1EZ6A

Structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 39
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ez6A00
1SNQA 4TRDA 3HEJA 2F3VA 1EY6A 2F0EA 3OWFA 4ZUIA 1SYFA 1TQOA 4KTAA 4QMGA 4R8NA 3SK4A 1KDAA 1STNA 2OEOA 3P75A 3P1HA 5CR3A 2PZTA 2F0JA 2F0OA 4N9TA 4DU9A 4EVOA 1EYAA 4WORA 3SK5A 5C4ZA 4HMJA 4K5WA 3HZXA 5ISRA 5CV6A 1SYGA 2RDFA 4H7BA 4OL7A 1SYEA 3TMEA 4EQNA 5IGDA 5C4HA 3V2TA 1SYBA 4K2LA 2PYKA 4YIJA 1EY8A 2EY6A 2F0LA 3QOJA 4IUNA 4NDXA 4ME5A 4RKBA 4KY6A 1STHA 1ENCA 3EJIA 1SYDA 1A3TA 2EY5A 3NXWA 2SOBA 4EQPA 1F2MA 4QF4A 2LKVA 5EGTA 5HURA 5JOBA 4S3SA 2SNMA 1STBA 3DMUA 4KJOA 2M00A 1EZ6A 4B9WA 2F0TA 2F3WA 3EVQA 3NP8A 3SHLA 5IGFA 4ZUJA 1IHZA 1A3UA 4KHVA 1STYA 2OXPA 4KJNA 4WRDA 4PMBA 2EY2A 4HMIA 1A3VA 3EROA 3RUZA 1A2UA 2QDBA 3MEHA 4IZ8A 3D6CA 3TP8A 5J22A 3NUCA 2F0NA 1F2ZA 1SYCA 1SNMA 3MVVA 1KABA 1EY4A 2EYMA 2F0WA 5M9OA 2SNSA 1SNPA 5CGKA 5NUCA 1F2YA 1SNCA 4ZQ3A 5HGTA 2F0KA 4NMZA 3R3OA 1KDCA 1RKNA 4KY7A 4ODGA 3D8GA 5CV7A 2F0DA 5C3WA 5I9PA 1TT2A 2F0PA 5IODA 2EYLA 5K5PA 3MZ5A 1EY0A 1JORA 4DGZA 5E3FA 3U9OA 3C1EA 2EY1A 2F0HA 4RKLA 4IALA 5DEHA 4NP5A 3TP6A 4KD3A 2EYJA 1AEXA 5IGEA 2EYFA 2KQ3A 5E1FA 5CV8A 3NHHA 5KEEA 1STGA 1KAAA 1II3A 1U9RA 1EYCA 4N9PA 2PW5A 3BDLA 5F2DA 2KHSA 5I9OA 1TR5A 2F0GA 2PQEA 3T13A 2F0UA 4LAAA 5C3XA 3VA5A 2ENBA 4PNYA 4KV6A 4I65A 3ITPA 4K8IA 1EY9A 3TP7A 3ERQA 5C5LA 1EY5A 5KRUA 1EQVA 4K2KA 3SXHA 3MHBA 5EKKA 4DFAA 1JOOA 5KYIA 4K5VA 4K8JA 1A2TA 2EYPA 4MIUA 5DAUA 3OSOA 4DF7A 4E6IA 4K14A 5I6WA 5I6YA 3LX0A 5IOCA 2PZUA 3MXPA 4NKLA 4B9XA 2F0FA 5CV5A 2F0SA 3H6MA 2RKSA 3OMGA 1EZ8A 1NUCA 5IGGA 3D4WA 4EQOA 3OMCA 3QB3A 5IGCA 4KY5A 5KGUA 5IGBA 3QOLA 4J6HA 5CV9A 4QB4A 4J1MA 4K6DA 2PW7A 1KDBA 2EXZA 2PZWA 2EYOA 1SNDA 5C5MA 5KIXA 2HQEA 4G57A 2NUCA 3D4DA 2OF1A 3PMFA 1STAA 3C1FA 4K5XA 5CV4A 1ENAA 2F0QA 2F0VA 4HTHA 3TP5A 4F8MA 3S9WA 1JOKA 1JOQA 3NQTA 4KD4A 3DHQA 3BDCA 1SNOA 3SK8A 4F7XA 2F0MA 5IIFA 5J1ZA 5KYLA 5C6AA 4ID6A 5JAVA 5J39A 1EYDA 3E5SA 4PMCA 2WACA 3SR1A 1NSNS 2EYHA 2O4XA 2RBMA 3NK9A 3SK6A 2F0IA 3T16A 5CC4A 5EKLA 1EY7A
chains in the Genus database with same CATH superfamily
1Z47A 2B2TC 1Y1VH 2ZXOA 3HP3A 4MTNA 2RHSB 2H1EA 2KVMA 2YV5A 4A3FH 1QNUA 3U9SA 4CHTB 1CK1A 2KBNA 4P72A 5M3MB 4PZ7A 1WTRA 1RTNA 1S72A 3QJYA 4YY3Q 2B2UC 2LSSA 2R6GA 3K80C 3W3AA 3A8KE 4RKBA 5IYCG 4YY3L 1F77A 1JJCB 3NXWA 1JB7A 4RGMA 1Q8KA 4DV2Q 2AQ1B 2JE6I 4HJ7A 2CKZB 3K0XA 4L8JA 1HQRD 3MAQA 4DK0A 3HOVB 5IYBH 2KOLA 4DV2L 3NPPA 2H5XA 4GOPC 3HOXG 2Z6KC 4HMIA 4YCVA 3PO3B 4G7HC 1TS3A 1SJHD 4RGNA 2L0CA 4MHEA 1Y1WB 1IL8A 1EOTA 3R3OA 3ER0A 3D8GA 2CH4A 4N8X1 5K5PA 3Q23A 5M3MH 4LFCQ 4N8FA 1RL2A 1TU2B 1WI5A 4CDDC 4A3KG 3JAML 1DXMA 1WTHA 1U5KA 4LFCL 5AJ3Q 2IX3A 1V1OA 1XTCD 3UDFA 4HJ5A 5M5XB 2VUMG 1NY4A 1VQNA 5AJ3L 1CHPD 2F4VQ 3HOWB 5ELCA 1EY9A 3WOFA 1TVXA 2NZHA 1LLRD 2RHQB 1K3BC 2F4VL 5EKKA 4RGTA 4CDFC 3RN2A 4ZRZA 2KEEA 4DF7A 1HTPA 1VQDA 2F3IA 2B63G 4QIWB 2NN6I 3PO3H 2D62A 2PO4A 3J7YW 1HNWQ 2ATWA 5GADC 1KLUD 1W6KA 4DV4Q 4ZCKA 5A2QL 1Y1WH 1IBLL 1HNWL 4KKTA 4AYBG 4HCEA 1QUQA 3PIO3 2PW7A 2EXZA 4DV4L 3VDYA 4IPCA 5IT9E 1KC8C 2FMCA 3FEWX 4A3DH 2CWAA 4K5XA 3CPWA 2XGTA 2WP8J 1YHQA 2F0VA 1L2FA 4BY7B 1SAPA 3K0YA 3M4QA 3HOWH 5EBDA 4QJFA 1HNXQ 4XT3B 1DD2A 4PG3A 1HNXL 4GOPB 2F0EA 1IKLA 5T1GA 4KTAA 1IYUA 2AUJD 1CKNA 3M3YH 4CDCC 4X3SA 1C7YA 3NE5B 5C4ZA 5JVH3 2ZTCA 4OL7A 3BJUA 3TMEA 2PYKA 2EY6A 5COYA 3J81j 3DWQA 1IZ6A 1H9KA 4IUPA 3L3OC 1B3QA 2JXMB 2ZT9C 1MD2D 2X69A 4RGOS 5JEAH 3PUVA 3PF4A 1J8IA 2CCZA 1F9SA 3D6CA 3GO5A 3I55A 3U4VA 4Y7NB 4DKAC 4JI2Q 2N78A 3A54A 1PA6A 4BY1B 4JYAQ 2RA4A 3C2PA 2PQAA 2K75A 4U68A 1CUKA 2EYLA 5FLXc 4JI2L 1EQTA 4JYAL 1CHQD 2EY1A 5DEHA 1B2TA 3MC0B 1D1IA 3K5OA 3CQZB 2NVYB 5C0XG 3H94A 3U58A 4OWWB 2PNRC 4OONA 2BDOA 1Y8OB 2B2WA 1QB5D 1FGBD 1X3FA 5C5LA 4DV5Q 1TWFB 1EQVA 3H91A 3L0OA 5LHY1 5IP9H 3PIP3 1SMYC 3HOZG 4DV5L 1A2TA 5DAUA 3E9IA 3I2ZA 1EIHA 2LY7A 2FJ2A 4HAEA 4XTCS 2EOTA 3T51B 5M3FG 4HJ8A 1U4PA 4Y7NH 2WAQB 1UWVA 4BY1H 2JA8G 4R4IA 3DXJC 2PZWA 5C5MA 5D14A 3GTQB 2EIFA 1Q3LA 1PH8A 1JCKB 5CV4A 3ZJYC 2GA4B 5D3DA 5LMUL 1PRTD 3CCUA 1TWGB 3C3LA 5JAVA 1KIXA 5IYCH 1QILA 1SE4A 2F3VA 1SYFA 2ZXRA 4M8AA 4G7ZC 1G6PA 2IX0A 1EIFA 3JAMi 4A93B 2B2UA 1XMOQ 4JI0L 4G4KA 1E0BA 1HNZQ 1S5DD 2ICEC 4X66Q 2Q2HA 4H7BA 2B63B 1XMOL 5BN4A 1HNZL 1BBWA 4X66L 1ZXTA 3GTQH 4GN3B 1QNKA 4PV1C 1JJ2A 4KLKA 1UNSA 1K8AC 4GOPA 4CKEA 3HKSA 4DNIA 2B8FA 2KJXA 1TWGH 4ZUJA 4A3CG 4TQUS 4Q5VA 2LMCB 2NWGA 2K5QA 5FOBB 2EQSA 2VUMH 1KD1C 5FO7B 3QG1A 3S2DB 1H9SB 3Q6SA 3JC66 4JBJA 1KDCA 1G6ZA 3E0JA 4A93H 3OTOQ 4XQNA 2CW0D 2L5TA 3URYA 2B63H 1EEID 1ET6A 4IALA 2EYJA 3OTOL 2KCMA 5E1FA 3R8BA 2IL8A 1N33Q 3A55A 1KHIA 4ALPA 2BCOA 1ICFB 3KLRA 1WYDA 2HDLA 3I7FA 2N88A 3S14H 5DLQE 1FD7D 5EKIA 5FLMG 2UUCQ 3G7LA 5KRUA 3FP9A 1AZPA 2UUCL 3W2DA 1HR0Q 2MO0A 2EYPA 1LUZA 2MUYA 1WD1A 1JWSD 2Z1CA 3W1BA 1LYLA 2EPBA 4YCUA 1HR0L 5CV5A 3GTOB 3F2DA 2I5HA 1ET9A 1JJGA 4DV0Q 4ZKCB 4X3KA 1SE2A 1IW7C 2PI2E 4DV0L 5E4WC 1TS2A 4WFN3 1HXYD 4GN5A 3TZDA 3RLFA 1N36Q 5JJLA 4O0AA 4KHZA 2F52A 1LTRD 3UDIA 3BZDB 2VL6A 1TWHB 4PMCA 1Q81C 1N36L 3GQBA 3DM3A 1S3OA 1I6VC 1AZQA 4DAVA 3KFUA 5ELBA 1P16A 5DM63 5C4JH 3S1RB 4IURA 2AQ2B 4OIKA 4EGVA 2E5LQ 2OEOA 1VMCA 3DWAA 4EVOA 4C3HG 2E5LL 2ALYB 3KDFB 4A3IG 4L5SA 3QOJA 1BKBA 3F2CA 3NBIA 4NW2A 2A19A 4A3MG 4BBSB 1ENCA 1O7IA 1BVSA 2EY5A 4LF6Q 4C3JG 1NR4A 3DMUA 1QE6A 4LF6L 1X6OA 3NTKA 2F3WA 2EDGA 1U4LA 2M2LA 2OXPA 1TWHH 1QVCA 1VQCA 4WRDA 5C0XH 4XYOA 3A7LA 1SXTA 2A6ED 1WFQA 5JJIA 1SYCA 3Q24A 2NVXH 5CGKA 4Z9CB 4X62Q 1VQBA 4MN3A 2F0DA 4OHJA 3KJOA 3HOZH 1KL9A 4X62L 1JORA 3U9OA 4P73A 1Y1VG 2IWHA 4UPAA 4QIWE 4KD3A 1I5FA 1MGSA 4X65Q 1KXLA 3NHHA 2P5ZX 3BG3A 1STGA 5M3FH 3H3VH 1EFWA 1II3A 4JG2A 5F2DA 1P8LA 1TR5A 4X65L 1STEA 1LTSD 3K8AA 1SBBB 1DZ1A 1E2ZA 4R4TA 1N34Q 2NVTB 1M4VA 2ASBA 2GN5A 4LFAQ 3GTJB 4FXGC 1N34L 3MXNA 1QZHA 1O80A 4LFAL 1YVCA 3J81c 4MTKA 4ZK9B 1LM0A 3G48A 4UP9A 5IYBG 2OQKA 3C46A 2E2JB 4MZ9A 1VQAA 3KJPA 4UDUC 4K6DA 1KDBA 1EU4A 2RSNA 3CF5A 1V8QA 1WTVA 1WJJA 4HIDA 4G57A 3KF8A 3PMFA 2L1BA 3A8IE 3I4MB 1JOQA 4IPDA 4F7XA 5M3MG 3E6ZX 1PZID 2DNCA 5J1ZA 1OO9B 3I4OA 1MBYA 1NSNS 2NVTH 1G2TA 3SK6A 3MWYW 3CCEA 5EKLA 2XTIA 4LF5Q 1YNXA 1SNQA 2HQLA 4JC0A 2LXKA 1MJEA 3N6RA 1L1OC 4QMGA 2DN8A 3RZDB 3CC7A 1FJGQ 2F0JA 1C48A 3VR3A 3HOVG 4NXNQ 4WORA 1Q82C 2CQOA 3GV6A 1N8RC 1FJGL 1VQ8A 1HUNA 3CKIB 4NXNL 4IFDJ 2Q2TA 3PO3G 2A6HD 4YCWA 2QKIC 1E7ZA 4M1UB 1JR0D 2Q8TA 3EJIA 3JAME 3Q8DA 3RR5A 1Y1WG 5GAGC 3GD7A 1PTOB 1GHJA 4DUYQ 1BCPB 1S5BD 3EVQA 3SHLA 3NP8A 4PZ6A 2A68C 4DUYL 2IT1A 4YWLA 2PCFB 2UXBQ 2G9DA 2L15A 4IN3A 2QDBA 3TP8A 3U50C 2K04A 2UXBL 3MA2B 1TY2A 1TWAH 3NTIA 3RZDH 3HOWG 1SNCA 1ZYRD 4J15A 5C3WA 1EIGA 2L55A 4ZAIA 1R9TB 5GAEC 3G71A 4GN4B 5A2QE 5E3FA 1XTDA 4JI7Q 4POFA 3W1GA 2XWBB 2PQEA 1JWUD 2WAQE 3ICEA 2KHJA 3FVQA 1CSQA 3I3CA 4AIMA 1PTOH 2H4OA 2XIWA 4K8IA 2R61A 1X55A 3UDXA 4K2KA 1A8VA 3MHBA 2DGYA 1VQ9A 2NTTA 2F03A 2V4DA 4ULLA 3T56B 2PZUA 3SDZA 2R7ZB 4A4IA 3UE0A 1PH1A 4BY7G 1HPCA 1L1OB 4CJ2C 2UXDQ 4APVA 5JEAG 4QB4A 2D0OA 3KF6A 5CORA 1R9TH 2HD3A 2UXDL 4DAYA 2BH2A 3A7AB 1SR3A 5GQOA 1KAWA 3J7AF 4LF7L 2F0QA 2RF4A 3DHQA 3AEVA 1X3PA 4WJ3M 4DAMA 5KYLA 3L2PA 1HR0W 4FF4A 3J80c 4JI8Q 1LV9A 1EIYB 4A3MH 4H02A 4QY7A 3EBEA 3A8JE 1JWMD 4OWTB 4JI8L 3SK4A 3TREA 1KDAA 2K4KA 2R7ZH 2PZTA 1MSGA 1VDZA 2JK8A 4A3JB 5IP9G 5EQ0A 5ISRA 3EQLC 2E2DC 1WOCA 2FINB 1U4MA 4QQBX 4I7AA 2F0LA 4ME5A 1XX8A 4DXGA 3KLWA 1SYDA 5EGTA 2ES2A 5AFWA 4BY1G 3K5NA 4OWXB 1J5EQ 2G5DA 2AWOA 2Q8IB 2LS01 4C1NK 1PYWD 1STYA 1J5EL 3CW2C 3M4YA 4P74A 5J22A 4CJ1B 1F2LA 1G2SA 1DOKA 1K3RA 3IAYA 1ZEQX 5NUCA 4AQYQ 3UE1A 2BH8A 1N9WA 4A3JH 4DR6Q 4AQYL 2JN4A 1N32Q 4HR7B 2Y0SB 2GVBA 4DR5Q 2A8VA 4DR6L 1WTQA 4YWMA 1N32L 3STBC 1KAAA 4DR5L 2RSOA 4L63B 1V9PA 1VQJA 4OO1H 4RFBA 2EZVA 4LWCA 4I65A 2KA7A 1HQMC 2WAQG 4H44C 4RH6A 1GXDC 2EJMA 5BR8Q 5EAYA 1RF2D 2KCTA 