1EZ6A

Structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez6A00
2PZUA 1STBA 3OMGA 1F2YA 4K5XA 3C1FA 5CC4A 4LAAA 3QOJA 3RUZA 4F8MA 1EY7A 4B9WA 4K14A 4R8NA 1TR5A 1NUCA 4EQOA 4PMCA 5C3XA 1KDBA 3DHQA 4HTHA 4WORA 2M00A 3SXHA 2EYPA 2PZWA 5IGGA 4ZQ3A 3TP8A 5J39A 1EY0A 4KY5A 1A3VA 5E1FA 2F0KA 5IGCA 4MIUA 1A3UA 4KY6A 1SYGA 2SOBA 5C5LA 3SR1A 1EY4A 3TP7A 2F0MA 1SNOA 2EY6A 1JOOA 1STHA 4DF7A 1EZ6A 4K5VA 5DEHA 1SYDA 3DMUA 1SNMA 1U9RA 4ID6A 4EQPA 2F0DA 3P1HA 2F0GA 1TQOA 2F0WA 2O4XA 3EVQA 4KD3A 3V2TA 3R3OA 3NUCA 4EQNA 4F7XA 5IODA 2PW5A 1EY9A 5KGUA 4KD4A 4PMBA 4YIJA 5EKLA 5CV9A 4N9PA 5IGBA 5I9OA 3U9OA 1TT2A 2EYLA 2F0TA 3SK5A 2F0IA 2RDFA 5J1ZA 1JORA 2QDBA 3HEJA 3S9WA 3MEHA 4RKLA 2EYHA 5CV7A 4H7BA 5ISRA 5C4HA 3MXPA 5HURA 3E5SA 2F0JA 2EXZA 2F0HA 4WRDA 5IIFA 2OF1A 1STNA 4KV6A 5I9PA 4IALA 5IGFA 2EY5A 1EZ8A 1EYAA 2WACA 3HZXA 1KABA 4K6DA 4DU9A 3SK6A 2F0UA 2F0PA 1A3TA 2F3VA 5CV4A 5CGKA 5E3FA 5I6WA 3D8GA 2OEOA 4E6IA 1KDAA 2OXPA 5CV5A 2EY2A 5KRUA 2EYFA 4K8IA 5IGDA 1KDCA 2F0EA 2F0QA 3EROA 1SYBA 1F2ZA 3NQTA 1STYA 4B9XA 4DGZA 2SNMA 5JAVA 2F0NA 4K8JA 4RKBA 5F2DA 3NHHA 1II3A 5C5MA 3BDCA 5CV6A 4G57A 1F2MA 1SNCA 3T16A 5C4ZA 3NXWA 5C3WA 5M9OA 3MHBA 3P75A 5HGTA 2RBMA 4ODGA 4K5WA 1A2TA 1EQVA 5IOCA 2PYKA 1EY5A 2HQEA 5DAUA 5EKKA 2RKSA 3BDLA 4IUNA 1NSNS 3C1EA 1AEXA 4N9TA 4NDXA 4PNYA 5NUCA 4HMJA 3TP5A 1SNDA 3LX0A 3OSOA 3OWFA 1SNPA 5EGTA 5J22A 1SYFA 3ITPA 3QB3A 1A2UA 1JOQA 4QMGA 2KHSA 5CV8A 1STAA 4ZUIA 4HMIA 4K2KA 4ME5A 4J6HA 1EYCA 4QB4A 4QF4A 2EYOA 2EYMA 2F3WA 1ENAA 5KEEA 4ZUJA 4NKLA 4IZ8A 3T13A 4DFAA 4J1MA 1IHZA 1JOKA 2LKVA 4K2LA 4KHVA 3OMCA 3PMFA 3SK8A 1EY8A 1KAAA 1EYDA 2EYJA 2EY1A 2PW7A 2NUCA 4NMZA 5IGEA 2F0LA 3ERQA 5K5PA 1ENCA 4KTAA 3NK9A 4NP5A 4KJOA 4EVOA 5C6AA 3TMEA 3SHLA 4S3SA 3D4DA 5I6YA 1EY6A 4TRDA 2F0FA 3D6CA 4OL7A 2PQEA 1SYEA 5JOBA 5KYLA 3EJIA 4KY7A 1STGA 3MZ5A 2KQ3A 3QOLA 2SNSA 3TP6A 5CR3A 5KYIA 3D4WA 3MVVA 2ENBA 3H6MA 4KJNA 1SNQA 2F0SA 4I65A 2PZTA 1RKNA 3NP8A 2F0VA 3SK4A 3VA5A 1SYCA 2F0OA 5KIXA
chains in the Genus database with same CATH superfamily
4OX9Q 1X65A 3H15A 1WD1A 3HOYG 4RG1A 1IBKL 1OXSC 5IP9H 4L5TA 3J81L 1KDBA 4IN3A 1LACA 4A3JH 1N34L 1GHKA 3FRPB 1A3VA 2L0CA 4HJ9A 2A73B 4XT1B 2XIWA 2VQEQ 2JJQA 1W3SA 3TP7A 2AUJD 4DF7A 1EZ6A 1ZXTA 2B2YC 3MA2B 1N32Q 1XMQQ 1YBYA 3GTPH 4AQYQ 2O5IC 1LT6D 1JB7A 2K5NA 3PV0A 2NB0A 2PMZB 4YIJA 1HTPA 3RN5A 2MFIA 4CHTB 2ICEC 4DR6Q 2QF7A 2ES2A 3A7LA 1H9SA 1H9RA 1IBMQ 5HURA 2JA5G 4JYAL 1DM0B 3Q22A 4HSVA 1M1KC 1O7LA 1HNWL 1TWFB 4XTCS 4C3IH 5I2XA 1YEZA 4DU9A 3M7GA 2JA6G 4QIWE 4B3ML 4YCUA 4DK3C 1VQNA 1SBBB 1P8LA 5CV5A 4DR3Q 4JCVE 1YHAA 3GV6A 1OXVA 1D5MC 3J80L 1EU3A 1WCMG 1HQRD 2B2VA 5M3FB 3J80E 4LF8Q 4FYDA 2NVYB 4OO1H 2WKCA 3WWVA 4J8QA 2N8NA 2A6EC 1EQVA 1LUZA 2UXBQ 2Q8IB 4MZ9A 3OSOA 1SNPA 4DAVA 2IX3A 3WOEA 1I50H 1HA5A 2CH4W 3IKJA 2JA6B 4X65Q 1CUKA 1JOKA 5IP7H 2LS01 4B3TL 4A3FG 1TWFH 1GKHA 1B44D 2EJGC 2YTYA 3TMEA 1BCPF 1TS5A 4GS3A 1YJWA 1Y8OB 2K5QA 2PQEA 1Q90A 3BVGA 3LNNA 3ND9A 1A15A 1LT5D 2SNSA 4OIKA 3NTIA 3UDXA 1Y69U 1EQQA 5KYIA 3NWTA 4JOIA 1WTHA 2RHSB 2FFKB 1A63A 3NP8A 1JICA 2C5CA 3G4SA 1SYCA 1GUGA 2K75A 4AYBE 4GN4B 4CKEA 4JI3L 4HIMA 4RFBA 2HCIA 2FHTA 3G6JB 1HNZQ 2UUAL 1TR5A 1QVFA 4FO2A 3PUYA 2WIIB 2CWAA 4I7AA 1B1ZA 5J39A 2NBFA 3EFXD 3J81j 1DJRD 1CA5A 1CI3M 5IGCA 4C3JB 3U4ZA 3ULLA 3I56A 2KHJA 3T51B 5FKAC 3K7AH 4FVMA 1VQAA 1X54A 3I73A 1D2BA 3V2TA 1EUJA 3KFUA 2PNHA 3H3VI 1K0RA 1UE6A 1G91A 1Z47A 3HOZG 2PO4A 1ONLA 1BOSA 3OW2A 4UPAA 5LMUQ 4CKBA 4A3EG 1QB5D 3IFDA 1BXTA 4DR5L 3NSWA 2NTTA 4L8JA 2G9HD 1RL2A 4DNTB 4XYOA 4K6DA 1C0AA 2EY2A 3OWEB 4BBSG 1PH3A 1S4ZA 4DGZA 1S5ED 4HR7B 3K7UC 5I9PA 1Q86C 4H13C 4DV3L 1X3QA 1B2TA 3MHBA 3HOZB 5ELEA 3D0FA 2E5LL 3U50C 1MKHA 5DAUA 4BBRB 2HIVA 3L7ZC 1GHJA 2UXDQ 2GN5A 3S17B 4ME5A 1PFBA 1SDFA 3G48A 4BY7H 1T5XD 2G5DA 4NMZA 1HJPA 1PDQA 2JN4A 5M3MH 2OCEA 3KK7A 1TVXA 3I7FA 3SHLA 3DM1A 5I6YA 1XJVA 1IBLL 1MSGA 2XSCA 4JW0A 3A8IE 4BWGB 4JBJA 2K5VA 4YWLA 3TP6A 3RNUA 1VF5C 3RR5A 1B3QA 2F0SA 2IJ0A 4IUPA 1Q3LA 1QJOA 2WB1E 4DR2L 1DONA 4BBRG 1Q7YC 4B9WA 2PQAA 1KNEA 3NE5B 3DHQA 3GTOB 3CU7A 1G6PA 2O2LD 2PZWA 3CMEA 2NZOA 1X6OA 5HY6A 1N32L 2F0KA 2OWOA 4PG3A 2Q2IA 1YVCA 2EVBA 3BDOA 1KQSA 3I4NH 1YIJA 1CTMA 4YY3L 4GLVB 3RLNA 3UDFA 2F0DA 3VR4A 4H0LC 4UP9A 2WAQG 5ELCA 3F2DA 1HNXQ 2Y0SB 3I4LA 2C9OA 5LMUL 4GN3B 4CJ1B 1O7YA 2V1CC 5LL6S 1EIYB 2F0JA 2MGSA 5EKIA 1ILPA 3GDEA 5FO9B 2E76C 2R61A 4QUFA 4Y7NH 2UUBL 1UE1A 2NN6I 4O1NA 3T53B 1G6ZA 5E3FA 3HGBA 3HOZH 4JI8L 1KDCA 3DWPA 4A3DH 3CRLC 4B9XA 2VB3X 5JAVA 4CJ0B 1Q12A 4HIDA 1TWHB 5IWAL 2ALYB 4G7ZC 1QVCA 5ELFA 1KL9A 4FF1A 1KHIA 1IL2A 3FEWX 1EYGA 4X64L 4NXNL 2TSSA 4A76A 4PNYA 2VUMH 1OTCA 1Y8NB 1A2UA 1N9WA 2KEDA 3MC0B 3GTQH 1C48A 2CVRA 5KEEA 3FHWA 4ZUJA 2L55A 3F2CA 4K2LA 4BBRH 1TY2A 1PV4A 4IFDG 1SE4A 3C2PA 4Y7NB 3H94A 4EVOA 1KC8C 1MI2A 4JI1Q 2R93H 1XPOA 1V1PB 1YHBA 3HG9A 2Q8RE 2K4KA 4HIKA 1PMRA 1SYEA 3MXNA 2VQFQ 2OT2A 1ET6A 3RD4A 2HDMA 3TEHB 1CKNA 4QQBX 2PZUA 1EQRA 1F9PA 1OXXK 4RGNA 4A3MB 4KHPL 4X62Q 2BA0A 3AYHB 1BO0A 4C3HH 4FDBA 4HTHA 2R7ZB 4ZQ3A 1H95A 3S1MH 1LTID 3CC4A 1VS0A 2HT1A 1IW7D 1I4QA 2ZXPA 5IP9G 2GA4B 2NTSA 3L0OA 1I4PA 3R2IA 1TWHH 4G7HC 1L1OA 5ELOA 2EPBA 1HRJA 5IYDG 2F0TA 1SLJA 1EIFA 2QDBA 3I90A 4X3SA 1PH9A 3I4MG 1KRSA 4LWCA 1GUWA 2K6AA 1SEBD 2F0HA 5DLQE 3KYHC 2OTLA 3QG1A 5IGFA 1DOMA 1KNAA 4PZ7A 1B70B 3SK6A 2F0PA 1NE3A 1HUMA 2AMCB 1FJGL 1N8RC 2OEOA 3MXGA 4DKAC 4LF9L 1LYLA 3FDTA 5L37A 3EBEA 2F0QA 1E1TA 2PNRC 1STYA 3S2HH 4ZAIA 2J0TD 5F2DA 5BN5A 4L5SA 1F2MA 1SMYC 2B2TA 1SXTA 2OQKA 3S1NH 4A3IH 3BDLA 1E1OA 4R1JA 4UAIA 5KNDA 2D5DA 5EGTA 4XDXA 1STAA 1EEFD 1WTWA 1TS2A 1DYQA 1U4LA 4KHVA 4IJHA 4DV6Q 1E2ZA 4LFAQ 3STBD 5D3IB 1PH2A 4L63B 4M1UB 2A6HD 4DN4M 1SSOA 1SFOB 3HRZC 3ULPA 4A3MH 1PYSB 1I6VC 1S5FD 1WTQA 5EAYA 1HHVA 4DUYL 5GROA 1FNVA 2R93B 5C3EB 1Y1VH 4A3KB 1TU2B 1XTCD 1KAWA 3LWUA 1JB3A 1O80A 2KCMA 3RUZA 4A3BB 2A74C 1EU4A 2MNAA 4QCLA 3LWEA 1PZJD 1VQ8A 2N88A 2BE5C 3DUZA 5LL6X 4WORA 3TP8A 5JEAH 1XTDA 2JP1A 3ZYYX 3J81E 4LUZA 4RMFA 3N52A 4JK1C 1SR3A 1Y14B 4DNIA 2R7ZH 2RF4A 4JI1L 1RJTA 1S3OA 2ZTDA 3WDNA 1E0BA 1SNMA 2FINB 2V4DA 4C1NK 1IYUA 1TQOA 1PFNA 1LT3D 4IO9A 2EZVA 1ET9A 5IY0A 4IUTA 4PQXA 4N9PA 1PRTF 4IPHA 1JWUD 2KEEA 3CAMA 2NVXB 1O7ZA 1WFQA 1T9HA 1AW7A 2K33A 3I3CA 4A3EH 1RF2D 3BZKA 2EXZA 1CK1A 1FD7D 1Q8IA 2OF1A 4KHZA 5EPLA 4A3BH 3NBIA 3GD7A 1TY0A 1I4RA 4BXXG 2IHFA 1LTGD 5LMNW 2QKIC 2EYFA 5IYDH 1DZ1A 4A3LH 1H9JA 3H3VH 4FF3A 3FKIH 3CCVA 1HA6A 1K28A 1PH5A 3CRKC 3K81C 1EWCA 5HGTA 2RBMA 4FP5D 3R8BA 2E2HH 1A2TA 3U4VA 4CDFC 3PIO3 3K6OA 1GJXA 2NZ1D 1L1OC 1C7YA 2NN6G 5EJWA 4FNFA 4R4CA 2DY7A 4QF4A 2PQAB 4QB4A 3K58A 3L3OC 2B2WA 2MHVA 1CT1D 1X3GA 3K57A 1XWEA 1EY8A 2EYJA 3KUPA 5IGEA 5JPMC 1PTOD 1DOKA 3ERQA 4RGMA 3I70A 3RZOB 2Y0SE 3E0JA 5GAGC 4Q5VA 3D4DA 1TWAB 1D6EC 1TWGH 2K03A 1QNKA 4KJNA 4RGTA 3MXUA 3SK4A 4CJ2C 3HOUG 1X32A 1NAPA 4APVA 1SFOH 3OMGA 3STBC 2LMCB 3CMAA 1F9RA 1K8MA 1WJJA 2UUBQ 1CKNB 1JMCA 2A19A 4A3KH 1EEID 3UE0A 5JVH3 1G8ZD 5M5YH 4MIUA 2KOLA 2A8VA 5FJ8H 2PI2E 3HOVB 2KCCA 1STHA 3W3AA 1KLGD 1LTSD 1Z6HA 4DV5L 4A3GG 5FO8B 1U9RA 4U68A 4KD3A 3J81c 5IODA 2JEBI 3BU2A 1X3FA 5I9OA 3L9AX 4DV1L 4JI0L 1CQFA 2K5DA 1JORA 1Y1VG 3HOWB 2HHHL 2WKDA 4DV7L 2IX0A 1Y1WB 2R6GA 2VW9A 1B3AA 3HZXA 4GLXA 2QCPX 1VQHA 2K1BA 2F3VA 2Q2HA 3KF6A 1HZ9A 2H4OA 1BNZA 1Q8KA 4B3SQ 5J3BA 2NN6H 1YITA 2I46A 1MBYA 3S17H 4IFDI 3M4OB 2K7VA 1BVSA 2XWBB 2VQFL 1BKBA 1NY4A 1PH8A 1ICFB 1I6HH 1MJCA 3I4NG 2F03A 3PO2G 1PTOC 1MJEA 1IKMA 1I3QB 3RZDH 4DPGA 2FJ2A 4ODGA 3E9HA 2HQEA 5G3LF 1X55A 4GOPC 4K0KQ 4NXNQ 1CKOA 1XMOL 3ITPA 3MFYA 4QMGA 2KHSA 2K50A 4C3JG 1IBML 1FJGQ 4LW1A 3I72A 4J6HA 1EYCA 4K2KA 2M2LA 3S2HB 1SJHD 2JE6I 4J1MA 4EQ5A 3GV3A 2EY1A 1M90C 4HJ7A 2JA8H 1L2FA 3S1NB 1WCMB 1LO5D 1X3EA 2ZJPA 1BUVT 2LY7A 3MZ5A 1WTOA 1YJ9A 3EIVA 3X3NA 4JC0A 2R92G 4A93G 1XMQL 1U5KA 3KLSA 1MGSA 4C3IB 2Q8TA 3QWNA 1TKWB 3GTPB 1PTOF 2QA4A 1STEA 5M5XH 1GO3E 2MPMA 1O7IA 4MHEA 1CA6A 1BBUA 4IJLA 1DD2A 2KECA 2K04A 2MJ8A 5T1IA 4B3TQ 1I4GA 3KF8A 2AKWB 4ALPA 2SOBA 2L11A 2MO0A 3JAMc 3S14B 1K8OA 3A7AB 5IP7G 1VQ6A 4P73A 2NVYH 2R7FA 1SYDA 1WI5A 3T1YQ 1Z9FA 3FPPA 4ID6A 3C3LA 2O4XA 1MD2D 2H1EA 2PW5A 1P16A 1WTRA 5LMNL 1GUSA 1YHQA 3H3VC 3U9OA 3J7ZC 2WP8J 4X3KA 3PGZA 4GNXB 2PPBC 2RDFA 3S9WA 5ISRA 3CCMA 5CV7A 1XNQL 4UP7A 3MXPA 2BE5D 3E6ZX 1PFSA 4MNOA 1VQJA 2MQHA 3ULJA 3CPFA 1Q81C 1XX8A 3J7YW 4CDEC 5G3LD 5HGQA 1FR3A 3CXCA 5C3EG 1AE3A 1VQ7A 4MN3A 2F0UA 1VQMA 1H9SB 5CV4A 4OHJA 3VR2A 5C4JH 1PVOA 4X3UA 1G2TA 4YHHQ 1HPCA 