4ZUJA

Crystal structure of staphylococcal nuclease variant delta+phs y91h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAHIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zujA00
5IGGA 3QOLA 3SK6A 2EYLA 5J1ZA 1JOOA 2PZUA 3EROA 5E3FA 3RUZA 4HMIA 2F0VA 3P75A 3VA5A 3T13A 5IGEA 1U9RA 4J1MA 4N9PA 4K8IA 5DEHA 5CV7A 5I9OA 4YIJA 2EXZA 1STAA 4KTAA 4WRDA 4KV6A 1EYCA 5CV6A 3LX0A 1SYCA 4HMJA 4EQNA 5EKKA 3NXWA 5CV4A 3OMGA 5C3XA 4KJNA 2F0PA 2PZWA 5IGFA 3ITPA 3ERQA 2KQ3A 3PMFA 2F0OA 4K2KA 5IGDA 5KYLA 1STBA 2EYOA 2F3VA 1KDBA 2F0FA 3MZ5A 4J6HA 4OL7A 4QF4A 4ZUIA 5JAVA 4PMBA 5E1FA 1SYDA 4KY5A 1A3TA 1EZ8A 2EYPA 3MEHA 4K5VA 4LAAA 3NQTA 2F0GA 4K14A 4NP5A 3NK9A 3TMEA 5C4HA 3NUCA 2PZTA 5C3WA 3D4DA 4R8NA 5C6AA 1II3A 1SYBA 1F2MA 5I6WA 3SXHA 5KEEA 5CV8A 2PW7A 2OF1A 2SNSA 4IUNA 4S3SA 5EGTA 1SNCA 2EY6A 2F3WA 5CV5A 3H6MA 5JOBA 3TP5A 5IODA 3S9WA 2RDFA 4K5XA 4N9TA 5F2DA 5CGKA 4TRDA 1EY7A 2PQEA 4F7XA 2F0WA 1F2ZA 3HEJA 3DHQA 5KRUA 5CC4A 1SYGA 5J22A 2EYMA 4NMZA 5C5MA 1JORA 3HZXA 2F0IA 1IHZA 1SYEA 4I65A 4B9XA 5IIFA 4KJOA 4KY7A 1EY4A 1SNDA 3MVVA 1EY8A 1STYA 1STGA 2ENBA 4QMGA 1TT2A 3TP6A 2WACA 2EY1A 1SNOA 3C1EA 2F0QA 1EY9A 2EY5A 2LKVA 3TP8A 3C1FA 1ENAA 4F8MA 4IZ8A 3D6CA 2F0SA 3DMUA 4QB4A 5EKLA 3U9OA 4DU9A 5K5PA 5KGUA 4ZUJA 5IGCA 2F0NA 4KD3A 4KY6A 1A3VA 3QOJA 2OXPA 2RKSA 4K6DA 3T16A 2EY2A 2SOBA 1STHA 1SNPA 1EY0A 4G57A 5DAUA 4DF7A 2OEOA 2F0DA 3SK8A 4H7BA 3BDLA 1KDCA 3BDCA 4K5WA 3MXPA 4KHVA 4ODGA 2EYJA 4ME5A 5CV9A 1STNA 3SK4A 2QDBA 4MIUA 4B9WA 5I9PA 5CR3A 5J39A 3EJIA 4KD4A 5ISRA 1SNMA 2F0TA 1F2YA 3E5SA 3D4WA 4E6IA 2EYHA 3OWFA 1SYFA 5C4ZA 1A2TA 3OMCA 4NDXA 4RKBA 4RKLA 4WORA 4DFAA 4EQOA 5I6YA 2SNMA 2PYKA 2NUCA 4DGZA 1KDAA 1AEXA 2F0EA 4ZQ3A 4PMCA 5NUCA 4EQPA 1EY6A 5KIXA 1ENCA 3TP7A 1JOKA 1RKNA 2PW5A 2HQEA 5M9OA 2F0HA 2M00A 2O4XA 5HURA 2F0KA 1A2UA 4NKLA 2F0LA 3SK5A 5HGTA 2F0JA 1SNQA 2EYFA 3NHHA 2RBMA 3NP8A 4ID6A 4IALA 1A3UA 4K2LA 1NSNS 4K8JA 1EZ6A 1EYAA 4HTHA 4EVOA 3D8GA 2KHSA 3V2TA 2F0MA 1TR5A 3R3OA 3P1HA 3SHLA 5IGBA 3EVQA 1JOQA 3QB3A 4PNYA 3OSOA 1NUCA 5C5LA 1KABA 2F0UA 5IOCA 1KAAA 3SR1A 1TQOA 1EYDA 1EQVA 5KYIA 3MHBA 1EY5A
chains in the Genus database with same CATH superfamily
3CW2C 3L3OC 1G8ZD 5JEAG 3AFQA 1VQ6A 2VL6A 5E7NA 1VQGA 3S1MH 2XRSD 3K59A 2VXWA 1QWYA 4N9PA 1AFPA 4CJ0B 1Q3LA 4WRDA 2PPBC 4A3BH 1BNZA 2C5CA 3LX0A 4DAYA 3NXWA 1EIGA 3W3AA 4ZRZA 4JI6L 2UUBQ 4HCEA 1FGBD 1VQAA 4K2KA 4DUZQ 1PVOA 5EBCA 3PIP3 3JAML 1Q81C 1N33Q 1LT4D 2RVLA 1FNWA 1W6JA 4B08A 1G2SA 4DV5L 4R8NA 5LL6S 1D2BA 1RJTA 2CQAA 3S17H 4R4IA 4N9TA 2CKZB 2A6HC 1Y8NB 3Q8DA 3LNNA 2ZTEA 2DNEA 3ERSX 3PUVA 4DN4M 2JEAI 1ILQA 5A2QE 3TREA 4GLAC 3V05A 3RN2A 1V9PA 1S3OA 4WJWA 3TS2A 1KHIA 2L12A 1MD2D 1SFOH 1QILA 5KGUA 1DOKA 1VQCA 1EIHA 4KD3A 2JYOA 2N3SA 1STHA 2HDLA 1TWHH 4NXML 1LTRD 1CZWA 1SEBD 2GVBA 4K5WA 4GNXA 2Z4HA 4KHZA 2E74C 2K14A 1PFSA 1OXVA 2BE5C 3KDFB 4DV1Q 1TS5A 1PH5A 3KBXA 3SGIA 2EYHA 3H3VC 3FMCA 1GVPA 1UWVA 3GP7A 5IT9c 1DD2A 5IY0A 4I7ZC 3SEBA 1AEXA 2JA7H 4KN7C 1GO3E 1JOKA 2WB1B 5M5YH 4A3FB 4JI0Q 1NR2A 1JICA 1GUSA 1NSNS 2CFMA 4LF4L 1AE2A 4PZ6A 3S1NB 1TR5A 2L11A 3P1HA 5JPNC 4XQNA 4UP8A 2RDHA 3J7YW 3ND9A 1LTLA 4AH6A 1NUCA 2R7ZB 4X66Q 5AJ3L 3PGZA 1WYDA 1WVLA 5LL6X 4EQ5A 1EYDA 2PQAA 2BA1A 1BXTA 4YCWA 3EROA 2A6EC 5BR8L 1VMPA 2CW0D 3AYHB 1HR0Q 1F2LA 1HCZA 5IYDH 5M5WB 4MN3A 2KOLA 2PZWA 4R4QA 2RHQB 3BS1A 2R7DA 1B8AA 5KYLA 4A3FG 3T51B 3NBHA 3MZ5A 3B6YA 4OGQC 1JCKB 2A69D 4P72A 4DV4Q 3OTOQ 2DUDA 3BU2A 3TSSA 1ZYRD 4K0KL 1VCIA 2R7ZG 4XTCS 4GLXA 3S1RH 3JC66 3I7FA 2FMCA 2PQEA 1PTOH 3C46A 2F0WA 3U50C 4FVMA 4WJ4A 4JI8Q 1E2VA 4QIWB 3KUPA 4CKEA 1PFBA 1D5MC 2ENBA 2KHJA 5T1IA 4IPCA 3GDEA 1J8IA 5K5PA 3PF5A 1I4RA 3D31A 4DPGA 1SNPA 2M2LA 4G7HC 2VZAA 1PH9A 3K0YA 1GXDC 4X3UA 4A4IA 2B63B 4R4CA 1SN8A 3MXPA 1I4XA 2K05A 4O2DA 5M3MB 5EQ0A 1EIFA 1ONLA 2IL8A 2R61A 2I46A 4V190 3T4AC 3DWQA 4JCVE 3OW7A 1FL0A 1EQTA 2C9OA 2K6AA 2R93H 3H94A 3OMCA 3BVMA 3HOZB 5C44B 1MGSA 4A93B 4JBWA 1KIXA 4BBSB 3PCOB 3MXGA 4CDCC 3UDFA 2HQEA 1BCPD 2JN4A 2ES2A 5A35A 3A8JE 5C3WA 4B3ML 2OCEA 4B3TL 1JR0D 1W3SA 3SHLA 5LHY1 3NTKA 4DR1Q 2O2LD 2IX3A 3T1HL 2B63G 1EFWA 1Q86C 2F0UA 2E2DC 1IBML 2K5NA 1EFID 3PO2H 2ATWA 3CRKC 2IW3A 5M3MG 2NVYB 4A3EB 3FEWX 3SK6A 2E2HB 4Y7NB 2PZUA 3DEPA 2UUCQ 3M3YH 2EE1A 1BUVT 5DEHA 1W2BA 2EJGC 3HOZG 1BCPF 2QGQA 4RHRA 4H0LC 1SYCA 5C44G 4HN7A 4C3IH 4A93G 5EKKA 3O13A 4BBSG 4DR2L 1N8RC 2F0PA 1I50B 3M4OH 1D5ZC 1JWUD 3VA7A 3S14B 3JAME 2PI2E 4FO2A 4EGVA 4IOAA 2BDOA 1YIJA 2BH2A 4ZK9B 1A0IA 4ZCKA 4JBJA 4YY3Q 5C4HA 5CV8A 5IYCG 3KJPA 2EY6A 1MIUA 1H9MA 2JE6I 2D0OA 4K5XA 2UU9L 3GTPH 4A3EG 5KRUA 1YITA 4F87A 2VB3X 2VUMH 1Z6HA 1STGA 1HPCA 3TS0A 1J6QA 2FINB 4AIMA 2KEEA 3G6EA 1RCVD 1FVIA 5D3IB 1XMOL 3GTQB 3D6WA 1A63A 1HA5A 3PUYA 2PNRC 4JI3Q 2N49A 4ODGA 4DK3C 3BG3A 2ZJRA 1JMCA 4MIUA 4L63B 4YWKA 1KTKA 2Z6KC 3K5OA 4KD4A 1WCMH 4LF9L 4H13C 4WORA 1QOHA 4RH6A 2MHVA 3A7AB 2F4VQ 1RKNA 4X64L 2PW5A 1KC8C 1RDPD 3FKIH 3K5MA 4POGA 1Z47A 3C3LA 1R9TB 3F2DA 1BBWA 2MO1A 3VR4A 2WAQB 4NXNL 1TIID 4DV7L 5IGBA 1PTOF 4FDBA 2A68C 3RZOH 5G3LD 1IKMA 5IT9E 2YTVA 3FVQA 3F2UA 3MXNA 1KAAA 3K6OA 2A5HA 3OIPA 1B50A 3IFTA 1HNZQ 1XNRL 1ML0D 3MEFA 1PRTF 2UUAQ 3H3VI 2RQXA 2NVXB 1F9QA 1O7LA 2F0VA 2L1BA 1K3RA 4J1MA 5C4XB 1CSQA 4YWLA 4YIJA 3K8AA 2E2IH 1YHBA 4HMJA 2KA7A 4IPDA 4RMFA 4LF5Q 1BO0A 3EN2A 4C1NK 4KJNA 3I55A 1X3GA 4QUCA 3S2HH 3E9HA 4P74A 2XVSA 2VQEQ 2Q2TA 1MHWC 3K0XA 2DN8A 4BY7B 1K8AC 5G3LF 1OXSC 3A56A 5J3BA 2WAQG 3NK9A 1X3FA 5D3DA 4BXXG 4U673 2WFWA 2UXBQ 1B44D 1N36Q 1EWCA 2A8VA 1E0BA 5KEEA 4WJ3M 1BVSA 2Q2HA 4XQQA 1JWMD 2EJMA 4QGUA 4C2MH 3S15H 1VDZA 2F3WA 5CV5A 2MO0A 5F2DA 3VR5A 2XWBB 2AQ2B 1CI3M 4R4OA 4JI5Q 3CRLC 5C4XG 3BVZA 1E3PA 1RHPA 2KCTA 4MZ9A 4DR3L 1VQPA 3UI2A 5D14A 4DAYB 3MA2B 1PYBA 4OEMB 3QOJA 4DK1A 2AWOA 3GTJH 4BY7G 3S24A 2OEOA 2R92B 1IYJB 1JJGA 1C7YA 3BDLA 2K52A 1SROA 1JWSD 1HHVA 1EYGA 5D65A 1E24A 3VYRA 3RLNA 3NTIA 3OWEB 1ZKOA 4NPSA 1DJRD 4RCOA 5CBAE 5JVH3 3T1YQ 4YCUA 4XQJA 2Q2IA 1SJED 3VYUA 1N32L 4BWGB 1F9PA 5NUCA 3PIO3 5C4JH 2HD3A 4KKTA 2KEDA 4K2LA 5JEAH 4DNRB 1X56A 1Z9FA 4R4TA 2KHSA 3MWYW 1TS4A 2BOSA 4RWSC 4RG1A 1M4VA 2R92G 4XIGS 2AWNA 1EL0A 1YJ9A 2NTTA 1YNXA 3X3NA 2AKWB 3ICEA 3H3VH 3CU7A 4GNXB 1R4PB 4DNTB 4JI0L 1XX8A 4NB3A 2LSSA 1RL2A 1B3QA 3M85A 4A3IB 4L5SA 5KNCA 5C0XJ 4GZYC 3S1QB 1Q90A 4GKJQ 1H95A 2RCFA 5I4DA 2F0OA 4KI0A 1X54A 1K8GA 2I5HA 1KDBA 3CXCA 4IUTA 1RD9D 2D0PA 2HCCA 1VF5C 1SYDA 4RHSA 1WJJA 1QE6A 3UDXA 1YNNC 3JAMi 3TRZA 5C6AA 1SE3A 2EVBA 2VQFQ 1JB7A 4OONA 3K57A 1B4OA 3GV3A 2N78A 3L7ZC 2DNCA 2B29A 4UHVA 3STBD 3HEJA 3J81c 1VQLA 4ZKCB 2PQAB 4A3DH 1WD0A 1V43A 4HJ9A 2UXDL 1N9WA 3GTLB 2EY1A 4A3IG 2LKVA 2MPMA 3MFGA 3TP8A 2IPKD 4QB4A 5IP7H 5EKIA 4XXEA 1NMGA 3I2ZA 4G4KA 3HOVB 2HUGA 2YTXA 3FPPA 5E4XA 1A3VA 1CA5A 1MKHA 3CKIB 3U4VA 3BJUA 1EY0A 2BCOA 3KLSA 2WB1E 3NBHB 2AQ3B 1PHJA 3SE0A 1D5XC 1VQEA 4HIDA 1JB3A 3PO3B 4LF6L 5KNDA 4Y52H 3RZDB 3WWVA 5I9PA 4DR4Q 3L9AX 2Q8IB 1SMYD 5J39A 4GKKQ 3I3CA 2F0TA 3E5SA 2ZTCA 4C3JB 2K01A 1I94Q 1X3EA 1YNJD 2I5LX 1EUJA 3G4SA 4PMCA 4HSVA 1SXTA 4HEDA 4O42A 2O5JC 1S5FD 4PZ8A 4OWXB 4P75A 2F0KA 1NE3A 5JJIA 4HSPA 4GLVB 2K33A 2NN6G 4B3SQ 3M4PA 1PFNA 3HOVG 3LWUA 1Y1WB 2ASBA 1TWGB 3QB3A 3CAMA 1DYQA 2IHEA 2AUJD 4OX9Q 4GN4B 3H0GB 4JI2L 5C0XG 5KYIA 3PO3G 2CQOA 1QVCA 4A3FH 5IGGA 2SDFA 1HJPA 4C3JG 1LTGD 5CV7A 2Z4IA 2PNHA 1D7QA 2KHIA 1YHQA 2NZ1D 1GD7A 2A1AA 2R7ZH 4N8FA 1PH7A 2NVTB 1HRJA 4ZAIA 5M3FH 3I4LA 3NBIA 3PMFA 2BA0A 4QQBX 1GHKA 1L1OC 3KK7A 1QCBD 2CH4A 4DV6Q 2UXCL 2LFNA 5EBDA 3MEHA 1I6HH 1PXUA 1IW7D 1QB5D 1H9SA 4NP5A 2UUCL 1Y1WG 3IAYA 2FJ2A 1HZ9A 2XSCA 4OXPA 4LMQD 4IUNA 4KK7A 1K28A 2B2TC 3TZDA 1SE2A 1G51A 3H0GG 1LTAD 4F7XA 1GUGA 2K4KA 1SYGA 3GD7A 2O5IC 3NELA 4I65A 4B9XA 1X3PA 1CKNA 4J15A 3TP6A 4QMGA 4DR5L 2JA8H 5JJLA 4BY1B 3G48A 4DU9A 4GOPA 1AZQA 1MJCA 1VQOA 1PZJD 4FP5D 1HZBA 4JBMA 4I7AA 1GUWA 1UAPA 3DM3A 4J8QA 1DONA 2GN5A 2ZXOA 3I90A 4JI1Q 1WI5A 4LFAL 1TWFH 1UE5A 5FLMH 4IO9A 2JQOA 3Q0AA 3GTMH 2Q8TA 4CHTB 3OPOA 1G91A 1AH9A 3HOYB 3CF5A 1E2ZA 4DFAA 4LF8Q 3QJYA 3RMHA 3QWNA 3H91A 1PH1A 3S16B 1J5EL 4LF7Q 4AYBB 5IP9H 1HNXQ 5HURA 4ZKBB 1XYIA 1SNQA 2EYFA 4BY1G 3F8TA 2J0TD 1LT5D 1QVGA 2E75C 1HZCA 3QIAA 3HOXB 3L2PA 5C44H 2F4VL 2HIVA 1HFNA 1X32A 4BBSH 2OTJA 1EY5A 1I3QH 3J80c 2KCMA 4UDUC 4RGOS 1B9NA 2DJGC 2QCPX 3HS0C 4JOIC 1Y8OB 3HOYG 3KF6A 4K8IA 2EXZA 5M5XH 1UEBA 4BBRH 2VW9A 1YI2A 3PF4A 5FOBB 5IYCH 4KHPL 1PMRA 2JA6H 4YWMA 1HXYD 4RGMA 4AYBG 4P73A 1XWEA 2GA4B 4A3EH 4LUOA 1TVXA 5IT9L 3NQTA 3GTKB 4A3MB 4JW0A 2RSOA 2PCFB 1DGSA 