1I94Q

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEERYKVGDVVEIIEARPISKRKRFRVLRLVEEGRLDLVEKYLVRRQNYASLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
total genus 10
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i94Q00
2WFWA 3PUZA 2OQ0A 4DNIA 3L7ZC 4A93G 4GLVB 1PH3A 3EN2A 1M90C 2YTXA 2C35B 4GNXA 4X62L 3CP0A 2LSSA 3EIVA 3AFPA 1IBKL 3GD7A 2RF4A 4AQYL 1I5FA 2ZM6L 1J5EQ 3I4NH 4A3CG 5GAEC 2NVQH 1JT8A 4A3KH 2VNUD 1LM0A 5J3BA 2I5LX 3J81j 4DV6L 4A3LG 4ME3A 1D8LA 4DK6C 1V9PA 1TXYA 2OQKA 3GTMH 4LFBL 4UP8A 4A3BG 4X62Q 2MFIA 1HZAA 4DR4L 1IBKQ 4BBSH 3M9BA 2ZM6Q 2PI2E 4AQYQ 2F4VL 3GTJH 1NY4A 1HNXL 3S17H 1X3EA 4R4CA 2PQAB 4DKAC 1XMOQ 3KDFA 1K73C 1KIXA 2Y0SE 2K5HA 2VQFL 2I0QA 5ELNA 2KCTA 2UXCL 4JG2A 2F3IA 3CC4A 3PO2H 2CWPA 4LF9L 3PUYA 4GS3A 4DV6Q 1YJWA 2GVBA 3KFUA 1TWHH 4JI5L 5AJ3Q 2JA7G 5IP7H 3G48A 2WB1G 1U0LA 4LFBQ 4A3JG 2Q2UA 4IFDG 3F8TA 3PO3H 3FKIG 1MJCA 4DV2L 1YHBA 4DV5L 3J81c 3CC7A 3HOWH 1PH1A 4DR4Q 1B8AA 4P71A 3H3VI 2F4VQ 2CKZB 3S2HH 1VQAA 1HNXQ 4GNXC 2YTVA 3F2DA 4POGA 1D7QA 5GAHC 5HY6A 4R4IA 4LUZA 4KHZA 3KYHC 1YNXA 4C3HH 1VQEA 4OWXB 3M4PA 2VQFQ 4HIMA 4LF5L 4NXML 4DV7L 4A3GH 2UXCQ 1Y1VG 1V1QA 4LF9Q 1WFQA 1EWIA 3VDYA 4KI0A 3PUVA 3KJPA 4A3FH 3KF6B 5M5XH 4JI5Q 1HZ9A 3J81i 1S40A 5IY0A 3M4OH 3L0OA 3HOUG 4AIMA 3HKSA 3S15H 2L15A 2QEXA 1GM5A 2Q2TA 4DV5Q 4DV2Q 1A8VA 2BH2A 3S1QH 5C4JH 2D62A 2R7FA 3J80c 5M3FH 3MXNB 4IPDA 5C0XI 4HIDA 1VQDA 1U5KA 5LMNQ 4A3MH 4BY1H 4A3LH 1QVCA 2ZTEA 2BA1A 3K8AA 5E7NA 3CPWA 4IPCA 3WWVA 4LF5Q 4GNXB 4DV7Q 4NXMQ 2EQSA 2D0OA 3GTGH 1EUJA 1V43A 1B7YB 1JMCA 2ES2A 3D0FA 1IL2A 4A76A 4R4OA 4NB3A 5GROA 3J80i 2K14A 1Q12A 1TWFH 1PYSB 1X55A 2JK8A 2KCMA 4Y7NH 4R4TA 3OYYA 3JAMc 3I4OA 4YCWA 4LW1A 4OO1I 4LFAL 1CKNB 4A4IA 3OW2A 3F1ZA 1ASZA 1X65A 4GLAC 3HFZB 2DUDA 2Q2IA 2UXBL 1FGUA 4AH6A 4JI0L 1UWVA 1I94L 1EIYB 4B3TL 1SMXA 3BJUA 2R6GA 3UDGA 1E3PA 4QY7A 4LUOA 4NPSA 2VUMG 2HIXA 4BA1I 4JI2L 2B63G 3KDFB 2MO1A 2E8GA 2E5LL 2N49A 5IP9H 5FLMH 1YI2A 4LFAQ 3CMEA 5JEAG 1IBML 4NXNL 3CD6A 2LXKA 2GVAA 1YVCA 1X54A 4GN5A 4JBWA 1WJJA 3RLOA 4AYBE 1XMQL 4PZ7A 2JA5H 1KQSA 1JJ2A 4BBRH 1KRSA 3NBHB 4HIKA 2NVXH 2KENA 2H5XA 5IYDG 3OTOL 4KHPL 3CCRA 2UXBQ 4JI0Q 2MO0A 1I94Q 2N8NA 4PG3A 5C0XG 4DR2Q 1CUKA 1N8RC 4JI2Q 4DK3C 2CFMA 2WP8J 1HJPA 3HOXG 1KD1C 1XJVA 4A3KG 2XGTA 2E5LQ 1YHQA 2VQEL 3ER0A 2NN6I 1WYDA 3U50C 1IBMQ 1EOVA 2F52A 2E2IH 4NXNQ 1HZBA 4A3DH 4DUYL 3HOZH 4GKJL 4BA2I 1XMQQ 1NE3A 4LF7L 2NVYH 3GTLH 2Z6KA 1PA6A 2R93H 5HGQA 4KHPQ 3CCJA 2CQOA 2CWAA 1VQBA 2K75A 3OTOQ 1R9TH 4OO1G 1PVOA 1SRUA 1RIPA 3FP9A 3RN2A 4L5QA 3TRZA 1HNWL 4EX5A 2IHFA 4XTCS 4BY7H 2VQEQ 4P72A 4JI8L 3CQZH 4LUVA 4DR7L 2MNAA 4A3IH 4UP7A 3W5OA 4DUYQ 3HOVG 1HR0W 2CCZA 1A0IA 4LF7Q 1YIJA 2VL6A 1VQGA 1AE2A 1OXSC 3A0JA 4FDBA 1VQMA 1XMOL 2JA8G 4GKKL 1KXLA 2WB1E 4MNOA 1X6OA 3HOYH 3PO3G 2N3SA 5IWAL 2R92G 1HNWQ 1PHJA 3PIOA 1CKNA 4OXPA 1X9NA 4JV5Q 5AJ3L 3I7FA 1FVIA 4OWWB 1MKHA 3K81C 3RLFA 3ZJYC 4LF4L 2AWNA 1VQHA 4JI8Q 1UE1A 4IO9A 5M3MG 3S1RH 2HHHL 4DR7Q 2BA0A 2RHSB 4A3EG 3HKZG 1Y1WH 1EIFA 2AKWB 1HNZL 4GKKQ 5IYCG 2UUBL 3TEHB 2NN6G 4L5TA 5IE8A 3I4MH 3JC66 5IWAQ 4JCVE 4GOPA 5JJLA 1W3SA 1YHAA 4GLXA 1IBLL 1JB7A 2Z6KC 1Q82C 1WCMH 4UPAA 4A3MG 4TVAB 4LF4Q 1L1OA 5C4XH 5M5YH 2HHHQ 2KBNA 1PFSA 3MEFA 4IFDJ 1BBWA 1HNZQ 3U4ZA 3NEMA 5LMNL 1Y14B 2UUCL 1RL2A 2UUBQ 1TWGH 1N36L 1C0AA 4A93H 2HIVA 2A8VA 1E1OA 2K5VA 1IBLQ 3DM3A 2D0PA 3T1YL 3KLWA 4DUZL 3M7NA 3K7AH 3BZKA 1PH9A 4P73A 4A3CH 5LMUL 1AH9A 2JA6G 1Q1BA 3H0GH 1SN8A 2PNHA 2RHQB 3NELA 1CKMA 4B3ML 1VQNA 1JJCB 1QUQA 3G4SA 2UUCQ 1XTDA 1SE8A 2UU9L 1PV4A 1N36Q 4Y52H 2K52A 3CF5A 2I5MX 1LTLA 1SROA 3K7UC 5EAYA 2YTYA 5GAGC 4DR3L 4MTNA 4IOAA 3AYHB 2IT1A 1Q86C 2HT1A 4B3RL 3UE0A 4A3BH 4BXXG 5FLXc 2V1CC 3T1YQ 4RMFA 2JA5G 3UDIA 1PH7A 4DUZQ 4GOPC 4BBRG 5LMUQ 3G71A 4LF8L 4B3MQ 3ULLA 1L1OC 2UXDL 1N9WA 3I2ZA 3K0XA 4XIGS 5FJ8G 4A75A 3T1HL 2UU9Q 5ELOA 1VQFA 3CAMA 3RNUA 5LMNW 1NJIC 1VQJA 3M85A 2JA7H 1L0WA 2JJQA 3GDEA 4DR3Q 3CW2C 4A3JH 1S72A 3U4VA 3CCSA 4B3RQ 3B6YA 3HOZG 4DR2L 1E24A 1X3GA 3D31A 2AMCB 4X66L 2YU9H 3UDXA 1N34L 1I6HH 1VQIA 2HQLA 2N78A 4LF8Q 5C44G 1VCIA 4GOPB 1PH6A 2R7ZH 2UXDQ 2UUAL 1Y1VH 3E9IA 3J7ZC 3T1HQ 2VY3A 4KLKA 1L1OB 4QQBX 1GKHA 3HOUH 4BY7G 1VQ4A 4GN3B 4LF6L 2ALYB 3F2BA 4OONA 1LUZA 3RN5A 3RLNA 3I56A 2IY5B 1NMFA 1X56A 5C0XJ 3I4NG 4YCUA 3M3YH 4X66Q 1Q8KA 1N34Q 3RR5A 4WJ4A 1Z47A 4DAMA 4YCVA 4JI1L 2UUAQ 4IPHA 1LYLA 1CSQA 1Q1EA 2OWOA 1KHIA 4PZ8A 3A5UA 2OCEA 2Q2HA 1XNQL 1G6PA 4LF6Q 4DR6L 5DLQE 1K3RA 4J15A 4R1JA 2A1AA 4JOIC 3TS0A 4JYAL 4DV1L 4BBSG 1QUQB 4YHHL 3HKZE 1S3OA 1VQ5A 4UY8C 4JV5L 4POFA 4C2MH 1UEBA 1A62A 2KHJA 4DPGA 1QZGA 1N32L 1WOCA 2K50A 1C7YA 5GQOA 4JI1Q 1Q46A 1E7ZA 2FXQA 3PO2G 3GO5A 5IYBH 2QGQA 1PH5A 1JJGA 3PF4A 4WJ3M 2LXJA 5IP7G 1VQ8A 1L2FA 4L5SA 1Z9FA 2WAQG 1XNQQ 1BVSA 3A74A 4DR6Q 3GTOH 2EIFA 3RZOH 3E9HA 3HOWG 4JYAQ 4R4QA 3EBEA 4PZ6A 3STBD 3U58A 4MZ9A 4DV1Q 4YHHQ 1VQ9A 4IFDI 2B29A 4OX9L 2JEAI 5IT9c 4O2DA 1N32Q 4DV4L 3S16H 4OWTB 4JI6Q 4K0KL 1XNRL 4A3GG 3Q8DA 4IPGA 3TS2A 4A3FG 5C3EH 5IYDH 1YZ6A 3PV0A 2BH8A 3BZCA 1DGSA 2NZOA 2ID0A 3GTKH 4DV0L 1KC8C 3HOXH 3M4QA 3SGIA 3CC2A 1KAWA 4GKJQ 3H0GG 1VQKA 1M1KC 5M3FG 4BY1G 1E1TA 1GVPA 1C9OA 1P8LA 3KF8B 3CCEA 2AHOB 4OX9Q 2JEBI 3UDFA 4DV4Q 1I50H 3PCOB 1BBUA 4K0KQ 1XNRQ 1G291 1CSPA 3NENA 3CXCA 3TREA 4TQUS 1AE3A 3PSIA 1N33L 3S24A 3IRBA 1JE5A 2YV5A 3FHWA 2NVTH 1KL9A 4DV0Q 3W1GA 2DGYA 1CKOA 4IJHA 4QJFA 5JJKA 1MJEA 1I3QH 3I55A 3KJOA 3S2DH 4X64L 1KRTA 1YBYA 4JBJA 3PUWA 1EFWA 3TQYA 3ULPA 4HJAA 3HOVH 1YEZA 1GO3E 1HZCA 2PI2A 4DAYB 1NBWA 4YY3L 1O7IA 3G6EA 1X3FA 2JA8H 1VQPA 2XTIA 2QA4A 3H15A 3CCVA 4H02A 1N33Q 1Q7YC 5M5WH 2E2JH 1P16A 4HJ8A 2ZJRA 1ASYA 2R92H 4B3SL 3S1MH 1XPRA 4C3JH 3CCLA 1G51A 3PUXA 4JI7L 4X64Q 5IP9G 5FLMG 2GN5A 2R7ZG 3ULJA 5M3MH 2PMZE 3GTQH 4LFCL 4DV3L 2B3GA 4A3EH 3LGJA 1K0RA 4YY3Q 2NZHA 2OTJA 2Y0SG 5IYCH 4P74A 1TWAH 1NTGA 1SLJA 1T9HA 4B3SQ 1MIUA 4JOIA 4C3IH 1OXXK 3PIPA 3CCMA 2YYZA 1VQ7A 4JBMA 2A19A 4JI7Q 4ALPA 1FJGL 4GN4B 2AWOA 4DR5L 1YITA 3AFQA 3DLLA 4IOCA 4A3DG 3ICEA 1Q81C 4LFCQ 3FKIH 1FL0A 4DV3Q 4DR1L 1SFOH 1IXRA 2VW9A 1E22A 1YJNA 2KHIA 1XPUA 2IHEA 3CCQA 2ASBA 1VQOA 4X6AH 4JBKA 2R93G 2ZTDA 5H1SE 3CMAA 4APVA 4EQ5A 3CCUA 1QZHA 1OXUA 3BU2A 3W1BA 4HJ5A 5JEAJ 1OTCA 1H95A 1TWCH 2K5NA 1VQLA 2IX1A 2R7DA 5K36G 1FJGQ 4X65L 2ZTCA 4DR5Q 4YWMA 3F2CA 2OTLA 4JI4L 3S1NH 1GD7A 3E0EA 4JC0A 4A3IG 2I5HA 4RG1A 5IYBG 4DR1Q 1EYGA 4QGUA 2JA6H 2ZJPA 1WI5A 4HJ9A 4O0AA 3CPFA 3JAMi 3KOJA 1UE5A 1PH8A 1A63A 2WAQE 3STBC 3GTPH 2MQHA 2PQAA 1K8AC 2RCNA 4UP9A 1J6QA 4HIOA 1PYBA 3HOYG 5BR8L 5GADC 1PH4A 2IX0A 2VZAA 1HR0L 5JJIA 4L5RC 3RZDH 2ATWA 1EQQA 4BXXH 1NMGA 2JQOA 4YWLA 1K9MC 4X65Q 3S14H 4JI4Q 3UE1A 4IJLA 1OXTA 4PMWA 1PH2A 3ERSX 1B70B 1VS0A 1EQRA 2Z0SA 1OXVA 3A5ZB 4LWCA 4QIWE 5C3EG 3PF5A 1Y1WG 1QVFA 4P75A 2E2HH 4B3TQ 3J7A5 4JI3L 5FJ8H 1IYJB 1BKBA 2K4KA 1K83H 4YWKA 4JI6L 1VQ6A 3I4MG 3L2PA 5BR8Q 2JA9A 2EXDA 1QVGA 1W2BA 1SR3A 1UE6A 1UE7A 1HR0Q 1K8GA 4LNQA 3H3VH 1WCMG 1YJ9A 3KF6A 3AEVA 4HJ7A 5C4XG 4QL5A 1VQCA 2VUMH 2B63H 1J5EL 2JE6I 2VS1A 1HH2P 1IZ6A 5C44H 3K80C 3PGZA 4JI3Q 1XPOA 3AQQA 4AYBG 2ZJQA
chains in the Genus database with same CATH superfamily
2WFWA 5JPNC 3L7ZC 1M90C 3ERQA 4TKOB 3CP0A 4JW0A 5EBDA 5C0XH 3EIVA 3AFPA 3EROA 4BS9A 1I5FA 2ZM6L 3KUPA 3GTOB 2NVQH 4A3KH 4EQPA 4QB4A 4C3JG 3S1RB 1AEXA 1LTSD 1QNKA 1E2VA 4LFBL 1TXYA 3GTMH 4F88A 5C3EB 1HA6A 1AP0A 4X62Q 2MFIA 2DN8A 2KEEA 3GTKB 2PI2E 1HNXL 1NY4A 1XMOQ 5E4WC 3IFTA 1WCMB 4EGVA 2UXCL 3PO2H 2CWPA 2CW0C 3TP8A 2JA7G 1MI2A 2R3ZA 2WB1G 4ZCKA 2Q2UA 2L1BA 2PW5A 3F8TA 3FKIG 4DR4Q 5J22A 1YHBA 1SYFA 3HOWH 4IZ8A 4AYBB 1G8ZD 2KECA 1B8AA 1PH1A 2CKZB 3S2HH 1VQAA 4A93B 5GAHC 2VQFQ 1VQEA 4NXML 2XWJB 1WTQA 1TIID 1V1QA 5ELCA 4EVOA 1EWIA 1JWMD 3KJPA 5M5XH 5FLXL 1B1ZA 1DONA 2D2CC 2Q2TA 4FYDA 1NR2A 2I46A 3MTSA 4DV2Q 1A8VA 3S1QH 5C4JH 3J80c 5M3FH 3C1EA 2CW0D 3K8AA 4LF5Q 3MXPA 4IPCA 1SEBD 5M3MB 1EUJA 3D0FA 4A76A 4R4OA 5GROA 5E4XA 2OEOA 1DCZA 3D3RA 3I4OA 3A56A 4R9WA 3OW2A 1X65A 5EBCA 3TN2A 1CZGA 4KY5A 4B3TL 3FEWX 4Z9CB 1E3PA 4LUOA 2YU9B 1DOMA 2HIXA 1RODA 4JI2L 1W6KA 1Y1VB 4HMIA 1B44D 5JEAG 1GUTA 4GN5A 1CQFA 1WJJA 1LTID 3DXJC 1KAAA 1JJ2A 2HCCA 1KRSA 2NVXH 2KENA 2H5XA 2UXBQ 2MUYA 1I94Q 3A8KE 1WD0A 1CUKA 5JVG3 1GHKA 1XWEA 2BDNA 2CFMA 2WP8J 4DGZA 3HOXG 2HUGA 3H3VC 2NN6I 1F2LA 1EOVA 2F52A 4NXNQ 5IGDA 5A2QE 1BXTA 2DY7A 4LF7L 3A55A 4FF1A 2CQOA 3OTOQ 1X3PA 3U9SA 1HNWL 4KN7C 2C5CA 2F0DA 1AW7A 4XTCS 2VQEQ 1PTOB 4LUVA 4A3IH 1WTRA 4KKSA 3HOVG 1PZID 2CCZA 1YIJA 1AE2A 4GKKL 2WB1E 5IOCA 1X6OA 4HN7A 1JICA 3SK8A 4JV5Q 5AJ3L 1FVIA 3ZJYC 3RLFA 4LF4L 4B9XA 1SNDA 2BA0A 2XSCA 3I90A 1OO9B 1UNSA 2EDGA 4OELB 1IKLA 1PRTD 3I4MH 2RDGA 4JCVE 4GOPA 2F0KA 2Z4IA 1IBLL 5D14A 2Z6KC 4G57A 1SYEA 1L1OA 1RDPD 1GJXA 3MEFA 2NVTB 1BF4A 2EYMA 1MSHA 3S2DB 1TWGH 3ND9A 3DM3A 4O1NA 3N6RA 1JOOA 3FDTA 4DUZL 3M7NA 5BN5A 2EY5A 3PO3B 1A2UA 5LMUL 1AH9A 3QR8A 3JAME 1UEAB 1CKMA 3NELA 1EEFD 4DA2A 2TMPA 2UUCQ 1SYBA 4CJ1B 1N36Q 5KNDA 2I5MX 2J0TD 3DM1A 5GAGC 2PZTA 3IKJA 3E5SA 2IT1A 3HKZB 4BXXG 4ZRZA 3M4OB 2F0GA 5AFWA 3OSOA 3G71A 4C3IB 1A3TA 2ZXPA 1EYDA 2JXMB 3K0XA 3I2ZA 2UXDL 4A3MB 2UU9Q 1BCPF 2IX3A 2B8GA 1VQFA 4H0LC 3Q0AA 3CAMA 1HUMA 4RGTA 4IFDH 5EKIA 3B6YA 2K33A 3OPOA 2KJXA 3Q23A 2QDLA 1TWFB 4Y7NB 4K2KA 4X66L 1EIGA 3UDXA 1I6HH 1VCIA 4O42A 4WRDA 2R7ZH 1O7ZA 2F0HA 1G2TA 1JOQA 