1OXUA 4JI5L 1E7ZA 3EROA 1HFNA 2B2YA 1VQOA 3HOWG 3CP0A 3OTOQ 4KK7A 3CCJA 1ZYRC 2Y0SG 3P75A 3VDYA 3PO3H 2CWPA 1GUNA 4A75A 5IOCA 1RIPA 3GTJH 1K83H 1E3PA 1AEXA 1X3PA 5NUCA 3HFZB 4LF7L 3LX0A 1GUTA 2A68C 2E2JB 4IQZA 5FLXE 4OELB 5BN4A 1E24A 3PUVA 4HMIA 1B9NA 1RCVD 2QDLA 2JQOA 4OO1I 2E2IB 1ENAA 5M5WB 2R92H 3I4MH 1PTOH 2IPKD 1FGBD 3OMCA 2D0OA 1HZAA 1LT4D 4CDDC 1KIXA 2BA1A 3CC7A 4LF4Q 3A55A 3GO5A 1RODA 3W2DA 3S14H 5E4XA 2YYZA 1IKLA 1KD1C 4H44C 3KJOA 1S5DD 1ZKOA 1PLFA 4EGVA 2BH8A 1LTTD 3M3YH 5FLXL 2I5LX 1YNND 1J6QA 4JBMA 2EYPA 3EQLC 4DV5Q 4TKOB 5JEAG 4Q0FA 5BR8Q 3RMHA 2R3ZA 4OXPA 5D3DA 2R92B 2GVBA 5CBAE 4DAYB 1HQMC 2SDFA 5AFWA 4FXDA 3OYYA 3D4RA 1WTPA 2B63H 3NUCA 4KD4A 1H9MA 3HOXH 1YJNA 5CV9A 5DNFA 1NCVA 3C46A 3NBHB 4DR6L 4XQQA 3S1QH 1V9PA 2XGTA 3DLLA 5C4HA 1QOHA 4K6LA 4WRDA 4XT3B 2QGQA 5GQOA 4XXEA 4B3SL 1TS4A 1G2SA 2BOSA 3BVZA 3VR5A 3I2ZA 5M3MB 4OEMB 4LJZC 1ESFA 1KABA 2QW7A 2Z6BA 4J15A 2IL8A 4E6IA 2OXPA 4BA1I 5KRUA 4DV7Q 3PCOB 2GVAA 2WB1B 3HS0C 4K8JA 3KF6B 4X3TA 5C4JB 1NMFA 1VMPA 1IL8A 3EA6A 1Z7TA 1FNWA 1ILQA 2B29A 3KBXA 1PH7A 2NVQB 4A3GB 2PYKA 1PTOB 1HNXL 1BQQT 2C35B 3C1EA 4XQJA 5ELDA 4HMJA 2UXBL 3OWFA 5M3FH 2ZT9C 3SGIA 2K5WA 2FMMA 1JOQA 4JI7Q 4UY8C 2EE1A 1F2LA 3GTJB 4IZ8A 1R9TB 1Y1VB 4N8FA 3GTMB 2ZM6Q 1J8IA 1CFMA 1F77A 4V0BA 1PH6A 4LF4L 2EJMA 1AE2A 4KJOA 1Q46A 3T1HL 3NQIA 3KLRA 2BH2A 4A3FB 1Q1EA 4TQUS 5KYLA 3HOVH 1H9KA 3E9IA 1N36L 3ONAB 3D4WA 3MVVA 3VA5A 3NBHA 2DJFC 1JQYD 5EBCA 5FLXc 1HH2P 1EY7A 1JJGA 3PUZA 1HZBA 1UAPA 4O2DA 1I94Q 4OWTB 4DK6C 2K01A 4JI2L 2AQ2B 2A6HC 1A3UA 3FVQA 2VS1A 4DUZL 4DK0A 5I4DA 4P2CB 3UDIA 5C4XG 3H0GG 1IYVA 4GZYC 4C3IG 4CKCA 3DMUA 5K36H 3EVQA 3W1GA 4BY1H 3R3OA 2R93G 1JCKB 3K7AB 4GKJQ 5EKLA 1NTGA 1I6HB 3CCQA 2EQSA 1EIGA 1I50B 3G7LA 3FKIB 2HUGA 4LFCL 3CCEA 2WAQB 1AZPA 5LMNQ 2UU9Q 3G71A 3GP7A 3TBIB 2JA8G 3KDFA 4PMWA 3A8KE 1EYAA 4AYBB 3NWSA 5H1SE 2Z6KA 3U58A 4N8X1 1Q82C 4POGA 2F4VQ 2L1BA 4JI6L 2RA4A 1SYBA 1HZCA 1J5EL 4PZ6A 2F0NA 2ZTCA 4GN5A 2Q2UA 1II3A 3M85A 1QUQA 5C4ZA 2E2DC 1EWHA 1F9SA 1F9QA 1B4OA 4DR2Q 3PO2H 1VQ9A 1VQFA 3K5MA 1L0YB 4BY7B 1NSNS 1M8AA 4RHRA 2DN8A 5E7NA 1U4PA 4M8AA 4DXGA 1XMOQ 1FNUA 3AMUA 4C3JH 5JJLA 4DV2Q 4DV0Q 2IY5B 2XWJB 4OIJA 4A3FH 3SK8A 1VQ5A 2JEAI 4A3JB 5A35A 4LF5Q 2ZXOA 1G51A 3LGJA 3U9SA 3VYUA 4TSSA 1X9NA 4NP5A 4LUVA 2VB2X 2ID0A 1HR0Q 4FF2A 4LFBQ 4GLAC 2DNCA 2L5TA 1SMYD 3P7JA 4TRDA 3S16B 5JOBA 1IW7C 3GTMH 1WTXA 1KXLA 2PZTA 4U673 2F0VA 3VYSA 3K8AA 4XQNA 3F1ZA 5BR8L 2L4NA 3QOJA 4JBKA 1XPRA 3CQZB 1QG7A 1V43A 1N33Q 3RZOH 1NUCA 2NVTB 3ZJYC 2M00A 1HFGA 3BG3A 2VUMG 3KBGA 4KHPQ 4NPSA 1CKMA 2A5HA 3IFTA 4DV6L 3CD6A 4LMQD 1AFPA 5KNBA 2I0QA 4IFDH 2VL6A 1CM9A 2F0WA 1D1KA 5KGUA 1V8QA 2BCOA 1ZYRD 4LF7Q 3HP3A 3PF4A 4H7BA 2A69D 4DK1A 1MSHA 3E5SA 3GTOH 2KENA 4LK1C 4DV4Q 3TZUA 5C0XG 1I94L 5C0XH 2DUDA 1PRTB 4L6TB 1F2ZA 4BBSH 3S15H 3HKZE 1PXUA 1FVIA 4DR4L 1NR2A 2MUYA 3BDCA 2BDOA 4AQYL 4JI7L 2RHQB 1NBWA 3MXNB 3QO2A 2XTIA 3GTGB 2JA6H 4KN4C 2RKSA 4IUNA 1DGSA 4RAUC 1YNXA 3TP5A 1EFID 4FXGC 2YU9H 1XYIA 4DR1Q 5IT9E 1SE2A 3DXJC 3J80i 3F8TA 1IHZA 3S16H 3VYRA 1PA6A 3AFQA 3IAYA 1ENCA 2I5MX 2UUCQ 3NK9A 1N34Q 4JI6Q 3AB9A 5C6AA 4A3GH 2O5JC 5TSSA 1A0IA 2N55A 3D6CA 4OL7A 3HKZG 1STGA 3RLOA 2X6GA 3SE0A 2RSNA 1JWMD 4LFAL 3AQQA 1IBKQ 3GTKB 2B63B 4I65A 2N3SA 5C44G 2F0OA 1TS3A 2AWOA 4EX5A 1QCBD 4A4IA 1K8AC 3CC2A 3J81i 2NVQH 1CHPD 4K14A 3E0EA 2DGYA 3A0JA 5FK9C 1EY0A 4DV0L 1V1OA 1GXDC 4AIMA 1D5XC 2J7ZA 4BS9A 3SR1A 2HIXA 4IOCA 3NELA 1RTNA 1JOOA 2YTXA 4OGQC 5IYBH 4R4IA 4K5VA 1JR0D 3HKZB 2WV6D 1HR0L 4F8MA 1LTRD 5K36G 3PIOA 3HOUB 1VQKA 2ATWA 2B63G 4DUZQ 5EQ0A 3SVMA 2JA5B 4RWSC 4NB3A 1HNWQ 3GQBA 4RCNA 3GTQB 3HEJA 3UDGA 3S1RB 3BYYB 1CZGA 4KMUC 4C3HB 5IE8A 3BZCA 4DNRB 2A68D 2K28A 4IALA 2CQOA 1J5EQ 4GOPA 3T56B 2B2WC 2XNAC 3H91A 3HOVG 1W6KA 5I6WA 3VYTA 2F3IA 4K8IA 5IGDA 1A62A 1HUNA 3FKIG 2F0EA 1BDOA 3S2DH 3GTLB 1YNJC 2SNMA 4A93H 5CV6A 4MTNA 2AHOB 2B8GA 1NNXA 1ZEQX 3D31A 1E22A 2ICIA 4R4OA 3S15B 1EY5A 3PIP3 2D62A 3TDQA 4AH6A 1D5ZC 3WOFA 3QB3A 1E2WA 4WFN3 4YWKA 2B2UC 2DY8A 1PH4A 4IFDJ 4JI2Q 3JC66 2F0LA 4P71A 2UUCL 4KTAA 1IXRA 2A6ED 1DXMA 1RDPD 2FXQA 2X69A 2KUMA 4X65L 2F0FA 2KCTA 4OWWB 3I4NB 1VQCA 4NXMQ 1I4HA 1DCZA 2XRSD 2AWNA 3TSSA 1FL0A 3MAQA 1VQLA 4LF5L 3Q6SA 2YTVA 2RCNA 2N78A 5ELNA 4ZK9B 5C44B 1LLRD 2IWHA 4P72A 4IOAA 3UI2A 1JC7A 1ML0D 2L15A 1STBA 1F2YA 5IT9L 4XYQA 3CW2C 3HOYH 2Z1CA 4C3HG 4R8NA 1R4PB 2JA7B 3X3MA 2AQ3B 4ABNA 1BCPC 1ICWA 5C3EH 3Q8DA 1A6XA 2TMPA 1L0XB 4IUQA 4B3RQ 3MWYW 2Z0SA 4L5RC 4OONA 2UXCQ 1SYGA 2EY6A 2E75C 4WJ3M 3W1BA 1ENFA 2NVXH 2B2UA 2F0GA 3CQZH 5EBDA 4C2MH 4A93B 4Z9CB 1T5EA 1WYDA 4DR5Q 5C0XI 5IYCG 1XNRQ 1JJCB 1CHQD 5C44H 3T4AC 3MEHA 4RKLA 1PYWD 3ER0A 3F2UA 1G291 1VQIA 5FJ8G 4UP8A 5IIFA 2JA5H 1QNUA 1B9MA 1NMGA 3V96A 2NVTH 3PO3G 3S1RH 2LSSA 2HHHQ 3IL8A 3D8GA 4GKKQ 1K0SA 1UE7A 4KLKA 3J7AV 1X56A 2E5LQ 4JVZA 3S1MB 1D1IA 1M4VA 1XXGA 3H09A 3K0YA 1LTBD 1J9OA 4DV1Q 4JI0Q 4RKBA 3T16A 1PRTC 3NXWA 4NW2A 4BY1G 2K14A 4DR1L 1BR9A 3OOCA 2ZJRA 3A54A 5DM63 5IGBA 5J22A 1SJED 3N6RA 1SYFA 1ESRA 2AUKA 5JJZA 3OPOA 1EOTA 1BBXC 5KNCA 2F3WA 2JA7H 1IZ6A 3QIAA 1UEAB 2JYOA 3F2BA 4DV2L 4A3CG 4DFAA 4LF6Q 4RCOA 1TWGB 3PMFA 2PW7A 4K0KL 4PV1C 2IW3A 3BJUA 4O42A 4DXFA 1JT8A 2HCCA 3Q23A 3OIQA 3K5OA 1NR4A 4DAYA 2IT1A 2MP1A 4QL5A 3Q24A 4HJ8A 1EL0A 1EFWA 3RLFA 3CCLA 4KY7A 3KJPA 5IWAQ 2MO1A 2QEXA 1QVGA 3FPUB 1AP0A 4MTKA 2Z8LA 1SMXA 1TWAH 4UHVA 2CH4A 5D65A 1JWSD 3C1FA 5CC4A 4HJAA 3W5OA 4EQOA 1B7YB 3DWAA 5CYUA 2A1AA 2YU9B 2ASBA 3OW7A 1TXYA 2JA9A 1EOVA 1Q1BA 4KY6A 1UE5A 5DEHA 1RD9D 3ND8A 4DV3Q 3CCUA 3P1HA 2E2HB 2KJXA 4HCSA 1PZID 2Q2TA 5M3FG 4PMBA 4KKUA 2XRQD 3R2TA 3NTHA 3AU7A 5A2QE 1XNRL 5AJ3Q 2CQAA 3GTKH 3BYTB 4UDUC 1DOLA 2B2TC 4IUUA 2F4IA 1QZHA 4YHHL 2CHBD 1STNA 1CSPA 3PO3B 2EY5A 1V1PA 4R4TA 5JJKA 4JV5Q 4FF4A 3OTOL 1A3TA 2NWGA 4XIGS 2KA7A 4LF9Q 4LNQA 2B39A 4ME3A 3JAMi 1S5CD 5FLMG 4F87A 4WJWA 1PHJA 3NQTA 3K80C 2E2IH 4A3IB 1B8AA 1C4QA 3I91A 5C5MA 4DR4Q 4G57A 5C4XH 1K8GA 5C3WA 2OTJA 5IT9c 1WD0A 1XPUA 4JI8Q 1MIUA 5EPJA 1XNQQ 1LV9A 3NEMA 4JG2A 3J7AF 1C9OA 1EIHA 3M4OH 2K52A 2Z4HA 5CGKA 4HSPA 3J7A5 1SNDA 1SN8A 2JA8B 4IPDA 4ZUIA 4GNXA 2RSOA 4L5QA 2LXKA 1YNJD 3AEVA 4A3EB 3TN2A 4LF6L 4NKLA 2CKZB 3MTSA 4CGYB 3A5UA 1IYJB 3PUWA 2XN9C 4Y52H 5K5PA 1VF7A 1LABA 4V190 4HEDA 4GOPB 4DA2A 4A3IG 1W2BA 3T1YL 1UUPA 4RA8A 2X6LA 3KF8B 3B6YA 3EJIA 2CW0D 4A3MG 4DUYQ 3Q0AA 3GTLH 4B08A 3DEPA 2ENBA 3H6MA 1SNQA 1FGUA 1WCMH 1O78A 2XVSA 2EOTA 5FO7B 3CPWA 1U4RA 2N49A 1UEBA 3OIPA 3S24A 1W6JA 4X66L 1I4XA 4JOIC 2A69C 1SRUA 4PMCA 5C3XA 2M9VA 1S5BD 3EN2A 5JVG3 1R9TH 1LTAD 3SEBA 2E8GA 4G4KA 5IGGA 2I5HA 4PZ8A 2H5XA 2SEBD 1BF4A 1QILA 5E1FA 2WB1G 3TS2A 1KTKA 4WJ4A 3H0GH 1EY4A 3V05A 4CDCC 4R4QA 1AZQA 2WFWA 3MFGA 1VCIA 4BA2I 4YY3Q 3CF5A 2HD3A 3KLSX 5M3MG 2F52A 3A56A 5E4WC 3URYA 4GKJL 3J80c 3DEOA 1N36Q 2KHIA 1K9MC 2D2CC 2PCFB 3PQIA 4X64Q 3JAME 1D8LA 1VQGA 2JXMB 3QR8A 1B53A 3FMCA 2IHEA 5ELBA 4B3RL 3E3XA 3KDFB 4C1NI 2B2VC 2VUMB 3M4PA 1K73C 4POFA 2RVLA 2UXCL 3O13A 4KKTA 3TRZA 3A5ZB 1CQVA 5C4XB 1EWIA 3HOXG 4GNXC 2ZM6L 4JI5Q 2RDGA 5GAEC 4NXML 4A3LG 1K3RA 1K83B 2FMCA 2KCNA 1GM5A 5T1GA 3T1HQ 1SNCA 5D14A 4O0AA 4JI4Q 4C2MB 1WTVA 3R93A 4LUOA 5EKKA 2I07B 3VR3A 4X62L 1A8VA 4NDXA 1L0WA 1JE4A 2B3GA 1NJIC 3L2PA 1LTLA 5CV8A 4LFCQ 2HQLA 5C0XJ 2UU9L 2EYMA 4GKKL 3I55A 1GOZA 2P5ZX 3T13A 2CCZA 4IUVA 1VQ4A 3NENA 4YCWA 4TVAB 1ASZA 4IPGA 1GUOA 3K5NA 1UWVA 4S3SA 4JPBW 4YCVA 3A8JE 1B50A 4FXKC 3CCRA 4ZCKA 3M9BA 2KQ3A 1R4QB 2B8FA 4ULLA 4ZKBB 3QJYA 2RQXA 2WAQE 4LF8L 2LFNA 4HIOA 2KVMA 1HXYD 4DR7L 2VNUD 5A2QL 5GAHC 4P74A 5JPNC 3I4OA 4KN7C 1LM0A 4JBWA 2K32A 3D3RA 4BY1B 1GVPA 2LXJA 3I4MB 4HCEA 3P20A 2K5HA 3SXHA 1KLUD 5COYA 2CW0C 2VXWA 3HKSA 2QEJC 3PF5A 3NPPA 1BBWA 4QY7A 4C56C 5C5LA 3HOXB 4JV5L 3UE1A 3D6WA 1YNNC 3MEFA 3VA7A 2L9HA 2VZAA 4JYAQ 2JK8A 4OX9L 1PRTD 3M3YB 3H0GB 1TT2A 4YWMA 1QZGA 3SK5A 2F0IA 5J1ZA 3RN2A 4A3DB 2HDLA 1HTLD 2EYHA 2AQ1B 4A3CH 5M5WH 2IX1A 2PI2A 2K05A 4R9WA 1CZWA 1QWYA 5AJ3L 2WACA 4A3BG 2D0PA 3ERSX 1KDAA 4BXXH 3SDZA 1TWCB 1I3QH 3DWQA 3RZDB 1VQDA 1MHWC 3FP9A 1HR0W 3K0XA 1SAPA 1WVLA 2RCFA 3NHHA 1AH9A 3M4YA 2F4VL 3NTKA 4ZRZA 4LFBL 2DJGC 1BCPB 1YI2A 1V1QA 4ZLTF 4P75A 1K3BC 2F1MA 2E74C 4N9TA 4QUCA 1QUQB 3VR6A 3M4QA 3S2DB 4B3MQ 2NYZD 2EYOA 1JJ2A 5M5XB 1VDZA 2Z6KC 2R7ZG 1C8CA 1TIID 2NUCA 3TQYA 2EJFC 3G6EA 5CORA 3PSIA 3HOYB 4KI0A 1BCPD 1IBLQ 1PYBA 4HJ5A 1E2VA 4JI3Q 3QOLA 5DM73 5CMDA 1HNZL 2UUAQ 3S1QB 3AFPA 2JSOA 1RKNA 4KKSA 1OO9B 3BS1A 1D7QA 4K5XA 1PFMA 3OHXC 1L1OB 4LAAA 1UNSA 2PMZE 4IPCA 5LHY1 2QILA 4F88A 2Z9HA 4G7OC 1YZ6A 2UXDL 2VY3A 5FLMH 4KY5A 2DNEA 4X6AH 4DAMA 4I7ZC 4DV4L 1N33L 2KBNA 1QE6A 4X66Q 4CBVA 2VQEL 5JEAJ 2RDHA 3KLWA 5CBEE 1SNOA 2F0MA 3K5LA 4ZYSA 1EQTA 2ZJQA 3JAML 5GADC 4QIWB 2Z4IA 4AYBG 4EQPA 2WINB 1FYCA 4EQNA 4F7XA 2CFMA 1EY9A 4H02A 1HCZA 2EYLA 5JJIA 3PIPA 2OQ0A 4BBSB 4HN7A 2JA7G 1U4MA 5IYBG 3M7NA 3CKIB 4ZKCB 4RH6A 5EPKA 4RGOS 1PH1A 1TWCH 1RTOA 4KV6A 3PUXA 4OO1G 2ZXRA 1CSQA 1EZ8A 2YV5A 3GTGH 3TS0A 4RHSA 3K59A 1PZKD 1OXTA 3TZDA 5BN3A 1WOCA 5FOBB 3PO2B 4DR3L 1SE3A 5M5YB 4JI4L 4A3DG 1AN8A 3HOUH 2EDGA 3ICEA 1JE5A 2E2JH 2ZTEA 1KRTA 4QGUA 5M9OA 4K5WA 1RHPA 2NZHA 4A3KG 1VQBA 1S72A 4DAPA 4ILWA 1SE8A 1U0LA 2J4XA 3TREA 4BY7G 4HAEA 3HOWH 2EIFA 3KOJA 3IRBA 2EXDA 2LKVA 1KAAA 1Y1WH 1EYDA 3CCSA 1GD7A 4R8IA 1Y1WG 3DM3A 2R7DA 2L12A 4IURA 2BDNA 1Y8PB 4DR7Q 1ASYA 1EY6A 4A3JG 1I5FA 3CHBD 5IYCH 5CR3A 2D9UA 5I2YA 1VMCA 4OWXB 2G9DA 1SROA 3BZDB 1VQEA 3I8ZA 1S40A 3BVMA 3A74A 5KIXA 4QJFA 1VQPA
