1EZ6A

Structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez6A00
4F7XA 2F3VA 3C1FA 3DHQA 5DEHA 5HGTA 5CV8A 1EYAA 1F2ZA 1IHZA 1STHA 2F0PA 2NUCA 3H6MA 3T13A 5C4ZA 3ITPA 4QF4A 3BDLA 4WRDA 1A2TA 3P75A 3SK5A 5C5MA 4QB4A 4KJNA 1EQVA 5M9OA 3SK6A 4EQNA 5KEEA 5IODA 5IGDA 5IIFA 5KYIA 4I65A 3MVVA 5EKKA 5C3XA 5C4HA 1ENCA 5I9OA 4F8MA 2F0VA 2WACA 2F0SA 2F0OA 3QOLA 1SYDA 2M00A 3TP6A 2EXZA 4OL7A 5IGGA 5IGBA 5JAVA 4B9WA 4E6IA 2RBMA 1SNCA 3NP8A 3QB3A 2SNMA 4LAAA 4DGZA 4ODGA 2PW5A 3OWFA 5CV4A 4K8JA 4N9PA 4H7BA 4ME5A 3RUZA 4EVOA 2KQ3A 4K2KA 4K8IA 4K5WA 5C5LA 5CR3A 4PNYA 1TT2A 5DAUA 3D4DA 1EYCA 5E3FA 2EYPA 4K2LA 5I6YA 2EY2A 5C6AA 4K6DA 2PYKA 4HMJA 4YIJA 1F2MA 1SYFA 3SK8A 3T16A 4KY7A 3TP5A 1SYEA 3QOJA 3D4WA 4KHVA 4KY5A 4PMCA 1EYDA 3NQTA 5KIXA 1SNDA 2F0IA 2PZWA 4IZ8A 5CV9A 3SR1A 1EY0A 1NSNS 4G57A 4IALA 5I6WA 1KAAA 2OXPA 3EROA 3S9WA 1A3TA 1JOKA 1RKNA 2F0LA 1NUCA 2F0TA 2F0FA 2LKVA 3NXWA 3OSOA 4KY6A 5CGKA 3EVQA 5CC4A 2QDBA 1KABA 2EYMA 4R8NA 1STGA 4ZQ3A 2F0GA 4S3SA 4KD4A 5J39A 4PMBA 4J1MA 1A3VA 3NK9A 1SNMA 4HTHA 1EY6A 2KHSA 1KDBA 4J6HA 4DU9A 2F0DA 5NUCA 2OEOA 3MEHA 3EJIA 5F2DA 4DFAA 4EQOA 4HMIA 4NMZA 2EY1A 4DF7A 1EY5A 1EY8A 3BDCA 3D6CA 3D8GA 3LX0A 1EY7A 1AEXA 1SNPA 2PQEA 5IGEA 2F0EA 4ZUJA 3TMEA 1STAA 2F0MA 2F3WA 1EZ6A 1TR5A 1F2YA 2EYJA 4MIUA 2RDFA 3VA5A 1SNQA 1EY4A 4ID6A 5J22A 1STBA 3HEJA 3P1HA 5CV6A 5K5PA 2F0JA 5EKLA 5ISRA 2EY5A 5CV7A 3TP7A 4K5XA 3TP8A 1KDCA 1U9RA 1STYA 1II3A 1JOQA 4RKBA 5KYLA 1SNOA 4KV6A 3NHHA 5J1ZA 5CV5A 5IGCA 3U9OA 2PW7A 4KTAA 5E1FA 3SHLA 1A3UA 3R3OA 4KD3A 2F0WA 2PZUA 1SYBA 4IUNA 2EY6A 3SXHA 2F0KA 2F0QA 3C1EA 4B9XA 4QMGA 3SK4A 4TRDA 1TQOA 3MZ5A 2EYOA 4NKLA 4ZUIA 2EYLA 1ENAA 2F0UA 4EQPA 5HURA 5EGTA 2ENBA 2F0HA 2RKSA 3OMGA 4NDXA 5IOCA 4KJOA 1A2UA 2EYHA 4WORA 1KDAA 2OF1A 1SYGA 4K14A 1SYCA 5C3WA 2F0NA 5KGUA 5KRUA 1STNA 5IGFA 3V2TA 2SOBA 4K5VA 2PZTA 2SNSA 3MHBA 3DMUA 3PMFA 3NUCA 4N9TA 3ERQA 2HQEA 2O4XA 5JOBA 3HZXA 1EY9A 5I9PA 3MXPA 4RKLA 1JOOA 1EZ8A 2EYFA 3E5SA 4NP5A 3OMCA 1JORA
chains in the Genus database with same CATH superfamily
1V43A 2B2VA 1HNWL 3TS2A 1Q1BA 2KECA 1EQVA 4R4TA 3IAYA 4DAYA 3SVMA 1LT3D 1WCMG 3Q8DA 3UDGA 1YHAA 2WIIB 2NVYB 3QOLA 1VMPA 3HOVH 4E6IA 1I4PA 4LAAA 2VNUD 3H3VC 4WJ3M 5C3EB 2LMCB 2KQ3A 5ELFA 2AQ3B 3NWSA 3CD6A 4A3GB 4DR3Q 2K1BA 4YIJA 3KBXA 4KY7A 1UE5A 4NXNL 3BYTB 3S1NB 4NXNQ 3DUZA 2UXCL 1I5FA 4IALA 4OXPA 1R9TB 1D2BA 3D3RA 3W2DA 5IY0A 2F0FA 3GV6A 1Q12A 3GO5A 4LFBQ 4A93G 1LACA 5D65A 1TU2B 1PA6A 4CDEC 3SEBA 2AWOA 1KQSA 4LFAQ 1EU3A 2D9UA 4EX5A 2K5DA 3NK9A 4JI7L 4DUYQ 1N32L 1PLFA 2QILA 3CCVA 3X3NA 1WVLA 3KUPA 3S14H 3UI2A 3D6CA 1UEBA 1K8GA 4JBJA 2UXDL 4HCEA 5JPNC 4OO1I 4CJ0B 3VDYA 3VYUA 4ZLTF 4AYBB 3BVGA 2Y0SE 1ZYRC 1Q8KA 1AZPA 5IT9E 5K5PA 2F0JA 2CW0C 1CK1A 1PFSA 4LK1C 3TP8A 5LMNL 2B63G 4BY1H 2UUBQ 1CKNA 2A1AA 2BA1A 4IN3A 1S3OA 3C1EA 3CCUA 3NPPA 3RZDB 4LF6Q 1LO5D 4JW0A 2EYHA 3LGJA 1KHIA 2DUDA 2OTJA 2Q8IB 2A74C 2PI2E 4JBWA 3HKSA 1IW7D 5EPLA 4RKLA 3TBIB 2VY3A 1VQPA 3CMEA 2B63B 3J7A5 3E6ZX 1IHZA 1YEZA 2B63H 1IYJB 3NQIA 3SK5A 4ABNA 4LF8Q 5AJ3L 1I4HA 1B70B 5IIFA 4I65A 2F4VQ 3ONAB 4GLVB 4LMQD 4HJ5A 4HJ8A 2R93H 3EBEA 5BR8Q 3VR4A 4F8MA 2WACA 1VQJA 1LV9A 2QEXA 1HRJA 2XRQD 5JAVA 2F1MA 1EIFA 3CRKC 3MC0B 1L2FA 4C2MB 1SNCA 5FOBB 2VUMH 2QF7A 3A56A 3A5ZB 4UPAA 1GUTA 4N9PA 4A3IG 4DR4Q 1CKOA 1XWEA 1NNXA 3BZKA 5C0XI 3DM3A 1PZJD 3HOWH 2FMMA 4H0LC 1FJGL 2CKZB 4LFAL 2X6LA 1B3AA 5GAHC 1CT1D 1BBUA 3FVQA 4KHVA 4BY1B 1SNDA 1E22A 1JORA 3GTJH 3J80L 2LKVA 4A75A 3EVQA 2O2LD 1HZCA 2O5JC 3PUWA 2CH4W 1LTAD 1C8CA 1BF4A 3D4RA 1F9QA 1SNMA 4C3HG 2WB1G 2X6GA 2VS1A 1QCBD 1TS2A 1I6HB 4A3IB 2NVQB 2MGSA 3S16B 1VQGA 5IYDH 2VZAA 1E7ZA 1YJNA 3G48A 1O80A 4BBRG 2F0MA 4MIUA 4RFBA 4X3UA 4HSPA 1LM0A 1Q81C 1C48A 4B08A 5FO9B 5TSSA 5CBEE 5EKLA 1LTGD 1XPRA 3IRBA 4A3JB 3TEHB 4DXGA 2JJQA 1IBML 5IGCA 5E1FA 2PZUA 3GTQB 2MNAA 2QCPX 1PTOD 2B2WC 2L55A 4QMGA 1PZKD 3FKIB 2B2YC 4NKLA 4FNFA 1L0YB 1KAWA 2WKDA 4GNXA 1PRTD 1EWHA 1KTKA 2RKSA 3FRPB 2K5NA 3KOJA 2E2DC 3NWTA 2YTVA 3CCRA 5M5WB 1Q90A 3PO2G 5JEAJ 4B3RL 1XMQQ 2AQ1B 5FLXE 3MHBA 2SNSA 4OO1H 2ZJPA 3I56A 4AIMA 1V1PA 4GN3B 1ET6A 1WTVA 1U4PA 3K81C 2JA7H 4DNIA 3V96A 3ERSX 2HIVA 3WDNA 4DV6L 1FL0A 2NB0A 4Q0FA 1VQEA 4LF4Q 3QIAA 2UXBL 3K59A 2XIWA 1ENCA 2J0TD 3WOEA 3L3OC 4UAIA 1H9MA 4FYDA 2A68C 4C56C 2WAQE 3PIO3 2I5LX 2Q8RE 3CCLA 2JA8H 3HFZB 3GTMH 4EVOA 4PNYA 4IOAA 5DAUA 3U50C 4DR5L 4K2LA 4L6TB 1FD7D 1XTCD 1QNKA 1PYWD 3L9AX 3HG9A 4LF8L 4YHHL 2XSCA 2D5DA 2WB1E 1BVSA 4BA1I 2G9DA 4DR6L 4DR4L 2VUMB 1BBXC 1N9WA 2I46A 1NUCA 2DJFC 1BUVT 1I4QA 3PUXA 2JEBI 2RVLA 2E8GA 5CC4A 2QDBA 1HR0W 2VQFQ 4R8NA 1D7QA 4DK1A 1TWGH 1ONLA 1LTTD 4CKBA 2PNRC 1TWHB 4JI4L 4CBVA 2CWAA 2MPMA 1TR5A 4JPBW 3TZUA 1B50A 4OELB 3BZDB 1W3SA 2IY5B 4DV5L 4YWKA 4B3TL 3J80i 2JA6G 4KHZA 3I73A 1S5CD 3T4AC 1JWUD 1RF2D 4MTNA 1VQAA 2RF4A 1G6ZA 3NSWA 1Y1VH 2NVQH 2KHJA 3NE5B 4B3RQ 3SK4A 2NN6H 2D62A 1XMQL 1YNJC 3MZ5A 1WTHA 5ELCA 5ELOA 1U4LA 4N8FA 2B2WA 1MKHA 5D3DA 5IOCA 1DYQA 2F0NA 1PTOC 2GVBA 1PYSB 1K8AC 4MNOA 2IWHA 2O4XA 1G2SA 3H15A 1K73C 1EY9A 3K0XA 3DWPA 3CC2A 5H1SE 3J80c 1B7YB 3N6RA 4DR1Q 3F2BA 3AMUA 4OWTB 2L0CA 4DK3C 2EOTA 2QGQA 4Q5VA 1JQYD 1GHKA 2KEEA 3OIQA 1B8AA 1BBWA 4EQNA 1NTGA 2ZTDA 5IODA 4A3LG 4KK7A 4OGQC 1VDZA 5JJLA 5IGGA 4RHSA 2FJ2A 4ZRZA 2DN8A 1N36Q 2VB3X 3H0GB 3KLWA 3RUZA 5C5LA 4DV4Q 2EJFC 3BVZA 3DWAA 2EYPA 2JK8A 3A8IE 4X65Q 2A6EC 3C3LA 4K0KL 2Z6KC 4KLKA 2ZTEA 3HGBA 3R2IA 1GUWA 5EPKA 5GQOA 1JOKA 1S5FD 3NXWA 2WKCA 3L2PA 2NWGA 4IQZA 1Q1EA 1H9RA 1R9TH 1B9NA 3EIVA 3OIPA 4PMBA 1KDBA 2C9OA 1BO0A 5BR8L 1KIXA 3MEHA 5F2DA 4EQOA 2EQSA 2JN4A 4QJFA 3ND9A 3VA7A 2JA9A 1IBKL 3I4OA 5GADC 2F3WA 5E4WC 2HDLA 3AYHB 2PMZB 4FXDA 1MJEA 1EY4A 2UXBQ 2JXMB 5J22A 4DR1L 3BG3A 1H9SA 1XXGA 5IYBG 2UU9L 4JI3L 1VQNA 1DOMA 4CHTB 4GNXB 4KV6A 1XNRL 2JA6B 1CSQA 3FMCA 1GUGA 1IZ6A 4JI8L 1TWAB 3HOWB 4JYAL 4GKKL 2J4XA 1M90C 3GP7A 3RLFA 1VQ7A 3CCQA 4IUUA 3M4OH 4A3EH 1SYGA 1X3PA 3I55A 4LF6L 1G2TA 5LL6X 1R4PB 1YNJD 2JA8G 2A6ED 3A5UA 4HIKA 1SLJA 3H91A 4JOIC 5IP9H 3D6WA 4HJ9A 1P16A 5IYCH 4F7XA 4ALPA 3C1FA 1JJ2A 1I4RA 5DEHA 1SMYD 3H6MA 2HDMA 4PZ8A 3ICEA 2IPKD 5C5MA 2K14A 4DV3Q 4JI4Q 3SK6A 3VR2A 3M85A 1I3QB 3HOXH 4WFN3 3QWNA 3I4MH 3Q23A 3DEPA 5C3XA 5C4HA 2KJXA 4HJAA 5IGBA 1BDOA 4QY7A 4A3MG 3NP8A 1WTPA 2V4DA 1HH2P 3S2DH 4DR7Q 5FLXc 4LNQA 3S14B 1PMRA 4CDFC 2OQ0A 2FINB 4JBKA 5GAGC 1TWFB 4OIKA 3Q22A 2BCOA 1WTWA 4LF9Q 4QIWB 1A3TA 2KCMA 4BY1G 1B2TA 4QCLA 4CJ2C 2R7ZG 2YTYA 2EYMA 4DA2A 1N33L 2LSSA 1QILA 1IBLQ 1SE3A 3ULPA 1JT8A 1EY6A 2KHSA 1HNZQ 1AZQA 4DU9A 2IW3A 1S40A 4IURA 1QE6A 1GO3E 1Z9FA 4NMZA 3EFXD 1NBWA 3PF4A 1TY2A 2K7VA 2Y0SB 2E2IB 1PRTF 1YHBA 4ZK9B 4RH6A 3KJOA 3K7UC 4XYOA 3GTOH 3VA5A 2K5VA 5ELEA 4B3SQ 1ESFA 4QGUA 2JA5G 4GLAC 4NXML 2GA4B 5M3MB 1BNZA 1BR9A 4UHVA 3FDTA 2Q2TA 1D6EC 1I94L 2ICEC 3AFQA 1SE8A 3P7JA 4MN3A 1S4ZA 2R7ZB 4NXMQ 1RCVD 2F0QA 5BN3A 5BN5A 2A73B 3R8BA 4ZUIA 1A63A 1QVCA 3U9SA 1LT5D 2RDGA 5DNFA 1QWYA 5A2QE 3AB9A 4A3DG 3E9HA 1STNA 1K8MA 1R4QB 4C3JG 3RN2A 1IL8A 2LY7A 2QKIC 2JA6H 4RGNA 2K05A 3DHQA 2F4IA 1K9MC 3J81j 2F0PA 5C4ZA 4LJZC 3J7ZC 3P75A 3QJYA 3K57A 4RA8A 5I4DA 1A62A 5IYCG 2N49A 3VR3A 4JVZA 5I9OA 1PZID 3TN2A 1EIHA 4L5RC 2MQHA 3TSSA 2SNMA 1Y1VB 2NZHA 4A3DB 4K8JA 3KDFB 4I7AA 4A3DH 3S1QH 4QQBX 4K5WA 1GUSA 3M4PA 3I2ZA 1SRUA 4DK6C 3HOXB 1V1OA 1RL2A 2L15A 3FP9A 4A93B 5E7NA 2WFWA 5KNCA 5FO7B 1RKNA 1M1KC 3PUYA 1PH5A 1A3VA 3NTIA 1HA5A 1CHQD 5FJ8G 1PTOH 5NUCA 1Y1VG 4KN7C 4NB3A 1EY5A 3D8GA 3OW2A 3GQBA 1EY7A 2N8NA 4UP8A 5M5XB 1LTLA 2BE5D 4Y7NB 4BA2I 2NZ1D 3KF8B 3HOXG 1EUJA 1FNWA 1KDCA 4A3EB 4DNRB 4X62Q 1ASYA 2YV5A 1H9JA 2VXWA 1AFPA 1EQRA 4C3HH 2F0KA 4DN4M 1X54A 1BKBA 5HURA 3HOYH 4GN5A 1K3BC 4H44C 5GAEC 1IBKQ 1S5BD 5C4JH 5M5YB 4KJOA 2I0QA 3QO2A 2A19A 2R7FA 1UE6A 2CCZA 5KRUA 3CQZH 2PQAB 5M3MH 1J5EQ 1CA5A 4RHRA 2MJ8A 1AE3A 3KF6A 1WJJA 2QDLA 3J81c 2UU9Q 4A3BG 5IWAL 1G91A 3Q24A 4B3ML 3CAMA 3NBIA 1WCMH 2NTTA 3NELA 2DNEA 1BCPD 3PIOA 4CGYB 3KYHC 4ME3A 3STBC 3G4SA 1STHA 3CMAA 2N88A 3PSIA 3BDLA 3PUZA 2MUYA 1E1OA 5M9OA 2OTLA 4G7HC 3GTPB 3ER0A 4M8AA 4C2MH 4ZCKA 1O7ZA 4TSSA 3TP6A 5LMNQ 3CC7A 5JJIA 3F2UA 5DM63 4GS3A 4Y7NH 1BCPF 4ME5A 3U58A 4A3FH 3D4DA 1EYCA 1YJ9A 3AQQA 4YY3L 4XDXA 5C0XH 2EY2A 3PIP3 4K6DA 3H3VH 3SDZA 4JI5Q 1KRTA 1EYDA 5CV9A 5C4XG 1QVFA 1DXMA 1GXDC 4LUOA 1W2BA 3VYTA 2F0TA 5IT9L 3OTOQ 1TWCB 1X3EA 3E0JA 1LT4D 1MI2A 1HNXQ 3OTOL 1QOHA 2DNCA 2F0GA 1PRTB 5KNDA 4ULLA 3KLSX 4LF9L 1CM9A 2HT1A 2EIFA 3MWYW 3RZOB 5HY6A 5FKAC 1G8ZD 1ZKOA 3W3AA 1XJVA 4HMIA 3I4NB 1E24A 