2L0CA

Solution nmr structure of protein sty4237 (residues 36-120) from salmonella enterica, northeast structural genomics consortium target slr115
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
b'MAPLQQKQVVVSNKREKPVNDRRSRQQEVSPAGTSMRYEASFKPLNGGLEKTFRLQAQQYHALTVGDQGTLSYKGTRFVGFVSRTPDNELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative membrane protein
publication title Solution NMR Structure of protein STY4237 (residues 36-120) from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR115
rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Structural genomics, unknown function
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l0cA00
2L0CA 3RD4A
chains in the Genus database with same CATH superfamily
3FMCA 3RLFA 4IJLA 4UDUC 1PTOH 2KJXA 3W1GA 1HXYD 1X6OA 4R8IA 1E3PA 4YCVA 1L0YB 4F87A 3TP7A 2PNRC 5CC4A 2K5QA 1U4PA 4NB3A 4FO2A 3OPOA 5IP9G 1ENAA 2DNEA 1A63A 4NXNL 4UP7A 1N32L 1Q86C 4DUYQ 2Z6KC 4OIKA 2IX0A 1TQOA 4AH6A 1A15A 5JEAH 5LHY1 5C4XG 2PCFB 1DCZA 5IIFA 2JQOA 2DY8A 1E24A 4DXFA 4BY1H 1CZWA 1VQBA 1DONA 1AH9A 4DAMA 5CV9A 5GAHC 1EWIA 3K5LA 3F8TA 2L5TA 1XMQQ 2Y0SE 4DN4M 3W2DA 2LS01 4IJHA 3RLNA 3L2PA 5F2DA 5BN5A 1IL8A 4IUPA 1KAWA 1EUJA 4LF4L 3CD6A 3V96A 4OO1G 5JPNC 1A3TA 1VS0A 3STBC 4B9WA 4DV1L 2VQEL 1S5FD 1UE7A 2PZTA 4XQNA 5C3EH 1H9RA 3VR6A 3OW7A 5IY0A 4HMIA 3A8IE 3FRPB 3RR5A 4XT3B 1NAPA 2B2UC 4F8MA 1Q3LA 1HQMC 4CDEC 4HJ9A 4BBRH 5HGQA 1UNSA 1KAAA 1SYCA 1HFGA 3RZOB 4A3KH 3MXNA 1I4PA 3D0FA 2YV5A 3T51B 3JAML 2F3WA 4JK1C 2EXZA 1B7YB 4QMGA 5FJ8H 1BCPB 4CDCC 2PNHA 1NNXA 4FYDA 4KLKA 2RCFA 4PNYA 2E2IH 3K5NA 2SNMA 4LF6Q 4B3ML 2F3VA 4A3KB 3TSSA 2MFIA 1AE2A 3CPWA 4A3MH 3GTQH 4JG2A 1F2YA 2A6HC 5IYCG 3KOJA 4A3GH 5I9OA 2JA6H 1Q8IA 2AWOA 1JORA 3D3RA 1IYVA 3VYSA 2JA7H 1EOVA 4BY7G 3J81L 1IKLA 2E2IB 1QVGA 2IX1A 1EIYB 3GTQB 1YHQA 3NBHB 3DWAA 3QOLA 4A3GB 5M9OA 2JA6B 4IUUA 1GOZA 4HJ8A 4GKJL 4C3HH 2AUKA 2JA7B 4AQYL 4DNIA 3R2TA 1Y1WG 4DV2Q 5IT9L 1PTOF 3JAMc 1F9QA 1DD2A 4OIJA 1PZKD 2NN6G 3NENA 5E1FA 3VYRA 1BDOA 4KTAA 3S1RB 3C1EA 3VA7A 3NXWA 4C3HB 3X3NA 2KEDA 3MC0B 4O0AA 5IGFA 2SNSA 1TWHB 5FK9C 2F03A 1PH9A 2Q2HA 5GROA 3BVGA 1EY5A 1LM0A 4HJ7A 1J5EL 1ASYA 5LL6X 4QIWE 3PO2B 2DNCA 4JI2L 1JICA 4OGQC 3ITPA 1IKMA 4PZ8A 3PQIA 2Q2IA 3X3MA 4EQPA 2O5IC 2Z9HA 3H91A 2D5DA 4HSPA 3GDEA 1TWFH 1VF5C 4XDXA 2QW7A 1SDFA 1CKOA 1MJCA 2B2VC 3FPUB 1CKNB 1K8OA 2DN8A 4XT1B 5IODA 3TS0A 2B29A 1XWEA 2R92G 2WV6D 5GQOA 4GN5A 1XNQQ 2VNUD 5IGCA 1VQHA 1I94Q 2ZT9C 4Q0FA 3P20A 4ZYSA 2KOLA 1HHVA 4RGNA 5IYDG 2EYOA 1HZBA 1WTQA 3EFXD 1PH7A 1SNPA 1EYDA 1JCKB 1KDCA 1TS3A 4UPAA 1JMCA 1IYJB 4LMQD 1KLGD 2B2YA 2FMMA 4BBSG 1OXSC 1NCVA 4K5WA 5C4ZA 3HOWH 4MNOA 3TZUA 4P2CB 2HHHL 2CKZB 3CRKC 4I7AA 3KBXA 3UDFA 3BYYB 4DKAC 1TT2A 2XNAC 1IBKQ 1RIPA 4ZCKA 4LFCQ 1UAPA 2WB1E 3A55A 3EIVA 3A56A 5E4XA 3WWVA 2VL6A 2QF7A 3VR4A 3A5ZB 3HOWB 2A5HA 1U0LA 4HAEA 1LTBD 1VQGA 1SE4A 5ELNA 4QJFA 4DGZA 4C2MB 1SE2A 1RF2D 3DWPA 3MWYW 2QGQA 3HOZH 4A3FG 1M8AA 3G4SA 2K52A 5A2QE 1TWAH 4KV6A 2LFNA 4G7ZC 4HSVA 3K57A 3TQYA 3S15H 1F9RA 1N34Q 1KRTA 1CQVA 2JP1A 3BU2A 5DEHA 1VQFA 3CKIB 3L9AX 2H4OA 3HOZB 2L9HA 4GZYC 2R93B 1DOKA 4P74A 1EY7A 1JWUD 1PV4A 1H9MA 5C5MA 1UWVA 1L0WA 1JWMD 1PDQA 1UEAB 3VYTA 1SFOH 4R4CA 3S15B 4Y52H 1V43A 2NZOA 5ELOA 2WACA 4HJAA 2P5ZX 3R3OA 3VYUA 5G3LD 1A8VA 4ZQ3A 2PZWA 4LUZA 1ZYRC 1E2WA 2KENA 3DEOA 2ZJQA 1SNQA 4N9PA 4GOPC 3SEBA 4A75A 3AEVA 1RDPD 3M7GA 5M5WB 5C0XJ 2PMZB 4X6AH 4DUZQ 2LXJA 1N33Q 1GUTA 3K0XA 5IGBA 4IPDA 1BR9A 1TXYA 1PFMA 3KDFA 1IXRA 3D4DA 5GAGC 3AMUA 1SRUA 2E2HH 3I7FA 4R1JA 5HGTA 4DV5Q 3KBGA 1RD9D 3A8KE 1C48A 4JI7L 1I6HH 1N36Q 3CAMA 4P71A 4HIMA 2RCNA 4Z9CB 1I5FA 4QUFA 5C4JB 4DR6Q 2E2HB 1IBMQ 2XWJB 1S40A 1TY2A 3CP0A 1TWGH 2Z0SA 1PTOD 1E22A 3S1MB 3MXGA 1YNND 4LF7L 1F2MA 5I2YA 1I6HB 2AKWB 1XYIA 1SYBA 3NQTA 2IWHA 2F0EA 5LMUL 4DAVA 2K05A 2QEJC 3T13A 1TWCH 2Z1CA 4DK0A 1PH1A 4KD3A 1TWGB 4MIUA 2FJ2A 4DFAA 3KJPA 4A3LG 4OELB 2A73B 1STNA 1YJNA 2UUCQ 1IBLL 1SMYD 2TMPA 3VA5A 1LTTD 1STEA 1LT6D 1LLRD 4LF8L 5JAVA 1XMOL 3DM3A 3A74A 2MPMA 3E0EA 1HTLD 4WORA 4DR3L 1DGSA 1K8AC 1WTRA 1L2FA 1G291 2MP1A 4NMZA 4BS9A 3MVVA 3HGBA 4J6HA 2VQFL 3TREA 1B9NA 1GVPA 1PFNA 2E2JH 5FOBB 1KQSA 1QNKA 2RBMA 4OO1H 4G57A 2OEOA 1PFSA 1EY4A 5JVH3 4HMJA 1VQ8A 4NP5A 1W2BA 3E3XA 4A3BG 1I6VC 2M00A 1E2ZA 3MEFA 4LFAL 1SJHD 4KK7A 1ZKOA 5EKIA 5EBDA 5D3IB 2B39A 4DNTB 2BDNA 5ELEA 4QCLA 4GKKL 1UE1A 3NWSA 2M9VA 1XTDA 4IFDI 1NSNS 5HURA 3U50C 4YWLA 4ID6A 1SLJA 2WB1G 1VQOA 3HP3A 4JV5Q 1HUNA 2AMCB 1X32A 5NUCA 1YZ6A 1N32Q 2EPBA 4DV4Q 1STAA 3SXHA 4ZLTF 2L11A 5I6YA 5M3MH 2YU9H 1HTPA 2SEBD 4DR7Q 2EY2A 2UUBQ 5FO9B 1VQMA 2JA5G 5ELBA 1FVIA 3K8AA 2IT1A 1K8GA 2XIWA 5IYCH 1NBWA 1GM5A 3RZDB 1DYQA 3IFTA 3HZXA 1STBA 3J7ZC 1QUQA 2YU9B 5KYLA 1L1OA 4A4IA 2EZVA 4QY7A 1DOMA 2UXBQ 1EZ8A 3M4YA 5A35A 1Q7YC 1SNMA 2R3ZA 5M5XH 3ONAB 1NTGA 2C9OA 1KIXA 4FF2A 5EQ0A 3A54A 1BO0A 3V05A 2F0SA 1M1KC 4KY5A 3FKIH 4DV1Q 2LMCB 2VQEQ 1TU2B 4ZAIA 1V1PA 1JB3A 1XPRA 4X66Q 3SR1A 2KEEA 2WAQB 1EYCA 3H15A 4GNXC 5DNFA 1B8AA 3T16A 5ELDA 3HOUG 5CGKA 5IWAL 5IP7G 1YJ9A 4GS3A 3GTMH 2ZTEA 1LUZA 4CDDC 3DHQA 1B2TA 1V1QA 3J81i 1E1OA 4AYBB 1O7ZA 1VMPA 3TBIB 3RLOA 1S5ED 1X3PA 3E9HA 3NEMA 5JVG3 1B50A 3HRZC 3PSIA 3PIP3 1LYLA 1SNDA 3MFYA 3HOYH 1S3OA 1IW7C 4OXPA 2CVRA 2NVXH 3C2PA 3FPPA 1Z9FA 4EQOA 3J81j 3QJYA 4IUQA 3HOXH 2UU9L 1B70B 4UY8C 2FINB 3I4MB 4BXXG 2F0NA 5FLMG 3OWEB 1KABA 3IKJA 1Y8OB 5M5YB 4POGA 4FNFA 2WP8J 3NK9A 3DMUA 4HEDA 4AIMA 3F2CA 4IO9A 2HUGA 3NHHA 2EOTA 2N49A 2CH4A 3J80E 1VQCA 1K0SA 4C3IH 4CHTB 4PV1C 2EE1A 2R93G 1A3VA 3MFGA 1R9TH 4GKJQ 3UI2A 2VY3A 1JB7A 3PUYA 2EJGC 1UE6A 1GUWA 2Z4HA 3Q8DA 4YIJA 1QILA 4DV3Q 3H0GB 2F4VL 1JE4A 4XQQA 4CKCA 4YWMA 2Z6BA 3I4NH 1TY0A 2RA4A 1K83H 3LGJA 2QDLA 4RHRA 5KRUA 1EEFD 3AFQA 1CT1D 2XN9C 2B63G 1SROA 1K0RA 3IFDA 2O2LD 1U5KA 2PO4A 4DK3C 2ID0A 1Y1VB 4ME5A 4RWSC 3I4NB 4FF4A 1H9SA 4JOIC 1WD0A 1K83B 1PH3A 4LF9Q 3HOVH 5LMNQ 3M85A 5FLXL 2H5XA 4C3JH 5C0XH 1KRSA 4DV6L 1O7LA 3S2HH 4A3JB 3G48A 1I4QA 4JI6L 4DR4Q 1JWSD 4A3DH 4JI1Q 4JI8Q 4OWTB 4C3JB 2VUMH 1PTOB 4A3IG 3H94A 1G8ZD 1VQ9A 1FYCA 3A7LA 3UDIA 2ZTCA 2EJMA 4OX9L 1WCMG 2D0PA 4XIGS 1X65A 1EFID 4A3EH 1TS2A 4KI0A 2DJFC 1IYUA 2G9DA 2E76C 4KKSA 1F2ZA 4KD4A 2XRSD 3R93A 1NMGA 2R7FA 2J4XA 5CBEE 1RHPA 3M3YH 5KEEA 1MSGA 2HHHQ 2N88A 2PZUA 1AZQA 3NUCA 1X55A 4K8JA 2Q8TA 5IOCA 3W3AA 3CU7A 1AEXA 5J3BA 4MTKA 1LV9A 5C5LA 1J9OA 2R7ZH 2BCOA 1LACA 1S72A 1XXGA 1SJED 4IALA 4BY1B 4Y7NH 1X54A 1PZID 2CHBD 2G9HD 3BDOA 1WTOA 2MGSA 1WTHA 4KMUC 2A6EC 3DEPA 4JYAL 2R7ZB 1PTOC 3A7AB 1YNNC 3OHXC 1FNWA 3W1BA 3T1YQ 4RAUC 3K7AH 4DR1Q 2AQ3B 2R6GA 4LF5L 1QE6A 4L6TB 1HNXL 4J8QA 1AE3A 4QQBX 3LX0A 5M3FH 3EA6A 3J7AF 2VB2X 2A69D 5C3EB 1SYDA 4A3LH 4ALPA 4WJWA 3TP5A 3DUZA 1QUQB 2KCTA 1SMYC 2WIIB 1S5BD 3CCEA 4K6DA 1ILQA 4JI3L 5G3LF 1JT8A 1AP0A 1SEBD 5E7NA 5CV6A 1G6PA 4BBRB 1YNJD 2X69A 3P1HA 1K28A 4FXKC 1D2BA 1PRTF 2JXMB 2HCIA 2OQ0A 4KHPL 3NQIA 2EVBA 2FFKB 4QUCA 1V1PB 4X3TA 2OXPA 2A68D 3D8GA 2V4DA 3GTPH 4HN7A 3TN2A 4JC0A 3JAME 1FR3A 4A3MB 1EY6A 4LFBL 2JEBI 1KHIA 4C56C 5L37A 3S24A 4YY3L 1VDZA 1JE5A 2AUJD 2YTYA 2CWPA 4JI7Q 1GD7A 2V1CC 3GTPB 4YHHQ 4IFDG 3SGIA 3E0JA 4B3RL 3KF8A 4R9WA 4X62L 4A93G 2B2TA 4OWXB 5KNDA 2KHJA 4BA1I 4LF7Q 4A76A 1ICWA 3J81E 1BCPC 3LWUA 1KDBA 2XRQD 2EYLA 2I0QA 1QJOA 3PIOA 5LMUQ 3KK7A 1JJ2A 4JW0A 4PMBA 1XNRL 1RL2A 2J7ZA 2F0WA 2ZXRA 4J1MA 1T5XD 2NYZD 1STHA 3OTOQ 1SMXA 4DV0Q 4DV7L 5CV8A 4WJ3M 3J81c 5IT9E 2QEXA 1IBLQ 2PQAA 4EQNA 3IAYA 2JA8G 1WFQA 2JA5H 3ICEA 4GLAC 1GKHA 1SXTA 5C6AA 1WD1A 3E6ZX 1CUKA 4LF8Q 1Y8PB 3NPPA 2KCNA 1XMOQ 1VQEA 3HS0C 1FJGL 5ELFA 3ZJYC 3OW2A 2JE6I 3CMAA 2EYFA 4DR3Q 1GHKA 5IT9c 3Q24A 2UXCL 1Q46A 3W5OA 1PFBA 1MKHA 4KKTA 2VQFQ 1EYAA 2L15A 1TWFB 2B2WA 1QG7A 2K5NA 2HQEA 2IHEA 1HNZL 1B9MA 4F88A 3BDLA 1PMRA 1Y8NB 2YTXA 5JPMC 3S1QH 1RJTA 1BBWA 2EQSA 5CR3A 4LNQA 1DXMA 3L7ZC 2WINB 3GP7A 3S16H 2CW0D 4LWCA 3HKSA 3RMHA 1YI2A 1HCZA 3H09A 1DZ1A 4LFAQ 2MUYA 4JBWA 3JC66 4FXGC 1B53A 4B3SL 5IP7H 1H9SB 