4ZUJA

Crystal structure of staphylococcal nuclease variant delta+phs y91h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAHIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4zujA00
1EQVA 5F2DA 1TR5A 5CV4A 1EY5A 4PMBA 1TT2A 2RDFA 1SYEA 5IGFA 1A3TA 5IOCA 5IODA 5E1FA 2F0DA 5CC4A 3D6CA 1NSNS 4N9PA 5KEEA 1JORA 3EJIA 2F0FA 2F0KA 4IZ8A 3SK8A 1A2UA 1EY0A 5I9PA 5IGGA 5K5PA 3C1FA 3SXHA 2EYOA 3EROA 5KRUA 1EZ8A 5E3FA 2SOBA 3SK5A 3MEHA 3D4DA 1SYGA 4TRDA 5IGEA 2EY5A 1EZ6A 4WORA 2EYMA 3DMUA 1II3A 2LKVA 2PW5A 2EY6A 4DU9A 5HURA 4EQPA 1SNQA 5J22A 3D8GA 4QMGA 3SK4A 5KYLA 2F3VA 4DF7A 3MZ5A 2PYKA 1ENCA 3MVVA 3PMFA 4IUNA 4HTHA 1F2MA 1RKNA 2OXPA 3TP5A 3ERQA 3MXPA 3EVQA 3NUCA 4EQNA 3NHHA 3T16A 4DFAA 2F0TA 3QOLA 2PZTA 4ZQ3A 4LAAA 4EQOA 2KHSA 5CR3A 5C6AA 4B9XA 4B9WA 4NKLA 3OSOA 1F2ZA 1EYAA 2F3WA 1SNOA 2F0GA 2OEOA 4ZUJA 1TQOA 2F0UA 3OWFA 4EVOA 3TMEA 2F0EA 5CV5A 1SYFA 2EYLA 3TP7A 5I6WA 5I6YA 4ODGA 3NXWA 5C5LA 5C4ZA 3T13A 2PQEA 1STGA 4K5VA 1EYCA 1KDCA 4H7BA 2EY1A 4KY7A 5CV6A 5CV9A 3E5SA 3RUZA 2F0SA 3P75A 4K5WA 5J1ZA 5C3XA 4K5XA 1STYA 5IIFA 5KYIA 2F0VA 4KHVA 1SNDA 5J39A 4F7XA 3NK9A 4KTAA 1A3VA 2F0JA 1SNMA 2QDBA 5C5MA 3NP8A 3ITPA 3MHBA 1EY9A 1EY7A 3HEJA 3H6MA 4OL7A 5KIXA 1EY8A 1SNPA 2F0PA 1U9RA 3DHQA 1STHA 3OMGA 4K8JA 2SNMA 1JOQA 2F0WA 5C3WA 3P1HA 3R3OA 2PW7A 2EY2A 1EY6A 4ZUIA 5NUCA 3TP8A 1NUCA 4J6HA 5CV7A 5EKKA 5ISRA 4KJNA 4KY5A 4PNYA 4PMCA 4ME5A 2RKSA 2OF1A 4K14A 4MIUA 2EXZA 4N9TA 4S3SA 4ID6A 1STBA 2HQEA 4I65A 1STNA 4KD4A 4J1MA 3LX0A 5CGKA 4HMIA 5DAUA 1SNCA 1SYCA 5IGBA 1JOKA 4RKLA 5KGUA 2PZUA 3S9WA 2F0HA 2F0OA 1ENAA 1EY4A 3TP6A 4E6IA 5EGTA 2EYFA 5JOBA 1IHZA 5HGTA 2ENBA 3QB3A 4YIJA 2RBMA 1KAAA 4KY6A 3C1EA 1SYBA 4KV6A 3U9OA 1STAA 2M00A 5JAVA 3BDLA 4NMZA 2KQ3A 3NQTA 2EYHA 3D4WA 2SNSA 3HZXA 3V2TA 4DGZA 2NUCA 4K2KA 2O4XA 3BDCA 4KJOA 4NDXA 4G57A 2F0LA 4RKBA 5M9OA 5EKLA 2EYJA 1KDBA 2EYPA 4HMJA 4IALA 4K8IA 4NP5A 3QOJA 3SHLA 3SK6A 5I9OA 1KABA 3OMCA 1F2YA 4K6DA 2F0IA 4QF4A 2F0MA 5CV8A 5DEHA 4KD3A 1EYDA 4R8NA 3SR1A 4K2LA 2PZWA 1A3UA 2F0QA 5IGDA 4WRDA 1SYDA 3VA5A 4F8MA 4QB4A 1AEXA 2F0NA 1A2TA 1KDAA 5C4HA 5IGCA 2WACA 1JOOA
chains in the Genus database with same CATH superfamily
1IYJB 2UXBL 1Y8PB 1I3QH 5IODA 4EGVA 3HOWB 5E4XA 2DJFC 1TKWB 3RNUA 1RHPA 2RHSB 2CKZB 3PUXA 1I6HH 5JVH3 3S16H 1BBUA 4A3DB 2J0TD 4DA2A 1UUPA 2K28A 1TWHB 3PV0A 3HKSA 2LFNA 4DR2L 4QMGA 2YU9B 4JCVE 2GA4B 2E76C 4DR2Q 1RF2D 1BBWA 4A3FB 2MJ8A 4KN7C 2KVMA 2Q2IA 4RMFA 4BBRG 5JJIA 4DFAA 2MNAA 2JA7B 5C6AA 4C56C 1MJEA 1DONA 2F3WA 3VDYA 3TQYA 4ZUJA 4C3HB 4A3GH 3TMEA 5CV5A 1YNXA 1HNZQ 3VYTA 2UXCQ 3S1QH 1PZJD 3TRZA 1HZ9A 2IWHA 4GOPA 3AB9A 2F4IA 3FKIH 3NE5B 2F0VA 4B08A 4JI0Q 2F4VQ 2KBNA 1RIPA 2KCNA 4MTNA 4JI2Q 1VQNA 2A19A 5M3FG 3NTKA 1IKMA 2AQ3B 1MI2A 2LSSA 3S1RH 1Q7YC 2Q8RE 2WAQB 4DV4Q 2F0WA 2AQ1B 4DR4Q 5C3WA 3D31A 2GVBA 4DV1L 5NUCA 2Z4IA 1DZ1A 1CA5A 1VQLA 4A3EB 1SN8A 4DV7Q 4YY3L 4KD4A 2NZ1D 1AP0A 3K58A 1TIID 1SNCA 1BDOA 4EQ5A 2KOLA 1DD2A 4HIMA 4E6IA 2EJGC 1KL9A 2ATWA 3S15B 2HQLA 3KDFA 4CJ0B 2O4XA 2MO1A 1S4ZA 4X66Q 1B70B 4RFBA 5I2XA 4IALA 1S3OA 1TVXA 4DNRB 1MKHA 2A69D 1K3BC 3HOVG 3RZOB 1HTLD 1E1TA 2JA6G 1BXTA 3F8TA 3HOXB 4JI4Q 1ET6A 3VR6A 1XNQL 1SYDA 1YNJC 5IGCA 1GO3E 3JAMc 1A2TA 4QB4A 1EU4A 3I4NG 3TN2A 2CW0C 3K0YA 2A6EC 1HNWQ 1XPRA 1ESRA 1BBXC 1PTOD 1XTCD 3HKZE 2NTTA 3FKIB 2QA4A 1G6PA 1VQMA 5DM63 3EJIA 4LF7L 3F1ZA 1IW7D 3QIAA 2ZM6L 3RZOH 4IFDJ 1Q81C 3C2PA 3J81L 4LFCL 1QVFA 4H13C 5J22A 1G2SA 3SK4A 4XTCS 4GOPB 1BNZA 3GTLB 5CBEE 1ENCA 3MVVA 1GUOA 3STBC 2CCZA 2B2TA 3OHXC 3L0OA 4FYDA 2MUYA 1OTCA 4IFDG 2K4KA 3IL8A 4QUFA 2IPKD 4DV5L 1PH4A 5I6WA 2F0EA 1JWUD 1IL2A 1LLRD 4IN3A 2SEBD 4LW1A 5CV9A 3ND8A 4K0KQ 1LTBD 4GKKQ 1O7ZA 1XJVA 5EKIA 1YHAA 2ZTEA 2NWGA 3HGBA 4OL7A 5KIXA 2RCFA 2F0PA 1PH1A 4XQNA 1JB7A 3BZKA 1IBKL 2UXBQ 1EY6A 3NQIA 1IBLQ 2MHVA 3CCMA 5EKKA 2NVYB 1KRSA 4KJNA 3A7AB 4R4IA 2XRQD 2OF1A 4K14A 2XWJB 1Z7TA 2HQEA 4I65A 1STNA 2AWNA 3K81C 1ZXTA 5M5XH 1VQ8A 1Q12A 2JA6H 1HJPA 2XIWA 1IHZA 1PRTC 1B1ZA 3C1EA 1V43A 1X3PA 3OWEB 5T1IA 4K2KA 1SRUA 4JI7Q 3J81c 4LFAL 3HOWH 3GTPH 1V1QA 2OTJA 2KUMA 3SVMA 4DKAC 2RQXA 1CKNA 1HFNA 1O78A 1K8MA 1AZPA 1EIFA 1CTMA 3U9SA 1EQVA 2KEEA 1I94L 1EQRA 1EY5A 2PCFB 2K5VA 3N6RA 3JAML 5CC4A 4A3EG 4UY8C 2F0FA 3PO3H 4A3KH 1I94Q 4ALPA 1W3SA 2CQAA 2DN8A 2CVRA 4GOPC 5K36G 1TS5A 4IPCA 1E3PA 1E24A 2YTVA 3BZDB 1XTDA 4TKOB 1EZ6A 3D0FA 2Y0SB 1KAWA 1G2TA 1OXUA 4DV1Q 3S1QB 1LTLA 4GKJL 1I4PA 4BXXG 1QG7A 1VQEA 4YY3Q 4KKUA 2DGYA 3MXPA 5M5XB 3NHHA 4IUTA 3T16A 4DR7Q 3EA6A 2N78A 1XX8A 1EQQA 1YHQA 4XIGS 1EYAA 1WCMB 1OXSC 1C4QA 1YNNC 4UP9A 1SFOH 1C7YA 3HOXH 2A74C 1IYVA 2E2HB 1SYFA 2JJQA 4A3JB 5C0XG 2EE1A 5FLXL 3T1YQ 1KDCA 4GLAC 2F0SA 3HP3A 5J1ZA 1PH3A 4G7ZC 1NMFA 2XRSD 1Q1BA 2K5QA 4B3MQ 3L7ZC 1CSQA 1Z9FA 3KF8B 3I4NB 2ZJRA 2KHJA 3P1HA 2PW7A 2R6GA 2ZXPA 3DWPA 4MN3A 4WFN3 3BZCA 4Y7NB 1DOLA 4QY7A 2F4VL 3AYHB 3RD4A 4OWWB 2VL6A 3M9BA 5EGTA 4V190 1AE2A 4PQXA 1X65A 4YIJA 5EAYA 3BYTB 2N8NA 1EEFD 4ME3A 4P2CB 1M90C 2E5LQ 2O2LD 1JJGA 5D65A 1DYQA 1D1KA 1F9RA 2E5LL 1A6XA 4JI5Q 3KJPA 1PH8A 4HMJA 1EQTA 5FLMH 1HNXQ 1PH6A 2R92G 1X3QA 1F2YA 2NN6H 3CCVA 1WJJA 5C4JH 3RN5A 1VQIA 4KHPL 1Q3LA 5KNBA 4HJ7A 1I6VC 2QCPX 2JEBI 1QB5D 2XNAC 1UAPA 5E1FA 4FF1A 4IQZA 2A6HC 1BOSA 3RZDH 1MD2D 3E6ZX 1CT1D 4XXEA 4DPGA 1EUJA 2XTIA 3S1NB 2EYMA 3CP0A 5G3LF 1FJGL 4A3LH 1HQMC 3GV3A 5FO9B 2F3VA 4X65L 2PQAB 2R3ZA 1I4GA 1YNND 2K04A 3KUPA 3AFPA 3ERQA 2ZJPA 1D5MC 1ICFB 1TXYA 5M3MB 2WB1E 3MXNB 1F2ZA 3J7ZC 2J4XA 2F0GA 3M7GA 2ZM6Q 1PH5A 4MTKA 4QUCA 2WB1B 3CCLA 3GTQB 4AQYQ 2CWAA 4GZYC 4A3MG 1SMYD 3F2CA 4JI7L 4DR6L 1EYCA 2VY3A 4FXDA 4K5WA 4NXNL 2B2VA 2N88A 1QOHA 5J39A 1WTOA 4DR6Q 1U4RA 4G7OC 1PFMA 3J7AV 4HJ8A 5EPJA 1MSHA 4OHJA 3DLLA 2E8GA 1B7YB 4A3BB 1I6HB 3OMGA 2GN5A 4K8JA 3RLOA 2D0PA 5JPNC 2CQOA 1H9SB 2PI2A 5IT9L 5JVG3 2L9HA 5EJWA 3TP8A 1LTTD 1O7IA 5CV7A 5ISRA 3UDGA 3RZDB 4FF3A 1SROA 3J80E 4JBKA 3D3RA 4ID6A 5C44B 3GTJB 2XSCA 3HOZH 1VF5C 1E2WA 1X6OA 2D2CC 2OQKA 3OW2A 4DR7L 4YCWA 2BA0A 5JOBA 4L5RC 3G48A 5E7NA 2NYZD 5LMUQ 3DUZA 3IFTA 1QVGA 4LF9Q 2E2JH 2R93H 3GTLH 2HCIA 3H3VI 3D4WA 3F2DA 2NUCA 5TSSA 5ELNA 4RKBA 3NBHB 2Q8TA 3UI2A 1HCZA 1QWYA 3K7UC 1EIGA 1X32A 2DJGC 1SSOA 3NBHA 2F0NA 3IFDA 2NZHA 3CD6A 1R9TH 3I70A 4BY7H 1CFMA 2B2TC 3IKJA 4U673 1LACA 2XVSA 3A7LA 3I73A 1E22A 4OWXB 4ZAIA 1B2TA 1YI2A 2I0QA 3S2HB 5KRUA 5E3FA 3BS1A 3HOUH 3MXUA 2LKVA 4DV6L 3N52A 1FR3A 2BOSA 3D8GA 4BY7B 4IUPA 1N9WA 3H0GB 1H9SA 1I3QB 1TWFH 2QILA 2L55A 1K73C 2B63G 4JI6L 3VR4A 3GTOH 1D2BA 2R92B 4DV4L 4B9XA 4GN4B 4DK1A 1H95A 2QGQA 5KNDA 5C4JB 3U58A 1A0IA 3HOUB 4AYBG 3OWFA 3PIO3 1JMCA 1SJHD 1B3AA 1HR0Q 2B29A 2KJXA 4JI1L 1D5XC 2B8GA 3S24A 2TSSA 3BVZA 4A3EH 1G91A 1D5ZC 1N32L 1LV9A 4GNXC 5H1SE 3PF4A 1XMQQ 1EL0A 2NB0A 2K33A 1S5DD 1K3RA 1CKOA 4A3CH 1L2FA 4AIMA 1YNJD 3KF6A 1Q8IA 3TS0A 4C3JH 1Z6HA 5IYDG 1I50H 3PIP3 2DNEA 2OTLA 4RKLA 5E4WC 1PYSB 5IYBG 4ILWA 3M7NA 1L1OA 3KF8A 5HGTA 1EIHA 2E2IB 4DK3C 3K7AB 3T4AC 1F9SA 3SDZA 2M00A 3HOYH 3W5OA 2KQ3A 4DAVA 4A3MB 3GTQH 5IWAQ 4QJFA 4A3FH 4L5QA 1WD0A 2EYPA 4X3TA 3NTIA 2R92H 3QOJA 1P16A 2ZTCA 3M3YB 4YCUA 4FP5D 3AQQA 4R8IA 3PIPA 3GDEA 4C3HG 4WRDA 1C0AA 1F9PA 4JW0A 1CHQD 2AHOB 5C4HA 3NTHA 3OYYA 4C3IH 4LF8Q 1Q86C 1JORA 2F0KA 3A8KE 2AWOA 1TWAB 3PSIA 4UP7A 5M3FB 2K7VA 3PIOA 2F3IA 2DY8A 2WAQG 3I2ZA 3E9IA 1GJXA 4DUZQ 2A8VA 4HSPA 2MPMA 4L6TB 3PUVA 2V1CC 1IBMQ 2QW7A 2HHHL 4RGTA 1WTRA 1ML0D 1FVIA 1TWAH 4CKBA 3GTGH 4L5TA 4X66L 1UE1A 4QIWB 1LTAD 1WFQA 1KIXA 5T1GA 3GQBA 3S14B 5BR8Q 1HZBA 1X56A 3T56B 3ULJA 1VQBA 3W3AA 1OO9B 3TDQA 4HR7B 3KLRA 3SEBA 5KYIA 1X3EA 1K8OA 4KHVA 1K0SA 5DM73 1XNQQ 3HOZB 3NEMA 2L12A 5LL6S 3T51B 3M4PA 2Z8LA 3HEJA 1VQAA 3PGZA 1D7QA 1SMYC 5C4XH 1STHA 2R7ZH 5GQOA 4PMWA 2L11A 3CRLC 2EJFC 2G9DA 3R3OA 3OW7A 4A3DH 1V1OA 4ZKCB 3Q23A 1QILA 2ICIA 3S2DB 4LWCA 2B63B 4JI3Q 3A55A 1IKLA 1GOZA 3T53B 4OEMB 3S1NH 3CQZB 1EEID 2Q2TA 1QZHA 2R7ZG 3DM3A 5BN4A 3QB3A 3HOUG 1R4PB 2Q2HA 4G4KA 1KLGD 3U9OA 1STAA 1X55A 1GUWA 3NQTA 1X54A 1TU2B 2WAQE 1ET9A 2L15A 2NVYH 1LT3D 1G51A 2AKWB 2BH8A 1ASZA 3PQIA 4K8IA 2R61A 3SK6A 1RL2A 2NN6G 4A93H 4RA8A 2BDNA 3I4MG 5FLXc 2PO4A 1EYDA 2PZWA 4BWGB 5FO8B 2JK8A 3GP7A 1KXLA 1KDAA 1GHKA 1TWHH 2JEAI 5J3BA 1WTPA 1XWEA 1TT2A 2RDFA 5JJLA 4IOAA 1TWFB 4RAUC 1N32Q 4G7HC 3GTPB 4R9WA 5EQ0A 2E2DC 2VS1A 2VXWA 2NVQH 5FLMG 1IBLL 2UUBQ 1YJ9A 1P8LA 4Y52H 3SXHA 3G6EA 1Y1VG 4IUVA 2NBFA 1U4PA 3AU7A 5HURA 1RODA 1SNQA 4RGMA 3EFXD 2QKIC 3M4QA 3UDIA 3G4SA 1F2MA 4DV3L 3J7YW 3FDTA 3QOLA 1Q82C 5CR3A 2A5HA 2KCMA 3E0JA 2IL8A 3OSOA 