4FP5D 4IPGA 1PLFA 4KHPQ 5JPNC 3OSOA 3SVMA 4H13C 5I6WA 5BR8L 4V190 4NKLA 2K05A 3TZUA 1YIJA 4KHPL 2XRSD 4KN4C 4QGUA 3LWUA 4EQOA 3OMCA 2JP1A 2X6LA 3QB3A 4LJZC 5IGBA 2Z4IA 4ZKBB 1JE5A 1PH4A 3OWEB 1JICA 1WVLA 4HIKA 1ILQA 5FLXL 1RD9D 3BVMA 1ASYA 3HOVH 4A93G 1L0XB 1YHAA 5M5WB 3AFQA 1B44D 4DR7Q 1PFMA 1B53A 1CM9A 2LXJA 3PIOA 2JEBI 1O7YA 1IBLQ 4KN7C 4DR7L 3L9AX 3VR4A 1AE3A 1VS0A 3OWFA 4XQQA 3IKJA 4DU9A 3AU7A 3R93A 3O13A 2B3GA 5IGDA 5LMNQ 5M5XH 4XIGS 1CT1D 1XPRA 2JJQA 5FO8B 5LMNL 3ULLA 1MSHA 1VQHA 4EQPA 2ZJRA 3TBIB 4QF4A 3U4ZA 4DR4L 2SNMA 4B9WA 4C3IB 2QDLA 1HHVA 3HG9A 5C44B 2ZJPA 3PUWA 3HOUB 2CWPA 3D0FA 3P7JA 4IUTA 2QF7A 4DNTB 1W2BA 1LTTD 3SE0A 4RHRA 4C56C 1GHKA 2F0WA 2SNSA 1FNWA 1SNPA 4L5QA 4NMZA 1QG7A 4A75A 1I4RA 4FF3A 4KY7A 2O5JC 2VW9A 1CSPA 1XXGA 2I07B 4DGZA 4PQXA 3TP6A 2XWJB 2PI2A 1GUGA 1YNJD 1O78A 1NE3A 2KHIA 4BY7H 3BDLA 1X56A 2WB1B 2KHSA 2F0GA 5JPMC 1G51A 2B39A 1Y8NB 3T1HQ 1GJXA 3CC4A 1I4GA 3ERQA 3CXCA 2SEBD 1JC7A 1QOHA 3T1HL 4BXXH 2KUMA 3BZCA 4R4OA 3EN2A 1E2WA 1SRUA 2C9OA 1AP0A 1I4QA 1BNZA 5C44H 2NVQB 3LX0A 5IOCA 1XMQQ 1FL0A 1QZGA 1SE8A 4FDBA 4B9XA 3HOUH 2K5DA 4LF4Q 5ELNA 2IW3A 1XMQL 2EXDA 5IGCA 2RDGA 4GZYC 4LF4L 2A69D 4J1MA 1RIPA 4BWGB 3N52A 1SSOA 3PIPA 1CI3M 1OXXK 1Z9FA 3CCRA 3HOYG 1E3PA 2DY8A 2YYZA 3ULPA 1BQQT 5CBAE 2G9HD 2WFWA 3LGJA 2QCPX 1UUPA 2WKDA 2OQ0A 2NN6H 3D3RA 1AW7A 3DLLA 2F0IA 1PH2A 2RQXA 4QCLA 4BBSG 4KKSA 3HEJA 1I4XA 2OTJA 1X65A 4AH6A 3NBHB 1TS4A 2N49A 1NR2A 4JPBW 3X3NA 5K36G 3K57A 3KOJA 1EYAA 3QO2A 3W5OA 3HRZC 1SYGA 2B2VC 5LMUQ 3CQZH 2NVYH 1BOSA 5C4HA 2J4XA 3ZYYX 1GM5A 4JI3Q 4FO2A 4BA1I 4IJHA 4KY6A 5ELFA 4DN4M 2DNEA 1I4PA 1KRTA 3A56A 2QA4A 2Z0SA 4JI3L 3D6WA 3MFYA 2B2TA 2E8GA 5HURA 3CCVA 1TWFH 1LTGD 2QEXA 3T53B 2AHOB 3KK7A 1NBWA 1X3QA 4JI0Q 4HIMA 4WJ4A 1OXVA 2EY2A 1WD0A 3I4NB 4B3MQ 2HCIA 2K5HA 3RZOB 1BO0A 1WCMB 2F0NA 1F2ZA 1I94Q 2JA6B 2EVBA 3P20A 1L0WA 4B3ML 4G7OC 4CGYB 4DXFA 1F2YA 3M4OB 2WV6D 1CA5A 4EX5A 3G6EA 1I94L 4JBWA 4FYDA 2I46A 3MZ5A 4XYQA 1EY0A 1T5XD 3EA6A 4LUOA 3M7GA 5IGEA 1AEXA 1VCIA 3K81C 5CV8A 5EPJA 2D9UA 3STBD 4UHVA 2Z6KA 2JA5B 1EYCA 3S17B 2B2YC 2NYZD 5CYUA 1I50B 1B50A 3LNNA 1ESFA 3WDNA 1XNQQ 4O2DA 1DGSA 1YNNC 1LT4D 3I4NH 3MXPA 3I4MG 1HUMA 3E9HA 1XNQL 2CHBD 3RZOH 3E0EA 3H3VC 2JA6H 1PXUA 5H1SE 1EFID 1EYGA 1PTOF 3M4OH 2RDHA 1BCPF 1D1KA 4DR1Q 5C0XI 2PMZB 2JA9A 2F4IA 4HSPA 4LUZA 2I5MX 4DR1L 3TEHB 2VXWA 2OF1A 2OWOA 4BS9A 5IY0A 2PNHA 2R3ZA 2JA5H 4LF9Q 3PUYA 4KD4A 3S17H 4OXPA 1HA6A 3F2BA 1Q1BA 3I8ZA 4LF9L 5J39A 3WWVA 1XWEA 2L4NA 3S2DH 3PUZA 1Q12A 1S40A 4K0KQ 2K33A 3J81L 1EUJA 4K5WA 3I90A 1EU3A 4K0KL 1G8ZD 1K28A 1SYEA 5ELOA 3V2TA 1SYBA 3J7AV 1E24A 1EY8A 1R4PB 4NDXA 4A3EB 1PYBA 1JT8A 2N55A 2QW7A 2K28A 3BYYB 5IE8A 4S3SA 3M85A 1KQSA 2Y0SE 1HCZA 3HOYB 2XSCA 1FYCA 3MXGA 5GAHC 3PF5A 4KJNA 2C35B 2D0PA 1EWIA 1FVIA 1DYQA 3GP7A 3GTOH 1Z6HA 1GUNA 1SNMA 3S1QB 2EYMA 4CJ0B 3CMEA 3PV0A 4ZQ3A 2CFMA 1ASZA 4ODGA 2KENA 5LMNW 2VB3X 3CP0A 2I5LX 2OTLA 1V1QA 3TS2A 1JQYD 4LMQD 4XXEA 1T5EA 3ONAB 1PFNA 4A3EH 2R7ZG 2AQ3B 4LUVA 5KNBA 2XVSA 3LWEA 1PH9A 5EBCA 4B3RQ 3VA5A 4IFDG 4ABNA 3EIVA 2ZXPA 1NMFA 2VZAA 2Z4HA 2MHVA 4B3RL 5E7NA 3HOYH 2NBFA 1IKMA 2QGQA 1A15A 3S1RH 1M8AA 4MIUA 4TSSA 5EPLA 4K14A 3ND8A 5IT9c 1PDQA 3H6MA 2RKSA 3S1QH 4DK6C 3A74A 2DY7A 4J8QA 3PUXA 1UE6A 2E2IB 4KY5A 1C4QA 1I3QB 2XN9C 1PTOC 4DV3Q 1KTKA 1BCPC 1RTOA 4BBSH 1AH9A 4BBRB 1MKHA 4DV3L 4JBKA 2L12A 1H9SA 1IYVA 1O7LA 4HTHA 1SJED 5BN3A 5K36H 4BA2I 3NQTA 1AFPA 4A3JG 1SMYD 5IP7H 3X3MA 2K50A 3DEOA 4DR2Q 2HT1A 1CTMA 4HN7A 4OELB 1LTLA 1C0AA 4DR2L 2JA7B 1V1PB 1UEBA 4OO1G 3J7ZC 1BUVT 1EY6A 1TQOA 4ZLTF 1PH3A 4KI0A 2NTSA 3KBXA 3P75A 2B2VA 5T1IA 1QVFA 2E2IH 1L0YB 1PFBA 1I3QH 5C4XG 2X6GA 3I91A 1QJOA 3DM1A 1STHA 2BE5C 1HZAA 4BBRH 3A0JA 1G291 3DEPA 1SDFA 1O7ZA 3OYYA 1VF5C 3GTJH 5IYDG 4LNQA 2Y0SG 1W6JA 1Q8IA 5IGFA 2TMPA 1WTWA 3FKIB 2J0TD 1CZGA 2RCNA 2WB1E 3EROA 2DUDA 4IZ8A 3MEHA 3MFGA 1H95A 2JA7H 2JSOA 3MVVA 3J80L 4HJ9A 2UU9Q 2E2JH 1MIUA 2IPKD 1RJTA 5CV7A 1PH7A 2UU9L 2MJ8A 1XPUA 1CZWA 4UAIA 2F0HA 4EQNA 4RKLA 2JQOA 2VQEL 1Z7TA 4NP5A 2B2YA 3I4MH 5KEEA 3TQYA 2K5VA 5I4DA 3TN2A 5FLXE 5I9OA 3FMCA 4K6LA 5CBEE 4ILWA 2ENBA 4OGQC 4PNYA 1Y8PB 4R4QA 2HHHL 3R2IA 3RNUA 4YWKA 1RODA 3RLNA 3GTKB 3K6OA 1WTXA 3KDFA 1HZCA 3J81i 1XYIA 2MO1A 1UAPA 1XJVA 5FKAC 3HS0C 1S5FD 2F0FA 5TSSA 3D4WA 4DA2A 4H0LC 2ZJQA 5KNCA 4C2MB 1D8LA 1BF4A 1GUSA 2F1MA 4A3BB 1ML0D 2BDNA 3S16B 2HQEA 3BS1A 4QUFA 1C8CA 4IJLA 3CAMA 3OIQA 1PHJA 5HGQA 3TP5A 4JCVE 4FF2A 2QEJC 2F0MA 4DAPA 1TIID 3I56A 4U673 2R93B 2EYHA 1LACA 2R92B 1NTGA 1U4RA 4OO1I 4JI4Q 1IW7D 1BBXC 4JVZA 5A35A 4A3LH 4LF7Q 4JI4L 1JMCA 4BXXG 4C3IG 1C9OA 4F88A 4DK1A 1KLGD 1X9NA 5J3BA 3T4AC 2YTVA 5JJZA 5C44G 3OIPA 3HOUG 4A3BH 2BOSA 1BXTA 3FDTA 4IUNA 2D2CC 2YTYA 3S16H 4A76A 4PMWA 2HDMA 3G4SA 3NTHA 2LKVA 2M00A 4GLVB 2VQFQ 5GROA 1QUQB 3FHWA 1VQIA 4A3GB 2R93H 2RCFA 2VQFL 4GKKQ 2RVLA 2WB1G 3DWPA 2R92H 1KABA 4IUUA 3OW7A 1Q90A 2EJGC 5HY6A 1WTPA 4IFDH 1OXTA 1KNAA 4GKKL 3F8TA 5IODA 4A3FB 4OX9Q 2NN6G 1EL0A 5EJWA 3K5LA 2HIVA 4NPSA 3S1MB 3OOCA 1AE2A 1DOLA 3V96A 4OX9L 3FPPA 1Q46A 1RCVD 1PZKD 2KQ3A 1Q7YC 2FMMA 1F9RA 4R8IA 2B29A 2GVAA 1CA6A 1PVOA 1CKNB 5C4XB 4JBMA 2Q2IA 1PMRA 3HKZE 1B3AA 1Y14B 1VQEA 2PMZE 3RN5A 4IQZA 2WKCA 3HGBA 1UE7A 1D7QA 1K0RA 3M7NA 1PRTC 1Y69U 2OCEA 4A3GH 5IWAQ 2HCCA 5KNDA 2F0SA 1PYSB 2PPBC 5IGGA 3BYTB 5LL6X 5IWAL 1A63A 1K8OA 1OXSC 3M4PA 4R9WA 1PTOD 1BCPD 2EYOA 1E22A 3S1MH 1B8AA 2K1BA 3D4DA 4XQJA 3C1FA 1ENAA 3NENA 2OT2A 1B70B 4F8MA 1UE5A 3K59A 5C4XH 3J80i 2PQAB 5C3EB 4DV7Q 2O4XA 1YEZA 5CC4A 1HFGA 3I4LA 4DUZQ 1EY7A 1VF7A 1YJ9A 3EFXD 4DV7L 3CCLA 4YHHQ 4DUZL 1PFSA 3ND9A 1S5ED 5IYDH 1TY0A 5JEAJ 3OHXC 4YHHL 2N8NA 4UP8A 3A5ZB 2KCNA 4EQ5A 1DONA 2MFIA 4DV1Q 3QIAA 3I4NG 3TSSA 1WCMG 2CW0C 2NZOA 4DV1L 2JA6G 2BE5D 1HTLD 1LT6D 1J6QA 1VQ7A 4LF8Q 4IO9A 3GTMB 3H0GB 4A3DB 1L1OA 2CH4W 3K58A 4LF8L 3Q22A 1A3UA 1YI2A 5C3EH 4R1JA 1D6EC 5FJ8H 1VQPA 2JA5G 4IPHA 4JV5Q 1PRTB 2K5NA 2ZTDA 1HFNA 1EY4A 1S4ZA 1NMGA 4CKCA 4JV5L 1DCZA 2F0PA 3FPUB 2KCCA 3M3YB 1D5XC 4DR4Q 3CCJA 2IX1A 4GS3A 1KNEA 1GUTA 1BR9A 1YBYA 4P71A 5M5WH 4B3TQ 1HRJA 4L6TB 2F0UA 2MPMA 4LAAA 2A68D 2A74C 4DK3C 3GTMH 4B3TL 3H0GH 3R2TA 3HKZG 3VYUA 1TXYA 3SXHA 3VR2A 1JOOA 2QILA 3QWNA 2Z9HA 1E1TA 1A62A 5KYIA 4E6IA 1T9HA 3VA7A 1X54A 3RMHA 3M9BA 2BA1A 3NWSA 1D2BA 2K6AA 4HSVA 5KGUA 2E75C 1BBUA 3J81E 3BVZA 3K7UC 2E2HB 2AMCB 4R4CA 3I72A 3S9WA 3H09A 4C3IH 2XRQD 4RMFA 4UP7A 3PSIA 1TS5A 1SE3A 2A73B 4A3EG 1HZBA 1YITA 1IYJB 1D5ZC 3UI2A 3MTSA 1E1OA 2O2LD 2O5IC 1VMPA 4HEDA 2A6EC 2MNAA 4JI5Q 2UXCQ 3JAMc 3SK5A 2BA0A 4IOAA 5CV6A 3BVGA 1W3SA 1VQ6A 4JI5L 2UXCL 4GNXC 2E2HH 4DR3Q 1A3TA 3SGIA 1CKOA 1IBKQ 4DV6Q 2MQHA 1EWHA 4KJOA 5D65A 4DR3L 1K83B 4LK1C 1IBKL 4DV6L 3NSWA 3CD6A 1MJCA 1LTAD 4KHVA 2NVQH 1LTID 2IHFA 4IUVA 1PZJD 5FO9B 4IOCA 1A2UA 1YJNA 2DJGC 5M9OA 5IP7G 1WTOA 3TS0A 4HJAA 1EWCA 1GKHA 3CU7A 4L5TA 1RKNA 3ERSX 4O42A 1SFOB 1GVPA 2YU9B 3I70A 3HOXB 2EYFA 3SEBA 1HH2P 4CBVA 1U9RA 1V43A 3OW2A 1K0SA 3CMAA 3ITPA 3TP7A 1GO3E 1OTCA 1X32A 2D5DA 1K83H 1GUOA 3KLSX 4QUCA 2Q8RE 4BBRG 3CRKC 4XT1B 1M90C 4A3KB 1H9MA 2YTXA 5I6YA 3AYHB 2N3SA 2NZ1D 3CPFA 2VUMB 1TWCB 1M1KC 2FXQA 5G3LF 1KRSA 1LT5D 1PH5A 2R7DA 2VY3A 3TRZA 5CV9A 4O1NA 1SFOH 4CDEC 2IY5B 1DJRD 2JA7G 5BN5A 1SROA 2YU9H 3HOXH 4PZ8A 4L5RC 1STAA 4GLAC 3HFZB 2E74C 1PV4A 3IL8A 4B08A 4FNFA 1YZ6A 2A6HC 2JYOA 2AUKA 3SK8A 4GNXB 2FHTA 1F9QA 1VQGA 4AYBB 1VQ5A 3F1ZA 2JEAI 1EYDA 3IFTA 3S14B 2RBMA 1WCMH 3T16A 5JVG3 4X3UA 1HA5A 4A3KH 1PH6A 1STNA 3HKZB 3P1HA 3J80E 2F0OA 1TWCH 5C0XJ 2MP1A 5IT9L 3NQIA 3FKIG 2CVRA 2EE1A 1ZYRC 1B1ZA 4DNRB 1U0LA 3GDEA 3MXNB 1I50H 2L11A 2LFNA 2SOBA 3BU2A 1F2MA 3CRLC 4XDXA 4RCNA 3H3VI 1EZ6A 1OXUA 2F0TA 5JJKA 1IHZA 4TKOB 1N33L 4PMBA 1CFMA 3RD4A 1DOMA 1XPOA 3AB9A 3KF8B 4JI6Q 4DPGA 5C4JB 3KYHC 2NB0A 1AN8A 2TSSA 3GTLB 1JE4A 4JI6L 2ID0A 3AFPA 3C1EA 1VQLA 4OIJA 3H15A 1X3EA 