3CRLC 2J0TD 3S16B 4DUYL 2F0PA 4GKKQ 3OMGA 1WYDA 1HZ9A 3L3OC 4G7OC 2PQEA 5D65A 1MGSA 3H0GG 4WJ4A 1JOKA 2Q8RE 3PO3G 3PV0A 4RMFA 5EKLA 4PMWA 3TMEA 2JJQA 1STYA 1G91A 2NVYH 5A2QL 2CFMA 1XMQL 2HT1A 4FDBA 4N8X1 5KGUA 4L5TA 3CCSA 4APVA 5COYA 2OCEA 4M8AA 5CV5A 4XXEA 1U4LA 2NVYB 1B3QA 3OSOA 1Z47A 1YVCA 1YNXA 4ABNA 2Z4IA 2E2DC 3Q22A 4FF3A 1TWAB 1CKMA 1Q12A 5C44H 2NVTH 3I8ZA 3URYA 1BNZA 4A3JG 2GVAA 2CCZA 3O13A 5IE8A 3GO5A 2K28A 3BVMA 3PUWA 4CJ2C 2PW5A 3K0YA 1SNOA 4ME3A 3AYHB 1GHJA 2R61A 4K2KA 4B3TQ 2HDLA 5C44B 2YTVA 1Q81C 1D7QA 5J22A 1SFOB 1VQLA 4ZUJA 2HCCA 4JI4L 1PRTD 3CCJA 3RNUA 2K01A 1CA5A 3KLRA 4G4KA 4QB4A 4HIDA 3GTLH 1FNVA 5IWAQ 4K0KL 4CBVA 5K36H 3Q6SA 3UE0A 1VF7A 2RDHA 1NJIC 3RUZA 1BQQT 4DAYA 5C4HA 2B63H 3HKZB 2F0JA 3I4OA 5JEAG 5DM63 1BF4A 3GTKH 1C0AA 3E5SA 4LF6L 2FMCA 3OIPA 1PVOA 4X3UA 4FVMA 5E4WC 4HTHA 2XTIA 3M9BA 2G5DA 3A0JA 1IL2A 1V8QA 2DUDA 3CQZH 4H02A 1IHZA 1EQQA 3DWQA 3I91A 3H3VH 4U68A 4N8FA 1Z7TA 3MXNB 3MXUA 1O7IA 2F4IA 3M4QA 2K1BA 2KHIA 3WDNA 4BWGB 4RKLA 1R4PB 2EJFC 2X6LA 2NZHA 2ZXOA 2RDFA 4JVZA 5IP9H 4GLVB 1VCIA 4GN3B 2A1AA 4K8IA 2AQ2B 3K7UC 1O78A 4B9XA 1Q8KA 5LL6S 2B3GA 1X3FA 5C4XH 1PA6A 2Z6KA 1WCMH 5C3EG 5AJ3L 1TWCB 4WRDA 5DM73 1HNWQ 1PH6A 4R4IA 2RF4A 1WOCA 3N6RA 5DLQE 4E6IA 3KF6A 1G2SA 1V1OA 2D2CC 5C4XB 2RQXA 1SYGA 2XGTA 2IX3A 2PMZE 2F0LA 2K5VA 2D9UA 1A6XA 1SSOA 1SYEA 4KHVA 2I46A 2N78A 4A3KG 2F4VQ 3I2ZA 3NSWA 4BA2I 3F1ZA 4PZ7A 2QILA 4JCVE 3EROA 3MHBA 4KJOA 2OF1A 1EEID 4S3SA 5FJ8G 1LTRD 1MSHA 3PF4A 3NBIA 2Q2UA 1U4MA 2NTSA 3M4OH 1VQNA 2CWAA 1G2TA 4X3KA 4X64Q 1GXDC 3D6WA 2B8FA 4A3GG 2A6HD 2E2JB 2VS1A 2JA6G 1PH2A 2JSOA 1XNQL 4P75A 1VQ6A 3BS1A 1I94L 2JA7G 1QNUA 2F0IA 3CCUA 1R4QB 2HIVA 4DV6Q 1TR5A 3M4OB 2EYMA 4PG3A 2B2UA 1I4GA 2UXDL 2Q8IB 2L12A 5AFWA 2CH4W 3ZYYX 4LAAA 1HUMA 4JI6Q 4HIKA 5CORA 1HR0L 1FL0A 1IZ6A 2JA9A 2L55A 1LT5D 4C3HG 3CCMA 1LTGD 4NXNQ 1Z6HA 2VW9A 3A5UA 4NXML 3ND8A 1YNJC 1CTMA 2RDGA 3CC7A 1HA5A 1SBBB 3BJUA 1FGBD 1V9PA 5D14A 4EQ5A 2ATWA 1UE5A 3PO2G 2LY7A 3QR8A 4RHSA 1D6EC 3SK4A 2YYZA 1QVCA 4G7HC 4L5SA 1RODA 3NE5B 4PZ6A 3AFPA 2MHVA 1QVFA 5M3MB 2F0VA 1C8CA 4BY7H 4N9TA 2D62A 2IY5B 3D4RA 1KTKA 3S14H 4H0LC 3V2TA 1W6JA 3S9WA 2O5JC 2A74C 2RKSA 4LF4Q 3NTHA 4JI5L 4ULLA 5FKAC 5I4DA 5IGDA 1N34L 1OXUA 3K59A 2QKIC 1A62A 3EBEA 1Y1WH 5T1GA 4JYAQ 3MZ5A 2ZJRA 1CHPD 2DY7A 2L4NA 2MO0A 5M5XB 2NN6H 1I4HA 3E9IA 1EWHA 1KLUD 1PZJD 3VR5A 1K3RA 1ESFA 3CC4A 3GV6A 1PLFA 3TS2A 1SN8A 2K32A 1LTLA 1KD1C 1C7YA 2A19A 3GTGH 2Z8LA 2L0CA 2XWBB 3FKIB 1G51A 1EIHA 2SDFA 1TVXA 2B2YC 1CZGA 4J15A 1OXVA 1ICFB 2ZM6L 5J39A 4DUZL 5EJWA 3CCLA 2KECA 2KVMA 3HOWG 3GTMB 3PUXA 2NBFA 2RHQB 2I5LX 3NBHA 3KLSA 4HIOA 4DK6C 2F0KA 4LUVA 2B8GA 2XVSA 3I70A 1VQAA 4B3MQ 2B2VA 2ZXPA 4DV5L 1SAPA 3KFUA 2KHSA 1K73C 1KXLA 2BDOA 3C3LA 2R92H 3HOYB 4ZUIA 4L63B 2EXDA 4HR7B 1FNUA 2F52A 2GA4B 1N36L 2NVXB 2CQAA 3CF5A 3GTJH 3J80L 2A8VA 3HOXB 3FHWA 5IYDH 1IBML 1FGUA 2Q2TA 3KDFB 4HJ5A 3HOZG 4UHVA 1EYGA 4H7BA 2RVLA 4LFBQ 1KNAA 3H6MA 2UUAL 4BBSH 5JJKA 4YY3Q 1ZXTA 3GTJB 4AQYQ 1A2UA 4C1NI 4DR2L 3CPFA 2NVQH 1T5EA 1SE3A 4B3RQ 2LKVA 4X62Q 4C3IB 4IUNA 1NMFA 2QDBA 3BG3A 1WVLA 1PXUA 4UAIA 5C0XI 2E5LL 2WAQE 1R9TB 1PYBA 4BBSB 1TIID 1CSQA 3HEJA 5BN3A 3NELA 1TKWB 4XQJA 1XNRQ 1M90C 2PYKA 4RA8A 3HFZB 1J5EQ 5IGGA 1PRTB 3RN5A 1ZYRD 4AYBE 4DF7A 1PH4A 4JI2Q 1K3BC 4DV7Q 5BR8L 2RSOA 1EY0A 2JN4A 2Y0SB 4A3FH 1HPCA 3OYYA 3S17H 4KY7A 1EOTA 2RSNA 2KUMA 2K33A 2OQKA 1FJGQ 4UP8A 1QZHA 2OTJA 3K5MA 2AWNA 4A3FB 1CK1A 2ALYB 1XX8A 2UXCQ 4OHJA 2EYHA 3I4LA 1S5CD 3VR2A 3HOVB 4YCWA 1VQ4A 2NB0A 4O2DA 3VR3A 1JC7A 1HR0W 1HNZQ 2EYPA 1I50H 3F2UA 2QA4A 3S2HB 3AQQA 4NPSA 4C1NK 1E2VA 2K5HA 4RGMA 4TVAB 3DLLA 1YEZA 5FLXE 2BE5D 3EVQA 3TDQA 1O80A 3J7YW 4GOPA 1PRTC 4A3DB 2OWOA 2VUMB 5JJZA 2E75C 1F9SA 1I50B 1S4ZA 4JV5L 1NUCA 4B3SQ 4IUVA 2M2LA 4DA2A 2AHOB 1AZPA 1S5DD 4A3EB 4L5RC 1E1TA 3EN2A 4DV4L 1AN8A 5FLXc 1SYFA 3EQLC 2BOSA 1PYWD 3M7NA 4DR7L 2UUBL 2F0TA 3C1FA 3M3YB 4HCEA 2ZTDA 1DOLA 3MXPA 2K5WA 2C35B 5KNCA 4FF1A 1TS5A 1AFPA 4O1NA 1K8MA 2I07B 1O7YA 1D5MC 5JOBA 3GV3A 1JJGA 1H9JA 5TSSA 2UXBL 2K03A 4Y7NB 1ET9A 1X3EA 4XYQA 4JI0L 4KJNA 3K58A 1A0IA 1LABA 2L1BA 2WKDA 3PIO3 2IPKD 3QO2A 4MTNA 2IL8A 1G6ZA 1WTPA 1ASZA 2K4KA 3K7AB 2MO1A 3WOEA 3OIQA 3S1NH 1L1OB 1BVSA 4X66L 4ODGA 2I5MX 3G7LA 3CHBD 5M3FB 4NKLA 1STGA 3R8BA 3RZOH 1LO5D 1Q82C 2AQ1B 5I2XA 3MTSA 3S1NB 2F0MA 4QIWB 4JI4Q 4TRDA 4L8JA 3TP6A 2K50A 4K0KQ 3SK8A 1PH5A 3G71A 3I72A 4EGVA 1WJJA 1DJRD 1P8LA 1LTAD 2K5DA 4NW2A 4A3CG 5M3MG 2FXQA 1E7ZA 4PQXA 4IOCA 1XJVA 5EBCA 3M4PA 1HRJA 4R4OA 1X9NA 2BA1A 4A3BH 4MN3A 3G6EA 1M4VA 5T1IA 5H1SE 1L1OC 4DXGA 4DPGA 4POFA 4KN4C 1CM9A 4K2LA 4LUOA 1CQFA 5EKKA 1CFMA 3T1HL 4A3BB 3I90A 1H95A 3AB9A 3K5OA 1EY9A 3S1RH 2WAQG 2NZ1D 2EYJA 2K7VA 4DR5L 1X3QA 4L5QA 4TSSA 5C3WA 3U58A 3OOCA 1TWHH 3P7JA 3FKIG 4IN3A 3LNNA 4LW1A 2ZJPA 1I4RA 3BDCA 3D31A 4X3SA 3DM1A 1CA6A 2EDGA 4IFDJ 2WB1B 4R4QA 1P16A 4AYBG 5IYBG 5AJ3Q 3PO2H 4DV3L 3B6YA 4X65L 4ZKCB 1RTNA 1T9HA 2F0HA 2DJGC 4RCNA 3I73A 1EL0A 1XTCD 4GLXA 1L0XB 4DU9A 2K75A 2D0OA 3EJIA 2EY5A 1EIFA 1EU4A 4K6LA 3T4AC 2F0GA 2K14A 3PMFA 1KC8C 1KL9A 2JA5B 2ENBA 1BXTA 2F0FA 3ULPA 1BKBA 1VQPA 3I4MG 3GD7A 4LF9L 3IRBA 2WFWA 5ELCA 3HOYG 5LMNL 4RKBA 4DAPA 1IW7D 1ESRA 3AU7A 3K81C 4OL7A 4CKBA 3QB3A 1X3GA 4IQZA 3HOXG 3BYTB 3GQBA 5FO7B 1MIUA 3KLWA 4DR4L 3KJOA 4QGUA 1PH8A 4YWKA 1Y14B 3HOUH 4JI1L 4JI8L 4GNXA 3S2DH 4UP9A 1E0BA 3Q23A 3S1QB 3A8JE 4Q5VA 1WTXA 1W6KA 4DNRB 2UXDQ 4C3IG 2H1EA 3FVQA 3FDTA 2F1MA 1HR0Q 4PMCA 3HOUB 4K5VA 3S2DB 5KIXA 5JJLA 1NR2A 1SNCA 5KYIA 4NXMQ 2IHFA 4CDFC 4GN4B 4H44C 4C2MH 4HCSA 4P72A 3CMEA 4KN7C 3ULLA 5GADC 3MAQA 1BCPF 3I56A 4OONA 1Y1VG 4V190 4BXXH 1GUGA 2Y0SG 3OMCA 3I4NG 3TEHB 1GUNA 5FLMH 5J1ZA 5CBAE 4GOPB 5GAEC 1EQRA 4CKEA 1HJPA 1F77A 1HZAA 3T1YL 4B08A 1U9RA 1EY8A 3WOFA 4DR1L 4RCOA 2R93H 1N9WA 1PYSB 3U4VA 1MI2A 4DK1A 5EPJA 3TP8A 4H13C 4NDXA 3HOVG 3SE0A 1VQKA 4JI5Q 5BN4A 3SK5A 4MHEA 4C3JG 5C0XG 1GJXA 1AW7A 1YHAA 1QZGA 2PI2E 2NVTB 2JK8A 4IURA 3H3VI 2BH2A 1QOHA 1D1KA 2R7DA 1N8RC 1EZ6A 1TS4A 1GUSA 1WTWA 4A3DG 5M5WH 2VUMG 3NP8A 1OXTA 1OXXK 3F2DA 3J80i 3D6CA 2HDMA 2IW3A 2F0UA 1D1IA 4M1UB 1NR4A 2KCCA 4A3EG 4IPCA 3CCQA 3GTLB 1HZCA 2ZM6Q 1HFNA 4BY1G 1JOQA 4JOIA 4EX5A 2B63B 3GTKB 3TRZA 4I65A 1YITA 1VMCA 4K5XA 5C4JH 1JJCB 2VZAA 1VQDA 2PW7A 2R7ZG 3F2BA 2UU9Q 4P73A 4CJ1B 3S1MH 3SHLA 3K80C 3CQZB 3SK6A 1LT4D 1BOSA 4IPHA 3NTIA 5JEAJ 2MNAA 3RD4A 1SE8A 2KCMA 4A3IH 5EAYA 2GVBA 4YHHL 2EY6A 4DV2L 1BBUA 2A6ED 3P75A 3STBD 1I3QH 2BE5C 4OO1I 3T53B 4XYOA 5KNBA 1WTVA 2X6GA 2FHTA 1UEBA 2SOBA 1X56A 2OT2A 1DM0B 3SVMA 3Q0AA 1VQIA 2UUAQ 4A3IB 5E3FA 5CMDA 4DR2Q 5M3FG 2E8GA 1EFWA 2KQ3A 3J7A5 3ERQA 1I3QB 3QIAA 3ULJA 1CI3M 1YBYA 4BBRG 1WCMB 4OEMB 2KA7A 3OTOL 5C3XA 4DV0L 2E5LQ 1MD2D 1EIGA 3KF8B 4JBJA 1CHQD 3RN2A 1Q1EA 2HIXA 4LJZC 2N3SA 3CCRA 1U4RA 3KUPA 2EIFA 1YIJA 4LK1C 1J8IA 3TZDA 2JYOA 3LWEA 3HKZE 1NY4A 3H3VC 3MEHA 5LMNW 2EY1A 1PHJA 3K6OA 5BR8Q 3ER0A 5EGTA 4JPBW 4A3MG 1OTCA 1ONLA 3FP9A 1BUVT 5FO8B 1F9PA 1VQ5A 4CGYB 2HD3A 2PQAB 2RHSB 1Y69U 2ICIA 1VQJA 1D8LA 1WI5A 2A69C 2F0QA 1YJWA 1CSPA 3NWTA 1QWYA 3QG1A 4RGTA 4JBKA 4EVOA 1VQ7A 4FXDA 2DGYA 1XPUA 1HA6A 2JEAI 1QCBD 1B3AA 2HQLA 2B2TC 3QWNA 1BBXC 3U9SA 1F2LA 4O42A 1IBKL 5CV4A 1EQVA 4LFCL 4OX9Q 1H9KA 3C46A 1ENCA 4U673 1HQRD 1BCPD 3IL8A 4KHZA 2NN6I 2GN5A 1QB5D 3J7AV 2VXWA 5I9PA 1W3SA 4I7ZC 5EPKA 2A68C 2WKCA 5EPLA 5K5PA 4V0BA 1B1ZA 2C5CA 3OWFA 3RZDH 4IOAA 4TQUS 4F7XA 4GNXB 4A3CH 1JOOA 4QF4A 3CCVA 1A3UA 2CQOA 1B4OA 1FD7D 3KLSX 2VB3X 4RG1A 3FEWX 4BY7B 1RKNA 4IFDH 4IUTA 1Q90A 4TKOB 3U4ZA 3S14B 4A93H 2E74C 2TSSA 1JQYD 3BZDB 2MQHA 1K9MC 4JI0Q 2B2WC 2XSCA 2F3IA 4LF5Q 3CC2A 1C4QA 1HNXQ 4OWWB 1GO3E 1Y1WB 5JJIA 1EQTA 4JBMA 3JAMi 2NTTA 4A93B 1EWCA 1II3A 4WFN3 4B3TL 1ML0D 1YHBA 3DXJC 5CYUA 3R2IA 5DAUA 1NE3A 1HH2P 2ICEC 5IYBH 4K14A 3GTGB 2JA8H 4JI3Q 1N33L 4KKUA 3HG9A 4RGOS 1KNEA 5I6WA 5D3DA 1ENFA 3BZCA 2NWGA 4R8NA 1ET6A 3BVZA 2N8NA 2JA8B 2OTLA 4KHPQ 1LTSD 4MZ9A 4KY6A 1XPOA 3I3CA 3I4MH 4R4TA 5CV7A 3T56B 3NTKA 3CW2C 4DR6L 1GUOA 5M5YH 2CW0C 2N55A 2BH8A 2KBNA 2R92B 3L0OA 4IZ8A 1ZEQX 2F0OA 4DAYB 5ISRA 1OO9B 2LSSA 1Q1BA 4XTCS 1UUPA 1D5ZC 1JR0D 3PF5A 2PPBC 2ASBA 1I4XA 3BZKA 3ND9A 1B44D 3PCOB 1RCVD 1J6QA 2I5HA 4YCUA 3UE1A 1SR3A 5C44G 2K6AA 3T1HQ 2LXKA 2UUCL 4ZRZA 1EU3A 2NVQB 1HNWL 1D5XC 3D4WA 3G6JB 3H0GH 3MA2B 4RFBA 3CXCA 4DR5Q 2ES2A 1CKNA 3GTOH 3U9OA 3PO3H 5IGEA 1RTOA 1LTID 3VDYA 3J80c 1MBYA 3ERSX 2IJ0A 4IPGA 3HKZG 4ZKBB 4X65Q 3N52A 5HY6A 3GTOB 1Y1VH 2O4XA 3I55A 3PO3B 3KYHC 5K36G 2PI2A 1C9OA 2NUCA 1A2TA 3SDZA 1ILPA 4FP5D 1KDAA 1LT3D 3PGZA 3PUVA 2BA0A 3S17B 4QL5A 3PUZA 2K04A 1MHWC 2F0DA 3KF6B 4CJ0B 3PIPA 4RH6A 4A3JH 4X64L 2MJ8A 2QCPX 3UDXA 4ILWA 3UDGA 1MJEA 3QOJA 4ZK9B