3HOXG 3H6MA 1RODA 3OHXC 4LF5L 2ICEC 1CQVA 3CCEA 3S14H 1F2ZA 2VQEL 3MXNB 1TWCB 1OTCA 1VQ8A 2K5WA 1NCVA 2IY5B 2WB1G 4LK1C 1LM0A 2QA4A 1TT2A 2UXBL 2WACA 1N36L 1AN8A 4DK0A 4FF1A 4DR7Q 3EBEA 1HZAA 1H9JA 3BVGA 5LMNL 4TQUS 1Y1VB 2K5HA 4GS3A 3GTGH 1JE4A 2EPBA 4DUYQ 4A3MG 1B70B 2OT2A 2EYJA 1Q7YC 3M4YA 3SK4A 2WAQE 3FDTA 1HA6A 1X65A 4UY8C 4HJ5A 1SLJA 3U58A 4ME3A 1PH8A 1LTID 3IL8A 3MTSA 4RKLA 4EQOA 2MGSA 2G9HD 3M4QA 5IWAL 1N34Q 2OTLA 2QEXA 3A8KE 1BBXC 3CQZH 1YVCA 5FO8B 2KJXA 3T1YL 1CUKA 1FGUA 3RN5A 1VQJA 2B2VA 4APVA 3CP0A 3V2TA 1Y1VG 4CKCA 1GOZA 2PMZE 3AFPA 1LT6D 2WIIB 2E5LL 5K36H 4FF4A 2OQ0A 2LS01 1ICFB 1WTHA 1K9MC 3VDYA 1WTRA 3AB9A 2MP1A 2XTIA 1SFOB 1R9TH 3EQLC 1XPUA 3ND8A 5AFWA 4BXXH 4KMUC 1ESFA 1BCPB 1F9RA 5CV6A 2NVQH 2V1CC 2IX1A 1FYCA 5C3XA 5LMUQ 4B3RQ 4M8AA 3L0OA 2CVRA 1WD1A 2JK8A 4QCLA 4LUZA 1C9OA 4PMBA 4LFCL 5JAVA 2FMMA 4K5VA 2NVXH 3J7AF 4EX5A 1VQ4A 4O1NA 3NUCA 2CW0C 1O78A 1DOLA 5I6WA 3BDOA 1X55A 2SNSA 3E3XA 5T1GA 1S4ZA 4DV0L 4GKJL 2JA7B 1MSHA 4IPGA 3GTOH 5M5YB 4XT1B 1HNWQ 1VQBA 4LFBQ 3DHQA 4C56C 2A69C 4A3CH 2ZJQA 3DWAA 3URYA 5KIXA 1C8CA 1ZYRC 2A74C 2F0QA 4A3LG 2VQFL 5TSSA 4TVAB 2N55A 2F0SA 2JA9A 2X6GA 1FNUA 2EIFA 4A3JB 1Q12A 3ER0A 3Q6SA 4KY6A 4WFN3 1A8VA 2MQHA 5JVG3 3KJOA 5HY6A 4H7BA 4DAVA 2K5VA 4KHVA 3Q22A 2BDNA 1B53A 1NTGA 1SRUA 2NWGA 1KXLA 1T5XD 5ISRA 4JYAQ 4ABNA 2J4XA 4JI6Q 2JA7G 2NN6I 4IUVA 3KYHC 3PQIA 1YZ6A 3UE1A 2N8NA 3BZKA 3KF8A 2JEBI 3A8IE 3WDNA 3IRBA 2E2JH 2ZXRA 4OWWB 3CC2A 3PIPA 2R92H 4H02A 4RFBA 1U4RA 4L8JA 1PLFA 5C0XI 1MI2A 1JOQA 4X62L 1JE5A 1XPRA 4A3JG 1PTOD 1C48A 1PTOB 3CCRA 3KLWA 4PNYA 4JI7L 2ZM6L 2VNUD 1RF2D 5ELOA 4DR6Q 1B7YB 4L5TA 1CA6A 2JP1A 4UAIA 3MHBA 5IYDG 1BCPC 1PRTD 1BBUA 1FR3A 3QOLA 1PRTB 1IKLA 1YJNA 3P20A 1XXGA 3P75A 1C0AA 4RAUC 4IPHA 2CWPA 1K73C 5H1SE 1NY4A 1TU2B 5ELDA 1NR4A 5KNBA 4ZLTF 1U4PA 5C3EH 4A3KH 2QDLA 5IGFA 3ERQA 3OW2A 4X65L 3DXJC 1LO5D 2L0CA 4C3HH 2B2YC 3OOCA 3E9IA 2B2WA 3TMEA 4EQPA 5LMNW 2R93B 4HIMA 3BYTB 1W6KA 2G9DA 1SNCA 3GQBA 4YHHL 5EPLA 2ZJPA 2K1BA 1ZEQX 4CDEC 1ILPA 5JJZA 1X3QA 1HUMA 4FXGC 4ZYSA 2E8GA 4DV6L 4LF4Q 2L4NA 2PMZB 2QILA 4JK1C 2G5DA 2IWHA 2K04A 3KLRA 1EY4A 4DV3Q 4GN5A 1KLUD 4PG3A 4LNQA 3I72A 5AJ3Q 4IZ8A 1O80A 3DMUA 1TS3A 5IGCA 3PO2B 4OHJA 1GKHA 3CCQA 4K6DA 3G71A 1K0SA 2EY2A 3LWEA 4G57A 3CPFA 1EWHA 1IL2A 2JSOA 5JJKA 2MNAA 2LMCB 3M3YB 3CMEA 1ZXTA 3I4NH 3X3MA 3NWSA 2R93G 2UUBL 1A62A 3W1BA 3KLSX 1H9SB 4DUZL 3HOWH 3ULJA 1N33L 3K7AH 1PV4A 3SDZA 1BR9A 2NN6H 2VY3A 3M4OB 3D4WA 3HOVH 1I4QA 1QNUA 3K5LA 5DLQE 3AEVA 1K8OA 1X6OA 4K0KQ 1OXXK 4JI1L 3HOUB 2IHFA 5C0XH 3VYTA 5HGTA 1CKNB 2F0JA 1MSGA 4FF2A 1A3UA 1RIPA 4HTHA 4CGYB 3PO2G 1V1OA 2YU9H 3GTPB 3CC7A 4GOPB 4LF8L 4A3GH 2X69A 4JG2A 3A5ZB 3CC4A 3MXUA 5ELCA 3RLOA 3TDQA 3WOEA 5E4WC 1TKWB 1SE4A 1HNXL 4DK6C 3F2BA 5J1ZA 3CCSA 5IGEA 3T13A 1Y1WH 2RCNA 2NZOA 1PA6A 2Z6KA 4KV6A 3CCVA 1DZ1A 3AMUA 4KKUA 1VQNA 2FHTA 2NB0A 1LTSD 1PZKD 4DV1L 4GN3B 4R9WA 3HOUG 3H0GH 1STBA 4L6TB 1HQRD 3CCJA 1JJCB 1WCMB 3NTHA 2F0GA 2KVMA 1PH2A 1Q1EA 1CTMA 1STEA 2PZTA 1NNXA 1XNQQ 2B8GA 1FJGQ 2NVTH 2FXQA 4POFA 4DAPA 3FKIB 4M1UB 2TSSA 1EY7A 1ESRA 1PH3A 4B3MQ 4MTKA 4NMZA 4B3TQ 1S5DD 1IYVA 4ILWA 4X66L 4HIOA 1SNDA 3HG9A 4Q0FA 3E0JA 2WKCA 1NJIC 5ELFA 3RZOB 3GO5A 3KF6B 5GAEC 3T1HQ 1UUPA 3CMAA 3D6CA 4UP7A 4JI4Q 3NENA 4QJFA 4ZUJA 3CCLA 2F0NA 2ICIA 4QY7A 2LXKA 4HAEA 4RGNA 1HR0L 1LV9A 3RD4A 4AYBE 1RTNA 2HQLA 1HQMC 1WCMG 3SK8A 2K03A 2E2IB 3FPUB 4A76A 2P5ZX 4DV4L 3EJIA 3OTOL 4DR2Q 4BY1H 3AQQA 3RLFA 3I4MB 4QUFA 5C4ZA 1SYFA 3FKIG 1HTPA 5GQOA 1QNKA 4DXGA 1D8LA 4DV2Q 4DUYL 2F52A 4GOPC 2B8FA 1A2UA 1IBKQ 1SAPA 3SK5A 3OIQA 2AHOB 4IALA 3NHHA 4C2MB 3S15B 4JI8L 2DY8A 1WTOA 3J81L 3M7NA 1K83B 3HOYH 1U0LA 2UU9Q 4HJ8A 1CSPA 4OELB 1I5FA 3TQYA 5FO7B 2K75A 4V0BA 4DNIA 4HMIA 4MHEA 3I4MG 3F2CA 1HH2P 4KTAA 1BOSA 5CV4A 3HOXH 1VS0A 3TBIB 1SSOA 1J9OA 3UDIA 3DLLA 3CD6A 4GNXC 1I6VC 4RGTA 3ZYYX 2A6HD 2CHBD 4LJZC 2CCZA 1Y14B 4PZ7A 5E1FA 4AQYQ 4LF9Q 3NPPA 2JA5B 3D4DA 4F88A 1FD7D 1QJOA 2Y0SB 4X64Q 5IE8A 2B2UA 3S1NH 4B3RL 4X3TA 3S2DB 2Q8RE 4XDXA 4DR1L 2BH8A 4OO1G 1KD1C 3TN2A 2WINB 3LGJA 1IHZA 4NXNQ 2L55A 1EY9A 2EY5A 1K3BC 1I4PA 3D4RA 2BE5D 5CYUA 3U4ZA 2OXPA 3STBC 4DKAC 5DAUA 3PUZA 3HP3A 5M5WH 1TWAB 2WP8J 2Z8LA 2HHHQ 2Q2UA 4LFBL 1L2FA 3WOFA 1TWCH 1KDCA 2JA5G 3P7JA 1STNA 5FJ8G 1M1KC 5IYBG 3W2DA 2Y0SG 1UEAB 4KN4C 2QKIC 3ZJYC 4IUPA 4YY3L 4H44C 3OWFA 3JAMc 1A2TA 1H9KA 1Q1BA 3ONAB 4DGZA 3BZCA 3RNUA 4ZQ3A 2JJQA 5DM73 1G6ZA 1D6EC 5I2XA 3K58A 1YEZA 3UDGA 2O4XA 2K5QA 1IBLQ 1DOMA 2RBMA 1SMYC 2A6ED 1EU3A 1ET6A 4JYAL 4L5QA 1E1TA 1EOVA 1AP0A 1YNJC 4UPAA 3I73A 1KNEA 5BN5A 4A3DB 1EQVA 2DY7A 4UP9A 4KLKA 3VR6A 4DR3Q 2PI2A 1A15A 4ULLA 3HKZE 1FNVA 1TY0A 1DCZA 4JI3L 1QZGA 2B63H 1S5ED 5FLXc 1CKMA 3A74A 5M3MH 3V96A 2EQSA 2KUMA 5BN3A 4HJ7A 3OMGA 3KF8B 3R2IA 4DR6L 2B2VC 2EYOA 1B3AA 1U4LA 4HR7B 3HOZH 3N52A 1Q82C 2MJ8A 4A93H 5GROA 1A3TA 1PH4A 4IFDJ 2R3ZA 1XJVA 2E76C 1VQ7A 1N32Q 3I56A 3W1GA 1HR0W 4S3SA 5EGTA 5FLXL 4A3LH 1KL9A 1D1KA 4A3DG 5IODA 3S9WA 5CGKA 3PIOA 3I4OA 4PMWA 3G6JB 4R8IA 1SDFA 4L5RC 3PV0A 1XTDA 1JORA 5C5MA 5IP7G 1IW7C 4JC0A 3J7ZC 2L5TA 3K5NA 3C1EA 3TEHB 2NVYH 1HNZL 2UUAL 1ENAA 1CKOA 4F8MA 3D3RA 2E2HH 4Y7NH 3J80L 2D62A 3DUZA 2RKSA 3T16A 1DM0B 1CZGA 2EXDA 3Q24A 1TS2A 2ZXPA 4IOCA 1OXUA 5EPKA 1XMQQ 1Q8KA 2R7FA 1SMXA 2KBNA 3BDCA 1L1OA 1I50H 4YCVA 4LWCA 2MFIA 5CV9A 2K32A 1S40A 4DV3L 4FXDA 2QDBA 3MAQA 5ELBA 4KKSA 2EZVA 1SNMA 1F2YA 3UE0A 5EJWA 2J7ZA 5M3FB 1E1OA 4A3JH 4NDXA 4RKBA 2PYKA 2B2TA 3A55A 1KDAA 1I6HB 4PV1C 4JPBW 4IURA 5FKAC 2V4DA 4JBKA 1Q8IA 1V8QA 3J81E 3S1MB 3EIVA 4JI5L 4EVOA 1PYWD 2LY7A 3EVQA 4U68A 4A3BB 1F9SA 1ENFA 2QW7A 1WTPA 4HCSA 2ZTDA 3U9SA 1HFGA 1Z7TA 1V1PA 2UXDQ 3VR2A 2F1MA 3OYYA 2WV6D 1IL8A 3GTQH 2XN9C 2JA8B 1VQFA 2B3GA 4R1JA 3BZDB 1LACA 3K80C 1XPOA 4JVZA 1U5KA 4CJ1B 5M3FG 3SVMA 1LABA 4IFDG 1P16A 3VR3A 1N34L 2D2CC 4BA1I 5GADC 1QUQA 3S17B 2CH4W 3G7LA 1WTWA 3DEOA 2RDGA 2F4IA 3I8ZA 5IGDA 1TWFB 4LF6Q 4J6HA 3GTMB 3DWPA 4LAAA 4K14A 1NBWA 1PZID 1K8MA 4A3BG 1VQIA 1EEID 1PFMA 4N8X1 4FYDA 4IJHA 1M8AA 2SEBD 1LUZA 4RA8A 2D9UA 3I70A 4TRDA 4HIKA 2JA8G 1MBYA 3K81C 2FFKB 2CWAA 1TWHB 2AMCB 1MJEA 3CCUA 3FP9A 1SYEA 1M90C 5IIFA 4KY7A 5BN4A 1EY8A 2DJFC 1SNOA 2M9VA 3C1FA 4JOIA 1XNQL 3U9OA 1VQMA 3HKZB 4JI2Q 5C4XH 4K6LA 1FJGL 5FLMG 2B2WC 1I3QB 4JV5Q 1O7YA 4DF7A 1C4QA 4CDDC 1AE3A 3TZUA 5M5XB 4ME5A 1B1ZA 4XYQA 4BBRB 1UE1A 2QEJC 5CR3A 4BY7H 3R2TA 2JA6B 1T5EA 1IXRA 1CM9A 2R6GA 4E6IA 5IP9G 1UE6A 4JI4L 5L37A 2MUYA 1LTTD 5I6YA 3CPWA 2A68D 2UXCQ 3BYYB 3E6ZX 1G6PA 1LYLA 2DGYA 2NZHA 1KLGD 1ASZA 1UNSA 4X6AH 4XYOA 4P2CB 2OWOA 1WTVA 1BKBA 2YTYA 1CHQD 3D8GA 3HKZG 1GHJA 5FK9C 2IX0A 2XRQD 2PO4A 1KABA 2L9HA 5HGQA 2XIWA 5IOCA 1X9NA 1I4HA 3A5UA 4DV2L 4BBRG 4DR5Q 1KRTA 1E7ZA 3HOUH 2RA4A 2KENA 2EYLA 4TKOB 2KECA 3J81j 1IBKL 3CCMA 2JA6G 1JOOA 3DM1A 4CJ2C 4DV5Q 1JJ2A 1U9RA 5I9OA 1LLRD 1ICWA 1L0XB 3GTGB 3QG1A 4DR4L 4GKKL 1GUTA 3NEMA 3NSWA 3S1RB 5EPJA 2XGTA 4LFAQ 1BQQT 1I94L 3ULPA 2ID0A 2F0FA 3Q23A 1G291 3IFDA 5EKLA 2EYPA 2Z9HA 3PUXA 3EFXD 4OO1I 2H1EA 1II3A 3KDFA 2Z1CA 5FLXE 2PW7A 3EA6A 4LUVA 3NE5B 1J5EQ 4B3SL 3TP5A 1F77A 1YHAA 2HCIA 1WTXA 1PYSB 3CQZB 1S5BD 2C35B 3MC0B 5CC4A 4NXMQ 1KQSA 2F3IA 4AQYL 2F03A 2EOTA 4XT3B 4OX9L 3M7GA 2YYZA 1E2WA 3J80E 1GUNA 3E0EA 2RHSB 1Y69U 2KCNA 3J7AV 2SOBA 4MTNA 4A3IH 3S1QH 2F0DA 1O7ZA 4X3KA 4B9WA 2NVQB 4KHPQ 4O0AA 1XTCD 3K7UC 1YJWA 1EWIA 1SR3A 2HHHL 1ASYA 2F0HA 3M9BA 5K36G 2HDMA 3NP8A 3PSIA 4ID6A 4IJLA 5BR8Q 2I07B 5I2YA 3H15A 1JT8A 1DXMA 1VQ9A 3GTOB 3I4MH 2HIXA 3AU7A 1GM5A 3GTLH 3J81i 4C3IB 1OXTA 4IN3A 2RSNA 4DA2A 4ALPA 1KAWA 1NAPA 1S72A 3SR1A 5J22A 1IBLL 5E3FA 3RUZA 5LMNQ 2Y0SE 1YNND 3VA5A 1PTOC 4CKBA 1VQKA 1K83H 1STAA 2AUKA 3A7LA 3CHBD 4OIJA 1EYCA 3PO3H 3RZDH 3FRPB 3KBGA 1SBBB 2AQ1B 3ULLA 2GVAA 2JXMB 4CBVA 4C3JH 5ELNA 3QR8A 2F3VA 1JQYD 1PRTC 4OL7A 4FF3A 3I91A 3W5OA 2RF4A 1EU4A 4OO1H 2VB2X 2VUMB 4LF7L 1ET9A 1GUOA 1SYBA 4C3IG 1LT3D 1CK1A 1WOCA 2OF1A 4A3CG 2E2JB 3QO2A 2X6LA 4HJAA 5IWAQ 2RDFA 1PH6A 1TWGH 2A73B 1V1QA 1EEFD 2B39A 2K5DA 5CBEE 3HFZB 2F0IA 4KJOA 2EDGA 2L15A 3MVVA 3F1ZA 2JA5H 5A2QL 2E5LQ 1KRSA 5JPMC 2XWJB 5FJ8H 1HUNA 5IYBH 3KFUA 1LTBD 1VMCA 2K7VA 2Z6BA 1E22A 1UE7A 2H5XA 3S2DH 2WKDA 2VUMG 1S5CD 2TMPA 1OO9B 1D1IA 1SE8A 2B2UC 2NBFA 2B2YA 5C3EB 4A3KB 4RCNA 4DXFA 3C2PA 4FXKC 1RTOA 4LFCQ 3R8BA 4BS9A 1JC7A 1BF4A 4C3HB 2F0EA 1TWAH 1IBMQ 1R4QB 1EY6A 1XMQL 3NWTA 1CFMA 4X3SA 3T56B 4NKLA 2F0LA 2LXJA 1IZ6A 4DV0Q 1EZ6A 2F0MA 3R3OA 3VYSA 1HTLD 5FO9B 4IFDI 5C5LA 4DR7L 3HRZC 1Y8PB 3IKJA 4PQXA 3S2HB 1TQOA 1T9HA 2Z0SA 1PDQA 1L1OB 5C3EG 4A3KG 5GAHC 2KCCA 4P71A 3FHWA 4IUUA 2IJ0A 3D0FA 3KOJA 1U4MA 3RR5A 4EQNA 4C3HG 3I4NB 5JEAJ 3ITPA 1WFQA 2KQ3A 2EJFC 1VF7A 4CDFC 2IT1A 2VS1A 3HGBA 4LW1A 4OIKA 3HOWB 2NYZD 3S16H 5GAGC 3K7AB 1KNAA 4G7ZC 1AZPA 1EZ8A 1QVFA 2NTSA 1IYUA 4G7OC 1O7IA 4IUQA 1CQFA 5DNFA 1F2MA 3SXHA 4Z9CB 4QL5A 2I0QA 5COYA 5JOBA 4MNOA 1K0RA 1XMOQ 4TSSA 3R93A 3PUWA 4OWTB 1NMFA 1L0WA 3GTJB 1V1PB 1EQQA 1G2TA 4X62Q 2EYMA 3HZXA 2I5MX 1B2TA 3MFYA 1WTQA 1TXYA 2YU9B 1STYA 5CMDA 4JI7Q 4A3GB 2ZM6Q 2XNAC 3I4NG 4C1NI 1VQDA 1Q46A 1QUQB 4A75A 1TY2A 3GV6A 2YV5A 3J80i 1VQHA 3HOWG 1CT1D 2ZT9C 5C4JB 5LMUL 1BDOA 4NW2A 1GJXA 1AW7A 4DAMA 4DV7Q 2D5DA 5CORA 3GTKH 2A19A 1B9MA 4A3MH 2HT1A 1I4GA 5ELEA 4X65Q 4Q5VA 2SNMA 2NUCA 5DM63 4JV5L 4BA2I 1P8LA 3H09A 1VQ5A 3NQIA 1ENCA 3TP7A 1H9RA 5M9OA 2ALYB 1XNRQ 2H4OA 2M00A 1HNWL 4A3GG 1SJHD 4QF4A 4ZUIA 3A54A 4KY5A 4K8JA 1L0YB 1EYAA 1EOTA 3J7A5 4IQZA 4YHHQ 5EAYA 2QF7A 1CHPD 2N88A 4QIWE 2K50A 1EIYB 4FNFA 4IFDH 3OSOA 1YBYA 1EQRA 3A0JA 3T53B 1A6XA 1QZHA 2K28A 3N6RA 1QG7A 1Y1VH 3HKSA 2OQKA