2GA4B 1LTTD 2VY3A 4KLKA 3NBIA 3S1NB 3HOUH 4BY7G 4GN3B 4V0BA 5IODA 4OONA 1PXUA 2BCOA 1SJED 1NMFA 1LLRD 1PYWD 3GTPB 3M3YH 3D4RA 4YCVA 2HQEA 1STGA 3S14B 1CSQA 1KHIA 1X32A 1KABA 1G6PA 4LF6Q 3URYA 5DLQE 4JYAL 3R2IA 2E76C 2KVMA 4BBSG 1QUQB 1B9MA 1STEA 1S3OA 1QZGA 2RDHA 1N32L 1M8AA 1ENCA 4JI1Q 1E7ZA 1JJGA 4PMBA 3OOCA 4K14A 1XNQQ 1BVSA 1CHQD 3GTOH 3L9AX 4NP5A 5JAVA 5I9OA 4DV1Q 2E75C 1VQ9A 4KHVA 3PIP3 5KYLA 1HTPA 1HUNA 3CQZB 2L5TA 5IYDH 5C3EH 1YZ6A 3PV0A 4Q5VA 2NZOA 3J7AV 2NVQB 3GTKH 5COYA 1KC8C 5CBAE 4ZK9B 4ID6A 2WKCA 4H7BA 1EWCA 1X3QA 4GKJQ 2B2VC 3H0GG 1JCKB 1STNA 4BY1G 1TU2B 3I70A 1GVPA 1C9OA 3CCEA 4OX9Q 2JEBI 4DV4Q 3GTMB 4K0KQ 1XNRQ 3NENA 4TQUS 3EA6A 3QOLA 1L0YB 1DOLA 3CKIB 3NQIA 4DV0Q 2DGYA 1CKOA 1ONLA 1I3QH 3I55A 2B2TA 2XRQD 4JBJA 1I4GA 4B08A 1HZCA 5C4XB 3U9OA 2PO4A 4CKEA 5FLXE 2Q8RE 1O7IA 5M5YB 1WTVA 1X3FA 1VQPA 2XTIA 1WTOA 1BOSA 2LY7A 3CCVA 1ICFB 4H02A 1Q7YC 1N33Q 4HJ8A 4UHVA 2ZJRA 3S2HB 2R92H 1QOHA 1TS4A 2NYZD 3S1MH 5C6AA 3CCLA 4JI7L 3GV6A 5M3MH 4DK1A 1STYA 5M5XB 3GTQH 5BN4A 4A3EH 5CV9A 1MGSA 2O2LD 4KJNA 4P74A 5C4JB 1NCVA 2TSSA 4B3SQ 1PMRA 2E74C 4JOIA 3IAYA 3KK7A 3SE0A 3CCMA 2MGSA 2A19A 1PFNA 4CBVA 2F0VA 2AWOA 4DR5L 1YITA 4I65A 3DLLA 1KDBA 1Q81C 4LFCQ 2VW9A 1YJNA 2KHIA 3CCQA 2G9DA 2R93G 1I6VC 1S4ZA 1U4MA 4APVA 1LT4D 3K6OA 4HJ5A 4JPBW 2M2LA 3QWNA 3PIO3 1OTCA 1VQLA 3NSWA 4ILWA 2OTLA 4JC0A 1UUPA 1EYGA 4DR1Q 2RCFA 1A63A 3CRKC 2MQHA 1MHWC 3HOYG 1J6QA 1PYBA 5BR8L 5M9OA 1QG7A 1B4OA 5JJIA 2XN9C 3SHLA 2JQOA 2NVXB 4X65Q 4JI4Q 3UE1A 3QJYA 5DM63 1VS0A 2Z0SA 1EQRA 3PF5A 4LWCA 3K5NA 1Y1WG 4HEDA 4P75A 2ENBA 3QOJA 3SK4A 1TR5A 1SNQA 1IYJB 1BKBA 2L0CA 3G6JB 4YWKA 1ET9A 1VQ6A 3BYYB 1PLFA 4LNQA 1PTOH 1UE7A 1DZ1A 4MIUA 1YJ9A 1GUSA 1Y8OB 4HJ7A 1TS5A 3NWTA 4G7HC 2WV6D 3OW7A 1HH2P 2PPBC 1FNUA 3TP7A 3AB9A 1XTCD 1XPOA 4JI3Q 4J8QA 3PUZA 4GLVB 4A3IB 3W2DA 3WDNA 4X62L 2LSSA 3GD7A 2RF4A 4IQZA 1J5EQ 4A3CG 4IUUA 5GAEC 3VYRA 1LM0A 2FMCA 1O7LA 5J3BA 1NNXA 3A8IE 3BDCA 2B2YC 4ME3A 1STAA 1V9PA 4DK6C 5I6WA 1PRTF 4A3BG 4DR4L 1IBKQ 3BVZA 5C4ZA 4AQYQ 3HOXB 3S17H 1ESRA 2PQAB 1Z7TA 3BDOA 4RCOA 4DKAC 2XVSA 2VQFL 2KCTA 4JG2A 1NR4A 1YJWA 4UAIA 1EYCA 2GVBA 1TS2A 5C4HA 1BCPC 1IL8A 3PO3H 1MJCA 2WKDA 4DV2L 3DMUA 3P20A 1WTPA 3H3VI 1TWGB 4GNXC 2YTVA 1Z6HA 4KHZA 4C3HH 4OWXB 4LF5L 1LO5D 4A3GH 3ND8A 1CM9A 1EY8A 3VA7A 1HQRD 3KF6B 4JI5Q 3V05A 1GHJA 1D6EC 2K28A 3M4OH 4AIMA 3MWYW 3HKSA 2QEXA 2E2JB 1LACA 2F0TA 4IPDA 3HEJA 4A3MH 4FF4A 1YNJC 1B7YB 2QW7A 4EQNA 3OMCA 4C56C 4JK1C 1Q12A 1TWFH 4Y7NH 4R4TA 4LW1A 3TP5A 4OO1I 2PW7A 1CKNB 3M4YA 4LAAA 1AN8A 3HFZB 2DUDA 2Q2IA 2UXBL 1SFOB 1UWVA 1MBYA 2JP1A 1I94L 5FK9C 1SMXA 3BJUA 1I6HB 1CI3M 4C1NK 1V1OA 4L63B 2E8GA 3BG3A 3UI2A 2O4XA 2N49A 3QO2A 1YI2A 4NXNL 3CD6A 3G7LA 4ABNA 1DD2A 2IWHA 3RLOA 3VR4A 1YNJD 1HA5A 1EY9A 3ITPA 4HIKA 5ELEA 3OTOL 3CCRA 2N8NA 4CJ0B 2NBFA 5C0XG 3M3YB 4ZQ3A 1GUOA 1HJPA 1CA6A 4A3KG 2E5LQ 2VQEL 2H1EA 3ER0A 1WYDA 2E2IH 1G6ZA 3RZDB 1HZBA 2EYOA 1NE3A 3WOEA 1W6JA 2HDLA 3GTLH 3A7LA 1EY4A 4CGYB 1PA6A 4KHPQ 1F9PA 2CWAA 1VQBA 2K75A 1R9TH 1ZKOA 3GQBA 1RIPA 3RN2A 2IHFA 3H6MA 4P72A 4XT3B 3CQZH 2MNAA 3MC0B 2RSNA 3DUZA 2VL6A 5FO8B 2B63B 2VUMB 1VQGA 2JA8G 1ILPA 3I73A 1VQMA 2EYFA 2Z4HA 3SEBA 3I8ZA 1B2TA 5D3IB 4M1UB 3PIOA 1ICWA 5IGEA 1AFPA 5CMDA 4JI8Q 5A35A 4DR7Q 4IUTA 5TSSA 2A74C 2SNMA 3J81E 1HQMC 2NWGA 5JPMC 1ESFA 4L5TA 5IE8A 1I4XA 3JC66 4RKBA 5JJLA 3KLSA 1JB7A 2H4OA 3KBXA 1Q82C 3FPUB 5CYUA 5C4XH 5M5YH 2FHTA 1EY0A 3VYUA 2EJMA 1BBWA 1ML0D 1XX8A 1HNZQ 3U4ZA 4BBSB 4FF3A 1I3QB 5LMNL 1Y14B 2UUCL 2UUBQ 1N36L 2HIVA 2A8VA 1ILQA 1E1OA 2DNCA 3GP7A 2F0UA 3KLWA 3BZKA 1FGBD 2JA6G 1Q1BA 2R92B 1VQNA 3S1MB 1LT6D 1JJCB 1QUQA 2LKVA 2UU9L 3DEPA 1SROA 3GTQB 3K0YA 4MTNA 1Q86C 4A3EB 3UE0A 3TZDA 5CBEE 3MEHA 3T1YQ 4RHSA 1TVXA 2PQEA 5J1ZA 2A69D 4B3MQ 1N9WA 5FJ8G 4XIGS 3HG9A 5ELOA 2JA7H 2EY6A 1VQJA 2J4XA 1RJTA 1EY6A 4DR3Q 3GTGB 2K5QA 1IW7D 2AQ1B 4DR2L 5KNBA 1SNPA 3VYTA 2EXZA 3X3NA 3HP3A 2SEBD 5C44G 3NTKA 1PH6A 3T1HQ 4FF2A 3OMGA 1D1IA 1VQ4A 2MHVA 4LF6L 2V4DA 4U68A 2ALYB 3F2BA 2NTTA 3HRZC 5C0XJ 3I4NG 4YCUA 3J7AF 1Q8KA 1I4RA 4DXFA 4JI1L 5KRUA 2UUAQ 1FNVA 1WTHA 2F0OA 1MD2D 2CH4A 2SOBA 2JA5B 3VR6A 2WACA 4BBRB 2OCEA 1XNQL 3MZ5A 5IGFA 2I07B 4XT1B 1K3RA 4JOIC 3TS0A 1PFMA 3R2TA 4DV1L 4UY8C 1PRTC 1VQ5A 5T1GA 1UEBA 1A62A 2EYLA 4DPGA 2K50A 3MFYA 1C7YA 5HGTA 3LWUA 2VXWA 3HOZB 5IYBH 2XNAC 5CR3A 1TS3A 2F0WA 2LXJA 4KD4A 5IP7G 1L2FA 2QEJC 1PFBA 1FYCA 2RDFA 4DR6Q 2PMZB 3LX0A 5C3XA 2AUJD 2KCNA 3RZOH 4GKJL 4R4QA 3STBD 2B29A 2D5DA 4OX9L 2CH4W 1WTWA 4DV4L 3S16H 1BNZA 4K0KL 1XNRL 3Q8DA 4A3FG 2BH8A 3BZCA 4L6TB 2ID0A 4DV0L 3HOXH 4A3LG 1I50H 1EQVA 3PCOB 1BBUA 1G291 1CSPA 3TREA 1AE3A 2F0EA 1N33L 3IRBA 3S17B 1JE5A 3BZDB 3FHWA 2EY2A 2Q8IB 3VR5A 3W1GA 1JOKA 4IJHA 2F0SA 4WORA 3D4WA 1HCZA 5CV5A 4FXGC 3ULPA 3HOVH 1YEZA 1GO3E 4DAYB 3SK6A 2WAQB 1QB5D 3H91A 3H15A 2E2JH 4KKTA 3DWPA 4B3SL 3I72A 1I4QA 1XPRA 4C3HB 1SMYD 1G51A 4A3GB 5IP9G 3FPPA 5FLMG 2R7ZG 2RA4A 4LFCL 4IUNA 2B3GA 4IUVA 4X3SA 4YY3Q 3DWAA 4ULLA 1RKNA 1T9HA 1DYQA 2LMCB 4PQXA 1B3AA 1OXXK 2KQ3A 1F2YA 4GN4B 5DNFA 2KUMA 3AFQA 5EPLA 4A3DG 1Q8IA 2N55A 3BYTB 1FL0A 4DR1L 1SFOH 5DEHA 3HS0C 1IXRA 1XPUA 1JQYD 2IHEA 4RA8A 1SSOA 4RKLA 1OXUA 2B39A 1V1PB 3TP6A 5JEAJ 1H95A 2DJGC 2A5HA 1TWCH 2K05A 2IX1A 2NZ1D 4K6DA 4X65L 2ZTCA 4JI4L 2JSOA 4KMUC 1GD7A 4UDUC 4DFAA 1H9KA 2I5HA 5EPJA 1UAPA 5CGKA 2DNEA 3KOJA 1UE5A 2OXPA 2PQAA 1K8AC 4UP9A 1IHZA 5I9PA 4DAVA 2VZAA 4L5RC 3RZDH 3Q24A 4BXXH 1K9MC 4IJLA 1OXTA 5EPKA 4PMWA 2IL8A 3C3LA 5C3EG 4QIWE 4B3TQ 4JI3L 1LTGD 2XRSD 2F4IA 1K83H 5IT9E 4JI6L 2EYJA 2E2IB 3L2PA 3EVQA 2JA9A 5CV6A 3BS1A 4XXEA 2B2UC 1QVGA 1CTMA 3H3VH 1WCMG 3GTLB 1O80A 4KK7A 3KF6A 4QL5A 1VQCA 3NP8A 2VUMH 2B63H 1J5EL 1R9TB 2JE6I 2VS1A 1KTKA 3AQQA 5GADC 4AYBG 2ZJQA 4A93G 1LABA 2QILA 2YTXA 2C35B 1S5BD 4CKBA 1IBKL 4BWGB 2CQAA 4AQYL 3OHXC 2VNUD 4QCLA 3RD4A 2I5LX 4KJOA 1S5CD 1D8LA 4K5VA 2OQKA 2EYPA 1RTOA 4OO1H 4V190 3J81L 4IALA 5EKKA 1VF7A 4BBSH 1CQVA 4R8IA 3GTJH 1K73C 1KIXA 1U4PA 2I0QA 3PQIA 3O13A 2K5HA 5ELNA 3OWEB 4DAPA 1Y69U 2F3IA 2HDMA 3CC4A 3P75A 4J1MA 4DV6Q 2A68C 3KFUA 1TWHH 4JI5L 5AJ3Q 3OIQA 4FO2A 3G48A 4RFBA 2B2WC 4A3JG 2N88A 3Q6SA 4XQQA 2F4VQ 1GXDC 5HY6A 1II3A 4LUZA 3KYHC 1RCVD 2FJ2A 3M4PA 1NUCA 1Y1VG 2SNSA 4LF9Q 1WFQA 1A6XA 2FMMA 2Z9HA 1HZ9A 3J81i 1PZKD 1S40A 1E2ZA 3L0OA 1PZJD 5M5WB 2OT2A 4DV5Q 1BR9A 1BCPB 3QIAA 4RCNA 3MXNB 4C3JB 4HIDA 1WVLA 1VQDA 1YNNC 4BY1H 1VMPA 1QVCA 2BA1A 2A68D 5E7NA 3CPWA 3WWVA 4GNXB 4DV7Q 4FXDA 3GTGH 3E6ZX 4OEMB 1V43A 1SYDA 5ELFA 1JMCA 1EWHA 2ES2A 2IW3A 1IL2A 1EOTA 1U9RA 3Q22A 1PYSB 1U4LA 3JAMc 4WJWA 4YCWA 1JR0D 3K58A 2F0JA 3F1ZA 3ONAB 2JA7B 1ASZA 2WB1B 3MA2B 2RSOA 3FKIB 1FGUA 4AH6A 3NQTA 1EIYB 1F2MA 4QY7A 4BA1I 4HAEA 3E3XA 3KDFB 1YNND 2ICIA 2E5LL 4LFAQ 3CMEA 4LMQD 1YVCA 3R3OA 2QKIC 4AYBE 2JA5H 3C1FA 1KQSA 1FR3A 3EFXD 4BBRH 3NBHB 4KHPL 2Z8LA 3W3AA 4JI0Q 1CHPD 4TSSA 1N8RC 4DK3C 3TBIB 4K8IA 1STHA 1IBMQ 4Q0FA 1ZYRD 3HOZH 1XMQQ 2NVYH 1V8QA 4MTKA 2G9HD 1IYUA 2Z6KA 2R93H 5HGQA 1LTBD 2RVLA 1JE4A 1SRUA 3FP9A 3MHBA 4L5QA 3DEOA 4RGMA 1HPCA 4CDEC 2F3VA 2FFKB 4DNRB 4JI8L 4DR7L 3FRPB 4UP7A 3W5OA 4DUYQ 2K6AA 2L12A 1K8OA 4NMZA 1A0IA 4OGQC 4K5XA 4FDBA 1OXSC 1XMOL 4X3TA 3RZOB 4ZAIA 1C8CA 3HOYH 3PO3G 2N3SA 2AQ2B 4OXPA 3S16B 1MKHA 4ZUJA 2AWNA 1UE1A 4IO9A 3EQLC 2RHSB 3NPPA 3HKZG 1Y1WH 5E1FA 5G3LF 1EIFA 2AKWB 1HNZL 1B3QA 3IFDA 3S9WA 5IYCG 2UUBL 2NN6G 4S3SA 1K3BC 2C9OA 5IWAQ 1STBA 3OWFA 1W3SA 4GLXA 4C3IG 1I50B 3KBGA 4UPAA 4A3MG 1SE4A 5D65A 2R61A 2HHHQ 5E3FA 2WIIB 2KBNA 4IUPA 3SXHA 1TY0A 1JWSD 3J80E 2RBMA 1B50A 1A15A 3HOVB 1C4QA 1HTLD 4NKLA 3T1YL 3NTHA 4N9TA 3K7AH 1PH9A 4A3CH 3PMFA 3V96A 1SN8A 2PNHA 4HMJA 3X3MA 4B3ML 3G4SA 1XTDA 3MAQA 2A6HD 1SJHD 3CF5A 1K28A 5EAYA 1LTLA 1S5ED 3K7UC 4ZUIA 4OHJA 4DR3L 2HT1A 4A3BH 2ZT9C 5FLXc 2V1CC 4FP5D 1PDQA 3UDIA 2M00A 1PH7A 4GOPC 2K5DA 3L3OC 3ULLA 1L1OC 4A75A 1EU4A 5K5PA 3DHQA 1H9JA 3T1HL 2HCIA 1NJIC 3M85A 1L0WA 2JJQA 3GDEA 3CW2C 2PYKA 3CCSA 5FKAC 4B3RQ 1K0SA 4K5WA 1E24A 1LT3D 1X3GA 3D31A 2HQLA 2ICEC 4LF8Q 2ZXRA 1TWCB 2UUAL 2PNRC 1TT2A 4QQBX 4RGOS 1F77A 2MP1A 1HFNA 1LUZA 1X56A 1N34Q 3RR5A 1MSGA 4WJ4A 4DAMA 1A2TA 3NHHA 1LYLA 3A54A 4DAYA 2OWOA 1Q1EA 2B2VA 3A5UA 2M9VA 2Q2HA 1QJOA 1QCBD 4YIJA 4DR6L 4DXGA 5CORA 4R1JA 2A1AA 2BE5D 4G4KA 1K83B 3HKZE 5IT9L 4JV5L 4POFA 1HHVA 3K5OA 2KHJA 2VB3X 3J7YW 3C2PA 5K36H 1WOCA 5ELDA 5GQOA 3SDZA 1Q46A 2F3WA 4XQJA 2FXQA 3PO2G 3GO5A 2QGQA 1PH5A 4WJ3M 1VQ8A 4DF7A 5T1IA 3A74A 5DM73 1EEID 2EIFA 3HOWG 3EBEA 4PZ6A 4MZ9A 4YHHQ 4DN4M 4O2DA 3AU7A 4BY7B 1FNWA 1PRTB 4IPGA 4H13C 3TS2A 1DJRD 1PTOF 3TZUA 3MVVA 4H44C 5I2XA 3M4QA 3CC2A 3P7JA 1FD7D 1V1PA 5M3FG 2DY8A 3AMUA 1P8LA 1SYCA 3KF8B 2AHOB 3UDFA 4ME5A 2L9HA 2KHSA 2L11A 3PSIA 5BN3A 4KKUA 2YV5A 3GTJB 2KOLA 1SXTA 1KL9A 1EY7A 2A69C 5JJKA 2RQXA 1YBYA 1Q90A 1EFWA 1TWHB 4HJAA 1BO0A 2PI2A 1NBWA 4HR7B 4YY3L 1IW7C 2JA8H 5EQ0A 1G2SA 5M5WH 3CU7A 1P16A 1ASYA 3I4LA 4N9PA 2EVBA 2MJ8A 4C3JH 1TKWB 3RUZA 3WOFA 3A7AB 3PUXA 4X64Q 4F87A 2GN5A 3ULJA 2IJ0A 4U673 5LL6X 2D9UA 2NZHA 2B8FA 4M8AA 2Y0SG 2JYOA 1SNOA 2KCCA 2F0NA 3F2UA 3H0GB 1TWAH 1NTGA 1SLJA 2LS01 4BY1B 2K32A 2DJFC 1VQ7A 1EQTA 2YYZA 4JBMA 2F0MA 4C1NI 2FINB 1SAPA 3ICEA 3FKIH 4DV3Q 1KLGD 3ZYYX 1E22A 2B2TC 3K57A 2ASBA 4JBKA 1EL0A 2ZTDA 5CV4A 5KNCA 3CMAA 5FOBB 3CCUA 1QZHA 3W1BA 1T5XD 3VR3A 4FXKC 1B53A 3LWEA 2F0IA 2NUCA 2R7DA 4X3KA 