1EZ6A

Structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez6A00
4F8MA 1EYDA 1SNMA 2F0SA 4KTAA 4QF4A 4I65A 1SYCA 2EXZA 3EJIA 1AEXA 4KHVA 4ZUJA 3TP7A 5IGEA 4G57A 4EVOA 4IZ8A 3NUCA 4ME5A 5IODA 3R3OA 5I6YA 2EYHA 1F2ZA 2F0UA 2F0OA 4HMJA 5CV9A 3ITPA 3D8GA 3C1EA 4K6DA 2F0JA 3D4DA 1KDBA 4LAAA 4MIUA 4DFAA 5I9OA 4F7XA 4K5VA 4K2KA 4N9PA 2F0GA 5KIXA 4R8NA 4ZUIA 4S3SA 5IGDA 5CV4A 2F0KA 5CC4A 3OMCA 5DAUA 1KAAA 2F0HA 5E1FA 4EQNA 1KABA 4N9TA 2PYKA 3QB3A 4PMCA 2PW7A 4K14A 3MZ5A 2HQEA 5IGCA 4ODGA 5KEEA 4KY5A 5HURA 4K8IA 1F2MA 4J1MA 4QB4A 3VA5A 3SR1A 5KYIA 1A3TA 2WACA 3RUZA 3TP5A 5J22A 1SNPA 1EY7A 1JOOA 1STBA 1STGA 4B9WA 1EY0A 1STYA 4PNYA 1NUCA 3TMEA 2EYFA 1EY6A 5JAVA 4NKLA 5CV8A 4K5WA 5J39A 5KGUA 3SHLA 1TQOA 1SYEA 1EY8A 3D6CA 3OSOA 4WRDA 5CGKA 4HMIA 5IGGA 3NHHA 2EY5A 1EY4A 2RDFA 4KJNA 1ENAA 3BDCA 3P75A 3S9WA 4KD3A 2F0EA 1KDCA 2F0VA 3BDLA 4IALA 4EQPA 1EY5A 5DEHA 5I9PA 3SK5A 1NSNS 4PMBA 2F0IA 3C1FA 3NP8A 5F2DA 4DU9A 3P1HA 4DF7A 1SYFA 5C3XA 5JOBA 5C6AA 1EZ8A 4KJOA 2PZTA 2OXPA 2F0TA 4OL7A 1ENCA 3NK9A 3OWFA 5CV5A 2EY6A 5KYLA 4QMGA 1U9RA 3D4WA 3PMFA 4KD4A 1SNQA 2F0MA 2OEOA 3NQTA 1TT2A 2F0LA 1EYCA 4K5XA 3HZXA 4K8JA 3LX0A 5EKLA 1II3A 5IGFA 1JORA 1SYGA 2RBMA 1EZ6A 2F0FA 2SOBA 3OMGA 5EGTA 2EYLA 3T13A 3SK4A 3U9OA 4IUNA 3NXWA 1JOQA 2EYOA 1TR5A 5IIFA 5IGBA 3SK6A 2F0NA 4WORA 5ISRA 1SYBA 3EROA 4HTHA 1F2YA 2PW5A 2KHSA 2PQEA 5C5LA 1A3VA 1EYAA 1SYDA 2EY2A 2KQ3A 3EVQA 3QOLA 1IHZA 4RKBA 4EQOA 4TRDA 2PZWA 3TP8A 2NUCA 3HEJA 3MHBA 4NDXA 5C4HA 3ERQA 4E6IA 4KV6A 3QOJA 3H6MA 1STAA 2F0DA 1SNOA 3MXPA 4ZQ3A 2EYJA 2PZUA 4K2LA 2F3VA 5EKKA 5NUCA 5K5PA 5J1ZA 3DHQA 4J6HA 4RKLA 5IOCA 1KDAA 5M9OA 2F0QA 3SXHA 5KRUA 1RKNA 5C3WA 2OF1A 1A2UA 3SK8A 2QDBA 5I6WA 5CR3A 1EQVA 4DGZA 4B9XA 2F0PA 4KY6A 2EYPA 5HGTA 4KY7A 4H7BA 2M00A 1A2TA 1STHA 5C5MA 2RKSA 4ID6A 4NP5A 5C4ZA 1STNA 2SNSA 3MEHA 3V2TA 2LKVA 3E5SA 4YIJA 2F0WA 5E3FA 1A3UA 1SNDA 3DMUA 5CV6A 2ENBA 3TP6A 2EYMA 2O4XA 3MVVA 5CV7A 3T16A 2F3WA 1JOKA 2SNMA 1SNCA 4NMZA 2EY1A 1EY9A
chains in the Genus database with same CATH superfamily
4F8MA 3SEBA 4MTKA 2L4NA 5FO9B 1B3AA 1Y14B 2CCZA 1MJEA 2CFMA 3T4AC 2EYHA 1M1KC 2F0OA 1L2FA 1N36L 2EVBA 2JQOA 4BY7G 1KDBA 4CKEA 3MAQA 4F7XA 3B6YA 2VQFQ 3E6ZX 1E3PA 4CDFC 3NBHA 5DAUA 5HGQA 4BBSB 1XWEA 1JT8A 1D7QA 4EQ5A 2IJ0A 2KCTA 2PYKA 3I4NG 2A19A 3U9SA 5KEEA 1NY4A 4DUZQ 2Z9HA 2AQ3B 4JCVE 3PO2G 2WACA 1EY7A 5FO8B 5K36H 2E2JB 2FMMA 4YWKA 2UUBL 2WINB 2CKZB 1ICFB 1PFNA 2G5DA 1UAPA 4L5QA 5IYBG 5I4DA 5AFWA 4A3LG 2NZOA 4ZKCB 3I4MB 4R4OA 3OWEB 5IYCG 2RCNA 4RGMA 1Q3LA 1CHPD 1JE4A 1KXLA 4HJ8A 4AIMA 2F0TA 3OWFA 1DD2A 5KYLA 1VS0A 4A3IG 1AZPA 2K5NA 2MHVA 3FPUB 2EXDA 5FJ8G 5M3FH 1X55A 4OO1G 4AH6A 4DAPA 1ZYRD 2K04A 4B3MQ 3PUXA 3AEVA 1M8AA 4A3DG 2N88A 1XMOL 2OTLA 2EY2A 1FGBD 2DGYA 3ULLA 1W3SA 1YITA 1GJXA 3BVZA 1MJCA 1CM9A 5M3MB 3MXPA 1UWVA 3OIQA 5K5PA 5J1ZA 4HAEA 2WP8J 3PUWA 4LF9Q 2AWOA 5C3EB 3HOYB 3MXNB 2Y0SB 4POGA 5I6WA 3F2UA 4X62L 4FYDA 4ID6A 1VCIA 1GUSA 2VB2X 3VDYA 3EN2A 4QGUA 2C5CA 5EPJA 5CV7A 3PQIA 1LTTD 1JOKA 2UXCL 4DV5Q 1M4VA 3KFUA 4JG2A 3NE5B 1S5DD 1OXTA 1BBWA 3NWTA 2HQLA 2XN9C 4KTAA 3VR3A 1KL9A 2ZXOA 5K36G 1O80A 3NWSA 5CBAE 3I91A 2PMZE 4R4QA 1H9RA 5CBEE 2E5LQ 1IYVA 2MP1A 1VQMA 2N55A 1E1OA 3NBHB 1H95A 1LABA 4QUCA 1S4ZA 4DV7L 3T51B 4K2KA 3BVMA 2OQ0A 3DM1A 5T1GA 3H15A 1VQAA 1T5EA 1MGSA 3OTOL 4JI4Q 1TS5A 4LFBL 4P75A 3VA5A 4ZYSA 5KYIA 1XPOA 1Q1EA 1NJIC 3DWQA 1T5XD 3NPPA 3S1NB 3RZDB 3ONAB 2IL8A 4NKLA 2D0OA 5CV8A 2B2WA 4Y7NH 5M3FG 2QA4A 3AQQA 3SHLA 2ZJPA 1YBYA 2OQKA 3NHHA 5LMUQ 4DR6Q 4GN5A 2F0EA 4M8AA 1G6PA 4PMBA 1XPUA 1FR3A 1Q7YC 1L0YB 1EIHA 3PV0A 1RHPA 4CJ0B 2FINB 3SGIA 4BXXH 4G4KA 3AFQA 3I56A 5C44H 4IUQA 3NENA 3X3NA 4ALPA 2AUJD 4NB3A 4GOPA 2BH8A 5JVH3 3SK6A 4WORA 1WYDA 1QUQA 1B2TA 1SYDA 1I94L 5AJ3L 3OPOA 5JPMC 4YHHL 2B3GA 4KKTA 3SE0A 1TWHH 2ZTCA 4CBVA 1NR4A 3JAMi 1TKWB 3WOFA 1WVLA 1VQJA 3D3RA 1D2BA 3SDZA 1X3PA 5FLMH 1B8AA 1PVOA 2RF4A 2F0PA 3BJUA 3PF5A 1N34Q 4BA1I 2ZM6Q 1IBMQ 2R93B 4NP5A 3V2TA 1PH6A 3RZOH 4DR4L 1AP0A 1PH3A 2R7FA 1VQHA 1SNDA 2KCNA 1WTOA 1LTGD 1HXYD 1N32L 3J81i 3FMCA 1QJOA 5J3BA 1TIID 1VQFA 4L6TB 1NCVA 3M3YH 1L0WA 5C4XH 4L5RC 1OO9B 1X9NA 1TWFB 1C7YA 1H9JA 1AN8A 1FD7D 4LF5L 1HR0Q 4ZRZA 1XPRA 2KEDA 4B08A 4NXNL 5CC4A 1DYQA 3K59A 4GLVB 1O7YA 4KN7C 4O0AA 3A8IE 1CUKA 3I90A 1PZID 4KY5A 3KOJA 1DCZA 4HCSA 4BXXG 1STGA 1SXTA 2AUKA 3K7AB 5EJWA 4AYBB 4FXGC 3TDQA 5L37A 3PIP3 4HSPA 5IWAL 3BS1A 2Q2UA 1KDCA 2JA6B 3BDLA 3FPPA 4H02A 1E2ZA 2E8GA 2WAQE 2K50A 1Z6HA 2ZJRA 2EZVA 2J0TD 5BR8Q 4DKAC 4OL7A 1CZGA 3BZKA 1LACA 2B8FA 3D4WA 4GOPB 3D4RA 4JW0A 1PYBA 2B2YC 2L9HA 1KTKA 4A3FB 3V96A 4XYOA 1F77A 1E2WA 1VF7A 5M5WH 4A3EB 4QUFA 1QUQB 1KC8C 1DOKA 5FLMG 2L55A 3IKJA 4EGVA 4PZ8A 4JK1C 1TWAB 1D6EC 3EROA 3S2DH 1SR3A 1X3EA 3HOXB 3H3VC 3VR4A 3HOZH 1IHZA 4EQOA 4AQYQ 1TU2B 1E22A 4KI0A 2VQEQ 3F2BA 1T9HA 2QGQA 5BN5A 1VQEA 4DR2Q 2EJGC 2F3VA 3DXJC 2R92B 2PMZB 3KJOA 4IUTA 4OIKA 3NQIA 1N33Q 5M5YH 5C3WA 4C3IH 3CMEA 2KHIA 2QDBA 5CR3A 1Y69U 3S2HB 2EQSA 4KY7A 5BN3A 1PH5A 3NBIA 4A3MH 4X65L 2HCCA 3I8ZA 1X56A 4HR7B 4CDDC 3J7ZC 3UDXA 3K58A 1X3GA 1A62A 1Q46A 1SNCA 2E2HB 3CC7A 1PTOC 4X3UA 3RR5A 5IP9H 4JOIC 3NEMA 4DK3C 2Z1CA 4I7ZC 2JJQA 3K0YA 3KBXA 4R8IA 1ENFA 2Z0SA 4BY1B 3E0JA 4C1NK 4LNQA 5IGDA 4K0KL 1EEID 1CQFA 4LUOA 3H09A 3S15H 5D65A 3HOVB 2I5MX 5I2YA 1QNKA 4A3JH 2HDMA 5D3DA 2BA0A 4DUZL 4NXML 2EOTA 3K81C 5FO7B 1AFPA 5IY0A 1BQQT 2R7ZB 2RQXA 3CC2A 4DV6L 4XYQA 1Z9FA 4XT1B 2QCPX 3VYRA 5IGGA 1Y1VH 2CHBD 3ULJA 4KJNA 1PH1A 4EQPA 1QZGA 2XIWA 5EQ0A 4ZLTF 1BCPB 3MFYA 3HOZG 2BOSA 2VW9A 4IUUA 2YTVA 2QEJC 2ZXPA 2VUMG 2H1EA 1JMCA 2F0MA 1J9OA 2B39A 2P5ZX 5LMNQ 2HUGA 1MSGA 2L15A 1BCPD 1FGUA 3Q8DA 3R2TA 4R4TA 1GUNA 2YTYA 5I2XA 1VQ5A 1P16A 4A3MG 1XX8A 3A8KE 4FF2A 1YHAA 2Z4HA 4A3KH 4DR7Q 3MC0B 1SFOH 1E1TA 3S17H 1JJ2A 2CVRA 3QOJA 3H6MA 4UAIA 1HZCA 2GN5A 3KF8A 5COYA 4MNOA 5IOCA 1Q90A 1KDAA 4QY7A 4CGYB 5IP9G 1I4RA 4LF9L 3T1YQ 2NVQB 2SEBD 1SE8A 2KA7A 2M00A 4H7BA 5C0XH 2YU9H 1X3FA 2WB1G 1IW7C 4KKSA 3GTMB 3HKZB 2C9OA 1FL0A 2F4IA 1YZ6A 4A3JG 4DV5L 3KF6A 3A0JA 3T56B 1S5ED 5DM63 1I3QH 2JEBI 4KHVA 4PV1C 5FLXc 2NVYH 5I6YA 3S1QH 1LYLA 1RODA 2K5WA 1SBBB 1Q1BA 2E5LL 1JJCB 2M9VA 3DEOA 1EWCA 3GTOH 1G291 1DXMA 1Y1VG 3D4DA 2WAQB 2K6AA 1PXUA 3KLSX 4ZUIA 2NN6G 2F0KA 2F0HA 4LF4L 2VL6A 2HQEA 1F9QA 3KLWA 2X6LA 5ELDA 4JI4L 4K8IA 1B1ZA 2D5DA 1QCBD 4GLAC 3IFDA 3PUZA 4B9WA 3IFTA 1V1PA 4PNYA 3T53B 3Q23A 1LT3D 1NUCA 2SDFA 2CH4A 1KHIA 1Q8KA 4QCLA 1E0BA 1K0RA 2K4KA 2EY5A 3PO3G 1VQGA 2K28A 5LMUL 2UUCQ 5D14A 1B4OA 1ILQA 2O5JC 1VDZA 2XRSD 3SK5A 1S40A 3NP8A 1R9TH 2WB1E 4A3KG 2FFKB 4X64L 2X6GA 3MFGA 1PZKD 1Y1WH 3BYTB 4KJOA 3I2ZA 5CV5A 1ZKOA 4LK1C 4JI7Q 3M7NA 4K5XA 2A74C 2LXKA 1CK1A 1XJVA 2FJ2A 1LT5D 5ELNA 1G2TA 4QIWB 1LT4D 1E2VA 4KLKA 2EYOA 1TR5A 1BUVT 5C0XG 2KENA 3KLSA 3QOLA 2K32A 3KF8B 1OXVA 3P7JA 3ERQA 3ICEA 2DUDA 3PO2H 3SVMA 4B3RQ 4LFAL 5M9OA 1WJJA 1Y8OB 4A3BH 4QL5A 1NMFA 4F88A 3M9BA 1WI5A 3SK8A 2DJFC 1D8LA 2PCFB 3HOWB 2OCEA 2RCFA 2JA8H 4G7ZC 2ZM6L 1JB3A 2F0WA 3H3VI 3FRPB 2ICEC 4PQXA 1SE3A 1AH9A 4X6AH 4A3IH 1Q86C 1J8IA 4PMWA 3DEPA 2BA1A 4OX9Q 3TP7A 4JI0L 1I5FA 5C4XB 4OO1H 2F0UA 1VQNA 3FKIH 3I72A 2Q2TA 4ZK9B 1HR0L 3HOUB 1HNWQ 5GAGC 1E7ZA 4N9PA 1C48A 2B2VC 4DK6C 1FNVA 1UUPA 1EWHA 2K14A 1V1PB 1J5EQ 2PW7A 3OIPA 3GTGB 4RH6A 2PI2A 1Y1WG 2D9UA 1B70B 1K83H 3GQBA 3TP5A 1B9NA 4I7AA 3KDFA 1RCVD 2BCOA 1VQDA 3M4YA 4LUZA 4WRDA 3S1RH 1W6KA 1JWMD 2BE5D 4HMIA 1XMQL 3D0FA 4B3SL 1LTAD 3PIO3 1EY5A 1SROA 4KKUA 1NSNS 4JI8Q 4OO1I 1NBWA 3RN5A 1YI2A 2Q2HA 4IPHA 4DR3Q 2I07B 3T1HQ 2Q2IA 1KLUD 4C2MH 2N8NA 1CZWA 1WD1A 2JA5B 3PF4A 2CW0C 2AWNA 3CCVA 4CHTB 3HZXA 4A3BG 1HZAA 5JJKA 3R2IA 1VQCA 5M5WB 1YNJD 2J7ZA 3OW2A 3NXWA 3TN2A 2JA8G 1IYJB 2N49A 1HQRD 1JE5A 1L1OC 2YTXA 2KHSA 1TY2A 3GTKH 1UE7A 3GTPB 3AMUA 4HJAA 2R6GA 4L8JA 4AQYL 1PH7A 2VQEL 3D6WA 1DM0B 2HIXA 1EYGA 1S3OA 2RA4A 4ZKBB 5C0XJ 3ND9A 4TSSA 4DR2L 4B3TQ 2B63B 4FXDA 2Z8LA 4A4IA 3K57A 5M5XH 1BOSA 1Z47A 2JN4A 2NZ1D 3DLLA 1VQKA 1A2UA 4C3IB 3IL8A 3FKIG 1G6ZA 3KK7A 2KECA 1A6XA 5ELFA 1TS3A 3BZDB 4Q0FA 4P72A 3CRLC 2QILA 3CCSA 3FEWX 4FO2A 2GVBA 4P2CB 3TREA 4DAMA 3VR5A 4NMZA 4V190 2X69A 1Y8PB 3M4QA 2ZTDA 2A6ED 2NVXB 4ZAIA 1IL8A 5A35A 3EJIA 3F8TA 2PQAA 4LF7Q 1HRJA 4YY3Q 3I73A 1IBKQ 4DV4Q 1X65A 3J81E 3K5NA 4JBKA 3U58A 1R4PB 4X3TA 1UE1A 3KDFB 4IPCA 1WTVA 1V9PA 3OHXC 2NZHA 1ZYRC 4IUVA 1KD1C 5J22A 4O2DA 4LF8Q 1EY6A 4X66L 4C3JB 1VQLA 4N8FA 1HNXQ 3K7UC 1TQOA 2ZT9C 4RG1A 2Q8RE 3QIAA 4BY1G 1HNZQ 1CA6A 4C3HB 3BG3A 1WTPA 3GV6A 5LHY1 2F0IA 