chains in the Genus database with same CATH topology
3L3OC 1G8ZD 5JEAG 2XRSD 3K59A 2VXWA 1QWYA 4N9PA 1AFPA 4CJ0B 1Q3LA 4WRDA 2PPBC 1BNZA 2C5CA 3LX0A 4DAYA 3NXWA 1EIGA 3W3AA 4ZRZA 4HCEA 1FGBD 4K2KA 5EBCA 3PIP3 3JAML 1LT4D 2RVLA 1FNWA 1W6JA 4B08A 1G2SA 4R8NA 5LL6S 1D2BA 1RJTA 2CQAA 4N9TA 2A6HC 1Y8NB 3LNNA 2DNEA 3PUVA 4DN4M 2JEAI 1ILQA 5A2QE 3V05A 4WJWA 2L12A 1MD2D 1QILA 5KGUA 1DOKA 1EIHA 4KD3A 2JYOA 1STHA 2HDLA 1LTRD 1CZWA 1SEBD 4K5WA 2Z4HA 4KHZA 2E74C 1OXVA 2BE5C 1TS5A 3KBXA 2EYHA 3H3VC 3FMCA 3GP7A 1DD2A 4I7ZC 3SEBA 1AEXA 4KN7C 1JOKA 2WB1B 4A3FB 1JICA 1NR2A 1GUSA 1NSNS 3S1NB 1TR5A 2L11A 3P1HA 5JPNC 4XQNA 2RDHA 3J7YW 3ND9A 1NUCA 2R7ZB 1WVLA 5LL6X 1EYDA 2BA1A 1BXTA 3EROA 2A6EC 1VMPA 2CW0D 1F2LA 1HCZA 5M5WB 4MN3A 2KOLA 2PZWA 3BS1A 5KYLA 3T51B 3NBHA 3MZ5A 4OGQC 1JCKB 2A69D 3TSSA 1ZYRD 1VCIA 4XTCS 2FMCA 2PQEA 1PTOH 3C46A 2F0WA 4FVMA 1E2VA 4QIWB 3KUPA 4CKEA 1PFBA 1D5MC 2ENBA 5T1IA 1J8IA 5K5PA 1I4RA 3D31A 1SNPA 2M2LA 4G7HC 3K0YA 1GXDC 4X3UA 2B63B 3MXPA 1I4XA 2K05A 5M3MB 5EQ0A 1ONLA 2R61A 2IL8A 2I46A 4V190 3T4AC 3DWQA 3OW7A 1EQTA 2C9OA 2K6AA 3H94A 3OMCA 3BVMA 3HOZB 5C44B 1MGSA 4A93B 4JBWA 4BBSB 3MXGA 2HQEA 1BCPD 5A35A 3A8JE 5C3WA 1JR0D 3SHLA 5LHY1 3NTKA 2O2LD 2IX3A 2F0UA 2E2DC 1EFID 3CRKC 2IW3A 2NVYB 4A3EB 3FEWX 3SK6A 2E2HB 4Y7NB 2PZUA 3DEPA 2EE1A 1BUVT 5DEHA 2EJGC 1BCPF 4RHRA 4H0LC 1SYCA 4HN7A 5EKKA 3O13A 2F0PA 1I50B 1D5ZC 1JWUD 3VA7A 3S14B 3JAME 4FO2A 4EGVA 2BDOA 4ZK9B 5C4HA 5CV8A 2EY6A 1H9MA 2JE6I 4K5XA 5KRUA 4F87A 2VB3X 1Z6HA 1STGA 1HPCA 2FINB 2KEEA 1RCVD 5D3IB 3GTQB 3D6WA 1HA5A 3PUYA 2PNRC 4ODGA 3BG3A 4MIUA 4L63B 1KTKA 3K5OA 4KD4A 4H13C 4WORA 1QOHA 4RH6A 2MHVA 3A7AB 1RKNA 2PW5A 1RDPD 3K5MA 1Z47A 3C3LA 1R9TB 3VR4A 2WAQB 1TIID 5IGBA 1PTOF 2A68C 5G3LD 1IKMA 5IT9E 3FVQA 3F2UA 3MXNA 1KAAA 3K6OA 2A5HA 3OIPA 1B50A 3IFTA 1ML0D 1PRTF 2RQXA 2NVXB 1F9QA 1O7LA 2F0VA 2L1BA 4J1MA 5C4XB 4YIJA 4HMJA 2KA7A 1BO0A 4C1NK 4KJNA 4QUCA 2XVSA 2DN8A 4BY7B 5G3LF 1OXSC 3A56A 3NK9A 5D3DA 4U673 1B44D 1EWCA 1E0BA 5KEEA 4XQQA 1JWMD 2EJMA 1VDZA 2F3WA 5CV5A 5F2DA 3VR5A 2XWBB 2AQ2B 1CI3M 3CRLC 3BVZA 1RHPA 3UI2A 5D14A 4DK1A 3MA2B 3QOJA 2AWOA 2OEOA 2R92B 3BDLA 1JWSD 1HHVA 5D65A 3VYRA 3NTIA 3OWEB 1ZKOA 4RCOA 1DJRD 5CBAE 5JVH3 4XQJA 1SJED 3VYUA 4BWGB 1F9PA 5NUCA 3PIO3 4KKTA 2KEDA 4K2LA 5JEAH 4DNRB 2KHSA 3MWYW 1TS4A 2BOSA 4RWSC 1M4VA 4XIGS 2AWNA 1EL0A 2NTTA 3X3NA 3CU7A 1R4PB 4DNTB 1XX8A 3M85A 4A3IB 5KNCA 5C0XJ 4GZYC 3S1QB 1Q90A 5I4DA 2F0OA 4KI0A 1KDBA 4IUTA 1RD9D 2HCCA 1VF5C 1SYDA 4RHSA 1QE6A 1YNNC 5C6AA 1SE3A 2EVBA 3K57A 1B4OA 3GV3A 3L7ZC 2DNCA 3HEJA 4ZKCB 1WD0A 1V43A 3GTLB 2EY1A 2LKVA 2MPMA 3MFGA 3TP8A 2IPKD 4QB4A 5EKIA 4XXEA 4G4KA 3HOVB 2HUGA 3FPPA 5E4XA 1A3VA 1CA5A 3CKIB 1EY0A 2BCOA 3KLSA 2AQ3B 3SE0A 1D5XC 1JB3A 3PO3B 5KNDA 3RZDB 5I9PA 3L9AX 2Q8IB 1SMYD 5J39A 3I3CA 2F0TA 3E5SA 4C3JB 2K01A 1YNJD 4PMCA 4HSVA 1SXTA 4HEDA 4O42A 2O5JC 1S5FD 2F0KA 4HSPA 2K33A 2NN6G 1PFNA 3LWUA 1Y1WB 1TWGB 3QB3A 1DYQA 2AUJD 3H0GB 5C0XG 5KYIA 5IGGA 2SDFA 4C3JG 1LTGD 5CV7A 2Z4IA 2NZ1D 2NVTB 1HRJA 4ZAIA 3I4LA 3NBIA 3PMFA 2BA0A 1GHKA 3KK7A 1QCBD 5EBDA 2LFNA 3MEHA 1PXUA 1IW7D 1QB5D 1H9SA 4NP5A 3IAYA 2FJ2A 2XSCA 4LMQD 4IUNA 4KK7A 2B2TC 3TZDA 1SE2A 1LTAD 4F7XA 1GUGA 3GD7A 1SYGA 2O5IC 4I65A 4B9XA 3TP6A 4QMGA 4BY1B 1AZQA 4DU9A 1PZJD 4FP5D 1GUWA 1UAPA 4J8QA 1DONA 2ZXOA 3I90A 3Q0AA 2Q8TA 4CHTB 3OPOA 1G91A 3HOYB 1E2ZA 4DFAA 3QJYA 3RMHA 3QWNA 3H91A 3S16B 4AYBB 5HURA 4ZKBB 1XYIA 1SNQA 2EYFA 2J0TD 1LT5D 2E75C 3QIAA 3HOXB 1HFNA 1X32A 1EY5A 4UDUC 4RGOS 1B9NA 2QCPX 3HS0C 1Y8OB 4K8IA 2EXZA 5FOBB 1PMRA 1HXYD 4RGMA 1XWEA 2GA4B 1TVXA 5IT9L 3NQTA 3GTKB 4A3MB 2RSOA 2PCFB 3H6MA 1RODA 3OHXC 2ICEC 1CQVA 1F2ZA 1TWCB 2K5WA 1NCVA 4LK1C 1TT2A 2WACA 1AN8A 4DK0A 4FF1A 1H9JA 3BVGA 4TQUS 1Y1VB 1JE4A 2EPBA 2OT2A 2EYJA 3M4YA 3SK4A 3FDTA 1HA6A 1LTID 3IL8A 3MTSA 4RKLA 4EQOA 2MGSA 2G9HD 3A8KE 1BBXC 5FO8B 2KJXA 2B2VA 3V2TA 4CKCA 1GOZA 1LT6D 2WIIB 5K36H 4FF4A 2LS01 1WTRA 3AB9A 2MP1A 1SFOB 3EQLC 3ND8A 5AFWA 4KMUC 1ESFA 1BCPB 1F9RA 5CV6A 2IX1A 1FYCA 5C3XA 4M8AA 2CVRA 1WD1A 4QCLA 5JAVA 4PMBA 2FMMA 4K5VA 3J7AF 4O1NA 3NUCA 2CW0C 1O78A 1DOLA 5I6WA 3BDOA 2SNSA 5T1GA 1S4ZA 2JA7B 1MSHA 5M5YB 4XT1B 3DHQA 4C56C 2A69C 3DWAA 3URYA 5KIXA 1C8CA 1ZYRC 2A74C 2F0QA 5TSSA 2N55A 2F0SA 2X6GA 1FNUA 4A3JB 1Q12A 3Q6SA 4KY6A 4WFN3 5JVG3 4H7BA 4DAVA 4KHVA 3Q22A 2BDNA 1B53A 2NWGA 1T5XD 5ISRA 4ABNA 2J4XA 2NN6I 4IUVA 3KF8A 2JEBI 3A8IE 3WDNA 2ZXRA 4RFBA 1U4RA 4L8JA 1PLFA 5C0XI 1MI2A 1JOQA 1PTOD 1C48A 1PTOB 4PNYA 2VNUD 1RF2D 1CA6A 2JP1A 4UAIA 3MHBA 1BCPC 1PRTD 1FR3A 3QOLA 1PRTB 1IKLA 3P20A 1XXGA 3P75A 4RAUC 1TU2B 5ELDA 1NR4A 5KNBA 4ZLTF 1U4PA 5IGFA 3ERQA 3DXJC 1LO5D 2L0CA 4EQPA 2B2YC 3OOCA 3TMEA 2B2WA 2R93B 3BYTB 1W6KA 2G9DA 1SNCA 3GQBA 5EPLA 2K1BA 1ZEQX 1ILPA 5JJZA 1X3QA 1HUMA 4FXGC 4ZYSA 2L4NA 2PMZB 2QILA 4JK1C 2IWHA 2K04A 3KLRA 1EY4A 1KLUD 3I72A 4IZ8A 1O80A 3DMUA 1TS3A 5IGCA 3PO2B 4OHJA 4K6DA 2EY2A 3LWEA 4G57A 1EWHA 2JSOA 2LMCB 3M3YB 1ZXTA 3X3MA 3NWSA 3KLSX 1H9SB 3SDZA 1BR9A 2NN6H 3M4OB 3D4WA 1I4QA 1QNUA 3K5LA 1K8OA 1OXXK 3HOUB 5C0XH 3VYTA 5HGTA 2F0JA 1MSGA 4FF2A 1A3UA 4HTHA 4CGYB 1V1OA 3GTPB 2X69A 3MXUA 5ELCA 3TDQA 3WOEA 5E4WC 1TKWB 1SE4A 5J1ZA 5IGEA 3T13A 4KV6A 1DZ1A 3AMUA 4KKUA 2FHTA 2NB0A 1LTSD 1PZKD 4R9WA 1STBA 4L6TB 1HQRD 1WCMB 3NTHA 2F0GA 2KVMA 1Q1EA 1CTMA 1STEA 2PZTA 2B8GA 4DAPA 3FKIB 4M1UB 2TSSA 1EY7A 1ESRA 4NMZA 1S5DD 1IYVA 4ILWA 1SNDA 3HG9A 4Q0FA 3E0JA 2WKCA 5ELFA 3RZOB 3GO5A 1UUPA 3D6CA 4ZUJA 2F0NA 2ICIA 4HAEA 4RGNA 1LV9A 3RD4A 1RTNA 1HQMC 3SK8A 2K03A 2E2IB 3FPUB 3EJIA 3RLFA 3I4MB 4QUFA 5C4ZA 1SYFA 1HTPA 1QNKA 4DXGA 2B8FA 1A2UA 1SAPA 3SK5A 3OIQA 4IALA 3NHHA 4C2MB 3S15B 2DY8A 1WTOA 3J81L 3M7NA 1K83B 5FO7B 4V0BA 4HMIA 4MHEA 4KTAA 1BOSA 5CV4A 3TBIB 1SSOA 1J9OA 1I6VC 4RGTA 3ZYYX 2A6HD 2CHBD 4LJZC 5E1FA 3NPPA 2JA5B 3D4DA 4F88A 1FD7D 1QJOA 2Y0SB 2B2UA 4X3TA 3S2DB 2Q8RE 4XDXA 4OO1G 3TN2A 2WINB 1IHZA 2L55A 1EY9A 2EY5A 1I4PA 3D4RA 2BE5D 5CYUA 2OXPA 5DAUA 3PUZA 3HP3A 1TWAB 2WP8J 2Z8LA 3WOFA 1KDCA 3P7JA 1STNA 3W2DA 1UEAB 4KN4C 2QKIC 4IUPA 4H44C 3OWFA 1A2TA 1H9KA 1Q1BA 3ONAB 4DGZA 4ZQ3A 5DM73 1G6ZA 1D6EC 5I2XA 3K58A 2O4XA 2K5QA 1DOMA 2RBMA 1SMYC 2A6ED 1EU3A 1ET6A 1AP0A 1YNJC 3I73A 1KNEA 5BN5A 4A3DB 1EQVA 2DY7A 3VR6A 1A15A 4ULLA 1FNVA 1TY0A 1DCZA 1S5ED 3V96A 2KUMA 5BN3A 3OMGA 3R2IA 2B2VC 2EYOA 1B3AA 1U4LA 4HR7B 3N52A 2MJ8A 4IFDJ 1A3TA 2R3ZA 2E76C 4S3SA 5EGTA 5FLXL 1D1KA 5IODA 3S9WA 5CGKA 4PMWA 3G6JB 4R8IA 1SDFA 3PV0A 1JORA 5C5MA 1IW7C 2L5TA 3K5NA 3C1EA 1ENAA 4F8MA 3D3RA 3J80L 2D62A 3DUZA 2RKSA 3T16A 1DM0B 1CZGA 3Q24A 1TS2A 2ZXPA 1OXUA 5EPKA 3BDCA 5CV9A 2K32A 4FXDA 2QDBA 3MAQA 5ELBA 4KKSA 2EZVA 1SNMA 1F2YA 5EJWA 2J7ZA 5M3FB 4NDXA 4RKBA 2PYKA 2B2TA 3A55A 1KDAA 1I6HB 4PV1C 4IURA 5FKAC 2V4DA 1Q8IA 1V8QA 3J81E 3S1MB 4EVOA 1PYWD 2LY7A 3EVQA 4U68A 4A3BB 1F9SA 1ENFA 1WTPA 4HCSA 3U9SA 1HFGA 1Z7TA 1V1PA 3VR2A 2F1MA 2WV6D 1IL8A 2XN9C 2JA8B 3BZDB 1LACA 4CJ1B 3SVMA 1LABA 4IFDG 3VR3A 2D2CC 4BA1I 3S17B 3G7LA 1WTWA 3DEOA 2RDGA 2F4IA 3I8ZA 5IGDA 1TWFB 4J6HA 3GTMB 3DWPA 4LAAA 4K14A 1PZID 1K8MA 1EEID 1PFMA 4FYDA 1M8AA 2SEBD 4RA8A 2D9UA 3I70A 4TRDA 1MBYA 2FFKB 1TWHB 1SYEA 5IIFA 4KY7A 5BN4A 1EY8A 1SNOA 2M9VA 3C1FA 3U9OA 3HKZB 4K6LA 2B2WC 1I3QB 1O7YA 4DF7A 1C4QA 3TZUA 5M5XB 4ME5A 1B1ZA 4XYQA 4BBRB 2QEJC 5CR3A 3R2TA 2JA6B 1T5EA 1CM9A 2R6GA 4E6IA 2MUYA 1LTTD 5I6YA 2A68D 3BYYB 3E6ZX 1KLGD 1UNSA 4XYOA 4P2CB 1WTVA 1CHQD 3D8GA 1GHJA 5FK9C 2IX0A 2XRQD 