chains in the Genus database with same CATH topology
3FMCA 3RLFA 4UDUC 1PTOH 2KJXA 1HXYD 4R8IA 1L0YB 4F87A 3TP7A 2PNRC 5CC4A 2K5QA 1U4PA 4FO2A 3OPOA 1ENAA 2DNEA 4OIKA 2IX0A 1TQOA 1A15A 5JEAH 5LHY1 2PCFB 1DCZA 5IIFA 2DY8A 4DXFA 1CZWA 1DONA 5CV9A 3K5LA 2L5TA 4DN4M 3W2DA 2LS01 5F2DA 5BN5A 1IL8A 4IUPA 3V96A 4OO1G 5JPNC 1A3TA 4B9WA 1S5FD 2PZTA 4XQNA 1H9RA 3VR6A 3OW7A 4HMIA 3A8IE 3FRPB 4XT3B 1NAPA 2B2UC 4F8MA 1Q3LA 1HQMC 1UNSA 1KAAA 1SYCA 1HFGA 3RZOB 3MXNA 1I4PA 3T51B 3JAML 2F3WA 4JK1C 2EXZA 4QMGA 1BCPB 4FYDA 4PNYA 3K5NA 2SNMA 2F3VA 4A3KB 3TSSA 1F2YA 2A6HC 5I9OA 1Q8IA 2AWOA 1JORA 3D3RA 1IYVA 3VYSA 3J81L 1IKLA 2E2IB 2IX1A 3GTQB 3DWAA 3QOLA 4A3GB 5M9OA 2JA6B 4IUUA 1GOZA 2AUKA 2JA7B 3R2TA 5IT9L 1PTOF 1F9QA 1DD2A 4OIJA 1PZKD 2NN6G 5E1FA 3VYRA 1BDOA 4KTAA 3S1RB 3C1EA 3VA7A 3NXWA 4C3HB 3X3NA 2KEDA 3MC0B 5IGFA 2SNSA 1TWHB 5FK9C 2F03A 3BVGA 1EY5A 5LL6X 3PO2B 2DNCA 1JICA 4OGQC 3ITPA 1IKMA 3X3MA 4EQPA 2O5IC 3H91A 2D5DA 4HSPA 1VF5C 4XDXA 1SDFA 2B2VC 3FPUB 1K8OA 2DN8A 4XT1B 5IODA 1XWEA 2WV6D 2VNUD 5IGCA 2ZT9C 4Q0FA 3P20A 4ZYSA 2KOLA 1HHVA 4RGNA 2EYOA 1WTQA 3EFXD 1SNPA 1EYDA 1JCKB 1KDCA 1TS3A 4LMQD 1KLGD 2B2YA 2FMMA 1OXSC 1NCVA 4K5WA 5C4ZA 3TZUA 4P2CB 3CRKC 3KBXA 3BYYB 1TT2A 2XNAC 1UAPA 3A55A 3A56A 5E4XA 2QF7A 3VR4A 3HOWB 2A5HA 4HAEA 1LTBD 1SE4A 4DGZA 4C2MB 1SE2A 1RF2D 3DWPA 3MWYW 1M8AA 5A2QE 4KV6A 2LFNA 4G7ZC 4HSVA 3K57A 1F9RA 1CQVA 2JP1A 5DEHA 3CKIB 3L9AX 2H4OA 3HOZB 2L9HA 4GZYC 2R93B 1DOKA 1EY7A 1JWUD 1H9MA 5C5MA 3VYTA 1JWMD 1PDQA 1UEAB 3S15B 1V43A 2WACA 3R3OA 3VYUA 5G3LD 4ZQ3A 2PZWA 1ZYRC 1E2WA 3DEOA 1SNQA 4N9PA 3SEBA 1RDPD 3M7GA 5M5WB 5C0XJ 2PMZB 1GUTA 5IGBA 1BR9A 1PFMA 3D4DA 3AMUA 5HGTA 3KBGA 1RD9D 3A8KE 1C48A 4Z9CB 5C4JB 4QUFA 2E2HB 2XWJB 1TY2A 3S1MB 1PTOD 3MXGA 1YNND 1F2MA 5I2YA 1I6HB 1XYIA 1SYBA 3NQTA 2IWHA 2F0EA 4DAVA 2K05A 2QEJC 3T13A 2Z1CA 4DK0A 4KD3A 1TWGB 4MIUA 2FJ2A 4DFAA 2A73B 1STNA 1SMYD 2TMPA 3VA5A 1LTTD 1STEA 1LT6D 1LLRD 5JAVA 2MPMA 1HTLD 4WORA 1WTRA 1G291 2MP1A 4NMZA 4BS9A 3MVVA 3HGBA 4J6HA 1B9NA 1PFNA 5FOBB 1QNKA 2RBMA 4OO1H 4G57A 2OEOA 1EY4A 5JVH3 4HMJA 4NP5A 1I6VC 2M00A 1E2ZA 1SJHD 4KK7A 1ZKOA 5EKIA 5EBDA 5D3IB 2B39A 4DNTB 2BDNA 5ELEA 4QCLA 3NWSA 2M9VA 4IFDI 1NSNS 5HURA 4ID6A 3HP3A 1HUNA 1X32A 5NUCA 2EPBA 1STAA 3SXHA 4ZLTF 2L11A 5I6YA 1HTPA 2SEBD 2EY2A 5FO9B 5ELBA 2IT1A 2XIWA 3RZDB 1DYQA 3IFTA 3HZXA 1STBA 2YU9B 5KYLA 2EZVA 1DOMA 1EZ8A 3M4YA 5A35A 1SNMA 2R3ZA 3ONAB 2C9OA 4FF2A 5EQ0A 3A54A 1BO0A 3V05A 2F0SA 4KY5A 2LMCB 1TU2B 4ZAIA 1V1PA 1JB3A 3SR1A 2KEEA 2WAQB 1EYCA 5DNFA 3T16A 5ELDA 5CGKA 3DHQA 1B2TA 4AYBB 1O7ZA 1VMPA 3TBIB 1S5ED 1X3PA 5JVG3 1B50A 3HRZC 3PIP3 1SNDA 3MFYA 1IW7C 2CVRA 3C2PA 3FPPA 4EQOA 3QJYA 4IUQA 2FINB 3I4MB 2F0NA 3OWEB 1KABA 3IKJA 1Y8OB 5M5YB 4FNFA 2WP8J 3NK9A 3DMUA 4HEDA 2HUGA 3NHHA 2EOTA 3J80E 4CHTB 4PV1C 2EE1A 1A3VA 3MFGA 3UI2A 3PUYA 2EJGC 1GUWA 2Z4HA 4YIJA 1QILA 3H0GB 1JE4A 4XQQA 4CKCA 1TY0A 2RA4A 5KRUA 4RHRA 1EEFD 1CT1D 2XN9C 3IFDA 2O2LD 2PO4A 2ID0A 1Y1VB 4ME5A 4RWSC 3I4NB 4FF4A 1H9SA 1WD0A 1K83B 3M85A 5FLXL 5C0XH 1O7LA 4A3JB 1I4QA 1JWSD 4C3JB 1PTOB 3H94A 1G8ZD 1FYCA 3A7LA 2EJMA 4XIGS 1EFID 1TS2A 4KI0A 1IYUA 2G9DA 2E76C 4KKSA 1F2ZA 4KD4A 2XRSD 3R93A 2J4XA 5CBEE 1RHPA 5KEEA 1MSGA 2N88A 2PZUA 1AZQA 3NUCA 4K8JA 2Q8TA 5IOCA 3W3AA 3CU7A 1AEXA 1LV9A 5C5LA 1J9OA 2BCOA 1LACA 1XXGA 1SJED 4IALA 4BY1B 2CHBD 1PZID 3BDOA 2G9HD 1WTOA 2MGSA 4KMUC 2A6EC 3DEPA 2R7ZB 1PTOC 3A7AB 1YNNC 3OHXC 1FNWA 4RAUC 2AQ3B 2R6GA 1QE6A 4L6TB 4J8QA 3LX0A 3EA6A 3J7AF 2VB2X 2A69D 5C3EB 1SYDA 4WJWA 3TP5A 3DUZA 1SMYC 2WIIB 1S5BD 4K6DA 1ILQA 5G3LF 1AP0A 1SEBD 5CV6A 4BBRB 1YNJD 2X69A 3P1HA 4FXKC 1D2BA 1PRTF 2JXMB 2HCIA 3NQIA 2EVBA 2FFKB 4QUCA 1V1PB 4X3TA 2OXPA 2A68D 3D8GA 2V4DA 4HN7A 3TN2A 3JAME 1FR3A 4A3MB 1EY6A 2JEBI 4C56C 1VDZA 2AUJD 3GTPB 4IFDG 3E0JA 3KF8A 4R9WA 2B2TA 5KNDA 4BA1I 1ICWA 3J81E 1BCPC 3LWUA 1KDBA 2XRQD 2EYLA 1QJOA 3KK7A 4PMBA 2J7ZA 2F0WA 2ZXRA 4J1MA 1T5XD 2NYZD 1STHA 5CV8A 5IT9E 4EQNA 3IAYA 1SXTA 5C6AA 1WD1A 3E6ZX 1Y8PB 3NPPA 2KCNA 3HS0C 5ELFA 2JE6I 2EYFA 1GHKA 3Q24A 1PFBA 4KKTA 1EYAA 1TWFB 2B2WA 1QG7A 2HQEA 1B9MA 4F88A 3BDLA 1PMRA 1Y8NB 5JPMC 1RJTA 5CR3A 1DXMA 3L7ZC 2WINB 3GP7A 2CW0D 3RMHA 1HCZA 3H09A 1DZ1A 2MUYA 4JBWA 4FXGC 1B53A 1H9SB 3CRLC 2J0TD 3S16B 2F0PA 3OMGA 3L3OC 4G7OC 2PQEA 5D65A 1MGSA 1JOKA 2Q8RE 3PV0A 5EKLA 4PMWA 3TMEA 1STYA 1G91A 5A2QL 5KGUA 5COYA 4M8AA 5CV5A 4XXEA 1U4LA 2NVYB 3OSOA 1Z47A 4ABNA 2Z4IA 2E2DC 3Q22A 4FF3A 1TWAB 1Q12A 3I8ZA 3URYA 1BNZA 3O13A 3GO5A 2K28A 3BVMA 3PUWA 4CJ2C 2PW5A 3K0YA 1SNOA 1GHJA 2R61A 4K2KA 2HDLA 5C44B 5J22A 1SFOB 4ZUJA 2HCCA 1PRTD 2K01A 1CA5A 3KLRA 4G4KA 4QB4A 1FNVA 4CBVA 5K36H 3Q6SA 1VF7A 2RDHA 3RUZA 1BQQT 4DAYA 5C4HA 3HKZB 2F0JA 5JEAG 5DM63 1BF4A 3E5SA 2FMCA 3OIPA 4X3UA 4FVMA 5E4WC 4HTHA 1V8QA 1IHZA 3DWQA 3I91A 4U68A 1Z7TA 3MXUA 2F4IA 2K1BA 3WDNA 4BWGB 4RKLA 1R4PB 2EJFC 2X6LA 2ZXOA 2RDFA 1VCIA 4K8IA 2AQ2B 1O78A 4B9XA 5LL6S 1TWCB 4WRDA 5DM73 3N6RA 4E6IA 1G2SA 1V1OA 2D2CC 5C4XB 2RQXA 1SYGA 2IX3A 2F0LA 2D9UA 1A6XA 1SSOA 1SYEA 4KHVA 2I46A 3NSWA 4BA2I 2QILA 3EROA 3MHBA 4KJOA 2OF1A 1EEID 4S3SA 1LTRD 1MSHA 3NBIA 1U4MA 2NTSA 1G2TA 4X3KA 1GXDC 3D6WA 2B8FA 2E2JB 2A6HD 2JSOA 3BS1A 1QNUA 2F0IA 1R4QB 1TR5A 3M4OB 2EYMA 2B2UA 1I4GA 2Q8IB 2L12A 5AFWA 3ZYYX 4LAAA 1HUMA 5CORA 2L55A 1LT5D 4C3HG 1LTGD 1Z6HA 3ND8A 1YNJC 1CTMA 2RDGA 1HA5A 1SBBB 1FGBD 5D14A 2LY7A 4RHSA 3SK4A 1D6EC 2YYZA 4G7HC 1RODA 3NE5B 2MHVA 5M3MB 2F0VA 1C8CA 4N9TA 2D62A 3D4RA 1KTKA 4H0LC 3V2TA 1W6JA 3S9WA 2O5JC 2A74C 2RKSA 3NTHA 5I4DA 4ULLA 5FKAC 5IGDA 1OXUA 3K59A 2QKIC 5T1GA 3MZ5A 1CHPD 2DY7A 2L4NA 5M5XB 2NN6H 1I4HA 1EWHA 1KLUD 1PZJD 3VR5A 1ESFA 3GV6A 1PLFA 2K32A 2Z8LA 2L0CA 2XWBB 3FKIB 1EIHA 2SDFA 1TVXA 2B2YC 1CZGA 1OXVA 5J39A 5EJWA 2KECA 2KVMA 3GTMB 3PUXA 2NBFA 3NBHA 3KLSA 2F0KA 2B8GA 2XVSA 3I70A 2B2VA 2ZXPA 1SAPA 2KHSA 2BDOA 3C3LA 3HOYB 4ZUIA 4L63B 4HR7B 1FNUA 2GA4B 2NVXB 2CQAA 3J80L 3HOXB 4H7BA 2RVLA 1KNAA 3H6MA 1ZXTA 3GTJB 1A2UA 4C1NI 1T5EA 1SE3A 2LKVA 4C3IB 4IUNA 2QDBA 3BG3A 1WVLA 1PXUA 4UAIA 5C0XI 1R9TB 4BBSB 1TIID 3HEJA 5BN3A 1TKWB 4XQJA 2PYKA 4RA8A 5IGGA 1PRTB 1ZYRD 4DF7A 2RSOA 1EY0A 2Y0SB 1HPCA 4KY7A 1EOTA 2RSNA 2KUMA 2K33A 3K5MA 2AWNA 4A3FB 1CK1A 1XX8A 4OHJA 2EYHA 3I4LA 1S5CD 3VR2A 3HOVB 2NB0A 3VR3A 1JC7A 2EYPA 3F2UA 3S2HB 4C1NK 1E2VA 4RGMA 5FLXE 2BE5D 3EVQA 3TDQA 1O80A 3J7YW 1PRTC 4A3DB 2VUMB 5JJZA 2E75C 1F9SA 1I50B 1S4ZA 1NUCA 4IUVA 2M2LA 4DA2A 1AZPA 1S5DD 4A3EB 1AN8A 1SYFA 3EQLC 2BOSA 1PYWD 3M7NA 2F0TA 3C1FA 3M3YB 4HCEA 1DOLA 3MXPA 2K5WA 5KNCA 4FF1A 1TS5A 1AFPA 4O1NA 1K8MA 2I07B 1O7YA 1D5MC 5JOBA 3GV3A 1H9JA 5TSSA 2K03A 4Y7NB 1ET9A 4XYQA 4KJNA 3K58A 1LABA 2L1BA 2WKDA 3PIO3 2IPKD 3QO2A 2IL8A 1G6ZA 1WTPA 3K7AB 3WOEA 3OIQA 4ODGA 3G7LA 3CHBD 5M3FB 4NKLA 1STGA 3R8BA 1LO5D 2AQ1B 5I2XA 3MTSA 3S1NB 2F0MA 4QIWB 4TRDA 4L8JA 3TP6A 3SK8A 3I72A 4EGVA 1DJRD 1LTAD 2K5DA 4NW2A 4PQXA 5EBCA 1HRJA 2BA1A 4MN3A 1M4VA 5T1IA 4DXGA 4KN4C 1CM9A 4K2LA 1CQFA 5EKKA 1CFMA 4A3BB 3I90A 3AB9A 3K5OA 1EY9A 2NZ1D 2EYJA 2K7VA 1X3QA 4TSSA 5C3WA 3OOCA 3P7JA 4IN3A 3LNNA 1I4RA 3BDCA 3D31A 4X3SA 3DM1A 1CA6A 2EDGA 4IFDJ 2WB1B 4ZKCB 1RTNA 2F0HA 4RCNA 3I73A 1EL0A 1XTCD 1L0XB 4DU9A 3EJIA 2EY5A 1EU4A 4K6LA 3T4AC 2F0GA 3PMFA 2JA5B 2ENBA 1BXTA 2F0FA 3GD7A 