2L0CA

Solution nmr structure of protein sty4237 (residues 36-120) from salmonella enterica, northeast structural genomics consortium target slr115
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
97
structure length
97
Chain Sequence
MAPLQQKQVVVSNKREKPVNDRRSRQQEVSPAGTSMRYEASFKPLNGGLEKTFRLQAQQYHALTVGDQGTLSYKGTRFVGFVSRTPDNELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative membrane protein
publication title Solution NMR Structure of protein STY4237 (residues 36-120) from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR115
rcsb
source organism Salmonella enterica subsp. enterica serovar typhi
molecule tags Structural genomics, unknown function
total genus 14
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.660 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2l0cA00
2L0CA 3RD4A
chains in the Genus database with same CATH superfamily
1WTHA 3I4MH 1V1QA 1SE2A 5EAYA 4BA1I 5I2YA 1KXLA 5EKKA 1IYJB 2EY5A 4LWCA 4PMWA 1OXXK 1Y1WH 3CHBD 2LKVA 4XXEA 1B44D 4DUZL 2UXDL 3QO2A 3ONAB 3G71A 2D62A 5GQOA 4YY3Q 1XPRA 3EN2A 2F3WA 5ISRA 4A3JH 3PF5A 1HZBA 1GJXA 2AQ1B 4BBRH 4JW0A 3VYRA 1H9MA 1BKBA 1HQRD 1VQJA 3GTPB 4IUNA 4R4IA 2KCTA 3E5SA 5C5MA 2B63B 4HJ9A 2B2VC 1BUVT 2OQKA 1HR0L 1TY2A 3QIAA 4C3IG 4R8IA 1EWCA 1PH7A 2MJ8A 4TQUS 4LFCL 3HP3A 4DR7Q 4BY1H 4GLAC 1F77A 1N32L 5M5YB 5EBDA 4TRDA 4LF5L 3A8IE 1EY6A 1VDZA 1PFNA 2JEAI 1VQCA 3L2PA 4NKLA 4CHTB 2SDFA 3HRZC 4GLVB 3J81i 4ZQ3A 3NE5B 1C8CA 3PUWA 4DKAC 3OMCA 4JI2L 1ET6A 2K7VA 3DEOA 4QUCA 3HOZG 2QEJC 3PUZA 3I7FA 5J22A 2K1BA 3RUZA 3ZJYC 2RHSB 1NBWA 4B3TL 3WOEA 1II3A 4LW1A 4JBWA 1YBYA 1WVLA 4WFN3 3CKIB 1Z9FA 4A3GG 3HZXA 1MJCA 2XRQD 2CFMA 1HUNA 2Q2IA 1Y8OB 2IW3A 4A93H 2VQEQ 1TWGH 3D0FA 2DY7A 3I73A 1IXRA 3N6RA 1F2LA 2VZAA 1D1IA 1E3PA 1ZYRC 1Q82C 1WJJA 4POFA 2R6GA 2K5DA 3CCSA 5K36H 3NQTA 1TVXA 2ZXPA 4JVZA 4H13C 4A3BH 3QR8A 4WJWA 2EYPA 2I0QA 3S1NB 4ZLTF 1X3PA 1SNMA 1EOVA 3C1EA 1IBKQ 2IX1A 3H0GB 2BE5D 1RODA 1TWAH 5JVG3 2NVYB 1JMCA 4IPDA 2A73B 5C4ZA 1CTMA 3MVVA 1G2SA 3EBEA 4RA8A 5HGTA 1S5BD 2FINB 1MIUA 3C1FA 4A3FB 3MA2B 4POGA 2YTVA 2PQEA 4M1UB 2VQFL 3MXNA 3STBC 1G91A 4NMZA 5M5WB 2LMCB 1NMGA 5C6AA 3PV0A 3Q6SA 1Q12A 3HOUB 3RZOB 2JK8A 1IBMQ 3K58A 5IYDG 3KBXA 2KA7A 4A3CH 4N9PA 5C3WA 1LACA 3D3RA 1C48A 1I4PA 4DR2L 1D5ZC 1AFPA 5JJKA 2QDLA 1QWYA 2M00A 1LTSD 4JOIA 4K6DA 2IHEA 3FKIH 3I55A 3FEWX 1VQ5A 2JA6H 1EEFD 4DV6L 3J7YW 2A5HA 2PZUA 1B53A 5K36G 2ZTCA 2O2LD 5IYCH 5JJZA 3T1HL 1IL2A 3PUYA 5ELOA 2ICIA 4JI6L 3GTKB 2O5JC 3HOVB 1NTGA 4XT3B 1W3SA 5HGQA 2EXDA 1EWIA 2VNUD 2WACA 4X64L 1SMYC 1UEAB 3J81j 4FO2A 3UDIA 4N9TA 3QB3A 4HR7B 3M85A 1TWFB 1PH5A 1O7IA 3BG3A 1ZXTA 5LMNW 3VYSA 2HUGA 2EJFC 1A6XA 2K32A 1K3BC 2FJ2A 4QF4A 3KK7A 3S1RB 1VQNA 2K5NA 5IP9H 1BCPF 5IGEA 5D65A 1Z7TA 3I8ZA 3MHBA 1QVGA 1Q81C 1FJGL 5I6YA 3G7LA 1VQKA 1WFQA 1SYFA 1B8AA 2XWBB 5AJ3L 1RL2A 1EY5A 4I7ZC 3SK5A 4NXNQ 3DM1A 2KENA 3BYTB 4H0LC 3JAME 3MWYW 3OW7A 1XYIA 1K0SA 1BCPB 3DUZA 4K14A 1DZ1A 2E74C 1TWHB 3ULPA 4DR6Q 2AKWB 2HD3A 3MAQA 3A55A 5LMNL 3EJIA 3S2HH 3I4LA 2QW7A 1SYGA 1F9PA 3F2UA 4KKUA 1QNKA 4MTKA 2SEBD 1BQQT 3G6EA 3KDFB 1V1PB 3GTMB 5C4HA 4IJLA 4DXGA 4HIKA 2GVBA 2JA5G 1WI5A 3S1QB 4K5XA 2PYKA 4C3IB 4P75A 5IT9E 5GADC 2VXWA 5AFWA 1EOTA 1K83H 4FF3A 1D5XC 1LT6D 1F2YA 4NPSA 3NELA 2CQOA 1ENFA 4LF8L 1XNQL 3IKJA 1EIHA 1IL8A 3RLOA 1Y1VH 4RCOA 5E4XA 4FNFA 1I94Q 3OYYA 2NN6I 1SLJA 3BYYB 1CSPA 4O1NA 3U50C 1Y14B 4WRDA 5M3MB 2EVBA 3FDTA 4JV5L 1U4MA 3S1MB 2SNMA 1K8AC 1EQQA 3UDGA 1JC7A 4DV7L 4DK3C 3OW2A 3UE1A 4AQYL 1N36Q 1ASYA 1HA6A 3DXJC 4C3JH 1BCPD 1Z6HA 4S3SA 1QZGA 4LF6L 1K9MC 3BDLA 3SGIA 2ZXRA 1CHQD 3AU7A 5EPKA 4HIDA 3GTLB 3SK4A 5DAUA 1VMCA 2CHBD 2R93G 1X3FA 3D6CA 2Q8TA 2JQOA 4YWMA 4ZRZA 1B9MA 1MD2D 1T5EA 3D31A 3KJOA 4OO1I 2HIXA 1AE2A 3I4NG 1K8GA 3HFZB 4PV1C 2JJQA 2QKIC 4C1NK 4EVOA 4ME5A 3A5ZB 1JJCB 4Z9CB 3K81C 2XVSA 4ZUJA 4ZK9B 4KI0A 4FF4A 1Q1BA 1I4GA 1VQOA 1S3OA 3GTPH 3BZDB 3PO2H 1I50B 3RD4A 2EPBA 5I6WA 1QCBD 5JJLA 2C5CA 1DJRD 2VB3X 3PO3B 2VUMB 4DK1A 2Z9HA 5CMDA 1SNPA 2IX3A 1SNQA 1D1KA 4PNYA 4YCUA 4K2KA 3CRLC 3NK9A 3OIPA 3M4OB 5FOBB 3HEJA 4X3UA 5M5YH 4P71A 3TS2A 1XMOL 4RMFA 3KOJA 1EY4A 2WAQE 1I6VC 1OXSC 3G48A 2CW0D 4FF1A 1N33Q 1BO0A 1E1TA 1UE7A 2K33A 4RAUC 2F3VA 4FDBA 2E2JB 1LM0A 4A3IH 2B2WA 1HNWL 3PIO3 4EQPA 4CKCA 2Z6KC 2B2YA 3I70A 3PUVA 2FFKB 2F4VL 3MXUA 1K0RA 2EDGA 1SYBA 1EUJA 1GUOA 2PNRC 4PMBA 1LTAD 4EGVA 3BZCA 2GA4B 1VMPA 5IIFA 2K6AA 1PH8A 3CU7A 3NENA 1RCVD 1HZCA 1E2VA 1FNVA 4PZ8A 2D5DA 4L5QA 3U9OA 3L7ZC 2B8FA 1QILA 1KRTA 4GN4B 2NYZD 1WTRA 1E22A 1K28A 4BXXH 1KAWA 4ODGA 2B63G 4JI8Q 4XQJA 2NZHA 4JYAL 4CDCC 1PH6A 1GXDC 2OF1A 2JN4A 3S9WA 1E2WA 2L0CA 2WAQB 2R7ZB 3MXNB 4OIJA 1IW7D 1RKNA 4IQZA 3KF6A 4N8X1 2UXBL 3OTOQ 4JI0Q 2WKCA 1CA6A 5C4XB 3CRKC 1R9TB 4E6IA 5IP7H 1CKNA 1KNEA 3NPPA 3PGZA 4DV5Q 4AYBB 1ICFB 4K5VA 5LL6S 5LMUL 1BBWA 2NVYH 4LF4Q 4JBMA 3GQBA 4XQQA 4OWWB 5E3FA 4OELB 4B3RQ 1QUQB 1DXMA 4A75A 3AB9A 4DR1L 5I9OA 1G6ZA 1GD7A 5CORA 4DR4Q 1YVCA 4A3FH 3S16B 2D0PA 3AFPA 2CW0C 4G7OC 4DR3Q 1I3QH 1GUSA 5A2QL 3FP9A 5HURA 4R4QA 1X6OA 3NTIA 1PRTF 3TP7A 4K0KL 1G51A 2OXPA 3T13A 1KABA 1S4ZA 1J5EL 1VQEA 3HKZB 1Q8IA 2AUKA 1Q7YC 2BOSA 4GOPA 1YIJA 4C3HH 1PH3A 1LTLA 3CMEA 1OXTA 2A68C 2JA5B 5IGBA 5JEAJ 1AW7A 4X66Q 5C0XG 5IGDA 3H3VC 3K80C 3NXWA 1XNRQ 2XNAC 1PRTB 4CBVA 2CKZB 4QGUA 4DAMA 3MTSA 2J7ZA 4GKKL 3PIPA 2HCIA 1A8VA 4RFBA 4QY7A 3L0OA 1I5FA 4DV2L 5J1ZA 3GTKH 5BR8L 2EJMA 1H9SB 2K50A 2PI2A 3DWQA 4KJNA 3H0GG 2IPKD 3J81c 3T53B 2PMZB 2UUAL 2RF4A 1X54A 1WCMB 1G8ZD 4KY6A 1QG7A 2IX0A 2RHQB 2O5IC 2VL6A 1TWFH 1IYVA 3TS0A 5C0XJ 3ER0A 2NTTA 4KV6A 2WV6D 5FLXE 4B3ML 1VQ9A 2EYJA 4A3MH 1SMXA 2EE1A 1HH2P 4QMGA 1NAPA 5CV6A 3CC2A 4O2DA 1FR3A 3EQLC 2DNEA 4GS3A 4A3FG 1BBXC 4JG2A 3BZKA 1P16A 2XGTA 3M7GA 2E75C 4DA2A 3M7NA 4RGNA 2BDNA 1H9KA 2PW7A 2Q8RE 2JA8G 4CKBA 1BVSA 1DM0B 1CZWA 2BDOA 1HNZL 3HOUG 3GDEA 4NB3A 3W5OA 1PRTD 3I4NB 1XPOA 4PG3A 3GTOB 4K2LA 2WB1E 2Z4IA 4CDEC 4DNRB 4DUZQ 2UXDQ 3GP7A 1JJGA 4QCLA 1IBLL 1PTOC 5IODA 1NE3A 1LT4D 3F2CA 4YIJA 2E2HH 5DLQE 1LUZA 4XTCS 3TREA 3TMEA 3TP8A 1EIYB 1PZJD 2K4KA 2ASBA 2ZJQA 3GTMH 4JI4L 2CVRA 2AQ2B 3S1QH 1I4XA 5D14A 3S14H 3I90A 3WWVA 3NWSA 4IFDI 3HOVG 4C3IH 3JAML 3BS1A 1MSGA 5EKIA 2JXMB 1A62A 1VQHA 1X65A 2D0OA 1U4LA 3I91A 3K0YA 4H44C 2GVAA 2JA9A 1HR0Q 2D9UA 4LUZA 4EQOA 3TQYA 1E7ZA 5M5XB 2JEBI 3C3LA 4LFCQ 5M3MH 5DNFA 5G3LD 2CH4W 2EYHA 1LLRD 4LF5Q 2RSOA 1Q86C 4G7ZC 4P72A 3NQIA 5IT9L 4C56C 2A19A 1F9RA 1RTNA 2RSNA 4DXFA 3CPWA 3T4AC 1DD2A 2WB1B 1RHPA 4HMIA 4KHVA 4JI5Q 3GD7A 4UPAA 4X3SA 3HOZH 2K05A 3GTLH 2F1MA 4DPGA 3LGJA 1EQRA 1TY0A 2DN8A 4JI2Q 2RDHA 4A3KB 2UU9L 3CXCA 1VQPA 2FXQA 5E4WC 5DM73 4A3GH 4TSSA 2UUCL 2WFWA 4BBSG 1N34L 1SNCA 4B3TQ 2A6ED 4C2MB 4RKBA 5JJIA 3K7AH 1X3GA 3AEVA 1N8RC 1PRTC 1VQBA 3B6YA 2IHFA 3NSWA 2NVTH 3M4YA 1X32A 4N8FA 5FO7B 4F88A 2OQ0A 5C4JB 3S2DH 1LO5D 1L0XB 2V4DA 1DOLA 1EWHA 5JAVA 2PCFB 1I50H 4A3LG 1OO9B 1KIXA 2F0LA 1B70B 4B3SL 3H3VH 5M3MG 1RJTA 2XSCA 2KUMA 3CF5A 2K28A 4KN4C 4HAEA 2UXCL 4Y7NH 5FKAC 2ZXOA 2A69D 1O7YA 2EYOA 1PZKD 5IWAL 4GLXA 3GTGB 1SDFA 1DYQA 4BA2I 2B2TC 3M3YB 3UE0A 1XXGA 4YCVA 2IJ0A 4EQ5A 1HZ9A 2X69A 2YYZA 5CBEE 1VQFA 2CH4A 2E2DC 1S72A 2F0VA 1V8QA 5KRUA 3KF6B 4TVAB 5IYDH 3S17B 1AEXA 3BVZA 1WTQA 1TXYA 1KL9A 2VQFQ 2DGYA 1EY7A 3A7AB 5T1IA 1CKNB 1T9HA 3RN2A 3CD6A 1SYDA 1PV4A 2WIIB 4U673 3K7UC 3H09A 1ET9A 4LF9L 1T5XD 4EQNA 1EEID 3E3XA 4GNXC 2X6LA 1E0BA 4DR5L 3RNUA 1PXUA 2K75A 2PI2E 1K8MA 2ZTEA 1AZPA 1PFSA 2DNCA 1YHBA 4MNOA 3EA6A 1PTOH 2MHVA 1HQMC 3RLNA 4KD4A 1SSOA 3PO3G 2K5QA 4DR7L 5E1FA 2A6EC 3MFYA 2G5DA 2VUMG 3OIQA 4QQBX 2AUJD 1SEBD 2MP1A 3IFTA 5J39A 4FXGC 2QF7A 2KECA 3KLRA 3T1HQ 1Y8NB 2PQAA 3CCEA 4CJ2C 4MN3A 1ML0D 3SK6A 4X65L 2Q8IB 3VR4A 4X64Q 3F1ZA 4GOPB 1LTID 3TRZA 2KVMA 4KMUC 1E2ZA 2AWNA 3CCQA 3TZUA 1NY4A 2JA8B 1SXTA 2F0NA 3AQQA 2C9OA 1VCIA 4O42A 1KC8C 2I5LX 1RF2D 2LSSA 2B2UA 3P1HA 1YI2A 1DONA 1SFOH 4R4TA 2F0HA 2ZJRA 1G6PA 3PMFA 1OXUA 5AJ3Q 2YU9B 4FYDA 1CKMA 4DAYA 4X3KA 1WTWA 4UP7A 