2PO4A 1KABA 2L9HA 2XIWA 5IOCA 1I4HA 2RA4A 2EYLA 4TKOB 2KECA 1JOOA 3DM1A 4CJ2C 1U9RA 5I9OA 1LLRD 1ICWA 1L0XB 3GTGB 3QG1A 1GUTA 3NSWA 3S1RB 5EPJA 1BQQT 2ID0A 2F0FA 3Q23A 1G291 3IFDA 5EKLA 2EYPA 3EFXD 3PUXA 4OO1I 2H1EA 1II3A 2Z1CA 5FLXE 2PW7A 3EA6A 3NE5B 3TP5A 1F77A 2HCIA 1WTXA 3CQZB 1S5BD 3MC0B 5CC4A 2F03A 2EOTA 4XT3B 3M7GA 2YYZA 1E2WA 3J80E 1GUNA 1Y69U 2KCNA 3J7AV 2SOBA 2F0DA 1O7ZA 4X3KA 4B9WA 2NVQB 1XTCD 2F0HA 5K36G 2HDMA 3NP8A 4ID6A 5I2YA 2I07B 1DXMA 3GTOB 3AU7A 4C3IB 1OXTA 4IN3A 2RSNA 4DA2A 1NAPA 3SR1A 5J22A 5E3FA 3RUZA 3VA5A 1YNND 1PTOC 4CKBA 1STAA 2AUKA 3A7LA 3CHBD 4OIJA 1EYCA 3FRPB 3KBGA 1SBBB 2AQ1B 2JXMB 4CBVA 2F3VA 1JQYD 1PRTC 4OL7A 4FF3A 3I91A 1EU4A 4OO1H 2VB2X 2VUMB 1ET9A 1GUOA 1SYBA 4C3IG 1LT3D 1CK1A 2OF1A 2E2JB 3QO2A 2X6LA 2RDFA 2A73B 1EEFD 2B39A 2K5DA 5CBEE 2F0IA 4KJOA 2EDGA 3MVVA 5A2QL 5JPMC 2XWJB 1HUNA 1LTBD 1VMCA 2K7VA 2WKDA 1S5CD 2TMPA 1OO9B 1D1IA 2B2UC 2NBFA 2B2YA 5C3EB 4A3KB 4RCNA 4DXFA 3C2PA 4FXKC 1RTOA 3R8BA 4BS9A 1JC7A 1BF4A 4C3HB 2F0EA 1R4QB 1EY6A 3NWTA 1CFMA 4X3SA 3T56B 4NKLA 2F0LA 1EZ6A 2F0MA 3R3OA 3VYSA 1HTLD 5FO9B 4IFDI 5C5LA 3HRZC 1Y8PB 3IKJA 4PQXA 3S2HB 1TQOA 1PDQA 2KCCA 4IUUA 2IJ0A 1U4MA 4EQNA 4C3HG 3I4NB 5JEAJ 3ITPA 2KQ3A 2EJFC 1VF7A 2IT1A 3HGBA 3HOWB 4OIKA 2NYZD 4G7ZC 3K7AB 1KNAA 1AZPA 1EZ8A 2NTSA 1IYUA 4G7OC 4IUQA 1CQFA 5DNFA 1F2MA 3SXHA 4Z9CB 5COYA 5JOBA 4TSSA 3R93A 3PUWA 3GTJB 1V1PB 1G2TA 2EYMA 3HZXA 1B2TA 3MFYA 1WTQA 2YU9B 1STYA 5CMDA 4A3GB 2XNAC 4C1NI 1TY2A 3GV6A 1CT1D 2ZT9C 5C4JB 1BDOA 4NW2A 1GJXA 1AW7A 2D5DA 5CORA 1B9MA 1I4GA 5ELEA 4Q5VA 2SNMA 2NUCA 5DM63 4BA2I 3H09A 3NQIA 1ENCA 3TP7A 1H9RA 5M9OA 2H4OA 2M00A 1SJHD 4QF4A 4ZUIA 3A54A 4KY5A 4K8JA 1L0YB 1EYAA 1EOTA 4IQZA 2QF7A 1CHPD 2N88A 4FNFA 4IFDH 3OSOA 3T53B 1A6XA 2K28A 3N6RA 1QG7A 1X3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGG A;  3QOL A;  3SK6 A;  2EYL A;  5J1Z A;  1JOO A;  2PZU A;  3ERO A;  5E3F A;  3RUZ A;  4HMI A;  2F0V A;  3P75 A;  3VA5 A;  3T13 A;  5IGE A;  1U9R A;  4J1M A;  4N9P A;  4K8I A;  5DEH A;  5CV7 A;  5I9O A;  4YIJ A;  2EXZ A;  1STA A;  4KTA A;  4WRD A;  4KV6 A;  1EYC A;  5CV6 A;  3LX0 A;  1SYC A;  4HMJ A;  4EQN A;  5EKK A;  3NXW A;  5CV4 A;  3OMG A;  5C3X A;  4KJN A;  2F0P A;  2PZW A;  5IGF A;  3ITP A;  3ERQ A;  2KQ3 A;  3PMF A;  2F0O A;  4K2K A;  5IGD A;  5KYL A;  1STB A;  2EYO A;  2F3V A;  1KDB A;  2F0F A;  3MZ5 A;  4J6H A;  4OL7 A;  4QF4 A;  4ZUI A;  5JAV A;  4PMB A;  5E1F A;  1SYD A;  4KY5 A;  1A3T A;  1EZ8 A;  2EYP A;  3MEH A;  4K5V A;  4LAA A;  3NQT A;  2F0G A;  4K14 A;  4NP5 A;  3NK9 A;  3TME A;  5C4H A;  3NUC A;  2PZT A;  5C3W A;  3D4D A;  4R8N A;  5C6A A;  1II3 A;  1SYB A;  1F2M A;  5I6W A;  3SXH A;  5KEE A;  5CV8 A;  2PW7 A;  2OF1 A;  2SNS A;  4IUN A;  4S3S A;  5EGT A;  1SNC A;  2EY6 A;  2F3W A;  5CV5 A;  3H6M A;  5JOB A;  3TP5 A;  5IOD A;  3S9W A;  2RDF A;  4K5X A;  4N9T A;  5F2D A;  5CGK A;  4TRD A;  1EY7 A;  2PQE A;  4F7X A;  2F0W A;  1F2Z A;  3HEJ A;  3DHQ A;  5KRU A;  5CC4 A;  1SYG A;  5J22 A;  2EYM A;  4NMZ A;  5C5M A;  1JOR A;  3HZX A;  2F0I A;  1IHZ A;  1SYE A;  4I65 A;  4B9X A;  5IIF A;  4KJO A;  4KY7 A;  1EY4 A;  1SND A;  3MVV A;  1EY8 A;  1STY A;  1STG A;  2ENB A;  4QMG A;  1TT2 A;  3TP6 A;  2WAC A;  2EY1 A;  1SNO A;  3C1E A;  2F0Q A;  1EY9 A;  2EY5 A;  2LKV A;  3TP8 A;  3C1F A;  1ENA A;  4F8M A;  4IZ8 A;  3D6C A;  2F0S A;  3DMU A;  4QB4 A;  5EKL A;  3U9O A;  4DU9 A;  5K5P A;  5KGU A;  4ZUJ A;  5IGC A;  2F0N A;  4KD3 A;  4KY6 A;  1A3V A;  3QOJ A;  2OXP A;  2RKS A;  4K6D A;  3T16 A;  2EY2 A;  2SOB A;  1STH A;  1SNP A;  1EY0 A;  4G57 A;  5DAU A;  4DF7 A;  2OEO A;  2F0D A;  3SK8 A;  4H7B A;  3BDL A;  1KDC A;  3BDC A;  4K5W A;  3MXP A;  4KHV A;  4ODG A;  2EYJ A;  4ME5 A;  5CV9 A;  1STN A;  3SK4 A;  2QDB A;  4MIU A;  4B9W A;  5I9P A;  5CR3 A;  5J39 A;  3EJI A;  4KD4 A;  5ISR A;  1SNM A;  2F0T A;  1F2Y A;  3E5S A;  3D4W A;  4E6I A;  2EYH A;  3OWF A;  1SYF A;  5C4Z A;  1A2T A;  3OMC A;  4NDX A;  4RKB A;  4RKL A;  4WOR A;  4DFA A;  4EQO A;  5I6Y A;  2SNM A;  2PYK A;  2NUC A;  4DGZ A;  1KDA A;  1AEX A;  2F0E A;  4ZQ3 A;  4PMC A;  5NUC A;  4EQP A;  1EY6 A;  5KIX A;  1ENC A;  3TP7 A;  1JOK A;  1RKN A;  2PW5 A;  2HQE A;  5M9O A;  2F0H A;  2M00 A;  2O4X A;  5HUR A;  2F0K A;  1A2U A;  4NKL A;  2F0L A;  3SK5 A;  5HGT A;  2F0J A;  1SNQ A;  2EYF A;  3NHH A;  2RBM A;  3NP8 A;  4ID6 A;  4IAL A;  1A3U A;  4K2L A;  1NSN S;  4K8J A;  1EZ6 A;  1EYA A;  4HTH A;  4EVO A;  3D8G A;  2KHS A;  3V2T A;  2F0M A;  1TR5 A;  3R3O A;  3P1H A;  3SHL A;  5IGB A;  3EVQ A;  1JOQ A;  3QB3 A;  4PNY A;  3OSO A;  1NUC A;  5C5L A;  1KAB A;  2F0U A;  5IOC A;  1KAA A;  3SR1 A;  1TQO A;  1EYD A;  1EQV A;  5KYI A;  3MHB A;  1EY5 A; 
#chains in the Genus database with same CATH topology
 3CW2 C;  3L3O C;  1G8Z D;  5JEA G;  3AFQ A;  1VQ6 A;  2VL6 A;  5E7N A;  1VQG A;  3S1M H;  2XRS D;  3K59 A;  2VXW A;  1QWY A;  4N9P A;  1AFP A;  4CJ0 B;  1Q3L A;  4WRD A;  2PPB C;  4A3B H;  1BNZ A;  2C5C A;  3LX0 A;  4DAY A;  3NXW A;  1EIG A;  3W3A A;  4ZRZ A;  4JI6 L;  2UUB Q;  4HCE A;  1FGB D;  1VQA A;  4K2K A;  4DUZ Q;  1PVO A;  5EBC A;  3PIP 3;  3JAM L;  1Q81 C;  1N33 Q;  1LT4 D;  2RVL A;  1FNW A;  1W6J A;  4B08 A;  1G2S A;  4DV5 L;  4R8N A;  5LL6 S;  1D2B A;  1RJT A;  2CQA A;  3S17 H;  4R4I A;  4N9T A;  2CKZ B;  2A6H C;  1Y8N B;  3Q8D A;  3LNN A;  2ZTE A;  2DNE A;  3ERS X;  3PUV A;  4DN4 M;  2JEA I;  1ILQ A;  5A2Q E;  3TRE A;  4GLA C;  3V05 A;  3RN2 A;  1V9P A;  1S3O A;  4WJW A;  3TS2 A;  1KHI A;  2L12 A;  1MD2 D;  1SFO H;  1QIL A;  5KGU A;  1DOK A;  1VQC A;  1EIH A;  4KD3 A;  2JYO A;  2N3S A;  1STH A;  2HDL A;  1TWH H;  4NXM L;  1LTR D;  1CZW A;  1SEB D;  2GVB A;  4K5W A;  4GNX A;  2Z4H A;  4KHZ A;  2E74 C;  2K14 A;  1PFS A;  1OXV A;  2BE5 C;  3KDF B;  4DV1 Q;  1TS5 A;  1PH5 A;  3KBX A;  3SGI A;  2EYH A;  3H3V C;  3FMC A;  1GVP A;  1UWV A;  3GP7 A;  5IT9 c;  1DD2 A;  5IY0 A;  4I7Z C;  3SEB A;  1AEX A;  2JA7 H;  4KN7 C;  1GO3 E;  1JOK A;  2WB1 B;  5M5Y H;  4A3F B;  4JI0 Q;  1NR2 A;  1JIC A;  1GUS A;  1NSN S;  2CFM A;  4LF4 L;  1AE2 A;  4PZ6 A;  3S1N B;  1TR5 A;  2L11 A;  3P1H A;  5JPN C;  4XQN A;  4UP8 A;  2RDH A;  3J7Y W;  3ND9 A;  1LTL A;  4AH6 A;  1NUC A;  2R7Z B;  4X66 Q;  5AJ3 L;  3PGZ A;  1WYD A;  1WVL A;  5LL6 X;  4EQ5 A;  1EYD A;  2PQA A;  2BA1 A;  1BXT A;  4YCW A;  3ERO A;  2A6E C;  5BR8 L;  1VMP A;  2CW0 D;  3AYH B;  1HR0 Q;  1F2L A;  1HCZ A;  5IYD H;  5M5W B;  4MN3 A;  2KOL A;  2PZW A;  4R4Q A;  2RHQ B;  3BS1 A;  2R7D A;  1B8A A;  5KYL A;  4A3F G;  3T51 B;  3NBH A;  3MZ5 A;  3B6Y A;  4OGQ C;  1JCK B;  2A69 D;  4P72 A;  4DV4 Q;  3OTO Q;  2DUD A;  3BU2 A;  3TSS A;  1ZYR D;  4K0K L;  1VCI A;  2R7Z G;  4XTC S;  4GLX A;  3S1R H;  3JC6 6;  3I7F A;  2FMC A;  2PQE A;  1PTO H;  3C46 A;  2F0W A;  3U50 C;  4FVM A;  4WJ4 A;  4JI8 Q;  1E2V A;  4QIW B;  3KUP A;  4CKE A;  1PFB A;  1D5M C;  2ENB A;  2KHJ A;  5T1I A;  4IPC A;  3GDE A;  1J8I A;  5K5P A;  3PF5 A;  1I4R A;  3D31 A;  4DPG A;  1SNP A;  2M2L A;  4G7H C;  2VZA A;  1PH9 A;  3K0Y A;  1GXD C;  4X3U A;  4A4I A;  2B63 B;  4R4C A;  1SN8 A;  3MXP A;  1I4X A;  2K05 A;  4O2D A;  5M3M B;  5EQ0 A;  1EIF A;  1ONL A;  2IL8 A;  2R61 A;  2I46 A;  4V19 0;  3T4A C;  3DWQ A;  4JCV E;  3OW7 A;  1FL0 A;  1EQT A;  2C9O A;  2K6A A;  2R93 H;  3H94 A;  3OMC A;  3BVM A;  3HOZ B;  5C44 B;  1MGS A;  4A93 B;  4JBW A;  1KIX A;  4BBS B;  3PCO B;  3MXG A;  4CDC C;  3UDF A;  2HQE A;  1BCP D;  2JN4 A;  2ES2 A;  5A35 A;  3A8J E;  5C3W A;  4B3M L;  2OCE A;  4B3T L;  1JR0 D;  1W3S A;  3SHL A;  5LHY 1;  3NTK A;  4DR1 Q;  2O2L D;  2IX3 A;  3T1H L;  2B63 G;  1EFW A;  1Q86 C;  2F0U A;  2E2D C;  1IBM L;  2K5N A;  1EFI D;  3PO2 H;  2ATW A;  3CRK C;  2IW3 A;  5M3M G;  2NVY B;  4A3E B;  3FEW X;  3SK6 A;  2E2H B;  4Y7N B;  2PZU A;  3DEP A;  2UUC Q;  3M3Y H;  2EE1 A;  1BUV T;  5DEH A;  1W2B A;  2EJG C;  3HOZ G;  1BCP F;  2QGQ A;  4RHR A;  4H0L C;  1SYC A;  5C44 G;  4HN7 A;  4C3I H;  4A93 G;  5EKK A;  3O13 A;  4BBS G;  4DR2 L;  1N8R C;  2F0P A;  1I50 B;  3M4O H;  1D5Z C;  1JWU D;  3VA7 A;  3S14 B;  3JAM E;  2PI2 E;  4FO2 A;  4EGV A;  4IOA A;  2BDO A;  1YIJ A;  2BH2 A;  4ZK9 B;  1A0I A;  4ZCK A;  4JBJ A;  4YY3 Q;  5C4H A;  5CV8 A;  5IYC G;  3KJP A;  2EY6 A;  1MIU A;  1H9M A;  2JE6 I;  2D0O A;  4K5X A;  2UU9 L;  3GTP H;  4A3E G;  5KRU A;  1YIT A;  4F87 A;  2VB3 X;  2VUM H;  1Z6H A;  1STG A;  1HPC A;  3TS0 