5ELCA 4RKBA 4DAPA 1IW7D 1ESRA 3AU7A 4OL7A 4CKBA 3QB3A 4IQZA 3BYTB 3GQBA 5FO7B 1E0BA 3Q23A 3S1QB 3A8JE 4Q5VA 1WTXA 1W6KA 4DNRB 4C3IG 2H1EA 3FVQA 3FDTA 2F1MA 4PMCA 3HOUB 4K5VA 3S2DB 5KIXA 1NR2A 1SNCA 5KYIA 4H44C 4HCSA 4KN7C 3MAQA 1BCPF 4V190 1GUGA 3OMCA 1GUNA 5J1ZA 5CBAE 4CKEA 1F77A 4B08A 1U9RA 1EY8A 3WOFA 4RCOA 1MI2A 4DK1A 5EPJA 3TP8A 4H13C 4NDXA 3SE0A 5BN4A 3SK5A 4MHEA 4C3JG 5C0XG 1GJXA 1AW7A 2NVTB 4IURA 1QOHA 1D1KA 1EZ6A 1TS4A 1GUSA 1WTWA 3NP8A 1OXTA 1OXXK 3D6CA 2HDMA 2IW3A 2F0UA 1D1IA 4M1UB 1NR4A 2KCCA 3GTLB 1HFNA 1JOQA 2B63B 3GTKB 4I65A 1VMCA 4K5XA 2PW7A 4CJ1B 3SHLA 3CQZB 3SK6A 1LT4D 1BOSA 5JEAJ 3NTIA 3RD4A 2EY6A 2A6ED 3P75A 2BE5C 4OO1I 3T53B 4XYOA 5KNBA 1WTVA 2X6GA 2FHTA 2SOBA 2OT2A 1DM0B 3SVMA 3Q0AA 4A3IB 5E3FA 5CMDA 2KQ3A 3ERQA 1I3QB 3QIAA 1CI3M 1WCMB 2KA7A 5C3XA 1MD2D 1EIGA 1CHQD 1Q1EA 4LJZC 1U4RA 3KUPA 4LK1C 1J8IA 3TZDA 2JYOA 3LWEA 3H3VC 3MEHA 2EY1A 3K6OA 5EGTA 1ONLA 1BUVT 5FO8B 1F9PA 4CGYB 1Y69U 2ICIA 2A69C 2F0QA 3NWTA 1QWYA 3QG1A 4RGTA 4EVOA 4FXDA 1HA6A 2JEAI 1QCBD 1B3AA 2B2TC 3QWNA 1BBXC 3U9SA 1F2LA 4O42A 5CV4A 1EQVA 1H9KA 3C46A 1ENCA 4U673 1HQRD 1BCPD 3IL8A 4KHZA 2NN6I 1QB5D 3J7AV 2VXWA 5I9PA 4I7ZC 5EPKA 2A68C 2WKCA 5EPLA 5K5PA 4V0BA 1B1ZA 2C5CA 3OWFA 4TQUS 4F7XA 1JOOA 4QF4A 1A3UA 1B4OA 1FD7D 3KLSX 2VB3X 3FEWX 4BY7B 1RKNA 4IFDH 4IUTA 1Q90A 4TKOB 3S14B 2E74C 2TSSA 1JQYD 3BZDB 2B2WC 2XSCA 1C4QA 1Y1WB 1EQTA 2NTTA 4A93B 1EWCA 1II3A 4WFN3 1ML0D 3DXJC 5CYUA 3R2IA 5DAUA 2ICEC 4K14A 3GTGB 4KKUA 3HG9A 4RGOS 1KNEA 5I6WA 5D3DA 1ENFA 2NWGA 4R8NA 1ET6A 3BVZA 2JA8B 1LTSD 4KY6A 3I3CA 5CV7A 3T56B 3NTKA 1GUOA 2CW0C 2N55A 2R92B 4IZ8A 1ZEQX 2F0OA 5ISRA 1OO9B 1Q1BA 4XTCS 1UUPA 1D5ZC 1JR0D 2PPBC 1I4XA 3ND9A 1B44D 1RCVD 2K6AA 4ZRZA 1EU3A 2NVQB 1D5XC 3D4WA 3G6JB 3MA2B 4RFBA 3U9OA 5IGEA 1RTOA 1LTID 1MBYA 2IJ0A 4ZKBB 3N52A 3GTOB 2O4XA 3PO3B 5K36G 2NUCA 1A2TA 3SDZA 1ILPA 4FP5D 1KDAA 1LT3D 3PUVA 2BA0A 3S17B 3PUZA 2K04A 2F0DA 4CJ0B 4RH6A 2MJ8A 2QCPX 4ILWA 3QOJA 4ZK9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0C A;  3RD4 A; 
#chains in the Genus database with same CATH topology
 3FMC A;  3RLF A;  4IJL A;  4UDU C;  1PTO H;  2KJX A;  3W1G A;  1HXY D;  1X6O A;  4R8I A;  1E3P A;  4YCV A;  1L0Y B;  4F87 A;  3TP7 A;  2PNR C;  5CC4 A;  2K5Q A;  1U4P A;  4NB3 A;  4FO2 A;  3OPO A;  5IP9 G;  1ENA A;  2DNE A;  1A63 A;  4NXN L;  4UP7 A;  1N32 L;  1Q86 C;  4DUY Q;  2Z6K C;  4OIK A;  2IX0 A;  1TQO A;  4AH6 A;  1A15 A;  5JEA H;  5LHY 1;  5C4X G;  2PCF B;  1DCZ A;  5IIF A;  2JQO A;  2DY8 A;  1E24 A;  4DXF A;  4BY1 H;  1CZW A;  1VQB A;  1DON A;  1AH9 A;  4DAM A;  5CV9 A;  5GAH C;  1EWI A;  3K5L A;  3F8T A;  2L5T A;  1XMQ Q;  2Y0S E;  4DN4 M;  3W2D A;  2LS0 1;  4IJH A;  3RLN A;  3L2P A;  5F2D A;  5BN5 A;  1IL8 A;  4IUP A;  1KAW A;  1EUJ A;  4LF4 L;  3CD6 A;  3V96 A;  4OO1 G;  5JPN C;  1A3T A;  1VS0 A;  3STB C;  4B9W A;  4DV1 L;  2VQE L;  1S5F D;  1UE7 A;  2PZT A;  4XQN A;  5C3E H;  1H9R A;  3VR6 A;  3OW7 A;  5IY0 A;  4HMI A;  3A8I E;  3FRP B;  3RR5 A;  4XT3 B;  1NAP A;  2B2U C;  4F8M A;  1Q3L A;  1HQM C;  4CDE C;  4HJ9 A;  4BBR H;  5HGQ A;  1UNS A;  1KAA A;  1SYC A;  1HFG A;  3RZO B;  4A3K H;  3MXN A;  1I4P A;  3D0F A;  2YV5 A;  3T51 B;  3JAM L;  2F3W A;  4JK1 C;  2EXZ A;  1B7Y B;  4QMG A;  5FJ8 H;  1BCP B;  4CDC C;  2PNH A;  1NNX A;  4FYD A;  4KLK A;  2RCF A;  4PNY A;  2E2I H;  3K5N A;  2SNM A;  4LF6 Q;  4B3M L;  2F3V A;  4A3K B;  3TSS A;  2MFI A;  1AE2 A;  3CPW A;  4A3M H;  3GTQ H;  4JG2 A;  1F2Y A;  2A6H C;  5IYC G;  3KOJ A;  4A3G H;  5I9O A;  2JA6 H;  1Q8I A;  2AWO A;  1JOR A;  3D3R A;  1IYV A;  3VYS A;  2JA7 H;  1EOV A;  4BY7 G;  3J81 L;  1IKL A;  2E2I B;  1QVG A;  2IX1 A;  1EIY B;  3GTQ B;  1YHQ A;  3NBH B;  3DWA A;  3QOL A;  4A3G B;  5M9O A;  2JA6 B;  4IUU A;  1GOZ A;  4HJ8 A;  4GKJ L;  4C3H H;  2AUK A;  2JA7 B;  4AQY L;  4DNI A;  3R2T A;  1Y1W G;  4DV2 Q;  5IT9 L;  1PTO F;  3JAM c;  1F9Q A;  1DD2 A;  4OIJ A;  1PZK D;  2NN6 G;  3NEN A;  5E1F A;  3VYR A;  1BDO A;  4KTA A;  3S1R B;  3C1E A;  3VA7 A;  3NXW A;  4C3H B;  3X3N A;  2KED A;  3MC0 B;  4O0A A;  5IGF A;  2SNS A;  1TWH B;  5FK9 C;  2F03 A;  1PH9 A;  2Q2H A;  5GRO A;  3BVG A;  1EY5 A;  1LM0 A;  4HJ7 A;  1J5E L;  1ASY A;  5LL6 X;  4QIW E;  3PO2 B;  2DNC A;  4JI2 L;  1JIC A;  4OGQ C;  3ITP A;  1IKM A;  4PZ8 A;  3PQI A;  2Q2I A;  3X3M A;  4EQP A;  2O5I C;  2Z9H A;  3H91 A;  2D5D A;  4HSP A;  3GDE A;  1TWF H;  1VF5 C;  4XDX A;  2QW7 A;  1SDF A;  1CKO A;  1MJC A;  2B2V C;  3FPU B;  1CKN B;  1K8O A;  2DN8 A;  4XT1 B;  5IOD A;  3TS0 A;  2B29 A;  1XWE A;  2R92 G;  2WV6 D;  5GQO A;  4GN5 A;  1XNQ Q;  2VNU D;  5IGC A;  1VQH A;  1I94 Q;  2ZT9 C;  4Q0F A;  3P20 A;  4ZYS A;  2KOL A;  1HHV A;  4RGN A;  5IYD G;  2EYO A;  1HZB A;  1WTQ A;  3EFX D;  1PH7 A;  1SNP A;  1EYD A;  1JCK B;  1KDC A;  1TS3 A;  4UPA A;  1JMC A;  1IYJ B;  4LMQ D;  1KLG D;  2B2Y A;  2FMM A;  4BBS G;  1OXS C;  1NCV A;  4K5W A;  5C4Z A;  3HOW H;  4MNO A;  3TZU A;  4P2C B;  2HHH L;  2CKZ B;  3CRK C;  4I7A A;  3KBX A;  3UDF A;  3BYY B;  4DKA C;  1TT2 A;  2XNA C;  1IBK Q;  1RIP A;  4ZCK A;  4LFC Q;  1UAP A;  2WB1 E;  3A55 A;  3EIV A;  3A56 A;  5E4X A;  3WWV A;  2VL6 A;  2QF7 A;  3VR4 A;  3A5Z B;  3HOW B;  2A5H A;  1U0L A;  4HAE A;  1LTB D;  1VQG A;  1SE4 A;  5ELN A;  4QJF A;  4DGZ A;  4C2M B;  1SE2 A;  1RF2 D;  3DWP A;  3MWY W;  2QGQ A;  3HOZ H;  4A3F G;  1M8A A;  3G4S A;  2K52 A;  5A2Q E;  1TWA H;  4KV6 A;  2LFN A;  4G7Z C;  4HSV A;  3K57 A;  3TQY A;  3S15 H;  1F9R A;  1N34 Q;  1KRT A;  1CQV A;  2JP1 A;  3BU2 A;  5DEH A;  1VQF A;  3CKI B;  3L9A X;  2H4O A;  3HOZ B;  2L9H A;  4GZY C;  2R93 B;  1DOK A;  4P74 A;  1EY7 A;  1JWU D;  1PV4 A;  1H9M A;  5C5M A;  1UWV A;  1L0W A;  1JWM D;  1PDQ A;  1UEA B;  3VYT A;  1SFO H;  4R4C A;  3S15 B;  4Y52 H;  1V43 A;  2NZO A;  5ELO A;  2WAC A;  4HJA A;  2P5Z X;  3R3O A;  3VYU A;  5G3L D;  1A8V A;  4ZQ3 A;  2PZW A;  4LUZ A;  1ZYR C;  1E2W A;  2KEN A;  3DEO A;  2ZJQ A;  1SNQ A;  4N9P A;  4GOP C;  3SEB A;  4A75 A;  3AEV A;  1RDP D;  3M7G A;  5M5W B;  5C0X J;  2PMZ B;  4X6A H;  4DUZ Q;  2LXJ A;  1N33 Q;  1GUT A;  3K0X A;  5IGB A;  4IPD A;  1BR9 A;  1TXY A;  1PFM A;  3KDF A;  1IXR A;  3D4D A;  5GAG C;  3AMU A;  1SRU A;  2E2H H;  3I7F A;  4R1J A;  5HGT A;  4DV5 Q;  3KBG A;  1RD9 D;  3A8K E;  1C48 A;  4JI7 L;  1I6H H;  1N36 Q;  3CAM A;  4P71 A;  4HIM A;  2RCN A;  4Z9C B;  1I5F A;  4QUF A;  5C4J B;  4DR6 Q;  2E2H B;  1IBM Q;  2XWJ B;  1S40 A;  1TY2 A;  3CP0 A;  1TWG H;  2Z0S A;  1PTO D;  1E22 A;  3S1M B;  3MXG A;  1YNN D;  4LF7 L;  1F2M A;  5I2Y A;  1I6H B;  2AKW B;  1XYI A;  1SYB A;  3NQT A;  2IWH A;  2F0E A;  5LMU L;  4DAV A;  2K05 A;  2QEJ C;  3T13 A;  1TWC H;  2Z1C A;  4DK0 A;  1PH1 A;  4KD3 A;  1TWG B;  4MIU A;  2FJ2 A;  4DFA A;  3KJP A;  4A3L G;  4OEL B;  2A73 B;  1STN A;  1YJN A;  2UUC Q;  1IBL L;  1SMY D;  2TMP A;  3VA5 A;  1LTT D;  1STE A;  1LT6 D;  1LLR D;  4LF8 L;  5JAV A;  1XMO L;  3DM3 A;  3A74 A;  2MPM A;  3E0E A;  1HTL D;  4WOR A;  4DR3 L;  1DGS A;  1K8A C;  1WTR A;  1L2F A;  1G29 1;  2MP1 A;  4NMZ A;  4BS9 A;  3MVV A;  3HGB A;  4J6H A;  2VQF L;  3TRE A;  1B9N A;  1GVP A;  1PFN A;  2E2J H;  5FOB B;  1KQS A;  1QNK A;  2RBM A;  4OO1 H;  4G57 A;  2OEO A;  1PFS A;  1EY4 A;  5JVH 3;  4HMJ A;  1VQ8 A;  4NP5 A;  1W2B A;  3E3X A;  4A3B G;  1I6V C;  2M00 A;  1E2Z A;  3MEF A;  4LFA L;  1SJH D;  4KK7 A;  1ZKO A;  5EKI A;  5EBD A;  5D3I B;  2B39 A;  4DNT B;  2BDN A;  5ELE A;  4QCL A;  4GKK L;  1UE1 A;  3NWS A;  2M9V A;  1XTD A;  4IFD I;  1NSN S;  5HUR A;  3U50 C;  4YWL A;  4ID6 A;  1SLJ A;  2WB1 G;  1VQO A;  3HP3 A;  4JV5 Q;  1HUN A;  2AMC B;  1X32 A;  5NUC A;  1YZ6 A;  1N32 Q;  2EPB A;  4DV4 Q;  1STA A;  3SXH A;  4ZLT F;  2L11 A;  5I6Y A;  5M3M H;  2YU9 H;  1HTP A;  2SEB D;  4DR7 Q;  2EY2 A;  2UUB Q;  5FO9 B;  1VQM A;  2JA5 G;  5ELB A;  1FVI A;  3K8A A;  2IT1 A;  1K8G