1H9RA 3ZYYX 1WTPA 3CW2C 1HJPA 1L1OA 1ONLA 1TWCB 1QVFA 3OOCA 4KHPL 1JOQA 3VDYA 2JA5H 4DK6C 4AIMA 3NEMA 3F2DA 1PH2A 5NUCA 3RZDB 2WAQG 2F0GA 3ULJA 2R7ZG 1E24A 1S40A 2I46A 1KLGD 2G9HD 5C3EB 2F0FA 1A3TA 5M3FB 4ZKCB 3OWFA 5C4XG 1LYLA 2PNHA 4WJ3M 1QOHA 2HIVA 4DNTB 1XJVA 3QOJA 4LF8Q 1XNQQ 1E1OA 4AYBG 2M9VA 2FHTA 2XIWA 1MBYA 1TT2A 2MO1A 1F2ZA 2XRSD 5IYBG 4DAPA 1B9NA 1WCMH 1N9WA 2BE5C 2KBNA 4I65A 4ZCKA 3GTQB 3D8GA 4JV5Q 2V1CC 5CV5A 1D2BA 3T51B 5LHY1 2LXKA 4DV7Q 1STHA 3D4WA 3CCRA 4AQYQ 1CUKA 4LF6Q 4G4KA 2N8NA 2KHSA 1AE3A 2ENBA 3U4VA 2R93H 2G9DA 1M4VA 4XQNA 5CV8A 4BBSB 1GHJA 2B2VA 1OXVA 1LT3D 2EYLA 1S5ED 2VY3A 1KHIA 3HKZG 3I4NH 1DOKA 2K03A 1DOMA 2EIFA 5FLXL 4FXDA 4J8QA 1EU4A 3GTOH 2ZT9C 1IYUA 4YHHL 1PZID 4IOCA 2ATWA 4ZKBB 4P2CB 1NJIC 4JBKA 3WDNA 5KNBA 4RHRA 4GKJL 5KIXA 3ERQA 4LAAA 3R93A 1EIGA 2SOBA 2IL8A 2D2CC 3AMUA 2F0QA 1VF7A 3QWNA 5M9OA 4JI7L 1I4QA 4JC0A 3CCUA 3NUCA 2RCNA 2L15A 3IL8A 4X3TA 1KAAA 3GTJH 2TMPA 1YNJD 1KDBA 5EPJA 2KHJA 4QL5A 3CAMA 5DEHA 1CSQA 1WCMG 3J80L 4GOPC 5FO8B 1X3EA 5CV7A 3RN5A 5CC4A 2E5LL 1A2UA 5CR3A 3KFUA 3SHLA 3I4MB 4YWKA 5CYUA 1XMOQ 4NXML 1JORA 3K8AA 4HEDA 1NCVA 3OHXC 2OEOA 2L5TA 1MI2A 4IFDJ 3GV3A 1I4RA 1Y1WB 1HNWQ 4DV3L 2RQXA 4EX5A 2NZ1D 3MXPA 2K01A 2F4VQ 2JP1A 4DR6L 2K5WA 1C0AA 2NZOA 1D8LA 3K57A 3ITPA 3PCOB 4A3KH 1LABA 4L6TB 3CP0A 4DV4L 4X62L 1SNOA 1CQVA 2L4NA 4DK0A 2B63H 1F2MA 4P73A 1B1ZA 5TSSA 4M8AA 1SYCA 1STEA 4XDXA 4BWGB 4DNIA 3NTKA 1HPCA 2RA4A 4MHEA 4XT1B 3SEBA 1TQOA 5C4JH 4OX9L 1NUCA 1U0LA 4JYAQ 1K8OA 1Q3LA 2CWAA 2Z0SA 3A5UA 3KUPA 4F8MA 4BY1B 3Q24A 3K6OA 1KRSA 5D3DA 3FVQA 5KYIA 3QJYA 2PZWA 2NB0A 4LF7L 3U9SA 3W3AA 3TP5A 1EZ6A 4KTAA 2UXBQ 5A35A 1I4HA 1N36L 1EFWA 4OWXB 1KQSA 3A8JE 4DGZA 2B29A 5GROA 2Q2HA 4PQXA 2F4IA 4B9XA 1WTXA 1O7ZA 3H94A 1EYDA 4UP8A 1VQ6A 2KJXA 2R7DA 5LMUQ 5JEAH 3NWTA 2WB1G 3ND9A 1ESRA 5L37A 1EY0A 1BCPC 3K5OA 2MNAA 4YCWA 1BR9A 2NUCA 2RKSA 3S24A 1SNDA 1Z47A 4JCVE 1EIFA 1F9QA 2B3GA 3HGBA 1RDPD 1UAPA 3VR3A 4A3KG 2DY8A 3D4RA 1PHJA 2OTLA 4R1JA 1WOCA 2A1AA 3I3CA 4A3EB 5I9PA 5BN4A 2PQAB 3S17H 1WTOA 4KLKA 2AWOA 5ELCA 4JI1L 3NBHA 1JB7A 2QEXA 4RG1A 4H02A 3E9HA 4A93B 1TWGB 4K0KQ 1O80A 1MKHA 2O4XA 1VQDA 4IUQA 3TN2A 5C0XH 1J5EQ 3NHHA 1HCZA 2WKDA 3MXGA 4DU9A 2PO4A 4DV0L 3A54A 1F9SA 2R3ZA 2OCEA 1HXYD 1BDOA 2HDLA 3G6JB 1TU2B 1HRJA 3R2IA 3EVQA 1HA5A 1XMQL 1D6EC 3S1NH 4A3BB 2N78A 1STYA 3KLSX 3H3VI 3DM3A 3H0GH 3QOLA 1UE1A 4HMJA 1BBUA 3GV6A 4DV1L 2ZM6L 1CFMA 2DJGC 4GKKQ 5HY6A 4HCSA 4LFAQ 1TWAB 1BNZA 2A6HD 4DV2Q 1SRUA 5BR8Q 4DAYB 5C44G 1QZHA 3DLLA 5EBCA 3MEHA 5IGFA 1RTOA 5JEAG 2UUAQ 5GAGC 1L1OB 4R9WA 3V2TA 1XTCD 1LTBD 1JOKA 3W1GA 1QE6A 4Q0FA 4J6HA 4B3MQ 4PZ6A 4IPHA 5M5WH 2JA8H 3HOUH 3RZOH 2N3SA 1O7LA 2WINB 4J1MA 1MJEA 4QJFA 1V1OA 1XPUA 2E76C 1H9JA 3KF8A 3J7AF 5ELEA 4QIWE 1HNZQ 1JE5A 3F2BA 1NSNS 3TP6A 4PMCA 1MHWC 2ZTDA 1I6HB 3IRBA 3J80i 3T1YL 2YU9H 3FKIB 4JI3L 4ABNA 3CQZB 4G7HC 3HKSA 2A8VA 2JA6B 1JB3A 3VYTA 3SR1A 1TWCH 4F87A 4LUOA 4NW2A 1IBLQ 1RIPA 3HOVH 3V05A 1GUWA 2AHOB 3FMCA 1EQTA 3HOWB 2CWPA 1BXTA 4FVMA 5C3EH 1PA6A 3MFGA 4JI4Q 1OTCA 1VQAA 5M3FH 1X9NA 1PMRA 3DHQA 2MQHA 4OWTB 1IW7C 1FGBD 1LTTD 5G3LF 2NN6H 2ES2A 1KDCA 4LF4L 2K5VA 1YNND 1VQMA 3S1RH 1GO3E 1WD0A 1YNXA 1LTRD 2MGSA 3TZDA 2R92B 4CJ0B 1FNUA 3TEHB 3GTQH 1JOOA 2E2IB 1U9RA 4IZ8A 4LFBL 2A6HC 3OWEB 4JBJA 4KKSA 1FGUA 1CT1D 2DJFC 1UE5A 2RCFA 3D6WA 2VS1A 3FPUB 2F0TA 4L8JA 3FHWA 1TWHH 4UAIA 1VQGA 2K14A 4BBSH 5BN5A 1YITA 1ILQA 2NVXB 2BCOA 5KEEA 1SBBB 4ILWA 3BVMA 5ELFA 1S5DD 2UU9Q 1PLFA 4HJ7A 1W2BA 1VQ7A 1KDAA 2N49A 2MFIA 3Q23A 2UUCQ 1NR2A 3LNNA 5IY0A 1UNSA 1XNRL 4UDUC 5ELBA 1HTPA 3Q8DA 4HIOA 1X55A 5C3EG 4A3LH 2A74C 5M3FG 1Y1VB 2NN6G 3PQIA 2Z6KA 5KGUA 2L55A 4JOIC 2QILA 3S1MH 1N32Q 3ERSX 3CPFA 1C4QA 3BVGA 4B3SQ 2F03A 1SJED 5EPLA 4B9WA 5IGGA 3PSIA 2UXCQ 4C3JB 3U4ZA 2F0EA 3PIP3 5IWAQ 1PH9A 2EZVA 1YNNC 5KNDA 1HR0W 1VQIA 1A63A 2P5ZX 1HNXL 5ELNA 2PZTA 3HG9A 3VR2A 2F3IA 3CCLA 3FRPB 4P74A 2DUDA 1M90C 4OO1G 1EL0A 3F8TA 4MIUA 1YHAA 2OTJA 1YEZA 1PFMA 1YZ6A 3I56A 1FD7D 2HHHL 3URYA 3A7LA 5IT9c 5KYLA 5IOCA 1ZYRD 4DUYL 1NNXA 1J6QA 2HCCA 1PYSB 2Y0SE 4IJHA 4RGTA 3PO2B 4LF9Q 4K8IA 1JQYD 2UUBL 2NBFA 3PO3H 1CA5A 4DR5Q 2H5XA 3A74A 4IUPA 2VUMH 2BH8A 2EYFA 2EY6A 3H91A 3M4OH 4NDXA 4G57A 1HFGA 5C44B 1A15A 1Y69U 4KJOA 4GN3B 1KD1C 3VA5A 1PYBA 3PF4A 5FJ8H 2I5MX 3NBHB 4HTHA 1R4PB 1TS4A 2N55A 4ME3A 1CZGA 4IO9A 2E2JH 2E8GA 4K8JA 3I4MG 4X65Q 4V190 3STBD 3G4SA 4A3IB 3HOYB 2Q2TA 4BY7B 1NMFA 2ALYB 1EY8A 4PZ7A 1IZ6A 4JI5L 1FNWA 2ICEC 2JE6I 1M8AA 4ZYSA 2QA4A 4MTNA 2I5HA 4YY3L 1Y1WG 4KK7A 4NP5A 3SVMA 5JPNC 2YV5A 3P20A 5KNCA 1NR4A 1ILPA 2Y0SB 3KYHC 2JA7B 3CC4A 2WP8J 2BA0A 4A3JG 4RGOS 3S15B 3HOXB 5IGCA 3K5NA 4A3EH 4HSVA 2YTXA 4DR2Q 4BBRG 5FO9B 3LWUA 1YJNA 2L12A 4LK1C 1Y8PB 1MGSA 1KNAA 2Z6BA 4CDFC 1C7YA 1CQFA 2HT1A 4APVA 3T16A 1PYWD 3K5MA 2KCNA 4A3DB 2F0IA 4CGYB 4DV6Q 1V9PA 5EJWA 3DWAA 3HS0C 4L5TA 5I4DA 5K5PA 5JOBA 1SMYD 4HCEA 2R7ZH 4KKTA 4KHPQ 2L11A 4JI6Q 4RKLA 4BY1G 5JVH3 5C4XH 4HN7A 1SYEA 1TR5A 3M4PA 5D3IB 1R9TH 2KEEA 2YTYA 1TKWB 1U4PA 4WJ4A 5FJ8G 3E9IA 3KF8B 2J0TD 4DFAA 4RGMA 2Z4HA 5H1SE 3NBIA 4K5WA 5IYBH 3J7ZC 4R8NA 5A2QE 3J81E 1J8IA 1X3QA 4LUVA 2A69C 2KOLA 1HTLD 3BU2A 4KD3A 1YJWA 4FP5D 2RDGA 2F0PA 3QG1A 3KLWA 4CJ1B 3E0EA 1CKOA 3S16H 1JWSD 3JAMi 1FJGQ 4OXPA 5E7NA 3A0JA 1B4OA 3E6ZX 1B7YB 2RVLA 2F0WA 1I3QB 2VQEL 1R4QB 4TKOB 4A3EG 2F0JA 3OPOA 1V43A 5F2DA 2B2WC 3CMAA 2ID0A 2EOTA 3WOFA 4A93G 3SK8A 2B2YC 1GUTA 2M2LA 3SXHA 5LMNQ 4C3HB 3ICEA 4XYOA 5C5LA 4UP9A 5C0XI 1I6HH 2EYMA 3KBGA 4RH6A 3RLFA 4YHHQ 3CQZH 3VA7A 1QUQA 1IBKL 1PH4A 4GKJQ 3UDXA 3I72A 1GM5A 4A3BG 1M1KC 2OWOA 2JYOA 4XIGS 1QNUA 2B39A 4IFDH 4JI7Q 5J3BA 2F0UA 2LFNA 1TS3A 3U58A 3HOWH 3CC7A 2Q2UA 5FK9C 3P7JA 2NVQB 4ZUIA 3I2ZA 2XN9C 2IT1A 1FVIA 2ZJPA 2AQ3B 1HFNA 2XWJB 4A3MB 2MPMA 4JK1C 2GN5A 1IBML 2R92H 2E5LQ 2E2IH 1XWEA 4IUVA 4HIMA 2KCMA 3NP8A 3EFXD 5IE8A 4NXMQ 4FF2A 1Q46A 4A3CG 2KCCA 5EKLA 2F0DA 3V96A 1JCKB 1H9SA 4U68A 1A3VA 1EU3A 4DV3Q 4HJAA 1U4RA 5CBAE 3BDOA 2HQLA 3P75A 2NVXH 3FKIG 2BH2A 2EQSA 3R2TA 2JA6G 1Q1EA 2L9HA 1SE4A 4DV4Q 2E2HB 4HJ8A 4X62Q 1ICWA 1QJOA 5IYCG 2X6GA 3L9AX 4OONA 3PIOA 4IURA 4KY5A 2LY7A 4IFDG 3S14B 2F0SA 2QGQA 3J7AV 1VQ8A 2B2TA 3HOWG 2BA1A 2EJGC 1ZKOA 1LT5D 3I4OA 2NTSA 5M5XH 1LV9A 5FLXc 4OX9Q 1JWMD 1KTKA 3H6MA 3ULLA 5BN3A 4HJ5A 3C46A 1TS2A 1J9OA 4MZ9A 2HDMA 4IUUA 5EQ0A 1XX8A 2R92G 4LF7Q 5IP9G 1U5KA 4C1NI 5GAEC 4DN4M 3ND8A 3AFQA 3D4DA 5FLMH 1Q90A 3IAYA 1SR3A 4NXNL 1BOSA 2FMCA 1QVCA 1UE6A 1ENAA 2RDFA 4GNXA 3A56A 3HOZB 1SROA 1YJ9A 1Q8KA 4GZYC 2FMMA 1CI3M 3BDCA 4A3JB 2MUYA 2LS01 3J80c 2N88A 1JJ2A 4KY7A 1HUMA 5C3XA 3DWPA 4BBRB 4A3GB 5CGKA 2F0KA 1HHVA 4ULLA 4C2MH 1PFBA 4FXKC 1WTVA 2HQEA 1CK1A 1EFID 3K7AB 3CCMA 1AZQA 2J4XA 4JI1Q 1I94L 4L5RC 2F0OA 4L5SA 3J7A5 2NVTB 3K0XA 3S2DB 1C9OA 3K59A 1AN8A 3TDQA 1UEBA 5I2XA 1Y1VG 4IN3A 4QUFA 4O0AA 4V0BA 1W6KA 4OGQC 4K6LA 4DV0Q 4UY8C 3A8KE 4B08A 2H1EA 1ZEQX 1ENCA 1XMQQ 1SJHD 1JICA 1YNJC 2K5HA 3L3OC 4Y7NB 5C44H 1SAPA 3GTGH 2NWGA 5FLMG 4DV1Q 2ZM6Q 4C3JG 3M3YH 5JPMC 1MSHA 1L0YB 4BS9A 2XTIA 3VYUA 3FPPA 1VQLA 3UDFA 2AMCB 3HOYH 4DR1Q 4BY7H 1GOZA 2JSOA 1GHKA 1VF5C 2VB2X 1JR0D 1G291 3MEFA 4AYBE 4YWLA 1B50A 1UUPA 4R4CA 2LXJA 1S5FD 2A68D 1GUNA 1PTOF 1JE4A 3SDZA 4XYQA 1BF4A 3RMHA 1L0WA 2JA7H 1YHQA 2QCPX 3LWEA 3RR5A 3S15H 3HOXH 2K04A 2C35B 2L1BA 3PUXA 3NTHA 1STBA 3TSSA 1EZ8A 3PO2G 3KLSA 1K73C 2SNSA 3T1YQ 3EROA 4A3DH 1PTOB 1EYGA 4JI3Q 1STAA 1GUGA 3MC0B 1GVPA 4QB4A 1UWVA 2OT2A 1IKMA 1TIID 3DMUA 4X6AH 3HKZE 1N33L 3E0JA 2KQ3A 2TSSA 1HZAA 4WORA 1P8LA 4IOAA 2R61A 4LNQA 4ALPA 4DF7A 1ASZA 2RBMA 2KEDA 2B8GA 4JPBW 3HOYG 4A3IG 1L2FA 4I7AA 4BY7G 3K5LA 3BJUA 1EQVA 1B3AA 4HSPA 2EXZA 3O13A 1K3RA 4CKEA 2QDBA 1A0IA 1AP0A 3SE0A 1EYAA 1D7QA 2PMZE 4RWSC 3W1BA 4A4IA 2Y0SG 2R7FA 4LFBQ 2JA7G 1KLUD 1SFOB 1QB5D 1PTOD 2Z1CA 4JI8L 3Q0AA 3HOXG 3Q22A 2H4OA 3J81L 4IUTA 1RD9D 4ZAIA 4H7BA 4OL7A 3N52A 1GKHA 4RHSA 4BXXG 4AH6A 3KJPA 3CCJA 4ID6A 1FYCA 4A3DG 1CM9A 1CHPD 1PH1A 1PDQA 3RZDH 3OTOL 4JI0L 3DEPA 3TBIB 4DAVA 1SE3A 5ELDA 4DV5L 5T1GA 5LL6X 5CV9A 1FL0A 4LFAL 2EY2A 4LJZC 4UHVA 2IY5B 1JT8A 5IP7G 2CQAA 4B3RL 4KHZA 2K52A 4Y52H 4L63B 1SE8A 3W2DA 4IALA 4QIWB 2NVQH 1STGA 1STNA 4DR4L 4IPGA 3MZ5A 1WD1A 1DCZA 1IHZA 2IWHA 4DR3L 5COYA 1A3UA 1X56A 2I07B 4OIKA 1EYCA 3X3MA 1IKLA 2KHIA 3R8BA 5DM63 1EY9A 1PVOA 1TS5A 3GO5A 3OSOA 2R93B 4OEMB 5EGTA 3AYHB 3LX0A 3EIVA 4GN5A 4OO1H 4R4OA 3UI2A 3S2HB 4LMQD 4J15A 4X66L 3JC66 1XTDA 1AH9A 1DGSA 1HNXQ 2PPBC 1VQ4A 1B3QA 1N34Q 4C3HG 2F0MA 4A76A 3M9BA 3H15A 1D5MC 4F7XA 1H95A 1K83B 2B2UC 3J80E 1ESFA 4OHJA 1LTGD 1VS0A 4Q5VA 4CDDC 2HHHQ 3T56B 1G2TA 3X3NA 3C2PA 4DUYQ 1SN8A 1JWUD 3VR6A 3CCVA 5GAHC 1W6JA 1A2TA 2EY1A 1O78A 4GNXB 4IPCA 3VR5A 3IFDA 4KN7C 3GTJB 4RCNA 1B2TA 3M4QA 2UUBQ 1L1OC 2VW9A 1WYDA 2MO0A 2Z8LA 1S5CD 2PW5A 3OMGA 3R3OA 5CV4A 2F52A 3KDFA 1V1PA 2CCZA 3JAMc 4A3MG