2R61A 4XIGS 1PH8A 3A7AB 3G4SA 5CORA 2A5HA 5FOBB 2GVAA 1BNZA 2PZTA 1LUZA 4BBRG 5JJIA 3J80E 3G6JB 1A63A 3GP7A 3FP9A 4L5SA 3M4OB 4HIOA 4IN3A 5LMNL 3GTLH 4HSVA 1HUNA 1A15A 1EOTA 1NR2A 3L0OA 1HUMA 3ULPA 1H9MA 5CMDA 4GN3B 2UXBQ 3MHBA 5KNDA 3TQYA 1PLFA 3CCUA 4FF1A 5NUCA 3TS2A 3PGZA 1U4LA 3PIPA 3N6RA 3CXCA 1ET9A 3QR8A 1SN8A 3T1YL 3KUPA 3A54A 1WCMH 4G7HC 3W2DA 1PRTB 1I4PA 1ESFA 4LF6Q 4DV2Q 1BO0A 1O7IA 1K3BC 1NTGA 1YIJA 3S16B 3DMUA 4DV0Q 1O78A 1AW7A 1I50H 5JPNC 4JBMA 4K6LA 3O13A 3TBIB 4A3CH 4FDBA 1EY9A 2PQAB 3H94A 2TSSA 4DA2A 4LW1A 4KHPQ 1PRTD 4DV3Q 4QF4A 4BWGB 1SYCA 4ZUJA 2I0QA 4IZ8A 4JOIA 2IX3A 3S1MH 4LMQD 3IRBA 4U68A 1XNRQ 4YCUA 2B2UC 3RLFA 2EPBA 4XQQA 3GTJH 2E2IB 2F0JA 1PFSA 1A8VA 2F0GA 2WKDA 2KHJA 4OEMB 5CV4A 2XWBB 4WJWA 4OXPA 3CW2C 1KAAA 3H0GH 2HHHQ 5C4JH 4POFA 4A93B 1I4GA 1I6HH 4QJFA 1K8OA 4P74A 4UPAA 3LWUA 1QVGA 1C4QA 4A3GB 1BDOA 1UE5A 2JE6I 1EY8A 1GXDC 4J15A 1VMCA 3RLOA 2HIVA 1KIXA 1PH2A 3V05A 3K5LA 3CPWA 1TVXA 1HZ9A 3J7AF 2WFWA 1PRTF 4DXGA 3J81L 5EKIA 3CQZB 3HFZB 4U673 3STBC 1YNXA 2HDLA 2ZXRA 2MQHA 1K0SA 5CYUA 3F1ZA 1NMGA 2I5HA 1XXGA 4JI7L 4K8JA 1TS2A 4F87A 2L12A 4HCEA 4V0BA 1TS4A 1SE2A 1RDPD 1WCMG 3N52A 4BY7B 1SYBA 3NTHA 1GO3E 2JA7H 4IFDH 2RSNA 4JI6Q 2NUCA 1BKBA 3I4NB 1TWGB 4CJ1B 4A3CG 4JI1Q 3U4ZA 3PO2B 4JI5Q 4TVAB 4B3RL 1IL2A 1FJGQ 2CQAA 4RGNA 2IPKD 3J80L 2ES2A 1JICA 2O2LD 4B9XA 4FXKC 1XTDA 5IP7H 1CKNA 1STHA 2RKSA 3DUZA 2VY3A 1PTOB 2EYMA 1UNSA 3H0GG 2AMCB 1K3RA 4UDUC 2EY1A 4IFDI 3K6OA 2VUMH 2E2JH 4A3IB 3MTSA 2MUYA 2B2WC 4H13C 4OX9L 4ME5A 1OTCA 4HJ5A 4FF3A 3UDGA 1PTOD 4P71A 3G7LA 3KJPA 1ESRA 3C1EA 4K6DA 4YWLA 3I4MH 3BU2A 4A3DB 1HNWL 4ABNA 4P73A 4GS3A 2LMCB 3OMCA 3D31A 1HZBA 1IBLQ 3RD4A 1J5EL 1EIFA 1YEZA 5IE8A 3MXGA 1EY0A 1GVPA 3GD7A 3TMEA 1AE2A 3KYHC 1M90C 4GOPC 1FVIA 1ASZA 3PSIA 4PZ6A 1EY4A 3ZYYX 1EOVA 1PYSB 3P75A 3LWEA 5ELEA 3C2PA 1GM5A 3I55A 1GKHA 2NTTA 1S5FD 2JA7G 4JI8L 2BDNA 2VQFL 4IFDG 1VMPA 2D0PA 4DR3L 2A1AA 1YNND 5M3MH 2A6HD 2K5VA 2RSOA 1IKLA 2OEOA 4RHRA 1VQ9A 5C3EH 2RHQB 3NTIA 2Z6BA 3HOYH 1EIYB 2L0CA 5GADC 4X62Q 2XRQD 1DOLA 1MD2D 3SK4A 1QB5D 5IP7G 4O42A 4OWXB 1DONA 2RHSB 4DR5Q 2PQEA 2NN6H 4JYAQ 4BBSG 3CD6A 1VQ6A 3AYHB 1EWIA 3A8JE 4E6IA 1O7LA 2ZTEA 4B3TL 5LL6S 3TZUA 3J81j 1CKNB 4GKKQ 1D1KA 5M3FB 1O7ZA 5DNFA 5E4XA 4DGZA 2KCMA 3PO3H 3NSWA 1HPCA 2DN8A 2RVLA 1VQ7A 1SAPA 4B3ML 3I4MG 2F52A 3G48A 2KUMA 3MVVA 1EQTA 1LTID 1XYIA 2NN6I 1EYDA 3S1NH 3RZDH 4I65A 4XQJA 3CHBD 1AEXA 1SMYD 1H9SA 3RN2A 3GV3A 4H44C 2QEXA 2JXMB 4NPSA 4LF7L 4YY3L 3TS0A 2E2DC 2AKWB 4DR1Q 2B2VA 1OXUA 4DV4L 1IBKL 5HY6A 4GKJQ 4OELB 3EIVA 3CPFA 4Q5VA 2QF7A 1PZJD 2A69C 3QG1A 2HD3A 5M3MG 2B8GA 4QB4A 1BCPC 3TRZA 1A3TA 3RUZA 4HIMA 1JOOA 1YHBA 1S72A 1BCPF 5C3EG 3HOYG 4K5WA 2Y0SG 1EQRA 2BDOA 2A68D 3ER0A 1R4QB 1HNXL 2CH4W 1N9WA 1F9RA 1ENAA 2F0VA 1G8ZD 5I9PA 1HNZL 3L3OC 5AJ3Q 1MHWC 1SLJA 2ASBA 5JOBA 1K28A 1X3QA 1EZ8A 1RTOA 3UDFA 4DNTB 5C0XI 1QE6A 2IWHA 1HHVA 2YV5A 1TT2A 4RCOA 5EAYA 4BA2I 3M85A 2B29A 4IFDJ 1HA5A 4DXFA 1XTCD 2EYLA 4Y7NB 1UEAB 4IQZA 3F2DA 1G2SA 2R93H 1HR0W 2F0NA 4X3SA 1C8CA 2PW5A 4DR6L 4JV5Q 1QVCA 1CT1D 1F9PA 2DNCA 4DV1Q 2PZWA 3HEJA 3R93A 2A8VA 4RWSC 3CC4A 2EYJA 2N78A 4K2LA 4A76A 1B44D 1KNAA 5KRUA 5C44B 5E7NA 1TWFH 4GLXA 4LF5Q 1HTPA 3PIOA 2UU9Q 2Y0SE 1RJTA 4UP7A 2ZJQA 1EU4A 4LF6L 2LXJA 4NXNQ 4DV2L 1TXYA 2SNSA 2H5XA 2NVTH 2UUAQ 3E5SA 1A3UA 1FYCA 4DV0L 1CA5A 2MPMA 1H9SB 3G6EA 2TMPA 3K7AH 1TWHB 2F0SA 3VYTA 5JJZA 1PV4A 3S14H 3GTQH 3WOEA 1CTMA 4DV3L 2E76C 2ICIA 3E0EA 1G51A 4G57A 4EX5A 1V1OA 1K8MA 1H9KA 5TSSA 3PUYA 1Q12A 1XNRL 5FK9C 1ICWA 2JA6H 4DFAA 1KLGD 1XNQQ 1N34L 2RDGA 1IBML 2OTJA 2EIFA 1I4XA 3RZOB 4L63B 5IGCA 5C4JB 2HHHL 1KQSA 4ODGA 5BN4A 2L11A 3SR1A 3J7AV 4IPGA 2D62A 4RAUC 4FF4A 4A3FH 2JK8A 1TWCH 4JI2Q 1YJ9A 4A3EH 1JR0D 2EYFA 3EBEA 1WD0A 3M3YB 3ZJYC 2VZAA 3PUVA 1SYEA 3D6CA 2F4VQ 1TWAH 4OHJA 2R93G 3HOXH 4IALA 3AB9A 1GUTA 2Z6KC 3HKSA 1LT6D 2AHOB 2KCCA 1QILA 1ET6A 2BH2A 2R92H 3NK9A 1CKMA 4Y52H 3J7YW 4LFCQ 3NQTA 2PNRC 5IGFA 3LX0A 1JORA 2R7DA 2UXDQ 1ILPA 1L1OB 1UEBA 3UDIA 3S2HH 5EGTA 4G7OC 2CW0D 3P20A 2QKIC 3H91A 2J4XA 1KRTA 4PZ7A 3M7GA 1DZ1A 4DN4M 2KQ3A 2ATWA 4JI6L 5IT9E 1P8LA 1B7YB 3E9HA 2E2HH 2F3IA 1B3QA 1ZXTA 2IT1A 5BR8L 3W1GA 2V4DA 4JI1L 4JI5L 4AYBG 1QG7A 1FJGL 1EFWA 1S5CD 3GDEA 2G9DA 1VQ4A 4BY1H 3CCQA 1MKHA 2EYPA 5HGTA 2HCIA 3KBGA 2JA6G 4K0KQ 2LKVA 1ONLA 1ZEQX 3AU7A 2IHFA 3S2DB 2LS01 3AFPA 3TP6A 3HOVH 3HOZB 3RLNA 2F3WA 5D3IB 3DWAA 4NXMQ 2K1BA 4BBRH 4GNXC 1I6VC 4KHZA 2DJGC 2BE5C 2K5DA 3PCOB 2N3SA 2CWAA 2DY8A 4KMUC 5KNBA 2VUMB 2WIIB 2MJ8A 2R7ZH 2XTIA 4DV6Q 4A3FG 4EVOA 2JA9A 4A3EG 1N33L 1F2ZA 5M5YB 1WFQA 2A73B 5LMNW 1VQIA 2B2UA 4LAAA 4MIUA 5GAEC 1PDQA 4K5VA 4A3MB 3HOXG 1G91A 2IW3A 4IUPA 5FKAC 3EFXD 4EQNA 3NELA 4FP5D 4N9TA 1D5MC 4IPDA 3JAME 1IBLL 1YNJC 3I4OA 1F2MA 3W3AA 2EJMA 4DNIA 3IAYA 2R92G 2F1MA 3A74A 5JVG3 4DPGA 1PA6A 4A75A 2OT2A 2OWOA 5KGUA 5CGKA 4AYBE 3QWNA 4CKCA 1NNXA 2RDFA 1JCKB 2B2TC 3OOCA 1BXTA 3URYA 2WB1B 3L2PA 2ID0A 2CQOA 3C1FA 1EUJA 4O1NA 2I46A 3S15B 4C1NI 3U50C 1EIGA 2KBNA 1X32A 4M1UB 4A3JB 4HN7A 4R9WA 1SNQA 2FMCA 2ALYB 3K0XA 4APVA 1QNUA 1UE6A 1LM0A 1SYGA 1SE4A 1V1QA 5EBDA 2NVQH 2MO0A 1OXXK 1V43A 1IYUA 1JOQA 5ELOA 1Y1VB 3M4PA 1DJRD 1PH4A 1A3VA 4DR5L 1QVFA 3GTMH 2A6EC 3J7A5 2NYZD 4OONA 4LUVA 4RGTA 4JYAL 4IO9A 3HOVG 4CDEC 5GAHC 3DM3A 4WJ3M 4ZQ3A 2K03A 2PZUA 2V1CC 4XQNA 1VQBA 2NTSA 4RKLA 1PFMA 2B2YA 3A56A 4JI3Q 3Q22A 2R7ZG 4HIDA 4GKKL 3RNUA 3Q0AA 3I4LA 2M2LA 4GZYC 5IT9c 1W2BA 2E75C 3CAMA 3PO3B 1A2TA 4ZCKA 4X3KA 4LF4Q 5CV6A 4A3KB 4JVZA 2O4XA 4DR7L 4Z9CB 1SFOB 3OYYA 3S17B 2L1BA 4UY8C 1SNMA 5IT9L 4YWMA 2EE1A 3E3XA 5IODA 4ULLA 5DLQE 5CV9A 1B50A 4XDXA 3D8GA 3UE0A 3RMHA 1WTQA 1B9MA 2YU9B 4DR1L 4GKJL 2PNHA 4X64Q 2H4OA 1TY0A 4DAYA 2IX0A 5E1FA 4PMCA 3MZ5A 4DUYQ 3WWVA 3W5OA 1K8GA 2PPBC 1STBA 1HH2P 2K52A 3L9AX 1MBYA 4CDCC 5H1SE 1K9MC 1CSPA 1I3QB 4DAVA 2NVYB 3S1QB 4TQUS 3JAMc 3BDCA 1IXRA 4MN3A 3S9WA 4KD3A 3GTOB 4TKOB 3TEHB 2GA4B 3EA6A 4RA8A 1L0XB 2XGTA 4GN4B 4DU9A 3HKZG 4BS9A 4WJ4A 1MSHA 2OXPA 3MA2B 1ENCA 3R8BA 4LFAQ 4QMGA 4CJ2C 1IKMA 3JAML 1II3A 2KEEA 3BZCA 4DK0A 3J81c 2SOBA 4MZ9A 3HOWH 3L7ZC 3STBD 3T13A 1D1IA 3VYSA 3I70A 2VXWA 5IIFA 3A7LA 2WAQG 4HTHA 2FHTA 2UUCL 1PRTC 1Q82C 4JV5L 3A55A 3MWYW 4DV1L 2Q8IB 1R9TB 1JC7A 1Y1WB 1SNOA 5EKKA 3K8AA 4J6HA 4JI0Q 2F0QA 3SXHA 2IX1A 3ND8A 1RKNA 3A5UA 4OGQC 5JEAH 4JPBW 1EQVA 2K05A 1WOCA 4KY6A 3HOUH 1SRUA 2UU9L 5C5MA 1F9SA 3DWPA 3CCEA 1STNA 1SJHD 1SMXA 2E74C 3MEHA 2NVTB 2K01A 4R4CA 1EFID 2UUAL 3J80c 1WTHA 5E3FA 1KNEA 3Q24A 1U4MA 1A0IA 3GTGH 5LL6X 1GUWA 1ASYA 4RGOS 2MGSA 3HKZE 3TSSA 3OW7A 5C44G 3S14B 3GTQB 4A3BB 4RFBA 3ERSX 1Q81C 3J80i 1N36Q 1XMQQ 3ITPA 1LO5D 4B3SQ 4DAYB 1JB7A 1D5XC 3CF5A 1C0AA 1GD7A 2O5IC 3HGBA 1RIPA 2JA8B 1XNQL 4KN4C 4R8NA 1YHQA 3CCLA 4BBSH 1KABA 5G3LD 5T1IA 2Q8TA 4K14A 3X3MA 1PFBA 4FNFA 2JA5H 3CRKC 1HFNA 5E4WC 1SNPA 3I7FA 1W6JA 2F03A 2L5TA 2UUBQ 1TWCB 5GROA 1V8QA 1BBXC 4JI2L 1S5BD 1K8AC 1NE3A 1U4RA 5DM73 1JWSD 1LTRD 2F4VL 3FKIB 3HOWG 1PMRA 1CSQA 2MFIA 1HTLD 3HRZC 2IHEA 4UP8A 4YCWA 3GTPH 5ELBA 5F2DA 4HJ9A 1SYFA 1CKOA 1EQQA 1WTRA 2B63H 2VNUD 3PMFA 3CU7A 4KD4A 1K83B 1I4HA 4LFCL 4ILWA 2RBMA 5C4XG 3UI2A 2LFNA 2WKCA 2UXDL 2F0FA 3OMGA 1NAPA 1HQMC 5JEAG 1WTXA 3S1RB 4QIWE 3HOUG 1DGSA 2AQ1B 5FLXE 3FVQA 5G3LF 1XMOQ 4RCNA 5C5LA 4RMFA 1EYAA 3EVQA 2K5HA 4NDXA 2EDGA 3FHWA 2XVSA 3T1HL 4DNRB 4C2MB 1KRSA 2NB0A 2NVXH 1CQVA 1RF2D 1X54A 1FNUA 1PTOF 4MTNA 2MO1A 3TZDA 4OWTB 1GOZA 1AZQA 1EEFD 1SDFA 4OIJA 5IYDH 3GTKB 2ENBA 5EBCA 2XSCA 2UXCQ 1EU3A 3W1BA 3F2CA 1IZ6A 4BBRB 1B53A 2FXQA 2JA5G 2KJXA 2G9HD 3K5MA 4X66Q 4C3JH 5IGEA 2LSSA 2XNAC 3NUCA 4DK1A 5M5XB 4HEDA 1BR9A 4QQBX 4H0LC 4HMJA 1WTWA 1YNNC 4HJ7A 4DV7Q 4C3HH 3QJYA 4LJZC 2A6HC 1QZHA 2QW7A 3CCMA 1BVSA 3OTOQ 3VR6A 1VQOA 3QB3A 1ML0D 1U4PA 2D2CC 4IURA 5HURA 4LFBQ 1LTSD 3MXUA 1SJED 1J6QA 5A2QE 2CWPA 1IW7D 2B63G 2PO4A 2DNEA 1HCZA 4UP9A 2A69D 3M4OH 5GQOA 5JAVA 5KNCA 4C3IG 5J39A 1CI3M 1HFGA 3QO2A 1F2LA 1E24A 2R3ZA 1JQYD 3I3CA 4OWWB 3HS0C 2Z6KA 3P1HA 3JC66 1MI2A 3BDOA 3CCJA 4FVMA 2EY6A 1D5ZC 1Z7TA 3BVGA 4IJHA 2JSOA 2F0LA 1EYCA 3A5ZB 5EKLA 1C9OA 4HIKA 3C3LA 4LF8L 1YVCA 4IUNA 4JC0A 5ISRA 4UHVA 1F2YA 1CFMA 3S16H 1I94Q 4XT3B 4YCVA 1GHKA 5IYDG 2Z4IA 4R4IA 4YHHQ 3G71A 1SMYC 2NBFA 5JEAJ 3E9IA 3K80C 3S24A 4J8QA 3GO5A 1LTLA 1CHQD 3NTKA 1AE3A 2IY5B 1QOHA 4C3JG 2OF1A 1FNWA 4N8X1 4JI3L 3CMAA 1K73C 2HT1A 3GTLB 2E2IH 3UE1A 1LLRD 2JEAI 4C3HG 5C4ZA 4DR4Q 3CKIB 1L1OA 4JBWA 4L5TA 3VYUA 2QDLA 1BBUA 4A93H 1N32Q 2JYOA 3T16A 5FLXL 2SNMA 2A68C 2UXBL 1OXSC 2K75A 4GNXA 2I5LX 4JBJA 2EJFC 2VS1A 2RDHA 4A3GH 2EXZA 1RD9D 3R3OA 5ELCA 3MEFA 5EPLA 1WCMB 1JWUD 1MIUA 1DOMA 5I9OA 3CP0A 4R1JA 5KIXA 4S3SA 2MNAA 4MHEA 2PI2E 3U4VA 3BYYB 2NWGA 3CQZH 1I50B 4DUYL 4J1MA 2YYZA 4KK7A 2JP1A 1BF4A 2K7VA 2XWJB 1QWYA 1STYA 4PG3A 4KHPL 1GUOA 2DY7A 1SEBD 3H3VH 1RL2A 3OSOA 3S1MB 5IWAQ 2K5QA 1VQ8A 2C35B 4BY7H 2B2TA 1X6OA 1PHJA 3GTJB 4C56C 4RHSA 4IOCA 5DEHA 4XXEA 1STEA 3K5OA 3CCRA 4DF7A 3I4NH 1TWGH 3C46A 5C3XA 2AQ2B 1LTBD 3H0GB 5C6AA 1Y8NB 2KOLA 3HG9A 3LNNA 1U9RA 1I6HB 3KLRA 4XTCS 4IJLA 3FDTA 1RTNA 2LY7A 4LWCA 5A2QL 1EZ6A 2WV6D 5IYBH 4A3LH 3U9OA 5IGBA 1PTOH 1JJGA 2KVMA 1LV9A 1HJPA 5IYCH 3KF6B 4RKBA 1YJNA 1VQPA 3LGJA 4TRDA 3TP8A 2K33A 1EL0A 4CKBA 3WDNA 5C4HA 1SSOA 4KV6A 1VF5C 1I4QA 1GHJA 4A93G 1STAA 2F0DA 3DHQA 4ME3A 5FJ8H 1PH9A 3VA7A 4A3GG 1GUGA 5JJLA 4WFN3 1Q8IA 5EPKA 4IOAA 4X65Q 4NW2A 4A3DH 3MXNA 4GNXB 1N8RC 4YIJA 2JA7B 3VR2A 3HP3A 1U0LA 3EQLC 3Q6SA 2VB3X 1HA6A 1YJWA 1U5KA 1PYWD 1KAWA
