1EZ6A

Structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez6A00
1SNOA 4J6HA 4KJOA 2F0SA 4NDXA 5IIFA 2F0HA 2M00A 1JOKA 2F0OA 4DGZA 5IGDA 2F0TA 5EKLA 5F2DA 1KDBA 4ID6A 1RKNA 1SYEA 3DHQA 1NUCA 5I9OA 2F0EA 2EYMA 3S9WA 1JOOA 3NK9A 4ODGA 2F3WA 3NP8A 5CV6A 1NSNS 4LAAA 1STBA 2O4XA 4OL7A 4S3SA 1F2ZA 3NQTA 5NUCA 1EY6A 5IGBA 5IGFA 5KGUA 1II3A 4KJNA 3EROA 2SNMA 4H7BA 3E5SA 3U9OA 3OMCA 3LX0A 4WRDA 2F0MA 2EYPA 4TRDA 4K6DA 1A3TA 1AEXA 4PMCA 2OF1A 4KD3A 5ISRA 4HTHA 3D6CA 3HZXA 3OSOA 5IGCA 1EY5A 1TR5A 1TT2A 4K5XA 4I65A 3V2TA 5DEHA 2KHSA 4F7XA 5E1FA 1EYDA 4PMBA 3SK6A 2RBMA 1KDCA 1SNPA 2F0GA 3P1HA 5KIXA 5KYIA 1EY7A 4EQOA 1U9RA 2F0QA 4RKLA 1EZ6A 3TP8A 1SNMA 3NXWA 4EVOA 5CV7A 4B9XA 5JAVA 5KYLA 3MVVA 3PMFA 4YIJA 5IOCA 4K8IA 1KAAA 1ENAA 3SR1A 5J1ZA 2OEOA 3RUZA 4ZUIA 2PW5A 3ERQA 4K2LA 4QB4A 4HMIA 1STHA 2EXZA 3MXPA 3NHHA 5CV9A 5I9PA 1STAA 2F0JA 4ZQ3A 1STGA 1A2UA 2PZUA 3MZ5A 5CV4A 1EY8A 3P75A 3BDCA 2RKSA 4NP5A 2EY1A 5C4HA 4K5VA 4N9TA 3SHLA 5DAUA 5IODA 5I6WA 2SNSA 5KRUA 1A2TA 3MEHA 3BDLA 5HURA 5J39A 1SYFA 2LKVA 3ITPA 3NUCA 4KTAA 4K2KA 2PYKA 1KABA 3R3OA 3TP6A 5M9OA 4B9WA 4QF4A 5EKKA 4IALA 3VA5A 4E6IA 2EYFA 1F2MA 3EVQA 1IHZA 2F0DA 4N9PA 5CR3A 3QOJA 3QOLA 2F0UA 1EY0A 4KV6A 3SK4A 3TMEA 2HQEA 2OXPA 5HGTA 4DU9A 4KY7A 1SYGA 2F0KA 2F3VA 3OWFA 1EZ8A 4RKBA 3TP7A 1SYDA 2EY2A 3EJIA 5C3XA 5C3WA 5CV8A 3C1FA 4K8JA 4KY5A 1EY4A 1EYAA 5CGKA 3D4DA 3H6MA 3SK8A 4KHVA 5K5PA 4IZ8A 1EY9A 3HEJA 5C5MA 4ME5A 5CV5A 5C5LA 1STNA 4F8MA 5IGEA 1JORA 3DMUA 4IUNA 2QDBA 3MHBA 4NKLA 4NMZA 3T13A 2EYLA 1F2YA 4EQPA 2F0WA 2EY5A 2SOBA 3D8GA 5IGGA 1EYCA 4KD4A 4MIUA 4KY6A 2F0IA 3T16A 2PZTA 4WORA 5C6AA 5I6YA 5KEEA 2EYOA 2F0NA 1SNDA 1EQVA 3SXHA 2NUCA 3OMGA 1SNQA 4J1MA 1A3UA 3TP5A 4DFAA 1SYBA 1TQOA 4QMGA 2EY6A 2WACA 2F0PA 4DF7A 5J22A 1A3VA 3QB3A 2F0VA 5CC4A 2ENBA 2PZWA 4PNYA 4G57A 4K14A 5EGTA 2EYJA 4K5WA 5C4ZA 2KQ3A 2RDFA 4HMJA 2PQEA 3C1EA 5E3FA 4R8NA 1STYA 2F0LA 4ZUJA 3D4WA 2F0FA 2PW7A 1ENCA 1KDAA 5JOBA 4EQNA 1JOQA 3SK5A 1SYCA 1SNCA 2EYHA
chains in the Genus database with same CATH superfamily
1XX8A 2M00A 3K6OA 4B3SL 3A74A 4JI1Q 5C4XH 5EKLA 2LSSA 5IP9H 3BZCA 4AH6A 5E4WC 2F3WA 1Z7TA 2D9UA 4C56C 1F9RA 1PFBA 5IGBA 1EY6A 1O7LA 1TWHB 4MZ9A 2SNMA 2CQAA 3HKZG 4FDBA 3PUXA 4RGNA 1IYVA 1JCKB 2NVQH 1NY4A 5DLQE 1EWCA 1WTOA 5GAHC 4PQXA 3NTKA 5M5XB 4DK6C 5M3MG 1B3AA 4C3JG 3NE5B 1WOCA 2RBMA 2Z0SA 3T1HQ 1Y1VB 2VB3X 3MVVA 3CC7A 4A3IG 2G9DA 4M8AA 2ZM6Q 1SJHD 4X6AH 4RMFA 4HJ9A 1HUMA 1UE7A 2N3SA 4CDEC 1YNJD 1EFID 1JMCA 1MSHA 1STAA 3HFZB 2I5LX 5JVH3 2IX1A 2HT1A 1VQ9A 4LF9Q 5C44B 1YNJC 2K01A 2KCTA 1J5EL 1PH8A 3TP6A 4IJLA 1Y8OB 4B9WA 1GHKA 3L7ZC 2EZVA 2SEBD 3LWEA 4N9PA 4KMUC 5IT9c 1WD1A 2KEDA 1WTXA 3TMEA 2N8NA 4B3RQ 2D0PA 4JI0L 1LTLA 3TEHB 4UPAA 5IP9G 3G6JB 4UHVA 3UDGA 4BY1H 2K5WA 4LF8L 3SEBA 1I94Q 1RD9D 3NELA 1BCPF 5K5PA 1TWHH 2F52A 3GV3A 3IKJA 1DCZA 3S1NB 1Q1BA 4JI1L 1JWMD 3QJYA 4KY6A 3OYYA 1S40A 4LUVA 3H0GB 4MN3A 5KEEA 1N34Q 1PH2A 1W2BA 2NN6I 1I4XA 3NWTA 1SNQA 1K0SA 4FF1A 3KDFA 5CC4A 4UDUC 1O80A 2ICIA 2I5HA 5C4ZA 3GTPB 2F0FA 1YNXA 3CC2A 1MBYA 4PZ7A 3PCOB 4CJ0B 1I6VC 5IYCH 3K0YA 1KNAA 1HQRD 1I3QB 2QGQA 2ASBA 5J3BA 2QKIC 2BCOA 2AQ3B 1C8CA 3T1HL 1PDQA 3MXNB 4ODGA 3RN2A 1CI3M 3NENA 2O4XA 2ZM6L 3VYSA 5A2QL 2O5IC 2EQSA 4KJNA 1Q86C 4HIOA 2E8GA 2X6GA 3JAMc 1GUOA 3LX0A 1RIPA 1EEFD 2B2YA 1TWCB 1BDOA 4DPGA 1A3TA 1AEXA 5IYBH 1N33L 1E0BA 3CMEA 1MGSA 4LF9L 4DR1Q 1TR5A 1TT2A 2E5LQ 5HY6A 2Q8TA 1X54A 5DEHA 2L9HA 2GA4B 3CXCA 3KJPA 4R4CA 1PMRA 3HKSA 5EBDA 1HFGA 4BY1G 1Y69U 3ERQA 4B3RL 4DNIA 1E1TA 1XMQQ 4U673 3BZDB 4L5TA 3BVZA 2B2YC 3OW2A 2ZJPA 3BVMA 1I94L 4N9TA 5A2QE 4PMWA 4BY7H 3NUCA 4E6IA 5FKAC 1F2LA 2O2LD 1N34L 1I5FA 2ZT9C 4C1NK 1G6ZA 3SK4A 3D3RA 4DK3C 4TSSA 3TREA 1N8RC 3S1QH 1S5ED 2K7VA 2MO1A 4TQUS 5ELBA 5C0XH 5TSSA 3A7LA 3MWYW 2IHFA 1A63A 1YBYA 4K8JA 3PIOA 1PHJA 2DJFC 1VQFA 4IZ8A 3MEFA 3HEJA 2VXWA 5C5MA 5C5LA 1SMXA 2E2IH 1VQNA 2VUMH 2NVYH 4LW1A 3CRKC 4NW2A 3HGBA 4P74A 1HNZQ 2L11A 3DLLA 1EQVA 1L1OC 2DJGC 1NCVA 4DF7A 3HOZB 4CKEA 1OTCA 1V9PA 2K5NA 4DKAC 2MUYA 1CKNB 4HMJA 1SAPA 4C3HB 1CKMA 3K5MA 3EBEA 3CCMA 4RWSC 4A3DB 4DV1Q 2F0LA 1K9MC 4X3KA 4DR1L 1RJTA 3A5UA 2EDGA 3NPPA 4HJ7A 3TZDA 5LMNQ 3NQIA 1C4QA 2A6ED 4DV6Q 3K7UC 4CDFC 4YWLA 5JJKA 1V8QA 1Q3LA 1VQCA 3P7JA 3CP0A 4UP7A 1OXTA 1WTHA 4BY7G 4OELB 2A6EC 1VQGA 4R9WA 4CGYB 1XMQL 4RGTA 4KD3A 3CCUA 3OSOA 3CCQA 2HUGA 3VR2A 2B2WA 3H94A 1EOTA 2FFKB 4EQOA 1ONLA 3TP8A 3M4YA 4HR7B 5C0XG 3I4NB 2EJMA 4GOPA 1CK1A 1OXSC 2JE6I 1BXTA 3LNNA 2V4DA 3IL8A 1ET9A 4HMIA 1BO0A 2VUMG 4UP9A 1EIYB 2E76C 3WWVA 3KLSA 2R7DA 1GUGA 3PQIA 3I4MB 2RKSA 3EN2A 3HOYB 2UUAQ 3FMCA 1DOLA 5DAUA 3S14H 5I6WA 5KRUA 1CHPD 2JA9A 3MEHA 1CHQD 5FOBB 5EQ0A 1TWAH 3ZJYC 4J8QA 1JJGA 4XT3B 4IALA 2B2WC 1IHZA 1HNZL 1B9MA 2F0DA 1Y8PB 2BOSA 2JK8A 4GOPC 2ZXRA 1WYDA 2HQEA 4GLVB 2F3VA 1JE5A 1SE8A 1D1KA 3K5NA 2KHJA 4KY5A 2AQ1B 2BA1A 3K5OA 5T1IA 4DV1L 5DM63 1P16A 4IURA 3HOXH 2Q2TA 5EJWA 2EYLA 5AJ3Q 2D62A 4TVAB 1TS4A 5LMNL 1VQEA 1EIGA 4DV6L 2XSCA 1GJXA 3GQBA 3UE1A 5IP7H 4A3JB 2C9OA 2HCIA 4K0KQ 1HR0W 1E1OA 3K57A 2K75A 5BN4A 3E9HA 4A3LH 3NBIA 4CBVA 2QA4A 3S17H 1PZKD 2IL8A 3D4WA 2IX3A 3RNUA 2IY5B 2R7ZB 1JOQA 1Q46A 5LMUQ 2I0QA 2R92B 1G8ZD 2A6HD 2RHSB 3G6EA 2F0SA 1L0WA 1KDBA 4ID6A 1LTTD 3E6ZX 3GP7A 2WIIB 1NSNS 3MC0B 2A6HC 3HOYH 2PMZB 1F2ZA 1KL9A 3NQTA 4LWCA 2K32A 2RVLA 4A3GB 3F2DA 4BBRB 2EYPA 1AH9A 2JEBI 1TWFB 1ET6A 2YV5A 2K04A 2UUAL 4FO2A 3I90A 2HIXA 1S4ZA 1G6PA 4A3KH 1RTOA 5IY0A 1SXTA 3NXWA 2A74C 1AN8A 4YIJA 4QL5A 2OEOA 1J9OA 1WTVA 4HN7A 2PW5A 3PIPA 2EXZA 3HOXG 4X62Q 2KBNA 3Q8DA 1KRSA 1NR4A 4DR3L 3CRLC 1VMPA 5C3EH 4A3JH 2JXMB 2Y0SE 1M4VA 3K5LA 4DV2Q 4ZAIA 2IJ0A 1DGSA 1X32A 2CWAA 3S16B 5IP7G 2VQFQ 2PYKA 1W6KA 1GUNA 3RZDB 2EOTA 2GVAA 5AJ3L 1H9SA 4LJZC 3KDFB 1JQYD 4R8IA 1RTNA 5CR3A 2BA0A 1SROA 1D5XC 2PI2A 3AU7A 1AFPA 2E2DC 4C2MH 1XNQQ 3RLNA 4K0KL 3IFTA 3F2UA 1QOHA 1EEID 1TY2A 1FNWA 2L15A 5LMUL 4F8MA 3HOYG 2K5VA 3DXJC 1IBLQ 5T1GA 2HQLA 3CPWA 1X3EA 2RCNA 3G4SA 4A3GH 3OIQA 2EXDA 1MHWC 1LACA 3SXHA 4BA1I 5LL6S 1BVSA 2F0PA 2WACA 5CORA 3KF6B 3VR4A 2F4VQ 2RDGA 4PNYA 1IXRA 1PRTD 3L9AX 3DEPA 3T56B 4A3KG 3U9SA 3ER0A 1RL2A 3PO2H 3HOVB 1QZGA 4ME3A 3GD7A 1BQQT 3J7A5 1PRTC 1G91A 3H91A 1N36Q 2H5XA 4A3MH 3A0JA 3T4AC 4IJHA 4XQJA 3M3YB 3NBHA 2F4IA 4GS3A 2VY3A 5NUCA 5C3EG 4A3JG 3A8KE 2Z6BA 3IFDA 4H7BA 1H9JA 3U9OA 2MO0A 4X62L 3S24A 3J80i 4RG1A 1WCMB 2E2HB 3KBXA 4JBMA 4DXFA 2OF1A 2BE5D 5IGCA 1ICWA 3W5OA 2R7ZG 2JA6H 2R92G 2WAQE 5IYDH 4DV2L 4A76A 2K6AA 5M5YB 2VQFL 4JI5L 2DY8A 4KKUA 3SK6A 1KRTA 4JG2A 1CT1D 1KLGD 1SNMA 1V43A 2BE5C 2K14A 2ZTEA 4R4QA 4UAIA 5GADC 1U4LA 2MP1A 3V05A 1KXLA 4G7ZC 4LNQA 3RUZA 4QB4A 3J7YW 1XNQL 4CJ1B 3HG9A 3J81i 4A3GG 5CV4A 2I46A 4BXXH 5BN3A 3U4VA 2QCPX 2XWJB 3BDLA 3BYTB 1IBLL 5EAYA 3R3OA 4OO1H 3K7AB 5EKKA 2Y0SB 2NYZD 3QR8A 5D3IB 3TDQA 1UUPA 4DK0A 4X64Q 1V1PA 1CM9A 2UXBQ 3PO2G 1PH7A 3U58A 2PPBC 1B9NA 2RQXA 4KY7A 1SYGA 2F4VL 4Q0FA 3BU2A 2JA5B 1HTLD 1S5FD 4H44C 5C3WA 3C1FA 1P8LA 3M3YH 2B63H 1UE1A 4OWTB 3SK8A 3VYRA 4A75A 4A3MG 5EPJA 2NB0A 1YZ6A 5IGEA 4OWXB 5FLXc 2B39A 3D8GA 5IGGA 2K4KA 2KHIA 1TS5A 3KF8B 2M2LA 1AW7A 1MJEA 2FMCA 1E3PA 4J1MA 1PH1A 1XNRQ 1TVXA 4AYBB 2DNCA 2B3GA 5J22A 2B29A 3BDOA 2VW9A 4LFAQ 2JA6G 2DY7A 5IYDG 2GN5A 2IW3A 4WJ4A 3TBIB 1BNZA 1STYA 4ZUJA 1SRUA 1IKMA 1SNCA 3GTOH 1J8IA 1H9RA 2EVBA 1JOKA 3PIO3 5IGDA 4YY3L 4GOPB 5F2DA 1DZ1A 3DHQA 1HZAA 4KN7C 4ZRZA 3S9WA 3QWNA 2K5DA 3A54A 3KUPA 1X3GA 1R4QB 4BXXG 1DD2A 4PZ6A 4YWMA 1G51A 3DWPA 4OO1G 2FINB 2DUDA 1K8GA 1Y1WH 2MNAA 3CPFA 3GTLB 1B2TA 3T1YQ 1NE3A 4IQZA 2SDFA 4DV3Q 4LF6Q 1RDPD 4IPHA 1A8VA 5CMDA 1RODA 2WAQB 1PYWD 4I7AA 4ZK9B 3FRPB 4X64L 2UXBL 1YHBA 2B63G 1I50H 1S5BD 3OOCA 1DM0B 4RFBA 2A1AA 3AFPA 4JW0A 1VQPA 5M5WB 1BF4A 1OXUA 1HR0Q 1EU3A 2X69A 3LWUA 4H0LC 3F2BA 4DAMA 3E9IA 4DV0L 3S2HH 1A2TA 1TU2B 1PFMA 4RHRA 2M9VA 4KTAA 3ULPA 1BBWA 2L55A 4R4TA 3MXGA 3EVQA 3JAME 1XNRL 4TKOB 3RR5A 4DU9A 4GKKQ 4JOIA 1EZ8A 4LFAL 1PTOD 5EKIA 3W1BA 1E22A 1WTRA 5CGKA 2A68D 2JA7B 1WVLA 1N33Q 4GN3B 2CFMA 2DN8A 1STNA 2B2TA 3KFUA 4B08A 1PTOC 4GLAC 3I3CA 4QQBX 1MJCA 1X55A 2A68C 2Y0SG 5I6YA 1HA6A 3FP9A 2NUCA 2F03A 4GZYC 1WFQA 1TQOA 2BDOA 2D2CC 2V1CC 5E4XA 2RCFA 1A3VA 1Y1WG 2PQAA 3QB3A 4A3EB 2MHVA 2RSOA 2QEXA 1Z9FA 4JOIC 4K5WA 1ASYA 1UNSA 1W6JA 1O78A 1CZGA 4V0BA 2Z4HA 3MFYA 4NPSA 1IW7D 1JT8A 3T1YL 4O1NA 3H15A 1EWIA 2B2TC 4DV3L 4LF6L 2BDNA 5M5WH 1IZ6A 3UI2A 3RLOA 1IW7C 1UAPA 1IBMQ 3UE0A 5M5XH 5KGUA 5FLMH 2N88A 4RCOA 3E5SA 1PFSA 3OMCA 2JA8B 1Y1VH 1SFOB 1VQBA 1HR0L 1Q90A 