1FJGQ 4YWMA 3F2CA 4A3JB 4A3IG 2XIWA 4RWSC 2AUKA 4RG1A 5IYBG 2JA6H 2PZUA 2ZJPA 4HJ9A 2X6GA 3CPFA 3T51B 3NK9A 1Y8PB 5KEEA 3STBC 1F9SA 4HIOA 3H94A 1PH4A 2IX0A 3BVGA 1NMGA 4YWLA 1PH2A 2B2YA 4KY7A 1B70B 3A5ZB 5KYIA 1OXVA 2F0PA 2X6LA 1QNUA 3J7A5 5FJ8H 4F8MA 1CT1D 5IGBA 4CJ2C 4IURA 2EE1A 4XYOA 1KNEA 3I4MG 5ELBA 2KEDA 1W2BA 1HR0Q 2NVYB 1H9SB 2R93B 4ZKBB 2A6EC 4CDDC 2F0FA 1IZ6A 5C44H 3K80C 5JEAH 3PGZA 1DM0B 4C2MB 3MXNA 2OQ0A 4DNIA 1PH3A 3EN2A 2PCFB 5KIXA 4GNXA 1D2BA 1CA5A 2BDOA 4RGNA 4CKCA 3I4NH 1ET6A 4CHTB 1E2WA 3HOYB 3KLSX 1JT8A 4KN4C 4WFN3 1SMYC 5G3LD 4HSPA 1U4RA 2EY1A 3J81j 4DV6L 2JN4A 1CFMA 4HCEA 1Y1WB 2A6ED 2NTSA 4UP8A 3T13A 1HZAA 3M9BA 2ZM6Q 2F4VL 1X3EA 4R4CA 3D6CA 3KDFA 2L55A 2Y0SE 2LFNA 4LF9L 3PUYA 4GS3A 1Q3LA 5IP7H 2F1MA 2ZXOA 1U0LA 4LFBQ 3NBHA 1IYVA 4IFDG 4DV5L 3BVMA 3J81c 3CC7A 2NB0A 3J80L 4P71A 1HNXQ 4POGA 1SBBB 3F2DA 1D7QA 4PV1C 4R4IA 1ZXTA 1YNXA 3K5MA 4HIMA 3VA5A 1RF2D 4DV7L 2UXCQ 4XQNA 4A3FH 3VDYA 4KI0A 3PUVA 3EJIA 3K7AB 5IY0A 3HOUG 3MFGA 4DK0A 3S15H 1T5EA 2L15A 1GM5A 1SNMA 2BH2A 3R93A 2D62A 2R7FA 5C0XI 4A3LH 1U5KA 5LMNQ 5JVH3 2ZTEA 4NXMQ 1CK1A 4A3BB 2EQSA 2D0OA 1F9RA 1AZQA 2F0LA 2QCPX 4IN3A 3SK5A 1JWUD 4NB3A 1LTAD 3J80i 2K14A 2JK8A 1X55A 1K8MA 2KCMA 3OYYA 1VMCA 3P1HA 1C48A 1O7YA 4LFAL 4A4IA 1SNCA 1RHPA 4NDXA 4GLAC 3N52A 3VYSA 1GUGA 2XWBB 4JI0L 1TY2A 1QILA 4OIKA 2R6GA 3UDGA 4NPSA 2VUMG 2B63G 5EGTA 2MO1A 3T53B 5IP9H 1SE2A 5FLMH 1IBML 5J39A 2LXKA 2GVAA 4R8NA 1X54A 4JBWA 2EZVA 1XMQL 4PZ7A 1SE3A 1ZEQX 1D5ZC 2K5WA 3VR2A 4KY6A 4OIJA 5IYDG 2MO0A 4E6IA 4PG3A 1HFGA 2KA7A 4DR2Q 3DWQA 2VB2X 1E0BA 4KD3A 4JI2Q 1KD1C 1PTOC 1AZPA 1TQOA 1XJVA 1R4PB 2XGTA 2P5ZX 1YHQA 3C46A 4NW2A 1JORA 3U50C 2AQ3B 4A3DH 4DUYL 4BA2I 3RMHA 3D8GA 3SVMA 3H09A 3NXWA 5JJZA 3CCJA 1BBXC 1PVOA 4OO1G 2E2HB 3TRZA 4EX5A 4BY7H 4EQOA 1I4PA 3TSSA 1HR0W 5DAUA 4LF7Q 1KNAA 4G7ZC 5FO9B 3A0JA 1KXLA 3BDLA 2EYHA 3M7GA 4MNOA 1PTOD 1LT5D 5CV8A 4PNYA 1QE6A 4RAUC 5IWAL 1PHJA 2R92G 1CKNA 1HNWQ 1X9NA 1D1KA 4DNTB 3I7FA 4OWWB 4XYQA 3K81C 1I4HA 1DOKA 1VQHA 5M3MG 3MXGA 3S1RH 2HHHL 4L8JA 2O5IC 4A3EG 3QB3A 1SYGA 4GKKQ 5JOBA 1XYIA 4A3KB 5FO7B 3TEHB 1HRJA 1YHAA 3IL8A 1WCMH 4TVAB 4LF4Q 1EYAA 4CDFC 4MHEA 2QDBA 3K59A 1PFSA 1H9RA 4IFDJ 2F0QA 5CV7A 4GZYC 3HGBA 3NEMA 4PMCA 1RL2A 1C0AA 2HD3A 4A93H 3PO2B 2K5VA 3MXUA 1IBLQ 4LJZC 2D0PA 5NUCA 2JA8B 5I2YA 5L37A 4MN3A 4P73A 4P2CB 1EIHA 3HOWB 1KLUD 3H0GH 4B9WA 2RHQB 3V2TA 4Y52H 4K2LA 1SE8A 1PV4A 2K52A 3TDQA 4QUFA 2K04A 1A3VA 2YTYA 3D6WA 1IKMA 4IOAA 1O78A 3AYHB 4LK1C 5LL6S 4B3RL 4RHRA 2J7ZA 4RMFA 2JA5G 4I7ZC 1B9NA 4N8X1 4ZKCB 4DUZQ 1TWAB 2EJGC 2L4NA 4BBRG 5LMUQ 1Y8NB 4HTHA 3S1QB 1BDOA 4LF8L 4QUCA 5M3FB 3RNUA 5LMNW 1SDFA 1ZYRC 4A3JH 1S72A 3A8JE 3U4VA 1ENAA 3HOZG 2K7VA 4HCSA 2AMCB 3NE5B 1N34L 2YU9H 1VQIA 2N78A 4GOPB 2UXDQ 5C5LA 1R4QB 1Y1VH 3E9IA 3J7ZC 5HURA 3KF8A 1D5MC 1L1OB 1EY5A 1GKHA 2Z1CA 5IGGA 2JA6B 3OIPA 1RTNA 1NSNS 3RN5A 1ENFA 3RLNA 3I56A 2IY5B 1S5DD 5C3WA 2X69A 4X66Q 1GUWA 1Z47A 1F2ZA 4IPHA 2CVRA 1EZ6A 4I7AA 4PZ8A 3K5LA 1M4VA 4XDXA 2Y0SB 2PZWA 4J15A 4IUQA 2IPKD 1D5XC 3FMCA 4YHHL 4C2MH 1CZWA 4CDCC 5IIFA 1EFID 5LHY1 3HZXA 5A2QL 3PF4A 2O5JC 1F9QA 4L5SA 1Z9FA 3E0JA 2WAQG 2K03A 2G5DA 5C44B 4JYAQ 3E9HA 3U58A 4IFDI 2JEAI 2MPMA 5IT9c 1N32Q 3D4DA 4OWTB 4C3HG 4JI6Q 2Q8TA 4A3GG 1EU3A 5EJWA 1H9MA 3I4NB 4OL7A 1DGSA 2QF7A 3SGIA 5CC4A 4G7OC 1KAWA 3GV3A 1VQKA 1WTXA 1M1KC 2A6HC 1E1TA 5KGUA 1G91A 4DU9A 1VF5C 4K8JA 3QG1A 3CXCA 4ZYSA 1GOZA 3S24A 1J9OA 1KDCA 2RKSA 2NVTH 1KDAA 4QJFA 2F03A 4ZLTF 1MJEA 3I4MB 3KJOA 3S2DH 4X64L 1KRTA 4X3UA 3PUWA 1DXMA 3TQYA 1VDZA 2SDFA 3G6EA 2K1BA 2QA4A 2EPBA 1XXGA 4JVZA 5C5MA 3T56B 1LTRD 1A3UA 4QIWB 4J6HA 4A3FB 2PMZE 3FVQA 4DV3L 1H9SA 3CHBD 3LGJA 2CHBD 1K0RA 3S15B 2OTJA 4F7XA 5IYCH 5IGCA 2NN6H 2WINB 3JAML 3I91A 1MIUA 4C3IH 3PIPA 4HSVA 4K6LA 4JI7Q 4ALPA 1FJGL 1BUVT 2EJFC 4IOCA 4ODGA 1BCPD 1J8IA 2B2UA 4X6AH 1VQOA 4QMGA 2BE5C 5H1SE 3R8BA 4EQ5A 1BQQT 3BU2A 4KV6A 3TMEA 5D3DA 3LNNA 2K5NA 5K36G 1L0XB 4DR5Q 3S1NH 1NAPA 3E0EA 4RH6A 4QGUA 1WI5A 4O0AA 3JAMi 1WD1A 1PH8A 2WAQE 3GTPH 3NUCA 2R7ZB 2RCNA 1HR0L 4FNFA 2ATWA 1EQQA 3S14H 3HOUB 2BOSA 3ERSX 1EZ8A 4FVMA 2K01A 5EKLA 1QVFA 2E2HH 3NTIA 4TRDA 4KTAA 2K4KA 2A73B 3SR1A 1GUNA 2Z6BA 2OF1A 1HXYD 4A3DB 5BR8Q 1S5FD 3I3CA 2EXDA 1SR3A 1UE6A 3T16A 5F2DA 1K8GA 3CRLC 3T4AC 2E2DC 3AEVA 5I6YA 5C4XG 1QWYA 3KLRA 1RD9D 3NWSA 4QF4A 4N8FA 5I4DA 5ISRA 1JC7A 1JB3A 2B2WA 2EOTA 1LV9A
chains in the Genus database with same CATH topology
2WFWA 3PUZA 2OQ0A 4DNIA 3L7ZC 4A93G 4GLVB 1PH3A 3EN2A 1M90C 2YTXA 2C35B 4GNXA 4X62L 3CP0A 2LSSA 3EIVA 3AFPA 1IBKL 3GD7A 2RF4A 4AQYL 1I5FA 2ZM6L 1J5EQ 3I4NH 4A3CG 5GAEC 2NVQH 1JT8A 4A3KH 2VNUD 1LM0A 5J3BA 2I5LX 3J81j 4DV6L 4A3LG 4ME3A 1D8LA 4DK6C 1V9PA 1TXYA 2OQKA 3GTMH 4LFBL 4UP8A 4A3BG 4X62Q 2MFIA 1HZAA 4DR4L 1IBKQ 4BBSH 3M9BA 2ZM6Q 2PI2E 4AQYQ 2F4VL 3GTJH 1NY4A 1HNXL 3S17H 1X3EA 4R4CA 2PQAB 4DKAC 1XMOQ 3KDFA 1K73C 1KIXA 2Y0SE 2K5HA 2VQFL 2I0QA 5ELNA 2KCTA 2UXCL 4JG2A 2F3IA 3CC4A 3PO2H 2CWPA 4LF9L 3PUYA 4GS3A 4DV6Q 1YJWA 2GVBA 3KFUA 1TWHH 4JI5L 5AJ3Q 2JA7G 5IP7H 3G48A 2WB1G 1U0LA 4LFBQ 4A3JG 2Q2UA 4IFDG 3F8TA 3PO3H 3FKIG 1MJCA 4DV2L 1YHBA 4DV5L 3J81c 3CC7A 3HOWH 1PH1A 4DR4Q 1B8AA 4P71A 3H3VI 2F4VQ 2CKZB 3S2HH 1VQAA 1HNXQ 4GNXC 2YTVA 3F2DA 4POGA 1D7QA 5GAHC 5HY6A 4R4IA 4LUZA 4KHZA 3KYHC 1YNXA 4C3HH 1VQEA 4OWXB 3M4PA 2VQFQ 4HIMA 4LF5L 4NXML 4DV7L 4A3GH 2UXCQ 1Y1VG 1V1QA 4LF9Q 1WFQA 1EWIA 3VDYA 4KI0A 3PUVA 3KJPA 4A3FH 3KF6B 5M5XH 4JI5Q 1HZ9A 3J81i 1S40A 5IY0A 3M4OH 3L0OA 3HOUG 4AIMA 3HKSA 3S15H 2L15A 2QEXA 1GM5A 2Q2TA 4DV5Q 4DV2Q 1A8VA 2BH2A 3S1QH 5C4JH 2D62A 2R7FA 3J80c 5M3FH 3MXNB 4IPDA 5C0XI 4HIDA 1VQDA 1U5KA 5LMNQ 4A3MH 4BY1H 4A3LH 1QVCA 2ZTEA 2BA1A 3K8AA 5E7NA 3CPWA 4IPCA 3WWVA 4LF5Q 4GNXB 4DV7Q 4NXMQ 2EQSA 2D0OA 3GTGH 1EUJA 1V43A 1B7YB 1JMCA 2ES2A 3D0FA 1IL2A 4A76A 4R4OA 4NB3A 5GROA 3J80i 2K14A 1Q12A 1TWFH 1PYSB 1X55A 2JK8A 2KCMA 4Y7NH 4R4TA 3OYYA 3JAMc 3I4OA 4YCWA 4LW1A 4OO1I 4LFAL 1CKNB 4A4IA 3OW2A 3F1ZA 1ASZA 1X65A 4GLAC 3HFZB 2DUDA 2Q2IA 2UXBL 1FGUA 4AH6A 4JI0L 1UWVA 1I94L 1EIYB 4B3TL 1SMXA 3BJUA 2R6GA 3UDGA 1E3PA 4QY7A 4LUOA 4NPSA 2VUMG 2HIXA 4BA1I 4JI2L 2B63G 3KDFB 2MO1A 2E8GA 2E5LL 2N49A 5IP9H 5FLMH 1YI2A 4LFAQ 3CMEA 5JEAG 1IBML 4NXNL 3CD6A 2LXKA 2GVAA 1YVCA 1X54A 4GN5A 4JBWA 1WJJA 3RLOA 4AYBE 1XMQL 4PZ7A 2JA5H 1KQSA 1JJ2A 4BBRH 1KRSA 3NBHB 4HIKA 2NVXH 2KENA 2H5XA 5IYDG 3OTOL 4KHPL 3CCRA 2UXBQ 4JI0Q 2MO0A 1I94Q 2N8NA 4PG3A 5C0XG 4DR2Q 1CUKA 1N8RC 4JI2Q 4DK3C 2CFMA 2WP8J 1HJPA 3HOXG 1KD1C 1XJVA 4A3KG 2XGTA 2E5LQ 1YHQA 2VQEL 3ER0A 2NN6I 1WYDA 3U50C 1IBMQ 1EOVA 2F52A 2E2IH 4NXNQ 1HZBA 4A3DH 4DUYL 3HOZH 4GKJL 4BA2I 1XMQQ 1NE3A 4LF7L 2NVYH 3GTLH 2Z6KA 1PA6A 2R93H 5HGQA 4KHPQ 3CCJA 2CQOA 2CWAA 1VQBA 2K75A 3OTOQ 1R9TH 4OO1G 1PVOA 1SRUA 1RIPA 3FP9A 3RN2A 4L5QA 3TRZA 1HNWL 4EX5A 2IHFA 4XTCS 4BY7H 2VQEQ 4P72A 4JI8L 3CQZH 4LUVA 4DR7L 2MNAA 4A3IH 4UP7A 3W5OA 4DUYQ 3HOVG 1HR0W 2CCZA 1A0IA 4LF7Q 1YIJA 2VL6A 1VQGA 1AE2A 1OXSC 3A0JA 4FDBA 1VQMA 1XMOL 2JA8G 4GKKL 1KXLA 2WB1E 4MNOA 1X6OA 3HOYH 3PO3G 2N3SA 5IWAL 2R92G 1HNWQ 1PHJA 3PIOA 1CKNA 4OXPA 1X9NA 4JV5Q 5AJ3L 3I7FA 1FVIA 4OWWB 1MKHA 3K81C 3RLFA 3ZJYC 4LF4L 2AWNA 1VQHA 4JI8Q 1UE1A 4IO9A 5M3MG 3S1RH 2HHHL 4DR7Q 2BA0A 2RHSB 4A3EG 3HKZG 1Y1WH 1EIFA 2AKWB 1HNZL 4GKKQ 5IYCG 2UUBL 3TEHB 2NN6G 4L5TA 5IE8A 3I4MH 3JC66 5IWAQ 4JCVE 4GOPA 5JJLA 1W3SA 1YHAA 4GLXA 1IBLL 1JB7A 2Z6KC 1Q82C 1WCMH 4UPAA 4A3MG 4TVAB 4LF4Q 1L1OA 5C4XH 5M5YH 2HHHQ 2KBNA 1PFSA 3MEFA 4IFDJ 1BBWA 1HNZQ 3U4ZA 3NEMA 5LMNL 1Y14B 2UUCL 1RL2A 2UUBQ 1TWGH 1N36L 1C0AA 4A93H 2HIVA 2A8VA 1E1OA 2K5VA 1IBLQ 3DM3A 2D0PA 3T1YL 3KLWA 4DUZL 3M7NA 3K7AH 3BZKA 1PH9A 4P73A 4A3CH 5LMUL 1AH9A 2JA6G 1Q1BA 3H0GH 1SN8A 2PNHA 2RHQB 3NELA 1CKMA 4B3ML 1VQNA 1JJCB 1QUQA 3G4SA 2UUCQ 1XTDA 1SE8A 2UU9L 1PV4A 1N36Q 4Y52H 2K52A 3CF5A 2I5MX 1LTLA 1SROA 3K7UC 5EAYA 2YTYA 5GAGC 4DR3L 4MTNA 4IOAA 3AYHB 2IT1A 1Q86C 2HT1A 4B3RL 3UE0A 4A3BH 4BXXG 5FLXc 2V1CC 3T1YQ 4RMFA 2JA5G 3UDIA 1PH7A 4DUZQ 4GOPC 4BBRG 5LMUQ 3G71A 4LF8L 4B3MQ 3ULLA 1L1OC 2UXDL 1N9WA 3I2ZA 3K0XA 4XIGS 5FJ8G 4A75A 3T1HL 2UU9Q 5ELOA 1VQFA 3CAMA 3RNUA 5LMNW 1NJIC 1VQJA 3M85A 2JA7H 1L0WA 2JJQA 3GDEA 4DR3Q 3CW2C 4A3JH 1S72A 3U4VA 3CCSA 4B3RQ 3B6YA 3HOZG 4DR2L 1E24A 1X3GA 3D31A 2AMCB 4X66L 2YU9H 3UDXA 1N34L 1I6HH 1VQIA 2HQLA 2N78A 4LF8Q 5C44G 1VCIA 4GOPB 1PH6A 2R7ZH 2UXDQ 2UUAL 1Y1VH 3E9IA 3J7ZC 3T1HQ 2VY3A 4KLKA 1L1OB 4QQBX 1GKHA 3HOUH 4BY7G 1VQ4A 4GN3B 4LF6L 2ALYB 3F2BA 4OONA 1LUZA 3RN5A 3RLNA 3I56A 2IY5B 1NMFA 1X56A 5C0XJ 3I4NG 4YCUA 3M3YH 4X66Q 1Q8KA 1N34Q 3RR5A 4WJ4A 1Z47A 4DAMA 4YCVA 4JI1L 2UUAQ 4IPHA 1LYLA 1CSQA 1Q1EA 2OWOA 1KHIA 4PZ8A 3A5UA 2OCEA 2Q2HA 1XNQL 1G6PA 4LF6Q 4DR6L 5DLQE 1K3RA 4J15A 4R1JA 2A1AA 4JOIC 3TS0A 4JYAL 4DV1L 4BBSG 1QUQB 4YHHL 3HKZE 1S3OA 1VQ5A 4UY8C 4JV5L 4POFA 4C2MH 1UEBA 1A62A 2KHJA 4DPGA 1QZGA 1N32L 1WOCA 2K50A 1C7YA 5GQOA 4JI1Q 1Q46A 1E7ZA 2FXQA 3PO2G 3GO5A 5IYBH 2QGQA 1PH5A 1JJGA 3PF4A 4WJ3M 2LXJA 5IP7G 1VQ8A 1L2FA 4L5SA 1Z9FA 2WAQG 1XNQQ 1BVSA 3A74A 4DR6Q 3GTOH 2EIFA 3RZOH 3E9HA 3HOWG 4JYAQ 4R4QA 3EBEA 4PZ6A 3STBD 3U58A 4MZ9A 4DV1Q 4YHHQ 1VQ9A 4IFDI 2B29A 4OX9L 2JEAI 5IT9c 4O2DA 1N32Q 4DV4L 3S16H 4OWTB 4JI6Q 4K0KL 1XNRL 4A3GG 3Q8DA 4IPGA 3TS2A 4A3FG 5C3EH 5IYDH 1YZ6A 3PV0A 2BH8A 3BZCA 1DGSA 2NZOA 2ID0A 3GTKH 4DV0L 1KC8C 3HOXH 3M4QA 