2FFKB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/viral protein/cytokine
molecule keywords rabbitpox encoded CC chemokine inhibitor
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ffkB00
1F9PA 3D6WA 1AP0A 2JYOA 1G2SA 2CVRA 4QUCA 4DN4M 3G7LA 4X3KA 5EKIA 1U4RA 5DNFA 1B53A 4MN3A 2B2YC 2FINB 3SVMA 1NR2A 2L12A 2RSOA 1WVLA 1S4ZA 1B50A 1PFMA 1WTOA 2X6LA 4IUQA 5T1IA 1VMCA 1RTOA 4ZKBB 2NYZD 4IUTA 1WTXA 4HAEA 4XT3B 2J7ZA 2K28A 2X6GA 2L4NA 3Q6SA 1U4MA 2M2LA 5T1GA 2B2YA 4ZAIA 1DONA 4QUFA 4X3UA 4O42A 5D14A 2K01A 2L1BA 1HUNA 2N55A 3ONAB 1AZPA 5EPKA 3FDTA 3GV3A 1WTQA 1DZ1A 1C8CA 1KNAA 2L11A 3I90A 3H91A 4ZLTF 4CJ1B 1X32A 2RA4A 4RA8A 1EOTA 1A15A 2D9UA 2L9HA 2FFKB 1DOKA 3MWYW 1IKMA 1DOLA 4CJ0B 1HA6A 3P7JA 5E4WC 1EQTA 1HHVA 4OIKA 1J9OA 4R8IA 2KVMA 1WTWA 1PFBA 5CBAE 1SSOA 1BO0A 2K05A 3HP3A 4LMQD 1CM9A 1M8AA 1ZXTA 1B3AA 2B2UA 1WTRA 2NZ1D 2MP1A 1O7ZA 3LWEA 3DM1A 2JP1A 1ESRA 2FHTA 1F9SA 2B2TC 4HSVA 2N88A 4RAUC 4UAIA 1LV9A 2X69A 3I8ZA 1WTVA 2FJ2A 2HDMA 1U4PA 2FMMA 1KNEA 1EIHA 5CBEE 5D65A 3QO2A 3UI2A 2KUMA 2KEEA 1JICA 1QG7A 1SAPA 2B2UC 2EPBA 1RJTA 4R9WA 3KUPA 3TN2A 1JE4A 1PLFA 2RSNA 4MHEA 1XX8A 2XIWA 4ZK9B 2HDLA 2MJ8A 2H1EA 2R3ZA 2B2TA 4IURA 2BDNA 1B4OA 1U4LA 2K1BA 2K04A 3F2UA 3MTSA 4IUVA 4IUUA 1E0BA 1MI2A 1Q3LA 1ML0D 2IL8A 1QE6A 1XYIA 1GUWA 4X3SA 4HEDA 1IL8A 4RWSC 4X3TA 5JJZA 1F9QA 1MSHA 2HCCA 2KOLA 3KBXA 2HCIA 1HFNA 1QNKA 2B2WC 2DY8A 2RVLA 1F2LA 1PDQA 1PFNA 3FPUB 5CORA 5EPJA 1WD0A 4U68A 1ILPA 5E4XA 2KECA 2KEDA 4ZKCB 1VMPA 1X3QA 5EQ0A 1IKLA 1EIGA 1NAPA 4XT1B 1AZQA 2Q8RE 2MGSA 1RTNA 2SDFA 3GV6A 5EJWA 1CA6A 3IFDA 3R93A 1G6ZA 2MPMA 2EE1A 1X3PA 2NWGA 2B2VA 1BF4A 1HUMA 2B2WA 4IUPA 3DEPA 1ILQA 4HCSA 2VXWA 4XDXA 4OIJA 4NW2A 1BNZA 2EOTA 2Q8TA 1CA5A 1SDFA 2HUGA 5AFWA 1HFGA 1NCVA 1NR4A 1ICWA 1F9RA 4CJ2C 1MGSA 3I91A 1B2TA 1HRJA 5EPLA 1BBXC 2B2VC 3N52A 5COYA 5CMDA 1WD1A 1G91A 3DEOA 1WTPA 2DY7A 2K03A 3TZDA 1RHPA 1DOMA 1MSGA 1O7YA 1RODA 1EL0A 3I3CA 1G2TA 1TVXA 3IL8A 1O80A 1J8IA
chains in the Genus database with same CATH superfamily
3OWEB 1I4RA 4DAMA 1EY8A 4PMBA 3DLLA 3SK6A 1PH1A 4BBRH 1RTOA 4PG3A 2EYOA 2RHSB 3V96A 1WCMH 2CW0D 4TKOB 4KJNA 4QUFA 4X3UA 2J0TD 4JI6Q 4BS9A 2B3GA 2WKCA 4DAVA 3CXCA 4ZLTF 2KQ3A 4PZ8A 1STAA 4WFN3 5C4XH 2HQEA 4F7XA 2F0LA 1I4GA 1PZJD 1Y8NB 2WACA 5GAEC 2PZTA 4R8IA 3IRBA 4G7ZC 2G5DA 4YIJA 1HNZQ 1B44D 4A3BB 3M4OB 1SSOA 3PF5A 3K5LA 1QNUA 1PYBA 4IFDJ 1K83H 3LNNA 1SYBA 3NHHA 2I5MX 1YJ9A 4UAIA 5ELDA 4YY3Q 3TZUA 3H15A 2JA8H 4DA2A 2CWAA 1SAPA 4DV6L 1JE4A 1XMOL 3JAML 4A3EB 2E2IH 2RDHA 1XNRQ 1MKHA 4DK6C 3SE0A 3CPWA 3I4NH 2R7ZB 4DAPA 3AFPA 2DGYA 1B8AA 3CRKC 5IP7G 1EY0A 1GUOA 5CORA 1PDQA 5M3MH 1V1PB 1HA5A 2KECA 1X65A 4OWTB 3D31A 3BDOA 1PZKD 4DR2L 1PH3A 1N9WA 3DUZA 1SE8A 3A74A 5CYUA 1KAWA 1K0SA 1SNCA 3PIOA 3RN2A 4A3JG 2IJ0A 1LTBD 5AFWA 3TDQA 2F0HA 3M4QA 3T1HQ 4LNQA 3I70A 1EQVA 1STYA 4LF4L 3AFQA 4YHHQ 5EPLA 1DXMA 1TKWB 1Q46A 4RKBA 1EEFD 1IYUA 3M9BA 3NK9A 1XPOA 2BH2A 2CQAA 2CHBD 3IL8A 4H44C 2RDGA 4NXMQ 4FP5D 1SLJA 5C5LA 5KYIA 1G2SA 3BZCA 4IFDI 2JA7H 3MC0B 1BQQT 3DMUA 3KOJA 4N8FA 1K0RA 1E2ZA 1Q1BA 4A3MH 2R93G 5IYDH 4NKLA 3CCRA 4IN3A 3BVGA 1TQOA 2BE5D 5GAHC 2RDFA 5D14A 3OTOL 1SNOA 3HKZB 3A8IE 1K8GA 5IYBG 2NVTB 2IT1A 4CJ1B 5FLMH 3U4VA 2F4VL 2RA4A 2CW0C 3VR6A 5C4JH 4AQYL 4YWKA 4AYBG 5D3IB 2RCFA 1WI5A 4BBRG 2UU9Q 2F0VA 1QOHA 5IGEA 3PUVA 1TWCB 4B3TL 3A5ZB 2VL6A 4FDBA 3DWQA 1OO9B 5FJ8G 4JI1Q 2ZXPA 4A3KG 4KHPQ 1GOZA 2JP1A 4RAUC 4DK3C 4L5QA 3H3VI 3S14H 4H0LC 5C4XG 3S17H 3Q24A 1V8QA 1KLUD 2Z1CA 3AYHB 4A75A 1OTCA 1OXTA 4QCLA 2JSOA 5BR8L 1RJTA 5CV8A 1VQEA 4G7HC 1TWFH 3RLFA 4RHSA 5H1SE 4NMZA 3JAMc 1AW7A 2BDNA 5JPNC 3CC7A 2R7DA 1IL8A 4X3TA 1A2UA 1MSHA 3K80C 1D1IA 1YVCA 1PFNA 3GQBA 3CP0A 2EYHA 3CCVA 3GTGB 3A8JE 4XXEA 4FF3A 1GM5A 3NE5B 1SFOH 3GTQH 1EIGA 2K5VA 4UHVA 1TIID 4C3JG 2XGTA 1V1PA 2L55A 2MPMA 5LMUQ 1PTOH 1I4XA 3MEFA 2QEJC 2PCFB 1BBUA 3VYUA 4MTNA 5I2XA 2M00A 5F2DA 4FXKC 4OONA 2Q8TA 2MNAA 1NMGA 3Q22A 4DR7Q 5J1ZA 4FVMA 4CHTB 1IBLL 2K14A 4ZCKA 4K2LA 2RQXA 3VR5A 1Y1WG 1VQIA 1CK1A 1D8LA 3KFUA 3S15B 1WD1A 1LACA 1Y1VH 1VQJA 4UPAA 2NVYH 3DXJC 1TWAB 4C1NK 1B9NA 1SMYD 1MSGA 1MD2D 2XRQD 4GN4B 2AUKA 1DGSA 3EVQA 1W2BA 2YU9H 2CVRA 2OCEA 2F3WA 4DUZQ 1ZEQX 2FINB 1C4QA 2RSOA 2ZJRA 3J7A5 3UDFA 3PO2G 1IW7D 1YNJC 3U50C 3CPFA 4O1NA 4HAEA 2GVAA 1LTAD 3AU7A 2XNAC 2N55A 1X54A 1AZPA 3PIPA 3GV3A 3K0YA 3EQLC 2ZXRA 1L2FA 3GTJH 1PRTF 3TP8A 4X65L 4A3IG 1LUZA 4A3MG 2CH4W 1HTPA 3IFTA 4TSSA 5LMNQ 3HOZB 1EZ6A 1K73C 1H9RA 4Q5VA 2UUAL 5AJ3L 3K59A 4P74A 4JBKA 2AHOB 4V190 4GOPB 2RKSA 2DJGC 1EEID 5CR3A 3M3YB 1W6JA 1U4PA 1HTLD 5A35A 5IGCA 3GTLH 3EN2A 3OIQA 4ODGA 1HZCA 2K52A 1I5FA 3MEHA 2A68C 4JK1C 4DR5Q 2IX0A 1JWMD 3NPPA 4WJ3M 4OXPA 4BY7H 4IUUA 4QL5A 1E0BA 2IL8A 1GUWA 4L5RC 2K33A 4OGQC 2DUDA 3HZXA 2JE6I 3TEHB 3BYYB 2JEAI 2A5HA 3K81C 2OT2A 4YCVA 1F2YA 2PQEA 4LWCA 4P71A 1YZ6A 3S1RB 3CKIB 4LW1A 2NZOA 2MO0A 1SMXA 2QDBA 5EJWA 4JBMA 1G51A 3F8TA 5LL6X 4QJFA 1K28A 4IOAA 1EYCA 1D5XC 1PA6A 1NSNS 3QOJA 2EYPA 4AYBB 5IP9H 1QVCA 2HUGA 1HFGA 1F9RA 1VS0A 1NUCA 1WCMB 4IFDH 3IAYA 5EKKA 4IZ8A 1YHAA 4A3FH 1SN8A 2Q2UA 3RZDH 1BR9A 1DOMA 1RHPA 1WOCA 1EWCA 3FMCA 4DV3L 3SK5A 1VDZA 5C4XB 5DNFA 3TMEA 2QILA 2JA9A 1II3A 1SMYC 1LTGD 2AQ3B 4LFBQ 2XWJB 4C3HH 4A3CH 4K14A 1EY9A 2MFIA 5CV6A 2A69D 1K83B 4J8QA 2R92H 4RFBA 4K6DA 4B3MQ 1HJPA 2IX1A 5J22A 1VQFA 1XNQQ 1BBWA 2JA8B 4JBJA 1O78A 4HMIA 4JI5L 5M5XH 2CQOA 5EAYA 1N34Q 5KRUA 2I07B 3OHXC 1HQMC 4DV2L 2E2IB 3MFGA 1DOLA 1YITA 3H3VH 4A93H 3I4NB 1CM9A 4HMJA 1STHA 4JOIC 3CQZH 2YTXA 3HOYH 4N8X1 5M3MB 1YBYA 1UE5A 1I4QA 2Z6BA 4GOPA 4JV5L 3K5OA 4JI8Q 5LHY1 4BA1I 1YHBA 2EPBA 3TN2A 2SOBA 5BN5A 1I50H 4LFCQ 3S1NH 3U4ZA 1TS3A 2DY8A 3EBEA 3HEJA 3DM3A 4HR7B 5KNBA 3GP7A 5FO7B 4U68A 4JC0A 5KGUA 2F1MA 1ESFA 2DNCA 1PH2A 2ZTEA 4XT1B 3KK7A 1EIFA 1PYSB 3ER0A 5IGDA 4RHRA 1Y69U 3FHWA 2JA7B 3MVVA 3DEPA 4JI6L 2NBFA 2L5TA 3M7NA 4R4OA 1K3RA 4XDXA 4DR3Q 2ASBA 3OSOA 1EWIA 3P75A 4A3MB 2CKZB 1BUVT 1CI3M 4DFAA 1VQHA 3S1MH 3PMFA 1EU4A 1ET9A 1HH2P 3D4DA 4XQNA 2PI2A 1EFWA 2KHSA 4B08A 2QEXA 1Q82C 3JAME 1SE3A 3QOLA 2EY5A 4WJ4A 3DEOA 2ATWA 2ZM6Q 1HNZL 4HIKA 3U9SA 3TS2A 4KKUA 2HHHQ 4FO2A 4KI0A 1SE2A 3RUZA 2LS01 1F2MA 1B53A 5C4JB 3AEVA 1WTHA 3PSIA 3DWPA 4YY3L 1WVLA 3CHBD 2GN5A 3U9OA 1UAPA 4DV7Q 1CUKA 3KLWA 2CH4A 2AKWB 1CQVA 3W1GA 4A3FG 2X6GA 1ZKOA 2EJGC 5CV9A 1VF7A 3J81L 1L0YB 1XNRL 4V0BA 4LF8Q 3AMUA 2EYMA 3H91A 3S14B 3IKJA 3S17B 2D0OA 1GJXA 4LJZC 2LKVA 3FPPA 4P2CB 3K58A 1E24A 1UNSA 1TWFB 2AWOA 2PW7A 4A3DH 1B1ZA 1C0AA 2R7ZG 5JEAG 3PGZA 2VW9A 3CMEA 5M5YH 2B2UA 4P72A 2A6ED 1CKMA 1FNWA 2LMCB 3DM1A 5IWAQ 2B2TC 4HSVA 3UDGA 4LF9Q 4IQZA 1KDCA 1VF5C 2A1AA 4NP5A 2K4KA 3T1HL 1SFOB 3GTQB 5D3DA 4F8MA 3F1ZA 3SDZA 1UE7A 4PZ7A 4LF6Q 3ERQA 1Q1EA 4MHEA 1PTOB 2XIWA 2F0MA 1LTSD 2B2TA 4WRDA 5EKLA 2CCZA 1F77A 3OMGA 4I7AA 4GNXC 3HRZC 3VA7A 1CHPD 3QB3A 1WFQA 2HCIA 1TR5A 1IZ6A 5GQOA 5ELCA 1Y1VB 5E4XA 2NVYB 1AEXA 4G57A 3ND9A 1NAPA 4OWXB 3EA6A 4B3RQ 5ELEA 2YU9B 3GV6A 1OXVA 4J1MA 5A2QL 1VQ4A 3TP6A 2B2VA 2KCCA 1RIPA 1H9JA 1Z47A 3KF6B 2WAQB 1CTMA 3GTPH 5C6AA 1CA5A 2EXZA 2HQLA 3GD7A 3S24A 2UUBL 2LSSA 2MO1A 5ISRA 1LT6D 2UU9L 3HKZG 4UP7A 4BBSH 2NN6I 1N32Q 4ALPA 3RLOA 3R2IA 2J4XA 1I94Q 4RGOS 1A3TA 1Q8KA 3GTJB 5K36H 3RLNA 2IY5B 2VQFQ 1JOOA 1UEAB 3TBIB 2PQAB 5JJLA 1E22A 2F0OA 3W5OA 4HJAA 2NVQH 2EJMA 3J7AF 2WB1B 3HKZE 4UP8A 1GD7A 4O42A 4YWLA 1I6HH 4RH6A 3SK8A 1DZ1A 2DNEA 3E9HA 4CDDC 3GTLB 3OWFA 4YCWA 3M7GA 5IODA 1EU3A 4HSPA 3BS1A 4QY7A 1AFPA 1NTGA 4PV1C 4UP9A 4DR6Q 2IWHA 1EQTA 2JA5H 2KVMA 4BY7B 1WTWA 5CBAE 4DAYB 5BN4A 5ELOA 4JCVE 4S3SA 1FGUA 3P20A 1L1OB 1GHJA 5LMUL 3T1YL 1XMQQ 2B63H 2UXBQ 3PO3H 1ONLA 5IGBA 5I6YA 4J6HA 3RNUA 1WTVA 4IO9A 2Z4HA 4DR7L 1PZID 2F3VA 3HG9A 1PTOC 3Q23A 2OXPA 4R9WA 3E0JA 2C5CA 2H1EA 3C1EA 1HNWL 1Y8OB 3JC66 5KYLA 1B4OA 3MTSA 2RCNA 2VNUD 1Q3LA 2Z4IA 2NTSA 1FR3A 1UWVA 4RKLA 3V05A 2R6GA 2F0PA 4DUZL 2QDLA 1LYLA 4LFAL 1HFNA 1QNKA 3OW2A 2C9OA 2ZTCA 4A3FB 1U9RA 4ME5A 2KEDA 3RZDB 2PW5A 2PPBC 4OO1I 4QB4A 1SROA 1CA6A 3VDYA 2AQ1B 3FKIH 4F87A 4HCSA 3MFYA 3L2PA 4X64Q 1JE5A 1QVGA 1Z7TA 2VB3X 2NVXH 5IT9L 1QB5D 4C3HB 3KF6A 4FXDA 4O0AA 1TWGH 2R92B 3TSSA 4U673 5LMNL 1KABA 2DY7A 2F0WA 5I4DA 3MXPA 3J80i 1T5XD 4DXGA 2IHEA 1AP0A 3I2ZA 3T53B 5JVH3 5M5XB 3BG3A 3SVMA 1FGBD 3K57A 3HOZG 4KKTA 2X6LA 4PQXA 2E75C 4A93B 1LT5D 3H6MA 2EY1A 1C48A 1K8OA 3PF4A 4DF7A 2EIFA 2J7ZA 2L4NA 3CQZB 1GKHA 4QIWB 5C0XG 4DR5L 3HOYB 4X6AH 3HOUH 1QUQB 2PQAA 4ULLA 3RN5A 2TSSA 4KY7A 1Q81C 1TS5A 