3AU7A 1HQMC 2PQEA 4DKAC 5IGEA 3R2TA 1STAA 2LFNA 3CCEA 1FGBD 4DV7Q 3S24A 4X66Q 1X55A 3TS0A 1Q8IA 4R4QA 2B29A 4IUVA 2PO4A 5DLQE 2HHHL 2ZM6Q 4KKSA 4HIOA 5KYLA 1A15A 1Y1WG 1A6XA 1SR3A 1VQFA 3T1HQ 4DV0L 1MSGA 1HR0Q 2AWNA 5EPJA 1YNNC 5AFWA 1E2VA 3SE0A 1UUPA 1N34Q 5L37A 1SFOB 1MD2D 1JB3A 1E1TA 2JYOA 3U4VA 2E2JH 5C3WA 2EVBA 4K6LA 4A3FG 5CYUA 1CQFA 1XTDA 2SOBA 3GTJB 4JI6L 2HQEA 1SE4A 4JV5Q 4I7ZC 1MSHA 2QEJC 5C3EH 3MXUA 3E5SA 2FXQA 4DV1Q 4OWXB 1TKWB 3VR5A 1F2ZA 2RCFA 3T13A 1SN8A 4MHEA 1HQRD 1A2TA 1NAPA 1VS0A 2HQLA 4C3IH 2TMPA 1MBYA 3CU7A 1KD1C 5JEAH 2L11A 4YY3Q 2JEAI 2QA4A 1VQ6A 5LMUQ 4FF1A 1PH4A 1EU4A 1FJGQ 1B53A 1M4VA 1YNXA 4XQQA 3LWUA 1ILPA 4TVAB 5C6AA 4RCOA 3SK8A 4A3CH 4PZ6A 3T16A 1K3RA 2UUAQ 1S72A 3CP0A 1HJPA 4HR7B 4BBSH 1HZAA 1LTSD 1YNND 4R1JA 1NSNS 3V05A 2OXPA 3OPOA 5C4XH 1OO9B 4POGA 1TWGB 4X64L 4S3SA 4JI7Q 1E0BA 2ES2A 1Y14B 2AMCB 1LTBD 4QL5A 1N33Q 3S1MB 3I4MG 2B2YA 5LMUL 1SMYC 2YTXA 1VQMA 4MTKA 1Q46A 4JCVE 1FVIA 3I91A 1E2WA 2E74C 2OT2A 4DK0A 1PH8A 1HZ9A 1RJTA 2NYZD 3TP7A 4TQUS 3K8AA 1N34L 1GVPA 3GTOB 3S2HB 1GHJA 2C35B 5IP7H 3NHHA 3S1NH 4LF5L 3GTMB 2D0OA 1WTRA 4IUQA 3DM1A 4UP7A 2Z4IA 4OHJA 2PQAA 4BY7H 5C44G 2C5CA 3M3YH 4IPDA 5G3LF 2R7ZH 2NBFA 3I4MB 4F87A 2ZM6L 3JAME 1XYIA 3BU2A 1CZGA 3A8KE 1F9PA 1IBMQ 4JK1C 4DV7L 3GTQH 2MO0A 1SAPA 1Y8NB 3HKZB 4A3GG 1Q7YC 2R3ZA 2WP8J 2EYFA 1ENFA 5ISRA 4LFCQ 3OMCA 2LS01 4WJWA 4YWLA 3K5MA 1H9SB 5FO8B 3CF5A 5M5WH 1C9OA 1O7YA 2B2TA 4AQYQ 2JP1A 3KJPA 2LXKA 4KJNA 1CA6A 4JC0A 1HCZA 1I94Q 3STBD 5JEAG 3H0GG 1XX8A 5IYDG 1SMXA 4P74A 1HHVA 5HGQA 4P71A 4GKJQ 2VQEQ 1HFGA 3TZDA 2R7DA 3GTLH 3S15H 2A5HA 3NTKA 1TVXA 1YVCA 1Z7TA 3HKZG 2IX1A 3KBGA 4XXEA 2PYKA 1DZ1A 1WTQA 1J8IA 3EA6A 1SYEA 4KY5A 1VQIA 4C3IB 1I6VC 4JI0L 3IFDA 3S9WA 2F0LA 3MXNB 1GM5A 1UEAB 1X3FA 4ZQ3A 1RTOA 4L5SA 2E76C 1KXLA 5DM73 3HOUG 3J7AV 2SEBD 4DFAA 1Y1WH 1VF7A 2XNAC 2EY1A 4CKEA 1EY8A 3M4QA 3M7NA 1RODA 2A6HD 1EZ6A 4IPCA 4Z9CB 3OHXC 2P5ZX 2H5XA 5CORA 1J9OA 3A74A 2K50A 2UUBL 4RKBA 1D1KA 1CTMA 4FVMA 1DOLA 2RSNA 3KF8A 1N36L 4PQXA 2IX3A 1X3GA 3J7AF 3H94A 4C1NK 1XPUA 1H9KA 1STEA 2EYOA 1ENAA 1B44D 1IW7C 1F77A 2OF1A 3GTKB 2ZXRA 3PUVA 3S17B 2Z4HA 1JWMD 2K28A 3PF5A 2D0PA 5IYBH 1PH7A 3S1QB 3WWVA 2D2CC 2GN5A 3PIPA 2F03A 4L8JA 5HGTA 1L0XB 3VR6A 1EYAA 2X69A 3KF6B 2WAQG 2K32A 2XWBB 4CDCC 3RMHA 4QUFA 1UE1A 3MVVA 4FF3A 2L4NA 4A3LH 4X66L 1ICWA 2EXZA 1IYVA 1X6OA 3PCOB 4EGVA 4DR7L 2B2VC 4HEDA 4QIWE 5EQ0A 1EEID 3GTGH 1NMGA 1B4OA 5E3FA 4HIDA 2GVAA 4BS9A 1IKMA 3F8TA 1PYBA 1TWAH 1SSOA 1FNVA 2ALYB 2AUJD 2E75C 2WAQB 4A3JG 1XMOL 2DGYA 1ZEQX 3A7AB 5CGKA 1C4QA 1GUOA 5A35A 4OX9Q 2E5LQ 5JVG3 4IFDI 1AP0A 1STGA 5EBCA 4AYBE 4KD4A 4R4OA 1VQBA 4J1MA 1ILQA 3FKIG 2K5QA 1OTCA 3WOFA 2Y0SG 5T1GA 4GLXA 4GOPB 2Z9HA 1VQ4A 2CVRA 2OEOA 2XRSD 3EJIA 4IUTA 1KLGD 2EXDA 4HSVA 2Q2HA 1QUQB 3LX0A 3RZOH 1SNPA 3HOVG 2K01A 1D5XC 1I4XA 2F52A 5K36H 1ESRA 2JA8B 2JA5B 4J8QA 3BDOA 1DOKA 5COYA 4R9WA 3D0FA 1KNEA 4POFA 3P1HA 4DR2L 2PNHA 2E2HH 2NZOA 4X3SA 3ZJYC 2L12A 4Y52H 2A6HC 4DV6Q 1SNOA 1X56A 1CKMA 4JV5L 1Y1WB 1G6PA 5J3BA 3HOYG 1PTOB 4LF7Q 4R4IA 3PV0A 2ENBA 1U4MA 4BBSB 1NY4A 1JJGA 3C2PA 3MFYA 3E0EA 1RDPD 4GNXC 4KN4C 4U68A 1KL9A 3DMUA 5CBAE 5LMNW 4A3FB 3G6EA 2BDOA 1PXUA 1XPOA 3H0GH 4NPSA 1NCVA 4IFDJ 3L7ZC 1HPCA 1PH6A 1VQ5A 4EQ5A 5CV8A 5IP7G 2NUCA 5K36G 1EOTA 2VUMG 2B3GA 3GTLB 3S15B 4QB4A 1RD9D 2R6GA 1EQQA 3ULLA 3HOYB 3GD7A 3GDEA 4FDBA 2JQOA 1Z6HA 2F3IA 3A0JA 2F0OA 1SYDA 3N52A 2AUKA 3CQZB 2HCIA 4B9WA 1H95A 2MHVA 4MZ9A 4DGZA 2KCTA 3HKZE 1D5ZC 4YCVA 1XMOQ 2YU9H 1VQOA 1OXUA 2N3SA 3I4NH 2E2HB 3LWEA 1YITA 4O1NA 4UP9A 2EDGA 3MXNA 3I90A 2H4OA 1JE5A 3W1GA 4JI5L 2F0IA 1VQHA 5T1IA 3SR1A 5M3MG 3QR8A 5FLMH 2IL8A 5I6WA 3OSOA 4ZKBB 3HOZH 1PDQA 2XN9C 3G7LA 1V9PA 2A68D 5M5XH 3G71A 1RTNA 2K52A 1HTPA 1WTXA 3DEOA 4X64Q 4APVA 3B6YA 5IT9c 2XTIA 3S1MH 1Q86C 5LHY1 2JA7G 1D5MC 4P2CB 3MA2B 1PH3A 2EYJA 4BWGB 1CKNB 1EIYB 5EAYA 3VYSA 4DAPA 4O42A 4C3IG 1STYA 1KNAA 3GTKH 4GOPA 4LF7L 4DNTB 3RLNA 4G4KA 5FJ8H 2KHIA 2F0WA 3K58A 1PH2A 3E9IA 4P75A 3I72A 3KDFA 3M9BA 2UUCL 3HOUB 5EGTA 1QVGA 3FPUB 1ZXTA 3OMGA 3VYRA 4FF4A 3CRLC 4YCUA 3PO3B 1SYCA 5EBDA 4X6AH 4A3JH 3DWQA 5I2XA 4RGTA 3FEWX 5IWAQ 4JYAQ 1HNZL 2NVXB 4KMUC 1OXSC 4XT1B 1HXYD 1DD2A 2CHBD 4L63B 1MGSA 4R4CA 3HZXA 2ZJRA 2BDNA 2B39A 5I9PA 4ZKCB 4PV1C 2B8FA 4XQNA 3K7AB 2VW9A 1JWSD 4UY8C 1EOVA 1WFQA 4QF4A 1DONA 2BH8A 2G9HD 4ZAIA 3GTGB 3F2CA 3MFGA 4GN4B 3CPWA 4DPGA 3MAQA 3S1RH 1TWFH 2K5WA 5EKKA 5KYIA 2F0SA 2VB2X 4DAMA 4OL7A 4DV0Q 3PO3G 1TIID 2PW5A 2XGTA 1V1PB 4JOIA 1VMCA 4DAYB 1JMCA 4OX9L 4DUZQ 1E3PA 3RZDH 4DUYL 3I3CA 2E5LL 1N32Q 5I6YA 2CFMA 2EE1A 1F2MA 1SYFA 2QW7A 4J15A 1JICA 4IJLA 3L0OA 5KIXA 2PZWA 4XTCS 2KCNA 1EYGA 5M3FH 4A3EG 1SE2A 4A3IH 1NR2A 1JC7A 3A54A 4RMFA 4EQPA 5JJKA 3UE1A 3ULJA 3FHWA 1OXXK 4A3MH 2R61A 4DV4L 3HOWG 3T1YL 5C44H 3A8JE 4JI2Q 4R8IA 4AH6A 3I4NG 2K6AA 3FPPA 4L5TA 1ET9A 2RDHA 4OEMB 3BDCA 3I7FA 3A7LA 5FLXL 1AEXA 3EN2A 2B2UC 4FXGC 3DXJC 3TMEA 1KLUD 2ZXPA 5EJWA 1EWIA 1YHQA 2NN6I 4H02A 1STBA 5IP9G 2DY8A 1NR4A 1UAPA 2EJGC 5CV7A 4AYBG 3BJUA 5KNBA 1CUKA 4ILWA 1HNWQ 4YWMA 3KFUA 1A3UA 3R3OA 4IUNA 2K75A 4PZ7A 3BZCA 1T5XD 4TRDA 3K0YA 2F0UA 2Z0SA 3TRZA 3M4OB 5C0XG 4IFDG 3PO2H 1HUMA 3HOVB 3NENA 1GOZA 5IGFA 4UDUC 3V2TA 1I50H 4K5VA 4XIGS 3Q6SA 4BBRB 2PZTA 3NUCA 1K0RA 1EEFD 3MXPA 4OONA 2O5IC 2H1EA 3S2HH 1F2LA 4BXXH 1UNSA 4RAUC 1ZYRD 1I6HH 2NTSA 5BN4A 1QUQA 2ZXOA 3ITPA 1F9SA 1Q82C 4V190 1QJOA 1XNQL 4OIJA 5C0XJ 2JA5H 2KENA 2K4KA 3NEMA 1L1OC 4X65L 1O7IA 2M00A 4FO2A 2A8VA 3J7YW 3K6OA 4ODGA 3JC66 5CV4A 1D1IA 1L1OB 2KBNA 3JAML 4HN7A 1S5ED 3FKIH 2Z1CA 2UUAL 2IT1A 4HMJA 3F2DA 1JR0D 1W6KA 3PQIA 3CCMA 4IZ8A 2L9HA 2M9VA 1L0WA 1TS4A 1KAAA 1IBLL 3BS1A 4DV2L 1LUZA 1MIUA 1GD7A 4CKCA 1SBBB 4PMWA 1LABA 2K5HA 1IYUA 1KABA 2IX0A 3CCSA 4LWCA 1BOSA 2NN6G 3NTHA 4HTHA 2RSOA 1YIJA 2I5MX 4QUCA 1AW7A 1GUNA 3UE0A 4BBRH 1B9MA 2N55A 3W5OA 4C3HB 4RG1A 4HAEA 5C4JB 2NVTH 4AQYL 1X32A 3S16H 2AKWB 2Z8LA 3HOUH 5CMDA 1N8RC 4FF2A 1A8VA 2Q2UA 2PCFB 1VF5C 1GJXA 2RCNA 2BE5C 2WINB 1FGUA 5C44B 1E2ZA 5J1ZA 1CFMA 2PW7A 1SDFA 2EY6A 1HFNA 2EJMA 4IFDH 4G7ZC 1TQOA 1PFMA 1BCPB 1ASZA 4C1NI 3K5LA 4BY7G 3T56B 1KC8C 4K14A 5KGUA 3Q0AA 1TS3A 3HOZB 3CKIB 4JI8Q 4RGMA 4N9TA 2FHTA 1ML0D 1P8LA 4IJHA 3S1RB 2KOLA 4LF5Q 3J81E 1SFOH 1XNRQ 3URYA 2HIXA 1EL0A 2WV6D 4DV2Q 1W6JA 1T9HA 2BA0A 1HUNA 4WRDA 3W1BA 3RR5A 1JE4A 5IGDA 4BXXG 4B3TQ 5EKIA 5LL6S 4XT3B 4ZYSA 1HZBA 3F1ZA 1UWVA 3QB3A 4C3JH 3HOZG 3OWFA 1Y8OB 3TDQA 4H7BA 2A69D 4C3JB 5ELBA 2HUGA 1SJHD 3MEFA 1DJRD 1EFWA 1YZ6A 4A3MB 2G5DA 5JJZA 4N8X1 2PPBC 1EFID 1IXRA 1TXYA 1JCKB 2YU9B 4FXKC 1VQCA 3CXCA 1S5DD 4PMCA 4JI1Q 1V1QA 1D8LA 4JI1L 5JPMC 5M3FG 1MHWC 1PTOF 1K0SA 3EROA 2B8GA 2OQKA 2NVXH 4K0KQ 4IPHA 2XWJB 5JVH3 4YHHQ 1L1OA 5FK9C 5ELDA 4X3KA 3R93A 4A3CG 2TSSA 2FMCA 1ICFB 1U5KA 5J39A 4LW1A 1WTOA 3S2DB 3AFPA 3KK7A 3J81L 2J7ZA 2MO1A 4LUVA 4J6HA 2F0DA 4F88A 1DM0B 2HD3A 3MTSA 1CHPD 3DLLA 2KA7A 1TS5A 2CWPA 4DXFA 2KVMA 2IJ0A 4ZUJA 3G6JB 3I8ZA 4JI0Q 3BVMA 4A3BB 2IHFA 3CC4A 2DJGC 4L5QA 4O0AA 4DAVA 1SXTA 1SNQA 1PVOA 1G51A 1RIPA 1YBYA 3H3VI 3HEJA 1G291 4RCNA 3LNNA 4GOPC 4DV3L 1Q3LA 4OO1G 1VQ8A 2YYZA 1HA6A 1QZHA 4GKJL 1JJCB 4KTAA 1U0LA 3SHLA 4IO9A 4KD3A 3CHBD 3T51B 2PI2A 2ZT9C 4A3GH 3OWEB 3CW2C 2EYLA 2N78A 3HP3A 1C7YA 4NDXA 2R92G 2NVTB 1YJWA 1SROA 2Q8TA 2I5HA 4A76A 2SDFA 4V0BA 1NMFA 3UDXA 1RHPA 1HR0L 3PMFA 3KLSA 5JOBA 4A3KG 1I3QH 1YI2A 4GZYC 2FFKB 2Z6BA 2CW0D 3TREA 2AHOB 1KRSA 3RLOA 1OXVA 3RD4A 1VQLA 2ATWA 1WD0A 3ZYYX 4JI3Q 2CQAA 3GTPH 2JSOA 1HNXL 2L1BA 3K80C 4WJ4A 4P73A 1IL2A 2KEDA 3J81i 5E4XA 2VL6A 3HRZC 3IL8A 2F0VA 1SJED 4H13C 2R92B 1TY0A 5IE8A 4KI0A 4DV5Q 2I07B 4K8IA 5I2YA 5CR3A 5FLMG 1TT2A 4A3KB 1B3QA 1FYCA 4HCSA 4LFBL 4A3KH 1QG7A 1DGSA 3SGIA 4XYQA 5AJ3Q 4NW2A 2A69C 1NJIC 5ELNA 1PHJA 1EY0A 2RA4A 2Z6KA 1PFBA 1TWCH 1I50B 1PV4A 1LTRD 3O13A 3S17H 2VQFL 1MJCA 2WB1B 5M3FB 1X65A 1LLRD 5M5YH 4YCWA 2KUMA 2V1CC 1BQQT 4G7OC 1VQKA 2JE6I 4JG2A 1X3QA 3M3YB 2BOSA 1K8OA 1Z47A 4DF7A 5D3IB 4B3MQ 3QG1A 3PO3H 3K5OA 3H09A 1AH9A 2RHSB 1XNQQ 1J6QA 1SEBD 5G3LD 2B2UA 1F2YA 2M2LA 2K04A 3JAMi 1PH9A 2VQEL 1FR3A 1K83H 1LT6D 2PMZE 4ID6A 3JAMc 1BCPC 1K83B 1C0AA 2EY5A 3U4ZA 1U9RA 3I4LA 4X3TA 2RHQB 2BH2A 2KCCA 1CQVA 2ID0A 5CV5A 3U9OA 1GKHA 3SXHA 1SYBA 4B9XA 4BBSG 4B3SL 2R92H 1J5EL 1EWCA 2ASBA 4A3BH 3OYYA 5D14A 1CSPA 2Q2IA 2F0HA 1WOCA 1A2UA 2ZJQA 3ND8A 4DR2Q 1OXTA 2CQOA 3KLRA 2NVYH 3P20A 2DY7A 4IPGA 3IKJA 4HIMA 1EQTA 1X9NA 1M8AA 1LTID 1O78A 1VQDA 1IKLA 4X62L 4DV1L 1FNUA 1WYDA 1AN8A 4U673 1JOOA 3RNUA 2ZTCA 1F9RA 4O2DA 2F3VA 3M7GA 3GV3A 4JI6Q 1A0IA 2UXDQ 2IHEA 3TQYA 3BYYB 3T1YQ 2K03A 4HJ7A 2UXCQ 2ICIA 3RN5A 3E3XA 5KEEA 3T53B 4KKTA 4DR3L 5C3EG 2HCCA 2CH4A 4BY7B 3PGZA 2RBMA 4A93H 4P72A 1VCIA 1AE2A 2MP1A 2LXJA 4JI2L 4K2KA 4CJ1B 4DUZL 4IUPA 2HHHQ 3K7AH 4OWWB 1VQ9A 4FP5D 4A4IA 1I4GA 3TP5A 2XVSA 3D4WA 3QOJA 3NQTA 2B2TC 4XQJA 1UE7A 2L5TA 4G57A 4TKOB 4RGOS 4KY6A 5C4XB 1O7LA 2AQ2B 2EZVA 2EPBA 1NE3A 2E2JB 4CDDC 3AEVA 1TWHH 4DR5Q 1HTLD 1WI5A 4M1UB 1Y69U 4KHPL 2JA7B 4KKUA 2F4VL 3UDIA 3PO2B 3C46A 2F0EA 4DR6Q 1WD1A 5A2QL 1PH1A 2R93G 2E2IH 2RDFA 1DCZA 2MFIA 4PG3A 4RWSC 3M4YA 5CV6A 4K5XA 2OWOA 1JOQA 1II3A 1EIGA 2UUCQ 3OOCA 1QNUA 1PRTC 2RQXA 1CZWA 2K33A 3HS0C 4LUZA 1QZGA 1B1ZA 1JB7A 4JBMA 1K28A 1T5EA 4GKKQ 3UDFA 1WCMB 2OCEA 3OW7A 4IOCA 4WORA 4LF4L 1KDAA 1PFNA 1QB5D 3I70A 4KHPQ 3EQLC 3CPFA 3J80E 3A55A 3IFTA 3MXGA 3T1HL 3CCJA 5GROA 1CI3M 1V8QA 2R93B 3ERQA 3K5NA 1LYLA 1U4RA 4LFCL 3X3MA 3NBHB 1BXTA 1Y8PB 1EZ8A 4NP5A 3NBHA 3D31A
