2FFKB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
b'APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rabbitpox encoded CC chemokine inhibitor
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
molecule tags Virus/viral protein/cytokine
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ffkB00
1MSGA 3IL8A 2JP1A 1PFMA 4MN3A 1G2SA 1DOMA 1BNZA 1MI2A 4U68A 1F9PA 2FJ2A 1E0BA 4X3SA 5EKIA 1JICA 1ICWA 1RTNA 3LWEA 2K03A 1IKMA 2RSNA 1B2TA 1KNAA 3TZDA 1WTXA 4RA8A 3HP3A 1RHPA 1U4PA 2MGSA 2L12A 3DEOA 3R93A 1BF4A 1PFNA 2FHTA 3I3CA 2D9UA 2EPBA 1WTRA 5EQ0A 4CJ2C 2L1BA 1HA6A 2FINB 2HCIA 2RSOA 4QUCA 4X3UA 2RA4A 1DONA 5CBAE 1QNKA 1ESRA 4UAIA 3D6WA 1DOLA 3KUPA 5T1GA 1CA6A 1XX8A 1RODA 1PDQA 1HFNA 1J9OA 1B4OA 5E4WC 2HDLA 1IL8A 1JE4A 2MP1A 2NZ1D 2N55A 5AFWA 3MTSA 2KECA 1QE6A 3SVMA 1XYIA 2CVRA 1G2TA 1U4LA 1EIHA 5D65A 1B53A 4CJ1B 1AZQA 4ZKBB 5EPJA 2KUMA 4QUFA 2NWGA 4XDXA 4ZKCB 2K05A 1WD0A 1MGSA 2JYOA 5COYA 4IUVA 1VMPA 1NR4A 1DZ1A 1J8IA 3H91A 4R8IA 4MHEA 1F2LA 4X3TA 2KVMA 4IUQA 1SSOA 3P7JA 1C8CA 2X69A 4IUUA 5CBEE 2FFKB 3DM1A 4HEDA 1BO0A 1HUNA 2B2YA 1X3QA 1CM9A 1LV9A 4LMQD 2L11A 2X6LA 1SDFA 2DY7A 2SDFA 3G7LA 5EJWA 1QG7A 3TN2A 4IUTA 1WTQA 3FPUB 1O7YA 3MWYW 2X6GA 2MPMA 1S4ZA 1SAPA 2DY8A 3ONAB 4NW2A 1A15A 1BBXC 1NCVA 1HHVA 2HDMA 2K28A 1RJTA 1G6ZA 5D14A 2Q8TA 1B3AA 1G91A 2B2VA 1X32A 1IKLA 2N88A 1KNEA 1ILQA 3GV6A 1WD1A 1NAPA 5EPLA 1AZPA 2VXWA 1EOTA 1EQTA 1F9QA 1WVLA 2B2WA 1NR2A 1EIGA 2B2TC 2BDNA 2IL8A 2NYZD 2Q8RE 1U4RA 3GV3A 3QO2A 4O42A 4OIJA 3N52A 5T1IA 1WTOA 1HRJA 1MSHA 2HCCA 1X3PA 5CORA 2B2TA 1WTVA 2B2YC 4HAEA 2K01A 1O80A 2FMMA 2K04A 4X3KA 4ZAIA 5CMDA 2MJ8A 1DOKA 2K1BA 4OIKA 1PLFA 3KBXA 1PFBA 1F9SA 2B2UC 2L9HA 5DNFA 4XT1B 4IUPA 1HFGA 1U4MA 3I90A 3Q6SA 5E4XA 3IFDA 2B2UA 2EE1A 3I8ZA 3F2UA 1WTPA 2B2VC 2KEEA 3UI2A 2EOTA 4XT3B 5EPKA 1RTOA 3FDTA 4DN4M 4ZK9B 2B2WC 1F9RA 4IURA 3DEPA 2L4NA 4R9WA 2XIWA 1WTWA 5JJZA 2R3ZA 4ZLTF 3I91A 2RVLA 4RWSC 4HSVA 2HUGA 1ZXTA 2KEDA 1ILPA 1TVXA 4HCSA 1HUMA 1VMCA 2H1EA 2J7ZA 1ML0D 1Q3LA 2M2LA 1M8AA 4CJ0B 2KOLA 4RAUC 1CA5A 1AP0A 1GUWA 1O7ZA 1B50A 1EL0A
chains in the Genus database with same CATH superfamily
1CSPA 2GVBA 3SE0A 2EIFA 2E8GA 1VDZA 2AUKA 2QA4A 2C9OA 4HMIA 3S2DH 4Z9CB 2EYLA 2ZM6L 1EQVA 3HOVB 4C3HH 2IWHA 5JAVA 5ELEA 5GQOA 3UE0A 2R93B 2PI2A 2ZXPA 4JI6L 3QG1A 4DV5Q 4EVOA 2IPKD 3DWPA 5LL6X 3HOUG 4KK7A 4R4OA 5IP7G 3NQIA 4YIJA 2QW7A 1T9HA 4IPGA 3I55A 1U0LA 3K8AA 4A3EB 4C2MH 3H09A 3K7UC 2OT2A 4I65A 4GN4B 1SN8A 3S16H 1C4QA 3F2DA 5C0XH 4A3DG 2F0EA 4C1NI 1UAPA 1J8IA 2A73B 1TWAH 2VUMG 3RUZA 3OTOQ 3M4OH 4JYAQ 3I72A 5M5YB 2G5DA 4EGVA 3DM1A 2BCOA 5CBEE 5CV7A 2VW9A 1VQ8A 1PZKD 5HURA 2ZXOA 4NXMQ 2I07B 3FPUB 5IYCG 2HHHQ 3NE5B 1Y69U 1I94Q 1VQKA 2QEXA 1RJTA 1G6ZA 1OXSC 2R6GA 3J80c 2JA6H 1LTBD 2EXZA 1KNEA 3D8GA 1Y1VH 2KCCA 2MNAA 1PYBA 2I5LX 2Z1CA 1B9NA 3QO2A 5C3EB 5IIFA 1BCPB 4C3JB 3J81c 4A3GB 1X3FA 1Y1WB 2K01A 5A35A 1L1OB 5HGQA 3CMAA 5FLXc 5C0XG 5M3FH 3J80i 1PH9A 2SNMA 1AFPA 3VR2A 4JOIA 3S17H 3FEWX 4HTHA 4KY6A 4LF8Q 4B3TL 2LSSA 2AHOB 3SK6A 4X65Q 2A74C 1YNXA 4ZLTF 1TKWB 1BOSA 5IGEA 4RWSC 4HJ7A 4DR6L 3W5OA 1TVXA 1CFMA 2Z4HA 2F52A 1JE5A 1YNND 3HOWB 4YY3L 3BU2A 3S1NB 1PTOB 1LTAD 2F4VL 5IP9H 3M7GA 1XNQL 4A3JB 1M90C 3FVQA 3S2HH 4DAYB 2EY6A 1KC8C 4BY1G 3SK4A 2N3SA 4FXDA 4DAVA 3DHQA 1RTNA 1YHAA 4KHPQ 2CW0D 2K5HA 3OSOA 1WTXA 1Z7TA 2NVYH 1U5KA 4NMZA 3KLSA 5G3LF 3SHLA 3J7AF 3IAYA 1QVCA 1HH2P 1YEZA 1JMCA 1I6HB 2E2DC 2K5VA 4NPSA 2AWNA 3A7AB 5C3XA 2JEBI 3I4OA 2EYHA 1VQNA 2NZ1D 1FJGQ 5I4DA 1EIHA 5D65A 4H7BA 1JB3A 1G6PA 4K5VA 5EPJA 4H13C 3U4VA 3OHXC 1VQFA 1EY6A 3C1EA 1LTTD 2VB3X 1PH6A 1ESFA 3OW7A 1LTSD 4IUUA 3PIPA 3KDFA 5J22A 5C4HA 4TSSA 2F0QA 1QILA 3G7LA 5C44G 3GTJB 5EJWA 1KD1C 2WACA 4P73A 2R7FA 4IFDI 4IUTA 3I4NH 1TQOA 2VQEL 1PH8A 1S4ZA 1Z47A 1YBYA 2RBMA 1VQ6A 3MFGA 4H02A 5BN5A 1B3AA 5DM63 3M4QA 2YU9B 4BBSB 1WTHA 1SFOB 1N33L 4DV7Q 4Q5VA 2ZJPA 3U9SA 4JG2A 3MXNA 1S72A 1Q82C 2VQFQ 3E6ZX 3M4PA 1R9TB 4GKKQ 4DV3L 1JWMD 2P5ZX 4DPGA 4OGQC 3M3YB 1XNRL 2IW3A 5GAEC 2UXCL 3MXPA 4KHVA 3TREA 5C4XH 3T51B 2EOTA 2PQAA 5CYUA 1K83B 2IT1A 2F0IA 1MHWC 2F0FA 3ERQA 2CH4A 3CCUA 2EZVA 1ASZA 2K75A 1SE3A 3R3OA 3F2CA 3HOVH 4LFBQ 4LUOA 4JOIC 4ZUJA 4O1NA 4P75A 4BBRG 1BR9A 1QZGA 4LFCL 4HJ9A 3OIPA 3CHBD 1PRTD 1B2TA 4LF9L 2L15A 1KNAA 4DFAA 3MVVA 1X9NA 4L5TA 3HP3A 1UE6A 4Y7NH 2R7ZG 2K33A 2R61A 4BXXH 1VQIA 3QB3A 3D3RA 5JPMC 2RSOA 1FYCA 1VQAA 4B3MQ 1QNKA 1ESRA 1S5DD 1W6KA 4UAIA 3VDYA 1PZJD 2XRSD 2HDLA 4KN4C 4UDUC 3GTPB 2D62A 4JBWA 4OONA 5GADC 3VYRA 3PF5A 4NDXA 2ZM6Q 3WOFA 1MGSA 2L55A 3H91A 4A3FB 5IWAQ 1HR0L 5IE8A 4JI6Q 1XJVA 3PV0A 1Q46A 3X3MA 3HOYB 1I6VC 4BY7G 4DK3C 4LMQD 4JCVE 4FO2A 2A8VA 2XTIA 3GTLH 3JAMc 1I50B 5C3EH 2Q2UA 2PW5A 4BXXG 3AB9A 3DXJC 2DJGC 3DLLA 1VQGA 1UNSA 3RZDB 1GD7A 2YTVA 1P8LA 2EJGC 4OIJA 4G7HC 3S1MB 1WTVA 4WJ4A 4E6IA 1IW7D 1HZCA 2E2JH 1ASYA 1BVSA 1O80A 5F2DA 3N6RA 5EBDA 2B63G 3OYYA 2WINB 4IUPA 1GUGA 3IFTA 1EQRA 3F2UA 1Y14B 3HOWH 3EIVA 1RL2A 1PTOH 3FDTA 1AE3A 1XTDA 1F9RA 3BZCA 3SDZA 2B8GA 4NKLA 2JA8B 1ET6A 1SMXA 5K36H 1ILPA 4OO1H 2AUJD 4HN7A 4HCSA 4A93H 4BWGB 1Y8NB 4JI7L 1Q3LA 4FP5D 1M8AA 4CJ0B 2XVSA 3K7AH 1A63A 1ET9A 5IT9c 4ID6A 1FNUA 4U68A 5EKIA 1ZKOA 3RLOA 1JICA 1BBUA 1JOKA 2AKWB 1I6HH 2EY1A 1T5XD 4IPDA 5C4ZA 3EN2A 1HA5A 2B29A 3R8BA 2O5JC 3TP5A 2PCFB 4J8QA 4YY3Q 4DV5L 2NN6I 1Q1BA 4QGUA 2WB1G 2F0UA 3BYTB 3PF4A 1SNCA 5FKAC 1AE2A 1E2ZA 3K58A 2JA9A 3CMEA 2OF1A 3OIQA 4CKBA 3CC4A 1G2TA 4OO1G 3OMCA 5KYIA 3PSIA 1I5FA 4IUVA 3VA7A 1STHA 1HNZQ 1IBMQ 2BA1A 1K73C 4X3TA 3HOUB 5J1ZA 3OTOL 1HQMC 4JYAL 1D1IA 1TS4A 4X64Q 2HIVA 2XSCA 3KF6A 4MNOA 1BBXC 2HHHL 3A7LA 1I94L 2KCTA 3A55A 1PA6A 2XRQD 1KLGD 3AYHB 4DA2A 1V1PA 3H15A 1O7IA 2K5WA 1KTKA 2KHIA 2N88A 2A68C 3HEJA 3CF5A 1S40A 3I73A 1WVLA 2VUMB 2A68D 1WTOA 2A6EC 1IYJB 1E24A 2A6ED 3TEHB 2FMMA 2Z6KA 3J81j 4IJHA 4QQBX 1KDBA 4DR2Q 4GLVB 4AYBG 1K83H 4PMBA 1VF5C 4HIKA 3CCJA 1PV4A 5DNFA 1RCVD 5C6AA 2B2UA 5M5WB 1R4QB 2QKIC 1QUQB 3HOXB 2KHSA 3A54A 4LF8L 1HNWL 4WFN3 1X3GA 1N33Q 4R9WA 4X65L 1QJOA 5C5MA 3S1RH 3PQIA 3G6EA 1EEID 1VMCA 3S1QB 2OXPA 1H9RA 3NHHA 1XNRQ 3AFQA 2IHEA 4ALPA 1PH3A 4AQYL 2NTSA 1IHZA 3FKIH 5EBCA 2K03A 1KRSA 1CKMA 2KCMA 3VYUA 4KHPL 1IKMA 2PMZE 1DCZA 1A2UA 1PH4A 3DEOA 2JEAI 3NTHA 2Z0SA 1TWCB 4B9WA 3KDFB 1GM5A 1G8ZD 2CWAA 1IYVA 3D6WA 3OWEB 2JA5H 3D4DA 1PYSB 2EQSA 2EYMA 2VY3A 3P75A 4BY1B 4A3FH 1EYAA 2ZTDA 2ZTEA 5IGCA 1LT6D 2ICIA 2A6HC 2J0TD 3CQZH 5I2YA 4L5SA 4DNTB 3T53B 3V2TA 1O7LA 4LF9Q 2EJMA 4K2LA 5IYDH 5COYA 1SJED 1NR4A 1CUKA 1JCKB 4K6DA 4ZYSA 3Q22A 3GTMB 3U9OA 4IUQA 3NXWA 4O2DA 2HD3A 2FFKB 3H3VH 1HUNA 4NP5A 4ODGA 1CZGA 4ZUIA 1I4XA 4NB3A 1K0RA 1LO5D 1O7YA 2EDGA 2ZJRA 2Q8TA 2PQAB 5KEEA 1Q90A 2VS1A 4GOPA 4P72A 1SNPA 1TS5A 2TMPA 2Y0SB 4C3IB 1GVPA 4A75A 3D6CA 3MFYA 1XPUA 1F9QA 1R4PB 1S3OA 2K50A 2RHSB 1NR2A 1EIGA 4OELB 4DV7L 3GV3A 4A3BB 3CW2C 1BCPD 5CORA 1HR0Q 4KKTA 4WRDA 1JT8A 1HR0W 3S14B 4DXGA 4GKKL 4J1MA 3W1GA 1S5ED 4OIKA 2ATWA 4JK1C 1LT3D 5C0XI 1QOHA 4R8NA 2E2HB 1VF7A 3AQQA 3VYTA 1A3VA 4GLAC 2DNCA 3UI2A 1SE8A 3TSSA 5KNBA 4LUZA 1PZID 4ZCKA 1GJXA 5JJZA 2YTYA 2HT1A 1VQMA 2Z6KC 3I4MG 1DYQA 1S5BD 3P20A 4A3KG 1PTOD 5FO8B 2JE6I 4JI2L 4QY7A 3C3LA 2VL6A 1I4GA 4OWTB 2WKDA 2JP1A 1BNZA 2UUAQ 4DNRB 3R2IA 5JEAG 5CV5A 1GOZA 2RSNA 1NSNS 1KABA 1BF4A 2FXQA 2EXDA 3NBHA 3W1BA 5CBAE 1C9OA 2F3IA 4B3ML 1JORA 2ZXRA 4BBRB 4HJ8A 2UU9Q 4A3LH 1OO9B 3PIO3 1KQSA 4LUVA 4DF7A 3H6MA 1E1OA 2UXBL 2E5LQ 3HRZC 4OX9L 4R4CA 1KIXA 1K8OA 2KUMA 3WWVA 1NMFA 1SYBA 4N9TA 1Y8OB 1IYUA 4L8JA 4K0KL 1LLRD 3MEHA 2R7DA 2R92G 5IWAL 2YV5A 3PO2B 5D3DA 5CV8A 1B1ZA 1EZ6A 2UUCL 3ONAB 4NW2A 2X6GA 2MPMA 1KHIA 2UXDQ 3ND9A 4KD4A 2PMZB 2JXMB 2IJ0A 3PO3H 4YHHQ 3VR4A 3STBC 1J5EQ 3MAQA 1EY4A 1KL9A 3STBD 2IL8A 4O42A 3PMFA 4FF2A 4DV0Q 5FJ8G 3RN5A 1VQ5A 1SYGA 3LNNA 1GO3E 4BY7B 4ZRZA 2B39A 1SBBB 3FMCA 3K59A 3K80C 1NNXA 3KBXA 3GTGB 3NTKA 4RFBA 3D31A 4C3HG 4XIGS 3Q6SA 4JC0A 4GOPC 4LF5Q 3I8ZA 3GTKB 2KEEA 1XWEA 3K0XA 1CKNA 4DV1Q 5C3WA 2E75C 4F8MA 3NSWA 1GHJA 1DD2A 2H1EA 4JBKA 3S15H 2PQEA 2M2LA 4H0LC 1WYDA 2KOLA 3ZJYC 2CCZA 3C1FA 4CDFC 1XPRA 1SE4A 3GO5A 2E2IH 1TWCH 1K0SA 1MI2A 2FJ2A 1ICWA 4K5XA 1HNWQ 2NB0A 1VQLA 1PH1A 1RHPA 1PHJA 4GNXA 3EVQA 3BJUA 1H9JA 4HJ5A 1WTRA 1YNNC 3RMHA 2HCIA 4R1JA 2JA6G 1SNQA 2E76C 3CXCA 2CH4W 5M9OA 1N34Q 3GTQB 3QIAA 1Y1VG 4C1NK 1YITA 3GTMH 5AFWA 3X3NA 1QE6A 4AQYQ 2Q2TA 1V1PB 4J15A 2WAQG 2CW0C 1JWUD 4LNQA 2V4DA 2YYZA 1WD0A 1JR0D 5M3MH 3V96A 1EEFD 3PGZA 1MJEA 5M3FG 1HNZL 4DAPA 3VR3A 1IBML 3PUVA 