chains in the Genus database with same CATH topology
1SE2A 4BA1I 5I2YA 5EKKA 2EY5A 4PMWA 1OXXK 3CHBD 2LKVA 4XXEA 1B44D 3QO2A 3ONAB 2D62A 2F3WA 5ISRA 1GJXA 2AQ1B 3VYRA 1H9MA 1HQRD 3GTPB 4IUNA 3E5SA 5C5MA 2B63B 2B2VC 1BUVT 1TY2A 3QIAA 4C3IG 4R8IA 1EWCA 2MJ8A 4TQUS 3HP3A 1F77A 5M5YB 5EBDA 4TRDA 3A8IE 1EY6A 1VDZA 1PFNA 2JEAI 4NKLA 4CHTB 2SDFA 3HRZC 4ZQ3A 3NE5B 1C8CA 3PUWA 3OMCA 1ET6A 2K7VA 3DEOA 4QUCA 2QEJC 3PUZA 5J22A 2K1BA 3RUZA 3WOEA 1II3A 4JBWA 1WVLA 4WFN3 3CKIB 3HZXA 2XRQD 1HUNA 1Y8OB 2IW3A 2DY7A 3I73A 3N6RA 1F2LA 1D1IA 1ZYRC 2R6GA 2K5DA 5K36H 3NQTA 1TVXA 2ZXPA 4H13C 4WJWA 2EYPA 3S1NB 4ZLTF 1X3PA 1SNMA 3C1EA 2IX1A 3H0GB 2BE5D 1RODA 5JVG3 2NVYB 2A73B 5C4ZA 1CTMA 3MVVA 1G2SA 4RA8A 5HGTA 1S5BD 2FINB 3C1FA 4A3FB 3MA2B 2PQEA 4M1UB 3MXNA 1G91A 4NMZA 5M5WB 2LMCB 5C6AA 3PV0A 3Q6SA 1Q12A 3HOUB 3RZOB 3K58A 3KBXA 2KA7A 4N9PA 5C3WA 1LACA 3D3RA 1C48A 1I4PA 1D5ZC 1AFPA 1QWYA 2M00A 1LTSD 4K6DA 3FEWX 1EEFD 3J7YW 2A5HA 2PZUA 1B53A 5K36G 2O2LD 5JJZA 3PUYA 2ICIA 3GTKB 2O5JC 3HOVB 4XT3B 2VNUD 2WACA 1SMYC 1UEAB 4FO2A 4N9TA 3QB3A 4HR7B 3M85A 1TWFB 3BG3A 1ZXTA 3VYSA 2HUGA 2EJFC 1A6XA 2K32A 2FJ2A 4QF4A 3KK7A 3S1RB 1BCPF 5IGEA 5D65A 1Z7TA 3I8ZA 3MHBA 5I6YA 3G7LA 1SYFA 2XWBB 4I7ZC 1EY5A 3SK5A 3DM1A 4H0LC 3BYTB 3JAME 3MWYW 3OW7A 1XYIA 1BCPB 3DUZA 4K14A 1DZ1A 2E74C 1TWHB 3MAQA 3A55A 3EJIA 3I4LA 3F2UA 1SYGA 1F9PA 4KKUA 1QNKA 2SEBD 1BQQT 1V1PB 3GTMB 5C4HA 4DXGA 3S1QB 4K5XA 2PYKA 4C3IB 5IT9E 2VXWA 5AFWA 1EOTA 4FF3A 1D5XC 1LT6D 1F2YA 1ENFA 3IKJA 1EIHA 1IL8A 4RCOA 5E4XA 4FNFA 2NN6I 3BYYB 4O1NA 4WRDA 5M3MB 2EVBA 3FDTA 1U4MA 3S1MB 2SNMA 1JC7A 1HA6A 3DXJC 1BCPD 1Z6HA 4S3SA 3BDLA 2ZXRA 1CHQD 3AU7A 5EPKA 3GTLB 3SK4A 5DAUA 1VMCA 2CHBD 3D6CA 2Q8TA 4ZRZA 1B9MA 1MD2D 1T5EA 3D31A 4OO1I 4PV1C 2QKIC 4C1NK 4EVOA 4ME5A 4Z9CB 2XVSA 4ZUJA 4ZK9B 4KI0A 4FF4A 1Q1BA 1I4GA 3BZDB 1I50B 3RD4A 2EPBA 5I6WA 1QCBD 2C5CA 1DJRD 2VB3X 3PO3B 2VUMB 4DK1A 5CMDA 1SNPA 2IX3A 1SNQA 1D1KA 4PNYA 4K2KA 3CRLC 3NK9A 3OIPA 3M4OB 5FOBB 3HEJA 4X3UA 1EY4A 1I6VC 1OXSC 2CW0D 4FF1A 1BO0A 2K33A 4RAUC 2F3VA 2E2JB 2B2WA 3PIO3 4EQPA 4CKCA 2B2YA 3I70A 3PUVA 2FFKB 3MXUA 2EDGA 1SYBA 1GUOA 2PNRC 4PMBA 1LTAD 4EGVA 2GA4B 1VMPA 5IIFA 2K6AA 3CU7A 1RCVD 1E2VA 1FNVA 2D5DA 3U9OA 3L7ZC 2B8FA 1QILA 2NYZD 1WTRA 4ODGA 4XQJA 1GXDC 2OF1A 3S9WA 1E2WA 2L0CA 2WAQB 2R7ZB 4OIJA 1IW7D 1RKNA 4IQZA 2WKCA 1CA6A 5C4XB 3CRKC 1R9TB 4E6IA 1KNEA 3NPPA 4AYBB 4K5VA 5LL6S 3GQBA 4XQQA 5E3FA 1DXMA 3AB9A 5I9OA 1G6ZA 5CORA 3S16B 2CW0C 4G7OC 1GUSA 5A2QL 5HURA 3NTIA 1PRTF 3TP7A 2OXPA 3T13A 1KABA 1S4ZA 3HKZB 1Q8IA 2AUKA 2BOSA 2JA5B 1OXTA 2A68C 5IGBA 5JEAJ 1AW7A 5C0XG 5IGDA 3H3VC 3NXWA 2XNAC 1PRTB 4CBVA 3MTSA 2J7ZA 2HCIA 4RFBA 5J1ZA 2EJMA 1H9SB 3DWQA 4KJNA 2IPKD 3T53B 2PMZB 1WCMB 1G8ZD 4KY6A 1QG7A 2IX0A 2O5IC 1IYVA 5C0XJ 2NTTA 4KV6A 2WV6D 5FLXE 2EYJA 2EE1A 4QMGA 1NAPA 5CV6A 1FR3A 3EQLC 2DNEA 1BBXC 3M7GA 2E75C 4DA2A 3M7NA 4RGNA 2BDNA 1H9KA 2PW7A 2Q8RE 4CKBA 1DM0B 1CZWA 2BDOA 1PRTD 3I4NB 3GTOB 4K2LA 2Z4IA 4DNRB 3GP7A 4QCLA 1PTOC 5IODA 1LT4D 4YIJA 4XTCS 3TMEA 3TP8A 1PZJD 2CVRA 2AQ2B 5D14A 1I4XA 3I90A 3NWSA 4IFDI 3JAML 3BS1A 1MSGA 5EKIA 2JXMB 1U4LA 3I91A 3K0YA 4H44C 2D9UA 4EQOA 5M5XB 2JEBI 3C3LA 5DNFA 5G3LD 2EYHA 1LLRD 2RSOA 4G7ZC 3NQIA 5IT9L 4C56C 1F9RA 1RTNA 2RSNA 4DXFA 3T4AC 1DD2A 2WB1B 1RHPA 4HMIA 4KHVA 3GD7A 4X3SA 2K05A 2F1MA 1TY0A 2DN8A 2RDHA 4A3KB 5DM73 5E4WC 4TSSA 1SNCA 2A6ED 4C2MB 4RKBA 1PRTC 3NSWA 3M4YA 1X32A 5FO7B 4F88A 5C4JB 1LO5D 1L0XB 2V4DA 1DOLA 1EWHA 5JAVA 2PCFB 1OO9B 2F0LA 1RJTA 2XSCA 2KUMA 2K28A 4KN4C 4HAEA 5FKAC 2ZXOA 2A69D 1O7YA 2EYOA 1PZKD 3GTGB 1SDFA 1DYQA 4BA2I 2B2TC 3M3YB 1XXGA 2IJ0A 2X69A 2YYZA 5CBEE 2E2DC 2F0VA 1V8QA 5KRUA 3S17B 1AEXA 3BVZA 1WTQA 1EY7A 3A7AB 5T1IA 1SYDA 2WIIB 4U673 3H09A 1ET9A 1T5XD 4EQNA 1EEID 2X6LA 1E0BA 1PXUA 1K8MA 1AZPA 2DNCA 3EA6A 1PTOH 2MHVA 1HQMC 4KD4A 1SSOA 2K5QA 5E1FA 2A6EC 3MFYA 3OIQA 2AUJD 1SEBD 2MP1A 3IFTA 5J39A 4FXGC 2QF7A 2KECA 3KLRA 1Y8NB 4CJ2C 4MN3A 1ML0D 3SK6A 2Q8IB 3VR4A 1LTID 2KVMA 4KMUC 1E2ZA 2AWNA 3TZUA 2JA8B 1SXTA 2F0NA 2C9OA 1VCIA 4O42A 1RF2D 2B2UA 3P1HA 1DONA 2F0HA 3PMFA 1OXUA 2YU9B 4FYDA 4DAYA 4X3KA 1WTWA 1H9RA 3ZYYX 1WTPA 1ONLA 1TWCB 3OOCA 1JOQA 5NUCA 3RZDB 2F0GA 2I46A 1KLGD 2G9HD 5C3EB 2F0FA 1A3TA 5M3FB 4ZKCB 3OWFA 1QOHA 4DNTB 3QOJA 2M9VA 2FHTA 2XIWA 1MBYA 1TT2A 1F2ZA 2XRSD 4DAPA 1B9NA 2BE5C 4I65A 3GTQB 3D8GA 5CV5A 1D2BA 3T51B 5LHY1 1STHA 3D4WA 4G4KA 2KHSA 2ENBA 2G9DA 1M4VA 4XQNA 5CV8A 4BBSB 1GHJA 2B2VA 1OXVA 1LT3D 2EYLA 1S5ED 1DOKA 2K03A 1DOMA 5FLXL 4FXDA 4J8QA 1EU4A 2ZT9C 1IYUA 1PZID 4ZKBB 4P2CB 3WDNA 5KNBA 4RHRA 5KIXA 3ERQA 4LAAA 3R93A 1EIGA 2SOBA 2IL8A 2D2CC 3AMUA 2F0QA 1VF7A 3QWNA 5M9OA 1I4QA 3NUCA 3IL8A 4X3TA 1KAAA 2TMPA 1YNJD 1KDBA 5EPJA 5DEHA 3J80L 5FO8B 5CV7A 5CC4A 1A2UA 5CR3A 3SHLA 3I4MB 5CYUA 1JORA 4HEDA 1NCVA 3OHXC 2OEOA 2L5TA 1MI2A 4IFDJ 3GV3A 1I4RA 1Y1WB 2RQXA 2NZ1D 3MXPA 2K01A 2JP1A 2K5WA 3K57A 3ITPA 1LABA 4L6TB 1SNOA 1CQVA 2L4NA 4DK0A 1F2MA 1B1ZA 5TSSA 4M8AA 1SYCA 1STEA 4XDXA 4BWGB 3NTKA 1HPCA 2RA4A 4MHEA 4XT1B 3SEBA 1TQOA 1NUCA 1K8OA 1Q3LA 3KUPA 4F8MA 4BY1B 3Q24A 3K6OA 5D3DA 3FVQA 5KYIA 3QJYA 2PZWA 2NB0A 3U9SA 3W3AA 3TP5A 1EZ6A 4KTAA 5A35A 1I4HA 3A8JE 4DGZA 4PQXA 2F4IA 4B9XA 1WTXA 1O7ZA 3H94A 1EYDA 2KJXA 5JEAH 3NWTA 3ND9A 1ESRA 1EY0A 1BCPC 3K5OA 1BR9A 2NUCA 2RKSA 1SNDA 1Z47A 1F9QA 3HGBA 1RDPD 1UAPA 3VR3A 2DY8A 3D4RA 3I3CA 4A3EB 5I9PA 5BN4A 1WTOA 2AWOA 5ELCA 3NBHA 4A93B 1TWGB 1O80A 2O4XA 4IUQA 3TN2A 5C0XH 3NHHA 1HCZA 2WKDA 3MXGA 4DU9A 2PO4A 3A54A 1F9SA 2R3ZA 1HXYD 1BDOA 2HDLA 3G6JB 1TU2B 1HRJA 3R2IA 3EVQA 1HA5A 1D6EC 4A3BB 1STYA 3KLSX 3QOLA 4HMJA 3GV6A 1CFMA 4HCSA 1TWAB 1BNZA 2A6HD 5EBCA 3MEHA 5IGFA 1RTOA 5JEAG 4R9WA 3V2TA 1XTCD 1LTBD 1JOKA 1QE6A 4Q0FA 4J6HA 1O7LA 2WINB 4J1MA 1V1OA 2E76C 1H9JA 3KF8A 3J7AF 5ELEA 1NSNS 3TP6A 4PMCA 1I6HB 3FKIB 4ABNA 3CQZB 4G7HC 2JA6B 1JB3A 3VYTA 3SR1A 4F87A 4NW2A 3V05A 1GUWA 3FMCA 1EQTA 3HOWB 1BXTA 4FVMA 3MFGA 1PMRA 3DHQA 1IW7C 1FGBD 1LTTD 5G3LF 2NN6H 1KDCA 1YNND 1WD0A 1LTRD 2MGSA 3TZDA 2R92B 4CJ0B 1FNUA 1JOOA 2E2IB 1U9RA 4IZ8A 2A6HC 3OWEB 4KKSA 1CT1D 3D6WA 3FPUB 2F0TA 4L8JA 4UAIA 5BN5A 1ILQA 2NVXB 2BCOA 5KEEA 1SBBB 4ILWA 3BVMA 5ELFA 1S5DD 1PLFA 1KDAA 3Q23A 1NR2A 3LNNA 1UNSA 4UDUC 5ELBA 1HTPA 2A74C 1Y1VB 2NN6G 5KGUA 2L55A 2QILA 1C4QA 3BVGA 2F03A 1SJED 5EPLA 4B9WA 5IGGA 4C3JB 2F0EA 3PIP3 2EZVA 1YNNC 5KNDA 2PZTA 3HG9A 3VR2A 3FRPB 4OO1G 1EL0A 4MIUA 1PFMA 1FD7D 3URYA 3A7LA 5KYLA 5IOCA 1ZYRD 2HCCA 4RGTA 3PO2B 4K8IA 1JQYD 2NBFA 1CA5A 4IUPA 2EYFA 2EY6A 3H91A 4NDXA 4G57A 1HFGA 5C44B 1A15A 1Y69U 4KJOA 3VA5A 4HTHA 1R4PB 1TS4A 2N55A 1CZGA 4K8JA 4V190 3HOYB 4A3IB 4BY7B 1EY8A 1FNWA 2ICEC 2JE6I 1M8AA 4ZYSA 4KK7A 4NP5A 3SVMA 5JPNC 3P20A 5KNCA 1NR4A 1ILPA 2Y0SB 2JA7B 2WP8J 2BA0A 4RGOS 3S15B 3HOXB 5IGCA 3K5NA 4HSVA 5FO9B 3LWUA 2L12A 4LK1C 1Y8PB 1MGSA 1KNAA 1CQFA 3T16A 1PYWD 3K5MA 2KCNA 4A3DB 2F0IA 4CGYB 5EJWA 3DWAA 3HS0C 5I4DA 5K5PA 5JOBA 1SMYD 4HCEA 4KKTA 2L11A 4RKLA 5JVH3 4HN7A 1SYEA 1TR5A 5D3IB 2KEEA 1TKWB 1U4PA 2J0TD 4DFAA 4RGMA 2Z4HA 3NBIA 4K5WA 4R8NA 5A2QE 3J81E 1J8IA 1X3QA 2A69C 2KOLA 1HTLD 4KD3A 4FP5D 2RDGA 2F0PA 3QG1A 4CJ1B 1JWSD 3E6ZX 1B4OA 2RVLA 