chains in the Genus database with same CATH topology
1V43A 2B2VA 1Q1BA 2KECA 1EQVA 3IAYA 4DAYA 3SVMA 1LT3D 2WIIB 2NVYB 3QOLA 1VMPA 4E6IA 1I4PA 4LAAA 2VNUD 3H3VC 5C3EB 2LMCB 2KQ3A 5ELFA 2AQ3B 3NWSA 4A3GB 2K1BA 4YIJA 3KBXA 4KY7A 3BYTB 3S1NB 3DUZA 4IALA 1R9TB 1D2BA 3D3RA 3W2DA 2F0FA 3GV6A 1Q12A 3GO5A 1LACA 5D65A 1TU2B 3SEBA 2AWOA 1EU3A 2D9UA 2K5DA 3NK9A 1PLFA 2QILA 3X3NA 1WVLA 3KUPA 3UI2A 3D6CA 4HCEA 5JPNC 4OO1I 4CJ0B 3VYUA 4ZLTF 4AYBB 3BVGA 1ZYRC 1AZPA 5IT9E 5K5PA 2F0JA 2CW0C 1CK1A 4LK1C 3TP8A 2BA1A 4IN3A 3C1EA 3NPPA 3RZDB 1LO5D 2EYHA 2Q8IB 2A74C 4JBWA 1IW7D 5EPLA 4RKLA 3TBIB 2B63B 3E6ZX 1IHZA 3NQIA 3SK5A 4ABNA 1I4HA 5IIFA 4I65A 3ONAB 4LMQD 4F8MA 3VR4A 2WACA 1LV9A 1HRJA 2XRQD 5JAVA 2F1MA 3CRKC 3MC0B 4C2MB 5FOBB 1SNCA 2QF7A 3A56A 1GUTA 4N9PA 1XWEA 5C0XI 1PZJD 2FMMA 4H0LC 2X6LA 1B3AA 1CT1D 4KHVA 3FVQA 4BY1B 1SNDA 1JORA 3J80L 2LKVA 3EVQA 2O2LD 2O5JC 3PUWA 1LTAD 1C8CA 1BF4A 3D4RA 1F9QA 1SNMA 4C3HG 2X6GA 1QCBD 1TS2A 1I6HB 4A3IB 2NVQB 2MGSA 3S16B 1O80A 2F0MA 4MIUA 4RFBA 4X3UA 4HSPA 1C48A 4B08A 5FO9B 5TSSA 5CBEE 5EKLA 1LTGD 4A3JB 4DXGA 5IGCA 5E1FA 2PZUA 3GTQB 2QCPX 1PTOD 2B2WC 2L55A 4QMGA 1PZKD 3FKIB 2B2YC 4NKLA 4FNFA 1L0YB 2WKDA 1PRTD 1EWHA 1KTKA 2RKSA 3FRPB 2E2DC 3NWTA 5M5WB 1Q90A 5JEAJ 2AQ1B 5FLXE 3MHBA 2SNSA 4OO1H 1V1PA 1ET6A 1WTVA 1U4PA 3V96A 3WDNA 2NB0A 4Q0FA 3QIAA 3K59A 2XIWA 1ENCA 2J0TD 3WOEA 3L3OC 4UAIA 1H9MA 4FYDA 2A68C 4C56C 3PIO3 2Q8RE 4EVOA 4PNYA 5DAUA 4K2LA 4L6TB 1FD7D 1XTCD 1QNKA 1PYWD 3L9AX 3HG9A 2XSCA 2D5DA 4BA1I 2G9DA 2VUMB 1BBXC 2I46A 1NUCA 1BUVT 1I4QA 2JEBI 2RVLA 3PUXA 5CC4A 2QDBA 4R8NA 4DK1A 1ONLA 1LTTD 4CKBA 2PNRC 1TWHB 4CBVA 1TR5A 2MPMA 3TZUA 1B50A 3BZDB 4KHZA 3I73A 1S5CD 3T4AC 1JWUD 1RF2D 1G6ZA 3NSWA 3NE5B 3SK4A 2NN6H 2D62A 1YNJC 3MZ5A 5ELCA 1U4LA 2B2WA 5IOCA 5D3DA 1DYQA 2F0NA 1PTOC 2IWHA 2O4XA 1G2SA 1EY9A 3DWPA 3N6RA 3AMUA 2L0CA 2EOTA 4Q5VA 1JQYD 1GHKA 2KEEA 3OIQA 4EQNA 5IODA 4KK7A 4OGQC 1VDZA 5IGGA 4RHSA 2FJ2A 4ZRZA 2DN8A 2VB3X 3H0GB 3RUZA 5C5LA 2EJFC 3BVZA 3DWAA 2EYPA 3A8IE 2A6EC 3C3LA 3HGBA 3R2IA 1GUWA 5EPKA 1S5FD 1JOKA 3NXWA 2WKCA 2NWGA 4IQZA 1Q1EA 1H9RA 1B9NA 3OIPA 4PMBA 1KDBA 2C9OA 1BO0A 3MEHA 5F2DA 4EQOA 3ND9A 3VA7A 2F3WA 5E4WC 2HDLA 2PMZB 4FXDA 1EY4A 2JXMB 5J22A 3BG3A 1H9SA 1XXGA 1DOMA 4CHTB 4KV6A 2JA6B 3FMCA 1GUGA 1TWAB 3HOWB 2J4XA 3GP7A 3RLFA 4IUUA 1SYGA 1X3PA 1G2TA 5LL6X 1R4PB 1YNJD 2A6ED 3H91A 3D6WA 4F7XA 3C1FA 1I4RA 5DEHA 1SMYD 3H6MA 2HDMA 2IPKD 5C5MA 3SK6A 3VR2A 3M85A 1I3QB 4WFN3 3QWNA 3Q23A 3DEPA 5C3XA 5C4HA 2KJXA 5IGBA 1BDOA 1WTPA 3NP8A 2V4DA 3S14B 1PMRA 2FINB 1TWFB 4OIKA 3Q22A 2BCOA 1WTWA 4QIWB 1A3TA 1B2TA 4QCLA 4CJ2C 2EYMA 4DA2A 1QILA 1SE3A 1EY6A 2KHSA 1AZQA 4DU9A 2IW3A 4IURA 1QE6A 4NMZA 3EFXD 1TY2A 2K7VA 2Y0SB 2E2IB 1PRTF 4ZK9B 4RH6A 4XYOA 3VA5A 5ELEA 1ESFA 2GA4B 5M3MB 1BNZA 1BR9A 3FDTA 1D6EC 2ICEC 3P7JA 4MN3A 1S4ZA 2R7ZB 1RCVD 2F0QA 5BN3A 5BN5A 2A73B 3R8BA 4ZUIA 3U9SA 1LT5D 2RDGA 5DNFA 1QWYA 5A2QE 3AB9A 1STNA 1K8MA 1R4QB 4C3JG 1IL8A 2LY7A 2QKIC 4RGNA 2K05A 3DHQA 2F4IA 2F0PA 5C4ZA 4LJZC 3P75A 3QJYA 3K57A 4RA8A 5I4DA 3VR3A 5I9OA 1PZID 3TN2A 1EIHA 3TSSA 2SNMA 1Y1VB 4A3DB 4K8JA 4K5WA 1GUSA 3HOXB 1V1OA 4A93B 5KNCA 5FO7B 1RKNA 3PUYA 1A3VA 3NTIA 1HA5A 1CHQD 1PTOH 5NUCA 4KN7C 1EY5A 3D8GA 5M5XB 3GQBA 1EY7A 2BE5D 4Y7NB 4BA2I 2NZ1D 1FNWA 1KDCA 4A3EB 4DNRB 1H9JA 2VXWA 1AFPA 2F0KA 4DN4M 5HURA 4H44C 1S5BD 5M5YB 4KJOA 3QO2A 5KRUA 1CA5A 4RHRA 2MJ8A 1G91A 3Q24A 3NBIA 2NTTA 2DNEA 1BCPD 4CGYB 1STHA 2N88A 3BDLA 3PUZA 2MUYA 5M9OA 4G7HC 3GTPB 4M8AA 1O7ZA 4TSSA 3TP6A 3F2UA 5DM63 1BCPF 4ME5A 3D4DA 1EYCA 4XDXA 5C0XH 2EY2A 3PIP3 4K6DA 3SDZA 1EYDA 5CV9A 1DXMA 1GXDC 3VYTA 2F0TA 5IT9L 1TWCB 3E0JA 1LT4D 1MI2A 1QOHA 2DNCA 2F0GA 1PRTB 5KNDA 4ULLA 3KLSX 1CM9A 3MWYW 3RZOB 5FKAC 1G8ZD 1ZKOA 3W3AA 4HMIA 3I4NB 3AU7A 1HQMC 2PQEA 5IGEA 3R2TA 1STAA 2LFNA 1FGBD 1Q8IA 4IUVA 2PO4A 4KKSA 5KYLA 1A15A 1A6XA 1MSGA 2AWNA 5EPJA 1YNNC 5AFWA 1E2VA 3SE0A 1UUPA 1SFOB 1MD2D 1JB3A 2JYOA 5C3WA 2EVBA 4K6LA 5CYUA 1CQFA 2SOBA 3GTJB 2HQEA 1SE4A 4I7ZC 1MSHA 2QEJC 3MXUA 3E5SA 1TKWB 3VR5A 1F2ZA 3T13A 1HQRD 4MHEA 1A2TA 1NAPA 2TMPA 1MBYA 3CU7A 5JEAH 2L11A 2JEAI 4FF1A 1EU4A 1B53A 1M4VA 4XQQA 3LWUA 1ILPA 5C6AA 4RCOA 3SK8A 3T16A 4HR7B 1LTSD 1YNND 1NSNS 3V05A 2OXPA 3OPOA 1OO9B 1TWGB 4S3SA 1E0BA 1LTBD 3S1MB 2B2YA 1SMYC 3I91A 1E2WA 2E74C 2OT2A 4DK0A 1RJTA 2NYZD 3TP7A 4TQUS 3GTOB 3S2HB 1GHJA 3NHHA 3GTMB 1WTRA 4IUQA 3DM1A 2Z4IA 4OHJA 2C5CA 5G3LF 2NBFA 3I4MB 4F87A 3JAME 1XYIA 1CZGA 3A8KE 1F9PA 4JK1C 1SAPA 1Y8NB 3HKZB 2R3ZA 2WP8J 2EYFA 1ENFA 5ISRA 3OMCA 2LS01 4WJWA 3K5MA 1H9SB 5FO8B 1O7YA 2B2TA 2JP1A 4KJNA 1CA6A 1HCZA 5JEAG 1XX8A 1HHVA 1HFGA 3TZDA 2A5HA 3NTKA 1TVXA 1Z7TA 2IX1A 3KBGA 4XXEA 2PYKA 1DZ1A 1WTQA 1J8IA 3EA6A 1SYEA 4KY5A 4C3IB 1I6VC 3IFDA 3S9WA 2F0LA 1UEAB 4ZQ3A 1RTOA 2E76C 5DM73 3J7AV 2SEBD 4DFAA 1VF7A 2XNAC 2EY1A 4CKEA 1EY8A 3M7NA 1RODA 2A6HD 1EZ6A 4Z9CB 3OHXC 5CORA 1J9OA 4RKBA 1D1KA 1CTMA 4FVMA 1DOLA 2RSNA 3KF8A 4PQXA 2IX3A 3J7AF 3H94A 4C1NK 1H9KA 1STEA 2EYOA 1ENAA 1B44D 1IW7C 1F77A 2OF1A 3GTKB 2ZXRA 3PUVA 3S17B 2Z4HA 1JWMD 2K28A 3S1QB 2D2CC 2F03A 4L8JA 5HGTA 1L0XB 3VR6A 1EYAA 2X69A 2K32A 2XWBB 3RMHA 4QUFA 3MVVA 4FF3A 2L4NA 1ICWA 2EXZA 1IYVA 4EGVA 2B2VC 4HEDA 5EQ0A 1EEID 1B4OA 5E3FA 4BS9A 1IKMA 1SSOA 1FNVA 2E75C 2AUJD 2WAQB 1ZEQX 3A7AB 5CGKA 1C4QA 1GUOA 5A35A 5JVG3 4IFDI 1AP0A 1STGA 5EBCA 4KD4A 4J1MA 1ILQA 2K5QA 3WOFA 5T1GA 2CVRA 2OEOA 2XRSD 3EJIA 4IUTA 1KLGD 4HSVA 3LX0A 1SNPA 2K01A 1D5XC 1I4XA 5K36H 1ESRA 2JA8B 2JA5B 4J8QA 3BDOA 1DOKA 5COYA 4R9WA 1KNEA 3P1HA 4X3SA 2L12A 2A6HC 1SNOA 1Y1WB 1PTOB 3PV0A 2ENBA 1U4MA 4BBSB 3C2PA 3MFYA 1RDPD 4KN4C 4U68A 3DMUA 5CBAE 4A3FB 2BDOA 1PXUA 1NCVA 4IFDJ 3L7ZC 1HPCA 5CV8A 2NUCA 5K36G 1EOTA 3GTLB 3S15B 4QB4A 1RD9D 2R6GA 3HOYB 3GD7A 1Z6HA 2F0OA 1SYDA 3N52A 2AUKA 3CQZB 2HCIA 4B9WA 2MHVA 4DGZA 1D5ZC 1OXUA 2E2HB 3LWEA 4O1NA 2EDGA 3MXNA 3I90A 2H4OA 2F0IA 5T1IA 3SR1A 2IL8A 5I6WA 3OSOA 4ZKBB 1PDQA 2XN9C 3G7LA 2A68D 1RTNA 1HTPA 1WTXA 3DEOA 5LHY1 1D5MC 4P2CB 3MA2B 2EYJA 4BWGB 3VYSA 4DAPA 4O42A 4C3IG 1STYA 1KNAA 4DNTB 4G4KA 2F0WA 3K58A 3I72A 3HOUB 5EGTA 3FPUB 1ZXTA 3OMGA 3VYRA 4FF4A 3CRLC 3PO3B 1SYCA 5EBDA 3DWQA 5I2XA 4RGTA 3FEWX 2NVXB 4KMUC 1OXSC 4XT1B 1HXYD 1DD2A 2CHBD 4L63B 1MGSA 3HZXA 2BDNA 2B39A 5I9PA 4ZKCB 4PV1C 2B8FA 4XQNA 3K7AB 1JWSD 4QF4A 1DONA 2G9HD 4ZAIA 3GTGB 3MFGA 3MAQA 2K5WA 5EKKA 5KYIA 2F0SA 2VB2X 4OL7A 1TIID 2PW5A 1V1PB 1VMCA 3I3CA 5I6YA 2EE1A 1F2MA 1SYFA 1JICA 5KIXA 2PZWA 4XTCS 2KCNA 1SE2A 1NR2A 1JC7A 3A54A 4EQPA 1OXXK 2R61A 3A8JE 4R8IA 2K6AA 3FPPA 1ET9A 2RDHA 3BDCA 3A7LA 5FLXL 1AEXA 2B2UC 4FXGC 3DXJC 3TMEA 1KLUD 2ZXPA 5EJWA 2NN6I 1STBA 2DY8A 1NR4A 1UAPA 2EJGC 5CV7A 5KNBA 4ILWA 1A3UA 3R3OA 4IUNA 1T5XD 4TRDA 3K0YA 2F0UA 3M4OB 5C0XG 4IFDG 1HUMA 3HOVB 1GOZA 5IGFA 4UDUC 3V2TA 4K5VA 4XIGS 3Q6SA 4BBRB 2PZTA 3NUCA 1EEFD 3MXPA 2O5IC 2H1EA 1F2LA 1UNSA 4RAUC 1ZYRD 2NTSA 5BN4A 2ZXOA 3ITPA 1F9SA 4V190 1QJOA 4OIJA 5C0XJ 2M00A 4FO2A 3J7YW 3K6OA 4ODGA 5CV4A 1D1IA 3JAML 4HN7A 1S5ED 2Z1CA 2IT1A 4HMJA 1JR0D 1W6KA 4IZ8A 2L9HA 2M9VA 1TS4A 1KAAA 3BS1A 4CKCA 1SBBB 4PMWA 1LABA 1IYUA 1KABA 2IX0A 1BOSA 2NN6G 3NTHA 4HTHA 2RSOA 4QUCA 1AW7A 1GUNA 1B9MA 2N55A 4C3HB 4HAEA 5C4JB 1X32A 2Z8LA 5CMDA 4FF2A 2PCFB 1VF5C 1GJXA 2BE5C 2WINB 5C44B 1E2ZA 5J1ZA 1CFMA 2PW7A 1SDFA 2EY6A 1HFNA 2EJMA 4IFDH 4G7ZC 1TQOA 1PFMA 1BCPB 4C1NI 3K5LA 3T56B 4K14A 5KGUA 3Q0AA 1TS3A 3HOZB 3CKIB 4RGMA 4N9TA 2FHTA 1ML0D 3S1RB 2KOLA 3J81E 3URYA 1EL0A 2WV6D 1W6JA 2BA0A 1HUNA 4WRDA 1JE4A 5IGDA 5EKIA 5LL6S 4XT3B 