4DV0L 3BDLA 2N78A 1QCBD 1T9HA 2LY7A 4UY8C 3KDFA 4GKJQ 1X3GA 3T4AC 1EOVA 2QW7A 5JJKA 1JWUD 4DGZA 1VQKA 5C3EH 1L1OC 1D5ZC 3K7AH 4C56C 1I50B 1ZYRD 1IBKQ 3S1NB 1HZ9A 2BA0A 1GVPA 3LWEA 4EQNA 1CFMA 3BZKA 4DAYA 1VCIA 2N88A 4KD4A 3H0GH 1JMCA 1MBYA 2B8GA 4DUYQ 1K8MA 3T56B 1L1OA 5FKAC 1A0IA 4L5TA 1ET6A 4DV4Q 1PLFA 4KN4C 2KCMA 3S9WA 4I7ZC 5KNCA 4EVOA 4QF4A 1L0XB 2VY3A 1QZGA 1E1TA 3EROA 2UXCL 2K5DA 1P16A 3S1MB 1VQ5A 2B63G 1WCMG 1GUTA 2FMCA 1VQMA 4X62Q 5DAUA 5EBCA 5FLXL 3E9IA 3KBGA 4LFBL 1HNXQ 1PV4A 2BOSA 2PI2E 2SDFA 4B3SQ 1G6ZA 5ELFA 4AYBE 1K9MC 2E74C 3R8BA 4G4KA 2NN6H 2UUCQ 1BKBA 4DR1Q 1XNQL 2XSCA 1W6KA 1Q86C 1HZBA 4DNIA 3STBD 3UDIA 4L5SA 2Z6KC 3N52A 1LO5D 2VB2X 2HIXA 3ERSX 3QR8A 4DV1Q 1UUPA 2HIVA 2JA8G 4KJOA 4XYQA 3ZJYC 2Z6KA 4JI0Q 3H3VC 5C4ZA 3E6ZX 2KENA 4EQOA 4A3DB 3I4NG 3M4PA 2F0NA 4JI8L 3I4LA 1SYDA 5M5YB 1JB7A 1JJ2A 4XT3B 3K6OA 2K28A 5M3MG 2WP8J 2YTYA 3TREA 2D2CC 3ICEA 3QWNA 3D8GA 4GKKQ 1STBA 1JT8A 1ENCA 1U5KA 4LFCL 3A0JA 1KHIA 1QUQA 4Q0FA 3PV0A 1DOKA 1LT4D 1KDAA 3P7JA 1KD1C 5FK9C 3J81i 3BJUA 3G6EA 4IALA 2K5WA 3A7AB 2FHTA 5CV4A 1D1KA 1DYQA 1JB3A 2HDMA 1B3QA 2FMMA 1EIHA 1JR0D 3X3NA 2JA7G 3F2CA 1V1QA 5C3XA 3HOWH 3PUXA 3VR3A 4K0KQ 2BE5C 2KCTA 4IURA 5C3EG 3J81E 5DM73 5IYDG 4FF4A 2K1BA 1VQAA 2K50A 2CFMA 2KCNA 2RF4A 4HJ8A 1TY2A 4CKEA 3GTPB 1ENFA 4OO1H 1FYCA 2E2HH 4LUZA 2RVLA 1XMOQ 5HURA 1K8AC 4BBSB 5FLXc 4DV7L 1M90C 4RGMA 5FLMG 1R4PB 4R4QA 1KLGD 4KMUC 1CZWA 2E8GA 5JJIA 1NJIC 2N8NA 4XQQA 4LF8L 3QJYA 2AMCB 1BNZA 5C3WA 2A6HD 3RMHA 2WIIB 3E5SA 4AIMA 2NVQB 1CHQD 2EDGA 2ALYB 4DU9A 1JOKA 1I6HB 2O5JC 1O7YA 1RODA 3CAMA 2H4OA 2JA6B 1F9PA 3U58A 4KY6A 4LF4Q 5IWAL 3K5MA 4OHJA 3J80L 5HGQA 2NN6G 1NR2A 1RL2A 3I73A 1B9MA 4R4TA 5FOBB 4IUQA 1VMCA 2JA5B 3FRPB 3D0FA 3T51B 2F0DA 1WTXA 3BYTB 2R7FA 5J39A 4LF6L 2B63B 3TRZA 3I4MB 3PO3B 2M2LA 5I6WA 1SNMA 1STGA 4JI3L 1S5BD 4MZ9A 1KNAA 1PRTD 1UE1A 1X32A 3S1QH 4LK1C 3L0OA 1IKMA 4L63B 1UE6A 3C3LA 2CWPA 4B3RL 2RBMA 2F52A 3MA2B 1VQLA 2NZ1D 2Q2HA 2G9HD 1EYAA 2I5HA 3CRLC 1Y1VG 4AQYQ 4H7BA 3UE0A 1BVSA 2FXQA 2EZVA 4IPCA 2QKIC 4OX9Q 1IW7C 4IUNA 4NXNQ 1QG7A 3P1HA 2O4XA 1IBML 2F0JA 3FKIB 2WAQG 1XX8A 2WKDA 4ZYSA 5FO9B 4DNRB 3F2UA 1Y14B 4IUVA 5J3BA 2QA4A 2NVXB 1MI2A 1I94L 4GOPC 2UXDL 2KOLA 3A55A 2VQFL 3SR1A 1TWGB 4JI2Q 3RZOH 3Q0AA 2ES2A 1KRSA 1VQNA 4GZYC 1NBWA 1PYWD 2WAQE 5KEEA 3G4SA 3J81j 1D5MC 4M8AA 4IUPA 1O7IA 3AB9A 1QILA 1FNUA 2ZT9C 4OIJA 1N36L 4NW2A 1MJCA 2GA4B 4BY1H 1EQRA 2NUCA 2WINB 4CDCC 2WB1G 2OQKA 1ICWA 1MGSA 3PCOB 1HRJA 1DCZA 4DR6L 3CCMA 4A3LH 3HOUB 1WTPA 1RCVD 1E1OA 2C35B 2A6HC 3DHQA 1TVXA 2WV6D 1XMQL 4HCEA 4C1NI 3PQIA 2UXBL 3KLSX 2ICEC 1BCPD 2E2JH 1LTTD 1SE4A 1RDPD 2L12A 2EJFC 4ME3A 5M3FH 1B50A 3J80c 4BY7G 4IOCA 1GUGA 4R8NA 4ZUJA 5T1IA 2WB1E 3ULJA 3WWVA 5C3EB 5KNDA 1PTOF 1X55A 3K7AB 4LUOA 4BXXH 3GTMH 1A3UA 1D2BA 3ULLA 2K01A 1STEA 1BCPB 2LFNA 2N3SA 3H0GB 3HOVH 4JI7Q 5IY0A 5IE8A 1C8CA 2F4IA 5IT9E 1TS4A 3G48A 3FP9A 1A6XA 3CCJA 4H02A 2F0FA 3CD6A 4CKCA 4POGA 1I6VC 1TWHH 4JPBW 2ZTDA 1J5EQ 1EUJA 2IW3A 5E4WC 5IP9G 5IYCH 1PVOA 1A8VA 2KHJA 1YIJA 2K5QA 2A74C 3N6RA 3J7AV 3RD4A 4IFDG 2MP1A 2M9VA 1CSPA 2B29A 4A3GH 1RD9D 2IHFA 3H09A 4OL7A 4X64L 2EYJA 3DWAA 4FXGC 1VQ7A 4FF1A 1DM0B 3MXUA 2NTTA 3NTKA 1VQ6A 3QO2A 4EGVA 5M5WH 2B2UC 4K8IA 3AQQA 2RSNA 1B70B 2A69C 5ELNA 4HIOA 4TQUS 4QMGA 3CC2A 3H94A 3GTOH 1GXDC 2K04A 3K8AA 4C3HG 3LWUA 4K6LA 4GN5A 3F2DA 4A3CG 3NBHB 3OW7A 3ND8A 4GS3A 1OXUA 4GN3B 2R92G 1KAAA 2OF1A 2LXJA 1BDOA 4ABNA 1WD0A 5EPJA 5C44B 2OQ0A 4CGYB 4UDUC 1X3QA 2OEOA 5G3LD 1I3QH 4IPHA 3E3XA 4OEMB 4YHHL 1W3SA 5JOBA 3UDXA 1ILQA 1LLRD 1D6EC 2VXWA 1SRUA 1CKOA 3MZ5A 4A93G 1VQ8A 4CDFC 4NXML 3TQYA 2Y0SB 3A5UA 3TP5A 5HGTA 3HOYG 4NPSA 5E3FA 5LMNW 1PH8A 2K75A 2B2VC 5CMDA 5IGGA 3HGBA 1J6QA 2JN4A 1QWYA 1X6OA 1E3PA 3F2BA 1U4RA 5CV5A 3SK4A 1I4PA 2F3IA 5FLXE 1IYVA 1PH9A 1S4ZA 4DUYL 3W1BA 1R9TH 5DM63 1YNXA 4QIWE 3J7ZC 1PH5A 1XWEA 2F0SA 1YJWA 1VQBA 1SYFA 3D6CA 5T1GA 4F88A 5IP7H 4EX5A 1HUNA 1WTQA 3CCQA 3I90A 4C2MH 4DK1A 4B9WA 4DNTB 4KD3A 4JI1L 4DPGA 4MTKA 4KHPL 3HOWB 2XTIA 4APVA 4A3JH 1HHVA 1SNPA 1HNXL 3CC4A 4B3SL 1WYDA 2B39A 1B3AA 2E2HB 4LF5Q 4JI4Q 5FO8B 1TY0A 4JG2A 1VQPA 4EQ5A 1VQGA 4DV5Q 2EYFA 3VR2A 1SJHD 1TU2B 2Q2TA 2UUCL 4P75A 3HOXH 1VQDA 4DR1L 1LV9A 3I8ZA 2FJ2A 3KDFB 3KYHC 4BA2I 4KY5A 4C3IH 2VS1A 3J81c 1KQSA 2JA6H 5CC4A 5D65A 1A63A 2KUMA 2XN9C 4KK7A 1UEBA 1SYCA 5IYCG 2HDLA 1JOQA 1Q12A 4PNYA 4ZQ3A 4X66Q 1FJGQ 4EQPA 4LF7Q 1ENAA 2R93H 4WORA 1M4VA 3NSWA 5ELBA 1EIYB 1SNDA 2G9DA 2O5IC 3I4MH 4JBWA 4MIUA 1SR3A 3D4WA 3NBHA 2Q8RE 3NTIA 1Q90A 2MGSA 5IYBH 3WOFA 2D0PA 4Y7NB 3PIO3 4JYAQ 3VYRA 3KF8A 1X3PA 2A6EC 4GKKL 4PZ6A 1XXGA 2EY6A 2QF7A 5GAGC 4A3DG 5CV7A 1JJGA 2EOTA 1YEZA 3I7FA 3I55A 1EY4A 3K0XA 1STNA 4L6TB 4KHVA 2PYKA 1B2TA 4R4IA 1S5DD 5FJ8H 5M9OA 3T16A 4A3KH 3V2TA 1G2TA 1EL0A 1H95A 3CCSA 3SEBA 3HFZB 1O80A 4RGNA 1FL0A 4NDXA 1S3OA 2OTJA 3ITPA 1SNQA 2PNRC 4A76A 1VQOA 3S1QB 4XIGS 2BDOA 3NQIA 3BU2A 4IJHA 2OWOA 1AN8A 3NWSA 4K0KL 5IIFA 1DONA 1AH9A 4KV6A 2F0EA 4HJ9A 2L15A 4RMFA 2L11A 2EXDA 3VYSA 1M1KC 4C3JH 4KHZA 1NMFA 1EOTA 2BA1A 2L9HA 4K8JA 3GTKH 2PMZB 1Q7YC 1EYDA 3L7ZC 1ASZA 1PFBA 5JEAJ 1WJJA 3HP3A 1RKNA 3OYYA 1HR0Q 3X3MA 1Y1WH 4WJWA 2KHIA 3J80E 4BBSG 3RZOB 3GDEA 1GO3E 3FEWX 4Y52H 2AUJD 3NTHA 3RR5A 5CBEE 4DR4Q 5K36G 3URYA 3NQTA 1E2VA 3KUPA 2ZXOA 3EJIA 4ZK9B 2OTLA 3B6YA 4BY1B 2VQEQ 2AWNA 5I9PA 3CMAA 1NNXA 3PO2H 4XTCS 4RWSC 1L0WA 3A8KE 3HOXG 1F2LA 1ILPA 1KXLA 2XRSD 3G71A 4C3IG 4ID6A 1YNJD 2JA6G 1PH6A 1ASYA 3M85A 5LL6S 2E5LQ 2YYZA 1Z6HA 2EQSA 1TT2A 3S2DB 5CGKA 1C7YA 2E2JB 3D3RA 4A3IH 5M3FB 2JA5G 3D4RA 1GHKA 1SDFA 5TSSA 5E7NA 1XJVA 2F0IA 1H9MA 3I4MG 3PO3G 3L9AX 4N9PA 3GTMB 2I0QA 5I9OA 1IHZA 4K2KA 1JJCB 2K03A 4N9TA 3TZDA 2JK8A 3I3CA 4IPDA 3HOVB 1YHQA 2H5XA 3D6WA 1IXRA 2JYOA 2R61A 2UUBQ 1HPCA 3G7LA 4X3KA 4CDEC 1N33Q 4MN3A 2ID0A 2KBNA 1U0LA 1X3FA 2D5DA 4HIMA 1XTCD 4QQBX 1TWHB 4B3ML 1JQYD 3OMCA 4OX9L 4J15A 2MQHA 4KN7C 4NXNL 1DD2A 4FYDA 1G291 1KC8C 2A68D 5KIXA 1N34L 3S2HH 4A3GB 1U4MA 5IT9c 5C44H 1DJRD 3J7YW 3PIP3 2L1BA 2AQ2B 1CSQA 2IX3A 2A8VA 5EPKA 3FDTA 1X56A 5M5WB 3FKIG 3PUWA 2SEBD 1MJEA 4JI2L 1FVIA 3W3AA 1A15A 1BXTA 2FFKB 3LGJA 3GTOB 1FD7D 1XPUA 1JORA 3R2TA 3SXHA 2TMPA 3OPOA 1O7ZA 3NEMA 4H13C 1EQQA 4K5VA 2Z8LA 4QGUA 3A54A 4K5XA 3HKSA 1LTLA 1QJOA 3BVZA 2Z0SA 1KNEA 4DK0A 1I3QB 1HXYD 3T1YQ 3SGIA 1EFID 3BDCA 1MHWC 3VYTA 3EFXD 1XYIA 1IYJB 2VUMH 1BOSA 2HCCA 4HN7A 3QG1A 3HOUG 4DXFA 4DR3L 1HNWQ 1EYGA 5C5MA 1PH4A 4ZRZA 1G6PA 3KLSA 1EY6A 1AZQA 1RTNA 4P73A 1ZYRC 2NWGA 1HZAA 4LFAQ 3G6JB 3T13A 3HS0C 2ZM6L 4JI7L 1LABA 1H9SB 1R9TB 2Z9HA 5IGFA 2HHHL 1NR4A 2MHVA 4DV6Q 1J5EL 4OWWB 3H0GG 3MXGA 1SBBB 4FF2A 4AH6A 1OXXK 1JCKB 1AE3A 1CZGA 1P8LA 4L8JA 2NZHA 4C2MB 1J8IA 4QUCA 1NY4A 2ZJPA 3S16H 2JEBI 1SEBD 1PFMA 3A7LA 3LX0A 2JJQA 1ICFB 4A3JB 3A56A 1Y8PB 2A19A 1T5EA 1YNND 4DR2Q 4OELB 5C0XJ 1R4QB 5C4HA 1KDBA 3HOXB 5JAVA 3CCUA 3R3OA 2K32A 4C3IB 4PMCA 1B7YB 3STBC 4Y7NH 3I56A 1V1OA 2KJXA 3OIPA 2MUYA 4YCUA 4CJ0B 2L0CA 4LF9L 1V43A 4BWGB 1KTKA 3M4YA 2R93B 4DV0Q 1ZXTA 4XYOA 1WTRA 5C44G 5A2QE 1VQ9A 1ESRA 1F9SA 1F2ZA 2V1CC 4CBVA 1OXSC 1Q8IA 1S40A 1LM0A 2K6AA 4O2DA 4B9XA 1SYEA 5EBDA 4BBRB 3OTOQ 2HD3A 4A3BH 3W2DA 3M4OH 2Y0SG 4HJ7A 1QE6A 1SJED 3NUCA 1PXUA 4HEDA 5JJZA 1X9NA 1F9QA 3CF5A 3KBXA 5DLQE 2F4VQ 3KLRA 3PUZA 3QIAA 4A3KB 3FVQA 4RCNA 4ZKCB 1HR0W 4M1UB 1PRTB 1PMRA 5EQ0A 1IKLA 2UXCQ 1FNVA 2VZAA 5BN3A 3WOEA 4TRDA 4B3TQ 2QGQA 3R93A 1BCPF 5GROA 3EIVA 5C0XI 4A3EH 3VR4A 2Y0SE 1N32L 4IJLA 3SHLA 2VUMG 2R7ZH 5JEAH 4KTAA 2O2LD 1HCZA 3MAQA 2I46A 1BBXC 5BR8Q 2F0QA 1H9SA 2EVBA 2SNSA 3NBIA 1D7QA 1JWSD 4LF5L 4JI4L 2ENBA 2PZUA 1QZHA 3HOWG 4DN4M 4KLKA 5EKIA 4C3JB 1E2WA 2YTVA 4DV5L 2QCPX 3BVMA 1A2TA 3Q8DA 1XPRA 3GTKB 1Z9FA 2P5ZX 1LTRD 3VA5A 1WTOA 2F03A 4GLXA 4OO1G 4JW0A 1C9OA 1JC7A 4IUTA 5HY6A 3K7UC 3Q6SA 2EYLA 1Y1WB 4ZAIA 4FNFA 2YV5A 4X66L 1FJGL 1I4HA 1V9PA 4LF7L 3ONAB 3ZYYX 4I65A 2E76C 1MIUA 2SNMA 4JOIA 2F0UA 1YNNC 1IBLQ 1IL2A 3MXNB 4K5WA 2XWBB 3C46A 3S2DH 4HJ5A 1HA6A 4G7OC 4LMQD 2K05A 3PO2B 1EY5A 4GNXB 1M8AA 4JYAL 4NB3A 4RG1A 1SXTA 1S5CD 1A3VA 1YJNA 5DEHA 5IOCA 3WDNA 4DKAC 2F0GA 1KL9A 1S5FD 1AE2A 5G3LF 1G8ZD 3JAMi 2NVTH 2N49A 1LT3D 1JICA 4GLVB 2JQOA 2R3ZA 4A3IB 2KA7A 1TWCH 3NP8A 4POFA 1ML0D 1RF2D 1LTID 4GLAC 1X3EA 1PRTC 4X65Q 1S5ED 3NWTA 1VMPA 4YWMA 3CW2C 4HIDA 4LAAA 1N8RC 3IFDA 2UUAQ 2EE1A 5AJ3Q 1BF4A 2Q2IA 3C2PA 1CKNB 3PUYA 5I2YA 4A3BG 3KJOA 3I72A 3NELA 1CT1D 4E6IA 2BH8A 3ULPA 2DJFC 1KIXA 4CKBA 3S2HB 5COYA 3I4OA 4RCOA 3GTGH 3KF8B 3L3OC 3NXWA 4A4IA 4IPGA 1GUNA 1HR0L 3TP7A 4A3EG 1H9KA 3C1FA 4MNOA 2B2YC 2PO4A 5JPMC 1E7ZA 1GUSA 2Q8IB 1VQCA 4R1JA 4ZKBB 4DR4L 2NYZD 1PTOD 2BCOA 1PH7A 4GKJL 3KJPA 3S15H 2B2YA 3OOCA 2K5HA 2VQEL 1TWAH 2B8FA 2DN8A 2ICIA 1EZ8A 2F0TA 2F0KA 1TS2A 5E1FA 1NE3A 2ZJQA 1IBKL 1SYGA 2PMZE 2A73B 3GO5A 2JXMB 4RA8A 1K3BC 2D9UA 4BY1G 3E0EA 3MWYW 3MHBA 3NENA 4OIKA 1J9OA 4JI3Q 2E5LL 1BO0A 3MXNA 2VUMB 4RGTA 5K5PA 4DV3Q 4DV4L 3CU7A 3O13A 4LUVA 4A3LG 1EWHA 1BCPC 5EGTA 1KRTA 4ILWA 2X69A 4GNXA 2PZWA 2D62A 1CQFA 3K5NA 5NUCA 3UI2A 2PNHA 4X62L 2KEEA 1YI2A 2I5LX 2K7VA 5JVG3 5M3FG 2MJ8A 3TS0A 2EY2A 3HOZH 1U4LA 4ZUIA 4PMWA 5L37A 4JVZA 3BZDB 4X3SA 1N33L 4BXXG 2HT1A 4JI5Q 3UE1A 2B2WC 3FPUB 5C0XH 1IBMQ 2WFWA 5GADC 4DV2Q 1EY7A 1PHJA 3M3YH 3HOVG 2V4DA 2NB0A 4HTHA 2UXDQ 3S16B 4R4CA 1HUMA 1HQRD 2B2WA 1TXYA 4KKSA 3CCEA 4DV1L 4XQJA 1PFSA 2LXKA 2GVBA 1XTDA 1NCVA 3CCLA 1A62A 1O7LA 4A3GG 1CKNA 4CJ2C 3I91A 4JV5Q 4JI0L 2XVSA 1G91A 2IPKD 1QVFA 1S72A 1N36Q 2E2DC 3S1RH 4TVAB 2K5NA 2RHQB 4Z9CB
