2B63H

Complete rna polymerase ii-rna inhibitor complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b63H00
1E7ZA 1VQKA 3PUWA 2Q2UA 5HY6A 1K8AC 1W3SA 2RHQB 1HZAA 2UUBQ 4NXNL 3S15H 3M4PA 1LTLA 1VCIA 5IWAL 5M3FG 2JA7H 5AJ3L 3H3VH 3HOUG 4JC0A 4DAMA 3I4NH 1L1OA 4DR2Q 3FHWA 4GOPB 1NE3A 4A3MH 5M3FH 5GADC 1GD7A 3MXNB 3HOUH 2I5HA 4DR4L 4JG2A 1PH2A 1MIUA 3KYHC 5M3MG 3UDGA 3ICEA 3ZJYC 4QQBX 1VQIA 1VQHA 3PCOB 2OWOA 1V43A 2KBNA 1UWVA 2F3IA 5C0XG 1KHIA 1IBLQ 1C0AA 3OW2A 4PMWA 5LMNW 1PH7A 1M1KC 2K5NA 1EYGA 1N33L 3PF4A 4JYAL 4GLAC 4DAYB 1E24A 1JMCA 1TWHH 3UDIA 5GQOA 4DV1Q 4QGUA 3KJOA 2ALYB 4AQYQ 1VQ9A 4JI5Q 2D0PA 3GTOH 5JEAJ 1M90C 3GDEA 2ATWA 2KHIA 3CPWA 3F1ZA 1EFWA 3PUXA 4GKJQ 1HZBA 2PQAA 1VQJA 1GO3E 2OCEA 4OWXB 4HJ9A 3NELA 4UPAA 2YV5A 4LFCL 1UE1A 1P8LA 4JI0L 3S2DH 1A8VA 2VW9A 2BH8A 2F52A 3PIOA 1HJPA 1VQ6A 4JI8L 1BBWA 1S3OA 4QY7A 1YZ6A 4HIDA 2UU9Q 3HOYG 1HZ9A 4P71A 1HNZL 5JJKA 2UUCL 1XJVA 2A8VA 1BKBA 2UXCQ 4WJ4A 2WB1E 5C3EG 1P16A 2CQOA 2WAQE 4OO1G 3NENA 2K52A 1LUZA 4BA1I 3K81C 3G6EA 3HKSA 3BZKA 3CCVA 2N78A 1TWFH 1B70B 3PIPA 1VQ4A 1Y1VG 2JJQA 1V9PA 1XMOL 1PH6A 3TEHB 4DV2L 1U5KA 2B3GA 3W1BA 3CCSA 3F8TA 1L2FA 4DV5Q 1H95A 3KDFA 1J6QA 5IT9c 1Y1WG 1RL2A 3STBC 1YHBA 4B3SQ 4DV6L 1QVGA 4GN5A 3GTPH 3M9BA 4JI3L 1VQ8A 2DGYA 5BR8L 2JEBI 1A62A 3PSIA 4QJFA 2BH2A 4JI4Q 4APVA 1XMQL 4P75A 4GKKL 1UE6A 1SLJA 5IY0A 3K0XA 1WOCA 1N34L 1PA6A 2N8NA 3T1HL 2CWAA 3L7ZC 2MO1A 3KOJA 5IP7G 1VQ7A 4IPHA 1YBYA 2JK8A 4LF9L 3CCQA 2NVTH 2E8GA 4A3IG 1PHJA 2NVYH 1D7QA 3HKZG 5K36G 4LF7Q 2I5MX 4LF4Q 2ZJRA 1AH9A 4B3RQ 3KLWA 4R4OA 4UP7A 1SMXA 2ZM6L 5C4JH 4C2MH 1Q82C 4NXML 1VQDA 2IX1A 4AIMA 3GTGH 4A3LG 2E2IH 2KCTA 3CQZH 1YJWA 3AYHB 4X62L 3UDXA 1K8GA 2A19A 1B7YB 2PMZE 4IJLA 3M4OH 4A3LH 1AE3A 4A3EG 3JAMc 1XTDA 2K14A 1HNXL 1VQAA 2PI2A 4HIMA 1EIYB 4JI6L 2AHOB 2MO0A 4LNQA 3M85A 3PUYA 1SROA 4C3HH 4HJ7A 3OYYA 4JBJA 4POFA 4A3EH 1U0LA 1I5FA 3TS0A 1K9MC 1K83H 2XGTA 1TWAH 3CAMA 2KHJA 4LWCA 5HGQA 2QEXA 4BBRH 2ZJPA 2Q2TA 3GTKH 4DKAC 3OTOL 3JAMi 2EQSA 1G51A 1N32L 1HNWL 4C3IH 3T1YL 2L15A 3DM3A 3WWVA 3S16H 1CKMA 3FKIH 4YWMA 2ID0A 1OXUA 1XNRL 3NBHB 1YEZA 1YITA 1I94Q 4PG3A 4IFDJ 1PYSB 4GOPA 1YI2A 2K5VA 5M5YH 5IP9G 1CKNB 3PV0A 2HHHL 3A74A 4LW1A 4DV4L 4LF6L 4A93G 4DV7L 3CD6A 4A3BH 2ZTCA 5IP9H 3U58A 3H0GG 4IFDI 4WJ3M 3PF5A 1Q46A 2A1AA 1SFOH 4HJAA 2VS1A 2FXQA 3F2DA 2AMCB 4R4QA 5IYDG 3Q8DA 3CCJA 5FLMG 2R6GA 4YWKA 3H0GH 1KRTA 2IHEA 4K0KQ 2UXDL 4DUZL 1CKOA 2ZTEA 1PH8A 1UE7A 5DLQE 5IYDH 3D0FA 2IX0A 2GVAA 1JE5A 4DR3L 4DR1L 2LXKA 4HIOA 1UEBA 5IE8A 2K4KA 5LMNQ 4A3JG 2KCMA 3F2CA 1VQOA 2GN5A 5M5XH 3S1NH 5M3MH 4IO9A 2HIXA 2JQOA 1HR0L 4AH6A 4LFBQ 1K3RA 2K75A 5BR8Q 3BJUA 4KI0A 3I4OA 4A3JH 4DUYL 4L5QA 4B3MQ 3ER0A 1IL2A 1CSQA 1E22A 4DR5L 4JI1Q 4GNXB 1Q12A 3KF6B 2NVQH 3J81c 3UDFA 2RHSB 4X64L 4B3TQ 3RLFA 4DV3Q 1X3EA 3F2BA 4OWWB 3M7NA 4O2DA 4KHPQ 4C3JH 4X66L 2VL6A 2NVXH 2R7ZG 4DR6Q 2NN6I 1Q1BA 2YTYA 3GD7A 4A3GG 2YTXA 3S24A 1BVSA 4LFAL 3GTMH 1EUJA 2E5LL 4DK6C 1S72A 3J81i 1J5EL 2R7ZH 1X54A 4TVAB 4A3FG 2VUMG 5JJIA 3CP0A 1KL9A 4R4TA 3A0JA 3J81j 3S1RH 4LF5L 4JCVE 1FJGQ 2ASBA 3HOWG 1WFQA 3K8AA 1TXYA 4A3DG 4NXMQ 3RLOA 1XNQL 4YCUA 2AKWB 2V1CC 3E9IA 2NZOA 3U50C 4X65L 4A3FH 2YU9H 4GLVB 1VQNA 4DR7L 3S2HH 5GAGC 3HOYH 1K73C 2AWOA 2K5HA 3PO3G 3E9HA 3RZDH 2YYZA 4A3DH 5C4XG 3UE0A 2R7DA 3CCLA 4JV5L 3JC66 4JI2L 1E3PA 4JI7L 4LF8L 1Y14B 5C3EH 4RG1A 4YHHL 3I55A 4DV0L 3PO3H 5C4XH 3EIVA 4YY3L 2VQFL 4O0AA 2GVBA 2Z6KA 2C35B 3RLNA 1Y1VH 1W2BA 4MZ9A 2LSSA 2D62A 5J3BA 4GOPC 1OTCA 1KXLA 1PYBA 2CCZA 2Y0SG 3BZCA 3CF5A 2ES2A 2E2JH 2UUBL 3T1YQ 1IBKQ 3L0OA 3CW2C 2R93G 4KLKA 1Y1WH 1S40A 2B63G 5LMUQ 1IXRA 2YTVA 4DR2L 2NZHA 3S1QH 4OX9Q 4OX9L 1FGUA 1EQRA 1L1OC 1N36L 3S17H 1HH2P 1C9OA 1T9HA 1B8AA 3G48A 2IT1A 1I50H 3ULJA 5H1SE 2B63H 2R93H 3UE1A 5JEAG 1JJ2A 4DV7Q 4NXNQ 1HZCA 5IWAQ 1X55A 5AJ3Q 2PNHA 2K50A 4YWLA 2CKZB 5IP7H 5M5WH 2F4VL 1L0WA 2JA8G 1TWGH 4YCVA 5IYBG 4A3IH 1K0RA 1UE5A 1X6OA 1KC8C 4DR4Q 2N3SA 4L5TA 3G71A 4DUZQ 1X56A 1QZHA 1EWIA 1WI5A 3HOVG 4DV1L 2WFWA 3NEMA 4YCWA 1OXVA 4PZ8A 4JI5L 4DPGA 4AQYL 3GTLH 3U4VA 2Q2HA 1QUQA 2DUDA 2JA6G 1VQLA 4GKJL 1SE8A 1ASZA 1N33Q 4MTNA 1N8RC 3LGJA 1VQMA 4JYAQ 3H3VI 4DUYQ 1HR0W 1EOVA 3U4ZA 1FL0A 2JA6H 1X65A 3M4QA 1QUQB 1CKNA 2UU9L 1KIXA 2HQLA 1PH9A 2UUAL 5E7NA 4QL5A 1IBML 4POGA 4LFCQ 4P72A 3CCEA 4LFAQ 1YVCA 3I2ZA 3CPFA 1PV4A 4AYBG 5C0XJ 1OXTA 2E2HH 4JI0Q 2IY5B 4JI8Q 4IOAA 1YNXA 4H02A 3AFPA 2VQEL 1AE2A 4LF5Q 2RF4A 1HNZQ 2UUCQ 3TS2A 1VS0A 2CFMA 1I6HH 1YIJA 2EXDA 5C0XI 3B6YA 1CSPA 4P73A 3J7ZC 4UP9A 4L5SA 4BBSG 2Z6KC 1KRSA 4A93H 5FJ8G 2WB1G 1QZGA 4JBMA 3L2PA 2WAQG 1EQQA 4JV5Q 2OTJA 4JI2Q 1XMOQ 2VNUD 3AQQA 3PO2G 4A4IA 4YHHQ 2I5LX 4BY7G 4GS3A 4JI4L 1LYLA 4DV2Q 4BBSH 4YY3Q 1N9WA 1SRUA 5FJ8H 4A76A 4JBKA 4OONA 5FLMH 3CCRA 3I4MG 4GNXA 3KFUA 4X6AH 3PO2H 3KF6A 3HOZG 3KF8B 3I4NG 1EIFA 2H5XA 2JA9A 4BY7H 1G291 5ELNA 4GLXA 4DV6Q 1KD1C 3HKZE 1G6PA 5EAYA 4IJHA 4A3MG 4JI3Q 3I4MH 1VQFA 3FP9A 1VQPA 3HOZH 1Q86C 1QVCA 1XMQQ 4LF7L 4GKKQ 3K7UC 4LF4L 4ME3A 4OXPA 5ELOA 4UY8C 1N36Q 3DLLA 1N34Q 5FLXc 3J7A5 3K80C 4A3GH 4B3RL 1A63A 1VQGA 1TWCH 2PI2E 4J15A 3T1HQ 1XPRA 2R92G 1GKHA 1JB7A 4OO1I 2KENA 3W1GA 4LF9Q 3GTJH 1PH5A 2N49A 4XTCS 1GVPA 4NPSA 3S1MH 1L1OB 2I0QA 1XPUA 1XPOA 2R92H 2F4VQ 2MFIA 4TQUS 4BXXG 1DGSA 5GAEC 4JOIA 4IFDG 4NB3A 4OWTB 1Q81C 4LUVA 2ZM6Q 3PGZA 2WP8J 4A3KG 4Y52H 4GN4B 4BA2I 2VUMH 5IYCG 4BXXH 4QIWE 3RN5A 3A5ZB 4X62Q 3HOWH 2XTIA 1YJ9A 2UXBL 2JA5G 2JEAI 4A3KH 4XIGS 5IYCH 3PUZA 4AYBE 1HNXQ 3TREA 1BBUA 3CC7A 4JI6Q 1WCMG 1CUKA 2D0OA 3GO5A 2JA5H 3STBD 2B29A 1I94L 3I56A 3PUVA 2ZJQA 3J80c 3H15A 1V1QA 4HJ8A 5JJLA 1WCMH 3OTOQ 2UUAQ 4HIKA 1N32Q 3A5UA 3S14H 4LUOA 2PQAB 1IBMQ 1HNWQ 3AEVA 1IZ6A 4PZ6A 1E1OA 4PZ7A 4DNIA 3ULPA 1XNRQ 1SN8A 2NN6G 1MKHA 3J80i 2OTLA 1NBWA 2MNAA 2IHFA 3KJPA 1FVIA 3IRBA 3G4SA 2HHHQ 2VQEQ 4RMFA 2BA0A 1MJEA 2HIVA 2CWPA 4K0KL 2VZAA 4DV4Q 4LF6Q 2EIFA 4EQ5A 1Q1EA 3VDYA 1Q8KA 4R4CA 3HOXG 1VQ5A 1Z47A 1D8LA 2MQHA 4JBWA 1NY4A 2OQKA 3SGIA 5LMNL 4GNXC 1Q7YC 1OXXK 2Q2IA 1IBLL 3AFQA 1Z9FA 4Y7NH 4LFBL 3HOXH 1WYDA 2UXDQ 3EN2A 4B3ML 1QVFA 1NJIC 2QGQA 1E1TA 1PH1A 3RN2A 4FDBA 4LUZA 3W5OA 4JI1L 1ASYA 1I3QH 5GROA 2JA8H 2ZTDA 2AWNA 1X3GA 3KDFB 5IYBH 4EX5A 4DR1Q 4DR3Q 4B3TL 4DV3L 4DK3C 1IYJB 3BU2A 1YHQA 3RNUA 4KHPL 3HOVH 4UP8A 1VQEA 4KHZA 4DR6L 3I7FA 1SR3A 1HR0Q 1OXSC 1PH4A 1NTGA 4GN3B 1PVOA 2R7FA 1JJGA 3CCUA 1JT8A 1R9TH 4R1JA 2BA1A 4DR5Q 2RCNA 3CC2A 2QA4A 4IOCA 3ULLA 1JJCB 1PH3A 3M3YH 3EBEA 3K7AH 5C44G 4X64Q 1FJGL 1WJJA 4ALPA 3MEFA 4L5RC 1O7IA 1KAWA 4IPDA 4IPCA 4JOIC 4X66Q 4A75A 1PFSA 4P74A 2UXCL 4R4IA 2Z0SA 1NMFA 1X3FA 5C44H 1KQSA 2HT1A 1RIPA 2E5LQ 1VQCA 3CC4A 3CXCA 1J5EQ 3TRZA 4A3CG 3D31A 3HFZB 3TQYA 1LM0A 1NMGA 3GTQH 4BBRG 3ERSX 1X9NA 4BY1G 1XNQQ 4A3CH 4X65Q 4DR7Q 2LXJA 5GAHC 4DV5L 1VQBA 2VY3A 2Y0SE 1MJCA 3E0EA 3FKIG 1C7YA 2UXBQ 4B3SL 1YHAA 4IPGA 4MNOA 2JE6I 1GM5A 4BY1H 4HJ5A 4LF8Q 3RR5A 1IBKL 4JI7Q 3CMAA 3CCMA 5LMUL 4DV0Q 3RZOH 2VQFQ 1YJNA 4A3BG 2OQ0A 1A0IA 2JA7G 3CMEA
chains in the Genus database with same CATH superfamily
5IOCA 1VQKA 1PFBA 1HZAA 1BCPC 1T5XD 4CJ0B 3MC0B 1X3QA 1NE3A 5EPJA 1H9RA 5C5MA 3J7YW 1STGA 5GADC 3HOUH 2Z4HA 2NWGA 1GHKA 3H94A 1PH2A 2KECA 2F0TA 1B3QA 1MIUA 3M4YA 3ICEA 3ZJYC 1RCVD 1JORA 3EFXD 1UWVA 3LWEA 3OW2A 1LTSD 5LMNW 1Q8IA 4ZCKA 1PH7A 3TN2A 5T1GA 3PF4A 2O4XA 1JMCA 1TWHH 4DV1Q 3TZDA 4AQYQ 1WTRA 5DNFA 3GDEA 1GUGA 2F0IA 2PQAA 1VQJA 4HJ9A 4LFCL 2VW9A 1VQ6A 1U4RA 4JI8L 3K5LA 2EJMA 2MJ8A 4P71A 5JJKA 4C3JB 2UUCL 1XJVA 5G3LF 5C3EG 3IFDA 2CQOA 2XWJB 5CC4A 4ZKBB 1KDCA 2NTTA 3K81C 1EIHA 3HKSA 1VQ4A 3CCVA 2R7ZB 4XDXA 4DK1A 3NWTA 1HCZA 3EVQA 2XVSA 3SDZA 3CCSA 1L2FA 1LV9A 1O7LA 2VUMB 4K2LA 3HOWB 1TVXA 1YHBA 2RSOA 1QVGA 3GTPH 4JI3L 1A62A 2MGSA 1BOSA 1WOCA 4XT1B 3T1HL 5D65A 2CWAA 3L7ZC 1WTHA 3E3XA 3KOJA 4IPHA 2JK8A 5FO9B 2NVTH 4A3IG 2NVYH 2L55A 3BG3A 4LF4Q 1EY6A 2IW3A 1JR0D 1B9MA 1SMXA 1JWUD 4C2MH 1Q82C 4NXML 1S5FD 4AIMA 4S3SA 3SVMA 5D14A 2KCTA 4B9XA 4X62L 1K8GA 2A19A 4K14A 2K14A 3QO2A 1HNXL 4JI6L 3O13A 1QILA 3M85A 1SROA 3OYYA 4A3EH 2LFNA 1K9MC 1I5FA 3TS0A 2JA8B 1MGSA 2KHJA 4BBRH 4ZKCB 3T1YL 3VYUA 3S16H 3DM3A 2PPBC 1CKMA 5JOBA 1CI3M 1D1IA 2EJFC 1YITA 2JXMB 2K5VA 5M5YH 3PV0A 1RODA 1CA6A 3K7AB 2IJ0A 1D5MC 3A74A 4LF6L 1EU4A 4DV7L 4A3BH 1SE2A 3BDCA 1Q46A 5C44B 2FXQA 1SNQA 1IW7D 1QOHA 5IYDG 4B9WA 4OHJA 1CTMA 2R6GA 5CV9A 1KRTA 1CT1D 2EY2A 2UXDL 1PH8A 4AYBB 4HCEA 2RDHA 4DR1L 1PRTC 2N55A 4HIOA 2Q8TA 2KCMA 3F2CA 3SK4A 5M5XH 5M3MH 4AH6A 1IL2A 4C3JG 1E22A 4DR5L 4LAAA 3UDFA 3BZDB 4OWWB 5CBEE 4KHPQ 1X3PA 5I9PA 2NVXH 2R7ZG 2F1MA 2YTYA 1X32A 4MIUA 2YTXA 3S24A 4DA2A 4LFAL 2E5LL 2PQEA 1AN8A 1SMYC 1STBA 2VUMG 1KL9A 2ASBA 3S9WA 3A7AB 3HOWG 5TSSA 1Y8PB 3E9IA 1V1PA 3U50C 1BO0A 2K03A 1U9RA 3DWAA 3S1MB 3ND9A 1K73C 5CGKA 1RD9D 2R92B 3CHBD 1DD2A 2X6LA 4JI2L 4V190 3NUCA 4RG1A 4ID6A 4OO1H 2EYPA 3PO3H 2VQFL 2C35B 3RLNA 4CKCA 2CQAA 4MZ9A 4GOPC 1PZJD 1MI2A 3OIPA 2E2JH 1JWMD 1I4GA 3C1FA 1IBKQ 3CW2C 4KLKA 1Y1WH 2RBMA 1IXRA 3AMUA 1PXUA 1KLGD 4M1UB 4FVMA 4XXEA 2KVMA 1FGUA 3PQIA 1L1OC 4K6LA 1HH2P 1T9HA 2IT1A 2BCOA 3Q0AA 3UE1A 5JEAG 2B2VC 3S14B 1LO5D 1X55A 1F2MA 1EY0A 2SNMA 4LK1C 1ONLA 5M5WH 1L0WA 4WFN3 1PMRA 2JA8G 5IYBG 1ZYRC 4CHTB 2K28A 3HG9A 2WFWA 4HSVA 4PZ8A 4JI5L 4DPGA 4RGTA 1QUQA 2DUDA 2EPBA 1EY7A 2HQEA 1N33Q 4K5XA 1X65A 5A2QE 2CW0D 2J0TD 2UUAL 1G2SA 