4ZYSA 3QB3A 3OWFA 1Y8OB 3TDQA 4H7BA 2A69D 4C3JB 5ELBA 2HUGA 1SJHD 1DJRD 4A3MB 5JJZA 2PPBC 1EFID 1JCKB 2YU9B 4FXKC 1S5DD 4PMCA 5JPMC 1PTOF 3EROA 2B8GA 2XWJB 5JVH3 5FK9C 5ELDA 4X3KA 3R93A 2TSSA 2FMCA 5J39A 1WTOA 3S2DB 3KK7A 3J81L 2J7ZA 4J6HA 2F0DA 4F88A 1DM0B 3MTSA 1CHPD 2KA7A 1TS5A 4DXFA 2KVMA 2IJ0A 4ZUJA 3G6JB 3I8ZA 3BVMA 4A3BB 4DAVA 1SXTA 1SNQA 3HEJA 1G291 4RCNA 3LNNA 1Q3LA 4OO1G 2YYZA 1HA6A 4KTAA 3SHLA 4KD3A 3CHBD 3T51B 2ZT9C 3OWEB 2EYLA 3HP3A 4NDXA 2NVTB 2Q8TA 2SDFA 4V0BA 1RHPA 3PMFA 3KLSA 5JOBA 4GZYC 2FFKB 2CW0D 1OXVA 3RD4A 1WD0A 3ZYYX 2CQAA 2JSOA 2L1BA 2KEDA 5E4XA 3HRZC 3IL8A 2F0VA 1SJED 4H13C 2R92B 1TY0A 4KI0A 2I07B 4K8IA 5I2YA 5CR3A 1TT2A 4A3KB 1FYCA 4HCSA 1QG7A 4XYQA 4NW2A 2A69C 1EY0A 2RA4A 1PFBA 1I50B 1LTRD 3O13A 2WB1B 5M3FB 1LLRD 2KUMA 1BQQT 4G7OC 2JE6I 1X3QA 3M3YB 2BOSA 1K8OA 1Z47A 4DF7A 5D3IB 3QG1A 3K5OA 3H09A 5G3LD 1SEBD 2B2UA 1F2YA 2M2LA 2K04A 1FR3A 4ID6A 1LT6D 1BCPC 1K83B 2EY5A 1U9RA 3I4LA 4X3TA 2KCCA 1CQVA 2ID0A 5CV5A 3U9OA 3SXHA 1SYBA 4B9XA 1EWCA 5D14A 2F0HA 1A2UA 3ND8A 1OXTA 3KLRA 3P20A 2DY7A 3IKJA 1EQTA 1M8AA 1LTID 1O78A 1IKLA 1FNUA 1AN8A 4U673 1JOOA 1F9RA 2F3VA 3M7GA 3GV3A 3BYYB 2K03A 2ICIA 5KEEA 3T53B 4KKTA 2HCCA 4BY7B 2RBMA 1VCIA 2MP1A 4K2KA 4CJ1B 4IUPA 4FP5D 1I4GA 3TP5A 2XVSA 3D4WA 3QOJA 3NQTA 2B2TC 4XQJA 2L5TA 4G57A 4TKOB 4RGOS 4KY6A 5C4XB 1O7LA 2AQ2B 2EZVA 2EPBA 2E2JB 1HTLD 4M1UB 1Y69U 2JA7B 4KKUA 3PO2B 3C46A 2F0EA 1WD1A 5A2QL 2RDFA 1DCZA 4RWSC 3M4YA 5CV6A 4K5XA 1JOQA 1II3A 1EIGA 3OOCA 1QNUA 1PRTC 2RQXA 1CZWA 2K33A 3HS0C 1B1ZA 1T5EA 1WCMB 3OW7A 4WORA 1KDAA 1PFNA 1QB5D 3I70A 3J80E 3EQLC 3A55A 3IFTA 3MXGA 1CI3M 1V8QA 2R93B 3ERQA 3K5NA 1U4RA 3X3MA 1BXTA 1Y8PB 1EZ8A 4NP5A 3NBHA 3D31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7X A;  2F3V A;  3C1F A;  3DHQ A;  5DEH A;  5HGT A;  5CV8 A;  1EYA A;  1F2Z A;  1IHZ A;  1STH A;  2F0P A;  2NUC A;  3H6M A;  3T13 A;  5C4Z A;  3ITP A;  4QF4 A;  3BDL A;  4WRD A;  1A2T A;  3P75 A;  3SK5 A;  5C5M A;  4QB4 A;  4KJN A;  1EQV A;  5M9O A;  3SK6 A;  4EQN A;  5KEE A;  5IOD A;  5IGD A;  5IIF A;  5KYI A;  4I65 A;  3MVV A;  5EKK A;  5C3X A;  5C4H A;  1ENC A;  5I9O A;  4F8M A;  2F0V A;  2WAC A;  2F0S A;  2F0O A;  3QOL A;  1SYD A;  2M00 A;  3TP6 A;  2EXZ A;  4OL7 A;  5IGG A;  5IGB A;  5JAV A;  4B9W A;  4E6I A;  2RBM A;  1SNC A;  3NP8 A;  3QB3 A;  2SNM A;  4LAA A;  4DGZ A;  4ODG A;  2PW5 A;  3OWF A;  5CV4 A;  4K8J A;  4N9P A;  4H7B A;  4ME5 A;  3RUZ A;  4EVO A;  2KQ3 A;  4K2K A;  4K8I A;  4K5W A;  5C5L A;  5CR3 A;  4PNY A;  1TT2 A;  5DAU A;  3D4D A;  1EYC A;  5E3F A;  2EYP A;  4K2L A;  5I6Y A;  2EY2 A;  5C6A A;  4K6D A;  2PYK A;  4HMJ A;  4YIJ A;  1F2M A;  1SYF A;  3SK8 A;  3T16 A;  4KY7 A;  3TP5 A;  1SYE A;  3QOJ A;  3D4W A;  4KHV A;  4KY5 A;  4PMC A;  1EYD A;  3NQT A;  5KIX A;  1SND A;  2F0I A;  2PZW A;  4IZ8 A;  5CV9 A;  3SR1 A;  1EY0 A;  1NSN S;  4G57 A;  4IAL A;  5I6W A;  1KAA A;  2OXP A;  3ERO A;  3S9W A;  1A3T A;  1JOK A;  1RKN A;  2F0L A;  1NUC A;  2F0T A;  2F0F A;  2LKV A;  3NXW A;  3OSO A;  4KY6 A;  5CGK A;  3EVQ A;  5CC4 A;  2QDB A;  1KAB A;  2EYM A;  4R8N A;  1STG A;  4ZQ3 A;  2F0G A;  4S3S A;  4KD4 A;  5J39 A;  4PMB A;  4J1M A;  1A3V A;  3NK9 A;  1SNM A;  4HTH A;  1EY6 A;  2KHS A;  1KDB A;  4J6H A;  4DU9 A;  2F0D A;  5NUC A;  2OEO A;  3MEH A;  3EJI A;  5F2D A;  4DFA A;  4EQO A;  4HMI A;  4NMZ A;  2EY1 A;  4DF7 A;  1EY5 A;  1EY8 A;  3BDC A;  3D6C A;  3D8G A;  3LX0 A;  1EY7 A;  1AEX A;  1SNP A;  2PQE A;  5IGE A;  2F0E A;  4ZUJ A;  3TME A;  1STA A;  2F0M A;  2F3W A;  1EZ6 A;  1TR5 A;  1F2Y A;  2EYJ A;  4MIU A;  2RDF A;  3VA5 A;  1SNQ A;  1EY4 A;  4ID6 A;  5J22 A;  1STB A;  3HEJ A;  3P1H A;  5CV6 A;  5K5P A;  2F0J A;  5EKL A;  5ISR A;  2EY5 A;  5CV7 A;  3TP7 A;  4K5X A;  3TP8 A;  1KDC A;  1U9R A;  1STY A;  1II3 A;  1JOQ A;  4RKB A;  5KYL A;  1SNO A;  4KV6 A;  3NHH A;  5J1Z A;  5CV5 A;  5IGC A;  3U9O A;  2PW7 A;  4KTA A;  5E1F A;  3SHL A;  1A3U A;  3R3O A;  4KD3 A;  2F0W A;  2PZU A;  1SYB A;  4IUN A;  2EY6 A;  3SXH A;  2F0K A;  2F0Q A;  3C1E A;  4B9X A;  4QMG A;  3SK4 A;  4TRD A;  1TQO A;  3MZ5 A;  2EYO A;  4NKL A;  4ZUI A;  2EYL A;  1ENA A;  2F0U A;  4EQP A;  5HUR A;  5EGT A;  2ENB A;  2F0H A;  2RKS A;  3OMG A;  4NDX A;  5IOC A;  4KJO A;  1A2U A;  2EYH A;  4WOR A;  1KDA A;  2OF1 A;  1SYG A;  4K14 A;  1SYC A;  5C3W A;  2F0N A;  5KGU A;  5KRU A;  1STN A;  5IGF A;  3V2T A;  2SOB A;  4K5V A;  2PZT A;  2SNS A;  3MHB A;  3DMU A;  3PMF A;  3NUC A;  4N9T A;  3ERQ A;  2HQE A;  2O4X A;  5JOB A;  3HZX A;  1EY9 A;  5I9P A;  3MXP A;  4RKL A;  1JOO A;  1EZ8 A;  2EYF A;  3E5S A;  4NP5 A;  3OMC A;  1JOR A; 
#chains in the Genus database with same CATH topology
 1V43 A;  2B2V A;  1HNW L;  3TS2 A;  1Q1B A;  2KEC A;  1EQV A;  4R4T A;  3IAY A;  4DAY A;  3SVM A;  1LT3 D;  1WCM G;  3Q8D A;  3UDG A;  1YHA A;  2WII B;  2NVY B;  3QOL A;  1VMP A;  3HOV H;  4E6I A;  1I4P A;  4LAA A;  2VNU D;  3H3V C;  4WJ3 M;  5C3E B;  2LMC B;  2KQ3 A;  5ELF A;  2AQ3 B;  3NWS A;  3CD6 A;  4A3G B;  4DR3 Q;  2K1B A;  4YIJ A;  3KBX A;  4KY7 A;  1UE5 A;  4NXN L;  3BYT B;  3S1N B;  4NXN Q;  3DUZ A;  2UXC L;  1I5F A;  4IAL A;  4OXP A;  1R9T B;  1D2B A;  3D3R A;  3W2D A;  5IY0 A;  2F0F A;  3GV6 A;  1Q12 A;  3GO5 A;  4LFB Q;  4A93 G;  1LAC A;  5D65 A;  1TU2 B;  1PA6 A;  4CDE C;  3SEB A;  2AWO A;  1KQS A;  4LFA Q;  1EU3 A;  2D9U A;  4EX5 A;  2K5D A;  3NK9 A;  4JI7 L;  4DUY Q;  1N32 L;  1PLF A;  2QIL A;  3CCV A;  3X3N A;  1WVL A;  3KUP A;  3S14 H;  3UI2 A;  3D6C A;  1UEB A;  1K8G A;  4JBJ A;  2UXD L;  4HCE A;  5JPN C;  4OO1 I;  4CJ0 B;  3VDY A;  3VYU A;  4ZLT F;  4AYB B;  3BVG A;  2Y0S E;  1ZYR C;  1Q8K A;  1AZP A;  5IT9 E;  5K5P A;  2F0J A;  2CW0 C;  1CK1 A;  1PFS A;  4LK1 C;  3TP8 A;  5LMN L;  2B63 G;  4BY1 H;  2UUB Q;  1CKN A;  2A1A A;  2BA1 A;  4IN3 A;  1S3O A;  3C1E A;  3CCU A;  3NPP A;  3RZD B;  4LF6 Q;  1LO5 D;  4JW0 A;  2EYH A;  3LGJ A;  1KHI A;  2DUD A;  2OTJ A;  2Q8I B;  2A74 C;  2PI2 E;  4JBW A;  3HKS A;  1IW7 D;  5EPL A;  4RKL A;  3TBI B;  2VY3 A;  1VQP A;  3CME A;  2B63 B;  3J7A 5;  3E6Z X;  1IHZ A;  1YEZ A;  2B63 H;  1IYJ B;  3NQI A;  3SK5 A;  4ABN A;  4LF8 Q;  5AJ3 L;  1I4H A;  1B70 B;  5IIF A;  4I65 A;  2F4V Q;  3ONA B;  4GLV B;  4LMQ D;  4HJ5 A;  4HJ8 A;  2R93 H;  3EBE A;  5BR8 Q;  3VR4 A;  4F8M A;  2WAC A;  1VQJ A;  1LV9 A;  2QEX A;  1HRJ A;  2XRQ D;  5JAV A;  2F1M A;  1EIF A;  3CRK C;  3MC0 B;  1L2F A;  4C2M B;  1SNC A;  5FOB B;  2VUM H;  2QF7 A;  3A56 A;  3A5Z B;  4UPA A;  1GUT A;  4N9P A;  4A3I G;  4DR4 Q;  1CKO A;  1XWE A;  1NNX A;  3BZK A;  5C0X I;  3DM3 A;  1PZJ D;  3HOW H;  2FMM A;  4H0L C;  1FJG L;  2CKZ B;  4LFA L;  2X6L A;  1B3A A;  5GAH C;  1CT1 D;  1BBU A;  3FVQ A;  4KHV A;  4BY1 B;  1SND A;  1E22 A;  1JOR A;  3GTJ H;  3J80 L;  2LKV A;  4A75 A;  3EVQ A;  2O2L D;  1HZC A;  2O5J C;  3PUW A;  2CH4 W;  1LTA D;  1C8C A;  1BF4 A;  3D4R A;  1F9Q A;  1SNM A;  4C3H G;  2WB1 G;  2X6G A;  2VS1 A;  1QCB D;  1TS2 A;  1I6H B;  4A3I B;  2NVQ B;  2MGS A;  3S16 B;  1VQG A;  5IYD H;  2VZA A;  1E7Z A;  1YJN A;  3G48 A;  1O80 A;  4BBR G;  2F0M A;  4MIU A;  4RFB A;  4X3U A;  4HSP A;  1LM0 A;  1Q81 C;  1C48 A;  4B08 A;  5FO9 B;  5TSS A;  5CBE E;  5EKL A;  1LTG D;  1XPR A;  3IRB A;  4A3J B;  3TEH B;  4DXG A;  2JJQ A;  1IBM L;  5IGC A;  5E1F A;  2PZU A;  3GTQ B;  2MNA A;  2QCP X;  1PTO D;  2B2W C;  2L55 A;  4QMG A;  1PZK D;  3FKI B;  2B2Y C;  4NKL A;  4FNF A;  1L0Y B;  1KAW A;  2WKD A;  4GNX A;  1PRT D;  1EWH A;  1KTK A;  2RKS A;  3FRP B;  2K5N A;  3KOJ A;  2E2D C;  3NWT A;  2YTV A;  3CCR A;  5M5W B;  1Q90 A;  3PO2 G;  5JEA J;  4B3R L;  1XMQ Q;  2AQ1 B;  5FLX E;  3MHB A;  2SNS A;  4OO1 H;  2ZJP A;  3I56 A;  4AIM A;  1V1P A;  4GN3 B;  1ET6 A;  1WTV A;  1U4P A;  3K81 C;  2JA7 H;  4DNI A;  3V96 A;  3ERS X;  2HIV A;  3WDN A;  4DV6 L;  1FL0 A;  2NB0 A;  4Q0F A;  1VQE A;  4LF4 Q;  3QIA A;  2UXB L;  3K59 A;  2XIW A;  1ENC A;  2J0T D;  3WOE A;  3L3O C;  4UAI A;  1H9M A;  4FYD A;  2A68 C;  4C56 C;  2WAQ E;  3PIO 3;  2I5L X;  2Q8R E;  3CCL A;  2JA8 H;  3HFZ B;  3GTM H;  4EVO A;  4PNY A;  4IOA A;  5DAU A;  3U50 C;  4DR5 L;  4K2L A;  4L6T B;  1FD7 D;  1XTC D;  1QNK A;  1PYW D;  3L9A X;  3HG9 A;  4LF8 L;  4YHH L;  2XSC A;  2D5D A;  2WB1 E;  1BVS A;  4BA1 I;  2G9D A;  4DR6 L;  4DR4 L;  2VUM B;  1BBX C;  1N9W A;  2I46 A;  1NUC A;  2DJF C;  1BUV T;  1I4Q A;  3PUX A;  2JEB I;  