3M3YH 2XN9C 3BYYB 4JBJA 1K8AC 1FD7D 5AJ3Q 2QEXA 3K5NA 2NVXB 1TY0A 2EQSA 4QL5A 1DCZA 1LABA 2OQ0A 1VQ9A 3M85A 5C5LA 4KN4C 2I5HA 1STGA 4KY7A 1LTID 3P75A 3FRPB 1BR9A 1GD7A 4IFDH 1NAPA 4R4CA 1LYLA 3KJOA 2A73B 4JBWA 2O5JC 1MHWC 3K8AA 4X6AH 1EU3A 3MHBA 3J81j 2E2IH 1DGSA 2KA7A 1R9TB 2Z6BA 2FINB 4A3MH 3IRBA 1IW7C 3DXJC 4KY5A 1U4LA 4S3SA 3Q24A 4IJLA 5DNFA 5IGBA 4J1MA 3H3VC 1HUNA 1S40A 4CBVA 1T5XD 1SYBA 2QDLA 4JV5Q 3V2TA 1JJCB 2EYHA 3E9HA 2HHHQ 2M2LA 4NDXA 3HKZB 4YWMA 1SAPA 1RDPD 1NMGA 4XT1B 2O5IC 1MBYA 2NZOA 1QCBD 4FXGC 1XXGA 2F0MA 4A93G 4ZCKA 5CMDA 4R8NA 1B50A 2K05A 2WKCA 4N8X1 1CHPD 5BN3A 3ZJYC 4F8MA 1Y1WH 2RA4A 2JA5H 5I4DA 1Q46A 2B8FA 1TR5A 2HDMA 2C9OA 1TS3A 1K83B 3KFUA 2PNHA 1FL0A 2Z0SA 1W6JA 3SK8A 3MXNA 1FNUA 3JAME 4X62Q 4DV6Q 1BKBA 4BBSH 3R2TA 1ZEQX 1PRTD 3H3VH 1I4RA 2CFMA 5KYLA 1YIJA 3BG3A 5EBCA 4A75A 4CHTB 1VQDA 1V8QA 1HQRD 1HH2P 4LK1C 4JI5L 2JQOA 1U5KA 1E2VA 1DOMA 1TQOA 4DUYQ 2KECA 4DXFA 5I6YA 1BF4A 5M5YB 1UEBA 1UE6A 1D8LA 4POGA 1JQYD 2KCTA 5C3XA 4JVZA 1LT4D 2B63H 4DXGA 4F7XA 3I4MB 4KHPQ 3D6WA 2MO0A 5C5MA 1PV4A 1HZAA 5IY0A 1Y1WB 1PXUA 1EY9A 3H6MA 2MQHA 4DR3Q 5M5WH 2SNMA 3KF6B 1K9MC 2I5MX 3AFQA 1FNWA 1KRTA 3CPFA 2R93G 2CH4A 5C3EG 1KLUD 2F52A 1L0YB 3CXCA 1JC7A 4ME5A 2RKSA 2ZXOA 4N9TA 2AUKA 4IOCA 4X65Q 2B2YC 4OO1G 4WJWA 5IYCG 1NBWA 1XMOQ 4DV3Q 3ERSX 1PVOA 1PTOB 1BO0A 1SFOB 3R93A 1J5EL 3MA2B 2HIVA 3HZXA 4H02A 2K5DA 1N33L 4IUUA 3A74A 2EYJA 3GTMH 3QO2A 2VQEL 4C3JG 2IT1A 4KMUC 1OXTA 1ZKOA 3SR1A 1U4MA 3VA5A 2A6ED 1AEXA 4DV0L 2WB1G 3KK7A 2K5NA 2K32A 1JOOA 2IHEA 4OIKA 5F2DA 5CV4A 4N8FA 1YITA 4PG3A 4LF5Q 5ELCA 3D6CA 5BN5A 2UUAL 4BY1G 3K5OA 1A8VA 3L3OC 4I7AA 3GTOB 2GVAA 1MJCA 1RTOA 4GS3A 4QIWE 2AMCB 5GAGC 1EYGA 1N36L 3QG1A 1KD1C 3KOJA 4PV1C 2OCEA 5A2QL 1HTPA 4HIOA 1K0RA 4LF6L 4GLVB 3CCEA 3V96A 2J7ZA 4EQOA 1HUMA 3VR5A 4MZ9A 4Q5VA 5LMUL 1N36Q 1F9QA 3NELA 3DEOA 3PUZA 2LS01 3SE0A 3PO2G 1WYDA 3S16B 4FO2A 3L9AX 3M4YA 3GO5A 3I3CA 5FO7B 3E3XA 3T13A 2PQEA 2YU9H 1SE2A 3CMEA 1SR3A 4K5VA 1IBKQ 3M4OB 4H7BA 1RCVD 1FGBD 3J80c 2VZAA 2Z4HA 4IO9A 3Q22A 1UNSA 3X3NA 4U68A 1L1OC 4TQUS 2KENA 2M9VA 4R4QA 4A3DG 2YYZA 1NTGA 4HJ5A 5A35A 2EY2A 3CAMA 3A0JA 2TMPA 1LT5D 3E0EA 1QE6A 2VB3X 1PYBA 2ZJQA 4LMQD 4ZUIA 3MWYW 3PCOB 1FGUA 4HEDA 5IT9c 4H0LC 5I2YA 1JICA 3I56A 1SXTA 2OT2A 1ILQA 2Z9HA 1PFBA 1GXDC 5FJ8G 5JAVA 4BY7G 5LHY1 1H9JA 3H0GG 2VB2X 2N3SA 2RSNA 5FOBB 3I91A 4DAYB 1QZGA 3C3LA 1SE4A 3U4VA 2B2UC 4NP5A 4XQJA 1PTOF 3SHLA 2JA7H 5IYDH 1NR4A 4K6DA 1VQ7A 2K50A 4IURA 1BCPD 3LGJA 2K5HA 3A5UA 2FJ2A 3VYUA 5IGDA 5KEEA 1Y1WG 1N34Q 3OOCA 3IAYA 2EVBA 2BH2A 4IUQA 1BVSA 3CRKC 2ASBA 1M4VA 1TS2A 5IOCA 4GLXA 4JI8L 3FPUB 5CORA 1PFNA 4C1NI 3MTSA 1SE3A 1AW7A 4K0KL 4A4IA 3ER0A 1TWCB 2BE5C 1XPUA 1QVCA 1XMOL 3WOFA 1B9MA 1M8AA 3KLSX 4BBSG 3KLSA 2F03A 1VQCA 4LF4Q 4B3TQ 2UUBL 3ND9A 4RWSC 4EQNA 2F0TA 3OPOA 2PZTA 3SGIA 5K36H 2Z6KC 3HOVB 1TWCH 2B2WC 1DJRD 3HOXG 4L5SA 1NCVA 4QGUA 4EVOA 3W2DA 2KCCA 4YHHQ 2EDGA 1B44D 4I7ZC 3RLFA 4UAIA 1O80A 4LUVA 3ULPA 2NVTB 4BY1B 1PRTF 4AQYL 3EN2A 5JEAJ 4QQBX 1AN8A 2H1EA 2NVQB 1EWCA 1SE8A 2K75A 4CDCC 1HRJA 3NP8A 5C0XJ 3F2UA 3QR8A 3S2HH 3U50C 2A68C 4B3SQ 4PZ6A 1JOQA 5FJ8H 1VQFA 3K0XA 4CJ2C 5ELEA 3B6YA 3RLNA 4ZKBB 3I72A 3HG9A 3NPPA 1LTSD 4HN7A 3CW2C 4PNYA 4DN4M 1VMCA 2EXZA 4OX9Q 1PFSA 3KLWA 4A3IH 4CDFC 1C9OA 4MNOA 3WWVA 4YWLA 1NE3A 3F2BA 1VF7A 2JA9A 1KAAA 1A62A 2L5TA 4IPDA 2E2HH 3TREA 2Q8IB 1WOCA 4WJ4A 3VR3A 1UWVA 4G57A 1VDZA 2JE6I 3EIVA 3S1MB 1O7LA 2F0IA 1VCIA 2EIFA 1PYWD 1I4QA 1QNUA 2F0QA 3H09A 3JAMi 4B3TL 3CPWA 3K57A 4RHRA 3J7AF 1LO5D 4PMBA 1SYEA 1HXYD 1NSNS 2CWPA 4PZ8A 4IZ8A 2C5CA 3HOZG 3J80i 2HIXA 3JC66 5IYBH 2F1MA 2YTYA 1XPOA 4TRDA 4IPGA 1GUNA 1W2BA 4EX5A 1HNWL 2EY6A 2JA5G 3K59A 4EQPA 4CGYB 3K5MA 3G71A 1HFGA 1PH7A 1H9RA 3S2DH 1ZYRD 3PMFA 3TSSA 2MP1A 3NUCA 3EVQA 1CK1A 3VR2A 4RH6A 1PZKD 4NKLA 4DR4L 4JI0L 1I4HA 5JEAH 2K52A 1S5BD 5D14A 4XQQA 1T5EA 1WVLA 3E5SA 4C3IB 1WTVA 2LY7A 1ASYA 3FEWX 3S1MH 3EBEA 1Q90A 1VQOA 1CI3M 2LMCB 4KTAA 5GAEC 3I7FA 2EXDA 1CZWA 4BBSB 1VQGA 1A63A 1U0LA 1S5FD 1YJNA 2ZT9C 2X6LA 4NB3A 5JJZA 1M1KC 1VQ5A 1RD9D 3LX0A 4X3KA 3S9WA 1JOKA 5AFWA 5G3LD 4XYQA 1EY4A 1Y1VB 1WCMG 2EYFA 3HRZC 3CC2A 3MFGA 1EFWA 2JSOA 3R2IA 3V05A 5ELOA 1PDQA 4FVMA 1QNKA 4JG2A 2P5ZX 3TS2A 5IP9H 2UUCQ 3GD7A 1MGSA 4NPSA 1I50B 2VUMG 4CJ1B 5M3MG 5AJ3L 4BY1H 4LFBQ 4QF4A 5M3FH 1EOTA 5JPMC 2AUJD 2PMZB 3MC0B 1G291 3NWTA 2UU9L 4OONA 3UDXA 4DAMA 2Y0SE 3M4OH 3ZYYX 5M5WB 3FMCA 1L0WA 1XNRL 3A8JE 1LUZA 5EPLA 1YVCA 3DWQA 2HT1A 3GTGB 3C1FA 4WJ3M 2EYOA 3CU7A 1B8AA 1SYGA 5IGEA 2EY5A 4A3BG 1IYUA 2IX1A 1H9KA 2K14A 2RSOA 3ICEA 2EJMA 5M5YH 1TY2A 4OX9L 4ZLTF 3L2PA 2B2YA 4O0AA 5ELDA 1KNEA 1AZQA 2OXPA 1KNAA 4P74A 4OIJA 4B9WA 3CCUA 4HAEA 1SNOA 1JWMD 3K7AH 4A3BH 3DWAA 1X3GA 3TZUA 4B3RL 5IP7G 3AEVA 3KDFB 1N8RC 4RHSA 3HOYG 4DV7L 1E1OA 1CZGA 3RUZA 5D3IB 1BCPC 1DOKA 1E2ZA 4DR1L 5IIFA 4JC0A 1B9NA 4RGOS 1L0XB 5DLQE 1O7YA 2N49A 2F0JA 3CQZH 1J5EQ 3MFYA 1JCKB 5GAHC 1EY8A 3DHQA 4DK0A 4YWKA 3T1YL 2RDHA 1QUQB 3KBGA 4IPHA 3S17H 4J6HA 4BS9A 4JPBW 3URYA 4PMCA 4MIUA 1KTKA 3GTMB 4A3FG 5CGKA 4BBRB 1S5ED 4HCSA 3GV6A 5CBAE 1K28A 2PZUA 3TP6A 3X3MA 5C0XH 5HGQA 2CH4W 3CCQA 3LWEA 4ULLA 4DGZA 1KQSA 4BXXH 4KHZA 1JWSD 4KJOA 1S5CD 1D1IA 5M9OA 1GUGA 1KDBA 3CCSA 5I9OA 1F2LA 2I5LX 4NXNQ 3OMCA 3HOVH 5EPKA 2HDLA 3WOEA 1N34L 1SDFA 4XYOA 3A8IE 3H94A 4IFDI 2EOTA 4UHVA 2IX0A 4P73A 1LT6D 1VMPA 2E74C 4KLKA 5LMNW 3H0GH 4K6LA 3TBIB 2NN6I 2WV6D 1A3TA 4L63B 2F0DA 4DUZL 4N9PA 4APVA 1JE4A 2RHQB 4Y7NH 1WTQA 3EQLC 5LL6X 1AFPA 1WD1A 4AH6A 5IGGA 4BA2I 1IXRA 3MEHA 4DR3L 1LM0A 3I90A 4OGQC 1F77A 4WORA 1BUVT 2SDFA 2X69A 1SJED 2RF4A 3DMUA 1GUTA 3DM1A 5IP7H 1I5FA 4RGNA 2UXDQ 2MFIA 1DXMA 4JI8Q 1WTHA 3P20A 4FDBA 3GTKH 5C3EB 2DNCA 1K8GA 1OXVA 1RKNA 4PZ7A 5COYA 2VUMB 4ZQ3A 4LAAA 5FKAC 3QJYA 2C35B 4MHEA 2UUCL 2NTSA 2FFKB 3S1RB 2ALYB 2IW3A 4B3ML 3FP9A 2L4NA 1B3QA 5C4ZA 4DV2Q 3GTKB 4RG1A 2VNUD 4L8JA 1VQHA 1C48A 4LJZC 4NXMQ 1V9PA 4K5XA 1YEZA 2K1BA 4C3JB 4DV2L 1WTXA 2V4DA 4C2MB 1DM0B 1E7ZA 1CA6A 1V1PB 2LXKA 1A3VA 1Y1VH 3ITPA 5GADC 1EY7A 1ICWA 2K5WA 2B2WA 1HZCA 1CQVA 4B3SL 1EWHA 4LF8L 1CKNB 4JI6Q 2IJ0A 3G7LA 4RCOA 3BJUA 4A3KB 4JK1C 4DR5L 2YV5A 2A6HD 3OIPA 1J8IA 5LMNL 3J81i 4GKKL 2WIIB 4X3UA 2PPBC 2CHBD 4JI2L 4H44C 1PMRA 4KY6A 4CDDC 3I4NH 4KV6A 3R8BA 2VUMH 1GHJA 1SMXA 1KABA 2KHIA 2QF7A 3FPPA 1SBBB 3TEHB 1FJGQ 2RVLA 4CDEC 4KD3A 3RMHA 3K5LA 2PMZE 1UE7A 5JEAG 1A3UA 4KKTA 2N55A 2PNRC 3CC7A 4BA1I 3HOYB 5IGFA 1IL8A 5BR8L 3MEFA 3J81E 3BU2A 2Z1CA 1N33Q 4F87A 4JOIA 4IJHA 5JJKA 4UDUC 3OIQA 4DNIA 1L1OB 2SOBA 1EOVA 4A3LG 1ONLA 4KK7A 2B39A 1II3A 3H91A 5IWAL 2K03A 2YTXA 4UPAA 5HY6A 4NXML 1K83H 1RTNA 4C1NK 2AQ2B 4IUNA 4Z9CB 3WDNA 3TP5A 1Y69U 2JA8B 3P7JA 1ESFA 1CQFA 2D9UA 4LFAQ 1HA6A 5A2QE 4ZK9B 4LF7Q 2OEOA 2JYOA 1STEA 2X6GA 1SEBD 3HFZB 4O2DA 4ODGA 4AYBE 3Q8DA 2VQFQ 1HNZL 3AMUA 1TS4A 1W6KA 2IX3A 4TSSA 1BCPF 1STYA 1HHVA 2L0CA 3U4ZA 5C44H 3GTJH 4KI0A 3PO3B 2FXQA 4POFA 2FMCA 3DEPA 4A3GG 2BA1A 1PZID 1SNMA 1SNPA 2Y0SG 4JI1Q 1SLJA 1Z47A 1Q1EA 1YBYA 2OWOA 3LWUA 2R7FA 3KYHC 4DF7A 5C3EH 1IBML 2ID0A 5DAUA 1CSPA 1A15A 3OTOQ 1Y8NB 2F0HA 1TWGB 1ENAA 5IT9E 3PO2H 1G6ZA 3CKIB 4M1UB 1J9OA 1YJWA 4XT3B 4A3JG 1NR2A 1GM5A 3W1BA 2SNSA 3NWSA 3Q6SA 5IE8A 3OTOL 1PH9A 4DAPA 5EKLA 1PLFA 1Y8OB 3LNNA 4A3IB 2RCNA 3A5ZB 1PHJA 2UU9Q 2I46A 4GNXA 1RJTA 3D4RA 4JOIC 1VQKA 4LF4L 4QCLA 4LFBL 2R7DA 1CUKA 1JT8A 4P71A 2D0OA 1YHBA 1CM9A 4CKEA 1GVPA 4DV0Q 4FF2A 4HSVA 3BVGA 1CKMA 4YCVA 5KNCA 5CYUA 1PA6A 2UUAQ 1HPCA 1EY0A 5I9PA 5FK9C 4LF5L 3EROA 1EZ8A 4DR5Q 3D4DA 2R7ZB 2G5DA 2UXCL 3PF5A 1I4XA 3I4OA 1YZ6A 2I07B 2K01A 4GN3B 2A68D 4A3CG 2RDGA 4X3SA 4R4OA 1MIUA 5ELBA 3MZ5A 1AH9A 4A3KG 4BBRH 4HIKA 4LUZA 4DUYL 4LF6Q 4FF4A 4C2MH 2KHSA 2PI2E 1ENFA 1AE3A 2D62A 1GUSA 3H15A 5C4XG 2F0UA 1QJOA 5ELFA 2EYLA 2JN4A 1Q8KA 3NXWA 1WI5A 2L1BA 3MXGA 2ZXRA 5D3DA 2K6AA 2EY1A 5CV6A 2JXMB 4JV5L 5EBDA 4NW2A 1HR0W 1SNDA 1KHIA 3VYRA 4GN5A 1WCMH 1NJIC 2QDBA 1EWIA 5C0XI 4JBMA 4DR1Q 3J80L 4ZYSA 2B2UA 3CCJA 2NVXH 1BCPB 1U9RA 4J15A 1T9HA 3S15H 4A3JH 1S72A 2HCCA 1J6QA 2BE5D 1MSGA 2FMMA 4UP8A 2PQAA 1NUCA 1HA5A 3HOWG 4P72A 2IY5B 1STBA 2JA8G 3K80C 2WINB 2VW9A 2QEJC 1PTOC 2F0OA 2Z6KA 5M3MH 3FHWA 2DUDA 1ZYRC 2ENBA 4M8AA 1GKHA 4DK6C 3VA7A 4HJAA 4R4TA 2JA5B 3HS0C 1QUQA 1VQ4A 3BDLA 4NMZA 3CMAA 4TVAB 4GNXB 2A69C 3G6JB 2ICEC 2NVTH 2JA7G 3NSWA 5L37A 2XWBB 4OELB 4HCEA 5CV8A 5DEHA 4ZRZA 2ZTDA 4C3HH 4LFCQ 3I4MH 3O13A 3NBIA 4A3GB 1VQ6A 3NENA 4V0BA 1V1PA 1JE5A 4X64L 1BQQT 2WFWA 2WACA 4XDXA 3BVMA 1B53A 3A56A 4O1NA 3UE1A 2HD3A 3TZDA 1Y14B 4LF9L 4C3IG 4X64Q 1KC8C 1E0BA 3Q0AA 4GKJQ 2VQFL 4OO1I 2MGSA 5IP9G 1D6EC 1OXXK 3I8ZA 2DY7A 3W1GA 3UDFA 5C44G 2EPBA 1PRTB 1A2UA 3PO3G 3PUYA 4DV5Q 5K5PA 3KBXA 1JB3A 3SK5A 3A54A 2UXDL 2JP1A 1VQPA 2KEDA 1HR0L 1IZ6A 4RCNA 1R4QB 2BDOA 1PTOH 2PW5A 4DU9A 3BDOA 3J7A5 1UE5A 1NNXA 2H4OA 4CKCA 2R93B 2E2JB 1LTGD 1LTRD 1FNVA 2BCOA 2PYKA 4ABNA 3HKZG 4HTHA 4HJ9A 1B4OA 2WP8J 4A3IG 4LUOA 3UE0A 3CHBD 1H9MA 2E75C 4A93B 3ONAB 1EIYB 2B2VC 2EZVA 3TP7A 4X62L 4FXKC 4F88A 3T1HQ 3QWNA 3S17B 1JR0D 3FKIG 4O42A 2VQEQ 1NY4A 2B3GA 2XGTA 4OWTB 4DNTB 2D5DA 4YHHL 4HIDA 3NK9A 3T1HL 1XNRQ 1TWGH 4JI4L 1C8CA 2JA6B 5FLXE 5GROA 5IYCH 3PUWA 4A76A 4JI3L 2ES2A 1UEAB 4OXPA 1X9NA 1XYIA 3RN2A 2IHFA 1JJ2A 4R1JA 1X3FA 2G9HD 3CF5A 2HUGA 4HMIA 4Q0FA 1SYCA 5KGUA 4P75A 1PH2A 3CCRA 2WKDA 3STBD 1G8ZD 4FNFA 4JYAQ 4DAYA 2LXJA 2RBMA 4AYBB 5C4XB 3RR5A 5LMNQ 1ILPA 1VQJA 2FHTA 4J8QA 3I4LA 4JYAL 1WTWA 2A1AA 3BDCA 3K6OA 1VS0A 2F0LA 2JA8H 3CC4A 3ULLA 4OO1H 2Q2UA 1XMQL 1HNXL 3MAQA 1EFID 3VYSA 4K2LA 4LNQA 3PO2B 3S14H 4B3RQ 1FYCA 4KKSA 2CW0D 3I55A 3C46A 3FVQA 2H5XA