chains in the Genus database with same CATH topology
4F8MA 3SEBA 2L4NA 5FO9B 1B3AA 3T4AC 2EYHA 2F0OA 2EVBA 1KDBA 4CKEA 3MAQA 4F7XA 3E6ZX 3NBHA 5DAUA 4BBSB 1XWEA 2IJ0A 2PYKA 3U9SA 5KEEA 2AQ3B 2WACA 1EY7A 5FO8B 5K36H 2E2JB 2FMMA 2WINB 1PFNA 1UAPA 5I4DA 5AFWA 4ZKCB 3I4MB 3OWEB 4RGMA 1Q3LA 1CHPD 1JE4A 2F0TA 3OWFA 1DD2A 5KYLA 1AZPA 2MHVA 3FPUB 4OO1G 4DAPA 1ZYRD 2K04A 3PUXA 1M8AA 2N88A 2EY2A 1FGBD 1GJXA 3BVZA 1CM9A 5M3MB 3MXPA 3OIQA 5K5PA 5J1ZA 4HAEA 2WP8J 3PUWA 2AWOA 5C3EB 3HOYB 2Y0SB 5I6WA 3F2UA 4FYDA 4ID6A 1VCIA 1GUSA 2VB2X 2C5CA 5EPJA 5CV7A 1LTTD 1JOKA 1M4VA 3NE5B 1S5DD 1OXTA 3NWTA 4KTAA 2XN9C 3VR3A 2ZXOA 5K36G 1O80A 3NWSA 5CBAE 3I91A 1H9RA 5CBEE 1IYVA 2MP1A 2N55A 1LABA 4QUCA 1S4ZA 3T51B 4K2KA 3BVMA 3DM1A 5T1GA 1T5EA 1MGSA 1TS5A 3VA5A 4ZYSA 5KYIA 1Q1EA 3DWQA 1T5XD 3NPPA 3S1NB 3RZDB 3ONAB 2IL8A 4NKLA 5CV8A 2B2WA 3SHLA 3NHHA 2F0EA 4M8AA 4PMBA 1FR3A 1L0YB 1EIHA 3PV0A 1RHPA 4CJ0B 2FINB 4G4KA 4IUQA 3X3NA 2AUJD 5JVH3 3SK6A 4WORA 1B2TA 1SYDA 3OPOA 5JPMC 4KKTA 3SE0A 4CBVA 1NR4A 1TKWB 3WOFA 1WVLA 3D3RA 1D2BA 3SDZA 1X3PA 2F0PA 4BA1I 2R93B 4NP5A 3V2TA 1AP0A 1SNDA 2KCNA 1WTOA 1LTGD 1HXYD 3FMCA 1QJOA 1TIID 4L6TB 1NCVA 1OO9B 1TWFB 1H9JA 1AN8A 1FD7D 4ZRZA 2KEDA 4B08A 5CC4A 1DYQA 3K59A 1O7YA 4KN7C 3A8IE 3I90A 1PZID 4KY5A 1DCZA 4HCSA 1STGA 1SXTA 2AUKA 3K7AB 5EJWA 4AYBB 4FXGC 3TDQA 3PIP3 4HSPA 3BS1A 2JA6B 1KDCA 3BDLA 3FPPA 1E2ZA 1Z6HA 2EZVA 2J0TD 4OL7A 1CZGA 1LACA 2B8FA 3D4WA 3D4RA 2B2YC 2L9HA 1KTKA 4A3FB 3V96A 4XYOA 1F77A 1E2WA 1VF7A 4A3EB 4QUFA 1DOKA 2L55A 3IKJA 4EGVA 4JK1C 1TWAB 1D6EC 3EROA 3HOXB 3H3VC 3VR4A 1IHZA 4EQOA 1TU2B 4KI0A 5BN5A 2EJGC 2F3VA 3DXJC 2R92B 2PMZB 4IUTA 4OIKA 3NQIA 5C3WA 2QDBA 5CR3A 1Y69U 3S2HB 4KY7A 5BN3A 3NBIA 2HCCA 3I8ZA 4HR7B 3K58A 1SNCA 2E2HB 1PTOC 4X3UA 2Z1CA 4I7ZC 3K0YA 3KBXA 4R8IA 1ENFA 4BY1B 3E0JA 4C1NK 5IGDA 1EEID 1CQFA 3H09A 5D65A 3HOVB 5I2YA 1QNKA 2HDMA 5D3DA 2BA0A 2EOTA 5FO7B 1AFPA 1BQQT 2R7ZB 2RQXA 4XYQA 4XT1B 2QCPX 3VYRA 5IGGA 2CHBD 4KJNA 4EQPA 2XIWA 5EQ0A 4ZLTF 1BCPB 3MFYA 2BOSA 4IUUA 2QEJC 2ZXPA 2H1EA 2F0MA 1J9OA 2B39A 2HUGA 1MSGA 1BCPD 3R2TA 1GUNA 5I2XA 1XX8A 3A8KE 4FF2A 2Z4HA 3MC0B 2CVRA 3QOJA 3H6MA 4UAIA 3KF8A 5COYA 5IOCA 1Q90A 1KDAA 4CGYB 1I4RA 2NVQB 2SEBD 2KA7A 4H7BA 2M00A 5C0XH 1IW7C 4KKSA 3GTMB 3HKZB 2C9OA 2F4IA 3T56B 1S5ED 5DM63 4KHVA 2JEBI 4PV1C 5I6YA 1RODA 2K5WA 1SBBB 1Q1BA 2M9VA 3DEOA 1EWCA 1G291 1DXMA 3D4DA 2WAQB 2K6AA 1PXUA 3KLSX 4ZUIA 2NN6G 2F0KA 2F0HA 2HQEA 1F9QA 2X6LA 5ELDA 4K8IA 1B1ZA 2D5DA 1QCBD 3IFDA 3PUZA 4B9WA 3IFTA 1V1PA 4PNYA 3T53B 3Q23A 1LT3D 1NUCA 2SDFA 4QCLA 1E0BA 2EY5A 2K28A 5D14A 1B4OA 1ILQA 2O5JC 1VDZA 2XRSD 3SK5A 3NP8A 2FFKB 2X6GA 3MFGA 1PZKD 3BYTB 4KJOA 5CV5A 1ZKOA 4LK1C 3M7NA 4K5XA 2A74C 1CK1A 2FJ2A 1LT5D 1G2TA 4QIWB 1LT4D 1E2VA 2EYOA 1TR5A 1BUVT 5C0XG 3KLSA 3QOLA 2K32A 1OXVA 3P7JA 3ERQA 3SVMA 5M9OA 1Y8OB 4F88A 3SK8A 2PCFB 3HOWB 4G7ZC 1JB3A 2F0WA 3FRPB 2ICEC 4PQXA 1SE3A 1J8IA 4PMWA 3DEPA 2BA1A 3TP7A 5C4XB 4OO1H 2F0UA 3I72A 4ZK9B 3HOUB 4N9PA 1C48A 2B2VC 1FNVA 1UUPA 1EWHA 1V1PB 2PW7A 3OIPA 3GTGB 4RH6A 2D9UA 3GQBA 3TP5A 1B9NA 1RCVD 2BCOA 3M4YA 4WRDA 1W6KA 1JWMD 2BE5D 4HMIA 1LTAD 3PIO3 1EY5A 4KKUA 1NSNS 4OO1I 2I07B 1KLUD 1CZWA 1WD1A 2JA5B 2CW0C 2AWNA 4CHTB 3HZXA 3R2IA 5M5WB 1YNJD 2J7ZA 3NXWA 3TN2A 1HQRD 2KHSA 1TY2A 3GTPB 3AMUA 2R6GA 4L8JA 3D6WA 1DM0B 2RA4A 4ZKBB 5C0XJ 3ND9A 4TSSA 2B63B 4FXDA 2Z8LA 3K57A 1BOSA 1Z47A 2NZ1D 1A2UA 4C3IB 3IL8A 1G6ZA 3KK7A 2KECA 1A6XA 5ELFA 1TS3A 3BZDB 4Q0FA 3CRLC 2QILA 3FEWX 4FO2A 4P2CB 3VR5A 4NMZA 4V190 2X69A 1Y8PB 2A6ED 2NVXB 4ZAIA 1IL8A 5A35A 3EJIA 1HRJA 3I73A 3J81E 3K5NA 1R4PB 4X3TA 1WTVA 3OHXC 1ZYRC 4IUVA 5J22A 1EY6A 4C3JB 1TQOA 2ZT9C 2Q8RE 3QIAA 1CA6A 4C3HB 3BG3A 1WTPA 3GV6A 5LHY1 2F0IA 2R61A 4XIGS 3A7AB 5CORA 2A5HA 5FOBB 1BNZA 2PZTA 3J80E 3G6JB 3GP7A 3M4OB 4IN3A 4HSVA 1HUNA 1A15A 1EOTA 1NR2A 1HUMA 1H9MA 5CMDA 3MHBA 5KNDA 1PLFA 4FF1A 5NUCA 1U4LA 3N6RA 1ET9A 3KUPA 3A54A 4G7HC 3W2DA 1PRTB 1I4PA 1ESFA 1BO0A 3S16B 3DMUA 1O78A 1AW7A 5JPNC 4K6LA 3O13A 3TBIB 1EY9A 3H94A 2TSSA 4DA2A 1PRTD 4QF4A 4BWGB 1SYCA 4ZUJA 4IZ8A 2IX3A 4LMQD 4U68A 4XQQA 2B2UC 2EPBA 3RLFA 2E2IB 2F0JA 2F0GA 2WKDA 5CV4A 2XWBB 4WJWA 1KAAA 4A93B 1I4GA 1K8OA 3LWUA 1C4QA 4A3GB 1BDOA 2JE6I 1EY8A 1GXDC 1VMCA 3V05A 3K5LA 1TVXA 3J7AF 1PRTF 4DXGA 3J81L 5EKIA 3CQZB 4U673 2HDLA 2ZXRA 5CYUA 1XXGA 4K8JA 1TS2A 4F87A 2L12A 4HCEA 4V0BA 1TS4A 1SE2A 1RDPD 3N52A 4BY7B 1SYBA 3NTHA 4IFDH 2RSNA 2NUCA 3I4NB 1TWGB 4CJ1B 3PO2B 2CQAA 4RGNA 2IPKD 3J80L 1JICA 2O2LD 4B9XA 4FXKC 1STHA 2RKSA 3DUZA 1PTOB 2EYMA 1UNSA 4UDUC 2EY1A 4IFDI 3K6OA 4A3IB 3MTSA 2MUYA 2B2WC 4H13C 4ME5A 4FF3A 1PTOD 3G7LA 1ESRA 3C1EA 4K6DA 4A3DB 4ABNA 2LMCB 3OMCA 3D31A 3RD4A 3MXGA 1EY0A 3GD7A 3TMEA 1EY4A 3ZYYX 3P75A 3LWEA 5ELEA 3C2PA 2NTTA 1S5FD 2BDNA 4IFDG 1VMPA 1YNND 2A6HD 2RSOA 1IKLA 2OEOA 4RHRA 3NTIA 2L0CA 2XRQD 1DOLA 1MD2D 3SK4A 1QB5D 1DONA 4O42A 2PQEA 2NN6H 3A8JE 4E6IA 1O7LA 5LL6S 3TZUA 1D1KA 5M3FB 1O7ZA 5DNFA 5E4XA 4DGZA 3NSWA 1HPCA 2DN8A 2RVLA 1SAPA 2KUMA 3MVVA 1EQTA 1LTID 1XYIA 2NN6I 1EYDA 4I65A 4XQJA 3CHBD 1AEXA 1SMYD 1H9SA 3GV3A 4H44C 2JXMB 2E2DC 2B2VA 1OXUA 4Q5VA 2QF7A 1PZJD 2A69C 3QG1A 2B8GA 4QB4A 1BCPC 1A3TA 3RUZA 1JOOA 1BCPF 4K5WA 2A68D 2BDOA 1R4QB 1F9RA 1ENAA 2F0VA 1G8ZD 5I9PA 3L3OC 5JOBA 1X3QA 1EZ8A 1RTOA 4DNTB 5C0XI 1QE6A 2IWHA 1HHVA 4RCOA 1TT2A 4BA2I 3M85A 4IFDJ 1HA5A 4DXFA 1XTCD 2EYLA 4Y7NB 1UEAB 4IQZA 1G2SA 2F0NA 4X3SA 1C8CA 2PW5A 1CT1D 1F9PA 2DNCA 2PZWA 3HEJA 3R93A 4RWSC 2EYJA 4K2LA 1B44D 1KNAA 5KRUA 5C44B 1HTPA 1RJTA 1EU4A 2SNSA 3E5SA 1A3UA 1FYCA 1CA5A 2MPMA 1H9SB 2TMPA 1TWHB 2F0SA 3VYTA 5JJZA 3WOEA 1CTMA 2E76C 2ICIA 4G57A 1V1OA 1K8MA 1H9KA 5TSSA 3PUYA 1Q12A 5FK9C 1ICWA 4DFAA 1KLGD 2RDGA 1I4XA 3RZOB 4L63B 5IGCA 5C4JB 4ODGA 5BN4A 2L11A 3SR1A 3J7AV 4FF4A 2D62A 4RAUC 1JR0D 2EYFA 1WD0A 3M3YB 3PUVA 1SYEA 3D6CA 4OHJA 4IALA 3AB9A 1GUTA 1LT6D 2KCCA 1QILA 1ET6A 3NK9A 3J7YW 3NQTA 2PNRC 5IGFA 3LX0A 1JORA 1ILPA 5EGTA 4G7OC 2CW0D 3P20A 2QKIC 3H91A 2J4XA 3M7GA 1DZ1A 4DN4M 2KQ3A 5IT9E 1ZXTA 2IT1A 2V4DA 1QG7A 1S5CD 2G9DA 2EYPA 5HGTA 2HCIA 3KBGA 2LKVA 1ONLA 1ZEQX 3AU7A 3S2DB 2LS01 3TP6A 3HOZB 2F3WA 5D3IB 3DWAA 2K1BA 1I6VC 4KHZA 2BE5C 2K5DA 2DY8A 2VUMB 4KMUC 5KNBA 2WIIB 2MJ8A 4EVOA 1F2ZA 5M5YB 2A73B 2B2UA 4LAAA 4MIUA 1PDQA 4K5VA 4A3MB 1G91A 2IW3A 4IUPA 5FKAC 3EFXD 4EQNA 4FP5D 4N9TA 1D5MC 3JAME 1YNJC 1F2MA 3W3AA 2EJMA 3IAYA 2F1MA 5JVG3 2OT2A 5KGUA 5CGKA 3QWNA 4CKCA 2RDFA 1JCKB 2B2TC 3OOCA 1BXTA 3URYA 2WB1B 2ID0A 3C1FA 4O1NA 2I46A 3S15B 4C1NI 1EIGA 1X32A 4M1UB 4A3JB 4HN7A 4R9WA 1SNQA 2FMCA 1QNUA 1SYGA 1SE4A 5EBDA 1OXXK 1V43A 1IYUA 1JOQA 1Y1VB 1DJRD 1A3VA 2A6EC 2NYZD 4RGTA 4ZQ3A 2K03A 2PZUA 4XQNA 2NTSA 4RKLA 1PFMA 2B2YA 3A56A 3Q22A 3Q0AA 3I4LA 2M2LA 4GZYC 2E75C 3PO3B 1A2TA 4X3KA 5CV6A 4A3KB 2O4XA 4Z9CB 1SFOB 3S17B 2L1BA 1SNMA 5IT9L 2EE1A 5IODA 4ULLA 1B50A 5CV9A 4XDXA 3D8GA 3RMHA 1WTQA 1B9MA 2YU9B 2H4OA 1TY0A 4DAYA 2IX0A 5E1FA 4PMCA 3MZ5A 2PPBC 1STBA 3L9AX 1MBYA 1I3QB 4DAVA 2NVYB 3S1QB 4TQUS 3BDCA 3S9WA 4MN3A 4KD3A 3GTOB 4TKOB 2GA4B 3EA6A 4RA8A 1L0XB 4DU9A 4BS9A 1MSHA 2OXPA 3MA2B 1ENCA 3R8BA 4QMGA 4CJ2C 1IKMA 3JAML 1II3A 2KEEA 4DK0A 2SOBA 3L7ZC 3T13A 1D1IA 3VYSA 3I70A 2VXWA 5IIFA 3A7LA 4HTHA 2FHTA 1PRTC 3A55A 3MWYW 1R9TB 2Q8IB 1JC7A 1Y1WB 1SNOA 5EKKA 4J6HA 2F0QA 3SXHA 2IX1A 3ND8A 1RKNA 4OGQC 5JEAH 1EQVA 2K05A 4KY6A 5C5MA 1F9SA 3DWPA 1STNA 1SJHD 2E74C 3MEHA 2NVTB 2K01A 1EFID 5E3FA 1KNEA 3Q24A 1U4MA 5LL6X 1GUWA 4RGOS 2MGSA 3TSSA 3OW7A 3S14B 3GTQB 4A3BB 4RFBA 3ITPA 1LO5D 1D5XC 2O5IC 