2FFKB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rabbitpox encoded CC chemokine inhibitor
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
molecule tags Virus/viral protein/cytokine
total genus 7
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ffkB00
4ZKCB 2K28A 4MN3A 3Q6SA 3P7JA 4R9WA 2XIWA 1WTWA 1HFGA 4NW2A 1ESRA 2HCIA 1PFNA 1QG7A 5D14A 2DY7A 1GUWA 1CM9A 5CMDA 1CA6A 1MI2A 1DOKA 1RTOA 2NZ1D 1DZ1A 2MGSA 1O7YA 1DONA 1NAPA 1QNKA 2B2YA 2KECA 1NR2A 1ICWA 1O7ZA 2IL8A 5CORA 2L4NA 2L9HA 1XYIA 1SSOA 1B53A 2J7ZA 2L12A 1HHVA 1JICA 1B4OA 1G2SA 2K1BA 1IL8A 2FFKB 2KEEA 2N88A 5AFWA 5D65A 2JP1A 5DNFA 4DN4M 5CBAE 5EQ0A 2D9UA 1RTNA 2FHTA 4ZAIA 5CBEE 1G6ZA 1RODA 2FINB 1VMCA 1ILQA 1PDQA 1BO0A 1G2TA 3I90A 3R93A 1S4ZA 4HCSA 4ZK9B 2N55A 4X3TA 4ZKBB 1HRJA 4OIKA 1F9QA 2B2VC 2MP1A 1M8AA 1O80A 2B2TA 2X6LA 3DEPA 1QE6A 1X32A 1EOTA 2M2LA 4IUTA 3TZDA 3UI2A 2K05A 4RWSC 3F2UA 1HUMA 1RHPA 1SAPA 2RA4A 2X69A 1BNZA 2JYOA 2RVLA 1PLFA 4CJ2C 1IKLA 1MSHA 3H91A 5EKIA 4QUFA 1CA5A 1PFMA 4X3KA 1F9PA 5T1IA 1WTVA 2MPMA 1HFNA 2EPBA 2EOTA 2L11A 4IUPA 2X6GA 4ZLTF 2NYZD 1E0BA 2CVRA 3FPUB 4QUCA 3TN2A 3MTSA 1WTRA 1WD0A 2B2WA 4IUQA 1J8IA 1B3AA 1U4LA 1DOLA 3IL8A 3LWEA 4IUVA 4HEDA 1EIGA 3N52A 4RAUC 1XX8A 4RA8A 1HUNA 3QO2A 1U4RA 3KUPA 3GV3A 2NWGA 5EPJA 2HCCA 3ONAB 2KUMA 5EPKA 3KBXA 4O42A 1LV9A 2R3ZA 4MHEA 1J9OA 4X3SA 1HA6A 5EPLA 4R8IA 2HUGA 2L1BA 5COYA 3D6WA 1Q3LA 1MGSA 1ZXTA 1WVLA 2K04A 1RJTA 2B2UA 2MJ8A 2B2YC 1EQTA 1KNAA 2H1EA 5JJZA 1WD1A 1U4MA 2Q8RE 1VMPA 1EL0A 1F2LA 4XDXA 1AP0A 1B50A 2SDFA 4HSVA 1IKMA 1A15A 2Q8TA 3HP3A 4CJ1B 4IURA 2HDLA 1WTQA 2FJ2A 4OIJA 1PFBA 2HDMA 1BF4A 1TVXA 2B2VA 2B2WC 1AZQA 1AZPA 5E4WC 2KVMA 4CJ0B 2K01A 3I91A 1WTOA 1ML0D 5E4XA 1JE4A 1MSGA 1ILPA 3DEOA 2BDNA 2EE1A 1WTPA 1X3QA 1WTXA 1F9RA 1NCVA 2B2TC 2K03A 4IUUA 4U68A 1EIHA 5EJWA 1C8CA 3SVMA 2KEDA 2RSNA 3I8ZA 5T1GA 1G91A 1DOMA 2B2UC 3I3CA 4HAEA 4XT1B 2KOLA 2DY8A 3MWYW 4LMQD 1B2TA 4XT3B 3FDTA 4X3UA 1NR4A 2FMMA 1BBXC 1X3PA 3DM1A 1KNEA 1F9SA 2RSOA 4UAIA 1SDFA 3G7LA 3IFDA 1U4PA 2VXWA 3GV6A
chains in the Genus database with same CATH superfamily
1IW7C 2EYMA 4DK6C 3H3VH 1PVOA 4JC0A 1EEID 2SOBA 1YJWA 3BYTB 4NW2A 5IP9G 1X56A 3CCUA 3VR5A 4WJ4A 1HCZA 2V1CC 1S5BD 3W1BA 2HIVA 3BVMA 3S15B 1PHJA 1QZGA 4IFDH 2F0HA 1K0SA 2F03A 1S5FD 4DGZA 5E7NA 1B53A 1SNQA 1CQFA 3UE1A 1JICA 1GUOA 1TS4A 4A93B 3QJYA 1C48A 1RDPD 2JA6H 2BOSA 1PH1A 1NE3A 5KEEA 1RODA 1SE2A 2FINB 3OMCA 4KHPQ 2RCNA 4GZYC 1U0LA 3NXWA 1HQRD 1DCZA 1XTDA 3TP5A 1K83B 4U673 5C0XI 4JCVE 3CCMA 4GKKQ 5M5WH 2SNSA 4OX9Q 2HQLA 3UI2A 1Q7YC 3F2UA 1PA6A 4CHTB 4KKUA 2WP8J 4CDCC 5KYLA 2JA5H 1PFMA 5IT9E 2JSOA 1P16A 1TS5A 2K52A 3P20A 4YCWA 4ZLTF 4QUCA 1J5EQ 3K5OA 3L0OA 3LWEA 3NPPA 1HNWL 3MXNA 4NPSA 4DR7L 2NWGA 1EY0A 4OL7A 3GTQB 5F2DA 2KUMA 1IBML 3F1ZA 4R4IA 1PV4A 2KHSA 4MHEA 1J9OA 3AFQA 3PO2H 2TSSA 3J81c 1J6QA 1D1KA 4Q5VA 2Z9HA 3GDEA 1WVLA 1RJTA 1K73C 4TRDA 1VMPA 4N9PA 1RL2A 1Z6HA 2PQAA 1KRSA 3NE5B 3O13A 4NXML 3RLNA 3VA7A 1S3OA 4TQUS 4C3HH 2NVYH 1D6EC 3NEMA 3TREA 3I4NB 4GLVB 4G4KA 2ZJRA 1XTCD 3MC0B 3AB9A 1II3A 3HOXG 1STBA 1A3UA 4ULLA 2Q2IA 5K5PA 4C3JH 3PSIA 1Q8KA 2RBMA 2B63G 4GKJQ 2LMCB 5IGFA 4A3MG 1Q86C 4OWWB 4XQJA 4QGUA 3FHWA 2E8GA 2I5MX 4AH6A 1KLUD 1PYBA 4QB4A 3IKJA 3HRZC 1Q46A 4LF8L 1BOSA 2UXBQ 2Z6KC 4J1MA 4RKLA 1GUWA 1EU4A 1H9SA 5LMNL 4LFBQ 1E2WA 2NZ1D 1ZYRD 1SMXA 1QNKA 5A2QE 4KMUC 3C1FA 1B70B 5I9OA 2Q2HA 4QIWE 2J7ZA 2M00A 4DN4M 5DNFA 5M3FB 1YNXA 1KABA 2UUCQ 1JOKA 1ASZA 1BO0A 5GROA 1Y69U 3I90A 3GTMB 4KJOA 4I65A 4KKTA 1N8RC 2CH4W 1IYUA 2RHQB 3KLSX 3M4OB 4POFA 1OXVA 4LFCQ 4IUTA 2F1MA 3PF4A 5C0XG 5FLMG 1CKMA 4DV0Q 2PPBC 4KN4C 3VDYA 3S1RB 1SYEA 1LTSD 1IKLA 1F2ZA 4O2DA 3S9WA 2I46A 4DR3Q 3DMUA 4JI6Q 4B3RL 3CC4A 4AYBE 4TSSA 1W6JA 1CI3M 1PH2A 2XSCA 3RZOH 2B29A 2K32A 2OF1A 2F3VA 3CMAA 1XX8A 1U4RA 3I4OA 4DNIA 5I6YA 4JBKA 3AQQA 1LTGD 2UUBQ 4YWLA 1LTAD 1QUQB 3KOJA 2KJXA 2CWPA 5CGKA 4A3EH 4HTHA 2JA6B 3AEVA 1LO5D 1E2VA 2UU9Q 1FGBD 4N8X1 1BF4A 5C4XH 3A55A 4DR5Q 2D0PA 1ZYRC 4A3FH 5M5WB 3OMGA 4BS9A 1QVGA 3UE0A 5IGDA 1EWCA 3OTOL 3J81L 4Y52H 5CV5A 5IYDG 5JVH3 2B39A 3KFUA 4U68A 1VQ7A 2JA5B 2K5DA 2B8FA 2KCNA 3PUWA 1VQ9A 2PZUA 1AN8A 3HOVH 1X3PA 4DAVA 1B9MA 1NUCA 5D3IB 4JI0Q 4UAIA 1MD2D 4UHVA 5IYBG 1Q90A 2BA1A 3NQIA 3ERQA 2B8GA 5KYIA 1VQGA 3PO3H 1QVCA 1EYGA 3PO2B 1LM0A 1STGA 4FF4A 3RUZA 1STYA 2F0GA 2A69D 1XNRQ 1XWEA 4KKSA 1S5DD 2F0IA 5AFWA 2K6AA 2JP1A 2K75A 4IALA 3V96A 3I4MH 1SN8A 4C3HB 3A5ZB 1JJ2A 4JPBW 3J81i 1S4ZA 4DV7Q 5IODA 4NXNQ 1ZEQX 1XMQQ 1M8AA 4H02A 4QF4A 2F3WA 2F0UA 1X32A 4RH6A 1LT4D 3ITPA 4C3JB 4R4TA 4YHHQ 3RN2A 3ND8A 1CA5A 4UPAA 1PYWD 1TIID 4XYQA 1JJGA 2YU9H 3HOUH 1QCBD 2QW7A 5CV6A 1EFID 2CVRA 3T16A 2DNCA 1B3AA 2YTYA 1GUNA 2QF7A 3TEHB 4HJ9A 1FJGL 4BA1I 4YY3L 5D3DA 4O42A 4RHRA 4GOPC 1HA6A 1UEBA 4RCOA 1VQOA 2R93G 3I55A 1HR0Q 2QEJC 4RGTA 5H1SE 2JEBI 2E2IH 3IAYA 2K33A 1KTKA 1X65A 4HN7A 4AIMA 1LT3D 4JBWA 4HIDA 1Q81C 3ICEA 2CKZB 4HSVA 4BBRH 5IYCH 5IP7H 4H0LC 2F0QA 1KQSA 1T5EA 2EYLA 1WTOA 1ML0D 1X6OA 2A69C 2XRQD 2AWOA 4FNFA 4P74A 2RDHA 1M1KC 3DUZA 1UE7A 2K03A 4K2KA 3CRLC 1I50H 2MNAA 4DAPA 3S2HB 4DV3Q 3CKIB 2RDFA 4XT1B 5BN3A 2EYJA 3JAML 1G6PA 4EQOA 2F0VA 1H95A 4X3UA 3RZOB 1H9KA 1MBYA 4DK1A 2RSOA 1R9TH 1BR9A 2E2JH 5FLXL 1V1PB 3HOWG 2Y0SB 4FF1A 5C0XJ 3IRBA 3D3RA 1GHJA 1ICFB 2P5ZX 3HEJA 1Y8PB 1MI2A 5IGGA 1YVCA 4JI1L 1N34Q 4A3EB 2PNHA 2L4NA 4PMBA 2OTLA 2HIXA 1PZKD 1B4OA 2EY6A 2K1BA 4RG1A 4A3GG 5IY0A 3GTOH 4HMIA 2BA0A 4JOIC 5C4XB 3QG1A 2E5LL 1I4GA 4LFAQ 2I07B 2JJQA 2K50A 4AQYQ 4FF3A 1X3FA 4EVOA 3N6RA 2WINB 3U4VA 3TBIB 1Q82C 2GN5A 1RKNA 3HOVB 2Z1CA 3KF6A 1WTVA 2A6HD 5I2XA 4UDUC 1ENCA 2VQFL 4A75A 1A2TA 2CH4A 3A7AB 3G71A 3PO3B 3NELA 1U4LA 3J7AV 1VQMA 1EQVA 2C9OA 1VS0A 3OW7A 3SDZA 1E1OA 2HHHL 3VR4A 4P75A 1EY5A 2AKWB 2EQSA 2H1EA 4A4IA 4HMJA 1U4MA 1F2LA 3I4MB 4A93G 3KF8A 4B08A 2GA4B 3OHXC 3TZUA 1B44D 3GO5A 3BYYB 1FNVA 3I72A 4PZ8A 5JJIA 2ZJPA 5FO9B 3P1HA 5C4JB 1V43A 4PV1C 3CC2A 2AHOB 3A0JA 5EGTA 1VF7A 4YCVA 1HNWQ 3R3OA 5T1GA 4DR7Q 3BZDB 2YU9B 2B2UC 3HOUB 5HGTA 4CKBA 1IBMQ 2ICEC 1SFOH 3ULPA 2FMMA 4PQXA 3H15A 1TQOA 2JA9A 2IX1A 1T9HA 3HKZE 2VXWA 5KNDA 4IFDI 4K6DA 2LSSA 5K36G 3J80E 1OO9B 2OCEA 1C0AA 5GADC 2NN6H 3OIQA 2RF4A 2K4KA 4XTCS 4OO1H 1DZ1A 1S72A 4NXMQ 4FVMA 1IBLL 1VQNA 2A6HC 3A74A 4Y7NH 1GM5A 2E2IB 1XYIA 2J0TD 2XNAC 1EWIA 5CBAE 3CMEA 3T13A 2R92H 3HKSA 4J8QA 1DYQA 1U5KA 3EJIA 4LUOA 4HCEA 1E22A 1PRTB 3M3YB 1G2TA 3DWAA 1LYLA 2PCFB 2LFNA 1WYDA 3I4NG 5C3EH 1EOTA 1K0RA 1I50B 1HZBA 1HUMA 1CTMA 5IT9L 1CZWA 3DWQA 4LF8Q 4DAMA 1JQYD 2AMCB 2EPBA 1WTHA 3B6YA 4DV2L 1R9TB 1STNA 2E2JB 1PZJD 1VF5C 4XQNA 2B2WA 3E0EA 3GD7A 4RA8A 1VQAA 2E2DC 2WIIB 3GTLH 4IPDA 2F4IA 2NTTA 2NZHA 2EZVA 3L3OC 2EYFA 3NTKA 3ZYYX 2CQAA 4GNXA 4A76A 1K28A 2AQ3B 1WD1A 4E6IA 3GTOB 1EYAA 2WKCA 4OWTB 2Q8RE 1EL0A 5M3FG 1SYDA 1HNXL 3F2CA 2OQ0A 2PNRC 2H4OA 1LT6D 4LF5L 3BZCA 4CJ1B 1SJHD 1OXSC 3CF5A 1VQBA 4B3RQ 3T56B 2IT1A 2K5NA 4QIWB 5IGBA 3WDNA 3CCQA 1CFMA 2XTIA 3VR2A 1UE5A 2KEDA 2QDLA 3H3VC 2WB1E 3TP8A 1VQDA 4K5VA 2KOLA 1SNMA 3G48A 4LMQD 4LF6L 1GKHA 4ME3A 3C1EA 1BBXC 2EVBA 2JEAI 4KV6A 1UAPA 3BU2A 2K28A 3RMHA 3WWVA 4CKEA 1R4QB 2EJFC 1SNCA 4O1NA 3CQZH 5A2QL 5KRUA 4IFDG 2XGTA 4RKBA 5ELCA 1RTOA 3FEWX 4ZUIA 1PTOB 4AYBB 1RF2D 2ATWA 5CORA 4L6TB 4R4OA 2O5IC 3U9OA 1K8MA 2OT2A 4KD4A 2MO1A 2JA6G 1IL8A 4H13C 5CR3A 1S40A 4CDFC 5ELOA 4X62L 4PZ7A 1E7ZA 1I5FA 5EKKA 5EKLA 2DJFC 2JA5G 5LMUL 4JBJA 3KBGA 1G8ZD 4QUFA 3TS2A 1SFOB 1MJEA 3K59A 2EOTA 3UDGA 2YV5A 1MIUA 5A35A 2UUAL 1FD7D 4JG2A 2SEBD 3KLSA 1UWVA 5FJ8H 1JORA 2OWOA 3QO2A 5C5MA 1EQRA 3KJPA 3PO2G 1N9WA 2ENBA 1UUPA 3J7YW 2EIFA 5EPLA 2PYKA 3PIOA 2N49A 2AQ2B 2Z0SA 2OEOA 1D2BA 1EQTA 4C1NI 2R92B 4JI5L 3SXHA 3E0JA 2N78A 2AQ1B 2R7ZH 3KLWA 4C3HG 2VZAA 4OIJA 1N33L 1PRTF 1GUTA 2Z6KA 2IX0A 3K58A 3CRKC 5C3EB 1C7YA 1MSGA 1ILPA 1UEAB 4FDBA 1TWHH 4IUUA 2F0TA 1W3SA 4C3JG 3GTKB 3PIPA 4B3ML 2A5HA 4L63B 1FJGQ 1LLRD 3AU7A 4YY3Q 2G9HD 1PXUA 3MWYW 1EY6A 3SK4A 1R4PB 1YHQA 1U4PA 3BG3A 3UDFA 2G5DA 3GTLB 1EY8A 3KF6B 3HG9A 4HR7B 2H5XA 3V05A 5FOBB 1OXTA 1DONA 5CYUA 1ICWA 3MFYA 3CU7A 5DEHA 1KDAA 4DK0A 2KQ3A 3PUZA 2N88A 3MEFA 5D65A 2KCCA 4MTNA 2A6ED 1XMOL 1V9PA 4DA2A 5HURA 3S2DH 5FO7B 1TS3A 3URYA 1HZCA 1TR5A 4F8MA 4DK3C 3TDQA 3VR6A 1F9QA 4DAYB 3DEPA 3SEBA 1L1OB 2F52A 1UNSA 1I3QH 3K5LA 2OTJA 4KY5A 4CJ2C 1MSHA 3HOZB 3CC7A 1NMFA 3A7LA 4LNQA 2Q2UA 4BXXH 2R61A 1VQ6A 1I4RA 4JI1Q 4K5WA 2FMCA 3RZDH 1WD0A 2XN9C 2BH2A 1G6ZA 4IUVA 4HEDA 1EIGA 4BA2I 2Y0SG 4R8NA 2JA8H 