1EZ6A

Structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez6A00
2EYLA 2F0UA 3ITPA 5IOCA 4F7XA 3P75A 1EYCA 5IODA 3PMFA 1EY8A 2EYPA 3NQTA 5DAUA 2EYFA 1EYDA 3TP6A 3H6MA 4B9WA 2F0SA 4J6HA 4KJOA 2OF1A 4KY7A 3SHLA 4YIJA 3QB3A 5HGTA 1IHZA 4H7BA 5ISRA 2HQEA 2F0LA 2F0QA 5KYIA 2F0IA 2RDFA 2EY5A 4MIUA 1SYDA 2PW7A 3V2TA 2O4XA 5CR3A 5IGGA 3NK9A 2F0DA 3LX0A 5E3FA 2F0WA 3RUZA 3EROA 2F0JA 1A3TA 1SNQA 1STBA 2SNMA 1EY6A 5CV5A 5JOBA 3MEHA 5CV7A 5C5LA 2EY6A 2F0HA 1SNCA 3SXHA 3TMEA 5HURA 5JAVA 3SR1A 1F2MA 1KDBA 1SYGA 5IGCA 2F0KA 2KHSA 4K14A 3BDCA 3NUCA 4K8JA 1SNPA 1A2TA 2PZWA 5C4ZA 1II3A 4DGZA 1EY7A 2RBMA 5I9OA 1TQOA 4E6IA 2RKSA 3ERQA 1A2UA 4IUNA 4KHVA 5C5MA 1EQVA 4I65A 5CV6A 4ID6A 3QOJA 3NP8A 4K8IA 3S9WA 3VA5A 4ZUJA 3MHBA 5C6AA 3BDLA 3TP8A 5KIXA 1NUCA 4RKBA 4ODGA 2EYJA 2PZUA 3TP7A 2F0OA 3TP5A 3C1FA 4K5WA 2F3WA 5I6WA 3NHHA 4K2LA 4QB4A 3QOLA 4TRDA 5EKKA 5C3XA 5KYLA 3MVVA 1KAAA 5KGUA 4R8NA 4NKLA 2PW5A 1NSNS 4RKLA 3OMCA 5IGBA 4N9TA 3SK5A 1STNA 4N9PA 4NP5A 4DF7A 4K2KA 5E1FA 1JOKA 5EGTA 5IGFA 1JOQA 1TT2A 3P1HA 4S3SA 3SK8A 3T13A 5J22A 1EY0A 3D4WA 2ENBA 4DFAA 2F0VA 4K5VA 3EJIA 4WRDA 3R3OA 4B9XA 2F0PA 4KTAA 4DU9A 5C4HA 5CC4A 4IALA 5IGDA 5CV4A 4ZQ3A 3DMUA 3U9OA 1RKNA 3D6CA 3D8GA 3HZXA 1JORA 2EY1A 3T16A 2KQ3A 1F2ZA 3HEJA 1EY9A 2F0EA 2PYKA 1A3VA 1SYEA 2M00A 4KY5A 2SNSA 4OL7A 1EY4A 1TR5A 5CV9A 2F0MA 4HTHA 4PNYA 4EVOA 2F3VA 2NUCA 4IZ8A 5CGKA 4ME5A 1KDAA 1SYBA 2F0TA 4KV6A 1ENCA 1STHA 1STAA 2EYMA 2SOBA 4K5XA 1ENAA 3C1EA 4NDXA 4EQOA 1STYA 4ZUIA 1SNMA 5NUCA 5KRUA 2PQEA 3MXPA 5IIFA 4KJNA 1KABA 2F0NA 2F0FA 1KDCA 3SK6A 1SYCA 5CV8A 4HMJA 4J1MA 5DEHA 5EKLA 4WORA 2OXPA 3D4DA 3MZ5A 5C3WA 2EYHA 4QMGA 1EZ6A 3EVQA 2EY2A 4PMBA 3OMGA 5I9PA 2EXZA 4G57A 3OSOA 2F0GA 4KD3A 5J1ZA 4EQNA 2WACA 1SNDA 2PZTA 2OEOA 4QF4A 5KEEA 5IGEA 1EY5A 1SYFA 2EYOA 3NXWA 4KY6A 5J39A 3OWFA 4NMZA 3SK4A 1EZ8A 4K6DA 5M9OA 4PMCA 1SNOA 1STGA 3E5SA 1A3UA 1EYAA 1F2YA 4HMIA 5I6YA 1U9RA 4LAAA 5F2DA 4EQPA 3DHQA 1JOOA 4F8MA 4KD4A 5K5PA 1AEXA 2LKVA 2QDBA
chains in the Genus database with same CATH superfamily
4A93B 2UUBL 2ATWA 4QY7A 5JJIA 1HXYD 1EYDA 2K5DA 2IY5B 1PH9A 2QEJC 4JW0A 1IYUA 2ZTCA 4QGUA 4B08A 4OIJA 4IO9A 1QNKA 3DXJC 2F0DA 2AMCB 3S2DB 3CCUA 3PIOA 3EROA 1G8ZD 5JOBA 1XYIA 4XDXA 3C2PA 4RA8A 4K0KL 1QJOA 4UP7A 5JJKA 4JBWA 4K8JA 3W5OA 5C4ZA 4Y52H 1CZGA 1CQVA 5JPMC 5FJ8G 1X3EA 1IBKL 3QOJA 2UU9L 3EQLC 4LF8Q 2Z4IA 5ELDA 3GTJB 1RDPD 1HCZA 1JICA 3F2BA 2JA8H 3U58A 3S17H 2BE5D 1K83H 3TN2A 5KYLA 1F9PA 4AH6A 2B2TC 3BZCA 1MIUA 2JA7G 2NWGA 2RSNA 1PH2A 2ZTEA 5C4JB 3I2ZA 1AFPA 5J22A 3I90A 3CPFA 3PQIA 1X56A 2B63H 4JI1L 1Q81C 1XMOL 3I4MG 2UUCL 3NBHB 3DUZA 4R4IA 4DR3Q 3JAMc 3U9SA 2SNSA 3U50C 4A3KH 2MJ8A 3T4AC 1SMYC 4C1NK 1SYBA 4DV7L 1B50A 2CQOA 4N8FA 2X69A 3Q8DA 1FNUA 4ALPA 1V8QA 2OTJA 1KIXA 4LNQA 4KJNA 1IW7D 5CV8A 1WOCA 3CCLA 1VF7A 1MI2A 3I8ZA 4OX9L 3NENA 4LFBL 4NW2A 2HT1A 5I9PA 1LLRD 5I4DA 3MWYW 3SVMA 3PO2B 3W2DA 2JA5G 4A3LH 1LT4D 1Y69U 1TY0A 2MGSA 5EPLA 3O13A 4H13C 4DV5L 2D62A 3CCVA 2EJFC 4ZK9B 1I4PA 1SXTA 5IOCA 1RCVD 1KQSA 2ID0A 1VQMA 5FLMG 4O2DA 4AIMA 1XTDA 3UDXA 2KA7A 2K6AA 4RCNA 2Q8TA 4JV5Q 4KY7A 1P8LA 3BG3A 4BBSH 4FYDA 1Q1BA 2PQAB 1EQRA 2KCTA 3FKIH 5G3LD 1JJGA 4Q0FA 4BY1B 4MIUA 1B4OA 1EQTA 3KBXA 1FL0A 3NTHA 3E9HA 1DZ1A 3RR5A 4DN4M 1D7QA 2NN6G 4YCUA 4OXPA 4DV3L 2KVMA 3E0JA 3JAME 1Q90A 4L8JA 4OHJA 4PMWA 3P7JA 3A8KE 5C5MA 5CV6A 3NP8A 3J81i 2B2YC 2DJGC 3FHWA 1PMRA 1X3PA 3NWSA 1BBUA 2MHVA 2PI2A 1SJED 4RKBA 3WOFA 1E2ZA 1PLFA 2EZVA 1HR0W 3R2TA 2F4VL 2VNUD 4F88A 4JK1C 1GKHA 2L1BA 3I91A 1EEFD 4RHRA 5C0XG 4YHHQ 4HAEA 1SN8A 1R9TB 1PYBA 1TU2B 3HOZB 4A3GH 4RG1A 2ICIA 1JOQA 5M3MB 1VQEA 3CCRA 5IT9L 2QILA 3VYUA 1KTKA 3HGBA 4WRDA 2O5JC 3MAQA 3H0GH 5GQOA 2XTIA 3U9OA 1PH7A 3K5MA 1VQ7A 2R93B 1I5FA 1HR0Q 1JMCA 3K58A 3HOWG 2NVQB 1TWHB 2VXWA 4RGTA 2E5LQ 3HEJA 4OL7A 2M00A 3AFPA 3IL8A 3IKJA 4HTHA 1TKWB 1JE5A 4ME5A 4KV6A 4DXGA 4A3JH 1HFGA 1ENAA 1LTLA 4C3JB 1J6QA 1QB5D 4R8IA 1OXSC 4DR1L 1KABA 2GVAA 1SBBB 2AWOA 1FGUA 4J1MA 2A6EC 1I50B 2NVXH 5BR8Q 1X9NA 3R93A 1TS3A 4A3DB 1VQDA 1EU3A 3KOJA 3FRPB 2BA1A 1PH5A 5FLXL 3TEHB 1U9RA 4EQPA 4KD4A 1B44D 4LUOA 5KNDA 1T5EA 5GAHC 2Z0SA 1XTCD 3H3VH 1J8IA 1L1OB 1ICFB 4B9WA 3T1YL 4DV6L 4YWLA 2Q2IA 4OWXB 4DAYB 2C9OA 4KKUA 3GTKH 3SDZA 5HGQA 4AQYL 2V1CC 3OOCA 1SYDA 3V2TA 2TMPA 3NBHA 2WP8J 3ZJYC 1AP0A 3KUPA 4IFDH 2ICEC 1K0RA 3G4SA 1AN8A 1CZWA 3B6YA 4LUVA 3MEHA 2NVYB 1LT5D 3G48A 3SR1A 1ASZA 3NUCA 4DV1L 1EY7A 3MXUA 3HOVG 5C4XB 3CMEA 5M5YB 1HTPA 1KNAA 3KLWA 2LMCB 1CM9A 3AEVA 4LF5Q 1W2BA 3GTPB 3VA5A 2JXMB 1WCMG 2EJMA 3GTLH 1E2VA 4ODGA 2B2VA 4DV0L 4BY7B 2X6LA 2R7ZH 1A62A 1BKBA 1BO0A 3AMUA 2ZXPA 1Q82C 2WAQB 4DNTB 4KHPQ 4N9TA 2B2UC 4N9PA 5E1FA 4B3TQ 4JYAL 2ES2A 2Z6BA 4JOIC 1WD0A 3D6CA 5EKIA 2RA4A 1H9SA 4R1JA 1U4PA 4UP9A 2D2CC 3MC0B 2SOBA 3KF6A 2N78A 5IP9H 1N9WA 1QILA 1MHWC 2EJGC 2B8FA 2KOLA 3FPPA 2F0FA 4DV4Q 2IWHA 1LTAD 2A6HC 1E2WA 1V1OA 3I73A 4X62L 3CU7A 5D14A 2IHFA 2A5HA 1QVGA 2JA8B 1EWCA 4A3CH 3S17B 1K83B 2JSOA 2Y0SB 1PH4A 4L63B 1Y1VH 3HOYG 4C2MH 4A3EH 1X3QA 4PMCA 4Z9CB 1S72A 1PZJD 3NBIA 3NTKA 5M3FB 3D4WA 5LMUQ 1STEA 4YCWA 3S2DH 1EY8A 2UXCL 4NXML 2BE5C 5IYDH 2B63B 3L3OC 4A3IH 3GO5A 2XGTA 1K8AC 4J6HA 2HUGA 1BQQT 4B3ML 1PH1A 3RZDH 4LF7Q 4A3KB 4DR5L 1Y1WG 2EY5A 5LHY1 1L0WA 2K75A 5LMNW 4DR2Q 4R4CA 1FVIA 3VR4A 4O0AA 3KFUA 2VQFQ 1A3TA 4X3TA 1YIJA 4ME3A 2KHSA 1CKNA 2JE6I 3L2PA 1JCKB 2JK8A 3ERQA 4NXNL 4IUUA 3JAML 1WTRA 4G4KA 5LMNQ 5CYUA 2WFWA 1B9MA 1IW7C 3RNUA 2I5HA 4K5WA 1QZGA 4RGOS 5EKKA 3HKZB 3STBD 3U4VA 2DGYA 2L9HA 3Q24A 2UXBL 3T1HL 1L0YB 3CP0A 1OXXK 3OPOA 3P1HA 4R4QA 4BBSB 1YJNA 1SMXA 3FEWX 1L1OA 4K5VA 3EJIA 5M5XH 3H3VI 3FKIB 2KUMA 1A6XA 1UE1A 5FJ8H 4RHSA 1IXRA 2EQSA 4HJ8A 5DLQE 1OO9B 4GN4B 4DAMA 4IPDA 4GLVB 3VDYA 4K5XA 4XYQA 1STYA 4B3SL 3S16H 4G7ZC 2AWNA 1DOKA 1D8LA 4O42A 4PZ8A 3MTSA 3KK7A 1D5MC 2JA7H 4DR4Q 3PO3B 1HNXL 2ZM6L 4KD3A 1PRTF 1GUSA 5ELOA 5KEEA 4QF4A 1GM5A 4JI6L 5CMDA 1D1IA 4DUZQ 1QWYA 1KLGD 1SNOA 1RL2A 4A3GB 3I4MH 1JOOA 1ZEQX 3RMHA 4DK6C 2EYLA 3P75A 1EYCA 3H0GB 2F03A 2KCNA 4UHVA 3K59A 4X66Q 4MN3A 5CBEE 2OF1A 2A8VA 4JI2Q 4LFCQ 4P73A 1E1TA 1IHZA 3CPWA 1JQYD 4DUYL 5DM63 1YNXA 2K4KA 2M2LA 1UAPA 2JA5H 5CV5A 4JI5Q 1X3FA 4DK1A 3M3YH 1VQ6A 1LT6D 1DJRD 3JC66 2IL8A 4FNFA 2NVXB 1Q3LA 1YHBA 1II3A 4H0LC 5C44G 3OW2A 1F9QA 1WTXA 1O7YA 1KL9A 4K8IA 3SE0A 1S4ZA 2DNCA 1LYLA 2PCFB 1GJXA 1DXMA 5FLMH 2RSOA 3I4LA 2A69D 1G91A 2PZUA 2XNAC 1TWFH 1XNQL 4LW1A 4TRDA 2O5IC 3BDOA 3NTIA 5IYCG 3J80E 3W1BA 5FLXc 1N36L 2UUAQ 1BXTA 5JJLA 1IL2A 4JI8L 3K7AH 2ENBA 2EVBA 2N3SA 4JI3Q 2RHSB 1YJWA 3GTKB 5IGDA 3D6WA 5AFWA 3BZKA 2UXDQ 3D8GA 3MFGA 2ALYB 2EY1A 5D3DA 1ASYA 3ULLA 2YYZA 4OWWB 1D5XC 2K01A 1LTTD 1LM0A 1STHA 1STAA 1KRSA 1SNMA 5NUCA 3HOXG 1Z9FA 3TQYA 1ONLA 1C8CA 3K5OA 4WJ3M 2RDGA 1UWVA 3K6OA 3ND8A 5C3WA 5C0XH 3V05A 3RN5A 1KAWA 2VB2X 4KMUC 4F87A 4TQUS 4GLXA 4DR7Q 3OMGA 3GTLB 4GNXB 2PO4A 3OSOA 3I56A 2Z1CA 2R7ZB 4LF8L 1SNDA 2CWAA 1IYJB 2EYOA 4I7AA 1GUTA 2WB1E 4A3FG 1A3UA 5I6YA 3HOWH 2L0CA 1PTOH 1XJVA 4F7XA 4FDBA 4HJAA 3A5ZB 3M85A 3GTQH 1JWUD 2C5CA 4DNRB 5KNCA 3CCQA 4A3BB 2A74C 3UI2A 4JBMA 4HIMA 2NB0A 3VR6A 1RHPA 1S5DD 4HIDA 4C3HG 1YJ9A 1VQ8A 4X65Q 1ILQA 4X3UA 4OGQC 2NZ1D 1OXVA 2R6GA 3UE0A 4IN3A 3RUZA 2E2DC 5JAVA 5IGCA 1ICWA 2K14A 3C46A 3CKIB 1QUQB 1K28A 3NSWA 1VQ9A 3PIP3 1TQOA 2HCIA 3G6EA 2FINB 1E7ZA 2JEBI 2R7FA 4OO1G 2E2HH 1Y1VB 3OTOQ 4JI0Q 1K0SA 3K81C 3T53B 4C2MB 4A3EB 5GAEC 5KIXA 1KHIA 2HDMA 2A73B 2HHHQ 1WD1A 4PQXA 4LFAQ 2B2WA 1HZAA 2NBFA 3OWEB 1HPCA 1EL0A 2PW5A 1G6ZA 2RCNA 2BOSA 3M4YA 4PG3A 3SK5A 4NP5A 4A3IB 2AQ1B 4O1NA 5EGTA 1FJGL 2N88A 3E9IA 1JC7A 1A15A 1OXTA 3VR5A 3RZDB 4CKBA 4OONA 5CC4A 4GLAC 1ESRA 3DMUA 1JORA 1H9KA 3HOVH 2Z6KC 2GN5A 4BBRG 1PZID 2G9DA 2J4XA 3QO2A 1A3VA 1SYEA 5H1SE 1EUJA 2F3VA 1YBYA 4CKCA 1AE3A 1KDAA 1WCMH 5IY0A 2XWBB 2HCCA 1PDQA 1X6OA 4GKJL 2JP1A 2LFNA 4B3RQ 2Z9HA 1M90C 3PV0A 4M1UB 5M3FH 2OWOA 3CHBD 1YNNC 2EXZA 4DK3C 4P75A 4CDFC 1K9MC 4LWCA 1IKLA 1BCPD 1Z7TA 2Q2HA 3V96A 1N33L 1PH3A 4L6TB 3VA7A 4ILWA 2VQEQ 4IFDJ 3K0YA 2NZHA 1X3GA 1SEBD 1VQ4A 4X64L 1IBLL 1SE2A 5M5XB 3NQTA 4YHHL 3X3MA 4RFBA 4AYBE 2F0SA 1LUZA 5DM73 2NN6I 1E24A 1SROA 3A0JA 2VL6A 1X54A 4ZRZA 5G3LF 1NBWA 4GS3A 1B9NA 4BA1I 1ZXTA 3F2DA 5JVH3 1HZ9A 1EWIA 3S16B 1HNWL 4HCEA 1JJCB 1BCPB 4HR7B 1EFID 1VQHA 4LK1C 1SYGA 5JJZA 4QUFA 1A2TA 1R4QB 2LSSA 2JA7B 4L5RC 4YY3L 5BN5A 3TBIB 3PSIA 4XQNA 4GN5A 5C0XI 3K5NA 1H9SB 4GNXA 3H15A 3I4MB 1XMQL 3X3NA 5C3XA 3KLRA 3KF6B 4XT3B 4X6AH 1DYQA 2Q2TA 5DNFA 4DF7A 3W1GA 4YWKA 4KLKA 