A;  2XIW A;  5IYC H;  1NBW A;  1GM5 A;  3RZD B;  1DYQ A;  3IFT A;  3HZX A;  1STB A;  3J7Z C;  1QUQ A;  2YU9 B;  5KYL A;  1L1O A;  4A4I A;  2EZV A;  4QY7 A;  1DOM A;  2UXB Q;  1EZ8 A;  3M4Y A;  5A35 A;  1Q7Y C;  1SNM A;  2R3Z A;  5M5X H;  3ONA B;  1NTG A;  2C9O A;  1KIX A;  4FF2 A;  5EQ0 A;  3A54 A;  1BO0 A;  3V05 A;  2F0S A;  1M1K C;  4KY5 A;  3FKI H;  4DV1 Q;  2LMC B;  2VQE Q;  1TU2 B;  4ZAI A;  1V1P A;  1JB3 A;  1XPR A;  4X66 Q;  3SR1 A;  2KEE A;  2WAQ B;  1EYC A;  3H15 A;  4GNX C;  5DNF A;  1B8A A;  3T16 A;  5ELD A;  3HOU G;  5CGK A;  5IWA L;  5IP7 G;  1YJ9 A;  4GS3 A;  3GTM H;  2ZTE A;  1LUZ A;  4CDD C;  3DHQ A;  1B2T A;  1V1Q A;  3J81 i;  1E1O A;  4AYB B;  1O7Z A;  1VMP A;  3TBI B;  3RLO A;  1S5E D;  1X3P A;  3E9H A;  3NEM A;  5JVG 3;  1B50 A;  3HRZ C;  3PSI A;  3PIP 3;  1LYL A;  1SND A;  3MFY A;  3HOY H;  1S3O A;  1IW7 C;  4OXP A;  2CVR A;  2NVX H;  3C2P A;  3FPP A;  1Z9F A;  4EQO A;  3J81 j;  3QJY A;  4IUQ A;  3HOX H;  2UU9 L;  1B70 B;  4UY8 C;  2FIN B;  3I4M B;  4BXX G;  2F0N A;  5FLM G;  3OWE B;  1KAB A;  3IKJ A;  1Y8O B;  5M5Y B;  4POG A;  4FNF A;  2WP8 J;  3NK9 A;  3DMU A;  4HED A;  4AIM A;  3F2C A;  4IO9 A;  2HUG A;  3NHH A;  2EOT A;  2N49 A;  2CH4 A;  3J80 E;  1VQC A;  1K0S A;  4C3I H;  4CHT B;  4PV1 C;  2EE1 A;  2R93 G;  1A3V A;  3MFG A;  1R9T H;  4GKJ Q;  3UI2 A;  2VY3 A;  1JB7 A;  3PUY A;  2EJG C;  1UE6 A;  1GUW A;  2Z4H A;  3Q8D A;  4YIJ A;  1QIL A;  4DV3 Q;  3H0G B;  2F4V L;  1JE4 A;  4XQQ A;  4CKC A;  4YWM A;  2Z6B A;  3I4N H;  1TY0 A;  2RA4 A;  1K83 H;  3LGJ A;  2QDL A;  4RHR A;  5KRU A;  1EEF D;  3AFQ A;  1CT1 D;  2XN9 C;  2B63 G;  1SRO A;  1K0R A;  3IFD A;  2O2L D;  1U5K A;  2PO4 A;  4DK3 C;  2ID0 A;  1Y1V B;  4ME5 A;  4RWS C;  3I4N B;  4FF4 A;  1H9S A;  4JOI C;  1WD0 A;  1K83 B;  1PH3 A;  4LF9 Q;  3HOV H;  5LMN Q;  3M85 A;  5FLX L;  2H5X A;  4C3J H;  5C0X H;  1KRS A;  4DV6 L;  1O7L A;  3S2H H;  4A3J B;  3G48 A;  1I4Q A;  4JI6 L;  4DR4 Q;  1JWS D;  4A3D H;  4JI1 Q;  4JI8 Q;  4OWT B;  4C3J B;  2VUM H;  1PTO B;  4A3I G;  3H94 A;  1G8Z D;  1VQ9 A;  1FYC A;  3A7L A;  3UDI A;  2ZTC A;  2EJM A;  4OX9 L;  1WCM G;  2D0P A;  4XIG S;  1X65 A;  1EFI D;  4A3E H;  1TS2 A;  4KI0 A;  2DJF C;  1IYU A;  2G9D A;  2E76 C;  4KKS A;  1F2Z A;  4KD4 A;  2XRS D;  3R93 A;  1NMG A;  2R7F A;  2J4X A;  5CBE E;  1RHP A;  3M3Y H;  5KEE A;  1MSG A;  2HHH Q;  2N88 A;  2PZU A;  1AZQ A;  3NUC A;  1X55 A;  4K8J A;  2Q8T A;  5IOC A;  3W3A A;  3CU7 A;  1AEX A;  5J3B A;  4MTK A;  1LV9 A;  5C5L A;  1J9O A;  2R7Z H;  2BCO A;  1LAC A;  1S72 A;  1XXG A;  1SJE D;  4IAL A;  4BY1 B;  4Y7N H;  1X54 A;  1PZI D;  2CHB D;  2G9H D;  3BDO A;  1WTO A;  2MGS A;  1WTH A;  4KMU C;  2A6E C;  3DEP A;  4JYA L;  2R7Z B;  1PTO C;  3A7A B;  1YNN C;  3OHX C;  1FNW A;  3W1B A;  3T1Y Q;  4RAU C;  3K7A H;  4DR1 Q;  2AQ3 B;  2R6G A;  4LF5 L;  1QE6 A;  4L6T B;  1HNX L;  4J8Q A;  1AE3 A;  4QQB X;  3LX0 A;  5M3F H;  3EA6 A;  3J7A F;  2VB2 X;  2A69 D;  5C3E B;  1SYD A;  4A3L H;  4ALP A;  4WJW A;  3TP5 A;  3DUZ A;  1QUQ B;  2KCT A;  1SMY C;  2WII B;  1S5B D;  3CCE A;  4K6D A;  1ILQ A;  4JI3 L;  5G3L F;  1JT8 A;  1AP0 A;  1SEB D;  5E7N A;  5CV6 A;  1G6P A;  4BBR B;  1YNJ D;  2X69 A;  3P1H A;  1K28 A;  4FXK C;  1D2B A;  1PRT F;  2JXM B;  2HCI A;  2OQ0 A;  4KHP L;  3NQI A;  2EVB A;  2FFK B;  4QUC A;  1V1P B;  4X3T A;  2OXP A;  2A68 D;  3D8G A;  2V4D A;  3GTP H;  4HN7 A;  3TN2 A;  4JC0 A;  3JAM E;  1FR3 A;  4A3M B;  1EY6 A;  4LFB L;  2JEB I;  1KHI A;  4C56 C;  5L37 A;  3S24 A;  4YY3 L;  1VDZ A;  1JE5 A;  2AUJ D;  2YTY A;  2CWP A;  4JI7 Q;  1GD7 A;  2V1C C;  3GTP B;  4YHH Q;  4IFD G;  3SGI A;  3E0J A;  4B3R L;  3KF8 A;  4R9W A;  4X62 L;  4A93 G;  2B2T A;  4OWX B;  5KND A;  2KHJ A;  4BA1 I;  4LF7 Q;  4A76 A;  1ICW A;  3J81 E;  1BCP C;  3LWU A;  1KDB A;  2XRQ D;  2EYL A;  2I0Q A;  1QJO A;  3PIO A;  5LMU Q;  3KK7 A;  1JJ2 A;  4JW0 A;  4PMB A;  1XNR L;  1RL2 A;  2J7Z A;  2F0W A;  2ZXR A;  4J1M A;  1T5X D;  2NYZ D;  1STH A;  3OTO Q;  1SMX A;  4DV0 Q;  4DV7 L;  5CV8 A;  4WJ3 M;  3J81 c;  5IT9 E;  2QEX A;  1IBL Q;  2PQA A;  4EQN A;  3IAY A;  2JA8 G;  1WFQ A;  2JA5 H;  3ICE A;  4GLA C;  1GKH A;  1SXT A;  5C6A A;  1WD1 A;  3E6Z X;  1CUK A;  4LF8 Q;  1Y8P B;  3NPP A;  2KCN A;  1XMO Q;  1VQE A;  3HS0 C;  1FJG L;  5ELF A;  3ZJY C;  3OW2 A;  2JE6 I;  3CMA A;  2EYF A;  4DR3 Q;  1GHK A;  5IT9 c;  3Q24 A;  2UXC L;  1Q46 A;  3W5O A;  1PFB A;  1MKH A;  4KKT A;  2VQF Q;  1EYA A;  2L15 A;  1TWF B;  2B2W A;  1QG7 A;  2K5N A;  2HQE A;  2IHE A;  1HNZ L;  1B9M A;  4F88 A;  3BDL A;  1PMR A;  1Y8N B;  2YTX A;  5JPM C;  3S1Q H;  1RJT A;  1BBW A;  2EQS A;  5CR3 A;  4LNQ A;  1DXM A;  3L7Z C;  2WIN B;  3GP7 A;  3S16 H;  2CW0 D;  4LWC A;  3HKS A;  3RMH A;  1YI2 A;  1HCZ A;  3H09 A;  1DZ1 A;  4LFA Q;  2MUY A;  4JBW A;  3JC6 6;  4FXG C;  1B53 A;  4B3S L;  5IP7 H;  1H9S B;  3CRL C;  2J0T D;  3S16 B;  4DUY L;  2F0P A;  4GKK Q;  3OMG A;  1WYD A;  1HZ9 A;  3L3O C;  4G7O C;  2PQE A;  5D65 A;  1MGS A;  3H0G G;  4WJ4 A;  1JOK A;  2Q8R E;  3PO3 G;  3PV0 A;  4RMF A;  5EKL A;  4PMW A;  3TME A;  2JJQ A;  1STY A;  1G91 A;  2NVY H;  5A2Q L;  2CFM A;  1XMQ L;  2HT1 A;  4FDB A;  4N8X 1;  5KGU A;  4L5T A;  3CCS A;  4APV A;  5COY A;  2OCE A;  4M8A A;  5CV5 A;  4XXE A;  1U4L A;  2NVY B;  1B3Q A;  3OSO A;  1Z47 A;  1YVC A;  1YNX A;  4ABN A;  2Z4I A;  2E2D C;  3Q22 A;  4FF3 A;  1TWA B;  1CKM A;  1Q12 A;  5C44 H;  2NVT H;  3I8Z A;  3URY A;  1BNZ A;  4A3J G;  2GVA A;  2CCZ A;  3O13 A;  5IE8 A;  3GO5 A;  2K28 A;  3BVM A;  3PUW A;  4CJ2 C;  2PW5 A;  3K0Y A;  1SNO A;  4ME3 A;  3AYH B;  1GHJ A;  2R61 A;  4K2K A;  4B3T Q;  2HDL A;  5C44 B;  2YTV A;  1Q81 C;  1D7Q A;  5J22 A;  1SFO B;  1VQL A;  4ZUJ A;  2HCC A;  4JI4 L;  1PRT D;  3CCJ A;  3RNU A;  2K01 A;  1CA5 A;  3KLR A;  4G4K A;  4QB4 A;  4HID A;  3GTL H;  1FNV A;  5IWA Q;  4K0K L;  4CBV A;  5K36 H;  3Q6S A;  3UE0 A;  1VF7 A;  2RDH A;  1NJI C;  3RUZ A;  1BQQ T;  4DAY A;  5C4H A;  2B63 H;  3HKZ B;  2F0J A;  3I4O A;  5JEA G;  5DM6 3;  1BF4 A;  3GTK H;  1C0A A;  3E5S A;  4LF6 L;  2FMC A;  3OIP A;  1PVO A;  4X3U A;  4FVM A;  5E4W C;  4HTH A;  2XTI A;  3M9B A;  2G5D A;  3A0J A;  1IL2 A;  1V8Q A;  2DUD A;  3CQZ H;  4H02 A;  1IHZ A;  1EQQ A;  3DWQ A;  3I91 A;  3H3V H;  4U68 A;  4N8F A;  1Z7T A;  3MXN B;  3MXU A;  1O7I A;  2F4I A;  3M4Q A;  2K1B A;  2KHI A;  3WDN A;  4BWG B;  4RKL A;  1R4P B;  2EJF C;  2X6L A;  2NZH A;  2ZXO A;  2RDF A;  4JVZ A;  5IP9 H;  4GLV B;  1VCI A;  4GN3 B;  2A1A A;  4K8I A;  2AQ2 B;  3K7U C;  1O78 A;  4B9X A;  1Q8K A;  5LL6 S;  2B3G A;  1X3F A;  5C4X H;  1PA6 A;  2Z6K A;  1WCM H;  5C3E G;  5AJ3 L;  1TWC B;  4WRD A;  5DM7 3;  1HNW Q;  1PH6 A;  4R4I A;  2RF4 A;  1WOC A;  3N6R A;  5DLQ E;  4E6I A;  3KF6 A;  1G2S A;  1V1O A;  2D2C C;  5C4X B;  2RQX A;  1SYG A;  2XGT A;  2IX3 A;  2PMZ E;  2F0L A;  2K5V A;  2D9U A;  1A6X A;  1SSO A;  1SYE A;  4KHV A;  2I46 A;  2N78 A;  4A3K G;  2F4V Q;  3I2Z A;  3NSW A;  4BA2 I;  3F1Z A;  4PZ7 A;  2QIL A;  4JCV E;  3ERO A;  3MHB A;  4KJO A;  2OF1 A;  1EEI D;  4S3S A;  5FJ8 G;  1LTR D;  1MSH A;  3PF4 A;  3NBI A;  2Q2U A;  1U4M A;  2NTS A;  3M4O H;  1VQN A;  2CWA A;  1G2T A;  4X3K A;  4X64 Q;  1GXD C;  3D6W A;  2B8F A;  4A3G G;  2A6H D;  2E2J B;  2VS1 A;  2JA6 G;  1PH2 A;  2JSO A;  1XNQ L;  4P75 A;  1VQ6 A;  3BS1 A;  1I94 L;  2JA7 G;  1QNU A;  2F0I A;  3CCU A;  1R4Q B;  2HIV A;  4DV6 Q;  1TR5 A;  3M4O B;  2EYM A;  4PG3 A;  2B2U A;  1I4G A;  2UXD L;  2Q8I B;  2L12 A;  5AFW A;  2CH4 W;  3ZYY X;  4LAA A;  1HUM A;  4JI6 Q;  4HIK A;  5COR A;  1HR0 L;  1FL0 A;  1IZ6 A;  2JA9 A;  2L55 A;  1LT5 D;  4C3H G;  3CCM A;  1LTG D;  4NXN Q;  1Z6H A;  2VW9 A;  3A5U A;  4NXM L;  3ND8 A;  1YNJ C;  1CTM A;  2RDG A;  3CC7 A;  1HA5 A;  1SBB B;  3BJU A;  1FGB D;  1V9P A;  5D14 A;  4EQ5 A;  2ATW A;  1UE5 A;  3PO2 G;  2LY7 A;  3QR8 A;  4RHS A;  1D6E C;  3SK4 A;  2YYZ A;  1QVC A;  4G7H C;  4L5S A;  1ROD A;  3NE5 B;  4PZ6 A;  3AFP A;  2MHV A;  1QVF A;  5M3M B;  2F0V A;  1C8C A;  4BY7 H;  4N9T A;  2D62 A;  2IY5 B;  3D4R A;  1KTK A;  3S14 H;  4H0L C;  3V2T A;  1W6J A;  3S9W A;  2O5J C;  2A74 C;  2RKS A;  4LF4 Q;  3NTH A;  4JI5 L;  4ULL A;  5FKA C;  5I4D A;  5IGD A;  1N34 L;  1OXU A;  3K59 A;  2QKI C;  1A62 A;  3EBE A;  1Y1W H;  5T1G A;  4JYA Q;  3MZ5 A;  2ZJR A;  1CHP D;  2DY7 A;  2L4N A;  2MO0 A;  5M5X B;  2NN6 H;  1I4H A;  3E9I A;  1EWH A;  1KLU D;  1PZJ D;  3VR5 A;  1K3R A;  1ESF A;  3CC4 A;  3GV6 A;  1PLF A;  3TS2 A;  1SN8 A;  2K32 A;  1LTL A;  1KD1 C;  1C7Y A;  2A19 A;  3GTG H;  2Z8L A;  2L0C A;  2XWB B;  3FKI B;  1G51 A;  1EIH A;  2SDF A;  1TVX A;  2B2Y C;  1CZG A;  4J15 A;  1OXV A;  1ICF B;  2ZM6 L;  5J39 A;  4DUZ L;  5EJW A;  3CCL A;  2KEC A;  2KVM A;  3HOW G;  3GTM B;  3PUX A;  2NBF A;  2RHQ B;  2I5L X;  3NBH A;  3KLS A;  4HIO A;  4DK6 C;  2F0K A;  4LUV A;  2B8G A;  2XVS A;  3I70 A;  1VQA A;  4B3M Q;  2B2V A;  2ZXP A;  4DV5 L;  1SAP A;  3KFU A;  2KHS A;  1K73 C;  1KXL A;  2BDO A;  3C3L A;  2R92 H;  3HOY B;  4ZUI A;  4L63 B;  2EXD A;  4HR7 B;  1FNU A;  2F52 A;  2GA4 B;  1N36 L;  2NVX B;  2CQA A;  3CF5 A;  3GTJ H;  3J80 L;  2A8V A;  3HOX B;  3FHW A;  5IYD H;  1IBM L;  1FGU A;  2Q2T A;  3KDF B;  4HJ5 A;  3HOZ G;  4UHV A;  1EYG A;  4H7B A;  2RVL A;  4LFB Q;  1KNA A;  3H6M A;  2UUA L;  4BBS H;  5JJK A;  4YY3 Q;  1ZXT A;  3GTJ B;  4AQY Q;  1A2U A;  4C1N I;  4DR2 L;  3CPF A;  2NVQ H;  1T5E A;  1SE3 A;  4B3R Q;  2LKV A;  4X62 Q;  4C3I B;  4IUN A;  1NMF A;  2QDB A;  3BG3 A;  1WVL A;  1PXU A;  4UAI A;  5C0X I;  2E5L L;  2WAQ E;  1R9T B;  1PYB A;  4BBS B;  1TII D;  1CSQ A;  3HEJ A;  5BN3 A;  3NEL A;  1TKW B;  4XQJ A;  1XNR Q;  1M90 C;  2PYK A;  4RA8 A;  3HFZ B;  1J5E Q;  5IGG A;  1PRT B;  3RN5 A;  1ZYR D;  4AYB E;  4DF7 A;  1PH4 A;  4JI2 Q;  1K3B C;  4DV7 Q;  5BR8 L;  2RSO A;  1EY0 A;  2JN4 A;  2Y0S B;  4A3F H;  1HPC A;  3OYY A;  3S17 H;  4KY7 A;  1EOT A;  2RSN A;  2KUM A;  2K33 A;  2OQK A;  1FJG Q;  4UP8 A;  1QZH A;  2OTJ A;  3K5M A;  2AWN A;  4A3F B;  1CK1 A;  2ALY B;  1XX8 A;  2UXC Q;  4OHJ A;  2EYH A;  3I4L A;  1S5C D;  3VR2 A;  3HOV B;  4YCW A;  1VQ4 A;  2NB0 A;  4O2D A;  3VR3 A;  1JC7 A;  1HR0 W;  1HNZ Q;  2EYP A;  1I50 H;  3F2U A;  2QA4 A;  3S2H B;  3AQQ A;  4NPS A;  4C1N K;  1E2V A;  2K5H A;  4RGM A;  4TVA B;  3DLL A;  1YEZ A;  5FLX E;  2BE5 D;  3EVQ A;  3TDQ A;  1O80 A;  3J7Y W;  4GOP A;  1PRT C;  4A3D B;  2OWO A;  2VUM B;  5JJZ A;  2E75 C;  1F9S A;  1I50 B;  1S4Z A;  4JV5 L;  1NUC A;  4B3S Q;  4IUV A;  2M2L A;  4DA2 A;  2AHO B;  1AZP A;  1S5D D;  4A3E B;  4L5R C;  1E1T A;  3EN2 A;  4DV4 L;  1AN8 A;  5FLX c;  1SYF A;  3EQL C;  2BOS A;  1PYW D;  3M7N A;  4DR7 L;  2UUB L;  2F0T A;  3C1F A;  3M3Y B;  4HCE A;  2ZTD A;  1DOL A;  3MXP A;  2K5W A;  2C35 B;  5KNC A;  4FF1 A;  1TS5 A;  1AFP A;  4O1N A;  1K8M A;  2I07 B;  1O7Y A;  1D5M C;  5JOB A;  3GV3 A;  1JJG A;  1H9J A;  5TSS A;  2UXB L;  2K03 A;  4Y7N B;  1ET9 A;  1X3E A;  4XYQ A;  4JI0 L;  4KJN A;  3K58 A;  1A0I A;  1LAB A;  2L1B A;  2WKD A;  3PIO 3;  2IPK D;  3QO2 A;  4MTN A;  2IL8 A;  1G6Z A;  1WTP A;  1ASZ A;  2K4K A;  3K7A B;  2MO1 A;  3WOE A;  3OIQ A;  3S1N H;  1L1O B;  1BVS A;  4X66 L;  4ODG A;  2I5M X;  3G7L A;  3CHB D;  5M3F B;  4NKL A;  1STG A;  3R8B A;  3RZO H;  1LO5 D;  1Q82 C;  2AQ1 B;  5I2X A;  3MTS A;  3S1N B;  2F0M A;  4QIW B;  4JI4 Q;  4TRD A;  4L8J A;  3TP6 A;  2K50 A;  4K0K Q;  3SK8 A;  1PH5 A;  3G71 A;  3I72 A;  4EGV A;  1WJJ A;  1DJR D;  1P8L A;  1LTA D;  2K5D A;  4NW2 A;  4A3C G;  5M3M G;  2FXQ A;  1E7Z A;  4PQX A;  4IOC A;  1XJV A;  5EBC A;  3M4P A;  1HRJ A;  4R4O A;  1X9N A;  2BA1 A;  4A3B H;  4MN3 A;  3G6E A;  1M4V A;  5T1I A;  5H1S E;  1L1O C;  4DXG A;  4DPG A;  4POF A;  4KN4 C;  1CM9 A;  4K2L A;  4LUO A;  1CQF A;  5EKK A;  1CFM A;  3T1H L;  4A3B B;  3I90 A;  1H95 A;  3AB9 A;  3K5O A;  1EY9 A;  3S1R H;  2WAQ G;  2NZ1 D;  2EYJ A;  2K7V A;  4DR5 L;  1X3Q A;  4L5Q A;  4TSS A;  5C3W A;  3U58 A;  3OOC A;  1TWH H;  3P7J A;  3FKI G;  4IN3 A;  3LNN A;  4LW1 A;  2ZJP A;  1I4R A;  3BDC A;  3D31 A;  4X3S A;  3DM1 A;  1CA6 A;  2EDG A;  4IFD J;  2WB1 B;  4R4Q A;  1P16 A;  4AYB G;  5IYB G;  5AJ3 Q;  3PO2 H;  4DV3 L;  3B6Y A;  4X65 L;  4ZKC B;  1RTN A;  1T9H A;  2F0H A;  2DJG C;  4RCN A;  3I73 A;  1EL0 A;  1XTC D;  4GLX A;  1L0X B;  4DU9 A;  2K75 A;  2D0O A;  3EJI A;  2EY5 A;  1EIF A;  1EU4 A;  4K6L A;  3T4A C;  2F0G A;  2K14 A;  3PMF A;  1KC8 C;  1KL9 A;  2JA5 B;  2ENB A;  1BXT A;  2F0F A;  3ULP A;  1BKB A;  1VQP A;  3I4M G;  3GD7 A;  4LF9 L;  3IRB A;  2WFW A;  5ELC A;  3HOY G;  5LMN L;  4RKB A;  4DAP A;  1IW7 D;  1ESR A;  3AU7 A;  3K81 C;  4OL7 A;  4CKB A;  3QB3 A;  1X3G A;  4IQZ A;  3HOX G;  3BYT B;  3GQB A;  5FO7 B;  1MIU A;  3KLW A;  4DR4 L;  3KJO A;  4QGU A;  1PH8 A;  4YWK A;  1Y14 B;  3HOU H;  4JI1 L;  4JI8 L;  4GNX A;  3S2D H;  4UP9 A;  1E0B A;  3Q23 A;  3S1Q B;  3A8J E;  4Q5V A;  1WTX A;  1W6K A;  4DNR B;  2UXD Q;  4C3I G;  2H1E A;  3FVQ A;  3FDT A;  2F1M A;  1HR0 Q;  4PMC A;  3HOU B;  4K5V A;  3S2D B;  5KIX A;  5JJL A;  1NR2 A;  1SNC A;  5KYI A;  4NXM Q;  2IHF A;  4CDF C;  4GN4 B;  4H44 C;  4C2M H;  4HCS A;  4P72 A;  3CME A;  4KN7 C;  3ULL A;  5GAD C;  3MAQ A;  1BCP F;  3I56 A;  4OON A;  1Y1V G;  4V19 0;  4BXX H;  1GUG A;  2Y0S G;  3OMC A;  3I4N G;  3TEH B;  1GUN A;  5FLM H;  5J1Z A;  5CBA E;  4GOP B;  5GAE C;  1EQR A;  4CKE A;  1HJP A;  1F77 A;  1HZA A;  3T1Y L;  4B08 A;  1U9R A;  1EY8 A;  3WOF A;  4DR1 L;  4RCO A;  2R93 H;  1N9W A;  1PYS B;  3U4V A;  1MI2 A;  4DK1 A;  5EPJ A;  3TP8 A;  4H13 C;  4NDX A;  3HOV G;  3SE0 A;  1VQK A;  4JI5 Q;  5BN4 A;  3SK5 A;  4MHE A;  4C3J G;  5C0X G;  1GJX A;  1AW7 A;  1YHA A;  1QZG A;  2PI2 E;  2NVT B;  2JK8 A;  4IUR A;  3H3V I;  2BH2 A;  1QOH A;  1D1K A;  2R7D A;  1N8R C;  1EZ6 A;  1TS4 A;  1GUS A;  1WTW A;  4A3D G;  5M5W H;  2VUM G;  3NP8 A;  1OXT A;  1OXX K;  3F2D A;  3J80 i;  3D6C A;  2HDM A;  2IW3 A;  2F0U A;  1D1I A;  4M1U B;  1NR4 A;  2KCC A;  4A3E G;  4IPC A;  3CCQ A;  3GTL B;  1HZC A;  2ZM6 Q;  1HFN A;  4BY1 G;  1JOQ A;  4JOI A;  4EX5 A;  2B63 B;  3GTK B;  3TRZ A;  4I65 A;  1YIT A;  1VMC A;  4K5X A;  5C4J H;  1JJC B;  2VZA A;  1VQD A;  2PW7 A;  2R7Z G;  3F2B A;  2UU9 Q;  4P73 A;  4CJ1 B;  3S1M H;  3SHL A;  3K80 C;  3CQZ B;  3SK6 A;  1LT4 D;  1BOS A;  4IPH A;  3NTI A;  5JEA J;  2MNA A;  3RD4 A;  1SE8 A;  2KCM A;  4A3I H;  5EAY A;  2GVB A;  4YHH L;  2EY6 A;  4DV2 L;  1BBU A;  2A6E D;  3P75 A;  3STB D;  1I3Q H;  2BE5 C;  4OO1 I;  3T53 B;  4XYO A;  5KNB A;  1WTV A;  2X6G A;  2FHT A;  1UEB A;  2SOB A;  1X56 A;  2OT2 A;  1DM0 B;  3SVM A;  3Q0A A;  1VQI A;  2UUA Q;  4A3I B;  5E3F A;  5CMD A;  4DR2 Q;  5M3F G;  2E8G A;  1EFW A;  2KQ3 A;  3J7A 5;  3ERQ A;  1I3Q B;  3QIA A;  3ULJ A;  1CI3 M;  1YBY A;  4BBR G;  1WCM B;  4OEM B;  2KA7 A;  3OTO L;  5C3X A;  4DV0 L;  2E5L Q;  1MD2 D;  1EIG A;  3KF8 B;  4JBJ A;  1CHQ D;  3RN2 A;  1Q1E A;  2HIX A;  4LJZ C;  2N3S A;  3CCR A;  1U4R A;  3KUP A;  2EIF A;  1YIJ A;  4LK1 C;  1J8I A;  3TZD A;  2JYO A;  3LWE A;  3HKZ E;  1NY4 A;  3H3V C;  3MEH A;  5LMN W;  2EY1 A;  1PHJ A;  3K6O A;  5BR8 Q;  3ER0 A;  5EGT A;  4JPB W;  4A3M G;  1OTC A;  1ONL A;  3FP9 A;  1BUV T;  5FO8 B;  1F9P A;  1VQ5 A;  4CGY B;  2HD3 A;  2PQA B;  2RHS B;  1Y69 U;  2ICI A;  1VQJ A;  1D8L A;  1WI5 A;  2A69 C;  2F0Q A;  1YJW A;  1CSP A;  3NWT A;  1QWY A;  3QG1 A;  4RGT A;  4JBK A;  4EVO A;  1VQ7 A;  4FXD A;  2DGY A;  1XPU A;  1HA6 A;  2JEA I;  1QCB D;  1B3A A;  2HQL A;  2B2T C;  3QWN A;  1BBX C;  3U9S A;  1F2L A;  4O42 A;  1IBK L;  5CV4 A;  1EQV A;  4LFC L;  4OX9 Q;  1H9K A;  3C46 A;  1ENC A;  4U67 3;  1HQR D;  1BCP D;  3IL8 A;  4KHZ A;  2NN6 I;  2GN5 A;  1QB5 D;  3J7A V;  2VXW A;  5I9P A;  1W3S A;  