2ICIA 4A3LG 3NEMA 5L37A 1CKMA 3NBHA 3E3XA 1G91A 3GV3A 1A0IA 1EY5A 5LL6S 4A3BG 3DUZA 4WJWA 2CQAA 1B9MA 4K8JA 4X6AH 1LT3D 3OMGA 1HZ9A 1EZ8A 3D4RA 1IL2A 4OEMB 1B4OA 2UUBQ 3GTLH 4C1NI 3QOLA 2NVXB 2R93G 2L9HA 4LFBQ 4IUQA 2UUBL 4RHSA 5KIXA 2R92G 2MGSA 3J7A5 3HOZB 1NNXA 1RDPD 4LFBL 4F87A 3AMUA 3WOEA 3G6JB 1E2VA 1TKWB 5M3FB 1K73C 3BDCA 3S15B 2IJ0A 2K01A 5C6AA 1MHWC 5D3IB 2JA8B 2HUGA 2IHEA 2V1CC 2WACA 3SR1A 4KK7A 5CMDA 1EOVA 1LABA 2KEDA 5FK9C 4FVMA 1ONLA 2E76C 1IBMQ 2WINB 1I4HA 4JOIC 1R4QB 5CR3A 4N9TA 1IBML 3B6YA 4KMUC 2DJFC 4HMJA 3HZXA 2RDFA 4GLXA 1K9MC 4A3GG 3NELA 4GNXA 2I0QA 1IXRA 1GD7A 1CQVA 3KLSA 3PO2G 2K32A 1CQFA 5I2XA 3AQQA 4A3FG 2WIIB 1STBA 1A6XA 2SDFA 2Z8LA 5EPKA 3S15H 1GOZA 4Q0FA 1EQQA 3KF6B 2JA8H 3BZKA 3PCOB 5DM73 4DAYB 2A1AA 1SMXA 3RUZA 1Q86C 2A5HA 2C5CA 3NUCA 2FFKB 1B9NA 1VQFA 1EEFD 5IIFA 5I9PA 1B7YB 4LW1A 3IFDA 4QL5A 3PO2H 5I2YA 4RCOA 4FXDA 2UUAQ 2ZM6Q 1K8MA 1VQOA 2UUAL 4KV6A 2ZM6L 2VS1A 4P75A 1FNUA 1I6HB 1ICWA 3PGZA 2VQEQ 1SEBD 4NB3A 3VYRA 1TWAB 4HCSA 5C3EG 4J6HA 2K7VA 1D5MC 3NWTA 4LF5L 5FJ8G 1SNDA 3QR8A 3KBGA 2HHHQ 1Q1EA 1MI2A 4V0BA 1YJWA 2Q2UA 4A3CH 4IFDI 2NUCA 4JW0A 3A5UA 2ZTEA 1PRTF 3TDQA 1JOKA 1YNND 3FKIH 3MEFA 4ID6A 3E5SA 1ESRA 3NK9A 1FNVA 1LTBD 3RLOA 3GTPB 3L7ZC 3OPOA 3S1NB 4TRDA 2K52A 2Z6BA 4RAUC 1I6HH 4ZUIA 4R8NA 5DNFA 3H0GG 1NJIC 1RHPA 4X3TA 4A3DG 2EJFC 1EQRA 1YHBA 4UY8C 2K14A 3VYSA 3MXUA 2VNUD 1JB3A 5FLMH 3Q0AA 4TVAB 3ULJA 4K2LA 4HIOA 4YIJA 3GTGB 3K7AB 3VR5A 1VQ4A 4X64Q 4Y52H 1F9PA 1X3GA 3VR6A 1NCVA 3CC2A 1S5CD 3CCSA 4X64L 5JOBA 1YNJC 3GTKH 4JI7L 2M9VA 4C3HB 3IRBA 2AKWB 1VQMA 4B3SQ 1A3VA 2XNAC 1BDOA 4A3IB 3S24A 3GTPH 5ELEA 4JI1Q 3VYTA 3S1NH 3T1YQ 4A3MB 4C2MH 4B3SL 2J7ZA 5HGTA 1FR3A 3CHBD 4FXKC 4C3JB 4JK1C 2F0KA 5E4XA 2K5WA 4JI1L 3T1YL 1SN8A 1TT2A 3F2UA 4MNOA 2K03A 3FRPB 5M5YB 1K8GA 4POGA 1V1PA 2A69C 1NAPA 3KUPA 1QCBD 1SLJA 2KECA 3K7AH 3GTGH 4NXMQ 4N9PA 1UEAB 2PW5A 5C3XA 3T13A 1ENFA 2AWNA 2R7FA 4NXML 3S2HB 1ZKOA 3I73A 4C3HH 2B2WC 3K5MA 3CCQA 1H9JA 4DFAA 2HIXA 3PO2B 1Y1VB 4K5VA 1VQKA 4A3IH 1J9OA 3PQIA 1NUCA 2VB2X 4I7ZC 4AYBE 1H9RA 2B8GA 1LO5D 4C3JH 1ILPA 5G3LD 4RG1A 3V05A 4GKJQ 1FGUA 1QVGA 1XNRQ 3D31A 5M5YH 1UE1A 4GKJL 3CCMA 4FF1A 1XNRL 4ME3A 4ZYSA 1QWYA 4KKUA 4P2CB 1HJPA 4RA8A 3UDGA 1SNOA 1DM0B 1GUWA 4CKBA 3S2HH 5ELDA 4JOIA 4RWSC 3BDOA
chains in the Genus database with same CATH topology
1Z47A 2B2TC 2ZXOA 3HP3A 2H1EA 2KVMA 1QNUA 3U9SA 4CHTB 1CK1A 5M3MB 1WTRA 1RTNA 3QJYA 2B2UC 2R6GA 3W3AA 3A8KE 4RKBA 1F77A 3NXWA 4RGMA 2AQ1B 2JE6I 4L8JA 1HQRD 3MAQA 4DK0A 3HOVB 2KOLA 3NPPA 4HMIA 3PO3B 4G7HC 1TS3A 1SJHD 4RGNA 2L0CA 4MHEA 1Y1WB 1IL8A 1EOTA 3R3OA 3D8GA 5K5PA 3Q23A 1TU2B 3JAML 1DXMA 2IX3A 1V1OA 1XTCD 5M5XB 1CHPD 3HOWB 5ELCA 1EY9A 3WOFA 1TVXA 1LLRD 5EKKA 4RGTA 4ZRZA 2KEEA 4DF7A 1HTPA 4QIWB 2NN6I 2D62A 2PO4A 3J7YW 1KLUD 1W6KA 5A2QL 4KKTA 4HCEA 3PIO3 2PW7A 2EXZA 5IT9E 2FMCA 3FEWX 4K5XA 2WP8J 2F0VA 4BY7B 1SAPA 3K0YA 5EBDA 4XT3B 1DD2A 2F0EA 1IKLA 5T1GA 4KTAA 1IYUA 2AUJD 4X3SA 3NE5B 5C4ZA 5JVH3 4OL7A 3TMEA 2PYKA 2EY6A 5COYA 3DWQA 1H9KA 4IUPA 3L3OC 2JXMB 2ZT9C 1MD2D 2X69A 4RGOS 5JEAH 3PUVA 1J8IA 1F9SA 3D6CA 3GO5A 4Y7NB 3A54A 4BY1B 2RA4A 3C2PA 4U68A 2EYLA 1EQTA 1CHQD 2EY1A 5DEHA 1B2TA 3MC0B 1D1IA 3K5OA 3CQZB 2NVYB 5C0XG 3H94A 2PNRC 2BDOA 1Y8OB 2B2WA 1QB5D 1FGBD 5C5LA 1TWFB 1EQVA 3H91A 5LHY1 3PIP3 1SMYC 1A2TA 5DAUA 1EIHA 2LY7A 2FJ2A 4HAEA 4XTCS 2EOTA 3T51B 1U4PA 2WAQB 3DXJC 2PZWA 5C5MA 5D14A 3GTQB 1Q3LA 1JCKB 5CV4A 2GA4B 5D3DA 1PRTD 1TWGB 3C3LA 5JAVA 1QILA 1SE4A 2F3VA 1SYFA 2ZXRA 4M8AA 4G7ZC 2IX0A 4A93B 2B2UA 4G4KA 1E0BA 1S5DD 2ICEC 2B63B 4H7BA 5BN4A 1ZXTA 1QNKA 4PV1C 1UNSA 4CKEA 2B8FA 2KJXA 4ZUJA 4TQUS 4Q5VA 2LMCB 2NWGA 2K5QA 5FOBB 5FO7B 3QG1A 3S2DB 1H9SB 3Q6SA 1KDCA 1G6ZA 3E0JA 4XQNA 2CW0D 2L5TA 3URYA 1EEID 1ET6A 4IALA 2EYJA 5E1FA 3R8BA 2IL8A 3A55A 2BCOA 3KLRA 2HDLA 2N88A 5EKIA 1FD7D 3G7LA 5KRUA 1AZPA 3W2DA 2EYPA 2MUYA 1WD1A 1JWSD 2Z1CA 2EPBA 5CV5A 3GTOB 1ET9A 4ZKCB 4X3KA 1SE2A 1IW7C 5E4WC 1TS2A 4WFN3 1HXYD 3TZDA 3RLFA 4KHZA 1LTRD 3BZDB 1TWHB 4PMCA 3GQBA 1I6VC 1AZQA 4DAVA 5ELBA 5DM63 3S1RB 4IURA 2AQ2B 4OIKA 4EGVA 2OEOA 1VMCA 3DWAA 4EVOA 4C3HG 3QOJA 3NBIA 4NW2A 4BBSB 1ENCA 2EY5A 4C3JG 1NR4A 3DMUA 1QE6A 3NTKA 2F3WA 2EDGA 1U4LA 2M2LA 2OXPA 4WRDA 5C0XH 4XYOA 3A7LA 1SXTA 2A6ED 1SYCA 3Q24A 5CGKA 4Z9CB 4MN3A 2F0DA 4OHJA 1JORA 3U9OA 2IWHA 4KD3A 1MGSA 3NHHA 3BG3A 1STGA 1II3A 5F2DA 1TR5A 1STEA 1LTSD 1DZ1A 1SBBB 1E2ZA 2NVTB 1M4VA 3GTJB 4FXGC 3MXNA 1O80A 4ZK9B 3C46A 2E2JB 4UDUC 4K6DA 1KDBA 1EU4A 2RSNA 1V8QA 1WTVA 4G57A 3KF8A 3PMFA 2L1BA 3A8IE 3I4MB 1JOQA 4F7XA 3E6ZX 1PZID 2DNCA 5J1ZA 1OO9B 1MBYA 1NSNS 1G2TA 3SK6A 3MWYW 5EKLA 1SNQA 3N6RA 4QMGA 2DN8A 3RZDB 2F0JA 1C48A 3VR3A 4WORA 3GV6A 1HUNA 3CKIB 4IFDJ 2A6HD 2QKIC 4M1UB 1JR0D 2Q8TA 3EJIA 3JAME 3GD7A 1PTOB 1GHJA 1BCPB 1S5BD 3EVQA 3SHLA 3NP8A 2A68C 2IT1A 2PCFB 2G9DA 4IN3A 2QDBA 3TP8A 2K04A 3MA2B 1TY2A 3NTIA 1SNCA 1ZYRD 5C3WA 1EIGA 2L55A 4ZAIA 1R9TB 5A2QE 5E3FA 2XWBB 2PQEA 1JWUD 3FVQA 3I3CA 1PTOH 2H4OA 2XIWA 4K8IA 2R61A 4K2KA 3MHBA 2NTTA 2F03A 2V4DA 4ULLA 3T56B 2PZUA 3SDZA 2R7ZB 1HPCA 4CJ2C 5JEAG 4QB4A 5CORA 4DAYA 3A7AB 3J7AF 2F0QA 3DHQA 1X3PA 5KYLA 4FF4A 1LV9A 3A8JE 1JWMD 3SK4A 1KDAA 2PZTA 1MSGA 1VDZA 4A3JB 5EQ0A 5ISRA 3EQLC 2E2DC 2FINB 1U4MA 2F0LA 4ME5A 1XX8A 4DXGA 1SYDA 5EGTA 5AFWA 3K5NA 2AWOA 2Q8IB 2LS01 4C1NK 1PYWD 1STYA 3M4YA 5J22A 4CJ1B 1F2LA 1G2SA 1DOKA 3IAYA 1ZEQX 5NUCA 4HR7B 2Y0SB 1WTQA 1KAAA 2RSOA 4L63B 4OO1H 4RFBA 2EZVA 4I65A 2KA7A 1HQMC 4H44C 4RH6A 1GXDC 2EJMA 1RF2D 4FP5D 1PLFA 5JPNC 3OSOA 3SVMA 4H13C 5I6WA 4V190 4NKLA 2K05A 3TZUA 2XRSD 4KN4C 3LWUA 4EQOA 3OMCA 2JP1A 2X6LA 3QB3A 4LJZC 5IGBA 2Z4IA 4ZKBB 3OWEB 1JICA 1WVLA 1ILQA 5FLXL 1RD9D 3BVMA 1L0XB 5M5WB 1B44D 1PFMA 1B53A 1CM9A 2JEBI 1O7YA 4KN7C 3L9AX 3VR4A 3OWFA 4XQQA 3IKJA 4DU9A 3AU7A 3R93A 3O13A 5IGDA 4XIGS 1CT1D 5FO8B 1MSHA 4EQPA 3TBIB 4QF4A 2SNMA 4B9WA 4C3IB 1HHVA 3HG9A 5C44B 3PUWA 3HOUB 3P7JA 4IUTA 2QF7A 4DNTB 1LTTD 3SE0A 4RHRA 4C56C 1GHKA 2F0WA 2SNSA 1SNPA 1FNWA 4NMZA 1QG7A 1I4RA 4FF3A 4KY7A 2O5JC 1XXGA 2I07B 4DGZA 4PQXA 3TP6A 2XWJB 1GUGA 1YNJD 1O78A 3BDLA 2WB1B 2KHSA 2F0GA 5JPMC 2B39A 1Y8NB 1GJXA 1I4GA 3ERQA 2SEBD 1JC7A 1QOHA 2KUMA 1E2WA 2C9OA 1AP0A 1I4QA 1BNZA 2NVQB 3LX0A 5IOCA 4B9XA 2K5DA 2IW3A 5IGCA 2RDGA 4GZYC 2A69D 4J1MA 4BWGB 3N52A 1SSOA 1CI3M 1OXXK 2DY8A 2YYZA 1BQQT 5CBAE 2G9HD 2QCPX 1UUPA 2WKDA 2NN6H 3D3RA 1AW7A 2F0IA 2RQXA 4QCLA 4KKSA 3HEJA 1I4XA 1TS4A 1NR2A 3X3NA 5K36G 3K57A 1EYAA 3QO2A 3HRZC 1SYGA 2B2VC 1BOSA 5C4HA 2J4XA 3ZYYX 4FO2A 4BA1I 4KY6A 5ELFA 4DN4M 2DNEA 1I4PA 3A56A 3D6WA 3MFYA 2B2TA 5HURA 1LTGD 3T53B 3KK7A 1X3QA 1OXVA 2EY2A 1WD0A 3I4NB 2HCIA 3RZOB 1BO0A 1WCMB 2F0NA 1F2ZA 2JA6B 2EVBA 3P20A 4G7OC 4CGYB 4DXFA 1F2YA 3M4OB 2WV6D 1CA5A 4JBWA 4FYDA 2I46A 3MZ5A 4XYQA 1EY0A 1T5XD 3EA6A 5IGEA 3M7GA 1AEXA 1VCIA 5CV8A 5EPJA 2D9UA 2JA5B 1EYCA 3S17B 2B2YC 2NYZD 5CYUA 1I50B 1B50A 3LNNA 1ESFA 3WDNA 1YNNC 1LT4D 3MXPA 1HUMA 2CHBD 3H3VC 1PXUA 1EFID 1PTOF 2RDHA 1BCPF 1D1KA 5C0XI 2PMZB 2F4IA 4HSPA 2VXWA 2OF1A 4BS9A 2R3ZA 3PUYA 4KD4A 1HA6A 1Q1BA 3I8ZA 5J39A 1XWEA 2L4NA 3PUZA 1Q12A 2K33A 3J81L 4K5WA 3I90A 1EU3A 1G8ZD 1SYEA 3V2TA 1SYBA 3J7AV 1EY8A 1R4PB 4NDXA 4A3EB 2N55A 2K28A 3BYYB 4S3SA 3M85A 1HCZA 3HOYB 2XSCA 1FYCA 3MXGA 4KJNA 1DYQA 3GP7A 1Z6HA 1GUNA 1SNMA 3S1QB 2EYMA 4CJ0B 3PV0A 4ZQ3A 4ODGA 2VB3X 1JQYD 4LMQD 4XXEA 1T5EA 3ONAB 1PFNA 2AQ3B 5KNBA 2XVSA 3LWEA 5EBCA 3VA5A 4IFDG 4ABNA 2ZXPA 2Z4HA 2MHVA 2NBFA 1IKMA 1A15A 1M8AA 4MIUA 4TSSA 5EPLA 4K14A 3ND8A 1PDQA 3H6MA 2RKSA 2DY7A 4J8QA 3PUXA 2E2IB 4KY5A 1C4QA 1I3QB 2XN9C 1PTOC 1KTKA 1BCPC 1RTOA 4BBRB 2L12A 1H9SA 1IYVA 1O7LA 4HTHA 1SJED 5BN3A 5K36H 4BA2I 3NQTA 1AFPA 1SMYD 3X3MA 3DEOA 1CTMA 4HN7A 2JA7B 1V1PB 4OO1G 1BUVT 1EY6A 1TQOA 4ZLTF 4KI0A 2NTSA 3KBXA 3P75A 2B2VA 5T1IA 1L0YB 1PFBA 2X6GA 3I91A 1QJOA 3DM1A 1STHA 2BE5C 1G291 3DEPA 