1IBKQ 4ABNA 1LABA 4S3SA 5JEAG 2UU9Q 1JR0D 2OQ0A 5EQ0A 4DFAA 2F0VA 4B9XA 2VUMG 3J80L 1O78A 4IALA 5CV4A 4HSVA 1NCVA 5FK9C 1VQBA 3J7YW 2K04A 2PMZB 1AZQA 2HQLA 3VYTA 3PO3H 2JA5B 3GQBA 2NUCA 2ZXOA 1C4QA 3M3YB 4KHZA 1VQNA 1PRTC 3CCSA 4K6LA 1KDCA 5DEHA 3TZUA 4JI1Q 2IHEA 2EYHA 1XMOQ 5IP7G 4QMGA 3K7UC 1QUQA 4Q5VA 4XTCS 1FNWA 1C7YA 1Y8OB 2WKCA 1TWFB 2DNEA 5D65A 4LF5L 4DV7Q 2A68C 2NTTA 3DEPA 4DK0A 3M4OB 1EFWA 2LKVA 3CCJA 1CKNB 3K7AB 1GO3E 3CMAA 5LL6X 3D4RA 4TKOB 4B3TL 3E3XA 2LS01 4KJOA 1M1KC 3J81c 4YIJA 1PTOD 3QB3A 2F0LA 2F0QA 5EBDA 5ELEA 2AHOB 1GXDC 2F0JA 1N8RC 1TS5A 4CKEA 1Q1EA 2AUJD 1YNJD 2RF4A 1KXLA 1YZ6A 4LF6L 1ML0D 3NWTA 1XNRQ 2OQKA 1RTNA 1EQVA 3I4NG 4ID6A 4QIWE 1KC8C 2PI2E 3CC7A 3I55A 3HOWB 4BWGB 1E0BA 1D6EC 1PTOB 4IOCA 1EWHA 1HNZQ 1W6KA 3QOLA 1LTGD 1DOLA 1ZKOA 1SE8A 3S1RH 2H1EA 1TWGH 3KLSX 4P2CB 5L37A 3TSSA 1EYGA 3GTQB 1Y14B 3QG1A 4J15A 2PNRC 4IPHA 4XT1B 4KN4C 1JOKA 1X65A 2BA0A 3UE1A 3D0FA 4JI7L 2DY8A 2XN9C 4ZQ3A 2HDLA 2WB1G 5C44H 2CHBD 3DWPA 3J7ZC 4LF7L 1CFMA 3J81E 4NB3A 4EQOA 5C6AA 2JA6G 2CCZA 3ONAB 2RCFA 3CAMA 4I7ZC 4RGMA 1B2TA 2Z4HA 5IYCH 2ZT9C 1S5CD 1N32Q 2E2HB 1VQCA 2EY2A 4PMBA 4PZ7A 1PFBA 2XWJB 2ZXRA 4A3BH 4EQNA 1GHJA 2OEOA 1IYVA 4HN7A 1CKMA 1O80A 5GAGC 4DR1Q 1MGSA 3K0XA 4DA2A 4HSPA 3WOEA 2CW0D 2R92H 3KYHC 4DAPA 1VQGA 2O2LD 3L0OA 3Q0AA 3HOXH 2XRQD 3HOVB 3M4PA 4KI0A 3S14B 2YTVA 4QCLA 2F0IA 2RDFA 5A35A 3CXCA 3K57A 2YTYA 1JJ2A 1WCMB 2D0OA 3F2UA 3BJUA 1I3QB 5IGGA 5IWAQ 4QJFA 4CBVA 3S1QH 3Q22A 1SNCA 5M5WH 4DAVA 1B53A 3T1YQ 4A3FH 5AJ3Q 4DV6Q 2PZWA 1TXYA 4DGZA 4OIKA 5I9OA 1V1PB 2R7DA 5FKAC 4IUNA 4DR6L 2JA9A 3RLOA 3A56A 4I65A 2EPBA 2J7ZA 1N34L 2P5ZX 3MXNA 3S9WA 1WTVA 1CA6A 5JVG3 1V9PA 1WFQA 5EBCA 1RF2D 1PV4A 2B2VC 3E6ZX 4MHEA 3QJYA 1TVXA 3FDTA 3A55A 4C3HH 1IBML 4IURA 1MBYA 4DUZL 2SEBD 4DV1Q 4H02A 3TZDA 4MNOA 1U5KA 1GD7A 4RKLA 5C3EG 3DEOA 4XYOA 4M8AA 3M9BA 1BCPC 2QDLA 2K52A 3VR3A 3T13A 1SE4A 3UDIA 3HRZC 1Q8IA 3T51B 5C0XJ 3FP9A 4CHTB 4X66L 4DV0Q 2L4NA 3FVQA 1F2ZA 4LFCL 1QVCA 4JI2L 1VQKA 3SHLA 2B8GA 1JB7A 2F0MA 3HOYB 4RMFA 4A76A 1AH9A 3GTMH 3HG9A 4POFA 1Y8NB 3I72A 2D9UA 3A8IE 4AYBG 1VMPA 4JI5L 4JYAQ 3SK6A 2LXJA 4HMJA 3K80C 2VY3A 1EU4A 1SMYD 3UDFA 2CVRA 4FVMA 2CH4A 2HIXA 3CQZH 2F0GA 4IJHA 3HOUG 5A2QE 1CHPD 1HFNA 1I4HA 1Y1WB 5EPJA 1UEAB 1PH6A 5LL6S 4HMIA 2K32A 1Z47A 3K5LA 4BBRH 1ET6A 3KF8B 4R4TA 2B29A 3PF5A 1EQQA 3CW2C 1SFOH 1O7LA 3PCOB 1OTCA 3S2HH 1MSGA 3LWEA 1I4GA 2KEEA 1IZ6A 1DCZA 2E76C 5GROA 3OIPA 3H94A 4X62Q 1I94Q 2UUAL 2B39A 3NQIA 3I3CA 1UE5A 2KHIA 5HGTA 4JI3L 5ELNA 1YHAA 4A3JG 2OCEA 3J80c 4JI4L 1I4QA 4XXEA 3BYYB 3VR2A 1FR3A 2RDHA 3GTGH 4BS9A 4UAIA 4FXDA 4R9WA 1SNQA 2L11A 4DV2L 2ZJQA 2UXCQ 2A19A 3FPUB 4NXMQ 1UE6A 4K14A 1CKOA 4FF1A 1GUNA 1XX8A 4DR5Q 2C35B 4TSSA 3KJOA 2MP1A 1L0XB 1G2SA 4U673 3MHBA 1I4XA 3BU2A 1NY4A 3BDLA 3TP8A 5ELFA 2Q8IB 4DR7L 1SLJA 3PUYA 5ELCA 4DKAC 4X3SA 2F3WA 1F2LA 1NNXA 1DD2A 1SSOA 3D3RA 3IAYA 3TRZA 1OXUA 3J7A5 4C3IG 1CQFA 1NSNS 2N49A 1J5EQ 3ER0A 1STNA 4OWTB 3HFZB 3BZDB 3PIPA 1YITA 4JCVE 5E4XA 3R3OA 1L1OC 2XVSA 4MTKA 4IFDG 1CI3M 4GOPA 4UPAA 4LF4Q 4WFN3 4X65L 2VZAA 2ASBA 2F0TA 1GUGA 1ENCA 4LMQD 4NDXA 3MXPA 4DXFA 4KN7C 4IUQA 1FNVA 3M4OH 1SJHD 2GA4B 1VQJA 1V1QA 2NN6H 1X32A 2ZJRA 3J81L 2EE1A 4GKKQ 4WJ4A 1EZ6A 3GTOH 1V1PA 2E8GA 3CRKC 2K05A 5JEAH 3OYYA 1YNJC 2LXKA 5IYBG 4A3MG 2VUMH 2A6ED 2IX1A 3S1RB 4KY6A 1TWGB 2BCOA 4NMZA 5M9OA 5T1IA 3TREA 4B3SQ 1STGA 2E2IH 5F2DA 2J0TD 3RD4A 1Q46A 1Q7YC 1XXGA 2EXDA 2TSSA 1JB3A 3A8JE 2K5NA 3VYRA 4OEMB 2WAQE 1QE6A 5DAUA 1MSHA 4L5SA 4XQQA 1HNXQ 4FF2A 1WJJA 1PHJA 5C44B 4JI6Q 1EIFA 4CDDC 1TWAH 1XPRA 2HQEA 1DOMA 1EIYB 5IP7H 3G6JB 5HY6A 1H9RA 1DGSA 1S5ED 1STBA 4OO1I 4A93G 1BR9A 4WJWA 4RGNA 2F0KA 3KDFA 3CD6A 2KENA 2L12A 3GDEA 2L55A 2HIVA 2MO1A 4B3RL 2QCPX 3WWVA 4JC0A 4KHVA 2K5QA 2H4OA 1BF4A 4G7OC 2K50A 4CJ2C 3SGIA 1GOZA 2KJXA 4FXGC 2Y0SE 3N6RA 1VQOA 2A1AA 1B8AA 4FO2A 2B2TA 4DR3L 1KAAA 2NVTH 5KGUA 2R92B 1XWEA 5EJWA 5EPKA 1Q12A 3KF8A 2Z8LA 3HOXB 2I5LX 3VYSA 1JT8A 2K1BA 4RCOA 5CBAE 1EY0A 4BXXG 4JVZA 4DU9A 2F0PA 4TVAB 5J3BA 4N8X1 5IE8A 3HZXA 4L5TA 3GD7A 1SE3A 3I4NH 1U4MA 2EIFA 3KLSA 3S1QB 4JBKA 1CK1A 5K36G 1TS4A 5M5WB 1QZHA 1VDZA 4A3FB 2IX0A 2QW7A 2EDGA 4ZAIA 4JI8Q 3S15H 4WORA 3OIQA 3CRLC 5CORA 4IOAA 2QEXA 4YWMA 1PFNA 3KJPA 4G57A 2BH8A 4JV5L 5D3IB 3LGJA 4C3HB 1K8MA 3S14H 2KCMA 3JAMi 1BCPF 1HZBA 1EYAA 2A6HD 2VS1A 4F8MA 1CUKA 1I6VC 3DHQA 1HUMA 3P20A 3HKZE 1I3QH 1HTLD 5A2QL 2F0UA 4FXKC 1PYWD 4HJ9A 3NPPA 5T1GA 5IODA 1E3PA 2JA6H 2AQ2B 2D0PA 4P71A 1C9OA 3F8TA 1HH2P 1M4VA 3PO2G 2SDFA 3TS2A 4Y7NH 1VF5C 1VQAA 3IFDA 3GTMB 3QR8A 5EAYA 3NK9A 3TP5A 3CCEA 3SXHA 1F2MA 3I7FA 1JE4A 4EQ5A 2KHJA 3CQZB 2F52A 1MJEA 4P72A 2B2YA 3STBC 4POGA 1K73C 1VCIA 1U4LA 2KCCA 4BY1G 1LV9A 4LJZC 3OW7A 1YHQA 3EIVA 3TP7A 4DPGA 3H09A 3HKSA 4H44C 4LF9Q 1HR0L 4BBRB 3J81j 3NHHA 2E5LL 4QB4A 4X3KA 1SFOB 1E1OA 1W6JA 1PVOA 2B2WC 2MO0A 3S2HB 4FF4A 4R8NA 2UUBQ 1GUOA 3HOYH 4ZCKA 1LTBD 3URYA 3BVMA 1TT2A 2EOTA 4EX5A 1B3QA 1YI2A 1NTGA 4G7HC 3M4QA 1YEZA 1S5BD 4KTAA 1AW7A 3G7LA 1R4PB 5BR8L 3WDNA 3RLFA 3GTGB 2BDNA 1EY4A 2JJQA 4IUTA 4K0KQ 1FJGQ 2BDOA 1Y1WH 2FMMA 3HOZG 2ZTDA 2KEDA 4C1NI 2DN8A 3HP3A 2E75C 3GP7A 5M3MG 1MJCA 2RVLA 3EA6A 4V190 1SYCA 1VQIA 3MZ5A 5C3EH 4HCSA 2R93G 1B7YB 1G291 2M9VA 4FP5D 4ZLTF 1XNRL 3EBEA 5J1ZA 2WACA 1FGBD 4QQBX 1UEBA 4CDCC 3GV3A 3A74A 1F77A 1JWSD 4GKJQ 3PIO3 4C3JG 3PGZA 4P74A 4HJ5A 3C3LA 1HNZL 2AKWB 1RIPA 3DWAA 1HRJA 3PMFA 3H3VC 1HUNA 3A54A 2IW3A 1HQRD 3HS0C 4R4OA 4A3DG 3MXNB 1L2FA 2UUCQ 1WYDA 3DM1A 1N33Q 2RQXA 5ISRA 1PTOF 5KYIA 1Q86C 1H9MA 2I07B 3TS0A 2PW7A 3S1MH 4BA2I 3D31A 1IBLQ 3HOUH 4X64Q 3LX0A 2CH4W 4ULLA 2Q8RE 2I0QA 1QNUA 1RODA 1T9HA 4KK7A 2FXQA 1BNZA 1CT1D 2A69C 4OX9Q 1H95A 3GTOB 4LFBQ 4GN3B 3PUXA 2OT2A 3LWUA 4KHPL 1LTRD 2RKSA 2JEAI 1RJTA 1ZYRD 2QKIC 5IGBA 1N32L 2VUMB 1WTOA 1SR3A 1TIID 2CFMA 3IRBA 4ZUJA 2L5TA 1FYCA 2FHTA 4IQZA 1EEID 1HNWQ 2EYJA 2E2IB 1H9JA 4DV5Q 4GNXC 1KLUD 3RZOH 4K2LA 3MXGA 3S1NB 5JPNC 1SDFA 5FOBB 3DLLA 2B2UA 1AE2A 4ZKCB 3CF5A 4YY3Q 3H91A 5C4XG 2VB3X 5BN3A 2KECA 4JOIA 1TWAB 4UY8C 2BH2A 1F9RA 4DV4L 3DWQA 1XMQQ 4MZ9A 2F4IA 4MTNA 1S3OA 4BY7G 4KY5A 4DNIA 1UUPA 1J9OA 4DV3Q 2WAQG 3F1ZA 4CJ0B 3QIAA 3BVZA 1PH8A 3AU7A 2NTSA 2L15A 5IWAL 1M8AA 3J7AF 1HA6A 4CJ1B 2HD3A 1WTHA 1QG7A 1JWMD 2JN4A 5FO8B 3A5UA 5LMUL 4C3IH 5AJ3L 3I70A 1VS0A 2YTXA 4J8QA 4HJ7A 1D1KA 5I2YA 1QVFA 1ENFA 3CCMA 2F4VQ 3MA2B 1Y8PB 3TDQA 2WV6D 2QGQA 1SYFA 1A8VA 2IJ0A 2NVTB 4K6DA 1LTID 3E5SA 2K7VA 3SEBA 5K5PA 1AEXA 4DR2L 3ITPA 3OHXC 2VQFL 2I5MX 2EYPA 2CWPA 2YU9B 1TWCH 2R3ZA 2JA8G 1KNEA 1B70B 1MKHA 1U0LA 1WVLA 2Y0SG 3I4NB 1ESFA 5E4WC 1KD1C 3PUZA 4RWSC 2E2JH 1G6PA 2D5DA 3L9AX 1Z6HA 5LMNL 4A4IA 5J39A 5IYBH 4A3MH 2IT1A 2NYZD 3MFYA 1BBWA 4EGVA 5M3FG 3S15B 3ERSX 5CV7A 5HURA 1KDBA 2JYOA 2B63G 1BOSA 1EOVA 2RBMA 4L5QA 2XSCA 3DM3A 2G5DA 1A2UA 2IX3A 4GOPB 4A3KG 4HIKA 1I6HH 1O7IA 4QL5A 2PQAA 2WB1B 3AYHB 2IPKD 1CSQA 3C1FA 3QWNA 4LF6Q 1XPUA 2JA6B 1HZCA 3OMCA 3ND9A 5FO7B 2PNHA 4OELB 2N55A 1VQLA 5IGFA 3SK8A 3EFXD 2MFIA 4U68A 4FF3A 4A93H 4A3LG 4Y7NB 1I94L 4AQYQ 3T16A 1T5XD 2KQ3A 5JEAJ 4HEDA 4RH6A 2FMCA 3G71A 1EY9A 4DR4L 1PA6A 2F0EA 3NELA 3TMEA 3HKZG 1K8GA 4IZ8A 1CA5A 5CGKA 2EYMA 5ELBA 3C1EA 5KRUA 2JQOA 2PQEA 3KBGA 1XPOA 5IIFA 1PZKD 4JI7Q 2F0NA 4BBSG 1EOTA 1EIHA 1ET9A 1LACA 5EKLA 2OXPA 3FKIG 2G9HD 3M7NA 1WTWA 1YVCA 1K3RA 2X6GA 4IPCA 4BXXH 4UP8A 2FFKB 3ZYYX 2PZTA 2WKDA 3GTJH 1UNSA 1O7ZA 3SK4A 4ZKBB 4OO1H 4KKSA 1F2YA 1YNND 1PYSB 2GVBA 3F2CA 2KBNA 4C56C 3KDFB 1NE3A 1S40A 3PF4A 5K36H 2OTLA 2F3IA 1J5EL 3TP6A 3H6MA 1GVPA 3MEFA 3PO3G 3M7GA 5C4JH 2N8NA 4UDUC 1KRTA 2LY7A 4H7BA 1SRUA 4JPBW 2K28A 3J80i 4IPGA 1CTMA 2PMZE 1WI5A 2O4XA 1DONA 4LF4L 4A3GG 5CR3A 2RHQB 1PFSA 2SNMA 1B3AA 3BYTB 3LNNA 3Q23A 4QUCA 3H0GG 4YCVA 1TS2A 1QCBD 3BDCA 5C3EB 1LO5D 1WTQA 1A0IA 4GKKL 4DAYA 4XQJA 1E22A 3N52A 2UXDL 4IJLA 2QA4A 3CC4A 3PO2H 1PXUA 3AQQA 2R61A 3MVVA 3CC2A 4PV1C 4IFDI 1NR2A 4DR6Q 1RTOA 4AYBB 1N34Q 2K33A 4B3MQ 3BVGA 5C4HA 2F1MA 4V0BA 1RKNA 3S1MB 1IBMQ 3HOUB 5C5LA 2PYKA 4GZYC 1HA5A 3GV6A 1TR5A 5CV9A 1NJIC 2B3GA 4BY1H 1HQMC 4ZUIA 1VQFA 2ZJPA 1B1ZA 2NZOA 4NXNQ 3R8BA 1NR4A 3R2IA 1G51A 3EVQA 5IT9c 1K3BC 1GHKA 3U4ZA 1PRTD 1CSPA 4XIGS 1Q8KA 4CGYB 1TY2A 3IFTA 3RZOB 1PFMA 2PPBC 1C0AA 1QOHA 1S5FD 1LTSD 1U4RA 4A3JB 2DJFC 5IGEA 2XRSD 1NMFA 2QF7A 1EZ8A 1RD9D 2UXBQ 3T56B 1ZYRC 1VMCA 3K8AA 3T1HQ 1F9SA 3FMCA 1BDOA 1PTOC 2WINB 5I2XA 2QDBA 2A68D 2MUYA 2YV5A 4JG2A 1R9TH 1P16A 2EYFA 3HOZH 4APVA 5E7NA 1AZPA 5M3MH 4JBJA 4IUPA 1UE7A 2R7ZG 1BUVT 2K5HA 2K5WA 3RN2A 3UDGA 4RAUC 1DM0B 2R93H 2NVQH 3OTOL 4JI0L 1BBXC 1PRTB 1TWHH 1GUWA 3AB9A 1FD7D 5E3FA 2F0WA 2FJ2A 1X55A 2HHHL 1EY6A 1EIGA 2EY6A 2F0HA 4LFAL 1V43A 1MD2D 5TSSA 4C3IB 3S1NH 1D2BA 4IUVA 1SNPA 4C3JH 4A3BG 3ULJA 2MPMA 3NEMA 4E6IA 2ZM6Q 4JI4Q 2E74C 5COYA 1I50H 3A7AB 4CDEC 3J7AV 3E0EA 4PZ6A 1K8OA 1A63A 1ILPA 1NUCA 4A3DH 1SAPA 5IP9G 2F0OA 4DV2Q 2R92G 2CQAA 2CKZB 5I6WA 5IT9E 2XIWA 3ULPA 1LT3D 4ZYSA 3S24A 2MQHA 4NPSA 1G2TA 4HIOA 4NKLA 1TWCB 3L7ZC 2AQ3B 5KNBA 4K2KA 3W3AA 1HJPA 3RLNA 4A3CG 1C48A 2H5XA 3AFQA 2AUKA 1Y1VG 5BN4A 1D5ZC 3I4OA 4A3EG 2E2JB 2Z6KA 4DUYQ 4GOPC 4A3MB 4A75A 2I46A 4EVOA 3NE5B 4PNYA 1IKMA 4KKTA 2DY7A 3PUWA 3Q6SA 2MNAA 5IYDG 4A3IG 2DUDA 1VQPA 1VQ5A 2VQEL 1CHQD 2K5VA 2NVYH 3D4DA 5FLXE 1I4RA 1I6HB 3EN2A 4QIWB 2WIIB 5C4XH 2YU9H 5GADC 5M5YH 1XNQQ 2K03A 4LUZA 2CW0C 3GTPH 1EY5A 1W3SA 3NXWA 3OWFA 1WTPA 3ICEA 1NAPA 1N36Q 3BS1A 4LAAA 1HHVA 1IL8A 1BVSA 1NMGA 4LF9L 3PUVA 5FO9B 2VW9A 2Q2UA 4BY7H 2V4DA 3A7LA