1SSOA 2N8NA 2DJFC 4HEDA 4EQPA 4C3IH 3JAML 5M5XB 1F2MA 5HGTA 4UP8A 2OTLA 1E1TA 4X64L 1HZBA 2PZUA 4A3BH 2DY8A 3AEVA 1KDAA 1Q86C 1EY9A 1GUOA 2K28A 5D14A 3H3VC 1VQDA 1V43A 3S14H 3H0GB 5CV6A 3QR8A 5C5LA 2Q8IB 3RZOB 1PMRA 3CCRA 1ENFA 4IPHA 1EQTA 2HQEA 2A69D 2OQKA 5IP9G 1AZQA 1EZ8A 1U4RA 4A3MH 1SYEA 3T1HL 5T1IA 1WOCA 2HCCA 4LWCA 5JPNC 2LXJA 1PH7A 1QNUA 1VQPA 2MJ8A 1XXGA 4GZYC 1DOKA 1CTMA 2KHJA 4DR2L 1JJ2A 1JOQA 1H95A 1TXYA 3VYSA 1EUJA 2NVXB 2IX0A 1U4MA 5E4XA 2D0PA 1P16A 3IFDA 4L63B 4RHSA 4ZQ3A 4IO9A 1UE1A 5I6YA 2RF4A 3KBGA 1DM0B 3BVZA 3D4WA 2VZAA 2XIWA 3E5SA 1TT2A 2HUGA 5TSSA 2F1MA 1EWHA 2F0OA 4DV2Q 2H5XA 2JA7B 1ML0D 4HMJA 4ME5A 3CP0A 5IGFA 2WKCA 3T16A 2NVTB 1NY4A 2ZJQA 4DR5Q 1EL0A 4MTKA 1TWHH 2ASBA 3EQLC 2PNRC 3I70A 4MN3A 1DOMA 3ICEA 5ELNA 4DR7Q 2Z8LA 5A2QE 3KJPA 4QB4A 2RDFA 3HKZG 3UDIA 3TZDA 3BZDB 3ITPA 4PQXA 1QWYA 1RIPA 3I4NG 1YIJA 2L1BA 1SROA 3LWUA 2IX3A 2A1AA 3EFXD 1A3UA 3KUPA 5IOCA 5T1GA 1RODA 1BDOA 2K32A 3RN2A 1PDQA 4JI2Q 1YJWA 1IL8A 1ONLA 1VCIA 2DUDA 3RLFA 3U4ZA 2CVRA 2R93H 4IQZA 3PO2H 1PRTC 1SYFA 4OL7A 4OO1I 1CQVA 5ELCA 1WCMB 1VS0A 4GNXC 3OWFA 1CZWA 4JI4L 1N36Q 4DUZQ 2XWBB 1Q81C 3QOJA 3MA2B 4A3EH 4BS9A 1Z9FA 4PZ6A 2ICEC 3HOZB 1BO0A 2B2YA 1CM9A 5C4XG 1WD1A 2X6LA 4PZ8A 3MWYW 2SNSA 1HHVA 2K5DA 4UP7A 5ELOA 4RGOS 1NJIC 4GKJL 2UXBQ 5M5YH 1ZEQX 1VQ9A 4OX9Q 4GN5A 1AZPA 4AH6A 1EOTA 5BR8Q 3KJOA 1B9MA 2NYZD 3HOVG 5G3LD 4K0KQ 2R93G 1I3QB 3CCLA 1CK1A 5CMDA 2UUCQ 2MO0A 4M1UB 2LS01 2DN8A 4C3JH 1SMYD 1SYDA 2OEOA 4A3GH 1GKHA 3MC0B 5A2QL 1Y1WH 2B8FA 5EPKA 2F3VA 4IFDH 1UUPA 5NUCA 3GTOB 1QVFA 1TY0A 2BH2A 4K5WA 5I2XA 4K8IA 3Q0AA 1TS3A 2KEDA 1IW7C 2RCFA 5IYBH 4LF4L 4QF4A 4CKEA 3KFUA 3RNUA 1II3A 1SRUA 1EYDA 1EYGA 1QCBD 1PFMA 3DM3A 1PH5A 2UUAL 3KYHC 3RD4A 4PMCA 3S1NH 1CI3M 2A5HA 1D7QA 1RKNA 1B3QA 4A3JH 4IFDJ 3I4LA 2L12A 3I4MB 4WJ3M 3P1HA 4A3KB 3TRZA 5KNDA 5C3EG 1HA6A 4C3JG 1U9RA 4A3GG 1LM0A 1ZYRD 1EYCA 3GD7A 3ULLA 1DOLA 1OXTA 2RDGA 1HTLD 2WP8J 5CV9A 2UU9L 1HFNA 3NBIA 4K14A 4YWLA 1XYIA 5HY6A 1FGBD 2ES2A 2G9DA 2E5LL 5M5XH 3I2ZA 4XDXA 4A4IA 4F88A 1I4RA 3NP8A 4ZKCB 4IALA 3TBIB 3K5LA 3DUZA 3C2PA 1VMPA 2C5CA 3CD6A 4A3IB 2I0QA 4HIOA 2F03A 4TVAB 2F0GA 2Y0SE 2KVMA 1OXUA 2KCNA 3HOWG 4HIMA 1SDFA 2SDFA 1WTQA 4WORA 2UXDL 4LW1A 4RKLA 4PMWA 5K36G 1V8QA 4DU9A 2RCNA 4A93G 2B2VA 4YHHL 1QVGA 3CC2A 3VR6A 2Z9HA 2OCEA 3GTJH 1EIFA 4FNFA 2QEJC 1J5EL 5IY0A 3PUYA 2Q8RE 4B3RQ 2R92B 4DV0L 1D1KA 1HQRD 2B2YC 2RDHA 4L5RC 2WFWA 3L9AX 2UUBQ 2YU9H 4BBSH 1KDCA 4TKOB 1SFOH 1VQBA 3E9IA 1F9SA 1TS2A 2KQ3A 3TDQA 1T5EA 4XXEA 3EJIA 4B3SQ 5JVG3 3M4YA 4LF5L 4L6TB 2JA7H 3U50C 1R9TH 2CQOA 2BOSA 4A3DB 3H3VI 3W3AA 1X55A 1F2YA 2NVTH 3M3YH 4DV1L 3K5OA 1IXRA 1CKOA 5L37A 3URYA 4JPBW 3T1HQ 4HSVA 3PUZA 4FF1A 3S2DB 1N8RC 4C3HB 4DUYQ 2FMCA 4KV6A 4DAYA 1FL0A 3TP8A 3CCSA 4F7XA 1DJRD 4X3SA 3MHBA 3NWSA 5CV4A 2DNEA 1KAAA 4FVMA 1CSQA 4RG1A 2D2CC 3J81E 1E22A 3R93A 3JC66 2PYKA 4KMUC 1STYA 2VNUD 3TQYA 1CHPD 3S16B 3BDOA 5FLXE 2FINB 1WCMH 2KBNA 2JQOA 1PVOA 3MZ5A 1JJCB 1TWGB 1N34L 3QJYA 5E4WC 1JE4A 1HZAA 2N55A 3J7YW 3SVMA 3M4OB 2NUCA 3HOZH 4DK6C 1D2BA 4B9XA 2D0OA 1JOOA 4H44C 4A3CH 2CWPA 3HS0C 2IX1A 1HTPA 3KF8A 1SNOA 3A8KE 4PG3A 4MHEA 2OTJA 3TP7A 3GTPH 4LAAA 3P7JA 1YJ9A 1EY7A 1K3RA 4HSPA 1LV9A 1Y1VB 2LY7A 3BVMA 1LACA 4PV1C 4XQNA 4JI3Q 1QG7A 4C56C 4FF4A 3WDNA 1TU2B 4MTNA 1EU3A 3Q8DA 2WAQB 4MIUA 1EFWA 2J4XA 4EQ5A 3GQBA 1Q8IA 3T1YL 2AQ3B 2GA4B 3HOYH 4RGMA 1NE3A 4BA1I 4DR1Q 4JI4Q 2VXWA 4R4QA 1IBKL 3MXNB 1LTLA 2KENA 1I50H 3S17B 3KLSX 4RCOA 2AQ1B 3Q23A 4HAEA 1UEAB 3FP9A 4X3KA 2SEBD 1SEBD 1E7ZA 4FXKC 1SLJA 2KJXA 3FKIG 3RZDH 3GTOH 3A8JE 4AIMA 1L0YB 3J7ZC 3CPWA 4DKAC 3J80L 4UPAA 1JJGA 3S1MH 1XTCD 2B2VC 4GKJQ 1K8GA 4KY7A 2L4NA 2K52A 4G4KA 4JVZA 1KRTA 5KRUA 5KNCA 3J81L 2R3ZA 2ZTCA 1C7YA 2JA5G 1BCPC 3BDCA 4GLXA 4A3FG 4JI1Q 4M8AA 3S24A 5FLXL 4DV2L 4K8JA 1L1OC 5BN3A 5C44B 3MXUA 4CGYB 3F1ZA 4YWMA 4OWXB 4IJLA 5FLMH 1B50A 2NVYB 5EGTA 5IYDG 4DR5L 2JA8H 2EY5A 3KLRA 4DR7L 4O0AA 5DLQE 1YJNA 3U58A 2FHTA 3AMUA 3CCEA 4QMGA 3CCVA 4KKUA 1PTOC 2WV6D 4X3UA 4LF4Q 2RA4A 3K5MA 3DWAA 1Q7YC 4FYDA 4GN3B 5D3IB 3B6YA 4A3IH 4IPCA 2WB1E 1DZ1A 2MP1A 3MTSA 1FVIA 2AQ2B 4K2KA 3HKZB 3M85A 3VA5A 2QILA 1Y8PB 4QUFA 4V0BA 2NWGA 4IOAA 5CR3A 3I4NB 4ILWA 1N36L 2I46A 4DUZL 3ULPA 2RHQB 4RCNA 1HNXL 5K5PA 3G4SA 4UHVA 3UE1A 1I4PA 1OXVA 1X6OA 3ND8A 3SEBA 1L0WA 4N8FA 3J7AV 3HOUH 1V1QA 5IP7H 1SNDA 4CHTB 4JI0Q 1IKLA 2MQHA 5KYLA 5ELBA 2Z4IA 1LT5D 2BDNA 2R7ZB 4P74A 5DM73 3K81C 5BR8L 1CA5A 2Q2HA 1XMOQ 3N52A 1HRJA 1G291 2IHFA 3OMGA 2XNAC 1Q1EA 1CT1D 4A3DH 4N8X1 1HPCA 1TY2A 1QZHA 1W2BA 2VUMH 2RQXA 4AYBE 4OWWB 2NBFA 1WTPA 4QJFA 4UY8C 4QL5A 3A5ZB 2K14A 5IYCH 1JB7A 5LMNQ 3L3OC 3UDFA 2F4IA 3NWTA 3IRBA 5GROA 5LMNW 4A3LG 3A5UA 2F3WA 5M5WH 4KD3A 3HOXH 3JAME 3W2DA 4DK1A 5C4JB 2BE5C 1IBLQ 4CDCC 2M9VA 4X62L 1E2WA 4Y7NB 2BE5D 1W6JA 3PIP3 5J3BA 2O2LD 2VB2X 3S1QH 1E0BA 1EFID 4XTCS 3D0FA 1D5ZC 3TS2A 1TWGH 3SR1A 5CGKA 4X66Q 2OWOA 1H9MA 2D9UA 4RGTA 2EPBA 1G51A 3HZXA 4CJ2C 4QUCA 5JOBA 2NVQB 2B63B 4RH6A 2PNHA 3RR5A 1A6XA 3PO3G 4U673 1K8AC 1VQCA 4DV4L 4YCVA 2EYFA 1RD9D 4K6LA 1YI2A 2F0TA 1XMQL 4ABNA 5BN4A 3HOXG 1SXTA 3T56B 5C0XJ 1BUVT 4BY1H 3GTLB 1ENCA 5JVH3 4JI8Q 4JI5Q 3BZKA 3S9WA 5DAUA 1FD7D 2ID0A 5ISRA 3G48A 2AWOA 3H94A 5IT9E 4KTAA 1D6EC 2CQAA 3KF6B 2F0VA 2EYOA 2QGQA 1BXTA 1HXYD 2HDMA 4I7AA 1WJJA 1CHQD 1GUNA 1C48A 1NTGA 4EX5A 2E2JB 5E1FA 1FR3A 1PRTF 3J81i 5ELDA 4QIWB 2ZT9C 1QB5D 2B2TC 4B3RL 3AU7A 2BH8A 3PIOA 2F0SA 3SGIA 1MKHA 2WB1B 4ZAIA 2UUBL 1IZ6A 1PLFA 4KY5A 5FO9B 1PFBA 1VQOA 2TSSA 2L9HA 3R2TA 2XN9C 1STAA 3EBEA 2LXKA 4DK0A 2I5HA 4B3SL 4A93B 1BQQT 4DGZA 3ZYYX 1UE5A 5C44H 1QUQA 3T1YQ 2F0WA 4DN4M 3K7AB 1M4VA 2AMCB 2A69C 4RHRA 4LK1C 4I7ZC 1A2TA 3G71A 2RVLA 2NZOA 1IBKQ 2E2HH 5KGUA 4N9PA 3PUWA 3BVGA 1H9SA 1HUMA 4TQUS 3TMEA 2J7ZA 2PI2E 1O7ZA 1A3TA 4DUYL 1STGA 5M3MG 3IL8A 5AJ3L 2PPBC 3K57A 1EOVA 4V190 4XQJA 4YWKA 3BDLA 2GVAA 3KF8B 4LF7Q 2Y0SG 4RA8A 4C3IG 1N32L 1J6QA 4OEMB 1I4HA 1LABA 3EA6A 4FDBA 3L0OA 4A3BG 5IODA 4DAMA 2MUYA 3UDGA 4NXNQ 4AYBB 1K9MC 1X65A 5IT9L 1TWFB 2JN4A 1B44D 2QDLA 4KN7C 2KECA 2RKSA 2IY5B 4A3MG 2QCPX 3L7ZC 1AN8A 1PXUA 1FGUA 4G7OC 2K05A 2C35B 2D5DA 1EWCA 4BBRH 4JV5Q 2EJFC 3DWQA 3K6OA 3NQTA 3CKIB 2LMCB 1L0XB 5EKKA 1FNWA 1TR5A 4HCEA 1X3QA 5E3FA 2L11A 4TRDA 4JI3L 4IN3A 1SYCA 2R7ZH 1RF2D 1SAPA 1Q12A 4JBJA 2MFIA 4YCUA 3GDEA 4GOPB 1G91A 4MZ9A 3BG3A 1D5XC 3K5NA 4CDEC 3GV6A 1X32A 4DR1L 4F87A 3GP7A 4KJOA 1DGSA 4XYQA 3LGJA 2CKZB 1HNXQ 5DEHA 4DV6Q 2CFMA 1GUSA 1JC7A 4POFA 4DR4Q 3S1RB 1OXXK 4LF6Q 4LFAQ 1MIUA 2LKVA 4BY7H 4XT3B 1UWVA 5C4JH 3DEPA 1LTGD 1WTWA 1X54A 3O13A 2PW7A 3GTGH 2XGTA 1GUTA 4CKCA 4UP9A 2MO1A 2O5IC 3FKIB 1K28A 1LUZA 2K4KA 3GTKH 4JI1L 4DNIA 3PO2G 5GAHC 5I9OA 3E3XA 1KAWA 3KLWA 4IZ8A 1AEXA 3I7FA 1V9PA 1SMYC 3TS0A 1LTID 1G2SA 3OOCA 2MHVA 3T13A 3J7A5 1F9PA 2YTXA 2NVQH 2B63H 4A3EG 4QCLA 1YZ6A 3NUCA 2F0JA 1V1OA 2JA5B 3NPPA 1F77A 2MGSA 2B3GA 2N49A 1MD2D 3NBHB 3CQZB 3NENA 5EQ0A 3NELA 5CC4A 1DONA 1LTRD 2PZWA 2KA7A 2K5QA 1A8VA 4DR3L 1CA6A 1ENAA 4X62Q 4G57A 5FK9C 2XWJB 1U4LA 4RMFA 1PFSA 4IOCA 2K5NA 1F2ZA 4PNYA 2WAQE 1EIYB 2F0PA 3OW2A 2JYOA 3GTQH 3BYYB 3FHWA 2Z6BA 1F2LA 5LMUL 3A74A 2X69A 1KXLA 1ZYRC 3JAMi 1K8MA 1HCZA 1S5CD 3CRKC 1Y1WG 3TN2A 4Y52H 4IFDG 2ENBA 2PZTA 1DXMA 3TZUA 3PCOB 4DV4Q 1A15A 1NCVA 2DGYA 2F0LA 1C0AA 1XMQQ 5IGBA 5IYBG 4JI0L 1L2FA 4JBMA 5JJKA 2B2WA 2M00A 3EROA 1YVCA 2V1CC 1XMOL 1MSHA 4Q0FA 2QDBA 3E0EA 3HGBA 3H0GH 3RZOH 1UEBA 2K1BA 4BA2I 3DMUA 1JWSD 3M9BA 4XT1B 2O4XA 4ME3A 4A3JG 1YHQA 1HFGA 5ELFA 3TP6A 2EE1A 4L5QA 4B3TQ 1Z6HA 5GAGC 1RTOA 1CKNB 4ZK9B 4P71A 4POGA 1OTCA 1GXDC 5LMNL 3D4RA 4DR6Q 1B70B 3CAMA 1I4QA 2E74C 5E7NA 4GS3A 5FOBB 5IGDA 2NVXH 1ZXTA 4R4TA 3FPPA 2F0MA 2F4VQ 1YNJC 2A19A 2SOBA 1K3BC 1XNQQ 1YNJD 1L1OA 3NK9A 1IBLL 3L2PA 1MSGA 3A0JA 4B08A 3HKSA 1PRTB 3QOLA 3LWEA 4KJNA 3H0GG 1TWFH 4GNXB 4X66L 3HKZE 3CRLC 1NBWA 1PFNA 2JJQA 3CCMA 1BCPF 1SR3A 4DXFA 1WFQA 4IUNA 4NXML 1STNA 1XX8A 3E9HA 1EY0A 3J80E 4PZ7A 2EVBA 5AJ3Q 2NZHA 4S3SA 4ZKBB 2NTTA 1CQFA 3AFPA 1D8LA 5LL6S 4BBSG 1N32Q 1E2VA 1MBYA 1B8AA 2HQLA 4OXPA 3M7NA 4R8IA 4HR7B 4JI5L 4JI8L 4C2MB 4X6AH 5I9PA 4JW0A 3PO3B 3NEMA 1BKBA 1W3SA 2JA7G 1PTOF 2VQEQ 1VQ7A 4G7ZC 1EQQA 3RLNA 1TWAB 1S5FD 4RGNA 4WJWA 5FO7B 2Q2IA 1ILQA 1NAPA 3MEFA 5EPLA 2JSOA 4OHJA 1PH2A 2L5TA 1H9SB 4EQNA 3F2BA 2JA6B 4DV3Q 2WIIB 3Q24A 2F0KA 4R4IA 2CHBD 3OPOA 2LFNA 4KI0A 4P2CB 2F0HA 2I5MX 1ICFB 1WI5A 2UXCQ 4CBVA 3I90A 4KKSA 3KK7A 1AW7A 3S15B 2NN6H 1I3QH 1NUCA 2OQ0A 1EU4A 1VQEA 2B2WC 4IURA 4XQQA 1WCMG 5M3FB 1X3EA 2HIXA 2E2IB 1VQJA 1X56A 2BA0A 4J6HA 1HZ9A 3CCQA 1FNVA 5JJLA 1HJPA 1BBWA 4FF3A 3HOZG 1H9KA 3CPFA 3UDXA 4RKBA 1GHKA 4A3CG 1EWIA 1UE7A 4LFCQ 1FJGL 5H1SE 4KLKA 1EY8A 4YCWA 3KOJA 2A6HD 1PYWD 4HIDA 1MJCA 3HFZB 1EY5A 3T4AC 4LF7L 1B7YB 1U4PA 1RDPD 2H4OA 2K7VA 3S2HB 3I3CA 3A8IE 3I56A 1E3PA 4KHZA 2F0NA 2PO4A 1VQHA 3IKJA 1NMGA 2NN6G 1A0IA 4NXNL 5M3MB 2JK8A 3HOYG 1AH9A 1J9OA 1B4OA 3I4MH 3E0JA 1YHBA 1N9WA 5EAYA 4APVA 4A3KH 3K0YA 2QF7A 1B53A 4LJZC 4CJ1B 1STBA 2F0DA 3VR5A 1O78A 3LX0A 3ERSX 2EYPA 2ALYB 3HG9A 4JV5L 5JEAH 4ULLA 2VQFL 2EY2A 1C8CA 4QIWE 3SXHA 1LYLA 1VQ4A 1IL2A 2EYJA 5KIXA 3V05A 4DR3Q 2DY7A 1A62A 1GUWA 3ULJA 3F8TA 4A3MB 3C46A 3SK5A 3QWNA 2G9HD 2L0CA 1LT4D 1Q8KA 3CC7A 1JQYD 3CU7A 4FXGC 2BDOA 5FLMG 1SNMA 1X3PA 5LMUQ 2B2TA 3ER0A 4CDDC 4HJAA 2JA8G 2K04A 5JEAJ 3MXGA 4DV6L 4LFBL 5I6WA 1SJHD 2B2UC 2K6AA 2GN5A 2R92H 5EKLA 4DR4L 3BS1A 4LF6L 3G6JB 1D5MC 5J39A 4LFAL 4XYOA 4A76A 5JJIA 1M1KC 3NTIA 4EQOA 5LHY1 1TWHB 3I91A 5IGGA 4A3IG 1TIID 1XPOA 1KLUD 3A56A 4JI7Q 5C4XB 2N78A 1STEA 3PUXA 4RAUC 1AP0A 3WOEA 3FRPB 1SE2A 5FJ8H 3SK8A