1SDFA 1O7ZA 1VF5C 1W6JA 5IGFA 1Q8IA 2TMPA 1WTWA 3FKIB 2J0TD 1CZGA 3EROA 4IZ8A 3MEHA 3MFGA 2JSOA 3MVVA 3J80L 2IPKD 1RJTA 5CV7A 2MJ8A 1CZWA 4UAIA 2F0HA 4EQNA 4RKLA 1Z7TA 4NP5A 2B2YA 5KEEA 5I4DA 3TN2A 5FLXE 5I9OA 3FMCA 4K6LA 5CBEE 4ILWA 2ENBA 4OGQC 4PNYA 1Y8PB 3R2IA 1RODA 3GTKB 3K6OA 1WTXA 1XYIA 1UAPA 5FKAC 3HS0C 1S5FD 2F0FA 5TSSA 3D4WA 4DA2A 4H0LC 5KNCA 4C2MB 1BF4A 1GUSA 2F1MA 4A3BB 1ML0D 2BDNA 3S16B 2HQEA 3BS1A 4QUFA 1C8CA 3OIQA 3TP5A 4FF2A 2QEJC 2F0MA 4DAPA 1TIID 4U673 2R93B 2EYHA 1LACA 2R92B 1U4RA 4OO1I 1IW7D 1BBXC 5A35A 4C3IG 4F88A 4DK1A 1KLGD 3T4AC 5JJZA 3OIPA 2BOSA 1BXTA 3FDTA 4IUNA 2D2CC 4PMWA 2HDMA 3NTHA 2LKVA 2M00A 4A3GB 2RVLA 3DWPA 4IUUA 1KABA 3OW7A 1Q90A 2EJGC 1WTPA 4IFDH 1OXTA 1KNAA 5IODA 4A3FB 2NN6G 1EL0A 5EJWA 3K5LA 3S1MB 3OOCA 1DOLA 3V96A 3FPPA 1RCVD 1PZKD 2KQ3A 2FMMA 1F9RA 4R8IA 1CA6A 5C4XB 1PMRA 1B3AA 4IQZA 2WKCA 3HGBA 3M7NA 1PRTC 1Y69U 2HCCA 5KNDA 2F0SA 2PPBC 5IGGA 3BYTB 5LL6X 1K8OA 1OXSC 4R9WA 1PTOD 1BCPD 2EYOA 2K1BA 3D4DA 4XQJA 3C1FA 1ENAA 2OT2A 4F8MA 3K59A 5C3EB 2O4XA 5CC4A 1HFGA 3I4LA 1EY7A 1VF7A 3EFXD 3ND9A 1S5ED 1TY0A 5JEAJ 3OHXC 2KCNA 1DONA 3QIAA 3TSSA 2CW0C 2BE5D 1HTLD 1LT6D 3GTMB 3H0GB 4A3DB 3K58A 3Q22A 1A3UA 1D6EC 1PRTB 1HFNA 1EY4A 1S4ZA 4CKCA 1DCZA 2F0PA 3FPUB 2KCCA 3M3YB 1D5XC 2IX1A 1KNEA 1GUTA 1BR9A 1HRJA 4L6TB 2F0UA 2MPMA 4LAAA 2A68D 2A74C 3R2TA 3VYUA 3SXHA 3VR2A 1JOOA 2QILA 3QWNA 5KYIA 3VA7A 4E6IA 3RMHA 2BA1A 3NWSA 1D2BA 2K6AA 4HSVA 5KGUA 2E75C 3J81E 3BVZA 2E2HB 3I72A 3S9WA 3H09A 2XRQD 1TS5A 1SE3A 2A73B 1D5ZC 3UI2A 3MTSA 2O2LD 2O5IC 1VMPA 4HEDA 2A6EC 3SK5A 2BA0A 5CV6A 3BVGA 1A3TA 1EWHA 4KJOA 5D65A 1K83B 4LK1C 3NSWA 1LTAD 4KHVA 1LTID 4IUVA 1PZJD 5FO9B 1A2UA 5M9OA 1WTOA 1EWCA 3CU7A 1RKNA 4O42A 1SFOB 2YU9B 3I70A 3HOXB 2EYFA 3SEBA 4CBVA 1U9RA 1V43A 3ITPA 3TP7A 1X32A 2D5DA 1GUOA 3KLSX 4QUCA 2Q8RE 3CRKC 4XT1B 4A3KB 1H9MA 5I6YA 2NZ1D 2VUMB 1TWCB 5G3LF 1LT5D 5CV9A 4O1NA 1DJRD 5BN5A 1STAA 2E74C 3IL8A 4B08A 4FNFA 2A6HC 2JYOA 2AUKA 3SK8A 2FHTA 1F9QA 4AYBB 2JEAI 1EYDA 3IFTA 3S14B 2RBMA 3T16A 5JVG3 4X3UA 1HA5A 1STNA 3HKZB 3P1HA 3J80E 2F0OA 5C0XJ 2MP1A 5IT9L 3NQIA 2CVRA 2EE1A 1ZYRC 1B1ZA 4DNRB 2L11A 2LFNA 2SOBA 1F2MA 3CRLC 4XDXA 4RCNA 1EZ6A 1OXUA 2F0TA 1IHZA 4TKOB 4PMBA 1CFMA 3RD4A 1DOMA 3AB9A 5C4JB 2NB0A 1AN8A 2TSSA 3GTLB 1JE4A 2ID0A 3C1EA 4OIJA 2ICIA 3NBHA 1G91A 3GV3A 1EY5A 5LL6S 3DUZA 4WJWA 2CQAA 1B9MA 4K8JA 1LT3D 3OMGA 1EZ8A 3D4RA 1B4OA 4C1NI 3QOLA 2NVXB 2L9HA 4IUQA 4RHSA 5KIXA 2MGSA 3HOZB 1RDPD 4F87A 3AMUA 3WOEA 3G6JB 1E2VA 1TKWB 5M3FB 3BDCA 3S15B 2IJ0A 2K01A 5C6AA 5D3IB 2JA8B 2HUGA 2WACA 3SR1A 4KK7A 5CMDA 1LABA 2KEDA 5FK9C 4FVMA 1ONLA 2E76C 2WINB 1I4HA 1R4QB 5CR3A 4N9TA 4KMUC 4HMJA 3HZXA 2RDFA 1CQVA 3KLSA 2K32A 1CQFA 5I2XA 2WIIB 1STBA 1A6XA 2SDFA 2Z8LA 5EPKA 1GOZA 4Q0FA 5DM73 3RUZA 2A5HA 2C5CA 3NUCA 2FFKB 1B9NA 1EEFD 5IIFA 5I9PA 3IFDA 5I2YA 4RCOA 4FXDA 1K8MA 4KV6A 1FNUA 1I6HB 1ICWA 1SEBD 3VYRA 1TWAB 4HCSA 4J6HA 2K7VA 1D5MC 3NWTA 1SNDA 3KBGA 1Q1EA 1MI2A 4V0BA 4IFDI 2NUCA 1PRTF 3TDQA 1JOKA 1YNND 4ID6A 3E5SA 1ESRA 1FNVA 3NK9A 1LTBD 3GTPB 3L7ZC 3OPOA 3S1NB 4TRDA 4RAUC 4ZUIA 4R8NA 5DNFA 1RHPA 4X3TA 2EJFC 3VYSA 3MXUA 2VNUD 1JB3A 3Q0AA 4K2LA 3GTGB 4YIJA 3K7AB 3VR5A 1F9PA 3VR6A 1NCVA 1S5CD 5JOBA 1YNJC 2M9VA 4C3HB 1A3VA 2XNAC 1BDOA 4A3IB 5ELEA 3VYTA 4A3MB 2J7ZA 5HGTA 4C3JB 1FR3A 3CHBD 4FXKC 4JK1C 2F0KA 5E4XA 2K5WA 1TT2A 3F2UA 2K03A 3FRPB 5M5YB 1V1PA 2A69C 1NAPA 3KUPA 1QCBD 2KECA 4N9PA 1UEAB 2PW5A 5C3XA 3T13A 1ENFA 2AWNA 3S2HB 1ZKOA 3I73A 2B2WC 3K5MA 1H9JA 4DFAA 3PO2B 1Y1VB 4K5VA 1J9OA 1NUCA 2VB2X 4I7ZC 1H9RA 2B8GA 1LO5D 1ILPA 5G3LD 3V05A 3D31A 4FF1A 4ZYSA 1QWYA 4KKUA 4P2CB 4RA8A 1SNOA 1DM0B 1GUWA 4CKBA 5ELDA 4RWSC 3BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNQ A;  4TRD A;  3HEJ A;  2F3V A;  1EY6 A;  2F0E A;  3OWF A;  4ZUI A;  1SYF A;  1TQO A;  4KTA A;  4QMG A;  4R8N A;  3SK4 A;  1KDA A;  1STN A;  2OEO A;  3P75 A;  3P1H A;  5CR3 A;  2PZT A;  2F0J A;  2F0O A;  4N9T A;  4DU9 A;  4EVO A;  1EYA A;  4WOR A;  3SK5 A;  5C4Z A;  4HMJ A;  4K5W A;  3HZX A;  5ISR A;  5CV6 A;  1SYG A;  2RDF A;  4H7B A;  4OL7 A;  1SYE A;  3TME A;  4EQN A;  5IGD A;  5C4H A;  3V2T A;  1SYB A;  4K2L A;  2PYK A;  4YIJ A;  1EY8 A;  2EY6 A;  2F0L A;  3QOJ A;  4IUN A;  4NDX A;  4ME5 A;  4RKB A;  4KY6 A;  1STH A;  1ENC A;  3EJI A;  1SYD A;  1A3T A;  2EY5 A;  3NXW A;  2SOB A;  4EQP A;  1F2M A;  4QF4 A;  2LKV A;  5EGT A;  5HUR A;  5JOB A;  4S3S A;  2SNM A;  1STB A;  3DMU A;  4KJO A;  2M00 A;  1EZ6 A;  4B9W A;  2F0T A;  2F3W A;  3EVQ A;  3NP8 A;  3SHL A;  5IGF A;  4ZUJ A;  1IHZ A;  1A3U A;  4KHV A;  1STY A;  2OXP A;  4KJN A;  4WRD A;  4PMB A;  2EY2 A;  4HMI A;  1A3V A;  3ERO A;  3RUZ A;  1A2U A;  2QDB A;  3MEH A;  4IZ8 A;  3D6C A;  3TP8 A;  5J22 A;  3NUC A;  2F0N A;  1F2Z A;  1SYC A;  1SNM A;  3MVV A;  1KAB A;  1EY4 A;  2EYM A;  2F0W A;  5M9O A;  2SNS A;  1SNP A;  5CGK A;  5NUC A;  1F2Y A;  1SNC A;  4ZQ3 A;  5HGT A;  2F0K A;  4NMZ A;  3R3O A;  1KDC A;  1RKN A;  4KY7 A;  4ODG A;  3D8G A;  5CV7 A;  2F0D A;  5C3W A;  5I9P A;  1TT2 A;  2F0P A;  5IOD A;  2EYL A;  5K5P A;  3MZ5 A;  1EY0 A;  1JOR A;  4DGZ A;  5E3F A;  3U9O A;  3C1E A;  2EY1 A;  2F0H A;  4RKL A;  4IAL A;  5DEH A;  4NP5 A;  3TP6 A;  4KD3 A;  2EYJ A;  1AEX A;  5IGE A;  2EYF A;  2KQ3 A;  5E1F A;  5CV8 A;  3NHH A;  5KEE A;  1STG A;  1KAA A;  1II3 A;  1U9R A;  1EYC A;  4N9P A;  2PW5 A;  3BDL A;  5F2D A;  2KHS A;  5I9O A;  1TR5 A;  2F0G A;  2PQE A;  3T13 A;  2F0U A;  4LAA A;  5C3X A;  3VA5 A;  2ENB A;  4PNY A;  4KV6 A;  4I65 A;  3ITP A;  4K8I A;  1EY9 A;  3TP7 A;  3ERQ A;  5C5L A;  1EY5 A;  5KRU A;  1EQV A;  4K2K A;  3SXH A;  3MHB A;  5EKK A;  4DFA A;  1JOO A;  5KYI A;  4K5V A;  4K8J A;  1A2T A;  2EYP A;  4MIU A;  5DAU A;  3OSO A;  4DF7 A;  4E6I A;  4K14 A;  5I6W A;  5I6Y A;  3LX0 A;  5IOC A;  2PZU A;  3MXP A;  4NKL A;  4B9X A;  2F0F A;  5CV5 A;  2F0S A;  3H6M A;  2RKS A;  3OMG A;  1EZ8 A;  1NUC A;  5IGG A;  3D4W A;  4EQO A;  3OMC A;  3QB3 A;  5IGC A;  4KY5 A;  5KGU A;  5IGB A;  3QOL A;  4J6H A;  5CV9 A;  4QB4 A;  4J1M A;  4K6D A;  2PW7 A;  1KDB A;  2EXZ A;  2PZW A;  2EYO A;  1SND A;  5C5M A;  5KIX A;  2HQE A;  4G57 A;  2NUC A;  3D4D A;  2OF1 A;  3PMF A;  1STA A;  3C1F A;  4K5X A;  5CV4 A;  1ENA A;  2F0Q A;  2F0V A;  4HTH A;  3TP5 A;  4F8M A;  3S9W A;  1JOK A;  1JOQ A;  3NQT A;  4KD4 A;  3DHQ A;  3BDC A;  1SNO A;  3SK8 A;  4F7X A;  2F0M A;  5IIF A;  5J1Z A;  5KYL A;  5C6A A;  4ID6 A;  5JAV A;  5J39 A;  1EYD A;  3E5S A;  4PMC A;  2WAC A;  3SR1 A;  1NSN S;  2EYH A;  2O4X A;  2RBM A;  3NK9 A;  3SK6 A;  2F0I A;  3T16 A;  5CC4 A;  5EKL A;  1EY7 A; 
#chains in the Genus database with same CATH topology