2JA8B 3HGBA 4KN4C 4R8NA 1KABA 5G3LD 5T1IA 2Q8TA 4K14A 3X3MA 1PFBA 4FNFA 3CRKC 1HFNA 5E4WC 1SNPA 1W6JA 2F03A 2L5TA 1TWCB 1V8QA 1BBXC 1S5BD 1U4RA 5DM73 1JWSD 1LTRD 3FKIB 1PMRA 1HTLD 3HRZC 5ELBA 5F2DA 1SYFA 1WTRA 2VNUD 3PMFA 3CU7A 4KD4A 1K83B 1I4HA 4ILWA 2RBMA 3UI2A 2LFNA 2WKCA 2F0FA 3OMGA 1NAPA 1HQMC 5JEAG 1WTXA 3S1RB 2AQ1B 5FLXE 3FVQA 5G3LF 4RCNA 5C5LA 1EYAA 3EVQA 4NDXA 2EDGA 2XVSA 4DNRB 4C2MB 2NB0A 1CQVA 1RF2D 1FNUA 1PTOF 3TZDA 1GOZA 1AZQA 1EEFD 1SDFA 4OIJA 3GTKB 2ENBA 5EBCA 2XSCA 1EU3A 4BBRB 1B53A 2KJXA 2G9HD 3K5MA 5IGEA 2XNAC 3NUCA 4DK1A 5M5XB 4HEDA 1BR9A 4H0LC 4HMJA 1WTWA 1YNNC 3QJYA 4LJZC 2A6HC 3VR6A 3QB3A 1ML0D 1U4PA 2D2CC 4IURA 5HURA 1LTSD 3MXUA 1SJED 5A2QE 1IW7D 2PO4A 2DNEA 1HCZA 2A69D 5JAVA 5KNCA 4C3IG 5J39A 1CI3M 1HFGA 3QO2A 1F2LA 2R3ZA 1JQYD 3I3CA 3HS0C 3P1HA 1MI2A 3BDOA 4FVMA 2EY6A 1D5ZC 1Z7TA 3BVGA 2JSOA 2F0LA 1EYCA 5EKLA 3C3LA 4IUNA 5ISRA 1F2YA 1CFMA 4XT3B 1GHKA 2Z4IA 1SMYC 2NBFA 5JEAJ 4J8QA 3GO5A 1CHQD 3NTKA 1QOHA 4C3JG 2OF1A 1FNWA 3GTLB 1LLRD 2JEAI 4C3HG 5C4ZA 3CKIB 4JBWA 3VYUA 2JYOA 3T16A 5FLXL 2SNMA 2A68C 1OXSC 2EJFC 2RDHA 2EXZA 1RD9D 3R3OA 5ELCA 5EPLA 1WCMB 1JWUD 1DOMA 5I9OA 5KIXA 4S3SA 4MHEA 3BYYB 2NWGA 1I50B 4J1MA 2YYZA 4KK7A 2JP1A 1BF4A 2K7VA 2XWJB 1QWYA 1STYA 1GUOA 2DY7A 1SEBD 3OSOA 3S1MB 2K5QA 2B2TA 3GTJB 4C56C 4RHSA 5DEHA 4XXEA 1STEA 3K5OA 4DF7A 3C46A 5C3XA 2AQ2B 1LTBD 3H0GB 5C6AA 1Y8NB 2KOLA 3HG9A 3LNNA 1U9RA 1I6HB 3KLRA 4XTCS 3FDTA 1RTNA 2LY7A 5A2QL 1EZ6A 2WV6D 3U9OA 5IGBA 1PTOH 2KVMA 1LV9A 4RKBA 4TRDA 3TP8A 2K33A 1EL0A 4CKBA 3WDNA 5C4HA 1SSOA 4KV6A 1VF5C 1I4QA 1GHJA 1STAA 2F0DA 3DHQA 3VA7A 1GUGA 4WFN3 1Q8IA 5EPKA 4NW2A 3MXNA 4YIJA 2JA7B 3VR2A 3HP3A 3Q6SA 3EQLC 2VB3X 1HA6A 1PYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8M A;  1EYD A;  1SNM A;  2F0S A;  4KTA A;  4QF4 A;  4I65 A;  1SYC A;  2EXZ A;  3EJI A;  1AEX A;  4KHV A;  4ZUJ A;  3TP7 A;  5IGE A;  4G57 A;  4EVO A;  4IZ8 A;  3NUC A;  4ME5 A;  5IOD A;  3R3O A;  5I6Y A;  2EYH A;  1F2Z A;  2F0U A;  2F0O A;  4HMJ A;  5CV9 A;  3ITP A;  3D8G A;  3C1E A;  4K6D A;  2F0J A;  3D4D A;  1KDB A;  4LAA A;  4MIU A;  4DFA A;  5I9O A;  4F7X A;  4K5V A;  4K2K A;  4N9P A;  2F0G A;  5KIX A;  4R8N A;  4ZUI A;  4S3S A;  5IGD A;  5CV4 A;  2F0K A;  5CC4 A;  3OMC A;  5DAU A;  1KAA A;  2F0H A;  5E1F A;  4EQN A;  1KAB A;  4N9T A;  2PYK A;  3QB3 A;  4PMC A;  2PW7 A;  4K14 A;  3MZ5 A;  2HQE A;  5IGC A;  4ODG A;  5KEE A;  4KY5 A;  5HUR A;  4K8I A;  1F2M A;  4J1M A;  4QB4 A;  3VA5 A;  3SR1 A;  5KYI A;  1A3T A;  2WAC A;  3RUZ A;  3TP5 A;  5J22 A;  1SNP A;  1EY7 A;  1JOO A;  1STB A;  1STG A;  4B9W A;  1EY0 A;  1STY A;  4PNY A;  1NUC A;  3TME A;  2EYF A;  1EY6 A;  5JAV A;  4NKL A;  5CV8 A;  4K5W A;  5J39 A;  5KGU A;  3SHL A;  1TQO A;  1SYE A;  1EY8 A;  3D6C A;  3OSO A;  4WRD A;  5CGK A;  4HMI A;  5IGG A;  3NHH A;  2EY5 A;  1EY4 A;  2RDF A;  4KJN A;  1ENA A;  3BDC A;  3P75 A;  3S9W A;  4KD3 A;  2F0E A;  1KDC A;  2F0V A;  3BDL A;  4IAL A;  4EQP A;  1EY5 A;  5DEH A;  5I9P A;  3SK5 A;  1NSN S;  4PMB A;  2F0I A;  3C1F A;  3NP8 A;  5F2D A;  4DU9 A;  3P1H A;  4DF7 A;  1SYF A;  5C3X A;  5JOB A;  5C6A A;  1EZ8 A;  4KJO A;  2PZT A;  2OXP A;  2F0T A;  4OL7 A;  1ENC A;  3NK9 A;  3OWF A;  5CV5 A;  2EY6 A;  5KYL A;  4QMG A;  1U9R A;  3D4W A;  3PMF A;  4KD4 A;  1SNQ A;  2F0M A;  2OEO A;  3NQT A;  1TT2 A;  2F0L A;  1EYC A;  4K5X A;  3HZX A;  4K8J A;  3LX0 A;  5EKL A;  1II3 A;  5IGF A;  1JOR A;  1SYG A;  2RBM A;  1EZ6 A;  2F0F A;  2SOB A;  3OMG A;  5EGT A;  2EYL A;  3T13 A;  3SK4 A;  3U9O A;  4IUN A;  3NXW A;  1JOQ A;  2EYO A;  1TR5 A;  5IIF A;  5IGB A;  3SK6 A;  2F0N A;  4WOR A;  5ISR A;  1SYB A;  3ERO A;  4HTH A;  1F2Y A;  2PW5 A;  2KHS A;  2PQE A;  5C5L A;  1A3V A;  1EYA A;  1SYD A;  2EY2 A;  2KQ3 A;  3EVQ A;  3QOL A;  1IHZ A;  4RKB A;  4EQO A;  4TRD A;  2PZW A;  3TP8 A;  2NUC A;  3HEJ A;  3MHB A;  4NDX A;  5C4H A;  3ERQ A;  4E6I A;  4KV6 A;  3QOJ A;  3H6M A;  1STA A;  2F0D A;  1SNO A;  3MXP A;  4ZQ3 A;  2EYJ A;  2PZU A;  4K2L A;  2F3V A;  5EKK A;  5NUC A;  5K5P A;  5J1Z A;  3DHQ A;  4J6H A;  4RKL A;  5IOC A;  1KDA A;  5M9O A;  2F0Q A;  3SXH A;  5KRU A;  1RKN A;  5C3W A;  2OF1 A;  1A2U A;  3SK8 A;  2QDB A;  5I6W A;  5CR3 A;  1EQV A;  4DGZ A;  4B9X A;  2F0P A;  4KY6 A;  2EYP A;  5HGT A;  4KY7 A;  4H7B A;  2M00 A;  1A2T A;  1STH A;  5C5M A;  2RKS A;  4ID6 A;  4NP5 A;  5C4Z A;  1STN A;  2SNS A;  3MEH A;  3V2T A;  2LKV A;  3E5S A;  4YIJ A;  2F0W A;  5E3F A;  1A3U A;  1SND A;  3DMU A;  5CV6 A;  2ENB A;  3TP6 A;  2EYM A;  2O4X A;  3MVV A;  5CV7 A;  3T16 A;  2F3W A;  1JOK A;  2SNM A;  1SNC A;  4NMZ A;  2EY1 A;  1EY9 A; 
#chains in the Genus database with same CATH topology
 4F8M A;  3SEB A;  4MTK A;  2L4N A;  5FO9 B;  1B3A A;  1Y14 B;  2CCZ A;  1MJE A;  2CFM A;  3T4A C;  2EYH A;  1M1K C;  2F0O A;  1L2F A;  1N36 L;  2EVB A;  2JQO A;  4BY7 G;  1KDB A;  4CKE A;  3MAQ A;  4F7X A;  3B6Y A;  2VQF Q;  3E6Z X;  1E3P A;  4CDF C;  3NBH A;  5DAU A;  5HGQ A;  4BBS B;  1XWE A;  1JT8 A;  1D7Q A;  4EQ5 A;  2IJ0 A;  2KCT A;  2PYK A;  3I4N G;  2A19 A;  3U9S A;  5KEE A;  1NY4 A;  4DUZ Q;  2Z9H A;  2AQ3 B;  4JCV E;  3PO2 G;  2WAC A;  1EY7 A;  5FO8 B;  5K36 H;  2E2J B;  2FMM A;  4YWK A;  2UUB L;  2WIN B;  2CKZ B;  1ICF B;  1PFN A;  2G5D A;  1UAP A;  4L5Q A;  5IYB G;  5I4D A;  5AFW A;  4A3L G;  2NZO A;  4ZKC B;  3I4M B;  4R4O A;  3OWE B;  5IYC G;  2RCN A;  4RGM A;  1Q3L A;  1CHP D;  1JE4 A;  1KXL A;  4HJ8 A;  4AIM A;  2F0T A;  3OWF A;  1DD2 A;  5KYL A;  1VS0 A;  4A3I G;  1AZP A;  2K5N A;  2MHV A;  3FPU B;  2EXD A;  5FJ8 G;  5M3F H;  1X55 A;  4OO1 G;  4AH6 A;  4DAP A;  1ZYR D;  2K04 A;  4B3M Q;  3PUX A;  3AEV A;  1M8A A;  4A3D G;  2N88 A;  1XMO L;  2OTL A;  2EY2 A;  1FGB D;  2DGY A;  3ULL A;  1W3S A;  1YIT A;  1GJX A;  3BVZ A;  1MJC A;  1CM9 A;  5M3M B;  3MXP A;  1UWV A;  3OIQ A;  5K5P A;  5J1Z A;  4HAE A;  2WP8 J;  3PUW A;  4LF9 Q;  2AWO A;  5C3E B;  3HOY B;  3MXN B;  2Y0S B;  4POG A;  5I6W A;  3F2U A;  4X62 L;  4FYD A;  4ID6 A;  1VCI A;  1GUS A;  2VB2 X;  3VDY A;  3EN2 A;  4QGU A;  2C5C A;  5EPJ A;  5CV7 A;  3PQI A;  1LTT D;  1JOK A;  2UXC L;  4DV5 Q;  1M4V A;  3KFU A;  4JG2 A;  3NE5 B;  1S5D D;  1OXT A;  1BBW A;  3NWT A;  2HQL A;  2XN9 C;  4KTA A;  3VR3 A;  1KL9 A;  2ZXO A;  5K36 G;  1O80 A;  3NWS A;  5CBA E;  3I91 A;  2PMZ E;  4R4Q A;  1H9R A;  5CBE E;  2E5L Q;  1IYV A;  2MP1 A;  1VQM A;  2N55 A;  1E1O A;  3NBH B;  1H95 A;  1LAB A;  4QUC A;  1S4Z A;  4DV7 L;  3T51 B;  4K2K A;  3BVM A;  2OQ0 A;  3DM1 A;  5T1G A;  3H15 A;  1VQA A;  1T5E A;  1MGS A;  3OTO L;  4JI4 Q;  1TS5 A;  4LFB L;  4P75 A;  3VA5 A;  4ZYS A;  5KYI A;  1XPO A;  1Q1E A;  1NJI C;  3DWQ A;  1T5X D;  3NPP A;  3S1N B;  3RZD B;  3ONA B;  2IL8 A;  4NKL A;  2D0O A;  5CV8 A;  2B2W A;  4Y7N H;  5M3F G;  2QA4 A;  3AQQ A;  3SHL A;  2ZJP A;  1YBY A;  2OQK A;  3NHH A;  5LMU Q;  4DR6 Q;  4GN5 A;  2F0E A;  4M8A A;  1G6P A;  4PMB A;  1XPU A;  1FR3 A;  1Q7Y C;  1L0Y B;  1EIH A;  3PV0 A;  1RHP A;  4CJ0 B;  2FIN B;  3SGI A;  4BXX H;  4G4K A;  3AFQ A;  3I56 A;  5C44 H;  4IUQ A;  3NEN A;  3X3N A;  4ALP A;  2AUJ D;  4NB3 A;  4GOP A;  2BH8 A;  5JVH 3;  3SK6 A;  4WOR A;  1WYD A;  1QUQ A;  1B2T A;  1SYD A;  1I94 L;  5AJ3 L;  3OPO A;  5JPM C;  4YHH L;  2B3G A;  4KKT A;  3SE0 A;  1TWH H;  2ZTC A;  4CBV A;  1NR4 A;  3JAM i;  1TKW B;  3WOF A;  1WVL A;  1VQJ A;  3D3R A;  1D2B A;  3SDZ A;  1X3P A;  5FLM H;  1B8A A;  1PVO A;  2RF4 A;  2F0P A;  3BJU A;  3PF5 A;  1N34 Q;  4BA1 I;  2ZM6 Q;  1IBM Q;  2R93 B;  4NP5 A;  3V2T A;  1PH6 A;  3RZO H;  4DR4 L;  1AP0 A;  1PH3 A;  2R7F A;  1VQH A;  1SND A;  2KCN A;  1WTO A;  1LTG D;  1HXY D;  1N32 L;  3J81 i;  3FMC A;  1QJO A;  5J3B A;  1TII D;  1VQF A;  4L6T B;  1NCV A;  3M3Y H;  1L0W A;  5C4X H;  4L5R C;  1OO9 B;  1X9N A;  1TWF B;  1C7Y A;  1H9J A;  1AN8 A;  1FD7 D;  4LF5 L;  1HR0 Q;  4ZRZ A;  1XPR A;  2KED A;  4B08 A;  4NXN L;  5CC4 A;  1DYQ A;  3K59 A;  4GLV B;  1O7Y A;  4KN7 C;  4O0A A;  3A8I E;  1CUK A;  3I90 A;  1PZI D;  4KY5 A;  3KOJ A;  1DCZ A;  4HCS A;  4BXX G;  1STG A;  1SXT A;  2AUK A;  3K7A B;  5EJW A;  4AYB B;  4FXG C;  3TDQ A;  5L37 A;  3PIP 3;  4HSP A;  5IWA L;  3BS1 A;  2Q2U A;  1KDC A;  2JA6 B;  3BDL A;  3FPP A;  4H02 A;  1E2Z A;  2E8G A;  2WAQ E;  2K50 A;  1Z6H A;  2ZJR A;  2EZV A;  2J0T D;  5BR8 Q;  4DKA C;  4OL7 A;  1CZG A;  3BZK A;  1LAC A;  2B8F A;  3D4W A;  4GOP B;  