chains in the Genus database with same CATH topology
1WD1A 1OXSC 3J81L 1KDBA 4IN3A 1LACA 1GHKA 3FRPB 1A3VA 2L0CA 2A73B 4XT1B 2XIWA 3TP7A 2AUJD 4DF7A 1EZ6A 1ZXTA 2B2YC 3MA2B 2O5IC 1LT6D 3PV0A 2NB0A 2PMZB 4YIJA 1HTPA 4CHTB 2ICEC 2QF7A 3A7LA 1H9SA 1H9RA 5HURA 1DM0B 3Q22A 4HSVA 1O7LA 1TWFB 4XTCS 5I2XA 4DU9A 3M7GA 1SBBB 5CV5A 3GV6A 1OXVA 1D5MC 3J80L 1EU3A 1HQRD 2B2VA 5M3FB 3J80E 4FYDA 2NVYB 4OO1H 2WKCA 4J8QA 2A6EC 1EQVA 2Q8IB 3OSOA 1SNPA 4DAVA 2IX3A 3WOEA 1HA5A 3IKJA 2JA6B 1JOKA 2LS01 1B44D 2EJGC 3TMEA 1BCPF 1TS5A 1Y8OB 2K5QA 2PQEA 1Q90A 3BVGA 3LNNA 3ND9A 1A15A 1LT5D 2SNSA 4OIKA 3NTIA 1Y69U 5KYIA 3NWTA 2FFKB 3NP8A 1JICA 2C5CA 1SYCA 1GUGA 4CKEA 4RFBA 2HCIA 2FHTA 3G6JB 1TR5A 4FO2A 3PUYA 2WIIB 1B1ZA 5J39A 2NBFA 3EFXD 1DJRD 1CA5A 1CI3M 5IGCA 4C3JB 3T51B 5FKAC 4FVMA 3I73A 1D2BA 3V2TA 1G91A 1Z47A 2PO4A 1ONLA 1BOSA 4CKBA 1QB5D 3IFDA 1BXTA 3NSWA 2NTTA 4L8JA 2G9HD 4DNTB 4XYOA 4K6DA 2EY2A 3OWEB 1S4ZA 4DGZA 1S5ED 4HR7B 5I9PA 4H13C 1X3QA 1B2TA 3MHBA 3HOZB 5ELEA 5DAUA 4BBRB 3L7ZC 1GHJA 3S17B 4ME5A 1PFBA 1SDFA 1T5XD 4NMZA 1PDQA 3KK7A 1TVXA 3SHLA 3DM1A 5I6YA 1MSGA 2XSCA 3A8IE 4BWGB 3TP6A 1VF5C 2F0SA 2IJ0A 4IUPA 1Q3LA 1QJOA 1DONA 4B9WA 1KNEA 3NE5B 3DHQA 3GTOB 3CU7A 2O2LD 2PZWA 2F0KA 2EVBA 3BDOA 1CTMA 2F0DA 3VR4A 4H0LC 5ELCA 2Y0SB 3I4LA 2C9OA 4CJ1B 1O7YA 5LL6S 1ILPA 2F0JA 2MGSA 5EKIA 5FO9B 2E76C 2R61A 4QUFA 2NN6I 4O1NA 3T53B 1G6ZA 5E3FA 3HGBA 1KDCA 3DWPA 3CRLC 4B9XA 2VB3X 5JAVA 4CJ0B 1Q12A 1TWHB 4G7ZC 5ELFA 4FF1A 3FEWX 2TSSA 4PNYA 1Y8NB 1A2UA 2KEDA 3MC0B 1C48A 2CVRA 5KEEA 4ZUJA 2L55A 4K2LA 1TY2A 4IFDG 1SE4A 3C2PA 4Y7NB 3H94A 4EVOA 1MI2A 1V1PB 3HG9A 2Q8RE 1PMRA 1SYEA 3MXNA 2OT2A 1ET6A 3RD4A 2HDMA 2PZUA 4A3MB 1F9PA 1OXXK 4RGNA 2BA0A 1BO0A 4HTHA 2R7ZB 4ZQ3A 1LTID 1IW7D 1I4QA 2ZXPA 2GA4B 2NTSA 1I4PA 3R2IA 4G7HC 2EPBA 1HRJA 2F0TA 2QDBA 3I90A 4X3SA 1GUWA 2K6AA 1SEBD 2F0HA 3QG1A 5IGFA 1DOMA 1KNAA 3SK6A 2F0PA 1HUMA 2OEOA 3MXGA 3FDTA 2F0QA 2PNRC 1STYA 4ZAIA 2J0TD 5F2DA 5BN5A 1F2MA 1SMYC 2B2TA 1SXTA 3BDLA 5KNDA 4UAIA 2D5DA 5EGTA 4XDXA 1STAA 1EEFD 1WTWA 1TS2A 1DYQA 1U4LA 4KHVA 1E2ZA 5D3IB 4L63B 4M1UB 2A6HD 4DN4M 1SSOA 1SFOB 3HRZC 1I6VC 1S5FD 1WTQA 1HHVA 1FNVA 2R93B 5C3EB 4A3KB 1TU2B 1XTCD 3LWUA 1JB3A 1O80A 3RUZA 4A3BB 2A74C 1EU4A 4QCLA 3LWEA 1PZJD 2N88A 2BE5C 3DUZA 5LL6X 4WORA 3TP8A 5JEAH 2JP1A 3ZYYX 3J81E 3N52A 4JK1C 1RJTA 3WDNA 1E0BA 1SNMA 2FINB 2V4DA 4C1NK 1IYUA 1TQOA 1PFNA 1LT3D 2EZVA 1ET9A 4IUTA 4PQXA 4N9PA 1PRTF 1JWUD 2KEEA 2NVXB 1O7ZA 1AW7A 2K33A 3I3CA 1RF2D 2EXZA 1CK1A 1FD7D 1Q8IA 2OF1A 4KHZA 5EPLA 3NBIA 3GD7A 1TY0A 1I4RA 1LTGD 2QKIC 2EYFA 1DZ1A 1H9JA 4FF3A 1HA6A 3CRKC 1EWCA 5HGTA 2RBMA 4FP5D 3R8BA 1A2TA 3PIO3 3K6OA 1GJXA 2NZ1D 2NN6G 5EJWA 4FNFA 2DY7A 4QF4A 4QB4A 3K58A 3L3OC 2B2WA 2MHVA 1CT1D 3K57A 1XWEA 1EY8A 2EYJA 3KUPA 5IGEA 5JPMC 1DOKA 1PTOD 3ERQA 4RGMA 3I70A 3RZOB 3E0JA 4Q5VA 3D4DA 1TWAB 1D6EC 2K03A 1QNKA 4KJNA 4RGTA 3MXUA 3SK4A 4CJ2C 1X32A 1NAPA 3OMGA 2LMCB 1F9RA 1K8MA 1EEID 5JVH3 1G8ZD 4MIUA 2KOLA 3HOVB 2KCCA 1STHA 3W3AA 1KLGD 1LTSD 1Z6HA 5FO8B 1U9RA 4U68A 4KD3A 5IODA 2JEBI 5I9OA 3L9AX 1CQFA 2K5DA 1JORA 3HOWB 2WKDA 2IX0A 1Y1WB 2R6GA 1B3AA 3HZXA 2QCPX 2K1BA 2F3VA 2H4OA 1BNZA 2NN6H 2I46A 1MBYA 4IFDI 3M4OB 2K7VA 2XWBB 2F03A 1PTOC 1IKMA 1I3QB 2FJ2A 4ODGA 2HQEA 5G3LF 3ITPA 3MFYA 4QMGA 2KHSA 4C3JG 4K2KA 3I72A 4J6HA 1EYCA 2M2LA 3S2HB 1SJHD 2JE6I 4J1MA 3GV3A 2EY1A 3S1NB 1WCMB 1LO5D 1BUVT 2LY7A 3MZ5A 1WTOA 3X3NA 3KLSA 1MGSA 4C3IB 2Q8TA 3QWNA 1TKWB 3GTPB 1PTOF 1STEA 2MPMA 1CA6A 4MHEA 1DD2A 2KECA 2K04A 2MJ8A 5T1IA 1I4GA 3KF8A 2SOBA 2L11A 3S14B 1K8OA 3A7AB 1SYDA 4ID6A 3FPPA 3C3LA 2O4XA 1MD2D 2H1EA 2PW5A 1WTRA 1GUSA 3H3VC 3U9OA 2WP8J 4X3KA 2PPBC 2RDFA 3S9WA 5ISRA 5CV7A 3MXPA 2BE5D 3E6ZX 1XX8A 3J7YW 5G3LD 1FR3A 4MN3A 2F0UA 1H9SB 5CV4A 4OHJA 3VR2A 4X3UA 1G2TA 1HPCA 1OXUA 3EROA 1HFNA 2B2YA 4KK7A 1ZYRC 3P75A 1GUNA 5IOCA 1AEXA 1X3PA 5NUCA 3LX0A 1GUTA 2A68C 2E2JB 4IQZA 5FLXE 5BN4A 3PUVA 4HMIA 1B9NA 1RCVD 2E2IB 4OO1I 1ENAA 5M5WB 1PTOH 2IPKD 1FGBD 3OMCA 1LT4D 2BA1A 3A55A 3GO5A 1RODA 3W2DA 5E4XA 2YYZA 1IKLA 4H44C 1S5DD 1ZKOA 1PLFA 4EGVA 1LTTD 5FLXL 1YNND 2EYPA 3EQLC 4TKOB 5JEAG 4Q0FA 3RMHA 2R3ZA 5D3DA 2R92B 5CBAE 1HQMC 2SDFA 5AFWA 4FXDA 3D4RA 1WTPA 3NUCA 4KD4A 1H9MA 5CV9A 5DNFA 1NCVA 3C46A 4XQQA 5C4HA 1QOHA 4K6LA 4WRDA 4XT3B 4XXEA 1TS4A 1G2SA 2BOSA 3BVZA 3VR5A 5M3MB 4LJZC 1ESFA 1KABA 2IL8A 4E6IA 2OXPA 4BA1I 5KRUA 2WB1B 3HS0C 4K8JA 4X3TA 5C4JB 1VMPA 1IL8A 3EA6A 1Z7TA 1FNWA 1ILQA 3KBXA 2NVQB 4A3GB 2PYKA 1PTOB 1BQQT 3C1EA 4XQJA 5ELDA 4HMJA 3OWFA 2ZT9C 2K5WA 2FMMA 1JOQA 2EE1A 1F2LA 3GTJB 4IZ8A 1R9TB 1Y1VB 3GTMB 1J8IA 1CFMA 1F77A 4V0BA 2EJMA 4KJOA 3NQIA 3KLRA 4A3FB 1Q1EA 4TQUS 5KYLA 1H9KA 3ONAB 3D4WA 3MVVA 3VA5A 3NBHA 1JQYD 5EBCA 1EY7A 3PUZA 1UAPA 2K01A 2AQ2B 2A6HC 1A3UA 3FVQA 4DK0A 5I4DA 4P2CB 1IYVA 4GZYC 4C3IG 4CKCA 3DMUA 5K36H 3EVQA 3R3OA 1JCKB 3K7AB 5EKLA 1I6HB 1EIGA 1I50B 3G7LA 3FKIB 2HUGA 2WAQB 1AZPA 3GP7A 3TBIB 4PMWA 3A8KE 1EYAA 4AYBB 3NWSA 2L1BA 2RA4A 1SYBA 2F0NA 1II3A 3M85A 5C4ZA 2E2DC 1EWHA 1F9SA 1F9QA 1B4OA 3K5MA 1L0YB 4BY7B 1NSNS 1M8AA 4RHRA 2DN8A 1U4PA 4M8AA 4DXGA 1FNUA 3AMUA 2XWJB 4OIJA 3SK8A 2JEAI 4A3JB 5A35A 2ZXOA 3U9SA 3VYUA 4TSSA 4NP5A 2VB2X 2ID0A 4FF2A 2DNCA 2L5TA 1SMYD 3P7JA 4TRDA 3S16B 5JOBA 1IW7C 1WTXA 2PZTA 4U673 2F0VA 3VYSA 4XQNA 2L4NA 3QOJA 3CQZB 1QG7A 1V43A 1NUCA 2NVTB 2M00A 1HFGA 3BG3A 3KBGA 2A5HA 3IFTA 4LMQD 1AFPA 5KNBA 4IFDH 1CM9A 2F0WA 1D1KA 5KGUA 1V8QA 2BCOA 1ZYRD 3HP3A 4H7BA 2A69D 4DK1A 1MSHA 3E5SA 4LK1C 3TZUA 5C0XG 5C0XH 1PRTB 4L6TB 1F2ZA 1PXUA 1NR2A 2MUYA 3BDCA 2BDOA 3GTGB 3QO2A 4KN4C 2RKSA 4IUNA 4RAUC 3TP5A 1EFID 4FXGC 1XYIA 5IT9E 1SE2A 3DXJC 1IHZA 3VYRA 3IAYA 1ENCA 3NK9A 3AB9A 5C6AA 2O5JC 5TSSA 2N55A 3D6CA 4OL7A 1STGA 3SE0A 2X6GA 2RSNA 1JWMD 3GTKB 2B63B 4I65A 2F0OA 1TS3A 2AWOA 1QCBD 1CHPD 4K14A 5FK9C 1EY0A 1V1OA 1GXDC 1D5XC 2J7ZA 4BS9A 3SR1A 4OGQC 1RTNA 1JOOA 4K5VA 1JR0D 3HKZB 2WV6D 4F8MA 1LTRD 5K36G 3HOUB 5EQ0A 3SVMA 2JA5B 4RWSC 3GQBA 4RCNA 3GTQB 3HEJA 3S1RB 3BYYB 1CZGA 4KMUC 4C3HB 4DNRB 2A68D 2K28A 4IALA 3T56B 2B2WC 2XNAC 3H91A 1W6KA 5I6WA 3VYTA 4K8IA 5IGDA 1HUNA 2F0EA 1BDOA 3GTLB 1YNJC 2SNMA 5CV6A 2B8GA 1ZEQX 3D31A 2ICIA 3S15B 1EY5A 3PIP3 2D62A 3TDQA 1D5ZC 3WOFA 3QB3A 1E2WA 4WFN3 2B2UC 2DY8A 4IFDJ 2F0LA 4KTAA 2A6ED 1DXMA 1RDPD 2X69A 2KUMA 3I4NB 2F0FA 1I4HA 1DCZA 2XRSD 2AWNA 3TSSA 3MAQA 3Q6SA 4ZK9B 5C44B 1LLRD 2IWHA 3UI2A 1JC7A 1ML0D 1STBA 1F2YA 5IT9L 4XYQA 2Z1CA 4C3HG 4R8NA 1R4PB 2JA7B 3X3MA 2AQ3B 4ABNA 1BCPC 1ICWA 1A6XA 2TMPA 1L0XB 4IUQA 3MWYW 1SYGA 2EY6A 2E75C 1ENFA 2B2UA 2F0GA 5EBDA 4A93B 4Z9CB 1T5EA 5C0XI 1CHQD 3T4AC 3MEHA 4RKLA 1PYWD 3F2UA 1G291 5IIFA 1QNUA 1B9MA 3V96A 3IL8A 3D8GA 3J7AV 3S1MB 1D1IA 1M4VA 1XXGA 3H09A 3K0YA 1LTBD 1J9OA 4RKBA 3T16A 1PRTC 3NXWA 4NW2A 1BR9A 3OOCA 3A54A 5DM63 5IGBA 5J22A 1SJED 3N6RA 1SYFA 1ESRA 2AUKA 5JJZA 3OPOA 1EOTA 1BBXC 5KNCA 2F3WA 3QIAA 1UEAB 2JYOA 4DFAA 4RCOA 1TWGB 3PMFA 2PW7A 4PV1C 2IW3A 4DXFA 4O42A 2HCCA 3Q23A 3OIQA 3K5OA 1NR4A 4DAYA 2IT1A 2MP1A 3Q24A 1EL0A 3RLFA 4KY7A 3FPUB 1AP0A 2Z8LA 5D65A 1JWSD 3C1FA 5CC4A 4EQOA 3DWAA 5CYUA 2YU9B 3OW7A 1Q1BA 4KY6A 5DEHA 1RD9D 3ND8A 3P1HA 2E2HB 2KJXA 4HCSA 1PZID 4PMBA 4KKUA 2XRQD 3R2TA 3NTHA 3AU7A 5A2QE 2CQAA 3BYTB 4UDUC 1DOLA 2B2TC 4IUUA 2F4IA 2CHBD 1STNA 3PO3B 2EY5A 1V1PA 4FF4A 1A3TA 2NWGA 4XIGS 2KA7A 2B39A 1S5CD 4F87A 4WJWA 3NQTA 4A3IB 1C4QA 3I91A 5C5MA 4G57A 5C3WA 1WD0A 5EPJA 1LV9A 3J7AF 1EIHA 2Z4HA 5CGKA 4HSPA 1SNDA 2JA8B 4ZUIA 2RSOA 1YNJD 4A3EB 3TN2A 4NKLA 3MTSA 4CGYB 3PUWA 2XN9C 5K5PA 