4QL5A 1PTOF 1IBML 1YNJC 3HRZC 4POGA 2LY7A 1QJOA 4P72A 2NVTB 3MXGA 4AYBG 1VDZA 5C0XJ 1YNXA 3AFPA 1STYA 2HDMA 3PMFA 3TS2A 4HMIA 1VS0A 1D5ZC 3I4LA 1NNXA 1FNWA 2Z6KC 4A93H 5FJ8G 1QZGA 1ZEQX 2KUMA 1EQQA 2E2DC 1HQMC 3GTQB 2EXZA 4YHHQ 2I5LX 4BBSH 1LYLA 4DV2Q 4YY3Q 4X3TA 5FLMH 4X6AH 1HA5A 1MD2D 3E6ZX 2K05A 1TY0A 2F03A 1EIFA 3BYTB 3R2IA 4BBRB 5I2YA 3EQLC 4DV6Q 3BDOA 4BY1B 3I4MH 4C1NI 5EKIA 3S16B 1GUWA 4JK1C 2KCNA 3ND8A 3NXWA 3DHQA 3TMEA 4GKKQ 2C9OA 3K7UC 2EYFA 1QNKA 3J7A5 1N36Q 1S5ED 3DLLA 3TSSA 5FLXc 3T53B 3TDQA 1VQGA 2PI2E 2K01A 4J15A 2R92G 1AEXA 1JOOA 2M9VA 4LF9Q 4A3BB 3MAQA 2N49A 2JA7B 1GVPA 1L1OB 1XPUA 2MFIA 4BXXG 4JOIA 2D2CC 4OWTB 1Q81C 4HMJA 3PGZA 2JP1A 2WP8J 2BE5D 4Y52H 4GN4B 4BA2I 5IYCG 1FNVA 2ZT9C 3A5ZB 3BS1A 2XTIA 3D4WA 3VYTA 4CDCC 2PCFB 5M3MB 4FF4A 1I4PA 3GO5A 2JA5H 2XRQD 2Z9HA 5C4HA 3I56A 2ZJQA 4PQXA 4NW2A 3ERQA 2F0UA 2A5HA 3OTOQ 4MHEA 3BVGA 4HIKA 1IKLA 1HNWQ 3I90A 2NVXB 2EYJA 1IZ6A 4KK7A 1E1OA 1EY8A 4PZ7A 4DNIA 2O5IC 4OIKA 3S2DB 2OTLA 1NBWA 1FD7D 4RMFA 2F0HA 4YIJA 1Q1EA 1Q8KA 2EZVA 2MQHA 1B53A 3OOCA 2OQKA 3SGIA 1H9JA 5C3XA 1Q7YC 2E74C 2I07B 3AFQA 1WYDA 1SYFA 4B3ML 1ICFB 1NJIC 1ASYA 2RVLA 4JI1L 1WVLA 5D3DA 1K8OA 3VR4A 2MP1A 2BDNA 3R2TA 4N8X1 4DK3C 1YHQA 4DGZA 4DR6L 1L0YB 2E2JB 1PH4A 1NTGA 2R7FA 3CCUA 1Y1WB 1TS5A 3CC2A 4UHVA 2L5TA 2SNSA 4CDEC 1EEID 1FJGL 2CH4A 4IPDA 1I6VC 4IPCA 5KNDA 5EPLA 1JWSD 1QG7A 2Z0SA 3EJIA 2EY1A 4H0LC 3CC4A 1G91A 5M5WB 3TQYA 4BBRG 3RUZA 4ZUJA 4BY1G 3WOEA 5C4JB 1XNQQ 4A3CH 4X65Q 2LXJA 2DN8A 1VQBA 5HURA 2UXBQ 2A6HD 4JI7Q 4K5VA 3CCMA 4K5WA 1PRTD 5LMUL 4DV0Q 3RZOH 3SK8A 5EKLA 4OX9L 4QIWE 4A3BG 2JA7G 1TWAB 1DONA 4J8QA 1SYBA 4F7XA 1W3SA 2RHQB 3A8IE 2EY6A 4NXNL 3S15H 5IWAL 3H3VH 2VB3X 3I4NH 1L1OA 4DFAA 2K5DA 3OHXC 5M3FH 1GD7A 3MXNB 4DR4L 4JG2A 3H6MA 3KYHC 3RD4A 4WORA 5C6AA 5M3MG 1CK1A 1VQIA 5J39A 2OWOA 1K3BC 1V43A 2BDOA 2KBNA 1SFOB 4QUCA 2F3IA 5EJWA 4A93B 1C0AA 1IBLQ 2J4XA 4PMWA 3K58A 1EYGA 1E2ZA 3CRLC 2HD3A 3NTHA 3H0GB 1E24A 1GHJA 1UNSA 2P5ZX 3OSOA 4DF7A 4OELB 5EPKA 2D0PA 4DXGA 3FPPA 2ATWA 3CPWA 1EFWA 3PUXA 4GKJQ 4LMQD 5HGTA 1BXTA 2YV5A 4N9PA 1UE1A 1F2ZA 1P8LA 1PTOH 4KD3A 4JI0L 1A8VA 2F52A 1HJPA 4RGOS 5IGEA 1S3OA 4QY7A 2UU9Q 1KDAA 5KYIA 2PO4A 2WAQE 4OO1G 5KNBA 1LUZA 3GTMB 3KUPA 3I73A 1B70B 2JJQA 1V9PA 5ELCA 1XMOL 3VA5A 5I9OA 5IIFA 2NN6H 2SEBD 4QF4A 5LL6S 2CHBD 3W1BA 1MSGA 4DV5Q 4A3FB 2K5WA 3S2HB 1ZYRD 5IT9c 1Y1WG 1JCKB 4B3SQ 1VQ8A 1U4LA 4JI4Q 4APVA 1XMQL 2JA5B 3FRPB 2RQXA 1N34L 4RFBA 2G9DA 2MO1A 3QR8A 1VQ7A 1KTKA 3PIP3 3CCQA 1PDQA 1NSNS 1LACA 1KDBA 4EVOA 4R8IA 3OMGA 3S1QB 1CZGA 4B3RQ 3P75A 4R4OA 3Q24A 1ET6A 1YNJD 1EWHA 4HR7B 2ZM6L 1F9SA 5K36H 2IX1A 4A3LG 1VQDA 1OO9B 3J80L 2E2IH 3Q23A 4G7OC 3CQZH 3I8ZA 1DM0B 3K6OA 1B7YB 4IJLA 3ZYYX 3JAMc 2PI2A 4HIMA 3PUYA 4C3HH 4HJ7A 2LMCB 1K83H 2XGTA 3CAMA 5HGQA 2ZJPA 1BUVT 2NB0A 1PTOC 2Q2TA 2Z4IA 4DAVA 5BN5A 2EQSA 1G51A 1N32L 2L0CA 4C3IH 3MWYW 5DM73 2L15A 1OXUA 1H9SA 1YEZA 3NBHB 4UAIA 5NUCA 4PG3A 3A55A 1CKNB 1SXTA 3QOLA 3CU7A 3MXNA 1XXGA 4A93G 3CD6A 5IP9H 3U58A 2PW5A 3H0GG 3HEJA 2A1AA 2EYHA 4RGMA 4R4QA 3F2DA 1E2VA 1I4RA 5FLMG 2RDFA 3NK9A 1F9QA 4DUZL 2ZTEA 1GJXA 5DLQE 3J7AF 4XT3B 4DR3L 1VMCA 2LXKA 1MBYA 1UEBA 4ILWA 1SE4A 2GN5A 3I70A 3S1NH 1HR0L 3R3OA 1K3RA 2G5DA 4KI0A 4A3JH 4DUYL 4L5QA 4GNXB 3FEWX 1BR9A 2WAQB 5ELBA 1XTCD 3J81c 1SYCA 2RHSB 4B3TQ 1PZID 2B2YC 4O2DA 4CGYB 1Q1BA 1EIGA 3DUZA 3I4NB 4IURA 4DK6C 5G3LD 1X54A 2DY7A 4A3FG 4EQOA 3CP0A 5JJIA 5CBAE 4A3GH 3J81j 3TBIB 4JCVE 2R3ZA 1JB3A 5CORA 4NXMQ 1HTPA 3RLOA 2NVQH 2NZOA 4DR7L 2OT2A 4GLVB 1VQNA 1SDFA 3HOYH 5KYLA 3E9HA 3RZDH 2YYZA 4A3DH 2TMPA 4ZUIA 3UE0A 4LF8L 1ML0D 1KAAA 1B50A 5C4XH 1V1PB 1HRJA 4RWSC 4O0AA 2Z1CA 1SBBB 1XWEA 2D62A 1SEBD 5J3BA 2CCZA 3BZCA 2ES2A 3T1YQ 1TS2A 2FFKB 4A3KB 2F0DA 2ZXPA 4CJ2C 3T56B 4ZQ3A 2YTVA 3EA6A 1RF2D 2NZHA 1AW7A 1EQRA 3S17H 3D4DA 1B8AA 2R93H 2B63H 2A6ED 1RTNA 3E0JA 1JJ2A 4DV7Q 2NTSA 5AJ3Q 2JSOA 3FPUB 4K8JA 3D8GA 2K50A 2F4VL 1BCPB 1UE5A 5IGGA 4L5TA 1X56A 4P2CB 1EWIA 1WI5A 4RKBA 4KTAA 4DV1L 3NEMA 4TKOB 3NTIA 4AQYL 4E6IA 1SAPA 1Z6HA 1SE8A 4L8JA 4Y7NB 4JYAQ 3HOXB 1HR0W 1EOVA 2JA6H 3NBHA 5KGUA 1QUQB 1O7YA 1CKNA 1SJHD 5J1ZA 1KIXA 1FGBD 5E7NA 4DXFA 1GUOA 3M3YH 4LFAQ 1PV4A 3CPFA 5T1IA 2E2HH 2IY5B 2VQEL 1AE2A 1SNOA 1TQOA 1FNUA 2AUKA 2A68C 3VYSA 1HNZQ 5CR3A 1I6HH 4I7AA 4H13C 1CSPA 4P73A 3CQZB 4UP9A 2B2WA 4Z9CB 1EQTA 3NSWA 3L2PA 2WAQG 4XQJA 2OTJA 2VNUD 4JI2Q 4A4IA 1WD1A 3FMCA 2XSCA 4H44C 4FYDA 2D9UA 1SRUA 4MTKA 1VF7A 4C3HB 4XQQA 4GNXA 3PO2H 1K83B 4JW0A 3KF8B 3I4NG 2JA9A 4BY7H 3K0YA 4RHSA 1SE3A 1KD1C 3HKZE 1F2YA 4IJHA 2ICIA 5EAYA 5FKAC 1VQFA 3FP9A 4C3IB 1Q3LA 3HOZH 1QVCA 2L11A 3V2TA 1KABA 4IUUA 4LF4L 3K5NA 2B2UC 5ELOA 4UY8C 3W2DA 2A74C 1G8ZD 3MZ5A 4OO1I 2KENA 5E1FA 3GTJH 2QW7A 2H4OA 3A54A 1LTAD 4TQUS 4IFDG 1DGSA 1A2TA 5GAEC 4NB3A 1QCBD 2DNEA 1BDOA 3HOUB 2KOLA 4A3KG 2F0OA 5IODA 3UI2A 3RN5A 1SNDA 5IGBA 4HN7A 2ICEC 2WINB 5CV8A 4XIGS 2VB2X 4XYQA 5EGTA 3TREA 3CC7A 1C48A 1TWHB 5EBDA 2KCCA 4KMUC 2Q8IB 3PUVA 2K32A 3H15A 1Y69U 1V1QA 4HJ8A 1NCVA 1TS3A 1WCMH 2QF7A 5DEHA 2UUAQ 3A5UA 1IBMQ 4I65A 3F2UA 2FMCA 1TU2B 1XNRQ 2NN6G 3J80i 2MNAA 1I4HA 1FVIA 3NTKA 5JAVA 2HHHQ 2BA0A 2HIVA 4DV4Q 1SJED 4R4CA 3HOXG 1D8LA 1IKMA 3C2PA 1NY4A 1STAA 2F3VA 3HOYB 1G6ZA 1Z9FA 3KK7A 3Q22A 3EN2A 1QVFA 2QGQA 1SYDA 1LLRD 2ZTDA 2AWNA 1X3GA 3KDFB 4H7BA 1W6KA 3MHBA 4DN4M 1IYJB 4KHPL 3HOVH 1VQEA 4KHZA 1S4ZA 3GTPB 4EQPA 1WTQA 1PTOD 1PRTB 1R9TH 3ULLA 3MEHA 5C44G 4X64Q 1HUNA 1EY5A 1WJJA 3MEFA 4IUNA 1KAWA 4X66Q 4A75A 1PFSA 4P74A 2UXCL 3SR1A 3P1HA 2HT1A 1RIPA 2NVYB 1EYAA 1J5EQ 4C3HG 1BCPD 1LM0A 1CM9A 4IN3A 5D3IB 1X9NA 3HKZB 4C2MB 2B2TC 4C3IG 2QEJC 1SNCA 5GAHC 1PYWD 3E0EA 1MJCA 4IUVA 3SHLA 3KF8A 1PLFA 1HXYD 2JE6I 1BF4A 1A3TA 1J9OA 3OWFA 3QG1A 3RR5A 1IBKL 3OMCA 5COYA 2ZXOA 1PFMA 2QKIC 3TP6A 1A0IA 4A3EB 1E7ZA 3PUWA 3KLSX 1IYUA 2Q2UA 3QWNA 2UUBQ 2QILA 4QCLA 4FP5D 4O1NA 2QDBA 3HOUG 4DAMA 4DR2Q 4GOPB 1T5EA 4A3MH 5M5YB 1II3A 4DNTB 1JQYD 2I5HA 2XRSD 4DAYA 1B4OA 3UDGA 4QQBX 4FF2A 3PCOB 1LTGD 2WACA 3KLSA 1N33L 4ME5A 4QUFA 4GLAC 4RKLA 2R61A 1LTID 1STNA 4MN3A 2ALYB 1VQ9A 3GTOH 5JEAJ 3KLRA 5M5XB 1HZBA 2L9HA 1GO3E 4OWXB 3NELA 4UPAA 2F0PA 5KRUA 2BH8A 4C1NK 5IGCA 4HIDA 3HOYG 3SK6A 1HZ9A 1TKWB 1IYVA 2PYKA 4WJ4A 3C3LA 2WB1E 2EY5A 1P16A 4HAEA 2VXWA 4N9TA 3T51B 2F0WA 1QB5D 1R4PB 3BZKA 1TWFH 2N78A 3PIPA 3J80E 1PH6A 4DV2L 1RKNA 3D6WA 5EBCA 5FLXL 5FK9C 3KDFA 1J6QA 3STBC 4DV6L 3PIO3 3HP3A 3M9BA 5BR8L 3PSIA 1EZ8A 2BH2A 3VYRA 2DY8A 3PO3B 3N6RA 2RDGA 1C4QA 1UE6A 4CDDC 4GKKL 5IY0A 3WOFA 4X3SA 1IL8A 4OL7A 3P20A 4NKLA 1DJRD 1EWCA 1YBYA 4LF9L 1KNAA 5JPNC 1D7QA 5EQ0A 3HKZG 4LF7Q 2I5MX 2J7ZA 4KJNA 2ZJRA 2EYOA 1WTOA 1V8QA 1AFPA 1NR2A 2A73B 3GTGH 1YJWA 3AYHB 5DAUA 2PMZE 2A68D 1AE3A 1LT5D 4A3EG 5LL6X 2MO0A 3G7LA 2SOBA 4JBJA 3NQTA 4POFA 1V1OA 1U0LA 2X69A 4LWCA 1E2WA 3OTOL 3DEPA 1HNWL 3HOVB 5AFWA 3QOJA 3WWVA 4CKEA 3FKIH 4YWMA 1F2LA 1D6EC 1R9TB 1I94Q 1PYSB 2WKCA 4GOPA 3GQBA 3AU7A 1ZKOA 2ZTCA 4IFDI 1H9SB 5FOBB 1DOLA 4DAPA 2AMCB 3MFGA 3Q6SA 2B2VA 5JVH3 2KJXA 4C56C 4K0KQ 3FVQA 1CKOA 3GP7A 5IYDH 3D0FA 1SMYD 2IX0A 2GVAA 2CH4W 5IE8A 5LMNQ 1VQOA 3NBIA 4K2KA 4R9WA 4LFBQ 2JQOA 5CV7A 4WJWA 2KEDA 3I4OA 1F9PA 3IL8A 4BBSB 5C0XH 2WB1B 1YNNC 1Y8NB 3GV6A 4PV1C 2E76C 3HS0C 4U68A 1NR4A 3RLFA 4DV3Q 4WJ3M 4C3JH 5BN4A 2NN6I 3I4MB 3J7AV 4U673 4I7ZC 3BVZA 4KV6A 1EUJA 1S72A 2R7ZH 4BWGB 4TVAB 3N52A 4UDUC 4A3MB 3S1RH 4LF5L 4NDXA 1WFQA 1EYCA 1TXYA 4KN4C 1XNQL 4X65L 2YU9H 2AQ1B 5GAGC 2K5HA 3PO3G 4HSPA 2C5CA 2KA7A 4B08A 1DCZA 3CCLA 4JV5L 1M4VA 3URYA 3JC66 1E3PA 4JI7L 1Y14B 2B2TA 3I55A 4DV0L 3QJYA 1WTXA 2Z6KA 1SNPA 2OEOA 3IAYA 1Y1VH 1W2BA 3BDLA 1CFMA 1TIID 1KXLA 4M8AA 5E3FA 3CF5A 4KHVA 1Z7TA 1Y8OB 4RCOA 4J1MA 2PMZB 1I50H 2IWHA 3VR3A 2TSSA 1K8MA 2B39A 1CHQD 5JEAH 4YWLA 2CKZB 5IP7H 4V0BA 1TWGH 4YCVA 4JPBW 1KC8C 4DUZQ 3G71A 3T16A 1QZHA 1EFID 3HOVG 4YCWA 3L3OC 3GTLH 5A35A 3T4AC 1HFGA 4QIWB 1L0XB 1RTOA 1ICWA 4GKJL 1B9NA 3NHHA 3WDNA 1EY4A 3I91A 4DUYQ 4G7ZC 1CA5A 1H9MA 1MHWC 2UU9L 1K28A 4IQZA 4KD4A 2AQ2B 3OPOA 4FNFA 3MFYA 5IT9L 5KIXA 4LFCQ 3CCEA 3I2ZA 1LABA 4JI8Q 4H02A 1A3UA 2HCCA 2O2LD 1BNZA 3NQIA 2UUCQ 2K04A 3GTGB 3B6YA 3J7ZC 1DXMA 5KNCA 4BBSG 1KRSA 2WB1G 4JBMA 2XWBB 3X3MA 3TP5A 3DMUA 4GS3A 4JI4L 3VR5A 1ILQA 1N9WA 5FJ8H 4A76A 4JBKA 3I4MG 2FINB 2H5XA 1G291 5ELNA 5KEEA 3NWSA 2AUJD 4Q5VA 4NMZA 4A3MG 4JI3Q 1VQPA 3MA2B 3FKIB 1F77A 3SEBA 3OIQA 3RZOB 4ME3A 3JAML 4B3RL 1ET9A 1QWYA 3T1HQ 1TWCH 1XPRA 1SYGA 5FO7B 1GKHA 1JB7A 2NBFA 1HUMA 1PH5A 2F0NA 3S15B 2A69C 4XTCS 3S1MH 2R92H 2F4VQ 3HZXA 1TS4A 1EZ6A 2HUGA 5M3FB 1LT6D 1SSOA 3T13A 1LTBD 4BXXH 1K0SA 3IKJA 2GA4B 2X6GA 4X62Q 2JA5G 2JEAI 4ULLA 2L4NA 5CV5A 1I4XA 5IYCH 3PUZA 4AYBE 1HNXQ 3BVMA 4JI6Q 1BBUA 4CBVA 2D0OA 1TR5A 3STBD 4FXKC 3D6CA 3BYYB 4RA8A 5IGFA 5JJLA 2H1EA 1D2BA 4ZYSA 3S14H 1GUNA 3ULPA 1SN8A 1PTOB 2KEEA 1MKHA 2BE5C 2MHVA 3VR2A 3G4SA 2VQEQ 4RAUC 3S1RB 1MJEA 2VZAA 4QB4A 4K6DA 2EIFA 4LF6Q 1LTRD 3VDYA 1HFNA 3J81L 2YU9B 1Z47A 2K5QA 3R93A 1OXXK 1WTPA 2KHSA 5LHY1 1DYQA 2M00A 2UXDQ 1WTVA 3H09A 3SXHA 5JPMC 1PH1A 3RN2A 4LUZA 4DK0A 1I3QH 5E4XA 5GROA 2FHTA 3W3AA 4DR1Q 1Y1VB 4KY6A 4B3TL 1A15A 2DNCA 2MUYA 4FO2A 3RNUA 4IUPA 4UP8A 1TY2A 3NP8A 4GN3B 2EOTA 3DXJC 2EJGC 4O42A 4R1JA 2BA1A 4FXDA 4DR5Q 1JICA 2NUCA 2QA4A 3KBGA 2F0SA 1W6JA 4L5RC 1I50B 1O7IA 4HTHA 3CKIB 4JOIC 2EE1A 1RDPD 1KQSA 