2F0WA 1I3QB 1R4QB 4TKOB 2F0JA 3OPOA 1V43A 5F2DA 2B2WC 2ID0A 2EOTA 3WOFA 3SK8A 2B2YC 1GUTA 2M2LA 3SXHA 4C3HB 4XYOA 5C5LA 5C0XI 2EYMA 3KBGA 4RH6A 3RLFA 3VA7A 3I72A 2JYOA 4XIGS 1QNUA 2B39A 4IFDH 2F0UA 2LFNA 1TS3A 5FK9C 3P7JA 2NVQB 4ZUIA 2XN9C 2IT1A 2AQ3B 1HFNA 2XWJB 4A3MB 2MPMA 4JK1C 1XWEA 4IUVA 3NP8A 3EFXD 4FF2A 2KCCA 5EKLA 2F0DA 3V96A 1JCKB 1H9SA 4U68A 1A3VA 1EU3A 1U4RA 5CBAE 3BDOA 3P75A 3R2TA 1Q1EA 2L9HA 1SE4A 2E2HB 1ICWA 1QJOA 2X6GA 3L9AX 4IURA 4KY5A 2LY7A 4IFDG 3S14B 2F0SA 3J7AV 2B2TA 2BA1A 2EJGC 1ZKOA 1LT5D 2NTSA 1LV9A 1JWMD 1KTKA 3H6MA 5BN3A 3C46A 1TS2A 1J9OA 2HDMA 4IUUA 5EQ0A 1XX8A 4C1NI 4DN4M 3ND8A 3D4DA 1Q90A 3IAYA 1BOSA 2FMCA 1ENAA 2RDFA 3A56A 3HOZB 4GZYC 2FMMA 1CI3M 3BDCA 4A3JB 2MUYA 2LS01 2N88A 4KY7A 1HUMA 5C3XA 3DWPA 4BBRB 4A3GB 5CGKA 2F0KA 1HHVA 4ULLA 1PFBA 4FXKC 1WTVA 2HQEA 1CK1A 1EFID 3K7AB 1AZQA 2J4XA 2F0OA 2NVTB 3S2DB 3K59A 1AN8A 3TDQA 5I2XA 4IN3A 4QUFA 4V0BA 1W6KA 4OGQC 4K6LA 3A8KE 4B08A 2H1EA 1ZEQX 1ENCA 1SJHD 1JICA 1YNJC 3L3OC 4Y7NB 1SAPA 2NWGA 4C3JG 5JPMC 1MSHA 1L0YB 4BS9A 3VYUA 3FPPA 1GOZA 2JSOA 1GHKA 1VF5C 2VB2X 1JR0D 1G291 1B50A 1UUPA 1S5FD 2A68D 1GUNA 1PTOF 1JE4A 3SDZA 4XYQA 1BF4A 3RMHA 2QCPX 3LWEA 2K04A 2L1BA 3PUXA 3NTHA 1STBA 3TSSA 1EZ8A 3KLSA 2SNSA 3EROA 1PTOB 1STAA 1GUGA 3MC0B 4QB4A 2OT2A 1IKMA 1TIID 3DMUA 3E0JA 2KQ3A 2TSSA 4WORA 2R61A 4DF7A 2RBMA 2KEDA 2B8GA 3K5LA 1EQVA 1B3AA 4HSPA 2EXZA 3O13A 4CKEA 2QDBA 1AP0A 3SE0A 1EYAA 4RWSC 1KLUD 1SFOB 1QB5D 1PTOD 2Z1CA 3Q0AA 3Q22A 2H4OA 3J81L 4IUTA 1RD9D 4ZAIA 4H7BA 4OL7A 3N52A 4RHSA 4ID6A 1FYCA 1CM9A 1CHPD 1PDQA 3DEPA 3TBIB 4DAVA 1SE3A 5ELDA 5T1GA 5LL6X 5CV9A 2EY2A 4LJZC 2CQAA 4KHZA 4L63B 3W2DA 4IALA 4QIWB 1STGA 1STNA 3MZ5A 1WD1A 1DCZA 1IHZA 2IWHA 5COYA 1A3UA 2I07B 4OIKA 1EYCA 3X3MA 1IKLA 3R8BA 5DM63 1EY9A 1TS5A 3GO5A 3OSOA 2R93B 5EGTA 3LX0A 4OO1H 3UI2A 3S2HB 4LMQD 2PPBC 4C3HG 2F0MA 1D5MC 4F7XA 1K83B 2B2UC 3J80E 1ESFA 4OHJA 1LTGD 4Q5VA 1G2TA 3T56B 3X3NA 3C2PA 1JWUD 3VR6A 1W6JA 1A2TA 2EY1A 1O78A 3VR5A 3IFDA 4KN7C 3GTJB 4RCNA 1B2TA 2Z8LA 1S5CD 2PW5A 3OMGA 3R3OA 5CV4A 1V1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0C A;  3RD4 A; 
#chains in the Genus database with same CATH topology
 1WTH A;  3I4M H;  1V1Q A;  1SE2 A;  5EAY A;  4BA1 I;  5I2Y A;  1KXL A;  5EKK A;  1IYJ B;  2EY5 A;  4LWC A;  4PMW A;  1OXX K;  1Y1W H;  3CHB D;  2LKV A;  4XXE A;  1B44 D;  4DUZ L;  2UXD L;  3QO2 A;  3ONA B;  3G71 A;  2D62 A;  5GQO A;  4YY3 Q;  1XPR A;  3EN2 A;  2F3W A;  5ISR A;  4A3J H;  3PF5 A;  1HZB A;  1GJX A;  2AQ1 B;  4BBR H;  4JW0 A;  3VYR A;  1H9M A;  1BKB A;  1HQR D;  1VQJ A;  3GTP B;  4IUN A;  4R4I A;  2KCT A;  3E5S A;  5C5M A;  2B63 B;  4HJ9 A;  2B2V C;  1BUV T;  2OQK A;  1HR0 L;  1TY2 A;  3QIA A;  4C3I G;  4R8I A;  1EWC A;  1PH7 A;  2MJ8 A;  4TQU S;  4LFC L;  3HP3 A;  4DR7 Q;  4BY1 H;  4GLA C;  1F77 A;  1N32 L;  5M5Y B;  5EBD A;  4TRD A;  4LF5 L;  3A8I E;  1EY6 A;  1VDZ A;  1PFN A;  2JEA I;  1VQC A;  3L2P A;  4NKL A;  4CHT B;  2SDF A;  3HRZ C;  4GLV B;  3J81 i;  4ZQ3 A;  3NE5 B;  1C8C A;  3PUW A;  4DKA C;  3OMC A;  4JI2 L;  1ET6 A;  2K7V A;  3DEO A;  4QUC A;  3HOZ G;  2QEJ C;  3PUZ A;  3I7F A;  5J22 A;  2K1B A;  3RUZ A;  3ZJY C;  2RHS B;  1NBW A;  4B3T L;  3WOE A;  1II3 A;  4LW1 A;  4JBW A;  1YBY A;  1WVL A;  4WFN 3;  3CKI B;  1Z9F A;  4A3G G;  3HZX A;  1MJC A;  2XRQ D;  2CFM A;  1HUN A;  2Q2I A;  1Y8O B;  2IW3 A;  4A93 H;  2VQE Q;  1TWG H;  3D0F A;  2DY7 A;  3I73 A;  1IXR A;  3N6R A;  1F2L A;  2VZA A;  1D1I A;  1E3P A;  1ZYR C;  1Q82 C;  1WJJ A;  4POF A;  2R6G A;  2K5D A;  3CCS A;  5K36 H;  3NQT A;  1TVX A;  2ZXP A;  4JVZ A;  4H13 C;  4A3B H;  3QR8 A;  4WJW A;  2EYP A;  2I0Q A;  3S1N B;  4ZLT F;  1X3P A;  1SNM A;  1EOV A;  3C1E A;  1IBK Q;  2IX1 A;  3H0G B;  2BE5 D;  1ROD A;  1TWA H;  5JVG 3;  2NVY B;  1JMC A;  4IPD A;  2A73 B;  5C4Z A;  1CTM A;  3MVV A;  1G2S A;  3EBE A;  4RA8 A;  5HGT A;  1S5B D;  2FIN B;  1MIU A;  3C1F A;  4A3F B;  3MA2 B;  4POG A;  2YTV A;  2PQE A;  4M1U B;  2VQF L;  3MXN A;  3STB C;  1G91 A;  4NMZ A;  5M5W B;  2LMC B;  1NMG A;  5C6A A;  3PV0 A;  3Q6S A;  1Q12 A;  3HOU B;  3RZO B;  2JK8 A;  1IBM Q;  3K58 A;  5IYD G;  3KBX A;  2KA7 A;  4A3C H;  4N9P A;  5C3W A;  1LAC A;  3D3R A;  1C48 A;  1I4P A;  4DR2 L;  1D5Z C;  1AFP A;  5JJK A;  2QDL A;  1QWY A;  2M00 A;  1LTS D;  4JOI A;  4K6D A;  2IHE A;  3FKI H;  3I55 A;  3FEW X;  1VQ5 A;  2JA6 H;  1EEF D;  4DV6 L;  3J7Y W;  2A5H A;  2PZU A;  1B53 A;  5K36 G;  2ZTC A;  2O2L D;  5IYC H;  5JJZ A;  3T1H L;  1IL2 A;  3PUY A;  5ELO A;  2ICI A;  4JI6 L;  3GTK B;  2O5J C;  3HOV B;  1NTG A;  4XT3 B;  1W3S A;  5HGQ A;  2EXD A;  1EWI A;  2VNU D;  2WAC A;  4X64 L;  1SMY C;  1UEA B;  3J81 j;  4FO2 A;  3UDI A;  4N9T A;  3QB3 A;  4HR7 B;  3M85 A;  1TWF B;  1PH5 A;  1O7I A;  3BG3 A;  1ZXT A;  5LMN W;  3VYS A;  2HUG A;  2EJF C;  1A6X A;  2K32 A;  1K3B C;  2FJ2 A;  4QF4 A;  3KK7 A;  3S1R B;  1VQN A;  2K5N A;  5IP9 H;  1BCP F;  5IGE A;  5D65 A;  1Z7T A;  3I8Z A;  3MHB A;  1QVG A;  1Q81 C;  1FJG L;  5I6Y A;  3G7L A;  1VQK A;  1WFQ A;  1SYF A;  1B8A A;  2XWB B;  5AJ3 L;  1RL2 A;  1EY5 A;  4I7Z C;  3SK5 A;  4NXN Q;  3DM1 A;  2KEN A;  3BYT B;  4H0L C;  3JAM E;  3MWY W;  3OW7 A;  1XYI A;  1K0S A;  1BCP B;  3DUZ A;  4K14 A;  1DZ1 A;  2E74 C;  1TWH B;  3ULP A;  4DR6 Q;  2AKW B;  2HD3 A;  3MAQ A;  3A55 A;  5LMN L;  3EJI A;  3S2H H;  3I4L A;  2QW7 A;  1SYG A;  1F9P A;  3F2U A;  4KKU A;  1QNK A;  4MTK A;  2SEB D;  1BQQ T;  3G6E A;  3KDF B;  1V1P B;  3GTM B;  5C4H A;  4IJL A;  4DXG A;  4HIK A;  2GVB A;  2JA5 G;  1WI5 A;  3S1Q B;  4K5X A;  2PYK A;  4C3I B;  4P75 A;  5IT9 E;  5GAD C;  2VXW A;  5AFW A;  1EOT A;  1K83 H;  4FF3 A;  1D5X C;  1LT6 D;  1F2Y A;  4NPS A;  3NEL A;  2CQO A;  1ENF A;  4LF8 L;  1XNQ L;  3IKJ A;  1EIH A;  1IL8 A;  3RLO A;  1Y1V H;  4RCO A;  5E4X A;  4FNF A;  1I94 Q;  3OYY A;  2NN6 I;  1SLJ A;  3BYY B;  1CSP A;  4O1N A;  3U50 C;  1Y14 B;  4WRD A;  5M3M B;  2EVB A;  3FDT A;  4JV5 L;  1U4M A;  3S1M B;  2SNM A;  1K8A C;  1EQQ A;  3UDG A;  1JC7 A;  4DV7 L;  4DK3 C;  3OW2 A;  3UE1 A;  4AQY L;  1N36 Q;  1ASY A;  1HA6 A;  3DXJ C;  4C3J H;  1BCP D;  1Z6H A;  4S3S A;  1QZG A;  4LF6 L;  1K9M C;  3BDL A;  3SGI A;  2ZXR A;  1CHQ D;  3AU7 A;  5EPK A;  4HID A;  3GTL B;  3SK4 A;  5DAU A;  1VMC A;  2CHB D;  2R93 G;  1X3F A;  3D6C A;  2Q8T A;  2JQO A;  4YWM A;  4ZRZ A;  1B9M A;  1MD2 D;  1T5E A;  3D31 A;  3KJO A;  4OO1 I;  2HIX A;  1AE2 A;  3I4N G;  1K8G A;  3HFZ B;  4PV1 C;  2JJQ A;  2QKI C;  4C1N K;  4EVO A;  4ME5 A;  3A5Z B;  1JJC B;  4Z9C B;  3K81 C;  2XVS A;  4ZUJ A;  4ZK9 B;  4KI0 A;  4FF4 A;  1Q1B A;  1I4G A;  1VQO A;  1S3O A;  3GTP H;  3BZD B;  3PO2 H;  1I50 B;  3RD4 A;  2EPB A;  5I6W A;  1QCB D;  5JJL A;  2C5C A;  1DJR D;  2VB3 X;  3PO3 B;  2VUM B;  4DK1 A;  2Z9H A;  5CMD A;  1SNP A;  2IX3 A;  1SNQ A;  1D1K A;  4PNY A;  4YCU A;  4K2K A;  3CRL C;  3NK9 A;  3OIP A;  3M4O B;  5FOB B;  3HEJ A;  4X3U A;  5M5Y H;  4P71 A;  3TS2 A;  1XMO L;  4RMF A;  3KOJ A;  1EY4 A;  2WAQ E;  1I6V C;  1OXS C;  3G48 A;  2CW0 D;  4FF1 A;  1N33 Q;  1BO0 A;  1E1T A;  1UE7 A;  2K33 A;  4RAU C;  2F3V A;  4FDB A;  2E2J B;  1LM0 A;  4A3I H;  2B2W A;  1HNW L;  3PIO 3;  4EQP A;  4CKC A;  2Z6K C;  2B2Y A;  3I70 A;  3PUV A;  2FFK B;  2F4V L;  3MXU A;  1K0R A;  2EDG A;  1SYB A;  1EUJ A;  1GUO A;  2PNR C;  4PMB A;  1LTA D;  4EGV A;  3BZC A;  2GA4 B;  1VMP A;  5IIF A;  2K6A A;  1PH8 A;  3CU7 A;  3NEN A;  1RCV D;  1HZC A;  1E2V A;  1FNV A;  4PZ8 A;  2D5D A;  4L5Q A;  3U9O A;  3L7Z C;  2B8F A;  1QIL A;  1KRT A;  4GN4 B;  2NYZ D;  1WTR A;  1E22 A;  1K28 A;  4BXX H;  1KAW A;  4ODG A;  2B63 G;  4JI8 Q;  4XQJ A;  2NZH A;  4JYA L;  4CDC C;  1PH6 A;  1GXD C;  2OF1 A;  2JN4 A;  3S9W A;  1E2W A;  2L0C A;  2WAQ B;  2R7Z B;  3MXN B;  4OIJ A;  1IW7 D;  1RKN A;  4IQZ A;  3KF6 A;  4N8X 1;  2UXB L;  3OTO Q;  4JI0 Q;  2WKC A;  1CA6 A;  5C4X B;  3CRK