3W3AA 3M7NA 2B2UA 2ALYB 3V2TA 5JVG3 3FVQA 5E1FA 1SNPA 5BR8Q 1HJPA 3VR5A 1WD0A 3HS0C 2A8VA 4A93B 1QUQA 1GHJA 1CFMA 1QCBD 5C44H 5JJLA 1LTRD 1QNUA 4GKKL 3Q24A 2OQKA 1PH5A 1EQTA 2L5TA 4HIMA 4K5VA 4DK1A 2B2UC 3IRBA 3J81j 4CDDC 5CBEE 5C0XJ 1K8MA 1IBKQ 4QF4A 2KENA 3GTQB 4FF3A 1LT6D 2WAQG 1O7ZA 4JBJA 4HCEA 2EJFC 4A3BB 3A5ZB 5K36H 3S1NH 2K05A 3D6WA 4GN4B 1T5XD 1SLJA 3TP7A 1LT3D 3BVGA 3K0XA 3H0GH 1L2FA 5C3XA 1UE6A 3PIP3 1FJGQ 1KAWA 3W1GA 1I4QA 2KCNA 4ZCKA 1L0YB 4P72A 4ME5A 1O7YA 1QB5D 2PNHA 3DMUA 4X3SA 4NXNQ 2AKWB 1BR9A 3NBHB 2F0WA 5FLMG 1M90C 4DNRB 4ZYSA 4A4IA 4CKBA 3AYHB 2CW0D 2F0NA 3GTPH 2CCZA 1NMGA 4L5SA 1L1OA 1Y1VG 1IBML 1IYUA 2Z1CA 1I3QH 3JC66 2N78A 3OPOA 4P2CB 5FO9B 2KQ3A 5E3FA 1FGUA 2CW0C 1G291 5M9OA 2L1BA 4A93H 1LO5D 2JJQA 5M3FB 1K73C 5ELCA 1VQ4A 2HCCA 4CHTB 4QUFA 5C44G 5LL6X 4DN4M 4DAYA 3T53B 1KIXA 5BR8L 1Z47A 2PNRC 1TWCH 1K3RA 3U50C 3FHWA 2A69D 1QILA 1XWEA 2K1BA 3MTSA 4S3SA 2ICEC 1N32Q 3J80L 1XPOA 3M4OB 3QIAA 4OHJA 1C9OA 1IKLA 3I70A 4YCWA 5DNFA 4JV5Q 3CKIB 3CF5A 1F77A 4XYQA 2A69C 4M1UB 3DUZA 4A3BH 4FF4A 2AHOB 1K28A 3R2IA 1CA6A 1V1PB 2PMZE 5K36G 1FD7D 3ZYYX 1IBKL 5G3LF 5H1SE 2N49A 4C1NI 4LF5Q 4B9XA 1LABA 3H0GG 1ENAA 3L0OA 4XQQA 3J81L 1PFNA 4DNTB 4IFDH 3FPPA 1ZEQX 1PH6A 4O42A 2ATWA 3AB9A 3Q6SA 4ZQ3A 2I07B 2J0TD 2K5QA 3CHBD 3BS1A 1FJGL 5ELOA 1QVFA 5IODA 2KEEA 3J80E 2D5DA 5HURA 1SYFA 4NXNL 2L0CA 4K2KA 3JAMi 3KLWA 3M7GA 3O13A 1F9SA 1L0XB 1U5KA 4OIKA 2NZ1D 4HAEA 4KV6A 2UXDQ 1KQSA 4A93G 4BBSB 2OCEA 1G2TA 3A55A 2R61A 3CQZB 1A62A 2LY7A 4RGMA 3MFGA 5A35A 1XXGA 3EJIA 1LV9A 3QO2A 4FNFA 4IPCA 2OTLA 1EYAA 1X6OA 3C46A 1XTDA 4JYAQ 3HOZH 1E2ZA 3J81E 1VQ8A 1U4RA 2C35B 1BCPD 2VQEL 4C3HH 2BH2A 4B3TQ 4A3DH 2AUJD 3PUYA 1YI2A 2MJ8A 3TP5A 2X6LA 4Q5VA 2UUBQ 2NZHA 1BCPC 1N32L 3D0FA 4JI7Q 4A3BG 1YEZA 2ZXOA 2EYJA 4DR3Q 4JV5L 4R8NA 3VA5A 3X3NA 1KC8C 3PO3B 3E0JA 2UU9L 2EYHA 1ICFB 1HA5A 3GTGB 3NWSA 1M1KC 1LTGD 3R93A 4IFDG 4ILWA 4FXKC 4KHZA 3DWAA 4LF5L 3S2DB 2NTSA 3EROA 2FXQA 2G9HD 2NVTB 3I4NH 1TY0A 1DXMA 3W2DA 3PUZA 1EIFA 1EY5A 1F9PA 1CSPA 1TWGB 4K5XA 4I65A 4KKSA 4NB3A 3F1ZA 2XVSA 1IL8A 1KDCA 2F0GA 2YYZA 5KYIA 5FJ8G 2R93B 5JAVA 4H13C 3I4MH 3BG3A 4K8IA 3GO5A 2UXDL 1EFWA 3A8JE 3HOZG 2WP8J 1CTMA 2K33A 1BBUA 4FYDA 2K5HA 3P20A 2XRQD 5JPMC 3P75A 4C3HG 3I56A 4HJ8A 2EY1A 1EWHA 4A3DG 4JYAL 1LTBD 2JYOA 2Q2IA 4Y7NB 1KABA 1ESFA 1VQHA 4L5RC 2YTYA 3PF5A 2PQAB 4B3TL 1QJOA 3HRZC 1HZ9A 2JQOA 3CCJA 2UUBL 3VYTA 1AZPA 3NTHA 3OWFA 4JI7L 5C0XI 4WJ3M 1LT5D 2KJXA 3GTMB 3VYUA 1PZJD 5GROA 5CV8A 3CCLA 1MD2D 3BZKA 1EY9A 1ZKOA 3M4PA 5CV5A 3ND8A 1R9TB 4NMZA 1F2YA 4JI5Q 2EY5A 1VDZA 3G71A 1EL0A 3FPUB 2GVBA 3EIVA 1HFNA 2R7ZH 4P73A 2R92H 1UEAB 2AMCB 3I4NG 4OX9Q 2CH4W 2F0VA 1STEA 4G57A 1NNXA 2PCFB 3N52A 3IAYA 1KNEA 1YHAA 4EQNA 4JI4Q 3D4DA 4U68A 1WJJA 2A73B 1LM0A 5JEAH 3I4MG 2LS01 1B3QA 1X3PA 3HOWB 2F0TA 4O2DA 3RD4A 4DV4Q 2JSOA 1RKNA 1MI2A 4YWKA 5E7NA 4AYBE 1NUCA 4RCNA 2F0EA 1QUQB 4BBRH 1C0AA 1NBWA 3NTIA 4LFCQ 1X56A 1C7YA 1TWFH 3S1MB 1SE3A 3MXNA 2DNEA 4R4OA 1BKBA 4X65Q 4LF4Q 4IFDI 3PV0A 1X9NA 1Q12A 3KK7A 3S1RB 1MIUA 5ISRA 4HTHA 3RLFA 1K83B 4RGOS 3L3OC 2LMCB 1EYDA 2LXKA 4JCVE 4PMBA 2Z9HA 5KNCA 1B7YB 1EZ6A 4N8FA 1I6HB 3DEOA 1JJCB 2J4XA 4JI3Q 4OGQC 3S16H 1B50A 1Q1EA 1D5MC 3MXPA 1CZWA 3NHHA 5CV9A 3RZDH 1FNVA 2F0JA 1EQRA 2KCCA 1HHVA 1VQAA 1DJRD 1KTKA 2CHBD 4LF7Q 1VQ7A 1YJWA 4YY3Q 1L1OB 2L4NA 4FXGC 2XNAC 3WOEA 3GV6A 4OX9L 2QW7A 4GNXA 5JPNC 4JBWA 4DR7Q 1I4PA 5JEAG 2HDMA 4APVA 3GTKB 1EY4A 4BBRG 4KHVA 5M3MB 4JI4L 2IWHA 4C3JB 2XIWA 4NKLA 3URYA 3MHBA 5IE8A 3GTJB 3D31A 2DGYA 4DV4L 4KD4A 1LTSD 4A3IB 5ELDA 1VQJA 3HOVH 5CYUA 1VF7A 2E75C 2NN6H 4CKCA 1EOVA 3MAQA 2FHTA 4LFCL 3STBD 1QNKA 2OWOA 2Z6KA 5EPLA 4X65L 4ZLTF 4LF4L 4GNXC 4DR6Q 4IUQA 2RDFA 5IT9L 1I6HH 1BUVT 1CQFA 2MFIA 4K6LA 3F8TA 1E2WA 4KK7A 4EQ5A 1ENCA 1KDAA 3STBC 2J7ZA 3I4OA 1SJED 1YIJA 3KLRA 1SNOA 4EGVA 4DV0Q 3RZOB 2F0OA 4DGZA 2EIFA 3TRZA 3TSSA 1Q81C 4HCSA 2E2HH 1WCMH 1JOOA 4JI6Q 1SBBB 5LHY1 4JI3L 1VCIA 5IGFA 1O7IA 5M5YH 5C4XB 2Z6KC 3CCVA 1QG7A 2TMPA 4L63B 4K6DA 2WV6D 1HTPA 1XTCD 4PMCA 2MGSA 2WKCA 5LMNW 3LGJA 1B70B 4KN4C 2OTJA 2VB2X 4B3MQ 1OO9B 1JR0D 4LF7L 3RN5A 4A3CH 2A19A 1T5EA 1ZYRD 5IT9E 4XXEA 2NVQB 1X65A 2AWNA 4LMQD 4EVOA 5KYLA 3OTOQ 3PMFA 4IOCA 1ILQA 4LK1C 1TIID 4DR7L 2XRSD 1ZYRC 3K8AA 3K7AH 3M85A 3KLSX 4ALPA 5JJIA 4HSPA 1TS3A 1LTID 1JJ2A 4MTKA 3TQYA 3R8BA 4Y52H 3HOVG 3JAML 2PI2E 2NN6G 2SNSA 5D3DA 3WOFA 5I2XA 5KNDA 2JA5H 3PGZA 1JWSD 2Q2HA 3QOJA 3S15B 4EX5A 2F0UA 1EY0A 3U4ZA 1XPUA 1V1QA 1EIHA 2F0KA 1EYGA 4DR6L 4P71A 3PUWA 1EQQA 1G2SA 4IUVA 1WCMG 3ULLA 3L2PA 3T51B 2B2VA 1JORA 2BH8A 1NTGA 4C3IB 1K8AC 4JI2Q 3ICEA 4BY1B 5ELNA 1IL2A 4JI6L 4ULLA 1AP0A 1LLRD 1DOKA 2R6GA 4N8X1 2ENBA 2PZWA 4K14A 1J6QA 4KHPQ 3CMAA 5AFWA 2CH4A 4A3CG 1SE2A 1CQVA 1KD1C 4QCLA 4XIGS 2IPKD 4B3ML 2B2VC 4LUZA 1RF2D 2F3IA 4AQYQ 5D65A 5BN5A 4LFBQ 2AQ2B 4NXMQ 1B4OA 4XYOA 2Q8IB 4F88A 2Z8LA 3OTOL 3KBGA 2VNUD 4OL7A 3GTLH 1Q82C 2QF7A 4DUZQ 4IO9A 3NSWA 2I5MX 3A56A 2ZJRA 2F0MA 2JA5G 2JEAI 3S15H 1HNWQ 3D6CA 3H3VH 1WTWA 2K28A 4FXDA 5C4JB 1D1IA 2JN4A 4F7XA 2CKZB 1XJVA 1S72A 1BBXC 3ONAB 4FP5D 1EY7A 1VQIA 1PH3A 4G7OC 2F0QA 4RKLA 1K3BC 4AIMA 4IUTA 5CV7A 1PYBA 4POGA 4C3IH 4AYBG 1STHA 2IT1A 3FEWX 3NEMA 2H4OA 5C4XG 1A2UA 2EJGC 3BDCA 3I7FA 4NP5A 3A8IE 3SHLA 1UWVA 3D4RA 3AEVA 1H9SB 1ZXTA 3SE0A 4OO1I 2VS1A 1B8AA 4JI2L 3H09A 1GUSA 5KNBA 4HJAA 2JA7H 3TZUA 3DM1A 2R7FA 4BY7B 1PYSB 2R3ZA 1U0LA 4KHPL 2N55A 1PRTB 2B8FA 1Z6HA 5FO7B 4MNOA 3Q23A 1VQDA 3S1QB 4A3EH 1CSQA 4RHSA 4AQYL 4LFBL 1CUKA 1EYCA 5ELEA 4WORA 5C6AA 1E24A 4NXML 1SEBD 4OWWB 3HP3A 4QUCA 4RH6A 1JC7A 5C4JH 2E2IB 2EY6A 2VUMB 1VF5C 2NVYB 4DUZL 5EGTA 2KCMA 2PQEA 3KF6A 1W3SA 1S3OA 5JOBA 1HNWL 4KLKA 4YCUA 1HZCA 1X3FA 4KJOA 4NDXA 5HGQA 1HCZA 2AWOA 2CWPA 4JPBW 1N9WA 2JA8H 4F87A 4C3IG 3SVMA 1SFOH 1QWYA 3BJUA 1SE4A 4QY7A 4R1JA 1RCVD 2KA7A 2QILA 1EU4A 2ES2A 3OIPA 1NJIC 1HXYD 2RHQB 3G7LA 2CQOA 1KHIA 4QIWE 1QZHA 2JA7G 4IPDA 4G4KA 1FVIA 2KHSA 4IFDJ 2VQEQ 1OXXK 2RF4A 2MQHA 2E74C 5KIXA 2E2JB 1SN8A 4G7HC 4GNXB 1JE4A 3X3MA 3C2PA 5IOCA 2FMMA 3TN2A 1LTAD 1VQLA 5IYCG 2UXCQ 1GUWA 4A3EG 4JVZA 1STGA 3GTQH 2PZUA 1OXVA 3MZ5A 4YCVA 5CBAE 1AE2A 1X3QA 4IOAA 1Q7YC 2UU9Q 1LYLA 1AZQA 3ITPA 1YVCA 3C3LA 4ZKCB 1PLFA 2VZAA 1S5CD 3FKIB 5IYBG 3S14B 1E7ZA 2OXPA 5HGTA 3AFQA 1VQKA 1TWAB 1XPRA 4RKBA 4DUYQ 4BS9A 2D0OA 3VR3A 2RA4A 1QVGA 2JA8G 1H9MA 2AUKA 2E5LL 4IUNA 1D7QA 4EQPA 2SOBA 4OONA 3K58A 3QG1A 1VQOA 2K52A 1A3UA 3KF8A 2IHEA 1PRTF 5M3FH 4A3FB 3HOXB 2WKDA 5FJ8H 2E2JH 4XTCS 3B6YA 3V96A 3VA7A 3H3VI 2PW7A 3CC4A 2KVMA 1LT4D 3SK5A 2JP1A 4HIKA 1MKHA 3UDFA 3CD6A 3MXUA 4J6HA 1HH2P 4DR4Q 2F0HA 3M4OH 4BA2I 1PA6A 3RMHA 2QEJC 4X66Q 5I9OA 3S17B 1A15A 1V1OA 5GAGC 2HDLA 1HRJA 4LAAA 3I72A 3AMUA 1STBA 3KJOA 4V190 1GM5A 3R2TA 2TSSA 4YHHQ 5COYA 3BYYB 4O0AA 3Q22A 1PH9A 4ABNA 3E0EA 1JB3A 2ZTDA 2NZOA 2UXCL 4TRDA 3FKIH 4GN5A 2NTTA 2P5ZX 3VDYA 2NVXB 1XMOQ 1ESRA 2QDLA 1U4PA 3CCEA 1FR3A 1CA5A 3I8ZA 4QIWB 1D8LA 1KAAA 4GKJQ 4P75A 1U4MA 5J1ZA 3SGIA 1S5DD 4ZUIA 4A3KB 3M9BA 3WDNA 2WFWA 2XGTA 1GO3E 4DUYL 2LFNA 2Q2UA 5FK9C 5FO8B 3Q0AA 5GQOA 4HIDA 4L6TB 4POFA 1PTOB 5I4DA 3MA2B 4A3FH 5C4HA 4BBSH 1ML0D 1KLUD 5GAEC 5M3FG 3CQZH 2WB1E 4HEDA 2UUCQ 1YITA 2EYFA 1AE3A 4CJ2C 1F2MA 1NAPA 5C3EB 1R4PB 4XDXA 1XYIA 3CCRA 1VQMA 3I4LA 4DV5Q 1JWUD 3H3VC 3K59A 2EY2A 1F9QA 4BWGB 2XWBB 2WINB 4J15A 3H6MA 2F1MA 1QE6A 2ID0A 4DR4L 4C2MB 4WFN3 3J80c 2F0IA 4X66L 3HKZE 1NMFA 3DWQA 1I4HA 3PO3H 2NVXH 3FKIG 5JEAJ 4DFAA 4QMGA 3GTGH 4YHHL 1B53A 3N6RA 3G48A 2Q8RE 1GD7A 4GLXA 2HHHQ 3E3XA 3S2DH 2KUMA 4I7ZC 4DR2Q 1PXUA 1B44D 4JI8Q 4QJFA 1XMOL 2VL6A 1GVPA 1YHQA 2NVTH 4KKTA 4RA8A 1E2VA 3J81c 1HUNA 2EYMA 1FNUA 2XN9C 3NK9A 3PO2B 4KI0A 1PTOH 4X3UA 5FLXL 4UP8A 1TWGH 5IWAQ 1DYQA 3UDXA 4GKJL 1A0IA 4A3FG 1YNND 1K0RA 4HJ5A 4JBKA 4BBSG 1UE5A 3KOJA 4A3MB 2R93H 1H95A 3J7ZC 1Q8KA 4X3TA 4DV7Q 3HZXA 1YNNC 2XTIA 5I2YA 1D6EC 4IUPA 2UUCL 3EQLC 1HPCA 2A5HA 4A3LG 3VR6A 5G3LD 1ASZA 2JA6B 2HIVA 2EE1A 2EPBA 1TS2A 4K2LA 4Y7NH 2OT2A 4DV5L 3FDTA 5I9PA 1HZBA 2YTXA 5L37A 1EY8A 5FLXE 1CKOA 4WJWA 3CU7A 4L8JA 4HSVA 3PO3G 4QGUA 2KECA 5J39A 2LKVA 3PSIA 4L5QA 3PUVA 1IYJB 3PF4A 1JICA 3GTMH 4ZKBB 4UY8C 1WI5A 2WB1B 1HQMC 1PTOF 1R9TH 1K8OA 2LXJA 3HOUB 3SDZA 2HHHL 3A7AB 3CAMA 1MSGA 1T9HA 3KYHC 2OQ0A 1D5ZC 2ZTCA 4DR2L 3OHXC 2QDBA 4JI8L 1M8AA 1TKWB 2RSNA 3TS0A 4MIUA 3T16A 1SMYD 2MPMA 2EYOA 4DR5Q 3EA6A 1NR2A 3CCSA 1SNDA 2B63B 2R93G 1HNXQ 4PG3A 2K50A 5IWAL 3K81C 5EBCA 1SR3A 2H1EA 3HKZB 3OW7A 4DXGA 3HOWH 1SMYC 2L12A 1LUZA 3C1EA 2YU9B 4CDCC 3I2ZA 4OXPA 1VQ5A 1PVOA 3S1MH 1SYCA 4DV7L 4FVMA 2G5DA 5IIFA 3K80C 5EPKA 4DAYB 3M4QA 1Q8IA 1DONA 2FJ2A 1SYEA 4IPGA 1BOSA 5DM73 3S1RH 5CV6A 3NP8A 2B8GA 3ERSX 5JJZA 4MTNA 3TS2A 1WTQA 1FGBD 1K83H 3GTOB 1II3A 3DM3A 4XQNA 2NWGA 4H02A 1YJ9A 1TXYA 4LUOA 4WRDA 1WTPA 4R4IA 1B1ZA 1CKNA 1DOMA 1H9KA 4B3SQ 1GKHA 1JB7A 3HOUH 3ND9A 1VQ6A 4JC0A 3P1HA 3I55A 1U9RA 1QVCA 4OEMB 1YJNA 1I4RA 3EFXD 4FF2A 3GDEA 1GXDC 1Y1WB 3SR1A 4MHEA 3J7AV 1VMCA 1UEBA 3OWEB 1Y14B 1VS0A 3AQQA 3I73A 2Z4IA 3J7AF 3I91A 1I50B 3ULJA 1ILPA 1C48A 1N36L 2YU9H 3GTKH 2O5JC 3HOWG 4PV1C 1BCPB 1ENFA 2CVRA 2ZXPA 4DR5L 1SDFA 3QOLA 4JK1C 5M3MH 4C3JH 1GOZA 1HNXL 1EUJA 4PZ8A 1FL0A 3S2HB 5ELFA 4IN3A 2ZJQA 3GTJH 1I4GA 1SYDA 4A3IH 1PZID 1Y8NB 4Z9CB 1D2BA 1SSOA 2YTVA 3CW2C 1PV4A 2K03A 5D14A 4XT1B 3T13A 1J5EQ 4OIJA 4IUUA 2PZTA 1A6XA 2KOLA 2NBFA 4DAPA 3OMGA 1RHPA 1SYBA 2WB1G 3RZOH 3UDIA 1GUTA 1FYCA 2RDHA 4JI0Q 4DAVA 1PH4A 2IX0A 2PO4A 2C5CA 3HOUG 4LF8Q 4DA2A 3F2CA 2HD3A 4RAUC