chains in the Genus database with same CATH topology
3OWEB 1I4RA 1EY8A 4PMBA 3SK6A 1RTOA 2EYOA 3V96A 2CW0D 4TKOB 4KJNA 4QUFA 4X3UA 2J0TD 4BS9A 2WKCA 4DAVA 4ZLTF 2KQ3A 1STAA 4WFN3 2HQEA 4F7XA 2F0LA 1I4GA 1PZJD 1Y8NB 2WACA 2PZTA 4R8IA 4G7ZC 4A3BB 4YIJA 1B44D 3M4OB 1SSOA 3K5LA 1QNUA 4IFDJ 3LNNA 1SYBA 3NHHA 4UAIA 5ELDA 3TZUA 4DA2A 1SAPA 1JE4A 3JAML 4A3EB 2RDHA 3SE0A 2R7ZB 4DAPA 3CRKC 1EY0A 1GUOA 5CORA 1PDQA 1V1PB 1HA5A 2KECA 3D31A 3BDOA 1PZKD 3DUZA 5CYUA 1SNCA 2IJ0A 1LTBD 5AFWA 3TDQA 2F0HA 3I70A 1EQVA 1STYA 5EPLA 1DXMA 1TKWB 4RKBA 1EEFD 1IYUA 3NK9A 2CQAA 2CHBD 3IL8A 4H44C 2RDGA 4FP5D 5C5LA 5KYIA 1G2SA 4IFDI 3MC0B 1BQQT 3DMUA 1E2ZA 1Q1BA 4NKLA 4IN3A 3BVGA 1TQOA 2BE5D 2RDFA 5D14A 1SNOA 3HKZB 3A8IE 2NVTB 2IT1A 4CJ1B 2RA4A 2CW0C 3VR6A 5D3IB 2F0VA 1QOHA 5IGEA 3PUVA 1TWCB 3DWQA 1OO9B 2ZXPA 1GOZA 2JP1A 4RAUC 4H0LC 3Q24A 1V8QA 1KLUD 2Z1CA 1OXTA 4QCLA 2JSOA 1RJTA 5CV8A 4G7HC 3RLFA 4RHSA 4NMZA 1AW7A 2BDNA 5JPNC 1IL8A 4X3TA 1A2UA 1MSHA 1D1IA 1PFNA 3GQBA 2EYHA 3GTGB 3A8JE 4XXEA 4FF3A 3NE5B 1EIGA 1TIID 4C3JG 1V1PA 2L55A 2MPMA 1PTOH 1I4XA 2QEJC 2PCFB 3VYUA 5I2XA 2M00A 5F2DA 4FXKC 2Q8TA 3Q22A 5J1ZA 4FVMA 4CHTB 4K2LA 2RQXA 3VR5A 1CK1A 3S15B 1WD1A 1LACA 3DXJC 1TWAB 4C1NK 1B9NA 1SMYD 1MSGA 1MD2D 2XRQD 2AUKA 3EVQA 2CVRA 2F3WA 1ZEQX 2FINB 1C4QA 2RSOA 1IW7D 1YNJC 4O1NA 4HAEA 1LTAD 3AU7A 2XNAC 2N55A 1AZPA 3GV3A 3K0YA 3EQLC 2ZXRA 1PRTF 3TP8A 1HTPA 3IFTA 4TSSA 3HOZB 1EZ6A 1H9RA 4Q5VA 3K59A 4V190 2RKSA 1EEID 5CR3A 3M3YB 1W6JA 1U4PA 1HTLD 5A35A 5IGCA 3OIQA 4ODGA 3MEHA 2A68C 4JK1C 2IX0A 1JWMD 3NPPA 4IUUA 1E0BA 2IL8A 1GUWA 2K33A 4OGQC 3HZXA 2JE6I 3BYYB 2JEAI 2A5HA 2OT2A 1F2YA 2PQEA 3S1RB 3CKIB 2QDBA 5EJWA 5LL6X 1EYCA 1D5XC 1NSNS 3QOJA 2EYPA 4AYBB 2HUGA 1HFGA 1F9RA 1NUCA 1WCMB 4IFDH 3IAYA 5EKKA 4IZ8A 1BR9A 1DOMA 1RHPA 1EWCA 3FMCA 3SK5A 1VDZA 5C4XB 5DNFA 3TMEA 2QILA 1II3A 1SMYC 1LTGD 2AQ3B 2XWJB 4K14A 1EY9A 5CV6A 2A69D 1K83B 4J8QA 4RFBA 4K6DA 2IX1A 5J22A 2JA8B 1O78A 4HMIA 5KRUA 2I07B 3OHXC 1HQMC 2E2IB 3MFGA 1DOLA 3I4NB 1CM9A 4HMJA 1STHA 5M3MB 1I4QA 3K5OA 5LHY1 4BA1I 2EPBA 3TN2A 2SOBA 5BN5A 1TS3A 2DY8A 4HR7B 3HEJA 5KNBA 3GP7A 5FO7B 4U68A 5KGUA 2F1MA 1ESFA 2DNCA 4XT1B 3KK7A 5IGDA 4RHRA 1Y69U 2JA7B 3MVVA 3DEPA 3M7NA 2NBFA 2L5TA 4XDXA 3OSOA 3P75A 4A3MB 4DFAA 1BUVT 1CI3M 1EU4A 1ET9A 3PMFA 3D4DA 4XQNA 2KHSA 4B08A 3JAME 1SE3A 3QOLA 2EY5A 3DEOA 3U9SA 4KKUA 4FO2A 4KI0A 1SE2A 3RUZA 2LS01 1F2MA 1B53A 5C4JB 3DWPA 1WVLA 3CHBD 3U9OA 1UAPA 1CQVA 2X6GA 1ZKOA 2EJGC 5CV9A 1VF7A 3J81L 1L0YB 4V0BA 3AMUA 2EYMA 3H91A 3S14B 3IKJA 3S17B 1GJXA 4LJZC 2LKVA 3FPPA 4P2CB 3K58A 1UNSA 1TWFB 2AWOA 2PW7A 1B1ZA 5JEAG 2B2UA 2A6ED 1FNWA 2LMCB 3DM1A 2B2TC 4HSVA 4IQZA 1KDCA 1VF5C 4NP5A 1SFOB 3GTQB 5D3DA 4F8MA 3SDZA 3ERQA 1Q1EA 4MHEA 1PTOB 2XIWA 2F0MA 1LTSD 2B2TA 4WRDA 5EKLA 1F77A 3OMGA 3HRZC 3VA7A 1CHPD 3QB3A 2HCIA 1TR5A 5ELCA 1Y1VB 5E4XA 2NVYB 1AEXA 4G57A 3ND9A 1NAPA 3EA6A 5ELEA 2YU9B 3GV6A 1OXVA 4J1MA 5A2QL 3TP6A 2B2VA 2KCCA 1H9JA 1Z47A 2WAQB 1CTMA 5C6AA 1CA5A 2EXZA 3GD7A 5ISRA 1LT6D 2NN6I 3R2IA 2J4XA 4RGOS 1A3TA 3GTJB 5K36H 1JOOA 1UEAB 3TBIB 2F0OA 2EJMA 3J7AF 2WB1B 4O42A 4RH6A 3SK8A 1DZ1A 2DNEA 3GTLB 3OWFA 3M7GA 5IODA 1EU3A 4HSPA 3BS1A 1AFPA 4PV1C 2IWHA 1EQTA 2KVMA 4BY7B 1WTWA 5CBAE 5BN4A 4S3SA 3P20A 1GHJA 1ONLA 5IGBA 5I6YA 4J6HA 1WTVA 2Z4HA 1PZID 2F3VA 3HG9A 1PTOC 3Q23A 2OXPA 4R9WA 3E0JA 2C5CA 2H1EA 3C1EA 1Y8OB 5KYLA 1B4OA 3MTSA 2VNUD 1Q3LA 2Z4IA 2NTSA 1FR3A 4RKLA 3V05A 2R6GA 2F0PA 1HFNA 1QNKA 2C9OA 4A3FB 1U9RA 4ME5A 2KEDA 3RZDB 2PW5A 2PPBC 4OO1I 4QB4A 1CA6A 2AQ1B 4F87A 4HCSA 3MFYA 1Z7TA 2VB3X 5IT9L 1QB5D 4C3HB 4FXDA 2R92B 3TSSA 4U673 1KABA 2DY7A 2F0WA 5I4DA 3MXPA 1T5XD 4DXGA 1AP0A 3T53B 5JVH3 5M5XB 3BG3A 3SVMA 1FGBD 3K57A 4KKTA 2X6LA 4PQXA 2E75C 4A93B 1LT5D 3H6MA 2EY1A 1C48A 1K8OA 4DF7A 2J7ZA 2L4NA 3CQZB 4QIWB 5C0XG 3HOYB 4ULLA 2TSSA 4KY7A 1TS5A 3BDLA 1QCBD 2LY7A 3T4AC 1JWUD 4DGZA 1D5ZC 4C56C 1I50B 1ZYRD 3S1NB 3LWEA 2BA0A 4EQNA 1CFMA 4DAYA 1VCIA 2N88A 4KD4A 1MBYA 2B8GA 1K8MA 3T56B 5FKAC 1ET6A 1PLFA 4KN4C 3S9WA 4I7ZC 5KNCA 4EVOA 4QF4A 1L0XB 3EROA 2K5DA 3S1MB 1GUTA 2FMCA 5DAUA 5EBCA 5FLXL 3KBGA 2BOSA 2SDFA 1G6ZA 5ELFA 2E74C 3R8BA 4G4KA 2NN6H 2XSCA 1W6KA 3N52A 1LO5D 2VB2X 1UUPA 4KJOA 4XYQA 3H3VC 5C4ZA 3E6ZX 4EQOA 4A3DB 2F0NA 3I4LA 1SYDA 5M5YB 4XT3B 3K6OA 2K28A 2WP8J 2D2CC 3QWNA 3D8GA 1STBA 1ENCA 4Q0FA 3PV0A 1DOKA 1LT4D 1KDAA 3P7JA 5FK9C 4IALA 2K5WA 3A7AB 2FHTA 5CV4A 1D1KA 1DYQA 1JB3A 2HDMA 2FMMA 1EIHA 1JR0D 3X3NA 5C3XA 3PUXA 3VR3A 2BE5C 4IURA 3J81E 5DM73 4FF4A 2K1BA 3GTPB 2KCNA 4OO1H 1TY2A 4CKEA 1ENFA 1FYCA 2RVLA 5HURA 4BBSB 4RGMA 1R4PB 1KLGD 4KMUC 1CZWA 4XQQA 3QJYA 1BNZA 5C3WA 2A6HD 3RMHA 2WIIB 3E5SA 2NVQB 1CHQD 2EDGA 4DU9A 1JOKA 1I6HB 2O5JC 1O7YA 1RODA 2H4OA 2JA6B 1F9PA 4KY6A 3K5MA 4OHJA 3J80L 2NN6G 1NR2A 3I73A 1B9MA 5FOBB 4IUQA 1VMCA 2JA5B 3FRPB 3T51B 2F0DA 1WTXA 3BYTB 5J39A 2B63B 3I4MB 3PO3B 2M2LA 5I6WA 1SNMA 1STGA 1S5BD 1KNAA 1PRTD 1X32A 4LK1C 1IKMA 4L63B 3C3LA 2RBMA 3MA2B 2NZ1D 2G9HD 1EYAA 3CRLC 4H7BA 2EZVA 2QKIC 1IW7C 4IUNA 1QG7A 3P1HA 2O4XA 2F0JA 3FKIB 4ZYSA 1XX8A 2WKDA 5FO9B 4DNRB 3F2UA 4IUVA 2NVXB 1MI2A 2KOLA 3A55A 3SR1A 1TWGB 3Q0AA 4GZYC 5KEEA 1PYWD 1D5MC 4M8AA 4IUPA 3AB9A 1QILA 1FNUA 2ZT9C 4OIJA 4NW2A 2GA4B 2NUCA 2WINB 1ICWA 1MGSA 1HRJA 1DCZA 3HOUB 1WTPA 1RCVD 2A6HC 3DHQA 1TVXA 2WV6D 4HCEA 4C1NI 3KLSX 2ICEC 1BCPD 1LTTD 1SE4A 1RDPD 2L12A 2EJFC 1B50A 1GUGA 4R8NA 4ZUJA 5T1IA 5C3EB 5KNDA 1PTOF 3K7AB 1A3UA 1D2BA 2K01A 1STEA 1BCPB 2LFNA 3H0GB 1C8CA 2F4IA 5IT9E 1TS4A 1A6XA 2F0FA 4CKCA 1I6VC 2IW3A 5E4WC 2K5QA 2A74C 3N6RA 3J7AV 3RD4A 4IFDG 2MP1A 2M9VA 1RD9D 3H09A 4OL7A 2EYJA 3DWAA 4FXGC 4FF1A 1DM0B 3MXUA 2NTTA 3NTKA 3QO2A 4EGVA 2B2UC 4K8IA 2RSNA 2A69C 4TQUS 4QMGA 3H94A 1GXDC 2K04A 4C3HG 3LWUA 4K6LA 3OW7A 1OXUA 3ND8A 1KAAA 2OF1A 4ABNA 1BDOA 1WD0A 5EPJA 5C44B 4CGYB 4UDUC 1X3QA 2OEOA 5G3LD 5JOBA 1ILQA 1LLRD 1D6EC 2VXWA 3MZ5A 2Y0SB 3TP5A 5HGTA 5E3FA 2B2VC 5CMDA 5IGGA 3HGBA 1QWYA 1U4RA 5CV5A 3SK4A 1I4PA 5FLXE 1IYVA 1S4ZA 5DM63 1XWEA 2F0SA 1SYFA 3D6CA 5T1GA 4F88A 1HUNA 1WTQA 3I90A 4DK1A 4B9WA 4DNTB 4KD3A 3HOWB 1HHVA 1SNPA 2B39A 1B3AA 2E2HB 5FO8B 1TY0A 2EYFA 3VR2A 1SJHD 1TU2B 1LV9A 3I8ZA 2FJ2A 4BA2I 4KY5A 5CC4A 5D65A 2KUMA 2XN9C 4KK7A 1SYCA 2HDLA 1JOQA 1Q12A 4PNYA 4ZQ3A 4EQPA 1ENAA 4WORA 1M4VA 3NSWA 5ELBA 1SNDA 2G9DA 2O5IC 4JBWA 4MIUA 3D4WA 3NBHA 2Q8RE 3NTIA 1Q90A 2MGSA 4Y7NB 3WOFA 3PIO3 3VYRA 3KF8A 1X3PA 2A6EC 1XXGA 2EY6A 2QF7A 5CV7A 2EOTA 1EY4A 1STNA 4L6TB 4KHVA 2PYKA 1B2TA 1S5DD 5M9OA 3T16A 3V2TA 1G2TA 1EL0A 3SEBA 1O80A 4RGNA 4NDXA 3ITPA 1SNQA 2PNRC 3S1QB 4XIGS 2BDOA 3NQIA 1AN8A 3NWSA 5IIFA 1DONA 4KV6A 2F0EA 2L11A 3VYSA 4KHZA 1EOTA 2BA1A 2L9HA 4K8JA 2PMZB 1EYDA 3L7ZC 1PFBA 5JEAJ 3HP3A 1RKNA 3X3MA 4WJWA 3J80E 3RZOB 3FEWX 2AUJD 3NTHA 5CBEE 5K36G 3URYA 3NQTA 1E2VA 3KUPA 2ZXOA 3EJIA 4ZK9B 4BY1B 2AWNA 5I9PA 4XTCS 4RWSC 3A8KE 1F2LA 1ILPA 2XRSD 4C3IG 4ID6A 1YNJD 3M85A 5LL6S 2YYZA 1Z6HA 1TT2A 3S2DB 5CGKA 2E2JB 3D3RA 5M3FB 3D4RA 1GHKA 1SDFA 5TSSA 2F0IA 1H9MA 3L9AX 4N9PA 3GTMB 5I9OA 1IHZA 4K2KA 2K03A 4N9TA 3TZDA 3I3CA 3HOVB 3D6WA 2JYOA 2R61A 1HPCA 3G7LA 4X3KA 4MN3A 2ID0A 2D5DA 1XTCD 1TWHB 1JQYD 3OMCA 4KN7C 1DD2A 4FYDA 1G291 2A68D 5KIXA 4A3GB 1U4MA 3J7YW 1DJRD 3PIP3 2L1BA 2AQ2B 2IX3A 5EPKA 3FDTA 5M5WB 3PUWA 2SEBD 3W3AA 1A15A 1BXTA 2FFKB 3GTOB 1FD7D 1JORA 3R2TA 3SXHA 2TMPA 3OPOA 1O7ZA 4H13C 4K5VA 2Z8LA 3A54A 4K5XA 1QJOA 3BVZA 1KNEA 4DK0A 1I3QB 1HXYD 1EFID 3BDCA 3VYTA 3EFXD 