1VF7A 1LABA 4V190 4HEDA 4DA2A 1UUPA 4RA8A 2X6LA 3EJIA 2CW0D 3Q0AA 4B08A 3DEPA 2ENBA 3H6MA 1SNQA 1O78A 2XVSA 2EOTA 5FO7B 1U4RA 3OIPA 1W6JA 1I4XA 2A69C 4PMCA 5C3XA 2M9VA 1S5BD 5JVG3 1LTAD 3SEBA 4G4KA 5IGGA 2SEBD 1BF4A 1QILA 5E1FA 1KTKA 1EY4A 3V05A 1AZQA 3MFGA 1VCIA 4BA2I 3KLSX 3A56A 5E4WC 3URYA 3DEOA 2D2CC 2PCFB 3JAME 2JXMB 3FMCA 1B53A 5ELBA 4C1NI 2B2VC 2VUMB 2RVLA 3O13A 4KKTA 1CQVA 5C4XB 2RDGA 1K83B 2FMCA 2KCNA 5T1GA 1SNCA 5D14A 4C2MB 1WTVA 3R93A 3VR3A 5EKKA 2I07B 4NDXA 1JE4A 5CV8A 5C0XJ 2EYMA 1GOZA 3T13A 4IUVA 1GUOA 3K5NA 4S3SA 3A8JE 1B50A 4FXKC 2KQ3A 1R4QB 2B8FA 4ULLA 4ZKBB 3QJYA 2RQXA 2LFNA 2KVMA 1HXYD 2VNUD 5A2QL 5JPNC 4KN7C 2K32A 4JBWA 3D3RA 4BY1B 3I4MB 4HCEA 3P20A 3SXHA 1KLUD 5COYA 2CW0C 2VXWA 2QEJC 3NPPA 4C56C 5C5LA 3HOXB 3D6WA 1YNNC 3VA7A 2L9HA 1PRTD 3M3YB 3H0GB 1TT2A 3SK5A 2F0IA 5J1ZA 4A3DB 2HDLA 1HTLD 2EYHA 2AQ1B 2IX1A 2K05A 4R9WA 1CZWA 1QWYA 2WACA 1KDAA 3SDZA 1TWCB 3DWQA 3RZDB 1SAPA 1WVLA 3NHHA 3M4YA 3NTKA 4ZRZA 1BCPB 4ZLTF 2F1MA 2E74C 4N9TA 4QUCA 3VR6A 3S2DB 2NYZD 2EYOA 5M5XB 1VDZA 1C8CA 1TIID 2NUCA 2EJFC 5CORA 3HOYB 4KI0A 1BCPD 1E2VA 3QOLA 5DM73 5CMDA 3S1QB 2JSOA 1RKNA 4KKSA 1OO9B 3BS1A 4K5XA 1PFMA 3OHXC 4LAAA 1UNSA 5LHY1 2QILA 4F88A 4G7OC 4KY5A 2DNEA 4I7ZC 1QE6A 4CBVA 5JEAJ 2RDHA 5CBEE 1SNOA 2F0MA 3K5LA 4ZYSA 1EQTA 3JAML 4QIWB 2Z4IA 4EQPA 2WINB 1FYCA 4EQNA 4F7XA 1EY9A 1HCZA 2EYLA 4BBSB 4HN7A 1U4MA 3M7NA 3CKIB 4ZKCB 4RH6A 5EPKA 4RGOS 1RTOA 4KV6A 3PUXA 4OO1G 2ZXRA 1EZ8A 4RHSA 3K59A 1PZKD 1OXTA 3TZDA 5BN3A 5FOBB 3PO2B 1SE3A 5M5YB 1AN8A 2EDGA 5M9OA 4K5WA 1RHPA 4DAPA 4ILWA 2J4XA 4HAEA 2LKVA 1KAAA 1EYDA 4R8IA 2L12A 4IURA 2BDNA 1Y8PB 1EY6A 3CHBD 5CR3A 2D9UA 5I2YA 1VMCA 2G9DA 3BZDB 3I8ZA 3BVMA 5KIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZU A;  1STB A;  3OMG A;  1F2Y A;  4K5X A;  3C1F A;  5CC4 A;  4LAA A;  3QOJ A;  3RUZ A;  4F8M A;  1EY7 A;  4B9W A;  4K14 A;  4R8N A;  1TR5 A;  1NUC A;  4EQO A;  4PMC A;  5C3X A;  1KDB A;  3DHQ A;  4HTH A;  4WOR A;  2M00 A;  3SXH A;  2EYP A;  2PZW A;  5IGG A;  4ZQ3 A;  3TP8 A;  5J39 A;  1EY0 A;  4KY5 A;  1A3V A;  5E1F A;  2F0K A;  5IGC A;  4MIU A;  1A3U A;  4KY6 A;  1SYG A;  2SOB A;  5C5L A;  3SR1 A;  1EY4 A;  3TP7 A;  2F0M A;  1SNO A;  2EY6 A;  1JOO A;  1STH A;  4DF7 A;  1EZ6 A;  4K5V A;  5DEH A;  1SYD A;  3DMU A;  1SNM A;  1U9R A;  4ID6 A;  4EQP A;  2F0D A;  3P1H A;  2F0G A;  1TQO A;  2F0W A;  2O4X A;  3EVQ A;  4KD3 A;  3V2T A;  3R3O A;  3NUC A;  4EQN A;  4F7X A;  5IOD A;  2PW5 A;  1EY9 A;  5KGU A;  4KD4 A;  4PMB A;  4YIJ A;  5EKL A;  5CV9 A;  4N9P A;  5IGB A;  5I9O A;  3U9O A;  1TT2 A;  2EYL A;  2F0T A;  3SK5 A;  2F0I A;  2RDF A;  5J1Z A;  1JOR A;  2QDB A;  3HEJ A;  3S9W A;  3MEH A;  4RKL A;  2EYH A;  5CV7 A;  4H7B A;  5ISR A;  5C4H A;  3MXP A;  5HUR A;  3E5S A;  2F0J A;  2EXZ A;  2F0H A;  4WRD A;  5IIF A;  2OF1 A;  1STN A;  4KV6 A;  5I9P A;  4IAL A;  5IGF A;  2EY5 A;  1EZ8 A;  1EYA A;  2WAC A;  3HZX A;  1KAB A;  4K6D A;  4DU9 A;  3SK6 A;  2F0U A;  2F0P A;  1A3T A;  2F3V A;  5CV4 A;  5CGK A;  5E3F A;  5I6W A;  3D8G A;  2OEO A;  4E6I A;  1KDA A;  2OXP A;  5CV5 A;  2EY2 A;  5KRU A;  2EYF A;  4K8I A;  5IGD A;  1KDC A;  2F0E A;  2F0Q A;  3ERO A;  1SYB A;  1F2Z A;  3NQT A;  1STY A;  4B9X A;  4DGZ A;  2SNM A;  5JAV A;  2F0N A;  4K8J A;  4RKB A;  5F2D A;  3NHH A;  1II3 A;  5C5M A;  3BDC A;  5CV6 A;  4G57 A;  1F2M A;  1SNC A;  3T16 A;  5C4Z A;  3NXW A;  5C3W A;  5M9O A;  3MHB A;  3P75 A;  5HGT A;  2RBM A;  4ODG A;  4K5W A;  1A2T A;  1EQV A;  5IOC A;  2PYK A;  1EY5 A;  2HQE A;  5DAU A;  5EKK A;  2RKS A;  3BDL A;  4IUN A;  1NSN S;  3C1E A;  1AEX A;  4N9T A;  4NDX A;  4PNY A;  5NUC A;  4HMJ A;  3TP5 A;  1SND A;  3LX0 A;  3OSO A;  3OWF A;  1SNP A;  5EGT A;  5J22 A;  1SYF A;  3ITP A;  3QB3 A;  1A2U A;  1JOQ A;  4QMG A;  2KHS A;  5CV8 A;  1STA A;  4ZUI A;  4HMI A;  4K2K A;  4ME5 A;  4J6H A;  1EYC A;  4QB4 A;  4QF4 A;  2EYO A;  2EYM A;  2F3W A;  1ENA A;  5KEE A;  4ZUJ A;  4NKL A;  4IZ8 A;  3T13 A;  4DFA A;  4J1M A;  1IHZ A;  1JOK A;  2LKV A;  4K2L A;  4KHV A;  3OMC A;  3PMF A;  3SK8 A;  1EY8 A;  1KAA A;  1EYD A;  2EYJ A;  2EY1 A;  2PW7 A;  2NUC A;  4NMZ A;  5IGE A;  2F0L A;  3ERQ A;  5K5P A;  1ENC A;  4KTA A;  3NK9 A;  4NP5 A;  4KJO A;  4EVO A;  5C6A A;  3TME A;  3SHL A;  4S3S A;  3D4D A;  5I6Y A;  1EY6 A;  4TRD A;  2F0F A;  3D6C A;  4OL7 A;  2PQE A;  1SYE A;  5JOB A;  5KYL A;  3EJI A;  4KY7 A;  1STG A;  3MZ5 A;  2KQ3 A;  3QOL A;  2SNS A;  3TP6 A;  5CR3 A;  5KYI A;  3D4W A;  3MVV A;  2ENB A;  3H6M A;  4KJN A;  1SNQ A;  2F0S A;  4I65 A;  2PZT A;  1RKN A;  3NP8 A;  2F0V A;  3SK4 A;  3VA5 A;  1SYC A;  2F0O A;  5KIX A; 
#chains in the Genus database with same CATH topology
 4OX9 Q;  1X65 A;  3H15 A;  1WD1 A;  3HOY G;  4RG1 A;  1IBK L;  1OXS C;  5IP9 H;  4L5T A;  3J81 L;  1KDB A;  4IN3 A;  1LAC A;  4A3J H;  1N34 L;  1GHK A;  3FRP B;  1A3V A;  2L0C A;  4HJ9 A;  2A73 B;  4XT1 B;  2XIW A;  2VQE Q;  2JJQ A;  1W3S A;  3TP7 A;  2AUJ D;  4DF7 A;  1EZ6 A;  1ZXT A;  2B2Y C;  3MA2 B;  1N32 Q;  1XMQ Q;  1YBY A;  3GTP H;  4AQY Q;  2O5I C;  1LT6 D;  1JB7 A;  2K5N A;  3PV0 A;  2NB0 A;  2PMZ B;  4YIJ A;  1HTP A;  3RN5 A;  2MFI A;  4CHT B;  2ICE C;  4DR6 Q;  2QF7 A;  2ES2 A;  3A7L A;  1H9S A;  1H9R A;  1IBM Q;  5HUR A;  2JA5 G;  4JYA L;  1DM0 B;  3Q22 A;  4HSV A;  1M1K C;  1O7L A;  1HNW L;  1TWF B;  4XTC S;  4C3I H;  5I2X A;  1YEZ A;  4DU9 A;  3M7G A;  2JA6 G;  4QIW E;  4B3M L;  4YCU A;  4DK3 C;  1VQN A;  1SBB B;  1P8L A;  5CV5 A;  4DR3 Q;  4JCV E;  1YHA A;  3GV6 A;  1OXV A;  1D5M C;  3J80 L;  1EU3 A;  1WCM G;  1HQR D;  2B2V A;  5M3F B;  3J80 E;  4LF8 Q;  4FYD A;  2NVY B;  4OO1 H;  2WKC A;  3WWV A;  4J8Q A;  2N8N A;  2A6E C;  1EQV A;  1LUZ A;  2UXB Q;  2Q8I B;  4MZ9 A;  3OSO A;  1SNP A;  4DAV A;  2IX3 A;  3WOE A;  1I50 H;  1HA5 A;  2CH4 W;  3IKJ A;  2JA6 B;  4X65 Q;  1CUK A;  1JOK A;  5IP7 H;  2LS0 1;  4B3T L;  4A3F G;  1TWF H;  1GKH A;  1B44 D;  2EJG C;  2YTY A;  3TME A;  1BCP F;  1TS5 A;  4GS3 A;  1YJW A;  1Y8O B;  2K5Q A;  2PQE A;  1Q90 A;  3BVG A;  3LNN A;  3ND9 A;  1A15 A;  1LT5 D;  2SNS A;  4OIK A;  3NTI A;  3UDX A;  1Y69 U;  1EQQ A;  5KYI A;  3NWT A;  4JOI A;  1WTH A;  2RHS B;  2FFK B;  1A63 A;  3NP8 A;  1JIC A;  2C5C A;  3G4S A;  1SYC A;  1GUG A;  2K75 A;  4AYB E;  4GN4 B;  4CKE A;  4JI3 L;  4HIM A;  4RFB A;  2HCI A;  2FHT A;  3G6J B;  1HNZ Q;  2UUA L;  1TR5 A;  1QVF A;  4FO2 A;  3PUY A;  2WII B;  2CWA A;  4I7A A;  1B1Z A;  5J39 A;  2NBF A;  3EFX D;  3J81 j;  1DJR D;  1CA5 A;  1CI3 M;  5IGC A;  4C3J B;  3U4Z A;  3ULL A;  3I56 A;  2KHJ A;  3T51 B;  5FKA C;  3K7A H;  4FVM A;  1VQA A;  1X54 A;  3I73 A;  1D2B A;  3V2T A;  1EUJ A;  3KFU A;  2PNH A;  3H3V I;  1K0R A;  1UE6 A;  1G91 A;  1Z47 A;  3HOZ G;  2PO4 A;  1ONL A;  1BOS A;  3OW2 A;  4UPA A;  5LMU Q;  4CKB A;  4A3E G;  1QB5 D;  3IFD A;  1BXT A;  4DR5 L;  3NSW A;  2NTT A;  4L8J A;  2G9H D;  1RL2 A;  4DNT B;  4XYO A;  4K6D A;  1C0A A;  2EY2 A;  3OWE B;  4BBS G;  1PH3 A;  1S4Z A;  4DGZ A;  1S5E D;  4HR7 B;  3K7U C;  5I9P A;  1Q86 C;  4H13 C;  4DV3 L;  1X3Q A;  1B2T A;  3MHB A;  3HOZ B;  5ELE A;  3D0F A;  2E5L L;  3U50 C;  1MKH A;  5DAU A;  4BBR B;  2HIV A;  3L7Z C;  1GHJ A;  2UXD Q;  2GN5 A;  3S17 B;  4ME5 A;  1PFB A;  1SDF A;  3G48 A;  4BY7 H;  1T5X D;  2G5D A;  4NMZ A;  1HJP A;  1PDQ A;  2JN4 A;  5M3M H;  2OCE A;  3KK7 A;  1TVX A;  3I7F A;  3SHL A;  3DM1 A;  5I6Y A;  1XJV A;  1IBL L;  1MSG A;  2XSC A;  4JW0 A;  3A8I E;  4BWG B;  4JBJ A;  2K5V A;  4YWL A;  3TP6 A;  3RNU A;  1VF5 C;  3RR5 A;  1B3Q A;  2F0S A;  2IJ0 A;  4IUP A;  1Q3L A;  1QJO A;  2WB1 E;  4DR2 L;  1DON A;  4BBR G;  1Q7Y C;  4B9W A;  2PQA A;  1KNE A;  3NE5 B;  3DHQ A;  3GTO B;  3CU7 A;  1G6P A;  2O2L D;  2PZW A;  3CME A;  2NZO A;  1X6O A;  5HY6 A;  1N32 L;  2F0K A;  2OWO A;  4PG3 A;  2Q2I A;  1YVC A;  2EVB A;  3BDO A;  1KQS A;  3I4N H;  1YIJ A;  1CTM A;  4YY3 L;  4GLV B;  3RLN A;  3UDF A;  2F0D A;  3VR4 A;  4H0L C;  4UP9 A;  2WAQ G;  5ELC A;  3F2D A;  1HNX Q;  2Y0S B;  3I4L A;  2C9O A;  5LMU L;  4GN3 B;  4CJ1 B;  1O7Y A;  2V1C C;  5LL6 S;  1EIY B;  2F0J A;  2MGS A;  5EKI A;  1ILP A;  3GDE A;  5FO9 B;  2E76 C;  2R61 A;  4QUF A;  4Y7N H;  2UUB L;  1UE1 A;  2NN6 I;  4O1N A;  3T53 B;  1G6Z A;  5E3F A;  3HGB A;  3HOZ H;  4JI8 L;  1KDC A;  3DWP A;  4A3D H;  3CRL C;  4B9X A;  2VB3 X;  5JAV A;  4CJ0 B;  1Q12 A;  4HID A;  1TWH B;  5IWA L;  2ALY B;  