chains in the Genus database with same CATH topology
1XX8A 2M00A 3K6OA 5EKLA 5E4WC 2F3WA 1Z7TA 2D9UA 4C56C 1F9RA 1PFBA 5IGBA 1EY6A 1O7LA 1TWHB 2SNMA 2CQAA 3PUXA 4RGNA 1IYVA 1JCKB 1EWCA 1WTOA 4PQXA 3NTKA 5M5XB 1B3AA 4C3JG 3NE5B 2RBMA 1Y1VB 2VB3X 3MVVA 2G9DA 4M8AA 1SJHD 1HUMA 1YNJD 1EFID 1MSHA 1STAA 5JVH3 2IX1A 5C44B 1YNJC 2K01A 3TP6A 1Y8OB 4B9WA 1GHKA 3L7ZC 2EZVA 2SEBD 3LWEA 4N9PA 4KMUC 1WD1A 2KEDA 1WTXA 3TMEA 3G6JB 2K5WA 3SEBA 1RD9D 1BCPF 5K5PA 3GV3A 3IKJA 1DCZA 3S1NB 1Q1BA 1JWMD 3QJYA 4KY6A 5KEEA 3H0GB 4MN3A 2NN6I 1I4XA 3NWTA 1SNQA 4FF1A 5CC4A 4UDUC 1O80A 2ICIA 5C4ZA 3GTPB 2F0FA 1MBYA 4CJ0B 1I6VC 3K0YA 1KNAA 1HQRD 1I3QB 2QKIC 2BCOA 2AQ3B 1C8CA 1PDQA 4ODGA 1CI3M 2O4XA 3VYSA 5A2QL 2O5IC 4KJNA 2X6GA 1GUOA 3LX0A 1EEFD 2B2YA 1TWCB 1BDOA 1A3TA 1AEXA 1E0BA 1MGSA 1TR5A 1TT2A 2Q8TA 5DEHA 2L9HA 2GA4B 1PMRA 5EBDA 1HFGA 1Y69U 3ERQA 4U673 3BZDB 3BVZA 2B2YC 3BVMA 4N9TA 5A2QE 4PMWA 3NUCA 4E6IA 5FKAC 1F2LA 2O2LD 2ZT9C 4C1NK 1G6ZA 3SK4A 3D3RA 4TSSA 1S5ED 2K7VA 4TQUS 5ELBA 5C0XH 5TSSA 3A7LA 3MWYW 4K8JA 4IZ8A 3HEJA 2VXWA 5C5MA 5C5LA 3CRKC 4NW2A 3HGBA 2L11A 1EQVA 1NCVA 4DF7A 3HOZB 4CKEA 2MUYA 4HMJA 1SAPA 4C3HB 3K5MA 4RWSC 4A3DB 2F0LA 4X3KA 1RJTA 2EDGA 3NPPA 3TZDA 3NQIA 1C4QA 2A6ED 1V8QA 1Q3LA 3P7JA 1OXTA 2A6EC 4R9WA 4CGYB 4RGTA 4KD3A 3OSOA 2HUGA 3VR2A 2B2WA 3H94A 1EOTA 2FFKB 4EQOA 1ONLA 3TP8A 3M4YA 4HR7B 5C0XG 3I4NB 2EJMA 1CK1A 1OXSC 2JE6I 1BXTA 3LNNA 2V4DA 3IL8A 1ET9A 4HMIA 1BO0A 2E76C 3KLSA 1GUGA 3I4MB 2RKSA 3HOYB 3FMCA 1DOLA 5DAUA 5I6WA 5KRUA 1CHPD 3MEHA 1CHQD 5FOBB 5EQ0A 4J8QA 4XT3B 4IALA 2B2WC 1IHZA 1B9MA 2F0DA 1Y8PB 2BOSA 2ZXRA 2HQEA 2F3VA 1D1KA 3K5NA 4KY5A 2AQ1B 2BA1A 3K5OA 5T1IA 5DM63 4IURA 5EJWA 2EYLA 2D62A 1TS4A 1EIGA 2XSCA 1GJXA 3GQBA 4A3JB 2C9OA 2HCIA 3K57A 5BN4A 3NBIA 4CBVA 1PZKD 2IL8A 3D4WA 2IX3A 1JOQA 2R7ZB 2R92B 1G8ZD 2A6HD 2F0SA 1KDBA 4ID6A 1LTTD 3E6ZX 3GP7A 2WIIB 1NSNS 3MC0B 2A6HC 2PMZB 1F2ZA 3NQTA 2K32A 2RVLA 4A3GB 4BBRB 2EYPA 2JEBI 1TWFB 1ET6A 2K04A 4FO2A 3I90A 1S4ZA 1RTOA 1SXTA 3NXWA 2A74C 1AN8A 4YIJA 2OEOA 1J9OA 1WTVA 4HN7A 2PW5A 2EXZA 1NR4A 3CRLC 1VMPA 2JXMB 1M4VA 3K5LA 4ZAIA 2IJ0A 1X32A 3S16B 2PYKA 1W6KA 1GUNA 3RZDB 2EOTA 1H9SA 4LJZC 1JQYD 4R8IA 1RTNA 5CR3A 2BA0A 1D5XC 3AU7A 1AFPA 2E2DC 3IFTA 3F2UA 1QOHA 1EEID 1TY2A 1FNWA 4F8MA 3DXJC 5T1GA 3OIQA 1LACA 3SXHA 4BA1I 5LL6S 2WACA 2F0PA 5CORA 3VR4A 2RDGA 4PNYA 1PRTD 3L9AX 3DEPA 3T56B 3U9SA 3HOVB 3GD7A 1BQQT 1PRTC 1G91A 3H91A 3T4AC 4XQJA 3M3YB 3NBHA 2F4IA 5NUCA 3A8KE 3IFDA 4H7BA 1H9JA 3U9OA 2E2HB 1WCMB 3KBXA 4DXFA 2OF1A 2BE5D 5IGCA 1ICWA 2K6AA 5M5YB 2DY8A 4KKUA 3SK6A 1CT1D 1KLGD 1SNMA 1V43A 2BE5C 4UAIA 1U4LA 2MP1A 3V05A 4G7ZC 3RUZA 4QB4A 3J7YW 4CJ1B 3HG9A 5CV4A 2I46A 5BN3A 2QCPX 2XWJB 3BDLA 3BYTB 3R3OA 4OO1H 3K7AB 5EKKA 2Y0SB 2NYZD 5D3IB 3TDQA 1UUPA 4DK0A 1V1PA 1CM9A 2PPBC 1B9NA 2RQXA 4KY7A 1SYGA 4Q0FA 2JA5B 1HTLD 1S5FD 4H44C 5C3WA 3C1FA 3SK8A 3VYRA 5EPJA 2NB0A 5IGEA 2B39A 3D8GA 5IGGA 1TS5A 2M2LA 1AW7A 2FMCA 4J1MA 1TVXA 4AYBB 2DNCA 5J22A 3BDOA 2DY7A 2IW3A 3TBIB 1BNZA 1STYA 4ZUJA 1IKMA 1SNCA 1J8IA 1H9RA 2EVBA 1JOKA 3PIO3 5IGDA 5F2DA 1DZ1A 3DHQA 4KN7C 4ZRZA 3S9WA 3QWNA 2K5DA 3A54A 3KUPA 1R4QB 1DD2A 3DWPA 4OO1G 2FINB 3GTLB 1B2TA 4IQZA 2SDFA 1RDPD 5CMDA 1RODA 2WAQB 1PYWD 4ZK9B 3FRPB 1S5BD 3OOCA 1DM0B 4RFBA 5M5WB 1BF4A 1OXUA 1EU3A 2X69A 3LWUA 4H0LC 1A2TA 1TU2B 1PFMA 4RHRA 2M9VA 4KTAA 2L55A 3MXGA 3EVQA 3JAME 4TKOB 4DU9A 1EZ8A 1PTOD 5EKIA 1WTRA 5CGKA 2A68D 2JA7B 1WVLA 2DN8A 1STNA 2B2TA 4B08A 1PTOC 3I3CA 2A68C 5I6YA 1HA6A 2NUCA 2F03A 4GZYC 2BDOA 1TQOA 2D2CC 5E4XA 1A3VA 3QB3A 4A3EB 2MHVA 2RSOA 4K5WA 1UNSA 1W6JA 1O78A 1CZGA 4V0BA 2Z4HA 3MFYA 1IW7D 4O1NA 2B2TC 2BDNA 3UI2A 1IW7C 1UAPA 5KGUA 2N88A 4RCOA 3E5SA 2JA8B 3OMCA 1SFOB 1Q90A 3W3AA 3M7NA 2B2UA 3V2TA 5JVG3 3FVQA 5E1FA 1SNPA 3VR5A 1WD0A 3HS0C 4A93B 1GHJA 1CFMA 1QCBD 1LTRD 1QNUA 3Q24A 1EQTA 2L5TA 4K5VA 4DK1A 2B2UC 5CBEE 5C0XJ 1K8MA 4QF4A 3GTQB 4FF3A 1LT6D 1O7ZA 4HCEA 2EJFC 4A3BB 5K36H 2K05A 3D6WA 1T5XD 3TP7A 1LT3D 3BVGA 5C3XA 3PIP3 1I4QA 2KCNA 1L0YB 4ME5A 1O7YA 1QB5D 3DMUA 4X3SA 1BR9A 2F0WA 4DNRB 4ZYSA 4CKBA 2CW0D 2F0NA 1IYUA 2Z1CA 3OPOA 4P2CB 5FO9B 2KQ3A 5E3FA 2CW0C 1G291 5M9OA 2L1BA 1LO5D 5M3FB 5ELCA 2HCCA 4CHTB 4QUFA 5LL6X 4DN4M 4DAYA 3T53B 1Z47A 2PNRC 2A69D 1QILA 1XWEA 2K1BA 3MTSA 4S3SA 2ICEC 3J80L 3M4OB 3QIAA 4OHJA 1IKLA 3I70A 5DNFA 3CKIB 1F77A 4XYQA 2A69C 4M1UB 3DUZA 4FF4A 3R2IA 1CA6A 1V1PB 5K36G 1FD7D 3ZYYX 5G3LF 4C1NI 4B9XA 1LABA 1ENAA 4XQQA 3J81L 1PFNA 4DNTB 4IFDH 3FPPA 1ZEQX 4O42A 3AB9A 3Q6SA 4ZQ3A 2I07B 2J0TD 2K5QA 3CHBD 3BS1A 5IODA 2KEEA 3J80E 2D5DA 5HURA 1SYFA 2L0CA 4K2KA 3M7GA 3O13A 1F9SA 1L0XB 4OIKA 2NZ1D 4HAEA 4KV6A 4BBSB 1G2TA 3A55A 2R61A 3CQZB 4RGMA 2LY7A 3MFGA 5A35A 1XXGA 3EJIA 1LV9A 3QO2A 4FNFA 1EYAA 3C46A 1E2ZA 3J81E 1U4RA 1BCPD 2AUJD 3PUYA 2MJ8A 3TP5A 2X6LA 4Q5VA 1BCPC 2ZXOA 2EYJA 4R8NA 3VA5A 3X3NA 3PO3B 3E0JA 2EYHA 1HA5A 3GTGB 3NWSA 1LTGD 3R93A 4IFDG 4ILWA 4FXKC 4KHZA 3DWAA 3S2DB 2NTSA 3EROA 2G9HD 2NVTB 1TY0A 1DXMA 3W2DA 3PUZA 1F9PA 1EY5A 1TWGB 4K5XA 4I65A 4KKSA 2XVSA 1IL8A 1KDCA 2F0GA 2YYZA 5KYIA 2R93B 5JAVA 4H13C 3BG3A 4K8IA 3GO5A 3A8JE 2WP8J 1CTMA 2K33A 4FYDA 3P20A 2XRQD 5JPMC 3P75A 4C3HG 2EY1A 1EWHA 1LTBD 2JYOA 4Y7NB 1KABA 1ESFA 1QJOA 3HRZC 3VYTA 1AZPA 3NTHA 3OWFA 5C0XI 1LT5D 2KJXA 3GTMB 3VYUA 1PZJD 5CV8A 1MD2D 1EY9A 1ZKOA 5CV5A 3ND8A 1R9TB 4NMZA 1F2YA 2EY5A 1VDZA 1EL0A 3FPUB 1HFNA 1UEAB 2F0VA 1STEA 4G57A 2PCFB 3N52A 3IAYA 4EQNA 1KNEA 3D4DA 4U68A 2A73B 5JEAH 2LS01 1X3PA 3HOWB 2F0TA 3RD4A 2JSOA 1RKNA 1MI2A 1NUCA 4RCNA 2F0EA 3NTIA 3S1MB 1SE3A 3MXNA 2DNEA 4IFDI 3PV0A 1Q12A 3KK7A 3S1RB 5ISRA 4HTHA 3RLFA 1K83B 4RGOS 3L3OC 2LMCB 1EYDA 4PMBA 5KNCA 1EZ6A 1I6HB 3DEOA 2J4XA 4OGQC 1B50A 1Q1EA 1D5MC 3MXPA 1CZWA 3NHHA 5CV9A 1FNVA 2F0JA 2KCCA 1HHVA 1DJRD 1KTKA 2CHBD 2L4NA 4FXGC 2XNAC 3WOEA 3GV6A 5JPNC 4JBWA 1I4PA 5JEAG 2HDMA 3GTKB 1EY4A 4KHVA 5M3MB 2IWHA 4C3JB 2XIWA 4NKLA 3URYA 3MHBA 3GTJB 3D31A 4KD4A 1LTSD 4A3IB 5ELDA 5CYUA 1VF7A 2E75C 2NN6H 4CKCA 3MAQA 2FHTA 1QNKA 5EPLA 4ZLTF 4IUQA 2RDFA 5IT9L 1BUVT 1CQFA 4K6LA 4KK7A 1E2WA 1ENCA 1KDAA 2J7ZA 1SJED 3KLRA 1SNOA 4EGVA 3RZOB 2F0OA 4DGZA 3TSSA 4HCSA 1JOOA 1SBBB 5LHY1 1VCIA 5IGFA 5C4XB 1QG7A 2TMPA 4L63B 4K6DA 2WV6D 1HTPA 1XTCD 4PMCA 2MGSA 2WKCA 4KN4C 2VB2X 1OO9B 1JR0D 1T5EA 1ZYRD 5IT9E 4XXEA 2NVQB 4LMQD 2AWNA 4EVOA 5KYLA 3PMFA 1ILQA 4LK1C 1TIID 2XRSD 1ZYRC 3M85A 3KLSX 4HSPA 1TS3A 1LTID 3R8BA 3JAML 2NN6G 2SNSA 5D3DA 3WOFA 5I2XA 5KNDA 1JWSD 3QOJA 3S15B 2F0UA 1EY0A 1EIHA 2F0KA 3PUWA 1G2SA 4IUVA 3T51B 2B2VA 1JORA 4C3IB 4BY1B 4ULLA 1AP0A 1LLRD 1DOKA 2R6GA 2ENBA 2PZWA 4K14A 5AFWA 1SE2A 1CQVA 4QCLA 4XIGS 2IPKD 2B2VC 1RF2D 5BN5A 5D65A 2AQ2B 1B4OA 4XYOA 2Q8IB 4F88A 2Z8LA 3KBGA 2VNUD 4OL7A 2QF7A 3NSWA 3A56A 2F0MA 2JEAI 3D6CA 1WTWA 2K28A 4FXDA 5C4JB 1D1IA 4F7XA 1BBXC 1EY7A 3ONAB 4FP5D 4G7OC 2F0QA 4RKLA 4IUTA 5CV7A 1STHA 2IT1A 3FEWX 2H4OA 1A2UA 2EJGC 3BDCA 4NP5A 3A8IE 3SHLA 3D4RA 1H9SB 1ZXTA 3SE0A 4OO1I 3H09A 1GUSA 5KNBA 3TZUA 3DM1A 4BY7B 2R3ZA 2N55A 1PRTB 2B8FA 1Z6HA 5FO7B 3Q23A 3S1QB 4RHSA 1EYCA 5ELEA 4WORA 5C6AA 1SEBD 3HP3A 4QUCA 4RH6A 1JC7A 2E2IB 2EY6A 2VUMB 1VF5C 2NVYB 5EGTA 2PQEA 5JOBA 4KJOA 4NDXA 1HCZA 2AWOA 4F87A 4C3IG 3SVMA 1QWYA 1SE4A 1RCVD 2KA7A 2QILA 1EU4A 3OIPA 1HXYD 3G7LA 4G4KA 2KHSA 4IFDJ 1OXXK 2E74C 5KIXA 2E2JB 4G7HC 1JE4A 3X3MA 3C2PA 5IOCA 2FMMA 3TN2A 1LTAD 1GUWA 1STGA 2PZUA 1OXVA 3MZ5A 5CBAE 1X3QA 1AZQA 3ITPA 3C3LA 4ZKCB 1PLFA 1S5CD 3FKIB 3S14B 2OXPA 5HGTA 1TWAB 4RKBA 4BS9A 3VR3A 2RA4A 1H9MA 2AUKA 4IUNA 4EQPA 