2XN9C 1GUTA 1VQCA 2E5LQ 2V4DA 3CXCA 3TRZA 2MPMA 4A3CG 1O7ZA 3GTQH 1NMGA 1TWGB 4ZRZA 4PMCA 3ERSX 1FR3A 4IUTA 2E2IB 2B8FA 2Y0SE 1C7YA 2F0VA 3FKIG 3GTLB 3IFTA 1YHAA 4IPGA 4MNOA 4BY1H 4HJ5A 3CMAA 1O78A 2D5DA 1H9KA 4ABNA 2VQFQ 1BBXC 4WRDA 2QCPX 4G57A 5HY6A 1K8AC 3ONAB 4N8FA 4IZ8A 4FF1A 2BOSA 1LTLA 1VCIA 1YNND 3M4PA 5M3FG 1EU3A 4FF3A 5AJ3L 2JA7H 4JC0A 1CHPD 2EVBA 3V05A 1AP0A 3QIAA 3FHWA 4G7HC 1B44D 2XIWA 1VMPA 1F9RA 2K7VA 2A6HC 1VQHA 2FMMA 5C0XG 1KHIA 1M1KC 2K5NA 5FLXE 4HCSA 4JYAL 4DAYB 3UDIA 5GQOA 4QGUA 1ESRA 1QNUA 4F87A 3KJOA 4JI5Q 1M90C 2KHIA 3G6JB 1HA6A 3F1ZA 5L37A 5BN3A 3C1EA 3S1NB 2OCEA 4TRDA 5I4DA 2F0MA 3E5SA 4A3JB 3S2DH 3PIOA 3EROA 1BBWA 3DWQA 1YZ6A 1TWCB 1HNZL 2F0LA 1C8CA 2DJFC 1ENFA 2A8VA 1BKBA 2UXCQ 2Z6BA 2IL8A 1E0BA 1Q90A 3NENA 2K52A 4BA1I 3G6EA 3QB3A 1Y1VG 1UUPA 4A3GB 3TEHB 1U5KA 2B3GA 4F8MA 5DM63 3F8TA 2NVQB 1UEAB 1LT3D 2RCFA 1H95A 3LNNA 1RL2A 3RZDB 5J22A 3MTSA 4A3DB 4BS9A 4GN5A 2EDGA 3I72A 2DGYA 2JEBI 4QJFA 1G2TA 5C4XB 4P75A 1SLJA 1JC7A 3K0XA 3D4RA 4IUQA 1PA6A 2N8NA 5CMDA 5IP7G 2LKVA 4J6HA 5C3WA 5ELFA 3U9SA 2PZWA 2E8GA 5M9OA 1PHJA 1IHZA 5K36G 1ILPA 1AH9A 2B2YA 2Y0SB 3H91A 3KLWA 5K5PA 3S17B 4UP7A 2R93B 2M2LA 2B63B 2F0JA 5C4JH 4XYOA 4RCNA 3UDXA 3M4OH 4A3LH 2NYZD 1R4QB 2F4IA 1XTDA 3K57A 1VQAA 2K1BA 1EIYB 2AHOB 4LNQA 4PNYA 3NPPA 1ZXTA 2SDFA 1I3QB 1TWAH 1JE4A 2F0FA 3HGBA 2F0EA 2QEXA 3GTKH 2E75C 4DKAC 3JAMi 1JOQA 1PFNA 1EYDA 2ID0A 1XNRL 4GZYC 3LX0A 4IFDJ 2JA6B 4QMGA 1YI2A 5IP9G 3KBXA 2HHHL 3ITPA 1STEA 5EKKA 4LW1A 4DV4L 5I6YA 3PF5A 1CQVA 3D3RA 1SYEA 1SFOH 4HJAA 2VS1A 1BCPF 3M3YB 2E2HB 3Q8DA 3CCJA 2Q8RE 4KKSA 4YWKA 5ISRA 3H0GH 1CZWA 4KJOA 2A69D 2IHEA 1UE7A 3TZUA 1I6HB 1JE5A 3M7GA 2K33A 3SK5A 3MXUA 4A3JG 1GXDC 2K4KA 3NE5B 1B3AA 3OWEB 3DEOA 1A2UA 4IO9A 2HIXA 4OGQC 2K75A 5BR8Q 3BJUA 2AQ3B 4B3MQ 5C5LA 3ER0A 1CSQA 2RKSA 4JI1Q 1Q12A 3KF6B 1HHVA 5C4ZA 4L63B 4X64L 1XX8A 3M7NA 1X3EA 3F2BA 3PO2B 3FDTA 4BY7B 4X66L 2VL6A 4DR6Q 3GD7A 4A3GG 3MVVA 1BVSA 3CRKC 3HOZB 3GTMH 1SNMA 3J81i 1J5EL 1KNEA 4R4TA 5FO8B 3A0JA 1FJGQ 1DOMA 1QE6A 2WV6D 3K8AA 4PMBA 4A3DG 4YCUA 2AKWB 2V1CC 4A3FH 3S2HH 1B1ZA 3GTJB 2IX3A 5I2XA 5JJZA 2AWOA 2G9HD 5C4XG 3LWUA 3X3NA 2R7DA 5C3EH 1LTTD 4YHHL 2L12A 1HPCA 3EIVA 4YY3L 4K8IA 2GVBA 1EOTA 2LSSA 1OTCA 1PYBA 2EYLA 2Y0SG 2B8GA 2UUBL 3L0OA 1U4PA 2R93G 2B63G 1S40A 2QDLA 5LMUQ 4DR2L 3S1QH 2CVRA 4OX9Q 4G4KA 1I4QA 1N36L 1GUSA 1C9OA 3G48A 3ULJA 5IT9E 5H1SE 1WCMB 3TP7A 4KY5A 4NXNQ 1HZCA 5IWAQ 3L9AX 3P7JA 2O5JC 2B2UA 2PNHA 1GOZA 4NP5A 2I46A 2RA4A 4A3IH 1K0RA 1X6OA 5E4WC 3I3CA 5I6WA 4DR4Q 2N3SA 1A3VA 1OXVA 2N88A 2Q2HA 3U4VA 4CJ1B 1A6XA 1DOKA 2ZXRA 2JA6G 1VQLA 2K6AA 1ASZA 4MTNA 5F2DA 1N8RC 3LGJA 1VQMA 2A6EC 4L6TB 3H3VI 1EL0A 3U4ZA 1FL0A 4CKBA 5CV6A 3M4QA 2RSNA 2F0GA 1B2TA 1CQFA 2HQLA 1PH9A 1ESFA 3JAME 2XNAC 3C46A 4ZAIA 4JI0Q 1YVCA 1OXTA 1O80A 1UAPA 3K59A 4IOAA 2JYOA 3V96A 3OW7A 4LF5Q 2RF4A 4R8NA 1FYCA 2CFMA 1YIJA 1EQVA 2EXDA 4KN7C 5C0XI 2NZ1D 2PW7A 4L5SA 3R8BA 1VF5C 3M4OB 4JVZA 4JV5Q 1XMOQ 1NUCA 3AQQA 3PO2G 4BY7G 1EY9A 1D5XC 1STHA 5ELDA 2KQ3A 4OONA 3CCRA 3KFUA 1WD0A 3KF6A 3HOZG 3GTKB 4GLXA 2PZUA 2ENBA 5CYUA 1PRTF 5A2QL 1G6PA 1DZ1A 1Q86C 2Z8LA 5CV4A 1XMQQ 4LF7L 4OXPA 1HTLD 4ZK9B 2F3WA 1N34Q 3K80C 1A63A 1IW7C 1EEFD 3A56A 2DJGC 3W1GA 4KKTA 4NPSA 4TSSA 2I0QA 1XYIA 1XPOA 1AZQA 2F0QA 1ENAA 1HQRD 4ODGA 3CMEA 2JN4A 3J81E 4LUVA 2ZM6Q 4RHRA 2PZTA 1WTWA 2VUMH 4IFDH 4DNRB 4ZLTF 1AZPA 4EQNA 3HOWH 1YJ9A 2UXBL 2OF1A 4LJZC 4A3KH 1WCMG 1CUKA 2B29A 1I94L 2IPKD 4X3KA 3J80c 1LT4D 1KLUD 1RJTA 3GV3A 1ENCA 4OEMB 3GTOB 4RH6A 4EGVA 4HEDA 1TT2A 4KY7A 1N32Q 2FJ2A 4RGNA 4LUOA 2PQAB 4IALA 3AEVA 1M8AA 4PZ6A 2L1BA 3U9OA 4XQNA 4DU9A 2IHFA 3KJPA 1MSHA 3IRBA 1U4MA 4Q0FA 2B2WC 2WIIB 2CWPA 4K0KL 4EQ5A 2HCIA 4F88A 1VQ5A 4JBWA 4FXGC 5LMNL 4GNXC 3SE0A 2Q2IA 1IBLL 3A8JE 1TWFB 3K5OA 4Y7NH 4LFBL 3HOXH 3K5MA 4X3UA 1J8IA 2WKDA 5ELEA 5C3EB 1E1TA 4FDBA 3W5OA 2JA8H 1S5CD 5IYBH 4DR3Q 3H3VC 4EX5A 3A8KE 4DV3L 3BU2A 3A7LA 2PNRC 3VA7A 1S5DD 1JOKA 3I7FA 1SR3A 1HR0Q 1OXSC 3MXPA 3AB9A 1RHPA 1PVOA 1JJGA 4CDFC 1JT8A 2RCNA 4IOCA 1JJCB 1PH3A 3EBEA 3K7AH 2OXPA 4ALPA 2LS01 4R4IA 3VR6A 5IGDA 1NMFA 1X3FA 5C44H 5JVG3 1PZKD 3TP8A 3D31A 3HFZB 3DM1A 4A3IB 1BQQT 4DR7Q 1S5BD 4DV5L 2F0KA 4OIJA 2VY3A 3RMHA 4B3SL 2HDLA 1GM5A 2EYMA 4LF8Q 2CW0C 1NAPA 1YJNA 2OQ0A 4KKUA 1D1KA 3DWPA
chains in the Genus database with same CATH topology
1E7ZA 1VQKA 3PUWA 2Q2UA 5HY6A 1K8AC 1W3SA 2RHQB 1HZAA 2UUBQ 4NXNL 3S15H 3M4PA 1LTLA 1VCIA 5IWAL 5M3FG 2JA7H 5AJ3L 3H3VH 3HOUG 4JC0A 4DAMA 3I4NH 1L1OA 4DR2Q 3FHWA 4GOPB 1NE3A 4A3MH 5M3FH 5GADC 1GD7A 3MXNB 3HOUH 2I5HA 4DR4L 4JG2A 1PH2A 1MIUA 3KYHC 5M3MG 3UDGA 3ICEA 3ZJYC 4QQBX 1VQIA 1VQHA 3PCOB 2OWOA 1V43A 2KBNA 1UWVA 2F3IA 5C0XG 1KHIA 1IBLQ 1C0AA 3OW2A 4PMWA 5LMNW 1PH7A 1M1KC 2K5NA 1EYGA 1N33L 3PF4A 4JYAL 4GLAC 4DAYB 1E24A 1JMCA 1TWHH 3UDIA 5GQOA 4DV1Q 4QGUA 3KJOA 2ALYB 4AQYQ 1VQ9A 4JI5Q 2D0PA 3GTOH 5JEAJ 1M90C 3GDEA 2ATWA 2KHIA 3CPWA 3F1ZA 1EFWA 3PUXA 4GKJQ 1HZBA 2PQAA 1VQJA 1GO3E 2OCEA 4OWXB 4HJ9A 3NELA 4UPAA 2YV5A 4LFCL 1UE1A 1P8LA 4JI0L 3S2DH 1A8VA 2VW9A 2BH8A 2F52A 3PIOA 1HJPA 1VQ6A 4JI8L 1BBWA 1S3OA 4QY7A 1YZ6A 4HIDA 2UU9Q 3HOYG 1HZ9A 4P71A 1HNZL 5JJKA 2UUCL 1XJVA 2A8VA 1BKBA 2UXCQ 4WJ4A 2WB1E 5C3EG 1P16A 2CQOA 2WAQE 4OO1G 3NENA 2K52A 1LUZA 4BA1I 3K81C 3G6EA 3HKSA 3BZKA 3CCVA 2N78A 1TWFH 1B70B 3PIPA 1VQ4A 1Y1VG 2JJQA 1V9PA 1XMOL 1PH6A 3TEHB 4DV2L 1U5KA 2B3GA 3W1BA 3CCSA 3F8TA 1L2FA 4DV5Q 1H95A 3KDFA 1J6QA 5IT9c 1Y1WG 1RL2A 3STBC 1YHBA 4B3SQ 4DV6L 1QVGA 4GN5A 3GTPH 3M9BA 4JI3L 1VQ8A 2DGYA 5BR8L 2JEBI 1A62A 3PSIA 4QJFA 2BH2A 4JI4Q 4APVA 1XMQL 4P75A 4GKKL 1UE6A 1SLJA 5IY0A 3K0XA 1WOCA 1N34L 1PA6A 2N8NA 3T1HL 2CWAA 3L7ZC 2MO1A 3KOJA 5IP7G 1VQ7A 4IPHA 1YBYA 2JK8A 4LF9L 3CCQA 2NVTH 2E8GA 4A3IG 1PHJA 2NVYH 1D7QA 3HKZG 5K36G 4LF7Q 2I5MX 4LF4Q 2ZJRA 1AH9A 4B3RQ 3KLWA 4R4OA 4UP7A 1SMXA 2ZM6L 5C4JH 4C2MH 1Q82C 4NXML 1VQDA 2IX1A 4AIMA 3GTGH 4A3LG 2E2IH 2KCTA 3CQZH 1YJWA 3AYHB 4X62L 3UDXA 1K8GA 2A19A 1B7YB 2PMZE 4IJLA 3M4OH 4A3LH 1AE3A 4A3EG 3JAMc 1XTDA 2K14A 1HNXL 1VQAA 2PI2A 4HIMA 1EIYB 4JI6L 2AHOB 2MO0A 4LNQA 3M85A 3PUYA 1SROA 4C3HH 4HJ7A 3OYYA 4JBJA 4POFA 4A3EH 1U0LA 1I5FA 3TS0A 1K9MC 1K83H 2XGTA 1TWAH 3CAMA 2KHJA 4LWCA 5HGQA 2QEXA 4BBRH 2ZJPA 2Q2TA 3GTKH 4DKAC 3OTOL 3JAMi 2EQSA 1G51A 1N32L 1HNWL 4C3IH 3T1YL 2L15A 3DM3A 3WWVA 3S16H 1CKMA 3FKIH 4YWMA 2ID0A 1OXUA 1XNRL 3NBHB 1YEZA 1YITA 1I94Q 4PG3A 4IFDJ 1PYSB 4GOPA 1YI2A 2K5VA 5M5YH 5IP9G 1CKNB 3PV0A 2HHHL 3A74A 4LW1A 4DV4L 4LF6L 4A93G 4DV7L 3CD6A 4A3BH 2ZTCA 5IP9H 3U58A 3H0GG 4IFDI 4WJ3M 3PF5A 1Q46A 2A1AA 1SFOH 4HJAA 2VS1A 2FXQA 3F2DA 2AMCB 4R4QA 5IYDG 3Q8DA 3CCJA 5FLMG 2R6GA 4YWKA 3H0GH 1KRTA 2IHEA 4K0KQ 2UXDL 4DUZL 1CKOA 2ZTEA 1PH8A 1UE7A 5DLQE 5IYDH 3D0FA 2IX0A 2GVAA 1JE5A 4DR3L 4DR1L 2LXKA 4HIOA 1UEBA 5IE8A 2K4KA 5LMNQ 4A3JG 2KCMA 3F2CA 1VQOA 2GN5A 5M5XH 3S1NH 5M3MH 4IO9A 2HIXA 2JQOA 1HR0L 4AH6A 4LFBQ 1K3RA 2K75A 5BR8Q 3BJUA 4KI0A 3I4OA 4A3JH 4DUYL 4L5QA 4B3MQ 3ER0A 1IL2A 1CSQA 1E22A 4DR5L 4JI1Q 4GNXB 1Q12A 3KF6B 2NVQH 3J81c 3UDFA 2RHSB 4X64L 4B3TQ 3RLFA 4DV3Q 1X3EA 3F2BA 4OWWB 3M7NA 4O2DA 4KHPQ 4C3JH 4X66L 2VL6A 2NVXH 2R7ZG 4DR6Q 2NN6I 1Q1BA 2YTYA 3GD7A 4A3GG 2YTXA 3S24A 1BVSA 4LFAL 3GTMH 1EUJA 2E5LL 4DK6C 1S72A 3J81i 1J5EL 2R7ZH 1X54A 4TVAB 4A3FG 2VUMG 5JJIA 3CP0A 1KL9A 4R4TA 3A0JA 3J81j 3S1RH 4LF5L 4JCVE 1FJGQ 2ASBA 3HOWG 1WFQA 3K8AA 1TXYA 4A3DG 4NXMQ 3RLOA 1XNQL 4YCUA 2AKWB 2V1CC 3E9IA 2NZOA 3U50C 4X65L 4A3FH 2YU9H 4GLVB 1VQNA 4DR7L 3S2HH 5GAGC 3HOYH 1K73C 2AWOA 2K5HA 3PO3G 3E9HA 3RZDH 2YYZA 4A3DH 5C4XG 3UE0A 2R7DA 3CCLA 4JV5L 3JC66 4JI2L 1E3PA 4JI7L 4LF8L 1Y14B 5C3EH 4RG1A 4YHHL 3I55A 4DV0L 3PO3H 5C4XH 3EIVA 4YY3L 2VQFL 4O0AA 2GVBA 2Z6KA 2C35B 3RLNA 1Y1VH 1W2BA 4MZ9A 2LSSA 2D62A 5J3BA 4GOPC 1OTCA 1KXLA 1PYBA 2CCZA 2Y0SG 3BZCA 3CF5A 2ES2A 2E2JH 2UUBL 3T1YQ 1IBKQ 3L0OA 3CW2C 2R93G 4KLKA 1Y1WH 1S40A 2B63G 5LMUQ 1IXRA 2YTVA 4DR2L 2NZHA 3S1QH 4OX9Q 4OX9L 1FGUA 1EQRA 1L1OC 1N36L 3S17H 1HH2P 1C9OA 1T9HA 1B8AA 3G48A 2IT1A 1I50H 3ULJA 5H1SE 2B63H 2R93H 3UE1A 5JEAG 1JJ2A 4DV7Q 4NXNQ 1HZCA 5IWAQ 1X55A 5AJ3Q 2PNHA 2K50A 4YWLA 2CKZB 5IP7H 5M5WH 2F4VL 1L0WA 2JA8G 1TWGH 4YCVA 5IYBG 4A3IH 1K0RA 1UE5A 1X6OA 1KC8C 4DR4Q 2N3SA 4L5TA 3G71A 4DUZQ 1X56A 1QZHA 1EWIA 1WI5A 3HOVG 4DV1L 2WFWA 3NEMA 4YCWA 1OXVA 4PZ8A 4JI5L 4DPGA 4AQYL 3GTLH 3U4VA 2Q2HA 1QUQA 2DUDA 2JA6G 1VQLA 4GKJL 1SE8A 1ASZA 1N33Q 4MTNA 1N8RC 3LGJA 1VQMA 4JYAQ 3H3VI 4DUYQ 1HR0W 1EOVA 3U4ZA 1FL0A 2JA6H 1X65A 3M4QA 1QUQB 1CKNA 2UU9L 1KIXA 2HQLA 1PH9A 2UUAL 5E7NA 4QL5A 1IBML 4POGA 4LFCQ 4P72A 3CCEA 4LFAQ 1YVCA 3I2ZA 3CPFA 1PV4A 4AYBG 5C0XJ 1OXTA 2E2HH 4JI0Q 2IY5B 4JI8Q 4IOAA 1YNXA 4H02A 3AFPA 2VQEL 1AE2A 4LF5Q 2RF4A 1HNZQ 2UUCQ 3TS2A 1VS0A 2CFMA 1I6HH 1YIJA 2EXDA 5C0XI 3B6YA 1CSPA 4P73A 3J7ZC 4UP9A 4L5SA 4BBSG 2Z6KC 1KRSA 4A93H 5FJ8G 2WB1G 1QZGA 4JBMA 3L2PA 2WAQG 1EQQA 4JV5Q 2OTJA 4JI2Q 1XMOQ 2VNUD 3AQQA 3PO2G 4A4IA 4YHHQ 2I5LX 4BY7G 4GS3A 4JI4L 1LYLA 4DV2Q 4BBSH 4YY3Q 1N9WA 1SRUA 5FJ8H 4A76A 4JBKA 4OONA 5FLMH 3CCRA 3I4MG 4GNXA 3KFUA 4X6AH 3PO2H 3KF6A 3HOZG 3KF8B 3I4NG 1EIFA 2H5XA 2JA9A 4BY7H 1G291 5ELNA 4GLXA 4DV6Q 1KD1C 3HKZE 1G6PA 5EAYA 4IJHA 4A3MG 4JI3Q 3I4MH 1VQFA 3FP9A 1VQPA 3HOZH 1Q86C 1QVCA 1XMQQ 4LF7L 4GKKQ 3K7UC 4LF4L 4ME3A 4OXPA 5ELOA 4UY8C 1N36Q 3DLLA 1N34Q 5FLXc 3J7A5 