C;  1R9T B;  4E6I A;  5IP7 H;  1CKN A;  1KNE A;  3NPP A;  3PGZ A;  4DV5 Q;  4AYB B;  1ICF B;  4K5V A;  5LL6 S;  5LMU L;  1BBW A;  2NVY H;  4LF4 Q;  4JBM A;  3GQB A;  4XQQ A;  4OWW B;  5E3F A;  4OEL B;  4B3R Q;  1QUQ B;  1DXM A;  4A75 A;  3AB9 A;  4DR1 L;  5I9O A;  1G6Z A;  1GD7 A;  5COR A;  4DR4 Q;  1YVC A;  4A3F H;  3S16 B;  2D0P A;  3AFP A;  2CW0 C;  4G7O C;  4DR3 Q;  1I3Q H;  1GUS A;  5A2Q L;  3FP9 A;  5HUR A;  4R4Q A;  1X6O A;  3NTI A;  1PRT F;  3TP7 A;  4K0K L;  1G51 A;  2OXP A;  3T13 A;  1KAB A;  1S4Z A;  1J5E L;  1VQE A;  3HKZ B;  1Q8I A;  2AUK A;  1Q7Y C;  2BOS A;  4GOP A;  1YIJ A;  4C3H H;  1PH3 A;  1LTL A;  3CME A;  1OXT A;  2A68 C;  2JA5 B;  5IGB A;  5JEA J;  1AW7 A;  4X66 Q;  5C0X G;  5IGD A;  3H3V C;  3K80 C;  3NXW A;  1XNR Q;  2XNA C;  1PRT B;  4CBV A;  2CKZ B;  4QGU A;  4DAM A;  3MTS A;  2J7Z A;  4GKK L;  3PIP A;  2HCI A;  1A8V A;  4RFB A;  4QY7 A;  3L0O A;  1I5F A;  4DV2 L;  5J1Z A;  3GTK H;  5BR8 L;  2EJM A;  1H9S B;  2K50 A;  2PI2 A;  3DWQ A;  4KJN A;  3H0G G;  2IPK D;  3J81 c;  3T53 B;  2PMZ B;  2UUA L;  2RF4 A;  1X54 A;  1WCM B;  1G8Z D;  4KY6 A;  1QG7 A;  2IX0 A;  2RHQ B;  2O5I C;  2VL6 A;  1TWF H;  1IYV A;  3TS0 A;  5C0X J;  3ER0 A;  2NTT A;  4KV6 A;  2WV6 D;  5FLX E;  4B3M L;  1VQ9 A;  2EYJ A;  4A3M H;  1SMX A;  2EE1 A;  1HH2 P;  4QMG A;  1NAP A;  5CV6 A;  3CC2 A;  4O2D A;  1FR3 A;  3EQL C;  2DNE A;  4GS3 A;  4A3F G;  1BBX C;  4JG2 A;  3BZK A;  1P16 A;  2XGT A;  3M7G A;  2E75 C;  4DA2 A;  3M7N A;  4RGN A;  2BDN A;  1H9K A;  2PW7 A;  2Q8R E;  2JA8 G;  4CKB A;  1BVS A;  1DM0 B;  1CZW A;  2BDO A;  1HNZ L;  3HOU G;  3GDE A;  4NB3 A;  3W5O A;  1PRT D;  3I4N B;  1XPO A;  4PG3 A;  3GTO B;  4K2L A;  2WB1 E;  2Z4I A;  4CDE C;  4DNR B;  4DUZ Q;  2UXD Q;  3GP7 A;  1JJG A;  4QCL A;  1IBL L;  1PTO C;  5IOD A;  1NE3 A;  1LT4 D;  3F2C A;  4YIJ A;  2E2H H;  5DLQ E;  1LUZ A;  4XTC S;  3TRE A;  3TME A;  3TP8 A;  1EIY B;  1PZJ D;  2K4K A;  2ASB A;  2ZJQ A;  3GTM H;  4JI4 L;  2CVR A;  2AQ2 B;  3S1Q H;  1I4X A;  5D14 A;  3S14 H;  3I90 A;  3WWV A;  3NWS A;  4IFD I;  3HOV G;  4C3I H;  3JAM L;  3BS1 A;  1MSG A;  5EKI A;  2JXM B;  1A62 A;  1VQH A;  1X65 A;  2D0O A;  1U4L A;  3I91 A;  3K0Y A;  4H44 C;  2GVA A;  2JA9 A;  1HR0 Q;  2D9U A;  4LUZ A;  4EQO A;  3TQY A;  1E7Z A;  5M5X B;  2JEB I;  3C3L A;  4LFC Q;  5M3M H;  5DNF A;  5G3L D;  2CH4 W;  2EYH A;  1LLR D;  4LF5 Q;  2RSO A;  1Q86 C;  4G7Z C;  4P72 A;  3NQI A;  5IT9 L;  4C56 C;  2A19 A;  1F9R A;  1RTN A;  2RSN A;  4DXF A;  3CPW A;  3T4A C;  1DD2 A;  2WB1 B;  1RHP A;  4HMI A;  4KHV A;  4JI5 Q;  3GD7 A;  4UPA A;  4X3S A;  3HOZ H;  2K05 A;  3GTL H;  2F1M A;  4DPG A;  3LGJ A;  1EQR A;  1TY0 A;  2DN8 A;  4JI2 Q;  2RDH A;  4A3K B;  2UU9 L;  3CXC A;  1VQP A;  2FXQ A;  5E4W C;  5DM7 3;  4A3G H;  4TSS A;  2UUC L;  2WFW A;  4BBS G;  1N34 L;  1SNC A;  4B3T Q;  2A6E D;  4C2M B;  4RKB A;  5JJI A;  3K7A H;  1X3G A;  3AEV A;  1N8R C;  1PRT C;  1VQB A;  3B6Y A;  2IHF A;  3NSW A;  2NVT H;  3M4Y A;  1X32 A;  4N8F A;  5FO7 B;  4F88 A;  2OQ0 A;  5C4J B;  3S2D H;  1LO5 D;  1L0X B;  2V4D A;  1DOL A;  1EWH A;  5JAV A;  2PCF B;  1I50 H;  4A3L G;  1OO9 B;  1KIX A;  2F0L A;  1B70 B;  4B3S L;  3H3V H;  5M3M G;  1RJT A;  2XSC A;  2KUM A;  3CF5 A;  2K28 A;  4KN4 C;  4HAE A;  2UXC L;  4Y7N H;  5FKA C;  2ZXO A;  2A69 D;  1O7Y A;  2EYO A;  1PZK D;  5IWA L;  4GLX A;  3GTG B;  1SDF A;  1DYQ A;  4BA2 I;  2B2T C;  3M3Y B;  3UE0 A;  1XXG A;  4YCV A;  2IJ0 A;  4EQ5 A;  1HZ9 A;  2X69 A;  2YYZ A;  5CBE E;  1VQF A;  2CH4 A;  2E2D C;  1S72 A;  2F0V A;  1V8Q A;  5KRU A;  3KF6 B;  4TVA B;  5IYD H;  3S17 B;  1AEX A;  3BVZ A;  1WTQ A;  1TXY A;  1KL9 A;  2VQF Q;  2DGY A;  1EY7 A;  3A7A B;  5T1I A;  1CKN B;  1T9H A;  3RN2 A;  3CD6 A;  1SYD A;  1PV4 A;  2WII B;  4U67 3;  3K7U C;  3H09 A;  1ET9 A;  4LF9 L;  1T5X D;  4EQN A;  1EEI D;  3E3X A;  4GNX C;  2X6L A;  1E0B A;  4DR5 L;  3RNU A;  1PXU A;  2K75 A;  2PI2 E;  1K8M A;  2ZTE A;  1AZP A;  1PFS A;  2DNC A;  1YHB A;  4MNO A;  3EA6 A;  1PTO H;  2MHV A;  1HQM C;  3RLN A;  4KD4 A;  1SSO A;  3PO3 G;  2K5Q A;  4DR7 L;  5E1F A;  2A6E C;  3MFY A;  2G5D A;  2VUM G;  3OIQ A;  4QQB X;  2AUJ D;  1SEB D;  2MP1 A;  3IFT A;  5J39 A;  4FXG C;  2QF7 A;  2KEC A;  3KLR A;  3T1H Q;  1Y8N B;  2PQA A;  3CCE A;  4CJ2 C;  4MN3 A;  1ML0 D;  3SK6 A;  4X65 L;  2Q8I B;  3VR4 A;  4X64 Q;  3F1Z A;  4GOP B;  1LTI D;  3TRZ A;  2KVM A;  4KMU C;  1E2Z A;  2AWN A;  3CCQ A;  3TZU A;  1NY4 A;  2JA8 B;  1SXT A;  2F0N A;  3AQQ A;  2C9O A;  1VCI A;  4O42 A;  1KC8 C;  2I5L X;  1RF2 D;  2LSS A;  2B2U A;  3P1H A;  1YI2 A;  1DON A;  1SFO H;  4R4T A;  2F0H A;  2ZJR A;  1G6P A;  3PMF A;  1OXU A;  5AJ3 Q;  2YU9 B;  4FYD A;  1CKM A;  4DAY A;  4X3K A;  1WTW A;  4UP7 A;  1H9R A;  3ZYY X;  1WTP A;  3CW2 C;  1HJP A;  1L1O A;  1ONL A;  1TWC B;  1QVF A;  3OOC A;  4KHP L;  1JOQ A;  3VDY A;  2JA5 H;  4DK6 C;  4AIM A;  3NEM A;  3F2D A;  1PH2 A;  5NUC A;  3RZD B;  2WAQ G;  2F0G A;  3ULJ A;  2R7Z G;  1E24 A;  1S40 A;  2I46 A;  1KLG D;  2G9H D;  5C3E B;  2F0F A;  1A3T A;  5M3F B;  4ZKC B;  3OWF A;  5C4X G;  1LYL A;  2PNH A;  4WJ3 M;  1QOH A;  2HIV A;  4DNT B;  1XJV A;  3QOJ A;  4LF8 Q;  1XNQ Q;  1E1O A;  4AYB G;  2M9V A;  2FHT A;  2XIW A;  1MBY A;  1TT2 A;  2MO1 A;  1F2Z A;  2XRS D;  5IYB G;  4DAP A;  1B9N A;  1WCM H;  1N9W A;  2BE5 C;  2KBN A;  4I65 A;  4ZCK A;  3GTQ B;  3D8G A;  4JV5 Q;  2V1C C;  5CV5 A;  1D2B A;  3T51 B;  5LHY 1;  2LXK A;  4DV7 Q;  1STH A;  3D4W A;  3CCR A;  4AQY Q;  1CUK A;  4LF6 Q;  4G4K A;  2N8N A;  2KHS A;  1AE3 A;  2ENB A;  3U4V A;  2R93 H;  2G9D A;  1M4V A;  4XQN A;  5CV8 A;  4BBS B;  1GHJ A;  2B2V A;  1OXV A;  1LT3 D;  2EYL A;  1S5E D;  2VY3 A;  1KHI A;  3HKZ G;  3I4N H;  1DOK A;  2K03 A;  1DOM A;  2EIF A;  5FLX L;  4FXD A;  4J8Q A;  1EU4 A;  3GTO H;  2ZT9 C;  1IYU A;  4YHH L;  1PZI D;  4IOC A;  2ATW A;  4ZKB B;  4P2C B;  1NJI C;  4JBK A;  3WDN A;  5KNB A;  4RHR A;  4GKJ L;  5KIX A;  3ERQ A;  4LAA A;  3R93 A;  1EIG A;  2SOB A;  2IL8 A;  2D2C C;  3AMU A;  2F0Q A;  1VF7 A;  3QWN A;  5M9O A;  4JI7 L;  1I4Q A;  4JC0 A;  3CCU A;  3NUC A;  2RCN A;  2L15 A;  3IL8 A;  4X3T A;  1KAA A;  3GTJ H;  2TMP A;  1YNJ D;  1KDB A;  5EPJ A;  2KHJ A;  4QL5 A;  3CAM A;  5DEH A;  1CSQ A;  1WCM G;  3J80 L;  4GOP C;  5FO8 B;  1X3E A;  5CV7 A;  3RN5 A;  5CC4 A;  2E5L L;  1A2U A;  5CR3 A;  3KFU A;  3SHL A;  3I4M B;  4YWK A;  5CYU A;  1XMO Q;  4NXM L;  1JOR A;  3K8A A;  4HED A;  1NCV A;  3OHX C;  2OEO A;  2L5T A;  1MI2 A;  4IFD J;  3GV3 A;  1I4R A;  1Y1W B;  1HNW Q;  4DV3 L;  2RQX A;  4EX5 A;  2NZ1 D;  3MXP A;  2K01 A;  2F4V Q;  2JP1 A;  4DR6 L;  2K5W A;  1C0A A;  2NZO A;  1D8L A;  3K57 A;  3ITP A;  3PCO B;  4A3K H;  1LAB A;  4L6T B;  3CP0 A;  4DV4 L;  4X62 L;  1SNO A;  1CQV A;  2L4N A;  4DK0 A;  2B63 H;  1F2M A;  4P73 A;  1B1Z A;  5TSS A;  4M8A A;  1SYC A;  1STE A;  4XDX A;  4BWG B;  4DNI A;  3NTK A;  1HPC A;  2RA4 A;  4MHE A;  4XT1 B;  3SEB A;  1TQO A;  5C4J H;  4OX9 L;  1NUC A;  1U0L A;  4JYA Q;  1K8O A;  1Q3L A;  2CWA A;  2Z0S A;  3A5U A;  3KUP A;  4F8M A;  4BY1 B;  3Q24 A;  3K6O A;  1KRS A;  5D3D A;  3FVQ A;  5KYI A;  3QJY A;  2PZW A;  2NB0 A;  4LF7 L;  3U9S A;  3W3A A;  3TP5 A;  1EZ6 A;  4KTA A;  2UXB Q;  5A35 A;  1I4H A;  1N36 L;  1EFW A;  4OWX B;  1KQS A;  3A8J E;  4DGZ A;  2B29 A;  5GRO A;  2Q2H A;  4PQX A;  2F4I A;  4B9X A;  1WTX A;  1O7Z A;  3H94 A;  1EYD A;  4UP8 A;  1VQ6 A;  2KJX A;  2R7D A;  5LMU Q;  5JEA H;  3NWT A;  2WB1 G;  3ND9 A;  1ESR A;  5L37 A;  1EY0 A;  1BCP C;  3K5O A;  2MNA A;  4YCW A;  1BR9 A;  2NUC A;  2RKS A;  3S24 A;  1SND A;  1Z47 A;  4JCV E;  1EIF A;  1F9Q A;  2B3G A;  3HGB A;  1RDP D;  1UAP A;  3VR3 A;  4A3K G;  2DY8 A;  3D4R A;  1PHJ A;  2OTL A;  4R1J A;  1WOC A;  2A1A A;  3I3C A;  4A3E B;  5I9P A;  5BN4 A;  2PQA B;  3S17 H;  1WTO A;  4KLK A;  2AWO A;  5ELC A;  4JI1 L;  3NBH A;  