2SOBA 3K58A 3QG1A 1A3UA 3KF8A 1PRTF 4A3FB 3HOXB 2WKDA 4XTCS 3V96A 3VA7A 2PW7A 2KVMA 1LT4D 3SK5A 2JP1A 3MXUA 4J6HA 2F0HA 4BA2I 3RMHA 2QEJC 5I9OA 3S17B 1A15A 1V1OA 2HDLA 1HRJA 4LAAA 3I72A 3AMUA 1STBA 4V190 3R2TA 2TSSA 5COYA 3BYYB 3Q22A 4ABNA 1JB3A 4TRDA 2NTTA 2NVXB 1ESRA 1U4PA 1FR3A 1CA5A 3I8ZA 4QIWB 1KAAA 1U4MA 5J1ZA 1S5DD 4ZUIA 4A3KB 3WDNA 2LFNA 5FK9C 5FO8B 3Q0AA 4L6TB 1PTOB 5I4DA 3MA2B 5C4HA 1ML0D 1KLUD 4HEDA 2EYFA 4CJ2C 1F2MA 1NAPA 5C3EB 1R4PB 4XDXA 1XYIA 3I4LA 1JWUD 3H3VC 3K59A 2EY2A 1F9QA 4BWGB 2XWBB 2WINB 3H6MA 2F1MA 1QE6A 2ID0A 4C2MB 4WFN3 2F0IA 3DWQA 1I4HA 5JEAJ 4DFAA 4QMGA 1B53A 3N6RA 2Q8RE 2KUMA 4I7ZC 1PXUA 1B44D 4KKTA 4RA8A 1E2VA 1HUNA 2EYMA 1FNUA 2XN9C 3NK9A 3PO2B 4KI0A 1PTOH 4X3UA 5FLXL 1DYQA 1YNND 4A3MB 4X3TA 3HZXA 1YNNC 5I2YA 1D6EC 4IUPA 3EQLC 1HPCA 2A5HA 3VR6A 5G3LD 2JA6B 2EE1A 2EPBA 1TS2A 4K2LA 2OT2A 3FDTA 5I9PA 1EY8A 5FLXE 4WJWA 3CU7A 4L8JA 4HSVA 2KECA 5J39A 2LKVA 3PUVA 1JICA 4ZKBB 2WB1B 1HQMC 1PTOF 1K8OA 3HOUB 3SDZA 3A7AB 1MSGA 1D5ZC 3OHXC 2QDBA 1M8AA 1TKWB 2RSNA 4MIUA 3T16A 1SMYD 2MPMA 2EYOA 3EA6A 1NR2A 1SNDA 2B63B 5EBCA 2H1EA 3HKZB 3OW7A 4DXGA 1SMYC 2L12A 3C1EA 2YU9B 1SYCA 4FVMA 5IIFA 5EPKA 1Q8IA 1DONA 2FJ2A 1SYEA 1BOSA 5DM73 5CV6A 3NP8A 2B8GA 5JJZA 1WTQA 1FGBD 3GTOB 1II3A 4XQNA 2NWGA 4WRDA 1WTPA 1B1ZA 1DOMA 1H9KA 3ND9A 3P1HA 1U9RA 1I4RA 3EFXD 4FF2A 1GXDC 1Y1WB 3SR1A 4MHEA 3J7AV 1VMCA 3OWEB 3I73A 2Z4IA 3J7AF 3I91A 1I50B 1ILPA 1C48A 2O5JC 4PV1C 1BCPB 1ENFA 2CVRA 2ZXPA 1SDFA 3QOLA 4JK1C 1GOZA 3S2HB 5ELFA 4IN3A 1I4GA 1SYDA 1PZID 1Y8NB 4Z9CB 1D2BA 1SSOA 2K03A 5D14A 4XT1B 3T13A 4OIJA 4IUUA 2PZTA 1A6XA 2KOLA 2NBFA 4DAPA 3OMGA 1RHPA 1SYBA 1GUTA 1FYCA 2RDHA 4DAVA 2IX0A 2PO4A 2C5CA 4DA2A 4RAUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNO A;  4J6H A;  4KJO A;  2F0S A;  4NDX A;  5IIF A;  2F0H A;  2M00 A;  1JOK A;  2F0O A;  4DGZ A;  5IGD A;  2F0T A;  5EKL A;  5F2D A;  1KDB A;  4ID6 A;  1RKN A;  1SYE A;  3DHQ A;  1NUC A;  5I9O A;  2F0E A;  2EYM A;  3S9W A;  1JOO A;  3NK9 A;  4ODG A;  2F3W A;  3NP8 A;  5CV6 A;  1NSN S;  4LAA A;  1STB A;  2O4X A;  4OL7 A;  4S3S A;  1F2Z A;  3NQT A;  5NUC A;  1EY6 A;  5IGB A;  5IGF A;  5KGU A;  1II3 A;  4KJN A;  3ERO A;  2SNM A;  4H7B A;  3E5S A;  3U9O A;  3OMC A;  3LX0 A;  4WRD A;  2F0M A;  2EYP A;  4TRD A;  4K6D A;  1A3T A;  1AEX A;  4PMC A;  2OF1 A;  4KD3 A;  5ISR A;  4HTH A;  3D6C A;  3HZX A;  3OSO A;  5IGC A;  1EY5 A;  1TR5 A;  1TT2 A;  4K5X A;  4I65 A;  3V2T A;  5DEH A;  2KHS A;  4F7X A;  5E1F A;  1EYD A;  4PMB A;  3SK6 A;  2RBM A;  1KDC A;  1SNP A;  2F0G A;  3P1H A;  5KIX A;  5KYI A;  1EY7 A;  4EQO A;  1U9R A;  2F0Q A;  4RKL A;  1EZ6 A;  3TP8 A;  1SNM A;  3NXW A;  4EVO A;  5CV7 A;  4B9X A;  5JAV A;  5KYL A;  3MVV A;  3PMF A;  4YIJ A;  5IOC A;  4K8I A;  1KAA A;  1ENA A;  3SR1 A;  5J1Z A;  2OEO A;  3RUZ A;  4ZUI A;  2PW5 A;  3ERQ A;  4K2L A;  4QB4 A;  4HMI A;  1STH A;  2EXZ A;  3MXP A;  3NHH A;  5CV9 A;  5I9P A;  1STA A;  2F0J A;  4ZQ3 A;  1STG A;  1A2U A;  2PZU A;  3MZ5 A;  5CV4 A;  1EY8 A;  3P75 A;  3BDC A;  2RKS A;  4NP5 A;  2EY1 A;  5C4H A;  4K5V A;  4N9T A;  3SHL A;  5DAU A;  5IOD A;  5I6W A;  2SNS A;  5KRU A;  1A2T A;  3MEH A;  3BDL A;  5HUR A;  5J39 A;  1SYF A;  2LKV A;  3ITP A;  3NUC A;  4KTA A;  4K2K A;  2PYK A;  1KAB A;  3R3O A;  3TP6 A;  5M9O A;  4B9W A;  4QF4 A;  5EKK A;  4IAL A;  3VA5 A;  4E6I A;  2EYF A;  1F2M A;  3EVQ A;  1IHZ A;  2F0D A;  4N9P A;  5CR3 A;  3QOJ A;  3QOL A;  2F0U A;  1EY0 A;  4KV6 A;  3SK4 A;  3TME A;  2HQE A;  2OXP A;  5HGT A;  4DU9 A;  4KY7 A;  1SYG A;  2F0K A;  2F3V A;  3OWF A;  1EZ8 A;  4RKB A;  3TP7 A;  1SYD A;  2EY2 A;  3EJI A;  5C3X A;  5C3W A;  5CV8 A;  3C1F A;  4K8J A;  4KY5 A;  1EY4 A;  1EYA A;  5CGK A;  3D4D A;  3H6M A;  3SK8 A;  4KHV A;  5K5P A;  4IZ8 A;  1EY9 A;  3HEJ A;  5C5M A;  4ME5 A;  5CV5 A;  5C5L A;  1STN A;  4F8M A;  5IGE A;  1JOR A;  3DMU A;  4IUN A;  2QDB A;  3MHB A;  4NKL A;  4NMZ A;  3T13 A;  2EYL A;  1F2Y A;  4EQP A;  2F0W A;  2EY5 A;  2SOB A;  3D8G A;  5IGG A;  1EYC A;  4KD4 A;  4MIU A;  4KY6 A;  2F0I A;  3T16 A;  2PZT A;  4WOR A;  5C6A A;  5I6Y A;  5KEE A;  2EYO A;  2F0N A;  1SND A;  1EQV A;  3SXH A;  2NUC A;  3OMG A;  1SNQ A;  4J1M A;  1A3U A;  3TP5 A;  4DFA A;  1SYB A;  1TQO A;  4QMG A;  2EY6 A;  2WAC A;  2F0P A;  4DF7 A;  5J22 A;  1A3V A;  3QB3 A;  2F0V A;  5CC4 A;  2ENB A;  2PZW A;  4PNY A;  4G57 A;  4K14 A;  5EGT A;  2EYJ A;  4K5W A;  5C4Z A;  2KQ3 A;  2RDF A;  4HMJ A;  2PQE A;  3C1E A;  5E3F A;  4R8N A;  1STY A;  2F0L A;  4ZUJ A;  3D4W A;  2F0F A;  2PW7 A;  1ENC A;  1KDA A;  5JOB A;  4EQN A;  1JOQ A;  3SK5 A;  1SYC A;  1SNC A;  2EYH A; 
#chains in the Genus database with same CATH topology
 1XX8 A;  2M00 A;  3K6O A;  4B3S L;  3A74 A;  4JI1 Q;  5C4X H;  5EKL A;  2LSS A;  5IP9 H;  3BZC A;  4AH6 A;  5E4W C;  2F3W A;  1Z7T A;  2D9U A;  4C56 C;  1F9R A;  1PFB A;  5IGB A;  1EY6 A;  1O7L A;  1TWH B;  4MZ9 A;  2SNM A;  2CQA A;  3HKZ G;  4FDB A;  3PUX A;  4RGN A;  1IYV A;  1JCK B;  2NVQ H;  1NY4 A;  5DLQ E;  1EWC A;  1WTO A;  5GAH C;  4PQX A;  3NTK A;  5M5X B;  4DK6 C;  5M3M G;  1B3A A;  4C3J G;  3NE5 B;  1WOC A;  2RBM A;  2Z0S A;  3T1H Q;  1Y1V B;  2VB3 X;  3MVV A;  3CC7 A;  4A3I G;  2G9D A;  4M8A A;  2ZM6 Q;  1SJH D;  4X6A H;  4RMF A;  4HJ9 A;  1HUM A;  1UE7 A;  2N3S A;  4CDE C;  1YNJ D;  1EFI D;  1JMC A;  1MSH A;  1STA A;  3HFZ B;  2I5L X;  5JVH 3;  2IX1 A;  2HT1 A;  1VQ9 A;  4LF9 Q;  5C44 B;  1YNJ C;  2K01 A;  2KCT A;  1J5E L;  1PH8 A;  3TP6 A;  4IJL A;  1Y8O B;  4B9W A;  1GHK A;  3L7Z C;  2EZV A;  2SEB D;  3LWE A;  4N9P A;  4KMU C;  5IT9 c;  1WD1 A;  2KED A;  1WTX A;  3TME A;  2N8N A;  4B3R Q;  2D0P A;  4JI0 L;  1LTL A;  3TEH B;  4UPA A;  5IP9 G;  3G6J B;  4UHV A;  3UDG A;  4BY1 H;  2K5W A;  4LF8 L;  3SEB A;  1I94 Q;  1RD9 D;  3NEL A;  1BCP F;  5K5P A;  1TWH H;  2F52 A;  3GV3 A;  3IKJ A;  1DCZ A;  3S1N B;  1Q1B A;  4JI1 L;  1JWM D;  3QJY A;  4KY6 A;  3OYY A;  1S40 A;  4LUV A;  3H0G B;  4MN3 A;  5KEE A;  1N34 Q;  1PH2 A;  1W2B A;  2NN6 I;  1I4X A;  3NWT A;  1SNQ A;  1K0S A;  4FF1 A;  3KDF A;  5CC4 A;  4UDU C;  1O80 A;  2ICI A;  2I5H A;  5C4Z A;  3GTP B;  2F0F A;  1YNX A;  3CC2 A;  1MBY A;  4PZ7 A;  3PCO B;  4CJ0 B;  1I6V C;  5IYC H;  3K0Y A;  1KNA A;  1HQR D;  1I3Q B;  2QGQ A;  2ASB A;  5J3B A;  2QKI C;  2BCO A;  2AQ3 B;  1C8C A;  3T1H L;  1PDQ A;  3MXN B;  4ODG A;  3RN2 A;  1CI3 M;  3NEN A;  2O4X A;  2ZM6 L;  3VYS A;  5A2Q L;  2O5I C;  2EQS A;  4KJN A;  1Q86 C;  4HIO A;  2E8G A;  2X6G A;  3JAM c;  1GUO A;  3LX0 A;  1RIP A;  1EEF D;  2B2Y A;  1TWC B;  1BDO A;  4DPG A;  1A3T A;  1AEX A;  5IYB H;  1N33 L;  1E0B A;  3CME A;  1MGS A;  4LF9 L;  4DR1 Q;  1TR5 A;  1TT2 A;  2E5L Q;  5HY6 A;  2Q8T A;  1X54 A;  5DEH A;  2L9H A;  2GA4 B;  3CXC A;  3KJP A;  4R4C A;  1PMR A;  3HKS A;  5EBD A;  1HFG A;  4BY1 G;  1Y69 U;  3ERQ A;  4B3R L;  4DNI A;  1E1T A;  1XMQ Q;  4U67 3;  3BZD B;  4L5T A;  3BVZ A;  2B2Y C;  3OW2 A;  2ZJP A;  3BVM A;  1I94 L;  4N9T A;  5A2Q E;  4PMW A;  4BY7 H;  3NUC A;  4E6I A;  5FKA C;  1F2L A;  2O2L D;  1N34 L;  1I5F A;  2ZT9 C;  4C1N K;  1G6Z A;  3SK4 A;  3D3R A;  4DK3 C;  4TSS A;  3TRE A;  1N8R C;  3S1Q H;  1S5E D;  2K7V A;  2MO1 A;  4TQU S;  5ELB A;  5C0X H;  5TSS A;  3A7L A;  3MWY W;  2IHF A;  1A63 A;  1YBY A;  4K8J A;  3PIO A;  1PHJ A;  2DJF C;  1VQF A;  4IZ8 A;  3MEF A;  3HEJ A;  2VXW A;  5C5M A;  5C5L A;  1SMX A;  2E2I H;  1VQN A;  2VUM H;  2NVY H;  4LW1 A;  3CRK C;  4NW2 A;  3HGB A;  4P74 A;  1HNZ Q;  2L11 A;  3DLL A;  1EQV A;  1L1O C;  2DJG C;  1NCV A;  4DF7 A;  3HOZ B;  4CKE A;  1OTC A;  1V9P A;  2K5N A;  4DKA C;  2MUY A;  1CKN B;  4HMJ A;  1SAP A;  4C3H B;  1CKM A;  3K5M A;  3EBE A;  3CCM A;  4RWS C;  4A3D B;  4DV1 Q;  2F0L A;  1K9M C;  4X3K A;  4DR1 L;  1RJT A;  3A5U A;  2EDG A;  3NPP A;  4HJ7 A;  3TZD A;  5LMN Q;  3NQI A;  1C4Q A;  2A6E D;  4DV6 Q;  3K7U C;  4CDF C;  4YWL A;  5JJK A;  1V8Q A;  1Q3L A;  1VQC A;  3P7J A;  3CP0 A;  4UP7 A;  1OXT A;  1WTH A;  4BY7 G;  4OEL B;  2A6E C;  1VQG A;  4R9W A;  4CGY B;  1XMQ L;  4RGT A;  4KD3 A;  3CCU A;  3OSO A;  3CCQ A;  2HUG A;  3VR2 A;  2B2W A;  3H94 A;  1EOT A;  2FFK B;  4EQO A;  1ONL A;  3TP8 A;  3M4Y A;  4HR7 B;  5C0X G;  3I4N B;  2EJM A;  4GOP A;  1CK1 A;  1OXS C;  2JE6 I;  1BXT A;  3LNN A;  2V4D A;  3IL8 A;  1ET9 A;  4HMI A;  1BO0 A;  2VUM G;  4UP9 A;  1EIY B;  2E76 C;  3WWV A;  3KLS A;  2R7D A;  