3S1QH 3CQZB 3KBXA 3OWEB 1XXGA 2XRSD 1X3EA 3M4YA 4X3SA 4WFN3 4BY7H 1BXTA 1VQJA 1PTOF 3K57A 3S1NH 4A3EG 1XJVA 2E5LQ 1TWFB 4X66L 4JYAL 4DXGA 4X65L 1PH6A 1HTPA 1NJIC 1AP0A 4A3MH 4KI0A 5C4XG 3DM3A 3M7GA 5LMNW 4IO9A 4IURA 1NSNS 3NBHB 1JB3A 1PFBA 4IFDJ 3EA6A 1AZPA 4BY1H 1N32L 1S5ED 1JE4A 1YEZA 2VQFQ 3A5UA 4GN4B 2R7FA 4XYOA 2ICIA 1PYSB 2CW0C 2A6EC 4B9XA 4HIOA 3HOVG 4ZQ3A 5FKAC 4LWCA 4XT3B 2L5TA 2HHHQ 3R8BA 1PRTD 1JR0D 3KDFA 3JAMc 1TY2A 2I5HA 4HJAA 4IOAA 5I4DA 1GXDC 3Q6SA 2HCIA 5FLXc 3NTHA 2ID0A 4OXPA 1BCPB 1B9NA 4UP8A 3Q24A 4A3IH 4BBSH 1HZ9A 1KL9A 2IL8A 2A1AA 3GQBA 5EBCA 1TS2A 5BR8Q 2O4XA 3I4MG 1K8GA 5IGEA 2R7ZB 1EQQA 4GNXB 2MQHA 1LT5D 1M4VA 1VMCA 4K5XA 5DM73 5I9PA 3K81C 3CW2C 2JE6I 2N55A 4M1UB 2NTSA 1I6HH 4GOPA 2B2TA 1TWHB 4RGMA 1KAWA 1GJXA 4EQNA 4RWSC 1N36Q 3NQTA 1Q12A 1RHPA 1SAPA 2RA4A 3HZXA 1CQVA 4JI3L 4DPGA 1GO3E 3HOUG 4YIJA 3EFXD 1FR3A 4A3DH 4WJWA 1IBLQ 1CKOA 5ELFA 3TN2A 4DUYL 1B7YB 2NVYB 1EU3A 1E2ZA 2A73B 5J1ZA 3ONAB 1GVPA 3TRZA 4EGVA 3X3NA 4CGYB 5IYDH 3A8IE 1FL0A 2K04A 5JPNC 3HKZB 1PRTC 3ERSX 1CSQA 1JOOA 4R4QA 4HSPA 1LTLA 5IP7G 4OGQC 1A15A 4A3LH 4JI7L 2NVTH 5IYBH 1VQEA 2RDGA 1AZQA 4DR6L 3ULLA 1O78A 3K0YA 5M5YH 4DV2Q 1I3QB 1PTOD 1SYCA 2PZTA 3R2IA 4RHSA 2LY7A 1L2FA 2B2TC 1EIHA 3SVMA 1DJRD 1QJOA 4EQ5A 5CC4A 2PMZE 1B2TA 4JOIA 2NN6I 3RZDB 1LABA 4QY7A 3H94A 3H0GH 5J3BA 4OO1I 3J80L 3PIP3 2ES2A 2PO4A 4ZCKA 2JA8B 3S1QB 4MN3A 2K5VA 1O7IA 1JWMD 2L15A 1HFGA 5D14A 5C4ZA 4BY7B 1HNXQ 2VS1A 4LF5Q 3VYUA 2PW5A 2IWHA 4A3JH 3S1NB 5JEAH 1VQ8A 2B2YA 4MNOA 4FYDA 3PUXA 1XPUA 4JI4L 4S3SA 1TT2A 5JJKA 2EJMA 1U9RA 2L12A 4OWXB 3CCEA 1A6XA 1HJPA 3Q0AA 4BY1B 2R7DA 2YTXA 3RR5A 5CV7A 4HCSA 4OELB 2E75C 1T5XD 3EROA 1HRJA 1OXXK 4LF6Q 4EX5A 3LWUA 4A3BH 1QE6A 3G6JB 2DNEA 2WAQB 1YHAA 4L8JA 2VUMH 1O7LA 1PLFA 2RVLA 3MXNB 2SNMA 3MHBA 3EIVA 3I73A 5IT9c 4DNRB 3NHHA 2L11A 4HIMA 4GLAC 4LAAA 4C1NK 4KD3A 1KDBA 3A54A 4A3FB 1PTOC 4GS3A 4R1JA 2F0JA 3PGZA 1V1QA 1SROA 2HCCA 2WB1B 4A3IB 1LV9A 1BCPF 2R3ZA 2PQAB 1EFWA 4BBSB 1ET9A 4X62Q 4AYBG 4ID6A 1XPOA 3JAMi 2B2UA 4G57A 1FGUA 2B2YC 1X3GA 4NP5A 2K14A 5JJLA 1RIPA 1VCIA 1K8OA 1G291 4LK1C 2F0KA 1YBYA 5LMUQ 3BDLA 1Q1BA 1TU2B 2HQEA 1I6HB 3VYTA 5BN5A 2KVMA 4N9TA 4C56C 3FKIH 2EE1A 4KN7C 4P71A 4G7HC 1KIXA 3EN2A 2UUAQ 2C5CA 3HFZB 1VQCA 1KD1C 4V0BA 2Z6BA 1PMRA 3I8ZA 5FK9C 1JC7A 5IE8A 3I3CA 3F8TA 4A3DB 1H9SB 1JJCB 1G51A 4NMZA 3C46A 1VQHA 2F0SA 2K5WA 1BVSA 1KNEA 3IFDA 3MAQA 4RMFA 1Q8IA 3SHLA 1KC8C 2JA7H 2NN6G 4OHJA 1Y8OB 2XIWA 3K6OA 1ESRA 4DNTB 3CHBD 4X64L 4JI5Q 4Q0FA 5J39A 5BR8L 3NP8A 1N33Q 1AE2A 4C3IH 1QB5D 2KECA 2F0OA 3HS0C 4JK1C 2DN8A 5DAUA 1Z9FA 4A3KH 2R92G 2PQEA 1TWCH 5C6AA 1A8VA 2K5HA 3D4DA 1JB7A 1FNUA 3GTPH 2NVTB 2CWAA 4B3MQ 3EBEA 1CSPA 1I4XA 5TSSA 1N36L 5M5YB 1BBUA 4GN3B 3CCRA 4ME5A 4LF9L 5C3EG 3VYRA 1BQQT 4M8AA 5C44H 2X69A 2KHIA 2XWBB 1BNZA 5AJ3L 2VB2X 1TWGH 3VA5A 1IZ6A 5I6WA 3H0GB 1DM0B 4BBRB 4F88A 1D5ZC 1WTRA 2NYZD 4OEMB 4I7ZC 1CHPD 1EUJA 2PI2A 2EJGC 4P72A 1J8IA 1HUNA 3UDXA 3MXPA 2QA4A 3KUPA 4N8FA 5GAGC 3C3LA 1K83H 5EPJA 4LW1A 4A3JB 2F0EA 1STEA 4ZRZA 5C3WA 2I5LX 2QKIC 3CCJA 1XMOQ 4UY8C 1DXMA 2MHVA 5GAHC 3S14H 4O0AA 3TP6A 1KNAA 1Z47A 3U4ZA 4DR1L 1QOHA 3T1HL 3RD4A 2GVAA 4LUVA 3DLLA 4HIKA 2IHEA 3G6EA 5ELBA 2ZM6L 2IJ0A 2ZJQA 2C35B 2HDMA 4IJHA 3BDOA 4IPGA 3MXGA 3EQLC 5E4WC 4DU9A 1QUQA 2KHJA 4ZYSA 4GN5A 4IJLA 4IOCA 1VQ4A 4A3BB 3I2ZA 3PCOB 3E3XA 3GTQH 3NSWA 1VQIA 3NK9A 2VUMB 3NTIA 2EY5A 2AWNA 4IUNA 4HJ7A 1Y1WH 3OSOA 2ALYB 3HOZG 1HPCA 4HAEA 4JBMA 2WAQE 5JAVA 1TXYA 4JVZA 3MFGA 1Q1EA 3GV6A 1SLJA 3K80C 4KHVA 4P73A 5BN4A 4X66Q 1JWUD 4JYAQ 4X65Q 1XNQL 1MJCA 1WTWA 4KK7A 3BS1A 2EXDA 1QG7A 2DY7A 3RLOA 3HOYH 3I4NH 3QIAA 2V4DA 1CK1A 3T1YL 3R2TA 4L5SA 2WACA 3BZKA 1N32Q 2CQOA 4A3CH 1OXUA 1UE6A 1JMCA 2EY2A 1HR0W 3T51B 4ABNA 2A74C 4ZAIA 4QL5A 3K7AH 4XIGS 1GUSA 4RGOS 1LUZA 3M4PA 1SXTA 2N3SA 3FKIB 3FMCA 4OIKA 1A2UA 1IXRA 3U50C 1W2BA 1O80A 2L55A 4FXKC 5JOBA 3TZDA 5CV4A 4EQPA 2PW7A 1WFQA 4K14A 4MZ9A 3NENA 4APVA 1F9PA 1C4QA 2LXJA 4G7ZC 1HFNA 3WOFA 2ZXOA 1PH9A 3BDCA 4IUPA 2RCFA 3FPUB 3SGIA 5FJ8G 4POGA 1JE5A 1SR3A 2QCPX 2JA7B 3IL8A 1DOLA 5CV9A 4B9WA 4LF7L 2ZXRA 2MUYA 1AEXA 1WI5A 3PUYA 1A3VA 1P8LA 5EPKA 1PZID 4C3IB 2O5JC 3W3AA 3S1MH 1Y1VH 1GUGA 2BE5D 5KIXA 4K8JA 1D7QA 4A3KB 3E6ZX 3I70A 5C5LA 1HQMC 1E3PA 1TWCB 1SNPA 2VQEL 5M3MH 3CXCA 3K5NA 3GTPB 4KTAA 2R7ZG 1FNWA 1TKWB 1B50A 4FXDA 1KAAA 4JI3Q 1TVXA 4JI8L 2NBFA 4CJ0B 2K01A 1I94L 4DKAC 1F9RA 2OXPA 1NCVA 5C44B 4Y7NB 2NVXH 4DUYQ 5EJWA 4YCUA 5JVG3 1G91A 1TWGB 3FVQA 3QWNA 3J7ZC 3CP0A 3SK6A 2O2LD 1ET6A 1CZGA 1WCMH 2IX3A 3DM1A 1QZHA 1VQKA 1EIFA 1SYGA 3U58A 2EY1A 3J7AF 3M4QA 3P7JA 1V8QA 1PFNA 3TS0A 3BJUA 1SBBB 1YNNC 5CMDA 5IP9H 2VB3X 1DOKA 4H44C 5EBDA 1EZ6A 3X3MA 3S14B 4JI7Q 4ALPA 1PH5A 4DR6Q 1V1PA 3HKZG 2QILA 3GTGH 2Z4HA 4YWKA 2FFKB 1ONLA 2YTVA 5IWAL 1PH3A 1GHKA 1A0IA 2N8NA 3D31A 1QWYA 3S17H 2EXZA 1LTTD 4X3TA 1STAA 2BE5C 4LF4L 1IBKL 1NMGA 2M2LA 1KDCA 4KJNA 4IPHA 3STBD 2UXCQ 1LACA 1Y1WB 5M9OA 3F2BA 4JI2L 4B3TL 4DV5L 2MPMA 4BXXG 2CW0D 2R6GA 2X6GA 2E2HH 3PF5A 2JA8G 4JI4Q 4CBVA 2ZTDA 3N52A 1F2YA 2VY3A 4B3SL 3KF8B 3HOYB 4BY7G 1HTLD 3SE0A 1CUKA 2PMZB 4DV4L 1CKNA 3NUCA 2L0CA 3NBIA 3H6MA 1L0XB 2ZTEA 1JCKB 4K2LA 1SYBA 3K0XA 4TKOB 2XWJB 1KXLA 5LL6S 2DUDA 3K7AB 3OPOA 4DR2Q 1EY7A 1IKMA 1QILA 4DV6L 2Q8TA 5LHY1 1BKBA 4BY1G 2EYPA 3NWTA 2B2VA 2QEXA 1C9OA 5J22A 3GTJH 5E4XA 2IY5B 3DEOA 2F0WA 2WAQG 1YITA 1YNJD 1OTCA 4KY7A 2RSNA 1SE4A 3HOXH 2I0QA 1UE1A 4H7BA 1PH8A 1X54A 2DY8A 3TMEA 2B63H 1ASYA 4IQZA 4ZKCB 4A3FG 4K6LA 2Q8IB 2F0MA 3J80c 3STBC 4R9WA 1HNZQ 2WB1G 3E5SA 3CAMA 3OW2A 1E1TA 4A3IG 3DHQA 1Y1VB 3MEHA 3S1MB 4BBSG 1A63A 1D5MC 4X6AH 1SEBD 2KBNA 2MGSA 3GP7A 4DF7A 4DV1L 1NAPA 3M7NA 3MXUA 4QCLA 2L9HA 5M3MB 4FP5D 4CDDC 3T53B 2LS01 3S2HH 2F0LA 2KEEA 5NUCA 1RD9D 5DLQE 5EQ0A 1EZ8A 1PDQA 4NB3A 1IYVA 3PO3G 1TWAH 4IPCA 2B2VC 4PZ6A 3D6CA 2X6LA 2NVXB 4WRDA 3K8AA 5GAEC 1VQPA 1X55A 4RFBA 1WOCA 4MIUA 2ASBA 5C0XH 5FLMH 1D5XC 2JYOA 5EKIA 2F4VL 2XVSA 4X64Q 4A3DG 2GVBA 1WCMB 1EY9A 3S24A 1EIYB 2UXDL 5JPMC 1W6KA 3QOLA 4BWGB 4UP7A 4IUQA 4RAUC 3WOEA 3W2DA 1CT1D 4QQBX 4K0KL 1YNJC 4DUZL 1STHA 3W5OA 3K5MA 3T4AC 2YYZA 1ZKOA 2L1BA 1LTID 4J6HA 4R8IA 4DFAA 3D8GA 1ZXTA 3GTGB 5L37A 4LF9Q 1WJJA 3FRPB 2JQOA 4A3LG 1I6VC 1D1IA 2LKVA 3S17B 2HDLA 1LTBD 1BDOA 4F7XA 3PUVA 5AJ3Q 4XQQA 2RQXA 5HGQA 2RHSB 4IZ8A 1KHIA 1NTGA 4PG3A 1SRUA 1WTXA 1PH7A 3QOJA 4V190 3PV0A 1ENFA 1SE8A 4KHPL 5I2YA 4HJ8A 1DOMA 1H9RA 1Z7TA 2K7VA 3H0GG 4BBRG 5IIFA 5IYCG 4GKKL 2E2HB 1K3RA 1BUVT 1F9SA 5DM63 4L5QA 1EWHA 3PIO3 2CFMA 3G7LA 3SK5A 5FO8B 4OX9L 3S2DB 5KNCA 4DR1Q 3T1HQ 1ENAA 2BDOA 4A3JG 1CM9A 5JEAG 3M9BA 2NVQH 3SK8A 5C4JH 2ZM6Q 4FO2A 1O7YA 1J5EL 2EYOA 3S16H 4DR4Q 1I4PA 1YJNA 1HHVA 3QR8A 3V2TA 4JV5Q 2Q2TA 1Y8NB 1CHQD 1ILQA 2F3IA 2E76C 3GTJB 2J4XA 3R93A 5EAYA 2UXCL 4ZKBB 3LGJA 4A3BG 2MP1A 2TMPA 4DXFA 1JWSD 2K05A 4LUZA 2VUMG 3IFTA 3HOXB 1I4QA 3D0FA 1XNQQ 4R4CA 3H91A 3ULJA 2HD3A 2ZXPA 2B63B 4A3MB 1B8AA 1NNXA 5ELDA 4YWMA 4RCNA 5ISRA 1E24A 3RLFA 3T1YQ 2EDGA 3MTSA 5KGUA 2VW9A 1K8AC 3VYSA 3M3YH 3CCVA 2NB0A 1XPRA 1VQLA 4GKJL 2CHBD 4GLXA 1H9MA 5KNBA 2G9DA 4DR2L 1L0YB 1Q3LA 1MGSA 2D62A 2R93H 2UXBL 1F77A 1GD7A 1B3QA 3J80i 4J15A 3DWPA 3M85A 2PI2E 4XDXA 1YI2A 4LFBL 5GQOA 1WTQA 1TWAB 4NKLA 2F0DA 3FKIG 2JN4A 3I91A 1EOVA 4QMGA 1TY0A 2BDNA 1L0WA 1WTPA 1I4HA 3CD6A 2E74C 1VQFA 2UUCL 4CKCA 2D0OA 3J81E 1C8CA 2IHFA 4LF7Q 2QDBA 5M5XH 3D4WA 3CCSA 2WV6D 3A56A 3KK7A 2F0NA 1GOZA 4C2MH 1FVIA 1A3TA 3FP9A 1HNZL 4LFCL 1SNDA 1D8LA 2JA7G 4DV0L 1SJED 3H09A 3HOWH 3PQIA 2VQEQ 4CDEC 3FPPA 4DR3L 3I56A 4JI6L 1JOQA 4TVAB 2A68D 3BVZA 1CA6A 4C3IG 3PMFA 3JC66 2OQKA 1AFPA 3U9SA 2KENA 4JI8Q 2F0FA 4PMCA 1O7ZA 2KA7A 3OOCA 4A3KG 1KLGD 2ZTCA 4RGNA 1I94Q 5G3LF 4FF2A 3AYHB 1G2SA 1AE3A 1CKNB 3A8JE 2D9UA 1RTNA 2FHTA 5CBEE 2UUBL 4A3GH 2D2CC 3TP7A 4G7OC 1KRTA 1F2MA 1LTRD 2VL6A 1DD2A 4PNYA 4OO1G 4OONA 2DJGC 3OWFA 5C44G 2UU9L 3I4LA 1EYCA 1PTOH 1AH9A 1IHZA 2BCOA 2D5DA 2A8VA 2B3GA 4DR5L 4KLKA 5T1IA 3VR3A 1HZAA 1FYCA 4DAYA 3LNNA 3TSSA 1L1OA 5LL6X 2WFWA 1E0BA 1YHBA 3G4SA 2Z8LA 4ZUJA 1NBWA 2PZWA 5C3XA 1QVFA 2NVQB 3LX0A 1JT8A 4PMWA 5IWAQ 4IN3A 1HA5A 1SMYD 4F87A 1HH2P 2HUGA 4QJFA 5COYA 4JI0L 3D6WA 5E3FA 3S16B 3S15H 4MTKA 3SR1A 3KYHC 3H3VI 4L5TA 5JJZA 1DGSA 2RKSA 3L9AX 4LF4Q 1IBKQ 1PH4A 4XXEA 2WKDA 4NDXA 4A93H 2K5QA 3J7A5 3QB3A 3KLRA 2FJ2A 5JEAJ 1IYJB 4JI2Q 2KCTA 2DGYA 4B3TQ 2A68C 4DV5Q 1XNRL 1X3QA 3J81j 1VQ5A 1YIJA 3KDFB 3OYYA 1Y1WG 3HGBA 1QNUA 3NBHA 4DV7L 2NZOA 4NXNL 4B3SQ 1XMQL 3RN5A 5HY6A 2M9VA 3A8KE 4UP9A 4ODGA 1B1ZA 3F2DA 4DV4Q 3JAME 3CPWA 4L5RC 3ER0A 1L1OC 2MO0A 2CCZA 1AW7A 4YHHL 1PFSA 4HJ5A 2A19A 5FLXE 1BCPD 2NUCA 3HOYG 4DR4L 5K36H 5ELNA 3E9HA 1SE3A 2HT1A 4DV6Q 5IGCA 1K9MC 1YJ9A 1V1OA 2R93B 4JV5L 4A3CG 1NR2A 3GTKH 1K3BC 1SSOA 5LMNQ 2IW3A 3NWSA 4GOPB 3MVVA 5E1FA 2MFIA 1NY4A 1H9JA 2F0PA 2QGQA 5C4HA 3AFPA 4FXGC 2LXKA 1IL2A 1HR0L 4ZK9B 1SMYC 3AMUA 1MKHA 2FXQA 2JXMB 1IW7D 3C2PA 3E9IA 4I7AA 1M90C 3I7FA 3Q22A 5M5XB 3BVGA 2Y0SE 4KY6A 1HXYD 1MHWC 3MA2B 5G3LD 4KHZA 3D4RA 4C2MB 2AUJD 4X3KA 3DXJC 1SYFA 3OIPA 1RCVD 2ZT9C 4DV1Q 5CV8A 3HOWB 3GV3A 3Q23A 3ND9A 4DV3L 3CCLA 1Y1VG 3L7ZC 1EYDA 1BBWA 2EYHA 1EY4A 3RNUA 3P75A 3K7UC 2MJ8A 1SNOA 1YNND 4Z9CB 3W1GA 2KCMA 5M3MG 4P2CB 1X9NA 1A62A 4A3GB 3HOZH 3CPFA 3UDIA 2SDFA 3MZ5A 1EEFD 1S5CD 5M3FH 2Z4IA 3HP3A 1BCPC 1N34L 2B2WC 4WJ3M 2F4VQ 1YZ6A 2BH8A 3KJOA 3GTMH 2AUKA 2UXDQ 1VDZA 4WORA 5ELEA 3M4OH 2JK8A 1Y14B 4GNXC 5IOCA 3L2PA 1TWFH 4K0KQ 3OTOQ 3S1RH 4ILWA 4LFAL 2VNUD 4K8IA 1WCMG 4DUZQ 3TQYA 4AQYL 1ESFA 4LJZC 2IPKD 3FDTA 1NR4A 3Q8DA 3EVQA 4JW0A 1SDFA 3ZJYC
