;  3H0G B;  1O7Y A;  1ZXT A;  4DGZ A;  1WTP A;  2H1E A;  3CHB D;  2B63 B;  2M9V A;  1V1O A;  3EA6 A;  3MFY A;  1ENA A;  3S1M B;  5JJZ A;  1PTO H;  1EYA A;  1JC7 A;  4EQO A;  4IAL A;  1X32 A;  2B8F A;  3TZD A;  4IUR A;  1ZYR D;  4HMJ A;  3ND8 A;  5G3L F;  1H9R A;  1PFN A;  3TBI B;  3A54 A;  2L0C A;  4XT1 B;  4XTC S;  3FEW X;  1WTQ A;  2F0O A;  1KDC A;  3J81 E;  3G7L A;  4RAU C;  3TP5 A;  3MHB A;  2BDO A;  3KUP A;  3A7A B;  2SEB D;  1STB A;  4M1U B;  2K32 A;  4DXG A;  4RGT A;  2NVX B;  2F0F A;  3I8Z A;  2J4X A;  3CU7 A;  3K0Y A;  3PIO 3;  1FD7 D;  3GV6 A;  1SYE A;  2L1B A;  2F4I A;  2XNA C;  2R6G A;  2EYH A;  2FMM A;  1EQT A;  3NQT A;  4JK1 C;  3CKI B;  4XQN A;  3FVQ A;  3KBG A;  1SNO A;  1EYD A;  1RCV D;  1EQV A;  3OPO A;  2HCC A;  2KUM A;  1D1K A;  5EQ0 A;  3AB9 A;  3RD4 A;  4ZAI A;  2Y0S B;  2B2Y C;  1PZI D;  2NN6 I;  4FVM A;  4BWG B;  4HMI A;  1FR3 A;  1CHQ D;  3QOL A;  1I4Q A;  1Y8N B;  1G2T A;  1S5F D;  2L11 A;  1TWH B;  4MN3 A;  1D5Z C;  4ME5 A;  2FIN B;  1LTB D;  4EVO A;  4M8A A;  3J80 L;  5JVG 3;  4HED A;  1EEF D;  1PZJ D;  4PMW A;  1CHP D;  1DJR D;  4RGM A;  4BBR B;  1OXS C;  4CJ0 B;  4S3S A;  3HOV B;  2RKS A;  1G29 1;  1M8A A;  3I4M B;  1HFN A;  4IUQ A;  1QWY A;  1XXG A;  1HCZ A;  2Z8L A;  3L3O C;  3MXG A;  1CA5 A;  2JA7 B;  4TRD A;  3DM1 A;  1RJT A;  5COY A;  5KNC A;  3OW7 A;  5CV7 A;  3J81 L;  1ESR A;  1EL0 A;  5DM6 3;  4B9W A;  3M7G A;  1S5D D;  3QJY A;  4RCO A;  4G7Z C;  3DMU A;  3K58 A;  2EVB A;  3PMF A;  3TZU A;  4A3G B;  4FO2 A;  2KCC A;  2EE1 A;  5C0X G;  3HOX B;  3BZD B;  1B9N A;  1ZYR C;  3KF8 A;  4A3D B;  2ICI A;  4C3I G;  4X3S A;  4K5X A;  1GUS A;  1STG A;  2L4N A;  2DNC A;  2EZV A;  2AWN A;  4OO1 I;  1VMC A;  1O78 A;  2KQ3 A;  2EY5 A;  3BG3 A;  1PXU A;  1Q1B A;  2K03 A;  5KYL A;  1TR5 A;  1X3Q A;  3RUZ A;  5DAU A;  1NAP A;  4KN7 C;  5T1I A;  1L0X B;  1SYF A;  3X3N A;  4HTH A;  1TT2 A;  1H9S B;  3J7Y W;  1DD2 A;  3I73 A;  1Q3L A;  3QWN A;  3GD7 A;  3A7L A;  1GUO A;  5E1F A;  1LT5 D;  2NVY B;  3DWQ A;  2K5D A;  3VR6 A;  4RCN A;  2KHS A;  2RBM A;  4XIG S;  3X3M A;  3NSW A;  5BN3 A;  2I07 B;  