chains in the Genus database with same CATH topology
1Y8PB 5IODA 4EGVA 3HOWB 5E4XA 1TKWB 1RHPA 3PUXA 5JVH3 4A3DB 2J0TD 4DA2A 1UUPA 2K28A 1TWHB 3PV0A 2LFNA 2YU9B 4QMGA 2GA4B 2E76C 1RF2D 4A3FB 2MJ8A 4KN7C 2KVMA 4DFAA 2JA7B 5C6AA 4C56C 1DONA 2F3WA 4ZUJA 4C3HB 3TMEA 5CV5A 3VYTA 1PZJD 2IWHA 3AB9A 2F4IA 3NE5B 2F0VA 4B08A 2KCNA 3NTKA 1IKMA 2AQ3B 1MI2A 2Q8RE 2WAQB 2F0WA 2AQ1B 5C3WA 3D31A 5NUCA 2Z4IA 1DZ1A 1CA5A 4A3EB 4KD4A 2NZ1D 1AP0A 3K58A 1TIID 1SNCA 1BDOA 2KOLA 1DD2A 4E6IA 2EJGC 3S15B 4CJ0B 2O4XA 1S4ZA 4RFBA 5I2XA 4IALA 1TVXA 4DNRB 2A69D 3RZOB 1HTLD 1BXTA 3HOXB 1ET6A 3VR6A 1SYDA 1YNJC 5IGCA 1A2TA 4QB4A 1EU4A 3TN2A 2CW0C 3K0YA 2A6EC 1ESRA 1BBXC 1PTOD 1XTCD 2NTTA 3FKIB 5DM63 3EJIA 1IW7D 3QIAA 4IFDJ 3C2PA 3J81L 4H13C 5J22A 1G2SA 3SK4A 4XTCS 1BNZA 3GTLB 5CBEE 1ENCA 3MVVA 1GUOA 2B2TA 3OHXC 4FYDA 2MUYA 4IFDG 3IL8A 4QUFA 2IPKD 5I6WA 2F0EA 1JWUD 1LLRD 4IN3A 2SEBD 5CV9A 3ND8A 1LTBD 1O7ZA 5EKIA 2NWGA 3HGBA 4OL7A 5KIXA 2F0PA 4XQNA 1EY6A 3NQIA 2MHVA 5EKKA 2NVYB 4KJNA 3A7AB 2XRQD 2OF1A 2XWJB 1Z7TA 4K14A 2HQEA 4I65A 1STNA 2AWNA 1ZXTA 1Q12A 2XIWA 1IHZA 1PRTC 1B1ZA 3C1EA 1V43A 1X3PA 3OWEB 5T1IA 4K2KA 2KUMA 3SVMA 2RQXA 1HFNA 1O78A 1K8MA 1AZPA 1CTMA 3U9SA 1EQVA 2KEEA 1EY5A 2PCFB 3N6RA 3JAML 5CC4A 2F0FA 2CQAA 2DN8A 2CVRA 5K36G 1TS5A 3BZDB 4TKOB 1EZ6A 2Y0SB 1G2TA 1OXUA 3S1QB 1I4PA 1QG7A 4KKUA 3MXPA 5M5XB 3NHHA 4IUTA 3T16A 3EA6A 1XX8A 4XIGS 1EYAA 1WCMB 1OXSC 1C4QA 1YNNC 2A74C 1IYVA 2E2HB 1SYFA 4A3JB 5C0XG 2EE1A 5FLXL 1KDCA 2F0SA 3HP3A 5J1ZA 4G7ZC 2XRSD 1Q1BA 2K5QA 3L7ZC 3I4NB 3P1HA 2PW7A 2R6GA 2ZXPA 3DWPA 4MN3A 4WFN3 4Y7NB 1DOLA 3RD4A 5EGTA 4V190 4PQXA 4YIJA 3BYTB 1EEFD 4P2CB 2O2LD 5D65A 1DYQA 1D1KA 1F9RA 1A6XA 4HMJA 1EQTA 1X3QA 1F2YA 2NN6H 1Q3LA 5KNBA 1I6VC 2QCPX 2JEBI 1QB5D 2XNAC 1UAPA 5E1FA 4FF1A 4IQZA 2A6HC 1BOSA 1MD2D 3E6ZX 1CT1D 4XXEA 3S1NB 2EYMA 5G3LF 1HQMC 3GV3A 5FO9B 2F3VA 2R3ZA 1I4GA 1YNND 2K04A 3KUPA 3ERQA 1D5MC 5M3MB 1F2ZA 2J4XA 2F0GA 3M7GA 4QUCA 2WB1B 3GTQB 4GZYC 1SMYD 1EYCA 4FXDA 4K5WA 2B2VA 2N88A 1QOHA 5J39A 1WTOA 1U4RA 4G7OC 1PFMA 3J7AV 5EPJA 1MSHA 4OHJA 4A3BB 1I6HB 3OMGA 4K8JA 5JPNC 1H9SB 5IT9L 5JVG3 2L9HA 5EJWA 3TP8A 1LTTD 5CV7A 4FF3A 5ISRA 3RZDB 3J80E 3D3RA 4ID6A 3GTJB 5C44B 2XSCA 1VF5C 1E2WA 2D2CC 2BA0A 5JOBA 2NYZD 3DUZA 3IFTA 2HCIA 3D4WA 2NUCA 5TSSA 4RKBA 2Q8TA 3UI2A 1HCZA 1QWYA 1EIGA 1X32A 1SSOA 3NBHA 2F0NA 3IFDA 3I70A 1CFMA 2B2TC 3IKJA 4U673 1LACA 2XVSA 3A7LA 3I73A 4ZAIA 1B2TA 3S2HB 5KRUA 5E3FA 3BS1A 3MXUA 2LKVA 3N52A 1FR3A 2BOSA 3D8GA 4BY7B 4IUPA 3H0GB 1H9SA 1I3QB 2QILA 2L55A 3VR4A 1D2BA 2R92B 4B9XA 4DK1A 5KNDA 5C4JB 3HOUB 3OWFA 3PIO3 1SJHD 1B3AA 2KJXA 1D5XC 2B8GA 2TSSA 3BVZA 1G91A 1D5ZC 1LV9A 1EL0A 2NB0A 2K33A 1S5DD 1YNJD 1Q8IA 1Z6HA 3PIP3 2DNEA 4RKLA 5E4WC 4ILWA 3M7NA 3KF8A 5HGTA 1EIHA 2E2IB 3K7AB 3T4AC 1F9SA 3SDZA 2M00A 2KQ3A 4DAVA 4A3MB 1WD0A 2EYPA 4X3TA 3NTIA 3QOJA 3M3YB 4FP5D 4R8IA 4C3HG 4WRDA 1F9PA 1CHQD 5C4HA 3NTHA 1JORA 2F0KA 3A8KE 2AWOA 1TWAB 5M3FB 2K7VA 2DY8A 1GJXA 4HSPA 2MPMA 4L6TB 3PUVA 4RGTA 1WTRA 1ML0D 4CKBA 4QIWB 1LTAD 5T1GA 3GQBA 3S14B 3T56B 3W3AA 1OO9B 3TDQA 4HR7B 3KLRA 3SEBA 5KYIA 1K8OA 4KHVA 5DM73 3HOZB 2L12A 5LL6S 3T51B 2Z8LA 3HEJA 1SMYC 1STHA 4PMWA 2L11A 3CRLC 2EJFC 2G9DA 3R3OA 3OW7A 1V1OA 4ZKCB 3Q23A 1QILA 2ICIA 3S2DB 2B63B 3A55A 1IKLA 1GOZA 3T53B 3CQZB 1EEID 5BN4A 3QB3A 1R4PB 4G4KA 1KLGD 3U9OA 1STAA 1GUWA 3NQTA 1TU2B 1ET9A 1LT3D 4K8IA 2R61A 3SK6A 2NN6G 4RA8A 2BDNA 2PO4A 1EYDA 2PZWA 4BWGB 5FO8B 3GP7A 1KDAA 1GHKA 2JEAI 1WTPA 1XWEA 1TT2A 2RDFA 1TWFB 4RAUC 4G7HC 3GTPB 4R9WA 5EQ0A 2E2DC 2VXWA 3SXHA 4IUVA 2NBFA 1U4PA 3AU7A 5HURA 1RODA 1SNQA 4RGMA 3EFXD 2QKIC 1F2MA 3J7YW 3FDTA 3QOLA 5CR3A 2A5HA 3E0JA 2IL8A 3OSOA 2XN9C 3BYYB 1FD7D 2NVXB 3K5NA 1TY0A 1DCZA 1LABA 3M85A 5C5LA 4KN4C 1STGA 4KY7A 1LTID 3P75A 3FRPB 1BR9A 4IFDH 1NAPA 2A73B 4JBWA 2O5JC 1EU3A 3MHBA 2KA7A 1R9TB 2FINB 1IW7C 3DXJC 4KY5A 1U4LA 4S3SA 3Q24A 5DNFA 5IGBA 4J1MA 3H3VC 1HUNA 4CBVA 1T5XD 1SYBA 3V2TA 2EYHA 2M2LA 4NDXA 3HKZB 1SAPA 1RDPD 4XT1B 2O5IC 1MBYA 1QCBD 4FXGC 1XXGA 2F0MA 5CMDA 4R8NA 1B50A 5BN3A 2K05A 2WKCA 1CHPD 4F8MA 2RA4A 5I4DA 2B8FA 1TR5A 2HDMA 2C9OA 1TS3A 1K83B 1W6JA 3SK8A 3MXNA 1FNUA 3JAME 3R2TA 1ZEQX 1PRTD 1I4RA 5KYLA 3BG3A 5EBCA 4CHTB 1V8QA 1HQRD 4LK1C 1E2VA 1DOMA 1TQOA 2KECA 4DXFA 5I6YA 1BF4A 5M5YB 1JQYD 5C3XA 1LT4D 4DXGA 4F7XA 3I4MB 3D6WA 5C5MA 1Y1WB 1EY9A 1PXUA 3H6MA 2SNMA 1FNWA 1KLUD 1L0YB 1JC7A 4ME5A 2RKSA 2ZXOA 4N9TA 2AUKA 2B2YC 4OO1G 4WJWA 1PTOB 1BO0A 1SFOB 3R93A 3MA2B 3HZXA 2K5DA 4IUUA 2EYJA 3QO2A 4C3JG 2IT1A 4KMUC 1OXTA 1ZKOA 3SR1A 1U4MA 3VA5A 2A6ED 1AEXA 3KK7A 2K32A 1JOOA 4OIKA 5F2DA 5CV4A 5ELCA 3D6CA 5BN5A 3K5OA 3L3OC 3GTOB 1RTOA 3QG1A 4PV1C 5A2QL 1HTPA 3V96A 2J7ZA 4EQOA 1HUMA 3VR5A 4Q5VA 1F9QA 3SE0A 3DEOA 3PUZA 2LS01 3S16B 4FO2A 3L9AX 3M4YA 3GO5A 3I3CA 5FO7B 3T13A 2PQEA 1SE2A 4K5VA 3M4OB 4H7BA 1RCVD 1FGBD 2Z4HA 3Q22A 1UNSA 3X3NA 4U68A 4TQUS 2M9VA 2YYZA 5A35A 2EY2A 2TMPA 1LT5D 1QE6A 2VB3X 4LMQD 4ZUIA 3MWYW 4HEDA 4H0LC 5I2YA 1JICA 1SXTA 2OT2A 1ILQA 1PFBA 1GXDC 5JAVA 5LHY1 1H9JA 2VB2X 2RSNA 5FOBB 3I91A 3C3LA 4XQJA 1SE4A 2B2UC 4NP5A 1PTOF 3SHLA 1NR4A 4K6DA 4IURA 1BCPD 2FJ2A 3VYUA 5KEEA 5IGDA 3OOCA 3IAYA 2EVBA 4IUQA 3CRKC 1M4VA 1TS2A 5IOCA 3FPUB 5CORA 1PFNA 4C1NI 3MTSA 1SE3A 1AW7A 1TWCB 2BE5C 3WOFA 1B9MA 1M8AA 3KLSX 3KLSA 2F03A 3ND9A 4RWSC 4EQNA 2F0TA 3OPOA 2PZTA 5K36H 3HOVB 2B2WC 1DJRD 1NCVA 4EVOA 3W2DA 2KCCA 2EDGA 1B44D 4I7ZC 3RLFA 4UAIA 1O80A 2NVTB 4BY1B 1PRTF 5JEAJ 1AN8A 2H1EA 2NVQB 1EWCA 1HRJA 3NP8A 5C0XJ 3F2UA 2A68C 1JOQA 4CJ2C 5ELEA 4ZKBB 3I72A 3HG9A 3NPPA 1LTSD 4HN7A 4PNYA 4DN4M 1VMCA 2EXZA 1VF7A 1KAAA 2L5TA 2Q8IB 3VR3A 4G57A 1VDZA 2JE6I 3S1MB 1O7LA 2F0IA 1VCIA 1PYWD 1I4QA 1QNUA 2F0QA 3H09A 3K57A 4RHRA 3J7AF 1LO5D 4PMBA 1SYEA 1HXYD 1NSNS 4IZ8A 2C5CA 2F1MA 4TRDA 1GUNA 2EY6A 3K59A 4EQPA 4CGYB 3K5MA 1HFGA 1H9RA 1ZYRD 3PMFA 3TSSA 2MP1A 3NUCA 3EVQA 1CK1A 3VR2A 4RH6A 1PZKD 4NKLA 1I4HA 5JEAH 1S5BD 5D14A 4XQQA 1T5EA 1WVLA 3E5SA 4C3IB 1WTVA 2LY7A 3FEWX 1Q90A 1CI3M 2LMCB 4KTAA 1CZWA 4BBSB 1S5FD 2ZT9C 2X6LA 5JJZA 1RD9D 3LX0A 4X3KA 3S9WA 1JOKA 5AFWA 5G3LD 4XYQA 1EY4A 1Y1VB 3HRZC 2EYFA 3MFGA 2JSOA 3R2IA 3V05A 1PDQA 4FVMA 1QNKA 3GD7A 1MGSA 1I50B 4CJ1B 4QF4A 1EOTA 5JPMC 2AUJD 2PMZB 3MC0B 1G291 3NWTA 3ZYYX 5M5WB 3FMCA 3A8JE 5EPLA 3DWQA 3GTGB 3C1FA 2EYOA 3CU7A 1SYGA 5IGEA 2EY5A 1IYUA 2IX1A 1H9KA 2RSOA 2EJMA 1TY2A 4ZLTF 2B2YA 5ELDA 1KNEA 1AZQA 2OXPA 1KNAA 4OIJA 4B9WA 4HAEA 1SNOA 1JWMD 3DWAA 3TZUA 4RHSA 1CZGA 3RUZA 5D3IB 1BCPC 1DOKA 1E2ZA 5IIFA 1B9NA 4RGOS 1L0XB 1O7YA 2F0JA 3MFYA 1JCKB 1EY8A 3DHQA 4DK0A 2RDHA 3KBGA 4J6HA 4BS9A 3URYA 4PMCA 4MIUA 3GTMB 1KTKA 5CGKA 4BBRB 1S5ED 4HCSA 3GV6A 5CBAE 2PZUA 3TP6A 3X3MA 5C0XH 3LWEA 4ULLA 4DGZA 4KHZA 1JWSD 4KJOA 1S5CD 1D1IA 5M9OA 1GUGA 1KDBA 5I9OA 1F2LA 3OMCA 5EPKA 2HDLA 3WOEA 1SDFA 4XYOA 3A8IE 3H94A 4IFDI 2EOTA 2IX0A 1LT6D 1VMPA 2E74C 4K6LA 3TBIB 2NN6I 2WV6D 1A3TA 4L63B 2F0DA 4N9PA 1JE4A 1WTQA 3EQLC 5LL6X 1AFPA 1WD1A 5IGGA 4BA2I 3MEHA 3I90A 4OGQC 1F77A 4WORA 1BUVT 2SDFA 2X69A 1SJED 3DMUA 1GUTA 3DM1A 4RGNA 1DXMA 3P20A 5C3EB 2DNCA 1OXVA 1RKNA 5COYA 2VUMB 4ZQ3A 4LAAA 5FKAC 3QJYA 4MHEA 2NTSA 2FFKB 3S1RB 2IW3A 2L4NA 5C4ZA 3GTKB 2VNUD 4L8JA 1C48A 4LJZC 4K5XA 2K1BA 4C3JB 1WTXA 2V4DA 4C2MB 1DM0B 1CA6A 1V1PB 1A3VA 3ITPA 1EY7A 1ICWA 2K5WA 2B2WA 1CQVA 1EWHA 2IJ0A 3G7LA 4RCOA 4A3KB 4JK1C 2A6HD 3OIPA 1J8IA 2WIIB 4X3UA 2PPBC 2CHBD 4H44C 1PMRA 4KY6A 4KV6A 3R8BA 1GHJA 1KABA 2QF7A 3FPPA 