3SGIA 3CC2A 1KAWA 4GKJQ 3H0GG 1VQKA 1M1KC 5M3FG 4BY1G 1E1TA 1GVPA 1C9OA 1P8LA 3KF8B 3CCEA 2AHOB 4OX9Q 2JEBI 3UDFA 4DV4Q 1I50H 3PCOB 1BBUA 4K0KQ 1XNRQ 1G291 1CSPA 3NENA 3CXCA 3TREA 4TQUS 1AE3A 3PSIA 1N33L 3S24A 3IRBA 1JE5A 2YV5A 3FHWA 2NVTH 1KL9A 4DV0Q 3W1GA 2DGYA 1CKOA 4IJHA 4QJFA 5JJKA 1MJEA 1I3QH 3I55A 3KJOA 3S2DH 4X64L 1KRTA 1YBYA 4JBJA 3PUWA 1EFWA 3TQYA 3ULPA 4HJAA 3HOVH 1YEZA 1GO3E 1HZCA 2PI2A 4DAYB 1NBWA 4YY3L 1O7IA 3G6EA 1X3FA 2JA8H 1VQPA 2XTIA 2QA4A 3H15A 3CCVA 4H02A 1N33Q 1Q7YC 5M5WH 2E2JH 1P16A 4HJ8A 2ZJRA 1ASYA 2R92H 4B3SL 3S1MH 1XPRA 4C3JH 3CCLA 1G51A 3PUXA 4JI7L 4X64Q 5IP9G 5FLMG 2GN5A 2R7ZG 3ULJA 5M3MH 2PMZE 3GTQH 4LFCL 4DV3L 2B3GA 4A3EH 3LGJA 1K0RA 4YY3Q 2NZHA 2OTJA 2Y0SG 5IYCH 4P74A 1TWAH 1NTGA 1SLJA 1T9HA 4B3SQ 1MIUA 4JOIA 4C3IH 1OXXK 3PIPA 3CCMA 2YYZA 1VQ7A 4JBMA 2A19A 4JI7Q 4ALPA 1FJGL 4GN4B 2AWOA 4DR5L 1YITA 3AFQA 3DLLA 4IOCA 4A3DG 3ICEA 1Q81C 4LFCQ 3FKIH 1FL0A 4DV3Q 4DR1L 1SFOH 1IXRA 2VW9A 1E22A 1YJNA 2KHIA 1XPUA 2IHEA 3CCQA 2ASBA 1VQOA 4X6AH 4JBKA 2R93G 2ZTDA 5H1SE 3CMAA 4APVA 4EQ5A 3CCUA 1QZHA 1OXUA 3BU2A 3W1BA 4HJ5A 5JEAJ 1OTCA 1H95A 1TWCH 2K5NA 1VQLA 2IX1A 2R7DA 5K36G 1FJGQ 4X65L 2ZTCA 4DR5Q 4YWMA 3F2CA 2OTLA 4JI4L 3S1NH 1GD7A 3E0EA 4JC0A 4A3IG 2I5HA 4RG1A 5IYBG 4DR1Q 1EYGA 4QGUA 2JA6H 2ZJPA 1WI5A 4HJ9A 4O0AA 3CPFA 3JAMi 3KOJA 1UE5A 1PH8A 1A63A 2WAQE 3STBC 3GTPH 2MQHA 2PQAA 1K8AC 2RCNA 4UP9A 1J6QA 4HIOA 1PYBA 3HOYG 5BR8L 5GADC 1PH4A 2IX0A 2VZAA 1HR0L 5JJIA 4L5RC 3RZDH 2ATWA 1EQQA 4BXXH 1NMGA 2JQOA 4YWLA 1K9MC 4X65Q 3S14H 4JI4Q 3UE1A 4IJLA 1OXTA 4PMWA 1PH2A 3ERSX 1B70B 1VS0A 1EQRA 2Z0SA 1OXVA 3A5ZB 4LWCA 4QIWE 5C3EG 3PF5A 1Y1WG 1QVFA 4P75A 2E2HH 4B3TQ 3J7A5 4JI3L 5FJ8H 1IYJB 1BKBA 2K4KA 1K83H 4YWKA 4JI6L 1VQ6A 3I4MG 3L2PA 5BR8Q 2JA9A 2EXDA 1QVGA 1W2BA 1SR3A 1UE6A 1UE7A 1HR0Q 1K8GA 4LNQA 3H3VH 1WCMG 1YJ9A 3KF6A 3AEVA 4HJ7A 5C4XG 4QL5A 1VQCA 2VUMH 2B63H 1J5EL 2JE6I 2VS1A 1HH2P 1IZ6A 5C44H 3K80C 3PGZA 4JI3Q 1XPOA 3AQQA 4AYBG 2ZJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WFW A;  3PUZ A;  2OQ0 A;  4DNI A;  3L7Z C;  4A93 G;  4GLV B;  1PH3 A;  3EN2 A;  1M90 C;  2YTX A;  2C35 B;  4GNX A;  4X62 L;  3CP0 A;  2LSS A;  3EIV A;  3AFP A;  1IBK L;  3GD7 A;  2RF4 A;  4AQY L;  1I5F A;  2ZM6 L;  1J5E Q;  3I4N H;  4A3C G;  5GAE C;  2NVQ H;  1JT8 A;  4A3K H;  2VNU D;  1LM0 A;  5J3B A;  2I5L X;  3J81 j;  4DV6 L;  4A3L G;  4ME3 A;  1D8L A;  4DK6 C;  1V9P A;  1TXY A;  2OQK A;  3GTM H;  4LFB L;  4UP8 A;  4A3B G;  4X62 Q;  2MFI A;  1HZA A;  4DR4 L;  1IBK Q;  4BBS H;  3M9B A;  2ZM6 Q;  2PI2 E;  4AQY Q;  2F4V L;  3GTJ H;  1NY4 A;  1HNX L;  3S17 H;  1X3E A;  4R4C A;  2PQA B;  4DKA C;  1XMO Q;  3KDF A;  1K73 C;  1KIX A;  2Y0S E;  2K5H A;  2VQF L;  2I0Q A;  5ELN A;  2KCT A;  2UXC L;  4JG2 A;  2F3I A;  3CC4 A;  3PO2 H;  2CWP A;  4LF9 L;  3PUY A;  4GS3 A;  4DV6 Q;  1YJW A;  2GVB A;  3KFU A;  1TWH H;  4JI5 L;  5AJ3 Q;  2JA7 G;  5IP7 H;  3G48 A;  2WB1 G;  1U0L A;  4LFB Q;  4A3J G;  2Q2U A;  4IFD G;  3F8T A;  3PO3 H;  3FKI G;  1MJC A;  4DV2 L;  1YHB A;  4DV5 L;  3J81 c;  3CC7 A;  3HOW H;  1PH1 A;  4DR4 Q;  1B8A A;  4P71 A;  3H3V I;  2F4V Q;  2CKZ B;  3S2H H;  1VQA A;  1HNX Q;  4GNX C;  2YTV A;  3F2D A;  4POG A;  1D7Q A;  5GAH C;  5HY6 A;  4R4I A;  4LUZ A;  4KHZ A;  3KYH C;  1YNX A;  4C3H H;  1VQE A;  4OWX B;  3M4P A;  2VQF Q;  4HIM A;  4LF5 L;  4NXM L;  4DV7 L;  4A3G H;  2UXC Q;  1Y1V G;  1V1Q A;  4LF9 Q;  1WFQ A;  1EWI A;  3VDY A;  4KI0 A;  3PUV A;  3KJP A;  4A3F H;  3KF6 B;  5M5X H;  4JI5 Q;  1HZ9 A;  3J81 i;  1S40 A;  5IY0 A;  3M4O H;  3L0O A;  3HOU G;  4AIM A;  3HKS A;  3S15 H;  2L15 A;  2QEX A;  1GM5 A;  2Q2T A;  4DV5 Q;  4DV2 Q;  1A8V A;  2BH2 A;  3S1Q H;  5C4J H;  2D62 A;  2R7F A;  3J80 c;  5M3F H;  3MXN B;  4IPD A;  5C0X I;  4HID A;  1VQD A;  1U5K A;  5LMN Q;  4A3M H;  4BY1 H;  4A3L H;  1QVC A;  2ZTE A;  2BA1 A;  3K8A A;  5E7N A;  3CPW A;  4IPC A;  3WWV A;  4LF5 Q;  4GNX B;  4DV7 Q;  4NXM Q;  2EQS A;  2D0O A;  3GTG H;  1EUJ A;  1V43 A;  1B7Y B;  1JMC A;  2ES2 A;  3D0F A;  1IL2 A;  4A76 A;  4R4O A;  4NB3 A;  5GRO A;  3J80 i;  2K14 A;  1Q12 A;  1TWF H;  1PYS B;  1X55 A;  2JK8 A;  2KCM A;  4Y7N H;  4R4T A;  3OYY A;  3JAM c;  3I4O A;  4YCW A;  4LW1 A;  4OO1 I;  4LFA L;  1CKN B;  4A4I A;  3OW2 A;  3F1Z A;  1ASZ A;  1X65 A;  4GLA C;  3HFZ B;  2DUD A;  2Q2I A;  2UXB L;  1FGU A;  4AH6 A;  4JI0 L;  1UWV A;  1I94 L;  1EIY B;  4B3T L;  1SMX A;  3BJU A;  2R6G A;  3UDG A;  1E3P A;  4QY7 A;  4LUO A;  4NPS A;  2VUM G;  2HIX A;  4BA1 I;  4JI2 L;  2B63 G;  3KDF B;  2MO1 A;  2E8G A;  2E5L L;  2N49 A;  5IP9 H;  5FLM H;  1YI2 A;  4LFA Q;  3CME A;  5JEA G;  1IBM L;  4NXN L;  3CD6 A;  2LXK A;  2GVA A;  1YVC A;  1X54 A;  4GN5 A;  4JBW A;  1WJJ A;  3RLO A;  4AYB E;  1XMQ L;  4PZ7 A;  2JA5 H;  1KQS A;  1JJ2 A;  4BBR H;  1KRS A;  3NBH B;  4HIK A;  2NVX H;  2KEN A;  2H5X A;  5IYD G;  3OTO L;  4KHP L;  3CCR A;  2UXB Q;  4JI0 Q;  2MO0 A;  1I94 Q;  2N8N A;  4PG3 A;  5C0X G;  4DR2 Q;  1CUK A;  1N8R C;  4JI2 Q;  4DK3 C;  2CFM A;  2WP8 J;  1HJP A;  3HOX G;  1KD1 C;  1XJV A;  4A3K G;  2XGT A;  2E5L Q;  1YHQ A;  2VQE L;  3ER0 A;  2NN6 I;  1WYD A;  3U50 C;  1IBM Q;  1EOV A;  2F52 A;  2E2I H;  4NXN Q;  1HZB A;  4A3D H;  4DUY L;  3HOZ H;  4GKJ L;  4BA2 I;  1XMQ Q;  1NE3 A;  4LF7 L;  2NVY H;  3GTL H;  2Z6K A;  1PA6 A;  2R93 H;  5HGQ A;  4KHP Q;  3CCJ A;  2CQO A;  2CWA A;  1VQB A;  2K75 A;  3OTO Q;  1R9T H;  4OO1 G;  1PVO A;  1SRU A;  1RIP A;  3FP9 A;  3RN2 A;  4L5Q A;  3TRZ A;  1HNW L;  4EX5 A;  2IHF A;  4XTC S;  4BY7 H;  2VQE Q;  4P72 A;  4JI8 L;  3CQZ H;  4LUV A;  4DR7 L;  2MNA A;  4A3I H;  4UP7 A;  3W5O A;  4DUY Q;  3HOV G;  1HR0 W;  2CCZ A;  1A0I A;  4LF7 Q;  1YIJ A;  2VL6 A;  1VQG A;  1AE2 A;  1OXS C;  3A0J A;  4FDB A;  1VQM A;  1XMO L;  2JA8 G;  4GKK L;  1KXL A;  2WB1 E;  4MNO A;  1X6O A;  3HOY H;  3PO3 G;  2N3S A;  5IWA L;  2R92 G;  1HNW Q;  1PHJ A;  3PIO A;  1CKN A;  4OXP A;  1X9N A;  4JV5 Q;  5AJ3 L;  3I7F A;  1FVI A;  4OWW B;  1MKH A;  3K81 C;  3RLF A;  3ZJY C;  4LF4 L;  2AWN A;  1VQH A;  4JI8 Q;  1UE1 A;  4IO9 A;  5M3M G;  3S1R H;  2HHH L;  4DR7 Q;  2BA0 A;  2RHS B;  4A3E G;  3HKZ G;  1Y1W H;  1EIF A;  2AKW B;  1HNZ L;  4GKK Q;  5IYC G;  2UUB L;  3TEH B;  2NN6 G;  4L5T A;  5IE8 A;  3I4M H;  3JC6 6;  5IWA Q;  4JCV E;  4GOP A;  5JJL A;  1W3S A;  1YHA A;  4GLX A;  1IBL L;  1JB7 A;  2Z6K C;  1Q82 C;  1WCM H;  4UPA A;  4A3M G;  4TVA B;  4LF4 Q;  1L1O A;  5C4X H;  5M5Y H;  2HHH Q;  2KBN A;  1PFS A;  3MEF A;  4IFD J;  1BBW A;  1HNZ Q;  3U4Z A;  3NEM A;  5LMN L;  1Y14 B;  2UUC L;  1RL2 A;  2UUB Q;  1TWG H;  1N36 L;  1C0A A;  4A93 H;  2HIV A;  2A8V A;  1E1O A;  2K5V A;  1IBL Q;  3DM3 A;  2D0P A;  3T1Y L;  3KLW A;  4DUZ L;  3M7N A;  3K7A H;  3BZK A;  1PH9 A;  4P73 A;  4A3C H;  5LMU L;  1AH9 A;  2JA6 G;  1Q1B A;  3H0G H;  1SN8 A;  2PNH A;  2RHQ B;  3NEL A;  1CKM A;  4B3M L;  1VQN A;  1JJC B;  1QUQ A;  3G4S A;  2UUC Q;  1XTD A;  1SE8 A;  2UU9 L;  1PV4 A;  1N36 Q;  4Y52 H;  2K52 A;  3CF5 A;  2I5M X;  1LTL A;  1SRO A;  3K7U C;  5EAY A;  2YTY A;  5GAG C;  4DR3 L;  4MTN A;  4IOA A;  3AYH B;  2IT1 A;  1Q86 C;  2HT1 A;  4B3R L;  3UE0 A;  4A3B H;  4BXX G;  5FLX c;  2V1C C;  3T1Y Q;  4RMF A;  2JA5 G;  3UDI A;  1PH7 A;  4DUZ Q;  4GOP C;  4BBR G;  5LMU Q;  3G71 A;  4LF8 L;  4B3M Q;  3ULL A;  1L1O C;  2UXD L;  1N9W A;  3I2Z A;  3K0X A;  4XIG S;  5FJ8 G;  4A75 A;  3T1H L;  2UU9 Q;  5ELO A;  1VQF A;  3CAM A;  3RNU A;  5LMN W;  1NJI C;  1VQJ A;  3M85 A;  2JA7 H;  1L0W A;  2JJQ A;  3GDE A;  4DR3 Q;  3CW2 C;  4A3J H;  1S72 A;  3U4V A;  3CCS A;  4B3R Q;  3B6Y A;  3HOZ G;  4DR2 L;  1E24 A;  1X3G A;  3D31 A;  2AMC B;  4X66 L;  2YU9 H;  3UDX A;  1N34 L;  1I6H H;  1VQI A;  2HQL A;  2N78 A;  4LF8 Q;  5C44 G;  1VCI A;  4GOP B;  1PH6 A;  2R7Z H;  2UXD Q;  2UUA L;  1Y1V H;  3E9I A;  3J7Z C;  3T1H Q;  2VY3 A;  4KLK A;  1L1O B;  4QQB X;  1GKH A;  3HOU H;  4BY7 G;  1VQ4 A;  4GN3 B;  4LF6 L;  2ALY B;  3F2B A;  4OON A;  1LUZ A;  3RN5 A;  3RLN A;  3I56 A;  2IY5 B;  1NMF A;  1X56 A;  5C0X J;  3I4N G;  4YCU A;  3M3Y H;  4X66 Q;  1Q8K A;  1N34 Q;  3RR5 A;  4WJ4 A;  1Z47 A;  4DAM A;  4YCV A;  4JI1 L;  2UUA Q;  4IPH A;  1LYL A;  1CSQ A;  1Q1E A;  2OWO A;  1KHI A;  4PZ8 A;  3A5U A;  2OCE A;  2Q2H A;  1XNQ L;  1G6P A;  4LF6 Q;  4DR6 L;  5DLQ E;  1K3R A;  4J15 A;  4R1J A;  2A1A A;  4JOI C;  3TS0 A;  4JYA L;  4DV1 L;  4BBS G;  1QUQ B;  4YHH L;  3HKZ E;  1S3O A;  1VQ5 A;  4UY8 C;  4JV5 L;  4POF A;  4C2M H;  1UEB A;  1A62 A;  2KHJ A;  4DPG A;  1QZG A;  1N32 L;  1WOC A;  2K50 A;  1C7Y A;  5GQO A;  4JI1 Q;  1Q46 A;  1E7Z A;  2FXQ A;  3PO2 G;  3GO5 A;  5IYB H;  2QGQ A;  1PH5 A;  1JJG A;  3PF4 A;  4WJ3 M;  2LXJ A;  5IP7 G;  1VQ8 A;  1L2F A;  4L5S A;  1Z9F A;  2WAQ G;  1XNQ Q;  1BVS A;  3A74 A;  4DR6 Q;  3GTO H;  2EIF A;  3RZO H;  3E9H A;  3HOW G;  4JYA Q;  4R4Q A;  3EBE A;  4PZ6 A;  3STB D;  3U58 A;  4MZ9 A;  4DV1 Q;  4YHH Q;  1VQ9 A;  4IFD I;  2B29 A;  4OX9 L;  2JEA I;  5IT9 c;  4O2D A;  1N32 Q;  4DV4 L;  3S16 H;  4OWT B;  4JI6 Q;  4K0K L;  1XNR L;  4A3G G;  3Q8D A;  4IPG A;  3TS2 A;  4A3F G;  5C3E H;  5IYD H;  1YZ6 A;  3PV0 A;  2BH8 A;  3BZC A;  1DGS A;  2NZO A;  2ID0 A;  3GTK H;  4DV0 L;  1KC8 C;  3HOX H;  