chains in the Genus database with same CATH topology
4A93B 1HXYD 1EYDA 2K5DA 2QEJC 1IYUA 4B08A 4OIJA 1QNKA 3DXJC 2F0DA 3S2DB 3EROA 1G8ZD 5JOBA 1XYIA 4XDXA 3C2PA 4RA8A 1QJOA 4JBWA 4K8JA 5C4ZA 1CZGA 1CQVA 5JPMC 3QOJA 3EQLC 2Z4IA 5ELDA 3GTJB 1RDPD 1HCZA 1JICA 2BE5D 3TN2A 5KYLA 1F9PA 2B2TC 2NWGA 2RSNA 5C4JB 1AFPA 5J22A 3I90A 3DUZA 3U9SA 2SNSA 2MJ8A 3T4AC 1SMYC 4C1NK 1SYBA 1B50A 2X69A 1FNUA 1V8QA 4KJNA 1IW7D 5CV8A 1VF7A 1MI2A 3I8ZA 4NW2A 5I9PA 1LLRD 5I4DA 3MWYW 3SVMA 3PO2B 3W2DA 1LT4D 1Y69U 1TY0A 2MGSA 5EPLA 3O13A 4H13C 2D62A 2EJFC 4ZK9B 1I4PA 1SXTA 5IOCA 1RCVD 2ID0A 2KA7A 2K6AA 4RCNA 2Q8TA 4KY7A 3BG3A 4FYDA 1Q1BA 5G3LD 4Q0FA 4BY1B 4MIUA 1B4OA 1EQTA 3KBXA 3NTHA 1DZ1A 4DN4M 2NN6G 2KVMA 3E0JA 3JAME 1Q90A 4L8JA 4OHJA 4PMWA 3P7JA 3A8KE 5C5MA 5CV6A 3NP8A 2B2YC 1PMRA 1X3PA 3NWSA 2MHVA 1SJED 4RKBA 3WOFA 1E2ZA 1PLFA 2EZVA 3R2TA 2VNUD 4F88A 4JK1C 2L1BA 3I91A 1EEFD 4RHRA 5C0XG 4HAEA 1R9TB 1TU2B 3HOZB 2ICIA 1JOQA 5M3MB 5IT9L 2QILA 3VYUA 1KTKA 3HGBA 4WRDA 2O5JC 3MAQA 3U9OA 3K5MA 2R93B 2NVQB 3K58A 1TWHB 2VXWA 4RGTA 3HEJA 4OL7A 2M00A 3IL8A 3IKJA 4HTHA 1TKWB 4ME5A 4KV6A 4DXGA 1HFGA 1ENAA 4C3JB 1QB5D 4R8IA 1OXSC 1KABA 1SBBB 2AWOA 4J1MA 2A6EC 1I50B 3R93A 1TS3A 4A3DB 1EU3A 3FRPB 2BA1A 5FLXL 1U9RA 4EQPA 4KD4A 1B44D 5KNDA 1T5EA 1XTCD 1J8IA 4B9WA 2C9OA 4KKUA 3SDZA 3OOCA 1SYDA 3V2TA 2TMPA 3NBHA 2WP8J 1AP0A 3KUPA 4IFDH 2ICEC 1AN8A 1CZWA 3MEHA 2NVYB 1LT5D 3SR1A 3NUCA 1EY7A 3MXUA 5C4XB 5M5YB 1HTPA 1KNAA 2LMCB 1CM9A 3GTPB 3VA5A 2JXMB 2EJMA 1E2VA 4ODGA 2B2VA 4BY7B 2X6LA 3AMUA 1BO0A 2ZXPA 2WAQB 4DNTB 4N9TA 2B2UC 4N9PA 5E1FA 1WD0A 3D6CA 5EKIA 2RA4A 1H9SA 1U4PA 2D2CC 3MC0B 2SOBA 1QILA 2EJGC 2B8FA 2KOLA 3FPPA 2F0FA 2IWHA 1LTAD 2A6HC 1E2WA 1V1OA 3I73A 3CU7A 5D14A 2A5HA 2JA8B 1EWCA 3S17B 1K83B 2JSOA 2Y0SB 4L63B 1X3QA 4PMCA 4Z9CB 1PZJD 3NBIA 3NTKA 5M3FB 3D4WA 1STEA 1EY8A 2BE5C 2B63B 3L3OC 3GO5A 4J6HA 2HUGA 1BQQT 4A3KB 2EY5A 5LHY1 3VR4A 1A3TA 4X3TA 2KHSA 2JE6I 1JCKB 3ERQA 4IUUA 3JAML 1WTRA 4G4KA 5CYUA 1B9MA 1IW7C 4K5WA 4RGOS 5EKKA 3HKZB 2L9HA 3Q24A 1L0YB 3OPOA 1OXXK 3P1HA 4BBSB 3FEWX 4K5VA 3EJIA 3FKIB 2KUMA 1A6XA 4RHSA 1OO9B 4K5XA 4XYQA 1STYA 4G7ZC 2AWNA 1DOKA 4O42A 3MTSA 3KK7A 1D5MC 3PO3B 4KD3A 1PRTF 1GUSA 5KEEA 4QF4A 5CMDA 1D1IA 1QWYA 1KLGD 1SNOA 4A3GB 1JOOA 1ZEQX 3RMHA 2EYLA 3P75A 1EYCA 3H0GB 2F03A 2KCNA 3K59A 4MN3A 5CBEE 2OF1A 1IHZA 1JQYD 5DM63 2M2LA 1UAPA 5CV5A 4DK1A 1LT6D 1DJRD 4FNFA 2IL8A 2NVXB 1Q3LA 1II3A 4H0LC 1F9QA 1WTXA 1O7YA 3SE0A 4K8IA 1S4ZA 2DNCA 2PCFB 1GJXA 1DXMA 2RSOA 3I4LA 2A69D 1G91A 2PZUA 2XNAC 4TRDA 2O5IC 3BDOA 3NTIA 3J80E 1BXTA 2ENBA 2EVBA 3GTKB 5IGDA 3D6WA 5AFWA 3D8GA 3MFGA 2EY1A 5D3DA 2YYZA 1D5XC 2K01A 1LTTD 1STHA 1STAA 1SNMA 5NUCA 1ONLA 1C8CA 3K5OA 2RDGA 3K6OA 3ND8A 5C3WA 5C0XH 3V05A 2VB2X 4KMUC 4F87A 4TQUS 3OMGA 3GTLB 2PO4A 3OSOA 2Z1CA 2R7ZB 1SNDA 2EYOA 1GUTA 1A3UA 5I6YA 2L0CA 1PTOH 4F7XA 3M85A 1JWUD 2C5CA 4DNRB 5KNCA 4A3BB 2A74C 3UI2A 2NB0A 3VR6A 1RHPA 1S5DD 4C3HG 1ILQA 4X3UA 4OGQC 2NZ1D 1OXVA 2R6GA 4IN3A 3RUZA 2E2DC 5JAVA 5IGCA 1ICWA 3C46A 3CKIB 3NSWA 3PIP3 1TQOA 2HCIA 2FINB 2JEBI 4OO1G 1Y1VB 4C2MB 3T53B 4A3EB 5KIXA 2HDMA 2A73B 1WD1A 4PQXA 2B2WA 2NBFA 3OWEB 1HPCA 1EL0A 2PW5A 1G6ZA 2BOSA 3M4YA 3SK5A 4NP5A 4A3IB 2AQ1B 4O1NA 5EGTA 2N88A 1JC7A 1A15A 1OXTA 3VR5A 3RZDB 4CKBA 5CC4A 1ESRA 3DMUA 1JORA 1H9KA 1PZID 2G9DA 2J4XA 3QO2A 1A3VA 1SYEA 2F3VA 4CKCA 1KDAA 2XWBB 2HCCA 1PDQA 2JP1A 2LFNA 3PV0A 4M1UB 3CHBD 1YNNC 2EXZA 1IKLA 1BCPD 1Z7TA 3V96A 4L6TB 3VA7A 4ILWA 4IFDJ 3K0YA 1SEBD 1SE2A 5M5XB 3NQTA 3X3MA 4RFBA 2F0SA 5DM73 2NN6I 4ZRZA 5G3LF 1B9NA 4BA1I 1ZXTA 5JVH3 3S16B 4HCEA 4HR7B 1BCPB 1EFID 4LK1C 1SYGA 5JJZA 4QUFA 1A2TA 1R4QB 2JA7B 5BN5A 3TBIB 4XQNA 5C0XI 3K5NA 1H9SB 3I4MB 3X3NA 5C3XA 3KLRA 4XT3B 1DYQA 5DNFA 4DF7A 4ABNA 1LABA 4S3SA 5JEAG 1JR0D 5EQ0A 4DFAA 2F0VA 4B9XA 3J80L 1O78A 4IALA 5CV4A 4HSVA 1NCVA 5FK9C 3J7YW 2K04A 2PMZB 1AZQA 3VYTA 2JA5B 3GQBA 2NUCA 2ZXOA 1C4QA 3M3YB 4KHZA 1PRTC 4K6LA 1KDCA 5DEHA 3TZUA 2EYHA 4QMGA 4Q5VA 4XTCS 1FNWA 1Y8OB 2WKCA 1TWFB 2DNEA 5D65A 2A68C 2NTTA 3DEPA 4DK0A 3M4OB 2LKVA 3K7AB 5LL6X 3D4RA 4TKOB 2LS01 4KJOA 4YIJA 1PTOD 3QB3A 2F0LA 2F0QA 5EBDA 5ELEA 1GXDC 2F0JA 1TS5A 4CKEA 1Q1EA 2AUJD 1YNJD 1ML0D 3NWTA 1RTNA 1EQVA 4ID6A 3HOWB 4BWGB 1E0BA 1D6EC 1PTOB 1EWHA 1W6KA 1LTGD 1DOLA 3QOLA 1ZKOA 2H1EA 3KLSX 4P2CB 3TSSA 3GTQB 3QG1A 2PNRC 4XT1B 4KN4C 1JOKA 2BA0A 2DY8A 2XN9C 4ZQ3A 2HDLA 2CHBD 3DWPA 1CFMA 3J81E 4EQOA 5C6AA 3ONAB 4I7ZC 4RGMA 1B2TA 2Z4HA 2ZT9C 1S5CD 2E2HB 2EY2A 4PMBA 1PFBA 2XWJB 2ZXRA 4EQNA 1GHJA 2OEOA 1IYVA 4HN7A 1O80A 1MGSA 4DA2A 4HSPA 3WOEA 2CW0D 4DAPA 2O2LD 3Q0AA 2XRQD 3HOVB 4KI0A 3S14B 4QCLA 2F0IA 2RDFA 5A35A 3K57A 1WCMB 3F2UA 1I3QB 5IGGA 4CBVA 3Q22A 1SNCA 4DAVA 1B53A 2PZWA 4DGZA 4OIKA 5I9OA 1V1PB 5FKAC 4IUNA 3A56A 4I65A 2EPBA 2J7ZA 3MXNA 3S9WA 1WTVA 1CA6A 5JVG3 5EBCA 1RF2D 2B2VC 3E6ZX 4MHEA 3QJYA 1TVXA 3FDTA 3A55A 4IURA 1MBYA 2SEBD 3TZDA 4RKLA 3DEOA 4XYOA 4M8AA 1BCPC 3VR3A 3T13A 1SE4A 3HRZC 1Q8IA 3T51B 5C0XJ 4CHTB 2L4NA 3FVQA 1F2ZA 3SHLA 2B8GA 2F0MA 3HOYB 3HG9A 1Y8NB 3I72A 2D9UA 3A8IE 1VMPA 3SK6A 4HMJA 1EU4A 1SMYD 2CVRA 4FVMA 2F0GA 5A2QE 1CHPD 1HFNA 1I4HA 1Y1WB 5EPJA 1UEAB 5LL6S 4HMIA 2K32A 1Z47A 3K5LA 1ET6A 1O7LA 1MSGA 3LWEA 1I4GA 2KEEA 1DCZA 2E76C 3OIPA 3H94A 2B39A 3NQIA 3I3CA 5HGTA 1I4QA 4XXEA 3BYYB 3VR2A 1FR3A 2RDHA 4BS9A 4UAIA 4FXDA 4R9WA 1SNQA 2L11A 3FPUB 4K14A 4FF1A 1GUNA 1XX8A 4TSSA 2MP1A 1L0XB 1G2SA 4U673 3MHBA 1I4XA 3BDLA 3TP8A 5ELFA 2Q8IB 3PUYA 5ELCA 4X3SA 2F3WA 1F2LA 1DD2A 1SSOA 3D3RA 3IAYA 1OXUA 4C3IG 1CQFA 1NSNS 1STNA 3BZDB 5E4XA 3R3OA 2XVSA 4IFDG 1CI3M 4WFN3 2F0TA 1GUGA 1ENCA 4LMQD 4NDXA 3MXPA 4DXFA 4KN7C 4IUQA 1FNVA 1SJHD 2GA4B 2NN6H 1X32A 3J81L 2EE1A 1EZ6A 1V1PA 3CRKC 2K05A 5JEAH 1YNJC 2A6ED 2IX1A 3S1RB 4KY6A 1TWGB 2BCOA 4NMZA 5M9OA 5T1IA 1STGA 5F2DA 2J0TD 3RD4A 1XXGA 2TSSA 1JB3A 3A8JE 3VYRA 1QE6A 5DAUA 1MSHA 4XQQA 4FF2A 5C44B 2HQEA 1DOMA 3G6JB 1H9RA 1S5ED 1STBA 4OO1I 1BR9A 4WJWA 4RGNA 2F0KA 2L12A 2L55A 2QCPX 4KHVA 2K5QA 2H4OA 1BF4A 4G7OC 4CJ2C 1GOZA 2KJXA 4FXGC 3N6RA 4FO2A 2B2TA 2R92B 1KAAA 5KGUA 1XWEA 5EJWA 5EPKA 1Q12A 3KF8A 2Z8LA 3HOXB 3VYSA 2K1BA 4RCOA 5CBAE 1EY0A 4DU9A 2F0PA 3HZXA 3GD7A 1SE3A 1U4MA 3KLSA 3S1QB 1CK1A 5K36G 1TS4A 5M5WB 1VDZA 4A3FB 2IX0A 2EDGA 4ZAIA 4WORA 3OIQA 3CRLC 5CORA 1PFNA 4G57A 5D3IB 4C3HB 1K8MA 1BCPF 1EYAA 2A6HD 4F8MA 3DHQA 1I6VC 1HUMA 3P20A 1HTLD 5A2QL 2F0UA 4FXKC 1PYWD 3NPPA 5T1GA 5IODA 2AQ2B 1M4VA 2SDFA 1VF5C 3IFDA 3GTMB 3NK9A 3TP5A 3SXHA 1F2MA 1JE4A 3CQZB 2B2YA 1VCIA 1U4LA 2KCCA 1LV9A 4LJZC 3OW7A 3TP7A 3H09A 4H44C 4BBRB 3NHHA 4QB4A 4X3KA 1SFOB 1W6JA 2B2WC 3S2HB 4FF4A 4R8NA 1GUOA 1LTBD 3URYA 3BVMA 1TT2A 2EOTA 4G7HC 1S5BD 4KTAA 1AW7A 3G7LA 1R4PB 3WDNA 3RLFA 3GTGB 2BDNA 1EY4A 4IUTA 2BDOA 2FMMA 2KEDA 4C1NI 2DN8A 3HP3A 2E75C 3GP7A 2RVLA 3EA6A 4V190 1SYCA 3MZ5A 4HCSA 1G291 2M9VA 4FP5D 4ZLTF 5J1ZA 2WACA 1FGBD 3GV3A 1F77A 1JWSD 3PIO3 4C3JG 3C3LA 3DWAA 1HRJA 3PMFA 3H3VC 1HUNA 3A54A 2IW3A 1HQRD 3HS0C 3DM1A 2RQXA 5ISRA 1PTOF 5KYIA 1H9MA 2I07B 2PW7A 4BA2I 3D31A 3LX0A 4ULLA 2Q8RE 1QNUA 1RODA 4KK7A 1BNZA 1CT1D 2A69C 3GTOB 3PUXA 2OT2A 3LWUA 1LTRD 2RKSA 2JEAI 1RJTA 1ZYRD 2QKIC 5IGBA 2VUMB 1WTOA 1TIID 4ZUJA 2L5TA 1FYCA 2FHTA 4IQZA 1EEID 2EYJA 2E2IB 1H9JA 1KLUD 4K2LA 3MXGA 3S1NB 5JPNC 1SDFA 5FOBB 2B2UA 4ZKCB 3H91A 2VB3X 5BN3A 2KECA 1TWAB 1F9RA 3DWQA 2F4IA 4KY5A 1UUPA 1J9OA 4CJ0B 3QIAA 3BVZA 3AU7A 2NTSA 1HA6A 3J7AF 1M8AA 4CJ1B 1QG7A 1JWMD 5FO8B 3I70A 4J8QA 1D1KA 5I2YA 1ENFA 3MA2B 1Y8PB 3TDQA 2WV6D 1SYFA 2NVTB 2IJ0A 4K6DA 