3K80C 4A3GH 4B3RL 1A63A 1VQGA 1TWCH 2PI2E 4J15A 3T1HQ 1XPRA 2R92G 1GKHA 1JB7A 4OO1I 2KENA 3W1GA 4LF9Q 3GTJH 1PH5A 2N49A 4XTCS 1GVPA 4NPSA 3S1MH 1L1OB 2I0QA 1XPUA 1XPOA 2R92H 2F4VQ 2MFIA 4TQUS 4BXXG 1DGSA 5GAEC 4JOIA 4IFDG 4NB3A 4OWTB 1Q81C 4LUVA 2ZM6Q 3PGZA 2WP8J 4A3KG 4Y52H 4GN4B 4BA2I 2VUMH 5IYCG 4BXXH 4QIWE 3RN5A 3A5ZB 4X62Q 3HOWH 2XTIA 1YJ9A 2UXBL 2JA5G 2JEAI 4A3KH 4XIGS 5IYCH 3PUZA 4AYBE 1HNXQ 3TREA 1BBUA 3CC7A 4JI6Q 1WCMG 1CUKA 2D0OA 3GO5A 2JA5H 3STBD 2B29A 1I94L 3I56A 3PUVA 2ZJQA 3J80c 3H15A 1V1QA 4HJ8A 5JJLA 1WCMH 3OTOQ 2UUAQ 4HIKA 1N32Q 3A5UA 3S14H 4LUOA 2PQAB 1IBMQ 1HNWQ 3AEVA 1IZ6A 4PZ6A 1E1OA 4PZ7A 4DNIA 3ULPA 1XNRQ 1SN8A 2NN6G 1MKHA 3J80i 2OTLA 1NBWA 2MNAA 2IHFA 3KJPA 1FVIA 3IRBA 3G4SA 2HHHQ 2VQEQ 4RMFA 2BA0A 1MJEA 2HIVA 2CWPA 4K0KL 2VZAA 4DV4Q 4LF6Q 2EIFA 4EQ5A 1Q1EA 3VDYA 1Q8KA 4R4CA 3HOXG 1VQ5A 1Z47A 1D8LA 2MQHA 4JBWA 1NY4A 2OQKA 3SGIA 5LMNL 4GNXC 1Q7YC 1OXXK 2Q2IA 1IBLL 3AFQA 1Z9FA 4Y7NH 4LFBL 3HOXH 1WYDA 2UXDQ 3EN2A 4B3ML 1QVFA 1NJIC 2QGQA 1E1TA 1PH1A 3RN2A 4FDBA 4LUZA 3W5OA 4JI1L 1ASYA 1I3QH 5GROA 2JA8H 2ZTDA 2AWNA 1X3GA 3KDFB 5IYBH 4EX5A 4DR1Q 4DR3Q 4B3TL 4DV3L 4DK3C 1IYJB 3BU2A 1YHQA 3RNUA 4KHPL 3HOVH 4UP8A 1VQEA 4KHZA 4DR6L 3I7FA 1SR3A 1HR0Q 1OXSC 1PH4A 1NTGA 4GN3B 1PVOA 2R7FA 1JJGA 3CCUA 1JT8A 1R9TH 4R1JA 2BA1A 4DR5Q 2RCNA 3CC2A 2QA4A 4IOCA 3ULLA 1JJCB 1PH3A 3M3YH 3EBEA 3K7AH 5C44G 4X64Q 1FJGL 1WJJA 4ALPA 3MEFA 4L5RC 1O7IA 1KAWA 4IPDA 4IPCA 4JOIC 4X66Q 4A75A 1PFSA 4P74A 2UXCL 4R4IA 2Z0SA 1NMFA 1X3FA 5C44H 1KQSA 2HT1A 1RIPA 2E5LQ 1VQCA 3CC4A 3CXCA 1J5EQ 3TRZA 4A3CG 3D31A 3HFZB 3TQYA 1LM0A 1NMGA 3GTQH 4BBRG 3ERSX 1X9NA 4BY1G 1XNQQ 4A3CH 4X65Q 4DR7Q 2LXJA 5GAHC 4DV5L 1VQBA 2VY3A 2Y0SE 1MJCA 3E0EA 3FKIG 1C7YA 2UXBQ 4B3SL 1YHAA 4IPGA 4MNOA 2JE6I 1GM5A 4BY1H 4HJ5A 4LF8Q 3RR5A 1IBKL 4JI7Q 3CMAA 3CCMA 5LMUL 4DV0Q 3RZOH 2VQFQ 1YJNA 4A3BG 2OQ0A 1A0IA 2JA7G 3CMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7Z A;  1VQK A;  3PUW A;  2Q2U A;  5HY6 A;  1K8A C;  1W3S A;  2RHQ B;  1HZA A;  2UUB Q;  4NXN L;  3S15 H;  3M4P A;  1LTL A;  1VCI A;  5IWA L;  5M3F G;  2JA7 H;  5AJ3 L;  3H3V H;  3HOU G;  4JC0 A;  4DAM A;  3I4N H;  1L1O A;  4DR2 Q;  3FHW A;  4GOP B;  1NE3 A;  4A3M H;  5M3F H;  5GAD C;  1GD7 A;  3MXN B;  3HOU H;  2I5H A;  4DR4 L;  4JG2 A;  1PH2 A;  1MIU A;  3KYH C;  5M3M G;  3UDG A;  3ICE A;  3ZJY C;  4QQB X;  1VQI A;  1VQH A;  3PCO B;  2OWO A;  1V43 A;  2KBN A;  1UWV A;  2F3I A;  5C0X G;  1KHI A;  1IBL Q;  1C0A A;  3OW2 A;  4PMW A;  5LMN W;  1PH7 A;  1M1K C;  2K5N A;  1EYG A;  1N33 L;  3PF4 A;  4JYA L;  4GLA C;  4DAY B;  1E24 A;  1JMC A;  1TWH H;  3UDI A;  5GQO A;  4DV1 Q;  4QGU A;  3KJO A;  2ALY B;  4AQY Q;  1VQ9 A;  4JI5 Q;  2D0P A;  3GTO H;  5JEA J;  1M90 C;  3GDE A;  2ATW A;  2KHI A;  3CPW A;  3F1Z A;  1EFW A;  3PUX A;  4GKJ Q;  1HZB A;  2PQA A;  1VQJ A;  1GO3 E;  2OCE A;  4OWX B;  4HJ9 A;  3NEL A;  4UPA A;  2YV5 A;  4LFC L;  1UE1 A;  1P8L A;  4JI0 L;  3S2D H;  1A8V A;  2VW9 A;  2BH8 A;  2F52 A;  3PIO A;  1HJP A;  1VQ6 A;  4JI8 L;  1BBW A;  1S3O A;  4QY7 A;  1YZ6 A;  4HID A;  2UU9 Q;  3HOY G;  1HZ9 A;  4P71 A;  1HNZ L;  5JJK A;  2UUC L;  1XJV A;  2A8V A;  1BKB A;  2UXC Q;  4WJ4 A;  2WB1 E;  5C3E G;  1P16 A;  2CQO A;  2WAQ E;  4OO1 G;  3NEN A;  2K52 A;  1LUZ A;  4BA1 I;  3K81 C;  3G6E A;  3HKS A;  3BZK A;  3CCV A;  2N78 A;  1TWF H;  1B70 B;  3PIP A;  1VQ4 A;  1Y1V G;  2JJQ A;  1V9P A;  1XMO L;  1PH6 A;  3TEH B;  4DV2 L;  1U5K A;  2B3G A;  3W1B A;  3CCS A;  3F8T A;  1L2F A;  4DV5 Q;  1H95 A;  3KDF A;  1J6Q A;  5IT9 c;  1Y1W G;  1RL2 A;  3STB C;  1YHB A;  4B3S Q;  4DV6 L;  1QVG A;  4GN5 A;  3GTP H;  3M9B A;  4JI3 L;  1VQ8 A;  2DGY A;  5BR8 L;  2JEB I;  1A62 A;  3PSI A;  4QJF A;  2BH2 A;  4JI4 Q;  4APV A;  1XMQ L;  4P75 A;  4GKK L;  1UE6 A;  1SLJ A;  5IY0 A;  3K0X A;  1WOC A;  1N34 L;  1PA6 A;  2N8N A;  3T1H L;  2CWA A;  3L7Z C;  2MO1 A;  3KOJ A;  5IP7 G;  1VQ7 A;  4IPH A;  1YBY A;  2JK8 A;  4LF9 L;  3CCQ A;  2NVT H;  2E8G A;  4A3I G;  1PHJ A;  2NVY H;  1D7Q A;  3HKZ G;  5K36 G;  4LF7 Q;  2I5M X;  4LF4 Q;  2ZJR A;  1AH9 A;  4B3R Q;  3KLW A;  4R4O A;  4UP7 A;  1SMX A;  2ZM6 L;  5C4J H;  4C2M H;  1Q82 C;  4NXM L;  1VQD A;  2IX1 A;  4AIM A;  3GTG H;  4A3L G;  2E2I H;  2KCT A;  3CQZ H;  1YJW A;  3AYH B;  4X62 L;  3UDX A;  1K8G A;  2A19 A;  1B7Y B;  2PMZ E;  4IJL A;  3M4O H;  4A3L H;  1AE3 A;  4A3E G;  3JAM c;  1XTD A;  2K14 A;  1HNX L;  1VQA A;  2PI2 A;  4HIM A;  1EIY B;  4JI6 L;  2AHO B;  2MO0 A;  4LNQ A;  3M85 A;  3PUY A;  1SRO A;  4C3H H;  4HJ7 A;  3OYY A;  4JBJ A;  4POF A;  4A3E H;  1U0L A;  1I5F A;  3TS0 A;  1K9M C;  1K83 H;  2XGT A;  1TWA H;  3CAM A;  2KHJ A;  4LWC A;  5HGQ A;  2QEX A;  4BBR H;  2ZJP A;  2Q2T A;  3GTK H;  4DKA C;  3OTO L;  3JAM i;  2EQS A;  1G51 A;  1N32 L;  1HNW L;  4C3I H;  3T1Y L;  2L15 A;  3DM3 A;  3WWV A;  3S16 H;  1CKM A;  3FKI H;  4YWM A;  2ID0 A;  1OXU A;  1XNR L;  3NBH B;  1YEZ A;  1YIT A;  1I94 Q;  4PG3 A;  4IFD J;  1PYS B;  4GOP A;  1YI2 A;  2K5V A;  5M5Y H;  5IP9 G;  1CKN B;  3PV0 A;  2HHH L;  3A74 A;  4LW1 A;  4DV4 L;  4LF6 L;  4A93 G;  4DV7 L;  3CD6 A;  4A3B H;  2ZTC A;  5IP9 H;  3U58 A;  3H0G G;  4IFD I;  4WJ3 M;  3PF5 A;  1Q46 A;  2A1A A;  1SFO H;  4HJA A;  2VS1 A;  2FXQ A;  3F2D A;  2AMC B;  4R4Q A;  5IYD G;  3Q8D A;  3CCJ A;  5FLM G;  2R6G A;  4YWK A;  3H0G H;  1KRT A;  2IHE A;  4K0K Q;  2UXD L;  4DUZ L;  1CKO A;  2ZTE A;  1PH8 A;  1UE7 A;  5DLQ E;  5IYD H;  3D0F A;  2IX0 A;  2GVA A;  1JE5 A;  4DR3 L;  4DR1 L;  2LXK A;  4HIO A;  1UEB A;  5IE8 A;  2K4K A;  5LMN Q;  4A3J G;  2KCM A;  3F2C A;  1VQO A;  2GN5 A;  5M5X H;  3S1N H;  5M3M H;  4IO9 A;  2HIX A;  2JQO A;  1HR0 L;  4AH6 A;  4LFB Q;  1K3R A;  2K75 A;  5BR8 Q;  3BJU A;  4KI0 A;  3I4O A;  4A3J H;  4DUY L;  4L5Q A;  4B3M Q;  3ER0 A;  1IL2 A;  1CSQ A;  1E22 A;  4DR5 L;  4JI1 Q;  4GNX B;  1Q12 A;  3KF6 B;  2NVQ H;  3J81 c;  3UDF A;  2RHS B;  4X64 L;  4B3T Q;  3RLF A;  4DV3 Q;  1X3E A;  3F2B A;  4OWW B;  3M7N A;  4O2D A;  4KHP Q;  4C3J H;  4X66 L;  2VL6 A;  2NVX H;  2R7Z G;  4DR6 Q;  2NN6 I;  1Q1B A;  2YTY A;  3GD7 A;  4A3G G;  2YTX A;  3S24 A;  1BVS A;  4LFA L;  3GTM H;  1EUJ A;  2E5L L;  4DK6 C;  1S72 A;  3J81 i;  1J5E L;  2R7Z H;  1X54 A;  4TVA B;  4A3F G;  2VUM G;  5JJI A;  3CP0 A;  1KL9 A;  4R4T A;  3A0J A;  3J81 j;  3S1R H;  4LF5 L;  4JCV E;  1FJG Q;  2ASB A;  3HOW G;  1WFQ A;  3K8A A;  1TXY A;  4A3D G;  4NXM Q;  3RLO A;  1XNQ L;  4YCU A;  2AKW B;  2V1C C;  3E9I A;  2NZO A;  3U50 C;  4X65 L;  4A3F H;  2YU9 H;  4GLV B;  1VQN A;  4DR7 L;  3S2H H;  5GAG C;  3HOY H;  1K73 C;  2AWO A;  2K5H A;  3PO3 G;  3E9H A;  3RZD H;  2YYZ A;  4A3D H;  5C4X G;  3UE0 A;  2R7D A;  3CCL A;  4JV5 L;  3JC6 6;  4JI2 L;  1E3P A;  4JI7 L;  4LF8 L;  1Y14 B;  5C3E H;  4RG1 A;  4YHH L;  3I55 A;  4DV0 L;  3PO3 H;  5C4X H;  3EIV A;  4YY3 L;  2VQF L;  4O0A A;  2GVB A;  2Z6K A;  2C35 B;  3RLN A;  1Y1V H;  1W2B A;  4MZ9 A;  2LSS A;  2D62 A;  5J3B A;  4GOP C;  1OTC A;  1KXL A;  1PYB A;  2CCZ A;  2Y0S G;  3BZC A;  3CF5 A;  2ES2 A;  2E2J H;  2UUB L;  3T1Y Q;  1IBK Q;  3L0O A;  3CW2 C;  2R93 G;  4KLK A;  1Y1W H;  1S40 A;  2B63 G;  5LMU Q;  1IXR A;  2YTV A;  4DR2 L;  2NZH A;  3S1Q H;  4OX9 Q;  4OX9 L;  1FGU A;  1EQR A;  1L1O C;  1N36 L;  3S17 H;  1HH2 P;  1C9O A;  1T9H A;  1B8A A;  3G48 A;  2IT1 A;  1I50 H;  3ULJ A;  5H1S E;  2B63 H;  2R93 H;  3UE1 A;  5JEA G;  1JJ2 A;  4DV7 Q;  4NXN Q;  1HZC A;  5IWA Q;  1X55 A;  5AJ3 Q;  2PNH A;  2K50 A;  4YWL A;  2CKZ B;  5IP7 H;  5M5W H;  2F4V L;  1L0W A;  2JA8 G;  1TWG H;  4YCV A;  5IYB G;  4A3I H;  1K0R A;  1UE5 A;  1X6O A;  1KC8 C;  4DR4 Q;  2N3S A;  4L5T A;  3G71 A;  4DUZ Q;  1X56 A;  1QZH A;  1EWI A;  1WI5 A;  3HOV G;  4DV1 L;  2WFW A;  3NEM A;  4YCW A;  1OXV A;  4PZ8 A;  4JI5 L;  4DPG A;  4AQY L;  3GTL H;  3U4V A;  2Q2H A;  1QUQ A;  2DUD A;  2JA6 G;  1VQL A;  4GKJ L;  1SE8 A;  1ASZ A;  1N33 Q;  4MTN A;  1N8R C;  3LGJ A;  1VQM A;  4JYA Q;  3H3V I;  4DUY Q;  1HR0 W;  1EOV A;  3U4Z A;  1FL0 A;  2JA6 H;  1X65 A;  3M4Q A;  1QUQ B;  1CKN A;  2UU9 L;  1KIX A;  2HQL A;  1PH9 A;  2UUA L;  5E7N A;  4QL5 A;  1IBM L;  4POG A;  4LFC Q;  4P72 A;  3CCE A;  4LFA Q;  1YVC A;  3I2Z A;  3CPF A;  1PV4 A;  4AYB G;  5C0X J;  1OXT A;  2E2H H;  4JI0 Q;  2IY5 B;  4JI8 Q;  4IOA A;  1YNX A;  4H02 A;  3AFP A;  2VQE L;  1AE2 A;  4LF5 Q;  2RF4 A;  1HNZ Q;  2UUC Q;  3TS2 A;  1VS0 A;  2CFM A;  1I6H H;  1YIJ A;  2EXD A;  5C0X I;  3B6Y A;  1CSP A;  4P73 A;  3J7Z C;  4UP9 A;  4L5S A;  4BBS G;  2Z6K C;  1KRS A;  4A93 H;  5FJ8 G;  2WB1 G;  1QZG A;  4JBM A;  3L2P A;  2WAQ G;  1EQQ A;  4JV5 Q;  2OTJ A;  4JI2 Q;  1XMO Q;  2VNU D;  3AQQ A;  3PO2 G;  4A4I A;  4YHH Q;  2I5L X;  4BY7 G;  4GS3 A;  4JI4 L;  1LYL A;  4DV2 Q;  4BBS H;  4YY3 Q;  1N9W A;  1SRU A;  5FJ8 H;  4A76 A;  4JBK A;  4OON A;  5FLM H;  3CCR A;  3I4M G;  4GNX A;  3KFU A;  4X6A H;  3PO2 H;  3KF6 A;  3HOZ G;  3KF8 B;  3I4N G;  1EIF A;  2H5X A;  2JA9 A;  4BY7 H;  1G29 1;  5ELN A;  4GLX A;  4DV6 Q;  1KD1 C;  3HKZ E;  1G6P A;  5EAY A;  4IJH A;  4A3M G;  4JI3 Q;  3I4M H;  1VQF A;  3FP9 A;  1VQP A;  3HOZ H;  1Q86 C;  1QVC A;  1XMQ Q;  4LF7 L;  4GKK Q;  3K7U C;  4LF4 L;  4ME3 A;  4OXP A;  