3M4Q A;  3SGI A;  3CC2 A;  1KAW A;  4GKJ Q;  3H0G G;  1VQK A;  1M1K C;  5M3F G;  4BY1 G;  1E1T A;  1GVP A;  1C9O A;  1P8L A;  3KF8 B;  3CCE A;  2AHO B;  4OX9 Q;  2JEB I;  3UDF A;  4DV4 Q;  1I50 H;  3PCO B;  1BBU A;  4K0K Q;  1XNR Q;  1G29 1;  1CSP A;  3NEN A;  3CXC A;  3TRE A;  4TQU S;  1AE3 A;  3PSI A;  1N33 L;  3S24 A;  3IRB A;  1JE5 A;  2YV5 A;  3FHW A;  2NVT H;  1KL9 A;  4DV0 Q;  3W1G A;  2DGY A;  1CKO A;  4IJH A;  4QJF A;  5JJK A;  1MJE A;  1I3Q H;  3I55 A;  3KJO A;  3S2D H;  4X64 L;  1KRT A;  1YBY A;  4JBJ A;  3PUW A;  1EFW A;  3TQY A;  3ULP A;  4HJA A;  3HOV H;  1YEZ A;  1GO3 E;  1HZC A;  2PI2 A;  4DAY B;  1NBW A;  4YY3 L;  1O7I A;  3G6E A;  1X3F A;  2JA8 H;  1VQP A;  2XTI A;  2QA4 A;  3H15 A;  3CCV A;  4H02 A;  1N33 Q;  1Q7Y C;  5M5W H;  2E2J H;  1P16 A;  4HJ8 A;  2ZJR A;  1ASY A;  2R92 H;  4B3S L;  3S1M H;  1XPR A;  4C3J H;  3CCL A;  1G51 A;  3PUX A;  4JI7 L;  4X64 Q;  5IP9 G;  5FLM G;  2GN5 A;  2R7Z G;  3ULJ A;  5M3M H;  2PMZ E;  3GTQ H;  4LFC L;  4DV3 L;  2B3G A;  4A3E H;  3LGJ A;  1K0R A;  4YY3 Q;  2NZH A;  2OTJ A;  2Y0S G;  5IYC H;  4P74 A;  1TWA H;  1NTG A;  1SLJ A;  1T9H A;  4B3S Q;  1MIU A;  4JOI A;  4C3I H;  1OXX K;  3PIP A;  3CCM A;  2YYZ A;  1VQ7 A;  4JBM A;  2A19 A;  4JI7 Q;  4ALP A;  1FJG L;  4GN4 B;  2AWO A;  4DR5 L;  1YIT A;  3AFQ A;  3DLL A;  4IOC A;  4A3D G;  3ICE A;  1Q81 C;  4LFC Q;  3FKI H;  1FL0 A;  4DV3 Q;  4DR1 L;  1SFO H;  1IXR A;  2VW9 A;  1E22 A;  1YJN A;  2KHI A;  1XPU A;  2IHE A;  3CCQ A;  2ASB A;  1VQO A;  4X6A H;  4JBK A;  2R93 G;  2ZTD A;  5H1S E;  3CMA A;  4APV A;  4EQ5 A;  3CCU A;  1QZH A;  1OXU A;  3BU2 A;  3W1B A;  4HJ5 A;  5JEA J;  1OTC A;  1H95 A;  1TWC H;  2K5N A;  1VQL A;  2IX1 A;  2R7D A;  5K36 G;  1FJG Q;  4X65 L;  2ZTC A;  4DR5 Q;  4YWM A;  3F2C A;  2OTL A;  4JI4 L;  3S1N H;  1GD7 A;  3E0E A;  4JC0 A;  4A3I G;  2I5H A;  4RG1 A;  5IYB G;  4DR1 Q;  1EYG A;  4QGU A;  2JA6 H;  2ZJP A;  1WI5 A;  4HJ9 A;  4O0A A;  3CPF A;  3JAM i;  3KOJ A;  1UE5 A;  1PH8 A;  1A63 A;  2WAQ E;  3STB C;  3GTP H;  2MQH A;  2PQA A;  1K8A C;  2RCN A;  4UP9 A;  1J6Q A;  4HIO A;  1PYB A;  3HOY G;  5BR8 L;  5GAD C;  1PH4 A;  2IX0 A;  2VZA A;  1HR0 L;  5JJI A;  4L5R C;  3RZD H;  2ATW A;  1EQQ A;  4BXX H;  1NMG A;  2JQO A;  4YWL A;  1K9M C;  4X65 Q;  3S14 H;  4JI4 Q;  3UE1 A;  4IJL A;  1OXT A;  4PMW A;  1PH2 A;  3ERS X;  1B70 B;  1VS0 A;  1EQR A;  2Z0S A;  1OXV A;  3A5Z B;  4LWC A;  4QIW E;  5C3E G;  3PF5 A;  1Y1W G;  1QVF A;  4P75 A;  2E2H H;  4B3T Q;  3J7A 5;  4JI3 L;  5FJ8 H;  1IYJ B;  1BKB A;  2K4K A;  1K83 H;  4YWK A;  4JI6 L;  1VQ6 A;  3I4M G;  3L2P A;  5BR8 Q;  2JA9 A;  2EXD A;  1QVG A;  1W2B A;  1SR3 A;  1UE6 A;  1UE7 A;  1HR0 Q;  1K8G A;  4LNQ A;  3H3V H;  1WCM G;  1YJ9 A;  3KF6 A;  3AEV A;  4HJ7 A;  5C4X G;  4QL5 A;  1VQC A;  2VUM H;  2B63 H;  1J5E L;  2JE6 I;  2VS1 A;  1HH2 P;  1IZ6 A;  5C44 H;  3K80 C;  3PGZ A;  4JI3 Q;  1XPO A;  3AQQ A;  4AYB G;  2ZJQ A; 
#chains in the Genus database with same CATH topology
 2WFW A;  5JPN C;  3L7Z C;  1M90 C;  3ERQ A;  4TKO B;  3CP0 A;  4JW0 A;  5EBD A;  5C0X H;  3EIV A;  3AFP A;  3ERO A;  4BS9 A;  1I5F A;  2ZM6 L;  3KUP A;  3GTO B;  2NVQ H;  4A3K H;  4EQP A;  4QB4 A;  4C3J G;  3S1R B;  1AEX A;  1LTS D;  1QNK A;  1E2V A;  4LFB L;  1TXY A;  3GTM H;  4F88 A;  5C3E B;  1HA6 A;  1AP0 A;  4X62 Q;  2MFI A;  2DN8 A;  2KEE A;  3GTK B;  2PI2 E;  1HNX L;  1NY4 A;  1XMO Q;  5E4W C;  3IFT A;  1WCM B;  4EGV A;  2UXC L;  3PO2 H;  2CWP A;  2CW0 C;  3TP8 A;  2JA7 G;  1MI2 A;  2R3Z A;  2WB1 G;  4ZCK A;  2Q2U A;  2L1B A;  2PW5 A;  3F8T A;  3FKI G;  4DR4 Q;  5J22 A;  1YHB A;  1SYF A;  3HOW H;  4IZ8 A;  4AYB B;  1G8Z D;  2KEC A;  1B8A A;  1PH1 A;  2CKZ B;  3S2H H;  1VQA A;  4A93 B;  5GAH C;  2VQF Q;  1VQE A;  4NXM L;  2XWJ B;  1WTQ A;  1TII D;  1V1Q A;  5ELC A;  4EVO A;  1EWI A;  1JWM D;  3KJP A;  5M5X H;  5FLX L;  1B1Z A;  1DON A;  2D2C C;  2Q2T A;  4FYD A;  1NR2 A;  2I46 A;  3MTS A;  4DV2 Q;  1A8V A;  3S1Q H;  5C4J H;  3J80 c;  5M3F H;  3C1E A;  2CW0 D;  3K8A A;  4LF5 Q;  3MXP A;  4IPC A;  1SEB D;  5M3M B;  1EUJ A;  3D0F A;  4A76 A;  4R4O A;  5GRO A;  5E4X A;  2OEO A;  1DCZ A;  3D3R A;  3I4O A;  3A56 A;  4R9W A;  3OW2 A;  1X65 A;  5EBC A;  3TN2 A;  1CZG A;  4KY5 A;  4B3T L;  3FEW X;  4Z9C B;  1E3P A;  4LUO A;  2YU9 B;  1DOM A;  2HIX A;  1ROD A;  4JI2 L;  1W6K A;  1Y1V B;  4HMI A;  1B44 D;  5JEA G;  1GUT A;  4GN5 A;  1CQF A;  1WJJ A;  1LTI D;  3DXJ C;  1KAA A;  1JJ2 A;  2HCC A;  1KRS A;  2NVX H;  2KEN A;  2H5X A;  2UXB Q;  2MUY A;  1I94 Q;  3A8K E;  1WD0 A;  1CUK A;  5JVG 3;  1GHK A;  1XWE A;  2BDN A;  2CFM A;  2WP8 J;  4DGZ A;  3HOX G;  2HUG A;  3H3V C;  2NN6 I;  1F2L A;  1EOV A;  2F52 A;  4NXN Q;  5IGD A;  5A2Q E;  1BXT A;  2DY7 A;  4LF7 L;  3A55 A;  4FF1 A;  2CQO A;  3OTO Q;  1X3P A;  3U9S A;  1HNW L;  4KN7 C;  2C5C A;  2F0D A;  1AW7 A;  4XTC S;  2VQE Q;  1PTO B;  4LUV A;  4A3I H;  1WTR A;  4KKS A;  3HOV G;  1PZI D;  2CCZ A;  1YIJ A;  1AE2 A;  4GKK L;  2WB1 E;  5IOC A;  1X6O A;  4HN7 A;  1JIC A;  3SK8 A;  4JV5 Q;  5AJ3 L;  1FVI A;  3ZJY C;  3RLF A;  4LF4 L;  4B9X A;  1SND A;  2BA0 A;  2XSC A;  3I90 A;  1OO9 B;  1UNS A;  2EDG A;  4OEL B;  1IKL A;  1PRT D;  3I4M H;  2RDG A;  4JCV E;  4GOP A;  2F0K A;  2Z4I A;  1IBL L;  5D14 A;  2Z6K C;  4G57 A;  1SYE A;  1L1O A;  1RDP D;  1GJX A;  3MEF A;  2NVT B;  1BF4 A;  2EYM A;  1MSH A;  3S2D B;  1TWG H;  3ND9 A;  3DM3 A;  4O1N A;  3N6R A;  1JOO A;  3FDT A;  4DUZ L;  3M7N A;  5BN5 A;  2EY5 A;  3PO3 B;  1A2U A;  5LMU L;  1AH9 A;  3QR8 A;  3JAM E;  1UEA B;  1CKM A;  3NEL A;  1EEF D;  4DA2 A;  2TMP A;  2UUC Q;  1SYB A;  4CJ1 B;  1N36 Q;  5KND A;  2I5M X;  2J0T D;  3DM1 A;  5GAG C;  2PZT A;  3IKJ A;  3E5S A;  2IT1 A;  3HKZ B;  4BXX G;  4ZRZ A;  3M4O B;  2F0G A;  5AFW A;  3OSO A;  3G71 A;  4C3I B;  1A3T A;  2ZXP A;  1EYD A;  2JXM B;  3K0X A;  3I2Z A;  2UXD L;  4A3M B;  2UU9 Q;  1BCP F;  2IX3 A;  2B8G A;  1VQF A;  4H0L C;  3Q0A A;  3CAM A;  1HUM A;  4RGT A;  4IFD H;  5EKI A;  3B6Y A;  2K33 A;  3OPO A;  2KJX A;  3Q23 A;  2QDL A;  1TWF B;  4Y7N B;  4K2K A;  4X66 L;  1EIG A;  3UDX A;  1I6H H;  1VCI A;  4O42 A;  4WRD A;  2R7Z H;  1O7Z A;  2F0H A;  1G2T A;  1JOQ A;  2GA4 B;  1LTT D;  2VY3 A;  4KLK A;  3NBI A;  3S1N B;  3HOU H;  4BY7 G;  4GN3 B;  4V0B A;  5IOD A;  4OON A;  1PXU A;  2BCO A;  1SJE D;  1NMF A;  1LLR D;  1PYW D;  3GTP B;  3M3Y H;  3D4R A;  4YCV A;  2HQE A;  1STG A;  3S14 B;  1CSQ A;  1KHI A;  1X32 A;  1KAB A;  1G6P A;  4LF6 Q;  3URY A;  5DLQ E;  4JYA L;  3R2I A;  2E76 C;  2KVM A;  4BBS G;  1QUQ B;  1B9M A;  1STE A;  1S3O A;  1QZG A;  2RDH A;  1N32 L;  1M8A A;  1ENC A;  4JI1 Q;  1E7Z A;  1JJG A;  4PMB A;  3OOC A;  4K14 A;  1XNQ Q;  1BVS A;  1CHQ D;  3GTO H;  3L9A X;  4NP5 A;  5JAV A;  5I9O A;  4DV1 Q;  2E75 C;  1VQ9 A;  4KHV A;  3PIP 3;  5KYL A;  1HTP A;  1HUN A;  3CQZ B;  2L5T A;  5IYD H;  5C3E H;  1YZ6 A;  3PV0 A;  4Q5V A;  2NZO A;  3J7A V;  2NVQ B;  3GTK H;  5COY A;  1KC8 C;  5CBA E;  4ZK9 B;  4ID6 A;  2WKC A;  4H7B A;  1EWC A;  1X3Q A;  4GKJ Q;  2B2V C;  3H0G G;  1JCK B;  1STN A;  4BY1 G;  1TU2 B;  3I70 A;  1GVP A;  1C9O A;  3CCE A;  4OX9 Q;  2JEB I;  4DV4 Q;  3GTM B;  4K0K Q;  1XNR Q;  3NEN A;  4TQU S;  3EA6 A;  3QOL A;  1L0Y B;  1DOL A;  3CKI B;  3NQI A;  4DV0 Q;  2DGY A;  1CKO A;  1ONL A;  1I3Q H;  3I55 A;  2B2T A;  2XRQ D;  4JBJ A;  1I4G A;  4B08 A;  1HZC A;  5C4X B;  3U9O A;  2PO4 A;  4CKE A;  5FLX E;  2Q8R E;  1O7I A;  5M5Y B;  1WTV A;  1X3F A;  1VQP A;  2XTI A;  1WTO A;  1BOS A;  2LY7 A;  3CCV A;  1ICF B;  4H02 A;  1Q7Y C;  1N33 Q;  4HJ8 A;  4UHV A;  2ZJR A;  3S2H B;  2R92 H;  1QOH A;  1TS4 A;  2NYZ D;  3S1M H;  5C6A A;  3CCL A;  4JI7 L;  3GV6 A;  5M3M H;  4DK1 A;  1STY A;  5M5X B;  3GTQ H;  5BN4 A;  4A3E H;  5CV9 A;  1MGS A;  2O2L D;  4KJN A;  4P74 A;  5C4J B;  1NCV A;  2TSS A;  4B3S Q;  1PMR A;  2E74 C;  4JOI A;  3IAY A;  3KK7 A;  3SE0 A;  3CCM A;  2MGS A;  2A19 A;  1PFN A;  4CBV A;  2F0V A;  2AWO A;  4DR5 L;  1YIT A;  4I65 A;  3DLL A;  1KDB A;  1Q81 C;  4LFC Q;  2VW9 A;  1YJN A;  2KHI A;  3CCQ A;  2G9D A;  2R93 G;  1I6V C;  1S4Z A;  1U4M A;  4APV A;  1LT4 D;  3K6O A;  4HJ5 A;  4JPB W;  2M2L A;  3QWN A;  3PIO 3;  1OTC A;  1VQL A;  3NSW A;  4ILW A;  2OTL A;  4JC0 A;  1UUP A;  1EYG A;  4DR1 Q;  2RCF A;  1A63 A;  3CRK C;  2MQH A;  1MHW C;  3HOY G;  1J6Q A;  1PYB A;  5BR8 L;  5M9O A;  1QG7 A;  1B4O A;  5JJI A;  2XN9 C;  3SHL A;  2JQO A;  2NVX B;  4X65 Q;  4JI4 Q;  3UE1 A;  3QJY A;  5DM6 3;  1VS0 A;  2Z0S A;  1EQR A;  3PF5 A;  4LWC A;  3K5N A;  1Y1W G;  4HED A;  4P75 A;  2ENB A;  3QOJ A;  3SK4 A;  1TR5 A;  1SNQ A;  1IYJ B;  1BKB A;  2L0C A;  3G6J B;  4YWK A;  1ET9 A;  1VQ6 A;  3BYY B;  1PLF A;  4LNQ A;  1PTO H;  1UE7 A;  1DZ1 A;  4MIU A;  1YJ9 A;  1GUS A;  1Y8O B;  4HJ7 A;  1TS5 A;  3NWT A;  4G7H C;  2WV6 D;  3OW7 A;  1HH2 P;  2PPB C;  1FNU A;  3TP7 A;  3AB9 A;  1XTC D;  1XPO A;  4JI3 Q;  4J8Q A;  3PUZ A;  4GLV B;  4A3I B;  3W2D A;  3WDN A;  4X62 L;  2LSS A;  3GD7 A;  2RF4 A;  4IQZ A;  1J5E Q;  4A3C G;  4IUU A;  5GAE C;  3VYR A;  1LM0 A;  2FMC A;  1O7L A;  5J3B A;  1NNX A;  3A8I E;  3BDC A;  2B2Y C;  4ME3 A;  1STA A;  1V9P A;  4DK6 C;  5I6W A;  