1JB7 A;  2QEX A;  4RG1 A;  4H02 A;  3E9H A;  4A93 B;  1TWG B;  4K0K Q;  1O80 A;  1MKH A;  2O4X A;  1VQD A;  4IUQ A;  3TN2 A;  5C0X H;  1J5E Q;  3NHH A;  1HCZ A;  2WKD A;  3MXG A;  4DU9 A;  2PO4 A;  4DV0 L;  3A54 A;  1F9S A;  2R3Z A;  2OCE A;  1HXY D;  1BDO A;  2HDL A;  3G6J B;  1TU2 B;  1HRJ A;  3R2I A;  3EVQ A;  1HA5 A;  1XMQ L;  1D6E C;  3S1N H;  4A3B B;  2N78 A;  1STY A;  3KLS X;  3H3V I;  3DM3 A;  3H0G H;  3QOL A;  1UE1 A;  4HMJ A;  1BBU A;  3GV6 A;  4DV1 L;  2ZM6 L;  1CFM A;  2DJG C;  4GKK Q;  5HY6 A;  4HCS A;  4LFA Q;  1TWA B;  1BNZ A;  2A6H D;  4DV2 Q;  1SRU A;  5BR8 Q;  4DAY B;  5C44 G;  1QZH A;  3DLL A;  5EBC A;  3MEH A;  5IGF A;  1RTO A;  5JEA G;  2UUA Q;  5GAG C;  1L1O B;  4R9W A;  3V2T A;  1XTC D;  1LTB D;  1JOK A;  3W1G A;  1QE6 A;  4Q0F A;  4J6H A;  4B3M Q;  4PZ6 A;  4IPH A;  5M5W H;  2JA8 H;  3HOU H;  3RZO H;  2N3S A;  1O7L A;  2WIN B;  4J1M A;  1MJE A;  4QJF A;  1V1O A;  1XPU A;  2E76 C;  1H9J A;  3KF8 A;  3J7A F;  5ELE A;  4QIW E;  1HNZ Q;  1JE5 A;  3F2B A;  1NSN S;  3TP6 A;  4PMC A;  1MHW C;  2ZTD A;  1I6H B;  3IRB A;  3J80 i;  3T1Y L;  2YU9 H;  3FKI B;  4JI3 L;  4ABN A;  3CQZ B;  4G7H C;  3HKS A;  2A8V A;  2JA6 B;  1JB3 A;  3VYT A;  3SR1 A;  1TWC H;  4F87 A;  4LUO A;  4NW2 A;  1IBL Q;  1RIP A;  3HOV H;  3V05 A;  1GUW A;  2AHO B;  3FMC A;  1EQT A;  3HOW B;  2CWP A;  1BXT A;  4FVM A;  5C3E H;  1PA6 A;  3MFG A;  4JI4 Q;  1OTC A;  1VQA A;  5M3F H;  1X9N A;  1PMR A;  3DHQ A;  2MQH A;  4OWT B;  1IW7 C;  1FGB D;  1LTT D;  5G3L F;  2NN6 H;  2ES2 A;  1KDC A;  4LF4 L;  2K5V A;  1YNN D;  1VQM A;  3S1R H;  1GO3 E;  1WD0 A;  1YNX A;  1LTR D;  2MGS A;  3TZD A;  2R92 B;  4CJ0 B;  1FNU A;  3TEH B;  3GTQ H;  1JOO A;  2E2I B;  1U9R A;  4IZ8 A;  4LFB L;  2A6H C;  3OWE B;  4JBJ A;  4KKS A;  1FGU A;  1CT1 D;  2DJF C;  1UE5 A;  2RCF A;  3D6W A;  2VS1 A;  3FPU B;  2F0T A;  4L8J A;  3FHW A;  1TWH H;  4UAI A;  1VQG A;  2K14 A;  4BBS H;  5BN5 A;  1YIT A;  1ILQ A;  2NVX B;  2BCO A;  5KEE A;  1SBB B;  4ILW A;  3BVM A;  5ELF A;  1S5D D;  2UU9 Q;  1PLF A;  4HJ7 A;  1W2B A;  1VQ7 A;  1KDA A;  2N49 A;  2MFI A;  3Q23 A;  2UUC Q;  1NR2 A;  3LNN A;  5IY0 A;  1UNS A;  1XNR L;  4UDU C;  5ELB A;  1HTP A;  3Q8D A;  4HIO A;  1X55 A;  5C3E G;  4A3L H;  2A74 C;  5M3F G;  1Y1V B;  2NN6 G;  3PQI A;  2Z6K A;  5KGU A;  2L55 A;  4JOI C;  2QIL A;  3S1M H;  1N32 Q;  3ERS X;  3CPF A;  1C4Q A;  3BVG A;  4B3S Q;  2F03 A;  1SJE D;  5EPL A;  4B9W A;  5IGG A;  3PSI A;  2UXC Q;  4C3J B;  3U4Z A;  2F0E A;  3PIP 3;  5IWA Q;  1PH9 A;  2EZV A;  1YNN C;  5KND A;  1HR0 W;  1VQI A;  1A63 A;  2P5Z X;  1HNX L;  5ELN A;  2PZT A;  3HG9 A;  3VR2 A;  2F3I A;  3CCL A;  3FRP B;  4P74 A;  2DUD A;  1M90 C;  4OO1 G;  1EL0 A;  3F8T A;  4MIU A;  1YHA A;  2OTJ A;  1YEZ A;  1PFM A;  1YZ6 A;  3I56 A;  1FD7 D;  2HHH L;  3URY A;  3A7L A;  5IT9 c;  5KYL A;  5IOC A;  1ZYR D;  4DUY L;  1NNX A;  1J6Q A;  2HCC A;  1PYS B;  2Y0S E;  4IJH A;  4RGT A;  3PO2 B;  4LF9 Q;  4K8I A;  1JQY D;  2UUB L;  2NBF A;  3PO3 H;  1CA5 A;  4DR5 Q;  2H5X A;  3A74 A;  4IUP A;  2VUM H;  2BH8 A;  2EYF A;  2EY6 A;  3H91 A;  3M4O H;  4NDX A;  4G57 A;  1HFG A;  5C44 B;  1A15 A;  1Y69 U;  4KJO A;  4GN3 B;  1KD1 C;  3VA5 A;  1PYB A;  3PF4 A;  5FJ8 H;  2I5M X;  3NBH B;  4HTH A;  1R4P B;  1TS4 A;  2N55 A;  4ME3 A;  1CZG A;  4IO9 A;  2E2J H;  2E8G A;  4K8J A;  3I4M G;  4X65 Q;  4V19 0;  3STB D;  3G4S A;  4A3I B;  3HOY B;  2Q2T A;  4BY7 B;  1NMF A;  2ALY B;  1EY8 A;  4PZ7 A;  1IZ6 A;  4JI5 L;  1FNW A;  2ICE C;  2JE6 I;  1M8A A;  4ZYS A;  2QA4 A;  4MTN A;  2I5H A;  4YY3 L;  1Y1W G;  4KK7 A;  4NP5 A;  3SVM A;  5JPN C;  2YV5 A;  3P20 A;  5KNC A;  1NR4 A;  1ILP A;  2Y0S B;  3KYH C;  2JA7 B;  3CC4 A;  2WP8 J;  2BA0 A;  4A3J G;  4RGO S;  3S15 B;  3HOX B;  5IGC A;  3K5N A;  4A3E H;  4HSV A;  2YTX A;  4DR2 Q;  4BBR G;  5FO9 B;  3LWU A;  1YJN A;  2L12 A;  4LK1 C;  1Y8P B;  1MGS A;  1KNA A;  2Z6B A;  4CDF C;  1C7Y A;  1CQF A;  2HT1 A;  4APV A;  3T16 A;  1PYW D;  3K5M A;  2KCN A;  4A3D B;  2F0I A;  4CGY B;  4DV6 Q;  1V9P A;  5EJW A;  3DWA A;  3HS0 C;  4L5T A;  5I4D A;  5K5P A;  5JOB A;  1SMY D;  4HCE A;  2R7Z H;  4KKT A;  4KHP Q;  2L11 A;  4JI6 Q;  4RKL A;  4BY1 G;  5JVH 3;  5C4X H;  4HN7 A;  1SYE A;  1TR5 A;  3M4P A;  5D3I B;  1R9T H;  2KEE A;  2YTY A;  1TKW B;  1U4P A;  4WJ4 A;  5FJ8 G;  3E9I A;  3KF8 B;  2J0T D;  4DFA A;  4RGM A;  2Z4H A;  5H1S E;  3NBI A;  4K5W A;  5IYB H;  3J7Z C;  4R8N A;  5A2Q E;  3J81 E;  1J8I A;  1X3Q A;  4LUV A;  2A69 C;  2KOL A;  1HTL D;  3BU2 A;  4KD3 A;  1YJW A;  4FP5 D;  2RDG A;  2F0P A;  3QG1 A;  3KLW A;  4CJ1 B;  3E0E A;  1CKO A;  3S16 H;  1JWS D;  3JAM i;  1FJG Q;  4OXP A;  5E7N A;  3A0J A;  1B4O A;  3E6Z X;  1B7Y B;  2RVL A;  2F0W A;  1I3Q B;  2VQE L;  1R4Q B;  4TKO B;  4A3E G;  2F0J A;  3OPO A;  1V43 A;  5F2D A;  2B2W C;  3CMA A;  2ID0 A;  2EOT A;  3WOF A;  4A93 G;  3SK8 A;  2B2Y C;  1GUT A;  2M2L A;  3SXH A;  5LMN Q;  4C3H B;  3ICE A;  4XYO A;  5C5L A;  4UP9 A;  5C0X I;  1I6H H;  2EYM A;  3KBG A;  4RH6 A;  3RLF A;  4YHH Q;  3CQZ H;  3VA7 A;  1QUQ A;  1IBK L;  1PH4 A;  4GKJ Q;  3UDX A;  3I72 A;  1GM5 A;  4A3B G;  1M1K C;  2OWO A;  2JYO A;  4XIG S;  1QNU A;  2B39 A;  4IFD H;  4JI7 Q;  5J3B A;  2F0U A;  2LFN A;  1TS3 A;  3U58 A;  3HOW H;  3CC7 A;  2Q2U A;  5FK9 C;  3P7J A;  2NVQ B;  4ZUI A;  3I2Z A;  2XN9 C;  2IT1 A;  1FVI A;  2ZJP A;  2AQ3 B;  1HFN A;  2XWJ B;  4A3M B;  2MPM A;  4JK1 C;  2GN5 A;  1IBM L;  2R92 H;  2E5L Q;  2E2I H;  1XWE A;  4IUV A;  4HIM A;  2KCM A;  3NP8 A;  3EFX D;  5IE8 A;  4NXM Q;  4FF2 A;  1Q46 A;  4A3C G;  2KCC A;  5EKL A;  2F0D A;  3V96 A;  1JCK B;  1H9S A;  4U68 A;  1A3V A;  1EU3 A;  4DV3 Q;  4HJA A;  1U4R A;  5CBA E;  3BDO A;  2HQL A;  3P75 A;  2NVX H;  3FKI G;  2BH2 A;  2EQS A;  3R2T A;  2JA6 G;  1Q1E A;  2L9H A;  1SE4 A;  4DV4 Q;  2E2H B;  4HJ8 A;  4X62 Q;  1ICW A;  1QJO A;  5IYC G;  2X6G A;  3L9A X;  4OON A;  3PIO A;  4IUR A;  4KY5 A;  2LY7 A;  4IFD G;  3S14 B;  2F0S A;  2QGQ A;  3J7A V;  1VQ8 A;  2B2T A;  3HOW G;  2BA1 A;  2EJG C;  1ZKO A;  1LT5 D;  3I4O A;  2NTS A;  5M5X H;  1LV9 A;  5FLX c;  4OX9 Q;  1JWM D;  1KTK A;  3H6M A;  3ULL A;  5BN3 A;  4HJ5 A;  3C46 A;  1TS2 A;  1J9O A;  4MZ9 A;  2HDM A;  4IUU A;  5EQ0 A;  1XX8 A;  2R92 G;  4LF7 Q;  5IP9 G;  1U5K A;  4C1N I;  5GAE C;  4DN4 M;  3ND8 A;  3AFQ A;  3D4D A;  5FLM H;  1Q90 A;  3IAY A;  1SR3 A;  4NXN L;  1BOS A;  2FMC A;  1QVC A;  1UE6 A;  1ENA A;  2RDF A;  4GNX A;  3A56 A;  3HOZ B;  1SRO A;  1YJ9 A;  1Q8K A;  4GZY C;  2FMM A;  1CI3 M;  3BDC A;  4A3J B;  2MUY A;  2LS0 1;  3J80 c;  2N88 A;  1JJ2 A;  4KY7 A;  1HUM A;  5C3X A;  3DWP A;  4BBR B;  4A3G B;  5CGK A;  2F0K A;  1HHV A;  4ULL A;  4C2M H;  1PFB A;  4FXK C;  1WTV A;  2HQE A;  1CK1 A;  1EFI D;  3K7A B;  3CCM A;  1AZQ A;  2J4X A;  4JI1 Q;  1I94 L;  4L5R C;  2F0O A;  4L5S A;  3J7A 5;  2NVT B;  3K0X A;  3S2D B;  1C9O A;  3K59 A;  1AN8 A;  3TDQ A;  1UEB A;  5I2X A;  1Y1V G;  4IN3 A;  4QUF A;  4O0A A;  4V0B A;  1W6K A;  4OGQ C;  4K6L A;  4DV0 Q;  4UY8 C;  3A8K E;  4B08 A;  2H1E A;  1ZEQ X;  1ENC A;  1XMQ Q;  1SJH D;  1JIC A;  1YNJ C;  2K5H A;  3L3O C;  4Y7N B;  5C44 H;  1SAP A;  3GTG H;  2NWG A;  5FLM G;  4DV1 Q;  2ZM6 Q;  4C3J G;  3M3Y H;  5JPM C;  1MSH A;  1L0Y B;  4BS9 A;  2XTI A;  3VYU A;  3FPP A;  1VQL A;  3UDF A;  2AMC B;  3HOY H;  4DR1 Q;  4BY7 H;  1GOZ A;  2JSO A;  1GHK A;  1VF5 C;  2VB2 X;  1JR0 D;  1G29 1;  3MEF A;  4AYB E;  4YWL A;  1B50 A;  1UUP A;  4R4C A;  2LXJ A;  1S5F D;  2A68 D;  1GUN A;  1PTO F;  1JE4 A;  3SDZ A;  4XYQ A;  1BF4 A;  3RMH A;  1L0W A;  2JA7 H;  1YHQ A;  2QCP X;  3LWE A;  3RR5 A;  3S15 H;  3HOX H;  2K04 A;  2C35 B;  2L1B A;  3PUX A;  3NTH A;  1STB A;  3TSS A;  1EZ8 A;  3PO2 G;  3KLS A;  1K73 C;  2SNS A;  3T1Y Q;  3ERO A;  4A3D H;  1PTO B;  1EYG A;  4JI3 Q;  1STA A;  1GUG A;  3MC0 B;  1GVP A;  4QB4 A;  1UWV A;  