A;  1J6Q A;  2FIN B;  4AIM A;  2KEE A;  3G6E A;  1RCV D;  1FVI A;  5D3I B;  1XMO L;  3GTQ B;  3D6W A;  1A63 A;  1HA5 A;  3PUY A;  2PNR C;  4JI3 Q;  2N49 A;  4ODG A;  4DK3 C;  3BG3 A;  2ZJR A;  1JMC A;  4MIU A;  4L63 B;  4YWK A;  1KTK A;  2Z6K C;  3K5O A;  4KD4 A;  1WCM H;  4LF9 L;  4H13 C;  4WOR A;  1QOH A;  4RH6 A;  2MHV A;  3A7A B;  2F4V Q;  1RKN A;  4X64 L;  2PW5 A;  1KC8 C;  1RDP D;  3FKI H;  3K5M A;  4POG A;  1Z47 A;  3C3L A;  1R9T B;  3F2D A;  1BBW A;  2MO1 A;  3VR4 A;  2WAQ B;  4NXN L;  1TII D;  4DV7 L;  5IGB A;  1PTO F;  4FDB A;  2A68 C;  3RZO H;  5G3L D;  1IKM A;  5IT9 E;  2YTV A;  3FVQ A;  3F2U A;  3MXN A;  1KAA A;  3K6O A;  2A5H A;  3OIP A;  1B50 A;  3IFT A;  1HNZ Q;  1XNR L;  1ML0 D;  3MEF A;  1PRT F;  2UUA Q;  3H3V I;  2RQX A;  2NVX B;  1F9Q A;  1O7L A;  2F0V A;  2L1B A;  1K3R A;  4J1M A;  5C4X B;  1CSQ A;  4YWL A;  4YIJ A;  3K8A A;  2E2I H;  1YHB A;  4HMJ A;  2KA7 A;  4IPD A;  4RMF A;  4LF5 Q;  1BO0 A;  3EN2 A;  4C1N K;  4KJN A;  3I55 A;  1X3G A;  4QUC A;  3S2H H;  3E9H A;  4P74 A;  2XVS A;  2VQE Q;  2Q2T A;  1MHW C;  3K0X A;  2DN8 A;  4BY7 B;  1K8A C;  5G3L F;  1OXS C;  3A56 A;  5J3B A;  2WAQ G;  3NK9 A;  1X3F A;  5D3D A;  4BXX G;  4U67 3;  2WFW A;  2UXB Q;  1B44 D;  1N36 Q;  1EWC A;  2A8V A;  1E0B A;  5KEE A;  4WJ3 M;  1BVS A;  2Q2H A;  4XQQ A;  1JWM D;  2EJM A;  4QGU A;  4C2M H;  3S15 H;  1VDZ A;  2F3W A;  5CV5 A;  2MO0 A;  5F2D A;  3VR5 A;  2XWB B;  2AQ2 B;  1CI3 M;  4R4O A;  4JI5 Q;  3CRL C;  5C4X G;  3BVZ A;  1E3P A;  1RHP A;  2KCT A;  4MZ9 A;  4DR3 L;  1VQP A;  3UI2 A;  5D14 A;  4DAY B;  3MA2 B;  1PYB A;  4OEM B;  3QOJ A;  4DK1 A;  2AWO A;  3GTJ H;  4BY7 G;  3S24 A;  2OEO A;  2R92 B;  1IYJ B;  1JJG A;  1C7Y A;  3BDL A;  2K52 A;  1SRO A;  1JWS D;  1HHV A;  1EYG A;  5D65 A;  1E24 A;  3VYR A;  3RLN A;  3NTI A;  3OWE B;  1ZKO A;  4NPS A;  1DJR D;  4RCO A;  5CBA E;  5JVH 3;  3T1Y Q;  4YCU A;  4XQJ A;  2Q2I A;  1SJE D;  3VYU A;  1N32 L;  4BWG B;  1F9P A;  5NUC A;  3PIO 3;  5C4J H;  2HD3 A;  4KKT A;  2KED A;  4K2L A;  5JEA H;  4DNR B;  1X56 A;  1Z9F A;  4R4T A;  2KHS A;  3MWY W;  1TS4 A;  2BOS A;  4RWS C;  4RG1 A;  1M4V A;  2R92 G;  4XIG S;  2AWN A;  1EL0 A;  1YJ9 A;  2NTT A;  1YNX A;  3X3N A;  2AKW B;  3ICE A;  3H3V H;  3CU7 A;  4GNX B;  1R4P B;  4DNT B;  4JI0 L;  1XX8 A;  4NB3 A;  2LSS A;  1RL2 A;  1B3Q A;  3M85 A;  4A3I B;  4L5S A;  5KNC A;  5C0X J;  4GZY C;  3S1Q B;  1Q90 A;  4GKJ Q;  1H95 A;  2RCF A;  5I4D A;  2F0O A;  4KI0 A;  1X54 A;  1K8G A;  2I5H A;  1KDB A;  3CXC A;  4IUT A;  1RD9 D;  2D0P A;  2HCC A;  1VF5 C;  1SYD A;  4RHS A;  1WJJ A;  1QE6 A;  3UDX A;  1YNN C;  3JAM i;  3TRZ A;  5C6A A;  1SE3 A;  2EVB A;  2VQF Q;  1JB7 A;  4OON A;  3K57 A;  1B4O A;  3GV3 A;  2N78 A;  3L7Z C;  2DNC A;  2B29 A;  4UHV A;  3STB D;  3HEJ A;  3J81 c;  1VQL A;  4ZKC B;  2PQA B;  4A3D H;  1WD0 A;  1V43 A;  4HJ9 A;  2UXD L;  1N9W A;  3GTL B;  2EY1 A;  4A3I G;  2LKV A;  2MPM A;  3MFG A;  3TP8 A;  2IPK D;  4QB4 A;  5IP7 H;  5EKI A;  4XXE A;  1NMG A;  3I2Z A;  4G4K A;  3HOV B;  2HUG A;  2YTX A;  3FPP A;  5E4X A;  1A3V A;  1CA5 A;  1MKH A;  3CKI B;  3U4V A;  3BJU A;  1EY0 A;  2BCO A;  3KLS A;  2WB1 E;  3NBH B;  2AQ3 B;  1PHJ A;  3SE0 A;  1D5X C;  1VQE A;  4HID A;  1JB3 A;  3PO3 B;  4LF6 L;  5KND A;  4Y52 H;  3RZD B;  3WWV A;  5I9P A;  4DR4 Q;  3L9A X;  2Q8I B;  1SMY D;  5J39 A;  4GKK Q;  3I3C A;  2F0T A;  3E5S A;  2ZTC A;  4C3J B;  2K01 A;  1I94 Q;  1X3E A;  1YNJ D;  2I5L X;  1EUJ A;  3G4S A;  4PMC A;  4HSV A;  1SXT A;  4HED A;  4O42 A;  2O5J C;  1S5F D;  4PZ8 A;  4OWX B;  4P75 A;  2F0K A;  1NE3 A;  5JJI A;  4HSP A;  4GLV B;  2K33 A;  2NN6 G;  4B3S Q;  3M4P A;  1PFN A;  3HOV G;  3LWU A;  1Y1W B;  2ASB A;  1TWG B;  3QB3 A;  3CAM A;  1DYQ A;  2IHE A;  2AUJ D;  4OX9 Q;  4GN4 B;  3H0G B;  4JI2 L;  5C0X G;  5KYI A;  3PO3 G;  2CQO A;  1QVC A;  4A3F H;  5IGG A;  2SDF A;  1HJP A;  4C3J G;  1LTG D;  5CV7 A;  2Z4I A;  2PNH A;  1D7Q A;  2KHI A;  1YHQ A;  2NZ1 D;  1GD7 A;  2A1A A;  2R7Z H;  4N8F A;  1PH7 A;  2NVT B;  1HRJ A;  4ZAI A;  5M3F H;  3I4L A;  3NBI A;  3PMF A;  2BA0 A;  4QQB X;  1GHK A;  1L1O C;  3KK7 A;  1QCB D;  2CH4 A;  4DV6 Q;  2UXC L;  2LFN A;  5EBD A;  3MEH A;  1I6H H;  1PXU A;  1IW7 D;  1QB5 D;  1H9S A;  4NP5 A;  2UUC L;  1Y1W G;  3IAY A;  2FJ2 A;  1HZ9 A;  2XSC A;  4OXP A;  4LMQ D;  4IUN A;  4KK7 A;  1K28 A;  2B2T C;  3TZD A;  1SE2 A;  1G51 A;  3H0G G;  1LTA D;  4F7X A;  1GUG A;  2K4K A;  1SYG A;  3GD7 A;  2O5I C;  3NEL A;  4I65 A;  4B9X A;  1X3P A;  1CKN A;  4J15 A;  3TP6 A;  4QMG A;  4DR5 L;  2JA8 H;  5JJL A;  4BY1 B;  3G48 A;  4DU9 A;  4GOP A;  1AZQ A;  1MJC A;  1VQO A;  1PZJ D;  4FP5 D;  1HZB A;  4JBM A;  4I7A A;  1GUW A;  1UAP A;  3DM3 A;  4J8Q A;  1DON A;  2GN5 A;  2ZXO A;  3I90 A;  4JI1 Q;  1WI5 A;  4LFA L;  1TWF H;  1UE5 A;  5FLM H;  4IO9 A;  2JQO A;  3Q0A A;  3GTM H;  2Q8T A;  4CHT B;  3OPO A;  1G91 A;  1AH9 A;  3HOY B;  3CF5 A;  1E2Z A;  4DFA A;  4LF8 Q;  3QJY A;  3RMH A;  3QWN A;  3H91 A;  1PH1 A;  3S16 B;  1J5E L;  4LF7 Q;  4AYB B;  5IP9 H;  1HNX Q;  5HUR A;  4ZKB B;  1XYI A;  1SNQ A;  2EYF A;  4BY1 G;  3F8T A;  2J0T D;  1LT5 D;  1QVG A;  2E75 C;  1HZC A;  3QIA A;  3HOX B;  3L2P A;  5C44 H;  2F4V L;  2HIV A;  1HFN A;  1X32 A;  4BBS H;  2OTJ A;  1EY5 A;  1I3Q H;  3J80 c;  2KCM A;  4UDU C;  4RGO S;  1B9N A;  2DJG C;  2QCP X;  3HS0 C;  4JOI C;  1Y8O B;  3HOY G;  3KF6 A;  4K8I A;  2EXZ A;  5M5X H;  1UEB A;  4BBR H;  2VW9 A;  1YI2 A;  3PF4 A;  5FOB B;  5IYC H;  4KHP L;  1PMR A;  2JA6 H;  4YWM A;  1HXY D;  4RGM A;  4AYB G;  4P73 A;  1XWE A;  2GA4 B;  4A3E H;  4LUO A;  1TVX A;  5IT9 L;  3NQT A;  3GTK B;  4A3M B;  4JW0 A;  2RSO A;  2PCF B;  1DGS A;  3HOX G;  3H6M A;  1ROD A;  3OHX C;  4LF5 L;  2ICE C;  1CQV A;  3CCE A;  3S14 H;  1F2Z A;  2VQE L;  3MXN B;  1TWC B;  1OTC A;  1VQ8 A;  2K5W A;  1NCV A;  2IY5 B;  2WB1 G;  4LK1 C;  1LM0 A;  2QA4 A;  1TT2 A;  2UXB L;  2WAC A;  1N36 L;  1AN8 A;  4DK0 A;  4FF1 A;  4DR7 Q;  3EBE A;  1HZA A;  1H9J A;  3BVG A;  5LMN L;  4TQU S;  1Y1V B;  2K5H A;  4GS3 A;  3GTG H;  1JE4 A;  2EPB A;  4DUY Q;  4A3M G;  1B70 B;  2OT2 A;  2EYJ A;  1Q7Y C;  3M4Y A;  3SK4 A;  2WAQ E;  3FDT A;  1HA6 A;  1X65 A;  4UY8 C;  4HJ5 A;  1SLJ A;  3U58 A;  4ME3 A;  1PH8 A;  1LTI D;  3IL8 A;  3MTS A;  4RKL A;  4EQO A;  2MGS A;  2G9H D;  3M4Q A;  5IWA L;  1N34 Q;  2OTL A;  2QEX A;  3A8K E;  1BBX C;  3CQZ H;  1YVC A;  5FO8 B;  2KJX A;  3T1Y L;  1CUK A;  1FGU A;  3RN5 A;  1VQJ A;  2B2V A;  4APV A;  3CP0 A;  3V2T A;  1Y1V G;  4CKC A;  1GOZ A;  2PMZ E;  3AFP A;  1LT6 D;  2WII B;  2E5L L;  5K36 H;  4FF4 A;  2OQ0 A;  2LS0 1;  1ICF B;  1WTH A;  1K9M C;  3VDY A;  1WTR A;  3AB9 A;  2MP1 A;  2XTI A;  1SFO B;  1R9T H;  3EQL C;  1XPU A;  3ND8 A;  5AFW A;  4BXX H;  4KMU C;  1ESF A;  1BCP B;  1F9R A;  5CV6 A;  2NVQ H;  2V1C C;  2IX1 A;  1FYC A;  5C3X A;  5LMU Q;  4B3R Q;  4M8A A;  3L0O A;  2CVR A;  1WD1 A;  2JK8 A;  4QCL A;  4LUZ A;  1C9O A;  4PMB A;  4LFC L;  5JAV A;  2FMM A;  4K5V A;  2NVX H;  3J7A F;  4EX5 A;  1VQ4 A;  4O1N A;  3NUC A;  2CW0 C;  1O78 A;  1DOL A;  5I6W A;  3BDO A;  1X55 A;  2SNS A;  3E3X A;  5T1G A;  1S4Z A;  4DV0 L;  4GKJ L;  2JA7 B;  1MSH A;  4IPG A;  3GTO H;  5M5Y B;  4XT1 B;  1HNW Q;  1VQB A;  4LFB Q;  3DHQ A;  4C56 C;  2A69 C;  4A3C H;  2ZJQ A;  3DWA A;  3URY A;  5KIX A;  1C8C A;  1ZYR C;  2A74 C;  2F0Q A;  4A3L G;  2VQF L;  5TSS A;  4TVA B;  2N55 A;  2F0S A;  2JA9 A;  2X6G A;  1FNU A;  2EIF A;  4A3J B;  1Q12 A;  3ER0 A;  3Q6S A;  4KY6 A;  4WFN 3;  1A8V A;  2MQH A;  5JVG 3;  3KJO A;  5HY6 A;  4H7B A;  4DAV A;  2K5V A;  4KHV A;  3Q22 A;  2BDN A;  1B53 A;  1NTG A;  1SRU A;  2NWG A;  1KXL A;  1T5X D;  5ISR A;  4JYA Q;  4ABN A;  2J4X A;  4JI6 Q;  2JA7 G;  2NN6 I;  4IUV A;  3KYH C;  3PQI A;  1YZ6 A;  3UE1 A;  2N8N A;  3BZK A;  3KF8 A;  2JEB I;  3A8I E;  3WDN A;  3IRB A;  2E2J H;  2ZXR A;  4OWW B;  3CC2 A;  3PIP A;  2R92 H;  4H02 A;  4RFB A;  1U4R A;  4L8J A;  1PLF A;  5C0X I;  1MI2 A;  1JOQ A;  4X62 L;  1JE5 A;  1XPR A;  4A3J G;  1PTO D;  1C48 A;  1PTO B;  3CCR A;  3KLW A;  4PNY A;  4JI7 L;  2ZM6 L;  2VNU D;  1RF2 D;  5ELO A;  4DR6 Q;  1B7Y B;  4L5T A;  1CA6 A;  2JP1 A;  4UAI A;  3MHB A;  5IYD G;  1BCP C;  1PRT D;  1BBU A;  1FR3 A;  3QOL A;  1PRT B;  1IKL A;  1YJN A;  3P20 A;  1XXG A;  3P75 A;  1C0A A;  4RAU C;  4IPH A;  2CWP A;  1K73 C;  5H1S E;  1NY4 A;  1TU2 B;  5ELD