1SBBB 2RVLA 4KD3A 3RMHA 3K5LA 5JEAG 1A3UA 4KKTA 2N55A 2PNRC 4BA1I 3HOYB 5IGFA 1IL8A 3J81E 2Z1CA 4F87A 4UDUC 3OIQA 2SOBA 1ONLA 4KK7A 2B39A 1II3A 3H91A 2K03A 1RTNA 4C1NK 2AQ2B 4IUNA 4Z9CB 3WDNA 3TP5A 1Y69U 2JA8B 3P7JA 1ESFA 1CQFA 2D9UA 1HA6A 5A2QE 4ZK9B 2OEOA 2JYOA 1STEA 2X6GA 1SEBD 4ODGA 3AMUA 1TS4A 1W6KA 2IX3A 4TSSA 1BCPF 1STYA 1HHVA 2L0CA 4KI0A 3PO3B 2FMCA 3DEPA 2BA1A 1PZID 1SNMA 1SNPA 1Z47A 1Q1EA 3LWUA 4DF7A 2ID0A 5DAUA 1A15A 1Y8NB 2F0HA 1TWGB 1ENAA 5IT9E 1G6ZA 3CKIB 4M1UB 1J9OA 4XT3B 1NR2A 2SNSA 3NWSA 3Q6SA 4DAPA 5EKLA 1PLFA 1Y8OB 3LNNA 4A3IB 2I46A 1RJTA 3D4RA 4QCLA 1CM9A 4CKEA 4FF2A 4HSVA 3BVGA 5KNCA 5CYUA 1HPCA 1EY0A 5I9PA 5FK9C 3EROA 1EZ8A 3D4DA 2R7ZB 1I4XA 2I07B 2K01A 2A68D 2RDGA 4X3SA 5ELBA 3MZ5A 4FF4A 2KHSA 1ENFA 2D62A 1GUSA 2F0UA 1QJOA 5ELFA 2EYLA 3NXWA 2L1BA 3MXGA 2ZXRA 5D3DA 2K6AA 2EY1A 5CV6A 2JXMB 5EBDA 4NW2A 1SNDA 3VYRA 2QDBA 5C0XI 3J80L 4ZYSA 2B2UA 1BCPB 1U9RA 2HCCA 2BE5D 1MSGA 2FMMA 1NUCA 1HA5A 1STBA 2WINB 2QEJC 1PTOC 2F0OA 1ZYRC 2ENBA 4M8AA 3VA7A 2JA5B 3HS0C 3BDLA 4NMZA 2A69C 3G6JB 2ICEC 3NSWA 2XWBB 4HCEA 5CV8A 5DEHA 4ZRZA 4A3GB 3O13A 3NBIA 4V0BA 1V1PA 1BQQT 2WACA 4XDXA 3BVMA 1B53A 3A56A 4O1NA 3TZDA 4C3IG 1E0BA 3Q0AA 4OO1I 2MGSA 1D6EC 1OXXK 3I8ZA 2DY7A 2EPBA 1PRTB 1A2UA 3PUYA 5K5PA 3KBXA 1JB3A 3SK5A 3A54A 2JP1A 2KEDA 4RCNA 1R4QB 2BDOA 1PTOH 2PW5A 4DU9A 3BDOA 2H4OA 4CKCA 2R93B 2E2JB 1LTGD 1LTRD 1FNVA 2BCOA 2PYKA 4ABNA 4HTHA 1B4OA 2WP8J 3CHBD 1H9MA 2E75C 4A93B 3ONAB 2B2VC 2EZVA 3TP7A 4FXKC 4F88A 3QWNA 3S17B 1JR0D 4O42A 4DNTB 2D5DA 3NK9A 1C8CA 2JA6B 5FLXE 3PUWA 1UEAB 1XYIA 2G9HD 2HUGA 4HMIA 4Q0FA 1SYCA 5KGUA 2WKDA 1G8ZD 4FNFA 4DAYA 2RBMA 4AYBB 5C4XB 1ILPA 2FHTA 4J8QA 3I4LA 1WTWA 3BDCA 3K6OA 2F0LA 4OO1H 3MAQA 1EFID 3VYSA 4K2LA 3PO2B 1FYCA 4KKSA 2CW0D 3C46A 3FVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQV A;  5F2D A;  1TR5 A;  5CV4 A;  1EY5 A;  4PMB A;  1TT2 A;  2RDF A;  1SYE A;  5IGF A;  1A3T A;  5IOC A;  5IOD A;  5E1F A;  2F0D A;  5CC4 A;  3D6C A;  1NSN S;  4N9P A;  5KEE A;  1JOR A;  3EJI A;  2F0F A;  2F0K A;  4IZ8 A;  3SK8 A;  1A2U A;  1EY0 A;  5I9P A;  5IGG A;  5K5P A;  3C1F A;  3SXH A;  2EYO A;  3ERO A;  5KRU A;  1EZ8 A;  5E3F A;  2SOB A;  3SK5 A;  3MEH A;  3D4D A;  1SYG A;  4TRD A;  5IGE A;  2EY5 A;  1EZ6 A;  4WOR A;  2EYM A;  3DMU A;  1II3 A;  2LKV A;  2PW5 A;  2EY6 A;  4DU9 A;  5HUR A;  4EQP A;  1SNQ A;  5J22 A;  3D8G A;  4QMG A;  3SK4 A;  5KYL A;  2F3V A;  4DF7 A;  3MZ5 A;  2PYK A;  1ENC A;  3MVV A;  3PMF A;  4IUN A;  4HTH A;  1F2M A;  1RKN A;  2OXP A;  3TP5 A;  3ERQ A;  3MXP A;  3EVQ A;  3NUC A;  4EQN A;  3NHH A;  3T16 A;  4DFA A;  2F0T A;  3QOL A;  2PZT A;  4ZQ3 A;  4LAA A;  4EQO A;  2KHS A;  5CR3 A;  5C6A A;  4B9X A;  4B9W A;  4NKL A;  3OSO A;  1F2Z A;  1EYA A;  2F3W A;  1SNO A;  2F0G A;  2OEO A;  4ZUJ A;  1TQO A;  2F0U A;  3OWF A;  4EVO A;  3TME A;  2F0E A;  5CV5 A;  1SYF A;  2EYL A;  3TP7 A;  5I6W A;  5I6Y A;  4ODG A;  3NXW A;  5C5L A;  5C4Z A;  3T13 A;  2PQE A;  1STG A;  4K5V A;  1EYC A;  1KDC A;  4H7B A;  2EY1 A;  4KY7 A;  5CV6 A;  5CV9 A;  3E5S A;  3RUZ A;  2F0S A;  3P75 A;  4K5W A;  5J1Z A;  5C3X A;  4K5X A;  1STY A;  5IIF A;  5KYI A;  2F0V A;  4KHV A;  1SND A;  5J39 A;  4F7X A;  3NK9 A;  4KTA A;  1A3V A;  2F0J A;  1SNM A;  2QDB A;  5C5M A;  3NP8 A;  3ITP A;  3MHB A;  1EY9 A;  1EY7 A;  3HEJ A;  3H6M A;  4OL7 A;  5KIX A;  1EY8 A;  1SNP A;  2F0P A;  1U9R A;  3DHQ A;  1STH A;  3OMG A;  4K8J A;  2SNM A;  1JOQ A;  2F0W A;  5C3W A;  3P1H A;  3R3O A;  2PW7 A;  2EY2 A;  1EY6 A;  4ZUI A;  5NUC A;  3TP8 A;  1NUC A;  4J6H A;  5CV7 A;  5EKK A;  5ISR A;  4KJN A;  4KY5 A;  4PNY A;  4PMC A;  4ME5 A;  2RKS A;  2OF1 A;  4K14 A;  4MIU A;  2EXZ A;  4N9T A;  4S3S A;  4ID6 A;  1STB A;  2HQE A;  4I65 A;  1STN A;  4KD4 A;  4J1M A;  3LX0 A;  5CGK A;  4HMI A;  5DAU A;  1SNC A;  1SYC A;  5IGB A;  1JOK A;  4RKL A;  5KGU A;  2PZU A;  3S9W A;  2F0H A;  2F0O A;  1ENA A;  1EY4 A;  3TP6 A;  4E6I A;  5EGT A;  2EYF A;  5JOB A;  1IHZ A;  5HGT A;  2ENB A;  3QB3 A;  4YIJ A;  2RBM A;  1KAA A;  4KY6 A;  3C1E A;  1SYB A;  4KV6 A;  3U9O A;  1STA A;  2M00 A;  5JAV A;  3BDL A;  4NMZ A;  2KQ3 A;  3NQT A;  2EYH A;  3D4W A;  2SNS A;  3HZX A;  3V2T A;  4DGZ A;  2NUC A;  4K2K A;  2O4X A;  3BDC A;  4KJO A;  4NDX A;  4G57 A;  2F0L A;  4RKB A;  5M9O A;  5EKL A;  2EYJ A;  1KDB A;  2EYP A;  4HMJ A;  4IAL A;  4K8I A;  4NP5 A;  3QOJ A;  3SHL A;  3SK6 A;  5I9O A;  1KAB A;  3OMC A;  1F2Y A;  4K6D A;  2F0I A;  4QF4 A;  2F0M A;  5CV8 A;  5DEH A;  4KD3 A;  1EYD A;  4R8N A;  3SR1 A;  4K2L A;  2PZW A;  1A3U A;  2F0Q A;  5IGD A;  4WRD A;  1SYD A;  3VA5 A;  4F8M A;  4QB4 A;  1AEX A;  2F0N A;  1A2T A;  1KDA A;  5C4H A;  5IGC A;  2WAC A;  1JOO A; 
#chains in the Genus database with same CATH topology
 1IYJ B;  2UXB L;  1Y8P B;  1I3Q H;  5IOD A;  4EGV A;  3HOW B;  5E4X A;  2DJF C;  1TKW B;  3RNU A;  1RHP A;  2RHS B;  2CKZ B;  3PUX A;  1I6H H;  5JVH 3;  3S16 H;  1BBU A;  4A3D B;  2J0T D;  4DA2 A;  1UUP A;  2K28 A;  1TWH B;  3PV0 A;  3HKS A;  2LFN A;  4DR2 L;  4QMG A;  2YU9 B;  4JCV E;  2GA4 B;  2E76 C;  4DR2 Q;  1RF2 D;  1BBW A;  4A3F B;  2MJ8 A;  4KN7 C;  2KVM A;  2Q2I A;  4RMF A;  4BBR G;  5JJI A;  4DFA A;  2MNA A;  2JA7 B;  5C6A A;  4C56 C;  1MJE A;  1DON A;  2F3W A;  3VDY A;  3TQY A;  4ZUJ A;  4C3H B;  4A3G H;  3TME A;  5CV5 A;  1YNX A;  1HNZ Q;  3VYT A;  2UXC Q;  3S1Q H;  1PZJ D;  3TRZ A;  1HZ9 A;  2IWH A;  4GOP A;  3AB9 A;  2F4I A;  3FKI H;  3NE5 B;  2F0V A;  4B08 A;  4JI0 Q;  2F4V Q;  2KBN A;  1RIP A;  2KCN A;  4MTN A;  4JI2 Q;  1VQN A;  2A19 A;  5M3F G;  3NTK A;  1IKM A;  2AQ3 B;  1MI2 A;  2LSS A;  3S1R H;  1Q7Y C;  2Q8R E;  2WAQ B;  4DV4 Q;  2F0W A;  2AQ1 B;  4DR4 Q;  5C3W A;  3D31 A;  2GVB A;  4DV1 L;  5NUC A;  2Z4I A;  1DZ1 A;  1CA5 A;  1VQL A;  4A3E B;  1SN8 A;  4DV7 Q;  4YY3 L;  4KD4 A;  2NZ1 D;  1AP0 A;  3K58 A;  1TII D;  1SNC A;  1BDO A;  4EQ5 A;  2KOL A;  1DD2 A;  4HIM A;  4E6I A;  2EJG C;  1KL9 A;  2ATW A;  3S15 B;  2HQL A;  3KDF A;  4CJ0 B;  2O4X A;  2MO1 A;  1S4Z A;  4X66 Q;  1B70 B;  4RFB A;  5I2X A;  4IAL A;  1S3O A;  1TVX A;  4DNR B;  1MKH A;  2A69 D;  1K3B C;  3HOV G;  3RZO B;  1HTL D;  1E1T A;  2JA6 G;  1BXT A;  3F8T A;  3HOX B;  4JI4 Q;  1ET6 A;  3VR6 A;  1XNQ L;  1SYD A;  1YNJ C;  5IGC A;  1GO3 E;  3JAM c;  1A2T A;  4QB4 A;  1EU4 A;  3I4N G;  3TN2 A;  2CW0 C;  3K0Y A;  2A6E C;  1HNW Q;  1XPR A;  1ESR A;  1BBX C;  1PTO D;  1XTC D;  3HKZ E;  2NTT A;  3FKI B;  2QA4 A;  1G6P A;  1VQM A;  5DM6 3;  3EJI A;  4LF7 L;  3F1Z A;  1IW7 D;  3QIA A;  2ZM6 L;  3RZO H;  4IFD J;  1Q81 C;  3C2P A;  3J81 L;  4LFC L;  1QVF A;  4H13 C;  5J22 A;  1G2S A;  3SK4 A;  4XTC S;  4GOP B;  1BNZ A;  3GTL B;  5CBE E;  1ENC A;  3MVV A;  1GUO A;  3STB C;  2CCZ A;  2B2T A;  3OHX C;  3L0O A;  4FYD A;  2MUY A;  1OTC A;  4IFD G;  2K4K A;  3IL8 A;  4QUF A;  2IPK D;  4DV5 L;  1PH4 A;  5I6W A;  2F0E A;  1JWU D;  1IL2 A;  1LLR D;  4IN3 A;  2SEB D;  4LW1 A;  5CV9 A;  3ND8 A;  4K0K Q;  1LTB D;  4GKK Q;  1O7Z A;  1XJV A;  5EKI A;  1YHA A;  2ZTE A;  2NWG A;  3HGB A;  4OL7 A;  5KIX A;  2RCF A;  2F0P A;  1PH1 A;  4XQN A;  1JB7 A;  3BZK A;  1IBK L;  2UXB Q;  1EY6 A;  3NQI A;  1IBL Q;  2MHV A;  3CCM A;  5EKK A;  2NVY B;  1KRS A;  4KJN A;  3A7A B;  4R4I A;  2XRQ D;  2OF1 A;  4K14 A;  2XWJ B;  1Z7T A;  2HQE A;  4I65 A;  1STN A;  2AWN A;  3K81 C;  1ZXT A;  5M5X H;  1VQ8 A;  1Q12 A;  2JA6 H;  1HJP A;  2XIW A;  1IHZ A;  1PRT C;  1B1Z A;  3C1E A;  1V43 A;  1X3P A;  3OWE B;  5T1I A;  4K2K A;  1SRU A;  4JI7 Q;  3J81 c;  4LFA L;  3HOW H;  3GTP H;  1V1Q A;  2OTJ A;  2KUM A;  3SVM A;  4DKA C;  2RQX A;  1CKN A;  1HFN A;  1O78 A;  1K8M A;  1AZP A;  1EIF A;  1CTM A;  3U9S A;  1EQV A;  2KEE A;  1I94 L;  1EQR A;  1EY5 A;  2PCF B;  2K5V A;  3N6R A;  3JAM L;  5CC4 A;  4A3E G;  4UY8 C;  2F0F A;  3PO3 H;  4A3K H;  1I94 Q;  4ALP A;  1W3S A;  2CQA A;  2DN8 A;  2CVR A;  4GOP C;  5K36 G;  1TS5 A;  4IPC A;  1E3P A;  1E24 A;  2YTV A;  3BZD B;  1XTD A;  4TKO B;  1EZ6 A;  3D0F A;  2Y0S B;  1KAW A;  1G2T A;  1OXU A;  4DV1 Q;  3S1Q B;  1LTL A;  4GKJ L;  1I4P A;  4BXX G;  1QG7 A;  1VQE A;  4YY3 Q;  4KKU A;  2DGY A;  3MXP A;  5M5X B;  3NHH A;  4IUT A;  3T16 A;  4DR7 Q;  3EA6 A;  2N78 A;  1XX8 A;  1EQQ A;  1YHQ A;  4XIG S;  1EYA A;  1WCM B;  1OXS C;  1C4Q A;  1YNN C;  4UP9 A;  1SFO H;  1C7Y A;  3HOX H;  2A74 C;  1IYV A;  2E2H B;  1SYF A;  2JJQ A;  4A3J B;  5C0X G;  