chains in the Genus database with same CATH topology
1IW7C 2EYMA 1EEID 2SOBA 3BYTB 4NW2A 3VR5A 1HCZA 1S5BD 3BVMA 3S15B 4IFDH 2F0HA 2F03A 1S5FD 4DGZA 1B53A 1SNQA 1CQFA 1JICA 1GUOA 1TS4A 4A93B 3QJYA 1C48A 1RDPD 2BOSA 5KEEA 1SE2A 1RODA 2FINB 3OMCA 4GZYC 3NXWA 1HQRD 1DCZA 3TP5A 4U673 1K83B 5C0XI 2SNSA 3UI2A 3F2UA 4CHTB 4KKUA 2WP8J 5KYLA 1PFMA 5IT9E 2JSOA 1TS5A 3P20A 4ZLTF 4QUCA 3K5OA 3LWEA 3NPPA 3MXNA 2NWGA 1EY0A 4OL7A 3GTQB 5F2DA 2KUMA 2KHSA 4MHEA 1J9OA 2TSSA 1D1KA 4Q5VA 1WVLA 1RJTA 4TRDA 1VMPA 4N9PA 1Z6HA 3NE5B 3O13A 3VA7A 4TQUS 1D6EC 3I4NB 4G4KA 1XTCD 3MC0B 3AB9A 1II3A 1STBA 1A3UA 4ULLA 5K5PA 2RBMA 2LMCB 5IGFA 4XQJA 1KLUD 4QB4A 3IKJA 3HRZC 1BOSA 4J1MA 4RKLA 1GUWA 1EU4A 1H9SA 1E2WA 2NZ1D 1ZYRD 1QNKA 5A2QE 4KMUC 3C1FA 5I9OA 2J7ZA 2M00A 4DN4M 5DNFA 5M3FB 1KABA 1JOKA 1BO0A 1Y69U 3I90A 3GTMB 4KJOA 4I65A 4KKTA 1IYUA 3KLSX 3M4OB 1OXVA 4IUTA 2F1MA 5C0XG 2PPBC 4KN4C 3S1RB 1SYEA 1LTSD 1IKLA 1F2ZA 3S9WA 2I46A 3DMUA 4TSSA 1W6JA 1CI3M 2XSCA 2K32A 2OF1A 2F3VA 1XX8A 1U4RA 5I6YA 1LTGD 1LTAD 2KJXA 5CGKA 4HTHA 2JA6B 1LO5D 1E2VA 1FGBD 1BF4A 3A55A 1ZYRC 5M5WB 3OMGA 4BS9A 5IGDA 1EWCA 3J81L 5CV5A 5JVH3 2B39A 4U68A 2JA5B 2K5DA 2B8FA 2KCNA 3PUWA 2PZUA 1AN8A 1X3PA 4DAVA 1B9MA 1NUCA 5D3IB 4UAIA 1MD2D 1Q90A 2BA1A 3NQIA 3ERQA 2B8GA 5KYIA 3PO2B 1STGA 4FF4A 3RUZA 1STYA 2F0GA 2A69D 1XWEA 4KKSA 1S5DD 2F0IA 5AFWA 2K6AA 2JP1A 4IALA 3V96A 4C3HB 1S4ZA 5IODA 1ZEQX 1M8AA 4QF4A 2F3WA 2F0UA 1X32A 4RH6A 1LT4D 3ITPA 4C3JB 3ND8A 1CA5A 1PYWD 1TIID 4XYQA 1QCBD 5CV6A 1EFID 2CVRA 3T16A 2DNCA 1B3AA 1GUNA 2QF7A 4BA1I 5D3DA 4O42A 4RHRA 1HA6A 4RCOA 2QEJC 4RGTA 2JEBI 3IAYA 2K33A 1KTKA 4HN7A 1LT3D 4JBWA 4HSVA 4H0LC 2F0QA 1T5EA 2EYLA 1WTOA 1ML0D 2A69C 2XRQD 2AWOA 4FNFA 2RDHA 3DUZA 2K03A 4K2KA 3CRLC 4DAPA 3S2HB 3CKIB 2RDFA 4XT1B 5BN3A 2EYJA 3JAML 4EQOA 2F0VA 4X3UA 3RZOB 1H9KA 1MBYA 4DK1A 2RSOA 1BR9A 5FLXL 1V1PB 2Y0SB 4FF1A 5C0XJ 3D3RA 1GHJA 3HEJA 1Y8PB 1MI2A 5IGGA 4A3EB 2L4NA 4PMBA 1PZKD 1B4OA 2EY6A 2K1BA 4HMIA 2BA0A 5C4XB 3QG1A 1I4GA 2I07B 4FF3A 4EVOA 3N6RA 2WINB 3TBIB 1RKNA 3HOVB 2Z1CA 1WTVA 2A6HD 5I2XA 4UDUC 1ENCA 1A2TA 3A7AB 3PO3B 1U4LA 3J7AV 1EQVA 2C9OA 3OW7A 3SDZA 3VR4A 1EY5A 2H1EA 4HMJA 1U4MA 1F2LA 3I4MB 3KF8A 4B08A 2GA4B 3OHXC 3TZUA 1B44D 3GO5A 3BYYB 1FNVA 3I72A 5FO9B 3P1HA 5C4JB 1V43A 4PV1C 5EGTA 1VF7A 3R3OA 5T1GA 3BZDB 2YU9B 2B2UC 3HOUB 5HGTA 4CKBA 2ICEC 2FMMA 4PQXA 1TQOA 2IX1A 2VXWA 5KNDA 4IFDI 4K6DA 5K36G 3J80E 1OO9B 2NN6H 3OIQA 4XTCS 4OO1H 1DZ1A 4FVMA 2A6HC 2E2IB 1XYIA 2J0TD 2XNAC 5CBAE 3T13A 4J8QA 1DYQA 3EJIA 4HCEA 1PRTB 3M3YB 1G2TA 3DWAA 2PCFB 2LFNA 1EOTA 1I50B 1HUMA 1CTMA 5IT9L 1CZWA 3DWQA 1JQYD 2EPBA 1R9TB 1STNA 2E2JB 1PZJD 1VF5C 4XQNA 2B2WA 3GD7A 4RA8A 2E2DC 2WIIB 2F4IA 2NTTA 2EZVA 3L3OC 2EYFA 3NTKA 3ZYYX 2CQAA 2AQ3B 1WD1A 4E6IA 3GTOB 1EYAA 2WKCA 2Q8RE 1EL0A 1SYDA 2PNRC 2H4OA 1LT6D 4CJ1B 1SJHD 1OXSC 3T56B 2IT1A 4QIWB 5IGBA 3WDNA 1CFMA 3VR2A 2KEDA 3H3VC 3TP8A 4K5VA 2KOLA 1SNMA 4LMQD 3C1EA 1BBXC 2EVBA 2JEAI 4KV6A 1UAPA 2K28A 3RMHA 4CKEA 1R4QB 2EJFC 1SNCA 4O1NA 5A2QL 5KRUA 4IFDG 4RKBA 5ELCA 1RTOA 3FEWX 4ZUIA 1PTOB 4AYBB 1RF2D 5CORA 4L6TB 2O5IC 3U9OA 1K8MA 2OT2A 4KD4A 1IL8A 4H13C 5CR3A 5EKKA 5EKLA 3KBGA 1G8ZD 4QUFA 1SFOB 3K59A 2EOTA 5A35A 1FD7D 2SEBD 3KLSA 1JORA 3QO2A 5C5MA 2ENBA 1UUPA 3J7YW 5EPLA 2PYKA 2AQ2B 2OEOA 1D2BA 1EQTA 4C1NI 2R92B 3SXHA 3E0JA 2AQ1B 4C3HG 4OIJA 1PRTF 1GUTA 2IX0A 3K58A 3CRKC 5C3EB 1MSGA 1ILPA 1UEAB 4IUUA 2F0TA 4C3JG 3GTKB 2A5HA 4L63B 1LLRD 3AU7A 2G9HD 1PXUA 3MWYW 1EY6A 3SK4A 1R4PB 1U4PA 3BG3A 3GTLB 1EY8A 3HG9A 4HR7B 3V05A 5FOBB 1OXTA 1DONA 5CYUA 1ICWA 3MFYA 3CU7A 5DEHA 1KDAA 4DK0A 2KQ3A 2N88A 3PUZA 5D65A 2KCCA 2A6ED 4DA2A 5HURA 5FO7B 1TS3A 3URYA 1TR5A 4F8MA 3TDQA 3VR6A 1F9QA 3DEPA 3SEBA 1UNSA 3K5LA 4KY5A 4CJ2C 1MSHA 3HOZB 3A7LA 2R61A 1I4RA 4K5WA 2FMCA 1WD0A 2XN9C 1G6ZA 4IUVA 4HEDA 1EIGA 4BA2I 4R8NA 3CQZB 3KBXA 3OWEB 1XXGA 2XRSD 3M4YA 4WFN3 4X3SA 1BXTA 1PTOF 3K57A 1TWFB 4DXGA 1HTPA 1AP0A 4KI0A 3M7GA 4IURA 1NSNS 1JB3A 1PFBA 4IFDJ 3EA6A 1AZPA 1S5ED 1JE4A 4XYOA 2ICIA 2CW0C 2A6EC 4B9XA 4ZQ3A 5FKAC 4XT3B 2L5TA 3R8BA 1PRTD 1JR0D 1TY2A 5I4DA 1GXDC 3Q6SA 2HCIA 3NTHA 2ID0A 1BCPB 1B9NA 3Q24A 2IL8A 3GQBA 5EBCA 1TS2A 2O4XA 5IGEA 2R7ZB 1LT5D 1M4VA 1VMCA 4K5XA 5DM73 5I9PA 2JE6I 2N55A 4M1UB 2NTSA 2B2TA 1TWHB 4RGMA 1GJXA 4EQNA 4RWSC 3NQTA 1Q12A 1RHPA 1SAPA 2RA4A 3HZXA 1CQVA 4YIJA 3EFXD 1FR3A 4WJWA 5ELFA 3TN2A 2NVYB 1EU3A 1E2ZA 2A73B 5J1ZA 3ONAB 4EGVA 3X3NA 4CGYB 3A8IE 2K04A 5JPNC 3HKZB 1PRTC 1JOOA 4HSPA 4OGQC 1A15A 2RDGA 1AZQA 1O78A 3K0YA 1I3QB 1PTOD 1SYCA 2PZTA 3R2IA 4RHSA 2LY7A 2B2TC 1EIHA 3SVMA 1DJRD 1QJOA 5CC4A 1B2TA 2NN6I 3RZDB 1LABA 4OO1I 3H94A 3J80L 3PIP3 2PO4A 2JA8B 3S1QB 4MN3A 1JWMD 1HFGA 5D14A 5C4ZA 4BY7B 3VYUA 2PW5A 2IWHA 3S1NB 5JEAH 2B2YA 4FYDA 3PUXA 4S3SA 1TT2A 2EJMA 1U9RA 2L12A 1A6XA 3Q0AA 4BY1B 5CV7A 4HCSA 2E75C 1T5XD 3EROA 1HRJA 1OXXK 3LWUA 1QE6A 3G6JB 2DNEA 2WAQB 4L8JA 1O7LA 1PLFA 2RVLA 2SNMA 3MHBA 3I73A 4DNRB 3NHHA 2L11A 4LAAA 4C1NK 4KD3A 1KDBA 3A54A 4A3FB 1PTOC 2F0JA 2HCCA 2WB1B 4A3IB 1LV9A 1BCPF 2R3ZA 4BBSB 1ET9A 4ID6A 2B2UA 4G57A 2B2YC 4NP5A 1VCIA 1K8OA 1G291 4LK1C 2F0KA 3BDLA 1Q1BA 1TU2B 2HQEA 1I6HB 3VYTA 5BN5A 2KVMA 4N9TA 4C56C 2EE1A 4KN7C 4G7HC 2C5CA 4V0BA 1PMRA 3I8ZA 5FK9C 1JC7A 3I3CA 4A3DB 1H9SB 4NMZA 3C46A 2F0SA 2K5WA 1KNEA 3IFDA 3MAQA 1Q8IA 3SHLA 2NN6G 4OHJA 1Y8OB 2XIWA 3K6OA 1ESRA 4DNTB 3CHBD 4Q0FA 5J39A 3NP8A 1QB5D 2KECA 2F0OA 3HS0C 4JK1C 2DN8A 5DAUA 2PQEA 5C6AA 3D4DA 1FNUA 2NVTB 1I4XA 5TSSA 5M5YB 4ME5A 3VYRA 1BQQT 4M8AA 2X69A 2XWBB 1BNZA 2VB2X 3VA5A 5I6WA 3H0GB 1DM0B 4BBRB 4F88A 1D5ZC 1WTRA 2NYZD 4I7ZC 1CHPD 1J8IA 2EJGC 1HUNA 3MXPA 3KUPA 3C3LA 5EPJA 4A3JB 2F0EA 1STEA 4ZRZA 5C3WA 2QKIC 1DXMA 2MHVA 3TP6A 1KNAA 1Z47A 1QOHA 3RD4A 5ELBA 2IJ0A 2HDMA 3BDOA 3MXGA 3EQLC 5E4WC 4DU9A 4ZYSA 4A3BB 3NSWA 3NK9A 2VUMB 3NTIA 2EY5A 2AWNA 4IUNA 3OSOA 1HPCA 4HAEA 5JAVA 3MFGA 1Q1EA 3GV6A 4KHVA 5BN4A 1JWUD 1WTWA 4KK7A 3BS1A 1QG7A 2DY7A 3QIAA 2V4DA 1CK1A 3R2TA 2WACA 1OXUA 2EY2A 3T51B 4ABNA 2A74C 4ZAIA 4XIGS 1GUSA 4RGOS 1SXTA 3FKIB 3FMCA 4OIKA 1A2UA 1O80A 2L55A 4FXKC 5JOBA 3TZDA 5CV4A 4EQPA 2PW7A 4K14A 1F9PA 1C4QA 4G7ZC 1HFNA 3WOFA 2ZXOA 3BDCA 4IUPA 3FPUB 2JA7B 2QCPX 3IL8A 1DOLA 5CV9A 4B9WA 2ZXRA 2MUYA 1AEXA 3PUYA 1A3VA 5EPKA 1PZID 4C3IB 2O5JC 3W3AA 1GUGA 2BE5D 5KIXA 4K8JA 4A3KB 3E6ZX 3I70A 5C5LA 1HQMC 1TWCB 1SNPA 3K5NA 3GTPB 4KTAA 1FNWA 1TKWB 1B50A 4FXDA 1KAAA 1TVXA 2NBFA 4CJ0B 2K01A 1F9RA 2OXPA 1NCVA 5C44B 4Y7NB 5EJWA 5JVG3 1G91A 1TWGB 3FVQA 3QWNA 3SK6A 2O2LD 1ET6A 1CZGA 2IX3A 3DM1A 1SYGA 2EY1A 3J7AF 3P7JA 1V8QA 1PFNA 1SBBB 1YNNC 5CMDA 2VB3X 1DOKA 4H44C 5EBDA 1EZ6A 3X3MA 3S14B 1V1PA 2QILA 2Z4HA 2FFKB 1ONLA 1GHKA 3D31A 1QWYA 2EXZA 1LTTD 4X3TA 1STAA 2BE5C 2M2LA 1KDCA 4KJNA 1LACA 1Y1WB 5M9OA 2MPMA 2CW0D 2R6GA 2X6GA 4CBVA 3N52A 1F2YA 3HOYB 1HTLD 3SE0A 2PMZB 3NUCA 2L0CA 3NBIA 3H6MA 1L0XB 1JCKB 4K2LA 1SYBA 4TKOB 2XWJB 5LL6S 3K7AB 3OPOA 1EY7A 1IKMA 1QILA 2Q8TA 5LHY1 2EYPA 3NWTA 2B2VA 5J22A 5E4XA 3DEOA 2F0WA 1YNJD 4KY7A 2RSNA 1SE4A 4H7BA 2DY8A 3TMEA 4IQZA 4ZKCB 4K6LA 2Q8IB 2F0MA 4R9WA 3E5SA 3DHQA 1Y1VB 3MEHA 3S1MB 1D5MC 1SEBD 2MGSA 4DF7A 3GP7A 1NAPA 3M7NA 3MXUA 4QCLA 2L9HA 5M3MB 4FP5D 3T53B 2LS01 2F0LA 2KEEA 5NUCA 1RD9D 5EQ0A 1EZ8A 1PDQA 1IYVA 2B2VC 3D6CA 2X6LA 2NVXB 4WRDA 4RFBA 4MIUA 5C0XH 1D5XC 2JYOA 5EKIA 2XVSA 1WCMB 1EY9A 5JPMC 1W6KA 3QOLA 4BWGB 4IUQA 4RAUC 3WOEA 3W2DA 1CT1D 1YNJC 