3D4R A;  4JW0 A;  1PYB A;  2B2Y C;  2L9H A;  1KTK A;  4A3F B;  3V96 A;  4XYO A;  1F77 A;  1E2W A;  1VF7 A;  5M5W H;  4A3E B;  4QUF A;  1QUQ B;  1KC8 C;  1DOK A;  5FLM G;  2L55 A;  3IKJ A;  4EGV A;  4PZ8 A;  4JK1 C;  1TWA B;  1D6E C;  3ERO A;  3S2D H;  1SR3 A;  1X3E A;  3HOX B;  3H3V C;  3VR4 A;  3HOZ H;  1IHZ A;  4EQO A;  4AQY Q;  1TU2 B;  1E22 A;  4KI0 A;  2VQE Q;  3F2B A;  1T9H A;  2QGQ A;  5BN5 A;  1VQE A;  4DR2 Q;  2EJG C;  2F3V A;  3DXJ C;  2R92 B;  2PMZ B;  3KJO A;  4IUT A;  4OIK A;  3NQI A;  1N33 Q;  5M5Y H;  5C3W A;  4C3I H;  3CME A;  2KHI A;  2QDB A;  5CR3 A;  1Y69 U;  3S2H B;  2EQS A;  4KY7 A;  5BN3 A;  1PH5 A;  3NBI A;  4A3M H;  4X65 L;  2HCC A;  3I8Z A;  1X56 A;  4HR7 B;  4CDD C;  3J7Z C;  3UDX A;  3K58 A;  1X3G A;  1A62 A;  1Q46 A;  1SNC A;  2E2H B;  3CC7 A;  1PTO C;  4X3U A;  3RR5 A;  5IP9 H;  4JOI C;  3NEM A;  4DK3 C;  2Z1C A;  4I7Z C;  2JJQ A;  3K0Y A;  3KBX A;  4R8I A;  1ENF A;  2Z0S A;  4BY1 B;  3E0J A;  4C1N K;  4LNQ A;  5IGD A;  4K0K L;  1EEI D;  1CQF A;  4LUO A;  3H09 A;  3S15 H;  5D65 A;  3HOV B;  2I5M X;  5I2Y A;  1QNK A;  4A3J H;  2HDM A;  5D3D A;  2BA0 A;  4DUZ L;  4NXM L;  2EOT A;  3K81 C;  5FO7 B;  1AFP A;  5IY0 A;  1BQQ T;  2R7Z B;  2RQX A;  3CC2 A;  4DV6 L;  4XYQ A;  1Z9F A;  4XT1 B;  2QCP X;  3VYR A;  5IGG A;  1Y1V H;  2CHB D;  3ULJ A;  4KJN A;  1PH1 A;  4EQP A;  1QZG A;  2XIW A;  5EQ0 A;  4ZLT F;  1BCP B;  3MFY A;  3HOZ G;  2BOS A;  2VW9 A;  4IUU A;  2YTV A;  2QEJ C;  2ZXP A;  2VUM G;  2H1E A;  1JMC A;  2F0M A;  1J9O A;  2B39 A;  2P5Z X;  5LMN Q;  2HUG A;  1MSG A;  2L15 A;  1BCP D;  1FGU A;  3Q8D A;  3R2T A;  4R4T A;  1GUN A;  2YTY A;  5I2X A;  1VQ5 A;  1P16 A;  4A3M G;  1XX8 A;  3A8K E;  4FF2 A;  1YHA A;  2Z4H A;  4A3K H;  4DR7 Q;  3MC0 B;  1SFO H;  1E1T A;  3S17 H;  1JJ2 A;  2CVR A;  3QOJ A;  3H6M A;  4UAI A;  1HZC A;  2GN5 A;  3KF8 A;  5COY A;  4MNO A;  5IOC A;  1Q90 A;  1KDA A;  4QY7 A;  4CGY B;  5IP9 G;  1I4R A;  4LF9 L;  3T1Y Q;  2NVQ B;  2SEB D;  1SE8 A;  2KA7 A;  2M00 A;  4H7B A;  5C0X H;  2YU9 H;  1X3F A;  2WB1 G;  1IW7 C;  4KKS A;  3GTM B;  3HKZ B;  2C9O A;  1FL0 A;  2F4I A;  1YZ6 A;  4A3J G;  4DV5 L;  3KF6 A;  3A0J A;  3T56 B;  1S5E D;  5DM6 3;  1I3Q H;  2JEB I;  4KHV A;  4PV1 C;  5FLX c;  2NVY H;  5I6Y A;  3S1Q H;  1LYL A;  1ROD A;  2K5W A;  1SBB B;  1Q1B A;  2E5L L;  1JJC B;  2M9V A;  3DEO A;  1EWC A;  3GTO H;  1G29 1;  1DXM A;  1Y1V G;  3D4D A;  2WAQ B;  2K6A A;  1PXU A;  3KLS X;  4ZUI A;  2NN6 G;  2F0K A;  2F0H A;  4LF4 L;  2VL6 A;  2HQE A;  1F9Q A;  3KLW A;  2X6L A;  5ELD A;  4JI4 L;  4K8I A;  1B1Z A;  2D5D A;  1QCB D;  4GLA C;  3IFD A;  3PUZ A;  4B9W A;  3IFT A;  1V1P A;  4PNY A;  3T53 B;  3Q23 A;  1LT3 D;  1NUC A;  2SDF A;  2CH4 A;  1KHI A;  1Q8K A;  4QCL A;  1E0B A;  1K0R A;  2K4K A;  2EY5 A;  3PO3 G;  1VQG A;  2K28 A;  5LMU L;  2UUC Q;  5D14 A;  1B4O A;  1ILQ A;  2O5J C;  1VDZ A;  2XRS D;  3SK5 A;  1S40 A;  3NP8 A;  1R9T H;  2WB1 E;  4A3K G;  2FFK B;  4X64 L;  2X6G A;  3MFG A;  1PZK D;  1Y1W H;  3BYT B;  4KJO A;  3I2Z A;  5CV5 A;  1ZKO A;  4LK1 C;  4JI7 Q;  3M7N A;  4K5X A;  2A74 C;  2LXK A;  1CK1 A;  1XJV A;  2FJ2 A;  1LT5 D;  5ELN A;  1G2T A;  4QIW B;  1LT4 D;  1E2V A;  4KLK A;  2EYO A;  1TR5 A;  1BUV T;  5C0X G;  2KEN A;  3KLS A;  3QOL A;  2K32 A;  3KF8 B;  1OXV A;  3P7J A;  3ERQ A;  3ICE A;  2DUD A;  3PO2 H;  3SVM A;  4B3R Q;  4LFA L;  5M9O A;  1WJJ A;  1Y8O B;  4A3B H;  4QL5 A;  1NMF A;  4F88 A;  3M9B A;  1WI5 A;  3SK8 A;  2DJF C;  1D8L A;  2PCF B;  3HOW B;  2OCE A;  2RCF A;  2JA8 H;  4G7Z C;  2ZM6 L;  1JB3 A;  2F0W A;  3H3V I;  3FRP B;  2ICE C;  4PQX A;  1SE3 A;  1AH9 A;  4X6A H;  4A3I H;  1Q86 C;  1J8I A;  4PMW A;  3DEP A;  2BA1 A;  4OX9 Q;  3TP7 A;  4JI0 L;  1I5F A;  5C4X B;  4OO1 H;  2F0U A;  1VQN A;  3FKI H;  3I72 A;  2Q2T A;  4ZK9 B;  1HR0 L;  3HOU B;  1HNW Q;  5GAG C;  1E7Z A;  4N9P A;  1C48 A;  2B2V C;  4DK6 C;  1FNV A;  1UUP A;  1EWH A;  2K14 A;  1V1P B;  1J5E Q;  2PW7 A;  3OIP A;  3GTG B;  4RH6 A;  2PI2 A;  1Y1W G;  2D9U A;  1B70 B;  1K83 H;  3GQB A;  3TP5 A;  1B9N A;  4I7A A;  3KDF A;  1RCV D;  2BCO A;  1VQD A;  3M4Y A;  4LUZ A;  4WRD A;  3S1R H;  1W6K A;  1JWM D;  2BE5 D;  4HMI A;  1XMQ L;  3D0F A;  4B3S L;  1LTA D;  3PIO 3;  1EY5 A;  1SRO A;  4KKU A;  1NSN S;  4JI8 Q;  4OO1 I;  1NBW A;  3RN5 A;  1YI2 A;  2Q2H A;  4IPH A;  4DR3 Q;  2I07 B;  3T1H Q;  2Q2I A;  1KLU D;  4C2M H;  2N8N A;  1CZW A;  1WD1 A;  2JA5 B;  3PF4 A;  2CW0 C;  2AWN A;  3CCV A;  4CHT B;  3HZX A;  4A3B G;  1HZA A;  5JJK A;  3R2I A;  1VQC A;  5M5W B;  1YNJ D;  2J7Z A;  3OW2 A;  3NXW A;  3TN2 A;  2JA8 G;  1IYJ B;  2N49 A;  1HQR D;  1JE5 A;  1L1O C;  2YTX A;  2KHS A;  1TY2 A;  3GTK H;  1UE7 A;  3GTP B;  3AMU A;  4HJA A;  2R6G A;  4L8J A;  4AQY L;  1PH7 A;  2VQE L;  3D6W A;  1DM0 B;  2HIX A;  1EYG A;  1S3O A;  2RA4 A;  4ZKB B;  5C0X J;  3ND9 A;  4TSS A;  4DR2 L;  4B3T Q;  2B63 B;  4FXD A;  2Z8L A;  4A4I A;  3K57 A;  5M5X H;  1BOS A;  1Z47 A;  2JN4 A;  2NZ1 D;  3DLL A;  1VQK A;  1A2U A;  4C3I B;  3IL8 A;  3FKI G;  1G6Z A;  3KK7 A;  2KEC A;  1A6X A;  5ELF A;  1TS3 A;  3BZD B;  4Q0F A;  4P72 A;  3CRL C;  2QIL A;  3CCS A;  3FEW X;  4FO2 A;  2GVB A;  4P2C B;  3TRE A;  4DAM A;  3VR5 A;  4NMZ A;  4V19 0;  2X69 A;  1Y8P B;  3M4Q A;  2ZTD A;  2A6E D;  2NVX B;  4ZAI A;  1IL8 A;  5A35 A;  3EJI A;  3F8T A;  2PQA A;  4LF7 Q;  1HRJ A;  4YY3 Q;  3I73 A;  1IBK Q;  4DV4 Q;  1X65 A;  3J81 E;  3K5N A;  4JBK A;  3U58 A;  1R4P B;  4X3T A;  1UE1 A;  3KDF B;  4IPC A;  1WTV A;  1V9P A;  3OHX C;  2NZH A;  1ZYR C;  4IUV A;  1KD1 C;  5J22 A;  4O2D A;  4LF8 Q;  1EY6 A;  4X66 L;  4C3J B;  1VQL A;  4N8F A;  1HNX Q;  3K7U C;  1TQO A;  2ZT9 C;  4RG1 A;  2Q8R E;  3QIA A;  4BY1 G;  1HNZ Q;  1CA6 A;  4C3H B;  3BG3 A;  1WTP A;  3GV6 A;  5LHY 1;  2F0I A;  2R61 A;  4XIG S;  1PH8 A;  3A7A B;  3G4S A;  5COR A;  2A5H A;  5FOB B;  2GVA A;  1BNZ A;  2PZT A;  1LUZ A;  4BBR G;  5JJI A;  3J80 E;  3G6J B;  1A63 A;  3GP7 A;  3FP9 A;  4L5S A;  3M4O B;  4HIO A;  4IN3 A;  5LMN L;  3GTL H;  4HSV A;  1HUN A;  1A15 A;  1EOT A;  1NR2 A;  3L0O A;  1HUM A;  3ULP A;  1H9M A;  5CMD A;  4GN3 B;  2UXB Q;  3MHB A;  5KND A;  3TQY A;  1PLF A;  3CCU A;  4FF1 A;  5NUC A;  3TS2 A;  3PGZ A;  1U4L A;  3PIP A;  3N6R A;  3CXC A;  1ET9 A;  3QR8 A;  1SN8 A;  3T1Y L;  3KUP A;  3A54 A;  1WCM H;  4G7H C;  3W2D A;  1PRT B;  1I4P A;  1ESF A;  4LF6 Q;  4DV2 Q;  1BO0 A;  1O7I A;  1K3B C;  1NTG A;  1YIJ A;  3S16 B;  3DMU A;  4DV0 Q;  1O78 A;  1AW7 A;  1I50 H;  5JPN C;  4JBM A;  4K6L A;  3O13 A;  3TBI B;  4A3C H;  4FDB A;  1EY9 A;  2PQA B;  3H94 A;  2TSS A;  4DA2 A;  4LW1 A;  4KHP Q;  1PRT D;  4DV3 Q;  4QF4 A;  4BWG B;  1SYC A;  4ZUJ A;  2I0Q A;  4IZ8 A;  4JOI A;  2IX3 A;  3S1M H;  4LMQ D;  3IRB A;  4U68 A;  1XNR Q;  4YCU A;  2B2U C;  3RLF A;  2EPB A;  4XQQ A;  3GTJ H;  2E2I B;  2F0J A;  1PFS A;  1A8V A;  2F0G A;  2WKD A;  2KHJ A;  4OEM B;  5CV4 A;  2XWB B;  4WJW A;  4OXP A;  3CW2 C;  1KAA A;  3H0G H;  2HHH Q;  5C4J H;  4POF A;  4A93 B;  1I4G A;  1I6H H;  4QJF A;  1K8O A;  4P74 A;  4UPA A;  3LWU A;  1QVG A;  1C4Q A;  4A3G B;  1BDO A;  1UE5 A;  2JE6 I;  1EY8 A;  1GXD C;  4J15 A;  1VMC A;  3RLO A;  2HIV A;  1KIX A;  1PH2 A;  3V05 A;  3K5L A;  3CPW A;  1TVX A;  1HZ9 A;  3J7A F;  2WFW A;  1PRT F;  4DXG A;  3J81 L;  5EKI A;  3CQZ B;  3HFZ B;  4U67 3;  3STB C;  1YNX A;  2HDL A;  2ZXR A;  2MQH A;  1K0S A;  5CYU A;  3F1Z A;  1NMG A;  2I5H A;  1XXG A;  4JI7 L;  4K8J A;  1TS2 A;  4F87 A;  2L12 A;  4HCE A;  4V0B A;  1TS4 A;  1SE2 A;  1RDP D;  1WCM G;  3N52 A;  4BY7 B;  1SYB A;  3NTH A;  1GO3 E;  2JA7 H;  4IFD H;  2RSN A;  4JI6 Q;  2NUC A;  1BKB A;  3I4N B;  1TWG B;  4CJ1 B;  4A3C G;  4JI1 Q;  3U4Z A;  3PO2 B;  4JI5 Q;  4TVA B;  4B3R L;  1IL2 A;  1FJG Q;  2CQA A;  4RGN A;  2IPK D;  3J80 L;  2ES2 A;  1JIC A;  2O2L D;  4B9X A;  4FXK C;  1XTD A;  5IP7 H;  1CKN A;  1STH A;  2RKS A;  3DUZ A;  2VY3 A;  1PTO B;  2EYM A;  1UNS A;  3H0G G;  2AMC B;  1K3R A;  4UDU C;  2EY1 A;  4IFD I;  3K6O A;  2VUM H;  2E2J H;  4A3I B;  3MTS A;  2MUY A;  2B2W C;  4H13 C;  4OX9 L;  4ME5 A;  1OTC A;  4HJ5 A;  4FF3 A;  3UDG A;  1PTO D;  4P71 A;  3G7L A;  3KJP A;  1ESR A;  3C1E A;  4K6D A;  4YWL A;  3I4M H;  3BU2 A;  4A3D B;  1HNW L;  4ABN A;  4P73 A;  4GS3 A;  2LMC B;  3OMC A;  3D31 A;  1HZB A;  1IBL Q;  3RD4 A;  1J5E L;  1EIF A;  1YEZ A;  5IE8 A;  3MXG A;  1EY0 