5ELO A;  4UY8 C;  1N36 Q;  3DLL A;  1N34 Q;  5FLX c;  3J7A 5;  3K80 C;  4A3G H;  4B3R L;  1A63 A;  1VQG A;  1TWC H;  2PI2 E;  4J15 A;  3T1H Q;  1XPR A;  2R92 G;  1GKH A;  1JB7 A;  4OO1 I;  2KEN A;  3W1G A;  4LF9 Q;  3GTJ H;  1PH5 A;  2N49 A;  4XTC S;  1GVP A;  4NPS A;  3S1M H;  1L1O B;  2I0Q A;  1XPU A;  1XPO A;  2R92 H;  2F4V Q;  2MFI A;  4TQU S;  4BXX G;  1DGS A;  5GAE C;  4JOI A;  4IFD G;  4NB3 A;  4OWT B;  1Q81 C;  4LUV A;  2ZM6 Q;  3PGZ A;  2WP8 J;  4A3K G;  4Y52 H;  4GN4 B;  4BA2 I;  2VUM H;  5IYC G;  4BXX H;  4QIW E;  3RN5 A;  3A5Z B;  4X62 Q;  3HOW H;  2XTI A;  1YJ9 A;  2UXB L;  2JA5 G;  2JEA I;  4A3K H;  4XIG S;  5IYC H;  3PUZ A;  4AYB E;  1HNX Q;  3TRE A;  1BBU A;  3CC7 A;  4JI6 Q;  1WCM G;  1CUK A;  2D0O A;  3GO5 A;  2JA5 H;  3STB D;  2B29 A;  1I94 L;  3I56 A;  3PUV A;  2ZJQ A;  3J80 c;  3H15 A;  1V1Q A;  4HJ8 A;  5JJL A;  1WCM H;  3OTO Q;  2UUA Q;  4HIK A;  1N32 Q;  3A5U A;  3S14 H;  4LUO A;  2PQA B;  1IBM Q;  1HNW Q;  3AEV A;  1IZ6 A;  4PZ6 A;  1E1O A;  4PZ7 A;  4DNI A;  3ULP A;  1XNR Q;  1SN8 A;  2NN6 G;  1MKH A;  3J80 i;  2OTL A;  1NBW A;  2MNA A;  2IHF A;  3KJP A;  1FVI A;  3IRB A;  3G4S A;  2HHH Q;  2VQE Q;  4RMF A;  2BA0 A;  1MJE A;  2HIV A;  2CWP A;  4K0K L;  2VZA A;  4DV4 Q;  4LF6 Q;  2EIF A;  4EQ5 A;  1Q1E A;  3VDY A;  1Q8K A;  4R4C A;  3HOX G;  1VQ5 A;  1Z47 A;  1D8L A;  2MQH A;  4JBW A;  1NY4 A;  2OQK A;  3SGI A;  5LMN L;  4GNX C;  1Q7Y C;  1OXX K;  2Q2I A;  1IBL L;  3AFQ A;  1Z9F A;  4Y7N H;  4LFB L;  3HOX H;  1WYD A;  2UXD Q;  3EN2 A;  4B3M L;  1QVF A;  1NJI C;  2QGQ A;  1E1T A;  1PH1 A;  3RN2 A;  4FDB A;  4LUZ A;  3W5O A;  4JI1 L;  1ASY A;  1I3Q H;  5GRO A;  2JA8 H;  2ZTD A;  2AWN A;  1X3G A;  3KDF B;  5IYB H;  4EX5 A;  4DR1 Q;  4DR3 Q;  4B3T L;  4DV3 L;  4DK3 C;  1IYJ B;  3BU2 A;  1YHQ A;  3RNU A;  4KHP L;  3HOV H;  4UP8 A;  1VQE A;  4KHZ A;  4DR6 L;  3I7F A;  1SR3 A;  1HR0 Q;  1OXS C;  1PH4 A;  1NTG A;  4GN3 B;  1PVO A;  2R7F A;  1JJG A;  3CCU A;  1JT8 A;  1R9T H;  4R1J A;  2BA1 A;  4DR5 Q;  2RCN A;  3CC2 A;  2QA4 A;  4IOC A;  3ULL A;  1JJC B;  1PH3 A;  3M3Y H;  3EBE A;  3K7A H;  5C44 G;  4X64 Q;  1FJG L;  1WJJ A;  4ALP A;  3MEF A;  4L5R C;  1O7I A;  1KAW A;  4IPD A;  4IPC A;  4JOI C;  4X66 Q;  4A75 A;  1PFS A;  4P74 A;  2UXC L;  4R4I A;  2Z0S A;  1NMF A;  1X3F A;  5C44 H;  1KQS A;  2HT1 A;  1RIP A;  2E5L Q;  1VQC A;  3CC4 A;  3CXC A;  1J5E Q;  3TRZ A;  4A3C G;  3D31 A;  3HFZ B;  3TQY A;  1LM0 A;  1NMG A;  3GTQ H;  4BBR G;  3ERS X;  1X9N A;  4BY1 G;  1XNQ Q;  4A3C H;  4X65 Q;  4DR7 Q;  2LXJ A;  5GAH C;  4DV5 L;  1VQB A;  2VY3 A;  2Y0S E;  1MJC A;  3E0E A;  3FKI G;  1C7Y A;  2UXB Q;  4B3S L;  1YHA A;  4IPG A;  4MNO A;  2JE6 I;  1GM5 A;  4BY1 H;  4HJ5 A;  4LF8 Q;  3RR5 A;  1IBK L;  4JI7 Q;  3CMA A;  3CCM A;  5LMU L;  4DV0 Q;  3RZO H;  2VQF Q;  1YJN A;  4A3B G;  2OQ0 A;  1A0I A;  2JA7 G;  3CME A; 
#chains in the Genus database with same CATH topology
 5IOC A;  1VQK A;  1PFB A;  1HZA A;  1BCP C;  1T5X D;  4CJ0 B;  3MC0 B;  1X3Q A;  1NE3 A;  5EPJ A;  1H9R A;  5C5M A;  3J7Y W;  1STG A;  5GAD C;  3HOU H;  2Z4H A;  2NWG A;  1GHK A;  3H94 A;  1PH2 A;  2KEC A;  2F0T A;  1B3Q A;  1MIU A;  3M4Y A;  3ICE A;  3ZJY C;  1RCV D;  1JOR A;  3EFX D;  1UWV A;  3LWE A;  3OW2 A;  1LTS D;  5LMN W;  1Q8I A;  4ZCK A;  1PH7 A;  3TN2 A;  5T1G A;  3PF4 A;  2O4X A;  1JMC A;  1TWH H;  4DV1 Q;  3TZD A;  4AQY Q;  1WTR A;  5DNF A;  3GDE A;  1GUG A;  2F0I A;  2PQA A;  1VQJ A;  4HJ9 A;  4LFC L;  2VW9 A;  1VQ6 A;  1U4R A;  4JI8 L;  3K5L A;  2EJM A;  2MJ8 A;  4P71 A;  5JJK A;  4C3J B;  2UUC L;  1XJV A;  5G3L F;  5C3E G;  3IFD A;  2CQO A;  2XWJ B;  5CC4 A;  4ZKB B;  1KDC A;  2NTT A;  3K81 C;  1EIH A;  3HKS A;  1VQ4 A;  3CCV A;  2R7Z B;  4XDX A;  4DK1 A;  3NWT A;  1HCZ A;  3EVQ A;  2XVS A;  3SDZ A;  3CCS A;  1L2F A;  1LV9 A;  1O7L A;  2VUM B;  4K2L A;  3HOW B;  1TVX A;  1YHB A;  2RSO A;  1QVG A;  3GTP H;  4JI3 L;  1A62 A;  2MGS A;  1BOS A;  1WOC A;  4XT1 B;  3T1H L;  5D65 A;  2CWA A;  3L7Z C;  1WTH A;  3E3X A;  3KOJ A;  4IPH A;  2JK8 A;  5FO9 B;  2NVT H;  4A3I G;  2NVY H;  2L55 A;  3BG3 A;  4LF4 Q;  1EY6 A;  2IW3 A;  1JR0 D;  1B9M A;  1SMX A;  1JWU D;  4C2M H;  1Q82 C;  4NXM L;  1S5F D;  4AIM A;  4S3S A;  3SVM A;  5D14 A;  2KCT A;  4B9X A;  4X62 L;  1K8G A;  2A19 A;  4K14 A;  2K14 A;  3QO2 A;  1HNX L;  4JI6 L;  3O13 A;  1QIL A;  3M85 A;  1SRO A;  3OYY A;  4A3E H;  2LFN A;  1K9M C;  1I5F A;  3TS0 A;  2JA8 B;  1MGS A;  2KHJ A;  4BBR H;  4ZKC B;  3T1Y L;  3VYU A;  3S16 H;  3DM3 A;  2PPB C;  1CKM A;  5JOB A;  1CI3 M;  1D1I A;  2EJF C;  1YIT A;  2JXM B;  2K5V A;  5M5Y H;  3PV0 A;  1ROD A;  1CA6 A;  3K7A B;  2IJ0 A;  1D5M C;  3A74 A;  4LF6 L;  1EU4 A;  4DV7 L;  4A3B H;  1SE2 A;  3BDC A;  1Q46 A;  5C44 B;  2FXQ A;  1SNQ A;  1IW7 D;  1QOH A;  5IYD G;  4B9W A;  4OHJ A;  1CTM A;  2R6G A;  5CV9 A;  1KRT A;  1CT1 D;  2EY2 A;  2UXD L;  1PH8 A;  4AYB B;  4HCE A;  2RDH A;  4DR1 L;  1PRT C;  2N55 A;  4HIO A;  2Q8T A;  2KCM A;  3F2C A;  3SK4 A;  5M5X H;  5M3M H;  4AH6 A;  1IL2 A;  4C3J G;  1E22 A;  4DR5 L;  4LAA A;  3UDF A;  3BZD B;  4OWW B;  5CBE E;  4KHP Q;  1X3P A;  5I9P A;  2NVX H;  2R7Z G;  2F1M A;  2YTY A;  1X32 A;  4MIU A;  2YTX A;  3S24 A;  4DA2 A;  4LFA L;  2E5L L;  2PQE A;  1AN8 A;  1SMY C;  1STB A;  2VUM G;  1KL9 A;  2ASB A;  3S9W A;  3A7A B;  3HOW G;  5TSS A;  1Y8P B;  3E9I A;  1V1P A;  3U50 C;  1BO0 A;  2K03 A;  1U9R A;  3DWA A;  3S1M B;  3ND9 A;  1K73 C;  5CGK A;  1RD9 D;  2R92 B;  3CHB D;  1DD2 A;  2X6L A;  4JI2 L;  4V19 0;  3NUC A;  4RG1 A;  4ID6 A;  4OO1 H;  2EYP A;  3PO3 H;  2VQF L;  2C35 B;  3RLN A;  4CKC A;  2CQA A;  4MZ9 A;  4GOP C;  1PZJ D;  1MI2 A;  3OIP A;  2E2J H;  1JWM D;  1I4G A;  3C1F A;  1IBK Q;  3CW2 C;  4KLK A;  1Y1W H;  2RBM A;  1IXR A;  3AMU A;  1PXU A;  1KLG D;  4M1U B;  4FVM A;  4XXE A;  2KVM A;  1FGU A;  3PQI A;  1L1O C;  4K6L A;  1HH2 P;  1T9H A;  2IT1 A;  2BCO A;  3Q0A A;  3UE1 A;  5JEA G;  2B2V C;  3S14 B;  1LO5 D;  1X55 A;  1F2M A;  1EY0 A;  2SNM A;  4LK1 C;  1ONL A;  5M5W H;  1L0W A;  4WFN 3;  1PMR A;  2JA8 G;  5IYB G;  1ZYR C;  4CHT B;  2K28 A;  3HG9 A;  2WFW A;  4HSV A;  4PZ8 A;  4JI5 L;  4DPG A;  4RGT A;  1QUQ A;  2DUD A;  2EPB A;  1EY7 A;  2HQE A;  1N33 Q;  4K5X A;  1X65 A;  5A2Q E;  2CW0 D;  2J0T D;  2UUA L;  1G2S A;  4QL5 A;  1PTO F;  1IBM L;  1YNJ C;  3HRZ C;  4POG A;  2LY7 A;  1QJO A;  4P72 A;  2NVT B;  3MXG A;  4AYB G;  1VDZ A;  5C0X J;  1YNX A;  3AFP A;  1STY A;  2HDM A;  3PMF A;  3TS2 A;  4HMI A;  1VS0 A;  1D5Z C;  3I4L A;  1NNX A;  1FNW A;  2Z6K C;  4A93 H;  5FJ8 G;  1QZG A;  1ZEQ X;  2KUM A;  1EQQ A;  2E2D C;  1HQM C;  3GTQ B;  2EXZ A;  4YHH Q;  2I5L X;  4BBS H;  1LYL A;  4DV2 Q;  4YY3 Q;  4X3T A;  5FLM H;  4X6A H;  1HA5 A;  1MD2 D;  3E6Z X;  2K05 A;  1TY0 A;  2F03 A;  1EIF A;  3BYT B;  3R2I A;  4BBR B;  5I2Y A;  3EQL C;  4DV6 Q;  3BDO A;  4BY1 B;  3I4M H;  4C1N I;  5EKI A;  3S16 B;  1GUW A;  4JK1 C;  2KCN A;  3ND8 A;  3NXW A;  3DHQ A;  3TME A;  4GKK Q;  2C9O A;  3K7U C;  2EYF A;  1QNK A;  3J7A 5;  1N36 Q;  1S5E D;  3DLL A;  3TSS A;  5FLX c;  3T53 B;  3TDQ A;  1VQG A;  2PI2 E;  2K01 A;  4J15 A;  2R92 G;  1AEX A;  1JOO A;  2M9V A;  4LF9 Q;  4A3B B;  3MAQ A;  2N49 A;  2JA7 B;  1GVP A;  1L1O B;  1XPU A;  2MFI A;  4BXX G;  4JOI A;  2D2C C;  4OWT B;  1Q81 C;  4HMJ A;  3PGZ A;  2JP1 A;  2WP8 J;  2BE5 D;  4Y52 H;  4GN4 B;  4BA2 I;  5IYC G;  1FNV A;  2ZT9 C;  3A5Z B;  3BS1 A;  2XTI A;  3D4W A;  3VYT A;  4CDC C;  2PCF B;  5M3M B;  4FF4 A;  1I4P A;  3GO5 A;  2JA5 H;  2XRQ D;  2Z9H A;  5C4H A;  3I56 A;  2ZJQ A;  4PQX A;  4NW2 A;  3ERQ A;  2F0U A;  2A5H A;  3OTO Q;  4MHE A;  3BVG A;  4HIK A;  1IKL A;  1HNW Q;  3I90 A;  2NVX B;  2EYJ A;  1IZ6 A;  4KK7 A;  1E1O A;  1EY8 A;  4PZ7 A;  4DNI A;  2O5I C;  4OIK A;  3S2D B;  2OTL A;  1NBW A;  1FD7 D;  4RMF A;  2F0H A;  4YIJ A;  1Q1E A;  1Q8K A;  2EZV A;  2MQH A;  1B53 A;  3OOC A;  2OQK A;  3SGI A;  1H9J A;  5C3X A;  1Q7Y C;  2E74 C;  2I07 B;  3AFQ A;  1WYD A;  1SYF A;  4B3M L;  1ICF B;  1NJI C;  1ASY A;  2RVL A;  4JI1 L;  1WVL A;  5D3D A;  1K8O A;  3VR4 A;  2MP1 A;  2BDN A;  3R2T A;  4N8X 1;  4DK3 C;  1YHQ A;  4DGZ A;  4DR6 L;  1L0Y B;  2E2J B;  1PH4 A;  1NTG A;  2R7F A;  3CCU A;  1Y1W B;  1TS5 A;  3CC2 A;  4UHV A;  2L5T A;  2SNS A;  4CDE C;  1EEI D;  1FJG L;  2CH4 A;  4IPD A;  1I6V C;  4IPC A;  5KND A;  5EPL A;  1JWS D;  1QG7 A;  2Z0S A;  3EJI A;  2EY1 A;  4H0L C;  3CC4 A;  1G91 A;  5M5W B;  3TQY A;  4BBR G;  3RUZ A;  4ZUJ A;  4BY1 G;  3WOE A;  5C4J B;  1XNQ Q;  4A3C H;  4X65 Q;  2LXJ A;  2DN8 A;  1VQB A;  5HUR A;  2UXB Q;  2A6H D;  4JI7 Q;  4K5V A;  3CCM A;  4K5W A;  1PRT D;  5LMU L;  4DV0 Q;  3RZO H;  3SK8 A;  5EKL A;  4OX9 L;  4QIW E;  4A3B G;  2JA7 G;  1TWA B;  1DON A;  4J8Q A;  1SYB A;  4F7X A;  1W3S A;  2RHQ B;  3A8I E;  2EY6 A;  4NXN L;  3S15 H;  5IWA L;  3H3V H;  2VB3 X;  3I4N H;  1L1O A;  4DFA A;  2K5D A;  3OHX C;  5M3F H;  1GD7 A;  3MXN B;  4DR4 L;  4JG2 A;  3H6M A;  3KYH C;  3RD4 A;  4WOR A;  5C6A A;  5M3M G;  1CK1 A;  1VQI A;  5J39 A;  2OWO A;  1K3B C;  1V43 A;  2BDO A;  2KBN A;  1SFO B;  4QUC A;  2F3I A;  5EJW A;  4A93 B;  1C0A A;  1IBL Q;  2J4X A;  