1STHA 3K5MA 3T4AC 2YYZA 1ZKOA 2L1BA 1LTID 4J6HA 4R8IA 4DFAA 3D8GA 1ZXTA 3GTGB 3FRPB 1I6VC 1D1IA 2LKVA 3S17B 2HDLA 1LTBD 1BDOA 4F7XA 3PUVA 4XQQA 2RQXA 4IZ8A 1WTXA 3QOJA 4V190 3PV0A 1ENFA 5I2YA 1DOMA 1H9RA 1Z7TA 2K7VA 5IIFA 2E2HB 1BUVT 1F9SA 5DM63 3PIO3 1EWHA 3S2DB 3SK5A 3G7LA 5FO8B 5KNCA 1ENAA 2BDOA 1CM9A 5JEAG 3SK8A 4FO2A 1O7YA 2EYOA 1I4PA 1HHVA 3V2TA 1Y8NB 1CHQD 1ILQA 2E76C 3GTJB 2J4XA 3R93A 4ZKBB 2MP1A 2TMPA 4DXFA 1JWSD 2K05A 3IFTA 3HOXB 1I4QA 3H91A 2ZXPA 2B63B 4A3MB 5ELDA 5ISRA 4RCNA 3RLFA 5KGUA 2EDGA 3MTSA 3VYSA 2NB0A 2CHBD 1H9MA 5KNBA 2G9DA 1L0YB 1Q3LA 1MGSA 2D62A 1F77A 3DWPA 3M85A 4XDXA 1WTQA 1TWAB 4NKLA 2F0DA 3I91A 4QMGA 1TY0A 2BDNA 1WTPA 1I4HA 2E74C 4CKCA 3J81E 1C8CA 2QDBA 3D4WA 2WV6D 3A56A 3KK7A 2F0NA 1GOZA 1A3TA 1SNDA 1SJED 3H09A 3FPPA 1JOQA 2A68D 3BVZA 1CA6A 4C3IG 3PMFA 1AFPA 3U9SA 2F0FA 4PMCA 1O7ZA 2KA7A 3OOCA 1KLGD 4RGNA 4FF2A 5G3LF 1G2SA 3A8JE 2D9UA 1RTNA 2FHTA 5CBEE 2D2CC 3TP7A 4G7OC 1F2MA 1LTRD 1DD2A 4PNYA 4OO1G 3OWFA 3I4LA 1EYCA 1PTOH 1IHZA 2BCOA 2D5DA 5T1IA 3VR3A 1FYCA 4DAYA 3LNNA 3TSSA 5LL6X 1E0BA 2Z8LA 4ZUJA 2PZWA 5C3XA 2NVQB 3LX0A 4PMWA 4IN3A 1HA5A 1SMYD 4F87A 2HUGA 5COYA 3D6WA 5E3FA 3S16B 3SR1A 5JJZA 2RKSA 3L9AX 4XXEA 2WKDA 4NDXA 2K5QA 3QB3A 3KLRA 2FJ2A 5JEAJ 2A68C 1X3QA 3HGBA 1QNUA 3NBHA 2M9VA 3A8KE 4ODGA 1B1ZA 3JAME 1AW7A 5FLXE 1BCPD 2NUCA 5K36H 1SE3A 5IGCA 1V1OA 2R93B 1NR2A 1SSOA 2IW3A 3NWSA 3MVVA 5E1FA 1H9JA 2F0PA 5C4HA 4FXGC 4ZK9B 1SMYC 3AMUA 2JXMB 1IW7D 3C2PA 3Q22A 5M5XB 3BVGA 4KY6A 1HXYD 5G3LD 3MA2B 4KHZA 3D4RA 4C2MB 2AUJD 4X3KA 3DXJC 1SYFA 3OIPA 1RCVD 2ZT9C 5CV8A 3HOWB 3GV3A 3Q23A 3ND9A 3L7ZC 1EYDA 2EYHA 1EY4A 3P75A 2MJ8A 1SNOA 4Z9CB 1YNND 4P2CB 4A3GB 2SDFA 3MZ5A 1EEFD 1S5CD 2Z4IA 3HP3A 1BCPC 2B2WC 2AUKA 1VDZA 4WORA 5ELEA 5IOCA 4ILWA 2VNUD 4K8IA 1ESFA 4LJZC 2IPKD 3FDTA 1NR4A 3EVQA 1SDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKC B;  2K28 A;  4MN3 A;  3Q6S A;  3P7J A;  4R9W A;  2XIW A;  1WTW A;  1HFG A;  4NW2 A;  1ESR A;  2HCI A;  1PFN A;  1QG7 A;  5D14 A;  2DY7 A;  1GUW A;  1CM9 A;  5CMD A;  1CA6 A;  1MI2 A;  1DOK A;  1RTO A;  2NZ1 D;  1DZ1 A;  2MGS A;  1O7Y A;  1DON A;  1NAP A;  1QNK A;  2B2Y A;  2KEC A;  1NR2 A;  1ICW A;  1O7Z A;  2IL8 A;  5COR A;  2L4N A;  2L9H A;  1XYI A;  1SSO A;  1B53 A;  2J7Z A;  2L12 A;  1HHV A;  1JIC A;  1B4O A;  1G2S A;  2K1B A;  1IL8 A;  2FFK B;  2KEE A;  2N88 A;  5AFW A;  5D65 A;  2JP1 A;  5DNF A;  4DN4 M;  5CBA E;  5EQ0 A;  2D9U A;  1RTN A;  2FHT A;  4ZAI A;  5CBE E;  1G6Z A;  1ROD A;  2FIN B;  1VMC A;  1ILQ A;  1PDQ A;  1BO0 A;  1G2T A;  3I90 A;  3R93 A;  1S4Z A;  4HCS A;  4ZK9 B;  2N55 A;  4X3T A;  4ZKB B;  1HRJ A;  4OIK A;  1F9Q A;  2B2V C;  2MP1 A;  1M8A A;  1O80 A;  2B2T A;  2X6L A;  3DEP A;  1QE6 A;  1X32 A;  1EOT A;  2M2L A;  4IUT A;  3TZD A;  3UI2 A;  2K05 A;  4RWS C;  3F2U A;  1HUM A;  1RHP A;  1SAP A;  2RA4 A;  2X69 A;  1BNZ A;  2JYO A;  2RVL A;  1PLF A;  4CJ2 C;  1IKL A;  1MSH A;  3H91 A;  5EKI A;  4QUF A;  1CA5 A;  1PFM A;  4X3K A;  1F9P A;  5T1I A;  1WTV A;  2MPM A;  1HFN A;  2EPB A;  2EOT A;  2L11 A;  4IUP A;  2X6G A;  4ZLT F;  2NYZ D;  1E0B A;  2CVR A;  3FPU B;  4QUC A;  3TN2 A;  3MTS A;  1WTR A;  1WD0 A;  2B2W A;  4IUQ A;  1J8I A;  1B3A A;  1U4L A;  1DOL A;  3IL8 A;  3LWE A;  4IUV A;  4HED A;  1EIG A;  3N52 A;  4RAU C;  1XX8 A;  4RA8 A;  1HUN A;  3QO2 A;  1U4R A;  3KUP A;  3GV3 A;  2NWG A;  5EPJ A;  2HCC A;  3ONA B;  2KUM A;  5EPK A;  3KBX A;  4O42 A;  1LV9 A;  2R3Z A;  4MHE A;  1J9O A;  4X3S A;  1HA6 A;  5EPL A;  4R8I A;  2HUG A;  2L1B A;  5COY A;  3D6W A;  1Q3L A;  1MGS A;  1ZXT A;  1WVL A;  2K04 A;  1RJT A;  2B2U A;  2MJ8 A;  2B2Y C;  1EQT A;  1KNA A;  2H1E A;  5JJZ A;  1WD1 A;  1U4M A;  2Q8R E;  1VMP A;  1EL0 A;  1F2L A;  4XDX A;  1AP0 A;  1B50 A;  2SDF A;  4HSV A;  1IKM A;  1A15 A;  2Q8T A;  3HP3 A;  4CJ1 B;  4IUR A;  2HDL A;  1WTQ A;  2FJ2 A;  4OIJ A;  1PFB A;  2HDM A;  1BF4 A;  1TVX A;  2B2V A;  2B2W C;  1AZQ A;  1AZP A;  5E4W C;  2KVM A;  4CJ0 B;  2K01 A;  3I91 A;  1WTO A;  1ML0 D;  5E4X A;  1JE4 A;  1MSG A;  1ILP A;  3DEO A;  2BDN A;  2EE1 A;  1WTP A;  1X3Q A;  1WTX A;  1F9R A;  1NCV A;  2B2T C;  2K03 A;  4IUU A;  4U68 A;  1EIH A;  5EJW A;  1C8C A;  3SVM A;  2KED A;  2RSN A;  3I8Z A;  5T1G A;  1G91 A;  1DOM A;  2B2U C;  3I3C A;  4HAE A;  4XT1 B;  2KOL A;  2DY8 A;  3MWY W;  4LMQ D;  1B2T A;  4XT3 B;  3FDT A;  4X3U A;  1NR4 A;  2FMM A;  1BBX C;  1X3P A;  3DM1 A;  1KNE A;  1F9S A;  2RSO A;  4UAI A;  1SDF A;  3G7L A;  3IFD A;  1U4P A;  2VXW A;  3GV6 A; 
#chains in the Genus database with same CATH topology
 1IW7 C;  2EYM A;  4DK6 C;  3H3V H;  1PVO A;  4JC0 A;  1EEI D;  2SOB A;  1YJW A;  3BYT B;  4NW2 A;  5IP9 G;  1X56 A;  3CCU A;  3VR5 A;  4WJ4 A;  1HCZ A;  2V1C C;  1S5B D;  3W1B A;  2HIV A;  3BVM A;  3S15 B;  1PHJ A;  1QZG A;  4IFD H;  2F0H A;  1K0S A;  2F03 A;  1S5F D;  4DGZ A;  5E7N A;  1B53 A;  1SNQ A;  1CQF A;  3UE1 A;  1JIC A;  1GUO A;  1TS4 A;  4A93 B;  3QJY A;  1C48 A;  1RDP D;  2JA6 H;  2BOS A;  1PH1 A;  1NE3 A;  5KEE A;  1ROD A;  1SE2 A;  2FIN B;  3OMC A;  4KHP Q;  2RCN A;  4GZY C;  1U0L A;  3NXW A;  1HQR D;  1DCZ A;  1XTD A;  3TP5 A;  1K83 B;  4U67 3;  5C0X I;  4JCV E;  3CCM A;  4GKK Q;  5M5W H;  2SNS A;  4OX9 Q;  2HQL A;  3UI2 A;  1Q7Y C;  3F2U A;  1PA6 A;  4CHT B;  4KKU A;  2WP8 J;  4CDC C;  5KYL A;  2JA5 H;  1PFM A;  5IT9 E;  2JSO A;  1P16 A;  1TS5 A;  2K52 A;  3P20 A;  4YCW A;  4ZLT F;  4QUC A;  1J5E Q;  3K5O A;  3L0O A;  3LWE A;  3NPP A;  1HNW L;  3MXN A;  4NPS A;  4DR7 L;  2NWG A;  1EY0 A;  4OL7 A;  3GTQ B;  5F2D A;  2KUM A;  1IBM L;  3F1Z A;  4R4I A;  1PV4 A;  2KHS A;  4MHE A;  1J9O A;  3AFQ A;  3PO2 H;  2TSS A;  3J81 c;  1J6Q A;  1D1K A;  4Q5V A;  2Z9H A;  3GDE A;  1WVL A;  1RJT A;  1K73 C;  4TRD A;  1VMP A;  4N9P A;  1RL2 A;  1Z6H A;  2PQA A;  1KRS A;  3NE5 B;  3O13 A;  4NXM L;  3RLN A;  3VA7 A;  1S3O A;  4TQU S;  4C3H H;  2NVY H;  1D6E C;  3NEM A;  3TRE A;  3I4N B;  4GLV B;  4G4K A;  2ZJR A;  1XTC D;  3MC0 B;  3AB9 A;  1II3 A;  3HOX G;  1STB A;  1A3U A;  4ULL A;  2Q2I A;  5K5P A;  4C3J H;  3PSI A;  1Q8K A;  2RBM A;  2B63 G;  4GKJ Q;  2LMC B;  5IGF A;  4A3M G;  1Q86 C;  4OWW B;  4XQJ A;  4QGU A;  3FHW A;  2E8G A;  2I5M X;  4AH6 A;  1KLU D;  1PYB A;  4QB4 A;  3IKJ A;  3HRZ C;  1Q46 A;  4LF8 L;  1BOS A;  2UXB Q;  2Z6K C;  4J1M A;  4RKL A;  1GUW A;  1EU4 A;  1H9S A;  5LMN L;  4LFB Q;  1E2W A;  2NZ1 D;  1ZYR D;  1SMX A;  1QNK A;  5A2Q E;  4KMU C;  3C1F A;  1B70 B;  5I9O A;  2Q2H A;  4QIW E;  2J7Z A;  2M00 A;  4DN4 M;  5DNF A;  5M3F B;  1YNX A;  1KAB A;  2UUC Q;  1JOK A;  1ASZ A;  1BO0 A;  5GRO A;  1Y69 U;  3I90 A;  3GTM B;  4KJO A;  4I65 A;  4KKT A;  1N8R C;  2CH4 W;  1IYU A;  2RHQ B;  3KLS X;  3M4O B;  4POF A;  1OXV A;  4LFC Q;  4IUT A;  2F1M A;  3PF4 A;  5C0X G;  5FLM G;  1CKM A;  4DV0 Q;  2PPB C;  4KN4 C;  3VDY A;  3S1R B;  1SYE A;  1LTS D;  1IKL A;  1F2Z A;  4O2D A;  3S9W A;  2I46 A;  4DR3 Q;  3DMU A;  4JI6 Q;  4B3R L;  3CC4 A;  4AYB E;  4TSS A;  1W6J A;  1CI3 M;  1PH2 A;  2XSC A;  3RZO H;  2B29 A;  2K32 A;  2OF1 A;  2F3V A;  3CMA A;  1XX8 A;  1U4R A;  3I4O A;  4DNI A;  5I6Y A;  4JBK A;  3AQQ A;  1LTG D;  2UUB Q;  4YWL A;  1LTA D;  1QUQ B;  3KOJ A;  2KJX A;  2CWP A;  5CGK A;  4A3E H;  4HTH A;  2JA6 B;  3AEV A;  1LO5 D;  1E2V A;  2UU9 Q;  1FGB D;  4N8X 1;  1BF4 A;  5C4X H;  3A55 A;  4DR5 Q;  2D0P A;  1ZYR C;  4A3F H;  5M5W B;  3OMG A;  4BS9 A;  1QVG A;  3UE0 A;  5IGD A;  1EWC A;  3OTO L;  3J81 L;  4Y52 H;  5CV5 A;  5IYD G;  5JVH 3;  2B39 A;  3KFU A;  4U68 A;  1VQ7 A;  2JA5 B;  2K5D A;  2B8F A;  2KCN A;  3PUW A;  1VQ9 A;  2PZU A;  1AN8 A;  3HOV H;  1X3P A;  4DAV A;  1B9M A;  1NUC A;  5D3I B;  4JI0 Q;  4UAI A;  1MD2 D;  4UHV A;  5IYB G;  1Q90 A;  2BA1 A;  3NQI A;  3ERQ A;  2B8G A;  5KYI A;  1VQG A;  3PO3 H;  1QVC A;  1EYG A;  3PO2 B;  1LM0 A;  1STG A;  4FF4 A;  3RUZ A;  1STY A;  2F0G A;  2A69 D;  1XNR Q;  1XWE A;  4KKS A;  1S5D D;  2F0I A;  5AFW A;  2K6A A;  2JP1 A;  2K75 A;  4IAL A;  3V96 A;  3I4M H;  1SN8 A;  4C3H B;  3A5Z B;  1JJ2 A;  4JPB W;  3J81 i;  1S4Z A;  4DV7 Q;  5IOD A;  4NXN Q;  1ZEQ X;  1XMQ Q;  1M8A A;  4H02 A;  4QF4 A;  2F3W A;  2F0U A;  1X32 A;  4RH6 A;  1LT4 D;  3ITP A;  4C3J B;  4R4T A;  4YHH Q;  3RN2 A;  3ND8 A;  1CA5 A;  4UPA A;  1PYW D;  1TII D;  4XYQ A;  1JJG A;  2YU9 H;  3HOU H;  1QCB D;  2QW7 A;  5CV6 A;  1EFI D;  2CVR