1XYIA 1BOSA 2HCCA 4HN7A 3QG1A 4DXFA 5C5MA 4ZRZA 3KLSA 1EY6A 1AZQA 1RTNA 1ZYRC 2NWGA 3G6JB 3T13A 3HS0C 1LABA 1H9SB 1R9TB 5IGFA 1NR4A 2MHVA 3MXGA 1SBBB 4FF2A 1OXXK 1JCKB 1CZGA 1J8IA 4C2MB 4L8JA 4QUCA 2JEBI 1SEBD 1PFMA 3A7LA 3LX0A 4A3JB 3A56A 1Y8PB 1T5EA 1YNND 5C0XJ 1R4QB 5C4HA 1KDBA 3HOXB 5JAVA 3R3OA 2K32A 4C3IB 4PMCA 1V1OA 2KJXA 3OIPA 2MUYA 4CJ0B 2L0CA 1V43A 4BWGB 1KTKA 3M4YA 2R93B 1ZXTA 4XYOA 1WTRA 5A2QE 1ESRA 1F9SA 1F2ZA 4CBVA 1OXSC 1Q8IA 2K6AA 4B9XA 1SYEA 5EBDA 4BBRB 3W2DA 1QE6A 1SJED 3NUCA 5JJZA 1PXUA 4HEDA 1F9QA 3KBXA 3KLRA 3PUZA 3QIAA 4A3KB 3FVQA 4RCNA 4ZKCB 4M1UB 1PRTB 1PMRA 5EQ0A 1IKLA 1FNVA 5BN3A 3WOEA 4TRDA 3R93A 1BCPF 5C0XI 3VR4A 3SHLA 5JEAH 4KTAA 2O2LD 1HCZA 3MAQA 2I46A 1BBXC 2F0QA 1H9SA 2EVBA 2SNSA 3NBIA 1JWSD 2ENBA 2PZUA 4DN4M 5EKIA 4C3JB 1E2WA 2QCPX 3BVMA 1A2TA 3GTKB 1LTRD 3VA5A 1WTOA 2F03A 4OO1G 1JC7A 4IUTA 3Q6SA 2EYLA 1Y1WB 4ZAIA 4FNFA 1I4HA 3ONAB 3ZYYX 4I65A 2E76C 2SNMA 2F0UA 1YNNC 4K5WA 2XWBB 3C46A 1HA6A 4G7OC 4LMQD 2K05A 3PO2B 1EY5A 1M8AA 1SXTA 1S5CD 1A3VA 5DEHA 5IOCA 3WDNA 2F0GA 1S5FD 5G3LF 1G8ZD 1LT3D 1JICA 2R3ZA 4A3IB 2KA7A 3NP8A 1ML0D 1RF2D 1LTID 1PRTC 1S5ED 3NWTA 1VMPA 4LAAA 3IFDA 2EE1A 1BF4A 3C2PA 3PUYA 5I2YA 3I72A 1CT1D 4E6IA 4CKBA 3S2HB 5COYA 4RCOA 3L3OC 3NXWA 1GUNA 3TP7A 1H9KA 3C1FA 2B2YC 2PO4A 5JPMC 1GUSA 2Q8IB 4ZKBB 2NYZD 1PTOD 2BCOA 2B2YA 3OOCA 2B8FA 2DN8A 2ICIA 1EZ8A 2F0TA 2F0KA 1TS2A 5E1FA 1SYGA 3GO5A 2A73B 2JXMB 4RA8A 2D9UA 3MWYW 3MHBA 4OIKA 1J9OA 1BO0A 3MXNA 2VUMB 4RGTA 5K5PA 3CU7A 3O13A 1EWHA 1BCPC 5EGTA 4ILWA 2X69A 2PZWA 2D62A 1CQFA 3K5NA 5NUCA 3UI2A 2KEEA 2K7VA 5JVG3 2MJ8A 2EY2A 1U4LA 4ZUIA 4PMWA 3BZDB 4X3SA 2B2WC 3FPUB 5C0XH 1EY7A 2V4DA 2NB0A 4HTHA 3S16B 1HUMA 1HQRD 2B2WA 4KKSA 4XQJA 1NCVA 1O7LA 4CJ2C 3I91A 2XVSA 1G91A 2IPKD 2E2DC 4Z9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9P A;  3D6W A;  1AP0 A;  2JYO A;  1G2S A;  2CVR A;  4QUC A;  4DN4 M;  3G7L A;  4X3K A;  5EKI A;  1U4R A;  5DNF A;  1B53 A;  4MN3 A;  2B2Y C;  2FIN B;  3SVM A;  1NR2 A;  2L12 A;  2RSO A;  1WVL A;  1S4Z A;  1B50 A;  1PFM A;  1WTO A;  2X6L A;  4IUQ A;  5T1I A;  1VMC A;  1RTO A;  4ZKB B;  2NYZ D;  4IUT A;  1WTX A;  4HAE A;  4XT3 B;  2J7Z A;  2K28 A;  2X6G A;  2L4N A;  3Q6S A;  1U4M A;  2M2L A;  5T1G A;  2B2Y A;  4ZAI A;  1DON A;  4QUF A;  4X3U A;  4O42 A;  5D14 A;  2K01 A;  2L1B A;  1HUN A;  2N55 A;  3ONA B;  1AZP A;  5EPK A;  3FDT A;  3GV3 A;  1WTQ A;  1DZ1 A;  1C8C A;  1KNA A;  2L11 A;  3I90 A;  3H91 A;  4ZLT F;  4CJ1 B;  1X32 A;  2RA4 A;  4RA8 A;  1EOT A;  1A15 A;  2D9U A;  2L9H A;  2FFK B;  1DOK A;  3MWY W;  1IKM A;  1DOL A;  4CJ0 B;  1HA6 A;  3P7J A;  5E4W C;  1EQT A;  1HHV A;  4OIK A;  1J9O A;  4R8I A;  2KVM A;  1WTW A;  1PFB A;  5CBA E;  1SSO A;  1BO0 A;  2K05 A;  3HP3 A;  4LMQ D;  1CM9 A;  1M8A A;  1ZXT A;  1B3A A;  2B2U A;  1WTR A;  2NZ1 D;  2MP1 A;  1O7Z A;  3LWE A;  3DM1 A;  2JP1 A;  1ESR A;  2FHT A;  1F9S A;  2B2T C;  4HSV A;  2N88 A;  4RAU C;  4UAI A;  1LV9 A;  2X69 A;  3I8Z A;  1WTV A;  2FJ2 A;  2HDM A;  1U4P A;  2FMM A;  1KNE A;  1EIH A;  5CBE E;  5D65 A;  3QO2 A;  3UI2 A;  2KUM A;  2KEE A;  1JIC A;  1QG7 A;  1SAP A;  2B2U C;  2EPB A;  1RJT A;  4R9W A;  3KUP A;  3TN2 A;  1JE4 A;  1PLF A;  2RSN A;  4MHE A;  1XX8 A;  2XIW A;  4ZK9 B;  2HDL A;  2MJ8 A;  2H1E A;  2R3Z A;  2B2T A;  4IUR A;  2BDN A;  1B4O A;  1U4L A;  2K1B A;  2K04 A;  3F2U A;  3MTS A;  4IUV A;  4IUU A;  1E0B A;  1MI2 A;  1Q3L A;  1ML0 D;  2IL8 A;  1QE6 A;  1XYI A;  1GUW A;  4X3S A;  4HED A;  1IL8 A;  4RWS C;  4X3T A;  5JJZ A;  1F9Q A;  1MSH A;  2HCC A;  2KOL A;  3KBX A;  2HCI A;  1HFN A;  1QNK A;  2B2W C;  2DY8 A;  2RVL A;  1F2L A;  1PDQ A;  1PFN A;  3FPU B;  5COR A;  5EPJ A;  1WD0 A;  4U68 A;  1ILP A;  5E4X A;  2KEC A;  2KED A;  4ZKC B;  1VMP A;  1X3Q A;  5EQ0 A;  1IKL A;  1EIG A;  1NAP A;  4XT1 B;  1AZQ A;  2Q8R E;  2MGS A;  1RTN A;  2SDF A;  3GV6 A;  5EJW A;  1CA6 A;  3IFD A;  3R93 A;  1G6Z A;  2MPM A;  2EE1 A;  1X3P A;  2NWG A;  2B2V A;  1BF4 A;  1HUM A;  2B2W A;  4IUP A;  3DEP A;  1ILQ A;  4HCS A;  2VXW A;  4XDX A;  4OIJ A;  4NW2 A;  1BNZ A;  2EOT A;  2Q8T A;  1CA5 A;  1SDF A;  2HUG A;  5AFW A;  1HFG A;  1NCV A;  1NR4 A;  1ICW A;  1F9R A;  4CJ2 C;  1MGS A;  3I91 A;  1B2T A;  1HRJ A;  5EPL A;  1BBX C;  2B2V C;  3N52 A;  5COY A;  5CMD A;  1WD1 A;  1G91 A;  3DEO A;  1WTP A;  2DY7 A;  2K03 A;  3TZD A;  1RHP A;  1DOM A;  1MSG A;  1O7Y A;  1ROD A;  1EL0 A;  3I3C A;  1G2T A;  1TVX A;  3IL8 A;  1O80 A;  1J8I A; 
#chains in the Genus database with same CATH topology
 3OWE B;  1I4R A;  4DAM A;  1EY8 A;  4PMB A;  3DLL A;  3SK6 A;  1PH1 A;  4BBR H;  1RTO A;  4PG3 A;  2EYO A;  2RHS B;  3V96 A;  1WCM H;  2CW0 D;  4TKO B;  4KJN A;  4QUF A;  4X3U A;  2J0T D;  4JI6 Q;  4BS9 A;  2B3G A;  2WKC A;  4DAV A;  3CXC A;  4ZLT F;  2KQ3 A;  4PZ8 A;  1STA A;  4WFN 3;  5C4X H;  2HQE A;  4F7X A;  2F0L A;  1I4G A;  1PZJ D;  1Y8N B;  2WAC A;  5GAE C;  2PZT A;  4R8I A;  3IRB A;  4G7Z C;  2G5D A;  4YIJ A;  1HNZ Q;  1B44 D;  4A3B B;  3M4O B;  1SSO A;  3PF5 A;  3K5L A;  1QNU A;  1PYB A;  4IFD J;  1K83 H;  3LNN A;  1SYB A;  3NHH A;  2I5M X;  1YJ9 A;  4UAI A;  5ELD A;  4YY3 Q;  3TZU A;  3H15 A;  2JA8 H;  4DA2 A;  2CWA A;  1SAP A;  4DV6 L;  1JE4 A;  1XMO L;  3JAM L;  4A3E B;  2E2I H;  2RDH A;  1XNR Q;  1MKH A;  4DK6 C;  3SE0 A;  3CPW A;  3I4N H;  2R7Z B;  4DAP A;  3AFP A;  2DGY A;  1B8A A;  3CRK C;  5IP7 G;  1EY0 A;  1GUO A;  5COR A;  1PDQ A;  5M3M H;  1V1P B;  1HA5 A;  2KEC A;  1X65 A;  4OWT B;  3D31 A;  3BDO A;  1PZK D;  4DR2 L;  1PH3 A;  1N9W A;  3DUZ A;  1SE8 A;  3A74 A;  5CYU A;  1KAW A;  1K0S A;  1SNC A;  3PIO A;  3RN2 A;  4A3J G;  2IJ0 A;  1LTB D;  5AFW A;  3TDQ A;  2F0H A;  3M4Q A;  3T1H Q;  4LNQ A;  3I70 A;  1EQV A;  1STY A;  4LF4 L;  3AFQ A;  4YHH Q;  5EPL A;  1DXM A;  1TKW B;  1Q46 A;  4RKB A;  1EEF D;  1IYU A;  3M9B A;  3NK9 A;  1XPO A;  2BH2 A;  2CQA A;  2CHB D;  3IL8 A;  4H44 C;  2RDG A;  4NXM Q;  4FP5 D;  1SLJ A;  5C5L A;  5KYI A;  1G2S A;  3BZC A;  4IFD I;  2JA7 H;  3MC0 B;  1BQQ T;  3DMU A;  3KOJ A;  4N8F A;  1K0R A;  1E2Z A;  1Q1B A;  4A3M H;  2R93 G;  5IYD H;  4NKL A;  3CCR A;  4IN3 A;  3BVG A;  1TQO A;  2BE5 D;  5GAH C;  2RDF A;  5D14 A;  3OTO L;  1SNO A;  3HKZ B;  3A8I E;  1K8G A;  5IYB G;  2NVT B;  2IT1 A;  4CJ1 B;  5FLM H;  3U4V A;  2F4V L;  2RA4 A;  2CW0 C;  3VR6 A;  5C4J H;  4AQY L;  4YWK A;  4AYB G;  5D3I B;  2RCF A;  1WI5 A;  4BBR G;  2UU9 Q;  2F0V A;  1QOH A;  5IGE A;  3PUV A;  1TWC B;  4B3T L;  3A5Z B;  2VL6 A;  4FDB A;  3DWQ A;  1OO9 B;  5FJ8 G;  4JI1 Q;  2ZXP A;  4A3K G;  4KHP Q;  1GOZ A;  2JP1 A;  4RAU C;  4DK3 C;  4L5Q A;  3H3V I;  3S14 H;  4H0L C;  5C4X G;  3S17 H;  3Q24 A;  1V8Q A;  1KLU D;  2Z1C A;  3AYH B;  4A75 A;  1OTC A;  1OXT A;  4QCL A;  2JSO A;  5BR8 L;  1RJT A;  5CV8 A;  1VQE A;  4G7H C;  1TWF H;  3RLF A;  4RHS A;  5H1S E;  4NMZ A;  3JAM c;  1AW7 A;  2BDN A;  5JPN C;  3CC7 A;  2R7D A;  1IL8 A;  4X3T A;  1A2U A;  1MSH A;  3K80 C;  1D1I A;  1YVC A;  1PFN A;  3GQB A;  3CP0 A;  2EYH A;  3CCV A;  3GTG B;  3A8J E;  4XXE A;  4FF3 A;  1GM5 A;  3NE5 B;  1SFO H;  3GTQ H;  1EIG A;  2K5V A;  4UHV A;  1TII D;  4C3J G;  2XGT A;  1V1P A;  2L55 A;  2MPM A;  5LMU Q;  1PTO H;  1I4X A;  3MEF A;  2QEJ C;  2PCF B;  1BBU A;  3VYU A;  4MTN A;  5I2X A;  2M00 A;  5F2D A;  4FXK C;  4OON A;  2Q8T A;  2MNA A;  1NMG A;  3Q22 A;  4DR7 Q;  5J1Z A;  4FVM A;  4CHT B;  1IBL L;  2K14 A;  4ZCK A;  4K2L A;  2RQX A;  3VR5 A;  1Y1W G;  1VQI A;  1CK1 A;  1D8L A;  3KFU A;  3S15 B;  1WD1 A;  1LAC A;  1Y1V H;  1VQJ A;  4UPA A;  2NVY H;  3DXJ C;  1TWA B;  4C1N K;  1B9N A;  1SMY D;  1MSG A;  1MD2 D;  2XRQ D;  4GN4 B;  2AUK A;  1DGS A;  3EVQ A;  1W2B A;  2YU9 H;  2CVR A;  2OCE A;  2F3W A;  4DUZ Q;  1ZEQ X;  2FIN B;  1C4Q A;  2RSO A;  2ZJR A;  3J7A 5;  3UDF A;  3PO2 G;  1IW7 D;  1YNJ C;  3U50 C;  3CPF A;  4O1N A;  4HAE A;  2GVA A;  1LTA D;  3AU7 A;  2XNA C;  2N55 A;  1X54 A;  1AZP A;  3PIP A;  3GV3 A;  3K0Y A;  3EQL C;  2ZXR A;  1L2F A;  3GTJ H;  1PRT F;  3TP8 A;  4X65 L;  4A3I G;  1LUZ A;  4A3M G;  2CH4 W;  1HTP A;  3IFT A;  4TSS A;  5LMN Q;  3HOZ B;  1EZ6 A;  1K73 C;  1H9R A;  4Q5V A;  2UUA L;  5AJ3 L;  3K59 A;  4P74 A;  4JBK A;  2AHO B;  4V19 0;  4GOP B;  2RKS A;  2DJG C;  1EEI D;  5CR3 A;  3M3Y B;  1W6J A;  1U4P A;  1HTL D;  5A35 A;  5IGC A;  3GTL H;  3EN2 A;  3OIQ A;  4ODG A;  1HZC