4G7Z C;  1QVC A;  5ELF A;  1KL9 A;  4FF1 A;  1KHI A;  1IL2 A;  3FEW X;  1EYG A;  4X64 L;  4NXN L;  2TSS A;  4A76 A;  4PNY A;  2VUM H;  1OTC A;  1Y8N B;  1A2U A;  1N9W A;  2KED A;  3MC0 B;  3GTQ H;  1C48 A;  2CVR A;  5KEE A;  3FHW A;  4ZUJ A;  2L55 A;  3F2C A;  4K2L A;  4BBR H;  1TY2 A;  1PV4 A;  4IFD G;  1SE4 A;  3C2P A;  4Y7N B;  3H94 A;  4EVO A;  1KC8 C;  1MI2 A;  4JI1 Q;  2R93 H;  1XPO A;  1V1P B;  1YHB A;  3HG9 A;  2Q8R E;  2K4K A;  4HIK A;  1PMR A;  1SYE A;  3MXN A;  2VQF Q;  2OT2 A;  1ET6 A;  3RD4 A;  2HDM A;  3TEH B;  1CKN A;  4QQB X;  2PZU A;  1EQR A;  1F9P A;  1OXX K;  4RGN A;  4A3M B;  4KHP L;  4X62 Q;  2BA0 A;  3AYH B;  1BO0 A;  4C3H H;  4FDB A;  4HTH A;  2R7Z B;  4ZQ3 A;  1H95 A;  3S1M H;  1LTI D;  3CC4 A;  1VS0 A;  2HT1 A;  1IW7 D;  1I4Q A;  2ZXP A;  5IP9 G;  2GA4 B;  2NTS A;  3L0O A;  1I4P A;  3R2I A;  1TWH H;  4G7H C;  1L1O A;  5ELO A;  2EPB A;  1HRJ A;  5IYD G;  2F0T A;  1SLJ A;  1EIF A;  2QDB A;  3I90 A;  4X3S A;  1PH9 A;  3I4M G;  1KRS A;  4LWC A;  1GUW A;  2K6A A;  1SEB D;  2F0H A;  5DLQ E;  3KYH C;  2OTL A;  3QG1 A;  5IGF A;  1DOM A;  1KNA A;  4PZ7 A;  1B70 B;  3SK6 A;  2F0P A;  1NE3 A;  1HUM A;  2AMC B;  1FJG L;  1N8R C;  2OEO A;  3MXG A;  4DKA C;  4LF9 L;  1LYL A;  3FDT A;  5L37 A;  3EBE A;  2F0Q A;  1E1T A;  2PNR C;  1STY A;  3S2H H;  4ZAI A;  2J0T D;  5F2D A;  5BN5 A;  4L5S A;  1F2M A;  1SMY C;  2B2T A;  1SXT A;  2OQK A;  3S1N H;  4A3I H;  3BDL A;  1E1O A;  4R1J A;  4UAI A;  5KND A;  2D5D A;  5EGT A;  4XDX A;  1STA A;  1EEF D;  1WTW A;  1TS2 A;  1DYQ A;  1U4L A;  4KHV A;  4IJH A;  4DV6 Q;  1E2Z A;  4LFA Q;  3STB D;  5D3I B;  1PH2 A;  4L63 B;  4M1U B;  2A6H D;  4DN4 M;  1SSO A;  1SFO B;  3HRZ C;  3ULP A;  4A3M H;  1PYS B;  1I6V C;  1S5F D;  1WTQ A;  5EAY A;  1HHV A;  4DUY L;  5GRO A;  1FNV A;  2R93 B;  5C3E B;  1Y1V H;  4A3K B;  1TU2 B;  1XTC D;  1KAW A;  3LWU A;  1JB3 A;  1O80 A;  2KCM A;  3RUZ A;  4A3B B;  2A74 C;  1EU4 A;  2MNA A;  4QCL A;  3LWE A;  1PZJ D;  1VQ8 A;  2N88 A;  2BE5 C;  3DUZ A;  5LL6 X;  4WOR A;  3TP8 A;  5JEA H;  1XTD A;  2JP1 A;  3ZYY X;  3J81 E;  4LUZ A;  4RMF A;  3N52 A;  4JK1 C;  1SR3 A;  1Y14 B;  4DNI A;  2R7Z H;  2RF4 A;  4JI1 L;  1RJT A;  1S3O A;  2ZTD A;  3WDN A;  1E0B A;  1SNM A;  2FIN B;  2V4D A;  4C1N K;  1IYU A;  1TQO A;  1PFN A;  1LT3 D;  4IO9 A;  2EZV A;  1ET9 A;  5IY0 A;  4IUT A;  4PQX A;  4N9P A;  1PRT F;  4IPH A;  1JWU D;  2KEE A;  3CAM A;  2NVX B;  1O7Z A;  1WFQ A;  1T9H A;  1AW7 A;  2K33 A;  3I3C A;  4A3E H;  1RF2 D;  3BZK A;  2EXZ A;  1CK1 A;  1FD7 D;  1Q8I A;  2OF1 A;  4KHZ A;  5EPL A;  4A3B H;  3NBI A;  3GD7 A;  1TY0 A;  1I4R A;  4BXX G;  2IHF A;  1LTG D;  5LMN W;  2QKI C;  2EYF A;  5IYD H;  1DZ1 A;  4A3L H;  1H9J A;  3H3V H;  4FF3 A;  3FKI H;  3CCV A;  1HA6 A;  1K28 A;  1PH5 A;  3CRK C;  3K81 C;  1EWC A;  5HGT A;  2RBM A;  4FP5 D;  3R8B A;  2E2H H;  1A2T A;  3U4V A;  4CDF C;  3PIO 3;  3K6O A;  1GJX A;  2NZ1 D;  1L1O C;  1C7Y A;  2NN6 G;  5EJW A;  4FNF A;  4R4C A;  2DY7 A;  4QF4 A;  2PQA B;  4QB4 A;  3K58 A;  3L3O C;  2B2W A;  2MHV A;  1CT1 D;  1X3G A;  3K57 A;  1XWE A;  1EY8 A;  2EYJ A;  3KUP A;  5IGE A;  5JPM C;  1PTO D;  1DOK A;  3ERQ A;  4RGM A;  3I70 A;  3RZO B;  2Y0S E;  3E0J A;  5GAG C;  4Q5V A;  3D4D A;  1TWA B;  1D6E C;  1TWG H;  2K03 A;  1QNK A;  4KJN A;  4RGT A;  3MXU A;  3SK4 A;  4CJ2 C;  3HOU G;  1X32 A;  1NAP A;  4APV A;  1SFO H;  3OMG A;  3STB C;  2LMC B;  3CMA A;  1F9R A;  1K8M A;  1WJJ A;  2UUB Q;  1CKN B;  1JMC A;  2A19 A;  4A3K H;  1EEI D;  3UE0 A;  5JVH 3;  1G8Z D;  5M5Y H;  4MIU A;  2KOL A;  2A8V A;  5FJ8 H;  2PI2 E;  3HOV B;  2KCC A;  1STH A;  3W3A A;  1KLG D;  1LTS D;  1Z6H A;  4DV5 L;  4A3G G;  5FO8 B;  1U9R A;  4U68 A;  4KD3 A;  3J81 c;  5IOD A;  2JEB I;  3BU2 A;  1X3F A;  5I9O A;  3L9A X;  4DV1 L;  4JI0 L;  1CQF A;  2K5D A;  1JOR A;  1Y1V G;  3HOW B;  2HHH L;  2WKD A;  4DV7 L;  2IX0 A;  1Y1W B;  2R6G A;  2VW9 A;  1B3A A;  3HZX A;  4GLX A;  2QCP X;  1VQH A;  2K1B A;  2F3V A;  2Q2H A;  3KF6 A;  1HZ9 A;  2H4O A;  1BNZ A;  1Q8K A;  4B3S Q;  5J3B A;  2NN6 H;  1YIT A;  2I46 A;  1MBY A;  3S17 H;  4IFD I;  3M4O B;  2K7V A;  1BVS A;  2XWB B;  2VQF L;  1BKB A;  1NY4 A;  1PH8 A;  1ICF B;  1I6H H;  1MJC A;  3I4N G;  2F03 A;  3PO2 G;  1PTO C;  1MJE A;  1IKM A;  1I3Q B;  3RZD H;  4DPG A;  2FJ2 A;  4ODG A;  3E9H A;  2HQE A;  5G3L F;  1X55 A;  4GOP C;  4K0K Q;  4NXN Q;  1CKO A;  1XMO L;  3ITP A;  3MFY A;  4QMG A;  2KHS A;  2K50 A;  4C3J G;  1IBM L;  1FJG Q;  4LW1 A;  3I72 A;  4J6H A;  1EYC A;  4K2K A;  2M2L A;  3S2H B;  1SJH D;  2JE6 I;  4J1M A;  4EQ5 A;  3GV3 A;  2EY1 A;  1M90 C;  4HJ7 A;  2JA8 H;  1L2F A;  3S1N B;  1WCM B;  1LO5 D;  1X3E A;  2ZJP A;  1BUV T;  2LY7 A;  3MZ5 A;  1WTO A;  1YJ9 A;  3EIV A;  3X3N A;  4JC0 A;  2R92 G;  4A93 G;  1XMQ L;  1U5K A;  3KLS A;  1MGS A;  4C3I B;  2Q8T A;  3QWN A;  1TKW B;  3GTP B;  1PTO F;  2QA4 A;  1STE A;  5M5X H;  1GO3 E;  2MPM A;  1O7I A;  4MHE A;  1CA6 A;  1BBU A;  4IJL A;  1DD2 A;  2KEC A;  2K04 A;  2MJ8 A;  5T1I A;  4B3T Q;  1I4G A;  3KF8 A;  2AKW B;  4ALP A;  2SOB A;  2L11 A;  2MO0 A;  3JAM c;  3S14 B;  1K8O A;  3A7A B;  5IP7 G;  1VQ6 A;  4P73 A;  2NVY H;  2R7F A;  1SYD A;  1WI5 A;  3T1Y Q;  1Z9F A;  3FPP A;  4ID6 A;  3C3L A;  2O4X A;  1MD2 D;  2H1E A;  2PW5 A;  1P16 A;  1WTR A;  5LMN L;  1GUS A;  1YHQ A;  3H3V C;  3U9O A;  3J7Z C;  2WP8 J;  4X3K A;  3PGZ A;  4GNX B;  2PPB C;  2RDF A;  3S9W A;  5ISR A;  3CCM A;  5CV7 A;  1XNQ L;  4UP7 A;  3MXP A;  2BE5 D;  3E6Z X;  1PFS A;  4MNO A;  1VQJ A;  2MQH A;  3ULJ A;  3CPF A;  1Q81 C;  1XX8 A;  3J7Y W;  4CDE C;  5G3L D;  5HGQ A;  1FR3 A;  3CXC A;  5C3E G;  1AE3 A;  1VQ7 A;  4MN3 A;  2F0U A;  1VQM A;  1H9S B;  5CV4 A;  4OHJ A;  3VR2 A;  5C4J H;  1PVO A;  4X3U A;  1G2T A;  4YHH Q;  1HPC A;  1OXU A;  4JI5 L;  1E7Z A;  3ERO A;  1HFN A;  2B2Y A;  1VQO A;  3HOW G;  3CP0 A;  3OTO Q;  4KK7 A;  3CCJ A;  1ZYR C;  2Y0S G;  3P75 A;  3VDY A;  3PO3 H;  2CWP A;  1GUN A;  4A75 A;  5IOC A;  1RIP A;  3GTJ H;  1K83 H;  1E3P A;  1AEX A;  1X3P A;  5NUC A;  3HFZ B;  4LF7 L;  3LX0 A;  1GUT A;  2A68 C;  2E2J B;  4IQZ A;  5FLX E;  4OEL B;  5BN4 A;  1E24 A;  3PUV A;  4HMI A;  1B9N A;  1RCV D;  2QDL A;  2JQO A;  4OO1 I;  2E2I B;  1ENA A;  5M5W B;  2R92 H;  3I4M H;  1PTO H;  2IPK D;  1FGB D;  3OMC A;  2D0O A;  1HZA A;  1LT4 D;  4CDD C;  1KIX A;  2BA1 A;  3CC7 A;  4LF4 Q;  3A55 A;  3GO5 A;  1ROD A;  3W2D A;  3S14 H;  5E4X A;  2YYZ A;  1IKL A;  1KD1 C;  4H44 C;  3KJO A;  1S5D D;  1ZKO A;  1PLF A;  4EGV A;  2BH8 A;  1LTT D;  3M3Y H;  5FLX L;  2I5L X;  1YNN D;  1J6Q A;  4JBM A;  2EYP A;  3EQL C;  4DV5 Q;  4TKO B;  5JEA G;  4Q0F A;  5BR8 Q;  3RMH A;  2R3Z A;  4OXP A;  5D3D A;  2R92 B;  2GVB A;  5CBA E;  4DAY B;  1HQM C;  2SDF A;  5AFW A;  4FXD A;  3OYY A;  3D4R A;  1WTP A;  2B63 H;  3NUC A;  4KD4 A;  1H9M A;  3HOX H;  1YJN A;  5CV9 A;  5DNF A;  1NCV A;  3C46 A;  3NBH B;  4DR6 L;  4XQQ A;  3S1Q H;  1V9P A;  2XGT A;  3DLL A;  5C4H A;  1QOH A;  4K6L A;  4WRD A;  4XT3 B;  2QGQ A;  5GQO A;  4XXE A;  4B3S L;  1TS4 A;  1G2S A;  2BOS A;  3BVZ A;  3VR5 A;  3I2Z A;  5M3M B;  4OEM B;  4LJZ C;  1ESF A;  1KAB A;  2QW7 A;  2Z6B A;  4J15 A;  2IL8 A;  4E6I A;  2OXP A;  4BA1 I;  5KRU A;  4DV7 Q;  3PCO B;  2GVA A;  2WB1 B;  3HS0 C;  4K8J A;  3KF6 B;  4X3T A;  5C4J B;  1NMF A;  1VMP A;  1IL8 A;  3EA6 A;  1Z7T A;  1FNW A;  1ILQ A;  2B29 A;  3KBX A;  1PH7 A;  2NVQ B;  4A3G B;  2PYK A;  1PTO B;  1HNX L;  1BQQ T;  2C35 B;  3C1E A;  4XQJ A;  5ELD A;  4HMJ A;  2UXB L;  3OWF A;  5M3F H;  2ZT9 C;  3SGI A;  2K5W A;  2FMM A;  1JOQ A;  4JI7 Q;  4UY8 C;  2EE1 A;  1F2L A;  3GTJ B;  4IZ8 A;  1R9T B;  1Y1V B;  4N8F A;  3GTM B;  2ZM6 Q;  1J8I A;  1CFM A;  1F77 A;  4V0B A;  1PH6 A;  4LF4 L;  2EJM A;  1AE2 A;  4KJO A;  1Q46 A;  3T1H L;  3NQI A;  3KLR A;  2BH2 A;  4A3F B;  1Q1E A;  4TQU S;  5KYL A;  3HOV H;  1H9K A;  3E9I A;  1N36 L;  3ONA B;  3D4W A;  3MVV A;  3VA5 A;  3NBH A;  2DJF C;  1JQY D;  5EBC A;  5FLX c;  1HH2 P;  1EY7 A;  1JJG A;  3PUZ A;  1HZB A;  1UAP A;  4O2D A;  1I94 Q;  4OWT B;  4DK6 C;  2K01 A;  4JI2 L;  2AQ2 B;  2A6H C;  1A3U A;  3FVQ A;  2VS1 A;  4DUZ L;  4DK0 A;  5I4D A;  4P2C B;  3UDI A;  5C4X G;  3H0G G;  1IYV A;  4GZY C;  4C3I G;  4CKC A;  3DMU A;  5K36 H;  3EVQ A;  3W1G A;  4BY1 H;  3R3O A;  2R93 G;  1JCK B;  3K7A B;  4GKJ Q;  5EKL A;  1NTG A;  1I6H B;  3CCQ A;  2EQS A;  1EIG A;  1I50 B;  3G7L A;  3FKI B;  2HUG A;  4LFC L;  3CCE A;  2WAQ B;  1AZP A;  5LMN Q;  2UU9 Q;  3G71 A;  3GP7 A;  3TBI B;  2JA8 G;  3KDF A;  4PMW A;  3A8K E;  1EYA A;  4AYB B;  3NWS A;  5H1S E;  2Z6K A;  3U58 A;  4N8X 1;  1Q82 C;  4POG A;  2F4V Q;  2L1B A;  4JI6 L;  2RA4 A;  1SYB A;  1HZC A;  1J5E L;  4PZ6 A;  2F0N A;  2ZTC A;  4GN5 A;  2Q2U A;  1II3 A;  3M85 A;  1QUQ A;  5C4Z A;  2E2D C;  1EWH A;  1F9S A;  1F9Q A;  1B4O A;  4DR2 Q;  3PO2 H;  1VQ9 A;  1VQF A;  3K5M A;  1L0Y B;  4BY7 B;  1NSN S;  1M8A A;  4RHR A;  2DN8 A;  5E7N A;  1U4P A;  4M8A A;  4DXG A;  1XMO Q;  1FNU A;  3AMU A;  4C3J H;  5JJL A;  4DV2 Q;  4DV0 Q;  2IY5 B;  2XWJ B;  4OIJ A;  4A3F H;  3SK8 A;  1VQ5 A;  2JEA I;  4A3J B;  5A35 A;  4LF5 Q;  2ZXO A;  1G51 A;  3LGJ A;  3U9S A;  3VYU A;  4TSS A;  1X9N A;  4NP5 A;  4LUV A;  2VB2 X;  2ID0 A;  1HR0 Q;  4FF2 A;  4LFB Q;  4GLA C;  2DNC A;  2L5T A;  1SMY D;  3P7J A;  4TRD A;  3S16 B;  5JOB A;  1IW7 C;  3GTM H;  1WTX A;  1KXL A;  2PZT A;  4U67 3;  2F0V A;  3VYS A;  3K8A A;  4XQN A;  3F1Z A;  5BR8 L;  2L4N A;  3QOJ A;  4JBK A;  1XPR A;  3CQZ B;  1QG7 A;  1V43 A;  1N33 Q;  3RZO H;  1NUC A;  2NVT B;  3ZJY C;  2M00 A;  1HFG A;  3BG3 A;  2VUM G;  3KBG A;  4KHP Q;  4NPS A;  1CKM A;  2A5H A;  3IFT A;  4DV6 L;  3CD6 A;  4LMQ D;  1AFP A;  5KNB A;  2I0Q A;  4IFD H;  2VL6 A;  1CM9 A;  2F0W A;  1D1K A;  5KGU A;  1V8Q A;  2BCO A;  1ZYR D;  4LF7 Q;  3HP3 A;  3PF4 A;  4H7B A;  2A69 D;  4DK1 A;  1MSH A;  3E5S A;  3GTO H;  2KEN A;  4LK1 C;  4DV4 Q;  3TZU A;  5C0X G;  1I94 L;  5C0X H;  2DUD A;  1PRT B;  4L6T B;  1F2Z A;  4BBS H;  3S15 H;  3HKZ E;  1PXU A;  1FVI A;  4DR4 L;  1NR2 A;  2MUY A;  3BDC A;  2BDO A;  4AQY L;  4JI7 L;  2RHQ B;  1NBW A;  3MXN B;  3QO2 A;  2XTI A;  3GTG B;  2JA6 H;  4KN4 C;  2RKS A;  4IUN A;  1DGS A;  4RAU C;  1YNX A;  3TP5 A;  1EFI D;  4FXG C;  2YU9 H;  1XYI A;  4DR1 Q;  5IT9 E;  1SE2 A;  3DXJ C;  3J80 i;  3F8T A;  1IHZ A;  3S16 H;  3VYR A;  1PA6 A;  3AFQ A;  3IAY A;  1ENC A;  2I5M X;  2UUC Q;  3NK9 A;  1N34 Q;  4JI6 Q;  3AB9 A;  5C6A A;  4A3G H;  2O5J C;  5TSS A;  1A0I A;  2N55 A;  3D6C A;  4OL7 A;  3HKZ G;  1STG A;  3RLO A;  2X6G A;  3SE0 A;  2RSN A;  1JWM D;  4LFA L;  3AQQ A;  1IBK Q;  3GTK B;  2B63 B;  4I65 A;  2N3S A;  5C44 G;  2F0O A;  1TS3 A;  2AWO A;  4EX5 A;  1QCB D;  4A4I A;  1K8A C;  3CC2 A;  3J81 i;  2NVQ H;  1CHP D;  4K14 A;  3E0E A;  2DGY A;  3A0J A;  5FK9 C;  1EY0 A;  4DV0 L;  1V1O A;  1GXD C;  4AIM A;  1D5X C;  2J7Z A;  4BS9 A;  3SR1 A;  2HIX A;  4IOC A;  3NEL A;  1RTN A;  1JOO A;  2YTX A;  4OGQ C;  5IYB H;  4R4I A;  4K5V A;  1JR0 D;  3HKZ B;  2WV6 D;  1HR0 L;  4F8M A;  1LTR D;  5K36 G;  3PIO A;  3HOU B;  1VQK A;  2ATW A;  2B63 G;  4DUZ Q;  5EQ0 A;  3SVM A;  2JA5 B;  4RWS C;  4NB3 A;  1HNW Q;  3GQB A;  4RCN A;  3GTQ B;  3HEJ A;  3UDG A;  3S1R B;  3BYY B;  1CZG A;  4KMU C;  4C3H B;  5IE8 A;  3BZC A;  4DNR B;  2A68 D;  2K28 A;  4IAL A;  2CQO A;  1J5E Q;  4GOP A;  3T56 B;  2B2W C;  2XNA C;  3H91 A;  3HOV G;  1W6K A;  5I6W A;  3VYT A;  2F3I A;  4K8I A;  5IGD A;  1A62 A;  1HUN A;  3FKI G;  2F0E A;  1BDO A;  3S2D H;  3GTL B;  1YNJ C;  2SNM A;  4A93 H;  5CV6 A;  4MTN A;  2AHO B;  2B8G A;  1NNX A;  1ZEQ X;  3D31 A;  1E22 A;  2ICI A;  4R4O A;  3S15 B;  1EY5 A;  3PIP 3;  2D62 A;  3TDQ A;  4AH6 A;  1D5Z C;  3WOF A;  3QB3 A;  1E2W A;  4WFN 3;  4YWK A;  2B2U C;  2DY8 A;  1PH4 A;  4IFD J;  4JI2 Q;  3JC6 6;  2F0L A;  4P71 A;  2UUC L;  4KTA A;  1IXR A;  2A6E D;  1DXM A;  1RDP D;  2FXQ A;  2X69 A;  2KUM A;  4X65 L;  2F0F A;  2KCT A;  4OWW B;  3I4N B;  1VQC A;  4NXM Q;  1I4H A;  1DCZ A;  2XRS D;  2AWN A;  3TSS A;  1FL0 A;  3MAQ A;  1VQL A;  4LF5 L;  3Q6S A;  2YTV A;  2RCN A;  2N78 A;  5ELN A;  4ZK9 B;  5C44 B;  1LLR D;  2IWH A;  4P72 A;  4IOA A;  3UI2 A;  1JC7 A;  1ML0 D;  2L15 A;  1STB A;  1F2Y A;  5IT9 L;  4XYQ A;  3CW2 C;  3HOY H;  2Z1C A;  4C3H G;  4R8N A;  1R4P B;  2JA7 B;  3X3M A;  2AQ3 B;  4ABN A;  1BCP C;  1ICW A;  5C3E H;  3Q8D A;  1A6X A;  2TMP A;  1L0X B;  4IUQ A;  4B3R Q;  3MWY W;  2Z0S A;  4L5R C;  4OON A;  2UXC Q;  1SYG A;  2EY6 A;  2E75 C;  4WJ3 M;  3W1B A;  1ENF A;  2NVX H;  2B2U A;  2F0G A;  3CQZ H;  5EBD A;  4C2M H;  4A93 B;  4Z9C B;  1T5E A;  1WYD A;  4DR5 Q;  5C0X I;  5IYC G;  1XNR Q;  1JJC B;  1CHQ D;  5C44 H;  3T4A C;  3MEH A;  4RKL A;  1PYW D;  3ER0 A;  3F2U A;  1G29 1;  1VQI A;  5FJ8 G;  4UP8 A;  5IIF A;  2JA5 H;  1QNU A;  1B9M A;  1NMG A;  3V96 A;  2NVT H;  3PO3 G;  3S1R H;  2LSS A;  2HHH Q;  3IL8 A;  3D8G A;  4GKK Q;  1K0S A;  1UE7 A;  4KLK A;  3J7A V;  1X56 A;  2E5L Q;  4JVZ A;  3S1M B;  1D1I A;  1M4V A;  1XXG A;  3H09 A;  3K0Y A;  1LTB D;  1J9O A;  4DV1 Q;  4JI0 Q;  4RKB A;  3T16 A;  1PRT C;  3NXW A;  4NW2 A;  4BY1 G;  2K14 A;  4DR1 L;  1BR9 A;  3OOC A;  2ZJR A;  3A54 A;  5DM6 3;  5IGB A;  5J22 A;  1SJE D;  3N6R A;  1SYF A;  1ESR A;  2AUK A;  5JJZ A;  3OPO A;  1EOT A;  1BBX C;  5KNC A;  2F3W A;  2JA7 H;  1IZ6 A;  3QIA A;  1UEA B;  2JYO A;  3F2B A;  4DV2 L;  4A3C G;  4DFA A;  4LF6 Q;  4RCO A;  1TWG B;  3PMF A;  2PW7 A;  4K0K L;  4PV1 C;  2IW3 A;  3BJU A;  4O42 A;  4DXF A;  1JT8 A;  2HCC A;  3Q23 A;  3OIQ A;  3K5O A;  1NR4 A;  4DAY A;  2IT1 A;  2MP1 A;  4QL5 A;  3Q24 A;  4HJ8 A;  1EL0 A;  1EFW A;  3RLF A;  3CCL A;  4KY7 A;  3KJP A;  5IWA Q;  2MO1 A;  2QEX A;  1QVG A;  3FPU B;  1AP0 A;  4MTK A;  2Z8L A;  1SMX A;  1TWA H;  4UHV A;  2CH4 A;  5D65 A;  1JWS D;  3C1F A;  5CC4 A;  4HJA A;  3W5O A;  4EQO A;  1B7Y B;  3DWA A;  5CYU A;  2A1A A;  2YU9 B;  2ASB A;  3OW7 A;  1TXY A;  2JA9 A;  1EOV A;  1Q1B A;  4KY6 A;  1UE5 A;  5DEH A;  1RD9 D;  3ND8 A;  4DV3 Q;  3CCU A;  3P1H A;  2E2H B;  2KJX A;  4HCS A;  1PZI D;  2Q2T A;  5M3F G;  4PMB A;  4KKU A;  2XRQ D;  3R2T A;  3NTH A;  3AU7 A;  5A2Q E;  1XNR L;  5AJ3 Q;  2CQA A;  3GTK H;  3BYT B;  4UDU C;  1DOL A;  2B2T C;  4IUU A;  2F4I A;  1QZH A;  4YHH L;  2CHB D;  1STN A;  1CSP A;  3PO3 B;  2EY5 A;  1V1P A;  4R4T A;  5JJK A;  4JV5 Q;  4FF4 A;  3OTO L;  1A3T A;  2NWG A;  4XIG S;  2KA7 A;  4LF9 Q;  4LNQ A;  2B39 A;  4ME3 A;  3JAM i;  1S5C D;  5FLM G;  4F87 A;  4WJW A;  1PHJ A;  3NQT A;  3K80 C;  2E2I H;  4A3I B;  1B8A A;  1C4Q A;  3I91 A;  5C5M A;  4DR4 Q;  4G57 A;  5C4X H;  1K8G A;  5C3W A;  2OTJ A;  5IT9 c;  1WD0 A;  1XPU A;  4JI8 Q;  1MIU A;  5EPJ A;  1XNQ Q;  1LV9 A;  3NEM A;  4JG2 A;  3J7A F;  1C9O A;  1EIH A;  3M4O H;  2K52 A;  2Z4H A;  5CGK A;  4HSP A;  3J7A 5;  1SND A;  1SN8 A;  2JA8 B;  4IPD A;  4ZUI A;  4GNX A;  2RSO A;  4L5Q A;  2LXK A;  1YNJ D;  3AEV A;  4A3E B;  3TN2 A;  4LF6 L;  4NKL A;  2CKZ B;  3MTS A;  4CGY B;  3A5U A;  1IYJ B;  3PUW A;  2XN9 C;  4Y52 H;  5K5P A;  1VF7 A;  1LAB A;  4V19 0;  4HED A;  4GOP B;  4DA2 A;  4A3I G;  1W2B A;  3T1Y L;  1UUP A;  4RA8 A;  2X6L A;  3KF8 B;  3B6Y A;  3EJI A;  2CW0 D;  4A3M G;  4DUY Q;  3Q0A A;  3GTL H;  4B08 A;  3DEP A;  2ENB A;  3H6M A;  1SNQ A;  1FGU A;  1WCM H;  1O78 A;  2XVS A;  2EOT A;  5FO7 B;  3CPW A;  1U4R A;  2N49 A;  1UEB A;  3OIP A;  3S24 A;  1W6J A;  4X66 L;  1I4X A;  4JOI C;  2A69 C;  1SRU A;  4PMC A;  5C3X A;  2M9V A;  1S5B D;  3EN2 A;  5JVG 3;  1R9T H;  1LTA D;  3SEB A;  2E8G A;  4G4K A;  5IGG A;  2I5H A;  4PZ8 A;  2H5X A;  2SEB D;  1BF4 A;  1QIL A;  5E1F A;  2WB1 G;  3TS2 A;  1KTK A;  4WJ4 A;  3H0G H;  1EY4 A;  3V05 A;  4CDC C;  4R4Q A;  1AZQ A;  2WFW A;  3MFG A;  1VCI A;  4BA2 I;  4YY3 Q;  3CF5 A;  2HD3 A;  3KLS X;  5M3M G;  2F52 A;  3A56 A;  5E4W C;  3URY A;  4GKJ L;  3J80 c;  3DEO A;  1N36 Q;  2KHI A;  1K9M C;  2D2C C;  2PCF B;  3PQI A;  4X64 Q;  3JAM E;  1D8L A;  1VQG A;  2JXM B;  3QR8 A;  1B53 A;  3FMC A;  2IHE A;  5ELB A;  4B3R L;  3E3X A;  3KDF B;  4C1N I;  2B2V C;  2VUM B;  3M4P A;  1K73 C;  4POF A;  2RVL A;  2UXC L;  3O13 A;  4KKT A;  3TRZ A;  3A5Z B;  1CQV A;  5C4X B;  1EWI A;  3HOX G;  4GNX C;  2ZM6 L;  4JI5 Q;  2RDG A;  5GAE C;  4NXM L;  4A3L G;  1K3R A;  1K83 B;  2FMC A;  2KCN A;  1GM5 A;  5T1G A;  3T1H Q;  1SNC A;  5D14 A;  4O0A A;  4JI4 Q;  4C2M B;  1WTV A;  3R93 A;  4LUO A;  5EKK A;  2I07 B;  3VR3 A;  4X62 L;  1A8V A;  4NDX A;  1L0W A;  1JE4 A;  2B3G A;  1NJI C;  3L2P A;  1LTL A;  5CV8 A;  4LFC Q;  2HQL A;  5C0X J;  2UU9 L;  2EYM A;  4GKK L;  3I55 A;  1GOZ A;  2P5Z X;  3T13 A;  2CCZ A;  4IUV A;  1VQ4 A;  3NEN A;  4YCW A;  4TVA B;  1ASZ A;  4IPG A;  1GUO A;  3K5N A;  1UWV A;  4S3S A;  4JPB W;  4YCV