1PRT F;  4A3B G;  4DR4 L;  1IBK Q;  3BVZ A;  5C4Z A;  4AQY Q;  3HOX B;  3S17 H;  1ESR A;  2PQA B;  1Z7T A;  3BDO A;  4RCO A;  4DKA C;  2XVS A;  2VQF L;  2KCT A;  4JG2 A;  1NR4 A;  1YJW A;  4UAI A;  1EYC A;  2GVB A;  1TS2 A;  5C4H A;  1BCP C;  1IL8 A;  3PO3 H;  1MJC A;  2WKD A;  4DV2 L;  3DMU A;  3P20 A;  1WTP A;  3H3V I;  1TWG B;  4GNX C;  2YTV A;  1Z6H A;  4KHZ A;  4C3H H;  4OWX B;  4LF5 L;  1LO5 D;  4A3G H;  3ND8 A;  1CM9 A;  1EY8 A;  3VA7 A;  1HQR D;  3KF6 B;  4JI5 Q;  3V05 A;  1GHJ A;  1D6E C;  2K28 A;  3M4O H;  4AIM A;  3MWY W;  3HKS A;  2QEX A;  2E2J B;  1LAC A;  2F0T A;  4IPD A;  3HEJ A;  4A3M H;  4FF4 A;  1YNJ C;  1B7Y B;  2QW7 A;  4EQN A;  3OMC A;  4C56 C;  4JK1 C;  1Q12 A;  1TWF H;  4Y7N H;  4R4T A;  4LW1 A;  3TP5 A;  4OO1 I;  2PW7 A;  1CKN B;  3M4Y A;  4LAA A;  1AN8 A;  3HFZ B;  2DUD A;  2Q2I A;  2UXB L;  1SFO B;  1UWV A;  1MBY A;  2JP1 A;  1I94 L;  5FK9 C;  1SMX A;  3BJU A;  1I6H B;  1CI3 M;  4C1N K;  1V1O A;  4L63 B;  2E8G A;  3BG3 A;  3UI2 A;  2O4X A;  2N49 A;  3QO2 A;  1YI2 A;  4NXN L;  3CD6 A;  3G7L A;  4ABN A;  1DD2 A;  2IWH A;  3RLO A;  3VR4 A;  1YNJ D;  1HA5 A;  1EY9 A;  3ITP A;  4HIK A;  5ELE A;  3OTO L;  3CCR A;  2N8N A;  4CJ0 B;  2NBF A;  5C0X G;  3M3Y B;  4ZQ3 A;  1GUO A;  1HJP A;  1CA6 A;  4A3K G;  2E5L Q;  2VQE L;  2H1E A;  3ER0 A;  1WYD A;  2E2I H;  1G6Z A;  3RZD B;  1HZB A;  2EYO A;  1NE3 A;  3WOE A;  1W6J A;  2HDL A;  3GTL H;  3A7L A;  1EY4 A;  4CGY B;  1PA6 A;  4KHP Q;  1F9P A;  2CWA A;  1VQB A;  2K75 A;  1R9T H;  1ZKO A;  3GQB A;  1RIP A;  3RN2 A;  2IHF A;  3H6M A;  4P72 A;  4XT3 B;  3CQZ H;  2MNA A;  3MC0 B;  2RSN A;  3DUZ A;  2VL6 A;  5FO8 B;  2B63 B;  2VUM B;  1VQG A;  2JA8 G;  1ILP A;  3I73 A;  1VQM A;  2EYF A;  2Z4H A;  3SEB A;  3I8Z A;  1B2T A;  5D3I B;  4M1U B;  3PIO A;  1ICW A;  5IGE A;  1AFP A;  5CMD A;  4JI8 Q;  5A35 A;  4DR7 Q;  4IUT A;  5TSS A;  2A74 C;  2SNM A;  3J81 E;  1HQM C;  2NWG A;  5JPM C;  1ESF A;  4L5T A;  5IE8 A;  1I4X A;  3JC6 6;  4RKB A;  5JJL A;  3KLS A;  1JB7 A;  2H4O A;  3KBX A;  1Q82 C;  3FPU B;  5CYU A;  5C4X H;  5M5Y H;  2FHT A;  1EY0 A;  3VYU A;  2EJM A;  1BBW A;  1ML0 D;  1XX8 A;  1HNZ Q;  3U4Z A;  4BBS B;  4FF3 A;  1I3Q B;  5LMN L;  1Y14 B;  2UUC L;  2UUB Q;  1N36 L;  2HIV A;  2A8V A;  1ILQ A;  1E1O A;  2DNC A;  3GP7 A;  2F0U A;  3KLW A;  3BZK A;  1FGB D;  2JA6 G;  1Q1B A;  2R92 B;  1VQN A;  3S1M B;  1LT6 D;  1JJC B;  1QUQ A;  2LKV A;  2UU9 L;  3DEP A;  1SRO A;  3GTQ B;  3K0Y A;  4MTN A;  1Q86 C;  4A3E B;  3UE0 A;  3TZD A;  5CBE E;  3MEH A;  3T1Y Q;  4RHS A;  1TVX A;  2PQE A;  5J1Z A;  2A69 D;  4B3M Q;  1N9W A;  5FJ8 G;  4XIG S;  3HG9 A;  5ELO A;  2JA7 H;  2EY6 A;  1VQJ A;  2J4X A;  1RJT A;  1EY6 A;  4DR3 Q;  3GTG B;  2K5Q A;  1IW7 D;  2AQ1 B;  4DR2 L;  5KNB A;  1SNP A;  3VYT A;  2EXZ A;  3X3N A;  3HP3 A;  2SEB D;  5C44 G;  3NTK A;  1PH6 A;  3T1H Q;  4FF2 A;  3OMG A;  1D1I A;  1VQ4 A;  2MHV A;  4LF6 L;  2V4D A;  4U68 A;  2ALY B;  3F2B A;  2NTT A;  3HRZ C;  5C0X J;  3I4N G;  4YCU A;  3J7A F;  1Q8K A;  1I4R A;  4DXF A;  4JI1 L;  5KRU A;  2UUA Q;  1FNV A;  1WTH A;  2F0O A;  1MD2 D;  2CH4 A;  2SOB A;  2JA5 B;  3VR6 A;  2WAC A;  4BBR B;  2OCE A;  1XNQ L;  3MZ5 A;  5IGF A;  2I07 B;  4XT1 B;  1K3R A;  4JOI C;  3TS0 A;  1PFM A;  3R2T A;  4DV1 L;  4UY8 C;  1PRT C;  1VQ5 A;  5T1G A;  1UEB A;  1A62 A;  2EYL A;  4DPG A;  2K50 A;  3MFY A;  1C7Y A;  5HGT A;  3LWU A;  2VXW A;  3HOZ B;  5IYB H;  2XNA C;  5CR3 A;  1TS3 A;  2F0W A;  2LXJ A;  4KD4 A;  5IP7 G;  1L2F A;  2QEJ C;  1PFB A;  1FYC A;  2RDF A;  4DR6 Q;  2PMZ B;  3LX0 A;  5C3X A;  2AUJ D;  2KCN A;  3RZO H;  4GKJ L;  4R4Q A;  3STB D;  2B29 A;  2D5D A;  4OX9 L;  2CH4 W;  1WTW A;  4DV4 L;  3S16 H;  1BNZ A;  4K0K L;  1XNR L;  3Q8D A;  4A3F G;  2BH8 A;  3BZC A;  4L6T B;  2ID0 A;  4DV0 L;  3HOX H;  4A3L G;  1I50 H;  1EQV A;  3PCO B;  1BBU A;  1G29 1;  1CSP A;  3TRE A;  1AE3 A;  2F0E A;  1N33 L;  3IRB A;  3S17 B;  1JE5 A;  3BZD B;  3FHW A;  2EY2 A;  2Q8I B;  3VR5 A;  3W1G A;  1JOK A;  4IJH A;  2F0S A;  4WOR A;  3D4W A;  1HCZ A;  5CV5 A;  4FXG C;  3ULP A;  3HOV H;  1YEZ A;  1GO3 E;  4DAY B;  3SK6 A;  2WAQ B;  1QB5 D;  3H91 A;  3H15 A;  2E2J H;  4KKT A;  3DWP A;  4B3S L;  3I72 A;  1I4Q A;  1XPR A;  4C3H B;  1SMY D;  1G51 A;  4A3G B;  5IP9 G;  3FPP A;  5FLM G;  2R7Z G;  2RA4 A;  4LFC L;  4IUN A;  2B3G A;  4IUV A;  4X3S A;  4YY3 Q;  3DWA A;  4ULL A;  1RKN A;  1T9H A;  1DYQ A;  2LMC B;  4PQX A;  1B3A A;  1OXX K;  2KQ3 A;  1F2Y A;  4GN4 B;  5DNF A;  2KUM A;  3AFQ A;  5EPL A;  4A3D G;  1Q8I A;  2N55 A;  3BYT B;  1FL0 A;  4DR1 L;  1SFO H;  5DEH A;  3HS0 C;  1IXR A;  1XPU A;  1JQY D;  2IHE A;  4RA8 A;  1SSO A;  4RKL A;  1OXU A;  2B39 A;  1V1P B;  3TP6 A;  5JEA J;  1H95 A;  2DJG C;  2A5H A;  1TWC H;  2K05 A;  2IX1 A;  2NZ1 D;  4K6D A;  4X65 L;  2ZTC A;  4JI4 L;  2JSO A;  4KMU C;  1GD7 A;  4UDU C;  4DFA A;  1H9K A;  2I5H A;  5EPJ A;  1UAP A;  5CGK A;  2DNE A;  3KOJ A;  1UE5 A;  2OXP A;  2PQA A;  1K8A C;  4UP9 A;  1IHZ A;  5I9P A;  4DAV A;  2VZA A;  4L5R C;  3RZD H;  3Q24 A;  4BXX H;  1K9M C;  4IJL A;  1OXT A;  5EPK A;  4PMW A;  2IL8 A;  3C3L A;  5C3E G;  4QIW E;  4B3T Q;  4JI3 L;  1LTG D;  2XRS D;  2F4I A;  1K83 H;  5IT9 E;  4JI6 L;  2EYJ A;  2E2I B;  3L2P A;  3EVQ A;  2JA9 A;  5CV6 A;  3BS1 A;  4XXE A;  2B2U C;  1QVG A;  1CTM A;  3H3V H;  1WCM G;  3GTL B;  1O80 A;  4KK7 A;  3KF6 A;  4QL5 A;  1VQC A;  3NP8 A;  2VUM H;  2B63 H;  1J5E L;  1R9T B;  2JE6 I;  2VS1 A;  1KTK A;  3AQQ A;  5GAD C;  4AYB G;  2ZJQ A;  4A93 G;  1LAB A;  2QIL A;  2YTX A;  2C35 B;  1S5B D;  4CKB A;  1IBK L;  4BWG B;  2CQA A;  4AQY L;  3OHX C;  2VNU D;  4QCL A;  3RD4 A;  2I5L X;  4KJO A;  1S5C D;  1D8L A;  4K5V A;  2OQK A;  2EYP A;  1RTO A;  4OO1 H;  4V19 0;  3J81 L;  4IAL A;  5EKK A;  1VF7 A;  4BBS H;  1CQV A;  4R8I A;  3GTJ H;  1K73 C;  1KIX A;  1U4P A;  2I0Q A;  3PQI A;  3O13 A;  2K5H A;  5ELN A;  3OWE B;  4DAP A;  1Y69 U;  2F3I A;  2HDM A;  3CC4 A;  3P75 A;  4J1M A;  4DV6 Q;  2A68 C;  3KFU A;  1TWH H;  4JI5 L;  5AJ3 Q;  3OIQ A;  4FO2 A;  3G48 A;  4RFB A;  2B2W C;  4A3J G;  2N88 A;  3Q6S A;  4XQQ A;  2F4V Q;  1GXD C;  5HY6 A;  1II3 A;  4LUZ A;  3KYH C;  1RCV D;  2FJ2 A;  3M4P A;  1NUC A;  1Y1V G;  2SNS A;  4LF9 Q;  1WFQ A;  1A6X A;  2FMM A;  2Z9H A;  1HZ9 A;  3J81 i;  1PZK D;  1S40 A;  1E2Z A;  3L0O A;  1PZJ D;  5M5W B;  2OT2 A;  4DV5 Q;  1BR9 A;  1BCP B;  3QIA A;  4RCN A;  3MXN B;  4C3J B;  4HID A;  1WVL A;  1VQD A;  1YNN C;  4BY1 H;  1VMP A;  1QVC A;  2BA1 A;  2A68 D;  5E7N A;  3CPW A;  3WWV A;  4GNX B;  4DV7 Q;  4FXD A;  3GTG H;  3E6Z X;  4OEM B;  1V43 A;  1SYD A;  5ELF A;  1JMC A;  1EWH A;  2ES2 A;  2IW3 A;  1IL2 A;  1EOT A;  1U9R A;  3Q22 A;  1PYS B;  1U4L A;  3JAM c;  4WJW A;  4YCW A;  1JR0 D;  3K58 A;  2F0J A;  3F1Z A;  3ONA B;  2JA7 B;  1ASZ A;  2WB1 B;  3MA2 B;  2RSO A;  3FKI B;  1FGU A;  4AH6 A;  3NQT A;  1EIY B;  1F2M A;  4QY7 A;  4BA1 I;  4HAE A;  3E3X A;  3KDF B;  1YNN D;  2ICI A;  2E5L L;  4LFA Q;  3CME A;  4LMQ D;  1YVC A;  3R3O A;  2QKI C;  4AYB E;  2JA5 H;  3C1F A;  1KQS A;  1FR3 A;  3EFX D;  4BBR H;  3NBH B;  4KHP L;  2Z8L A;  3W3A A;  4JI0 Q;  1CHP D;  4TSS A;  1N8R C;  4DK3 C;  3TBI B;  4K8I A;  1STH A;  1IBM Q;  4Q0F A;  1ZYR D;  3HOZ H;  1XMQ Q;  2NVY H;  1V8Q A;  4MTK A;  2G9H D;  1IYU A;  2Z6K A;  2R93 H;  5HGQ A;  1LTB D;  2RVL A;  1JE4 A;  1SRU A;  3FP9 A;  3MHB A;  4L5Q A;  3DEO A;  4RGM A;  1HPC A;  4CDE C;  2F3V A;  2FFK B;  4DNR B;  4JI8 L;  4DR7 L;  3FRP B;  4UP7 A;  3W5O A;  4DUY Q;  2K6A A;  2L12 A;  1K8O A;  4NMZ A;  1A0I A;  4OGQ C;  4K5X A;  4FDB A;  1OXS C;  1XMO L;  4X3T A;  3RZO B;  4ZAI A;  1C8C A;  3HOY H;  3PO3 G;  2N3S A;  2AQ2 B;  4OXP A;  3S16 B;  1MKH A;  4ZUJ A;  2AWN A;  1UE1 A;  4IO9 A;  3EQL C;  2RHS B;  3NPP A;  3HKZ G;  1Y1W H;  5E1F A;  5G3L F;  1EIF A;  2AKW B;  1HNZ L;  1B3Q A;  3IFD A;  3S9W A;  5IYC G;  2UUB L;  2NN6 G;  4S3S A;  1K3B C;  2C9O A;  5IWA Q;  1STB A;  3OWF A;  1W3S A;  4GLX A;  4C3I G;  1I50 B;  3KBG A;  4UPA A;  4A3M G;  1SE4 A;  5D65 A;  2R61 A;  2HHH Q;  5E3F A;  2WII B;  2KBN A;  4IUP A;  3SXH A;  1TY0 A;  1JWS D;  3J80 E;  2RBM A;  1B50 A;  1A15 A;  3HOV B;  1C4Q A;  1HTL D;  4NKL A;  3T1Y L;  3NTH A;  4N9T A;  3K7A H;  1PH9 A;  4A3C H;  3PMF A;  3V96 A;  1SN8 A;  2PNH A;  4HMJ A;  3X3M A;  4B3M L;  3G4S A;  1XTD A;  3MAQ A;  2A6H D;  1SJH D;  3CF5 A;  1K28 A;  5EAY A;  1LTL A;  1S5E D;  3K7U C;  4ZUI A;  4OHJ A;  4DR3 L;  2HT1 A;  4A3B H;  2ZT9 C;  5FLX c;  2V1C C;  4FP5 D;  1PDQ A;  3UDI A;  2M00 A;  1PH7 A;  4GOP C;  2K5D A;  3L3O C;  3ULL A;  1L1O C;  4A75 A;  1EU4 A;  5K5P A;  3DHQ A;  1H9J A;  3T1H L;  2HCI A;  1NJI C;  3M85 A;  1L0W A;  2JJQ A;  3GDE A;  3CW2 C;  2PYK A;  3CCS A;  5FKA C;  4B3R Q;  1K0S A;  4K5W A;  1E24 A;  1LT3 D;  1X3G A;  3D31 A;  2HQL A;  2ICE C;  4LF8 Q;  2ZXR A;  1TWC B;  2UUA L;  2PNR C;  1TT2 A;  4QQB X;  4RGO S;  1F77 A;  2MP1 A;  1HFN A;  1LUZ A;  1X56 A;  1N34 Q;  3RR5 A;  1MSG A;  4WJ4 A;  4DAM A;  1A2T A;  3NHH A;  1LYL A;  3A54 A;  4DAY A;  2OWO A;  1Q1E A;  2B2V A;  3A5U A;  2M9V A;  2Q2H A;  1QJO A;  1QCB D;  4YIJ A;  4DR6 L;  4DXG A;  5COR A;  4R1J A;  2A1A