 1Z47 A;  2B2T C;  1Y1V H;  2ZXO A;  3HP3 A;  4MTN A;  2RHS B;  2H1E A;  2KVM A;  2YV5 A;  4A3F H;  1QNU A;  3U9S A;  4CHT B;  1CK1 A;  2KBN A;  4P72 A;  5M3M B;  4PZ7 A;  1WTR A;  1RTN A;  1S72 A;  3QJY A;  4YY3 Q;  2B2U C;  2LSS A;  2R6G A;  3K80 C;  3W3A A;  3A8K E;  4RKB A;  5IYC G;  4YY3 L;  1F77 A;  1JJC B;  3NXW A;  1JB7 A;  4RGM A;  1Q8K A;  4DV2 Q;  2AQ1 B;  2JE6 I;  4HJ7 A;  2CKZ B;  3K0X A;  4L8J A;  1HQR D;  3MAQ A;  4DK0 A;  3HOV B;  5IYB H;  2KOL A;  4DV2 L;  3NPP A;  2H5X A;  4GOP C;  3HOX G;  2Z6K C;  4HMI A;  4YCV A;  3PO3 B;  4G7H C;  1TS3 A;  1SJH D;  4RGN A;  2L0C A;  4MHE A;  1Y1W B;  1IL8 A;  1EOT A;  3R3O A;  3ER0 A;  3D8G A;  2CH4 A;  4N8X 1;  5K5P A;  3Q23 A;  5M3M H;  4LFC Q;  4N8F A;  1RL2 A;  1TU2 B;  1WI5 A;  4CDD C;  4A3K G;  3JAM L;  1DXM A;  1WTH A;  1U5K A;  4LFC L;  5AJ3 Q;  2IX3 A;  1V1O A;  1XTC D;  3UDF A;  4HJ5 A;  5M5X B;  2VUM G;  1NY4 A;  1VQN A;  5AJ3 L;  1CHP D;  2F4V Q;  3HOW B;  5ELC A;  1EY9 A;  3WOF A;  1TVX A;  2NZH A;  1LLR D;  2RHQ B;  1K3B C;  2F4V L;  5EKK A;  4RGT A;  4CDF C;  3RN2 A;  4ZRZ A;  2KEE A;  4DF7 A;  1HTP A;  1VQD A;  2F3I A;  2B63 G;  4QIW B;  2NN6 I;  3PO3 H;  2D62 A;  2PO4 A;  3J7Y W;  1HNW Q;  2ATW A;  5GAD C;  1KLU D;  1W6K A;  4DV4 Q;  4ZCK A;  5A2Q L;  1Y1W H;  1IBL L;  1HNW L;  4KKT A;  4AYB G;  4HCE A;  1QUQ A;  3PIO 3;  2PW7 A;  2EXZ A;  4DV4 L;  3VDY A;  4IPC A;  5IT9 E;  1KC8 C;  2FMC A;  3FEW X;  4A3D H;  2CWA A;  4K5X A;  3CPW A;  2XGT A;  2WP8 J;  1YHQ A;  2F0V A;  1L2F A;  4BY7 B;  1SAP A;  3K0Y A;  3M4Q A;  3HOW H;  5EBD A;  4QJF A;  1HNX Q;  4XT3 B;  1DD2 A;  4PG3 A;  1HNX L;  4GOP B;  2F0E A;  1IKL A;  5T1G A;  4KTA A;  1IYU A;  2AUJ D;  1CKN A;  3M3Y H;  4CDC C;  4X3S A;  1C7Y A;  3NE5 B;  5C4Z A;  5JVH 3;  2ZTC A;  4OL7 A;  3BJU A;  3TME A;  2PYK A;  2EY6 A;  5COY A;  3J81 j;  3DWQ A;  1IZ6 A;  1H9K A;  4IUP A;  3L3O C;  1B3Q A;  2JXM B;  2ZT9 C;  1MD2 D;  2X69 A;  4RGO S;  5JEA H;  3PUV A;  3PF4 A;  1J8I A;  2CCZ A;  1F9S A;  3D6C A;  3GO5 A;  3I55 A;  3U4V A;  4Y7N B;  4DKA C;  4JI2 Q;  2N78 A;  3A54 A;  1PA6 A;  4BY1 B;  4JYA Q;  2RA4 A;  3C2P A;  2PQA A;  2K75 A;  4U68 A;  1CUK A;  2EYL A;  5FLX c;  4JI2 L;  1EQT A;  4JYA L;  1CHQ D;  2EY1 A;  5DEH A;  1B2T A;  3MC0 B;  1D1I A;  3K5O A;  3CQZ B;  2NVY B;  5C0X G;  3H94 A;  3U58 A;  4OWW B;  2PNR C;  4OON A;  2BDO A;  1Y8O B;  2B2W A;  1QB5 D;  1FGB D;  1X3F A;  5C5L A;  4DV5 Q;  1TWF B;  1EQV A;  3H91 A;  3L0O A;  5LHY 1;  5IP9 H;  3PIP 3;  1SMY C;  3HOZ G;  4DV5 L;  1A2T A;  5DAU A;  3E9I A;  3I2Z A;  1EIH A;  2LY7 A;  2FJ2 A;  4HAE A;  4XTC S;  2EOT A;  3T51 B;  5M3F G;  4HJ8 A;  1U4P A;  4Y7N H;  2WAQ B;  1UWV A;  4BY1 H;  2JA8 G;  4R4I A;  3DXJ C;  2PZW A;  5C5M A;  5D14 A;  3GTQ B;  2EIF A;  1Q3L A;  1PH8 A;  1JCK B;  5CV4 A;  3ZJY C;  2GA4 B;  5D3D A;  5LMU L;  1PRT D;  3CCU A;  1TWG B;  3C3L A;  5JAV A;  1KIX A;  5IYC H;  1QIL A;  1SE4 A;  2F3V A;  1SYF A;  2ZXR A;  4M8A A;  4G7Z C;  1G6P A;  2IX0 A;  1EIF A;  3JAM i;  4A93 B;  2B2U A;  1XMO Q;  4JI0 L;  4G4K A;  1E0B A;  1HNZ Q;  1S5D D;  2ICE C;  4X66 Q;  2Q2H A;  4H7B A;  2B63 B;  1XMO L;  5BN4 A;  1HNZ L;  1BBW A;  4X66 L;  1ZXT A;  3GTQ H;  4GN3 B;  1QNK A;  4PV1 C;  1JJ2 A;  4KLK A;  1UNS A;  1K8A C;  4GOP A;  4CKE A;  3HKS A;  4DNI A;  2B8F A;  2KJX A;  1TWG H;  4ZUJ A;  4A3C G;  4TQU S;  4Q5V A;  2LMC B;  2NWG A;  2K5Q A;  5FOB B;  2EQS A;  2VUM H;  1KD1 C;  5FO7 B;  3QG1 A;  3S2D B;  1H9S B;  3Q6S A;  3JC6 6;  4JBJ A;  1KDC A;  1G6Z A;  3E0J A;  4A93 H;  3OTO Q;  4XQN A;  2CW0 D;  2L5T A;  3URY A;  2B63 H;  1EEI D;  1ET6 A;  4IAL A;  2EYJ A;  3OTO L;  2KCM A;  5E1F A;  3R8B A;  2IL8 A;  1N33 Q;  3A55 A;  1KHI A;  4ALP A;  2BCO A;  1ICF B;  3KLR A;  1WYD A;  2HDL A;  3I7F A;  2N88 A;  3S14 H;  5DLQ E;  1FD7 D;  5EKI A;  5FLM G;  2UUC Q;  3G7L A;  5KRU A;  3FP9 A;  1AZP A;  2UUC L;  3W2D A;  1HR0 Q;  2MO0 A;  2EYP A;  1LUZ A;  2MUY A;  1WD1 A;  1JWS D;  2Z1C A;  3W1B A;  1LYL A;  2EPB A;  4YCU A;  1HR0 L;  5CV5 A;  3GTO B;  3F2D A;  2I5H A;  1ET9 A;  1JJG A;  4DV0 Q;  4ZKC B;  4X3K A;  1SE2 A;  1IW7 C;  2PI2 E;  4DV0 L;  5E4W C;  1TS2 A;  4WFN 3;  1HXY D;  4GN5 A;  3TZD A;  3RLF A;  1N36 Q;  5JJL A;  4O0A A;  4KHZ A;  2F52 A;  1LTR D;  3UDI A;  3BZD B;  2VL6 A;  1TWH B;  4PMC A;  1Q81 C;  1N36 L;  3GQB A;  3DM3 A;  1S3O A;  1I6V C;  1AZQ A;  4DAV A;  3KFU A;  5ELB A;  1P16 A;  5DM6 3;  5C4J H;  3S1R B;  4IUR A;  2AQ2 B;  4OIK A;  4EGV A;  2E5L Q;  2OEO A;  1VMC A;  3DWA A;  4EVO A;  4C3H G;  2E5L L;  2ALY B;  3KDF B;  4A3I G;  4L5S A;  3QOJ A;  1BKB A;  3F2C A;  3NBI A;  4NW2 A;  2A19 A;  4A3M G;  4BBS B;  1ENC A;  1O7I A;  1BVS A;  2EY5 A;  4LF6 Q;  4C3J G;  1NR4 A;  3DMU A;  1QE6 A;  4LF6 L;  1X6O A;  3NTK A;  2F3W A;  2EDG A;  1U4L A;  2M2L A;  2OXP A;  1TWH H;  1QVC A;  1VQC A;  4WRD A;  5C0X H;  4XYO A;  3A7L A;  1SXT A;  2A6E D;  1WFQ A;  5JJI A;  1SYC A;  3Q24 A;  2NVX H;  5CGK A;  4Z9C B;  4X62 Q;  1VQB A;  4MN3 A;  2F0D A;  4OHJ A;  3KJO A;  3HOZ H;  1KL9 A;  4X62 L;  1JOR A;  3U9O A;  4P73 A;  1Y1V G;  2IWH A;  4UPA A;  4QIW E;  4KD3 A;  1I5F A;  1MGS A;  4X65 Q;  1KXL A;  3NHH A;  2P5Z X;  3BG3 A;  1STG A;  5M3F H;  3H3V H;  1EFW A;  1II3 A;  4JG2 A;  5F2D A;  1P8L A;  1TR5 A;  4X65 L;  1STE A;  1LTS D;  3K8A A;  1SBB B;  1DZ1 A;  1E2Z A;  4R4T A;  1N34 Q;  2NVT B;  1M4V A;  2ASB A;  2GN5 A;  4LFA Q;  3GTJ B;  4FXG C;  1N34 L;  3MXN A;  1QZH A;  1O80 A;  4LFA L;  1YVC A;  3J81 c;  4MTK A;  4ZK9 B;  1LM0 A;  3G48 A;  4UP9 A;  5IYB G;  2OQK A;  3C46 A;  2E2J B;  4MZ9 A;  1VQA A;  3KJP A;  4UDU C;  4K6D A;  1KDB A;  1EU4 A;  2RSN A;  3CF5 A;  1V8Q A;  1WTV A;  1WJJ A;  4HID A;  4G57 A;  3KF8 A;  3PMF A;  2L1B A;  3A8I E;  3I4M B;  1JOQ A;  4IPD A;  4F7X A;  5M3M G;  3E6Z X;  1PZI D;  2DNC A;  5J1Z A;  1OO9 B;  3I4O A;  1MBY A;  1NSN S;  2NVT H;  1G2T A;  3SK6 A;  3MWY W;  3CCE A;  5EKL A;  2XTI A;  4LF5 Q;  1YNX A;  1SNQ A;  2HQL A;  4JC0 A;  2LXK A;  1MJE A;  3N6R A;  1L1O C;  4QMG A;  2DN8 A;  3RZD B;  3CC7 A;  1FJG Q;  2F0J A;  1C48 A;  3VR3 A;  3HOV G;  4NXN Q;  4WOR A;  1Q82 C;  2CQO A;  3GV6 A;  1N8R C;  1FJG L;  1VQ8 A;  1HUN A;  3CKI B;  4NXN L;  4IFD J;  2Q2T A;  3PO3 G;  2A6H D;  4YCW A;  2QKI C;  1E7Z A;  4M1U B;  1JR0 D;  2Q8T A;  3EJI A;  3JAM E;  3Q8D A;  3RR5 A;  1Y1W G;  5GAG C;  3GD7 A;  1PTO B;  1GHJ A;  4DUY Q;  1BCP B;  1S5B D;  3EVQ A;  3SHL A;  3NP8 A;  4PZ6 A;  2A68 C;  4DUY L;  2IT1 A;  4YWL A;  2PCF B;  2UXB Q;  2G9D A;  2L15 A;  4IN3 A;  2QDB A;  3TP8 A;  3U50 C;  2K04 A;  2UXB L;  3MA2 B;  1TY2 A;  1TWA H;  3NTI A;  3RZD H;  3HOW G;  1SNC A;  1ZYR D;  4J15 A;  5C3W A;  1EIG A;  2L55 A;  4ZAI A;  1R9T B;  5GAE C;  3G71 A;  4GN4 B;  5A2Q E;  5E3F A;  1XTD A;  4JI7 Q;  4POF A;  3W1G A;  2XWB B;  2PQE A;  1JWU D;  2WAQ E;  3ICE A;  2KHJ A;  3FVQ A;  1CSQ A;  3I3C A;  4AIM A;  1PTO H;  2H4O A;  2XIW A;  4K8I A;  2R61 A;  1X55 A;  3UDX A;  4K2K A;  1A8V A;  3MHB A;  2DGY A;  1VQ9 A;  2NTT A;  2F03 A;  2V4D A;  4ULL A;  3T56 B;  2PZU A;  3SDZ A;  2R7Z B;  4A4I A;  3UE0 A;  1PH1 A;  4BY7 G;  1HPC A;  1L1O B;  4CJ2 C;  2UXD Q;  4APV A;  5JEA G;  4QB4 A;  2D0O A;  3KF6 A;  5COR A;  1R9T H;  2HD3 A;  2UXD L;  4DAY A;  2BH2 A;  3A7A B;  1SR3 A;  5GQO A;  1KAW A;  3J7A F;  4LF7 L;  2F0Q A;  2RF4 A;  3DHQ A;  3AEV A;  1X3P A;  4WJ3 M;  4DAM A;  5KYL A;  3L2P A;  1HR0 W;  4FF4 A;  3J80 c;  4JI8 Q;  1LV9 A;  1EIY B;  4A3M H;  4H02 A;  4QY7 A;  3EBE A;  3A8J E;  1JWM D;  4OWT B;  4JI8 L;  3SK4 A;  3TRE A;  1KDA A;  2K4K A;  2R7Z H;  2PZT A;  1MSG A;  1VDZ A;  2JK8 A;  4A3J B;  5IP9 G;  5EQ0 A;  5ISR A;  3EQL C;  2E2D C;  1WOC A;  2FIN B;  1U4M A;  4QQB X;  4I7A A;  2F0L A;  4ME5 A;  1XX8 A;  4DXG A;  3KLW A;  1SYD A;  5EGT A;  2ES2 A;  5AFW A;  4BY1 G;  3K5N A;  4OWX B;  1J5E Q;  2G5D A;  2AWO A;  2Q8I B;  2LS0 1;  4C1N K;  1PYW D;  1STY A;  1J5E L;  3CW2 C;  3M4Y A;  4P74 A;  5J22 A;  4CJ1 B;  1F2L A;  1G2S A;  1DOK A;  1K3R A;  3IAY A;  1ZEQ X;  5NUC A;  4AQY Q;  3UE1 A;  2BH8 A;  1N9W A;  4A3J H;  4DR6 Q;  4AQY L;  2JN4 A;  1N32 Q;  4HR7 B;  2Y0S B;  2GVB A;  4DR5 Q;  2A8V A;  4DR6 L;  1WTQ A;  4YWM A;  1N32 L;  3STB C;  1KAA A;  4DR5 L;  2RSO A;  4L63 B;  1V9P A;  1VQJ A;  4OO1 H;  4RFB A;  2EZV A;  4LWC A;  4I65 A;  2KA7 A;  1HQM C;  2WAQ G;  4H44 C;  4RH6 A;  1GXD C;  2EJM A;  5BR8 Q;  5EAY A;  1RF2 D;  2KCT A;  4FP5 D;  4IPG A;  1PLF A;  4KHP Q;  5JPN C;  3OSO A;  3SVM A;  4H13 C;  5I6W A;  5BR8 L;  4V19 0;  4NKL A;  2K05 A;  3TZU A;  1YIJ A;  4KHP L;  2XRS D;  4KN4 C;  4QGU A;  3LWU A;  4EQO A;  3OMC A;  2JP1 A;  2X6L A;  3QB3 A;  4LJZ C;  5IGB A;  2Z4I A;  4ZKB B;  1JE5 A;  1PH4 A;  3OWE B;  1JIC A;  1WVL A;  4HIK A;  1ILQ A;  5FLX L;  1RD9 D;  3BVM A;  1ASY A;  3HOV H;  4A93 G;  1L0X B;  1YHA