2L0CA

Solution nmr structure of protein sty4237 (residues 36-120) from salmonella enterica, northeast structural genomics consortium target slr115
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
MAPLQQKQVVVSNKREKPVNDRRSRQQEVSPAGTSMRYEASFKPLNGGLEKTFRLQAQQYHALTVGDQGTLSYKGTRFVGFVSRTPDNELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative membrane protein
publication title Solution NMR Structure of protein STY4237 (residues 36-120) from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR115
rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l0cA00
3RD4A 2L0CA
chains in the Genus database with same CATH superfamily
5FO8B 1VQ9A 1F2ZA 3BZDB 4LF6L 2B2TA 2MO0A 3IFTA 4JI6L 2LKVA 3RN2A 3KJOA 4OWXB 3K80C 1X65A 4GOPC 3S14H 3WOEA 3E0JA 1R4QB 3NUCA 2B2YA 1V43A 4A3EG 2BH8A 1GUGA 2KVMA 2WINB 4DK0A 4L8JA 4JI3L 4JI3Q 1B2TA 2K14A 3UDXA 4DR3L 2A74C 3C46A 2BA1A 3J81j 4L5RC 2A69C 2K5DA 3FKIH 3A8JE 3S24A 5KYLA 2A6HD 1U5KA 5HGTA 2UU9L 1TY2A 2IWHA 3NBHA 2EXZA 3BDOA 1PH6A 3CCUA 1MHWC 5JEAG 3GTMB 4IUVA 2X6LA 1QJOA 1Q81C 2OXPA 1O78A 1FJGL 1KDAA 2D0OA 2E5LQ 1LT5D 5IGEA 1B9MA 1YNXA 2IHFA 3LGJA 4J15A 4HAEA 1NCVA 4BY1G 1TR5A 5JAVA 3L9AX 3GD7A 1I50H 4ZKCB 2YTXA 5EKIA 3S17B 4Z9CB 3HKSA 4JK1C 3T13A 3AFPA 1N36L 1N36Q 1E1OA 4C3HH 2XWBB 2NTTA 1VQGA 3TP6A 1H9JA 1VQMA 4JYAQ 3NTHA 1PFSA 2CW0C 4FF2A 1O7LA 4X62Q 3PO2H 1EL0A 5ELFA 4RH6A 3G4SA 3E3XA 1SYGA 3Q24A 2ZXPA 1VQKA 3QWNA 2LXJA 1W6JA 1X9NA 1GHJA 3ZYYX 4K5XA 5LMNL 1VQPA 3FPUB 4HIOA 4A3BB 1JC7A 1KDBA 2L5TA 1HZAA 4QUCA 1I4QA 3MTSA 1F2LA 4HJ9A 3RZOB 1CKNB 1X56A 2Q8IB 2CHBD 4JPBW 5FJ8G 5IODA 3K0YA 3T1HQ 4X6AH 2RDFA 5JVH3 5I9PA 2R61A 3U4ZA 3K5LA 1QNKA 3J80i 4A3FH 3V05A 2FMCA 1LTAD 1PZJD 1HNXL 3DXJC 5IGFA 2EY1A 5LL6S 1HNXQ 1S40A 4QUFA 5EAYA 1SE2A 5IYBG 2IW3A 5GROA 3H3VC 1H9SB 3MVVA 5C6AA 2DY8A 2R92H 3W2DA 2SNSA 4DGZA 1JCKB 5CORA 1R4PB 3HOXB 1JE5A 3HOVH 4NW2A 3S16B 4A3CG 2JEAI 1G6ZA 1TXYA 2H1EA 2ZJRA 1TWHB 2K6AA 3GV6A 1WYDA 2VUMB 5ELBA 5IT9c 3QO2A 3OHXC 1KHIA 1VQJA 2VB2X 1O80A 2R7ZG 1EY8A 2XN9C 1AZQA 4POGA 1DXMA 1HNZL 1HNZQ 2F3IA 4YCWA 1HNWQ 4HMJA 1G51A 4DV4Q 1Z9FA 5J1ZA 3NP8A 2NTSA 1N32L 1OXUA 1PHJA 4P72A 5CV6A 2EOTA 1CKMA 5EKLA 1EY4A 1AFPA 3S1RB 3G48A 2F0UA 4G4KA 4NXML 3MXGA 3G6JB 3OIQA 4NXMQ 2K5VA 4JC0A 5LMUL 2N88A 3OWFA 2LMCB 2RSOA 4EQ5A 1PMRA 1BUVT 2BDNA 1Q86C 4NKLA 3PO3B 5T1IA 1VQEA 1ICWA 5K36H 2KCMA 3GTPB 4NB3A 1AE3A 1DOLA 4A3JG 4LNQA 2JA6H 1FGBD 4BBRB 1C48A 4RGOS 2HD3A 1K9MC 5K5PA 5E7NA 4Y7NB 4DV6Q 4XXEA 5M5WH 4HJ8A 1B8AA 4APVA 3BG3A 3KOJA 4L5SA 1CI3M 4IURA 4BBSB 2PI2E 1V1PB 4A3KB 3R93A 2NYZD 3W5OA 4R8IA 2F0QA 4V190 2ZXOA 4TVAB 2O4XA 1J9OA 4IUNA 5IWAL 1RL2A 3KFUA 5KIXA 2NVQB 4HR7B 3S2HB 3BVGA 3KBXA 4N8FA 3GTKH 2XTIA 3J7AF 4JI2L 2WAQE 1SYFA 3D8GA 1GUWA 1PDQA 2OT2A 1SYBA 1JOQA 2I5MX 3A55A 3OW7A 4JOIC 4TRDA 4EQPA 3PQIA 3M3YB 2GVAA 1JR0D 2F0SA 2YU9B 4E6IA 4A3EH 2JA7B 1B3QA 3HGBA 4R1JA 2PCFB 5LL6X 4GOPA 5KNDA 2OWOA 2HT1A 1KAAA 4RKLA 1Y69U 1KAWA 1Z6HA 3DM1A 5KEEA 2O5JC 5BR8Q 4A3BG 2MQHA 1I4GA 4KMUC 4P2CB 3K6OA 3RLNA 3LWUA 4LUVA 2B63B 3MC0B 3QOJA 5JEAH 1DGSA 3ULPA 3ITPA 1IL8A 1DD2A 3PUVA 2FXQA 2PNRC 2L12A 3I55A 1NMGA 1XTDA 2FINB 4LMQD 3E9IA 2RQXA 1ZYRC 4LFCL 1LLRD 2A19A 1N34Q 3CF5A 4BY1H 2EE1A 5C44B 1SYEA 4H7BA 5IIFA 1BCPB 3J80L 5HURA 3R2IA 1UE6A 2CKZB 1IBKL 1GVPA 1XX8A 4ZRZA 2B8GA 3A7LA 5CV5A 2ALYB 3HOXG 1B70B 3H94A 3G7LA 3STBC 3D31A 5JEAJ 2VUMG 1VQ4A 3J7A5 1PTOD 4OWWB 1A3TA 3KJPA 1W2BA 1MD2D 4B3SQ 2MGSA 1U4LA 5EKKA 2LFNA 4IPGA 4CDCC 1LTSD 5IT9E 4B08A 4B3ML 3KLSA 1BOSA 2IX3A 5JJZA 2NVYB 3CU7A 4R9WA 4JV5L 4HSPA 3TSSA 3URYA 2RHSB 3MFGA 1JB3A 4B3RL 5FJ8H 3CCRA 1K8MA 1C4QA 4HCSA 5EJWA 1CA5A 4KI0A 1L2FA 1G6PA 5KYIA 3DEPA 1K28A 4QB4A 2PZUA 1WTRA 2DN8A 1O7ZA 1XMQQ 1B44D 3E9HA 5IYBH 1ZKOA 2CH4A 2A73B 1JOKA 1MJCA 3OMCA 1AEXA 1I5FA 3FPPA 1T5XD 3SK8A 2IHEA 3PO3G 1B7YB 3ND8A 1UEBA 1MIUA 1Y8NB 4KHVA 3M7NA 3AU7A 4A3CH 5J3BA 3O13A 5EPJA 4X3UA 1XXGA 4HN7A 3OTOL 4FYDA 1KNEA 4BBRG 3R2TA 4N9PA 3UE0A 4GLVB 2R7ZH 2IJ0A 1SNCA 1X3PA 4QIWE 1NAPA 4F87A 2E75C 3MFYA 4DV2L 1RDPD 4BBSG 3L3OC 1PZID 4J8QA 2CVRA 2SDFA 1E24A 4HJ7A 2AQ1B 3FEWX 4M8AA 2F0TA 5CV7A 4A3KG 2PW5A 1K8AC 4OIKA 1HTPA 2LY7A 4DV5L 4FF3A 5EPKA 4PMWA 4RGMA 3NHHA 1FGUA 1EIFA 3DM3A 3J7YW 2Q2IA 2XSCA 2XRQD 5FK9C 4YHHL 1JJCB 4RFBA 4A4IA 3JC66 5M5XB 2EYOA 4ZYSA 2A6ED 2B2UC 3CHBD 2RCFA 5FLMG 2KHIA 5IE8A 4KV6A 3I8ZA 2CCZA 2NN6G 4A3JH 3HOZB 1L1OA 3TP5A 4LWCA 4JI8L 5JJIA 3PF5A 1H9RA 4I7AA 2Z4IA 5CR3A 1STAA 2F52A 4NXNL 1BNZA 3D4DA 4A3MB 4CKEA 3QOLA 1M90C 2EPBA 1RKNA 1C8CA 1SE4A 1X55A 4PG3A 2R6GA 2B63G 2PQEA 2KEDA 3GTMH 2M9VA 2YTYA 1E2ZA 5D3DA 4LJZC 3V2TA 4UY8C 2E74C 1QUQA 3DWQA 1XPOA 3V96A 4DV3L 1EEFD 4OX9Q 5F2DA 3SEBA 4DR7Q 3HG9A 3NWTA 3T16A 1MBYA 3NWSA 3PUZA 2E2JB 3S1QB 5C44G 2R3ZA 3GDEA 4EX5A 2VXWA 1WTOA 3S17H 1VF5C 1SNPA 3HFZB 5C4HA 2UXDL 3A74A 2HUGA 4JI0L 3VDYA 1EYAA 3OPOA 1TS4A 1PYWD 3TBIB 3MXNB 2EZVA 3J81i 3PIO3 1HA6A 3SK6A 1VQLA 1UE7A 1IW7C 1D5MC 4XQJA 2WAQB 4EVOA 4MHEA 4RWSC 4A3BH 1L0XB 2N3SA 2EXDA 4MTKA 1XYIA 2ID0A 2JE6I 2ZM6Q 1LTTD 2NBFA 4GN5A 3TQYA 2ZXRA 5TSSA 3RZOH 4UP8A 2RDHA 2MJ8A 1S3OA 2X69A 3Q8DA 1I6VC 3KF8A 2PQAB 2GVBA 5JOBA 2TMPA 1I94Q 2N78A 3F2BA 2EJMA 3RZDB 2CQAA 2PZTA 4AYBE 1GKHA 2AWOA 2F0FA 3L2PA 1EIYB 1SNDA 3N52A 4FO2A 4R4QA 1KNAA 3HOXH 1MGSA 1YJ9A 1C9OA 3S16H 2A69D 3A5ZB 3I4OA 1TWHH 2VUMH 5LHY1 5JJLA 1MI2A 2M2LA 1Q1BA 2QEJC 1EY9A 1U4MA 1TKWB 3HOYB 4LFBQ 3BZCA 1ZEQX 1HR0Q 2F0WA 2UXCQ 2BE5C 5ELDA 2A5HA 4Q0FA 3RN5A 1YIJA 3F2UA 1EYGA 2EY5A 3S15B 1FYCA 3LX0A 1A8VA 3M7GA 4NDXA 4B3TQ 5COYA 3S1RH 3S9WA 2KHJA 4DV0Q 3I70A 3NSWA 4DUZL 4DUZQ 3IKJA 5ELEA 2HHHL 3S2DB 2HHHQ 2QKIC 1HUNA 1JT8A 1Y8OB 4DU9A 1PZKD 3KDFA 5FO7B 1DYQA 3PO3H 4Q5VA 1JICA 2A68C 3GTPH 1YEZA 1LO5D 3CCLA 2ASBA 2JP1A 5ELOA 3HOZG 3D6WA 4CDFC 3HOUB 1WI5A 3CMEA 4RKBA 3RLOA 5EGTA 4BBRH 5M3MB 4JCVE 2Z4HA 2EY2A 3HP3A 4Y7NH 4ALPA 3PF4A 1FVIA 1LT6D 2Q8RE 3IRBA 1K73C 3A0JA 1IL2A 4A3MG 4A76A 2DJGC 2EJFC 2E76C 3TMEA 4BBSH 3TP8A 2K1BA 3KBGA 2Y0SE 1JORA 1SDFA 2RKSA 2AKWB 4A3KH 1A6XA 4CKBA 1GUOA 1HA5A 4LW1A 1TS2A 2E5LL 1SE3A 4QIWB 1HJPA 4JI5L 4JI5Q 3WWVA 1CT1D 1TY0A 2PZWA 2NVQH 4EQOA 2VQEQ 4IJHA 3S2HH 4B9WA 4LF9Q 4LUOA 1E2VA 2RDGA 3DMUA 4ZUJA 1N33L 5AJ3Q 1N33Q 4MNOA 3SVMA 5C3EB 3ER0A 4DPGA 1PH8A 3EBEA 1HPCA 5CMDA 2WIIB 3PIP3 3EN2A 4RHSA 5FLMH 3M3YH 4BA1I 2NN6H 4ULLA 2D5DA 2KOLA 4JYAL 2I0QA 4EGVA 4DA2A 4CBVA 1D6EC 4X62L 3NQIA 1KRTA 3Q22A 2XNAC 2WAQG 1Q46A 3CD6A 3X3MA 4A3GB 5J39A 2F4VQ 1NUCA 3P1HA 3J81L 3C3LA 1Y1WB 1S5ED 1VQAA 3W1GA 3FMCA 2B63H 4UDUC 2EDGA 5CV9A 3T1HL 2G5DA 1WCMB 3Q6SA 3EIVA 2Z9HA 1NR2A 3I73A 2AUJD 1CKNA 1Q90A 1PH2A 4QCLA 3MEHA 2BOSA 1CQVA 1VMCA 1K3RA 2ZT9C 4XYOA 1QZHA 5C44H 4DNTB 3GTOH 2I07B 2QF7A 1Q8IA 2Q8TA 1G2TA 3H6MA 3Q0AA 1TWAB 1ILQA 2F3WA 1QVGA 4FF1A 4XQNA 2NZ1D 1WTPA 1XNRQ 5KRUA 1D7QA 2LSSA 3VA7A 1X6OA 4WJWA 1H9SA 4MZ9A 3IL8A 1W3SA 3HEJA 4X64Q 1ONLA 3ERSX 1PH3A 1GUSA 2F1MA 2EYHA 5CBEE 2EYFA 1ICFB 1UE5A 3HOYG 2E2HB 1HNWL 4DV4L 1Q12A 1PRTB 2JYOA 2NVYH 1YJNA 1BBUA 4R8NA 1SYCA 1NJIC 5C0XG 4JI4L 3M85A 5IY0A 1ENAA 4OXPA 4JI4Q 1I6HB 1CTMA 4I7ZC 4BY7B 5I2XA 1I4HA 1WOCA 1YNJC 5IP7G 3KLWA 2L11A 2K33A 4J6HA 3GTJB 4RHRA 2IL8A 1QG7A 3EROA 4XYQA 3FDTA 2AQ3B 2VB3X 4G7ZC 1BO0A 4DR6Q 5HY6A 4HJ5A 4ABNA 2FFKB 4DV1Q 1IYJB 4ZLTF 3CQZH 1XPRA 5EQ0A 1VQNA 1SAPA 3N6RA 3HOUG 4GKJQ 1SYDA 1VDZA 1MJEA 2ZJPA 1BXTA 5KNBA 4C1NK 4AYBB 5M3MG 2R93B 3UDGA 4C2MH 1GUTA 5E4XA 4DV6L 1RODA 4H13C 4KY7A 1LT4D 4G7HC 4RG1A 4KD3A 1D5XC 1F2YA 1SXTA 3HKZE 5L37A 3BVZA 2M00A 3M9BA 4K2LA 1XJVA 3D3RA 4KD4A 3E5SA 3P20A 4GLXA 5C4JH 2PPBC 1LYLA 2AHOB 2J4XA 2KA7A 1X3EA 3BJUA 1JJ2A 3AYHB 2EVBA 3BDCA 4DK3C 1YNNC 3H91A 1BF4A 2F0GA 1GO3E 4HJAA 4DR5Q 2E2DC 3STBD 4R4CA 1VQIA 2J7ZA 5FLXc 2V4DA 4DUYQ 1EWCA 4FNFA 3SE0A 5M5XH 1WVLA 1EYDA 3JAMc 3GO5A 2O5IC 3QIAA 3CC2A 2B29A 4RGTA 1Z7TA 3CC7A 1LTBD 3H09A 3HOZH 4QJFA 3SDZA 2KJXA 2XVSA 2D62A 2F0HA 1YJWA 1HZ9A 1STYA 1HZBA 3VYUA 1TWCB 1KC8C 4A3GG 2F0PA 