chains in the Genus database with same CATH topology
3SE0A 1VDZA 2AUKA 2C9OA 4HMIA 4Z9CB 2EYLA 1EQVA 3HOVB 2IWHA 5JAVA 5ELEA 2R93B 2ZXPA 3QG1A 4EVOA 2IPKD 3DWPA 5LL6X 4KK7A 3NQIA 4YIJA 4A3EB 3H09A 2OT2A 4I65A 1C4QA 5C0XH 2F0EA 4C1NI 1UAPA 1J8IA 2A73B 3RUZA 3I72A 5M5YB 4EGVA 3DM1A 2BCOA 5CBEE 5CV7A 1PZKD 5HURA 2ZXOA 2I07B 3FPUB 3NE5B 1Y69U 1RJTA 1G6ZA 1OXSC 2R6GA 1LTBD 2EXZA 1KNEA 3D8GA 2KCCA 2Z1CA 1B9NA 3QO2A 5C3EB 5IIFA 1BCPB 4C3JB 4A3GB 1Y1WB 2K01A 5A35A 5C0XG 2SNMA 1AFPA 3VR2A 3FEWX 4HTHA 4KY6A 3SK6A 2A74C 4ZLTF 1TKWB 1BOSA 5IGEA 4RWSC 1TVXA 1CFMA 2Z4HA 1YNND 3HOWB 3S1NB 1PTOB 1LTAD 3M7GA 4A3JB 3FVQA 2EY6A 3SK4A 4FXDA 4DAVA 3DHQA 1RTNA 2CW0D 3OSOA 1WTXA 1Z7TA 4NMZA 3KLSA 5G3LF 3SHLA 3J7AF 3IAYA 1I6HB 2E2DC 2AWNA 3A7AB 5C3XA 2JEBI 2EYHA 2NZ1D 5I4DA 1EIHA 5D65A 4H7BA 1JB3A 4K5VA 5EPJA 4H13C 3OHXC 1EY6A 3C1EA 1LTTD 2VB3X 1ESFA 3OW7A 1LTSD 4IUUA 5J22A 5C4HA 4TSSA 2F0QA 1QILA 3G7LA 3GTJB 5EJWA 2WACA 4IFDI 4IUTA 1TQOA 1S4ZA 1Z47A 2RBMA 3MFGA 5BN5A 1B3AA 5DM63 2YU9B 4BBSB 1SFOB 4Q5VA 3U9SA 3MXNA 3E6ZX 1R9TB 1JWMD 4OGQC 3M3YB 2IW3A 3MXPA 4KHVA 3T51B 2EOTA 5CYUA 1K83B 2IT1A 2F0IA 2F0FA 3ERQA 2EZVA 1SE3A 3R3OA 4ZUJA 4O1NA 1BR9A 3OIPA 3CHBD 1PRTD 1B2TA 1KNAA 4DFAA 3MVVA 3HP3A 2K33A 2R61A 3QB3A 3D3RA 5JPMC 2RSOA 1FYCA 1QNKA 1ESRA 1S5DD 1W6KA 4UAIA 1PZJD 2XRSD 2HDLA 4KN4C 4UDUC 3GTPB 2D62A 4JBWA 3VYRA 4NDXA 3WOFA 1MGSA 2L55A 3H91A 4A3FB 3PV0A 3X3MA 3HOYB 1I6VC 4LMQD 4FO2A 1I50B 2PW5A 3AB9A 3DXJC 1UNSA 3RZDB 2EJGC 4OIJA 4G7HC 3S1MB 1WTVA 4E6IA 1IW7D 1O80A 5F2DA 5EBDA 3N6RA 2WINB 4IUPA 1GUGA 3IFTA 3F2UA 1PTOH 3FDTA 1F9RA 3SDZA 2B8GA 4NKLA 2JA8B 1ET6A 5K36H 1ILPA 4OO1H 2AUJD 4HN7A 4HCSA 4BWGB 1Y8NB 1Q3LA 4FP5D 1M8AA 4CJ0B 2XVSA 1ET9A 4ID6A 1FNUA 4U68A 5EKIA 1ZKOA 1JICA 1JOKA 2EY1A 1T5XD 5C4ZA 1HA5A 3R8BA 2O5JC 3TP5A 2PCFB 4J8QA 2NN6I 1Q1BA 2F0UA 3BYTB 1SNCA 5FKAC 1E2ZA 3K58A 2OF1A 3OIQA 4CKBA 1G2TA 4OO1G 3OMCA 5KYIA 4IUVA 3VA7A 1STHA 2BA1A 4X3TA 3HOUB 5J1ZA 1HQMC 1D1IA 1TS4A 2XSCA 1BBXC 3A7LA 3A55A 2XRQD 1KLGD 4DA2A 1V1PA 2K5WA 1KTKA 2N88A 2A68C 3HEJA 3I73A 1WVLA 2VUMB 2A68D 1WTOA 2A6EC 2A6ED 2FMMA 1KDBA 4PMBA 1VF5C 5DNFA 1RCVD 5C6AA 2B2UA 5M5WB 1R4QB 2QKIC 3HOXB 2KHSA 3A54A 4WFN3 4R9WA 1QJOA 5C5MA 1EEID 1VMCA 3S1QB 2OXPA 1H9RA 3NHHA 2NTSA 1IHZA 5EBCA 2K03A 3VYUA 1IKMA 1DCZA 1A2UA 3DEOA 2JEAI 3NTHA 1TWCB 4B9WA 1G8ZD 1IYVA 3D6WA 3OWEB 3D4DA 2EYMA 3P75A 4BY1B 1EYAA 5IGCA 1LT6D 2ICIA 2A6HC 2J0TD 5I2YA 4DNTB 3T53B 3V2TA 1O7LA 2EJMA 4K2LA 5COYA 1SJED 1NR4A 1JCKB 4K6DA 4ZYSA 3Q22A 3GTMB 3U9OA 4IUQA 3NXWA 2FFKB 1HUNA 4NP5A 4ODGA 1CZGA 4ZUIA 1I4XA 1LO5D 1O7YA 2EDGA 2Q8TA 5KEEA 1Q90A 1SNPA 1TS5A 2TMPA 2Y0SB 4C3IB 3D6CA 3MFYA 1F9QA 1R4PB 1NR2A 1EIGA 3GV3A 4A3BB 1BCPD 5CORA 4KKTA 4WRDA 3S14B 4DXGA 4J1MA 1S5ED 4OIKA 4JK1C 1LT3D 5C0XI 1QOHA 4R8NA 2E2HB 1VF7A 3VYTA 1A3VA 2DNCA 3UI2A 3TSSA 5KNBA 1PZID 1GJXA 5JJZA 1DYQA 1S5BD 3P20A 1PTOD 5FO8B 2JE6I 3C3LA 1I4GA 2WKDA 2JP1A 1BNZA 4DNRB 3R2IA 5JEAG 5CV5A 1GOZA 2RSNA 1NSNS 1KABA 1BF4A 3NBHA 5CBAE 1JORA 2ZXRA 4BBRB 1OO9B 3PIO3 4DF7A 3H6MA 3HRZC 1K8OA 2KUMA 1SYBA 4N9TA 1Y8OB 1IYUA 4L8JA 1LLRD 3MEHA 3PO2B 5D3DA 5CV8A 1B1ZA 1EZ6A 3ONAB 4NW2A 2X6GA 2MPMA 3ND9A 4KD4A 2PMZB 2JXMB 2IJ0A 3VR4A 3MAQA 1EY4A 2IL8A 4O42A 3PMFA 4FF2A 1SYGA 3LNNA 4BY7B 4ZRZA 2B39A 1SBBB 3FMCA 3K59A 3KBXA 3GTGB 3NTKA 4RFBA 3D31A 4C3HG 4XIGS 3Q6SA 3I8ZA 3GTKB 2KEEA 1XWEA 5C3WA 2E75C 4F8MA 3NSWA 1GHJA 1DD2A 2H1EA 2PQEA 2M2LA 4H0LC 2KOLA 3C1FA 1SE4A 3GO5A 1MI2A 2FJ2A 1ICWA 4K5XA 2NB0A 1RHPA 3EVQA 1H9JA 1WTRA 1YNNC 3RMHA 2HCIA 1SNQA 2E76C 5M9OA 3GTQB 3QIAA 4C1NK 5AFWA 3X3NA 1QE6A 1V1PB 2CW0C 1JWUD 2V4DA 2YYZA 1WD0A 1JR0D 3V96A 1EEFD 4DAPA 3VR3A 3PUVA 1SSOA 4HEDA 4EQPA 5M5XB 3JAML 1F2MA 5HGTA 2PZUA 2DY8A 1KDAA 1EY9A 1GUOA 2K28A 5D14A 3H3VC 1V43A 3H0GB 5CV6A 2Q8IB 5C5LA 3RZOB 1PMRA 1ENFA 1EQTA 2HQEA 2A69D 1AZQA 1EZ8A 1U4RA 1SYEA 5T1IA 2HCCA 5JPNC 1QNUA 2MJ8A 1XXGA 4GZYC 1DOKA 1CTMA 1JOQA 3VYSA 2NVXB 2IX0A 1U4MA 5E4XA 3IFDA 4RHSA 4L63B 4ZQ3A 5I6YA 1DM0B 3KBGA 3BVZA 3D4WA 2XIWA 3E5SA 1TT2A 2HUGA 5TSSA 2F1MA 1EWHA 2F0OA 2JA7B 1ML0D 4HMJA 4ME5A 5IGFA 2WKCA 3T16A 2NVTB 1EL0A 3EQLC 2PNRC 3I70A 4MN3A 1DOMA 2Z8LA 5A2QE 4QB4A 2RDFA 3TZDA 3BZDB 3ITPA 4PQXA 1QWYA 2L1BA 3LWUA 2IX3A 3EFXD 1A3UA 3KUPA 5IOCA 5T1GA 1RODA 1BDOA 2K32A 1PDQA 1IL8A 1ONLA 1VCIA 3RLFA 2CVRA 4IQZA 1PRTC 1SYFA 4OL7A 4OO1I 1CQVA 5ELCA 1WCMB 3OWFA 1CZWA 2XWBB 3QOJA 3MA2B 2ICEC 3HOZB 1BO0A 2B2YA 1CM9A 1WD1A 2X6LA 3MWYW 2SNSA 1HHVA 2K5DA 4RGOS 1ZEQX 1AZPA 1EOTA 1B9MA 2NYZD 5G3LD 1I3QB 1CK1A 5CMDA 4M1UB 2LS01 2DN8A 1SMYD 1SYDA 2OEOA 3MC0B 5A2QL 2B8FA 5EPKA 2F3VA 4IFDH 1UUPA 5NUCA 3GTOB 1TY0A 4K5WA 5I2XA 4K8IA 3Q0AA 1TS3A 2KEDA 1IW7C 4QF4A 4CKEA 1II3A 1EYDA 1QCBD 1PFMA 3RD4A 4PMCA 1CI3M 2A5HA 1RKNA 4IFDJ 3I4LA 2L12A 3I4MB 3P1HA 4A3KB 5KNDA 1HA6A 4C3JG 1U9RA 1ZYRD 1EYCA 3GD7A 1DOLA 1OXTA 2RDGA 1HTLD 2WP8J 5CV9A 1HFNA 3NBIA 4K14A 1XYIA 1FGBD 2G9DA 4XDXA 4ZKCB 4F88A 1I4RA 3NP8A 4IALA 3TBIB 3K5LA 3DUZA 3C2PA 1VMPA 2C5CA 4A3IB 2F03A 2F0GA 2KVMA 1OXUA 2KCNA 1SDFA 2SDFA 1WTQA 4WORA 4RKLA 4PMWA 5K36G 1V8QA 4DU9A 2B2VA 3VR6A 4FNFA 2QEJC 3PUYA 2Q8RE 2R92B 1D1KA 1HQRD 2B2YC 2RDHA 3L9AX 1KDCA 4TKOB 1F9SA 1TS2A 2KQ3A 3TDQA 1T5EA 4XXEA 3EJIA 5JVG3 3M4YA 4L6TB 2BOSA 4A3DB 3W3AA 1F2YA 3K5OA 3URYA 4HSVA 3PUZA 4FF1A 3S2DB 4C3HB 2FMCA 4KV6A 4DAYA 3TP8A 4F7XA 1DJRD 4X3SA 3MHBA 3NWSA 5CV4A 2DNEA 1KAAA 4FVMA 2D2CC 3J81E 3R93A 2PYKA 4KMUC 1STYA 2VNUD 1CHPD 3S16B 3BDOA 5FLXE 2FINB 3MZ5A 1TWGB 3QJYA 5E4WC 1JE4A 2N55A 3J7YW 3SVMA 3M4OB 2NUCA 1D2BA 4B9XA 1JOOA 4H44C 3HS0C 2IX1A 1HTPA 3KF8A 1SNOA 3A8KE 4MHEA 3TP7A 4LAAA 3P7JA 1EY7A 4HSPA 1LV9A 1Y1VB 2LY7A 3BVMA 1LACA 4PV1C 4XQNA 1QG7A 4C56C 4FF4A 3WDNA 1TU2B 1EU3A 2WAQB 4MIUA 2J4XA 3GQBA 1Q8IA 2AQ3B 2GA4B 4RGMA 4BA1I 2VXWA 3S17B 3KLSX 4RCOA 2AQ1B 3Q23A 4HAEA 1UEAB 4X3KA 2SEBD 1SEBD 4FXKC 2KJXA 3A8JE 1L0YB 3J80L 1XTCD 2B2VC 4KY7A 2L4NA 4G4KA 5KRUA 5KNCA 3J81L 2R3ZA 1BCPC 3BDCA 4M8AA 5FLXL 4K8JA 5BN3A 5C44B 3MXUA 4CGYB 1B50A 2NVYB 5EGTA 2EY5A 3KLRA 2FHTA 3AMUA 4QMGA 4KKUA 1PTOC 2WV6D 4X3UA 2RA4A 3K5MA 3DWAA 4FYDA 5D3IB 1DZ1A 2MP1A 3MTSA 2AQ2B 4K2KA 3HKZB 3M85A 3VA5A 2QILA 1Y8PB 4QUFA 4V0BA 2NWGA 5CR3A 3I4NB 4ILWA 2I46A 4RCNA 5K5PA 1I4PA 1OXVA 3ND8A 3SEBA 3J7AV 1SNDA 4CHTB 1IKLA 5KYLA 5ELBA 2Z4IA 1LT5D 2BDNA 2R7ZB 5DM73 1CA5A 3N52A 1HRJA 1G291 3OMGA 2XNAC 1Q1EA 1CT1D 1HPCA 1TY2A 2RQXA 2NBFA 1WTPA 3L3OC 2F4IA 3NWTA 2F3WA 4KD3A 3JAME 3W2DA 4DK1A 5C4JB 2BE5C 2M9VA 1E2WA 4Y7NB 2BE5D 1W6JA 3PIP3 2O2LD 2VB2X 1E0BA 1EFID 4XTCS 1D5ZC 3SR1A 5CGKA 1H9MA 2D9UA 4RGTA 2EPBA 3HZXA 4CJ2C 4QUCA 5JOBA 2NVQB 2B63B 4RH6A 1A6XA 4U673 2EYFA 1RD9D 4K6LA 2F0TA 4ABNA 5BN4A 1SXTA 3T56B 5C0XJ 1BUVT 3GTLB 1ENCA 5JVH3 3S9WA 5DAUA 1FD7D 2ID0A 5ISRA 2AWOA 3H94A 5IT9E 4KTAA 1D6EC 2CQAA 2F0VA 2EYOA 1BXTA 1HXYD 2HDMA 1CHQD 1GUNA 1C48A 2E2JB 5E1FA 1FR3A 1PRTF 5ELDA 4QIWB 2ZT9C 1QB5D 2B2TC 3AU7A 2F0SA 4ZAIA 2WB1B 1PLFA 4KY5A 5FO9B 1PFBA 2TSSA 2L9HA 3R2TA 2XN9C 1STAA 4DK0A 4A93B 1BQQT 4DGZA 3ZYYX 2F0WA 4DN4M 3K7AB 1M4VA 2A69C 4RHRA 4LK1C 4I7ZC 1A2TA 2RVLA 5KGUA 4N9PA 3PUWA 3BVGA 1H9SA 1HUMA 4TQUS 3TMEA 2J7ZA 1O7ZA 1A3TA 1STGA 3IL8A 2PPBC 3K57A 4V190 4XQJA 3BDLA 4RA8A 4C3IG 1I4HA 1LABA 3EA6A 5IODA 2MUYA 4AYBB 5IT9L 1TWFB 1B44D 4KN7C 2KECA 2RKSA 2QCPX 3L7ZC 1AN8A 1PXUA 4G7OC 2K05A 2D5DA 1EWCA 2EJFC 3DWQA 3K6OA 