A;  3A8J E;  1B50 A;  4FXK C;  3CCR A;  4ZCK A;  3M9B A;  2KQ3 A;  1R4Q B;  2B8F A;  4ULL A;  4ZKB B;  3QJY A;  2RQX A;  2WAQ E;  4LF8 L;  2LFN A;  4HIO A;  2KVM A;  1HXY D;  4DR7 L;  2VNU D;  5A2Q L;  5GAH C;  4P74 A;  5JPN C;  3I4O A;  4KN7 C;  1LM0 A;  4JBW A;  2K32 A;  3D3R A;  4BY1 B;  1GVP A;  2LXJ A;  3I4M B;  4HCE A;  3P20 A;  2K5H A;  3SXH A;  1KLU D;  5COY A;  2CW0 C;  2VXW A;  3HKS A;  2QEJ C;  3PF5 A;  3NPP A;  1BBW A;  4QY7 A;  4C56 C;  5C5L A;  3HOX B;  4JV5 L;  3UE1 A;  3D6W A;  1YNN C;  3MEF A;  3VA7 A;  2L9H A;  2VZA A;  4JYA Q;  2JK8 A;  4OX9 L;  1PRT D;  3M3Y B;  3H0G B;  1TT2 A;  4YWM A;  1QZG A;  3SK5 A;  2F0I A;  5J1Z A;  3RN2 A;  4A3D B;  2HDL A;  1HTL D;  2EYH A;  2AQ1 B;  4A3C H;  5M5W H;  2IX1 A;  2PI2 A;  2K05 A;  4R9W A;  1CZW A;  1QWY A;  5AJ3 L;  2WAC A;  4A3B G;  2D0P A;  3ERS X;  1KDA A;  4BXX H;  3SDZ A;  1TWC B;  1I3Q H;  3DWQ A;  3RZD B;  1VQD A;  1MHW C;  3FP9 A;  1HR0 W;  3K0X A;  1SAP A;  1WVL A;  2RCF A;  3NHH A;  1AH9 A;  3M4Y A;  2F4V L;  3NTK A;  4ZRZ A;  4LFB L;  2DJG C;  1BCP B;  1YI2 A;  1V1Q A;  4ZLT F;  4P75 A;  1K3B C;  2F1M A;  2E74 C;  4N9T A;  4QUC A;  1QUQ B;  3VR6 A;  3M4Q A;  3S2D B;  4B3M Q;  2NYZ D;  2EYO A;  1JJ2 A;  5M5X B;  1VDZ A;  2Z6K C;  2R7Z G;  1C8C A;  1TII D;  2NUC A;  3TQY A;  2EJF C;  3G6E A;  5COR A;  3PSI A;  3HOY B;  4KI0 A;  1BCP D;  1IBL Q;  1PYB A;  4HJ5 A;  1E2V A;  4JI3 Q;  3QOL A;  5DM7 3;  5CMD A;  1HNZ L;  2UUA Q;  3S1Q B;  3AFP A;  2JSO A;  1RKN A;  4KKS A;  1OO9 B;  3BS1 A;  1D7Q A;  4K5X A;  1PFM A;  3OHX C;  1L1O B;  4LAA A;  1UNS A;  2PMZ E;  4IPC A;  5LHY 1;  2QIL A;  4F88 A;  2Z9H A;  4G7O C;  1YZ6 A;  2UXD L;  2VY3 A;  5FLM H;  4KY5 A;  2DNE A;  4X6A H;  4DAM A;  4I7Z C;  4DV4 L;  1N33 L;  2KBN A;  1QE6 A;  4X66 Q;  4CBV A;  2VQE L;  5JEA J;  2RDH A;  3KLW A;  5CBE E;  1SNO A;  2F0M A;  3K5L A;  4ZYS A;  1EQT A;  2ZJQ A;  3JAM L;  5GAD C;  4QIW B;  2Z4I A;  4AYB G;  4EQP A;  2WIN B;  1FYC A;  4EQN A;  4F7X A;  2CFM A;  1EY9 A;  4H02 A;  1HCZ A;  2EYL A;  5JJI A;  3PIP A;  2OQ0 A;  4BBS B;  4HN7 A;  2JA7 G;  1U4M A;  5IYB G;  3M7N A;  3CKI B;  4ZKC B;  4RH6 A;  5EPK A;  4RGO S;  1PH1 A;  1TWC H;  1RTO A;  4KV6 A;  3PUX A;  4OO1 G;  2ZXR A;  1CSQ A;  1EZ8 A;  2YV5 A;  3GTG H;  3TS0 A;  4RHS A;  3K59 A;  1PZK D;  1OXT A;  3TZD A;  5BN3 A;  1WOC A;  5FOB B;  3PO2 B;  4DR3 L;  1SE3 A;  5M5Y B;  4JI4 L;  4A3D G;  1AN8 A;  3HOU H;  2EDG A;  3ICE A;  1JE5 A;  2E2J H;  2ZTE A;  1KRT A;  4QGU A;  5M9O A;  4K5W A;  1RHP A;  2NZH A;  4A3K G;  1VQB A;  1S72 A;  4DAP A;  4ILW A;  1SE8 A;  1U0L A;  2J4X A;  3TRE A;  4BY7 G;  4HAE A;  3HOW H;  2EIF A;  3KOJ A;  3IRB A;  2EXD A;  2LKV A;  1KAA A;  1Y1W H;  1EYD A;  3CCS A;  1GD7 A;  4R8I A;  1Y1W G;  3DM3 A;  2R7D A;  2L12 A;  4IUR A;  2BDN A;  1Y8P B;  4DR7 Q;  1ASY A;  1EY6 A;  4A3J G;  1I5F A;  3CHB D;  5IYC H;  5CR3 A;  2D9U A;  5I2Y A;  1VMC A;  4OWX B;  2G9D A;  1SRO A;  3BZD B;  1VQE A;  3I8Z A;  1S40 A;  3BVM A;  3A74 A;  5KIX A;  4QJF A;  1VQP A; 
#chains in the Genus database with same CATH homology
 1WD1 A;  1OXS C;  3J81 L;  1KDB A;  4IN3 A;  1LAC A;  1GHK A;  3FRP B;  1A3V A;  2L0C A;  2A73 B;  4XT1 B;  2XIW A;  3TP7 A;  2AUJ D;  4DF7 A;  1EZ6 A;  1ZXT A;  2B2Y C;  3MA2 B;  2O5I C;  1LT6 D;  3PV0 A;  2NB0 A;  2PMZ B;  4YIJ A;  1HTP A;  4CHT B;  2ICE C;  2QF7 A;  3A7L A;  1H9S A;  1H9R A;  5HUR A;  1DM0 B;  3Q22 A;  4HSV A;  1O7L A;  1TWF B;  4XTC S;  5I2X A;  4DU9 A;  3M7G A;  1SBB B;  5CV5 A;  3GV6 A;  1OXV A;  1D5M C;  3J80 L;  1EU3 A;  1HQR D;  2B2V A;  5M3F B;  3J80 E;  4FYD A;  2NVY B;  4OO1 H;  2WKC A;  4J8Q A;  2A6E C;  1EQV A;  2Q8I B;  3OSO A;  1SNP A;  4DAV A;  2IX3 A;  3WOE A;  1HA5 A;  3IKJ A;  2JA6 B;  1JOK A;  2LS0 1;  1B44 D;  2EJG C;  3TME A;  1BCP F;  1TS5 A;  1Y8O B;  2K5Q A;  2PQE A;  1Q90 A;  3BVG A;  3LNN A;  3ND9 A;  1A15 A;  1LT5 D;  2SNS A;  4OIK A;  3NTI A;  1Y69 U;  5KYI A;  3NWT A;  2FFK B;  3NP8 A;  1JIC A;  2C5C A;  1SYC A;  1GUG A;  4CKE A;  4RFB A;  2HCI A;  2FHT A;  3G6J B;  1TR5 A;  4FO2 A;  3PUY A;  2WII B;  1B1Z A;  5J39 A;  2NBF A;  3EFX D;  1DJR D;  1CA5 A;  1CI3 M;  5IGC A;  4C3J B;  3T51 B;  5FKA C;  4FVM A;  3I73 A;  1D2B A;  3V2T A;  1G91 A;  1Z47 A;  2PO4 A;  1ONL A;  1BOS A;  4CKB A;  1QB5 D;  3IFD A;  1BXT A;  3NSW A;  2NTT A;  4L8J A;  2G9H D;  4DNT B;  4XYO A;  4K6D A;  2EY2 A;  3OWE B;  1S4Z A;  4DGZ A;  1S5E D;  4HR7 B;  5I9P A;  4H13 C;  1X3Q A;  1B2T A;  3MHB A;  3HOZ B;  5ELE A;  5DAU A;  4BBR B;  3L7Z C;  1GHJ A;  3S17 B;  4ME5 A;  1PFB A;  1SDF A;  1T5X D;  4NMZ A;  1PDQ A;  3KK7 A;  1TVX A;  3SHL A;  3DM1 A;  5I6Y A;  1MSG A;  2XSC A;  3A8I E;  4BWG B;  3TP6 A;  1VF5 C;  2F0S A;  2IJ0 A;  4IUP A;  1Q3L A;  1QJO A;  1DON A;  4B9W A;  1KNE A;  3NE5 B;  3DHQ A;  3GTO B;  3CU7 A;  2O2L D;  2PZW A;  2F0K A;  2EVB A;  3BDO A;  1CTM A;  2F0D A;  3VR4 A;  4H0L C;  5ELC A;  2Y0S B;  3I4L A;  2C9O A;  4CJ1 B;  1O7Y A;  5LL6 S;  1ILP A;  2F0J A;  2MGS A;  5EKI A;  5FO9 B;  2E76 C;  2R61 A;  4QUF A;  2NN6 I;  4O1N A;  3T53 B;  1G6Z A;  5E3F A;  3HGB A;  1KDC A;  3DWP A;  3CRL C;  4B9X A;  2VB3 X;  5JAV A;  4CJ0 B;  1Q12 A;  1TWH B;  4G7Z C;  5ELF A;  4FF1 A;  3FEW X;  2TSS A;  4PNY A;  1Y8N B;  1A2U A;  2KED A;  3MC0 B;  1C48 A;  2CVR A;  5KEE A;  4ZUJ A;  2L55 A;  4K2L A;  1TY2 A;  4IFD G;  1SE4 A;  3C2P A;  4Y7N B;  3H94 A;  4EVO A;  1MI2 A;  1V1P B;  3HG9 A;  2Q8R E;  1PMR A;  1SYE A;  3MXN A;  2OT2 A;  1ET6 A;  3RD4 A;  2HDM A;  2PZU A;  4A3M B;  1F9P A;  1OXX K;  4RGN A;  2BA0 A;  1BO0 A;  4HTH A;  2R7Z B;  4ZQ3 A;  1LTI D;  1IW7 D;  1I4Q A;  2ZXP A;  2GA4 B;  2NTS A;  1I4P A;  3R2I A;  4G7H C;  2EPB A;  1HRJ A;  2F0T A;  2QDB A;  3I90 A;  4X3S A;  1GUW A;  2K6A A;  1SEB D;  2F0H A;  3QG1 A;  5IGF A;  1DOM A;  1KNA A;  3SK6 A;  2F0P A;  1HUM A;  2OEO A;  3MXG A;  3FDT A;  2F0Q A;  2PNR C;  1STY A;  4ZAI A;  2J0T D;  5F2D A;  5BN5 A;  1F2M A;  1SMY C;  2B2T A;  1SXT A;  3BDL A;  5KND A;  4UAI A;  2D5D A;  5EGT A;  4XDX A;  1STA A;  1EEF D;  1WTW A;  1TS2 A;  1DYQ A;  1U4L A;  4KHV A;  1E2Z A;  5D3I B;  4L63 B;  4M1U B;  2A6H D;  4DN4 M;  1SSO A;  1SFO B;  3HRZ C;  1I6V C;  1S5F D;  1WTQ A;  1HHV A;  1FNV A;  2R93 B;  5C3E B;  4A3K B;  1TU2 B;  1XTC D;  3LWU A;  1JB3 A;  1O80 A;  3RUZ A;  4A3B B;  2A74 C;  1EU4 A;  4QCL A;  3LWE A;  1PZJ D;  2N88 A;  2BE5 C;  3DUZ A;  5LL6 X;  4WOR A;  3TP8 A;  5JEA H;  2JP1 A;  3ZYY X;  3J81 E;  3N52 A;  4JK1 C;  1RJT A;  3WDN A;  1E0B A;  1SNM A;  2FIN B;  2V4D A;  4C1N K;  1IYU A;  1TQO A;  1PFN A;  1LT3 D;  2EZV A;  1ET9 A;  4IUT A;  4PQX A;  4N9P A;  1PRT F;  1JWU D;  2KEE A;  2NVX B;  1O7Z A;  1AW7 A;  2K33 A;  3I3C A;  1RF2 D;  2EXZ A;  1CK1 A;  1FD7 D;  1Q8I A;  2OF1 A;  4KHZ A;  5EPL A;  3NBI A;  3GD7 A;  1TY0 A;  1I4R A;  1LTG D;  2QKI C;  2EYF A;  1DZ1 A;  1H9J A;  4FF3 A;  1HA6 A;  3CRK C;  1EWC A;  5HGT A;  2RBM A;  4FP5 D;  3R8B A;  1A2T A;  3PIO 3;  3K6O A;  1GJX A;  2NZ1 D;  2NN6 G;  5EJW A;  4FNF A;  2DY7 A;  4QF4 A;  4QB4 A;  3K58 A;  3L3O C;  2B2W A;  2MHV A;  1CT1 D;  3K57 A;  1XWE A;  1EY8 A;  2EYJ A;  3KUP A;  5IGE A;  5JPM C;  1DOK A;  1PTO D;  3ERQ A;  4RGM A;  3I70 A;  3RZO B;  3E0J A;  4Q5V A;  3D4D A;  1TWA B;  1D6E C;  2K03 A;  1QNK A;  4KJN A;  4RGT A;  3MXU A;  3SK4 A;  4CJ2 C;  1X32 A;  1NAP A;  3OMG A;  2LMC B;  1F9R A;  1K8M A;  1EEI D;  5JVH 3;  1G8Z D;  4MIU A;  2KOL A;  3HOV B;  2KCC A;  1STH A;  3W3A A;  1KLG D;  1LTS D;  1Z6H A;  5FO8 B;  1U9R A;  4U68 A;  4KD3 A;  5IOD A;  2JEB I;  5I9O A;  3L9A X;  1CQF A;  2K5D A;  1JOR A;  3HOW B;  2WKD A;  2IX0 A;  1Y1W B;  2R6G A;  1B3A A;  3HZX A;  2QCP X;  2K1B A;  2F3V A;  2H4O A;  1BNZ A;  2NN6 H;  2I46 A;  1MBY A;  4IFD I;  3M4O B;  2K7V A;  2XWB B;  2F03 A;  1PTO C;  1IKM A;  1I3Q B;  2FJ2 A;  4ODG A;  2HQE A;  5G3L F;  3ITP A;  3MFY A;  4QMG A;  2KHS A;  4C3J G;  4K2K A;  3I72 A;  4J6H A;  1EYC A;  2M2L A;  3S2H B;  1SJH D;  2JE6 I;  4J1M A;  3GV3 A;  2EY1 A;  3S1N B;  1WCM B;  1LO5 D;  1BUV T;  2LY7 A;  3MZ5 A;  1WTO A;  3X3N A;  3KLS A;  1MGS A;  4C3I B;  2Q8T A;  3QWN A;  1TKW B;  3GTP B;  1PTO F;  1STE A;  2MPM A;  1CA6 A;  4MHE A;  1DD2 A;  2KEC A;  2K04 A;  2MJ8 A;  5T1I A;  1I4G A;  3KF8 A;  2SOB A;  2L11 A;  3S14 B;  1K8O A;  3A7A B;  1SYD A;  4ID6 A;  3FPP A;  3C3L A;  