5BR8L 2JN4A 3PUXA 4A3MH 3NTIA 3Q23A 1Y1WG 3HRZC 1EOTA 1EY0A 4C3JB 1VQ8A 1EWHA 2C35B 1XMOQ 1YHQA 1WCMG 3BYTB 3T56B 2K32A 4BWGB 2ES2A 3WDNA 1EIGA 5C3WA 1X3QA 3U58A 3S1NB 2OQ0A 2WKDA 3EJIA 2VW9A 1N34L 3QJYA 3S1QH 3F8TA 2GA4B 4GNXB 4GS3A 2Y0SB 4JI7L 1DOMA 1TU2B 2ICEC 4JI7Q 3VR5A 4JI1Q 4GN3B 2QA4A 1KXLA 3K7AB 3VR2A 5E1FA 1JWUD 1UAPA 3OYYA 1HH2P 2UUAQ 2UXBQ 3AMUA 1TT2A 4NMZA 1SLJA 1A0IA 1ILPA 3OOCA 2QILA 1TWGB 2GN5A 1PH7A 2ENBA 1I4PA 1PFNA 4H0LC 1A62A 1N9WA 4B3SL 1EWIA 2RA4A 3L7ZC 1YBYA 3M4PA 2VQFQ 3I7FA 3AQQA 1S5CD 1XTCD 2CWPA 5FOBB 1EUJA 1YHBA 5E4WC 4B9XA 1II3A 1HR0W 1EZ8A 2JSOA 1SN8A 3GQBA 5CC4A 1ASYA 1F9PA 2BCOA 3D0FA 3W3AA 2I46A 1WD0A 3M4QA 1PH1A 2A8VA 4BY7G 1NE3A 3DHQA 4O2DA 4J1MA 1YHAA 3DUZA 3TEHB 1XMQL 3RZDH 4M1UB 2NB0A 4UPAA 4KY5A 4Y52H 4DV7Q 4P74A 4AQYQ 5I4DA 1IKLA 1UWVA 4FXKC 2ZTCA 4YY3Q 1TS5A 1OXVA 2F0VA 1F77A 2Z0SA 5A2QE 1A15A 1SROA 4S3SA 4AYBG 2R93G 3I4MB 3BDLA 1EFWA 2Z6KC 1AP0A 2J0TD 2KECA 2B2YC 3T51B 5GAEC 4KJOA 1MKHA 1KQSA 4A75A 1JQYD 3HOYH 3A5UA 4DF7A 5C5LA 2F0NA 1IYVA 4X3KA 2BH2A 3S15H 2MUYA 1X54A 1Q82C 5C0XH 3NENA 3VYSA 3PV0A 3HS0C 4KK7A 1OO9B 4IFDG 2VY3A 5IP7H 1E7ZA 2B8FA 3KF6A 4WFN3 2NN6I 3LWEA 3KYHC 5M5WB 2JA5B 4OGQC 4GLAC 1ESRA 1UUPA 2K05A 1U4RA 5D65A 4QL5A 1M4VA 3S2DH 2Q2HA 1NSNS 4RMFA 1TIID 1UE1A 4TSSA 4TKOB 2L15A 4QF4A 4CDDC 4F7XA 1IW7D 4DXFA 5HGQA 4A3LG 3EFXD 4OO1G 1HFNA 4JW0A 2MFIA 1S72A 4UAIA 5FLXE 4P75A 2YYZA 2RF4A 5CV4A 3HOUH 5C0XJ 3R8BA 1QZGA 2DJFC 3D6CA 3JAME 3B6YA 1WTHA 1I3QB 1P16A 4PZ6A 5M3MH 4CGYB 3MZ5A 3K5MA 1GOZA 2HQLA 1IBMQ 2B2VC 1QB5D 4ZAIA 1PH5A 1B9NA 4GKKQ 1L1OB 2EYLA 1SJHD 3OIPA 2IX0A 5ELNA 4L5TA 4C3JG 3GTQB 3K7UC 4IPCA 3CKIB 4IZ8A 4A3DB 5IYCG 1QOHA 1B3AA 1Y8PB 4R4IA 4DFAA 2JXMB 4OEMB 4OX9L 5KNCA 4DR7L 2D0PA 4GZYC 1CZWA 2XIWA 4DR1Q 3MEFA 4KHPQ 2IX1A 4DR4Q 2F3VA 1QUQB 3HKZB 5GAGC 2Y0SG 4K0KQ 4K0KL 1TWFB 5BN5A 2E2IB 3I72A 3TS0A 4O0AA 3LNNA 3CCEA 2PMZB 1WTXA 1RTNA 2PI2A 1BQQT 1O7IA 4LF5L 4LF5Q 2BE5D 4YCVA 2OTJA 1J5EQ 3PGZA 1F9SA 1FD7D 2UUCQ 3QB3A 3NPPA 3PUWA 4DNIA 4JOIA 4X65Q 1U0LA 4PNYA 4CJ1B 4A3GH 2QDBA 2NUCA 4U68A 4DKAC 2IT1A 2A1AA 4A3IB 4PZ8A 1VQ7A 1TVXA 1SNQA 1SMXA 3K5OA 4CJ0B 1PRTC 3MXUA 2ZM6L 1WTVA 2ZTEA 3I3CA 1EY5A 4X66Q 2NZHA 2I5HA 1KABA 2IPKD 1GHKA 5DNFA 1F9QA 1WCMH 2F0IA 4L6TB 1NMFA 1I4RA 3C2PA 2XGTA 1K8OA 1PRTF 2UUBQ 4P71A 1LTID 2VZAA 3T53B 2A6EC 2RVLA 5D14A 3VR3A 2QDLA 1I94L 4KJNA 4HIKA 2CFMA 1H9MA 2A68D 3GTGB 3KF8B 2MHVA 4IUUA 2B2WC 1A63A 2HCIA 1SSOA 5J22A 1GUNA 1TWAH 2HDLA 4HSVA 2AMCB 4G7OC 2EYJA 2DUDA 4HEDA 1CHQD 1D5ZC 2TSSA 3CCJA 1M1KC 1QILA 2NZOA 4XDXA 1E3PA 1VQBA 1VF7A 4ODGA 3I4MG 3ZJYC 1VQDA 4H02A 4WJ3M 2RBMA 1N8RC 4PV1C 1M8AA 1S5DD 2E2HH 4LFBL 4RCOA 1HR0L 2UXCL 4BS9A 4UP7A 2HIXA 3I2ZA 1DM0B 1HQMC 2I5LX 2K01A 4OHJA 1DONA 4GN4B 4DAYA 5C5MA 1KLGD 2ICIA 1I6HH 1FNVA 1V1OA 5GADC 4XT1B 1VQ5A 4B3TL 4BY7H 2KEEA 5AFWA 3QG1A 3WOFA 3MWYW 1A3VA 1HRJA 3I4NB 5C4XB 4DV0L 1QCBD 1Y14B 3GTJH 2JA5G 1Y1VB 2K04A 2WB1E 1Z47A 4OONA 2Z6BA 4LK1C 2CW0D 4QY7A 1AN8A 3SK4A 4POFA 2HQEA 1STBA 2EYMA 3IFDA 3GTLB 4LF4Q 2EY6A 5GQOA 3CAMA 1CQFA 1OXXK 1HXYD 3CRLC 2NVXB 3CW2C 3VYRA 4ID6A 2R93H 1TQOA 1OXTA 4AIMA 5G3LF 1K83B 5I6WA 4LF6Q 3TRZA 4WRDA 3AEVA 4JI6Q 3FVQA 3C1FA 1BBXC 1A2TA 1G8ZD 3BZKA 3TZUA 2Z6KA 2LXKA 4FF4A 1AE2A 4FP5D 4A3JB 4A3DG 1B53A 4IO9A 4XQQA 4IFDH 3PUYA 1CSPA 1P8LA 1SMYC 2MP1A 1E0BA 3NBHB 4DR3Q 2WV6D 5ISRA 1EZ6A 1JWMD 2RSNA 4ZKBB 4KKUA 2NVTB 1PYSB 1V1QA 1RTOA 4GNXC 2VQEL 4LF9L 2JA7G 2UU9Q 1QNUA 3HKZG 2OCEA 1BCPC 3FRPB 4DXGA 5FO9B 5AJ3L 1PTOB 3KUPA 3HOWB 5IGGA 5A35A 1G291 4OO1H 4A3LH 2RCNA 1DCZA 3K8AA 3TREA 1OTCA 1FJGQ 4FXGC 3KK7A 5IYDG 2YU9H 1BCPF 2JA8B 5IGBA 1NR4A 3EVQA 2Q2TA 4IFDJ 4C3IB 2B2UA 2D9UA 1KD1C 2KBNA 1TWCH 3TZDA 1FNWA 1QVCA 1KIXA 4A3IG 2F4VL 1YNJD 1J8IA 2K5WA 1HQRD 4A93B 4C3JH 3UDIA 1BVSA 2N55A 5IYCH 1R9TB 2ATWA 3K58A 2B2VA 1PFBA 1K3BC 1NNXA 1YI2A 3M4OB 2VNUD 1D1IA 3OMGA 1SFOB 4KTAA 3KLRA 3S1NH 3OSOA 5LMNQ 4IUQA 2F0JA 4L63B 1STNA 2WACA 4NPSA 2L1BA 1GD7A 3H0GB 3TN2A 2V1CC 4HIDA 1PLFA 2ZTDA 4RAUC 1V9PA 3K7AH 4IUPA 2F0OA 1D2BA 4LAAA 3TDQA 1XNRL 5M3FB 2XWJB 1YZ6A 1PA6A 1TWGH 2A6HC 4YWMA 4PMCA 2CWAA 5C0XI 1T5EA 2F0KA 1KLUD 4X64L 3ONAB 2BDOA 1LABA 3FP9A 4FXDA 2QW7A 4WORA 1WFQA 1YITA 1S4ZA 5IOCA 1SEBD 1YNND 5D3IB 3NE5B 1RHPA 1K0RA 2G9DA 2JEBI 3A54A 1ZXTA 3OWEB 1PH9A 4IOCA 3SK5A 4QGUA 1WTWA 4ZK9B 3S1MB 3GV3A 4KLKA 3I4NG 3MA2B 5C4XG 3CPFA 1RD9D 1U4PA 2DNEA 2K7VA 3J81E 1Y1VG 1NTGA 1HCZA 2PW7A 5EBDA 4CHTB 1X32A 1U9RA 5T1GA 1CFMA 1I4XA 1N32Q 1KL9A 1SE8A 1D1KA 3JAMi 4DR6L 4DV1L 1LTRD 5M9OA 3IAYA 3CCQA 3CCSA 4UHVA 4IQZA 1PFMA 3G71A 2H5XA 2B2WA 4FDBA 3VR6A 1VQOA 4GKJL 3J80c 1LV9A 1STHA 4JG2A 2DNCA 2F0MA 1ESFA 1EOVA 2G9HD 4L5QA 1DOKA 4LF7L 4XT3B 4LF7Q 3K59A 3I4MH 5M5YB 4HCEA 4F8MA 2SEBD 3CMAA 5LMUQ 3P75A 3ERQA 5JJKA 5EBCA 3H3VH 1NBWA 1EQRA 2L55A 3ULJA 1L1OC 3TS2A 1GXDC 1MSGA 3U4VA 3G6EA 2CQOA 1F2MA 3S14B 1ZYRD 1EY7A 2MO1A 3ICEA 3ULLA 2LS01 1B4OA 4IOAA 1CSQA 4DR2L 4DR2Q 2PMZE 1E22A 1SR3A 1EU3A 3EQLC 1EY6A 2F0EA 4V0BA 3DWAA 4G57A 4C56C 1V1PA 2C9OA 3I90A 5CV8A 2JQOA 5I2YA 1VCIA 1XWEA 2JJQA 4DR5L 5BN4A 2JA5H 2KCTA 3FKIB 3DWPA 4HMIA 4PZ7A 4RCNA 2AWNA 4DUYL 1A2UA 3NBIA 3HOWG 5C3EG 1LT3D 2R7DA 1E2WA 4OELB 1VQ6A 1RJTA 1CKOA 3CRKC 4O42A 3K5NA 5E3FA 2QCPX 2JA8G 1FNUA 1PH4A 3E6ZX 1I3QH 5IWAQ 2WB1B 4C3IG 2VS1A 3PCOB 5KGUA 3J7ZC 5JVG3 1SNOA 1IZ6A 1KDCA 5JPNC 4JI2Q 1I50B 4KN7C 3RMHA 2MPMA 5IT9L 2SOBA 4GOPB 4TQUS 4A93G 1PVOA 2P5ZX 4K6LA 3GTQH 3CCMA 1YVCA 4C3HB 1JWSD 4A3DH 3T1YL 3T1YQ 2K52A 3I91A 1BKBA 2F0DA 1XMOL 3FHWA 4K2KA 3DLLA 3PO2B 4AH6A 3D4WA 2WKCA 3QR8A 4QMGA 1RIPA 3UI2A 1EQTA 3AFQA 3CC4A 2E2JH 4OIJA 4UP9A 1AW7A 2KCNA 2O2LD 3SXHA 2JA7H 3H0GG 1UEAB 4IALA 1TWFH 4JI1L 3I56A 2E2IH 4ILWA 1XPUA 4KKSA 4GNXA 1IXRA 4LF8L 2K28A 4LF8Q 2UUAL 2UXBL 5M3FG 5IYDH 3SGIA 2H4OA 1HUMA 4A3FB 1D8LA 5A2QL 3H15A 2E8GA 3A8KE 2DGYA 4LFCQ 4DK6C 2YTVA 4P73A 2EJGC 3CXCA 1ML0D 2K5QA 3GTOB 3K81C 1QWYA 5CYUA 4ME5A 4A3IH 2VQFL 1IBKQ 2R92B 2FHTA 4BXXG 3RUZA 4MIUA 3HOVB 1WJJA 2L4NA 1K0SA 4IJLA 5IP9G 4KN4C 2PNHA 2IY5B 4JBJA 5DM63 4H44C 3HZXA 1QVFA 3U9SA 3NXWA 2D2CC 1J6QA 3GTGH 4B3MQ 1VQHA 4DV7L 1PXUA 4AQYL 4JV5Q 1PYBA 3C1EA 2F4IA 1G91A 4YY3L 5CBAE 4B3RQ 5I6YA 3X3NA 1G2SA 1CUKA 3VA5A 5FLXL 5GAHC 4ZUIA 1LUZA 2B2TC 1CK1A 3T4AC 2QEXA 2K5HA 3UE1A 3JAML 4N9TA 1WD1A 3SR1A 2KQ3A 3CPWA 4R4TA 4IFDI 5C4ZA 3D4RA 4K8IA 1JMCA 3J80E 1WTQA 3BS1A 3U9OA 3K0XA 4IN3A 2X6GA 3CQZB 3F1ZA 4X3TA 1GM5A 4LFAL 4LFAQ 2AUKA 4YCUA 1HTLD 1X3GA 2OQKA 4K5WA 5DM73 2PYKA 4ZCKA 3TP7A 4PMBA 4PQXA 3OTOQ 5NUCA 2JA6B 4OO1I 1MSHA 1STGA 4C2MB 2B3GA 1VQFA 4MN3A 3I4NH 2HIVA 4CJ2C 1ENCA 5C4XH 2CH4W 4KHZA 1EFID 3FKIG 1Y1VH 3MXPA 2Z1CA 4DV2Q 3PIOA 1CZGA 4DN4M 2FMMA 2WFWA 4DNRB 1PTOC 2HCCA 1B50A 2MNAA 2F0LA 3KF6B 4HTHA 3VYTA 4DAMA 3GTLH 4FVMA 5C4JB 4DAVA 1SNMA 1Q8KA 5EPLA 5JPMC 5H1SE 4DV5Q 1DZ1A 1A3UA 1PTOF 1FR3A 1H95A 2NVXH 1PRTD 3SHLA 1LACA 1JJGA 1TS3A 1BR9A 2WB1G 2XRSD 5CGKA 3KLSX 1SBBB 1QE6A 1K83H 5ELCA 3GTKB 1JOOA 2SNMA 2L0CA 4YHHQ 1RF2D 2Q2UA 1CHPD 2OEOA 1LTGD 1IBML 2EIFA 4GKKL 1UNSA 3NQTA 1GJXA 1H9KA 3OW2A 2FJ2A 3A56A 4C3HG 1E1TA 1KRSA 2KHSA 1DJRD 4A3EB 1S5BD 2B39A 4C1NI 1RCVD 5DAUA 4JI8Q 3PO2G 3PMFA 3BYYB 3F2DA 4I65A 1IYUA 4YIJA 4CKCA 1IKMA 4K5VA 2NVTH 4NXNQ 1XNQL 4DR1L 5LMNW 1XNQQ 2K4KA 4KHPL 4DR4L 5I9OA 4WJ4A 4DAPA 1ASZA 1PTOH 1B1ZA 3HOWH 5C3EH 3U50C 4IPDA 5FKAC 1EIHA 1IHZA 3F2CA 1V8QA 2QGQA 2PO4A 1K8GA 4XIGS 4OL7A 4QQBX 1Q1EA 4N8X1 1L0YB 4A3FG 1Q7YC 4DV3Q 2JA8H 1PV4A 1J5EL 1IBLL 1IBLQ 3VR4A 2UUCL 1O7YA 2C5CA 3PSIA 4C3IH 3NEMA 4BY1B 4X65L 4OWTB 3DEOA 4RA8A 3MXNA 4XTCS 1HFGA 4R4OA 1EU4A 1S5FD 2UXDQ 3W1BA 2Z8LA 2R92G 4JI0Q 5IGCA 1Y1WH 3CP0A 3RD4A 4NP5A 1EQQA 4A93H 1VMPA 2KCCA 3HOVG 4X66L 3I4LA 4MTNA 2L9HA 3A8IE 1R9TH 1FL0A 1HHVA 4HIMA 4YWKA 3NK9A 3M4OH 1NY4A 2K75A 4YWLA 3E0EA 4IPHA 1SFOH 1CA6A 4K8JA 3RNUA 2UUBL 2DY7A 3BU2A 2OTLA 2NWGA 5G3LD 1ENFA 3L0OA 2PQAA 1C0AA 3H0GH 4JBWA 4U673 1SRUA 4ME3A 3RLFA 1W6KA 5C3XA 1ET9A 1AH9A 1BDOA 3H3VI 3J7AV 1C7YA 1EEID 5M3FH 2EQSA 4F88A 1LTLA 1JB7A 2KUMA 5BN3A 2JA9A 1T9HA 4JBMA 3A7AB 2R7FA 4O1NA 4JBKA 2K5NA 4DK1A 1LM0A 1SMYD 1KTKA 2EYPA 3ND9A 3MAQA 4ZQ3A 3K57A 2N8NA 4CDEC 4BXXH 5K36G 3P7JA 4K6DA 3RR5A 2WP8J 1F9RA 4IUTA 3NELA 5DEHA 2F03A 5IP9H 2ZJQA 2VL6A 1L0WA 3MHBA 1OXSC 4LUZA 3J81c 1BCPD 1AZPA 1BBWA 2JA6G 3S1MH 3BVMA 2OF1A 3PIPA 2R7ZB 4KY6A 3CCVA 2RHQB 4DAYB 3AB9A 4KKTA 4X3SA 1HZCA 2YV5A 4K14A 1VS0A 3UDFA 3R3OA 1STEA 4JVZA 1EYCA 4BA2I 1X3FA 2BA0A 3NTKA 1Q3LA 3EA6A 2KENA 3GP7A 3M4YA 4EQNA 4LF4L 1ET6A 2K50A 1VQCA 1EQVA 5IGDA 1CM9A 2K03A 1JE4A 4RGNA 5DLQE 2JK8A 1SJED 2HDMA 3KDFB 2AQ2B 2N49A 5M5YH