2EE1 A;  5FLX L;  3T1Y Q;  1KDC A;  4GLA C;  2F0S A;  3HP3 A;  5J1Z A;  1PH3 A;  4G7Z C;  1NMF A;  2XRS D;  1Q1B A;  2K5Q A;  4B3M Q;  3L7Z C;  1CSQ A;  1Z9F A;  3KF8 B;  3I4N B;  2ZJR A;  2KHJ A;  3P1H A;  2PW7 A;  2R6G A;  2ZXP A;  3DWP A;  4MN3 A;  4WFN 3;  3BZC A;  4Y7N B;  1DOL A;  4QY7 A;  2F4V L;  3AYH B;  3RD4 A;  4OWW B;  2VL6 A;  3M9B A;  5EGT A;  4V19 0;  1AE2 A;  4PQX A;  1X65 A;  4YIJ A;  5EAY A;  3BYT B;  2N8N A;  1EEF D;  4ME3 A;  4P2C B;  1M90 C;  2E5L Q;  2O2L D;  1JJG A;  5D65 A;  1DYQ A;  1D1K A;  1F9R A;  2E5L L;  1A6X A;  4JI5 Q;  3KJP A;  1PH8 A;  4HMJ A;  1EQT A;  5FLM H;  1HNX Q;  1PH6 A;  2R92 G;  1X3Q A;  1F2Y A;  2NN6 H;  3CCV A;  1WJJ A;  5C4J H;  3RN5 A;  1VQI A;  4KHP L;  1Q3L A;  5KNB A;  4HJ7 A;  1I6V C;  2QCP X;  2JEB I;  1QB5 D;  2XNA C;  1UAP A;  5E1F A;  4FF1 A;  4IQZ A;  2A6H C;  1BOS A;  3RZD H;  1MD2 D;  3E6Z X;  1CT1 D;  4XXE A;  4DPG A;  1EUJ A;  2XTI A;  3S1N B;  2EYM A;  3CP0 A;  5G3L F;  1FJG L;  4A3L H;  1HQM C;  3GV3 A;  5FO9 B;  2F3V A;  4X65 L;  2PQA B;  2R3Z A;  1I4G A;  1YNN D;  2K04 A;  3KUP A;  3AFP A;  3ERQ A;  2ZJP A;  1D5M C;  1ICF B;  1TXY A;  5M3M B;  2WB1 E;  3MXN B;  1F2Z A;  3J7Z C;  2J4X A;  2F0G A;  3M7G A;  2ZM6 Q;  1PH5 A;  4MTK A;  4QUC A;  2WB1 B;  3CCL A;  3GTQ B;  4AQY Q;  2CWA A;  4GZY C;  4A3M G;  1SMY D;  3F2C A;  4JI7 L;  4DR6 L;  1EYC A;  2VY3 A;  4FXD A;  4K5W A;  4NXN L;  2B2V A;  2N88 A;  1QOH A;  5J39 A;  1WTO A;  4DR6 Q;  1U4R A;  4G7O C;  1PFM A;  3J7A V;  4HJ8 A;  5EPJ A;  1MSH A;  4OHJ A;  3DLL A;  2E8G A;  1B7Y B;  4A3B B;  1I6H B;  3OMG A;  2GN5 A;  4K8J A;  3RLO A;  2D0P A;  5JPN C;  2CQO A;  1H9S B;  2PI2 A;  5IT9 L;  5JVG 3;  2L9H A;  5EJW A;  3TP8 A;  1LTT D;  1O7I A;  5CV7 A;  5ISR A;  3UDG A;  3RZD B;  4FF3 A;  1SRO A;  3J80 E;  4JBK A;  3D3R A;  4ID6 A;  5C44 B;  3GTJ B;  2XSC A;  3HOZ H;  1VF5 C;  1E2W A;  1X6O A;  2D2C C;  2OQK A;  3OW2 A;  4DR7 L;  4YCW A;  2BA0 A;  5JOB A;  4L5R C;  3G48 A;  5E7N A;  2NYZ D;  5LMU Q;  3DUZ A;  3IFT A;  1QVG A;  4LF9 Q;  2E2J H;  2R93 H;  3GTL H;  2HCI A;  3H3V I;  3D4W A;  3F2D A;  2NUC A;  5TSS A;  5ELN A;  4RKB A;  3NBH B;  2Q8T A;  3UI2 A;  1HCZ A;  1QWY A;  3K7U C;  1EIG A;  1X32 A;  2DJG C;  1SSO A;  3NBH A;  2F0N A;  3IFD A;  2NZH A;  3CD6 A;  1R9T H;  3I70 A;  4BY7 H;  1CFM A;  2B2T C;  3IKJ A;  4U67 3;  1LAC A;  2XVS A;  3A7L A;  3I73 A;  1E22 A;  4OWX B;  4ZAI A;  1B2T A;  1YI2 A;  2I0Q A;  3S2H B;  5KRU A;  5E3F A;  3BS1 A;  3HOU H;  3MXU A;  2LKV A;  4DV6 L;  3N52 A;  1FR3 A;  2BOS A;  3D8G A;  4BY7 B;  4IUP A;  1N9W A;  3H0G B;  1H9S A;  1I3Q B;  1TWF H;  2QIL A;  2L55 A;  1K73 C;  2B63 G;  4JI6 L;  3VR4 A;  3GTO H;  1D2B A;  2R92 B;  4DV4 L;  4B9X A;  4GN4 B;  4DK1 A;  1H95 A;  2QGQ A;  5KND A;  5C4J B;  3U58 A;  1A0I A;  3HOU B;  4AYB G;  3OWF A;  3PIO 3;  1JMC A;  1SJH D;  1B3A A;  1HR0 Q;  2B29 A;  2KJX A;  4JI1 L;  1D5X C;  2B8G A;  3S24 A;  2TSS A;  3BVZ A;  4A3E H;  1G91 A;  1D5Z C;  1N32 L;  1LV9 A;  4GNX C;  5H1S E;  3PF4 A;  1XMQ Q;  1EL0 A;  2NB0 A;  2K33 A;  1S5D D;  1K3R A;  1CKO A;  4A3C H;  1L2F A;  4AIM A;  1YNJ D;  3KF6 A;  1Q8I A;  3TS0 A;  4C3J H;  1Z6H A;  5IYD G;  1I50 H;  3PIP 3;  2DNE A;  2OTL A;  4RKL A;  5E4W C;  1PYS B;  5IYB G;  4ILW A;  3M7N A;  1L1O A;  3KF8 A;  5HGT A;  1EIH A;  2E2I B;  4DK3 C;  3K7A B;  3T4A C;  1F9S A;  3SDZ A;  2M00 A;  3HOY H;  3W5O A;  2KQ3 A;  4DAV A;  4A3M B;  3GTQ H;  5IWA Q;  4QJF A;  4A3F H;  4L5Q A;  1WD0 A;  2EYP A;  4X3T A;  3NTI A;  2R92 H;  3QOJ A;  1P16 A;  2ZTC A;  3M3Y B;  4YCU A;  4FP5 D;  3AQQ A;  4R8I A;  3PIP A;  3GDE A;  4C3H G;  4WRD A;  1C0A A;  1F9P A;  4JW0 A;  1CHQ D;  2AHO B;  5C4H A;  3NTH A;  3OYY A;  4C3I H;  4LF8 Q;  1Q86 C;  1JOR A;  2F0K A;  3A8K E;  2AWO A;  1TWA B;  3PSI A;  4UP7 A;  5M3F B;  2K7V A;  3PIO A;  2F3I A;  2DY8 A;  2WAQ G;  3I2Z A;  3E9I A;  1GJX A;  4DUZ Q;  2A8V A;  4HSP A;  2MPM A;  4L6T B;  3PUV A;  2V1C C;  1IBM Q;  2QW7 A;  2HHH L;  4RGT A;  1WTR A;  1ML0 D;  1FVI A;  1TWA H;  4CKB A;  3GTG H;  4L5T A;  4X66 L;  1UE1 A;  4QIW B;  1LTA D;  1WFQ A;  1KIX A;  5T1G A;  3GQB A;  3S14 B;  5BR8 Q;  1HZB A;  1X56 A;  3T56 B;  3ULJ A;  1VQB A;  3W3A A;  1OO9 B;  3TDQ A;  4HR7 B;  3KLR A;  3SEB A;  5KYI A;  1X3E A;  1K8O A;  4KHV A;  1K0S A;  5DM7 3;  1XNQ Q;  3HOZ B;  3NEM A;  2L12 A;  5LL6 S;  3T51 B;  3M4P A;  2Z8L A;  3HEJ A;  1VQA A;  3PGZ A;  1D7Q A;  1SMY C;  5C4X H;  1STH A;  2R7Z H;  5GQO A;  4PMW A;  2L11 A;  3CRL C;  2EJF C;  2G9D A;  3R3O A;  3OW7 A;  4A3D H;  1V1O A;  4ZKC B;  3Q23 A;  1QIL A;  2ICI A;  3S2D B;  4LWC A;  2B63 B;  4JI3 Q;  3A55 A;  1IKL A;  1GOZ A;  3T53 B;  4OEM B;  3S1N H;  3CQZ B;  1EEI D;  2Q2T A;  1QZH A;  2R7Z G;  3DM3 A;  5BN4 A;  3QB3 A;  3HOU G;  1R4P B;  2Q2H A;  4G4K A;  1KLG D;  3U9O A;  1STA A;  1X55 A;  1GUW A;  3NQT A;  1X54 A;  1TU2 B;  2WAQ E;  1ET9 A;  2L15 A;  2NVY H;  1LT3 D;  1G51 A;  2AKW B;  2BH8 A;  1ASZ A;  3PQI A;  4K8I A;  2R61 A;  3SK6 A;  1RL2 A;  2NN6 G;  4A93 H;  4RA8 A;  2BDN A;  3I4M G;  5FLX c;  2PO4 A;  1EYD A;  2PZW A;  4BWG B;  5FO8 B;  2JK8 A;  3GP7 A;  1KXL A;  1KDA A;  1GHK A;  1TWH H;  2JEA I;  5J3B A;  1WTP A;  1XWE A;  1TT2 A;  2RDF A;  5JJL A;  4IOA A;  1TWF B;  4RAU C;  1N32 Q;  4G7H C;  3GTP B;  4R9W A;  5EQ0 A;  2E2D C;  2VS1 A;  2VXW A;  2NVQ H;  5FLM G;  1IBL L;  2UUB Q;  1YJ9 A;  1P8L A;  4Y52 H;  3SXH A;  3G6E A;  1Y1V G;  4IUV A;  2NBF A;  1U4P A;  3AU7 A;  5HUR A;  1ROD A;  1SNQ A;  4RGM A;  3EFX D;  2QKI C;  3M4Q A;  3UDI A;  3G4S A;  1F2M A;  4DV3 L;  3J7Y W;  3FDT A;  3QOL A;  1Q82 C;  5CR3 A;  2A5H A;  2KCM A;  3E0J A;  2IL8 A;  3OSO A;  3M3Y H;  2XN9 C;  3BYY B;  4JBJ A;  1K8A C;  1FD7 D;  5AJ3 Q;  2QEX A;  3K5N A;  2NVX B;  1TY0 A;  2EQS A;  4QL5 A;  1DCZ A;  1LAB A;  2OQ0 A;  1VQ9 A;  3M85 A;  5C5L A;  4KN4 C;  2I5H A;  1STG A;  4KY7 A;  1LTI D;  3P75 A;  3FRP B;  1BR9 A;  1GD7 A;  4IFD H;  1NAP A;  4R4C A;  1LYL A;  3KJO A;  2A73 B;  4JBW A;  2O5J C;  1MHW C;  3K8A A;  4X6A H;  1EU3 A;  3MHB A;  3J81 j;  2E2I H;  1DGS A;  2KA7 A;  1R9T B;  2Z6B A;  2FIN B;  4A3M H;  3IRB A;  1IW7 C;  3DXJ C;  4KY5 A;  1U4L A;  4S3S A;  3Q24 A;  4IJL A;  5DNF A;  5IGB A;  4J1M A;  3H3V C;  1HUN A;  1S40 A;  4CBV A;  1T5X D;  1SYB A;  2QDL A;  4JV5 Q;  3V2T A;  1JJC B;  2EYH A;  3E9H A;  2HHH Q;  2M2L A;  4NDX A;  3HKZ B;  4YWM A;  1SAP A;  1RDP D;  1NMG A;  4XT1 B;  2O5I C;  1MBY A;  2NZO A;  1QCB D;  4FXG C;  1XXG A;  2F0M A;  4A93 G;  4ZCK A;  5CMD A;  4R8N A;  1B50 A;  2K05 A;  2WKC A;  4N8X 1;  1CHP D;  5BN3 A;  3ZJY C;  4F8M A;  1Y1W H;  2RA4 A;  2JA5 H;  5I4D A;  1Q46 A;  2B8F A;  1TR5 A;  2HDM A;  2C9O A;  1TS3 A;  1K83 B;  3KFU A;  2PNH A;  1FL0 A;  2Z0S A;  1W6J A;  3SK8 A;  3MXN A;  1FNU A;  3JAM E;  4X62 Q;  4DV6 Q;  1BKB A;  4BBS H;  3R2T A;  1ZEQ X;  1PRT D;  3H3V H;  1I4R A;  2CFM A;  5KYL A;  1YIJ A;  3BG3 A;  5EBC A;  4A75 A;  4CHT B;  1VQD A;  1V8Q A;  1HQR D;  1HH2 P;  4LK1 C;  4JI5 L;  2JQO A;  1U5K A;  1E2V A;  1DOM A;  1TQO A;  4DUY Q;  2KEC A;  4DXF A;  5I6Y A;  1BF4 A;  5M5Y B;  1UEB A;  1UE6 A;  1D8L A;  4POG A;  1JQY D;  2KCT A;  5C3X A;  4JVZ A;  1LT4 D;  2B63 H;  4DXG A;  4F7X A;  3I4M B;  4KHP Q;  3D6W A;  2MO0 A;  5C5M A;  1PV4 A;  1HZA A;  5IY0 A;  1Y1W B;  1PXU A;  1EY9 A;  3H6M A;  2MQH A;  4DR3 Q;  5M5W H;  2SNM A;  3KF6 B;  1K9M C;  2I5M X;  3AFQ A;  1FNW A;  1KRT A;  3CPF A;  2R93 G;  2CH4 A;  5C3E G;  1KLU D;  2F52 A;  1L0Y B;  3CXC A;  1JC7 A;  4ME5 A;  2RKS A;  2ZXO A;  4N9T A;  2AUK A;  4IOC A;  4X65 Q;  2B2Y C;  4OO1 G;  4WJW A;  5IYC G;  1NBW A;  1XMO Q;  4DV3 Q;  3ERS X;  1PVO A;  1PTO B;  1BO0 A;  1SFO B;  3R93 A;  1J5E L;  3MA2 B;  2HIV A;  3HZX A;  4H02 A;  2K5D A;  1N33 L;  4IUU A;  3A74 A;  2EYJ A;  3GTM H;  3QO2 A;  2VQE L;  4C3J G;  2IT1 A;  4KMU C;  1OXT A;  1ZKO A;  3SR1 A;  1U4M A;  3VA5 A;  2A6E D;  1AEX A;  4DV0 L;  2WB1 G;  3KK7 A;  2K5N A;  2K32 A;  1JOO A;  2IHE A;  4OIK A;  5F2D A;  5CV4 A;  4N8F A;  1YIT A;  4PG3 A;  4LF5 Q;  5ELC A;  3D6C A;  5BN5 A;  2UUA L;  4BY1 G;  3K5O A;  1A8V A;  3L3O C;  4I7A A;  3GTO B;  2GVA A;  1MJC A;  1RTO A;  4GS3 A;  4QIW E;  2AMC B;  5GAG C;  1EYG A;  1N36 L;  3QG1 A;  1KD1 C;  3KOJ A;  4PV1 C;  2OCE A;  5A2Q L;  1HTP A;  4HIO A;  1K0R A;  4LF6 L;  4GLV B;  3CCE A;  3V96 A;  2J7Z A;  4EQO A;  1HUM