1LTID 3E5SA 2K7VA 3SEBA 5K5PA 1AEXA 3ITPA 3OHXC 2EYPA 2YU9B 2R3ZA 1KNEA 1WVLA 3I4NB 1ESFA 5E4WC 3PUZA 4RWSC 2D5DA 3L9AX 1Z6HA 5J39A 2IT1A 2NYZD 3MFYA 4EGVA 3S15B 5CV7A 5HURA 1KDBA 2JYOA 1BOSA 2RBMA 2XSCA 1A2UA 2IX3A 2WB1B 2IPKD 3C1FA 3QWNA 2JA6B 3OMCA 3ND9A 5FO7B 2N55A 5IGFA 3SK8A 3EFXD 4FF3A 4U68A 4Y7NB 3T16A 1T5XD 2KQ3A 5JEAJ 4HEDA 4RH6A 2FMCA 1EY9A 2F0EA 3TMEA 4IZ8A 1CA5A 5CGKA 2EYMA 5ELBA 3C1EA 5KRUA 3KBGA 2PQEA 5IIFA 1PZKD 2F0NA 1EOTA 1EIHA 1ET9A 1LACA 5EKLA 2OXPA 2G9HD 3M7NA 1WTWA 2X6GA 2FFKB 3ZYYX 2PZTA 2WKDA 1UNSA 1O7ZA 3SK4A 4ZKBB 4OO1H 4KKSA 1F2YA 1YNND 4C56C 5K36H 3TP6A 3H6MA 3M7GA 4UDUC 2LY7A 4H7BA 2K28A 1CTMA 1DONA 2O4XA 5CR3A 2SNMA 1B3AA 3BYTB 3LNNA 3Q23A 4QUCA 1TS2A 1QCBD 3BDCA 5C3EB 1LO5D 1WTQA 4DAYA 4XQJA 3N52A 1PXUA 2R61A 3MVVA 4PV1C 4IFDI 1NR2A 1RTOA 4AYBB 2K33A 3BVGA 5C4HA 2F1MA 4V0BA 1RKNA 3S1MB 3HOUB 5C5LA 2PYKA 4GZYC 1HA5A 3GV6A 1TR5A 5CV9A 1HQMC 4ZUIA 1B1ZA 3R8BA 1NR4A 3R2IA 3EVQA 1GHKA 1PRTD 4XIGS 4CGYB 1TY2A 3IFTA 3RZOB 1PFMA 2PPBC 1QOHA 1S5FD 1LTSD 1U4RA 4A3JB 5IGEA 2XRSD 2QF7A 1EZ8A 1RD9D 3T56B 1ZYRC 1VMCA 1F9SA 3FMCA 1BDOA 1PTOC 2WINB 5I2XA 2QDBA 2A68D 2MUYA 2EYFA 1AZPA 4IUPA 1BUVT 2K5WA 4RAUC 1DM0B 1BBXC 1PRTB 1GUWA 3AB9A 1FD7D 5E3FA 2F0WA 2FJ2A 1EY6A 1EIGA 2EY6A 2F0HA 1V43A 1MD2D 5TSSA 4C3IB 1D2BA 4IUVA 1SNPA 2MPMA 4E6IA 2E74C 5COYA 3A7AB 3J7AV 1K8OA 1ILPA 1NUCA 1SAPA 2F0OA 2CQAA 5I6WA 5IT9E 2XIWA 1LT3D 4ZYSA 1G2TA 4NKLA 1TWCB 3L7ZC 2AQ3B 5KNBA 4K2KA 3W3AA 1C48A 2AUKA 5BN4A 1D5ZC 2E2JB 4A3MB 2I46A 4EVOA 3NE5B 4PNYA 1IKMA 4KKTA 2DY7A 3PUWA 3Q6SA 1CHQD 3D4DA 5FLXE 1I4RA 1I6HB 4QIWB 2WIIB 2K03A 2CW0C 1EY5A 3NXWA 3OWFA 1WTPA 1NAPA 3BS1A 4LAAA 1HHVA 1IL8A 3PUVA 5FO9B 2V4DA 3A7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYL A;  2F0U A;  3ITP A;  5IOC A;  4F7X A;  3P75 A;  1EYC A;  5IOD A;  3PMF A;  1EY8 A;  2EYP A;  3NQT A;  5DAU A;  2EYF A;  1EYD A;  3TP6 A;  3H6M A;  4B9W A;  2F0S A;  4J6H A;  4KJO A;  2OF1 A;  4KY7 A;  3SHL A;  4YIJ A;  3QB3 A;  5HGT A;  1IHZ A;  4H7B A;  5ISR A;  2HQE A;  2F0L A;  2F0Q A;  5KYI A;  2F0I A;  2RDF A;  2EY5 A;  4MIU A;  1SYD A;  2PW7 A;  3V2T A;  2O4X A;  5CR3 A;  5IGG A;  3NK9 A;  2F0D A;  3LX0 A;  5E3F A;  2F0W A;  3RUZ A;  3ERO A;  2F0J A;  1A3T A;  1SNQ A;  1STB A;  2SNM A;  1EY6 A;  5CV5 A;  5JOB A;  3MEH A;  5CV7 A;  5C5L A;  2EY6 A;  2F0H A;  1SNC A;  3SXH A;  3TME A;  5HUR A;  5JAV A;  3SR1 A;  1F2M A;  1KDB A;  1SYG A;  5IGC A;  2F0K A;  2KHS A;  4K14 A;  3BDC A;  3NUC A;  4K8J A;  1SNP A;  1A2T A;  2PZW A;  5C4Z A;  1II3 A;  4DGZ A;  1EY7 A;  2RBM A;  5I9O A;  1TQO A;  4E6I A;  2RKS A;  3ERQ A;  1A2U A;  4IUN A;  4KHV A;  5C5M A;  1EQV A;  4I65 A;  5CV6 A;  4ID6 A;  3QOJ A;  3NP8 A;  4K8I A;  3S9W A;  3VA5 A;  4ZUJ A;  3MHB A;  5C6A A;  3BDL A;  3TP8 A;  5KIX A;  1NUC A;  4RKB A;  4ODG A;  2EYJ A;  2PZU A;  3TP7 A;  2F0O A;  3TP5 A;  3C1F A;  4K5W A;  2F3W A;  5I6W A;  3NHH A;  4K2L A;  4QB4 A;  3QOL A;  4TRD A;  5EKK A;  5C3X A;  5KYL A;  3MVV A;  1KAA A;  5KGU A;  4R8N A;  4NKL A;  2PW5 A;  1NSN S;  4RKL A;  3OMC A;  5IGB A;  4N9T A;  3SK5 A;  1STN A;  4N9P A;  4NP5 A;  4DF7 A;  4K2K A;  5E1F A;  1JOK A;  5EGT A;  5IGF A;  1JOQ A;  1TT2 A;  3P1H A;  4S3S A;  3SK8 A;  3T13 A;  5J22 A;  1EY0 A;  3D4W A;  2ENB A;  4DFA A;  2F0V A;  4K5V A;  3EJI A;  4WRD A;  3R3O A;  4B9X A;  2F0P A;  4KTA A;  4DU9 A;  5C4H A;  5CC4 A;  4IAL A;  5IGD A;  5CV4 A;  4ZQ3 A;  3DMU A;  3U9O A;  1RKN A;  3D6C A;  3D8G A;  3HZX A;  1JOR A;  2EY1 A;  3T16 A;  2KQ3 A;  1F2Z A;  3HEJ A;  1EY9 A;  2F0E A;  2PYK A;  1A3V A;  1SYE A;  2M00 A;  4KY5 A;  2SNS A;  4OL7 A;  1EY4 A;  1TR5 A;  5CV9 A;  2F0M A;  4HTH A;  4PNY A;  4EVO A;  2F3V A;  2NUC A;  4IZ8 A;  5CGK A;  4ME5 A;  1KDA A;  1SYB A;  2F0T A;  4KV6 A;  1ENC A;  1STH A;  1STA A;  2EYM A;  2SOB A;  4K5X A;  1ENA A;  3C1E A;  4NDX A;  4EQO A;  1STY A;  4ZUI A;  1SNM A;  5NUC A;  5KRU A;  2PQE A;  3MXP A;  5IIF A;  4KJN A;  1KAB A;  2F0N A;  2F0F A;  1KDC A;  3SK6 A;  1SYC A;  5CV8 A;  4HMJ A;  4J1M A;  5DEH A;  5EKL A;  4WOR A;  2OXP A;  3D4D A;  3MZ5 A;  5C3W A;  2EYH A;  4QMG A;  1EZ6 A;  3EVQ A;  2EY2 A;  4PMB A;  3OMG A;  5I9P A;  2EXZ A;  4G57 A;  3OSO A;  2F0G A;  4KD3 A;  5J1Z A;  4EQN A;  2WAC A;  1SND A;  2PZT A;  2OEO A;  4QF4 A;  5KEE A;  5IGE A;  1EY5 A;  1SYF A;  2EYO A;  3NXW A;  4KY6 A;  5J39 A;  3OWF A;  4NMZ A;  3SK4 A;  1EZ8 A;  4K6D A;  5M9O A;  4PMC A;  1SNO A;  1STG A;  3E5S A;  1A3U A;  1EYA A;  1F2Y A;  4HMI A;  5I6Y A;  1U9R A;  4LAA A;  5F2D A;  4EQP A;  3DHQ A;  1JOO A;  4F8M A;  4KD4 A;  5K5P A;  1AEX A;  2LKV A;  2QDB A; 
#chains in the Genus database with same CATH topology
 4A93 B;  2UUB L;  2ATW A;  4QY7 A;  5JJI A;  1HXY D;  1EYD A;  2K5D A;  2IY5 B;  1PH9 A;  2QEJ C;  4JW0 A;  1IYU A;  2ZTC A;  4QGU A;  4B08 A;  4OIJ A;  4IO9 A;  1QNK A;  3DXJ C;  2F0D A;  2AMC B;  3S2D B;  3CCU A;  3PIO A;  3ERO A;  1G8Z D;  5JOB A;  1XYI A;  4XDX A;  3C2P A;  4RA8 A;  4K0K L;  1QJO A;  4UP7 A;  5JJK A;  4JBW A;  4K8J A;  3W5O A;  5C4Z A;  4Y52 H;  1CZG A;  1CQV A;  5JPM C;  5FJ8 G;  1X3E A;  1IBK L;  3QOJ A;  2UU9 L;  3EQL C;  4LF8 Q;  2Z4I A;  5ELD A;  3GTJ B;  1RDP D;  1HCZ A;  1JIC A;  3F2B A;  2JA8 H;  3U58 A;  3S17 H;  2BE5 D;  1K83 H;  3TN2 A;  5KYL A;  1F9P A;  4AH6 A;  2B2T C;  3BZC A;  1MIU A;  2JA7 G;  2NWG A;  2RSN A;  1PH2 A;  2ZTE A;  5C4J B;  3I2Z A;  1AFP A;  5J22 A;  3I90 A;  3CPF A;  3PQI A;  1X56 A;  2B63 H;  4JI1 L;  1Q81 C;  1XMO L;  3I4M G;  2UUC L;  3NBH B;  3DUZ A;  4R4I A;  4DR3 Q;  3JAM c;  3U9S A;  2SNS A;  3U50 C;  4A3K H;  2MJ8 A;  3T4A C;  1SMY C;  4C1N K;  1SYB A;  4DV7 L;  1B50 A;  2CQO A;  4N8F A;  2X69 A;  3Q8D A;  1FNU A;  4ALP A;  1V8Q A;  2OTJ A;  1KIX A;  4LNQ A;  4KJN A;  1IW7 D;  5CV8 A;  1WOC A;  3CCL A;  1VF7 A;  1MI2 A;  3I8Z A;  4OX9 L;  3NEN A;  4LFB L;  4NW2 A;  2HT1 A;  5I9P A;  1LLR D;  5I4D A;  3MWY W;  3SVM A;  3PO2 B;  3W2D A;  2JA5 G;  4A3L H;  1LT4 D;  1Y69 U;  1TY0 A;  2MGS A;  5EPL A;  3O13 A;  4H13 C;  4DV5 L;  2D62 A;  3CCV A;  2EJF C;  4ZK9 B;  1I4P A;  1SXT A;  5IOC A;  1RCV D;  1KQS A;  2ID0 A;  1VQM A;  5FLM G;  4O2D A;  4AIM A;  1XTD A;  3UDX A;  2KA7 A;  2K6A A;  4RCN A;  2Q8T A;  4JV5 Q;  4KY7 A;  1P8L A;  3BG3 A;  4BBS H;  4FYD A;  1Q1B A;  2PQA B;  1EQR A;  2KCT A;  3FKI H;  5G3L D;  1JJG A;  4Q0F A;  4BY1 B;  4MIU A;  1B4O A;  1EQT A;  3KBX A;  1FL0 A;  3NTH A;  3E9H A;  1DZ1 A;  3RR5 A;  4DN4 M;  1D7Q A;  2NN6 G;  4YCU A;  4OXP A;  4DV3 L;  2KVM A;  3E0J A;  3JAM E;  1Q90 A;  4L8J A;  4OHJ A;  4PMW A;  3P7J A;  3A8K E;  5C5M A;  5CV6 A;  3NP8 A;  3J81 i;  2B2Y C;  2DJG C;  3FHW A;  1PMR A;  1X3P A;  3NWS A;  1BBU A;  2MHV A;  2PI2 A;  1SJE D;  4RKB A;  3WOF A;  1E2Z A;  1PLF A;  2EZV A;  1HR0 W;  3R2T A;  2F4V L;  2VNU D;  4F88 A;  4JK1 C;  1GKH A;  2L1B A;  3I91 A;  1EEF D;  4RHR A;  5C0X G;  4YHH Q;  4HAE A;  1SN8 A;  1R9T B;  1PYB A;  1TU2 B;  3HOZ B;  4A3G H;  4RG1 A;  2ICI A;  1JOQ A;  5M3M B;  1VQE A;  3CCR A;  5IT9 L;  2QIL A;  3VYU A;  1KTK A;  3HGB A;  4WRD A;  2O5J C;  3MAQ A;  3H0G H;  5GQO A;  2XTI A;  3U9O A;  1PH7 A;  3K5M A;  1VQ7 A;  2R93 B;  1I5F A;  1HR0 Q;  1JMC A;  3K58 A;  3HOW G;  2NVQ B;  1TWH B;  2VXW A;  4RGT A;  2E5L Q;  3HEJ A;  4OL7 A;  2M00 A;  3AFP A;  3IL8 A;  3IKJ A;  4HTH A;  1TKW B;  1JE5 A;  4ME5 A;  4KV6 A;  4DXG A;  4A3J H;  1HFG A;  1ENA A;  1LTL A;  4C3J B;  1J6Q A;  1QB5 D;  4R8I A;  1OXS C;  4DR1 L;  1KAB A;  2GVA A;  1SBB B;  2AWO A;  1FGU A;  4J1M A;  2A6E C;  1I50 B;  2NVX H;  5BR8 Q;  1X9N A;  3R93 A;  1TS3 A;  4A3D B;  1VQD A;  1EU3 A;  3KOJ A;  3FRP B;  2BA1 A;  1PH5 A;  5FLX L;  3TEH B;  1U9R A;  4EQP A;  4KD4 A;  1B44 D;  4LUO A;  5KND A;  1T5E A;  5GAH C;  2Z0S A;  1XTC D;  3H3V H;  1J8I A;  1L1O B;  1ICF B;  4B9W A;  3T1Y L;  4DV6 L;  4YWL A;  2Q2I A;  4OWX B;  4DAY B;  2C9O A;  4KKU A;  3GTK H;  3SDZ A;  5HGQ A;  4AQY L;  2V1C C;  3OOC A;  1SYD A;  3V2T A;  2TMP A;  3NBH A;  2WP8 J;  3ZJY C;  1AP0 A;  3KUP A;  4IFD H;  2ICE C;  1K0R A;  3G4S A;  1AN8 A;  1CZW A;  3B6Y A;  4LUV A;  3MEH A;  2NVY B;  1LT5 D;  3G48 A;  3SR1 A;  1ASZ A;  3NUC A;  4DV1 L;  1EY7 A;  3MXU A;  3HOV G;  5C4X B;  3CME A;  5M5Y B;  1HTP A;  1KNA A;  3KLW A;  2LMC B;  1CM9 A;  3AEV A;  4LF5 Q;  1W2B A;  3GTP B;  3VA5 A;  2JXM B;  1WCM G;  2EJM A;  3GTL H;  1E2V A;  