A;  3T16 A;  2DNC A;  1B3A A;  2YTY A;  1GUN A;  2QF7 A;  3TEH B;  4HJ9 A;  1FJG L;  4BA1 I;  4YY3 L;  5D3D A;  4O42 A;  4RHR A;  4GOP C;  1HA6 A;  1UEB A;  4RCO A;  1VQO A;  2R93 G;  3I55 A;  1HR0 Q;  2QEJ C;  4RGT A;  5H1S E;  2JEB I;  2E2I H;  3IAY A;  2K33 A;  1KTK A;  1X65 A;  4HN7 A;  4AIM A;  1LT3 D;  4JBW A;  4HID A;  1Q81 C;  3ICE A;  2CKZ B;  4HSV A;  4BBR H;  5IYC H;  5IP7 H;  4H0L C;  2F0Q A;  1KQS A;  1T5E A;  2EYL A;  1WTO A;  1ML0 D;  1X6O A;  2A69 C;  2XRQ D;  2AWO A;  4FNF A;  4P74 A;  2RDH A;  1M1K C;  3DUZ A;  1UE7 A;  2K03 A;  4K2K A;  3CRL C;  1I50 H;  2MNA A;  4DAP A;  3S2H B;  4DV3 Q;  3CKI B;  2RDF A;  4XT1 B;  5BN3 A;  2EYJ A;  3JAM L;  1G6P A;  4EQO A;  2F0V A;  1H95 A;  4X3U A;  3RZO B;  1H9K A;  1MBY A;  4DK1 A;  2RSO A;  1R9T H;  1BR9 A;  2E2J H;  5FLX L;  1V1P B;  3HOW G;  2Y0S B;  4FF1 A;  5C0X J;  3IRB A;  3D3R A;  1GHJ A;  1ICF B;  2P5Z X;  3HEJ A;  1Y8P B;  1MI2 A;  5IGG A;  1YVC A;  4JI1 L;  1N34 Q;  4A3E B;  2PNH A;  2L4N A;  4PMB A;  2OTL A;  2HIX A;  1PZK D;  1B4O A;  2EY6 A;  2K1B A;  4RG1 A;  4A3G G;  5IY0 A;  3GTO H;  4HMI A;  2BA0 A;  4JOI C;  5C4X B;  3QG1 A;  2E5L L;  1I4G A;  4LFA Q;  2I07 B;  2JJQ A;  2K50 A;  4AQY Q;  4FF3 A;  1X3F A;  4EVO A;  3N6R A;  2WIN B;  3U4V A;  3TBI B;  1Q82 C;  2GN5 A;  1RKN A;  3HOV B;  2Z1C A;  3KF6 A;  1WTV A;  2A6H D;  5I2X A;  4UDU C;  1ENC A;  2VQF L;  4A75 A;  1A2T A;  2CH4 A;  3A7A B;  3G71 A;  3PO3 B;  3NEL A;  1U4L A;  3J7A V;  1VQM A;  1EQV A;  2C9O A;  1VS0 A;  3OW7 A;  3SDZ A;  1E1O A;  2HHH L;  3VR4 A;  4P75 A;  1EY5 A;  2AKW B;  2EQS A;  2H1E A;  4A4I A;  4HMJ A;  1U4M A;  1F2L A;  3I4M B;  4A93 G;  3KF8 A;  4B08 A;  2GA4 B;  3OHX C;  3TZU A;  1B44 D;  3GO5 A;  3BYY B;  1FNV A;  3I72 A;  4PZ8 A;  5JJI A;  2ZJP A;  5FO9 B;  3P1H A;  5C4J B;  1V43 A;  4PV1 C;  3CC2 A;  2AHO B;  3A0J A;  5EGT A;  1VF7 A;  4YCV A;  1HNW Q;  3R3O A;  5T1G A;  4DR7 Q;  3BZD B;  2YU9 B;  2B2U C;  3HOU B;  5HGT A;  4CKB A;  1IBM Q;  2ICE C;  1SFO H;  3ULP A;  2FMM A;  4PQX A;  3H15 A;  1TQO A;  2JA9 A;  2IX1 A;  1T9H A;  3HKZ E;  2VXW A;  5KND A;  4IFD I;  4K6D A;  2LSS A;  5K36 G;  3J80 E;  1OO9 B;  2OCE A;  1C0A A;  5GAD C;  2NN6 H;  3OIQ A;  2RF4 A;  2K4K A;  4XTC S;  4OO1 H;  1DZ1 A;  1S72 A;  4NXM Q;  4FVM A;  1IBL L;  1VQN A;  2A6H C;  3A74 A;  4Y7N H;  1GM5 A;  2E2I B;  1XYI A;  2J0T D;  2XNA C;  1EWI A;  5CBA E;  3CME A;  3T13 A;  2R92 H;  3HKS A;  4J8Q A;  1DYQ A;  1U5K A;  3EJI A;  4LUO A;  4HCE A;  1E22 A;  1PRT B;  3M3Y B;  1G2T A;  3DWA A;  1LYL A;  2PCF B;  2LFN A;  1WYD A;  3I4N G;  5C3E H;  1EOT A;  1K0R A;  1I50 B;  1HZB A;  1HUM A;  1CTM A;  5IT9 L;  1CZW A;  3DWQ A;  4LF8 Q;  4DAM A;  1JQY D;  2AMC B;  2EPB A;  1WTH A;  3B6Y A;  4DV2 L;  1R9T B;  1STN A;  2E2J B;  1PZJ D;  1VF5 C;  4XQN A;  2B2W A;  3E0E A;  3GD7 A;  4RA8 A;  1VQA A;  2E2D C;  2WII B;  3GTL H;  4IPD A;  2F4I A;  2NTT A;  2NZH A;  2EZV A;  3L3O C;  2EYF A;  3NTK A;  3ZYY X;  2CQA A;  4GNX A;  4A76 A;  1K28 A;  2AQ3 B;  1WD1 A;  4E6I A;  3GTO B;  1EYA A;  2WKC A;  4OWT B;  2Q8R E;  1EL0 A;  5M3F G;  1SYD A;  1HNX L;  3F2C A;  2OQ0 A;  2PNR C;  2H4O A;  1LT6 D;  4LF5 L;  3BZC A;  4CJ1 B;  1SJH D;  1OXS C;  3CF5 A;  1VQB A;  4B3R Q;  3T56 B;  2IT1 A;  2K5N A;  4QIW B;  5IGB A;  3WDN A;  3CCQ A;  1CFM A;  2XTI A;  3VR2 A;  1UE5 A;  2KED A;  2QDL A;  3H3V C;  2WB1 E;  3TP8 A;  1VQD A;  4K5V A;  2KOL A;  1SNM A;  3G48 A;  4LMQ D;  4LF6 L;  1GKH A;  4ME3 A;  3C1E A;  1BBX C;  2EVB A;  2JEA I;  4KV6 A;  1UAP A;  3BU2 A;  2K28 A;  3RMH A;  3WWV A;  4CKE A;  1R4Q B;  2EJF C;  1SNC A;  4O1N A;  3CQZ H;  5A2Q L;  5KRU A;  4IFD G;  2XGT A;  4RKB A;  5ELC A;  1RTO A;  3FEW X;  4ZUI A;  1PTO B;  4AYB B;  1RF2 D;  2ATW A;  5COR A;  4L6T B;  4R4O A;  2O5I C;  3U9O A;  1K8M A;  2OT2 A;  4KD4 A;  2MO1 A;  2JA6 G;  1IL8 A;  4H13 C;  5CR3 A;  1S40 A;  4CDF C;  5ELO A;  4X62 L;  4PZ7 A;  1E7Z A;  1I5F A;  5EKK A;  5EKL A;  2DJF C;  2JA5 G;  5LMU L;  4JBJ A;  3KBG A;  1G8Z D;  4QUF A;  3TS2 A;  1SFO B;  1MJE A;  3K59 A;  2EOT A;  3UDG A;  2YV5 A;  1MIU A;  5A35 A;  2UUA L;  1FD7 D;  4JG2 A;  2SEB D;  3KLS A;  1UWV A;  5FJ8 H;  1JOR A;  2OWO A;  3QO2 A;  5C5M A;  1EQR A;  3KJP A;  3PO2 G;  1N9W A;  2ENB A;  1UUP A;  3J7Y W;  2EIF A;  5EPL A;  2PYK A;  3PIO A;  2N49 A;  2AQ2 B;  2Z0S A;  2OEO A;  1D2B A;  1EQT A;  4C1N I;  2R92 B;  4JI5 L;  3SXH A;  3E0J A;  2N78 A;  2AQ1 B;  2R7Z H;  3KLW A;  4C3H G;  2VZA A;  4OIJ A;  1N33 L;  1PRT F;  1GUT A;  2Z6K A;  2IX0 A;  3K58 A;  3CRK C;  5C3E B;  1C7Y A;  1MSG A;  1ILP A;  1UEA B;  4FDB A;  1TWH H;  4IUU A;  2F0T A;  1W3S A;  4C3J G;  3GTK B;  3PIP A;  4B3M L;  2A5H A;  4L63 B;  1FJG Q;  1LLR D;  3AU7 A;  4YY3 Q;  2G9H D;  1PXU A;  3MWY W;  1EY6 A;  3SK4 A;  1R4P B;  1YHQ A;  1U4P A;  3BG3 A;  3UDF A;  2G5D A;  3GTL B;  1EY8 A;  3KF6 B;  3HG9 A;  4HR7 B;  2H5X A;  3V05 A;  5FOB B;  1OXT A;  1DON A;  5CYU A;  1ICW A;  3MFY A;  3CU7 A;  5DEH A;  1KDA A;  4DK0 A;  2KQ3 A;  3PUZ A;  2N88 A;  3MEF A;  5D65 A;  2KCC A;  4MTN A;  2A6E D;  1XMO L;  1V9P A;  4DA2 A;  5HUR A;  3S2D H;  5FO7 B;  1TS3 A;  3URY A;  1HZC A;  1TR5 A;  4F8M A;  4DK3 C;  3TDQ A;  3VR6 A;  1F9Q A;  4DAY B;  3DEP A;  3SEB A;  1L1O B;  2F52 A;  1UNS A;  1I3Q H;  3K5L A;  2OTJ A;  4KY5 A;  4CJ2 C;  1MSH A;  3HOZ B;  3CC7 A;  1NMF A;  3A7L A;  4LNQ A;  2Q2U A;  4BXX H;  2R61 A;  1VQ6 A;  1I4R A;  4JI1 Q;  4K5W A;  2FMC A;  3RZD H;  1WD0 A;  2XN9 C;  2BH2 A;  1G6Z A;  4IUV A;  4HED A;  1EIG A;  4BA2 I;  2Y0S G;  4R8N A;  2JA8 H;  3S1Q H;  3CQZ B;  3KBX A;  3OWE B;  1XXG A;  2XRS D;  1X3E A;  3M4Y A;  4X3S A;  4WFN 3;  4BY7 H;  1BXT A;  1VQJ A;  1PTO F;  3K57 A;  3S1N H;  4A3E G;  1XJV A;  2E5L Q;  1TWF B;  4X66 L;  4JYA L;  4DXG A;  4X65 L;  1PH6 A;  1HTP A;  1NJI C;  1AP0 A;  4A3M H;  4KI0 A;  5C4X G;  3DM3 A;  3M7G A;  5LMN W;  4IO9 A;  4IUR A;  1NSN S;  3NBH B;  1JB3 A;  1PFB A;  4IFD J;  3EA6 A;  1AZP A;  4BY1 H;  1N32 L;  1S5E D;  1JE4 A;  1YEZ A;  2VQF Q;  3A5U A;  4GN4 B;  2R7F A;  4XYO A;  2ICI A;  1PYS B;  2CW0 C;  2A6E C;  4B9X A;  4HIO A;  3HOV G;  4ZQ3 A;  5FKA C;  4LWC A;  4XT3 B;  2L5T A;  2HHH Q;  3R8B A;  1PRT D;  1JR0 D;  3KDF A;  3JAM c;  1TY2 A;  2I5H A;  4HJA A;  4IOA A;  5I4D A;  1GXD C;  3Q6S A;  2HCI A;  5FLX c;  3NTH A;  2ID0 A;  4OXP A;  1BCP B;  1B9N A;  4UP8 A;  3Q24 A;  4A3I H;  4BBS H;  1HZ9 A;  1KL9 A;  2IL8 A;  2A1A A;  3GQB A;  5EBC A;  1TS2 A;  5BR8 Q;  2O4X A;  3I4M G;  1K8G A;  5IGE A;  2R7Z B;  1EQQ A;  4GNX B;  2MQH A;  1LT5 D;  1M4V A;  1VMC A;  4K5X A;  5DM7 3;  5I9P A;  3K81 C;  3CW2 C;  2JE6 I;  2N55 A;  4M1U B;  2NTS A;  1I6H H;  4GOP A;  2B2T A;  1TWH B;  4RGM A;  1KAW A;  1GJX A;  4EQN A;  4RWS C;  1N36 Q;  3NQT A;  1Q12 A;  1RHP A;  1SAP A;  2RA4 A;  3HZX A;  1CQV A;  4JI3 L;  4DPG A;  1GO3 E;  3HOU G;  4YIJ A;  3EFX D;  1FR3 A;  4A3D H;  4WJW A;  1IBL Q;  1CKO A;  5ELF A;  3TN2 A;  4DUY L;  1B7Y B;  2NVY B;  1EU3 A;  1E2Z A;  2A73 B;  5J1Z A;  3ONA B;  1GVP A;  3TRZ A;  4EGV A;  3X3N A;  4CGY B;  5IYD H;  3A8I E;  1FL0 A;  2K04 A;  5JPN C;  3HKZ B;  1PRT C;  3ERS X;  1CSQ A;  1JOO A;  4R4Q A;  4HSP A;  1LTL A;  5IP7 G;  4OGQ C;  1A15 A;  4A3L H;  4JI7 L;  2NVT H;  5IYB H;  1VQE A;  2RDG A;  1AZQ A;  4DR6 L;  3ULL A;  1O78 A;  3K0Y A;  5M5Y H;  4DV2 Q;  1I3Q B;  1PTO D;  1SYC A;  2PZT A;  3R2I A;  4RHS A;  2LY7 A;  1L2F A;  2B2T C;  1EIH A;  3SVM A;  1DJR D;  1QJO A;  4EQ5 A;  5CC4 A;  2PMZ E;  1B2T A;  4JOI A;  2NN6 I;  3RZD B;  1LAB A;  4QY7 A;  3H94 A;  3H0G H;  5J3B A;  4OO1 I;  3J80 L;  3PIP 3;  2ES2 A;  2PO4 A;  4ZCK A;  2JA8 B;  3S1Q B;  4MN3 A;  2K5V A;  1O7I A;  1JWM D;  2L15 A;  1HFG A;  5D14 A;  5C4Z A;  4BY7 B;  1HNX Q;  2VS1 A;  4LF5 Q;  3VYU A;  2PW5 A;  2IWH A;  4A3J H;  3S1N B;  5JEA H;  1VQ8 A;  2B2Y A;  4MNO A;  4FYD A;  3PUX A;  1XPU A;  4JI4 L;  4S3S A;  1TT2 A;  5JJK A;  2EJM A;  1U9R A;  2L12 A;  4OWX B;  3CCE A;  1A6X A;  1HJP A;  3Q0A A;  4BY1 B;  2R7D A;  2YTX A;  3RR5 A;  5CV7 A;  4HCS A;  4OEL B;  2E75 C;  1T5X D;  3ERO A;  1HRJ A;  1OXX K;  4LF6 Q;  4EX5 A;  3LWU A;  4A3B H;  1QE6 A;  3G6J B;  2DNE A;  2WAQ B;  1YHA A;  4L8J A;  2VUM H;  1O7L A;  1PLF A;  2RVL A;  3MXN B;  2SNM A;  3MHB A;  3EIV A;  3I73 A;  5IT9 c;  4DNR B;  3NHH A;  2L11 A;  4HIM