3NQTA 3CKIB 2LMCB 1L0XB 5EKKA 1FNWA 1TR5A 4HCEA 1X3QA 5E3FA 2L11A 4TRDA 4IN3A 1SYCA 1RF2D 1SAPA 1Q12A 1G91A 3BG3A 1D5XC 3K5NA 3GV6A 1X32A 4F87A 3GP7A 4KJOA 4XYQA 5DEHA 1GUSA 1JC7A 3S1RB 1OXXK 2LKVA 4XT3B 3DEPA 1LTGD 1WTWA 3O13A 2PW7A 1GUTA 4CKCA 2O5IC 3FKIB 5I9OA 4IZ8A 1AEXA 1SMYC 1LTID 1G2SA 3OOCA 2MHVA 3T13A 1F9PA 4QCLA 3NUCA 2F0JA 1V1OA 2JA5B 3NPPA 1F77A 2MGSA 1MD2D 3CQZB 5EQ0A 5CC4A 1DONA 1LTRD 2PZWA 2KA7A 2K5QA 1CA6A 1ENAA 4G57A 5FK9C 2XWJB 1U4LA 1F2ZA 4PNYA 2F0PA 2JYOA 3BYYB 1F2LA 2X69A 1ZYRC 1K8MA 1HCZA 1S5CD 3CRKC 3TN2A 4IFDG 2ENBA 2PZTA 1DXMA 3TZUA 1A15A 1NCVA 2F0LA 5IGBA 2B2WA 2M00A 3EROA 1MSHA 4Q0FA 2QDBA 3HGBA 2K1BA 4BA2I 3DMUA 1JWSD 4XT1B 2O4XA 1HFGA 5ELFA 3TP6A 2EE1A 1Z6HA 1RTOA 4ZK9B 1GXDC 3D4RA 1I4QA 2E74C 5FOBB 5IGDA 1ZXTA 3FPPA 2F0MA 1YNJC 2SOBA 1YNJD 3NK9A 1MSGA 4B08A 1PRTB 3QOLA 3LWEA 4KJNA 3CRLC 1PFNA 1BCPF 4DXFA 4IUNA 1STNA 1XX8A 1EY0A 3J80E 2EVBA 4S3SA 4ZKBB 2NTTA 1CQFA 5LL6S 1E2VA 1MBYA 3M7NA 4R8IA 4HR7B 4C2MB 5I9PA 3PO3B 1PTOF 4G7ZC 1TWAB 1S5FD 4RGNA 4WJWA 5FO7B 1ILQA 1NAPA 5EPLA 2JSOA 4OHJA 2L5TA 1H9SB 4EQNA 2JA6B 2WIIB 3Q24A 2F0KA 2CHBD 3OPOA 2LFNA 4KI0A 4P2CB 2F0HA 4CBVA 3I90A 4KKSA 3KK7A 1AW7A 3S15B 2NN6H 1NUCA 1EU4A 2B2WC 4IURA 4XQQA 5M3FB 2E2IB 2BA0A 4J6HA 1FNVA 4FF3A 1H9KA 4RKBA 1GHKA 1EY8A 2A6HD 1PYWD 1EY5A 3T4AC 1U4PA 1RDPD 2H4OA 2K7VA 3S2HB 3I3CA 3A8IE 4KHZA 2F0NA 2PO4A 3IKJA 2NN6G 5M3MB 1J9OA 1B4OA 3E0JA 3K0YA 2QF7A 4CJ1B 1B53A 4LJZC 1STBA 2F0DA 3VR5A 1O78A 3LX0A 2EYPA 3HG9A 5JEAH 4ULLA 2EY2A 1C8CA 3SXHA 2EYJA 5KIXA 3V05A 2DY7A 1GUWA 4A3MB 3C46A 3SK5A 3QWNA 2G9HD 2L0CA 1LT4D 1JQYD 3CU7A 4FXGC 2BDOA 1SNMA 1X3PA 2B2TA 2K04A 5JEAJ 3MXGA 5I6WA 1SJHD 2B2UC 2K6AA 5EKLA 3BS1A 3G6JB 1D5MC 5J39A 4XYOA 3NTIA 4EQOA 5LHY1 1TWHB 3I91A 5IGGA 1TIID 1KLUD 3A56A 5C4XB 3PUXA 1STEA 4RAUC 1AP0A 3WOEA 3FRPB 1SE2A 4BS9A 3SK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSG A;  3IL8 A;  2JP1 A;  1PFM A;  4MN3 A;  1G2S A;  1DOM A;  1BNZ A;  1MI2 A;  4U68 A;  1F9P A;  2FJ2 A;  1E0B A;  4X3S A;  5EKI A;  1JIC A;  1ICW A;  1RTN A;  3LWE A;  2K03 A;  1IKM A;  2RSN A;  1B2T A;  1KNA A;  3TZD A;  1WTX A;  4RA8 A;  3HP3 A;  1RHP A;  1U4P A;  2MGS A;  2L12 A;  3DEO A;  3R93 A;  1BF4 A;  1PFN A;  2FHT A;  3I3C A;  2D9U A;  2EPB A;  1WTR A;  5EQ0 A;  4CJ2 C;  2L1B A;  1HA6 A;  2FIN B;  2HCI A;  2RSO A;  4QUC A;  4X3U A;  2RA4 A;  1DON A;  5CBA E;  1QNK A;  1ESR A;  4UAI A;  3D6W A;  1DOL A;  3KUP A;  5T1G A;  1CA6 A;  1XX8 A;  1ROD A;  1PDQ A;  1HFN A;  1J9O A;  1B4O A;  5E4W C;  2HDL A;  1IL8 A;  1JE4 A;  2MP1 A;  2NZ1 D;  2N55 A;  5AFW A;  3MTS A;  2KEC A;  1QE6 A;  3SVM A;  1XYI A;  2CVR A;  1G2T A;  1U4L A;  1EIH A;  5D65 A;  1B53 A;  4CJ1 B;  1AZQ A;  4ZKB B;  5EPJ A;  2KUM A;  4QUF A;  2NWG A;  4XDX A;  4ZKC B;  2K05 A;  1WD0 A;  1MGS A;  2JYO A;  5COY A;  4IUV A;  1VMP A;  1NR4 A;  1DZ1 A;  1J8I A;  3H91 A;  4R8I A;  4MHE A;  1F2L A;  4X3T A;  2KVM A;  4IUQ A;  1SSO A;  3P7J A;  1C8C A;  2X69 A;  4IUU A;  5CBE E;  2FFK B;  3DM1 A;  4HED A;  1BO0 A;  1HUN A;  2B2Y A;  1X3Q A;  1CM9 A;  1LV9 A;  4LMQ D;  2L11 A;  2X6L A;  1SDF A;  2DY7 A;  2SDF A;  3G7L A;  5EJW A;  1QG7 A;  3TN2 A;  4IUT A;  1WTQ A;  3FPU B;  1O7Y A;  3MWY W;  2X6G A;  2MPM A;  1S4Z A;  1SAP A;  2DY8 A;  3ONA B;  4NW2 A;  1A15 A;  1BBX C;  1NCV A;  1HHV A;  2HDM A;  2K28 A;  1RJT A;  1G6Z A;  5D14 A;  2Q8T A;  1B3A A;  1G91 A;  2B2V A;  1X32 A;  1IKL A;  2N88 A;  1KNE A;  1ILQ A;  3GV6 A;  1WD1 A;  1NAP A;  5EPL A;  1AZP A;  2VXW A;  1EOT A;  1EQT A;  1F9Q A;  1WVL A;  2B2W A;  1NR2 A;  1EIG A;  2B2T C;  2BDN A;  2IL8 A;  2NYZ D;  2Q8R E;  1U4R A;  3GV3 A;  3QO2 A;  4O42 A;  4OIJ A;  3N52 A;  5T1I A;  1WTO A;  1HRJ A;  1MSH A;  2HCC A;  1X3P A;  5COR A;  2B2T A;  1WTV A;  2B2Y C;  4HAE A;  2K01 A;  1O80 A;  2FMM A;  2K04 A;  4X3K A;  4ZAI A;  5CMD A;  2MJ8 A;  1DOK A;  2K1B A;  4OIK A;  1PLF A;  3KBX A;  1PFB A;  1F9S A;  2B2U C;  2L9H A;  5DNF A;  4XT1 B;  4IUP A;  1HFG A;  1U4M A;  3I90 A;  3Q6S A;  5E4X A;  3IFD A;  2B2U A;  2EE1 A;  3I8Z A;  3F2U A;  1WTP A;  2B2V C;  2KEE A;  3UI2 A;  2EOT A;  4XT3 B;  5EPK A;  1RTO A;  3FDT A;  4DN4 M;  4ZK9 B;  2B2W C;  1F9R A;  4IUR A;  3DEP A;  2L4N A;  4R9W A;  2XIW A;  1WTW A;  5JJZ A;  2R3Z A;  4ZLT F;  3I91 A;  2RVL A;  4RWS C;  4HSV A;  2HUG A;  1ZXT A;  2KED A;  1ILP A;  1TVX A;  4HCS A;  1HUM A;  1VMC A;  2H1E A;  2J7Z A;  1ML0 D;  1Q3L A;  2M2L A;  1M8A A;  4CJ0 B;  2KOL A;  4RAU C;  1CA5 A;  1AP0 A;  1GUW A;  1O7Z A;  1B50 A;  1EL0 A; 
#chains in the Genus database with same CATH topology
 1CSP A;  2GVB A;  3SE0 A;  2EIF A;  2E8G A;  1VDZ A;  2AUK A;  2QA4 A;  2C9O A;  4HMI A;  3S2D H;  4Z9C B;  2EYL A;  2ZM6 L;  1EQV A;  3HOV B;  4C3H H;  2IWH A;  5JAV A;  5ELE A;  5GQO A;  3UE0 A;  2R93 B;  2PI2 A;  2ZXP A;  4JI6 L;  3QG1 A;  4DV5 Q;  4EVO A;  2IPK D;  3DWP A;  5LL6 X;  3HOU G;  4KK7 A;  4R4O A;  5IP7 G;  3NQI A;  4YIJ A;  2QW7 A;  1T9H A;  4IPG A;  3I55 A;  1U0L A;  3K8A A;  4A3E B;  4C2M H;  3H09 A;  3K7U C;  2OT2 A;  4I65 A;  4GN4 B;  1SN8 A;  3S16 H;  1C4Q A;  3F2D A;  5C0X H;  4A3D G;  2F0E A;  4C1N I;  1UAP A;  1J8I A;  2A73 B;  1TWA H;  2VUM G;  3RUZ A;  3OTO Q;  3M4O H;  4JYA Q;  3I72 A;  5M5Y B;  2G5D A;  4EGV A;  3DM1 A;  2BCO A;  5CBE E;  5CV7 A;  2VW9 A;  1VQ8 A;  1PZK D;  5HUR A;  2ZXO A;  4NXM Q;  2I07 B;  3FPU B;  5IYC G;  2HHH Q;  3NE5 B;  1Y69 U;  1I94 Q;  1VQK A;  2QEX A;  1RJT A;  1G6Z A;  1OXS C;  2R6G A;  3J80 c;  2JA6 H;  1LTB D;  2EXZ A;  1KNE A;  3D8G A;  1Y1V H;  2KCC A;  2MNA A;  1PYB A;  2I5L X;  2Z1C A;  1B9N A;  3QO2 A;  5C3E B;  5IIF A;  1BCP B;  4C3J B;  3J81 c;  4A3G B;  1X3F A;  1Y1W B;  2K01 A;  5A35 A;  1L1O B;  5HGQ A;  3CMA A;  5FLX c;  5C0X G;  5M3F H;  3J80 i;  1PH9 A;  2SNM A;  1AFP A;  3VR2 A;  4JOI A;  3S17 H;  3FEW X;  4HTH A;  4KY6 A;  4LF8 Q;  4B3T L;  2LSS A;  2AHO B;  3SK6 A;  4X65 Q;  2A74 C;  1YNX A;  4ZLT F;  1TKW B;  1BOS A;  5IGE A;  4RWS C;  4HJ7 A;  4DR6 L;  3W5O A;  1TVX A;  1CFM A;  2Z4H A;  2F52 A;  1JE5 A;  1YNN D;  3HOW B;  4YY3 L;  3BU2 A;  3S1N B;  1PTO B;  1LTA D;  2F4V L;  5IP9 H;  3M7G A;  1XNQ L;  4A3J B;  1M90 C;  3FVQ A;  3S2H H;  4DAY B;  2EY6 A;  1KC8 C;  4BY1 G;  3SK4 A;  2N3S A;  4FXD A;  4DAV A;  3DHQ A;  1RTN A;  1YHA A;  4KHP Q;  2CW0 D;  2K5H A;  3OSO A;  1WTX A;  1Z7T A;  2NVY H;  1U5K A;  4NMZ A;  3KLS A;  5G3L F;  3SHL A;  3J7A F;  3IAY A;  1QVC A;  1HH2 P;  1YEZ A;  1JMC A;  1I6H B;  2E2D C;  2K5V A;  4NPS A;  2AWN A;  3A7A B;  5C3X A;  2JEB I;  3I4O A;  2EYH A;  1VQN A;  2NZ1 D;  1FJG Q;  5I4D A;  1EIH A;  5D65 A;  4H7B A;  1JB3 A;  1G6P A;  4K5V A;  5EPJ A;  4H13 C;  3U4V A;  3OHX C;  1VQF A;  1EY6 A;  3C1E A;  1LTT D;  2VB3 X;  1PH6 A;  1ESF A;  3OW7 A;  1LTS D;  4IUU A;  3PIP A;  3KDF A;  5J22 A;  5C4H A;  4TSS A;  2F0Q A;  1QIL A;  3G7L A;  5C44 G;  3GTJ B;  5EJW A;  1KD1 C;  2WAC A;  4P73 A;  2R7F A;  4IFD I;  4IUT A;  3I4N H;  1TQO A;  2VQE L;  1PH8 A;  1S4Z A;  1Z47 A;  1YBY A;  2RBM A;  1VQ6 A;  3MFG A;  4H02 A;  5BN5 A;  1B3A A;  5DM6 3;  3M4Q A;  2YU9 B;  4BBS B;  1WTH A;  1SFO B;  1N33 L;  4DV7 Q;  4Q5V A;  2ZJP A;  3U9S A;  4JG2 A;  3MXN A;  1S72 A;  1Q82 C;  2VQF Q;  3E6Z X;  3M4P A;  1R9T B;  4GKK Q;  4DV3 L;  1JWM D;  2P5Z X;  4DPG A;  4OGQ C;  3M3Y B;  1XNR L;  2IW3 A;  5GAE C;  2UXC L;  3MXP A;  4KHV A;  3TRE A;  5C4X H;  3T51 B;  2EOT A;  2PQA A;  5CYU A;  1K83 B;  2IT1 A;  2F0I A;  1MHW C;  2F0F A;  3ERQ A;  2CH4 A;  3CCU A;  2EZV A;  1ASZ A;  2K75 A;  1SE3 A;  3R3O A;  3F2C A;  3HOV H;  4LFB Q;  4LUO A;  4JOI C;  4ZUJ A;  4O1N A;  4P75 A;  4BBR G;  1BR9 A;  1QZG A;  4LFC L;  4HJ9 A;  3OIP A;  3CHB D;  1PRT D;  1B2T A;  4LF9 L;  2L15 A;  1KNA A;  4DFA A;  3MVV A;  1X9N A;  4L5T A;  3HP3 A;  1UE6 A;  4Y7N H;  2R7Z G;  2K33 A;  2R61 A;  4BXX H;  1VQI A;  3QB3 A;  3D3R A;  5JPM C;  2RSO A;  1FYC A;  1VQA A;  4B3M Q;  1QNK A;  1ESR A;  1S5D D;  1W6K A;  4UAI A;  3VDY A;  1PZJ D;  2XRS D;  2HDL A;  4KN4 C;  4UDU C;  3GTP B;  2D62 A;  4JBW A;  4OON A;  5GAD C;  3VYR A;  3PF5 A;  4NDX A;  2ZM6 Q;  3WOF A;  1MGS A;  2L55 A;  3H91 A;  4A3F B;  5IWA Q;  1HR0 L;  5IE8 A;  4JI6 Q;  1XJV A;  3PV0 A;  1Q46 A;  3X3M A;  3HOY B;  1I6V C;  4BY7 G;  4DK3 C;  4LMQ D;  4JCV E;  4FO2 A;  2A8V A;  2XTI A;  3GTL H;  3JAM c;  1I50 B;  5C3E H;  