A;  1GVP A;  3GD7 A;  3TME A;  1AE2 A;  3KYH C;  1M90 C;  4GOP C;  1FVI A;  1ASZ A;  3PSI A;  4PZ6 A;  1EY4 A;  3ZYY X;  1EOV A;  1PYS B;  3P75 A;  3LWE A;  5ELE A;  3C2P A;  1GM5 A;  3I55 A;  1GKH A;  2NTT A;  1S5F D;  2JA7 G;  4JI8 L;  2BDN A;  2VQF L;  4IFD G;  1VMP A;  2D0P A;  4DR3 L;  2A1A A;  1YNN D;  5M3M H;  2A6H D;  2K5V A;  2RSO A;  1IKL A;  2OEO A;  4RHR A;  1VQ9 A;  5C3E H;  2RHQ B;  3NTI A;  2Z6B A;  3HOY H;  1EIY B;  2L0C A;  5GAD C;  4X62 Q;  2XRQ D;  1DOL A;  1MD2 D;  3SK4 A;  1QB5 D;  5IP7 G;  4O42 A;  4OWX B;  1DON A;  2RHS B;  4DR5 Q;  2PQE A;  2NN6 H;  4JYA Q;  4BBS G;  3CD6 A;  1VQ6 A;  3AYH B;  1EWI A;  3A8J E;  4E6I A;  1O7L A;  2ZTE A;  4B3T L;  5LL6 S;  3TZU A;  3J81 j;  1CKN B;  4GKK Q;  1D1K A;  5M3F B;  1O7Z A;  5DNF A;  5E4X A;  4DGZ A;  2KCM A;  3PO3 H;  3NSW A;  1HPC A;  2DN8 A;  2RVL A;  1VQ7 A;  1SAP A;  4B3M L;  3I4M G;  2F52 A;  3G48 A;  2KUM A;  3MVV A;  1EQT A;  1LTI D;  1XYI A;  2NN6 I;  1EYD A;  3S1N H;  3RZD H;  4I65 A;  4XQJ A;  3CHB D;  1AEX A;  1SMY D;  1H9S A;  3RN2 A;  3GV3 A;  4H44 C;  2QEX A;  2JXM B;  4NPS A;  4LF7 L;  4YY3 L;  3TS0 A;  2E2D C;  2AKW B;  4DR1 Q;  2B2V A;  1OXU A;  4DV4 L;  1IBK L;  5HY6 A;  4GKJ Q;  4OEL B;  3EIV A;  3CPF A;  4Q5V A;  2QF7 A;  1PZJ D;  2A69 C;  3QG1 A;  2HD3 A;  5M3M G;  2B8G A;  4QB4 A;  1BCP C;  3TRZ A;  1A3T A;  3RUZ A;  4HIM A;  1JOO A;  1YHB A;  1S72 A;  1BCP F;  5C3E G;  3HOY G;  4K5W A;  2Y0S G;  1EQR A;  2BDO A;  2A68 D;  3ER0 A;  1R4Q B;  1HNX L;  2CH4 W;  1N9W A;  1F9R A;  1ENA A;  2F0V A;  1G8Z D;  5I9P A;  1HNZ L;  3L3O C;  5AJ3 Q;  1MHW C;  1SLJ A;  2ASB A;  5JOB A;  1K28 A;  1X3Q A;  1EZ8 A;  1RTO A;  3UDF A;  4DNT B;  5C0X I;  1QE6 A;  2IWH A;  1HHV A;  2YV5 A;  1TT2 A;  4RCO A;  5EAY A;  4BA2 I;  3M85 A;  2B29 A;  4IFD J;  1HA5 A;  4DXF A;  1XTC D;  2EYL A;  4Y7N B;  1UEA B;  4IQZ A;  3F2D A;  1G2S A;  2R93 H;  1HR0 W;  2F0N A;  4X3S A;  1C8C A;  2PW5 A;  4DR6 L;  4JV5 Q;  1QVC A;  1CT1 D;  1F9P A;  2DNC A;  4DV1 Q;  2PZW A;  3HEJ A;  3R93 A;  2A8V A;  4RWS C;  3CC4 A;  2EYJ A;  2N78 A;  4K2L A;  4A76 A;  1B44 D;  1KNA A;  5KRU A;  5C44 B;  5E7N A;  1TWF H;  4GLX A;  4LF5 Q;  1HTP A;  3PIO A;  2UU9 Q;  2Y0S E;  1RJT A;  4UP7 A;  2ZJQ A;  1EU4 A;  4LF6 L;  2LXJ A;  4NXN Q;  4DV2 L;  1TXY A;  2SNS A;  2H5X A;  2NVT H;  2UUA Q;  3E5S A;  1A3U A;  1FYC A;  4DV0 L;  1CA5 A;  2MPM A;  1H9S B;  3G6E A;  2TMP A;  3K7A H;  1TWH B;  2F0S A;  3VYT A;  5JJZ A;  1PV4 A;  3S14 H;  3GTQ H;  3WOE A;  1CTM A;  4DV3 L;  2E76 C;  2ICI A;  3E0E A;  1G51 A;  4G57 A;  4EX5 A;  1V1O A;  1K8M A;  1H9K A;  5TSS A;  3PUY A;  1Q12 A;  1XNR L;  5FK9 C;  1ICW A;  2JA6 H;  4DFA A;  1KLG D;  1XNQ Q;  1N34 L;  2RDG A;  1IBM L;  2OTJ A;  2EIF A;  1I4X A;  3RZO B;  4L63 B;  5IGC A;  5C4J B;  2HHH L;  1KQS A;  4ODG A;  5BN4 A;  2L11 A;  3SR1 A;  3J7A V;  4IPG A;  2D62 A;  4RAU C;  4FF4 A;  4A3F H;  2JK8 A;  1TWC H;  4JI2 Q;  1YJ9 A;  4A3E H;  1JR0 D;  2EYF A;  3EBE A;  1WD0 A;  3M3Y B;  3ZJY C;  2VZA A;  3PUV A;  1SYE A;  3D6C A;  2F4V Q;  1TWA H;  4OHJ A;  2R93 G;  3HOX H;  4IAL A;  3AB9 A;  1GUT A;  2Z6K C;  3HKS A;  1LT6 D;  2AHO B;  2KCC A;  1QIL A;  1ET6 A;  2BH2 A;  2R92 H;  3NK9 A;  1CKM A;  4Y52 H;  3J7Y W;  4LFC Q;  3NQT A;  2PNR C;  5IGF A;  3LX0 A;  1JOR A;  2R7D A;  2UXD Q;  1ILP A;  1L1O B;  1UEB A;  3UDI A;  3S2H H;  5EGT A;  4G7O C;  2CW0 D;  3P20 A;  2QKI C;  3H91 A;  2J4X A;  1KRT A;  4PZ7 A;  3M7G A;  1DZ1 A;  4DN4 M;  2KQ3 A;  2ATW A;  4JI6 L;  5IT9 E;  1P8L A;  1B7Y B;  3E9H A;  2E2H H;  2F3I A;  1B3Q A;  1ZXT A;  2IT1 A;  5BR8 L;  3W1G A;  2V4D A;  4JI1 L;  4JI5 L;  4AYB G;  1QG7 A;  1FJG L;  1EFW A;  1S5C D;  3GDE A;  2G9D A;  1VQ4 A;  4BY1 H;  3CCQ A;  1MKH A;  2EYP A;  5HGT A;  2HCI A;  3KBG A;  2JA6 G;  4K0K Q;  2LKV A;  1ONL A;  1ZEQ X;  3AU7 A;  2IHF A;  3S2D B;  2LS0 1;  3AFP A;  3TP6 A;  3HOV H;  3HOZ B;  3RLN A;  2F3W A;  5D3I B;  3DWA A;  4NXM Q;  2K1B A;  4BBR H;  4GNX C;  1I6V C;  4KHZ A;  2DJG C;  2BE5 C;  2K5D A;  3PCO B;  2N3S A;  2CWA A;  2DY8 A;  4KMU C;  5KNB A;  2VUM B;  2WII B;  2MJ8 A;  2R7Z H;  2XTI A;  4DV6 Q;  4A3F G;  4EVO A;  2JA9 A;  4A3E G;  1N33 L;  1F2Z A;  5M5Y B;  1WFQ A;  2A73 B;  5LMN W;  1VQI A;  2B2U A;  4LAA A;  4MIU A;  5GAE C;  1PDQ A;  4K5V A;  4A3M B;  3HOX G;  1G91 A;  2IW3 A;  4IUP A;  5FKA C;  3EFX D;  4EQN A;  3NEL A;  4FP5 D;  4N9T A;  1D5M C;  4IPD A;  3JAM E;  1IBL L;  1YNJ C;  3I4O A;  1F2M A;  3W3A A;  2EJM A;  4DNI A;  3IAY A;  2R92 G;  2F1M A;  3A74 A;  5JVG 3;  4DPG A;  1PA6 A;  4A75 A;  2OT2 A;  2OWO A;  5KGU A;  5CGK A;  4AYB E;  3QWN A;  4CKC A;  1NNX A;  2RDF A;  1JCK B;  2B2T C;  3OOC A;  1BXT A;  3URY A;  2WB1 B;  3L2P A;  2ID0 A;  2CQO A;  3C1F A;  1EUJ A;  4O1N A;  2I46 A;  3S15 B;  4C1N I;  3U50 C;  1EIG A;  2KBN A;  1X32 A;  4M1U B;  4A3J B;  4HN7 A;  4R9W A;  1SNQ A;  2FMC A;  2ALY B;  3K0X A;  4APV A;  1QNU A;  1UE6 A;  1LM0 A;  1SYG A;  1SE4 A;  1V1Q A;  5EBD A;  2NVQ H;  2MO0 A;  1OXX K;  1V43 A;  1IYU A;  1JOQ A;  5ELO A;  1Y1V B;  3M4P A;  1DJR D;  1PH4 A;  1A3V A;  4DR5 L;  1QVF A;  3GTM H;  2A6E C;  3J7A 5;  2NYZ D;  4OON A;  4LUV A;  4RGT A;  4JYA L;  4IO9 A;  3HOV G;  4CDE C;  5GAH C;  3DM3 A;  4WJ3 M;  4ZQ3 A;  2K03 A;  2PZU A;  2V1C C;  4XQN A;  1VQB A;  2NTS A;  4RKL A;  1PFM A;  2B2Y A;  3A56 A;  4JI3 Q;  3Q22 A;  2R7Z G;  4HID A;  4GKK L;  3RNU A;  3Q0A A;  3I4L A;  2M2L A;  4GZY C;  5IT9 c;  1W2B A;  2E75 C;  3CAM A;  3PO3 B;  1A2T A;  4ZCK A;  4X3K A;  4LF4 Q;  5CV6 A;  4A3K B;  4JVZ A;  2O4X A;  4DR7 L;  4Z9C B;  1SFO B;  3OYY A;  3S17 B;  2L1B A;  4UY8 C;  1SNM A;  5IT9 L;  4YWM A;  2EE1 A;  3E3X A;  5IOD A;  4ULL A;  5DLQ E;  5CV9 A;  1B50 A;  4XDX A;  3D8G A;  3UE0 A;  3RMH A;  1WTQ A;  1B9M A;  2YU9 B;  4DR1 L;  4GKJ L;  2PNH A;  4X64 Q;  2H4O A;  1TY0 A;  4DAY A;  2IX0 A;  5E1F A;  4PMC A;  3MZ5 A;  4DUY Q;  3WWV A;  3W5O A;  1K8G A;  2PPB C;  1STB A;  1HH2 P;  2K52 A;  3L9A X;  1MBY A;  4CDC C;  5H1S E;  1K9M C;  1CSP A;  1I3Q B;  4DAV A;  2NVY B;  3S1Q B;  4TQU S;  3JAM c;  3BDC A;  1IXR A;  4MN3 A;  3S9W A;  4KD3 A;  3GTO B;  4TKO B;  3TEH B;  2GA4 B;  3EA6 A;  4RA8 A;  1L0X B;  2XGT A;  4GN4 B;  4DU9 A;  3HKZ G;  4BS9 A;  4WJ4 A;  1MSH A;  2OXP A;  3MA2 B;  1ENC A;  3R8B A;  4LFA Q;  4QMG A;  4CJ2 C;  1IKM A;  3JAM L;  1II3 A;  2KEE A;  3BZC A;  4DK0 A;  3J81 c;  2SOB A;  4MZ9 A;  3HOW H;  3L7Z C;  3STB D;  3T13 A;  1D1I A;  3VYS A;  3I70 A;  2VXW A;  5IIF A;  3A7L A;  2WAQ G;  4HTH A;  2FHT A;  2UUC L;  1PRT C;  1Q82 C;  4JV5 L;  3A55 A;  3MWY W;  4DV1 L;  2Q8I B;  1R9T B;  1JC7 A;  1Y1W B;  1SNO A;  5EKK A;  3K8A A;  4J6H A;  4JI0 Q;  2F0Q A;  3SXH A;  2IX1 A;  3ND8 A;  1RKN A;  3A5U A;  4OGQ C;  5JEA H;  4JPB W;  1EQV A;  2K05 A;  1WOC A;  4KY6 A;  3HOU H;  1SRU A;  2UU9 L;  5C5M A;  1F9S A;  3DWP A;  3CCE A;  1STN A;  1SJH D;  1SMX A;  2E74 C;  3MEH A;  2NVT B;  2K01 A;  4R4C A;  1EFI D;  2UUA L;  3J80 c;  1WTH A;  5E3F A;  1KNE A;  3Q24 A;  1U4M A;  1A0I A;  3GTG H;  5LL6 X;  1GUW A;  1ASY A;  4RGO S;  2MGS A;  3HKZ E;  3TSS A;  3OW7 A;  5C44 G;  3S14 B;  3GTQ B;  4A3B B;  4RFB A;  3ERS X;  1Q81 C;  3J80 i;  1N36 Q;  1XMQ Q;  3ITP A;  1LO5 D;  4B3S Q;  4DAY B;  1JB7 A;  1D5X C;  3CF5 A;  1C0A A;  1GD7 A;  2O5I C;  3HGB A;  1RIP A;  2JA8 B;  1XNQ L;  4KN4 C;  4R8N A;  1YHQ A;  3CCL A;  4BBS H;  1KAB A;  5G3L D;  5T1I A;  2Q8T A;  4K14 A;  3X3M A;  1PFB A;  4FNF A;  2JA5 H;  3CRK C;  1HFN A;  5E4W C;  1SNP A;  3I7F A;  1W6J A;  2F03 A;  2L5T A;  2UUB Q;  1TWC B;  5GRO A;  1V8Q A;  1BBX C;  4JI2 L;  1S5B D;  1K8A C;  1NE3 A;  1U4R A;  5DM7 3;  1JWS D;  1LTR D;  2F4V L;  3FKI B;  3HOW G;  1PMR A;  1CSQ A;  2MFI A;  1HTL D;  3HRZ C;  2IHE A;  4UP8 A;  4YCW A;  3GTP H;  5ELB A;  5F2D A;  4HJ9 A;  1SYF A;  1CKO A;  1EQQ A;  1WTR A;  2B63 H;  2VNU D;  3PMF A;  3CU7 A;  4KD4 A;  1K83 B;  1I4H A;  4LFC L;  4ILW A;  2RBM A;  5C4X G;  3UI2 A;  2LFN A;  2WKC A;  2UXD L;  2F0F A;  3OMG A;  1NAP A;  1HQM C;  5JEA G;  1WTX A;  3S1R B;  4QIW E;  3HOU G;  1DGS A;  2AQ1 B;  5FLX E;  3FVQ A;  5G3L F;  1XMO Q;  4RCN A;  5C5L A;  4RMF A;  1EYA A;  3EVQ A;  2K5H A;  4NDX A;  2EDG A;  3FHW A;  2XVS A;  3T1H L;  4DNR B;  4C2M B;  1KRS A;  2NB0 A;  2NVX H;  1CQV A;  1RF2 D;  1X54 A;  1FNU A;  1PTO F;  4MTN A;  2MO1 