4ODG A;  2B2V A;  4DV0 L;  4BY7 B;  2X6L A;  2R7Z H;  1A62 A;  1BKB A;  1BO0 A;  3AMU A;  2ZXP A;  1Q82 C;  2WAQ B;  4DNT B;  4KHP Q;  4N9T A;  2B2U C;  4N9P A;  5E1F A;  4B3T Q;  4JYA L;  2ES2 A;  2Z6B A;  4JOI C;  1WD0 A;  3D6C A;  5EKI A;  2RA4 A;  1H9S A;  4R1J A;  1U4P A;  4UP9 A;  2D2C C;  3MC0 B;  2SOB A;  3KF6 A;  2N78 A;  5IP9 H;  1N9W A;  1QIL A;  1MHW C;  2EJG C;  2B8F A;  2KOL A;  3FPP A;  2F0F A;  4DV4 Q;  2IWH A;  1LTA D;  2A6H C;  1E2W A;  1V1O A;  3I73 A;  4X62 L;  3CU7 A;  5D14 A;  2IHF A;  2A5H A;  1QVG A;  2JA8 B;  1EWC A;  4A3C H;  3S17 B;  1K83 B;  2JSO A;  2Y0S B;  1PH4 A;  4L63 B;  1Y1V H;  3HOY G;  4C2M H;  4A3E H;  1X3Q A;  4PMC A;  4Z9C B;  1S72 A;  1PZJ D;  3NBI A;  3NTK A;  5M3F B;  3D4W A;  5LMU Q;  1STE A;  4YCW A;  3S2D H;  1EY8 A;  2UXC L;  4NXM L;  2BE5 C;  5IYD H;  2B63 B;  3L3O C;  4A3I H;  3GO5 A;  2XGT A;  1K8A C;  4J6H A;  2HUG A;  1BQQ T;  4B3M L;  1PH1 A;  3RZD H;  4LF7 Q;  4A3K B;  4DR5 L;  1Y1W G;  2EY5 A;  5LHY 1;  1L0W A;  2K75 A;  5LMN W;  4DR2 Q;  4R4C A;  1FVI A;  3VR4 A;  4O0A A;  3KFU A;  2VQF Q;  1A3T A;  4X3T A;  1YIJ A;  4ME3 A;  2KHS A;  1CKN A;  2JE6 I;  3L2P A;  1JCK B;  2JK8 A;  3ERQ A;  4NXN L;  4IUU A;  3JAM L;  1WTR A;  4G4K A;  5LMN Q;  5CYU A;  2WFW A;  1B9M A;  1IW7 C;  3RNU A;  2I5H A;  4K5W A;  1QZG A;  4RGO S;  5EKK A;  3HKZ B;  3STB D;  3U4V A;  2DGY A;  2L9H A;  3Q24 A;  2UXB L;  3T1H L;  1L0Y B;  3CP0 A;  1OXX K;  3OPO A;  3P1H A;  4R4Q A;  4BBS B;  1YJN A;  1SMX A;  3FEW X;  1L1O A;  4K5V A;  3EJI A;  5M5X H;  3H3V I;  3FKI B;  2KUM A;  1A6X A;  1UE1 A;  5FJ8 H;  4RHS A;  1IXR A;  2EQS A;  4HJ8 A;  5DLQ E;  1OO9 B;  4GN4 B;  4DAM A;  4IPD A;  4GLV B;  3VDY A;  4K5X A;  4XYQ A;  1STY A;  4B3S L;  3S16 H;  4G7Z C;  2AWN A;  1DOK A;  1D8L A;  4O42 A;  4PZ8 A;  3MTS A;  3KK7 A;  1D5M C;  2JA7 H;  4DR4 Q;  3PO3 B;  1HNX L;  2ZM6 L;  4KD3 A;  1PRT F;  1GUS A;  5ELO A;  5KEE A;  4QF4 A;  1GM5 A;  4JI6 L;  5CMD A;  1D1I A;  4DUZ Q;  1QWY A;  1KLG D;  1SNO A;  1RL2 A;  4A3G B;  3I4M H;  1JOO A;  1ZEQ X;  3RMH A;  4DK6 C;  2EYL A;  3P75 A;  1EYC A;  3H0G B;  2F03 A;  2KCN A;  4UHV A;  3K59 A;  4X66 Q;  4MN3 A;  5CBE E;  2OF1 A;  2A8V A;  4JI2 Q;  4LFC Q;  4P73 A;  1E1T A;  1IHZ A;  3CPW A;  1JQY D;  4DUY L;  5DM6 3;  1YNX A;  2K4K A;  2M2L A;  1UAP A;  2JA5 H;  5CV5 A;  4JI5 Q;  1X3F A;  4DK1 A;  3M3Y H;  1VQ6 A;  1LT6 D;  1DJR D;  3JC6 6;  2IL8 A;  4FNF A;  2NVX B;  1Q3L A;  1YHB A;  1II3 A;  4H0L C;  5C44 G;  3OW2 A;  1F9Q A;  1WTX A;  1O7Y A;  1KL9 A;  4K8I A;  3SE0 A;  1S4Z A;  2DNC A;  1LYL A;  2PCF B;  1GJX A;  1DXM A;  5FLM H;  2RSO A;  3I4L A;  2A69 D;  1G91 A;  2PZU A;  2XNA C;  1TWF H;  1XNQ L;  4LW1 A;  4TRD A;  2O5I C;  3BDO A;  3NTI A;  5IYC G;  3J80 E;  3W1B A;  5FLX c;  1N36 L;  2UUA Q;  1BXT A;  5JJL A;  1IL2 A;  4JI8 L;  3K7A H;  2ENB A;  2EVB A;  2N3S A;  4JI3 Q;  2RHS B;  1YJW A;  3GTK B;  5IGD A;  3D6W A;  5AFW A;  3BZK A;  2UXD Q;  3D8G A;  3MFG A;  2ALY B;  2EY1 A;  5D3D A;  1ASY A;  3ULL A;  2YYZ A;  4OWW B;  1D5X C;  2K01 A;  1LTT D;  1LM0 A;  1STH A;  1STA A;  1KRS A;  1SNM A;  5NUC A;  3HOX G;  1Z9F A;  3TQY A;  1ONL A;  1C8C A;  3K5O A;  4WJ3 M;  2RDG A;  1UWV A;  3K6O A;  3ND8 A;  5C3W A;  5C0X H;  3V05 A;  3RN5 A;  1KAW A;  2VB2 X;  4KMU C;  4F87 A;  4TQU S;  4GLX A;  4DR7 Q;  3OMG A;  3GTL B;  4GNX B;  2PO4 A;  3OSO A;  3I56 A;  2Z1C A;  2R7Z B;  4LF8 L;  1SND A;  2CWA A;  1IYJ B;  2EYO A;  4I7A A;  1GUT A;  2WB1 E;  4A3F G;  1A3U A;  5I6Y A;  3HOW H;  2L0C A;  1PTO H;  1XJV A;  4F7X A;  4FDB A;  4HJA A;  3A5Z B;  3M85 A;  3GTQ H;  1JWU D;  2C5C A;  4DNR B;  5KNC A;  3CCQ A;  4A3B B;  2A74 C;  3UI2 A;  4JBM A;  4HIM A;  2NB0 A;  3VR6 A;  1RHP A;  1S5D D;  4HID A;  4C3H G;  1YJ9 A;  1VQ8 A;  4X65 Q;  1ILQ A;  4X3U A;  4OGQ C;  2NZ1 D;  1OXV A;  2R6G A;  3UE0 A;  4IN3 A;  3RUZ A;  2E2D C;  5JAV A;  5IGC A;  1ICW A;  2K14 A;  3C46 A;  3CKI B;  1QUQ B;  1K28 A;  3NSW A;  1VQ9 A;  3PIP 3;  1TQO A;  2HCI A;  3G6E A;  2FIN B;  1E7Z A;  2JEB I;  2R7F A;  4OO1 G;  2E2H H;  1Y1V B;  3OTO Q;  4JI0 Q;  1K0S A;  3K81 C;  3T53 B;  4C2M B;  4A3E B;  5GAE C;  5KIX A;  1KHI A;  2HDM A;  2A73 B;  2HHH Q;  1WD1 A;  4PQX A;  4LFA Q;  2B2W A;  1HZA A;  2NBF A;  3OWE B;  1HPC A;  1EL0 A;  2PW5 A;  1G6Z A;  2RCN A;  2BOS A;  3M4Y A;  4PG3 A;  3SK5 A;  4NP5 A;  4A3I B;  2AQ1 B;  4O1N A;  5EGT A;  1FJG L;  2N88 A;  3E9I A;  1JC7 A;  1A15 A;  1OXT A;  3VR5 A;  3RZD B;  4CKB A;  4OON A;  5CC4 A;  4GLA C;  1ESR A;  3DMU A;  1JOR A;  1H9K A;  3HOV H;  2Z6K C;  2GN5 A;  4BBR G;  1PZI D;  2G9D A;  2J4X A;  3QO2 A;  1A3V A;  1SYE A;  5H1S E;  1EUJ A;  2F3V A;  1YBY A;  4CKC A;  1AE3 A;  1KDA A;  1WCM H;  5IY0 A;  2XWB B;  2HCC A;  1PDQ A;  1X6O A;  4GKJ L;  2JP1 A;  2LFN A;  4B3R Q;  2Z9H A;  1M90 C;  3PV0 A;  4M1U B;  5M3F H;  2OWO A;  3CHB D;  1YNN C;  2EXZ A;  4DK3 C;  4P75 A;  4CDF C;  1K9M C;  4LWC A;  1IKL A;  1BCP D;  1Z7T A;  2Q2H A;  3V96 A;  1N33 L;  1PH3 A;  4L6T B;  3VA7 A;  4ILW A;  2VQE Q;  4IFD J;  3K0Y A;  2NZH A;  1X3G A;  1SEB D;  1VQ4 A;  4X64 L;  1IBL L;  1SE2 A;  5M5X B;  3NQT A;  4YHH L;  3X3M A;  4RFB A;  4AYB E;  2F0S A;  1LUZ A;  5DM7 3;  2NN6 I;  1E24 A;  1SRO A;  3A0J A;  2VL6 A;  1X54 A;  4ZRZ A;  5G3L F;  1NBW A;  4GS3 A;  1B9N A;  4BA1 I;  1ZXT A;  3F2D A;  5JVH 3;  1HZ9 A;  1EWI A;  3S16 B;  1HNW L;  4HCE A;  1JJC B;  1BCP B;  4HR7 B;  1EFI D;  1VQH A;  4LK1 C;  1SYG A;  5JJZ A;  4QUF A;  1A2T A;  1R4Q B;  2LSS A;  2JA7 B;  4L5R C;  4YY3 L;  5BN5 A;  3TBI B;  3PSI A;  4XQN A;  4GN5 A;  5C0X I;  3K5N A;  1H9S B;  4GNX A;  3H15 A;  3I4M B;  1XMQ L;  3X3N A;  5C3X A;  3KLR A;  3KF6 B;  4XT3 B;  4X6A H;  1DYQ A;  2Q2T A;  5DNF A;  4DF7 A;  3W1G A;  4YWK A;  4KLK A;  1IBK Q;  4ABN A;  1LAB A;  4S3S A;  5JEA G;  2UU9 Q;  1JR0 D;  2OQ0 A;  5EQ0 A;  4DFA A;  2F0V A;  4B9X A;  2VUM G;  3J80 L;  1O78 A;  4IAL A;  5CV4 A;  4HSV A;  1NCV A;  5FK9 C;  1VQB A;  3J7Y W;  2K04 A;  2PMZ B;  1AZQ A;  2HQL A;  3VYT A;  3PO3 H;  2JA5 B;  3GQB A;  2NUC A;  2ZXO A;  1C4Q A;  3M3Y B;  4KHZ A;  1VQN A;  1PRT C;  3CCS A;  4K6L A;  1KDC A;  5DEH A;  3TZU A;  4JI1 Q;  2IHE A;  2EYH A;  1XMO Q;  5IP7 G;  4QMG A;  3K7U C;  1QUQ A;  4Q5V A;  4XTC S;  1FNW A;  1C7Y A;  1Y8O B;  2WKC A;  1TWF B;  2DNE A;  5D65 A;  4LF5 L;  4DV7 Q;  2A68 C;  2NTT A;  3DEP A;  4DK0 A;  3M4O B;  1EFW A;  2LKV A;  3CCJ A;  1CKN B;  3K7A B;  1GO3 E;  3CMA A;  5LL6 X;  3D4R A;  4TKO B;  4B3T L;  3E3X A;  2LS0 1;  4KJO A;  1M1K C;  3J81 c;  4YIJ A;  1PTO D;  3QB3 A;  2F0L A;  2F0Q A;  5EBD A;  5ELE A;  2AHO B;  1GXD C;  2F0J A;  1N8R C;  1TS5 A;  4CKE A;  1Q1E A;  2AUJ D;  1YNJ D;  2RF4 A;  1KXL A;  1YZ6 A;  4LF6 L;  1ML0 D;  3NWT A;  1XNR Q;  2OQK A;  1RTN A;  1EQV A;  3I4N G;  4ID6 A;  4QIW E;  1KC8 C;  2PI2 E;  3CC7 A;  3I55 A;  3HOW B;  4BWG B;  1E0B A;  1D6E C;  1PTO B;  4IOC A;  1EWH A;  1HNZ Q;  1W6K A;  3QOL A;  1LTG D;  1DOL A;  1ZKO A;  1SE8 A;  3S1R H;  2H1E A;  1TWG H;  3KLS X;  4P2C B;  5L37 A;  3TSS A;  1EYG A;  3GTQ B;  1Y14 B;  3QG1 A;  4J15 A;  2PNR C;  4IPH A;  4XT1 B;  4KN4 C;  1JOK A;  1X65 A;  2BA0 A;  3UE1 A;  3D0F A;  4JI7 L;  2DY8 A;  2XN9 C;  4ZQ3 A;  2HDL A;  2WB1 G;  5C44 H;  2CHB D;  3DWP A;  3J7Z C;  4LF7 L;  1CFM A;  3J81 E;  4NB3 A;  4EQO A;  5C6A A;  2JA6 G;  2CCZ A;  3ONA B;  2RCF A;  3CAM A;  4I7Z C;  4RGM A;  1B2T A;  2Z4H A;  5IYC H;  2ZT9 C;  1S5C D;  1N32 Q;  2E2H B;  1VQC A;  2EY2 A;  4PMB A;  4PZ7 A;  1PFB A;  2XWJ B;  2ZXR A;  4A3B H;  4EQN A;  1GHJ A;  2OEO A;  1IYV A;  4HN7 A;  1CKM A;  1O80 A;  5GAG C;  4DR1 Q;  1MGS A;  3K0X A;  4DA2 A;  4HSP A;  3WOE A;  2CW0 D;  2R92 H;  3KYH C;  4DAP A;  1VQG A;  2O2L D;  3L0O A;  3Q0A A;  3HOX H;  2XRQ D;  3HOV B;  3M4P A;  4KI0 A;  3S14 B;  2YTV A;  4QCL A;  2F0I A;  2RDF A;  5A35 A;  3CXC A;  3K57 A;  2YTY A;  1JJ2 A;  1WCM B;  2D0O A;  3F2U A;  3BJU A;  1I3Q B;  5IGG A;  5IWA Q;  4QJF A;  4CBV A;  3S1Q H;  3Q22 A;  1SNC A;  5M5W H;  4DAV A;  1B53 A;  3T1Y Q;  4A3F H;  5AJ3 Q;  4DV6 Q;  2PZW A;  1TXY A;  4DGZ A;  4OIK A;  5I9O A;  1V1P B;  2R7D A;  5FKA C;  4IUN A;  4DR6 L;  2JA9 A;  3RLO A;  3A56 A;  4I65 A;  2EPB A;  2J7Z A;  1N34 L;  2P5Z X;  3MXN A;  3S9W A;  1WTV A;  1CA6 A;  5JVG 3;  1V9P A;  1WFQ A;  5EBC A;  1RF2 D;  1PV4 A;  2B2V C;  3E6Z X;  4MHE