2RVL A;  2E8G A;  5CC4 A;  2QDB A;  1HR0 W;  2VQF Q;  4R8N A;  1D7Q A;  4DK1 A;  1TWG H;  1ONL A;  1LTT D;  4CKB A;  2PNR C;  1TWH B;  4JI4 L;  4CBV A;  2CWA A;  2MPM A;  1TR5 A;  4JPB W;  3TZU A;  1B50 A;  4OEL B;  3BZD B;  1W3S A;  2IY5 B;  4DV5 L;  4YWK A;  4B3T L;  3J80 i;  2JA6 G;  4KHZ A;  3I73 A;  1S5C D;  3T4A C;  1JWU D;  1RF2 D;  4MTN A;  1VQA A;  2RF4 A;  1G6Z A;  3NSW A;  1Y1V H;  2NVQ H;  2KHJ A;  3NE5 B;  4B3R Q;  3SK4 A;  2NN6 H;  2D62 A;  1XMQ L;  1YNJ C;  3MZ5 A;  1WTH A;  5ELC A;  5ELO A;  1U4L A;  4N8F A;  2B2W A;  1MKH A;  5D3D A;  5IOC A;  1DYQ A;  2F0N A;  1PTO C;  2GVB A;  1PYS B;  1K8A C;  4MNO A;  2IWH A;  2O4X A;  1G2S A;  3H15 A;  1K73 C;  1EY9 A;  3K0X A;  3DWP A;  3CC2 A;  5H1S E;  3J80 c;  1B7Y B;  3N6R A;  4DR1 Q;  3F2B A;  3AMU A;  4OWT B;  2L0C A;  4DK3 C;  2EOT A;  2QGQ A;  4Q5V A;  1JQY D;  1GHK A;  2KEE A;  3OIQ A;  1B8A A;  1BBW A;  4EQN A;  1NTG A;  2ZTD A;  5IOD A;  4A3L G;  4KK7 A;  4OGQ C;  1VDZ A;  5JJL A;  5IGG A;  4RHS A;  2FJ2 A;  4ZRZ A;  2DN8 A;  1N36 Q;  2VB3 X;  3H0G B;  3KLW A;  3RUZ A;  5C5L A;  4DV4 Q;  2EJF C;  3BVZ A;  3DWA A;  2EYP A;  2JK8 A;  3A8I E;  4X65 Q;  2A6E C;  3C3L A;  4K0K L;  2Z6K C;  4KLK A;  2ZTE A;  3HGB A;  3R2I A;  1GUW A;  5EPK A;  5GQO A;  1JOK A;  1S5F D;  3NXW A;  2WKC A;  3L2P A;  2NWG A;  4IQZ A;  1Q1E A;  1H9R A;  1R9T H;  1B9N A;  3EIV A;  3OIP A;  4PMB A;  1KDB A;  2C9O A;  1BO0 A;  5BR8 L;  1KIX A;  3MEH A;  5F2D A;  4EQO A;  2EQS A;  2JN4 A;  4QJF A;  3ND9 A;  3VA7 A;  2JA9 A;  1IBK L;  3I4O A;  5GAD C;  2F3W A;  5E4W C;  2HDL A;  3AYH B;  2PMZ B;  4FXD A;  1MJE A;  1EY4 A;  2UXB Q;  2JXM B;  5J22 A;  4DR1 L;  3BG3 A;  1H9S A;  1XXG A;  5IYB G;  2UU9 L;  4JI3 L;  1VQN A;  1DOM A;  4CHT B;  4GNX B;  4KV6 A;  1XNR L;  2JA6 B;  1CSQ A;  3FMC A;  1GUG A;  1IZ6 A;  4JI8 L;  1TWA B;  3HOW B;  4JYA L;  4GKK L;  2J4X A;  1M90 C;  3GP7 A;  3RLF A;  1VQ7 A;  3CCQ A;  4IUU A;  3M4O H;  4A3E H;  1SYG A;  1X3P A;  3I55 A;  4LF6 L;  1G2T A;  5LL6 X;  1R4P B;  1YNJ D;  2JA8 G;  2A6E D;  3A5U A;  4HIK A;  1SLJ A;  3H91 A;  4JOI C;  5IP9 H;  3D6W A;  4HJ9 A;  1P16 A;  5IYC H;  4F7X A;  4ALP A;  3C1F A;  1JJ2 A;  1I4R A;  5DEH A;  1SMY D;  3H6M A;  2HDM A;  4PZ8 A;  3ICE A;  2IPK D;  5C5M A;  2K14 A;  4DV3 Q;  4JI4 Q;  3SK6 A;  3VR2 A;  3M85 A;  1I3Q B;  3HOX H;  4WFN 3;  3QWN A;  3I4M H;  3Q23 A;  3DEP A;  5C3X A;  5C4H A;  2KJX A;  4HJA A;  5IGB A;  1BDO A;  4QY7 A;  4A3M G;  3NP8 A;  1WTP A;  2V4D A;  1HH2 P;  3S2D H;  4DR7 Q;  5FLX c;  4LNQ A;  3S14 B;  1PMR A;  4CDF C;  2OQ0 A;  2FIN B;  4JBK A;  5GAG C;  1TWF B;  4OIK A;  3Q22 A;  2BCO A;  1WTW A;  4LF9 Q;  4QIW B;  1A3T A;  2KCM A;  4BY1 G;  1B2T A;  4QCL A;  4CJ2 C;  2R7Z G;  2YTY A;  2EYM A;  4DA2 A;  1N33 L;  2LSS A;  1QIL A;  1IBL Q;  1SE3 A;  3ULP A;  1JT8 A;  1EY6 A;  2KHS A;  1HNZ Q;  1AZQ A;  4DU9 A;  2IW3 A;  1S40 A;  4IUR A;  1QE6 A;  1GO3 E;  1Z9F A;  4NMZ A;  3EFX D;  1NBW A;  3PF4 A;  1TY2 A;  2K7V A;  2Y0S B;  2E2I B;  1PRT F;  1YHB A;  4ZK9 B;  4RH6 A;  3KJO A;  3K7U C;  4XYO A;  3GTO H;  3VA5 A;  2K5V A;  5ELE A;  4B3S Q;  1ESF A;  4QGU A;  2JA5 G;  4GLA C;  4NXM L;  2GA4 B;  5M3M B;  1BNZ A;  1BR9 A;  4UHV A;  3FDT A;  2Q2T A;  1D6E C;  1I94 L;  2ICE C;  3AFQ A;  1SE8 A;  3P7J A;  4MN3 A;  1S4Z A;  2R7Z B;  4NXM Q;  1RCV D;  2F0Q A;  5BN3 A;  5BN5 A;  2A73 B;  3R8B A;  4ZUI A;  1A63 A;  1QVC A;  3U9S A;  1LT5 D;  2RDG A;  5DNF A;  1QWY A;  5A2Q E;  3AB9 A;  4A3D G;  3E9H A;  1STN A;  1K8M A;  1R4Q B;  4C3J G;  3RN2 A;  1IL8 A;  2LY7 A;  2QKI C;  2JA6 H;  4RGN A;  2K05 A;  3DHQ A;  2F4I A;  1K9M C;  3J81 j;  2F0P A;  5C4Z A;  4LJZ C;  3J7Z C;  3P75 A;  3QJY A;  3K57 A;  4RA8 A;  5I4D A;  1A62 A;  5IYC G;  2N49 A;  3VR3 A;  4JVZ A;  5I9O A;  1PZI D;  3TN2 A;  1EIH A;  4L5R C;  2MQH A;  3TSS A;  2SNM A;  1Y1V B;  2NZH A;  4A3D B;  4K8J A;  3KDF B;  4I7A A;  4A3D H;  3S1Q H;  4QQB X;  4K5W A;  1GUS A;  3M4P A;  3I2Z A;  1SRU A;  4DK6 C;  3HOX B;  1V1O A;  1RL2 A;  2L15 A;  3FP9 A;  4A93 B;  5E7N A;  2WFW A;  5KNC A;  5FO7 B;  1RKN A;  1M1K C;  3PUY A;  1PH5 A;  1A3V A;  3NTI A;  1HA5 A;  1CHQ D;  5FJ8 G;  1PTO H;  5NUC A;  1Y1V G;  4KN7 C;  4NB3 A;  1EY5 A;  3D8G A;  3OW2 A;  3GQB A;  1EY7 A;  2N8N A;  4UP8 A;  5M5X B;  1LTL A;  2BE5 D;  4Y7N B;  4BA2 I;  2NZ1 D;  3KF8 B;  3HOX G;  1EUJ A;  1FNW A;  1KDC A;  4A3E B;  4DNR B;  4X62 Q;  1ASY A;  2YV5 A;  1H9J A;  2VXW A;  1AFP A;  1EQR A;  4C3H H;  2F0K A;  4DN4 M;  1X54 A;  1BKB A;  5HUR A;  3HOY H;  4GN5 A;  1K3B C;  4H44 C;  5GAE C;  1IBK Q;  1S5B D;  5C4J H;  5M5Y B;  4KJO A;  2I0Q A;  3QO2 A;  2A19 A;  2R7F A;  1UE6 A;  2CCZ A;  5KRU A;  3CQZ H;  2PQA B;  5M3M H;  1J5E Q;  1CA5 A;  4RHR A;  2MJ8 A;  1AE3 A;  3KF6 A;  1WJJ A;  2QDL A;  3J81 c;  2UU9 Q;  4A3B G;  5IWA L;  1G91 A;  3Q24 A;  4B3M L;  3CAM A;  3NBI A;  1WCM H;  2NTT A;  3NEL A;  2DNE A;  1BCP D;  3PIO A;  4CGY B;  3KYH C;  4ME3 A;  3STB C;  3G4S A;  1STH A;  3CMA A;  2N88 A;  3PSI A;  3BDL A;  3PUZ A;  2MUY A;  1E1O A;  5M9O A;  2OTL A;  4G7H C;  3GTP B;  3ER0 A;  4M8A A;  4C2M H;  4ZCK A;  1O7Z A;  4TSS A;  3TP6 A;  5LMN Q;  3CC7 A;  5JJI A;  3F2U A;  5DM6 3;  4GS3 A;  4Y7N H;  1BCP F;  4ME5 A;  3U58 A;  4A3F H;  3D4D A;  1EYC A;  1YJ9 A;  3AQQ A;  4YY3 L;  4XDX A;  5C0X H;  2EY2 A;  3PIP 3;  4K6D A;  3H3V H;  3SDZ A;  4JI5 Q;  1KRT A;  1EYD A;  5CV9 A;  5C4X G;  1QVF A;  1DXM A;  1GXD C;  4LUO A;  1W2B A;  3VYT A;  2F0T A;  5IT9 L;  3OTO Q;  1TWC B;  1X3E A;  3E0J A;  1LT4 D;  1MI2 A;  1HNX Q;  3OTO L;  1QOH A;  2DNC A;  2F0G A;  1PRT B;  5KND A;  4ULL A;  3KLS X;  4LF9 L;  1CM9 A;  2HT1 A;  2EIF A;  3MWY W;  3RZO B;  5HY6 A;  5FKA C;  1G8Z D;  1ZKO A;  3W3A A;  1XJV A;  4HMI A;  3I4N B;  1E24 A;  3AU7 A;  1HQM C;  2PQE A;  4DKA C;  5IGE A;  3R2T A;  1STA A;  2LFN A;  3CCE A;  1FGB D;  4DV7 Q;  3S24 A;  4X66 Q;  1X55 A;  3TS0 A;  1Q8I A;  4R4Q A;  2B29 A;  4IUV A;  2PO4 A;  5DLQ E;  2HHH L;  2ZM6 Q;  4KKS A;  4HIO A;  5KYL A;  1A15 A;  1Y1W G;  1A6X A;  1SR3 A;  1VQF A;  3T1H Q;  4DV0 L;  1MSG A;  1HR0 Q;  2AWN A;  5EPJ A;  1YNN C;  5AFW A;  1E2V A;  3SE0 A;  1UUP A;  1N34 Q;  5L37 A;  1SFO B;  1MD2 D;  1JB3 A;  1E1T A;  2JYO A;  3U4V A;  2E2J H;  5C3W A;  2EVB A;  4K6L A;  4A3F G;  5CYU A;  1CQF A;  1XTD A;  2SOB A;  3GTJ B;  4JI6 L;  2HQE A;  1SE4 A;  4JV5 Q;  4I7Z C;  1MSH A;  2QEJ C;  5C3E H;  3MXU A;  3E5S A;  2FXQ A;  4DV1 Q;  4OWX B;  1TKW B;  3VR5 A;  1F2Z A;  2RCF A;  3T13 A;  1SN8 A;  4MHE A;  1HQR D;  1A2T A;  1NAP A;  1VS0 A;  2HQL A;  4C3I H;  2TMP A;  1MBY A;  3CU7 A;  1KD1 C;  5JEA H;  2L11 A;  4YY3 Q;  2JEA I;  2QA4 A;  1VQ6 A;  5LMU Q;  4FF1 A;  1PH4 A;  1EU4 A;  1FJG Q;  1B53 A;  1M4V A;  1YNX A;  4XQQ A;  3LWU A;  1ILP A;  4TVA B;  5C6A A;  4RCO A;  3SK8 A;  4A3C H;  4PZ6 A;  3T16 A;  1K3R A;  2UUA Q;  1S72 A;  3CP0 A;  1HJP A;  4HR7 B;  4BBS H;  1HZA A;  1LTS D;  1YNN D;  4R1J A;  1NSN S;  3V05 A;  2OXP A;  3OPO A;  5C4X H;  1OO9 B;  4POG A;  1TWG B;  4X64 L;  4S3S A;  4JI7 Q;  1E0B A;  2ES2 A;  1Y14 B;  2AMC B;  1LTB D;  4QL5 A;  1N33 Q;  3S1M B;  3I4M G;  2B2Y A;  5LMU L;  1SMY C;  2YTX A;  1VQM A;  4MTK A;  1Q46 A;  4JCV E;  1FVI A;  3I91 A;  1E2W A;  2E74 C;  2OT2 A;  4DK0 A;  1PH8 A;  1HZ9 A;  1RJT A;  2NYZ D;  3TP7 A;  4TQU S;  3K8A A;  1N34 L;  1GVP A;  3GTO B;  3S2H B;  1GHJ A;  2C35 B;  5IP7 H;  3NHH A;  3S1N H;  4LF5 L;  3GTM B;  2D0O A;  1WTR A;  4IUQ A;  3DM1 A;  4UP7 A;  2Z4I A;  4OHJ A;  2PQA A;  4BY7 H;  5C44 G;  2C5C A;  3M3Y H;  4IPD A;  5G3L F;  2R7Z H;  2NBF A;  3I4M B;  4F87 A;  2ZM6 L;  3JAM E;  1XYI A;  3BU2 A;  1CZG A;  3A8K E;  1F9P A;  1IBM Q;  4JK1 C;  4DV7 L;  3GTQ H;  2MO0 A;  1SAP A;  1Y8N B;  3HKZ B;  4A3G G;  1Q7Y C;  2R3Z A;  2WP8 J;  2EYF A;  1ENF A;  5ISR A;  4LFC Q;  3OMC A;  2LS0 1;  4WJW A;  4YWL A;  3K5M A;  1H9S B;  5FO8 B;  3CF5 A;  5M5W H;  1C9O A;  1O7Y A;  2B2T A;  4AQY Q;  2JP1 A;  3KJP A;  2LXK A;  4KJN A;  1CA6 A;  4JC0 A;  1HCZ A;  1I94 Q;  3STB D;  5JEA G;  3H0G G;  1XX8 A;  5IYD G;  1SMX A;  4P74 A;  1HHV A;  5HGQ A;  4P71 A;  4GKJ Q;  2VQE Q;  1HFG A;  3TZD A;  2R7D A;  3GTL H;  3S15 H;  2A5H A;  3NTK A;  1TVX A;  1YVC A;  1Z7T A;  3HKZ G;  2IX1 A;  3KBG A;  4XXE A;  2PYK A;  1DZ1 A;  1WTQ A;  1J8I A;  3EA6 A;  1SYE A;  4KY5 A;  1VQI A;  4C3I B;  1I6V