A;  5M5W B;  3AFQ A;  1B44 D;  4DR7 Q;  1PFM A;  1B53 A;  1CM9 A;  2LXJ A;  3PIO A;  2JEB I;  1O7Y A;  1IBL Q;  4KN7 C;  4DR7 L;  3L9A X;  3VR4 A;  1AE3 A;  1VS0 A;  3OWF A;  4XQQ A;  3IKJ A;  4DU9 A;  3AU7 A;  3R93 A;  3O13 A;  2B3G A;  5IGD A;  5LMN Q;  5M5X H;  4XIG S;  1CT1 D;  1XPR A;  2JJQ A;  5FO8 B;  5LMN L;  3ULL A;  1MSH A;  1VQH A;  4EQP A;  2ZJR A;  3TBI B;  4QF4 A;  3U4Z A;  4DR4 L;  2SNM A;  4B9W A;  4C3I B;  2QDL A;  1HHV A;  3HG9 A;  5C44 B;  2ZJP A;  3PUW A;  3HOU B;  2CWP A;  3D0F A;  3P7J A;  4IUT A;  2QF7 A;  4DNT B;  1W2B A;  1LTT D;  3SE0 A;  4RHR A;  4C56 C;  1GHK A;  2F0W A;  2SNS A;  1FNW A;  1SNP A;  4L5Q A;  4NMZ A;  1QG7 A;  4A75 A;  1I4R A;  4FF3 A;  4KY7 A;  2O5J C;  2VW9 A;  1CSP A;  1XXG A;  2I07 B;  4DGZ A;  4PQX A;  3TP6 A;  2XWJ B;  2PI2 A;  1GUG A;  1YNJ D;  1O78 A;  1NE3 A;  2KHI A;  4BY7 H;  3BDL A;  1X56 A;  2WB1 B;  2KHS A;  2F0G A;  5JPM C;  1G51 A;  2B39 A;  1Y8N B;  3T1H Q;  1GJX A;  3CC4 A;  1I4G A;  3ERQ A;  3CXC A;  2SEB D;  1JC7 A;  1QOH A;  3T1H L;  4BXX H;  2KUM A;  3BZC A;  4R4O A;  3EN2 A;  1E2W A;  1SRU A;  2C9O A;  1AP0 A;  1I4Q A;  1BNZ A;  5C44 H;  2NVQ B;  3LX0 A;  5IOC A;  1XMQ Q;  1FL0 A;  1QZG A;  1SE8 A;  4FDB A;  4B9X A;  3HOU H;  2K5D A;  4LF4 Q;  5ELN A;  2IW3 A;  1XMQ L;  2EXD A;  5IGC A;  2RDG A;  4GZY C;  4LF4 L;  2A69 D;  4J1M A;  1RIP A;  4BWG B;  3N52 A;  1SSO A;  3PIP A;  1CI3 M;  1OXX K;  1Z9F A;  3CCR A;  3HOY G;  1E3P A;  2DY8 A;  2YYZ A;  3ULP A;  1BQQ T;  5CBA E;  2G9H D;  2WFW A;  3LGJ A;  2QCP X;  1UUP A;  2WKD A;  2OQ0 A;  2NN6 H;  3D3R A;  1AW7 A;  3DLL A;  2F0I A;  1PH2 A;  2RQX A;  4QCL A;  4BBS G;  4KKS A;  3HEJ A;  1I4X A;  2OTJ A;  1X65 A;  4AH6 A;  3NBH B;  1TS4 A;  2N49 A;  1NR2 A;  4JPB W;  3X3N A;  5K36 G;  3K57 A;  3KOJ A;  1EYA A;  3QO2 A;  3W5O A;  3HRZ C;  1SYG A;  2B2V C;  5LMU Q;  3CQZ H;  2NVY H;  1BOS A;  5C4H A;  2J4X A;  3ZYY X;  1GM5 A;  4JI3 Q;  4FO2 A;  4BA1 I;  4IJH A;  4KY6 A;  5ELF A;  4DN4 M;  2DNE A;  1I4P A;  1KRT A;  3A56 A;  2QA4 A;  2Z0S A;  4JI3 L;  3D6W A;  3MFY A;  2B2T A;  2E8G A;  5HUR A;  3CCV A;  1TWF H;  1LTG D;  2QEX A;  3T53 B;  2AHO B;  3KK7 A;  1NBW A;  1X3Q A;  4JI0 Q;  4HIM A;  4WJ4 A;  1OXV A;  2EY2 A;  1WD0 A;  3I4N B;  4B3M Q;  2HCI A;  2K5H A;  3RZO B;  1BO0 A;  1WCM B;  2F0N A;  1F2Z A;  1I94 Q;  2JA6 B;  2EVB A;  3P20 A;  1L0W A;  4B3M L;  4G7O C;  4CGY B;  4DXF A;  1F2Y A;  3M4O B;  2WV6 D;  1CA5 A;  4EX5 A;  3G6E A;  1I94 L;  4JBW A;  4FYD A;  2I46 A;  3MZ5 A;  4XYQ A;  1EY0 A;  1T5X D;  3EA6 A;  4LUO A;  3M7G A;  5IGE A;  1AEX A;  1VCI A;  3K81 C;  5CV8 A;  5EPJ A;  2D9U A;  3STB D;  4UHV A;  2Z6K A;  2JA5 B;  1EYC A;  3S17 B;  2B2Y C;  2NYZ D;  5CYU A;  1I50 B;  1B50 A;  3LNN A;  1ESF A;  3WDN A;  1XNQ Q;  4O2D A;  1DGS A;  1YNN C;  1LT4 D;  3I4N H;  3MXP A;  3I4M G;  1HUM A;  3E9H A;  1XNQ L;  2CHB D;  3RZO H;  3E0E A;  3H3V C;  2JA6 H;  1PXU A;  5H1S E;  1EFI D;  1EYG A;  1PTO F;  3M4O H;  2RDH A;  1BCP F;  1D1K A;  4DR1 Q;  5C0X I;  2PMZ B;  2JA9 A;  2F4I A;  4HSP A;  4LUZ A;  2I5M X;  4DR1 L;  3TEH B;  2VXW A;  2OF1 A;  2OWO A;  4BS9 A;  5IY0 A;  2PNH A;  2R3Z A;  2JA5 H;  4LF9 Q;  3PUY A;  4KD4 A;  3S17 H;  4OXP A;  1HA6 A;  3F2B A;  1Q1B A;  3I8Z A;  4LF9 L;  5J39 A;  3WWV A;  1XWE A;  2L4N A;  3S2D H;  3PUZ A;  1Q12 A;  1S40 A;  4K0K Q;  2K33 A;  3J81 L;  1EUJ A;  4K5W A;  3I90 A;  1EU3 A;  4K0K L;  1G8Z D;  1K28 A;  1SYE A;  5ELO A;  3V2T A;  1SYB A;  3J7A V;  1E24 A;  1EY8 A;  1R4P B;  4NDX A;  4A3E B;  1PYB A;  1JT8 A;  2N55 A;  2QW7 A;  2K28 A;  3BYY B;  5IE8 A;  4S3S A;  3M85 A;  1KQS A;  2Y0S E;  1HCZ A;  3HOY B;  2XSC A;  1FYC A;  3MXG A;  5GAH C;  3PF5 A;  4KJN A;  2C35 B;  2D0P A;  1EWI A;  1FVI A;  1DYQ A;  3GP7 A;  3GTO H;  1Z6H A;  1GUN A;  1SNM A;  3S1Q B;  2EYM A;  4CJ0 B;  3CME A;  3PV0 A;  4ZQ3 A;  2CFM A;  1ASZ A;  4ODG A;  2KEN A;  5LMN W;  2VB3 X;  3CP0 A;  2I5L X;  2OTL A;  1V1Q A;  3TS2 A;  1JQY D;  4LMQ D;  4XXE A;  1T5E A;  3ONA B;  1PFN A;  4A3E H;  2R7Z G;  2AQ3 B;  4LUV A;  5KNB A;  2XVS A;  3LWE A;  1PH9 A;  5EBC A;  4B3R Q;  3VA5 A;  4IFD G;  4ABN A;  3EIV A;  2ZXP A;  1NMF A;  2VZA A;  2Z4H A;  2MHV A;  4B3R L;  5E7N A;  3HOY H;  2NBF A;  1IKM A;  2QGQ A;  1A15 A;  3S1R H;  1M8A A;  4MIU A;  4TSS A;  5EPL A;  4K14 A;  3ND8 A;  5IT9 c;  1PDQ A;  3H6M A;  2RKS A;  3S1Q H;  4DK6 C;  3A74 A;  2DY7 A;  4J8Q A;  3PUX A;  1UE6 A;  2E2I B;  4KY5 A;  1C4Q A;  1I3Q B;  2XN9 C;  1PTO C;  4DV3 Q;  1KTK A;  1BCP C;  1RTO A;  4BBS H;  1AH9 A;  4BBR B;  1MKH A;  4DV3 L;  4JBK A;  2L12 A;  1H9S A;  1IYV A;  1O7L A;  4HTH A;  1SJE D;  5BN3 A;  5K36 H;  4BA2 I;  3NQT A;  1AFP A;  4A3J G;  1SMY D;  5IP7 H;  3X3M A;  2K50 A;  3DEO A;  4DR2 Q;  2HT1 A;  1CTM A;  4HN7 A;  4OEL B;  1LTL A;  1C0A A;  4DR2 L;  2JA7 B;  1V1P B;  1UEB A;  4OO1 G;  3J7Z C;  1BUV T;  1EY6 A;  1TQO A;  4ZLT F;  1PH3 A;  4KI0 A;  2NTS A;  3KBX A;  3P75 A;  2B2V A;  5T1I A;  1QVF A;  2E2I H;  1L0Y B;  1PFB A;  1I3Q H;  5C4X G;  2X6G A;  3I91 A;  1QJO A;  3DM1 A;  1STH A;  2BE5 C;  1HZA A;  4BBR H;  3A0J A;  1G29 1;  3DEP A;  1SDF A;  1O7Z A;  3OYY A;  1VF5 C;  3GTJ H;  5IYD G;  4LNQ A;  2Y0S G;  1W6J A;  1Q8I A;  5IGF A;  2TMP A;  1WTW A;  3FKI B;  2J0T D;  1CZG A;  2RCN A;  2WB1 E;  3ERO A;  2DUD A;  4IZ8 A;  3MEH A;  3MFG A;  1H95 A;  2JA7 H;  2JSO A;  3MVV A;  3J80 L;  4HJ9 A;  2UU9 Q;  2E2J H;  1MIU A;  2IPK D;  1RJT A;  5CV7 A;  1PH7 A;  2UU9 L;  2MJ8 A;  1XPU A;  1CZW A;  4UAI A;  2F0H A;  4EQN A;  4RKL A;  2JQO A;  2VQE L;  1Z7T A;  4NP5 A;  2B2Y A;  3I4M H;  5KEE A;  3TQY A;  2K5V A;  5I4D A;  3TN2 A;  5FLX E;  5I9O A;  3FMC A;  4K6L A;  5CBE E;  4ILW A;  2ENB A;  4OGQ C;  4PNY A;  1Y8P B;  4R4Q A;  2HHH L;  3R2I A;  3RNU A;  4YWK A;  1ROD A;  3RLN A;  3GTK B;  3K6O A;  1WTX A;  3KDF A;  1HZC A;  3J81 i;  1XYI A;  2MO1 A;  1UAP A;  1XJV A;  5FKA C;  3HS0 C;  1S5F D;  2F0F A;  5TSS A;  3D4W A;  4DA2 A;  4H0L C;  2ZJQ A;  5KNC A;  4C2M B;  1D8L A;  1BF4 A;  1GUS A;  2F1M A;  4A3B B;  1ML0 D;  2BDN A;  3S16 B;  2HQE A;  3BS1 A;  4QUF A;  1C8C A;  4IJL A;  3CAM A;  3OIQ A;  1PHJ A;  5HGQ A;  3TP5 A;  4JCV E;  4FF2 A;  2QEJ C;  2F0M A;  4DAP A;  1TII D;  3I56 A;  4U67 3;  2R93 B;  2EYH A;  1LAC A;  2R92 B;  1NTG A;  1U4R A;  4OO1 I;  4JI4 Q;  1IW7 D;  1BBX C;  4JVZ A;  5A35 A;  4A3L H;  4LF7 Q;  4JI4 L;  1JMC A;  4BXX G;  4C3I G;  1C9O A;  4F88 A;  4DK1 A;  1KLG D;  1X9N A;  5J3B A;  3T4A C;  2YTV A;  5JJZ A;  5C44 G;  3OIP A;  3HOU G;  4A3B H;  2BOS A;  1BXT A;  3FDT A;  4IUN A;  2D2C C;  2YTY A;  3S16 H;  4A76 A;  4PMW A;  2HDM A;  3G4S A;  3NTH A;  2LKV A;  2M00 A;  4GLV B;  2VQF Q;  5GRO A;  1QUQ B;  3FHW A;  1VQI A;  4A3G B;  2R93 H;  2RCF A;  2VQF L;  4GKK Q;  2RVL A;  2WB1 G;  3DWP A;  2R92 H;  1KAB A;  4IUU A;  3OW7 A;  1Q90 A;  2EJG C;  5HY6 A;  1WTP A;  4IFD H;  1OXT A;  1KNA A;  4GKK L;  3F8T A;  5IOD A;  4A3F B;  4OX9 Q;  2NN6 G;  1EL0 A;  5EJW A;  3K5L A;  2HIV A;  4NPS A;  3S1M B;  3OOC A;  1AE2 A;  1DOL A;  3V96 A;  4OX9 L;  3FPP A;  1Q46 A;  1RCV D;  1PZK D;  2KQ3 A;  1Q7Y C;  2FMM A;  1F9R A;  4R8I A;  2B29 A;  2GVA A;  1CA6 A;  1PVO A;  1CKN B;  5C4X B;  4JBM A;  2Q2I A;  1PMR A;  3HKZ E;  1B3A A;  1Y14 B;  1VQE A;  2PMZ E;  3RN5 A;  4IQZ A;  2WKC A;  3HGB A;  1UE7 A;  1D7Q A;  1K0R A;  3M7N A;  1PRT C;  1Y69 U;  2OCE A;  4A3G H;  5IWA Q;  2HCC A;  5KND A;  2F0S A;  1PYS B;  2PPB C;  5IGG A;  3BYT B;  5LL6 X;  5IWA L;  1A63 A;  1K8O A;  1OXS C;  3M4P A;  4R9W A;  1PTO D;  1BCP D;  2EYO A;  1E22 A;  3S1M H;  1B8A A;  2K1B A;  3D4D A;  4XQJ A;  3C1F A;  1ENA A;  3NEN A;  2OT2 A;  1B70 B;  4F8M A;  1UE5 A;  3K59 A;  5C4X H;  3J80 i;  2PQA