2Q2U A;  2PW5 A;  4BXX G;  3AB9 A;  3DXJ C;  2DJG C;  3DLL A;  1VQG A;  1UNS A;  3RZD B;  1GD7 A;  2YTV A;  1P8L A;  2EJG C;  4OIJ A;  4G7H C;  3S1M B;  1WTV A;  4WJ4 A;  4E6I A;  1IW7 D;  1HZC A;  2E2J H;  1ASY A;  1BVS A;  1O80 A;  5F2D A;  3N6R A;  5EBD A;  2B63 G;  3OYY A;  2WIN B;  4IUP A;  1GUG A;  3IFT A;  1EQR A;  3F2U A;  1Y14 B;  3HOW H;  3EIV A;  1RL2 A;  1PTO H;  3FDT A;  1AE3 A;  1XTD A;  1F9R A;  3BZC A;  3SDZ A;  2B8G A;  4NKL A;  2JA8 B;  1ET6 A;  1SMX A;  5K36 H;  1ILP A;  4OO1 H;  2AUJ D;  4HN7 A;  4HCS A;  4A93 H;  4BWG B;  1Y8N B;  4JI7 L;  1Q3L A;  4FP5 D;  1M8A A;  4CJ0 B;  2XVS A;  3K7A H;  1A63 A;  1ET9 A;  5IT9 c;  4ID6 A;  1FNU A;  4U68 A;  5EKI A;  1ZKO A;  3RLO A;  1JIC A;  1BBU A;  1JOK A;  2AKW B;  1I6H H;  2EY1 A;  1T5X D;  4IPD A;  5C4Z A;  3EN2 A;  1HA5 A;  2B29 A;  3R8B A;  2O5J C;  3TP5 A;  2PCF B;  4J8Q A;  4YY3 Q;  4DV5 L;  2NN6 I;  1Q1B A;  4QGU A;  2WB1 G;  2F0U A;  3BYT B;  3PF4 A;  1SNC A;  5FKA C;  1AE2 A;  1E2Z A;  3K58 A;  2JA9 A;  3CME A;  2OF1 A;  3OIQ A;  4CKB A;  3CC4 A;  1G2T A;  4OO1 G;  3OMC A;  5KYI A;  3PSI A;  1I5F A;  4IUV A;  3VA7 A;  1STH A;  1HNZ Q;  1IBM Q;  2BA1 A;  1K73 C;  4X3T A;  3HOU B;  5J1Z A;  3OTO L;  1HQM C;  4JYA L;  1D1I A;  1TS4 A;  4X64 Q;  2HIV A;  2XSC A;  3KF6 A;  4MNO A;  1BBX C;  2HHH L;  3A7L A;  1I94 L;  2KCT A;  3A55 A;  1PA6 A;  2XRQ D;  1KLG D;  3AYH B;  4DA2 A;  1V1P A;  3H15 A;  1O7I A;  2K5W A;  1KTK A;  2KHI A;  2N88 A;  2A68 C;  3HEJ A;  3CF5 A;  1S40 A;  3I73 A;  1WVL A;  2VUM B;  2A68 D;  1WTO A;  2A6E C;  1IYJ B;  1E24 A;  2A6E D;  3TEH B;  2FMM A;  2Z6K A;  3J81 j;  4IJH A;  4QQB X;  1KDB A;  4DR2 Q;  4GLV B;  4AYB G;  1K83 H;  4PMB A;  1VF5 C;  4HIK A;  3CCJ A;  1PV4 A;  5DNF A;  1RCV D;  5C6A A;  2B2U A;  5M5W B;  1R4Q B;  2QKI C;  1QUQ B;  3HOX B;  2KHS A;  3A54 A;  4LF8 L;  1HNW L;  4WFN 3;  1X3G A;  1N33 Q;  4R9W A;  4X65 L;  1QJO A;  5C5M A;  3S1R H;  3PQI A;  3G6E A;  1EEI D;  1VMC A;  3S1Q B;  2OXP A;  1H9R A;  3NHH A;  1XNR Q;  3AFQ A;  2IHE A;  4ALP A;  1PH3 A;  4AQY L;  2NTS A;  1IHZ A;  3FKI H;  5EBC A;  2K03 A;  1KRS A;  1CKM A;  2KCM A;  3VYU A;  4KHP L;  1IKM A;  2PMZ E;  1DCZ A;  1A2U A;  1PH4 A;  3DEO A;  2JEA I;  3NTH A;  2Z0S A;  1TWC B;  4B9W A;  3KDF B;  1GM5 A;  1G8Z D;  2CWA A;  1IYV A;  3D6W A;  3OWE B;  2JA5 H;  3D4D A;  1PYS B;  2EQS A;  2EYM A;  2VY3 A;  3P75 A;  4BY1 B;  4A3F H;  1EYA A;  2ZTD A;  2ZTE A;  5IGC A;  1LT6 D;  2ICI A;  2A6H C;  2J0T D;  3CQZ H;  5I2Y A;  4L5S A;  4DNT B;  3T53 B;  3V2T A;  1O7L A;  4LF9 Q;  2EJM A;  4K2L A;  5IYD H;  5COY A;  1SJE D;  1NR4 A;  1CUK A;  1JCK B;  4K6D A;  4ZYS A;  3Q22 A;  3GTM B;  3U9O A;  4IUQ A;  3NXW A;  4O2D A;  2HD3 A;  2FFK B;  3H3V H;  1HUN A;  4NP5 A;  4ODG A;  1CZG A;  4ZUI A;  1I4X A;  4NB3 A;  1K0R A;  1LO5 D;  1O7Y A;  2EDG A;  2ZJR A;  2Q8T A;  2PQA B;  5KEE A;  1Q90 A;  2VS1 A;  4GOP A;  4P72 A;  1SNP A;  1TS5 A;  2TMP A;  2Y0S B;  4C3I B;  1GVP A;  4A75 A;  3D6C A;  3MFY A;  1XPU A;  1F9Q A;  1R4P B;  1S3O A;  2K50 A;  2RHS B;  1NR2 A;  1EIG A;  4OEL B;  4DV7 L;  3GV3 A;  4A3B B;  3CW2 C;  1BCP D;  5COR A;  1HR0 Q;  4KKT A;  4WRD A;  1JT8 A;  1HR0 W;  3S14 B;  4DXG A;  4GKK L;  4J1M A;  3W1G A;  1S5E D;  4OIK A;  2ATW A;  4JK1 C;  1LT3 D;  5C0X I;  1QOH A;  4R8N A;  2E2H B;  1VF7 A;  3AQQ A;  3VYT A;  1A3V A;  4GLA C;  2DNC A;  3UI2 A;  1SE8 A;  3TSS A;  5KNB A;  4LUZ A;  1PZI D;  4ZCK A;  1GJX A;  5JJZ A;  2YTY A;  2HT1 A;  1VQM A;  2Z6K C;  3I4M G;  1DYQ A;  1S5B D;  3P20 A;  4A3K G;  1PTO D;  5FO8 B;  2JE6 I;  4JI2 L;  4QY7 A;  3C3L A;  2VL6 A;  1I4G A;  4OWT B;  2WKD A;  2JP1 A;  1BNZ A;  2UUA Q;  4DNR B;  3R2I A;  5JEA G;  5CV5 A;  1GOZ A;  2RSN A;  1NSN S;  1KAB A;  1BF4 A;  2FXQ A;  2EXD A;  3NBH A;  3W1B A;  5CBA E;  1C9O A;  2F3I A;  4B3M L;  1JOR A;  2ZXR A;  4BBR B;  4HJ8 A;  2UU9 Q;  4A3L H;  1OO9 B;  3PIO 3;  1KQS A;  4LUV A;  4DF7 A;  3H6M A;  1E1O A;  2UXB L;  2E5L Q;  3HRZ C;  4OX9 L;  4R4C A;  1KIX A;  1K8O A;  2KUM A;  3WWV A;  1NMF A;  1SYB A;  4N9T A;  1Y8O B;  1IYU A;  4L8J A;  4K0K L;  1LLR D;  3MEH A;  2R7D A;  2R92 G;  5IWA L;  2YV5 A;  3PO2 B;  5D3D A;  5CV8 A;  1B1Z A;  1EZ6 A;  2UUC L;  3ONA B;  4NW2 A;  2X6G A;  2MPM A;  1KHI A;  2UXD Q;  3ND9 A;  4KD4 A;  2PMZ B;  2JXM B;  2IJ0 A;  3PO3 H;  4YHH Q;  3VR4 A;  3STB C;  1J5E Q;  3MAQ A;  1EY4 A;  1KL9 A;  3STB D;  2IL8 A;  4O42 A;  3PMF A;  4FF2 A;  4DV0 Q;  5FJ8 G;  3RN5 A;  1VQ5 A;  1SYG A;  3LNN A;  1GO3 E;  4BY7 B;  4ZRZ A;  2B39 A;  1SBB B;  3FMC A;  3K59 A;  3K80 C;  1NNX A;  3KBX A;  3GTG B;  3NTK A;  4RFB A;  3D31 A;  4C3H G;  4XIG S;  3Q6S A;  4JC0 A;  4GOP C;  4LF5 Q;  3I8Z A;  3GTK B;  2KEE A;  1XWE A;  3K0X A;  1CKN A;  4DV1 Q;  5C3W A;  2E75 C;  4F8M A;  3NSW A;  1GHJ A;  1DD2 A;  2H1E A;  4JBK A;  3S15 H;  2PQE A;  2M2L A;  4H0L C;  1WYD A;  2KOL A;  3ZJY C;  2CCZ A;  3C1F A;  4CDF C;  1XPR A;  1SE4 A;  3GO5 A;  2E2I H;  1TWC H;  1K0S A;  1MI2 A;  2FJ2 A;  1ICW A;  4K5X A;  1HNW Q;  2NB0 A;  1VQL A;  1PH1 A;  1RHP A;  1PHJ A;  4GNX A;  3EVQ A;  3BJU A;  1H9J A;  4HJ5 A;  1WTR A;  1YNN C;  3RMH A;  2HCI A;  4R1J A;  2JA6 G;  1SNQ A;  2E76 C;  3CXC A;  2CH4 W;  5M9O A;  1N34 Q;  3GTQ B;  3QIA A;  1Y1V G;  4C1N K;  1YIT A;  3GTM H;  5AFW A;  3X3N A;  1QE6 A;  4AQY Q;  2Q2T A;  1V1P B;  4J15 A;  2WAQ G;  2CW0 C;  1JWU D;  4LNQ A;  2V4D A;  2YYZ A;  1WD0 A;  1JR0 D;  5M3M H;  3V96 A;  1EEF D;  3PGZ A;  1MJE A;  5M3F G;  1HNZ L;  4DAP A;  3VR3 A;  1IBM L;  3PUV A;  1SSO A;  2N8N A;  2DJF C;  4HED A;  4EQP A;  4C3I H;  3JAM L;  5M5X B;  1F2M A;  5HGT A;  4UP8 A;  2OTL A;  1E1T A;  4X64 L;  1HZB A;  2PZU A;  4A3B H;  2DY8 A;  3AEV A;  1KDA A;  1Q86 C;  1EY9 A;  1GUO A;  2K28 A;  5D14 A;  3H3V C;  1VQD A;  1V43 A;  3S14 H;  3H0G B;  5CV6 A;  3QR8 A;  5C5L A;  2Q8I B;  3RZO B;  1PMR A;  3CCR A;  1ENF A;  4IPH A;  1EQT A;  2HQE A;  2A69 D;  2OQK A;  5IP9 G;  1AZQ A;  1EZ8 A;  1U4R A;  4A3M H;  1SYE A;  3T1H L;  5T1I A;  1WOC A;  2HCC A;  4LWC A;  5JPN C;  2LXJ A;  1PH7 A;  1QNU A;  1VQP A;  2MJ8 A;  1XXG A;  4GZY C;  1DOK A;  1CTM A;  2KHJ A;  4DR2 L;  1JJ2 A;  1JOQ A;  1H95 A;  1TXY A;  3VYS A;  1EUJ A;  2NVX B;  2IX0 A;  1U4M A;  5E4X A;  2D0P A;  1P16 A;  3IFD A;  4L63 B;  4RHS A;  4ZQ3 A;  4IO9 A;  1UE1 A;  5I6Y A;  2RF4 A;  3KBG A;  1DM0 B;  3BVZ A;  3D4W A;  2VZA A;  2XIW A;  3E5S A;  1TT2 A;  2HUG A;  5TSS A;  2F1M A;  1EWH A;  2F0O A;  4DV2 Q;  2H5X A;  2JA7 B;  1ML0 D;  4HMJ A;  4ME5 A;  3CP0 A;  5IGF A;  2WKC A;  3T16 A;  2NVT B;  1NY4 A;  2ZJQ A;  4DR5 Q;  1EL0 A;  4MTK A;  1TWH H;  2ASB A;  3EQL C;  2PNR C;  3I70 A;  4MN3 A;  1DOM A;  3ICE A;  5ELN A;  4DR7 Q;  2Z8L A;  5A2Q E;  3KJP A;  4QB4 A;  2RDF A;  3HKZ G;  3UDI A;  3TZD A;  3BZD B;  3ITP A;  4PQX A;  1QWY A;  1RIP A;  3I4N G;  1YIJ A;  2L1B A;  1SRO A;  3LWU A;  2IX3 A;  2A1A A;  3EFX D;  1A3U A;  3KUP A;  5IOC A;  5T1G A;  1ROD A;  1BDO A;  2K32 A;  3RN2 A;  1PDQ A;  4JI2 Q;  1YJW A;  1IL8 A;  1ONL A;  1VCI A;  2DUD A;  3RLF A;  3U4Z A;  2CVR A;  2R93 H;  4IQZ A;  3PO2 H;  1PRT C;  1SYF A;  4OL7 A;  4OO1 I;  1CQV A;  5ELC A;  1WCM B;  1VS0 A;  4GNX C;  3OWF A;  1CZW A;  4JI4 L;  1N36 Q;  4DUZ Q;  2XWB B;  1Q81 C;  3QOJ A;  3MA2 B;  4A3E H;  4BS9 A;  1Z9F A;  4PZ6 A;  2ICE C;  3HOZ B;  1BO0 A;  2B2Y A;  1CM9 A;  5C4X G;  1WD1 A;  2X6L A;  4PZ8 A;  3MWY W;  2SNS A;  1HHV A;  2K5D A;  4UP7 A;  5ELO A;  4RGO S;  1NJI C;  4GKJ L;  2UXB Q;  5M5Y H;  1ZEQ X;  1VQ9 A;  4OX9 Q;  4GN5 A;  1AZP A;  4AH6 A;  1EOT A;  5BR8 Q;  3KJO A;  1B9M A;  2NYZ D;  3HOV G;  5G3L D;  4K0K Q;  2R93 G;  1I3Q B;  3CCL A;  1CK1 A;  5CMD A;  2UUC Q;  2MO0 A;  4M1U B;  2LS0 1;  2DN8 A;  4C3J H;  1SMY D;  1SYD A;  2OEO A;  4A3G H;  1GKH A;  3MC0 B;  5A2Q L;  1Y1W H;  2B8F A;  5EPK A;  2F3V A;  4IFD H;  1UUP A;  5NUC A;  3GTO B;  1QVF A;  1TY0 A;  2BH2 A;  4K5W A;  5I2X A;  4K8I A;  3Q0A A;  1TS3 A;  2KED A;  1IW7 C;  2RCF A;  5IYB H;  4LF4 L;  4QF4 A;  4CKE A;  3KFU A;  3RNU A;  1II3 A;  1SRU A;  1EYD A;  1EYG A;  1QCB D;  1PFM A;  3DM3 A;  1PH5 A;  2UUA L;  3KYH C;  3RD4 A;  4PMC A;  3S1N H;  1CI3 M;  2A5H A;  1D7Q A;  1RKN A;  1B3Q A;  4A3J H;  4IFD J;  3I4L A;  2L12 A;  3I4M B;  4WJ3 M;  3P1H A;  4A3K B;  3TRZ A;  5KND A;  5C3E G;  1HA6 A;  4C3J G;  1U9R A;  