C;  4JI0 L;  3IFD A;  3S9W A;  2F0L A;  3MXN B;  1GM5 A;  1UEA B;  1X3F A;  4ZQ3 A;  1RTO A;  4L5S A;  2E76 C;  1KXL A;  5DM7 3;  3HOU G;  3J7A V;  2SEB D;  4DFA A;  1Y1W H;  1VF7 A;  2XNA C;  2EY1 A;  4CKE A;  1EY8 A;  3M4Q A;  3M7N A;  1ROD A;  2A6H D;  1EZ6 A;  4IPC A;  4Z9C B;  3OHX C;  2P5Z X;  2H5X A;  5COR A;  1J9O A;  3A74 A;  2K50 A;  2UUB L;  4RKB A;  1D1K A;  1CTM A;  4FVM A;  1DOL A;  2RSN A;  3KF8 A;  1N36 L;  4PQX A;  2IX3 A;  1X3G A;  3J7A F;  3H94 A;  4C1N K;  1XPU A;  1H9K A;  1STE A;  2EYO A;  1ENA A;  1B44 D;  1IW7 C;  1F77 A;  2OF1 A;  3GTK B;  2ZXR A;  3PUV A;  3S17 B;  2Z4H A;  1JWM D;  2K28 A;  3PF5 A;  2D0P A;  5IYB H;  1PH7 A;  3S1Q B;  3WWV A;  2D2C C;  2GN5 A;  3PIP A;  2F03 A;  4L8J A;  5HGT A;  1L0X B;  3VR6 A;  1EYA A;  2X69 A;  3KF6 B;  2WAQ G;  2K32 A;  2XWB B;  4CDC C;  3RMH A;  4QUF A;  1UE1 A;  3MVV A;  4FF3 A;  2L4N A;  4A3L H;  4X66 L;  1ICW A;  2EXZ A;  1IYV A;  1X6O A;  3PCO B;  4EGV A;  4DR7 L;  2B2V C;  4HED A;  4QIW E;  5EQ0 A;  1EEI D;  3GTG H;  1NMG A;  1B4O A;  5E3F A;  4HID A;  2GVA A;  4BS9 A;  1IKM A;  3F8T A;  1PYB A;  1TWA H;  1SSO A;  1FNV A;  2ALY B;  2AUJ D;  2E75 C;  2WAQ B;  4A3J G;  1XMO L;  2DGY A;  1ZEQ X;  3A7A B;  5CGK A;  1C4Q A;  1GUO A;  5A35 A;  4OX9 Q;  2E5L Q;  5JVG 3;  4IFD I;  1AP0 A;  1STG A;  5EBC A;  4AYB E;  4KD4 A;  4R4O A;  1VQB A;  4J1M A;  1ILQ A;  3FKI G;  2K5Q A;  1OTC A;  3WOF A;  2Y0S G;  5T1G A;  4GLX A;  4GOP B;  2Z9H A;  1VQ4 A;  2CVR A;  2OEO A;  2XRS D;  3EJI A;  4IUT A;  1KLG D;  2EXD A;  4HSV A;  2Q2H A;  1QUQ B;  3LX0 A;  3RZO H;  1SNP A;  3HOV G;  2K01 A;  1D5X C;  1I4X A;  2F52 A;  5K36 H;  1ESR A;  2JA8 B;  2JA5 B;  4J8Q A;  3BDO A;  1DOK A;  5COY A;  4R9W A;  3D0F A;  1KNE A;  4POF A;  3P1H A;  4DR2 L;  2PNH A;  2E2H H;  2NZO A;  4X3S A;  3ZJY C;  2L12 A;  4Y52 H;  2A6H C;  4DV6 Q;  1SNO A;  1X56 A;  1CKM A;  4JV5 L;  1Y1W B;  1G6P A;  5J3B A;  3HOY G;  1PTO B;  4LF7 Q;  4R4I A;  3PV0 A;  2ENB A;  1U4M A;  4BBS B;  1NY4 A;  1JJG A;  3C2P A;  3MFY A;  3E0E A;  1RDP D;  4GNX C;  4KN4 C;  4U68 A;  1KL9 A;  3DMU A;  5CBA E;  5LMN W;  4A3F B;  3G6E A;  2BDO A;  1PXU A;  1XPO A;  3H0G H;  4NPS A;  1NCV A;  4IFD J;  3L7Z C;  1HPC A;  1PH6 A;  1VQ5 A;  4EQ5 A;  5CV8 A;  5IP7 G;  2NUC A;  5K36 G;  1EOT A;  2VUM G;  2B3G A;  3GTL B;  3S15 B;  4QB4 A;  1RD9 D;  2R6G A;  1EQQ A;  3ULL A;  3HOY B;  3GD7 A;  3GDE A;  4FDB A;  2JQO A;  1Z6H A;  2F3I A;  3A0J A;  2F0O A;  1SYD A;  3N52 A;  2AUK A;  3CQZ B;  2HCI A;  4B9W A;  1H95 A;  2MHV A;  4MZ9 A;  4DGZ A;  2KCT A;  3HKZ E;  1D5Z C;  4YCV A;  1XMO Q;  2YU9 H;  1VQO A;  1OXU A;  2N3S A;  3I4N H;  2E2H B;  3LWE A;  1YIT A;  4O1N A;  4UP9 A;  2EDG A;  3MXN A;  3I90 A;  2H4O A;  1JE5 A;  3W1G A;  4JI5 L;  2F0I A;  1VQH A;  5T1I A;  3SR1 A;  5M3M G;  3QR8 A;  5FLM H;  2IL8 A;  5I6W A;  3OSO A;  4ZKB B;  3HOZ H;  1PDQ A;  2XN9 C;  3G7L A;  1V9P A;  2A68 D;  5M5X H;  3G71 A;  1RTN A;  2K52 A;  1HTP A;  1WTX A;  3DEO A;  4X64 Q;  4APV A;  3B6Y A;  5IT9 c;  2XTI A;  3S1M H;  1Q86 C;  5LHY 1;  2JA7 G;  1D5M C;  4P2C B;  3MA2 B;  1PH3 A;  2EYJ A;  4BWG B;  1CKN B;  1EIY B;  5EAY A;  3VYS A;  4DAP A;  4O42 A;  4C3I G;  1STY A;  1KNA A;  3GTK H;  4GOP A;  4LF7 L;  4DNT B;  3RLN A;  4G4K A;  5FJ8 H;  2KHI A;  2F0W A;  3K58 A;  1PH2 A;  3E9I A;  4P75 A;  3I72 A;  3KDF A;  3M9B A;  2UUC L;  3HOU B;  5EGT A;  1QVG A;  3FPU B;  1ZXT A;  3OMG A;  3VYR A;  4FF4 A;  3CRL C;  4YCU A;  3PO3 B;  1SYC A;  5EBD A;  4X6A H;  4A3J H;  3DWQ A;  5I2X A;  4RGT A;  3FEW X;  5IWA Q;  4JYA Q;  1HNZ L;  2NVX B;  4KMU C;  1OXS C;  4XT1 B;  1HXY D;  1DD2 A;  2CHB D;  4L63 B;  1MGS A;  4R4C A;  3HZX A;  2ZJR A;  2BDN A;  2B39 A;  5I9P A;  4ZKC B;  4PV1 C;  2B8F A;  4XQN A;  3K7A B;  2VW9 A;  1JWS D;  4UY8 C;  1EOV A;  1WFQ A;  4QF4 A;  1DON A;  2BH8 A;  2G9H D;  4ZAI A;  3GTG B;  3F2C A;  3MFG A;  4GN4 B;  3CPW A;  4DPG A;  3MAQ A;  3S1R H;  1TWF H;  2K5W A;  5EKK A;  5KYI A;  2F0S A;  2VB2 X;  4DAM A;  4OL7 A;  4DV0 Q;  3PO3 G;  1TII D;  2PW5 A;  2XGT A;  1V1P B;  4JOI A;  1VMC A;  4DAY B;  1JMC A;  4OX9 L;  4DUZ Q;  1E3P A;  3RZD H;  4DUY L;  3I3C A;  2E5L L;  1N32 Q;  5I6Y A;  2CFM A;  2EE1 A;  1F2M A;  1SYF A;  2QW7 A;  4J15 A;  1JIC A;  4IJL A;  3L0O A;  5KIX A;  2PZW A;  4XTC S;  2KCN A;  1EYG A;  5M3F H;  4A3E G;  1SE2 A;  4A3I H;  1NR2 A;  1JC7 A;  3A54 A;  4RMF A;  4EQP A;  5JJK A;  3UE1 A;  3ULJ A;  3FHW A;  1OXX K;  4A3M H;  2R61 A;  4DV4 L;  3HOW G;  3T1Y L;  5C44 H;  3A8J E;  4JI2 Q;  4R8I A;  4AH6 A;  3I4N G;  2K6A A;  3FPP A;  4L5T A;  1ET9 A;  2RDH A;  4OEM B;  3BDC A;  3I7F A;  3A7L A;  5FLX L;  1AEX A;  3EN2 A;  2B2U C;  4FXG C;  3DXJ C;  3TME A;  1KLU D;  2ZXP A;  5EJW A;  1EWI A;  1YHQ A;  2NN6 I;  4H02 A;  1STB A;  5IP9 G;  2DY8 A;  1NR4 A;  1UAP A;  2EJG C;  5CV7 A;  4AYB G;  3BJU A;  5KNB A;  1CUK A;  4ILW A;  1HNW Q;  4YWM A;  3KFU A;  1A3U A;  3R3O A;  4IUN A;  2K75 A;  4PZ7 A;  3BZC A;  1T5X D;  4TRD A;  3K0Y A;  2F0U A;  2Z0S A;  3TRZ A;  3M4O B;  5C0X G;  4IFD G;  3PO2 H;  1HUM A;  3HOV B;  3NEN A;  1GOZ A;  5IGF A;  4UDU C;  3V2T A;  1I50 H;  4K5V A;  4XIG S;  3Q6S A;  4BBR B;  2PZT A;  3NUC A;  1K0R A;  1EEF D;  3MXP A;  4OON A;  2O5I C;  2H1E A;  3S2H H;  1F2L A;  4BXX H;  1UNS A;  4RAU C;  1ZYR D;  1I6H H;  2NTS A;  5BN4 A;  1QUQ A;  2ZXO A;  3ITP A;  1F9S A;  1Q82 C;  4V19 0;  1QJO A;  1XNQ L;  4OIJ A;  5C0X J;  2JA5 H;  2KEN A;  2K4K A;  3NEM A;  1L1O C;  4X65 L;  1O7I A;  2M00 A;  4FO2 A;  2A8V A;  3J7Y W;  3K6O A;  4ODG A;  3JC6 6;  5CV4 A;  1D1I A;  1L1O B;  2KBN A;  3JAM L;  4HN7 A;  1S5E D;  3FKI H;  2Z1C A;  2UUA L;  2IT1 A;  4HMJ A;  3F2D A;  1JR0 D;  1W6K A;  3PQI A;  3CCM A;  4IZ8 A;  2L9H A;  2M9V A;  1L0W A;  1TS4 A;  1KAA A;  1IBL L;  3BS1 A;  4DV2 L;  1LUZ A;  1MIU A;  1GD7 A;  4CKC A;  1SBB B;  4PMW A;  1LAB A;  2K5H A;  1IYU A;  1KAB A;  2IX0 A;  3CCS A;  4LWC A;  1BOS A;  2NN6 G;  3NTH A;  4HTH A;  2RSO A;  1YIJ A;  2I5M X;  4QUC A;  1AW7 A;  1GUN A;  3UE0 A;  4BBR H;  1B9M A;  2N55 A;  3W5O A;  4C3H B;  4RG1 A;  4HAE A;  5C4J B;  2NVT H;  4AQY L;  1X32 A;  3S16 H;  2AKW B;  2Z8L A;  3HOU H;  5CMD A;  1N8R C;  4FF2 A;  1A8V A;  2Q2U A;  2PCF B;  1VF5 C;  1GJX A;  2RCN A;  2BE5 C;  2WIN B;  1FGU A;  5C44 B;  1E2Z A;  5J1Z A;  1CFM A;  2PW7 A;  1SDF A;  2EY6 A;  1HFN A;  2EJM A;  4IFD H;  4G7Z C;  1TQO A;  1PFM A;  1BCP B;  1ASZ A;  4C1N I;  3K5L A;  4BY7 G;  3T56 B;  1KC8 C;  4K14 A;  5KGU A;  3Q0A A;  1TS3 A;  3HOZ B;  3CKI B;  4JI8 Q;  4RGM A;  4N9T A;  2FHT A;  1ML0 D;  1P8L A;  4IJH A;  3S1R B;  2KOL A;  4LF5 Q;  3J81 E;  1SFO H;  1XNR Q;  3URY A;  2HIX A;  1EL0 A;  2WV6 D;  4DV2 Q;  1W6J A;  1T9H A;  2BA0 A;  1HUN A;  4WRD A;  3W1B A;  3RR5 A;  1JE4 A;  5IGD A;  4BXX G;  4B3T Q;  5EKI A;  5LL6 S;  4XT3 B;  4ZYS A;  1HZB A;  3F1Z A;  1UWV A;  3QB3 A;  4C3J H;  3HOZ G;  3OWF A;  1Y8O B;  3TDQ A;  4H7B A;  2A69 D;  4C3J B;  5ELB A;  2HUG A;  1SJH D;  3MEF A;  1DJR D;  1EFW A;  1YZ6 A;  4A3M B;  2G5D A;  5JJZ A;  4N8X 1;  2PPB C;  1EFI D;  1IXR A;  1TXY A;  1JCK B;  2YU9 B;  4FXK C;  1VQC A;  3CXC A;  1S5D D;  4PMC A;  4JI1 Q;  1V1Q A;  1D8L A;  4JI1 L;  5JPM C;  5M3F G;  1MHW C;  1PTO F;  1K0S A;  3ERO A;  2B8G A;  2OQK A;  2NVX H;  4K0K Q;  4IPH A;  2XWJ B;  5JVH 3;  4YHH Q;  1L1O A;  5FK9 C;  5ELD A;  4X3K A;  3R93 A;  4A3C G;  2TSS A;  2FMC A;  1ICF B;  1U5K A;  5J39 A;  4LW1 A;  1WTO A;  3S2D B;  3AFP A;  3KK7 A;  3J81 L;  2J7Z A;  2MO1 A;  4LUV A;  4J6H A;  2F0D A;  4F88 A;  1DM0 B;  2HD3 A;  3MTS A;  1CHP D;  3DLL A;  2KA7 A;  1TS5 A;  2CWP A;  4DXF A;  2KVM A;  2IJ0 A;  4ZUJ A;  3G6J B;  3I8Z A;  4JI0 Q;  3BVM A;  4A3B B;  2IHF A;  3CC4 A;  2DJG C;  4L5Q A;  4O0A A;  4DAV A;  1SXT A;  1SNQ A;  1PVO A;  1G51 A;  1RIP A;  1YBY A;  3H3V I;  3HEJ A;  1G29 1;  4RCN A;  3LNN A;  4GOP C;  4DV3 L;  1Q3L A;  4OO1 G;  1VQ8 A;  2YYZ A;  1HA6 A;  1QZH A;  4GKJ L;  1JJC B;  4KTA A;  1U0L A;  3SHL A;  4IO9 A;  4KD3 A;  3CHB D;  3T51 B;  2PI2 A;  2ZT9 C;  4A3G H;  3OWE B;  3CW2 C;  2EYL A;  2N78 A;  3HP3 A;  1C7Y A;  4NDX A;  2R92 G;  2NVT B;  1YJW A;  1SRO A;  2Q8T A;  2I5H A;  4A76 A;  2SDF A;  4V0B A;  1NMF A;  3UDX A;  1RHP A;  1HR0 L;  3PMF A;  3KLS A;  5JOB A;  4A3K G;  1I3Q H;  1YI2 A;  4GZY C;  2FFK B;  2Z6B A;  2CW0 D;  3TRE A;  