chains in the Genus database with same CATH topology
5FO8B 1F2ZA 3BZDB 2B2TA 3IFTA 2LKVA 3WOEA 3E0JA 1R4QB 3NUCA 2B2YA 1V43A 1GUGA 2KVMA 2WINB 4DK0A 4L8JA 1B2TA 2A74C 3C46A 2BA1A 2A69C 2K5DA 3A8JE 5KYLA 2A6HD 5HGTA 1TY2A 2IWHA 3NBHA 2EXZA 3BDOA 5JEAG 3GTMB 4IUVA 2X6LA 1QJOA 2OXPA 1O78A 1KDAA 1LT5D 5IGEA 1B9MA 4HAEA 1NCVA 1TR5A 5JAVA 3L9AX 3GD7A 4ZKCB 5EKIA 3S17B 4Z9CB 4JK1C 3T13A 2XWBB 2NTTA 3TP6A 1H9JA 3NTHA 2CW0C 4FF2A 1O7LA 1EL0A 5ELFA 4RH6A 3Q24A 1SYGA 2ZXPA 3QWNA 1W6JA 1GHJA 3ZYYX 4K5XA 3FPUB 4A3BB 1JC7A 1KDBA 2L5TA 4QUCA 1I4QA 3MTSA 1F2LA 3RZOB 2Q8IB 2CHBD 5IODA 3K0YA 2RDFA 5JVH3 5I9PA 2R61A 3K5LA 1QNKA 3V05A 2FMCA 1LTAD 1PZJD 3DXJC 5IGFA 2EY1A 5LL6S 4QUFA 1SE2A 2IW3A 3H3VC 1H9SB 3MVVA 5C6AA 2DY8A 3W2DA 2SNSA 4DGZA 1JCKB 5CORA 1R4PB 3HOXB 4NW2A 3S16B 2JEAI 1G6ZA 2H1EA 1TWHB 2K6AA 3GV6A 2VUMB 5ELBA 3QO2A 3OHXC 2VB2X 1O80A 1EY8A 2XN9C 1AZQA 1DXMA 4HMJA 5J1ZA 3NP8A 2NTSA 1OXUA 5CV6A 2EOTA 5EKLA 1EY4A 1AFPA 3S1RB 2F0UA 4G4KA 3MXGA 3G6JB 3OIQA 2N88A 3OWFA 2LMCB 2RSOA 1PMRA 1BUVT 2BDNA 4NKLA 3PO3B 5T1IA 1ICWA 5K36H 3GTPB 1DOLA 1FGBD 4BBRB 1C48A 4RGOS 5K5PA 4Y7NB 4XXEA 3BG3A 1CI3M 4IURA 4BBSB 1V1PB 4A3KB 3R93A 2NYZD 4R8IA 2F0QA 4V190 2ZXOA 2O4XA 1J9OA 4IUNA 5KIXA 2NVQB 4HR7B 3S2HB 3BVGA 3KBXA 3J7AF 1SYFA 3D8GA 1GUWA 1PDQA 2OT2A 1SYBA 1JOQA 3A55A 3OW7A 4TRDA 4EQPA 3M3YB 1JR0D 2F0SA 2YU9B 4E6IA 3HGBA 2PCFB 5LL6X 5KNDA 1KAAA 4RKLA 1Y69U 1Z6HA 3DM1A 5KEEA 2O5JC 1I4GA 4KMUC 4P2CB 3K6OA 3LWUA 2B63B 3MC0B 3QOJA 5JEAH 3ITPA 1IL8A 1DD2A 3PUVA 2PNRC 2L12A 2FINB 4LMQD 2RQXA 1ZYRC 1LLRD 2EE1A 5C44B 1SYEA 4H7BA 5IIFA 1BCPB 3J80L 5HURA 3R2IA 1XX8A 4ZRZA 2B8GA 3A7LA 5CV5A 3H94A 3G7LA 3D31A 5JEAJ 1PTOD 1A3TA 1MD2D 2MGSA 1U4LA 5EKKA 2LFNA 1LTSD 5IT9E 4B08A 3KLSA 1BOSA 2IX3A 5JJZA 2NVYB 3CU7A 4R9WA 4HSPA 3TSSA 3URYA 3MFGA 1JB3A 1K8MA 1C4QA 4HCSA 5EJWA 1CA5A 4KI0A 5KYIA 3DEPA 4QB4A 2PZUA 1WTRA 2DN8A 1O7ZA 1B44D 1ZKOA 2A73B 1JOKA 1AEXA 3OMCA 3FPPA 1T5XD 3SK8A 3ND8A 1Y8NB 4KHVA 3M7NA 3AU7A 3O13A 5EPJA 4X3UA 1XXGA 4HN7A 4FYDA 1KNEA 3R2TA 4N9PA 2IJ0A 1SNCA 1X3PA 1NAPA 4F87A 2E75C 3MFYA 1RDPD 3L3OC 1PZID 4J8QA 2CVRA 2SDFA 2AQ1B 3FEWX 4M8AA 2F0TA 5CV7A 2PW5A 4OIKA 1HTPA 2LY7A 4FF3A 5EPKA 4PMWA 4RGMA 3NHHA 3J7YW 2XSCA 2XRQD 5FK9C 4RFBA 5M5XB 2EYOA 4ZYSA 2A6ED 2B2UC 3CHBD 4KV6A 3I8ZA 2NN6G 3HOZB 3TP5A 1H9RA 2Z4IA 5CR3A 1STAA 1BNZA 3D4DA 4A3MB 4CKEA 3QOLA 2EPBA 1RKNA 1C8CA 1SE4A 2R6GA 2PQEA 2KEDA 2M9VA 1E2ZA 5D3DA 4LJZC 3V2TA 2E74C 3DWQA 3V96A 1EEFD 5F2DA 3SEBA 3HG9A 3NWTA 3T16A 1MBYA 3NWSA 3PUZA 2E2JB 3S1QB 2R3ZA 1WTOA 2VXWA 1VF5C 1SNPA 5C4HA 2HUGA 1EYAA 3OPOA 1TS4A 1PYWD 3TBIB 2EZVA 3PIO3 1HA6A 3SK6A 1IW7C 1D5MC 4XQJA 2WAQB 4EVOA 4MHEA 4RWSC 1L0XB 1XYIA 2ID0A 2JE6I 1LTTD 2NBFA 2ZXRA 5TSSA 2RDHA 2MJ8A 2X69A 1I6VC 3KF8A 5JOBA 2TMPA 2EJMA 3RZDB 2CQAA 2PZTA 2AWOA 2F0FA 1SNDA 3N52A 4FO2A 1KNAA 1MGSA 2A69D 5LHY1 1MI2A 2M2LA 1Q1BA 2QEJC 1EY9A 1U4MA 1TKWB 3HOYB 1ZEQX 2F0WA 2BE5C 5ELDA 2A5HA 4Q0FA 3F2UA 2EY5A 3S15B 1FYCA 3LX0A 3M7GA 4NDXA 5COYA 3S9WA 3I70A 3NSWA 3IKJA 5ELEA 3S2DB 2QKIC 1HUNA 1Y8OB 4DU9A 1PZKD 5FO7B 1DYQA 4Q5VA 1JICA 2A68C 1LO5D 2JP1A 3D6WA 3HOUB 4RKBA 5EGTA 5M3MB 2Z4HA 2EY2A 3HP3A 1LT6D 2Q8RE 2EJFC 2E76C 3TMEA 3TP8A 2K1BA 3KBGA 1JORA 1SDFA 2RKSA 1A6XA 4CKBA 1GUOA 1HA5A 1TS2A 1SE3A 4QIWB 1CT1D 1TY0A 2PZWA 4EQOA 4B9WA 1E2VA 2RDGA 3DMUA 4ZUJA 3SVMA 5C3EB 1HPCA 5CMDA 2WIIB 3PIP3 4RHSA 4BA1I 2NN6H 4ULLA 2D5DA 2KOLA 4EGVA 4DA2A 4CBVA 1D6EC 3NQIA 3Q22A 2XNAC 3X3MA 4A3GB 5J39A 1NUCA 3P1HA 3J81L 3C3LA 1Y1WB 1S5ED 3FMCA 4UDUC 2EDGA 5CV9A 1WCMB 3Q6SA 1NR2A 3I73A 2AUJD 1Q90A 4QCLA 3MEHA 2BOSA 1CQVA 1VMCA 2ZT9C 4XYOA 4DNTB 2I07B 2QF7A 1Q8IA 2Q8TA 1G2TA 3H6MA 3Q0AA 1TWAB 1ILQA 2F3WA 4FF1A 4XQNA 2NZ1D 1WTPA 5KRUA 3VA7A 4WJWA 1H9SA 3IL8A 3HEJA 1ONLA 1GUSA 2F1MA 2EYHA 5CBEE 2EYFA 2E2HB 1Q12A 1PRTB 2JYOA 4R8NA 1SYCA 5C0XG 3M85A 1ENAA 1I6HB 1CTMA 4I7ZC 4BY7B 5I2XA 1I4HA 1YNJC 2L11A 2K33A 4J6HA 3GTJB 4RHRA 2IL8A 1QG7A 3EROA 4XYQA 3FDTA 2AQ3B 2VB3X 4G7ZC 1BO0A 4ABNA 2FFKB 4ZLTF 5EQ0A 1SAPA 3N6RA 1SYDA 1VDZA 1BXTA 5KNBA 4C1NK 4AYBB 2R93B 1GUTA 5E4XA 1RODA 4H13C 4KY7A 1LT4D 4G7HC 4KD3A 1D5XC 1F2YA 1SXTA 3BVZA 2M00A 4K2LA 3D3RA 4KD4A 3E5SA 3P20A 2PPBC 2J4XA 2KA7A 2EVBA 3BDCA 1YNNC 3H91A 1BF4A 2F0GA 2E2DC 2J7ZA 2V4DA 1EWCA 4FNFA 3SE0A 1WVLA 1EYDA 3GO5A 2O5IC 3QIAA 4RGTA 1Z7TA 1LTBD 3H09A 3SDZA 2KJXA 2XVSA 2D62A 2F0HA 1STYA 3VYUA 1TWCB 2F0PA 3PUXA 3NTIA 3Q23A 3HRZC 1EOTA 1EY0A 4C3JB 1EWHA 3BYTB 3T56B 2K32A 4BWGB 3WDNA 1EIGA 5C3WA 1X3QA 3S1NB 2WKDA 3EJIA 3QJYA 2GA4B 2Y0SB 1DOMA 1TU2B 2ICEC 3VR5A 3K7AB 3VR2A 5E1FA 1JWUD 1UAPA 3AMUA 1TT2A 4NMZA 1ILPA 3OOCA 2QILA 1TWGB 2ENBA 1I4PA 1PFNA 4H0LC 2RA4A 3L7ZC 1S5CD 1XTCD 5FOBB 4B9XA 5E4WC 1II3A 1EZ8A 2JSOA 3GQBA 5CC4A 1F9PA 2BCOA 3W3AA 2I46A 1WD0A 3DHQA 4J1MA 3DUZA 4M1UB 2NB0A 4KY5A 5I4DA 1IKLA 4FXKC 1TS5A 1OXVA 2F0VA 1F77A 5A2QE 1A15A 4S3SA 3I4MB 3BDLA 1AP0A 2J0TD 2KECA 2B2YC 3T51B 4KJOA 1JQYD 4DF7A 5C5LA 2F0NA 1IYVA 4X3KA 2MUYA 5C0XH 3VYSA 3PV0A 3HS0C 4KK7A 1OO9B 4IFDG 2B8FA 4WFN3 2NN6I 3LWEA 5M5WB 2JA5B 4OGQC 1ESRA 1UUPA 2K05A 1U4RA 5D65A 1M4VA 1NSNS 1TIID 4TSSA 4TKOB 4QF4A 4F7XA 1IW7D 4DXFA 4OO1G 3EFXD 1HFNA 4UAIA 5FLXE 2YYZA 5CV4A 5C0XJ 3R8BA 3D6CA 3JAME 1I3QB 4CGYB 3MZ5A 3K5MA 1GOZA 2B2VC 1QB5D 4ZAIA 1B9NA 2EYLA 1SJHD 3OIPA 2IX0A 4C3JG 3GTQB 4IZ8A 3CKIB 4A3DB 1QOHA 1B3AA 1Y8PB 4DFAA 2JXMB 5KNCA 4GZYC 1CZWA 2XIWA 2JA7B 2IX1A 2F3VA 3HKZB 1TWFB 5BN5A 2E2IB 3I72A 3LNNA 2PMZB 1WTXA 1RTNA 1BQQT 2BE5D 1F9SA 1FD7D 3QB3A 3NPPA 3PUWA 4PNYA 4CJ1B 2QDBA 2NUCA 4U68A 4A3IB 2IT1A 1TVXA 1SNQA 4CJ0B 3K5OA 1PRTC 3MXUA 1WTVA 3I3CA 1EY5A 1KABA 2IPKD 1GHKA 5DNFA 1F9QA 2F0IA 4L6TB 1I4RA 3C2PA 1K8OA 1PRTF 1LTID 3T53B 2A6EC 2RVLA 5D14A 3VR3A 4KJNA 1H9MA 2A68D 3GTGB 2MHVA 4IUUA 2B2WC 2HCIA 1SSOA 5J22A 1GUNA 2HDLA 4HSVA 4G7OC 2EYJA 4HEDA 1CHQD 1D5ZC 2TSSA 1QILA 4XDXA 1VF7A 4ODGA 2RBMA 4PV1C 1M8AA 1S5DD 4RCOA 4BS9A 1DM0B 1HQMC 2K01A 4OHJA 1DONA 4DAYA 5C5MA 1KLGD 2ICIA 1FNVA 1V1OA 4XT1B 2KEEA 5AFWA 3QG1A 3WOFA 3MWYW 1A3VA 1HRJA 3I4NB 5C4XB 1QCBD 1Y1VB 2K04A 1Z47A 4LK1C 2CW0D 3SK4A 1AN8A 1STBA 2EYMA 2HQEA 3IFDA 3GTLB 2EY6A 1CQFA 1OXXK 1HXYD 3CRLC 2NVXB 3VYRA 4ID6A 1TQOA 1OXTA 5G3LF 1K83B 5I6WA 4WRDA 3FVQA 3C1FA 1BBXC 1A2TA 1G8ZD 3TZUA 4FF4A 4FP5D 4A3JB 1B53A 4XQQA 4IFDH 3PUYA 1SMYC 2MP1A 1E0BA 2WV6D 5ISRA 1EZ6A 1JWMD 2RSNA 4ZKBB 4KKUA 2NVTB 1RTOA 1QNUA 5FO9B 1BCPC 3FRPB 4DXGA 1PTOB 3KUPA 3HOWB 5IGGA 5A35A 1G291 4OO1H 1DCZA 4FXGC 3KK7A 1BCPF 2JA8B 5IGBA 1NR4A 3EVQA 4IFDJ 4C3IB 2B2UA 2D9UA 3TZDA 1FNWA 1YNJD 1J8IA 2K5WA 1HQRD 4A93B 2N55A 1R9TB 3K58A 2B2VA 1PFBA 3M4OB 2VNUD 1D1IA 3OMGA 1SFOB 4KTAA 3KLRA 3OSOA 4IUQA 2F0JA 4L63B 1STNA 2WACA 2L1BA 3H0GB 3TN2A 1PLFA 4RAUC 4IUPA 2F0OA 1D2BA 4LAAA 3TDQA 5M3FB 2XWJB 2A6HC 4PMCA 5C0XI 1T5EA 2F0KA 1KLUD 3ONAB 2BDOA 1LABA 4FXDA 4WORA 1S4ZA 5IOCA 1SEBD 1YNND 5D3IB 3NE5B 1RHPA 2G9DA 2JEBI 3A54A 1ZXTA 3OWEB 3SK5A 1WTWA 4ZK9B 3S1MB 3GV3A 3MA2B 1RD9D 1U4PA 2DNEA 2K7VA 3J81E 1HCZA 2PW7A 5EBDA 4CHTB 1X32A 1U9RA 5T1GA 1CFMA 1I4XA 1D1KA 1LTRD 5M9OA 3IAYA 4IQZA 1PFMA 2B2WA 3VR6A 1LV9A 1STHA 2DNCA 2F0MA 1ESFA 2G9HD 1DOKA 4XT3B 3K59A 5M5YB 4HCEA 4F8MA 2SEBD 3P75A 3ERQA 5EBCA 2L55A 1GXDC 1MSGA 1F2MA 3S14B 1ZYRD 1EY7A 2LS01 1B4OA 1EU3A 3EQLC 1EY6A 2F0EA 4V0BA 3DWAA 4G57A 4C56C 1V1PA 2C9OA 3I90A 5CV8A 5I2YA 1VCIA 1XWEA 5BN4A 3FKIB 3DWPA 4HMIA 4RCNA 2AWNA 1A2UA 3NBIA 1LT3D 1E2WA 1RJTA 3CRKC 4O42A 3K5NA 5E3FA 2QCPX 1FNUA 3E6ZX 2WB1B 4C3IG 5KGUA 5JVG3 1SNOA 5JPNC 1KDCA 1I50B 4KN7C 3RMHA 2MPMA 5IT9L 2SOBA 4TQUS 4K6LA 4C3HB 1JWSD 3I91A 2F0DA 4K2KA 3PO2B 3D4WA 2WKCA 4QMGA 3UI2A 1EQTA 4OIJA 1AW7A 2KCNA 2O2LD 3SXHA 1UEAB 4IALA 4ILWA 4KKSA 2K28A 2H4OA 1HUMA 4A3FB 5A2QL 3A8KE 2EJGC 1ML0D 2K5QA 3GTOB 1QWYA 5CYUA 4ME5A 2R92B 2FHTA 3RUZA 4MIUA 3HOVB 2L4NA 4KN4C 5DM63 4H44C 3HZXA 3U9SA 3NXWA 2D2CC 1PXUA 3C1EA 2F4IA 1G91A 5CBAE 5I6YA 3X3NA 1G2SA 3VA5A 5FLXL 4ZUIA 2B2TC 1CK1A 3T4AC 3JAML 4N9TA 1WD1A 3SR1A 2KQ3A 4IFDI 5C4ZA 3D4RA 4K8IA 3J80E 1WTQA 3BS1A 3U9OA 4IN3A 2X6GA 3CQZB 4X3TA 2AUKA 1HTLD 4K5WA 5DM73 2PYKA 3TP7A 4PMBA 4PQXA 5NUCA 2JA6B 4OO1I 1MSHA 1STGA 4C2MB 4MN3A 4CJ2C 1ENCA 4KHZA 1EFID 3MXPA 2Z1CA 1CZGA 4DN4M 2FMMA 4DNRB 1PTOC 2HCCA 1B50A 2F0LA 4HTHA 3VYTA 4FVMA 5C4JB 4DAVA 1SNMA 5EPLA 5JPMC 1DZ1A 1A3UA 1PTOF 1FR3A 1PRTD 3SHLA 1LACA 1TS3A 1BR9A 2XRSD 5CGKA 3KLSX 1SBBB 1QE6A 5ELCA 3GTKB 1JOOA 2SNMA 2L0CA 1RF2D 1CHPD 2OEOA 1LTGD 1UNSA 3NQTA 1GJXA 1H9KA 2FJ2A 3A56A 4C3HG 2KHSA 1DJRD 4A3EB 1S5BD 2B39A 4C1NI 1RCVD 5DAUA 3PMFA 3BYYB 4I65A 1IYUA 4YIJA 4CKCA 1IKMA 4K5VA 5I9OA 4DAPA 1PTOH 1B1ZA 5FKAC 1EIHA 1IHZA 1V8QA 2PO4A 4XIGS 4OL7A 1Q1EA 1L0YB 3VR4A 1O7YA 2C5CA 4BY1B 3DEOA 4RA8A 3MXNA 4XTCS 1HFGA 1EU4A 1S5FD 2Z8LA 5IGCA 3RD4A 4NP5A 1VMPA 2KCCA 3I4LA 2L9HA 3A8IE 1HHVA 3NK9A 1CA6A 4K8JA 2DY7A 2NWGA 5G3LD 1ENFA 4JBWA 4U673 3RLFA 1W6KA 5C3XA 1ET9A 1BDOA 3J7AV 1EEID 4F88A 2KUMA 5BN3A 3A7AB 4O1NA 4DK1A 1SMYD 1KTKA 2EYPA 3ND9A 3MAQA 4ZQ3A 3K57A 5K36G 3P7JA 4K6DA 2WP8J 1F9RA 4IUTA 5DEHA 2F03A 3MHBA 1OXSC 1AZPA 1BCPD 3BVMA 2OF1A 2R7ZB 4KY6A 3AB9A 4KKTA 4X3SA 4K14A 3R3OA 1STEA 1EYCA 4BA2I 2BA0A 3NTKA 1Q3LA 3EA6A 3GP7A 3M4YA 4EQNA 1ET6A 1EQVA 5IGDA 1CM9A 2K03A 1JE4A 4RGNA 1SJED 2HDMA 2AQ2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD4 A;  2L0C A; 
#chains in the Genus database with same CATH topology
 5FO8 B;  1VQ9 A;  1F2Z A;  3BZD B;  4LF6 L;  2B2T A;  2MO0 A;  3IFT A;  4JI6 L;  2LKV A;  3RN2 A;  3KJO A;  4OWX B;  3K80 C;  1X65 A;  4GOP C;  3S14 H;  3WOE A;  3E0J A;  1R4Q B;  3NUC A;  2B2Y A;  1V43 A;  4A3E G;  2BH8 A;  1GUG A;  2KVM A;  2WIN B;  4DK0 A;  4L8J A;  4JI3 L;  4JI3 Q;  1B2T A;  2K14 A;  3UDX A;  4DR3 L;  2A74 C;  3C46 A;  2BA1 A;  3J81 j;  4L5R C;  2A69 C;  2K5D A;  3FKI H;  3A8J E;  3S24 A;  5KYL A;  2A6H D;  1U5K A;  5HGT A;  2UU9 L;  1TY2 A;  2IWH A;  3NBH A;  2EXZ A;  3BDO A;  1PH6 A;  3CCU A;  1MHW C;  5JEA G;  3GTM B;  4IUV A;  2X6L A;  1QJO A;  1Q81 C;  2OXP A;  1O78 A;  1FJG L;  1KDA A;  2D0O A;  2E5L Q;  1LT5 D;  5IGE A;  1B9M A;  1YNX A;  2IHF A;  3LGJ A;  4J15 A;  4HAE A;  1NCV A;  4BY1 G;  1TR5 A;  5JAV A;  3L9A X;  3GD7 A;  1I50 H;  4ZKC B;  2YTX A;  5EKI A;  3S17 B;  4Z9C B;  3HKS A;  4JK1 C;  3T13 A;  3AFP A;  1N36 L;  1N36 Q;  1E1O A;  4C3H H;  2XWB B;  2NTT A;  1VQG A;  3TP6 A;  1H9J A;  1VQM A;  4JYA Q;  3NTH A;  1PFS A;  2CW0 C;  4FF2 A;  1O7L A;  4X62 Q;  3PO2 H;  1EL0 A;  5ELF A;  4RH6 A;  3G4S A;  3E3X A;  1SYG A;  3Q24 A;  2ZXP A;  1VQK A;  3QWN A;  2LXJ A;  1W6J A;  1X9N A;  1GHJ A;  3ZYY X;  4K5X A;  5LMN L;  1VQP A;  3FPU B;  4HIO A;  4A3B B;  1JC7 A;  1KDB A;  2L5T A;  1HZA A;  4QUC A;  1I4Q A;  3MTS A;  1F2L A;  4HJ9 A;  3RZO B;  1CKN B;  1X56 A;  2Q8I B;  2CHB D;  4JPB W;  5FJ8 G;  5IOD A;  3K0Y A;  3T1H Q;  4X6A H;  2RDF A;  5JVH 3;  5I9P A;  2R61 A;  3U4Z A;  3K5L A;  1QNK A;  3J80 i;  4A3F H;  3V05 A;  2FMC A;  1LTA D;  1PZJ D;  1HNX L;  3DXJ C;  5IGF A;  2EY1 A;  5LL6 S;  1HNX Q;  1S40 A;  4QUF A;  5EAY A;  1SE2 A;  5IYB G;  2IW3 A;  5GRO A;  3H3V C;  1H9S B;  3MVV A;  5C6A A;  2DY8 A;  2R92 H;  3W2D A;  2SNS A;  4DGZ A;  1JCK B;  5COR A;  1R4P B;  3HOX B;  1JE5 A;  3HOV H;  4NW2 A;  3S16 B;  4A3C G;  2JEA I;  1G6Z A;  1TXY A;  2H1E A;  2ZJR A;  1TWH B;  2K6A A;  3GV6 A;  1WYD A;  2VUM B;  5ELB A;  5IT9 c;  3QO2 A;  3OHX C;  1KHI A;  1VQJ A;  2VB2 X;  1O80 A;  2R7Z G;  1EY8 A;  2XN9 C;  1AZQ A;  4POG A;  1DXM A;  1HNZ L;  1HNZ Q;  2F3I A;  4YCW A;  1HNW Q;  4HMJ A;  1G51 A;  4DV4 Q;  1Z9F A;  5J1Z A;  3NP8 A;  2NTS A;  1N32 L;  1OXU A;  1PHJ A;  4P72 A;  5CV6 A;  2EOT A;  1CKM A;  5EKL A;  1EY4 A;  1AFP A;  3S1R B;  3G48 A;  2F0U A;  4G4K A;  4NXM L;  3MXG A;  3G6J B;  3OIQ A;  4NXM Q;  2K5V A;  4JC0 A;  5LMU L;  2N88 A;  3OWF A;  2LMC B;  2RSO A;  4EQ5 A;  1PMR A;  1BUV T;  2BDN A;  1Q86 C;  4NKL A;  3PO3 B;  5T1I A;  1VQE A;  1ICW A;  5K36 H;  2KCM A;  3GTP B;  4NB3 A;  1AE3 A;  1DOL A;  4A3J G;  4LNQ A;  2JA6 H;  1FGB D;  4BBR B;  1C48 A;  4RGO S;  2HD3 A;  1K9M C;  5K5P A;  5E7N A;  4Y7N B;  4DV6 Q;  4XXE A;  5M5W H;  4HJ8 A;  1B8A A;  4APV A;  3BG3 A;  3KOJ A;  4L5S A;  1CI3 M;  4IUR A;  4BBS B;  2PI2 E;  1V1P B;  4A3K B;  3R93 A;  2NYZ D;  3W5O A;  4R8I A;  2F0Q A;  4V19 0;  2ZXO A;  4TVA B;  2O4X A;  1J9O A;  4IUN A;  5IWA L;  1RL2 A;  3KFU A;  5KIX A;  2NVQ B;  4HR7 B;  3S2H B;  3BVG A;  3KBX A;  4N8F A;  3GTK H;  2XTI A;  3J7A F;  4JI2 L;  2WAQ E;  1SYF A;  3D8G A;  1GUW A;  1PDQ A;  2OT2 A;  1SYB A;  1JOQ A;  2I5M X;  3A55 A;  3OW7 A;  4JOI C;  4TRD A;  4EQP A;  3PQI A;  3M3Y B;  2GVA A;  1JR0 D;  2F0S A;  2YU9 B;  4E6I A;  4A3E H;  2JA7 B;  1B3Q A;  3HGB A;  4R1J A;  2PCF B;  5LL6 X;  4GOP A;  5KND A;  2OWO A;  2HT1 A;  1KAA A;  4RKL A;  1Y69 U;  1KAW A;  1Z6H A;  3DM1 A;  5KEE A;  2O5J C;  5BR8 Q;  4A3B G;  2MQH A;  1I4G A;  4KMU C;  4P2C B;  3K6O A;  3RLN A;  3LWU A;  4LUV A;  2B63 B;  3MC0 B;  3QOJ A;  5JEA H;  1DGS A;  3ULP A;  3ITP A;  1IL8 A;  1DD2 A;  3PUV A;  2FXQ A;  2PNR C;  2L12 A;  3I55 A;  1NMG A;  1XTD A;  2FIN B;  4LMQ D;  3E9I A;  2RQX A;  1ZYR C;  4LFC L;  1LLR D;  2A19 A;  1N34 Q;  3CF5 A;  4BY1 H;  2EE1 A;  5C44 B;  1SYE A;  4H7B A;  5IIF A;  1BCP B;  3J80 L;  5HUR A;  3R2I A;  1UE6 A;  2CKZ B;  1IBK L;  1GVP A;  1XX8 A;  4ZRZ A;  2B8G A;  3A7L A;  5CV5 A;  2ALY B;  3HOX G;  1B70 B;  3H94 A;  3G7L A;  3STB C;  3D31 A;  5JEA J;  2VUM G;  1VQ4 A;  3J7A 5;  1PTO D;  4OWW B;  1A3T A;  3KJP A;  1W2B A;  1MD2 D;  4B3S Q;  2MGS A;  1U4L A;  5EKK A;  2LFN A;  4IPG A;  4CDC C;  1LTS D;  5IT9 E;  4B08 A;  4B3M L;  3KLS A;  1BOS A;  2IX3 A;  5JJZ A;  2NVY B;  3CU7 A;  4R9W A;  4JV5 L;  4HSP A;  3TSS A;  3URY A;  2RHS B;  3MFG A;  1JB3 A;  4B3R L;  5FJ8 H;  3CCR A;  1K8M A;  1C4Q A;  4HCS A;  5EJW A;  1CA5 A;  4KI0 A;  1L2F A;  1G6P A;  5KYI A;  3DEP A;  1K28 A;  4QB4 A;  2PZU A;  1WTR A;  2DN8 A;  1O7Z A;  1XMQ Q;  1B44 D;  3E9H A;  5IYB H;  1ZKO A;  2CH4 A;  2A73 B;  1JOK A;  1MJC A;  3OMC A;  1AEX A;  1I5F A;  3FPP A;  1T5X D;  3SK8 A;  2IHE A;  3PO3 G;  1B7Y B;  3ND8 A;  1UEB A;  1MIU A;  1Y8N B;  4KHV A;  3M7N A;  3AU7 A;  4A3C H;  5J3B A;  3O13 A;  5EPJ A;  4X3U A;  1XXG A;  4HN7 A;  3OTO L;  4FYD A;  1KNE A;  4BBR G;  3R2T A;  4N9P A;  3UE0 A;  4GLV B;  2R7Z H;  2IJ0 A;  1SNC A;  1X3P A;  4QIW E;  1NAP A;  4F87 A;  2E75 C;  3MFY A;  4DV2 L;  1RDP D;  4BBS G;  3L3O C;  1PZI D;  4J8Q A;  2CVR A;  2SDF A;  1E24 A;  4HJ7 A;  2AQ1 B;  3FEW X;  4M8A A;  2F0T A;  5CV7 A;  4A3K G;  2PW5 A;  1K8A C;  4OIK A;  1HTP A;  2LY7 A;  4DV5 L;  4FF3 A;  5EPK A;  4PMW A;  4RGM A;  3NHH A;  1FGU A;  1EIF A;  3DM3 A;  3J7Y W;  2Q2I A;  2XSC A;  2XRQ D;  5FK9 C;  4YHH L;  1JJC B;  4RFB A;  4A4I A;  3JC6 6;  5M5X B;  2EYO A;  4ZYS A;  2A6E D;  2B2U C;  3CHB D;  2RCF A;  5FLM G;  2KHI A;  5IE8 A;  4KV6 A;  3I8Z A;  2CCZ A;  2NN6 G;  4A3J H;  3HOZ B;  1L1O A;  3TP5 A;  4LWC A;  4JI8 L;  5JJI A;  3PF5 A;  1H9R A;  4I7A A;  2Z4I A;  5CR3 A;  1STA A;  2F52 A;  4NXN L;  1BNZ A;  3D4D A;  4A3M B;  4CKE A;  3QOL A;  1M90 C;  2EPB A;  1RKN A;  1C8C A;  1SE4 A;  1X55 A;  4PG3 A;  2R6G A;  2B63 G;  2PQE A;  2KED A;  3GTM