4A3G G;  1LM0 A;  1ZYR D;  1EYC A;  3GD7 A;  3ULL A;  1DOL A;  1OXT A;  2RDG A;  1HTL D;  2WP8 J;  5CV9 A;  2UU9 L;  1HFN A;  3NBI A;  4K14 A;  4YWL A;  1XYI A;  5HY6 A;  1FGB D;  2ES2 A;  2G9D A;  2E5L L;  5M5X H;  3I2Z A;  4XDX A;  4A4I A;  4F88 A;  1I4R A;  3NP8 A;  4ZKC B;  4IAL A;  3TBI B;  3K5L A;  3DUZ A;  3C2P A;  1VMP A;  2C5C A;  3CD6 A;  4A3I B;  2I0Q A;  4HIO A;  2F03 A;  4TVA B;  2F0G A;  2Y0S E;  2KVM A;  1OXU A;  2KCN A;  3HOW G;  4HIM A;  1SDF A;  2SDF A;  1WTQ A;  4WOR A;  2UXD L;  4LW1 A;  4RKL A;  4PMW A;  5K36 G;  1V8Q A;  4DU9 A;  2RCN A;  4A93 G;  2B2V A;  4YHH L;  1QVG A;  3CC2 A;  3VR6 A;  2Z9H A;  2OCE A;  3GTJ H;  1EIF A;  4FNF A;  2QEJ C;  1J5E L;  5IY0 A;  3PUY A;  2Q8R E;  4B3R Q;  2R92 B;  4DV0 L;  1D1K A;  1HQR D;  2B2Y C;  2RDH A;  4L5R C;  2WFW A;  3L9A X;  2UUB Q;  2YU9 H;  4BBS H;  1KDC A;  4TKO B;  1SFO H;  1VQB A;  3E9I A;  1F9S A;  1TS2 A;  2KQ3 A;  3TDQ A;  1T5E A;  4XXE A;  3EJI A;  4B3S Q;  5JVG 3;  3M4Y A;  4LF5 L;  4L6T B;  2JA7 H;  3U50 C;  1R9T H;  2CQO A;  2BOS A;  4A3D B;  3H3V I;  3W3A A;  1X55 A;  1F2Y A;  2NVT H;  3M3Y H;  4DV1 L;  3K5O A;  1IXR A;  1CKO A;  5L37 A;  3URY A;  4JPB W;  3T1H Q;  4HSV A;  3PUZ A;  4FF1 A;  3S2D B;  1N8R C;  4C3H B;  4DUY Q;  2FMC A;  4KV6 A;  4DAY A;  1FL0 A;  3TP8 A;  3CCS A;  4F7X A;  1DJR D;  4X3S A;  3MHB A;  3NWS A;  5CV4 A;  2DNE A;  1KAA A;  4FVM A;  1CSQ A;  4RG1 A;  2D2C C;  3J81 E;  1E22 A;  3R93 A;  3JC6 6;  2PYK A;  4KMU C;  1STY A;  2VNU D;  3TQY A;  1CHP D;  3S16 B;  3BDO A;  5FLX E;  2FIN B;  1WCM H;  2KBN A;  2JQO A;  1PVO A;  3MZ5 A;  1JJC B;  1TWG B;  1N34 L;  3QJY A;  5E4W C;  1JE4 A;  1HZA A;  2N55 A;  3J7Y W;  3SVM A;  3M4O B;  2NUC A;  3HOZ H;  4DK6 C;  1D2B A;  4B9X A;  2D0O A;  1JOO A;  4H44 C;  4A3C H;  2CWP A;  3HS0 C;  2IX1 A;  1HTP A;  3KF8 A;  1SNO A;  3A8K E;  4PG3 A;  4MHE A;  2OTJ A;  3TP7 A;  3GTP H;  4LAA A;  3P7J A;  1YJ9 A;  1EY7 A;  1K3R A;  4HSP A;  1LV9 A;  1Y1V B;  2LY7 A;  3BVM A;  1LAC A;  4PV1 C;  4XQN A;  4JI3 Q;  1QG7 A;  4C56 C;  4FF4 A;  3WDN A;  1TU2 B;  4MTN A;  1EU3 A;  3Q8D A;  2WAQ B;  4MIU A;  1EFW A;  2J4X A;  4EQ5 A;  3GQB A;  1Q8I A;  3T1Y L;  2AQ3 B;  2GA4 B;  3HOY H;  4RGM A;  1NE3 A;  4BA1 I;  4DR1 Q;  4JI4 Q;  2VXW A;  4R4Q A;  1IBK L;  3MXN B;  1LTL A;  2KEN A;  1I50 H;  3S17 B;  3KLS X;  4RCO A;  2AQ1 B;  3Q23 A;  4HAE A;  1UEA B;  3FP9 A;  4X3K A;  2SEB D;  1SEB D;  1E7Z A;  4FXK C;  1SLJ A;  2KJX A;  3FKI G;  3RZD H;  3GTO H;  3A8J E;  4AIM A;  1L0Y B;  3J7Z C;  3CPW A;  4DKA C;  3J80 L;  4UPA A;  1JJG A;  3S1M H;  1XTC D;  2B2V C;  4GKJ Q;  1K8G A;  4KY7 A;  2L4N A;  2K52 A;  4G4K A;  4JVZ A;  1KRT A;  5KRU A;  5KNC A;  3J81 L;  2R3Z A;  2ZTC A;  1C7Y A;  2JA5 G;  1BCP C;  3BDC A;  4GLX A;  4A3F G;  4JI1 Q;  4M8A A;  3S24 A;  5FLX L;  4DV2 L;  4K8J A;  1L1O C;  5BN3 A;  5C44 B;  3MXU A;  4CGY B;  3F1Z A;  4YWM A;  4OWX B;  4IJL A;  5FLM H;  1B50 A;  2NVY B;  5EGT A;  5IYD G;  4DR5 L;  2JA8 H;  2EY5 A;  3KLR A;  4DR7 L;  4O0A A;  5DLQ E;  1YJN A;  3U58 A;  2FHT A;  3AMU A;  3CCE A;  4QMG A;  3CCV A;  4KKU A;  1PTO C;  2WV6 D;  4X3U A;  4LF4 Q;  2RA4 A;  3K5M A;  3DWA A;  1Q7Y C;  4FYD A;  4GN3 B;  5D3I B;  3B6Y A;  4A3I H;  4IPC A;  2WB1 E;  1DZ1 A;  2MP1 A;  3MTS A;  1FVI A;  2AQ2 B;  4K2K A;  3HKZ B;  3M85 A;  3VA5 A;  2QIL A;  1Y8P B;  4QUF A;  4V0B A;  2NWG A;  4IOA A;  5CR3 A;  3I4N B;  4ILW A;  1N36 L;  2I46 A;  4DUZ L;  3ULP A;  2RHQ B;  4RCN A;  1HNX L;  5K5P A;  3G4S A;  4UHV A;  3UE1 A;  1I4P A;  1OXV A;  1X6O A;  3ND8 A;  3SEB A;  1L0W A;  4N8F A;  3J7A V;  3HOU H;  1V1Q A;  5IP7 H;  1SND A;  4CHT B;  4JI0 Q;  1IKL A;  2MQH A;  5KYL A;  5ELB A;  2Z4I A;  1LT5 D;  2BDN A;  2R7Z B;  4P74 A;  5DM7 3;  3K81 C;  5BR8 L;  1CA5 A;  2Q2H A;  1XMO Q;  3N52 A;  1HRJ A;  1G29 1;  2IHF A;  3OMG A;  2XNA C;  1Q1E A;  1CT1 D;  4A3D H;  4N8X 1;  1HPC A;  1TY2 A;  1QZH A;  1W2B A;  2VUM H;  2RQX A;  4AYB E;  4OWW B;  2NBF A;  1WTP A;  4QJF A;  4UY8 C;  4QL5 A;  3A5Z B;  2K14 A;  5IYC H;  1JB7 A;  5LMN Q;  3L3O C;  3UDF A;  2F4I A;  3NWT A;  3IRB A;  5GRO A;  5LMN W;  4A3L G;  3A5U A;  2F3W A;  5M5W H;  4KD3 A;  3HOX H;  3JAM E;  3W2D A;  4DK1 A;  5C4J B;  2BE5 C;  1IBL Q;  4CDC C;  2M9V A;  4X62 L;  1E2W A;  4Y7N B;  2BE5 D;  1W6J A;  3PIP 3;  5J3B A;  2O2L D;  2VB2 X;  3S1Q H;  1E0B A;  1EFI D;  4XTC S;  3D0F A;  1D5Z C;  3TS2 A;  1TWG H;  3SR1 A;  5CGK A;  4X66 Q;  2OWO A;  1H9M A;  2D9U A;  4RGT A;  2EPB A;  1G51 A;  3HZX A;  4CJ2 C;  4QUC A;  5JOB A;  2NVQ B;  2B63 B;  4RH6 A;  2PNH A;  3RR5 A;  1A6X A;  3PO3 G;  4U67 3;  1K8A C;  1VQC A;  4DV4 L;  4YCV A;  2EYF A;  1RD9 D;  4K6L A;  1YI2 A;  2F0T A;  1XMQ L;  4ABN A;  5BN4 A;  3HOX G;  1SXT A;  3T56 B;  5C0X J;  1BUV T;  4BY1 H;  3GTL B;  1ENC A;  5JVH 3;  4JI8 Q;  4JI5 Q;  3BZK A;  3S9W A;  5DAU A;  1FD7 D;  2ID0 A;  5ISR A;  3G48 A;  2AWO A;  3H94 A;  5IT9 E;  4KTA A;  1D6E C;  2CQA A;  3KF6 B;  2F0V A;  2EYO A;  2QGQ A;  1BXT A;  1HXY D;  2HDM A;  4I7A A;  1WJJ A;  1CHQ D;  1GUN A;  1C48 A;  1NTG A;  4EX5 A;  2E2J B;  5E1F A;  1FR3 A;  1PRT F;  3J81 i;  5ELD A;  4QIW B;  2ZT9 C;  1QB5 D;  2B2T C;  4B3R L;  3AU7 A;  2BH8 A;  3PIO A;  2F0S A;  3SGI A;  1MKH A;  2WB1 B;  4ZAI A;  2UUB L;  1IZ6 A;  1PLF A;  4KY5 A;  5FO9 B;  1PFB A;  1VQO A;  2TSS A;  2L9H A;  3R2T A;  2XN9 C;  1STA A;  3EBE A;  2LXK A;  4DK0 A;  2I5H A;  4B3S L;  4A93 B;  1BQQ T;  4DGZ A;  3ZYY X;  1UE5 A;  5C44 H;  1QUQ A;  3T1Y Q;  2F0W A;  4DN4 M;  3K7A B;  1M4V A;  2AMC B;  2A69 C;  4RHR A;  4LK1 C;  4I7Z C;  1A2T A;  3G71 A;  2RVL A;  2NZO A;  1IBK Q;  2E2H H;  5KGU A;  4N9P A;  3PUW A;  3BVG A;  1H9S A;  1HUM A;  4TQU S;  3TME A;  2J7Z A;  2PI2 E;  1O7Z A;  1A3T A;  4DUY L;  1STG A;  5M3M G;  3IL8 A;  5AJ3 L;  2PPB C;  3K57 A;  1EOV A;  4V19 0;  4XQJ A;  4YWK A;  3BDL A;  2GVA A;  3KF8 B;  4LF7 Q;  2Y0S G;  4RA8 A;  4C3I G;  1N32 L;  1J6Q A;  4OEM B;  1I4H A;  1LAB A;  3EA6 A;  4FDB A;  3L0O A;  4A3B G;  5IOD A;  4DAM A;  2MUY A;  3UDG A;  4NXN Q;  4AYB B;  1K9M C;  1X65 A;  5IT9 L;  1TWF B;  2JN4 A;  1B44 D;  2QDL A;  4KN7 C;  2KEC A;  2RKS A;  2IY5 B;  4A3M G;  2QCP X;  3L7Z C;  1AN8 A;  1PXU A;  1FGU A;  4G7O C;  2K05 A;  2C35 B;  2D5D A;  1EWC A;  4BBR H;  4JV5 Q;  2EJF C;  3DWQ A;  3K6O A;  3NQT A;  3CKI B;  2LMC B;  1L0X B;  5EKK A;  1FNW A;  1TR5 A;  4HCE A;  1X3Q A;  5E3F A;  2L11 A;  4TRD A;  4JI3 L;  4IN3 A;  1SYC A;  2R7Z H;  1RF2 D;  1SAP A;  1Q12 A;  4JBJ A;  2MFI A;  4YCU A;  3GDE A;  4GOP B;  1G91 A;  4MZ9 A;  3BG3 A;  1D5X C;  3K5N A;  4CDE C;  3GV6 A;  1X32 A;  4DR1 L;  4F87 A;  3GP7 A;  4KJO A;  1DGS A;  4XYQ A;  3LGJ A;  2CKZ B;  1HNX Q;  5DEH A;  4DV6 Q;  2CFM A;  1GUS A;  1JC7 A;  4POF A;  4DR4 Q;  3S1R B;  1OXX K;  4LF6 Q;  4LFA Q;  1MIU A;  2LKV A;  4BY7 H;  4XT3 B;  1UWV A;  5C4J H;  3DEP A;  1LTG D;  1WTW A;  1X54 A;  3O13 A;  2PW7 A;  3GTG H;  2XGT A;  1GUT A;  4CKC A;  4UP9 A;  2MO1 A;  2O5I C;  3FKI B;  1K28 A;  1LUZ A;  2K4K A;  3GTK H;  4JI1 L;  4DNI A;  3PO2 G;  5GAH C;  5I9O A;  3E3X A;  1KAW A;  3KLW A;  4IZ8 A;  1AEX A;  3I7F A;  1V9P A;  1SMY C;  3TS0 A;  1LTI D;  1G2S A;  3OOC A;  2MHV A;  3T13 A;  3J7A 5;  1F9P A;  2YTX A;  2NVQ H;  2B63 H;  4A3E G;  4QCL A;  1YZ6 A;  3NUC A;  2F0J A;  1V1O A;  2JA5 B;  3NPP A;  1F77 A;  2MGS A;  2B3G A;  2N49 A;  1MD2 D;  3NBH B;  3CQZ B;  3NEN A;  5EQ0 A;  3NEL A;  5CC4 A;  1DON A;  1LTR D;  2PZW A;  2KA7 A;  2K5Q A;  1A8V A;  4DR3 L;  1CA6 A;  1ENA A;  4X62 Q;  4G57 A;  5FK9 C;  2XWJ B;  1U4L A;  4RMF A;  1PFS A;  4IOC A;  2K5N A;  1F2Z A;  4PNY A;  2WAQ E;  1EIY B;  2F0P A;  3OW2 A;  2JYO A;  3GTQ H;  3BYY B;  3FHW A;  2Z6B A;  1F2L A;  5LMU L;  3A74 A;  2X69 A;  1KXL A;  1ZYR C;  3JAM i;  1K8M A;  1HCZ A;  1S5C D;  3CRK C;  1Y1W G;  3TN2 A;  4Y52 H;  4IFD G;  2ENB A;  2PZT A;  1DXM A;  3TZU A;  3PCO B;  4DV4 Q;  1A15 A;  1NCV A;  2DGY A;  2F0L A;  1C0A A;  1XMQ Q;  5IGB A;  5IYB G;  4JI0 L;  1L2F A;  4JBM A;  5JJK A;  2B2W A;  2M00 A;  3ERO A;  1YVC A;  2V1C C;  1XMO L;  1MSH A;  4Q0F A;  2QDB A;  3E0E A;  3HGB A;  3H0G H;  3RZO H;  1UEB A;  2K1B A;  4BA2 I;  3DMU A;  1JWS D;  3M9B A;  4XT1 B;  2O4X A;  4ME3 A;  4A3J G;  1YHQ A;  1HFG A;  5ELF A;  3TP6 A;  2EE1 A;  4L5Q A;  4B3T Q;  1Z6H A;  5GAG C;  1RTO A;  1CKN