A;  1NR4 A;  5KNB A;  4ZLT F;  1U4P A;  5C3E H;  4A3K H;  2QDL A;  5IGF A;  3ERQ A;  3OW2 A;  4X65 L;  3DXJ C;  1LO5 D;  2L0C A;  4C3H H;  2B2Y C;  3OOC A;  3E9I A;  2B2W A;  3TME A;  4EQP A;  5LMN W;  2R93 B;  4HIM A;  3BYT B;  1W6K A;  2G9D A;  1SNC A;  3GQB A;  4YHH L;  5EPL A;  2ZJP A;  2K1B A;  1ZEQ X;  4CDE C;  1ILP A;  5JJZ A;  1X3Q A;  1HUM A;  4FXG C;  4ZYS A;  2E8G A;  4DV6 L;  4LF4 Q;  2L4N A;  2PMZ B;  2QIL A;  4JK1 C;  2G5D A;  2IWH A;  2K04 A;  3KLR A;  1EY4 A;  4DV3 Q;  4GN5 A;  1KLU D;  4PG3 A;  4LNQ A;  3I72 A;  5AJ3 Q;  4IZ8 A;  1O80 A;  3DMU A;  1TS3 A;  5IGC A;  3PO2 B;  4OHJ A;  1GKH A;  3CCQ A;  4K6D A;  3G71 A;  1K0S A;  2EY2 A;  3LWE A;  4G57 A;  3CPF A;  1EWH A;  1IL2 A;  2JSO A;  5JJK A;  2MNA A;  2LMC B;  3M3Y B;  3CME A;  1ZXT A;  3I4N H;  3X3M A;  3NWS A;  2R93 G;  2UUB L;  1A62 A;  3W1B A;  3KLS X;  1H9S B;  4DUZ L;  3HOW H;  3ULJ A;  1N33 L;  3K7A H;  1PV4 A;  3SDZ A;  1BR9 A;  2NN6 H;  2VY3 A;  3M4O B;  3D4W A;  3HOV H;  1I4Q A;  1QNU A;  3K5L A;  5DLQ E;  3AEV A;  1K8O A;  1X6O A;  4K0K Q;  1OXX K;  4JI1 L;  3HOU B;  2IHF A;  5C0X H;  3VYT A;  5HGT A;  1CKN B;  2F0J A;  1MSG A;  4FF2 A;  1A3U A;  1RIP A;  4HTH A;  4CGY B;  3PO2 G;  1V1O A;  2YU9 H;  3GTP B;  3CC7 A;  4GOP B;  4LF8 L;  4A3G H;  2X69 A;  4JG2 A;  3A5Z B;  3CC4 A;  3MXU A;  5ELC A;  3RLO A;  3TDQ A;  3WOE A;  5E4W C;  1TKW B;  1SE4 A;  1HNX L;  4DK6 C;  3F2B A;  5J1Z A;  3CCS A;  5IGE A;  3T13 A;  1Y1W H;  2RCN A;  2NZO A;  1PA6 A;  2Z6K A;  4KV6 A;  3CCV A;  1DZ1 A;  3AMU A;  4KKU A;  1VQN A;  2FHT A;  2NB0 A;  1LTS D;  1PZK D;  4DV1 L;  4GN3 B;  4R9W A;  3HOU G;  3H0G H;  1STB A;  4L6T B;  1HQR D;  3CCJ A;  1JJC B;  1WCM B;  3NTH A;  2F0G A;  2KVM A;  1PH2 A;  1Q1E A;  1CTM A;  1STE A;  2PZT A;  1NNX A;  1XNQ Q;  2B8G A;  1FJG Q;  2NVT H;  2FXQ A;  4POF A;  4DAP A;  3FKI B;  4M1U B;  2TSS A;  1EY7 A;  1ESR A;  1PH3 A;  4B3M Q;  4MTK A;  4NMZ A;  4B3T Q;  1S5D D;  1IYV A;  4ILW A;  4X66 L;  4HIO A;  1SND A;  3HG9 A;  4Q0F A;  3E0J A;  2WKC A;  1NJI C;  5ELF A;  3RZO B;  3GO5 A;  3KF6 B;  5GAE C;  3T1H Q;  1UUP A;  3CMA A;  3D6C A;  4UP7 A;  4JI4 Q;  3NEN A;  4QJF A;  4ZUJ A;  3CCL A;  2F0N A;  2ICI A;  4QY7 A;  2LXK A;  4HAE A;  4RGN A;  1HR0 L;  1LV9 A;  3RD4 A;  4AYB E;  1RTN A;  2HQL A;  1HQM C;  1WCM G;  3SK8 A;  2K03 A;  2E2I B;  3FPU B;  4A76 A;  2P5Z X;  4DV4 L;  3EJI A;  3OTO L;  4DR2 Q;  4BY1 H;  3AQQ A;  3RLF A;  3I4M B;  4QUF A;  5C4Z A;  1SYF A;  3FKI G;  1HTP A;  5GQO A;  1QNK A;  4DXG A;  1D8L A;  4DV2 Q;  4DUY L;  2F52 A;  4GOP C;  2B8F A;  1A2U A;  1IBK Q;  1SAP A;  3SK5 A;  3OIQ A;  2AHO B;  4IAL A;  3NHH A;  4C2M B;  3S15 B;  4JI8 L;  2DY8 A;  1WTO A;  3J81 L;  3M7N A;  1K83 B;  3HOY H;  1U0L A;  2UU9 Q;  4HJ8 A;  1CSP A;  4OEL B;  1I5F A;  3TQY A;  5FO7 B;  2K75 A;  4V0B A;  4DNI A;  4HMI A;  4MHE A;  3I4M G;  3F2C A;  1HH2 P;  4KTA A;  1BOS A;  5CV4 A;  3HOX H;  1VS0 A;  3TBI B;  1SSO A;  1J9O A;  3UDI A;  3DLL A;  3CD6 A;  4GNX C;  1I6V C;  4RGT A;  3ZYY X;  2A6H D;  2CHB D;  4LJZ C;  2CCZ A;  1Y14 B;  4PZ7 A;  5E1F A;  4AQY Q;  4LF9 Q;  3NPP A;  2JA5 B;  3D4D A;  4F88 A;  1FD7 D;  1QJO A;  2Y0S B;  4X64 Q;  5IE8 A;  2B2U A;  3S1N H;  4B3R L;  4X3T A;  3S2D B;  2Q8R E;  4XDX A;  4DR1 L;  2BH8 A;  4OO1 G;  1KD1 C;  3TN2 A;  2WIN B;  3LGJ A;  1IHZ A;  4NXN Q;  2L55 A;  1EY9 A;  2EY5 A;  1K3B C;  1I4P A;  3D4R A;  2BE5 D;  5CYU A;  3U4Z A;  2OXP A;  3STB C;  4DKA C;  5DAU A;  3PUZ A;  3HP3 A;  5M5W H;  1TWA B;  2WP8 J;  2Z8L A;  2HHH Q;  2Q2U A;  4LFB L;  1L2F A;  3WOF A;  1TWC H;  1KDC A;  2JA5 G;  3P7J A;  1STN A;  5FJ8 G;  1M1K C;  5IYB G;  3W2D A;  2Y0S G;  1UEA B;  4KN4 C;  2QKI C;  3ZJY C;  4IUP A;  4YY3 L;  4H44 C;  3OWF A;  3JAM c;  1A2T A;  1H9K A;  1Q1B A;  3ONA B;  4DGZ A;  3BZC A;  3RNU A;  4ZQ3 A;  2JJQ A;  5DM7 3;  1G6Z A;  1D6E C;  5I2X A;  3K58 A;  1YEZ A;  3UDG A;  2O4X A;  2K5Q A;  1IBL Q;  1DOM A;  2RBM A;  1SMY C;  2A6E D;  1EU3 A;  1ET6 A;  4JYA L;  4L5Q A;  1E1T A;  1EOV A;  1AP0 A;  1YNJ C;  4UPA A;  3I73 A;  1KNE A;  5BN5 A;  4A3D B;  1EQV A;  2DY7 A;  4UP9 A;  4KLK A;  3VR6 A;  4DR3 Q;  2PI2 A;  1A15 A;  4ULL A;  3HKZ E;  1FNV A;  1TY0 A;  1DCZ A;  4JI3 L;  1QZG A;  2B63 H;  1S5E D;  5FLX c;  1CKM A;  3A74 A;  5M3M H;  3V96 A;  2EQS A;  2KUM A;  5BN3 A;  4HJ7 A;  3OMG A;  3KF8 B;  3R2I A;  4DR6 L;  2B2V C;  2EYO A;  1B3A A;  1U4L A;  4HR7 B;  3HOZ H;  3N52 A;  1Q82 C;  2MJ8 A;  4A93 H;  5GRO A;  1A3T A;  1PH4 A;  4IFD J;  2R3Z A;  1XJV A;  2E76 C;  1VQ7 A;  1N32 Q;  3I56 A;  3W1G A;  1HR0 W;  4S3S A;  5EGT A;  5FLX L;  4A3L H;  1KL9 A;  1D1K A;  4A3D G;  5IOD A;  3S9W A;  5CGK A;  3PIO A;  3I4O A;  4PMW A;  3G6J B;  4R8I A;  1SDF A;  4L5R C;  3PV0 A;  1XTD A;  1JOR A;  5C5M A;  5IP7 G;  1IW7 C;  4JC0 A;  3J7Z C;  2L5T A;  3K5N A;  3C1E A;  3TEH B;  2NVY H;  1HNZ L;  2UUA L;  1ENA A;  1CKO A;  4F8M A;  3D3R A;  2E2H H;  4Y7N H;  3J80 L;  2D62 A;  3DUZ A;  2RKS A;  3T16 A;  1DM0 B;  1CZG A;  2EXD A;  3Q24 A;  1TS2 A;  2ZXP A;  4IOC A;  1OXU A;  5EPK A;  1XMQ Q;  1Q8K A;  2R7F A;  1SMX A;  2KBN A;  3BDC A;  1L1O A;  1I50 H;  4YCV A;  4LWC A;  2MFI A;  5CV9 A;  2K32 A;  1S40 A;  4DV3 L;  4FXD A;  2QDB A;  3MAQ A;  5ELB A;  4KKS A;  2EZV A;  1SNM A;  1F2Y A;  3UE0 A;  5EJW A;  2J7Z A;  5M3F B;  1E1O A;  4A3J H;  4NDX A;  4RKB A;  2PYK A;  2B2T A;  3A55 A;  1KDA A;  1I6H B;  4PV1 C;  4JPB W;  4IUR A;  5FKA C;  2V4D A;  4JBK A;  1Q8I A;  1V8Q A;  3J81 E;  3S1M B;  3EIV A;  4JI5 L;  4EVO A;  1PYW D;  2LY7 A;  3EVQ A;  4U68 A;  4A3B B;  1F9S A;  1ENF A;  2QW7 A;  1WTP A;  4HCS A;  2ZTD A;  3U9S A;  1HFG A;  1Z7T A;  1V1P A;  2UXD Q;  3VR2 A;  2F1M A;  3OYY A;  2WV6 D;  1IL8 A;  3GTQ H;  2XN9 C;  2JA8 B;  1VQF A;  2B3G A;  4R1J A;  3BZD B;  1LAC A;  3K80 C;  1XPO A;  4JVZ A;  1U5K A;  4CJ1 B;  5M3F G;  3SVM A;  1LAB A;  4IFD G;  1P16 A;  3VR3 A;  1N34 L;  2D2C C;  4BA1 I;  5GAD C;  1QUQ A;  3S17 B;  2CH4 W;  3G7L A;  1WTW A;  3DEO A;  2RDG A;  2F4I A;  3I8Z A;  5IGD A;  1TWF B;  4LF6 Q;  4J6H A;  3GTM B;  3DWP A;  4LAA A;  4K14 A;  1NBW A;  1PZI D;  1K8M A;  4A3B G;  1VQI A;  1EEI D;  1PFM A;  4N8X 1;  4FYD A;  4IJH A;  1M8A A;  2SEB D;  1LUZ A;  4RA8 A;  2D9U A;  3I70 A;  4TRD A;  4HIK A;  2JA8 G;  1MBY A;  3K81 C;  2FFK B;  2CWA A;  1TWH B;  2AMC B;  1MJE A;  3CCU A;  3FP9 A;  1SYE A;  1M90 C;  5IIF A;  4KY7 A;  5BN4 A;  1EY8 A;  2DJF C;  1SNO A;  2M9V A;  3C1F A;  4JOI A;  1XNQ L;  3U9O A;  1VQM A;  3HKZ B;  4JI2 Q;  5C4X H;  4K6L A;  1FJG L;  5FLM G;  2B2W C;  1I3Q B;  4JV5 Q;  1O7Y A;  4DF7 A;  1C4Q A;  4CDD C;  1AE3 A;  3TZU A;  5M5X B;  4ME5 A;  1B1Z A;  4XYQ A;  4BBR B;  1UE1 A;  2QEJ C;  5CR3 A;  4BY7 H;  3R2T A;  2JA6 B;  1T5E A;  1IXR A;  1CM9 A;  2R6G A;  4E6I A;  5IP9 G;  1UE6 A;  4JI4 L;  5L37 A;  2MUY A;  1LTT D;  5I6Y A;  3CPW A;  2A68 D;  2UXC Q;  3BYY B;  3E6Z X;  1G6P A;  1LYL A;  2DGY A;  2NZH A;  1KLG D;  1ASZ A;  1UNS A;  4X6A H;  4XYO A;  4P2C B;  2OWO A;  1WTV A;  1BKB A;  2YTY A;  1CHQ D;  3D8G A;  3HKZ G;  1GHJ A;  5FK9 C;  2IX0 A;  2XRQ D;  2PO4 A;  1KAB A;  2L9H A;  5HGQ A;  2XIW A;  5IOC A;  1X9N A;  1I4H A;  3A5U A;  4DV2 L;  4BBR G;  4DR5 Q;  1KRT A;  1E7Z A;  3HOU H;  2RA4 A;  2KEN A;  2EYL A;  4TKO B;  2KEC A;  3J81 j;  1IBK L;  3CCM A;  2JA6 G;  1JOO A;  3DM1 A;  4CJ2 C;  4DV5 Q;  1JJ2 A;  1U9R A;  5I9O A;  1LLR D;  1ICW A;  1L0X B;  3GTG B;  3QG1 A;  4DR4 L;  4GKK L;  1GUT A;  3NEM A;  3NSW A;  3S1R B;  5EPJ A;  2XGT A;  4LFA Q;  1BQQ T;  1I94 L;  3ULP A;  2ID0 A;  2F0F A;  3Q23 A;  1G29 1;  3IFD A;  5EKL A;  2EYP A;  2Z9H A;  3PUX A;  3EFX D;  4OO1 I;  2H1E A;  1II3 A;  3KDF A;  2Z1C A;  5FLX E;  2PW7 A;  3EA6 A;  4LUV A;  3NE5 B;  1J5E Q;  4B3S L;  3TP5 A;  1F77 A;  1YHA A;  2HCI A;  1WTX A;  1PYS B;  3CQZ B;  1S5B D;  2C35 B;  3MC0 B;  5CC4 A;  4NXM Q;  1KQS A;  2F3I A;  4AQY L;  2F03 A;  2EOT A;  4XT3 B;  4OX9 L;  3M7G A;  2YYZ A;  1E2W A;  3J80 E;  1GUN A;  3E0E A;  2RHS B;  1Y69 U;  2KCN A;  3J7A V;  2SOB A;  4MTN A;  4A3I H;  3S1Q H;  2F0D A;  1O7Z A;  4X3K A;  4B9W A;  2NVQ B;  4KHP Q;  4O0A A;  1XTC D;  3K7U C;  1YJW A;  1EWI A;  1SR3 A;  2HHH L;  1ASY A;  2F0H A;  3M9B A;  5K36 G;  2HDM A;  3NP8 A;  3PSI A;  4ID6 A;  4IJL A;  5BR8 Q;  2I07 B;  5I2Y A;  3H15 A;  1JT8 A;  1DXM A;  1VQ9 A;  3GTO B;  3I4M H;  2HIX