A;  4GLA C;  4LAA A;  4C1N K;  4KD3 A;  1KDB A;  3A54 A;  4A3F B;  1PTO C;  4GS3 A;  4R1J A;  2F0J A;  3PGZ A;  1V1Q A;  1SRO A;  2HCC A;  2WB1 B;  4A3I B;  1LV9 A;  1BCP F;  2R3Z A;  2PQA B;  1EFW A;  4BBS B;  1ET9 A;  4X62 Q;  4AYB G;  4ID6 A;  1XPO A;  3JAM i;  2B2U A;  4G57 A;  1FGU A;  2B2Y C;  1X3G A;  4NP5 A;  2K14 A;  5JJL A;  1RIP A;  1VCI A;  1K8O A;  1G29 1;  4LK1 C;  2F0K A;  1YBY A;  5LMU Q;  3BDL A;  1Q1B A;  1TU2 B;  2HQE A;  1I6H B;  3VYT A;  5BN5 A;  2KVM A;  4N9T A;  4C56 C;  3FKI H;  2EE1 A;  4KN7 C;  4P71 A;  4G7H C;  1KIX A;  3EN2 A;  2UUA Q;  2C5C A;  3HFZ B;  1VQC A;  1KD1 C;  4V0B A;  2Z6B A;  1PMR A;  3I8Z A;  5FK9 C;  1JC7 A;  5IE8 A;  3I3C A;  3F8T A;  4A3D B;  1H9S B;  1JJC B;  1G51 A;  4NMZ A;  3C46 A;  1VQH A;  2F0S A;  2K5W A;  1BVS A;  1KNE A;  3IFD A;  3MAQ A;  4RMF A;  1Q8I A;  3SHL A;  1KC8 C;  2JA7 H;  2NN6 G;  4OHJ A;  1Y8O B;  2XIW A;  3K6O A;  1ESR A;  4DNT B;  3CHB D;  4X64 L;  4JI5 Q;  4Q0F A;  5J39 A;  5BR8 L;  3NP8 A;  1N33 Q;  1AE2 A;  4C3I H;  1QB5 D;  2KEC A;  2F0O A;  3HS0 C;  4JK1 C;  2DN8 A;  5DAU A;  1Z9F A;  4A3K H;  2R92 G;  2PQE A;  1TWC H;  5C6A A;  1A8V A;  2K5H A;  3D4D A;  1JB7 A;  1FNU A;  3GTP H;  2NVT B;  2CWA A;  4B3M Q;  3EBE A;  1CSP A;  1I4X A;  5TSS A;  1N36 L;  5M5Y B;  1BBU A;  4GN3 B;  3CCR A;  4ME5 A;  4LF9 L;  5C3E G;  3VYR A;  1BQQ T;  4M8A A;  5C44 H;  2X69 A;  2KHI A;  2XWB B;  1BNZ A;  5AJ3 L;  2VB2 X;  1TWG H;  3VA5 A;  1IZ6 A;  5I6W A;  3H0G B;  1DM0 B;  4BBR B;  4F88 A;  1D5Z C;  1WTR A;  2NYZ D;  4OEM B;  4I7Z C;  1CHP D;  1EUJ A;  2PI2 A;  2EJG C;  4P72 A;  1J8I A;  1HUN A;  3UDX A;  3MXP A;  2QA4 A;  3KUP A;  4N8F A;  5GAG C;  3C3L A;  1K83 H;  5EPJ A;  4LW1 A;  4A3J B;  2F0E A;  1STE A;  4ZRZ A;  5C3W A;  2I5L X;  2QKI C;  3CCJ A;  1XMO Q;  4UY8 C;  1DXM A;  2MHV A;  5GAH C;  3S14 H;  4O0A A;  3TP6 A;  1KNA A;  1Z47 A;  3U4Z A;  4DR1 L;  1QOH A;  3T1H L;  3RD4 A;  2GVA A;  4LUV A;  3DLL A;  4HIK A;  2IHE A;  3G6E A;  5ELB A;  2ZM6 L;  2IJ0 A;  2ZJQ A;  2C35 B;  2HDM A;  4IJH A;  3BDO A;  4IPG A;  3MXG A;  3EQL C;  5E4W C;  4DU9 A;  1QUQ A;  2KHJ A;  4ZYS A;  4GN5 A;  4IJL A;  4IOC A;  1VQ4 A;  4A3B B;  3I2Z A;  3PCO B;  3E3X A;  3GTQ H;  3NSW A;  1VQI A;  3NK9 A;  2VUM B;  3NTI A;  2EY5 A;  2AWN A;  4IUN A;  4HJ7 A;  1Y1W H;  3OSO A;  2ALY B;  3HOZ G;  1HPC A;  4HAE A;  4JBM A;  2WAQ E;  5JAV A;  1TXY A;  4JVZ A;  3MFG A;  1Q1E A;  3GV6 A;  1SLJ A;  3K80 C;  4KHV A;  4P73 A;  5BN4 A;  4X66 Q;  1JWU D;  4JYA Q;  4X65 Q;  1XNQ L;  1MJC A;  1WTW A;  4KK7 A;  3BS1 A;  2EXD A;  1QG7 A;  2DY7 A;  3RLO A;  3HOY H;  3I4N H;  3QIA A;  2V4D A;  1CK1 A;  3T1Y L;  3R2T A;  4L5S A;  2WAC A;  3BZK A;  1N32 Q;  2CQO A;  4A3C H;  1OXU A;  1UE6 A;  1JMC A;  2EY2 A;  1HR0 W;  3T51 B;  4ABN A;  2A74 C;  4ZAI A;  4QL5 A;  3K7A H;  4XIG S;  1GUS A;  4RGO S;  1LUZ A;  3M4P A;  1SXT A;  2N3S A;  3FKI B;  3FMC A;  4OIK A;  1A2U A;  1IXR A;  3U50 C;  1W2B A;  1O80 A;  2L55 A;  4FXK C;  5JOB A;  3TZD A;  5CV4 A;  4EQP A;  2PW7 A;  1WFQ A;  4K14 A;  4MZ9 A;  3NEN A;  4APV A;  1F9P A;  1C4Q A;  2LXJ A;  4G7Z C;  1HFN A;  3WOF A;  2ZXO A;  1PH9 A;  3BDC A;  4IUP A;  2RCF A;  3FPU B;  3SGI A;  5FJ8 G;  4POG A;  1JE5 A;  1SR3 A;  2QCP X;  2JA7 B;  3IL8 A;  1DOL A;  5CV9 A;  4B9W A;  4LF7 L;  2ZXR A;  2MUY A;  1AEX A;  1WI5 A;  3PUY A;  1A3V A;  1P8L A;  5EPK A;  1PZI D;  4C3I B;  2O5J C;  3W3A A;  3S1M H;  1Y1V H;  1GUG A;  2BE5 D;  5KIX A;  4K8J A;  1D7Q A;  4A3K B;  3E6Z X;  3I70 A;  5C5L A;  1HQM C;  1E3P A;  1TWC B;  1SNP A;  2VQE L;  5M3M H;  3CXC A;  3K5N A;  3GTP B;  4KTA A;  2R7Z G;  1FNW A;  1TKW B;  1B50 A;  4FXD A;  1KAA A;  4JI3 Q;  1TVX A;  4JI8 L;  2NBF A;  4CJ0 B;  2K01 A;  1I94 L;  4DKA C;  1F9R A;  2OXP A;  1NCV A;  5C44 B;  4Y7N B;  2NVX H;  4DUY Q;  5EJW A;  4YCU A;  5JVG 3;  1G91 A;  1TWG B;  3FVQ A;  3QWN A;  3J7Z C;  3CP0 A;  3SK6 A;  2O2L D;  1ET6 A;  1CZG A;  1WCM H;  2IX3 A;  3DM1 A;  1QZH A;  1VQK A;  1EIF A;  1SYG A;  3U58 A;  2EY1 A;  3J7A F;  3M4Q A;  3P7J A;  1V8Q A;  1PFN A;  3TS0 A;  3BJU A;  1SBB B;  1YNN C;  5CMD A;  5IP9 H;  2VB3 X;  1DOK A;  4H44 C;  5EBD A;  1EZ6 A;  3X3M A;  3S14 B;  4JI7 Q;  4ALP A;  1PH5 A;  4DR6 Q;  1V1P A;  3HKZ G;  2QIL A;  3GTG H;  2Z4H A;  4YWK A;  2FFK B;  1ONL A;  2YTV A;  5IWA L;  1PH3 A;  1GHK A;  1A0I A;  2N8N A;  3D31 A;  1QWY A;  3S17 H;  2EXZ A;  1LTT D;  4X3T A;  1STA A;  2BE5 C;  4LF4 L;  1IBK L;  1NMG A;  2M2L A;  1KDC A;  4KJN A;  4IPH A;  3STB D;  2UXC Q;  1LAC A;  1Y1W B;  5M9O A;  3F2B A;  4JI2 L;  4B3T L;  4DV5 L;  2MPM A;  4BXX G;  2CW0 D;  2R6G A;  2X6G A;  2E2H H;  3PF5 A;  2JA8 G;  4JI4 Q;  4CBV A;  2ZTD A;  3N52 A;  1F2Y A;  2VY3 A;  4B3S L;  3KF8 B;  3HOY B;  4BY7 G;  1HTL D;  3SE0 A;  1CUK A;  2PMZ B;  4DV4 L;  1CKN A;  3NUC A;  2L0C A;  3NBI A;  3H6M A;  1L0X B;  2ZTE A;  1JCK B;  4K2L A;  1SYB A;  3K0X A;  4TKO B;  2XWJ B;  1KXL A;  5LL6 S;  2DUD A;  3K7A B;  3OPO A;  4DR2 Q;  1EY7 A;  1IKM A;  1QIL A;  4DV6 L;  2Q8T A;  5LHY 1;  1BKB A;  4BY1 G;  2EYP A;  3NWT A;  2B2V A;  2QEX A;  1C9O A;  5J22 A;  3GTJ H;  5E4X A;  2IY5 B;  3DEO A;  2F0W A;  2WAQ G;  1YIT A;  1YNJ D;  1OTC A;  4KY7 A;  2RSN A;  1SE4 A;  3HOX H;  2I0Q A;  1UE1 A;  4H7B A;  1PH8 A;  1X54 A;  2DY8 A;  3TME A;  2B63 H;  1ASY A;  4IQZ A;  4ZKC B;  4A3F G;  4K6L A;  2Q8I B;  2F0M A;  3J80 c;  3STB C;  4R9W A;  1HNZ Q;  2WB1 G;  3E5S A;  3CAM A;  3OW2 A;  1E1T A;  4A3I G;  3DHQ A;  1Y1V B;  3MEH A;  3S1M B;  4BBS G;  1A63 A;  1D5M C;  4X6A H;  1SEB D;  2KBN A;  2MGS A;  3GP7 A;  4DF7 A;  4DV1 L;  1NAP A;  3M7N A;  3MXU A;  4QCL A;  2L9H A;  5M3M B;  4FP5 D;  4CDD C;  3T53 B;  2LS0 1;  3S2H H;  2F0L A;  2KEE A;  5NUC A;  1RD9 D;  5DLQ E;  5EQ0 A;  1EZ8 A;  1PDQ A;  4NB3 A;  1IYV A;  3PO3 G;  1TWA H;  4IPC A;  2B2V C;  4PZ6 A;  3D6C A;  2X6L A;  2NVX B;  4WRD A;  3K8A A;  5GAE C;  1VQP A;  1X55 A;  4RFB A;  1WOC A;  4MIU A;  2ASB A;  5C0X H;  5FLM H;  1D5X C;  2JYO A;  5EKI A;  2F4V L;  2XVS A;  4X64 Q;  4A3D G;  2GVB A;  1WCM B;  1EY9 A;  3S24 A;  1EIY B;  2UXD L;  5JPM C;  1W6K A;  3QOL A;  4BWG B;  4UP7 A;  4IUQ A;  4RAU C;  3WOE A;  3W2D A;  1CT1 D;  4QQB X;  4K0K L;  1YNJ C;  4DUZ L;  1STH A;  3W5O A;  3K5M A;  3T4A C;  2YYZ A;  1ZKO A;  2L1B A;  1LTI D;  4J6H A;  4R8I A;  4DFA A;  3D8G A;  1ZXT A;  3GTG B;  5L37 A;  4LF9 Q;  1WJJ A;  3FRP B;  2JQO A;  4A3L G;  1I6V C;  1D1I A;  2LKV A;  3S17 B;  2HDL A;  1LTB D;  1BDO A;  4F7X A;  3PUV A;  5AJ3 Q;  4XQQ A;  2RQX A;  5HGQ A;  2RHS B;  4IZ8 A;  1KHI A;  1NTG A;  4PG3 A;  1SRU A;  1WTX A;  1PH7 A;  3QOJ A;  4V19 0;  3PV0 A;  1ENF A;  1SE8 A;  4KHP L;  5I2Y A;  4HJ8 A;  1DOM A;  1H9R A;  1Z7T A;  2K7V A;  3H0G G;  4BBR G;  5IIF A;  5IYC G;  4GKK L;  2E2H B;  1K3R A;  1BUV T;  1F9S A;  5DM6 3;  4L5Q A;  1EWH A;  3PIO 3;  2CFM A;  3G7L A;  3SK5 A;  5FO8 B;  4OX9 L;  3S2D B;  5KNC A;  4DR1 Q;  3T1H Q;  1ENA A;  2BDO A;  4A3J G;  1CM9 A;  5JEA G;  3M9B A;  2NVQ H;  3SK8 A;  5C4J H;  2ZM6 Q;  4FO2 A;  1O7Y A;  1J5E L;  2EYO A;  3S16 H;  4DR4 Q;  1I4P A;  1YJN A;  1HHV A;  3QR8 A;  3V2T A;  4JV5 Q;  2Q2T A;  1Y8N B;  1CHQ D;  1ILQ A;  2F3I A;  2E76 C;  3GTJ B;  2J4X A;  3R93 A;  5EAY A;  2UXC L;  4ZKB B;  3LGJ A;  4A3B G;  2MP1 A;  2TMP A;  4DXF A;  1JWS D;  2K05 A;  4LUZ A;  2VUM G;  3IFT A;  3HOX B;  1I4Q A;  3D0F A;  1XNQ Q;  4R4C A;  3H91 A;  3ULJ A;  2HD3 A;  2ZXP A;  2B63 B;  4A3M B;  1B8A A;  1NNX A;  5ELD A;  4YWM A;  4RCN A;  5ISR A;  1E24 A;  3RLF A;  3T1Y Q;  2EDG A;  3MTS A;  5KGU A;  2VW9 A;  1K8A C;  3VYS A;  3M3Y H;  3CCV A;  2NB0 A;  1XPR A;  1VQL A;  4GKJ L;  2CHB D;  4GLX A;  1H9M A;  5KNB A;  2G9D A;  4DR2 L;  1L0Y B;  1Q3L A;  1MGS A;  2D62 A;  2R93 H;  2UXB L;  1F77 A;  1GD7 A;  1B3Q A;  3J80 i;  4J15 A;  3DWP A;  3M85 A;  2PI2 E;  4XDX A;  1YI2 A;  4LFB L;  5GQO A;  1WTQ A;  1TWA B;  4NKL A;  2F0D A;  3FKI G;  2JN4 A;  3I91 A;  1EOV A;  4QMG A;  1TY0 A;  2BDN A;  1L0W A;  1WTP A;  1I4H A;  3CD6 A;  2E74 C;  1VQF A;  2UUC L;  4CKC A;  2D0O A;  3J81 E;  1C8C A;  2IHF A;  4LF7 Q;  2QDB A;  5M5X H;  3D4W A;  3CCS A;  2WV6 D;  3A56 A;  3KK7 A;  2F0N A;  1GOZ A;  4C2M H;  1FVI A;  1A3T A;  3FP9 A;  1HNZ L;  4LFC L;  1SND A;  1D8L A;  2JA7 G;  4DV0 L;  1SJE D;  3H09 A;  3HOW H;  3PQI A;  2VQE