4PMW A;  3K58 A;  1EYG A;  1E2Z A;  3CRL C;  2HD3 A;  3NTH A;  3H0G B;  1E24 A;  1GHJ A;  1UNS A;  2P5Z X;  3OSO A;  4DF7 A;  4OEL B;  5EPK A;  2D0P A;  4DXG A;  3FPP A;  2ATW A;  3CPW A;  1EFW A;  3PUX A;  4GKJ Q;  4LMQ D;  5HGT A;  1BXT A;  2YV5 A;  4N9P A;  1UE1 A;  1F2Z A;  1P8L A;  1PTO H;  4KD3 A;  4JI0 L;  1A8V A;  2F52 A;  1HJP A;  4RGO S;  5IGE A;  1S3O A;  4QY7 A;  2UU9 Q;  1KDA A;  5KYI A;  2PO4 A;  2WAQ E;  4OO1 G;  5KNB A;  1LUZ A;  3GTM B;  3KUP A;  3I73 A;  1B70 B;  2JJQ A;  1V9P A;  5ELC A;  1XMO L;  3VA5 A;  5I9O A;  5IIF A;  2NN6 H;  2SEB D;  4QF4 A;  5LL6 S;  2CHB D;  3W1B A;  1MSG A;  4DV5 Q;  4A3F B;  2K5W A;  3S2H B;  1ZYR D;  5IT9 c;  1Y1W G;  1JCK B;  4B3S Q;  1VQ8 A;  1U4L A;  4JI4 Q;  4APV A;  1XMQ L;  2JA5 B;  3FRP B;  2RQX A;  1N34 L;  4RFB A;  2G9D A;  2MO1 A;  3QR8 A;  1VQ7 A;  1KTK A;  3PIP 3;  3CCQ A;  1PDQ A;  1NSN S;  1LAC A;  1KDB A;  4EVO A;  4R8I A;  3OMG A;  3S1Q B;  1CZG A;  4B3R Q;  3P75 A;  4R4O A;  3Q24 A;  1ET6 A;  1YNJ D;  1EWH A;  4HR7 B;  2ZM6 L;  1F9S A;  5K36 H;  2IX1 A;  4A3L G;  1VQD A;  1OO9 B;  3J80 L;  2E2I H;  3Q23 A;  4G7O C;  3CQZ H;  3I8Z A;  1DM0 B;  3K6O A;  1B7Y B;  4IJL A;  3ZYY X;  3JAM c;  2PI2 A;  4HIM A;  3PUY A;  4C3H H;  4HJ7 A;  2LMC B;  1K83 H;  2XGT A;  3CAM A;  5HGQ A;  2ZJP A;  1BUV T;  2NB0 A;  1PTO C;  2Q2T A;  2Z4I A;  4DAV A;  5BN5 A;  2EQS A;  1G51 A;  1N32 L;  2L0C A;  4C3I H;  3MWY W;  5DM7 3;  2L15 A;  1OXU A;  1H9S A;  1YEZ A;  3NBH B;  4UAI A;  5NUC A;  4PG3 A;  3A55 A;  1CKN B;  1SXT A;  3QOL A;  3CU7 A;  3MXN A;  1XXG A;  4A93 G;  3CD6 A;  5IP9 H;  3U58 A;  2PW5 A;  3H0G G;  3HEJ A;  2A1A A;  2EYH A;  4RGM A;  4R4Q A;  3F2D A;  1E2V A;  1I4R A;  5FLM G;  2RDF A;  3NK9 A;  1F9Q A;  4DUZ L;  2ZTE A;  1GJX A;  5DLQ E;  3J7A F;  4XT3 B;  4DR3 L;  1VMC A;  2LXK A;  1MBY A;  1UEB A;  4ILW A;  1SE4 A;  2GN5 A;  3I70 A;  3S1N H;  1HR0 L;  3R3O A;  1K3R A;  2G5D A;  4KI0 A;  4A3J H;  4DUY L;  4L5Q A;  4GNX B;  3FEW X;  1BR9 A;  2WAQ B;  5ELB A;  1XTC D;  3J81 c;  1SYC A;  2RHS B;  4B3T Q;  1PZI D;  2B2Y C;  4O2D A;  4CGY B;  1Q1B A;  1EIG A;  3DUZ A;  3I4N B;  4IUR A;  4DK6 C;  5G3L D;  1X54 A;  2DY7 A;  4A3F G;  4EQO A;  3CP0 A;  5JJI A;  5CBA E;  4A3G H;  3J81 j;  3TBI B;  4JCV E;  2R3Z A;  1JB3 A;  5COR A;  4NXM Q;  1HTP A;  3RLO A;  2NVQ H;  2NZO A;  4DR7 L;  2OT2 A;  4GLV B;  1VQN A;  1SDF A;  3HOY H;  5KYL A;  3E9H A;  3RZD H;  2YYZ A;  4A3D H;  2TMP A;  4ZUI A;  3UE0 A;  4LF8 L;  1ML0 D;  1KAA A;  1B50 A;  5C4X H;  1V1P B;  1HRJ A;  4RWS C;  4O0A A;  2Z1C A;  1SBB B;  1XWE A;  2D62 A;  1SEB D;  5J3B A;  2CCZ A;  3BZC A;  2ES2 A;  3T1Y Q;  1TS2 A;  2FFK B;  4A3K B;  2F0D A;  2ZXP A;  4CJ2 C;  3T56 B;  4ZQ3 A;  2YTV A;  3EA6 A;  1RF2 D;  2NZH A;  1AW7 A;  1EQR A;  3S17 H;  3D4D A;  1B8A A;  2R93 H;  2B63 H;  2A6E D;  1RTN A;  3E0J A;  1JJ2 A;  4DV7 Q;  2NTS A;  5AJ3 Q;  2JSO A;  3FPU B;  4K8J A;  3D8G A;  2K50 A;  2F4V L;  1BCP B;  1UE5 A;  5IGG A;  4L5T A;  1X56 A;  4P2C B;  1EWI A;  1WI5 A;  4RKB A;  4KTA A;  4DV1 L;  3NEM A;  4TKO B;  3NTI A;  4AQY L;  4E6I A;  1SAP A;  1Z6H A;  1SE8 A;  4L8J A;  4Y7N B;  4JYA Q;  3HOX B;  1HR0 W;  1EOV A;  2JA6 H;  3NBH A;  5KGU A;  1QUQ B;  1O7Y A;  1CKN A;  1SJH D;  5J1Z A;  1KIX A;  1FGB D;  5E7N A;  4DXF A;  1GUO A;  3M3Y H;  4LFA Q;  1PV4 A;  3CPF A;  5T1I A;  2E2H H;  2IY5 B;  2VQE L;  1AE2 A;  1SNO A;  1TQO A;  1FNU A;  2AUK A;  2A68 C;  3VYS A;  1HNZ Q;  5CR3 A;  1I6H H;  4I7A A;  4H13 C;  1CSP A;  4P73 A;  3CQZ B;  4UP9 A;  2B2W A;  4Z9C B;  1EQT A;  3NSW A;  3L2P A;  2WAQ G;  4XQJ A;  2OTJ A;  2VNU D;  4JI2 Q;  4A4I A;  1WD1 A;  3FMC A;  2XSC A;  4H44 C;  4FYD A;  2D9U A;  1SRU A;  4MTK A;  1VF7 A;  4C3H B;  4XQQ A;  4GNX A;  3PO2 H;  1K83 B;  4JW0 A;  3KF8 B;  3I4N G;  2JA9 A;  4BY7 H;  3K0Y A;  4RHS A;  1SE3 A;  1KD1 C;  3HKZ E;  1F2Y A;  4IJH A;  2ICI A;  5EAY A;  5FKA C;  1VQF A;  3FP9 A;  4C3I B;  1Q3L A;  3HOZ H;  1QVC A;  2L11 A;  3V2T A;  1KAB A;  4IUU A;  4LF4 L;  3K5N A;  2B2U C;  5ELO A;  4UY8 C;  3W2D A;  2A74 C;  1G8Z D;  3MZ5 A;  4OO1 I;  2KEN A;  5E1F A;  3GTJ H;  2QW7 A;  2H4O A;  3A54 A;  1LTA D;  4TQU S;  4IFD G;  1DGS A;  1A2T A;  5GAE C;  4NB3 A;  1QCB D;  2DNE A;  1BDO A;  3HOU B;  2KOL A;  4A3K G;  2F0O A;  5IOD A;  3UI2 A;  3RN5 A;  1SND A;  5IGB A;  4HN7 A;  2ICE C;  2WIN B;  5CV8 A;  4XIG S;  2VB2 X;  4XYQ A;  5EGT A;  3TRE A;  3CC7 A;  1C48 A;  1TWH B;  5EBD A;  2KCC A;  4KMU C;  2Q8I B;  3PUV A;  2K32 A;  3H15 A;  1Y69 U;  1V1Q A;  4HJ8 A;  1NCV A;  1TS3 A;  1WCM H;  2QF7 A;  5DEH A;  2UUA Q;  3A5U A;  1IBM Q;  4I65 A;  3F2U A;  2FMC A;  1TU2 B;  1XNR Q;  2NN6 G;  3J80 i;  2MNA A;  1I4H A;  1FVI A;  3NTK A;  5JAV A;  2HHH Q;  2BA0 A;  2HIV A;  4DV4 Q;  1SJE D;  4R4C A;  3HOX G;  1D8L A;  1IKM A;  3C2P A;  1NY4 A;  1STA A;  2F3V A;  3HOY B;  1G6Z A;  1Z9F A;  3KK7 A;  3Q22 A;  3EN2 A;  1QVF A;  2QGQ A;  1SYD A;  1LLR D;  2ZTD A;  2AWN A;  1X3G A;  3KDF B;  4H7B A;  1W6K A;  3MHB A;  4DN4 M;  1IYJ B;  4KHP L;  3HOV H;  1VQE A;  4KHZ A;  1S4Z A;  3GTP B;  4EQP A;  1WTQ A;  1PTO D;  1PRT B;  1R9T H;  3ULL A;  3MEH A;  5C44 G;  4X64 Q;  1HUN A;  1EY5 A;  1WJJ A;  3MEF A;  4IUN A;  1KAW A;  4X66 Q;  4A75 A;  1PFS A;  4P74 A;  2UXC L;  3SR1 A;  3P1H A;  2HT1 A;  1RIP A;  2NVY B;  1EYA A;  1J5E Q;  4C3H G;  1BCP D;  1LM0 A;  1CM9 A;  4IN3 A;  5D3I B;  1X9N A;  3HKZ B;  4C2M B;  2B2T C;  4C3I G;  2QEJ C;  1SNC A;  5GAH C;  1PYW D;  3E0E A;  1MJC A;  4IUV A;  3SHL A;  3KF8 A;  1PLF A;  1HXY D;  2JE6 I;  1BF4 A;  1A3T A;  1J9O A;  3OWF A;  3QG1 A;  3RR5 A;  1IBK L;  3OMC A;  5COY A;  2ZXO A;  1PFM A;  2QKI C;  3TP6 A;  1A0I A;  4A3E B;  1E7Z A;  3PUW A;  3KLS X;  1IYU A;  2Q2U A;  3QWN A;  2UUB Q;  2QIL A;  4QCL A;  4FP5 D;  4O1N A;  2QDB A;  3HOU G;  4DAM A;  4DR2 Q;  4GOP B;  1T5E A;  4A3M H;  5M5Y B;  1II3 A;  4DNT B;  1JQY D;  2I5H A;  2XRS D;  4DAY A;  1B4O A;  3UDG A;  4QQB X;  4FF2 A;  3PCO B;  1LTG D;  2WAC A;  3KLS A;  1N33 L;  4ME5 A;  4QUF A;  4GLA C;  4RKL A;  2R61 A;  1LTI D;  1STN A;  4MN3 A;  2ALY B;  1VQ9 A;  3GTO H;  5JEA J;  3KLR A;  5M5X B;  1HZB A;  2L9H A;  1GO3 E;  4OWX B;  3NEL A;  4UPA A;  2F0P A;  5KRU A;  2BH8 A;  4C1N K;  5IGC A;  4HID A;  3HOY G;  3SK6 A;  1HZ9 A;  1TKW B;  1IYV A;  2PYK A;  4WJ4 A;  3C3L A;  2WB1 E;  2EY5 A;  1P16 A;  4HAE A;  2VXW A;  4N9T A;  3T51 B;  2F0W A;  1QB5 D;  1R4P B;  3BZK A;  1TWF H;  2N78 A;  3PIP A;  3J80 E;  1PH6 A;  4DV2 L;  1RKN A;  3D6W A;  5EBC A;  5FLX L;  5FK9 C;  3KDF A;  1J6Q A;  3STB C;  4DV6 L;  3PIO 3;  3HP3 A;  3M9B A;  5BR8 L;  3PSI A;  1EZ8 A;  2BH2 A;  3VYR A;  2DY8 A;  3PO3 B;  3N6R A;  2RDG A;  1C4Q A;  1UE6 A;  4CDD C;  4GKK L;  5IY0 A;  3WOF A;  4X3S A;  1IL8 A;  4OL7 A;  3P20 A;  4NKL A;  1DJR D;  1EWC A;  1YBY A;  4LF9 L;  1KNA A;  5JPN C;  1D7Q A;  5EQ0 A;  3HKZ G;  4LF7 Q;  2I5M X;  2J7Z A;  4KJN A;  2ZJR A;  2EYO A;  1WTO A;  1V8Q A;  1AFP A;  1NR2 A;  2A73 B;  3GTG H;  1YJW A;  3AYH B;  5DAU A;  2PMZ E;  2A68 D;  1AE3 A;  1LT5 D;  4A3E G;  5LL6 X;  2MO0 A;  3G7L A;  2SOB A;  4JBJ A;  3NQT A;  4POF A;  1V1O A;  1U0L A;  2X69 A;  4LWC A;  1E2W A;  3OTO L;  3DEP A;  1HNW L;  3HOV B;  5AFW A;  3QOJ A;  3WWV A;  4CKE A;  3FKI H;  4YWM A;  1F2L A;  1D6E C;  1R9T B;  1I94 Q;  1PYS B;  2WKC A;  4GOP A;  3GQB A;  3AU7 A;  1ZKO A;  2ZTC A;  4IFD I;  1H9S B;  5FOB B;  1DOL A;  4DAP A;  2AMC B;  3MFG A;  3Q6S A;  2B2V A;  5JVH 3;  2KJX A;  4C56 C;  4K0K Q;  3FVQ A;  1CKO A;  3GP7 A;  5IYD H;  3D0F A;  1SMY D;  2IX0 A;  2GVA A;  2CH4 W;  5IE8 A;  5LMN Q;  1VQO A;  3NBI A;  4K2K A;  4R9W A;  4LFB Q;  2JQO A;  5CV7 A;  4WJW A;  2KED A;  3I4O A;  1F9P A;  3IL8 A;  4BBS B;  5C0X H;  2WB1 B;  1YNN C;  1Y8N B;  3GV6 A;  4PV1 C;  2E76 C;  3HS0 C;  4U68 A;  1NR4 A;  3RLF A;  4DV3 Q;  4WJ3 M;  4C3J H;  5BN4 A;  2NN6 I;  3I4M B;  3J7A V;  4U67 3;  4I7Z C;  3BVZ A;  4KV6 A;  1EUJ A;  1S72 A;  2R7Z H;  4BWG B;  4TVA B;  3N52 A;  4UDU C;  4A3M B;  3S1R H;  4LF5 L;  4NDX A;  1WFQ A;  1EYC A;  1TXY A;  4KN4 C;  1XNQ L;  4X65 L;  2YU9 H;  2AQ1 B;  5GAG C;  2K5H A;  3PO3 G;  4HSP A;  2C5C A;  2KA7 A;  4B08 A;  1DCZ A;  3CCL A;  4JV5 L;  1M4V A;  3URY A;  3JC6 6;  1E3P A;  4JI7 L;  1Y14 B;  2B2T A;  3I55 A;  4DV0 L;  3QJY A;  1WTX A;  2Z6K A;  1SNP A;  2OEO A;  3IAY A;  1Y1V H;  1W2B A;  3BDL A;  1CFM A;  1TII D;  1KXL A;  4M8A A;  5E3F A;  3CF5 A;  4KHV A;  1Z7T A;  1Y8O B;  4RCO A;  4J1M A;  2PMZ B;  1I50 H;  2IWH A;  3VR3 A;  2TSS A;  1K8M A;  2B39 A;  1CHQ D;  5JEA H;  4YWL A;  2CKZ B;  5IP7 H;  4V0B A;  1TWG H;  4YCV A;  4JPB W;  1KC8 C;  4DUZ Q;  3G71 A;  3T16 A;  1QZH A;  1EFI D;  3HOV G;  4YCW A;  3L3O C;  3GTL H;  5A35 A;  3T4A C;  1HFG A;  4QIW B;  1L0X B;  1RTO A;  1ICW A;  4GKJ L;  1B9N A;  3NHH A;  3WDN A;  1EY4 A;  3I91 A;  4DUY Q;  4G7Z C;  1CA5 A;  1H9M A;  1MHW C;  2UU9 L;  1K28 A;  4IQZ A;  4KD4 A;  2AQ2 B;  3OPO A;  4FNF A;  3MFY A;  5IT9 L;  5KIX A;  4LFC Q;  3CCE A;  3I2Z A;  1LAB A;  4JI8 Q;  4H02 A;  1A3U A;  2HCC A;  2O2L D;  1BNZ A;  3NQI A;  2UUC Q;  2K04 A;  3GTG B;  3B6Y A;  3J7Z C;  1DXM A;  5KNC