A;  2BE5 D;  4G4K A;  1K83 B;  3HKZ E;  5IT9 L;  4JV5 L;  4POF A;  1HHV A;  3K5O A;  2KHJ A;  2VB3 X;  3J7Y W;  3C2P A;  5K36 H;  1WOC A;  5ELD A;  5GQO A;  3SDZ A;  1Q46 A;  2F3W A;  4XQJ A;  2FXQ A;  3PO2 G;  3GO5 A;  2QGQ A;  1PH5 A;  4WJ3 M;  1VQ8 A;  4DF7 A;  5T1I A;  3A74 A;  5DM7 3;  1EEI D;  2EIF A;  3HOW G;  3EBE A;  4PZ6 A;  4MZ9 A;  4YHH Q;  4DN4 M;  4O2D A;  3AU7 A;  4BY7 B;  1FNW A;  1PRT B;  4IPG A;  4H13 C;  3TS2 A;  1DJR D;  1PTO F;  3TZU A;  3MVV A;  4H44 C;  5I2X A;  3M4Q A;  3CC2 A;  3P7J A;  1FD7 D;  1V1P A;  5M3F G;  2DY8 A;  3AMU A;  1P8L A;  1SYC A;  3KF8 B;  2AHO B;  3UDF A;  4ME5 A;  2L9H A;  2KHS A;  2L11 A;  3PSI A;  5BN3 A;  4KKU A;  2YV5 A;  3GTJ B;  2KOL A;  1SXT A;  1KL9 A;  1EY7 A;  2A69 C;  5JJK A;  2RQX A;  1YBY A;  1Q90 A;  1EFW A;  1TWH B;  4HJA A;  1BO0 A;  2PI2 A;  1NBW A;  4HR7 B;  4YY3 L;  1IW7 C;  2JA8 H;  5EQ0 A;  1G2S A;  5M5W H;  3CU7 A;  1P16 A;  1ASY A;  3I4L A;  4N9P A;  2EVB A;  2MJ8 A;  4C3J H;  1TKW B;  3RUZ A;  3WOF A;  3A7A B;  3PUX A;  4X64 Q;  4F87 A;  2GN5 A;  3ULJ A;  2IJ0 A;  4U67 3;  5LL6 X;  2D9U A;  2NZH A;  2B8F A;  4M8A A;  2Y0S G;  2JYO A;  1SNO A;  2KCC A;  2F0N A;  3F2U A;  3H0G B;  1TWA H;  1NTG A;  1SLJ A;  2LS0 1;  4BY1 B;  2K32 A;  2DJF C;  1VQ7 A;  1EQT A;  2YYZ A;  4JBM A;  2F0M A;  4C1N I;  2FIN B;  1SAP A;  3ICE A;  3FKI H;  4DV3 Q;  1KLG D;  3ZYY X;  1E22 A;  2B2T C;  3K57 A;  2ASB A;  4JBK A;  1EL0 A;  2ZTD A;  5CV4 A;  5KNC A;  3CMA A;  5FOB B;  3CCU A;  1QZH A;  3W1B A;  1T5X D;  3VR3 A;  4FXK C;  1B53 A;  3LWE A;  2F0I A;  2NUC A;  2R7D A;  4X3K A;  1FJG Q;  4YWM A;  3F2C A;  4A3J B;  4A3I G;  2XIW A;  4RWS C;  2AUK A;  4RG1 A;  5IYB G;  2JA6 H;  2PZU A;  2ZJP A;  4HJ9 A;  2X6G A;  3CPF A;  3T51 B;  3NK9 A;  1Y8P B;  5KEE A;  3STB C;  1F9S A;  4HIO A;  3H94 A;  1PH4 A;  2IX0 A;  3BVG A;  1NMG A;  4YWL A;  1PH2 A;  2B2Y A;  4KY7 A;  1B70 B;  3A5Z B;  5KYI A;  1OXV A;  2F0P A;  2X6L A;  1QNU A;  3J7A 5;  5FJ8 H;  4F8M A;  1CT1 D;  5IGB A;  4CJ2 C;  4IUR A;  2EE1 A;  4XYO A;  1KNE A;  3I4M G;  5ELB A;  2KED A;  1W2B A;  1HR0 Q;  2NVY B;  1H9S B;  2R93 B;  4ZKB B;  2A6E C;  4CDD C;  2F0F A;  1IZ6 A;  5C44 H;  3K80 C;  5JEA H;  3PGZ A;  1DM0 B;  4C2M B;  3MXN A;  2OQ0 A;  4DNI A;  1PH3 A;  3EN2 A;  2PCF B;  5KIX A;  4GNX A;  1D2B A;  1CA5 A;  2BDO A;  4RGN A;  4CKC A;  3I4N H;  1ET6 A;  4CHT B;  1E2W A;  3HOY B;  3KLS X;  1JT8 A;  4KN4 C;  4WFN 3;  1SMY C;  5G3L D;  4HSP A;  1U4R A;  2EY1 A;  3J81 j;  4DV6 L;  2JN4 A;  1CFM A;  4HCE A;  1Y1W B;  2A6E D;  2NTS A;  4UP8 A;  3T13 A;  1HZA A;  3M9B A;  2ZM6 Q;  2F4V L;  1X3E A;  4R4C A;  3D6C A;  3KDF A;  2L55 A;  2Y0S E;  2LFN A;  4LF9 L;  3PUY A;  4GS3 A;  1Q3L A;  5IP7 H;  2F1M A;  2ZXO A;  1U0L A;  4LFB Q;  3NBH A;  1IYV A;  4IFD G;  4DV5 L;  3BVM A;  3J81 c;  3CC7 A;  2NB0 A;  3J80 L;  4P71 A;  1HNX Q;  4POG A;  1SBB B;  3F2D A;  1D7Q A;  4PV1 C;  4R4I A;  1ZXT A;  1YNX A;  3K5M A;  4HIM A;  3VA5 A;  1RF2 D;  4DV7 L;  2UXC Q;  4XQN A;  4A3F H;  3VDY A;  4KI0 A;  3PUV A;  3EJI A;  3K7A B;  5IY0 A;  3HOU G;  3MFG A;  4DK0 A;  3S15 H;  1T5E A;  2L15 A;  1GM5 A;  1SNM A;  2BH2 A;  3R93 A;  2D62 A;  2R7F A;  5C0X I;  4A3L H;  1U5K A;  5LMN Q;  5JVH 3;  2ZTE A;  4NXM Q;  1CK1 A;  4A3B B;  2EQS A;  2D0O A;  1F9R A;  1AZQ A;  2F0L A;  2QCP X;  4IN3 A;  3SK5 A;  1JWU D;  4NB3 A;  1LTA D;  3J80 i;  2K14 A;  2JK8 A;  1X55 A;  1K8M A;  2KCM A;  3OYY A;  1VMC A;  3P1H A;  1C48 A;  1O7Y A;  4LFA L;  4A4I A;  1SNC A;  1RHP A;  4NDX A;  4GLA C;  3N52 A;  3VYS A;  1GUG A;  2XWB B;  4JI0 L;  1TY2 A;  1QIL A;  4OIK A;  2R6G A;  3UDG A;  4NPS A;  2VUM G;  2B63 G;  5EGT A;  2MO1 A;  3T53 B;  5IP9 H;  1SE2 A;  5FLM H;  1IBM L;  5J39 A;  2LXK A;  2GVA A;  4R8N A;  1X54 A;  4JBW A;  2EZV A;  1XMQ L;  4PZ7 A;  1SE3 A;  1ZEQ X;  1D5Z C;  2K5W A;  3VR2 A;  4KY6 A;  4OIJ A;  5IYD G;  2MO0 A;  4E6I A;  4PG3 A;  1HFG A;  2KA7 A;  4DR2 Q;  3DWQ A;  2VB2 X;  1E0B A;  4KD3 A;  4JI2 Q;  1KD1 C;  1PTO C;  1AZP A;  1TQO A;  1XJV A;  1R4P B;  2XGT A;  2P5Z X;  1YHQ A;  3C46 A;  4NW2 A;  1JOR A;  3U50 C;  2AQ3 B;  4A3D H;  4DUY L;  4BA2 I;  3RMH A;  3D8G A;  3SVM A;  3H09 A;  3NXW A;  5JJZ A;  3CCJ A;  1BBX C;  1PVO A;  4OO1 G;  2E2H B;  3TRZ A;  4EX5 A;  4BY7 H;  4EQO A;  1I4P A;  3TSS A;  1HR0 W;  5DAU A;  4LF7 Q;  1KNA A;  4G7Z C;  5FO9 B;  3A0J A;  1KXL A;  3BDL A;  2EYH A;  3M7G A;  4MNO A;  1PTO D;  1LT5 D;  5CV8 A;  4PNY A;  1QE6 A;  4RAU C;  5IWA L;  1PHJ A;  2R92 G;  1CKN A;  1HNW Q;  1X9N A;  1D1K A;  4DNT B;  3I7F A;  4OWW B;  4XYQ A;  3K81 C;  1I4H A;  1DOK A;  1VQH A;  5M3M G;  3MXG A;  3S1R H;  2HHH L;  4L8J A;  2O5I C;  4A3E G;  3QB3 A;  1SYG A;  4GKK Q;  5JOB A;  1XYI A;  4A3K B;  5FO7 B;  3TEH B;  1HRJ A;  1YHA A;  3IL8 A;  1WCM H;  4TVA B;  4LF4 Q;  1EYA A;  4CDF C;  4MHE A;  2QDB A;  3K59 A;  1PFS A;  1H9R A;  4IFD J;  2F0Q A;  5CV7 A;  4GZY C;  3HGB A;  3NEM A;  4PMC A;  1RL2 A;  1C0A A;  2HD3 A;  4A93 H;  3PO2 B;  2K5V A;  3MXU A;  1IBL Q;  4LJZ C;  2D0P A;  5NUC A;  2JA8 B;  5I2Y A;  5L37 A;  4MN3 A;  4P73 A;  4P2C B;  1EIH A;  3HOW B;  1KLU D;  3H0G H;  4B9W A;  2RHQ B;  3V2T A;  4Y52 H;  4K2L A;  1SE8 A;  1PV4 A;  2K52 A;  3TDQ A;  4QUF A;  2K04 A;  1A3V A;  2YTY A;  3D6W A;  1IKM A;  4IOA A;  1O78 A;  3AYH B;  4LK1 C;  5LL6 S;  4B3R L;  4RHR A;  2J7Z A;  4RMF A;  2JA5 G;  4I7Z C;  1B9N A;  4N8X 1;  4ZKC B;  4DUZ Q;  1TWA B;  2EJG C;  2L4N A;  4BBR G;  5LMU Q;  1Y8N B;  4HTH A;  3S1Q B;  1BDO A;  4LF8 L;  4QUC A;  5M3F B;  3RNU A;  5LMN W;  1SDF A;  1ZYR C;  4A3J H;  1S72 A;  3A8J E;  3U4V A;  1ENA A;  3HOZ G;  2K7V A;  4HCS A;  2AMC B;  3NE5 B;  1N34 L;  2YU9 H;  1VQI A;  2N78 A;  4GOP B;  2UXD Q;  5C5L A;  1R4Q B;  1Y1V H;  3E9I A;  3J7Z C;  5HUR A;  3KF8 A;  1D5M C;  1L1O B;  1EY5 A;  1GKH A;  2Z1C A;  5IGG A;  2JA6 B;  3OIP A;  1RTN A;  1NSN S;  3RN5 A;  1ENF A;  3RLN A;  3I56 A;  2IY5 B;  1S5D D;  5C3W A;  2X69 A;  4X66 Q;  1GUW A;  1Z47 A;  1F2Z A;  4IPH A;  2CVR A;  1EZ6 A;  4I7A A;  4PZ8 A;  3K5L A;  1M4V A;  4XDX A;  2Y0S B;  2PZW A;  4J15 A;  4IUQ A;  2IPK D;  1D5X C;  3FMC A;  4YHH L;  4C2M H;  1CZW A;  4CDC C;  5IIF A;  1EFI D;  5LHY 1;  3HZX A;  5A2Q L;  3PF4 A;  2O5J C;  1F9Q A;  4L5S A;  1Z9F A;  3E0J A;  2WAQ G;  2K03 A;  2G5D A;  5C44 B;  4JYA Q;  3E9H A;  3U58 A;  4IFD I;  2JEA I;  2MPM A;  5IT9 c;  1N32 Q;  3D4D A;  4OWT B;  4C3H G;  4JI6 Q;  2Q8T A;  4A3G G;  1EU3 A;  5EJW A;  1H9M A;  3I4N B;  4OL7 A;  1DGS A;  2QF7 A;  3SGI A;  5CC4 A;  4G7O C;  1KAW A;  3GV3 A;  1VQK A;  1WTX A;  1M1K C;  2A6H C;  1E1T A;  5KGU A;  1G91 A;  4DU9 A;  1VF5 C;  4K8J A;  3QG1 A;  3CXC A;  4ZYS A;  1GOZ A;  3S24 A;  1J9O A;  1KDC A;  2RKS A;  2NVT H;  1KDA A;  4QJF A;  2F03 A;  4ZLT F;  1MJE A;  3I4M B;  3KJO A;  3S2D H;  4X64 L;  1KRT A;  4X3U A;  3PUW A;  1DXM A;  3TQY A;  1VDZ A;  2SDF A;  3G6E A;  2K1B A;  2QA4 A;  2EPB A;  1XXG A;  4JVZ A;  5C5M A;  3T56 B;  1LTR D;  1A3U A;  4QIW B;  4J6H A;  4A3F B;  2PMZ E;  3FVQ A;  4DV3 L;  1H9S A;  3CHB D;  3LGJ A;  2CHB D;  1K0R A;  3S15 B;  2OTJ A;  4F7X A;  5IYC H;  5IGC A;  2NN6 H;  2WIN B;  3JAM L;  3I91 A;  1MIU A;  4C3I H;  3PIP A;  4HSV A;  4K6L A;  4JI7 Q;  4ALP A;  1FJG L;  1BUV T;  2EJF C;  4IOC A;  4ODG A;  1BCP D;  1J8I A;  2B2U A;  4X6A H;  1VQO A;  4QMG A;  2BE5 C;  5H1S E;  3R8B A;  4EQ5 A;  1BQQ T;  3BU2 A;  4KV6 A;  3TME A;  5D3D A;  3LNN A;  2K5N A;  5K36 G;  1L0X B;  4DR5 Q;  3S1N H;  1NAP A;  3E0E A;  4RH6 A;  4QGU A;  1WI5 A;  4O0A A;  3JAM i;  1WD1 A;  1PH8 A;  2WAQ E;  3GTP H;  3NUC A;  2R7Z B;  2RCN A;  1HR0 L;  4FNF A;  2ATW A;  1EQQ A;  3S14 H;  3HOU B;  2BOS A;  3ERS X;  1EZ8 A;  4FVM A;  2K01 A;  5EKL A;  1QVF A;  2E2H H;  3NTI A;  4TRD A;  4KTA A;  2K4K A;  2A73 B;  3SR1 A;  1GUN A;  2Z6B A;  2OF1 A;  1HXY D;  4A3D B;  5BR8 Q;  1S5F D;  3I3C A;  2EXD A;  1SR3 A;  1UE6 A;  3T16 A;  5F2D A;  1K8G A;  3CRL C;  3T4A C;  2E2D C;  3AEV A;  5I6Y A;  5C4X G;  1QWY A;  3KLR A;  1RD9 D;  3NWS A;  4QF4 A;  4N8F A;  5I4D A;  5ISR A;  1JC7 A;  1JB3 A;  2B2W A;  2EOT A;  1LV9 A; 
#chains in the Genus database with same CATH homology