Q;  4CDE C;  3FPP A;  4DR3 L;  3I56 A;  4JI6 L;  1JOQ A;  4TVA B;  2A68 D;  3BVZ A;  1CA6 A;  4C3I G;  3PMF A;  3JC6 6;  2OQK A;  1AFP A;  3U9S A;  2KEN A;  4JI8 Q;  2F0F A;  4PMC A;  1O7Z A;  2KA7 A;  3OOC A;  4A3K G;  1KLG D;  2ZTC A;  4RGN A;  1I94 Q;  5G3L F;  4FF2 A;  3AYH B;  1G2S A;  1AE3 A;  1CKN B;  3A8J E;  2D9U A;  1RTN A;  2FHT A;  5CBE E;  2UUB L;  4A3G H;  2D2C C;  3TP7 A;  4G7O C;  1KRT A;  1F2M A;  1LTR D;  2VL6 A;  1DD2 A;  4PNY A;  4OO1 G;  4OON A;  2DJG C;  3OWF A;  5C44 G;  2UU9 L;  3I4L A;  1EYC A;  1PTO H;  1AH9 A;  1IHZ A;  2BCO A;  2D5D A;  2A8V A;  2B3G A;  4DR5 L;  4KLK A;  5T1I A;  3VR3 A;  1HZA A;  1FYC A;  4DAY A;  3LNN A;  3TSS A;  1L1O A;  5LL6 X;  2WFW A;  1E0B A;  1YHB A;  3G4S A;  2Z8L A;  4ZUJ A;  1NBW A;  2PZW A;  5C3X A;  1QVF A;  2NVQ B;  3LX0 A;  1JT8 A;  4PMW A;  5IWA Q;  4IN3 A;  1HA5 A;  1SMY D;  4F87 A;  1HH2 P;  2HUG A;  4QJF A;  5COY A;  4JI0 L;  3D6W A;  5E3F A;  3S16 B;  3S15 H;  4MTK A;  3SR1 A;  3KYH C;  3H3V I;  4L5T A;  5JJZ A;  1DGS A;  2RKS A;  3L9A X;  4LF4 Q;  1IBK Q;  1PH4 A;  4XXE A;  2WKD A;  4NDX A;  4A93 H;  2K5Q A;  3J7A 5;  3QB3 A;  3KLR A;  2FJ2 A;  5JEA J;  1IYJ B;  4JI2 Q;  2KCT A;  2DGY A;  4B3T Q;  2A68 C;  4DV5 Q;  1XNR L;  1X3Q A;  3J81 j;  1VQ5 A;  1YIJ A;  3KDF B;  3OYY A;  1Y1W G;  3HGB A;  1QNU A;  3NBH A;  4DV7 L;  2NZO A;  4NXN L;  4B3S Q;  1XMQ L;  3RN5 A;  5HY6 A;  2M9V A;  3A8K E;  4UP9 A;  4ODG A;  1B1Z A;  3F2D A;  4DV4 Q;  3JAM E;  3CPW A;  4L5R C;  3ER0 A;  1L1O C;  2MO0 A;  2CCZ A;  1AW7 A;  4YHH L;  1PFS A;  4HJ5 A;  2A19 A;  5FLX E;  1BCP D;  2NUC A;  3HOY G;  4DR4 L;  5K36 H;  5ELN A;  3E9H A;  1SE3 A;  2HT1 A;  4DV6 Q;  5IGC A;  1K9M C;  1YJ9 A;  1V1O A;  2R93 B;  4JV5 L;  4A3C G;  1NR2 A;  3GTK H;  1K3B C;  1SSO A;  5LMN Q;  2IW3 A;  3NWS A;  4GOP B;  3MVV A;  5E1F A;  2MFI A;  1NY4 A;  1H9J A;  2F0P A;  2QGQ A;  5C4H A;  3AFP A;  4FXG C;  2LXK A;  1IL2 A;  1HR0 L;  4ZK9 B;  1SMY C;  3AMU A;  1MKH A;  2FXQ A;  2JXM B;  1IW7 D;  3C2P A;  3E9I A;  4I7A A;  1M90 C;  3I7F A;  3Q22 A;  5M5X B;  3BVG A;  2Y0S E;  4KY6 A;  1HXY D;  1MHW C;  3MA2 B;  5G3L D;  4KHZ A;  3D4R A;  4C2M B;  2AUJ D;  4X3K A;  3DXJ C;  1SYF A;  3OIP A;  1RCV D;  2ZT9 C;  4DV1 Q;  5CV8 A;  3HOW B;  3GV3 A;  3Q23 A;  3ND9 A;  4DV3 L;  3CCL A;  1Y1V G;  3L7Z C;  1EYD A;  1BBW A;  2EYH A;  1EY4 A;  3RNU A;  3P75 A;  3K7U C;  2MJ8 A;  1SNO A;  1YNN D;  4Z9C B;  3W1G A;  2KCM A;  5M3M G;  4P2C B;  1X9N A;  1A62 A;  4A3G B;  3HOZ H;  3CPF A;  3UDI A;  2SDF A;  3MZ5 A;  1EEF D;  1S5C D;  5M3F H;  2Z4I A;  3HP3 A;  1BCP C;  1N34 L;  2B2W C;  4WJ3 M;  2F4V Q;  1YZ6 A;  2BH8 A;  3KJO A;  3GTM H;  2AUK A;  2UXD Q;  1VDZ A;  4WOR A;  5ELE A;  3M4O H;  2JK8 A;  1Y14 B;  4GNX C;  5IOC A;  3L2P A;  1TWF H;  4K0K Q;  3OTO Q;  3S1R H;  4ILW A;  4LFA L;  2VNU D;  4K8I A;  1WCM G;  4DUZ Q;  3TQY A;  4AQY L;  1ESF A;  4LJZ C;  2IPK D;  3FDT A;  1NR4 A;  3Q8D A;  3EVQ A;  4JW0 A;  1SDF A;  3ZJY C; 
#chains in the Genus database with same CATH homology
 1IW7 C;  2EYM A;  1EEI D;  2SOB A;  3BYT B;  4NW2 A;  3VR5 A;  1HCZ A;  1S5B D;  3BVM A;  3S15 B;  4IFD H;  2F0H A;  2F03 A;  1S5F D;  4DGZ A;  1B53 A;  1SNQ A;  1CQF A;  1JIC A;  1GUO A;  1TS4 A;  4A93 B;  3QJY A;  1C48 A;  1RDP D;  2BOS A;  5KEE A;  1SE2 A;  1ROD A;  2FIN B;  3OMC A;  4GZY C;  3NXW A;  1HQR D;  1DCZ A;  3TP5 A;  4U67 3;  1K83 B;  5C0X I;  2SNS A;  3UI2 A;  3F2U A;  4CHT B;  4KKU A;  2WP8 J;  5KYL A;  1PFM A;  5IT9 E;  2JSO A;  1TS5 A;  3P20 A;  4ZLT F;  4QUC A;  3K5O A;  3LWE A;  3NPP A;  3MXN A;  2NWG A;  1EY0 A;  4OL7 A;  3GTQ B;  5F2D A;  2KUM A;  2KHS A;  4MHE A;  1J9O A;  2TSS A;  1D1K A;  4Q5V A;  1WVL A;  1RJT A;  4TRD A;  1VMP A;  4N9P A;  1Z6H A;  3NE5 B;  3O13 A;  3VA7 A;  4TQU S;  1D6E C;  3I4N B;  4G4K A;  1XTC D;  3MC0 B;  3AB9 A;  1II3 A;  1STB A;  1A3U A;  4ULL A;  5K5P A;  2RBM A;  2LMC B;  5IGF A;  4XQJ A;  1KLU D;  4QB4 A;  3IKJ A;  3HRZ C;  1BOS A;  4J1M A;  4RKL A;  1GUW A;  1EU4 A;  1H9S A;  1E2W A;  2NZ1 D;  1ZYR D;  1QNK A;  5A2Q E;  4KMU C;  3C1F A;  5I9O A;  2J7Z A;  2M00 A;  4DN4 M;  5DNF A;  5M3F B;  1KAB A;  1JOK A;  1BO0 A;  1Y69 U;  3I90 A;  3GTM B;  4KJO A;  4I65 A;  4KKT A;  1IYU A;  3KLS X;  3M4O B;  1OXV A;  4IUT A;  2F1M A;  5C0X G;  2PPB C;  4KN4 C;  3S1R B;  1SYE A;  1LTS D;  1IKL A;  1F2Z A;  3S9W A;  2I46 A;  3DMU A;  4TSS A;  1W6J A;  1CI3 M;  2XSC A;  2K32 A;  2OF1 A;  2F3V A;  1XX8 A;  1U4R A;  5I6Y A;  1LTG D;  1LTA D;  2KJX A;  5CGK A;  4HTH A;  2JA6 B;  1LO5 D;  1E2V A;  1FGB D;  1BF4 A;  3A55 A;  1ZYR C;  5M5W B;  3OMG A;  4BS9 A;  5IGD A;  1EWC A;  3J81 L;  5CV5 A;  5JVH 3;  2B39 A;  4U68 A;  2JA5 B;  2K5D A;  2B8F A;  2KCN A;  3PUW A;  2PZU A;  1AN8 A;  1X3P A;  4DAV A;  1B9M A;  1NUC A;  5D3I B;  4UAI A;  1MD2 D;  1Q90 A;  2BA1 A;  3NQI A;  3ERQ A;  2B8G A;  5KYI A;  3PO2 B;  1STG A;  4FF4 A;  3RUZ A;  1STY A;  2F0G A;  2A69 D;  1XWE A;  4KKS A;  1S5D D;  2F0I A;  5AFW A;  2K6A A;  2JP1 A;  4IAL A;  3V96 A;  4C3H B;  1S4Z A;  5IOD A;  1ZEQ X;  1M8A A;  4QF4 A;  2F3W A;  2F0U A;  1X32 A;  4RH6 A;  1LT4 D;  3ITP A;  4C3J B;  3ND8 A;  1CA5 A;  1PYW D;  1TII D;  4XYQ A;  1QCB D;  5CV6 A;  1EFI D;  2CVR A;  3T16 A;  2DNC A;  1B3A A;  1GUN A;  2QF7 A;  4BA1 I;  5D3D A;  4O42 A;  4RHR A;  1HA6 A;  4RCO A;  2QEJ C;  4RGT A;  2JEB I;  3IAY A;  2K33 A;  1KTK A;  4HN7 A;  1LT3 D;  4JBW A;  4HSV A;  4H0L C;  2F0Q A;  1T5E A;  2EYL A;  1WTO A;  1ML0 D;  2A69 C;  2XRQ D;  2AWO A;  4FNF A;  2RDH A;  3DUZ A;  2K03 A;  4K2K A;  3CRL C;  4DAP A;  3S2H B;  3CKI B;  2RDF A;  4XT1 B;  5BN3 A;  2EYJ A;  3JAM L;  4EQO A;  2F0V A;  4X3U A;  3RZO B;  1H9K A;  1MBY A;  4DK1 A;  2RSO A;  1BR9 A;  5FLX L;  1V1P B;  2Y0S B;  4FF1 A;  5C0X J;  3D3R A;  1GHJ A;  3HEJ A;  1Y8P B;  1MI2 A;  5IGG A;  4A3E B;  2L4N A;  4PMB A;  1PZK D;  1B4O A;  2EY6 A;  2K1B A;  4HMI A;  2BA0 A;  5C4X B;  3QG1 A;  1I4G A;  2I07 B;  4FF3 A;  4EVO A;  3N6R A;  2WIN B;  3TBI B;  1RKN A;  3HOV B;  2Z1C A;  1WTV A;  2A6H D;  5I2X A;  4UDU C;  1ENC A;  1A2T A;  3A7A B;  3PO3 B;  1U4L A;  3J7A V;  1EQV A;  2C9O A;  3OW7 A;  3SDZ A;  3VR4 A;  1EY5 A;  2H1E A;  4HMJ A;  1U4M A;  1F2L A;  3I4M B;  3KF8 A;  4B08 A;  2GA4 B;  3OHX C;  3TZU A;  1B44 D;  3GO5 A;  3BYY B;  1FNV A;  3I72 A;  5FO9 B;  3P1H A;  5C4J B;  1V43 A;  4PV1 C;  5EGT A;  1VF7 A;  3R3O A;  5T1G A;  3BZD B;  2YU9 B;  2B2U C;  3HOU B;  5HGT A;  4CKB A;  2ICE C;  2FMM A;  4PQX A;  1TQO A;  2IX1 A;  2VXW A;  5KND A;  4IFD I;  4K6D A;  5K36 G;  3J80 E;  1OO9 B;  2NN6 H;  3OIQ A;  4XTC S;  4OO1 H;  1DZ1 A;  4FVM A;  2A6H C;  2E2I B;  1XYI A;  2J0T D;  2XNA C;  5CBA E;  3T13 A;  4J8Q A;  1DYQ A;  3EJI A;  4HCE A;  1PRT B;  3M3Y B;  1G2T A;  3DWA A;  2PCF B;  2LFN A;  1EOT A;  1I50 B;  1HUM A;  1CTM A;  5IT9 L;  1CZW A;  3DWQ A;  1JQY D;  2EPB A;  1R9T B;  1STN A;  2E2J B;  1PZJ D;  1VF5 C;  4XQN A;  2B2W A;  3GD7 A;  4RA8 A;  2E2D C;  2WII B;  2F4I A;  2NTT A;  2EZV A;  3L3O C;  2EYF A;  3NTK A;  3ZYY X;  2CQA A;  2AQ3 B;  1WD1 A;  4E6I A;  3GTO B;  1EYA A;  2WKC A;  2Q8R E;  1EL0 A;  1SYD A;  2PNR C;  2H4O A;  1LT6 D;  4CJ1 B;  1SJH D;  1OXS C;  3T56 B;  2IT1 A;  4QIW B;  5IGB A;  3WDN A;  1CFM A;  3VR2 A;  2KED A;  3H3V C;  3TP8 A;  4K5V A;  2KOL A;  1SNM A;  4LMQ D;  3C1E A;  1BBX C;  2EVB A;  2JEA I;  4KV6 A;  1UAP A;  2K28 A;  3RMH A;  4CKE A;  1R4Q B;  2EJF C;  1SNC A;  4O1N A;  5A2Q L;  5KRU A;  4IFD G;  4RKB A;  5ELC A;  1RTO A;  3FEW X;  4ZUI A;  1PTO B;  4AYB B;  1RF2 D;  5COR A;  4L6T B;  2O5I C;  3U9O A;  1K8M A;  2OT2 A;  4KD4 A;  1IL8 A;  4H13 C;  5CR3 A;  5EKK A;  5EKL A;  3KBG A;  1G8Z D;  4QUF A;  1SFO B;  3K59 A;  2EOT A;  5A35 A;  1FD7 D;  2SEB D;  3KLS A;  1JOR A;  3QO2 A;  5C5M A;  2ENB A;  1UUP A;  3J7Y W;  5EPL A;  2PYK A;  2AQ2 B;  2OEO A;  1D2B A;  1EQT A;  4C1N I;  2R92 B;  3SXH A;  3E0J A;  2AQ1 B;  4C3H G;  4OIJ A;  1PRT F;  1GUT A;  2IX0 A;  3K58 A;  3CRK C;  5C3E B;  1MSG A;  1ILP A;  1UEA B;  4IUU A;  2F0T A;  4C3J G;  3GTK B;  2A5H A;  4L63 B;  1LLR D;  3AU7 A;  2G9H D;  1PXU A;  3MWY W;  1EY6 A;  3SK4 A;  1R4P B;  1U4P A;  3BG3 A;  3GTL B;  1EY8 A;  3HG9 A;  4HR7 B;  3V05 A;  5FOB B;  1OXT A;  1DON A;  5CYU A;  1ICW A;  3MFY A;  3CU7 A;  5DEH A;  1KDA A;  4DK0 A;  2KQ3 