A;  3TZD A;  4OWT B;  1GOZ A;  1AZQ A;  1EEF D;  1SDF A;  4OIJ A;  5IYD H;  3GTK B;  2ENB A;  5EBC A;  2XSC A;  2UXC Q;  1EU3 A;  3W1B A;  3F2C A;  1IZ6 A;  4BBR B;  1B53 A;  2FXQ A;  2JA5 G;  2KJX A;  2G9H D;  3K5M A;  4X66 Q;  4C3J H;  5IGE A;  2LSS A;  2XNA C;  3NUC A;  4DK1 A;  5M5X B;  4HED A;  1BR9 A;  4QQB X;  4H0L C;  4HMJ A;  1WTW A;  1YNN C;  4HJ7 A;  4DV7 Q;  4C3H H;  3QJY A;  4LJZ C;  2A6H C;  1QZH A;  2QW7 A;  3CCM A;  1BVS A;  3OTO Q;  3VR6 A;  1VQO A;  3QB3 A;  1ML0 D;  1U4P A;  2D2C C;  4IUR A;  5HUR A;  4LFB Q;  1LTS D;  3MXU A;  1SJE D;  1J6Q A;  5A2Q E;  2CWP A;  1IW7 D;  2B63 G;  2PO4 A;  2DNE A;  1HCZ A;  4UP9 A;  2A69 D;  3M4O H;  5GQO A;  5JAV A;  5KNC A;  4C3I G;  5J39 A;  1CI3 M;  1HFG A;  3QO2 A;  1F2L A;  1E24 A;  2R3Z A;  1JQY D;  3I3C A;  4OWW B;  3HS0 C;  2Z6K A;  3P1H A;  3JC6 6;  1MI2 A;  3BDO A;  3CCJ A;  4FVM A;  2EY6 A;  1D5Z C;  1Z7T A;  3BVG A;  4IJH A;  2JSO A;  2F0L A;  1EYC A;  3A5Z B;  5EKL A;  1C9O A;  4HIK A;  3C3L A;  4LF8 L;  1YVC A;  4IUN A;  4JC0 A;  5ISR A;  4UHV A;  1F2Y A;  1CFM A;  3S16 H;  1I94 Q;  4XT3 B;  4YCV A;  1GHK A;  5IYD G;  2Z4I A;  4R4I A;  4YHH Q;  3G71 A;  1SMY C;  2NBF A;  5JEA J;  3E9I A;  3K80 C;  3S24 A;  4J8Q A;  3GO5 A;  1LTL A;  1CHQ D;  3NTK A;  1AE3 A;  2IY5 B;  1QOH A;  4C3J G;  2OF1 A;  1FNW A;  4N8X 1;  4JI3 L;  3CMA A;  1K73 C;  2HT1 A;  3GTL B;  2E2I H;  3UE1 A;  1LLR D;  2JEA I;  4C3H G;  5C4Z A;  4DR4 Q;  3CKI B;  1L1O A;  4JBW A;  4L5T A;  3VYU A;  2QDL A;  1BBU A;  4A93 H;  1N32 Q;  2JYO A;  3T16 A;  5FLX L;  2SNM A;  2A68 C;  2UXB L;  1OXS C;  2K75 A;  4GNX A;  2I5L X;  4JBJ A;  2EJF C;  2VS1 A;  2RDH A;  4A3G H;  2EXZ A;  1RD9 D;  3R3O A;  5ELC A;  3MEF A;  5EPL A;  1WCM B;  1JWU D;  1MIU A;  1DOM A;  5I9O A;  3CP0 A;  4R1J A;  5KIX A;  4S3S A;  2MNA A;  4MHE A;  2PI2 E;  3U4V A;  3BYY B;  2NWG A;  3CQZ H;  1I50 B;  4DUY L;  4J1M A;  2YYZ A;  4KK7 A;  2JP1 A;  1BF4 A;  2K7V A;  2XWJ B;  1QWY A;  1STY A;  4PG3 A;  4KHP L;  1GUO A;  2DY7 A;  1SEB D;  3H3V H;  1RL2 A;  3OSO A;  3S1M B;  5IWA Q;  2K5Q A;  1VQ8 A;  2C35 B;  4BY7 H;  2B2T A;  1X6O A;  1PHJ A;  3GTJ B;  4C56 C;  4RHS A;  4IOC A;  5DEH A;  4XXE A;  1STE A;  3K5O A;  3CCR A;  4DF7 A;  3I4N H;  1TWG H;  3C46 A;  5C3X A;  2AQ2 B;  1LTB D;  3H0G B;  5C6A A;  1Y8N B;  2KOL A;  3HG9 A;  3LNN A;  1U9R A;  1I6H B;  3KLR A;  4XTC S;  4IJL A;  3FDT A;  1RTN A;  2LY7 A;  4LWC A;  5A2Q L;  1EZ6 A;  2WV6 D;  5IYB H;  4A3L H;  3U9O A;  5IGB A;  1PTO H;  1JJG A;  2KVM A;  1LV9 A;  1HJP A;  5IYC H;  3KF6 B;  4RKB A;  1YJN A;  1VQP A;  3LGJ A;  4TRD A;  3TP8 A;  2K33 A;  1EL0 A;  4CKB A;  3WDN A;  5C4H A;  1SSO A;  4KV6 A;  1VF5 C;  1I4Q A;  1GHJ A;  4A93 G;  1STA A;  2F0D A;  3DHQ A;  4ME3 A;  5FJ8 H;  1PH9 A;  3VA7 A;  4A3G G;  1GUG A;  5JJL A;  4WFN 3;  1Q8I A;  5EPK A;  4IOA A;  4X65 Q;  4NW2 A;  4A3D H;  3MXN A;  4GNX B;  1N8R C;  4YIJ A;  2JA7 B;  3VR2 A;  3HP3 A;  1U0L A;  3EQL C;  3Q6S A;  2VB3 X;  1HA6 A;  1YJW A;  1U5K A;  1PYW D;  1KAW A; 
#chains in the Genus database with same CATH homology
 4F8M A;  3SEB A;  2L4N A;  5FO9 B;  1B3A A;  3T4A C;  2EYH A;  2F0O A;  2EVB A;  1KDB A;  4CKE A;  3MAQ A;  4F7X A;  3E6Z X;  3NBH A;  5DAU A;  4BBS B;  1XWE A;  2IJ0 A;  2PYK A;  3U9S A;  5KEE A;  2AQ3 B;  2WAC A;  1EY7 A;  5FO8 B;  5K36 H;  2E2J B;  2FMM A;  2WIN B;  1PFN A;  1UAP A;  5I4D A;  5AFW A;  4ZKC B;  3I4M B;  3OWE B;  4RGM A;  1Q3L A;  1CHP D;  1JE4 A;  2F0T A;  3OWF A;  1DD2 A;  5KYL A;  1AZP A;  2MHV A;  3FPU B;  4OO1 G;  4DAP A;  1ZYR D;  2K04 A;  3PUX A;  1M8A A;  2N88 A;  2EY2 A;  1FGB D;  1GJX A;  3BVZ A;  1CM9 A;  5M3M B;  3MXP A;  3OIQ A;  5K5P A;  5J1Z A;  4HAE A;  2WP8 J;  3PUW A;  2AWO A;  5C3E B;  3HOY B;  2Y0S B;  5I6W A;  3F2U A;  4FYD A;  4ID6 A;  1VCI A;  1GUS A;  2VB2 X;  2C5C A;  5EPJ A;  5CV7 A;  1LTT D;  1JOK A;  1M4V A;  3NE5 B;  1S5D D;  1OXT A;  3NWT A;  4KTA A;  2XN9 C;  3VR3 A;  2ZXO A;  5K36 G;  1O80 A;  3NWS A;  5CBA E;  3I91 A;  1H9R A;  5CBE E;  1IYV A;  2MP1 A;  2N55 A;  1LAB A;  4QUC A;  1S4Z A;  3T51 B;  4K2K A;  3BVM A;  3DM1 A;  5T1G A;  1T5E A;  1MGS A;  1TS5 A;  3VA5 A;  4ZYS A;  5KYI A;  1Q1E A;  3DWQ A;  1T5X D;  3NPP A;  3S1N B;  3RZD B;  3ONA B;  2IL8 A;  4NKL A;  5CV8 A;  2B2W A;  3SHL A;  3NHH A;  2F0E A;  4M8A A;  4PMB A;  1FR3 A;  1L0Y B;  1EIH A;  3PV0 A;  1RHP A;  4CJ0 B;  2FIN B;  4G4K A;  4IUQ A;  3X3N A;  2AUJ D;  5JVH 3;  3SK6 A;  4WOR A;  1B2T A;  1SYD A;  3OPO A;  5JPM C;  4KKT A;  3SE0 A;  4CBV A;  1NR4 A;  1TKW B;  3WOF A;  1WVL A;  3D3R A;  1D2B A;  3SDZ A;  1X3P A;  2F0P A;  4BA1 I;  2R93 B;  4NP5 A;  3V2T A;  1AP0 A;  1SND A;  2KCN A;  1WTO A;  1LTG D;  1HXY D;  3FMC A;  1QJO A;  1TII D;  4L6T B;  1NCV A;  1OO9 B;  1TWF B;  1H9J A;  1AN8 A;  1FD7 D;  4ZRZ A;  2KED A;  4B08 A;  5CC4 A;  1DYQ A;  3K59 A;  1O7Y A;  4KN7 C;  3A8I E;  3I90 A;  1PZI D;  4KY5 A;  1DCZ A;  4HCS A;  1STG A;  1SXT A;  2AUK A;  3K7A B;  5EJW A;  4AYB B;  4FXG C;  3TDQ A;  3PIP 3;  4HSP A;  3BS1 A;  2JA6 B;  1KDC A;  3BDL A;  3FPP A;  1E2Z A;  1Z6H A;  2EZV A;  2J0T D;  4OL7 A;  1CZG A;  1LAC A;  2B8F A;  3D4W A;  3D4R A;  2B2Y C;  2L9H A;  1KTK A;  4A3F B;  3V96 A;  4XYO A;  1F77 A;  1E2W A;  1VF7 A;  4A3E B;  4QUF A;  1DOK A;  2L55 A;  3IKJ A;  4EGV A;  4JK1 C;  1TWA B;  1D6E C;  3ERO A;  3HOX B;  3H3V C;  3VR4 A;  1IHZ A;  4EQO A;  1TU2 B;  4KI0 A;  5BN5 A;  2EJG C;  2F3V A;  3DXJ C;  2R92 B;  2PMZ B;  4IUT A;  4OIK A;  3NQI A;  5C3W A;  2QDB A;  5CR3 A;  1Y69 U;  3S2H B;  4KY7 A;  5BN3 A;  3NBI A;  2HCC A;  3I8Z A;  4HR7 B;  3K58 A;  1SNC A;  2E2H B;  1PTO C;  4X3U A;  2Z1C A;  4I7Z C;  3K0Y A;  3KBX A;  4R8I A;  1ENF A;  4BY1 B;  3E0J A;  4C1N K;  5IGD A;  1EEI D;  1CQF A;  3H09 A;  5D65 A;  3HOV B;  5I2Y A;  1QNK A;  2HDM A;  5D3D A;  2BA0 A;  2EOT A;  5FO7 B;  1AFP A;  1BQQ T;  2R7Z B;  2RQX A;  4XYQ A;  4XT1 B;  2QCP X;  3VYR A;  5IGG A;  2CHB D;  4KJN A;  4EQP A;  2XIW A;  5EQ0 A;  4ZLT F;  1BCP B;  3MFY A;  2BOS A;  4IUU A;  2QEJ C;  2ZXP A;  2H1E A;  2F0M A;  1J9O A;  2B39 A;  2HUG A;  1MSG A;  1BCP D;  3R2T A;  1GUN A;  5I2X A;  1XX8 A;  3A8K E;  4FF2 A;  2Z4H A;  3MC0 B;  2CVR A;  3QOJ A;  3H6M A;  4UAI A;  3KF8 A;  5COY A;  5IOC A;  1Q90 A;  1KDA A;  4CGY B;  1I4R A;  2NVQ B;  2SEB D;  2KA7 A;  4H7B A;  2M00 A;  5C0X H;  1IW7 C;  4KKS A;  3GTM B;  3HKZ B;  2C9O A;  2F4I A;  3T56 B;  1S5E D;  5DM6 3;  4KHV A;  2JEB I;  4PV1 C;  5I6Y A;  1ROD A;  2K5W A;  1SBB B;  1Q1B A;  2M9V A;  3DEO A;  1EWC A;  1G29 1;  1DXM A;  3D4D A;  2WAQ B;  2K6A A;  1PXU A;  3KLS X;  4ZUI A;  2NN6 G;  2F0K A;  2F0H A;  2HQE A;  1F9Q A;  2X6L A;  5ELD A;  4K8I A;  1B1Z A;  2D5D A;  1QCB D;  3IFD A;  3PUZ A;  4B9W A;  3IFT A;  1V1P A;  4PNY A;  3T53 B;  3Q23 A;  1LT3 D;  1NUC A;  2SDF A;  4QCL A;  1E0B A;  2EY5 A;  2K28 A;  5D14 A;  1B4O A;  1ILQ A;  2O5J C;  1VDZ A;  2XRS D;  3SK5 A;  3NP8 A;  2FFK B;  2X6G A;  3MFG A;  1PZK D;  3BYT B;  4KJO A;  5CV5 A;  1ZKO A;  4LK1 C;  3M7N A;  4K5X A;  2A74 C;  1CK1 A;  2FJ2 A;  1LT5 D;  1G2T A;  4QIW B;  1LT4 D;  1E2V A;  2EYO A;  1TR5 A;  1BUV T;  5C0X G;  3KLS A;  3QOL A;  2K32 A;  1OXV A;  3P7J A;  3ERQ A;  3SVM A;  5M9O A;  1Y8O B;  4F88 A;  3SK8 A;  2PCF B;  3HOW B;  4G7Z C;  1JB3 A;  2F0W A;  3FRP B;  2ICE C;  4PQX A;  1SE3 A;  1J8I A;  4PMW A;  3DEP A;  2BA1 A;  3TP7 A;  5C4X B;  4OO1 H;  2F0U A;  3I72 A;  4ZK9 B;  3HOU B;  4N9P A;  1C48 A;  2B2V C;  1FNV A;  1UUP A;  1EWH A;  1V1P B;  2PW7 A;  3OIP A;  3GTG B;  4RH6 A;  2D9U A;  3GQB A;  3TP5 A;  1B9N A;  1RCV D;  2BCO A;  3M4Y A;  4WRD A;  1W6K A;  1JWM D;  2BE5 D;  4HMI A;  1LTA D;  3PIO 3;  1EY5 A;  4KKU A;  1NSN S;  4OO1 I;  2I07 B;  1KLU D;  1CZW A;  1WD1 A;  2JA5 B;  2CW0 C;  2AWN A;  4CHT B;  3HZX A;  3R2I A;  5M5W B;  1YNJ D;  2J7Z A;  3NXW A;  3TN2 A;  1HQR D;  2KHS A;  1TY2 A;  3GTP B;  3AMU A;  2R6G A;  4L8J A;  3D6W A;  1DM0 B;  2RA4 A;  4ZKB B;  5C0X J;  3ND9 A;  4TSS A;  2B63 B;  4FXD A;  2Z8L A;  3K57 A;  1BOS A;  1Z47 A;  2NZ1 D;  1A2U A;  4C3I B;  3IL8 A;  1G6Z A;  3KK7 A;  2KEC A;  1A6X A;  5ELF A;  1TS3 A;  3BZD B;  4Q0F A;  3CRL C;  2QIL A;  3FEW X;  4FO2 A;  4P2C B;  3VR5 A;  4NMZ A;  4V19 0;  2X69 A;  1Y8P B;  2A6E D;  2NVX B;  4ZAI A;  1IL8 A;  5A35 A;  3EJI A;  1HRJ A;  3I73 A;  3J81 E;  3K5N A;  