A;  3VR5 A;  4MZ9 A;  4Q5V A;  5LMU L;  1N36 Q;  1F9Q A;  3NEL A;  3DEO A;  3PUZ A;  2LS0 1;  3SE0 A;  3PO2 G;  1WYD A;  3S16 B;  4FO2 A;  3L9A X;  3M4Y A;  3GO5 A;  3I3C A;  5FO7 B;  3E3X A;  3T13 A;  2PQE A;  2YU9 H;  1SE2 A;  3CME A;  1SR3 A;  4K5V A;  1IBK Q;  3M4O B;  4H7B A;  1RCV D;  1FGB D;  3J80 c;  2VZA A;  2Z4H A;  4IO9 A;  3Q22 A;  1UNS A;  3X3N A;  4U68 A;  1L1O C;  4TQU S;  2KEN A;  2M9V A;  4R4Q A;  4A3D G;  2YYZ A;  1NTG A;  4HJ5 A;  5A35 A;  2EY2 A;  3CAM A;  3A0J A;  2TMP A;  1LT5 D;  3E0E A;  1QE6 A;  2VB3 X;  1PYB A;  2ZJQ A;  4LMQ D;  4ZUI A;  3MWY W;  3PCO B;  1FGU A;  4HED A;  5IT9 c;  4H0L C;  5I2Y A;  1JIC A;  3I56 A;  1SXT A;  2OT2 A;  1ILQ A;  2Z9H A;  1PFB A;  1GXD C;  5FJ8 G;  5JAV A;  4BY7 G;  5LHY 1;  1H9J A;  3H0G G;  2VB2 X;  2N3S A;  2RSN A;  5FOB B;  3I91 A;  4DAY B;  1QZG A;  3C3L A;  1SE4 A;  3U4V A;  2B2U C;  4NP5 A;  4XQJ A;  1PTO F;  3SHL A;  2JA7 H;  5IYD H;  1NR4 A;  4K6D A;  1VQ7 A;  2K50 A;  4IUR A;  1BCP D;  3LGJ A;  2K5H A;  3A5U A;  2FJ2 A;  3VYU A;  5IGD A;  5KEE A;  1Y1W G;  1N34 Q;  3OOC A;  3IAY A;  2EVB A;  2BH2 A;  4IUQ A;  1BVS A;  3CRK C;  2ASB A;  1M4V A;  1TS2 A;  5IOC A;  4GLX A;  4JI8 L;  3FPU B;  5COR A;  1PFN A;  4C1N I;  3MTS A;  1SE3 A;  1AW7 A;  4K0K L;  4A4I A;  3ER0 A;  1TWC B;  2BE5 C;  1XPU A;  1QVC A;  1XMO L;  3WOF A;  1B9M A;  1M8A A;  3KLS X;  4BBS G;  3KLS A;  2F03 A;  1VQC A;  4LF4 Q;  4B3T Q;  2UUB L;  3ND9 A;  4RWS C;  4EQN A;  2F0T A;  3OPO A;  2PZT A;  3SGI A;  5K36 H;  2Z6K C;  3HOV B;  1TWC H;  2B2W C;  1DJR D;  3HOX G;  4L5S A;  1NCV A;  4QGU A;  4EVO A;  3W2D A;  2KCC A;  4YHH Q;  2EDG A;  1B44 D;  4I7Z C;  3RLF A;  4UAI A;  1O80 A;  4LUV A;  3ULP A;  2NVT B;  4BY1 B;  1PRT F;  4AQY L;  3EN2 A;  5JEA J;  4QQB X;  1AN8 A;  2H1E A;  2NVQ B;  1EWC A;  1SE8 A;  2K75 A;  4CDC C;  1HRJ A;  3NP8 A;  5C0X J;  3F2U A;  3QR8 A;  3S2H H;  3U50 C;  2A68 C;  4B3S Q;  4PZ6 A;  1JOQ A;  5FJ8 H;  1VQF A;  3K0X A;  4CJ2 C;  5ELE A;  3B6Y A;  3RLN A;  4ZKB B;  3I72 A;  3HG9 A;  3NPP A;  1LTS D;  4HN7 A;  3CW2 C;  4PNY A;  4DN4 M;  1VMC A;  2EXZ A;  4OX9 Q;  1PFS A;  3KLW A;  4A3I H;  4CDF C;  1C9O A;  4MNO A;  3WWV A;  4YWL A;  1NE3 A;  3F2B A;  1VF7 A;  2JA9 A;  1KAA A;  1A62 A;  2L5T A;  4IPD A;  2E2H H;  3TRE A;  2Q8I B;  1WOC A;  4WJ4 A;  3VR3 A;  1UWV A;  4G57 A;  1VDZ A;  2JE6 I;  3EIV A;  3S1M B;  1O7L A;  2F0I A;  1VCI A;  2EIF A;  1PYW D;  1I4Q A;  1QNU A;  2F0Q A;  3H09 A;  3JAM i;  4B3T L;  3CPW A;  3K57 A;  4RHR A;  3J7A F;  1LO5 D;  4PMB A;  1SYE A;  1HXY D;  1NSN S;  2CWP A;  4PZ8 A;  4IZ8 A;  2C5C A;  3HOZ G;  3J80 i;  2HIX A;  3JC6 6;  5IYB H;  2F1M A;  2YTY A;  1XPO A;  4TRD A;  4IPG A;  1GUN A;  1W2B A;  4EX5 A;  1HNW L;  2EY6 A;  2JA5 G;  3K59 A;  4EQP A;  4CGY B;  3K5M A;  3G71 A;  1HFG A;  1PH7 A;  1H9R A;  3S2D H;  1ZYR D;  3PMF A;  3TSS A;  2MP1 A;  3NUC A;  3EVQ A;  1CK1 A;  3VR2 A;  4RH6 A;  1PZK D;  4NKL A;  4DR4 L;  4JI0 L;  1I4H A;  5JEA H;  2K52 A;  1S5B D;  5D14 A;  4XQQ A;  1T5E A;  1WVL A;  3E5S A;  4C3I B;  1WTV A;  2LY7 A;  1ASY A;  3FEW X;  3S1M H;  3EBE A;  1Q90 A;  1VQO A;  1CI3 M;  2LMC B;  4KTA A;  5GAE C;  3I7F A;  2EXD A;  1CZW A;  4BBS B;  1VQG A;  1A63 A;  1U0L A;  1S5F D;  1YJN A;  2ZT9 C;  2X6L A;  4NB3 A;  5JJZ A;  1M1K C;  1VQ5 A;  1RD9 D;  3LX0 A;  4X3K A;  3S9W A;  1JOK A;  5AFW A;  5G3L D;  4XYQ A;  1EY4 A;  1Y1V B;  1WCM G;  2EYF A;  3HRZ C;  3CC2 A;  3MFG A;  1EFW A;  2JSO A;  3R2I A;  3V05 A;  5ELO A;  1PDQ A;  4FVM A;  1QNK A;  4JG2 A;  2P5Z X;  3TS2 A;  5IP9 H;  2UUC Q;  3GD7 A;  1MGS A;  4NPS A;  1I50 B;  2VUM G;  4CJ1 B;  5M3M G;  5AJ3 L;  4BY1 H;  4LFB Q;  4QF4 A;  5M3F H;  1EOT A;  5JPM C;  2AUJ D;  2PMZ B;  3MC0 B;  1G29 1;  3NWT A;  2UU9 L;  4OON A;  3UDX A;  4DAM A;  2Y0S E;  3M4O H;  3ZYY X;  5M5W B;  3FMC A;  1L0W A;  1XNR L;  3A8J E;  1LUZ A;  5EPL A;  1YVC A;  3DWQ A;  2HT1 A;  3GTG B;  3C1F A;  4WJ3 M;  2EYO A;  3CU7 A;  1B8A A;  1SYG A;  5IGE A;  2EY5 A;  4A3B G;  1IYU A;  2IX1 A;  1H9K A;  2K14 A;  2RSO A;  3ICE A;  2EJM A;  5M5Y H;  1TY2 A;  4OX9 L;  4ZLT F;  3L2P A;  2B2Y A;  4O0A A;  5ELD A;  1KNE A;  1AZQ A;  2OXP A;  1KNA A;  4P74 A;  4OIJ A;  4B9W A;  3CCU A;  4HAE A;  1SNO A;  1JWM D;  3K7A H;  4A3B H;  3DWA A;  1X3G A;  3TZU A;  4B3R L;  5IP7 G;  3AEV A;  3KDF B;  1N8R C;  4RHS A;  3HOY G;  4DV7 L;  1E1O A;  1CZG A;  3RUZ A;  5D3I B;  1BCP C;  1DOK A;  1E2Z A;  4DR1 L;  5IIF A;  4JC0 A;  1B9N A;  4RGO S;  1L0X B;  5DLQ E;  1O7Y A;  2N49 A;  2F0J A;  3CQZ H;  1J5E Q;  3MFY A;  1JCK B;  5GAH C;  1EY8 A;  3DHQ A;  4DK0 A;  4YWK A;  3T1Y L;  2RDH A;  1QUQ B;  3KBG A;  4IPH A;  3S17 H;  4J6H A;  4BS9 A;  4JPB W;  3URY A;  4PMC A;  4MIU A;  1KTK A;  3GTM B;  4A3F G;  5CGK A;  4BBR B;  1S5E D;  4HCS A;  3GV6 A;  5CBA E;  1K28 A;  2PZU A;  3TP6 A;  3X3M A;  5C0X H;  5HGQ A;  2CH4 W;  3CCQ A;  3LWE A;  4ULL A;  4DGZ A;  1KQS A;  4BXX H;  4KHZ A;  1JWS D;  4KJO A;  1S5C D;  1D1I A;  5M9O A;  1GUG A;  1KDB A;  3CCS A;  5I9O A;  1F2L A;  2I5L X;  4NXN Q;  3OMC A;  3HOV H;  5EPK A;  2HDL A;  3WOE A;  1N34 L;  1SDF A;  4XYO A;  3A8I E;  3H94 A;  4IFD I;  2EOT A;  4UHV A;  2IX0 A;  4P73 A;  1LT6 D;  1VMP A;  2E74 C;  4KLK A;  5LMN W;  3H0G H;  4K6L A;  3TBI B;  2NN6 I;  2WV6 D;  1A3T A;  4L63 B;  2F0D A;  4DUZ L;  4N9P A;  4APV A;  1JE4 A;  2RHQ B;  4Y7N H;  1WTQ A;  3EQL C;  5LL6 X;  1AFP A;  1WD1 A;  4AH6 A;  5IGG A;  4BA2 I;  1IXR A;  3MEH A;  4DR3 L;  1LM0 A;  3I90 A;  4OGQ C;  1F77 A;  4WOR A;  1BUV T;  2SDF A;  2X69 A;  1SJE D;  2RF4 A;  3DMU A;  1GUT A;  3DM1 A;  5IP7 H;  1I5F A;  4RGN A;  2UXD Q;  2MFI A;  1DXM A;  4JI8 Q;  1WTH A;  3P20 A;  4FDB A;  3GTK H;  5C3E B;  2DNC A;  1K8G A;  1OXV A;  1RKN A;  4PZ7 A;  5COY A;  2VUM B;  4ZQ3 A;  4LAA A;  5FKA C;  3QJY A;  2C35 B;  4MHE A;  2UUC L;  2NTS A;  2FFK B;  3S1R B;  2ALY B;  2IW3 A;  4B3M L;  3FP9 A;  2L4N A;  1B3Q A;  5C4Z A;  4DV2 Q;  3GTK B;  4RG1 A;  2VNU D;  4L8J A;  1VQH A;  1C48 A;  4LJZ C;  4NXM Q;  1V9P A;  4K5X A;  1YEZ A;  2K1B A;  4C3J B;  4DV2 L;  1WTX A;  2V4D A;  4C2M B;  1DM0 B;  1E7Z A;  1CA6 A;  1V1P B;  2LXK A;  1A3V A;  1Y1V H;  3ITP A;  5GAD C;  1EY7 A;  1ICW A;  2K5W A;  2B2W A;  1HZC A;  1CQV A;  4B3S L;  1EWH A;  4LF8 L;  1CKN B;  4JI6 Q;  2IJ0 A;  3G7L A;  4RCO A;  3BJU A;  4A3K B;  4JK1 C;  4DR5 L;  2YV5 A;  2A6H D;  3OIP A;  1J8I A;  5LMN L;  3J81 i;  4GKK L;  2WII B;  4X3U A;  2PPB C;  2CHB D;  4JI2 L;  4H44 C;  1PMR A;  4KY6 A;  4CDD C;  3I4N H;  4KV6 A;  3R8B A;  2VUM H;  1GHJ A;  1SMX A;  1KAB A;  2KHI A;  2QF7 A;  3FPP A;  1SBB B;  3TEH B;  1FJG Q;  2RVL A;  4CDE C;  4KD3 A;  3RMH A;  3K5L A;  2PMZ E;  1UE7 A;  5JEA G;  1A3U A;  4KKT A;  2N55 A;  2PNR C;  3CC7 A;  4BA1 I;  3HOY B;  5IGF A;  1IL8 A;  5BR8 L;  3MEF A;  3J81 E;  3BU2 A;  2Z1C A;  1N33 Q;  4F87 A;  4JOI A;  4IJH A;  5JJK A;  4UDU C;  3OIQ A;  4DNI A;  1L1O B;  2SOB A;  1EOV A;  4A3L G;  1ONL A;  4KK7 A;  2B39 A;  1II3 A;  3H91 A;  5IWA L;  2K03 A;  2YTX A;  4UPA A;  5HY6 A;  4NXM L;  1K83 H;  1RTN A;  4C1N K;  2AQ2 B;  4IUN A;  4Z9C B;  3WDN A;  3TP5 A;  1Y69 U;  2JA8 B;  3P7J A;  1ESF A;  1CQF A;  2D9U A;  4LFA Q;  1HA6 A;  5A2Q E;  4ZK9 B;  4LF7 Q;  2OEO A;  2JYO A;  1STE A;  2X6G A;  1SEB D;  3HFZ B;  4O2D A;  4ODG A;  4AYB E;  3Q8D A;  2VQF Q;  1HNZ L;  3AMU A;  1TS4 A;  1W6K A;  2IX3 A;  4TSS A;  1BCP F;  1STY A;  1HHV A;  2L0C A;  3U4Z A;  5C44 H;  3GTJ H;  4KI0 A;  3PO3 B;  2FXQ A;  4POF A;  2FMC A;  3DEP A;  4A3G G;  2BA1 A;  1PZI D;  1SNM A;  1SNP A;  2Y0S G;  4JI1 Q;  1SLJ A;  1Z47 A;  1Q1E A;  1YBY A;  2OWO A;  3LWU A;  2R7F A;  3KYH C;  4DF7 A;  5C3E H;  1IBM L;  2ID0 A;  5DAU A;  1CSP A;  1A15 A;  3OTO Q;  1Y8N B;  2F0H A;  1TWG B;  1ENA A;  5IT9 E;  3PO2 H;  1G6Z A;  3CKI B;  4M1U B;  1J9O A;  1YJW A;  4XT3 B;  4A3J G;  1NR2 A;  1GM5 A;  3W1B A;  2SNS A;  3NWS A;  3Q6S A;  5IE8 A;  3OTO L;  1PH9 A;  4DAP A;  5EKL A;  1PLF A;  1Y8O B;  3LNN A;  4A3I B;  2RCN A;  3A5Z B;  1PHJ A;  2UU9 Q;  2I46 A;  4GNX A;  1RJT A;  3D4R A;  4JOI C;  1VQK A;  4LF4 L;  4QCL A;  4LFB L;  2R7D A;  1CUK A;  1JT8 A;  4P71 A;  2D0O A;  1YHB A;  1CM9 A;  4CKE A;  1GVP A;  4DV0 Q;  4FF2 A;  4HSV A;  3BVG A;  1CKM A;  4YCV A;  5KNC A;  5CYU A;  1PA6 A;  2UUA Q;  1HPC A;  1EY0 A;  5I9P A;  5FK9 C;  4LF5 L;  3ERO A;  1EZ8 