1GUG A;  3PQI A;  3I4M B;  2RKS A;  3EN2 A;  3HOY B;  2UUA Q;  3FMC A;  1DOL A;  5DAU A;  3S14 H;  5I6W A;  5KRU A;  1CHP D;  2JA9 A;  3MEH A;  1CHQ D;  5FOB B;  5EQ0 A;  1TWA H;  3ZJY C;  4J8Q A;  1JJG A;  4XT3 B;  4IAL A;  2B2W C;  1IHZ A;  1HNZ L;  1B9M A;  2F0D A;  1Y8P B;  2BOS A;  2JK8 A;  4GOP C;  2ZXR A;  1WYD A;  2HQE A;  4GLV B;  2F3V A;  1JE5 A;  1SE8 A;  1D1K A;  3K5N A;  2KHJ A;  4KY5 A;  2AQ1 B;  2BA1 A;  3K5O A;  5T1I A;  4DV1 L;  5DM6 3;  1P16 A;  4IUR A;  3HOX H;  2Q2T A;  5EJW A;  2EYL A;  5AJ3 Q;  2D62 A;  4TVA B;  1TS4 A;  5LMN L;  1VQE A;  1EIG A;  4DV6 L;  2XSC A;  1GJX A;  3GQB A;  3UE1 A;  5IP7 H;  4A3J B;  2C9O A;  2HCI A;  4K0K Q;  1HR0 W;  1E1O A;  3K57 A;  2K75 A;  5BN4 A;  3E9H A;  4A3L H;  3NBI A;  4CBV A;  2QA4 A;  3S17 H;  1PZK D;  2IL8 A;  3D4W A;  2IX3 A;  3RNU A;  2IY5 B;  2R7Z B;  1JOQ A;  1Q46 A;  5LMU Q;  2I0Q A;  2R92 B;  1G8Z D;  2A6H D;  2RHS B;  3G6E A;  2F0S A;  1L0W A;  1KDB A;  4ID6 A;  1LTT D;  3E6Z X;  3GP7 A;  2WII B;  1NSN S;  3MC0 B;  2A6H C;  3HOY H;  2PMZ B;  1F2Z A;  1KL9 A;  3NQT A;  4LWC A;  2K32 A;  2RVL A;  4A3G B;  3F2D A;  4BBR B;  2EYP A;  1AH9 A;  2JEB I;  1TWF B;  1ET6 A;  2YV5 A;  2K04 A;  2UUA L;  4FO2 A;  3I90 A;  2HIX A;  1S4Z A;  1G6P A;  4A3K H;  1RTO A;  5IY0 A;  1SXT A;  3NXW A;  2A74 C;  1AN8 A;  4YIJ A;  4QL5 A;  2OEO A;  1J9O A;  1WTV A;  4HN7 A;  2PW5 A;  3PIP A;  2EXZ A;  3HOX G;  4X62 Q;  2KBN A;  3Q8D A;  1KRS A;  1NR4 A;  4DR3 L;  3CRL C;  1VMP A;  5C3E H;  4A3J H;  2JXM B;  2Y0S E;  1M4V A;  3K5L A;  4DV2 Q;  4ZAI A;  2IJ0 A;  1DGS A;  1X32 A;  2CWA A;  3S16 B;  5IP7 G;  2VQF Q;  2PYK A;  1W6K A;  1GUN A;  3RZD B;  2EOT A;  2GVA A;  5AJ3 L;  1H9S A;  4LJZ C;  3KDF B;  1JQY D;  4R8I A;  1RTN A;  5CR3 A;  2BA0 A;  1SRO A;  1D5X C;  2PI2 A;  3AU7 A;  1AFP A;  2E2D C;  4C2M H;  1XNQ Q;  3RLN A;  4K0K L;  3IFT A;  3F2U A;  1QOH A;  1EEI D;  1TY2 A;  1FNW A;  2L15 A;  5LMU L;  4F8M A;  3HOY G;  2K5V A;  3DXJ C;  1IBL Q;  5T1G A;  2HQL A;  3CPW A;  1X3E A;  2RCN A;  3G4S A;  4A3G H;  3OIQ A;  2EXD A;  1MHW C;  1LAC A;  3SXH A;  4BA1 I;  5LL6 S;  1BVS A;  2F0P A;  2WAC A;  5COR A;  3KF6 B;  3VR4 A;  2F4V Q;  2RDG A;  4PNY A;  1IXR A;  1PRT D;  3L9A X;  3DEP A;  3T56 B;  4A3K G;  3U9S A;  3ER0 A;  1RL2 A;  3PO2 H;  3HOV B;  1QZG A;  4ME3 A;  3GD7 A;  1BQQ T;  3J7A 5;  1PRT C;  1G91 A;  3H91 A;  1N36 Q;  2H5X A;  4A3M H;  3A0J A;  3T4A C;  4IJH A;  4XQJ A;  3M3Y B;  3NBH A;  2F4I A;  4GS3 A;  2VY3 A;  5NUC A;  5C3E G;  4A3J G;  3A8K E;  2Z6B A;  3IFD A;  4H7B A;  1H9J A;  3U9O A;  2MO0 A;  4X62 L;  3S24 A;  3J80 i;  4RG1 A;  1WCM B;  2E2H B;  3KBX A;  4JBM A;  4DXF A;  2OF1 A;  2BE5 D;  5IGC A;  1ICW A;  3W5O A;  2R7Z G;  2JA6 H;  2R92 G;  2WAQ E;  5IYD H;  4DV2 L;  4A76 A;  2K6A A;  5M5Y B;  2VQF L;  4JI5 L;  2DY8 A;  4KKU A;  3SK6 A;  1KRT A;  4JG2 A;  1CT1 D;  1KLG D;  1SNM A;  1V43 A;  2BE5 C;  2K14 A;  2ZTE A;  4R4Q A;  4UAI A;  5GAD C;  1U4L A;  2MP1 A;  3V05 A;  1KXL A;  4G7Z C;  4LNQ A;  3RUZ A;  4QB4 A;  3J7Y W;  1XNQ L;  4CJ1 B;  3HG9 A;  3J81 i;  4A3G G;  5CV4 A;  2I46 A;  4BXX H;  5BN3 A;  3U4V A;  2QCP X;  2XWJ B;  3BDL A;  3BYT B;  1IBL L;  5EAY A;  3R3O A;  4OO1 H;  3K7A B;  5EKK A;  2Y0S B;  2NYZ D;  3QR8 A;  5D3I B;  3TDQ A;  1UUP A;  4DK0 A;  4X64 Q;  1V1P A;  1CM9 A;  2UXB Q;  3PO2 G;  1PH7 A;  3U58 A;  2PPB C;  1B9N A;  2RQX A;  4KY7 A;  1SYG A;  2F4V L;  4Q0F A;  3BU2 A;  2JA5 B;  1HTL D;  1S5F D;  4H44 C;  5C3W A;  3C1F A;  1P8L A;  3M3Y H;  2B63 H;  1UE1 A;  4OWT B;  3SK8 A;  3VYR A;  4A75 A;  4A3M G;  5EPJ A;  2NB0 A;  1YZ6 A;  5IGE A;  4OWX B;  5FLX c;  2B39 A;  3D8G A;  5IGG A;  2K4K A;  2KHI A;  1TS5 A;  3KF8 B;  2M2L A;  1AW7 A;  1MJE A;  2FMC A;  1E3P A;  4J1M A;  1PH1 A;  1XNR Q;  1TVX A;  4AYB B;  2DNC A;  2B3G A;  5J22 A;  2B29 A;  3BDO A;  2VW9 A;  4LFA Q;  2JA6 G;  2DY7 A;  5IYD G;  2GN5 A;  2IW3 A;  4WJ4 A;  3TBI B;  1BNZ A;  1STY A;  4ZUJ A;  1SRU A;  1IKM A;  1SNC A;  3GTO H;  1J8I A;  1H9R A;  2EVB A;  1JOK A;  3PIO 3;  5IGD A;  4YY3 L;  4GOP B;  5F2D A;  1DZ1 A;  3DHQ A;  1HZA A;  4KN7 C;  4ZRZ A;  3S9W A;  3QWN A;  2K5D A;  3A54 A;  3KUP A;  1X3G A;  1R4Q B;  4BXX G;  1DD2 A;  4PZ6 A;  4YWM A;  1G51 A;  3DWP A;  4OO1 G;  2FIN B;  2DUD A;  1K8G A;  1Y1W H;  2MNA A;  3CPF A;  3GTL B;  1B2T A;  3T1Y Q;  1NE3 A;  4IQZ A;  2SDF A;  4DV3 Q;  4LF6 Q;  1RDP D;  4IPH A;  1A8V A;  5CMD A;  1ROD A;  2WAQ B;  1PYW D;  4I7A A;  4ZK9 B;  3FRP B;  4X64 L;  2UXB L;  1YHB A;  2B63 G;  1I50 H;  1S5B D;  3OOC A;  1DM0 B;  4RFB A;  2A1A A;  3AFP A;  4JW0 A;  1VQP A;  5M5W B;  1BF4 A;  1OXU A;  1HR0 Q;  1EU3 A;  2X69 A;  3LWU A;  4H0L C;  3F2B A;  4DAM A;  3E9I A;  4DV0 L;  3S2H H;  1A2T A;  1TU2 B;  1PFM A;  4RHR A;  2M9V A;  4KTA A;  3ULP A;  1BBW A;  2L55 A;  4R4T A;  3MXG A;  3EVQ A;  3JAM E;  1XNR L;  4TKO B;  3RR5 A;  4DU9 A;  4GKK Q;  4JOI A;  1EZ8 A;  4LFA L;  1PTO D;  5EKI A;  3W1B A;  1E22 A;  1WTR A;  5CGK A;  2A68 D;  2JA7 B;  1WVL A;  1N33 Q;  4GN3 B;  2CFM A;  2DN8 A;  1STN A;  2B2T A;  3KFU A;  4B08 A;  1PTO C;  4GLA C;  3I3C A;  4QQB X;  1MJC A;  1X55 A;  2A68 C;  2Y0S G;  5I6Y A;  1HA6 A;  3FP9 A;  2NUC A;  2F03 A;  4GZY C;  1WFQ A;  1TQO A;  2BDO A;  2D2C C;  2V1C C;  5E4X A;  2RCF A;  1A3V A;  1Y1W G;  2PQA A;  3QB3 A;  4A3E B;  2MHV A;  2RSO A;  2QEX A;  1Z9F A;  4JOI C;  4K5W A;  1ASY A;  1UNS A;  1W6J A;  1O78 A;  1CZG A;  4V0B A;  2Z4H A;  3MFY A;  4NPS A;  1IW7 D;  1JT8 A;  3T1Y L;  4O1N A;  3H15 A;  1EWI A;  2B2T C;  4DV3 L;  4LF6 L;  2BDN A;  5M5W H;  1IZ6 A;  3UI2 A;  3RLO A;  1IW7 C;  1UAP A;  1IBM Q;  3UE0 A;  5M5X H;  5KGU A;  5FLM H;  2N88 A;  4RCO A;  3E5S A;  1PFS A;  3OMC A;  2JA8 B;  1Y1V H;  1SFO B;  1VQB A;  1HR0 L;  1Q90 A;  3W3A A;  3M7N A;  2B2U A;  2ALY B;  3V2T A;  5JVG 3;  3FVQ A;  5E1F A;  1SNP A;  5BR8 Q;  1HJP A;  3VR5 A;  1WD0 A;  3HS0 C;  2A8V A;  4A93 B;  1QUQ A;  1GHJ A;  1CFM A;  1QCB D;  5C44 H;  5JJL A;  1LTR D;  1QNU A;  4GKK L;  3Q24 A;  2OQK A;  1PH5 A;  1EQT A;  2L5T A;  4HIM A;  4K5V A;  4DK1 A;  2B2U C;  3IRB A;  3J81 j;  4CDD C;  5CBE E;  5C0X J;  1K8M A;  1IBK Q;  4QF4 A;  2KEN A;  3GTQ B;  4FF3 A;  1LT6 D;  2WAQ G;  1O7Z A;  4JBJ A;  4HCE A;  2EJF C;  4A3B B;  3A5Z B;  5K36 H;  3S1N H;  2K05 A;  3D6W A;  4GN4 B;  1T5X D;  1SLJ A;  3TP7 A;  1LT3 D;  3BVG A;  3K0X A;  3H0G H;  1L2F A;  5C3X A;  1UE6 A;  3PIP 3;  1FJG Q;  1KAW A;  3W1G A;  1I4Q A;  2KCN A;  4ZCK A;  1L0Y B;  4P72 A;  4ME5 A;  1O7Y A;  1QB5 D;  2PNH A;  3DMU A;  4X3S A;  4NXN Q;  2AKW B;  1BR9 A;  3NBH B;  2F0W A;  5FLM G;  1M90 C;  4DNR B;  4ZYS A;  4A4I A;  4CKB A;  3AYH B;  2CW0 D;  2F0N A;  3GTP H;  2CCZ A;  1NMG A;  4L5S A;  1L1O A;  1Y1V G;  1IBM L;  1IYU A;  2Z1C A;  1I3Q H;  3JC6 6;  2N78 A;  3OPO A;  4P2C B;  5FO9 B;  2KQ3 A;  5E3F A;  1FGU A;  2CW0 C;  1G29 1;  5M9O A;  2L1B A;  4A93 H;  1LO5 D;  2JJQ A;  5M3F B;  1K73 C;  5ELC A;  1VQ4 A;  2HCC A;  4CHT B;  4QUF A;  5C44 G;  5LL6 X;  4DN4 M;  4DAY A;  3T53 B;  1KIX A;  5BR8 L;  1Z47 A;  2PNR C;  1TWC H;  1K3R A;  3U50 C;  3FHW A;  2A69 D;  1QIL A;  1XWE A;  2K1B A;  3MTS A;  4S3S A;  2ICE C;  1N32 Q;  3J80 L;  1XPO A;  3M4O B;  3QIA A;  4OHJ A;  1C9O A;  1IKL A;  3I70 A;  4YCW A;  5DNF A;  4JV5 Q;  3CKI B;  3CF5 A;  1F77 A;  4XYQ A;  2A69 C;  4M1U B;  3DUZ A;  4A3B H;  4FF4 A;  2AHO B;  1K28 A;  3R2I A;  1CA6 A;  1V1P B;  2PMZ E;  5K36 G;  1FD7 D;  3ZYY X;  1IBK L;  5G3L F;  5H1S E;  2N49 A;  4C1N I;  4LF5 Q;  4B9X A;  1LAB A;  3H0G G;  1ENA A;  3L0O A;  4XQQ A;  3J81 L;  1PFN A;  4DNT B;  4IFD H;  3FPP A;  1ZEQ X;  1PH6 A;  4O42 A;  2ATW A;  3AB9 A;  3Q6S A;  4ZQ3 A;  2I07 B;  2J0T D;  2K5Q A;  3CHB D;  3BS1 A;  1FJG L;  5ELO A;  1QVF A;  5IOD A;  2KEE A;  3J80 E;  2D5D A;  5HUR A;  1SYF A;  4NXN L;  2L0C A;  4K2K A;  3JAM i;  3KLW A;  3M7G A;  3O13 A;  1F9S A;  1L0X B;  1U5K A;  4OIK A;  2NZ1 D;  4HAE A;  4KV6 A;  2UXD Q;  1KQS A;  4A93 G;  4BBS B;  2OCE A;  1G2T A;  3A55 A;  2R61 A;  3CQZ B;  1A62 A;  2LY7 A;  4RGM A;  3MFG A;  5A35 A;  1XXG A;  3EJI A;  1LV9 A;  3QO2 A;  4FNF A;  4IPC A;  2OTL A;  1EYA A;  1X6O A;  3C46 A;  1XTD A;  4JYA Q;  3HOZ H;  1E2Z A;  3J81 E;  1VQ8 A;  1U4R A;  2C35 B;  1BCP D;  2VQE L;  4C3H H;  2BH2 A;  4B3T Q;  4A3D H;  2AUJ D;  3PUY A;  1YI2 A;  2MJ8 A;  3TP5 A;  2X6L