2AHO B;  1KRS A;  3RLO A;  1OXV A;  3RD4 A;  1VQL A;  2ATW A;  1WD0 A;  3ZYY X;  4JI3 Q;  2CQA A;  3GTP H;  2JSO A;  1HNX L;  2L1B A;  3K80 C;  4WJ4 A;  4P73 A;  1IL2 A;  2KED A;  3J81 i;  5E4X A;  2VL6 A;  3HRZ C;  3IL8 A;  2F0V A;  1SJE D;  4H13 C;  2R92 B;  1TY0 A;  5IE8 A;  4KI0 A;  4DV5 Q;  2I07 B;  4K8I A;  5I2Y A;  5CR3 A;  5FLM G;  1TT2 A;  4A3K B;  1B3Q A;  1FYC A;  4HCS A;  4LFB L;  4A3K H;  1QG7 A;  1DGS A;  3SGI A;  4XYQ A;  5AJ3 Q;  4NW2 A;  2A69 C;  1NJI C;  5ELN A;  1PHJ A;  1EY0 A;  2RA4 A;  2Z6K A;  1PFB A;  1TWC H;  1I50 B;  1PV4 A;  1LTR D;  3O13 A;  3S17 H;  2VQF L;  1MJC A;  2WB1 B;  5M3F B;  1X65 A;  1LLR D;  5M5Y H;  4YCW A;  2KUM A;  2V1C C;  1BQQ T;  4G7O C;  1VQK A;  2JE6 I;  4JG2 A;  1X3Q A;  3M3Y B;  2BOS A;  1K8O A;  1Z47 A;  4DF7 A;  5D3I B;  4B3M Q;  3QG1 A;  3PO3 H;  3K5O A;  3H09 A;  1AH9 A;  2RHS B;  1XNQ Q;  1J6Q A;  1SEB D;  5G3L D;  2B2U A;  1F2Y A;  2M2L A;  2K04 A;  3JAM i;  1PH9 A;  2VQE L;  1FR3 A;  1K83 H;  1LT6 D;  2PMZ E;  4ID6 A;  3JAM c;  1BCP C;  1K83 B;  1C0A A;  2EY5 A;  3U4Z A;  1U9R A;  3I4L A;  4X3T A;  2RHQ B;  2BH2 A;  2KCC A;  1CQV A;  2ID0 A;  5CV5 A;  3U9O A;  1GKH A;  3SXH A;  1SYB A;  4B9X A;  4BBS G;  4B3S L;  2R92 H;  1J5E L;  1EWC A;  2ASB A;  4A3B H;  3OYY A;  5D14 A;  1CSP A;  2Q2I A;  2F0H A;  1WOC A;  1A2U A;  2ZJQ A;  3ND8 A;  4DR2 Q;  1OXT A;  2CQO A;  3KLR A;  2NVY H;  3P20 A;  2DY7 A;  4IPG A;  3IKJ A;  4HIM A;  1EQT A;  1X9N A;  1M8A A;  1LTI D;  1O78 A;  1VQD A;  1IKL A;  4X62 L;  4DV1 L;  1FNU A;  1WYD A;  1AN8 A;  4U67 3;  1JOO A;  3RNU A;  2ZTC A;  1F9R A;  4O2D A;  2F3V A;  3M7G A;  3GV3 A;  4JI6 Q;  1A0I A;  2UXD Q;  2IHE A;  3TQY A;  3BYY B;  3T1Y Q;  2K03 A;  4HJ7 A;  2UXC Q;  2ICI A;  3RN5 A;  3E3X A;  5KEE A;  3T53 B;  4KKT A;  4DR3 L;  5C3E G;  2HCC A;  2CH4 A;  4BY7 B;  3PGZ A;  2RBM A;  4A93 H;  4P72 A;  1VCI A;  1AE2 A;  2MP1 A;  2LXJ A;  4JI2 L;  4K2K A;  4CJ1 B;  4DUZ L;  4IUP A;  2HHH Q;  3K7A H;  4OWW B;  1VQ9 A;  4FP5 D;  4A4I A;  1I4G A;  3TP5 A;  2XVS A;  3D4W A;  3QOJ A;  3NQT A;  2B2T C;  4XQJ A;  1UE7 A;  2L5T A;  4G57 A;  4TKO B;  4RGO S;  4KY6 A;  5C4X B;  1O7L A;  2AQ2 B;  2EZV A;  2EPB A;  1NE3 A;  2E2J B;  4CDD C;  3AEV A;  1TWH H;  4DR5 Q;  1HTL D;  1WI5 A;  4M1U B;  1Y69 U;  4KHP L;  2JA7 B;  4KKU A;  2F4V L;  3UDI A;  3PO2 B;  3C46 A;  2F0E A;  4DR6 Q;  1WD1 A;  5A2Q L;  1PH1 A;  2R93 G;  2E2I H;  2RDF A;  1DCZ A;  2MFI A;  4PG3 A;  4RWS C;  3M4Y A;  5CV6 A;  4K5X A;  2OWO A;  1JOQ A;  1II3 A;  1EIG A;  2UUC Q;  3OOC A;  1QNU A;  1PRT C;  2RQX A;  1CZW A;  2K33 A;  3HS0 C;  4LUZ A;  1QZG A;  1B1Z A;  1JB7 A;  4JBM A;  1K28 A;  1T5E A;  4GKK Q;  3UDF A;  1WCM B;  2OCE A;  3OW7 A;  4IOC A;  4WOR A;  4LF4 L;  1KDA A;  1PFN A;  1QB5 D;  3I70 A;  4KHP Q;  3EQL C;  3CPF A;  3J80 E;  3A55 A;  3IFT A;  3MXG A;  3T1H L;  3CCJ A;  5GRO A;  1CI3 M;  1V8Q A;  2R93 B;  3ERQ A;  3K5N A;  1LYL A;  1U4R A;  4LFC L;  3X3M A;  3NBH B;  1BXT A;  1Y8P B;  1EZ8 A;  4NP5 A;  3NBH A;  3D31 A; 
#chains in the Genus database with same CATH homology
 1V43 A;  2B2V A;  1Q1B A;  2KEC A;  1EQV A;  3IAY A;  4DAY A;  3SVM A;  1LT3 D;  2WII B;  2NVY B;  3QOL A;  1VMP A;  4E6I A;  1I4P A;  4LAA A;  2VNU D;  3H3V C;  5C3E B;  2LMC B;  2KQ3 A;  5ELF A;  2AQ3 B;  3NWS A;  4A3G B;  2K1B A;  4YIJ A;  3KBX A;  4KY7 A;  3BYT B;  3S1N B;  3DUZ A;  4IAL A;  1R9T B;  1D2B A;  3D3R A;  3W2D A;  2F0F A;  3GV6 A;  1Q12 A;  3GO5 A;  1LAC A;  5D65 A;  1TU2 B;  3SEB A;  2AWO A;  1EU3 A;  2D9U A;  2K5D A;  3NK9 A;  1PLF A;  2QIL A;  3X3N A;  1WVL A;  3KUP A;  3UI2 A;  3D6C A;  4HCE A;  5JPN C;  4OO1 I;  4CJ0 B;  3VYU A;  4ZLT F;  4AYB B;  3BVG A;  1ZYR C;  1AZP A;  5IT9 E;  5K5P A;  2F0J A;  2CW0 C;  1CK1 A;  4LK1 C;  3TP8 A;  2BA1 A;  4IN3 A;  3C1E A;  3NPP A;  3RZD B;  1LO5 D;  2EYH A;  2Q8I B;  2A74 C;  4JBW A;  1IW7 D;  5EPL A;  4RKL A;  3TBI B;  2B63 B;  3E6Z X;  1IHZ A;  3NQI A;  3SK5 A;  4ABN A;  1I4H A;  5IIF A;  4I65 A;  3ONA B;  4LMQ D;  4F8M A;  3VR4 A;  2WAC A;  1LV9 A;  1HRJ A;  2XRQ D;  5JAV A;  2F1M A;  3CRK C;  3MC0 B;  4C2M B;  5FOB B;  1SNC A;  2QF7 A;  3A56 A;  1GUT A;  4N9P A;  1XWE A;  5C0X I;  1PZJ D;  2FMM A;  4H0L C;  2X6L A;  1B3A A;  1CT1 D;  4KHV A;  3FVQ A;  4BY1 B;  1SND A;  1JOR A;  3J80 L;  2LKV A;  3EVQ A;  2O2L D;  2O5J C;  3PUW A;  1LTA D;  1C8C A;  1BF4 A;  3D4R A;  1F9Q A;  1SNM A;  4C3H G;  2X6G A;  1QCB D;  1TS2 A;  1I6H B;  4A3I B;  2NVQ B;  2MGS A;  3S16 B;  1O80 A;  2F0M A;  4MIU A;  4RFB A;  4X3U A;  4HSP A;  1C48 A;  4B08 A;  5FO9 B;  5TSS A;  5CBE E;  5EKL A;  1LTG D;  4A3J B;  4DXG A;  5IGC A;  5E1F A;  2PZU A;  3GTQ B;  2QCP X;  1PTO D;  2B2W C;  2L55 A;  4QMG A;  1PZK D;  3FKI B;  2B2Y C;  4NKL A;  4FNF A;  1L0Y B;  2WKD A;  1PRT D;  1EWH A;  1KTK A;  2RKS A;  3FRP B;  2E2D C;  3NWT A;  5M5W B;  1Q90 A;  5JEA J;  2AQ1 B;  5FLX E;  3MHB A;  2SNS A;  4OO1 H;  1V1P A;  1ET6 A;  1WTV A;  1U4P A;  3V96 A;  3WDN A;  2NB0 A;  4Q0F A;  3QIA A;  3K59 A;  2XIW A;  1ENC A;  2J0T D;  3WOE A;  3L3O C;  4UAI A;  1H9M A;  4FYD A;  2A68 C;  4C56 C;  3PIO 3;  2Q8R E;  4EVO A;  4PNY A;  5DAU A;  4K2L A;  4L6T B;  1FD7 D;  1XTC D;  1QNK A;  1PYW D;  3L9A X;  3HG9 A;  2XSC A;  2D5D A;  4BA1 I;  2G9D A;  2VUM B;  1BBX C;  2I46 A;  1NUC A;  1BUV T;  1I4Q A;  2JEB I;  2RVL A;  3PUX A;  5CC4 A;  2QDB A;  4R8N A;  4DK1 A;  1ONL A;  1LTT D;  4CKB A;  2PNR C;  1TWH B;  4CBV A;  1TR5 A;  2MPM A;  3TZU A;  1B50 A;  3BZD B;  4KHZ A;  3I73 A;  1S5C D;  3T4A C;  1JWU D;  1RF2 D;  1G6Z A;  3NSW A;  3NE5 B;  3SK4 A;  2NN6 H;  2D62 A;  1YNJ C;  3MZ5 A;  5ELC A;  1U4L A;  2B2W A;  5IOC A;  5D3D A;  1DYQ A;  2F0N A;  1PTO C;  2IWH A;  2O4X A;  1G2S A;  1EY9 A;  3DWP A;  3N6R A;  3AMU A;  2L0C A;  2EOT A;  4Q5V A;  1JQY D;  1GHK A;  2KEE A;  3OIQ A;  4EQN A;  5IOD A;  4KK7 A;  4OGQ C;  1VDZ A;  5IGG A;  4RHS A;  2FJ2 A;  4ZRZ A;  2DN8 A;  2VB3 X;  3H0G B;  3RUZ A;  5C5L A;  2EJF C;  3BVZ A;  3DWA A;  2EYP A;  3A8I E;  2A6E C;  3C3L A;  3HGB A;  3R2I A;  1GUW A;  5EPK A;  1S5F D;  1JOK A;  3NXW A;  2WKC A;  2NWG A;  4IQZ A;  1Q1E A;  1H9R A;  1B9N A;  3OIP A;  4PMB A;  1KDB A;  2C9O A;  1BO0 A;  3MEH A;  5F2D A;  4EQO A;  3ND9 A;  3VA7 A;  2F3W A;  5E4W C;  2HDL A;  2PMZ B;  4FXD A;  1EY4 A;  2JXM B;  5J22 A;  3BG3 A;  1H9S A;  1XXG A;  1DOM A;  4CHT B;  4KV6 A;  2JA6 B;  3FMC A;  1GUG A;  1TWA B;  3HOW B;  2J4X A;  3GP7 A;  3RLF A;  4IUU A;  1SYG A;  1X3P A;  1G2T A;  5LL6 X;  1R4P B;  1YNJ D;  2A6E D;  3H91 A;  3D6W A;  4F7X A;  3C1F A;  1I4R A;  5DEH A;  1SMY D;  3H6M A;  2HDM A;  2IPK D;  5C5M A;  3SK6 A;  3VR2 A;  3M85 A;  1I3Q B;  4WFN 3;  3QWN A;  3Q23 A;  3DEP A;  5C3X A;  5C4H A;  2KJX A;  5IGB A;  1BDO A;  1WTP A;  3NP8 A;  2V4D A;  3S14 B;  1PMR A;  2FIN B;  1TWF B;  4OIK A;  3Q22 A;  2BCO A;  1WTW A;  4QIW B;  1A3T A;  1B2T A;  4QCL A;  4CJ2 C;  2EYM A;  4DA2 A;  1QIL A;  1SE3 A;  1EY6 A;  2KHS A;  1AZQ A;  4DU9 A;  2IW3 A;  4IUR A;  1QE6 A;  4NMZ A;  3EFX D;  1TY2 A;  2K7V A;  2Y0S B;  2E2I B;  1PRT F;  4ZK9 B;  4RH6 A;  4XYO A;  3VA5 A;  5ELE A;  1ESF A;  2GA4 B;  5M3M B;  1BNZ A;  1BR9 A;  3FDT A;  1D6E C;  2ICE C;  3P7J A;  4MN3 A;  1S4Z A;  2R7Z B;  1RCV D;  2F0Q A;  5BN3 A;  5BN5 A;  2A73 B;  3R8B A;  4ZUI A;  3U9S A;  1LT5 D;  2RDG A;  5DNF A;  1QWY A;  5A2Q E;  3AB9 A;  1STN A;  1K8M A;  1R4Q B;  4C3J G;  1IL8 A;  2LY7 A;  2QKI C;  4RGN A;  2K05 A;  3DHQ A;  2F4I A;  2F0P A;  5C4Z A;  4LJZ C;  3P75 A;  3QJY A;  3K57 A;  4RA8 A;  5I4D A;  3VR3 A;  5I9O A;  1PZI D;  3TN2 A;  1EIH A;  3TSS A;  2SNM A;  1Y1V B;  4A3D B;  4K8J A;  4K5W A;  1GUS A;  3HOX B;  1V1O A;  4A93 B;  5KNC A;  5FO7 B;  1RKN A;  3PUY A;  1A3V A;  3NTI A;  1HA5 A;  1CHQ D;  1PTO H;  5NUC A;  4KN7 C;  1EY5 A;  3D8G A;  5M5X B;  3GQB A;  1EY7 A;  2BE5 D;  4Y7N B;  4BA2 I;  2NZ1 D;  1FNW A;  1KDC A;  4A3E B;  4DNR B;  1H9J A;  2VXW A;  1AFP A;  2F0K A;  4DN4 M;  5HUR A;  4H44 C;  1S5B D;  5M5Y B;  4KJO A;  3QO2 A;  5KRU A;  1CA5 A;  4RHR A;  2MJ8 A;  1G91 A;  3Q24 A;  3NBI A;  2NTT A;  2DNE A;  1BCP D;  4CGY B;  1STH A;  2N88 A;  3BDL A;  3PUZ A;  2MUY A;  5M9O A;  4G7H C;  3GTP B;  4M8A A;  1O7Z A;  4TSS A;  3TP6 A;  3F2U A;  5DM6 3;  1BCP F;  4ME5 A;  3D4D A;  1EYC A;  4XDX A;  5C0X H;  2EY2 A;  3PIP 3;  4K6D A;  3SDZ A;  