A;  3QJY A;  1TVX A;  3FDT A;  3A55 A;  4C3H H;  1IBM L;  4IUR A;  1MBY A;  4DUZ L;  2SEB D;  4DV1 Q;  4H02 A;  3TZD A;  4MNO A;  1U5K A;  1GD7 A;  4RKL A;  5C3E G;  3DEO A;  4XYO A;  4M8A A;  3M9B A;  1BCP C;  2QDL A;  2K52 A;  3VR3 A;  3T13 A;  1SE4 A;  3UDI A;  3HRZ C;  1Q8I A;  3T51 B;  5C0X J;  3FP9 A;  4CHT B;  4X66 L;  4DV0 Q;  2L4N A;  3FVQ A;  1F2Z A;  4LFC L;  1QVC A;  4JI2 L;  1VQK A;  3SHL A;  2B8G A;  1JB7 A;  2F0M A;  3HOY B;  4RMF A;  4A76 A;  1AH9 A;  3GTM H;  3HG9 A;  4POF A;  1Y8N B;  3I72 A;  2D9U A;  3A8I E;  4AYB G;  1VMP A;  4JI5 L;  4JYA Q;  3SK6 A;  2LXJ A;  4HMJ A;  3K80 C;  2VY3 A;  1EU4 A;  1SMY D;  3UDF A;  2CVR A;  4FVM A;  2CH4 A;  2HIX A;  3CQZ H;  2F0G A;  4IJH A;  3HOU G;  5A2Q E;  1CHP D;  1HFN A;  1I4H A;  1Y1W B;  5EPJ A;  1UEA B;  1PH6 A;  5LL6 S;  4HMI A;  2K32 A;  1Z47 A;  3K5L A;  4BBR H;  1ET6 A;  3KF8 B;  4R4T A;  2B29 A;  3PF5 A;  1EQQ A;  3CW2 C;  1SFO H;  1O7L A;  3PCO B;  1OTC A;  3S2H H;  1MSG A;  3LWE A;  1I4G A;  2KEE A;  1IZ6 A;  1DCZ A;  2E76 C;  5GRO A;  3OIP A;  3H94 A;  4X62 Q;  1I94 Q;  2UUA L;  2B39 A;  3NQI A;  3I3C A;  1UE5 A;  2KHI A;  5HGT A;  4JI3 L;  5ELN A;  1YHA A;  4A3J G;  2OCE A;  3J80 c;  4JI4 L;  1I4Q A;  4XXE A;  3BYY B;  3VR2 A;  1FR3 A;  2RDH A;  3GTG H;  4BS9 A;  4UAI A;  4FXD A;  4R9W A;  1SNQ A;  2L11 A;  4DV2 L;  2ZJQ A;  2UXC Q;  2A19 A;  3FPU B;  4NXM Q;  1UE6 A;  4K14 A;  1CKO A;  4FF1 A;  1GUN A;  1XX8 A;  4DR5 Q;  2C35 B;  4TSS A;  3KJO A;  2MP1 A;  1L0X B;  1G2S A;  4U67 3;  3MHB A;  1I4X A;  3BU2 A;  1NY4 A;  3BDL A;  3TP8 A;  5ELF A;  2Q8I B;  4DR7 L;  1SLJ A;  3PUY A;  5ELC A;  4DKA C;  4X3S A;  2F3W A;  1F2L A;  1NNX A;  1DD2 A;  1SSO A;  3D3R A;  3IAY A;  3TRZ A;  1OXU A;  3J7A 5;  4C3I G;  1CQF A;  1NSN S;  2N49 A;  1J5E Q;  3ER0 A;  1STN A;  4OWT B;  3HFZ B;  3BZD B;  3PIP A;  1YIT A;  4JCV E;  5E4X A;  3R3O A;  1L1O C;  2XVS A;  4MTK A;  4IFD G;  1CI3 M;  4GOP A;  4UPA A;  4LF4 Q;  4WFN 3;  4X65 L;  2VZA A;  2ASB A;  2F0T A;  1GUG A;  1ENC A;  4LMQ D;  4NDX A;  3MXP A;  4DXF A;  4KN7 C;  4IUQ A;  1FNV A;  3M4O H;  1SJH D;  2GA4 B;  1VQJ A;  1V1Q A;  2NN6 H;  1X32 A;  2ZJR A;  3J81 L;  2EE1 A;  4GKK Q;  4WJ4 A;  1EZ6 A;  3GTO H;  1V1P A;  2E8G A;  3CRK C;  2K05 A;  5JEA H;  3OYY A;  1YNJ C;  2LXK A;  5IYB G;  4A3M G;  2VUM H;  2A6E D;  2IX1 A;  3S1R B;  4KY6 A;  1TWG B;  2BCO A;  4NMZ A;  5M9O A;  5T1I A;  3TRE A;  4B3S Q;  1STG A;  2E2I H;  5F2D A;  2J0T D;  3RD4 A;  1Q46 A;  1Q7Y C;  1XXG A;  2EXD A;  2TSS A;  1JB3 A;  3A8J E;  2K5N A;  3VYR A;  4OEM B;  2WAQ E;  1QE6 A;  5DAU A;  1MSH A;  4L5S A;  4XQQ A;  1HNX Q;  4FF2 A;  1WJJ A;  1PHJ A;  5C44 B;  4JI6 Q;  1EIF A;  4CDD C;  1TWA H;  1XPR A;  2HQE A;  1DOM A;  1EIY B;  5IP7 H;  3G6J B;  5HY6 A;  1H9R A;  1DGS A;  1S5E D;  1STB A;  4OO1 I;  4A93 G;  1BR9 A;  4WJW A;  4RGN A;  2F0K A;  3KDF A;  3CD6 A;  2KEN A;  2L12 A;  3GDE A;  2L55 A;  2HIV A;  2MO1 A;  4B3R L;  2QCP X;  3WWV A;  4JC0 A;  4KHV A;  2K5Q A;  2H4O A;  1BF4 A;  4G7O C;  2K50 A;  4CJ2 C;  3SGI A;  1GOZ A;  2KJX A;  4FXG C;  2Y0S E;  3N6R A;  1VQO A;  2A1A A;  1B8A A;  4FO2 A;  2B2T A;  4DR3 L;  1KAA A;  2NVT H;  5KGU A;  2R92 B;  1XWE A;  5EJW A;  5EPK A;  1Q12 A;  3KF8 A;  2Z8L A;  3HOX B;  2I5L X;  3VYS A;  1JT8 A;  2K1B A;  4RCO A;  5CBA E;  1EY0 A;  4BXX G;  4JVZ A;  4DU9 A;  2F0P A;  4TVA B;  5J3B A;  4N8X 1;  5IE8 A;  3HZX A;  4L5T A;  3GD7 A;  1SE3 A;  3I4N H;  1U4M A;  2EIF A;  3KLS A;  3S1Q B;  4JBK A;  1CK1 A;  5K36 G;  1TS4 A;  5M5W B;  1QZH A;  1VDZ A;  4A3F B;  2IX0 A;  2QW7 A;  2EDG A;  4ZAI A;  4JI8 Q;  3S15 H;  4WOR A;  3OIQ A;  3CRL C;  5COR A;  4IOA A;  2QEX A;  4YWM A;  1PFN A;  3KJP A;  4G57 A;  2BH8 A;  4JV5 L;  5D3I B;  3LGJ A;  4C3H B;  1K8M A;  3S14 H;  2KCM A;  3JAM i;  1BCP F;  1HZB A;  1EYA A;  2A6H D;  2VS1 A;  4F8M A;  1CUK A;  1I6V C;  3DHQ A;  1HUM A;  3P20 A;  3HKZ E;  1I3Q H;  1HTL D;  5A2Q L;  2F0U A;  4FXK C;  1PYW D;  4HJ9 A;  3NPP A;  5T1G A;  5IOD A;  1E3P A;  2JA6 H;  2AQ2 B;  2D0P A;  4P71 A;  1C9O A;  3F8T A;  1HH2 P;  1M4V A;  3PO2 G;  2SDF A;  3TS2 A;  4Y7N H;  1VF5 C;  1VQA A;  3IFD A;  3GTM B;  3QR8 A;  5EAY A;  3NK9 A;  3TP5 A;  3CCE A;  3SXH A;  1F2M A;  3I7F A;  1JE4 A;  4EQ5 A;  2KHJ A;  3CQZ B;  2F52 A;  1MJE A;  4P72 A;  2B2Y A;  3STB C;  4POG A;  1K73 C;  1VCI A;  1U4L A;  2KCC A;  4BY1 G;  1LV9 A;  4LJZ C;  3OW7 A;  1YHQ A;  3EIV A;  3TP7 A;  4DPG A;  3H09 A;  3HKS A;  4H44 C;  4LF9 Q;  1HR0 L;  4BBR B;  3J81 j;  3NHH A;  2E5L L;  4QB4 A;  4X3K A;  1SFO B;  1E1O A;  1W6J A;  1PVO A;  2B2W C;  2MO0 A;  3S2H B;  4FF4 A;  4R8N A;  2UUB Q;  1GUO A;  3HOY H;  4ZCK A;  1LTB D;  3URY A;  3BVM A;  1TT2 A;  2EOT A;  4EX5 A;  1B3Q A;  1YI2 A;  1NTG A;  4G7H C;  3M4Q A;  1YEZ A;  1S5B D;  4KTA A;  1AW7 A;  3G7L A;  1R4P B;  5BR8 L;  3WDN A;  3RLF A;  3GTG B;  2BDN A;  1EY4 A;  2JJQ A;  4IUT A;  4K0K Q;  1FJG Q;  2BDO A;  1Y1W H;  2FMM A;  3HOZ G;  2ZTD A;  2KED A;  4C1N I;  2DN8 A;  3HP3 A;  2E75 C;  3GP7 A;  5M3M G;  1MJC A;  2RVL A;  3EA6 A;  4V19 0;  1SYC A;  1VQI A;  3MZ5 A;  5C3E H;  4HCS A;  2R93 G;  1B7Y B;  1G29 1;  2M9V A;  4FP5 D;  4ZLT F;  1XNR L;  3EBE A;  5J1Z A;  2WAC A;  1FGB D;  4QQB X;  1UEB A;  4CDC C;  3GV3 A;  3A74 A;  1F77 A;  1JWS D;  4GKJ Q;  3PIO 3;  4C3J G;  3PGZ A;  4P74 A;  4HJ5 A;  3C3L A;  1HNZ L;  2AKW B;  1RIP A;  3DWA A;  1HRJ A;  3PMF A;  3H3V C;  1HUN A;  3A54 A;  2IW3 A;  1HQR D;  3HS0 C;  4R4O A;  4A3D G;  3MXN B;  1L2F A;  2UUC Q;  1WYD A;  3DM1 A;  1N33 Q;  2RQX A;  5ISR A;  1PTO F;  5KYI A;  1Q86 C;  1H9M A;  2I07 B;  3TS0 A;  2PW7 A;  3S1M H;  4BA2 I;  3D31 A;  1IBL Q;  3HOU H;  4X64 Q;  3LX0 A;  2CH4 W;  4ULL A;  2Q8R E;  2I0Q A;  1QNU A;  1ROD A;  1T9H A;  4KK7 A;  2FXQ A;  1BNZ A;  1CT1 D;  2A69 C;  4OX9 Q;  1H95 A;  3GTO B;  4LFB Q;  4GN3 B;  3PUX A;  2OT2 A;  3LWU A;  4KHP L;  1LTR D;  2RKS A;  2JEA I;  1RJT A;  1ZYR D;  2QKI C;  5IGB A;  1N32 L;  2VUM B;  1WTO A;  1SR3 A;  1TII D;  2CFM A;  3IRB A;  4ZUJ A;  2L5T A;  1FYC A;  2FHT A;  4IQZ A;  1EEI D;  1HNW Q;  2EYJ A;  2E2I B;  1H9J A;  4DV5 Q;  4GNX C;  1KLU D;  3RZO H;  4K2L A;  3MXG A;  3S1N B;  5JPN C;  1SDF A;  5FOB B;  3DLL A;  2B2U A;  1AE2 A;  4ZKC B;  3CF5 A;  4YY3 Q;  3H91 A;  5C4X G;  2VB3 X;  5BN3 A;  2KEC A;  4JOI A;  1TWA B;  4UY8 C;  2BH2 A;  1F9R A;  4DV4 L;  3DWQ A;  1XMQ Q;  4MZ9 A;  2F4I A;  4MTN A;  1S3O A;  4BY7 G;  4KY5 A;  4DNI A;  1UUP A;  1J9O A;  4DV3 Q;  2WAQ G;  3F1Z A;  4CJ0 B;  3QIA A;  3BVZ A;  1PH8 A;  3AU7 A;  2NTS A;  2L15 A;  5IWA L;  1M8A A;  3J7A F;  1HA6 A;  4CJ1 B;  2HD3 A;  1WTH A;  1QG7 A;  1JWM D;  2JN4 A;  5FO8 B;  3A5U A;  5LMU L;  4C3I H;  5AJ3 L;  3I70 A;  1VS0 A;  2YTX A;  4J8Q A;  4HJ7 A;  1D1K A;  5I2Y A;  1QVF A;  1ENF A;  3CCM A;  2F4V Q;  3MA2 B;  1Y8P B;  3TDQ A;  2WV6 D;  2QGQ A;  1SYF A;  1A8V A;  2IJ0 A;  2NVT B;  4K6D A;  1LTI D;  3E5S A;  2K7V A;  3SEB A;  5K5P A;  1AEX A;  4DR2 L;  3ITP A;  3OHX C;  2VQF L;  2I5M X;  2EYP A;  2CWP A;  2YU9 B;  1TWC H;  2R3Z A;  2JA8 G;  1KNE A;  1B70 B;  1MKH A;  1U0L A;  1WVL A;  2Y0S G;  3I4N B;  1ESF A;  5E4W C;  1KD1 C;  3PUZ A;  4RWS C;  2E2J H;  1G6P A;  2D5D A;  3L9A X;  1Z6H A;  5LMN L;  4A4I A;  5J39 A;  5IYB H;  4A3M H;  2IT1 A;  2NYZ D;  3MFY A;  1BBW A;  4EGV A;  5M3F G;  3S15 B;  3ERS X;  5CV7 A;  5HUR A;  1KDB A;  2JYO A;  2B63 G;  1BOS A;  1EOV A;  2RBM A;  4L5Q A;  2XSC A;  3DM3 A;  2G5D A;  1A2U A;  2IX3 A;  4GOP B;  4A3K G;  4HIK A;  1I6H H;  1O7I A;  4QL5 A;  2PQA A;  2WB1 B;  3AYH B;  2IPK D;  1CSQ A;  3C1F A;  3QWN A;  4LF6 Q;  1XPU A;  2JA6 B;  1HZC A;  3OMC A;  3ND9 A;  5FO7 B;  2PNH A;  4OEL B;  2N55 A;  1VQL A;  5IGF A;  3SK8 A;  3EFX D;  2MFI A;  4U68 A;  4FF3 A;  4A93 H;  4A3L G;  4Y7N B;  1I94 L;  4AQY Q;  3T16 A;  1T5X D;  2KQ3 A;  5JEA J;  4HED A;  4RH6 A;  2FMC A;  3G71 A;  1EY9 A;  4DR4 L;  1PA6 A;  2F0E A;  3NEL A;  3TME A;  3HKZ G;  1K8G A;  4IZ8 A;  1CA5 A;  5CGK A;  2EYM A;  5ELB A;  3C1E A;  5KRU A;  2JQO A;  2PQE A;  3KBG A;  1XPO A;  5IIF A;  1PZK D;  4JI7 Q;  2F0N A;  4BBS G;  1EOT A;  1EIH A;  1ET9 A;  1LAC A;  5EKL A;  2OXP A;  3FKI G;  2G9H D;  3M7N A;  1WTW A;  1YVC A;  1K3R A;  2X6G A;  4IPC A;  4BXX H;  4UP8 A;  2FFK B;  3ZYY X;  2PZT A;  2WKD A;  3GTJ H;  1UNS A;  1O7Z A;  3SK4 A;  4ZKB