A;  2K52 A;  1I5F A;  3MEH A;  2A68 C;  4JK1 C;  4DR5 Q;  2IX0 A;  1JWM D;  3NPP A;  4WJ3 M;  4OXP A;  4BY7 H;  4IUU A;  4QL5 A;  1E0B A;  2IL8 A;  1GUW A;  4L5R C;  2K33 A;  4OGQ C;  2DUD A;  3HZX A;  2JE6 I;  3TEH B;  3BYY B;  2JEA I;  2A5H A;  3K81 C;  2OT2 A;  4YCV A;  1F2Y A;  2PQE A;  4LWC A;  4P71 A;  1YZ6 A;  3S1R B;  3CKI B;  4LW1 A;  2NZO A;  2MO0 A;  1SMX A;  2QDB A;  5EJW A;  4JBM A;  1G51 A;  3F8T A;  5LL6 X;  4QJF A;  1K28 A;  4IOA A;  1EYC A;  1D5X C;  1PA6 A;  1NSN S;  3QOJ A;  2EYP A;  4AYB B;  5IP9 H;  1QVC A;  2HUG A;  1HFG A;  1F9R A;  1VS0 A;  1NUC A;  1WCM B;  4IFD H;  3IAY A;  5EKK A;  4IZ8 A;  1YHA A;  4A3F H;  1SN8 A;  2Q2U A;  3RZD H;  1BR9 A;  1DOM A;  1RHP A;  1WOC A;  1EWC A;  3FMC A;  4DV3 L;  3SK5 A;  1VDZ A;  5C4X B;  5DNF A;  3TME A;  2QIL A;  2JA9 A;  1II3 A;  1SMY C;  1LTG D;  2AQ3 B;  4LFB Q;  2XWJ B;  4C3H H;  4A3C H;  4K14 A;  1EY9 A;  2MFI A;  5CV6 A;  2A69 D;  1K83 B;  4J8Q A;  2R92 H;  4RFB A;  4K6D A;  4B3M Q;  1HJP A;  2IX1 A;  5J22 A;  1VQF A;  1XNQ Q;  1BBW A;  2JA8 B;  4JBJ A;  1O78 A;  4HMI A;  4JI5 L;  5M5X H;  2CQO A;  5EAY A;  1N34 Q;  5KRU A;  2I07 B;  3OHX C;  1HQM C;  4DV2 L;  2E2I B;  3MFG A;  1DOL A;  1YIT A;  3H3V H;  4A93 H;  3I4N B;  1CM9 A;  4HMJ A;  1STH A;  4JOI C;  3CQZ H;  2YTX A;  3HOY H;  4N8X 1;  5M3M B;  1YBY A;  1UE5 A;  1I4Q A;  2Z6B A;  4GOP A;  4JV5 L;  3K5O A;  4JI8 Q;  5LHY 1;  4BA1 I;  1YHB A;  2EPB A;  3TN2 A;  2SOB A;  5BN5 A;  1I50 H;  4LFC Q;  3S1N H;  3U4Z A;  1TS3 A;  2DY8 A;  3EBE A;  3HEJ A;  3DM3 A;  4HR7 B;  5KNB A;  3GP7 A;  5FO7 B;  4U68 A;  4JC0 A;  5KGU A;  2F1M A;  1ESF A;  2DNC A;  1PH2 A;  2ZTE A;  4XT1 B;  3KK7 A;  1EIF A;  1PYS B;  3ER0 A;  5IGD A;  4RHR A;  1Y69 U;  3FHW A;  2JA7 B;  3MVV A;  3DEP A;  4JI6 L;  2NBF A;  2L5T A;  3M7N A;  4R4O A;  1K3R A;  4XDX A;  4DR3 Q;  2ASB A;  3OSO A;  1EWI A;  3P75 A;  4A3M B;  2CKZ B;  1BUV T;  1CI3 M;  4DFA A;  1VQH A;  3S1M H;  3PMF A;  1EU4 A;  1ET9 A;  1HH2 P;  3D4D A;  4XQN A;  2PI2 A;  1EFW A;  2KHS A;  4B08 A;  2QEX A;  1Q82 C;  3JAM E;  1SE3 A;  3QOL A;  2EY5 A;  4WJ4 A;  3DEO A;  2ATW A;  2ZM6 Q;  1HNZ L;  4HIK A;  3U9S A;  3TS2 A;  4KKU A;  2HHH Q;  4FO2 A;  4KI0 A;  1SE2 A;  3RUZ A;  2LS0 1;  1F2M A;  1B53 A;  5C4J B;  3AEV A;  1WTH A;  3PSI A;  3DWP A;  4YY3 L;  1WVL A;  3CHB D;  2GN5 A;  3U9O A;  1UAP A;  4DV7 Q;  1CUK A;  3KLW A;  2CH4 A;  2AKW B;  1CQV A;  3W1G A;  4A3F G;  2X6G A;  1ZKO A;  2EJG C;  5CV9 A;  1VF7 A;  3J81 L;  1L0Y B;  1XNR L;  4V0B A;  4LF8 Q;  3AMU A;  2EYM A;  3H91 A;  3S14 B;  3IKJ A;  3S17 B;  2D0O A;  1GJX A;  4LJZ C;  2LKV A;  3FPP A;  4P2C B;  3K58 A;  1E24 A;  1UNS A;  1TWF B;  2AWO A;  2PW7 A;  4A3D H;  1B1Z A;  1C0A A;  2R7Z G;  5JEA G;  3PGZ A;  2VW9 A;  3CME A;  5M5Y H;  2B2U A;  4P72 A;  2A6E D;  1CKM A;  1FNW A;  2LMC B;  3DM1 A;  5IWA Q;  2B2T C;  4HSV A;  3UDG A;  4LF9 Q;  4IQZ A;  1KDC A;  1VF5 C;  2A1A A;  4NP5 A;  2K4K A;  3T1H L;  1SFO B;  3GTQ B;  5D3D A;  4F8M A;  3F1Z A;  3SDZ A;  1UE7 A;  4PZ7 A;  4LF6 Q;  3ERQ A;  1Q1E A;  4MHE A;  1PTO B;  2XIW A;  2F0M A;  1LTS D;  2B2T A;  4WRD A;  5EKL A;  2CCZ A;  1F77 A;  3OMG A;  4I7A A;  4GNX C;  3HRZ C;  3VA7 A;  1CHP D;  3QB3 A;  1WFQ A;  2HCI A;  1TR5 A;  1IZ6 A;  5GQO A;  5ELC A;  1Y1V B;  5E4X A;  2NVY B;  1AEX A;  4G57 A;  3ND9 A;  1NAP A;  4OWX B;  3EA6 A;  4B3R Q;  5ELE A;  2YU9 B;  3GV6 A;  1OXV A;  4J1M A;  5A2Q L;  1VQ4 A;  3TP6 A;  2B2V A;  2KCC A;  1RIP A;  1H9J A;  1Z47 A;  3KF6 B;  2WAQ B;  1CTM A;  3GTP H;  5C6A A;  1CA5 A;  2EXZ A;  2HQL A;  3GD7 A;  3S24 A;  2UUB L;  2LSS A;  2MO1 A;  5ISR A;  1LT6 D;  2UU9 L;  3HKZ G;  4UP7 A;  4BBS H;  2NN6 I;  1N32 Q;  4ALP A;  3RLO A;  3R2I A;  2J4X A;  1I94 Q;  4RGO S;  1A3T A;  1Q8K A;  3GTJ B;  5K36 H;  3RLN A;  2IY5 B;  2VQF Q;  1JOO A;  1UEA B;  3TBI B;  2PQA B;  5JJL A;  1E22 A;  2F0O A;  3W5O A;  4HJA A;  2NVQ H;  2EJM A;  3J7A F;  2WB1 B;  3HKZ E;  4UP8 A;  1GD7 A;  4O42 A;  4YWL A;  1I6H H;  4RH6 A;  3SK8 A;  1DZ1 A;  2DNE A;  3E9H A;  4CDD C;  3GTL B;  3OWF A;  4YCW A;  3M7G A;  5IOD A;  1EU3 A;  4HSP A;  3BS1 A;  4QY7 A;  1AFP A;  1NTG A;  4PV1 C;  4UP9 A;  4DR6 Q;  2IWH A;  1EQT A;  2JA5 H;  2KVM A;  4BY7 B;  1WTW A;  5CBA E;  4DAY B;  5BN4 A;  5ELO A;  4JCV E;  4S3S A;  1FGU A;  3P20 A;  1L1O B;  1GHJ A;  5LMU L;  3T1Y L;  1XMQ Q;  2B63 H;  2UXB Q;  3PO3 H;  1ONL A;  5IGB A;  5I6Y A;  4J6H A;  3RNU A;  1WTV A;  4IO9 A;  2Z4H A;  4DR7 L;  1PZI D;  2F3V A;  3HG9 A;  1PTO C;  3Q23 A;  2OXP A;  4R9W A;  3E0J A;  2C5C A;  2H1E A;  3C1E A;  1HNW L;  1Y8O B;  3JC6 6;  5KYL A;  1B4O A;  3MTS A;  2RCN A;  2VNU D;  1Q3L A;  2Z4I A;  2NTS A;  1FR3 A;  1UWV A;  4RKL A;  3V05 A;  2R6G A;  2F0P A;  4DUZ L;  2QDL A;  1LYL A;  4LFA L;  1HFN A;  1QNK A;  3OW2 A;  2C9O A;  2ZTC A;  4A3F B;  1U9R A;  4ME5 A;  2KED A;  3RZD B;  2PW5 A;  2PPB C;  4OO1 I;  4QB4 A;  1SRO A;  1CA6 A;  3VDY A;  2AQ1 B;  3FKI H;  4F87 A;  4HCS A;  3MFY A;  3L2P A;  4X64 Q;  1JE5 A;  1QVG A;  1Z7T A;  2VB3 X;  2NVX H;  5IT9 L;  1QB5 D;  4C3H B;  3KF6 A;  4FXD A;  4O0A A;  1TWG H;  2R92 B;  3TSS A;  4U67 3;  5LMN L;  1KAB A;  2DY7 A;  2F0W A;  5I4D A;  3MXP A;  3J80 i;  1T5X D;  4DXG A;  2IHE A;  1AP0 A;  3I2Z A;  3T53 B;  5JVH 3;  5M5X B;  3BG3 A;  3SVM A;  1FGB D;  3K57 A;  3HOZ G;  4KKT A;  2X6L A;  4PQX A;  2E75 C;  4A93 B;  1LT5 D;  3H6M A;  2EY1 A;  1C48 A;  1K8O A;  3PF4 A;  4DF7 A;  2EIF A;  2J7Z A;  2L4N A;  3CQZ B;  1GKH A;  4QIW B;  5C0X G;  4DR5 L;  3HOY B;  4X6A H;  3HOU H;  1QUQ B;  2PQA A;  4ULL A;  3RN5 A;  2TSS A;  4KY7 A;  1Q81 C;  1TS5 A;  4DV0 L;  3BDL A;  2N78 A;  1QCB D;  1T9H A;  2LY7 A;  4UY8 C;  3KDF A;  4GKJ Q;  1X3G A;  3T4A C;  1EOV A;  2QW7 A;  5JJK A;  1JWU D;  4DGZ A;  1VQK A;  5C3E H;  1L1O C;  1D5Z C;  3K7A H;  4C56 C;  1I50 B;  1ZYR D;  1IBK Q;  3S1N B;  1HZ9 A;  2BA0 A;  1GVP A;  3LWE A;  4EQN A;  1CFM A;  3BZK A;  4DAY A;  1VCI A;  2N88 A;  4KD4 A;  3H0G H;  1JMC A;  1MBY A;  2B8G A;  4DUY Q;  1K8M A;  3T56 B;  1L1O A;  5FKA C;  1A0I A;  4L5T A;  1ET6 A;  4DV4 Q;  1PLF A;  4KN4 C;  2KCM A;  3S9W A;  4I7Z C;  5KNC A;  4EVO A;  4QF4 A;  1L0X B;  2VY3 A;  1QZG A;  1E1T A;  3ERO A;  2UXC L;  2K5D A;  1P16 A;  3S1M B;  1VQ5 A;  2B63 G;  1WCM G;  1GUT A;  2FMC A;  1VQM A;  4X62 Q;  5DAU A;  5EBC A;  5FLX L;  3E9I A;  3KBG A;  4LFB L;  1HNX Q;  1PV4 A;  2BOS A;  2PI2 E;  2SDF A;  4B3S Q;  1G6Z A;  5ELF A;  4AYB E;  1K9M C;  2E74 C;  3R8B A;  4G4K A;  2NN6 H;  2UUC Q;  1BKB A;  4DR1 Q;  1XNQ L;  2XSC A;  1W6K A;  1Q86 C;  1HZB A;  4DNI A;  3STB D;  3UDI A;  4L5S A;  2Z6K C;  3N52 A;  1LO5 D;  2VB2 X;  2HIX A;  3ERS X;  3QR8 A;  4DV1 Q;  1UUP A;  2HIV A;  2JA8 G;  4KJO A;  4XYQ A;  3ZJY C;  2Z6K A;  4JI0 Q;  3H3V C;  5C4Z A;  3E6Z X;  2KEN A;  4EQO A;  4A3D B;  3I4N G;  3M4P A;  2F0N A;  4JI8 L;  3I4L A;  1SYD A;  5M5Y B;  1JB7 A;  1JJ2 A;  4XT3 B;  3K6O A;  2K28 A;  5M3M G;  2WP8 J;  2YTY A;  3TRE A;  2D2C C;  3ICE A;  3QWN A;  3D8G A;  4GKK Q;  1STB A;  1JT8 A;  1ENC A;  1U5K A;  4LFC L;  3A0J A;  1KHI A;  1QUQ A;  4Q0F A;  3PV0 A;  1DOK A;  1LT4 D;  1KDA A;  3P7J A;  1KD1 C;  5FK9 C;  3J81 i;  3BJU A;  3G6E A;  4IAL A;  2K5W A;  3A7A B;  2FHT A;  5CV4 A;  1D1K A;  1DYQ A;  1JB3 A;  2HDM A;  1B3Q A;  2FMM A;  1EIH A;  1JR0 D;  3X3N A;  2JA7 G;  3F2C A;  1V1Q A;  5C3X A;  3HOW H;  3PUX A;  3VR3 A;  4K0K Q;  2BE5 C;  2KCT A;  4IUR A;  5C3E G;  3J81 E;  5DM7 3;  5IYD G;  4FF4 A;  2K1B A;  1VQA A;  2K50 A;  2CFM A;  2KCN A;  2RF4 A;  4HJ8 A;  1TY2 A;  4CKE A;  3GTP B;  1ENF A;  4OO1 H;  1FYC A;  2E2H H;  4LUZ A;  2RVL A;  1XMO Q;  5HUR A;  1K8A C;  4BBS B;  5FLX c;  4DV7 L;  1M90 C;  4RGM A;  5FLM G;  1R4P B;  4R4Q A;  1KLG D;  4KMU C;  1CZW A;  2E8G A;  5JJI A;  1NJI C;  2N8N A;  4XQQ A;  4LF8 L;  3QJY A;  2AMC B;  1BNZ A;  5C3W A;  2A6H D;  3RMH A;  2WII B;  3E5S A;  4AIM A;  2NVQ B;  1CHQ D;  2EDG A;  2ALY B;  4DU9 A;  1JOK A;  1I6H B;  2O5J C;  1O7Y A;  1ROD A;  3CAM A;  2H4O A;  2JA6 B;  1F9P A;  3U58 A;  4KY6 A;  4LF4 Q;  5IWA L;  3K5M A;  4OHJ A;  3J80 L;  5HGQ A;  2NN6 G;  1NR2 A;  1RL2 A;  3I73 A;  1B9M A;  4R4T A;  5FOB B;  4IUQ A;  1VMC A;  2JA5 B;  3FRP B;  3D0F A;  3T51 B;  2F0D A;  1WTX A;  3BYT B;  2R7F A;  5J39 A;  4LF6 L;  2B63 B;  3TRZ A;  3I4M