A;  4DR5 Q;  3D4D A;  2R7Z B;  2G5D A;  2UXC L;  3PF5 A;  1I4X A;  3I4O A;  1YZ6 A;  2I07 B;  2K01 A;  4GN3 B;  2A68 D;  4A3C G;  2RDG A;  4X3S A;  4R4O A;  1MIU A;  5ELB A;  3MZ5 A;  1AH9 A;  4A3K G;  4BBR H;  4HIK A;  4LUZ A;  4DUY L;  4LF6 Q;  4FF4 A;  4C2M H;  2KHS A;  2PI2 E;  1ENF A;  1AE3 A;  2D62 A;  1GUS A;  3H15 A;  5C4X G;  2F0U A;  1QJO A;  5ELF A;  2EYL A;  2JN4 A;  1Q8K A;  3NXW A;  1WI5 A;  2L1B A;  3MXG A;  2ZXR A;  5D3D A;  2K6A A;  2EY1 A;  5CV6 A;  2JXM B;  4JV5 L;  5EBD A;  4NW2 A;  1HR0 W;  1SND A;  1KHI A;  3VYR A;  4GN5 A;  1WCM H;  1NJI C;  2QDB A;  1EWI A;  5C0X I;  4JBM A;  4DR1 Q;  3J80 L;  4ZYS A;  2B2U A;  3CCJ A;  2NVX H;  1BCP B;  1U9R A;  4J15 A;  1T9H A;  3S15 H;  4A3J H;  1S72 A;  2HCC A;  1J6Q A;  2BE5 D;  1MSG A;  2FMM A;  4UP8 A;  2PQA A;  1NUC A;  1HA5 A;  3HOW G;  4P72 A;  2IY5 B;  1STB A;  2JA8 G;  3K80 C;  2WIN B;  2VW9 A;  2QEJ C;  1PTO C;  2F0O A;  2Z6K A;  5M3M H;  3FHW A;  2DUD A;  1ZYR C;  2ENB A;  4M8A A;  1GKH A;  4DK6 C;  3VA7 A;  4HJA A;  4R4T A;  2JA5 B;  3HS0 C;  1QUQ A;  1VQ4 A;  3BDL A;  4NMZ A;  3CMA A;  4TVA B;  4GNX B;  2A69 C;  3G6J B;  2ICE C;  2NVT H;  2JA7 G;  3NSW A;  5L37 A;  2XWB B;  4OEL B;  4HCE A;  5CV8 A;  5DEH A;  4ZRZ A;  2ZTD A;  4C3H H;  4LFC Q;  3I4M H;  3O13 A;  3NBI A;  4A3G B;  1VQ6 A;  3NEN A;  4V0B A;  1V1P A;  1JE5 A;  4X64 L;  1BQQ T;  2WFW A;  2WAC A;  4XDX A;  3BVM A;  1B53 A;  3A56 A;  4O1N A;  3UE1 A;  2HD3 A;  3TZD A;  1Y14 B;  4LF9 L;  4C3I G;  4X64 Q;  1KC8 C;  1E0B A;  3Q0A A;  4GKJ Q;  2VQF L;  4OO1 I;  2MGS A;  5IP9 G;  1D6E C;  1OXX K;  3I8Z A;  2DY7 A;  3W1G A;  3UDF A;  5C44 G;  2EPB A;  1PRT B;  1A2U A;  3PO3 G;  3PUY A;  4DV5 Q;  5K5P A;  3KBX A;  1JB3 A;  3SK5 A;  3A54 A;  2UXD L;  2JP1 A;  1VQP A;  2KED A;  1HR0 L;  1IZ6 A;  4RCN A;  1R4Q B;  2BDO A;  1PTO H;  2PW5 A;  4DU9 A;  3BDO A;  3J7A 5;  1UE5 A;  1NNX A;  2H4O A;  4CKC A;  2R93 B;  2E2J B;  1LTG D;  1LTR D;  1FNV A;  2BCO A;  2PYK A;  4ABN A;  3HKZ G;  4HTH A;  4HJ9 A;  1B4O A;  2WP8 J;  4A3I G;  4LUO A;  3UE0 A;  3CHB D;  1H9M A;  2E75 C;  4A93 B;  3ONA B;  1EIY B;  2B2V C;  2EZV A;  3TP7 A;  4X62 L;  4FXK C;  4F88 A;  3T1H Q;  3QWN A;  3S17 B;  1JR0 D;  3FKI G;  4O42 A;  2VQE Q;  1NY4 A;  2B3G A;  2XGT A;  4OWT B;  4DNT B;  2D5D A;  4YHH L;  4HID A;  3NK9 A;  3T1H L;  1XNR Q;  1TWG H;  4JI4 L;  1C8C A;  2JA6 B;  5FLX E;  5GRO A;  5IYC H;  3PUW A;  4A76 A;  4JI3 L;  2ES2 A;  1UEA B;  4OXP A;  1X9N A;  1XYI A;  3RN2 A;  2IHF A;  1JJ2 A;  4R1J A;  1X3F A;  2G9H D;  3CF5 A;  2HUG A;  4HMI A;  4Q0F A;  1SYC A;  5KGU A;  4P75 A;  1PH2 A;  3CCR A;  2WKD A;  3STB D;  1G8Z D;  4FNF A;  4JYA Q;  4DAY A;  2LXJ A;  2RBM A;  4AYB B;  5C4X B;  3RR5 A;  5LMN Q;  1ILP A;  1VQJ A;  2FHT A;  4J8Q A;  3I4L A;  4JYA L;  1WTW A;  2A1A A;  3BDC A;  3K6O A;  1VS0 A;  2F0L A;  2JA8 H;  3CC4 A;  3ULL A;  4OO1 H;  2Q2U A;  1XMQ L;  1HNX L;  3MAQ A;  1EFI D;  3VYS A;  4K2L A;  4LNQ A;  3PO2 B;  3S14 H;  4B3R Q;  1FYC A;  4KKS A;  2CW0 D;  3I55 A;  3C46 A;  3FVQ A;  2H5X A; 
#chains in the Genus database with same CATH homology
 1Y8P B;  5IOD A;  4EGV A;  3HOW B;  5E4X A;  1TKW B;  1RHP A;  3PUX A;  5JVH 3;  4A3D B;  2J0T D;  4DA2 A;  1UUP A;  2K28 A;  1TWH B;  3PV0 A;  2LFN A;  2YU9 B;  4QMG A;  2GA4 B;  2E76 C;  1RF2 D;  4A3F B;  2MJ8 A;  4KN7 C;  2KVM A;  4DFA A;  2JA7 B;  5C6A A;  4C56 C;  1DON A;  2F3W A;  4ZUJ A;  4C3H B;  3TME A;  5CV5 A;  3VYT A;  1PZJ D;  2IWH A;  3AB9 A;  2F4I A;  3NE5 B;  2F0V A;  4B08 A;  2KCN A;  3NTK A;  1IKM A;  2AQ3 B;  1MI2 A;  2Q8R E;  2WAQ B;  2F0W A;  2AQ1 B;  5C3W A;  3D31 A;  5NUC A;  2Z4I A;  1DZ1 A;  1CA5 A;  4A3E B;  4KD4 A;  2NZ1 D;  1AP0 A;  3K58 A;  1TII D;  1SNC A;  1BDO A;  2KOL A;  1DD2 A;  4E6I A;  2EJG C;  3S15 B;  4CJ0 B;  2O4X A;  1S4Z A;  4RFB A;  5I2X A;  4IAL A;  1TVX A;  4DNR B;  2A69 D;  3RZO B;  1HTL D;  1BXT A;  3HOX B;  1ET6 A;  3VR6 A;  1SYD A;  1YNJ C;  5IGC A;  1A2T A;  4QB4 A;  1EU4 A;  3TN2 A;  2CW0 C;  3K0Y A;  2A6E C;  1ESR A;  1BBX C;  1PTO D;  1XTC D;  2NTT A;  3FKI B;  5DM6 3;  3EJI A;  1IW7 D;  3QIA A;  4IFD J;  3C2P A;  3J81 L;  4H13 C;  5J22 A;  1G2S A;  3SK4 A;  4XTC S;  1BNZ A;  3GTL B;  5CBE E;  1ENC A;  3MVV A;  1GUO A;  2B2T A;  3OHX C;  4FYD A;  2MUY A;  4IFD G;  3IL8 A;  4QUF A;  2IPK D;  5I6W A;  2F0E A;  1JWU D;  1LLR D;  4IN3 A;  2SEB D;  5CV9 A;  3ND8 A;  1LTB D;  1O7Z A;  5EKI A;  2NWG A;  3HGB A;  4OL7 A;  5KIX A;  2F0P A;  4XQN A;  1EY6 A;  3NQI A;  2MHV A;  5EKK A;  2NVY B;  4KJN A;  3A7A B;  2XRQ D;  2OF1 A;  2XWJ B;  1Z7T A;  4K14 A;  2HQE A;  4I65 A;  1STN A;  2AWN A;  1ZXT A;  1Q12 A;  2XIW A;  1IHZ A;  1PRT C;  1B1Z A;  3C1E A;  1V43 A;  1X3P A;  3OWE B;  5T1I A;  4K2K A;  2KUM A;  3SVM A;  2RQX A;  1HFN A;  1O78 A;  1K8M A;  1AZP A;  1CTM A;  3U9S A;  1EQV A;  2KEE A;  1EY5 A;  2PCF B;  3N6R A;  3JAM L;  5CC4 A;  2F0F A;  2CQA A;  2DN8 A;  2CVR A;  5K36 G;  1TS5 A;  3BZD B;  4TKO B;  1EZ6 A;  2Y0S B;  1G2T A;  1OXU A;  3S1Q B;  1I4P A;  1QG7 A;  4KKU A;  3MXP A;  5M5X B;  3NHH A;  4IUT A;  3T16 A;  3EA6 A;  1XX8 A;  4XIG S;  1EYA A;  1WCM B;  1OXS C;  1C4Q A;  1YNN C;  2A74 C;  1IYV A;  2E2H B;  1SYF A;  4A3J B;  5C0X G;  2EE1 A;  5FLX L;  1KDC A;  2F0S A;  3HP3 A;  5J1Z A;  4G7Z C;  2XRS D;  1Q1B A;  2K5Q A;  3L7Z C;  3I4N B;  3P1H A;  2PW7 A;  2R6G A;  2ZXP A;  3DWP A;  4MN3 A;  4WFN 3;  4Y7N B;  1DOL A;  3RD4 A;  5EGT A;  4V19 0;  4PQX A;  4YIJ A;  3BYT B;  1EEF D;  4P2C B;  2O2L D;  5D65 A;  1DYQ A;  1D1K A;  1F9R A;  1A6X A;  4HMJ A;  1EQT A;  1X3Q A;  1F2Y A;  2NN6 H;  1Q3L A;  5KNB A;  1I6V C;  2QCP X;  2JEB I;  1QB5 D;  2XNA C;  1UAP A;  5E1F A;  4FF1 A;  4IQZ A;  2A6H C;  1BOS A;  1MD2 D;  3E6Z X;  1CT1 D;  4XXE A;  3S1N B;  2EYM A;  5G3L F;  1HQM C;  3GV3 A;  5FO9 B;  2F3V A;  2R3Z A;  1I4G A;  1YNN D;  2K04 A;  3KUP A;  3ERQ A;  1D5M C;  5M3M B;  1F2Z A;  2J4X A;  2F0G A;  3M7G A;  4QUC A;  2WB1 B;  3GTQ B;  4GZY C;  1SMY D;  1EYC A;  4FXD A;  4K5W A;  2B2V A;  2N88 A;  1QOH A;  5J39 A;  1WTO A;  1U4R A;  4G7O C;  1PFM A;  3J7A V;  5EPJ A;  1MSH A;  4OHJ A;  4A3B B;  1I6H B;  3OMG A;  4K8J A;  5JPN C;  1H9S B;  5IT9 L;  5JVG 3;  2L9H A;  5EJW A;  3TP8 A;  1LTT D;  5CV7 A;  4FF3 A;  5ISR A;  3RZD B;  3J80 E;  3D3R A;  4ID6 A;  3GTJ B;  5C44 B;  2XSC A;  1VF5 C;  1E2W A;  2D2C C;  2BA0 A;  5JOB A;  2NYZ D;  3DUZ A;  3IFT A;  2HCI A;  3D4W A;  2NUC A;  5TSS A;  4RKB A;  2Q8T A;  3UI2 A;  1HCZ A;  1QWY A;  1EIG A;  1X32 A;  1SSO A;  3NBH A;  2F0N A;  3IFD A;  3I70 A;  1CFM A;  2B2T C;  3IKJ A;  4U67 3;  1LAC A;  2XVS A;  3A7L A;  3I73 A;  4ZAI A;  1B2T A;  3S2H B;  5KRU A;  5E3F A;  3BS1 A;  3MXU A;  2LKV A;  3N52 A;  1FR3 A;  2BOS A;  3D8G A;  4BY7 B;  4IUP A;  3H0G B;  1H9S A;  1I3Q B;  2QIL A;  2L55 A;  3VR4 A;  1D2B A;  2R92 B;  4B9X A;  4DK1 A;  5KND A;  5C4J B;  3HOU B;  3OWF A;  3PIO 3;  1SJH D;  1B3A A;  2KJX A;  1D5X C;  2B8G A;  2TSS A;  3BVZ A;  1G91 A;  1D5Z C;  1LV9 A;  1EL0 A;  2NB0 A;  2K33 A;  1S5D D;  1YNJ D;  1Q8I A;  1Z6H A;  3PIP 3;  2DNE A;  4RKL A;  5E4W C;  4ILW A;  3M7N A;  3KF8 A;  5HGT A;  1EIH A;  2E2I B;  3K7A B;  3T4A C;  1F9S A;  3SDZ A;  2M00 A;  2KQ3 A;  4DAV A;  4A3M B;  1WD0 A;  2EYP A;  4X3T A;  3NTI A;  3QOJ A;  3M3Y B;  4FP5 D;  4R8I A;  4C3H G;  4WRD A;  1F9P A;  1CHQ D;  5C4H A;  3NTH A;  1JOR A;  2F0K A;  3A8K E;  2AWO A;  1TWA B;  5M3F B;  2K7V A;  2DY8 A;  1GJX A;  4HSP A;  2MPM A;  4L6T B;  3PUV A;  4RGT A;  1WTR A;  1ML0 D;  4CKB A;  4QIW B;  1LTA D;  5T1G A;  3GQB A;  3S14 B;  3T56 B;  3W3A A;  1OO9 B;  3TDQ A;  4HR7 B;  3KLR A;  3SEB A;  5KYI A;  1K8O A;  4KHV A;  5DM7 3;  3HOZ B;  2L12 A;  5LL6 S;  3T51 B;  2Z8L A;  3HEJ A;  1SMY C;  1STH A;  4PMW A;  2L11 A;  3CRL C;  2EJF C;  2G9D A;  3R3O A;  3OW7 A;  1V1O A;  4ZKC B;  3Q23 A;  1QIL A;  2ICI A;  3S2D B;  2B63 B;  3A55 A;  1IKL A;  1GOZ A;  3T53 B;  3CQZ B;  1EEI D;  5BN4 A;  3QB3 A;  1R4P B;  4G4K A;  1KLG D;  3U9O A;  1STA A;  1GUW A;  3NQT A;  1TU2 B;  1ET9 A;  1LT3 D;  4K8I A;  2R61 A;  3SK6 A;  2NN6 G;  4RA8 A;  2BDN A;  2PO4 A;  1EYD A;  2PZW A;  4BWG B;  5FO8 B;  3GP7 A;  1KDA A;  1GHK A;  2JEA I;  1WTP A;  1XWE A;  1TT2 A;  2RDF A;  1TWF B;  4RAU C;  4G7H C;  3GTP B;  4R9W A;  5EQ0 A;  2E2D C;  2VXW A;  3SXH A;  4IUV A;  2NBF A;  1U4P A;  3AU7 A;  5HUR