B;  5C3E B;  4DV7 Q;  2O4X A;  1YEZ A;  5CC4 A;  1HFG A;  3I4L A;  4DUZ Q;  1EY7 A;  1VF7 A;  1YJ9 A;  3EFX D;  4DV7 L;  3CCL A;  4YHH Q;  4DUZ L;  1PFS A;  3ND9 A;  1S5E D;  5IYD H;  1TY0 A;  5JEA J;  3OHX C;  4YHH L;  2N8N A;  4UP8 A;  3A5Z B;  2KCN A;  4EQ5 A;  1DON A;  2MFI A;  4DV1 Q;  3QIA A;  3I4N G;  3TSS A;  1WCM G;  2CW0 C;  2NZO A;  4DV1 L;  2JA6 G;  2BE5 D;  1HTL D;  1LT6 D;  1J6Q A;  1VQ7 A;  4LF8 Q;  4IO9 A;  3GTM B;  3H0G B;  4A3D B;  1L1O A;  2CH4 W;  3K58 A;  4LF8 L;  3Q22 A;  1A3U A;  1YI2 A;  5C3E H;  4R1J A;  1D6E C;  5FJ8 H;  1VQP A;  2JA5 G;  4IPH A;  4JV5 Q;  1PRT B;  2K5N A;  2ZTD A;  1HFN A;  1EY4 A;  1S4Z A;  1NMG A;  4CKC A;  4JV5 L;  1DCZ A;  2F0P A;  3FPU B;  2KCC A;  3M3Y B;  1D5X C;  4DR4 Q;  3CCJ A;  2IX1 A;  4GS3 A;  1KNE A;  1GUT A;  1BR9 A;  1YBY A;  4P71 A;  5M5W H;  4B3T Q;  1HRJ A;  4L6T B;  2F0U A;  2MPM A;  4LAA A;  2A68 D;  2A74 C;  4DK3 C;  3GTM H;  4B3T L;  3H0G H;  3R2T A;  3HKZ G;  3VYU A;  1TXY A;  3SXH A;  3VR2 A;  1JOO A;  2QIL A;  3QWN A;  2Z9H A;  1E1T A;  1A62 A;  5KYI A;  4E6I A;  1T9H A;  3VA7 A;  1X54 A;  3RMH A;  3M9B A;  2BA1 A;  3NWS A;  1D2B A;  2K6A A;  4HSV A;  5KGU A;  2E75 C;  1BBU A;  3J81 E;  3BVZ A;  3K7U C;  2E2H B;  2AMC B;  4R4C A;  3I72 A;  3S9W A;  3H09 A;  4C3I H;  2XRQ D;  4RMF A;  4UP7 A;  3PSI A;  1TS5 A;  1SE3 A;  2A73 B;  4A3E G;  1HZB A;  1YIT A;  1IYJ B;  1D5Z C;  3UI2 A;  3MTS A;  1E1O A;  2O2L D;  2O5I C;  1VMP A;  4HED A;  2A6E C;  2MNA A;  4JI5 Q;  2UXC Q;  3JAM c;  3SK5 A;  2BA0 A;  4IOA A;  5CV6 A;  3BVG A;  1W3S A;  1VQ6 A;  4JI5 L;  2UXC L;  4GNX C;  2E2H H;  4DR3 Q;  1A3T A;  3SGI A;  1CKO A;  1IBK Q;  4DV6 Q;  2MQH A;  1EWH A;  4KJO A;  5D65 A;  4DR3 L;  1K83 B;  4LK1 C;  1IBK L;  4DV6 L;  3NSW A;  3CD6 A;  1MJC A;  1LTA D;  4KHV A;  2NVQ H;  1LTI D;  2IHF A;  4IUV A;  1PZJ D;  5FO9 B;  4IOC A;  1A2U A;  1YJN A;  2DJG C;  5M9O A;  5IP7 G;  1WTO A;  3TS0 A;  4HJA A;  1EWC A;  1GKH A;  3CU7 A;  4L5T A;  1RKN A;  3ERS X;  4O42 A;  1SFO B;  1GVP A;  2YU9 B;  3I70 A;  3HOX B;  2EYF A;  3SEB A;  1HH2 P;  4CBV A;  1U9R A;  1V43 A;  3OW2 A;  1K0S A;  3CMA A;  3ITP A;  3TP7 A;  1GO3 E;  1OTC A;  1X32 A;  2D5D A;  1K83 H;  1GUO A;  3KLS X;  4QUC A;  2Q8R E;  4BBR G;  3CRK C;  4XT1 B;  1M90 C;  4A3K B;  1H9M A;  2YTX A;  5I6Y A;  3AYH B;  2N3S A;  2NZ1 D;  3CPF A;  2VUM B;  1TWC B;  1M1K C;  2FXQ A;  5G3L F;  1KRS A;  1LT5 D;  1PH5 A;  2R7D A;  2VY3 A;  3TRZ A;  5CV9 A;  4O1N A;  1SFO H;  4CDE C;  2IY5 B;  1DJR D;  2JA7 G;  5BN5 A;  1SRO A;  2YU9 H;  3HOX H;  4PZ8 A;  4L5R C;  1STA A;  4GLA C;  3HFZ B;  2E74 C;  1PV4 A;  3IL8 A;  4B08 A;  4FNF A;  1YZ6 A;  2A6H C;  2JYO A;  2AUK A;  3SK8 A;  4GNX B;  2FHT A;  1F9Q A;  1VQG A;  4AYB B;  1VQ5 A;  3F1Z A;  2JEA I;  1EYD A;  3IFT A;  3S14 B;  2RBM A;  1WCM H;  3T16 A;  5JVG 3;  4X3U A;  1HA5 A;  4A3K H;  1PH6 A;  1STN A;  3HKZ B;  3P1H A;  3J80 E;  2F0O A;  1TWC H;  5C0X J;  2MP1 A;  5IT9 L;  3NQI A;  3FKI G;  2CVR A;  2EE1 A;  1ZYR C;  1B1Z A;  4DNR B;  1U0L A;  3GDE A;  3MXN B;  1I50 H;  2L11 A;  2LFN A;  2SOB A;  3BU2 A;  1F2M A;  3CRL C;  4XDX A;  4RCN A;  3H3V I;  1EZ6 A;  1OXU A;  2F0T A;  5JJK A;  1IHZ A;  4TKO B;  1N33 L;  4PMB A;  1CFM A;  3RD4 A;  1DOM A;  1XPO A;  3AB9 A;  3KF8 B;  4JI6 Q;  4DPG A;  5C4J B;  3KYH C;  2NB0 A;  1AN8 A;  2TSS A;  3GTL B;  1JE4 A;  4JI6 L;  2ID0 A;  3AFP A;  3C1E A;  1VQL A;  4OIJ A;  3H15 A;  1X3E A;  2ICI A;  4A3L G;  3NEM A;  5L37 A;  1CKM A;  3NBH A;  3E3X A;  1G91 A;  3GV3 A;  1A0I A;  1EY5 A;  5LL6 S;  4A3B G;  3DUZ A;  4WJW A;  2CQA A;  1B9M A;  4K8J A;  4X6A H;  1LT3 D;  3OMG A;  1HZ9 A;  1EZ8 A;  3D4R A;  1IL2 A;  4OEM B;  1B4O A;  2UUB Q;  3GTL H;  4C1N I;  3QOL A;  2NVX B;  2R93 G;  2L9H A;  4LFB Q;  4IUQ A;  2UUB L;  4RHS A;  5KIX A;  2R92 G;  2MGS A;  3J7A 5;  3HOZ B;  1NNX A;  1RDP D;  4LFB L;  4F87 A;  3AMU A;  3WOE A;  3G6J B;  1E2V A;  1TKW B;  5M3F B;  1K73 C;  3BDC A;  3S15 B;  2IJ0 A;  2K01 A;  5C6A A;  1MHW C;  5D3I B;  2JA8 B;  2HUG A;  2IHE A;  2V1C C;  2WAC A;  3SR1 A;  4KK7 A;  5CMD A;  1EOV A;  1LAB A;  2KED A;  5FK9 C;  4FVM A;  1ONL A;  2E76 C;  1IBM Q;  2WIN B;  1I4H A;  4JOI C;  1R4Q B;  5CR3 A;  4N9T A;  1IBM L;  3B6Y A;  4KMU C;  2DJF C;  4HMJ A;  3HZX A;  2RDF A;  4GLX A;  1K9M C;  4A3G G;  3NEL A;  4GNX A;  2I0Q A;  1IXR A;  1GD7 A;  1CQV A;  3KLS A;  3PO2 G;  2K32 A;  1CQF A;  5I2X A;  3AQQ A;  4A3F G;  2WII B;  1STB A;  1A6X A;  2SDF A;  2Z8L A;  5EPK A;  3S15 H;  1GOZ A;  4Q0F A;  1EQQ A;  3KF6 B;  2JA8 H;  3BZK A;  3PCO B;  5DM7 3;  4DAY B;  2A1A A;  1SMX A;  3RUZ A;  1Q86 C;  2A5H A;  2C5C A;  3NUC A;  2FFK B;  1B9N A;  1VQF A;  1EEF D;  5IIF A;  5I9P A;  1B7Y B;  4LW1 A;  3IFD A;  4QL5 A;  3PO2 H;  5I2Y A;  4RCO A;  4FXD A;  2UUA Q;  2ZM6 Q;  1K8M A;  1VQO A;  2UUA L;  4KV6 A;  2ZM6 L;  2VS1 A;  4P75 A;  1FNU A;  1I6H B;  1ICW A;  3PGZ A;  2VQE Q;  1SEB D;  4NB3 A;  3VYR A;  1TWA B;  4HCS A;  5C3E G;  4J6H A;  2K7V A;  1D5M C;  3NWT A;  4LF5 L;  5FJ8 G;  1SND A;  3QR8 A;  3KBG A;  2HHH Q;  1Q1E A;  1MI2 A;  4V0B A;  1YJW A;  2Q2U A;  4A3C H;  4IFD I;  2NUC A;  4JW0 A;  3A5U A;  2ZTE A;  1PRT F;  3TDQ A;  1JOK A;  1YNN D;  3FKI H;  3MEF A;  4ID6 A;  3E5S A;  1ESR A;  3NK9 A;  1FNV A;  1LTB D;  3RLO A;  3GTP B;  3L7Z C;  3OPO A;  3S1N B;  4TRD A;  2K52 A;  2Z6B A;  4RAU C;  1I6H H;  4ZUI A;  4R8N A;  5DNF A;  3H0G G;  1NJI C;  1RHP A;  4X3T A;  4A3D G;  2EJF C;  1EQR A;  1YHB A;  4UY8 C;  2K14 A;  3VYS A;  3MXU A;  2VNU D;  1JB3 A;  5FLM H;  3Q0A A;  4TVA B;  3ULJ A;  4K2L A;  4HIO A;  4YIJ A;  3GTG B;  3K7A B;  3VR5 A;  1VQ4 A;  4X64 Q;  4Y52 H;  1F9P A;  1X3G A;  3VR6 A;  1NCV A;  3CC2 A;  1S5C D;  3CCS A;  4X64 L;  5JOB A;  1YNJ C;  3GTK H;  4JI7 L;  2M9V A;  4C3H B;  3IRB A;  2AKW B;  1VQM A;  4B3S Q;  1A3V A;  2XNA C;  1BDO A;  4A3I B;  3S24 A;  3GTP H;  5ELE A;  4JI1 Q;  3VYT A;  3S1N H;  3T1Y Q;  4A3M B;  4C2M H;  4B3S L;  2J7Z A;  5HGT A;  1FR3 A;  3CHB D;  4FXK C;  4C3J B;  4JK1 C;  2F0K A;  5E4X A;  2K5W A;  4JI1 L;  3T1Y L;  1SN8 A;  1TT2 A;  3F2U A;  4MNO A;  2K03 A;  3FRP B;  5M5Y B;  1K8G A;  4POG A;  1V1P A;  2A69 C;  1NAP A;  3KUP A;  1QCB D;  1SLJ A;  2KEC A;  3K7A H;  3GTG H;  4NXM Q;  4N9P A;  1UEA B;  2PW5 A;  5C3X A;  3T13 A;  1ENF A;  2AWN A;  2R7F A;  4NXM L;  3S2H B;  1ZKO A;  3I73 A;  4C3H H;  2B2W C;  3K5M A;  3CCQ A;  1H9J A;  4DFA A;  2HIX A;  3PO2 B;  1Y1V B;  4K5V A;  1VQK A;  4A3I H;  1J9O A;  3PQI A;  1NUC A;  2VB2 X;  4I7Z C;  4AYB E;  1H9R A;  2B8G A;  1LO5 D;  4C3J H;  1ILP A;  5G3L D;  4RG1 A;  3V05 A;  4GKJ Q;  1FGU A;  1QVG A;  1XNR Q;  3D31 A;  5M5Y H;  1UE1 A;  4GKJ L;  3CCM A;  4FF1 A;  1XNR L;  4ME3 A;  4ZYS A;  1QWY A;  4KKU A;  4P2C B;  1HJP A;  4RA8 A;  3UDG A;  1SNO A;  1DM0 B;  1GUW A;  4CKB A;  3S2H H;  5ELD A;  4JOI A;  4RWS C;  3BDO A; 
#chains in the Genus database with same CATH homology