A;  3AU7 A;  1GM5 A;  3GTL H;  3J81 i;  4C3I B;  1OXT A;  4IN3 A;  2RSN A;  4DA2 A;  4ALP A;  1KAW A;  1NAP A;  1S72 A;  3SR1 A;  5J22 A;  1IBL L;  5E3F A;  3RUZ A;  5LMN Q;  2Y0S E;  1YNN D;  3VA5 A;  1PTO C;  4CKB A;  1VQK A;  1K83 H;  1STA A;  2AUK A;  3A7L A;  3CHB D;  4OIJ A;  1EYC A;  3PO3 H;  3RZD H;  3FRP B;  3KBG A;  1SBB B;  2AQ1 B;  3ULL A;  2GVA A;  2JXM B;  4CBV A;  4C3J H;  5ELN A;  3QR8 A;  2F3V A;  1JQY D;  1PRT C;  4OL7 A;  4FF3 A;  3I91 A;  3W5O A;  2RF4 A;  1EU4 A;  4OO1 H;  2VB2 X;  2VUM B;  4LF7 L;  1ET9 A;  1GUO A;  1SYB A;  4C3I G;  1LT3 D;  1CK1 A;  1WOC A;  2OF1 A;  4A3C G;  2E2J B;  3QO2 A;  2X6L A;  4HJA A;  5IWA Q;  2RDF A;  1PH6 A;  1TWG H;  2A73 B;  1V1Q A;  1EEF D;  2B39 A;  2K5D A;  5CBE E;  3HFZ B;  2F0I A;  4KJO A;  2EDG A;  2L15 A;  3MVV A;  3F1Z A;  2JA5 H;  5A2Q L;  2E5L Q;  1KRS A;  5JPM C;  2XWJ B;  5FJ8 H;  1HUN A;  5IYB H;  3KFU A;  1LTB D;  1VMC A;  2K7V A;  2Z6B A;  1E22 A;  1UE7 A;  2H5X A;  3S2D H;  2WKD A;  2VUM G;  1S5C D;  2TMP A;  1OO9 B;  1D1I A;  1SE8 A;  2B2U C;  2NBF A;  2B2Y A;  5C3E B;  4A3K B;  4RCN A;  4DXF A;  3C2P A;  4FXK C;  1RTO A;  4LFC Q;  3R8B A;  4BS9 A;  1JC7 A;  1BF4 A;  4C3H B;  2F0E A;  1TWA H;  1IBM Q;  1R4Q B;  1EY6 A;  1XMQ L;  3NWT A;  1CFM A;  4X3S A;  3T56 B;  4NKL A;  2F0L A;  2LXJ A;  1IZ6 A;  4DV0 Q;  1EZ6 A;  2F0M A;  3R3O A;  3VYS A;  1HTL D;  5FO9 B;  4IFD I;  5C5L A;  4DR7 L;  3HRZ C;  1Y8P B;  3IKJ A;  4PQX A;  3S2H B;  1TQO A;  1T9H A;  2Z0S A;  1PDQ A;  1L1O B;  5C3E G;  4A3K G;  5GAH C;  2KCC A;  4P71 A;  3FHW A;  4IUU A;  2IJ0 A;  3D0F A;  3KOJ A;  1U4M A;  3RR5 A;  4EQN A;  4C3H G;  3I4N B;  5JEA J;  3ITP A;  1WFQ A;  2KQ3 A;  2EJF C;  1VF7 A;  4CDF C;  2IT1 A;  2VS1 A;  3HGB A;  4LW1 A;  4OIK A;  3HOW B;  2NYZ D;  3S16 H;  5GAG C;  3K7A B;  1KNA A;  4G7Z C;  1AZP A;  1EZ8 A;  1QVF A;  2NTS A;  1IYU A;  4G7O C;  1O7I A;  4IUQ A;  1CQF A;  5DNF A;  1F2M A;  3SXH A;  4Z9C B;  4QL5 A;  2I0Q A;  5COY A;  5JOB A;  4MNO A;  1K0R A;  1XMO Q;  4TSS A;  3R93 A;  3PUW A;  4OWT B;  1NMF A;  1L0W A;  3GTJ B;  1V1P B;  1EQQ A;  1G2T A;  4X62 Q;  2EYM A;  3HZX A;  2I5M X;  1B2T A;  3MFY A;  1WTQ A;  1TXY A;  2YU9 B;  1STY A;  5CMD A;  4JI7 Q;  4A3G B;  2ZM6 Q;  2XNA C;  3I4N G;  4C1N I;  1VQD A;  1Q46 A;  1QUQ B;  4A75 A;  1TY2 A;  3GV6 A;  2YV5 A;  3J80 i;  1VQH A;  3HOW G;  1CT1 D;  2ZT9 C;  5C4J B;  5LMU L;  1BDO A;  4NW2 A;  1GJX A;  1AW7 A;  4DAM A;  4DV7 Q;  2D5D A;  5COR A;  3GTK H;  2A19 A;  1B9M A;  4A3M H;  2HT1 A;  1I4G A;  5ELE A;  4X65 Q;  4Q5V A;  2SNM A;  2NUC A;  5DM6 3;  4JV5 L;  4BA2 I;  1P8L A;  3H09 A;  1VQ5 A;  3NQI A;  1ENC A;  3TP7 A;  1H9R A;  5M9O A;  2ALY B;  1XNR Q;  2H4O A;  2M00 A;  1HNW L;  4A3G G;  1SJH D;  4QF4 A;  4ZUI A;  3A54 A;  4KY5 A;  4K8J A;  1L0Y B;  1EYA A;  1EOT A;  3J7A 5;  4IQZ A;  4YHH Q;  5EAY A;  2QF7 A;  1CHP D;  2N88 A;  4QIW E;  2K50 A;  1EIY B;  4FNF A;  4IFD H;  3OSO A;  1YBY A;  1EQR A;  3A0J A;  3T53 B;  1A6X A;  1QZH A;  2K28 A;  3N6R A;  1QG7 A;  1Y1V H;  3HKS A;  2OQK A; 
#chains in the Genus database with same CATH homology
 3L3O C;  1G8Z D;  5JEA G;  2XRS D;  3K59 A;  2VXW A;  1QWY A;  4N9P A;  1AFP A;  4CJ0 B;  1Q3L A;  4WRD A;  2PPB C;  1BNZ A;  2C5C A;  3LX0 A;  4DAY A;  3NXW A;  1EIG A;  3W3A A;  4ZRZ A;  4HCE A;  1FGB D;  4K2K A;  5EBC A;  3PIP 3;  3JAM L;  1LT4 D;  2RVL A;  1FNW A;  1W6J A;  4B08 A;  1G2S A;  4R8N A;  5LL6 S;  1D2B A;  1RJT A;  2CQA A;  4N9T A;  2A6H C;  1Y8N B;  3LNN A;  2DNE A;  3PUV A;  4DN4 M;  2JEA I;  1ILQ A;  5A2Q E;  3V05 A;  4WJW A;  2L12 A;  1MD2 D;  1QIL A;  5KGU A;  1DOK A;  1EIH A;  4KD3 A;  2JYO A;  1STH A;  2HDL A;  1LTR D;  1CZW A;  1SEB D;  4K5W A;  2Z4H A;  4KHZ A;  2E74 C;  1OXV A;  2BE5 C;  1TS5 A;  3KBX A;  2EYH A;  3H3V C;  3FMC A;  3GP7 A;  1DD2 A;  4I7Z C;  3SEB A;  1AEX A;  4KN7 C;  1JOK A;  2WB1 B;  4A3F B;  1JIC A;  1NR2 A;  1GUS A;  1NSN S;  3S1N B;  1TR5 A;  2L11 A;  3P1H A;  5JPN C;  4XQN A;  2RDH A;  3J7Y W;  3ND9 A;  1NUC A;  2R7Z B;  1WVL A;  5LL6 X;  1EYD A;  2BA1 A;  1BXT A;  3ERO A;  2A6E C;  1VMP A;  2CW0 D;  1F2L A;  1HCZ A;  5M5W B;  4MN3 A;  2KOL A;  2PZW A;  3BS1 A;  5KYL A;  3T51 B;  3NBH A;  3MZ5 A;  4OGQ C;  1JCK B;  2A69 D;  3TSS A;  1ZYR D;  1VCI A;  4XTC S;  2FMC A;  2PQE A;  1PTO H;  3C46 A;  2F0W A;  4FVM A;  1E2V A;  4QIW B;  3KUP A;  4CKE A;  1PFB A;  1D5M C;  2ENB A;  5T1I A;  1J8I A;  5K5P A;  1I4R A;  3D31 A;  1SNP A;  2M2L A;  4G7H C;  3K0Y A;  1GXD C;  4X3U A;  2B63 B;  3MXP A;  1I4X A;  2K05 A;  5M3M B;  5EQ0 A;  1ONL A;  2R61 A;  2IL8 A;  2I46 A;  4V19 0;  3T4A C;  3DWQ A;  3OW7 A;  1EQT A;  2C9O A;  2K6A A;  3H94 A;  3OMC A;  3BVM A;  3HOZ B;  5C44 B;  1MGS A;  4A93 B;  4JBW A;  4BBS B;  3MXG A;  2HQE A;  1BCP D;  5A35 A;  3A8J E;  5C3W A;  1JR0 D;  3SHL A;  5LHY 1;  3NTK A;  2O2L D;  2IX3 A;  2F0U A;  2E2D C;  1EFI D;  3CRK C;  2IW3 A;  2NVY B;  4A3E B;  3FEW X;  3SK6 A;  2E2H B;  4Y7N B;  2PZU A;  3DEP A;  2EE1 A;  1BUV T;  5DEH A;  2EJG C;  1BCP F;  4RHR A;  4H0L C;  1SYC A;  4HN7 A;  5EKK A;  3O13 A;  2F0P A;  1I50 B;  1D5Z C;  1JWU D;  3VA7 A;  3S14 B;  3JAM E;  4FO2 A;  4EGV A;  2BDO A;  4ZK9 B;  5C4H A;  5CV8 A;  2EY6 A;  1H9M A;  2JE6 I;  4K5X A;  5KRU A;  4F87 A;  2VB3 X;  1Z6H A;  1STG A;  1HPC A;  2FIN B;  2KEE A;  1RCV D;  5D3I B;  3GTQ B;  3D6W A;  1HA5 A;  3PUY A;  2PNR C;  4ODG A;  3BG3 A;  4MIU A;  4L63 B;  1KTK A;  3K5O A;  4KD4 A;  4H13 C;  4WOR A;  1QOH A;  4RH6 A;  2MHV A;  3A7A B;  1RKN A;  2PW5 A;  1RDP D;  3K5M A;  1Z47 A;  3C3L A;  1R9T B;  3VR4 A;  2WAQ B;  1TII D;  5IGB A;  1PTO F;  2A68 C;  5G3L D;  1IKM A;  5IT9 E;  3FVQ A;  3F2U A;  3MXN A;  1KAA A;  3K6O A;  2A5H A;  3OIP A;  1B50 A;  3IFT A;  1ML0 D;  1PRT F;  2RQX A;  2NVX B;  1F9Q A;  1O7L A;  2F0V A;  2L1B A;  4J1M A;  5C4X B;  4YIJ A;  4HMJ A;  2KA7 A;  1BO0 A;  4C1N K;  4KJN A;  4QUC A;  2XVS A;  2DN8 A;  4BY7 B;  5G3L F;  1OXS C;  3A56 A;  3NK9 A;  5D3D A;  4U67 3;  1B44 D;  1EWC A;  1E0B A;  5KEE A;  4XQQ A;  1JWM D;  2EJM A;  1VDZ A;  2F3W A;  5CV5 A;  5F2D A;  3VR5 A;  2XWB B;  2AQ2 B;  1CI3 M;  3CRL C;  3BVZ A;  1RHP A;  3UI2 A;  5D14 A;  4DK1 A;  3MA2 B;  3QOJ A;  2AWO A;  2OEO A;  2R92 B;  3BDL A;  1JWS D;  1HHV A;  5D65 A;  3VYR A;  3NTI A;  3OWE B;  1ZKO A;  4RCO A;  1DJR D;  5CBA E;  5JVH 3;  4XQJ A;  1SJE D;  3VYU A;  4BWG B;  1F9P A;  5NUC A;  3PIO 3;  4KKT A;  2KED A;  4K2L A;  5JEA H;  4DNR B;  2KHS A;  3MWY W;  1TS4 A;  2BOS A;  4RWS C;  1M4V A;  4XIG S;  2AWN A;  1EL0 A;  2NTT A;  3X3N A;  3CU7 A;  1R4P B;  4DNT B;  1XX8 A;  3M85 A;  4A3I B;  5KNC A;  5C0X J;  4GZY C;  3S1Q B;  1Q90 A;  5I4D A;  2F0O A;  4KI0 A;  1KDB A;  4IUT A;  1RD9 D;  2HCC A;  1VF5 C;  1SYD A;  4RHS A;  1QE6 A;  1YNN C;  5C6A A;  1SE3 A;  2EVB A;  3K57 A;  1B4O A;  3GV3 A;  3L7Z C;  2DNC A;  3HEJ A;  4ZKC B;  1WD0 A;  1V43 A;  3GTL B;  2EY1 A;  2LKV A;  2MPM A;  3MFG A;  3TP8 A;  2IPK D;  4QB4 A;  5EKI A;  4XXE A;  4G4K A;  3HOV B;  2HUG A;  3FPP A;  5E4X A;  1A3V A;  1CA5 A;  3CKI B;  1EY0 A;  2BCO A;  3KLS A;  2AQ3 B;  3SE0 A;  1D5X C;  1JB3 A;  3PO3 B;  5KND A;  3RZD B;  5I9P A;  3L9A X;  2Q8I B;  1SMY D;  5J39 A;  3I3C A;  2F0T A;  3E5S A;  4C3J B;  2K01 A;  1YNJ D;  4PMC A;  4HSV A;  1SXT A;  4HED A;  4O42 A;  2O5J C;  1S5F D;  2F0K A;  4HSP A;  2K33 A;  2NN6 G;  1PFN A;  3LWU A;  1Y1W B;  1TWG B;  3QB3 A;  1DYQ A;  2AUJ D;  3H0G B;  5C0X G;  5KYI A;  5IGG A;  2SDF A;  4C3J G;  1LTG D;  5CV7 A;  2Z4I A;  2NZ1 D;  2NVT B;  1HRJ A;  4ZAI A;  3I4L A;  3NBI A;  3PMF A;  2BA0 A;  1GHK A;  3KK7 A;  1QCB D;  5EBD A;  2LFN A;  3MEH A;  1PXU A;  1IW7 D;  1QB5 D;  1H9S A;  4NP5 A;  3IAY A;  2FJ2 A;  2XSC A;  4LMQ D;  4IUN A;  4KK7 A;  2B2T C;  3TZD A;  1SE2 A;  1LTA D;  4F7X A;  1GUG A;  3GD7 A;  1SYG A;  2O5I C;  4I65 A;  4B9X A;  3TP6 A;  4QMG A;  4BY1 B;  1AZQ A;  4DU9 A;  1PZJ D;  4FP5 D;  1GUW A;  1UAP A;  4J8Q A;  1DON A;  2ZXO A;  3I90 A;  3Q0A A;  2Q8T A;  4CHT B;  3OPO A;  1G91 A;  3HOY B;  1E2Z A;  4DFA A;  3QJY A;  3RMH A;  3QWN A;  3H91 A;  3S16 B;  4AYB B;  5HUR A;  4ZKB B;  1XYI A;  1SNQ A;  2EYF A;  2J0T D;  1LT5 D;  2E75 C;  3QIA A;  3HOX B;  1HFN A;  1X32 A;  1EY5 A;  4UDU C;  4RGO S;  1B9N A;  2QCP X;  3HS0 C;  1Y8O B;  4K8I A;  2EXZ A;  5FOB B;  1PMR A;  1HXY D;  4RGM A;  1XWE A;  2GA4 