H;  2M9V A;  2YTY A;  1E2Z A;  5D3D A;  4LJZ C;  3V2T A;  4UY8 C;  2E74 C;  1QUQ A;  3DWQ A;  1XPO A;  3V96 A;  4DV3 L;  1EEF D;  4OX9 Q;  5F2D A;  3SEB A;  4DR7 Q;  3HG9 A;  3NWT A;  3T16 A;  1MBY A;  3NWS A;  3PUZ A;  2E2J B;  3S1Q B;  5C44 G;  2R3Z A;  3GDE A;  4EX5 A;  2VXW A;  1WTO A;  3S17 H;  1VF5 C;  1SNP A;  3HFZ B;  5C4H A;  2UXD L;  3A74 A;  2HUG A;  4JI0 L;  3VDY A;  1EYA A;  3OPO A;  1TS4 A;  1PYW D;  3TBI B;  3MXN B;  2EZV A;  3J81 i;  3PIO 3;  1HA6 A;  3SK6 A;  1VQL A;  1UE7 A;  1IW7 C;  1D5M C;  4XQJ A;  2WAQ B;  4EVO A;  4MHE A;  4RWS C;  4A3B H;  1L0X B;  2N3S A;  2EXD A;  4MTK A;  1XYI A;  2ID0 A;  2JE6 I;  2ZM6 Q;  1LTT D;  2NBF A;  4GN5 A;  3TQY A;  2ZXR A;  5TSS A;  3RZO H;  4UP8 A;  2RDH A;  2MJ8 A;  1S3O A;  2X69 A;  3Q8D A;  1I6V C;  3KF8 A;  2PQA B;  2GVB A;  5JOB A;  2TMP A;  1I94 Q;  2N78 A;  3F2B A;  2EJM A;  3RZD B;  2CQA A;  2PZT A;  4AYB E;  1GKH A;  2AWO A;  2F0F A;  3L2P A;  1EIY B;  1SND A;  3N52 A;  4FO2 A;  4R4Q A;  1KNA A;  3HOX H;  1MGS A;  1YJ9 A;  1C9O A;  3S16 H;  2A69 D;  3A5Z B;  3I4O A;  1TWH H;  2VUM H;  5LHY 1;  5JJL A;  1MI2 A;  2M2L A;  1Q1B A;  2QEJ C;  1EY9 A;  1U4M A;  1TKW B;  3HOY B;  4LFB Q;  3BZC A;  1ZEQ X;  1HR0 Q;  2F0W A;  2UXC Q;  2BE5 C;  5ELD A;  2A5H A;  4Q0F A;  3RN5 A;  1YIJ A;  3F2U A;  1EYG A;  2EY5 A;  3S15 B;  1FYC A;  3LX0 A;  1A8V A;  3M7G A;  4NDX A;  4B3T Q;  5COY A;  3S1R H;  3S9W A;  2KHJ A;  4DV0 Q;  3I70 A;  3NSW A;  4DUZ L;  4DUZ Q;  3IKJ A;  5ELE A;  2HHH L;  3S2D B;  2HHH Q;  2QKI C;  1HUN A;  1JT8 A;  1Y8O B;  4DU9 A;  1PZK D;  3KDF A;  5FO7 B;  1DYQ A;  3PO3 H;  4Q5V A;  1JIC A;  2A68 C;  3GTP H;  1YEZ A;  1LO5 D;  3CCL A;  2ASB A;  2JP1 A;  5ELO A;  3HOZ G;  3D6W A;  4CDF C;  3HOU B;  1WI5 A;  3CME A;  4RKB A;  3RLO A;  5EGT A;  4BBR H;  5M3M B;  4JCV E;  2Z4H A;  2EY2 A;  3HP3 A;  4Y7N H;  4ALP A;  3PF4 A;  1FVI A;  1LT6 D;  2Q8R E;  3IRB A;  1K73 C;  3A0J A;  1IL2 A;  4A3M G;  4A76 A;  2DJG C;  2EJF C;  2E76 C;  3TME A;  4BBS H;  3TP8 A;  2K1B A;  3KBG A;  2Y0S E;  1JOR A;  1SDF A;  2RKS A;  2AKW B;  4A3K H;  1A6X A;  4CKB A;  1GUO A;  1HA5 A;  4LW1 A;  1TS2 A;  2E5L L;  1SE3 A;  4QIW B;  1HJP A;  4JI5 L;  4JI5 Q;  3WWV A;  1CT1 D;  1TY0 A;  2PZW A;  2NVQ H;  4EQO A;  2VQE Q;  4IJH A;  3S2H H;  4B9W A;  4LF9 Q;  4LUO A;  1E2V A;  2RDG A;  3DMU A;  4ZUJ A;  1N33 L;  5AJ3 Q;  1N33 Q;  4MNO A;  3SVM A;  5C3E B;  3ER0 A;  4DPG A;  1PH8 A;  3EBE A;  1HPC A;  5CMD A;  2WII B;  3PIP 3;  3EN2 A;  4RHS A;  5FLM H;  3M3Y H;  4BA1 I;  2NN6 H;  4ULL A;  2D5D A;  2KOL A;  4JYA L;  2I0Q A;  4EGV A;  4DA2 A;  4CBV A;  1D6E C;  4X62 L;  3NQI A;  1KRT A;  3Q22 A;  2XNA C;  2WAQ G;  1Q46 A;  3CD6 A;  3X3M A;  4A3G B;  5J39 A;  2F4V Q;  1NUC A;  3P1H A;  3J81 L;  3C3L A;  1Y1W B;  1S5E D;  1VQA A;  3W1G A;  3FMC A;  2B63 H;  4UDU C;  2EDG A;  5CV9 A;  3T1H L;  2G5D A;  1WCM B;  3Q6S A;  3EIV A;  2Z9H A;  1NR2 A;  3I73 A;  2AUJ D;  1CKN A;  1Q90 A;  1PH2 A;  4QCL A;  3MEH A;  2BOS A;  1CQV A;  1VMC A;  1K3R A;  2ZT9 C;  4XYO A;  1QZH A;  5C44 H;  4DNT B;  3GTO H;  2I07 B;  2QF7 A;  1Q8I A;  2Q8T A;  1G2T A;  3H6M A;  3Q0A A;  1TWA B;  1ILQ A;  2F3W A;  1QVG A;  4FF1 A;  4XQN A;  2NZ1 D;  1WTP A;  1XNR Q;  5KRU A;  1D7Q A;  2LSS A;  3VA7 A;  1X6O A;  4WJW A;  1H9S A;  4MZ9 A;  3IL8 A;  1W3S A;  3HEJ A;  4X64 Q;  1ONL A;  3ERS X;  1PH3 A;  1GUS A;  2F1M A;  2EYH A;  5CBE E;  2EYF A;  1ICF B;  1UE5 A;  3HOY G;  2E2H B;  1HNW L;  4DV4 L;  1Q12 A;  1PRT B;  2JYO A;  2NVY H;  1YJN A;  1BBU A;  4R8N A;  1SYC A;  1NJI C;  5C0X G;  4JI4 L;  3M85 A;  5IY0 A;  1ENA A;  4OXP A;  4JI4 Q;  1I6H B;  1CTM A;  4I7Z C;  4BY7 B;  5I2X A;  1I4H A;  1WOC A;  1YNJ C;  5IP7 G;  3KLW A;  2L11 A;  2K33 A;  4J6H A;  3GTJ B;  4RHR A;  2IL8 A;  1QG7 A;  3ERO A;  4XYQ A;  3FDT A;  2AQ3 B;  2VB3 X;  4G7Z C;  1BO0 A;  4DR6 Q;  5HY6 A;  4HJ5 A;  4ABN A;  2FFK B;  4DV1 Q;  1IYJ B;  4ZLT F;  3CQZ H;  1XPR A;  5EQ0 A;  1VQN A;  1SAP A;  3N6R A;  3HOU G;  4GKJ Q;  1SYD A;  1VDZ A;  1MJE A;  2ZJP A;  1BXT A;  5KNB A;  4C1N K;  4AYB B;  5M3M G;  2R93 B;  3UDG A;  4C2M H;  1GUT A;  5E4X A;  4DV6 L;  1ROD A;  4H13 C;  4KY7 A;  1LT4 D;  4G7H C;  4RG1 A;  4KD3 A;  1D5X C;  1F2Y A;  1SXT A;  3HKZ E;  5L37 A;  3BVZ A;  2M00 A;  3M9B A;  4K2L A;  1XJV A;  3D3R A;  4KD4 A;  3E5S A;  3P20 A;  4GLX A;  5C4J H;  2PPB C;  1LYL A;  2AHO B;  2J4X A;  2KA7 A;  1X3E A;  3BJU A;  1JJ2 A;  3AYH B;  2EVB A;  3BDC A;  4DK3 C;  1YNN C;  3H91 A;  1BF4 A;  2F0G A;  1GO3 E;  4HJA A;  4DR5 Q;  2E2D C;  3STB D;  4R4C A;  1VQI A;  2J7Z A;  5FLX c;  2V4D A;  4DUY Q;  1EWC A;  4FNF A;  3SE0 A;  5M5X H;  1WVL A;  1EYD A;  3JAM c;  3GO5 A;  2O5I C;  3QIA A;  3CC2 A;  2B29 A;  4RGT A;  1Z7T A;  3CC7 A;  1LTB D;  3H09 A;  3HOZ H;  4QJF A;  3SDZ A;  2KJX A;  2XVS A;  2D62 A;  2F0H A;  1YJW A;  1HZ9 A;  1STY A;  1HZB A;  3VYU A;  1TWC B;  1KC8 C;  4A3G G;  2F0P A;  5BR8 L;  2JN4 A;  3PUX A;  4A3M H;  3NTI A;  3Q23 A;  1Y1W G;  3HRZ C;  1EOT A;  1EY0 A;  4C3J B;  1VQ8 A;  1EWH A;  2C35 B;  1XMO Q;  1YHQ A;  1WCM G;  3BYT B;  3T56 B;  2K32 A;  4BWG B;  2ES2 A;  3WDN A;  1EIG A;  5C3W A;  1X3Q A;  3U58 A;  3S1N B;  2OQ0 A;  2WKD A;  3EJI A;  2VW9 A;  1N34 L;  3QJY A;  3S1Q H;  3F8T A;  2GA4 B;  4GNX B;  4GS3 A;  2Y0S B;  4JI7 L;  1DOM A;  1TU2 B;  2ICE C;  4JI7 Q;  3VR5 A;  4JI1 Q;  4GN3 B;  2QA4 A;  1KXL A;  3K7A B;  3VR2 A;  5E1F A;  1JWU D;  1UAP A;  3OYY A;  1HH2 P;  2UUA Q;  2UXB Q;  3AMU A;  1TT2 A;  4NMZ A;  1SLJ A;  1A0I A;  1ILP A;  3OOC A;  2QIL A;  1TWG B;  2GN5 A;  1PH7 A;  2ENB A;  1I4P A;  1PFN A;  4H0L C;  1A62 A;  1N9W A;  4B3S L;  1EWI A;  2RA4 A;  3L7Z C;  1YBY A;  3M4P A;  2VQF Q;  3I7F A;  3AQQ A;  1S5C D;  1XTC D;  2CWP A;  5FOB B;  1EUJ A;  1YHB A;  5E4W C;  4B9X A;  1II3 A;  1HR0 W;  1EZ8 A;  2JSO A;  1SN8 A;  3GQB A;  5CC4 A;  1ASY A;  1F9P A;  2BCO A;  3D0F A;  3W3A A;  2I46 A;  1WD0 A;  3M4Q A;  1PH1 A;  2A8V A;  4BY7 G;  1NE3 A;  3DHQ A;  4O2D A;  4J1M A;  1YHA A;  3DUZ A;  3TEH B;  1XMQ L;  3RZD H;  4M1U B;  2NB0 A;  4UPA A;  4KY5 A;  4Y52 H;  4DV7 Q;  4P74 A;  4AQY Q;  5I4D A;  1IKL A;  1UWV A;  4FXK C;  2ZTC A;  4YY3 Q;  1TS5 A;  1OXV A;  2F0V A;  1F77 A;  2Z0S A;  5A2Q E;  1A15 A;  1SRO A;  4S3S A;  4AYB G;  2R93 G;  3I4M B;  3BDL A;  1EFW A;  2Z6K C;  1AP0 A;  2J0T D;  2KEC A;  2B2Y C;  3T51 B;  5GAE C;  4KJO A;  1MKH A;  1KQS A;  4A75 A;  1JQY D;  3HOY H;  3A5U A;  4DF7 A;  5C5L A;  2F0N A;  1IYV A;  4X3K A;  2BH2 A;  3S15 H;  2MUY A;  1X54 A;  1Q82 C;  5C0X H;  3NEN A;  3VYS A;  3PV0 A;  3HS0 C;  4KK7 A;  1OO9 B;  4IFD G;  2VY3 A;  5IP7 H;  1E7Z A;  2B8F A;  3KF6 A;  4WFN 3;  2NN6 I;  3LWE A;  3KYH C;  5M5W B;  2JA5 B;  4OGQ C;  4GLA C;  1ESR A;  1UUP A;  2K05 A;  1U4R A;  5D65 A;  4QL5 A;  1M4V A;  3S2D H;  2Q2H A;  1NSN S;  4RMF A;  1TII D;  1UE1 A;  4TSS A;  4TKO B;  2L15 A;  4QF4 A;  4CDD C;  4F7X A;  1IW7 D;  4DXF A;  5HGQ A;  4A3L G;  3EFX D;  4OO1 G;  1HFN A;  4JW0 A;  2MFI A;  1S72 A;  4UAI A;  5FLX E;  4P75 A;  2YYZ A;  2RF4 A;  5CV4 A;  3HOU H;  5C0X J;  3R8B A;  1QZG A;  2DJF C;  3D6C A;  3JAM E;  3B6Y A;  1WTH A;  1I3Q B;  1P16 A;  4PZ6 A;  5M3M H;  4CGY B;  3MZ5 A;  3K5M A;  1GOZ A;  2HQL A;  1IBM Q;  2B2V C;  1QB5 D;  4ZAI A;  1PH5 A;  1B9N A;  4GKK Q;  1L1O B;  2EYL A;  1SJH D;  3OIP A;  2IX0 A;  5ELN A;  4L5T A;  4C3J G;  3GTQ B;  3K7U C;  4IPC A;  3CKI B;  4IZ8 A;  4A3D B;  5IYC G;  1QOH A;  1B3A A;  1Y8P B;  4R4I A;  4DFA A;  2JXM B;  4OEM B;  4OX9 L;  5KNC A;  4DR7 L;  2D0P A;  4GZY C;  1CZW A;  2XIW A;  4DR1 Q;  3MEF A;  4KHP Q;  2IX1 A;  4DR4 Q;  2F3V A;  1QUQ B;  3HKZ B;  5GAG C;  2Y0S G;  4K0K Q;  4K0K L;  1TWF B;  5BN5 A;  2E2I B;  3I72 A;  3TS0 A;  4O0A A;  3LNN A;  3CCE A;  2PMZ B;  1WTX A;  1RTN A;  2PI2 A;  1BQQ T;  1O7I