2OT2 A;  1IKM A;  1TII D;  3DMU A;  4X6A H;  3HKZ E;  1N33 L;  3E0J A;  2KQ3 A;  2TSS A;  1HZA A;  4WOR A;  1P8L A;  4IOA A;  2R61 A;  4LNQ A;  4ALP A;  4DF7 A;  1ASZ A;  2RBM A;  2KED A;  2B8G A;  4JPB W;  3HOY G;  4A3I G;  1L2F A;  4I7A A;  4BY7 G;  3K5L A;  3BJU A;  1EQV A;  1B3A A;  4HSP A;  2EXZ A;  3O13 A;  1K3R A;  4CKE A;  2QDB A;  1A0I A;  1AP0 A;  3SE0 A;  1EYA A;  1D7Q A;  2PMZ E;  4RWS C;  3W1B A;  4A4I A;  2Y0S G;  2R7F A;  4LFB Q;  2JA7 G;  1KLU D;  1SFO B;  1QB5 D;  1PTO D;  2Z1C A;  4JI8 L;  3Q0A A;  3HOX G;  3Q22 A;  2H4O A;  3J81 L;  4IUT A;  1RD9 D;  4ZAI A;  4H7B A;  4OL7 A;  3N52 A;  1GKH A;  4RHS A;  4BXX G;  4AH6 A;  3KJP A;  3CCJ A;  4ID6 A;  1FYC A;  4A3D G;  1CM9 A;  1CHP D;  1PH1 A;  1PDQ A;  3RZD H;  3OTO L;  4JI0 L;  3DEP A;  3TBI B;  4DAV A;  1SE3 A;  5ELD A;  4DV5 L;  5T1G A;  5LL6 X;  5CV9 A;  1FL0 A;  4LFA L;  2EY2 A;  4LJZ C;  4UHV A;  2IY5 B;  1JT8 A;  5IP7 G;  2CQA A;  4B3R L;  4KHZ A;  2K52 A;  4Y52 H;  4L63 B;  1SE8 A;  3W2D A;  4IAL A;  4QIW B;  2NVQ H;  1STG A;  1STN A;  4DR4 L;  4IPG A;  3MZ5 A;  1WD1 A;  1DCZ A;  1IHZ A;  2IWH A;  4DR3 L;  5COY A;  1A3U A;  1X56 A;  2I07 B;  4OIK A;  1EYC A;  3X3M A;  1IKL A;  2KHI A;  3R8B A;  5DM6 3;  1EY9 A;  1PVO A;  1TS5 A;  3GO5 A;  3OSO A;  2R93 B;  4OEM B;  5EGT A;  3AYH B;  3LX0 A;  3EIV A;  4GN5 A;  4OO1 H;  4R4O A;  3UI2 A;  3S2H B;  4LMQ D;  4J15 A;  4X66 L;  3JC6 6;  1XTD A;  1AH9 A;  1DGS A;  1HNX Q;  2PPB C;  1VQ4 A;  1B3Q A;  1N34 Q;  4C3H G;  2F0M A;  4A76 A;  3M9B A;  3H15 A;  1D5M C;  4F7X A;  1H95 A;  1K83 B;  2B2U C;  3J80 E;  1ESF A;  4OHJ A;  1LTG D;  1VS0 A;  4Q5V A;  4CDD C;  2HHH Q;  3T56 B;  1G2T A;  3X3N A;  3C2P A;  4DUY Q;  1SN8 A;  1JWU D;  3VR6 A;  3CCV A;  5GAH C;  1W6J A;  1A2T A;  2EY1 A;  1O78 A;  4GNX B;  4IPC A;  3VR5 A;  3IFD A;  4KN7 C;  3GTJ B;  4RCN A;  1B2T A;  3M4Q A;  2UUB Q;  1L1O C;  2VW9 A;  1WYD A;  2MO0 A;  2Z8L A;  1S5C D;  2PW5 A;  3OMG A;  3R3O A;  5CV4 A;  2F52 A;  3KDF A;  1V1P A;  2CCZ A;  3JAM c;  4A3M G; 
#chains in the Genus database with same CATH homology
 1SE2 A;  4BA1 I;  5I2Y A;  5EKK A;  2EY5 A;  4PMW A;  1OXX K;  3CHB D;  2LKV A;  4XXE A;  1B44 D;  3QO2 A;  3ONA B;  2D62 A;  2F3W A;  5ISR A;  1GJX A;  2AQ1 B;  3VYR A;  1H9M A;  1HQR D;  3GTP B;  4IUN A;  3E5S A;  5C5M A;  2B63 B;  2B2V C;  1BUV T;  1TY2 A;  3QIA A;  4C3I G;  4R8I A;  1EWC A;  2MJ8 A;  4TQU S;  3HP3 A;  1F77 A;  5M5Y B;  5EBD A;  4TRD A;  3A8I E;  1EY6 A;  1VDZ A;  1PFN A;  2JEA I;  4NKL A;  4CHT B;  2SDF A;  3HRZ C;  4ZQ3 A;  3NE5 B;  1C8C A;  3PUW A;  3OMC A;  1ET6 A;  2K7V A;  3DEO A;  4QUC A;  2QEJ C;  3PUZ A;  5J22 A;  2K1B A;  3RUZ A;  3WOE A;  1II3 A;  4JBW A;  1WVL A;  4WFN 3;  3CKI B;  3HZX A;  2XRQ D;  1HUN A;  1Y8O B;  2IW3 A;  2DY7 A;  3I73 A;  3N6R A;  1F2L A;  1D1I A;  1ZYR C;  2R6G A;  2K5D A;  5K36 H;  3NQT A;  1TVX A;  2ZXP A;  4H13 C;  4WJW A;  2EYP A;  3S1N B;  4ZLT F;  1X3P A;  1SNM A;  3C1E A;  2IX1 A;  3H0G B;  2BE5 D;  1ROD A;  5JVG 3;  2NVY B;  2A73 B;  5C4Z A;  1CTM A;  3MVV A;  1G2S A;  4RA8 A;  5HGT A;  1S5B D;  2FIN B;  3C1F A;  4A3F B;  3MA2 B;  2PQE A;  4M1U B;  3MXN A;  1G91 A;  4NMZ A;  5M5W B;  2LMC B;  5C6A A;  3PV0 A;  3Q6S A;  1Q12 A;  3HOU B;  3RZO B;  3K58 A;  3KBX A;  2KA7 A;  4N9P A;  5C3W A;  1LAC A;  3D3R A;  1C48 A;  1I4P A;  1D5Z C;  1AFP A;  1QWY A;  2M00 A;  1LTS D;  4K6D A;  3FEW X;  1EEF D;  3J7Y W;  2A5H A;  2PZU A;  1B53 A;  5K36 G;  2O2L D;  5JJZ A;  3PUY A;  2ICI A;  3GTK B;  2O5J C;  3HOV B;  4XT3 B;  2VNU D;  2WAC A;  1SMY C;  1UEA B;  4FO2 A;  4N9T A;  3QB3 A;  4HR7 B;  3M85 A;  1TWF B;  3BG3 A;  1ZXT A;  3VYS A;  2HUG A;  2EJF C;  1A6X A;  2K32 A;  2FJ2 A;  4QF4 A;  3KK7 A;  3S1R B;  1BCP F;  5IGE A;  5D65 A;  1Z7T A;  3I8Z A;  3MHB A;  5I6Y A;  3G7L A;  1SYF A;  2XWB B;  4I7Z C;  1EY5 A;  3SK5 A;  3DM1 A;  4H0L C;  3BYT B;  3JAM E;  3MWY W;  3OW7 A;  1XYI A;  1BCP B;  3DUZ A;  4K14 A;  1DZ1 A;  2E74 C;  1TWH B;  3MAQ A;  3A55 A;  3EJI A;  3I4L A;  3F2U A;  1SYG A;  1F9P A;  4KKU A;  1QNK A;  2SEB D;  1BQQ T;  1V1P B;  3GTM B;  5C4H A;  4DXG A;  3S1Q B;  4K5X A;  2PYK A;  4C3I B;  5IT9 E;  2VXW A;  5AFW A;  1EOT A;  4FF3 A;  1D5X C;  1LT6 D;  1F2Y A;  1ENF A;  3IKJ A;  1EIH A;  1IL8 A;  4RCO A;  5E4X A;  4FNF A;  2NN6 I;  3BYY B;  4O1N A;  4WRD A;  5M3M B;  2EVB A;  3FDT A;  1U4M A;  3S1M B;  2SNM A;  1JC7 A;  1HA6 A;  3DXJ C;  1BCP D;  1Z6H A;  4S3S A;  3BDL A;  2ZXR A;  1CHQ D;  3AU7 A;  5EPK A;  3GTL B;  3SK4 A;  5DAU A;  1VMC A;  2CHB D;  3D6C A;  2Q8T A;  4ZRZ A;  1B9M A;  1MD2 D;  1T5E A;  3D31 A;  4OO1 I;  4PV1 C;  2QKI C;  4C1N K;  4EVO A;  4ME5 A;  4Z9C B;  2XVS A;  4ZUJ A;  4ZK9 B;  4KI0 A;  4FF4 A;  1Q1B A;  1I4G A;  3BZD B;  1I50 B;  3RD4 A;  2EPB A;  5I6W A;  1QCB D;  2C5C A;  1DJR D;  2VB3 X;  3PO3 B;  2VUM B;  4DK1 A;  5CMD A;  1SNP A;  2IX3 A;  1SNQ A;  1D1K A;  4PNY A;  4K2K A;  3CRL C;  3NK9 A;  3OIP A;  3M4O B;  5FOB B;  3HEJ A;  4X3U A;  1EY4 A;  1I6V C;  1OXS C;  2CW0 D;  4FF1 A;  1BO0 A;  2K33 A;  4RAU C;  2F3V A;  2E2J B;  2B2W A;  3PIO 3;  4EQP A;  4CKC A;  2B2Y A;  3I70 A;  3PUV A;  2FFK B;  3MXU A;  2EDG A;  1SYB A;  1GUO A;  2PNR C;  4PMB A;  1LTA D;  4EGV A;  2GA4 B;  1VMP A;  5IIF A;  2K6A A;  3CU7 A;  1RCV D;  1E2V A;  1FNV A;  2D5D A;  3U9O A;  3L7Z C;  2B8F A;  1QIL A;  2NYZ D;  1WTR A;  4ODG A;  4XQJ A;  1GXD C;  2OF1 A;  3S9W A;  1E2W A;  2L0C A;  2WAQ B;  2R7Z B;  4OIJ A;  1IW7 D;  1RKN A;  4IQZ A;  2WKC A;  1CA6 A;  5C4X B;  3CRK C;  1R9T B;  4E6I A;  1KNE A;  3NPP A;  4AYB B;  4K5V A;  5LL6 S;  3GQB A;  4XQQ A;  5E3F A;  1DXM A;  3AB9 A;  5I9O A;  1G6Z A;  5COR A;  3S16 B;  2CW0 C;  4G7O C;  1GUS A;  5A2Q L;  5HUR A;  3NTI A;  1PRT F;  3TP7 A;  2OXP A;  3T13 A;  1KAB A;  1S4Z A;  3HKZ B;  1Q8I A;  2AUK A;  2BOS A;  2JA5 B;  1OXT A;  2A68 C;  5IGB A;  5JEA J;  1AW7 A;  5C0X G;  5IGD A;  3H3V C;  3NXW A;  2XNA C;  1PRT B;  4CBV A;  3MTS A;  2J7Z A;  2HCI A;  4RFB A;  5J1Z A;  2EJM A;  1H9S B;  3DWQ A;  4KJN A;  2IPK D;  3T53 B;  2PMZ B;  1WCM B;  1G8Z D;  4KY6 A;  1QG7 A;  2IX0 A;  2O5I C;  1IYV A;  5C0X J;  2NTT A;  4KV6 A;  2WV6 D;  5FLX E;  2EYJ A;  2EE1 A;  4QMG A;  1NAP A;  5CV6 A;  1FR3 A;  3EQL C;  2DNE A;  1BBX C;  3M7G A;  2E75 C;  4DA2 A;  3M7N A;  4RGN A;  2BDN A;  1H9K A;  2PW7 A;  2Q8R E;  4CKB A;  1DM0 B;  1CZW A;  2BDO A;  1PRT D;  3I4N B;  3GTO B;  4K2L A;  2Z4I A;  4DNR B;  3GP7 A;  4QCL A;  1PTO C;  5IOD A;  1LT4 D;  4YIJ A;  4XTC S;  3TME A;  3TP8 A;  1PZJ D;  2CVR A;  2AQ2 B;  5D14 A;  1I4X A;  3I90 A;  3NWS A;  4IFD I;  3JAM L;  3BS1 A;  1MSG A;  5EKI A;  2JXM B;  1U4L A;  3I91 A;  3K0Y A;  4H44 C;  2D9U A;  4EQO A;  5M5X B;  2JEB I;  3C3L A;  5DNF A;  5G3L D;  2EYH A;  1LLR D;  2RSO A;  4G7Z C;  3NQI A;  5IT9 L;  4C56 C;  1F9R A;  1RTN A;  2RSN A;  4DXF A;  3T4A C;  1DD2 A;  2WB1 B;  1RHP A;  4HMI A;  4KHV A;  3GD7 A;  4X3S A;  2K05 A;  2F1M A;  1TY0 A;  2DN8 A;  2RDH A;  4A3K B;  5DM7 3;  5E4W C;  4TSS A;  1SNC A;  2A6E D;  4C2M B;  4RKB A;  1PRT C;  3NSW A;  3M4Y A;  1X32 A;  5FO7 B;  4F88 A;  5C4J B;  1LO5 D;  1L0X B;  2V4D A;  1DOL A;  1EWH A;  5JAV A;  2PCF B;  1OO9 B;  2F0L A;  1RJT A;  2XSC A;  2KUM A;  2K28 A;  4KN4 C;  4HAE A;  5FKA C;  2ZXO A;  2A69 D;  1O7Y A;  2EYO A;  1PZK D;  3GTG B;  1SDF A;  1DYQ A;  4BA2 I;  2B2T C;  3M3Y B;  1XXG A;  2IJ0 A;  2X69 A;  2YYZ A;  5CBE E;  2E2D C;  2F0V A;  1V8Q A;  5KRU A;  3S17 B;  1AEX A;  3BVZ A;  1WTQ A;  1EY7 A;  3A7A B;  5T1I A;  1SYD A;  2WII B;  4U67 3;  3H09 A;  1ET9 A;  1T5X D;  4EQN A;  1EEI D;  2X6L A;  1E0B A;  1PXU A;  1K8M A;  1AZP A;  2DNC A;  3EA6 A;  1PTO H;  2MHV A;  1HQM C;  4KD4 A;  1SSO A;  2K5Q A;  5E1F A;  2A6E C;  3MFY A;  3OIQ A;  2AUJ D;  1SEB D;  2MP1 A;  3IFT A;  5J39 A;  4FXG C;  2QF7 A;  2KEC A;  3KLR A;  1Y8N