B;  1TVX A;  5IT9 L;  3NQT A;  3GTK B;  4A3M B;  2RSO A;  2PCF B;  3H6M A;  1ROD A;  3OHX C;  2ICE C;  1CQV A;  1F2Z A;  1TWC B;  2K5W A;  1NCV A;  4LK1 C;  1TT2 A;  2WAC A;  1AN8 A;  4DK0 A;  4FF1 A;  1H9J A;  3BVG A;  4TQU S;  1Y1V B;  1JE4 A;  2EPB A;  2OT2 A;  2EYJ A;  3M4Y A;  3SK4 A;  3FDT A;  1HA6 A;  1LTI D;  3IL8 A;  3MTS A;  4RKL A;  4EQO A;  2MGS A;  2G9H D;  3A8K E;  1BBX C;  5FO8 B;  2KJX A;  2B2V A;  3V2T A;  4CKC A;  1GOZ A;  1LT6 D;  2WII B;  5K36 H;  4FF4 A;  2LS0 1;  1WTR A;  3AB9 A;  2MP1 A;  1SFO B;  3EQL C;  3ND8 A;  5AFW A;  4KMU C;  1ESF A;  1BCP B;  1F9R A;  5CV6 A;  2IX1 A;  1FYC A;  5C3X A;  4M8A A;  2CVR A;  1WD1 A;  4QCL A;  5JAV A;  4PMB A;  2FMM A;  4K5V A;  3J7A F;  4O1N A;  3NUC A;  2CW0 C;  1O78 A;  1DOL A;  5I6W A;  3BDO A;  2SNS A;  5T1G A;  1S4Z A;  2JA7 B;  1MSH A;  5M5Y B;  4XT1 B;  3DHQ A;  4C56 C;  2A69 C;  3DWA A;  3URY A;  5KIX A;  1C8C A;  1ZYR C;  2A74 C;  2F0Q A;  5TSS A;  2N55 A;  2F0S A;  2X6G A;  1FNU A;  4A3J B;  1Q12 A;  3Q6S A;  4KY6 A;  4WFN 3;  5JVG 3;  4H7B A;  4DAV A;  4KHV A;  3Q22 A;  2BDN A;  1B53 A;  2NWG A;  1T5X D;  5ISR A;  4ABN A;  2J4X A;  2NN6 I;  4IUV A;  3KF8 A;  2JEB I;  3A8I E;  3WDN A;  2ZXR A;  4RFB A;  1U4R A;  4L8J A;  1PLF A;  5C0X I;  1MI2 A;  1JOQ A;  1PTO D;  1C48 A;  1PTO B;  4PNY A;  2VNU D;  1RF2 D;  1CA6 A;  2JP1 A;  4UAI A;  3MHB A;  1BCP C;  1PRT D;  1FR3 A;  3QOL A;  1PRT B;  1IKL A;  3P20 A;  1XXG A;  3P75 A;  4RAU C;  1TU2 B;  5ELD A;  1NR4 A;  5KNB A;  4ZLT F;  1U4P A;  5IGF A;  3ERQ A;  3DXJ C;  1LO5 D;  2L0C A;  4EQP A;  2B2Y C;  3OOC A;  3TME A;  2B2W A;  2R93 B;  3BYT B;  1W6K A;  2G9D A;  1SNC A;  3GQB A;  5EPL A;  2K1B A;  1ZEQ X;  1ILP A;  5JJZ A;  1X3Q A;  1HUM A;  4FXG C;  4ZYS A;  2L4N A;  2PMZ B;  2QIL A;  4JK1 C;  2IWH A;  2K04 A;  3KLR A;  1EY4 A;  1KLU D;  3I72 A;  4IZ8 A;  1O80 A;  3DMU A;  1TS3 A;  5IGC A;  3PO2 B;  4OHJ A;  4K6D A;  2EY2 A;  3LWE A;  4G57 A;  1EWH A;  2JSO A;  2LMC B;  3M3Y B;  1ZXT A;  3X3M A;  3NWS A;  3KLS X;  1H9S B;  3SDZ A;  1BR9 A;  2NN6 H;  3M4O B;  3D4W A;  1I4Q A;  1QNU A;  3K5L A;  1K8O A;  1OXX K;  3HOU B;  5C0X H;  3VYT A;  5HGT A;  2F0J A;  1MSG A;  4FF2 A;  1A3U A;  4HTH A;  4CGY B;  1V1O A;  3GTP B;  2X69 A;  3MXU A;  5ELC A;  3TDQ A;  3WOE A;  5E4W C;  1TKW B;  1SE4 A;  5J1Z A;  5IGE A;  3T13 A;  4KV6 A;  1DZ1 A;  3AMU A;  4KKU A;  2FHT A;  2NB0 A;  1LTS D;  1PZK D;  4R9W A;  1STB A;  4L6T B;  1HQR D;  1WCM B;  3NTH A;  2F0G A;  2KVM A;  1Q1E A;  1CTM A;  1STE A;  2PZT A;  2B8G A;  4DAP A;  3FKI B;  4M1U B;  2TSS A;  1EY7 A;  1ESR A;  4NMZ A;  1S5D D;  1IYV A;  4ILW A;  1SND A;  3HG9 A;  4Q0F A;  3E0J A;  2WKC A;  5ELF A;  3RZO B;  3GO5 A;  1UUP A;  3D6C A;  4ZUJ A;  2F0N A;  2ICI A;  4HAE A;  4RGN A;  1LV9 A;  3RD4 A;  1RTN A;  1HQM C;  3SK8 A;  2K03 A;  2E2I B;  3FPU B;  3EJI A;  3RLF A;  3I4M B;  4QUF A;  5C4Z A;  1SYF A;  1HTP A;  1QNK A;  4DXG A;  2B8F A;  1A2U A;  1SAP A;  3SK5 A;  3OIQ A;  4IAL A;  3NHH A;  4C2M B;  3S15 B;  2DY8 A;  1WTO A;  3J81 L;  3M7N A;  1K83 B;  5FO7 B;  4V0B A;  4HMI A;  4MHE A;  4KTA A;  1BOS A;  5CV4 A;  3TBI B;  1SSO A;  1J9O A;  1I6V C;  4RGT A;  3ZYY X;  2A6H D;  2CHB D;  4LJZ C;  5E1F A;  3NPP A;  2JA5 B;  3D4D A;  4F88 A;  1FD7 D;  1QJO A;  2Y0S B;  2B2U A;  4X3T A;  3S2D B;  2Q8R E;  4XDX A;  4OO1 G;  3TN2 A;  2WIN B;  1IHZ A;  2L55 A;  1EY9 A;  2EY5 A;  1I4P A;  3D4R A;  2BE5 D;  5CYU A;  2OXP A;  5DAU A;  3PUZ A;  3HP3 A;  1TWA B;  2WP8 J;  2Z8L A;  3WOF A;  1KDC A;  3P7J A;  1STN A;  3W2D A;  1UEA B;  4KN4 C;  2QKI C;  4IUP A;  4H44 C;  3OWF A;  1A2T A;  1H9K A;  1Q1B A;  3ONA B;  4DGZ A;  4ZQ3 A;  5DM7 3;  1G6Z A;  1D6E C;  5I2X A;  3K58 A;  2O4X A;  2K5Q A;  1DOM A;  2RBM A;  1SMY C;  2A6E D;  1EU3 A;  1ET6 A;  1AP0 A;  1YNJ C;  3I73 A;  1KNE A;  5BN5 A;  4A3D B;  1EQV A;  2DY7 A;  3VR6 A;  1A15 A;  4ULL A;  1FNV A;  1TY0 A;  1DCZ A;  1S5E D;  3V96 A;  2KUM A;  5BN3 A;  3OMG A;  3R2I A;  2B2V C;  2EYO A;  1B3A A;  1U4L A;  4HR7 B;  3N52 A;  2MJ8 A;  4IFD J;  1A3T A;  2R3Z A;  2E76 C;  4S3S A;  5EGT A;  5FLX L;  1D1K A;  5IOD A;  3S9W A;  5CGK A;  4PMW A;  3G6J B;  4R8I A;  1SDF A;  3PV0 A;  1JOR A;  5C5M A;  1IW7 C;  2L5T A;  3K5N A;  3C1E A;  1ENA A;  4F8M A;  3D3R A;  3J80 L;  2D62 A;  3DUZ A;  2RKS A;  3T16 A;  1DM0 B;  1CZG A;  3Q24 A;  1TS2 A;  2ZXP A;  1OXU A;  5EPK A;  3BDC A;  5CV9 A;  2K32 A;  4FXD A;  2QDB A;  3MAQ A;  5ELB A;  4KKS A;  2EZV A;  1SNM A;  1F2Y A;  5EJW A;  2J7Z A;  5M3F B;  4NDX A;  4RKB A;  2PYK A;  2B2T A;  3A55 A;  1KDA A;  1I6H B;  4PV1 C;  4IUR A;  5FKA C;  2V4D A;  1Q8I A;  1V8Q A;  3J81 E;  3S1M B;  4EVO A;  1PYW D;  2LY7 A;  3EVQ A;  4U68 A;  4A3B B;  1F9S A;  1ENF A;  1WTP A;  4HCS A;  3U9S A;  1HFG A;  1Z7T A;  1V1P A;  3VR2 A;  2F1M A;  2WV6 D;  1IL8 A;  2XN9 C;  2JA8 B;  3BZD B;  1LAC A;  4CJ1 B;  3SVM A;  1LAB A;  4IFD G;  3VR3 A;  2D2C C;  4BA1 I;  3S17 B;  3G7L A;  1WTW A;  3DEO A;  2RDG A;  2F4I A;  3I8Z A;  5IGD A;  1TWF B;  4J6H A;  3GTM B;  3DWP A;  4LAA A;  4K14 A;  1PZI D;  1K8M A;  1EEI D;  1PFM A;  4FYD A;  1M8A A;  2SEB D;  4RA8 A;  2D9U A;  3I70 A;  4TRD A;  1MBY A;  2FFK B;  1TWH B;  1SYE A;  5IIF A;  4KY7 A;  5BN4 A;  1EY8 A;  1SNO A;  2M9V A;  3C1F A;  3U9O A;  3HKZ B;  4K6L A;  2B2W C;  1I3Q B;  1O7Y A;  4DF7 A;  1C4Q A;  3TZU A;  5M5X B;  4ME5 A;  1B1Z A;  4XYQ A;  4BBR B;  2QEJ C;  5CR3 A;  3R2T A;  2JA6 B;  1T5E A;  1CM9 A;  2R6G A;  4E6I A;  2MUY A;  1LTT D;  5I6Y A;  2A68 D;  3BYY B;  3E6Z X;  1KLG D;  1UNS A;  4XYO A;  4P2C B;  1WTV A;  1CHQ D;  3D8G A;  1GHJ A;  5FK9 C;  2IX0 A;  2XRQ D;  2PO4 A;  1KAB A;  2L9H A;  2XIW A;  5IOC A;  1I4H A;  2RA4 A;  2EYL A;  4TKO B;  2KEC A;  1JOO A;  3DM1 A;  4CJ2 C;  1U9R A;  5I9O A;  1LLR D;  1ICW A;  1L0X B;  3GTG B;  3QG1 A;  1GUT A;  3NSW A;  3S1R B;  5EPJ A;  1BQQ T;  2ID0 A;  2F0F A;  3Q23 A;  1G29 1;  3IFD A;  5EKL A;  2EYP A;  3EFX D;  3PUX A;  4OO1 I;  2H1E A;  1II3 A;  2Z1C A;  5FLX E;  2PW7 A;  3EA6 A;  3NE5 B;  3TP5 A;  1F77 A;  2HCI A;  1WTX A;  3CQZ B;  1S5B D;  3MC0 B;  5CC4 A;  2F03 A;  2EOT A;  4XT3 B;  3M7G A;  2YYZ A;  1E2W A;  3J80 E;  1GUN A;  1Y69 U;  2KCN A;  3J7A V;  2SOB A;  2F0D A;  1O7Z A;  4X3K A;  4B9W A;  2NVQ B;  1XTC D;  2F0H A;  5K36 G;  2HDM A;  3NP8 A;  4ID6 A;  5I2Y A;  2I07 B;  1DXM A;  3GTO B;  3AU7 A;  4C3I B;  1OXT A;  4IN3 A;  2RSN A;  4DA2 A;  1NAP A;  3SR1 A;  5J22 A;  5E3F A;  3RUZ A;  3VA5 A;  1YNN D;  1PTO C;  4CKB A;  1STA A;  2AUK A;  3A7L A;  3CHB D;  4OIJ A;  1EYC A;  3FRP B;  3KBG A;  1SBB B;  2AQ1 B;  2JXM B;  4CBV A;  2F3V A;  1JQY D;  1PRT C;  4OL7 A;  4FF3 A;  3I91 A;  1EU4 A;  4OO1 H;  2VB2 X;  2VUM B;  1ET9 A;  1GUO A;  1SYB A;  4C3I G;  1LT3 D;  1CK1 A;  2OF1 A;  2E2J B;  3QO2 A;  2X6L A;  2RDF A;  2A73 B;  1EEF D;  2B39 A;  2K5D A;  5CBE E;  2F0I A;  4KJO A;  2EDG A;  3MVV A;  5A2Q L;  5JPM C;  2XWJ B;  1HUN A;  1LTB D;  1VMC A;  2K7V A;  2WKD A;  1S5C D;  2TMP A;  1OO9 B;  1D1I A;  2B2U C;  2NBF A;  2B2Y A;  5C3E B;  4A3K B;  4RCN A;  4DXF A;  3C2P A;  4FXK C;  1RTO A;  3R8B A;  4BS9 A;  1JC7 A;  1BF4 A;  4C3H B;  2F0E A;  1R4Q B;  1EY6 A;  3NWT A;  1CFM A;  4X3S A;  3T56 B;  4NKL A;  2F0L A;  1EZ6 A;  2F0M A;  3R3O A;  3VYS A;  1HTL D;  5FO9 B;  4IFD I;  5C5L A;  3HRZ C;  1Y8P B;  3IKJ A;  4PQX A;  3S2H B;  1TQO A;  1PDQ A;  2KCC A;  4IUU A;  2IJ0 A;  1U4M A;  4EQN A;  4C3H G;  3I4N B;  5JEA J;  3ITP A;  2KQ3 A;  2EJF C;  1VF7 A;  2IT1 A;  3HGB A;  3HOW B;  4OIK A;  2NYZ D;  4G7Z C;  3K7A B;  1KNA A;  1AZP A;  1EZ8 A;  2NTS A;  1IYU A;  4G7O C;  4IUQ A;  1CQF A;  5DNF A;  1F2M A;  3SXH A;  4Z9C B;  5COY A;  5JOB A;  4TSS A;  3R93 A;  3PUW A;  3GTJ B;  1V1P B;  1G2T A;  2EYM A;  3HZX A;  1B2T A;  3MFY A;  1WTQ A;  2YU9 B;  1STY A;  5CMD A;  4A3G B;  2XNA C;  4C1N I;  1TY2 A;  3GV6 A;  1CT1 D;  2ZT9 C;  5C4J B;  1BDO A;  4NW2 A;  1GJX A;  1AW7 A;  2D5D A;  5COR A;  1B9M A;  1I4G A;  5ELE A;  4Q5V A;  2SNM A;  2NUC A;  5DM6 3;  4BA2 I;  3H09 A;  3NQI A;  1ENC A;  3TP7 A;  1H9R A;  5M9O A;  2H4O A;  2M00 A;  1SJH D;  4QF4 A;  4ZUI A;  3A54 A;  4KY5 A;  4K8J A;  1L0Y B;  1EYA A;  1EOT A;  4IQZ A;  2QF7 A;  1CHP D;  2N88 A;  4FNF A;  4IFD H;  3OSO A;  3T53 B;  1A6X A;  2K28 A;  3N6R A;  1QG7 A;  1X3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...