4I7Z C;  5EPK A;  2A68 C;  2WKC A;  5EPL A;  5K5P A;  4V0B A;  1B1Z A;  2C5C A;  3OWF A;  3RZD H;  4IOA A;  4TQU S;  4F7X A;  4GNX B;  4A3C H;  1JOO A;  4QF4 A;  3CCV A;  1A3U A;  2CQO A;  1B4O A;  1FD7 D;  3KLS X;  2VB3 X;  4RG1 A;  3FEW X;  4BY7 B;  1RKN A;  4IFD H;  4IUT A;  1Q90 A;  4TKO B;  3U4Z A;  3S14 B;  4A93 H;  2E74 C;  2TSS A;  1JQY D;  3BZD B;  2MQH A;  1K9M C;  4JI0 Q;  2B2W C;  2XSC A;  2F3I A;  4LF5 Q;  3CC2 A;  1C4Q A;  1HNX Q;  4OWW B;  1GO3 E;  1Y1W B;  5JJI A;  1EQT A;  4JBM A;  3JAM i;  2NTT A;  4A93 B;  1EWC A;  1II3 A;  4WFN 3;  4B3T L;  1ML0 D;  1YHB A;  3DXJ C;  5CYU A;  3R2I A;  5DAU A;  1NE3 A;  1HH2 P;  2ICE C;  5IYB H;  4K14 A;  3GTG B;  2JA8 H;  4JI3 Q;  1N33 L;  4KKU A;  3HG9 A;  4RGO S;  1KNE A;  5I6W A;  5D3D A;  1ENF A;  3BZC A;  2NWG A;  4R8N A;  1ET6 A;  3BVZ A;  2N8N A;  2JA8 B;  2OTL A;  4KHP Q;  1LTS D;  4MZ9 A;  4KY6 A;  1XPO A;  3I3C A;  3I4M H;  4R4T A;  5CV7 A;  3T56 B;  3NTK A;  3CW2 C;  4DR6 L;  1GUO A;  5M5Y H;  2CW0 C;  2N55 A;  2BH8 A;  2KBN A;  2R92 B;  3L0O A;  4IZ8 A;  1ZEQ X;  2F0O A;  4DAY B;  5ISR A;  1OO9 B;  2LSS A;  1Q1B A;  4XTC S;  1UUP A;  1D5Z C;  1JR0 D;  3PF5 A;  2PPB C;  2ASB A;  1I4X A;  3BZK A;  3ND9 A;  1B44 D;  3PCO B;  1RCV D;  1J6Q A;  2I5H A;  4YCU A;  3UE1 A;  1SR3 A;  5C44 G;  2K6A A;  3T1H Q;  2LXK A;  2UUC L;  4ZRZ A;  1EU3 A;  2NVQ B;  1HNW L;  1D5X C;  3D4W A;  3G6J B;  3H0G H;  3MA2 B;  4RFB A;  3CXC A;  4DR5 Q;  2ES2 A;  1CKN A;  3GTO H;  3U9O A;  3PO3 H;  5IGE A;  1RTO A;  1LTI D;  3VDY A;  3J80 c;  1MBY A;  3ERS X;  2IJ0 A;  4IPG A;  3HKZ G;  4ZKB B;  4X65 Q;  3N52 A;  5HY6 A;  3GTO B;  1Y1V H;  2O4X A;  3I55 A;  3PO3 B;  3KYH C;  5K36 G;  2PI2 A;  1C9O A;  2NUC A;  1A2T A;  3SDZ A;  1ILP A;  4FP5 D;  1KDA A;  1LT3 D;  3PGZ A;  3PUV A;  2BA0 A;  3S17 B;  4QL5 A;  3PUZ A;  2K04 A;  1MHW C;  2F0D A;  3KF6 B;  4CJ0 B;  3PIP A;  4RH6 A;  4A3J H;  4X64 L;  2MJ8 A;  2QCP X;  3UDX A;  4ILW A;  3UDG A;  1MJE A;  3QOJ A;  4ZK9 B; 
#chains in the Genus database with same CATH homology
 3FMC A;  3RLF A;  4UDU C;  1PTO H;  2KJX A;  1HXY D;  4R8I A;  1L0Y B;  4F87 A;  3TP7 A;  2PNR C;  5CC4 A;  2K5Q A;  1U4P A;  4FO2 A;  3OPO A;  1ENA A;  2DNE A;  4OIK A;  2IX0 A;  1TQO A;  1A15 A;  5JEA H;  5LHY 1;  2PCF B;  1DCZ A;  5IIF A;  2DY8 A;  4DXF A;  1CZW A;  1DON A;  5CV9 A;  3K5L A;  2L5T A;  4DN4 M;  3W2D A;  2LS0 1;  5F2D A;  5BN5 A;  1IL8 A;  4IUP A;  3V96 A;  4OO1 G;  5JPN C;  1A3T A;  4B9W A;  1S5F D;  2PZT A;  4XQN A;  1H9R A;  3VR6 A;  3OW7 A;  4HMI A;  3A8I E;  3FRP B;  4XT3 B;  1NAP A;  2B2U C;  4F8M A;  1Q3L A;  1HQM C;  1UNS A;  1KAA A;  1SYC A;  1HFG A;  3RZO B;  3MXN A;  1I4P A;  3T51 B;  3JAM L;  2F3W A;  4JK1 C;  2EXZ A;  4QMG A;  1BCP B;  4FYD A;  4PNY A;  3K5N A;  2SNM A;  2F3V A;  4A3K B;  3TSS A;  1F2Y A;  2A6H C;  5I9O A;  1Q8I A;  2AWO A;  1JOR A;  3D3R A;  1IYV A;  3VYS A;  3J81 L;  1IKL A;  2E2I B;  2IX1 A;  3GTQ B;  3DWA A;  3QOL A;  4A3G B;  5M9O A;  2JA6 B;  4IUU A;  1GOZ A;  2AUK A;  2JA7 B;  3R2T A;  5IT9 L;  1PTO F;  1F9Q A;  1DD2 A;  4OIJ A;  1PZK D;  2NN6 G;  5E1F A;  3VYR A;  1BDO A;  4KTA A;  3S1R B;  3C1E A;  3VA7 A;  3NXW A;  4C3H B;  3X3N A;  2KED A;  3MC0 B;  5IGF A;  2SNS A;  1TWH B;  5FK9 C;  2F03 A;  3BVG A;  1EY5 A;  5LL6 X;  3PO2 B;  2DNC A;  1JIC A;  4OGQ C;  3ITP A;  1IKM A;  3X3M A;  4EQP A;  2O5I C;  3H91 A;  2D5D A;  4HSP A;  1VF5 C;  4XDX A;  1SDF A;  2B2V C;  3FPU B;  1K8O A;  2DN8 A;  4XT1 B;  5IOD A;  1XWE A;  2WV6 D;  2VNU D;  5IGC A;  2ZT9 C;  4Q0F A;  3P20 A;  4ZYS A;  2KOL A;  1HHV A;  4RGN A;  2EYO A;  1WTQ A;  3EFX D;  1SNP A;  1EYD A;  1JCK B;  1KDC A;  1TS3 A;  4LMQ D;  1KLG D;  2B2Y A;  2FMM A;  1OXS C;  1NCV A;  4K5W A;  5C4Z A;  3TZU A;  4P2C B;  3CRK C;  3KBX A;  3BYY B;  1TT2 A;  2XNA C;  1UAP A;  3A55 A;  3A56 A;  5E4X A;  2QF7 A;  3VR4 A;  3HOW B;  2A5H A;  4HAE A;  1LTB D;  1SE4 A;  4DGZ A;  4C2M B;  1SE2 A;  1RF2 D;  3DWP A;  3MWY W;  1M8A A;  5A2Q E;  4KV6 A;  2LFN A;  4G7Z C;  4HSV A;  3K57 A;  1F9R A;  1CQV A;  2JP1 A;  5DEH A;  3CKI B;  3L9A X;  2H4O A;  3HOZ B;  2L9H A;  4GZY C;  2R93 B;  1DOK A;  1EY7 A;  1JWU D;  1H9M A;  5C5M A;  3VYT A;  1JWM D;  1PDQ A;  1UEA B;  3S15 B;  1V43 A;  2WAC A;  3R3O A;  3VYU A;  5G3L D;  4ZQ3 A;  2PZW A;  1ZYR C;  1E2W A;  3DEO A;  1SNQ A;  4N9P A;  3SEB A;  1RDP D;  3M7G A;  5M5W B;  5C0X J;  2PMZ B;  1GUT A;  5IGB A;  1BR9 A;  1PFM A;  3D4D A;  3AMU A;  5HGT A;  3KBG A;  1RD9 D;  3A8K E;  1C48 A;  4Z9C B;  5C4J B;  4QUF A;  2E2H B;  2XWJ B;  1TY2 A;  3S1M B;  1PTO D;  3MXG A;  1YNN D;  1F2M A;  5I2Y A;  1I6H B;  1XYI A;  1SYB A;  3NQT A;  2IWH A;  2F0E A;  4DAV A;  2K05 A;  2QEJ C;  3T13 A;  2Z1C A;  4DK0 A;  4KD3 A;  1TWG B;  4MIU A;  2FJ2 A;  4DFA A;  2A73 B;  1STN A;  1SMY D;  2TMP A;  3VA5 A;  1LTT D;  1STE A;  1LT6 D;  1LLR D;  5JAV A;  2MPM A;  1HTL D;  4WOR A;  1WTR A;  1G29 1;  2MP1 A;  4NMZ A;  4BS9 A;  3MVV A;  3HGB A;  4J6H A;  1B9N A;  1PFN A;  5FOB B;  1QNK A;  2RBM A;  4OO1 H;  4G57 A;  2OEO A;  1EY4 A;  5JVH 3;  4HMJ A;  4NP5 A;  1I6V C;  2M00 A;  1E2Z A;  1SJH D;  4KK7 A;  1ZKO A;  5EKI A;  5EBD A;  5D3I B;  2B39 A;  4DNT B;  2BDN A;  5ELE A;  4QCL A;  3NWS A;  2M9V A;  4IFD I;  1NSN S;  5HUR A;  4ID6 A;  3HP3 A;  1HUN A;  1X32 A;  5NUC A;  2EPB A;  1STA A;  3SXH A;  4ZLT F;  2L11 A;  5I6Y A;  1HTP A;  2SEB D;  2EY2 A;  5FO9 B;  5ELB A;  2IT1 A;  2XIW A;  3RZD B;  1DYQ A;  3IFT A;  3HZX A;  1STB A;  2YU9 B;  5KYL A;  2EZV A;  1DOM A;  1EZ8 A;  3M4Y A;  5A35 A;  1SNM A;  2R3Z A;  3ONA B;  2C9O A;  4FF2 A;  5EQ0 A;  3A54 A;  1BO0 A;  3V05 A;  2F0S A;  4KY5 A;  2LMC B;  1TU2 B;  4ZAI A;  1V1P A;  1JB3 A;  3SR1 A;  2KEE A;  2WAQ B;  1EYC A;  5DNF A;  3T16 A;  5ELD A;  5CGK A;  3DHQ A;  1B2T A;  4AYB B;  1O7Z A;  1VMP A;  3TBI B;  1S5E D;  1X3P A;  5JVG 3;  1B50 A;  3HRZ C;  3PIP 3;  1SND A;  3MFY A;  1IW7 C;  2CVR A;  3C2P A;  3FPP A;  4EQO A;  3QJY A;  4IUQ A;  2FIN B;  3I4M B;  2F0N A;  3OWE B;  1KAB A;  3IKJ A;  1Y8O B;  5M5Y B;  4FNF A;  2WP8 J;  3NK9 A;  3DMU A;  4HED A;  2HUG A;  3NHH A;  2EOT A;  3J80 E;  4CHT B;  4PV1 C;  2EE1 A;  1A3V A;  3MFG A;  3UI2 A;  3PUY A;  2EJG C;  1GUW A;  2Z4H A;  4YIJ A;  1QIL A;  3H0G B;  1JE4 A;  4XQQ A;  4CKC A;  1TY0 A;  2RA4 A;  5KRU A;  4RHR A;  1EEF D;  1CT1 D;  2XN9 C;  3IFD A;  2O2L D;  2PO4 A;  2ID0 A;  1Y1V B;  4ME5 A;  4RWS C;  3I4N B;  4FF4 A;  1H9S A;  1WD0 A;  1K83 B;  3M85 A;  5FLX L;  5C0X H;  1O7L A;  4A3J B;  1I4Q A;  1JWS D;  4C3J B;  1PTO B;  3H94 A;  1G8Z D;  1FYC A;  3A7L A;  2EJM A;  4XIG S;  1EFI D;  1TS2 A;  4KI0 A;  1IYU A;  2G9D A;  2E76 C;  4KKS A;  1F2Z A;  4KD4 A;  2XRS D;  3R93 A;  2J4X A;  5CBE E;  1RHP A;  5KEE A;  1MSG A;  2N88 A;  2PZU A;  1AZQ A;  3NUC A;  4K8J A;  2Q8T A;  5IOC A;  3W3A A;  3CU7 A;  1AEX A;  1LV9 A;  5C5L A;  1J9O A;  2BCO A;  1LAC A;  1XXG A;  1SJE D;  4IAL A;  4BY1 B;  2CHB D;  1PZI D;  3BDO A;  2G9H D;  1WTO A;  2MGS A;  4KMU C;  2A6E C;  3DEP A;  2R7Z B;  1PTO C;  3A7A B;  1YNN C;  3OHX C;  1FNW A;  4RAU C;  2AQ3 B;  2R6G A;  1QE6 A;  4L6T B;  4J8Q A;  3LX0 A;  3EA6 A;  3J7A F;  2VB2 X;  2A69 D;  5C3E B;  1SYD A;  4WJW A;  3TP5 A;  3DUZ A;  1SMY C;  2WII B;  1S5B D;  4K6D A;  1ILQ A;  5G3L F;  1AP0 A;  1SEB D;  5CV6 A;  4BBR B;  1YNJ D;  2X69 A;  3P1H A;  4FXK C;  1D2B A;  1PRT F;  2JXM B;  2HCI A;  3NQI A;  2EVB A;  2FFK B;  4QUC A;  1V1P B;  4X3T A;  2OXP A;  2A68 D;  3D8G A;  2V4D A;  4HN7 A;  3TN2 A;  3JAM E;  1FR3 A;  4A3M B;  1EY6 A;  2JEB I;  4C56 C;  1VDZ A;  2AUJ D;  3GTP B;  4IFD G;  3E0J A;  3KF8 A;  4R9W A;  2B2T A;  5KND A;  4BA1 I;  1ICW A;  3J81 E;  1BCP C;  3LWU A;  1KDB A;  2XRQ D;  2EYL A;  1QJO A;  3KK7 A;  4PMB A;  2J7Z A;  2F0W A;  2ZXR A;  4J1M A;  1T5X D;  2NYZ D;  1STH A;  5CV8 A;  5IT9 