A;  4BBS G;  1KRS A;  2WB1 G;  4JBM A;  2XWB B;  3X3M A;  3TP5 A;  3DMU A;  4GS3 A;  4JI4 L;  3VR5 A;  1ILQ A;  1N9W A;  5FJ8 H;  4A76 A;  4JBK A;  3I4M G;  2FIN B;  2H5X A;  1G29 1;  5ELN A;  5KEE A;  3NWS A;  2AUJ D;  4Q5V A;  4NMZ A;  4A3M G;  4JI3 Q;  1VQP A;  3MA2 B;  3FKI B;  1F77 A;  3SEB A;  3OIQ A;  3RZO B;  4ME3 A;  3JAM L;  4B3R L;  1ET9 A;  1QWY A;  3T1H Q;  1TWC H;  1XPR A;  1SYG A;  5FO7 B;  1GKH A;  1JB7 A;  2NBF A;  1HUM A;  1PH5 A;  2F0N A;  3S15 B;  2A69 C;  4XTC S;  3S1M H;  2R92 H;  2F4V Q;  3HZX A;  1TS4 A;  1EZ6 A;  2HUG A;  5M3F B;  1LT6 D;  1SSO A;  3T13 A;  1LTB D;  4BXX H;  1K0S A;  3IKJ A;  2GA4 B;  2X6G A;  4X62 Q;  2JA5 G;  2JEA I;  4ULL A;  2L4N A;  5CV5 A;  1I4X A;  5IYC H;  3PUZ A;  4AYB E;  1HNX Q;  3BVM A;  4JI6 Q;  1BBU A;  4CBV A;  2D0O A;  1TR5 A;  3STB D;  4FXK C;  3D6C A;  3BYY B;  4RA8 A;  5IGF A;  5JJL A;  2H1E A;  1D2B A;  4ZYS A;  3S14 H;  1GUN A;  3ULP A;  1SN8 A;  1PTO B;  2KEE A;  1MKH A;  2BE5 C;  2MHV A;  3VR2 A;  3G4S A;  2VQE Q;  4RAU C;  3S1R B;  1MJE A;  2VZA A;  4QB4 A;  4K6D A;  2EIF A;  4LF6 Q;  1LTR D;  3VDY A;  1HFN A;  3J81 L;  2YU9 B;  1Z47 A;  2K5Q A;  3R93 A;  1OXX K;  1WTP A;  2KHS A;  5LHY 1;  1DYQ A;  2M00 A;  2UXD Q;  1WTV A;  3H09 A;  3SXH A;  5JPM C;  1PH1 A;  3RN2 A;  4LUZ A;  4DK0 A;  1I3Q H;  5E4X A;  5GRO A;  2FHT A;  3W3A A;  4DR1 Q;  1Y1V B;  4KY6 A;  4B3T L;  1A15 A;  2DNC A;  2MUY A;  4FO2 A;  3RNU A;  4IUP A;  4UP8 A;  1TY2 A;  3NP8 A;  4GN3 B;  2EOT A;  3DXJ C;  2EJG C;  4O42 A;  4R1J A;  2BA1 A;  4FXD A;  4DR5 Q;  1JIC A;  2NUC A;  2QA4 A;  3KBG A;  2F0S A;  1W6J A;  4L5R C;  1I50 B;  1O7I A;  4HTH A;  3CKI B;  4JOI C;  2EE1 A;  1RDP D;  1KQS A;  2XN9 C;  1GUT A;  1VQC A;  2E5L Q;  2V4D A;  3CXC A;  3TRZ A;  2MPM A;  4A3C G;  1O7Z A;  3GTQ H;  1NMG A;  1TWG B;  4ZRZ A;  4PMC A;  3ERS X;  1FR3 A;  4IUT A;  2E2I B;  2B8F A;  2Y0S E;  1C7Y A;  2F0V A;  3FKI G;  3GTL B;  3IFT A;  1YHA A;  4IPG A;  4MNO A;  4BY1 H;  4HJ5 A;  3CMA A;  1O78 A;  2D5D A;  1H9K A;  4ABN A;  2VQF Q;  1BBX C;  4WRD A;  2QCP X;  4G57 A;  5HY6 A;  1K8A C;  3ONA B;  4N8F A;  4IZ8 A;  4FF1 A;  2BOS A;  1LTL A;  1VCI A;  1YNN D;  3M4P A;  5M3F G;  1EU3 A;  4FF3 A;  5AJ3 L;  2JA7 H;  4JC0 A;  1CHP D;  2EVB A;  3V05 A;  1AP0 A;  3QIA A;  3FHW A;  4G7H C;  1B44 D;  2XIW A;  1VMP A;  1F9R A;  2K7V A;  2A6H C;  1VQH A;  2FMM A;  5C0X G;  1KHI A;  1M1K C;  2K5N A;  5FLX E;  4HCS A;  4JYA L;  4DAY B;  3UDI A;  5GQO A;  4QGU A;  1ESR A;  1QNU A;  4F87 A;  3KJO A;  4JI5 Q;  1M90 C;  2KHI A;  3G6J B;  1HA6 A;  3F1Z A;  5L37 A;  5BN3 A;  3C1E A;  3S1N B;  2OCE A;  4TRD A;  5I4D A;  2F0M A;  3E5S A;  4A3J B;  3S2D H;  3PIO A;  3ERO A;  1BBW A;  3DWQ A;  1YZ6 A;  1TWC B;  1HNZ L;  2F0L A;  1C8C A;  2DJF C;  1ENF A;  2A8V A;  1BKB A;  2UXC Q;  2Z6B A;  2IL8 A;  1E0B A;  1Q90 A;  3NEN A;  2K52 A;  4BA1 I;  3G6E A;  3QB3 A;  1Y1V G;  1UUP A;  4A3G B;  3TEH B;  1U5K A;  2B3G A;  4F8M A;  5DM6 3;  3F8T A;  2NVQ B;  1UEA B;  1LT3 D;  2RCF A;  1H95 A;  3LNN A;  1RL2 A;  3RZD B;  5J22 A;  3MTS A;  4A3D B;  4BS9 A;  4GN5 A;  2EDG A;  3I72 A;  2DGY A;  2JEB I;  4QJF A;  1G2T A;  5C4X B;  4P75 A;  1SLJ A;  1JC7 A;  3K0X A;  3D4R A;  4IUQ A;  1PA6 A;  2N8N A;  5CMD A;  5IP7 G;  2LKV A;  4J6H A;  5C3W A;  5ELF A;  3U9S A;  2PZW A;  2E8G A;  5M9O A;  1PHJ A;  1IHZ A;  5K36 G;  1ILP A;  1AH9 A;  2B2Y A;  2Y0S B;  3H91 A;  3KLW A;  5K5P A;  3S17 B;  4UP7 A;  2R93 B;  2M2L A;  2B63 B;  2F0J A;  5C4J H;  4XYO A;  4RCN A;  3UDX A;  3M4O H;  4A3L H;  2NYZ D;  1R4Q B;  2F4I A;  1XTD A;  3K57 A;  1VQA A;  2K1B A;  1EIY B;  2AHO B;  4LNQ A;  4PNY A;  3NPP A;  1ZXT A;  2SDF A;  1I3Q B;  1TWA H;  1JE4 A;  2F0F A;  3HGB A;  2F0E A;  2QEX A;  3GTK H;  2E75 C;  4DKA C;  3JAM i;  1JOQ A;  1PFN A;  1EYD A;  2ID0 A;  1XNR L;  4GZY C;  3LX0 A;  4IFD J;  2JA6 B;  4QMG A;  1YI2 A;  5IP9 G;  3KBX A;  2HHH L;  3ITP A;  1STE A;  5EKK A;  4LW1 A;  4DV4 L;  5I6Y A;  3PF5 A;  1CQV A;  3D3R A;  1SYE A;  1SFO H;  4HJA A;  2VS1 A;  1BCP F;  3M3Y B;  2E2H B;  3Q8D A;  3CCJ A;  2Q8R E;  4KKS A;  4YWK A;  5ISR A;  3H0G H;  1CZW A;  4KJO A;  2A69 D;  2IHE A;  1UE7 A;  3TZU A;  1I6H B;  1JE5 A;  3M7G A;  2K33 A;  3SK5 A;  3MXU A;  4A3J G;  1GXD C;  2K4K A;  3NE5 B;  1B3A A;  3OWE B;  3DEO A;  1A2U A;  4IO9 A;  2HIX A;  4OGQ C;  2K75 A;  5BR8 Q;  3BJU A;  2AQ3 B;  4B3M Q;  5C5L A;  3ER0 A;  1CSQ A;  2RKS A;  4JI1 Q;  1Q12 A;  3KF6 B;  1HHV A;  5C4Z A;  4L63 B;  4X64 L;  1XX8 A;  3M7N A;  1X3E A;  3F2B A;  3PO2 B;  3FDT A;  4BY7 B;  4X66 L;  2VL6 A;  4DR6 Q;  3GD7 A;  4A3G G;  3MVV A;  1BVS A;  3CRK C;  3HOZ B;  3GTM H;  1SNM A;  3J81 i;  1J5E L;  1KNE A;  4R4T A;  5FO8 B;  3A0J A;  1FJG Q;  1DOM A;  1QE6 A;  2WV6 D;  3K8A A;  4PMB A;  4A3D G;  4YCU A;  2AKW B;  2V1C C;  4A3F H;  3S2H H;  1B1Z A;  3GTJ B;  2IX3 A;  5I2X A;  5JJZ A;  2AWO A;  2G9H D;  5C4X G;  3LWU A;  3X3N A;  2R7D A;  5C3E H;  1LTT D;  4YHH L;  2L12 A;  1HPC A;  3EIV A;  4YY3 L;  4K8I A;  2GVB A;  1EOT A;  2LSS A;  1OTC A;  1PYB A;  2EYL A;  2Y0S G;  2B8G A;  2UUB L;  3L0O A;  1U4P A;  2R93 G;  2B63 G;  1S40 A;  2QDL A;  5LMU Q;  4DR2 L;  3S1Q H;  2CVR A;  4OX9 Q;  4G4K A;  1I4Q A;  1N36 L;  1GUS A;  1C9O A;  3G48 A;  3ULJ A;  5IT9 E;  5H1S E;  1WCM B;  3TP7 A;  4KY5 A;  4NXN Q;  1HZC A;  5IWA Q;  3L9A X;  3P7J A;  2O5J C;  2B2U A;  2PNH A;  1GOZ A;  4NP5 A;  2I46 A;  2RA4 A;  4A3I H;  1K0R A;  1X6O A;  5E4W C;  3I3C A;  5I6W A;  4DR4 Q;  2N3S A;  1A3V A;  1OXV A;  2N88 A;  2Q2H A;  3U4V A;  4CJ1 B;  1A6X A;  1DOK A;  2ZXR A;  2JA6 G;  1VQL A;  2K6A A;  1ASZ A;  4MTN A;  5F2D A;  1N8R C;  3LGJ A;  1VQM A;  2A6E C;  4L6T B;  3H3V I;  1EL0 A;  3U4Z A;  1FL0 A;  4CKB A;  5CV6 A;  3M4Q A;  2RSN A;  2F0G A;  1B2T A;  1CQF A;  2HQL A;  1PH9 A;  1ESF A;  3JAM E;  2XNA C;  3C46 A;  4ZAI A;  4JI0 Q;  1YVC A;  1OXT A;  1O80 A;  1UAP A;  3K59 A;  4IOA A;  2JYO A;  3V96 A;  3OW7 A;  4LF5 Q;  2RF4 A;  4R8N A;  1FYC A;  2CFM A;  1YIJ A;  1EQV A;  2EXD A;  4KN7 C;  5C0X I;  2NZ1 D;  2PW7 A;  4L5S A;  3R8B A;  1VF5 C;  3M4O B;  4JVZ A;  4JV5 Q;  1XMO Q;  1NUC A;  3AQQ A;  3PO2 G;  4BY7 G;  1EY9 A;  1D5X C;  1STH A;  5ELD A;  2KQ3 A;  4OON A;  3CCR A;  3KFU A;  1WD0 A;  3KF6 A;  3HOZ G;  3GTK B;  4GLX A;  2PZU A;  2ENB A;  5CYU A;  1PRT F;  5A2Q L;  1G6P A;  1DZ1 A;  1Q86 C;  2Z8L A;  5CV4 A;  1XMQ Q;  4LF7 L;  4OXP A;  1HTL D;  4ZK9 B;  2F3W A;  1N34 Q;  3K80 C;  1A63 A;  1IW7 C;  1EEF D;  3A56 A;  2DJG C;  3W1G A;  4KKT A;  4NPS A;  4TSS A;  2I0Q A;  1XYI A;  1XPO A;  1AZQ A;  2F0Q A;  1ENA A;  1HQR D;  4ODG A;  3CME A;  2JN4 A;  3J81 E;  4LUV A;  2ZM6 Q;  4RHR A;  2PZT A;  1WTW A;  2VUM H;  4IFD H;  4DNR B;  4ZLT F;  1AZP A;  4EQN A;  3HOW H;  1YJ9 A;  2UXB L;  2OF1 A;  4LJZ C;  4A3K H;  1WCM G;  1CUK A;  2B29 A;  1I94 L;  2IPK D;  4X3K A;  3J80 c;  1LT4 D;  1KLU D;  1RJT A;  3GV3 A;  1ENC A;  4OEM B;  3GTO B;  4RH6 A;  4EGV A;  4HED A;  1TT2 A;  4KY7 A;  1N32 Q;  2FJ2 A;  4RGN A;  4LUO A;  2PQA B;  4IAL A;  3AEV A;  1M8A A;  4PZ6 A;  2L1B A;  3U9O A;  4XQN A;  4DU9 A;  2IHF A;  3KJP A;  1MSH A;  3IRB A;  1U4M A;  4Q0F A;  2B2W C;  2WII B;  2CWP A;  4K0K L;  4EQ5 A;  2HCI A;  4F88 A;  1VQ5 A;  4JBW A;  4FXG C;  5LMN L;  4GNX C;  3SE0 A;  2Q2I A;  1IBL L;  3A8J E;  1TWF B;  3K5O A;  4Y7N H;  4LFB L;  3HOX H;  3K5M A;  4X3U A;  1J8I A;  2WKD A;  5ELE A;  5C3E B;  1E1T A;  4FDB A;  3W5O A;  2JA8 H;  1S5C D;  5IYB H;  4DR3 Q;  3H3V C;  4EX5 A;  3A8K E;  4DV3 L;  3BU2 A;  3A7L A;  2PNR C;  3VA7 A;  1S5D D;  1JOK A;  3I7F A;  1SR3 A;  1HR0 Q;  1OXS C;  3MXP A;  3AB9 A;  1RHP A;  1PVO A;  1JJG A;  4CDF C;  1JT8 A;  2RCN A;  4IOC A;  1JJC B;  1PH3 A;  3EBE A;  3K7A H;  2OXP A;  4ALP A;  2LS0 1;  4R4I A;  3VR6 A;  5IGD A;  1NMF A;  1X3F A;  5C44 H;  5JVG 3;  1PZK D;  3TP8 A;  3D31 A;  3HFZ B;  3DM1 A;  4A3I B;  1BQQ T;  4DR7 Q;  1S5B D;  4DV5 L;  2F0K A;  4OIJ A;  2VY3 A;  3RMH A;  4B3S L;  2HDL A;  1GM5 A;  2EYM A;  4LF8 Q;  2CW0 C;  1NAP A;  1YJN A;  2OQ0 A;  4KKU A;  1D1K A;  3DWP A; 
#chains in the Genus database with same CATH homology