B;  3PO3 B;  2M2L A;  5I6W A;  1SNM A;  1STG A;  4JI3 L;  1S5B D;  4MZ9 A;  1KNA A;  1PRT D;  1UE1 A;  1X32 A;  3S1Q H;  4LK1 C;  3L0O A;  1IKM A;  4L63 B;  1UE6 A;  3C3L A;  2CWP A;  4B3R L;  2RBM A;  2F52 A;  3MA2 B;  1VQL A;  2NZ1 D;  2Q2H A;  2G9H D;  1EYA A;  2I5H A;  3CRL C;  1Y1V G;  4AQY Q;  4H7B A;  3UE0 A;  1BVS A;  2FXQ A;  2EZV A;  4IPC A;  2QKI C;  4OX9 Q;  1IW7 C;  4IUN A;  4NXN Q;  1QG7 A;  3P1H A;  2O4X A;  1IBM L;  2F0J A;  3FKI B;  2WAQ G;  1XX8 A;  2WKD A;  4ZYS A;  5FO9 B;  4DNR B;  3F2U A;  1Y14 B;  4IUV A;  5J3B A;  2QA4 A;  2NVX B;  1MI2 A;  1I94 L;  4GOP C;  2UXD L;  2KOL A;  3A55 A;  2VQF L;  3SR1 A;  1TWG B;  4JI2 Q;  3RZO H;  3Q0A A;  2ES2 A;  1KRS A;  1VQN A;  4GZY C;  1NBW A;  1PYW D;  2WAQ E;  5KEE A;  3G4S A;  3J81 j;  1D5M C;  4M8A A;  4IUP A;  1O7I A;  3AB9 A;  1QIL A;  1FNU A;  2ZT9 C;  4OIJ A;  1N36 L;  4NW2 A;  1MJC A;  2GA4 B;  4BY1 H;  1EQR A;  2NUC A;  2WIN B;  4CDC C;  2WB1 G;  2OQK A;  1ICW A;  1MGS A;  3PCO B;  1HRJ A;  1DCZ A;  4DR6 L;  3CCM A;  4A3L H;  3HOU B;  1WTP A;  1RCV D;  1E1O A;  2C35 B;  2A6H C;  3DHQ A;  1TVX A;  2WV6 D;  1XMQ L;  4HCE A;  4C1N I;  3PQI A;  2UXB L;  3KLS X;  2ICE C;  1BCP D;  2E2J H;  1LTT D;  1SE4 A;  1RDP D;  2L12 A;  2EJF C;  4ME3 A;  5M3F H;  1B50 A;  3J80 c;  4BY7 G;  4IOC A;  1GUG A;  4R8N A;  4ZUJ A;  5T1I A;  2WB1 E;  3ULJ A;  3WWV A;  5C3E B;  5KND A;  1PTO F;  1X55 A;  3K7A B;  4LUO A;  4BXX H;  3GTM H;  1A3U A;  1D2B A;  3ULL A;  2K01 A;  1STE A;  1BCP B;  2LFN A;  2N3S A;  3H0G B;  3HOV H;  4JI7 Q;  5IY0 A;  5IE8 A;  1C8C A;  2F4I A;  5IT9 E;  1TS4 A;  3G48 A;  3FP9 A;  1A6X A;  3CCJ A;  4H02 A;  2F0F A;  3CD6 A;  4CKC A;  4POG A;  1I6V C;  1TWH H;  4JPB W;  2ZTD A;  1J5E Q;  1EUJ A;  2IW3 A;  5E4W C;  5IP9 G;  5IYC H;  1PVO A;  1A8V A;  2KHJ A;  1YIJ A;  2K5Q A;  2A74 C;  3N6R A;  3J7A V;  3RD4 A;  4IFD G;  2MP1 A;  2M9V A;  1CSP A;  2B29 A;  4A3G H;  1RD9 D;  2IHF A;  3H09 A;  4OL7 A;  4X64 L;  2EYJ A;  3DWA A;  4FXG C;  1VQ7 A;  4FF1 A;  1DM0 B;  3MXU A;  2NTT A;  3NTK A;  1VQ6 A;  3QO2 A;  4EGV A;  5M5W H;  2B2U C;  4K8I A;  3AQQ A;  2RSN A;  1B70 B;  2A69 C;  5ELN A;  4HIO A;  4TQU S;  4QMG A;  3CC2 A;  3H94 A;  3GTO H;  1GXD C;  2K04 A;  3K8A A;  4C3H G;  3LWU A;  4K6L A;  4GN5 A;  3F2D A;  4A3C G;  3NBH B;  3OW7 A;  3ND8 A;  4GS3 A;  1OXU A;  4GN3 B;  2R92 G;  1KAA A;  2OF1 A;  2LXJ A;  1BDO A;  4ABN A;  1WD0 A;  5EPJ A;  5C44 B;  2OQ0 A;  4CGY B;  4UDU C;  1X3Q A;  2OEO A;  5G3L D;  1I3Q H;  4IPH A;  3E3X A;  4OEM B;  4YHH L;  1W3S A;  5JOB A;  3UDX A;  1ILQ A;  1LLR D;  1D6E C;  2VXW A;  1SRU A;  1CKO A;  3MZ5 A;  4A93 G;  1VQ8 A;  4CDF C;  4NXM L;  3TQY A;  2Y0S B;  3A5U A;  3TP5 A;  5HGT A;  3HOY G;  4NPS A;  5E3F A;  5LMN W;  1PH8 A;  2K75 A;  2B2V C;  5CMD A;  5IGG A;  3HGB A;  1J6Q A;  2JN4 A;  1QWY A;  1X6O A;  1E3P A;  3F2B A;  1U4R A;  5CV5 A;  3SK4 A;  1I4P A;  2F3I A;  5FLX E;  1IYV A;  1PH9 A;  1S4Z A;  4DUY L;  3W1B A;  1R9T H;  5DM6 3;  1YNX A;  4QIW E;  3J7Z C;  1PH5 A;  1XWE A;  2F0S A;  1YJW A;  1VQB A;  1SYF A;  3D6C A;  5T1G A;  4F88 A;  5IP7 H;  4EX5 A;  1HUN A;  1WTQ A;  3CCQ A;  3I90 A;  4C2M H;  4DK1 A;  4B9W A;  4DNT B;  4KD3 A;  4JI1 L;  4DPG A;  4MTK A;  4KHP L;  3HOW B;  2XTI A;  4APV A;  4A3J H;  1HHV A;  1SNP A;  1HNX L;  3CC4 A;  4B3S L;  1WYD A;  2B39 A;  1B3A A;  2E2H B;  4LF5 Q;  4JI4 Q;  5FO8 B;  1TY0 A;  4JG2 A;  1VQP A;  4EQ5 A;  1VQG A;  4DV5 Q;  2EYF A;  3VR2 A;  1SJH D;  1TU2 B;  2Q2T A;  2UUC L;  4P75 A;  3HOX H;  1VQD A;  4DR1 L;  1LV9 A;  3I8Z A;  2FJ2 A;  3KDF B;  3KYH C;  4BA2 I;  4KY5 A;  4C3I H;  2VS1 A;  3J81 c;  1KQS A;  2JA6 H;  5CC4 A;  5D65 A;  1A63 A;  2KUM A;  2XN9 C;  4KK7 A;  1UEB A;  1SYC A;  5IYC G;  2HDL A;  1JOQ A;  1Q12 A;  4PNY A;  4ZQ3 A;  4X66 Q;  1FJG Q;  4EQP A;  4LF7 Q;  1ENA A;  2R93 H;  4WOR A;  1M4V A;  3NSW A;  5ELB A;  1EIY B;  1SND A;  2G9D A;  2O5I C;  3I4M H;  4JBW A;  4MIU A;  1SR3 A;  3D4W A;  3NBH A;  2Q8R E;  3NTI A;  1Q90 A;  2MGS A;  5IYB H;  3WOF A;  2D0P A;  4Y7N B;  3PIO 3;  4JYA Q;  3VYR A;  3KF8 A;  1X3P A;  2A6E C;  4GKK L;  4PZ6 A;  1XXG A;  2EY6 A;  2QF7 A;  5GAG C;  4A3D G;  5CV7 A;  1JJG A;  2EOT A;  1YEZ A;  3I7F A;  3I55 A;  1EY4 A;  3K0X A;  1STN A;  4L6T B;  4KHV A;  2PYK A;  1B2T A;  4R4I A;  1S5D D;  5FJ8 H;  5M9O A;  3T16 A;  4A3K H;  3V2T A;  1G2T A;  1EL0 A;  1H95 A;  3CCS A;  3SEB A;  3HFZ B;  1O80 A;  4RGN A;  1FL0 A;  4NDX A;  1S3O A;  2OTJ A;  3ITP A;  1SNQ A;  2PNR C;  4A76 A;  1VQO A;  3S1Q B;  4XIG S;  2BDO A;  3NQI A;  3BU2 A;  4IJH A;  2OWO A;  1AN8 A;  3NWS A;  4K0K L;  5IIF A;  1DON A;  1AH9 A;  4KV6 A;  2F0E A;  4HJ9 A;  2L15 A;  4RMF A;  2L11 A;  2EXD A;  3VYS A;  1M1K C;  4C3J H;  4KHZ A;  1NMF A;  1EOT A;  2BA1 A;  2L9H A;  4K8J A;  3GTK H;  2PMZ B;  1Q7Y C;  1EYD A;  3L7Z C;  1ASZ A;  1PFB A;  5JEA J;  1WJJ A;  3HP3 A;  1RKN A;  3OYY A;  1HR0 Q;  3X3M A;  1Y1W H;  4WJW A;  2KHI A;  3J80 E;  4BBS G;  3RZO B;  3GDE A;  1GO3 E;  3FEW X;  4Y52 H;  2AUJ D;  3NTH A;  3RR5 A;  5CBE E;  4DR4 Q;  5K36 G;  3URY A;  3NQT A;  1E2V A;  3KUP A;  2ZXO A;  3EJI A;  4ZK9 B;  2OTL A;  3B6Y A;  4BY1 B;  2VQE Q;  2AWN A;  5I9P A;  3CMA A;  1NNX A;  3PO2 H;  4XTC S;  4RWS C;  1L0W A;  3A8K E;  3HOX G;  1F2L A;  1ILP A;  1KXL A;  2XRS D;  3G71 A;  4C3I G;  4ID6 A;  1YNJ D;  2JA6 G;  1PH6 A;  1ASY A;  3M85 A;  5LL6 S;  2E5L Q;  2YYZ A;  1Z6H A;  2EQS A;  1TT2 A;  3S2D B;  5CGK A;  1C7Y A;  2E2J B;  3D3R A;  4A3I H;  5M3F B;  2JA5 G;  3D4R A;  1GHK A;  1SDF A;  5TSS A;  5E7N A;  1XJV A;  2F0I A;  1H9M A;  3I4M G;  3PO3 G;  3L9A X;  4N9P A;  3GTM B;  2I0Q A;  5I9O A;  1IHZ A;  4K2K A;  1JJC B;  2K03 A;  4N9T A;  3TZD A;  2JK8 A;  3I3C A;  4IPD A;  3HOV B;  1YHQ A;  2H5X A;  3D6W A;  1IXR A;  2JYO A;  2R61 A;  2UUB Q;  1HPC A;  3G7L A;  4X3K A;  4CDE C;  1N33 Q;  4MN3 A;  2ID0 A;  2KBN A;  1U0L A;  1X3F A;  2D5D A;  4HIM A;  1XTC D;  4QQB X;  1TWH B;  4B3M L;  1JQY D;  3OMC A;  4OX9 L;  4J15 A;  2MQH A;  4KN7 C;  4NXN L;  1DD2 A;  4FYD A;  1G29 1;  1KC8 C;  2A68 D;  5KIX A;  1N34 L;  3S2H H;  4A3G B;  1U4M A;  5IT9 c;  5C44 H;  1DJR D;  3J7Y W;  3PIP 3;  2L1B A;  2AQ2 B;  1CSQ A;  2IX3 A;  2A8V A;  5EPK A;  3FDT A;  1X56 A;  5M5W B;  3FKI G;  3PUW A;  2SEB D;  1MJE A;  4JI2 L;  1FVI A;  3W3A A;  1A15 A;  1BXT A;  2FFK B;  3LGJ A;  3GTO B;  1FD7 D;  1XPU A;  1JOR A;  3R2T A;  3SXH A;  2TMP A;  3OPO A;  1O7Z A;  3NEM A;  4H13 C;  1EQQ A;  4K5V A;  2Z8L A;  4QGU A;  3A54 A;  4K5X A;  3HKS A;  1LTL A;  1QJO A;  3BVZ A;  2Z0S A;  1KNE A;  4DK0 A;  1I3Q B;  1HXY D;  3T1Y Q;  3SGI A;  1EFI D;  3BDC A;  1MHW C;  3VYT A;  3EFX D;  1XYI A;  1IYJ B;  2VUM H;  1BOS A;  2HCC A;  4HN7 A;  3QG1 A;  3HOU G;  4DXF A;  4DR3 L;  1HNW Q;  1EYG A;  5C5M A;  1PH4 A;  4ZRZ A;  1G6P A;  3KLS A;  1EY6 A;  1AZQ A;  1RTN A;  4P73 A;  1ZYR C;  2NWG A;  1HZA A;  4LFA Q;  3G6J B;  3T13 A;  3HS0 C;  2ZM6 L;  4JI7 L;  1LAB A;  1H9S B;  1R9T B;  2Z9H A;  5IGF A;  2HHH L;  1NR4 A;  2MHV A;  4DV6 Q;  1J5E L;  4OWW B;  3H0G G;  3MXG A;  1SBB B;  4FF2 A;  4AH6 A;  1OXX K;  1JCK B;  1AE3 A;  1CZG A;  1P8L A;  4L8J A;  2NZH A;  4C2M B;  1J8I A;  4QUC A;  1NY4 A;  2ZJP A;  3S16 H;  2JEB I;  1SEB D;  1PFM A;  3A7L A;  3LX0 A;  2JJQ A;  1ICF B;  4A3J B;  3A56 A;  1Y8P B;  2A19 A;  1T5E A;  1YNN D;  4DR2 Q;  4OEL B;  5C0X J;  1R4Q B;  5C4H A;  1KDB A;  3HOX B;  5JAV A;  3CCU A;  3R3O A;  2K32 A;  4C3I B;  4PMC A;  1B7Y B;  3STB C;  4Y7N H;  3I56 A;  1V1O A;  2KJX A;  3OIP A;  2MUY A;  4YCU A;  4CJ0 B;  2L0C A;  4LF9 L;  1V43 A;  4BWG B;  1KTK A;  3M4Y A;  2R93 B;  4DV0 Q;  1ZXT A;  4XYO A;  1WTR A;  5C44 G;  5A2Q E;  1VQ9 A;  1ESR A;  1F9S A;  1F2Z A;  2V1C C;  4CBV A;  1OXS C;  1Q8I A;  1S40 A;  1LM0 A;  2K6A A;  4O2D A;  4B9X A;  1SYE A;  5EBD A;  4BBR B;  3OTO Q;  2HD3 A;  4A3B H;  3W2D A;  3M4O H;  2Y0S G;  4HJ7 A;  1QE6 A;  1SJE D;  3NUC A;  1PXU A;  4HED A;  5JJZ A;  1X9N A;  1F9Q A;  3CF5 A;  3KBX A;  5DLQ E;  2F4V Q;  3KLR A;  3PUZ A;  3QIA A;  4A3K B;  3FVQ A;  4RCN A;  4ZKC B;  1HR0 W;  4M1U B;  1PRT B;  1PMR A;  5EQ0 A;  1IKL A;  2UXC Q;  1FNV A;  2VZA A;  5BN3 A;  3WOE A;  4TRD A;  4B3T Q;  2QGQ A;  3R93 A;  1BCP F;  5GRO A;  3EIV A;  5C0X I;  4A3E H;  3VR4 A;  2Y0S E;  1N32 L;  4IJL A;  3SHL