B;  4ZK9 B;  4P71 A;  4POG A;  1OTC A;  1GXD C;  5LMN L;  3D4R A;  4DR6 Q;  1B70 B;  3CAM A;  1I4Q A;  2E74 C;  5E7N A;  4GS3 A;  5FOB B;  5IGD A;  2NVX H;  1ZXT A;  4R4T A;  3FPP A;  2F0M A;  2F4V Q;  1YNJ C;  2A19 A;  2SOB A;  1K3B C;  1XNQ Q;  1YNJ D;  1L1O A;  3NK9 A;  1IBL L;  3L2P A;  1MSG A;  3A0J A;  4B08 A;  3HKS A;  1PRT B;  3QOL A;  3LWE A;  4KJN A;  3H0G G;  1TWF H;  4GNX B;  4X66 L;  3HKZ E;  3CRL C;  1NBW A;  1PFN A;  2JJQ A;  3CCM A;  1BCP F;  1SR3 A;  4DXF A;  1WFQ A;  4IUN A;  4NXM L;  1STN A;  1XX8 A;  3E9H A;  1EY0 A;  3J80 E;  4PZ7 A;  2EVB A;  5AJ3 Q;  2NZH A;  4S3S A;  4ZKB B;  2NTT A;  1CQF A;  3AFP A;  1D8L A;  5LL6 S;  4BBS G;  1N32 Q;  1E2V A;  1MBY A;  1B8A A;  2HQL A;  4OXP A;  3M7N A;  4R8I A;  4HR7 B;  4JI5 L;  4JI8 L;  4C2M B;  4X6A H;  5I9P A;  4JW0 A;  3PO3 B;  3NEM A;  1BKB A;  1W3S A;  2JA7 G;  1PTO F;  2VQE Q;  1VQ7 A;  4G7Z C;  1EQQ A;  3RLN A;  1TWA B;  1S5F D;  4RGN A;  4WJW A;  5FO7 B;  2Q2I A;  1ILQ A;  1NAP A;  3MEF A;  5EPL A;  2JSO A;  4OHJ A;  1PH2 A;  2L5T A;  1H9S B;  4EQN A;  3F2B A;  2JA6 B;  4DV3 Q;  2WII B;  3Q24 A;  2F0K A;  4R4I A;  2CHB D;  3OPO A;  2LFN A;  4KI0 A;  4P2C B;  2F0H A;  2I5M X;  1ICF B;  1WI5 A;  2UXC Q;  4CBV A;  3I90 A;  4KKS A;  3KK7 A;  1AW7 A;  3S15 B;  2NN6 H;  1I3Q H;  1NUC A;  2OQ0 A;  1EU4 A;  1VQE A;  2B2W C;  4IUR A;  4XQQ A;  1WCM G;  5M3F B;  1X3E A;  2HIX A;  2E2I B;  1VQJ A;  1X56 A;  2BA0 A;  4J6H A;  1HZ9 A;  3CCQ A;  1FNV A;  5JJL A;  1HJP A;  1BBW A;  4FF3 A;  3HOZ G;  1H9K A;  3CPF A;  3UDX A;  4RKB A;  1GHK A;  4A3C G;  1EWI A;  1UE7 A;  4LFC Q;  1FJG L;  5H1S E;  4KLK A;  1EY8 A;  4YCW A;  3KOJ A;  2A6H D;  1PYW D;  4HID A;  1MJC A;  3HFZ B;  1EY5 A;  3T4A C;  4LF7 L;  1B7Y B;  1U4P A;  1RDP D;  2H4O A;  2K7V A;  3S2H B;  3I3C A;  3A8I E;  3I56 A;  1E3P A;  4KHZ A;  2F0N A;  2PO4 A;  1VQH A;  3IKJ A;  1NMG A;  2NN6 G;  1A0I A;  4NXN L;  5M3M B;  2JK8 A;  3HOY G;  1AH9 A;  1J9O A;  1B4O A;  3I4M H;  3E0J A;  1YHB A;  1N9W A;  5EAY A;  4APV A;  4A3K H;  3K0Y A;  2QF7 A;  1B53 A;  4LJZ C;  4CJ1 B;  1STB A;  2F0D A;  3VR5 A;  1O78 A;  3LX0 A;  3ERS X;  2EYP A;  2ALY B;  3HG9 A;  4JV5 L;  5JEA H;  4ULL A;  2VQF L;  2EY2 A;  1C8C A;  4QIW E;  3SXH A;  1LYL A;  1VQ4 A;  1IL2 A;  2EYJ A;  5KIX A;  3V05 A;  4DR3 Q;  2DY7 A;  1A62 A;  1GUW A;  3ULJ A;  3F8T A;  4A3M B;  3C46 A;  3SK5 A;  3QWN A;  2G9H D;  2L0C A;  1LT4 D;  1Q8K A;  3CC7 A;  1JQY D;  3CU7 A;  4FXG C;  2BDO A;  5FLM G;  1SNM A;  1X3P A;  5LMU Q;  2B2T A;  3ER0 A;  4CDD C;  4HJA A;  2JA8 G;  2K04 A;  5JEA J;  3MXG A;  4DV6 L;  4LFB L;  5I6W A;  1SJH D;  2B2U C;  2K6A A;  2GN5 A;  2R92 H;  5EKL A;  4DR4 L;  3BS1 A;  4LF6 L;  3G6J B;  1D5M C;  5J39 A;  4LFA L;  4XYO A;  4A76 A;  5JJI A;  1M1K C;  3NTI A;  4EQO A;  5LHY 1;  1TWH B;  3I91 A;  5IGG A;  4A3I G;  1TII D;  1XPO A;  1KLU D;  3A56 A;  4JI7 Q;  5C4X B;  2N78 A;  1STE A;  3PUX A;  4RAU C;  1AP0 A;  3WOE A;  3FRP B;  1SE2 A;  5FJ8 H;  3SK8 A; 
#chains in the Genus database with same CATH homology
 3SE0 A;  1VDZ A;  2AUK A;  2C9O A;  4HMI A;  4Z9C B;  2EYL A;  1EQV A;  3HOV B;  2IWH A;  5JAV A;  5ELE A;  2R93 B;  2ZXP A;  3QG1 A;  4EVO A;  2IPK D;  3DWP A;  5LL6 X;  4KK7 A;  3NQI A;  4YIJ A;  4A3E B;  3H09 A;  2OT2 A;  4I65 A;  1C4Q A;  5C0X H;  2F0E A;  4C1N I;  1UAP A;  1J8I A;  2A73 B;  3RUZ A;  3I72 A;  5M5Y B;  4EGV A;  3DM1 A;  2BCO A;  5CBE E;  5CV7 A;  1PZK D;  5HUR A;  2ZXO A;  2I07 B;  3FPU B;  3NE5 B;  1Y69 U;  1RJT A;  1G6Z A;  1OXS C;  2R6G A;  1LTB D;  2EXZ A;  1KNE A;  3D8G A;  2KCC A;  2Z1C A;  1B9N A;  3QO2 A;  5C3E B;  5IIF A;  1BCP B;  4C3J B;  4A3G B;  1Y1W B;  2K01 A;  5A35 A;  5C0X G;  2SNM A;  1AFP A;  3VR2 A;  3FEW X;  4HTH A;  4KY6 A;  3SK6 A;  2A74 C;  4ZLT F;  1TKW B;  1BOS A;  5IGE A;  4RWS C;  1TVX A;  1CFM A;  2Z4H A;  1YNN D;  3HOW B;  3S1N B;  1PTO B;  1LTA D;  3M7G A;  4A3J B;  3FVQ A;  2EY6 A;  3SK4 A;  4FXD A;  4DAV A;  3DHQ A;  1RTN A;  2CW0 D;  3OSO A;  1WTX A;  1Z7T A;  4NMZ A;  3KLS A;  5G3L F;  3SHL A;  3J7A F;  3IAY A;  1I6H B;  2E2D C;  2AWN A;  3A7A B;  5C3X A;  2JEB I;  2EYH A;  2NZ1 D;  5I4D A;  1EIH A;  5D65 A;  4H7B A;  1JB3 A;  4K5V A;  5EPJ A;  4H13 C;  3OHX C;  1EY6 A;  3C1E A;  1LTT D;  2VB3 X;  1ESF A;  3OW7 A;  1LTS D;  4IUU A;  5J22 A;  5C4H A;  4TSS A;  2F0Q A;  1QIL A;  3G7L A;  3GTJ B;  5EJW A;  2WAC A;  4IFD I;  4IUT A;  1TQO A;  1S4Z A;  1Z47 A;  2RBM A;  3MFG A;  5BN5 A;  1B3A A;  5DM6 3;  2YU9 B;  4BBS B;  1SFO B;  4Q5V A;  3U9S A;  3MXN A;  3E6Z X;  1R9T B;  1JWM D;  4OGQ C;  3M3Y B;  2IW3 A;  3MXP A;  4KHV A;  3T51 B;  2EOT A;  5CYU A;  1K83 B;  2IT1 A;  2F0I A;  2F0F A;  3ERQ A;  2EZV A;  1SE3 A;  3R3O A;  4ZUJ A;  4O1N A;  1BR9 A;  3OIP A;  3CHB D;  1PRT D;  1B2T A;  1KNA A;  4DFA A;  3MVV A;  3HP3 A;  2K33 A;  2R61 A;  3QB3 A;  3D3R A;  5JPM C;  2RSO A;  1FYC A;  1QNK A;  1ESR A;  1S5D D;  1W6K A;  4UAI A;  1PZJ D;  2XRS D;  2HDL A;  4KN4 C;  4UDU C;  3GTP B;  2D62 A;  4JBW A;  3VYR A;  4NDX A;  3WOF A;  1MGS A;  2L55 A;  3H91 A;  4A3F B;  3PV0 A;  3X3M A;  3HOY B;  1I6V C;  4LMQ D;  4FO2 A;  1I50 B;  2PW5 A;  3AB9 A;  3DXJ C;  1UNS A;  3RZD B;  2EJG C;  4OIJ A;  4G7H C;  3S1M B;  1WTV A;  4E6I A;  1IW7 D;  1O80 A;  5F2D A;  5EBD A;  3N6R A;  2WIN B;  4IUP A;  1GUG A;  3IFT A;  3F2U A;  1PTO H;  3FDT A;  1F9R A;  3SDZ A;  2B8G A;  4NKL A;  2JA8 B;  1ET6 A;  5K36 H;  1ILP A;  4OO1 H;  2AUJ D;  4HN7 A;  4HCS A;  4BWG B;  1Y8N B;  1Q3L A;  4FP5 D;  1M8A A;  4CJ0 B;  2XVS A;  1ET9 A;  4ID6 A;  1FNU A;  4U68 A;  5EKI A;  1ZKO A;  1JIC A;  1JOK A;  2EY1 A;  1T5X D;  5C4Z A;  1HA5 A;  3R8B A;  2O5J C;  3TP5 A;  2PCF B;  4J8Q A;  2NN6 I;  1Q1B A;  2F0U A;  3BYT B;  1SNC A;  5FKA C;  1E2Z A;  3K58 A;  2OF1 A;  3OIQ A;  4CKB A;  1G2T A;  4OO1 G;  3OMC A;  5KYI A;  4IUV A;  3VA7 A;  1STH A;  2BA1 A;  4X3T A;  3HOU B;  5J1Z A;  1HQM C;  1D1I A;  1TS4 A;  2XSC A;  1BBX C;  3A7L A;  3A55 A;  2XRQ D;  1KLG D;  4DA2 A;  1V1P A;  2K5W A;  1KTK A;  2N88 A;  2A68 C;  3HEJ A;  3I73 A;  1WVL A;  2VUM B;  2A68 D;  1WTO A;  2A6E C;  2A6E D;  2FMM A;  1KDB A;  4PMB A;  1VF5 C;  5DNF A;  1RCV D;  5C6A A;  2B2U A;  5M5W B;  1R4Q B;  2QKI C;  3HOX B;  2KHS A;  3A54 A;  4WFN 3;  4R9W A;  1QJO A;  5C5M A;  1EEI D;  1VMC A;  3S1Q B;  2OXP A;  1H9R A;  3NHH A;  2NTS A;  1IHZ A;  5EBC A;  2K03 A;  3VYU A;  1IKM A;  1DCZ A;  1A2U A;  3DEO A;  2JEA I;  3NTH A;  1TWC B;  4B9W A;  1G8Z D;  1IYV A;  3D6W A;  3OWE B;  3D4D A;  2EYM A;  3P75 A;  4BY1 B;  1EYA A;  5IGC A;  1LT6 D;  2ICI A;  2A6H C;  2J0T D;  5I2Y A;  4DNT B;  3T53 B;  3V2T A;  1O7L A;  2EJM A;  4K2L A;  5COY A;  1SJE D;  1NR4 A;  1JCK B;  4K6D A;  4ZYS A;  3Q22 A;  3GTM B;  3U9O A;  4IUQ A;  3NXW A;  2FFK B;  1HUN A;  4NP5 A;  4ODG A;  1CZG A;  4ZUI A;  1I4X A;  1LO5 D;  1O7Y A;  2EDG A;  2Q8T A;  5KEE A;  1Q90 A;  1SNP A;  1TS5 A;  2TMP A;  2Y0S B;  4C3I B;  3D6C A;  3MFY A;  1F9Q A;  1R4P B;  1NR2 A;  1EIG A;  3GV3 A;  4A3B B;  1BCP D;  5COR A;  4KKT A;  4WRD A;  3S14 B;  4DXG A;  4J1M A;  1S5E D;  4OIK A;  4JK1 C;  1LT3 D;  5C0X I;  1QOH A;  4R8N A;  2E2H B;  1VF7 A;  3VYT A;  1A3V A;  2DNC A;  3UI2 A;  3TSS A;  5KNB A;  1PZI D;  1GJX A;  5JJZ A;  1DYQ A;  1S5B D;  3P20 A;  1PTO D;  5FO8 B;  2JE6 I;  3C3L A;  1I4G A;  2WKD A;  2JP1 A;  1BNZ A;  4DNR B;  3R2I A;  5JEA G;  5CV5 A;  1GOZ A;  2RSN A;  1NSN S;  1KAB A;  1BF4 A;  3NBH A;  5CBA E;  1JOR A;  2ZXR A;  4BBR B;  1OO9 B;  3PIO 3;  4DF7 A;  3H6M A;  3HRZ C;  1K8O A;  2KUM A;  1SYB A;  4N9T A;  1Y8O B;  1IYU A;  4L8J A;  1LLR D;  3MEH A;  3PO2 B;  5D3D A;  5CV8 A;  1B1Z A;  1EZ6 A;  3ONA B;  4NW2 A;  2X6G A;  2MPM A;  3ND9 A;  4KD4 A;  2PMZ B;  2JXM B;  2IJ0 A;  3VR4 A;  3MAQ A;  1EY4 A;  2IL8 A;  4O42 A;  3PMF A;  4FF2 A;  1SYG A;  3LNN A;  4BY7 B;  4ZRZ A;  2B39 A;  1SBB B;  3FMC A;  3K59 A;  3KBX A;  3GTG B;  3NTK A;  4RFB A;  3D31 A;  4C3H G;  4XIG S;  3Q6S A;  3I8Z A;  3GTK B;  2KEE A;  1XWE A;  5C3W A;  2E75 C;  4F8M A;  3NSW A;  1GHJ A;  1DD2 A;  2H1E A;  2PQE A;  2M2L A;  4H0L C;  2KOL A;  3C1F A;  1SE4 A;  3GO5 A;  1MI2 A;  2FJ2 A;  1ICW A;  4K5X A;  2NB0 A;  1RHP A;  3EVQ A;  1H9J A;  1WTR A;  1YNN C;  3RMH A;  2HCI A;  1SNQ A;  2E76 C;  5M9O A;  3GTQ B;  3QIA A;  4C1N K;  5AFW A;  3X3N A;  1QE6 A;  