B;  4OO1 H;  4KKS A;  1F2Y A;  1YNN D;  1PYS B;  2GVB A;  3F2C A;  2KBN A;  4C56 C;  3KDF B;  1NE3 A;  1S40 A;  3PF4 A;  5K36 H;  2OTL A;  2F3I A;  1J5E L;  3TP6 A;  3H6M A;  1GVP A;  3MEF A;  3PO3 G;  3M7G A;  5C4J H;  2N8N A;  4UDU C;  1KRT A;  2LY7 A;  4H7B A;  1SRU A;  4JPB W;  2K28 A;  3J80 i;  4IPG A;  1CTM A;  2PMZ E;  1WI5 A;  2O4X A;  1DON A;  4LF4 L;  4A3G G;  5CR3 A;  2RHQ B;  1PFS A;  2SNM A;  1B3A A;  3BYT B;  3LNN A;  3Q23 A;  4QUC A;  3H0G G;  4YCV A;  1TS2 A;  1QCB D;  3BDC A;  5C3E B;  1LO5 D;  1WTQ A;  1A0I A;  4GKK L;  4DAY A;  4XQJ A;  1E22 A;  3N52 A;  2UXD L;  4IJL A;  2QA4 A;  3CC4 A;  3PO2 H;  1PXU A;  3AQQ A;  2R61 A;  3MVV A;  3CC2 A;  4PV1 C;  4IFD I;  1NR2 A;  4DR6 Q;  1RTO A;  4AYB B;  1N34 Q;  2K33 A;  4B3M Q;  3BVG A;  5C4H A;  2F1M A;  4V0B A;  1RKN A;  3S1M B;  1IBM Q;  3HOU B;  5C5L A;  2PYK A;  4GZY C;  1HA5 A;  3GV6 A;  1TR5 A;  5CV9 A;  1NJI C;  2B3G A;  4BY1 H;  1HQM C;  4ZUI A;  1VQF A;  2ZJP A;  1B1Z A;  2NZO A;  4NXN Q;  3R8B A;  1NR4 A;  3R2I A;  1G51 A;  3EVQ A;  5IT9 c;  1K3B C;  1GHK A;  3U4Z A;  1PRT D;  1CSP A;  4XIG S;  1Q8K A;  4CGY B;  1TY2 A;  3IFT A;  3RZO B;  1PFM A;  2PPB C;  1C0A A;  1QOH A;  1S5F D;  1LTS D;  1U4R A;  4A3J B;  2DJF C;  5IGE A;  2XRS D;  1NMF A;  2QF7 A;  1EZ8 A;  1RD9 D;  2UXB Q;  3T56 B;  1ZYR C;  1VMC A;  3K8A A;  3T1H Q;  1F9S A;  3FMC A;  1BDO A;  1PTO C;  2WIN B;  5I2X A;  2QDB A;  2A68 D;  2MUY A;  2YV5 A;  4JG2 A;  1R9T H;  1P16 A;  2EYF A;  3HOZ H;  4APV A;  5E7N A;  1AZP A;  5M3M H;  4JBJ A;  4IUP A;  1UE7 A;  2R7Z G;  1BUV T;  2K5H A;  2K5W A;  3RN2 A;  3UDG A;  4RAU C;  1DM0 B;  2R93 H;  2NVQ H;  3OTO L;  4JI0 L;  1BBX C;  1PRT B;  1TWH H;  1GUW A;  3AB9 A;  1FD7 D;  5E3F A;  2F0W A;  2FJ2 A;  1X55 A;  2HHH L;  1EY6 A;  1EIG A;  2EY6 A;  2F0H A;  4LFA L;  1V43 A;  1MD2 D;  5TSS A;  4C3I B;  3S1N H;  1D2B A;  4IUV A;  1SNP A;  4C3J H;  4A3B G;  3ULJ A;  2MPM A;  3NEM A;  4E6I A;  2ZM6 Q;  4JI4 Q;  2E74 C;  5COY A;  1I50 H;  3A7A B;  4CDE C;  3J7A V;  3E0E A;  4PZ6 A;  1K8O A;  1A63 A;  1ILP A;  1NUC A;  4A3D H;  1SAP A;  5IP9 G;  2F0O A;  4DV2 Q;  2R92 G;  2CQA A;  2CKZ B;  5I6W A;  5IT9 E;  2XIW A;  3ULP A;  1LT3 D;  4ZYS A;  3S24 A;  2MQH A;  4NPS A;  1G2T A;  4HIO A;  4NKL A;  1TWC B;  3L7Z C;  2AQ3 B;  5KNB A;  4K2K A;  3W3A A;  1HJP A;  3RLN A;  4A3C G;  1C48 A;  2H5X A;  3AFQ A;  2AUK A;  1Y1V G;  5BN4 A;  1D5Z C;  3I4O A;  4A3E G;  2E2J B;  2Z6K A;  4DUY Q;  4GOP C;  4A3M B;  4A75 A;  2I46 A;  4EVO A;  3NE5 B;  4PNY A;  1IKM A;  4KKT A;  2DY7 A;  3PUW A;  3Q6S A;  2MNA A;  5IYD G;  4A3I G;  2DUD A;  1VQP A;  1VQ5 A;  2VQE L;  1CHQ D;  2K5V A;  2NVY H;  3D4D A;  5FLX E;  1I4R A;  1I6H B;  3EN2 A;  4QIW B;  2WII B;  5C4X H;  2YU9 H;  5GAD C;  5M5Y H;  1XNQ Q;  2K03 A;  4LUZ A;  2CW0 C;  3GTP H;  1EY5 A;  1W3S A;  3NXW A;  3OWF A;  1WTP A;  3ICE A;  1NAP A;  1N36 Q;  3BS1 A;  4LAA A;  1HHV A;  1IL8 A;  1BVS A;  1NMG A;  4LF9 L;  3PUV A;  5FO9 B;  2VW9 A;  2Q2U A;  4BY7 H;  2V4D A;  3A7L A; 
#chains in the Genus database with same CATH homology
 4A93 B;  1HXY D;  1EYD A;  2K5D A;  2QEJ C;  1IYU A;  4B08 A;  4OIJ A;  1QNK A;  3DXJ C;  2F0D A;  3S2D B;  3ERO A;  1G8Z D;  5JOB A;  1XYI A;  4XDX A;  3C2P A;  4RA8 A;  1QJO A;  4JBW A;  4K8J A;  5C4Z A;  1CZG A;  1CQV A;  5JPM C;  3QOJ A;  3EQL C;  2Z4I A;  5ELD A;  3GTJ B;  1RDP D;  1HCZ A;  1JIC A;  2BE5 D;  3TN2 A;  5KYL A;  1F9P A;  2B2T C;  2NWG A;  2RSN A;  5C4J B;  1AFP A;  5J22 A;  3I90 A;  3DUZ A;  3U9S A;  2SNS A;  2MJ8 A;  3T4A C;  1SMY C;  4C1N K;  1SYB A;  1B50 A;  2X69 A;  1FNU A;  1V8Q A;  4KJN A;  1IW7 D;  5CV8 A;  1VF7 A;  1MI2 A;  3I8Z A;  4NW2 A;  5I9P A;  1LLR D;  5I4D A;  3MWY W;  3SVM A;  3PO2 B;  3W2D A;  1LT4 D;  1Y69 U;  1TY0 A;  2MGS A;  5EPL A;  3O13 A;  4H13 C;  2D62 A;  2EJF C;  4ZK9 B;  1I4P A;  1SXT A;  5IOC A;  1RCV D;  2ID0 A;  2KA7 A;  2K6A A;  4RCN A;  2Q8T A;  4KY7 A;  3BG3 A;  4FYD A;  1Q1B A;  5G3L D;  4Q0F A;  4BY1 B;  4MIU A;  1B4O A;  1EQT A;  3KBX A;  3NTH A;  1DZ1 A;  4DN4 M;  2NN6 G;  2KVM A;  3E0J A;  3JAM E;  1Q90 A;  4L8J A;  4OHJ A;  4PMW A;  3P7J A;  3A8K E;  5C5M A;  5CV6 A;  3NP8 A;  2B2Y C;  1PMR A;  1X3P A;  3NWS A;  2MHV A;  1SJE D;  4RKB A;  3WOF A;  1E2Z A;  1PLF A;  2EZV A;  3R2T A;  2VNU D;  4F88 A;  4JK1 C;  2L1B A;  3I91 A;  1EEF D;  4RHR A;  5C0X G;  4HAE A;  1R9T B;  1TU2 B;  3HOZ B;  2ICI A;  1JOQ A;  5M3M B;  5IT9 L;  2QIL A;  3VYU A;  1KTK A;  3HGB A;  4WRD A;  2O5J C;  3MAQ A;  3U9O A;  3K5M A;  2R93 B;  2NVQ B;  3K58 A;  1TWH B;  2VXW A;  4RGT A;  3HEJ A;  4OL7 A;  2M00 A;  3IL8 A;  3IKJ A;  4HTH A;  1TKW B;  4ME5 A;  4KV6 A;  4DXG A;  1HFG A;  1ENA A;  4C3J B;  1QB5 D;  4R8I A;  1OXS C;  1KAB A;  1SBB B;  2AWO A;  4J1M A;  2A6E C;  1I50 B;  3R93 A;  1TS3 A;  4A3D B;  1EU3 A;  3FRP B;  2BA1 A;  5FLX L;  1U9R A;  4EQP A;  4KD4 A;  1B44 D;  5KND A;  1T5E A;  1XTC D;  1J8I A;  4B9W A;  2C9O A;  4KKU A;  3SDZ A;  3OOC A;  1SYD A;  3V2T A;  2TMP A;  3NBH A;  2WP8 J;  1AP0 A;  3KUP A;  4IFD H;  2ICE C;  1AN8 A;  1CZW A;  3MEH A;  2NVY B;  1LT5 D;  3SR1 A;  3NUC A;  1EY7 A;  3MXU A;  5C4X B;  5M5Y B;  1HTP A;  1KNA A;  2LMC B;  1CM9 A;  3GTP B;  3VA5 A;  2JXM B;  2EJM A;  1E2V A;  4ODG A;  2B2V A;  4BY7 B;  2X6L A;  3AMU A;  1BO0 A;  2ZXP A;  2WAQ B;  4DNT B;  4N9T A;  2B2U C;  4N9P A;  5E1F A;  1WD0 A;  3D6C A;  5EKI A;  2RA4 A;  1H9S A;  1U4P A;  2D2C C;  3MC0 B;  2SOB A;  1QIL A;  2EJG C;  2B8F A;  2KOL A;  3FPP A;  2F0F A;  2IWH A;  1LTA D;  2A6H C;  1E2W A;  1V1O A;  3I73 A;  3CU7 A;  5D14 A;  2A5H A;  2JA8 B;  1EWC A;  3S17 B;  1K83 B;  2JSO A;  2Y0S B;  4L63 B;  1X3Q A;  4PMC A;  4Z9C B;  1PZJ D;  3NBI A;  3NTK A;  5M3F B;  3D4W A;  1STE A;  1EY8 A;  2BE5 C;  2B63 B;  3L3O C;  3GO5 A;  4J6H A;  2HUG A;  1BQQ T;  4A3K B;  2EY5 A;  5LHY 1;  3VR4 A;  1A3T A;  4X3T A;  2KHS A;  2JE6 I;  1JCK B;  3ERQ A;  4IUU A;  3JAM L;  1WTR A;  4G4K A;  5CYU A;  1B9M A;  1IW7 C;  4K5W A;  4RGO S;  5EKK A;  3HKZ B;  2L9H A;  3Q24 A;  1L0Y B;  3OPO A;  1OXX K;  3P1H A;  4BBS B;  3FEW X;  4K5V A;  3EJI A;  3FKI B;  2KUM A;  1A6X A;  4RHS A;  1OO9 B;  4K5X A;  4XYQ A;  1STY A;  4G7Z C;  2AWN A;  1DOK A;  4O42 A;  3MTS A;  3KK7 A;  1D5M C;  3PO3 B;  4KD3 A;  1PRT F;  1GUS A;  5KEE A;  4QF4 A;  5CMD A;  1D1I A;  1QWY A;  1KLG D;  1SNO A;  4A3G B;  1JOO A;  1ZEQ X;  3RMH A;  2EYL A;  3P75 A;  1EYC A;  3H0G B;  2F03 A;  2KCN A;  3K59 A;  4MN3 A;  5CBE E;  2OF1 A;  1IHZ A;  1JQY D;  5DM6 3;  2M2L A;  1UAP A;  5CV5 A;  4DK1 A;  1LT6 D;  1DJR D;  4FNF A;  2IL8 A;  2NVX B;  1Q3L A;  1II3 A;  4H0L C;  1F9Q A;  1WTX A;  1O7Y A;  3SE0 A;  4K8I A;  1S4Z A;  2DNC A;  2PCF B;  1GJX A;  1DXM A;  2RSO A;  3I4L A;  2A69 D;  1G91 A;  2PZU A;  2XNA C;  4TRD A;  2O5I C;  3BDO A;  3NTI A;  3J80 E;  1BXT A;  2ENB A;  2EVB A;  3GTK B;  5IGD A;  3D6W A;  5AFW A;  3D8G A;  3MFG A;  2EY1 A;  5D3D A;  2YYZ A;  1D5X C;  2K01 A;  1LTT D;  1STH A;  1STA A;  1SNM A;  5NUC A;  1ONL A;  1C8C A;  3K5O A;  2RDG A;  3K6O A;  3ND8 A;  5C3W A;  5C0X H;  3V05 A;  2VB2 X;  4KMU C;  4F87 A;  4TQU S;  3OMG A;  3GTL B;  2PO4 A;  3OSO A;  2Z1C A;  2R7Z B;  1SND A;  2EYO A;  1GUT A;  1A3U A;  5I6Y A;  2L0C A;  1PTO H;  4F7X A;  3M85 A;  1JWU D;  2C5C A;  4DNR B;  5KNC A;  4A3B B;  2A74 C;  3UI2 A;  2NB0 A;  3VR6 A;  1RHP A;  1S5D D;  4C3H G;  1ILQ A;  4X3U A;  4OGQ C;  2NZ1 D;  1OXV A;  2R6G A;  4IN3 A;  3RUZ A;  2E2D C;  5JAV A;  5IGC A;  1ICW A;  3C46 A;  3CKI B;  3NSW A;  3PIP 3;  1TQO A;  2HCI A;  2FIN B;  2JEB I;  4OO1 G;  1Y1V B;  4C2M B;  3T53 B;  4A3E B;  5KIX A;  2HDM A;  2A73 B;  1WD1 A;  4PQX A;  2B2W A;  2NBF A;  3OWE B;  1HPC A;  1EL0 A;  2PW5 A;  1G6Z A;  2BOS A;  3M4Y A;  3SK5 A;  4NP5 A;  4A3I B;  2AQ1 B;  4O1N A;  5EGT A;  2N88 A;  1JC7 A;  1A15 A;  1OXT A;  3VR5 A;  3RZD B;  4CKB A;  5CC4 A;  1ESR A;  3DMU A;  1JOR A;  1H9K A;  1PZI D;  2G9D A;  2J4X A;  3QO2 A;  1A3V A;  1SYE A;  2F3V A;  4CKC A;  1KDA A;  2XWB B;  2HCC A;  1PDQ A;  2JP1 A;  2LFN A;  3PV0 A;  4M1U B;  3CHB D;  1YNN C;  2EXZ A;  1IKL A;  1BCP D;  1Z7T A;  3V96 A;  4L6T B;  3VA7 A;  4ILW A;  4IFD J;  3K0Y A;  1SEB D;  1SE2 A;  5M5X B;  3NQT A;  3X3M A;  4RFB A;  2F0S A;  5DM7 3;  2NN6 I;  4ZRZ A;  5G3L F;  1B9N A;  4BA1 I;  1ZXT A;  5JVH 3;  3S16 B;  4HCE A;  