A;  2VUM G;  2R7Z H;  5JEA H;  4KTA A;  2O2L D;  1HCZ A;  3MAQ A;  2I46 A;  1BBX C;  5BR8 Q;  2F0Q A;  1H9S A;  2EVB A;  2SNS A;  3NBI A;  1D7Q A;  1JWS D;  4LF5 L;  4JI4 L;  2ENB A;  2PZU A;  1QZH A;  3HOW G;  4DN4 M;  4KLK A;  5EKI A;  4C3J B;  1E2W A;  2YTV A;  4DV5 L;  2QCP X;  3BVM A;  1A2T A;  3Q8D A;  1XPR A;  3GTK B;  1Z9F A;  2P5Z X;  1LTR D;  3VA5 A;  1WTO A;  2F03 A;  4GLX A;  4OO1 G;  4JW0 A;  1C9O A;  1JC7 A;  4IUT A;  5HY6 A;  3K7U C;  3Q6S A;  2EYL A;  1Y1W B;  4ZAI A;  4FNF A;  2YV5 A;  4X66 L;  1FJG L;  1I4H A;  1V9P A;  4LF7 L;  3ONA B;  3ZYY X;  4I65 A;  2E76 C;  1MIU A;  2SNM A;  4JOI A;  2F0U A;  1YNN C;  1IBL Q;  1IL2 A;  3MXN B;  4K5W A;  2XWB B;  3C46 A;  3S2D H;  4HJ5 A;  1HA6 A;  4G7O C;  4LMQ D;  2K05 A;  3PO2 B;  1EY5 A;  4GNX B;  1M8A A;  4JYA L;  4NB3 A;  4RG1 A;  1SXT A;  1S5C D;  1A3V A;  1YJN A;  5DEH A;  5IOC A;  3WDN A;  4DKA C;  2F0G A;  1KL9 A;  1S5F D;  1AE2 A;  5G3L F;  1G8Z D;  3JAM i;  2NVT H;  2N49 A;  1LT3 D;  1JIC A;  4GLV B;  2JQO A;  2R3Z A;  4A3I B;  2KA7 A;  1TWC H;  3NP8 A;  4POF A;  1ML0 D;  1RF2 D;  1LTI D;  4GLA C;  1X3E A;  1PRT C;  4X65 Q;  1S5E D;  3NWT A;  1VMP A;  4YWM A;  3CW2 C;  4HID A;  4LAA A;  1N8R C;  3IFD A;  2UUA Q;  2EE1 A;  5AJ3 Q;  1BF4 A;  2Q2I A;  3C2P A;  1CKN B;  3PUY A;  5I2Y A;  4A3B G;  3KJO A;  3I72 A;  3NEL A;  1CT1 D;  4E6I A;  2BH8 A;  3ULP A;  2DJF C;  1KIX A;  4CKB A;  3S2H B;  5COY A;  3I4O A;  4RCO A;  3GTG H;  3KF8 B;  3L3O C;  3NXW A;  4A4I A;  4IPG A;  1GUN A;  1HR0 L;  3TP7 A;  4A3E G;  1H9K A;  3C1F A;  4MNO A;  2B2Y C;  2PO4 A;  5JPM C;  1E7Z A;  1GUS A;  2Q8I B;  1VQC A;  4R1J A;  4ZKB B;  4DR4 L;  2NYZ D;  1PTO D;  2BCO A;  1PH7 A;  4GKJ L;  3KJP A;  3S15 H;  2B2Y A;  3OOC A;  2K5H A;  2VQE L;  1TWA H;  2B8F A;  2DN8 A;  2ICI A;  1EZ8 A;  2F0T A;  2F0K A;  1TS2 A;  5E1F A;  1NE3 A;  2ZJQ A;  1IBK L;  1SYG A;  2PMZ E;  2A73 B;  3GO5 A;  2JXM B;  4RA8 A;  1K3B C;  2D9U A;  4BY1 G;  3E0E A;  3MWY W;  3MHB A;  3NEN A;  4OIK A;  1J9O A;  4JI3 Q;  2E5L L;  1BO0 A;  3MXN A;  2VUM B;  4RGT A;  5K5P A;  4DV3 Q;  4DV4 L;  3CU7 A;  3O13 A;  4LUV A;  4A3L G;  1EWH A;  1BCP C;  5EGT A;  1KRT A;  4ILW A;  2X69 A;  4GNX A;  2PZW A;  2D62 A;  1CQF A;  3K5N A;  5NUC A;  3UI2 A;  2PNH A;  4X62 L;  2KEE A;  1YI2 A;  2I5L X;  2K7V A;  5JVG 3;  5M3F G;  2MJ8 A;  3TS0 A;  2EY2 A;  3HOZ H;  1U4L A;  4ZUI A;  4PMW A;  5L37 A;  4JVZ A;  3BZD B;  4X3S A;  1N33 L;  4BXX G;  2HT1 A;  4JI5 Q;  3UE1 A;  2B2W C;  3FPU B;  5C0X H;  1IBM Q;  2WFW A;  5GAD C;  4DV2 Q;  1EY7 A;  1PHJ A;  3M3Y H;  3HOV G;  2V4D A;  2NB0 A;  4HTH A;  2UXD Q;  3S16 B;  4R4C A;  1HUM A;  1HQR D;  2B2W A;  1TXY A;  4KKS A;  3CCE A;  4DV1 L;  4XQJ A;  1PFS A;  2LXK A;  2GVB A;  1XTD A;  1NCV A;  3CCL A;  1A62 A;  1O7L A;  4A3G G;  1CKN A;  4CJ2 C;  3I91 A;  4JV5 Q;  4JI0 L;  2XVS A;  1G91 A;  2IPK D;  1QVF A;  1S72 A;  1N36 Q;  2E2D C;  3S1R H;  4TVA B;  2K5N A;  2RHQ B;  4Z9C B; 
#chains in the Genus database with same CATH homology
 3OWE B;  1I4R A;  1EY8 A;  4PMB A;  3SK6 A;  1RTO A;  2EYO A;  3V96 A;  2CW0 D;  4TKO B;  4KJN A;  4QUF A;  4X3U A;  2J0T D;  4BS9 A;  2WKC A;  4DAV A;  4ZLT F;  2KQ3 A;  1STA A;  4WFN 3;  2HQE A;  4F7X A;  2F0L A;  1I4G A;  1PZJ D;  1Y8N B;  2WAC A;  2PZT A;  4R8I A;  4G7Z C;  4A3B B;  4YIJ A;  1B44 D;  3M4O B;  1SSO A;  3K5L A;  1QNU A;  4IFD J;  3LNN A;  1SYB A;  3NHH A;  4UAI A;  5ELD A;  3TZU A;  4DA2 A;  1SAP A;  1JE4 A;  3JAM L;  4A3E B;  2RDH A;  3SE0 A;  2R7Z B;  4DAP A;  3CRK C;  1EY0 A;  1GUO A;  5COR A;  1PDQ A;  1V1P B;  1HA5 A;  2KEC A;  3D31 A;  3BDO A;  1PZK D;  3DUZ A;  5CYU A;  1SNC A;  2IJ0 A;  1LTB D;  5AFW A;  3TDQ A;  2F0H A;  3I70 A;  1EQV A;  1STY A;  5EPL A;  1DXM A;  1TKW B;  4RKB A;  1EEF D;  1IYU A;  3NK9 A;  2CQA A;  2CHB D;  3IL8 A;  4H44 C;  2RDG A;  4FP5 D;  5C5L A;  5KYI A;  1G2S A;  4IFD I;  3MC0 B;  1BQQ T;  3DMU A;  1E2Z A;  1Q1B A;  4NKL A;  4IN3 A;  3BVG A;  1TQO A;  2BE5 D;  2RDF A;  5D14 A;  1SNO A;  3HKZ B;  3A8I E;  2NVT B;  2IT1 A;  4CJ1 B;  2RA4 A;  2CW0 C;  3VR6 A;  5D3I B;  2F0V A;  1QOH A;  5IGE A;  3PUV A;  1TWC B;  3DWQ A;  1OO9 B;  2ZXP A;  1GOZ A;  2JP1 A;  4RAU C;  4H0L C;  3Q24 A;  1V8Q A;  1KLU D;  2Z1C A;  1OXT A;  4QCL A;  2JSO A;  1RJT A;  5CV8 A;  4G7H C;  3RLF A;  4RHS A;  4NMZ A;  1AW7 A;  2BDN A;  5JPN C;  1IL8 A;  4X3T A;  1A2U A;  1MSH A;  1D1I A;  1PFN A;  3GQB A;  2EYH A;  3GTG B;  3A8J E;  4XXE A;  4FF3 A;  3NE5 B;  1EIG A;  1TII D;  4C3J G;  1V1P A;  2L55 A;  2MPM A;  1PTO H;  1I4X A;  2QEJ C;  2PCF B;  3VYU A;  5I2X A;  2M00 A;  5F2D A;  4FXK C;  2Q8T A;  3Q22 A;  5J1Z A;  4FVM A;  4CHT B;  4K2L A;  2RQX A;  3VR5 A;  1CK1 A;  3S15 B;  1WD1 A;  1LAC A;  3DXJ C;  1TWA B;  4C1N K;  1B9N A;  1SMY D;  1MSG A;  1MD2 D;  2XRQ D;  2AUK A;  3EVQ A;  2CVR A;  2F3W A;  1ZEQ X;  2FIN B;  1C4Q A;  2RSO A;  1IW7 D;  1YNJ C;  4O1N A;  4HAE A;  1LTA D;  3AU7 A;  2XNA C;  2N55 A;  1AZP A;  3GV3 A;  3K0Y A;  3EQL C;  2ZXR A;  1PRT F;  3TP8 A;  1HTP A;  3IFT A;  4TSS A;  3HOZ B;  1EZ6 A;  1H9R A;  4Q5V A;  3K59 A;  4V19 0;  2RKS A;  1EEI D;  5CR3 A;  3M3Y B;  1W6J A;  1U4P A;  1HTL D;  5A35 A;  5IGC A;  3OIQ A;  4ODG A;  3MEH A;  2A68 C;  4JK1 C;  2IX0 A;  1JWM D;  3NPP A;  4IUU A;  1E0B A;  2IL8 A;  1GUW A;  2K33 A;  4OGQ C;  3HZX A;  2JE6 I;  3BYY B;  2JEA I;  2A5H A;  2OT2 A;  1F2Y A;  2PQE A;  3S1R B;  3CKI B;  2QDB A;  5EJW A;  5LL6 X;  1EYC A;  1D5X C;  1NSN S;  3QOJ A;  2EYP A;  4AYB B;  2HUG A;  1HFG A;  1F9R A;  1NUC A;  1WCM B;  4IFD H;  3IAY A;  5EKK A;  4IZ8 A;  1BR9 A;  1DOM A;  1RHP A;  1EWC A;  3FMC A;  3SK5 A;  1VDZ A;  5C4X B;  5DNF A;  3TME A;  2QIL A;  1II3 A;  1SMY C;  1LTG D;  2AQ3 B;  2XWJ B;  4K14 A;  1EY9 A;  5CV6 A;  2A69 D;  1K83 B;  4J8Q A;  4RFB A;  4K6D A;  2IX1 A;  5J22 A;  2JA8 B;  1O78 A;  4HMI A;  5KRU A;  2I07 B;  3OHX C;  1HQM C;  2E2I B;  3MFG A;  1DOL A;  3I4N B;  1CM9 A;  4HMJ A;  1STH A;  5M3M B;  1I4Q A;  3K5O A;  5LHY 1;  4BA1 I;  2EPB A;  3TN2 A;  2SOB A;  5BN5 A;  1TS3 A;  2DY8 A;  4HR7 B;  3HEJ A;  5KNB A;  3GP7 A;  5FO7 B;  4U68 A;  5KGU A;  2F1M A;  1ESF A;  2DNC A;  4XT1 B;  3KK7 A;  5IGD A;  4RHR A;  1Y69 U;  2JA7 B;  3MVV A;  3DEP A;  3M7N A;  2NBF A;  2L5T A;  4XDX A;  3OSO A;  3P75 A;  4A3M B;  4DFA A;  1BUV T;  1CI3 M;  1EU4 A;  1ET9 A;  3PMF A;  3D4D A;  4XQN A;  2KHS A;  4B08 A;  3JAM E;  1SE3 A;  3QOL A;  2EY5 A;  3DEO A;  3U9S A;  4KKU A;  4FO2 A;  4KI0 A;  1SE2 A;  3RUZ A;  2LS0 1;  1F2M A;  1B53 A;  5C4J B;  3DWP A;  1WVL A;  3CHB D;  3U9O A;  1UAP A;  1CQV A;  2X6G A;  1ZKO A;  2EJG C;  5CV9 A;  1VF7 A;  3J81 L;  1L0Y B;  4V0B A;  3AMU A;  2EYM A;  3H91 A;  3S14 B;  3IKJ A;  3S17 B;  1GJX A;  4LJZ C;  2LKV A;  3FPP A;  4P2C B;  3K58 A;  1UNS A;  1TWF B;  2AWO A;  2PW7 A;  1B1Z A;  5JEA G;  2B2U A;  2A6E D;  1FNW A;  2LMC B;  3DM1 A;  2B2T C;  4HSV A;  4IQZ A;  1KDC A;  1VF5 C;  4NP5 A;  1SFO B;  3GTQ B;  5D3D A;  4F8M A;  3SDZ A;  3ERQ A;  1Q1E A;  4MHE A;  1PTO B;  2XIW A;  2F0M A;  1LTS D;  2B2T A;  4WRD A;  5EKL A;  1F77 A;  3OMG A;  3HRZ C;  3VA7 A;  1CHP D;  3QB3 A;  2HCI A;  1TR5 A;  5ELC A;  1Y1V B;  5E4X A;  2NVY B;  1AEX A;  4G57 A;  3ND9 A;  1NAP A;  3EA6 A;  5ELE A;  2YU9 B;  3GV6 A;  1OXV A;  4J1M A;  5A2Q L;  3TP6 A;  2B2V A;  2KCC A;  1H9J A;  1Z47 A;  2WAQ B;  1CTM A;  5C6A A;  1CA5 A;  2EXZ A;  3GD7 A;  5ISR A;  1LT6 D;  2NN6 I;  3R2I A;  2J4X A;  4RGO S;  1A3T A;  3GTJ B;  5K36 H;  1JOO A;  1UEA B;  3TBI B;  2F0O A;  2EJM A;  3J7A F;  2WB1 B;  4O42 A;  4RH6 A;  3SK8 A;  1DZ1 A;  2DNE A;  3GTL B;  3OWF A;  3M7G A;  5IOD A;  1EU3 A;  4HSP A;  3BS1 A;  1AFP A;  4PV1 C;  2IWH A;  1EQT A;  2KVM A;  4BY7 B;  1WTW A;  5CBA E;  5BN4 A;  4S3S A;  3P20 A;  1GHJ A;  1ONL A;  5IGB A;  5I6Y A;  4J6H A;  1WTV A;  2Z4H A;  1PZI D;  2F3V A;  3HG9 A;  1PTO C;  3Q23 A;  2OXP A;  4R9W A;  3E0J A;  2C5C A;  2H1E A;  3C1E A;  1Y8O B;  5KYL A;  1B4O A;  3MTS A;  2VNU D;  1Q3L A;  2Z4I A;  2NTS A;  1FR3 A;  4RKL A;  3V05 A;  2R6G A;  2F0P A;  1HFN A;  1QNK A;  2C9O A;  4A3F B;  1U9R A;  4ME5 A;  2KED A;  3RZD B;  2PW5 A;  2PPB C;  4OO1 I;  4QB4 A;  1CA6 A;  2AQ1 B;  4F87 A;  4HCS A;  3MFY A;  1Z7T A;  2VB3 X;  5IT9 L;  1QB5 D;  4C3H B;  4FXD A;  2R92 B;  3TSS A;  4U67 3;  1KAB