1EYD A;  5CV9 A;  1DXM A;  1GXD C;  3VYT A;  2F0T A;  5IT9 L;  1TWC B;  3E0J A;  1LT4 D;  1MI2 A;  1QOH A;  2DNC A;  2F0G A;  1PRT B;  5KND A;  4ULL A;  3KLS X;  1CM9 A;  3MWY W;  3RZO B;  5FKA C;  1G8Z D;  1ZKO A;  3W3A A;  4HMI A;  3I4N B;  3AU7 A;  1HQM C;  2PQE A;  5IGE A;  3R2T A;  1STA A;  2LFN A;  1FGB D;  1Q8I A;  4IUV A;  2PO4 A;  4KKS A;  5KYL A;  1A15 A;  1A6X A;  1MSG A;  2AWN A;  5EPJ A;  1YNN C;  5AFW A;  1E2V A;  3SE0 A;  1UUP A;  1SFO B;  1MD2 D;  1JB3 A;  2JYO A;  5C3W A;  2EVB A;  4K6L A;  5CYU A;  1CQF A;  2SOB A;  3GTJ B;  2HQE A;  1SE4 A;  4I7Z C;  1MSH A;  2QEJ C;  3MXU A;  3E5S A;  1TKW B;  3VR5 A;  1F2Z A;  3T13 A;  1HQR D;  4MHE A;  1A2T A;  1NAP A;  2TMP A;  1MBY A;  3CU7 A;  5JEA H;  2L11 A;  2JEA I;  4FF1 A;  1EU4 A;  1B53 A;  1M4V A;  4XQQ A;  3LWU A;  1ILP A;  5C6A A;  4RCO A;  3SK8 A;  3T16 A;  4HR7 B;  1LTS D;  1YNN D;  1NSN S;  3V05 A;  2OXP A;  3OPO A;  1OO9 B;  1TWG B;  4S3S A;  1E0B A;  1LTB D;  3S1M B;  2B2Y A;  1SMY C;  3I91 A;  1E2W A;  2E74 C;  2OT2 A;  4DK0 A;  1RJT A;  2NYZ D;  3TP7 A;  4TQU S;  3GTO B;  3S2H B;  1GHJ A;  3NHH A;  3GTM B;  1WTR A;  4IUQ A;  3DM1 A;  2Z4I A;  4OHJ A;  2C5C A;  5G3L F;  2NBF A;  3I4M B;  4F87 A;  3JAM E;  1XYI A;  1CZG A;  3A8K E;  1F9P A;  4JK1 C;  1SAP A;  1Y8N B;  3HKZ B;  2R3Z A;  2WP8 J;  2EYF A;  1ENF A;  5ISR A;  3OMC A;  2LS0 1;  4WJW A;  3K5M A;  1H9S B;  5FO8 B;  1O7Y A;  2B2T A;  2JP1 A;  4KJN A;  1CA6 A;  1HCZ A;  5JEA G;  1XX8 A;  1HHV A;  1HFG A;  3TZD A;  2A5H A;  3NTK A;  1TVX A;  1Z7T A;  2IX1 A;  3KBG A;  4XXE A;  2PYK A;  1DZ1 A;  1WTQ A;  1J8I A;  3EA6 A;  1SYE A;  4KY5 A;  4C3I B;  1I6V C;  3IFD A;  3S9W A;  2F0L A;  1UEA B;  4ZQ3 A;  1RTO A;  2E76 C;  5DM7 3;  3J7A V;  2SEB D;  4DFA A;  1VF7 A;  2XNA C;  2EY1 A;  4CKE A;  1EY8 A;  3M7N A;  1ROD A;  2A6H D;  1EZ6 A;  4Z9C B;  3OHX C;  5COR A;  1J9O A;  4RKB A;  1D1K A;  1CTM A;  4FVM A;  1DOL A;  2RSN A;  3KF8 A;  4PQX A;  2IX3 A;  3J7A F;  3H94 A;  4C1N K;  1H9K A;  1STE A;  2EYO A;  1ENA A;  1B44 D;  1IW7 C;  1F77 A;  2OF1 A;  3GTK B;  2ZXR A;  3PUV A;  3S17 B;  2Z4H A;  1JWM D;  2K28 A;  3S1Q B;  2D2C C;  2F03 A;  4L8J A;  5HGT A;  1L0X B;  3VR6 A;  1EYA A;  2X69 A;  2K32 A;  2XWB B;  3RMH A;  4QUF A;  3MVV A;  4FF3 A;  2L4N A;  1ICW A;  2EXZ A;  1IYV A;  4EGV A;  2B2V C;  4HED A;  5EQ0 A;  1EEI D;  1B4O A;  5E3F A;  4BS9 A;  1IKM A;  1SSO A;  1FNV A;  2E75 C;  2AUJ D;  2WAQ B;  1ZEQ X;  3A7A B;  5CGK A;  1C4Q A;  1GUO A;  5A35 A;  5JVG 3;  4IFD I;  1AP0 A;  1STG A;  5EBC A;  4KD4 A;  4J1M A;  1ILQ A;  2K5Q A;  3WOF A;  5T1G A;  2CVR A;  2OEO A;  2XRS D;  3EJI A;  4IUT A;  1KLG D;  4HSV A;  3LX0 A;  1SNP A;  2K01 A;  1D5X C;  1I4X A;  5K36 H;  1ESR A;  2JA8 B;  2JA5 B;  4J8Q A;  3BDO A;  1DOK A;  5COY A;  4R9W A;  1KNE A;  3P1H A;  4X3S A;  2L12 A;  2A6H C;  1SNO A;  1Y1W B;  1PTO B;  3PV0 A;  2ENB A;  1U4M A;  4BBS B;  3C2P A;  3MFY A;  1RDP D;  4KN4 C;  4U68 A;  3DMU A;  5CBA E;  4A3F B;  2BDO A;  1PXU A;  1NCV A;  4IFD J;  3L7Z C;  1HPC A;  5CV8 A;  2NUC A;  5K36 G;  1EOT A;  3GTL B;  3S15 B;  4QB4 A;  1RD9 D;  2R6G A;  3HOY B;  3GD7 A;  1Z6H A;  2F0O A;  1SYD A;  3N52 A;  2AUK A;  3CQZ B;  2HCI A;  4B9W A;  2MHV A;  4DGZ A;  1D5Z C;  1OXU A;  2E2H B;  3LWE A;  4O1N A;  2EDG A;  3MXN A;  3I90 A;  2H4O A;  2F0I A;  5T1I A;  3SR1 A;  2IL8 A;  5I6W A;  3OSO A;  4ZKB B;  1PDQ A;  2XN9 C;  3G7L A;  2A68 D;  1RTN A;  1HTP A;  1WTX A;  3DEO A;  5LHY 1;  1D5M C;  4P2C B;  3MA2 B;  2EYJ A;  4BWG B;  3VYS A;  4DAP A;  4O42 A;  4C3I G;  1STY A;  1KNA A;  4DNT B;  4G4K A;  2F0W A;  3K58 A;  3I72 A;  3HOU B;  5EGT A;  3FPU B;  1ZXT A;  3OMG A;  3VYR A;  4FF4 A;  3CRL C;  3PO3 B;  1SYC A;  5EBD A;  3DWQ A;  5I2X A;  4RGT A;  3FEW X;  2NVX B;  4KMU C;  1OXS C;  4XT1 B;  1HXY D;  1DD2 A;  2CHB D;  4L63 B;  1MGS A;  3HZX A;  2BDN A;  2B39 A;  5I9P A;  4ZKC B;  4PV1 C;  2B8F A;  4XQN A;  3K7A B;  1JWS D;  4QF4 A;  1DON A;  2G9H D;  4ZAI A;  3GTG B;  3MFG A;  3MAQ A;  2K5W A;  5EKK A;  5KYI A;  2F0S A;  2VB2 X;  4OL7 A;  1TII D;  2PW5 A;  1V1P B;  1VMC A;  3I3C A;  5I6Y A;  2EE1 A;  1F2M A;  1SYF A;  1JIC A;  5KIX A;  2PZW A;  4XTC S;  2KCN A;  1SE2 A;  1NR2 A;  1JC7 A;  3A54 A;  4EQP A;  1OXX K;  2R61 A;  3A8J E;  4R8I A;  2K6A A;  3FPP A;  1ET9 A;  2RDH A;  3BDC A;  3A7L A;  5FLX L;  1AEX A;  2B2U C;  4FXG C;  3DXJ C;  3TME A;  1KLU D;  2ZXP A;  5EJW A;  2NN6 I;  1STB A;  2DY8 A;  1NR4 A;  1UAP A;  2EJG C;  5CV7 A;  5KNB A;  4ILW A;  1A3U A;  3R3O A;  4IUN A;  1T5X D;  4TRD A;  3K0Y A;  2F0U A;  3M4O B;  5C0X G;  4IFD G;  1HUM A;  3HOV B;  1GOZ A;  5IGF A;  4UDU C;  3V2T A;  4K5V A;  4XIG S;  3Q6S A;  4BBR B;  2PZT A;  3NUC A;  1EEF D;  3MXP A;  2O5I C;  2H1E A;  1F2L A;  1UNS A;  4RAU C;  1ZYR D;  2NTS A;  5BN4 A;  2ZXO A;  3ITP A;  1F9S A;  4V19 0;  1QJO A;  4OIJ A;  5C0X J;  2M00 A;  4FO2 A;  3J7Y W;  3K6O A;  4ODG A;  5CV4 A;  1D1I A;  3JAM L;  4HN7 A;  1S5E D;  2Z1C A;  2IT1 A;  4HMJ A;  1JR0 D;  1W6K A;  4IZ8 A;  2L9H A;  2M9V A;  1TS4 A;  1KAA A;  3BS1 A;  4CKC A;  1SBB B;  4PMW A;  1LAB A;  1IYU A;  1KAB A;  2IX0 A;  1BOS A;  2NN6 G;  3NTH A;  4HTH A;  2RSO A;  4QUC A;  1AW7 A;  1GUN A;  1B9M A;  2N55 A;  4C3H B;  4HAE A;  5C4J B;  1X32 A;  2Z8L A;  5CMD A;  4FF2 A;  2PCF B;  1VF5 C;  1GJX A;  2BE5 C;  2WIN B;  5C44 B;  1E2Z A;  5J1Z A;  1CFM A;  2PW7 A;  1SDF A;  2EY6 A;  1HFN A;  2EJM A;  4IFD H;  4G7Z C;  1TQO A;  1PFM A;  1BCP B;  4C1N I;  3K5L A;  3T56 B;  4K14 A;  5KGU A;  3Q0A A;  1TS3 A;  3HOZ B;  3CKI B;  4RGM A;  4N9T A;  2FHT A;  1ML0 D;  3S1R B;  2KOL A;  3J81 E;  3URY A;  1EL0 A;  2WV6 D;  1W6J A;  2BA0 A;  1HUN A;  4WRD A;  1JE4 A;  5IGD A;  5EKI A;  5LL6 S;  4XT3 B;  4ZYS A;  3QB3 A;  3OWF A;  1Y8O B;  3TDQ A;  4H7B A;  2A69 D;  4C3J B;  5ELB A;  2HUG A;  1SJH D;  1DJR D;  4A3M B;  5JJZ A;  2PPB C;  1EFI D;  1JCK B;  2YU9 B;  4FXK C;  1S5D D;  4PMC A;  5JPM C;  1PTO F;  3ERO A;  2B8G A;  2XWJ B;  5JVH 3;  5FK9 C;  5ELD A;  4X3K A;  3R93 A;  2TSS A;  2FMC A;  5J39 A;  1WTO A;  3S2D B;  3KK7 A;  3J81 L;  2J7Z A;  4J6H A;  2F0D A;  4F88 A;  1DM0 B;  3MTS A;  1CHP D;  2KA7 A;  1TS5 A;  4DXF A;  2KVM A;  2IJ0 A;  4ZUJ A;  3G6J B;  3I8Z A;  3BVM A;  4A3B B;  4DAV A;  1SXT A;  1SNQ A;  3HEJ A;  1G29 1;  4RCN A;  3LNN A;  1Q3L A;  4OO1 G;  2YYZ A;  1HA6 A;  4KTA A;  3SHL A;  4KD3 A;  3CHB D;  3T51 B;  2ZT9 C;  3OWE B;  2EYL A;  3HP3 A;  4NDX A;  2NVT B;  2Q8T A;  2SDF A;  4V0B A;  1RHP A;  3PMF A;  3KLS A;  5JOB A;  4GZY C;  2FFK B;  2CW0 D;  1OXV A;  3RD4 A;  1WD0 A;  3ZYY X;  2CQA A;  2JSO A;  2L1B A;  2KED A;  5E4X A;  3HRZ C;  3IL8 A;  2F0V A;  1SJE D;  4H13 C;  2R92 B;  1TY0 A;  4KI0 A;  2I07 B;  4K8I A;  5I2Y A;  5CR3 A;  1TT2 A;  4A3K B;  1FYC A;  4HCS A;  1QG7 A;  4XYQ A;  4NW2 A;  2A69 C;  1EY0 A;  2RA4 A;  1PFB A;  1I50 B;  1LTR D;  3O13 A;  2WB1 B;  5M3F B;  1LLR D;  2KUM A;  1BQQ T;  4G7O C;  2JE6 I;  1X3Q A;  3M3Y B;  2BOS A;  1K8O A;  1Z47 A;  4DF7 A;  5D3I B;  3QG1 A;  3K5O A;  3H09 A;  5G3L D;  1SEB D;  2B2U A;  1F2Y A;  2M2L A;  2K04 A;  1FR3 A;  4ID6 A;  1LT6 D;  1BCP C;  1K83 B;  2EY5 A;  1U9R A;  3I4L A;  4X3T A;  2KCC A;  1CQV A;  2ID0 A;  5CV5 A;  3U9O A;  3SXH A;  1SYB A;  4B9X A;  1EWC A;  5D14 A;  2F0H A;  1A2U A;  3ND8 A;  1OXT A;  3KLR A;  3P20 A;  2DY7 A;  3IKJ A;  1EQT A;  1M8A A;  1LTI D;  1O78 A;  1IKL A;  1FNU A;  1AN8 A;  4U67 3;  1JOO A;  1F9R A;  2F3V A;  3M7G A;  3GV3 A;  3BYY B;  2K03 A;  2ICI A;  5KEE A;  3T53 B;  4KKT A;  2HCC A;  4BY7 B;  2RBM A;  1VCI A;  2MP1 A;  4K2K A;  4CJ1 B;  4IUP A;  4FP5 D;  1I4G A;  3TP5 A;  2XVS A;  3D4W A;  3QOJ A;  3NQT A;  2B2T C;  4XQJ A;  2L5T A;  4G57 A;  4TKO B;  4RGO S;  4KY6 A;  5C4X B;  1O7L A;  2AQ2 B;  2EZV A;  2EPB A;  2E2J B;  1HTL D;  4M1U B;  1Y69 U;  2JA7 B;  4KKU A;  3PO2 B;  3C46 A;  2F0E A;  1WD1 A;  5A2Q L;  2RDF A;  1DCZ A;  4RWS C;  3M4Y A;  5CV6 A;  4K5X A;  1JOQ A;  1II3 A;  1EIG A;  3OOC A;  1QNU A;  1PRT C;  2RQX A;  1CZW A;  2K33 A;  3HS0 C;  1B1Z A;  1T5E A;  1WCM B;  3OW7 A;  4WOR A;  1KDA A;  1PFN A;  1QB5 D;  3I70 A;  3J80 E;  3EQL C;  3A55 A;  3IFT A;  3MXG A;  1CI3 M;  1V8Q A;  2R93 B;  3ERQ A;  3K5N A;  1U4R A;  3X3M A;  1BXT A;  1Y8P B;  1EZ8 A;  4NP5 A;  3NBH A;  3D31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...