A;  4Q5V A;  2UUB Q;  2NZH A;  1BCP C;  1N32 L;  3D0F A;  4JI7 Q;  4A3B G;  1YEZ A;  2ZXO A;  2EYJ A;  4DR3 Q;  4JV5 L;  4R8N A;  3VA5 A;  3X3N A;  1KC8 C;  3PO3 B;  3E0J A;  2UU9 L;  2EYH A;  1ICF B;  1HA5 A;  3GTG B;  3NWS A;  1M1K C;  1LTG D;  3R93 A;  4IFD G;  4ILW A;  4FXK C;  4KHZ A;  3DWA A;  4LF5 L;  3S2D B;  2NTS A;  3ERO A;  2FXQ A;  2G9H D;  2NVT B;  3I4N H;  1TY0 A;  1DXM A;  3W2D A;  3PUZ A;  1EIF A;  1EY5 A;  1F9P A;  1CSP A;  1TWG B;  4K5X A;  4I65 A;  4KKS A;  4NB3 A;  3F1Z A;  2XVS A;  1IL8 A;  1KDC A;  2F0G A;  2YYZ A;  5KYI A;  5FJ8 G;  2R93 B;  5JAV A;  4H13 C;  3I4M H;  3BG3 A;  4K8I A;  3GO5 A;  2UXD L;  1EFW A;  3A8J E;  3HOZ G;  2WP8 J;  1CTM A;  2K33 A;  1BBU A;  4FYD A;  2K5H A;  3P20 A;  2XRQ D;  5JPM C;  3P75 A;  4C3H G;  3I56 A;  4HJ8 A;  2EY1 A;  1EWH A;  4A3D G;  4JYA L;  1LTB D;  2JYO A;  2Q2I A;  4Y7N B;  1KAB A;  1ESF A;  1VQH A;  4L5R C;  2YTY A;  3PF5 A;  2PQA B;  4B3T L;  1QJO A;  3HRZ C;  1HZ9 A;  2JQO A;  3CCJ A;  2UUB L;  3VYT A;  1AZP A;  3NTH A;  3OWF A;  4JI7 L;  5C0X I;  4WJ3 M;  1LT5 D;  2KJX A;  3GTM B;  3VYU A;  1PZJ D;  5GRO A;  5CV8 A;  3CCL A;  1MD2 D;  3BZK A;  1EY9 A;  1ZKO A;  3M4P A;  5CV5 A;  3ND8 A;  1R9T B;  4NMZ A;  1F2Y A;  4JI5 Q;  2EY5 A;  1VDZ A;  3G71 A;  1EL0 A;  3FPU B;  2GVB A;  3EIV A;  1HFN A;  2R7Z H;  4P73 A;  2R92 H;  1UEA B;  2AMC B;  3I4N G;  4OX9 Q;  2CH4 W;  2F0V A;  1STE A;  4G57 A;  1NNX A;  2PCF B;  3N52 A;  3IAY A;  1KNE A;  1YHA A;  4EQN A;  4JI4 Q;  3D4D A;  4U68 A;  1WJJ A;  2A73 B;  1LM0 A;  5JEA H;  3I4M G;  2LS0 1;  1B3Q A;  1X3P A;  3HOW B;  2F0T A;  4O2D A;  3RD4 A;  4DV4 Q;  2JSO A;  1RKN A;  1MI2 A;  4YWK A;  5E7N A;  4AYB E;  1NUC A;  4RCN A;  2F0E A;  1QUQ B;  4BBR H;  1C0A A;  1NBW A;  3NTI A;  4LFC Q;  1X56 A;  1C7Y A;  1TWF H;  3S1M B;  1SE3 A;  3MXN A;  2DNE A;  4R4O A;  1BKB A;  4X65 Q;  4LF4 Q;  4IFD I;  3PV0 A;  1X9N A;  1Q12 A;  3KK7 A;  3S1R B;  1MIU A;  5ISR A;  4HTH A;  3RLF A;  1K83 B;  4RGO S;  3L3O C;  2LMC B;  1EYD A;  2LXK A;  4JCV E;  4PMB A;  2Z9H A;  5KNC A;  1B7Y B;  1EZ6 A;  4N8F A;  1I6H B;  3DEO A;  1JJC B;  2J4X A;  4JI3 Q;  4OGQ C;  3S16 H;  1B50 A;  1Q1E A;  1D5M C;  3MXP A;  1CZW A;  3NHH A;  5CV9 A;  3RZD H;  1FNV A;  2F0J A;  1EQR A;  2KCC A;  1HHV A;  1VQA A;  1DJR D;  1KTK A;  2CHB D;  4LF7 Q;  1VQ7 A;  1YJW A;  4YY3 Q;  1L1O B;  2L4N A;  4FXG C;  2XNA C;  3WOE A;  3GV6 A;  4OX9 L;  2QW7 A;  4GNX A;  5JPN C;  4JBW A;  4DR7 Q;  1I4P A;  5JEA G;  2HDM A;  4APV A;  3GTK B;  1EY4 A;  4BBR G;  4KHV A;  5M3M B;  4JI4 L;  2IWH A;  4C3J B;  2XIW A;  4NKL A;  3URY A;  3MHB A;  5IE8 A;  3GTJ B;  3D31 A;  2DGY A;  4DV4 L;  4KD4 A;  1LTS D;  4A3I B;  5ELD A;  1VQJ A;  3HOV H;  5CYU A;  1VF7 A;  2E75 C;  2NN6 H;  4CKC A;  1EOV A;  3MAQ A;  2FHT A;  4LFC L;  3STB D;  1QNK A;  2OWO A;  2Z6K A;  5EPL A;  4X65 L;  4ZLT F;  4LF4 L;  4GNX C;  4DR6 Q;  4IUQ A;  2RDF A;  5IT9 L;  1I6H H;  1BUV T;  1CQF A;  2MFI A;  4K6L A;  3F8T A;  1E2W A;  4KK7 A;  4EQ5 A;  1ENC A;  1KDA A;  3STB C;  2J7Z A;  3I4O A;  1SJE D;  1YIJ A;  3KLR A;  1SNO A;  4EGV A;  4DV0 Q;  3RZO B;  2F0O A;  4DGZ A;  2EIF A;  3TRZ A;  3TSS A;  1Q81 C;  4HCS A;  2E2H H;  1WCM H;  1JOO A;  4JI6 Q;  1SBB B;  5LHY 1;  4JI3 L;  1VCI A;  5IGF A;  1O7I A;  5M5Y H;  5C4X B;  2Z6K C;  3CCV A;  1QG7 A;  2TMP A;  4L63 B;  4K6D A;  2WV6 D;  1HTP A;  1XTC D;  4PMC A;  2MGS A;  2WKC A;  5LMN W;  3LGJ A;  1B70 B;  4KN4 C;  2OTJ A;  2VB2 X;  4B3M Q;  1OO9 B;  1JR0 D;  4LF7 L;  3RN5 A;  4A3C H;  2A19 A;  1T5E A;  1ZYR D;  5IT9 E;  4XXE A;  2NVQ B;  1X65 A;  2AWN A;  4LMQ D;  4EVO A;  5KYL A;  3OTO Q;  3PMF A;  4IOC A;  1ILQ A;  4LK1 C;  1TII D;  4DR7 L;  2XRS D;  1ZYR C;  3K8A A;  3K7A H;  3M85 A;  3KLS X;  4ALP A;  5JJI A;  4HSP A;  1TS3 A;  1LTI D;  1JJ2 A;  4MTK A;  3TQY A;  3R8B A;  4Y52 H;  3HOV G;  3JAM L;  2PI2 E;  2NN6 G;  2SNS A;  5D3D A;  3WOF A;  5I2X A;  5KND A;  2JA5 H;  3PGZ A;  1JWS D;  2Q2H A;  3QOJ A;  3S15 B;  4EX5 A;  2F0U A;  1EY0 A;  3U4Z A;  1XPU A;  1V1Q A;  1EIH A;  2F0K A;  1EYG A;  4DR6 L;  4P71 A;  3PUW A;  1EQQ A;  1G2S A;  4IUV A;  1WCM G;  3ULL A;  3L2P A;  3T51 B;  2B2V A;  1JOR A;  2BH8 A;  1NTG A;  4C3I B;  1K8A C;  4JI2 Q;  3ICE A;  4BY1 B;  5ELN A;  1IL2 A;  4JI6 L;  4ULL A;  1AP0 A;  1LLR D;  1DOK A;  2R6G A;  4N8X 1;  2ENB A;  2PZW A;  4K14 A;  1J6Q A;  4KHP Q;  3CMA A;  5AFW A;  2CH4 A;  4A3C G;  1SE2 A;  1CQV A;  1KD1 C;  4QCL A;  4XIG S;  2IPK D;  4B3M L;  2B2V C;  4LUZ A;  1RF2 D;  2F3I A;  4AQY Q;  5D65 A;  5BN5 A;  4LFB Q;  2AQ2 B;  4NXM Q;  1B4O A;  4XYO A;  2Q8I B;  4F88 A;  2Z8L A;  3OTO L;  3KBG A;  2VNU D;  4OL7 A;  3GTL H;  1Q82 C;  2QF7 A;  4DUZ Q;  4IO9 A;  3NSW A;  2I5M X;  3A56 A;  2ZJR A;  2F0M A;  2JA5 G;  2JEA I;  3S15 H;  1HNW Q;  3D6C A;  3H3V H;  1WTW A;  2K28 A;  4FXD A;  5C4J B;  1D1I A;  2JN4 A;  4F7X A;  2CKZ B;  1XJV A;  1S72 A;  1BBX C;  3ONA B;  4FP5 D;  1EY7 A;  1VQI A;  1PH3 A;  4G7O C;  2F0Q A;  4RKL A;  1K3B C;  4AIM A;  4IUT A;  5CV7 A;  1PYB A;  4POG A;  4C3I H;  4AYB G;  1STH A;  2IT1 A;  3FEW X;  3NEM A;  2H4O A;  5C4X G;  1A2U A;  2EJG C;  3BDC A;  3I7F A;  4NP5 A;  3A8I E;  3SHL A;  1UWV A;  3D4R A;  3AEV A;  1H9S B;  1ZXT A;  3SE0 A;  4OO1 I;  2VS1 A;  1B8A A;  4JI2 L;  3H09 A;  1GUS A;  5KNB A;  4HJA A;  2JA7 H;  3TZU A;  3DM1 A;  2R7F A;  4BY7 B;  1PYS B;  2R3Z A;  1U0L A;  4KHP L;  2N55 A;  1PRT B;  2B8F A;  1Z6H A;  5FO7 B;  4MNO A;  3Q23 A;  1VQD A;  3S1Q B;  4A3E H;  1CSQ A;  4RHS A;  4AQY L;  4LFB L;  1CUK A;  1EYC A;  5ELE A;  4WOR A;  5C6A A;  1E24 A;  4NXM L;  1SEB D;  4OWW B;  3HP3 A;  4QUC A;  4RH6 A;  1JC7 A;  5C4J H;  2E2I B;  2EY6 A;  2VUM B;  1VF5 C;  2NVY B;  4DUZ L;  5EGT A;  2KCM A;  2PQE A;  3KF6 A;  1W3S A;  1S3O A;  5JOB A;  1HNW L;  4KLK A;  4YCU A;  1HZC A;  1X3F A;  4KJO A;  4NDX A;  5HGQ A;  1HCZ A;  2AWO A;  2CWP A;  4JPB W;  1N9W A;  2JA8 H;  4F87 A;  4C3I G;  3SVM A;  1SFO H;  1QWY A;  3BJU A;  1SE4 A;  4QY7 A;  4R1J A;  1RCV D;  2KA7 A;  2QIL A;  1EU4 A;  2ES2 A;  3OIP A;  1NJI C;  1HXY D;  2RHQ B;  3G7L A;  2CQO A;  1KHI A;  4QIW E;  1QZH A;  2JA7 G;  4IPD A;  4G4K A;  1FVI A;  2KHS A;  4IFD J;  2VQE Q;  1OXX K;  2RF4 A;  2MQH A;  2E74 C;  5KIX A;  2E2J B;  1SN8 A;  4G7H C;  4GNX B;  1JE4 A;  3X3M A;  3C2P A;  5IOC A;  2FMM A;  3TN2 A;  1LTA D;  1VQL A;  5IYC G;  2UXC Q;  1GUW A;  4A3E G;  4JVZ A;  1STG A;  3GTQ H;  2PZU A;  1OXV A;  3MZ5 A;  4YCV A;  5CBA E;  1AE2 A;  1X3Q A;  4IOA A;  1Q7Y C;  2UU9 Q;  1LYL A;  1AZQ A;  3ITP A;  1YVC A;  3C3L A;  4ZKC B;  1PLF A;  2VZA A;  1S5C D;  3FKI B;  5IYB G;  3S14 B;  1E7Z A;  2OXP A;  5HGT A;  3AFQ A;  1VQK A;  1TWA B;  1XPR A;  4RKB A;  4DUY Q;  4BS9 A;  2D0O A;  3VR3 A;  2RA4 A;  1QVG A;  2JA8 G;  1H9M A;  2AUK A;  2E5L L;  4IUN A;  1D7Q A;  4EQP A;  2SOB A;  4OON A;  3K58 A;  3QG1 A;  1VQO A;  2K52 A;  1A3U A;  3KF8 A;  2IHE A;  1PRT F;  5M3F H;  4A3F B;  3HOX B;  2WKD A;  5FJ8 H;  2E2J H;  4XTC S;  3B6Y A;  3V96 A;  3VA7 A;  3H3V I;  2PW7 A;  3CC4 A;  2KVM A;  1LT4 D;  3SK5 A;  2JP1 A;  4HIK A;  1MKH A;  3UDF A;  3CD6 A;  3MXU A;  4J6H A;  1HH2 P;  4DR4 Q;  2F0H A;  3M4O H;  4BA2 I;  1PA6 A;  3RMH A;  2QEJ C;  4X66 Q;  5I9O A;  3S17 B;  1A15 A;  1V1O A;  5GAG C;  2HDL A;  1HRJ A;  4LAA A;  3I72 A;  3AMU A;  1STB A;  3KJO A;  4V19 0;  1GM5 A;  3R2T A;  2TSS A;  4YHH Q;  5COY A;  3BYY B;  4O0A A;  3Q22 A;  1PH9 A;  4ABN A;  3E0E A;  1JB3 A;  2ZTD A;  2NZO A;  2UXC L;  4TRD A;  3FKI H;  4GN5 A;  2NTT A;  2P5Z X;  3VDY A;  2NVX B;  1XMO Q;  1ESR A;  2QDL A;  1U4P A;  3CCE A;  1FR3 A;  1CA5 A;  3I8Z A;  4QIW B;  1D8L A;  1KAA A;  4GKJ Q;  4P75 A;  1U4M A;  5J1Z A;  3SGI A;  1S5D D;  4ZUI A;  4A3K B;  3M9B A;  3WDN A;  2WFW A;  2XGT A;  1GO3 E;  4DUY L;  2LFN A;  2Q2U A;  5FK9 C;  5FO8 B;  3Q0A A;  5GQO A;  4HID A;  4L6T B;  4POF A;  1PTO B;  5I4D A;  3MA2 B;  4A3F H;  5C4H A;  4BBS H;  1ML0 D;  1KLU D;  5GAE C;  5M3F G;  3CQZ H;  2WB1 E;  4HED A;  2UUC Q;  1YIT A;  2EYF A;  1AE3 A;  4CJ2 C;  1F2M A;  1NAP A;  5C3E B;  1R4P B;  4XDX A;  1XYI A;  3CCR A;  1VQM A;  3I4L A;  4DV5 Q;  1JWU D;  3H3V C;  3K59 A;  2EY2 A;  1F9Q A;  4BWG B;  2XWB B;  2WIN B;  4J15 A;  3H6M A;  2F1M A;  1QE6 A;  2ID0 A;  4DR4 L;  4C2M B;  4WFN 3;  3J80 c;  2F0I A;  4X66 L;  3HKZ E;  1NMF A;  3DWQ A;  