A;  2DY7 A;  2F0W A;  5I4D A;  3MXP A;  1T5X D;  4DXG A;  1AP0 A;  3T53 B;  5JVH 3;  5M5X B;  3BG3 A;  3SVM A;  1FGB D;  3K57 A;  4KKT A;  2X6L A;  4PQX A;  2E75 C;  4A93 B;  1LT5 D;  3H6M A;  2EY1 A;  1C48 A;  1K8O A;  4DF7 A;  2J7Z A;  2L4N A;  3CQZ B;  4QIW B;  5C0X G;  3HOY B;  4ULL A;  2TSS A;  4KY7 A;  1TS5 A;  3BDL A;  1QCB D;  2LY7 A;  3T4A C;  1JWU D;  4DGZ A;  1D5Z C;  4C56 C;  1I50 B;  1ZYR D;  3S1N B;  3LWE A;  2BA0 A;  4EQN A;  1CFM A;  4DAY A;  1VCI A;  2N88 A;  4KD4 A;  1MBY A;  2B8G A;  1K8M A;  3T56 B;  5FKA C;  1ET6 A;  1PLF A;  4KN4 C;  3S9W A;  4I7Z C;  5KNC A;  4EVO A;  4QF4 A;  1L0X B;  3ERO A;  2K5D A;  3S1M B;  1GUT A;  2FMC A;  5DAU A;  5EBC A;  5FLX L;  3KBG A;  2BOS A;  2SDF A;  1G6Z A;  5ELF A;  2E74 C;  3R8B A;  4G4K A;  2NN6 H;  2XSC A;  1W6K A;  3N52 A;  1LO5 D;  2VB2 X;  1UUP A;  4KJO A;  4XYQ A;  3H3V C;  5C4Z A;  3E6Z X;  4EQO A;  4A3D B;  2F0N A;  3I4L A;  1SYD A;  5M5Y B;  4XT3 B;  3K6O A;  2K28 A;  2WP8 J;  2D2C C;  3QWN A;  3D8G A;  1STB A;  1ENC A;  4Q0F A;  3PV0 A;  1DOK A;  1LT4 D;  1KDA A;  3P7J A;  5FK9 C;  4IAL A;  2K5W A;  3A7A B;  2FHT A;  5CV4 A;  1D1K A;  1DYQ A;  1JB3 A;  2HDM A;  2FMM A;  1EIH A;  1JR0 D;  3X3N A;  5C3X A;  3PUX A;  3VR3 A;  2BE5 C;  4IUR A;  3J81 E;  5DM7 3;  4FF4 A;  2K1B A;  3GTP B;  2KCN A;  4OO1 H;  1TY2 A;  4CKE A;  1ENF A;  1FYC A;  2RVL A;  5HUR A;  4BBS B;  4RGM A;  1R4P B;  1KLG D;  4KMU C;  1CZW A;  4XQQ A;  3QJY A;  1BNZ A;  5C3W A;  2A6H D;  3RMH A;  2WII B;  3E5S A;  2NVQ B;  1CHQ D;  2EDG A;  4DU9 A;  1JOK A;  1I6H B;  2O5J C;  1O7Y A;  1ROD A;  2H4O A;  2JA6 B;  1F9P A;  4KY6 A;  3K5M A;  4OHJ A;  3J80 L;  2NN6 G;  1NR2 A;  3I73 A;  1B9M A;  5FOB B;  4IUQ A;  1VMC A;  2JA5 B;  3FRP B;  3T51 B;  2F0D A;  1WTX A;  3BYT B;  5J39 A;  2B63 B;  3I4M B;  3PO3 B;  2M2L A;  5I6W A;  1SNM A;  1STG A;  1S5B D;  1KNA A;  1PRT D;  1X32 A;  4LK1 C;  1IKM A;  4L63 B;  3C3L A;  2RBM A;  3MA2 B;  2NZ1 D;  2G9H D;  1EYA A;  3CRL C;  4H7B A;  2EZV A;  2QKI C;  1IW7 C;  4IUN A;  1QG7 A;  3P1H A;  2O4X A;  2F0J A;  3FKI B;  4ZYS A;  1XX8 A;  2WKD A;  5FO9 B;  4DNR B;  3F2U A;  4IUV A;  2NVX B;  1MI2 A;  2KOL A;  3A55 A;  3SR1 A;  1TWG B;  3Q0A A;  4GZY C;  5KEE A;  1PYW D;  1D5M C;  4M8A A;  4IUP A;  3AB9 A;  1QIL A;  1FNU A;  2ZT9 C;  4OIJ A;  4NW2 A;  2GA4 B;  2NUC A;  2WIN B;  1ICW A;  1MGS A;  1HRJ A;  1DCZ A;  3HOU B;  1WTP A;  1RCV D;  2A6H C;  3DHQ A;  1TVX A;  2WV6 D;  4HCE A;  4C1N I;  3KLS X;  2ICE C;  1BCP D;  1LTT D;  1SE4 A;  1RDP D;  2L12 A;  2EJF C;  1B50 A;  1GUG A;  4R8N A;  4ZUJ A;  5T1I A;  5C3E B;  5KND A;  1PTO F;  3K7A B;  1A3U A;  1D2B A;  2K01 A;  1STE A;  1BCP B;  2LFN A;  3H0G B;  1C8C A;  2F4I A;  5IT9 E;  1TS4 A;  1A6X A;  2F0F A;  4CKC A;  1I6V C;  2IW3 A;  5E4W C;  2K5Q A;  2A74 C;  3N6R A;  3J7A V;  3RD4 A;  4IFD G;  2MP1 A;  2M9V A;  1RD9 D;  3H09 A;  4OL7 A;  2EYJ A;  3DWA A;  4FXG C;  4FF1 A;  1DM0 B;  3MXU A;  2NTT A;  3NTK A;  3QO2 A;  4EGV A;  2B2U C;  4K8I A;  2RSN A;  2A69 C;  4TQU S;  4QMG A;  3H94 A;  1GXD C;  2K04 A;  4C3H G;  3LWU A;  4K6L A;  3OW7 A;  1OXU A;  3ND8 A;  1KAA A;  2OF1 A;  4ABN A;  1BDO A;  1WD0 A;  5EPJ A;  5C44 B;  4CGY B;  4UDU C;  1X3Q A;  2OEO A;  5G3L D;  5JOB A;  1ILQ A;  1LLR D;  1D6E C;  2VXW A;  3MZ5 A;  2Y0S B;  3TP5 A;  5HGT A;  5E3F A;  2B2V C;  5CMD A;  5IGG A;  3HGB A;  1QWY A;  1U4R A;  5CV5 A;  3SK4 A;  1I4P A;  5FLX E;  1IYV A;  1S4Z A;  5DM6 3;  1XWE A;  2F0S A;  1SYF A;  3D6C A;  5T1G A;  4F88 A;  1HUN A;  1WTQ A;  3I90 A;  4DK1 A;  4B9W A;  4DNT B;  4KD3 A;  3HOW B;  1HHV A;  1SNP A;  2B39 A;  1B3A A;  2E2H B;  5FO8 B;  1TY0 A;  2EYF A;  3VR2 A;  1SJH D;  1TU2 B;  1LV9 A;  3I8Z A;  2FJ2 A;  4BA2 I;  4KY5 A;  5CC4 A;  5D65 A;  2KUM A;  2XN9 C;  4KK7 A;  1SYC A;  2HDL A;  1JOQ A;  1Q12 A;  4PNY A;  4ZQ3 A;  4EQP A;  1ENA A;  4WOR A;  1M4V A;  3NSW A;  5ELB A;  1SND A;  2G9D A;  2O5I C;  4JBW A;  4MIU A;  3D4W A;  3NBH A;  2Q8R E;  3NTI A;  1Q90 A;  2MGS A;  4Y7N B;  3WOF A;  3PIO 3;  3VYR A;  3KF8 A;  1X3P A;  2A6E C;  1XXG A;  2EY6 A;  2QF7 A;  5CV7 A;  2EOT A;  1EY4 A;  1STN A;  4L6T B;  4KHV A;  2PYK A;  1B2T A;  1S5D D;  5M9O A;  3T16 A;  3V2T A;  1G2T A;  1EL0 A;  3SEB A;  1O80 A;  4RGN A;  4NDX A;  3ITP A;  1SNQ A;  2PNR C;  3S1Q B;  4XIG S;  2BDO A;  3NQI A;  1AN8 A;  3NWS A;  5IIF A;  1DON A;  4KV6 A;  2F0E A;  2L11 A;  3VYS A;  4KHZ A;  1EOT A;  2BA1 A;  2L9H A;  4K8J A;  2PMZ B;  1EYD A;  3L7Z C;  1PFB A;  5JEA J;  3HP3 A;  1RKN A;  3X3M A;  4WJW A;  3J80 E;  3RZO B;  3FEW X;  2AUJ D;  3NTH A;  5CBE E;  5K36 G;  3URY A;  3NQT A;  1E2V A;  3KUP A;  2ZXO A;  3EJI A;  4ZK9 B;  4BY1 B;  2AWN A;  5I9P A;  4XTC S;  4RWS C;  3A8K E;  1F2L A;  1ILP A;  2XRS D;  4C3I G;  4ID6 A;  1YNJ D;  3M85 A;  5LL6 S;  2YYZ A;  1Z6H A;  1TT2 A;  3S2D B;  5CGK A;  2E2J B;  3D3R A;  5M3F B;  3D4R A;  1GHK A;  1SDF A;  5TSS A;  2F0I A;  1H9M A;  3L9A X;  4N9P A;  3GTM B;  5I9O A;  1IHZ A;  4K2K A;  2K03 A;  4N9T A;  3TZD A;  3I3C A;  3HOV B;  3D6W A;  2JYO A;  2R61 A;  1HPC A;  3G7L A;  4X3K A;  4MN3 A;  2ID0 A;  2D5D A;  1XTC D;  1TWH B;  1JQY D;  3OMC A;  4KN7 C;  1DD2 A;  4FYD A;  1G29 1;  2A68 D;  5KIX A;  4A3G B;  1U4M A;  3J7Y W;  1DJR D;  3PIP 3;  2L1B A;  2AQ2 B;  2IX3 A;  5EPK A;  3FDT A;  5M5W B;  3PUW A;  2SEB D;  3W3A A;  1A15 A;  1BXT A;  2FFK B;  3GTO B;  1FD7 D;  1JOR A;  3R2T A;  3SXH A;  2TMP A;  3OPO A;  1O7Z A;  4H13 C;  4K5V A;  2Z8L A;  3A54 A;  4K5X A;  1QJO A;  3BVZ A;  1KNE A;  4DK0 A;  1I3Q B;  1HXY D;  1EFI D;  3BDC A;  3VYT A;  3EFX D;  1XYI A;  1BOS A;  2HCC A;  4HN7 A;  3QG1 A;  4DXF A;  5C5M A;  4ZRZ A;  3KLS A;  1EY6 A;  1AZQ A;  1RTN A;  1ZYR C;  2NWG A;  3G6J B;  3T13 A;  3HS0 C;  1LAB A;  1H9S B;  1R9T B;  5IGF A;  1NR4 A;  2MHV A;  3MXG A;  1SBB B;  4FF2 A;  1OXX K;  1JCK B;  1CZG A;  1J8I A;  4C2M B;  4L8J A;  4QUC A;  2JEB I;  1SEB D;  1PFM A;  3A7L A;  3LX0 A;  4A3J B;  3A56 A;  1Y8P B;  1T5E A;  1YNN D;  5C0X J;  1R4Q B;  5C4H A;  1KDB A;  3HOX B;  5JAV A;  3R3O A;  2K32 A;  4C3I B;  4PMC A;  1V1O A;  2KJX A;  3OIP A;  2MUY A;  4CJ0 B;  2L0C A;  1V43 A;  4BWG B;  1KTK A;  3M4Y A;  2R93 B;  1ZXT A;  4XYO A;  1WTR A;  5A2Q E;  1ESR A;  1F9S A;  1F2Z A;  4CBV A;  1OXS C;  1Q8I A;  2K6A A;  4B9X A;  1SYE A;  5EBD A;  4BBR B;  3W2D A;  1QE6 A;  1SJE D;  3NUC A;  5JJZ A;  1PXU A;  4HED A;  1F9Q A;  3KBX A;  3KLR A;  3PUZ A;  3QIA A;  4A3K B;  3FVQ A;  4RCN A;  4ZKC B;  4M1U B;  1PRT B;  1PMR A;  5EQ0 A;  1IKL A;  1FNV A;  5BN3 A;  3WOE A;  4TRD A;  3R93 A;  1BCP F;  5C0X I;  3VR4 A;  3SHL A;  5JEA H;  4KTA A;  2O2L D;  1HCZ A;  3MAQ A;  2I46 A;  1BBX C;  2F0Q A;  1H9S A;  2EVB A;  2SNS A;  3NBI A;  1JWS D;  2ENB A;  2PZU A;  4DN4 M;  5EKI A;  4C3J B;  1E2W A;  2QCP X;  3BVM A;  1A2T A;  3GTK B;  1LTR D;  3VA5 A;  1WTO A;  2F03 A;  4OO1 G;  1JC7 A;  4IUT A;  3Q6S A;  2EYL A;  1Y1W B;  4ZAI A;  4FNF A;  1I4H A;  3ONA B;  3ZYY X;  4I65 A;  2E76 C;  2SNM A;  2F0U A;  1YNN C;  4K5W A;  2XWB B;  3C46 A;  1HA6 A;  4G7O C;  4LMQ D;  2K05 A;  3PO2 B;  1EY5 A;  1M8A A;  1SXT A;  1S5C D;  1A3V A;  5DEH A;  5IOC A;  3WDN A;  2F0G A;  1S5F D;  5G3L F;  1G8Z D;  1LT3 D;  1JIC A;  2R3Z A;  4A3I B;  2KA7 A;  3NP8 A;  1ML0 D;  1RF2 D;  1LTI D;  1PRT C;  1S5E D;  3NWT A;  1VMP A;  4LAA A;  3IFD A;  2EE1 A;  1BF4 A;  3C2P A;  3PUY A;  5I2Y A;  3I72 A;  1CT1 D;  4E6I A;  4CKB A;  3S2H B;  5COY A;  4RCO A;  3L3O C;  3NXW A;  1GUN A;  3TP7 A;  1H9K A;  3C1F A;  2B2Y C;  2PO4 A;  5JPM C;  1GUS A;  2Q8I B;  4ZKB B;  2NYZ D;  1PTO D;  2BCO A;  2B2Y A;  3OOC A;  2B8F A;  2DN8 A;  2ICI A;  1EZ8 A;  2F0T A;  2F0K A;  1TS2 A;  5E1F A;  1SYG A;  3GO5 A;  2A73 B;  2JXM B;  4RA8 A;  2D9U A;  3MWY W;  3MHB A;  4OIK A;  1J9O A;  1BO0 A;  3MXN A;  2VUM B;  4RGT A;  5K5P A;  3CU7 A;  3O13 A;  1EWH A;  1BCP C;  5EGT A;  4ILW A;  2X69 A;  2PZW A;  2D62 A;  1CQF A;  3K5N A;  5NUC A;  3UI2 A;  2KEE A;  2K7V A;  5JVG 3;  2MJ8 A;  2EY2 A;  1U4L A;  4ZUI A;  4PMW A;  3BZD B;  4X3S A;  2B2W C;  3FPU B;  5C0X H;  1EY7 A;  2V4D A;  2NB0 A;  4HTH A;  3S16 B;  1HUM A;  1HQR D;  2B2W A;  4KKS A;  4XQJ A;  1NCV A;  1O7L A;  4CJ2 C;  3I91 A;  2XVS A;  1G91 A;  2IPK D;  2E2D C;  4Z9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...