2O4X A;  1MD2 D;  2H1E A;  2PW5 A;  1WTR A;  1GUS A;  3H3V C;  3U9O A;  2WP8 J;  4X3K A;  2PPB C;  2RDF A;  3S9W A;  5ISR A;  5CV7 A;  3MXP A;  2BE5 D;  3E6Z X;  1XX8 A;  3J7Y W;  5G3L D;  1FR3 A;  4MN3 A;  2F0U A;  1H9S B;  5CV4 A;  4OHJ A;  3VR2 A;  4X3U A;  1G2T A;  1HPC A;  1OXU A;  3ERO A;  1HFN A;  2B2Y A;  4KK7 A;  1ZYR C;  3P75 A;  1GUN A;  5IOC A;  1AEX A;  1X3P A;  5NUC A;  3LX0 A;  1GUT A;  2A68 C;  2E2J B;  4IQZ A;  5FLX E;  5BN4 A;  3PUV A;  4HMI A;  1B9N A;  1RCV D;  2E2I B;  4OO1 I;  1ENA A;  5M5W B;  1PTO H;  2IPK D;  1FGB D;  3OMC A;  1LT4 D;  2BA1 A;  3A55 A;  3GO5 A;  1ROD A;  3W2D A;  5E4X A;  2YYZ A;  1IKL A;  4H44 C;  1S5D D;  1ZKO A;  1PLF A;  4EGV A;  1LTT D;  5FLX L;  1YNN D;  2EYP A;  3EQL C;  4TKO B;  5JEA G;  4Q0F A;  3RMH A;  2R3Z A;  5D3D A;  2R92 B;  5CBA E;  1HQM C;  2SDF A;  5AFW A;  4FXD A;  3D4R A;  1WTP A;  3NUC A;  4KD4 A;  1H9M A;  5CV9 A;  5DNF A;  1NCV A;  3C46 A;  4XQQ A;  5C4H A;  1QOH A;  4K6L A;  4WRD A;  4XT3 B;  4XXE A;  1TS4 A;  1G2S A;  2BOS A;  3BVZ A;  3VR5 A;  5M3M B;  4LJZ C;  1ESF A;  1KAB A;  2IL8 A;  4E6I A;  2OXP A;  4BA1 I;  5KRU A;  2WB1 B;  3HS0 C;  4K8J A;  4X3T A;  5C4J B;  1VMP A;  1IL8 A;  3EA6 A;  1Z7T A;  1FNW A;  1ILQ A;  3KBX A;  2NVQ B;  4A3G B;  2PYK A;  1PTO B;  1BQQ T;  3C1E A;  4XQJ A;  5ELD A;  4HMJ A;  3OWF A;  2ZT9 C;  2K5W A;  2FMM A;  1JOQ A;  2EE1 A;  1F2L A;  3GTJ B;  4IZ8 A;  1R9T B;  1Y1V B;  3GTM B;  1J8I A;  1CFM A;  1F77 A;  4V0B A;  2EJM A;  4KJO A;  3NQI A;  3KLR A;  4A3F B;  1Q1E A;  4TQU S;  5KYL A;  1H9K A;  3ONA B;  3D4W A;  3MVV A;  3VA5 A;  3NBH A;  1JQY D;  5EBC A;  1EY7 A;  3PUZ A;  1UAP A;  2K01 A;  2AQ2 B;  2A6H C;  1A3U A;  3FVQ A;  4DK0 A;  5I4D A;  4P2C B;  1IYV A;  4GZY C;  4C3I G;  4CKC A;  3DMU A;  5K36 H;  3EVQ A;  3R3O A;  1JCK B;  3K7A B;  5EKL A;  1I6H B;  1EIG A;  1I50 B;  3G7L A;  3FKI B;  2HUG A;  2WAQ B;  1AZP A;  3GP7 A;  3TBI B;  4PMW A;  3A8K E;  1EYA A;  4AYB B;  3NWS A;  2L1B A;  2RA4 A;  1SYB A;  2F0N A;  1II3 A;  3M85 A;  5C4Z A;  2E2D C;  1EWH A;  1F9S A;  1F9Q A;  1B4O A;  3K5M A;  1L0Y B;  4BY7 B;  1NSN S;  1M8A A;  4RHR A;  2DN8 A;  1U4P A;  4M8A A;  4DXG A;  1FNU A;  3AMU A;  2XWJ B;  4OIJ A;  3SK8 A;  2JEA I;  4A3J B;  5A35 A;  2ZXO A;  3U9S A;  3VYU A;  4TSS A;  4NP5 A;  2VB2 X;  2ID0 A;  4FF2 A;  2DNC A;  2L5T A;  1SMY D;  3P7J A;  4TRD A;  3S16 B;  5JOB A;  1IW7 C;  1WTX A;  2PZT A;  4U67 3;  2F0V A;  3VYS A;  4XQN A;  2L4N A;  3QOJ A;  3CQZ B;  1QG7 A;  1V43 A;  1NUC A;  2NVT B;  2M00 A;  1HFG A;  3BG3 A;  3KBG A;  2A5H A;  3IFT A;  4LMQ D;  1AFP A;  5KNB A;  4IFD H;  1CM9 A;  2F0W A;  1D1K A;  5KGU A;  1V8Q A;  2BCO A;  1ZYR D;  3HP3 A;  4H7B A;  2A69 D;  4DK1 A;  1MSH A;  3E5S A;  4LK1 C;  3TZU A;  5C0X G;  5C0X H;  1PRT B;  4L6T B;  1F2Z A;  1PXU A;  1NR2 A;  2MUY A;  3BDC A;  2BDO A;  3GTG B;  3QO2 A;  4KN4 C;  2RKS A;  4IUN A;  4RAU C;  3TP5 A;  1EFI D;  4FXG C;  1XYI A;  5IT9 E;  1SE2 A;  3DXJ C;  1IHZ A;  3VYR A;  3IAY A;  1ENC A;  3NK9 A;  3AB9 A;  5C6A A;  2O5J C;  5TSS A;  2N55 A;  3D6C A;  4OL7 A;  1STG A;  3SE0 A;  2X6G A;  2RSN A;  1JWM D;  3GTK B;  2B63 B;  4I65 A;  2F0O A;  1TS3 A;  2AWO A;  1QCB D;  1CHP D;  4K14 A;  5FK9 C;  1EY0 A;  1V1O A;  1GXD C;  1D5X C;  2J7Z A;  4BS9 A;  3SR1 A;  4OGQ C;  1RTN A;  1JOO A;  4K5V A;  1JR0 D;  3HKZ B;  2WV6 D;  4F8M A;  1LTR D;  5K36 G;  3HOU B;  5EQ0 A;  3SVM A;  2JA5 B;  4RWS C;  3GQB A;  4RCN A;  3GTQ B;  3HEJ A;  3S1R B;  3BYY B;  1CZG A;  4KMU C;  4C3H B;  4DNR B;  2A68 D;  2K28 A;  4IAL A;  3T56 B;  2B2W C;  2XNA C;  3H91 A;  1W6K A;  5I6W A;  3VYT A;  4K8I A;  5IGD A;  1HUN A;  2F0E A;  1BDO A;  3GTL B;  1YNJ C;  2SNM A;  5CV6 A;  2B8G A;  1ZEQ X;  3D31 A;  2ICI A;  3S15 B;  1EY5 A;  3PIP 3;  2D62 A;  3TDQ A;  1D5Z C;  3WOF A;  3QB3 A;  1E2W A;  4WFN 3;  2B2U C;  2DY8 A;  4IFD J;  2F0L A;  4KTA A;  2A6E D;  1DXM A;  1RDP D;  2X69 A;  2KUM A;  3I4N B;  2F0F A;  1I4H A;  1DCZ A;  2XRS D;  2AWN A;  3TSS A;  3MAQ A;  3Q6S A;  4ZK9 B;  5C44 B;  1LLR D;  2IWH A;  3UI2 A;  1JC7 A;  1ML0 D;  1STB A;  1F2Y A;  5IT9 L;  4XYQ A;  2Z1C A;  4C3H G;  4R8N A;  1R4P B;  2JA7 B;  3X3M A;  2AQ3 B;  4ABN A;  1BCP C;  1ICW A;  1A6X A;  2TMP A;  1L0X B;  4IUQ A;  3MWY W;  1SYG A;  2EY6 A;  2E75 C;  1ENF A;  2B2U A;  2F0G A;  5EBD A;  4A93 B;  4Z9C B;  1T5E A;  5C0X I;  1CHQ D;  3T4A C;  3MEH A;  4RKL A;  1PYW D;  3F2U A;  1G29 1;  5IIF A;  1QNU A;  1B9M A;  3V96 A;  3IL8 A;  3D8G A;  3J7A V;  3S1M B;  1D1I A;  1M4V A;  1XXG A;  3H09 A;  3K0Y A;  1LTB D;  1J9O A;  4RKB A;  3T16 A;  1PRT C;  3NXW A;  4NW2 A;  1BR9 A;  3OOC A;  3A54 A;  5DM6 3;  5IGB A;  5J22 A;  1SJE D;  3N6R A;  1SYF A;  1ESR A;  2AUK A;  5JJZ A;  3OPO A;  1EOT A;  1BBX C;  5KNC A;  2F3W A;  3QIA A;  1UEA B;  2JYO A;  4DFA A;  4RCO A;  1TWG B;  3PMF A;  2PW7 A;  4PV1 C;  2IW3 A;  4DXF A;  4O42 A;  2HCC A;  3Q23 A;  3OIQ A;  3K5O A;  1NR4 A;  4DAY A;  2IT1 A;  2MP1 A;  3Q24 A;  1EL0 A;  3RLF A;  4KY7 A;  3FPU B;  1AP0 A;  2Z8L A;  5D65 A;  1JWS D;  3C1F A;  5CC4 A;  4EQO A;  3DWA A;  5CYU A;  2YU9 B;  3OW7 A;  1Q1B A;  4KY6 A;  5DEH A;  1RD9 D;  3ND8 A;  3P1H A;  2E2H B;  2KJX A;  4HCS A;  1PZI D;  4PMB A;  4KKU A;  2XRQ D;  3R2T A;  3NTH A;  3AU7 A;  5A2Q E;  2CQA A;  3BYT B;  4UDU C;  1DOL A;  2B2T C;  4IUU A;  2F4I A;  2CHB D;  1STN A;  3PO3 B;  2EY5 A;  1V1P A;  4FF4 A;  1A3T A;  2NWG A;  4XIG S;  2KA7 A;  2B39 A;  1S5C D;  4F87 A;  4WJW A;  3NQT A;  4A3I B;  1C4Q A;  3I91 A;  5C5M A;  4G57 A;  5C3W A;  1WD0 A;  5EPJ A;  1LV9 A;  3J7A F;  1EIH A;  2Z4H A;  5CGK A;  4HSP A;  1SND A;  2JA8 B;  4ZUI A;  2RSO A;  1YNJ D;  4A3E B;  3TN2 A;  4NKL A;  3MTS A;  4CGY B;  3PUW A;  2XN9 C;  5K5P A;  1VF7 A;  1LAB A;  4V19 0;  4HED A;  4DA2 A;  1UUP A;  4RA8 A;  2X6L A;  3EJI A;  2CW0 D;  3Q0A A;  4B08 A;  3DEP A;  2ENB A;  3H6M A;  1SNQ A;  1O78 A;  2XVS A;  2EOT A;  5FO7 B;  1U4R A;  3OIP A;  1W6J A;  1I4X A;  2A69 C;  4PMC A;  5C3X A;  2M9V A;  1S5B D;  5JVG 3;  1LTA D;  3SEB A;  4G4K A;  5IGG A;  2SEB D;  1BF4 A;  1QIL A;  5E1F A;  1KTK A;  1EY4 A;  3V05 A;  1AZQ A;  3MFG A;  1VCI A;  4BA2 I;  3KLS X;  3A56 A;  5E4W C;  3URY A;  3DEO A;  2D2C C;  2PCF B;  3JAM E;  2JXM B;  3FMC A;  1B53 A;  5ELB A;  4C1N I;  2B2V C;  2VUM B;  2RVL A;  3O13 A;  4KKT A;  1CQV A;  5C4X B;  2RDG A;  1K83 B;  2FMC A;  2KCN A;  5T1G A;  1SNC A;  5D14 A;  4C2M B;  1WTV A;  3R93 A;  3VR3 A;  5EKK A;  2I07 B;  4NDX A;  1JE4 A;  5CV8 A;  5C0X J;  2EYM A;  1GOZ A;  3T13 A;  4IUV A;  1GUO A;  3K5N A;  4S3S A;  3A8J E;  1B50 A;  4FXK C;  2KQ3 A;  1R4Q B;  2B8F A;  4ULL A;  4ZKB B;  3QJY A;  2RQX A;  2LFN A;  2KVM A;  1HXY D;  2VNU D;  5A2Q L;  5JPN C;  4KN7 C;  2K32 A;  4JBW A;  3D3R A;  4BY1 B;  3I4M B;  4HCE A;  3P20 A;  3SXH A;  1KLU D;  5COY A;  2CW0 C;  2VXW A;  2QEJ C;  3NPP A;  4C56 C;  5C5L A;  3HOX B;  3D6W A;  1YNN C;  3VA7 A;  2L9H A;  1PRT D;  3M3Y B;  3H0G B;  1TT2 A;  3SK5 A;  2F0I A;  5J1Z A;  4A3D B;  2HDL A;  1HTL D;  2EYH A;  2AQ1 B;  2IX1 A;  2K05 A;  4R9W A;  1CZW A;  1QWY A;  2WAC A;  1KDA A;  3SDZ A;  1TWC B;  3DWQ A;  3RZD B;  1SAP A;  1WVL A;  3NHH A;  3M4Y A;  3NTK A;  4ZRZ A;  1BCP B;  4ZLT F;  2F1M A;  2E74 C;  4N9T A;  4QUC A;  3VR6 A;  3S2D B;  2NYZ D;  2EYO A;  5M5X B;  1VDZ A;  1C8C A;  1TII D;  2NUC A;  2EJF C;  5COR A;  3HOY B;  4KI0 A;  1BCP D;  1E2V A;  3QOL A;  5DM7 3;  5CMD A;  3S1Q B;  2JSO A;  1RKN A;  4KKS A;  1OO9 B;  3BS1 A;  4K5X A;  1PFM A;  3OHX C;  4LAA A;  1UNS A;  5LHY 1;  2QIL A;  4F88 A;  4G7O C;  4KY5 A;  2DNE A;  4I7Z C;  1QE6 A;  4CBV A;  5JEA J;  2RDH A;  5CBE E;  1SNO A;  2F0M A;  3K5L A;  4ZYS A;  1EQT A;  3JAM L;  4QIW B;  2Z4I A;  4EQP A;  2WIN B;  1FYC A;  4EQN A;  4F7X A;  1EY9 A;  1HCZ A;  2EYL A;  4BBS B;  4HN7 A;  1U4M A;  3M7N A;  3CKI B;  4ZKC B;  4RH6 A;  5EPK A;  4RGO S;  1RTO A;  4KV6 A;  3PUX A;  4OO1 G;  2ZXR A;  1EZ8 A;  4RHS A;  3K59 A;  1PZK D;  1OXT A;  3TZD A;  5BN3 A;  5FOB B;  3PO2 B;  1SE3 A;  5M5Y B;  1AN8 A;  2EDG A;  5M9O A;  4K5W A;  1RHP A;  4DAP A;  4ILW A;  2J4X A;  4HAE A;  2LKV A;  1KAA A;  1EYD A;  4R8I A;  2L12 A;  4IUR A;  2BDN A;  1Y8P B;  1EY6 A;  3CHB D;  5CR3 A;  2D9U A;  5I2Y A;  1VMC A;  2G9D A;  3BZD B;  3I8Z A;  3BVM A;  5KIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...