B;  4CJ2 C;  4MN3 A;  1ML0 D;  3SK6 A;  2Q8I B;  3VR4 A;  1LTI D;  2KVM A;  4KMU C;  1E2Z A;  2AWN A;  3TZU A;  2JA8 B;  1SXT A;  2F0N A;  2C9O A;  1VCI A;  4O42 A;  1RF2 D;  2B2U A;  3P1H A;  1DON A;  2F0H A;  3PMF A;  1OXU A;  2YU9 B;  4FYD A;  4DAY A;  4X3K A;  1WTW A;  1H9R A;  3ZYY X;  1WTP A;  1ONL A;  1TWC B;  3OOC A;  1JOQ A;  5NUC A;  3RZD B;  2F0G A;  2I46 A;  1KLG D;  2G9H D;  5C3E B;  2F0F A;  1A3T A;  5M3F B;  4ZKC B;  3OWF A;  1QOH A;  4DNT B;  3QOJ A;  2M9V A;  2FHT A;  2XIW A;  1MBY A;  1TT2 A;  1F2Z A;  2XRS D;  4DAP A;  1B9N A;  2BE5 C;  4I65 A;  3GTQ B;  3D8G A;  5CV5 A;  1D2B A;  3T51 B;  5LHY 1;  1STH A;  3D4W A;  4G4K A;  2KHS A;  2ENB A;  2G9D A;  1M4V A;  4XQN A;  5CV8 A;  4BBS B;  1GHJ A;  2B2V A;  1OXV A;  1LT3 D;  2EYL A;  1S5E D;  1DOK A;  2K03 A;  1DOM A;  5FLX L;  4FXD A;  4J8Q A;  1EU4 A;  2ZT9 C;  1IYU A;  1PZI D;  4ZKB B;  4P2C B;  3WDN A;  5KNB A;  4RHR A;  5KIX A;  3ERQ A;  4LAA A;  3R93 A;  1EIG A;  2SOB A;  2IL8 A;  2D2C C;  3AMU A;  2F0Q A;  1VF7 A;  3QWN A;  5M9O A;  1I4Q A;  3NUC A;  3IL8 A;  4X3T A;  1KAA A;  2TMP A;  1YNJ D;  1KDB A;  5EPJ A;  5DEH A;  3J80 L;  5FO8 B;  5CV7 A;  5CC4 A;  1A2U A;  5CR3 A;  3SHL A;  3I4M B;  5CYU A;  1JOR A;  4HED A;  1NCV A;  3OHX C;  2OEO A;  2L5T A;  1MI2 A;  4IFD J;  3GV3 A;  1I4R A;  1Y1W B;  2RQX A;  2NZ1 D;  3MXP A;  2K01 A;  2JP1 A;  2K5W A;  3K57 A;  3ITP A;  1LAB A;  4L6T B;  1SNO A;  1CQV A;  2L4N A;  4DK0 A;  1F2M A;  1B1Z A;  5TSS A;  4M8A A;  1SYC A;  1STE A;  4XDX A;  4BWG B;  3NTK A;  1HPC A;  2RA4 A;  4MHE A;  4XT1 B;  3SEB A;  1TQO A;  1NUC A;  1K8O A;  1Q3L A;  3KUP A;  4F8M A;  4BY1 B;  3Q24 A;  3K6O A;  5D3D A;  3FVQ A;  5KYI A;  3QJY A;  2PZW A;  2NB0 A;  3U9S A;  3W3A A;  3TP5 A;  1EZ6 A;  4KTA A;  5A35 A;  1I4H A;  3A8J E;  4DGZ A;  4PQX A;  2F4I A;  4B9X A;  1WTX A;  1O7Z A;  3H94 A;  1EYD A;  2KJX A;  5JEA H;  3NWT A;  3ND9 A;  1ESR A;  1EY0 A;  1BCP C;  3K5O A;  1BR9 A;  2NUC A;  2RKS A;  1SND A;  1Z47 A;  1F9Q A;  3HGB A;  1RDP D;  1UAP A;  3VR3 A;  2DY8 A;  3D4R A;  3I3C A;  4A3E B;  5I9P A;  5BN4 A;  1WTO A;  2AWO A;  5ELC A;  3NBH A;  4A93 B;  1TWG B;  1O80 A;  2O4X A;  4IUQ A;  3TN2 A;  5C0X H;  3NHH A;  1HCZ A;  2WKD A;  3MXG A;  4DU9 A;  2PO4 A;  3A54 A;  1F9S A;  2R3Z A;  1HXY D;  1BDO A;  2HDL A;  3G6J B;  1TU2 B;  1HRJ A;  3R2I A;  3EVQ A;  1HA5 A;  1D6E C;  4A3B B;  1STY A;  3KLS X;  3QOL A;  4HMJ A;  3GV6 A;  1CFM A;  4HCS A;  1TWA B;  1BNZ A;  2A6H D;  5EBC A;  3MEH A;  5IGF A;  1RTO A;  5JEA G;  4R9W A;  3V2T A;  1XTC D;  1LTB D;  1JOK A;  1QE6 A;  4Q0F A;  4J6H A;  1O7L A;  2WIN B;  4J1M A;  1V1O A;  2E76 C;  1H9J A;  3KF8 A;  3J7A F;  5ELE A;  1NSN S;  3TP6 A;  4PMC A;  1I6H B;  3FKI B;  4ABN A;  3CQZ B;  4G7H C;  2JA6 B;  1JB3 A;  3VYT A;  3SR1 A;  4F87 A;  4NW2 A;  3V05 A;  1GUW A;  3FMC A;  1EQT A;  3HOW B;  1BXT A;  4FVM A;  3MFG A;  1PMR A;  3DHQ A;  1IW7 C;  1FGB D;  1LTT D;  5G3L F;  2NN6 H;  1KDC A;  1YNN D;  1WD0 A;  1LTR D;  2MGS A;  3TZD A;  2R92 B;  4CJ0 B;  1FNU A;  1JOO A;  2E2I B;  1U9R A;  4IZ8 A;  2A6H C;  3OWE B;  4KKS A;  1CT1 D;  3D6W A;  3FPU B;  2F0T A;  4L8J A;  4UAI A;  5BN5 A;  1ILQ A;  2NVX B;  2BCO A;  5KEE A;  1SBB B;  4ILW A;  3BVM A;  5ELF A;  1S5D D;  1PLF A;  1KDA A;  3Q23 A;  1NR2 A;  3LNN A;  1UNS A;  4UDU C;  5ELB A;  1HTP A;  2A74 C;  1Y1V B;  2NN6 G;  5KGU A;  2L55 A;  2QIL A;  1C4Q A;  3BVG A;  2F03 A;  1SJE D;  5EPL A;  4B9W A;  5IGG A;  4C3J B;  2F0E A;  3PIP 3;  2EZV A;  1YNN C;  5KND A;  2PZT A;  3HG9 A;  3VR2 A;  3FRP B;  4OO1 G;  1EL0 A;  4MIU A;  1PFM A;  1FD7 D;  3URY A;  3A7L A;  5KYL A;  5IOC A;  1ZYR D;  2HCC A;  4RGT A;  3PO2 B;  4K8I A;  1JQY D;  2NBF A;  1CA5 A;  4IUP A;  2EYF A;  2EY6 A;  3H91 A;  4NDX A;  4G57 A;  1HFG A;  5C44 B;  1A15 A;  1Y69 U;  4KJO A;  3VA5 A;  4HTH A;  1R4P B;  1TS4 A;  2N55 A;  1CZG A;  4K8J A;  4V19 0;  3HOY B;  4A3I B;  4BY7 B;  1EY8 A;  1FNW A;  2ICE C;  2JE6 I;  1M8A A;  4ZYS A;  4KK7 A;  4NP5 A;  3SVM A;  5JPN C;  3P20 A;  5KNC A;  1NR4 A;  1ILP A;  2Y0S B;  2JA7 B;  2WP8 J;  2BA0 A;  4RGO S;  3S15 B;  3HOX B;  5IGC A;  3K5N A;  4HSV A;  5FO9 B;  3LWU A;  2L12 A;  4LK1 C;  1Y8P B;  1MGS A;  1KNA A;  1CQF A;  3T16 A;  1PYW D;  3K5M A;  2KCN A;  4A3D B;  2F0I A;  4CGY B;  5EJW A;  3DWA A;  3HS0 C;  5I4D A;  5K5P A;  5JOB A;  1SMY D;  4HCE A;  4KKT A;  2L11 A;  4RKL A;  5JVH 3;  4HN7 A;  1SYE A;  1TR5 A;  5D3I B;  2KEE A;  1TKW B;  1U4P A;  2J0T D;  4DFA A;  4RGM A;  2Z4H A;  3NBI A;  4K5W A;  4R8N A;  5A2Q E;  3J81 E;  1J8I A;  1X3Q A;  2A69 C;  2KOL A;  1HTL D;  4KD3 A;  4FP5 D;  2RDG A;  2F0P A;  3QG1 A;  4CJ1 B;  1JWS D;  3E6Z X;  1B4O A;  2RVL A;  2F0W A;  1I3Q B;  1R4Q B;  4TKO B;  2F0J A;  3OPO A;  1V43 A;  5F2D A;  2B2W C;  2ID0 A;  2EOT A;  3WOF A;  3SK8 A;  2B2Y C;  1GUT A;  2M2L A;  3SXH A;  4C3H B;  4XYO A;  5C5L A;  5C0X I;  2EYM A;  3KBG A;  4RH6 A;  3RLF A;  3VA7 A;  3I72 A;  2JYO A;  4XIG S;  1QNU A;  2B39 A;  4IFD H;  2F0U A;  2LFN A;  1TS3 A;  5FK9 C;  3P7J A;  2NVQ B;  4ZUI A;  2XN9 C;  2IT1 A;  2AQ3 B;  1HFN A;  2XWJ B;  4A3M B;  2MPM A;  4JK1 C;  1XWE A;  4IUV A;  3NP8 A;  3EFX D;  4FF2 A;  2KCC A;  5EKL A;  2F0D A;  3V96 A;  1JCK B;  1H9S A;  4U68 A;  1A3V A;  1EU3 A;  1U4R A;  5CBA E;  3BDO A;  3P75 A;  3R2T A;  1Q1E A;  2L9H A;  1SE4 A;  2E2H B;  1ICW A;  1QJO A;  2X6G A;  3L9A X;  4IUR A;  4KY5 A;  2LY7 A;  4IFD G;  3S14 B;  2F0S A;  3J7A V;  2B2T A;  2BA1 A;  2EJG C;  1ZKO A;  1LT5 D;  2NTS A;  1LV9 A;  1JWM D;  1KTK A;  3H6M A;  5BN3 A;  3C46 A;  1TS2 A;  1J9O A;  2HDM A;  4IUU A;  5EQ0 A;  1XX8 A;  4C1N I;  4DN4 M;  3ND8 A;  3D4D A;  1Q90 A;  3IAY A;  1BOS A;  2FMC A;  1ENA A;  2RDF A;  3A56 A;  3HOZ B;  4GZY C;  2FMM A;  1CI3 M;  3BDC A;  4A3J B;  2MUY A;  2LS0 1;  2N88 A;  4KY7 A;  1HUM A;  5C3X A;  3DWP A;  4BBR B;  4A3G B;  5CGK A;  2F0K A;  1HHV A;  4ULL A;  1PFB A;  4FXK C;  1WTV A;  2HQE A;  1CK1 A;  1EFI D;  3K7A B;  1AZQ A;  2J4X A;  2F0O A;  2NVT B;  3S2D B;  3K59 A;  1AN8 A;  3TDQ A;  5I2X A;  4IN3 A;  4QUF A;  4V0B A;  1W6K A;  4OGQ C;  4K6L A;  3A8K E;  4B08 A;  2H1E A;  1ZEQ X;  1ENC A;  1SJH D;  1JIC A;  1YNJ C;  3L3O C;  4Y7N B;  1SAP A;  2NWG A;  4C3J G;  5JPM C;  1MSH A;  1L0Y B;  4BS9 A;  3VYU A;  3FPP A;  1GOZ A;  2JSO A;  1GHK A;  1VF5 C;  2VB2 X;  1JR0 D;  1G29 1;  1B50 A;  1UUP A;  1S5F D;  2A68 D;  1GUN A;  1PTO F;  1JE4 A;  3SDZ A;  4XYQ A;  1BF4 A;  3RMH A;  2QCP X;  3LWE A;  2K04 A;  2L1B A;  3PUX A;  3NTH A;  1STB A;  3TSS A;  1EZ8 A;  3KLS A;  2SNS A;  3ERO A;  1PTO B;  1STA A;  1GUG A;  3MC0 B;  4QB4 A;  2OT2 A;  1IKM A;  1TII D;  3DMU A;  3E0J A;  2KQ3 A;  2TSS A;  4WOR A;  2R61 A;  4DF7 A;  2RBM A;  2KED A;  2B8G A;  3K5L A;  1EQV A;  1B3A A;  4HSP A;  2EXZ A;  3O13 A;  4CKE A;  2QDB A;  1AP0 A;  3SE0 A;  1EYA A;  4RWS C;  1KLU D;  1SFO B;  1QB5 D;  1PTO D;  2Z1C A;  3Q0A A;  3Q22 A;  2H4O A;  3J81 L;  4IUT A;  1RD9 D;  4ZAI A;  4H7B A;  4OL7 A;  3N52 A;  4RHS A;  4ID6 A;  1FYC A;  1CM9 A;  1CHP D;  1PDQ A;  3DEP A;  3TBI B;  4DAV A;  1SE3 A;  5ELD A;  5T1G A;  5LL6 X;  5CV9 A;  2EY2 A;  4LJZ C;  2CQA A;  4KHZ A;  4L63 B;  3W2D A;  4IAL A;  4QIW B;  1STG A;  1STN A;  3MZ5 A;  1WD1 A;  1DCZ A;  1IHZ A;  2IWH A;  5COY A;  1A3U A;  2I07 B;  4OIK A;  1EYC A;  3X3M A;  1IKL A;  3R8B A;  5DM6 3;  1EY9 A;  1TS5 A;  3GO5 A;  3OSO A;  2R93 B;  5EGT A;  3LX0 A;  4OO1 H;  3UI2 A;  3S2H B;  4LMQ D;  2PPB C;  4C3H G;  2F0M A;  1D5M C;  4F7X A;  1K83 B;  2B2U C;  3J80 E;  1ESF A;  4OHJ A;  1LTG D;  4Q5V A;  1G2T A;  3T56 B;  3X3N A;  3C2P A;  1JWU D;  3VR6 A;  1W6J A;  1A2T A;  2EY1 A;  1O78 A;  3VR5 A;  3IFD A;  4KN7 C;  3GTJ B;  4RCN A;  1B2T A;  2Z8L A;  1S5C D;  2PW5 A;  3OMG A;  3R3O A;  5CV4 A;  1V1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...