1AFP A;  3GO5 A;  1IKM A;  3S1N B;  2BOS A;  2IJ0 A;  4H44 C;  3NPP A;  2ZXP A;  4XT3 B;  1V43 A;  1LTA D;  3NQI A;  2SNS A;  3NUC A;  1EIH A;  1TS2 A;  3KBX A;  2EPB A;  3TSS A;  4OL7 A;  3R3O A;  5CV8 A;  1Q1E A;  2JXM B;  1Q8I A;  2JP1 A;  1S4Z A;  4C1N I;  3BVM A;  1U4P A;  2NVQ B;  1RTN A;  5AFW A;  1WVL A;  3IFT A;  4XQQ A;  2RDF A;  1EY7 A;  2L5T A;  5JPM C;  3KLS A;  2I46 A;  3SXH A;  2MUY A;  2AQ2 B;  3VR4 A;  1HQM C;  2JEB I;  1PFM A;  4J6H A;  2QDB A;  3EQL C;  4FYD A;  4F88 A;  1LAC A;  3CRL C;  4NDX A;  1LTR D;  4ILW A;  3I70 A;  4FF2 A;  1KNA A;  3DUZ A;  3T53 B;  1Y8P B;  2WB1 B;  4R8I A;  5C6A A;  1DZ1 A;  2D9U A;  1EEI D;  3H94 A;  1EYC A;  1IHZ A;  3NE5 B;  1BBX C;  1CZG A;  1KDA A;  2C9O A;  4A3E B;  5K5P A;  1J9O A;  3URY A;  3KK7 A;  3BVG A;  2O4X A;  1SJH D;  1BXT A;  3T4A C;  4L63 B;  2F0E A;  1TQO A;  5C44 B;  1IW7 D;  2PYK A;  1TWC B;  2F0W A;  4NKL A;  2E2D C;  4BY1 B;  4ID6 A;  1BNZ A;  3VA5 A;  2KCN A;  1TY2 A;  4ZLT F;  5C0X I;  1D5M C;  2OXP A;  3P20 A;  5NUC A;  2F0L A;  3A8K E;  4MHE A;  1FYC A;  4GZY C;  1B53 A;  5C4Z A;  4DK1 A;  1CA6 A;  2B2U C;  3GTP B;  5C3X A;  2R61 A;  3IFD A;  4XDX A;  3L7Z C;  3FRP B;  2F0Q A;  1RTO A;  1UEA B;  3TP8 A;  2L55 A;  1JWM D;  3OOC A;  2QEJ C;  1BUV T;  1ESF A;  1LV9 A;  1B2T A;  3M4Y A;  3LX0 A;  3FMC A;  3Q6S A;  1QE6 A;  1V1P A;  2PPB C;  3P1H A;  2FMC A;  3PIP 3;  3ITP A;  1GUW A;  1CQF A;  4C3H G;  1F77 A;  5C5M A;  4HSV A;  2IL8 A;  3H6M A;  4BS9 A;  5EKK A;  1SEB D;  2AUK A;  2WKC A;  5E4W C;  2ENB A;  1JCK B;  2EDG A;  1OXX K;  5CMD A;  3MVV A;  1I4G A;  5IGE A;  2Q8T A;  4QIW B;  5BN5 A;  1YNN C;  3V96 A;  2XWJ B;  4U67 3;  1E2W A;  3D6C A;  4OIJ A;  3VYS A;  1ENC A;  1GXD C;  2B2W A;  1UNS A;  3TP7 A;  4DN4 M;  2A6E D;  3DWP A;  3MTS A;  5LL6 X;  2EY1 A;  4F87 A;  2N55 A;  2LFN A;  3HG9 A;  1C48 A;  3HOZ B;  2VNU D;  2RSN A;  2NYZ D;  1SYC A;  3ND9 A;  1QG7 A;  3F2U A;  3NK9 A;  4KHV A;  3GTL B;  5HUR A;  1F9P A;  3D4R A;  4P2C B;  3HP3 A;  3N6R A;  1PMR A;  1PRT F;  3OIQ A;  4B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...