A;  4LF5 L;  4LF5 Q;  2BE5 D;  4YCV A;  2OTJ A;  1J5E Q;  3PGZ A;  1F9S A;  1FD7 D;  2UUC Q;  3QB3 A;  3NPP A;  3PUW A;  4DNI A;  4JOI A;  4X65 Q;  1U0L A;  4PNY A;  4CJ1 B;  4A3G H;  2QDB A;  2NUC A;  4U68 A;  4DKA C;  2IT1 A;  2A1A A;  4A3I B;  4PZ8 A;  1VQ7 A;  1TVX A;  1SNQ A;  1SMX A;  3K5O A;  4CJ0 B;  1PRT C;  3MXU A;  2ZM6 L;  1WTV A;  2ZTE A;  3I3C A;  1EY5 A;  4X66 Q;  2NZH A;  2I5H A;  1KAB A;  2IPK D;  1GHK A;  5DNF A;  1F9Q A;  1WCM H;  2F0I A;  4L6T B;  1NMF A;  1I4R A;  3C2P A;  2XGT A;  1K8O A;  1PRT F;  2UUB Q;  4P71 A;  1LTI D;  2VZA A;  3T53 B;  2A6E C;  2RVL A;  5D14 A;  3VR3 A;  2QDL A;  1I94 L;  4KJN A;  4HIK A;  2CFM A;  1H9M A;  2A68 D;  3GTG B;  3KF8 B;  2MHV A;  4IUU A;  2B2W C;  1A63 A;  2HCI A;  1SSO A;  5J22 A;  1GUN A;  1TWA H;  2HDL A;  4HSV A;  2AMC B;  4G7O C;  2EYJ A;  2DUD A;  4HED A;  1CHQ D;  1D5Z C;  2TSS A;  3CCJ A;  1M1K C;  1QIL A;  2NZO A;  4XDX A;  1E3P A;  1VQB A;  1VF7 A;  4ODG A;  3I4M G;  3ZJY C;  1VQD A;  4H02 A;  4WJ3 M;  2RBM A;  1N8R C;  4PV1 C;  1M8A A;  1S5D D;  2E2H H;  4LFB L;  4RCO A;  1HR0 L;  2UXC L;  4BS9 A;  4UP7 A;  2HIX A;  3I2Z A;  1DM0 B;  1HQM C;  2I5L X;  2K01 A;  4OHJ A;  1DON A;  4GN4 B;  4DAY A;  5C5M A;  1KLG D;  2ICI A;  1I6H H;  1FNV A;  1V1O A;  5GAD C;  4XT1 B;  1VQ5 A;  4B3T L;  4BY7 H;  2KEE A;  5AFW A;  3QG1 A;  3WOF A;  3MWY W;  1A3V A;  1HRJ A;  3I4N B;  5C4X B;  4DV0 L;  1QCB D;  1Y14 B;  3GTJ H;  2JA5 G;  1Y1V B;  2K04 A;  2WB1 E;  1Z47 A;  4OON A;  2Z6B A;  4LK1 C;  2CW0 D;  4QY7 A;  1AN8 A;  3SK4 A;  4POF A;  2HQE A;  1STB A;  2EYM A;  3IFD A;  3GTL B;  4LF4 Q;  2EY6 A;  5GQO A;  3CAM A;  1CQF A;  1OXX K;  1HXY D;  3CRL C;  2NVX B;  3CW2 C;  3VYR A;  4ID6 A;  2R93 H;  1TQO A;  1OXT A;  4AIM A;  5G3L F;  1K83 B;  5I6W A;  4LF6 Q;  3TRZ A;  4WRD A;  3AEV A;  4JI6 Q;  3FVQ A;  3C1F A;  1BBX C;  1A2T A;  1G8Z D;  3BZK A;  3TZU A;  2Z6K A;  2LXK A;  4FF4 A;  1AE2 A;  4FP5 D;  4A3J B;  4A3D G;  1B53 A;  4IO9 A;  4XQQ A;  4IFD H;  3PUY A;  1CSP A;  1P8L A;  1SMY C;  2MP1 A;  1E0B A;  3NBH B;  4DR3 Q;  2WV6 D;  5ISR A;  1EZ6 A;  1JWM D;  2RSN A;  4ZKB B;  4KKU A;  2NVT B;  1PYS B;  1V1Q A;  1RTO A;  4GNX C;  2VQE L;  4LF9 L;  2JA7 G;  2UU9 Q;  1QNU A;  3HKZ G;  2OCE A;  1BCP C;  3FRP B;  4DXG A;  5FO9 B;  5AJ3 L;  1PTO B;  3KUP A;  3HOW B;  5IGG A;  5A35 A;  1G29 1;  4OO1 H;  4A3L H;  2RCN A;  1DCZ A;  3K8A A;  3TRE A;  1OTC A;  1FJG Q;  4FXG C;  3KK7 A;  5IYD G;  2YU9 H;  1BCP F;  2JA8 B;  5IGB A;  1NR4 A;  3EVQ A;  2Q2T A;  4IFD J;  4C3I B;  2B2U A;  2D9U A;  1KD1 C;  2KBN A;  1TWC H;  3TZD A;  1FNW A;  1QVC A;  1KIX A;  4A3I G;  2F4V L;  1YNJ D;  1J8I A;  2K5W A;  1HQR D;  4A93 B;  4C3J H;  3UDI A;  1BVS A;  2N55 A;  5IYC H;  1R9T B;  2ATW A;  3K58 A;  2B2V A;  1PFB A;  1K3B C;  1NNX A;  1YI2 A;  3M4O B;  2VNU D;  1D1I A;  3OMG A;  1SFO B;  4KTA A;  3KLR A;  3S1N H;  3OSO A;  5LMN Q;  4IUQ A;  2F0J A;  4L63 B;  1STN A;  2WAC A;  4NPS A;  2L1B A;  1GD7 A;  3H0G B;  3TN2 A;  2V1C C;  4HID A;  1PLF A;  2ZTD A;  4RAU C;  1V9P A;  3K7A H;  4IUP A;  2F0O A;  1D2B A;  4LAA A;  3TDQ A;  1XNR L;  5M3F B;  2XWJ B;  1YZ6 A;  1PA6 A;  1TWG H;  2A6H C;  4YWM A;  4PMC A;  2CWA A;  5C0X I;  1T5E A;  2F0K A;  1KLU D;  4X64 L;  3ONA B;  2BDO A;  1LAB A;  3FP9 A;  4FXD A;  2QW7 A;  4WOR A;  1WFQ A;  1YIT A;  1S4Z A;  5IOC A;  1SEB D;  1YNN D;  5D3I B;  3NE5 B;  1RHP A;  1K0R A;  2G9D A;  2JEB I;  3A54 A;  1ZXT A;  3OWE B;  1PH9 A;  4IOC A;  3SK5 A;  4QGU A;  1WTW A;  4ZK9 B;  3S1M B;  3GV3 A;  4KLK A;  3I4N G;  3MA2 B;  5C4X G;  3CPF A;  1RD9 D;  1U4P A;  2DNE A;  2K7V A;  3J81 E;  1Y1V G;  1NTG A;  1HCZ A;  2PW7 A;  5EBD A;  4CHT B;  1X32 A;  1U9R A;  5T1G A;  1CFM A;  1I4X A;  1N32 Q;  1KL9 A;  1SE8 A;  1D1K A;  3JAM i;  4DR6 L;  4DV1 L;  1LTR D;  5M9O A;  3IAY A;  3CCQ A;  3CCS A;  4UHV A;  4IQZ A;  1PFM A;  3G71 A;  2H5X A;  2B2W A;  4FDB A;  3VR6 A;  1VQO A;  4GKJ L;  3J80 c;  1LV9 A;  1STH A;  4JG2 A;  2DNC A;  2F0M A;  1ESF A;  1EOV A;  2G9H D;  4L5Q A;  1DOK A;  4LF7 L;  4XT3 B;  4LF7 Q;  3K59 A;  3I4M H;  5M5Y B;  4HCE A;  4F8M A;  2SEB D;  3CMA A;  5LMU Q;  3P75 A;  3ERQ A;  5JJK A;  5EBC A;  3H3V H;  1NBW A;  1EQR A;  2L55 A;  3ULJ A;  1L1O C;  3TS2 A;  1GXD C;  1MSG A;  3U4V A;  3G6E A;  2CQO A;  1F2M A;  3S14 B;  1ZYR D;  1EY7 A;  2MO1 A;  3ICE A;  3ULL A;  2LS0 1;  1B4O A;  4IOA A;  1CSQ A;  4DR2 L;  4DR2 Q;  2PMZ E;  1E22 A;  1SR3 A;  1EU3 A;  3EQL C;  1EY6 A;  2F0E A;  4V0B A;  3DWA A;  4G57 A;  4C56 C;  1V1P A;  2C9O A;  3I90 A;  5CV8 A;  2JQO A;  5I2Y A;  1VCI A;  1XWE A;  2JJQ A;  4DR5 L;  5BN4 A;  2JA5 H;  2KCT A;  3FKI B;  3DWP A;  4HMI A;  4PZ7 A;  4RCN A;  2AWN A;  4DUY L;  1A2U A;  3NBI A;  3HOW G;  5C3E G;  1LT3 D;  2R7D A;  1E2W A;  4OEL B;  1VQ6 A;  1RJT A;  1CKO A;  3CRK C;  4O42 A;  3K5N A;  5E3F A;  2QCP X;  2JA8 G;  1FNU A;  1PH4 A;  3E6Z X;  1I3Q H;  5IWA Q;  2WB1 B;  4C3I G;  2VS1 A;  3PCO B;  5KGU A;  3J7Z C;  5JVG 3;  1SNO A;  1IZ6 A;  1KDC A;  5JPN C;  4JI2 Q;  1I50 B;  4KN7 C;  3RMH A;  2MPM A;  5IT9 L;  2SOB A;  4GOP B;  4TQU S;  4A93 G;  1PVO A;  2P5Z X;  4K6L A;  3GTQ H;  3CCM A;  1YVC A;  4C3H B;  1JWS D;  4A3D H;  3T1Y L;  3T1Y Q;  2K52 A;  3I91 A;  1BKB A;  2F0D A;  1XMO L;  3FHW A;  4K2K A;  3DLL A;  3PO2 B;  4AH6 A;  3D4W A;  2WKC A;  3QR8 A;  4QMG A;  1RIP A;  3UI2 A;  1EQT A;  3AFQ A;  3CC4 A;  2E2J H;  4OIJ A;  4UP9 A;  1AW7 A;  2KCN A;  2O2L D;  3SXH A;  2JA7 H;  3H0G G;  1UEA B;  4IAL A;  1TWF H;  4JI1 L;  3I56 A;  2E2I H;  4ILW A;  1XPU A;  4KKS A;  4GNX A;  1IXR A;  4LF8 L;  2K28 A;  4LF8 Q;  2UUA L;  2UXB L;  5M3F G;  5IYD H;  3SGI A;  2H4O A;  1HUM A;  4A3F B;  1D8L A;  5A2Q L;  3H15 A;  2E8G A;  3A8K E;  2DGY A;  4LFC Q;  4DK6 C;  2YTV A;  4P73 A;  2EJG C;  3CXC A;  1ML0 D;  2K5Q A;  3GTO B;  3K81 C;  1QWY A;  5CYU A;  4ME5 A;  4A3I H;  2VQF L;  1IBK Q;  2R92 B;  2FHT A;  4BXX G;  3RUZ A;  4MIU A;  3HOV B;  1WJJ A;  2L4N A;  1K0S A;  4IJL A;  5IP9 G;  4KN4 C;  2PNH A;  2IY5 B;  4JBJ A;  5DM6 3;  4H44 C;  3HZX A;  1QVF A;  3U9S A;  3NXW A;  2D2C C;  1J6Q A;  3GTG H;  4B3M Q;  1VQH A;  4DV7 L;  1PXU A;  4AQY L;  4JV5 Q;  1PYB A;  3C1E A;  2F4I A;  1G91 A;  4YY3 L;  5CBA E;  4B3R Q;  5I6Y A;  3X3N A;  1G2S A;  1CUK A;  3VA5 A;  5FLX L;  5GAH C;  4ZUI A;  1LUZ A;  2B2T C;  1CK1 A;  3T4A C;  2QEX A;  2K5H A;  3UE1 A;  3JAM L;  4N9T A;  1WD1 A;  3SR1 A;  2KQ3 A;  3CPW A;  4R4T A;  4IFD I;  5C4Z A;  3D4R A;  4K8I A;  1JMC A;  3J80 E;  1WTQ A;  3BS1 A;  3U9O A;  3K0X A;  4IN3 A;  2X6G A;  3CQZ B;  3F1Z A;  4X3T A;  1GM5 A;  4LFA L;  4LFA Q;  2AUK A;  4YCU A;  1HTL D;  1X3G A;  2OQK A;  4K5W A;  5DM7 3;  2PYK A;  4ZCK A;  3TP7 A;  4PMB A;  4PQX A;  3OTO Q;  5NUC A;  2JA6 B;  4OO1 I;  1MSH A;  1STG A;  4C2M B;  2B3G A;  1VQF A;  4MN3 A;  3I4N H;  2HIV A;  4CJ2 C;  1ENC A;  5C4X H;  2CH4 W;  4KHZ A;  1EFI D;  3FKI G;  1Y1V H;  3MXP A;  2Z1C A;  4DV2 Q;  3PIO A;  1CZG A;  4DN4 M;  2FMM A;  2WFW A;  4DNR B;  1PTO C;  2HCC A;  1B50 A;  2MNA A;  2F0L A;  3KF6 B;  4HTH A;  3VYT A;  4DAM A;  3GTL H;  4FVM A;  5C4J B;  4DAV A;  1SNM A;  1Q8K A;  5EPL A;  5JPM C;  5H1S E;  4DV5 Q;  1DZ1 A;  1A3U A;  1PTO F;  1FR3 A;  1H95 A;  2NVX H;  1PRT D;  3SHL A;  1LAC A;  1JJG A;  1TS3 A;  1BR9 A;  2WB1 G;  2XRS D;  5CGK A;  3KLS X;  1SBB B;  1QE6 A;  1K83 H;  5ELC A;  3GTK B;  1JOO A;  2SNM A;  2L0C A;  4YHH Q;  1RF2 D;  2Q2U A;  1CHP D;  2OEO A;  1LTG D;  1IBM L;  2EIF A;  4GKK L;  1UNS A;  3NQT A;  1GJX A;  1H9K A;  3OW2 A;  2FJ2 A;  3A56 A;  4C3H G;  1E1T A;  1KRS A;  2KHS A;  1DJR D;  4A3E B;  1S5B D;  2B39 A;  4C1N I;  1RCV D;  5DAU A;  4JI8 Q;  3PO2 G;  3PMF A;  3BYY B;  3F2D A;  4I65 A;  1IYU A;  4YIJ A;  4CKC A;  1IKM A;  4K5V A;  2NVT H;  4NXN Q;  1XNQ L;  4DR1 L;  5LMN W;  1XNQ Q;  2K4K A;  4KHP L;  4DR4 L;  5I9O A;  4WJ4 A;  4DAP A;  1ASZ A;  1PTO H;  1B1Z A;  3HOW H;  5C3E H;  3U50 C;  4IPD A;  5FKA C;  1EIH A;  1IHZ A;  3F2C A;  1V8Q A;  2QGQ A;  2PO4 A;  1K8G A;  4XIG S;  4OL7 A;  4QQB X;  1Q1E A;  4N8X 1;  1L0Y B;  4A3F G;  1Q7Y C;  4DV3 Q;  2JA8 H;  1PV4 A;  1J5E L;  1IBL L;  1IBL Q;  3VR4 A;  2UUC L;  1O7Y A;  2C5C A;  3PSI A;  4C3I H;  3NEM A;  4BY1 B;  4X65 L;  4OWT B;  3DEO A;  4RA8 A;  3MXN A;  4XTC S;  1HFG A;  4R4O A;  1EU4 A;  1S5F D;  2UXD Q;  3W1B A;  2Z8L A;  2R92 G;  4JI0 Q;  5IGC A;  1Y1W H;  3CP0 A;  3RD4 A;  4NP5 A;  1EQQ A;  4A93 H;  1VMP A;  2KCC A;  3HOV G;  4X66 L;  3I4L A;  4MTN A;  2L9H A;  3A8I E;  1R9T H;  1FL0 A;  1HHV A;  4HIM A;  4YWK A;  3NK9 A;  3M4O H;  1NY4 A;  2K75 A;  4YWL A;  3E0E A;  4IPH A;  1SFO H;  1CA6 A;  4K8J A;  3RNU A;  2UUB L;  2DY7 A;  3BU2 A;  2OTL A;  2NWG A;  5G3L D;  1ENF A;  3L0O A;  2PQA A;  1C0A A;  3H0G H;  4JBW A;  4U67 3;  1SRU A;  4ME3 A;  3RLF A;  1W6K A;  5C3X A;  1ET9 A;  1AH9 A;  1BDO A;  3H3V I;  3J7A V;  1C7Y A;  1EEI D;  5M3F H;  2EQS A;  4F88 A;  1LTL A;  1JB7 A;  2KUM A;  5BN3 A;  2JA9 A;  1T9H A;  4JBM A;  3A7A B;  2R7F A;  4O1N A;  4JBK A;  2K5N A;  4DK1 A;  1LM0 A;  1SMY D;  1KTK A;  2EYP A;  3ND9 A;  3MAQ A;  4ZQ3 A;  3K57 A;  2N8N A;  4CDE C;  4BXX H;  5K36 G;  3P7J A;  4K6D A;  3RR5 A;  2WP8 J;  1F9R A;  4IUT A;  3NEL A;  5DEH A;  2F03 A;  5IP9 H;  2ZJQ A;  2VL6 A;  1L0W A;  3MHB A;  1OXS C;  4LUZ A;  3J81 c;  1BCP D;  1AZP A;  1BBW A;  2JA6 G;  3S1M H;  3BVM A;  2OF1 A;  3PIP A;  2R7Z B;  4KY6 A;  3CCV A;  2RHQ B;  4DAY B;  3AB9 A;  4KKT A;  4X3S A;  1HZC A;  2YV5 A;  4K14 A;  1VS0 A;  3UDF A;  3R3O A;  1STE A;  4JVZ A;  1EYC A;  4BA2 I;  1X3F A;  2BA0 A;  3NTK A;  1Q3L A;  3EA6 A;  2KEN A;  3GP7 A;  3M4Y A;  4EQN A;  4LF4 L;  1ET6 A;  2K50 A;  1VQC A;  1EQV A;  5IGD A;  1CM9 A;  2K03 A;  1JE4 A;  4RGN A;  5DLQ E;  2JK8 A;  1SJE D;  2HDM A;  3KDF B;  2AQ2 B;  2N49 A;  5M5Y H; 
#chains in the Genus database with same CATH homology
 5FO8 B;  1F2Z A;  3BZD B;  2B2T A;  3IFT A;  2LKV A;  3WOE A;  3E0J A;  1R4Q B;  3NUC A;  2B2Y A;  1V43 A;  1GUG A;  2KVM A;  2WIN B;  4DK0 A;  4L8J A;  1B2T A;  2A74 C;  3C46 A;  2BA1 A;  2A69 C;  2K5D A;  3A8J E;  5KYL A;  2A6H D;  5HGT A;  1TY2 A;  2IWH A;  3NBH A;  2EXZ A;  3BDO A;  5JEA G;  3GTM B;  4IUV A;  2X6L A;  1QJO A;  2OXP A;  1O78 A;  1KDA A;  1LT5 D;  5IGE A;  1B9M A;  4HAE A;  1NCV A;  1TR5 A;  5JAV A;  3L9A X;  3GD7 A;  4ZKC B;  5EKI A;  3S17 B;  4Z9C B;  4JK1 C;  3T13 A;  2XWB B;  2NTT A;  3TP6 A;  1H9J A;  3NTH A;  2CW0 C;  4FF2 A;  1O7L A;  1EL0 A;  5ELF A;  4RH6 A;  3Q24 A;  1SYG A;  2ZXP A;  3QWN A;  1W6J A;  1GHJ A;  3ZYY X;  4K5X A;  3FPU B;  4A3B B;  1JC7 A;  1KDB A;  2L5T A;  4QUC A;  1I4Q A;  3MTS A;  1F2L A;  3RZO B;  2Q8I B;  2CHB D;  5IOD A;  3K0Y A;  2RDF A;  5JVH 3;  5I9P A;  2R61 A;  3K5L A;  1QNK A;  3V05 A;  2FMC A;  1LTA D;  1PZJ D;  3DXJ C;  5IGF A;  2EY1 A;  5LL6 S;  4QUF A;  1SE2 A;  2IW3 A;  3H3V C;  1H9S B;  3MVV A;  5C6A A;  2DY8 A;  3W2D A;  2SNS A;  4DGZ A;  1JCK B;  5COR A;  1R4P B;  3HOX B;  4NW2 A;  3S16 B;  2JEA I;  1G6Z A;  2H1E A;  1TWH B;  2K6A A;  3GV6 A;  2VUM B;  5ELB A;  3QO2 A;  3OHX C;  2VB2 X;  1O80 A;  1EY8 A;  2XN9 C;  1AZQ A;  1DXM A;  4HMJ A;  5J1Z A;  3NP8 A;  2NTS A;  1OXU A;  5CV6 A;  2EOT A;  5EKL A;  1EY4 A;  1AFP A;  3S1R B;  2F0U A;  4G4K A;  3MXG A;  3G6J B;  3OIQ A;  2N88 A;  3OWF A;  2LMC B;  2RSO A;  1PMR A;  1BUV T;  2BDN A;  4NKL A;  3PO3 B;  5T1I A;  1ICW A;  5K36 H;  3GTP B;  1DOL A;  1FGB D;  4BBR B;  1C48 A;  4RGO S;  5K5P A;  4Y7N B;  4XXE A;  3BG3 A;  1CI3 M;  4IUR A;  4BBS B;  1V1P B;  4A3K B;  3R93 A;  2NYZ D;  4R8I A;  2F0Q A;  4V19 0;  2ZXO A;  2O4X A;  1J9O A;  4IUN A;  5KIX A;  2NVQ B;  4HR7 B;  3S2H B;  3BVG A;  3KBX A;  3J7A F;  1SYF A;  3D8G A;  1GUW A;  1PDQ A;  2OT2 A;  1SYB A;  1JOQ A;  3A55 A;  3OW7 A;  4TRD A;  4EQP A;  3M3Y B;  1JR0 D;  2F0S A;  2YU9 B;  4E6I A;  3HGB A;  2PCF B;  5LL6 X;  5KND A;  1KAA A;  4RKL A;  1Y69 U;  1Z6H A;  3DM1 A;  5KEE A;  2O5J C;  1I4G A;  4KMU C;  4P2C B;  3K6O A;  3LWU A;  2B63 B;  3MC0 B;  3QOJ A;  5JEA H;  3ITP A;  1IL8 A;  1DD2 A;  3PUV A;  2PNR C;  2L12 A;  2FIN B;  4LMQ D;  2RQX A;  1ZYR C;  1LLR D;  2EE1 A;  5C44 B;  1SYE A;  4H7B A;  5IIF A;  1BCP B;  3J80 L;  5HUR A;  3R2I A;  1XX8 A;  4ZRZ A;  2B8G A;  3A7L A;  5CV5 A;  3H94 A;  3G7L A;  3D31 A;  5JEA J;  1PTO D;  1A3T A;  1MD2 D;  2MGS A;  1U4L A;  5EKK A;  2LFN A;  1LTS D;  5IT9 E;  4B08 A;  3KLS A;  1BOS A;  2IX3 A;  5JJZ A;  2NVY B;  3CU7 A;  4R9W A;  4HSP A;  3TSS A;  3URY A;  3MFG A;  1JB3 A;  1K8M A;  1C4Q A;  4HCS A;  5EJW A;  1CA5 A;  4KI0 A;  5KYI A;  3DEP A;  4QB4 A;  2PZU A;  1WTR A;  2DN8 A;  1O7Z A;  1B44 D;  1ZKO A;  2A73 B;  1JOK A;  1AEX A;  3OMC A;  3FPP A;  1T5X D;  3SK8 A;  3ND8 A;  1Y8N B;  4KHV A;  3M7N A;  3AU7 A;  3O13 A;  5EPJ A;  4X3U A;  1XXG A;  4HN7 A;  4FYD A;  1KNE A;  3R2T A;  4N9P A;  2IJ0 A;  1SNC A;  1X3P A;  1NAP A;  4F87 A;  2E75 C;  3MFY A;  1RDP D;  3L3O C;  1PZI D;  4J8Q A;  2CVR A;  2SDF A;  2AQ1 B;  3FEW X;  4M8A A;  2F0T A;  5CV7 A;  2PW5 A;  4OIK A;  1HTP A;  2LY7 A;  4FF3 A;  5EPK A;  4PMW A;  4RGM A;  3NHH A;  3J7Y W;  2XSC A;  2XRQ D;  5FK9 C;  4RFB A;  5M5X B;  2EYO A;  4ZYS A;  2A6E D;  2B2U C;  3CHB D;  4KV6 A;  3I8Z A;  2NN6 G;  3HOZ B;  3TP5 A;  1H9R A;  2Z4I A;  5CR3 A;  1STA A;  1BNZ A;  3D4D A;  4A3M B;  4CKE A;  3QOL A;  2EPB A;  1RKN A;  1C8C A;  1SE4 A;  2R6G A;  2PQE A;  2KED A;  2M9V A;  1E2Z A;  5D3D A;  4LJZ C;  3V2T A;  2E74 C;  3DWQ A;  3V96 A;  1EEF D;  5F2D A;  3SEB A;  3HG9 A;  3NWT A;  3T16 A;  1MBY A;  3NWS A;  3PUZ A;  2E2J B;  3S1Q B;  2R3Z A;  1WTO A;  2VXW A;  1VF5 C;  1SNP A;  5C4H A;  2HUG A;  1EYA A;  3OPO A;  1TS4 A;  1PYW D;  3TBI B;  2EZV A;  3PIO 3;  1HA6 A;  3SK6 A;  1IW7 C;  1D5M C;  4XQJ A;  2WAQ B;  4EVO A;  4MHE A;  4RWS C;  1L0X B;  1XYI A;  2ID0 A;  2JE6 I;  1LTT D;  2NBF A;  2ZXR A;  5TSS A;  2RDH A;  2MJ8 A;  2X69 A;  1I6V C;  3KF8 A;  5JOB A;  2TMP A;  2EJM A;  3RZD B;  2CQA A;  2PZT A;  2AWO A;  2F0F A;  1SND A;  3N52 A;  4FO2 A;  1KNA A;  1MGS A;  2A69 D;  5LHY 1;  1MI2 A;  2M2L A;  1Q1B A;  2QEJ C;  1EY9 A;  1U4M A;  1TKW B;  3HOY B;  1ZEQ X;  2F0W A;  2BE5 C;  5ELD A;  2A5H A;  4Q0F A;  3F2U A;  2EY5 A;  3S15 B;  1FYC A;  3LX0 A;  3M7G A;  4NDX A;  5COY A;  3S9W A;  3I70 A;  3NSW A;  3IKJ A;  5ELE A;  3S2D B;  2QKI C;  1HUN A;  1Y8O B;  4DU9 A;  1PZK D;  5FO7 B;  1DYQ A;  4Q5V A;  1JIC A;  2A68 C;  1LO5 D;  2JP1 A;  3D6W A;  3HOU B;  4RKB A;  5EGT A;  5M3M B;  2Z4H A;  2EY2 A;  3HP3 A;  1LT6 D;  2Q8R E;  2EJF C;  2E76 C;  3TME A;  3TP8 A;  2K1B A;  3KBG A;  1JOR A;  1SDF A;  2RKS A;  1A6X A;  4CKB A;  1GUO A;  1HA5 A;  1TS2 A;  1SE3 A;  4QIW B;  1CT1 D;  1TY0 A;  2PZW A;  4EQO A;  4B9W A;  1E2V A;  2RDG A;  3DMU A;  4ZUJ A;  3SVM A;  5C3E B;  1HPC A;  5CMD A;  2WII B;  3PIP 3;  4RHS A;  4BA1 I;  2NN6 H;  4ULL A;  2D5D A;  2KOL A;  4EGV A;  4DA2 A;  4CBV A;  1D6E C;  3NQI A;  3Q22 A;  2XNA C;  3X3M A;  4A3G B;  5J39 A;  1NUC A;  3P1H A;  3J81 L;  3C3L A;  1Y1W B;  1S5E D;  3FMC A;  4UDU C;  2EDG A;  5CV9 A;  1WCM B;  3Q6S A;  1NR2 A;  3I73 A;  2AUJ D;  1Q90 A;  4QCL A;  3MEH A;  2BOS A;  1CQV A;  1VMC A;  2ZT9 C;  4XYO A;  4DNT B;  2I07 B;  2QF7 A;  1Q8I A;  2Q8T A;  1G2T A;  3H6M A;  3Q0A A;  1TWA B;  1ILQ A;  2F3W A;  4FF1 A;  4XQN A;  2NZ1 D;  1WTP A;  5KRU A;  3VA7 A;  4WJW A;  1H9S A;  3IL8 A;  3HEJ A;  1ONL A;  1GUS A;  2F1M A;  2EYH A;  5CBE E;  2EYF A;  2E2H B;  1Q12 A;  1PRT B;  2JYO A;  4R8N A;  1SYC A;  5C0X G;  3M85 A;  1ENA A;  1I6H B;  1CTM A;  4I7Z C;  4BY7 B;  5I2X A;  1I4H A;  1YNJ C;  2L11 A;  2K33 A;  4J6H A;  3GTJ B;  4RHR A;  2IL8 A;  1QG7 A;  3ERO