1V1P B;  2CW0 C;  1JWU D;  2V4D A;  2YYZ A;  1WD0 A;  1JR0 D;  3V96 A;  1EEF D;  4DAP A;  3VR3 A;  3PUV A;  1SSO A;  4HED A;  4EQP A;  5M5X B;  3JAM L;  1F2M A;  5HGT A;  2PZU A;  2DY8 A;  1KDA A;  1EY9 A;  1GUO A;  2K28 A;  5D14 A;  3H3V C;  1V43 A;  3H0G B;  5CV6 A;  2Q8I B;  5C5L A;  3RZO B;  1PMR A;  1ENF A;  1EQT A;  2HQE A;  2A69 D;  1AZQ A;  1EZ8 A;  1U4R A;  1SYE A;  5T1I A;  2HCC A;  5JPN C;  1QNU A;  2MJ8 A;  1XXG A;  4GZY C;  1DOK A;  1CTM A;  1JOQ A;  3VYS A;  2NVX B;  2IX0 A;  1U4M A;  5E4X A;  3IFD A;  4RHS A;  4L63 B;  4ZQ3 A;  5I6Y A;  1DM0 B;  3KBG A;  3BVZ A;  3D4W A;  2XIW A;  3E5S A;  1TT2 A;  2HUG A;  5TSS A;  2F1M A;  1EWH A;  2F0O A;  2JA7 B;  1ML0 D;  4HMJ A;  4ME5 A;  5IGF A;  2WKC A;  3T16 A;  2NVT B;  1EL0 A;  3EQL C;  2PNR C;  3I70 A;  4MN3 A;  1DOM A;  2Z8L A;  5A2Q E;  4QB4 A;  2RDF A;  3TZD A;  3BZD B;  3ITP A;  4PQX A;  1QWY A;  2L1B A;  3LWU A;  2IX3 A;  3EFX D;  1A3U A;  3KUP A;  5IOC A;  5T1G A;  1ROD A;  1BDO A;  2K32 A;  1PDQ A;  1IL8 A;  1ONL A;  1VCI A;  3RLF A;  2CVR A;  4IQZ A;  1PRT C;  1SYF A;  4OL7 A;  4OO1 I;  1CQV A;  5ELC A;  1WCM B;  3OWF A;  1CZW A;  2XWB B;  3QOJ A;  3MA2 B;  2ICE C;  3HOZ B;  1BO0 A;  2B2Y A;  1CM9 A;  1WD1 A;  2X6L A;  3MWY W;  2SNS A;  1HHV A;  2K5D A;  4RGO S;  1ZEQ X;  1AZP A;  1EOT A;  1B9M A;  2NYZ D;  5G3L D;  1I3Q B;  1CK1 A;  5CMD A;  4M1U B;  2LS0 1;  2DN8 A;  1SMY D;  1SYD A;  2OEO A;  3MC0 B;  5A2Q L;  2B8F A;  5EPK A;  2F3V A;  4IFD H;  1UUP A;  5NUC A;  3GTO B;  1TY0 A;  4K5W A;  5I2X A;  4K8I A;  3Q0A A;  1TS3 A;  2KED A;  1IW7 C;  4QF4 A;  4CKE A;  1II3 A;  1EYD A;  1QCB D;  1PFM A;  3RD4 A;  4PMC A;  1CI3 M;  2A5H A;  1RKN A;  4IFD J;  3I4L A;  2L12 A;  3I4M B;  3P1H A;  4A3K B;  5KND A;  1HA6 A;  4C3J G;  1U9R A;  1ZYR D;  1EYC A;  3GD7 A;  1DOL A;  1OXT A;  2RDG A;  1HTL D;  2WP8 J;  5CV9 A;  1HFN A;  3NBI A;  4K14 A;  1XYI A;  1FGB D;  2G9D A;  4XDX A;  4ZKC B;  4F88 A;  1I4R A;  3NP8 A;  4IAL A;  3TBI B;  3K5L A;  3DUZ A;  3C2P A;  1VMP A;  2C5C A;  4A3I B;  2F03 A;  2F0G A;  2KVM A;  1OXU A;  2KCN A;  1SDF A;  2SDF A;  1WTQ A;  4WOR A;  4RKL A;  4PMW A;  5K36 G;  1V8Q A;  4DU9 A;  2B2V A;  3VR6 A;  4FNF A;  2QEJ C;  3PUY A;  2Q8R E;  2R92 B;  1D1K A;  1HQR D;  2B2Y C;  2RDH A;  3L9A X;  1KDC A;  4TKO B;  1F9S A;  1TS2 A;  2KQ3 A;  3TDQ A;  1T5E A;  4XXE A;  3EJI A;  5JVG 3;  3M4Y A;  4L6T B;  2BOS A;  4A3D B;  3W3A A;  1F2Y A;  3K5O A;  3URY A;  4HSV A;  3PUZ A;  4FF1 A;  3S2D B;  4C3H B;  2FMC A;  4KV6 A;  4DAY A;  3TP8 A;  4F7X A;  1DJR D;  4X3S A;  3MHB A;  3NWS A;  5CV4 A;  2DNE A;  1KAA A;  4FVM A;  2D2C C;  3J81 E;  3R93 A;  2PYK A;  4KMU C;  1STY A;  2VNU D;  1CHP D;  3S16 B;  3BDO A;  5FLX E;  2FIN B;  3MZ5 A;  1TWG B;  3QJY A;  5E4W C;  1JE4 A;  2N55 A;  3J7Y W;  3SVM A;  3M4O B;  2NUC A;  1D2B A;  4B9X A;  1JOO A;  4H44 C;  3HS0 C;  2IX1 A;  1HTP A;  3KF8 A;  1SNO A;  3A8K E;  4MHE A;  3TP7 A;  4LAA A;  3P7J A;  1EY7 A;  4HSP A;  1LV9 A;  1Y1V B;  2LY7 A;  3BVM A;  1LAC A;  4PV1 C;  4XQN A;  1QG7 A;  4C56 C;  4FF4 A;  3WDN A;  1TU2 B;  1EU3 A;  2WAQ B;  4MIU A;  2J4X A;  3GQB A;  1Q8I A;  2AQ3 B;  2GA4 B;  4RGM A;  4BA1 I;  2VXW A;  3S17 B;  3KLS X;  4RCO A;  2AQ1 B;  3Q23 A;  4HAE A;  1UEA B;  4X3K A;  2SEB D;  1SEB D;  4FXK C;  2KJX A;  3A8J E;  1L0Y B;  3J80 L;  1XTC D;  2B2V C;  4KY7 A;  2L4N A;  4G4K A;  5KRU A;  5KNC A;  3J81 L;  2R3Z A;  1BCP C;  3BDC A;  4M8A A;  5FLX L;  4K8J A;  5BN3 A;  5C44 B;  3MXU A;  4CGY B;  1B50 A;  2NVY B;  5EGT A;  2EY5 A;  3KLR A;  2FHT A;  3AMU A;  4QMG A;  4KKU A;  1PTO C;  2WV6 D;  4X3U A;  2RA4 A;  3K5M A;  3DWA A;  4FYD A;  5D3I B;  1DZ1 A;  2MP1 A;  3MTS A;  2AQ2 B;  4K2K A;  3HKZ B;  3M85 A;  3VA5 A;  2QIL A;  1Y8P B;  4QUF A;  4V0B A;  2NWG A;  5CR3 A;  3I4N B;  4ILW A;  2I46 A;  4RCN A;  5K5P A;  1I4P A;  1OXV A;  3ND8 A;  3SEB A;  3J7A V;  1SND A;  4CHT B;  1IKL A;  5KYL A;  5ELB A;  2Z4I A;  1LT5 D;  2BDN A;  2R7Z B;  5DM7 3;  1CA5 A;  3N52 A;  1HRJ A;  1G29 1;  3OMG A;  2XNA C;  1Q1E A;  1CT1 D;  1HPC A;  1TY2 A;  2RQX A;  2NBF A;  1WTP A;  3L3O C;  2F4I A;  3NWT A;  2F3W A;  4KD3 A;  3JAM E;  3W2D A;  4DK1 A;  5C4J B;  2BE5 C;  2M9V A;  1E2W A;  4Y7N B;  2BE5 D;  1W6J A;  3PIP 3;  2O2L D;  2VB2 X;  1E0B A;  1EFI D;  4XTC S;  1D5Z C;  3SR1 A;  5CGK A;  1H9M A;  2D9U A;  4RGT A;  2EPB A;  3HZX A;  4CJ2 C;  4QUC A;  5JOB A;  2NVQ B;  2B63 B;  4RH6 A;  1A6X A;  4U67 3;  2EYF A;  1RD9 D;  4K6L A;  2F0T A;  4ABN A;  5BN4 A;  1SXT A;  3T56 B;  5C0X J;  1BUV T;  3GTL B;  1ENC A;  5JVH 3;  3S9W A;  5DAU A;  1FD7 D;  2ID0 A;  5ISR A;  2AWO A;  3H94 A;  5IT9 E;  4KTA A;  1D6E C;  2CQA A;  2F0V A;  2EYO A;  1BXT A;  1HXY D;  2HDM A;  1CHQ D;  1GUN A;  1C48 A;  2E2J B;  5E1F A;  1FR3 A;  1PRT F;  5ELD A;  4QIW B;  2ZT9 C;  1QB5 D;  2B2T C;  3AU7 A;  2F0S A;  4ZAI A;  2WB1 B;  1PLF A;  4KY5 A;  5FO9 B;  1PFB A;  2TSS A;  2L9H A;  3R2T A;  2XN9 C;  1STA A;  4DK0 A;  4A93 B;  1BQQ T;  4DGZ A;  3ZYY X;  2F0W A;  4DN4 M;  3K7A B;  1M4V A;  2A69 C;  4RHR A;  4LK1 C;  4I7Z C;  1A2T A;  2RVL A;  5KGU A;  4N9P A;  3PUW A;  3BVG A;  1H9S A;  1HUM A;  4TQU S;  3TME A;  2J7Z A;  1O7Z A;  1A3T A;  1STG A;  3IL8 A;  2PPB C;  3K57 A;  4V19 0;  4XQJ A;  3BDL A;  4RA8 A;  4C3I G;  1I4H A;  1LAB A;  3EA6 A;  5IOD A;  2MUY A;  4AYB B;  5IT9 L;  1TWF B;  1B44 D;  4KN7 C;  2KEC A;  2RKS A;  2QCP X;  3L7Z C;  1AN8 A;  1PXU A;  4G7O C;  2K05 A;  2D5D A;  1EWC A;  2EJF C;  3DWQ A;  3K6O A;  3NQT A;  3CKI B;  2LMC B;  1L0X B;  5EKK A;  1FNW A;  1TR5 A;  4HCE A;  1X3Q A;  5E3F A;  2L11 A;  4TRD A;  4IN3 A;  1SYC A;  1RF2 D;  1SAP A;  1Q12 A;  1G91 A;  3BG3 A;  1D5X C;  3K5N A;  3GV6 A;  1X32 A;  4F87 A;  3GP7 A;  4KJO A;  4XYQ A;  5DEH A;  1GUS A;  1JC7 A;  3S1R B;  1OXX K;  2LKV A;  4XT3 B;  3DEP A;  1LTG D;  1WTW A;  3O13 A;  2PW7 A;  1GUT A;  4CKC A;  2O5I C;  3FKI B;  5I9O A;  4IZ8 A;  1AEX A;  1SMY C;  1LTI D;  1G2S A;  3OOC A;  2MHV A;  3T13 A;  1F9P A;  4QCL A;  3NUC A;  2F0J A;  1V1O A;  2JA5 B;  3NPP A;  1F77 A;  2MGS A;  1MD2 D;  3CQZ B;  5EQ0 A;  5CC4 A;  1DON A;  1LTR D;  2PZW A;  2KA7 A;  2K5Q A;  1CA6 A;  1ENA A;  4G57 A;  5FK9 C;  2XWJ B;  1U4L A;  1F2Z A;  4PNY A;  2F0P A;  2JYO A;  3BYY B;  1F2L A;  2X69 A;  1ZYR C;  1K8M A;  1HCZ A;  1S5C D;  3CRK C;  3TN2 A;  4IFD G;  2ENB A;  2PZT A;  1DXM A;  3TZU A;  1A15 A;  1NCV A;  2F0L A;  5IGB A;  2B2W A;  2M00 A;  3ERO A;  1MSH A;  4Q0F A;  2QDB A;  3HGB A;  2K1B A;  4BA2 I;  3DMU A;  1JWS D;  4XT1 B;  2O4X A;  1HFG A;  5ELF A;  3TP6 A;  2EE1 A;  1Z6H A;  1RTO A;  4ZK9 B;  1GXD C;  3D4R A;  1I4Q A;  2E74 C;  5FOB B;  5IGD A;  1ZXT A;  3FPP A;  2F0M A;  1YNJ C;  2SOB A;  1YNJ D;  3NK9 A;  1MSG A;  4B08 A;  1PRT B;  3QOL A;  3LWE A;  4KJN A;  3CRL C;  1PFN A;  1BCP F;  4DXF A;  4IUN A;  1STN A;  1XX8 A;  1EY0 A;  3J80 E;  2EVB A;  4S3S A;  4ZKB B;  2NTT A;  1CQF A;  5LL6 S;  1E2V A;  1MBY A;  3M7N A;  4R8I A;  4HR7 B;  4C2M B;  5I9P A;  3PO3 B;  1PTO F;  4G7Z C;  1TWA B;  1S5F D;  4RGN A;  4WJW A;  5FO7 B;  1ILQ A;  1NAP A;  5EPL A;  2JSO A;  4OHJ A;  2L5T A;  1H9S B;  4EQN A;  2JA6 B;  2WII B;  3Q24 A;  2F0K A;  2CHB D;  3OPO A;  2LFN A;  4KI0 A;  4P2C B;  2F0H A;  4CBV A;  3I90 A;  4KKS A;  3KK7 A;  1AW7 A;  3S15 B;  2NN6 H;  1NUC A;  1EU4 A;  2B2W C;  4IUR A;  4XQQ A;  5M3F B;  2E2I B;  2BA0 A;  4J6H A;  1FNV A;  4FF3 A;  1H9K A;  4RKB A;  1GHK A;  1EY8 A;  2A6H D;  1PYW D;  1EY5 A;  3T4A C;  1U4P A;  1RDP D;  2H4O A;  2K7V A;  3S2H B;  3I3C A;  3A8I E;  4KHZ A;  2F0N A;  2PO4 A;  3IKJ A;  2NN6 G;  5M3M B;  1J9O A;  1B4O A;  3E0J A;  3K0Y A;  2QF7 A;  4CJ1 B;  1B53 A;  4LJZ C;  1STB A;  2F0D A;  3VR5 A;  1O78 A;  3LX0 A;  2EYP A;  3HG9 A;  5JEA H;  4ULL A;  2EY2 A;  1C8C A;  3SXH A;  2EYJ A;  5KIX A;  3V05 A;  2DY7 A;  1GUW A;  4A3M B;  3C46 A;  3SK5 A;  3QWN A;  2G9H D;  2L0C A;  1LT4 D;  1JQY D;  3CU7 A;  4FXG C;  2BDO A;  1SNM A;  1X3P A;  2B2T A;  2K04 A;  5JEA J;  3MXG A;  5I6W A;  1SJH D;  2B2U C;  2K6A A;  5EKL A;  3BS1 A;  3G6J B;  1D5M C;  5J39 A;  4XYO A;  3NTI A;  4EQO A;  5LHY 1;  1TWH B;  3I91 A;  5IGG A;  1TII D;  1KLU D;  3A56 A;  5C4X B;  3PUX A;  1STE A;  4RAU C;  1AP0 A;  3WOE A;  3FRP B;  1SE2 A;  4BS9 A;  3SK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...