E;  4EQN A;  3IAY A;  1SXT A;  5C6A A;  1WD1 A;  3E6Z X;  1Y8P B;  3NPP A;  2KCN A;  3HS0 C;  5ELF A;  2JE6 I;  2EYF A;  1GHK A;  3Q24 A;  1PFB A;  4KKT A;  1EYA A;  1TWF B;  2B2W A;  1QG7 A;  2HQE A;  1B9M A;  4F88 A;  3BDL A;  1PMR A;  1Y8N B;  5JPM C;  1RJT A;  5CR3 A;  1DXM A;  3L7Z C;  2WIN B;  3GP7 A;  2CW0 D;  3RMH A;  1HCZ A;  3H09 A;  1DZ1 A;  2MUY A;  4JBW A;  4FXG C;  1B53 A;  1H9S B;  3CRL C;  2J0T D;  3S16 B;  2F0P A;  3OMG A;  3L3O C;  4G7O C;  2PQE A;  5D65 A;  1MGS A;  1JOK A;  2Q8R E;  3PV0 A;  5EKL A;  4PMW A;  3TME A;  1STY A;  1G91 A;  5A2Q L;  5KGU A;  5COY A;  4M8A A;  5CV5 A;  4XXE A;  1U4L A;  2NVY B;  3OSO A;  1Z47 A;  4ABN A;  2Z4I A;  2E2D C;  3Q22 A;  4FF3 A;  1TWA B;  1Q12 A;  3I8Z A;  3URY A;  1BNZ A;  3O13 A;  3GO5 A;  2K28 A;  3BVM A;  3PUW A;  4CJ2 C;  2PW5 A;  3K0Y A;  1SNO A;  1GHJ A;  2R61 A;  4K2K A;  2HDL A;  5C44 B;  5J22 A;  1SFO B;  4ZUJ A;  2HCC A;  1PRT D;  2K01 A;  1CA5 A;  3KLR A;  4G4K A;  4QB4 A;  1FNV A;  4CBV A;  5K36 H;  3Q6S A;  1VF7 A;  2RDH A;  3RUZ A;  1BQQ T;  4DAY A;  5C4H A;  3HKZ B;  2F0J A;  5JEA G;  5DM6 3;  1BF4 A;  3E5S A;  2FMC A;  3OIP A;  4X3U A;  4FVM A;  5E4W C;  4HTH A;  1V8Q A;  1IHZ A;  3DWQ A;  3I91 A;  4U68 A;  1Z7T A;  3MXU A;  2F4I A;  2K1B A;  3WDN A;  4BWG B;  4RKL A;  1R4P B;  2EJF C;  2X6L A;  2ZXO A;  2RDF A;  1VCI A;  4K8I A;  2AQ2 B;  1O78 A;  4B9X A;  5LL6 S;  1TWC B;  4WRD A;  5DM7 3;  3N6R A;  4E6I A;  1G2S A;  1V1O A;  2D2C C;  5C4X B;  2RQX A;  1SYG A;  2IX3 A;  2F0L A;  2D9U A;  1A6X A;  1SSO A;  1SYE A;  4KHV A;  2I46 A;  3NSW A;  4BA2 I;  2QIL A;  3ERO A;  3MHB A;  4KJO A;  2OF1 A;  1EEI D;  4S3S A;  1LTR D;  1MSH A;  3NBI A;  1U4M A;  2NTS A;  1G2T A;  4X3K A;  1GXD C;  3D6W A;  2B8F A;  2E2J B;  2A6H D;  2JSO A;  3BS1 A;  1QNU A;  2F0I A;  1R4Q B;  1TR5 A;  3M4O B;  2EYM A;  2B2U A;  1I4G A;  2Q8I B;  2L12 A;  5AFW A;  3ZYY X;  4LAA A;  1HUM A;  5COR A;  2L55 A;  1LT5 D;  4C3H G;  1LTG D;  1Z6H A;  3ND8 A;  1YNJ C;  1CTM A;  2RDG A;  1HA5 A;  1SBB B;  1FGB D;  5D14 A;  2LY7 A;  4RHS A;  3SK4 A;  1D6E C;  2YYZ A;  4G7H C;  1ROD A;  3NE5 B;  2MHV A;  5M3M B;  2F0V A;  1C8C A;  4N9T A;  2D62 A;  3D4R A;  1KTK A;  4H0L C;  3V2T A;  1W6J A;  3S9W A;  2O5J C;  2A74 C;  2RKS A;  3NTH A;  5I4D A;  4ULL A;  5FKA C;  5IGD A;  1OXU A;  3K59 A;  2QKI C;  5T1G A;  3MZ5 A;  1CHP D;  2DY7 A;  2L4N A;  5M5X B;  2NN6 H;  1I4H A;  1EWH A;  1KLU D;  1PZJ D;  3VR5 A;  1ESF A;  3GV6 A;  1PLF A;  2K32 A;  2Z8L A;  2L0C A;  2XWB B;  3FKI B;  1EIH A;  2SDF A;  1TVX A;  2B2Y C;  1CZG A;  1OXV A;  5J39 A;  5EJW A;  2KEC A;  2KVM A;  3GTM B;  3PUX A;  2NBF A;  3NBH A;  3KLS A;  2F0K A;  2B8G A;  2XVS A;  3I70 A;  2B2V A;  2ZXP A;  1SAP A;  2KHS A;  2BDO A;  3C3L A;  3HOY B;  4ZUI A;  4L63 B;  4HR7 B;  1FNU A;  2GA4 B;  2NVX B;  2CQA A;  3J80 L;  3HOX B;  4H7B A;  2RVL A;  1KNA A;  3H6M A;  1ZXT A;  3GTJ B;  1A2U A;  4C1N I;  1T5E A;  1SE3 A;  2LKV A;  4C3I B;  4IUN A;  2QDB A;  3BG3 A;  1WVL A;  1PXU A;  4UAI A;  5C0X I;  1R9T B;  4BBS B;  1TII D;  3HEJ A;  5BN3 A;  1TKW B;  4XQJ A;  2PYK A;  4RA8 A;  5IGG A;  1PRT B;  1ZYR D;  4DF7 A;  2RSO A;  1EY0 A;  2Y0S B;  1HPC A;  4KY7 A;  1EOT A;  2RSN A;  2KUM A;  2K33 A;  3K5M A;  2AWN A;  4A3F B;  1CK1 A;  1XX8 A;  4OHJ A;  2EYH A;  3I4L A;  1S5C D;  3VR2 A;  3HOV B;  2NB0 A;  3VR3 A;  1JC7 A;  2EYP A;  3F2U A;  3S2H B;  4C1N K;  1E2V A;  4RGM A;  5FLX E;  2BE5 D;  3EVQ A;  3TDQ A;  1O80 A;  3J7Y W;  1PRT C;  4A3D B;  2VUM B;  5JJZ A;  2E75 C;  1F9S A;  1I50 B;  1S4Z A;  1NUC A;  4IUV A;  2M2L A;  4DA2 A;  1AZP A;  1S5D D;  4A3E B;  1AN8 A;  1SYF A;  3EQL C;  2BOS A;  1PYW D;  3M7N A;  2F0T A;  3C1F A;  3M3Y B;  4HCE A;  1DOL A;  3MXP A;  2K5W A;  5KNC A;  4FF1 A;  1TS5 A;  1AFP A;  4O1N A;  1K8M A;  2I07 B;  1O7Y A;  1D5M C;  5JOB A;  3GV3 A;  1H9J A;  5TSS A;  2K03 A;  4Y7N B;  1ET9 A;  4XYQ A;  4KJN A;  3K58 A;  1LAB A;  2L1B A;  2WKD A;  3PIO 3;  2IPK D;  3QO2 A;  2IL8 A;  1G6Z A;  1WTP A;  3K7A B;  3WOE A;  3OIQ A;  4ODG A;  3G7L A;  3CHB D;  5M3F B;  4NKL A;  1STG A;  3R8B A;  1LO5 D;  2AQ1 B;  5I2X A;  3MTS A;  3S1N B;  2F0M A;  4QIW B;  4TRD A;  4L8J A;  3TP6 A;  3SK8 A;  3I72 A;  4EGV A;  1DJR D;  1LTA D;  2K5D A;  4NW2 A;  4PQX A;  5EBC A;  1HRJ A;  2BA1 A;  4MN3 A;  1M4V A;  5T1I A;  4DXG A;  4KN4 C;  1CM9 A;  4K2L A;  1CQF A;  5EKK A;  1CFM A;  4A3B B;  3I90 A;  3AB9 A;  3K5O A;  1EY9 A;  2NZ1 D;  2EYJ A;  2K7V A;  1X3Q A;  4TSS A;  5C3W A;  3OOC A;  3P7J A;  4IN3 A;  3LNN A;  1I4R A;  3BDC A;  3D31 A;  4X3S A;  3DM1 A;  1CA6 A;  2EDG A;  4IFD J;  2WB1 B;  4ZKC B;  1RTN A;  2F0H A;  4RCN A;  3I73 A;  1EL0 A;  1XTC D;  1L0X B;  4DU9 A;  3EJI A;  2EY5 A;  1EU4 A;  4K6L A;  3T4A C;  2F0G A;  3PMF A;  2JA5 B;  2ENB A;  1BXT A;  2F0F A;  3GD7 A;  5ELC A;  4RKB A;  4DAP A;  1IW7 D;  1ESR A;  3AU7 A;  4OL7 A;  4CKB A;  3QB3 A;  4IQZ A;  3BYT B;  3GQB A;  5FO7 B;  1E0B A;  3Q23 A;  3S1Q B;  3A8J E;  4Q5V A;  1WTX A;  1W6K A;  4DNR B;  4C3I G;  2H1E A;  3FVQ A;  3FDT A;  2F1M A;  4PMC A;  3HOU B;  4K5V A;  3S2D B;  5KIX A;  1NR2 A;  1SNC A;  5KYI A;  4H44 C;  4HCS A;  4KN7 C;  3MAQ A;  1BCP F;  4V19 0;  1GUG A;  3OMC A;  1GUN A;  5J1Z A;  5CBA E;  4CKE A;  1F77 A;  4B08 A;  1U9R A;  1EY8 A;  3WOF A;  4RCO A;  1MI2 A;  4DK1 A;  5EPJ A;  3TP8 A;  4H13 C;  4NDX A;  3SE0 A;  5BN4 A;  3SK5 A;  4MHE A;  4C3J G;  5C0X G;  1GJX A;  1AW7 A;  2NVT B;  4IUR A;  1QOH A;  1D1K A;  1EZ6 A;  1TS4 A;  1GUS A;  1WTW A;  3NP8 A;  1OXT A;  1OXX K;  3D6C A;  2HDM A;  2IW3 A;  2F0U A;  1D1I A;  4M1U B;  1NR4 A;  2KCC A;  3GTL B;  1HFN A;  1JOQ A;  2B63 B;  3GTK B;  4I65 A;  1VMC A;  4K5X A;  2PW7 A;  4CJ1 B;  3SHL A;  3CQZ B;  3SK6 A;  1LT4 D;  1BOS A;  5JEA J;  3NTI A;  3RD4 A;  2EY6 A;  2A6E D;  3P75 A;  2BE5 C;  4OO1 I;  3T53 B;  4XYO A;  5KNB A;  1WTV A;  2X6G A;  2FHT A;  2SOB A;  2OT2 A;  1DM0 B;  3SVM A;  3Q0A A;  4A3I B;  5E3F A;  5CMD A;  2KQ3 A;  3ERQ A;  1I3Q B;  3QIA A;  1CI3 M;  1WCM B;  2KA7 A;  5C3X A;  1MD2 D;  1EIG A;  1CHQ D;  1Q1E A;  4LJZ C;  1U4R A;  3KUP A;  4LK1 C;  1J8I A;  3TZD A;  2JYO A;  3LWE A;  3H3V C;  3MEH A;  2EY1 A;  3K6O A;  5EGT A;  1ONL A;  1BUV T;  5FO8 B;  1F9P A;  4CGY B;  1Y69 U;  2ICI A;  2A69 C;  2F0Q A;  3NWT A;  1QWY A;  3QG1 A;  4RGT A;  4EVO A;  4FXD A;  1HA6 A;  2JEA I;  1QCB D;  1B3A A;  2B2T C;  3QWN A;  1BBX C;  3U9S A;  1F2L A;  4O42 A;  5CV4 A;  1EQV A;  1H9K A;  3C46 A;  1ENC A;  4U67 3;  1HQR D;  1BCP D;  3IL8 A;  4KHZ A;  2NN6 I;  1QB5 D;  3J7A V;  2VXW A;  5I9P A;  4I7Z C;  5EPK A;  2A68 C;  2WKC A;  5EPL A;  5K5P A;  4V0B A;  1B1Z A;  2C5C A;  3OWF A;  4TQU S;  4F7X A;  1JOO A;  4QF4 A;  1A3U A;  1B4O A;  1FD7 D;  3KLS X;  2VB3 X;  3FEW X;  4BY7 B;  1RKN A;  4IFD H;  4IUT A;  1Q90 A;  4TKO B;  3S14 B;  2E74 C;  2TSS A;  1JQY D;  3BZD B;  2B2W C;  2XSC A;  1C4Q A;  1Y1W B;  1EQT A;  2NTT A;  4A93 B;  1EWC A;  1II3 A;  4WFN 3;  1ML0 D;  3DXJ C;  5CYU A;  3R2I A;  5DAU A;  2ICE C;  4K14 A;  3GTG B;  4KKU A;  3HG9 A;  4RGO S;  1KNE A;  5I6W A;  5D3D A;  1ENF A;  2NWG A;  4R8N A;  1ET6 A;  3BVZ A;  2JA8 B;  1LTS D;  4KY6 A;  3I3C A;  5CV7 A;  3T56 B;  3NTK A;  1GUO A;  2CW0 C;  2N55 A;  2R92 B;  4IZ8 A;  1ZEQ X;  2F0O A;  5ISR A;  1OO9 B;  1Q1B A;  4XTC S;  1UUP A;  1D5Z C;  1JR0 D;  2PPB C;  1I4X A;  3ND9 A;  1B44 D;  1RCV D;  2K6A A;  4ZRZ A;  1EU3 A;  2NVQ B;  1D5X C;  3D4W A;  3G6J B;  3MA2 B;  4RFB A;  3U9O A;  5IGE A;  1RTO A;  1LTI D;  1MBY A;  2IJ0 A;  4ZKB B;  3N52 A;  3GTO B;  2O4X A;  3PO3 B;  5K36 G;  2NUC A;  1A2T A;  3SDZ A;  1ILP A;  4FP5 D;  1KDA A;  1LT3 D;  3PUV A;  2BA0 A;  3S17 B;  3PUZ A;  2K04 A;  2F0D A;  4CJ0 B;  4RH6 A;  2MJ8 A;  2QCP X;  4ILW A;  3QOJ A;  4ZK9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...