4HR7 B;  1BCP B;  1EFI D;  4LK1 C;  1SYG A;  5JJZ A;  4QUF A;  1A2T A;  1R4Q B;  2JA7 B;  5BN5 A;  3TBI B;  4XQN A;  5C0X I;  3K5N A;  1H9S B;  3I4M B;  3X3N A;  5C3X A;  3KLR A;  4XT3 B;  1DYQ A;  5DNF A;  4DF7 A;  4ABN A;  1LAB A;  4S3S A;  5JEA G;  1JR0 D;  5EQ0 A;  4DFA A;  2F0V A;  4B9X A;  3J80 L;  1O78 A;  4IAL A;  5CV4 A;  4HSV A;  1NCV A;  5FK9 C;  3J7Y W;  2K04 A;  2PMZ B;  1AZQ A;  3VYT A;  2JA5 B;  3GQB A;  2NUC A;  2ZXO A;  1C4Q A;  3M3Y B;  4KHZ A;  1PRT C;  4K6L A;  1KDC A;  5DEH A;  3TZU A;  2EYH A;  4QMG A;  4Q5V A;  4XTC S;  1FNW A;  1Y8O B;  2WKC A;  1TWF B;  2DNE A;  5D65 A;  2A68 C;  2NTT A;  3DEP A;  4DK0 A;  3M4O B;  2LKV A;  3K7A B;  5LL6 X;  3D4R A;  4TKO B;  2LS0 1;  4KJO A;  4YIJ A;  1PTO D;  3QB3 A;  2F0L A;  2F0Q A;  5EBD A;  5ELE A;  1GXD C;  2F0J A;  1TS5 A;  4CKE A;  1Q1E A;  2AUJ D;  1YNJ D;  1ML0 D;  3NWT A;  1RTN A;  1EQV A;  4ID6 A;  3HOW B;  4BWG B;  1E0B A;  1D6E C;  1PTO B;  1EWH A;  1W6K A;  1LTG D;  1DOL A;  3QOL A;  1ZKO A;  2H1E A;  3KLS X;  4P2C B;  3TSS A;  3GTQ B;  3QG1 A;  2PNR C;  4XT1 B;  4KN4 C;  1JOK A;  2BA0 A;  2DY8 A;  2XN9 C;  4ZQ3 A;  2HDL A;  2CHB D;  3DWP A;  1CFM A;  3J81 E;  4EQO A;  5C6A A;  3ONA B;  4I7Z C;  4RGM A;  1B2T A;  2Z4H A;  2ZT9 C;  1S5C D;  2E2H B;  2EY2 A;  4PMB A;  1PFB A;  2XWJ B;  2ZXR A;  4EQN A;  1GHJ A;  2OEO A;  1IYV A;  4HN7 A;  1O80 A;  1MGS A;  4DA2 A;  4HSP A;  3WOE A;  2CW0 D;  4DAP A;  2O2L D;  3Q0A A;  2XRQ D;  3HOV B;  4KI0 A;  3S14 B;  4QCL A;  2F0I A;  2RDF A;  5A35 A;  3K57 A;  1WCM B;  3F2U A;  1I3Q B;  5IGG A;  4CBV A;  3Q22 A;  1SNC A;  4DAV A;  1B53 A;  2PZW A;  4DGZ A;  4OIK A;  5I9O A;  1V1P B;  5FKA C;  4IUN A;  3A56 A;  4I65 A;  2EPB A;  2J7Z A;  3MXN A;  3S9W A;  1WTV A;  1CA6 A;  5JVG 3;  5EBC A;  1RF2 D;  2B2V C;  3E6Z X;  4MHE A;  3QJY A;  1TVX A;  3FDT A;  3A55 A;  4IUR A;  1MBY A;  2SEB D;  3TZD A;  4RKL A;  3DEO A;  4XYO A;  4M8A A;  1BCP C;  3VR3 A;  3T13 A;  1SE4 A;  3HRZ C;  1Q8I A;  3T51 B;  5C0X J;  4CHT B;  2L4N A;  3FVQ A;  1F2Z A;  3SHL A;  2B8G A;  2F0M A;  3HOY B;  3HG9 A;  1Y8N B;  3I72 A;  2D9U A;  3A8I E;  1VMP A;  3SK6 A;  4HMJ A;  1EU4 A;  1SMY D;  2CVR A;  4FVM A;  2F0G A;  5A2Q E;  1CHP D;  1HFN A;  1I4H A;  1Y1W B;  5EPJ A;  1UEA B;  5LL6 S;  4HMI A;  2K32 A;  1Z47 A;  3K5L A;  1ET6 A;  1O7L A;  1MSG A;  3LWE A;  1I4G A;  2KEE A;  1DCZ A;  2E76 C;  3OIP A;  3H94 A;  2B39 A;  3NQI A;  3I3C A;  5HGT A;  1I4Q A;  4XXE A;  3BYY B;  3VR2 A;  1FR3 A;  2RDH A;  4BS9 A;  4UAI A;  4FXD A;  4R9W A;  1SNQ A;  2L11 A;  3FPU B;  4K14 A;  4FF1 A;  1GUN A;  1XX8 A;  4TSS A;  2MP1 A;  1L0X B;  1G2S A;  4U67 3;  3MHB A;  1I4X A;  3BDL A;  3TP8 A;  5ELF A;  2Q8I B;  3PUY A;  5ELC A;  4X3S A;  2F3W A;  1F2L A;  1DD2 A;  1SSO A;  3D3R A;  3IAY A;  1OXU A;  4C3I G;  1CQF A;  1NSN S;  1STN A;  3BZD B;  5E4X A;  3R3O A;  2XVS A;  4IFD G;  1CI3 M;  4WFN 3;  2F0T A;  1GUG A;  1ENC A;  4LMQ D;  4NDX A;  3MXP A;  4DXF A;  4KN7 C;  4IUQ A;  1FNV A;  1SJH D;  2GA4 B;  2NN6 H;  1X32 A;  3J81 L;  2EE1 A;  1EZ6 A;  1V1P A;  3CRK C;  2K05 A;  5JEA H;  1YNJ C;  2A6E D;  2IX1 A;  3S1R B;  4KY6 A;  1TWG B;  2BCO A;  4NMZ A;  5M9O A;  5T1I A;  1STG A;  5F2D A;  2J0T D;  3RD4 A;  1XXG A;  2TSS A;  1JB3 A;  3A8J E;  3VYR A;  1QE6 A;  5DAU A;  1MSH A;  4XQQ A;  4FF2 A;  5C44 B;  2HQE A;  1DOM A;  3G6J B;  1H9R A;  1S5E D;  1STB A;  4OO1 I;  1BR9 A;  4WJW A;  4RGN A;  2F0K A;  2L12 A;  2L55 A;  2QCP X;  4KHV A;  2K5Q A;  2H4O A;  1BF4 A;  4G7O C;  4CJ2 C;  1GOZ A;  2KJX A;  4FXG C;  3N6R A;  4FO2 A;  2B2T A;  2R92 B;  1KAA A;  5KGU A;  1XWE A;  5EJW A;  5EPK A;  1Q12 A;  3KF8 A;  2Z8L A;  3HOX B;  3VYS A;  2K1B A;  4RCO A;  5CBA E;  1EY0 A;  4DU9 A;  2F0P A;  3HZX A;  3GD7 A;  1SE3 A;  1U4M A;  3KLS A;  3S1Q B;  1CK1 A;  5K36 G;  1TS4 A;  5M5W B;  1VDZ A;  4A3F B;  2IX0 A;  2EDG A;  4ZAI A;  4WOR A;  3OIQ A;  3CRL C;  5COR A;  1PFN A;  4G57 A;  5D3I B;  4C3H B;  1K8M A;  1BCP F;  1EYA A;  2A6H D;  4F8M A;  3DHQ A;  1I6V C;  1HUM A;  3P20 A;  1HTL D;  5A2Q L;  2F0U A;  4FXK C;  1PYW D;  3NPP A;  5T1G A;  5IOD A;  2AQ2 B;  1M4V A;  2SDF A;  1VF5 C;  3IFD A;  3GTM B;  3NK9 A;  3TP5 A;  3SXH A;  1F2M A;  1JE4 A;  3CQZ B;  2B2Y A;  1VCI A;  1U4L A;  2KCC A;  1LV9 A;  4LJZ C;  3OW7 A;  3TP7 A;  3H09 A;  4H44 C;  4BBR B;  3NHH A;  4QB4 A;  4X3K A;  1SFO B;  1W6J A;  2B2W C;  3S2H B;  4FF4 A;  4R8N A;  1GUO A;  1LTB D;  3URY A;  3BVM A;  1TT2 A;  2EOT A;  4G7H C;  1S5B D;  4KTA A;  1AW7 A;  3G7L A;  1R4P B;  3WDN A;  3RLF A;  3GTG B;  2BDN A;  1EY4 A;  4IUT A;  2BDO A;  2FMM A;  2KED A;  4C1N I;  2DN8 A;  3HP3 A;  2E75 C;  3GP7 A;  2RVL A;  3EA6 A;  4V19 0;  1SYC A;  3MZ5 A;  4HCS A;  1G29 1;  2M9V A;  4FP5 D;  4ZLT F;  5J1Z A;  2WAC A;  1FGB D;  3GV3 A;  1F77 A;  1JWS D;  3PIO 3;  4C3J G;  3C3L A;  3DWA A;  1HRJ A;  3PMF A;  3H3V C;  1HUN A;  3A54 A;  2IW3 A;  1HQR D;  3HS0 C;  3DM1 A;  2RQX A;  5ISR A;  1PTO F;  5KYI A;  1H9M A;  2I07 B;  2PW7 A;  4BA2 I;  3D31 A;  3LX0 A;  4ULL A;  2Q8R E;  1QNU A;  1ROD A;  4KK7 A;  1BNZ A;  1CT1 D;  2A69 C;  3GTO B;  3PUX A;  2OT2 A;  3LWU A;  1LTR D;  2RKS A;  2JEA I;  1RJT A;  1ZYR D;  2QKI C;  5IGB A;  2VUM B;  1WTO A;  1TII D;  4ZUJ A;  2L5T A;  1FYC A;  2FHT A;  4IQZ A;  1EEI D;  2EYJ A;  2E2I B;  1H9J A;  1KLU D;  4K2L A;  3MXG A;  3S1N B;  5JPN C;  1SDF A;  5FOB B;  2B2U A;  4ZKC B;  3H91 A;  2VB3 X;  5BN3 A;  2KEC A;  1TWA B;  1F9R A;  3DWQ A;  2F4I A;  4KY5 A;  1UUP A;  1J9O A;  4CJ0 B;  3QIA A;  3BVZ A;  3AU7 A;  2NTS A;  1HA6 A;  3J7A F;  1M8A A;  4CJ1 B;  1QG7 A;  1JWM D;  5FO8 B;  3I70 A;  4J8Q A;  1D1K A;  5I2Y A;  1ENF A;  3MA2 B;  1Y8P B;  3TDQ A;  2WV6 D;  1SYF A;  2NVT B;  2IJ0 A;  4K6D A;  1LTI D;  3E5S A;  2K7V A;  3SEB A;  5K5P A;  1AEX A;  3ITP A;  3OHX C;  2EYP A;  2YU9 B;  2R3Z A;  1KNE A;  1WVL A;  3I4N B;  1ESF A;  5E4W C;  3PUZ A;  4RWS C;  2D5D A;  3L9A X;  1Z6H A;  5J39 A;  2IT1 A;  2NYZ D;  3MFY A;  4EGV A;  3S15 B;  5CV7 A;  5HUR A;  1KDB A;  2JYO A;  1BOS A;  2RBM A;  2XSC A;  1A2U A;  2IX3 A;  2WB1 B;  2IPK D;  3C1F A;  3QWN A;  2JA6 B;  3OMC A;  3ND9 A;  5FO7 B;  2N55 A;  5IGF A;  3SK8 A;  3EFX D;  4FF3 A;  4U68 A;  4Y7N B;  3T16 A;  1T5X D;  2KQ3 A;  5JEA J;  4HED A;  4RH6 A;  2FMC A;  1EY9 A;  2F0E A;  3TME A;  4IZ8 A;  1CA5 A;  5CGK A;  2EYM A;  5ELB A;  3C1E A;  5KRU A;  3KBG A;  2PQE A;  5IIF A;  1PZK D;  2F0N A;  1EOT A;  1EIH A;  1ET9 A;  1LAC A;  5EKL A;  2OXP A;  2G9H D;  3M7N A;  1WTW A;  2X6G A;  2FFK B;  3ZYY X;  2PZT A;  2WKD A;  1UNS A;  1O7Z A;  3SK4 A;  4ZKB B;  4OO1 H;  4KKS A;  1F2Y A;  1YNN D;  4C56 C;  5K36 H;  3TP6 A;  3H6M A;  3M7G A;  4UDU C;  2LY7 A;  4H7B A;  2K28 A;  1CTM A;  1DON A;  2O4X A;  5CR3 A;  2SNM A;  1B3A A;  3BYT B;  3LNN A;  3Q23 A;  4QUC A;  1TS2 A;  1QCB D;  3BDC A;  5C3E B;  1LO5 D;  1WTQ A;  4DAY A;  4XQJ A;  3N52 A;  1PXU A;  2R61 A;  3MVV A;  4PV1 C;  4IFD I;  1NR2 A;  1RTO A;  4AYB B;  2K33 A;  3BVG A;  5C4H A;  2F1M A;  4V0B A;  1RKN A;  3S1M B;  3HOU B;  5C5L A;  2PYK A;  4GZY C;  1HA5 A;  3GV6 A;  1TR5 A;  5CV9 A;  1HQM C;  4ZUI A;  1B1Z A;  3R8B A;  1NR4 A;  3R2I A;  3EVQ A;  1GHK A;  1PRT D;  4XIG S;  4CGY B;  1TY2 A;  3IFT A;  3RZO B;  1PFM A;  2PPB C;  1QOH A;  1S5F D;  1LTS D;  1U4R A;  4A3J B;  5IGE A;  2XRS D;  2QF7 A;  1EZ8 A;  1RD9 D;  3T56 B;  1ZYR C;  1VMC A;  1F9S A;  3FMC A;  1BDO A;  1PTO C;  2WIN B;  5I2X A;  2QDB A;  2A68 D;  2MUY A;  2EYF A;  1AZP A;  4IUP A;  1BUV T;  2K5W A;  4RAU C;  1DM0 B;  1BBX C;  1PRT B;  1GUW A;  3AB9 A;  1FD7 D;  5E3F A;  2F0W A;  2FJ2 A;  1EY6 A;  1EIG A;  2EY6 A;  2F0H A;  1V43 A;  1MD2 D;  5TSS A;  4C3I B;  1D2B A;  4IUV A;  1SNP A;  2MPM A;  4E6I A;  2E74 C;  5COY A;  3A7A B;  3J7A V;  1K8O A;  1ILP A;  1NUC A;  1SAP A;  2F0O A;  2CQA A;  5I6W A;  5IT9 E;  2XIW A;  1LT3 D;  4ZYS A;  1G2T A;  4NKL A;  1TWC B;  3L7Z C;  2AQ3 B;  5KNB A;  4K2K A;  3W3A A;  1C48 A;  2AUK A;  5BN4 A;  1D5Z C;  2E2J B;  4A3M B;  2I46 A;  4EVO A;  3NE5 B;  4PNY A;  1IKM A;  4KKT A;  2DY7 A;  3PUW A;  3Q6S A;  1CHQ D;  3D4D A;  5FLX E;  1I4R A;  1I6H B;  4QIW B;  2WII B;  2K03 A;  2CW0 C;  1EY5 A;  3NXW A;  3OWF A;  1WTP A;  1NAP A;  3BS1 A;  4LAA A;  1HHV A;  1IL8 A;  3PUV A;  5FO9 B;  2V4D A;  3A7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...