A;  4XYQ A;  3FDT A;  2AQ3 B;  2VB3 X;  4G7Z C;  1BO0 A;  4ABN A;  2FFK B;  4ZLT F;  5EQ0 A;  1SAP A;  3N6R A;  1SYD A;  1VDZ A;  1BXT A;  5KNB A;  4C1N K;  4AYB B;  2R93 B;  1GUT A;  5E4X A;  1ROD A;  4H13 C;  4KY7 A;  1LT4 D;  4G7H C;  4KD3 A;  1D5X C;  1F2Y A;  1SXT A;  3BVZ A;  2M00 A;  4K2L A;  3D3R A;  4KD4 A;  3E5S A;  3P20 A;  2PPB C;  2J4X A;  2KA7 A;  2EVB A;  3BDC A;  1YNN C;  3H91 A;  1BF4 A;  2F0G A;  2E2D C;  2J7Z A;  2V4D A;  1EWC A;  4FNF A;  3SE0 A;  1WVL A;  1EYD A;  3GO5 A;  2O5I C;  3QIA A;  4RGT A;  1Z7T A;  1LTB D;  3H09 A;  3SDZ A;  2KJX A;  2XVS A;  2D62 A;  2F0H A;  1STY A;  3VYU A;  1TWC B;  2F0P A;  3PUX A;  3NTI A;  3Q23 A;  3HRZ C;  1EOT A;  1EY0 A;  4C3J B;  1EWH A;  3BYT B;  3T56 B;  2K32 A;  4BWG B;  3WDN A;  1EIG A;  5C3W A;  1X3Q A;  3S1N B;  2WKD A;  3EJI A;  3QJY A;  2GA4 B;  2Y0S B;  1DOM A;  1TU2 B;  2ICE C;  3VR5 A;  3K7A B;  3VR2 A;  5E1F A;  1JWU D;  1UAP A;  3AMU A;  1TT2 A;  4NMZ A;  1ILP A;  3OOC A;  2QIL A;  1TWG B;  2ENB A;  1I4P A;  1PFN A;  4H0L C;  2RA4 A;  3L7Z C;  1S5C D;  1XTC D;  5FOB B;  4B9X A;  5E4W C;  1II3 A;  1EZ8 A;  2JSO A;  3GQB A;  5CC4 A;  1F9P A;  2BCO A;  3W3A A;  2I46 A;  1WD0 A;  3DHQ A;  4J1M A;  3DUZ A;  4M1U B;  2NB0 A;  4KY5 A;  5I4D A;  1IKL A;  4FXK C;  1TS5 A;  1OXV A;  2F0V A;  1F77 A;  5A2Q E;  1A15 A;  4S3S A;  3I4M B;  3BDL A;  1AP0 A;  2J0T D;  2KEC A;  2B2Y C;  3T51 B;  4KJO A;  1JQY D;  4DF7 A;  5C5L A;  2F0N A;  1IYV A;  4X3K A;  2MUY A;  5C0X H;  3VYS A;  3PV0 A;  3HS0 C;  4KK7 A;  1OO9 B;  4IFD G;  2B8F A;  4WFN 3;  2NN6 I;  3LWE A;  5M5W B;  2JA5 B;  4OGQ C;  1ESR A;  1UUP A;  2K05 A;  1U4R A;  5D65 A;  1M4V A;  1NSN S;  1TII D;  4TSS A;  4TKO B;  4QF4 A;  4F7X A;  1IW7 D;  4DXF A;  4OO1 G;  3EFX D;  1HFN A;  4UAI A;  5FLX E;  2YYZ A;  5CV4 A;  5C0X J;  3R8B A;  3D6C A;  3JAM E;  1I3Q B;  4CGY B;  3MZ5 A;  3K5M A;  1GOZ A;  2B2V C;  1QB5 D;  4ZAI A;  1B9N A;  2EYL A;  1SJH D;  3OIP A;  2IX0 A;  4C3J G;  3GTQ B;  4IZ8 A;  3CKI B;  4A3D B;  1QOH A;  1B3A A;  1Y8P B;  4DFA A;  2JXM B;  5KNC A;  4GZY C;  1CZW A;  2XIW A;  2JA7 B;  2IX1 A;  2F3V A;  3HKZ B;  1TWF B;  5BN5 A;  2E2I B;  3I72 A;  3LNN A;  2PMZ B;  1WTX A;  1RTN A;  1BQQ T;  2BE5 D;  1F9S A;  1FD7 D;  3QB3 A;  3NPP A;  3PUW A;  4PNY A;  4CJ1 B;  2QDB A;  2NUC A;  4U68 A;  4A3I B;  2IT1 A;  1TVX A;  1SNQ A;  4CJ0 B;  3K5O A;  1PRT C;  3MXU A;  1WTV A;  3I3C A;  1EY5 A;  1KAB A;  2IPK D;  1GHK A;  5DNF A;  1F9Q A;  2F0I A;  4L6T B;  1I4R A;  3C2P A;  1K8O A;  1PRT F;  1LTI D;  3T53 B;  2A6E C;  2RVL A;  5D14 A;  3VR3 A;  4KJN A;  1H9M A;  2A68 D;  3GTG B;  2MHV A;  4IUU A;  2B2W C;  2HCI A;  1SSO A;  5J22 A;  1GUN A;  2HDL A;  4HSV A;  4G7O C;  2EYJ A;  4HED A;  1CHQ D;  1D5Z C;  2TSS A;  1QIL A;  4XDX A;  1VF7 A;  4ODG A;  2RBM A;  4PV1 C;  1M8A A;  1S5D D;  4RCO A;  4BS9 A;  1DM0 B;  1HQM C;  2K01 A;  4OHJ A;  1DON A;  4DAY A;  5C5M A;  1KLG D;  2ICI A;  1FNV A;  1V1O A;  4XT1 B;  2KEE A;  5AFW A;  3QG1 A;  3WOF A;  3MWY W;  1A3V A;  1HRJ A;  3I4N B;  5C4X B;  1QCB D;  1Y1V B;  2K04 A;  1Z47 A;  4LK1 C;  2CW0 D;  3SK4 A;  1AN8 A;  1STB A;  2EYM A;  2HQE A;  3IFD A;  3GTL B;  2EY6 A;  1CQF A;  1OXX K;  1HXY D;  3CRL C;  2NVX B;  3VYR A;  4ID6 A;  1TQO A;  1OXT A;  5G3L F;  1K83 B;  5I6W A;  4WRD A;  3FVQ A;  3C1F A;  1BBX C;  1A2T A;  1G8Z D;  3TZU A;  4FF4 A;  4FP5 D;  4A3J B;  1B53 A;  4XQQ A;  4IFD H;  3PUY A;  1SMY C;  2MP1 A;  1E0B A;  2WV6 D;  5ISR A;  1EZ6 A;  1JWM D;  2RSN A;  4ZKB B;  4KKU A;  2NVT B;  1RTO A;  1QNU A;  5FO9 B;  1BCP C;  3FRP B;  4DXG A;  1PTO B;  3KUP A;  3HOW B;  5IGG A;  5A35 A;  1G29 1;  4OO1 H;  1DCZ A;  4FXG C;  3KK7 A;  1BCP F;  2JA8 B;  5IGB A;  1NR4 A;  3EVQ A;  4IFD J;  4C3I B;  2B2U A;  2D9U A;  3TZD A;  1FNW A;  1YNJ D;  1J8I A;  2K5W A;  1HQR D;  4A93 B;  2N55 A;  1R9T B;  3K58 A;  2B2V A;  1PFB A;  3M4O B;  2VNU D;  1D1I A;  3OMG A;  1SFO B;  4KTA A;  3KLR A;  3OSO A;  4IUQ A;  2F0J A;  4L63 B;  1STN A;  2WAC A;  2L1B A;  3H0G B;  3TN2 A;  1PLF A;  4RAU C;  4IUP A;  2F0O A;  1D2B A;  4LAA A;  3TDQ A;  5M3F B;  2XWJ B;  2A6H C;  4PMC A;  5C0X I;  1T5E A;  2F0K A;  1KLU D;  3ONA B;  2BDO A;  1LAB A;  4FXD A;  4WOR A;  1S4Z A;  5IOC A;  1SEB D;  1YNN D;  5D3I B;  3NE5 B;  1RHP A;  2G9D A;  2JEB I;  3A54 A;  1ZXT A;  3OWE B;  3SK5 A;  1WTW A;  4ZK9 B;  3S1M B;  3GV3 A;  3MA2 B;  1RD9 D;  1U4P A;  2DNE A;  2K7V A;  3J81 E;  1HCZ A;  2PW7 A;  5EBD A;  4CHT B;  1X32 A;  1U9R A;  5T1G A;  1CFM A;  1I4X A;  1D1K A;  1LTR D;  5M9O A;  3IAY A;  4IQZ A;  1PFM A;  2B2W A;  3VR6 A;  1LV9 A;  1STH A;  2DNC A;  2F0M A;  1ESF A;  2G9H D;  1DOK A;  4XT3 B;  3K59 A;  5M5Y B;  4HCE A;  4F8M A;  2SEB D;  3P75 A;  3ERQ A;  5EBC A;  2L55 A;  1GXD C;  1MSG A;  1F2M A;  3S14 B;  1ZYR D;  1EY7 A;  2LS0 1;  1B4O A;  1EU3 A;  3EQL C;  1EY6 A;  2F0E A;  4V0B A;  3DWA A;  4G57 A;  4C56 C;  1V1P A;  2C9O A;  3I90 A;  5CV8 A;  5I2Y A;  1VCI A;  1XWE A;  5BN4 A;  3FKI B;  3DWP A;  4HMI A;  4RCN A;  2AWN A;  1A2U A;  3NBI A;  1LT3 D;  1E2W A;  1RJT A;  3CRK C;  4O42 A;  3K5N A;  5E3F A;  2QCP X;  1FNU A;  3E6Z X;  2WB1 B;  4C3I G;  5KGU A;  5JVG 3;  1SNO A;  5JPN C;  1KDC A;  1I50 B;  4KN7 C;  3RMH A;  2MPM A;  5IT9 L;  2SOB A;  4TQU S;  4K6L A;  4C3H B;  1JWS D;  3I91 A;  2F0D A;  4K2K A;  3PO2 B;  3D4W A;  2WKC A;  4QMG A;  3UI2 A;  1EQT A;  4OIJ A;  1AW7 A;  2KCN A;  2O2L D;  3SXH A;  1UEA B;  4IAL A;  4ILW A;  4KKS A;  2K28 A;  2H4O A;  1HUM A;  4A3F B;  5A2Q L;  3A8K E;  2EJG C;  1ML0 D;  2K5Q A;  3GTO B;  1QWY A;  5CYU A;  4ME5 A;  2R92 B;  2FHT A;  3RUZ A;  4MIU A;  3HOV B;  2L4N A;  4KN4 C;  5DM6 3;  4H44 C;  3HZX A;  3U9S A;  3NXW A;  2D2C C;  1PXU A;  3C1E A;  2F4I A;  1G91 A;  5CBA E;  5I6Y A;  3X3N A;  1G2S A;  3VA5 A;  5FLX L;  4ZUI A;  2B2T C;  1CK1 A;  3T4A C;  3JAM L;  4N9T A;  1WD1 A;  3SR1 A;  2KQ3 A;  4IFD I;  5C4Z A;  3D4R A;  4K8I A;  3J80 E;  1WTQ A;  3BS1 A;  3U9O A;  4IN3 A;  2X6G A;  3CQZ B;  4X3T A;  2AUK A;  1HTL D;  4K5W A;  5DM7 3;  2PYK A;  3TP7 A;  4PMB A;  4PQX A;  5NUC A;  2JA6 B;  4OO1 I;  1MSH A;  1STG A;  4C2M B;  4MN3 A;  4CJ2 C;  1ENC A;  4KHZ A;  1EFI D;  3MXP A;  2Z1C A;  1CZG A;  4DN4 M;  2FMM A;  4DNR B;  1PTO C;  2HCC A;  1B50 A;  2F0L A;  4HTH A;  3VYT A;  4FVM A;  5C4J B;  4DAV A;  1SNM A;  5EPL A;  5JPM C;  1DZ1 A;  1A3U A;  1PTO F;  1FR3 A;  1PRT D;  3SHL A;  1LAC A;  1TS3 A;  1BR9 A;  2XRS D;  5CGK A;  3KLS X;  1SBB B;  1QE6 A;  5ELC A;  3GTK B;  1JOO A;  2SNM A;  2L0C A;  1RF2 D;  1CHP D;  2OEO A;  1LTG D;  1UNS A;  3NQT A;  1GJX A;  1H9K A;  2FJ2 A;  3A56 A;  4C3H G;  2KHS A;  1DJR D;  4A3E B;  1S5B D;  2B39 A;  4C1N I;  1RCV D;  5DAU A;  3PMF A;  3BYY B;  4I65 A;  1IYU A;  4YIJ A;  4CKC A;  1IKM A;  4K5V A;  5I9O A;  4DAP A;  1PTO H;  1B1Z A;  5FKA C;  1EIH A;  1IHZ A;  1V8Q A;  2PO4 A;  4XIG S;  4OL7 A;  1Q1E A;  1L0Y B;  3VR4 A;  1O7Y A;  2C5C A;  4BY1 B;  3DEO A;  4RA8 A;  3MXN A;  4XTC S;  1HFG A;  1EU4 A;  1S5F D;  2Z8L A;  5IGC A;  3RD4 A;  4NP5 A;  1VMP A;  2KCC A;  3I4L A;  2L9H A;  3A8I E;  1HHV A;  3NK9 A;  1CA6 A;  4K8J A;  2DY7 A;  2NWG A;  5G3L D;  1ENF A;  4JBW A;  4U67 3;  3RLF A;  1W6K A;  5C3X A;  1ET9 A;  1BDO A;  3J7A V;  1EEI D;  4F88 A;  2KUM A;  5BN3 A;  3A7A B;  4O1N A;  4DK1 A;  1SMY D;  1KTK A;  2EYP A;  3ND9 A;  3MAQ A;  4ZQ3 A;  3K57 A;  5K36 G;  3P7J A;  4K6D A;  2WP8 J;  1F9R A;  4IUT A;  5DEH A;  2F03 A;  3MHB A;  1OXS C;  1AZP A;  1BCP D;  3BVM A;  2OF1 A;  2R7Z B;  4KY6 A;  3AB9 A;  4KKT A;  4X3S A;  4K14 A;  3R3O A;  1STE A;  1EYC A;  4BA2 I;  2BA0 A;  3NTK A;  1Q3L A;  3EA6 A;  3GP7 A;  3M4Y A;  4EQN A;  1ET6 A;  1EQV A;  5IGD A;  1CM9 A;  2K03 A;  1JE4 A;  4RGN A;  1SJE D;  2HDM A;  2AQ2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...