1R4P B;  4X3T A;  1WTV A;  3OHX C;  1ZYR C;  4IUV A;  5J22 A;  1EY6 A;  4C3J B;  1TQO A;  2ZT9 C;  2Q8R E;  3QIA A;  1CA6 A;  4C3H B;  3BG3 A;  1WTP A;  3GV6 A;  5LHY 1;  2F0I A;  2R61 A;  4XIG S;  3A7A B;  5COR A;  2A5H A;  5FOB B;  1BNZ A;  2PZT A;  3J80 E;  3G6J B;  3GP7 A;  3M4O B;  4IN3 A;  4HSV A;  1HUN A;  1A15 A;  1EOT A;  1NR2 A;  1HUM A;  1H9M A;  5CMD A;  3MHB A;  5KND A;  1PLF A;  4FF1 A;  5NUC A;  1U4L A;  3N6R A;  1ET9 A;  3KUP A;  3A54 A;  4G7H C;  3W2D A;  1PRT B;  1I4P A;  1ESF A;  1BO0 A;  3S16 B;  3DMU A;  1O78 A;  1AW7 A;  5JPN C;  4K6L A;  3O13 A;  3TBI B;  1EY9 A;  3H94 A;  2TSS A;  4DA2 A;  1PRT D;  4QF4 A;  4BWG B;  1SYC A;  4ZUJ A;  4IZ8 A;  2IX3 A;  4LMQ D;  4U68 A;  4XQQ A;  2B2U C;  2EPB A;  3RLF A;  2E2I B;  2F0J A;  2F0G A;  2WKD A;  5CV4 A;  2XWB B;  4WJW A;  1KAA A;  4A93 B;  1I4G A;  1K8O A;  3LWU A;  1C4Q A;  4A3G B;  1BDO A;  2JE6 I;  1EY8 A;  1GXD C;  1VMC A;  3V05 A;  3K5L A;  1TVX A;  3J7A F;  1PRT F;  4DXG A;  3J81 L;  5EKI A;  3CQZ B;  4U67 3;  2HDL A;  2ZXR A;  5CYU A;  1XXG A;  4K8J A;  1TS2 A;  4F87 A;  2L12 A;  4HCE A;  4V0B A;  1TS4 A;  1SE2 A;  1RDP D;  3N52 A;  4BY7 B;  1SYB A;  3NTH A;  4IFD H;  2RSN A;  2NUC A;  3I4N B;  1TWG B;  4CJ1 B;  3PO2 B;  2CQA A;  4RGN A;  2IPK D;  3J80 L;  1JIC A;  2O2L D;  4B9X A;  4FXK C;  1STH A;  2RKS A;  3DUZ A;  1PTO B;  2EYM A;  1UNS A;  4UDU C;  2EY1 A;  4IFD I;  3K6O A;  4A3I B;  3MTS A;  2MUY A;  2B2W C;  4H13 C;  4ME5 A;  4FF3 A;  1PTO D;  3G7L A;  1ESR A;  3C1E A;  4K6D A;  4A3D B;  4ABN A;  2LMC B;  3OMC A;  3D31 A;  3RD4 A;  3MXG A;  1EY0 A;  3GD7 A;  3TME A;  1EY4 A;  3ZYY X;  3P75 A;  3LWE A;  5ELE A;  3C2P A;  2NTT A;  1S5F D;  2BDN A;  4IFD G;  1VMP A;  1YNN D;  2A6H D;  2RSO A;  1IKL A;  2OEO A;  4RHR A;  3NTI A;  2L0C A;  2XRQ D;  1DOL A;  1MD2 D;  3SK4 A;  1QB5 D;  1DON A;  4O42 A;  2PQE A;  2NN6 H;  3A8J E;  4E6I A;  1O7L A;  5LL6 S;  3TZU A;  1D1K A;  5M3F B;  1O7Z A;  5DNF A;  5E4X A;  4DGZ A;  3NSW A;  1HPC A;  2DN8 A;  2RVL A;  1SAP A;  2KUM A;  3MVV A;  1EQT A;  1LTI D;  1XYI A;  2NN6 I;  1EYD A;  4I65 A;  4XQJ A;  3CHB D;  1AEX A;  1SMY D;  1H9S A;  3GV3 A;  4H44 C;  2JXM B;  2E2D C;  2B2V A;  1OXU A;  4Q5V A;  2QF7 A;  1PZJ D;  2A69 C;  3QG1 A;  2B8G A;  4QB4 A;  1BCP C;  1A3T A;  3RUZ A;  1JOO A;  1BCP F;  4K5W A;  2A68 D;  2BDO A;  1R4Q B;  1F9R A;  1ENA A;  2F0V A;  1G8Z D;  5I9P A;  3L3O C;  5JOB A;  1X3Q A;  1EZ8 A;  1RTO A;  4DNT B;  5C0X I;  1QE6 A;  2IWH A;  1HHV A;  4RCO A;  1TT2 A;  4BA2 I;  3M85 A;  4IFD J;  1HA5 A;  4DXF A;  1XTC D;  2EYL A;  4Y7N B;  1UEA B;  4IQZ A;  1G2S A;  2F0N A;  4X3S A;  1C8C A;  2PW5 A;  1CT1 D;  1F9P A;  2DNC A;  2PZW A;  3HEJ A;  3R93 A;  4RWS C;  2EYJ A;  4K2L A;  1B44 D;  1KNA A;  5KRU A;  5C44 B;  1HTP A;  1RJT A;  1EU4 A;  2SNS A;  3E5S A;  1A3U A;  1FYC A;  1CA5 A;  2MPM A;  1H9S B;  2TMP A;  1TWH B;  2F0S A;  3VYT A;  5JJZ A;  3WOE A;  1CTM A;  2E76 C;  2ICI A;  4G57 A;  1V1O A;  1K8M A;  1H9K A;  5TSS A;  3PUY A;  1Q12 A;  5FK9 C;  1ICW A;  4DFA A;  1KLG D;  2RDG A;  1I4X A;  3RZO B;  4L63 B;  5IGC A;  5C4J B;  4ODG A;  5BN4 A;  2L11 A;  3SR1 A;  3J7A V;  4FF4 A;  2D62 A;  4RAU C;  1JR0 D;  2EYF A;  1WD0 A;  3M3Y B;  3PUV A;  1SYE A;  3D6C A;  4OHJ A;  4IAL A;  3AB9 A;  1GUT A;  1LT6 D;  2KCC A;  1QIL A;  1ET6 A;  3NK9 A;  3J7Y W;  3NQT A;  2PNR C;  5IGF A;  3LX0 A;  1JOR A;  1ILP A;  5EGT A;  4G7O C;  2CW0 D;  3P20 A;  2QKI C;  3H91 A;  2J4X A;  3M7G A;  1DZ1 A;  4DN4 M;  2KQ3 A;  5IT9 E;  1ZXT A;  2IT1 A;  2V4D A;  1QG7 A;  1S5C D;  2G9D A;  2EYP A;  5HGT A;  2HCI A;  3KBG A;  2LKV A;  1ONL A;  1ZEQ X;  3AU7 A;  3S2D B;  2LS0 1;  3TP6 A;  3HOZ B;  2F3W A;  5D3I B;  3DWA A;  2K1B A;  1I6V C;  4KHZ A;  2BE5 C;  2K5D A;  2DY8 A;  2VUM B;  4KMU C;  5KNB A;  2WII B;  2MJ8 A;  4EVO A;  1F2Z A;  5M5Y B;  2A73 B;  2B2U A;  4LAA A;  4MIU A;  1PDQ A;  4K5V A;  4A3M B;  1G91 A;  2IW3 A;  4IUP A;  5FKA C;  3EFX D;  4EQN A;  4FP5 D;  4N9T A;  1D5M C;  3JAM E;  1YNJ C;  1F2M A;  3W3A A;  2EJM A;  3IAY A;  2F1M A;  5JVG 3;  2OT2 A;  5KGU A;  5CGK A;  3QWN A;  4CKC A;  2RDF A;  1JCK B;  2B2T C;  3OOC A;  1BXT A;  3URY A;  2WB1 B;  2ID0 A;  3C1F A;  4O1N A;  2I46 A;  3S15 B;  4C1N I;  1EIG A;  1X32 A;  4M1U B;  4A3J B;  4HN7 A;  4R9W A;  1SNQ A;  2FMC A;  1QNU A;  1SYG A;  1SE4 A;  5EBD A;  1OXX K;  1V43 A;  1IYU A;  1JOQ A;  1Y1V B;  1DJR D;  1A3V A;  2A6E C;  2NYZ D;  4RGT A;  4ZQ3 A;  2K03 A;  2PZU A;  4XQN A;  2NTS A;  4RKL A;  1PFM A;  2B2Y A;  3A56 A;  3Q22 A;  3Q0A A;  3I4L A;  2M2L A;  4GZY C;  2E75 C;  3PO3 B;  1A2T A;  4X3K A;  5CV6 A;  4A3K B;  2O4X A;  4Z9C B;  1SFO B;  3S17 B;  2L1B A;  1SNM A;  5IT9 L;  2EE1 A;  5IOD A;  4ULL A;  1B50 A;  5CV9 A;  4XDX A;  3D8G A;  3RMH A;  1WTQ A;  1B9M A;  2YU9 B;  2H4O A;  1TY0 A;  4DAY A;  2IX0 A;  5E1F A;  4PMC A;  3MZ5 A;  2PPB C;  1STB A;  3L9A X;  1MBY A;  1I3Q B;  4DAV A;  2NVY B;  3S1Q B;  4TQU S;  3BDC A;  3S9W A;  4MN3 A;  4KD3 A;  3GTO B;  4TKO B;  2GA4 B;  3EA6 A;  4RA8 A;  1L0X B;  4DU9 A;  4BS9 A;  1MSH A;  2OXP A;  3MA2 B;  1ENC A;  3R8B A;  4QMG A;  4CJ2 C;  1IKM A;  3JAM L;  1II3 A;  2KEE A;  4DK0 A;  2SOB A;  3L7Z C;  3T13 A;  1D1I A;  3VYS A;  3I70 A;  2VXW A;  5IIF A;  3A7L A;  4HTH A;  2FHT A;  1PRT C;  3A55 A;  3MWY W;  1R9T B;  2Q8I B;  1JC7 A;  1Y1W B;  1SNO A;  5EKK A;  4J6H A;  2F0Q A;  3SXH A;  2IX1 A;  3ND8 A;  1RKN A;  4OGQ C;  5JEA H;  1EQV A;  2K05 A;  4KY6 A;  5C5M A;  1F9S A;  3DWP A;  1STN A;  1SJH D;  2E74 C;  3MEH A;  2NVT B;  2K01 A;  1EFI D;  5E3F A;  1KNE A;  3Q24 A;  1U4M A;  5LL6 X;  1GUW A;  4RGO S;  2MGS A;  3TSS A;  3OW7 A;  3S14 B;  3GTQ B;  4A3B B;  4RFB A;  3ITP A;  1LO5 D;  1D5X C;  2O5I C;  2JA8 B;  3HGB A;  4KN4 C;  4R8N A;  1KAB A;  5G3L D;  5T1I A;  2Q8T A;  4K14 A;  3X3M A;  1PFB A;  4FNF A;  3CRK C;  1HFN A;  5E4W C;  1SNP A;  1W6J A;  2F03 A;  2L5T A;  1TWC B;  1V8Q A;  1BBX C;  1S5B D;  1U4R A;  5DM7 3;  1JWS D;  1LTR D;  3FKI B;  1PMR A;  1HTL D;  3HRZ C;  5ELB A;  5F2D A;  1SYF A;  1WTR A;  2VNU D;  3PMF A;  3CU7 A;  4KD4 A;  1K83 B;  1I4H A;  4ILW A;  2RBM A;  3UI2 A;  2LFN A;  2WKC A;  2F0F A;  3OMG A;  1NAP A;  1HQM C;  5JEA G;  1WTX A;  3S1R B;  2AQ1 B;  5FLX E;  3FVQ A;  5G3L F;  4RCN A;  5C5L A;  1EYA A;  3EVQ A;  4NDX A;  2EDG A;  2XVS A;  4DNR B;  4C2M B;  2NB0 A;  1CQV A;  1RF2 D;  1FNU A;  1PTO F;  3TZD A;  1GOZ A;  1AZQ A;  1EEF D;  1SDF A;  4OIJ A;  3GTK B;  2ENB A;  5EBC A;  2XSC A;  1EU3 A;  4BBR B;  1B53 A;  2KJX A;  2G9H D;  3K5M A;  5IGE A;  2XNA C;  3NUC A;  4DK1 A;  5M5X B;  4HED A;  1BR9 A;  4H0L C;  4HMJ A;  1WTW A;  1YNN C;  3QJY A;  4LJZ C;  2A6H C;  3VR6 A;  3QB3 A;  1ML0 D;  1U4P A;  2D2C C;  4IUR A;  5HUR A;  1LTS D;  3MXU A;  1SJE D;  5A2Q E;  1IW7 D;  2PO4 A;  2DNE A;  1HCZ A;  2A69 D;  5JAV A;  5KNC A;  4C3I G;  5J39 A;  1CI3 M;  1HFG A;  3QO2 A;  1F2L A;  2R3Z A;  1JQY D;  3I3C A;  3HS0 C;  3P1H A;  1MI2 A;  3BDO A;  4FVM A;  2EY6 A;  1D5Z C;  1Z7T A;  3BVG A;  2JSO A;  2F0L A;  1EYC A;  5EKL A;  3C3L A;  4IUN A;  5ISR A;  1F2Y A;  1CFM A;  4XT3 B;  1GHK A;  2Z4I A;  1SMY C;  2NBF A;  5JEA J;  4J8Q A;  3GO5 A;  1CHQ D;  3NTK A;  1QOH A;  4C3J G;  2OF1 A;  1FNW A;  3GTL B;  1LLR D;  2JEA I;  4C3H G;  5C4Z A;  3CKI B;  4JBW A;  3VYU A;  2JYO A;  3T16 A;  5FLX L;  2SNM A;  2A68 C;  1OXS C;  2EJF C;  2RDH A;  2EXZ A;  1RD9 D;  3R3O A;  5ELC A;  5EPL A;  1WCM B;  1JWU D;  1DOM A;  5I9O A;  5KIX A;  4S3S A;  4MHE A;  3BYY B;  2NWG A;  1I50 B;  4J1M A;  2YYZ A;  4KK7 A;  2JP1 A;  1BF4 A;  2K7V A;  2XWJ B;  1QWY A;  1STY A;  1GUO A;  2DY7 A;  1SEB D;  3OSO A;  3S1M B;  2K5Q A;  2B2T A;  3GTJ B;  4C56 C;  4RHS A;  5DEH A;  4XXE A;  1STE A;  3K5O A;  4DF7 A;  3C46 A;  5C3X A;  2AQ2 B;  1LTB D;  3H0G B;  5C6A A;  1Y8N B;  2KOL A;  3HG9 A;  3LNN A;  1U9R A;  1I6H B;  3KLR A;  4XTC S;  3FDT A;  1RTN A;  2LY7 A;  5A2Q L;  1EZ6 A;  2WV6 D;  3U9O A;  5IGB A;  1PTO H;  2KVM A;  1LV9 A;  4RKB A;  4TRD A;  3TP8 A;  2K33 A;  1EL0 A;  4CKB A;  3WDN A;  5C4H A;  1SSO A;  4KV6 A;  1VF5 C;  1I4Q A;  1GHJ A;  1STA A;  2F0D A;  3DHQ A;  3VA7 A;  1GUG A;  4WFN 3;  1Q8I A;  5EPK A;  4NW2 A;  3MXN A;  4YIJ A;  2JA7 B;  3VR2 A;  3HP3 A;  3Q6S A;  3EQL C;  2VB3 X;  1HA6 A;  1PYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...