A;  1ROD A;  1SNQ A;  4RGM A;  3EFX D;  2QKI C;  1F2M A;  3J7Y W;  3FDT A;  3QOL A;  5CR3 A;  2A5H A;  3E0J A;  2IL8 A;  3OSO A;  2XN9 C;  3BYY B;  1FD7 D;  2NVX B;  3K5N A;  1TY0 A;  1DCZ A;  1LAB A;  3M85 A;  5C5L A;  4KN4 C;  1STG A;  4KY7 A;  1LTI D;  3P75 A;  3FRP B;  1BR9 A;  4IFD H;  1NAP A;  2A73 B;  4JBW A;  2O5J C;  1EU3 A;  3MHB A;  2KA7 A;  1R9T B;  2FIN B;  1IW7 C;  3DXJ C;  4KY5 A;  1U4L A;  4S3S A;  3Q24 A;  5DNF A;  5IGB A;  4J1M A;  3H3V C;  1HUN A;  4CBV A;  1T5X D;  1SYB A;  3V2T A;  2EYH A;  2M2L A;  4NDX A;  3HKZ B;  1SAP A;  1RDP D;  4XT1 B;  2O5I C;  1MBY A;  1QCB D;  4FXG C;  1XXG A;  2F0M A;  5CMD A;  4R8N A;  1B50 A;  5BN3 A;  2K05 A;  2WKC A;  1CHP D;  4F8M A;  2RA4 A;  5I4D A;  2B8F A;  1TR5 A;  2HDM A;  2C9O A;  1TS3 A;  1K83 B;  1W6J A;  3SK8 A;  3MXN A;  1FNU A;  3JAM E;  3R2T A;  1ZEQ X;  1PRT D;  1I4R A;  5KYL A;  3BG3 A;  5EBC A;  4CHT B;  1V8Q A;  1HQR D;  4LK1 C;  1E2V A;  1DOM A;  1TQO A;  2KEC A;  4DXF A;  5I6Y A;  1BF4 A;  5M5Y B;  1JQY D;  5C3X A;  1LT4 D;  4DXG A;  4F7X A;  3I4M B;  3D6W A;  5C5M A;  1Y1W B;  1EY9 A;  1PXU A;  3H6M A;  2SNM A;  1FNW A;  1KLU D;  1L0Y B;  1JC7 A;  4ME5 A;  2RKS A;  2ZXO A;  4N9T A;  2AUK A;  2B2Y C;  4OO1 G;  4WJW A;  1PTO B;  1BO0 A;  1SFO B;  3R93 A;  3MA2 B;  3HZX A;  2K5D A;  4IUU A;  2EYJ A;  3QO2 A;  4C3J G;  2IT1 A;  4KMU C;  1OXT A;  1ZKO A;  3SR1 A;  1U4M A;  3VA5 A;  2A6E D;  1AEX A;  3KK7 A;  2K32 A;  1JOO A;  4OIK A;  5F2D A;  5CV4 A;  5ELC A;  3D6C A;  5BN5 A;  3K5O A;  3L3O C;  3GTO B;  1RTO A;  3QG1 A;  4PV1 C;  5A2Q L;  1HTP A;  3V96 A;  2J7Z A;  4EQO A;  1HUM A;  3VR5 A;  4Q5V A;  1F9Q A;  3SE0 A;  3DEO A;  3PUZ A;  2LS0 1;  3S16 B;  4FO2 A;  3L9A X;  3M4Y A;  3GO5 A;  3I3C A;  5FO7 B;  3T13 A;  2PQE A;  1SE2 A;  4K5V A;  3M4O B;  4H7B A;  1RCV D;  1FGB D;  2Z4H A;  3Q22 A;  1UNS A;  3X3N A;  4U68 A;  4TQU S;  2M9V A;  2YYZ A;  5A35 A;  2EY2 A;  2TMP A;  1LT5 D;  1QE6 A;  2VB3 X;  4LMQ D;  4ZUI A;  3MWY W;  4HED A;  4H0L C;  5I2Y A;  1JIC A;  1SXT A;  2OT2 A;  1ILQ A;  1PFB A;  1GXD C;  5JAV A;  5LHY 1;  1H9J A;  2VB2 X;  2RSN A;  5FOB B;  3I91 A;  3C3L A;  4XQJ A;  1SE4 A;  2B2U C;  4NP5 A;  1PTO F;  3SHL A;  1NR4 A;  4K6D A;  4IUR A;  1BCP D;  2FJ2 A;  3VYU A;  5KEE A;  5IGD A;  3OOC A;  3IAY A;  2EVB A;  4IUQ A;  3CRK C;  1M4V A;  1TS2 A;  5IOC A;  3FPU B;  5COR A;  1PFN A;  4C1N I;  3MTS A;  1SE3 A;  1AW7 A;  1TWC B;  2BE5 C;  3WOF A;  1B9M A;  1M8A A;  3KLS X;  3KLS A;  2F03 A;  3ND9 A;  4RWS C;  4EQN A;  2F0T A;  3OPO A;  2PZT A;  5K36 H;  3HOV B;  2B2W C;  1DJR D;  1NCV A;  4EVO A;  3W2D A;  2KCC A;  2EDG A;  1B44 D;  4I7Z C;  3RLF A;  4UAI A;  1O80 A;  2NVT B;  4BY1 B;  1PRT F;  5JEA J;  1AN8 A;  2H1E A;  2NVQ B;  1EWC A;  1HRJ A;  3NP8 A;  5C0X J;  3F2U A;  2A68 C;  1JOQ A;  4CJ2 C;  5ELE A;  4ZKB B;  3I72 A;  3HG9 A;  3NPP A;  1LTS D;  4HN7 A;  4PNY A;  4DN4 M;  1VMC A;  2EXZ A;  1VF7 A;  1KAA A;  2L5T A;  2Q8I B;  3VR3 A;  4G57 A;  1VDZ A;  2JE6 I;  3S1M B;  1O7L A;  2F0I A;  1VCI A;  1PYW D;  1I4Q A;  1QNU A;  2F0Q A;  3H09 A;  3K57 A;  4RHR A;  3J7A F;  1LO5 D;  4PMB A;  1SYE A;  1HXY D;  1NSN S;  4IZ8 A;  2C5C A;  2F1M A;  4TRD A;  1GUN A;  2EY6 A;  3K59 A;  4EQP A;  4CGY B;  3K5M A;  1HFG A;  1H9R A;  1ZYR D;  3PMF A;  3TSS A;  2MP1 A;  3NUC A;  3EVQ A;  1CK1 A;  3VR2 A;  4RH6 A;  1PZK D;  4NKL A;  1I4H A;  5JEA H;  1S5B D;  5D14 A;  4XQQ A;  1T5E A;  1WVL A;  3E5S A;  4C3I B;  1WTV A;  2LY7 A;  3FEW X;  1Q90 A;  1CI3 M;  2LMC B;  4KTA A;  1CZW A;  4BBS B;  1S5F D;  2ZT9 C;  2X6L A;  5JJZ A;  1RD9 D;  3LX0 A;  4X3K A;  3S9W A;  1JOK A;  5AFW A;  5G3L D;  4XYQ A;  1EY4 A;  1Y1V B;  3HRZ C;  2EYF A;  3MFG A;  2JSO A;  3R2I A;  3V05 A;  1PDQ A;  4FVM A;  1QNK A;  3GD7 A;  1MGS A;  1I50 B;  4CJ1 B;  4QF4 A;  1EOT A;  5JPM C;  2AUJ D;  2PMZ B;  3MC0 B;  1G29 1;  3NWT A;  3ZYY X;  5M5W B;  3FMC A;  3A8J E;  5EPL A;  3DWQ A;  3GTG B;  3C1F A;  2EYO A;  3CU7 A;  1SYG A;  5IGE A;  2EY5 A;  1IYU A;  2IX1 A;  1H9K A;  2RSO A;  2EJM A;  1TY2 A;  4ZLT F;  2B2Y A;  5ELD A;  1KNE A;  1AZQ A;  2OXP A;  1KNA A;  4OIJ A;  4B9W A;  4HAE A;  1SNO A;  1JWM D;  3DWA A;  3TZU A;  4RHS A;  1CZG A;  3RUZ A;  5D3I B;  1BCP C;  1DOK A;  1E2Z A;  5IIF A;  1B9N A;  4RGO S;  1L0X B;  1O7Y A;  2F0J A;  3MFY A;  1JCK B;  1EY8 A;  3DHQ A;  4DK0 A;  2RDH A;  3KBG A;  4J6H A;  4BS9 A;  3URY A;  4PMC A;  4MIU A;  3GTM B;  1KTK A;  5CGK A;  4BBR B;  1S5E D;  4HCS A;  3GV6 A;  5CBA E;  2PZU A;  3TP6 A;  3X3M A;  5C0X H;  3LWE A;  4ULL A;  4DGZ A;  4KHZ A;  1JWS D;  4KJO A;  1S5C D;  1D1I A;  5M9O A;  1GUG A;  1KDB A;  5I9O A;  1F2L A;  3OMC A;  5EPK A;  2HDL A;  3WOE A;  1SDF A;  4XYO A;  3A8I E;  3H94 A;  4IFD I;  2EOT A;  2IX0 A;  1LT6 D;  1VMP A;  2E74 C;  4K6L A;  3TBI B;  2NN6 I;  2WV6 D;  1A3T A;  4L63 B;  2F0D A;  4N9P A;  1JE4 A;  1WTQ A;  3EQL C;  5LL6 X;  1AFP A;  1WD1 A;  5IGG A;  4BA2 I;  3MEH A;  3I90 A;  4OGQ C;  1F77 A;  4WOR A;  1BUV T;  2SDF A;  2X69 A;  1SJE D;  3DMU A;  1GUT A;  3DM1 A;  4RGN A;  1DXM A;  3P20 A;  5C3E B;  2DNC A;  1OXV A;  1RKN A;  5COY A;  2VUM B;  4ZQ3 A;  4LAA A;  5FKA C;  3QJY A;  4MHE A;  2NTS A;  2FFK B;  3S1R B;  2IW3 A;  2L4N A;  5C4Z A;  3GTK B;  2VNU D;  4L8J A;  1C48 A;  4LJZ C;  4K5X A;  2K1B A;  4C3J B;  1WTX A;  2V4D A;  4C2M B;  1DM0 B;  1CA6 A;  1V1P B;  1A3V A;  3ITP A;  1EY7 A;  1ICW A;  2K5W A;  2B2W A;  1CQV A;  1EWH A;  2IJ0 A;  3G7L A;  4RCO A;  4A3K B;  4JK1 C;  2A6H D;  3OIP A;  1J8I A;  2WII B;  4X3U A;  2PPB C;  2CHB D;  4H44 C;  1PMR A;  4KY6 A;  4KV6 A;  3R8B A;  1GHJ A;  1KAB A;  2QF7 A;  3FPP A;  1SBB B;  2RVL A;  4KD3 A;  3RMH A;  3K5L A;  5JEA G;  1A3U A;  4KKT A;  2N55 A;  2PNR C;  4BA1 I;  3HOY B;  5IGF A;  1IL8 A;  3J81 E;  2Z1C A;  4F87 A;  4UDU C;  3OIQ A;  2SOB A;  1ONL A;  4KK7 A;  2B39 A;  1II3 A;  3H91 A;  2K03 A;  1RTN A;  4C1N K;  2AQ2 B;  4IUN A;  4Z9C B;  3WDN A;  3TP5 A;  1Y69 U;  2JA8 B;  3P7J A;  1ESF A;  1CQF A;  2D9U A;  1HA6 A;  5A2Q E;  4ZK9 B;  2OEO A;  2JYO A;  1STE A;  2X6G A;  1SEB D;  4ODG A;  3AMU A;  1TS4 A;  1W6K A;  2IX3 A;  4TSS A;  1BCP F;  1STY A;  1HHV A;  2L0C A;  4KI0 A;  3PO3 B;  2FMC A;  3DEP A;  2BA1 A;  1PZI D;  1SNM A;  1SNP A;  1Z47 A;  1Q1E A;  3LWU A;  4DF7 A;  2ID0 A;  5DAU A;  1A15 A;  1Y8N B;  2F0H A;  1TWG B;  1ENA A;  5IT9 E;  1G6Z A;  3CKI B;  4M1U B;  1J9O A;  4XT3 B;  1NR2 A;  2SNS A;  3NWS A;  3Q6S A;  4DAP A;  5EKL A;  1PLF A;  1Y8O B;  3LNN A;  4A3I B;  2I46 A;  1RJT A;  3D4R A;  4QCL A;  1CM9 A;  4CKE A;  4FF2 A;  4HSV A;  3BVG A;  5KNC A;  5CYU A;  1HPC A;  1EY0 A;  5I9P A;  5FK9 C;  3ERO A;  1EZ8 A;  3D4D A;  2R7Z B;  1I4X A;  2I07 B;  2K01 A;  2A68 D;  2RDG A;  4X3S A;  5ELB A;  3MZ5 A;  4FF4 A;  2KHS A;  1ENF A;  2D62 A;  1GUS A;  2F0U A;  1QJO A;  5ELF A;  2EYL A;  3NXW A;  2L1B A;  3MXG A;  2ZXR A;  5D3D A;  2K6A A;  2EY1 A;  5CV6 A;  2JXM B;  5EBD A;  4NW2 A;  1SND A;  3VYR A;  2QDB A;  5C0X I;  3J80 L;  4ZYS A;  2B2U A;  1BCP B;  1U9R A;  2HCC A;  2BE5 D;  1MSG A;  2FMM A;  1NUC A;  1HA5 A;  1STB A;  2WIN B;  2QEJ C;  1PTO C;  2F0O A;  1ZYR C;  2ENB A;  4M8A A;  3VA7 A;  2JA5 B;  3HS0 C;  3BDL A;  4NMZ A;  2A69 C;  3G6J B;  2ICE C;  3NSW A;  2XWB B;  4HCE A;  5CV8 A;  5DEH A;  4ZRZ A;  4A3G B;  3O13 A;  3NBI A;  4V0B A;  1V1P A;  1BQQ T;  2WAC A;  4XDX A;  3BVM A;  1B53 A;  3A56 A;  4O1N A;  3TZD A;  4C3I G;  1E0B A;  3Q0A A;  4OO1 I;  2MGS A;  1D6E C;  1OXX K;  3I8Z A;  2DY7 A;  2EPB A;  1PRT B;  1A2U A;  3PUY A;  5K5P A;  3KBX A;  1JB3 A;  3SK5 A;  3A54 A;  2JP1 A;  2KED A;  4RCN A;  1R4Q B;  2BDO A;  1PTO H;  2PW5 A;  4DU9 A;  3BDO A;  2H4O A;  4CKC A;  2R93 B;  2E2J B;  1LTG D;  1LTR D;  1FNV A;  2BCO A;  2PYK A;  4ABN A;  4HTH A;  1B4O A;  2WP8 J;  3CHB D;  1H9M A;  2E75 C;  4A93 B;  3ONA B;  2B2V C;  2EZV A;  3TP7 A;  4FXK C;  4F88 A;  3QWN A;  3S17 B;  1JR0 D;  4O42 A;  4DNT B;  2D5D A;  3NK9 A;  1C8C A;  2JA6 B;  5FLX E;  3PUW A;  1UEA B;  1XYI A;  2G9H D;  2HUG A;  4HMI A;  4Q0F A;  1SYC A;  5KGU A;  2WKD A;  1G8Z D;  4FNF A;  4DAY A;  2RBM A;  4AYB B;  5C4X B;  1ILP A;  2FHT A;  4J8Q A;  3I4L A;  1WTW A;  3BDC A;  3K6O A;  2F0L A;  4OO1 H;  3MAQ A;  1EFI D;  3VYS A;  4K2L A;  3PO2 B;  1FYC A;  4KKS A;  2CW0 D;  3C46 A;  3FVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...