1I4H A;  3PO3 H;  2NVX H;  3FKI G;  5JEA J;  4DFA A;  4QMG A;  3GTG H;  4YHH L;  1B53 A;  3N6R A;  3G48 A;  2Q8R E;  1GD7 A;  4GLX A;  2HHH Q;  3E3X A;  3S2D H;  2KUM A;  4I7Z C;  4DR2 Q;  1PXU A;  1B44 D;  4JI8 Q;  4QJF A;  1XMO L;  2VL6 A;  1GVP A;  1YHQ A;  2NVT H;  4KKT A;  4RA8 A;  1E2V A;  3J81 c;  1HUN A;  2EYM A;  1FNU A;  2XN9 C;  3NK9 A;  3PO2 B;  4KI0 A;  1PTO H;  4X3U A;  5FLX L;  4UP8 A;  1TWG H;  5IWA Q;  1DYQ A;  3UDX A;  4GKJ L;  1A0I A;  4A3F G;  1YNN D;  1K0R A;  4HJ5 A;  4JBK A;  4BBS G;  1UE5 A;  3KOJ A;  4A3M B;  2R93 H;  1H95 A;  3J7Z C;  1Q8K A;  4X3T A;  4DV7 Q;  3HZX A;  1YNN C;  2XTI A;  5I2Y A;  1D6E C;  4IUP A;  2UUC L;  3EQL C;  1HPC A;  2A5H A;  4A3L G;  3VR6 A;  5G3L D;  1ASZ A;  2JA6 B;  2HIV A;  2EE1 A;  2EPB A;  1TS2 A;  4K2L A;  4Y7N H;  2OT2 A;  4DV5 L;  3FDT A;  5I9P A;  1HZB A;  2YTX A;  5L37 A;  1EY8 A;  5FLX E;  1CKO A;  4WJW A;  3CU7 A;  4L8J A;  4HSV A;  3PO3 G;  4QGU A;  2KEC A;  5J39 A;  2LKV A;  3PSI A;  4L5Q A;  3PUV A;  1IYJ B;  3PF4 A;  1JIC A;  3GTM H;  4ZKB B;  4UY8 C;  1WI5 A;  2WB1 B;  1HQM C;  1PTO F;  1R9T H;  1K8O A;  2LXJ A;  3HOU B;  3SDZ A;  2HHH L;  3A7A B;  3CAM A;  1MSG A;  1T9H A;  3KYH C;  2OQ0 A;  1D5Z C;  2ZTC A;  4DR2 L;  3OHX C;  2QDB A;  4JI8 L;  1M8A A;  1TKW B;  2RSN A;  3TS0 A;  4MIU A;  3T16 A;  1SMY D;  2MPM A;  2EYO A;  4DR5 Q;  3EA6 A;  1NR2 A;  3CCS A;  1SND A;  2B63 B;  2R93 G;  1HNX Q;  4PG3 A;  2K50 A;  5IWA L;  3K81 C;  5EBC A;  1SR3 A;  2H1E A;  3HKZ B;  3OW7 A;  4DXG A;  3HOW H;  1SMY C;  2L12 A;  1LUZ A;  3C1E A;  2YU9 B;  4CDC C;  3I2Z A;  4OXP A;  1VQ5 A;  1PVO A;  3S1M H;  1SYC A;  4DV7 L;  4FVM A;  2G5D A;  5IIF A;  3K80 C;  5EPK A;  4DAY B;  3M4Q A;  1Q8I A;  1DON A;  2FJ2 A;  1SYE A;  4IPG A;  1BOS A;  5DM7 3;  3S1R H;  5CV6 A;  3NP8 A;  2B8G A;  3ERS X;  5JJZ A;  4MTN A;  3TS2 A;  1WTQ A;  1FGB D;  1K83 H;  3GTO B;  1II3 A;  3DM3 A;  4XQN A;  2NWG A;  4H02 A;  1YJ9 A;  1TXY A;  4LUO A;  4WRD A;  1WTP A;  4R4I A;  1B1Z A;  1CKN A;  1DOM A;  1H9K A;  4B3S Q;  1GKH A;  1JB7 A;  3HOU H;  3ND9 A;  1VQ6 A;  4JC0 A;  3P1H A;  3I55 A;  1U9R A;  1QVC A;  4OEM B;  1YJN A;  1I4R A;  3EFX D;  4FF2 A;  3GDE A;  1GXD C;  1Y1W B;  3SR1 A;  4MHE A;  3J7A V;  1VMC A;  1UEB A;  3OWE B;  1Y14 B;  1VS0 A;  3AQQ A;  3I73 A;  2Z4I A;  3J7A F;  3I91 A;  1I50 B;  3ULJ A;  1ILP A;  1C48 A;  1N36 L;  2YU9 H;  3GTK H;  2O5J C;  3HOW G;  4PV1 C;  1BCP B;  1ENF A;  2CVR A;  2ZXP A;  4DR5 L;  1SDF A;  3QOL A;  4JK1 C;  5M3M H;  4C3J H;  1GOZ A;  1HNX L;  1EUJ A;  4PZ8 A;  1FL0 A;  3S2H B;  5ELF A;  4IN3 A;  2ZJQ A;  3GTJ H;  1I4G A;  1SYD A;  4A3I H;  1PZI D;  1Y8N B;  4Z9C B;  1D2B A;  1SSO A;  2YTV A;  3CW2 C;  1PV4 A;  2K03 A;  5D14 A;  4XT1 B;  3T13 A;  1J5E Q;  4OIJ A;  4IUU A;  2PZT A;  1A6X A;  2KOL A;  2NBF A;  4DAP A;  3OMG A;  1RHP A;  1SYB A;  2WB1 G;  3RZO H;  3UDI A;  1GUT A;  1FYC A;  2RDH A;  4JI0 Q;  4DAV A;  1PH4 A;  2IX0 A;  2PO4 A;  2C5C A;  3HOU G;  4LF8 Q;  4DA2 A;  3F2C A;  2HD3 A;  4RAU C; 
#chains in the Genus database with same CATH homology
 1XX8 A;  2M00 A;  3K6O A;  5EKL A;  5E4W C;  2F3W A;  1Z7T A;  2D9U A;  4C56 C;  1F9R A;  1PFB A;  5IGB A;  1EY6 A;  1O7L A;  1TWH B;  2SNM A;  2CQA A;  3PUX A;  4RGN A;  1IYV A;  1JCK B;  1EWC A;  1WTO A;  4PQX A;  3NTK A;  5M5X B;  1B3A A;  4C3J G;  3NE5 B;  2RBM A;  1Y1V B;  2VB3 X;  3MVV A;  2G9D A;  4M8A A;  1SJH D;  1HUM A;  1YNJ D;  1EFI D;  1MSH A;  1STA A;  5JVH 3;  2IX1 A;  5C44 B;  1YNJ C;  2K01 A;  3TP6 A;  1Y8O B;  4B9W A;  1GHK A;  3L7Z C;  2EZV A;  2SEB D;  3LWE A;  4N9P A;  4KMU C;  1WD1 A;  2KED A;  1WTX A;  3TME A;  3G6J B;  2K5W A;  3SEB A;  1RD9 D;  1BCP F;  5K5P A;  3GV3 A;  3IKJ A;  1DCZ A;  3S1N B;  1Q1B A;  1JWM D;  3QJY A;  4KY6 A;  5KEE A;  3H0G B;  4MN3 A;  2NN6 I;  1I4X A;  3NWT A;  1SNQ A;  4FF1 A;  5CC4 A;  4UDU C;  1O80 A;  2ICI A;  5C4Z A;  3GTP B;  2F0F A;  1MBY A;  4CJ0 B;  1I6V C;  3K0Y A;  1KNA A;  1HQR D;  1I3Q B;  2QKI C;  2BCO A;  2AQ3 B;  1C8C A;  1PDQ A;  4ODG A;  1CI3 M;  2O4X A;  3VYS A;  5A2Q L;  2O5I C;  4KJN A;  2X6G A;  1GUO A;  3LX0 A;  1EEF D;  2B2Y A;  1TWC B;  1BDO A;  1A3T A;  1AEX A;  1E0B A;  1MGS A;  1TR5 A;  1TT2 A;  2Q8T A;  5DEH A;  2L9H A;  2GA4 B;  1PMR A;  5EBD A;  1HFG A;  1Y69 U;  3ERQ A;  4U67 3;  3BZD B;  3BVZ A;  2B2Y C;  3BVM A;  4N9T A;  5A2Q E;  4PMW A;  3NUC A;  4E6I A;  5FKA C;  1F2L A;  2O2L D;  2ZT9 C;  4C1N K;  1G6Z A;  3SK4 A;  3D3R A;  4TSS A;  1S5E D;  2K7V A;  4TQU S;  5ELB A;  5C0X H;  5TSS A;  3A7L A;  3MWY W;  4K8J A;  4IZ8 A;  3HEJ A;  2VXW A;  5C5M A;  5C5L A;  3CRK C;  4NW2 A;  3HGB A;  2L11 A;  1EQV A;  1NCV A;  4DF7 A;  3HOZ B;  4CKE A;  2MUY A;  4HMJ A;  1SAP A;  4C3H B;  3K5M A;  4RWS C;  4A3D B;  2F0L A;  4X3K A;  1RJT A;  2EDG A;  3NPP A;  3TZD A;  3NQI A;  1C4Q A;  2A6E D;  1V8Q A;  1Q3L A;  3P7J A;  1OXT A;  2A6E C;  4R9W A;  4CGY B;  4RGT A;  4KD3 A;  3OSO A;  2HUG A;  3VR2 A;  2B2W A;  3H94 A;  1EOT A;  2FFK B;  4EQO A;  1ONL A;  3TP8 A;  3M4Y A;  4HR7 B;  5C0X G;  3I4N B;  2EJM A;  1CK1 A;  1OXS C;  2JE6 I;  1BXT A;  3LNN A;  2V4D A;  3IL8 A;  1ET9 A;  4HMI A;  1BO0 A;  2E76 C;  3KLS A;  1GUG A;  3I4M B;  2RKS A;  3HOY B;  3FMC A;  1DOL A;  5DAU A;  5I6W A;  5KRU A;  1CHP D;  3MEH A;  1CHQ D;  5FOB B;  5EQ0 A;  4J8Q A;  4XT3 B;  4IAL A;  2B2W C;  1IHZ A;  1B9M A;  2F0D A;  1Y8P B;  2BOS A;  2ZXR A;  2HQE A;  2F3V A;  1D1K A;  3K5N A;  4KY5 A;  2AQ1 B;  2BA1 A;  3K5O A;  5T1I A;  5DM6 3;  4IUR A;  5EJW A;  2EYL A;  2D62 A;  1TS4 A;  1EIG A;  2XSC A;  1GJX A;  3GQB A;  4A3J B;  2C9O A;  2HCI A;  3K57 A;  5BN4 A;  3NBI A;  4CBV A;  1PZK D;  2IL8 A;  3D4W A;  2IX3 A;  1JOQ A;  2R7Z B;  2R92 B;  1G8Z D;  2A6H D;  2F0S A;  1KDB A;  4ID6 A;  1LTT D;  3E6Z X;  3GP7 A;  2WII B;  1NSN S;  3MC0 B;  2A6H C;  2PMZ B;  1F2Z A;  3NQT A;  2K32 A;  2RVL A;  4A3G B;  4BBR B;  2EYP A;  2JEB I;  1TWF B;  1ET6 A;  2K04 A;  4FO2 A;  3I90 A;  1S4Z A;  1RTO A;  1SXT A;  3NXW A;  2A74 C;  1AN8 A;  4YIJ A;  2OEO A;  1J9O A;  1WTV A;  4HN7 A;  2PW5 A;  2EXZ A;  1NR4 A;  3CRL C;  1VMP A;  2JXM B;  1M4V A;  3K5L A;  4ZAI A;  2IJ0 A;  1X32 A;  3S16 B;  2PYK A;  1W6K A;  1GUN A;  3RZD B;  2EOT A;  1H9S A;  4LJZ C;  1JQY D;  4R8I A;  1RTN A;  5CR3 A;  2BA0 A;  1D5X C;  3AU7 A;  1AFP A;  2E2D C;  3IFT A;  3F2U A;  1QOH A;  1EEI D;  1TY2 A;  1FNW A;  4F8M A;  3DXJ C;  5T1G A;  3OIQ A;  1LAC A;  3SXH A;  4BA1 I;  5LL6 S;  2WAC A;  2F0P A;  5COR A;  3VR4 A;  2RDG A;  4PNY A;  1PRT D;  3L9A X;  3DEP A;  3T56 B;  3U9S A;  3HOV B;  3GD7 A;  1BQQ T;  1PRT C;  1G91 A;  3H91 A;  3T4A C;  4XQJ A;  3M3Y B;  3NBH A;  2F4I A;  5NUC A;  3A8K E;  3IFD A;  4H7B A;  1H9J A;  3U9O A;  2E2H B;  1WCM B;  3KBX A;  4DXF A;  2OF1 A;  2BE5 D;  5IGC A;  1ICW A;  2K6A A;  5M5Y B;  2DY8 A;  4KKU A;  3SK6 A;  1CT1 D;  1KLG D;  1SNM A;  1V43 A;  2BE5 C;  4UAI A;  1U4L A;  2MP1 A;  3V05 A;  4G7Z C;  3RUZ A;  4QB4 A;  3J7Y W;  4CJ1 B;  3HG9 A;  5CV4 A;  2I46 A;  5BN3 A;  2QCP X;  2XWJ B;  3BDL A;  3BYT B;  3R3O A;  4OO1 H;  3K7A B;  5EKK A;  2Y0S B;  2NYZ D;  5D3I B;  3TDQ A;  1UUP A;  4DK0 A;  1V1P A;  1CM9 A;  2PPB C;  1B9N A;  2RQX A;  4KY7 A;  1SYG A;  4Q0F A;  2JA5 B;  1HTL D;  1S5F D;  4H44 C;  5C3W A;  3C1F A;  3SK8 A;  3VYR A;  5EPJ A;  2NB0 A;  5IGE A;  2B39 A;  3D8G A;  5IGG A;  1TS5 A;  2M2L A;  1AW7 A;  2FMC A;  4J1M A;  1TVX A;  4AYB B;  2DNC A;  5J22 A;  3BDO A;  2DY7 A;  2IW3 A;  3TBI B;  1BNZ A;  1STY A;  4ZUJ A;  1IKM A;  1SNC A;  1J8I A;  1H9R A;  2EVB A;  1JOK A;  3PIO 3;  5IGD A;  5F2D A;  1DZ1 A;  3DHQ A;  4KN7 C;  4ZRZ A;  3S9W A;  3QWN A;  2K5D A;  3A54 A;  3KUP A;  1R4Q B;  1DD2 A;  3DWP A;  4OO1 G;  2FIN B;  3GTL B;  1B2T A;  4IQZ A;  2SDF A;  1RDP D;  5CMD A;  1ROD A;  2WAQ B;  1PYW D;  4ZK9 B;  3FRP B;  1S5B D;  3OOC A;  1DM0 B;  4RFB A;  5M5W B;  1BF4 A;  1OXU A;  1EU3 A;  2X69 A;  3LWU A;  4H0L C;  1A2T A;  1TU2 B;  1PFM A;  4RHR A;  2M9V A;  4KTA A;  2L55 A;  3MXG A;  3EVQ A;  3JAM E;  4TKO B;  4DU9 A;  1EZ8 A;  1PTO D;  5EKI A;  1WTR A;  5CGK A;  2A68 D;  2JA7 B;  1WVL A;  2DN8 A;  1STN A;  2B2T A;  4B08 A;  1PTO C;  3I3C A;  2A68 C;  5I6Y A;  1HA6 A;  2NUC A;  2F03 A;  4GZY C;  2BDO A;  1TQO A;  2D2C C;  5E4X A;  1A3V A;  3QB3 A;  4A3E B;  2MHV A;  2RSO A;  4K5W A;  1UNS A;  1W6J A;  