A;  2N88 A;  3PUZ A;  5D65 A;  2KCC A;  2A6E D;  4DA2 A;  5HUR A;  5FO7 B;  1TS3 A;  3URY A;  1TR5 A;  4F8M A;  3TDQ A;  3VR6 A;  1F9Q A;  3DEP A;  3SEB A;  1UNS A;  3K5L A;  4KY5 A;  4CJ2 C;  1MSH A;  3HOZ B;  3A7L A;  2R61 A;  1I4R A;  4K5W A;  2FMC A;  1WD0 A;  2XN9 C;  1G6Z A;  4IUV A;  4HED A;  1EIG A;  4BA2 I;  4R8N A;  3CQZ B;  3KBX A;  3OWE B;  1XXG A;  2XRS D;  3M4Y A;  4WFN 3;  4X3S A;  1BXT A;  1PTO F;  3K57 A;  1TWF B;  4DXG A;  1HTP A;  1AP0 A;  4KI0 A;  3M7G A;  4IUR A;  1NSN S;  1JB3 A;  1PFB A;  4IFD J;  3EA6 A;  1AZP A;  1S5E D;  1JE4 A;  4XYO A;  2ICI A;  2CW0 C;  2A6E C;  4B9X A;  4ZQ3 A;  5FKA C;  4XT3 B;  2L5T A;  3R8B A;  1PRT D;  1JR0 D;  1TY2 A;  5I4D A;  1GXD C;  3Q6S A;  2HCI A;  3NTH A;  2ID0 A;  1BCP B;  1B9N A;  3Q24 A;  2IL8 A;  3GQB A;  5EBC A;  1TS2 A;  2O4X A;  5IGE A;  2R7Z B;  1LT5 D;  1M4V A;  1VMC A;  4K5X A;  5DM7 3;  5I9P A;  2JE6 I;  2N55 A;  4M1U B;  2NTS A;  2B2T A;  1TWH B;  4RGM A;  1GJX A;  4EQN A;  4RWS C;  3NQT A;  1Q12 A;  1RHP A;  1SAP A;  2RA4 A;  3HZX A;  1CQV A;  4YIJ A;  3EFX D;  1FR3 A;  4WJW A;  5ELF A;  3TN2 A;  2NVY B;  1EU3 A;  1E2Z A;  2A73 B;  5J1Z A;  3ONA B;  4EGV A;  3X3N A;  4CGY B;  3A8I E;  2K04 A;  5JPN C;  3HKZ B;  1PRT C;  1JOO A;  4HSP A;  4OGQ C;  1A15 A;  2RDG A;  1AZQ A;  1O78 A;  3K0Y A;  1I3Q B;  1PTO D;  1SYC A;  2PZT A;  3R2I A;  4RHS A;  2LY7 A;  2B2T C;  1EIH A;  3SVM A;  1DJR D;  1QJO A;  5CC4 A;  1B2T A;  2NN6 I;  3RZD B;  1LAB A;  4OO1 I;  3H94 A;  3J80 L;  3PIP 3;  2PO4 A;  2JA8 B;  3S1Q B;  4MN3 A;  1JWM D;  1HFG A;  5D14 A;  5C4Z A;  4BY7 B;  3VYU A;  2PW5 A;  2IWH A;  3S1N B;  5JEA H;  2B2Y A;  4FYD A;  3PUX A;  4S3S A;  1TT2 A;  2EJM A;  1U9R A;  2L12 A;  1A6X A;  3Q0A A;  4BY1 B;  5CV7 A;  4HCS A;  2E75 C;  1T5X D;  3ERO A;  1HRJ A;  1OXX K;  3LWU A;  1QE6 A;  3G6J B;  2DNE A;  2WAQ B;  4L8J A;  1O7L A;  1PLF A;  2RVL A;  2SNM A;  3MHB A;  3I73 A;  4DNR B;  3NHH A;  2L11 A;  4LAA A;  4C1N K;  4KD3 A;  1KDB A;  3A54 A;  4A3F B;  1PTO C;  2F0J A;  2HCC A;  2WB1 B;  4A3I B;  1LV9 A;  1BCP F;  2R3Z A;  4BBS B;  1ET9 A;  4ID6 A;  2B2U A;  4G57 A;  2B2Y C;  4NP5 A;  1VCI A;  1K8O A;  1G29 1;  4LK1 C;  2F0K A;  3BDL A;  1Q1B A;  1TU2 B;  2HQE A;  1I6H B;  3VYT A;  5BN5 A;  2KVM A;  4N9T A;  4C56 C;  2EE1 A;  4KN7 C;  4G7H C;  2C5C A;  4V0B A;  1PMR A;  3I8Z A;  5FK9 C;  1JC7 A;  3I3C A;  4A3D B;  1H9S B;  4NMZ A;  3C46 A;  2F0S A;  2K5W A;  1KNE A;  3IFD A;  3MAQ A;  1Q8I A;  3SHL A;  2NN6 G;  4OHJ A;  1Y8O B;  2XIW A;  3K6O A;  1ESR A;  4DNT B;  3CHB D;  4Q0F A;  5J39 A;  3NP8 A;  1QB5 D;  2KEC A;  2F0O A;  3HS0 C;  4JK1 C;  2DN8 A;  5DAU A;  2PQE A;  5C6A A;  3D4D A;  1FNU A;  2NVT B;  1I4X A;  5TSS A;  5M5Y B;  4ME5 A;  3VYR A;  1BQQ T;  4M8A A;  2X69 A;  2XWB B;  1BNZ A;  2VB2 X;  3VA5 A;  5I6W A;  3H0G B;  1DM0 B;  4BBR B;  4F88 A;  1D5Z C;  1WTR A;  2NYZ D;  4I7Z C;  1CHP D;  1J8I A;  2EJG C;  1HUN A;  3MXP A;  3KUP A;  3C3L A;  5EPJ A;  4A3J B;  2F0E A;  1STE A;  4ZRZ A;  5C3W A;  2QKI C;  1DXM A;  2MHV A;  3TP6 A;  1KNA A;  1Z47 A;  1QOH A;  3RD4 A;  5ELB A;  2IJ0 A;  2HDM A;  3BDO A;  3MXG A;  3EQL C;  5E4W C;  4DU9 A;  4ZYS A;  4A3B B;  3NSW A;  3NK9 A;  2VUM B;  3NTI A;  2EY5 A;  2AWN A;  4IUN A;  3OSO A;  1HPC A;  4HAE A;  5JAV A;  3MFG A;  1Q1E A;  3GV6 A;  4KHV A;  5BN4 A;  1JWU D;  1WTW A;  4KK7 A;  3BS1 A;  1QG7 A;  2DY7 A;  3QIA A;  2V4D A;  1CK1 A;  3R2T A;  2WAC A;  1OXU A;  2EY2 A;  3T51 B;  4ABN A;  2A74 C;  4ZAI A;  4XIG S;  1GUS A;  4RGO S;  1SXT A;  3FKI B;  3FMC A;  4OIK A;  1A2U A;  1O80 A;  2L55 A;  4FXK C;  5JOB A;  3TZD A;  5CV4 A;  4EQP A;  2PW7 A;  4K14 A;  1F9P A;  1C4Q A;  4G7Z C;  1HFN A;  3WOF A;  2ZXO A;  3BDC A;  4IUP A;  3FPU B;  2JA7 B;  2QCP X;  3IL8 A;  1DOL A;  5CV9 A;  4B9W A;  2ZXR A;  2MUY A;  1AEX A;  3PUY A;  1A3V A;  5EPK A;  1PZI D;  4C3I B;  2O5J C;  3W3A A;  1GUG A;  2BE5 D;  5KIX A;  4K8J A;  4A3K B;  3E6Z X;  3I70 A;  5C5L A;  1HQM C;  1TWC B;  1SNP A;  3K5N A;  3GTP B;  4KTA A;  1FNW A;  1TKW B;  1B50 A;  4FXD A;  1KAA A;  1TVX A;  2NBF A;  4CJ0 B;  2K01 A;  1F9R A;  2OXP A;  1NCV A;  5C44 B;  4Y7N B;  5EJW A;  5JVG 3;  1G91 A;  1TWG B;  3FVQ A;  3QWN A;  3SK6 A;  2O2L D;  1ET6 A;  1CZG A;  2IX3 A;  3DM1 A;  1SYG A;  2EY1 A;  3J7A F;  3P7J A;  1V8Q A;  1PFN A;  1SBB B;  1YNN C;  5CMD A;  2VB3 X;  1DOK A;  4H44 C;  5EBD A;  1EZ6 A;  3X3M A;  3S14 B;  1V1P A;  2QIL A;  2Z4H A;  2FFK B;  1ONL A;  1GHK A;  3D31 A;  1QWY A;  2EXZ A;  1LTT D;  4X3T A;  1STA A;  2BE5 C;  2M2L A;  1KDC A;  4KJN A;  1LAC A;  1Y1W B;  5M9O A;  2MPM A;  2CW0 D;  2R6G A;  2X6G A;  4CBV A;  3N52 A;  1F2Y A;  3HOY B;  1HTL D;  3SE0 A;  2PMZ B;  3NUC A;  2L0C A;  3NBI A;  3H6M A;  1L0X B;  1JCK B;  4K2L A;  1SYB A;  4TKO B;  2XWJ B;  5LL6 S;  3K7A B;  3OPO A;  1EY7 A;  1IKM A;  1QIL A;  2Q8T A;  5LHY 1;  2EYP A;  3NWT A;  2B2V A;  5J22 A;  5E4X A;  3DEO A;  2F0W A;  1YNJ D;  4KY7 A;  2RSN A;  1SE4 A;  4H7B A;  2DY8 A;  3TME A;  4IQZ A;  4ZKC B;  4K6L A;  2Q8I B;  2F0M A;  4R9W A;  3E5S A;  3DHQ A;  1Y1V B;  3MEH A;  3S1M B;  1D5M C;  1SEB D;  2MGS A;  4DF7 A;  3GP7 A;  1NAP A;  3M7N A;  3MXU A;  4QCL A;  2L9H A;  5M3M B;  4FP5 D;  3T53 B;  2LS0 1;  2F0L A;  2KEE A;  5NUC A;  1RD9 D;  5EQ0 A;  1EZ8 A;  1PDQ A;  1IYV A;  2B2V C;  3D6C A;  2X6L A;  2NVX B;  4WRD A;  4RFB A;  4MIU A;  5C0X H;  1D5X C;  2JYO A;  5EKI A;  2XVS A;  1WCM B;  1EY9 A;  5JPM C;  1W6K A;  3QOL A;  4BWG B;  4IUQ A;  4RAU C;  3WOE A;  3W2D A;  1CT1 D;  1YNJ C;  1STH A;  3K5M A;  3T4A C;  2YYZ A;  1ZKO A;  2L1B A;  1LTI D;  4J6H A;  4R8I A;  4DFA A;  3D8G A;  1ZXT A;  3GTG B;  3FRP B;  1I6V C;  1D1I A;  2LKV A;  3S17 B;  2HDL A;  1LTB D;  1BDO A;  4F7X A;  3PUV A;  4XQQ A;  2RQX A;  4IZ8 A;  1WTX A;  3QOJ A;  4V19 0;  3PV0 A;  1ENF A;  5I2Y A;  1DOM A;  1H9R A;  1Z7T A;  2K7V A;  5IIF A;  2E2H B;  1BUV T;  1F9S A;  5DM6 3;  3PIO 3;  1EWH A;  3S2D B;  3SK5 A;  3G7L A;  5FO8 B;  5KNC A;  1ENA A;  2BDO A;  1CM9 A;  5JEA G;  3SK8 A;  4FO2 A;  1O7Y A;  2EYO A;  1I4P A;  1HHV A;  3V2T A;  1Y8N B;  1CHQ D;  1ILQ A;  2E76 C;  3GTJ B;  2J4X A;  3R93 A;  4ZKB B;  2MP1 A;  2TMP A;  4DXF A;  1JWS D;  2K05 A;  3IFT A;  3HOX B;  1I4Q A;  3H91 A;  2ZXP A;  2B63 B;  4A3M B;  5ELD A;  5ISR A;  4RCN A;  3RLF A;  5KGU A;  2EDG A;  3MTS A;  3VYS A;  2NB0 A;  2CHB D;  1H9M A;  5KNB A;  2G9D A;  1L0Y B;  1Q3L A;  1MGS A;  2D62 A;  1F77 A;  3DWP A;  3M85 A;  4XDX A;  1WTQ A;  1TWA B;  4NKL A;  2F0D A;  3I91 A;  4QMG A;  1TY0 A;  2BDN A;  1WTP A;  1I4H A;  2E74 C;  4CKC A;  3J81 E;  1C8C A;  2QDB A;  3D4W A;  2WV6 D;  3A56 A;  3KK7 A;  2F0N A;  1GOZ A;  1A3T A;  1SND A;  1SJE D;  3H09 A;  3FPP A;  1JOQ A;  2A68 D;  3BVZ A;  1CA6 A;  4C3I G;  3PMF A;  1AFP A;  3U9S A;  2F0F A;  4PMC A;  1O7Z A;  2KA7 A;  3OOC A;  1KLG D;  4RGN A;  4FF2 A;  5G3L F;  1G2S A;  3A8J E;  2D9U A;  1RTN A;  2FHT A;  5CBE E;  2D2C C;  3TP7 A;  4G7O C;  1F2M A;  1LTR D;  1DD2 A;  4PNY A;  4OO1 G;  3OWF A;  3I4L A;  1EYC A;  1PTO H;  1IHZ A;  2BCO A;  2D5D A;  5T1I A;  3VR3 A;  1FYC A;  4DAY A;  3LNN A;  3TSS A;  5LL6 X;  1E0B A;  2Z8L A;  4ZUJ A;  2PZW A;  5C3X A;  2NVQ B;  3LX0 A;  4PMW A;  4IN3 A;  1HA5 A;  1SMY D;  4F87 A;  2HUG A;  5COY A;  3D6W A;  5E3F A;  3S16 B;  3SR1 A;  5JJZ A;  2RKS A;  3L9A X;  4XXE A;  2WKD A;  4NDX A;  2K5Q A;  3QB3 A;  3KLR A;  2FJ2 A;  5JEA J;  2A68 C;  1X3Q A;  3HGB A;  1QNU A;  3NBH A;  2M9V A;  3A8K E;  4ODG A;  1B1Z A;  3JAM E;  1AW7 A;  5FLX E;  1BCP D;  2NUC A;  5K36 H;  1SE3 A;  5IGC A;  1V1O A;  2R93 B;  1NR2 A;  1SSO A;  2IW3 A;  3NWS A;  3MVV A;  5E1F A;  1H9J A;  2F0P A;  5C4H A;  4FXG C;  4ZK9 B;  1SMY C;  3AMU A;  2JXM B;  1IW7 D;  3C2P A;  3Q22 A;  5M5X B;  3BVG A;  4KY6 A;  1HXY D;  5G3L D;  3MA2 B;  4KHZ A;  3D4R A;  4C2M B;  2AUJ D;  4X3K A;  3DXJ C;  1SYF A;  3OIP A;  1RCV D;  2ZT9 C;  5CV8 A;  3HOW B;  3GV3 A;  3Q23 A;  3ND9 A;  3L7Z C;  1EYD A;  2EYH A;  1EY4 A;  3P75 A;  2MJ8 A;  1SNO A;  4Z9C B;  1YNN D;  4P2C B;  4A3G B;  2SDF A;  3MZ5 A;  1EEF D;  1S5C D;  2Z4I A;  3HP3 A;  1BCP C;  2B2W C;  2AUK A;  1VDZ A;  4WOR A;  5ELE A;  5IOC A;  4ILW A;  2VNU D;  4K8I A;  1ESF A;  4LJZ C;  2IPK D;  3FDT A;  1NR4 A;  3EVQ A;  1SDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...