 1E7Z A;  1VQK A;  3PUW A;  2Q2U A;  5HY6 A;  1K8A C;  1W3S A;  2RHQ B;  1HZA A;  2UUB Q;  4NXN L;  3S15 H;  3M4P A;  1LTL A;  1VCI A;  5IWA L;  5M3F G;  2JA7 H;  5AJ3 L;  3H3V H;  3HOU G;  4JC0 A;  4DAM A;  3I4N H;  1L1O A;  4DR2 Q;  3FHW A;  4GOP B;  1NE3 A;  4A3M H;  5M3F H;  5GAD C;  1GD7 A;  3MXN B;  3HOU H;  2I5H A;  4DR4 L;  4JG2 A;  1PH2 A;  1MIU A;  3KYH C;  5M3M G;  3UDG A;  3ICE A;  3ZJY C;  4QQB X;  1VQI A;  1VQH A;  3PCO B;  2OWO A;  1V43 A;  2KBN A;  1UWV A;  2F3I A;  5C0X G;  1KHI A;  1IBL Q;  1C0A A;  3OW2 A;  4PMW A;  5LMN W;  1PH7 A;  1M1K C;  2K5N A;  1EYG A;  1N33 L;  3PF4 A;  4JYA L;  4GLA C;  4DAY B;  1E24 A;  1JMC A;  1TWH H;  3UDI A;  5GQO A;  4DV1 Q;  4QGU A;  3KJO A;  2ALY B;  4AQY Q;  1VQ9 A;  4JI5 Q;  2D0P A;  3GTO H;  5JEA J;  1M90 C;  3GDE A;  2ATW A;  2KHI A;  3CPW A;  3F1Z A;  1EFW A;  3PUX A;  4GKJ Q;  1HZB A;  2PQA A;  1VQJ A;  1GO3 E;  2OCE A;  4OWX B;  4HJ9 A;  3NEL A;  4UPA A;  2YV5 A;  4LFC L;  1UE1 A;  1P8L A;  4JI0 L;  3S2D H;  1A8V A;  2VW9 A;  2BH8 A;  2F52 A;  3PIO A;  1HJP A;  1VQ6 A;  4JI8 L;  1BBW A;  1S3O A;  4QY7 A;  1YZ6 A;  4HID A;  2UU9 Q;  3HOY G;  1HZ9 A;  4P71 A;  1HNZ L;  5JJK A;  2UUC L;  1XJV A;  2A8V A;  1BKB A;  2UXC Q;  4WJ4 A;  2WB1 E;  5C3E G;  1P16 A;  2CQO A;  2WAQ E;  4OO1 G;  3NEN A;  2K52 A;  1LUZ A;  4BA1 I;  3K81 C;  3G6E A;  3HKS A;  3BZK A;  3CCV A;  2N78 A;  1TWF H;  1B70 B;  3PIP A;  1VQ4 A;  1Y1V G;  2JJQ A;  1V9P A;  1XMO L;  1PH6 A;  3TEH B;  4DV2 L;  1U5K A;  2B3G A;  3W1B A;  3CCS A;  3F8T A;  1L2F A;  4DV5 Q;  1H95 A;  3KDF A;  1J6Q A;  5IT9 c;  1Y1W G;  1RL2 A;  3STB C;  1YHB A;  4B3S Q;  4DV6 L;  1QVG A;  4GN5 A;  3GTP H;  3M9B A;  4JI3 L;  1VQ8 A;  2DGY A;  5BR8 L;  2JEB I;  1A62 A;  3PSI A;  4QJF A;  2BH2 A;  4JI4 Q;  4APV A;  1XMQ L;  4P75 A;  4GKK L;  1UE6 A;  1SLJ A;  5IY0 A;  3K0X A;  1WOC A;  1N34 L;  1PA6 A;  2N8N A;  3T1H L;  2CWA A;  3L7Z C;  2MO1 A;  3KOJ A;  5IP7 G;  1VQ7 A;  4IPH A;  1YBY A;  2JK8 A;  4LF9 L;  3CCQ A;  2NVT H;  2E8G A;  4A3I G;  1PHJ A;  2NVY H;  1D7Q A;  3HKZ G;  5K36 G;  4LF7 Q;  2I5M X;  4LF4 Q;  2ZJR A;  1AH9 A;  4B3R Q;  3KLW A;  4R4O A;  4UP7 A;  1SMX A;  2ZM6 L;  5C4J H;  4C2M H;  1Q82 C;  4NXM L;  1VQD A;  2IX1 A;  4AIM A;  3GTG H;  4A3L G;  2E2I H;  2KCT A;  3CQZ H;  1YJW A;  3AYH B;  4X62 L;  3UDX A;  1K8G A;  2A19 A;  1B7Y B;  2PMZ E;  4IJL A;  3M4O H;  4A3L H;  1AE3 A;  4A3E G;  3JAM c;  1XTD A;  2K14 A;  1HNX L;  1VQA A;  2PI2 A;  4HIM A;  1EIY B;  4JI6 L;  2AHO B;  2MO0 A;  4LNQ A;  3M85 A;  3PUY A;  1SRO A;  4C3H H;  4HJ7 A;  3OYY A;  4JBJ A;  4POF A;  4A3E H;  1U0L A;  1I5F A;  3TS0 A;  1K9M C;  1K83 H;  2XGT A;  1TWA H;  3CAM A;  2KHJ A;  4LWC A;  5HGQ A;  2QEX A;  4BBR H;  2ZJP A;  2Q2T A;  3GTK H;  4DKA C;  3OTO L;  3JAM i;  2EQS A;  1G51 A;  1N32 L;  1HNW L;  4C3I H;  3T1Y L;  2L15 A;  3DM3 A;  3WWV A;  3S16 H;  1CKM A;  3FKI H;  4YWM A;  2ID0 A;  1OXU A;  1XNR L;  3NBH B;  1YEZ A;  1YIT A;  1I94 Q;  4PG3 A;  4IFD J;  1PYS B;  4GOP A;  1YI2 A;  2K5V A;  5M5Y H;  5IP9 G;  1CKN B;  3PV0 A;  2HHH L;  3A74 A;  4LW1 A;  4DV4 L;  4LF6 L;  4A93 G;  4DV7 L;  3CD6 A;  4A3B H;  2ZTC A;  5IP9 H;  3U58 A;  3H0G G;  4IFD I;  4WJ3 M;  3PF5 A;  1Q46 A;  2A1A A;  1SFO H;  4HJA A;  2VS1 A;  2FXQ A;  3F2D A;  2AMC B;  4R4Q A;  5IYD G;  3Q8D A;  3CCJ A;  5FLM G;  2R6G A;  4YWK A;  3H0G H;  1KRT A;  2IHE A;  4K0K Q;  2UXD L;  4DUZ L;  1CKO A;  2ZTE A;  1PH8 A;  1UE7 A;  5DLQ E;  5IYD H;  3D0F A;  2IX0 A;  2GVA A;  1JE5 A;  4DR3 L;  4DR1 L;  2LXK A;  4HIO A;  1UEB A;  5IE8 A;  2K4K A;  5LMN Q;  4A3J G;  2KCM A;  3F2C A;  1VQO A;  2GN5 A;  5M5X H;  3S1N H;  5M3M H;  4IO9 A;  2HIX A;  2JQO A;  1HR0 L;  4AH6 A;  4LFB Q;  1K3R A;  2K75 A;  5BR8 Q;  3BJU A;  4KI0 A;  3I4O A;  4A3J H;  4DUY L;  4L5Q A;  4B3M Q;  3ER0 A;  1IL2 A;  1CSQ A;  1E22 A;  4DR5 L;  4JI1 Q;  4GNX B;  1Q12 A;  3KF6 B;  2NVQ H;  3J81 c;  3UDF A;  2RHS B;  4X64 L;  4B3T Q;  3RLF A;  4DV3 Q;  1X3E A;  3F2B A;  4OWW B;  3M7N A;  4O2D A;  4KHP Q;  4C3J H;  4X66 L;  2VL6 A;  2NVX H;  2R7Z G;  4DR6 Q;  2NN6 I;  1Q1B A;  2YTY A;  3GD7 A;  4A3G G;  2YTX A;  3S24 A;  1BVS A;  4LFA L;  3GTM H;  1EUJ A;  2E5L L;  4DK6 C;  1S72 A;  3J81 i;  1J5E L;  2R7Z H;  1X54 A;  4TVA B;  4A3F G;  2VUM G;  5JJI A;  3CP0 A;  1KL9 A;  4R4T A;  3A0J A;  3J81 j;  3S1R H;  4LF5 L;  4JCV E;  1FJG Q;  2ASB A;  3HOW G;  1WFQ A;  3K8A A;  1TXY A;  4A3D G;  4NXM Q;  3RLO A;  1XNQ L;  4YCU A;  2AKW B;  2V1C C;  3E9I A;  2NZO A;  3U50 C;  4X65 L;  4A3F H;  2YU9 H;  4GLV B;  1VQN A;  4DR7 L;  3S2H H;  5GAG C;  3HOY H;  1K73 C;  2AWO A;  2K5H A;  3PO3 G;  3E9H A;  3RZD H;  2YYZ A;  4A3D H;  5C4X G;  3UE0 A;  2R7D A;  3CCL A;  4JV5 L;  3JC6 6;  4JI2 L;  1E3P A;  4JI7 L;  4LF8 L;  1Y14 B;  5C3E H;  4RG1 A;  4YHH L;  3I55 A;  4DV0 L;  3PO3 H;  5C4X H;  3EIV A;  4YY3 L;  2VQF L;  4O0A A;  2GVB A;  2Z6K A;  2C35 B;  3RLN A;  1Y1V H;  1W2B A;  4MZ9 A;  2LSS A;  2D62 A;  5J3B A;  4GOP C;  1OTC A;  1KXL A;  1PYB A;  2CCZ A;  2Y0S G;  3BZC A;  3CF5 A;  2ES2 A;  2E2J H;  2UUB L;  3T1Y Q;  1IBK Q;  3L0O A;  3CW2 C;  2R93 G;  4KLK A;  1Y1W H;  1S40 A;  2B63 G;  5LMU Q;  1IXR A;  2YTV A;  4DR2 L;  2NZH A;  3S1Q H;  4OX9 Q;  4OX9 L;  1FGU A;  1EQR A;  1L1O C;  1N36 L;  3S17 H;  1HH2 P;  1C9O A;  1T9H A;  1B8A A;  3G48 A;  2IT1 A;  1I50 H;  3ULJ A;  5H1S E;  2B63 H;  2R93 H;  3UE1 A;  5JEA G;  1JJ2 A;  4DV7 Q;  4NXN Q;  1HZC A;  5IWA Q;  1X55 A;  5AJ3 Q;  2PNH A;  2K50 A;  4YWL A;  2CKZ B;  5IP7 H;  5M5W H;  2F4V L;  1L0W A;  2JA8 G;  1TWG H;  4YCV A;  5IYB G;  4A3I H;  1K0R A;  1UE5 A;  1X6O A;  1KC8 C;  4DR4 Q;  2N3S A;  4L5T A;  3G71 A;  4DUZ Q;  1X56 A;  1QZH A;  1EWI A;  1WI5 A;  3HOV G;  4DV1 L;  2WFW A;  3NEM A;  4YCW A;  1OXV A;  4PZ8 A;  4JI5 L;  4DPG A;  4AQY L;  3GTL H;  3U4V A;  2Q2H A;  1QUQ A;  2DUD A;  2JA6 G;  1VQL A;  4GKJ L;  1SE8 A;  1ASZ A;  1N33 Q;  4MTN A;  1N8R C;  3LGJ A;  1VQM A;  4JYA Q;  3H3V I;  4DUY Q;  1HR0 W;  1EOV A;  3U4Z A;  1FL0 A;  2JA6 H;  1X65 A;  3M4Q A;  1QUQ B;  1CKN A;  2UU9 L;  1KIX A;  2HQL A;  1PH9 A;  2UUA L;  5E7N A;  4QL5 A;  1IBM L;  4POG A;  4LFC Q;  4P72 A;  3CCE A;  4LFA Q;  1YVC A;  3I2Z A;  3CPF A;  1PV4 A;  4AYB G;  5C0X J;  1OXT A;  2E2H H;  4JI0 Q;  2IY5 B;  4JI8 Q;  4IOA A;  1YNX A;  4H02 A;  3AFP A;  2VQE L;  1AE2 A;  4LF5 Q;  2RF4 A;  1HNZ Q;  2UUC Q;  3TS2 A;  1VS0 A;  2CFM A;  1I6H H;  1YIJ A;  2EXD A;  5C0X I;  3B6Y A;  1CSP A;  4P73 A;  3J7Z C;  4UP9 A;  4L5S A;  4BBS G;  2Z6K C;  1KRS A;  4A93 H;  5FJ8 G;  2WB1 G;  1QZG A;  4JBM A;  3L2P A;  2WAQ G;  1EQQ A;  4JV5 Q;  2OTJ A;  4JI2 Q;  1XMO Q;  2VNU D;  3AQQ A;  3PO2 G;  4A4I A;  4YHH Q;  2I5L X;  4BY7 G;  4GS3 A;  4JI4 L;  1LYL A;  4DV2 Q;  4BBS H;  4YY3 Q;  1N9W A;  1SRU A;  5FJ8 H;  4A76 A;  4JBK A;  4OON A;  5FLM H;  3CCR A;  3I4M G;  4GNX A;  3KFU A;  4X6A H;  3PO2 H;  3KF6 A;  3HOZ G;  3KF8 B;  3I4N G;  1EIF A;  2H5X A;  2JA9 A;  4BY7 H;  1G29 1;  5ELN A;  4GLX A;  4DV6 Q;  1KD1 C;  3HKZ E;  1G6P A;  5EAY A;  4IJH A;  4A3M G;  4JI3 Q;  3I4M H;  1VQF A;  3FP9 A;  1VQP A;  3HOZ H;  1Q86 C;  1QVC A;  1XMQ Q;  4LF7 L;  4GKK Q;  3K7U C;  4LF4 L;  4ME3 A;  4OXP A;  5ELO A;  4UY8 C;  1N36 Q;  3DLL A;  1N34 Q;  5FLX c;  3J7A 5;  3K80 C;  4A3G H;  4B3R L;  1A63 A;  1VQG A;  1TWC H;  2PI2 E;  4J15 A;  3T1H Q;  1XPR A;  2R92 G;  1GKH A;  1JB7 A;  4OO1 I;  2KEN A;  3W1G A;  4LF9 Q;  3GTJ H;  1PH5 A;  2N49 A;  4XTC S;  1GVP A;  4NPS A;  3S1M H;  1L1O B;  2I0Q A;  1XPU A;  1XPO A;  2R92 H;  2F4V Q;  2MFI A;  4TQU S;  4BXX G;  1DGS A;  5GAE C;  4JOI A;  4IFD G;  4NB3 A;  4OWT B;  1Q81 C;  4LUV A;  2ZM6 Q;  3PGZ A;  2WP8 J;  4A3K G;  4Y52 H;  4GN4 B;  4BA2 I;  2VUM H;  5IYC G;  4BXX H;  4QIW E;  3RN5 A;  3A5Z B;  4X62 Q;  3HOW H;  2XTI A;  1YJ9 A;  2UXB L;  2JA5 G;  2JEA I;  4A3K H;  4XIG S;  5IYC H;  3PUZ A;  4AYB E;  1HNX Q;  3TRE A;  1BBU A;  3CC7 A;  4JI6 Q;  1WCM G;  1CUK A;  2D0O A;  3GO5 A;  2JA5 H;  3STB D;  2B29 A;  1I94 L;  3I56 A;  3PUV A;  2ZJQ A;  3J80 c;  3H15 A;  1V1Q A;  4HJ8 A;  5JJL A;  1WCM H;  3OTO Q;  2UUA Q;  4HIK A;  1N32 Q;  3A5U A;  3S14 H;  4LUO A;  2PQA B;  1IBM Q;  1HNW Q;  3AEV A;  1IZ6 A;  4PZ6 A;  1E1O A;  4PZ7 A;  4DNI A;  3ULP A;  1XNR Q;  1SN8 A;  2NN6 G;  1MKH A;  3J80 i;  2OTL A;  1NBW A;  2MNA A;  2IHF A;  3KJP A;  1FVI A;  3IRB A;  3G4S A;  2HHH Q;  2VQE Q;  4RMF A;  2BA0 A;  1MJE A;  2HIV A;  2CWP A;  4K0K L;  2VZA A;  4DV4 Q;  4LF6 Q;  2EIF A;  4EQ5 A;  1Q1E A;  3VDY A;  1Q8K A;  4R4C A;  3HOX G;  1VQ5 A;  1Z47 A;  1D8L A;  2MQH A;  4JBW A;  1NY4 A;  2OQK A;  3SGI A;  5LMN L;  4GNX C;  1Q7Y C;  1OXX K;  2Q2I A;  1IBL L;  3AFQ A;  1Z9F A;  4Y7N H;  4LFB L;  3HOX H;  1WYD A;  2UXD Q;  3EN2 A;  4B3M L;  1QVF A;  1NJI C;  2QGQ A;  1E1T A;  1PH1 A;  3RN2 A;  4FDB A;  4LUZ A;  3W5O A;  4JI1 L;  1ASY A;  1I3Q H;  5GRO A;  2JA8 H;  2ZTD A;  2AWN A;  1X3G A;  3KDF B;  5IYB H;  4EX5 A;  4DR1 Q;  4DR3 Q;  4B3T L;  4DV3 L;  4DK3 C;  1IYJ B;  3BU2 A;  1YHQ A;  3RNU A;  4KHP L;  3HOV H;  4UP8 A;  1VQE A;  4KHZ A;  4DR6 L;  3I7F A;  1SR3 A;  1HR0 Q;  1OXS C;  1PH4 A;  1NTG A;  4GN3 B;  1PVO A;  2R7F A;  1JJG A;  3CCU A;  1JT8 A;  1R9T H;  4R1J A;  2BA1 A;  4DR5 Q;  2RCN A;  3CC2 A;  2QA4 A;  4IOC A;  3ULL A;  1JJC B;  1PH3 A;  3M3Y H;  3EBE A;  3K7A H;  5C44 G;  4X64 Q;  1FJG L;  1WJJ A;  4ALP A;  3MEF A;  4L5R C;  1O7I A;  1KAW A;  4IPD A;  4IPC A;  4JOI C;  4X66 Q;  4A75 A;  1PFS A;  4P74 A;  2UXC L;  4R4I A;  2Z0S A;  1NMF A;  1X3F A;  5C44 H;  1KQS A;  2HT1 A;  1RIP A;  2E5L Q;  1VQC A;  3CC4 A;  3CXC A;  1J5E Q;  3TRZ A;  4A3C G;  3D31 A;  3HFZ B;  3TQY A;  1LM0 A;  1NMG A;  3GTQ H;  4BBR G;  3ERS X;  1X9N A;  4BY1 G;  1XNQ Q;  4A3C H;  4X65 Q;  4DR7 Q;  2LXJ A;  5GAH C;  4DV5 L;  1VQB A;  2VY3 A;  2Y0S E;  1MJC A;  3E0E A;  3FKI G;  1C7Y A;  2UXB Q;  4B3S L;  1YHA A;  4IPG A;  4MNO A;  2JE6 I;  1GM5 A;  4BY1 H;  4HJ5 A;  4LF8 Q;  3RR5 A;  1IBK L;  4JI7 Q;  3CMA A;  3CCM A;  5LMU L;  4DV0 Q;  3RZO H;  2VQF Q;  1YJN A;  4A3B G;  2OQ0 A;  1A0I A;  2JA7 G;  3CME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...