1O78 A;  1CZG A;  4V0B A;  2Z4H A;  3MFY A;  1IW7 D;  4O1N A;  2B2T C;  2BDN A;  3UI2 A;  1IW7 C;  1UAP A;  5KGU A;  2N88 A;  4RCO A;  3E5S A;  2JA8 B;  3OMC A;  1SFO B;  1Q90 A;  3W3A A;  3M7N A;  2B2U A;  3V2T A;  5JVG 3;  3FVQ A;  5E1F A;  1SNP A;  3VR5 A;  1WD0 A;  3HS0 C;  4A93 B;  1GHJ A;  1CFM A;  1QCB D;  1LTR D;  1QNU A;  3Q24 A;  1EQT A;  2L5T A;  4K5V A;  4DK1 A;  2B2U C;  5CBE E;  5C0X J;  1K8M A;  4QF4 A;  3GTQ B;  4FF3 A;  1LT6 D;  1O7Z A;  4HCE A;  2EJF C;  4A3B B;  5K36 H;  2K05 A;  3D6W A;  1T5X D;  3TP7 A;  1LT3 D;  3BVG A;  5C3X A;  3PIP 3;  1I4Q A;  2KCN A;  1L0Y B;  4ME5 A;  1O7Y A;  1QB5 D;  3DMU A;  4X3S A;  1BR9 A;  2F0W A;  4DNR B;  4ZYS A;  4CKB A;  2CW0 D;  2F0N A;  1IYU A;  2Z1C A;  3OPO A;  4P2C B;  5FO9 B;  2KQ3 A;  5E3F A;  2CW0 C;  1G29 1;  5M9O A;  2L1B A;  1LO5 D;  5M3F B;  5ELC A;  2HCC A;  4CHT B;  4QUF A;  5LL6 X;  4DN4 M;  4DAY A;  3T53 B;  1Z47 A;  2PNR C;  2A69 D;  1QIL A;  1XWE A;  2K1B A;  3MTS A;  4S3S A;  2ICE C;  3J80 L;  3M4O B;  3QIA A;  4OHJ A;  1IKL A;  3I70 A;  5DNF A;  3CKI B;  1F77 A;  4XYQ A;  2A69 C;  4M1U B;  3DUZ A;  4FF4 A;  3R2I A;  1CA6 A;  1V1P B;  5K36 G;  1FD7 D;  3ZYY X;  5G3L F;  4C1N I;  4B9X A;  1LAB A;  1ENA A;  4XQQ A;  3J81 L;  1PFN A;  4DNT B;  4IFD H;  3FPP A;  1ZEQ X;  4O42 A;  3AB9 A;  3Q6S A;  4ZQ3 A;  2I07 B;  2J0T D;  2K5Q A;  3CHB D;  3BS1 A;  5IOD A;  2KEE A;  3J80 E;  2D5D A;  5HUR A;  1SYF A;  2L0C A;  4K2K A;  3M7G A;  3O13 A;  1F9S A;  1L0X B;  4OIK A;  2NZ1 D;  4HAE A;  4KV6 A;  4BBS B;  1G2T A;  3A55 A;  2R61 A;  3CQZ B;  4RGM A;  2LY7 A;  3MFG A;  5A35 A;  1XXG A;  3EJI A;  1LV9 A;  3QO2 A;  4FNF A;  1EYA A;  3C46 A;  1E2Z A;  3J81 E;  1U4R A;  1BCP D;  2AUJ D;  3PUY A;  2MJ8 A;  3TP5 A;  2X6L A;  4Q5V A;  1BCP C;  2ZXO A;  2EYJ A;  4R8N A;  3VA5 A;  3X3N A;  3PO3 B;  3E0J A;  2EYH A;  1HA5 A;  3GTG B;  3NWS A;  1LTG D;  3R93 A;  4IFD G;  4ILW A;  4FXK C;  4KHZ A;  3DWA A;  3S2D B;  2NTS A;  3ERO A;  2G9H D;  2NVT B;  1TY0 A;  1DXM A;  3W2D A;  3PUZ A;  1F9P A;  1EY5 A;  1TWG B;  4K5X A;  4I65 A;  4KKS A;  2XVS A;  1IL8 A;  1KDC A;  2F0G A;  2YYZ A;  5KYI A;  2R93 B;  5JAV A;  4H13 C;  3BG3 A;  4K8I A;  3GO5 A;  3A8J E;  2WP8 J;  1CTM A;  2K33 A;  4FYD A;  3P20 A;  2XRQ D;  5JPM C;  3P75 A;  4C3H G;  2EY1 A;  1EWH A;  1LTB D;  2JYO A;  4Y7N B;  1KAB A;  1ESF A;  1QJO A;  3HRZ C;  3VYT A;  1AZP A;  3NTH A;  3OWF A;  5C0X I;  1LT5 D;  2KJX A;  3GTM B;  3VYU A;  1PZJ D;  5CV8 A;  1MD2 D;  1EY9 A;  1ZKO A;  5CV5 A;  3ND8 A;  1R9T B;  4NMZ A;  1F2Y A;  2EY5 A;  1VDZ A;  1EL0 A;  3FPU B;  1HFN A;  1UEA B;  2F0V A;  1STE A;  4G57 A;  2PCF B;  3N52 A;  3IAY A;  4EQN A;  1KNE A;  3D4D A;  4U68 A;  2A73 B;  5JEA H;  2LS0 1;  1X3P A;  3HOW B;  2F0T A;  3RD4 A;  2JSO A;  1RKN A;  1MI2 A;  1NUC A;  4RCN A;  2F0E A;  3NTI A;  3S1M B;  1SE3 A;  3MXN A;  2DNE A;  4IFD I;  3PV0 A;  1Q12 A;  3KK7 A;  3S1R B;  5ISR A;  4HTH A;  3RLF A;  1K83 B;  4RGO S;  3L3O C;  2LMC B;  1EYD A;  4PMB A;  5KNC A;  1EZ6 A;  1I6H B;  3DEO A;  2J4X A;  4OGQ C;  1B50 A;  1Q1E A;  1D5M C;  3MXP A;  1CZW A;  3NHH A;  5CV9 A;  1FNV A;  2F0J A;  2KCC A;  1HHV A;  1DJR D;  1KTK A;  2CHB D;  2L4N A;  4FXG C;  2XNA C;  3WOE A;  3GV6 A;  5JPN C;  4JBW A;  1I4P A;  5JEA G;  2HDM A;  3GTK B;  1EY4 A;  4KHV A;  5M3M B;  2IWH A;  4C3J B;  2XIW A;  4NKL A;  3URY A;  3MHB A;  3GTJ B;  3D31 A;  4KD4 A;  1LTS D;  4A3I B;  5ELD A;  5CYU A;  1VF7 A;  2E75 C;  2NN6 H;  4CKC A;  3MAQ A;  2FHT A;  1QNK A;  5EPL A;  4ZLT F;  4IUQ A;  2RDF A;  5IT9 L;  1BUV T;  1CQF A;  4K6L A;  4KK7 A;  1E2W A;  1ENC A;  1KDA A;  2J7Z A;  1SJE D;  3KLR A;  1SNO A;  4EGV A;  3RZO B;  2F0O A;  4DGZ A;  3TSS A;  4HCS A;  1JOO A;  1SBB B;  5LHY 1;  1VCI A;  5IGF A;  5C4X B;  1QG7 A;  2TMP A;  4L63 B;  4K6D A;  2WV6 D;  1HTP A;  1XTC D;  4PMC A;  2MGS A;  2WKC A;  4KN4 C;  2VB2 X;  1OO9 B;  1JR0 D;  1T5E A;  1ZYR D;  5IT9 E;  4XXE A;  2NVQ B;  4LMQ D;  2AWN A;  4EVO A;  5KYL A;  3PMF A;  1ILQ A;  4LK1 C;  1TII D;  2XRS D;  1ZYR C;  3M85 A;  3KLS X;  4HSP A;  1TS3 A;  1LTI D;  3R8B A;  3JAM L;  2NN6 G;  2SNS A;  5D3D A;  3WOF A;  5I2X A;  5KND A;  1JWS D;  3QOJ A;  3S15 B;  2F0U A;  1EY0 A;  1EIH A;  2F0K A;  3PUW A;  1G2S A;  4IUV A;  3T51 B;  2B2V A;  1JOR A;  4C3I B;  4BY1 B;  4ULL A;  1AP0 A;  1LLR D;  1DOK A;  2R6G A;  2ENB A;  2PZW A;  4K14 A;  5AFW A;  1SE2 A;  1CQV A;  4QCL A;  4XIG S;  2IPK D;  2B2V C;  1RF2 D;  5BN5 A;  5D65 A;  2AQ2 B;  1B4O A;  4XYO A;  2Q8I B;  4F88 A;  2Z8L A;  3KBG A;  2VNU D;  4OL7 A;  2QF7 A;  3NSW A;  3A56 A;  2F0M A;  2JEA I;  3D6C A;  1WTW A;  2K28 A;  4FXD A;  5C4J B;  1D1I A;  4F7X A;  1BBX C;  1EY7 A;  3ONA B;  4FP5 D;  4G7O C;  2F0Q A;  4RKL A;  4IUT A;  5CV7 A;  1STH A;  2IT1 A;  3FEW X;  2H4O A;  1A2U A;  2EJG C;  3BDC A;  4NP5 A;  3A8I E;  3SHL A;  3D4R A;  1H9S B;  1ZXT A;  3SE0 A;  4OO1 I;  3H09 A;  1GUS A;  5KNB A;  3TZU A;  3DM1 A;  4BY7 B;  2R3Z A;  2N55 A;  1PRT B;  2B8F A;  1Z6H A;  5FO7 B;  3Q23 A;  3S1Q B;  4RHS A;  1EYC A;  5ELE A;  4WOR A;  5C6A A;  1SEB D;  3HP3 A;  4QUC A;  4RH6 A;  1JC7 A;  2E2I B;  2EY6 A;  2VUM B;  1VF5 C;  2NVY B;  5EGT A;  2PQE A;  5JOB A;  4KJO A;  4NDX A;  1HCZ A;  2AWO A;  4F87 A;  4C3I G;  3SVM A;  1QWY A;  1SE4 A;  1RCV D;  2KA7 A;  2QIL A;  1EU4 A;  3OIP A;  1HXY D;  3G7L A;  4G4K A;  2KHS A;  4IFD J;  1OXX K;  2E74 C;  5KIX A;  2E2J B;  4G7H C;  1JE4 A;  3X3M A;  3C2P A;  5IOC A;  2FMM A;  3TN2 A;  1LTA D;  1GUW A;  1STG A;  2PZU A;  1OXV A;  3MZ5 A;  5CBA E;  1X3Q A;  1AZQ A;  3ITP A;  3C3L A;  4ZKC B;  1PLF A;  1S5C D;  3FKI B;  3S14 B;  2OXP A;  5HGT A;  1TWA B;  4RKB A;  4BS9 A;  3VR3 A;  2RA4 A;  1H9M A;  2AUK A;  4IUN A;  4EQP A;  2SOB A;  3K58 A;  3QG1 A;  1A3U A;  3KF8 A;  1PRT F;  4A3F B;  3HOX B;  2WKD A;  4XTC S;  3V96 A;  3VA7 A;  2PW7 A;  2KVM A;  1LT4 D;  3SK5 A;  2JP1 A;  3MXU A;  4J6H A;  2F0H A;  4BA2 I;  3RMH A;  2QEJ C;  5I9O A;  3S17 B;  1A15 A;  1V1O A;  2HDL A;  1HRJ A;  4LAA A;  3I72 A;  3AMU A;  1STB A;  4V19 0;  3R2T A;  2TSS A;  5COY A;  3BYY B;  3Q22 A;  4ABN A;  1JB3 A;  4TRD A;  2NTT A;  2NVX B;  1ESR A;  1U4P A;  1FR3 A;  1CA5 A;  3I8Z A;  4QIW B;  1KAA A;  1U4M A;  5J1Z A;  1S5D D;  4ZUI A;  4A3K B;  3WDN A;  2LFN A;  5FK9 C;  5FO8 B;  3Q0A A;  4L6T B;  1PTO B;  5I4D A;  3MA2 B;  5C4H A;  1ML0 D;  1KLU D;  4HED A;  2EYF A;  4CJ2 C;  1F2M A;  1NAP A;  5C3E B;  1R4P B;  4XDX A;  1XYI A;  3I4L A;  1JWU D;  3H3V C;  3K59 A;  2EY2 A;  1F9Q A;  4BWG B;  2XWB B;  2WIN B;  3H6M A;  2F1M A;  1QE6 A;  2ID0 A;  4C2M B;  4WFN 3;  2F0I A;  3DWQ A;  1I4H A;  5JEA J;  4DFA A;  4QMG A;  1B53 A;  3N6R A;  2Q8R E;  2KUM A;  4I7Z C;  1PXU A;  1B44 D;  4KKT A;  4RA8 A;  1E2V A;  1HUN A;  2EYM A;  1FNU A;  2XN9 C;  3NK9 A;  3PO2 B;  4KI0 A;  1PTO H;  4X3U A;  5FLX L;  1DYQ A;  1YNN D;  4A3M B;  4X3T A;  3HZX A;  1YNN C;  5I2Y A;  1D6E C;  4IUP A;  3EQL C;  1HPC A;  2A5H A;  3VR6 A;  5G3L D;  2JA6 B;  2EE1 A;  2EPB A;  1TS2 A;  4K2L A;  2OT2 A;  3FDT A;  5I9P A;  1EY8 A;  5FLX E;  4WJW A;  3CU7 A;  4L8J A;  4HSV A;  2KEC A;  5J39 A;  2LKV A;  3PUV A;  1JIC A;  4ZKB B;  2WB1 B;  1HQM C;  1PTO F;  1K8O A;  3HOU B;  3SDZ A;  3A7A B;  1MSG A;  1D5Z C;  3OHX C;  2QDB A;  1M8A A;  1TKW B;  2RSN A;  4MIU A;  3T16 A;  1SMY D;  2MPM A;  2EYO A;  3EA6 A;  1NR2 A;  1SND A;  2B63 B;  5EBC A;  2H1E A;  3HKZ B;  3OW7 A;  4DXG A;  1SMY C;  2L12 A;  3C1E A;  2YU9 B;  1SYC A;  4FVM A;  5IIF A;  5EPK A;  1Q8I A;  1DON A;  2FJ2 A;  1SYE A;  1BOS A;  5DM7 3;  5CV6 A;  3NP8 A;  2B8G A;  5JJZ A;  1WTQ A;  1FGB D;  3GTO B;  1II3 A;  4XQN A;  2NWG A;  4WRD A;  1WTP A;  1B1Z A;  1DOM A;  1H9K A;  3ND9 A;  3P1H A;  1U9R A;  1I4R A;  3EFX D;  4FF2 A;  1GXD C;  1Y1W B;  3SR1 A;  4MHE A;  3J7A V;  1VMC A;  3OWE B;  3I73 A;  2Z4I A;  3J7A F;  3I91 A;  1I50 B;  1ILP A;  1C48 A;  2O5J C;  4PV1 C;  1BCP B;  1ENF A;  2CVR A;  2ZXP A;  1SDF A;  3QOL A;  4JK1 C;  1GOZ A;  3S2H B;  5ELF A;  4IN3 A;  1I4G A;  1SYD A;  1PZI D;  1Y8N B;  4Z9C B;  1D2B A;  1SSO A;  2K03 A;  5D14 A;  4XT1 B;  3T13 A;  4OIJ A;  4IUU A;  2PZT A;  1A6X A;  2KOL A;  2NBF A;  4DAP A;  3OMG A;  1RHP A;  1SYB A;  1GUT A;  1FYC A;  2RDH A;  4DAV A;  2IX0 A;  2PO4 A;  2C5C A;  4DA2 A;  4RAU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...