 2WFW A;  3PUZ A;  2OQ0 A;  4DNI A;  3L7Z C;  4A93 G;  4GLV B;  1PH3 A;  3EN2 A;  1M90 C;  2YTX A;  2C35 B;  4GNX A;  4X62 L;  3CP0 A;  2LSS A;  3EIV A;  3AFP A;  1IBK L;  3GD7 A;  2RF4 A;  4AQY L;  1I5F A;  2ZM6 L;  1J5E Q;  3I4N H;  4A3C G;  5GAE C;  2NVQ H;  1JT8 A;  4A3K H;  2VNU D;  1LM0 A;  5J3B A;  2I5L X;  3J81 j;  4DV6 L;  4A3L G;  4ME3 A;  1D8L A;  4DK6 C;  1V9P A;  1TXY A;  2OQK A;  3GTM H;  4LFB L;  4UP8 A;  4A3B G;  4X62 Q;  2MFI A;  1HZA A;  4DR4 L;  1IBK Q;  4BBS H;  3M9B A;  2ZM6 Q;  2PI2 E;  4AQY Q;  2F4V L;  3GTJ H;  1NY4 A;  1HNX L;  3S17 H;  1X3E A;  4R4C A;  2PQA B;  4DKA C;  1XMO Q;  3KDF A;  1K73 C;  1KIX A;  2Y0S E;  2K5H A;  2VQF L;  2I0Q A;  5ELN A;  2KCT A;  2UXC L;  4JG2 A;  2F3I A;  3CC4 A;  3PO2 H;  2CWP A;  4LF9 L;  3PUY A;  4GS3 A;  4DV6 Q;  1YJW A;  2GVB A;  3KFU A;  1TWH H;  4JI5 L;  5AJ3 Q;  2JA7 G;  5IP7 H;  3G48 A;  2WB1 G;  1U0L A;  4LFB Q;  4A3J G;  2Q2U A;  4IFD G;  3F8T A;  3PO3 H;  3FKI G;  1MJC A;  4DV2 L;  1YHB A;  4DV5 L;  3J81 c;  3CC7 A;  3HOW H;  1PH1 A;  4DR4 Q;  1B8A A;  4P71 A;  3H3V I;  2F4V Q;  2CKZ B;  3S2H H;  1VQA A;  1HNX Q;  4GNX C;  2YTV A;  3F2D A;  4POG A;  1D7Q A;  5GAH C;  5HY6 A;  4R4I A;  4LUZ A;  4KHZ A;  3KYH C;  1YNX A;  4C3H H;  1VQE A;  4OWX B;  3M4P A;  2VQF Q;  4HIM A;  4LF5 L;  4NXM L;  4DV7 L;  4A3G H;  2UXC Q;  1Y1V G;  1V1Q A;  4LF9 Q;  1WFQ A;  1EWI A;  3VDY A;  4KI0 A;  3PUV A;  3KJP A;  4A3F H;  3KF6 B;  5M5X H;  4JI5 Q;  1HZ9 A;  3J81 i;  1S40 A;  5IY0 A;  3M4O H;  3L0O A;  3HOU G;  4AIM A;  3HKS A;  3S15 H;  2L15 A;  2QEX A;  1GM5 A;  2Q2T A;  4DV5 Q;  4DV2 Q;  1A8V A;  2BH2 A;  3S1Q H;  5C4J H;  2D62 A;  2R7F A;  3J80 c;  5M3F H;  3MXN B;  4IPD A;  5C0X I;  4HID A;  1VQD A;  1U5K A;  5LMN Q;  4A3M H;  4BY1 H;  4A3L H;  1QVC A;  2ZTE A;  2BA1 A;  3K8A A;  5E7N A;  3CPW A;  4IPC A;  3WWV A;  4LF5 Q;  4GNX B;  4DV7 Q;  4NXM Q;  2EQS A;  2D0O A;  3GTG H;  1EUJ A;  1V43 A;  1B7Y B;  1JMC A;  2ES2 A;  3D0F A;  1IL2 A;  4A76 A;  4R4O A;  4NB3 A;  5GRO A;  3J80 i;  2K14 A;  1Q12 A;  1TWF H;  1PYS B;  1X55 A;  2JK8 A;  2KCM A;  4Y7N H;  4R4T A;  3OYY A;  3JAM c;  3I4O A;  4YCW A;  4LW1 A;  4OO1 I;  4LFA L;  1CKN B;  4A4I A;  3OW2 A;  3F1Z A;  1ASZ A;  1X65 A;  4GLA C;  3HFZ B;  2DUD A;  2Q2I A;  2UXB L;  1FGU A;  4AH6 A;  4JI0 L;  1UWV A;  1I94 L;  1EIY B;  4B3T L;  1SMX A;  3BJU A;  2R6G A;  3UDG A;  1E3P A;  4QY7 A;  4LUO A;  4NPS A;  2VUM G;  2HIX A;  4BA1 I;  4JI2 L;  2B63 G;  3KDF B;  2MO1 A;  2E8G A;  2E5L L;  2N49 A;  5IP9 H;  5FLM H;  1YI2 A;  4LFA Q;  3CME A;  5JEA G;  1IBM L;  4NXN L;  3CD6 A;  2LXK A;  2GVA A;  1YVC A;  1X54 A;  4GN5 A;  4JBW A;  1WJJ A;  3RLO A;  4AYB E;  1XMQ L;  4PZ7 A;  2JA5 H;  1KQS A;  1JJ2 A;  4BBR H;  1KRS A;  3NBH B;  4HIK A;  2NVX H;  2KEN A;  2H5X A;  5IYD G;  3OTO L;  4KHP L;  3CCR A;  2UXB Q;  4JI0 Q;  2MO0 A;  1I94 Q;  2N8N A;  4PG3 A;  5C0X G;  4DR2 Q;  1CUK A;  1N8R C;  4JI2 Q;  4DK3 C;  2CFM A;  2WP8 J;  1HJP A;  3HOX G;  1KD1 C;  1XJV A;  4A3K G;  2XGT A;  2E5L Q;  1YHQ A;  2VQE L;  3ER0 A;  2NN6 I;  1WYD A;  3U50 C;  1IBM Q;  1EOV A;  2F52 A;  2E2I H;  4NXN Q;  1HZB A;  4A3D H;  4DUY L;  3HOZ H;  4GKJ L;  4BA2 I;  1XMQ Q;  1NE3 A;  4LF7 L;  2NVY H;  3GTL H;  2Z6K A;  1PA6 A;  2R93 H;  5HGQ A;  4KHP Q;  3CCJ A;  2CQO A;  2CWA A;  1VQB A;  2K75 A;  3OTO Q;  1R9T H;  4OO1 G;  1PVO A;  1SRU A;  1RIP A;  3FP9 A;  3RN2 A;  4L5Q A;  3TRZ A;  1HNW L;  4EX5 A;  2IHF A;  4XTC S;  4BY7 H;  2VQE Q;  4P72 A;  4JI8 L;  3CQZ H;  4LUV A;  4DR7 L;  2MNA A;  4A3I H;  4UP7 A;  3W5O A;  4DUY Q;  3HOV G;  1HR0 W;  2CCZ A;  1A0I A;  4LF7 Q;  1YIJ A;  2VL6 A;  1VQG A;  1AE2 A;  1OXS C;  3A0J A;  4FDB A;  1VQM A;  1XMO L;  2JA8 G;  4GKK L;  1KXL A;  2WB1 E;  4MNO A;  1X6O A;  3HOY H;  3PO3 G;  2N3S A;  5IWA L;  2R92 G;  1HNW Q;  1PHJ A;  3PIO A;  1CKN A;  4OXP A;  1X9N A;  4JV5 Q;  5AJ3 L;  3I7F A;  1FVI A;  4OWW B;  1MKH A;  3K81 C;  3RLF A;  3ZJY C;  4LF4 L;  2AWN A;  1VQH A;  4JI8 Q;  1UE1 A;  4IO9 A;  5M3M G;  3S1R H;  2HHH L;  4DR7 Q;  2BA0 A;  2RHS B;  4A3E G;  3HKZ G;  1Y1W H;  1EIF A;  2AKW B;  1HNZ L;  4GKK Q;  5IYC G;  2UUB L;  3TEH B;  2NN6 G;  4L5T A;  5IE8 A;  3I4M H;  3JC6 6;  5IWA Q;  4JCV E;  4GOP A;  5JJL A;  1W3S A;  1YHA A;  4GLX A;  1IBL L;  1JB7 A;  2Z6K C;  1Q82 C;  1WCM H;  4UPA A;  4A3M G;  4TVA B;  4LF4 Q;  1L1O A;  5C4X H;  5M5Y H;  2HHH Q;  2KBN A;  1PFS A;  3MEF A;  4IFD J;  1BBW A;  1HNZ Q;  3U4Z A;  3NEM A;  5LMN L;  1Y14 B;  2UUC L;  1RL2 A;  2UUB Q;  1TWG H;  1N36 L;  1C0A A;  4A93 H;  2HIV A;  2A8V A;  1E1O A;  2K5V A;  1IBL Q;  3DM3 A;  2D0P A;  3T1Y L;  3KLW A;  4DUZ L;  3M7N A;  3K7A H;  3BZK A;  1PH9 A;  4P73 A;  4A3C H;  5LMU L;  1AH9 A;  2JA6 G;  1Q1B A;  3H0G H;  1SN8 A;  2PNH A;  2RHQ B;  3NEL A;  1CKM A;  4B3M L;  1VQN A;  1JJC B;  1QUQ A;  3G4S A;  2UUC Q;  1XTD A;  1SE8 A;  2UU9 L;  1PV4 A;  1N36 Q;  4Y52 H;  2K52 A;  3CF5 A;  2I5M X;  1LTL A;  1SRO A;  3K7U C;  5EAY A;  2YTY A;  5GAG C;  4DR3 L;  4MTN A;  4IOA A;  3AYH B;  2IT1 A;  1Q86 C;  2HT1 A;  4B3R L;  3UE0 A;  4A3B H;  4BXX G;  5FLX c;  2V1C C;  3T1Y Q;  4RMF A;  2JA5 G;  3UDI A;  1PH7 A;  4DUZ Q;  4GOP C;  4BBR G;  5LMU Q;  3G71 A;  4LF8 L;  4B3M Q;  3ULL A;  1L1O C;  2UXD L;  1N9W A;  3I2Z A;  3K0X A;  4XIG S;  5FJ8 G;  4A75 A;  3T1H L;  2UU9 Q;  5ELO A;  1VQF A;  3CAM A;  3RNU A;  5LMN W;  1NJI C;  1VQJ A;  3M85 A;  2JA7 H;  1L0W A;  2JJQ A;  3GDE A;  4DR3 Q;  3CW2 C;  4A3J H;  1S72 A;  3U4V A;  3CCS A;  4B3R Q;  3B6Y A;  3HOZ G;  4DR2 L;  1E24 A;  1X3G A;  3D31 A;  2AMC B;  4X66 L;  2YU9 H;  3UDX A;  1N34 L;  1I6H H;  1VQI A;  2HQL A;  2N78 A;  4LF8 Q;  5C44 G;  1VCI A;  4GOP B;  1PH6 A;  2R7Z H;  2UXD Q;  2UUA L;  1Y1V H;  3E9I A;  3J7Z C;  3T1H Q;  2VY3 A;  4KLK A;  1L1O B;  4QQB X;  1GKH A;  3HOU H;  4BY7 G;  1VQ4 A;  4GN3 B;  4LF6 L;  2ALY B;  3F2B A;  4OON A;  1LUZ A;  3RN5 A;  3RLN A;  3I56 A;  2IY5 B;  1NMF A;  1X56 A;  5C0X J;  3I4N G;  4YCU A;  3M3Y H;  4X66 Q;  1Q8K A;  1N34 Q;  3RR5 A;  4WJ4 A;  1Z47 A;  4DAM A;  4YCV A;  4JI1 L;  2UUA Q;  4IPH A;  1LYL A;  1CSQ A;  1Q1E A;  2OWO A;  1KHI A;  4PZ8 A;  3A5U A;  2OCE A;  2Q2H A;  1XNQ L;  1G6P A;  4LF6 Q;  4DR6 L;  5DLQ E;  1K3R A;  4J15 A;  4R1J A;  2A1A A;  4JOI C;  3TS0 A;  4JYA L;  4DV1 L;  4BBS G;  1QUQ B;  4YHH L;  3HKZ E;  1S3O A;  1VQ5 A;  4UY8 C;  4JV5 L;  4POF A;  4C2M H;  1UEB A;  1A62 A;  2KHJ A;  4DPG A;  1QZG A;  1N32 L;  1WOC A;  2K50 A;  1C7Y A;  5GQO A;  4JI1 Q;  1Q46 A;  1E7Z A;  2FXQ A;  3PO2 G;  3GO5 A;  5IYB H;  2QGQ A;  1PH5 A;  1JJG A;  3PF4 A;  4WJ3 M;  2LXJ A;  5IP7 G;  1VQ8 A;  1L2F A;  4L5S A;  1Z9F A;  2WAQ G;  1XNQ Q;  1BVS A;  3A74 A;  4DR6 Q;  3GTO H;  2EIF A;  3RZO H;  3E9H A;  3HOW G;  4JYA Q;  4R4Q A;  3EBE A;  4PZ6 A;  3STB D;  3U58 A;  4MZ9 A;  4DV1 Q;  4YHH Q;  1VQ9 A;  4IFD I;  2B29 A;  4OX9 L;  2JEA I;  5IT9 c;  4O2D A;  1N32 Q;  4DV4 L;  3S16 H;  4OWT B;  4JI6 Q;  4K0K L;  1XNR L;  4A3G G;  3Q8D A;  4IPG A;  3TS2 A;  4A3F G;  5C3E H;  5IYD H;  1YZ6 A;  3PV0 A;  2BH8 A;  3BZC A;  1DGS A;  2NZO A;  2ID0 A;  3GTK H;  4DV0 L;  1KC8 C;  3HOX H;  3M4Q A;  3SGI A;  3CC2 A;  1KAW A;  4GKJ Q;  3H0G G;  1VQK A;  1M1K C;  5M3F G;  4BY1 G;  1E1T A;  1GVP A;  1C9O A;  1P8L A;  3KF8 B;  3CCE A;  2AHO B;  4OX9 Q;  2JEB I;  3UDF A;  4DV4 Q;  1I50 H;  3PCO B;  1BBU A;  4K0K Q;  1XNR Q;  1G29 1;  1CSP A;  3NEN A;  3CXC A;  3TRE A;  4TQU S;  1AE3 A;  3PSI A;  1N33 L;  3S24 A;  3IRB A;  1JE5 A;  2YV5 A;  3FHW A;  2NVT H;  1KL9 A;  4DV0 Q;  3W1G A;  2DGY A;  1CKO A;  4IJH A;  4QJF A;  5JJK A;  1MJE A;  1I3Q H;  3I55 A;  3KJO A;  3S2D H;  4X64 L;  1KRT A;  1YBY A;  4JBJ A;  3PUW A;  1EFW A;  3TQY A;  3ULP A;  4HJA A;  3HOV H;  1YEZ A;  1GO3 E;  1HZC A;  2PI2 A;  4DAY B;  1NBW A;  4YY3 L;  1O7I A;  3G6E A;  1X3F A;  2JA8 H;  1VQP A;  2XTI A;  2QA4 A;  3H15 A;  3CCV A;  4H02 A;  1N33 Q;  1Q7Y C;  5M5W H;  2E2J H;  1P16 A;  4HJ8 A;  2ZJR A;  1ASY A;  2R92 H;  4B3S L;  3S1M H;  1XPR A;  4C3J H;  3CCL A;  1G51 A;  3PUX A;  4JI7 L;  4X64 Q;  5IP9 G;  5FLM G;  2GN5 A;  2R7Z G;  3ULJ A;  5M3M H;  2PMZ E;  3GTQ H;  4LFC L;  4DV3 L;  2B3G A;  4A3E H;  3LGJ A;  1K0R A;  4YY3 Q;  2NZH A;  2OTJ A;  2Y0S G;  5IYC H;  4P74 A;  1TWA H;  1NTG A;  1SLJ A;  1T9H A;  4B3S Q;  1MIU A;  4JOI A;  4C3I H;  1OXX K;  3PIP A;  3CCM A;  2YYZ A;  1VQ7 A;  4JBM A;  2A19 A;  4JI7 Q;  4ALP A;  1FJG L;  4GN4 B;  2AWO A;  4DR5 L;  1YIT A;  3AFQ A;  3DLL A;  4IOC A;  4A3D G;  3ICE A;  1Q81 C;  4LFC Q;  3FKI H;  1FL0 A;  4DV3 Q;  4DR1 L;  1SFO H;  1IXR A;  2VW9 A;  1E22 A;  1YJN A;  2KHI A;  1XPU A;  2IHE A;  3CCQ A;  2ASB A;  1VQO A;  4X6A H;  4JBK A;  2R93 G;  2ZTD A;  5H1S E;  3CMA A;  4APV A;  4EQ5 A;  3CCU A;  1QZH A;  1OXU A;  3BU2 A;  3W1B A;  4HJ5 A;  5JEA J;  1OTC A;  1H95 A;  1TWC H;  2K5N A;  1VQL A;  2IX1 A;  2R7D A;  5K36 G;  1FJG Q;  4X65 L;  2ZTC A;  4DR5 Q;  4YWM A;  3F2C A;  2OTL A;  4JI4 L;  3S1N H;  1GD7 A;  3E0E A;  4JC0 A;  4A3I G;  2I5H A;  4RG1 A;  5IYB G;  4DR1 Q;  1EYG A;  4QGU A;  2JA6 H;  2ZJP A;  1WI5 A;  4HJ9 A;  4O0A A;  3CPF A;  3JAM i;  3KOJ A;  1UE5 A;  1PH8 A;  1A63 A;  2WAQ E;  3STB C;  3GTP H;  2MQH A;  2PQA A;  1K8A C;  2RCN A;  4UP9 A;  1J6Q A;  4HIO A;  1PYB A;  3HOY G;  5BR8 L;  5GAD C;  1PH4 A;  2IX0 A;  2VZA A;  1HR0 L;  5JJI A;  4L5R C;  3RZD H;  2ATW A;  1EQQ A;  4BXX H;  1NMG A;  2JQO A;  4YWL A;  1K9M C;  4X65 Q;  3S14 H;  4JI4 Q;  3UE1 A;  4IJL A;  1OXT A;  4PMW A;  1PH2 A;  3ERS X;  1B70 B;  1VS0 A;  1EQR A;  2Z0S A;  1OXV A;  3A5Z B;  4LWC A;  4QIW E;  5C3E G;  3PF5 A;  1Y1W G;  1QVF A;  4P75 A;  2E2H H;  4B3T Q;  3J7A 5;  4JI3 L;  5FJ8 H;  1IYJ B;  1BKB A;  2K4K A;  1K83 H;  4YWK A;  4JI6 L;  1VQ6 A;  3I4M G;  3L2P A;  5BR8 Q;  2JA9 A;  2EXD A;  1QVG A;  1W2B A;  1SR3 A;  1UE6 A;  1UE7 A;  1HR0 Q;  1K8G A;  4LNQ A;  3H3V H;  1WCM G;  1YJ9 A;  3KF6 A;  3AEV A;  4HJ7 A;  5C4X G;  4QL5 A;  1VQC A;  2VUM H;  2B63 H;  1J5E L;  2JE6 I;  2VS1 A;  1HH2 P;  1IZ6 A;  5C44 H;  3K80 C;  3PGZ A;  4JI3 Q;  1XPO A;  3AQQ A;  4AYB G;  2ZJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...