 1Z47 A;  2B2T C;  2ZXO A;  3HP3 A;  2H1E A;  2KVM A;  1QNU A;  3U9S A;  4CHT B;  1CK1 A;  5M3M B;  1WTR A;  1RTN A;  3QJY A;  2B2U C;  2R6G A;  3W3A A;  3A8K E;  4RKB A;  1F77 A;  3NXW A;  4RGM A;  2AQ1 B;  2JE6 I;  4L8J A;  1HQR D;  3MAQ A;  4DK0 A;  3HOV B;  2KOL A;  3NPP A;  4HMI A;  3PO3 B;  4G7H C;  1TS3 A;  1SJH D;  4RGN A;  2L0C A;  4MHE A;  1Y1W B;  1IL8 A;  1EOT A;  3R3O A;  3D8G A;  5K5P A;  3Q23 A;  1TU2 B;  3JAM L;  1DXM A;  2IX3 A;  1V1O A;  1XTC D;  5M5X B;  1CHP D;  3HOW B;  5ELC A;  1EY9 A;  3WOF A;  1TVX A;  1LLR D;  5EKK A;  4RGT A;  4ZRZ A;  2KEE A;  4DF7 A;  1HTP A;  4QIW B;  2NN6 I;  2D62 A;  2PO4 A;  3J7Y W;  1KLU D;  1W6K A;  5A2Q L;  4KKT A;  4HCE A;  3PIO 3;  2PW7 A;  2EXZ A;  5IT9 E;  2FMC A;  3FEW X;  4K5X A;  2WP8 J;  2F0V A;  4BY7 B;  1SAP A;  3K0Y A;  5EBD A;  4XT3 B;  1DD2 A;  2F0E A;  1IKL A;  5T1G A;  4KTA A;  1IYU A;  2AUJ D;  4X3S A;  3NE5 B;  5C4Z A;  5JVH 3;  4OL7 A;  3TME A;  2PYK A;  2EY6 A;  5COY A;  3DWQ A;  1H9K A;  4IUP A;  3L3O C;  2JXM B;  2ZT9 C;  1MD2 D;  2X69 A;  4RGO S;  5JEA H;  3PUV A;  1J8I A;  1F9S A;  3D6C A;  3GO5 A;  4Y7N B;  3A54 A;  4BY1 B;  2RA4 A;  3C2P A;  4U68 A;  2EYL A;  1EQT A;  1CHQ D;  2EY1 A;  5DEH A;  1B2T A;  3MC0 B;  1D1I A;  3K5O A;  3CQZ B;  2NVY B;  5C0X G;  3H94 A;  2PNR C;  2BDO A;  1Y8O B;  2B2W A;  1QB5 D;  1FGB D;  5C5L A;  1TWF B;  1EQV A;  3H91 A;  5LHY 1;  3PIP 3;  1SMY C;  1A2T A;  5DAU A;  1EIH A;  2LY7 A;  2FJ2 A;  4HAE A;  4XTC S;  2EOT A;  3T51 B;  1U4P A;  2WAQ B;  3DXJ C;  2PZW A;  5C5M A;  5D14 A;  3GTQ B;  1Q3L A;  1JCK B;  5CV4 A;  2GA4 B;  5D3D A;  1PRT D;  1TWG B;  3C3L A;  5JAV A;  1QIL A;  1SE4 A;  2F3V A;  1SYF A;  2ZXR A;  4M8A A;  4G7Z C;  2IX0 A;  4A93 B;  2B2U A;  4G4K A;  1E0B A;  1S5D D;  2ICE C;  2B63 B;  4H7B A;  5BN4 A;  1ZXT A;  1QNK A;  4PV1 C;  1UNS A;  4CKE A;  2B8F A;  2KJX A;  4ZUJ A;  4TQU S;  4Q5V A;  2LMC B;  2NWG A;  2K5Q A;  5FOB B;  5FO7 B;  3QG1 A;  3S2D B;  1H9S B;  3Q6S A;  1KDC A;  1G6Z A;  3E0J A;  4XQN A;  2CW0 D;  2L5T A;  3URY A;  1EEI D;  1ET6 A;  4IAL A;  2EYJ A;  5E1F A;  3R8B A;  2IL8 A;  3A55 A;  2BCO A;  3KLR A;  2HDL A;  2N88 A;  5EKI A;  1FD7 D;  3G7L A;  5KRU A;  1AZP A;  3W2D A;  2EYP A;  2MUY A;  1WD1 A;  1JWS D;  2Z1C A;  2EPB A;  5CV5 A;  3GTO B;  1ET9 A;  4ZKC B;  4X3K A;  1SE2 A;  1IW7 C;  5E4W C;  1TS2 A;  4WFN 3;  1HXY D;  3TZD A;  3RLF A;  4KHZ A;  1LTR D;  3BZD B;  1TWH B;  4PMC A;  3GQB A;  1I6V C;  1AZQ A;  4DAV A;  5ELB A;  5DM6 3;  3S1R B;  4IUR A;  2AQ2 B;  4OIK A;  4EGV A;  2OEO A;  1VMC A;  3DWA A;  4EVO A;  4C3H G;  3QOJ A;  3NBI A;  4NW2 A;  4BBS B;  1ENC A;  2EY5 A;  4C3J G;  1NR4 A;  3DMU A;  1QE6 A;  3NTK A;  2F3W A;  2EDG A;  1U4L A;  2M2L A;  2OXP A;  4WRD A;  5C0X H;  4XYO A;  3A7L A;  1SXT A;  2A6E D;  1SYC A;  3Q24 A;  5CGK A;  4Z9C B;  4MN3 A;  2F0D A;  4OHJ A;  1JOR A;  3U9O A;  2IWH A;  4KD3 A;  1MGS A;  3NHH A;  3BG3 A;  1STG A;  1II3 A;  5F2D A;  1TR5 A;  1STE A;  1LTS D;  1DZ1 A;  1SBB B;  1E2Z A;  2NVT B;  1M4V A;  3GTJ B;  4FXG C;  3MXN A;  1O80 A;  4ZK9 B;  3C46 A;  2E2J B;  4UDU C;  4K6D A;  1KDB A;  1EU4 A;  2RSN A;  1V8Q A;  1WTV A;  4G57 A;  3KF8 A;  3PMF A;  2L1B A;  3A8I E;  3I4M B;  1JOQ A;  4F7X A;  3E6Z X;  1PZI D;  2DNC A;  5J1Z A;  1OO9 B;  1MBY A;  1NSN S;  1G2T A;  3SK6 A;  3MWY W;  5EKL A;  1SNQ A;  3N6R A;  4QMG A;  2DN8 A;  3RZD B;  2F0J A;  1C48 A;  3VR3 A;  4WOR A;  3GV6 A;  1HUN A;  3CKI B;  4IFD J;  2A6H D;  2QKI C;  4M1U B;  1JR0 D;  2Q8T A;  3EJI A;  3JAM E;  3GD7 A;  1PTO B;  1GHJ A;  1BCP B;  1S5B D;  3EVQ A;  3SHL A;  3NP8 A;  2A68 C;  2IT1 A;  2PCF B;  2G9D A;  4IN3 A;  2QDB A;  3TP8 A;  2K04 A;  3MA2 B;  1TY2 A;  3NTI A;  1SNC A;  1ZYR D;  5C3W A;  1EIG A;  2L55 A;  4ZAI A;  1R9T B;  5A2Q E;  5E3F A;  2XWB B;  2PQE A;  1JWU D;  3FVQ A;  3I3C A;  1PTO H;  2H4O A;  2XIW A;  4K8I A;  2R61 A;  4K2K A;  3MHB A;  2NTT A;  2F03 A;  2V4D A;  4ULL A;  3T56 B;  2PZU A;  3SDZ A;  2R7Z B;  1HPC A;  4CJ2 C;  5JEA G;  4QB4 A;  5COR A;  4DAY A;  3A7A B;  3J7A F;  2F0Q A;  3DHQ A;  1X3P A;  5KYL A;  4FF4 A;  1LV9 A;  3A8J E;  1JWM D;  3SK4 A;  1KDA A;  2PZT A;  1MSG A;  1VDZ A;  4A3J B;  5EQ0 A;  5ISR A;  3EQL C;  2E2D C;  2FIN B;  1U4M A;  2F0L A;  4ME5 A;  1XX8 A;  4DXG A;  1SYD A;  5EGT A;  5AFW A;  3K5N A;  2AWO A;  2Q8I B;  2LS0 1;  4C1N K;  1PYW D;  1STY A;  3M4Y A;  5J22 A;  4CJ1 B;  1F2L A;  1G2S A;  1DOK A;  3IAY A;  1ZEQ X;  5NUC A;  4HR7 B;  2Y0S B;  1WTQ A;  1KAA A;  2RSO A;  4L63 B;  4OO1 H;  4RFB A;  2EZV A;  4I65 A;  2KA7 A;  1HQM C;  4H44 C;  4RH6 A;  1GXD C;  2EJM A;  1RF2 D;  4FP5 D;  1PLF A;  5JPN C;  3OSO A;  3SVM A;  4H13 C;  5I6W A;  4V19 0;  4NKL A;  2K05 A;  3TZU A;  2XRS D;  4KN4 C;  3LWU A;  4EQO A;  3OMC A;  2JP1 A;  2X6L A;  3QB3 A;  4LJZ C;  5IGB A;  2Z4I A;  4ZKB B;  3OWE B;  1JIC A;  1WVL A;  1ILQ A;  5FLX L;  1RD9 D;  3BVM A;  1L0X B;  5M5W B;  1B44 D;  1PFM A;  1B53 A;  1CM9 A;  2JEB I;  1O7Y A;  4KN7 C;  3L9A X;  3VR4 A;  3OWF A;  4XQQ A;  3IKJ A;  4DU9 A;  3AU7 A;  3R93 A;  3O13 A;  5IGD A;  4XIG S;  1CT1 D;  5FO8 B;  1MSH A;  4EQP A;  3TBI B;  4QF4 A;  2SNM A;  4B9W A;  4C3I B;  1HHV A;  3HG9 A;  5C44 B;  3PUW A;  3HOU B;  3P7J A;  4IUT A;  2QF7 A;  4DNT B;  1LTT D;  3SE0 A;  4RHR A;  4C56 C;  1GHK A;  2F0W A;  2SNS A;  1SNP A;  1FNW A;  4NMZ A;  1QG7 A;  1I4R A;  4FF3 A;  4KY7 A;  2O5J C;  1XXG A;  2I07 B;  4DGZ A;  4PQX A;  3TP6 A;  2XWJ B;  1GUG A;  1YNJ D;  1O78 A;  3BDL A;  2WB1 B;  2KHS A;  2F0G A;  5JPM C;  2B39 A;  1Y8N B;  1GJX A;  1I4G A;  3ERQ A;  2SEB D;  1JC7 A;  1QOH A;  2KUM A;  1E2W A;  2C9O A;  1AP0 A;  1I4Q A;  1BNZ A;  2NVQ B;  3LX0 A;  5IOC A;  4B9X A;  2K5D A;  2IW3 A;  5IGC A;  2RDG A;  4GZY C;  2A69 D;  4J1M A;  4BWG B;  3N52 A;  1SSO A;  1CI3 M;  1OXX K;  2DY8 A;  2YYZ A;  1BQQ T;  5CBA E;  2G9H D;  2QCP X;  1UUP A;  2WKD A;  2NN6 H;  3D3R A;  1AW7 A;  2F0I A;  2RQX A;  4QCL A;  4KKS A;  3HEJ A;  1I4X A;  1TS4 A;  1NR2 A;  3X3N A;  5K36 G;  3K57 A;  1EYA A;  3QO2 A;  3HRZ C;  1SYG A;  2B2V C;  1BOS A;  5C4H A;  2J4X A;  3ZYY X;  4FO2 A;  4BA1 I;  4KY6 A;  5ELF A;  4DN4 M;  2DNE A;  1I4P A;  3A56 A;  3D6W A;  3MFY A;  2B2T A;  5HUR A;  1LTG D;  3T53 B;  3KK7 A;  1X3Q A;  1OXV A;  2EY2 A;  1WD0 A;  3I4N B;  2HCI A;  3RZO B;  1BO0 A;  1WCM B;  2F0N A;  1F2Z A;  2JA6 B;  2EVB A;  3P20 A;  4G7O C;  4CGY B;  4DXF A;  1F2Y A;  3M4O B;  2WV6 D;  1CA5 A;  4JBW A;  4FYD A;  2I46 A;  3MZ5 A;  4XYQ A;  1EY0 A;  1T5X D;  3EA6 A;  5IGE A;  3M7G A;  1AEX A;  1VCI A;  5CV8 A;  5EPJ A;  2D9U A;  2JA5 B;  1EYC A;  3S17 B;  2B2Y C;  2NYZ D;  5CYU A;  1I50 B;  1B50 A;  3LNN A;  1ESF A;  3WDN A;  1YNN C;  1LT4 D;  3MXP A;  1HUM A;  2CHB D;  3H3V C;  1PXU A;  1EFI D;  1PTO F;  2RDH A;  1BCP F;  1D1K A;  5C0X I;  2PMZ B;  2F4I A;  4HSP A;  2VXW A;  2OF1 A;  4BS9 A;  2R3Z A;  3PUY A;  4KD4 A;  1HA6 A;  1Q1B A;  3I8Z A;  5J39 A;  1XWE A;  2L4N A;  3PUZ A;  1Q12 A;  2K33 A;  3J81 L;  4K5W A;  3I90 A;  1EU3 A;  1G8Z D;  1SYE A;  3V2T A;  1SYB A;  3J7A V;  1EY8 A;  1R4P B;  4NDX A;  4A3E B;  2N55 A;  2K28 A;  3BYY B;  4S3S A;  3M85 A;  1HCZ A;  3HOY B;  2XSC A;  1FYC A;  3MXG A;  4KJN A;  1DYQ A;  3GP7 A;  1Z6H A;  1GUN A;  1SNM A;  3S1Q B;  2EYM A;  4CJ0 B;  3PV0 A;  4ZQ3 A;  4ODG A;  2VB3 X;  1JQY D;  4LMQ D;  4XXE A;  1T5E A;  3ONA B;  1PFN A;  2AQ3 B;  5KNB A;  2XVS A;  3LWE A;  5EBC A;  3VA5 A;  4IFD G;  4ABN A;  2ZXP A;  2Z4H A;  2MHV A;  2NBF A;  1IKM A;  1A15 A;  1M8A A;  4MIU A;  4TSS A;  5EPL A;  4K14 A;  3ND8 A;  1PDQ A;  3H6M A;  2RKS A;  2DY7 A;  4J8Q A;  3PUX A;  2E2I B;  4KY5 A;  1C4Q A;  1I3Q B;  2XN9 C;  1PTO C;  1KTK A;  1BCP C;  1RTO A;  4BBR B;  2L12 A;  1H9S A;  1IYV A;  1O7L A;  4HTH A;  1SJE D;  5BN3 A;  5K36 H;  4BA2 I;  3NQT A;  1AFP A;  1SMY D;  3X3M A;  3DEO A;  1CTM A;  4HN7 A;  2JA7 B;  1V1P B;  4OO1 G;  1BUV T;  1EY6 A;  1TQO A;  4ZLT F;  4KI0 A;  2NTS A;  3KBX A;  3P75 A;  2B2V A;  5T1I A;  1L0Y B;  1PFB A;  2X6G A;  3I91 A;  1QJO A;  3DM1 A;  1STH A;  2BE5 C;  1G29 1;  3DEP A;  1SDF A;  1O7Z A;  1VF5 C;  1W6J A;  5IGF A;  1Q8I A;  2TMP A;  1WTW A;  3FKI B;  2J0T D;  1CZG A;  3ERO A;  4IZ8 A;  3MEH A;  3MFG A;  2JSO A;  3MVV A;  3J80 L;  2IPK D;  1RJT A;  5CV7 A;  2MJ8 A;  1CZW A;  4UAI A;  2F0H A;  4EQN A;  4RKL A;  1Z7T A;  4NP5 A;  2B2Y A;  5KEE A;  5I4D A;  3TN2 A;  5FLX E;  5I9O A;  3FMC A;  4K6L A;  5CBE E;  4ILW A;  2ENB A;  4OGQ C;  4PNY A;  1Y8P B;  3R2I A;  1ROD A;  3GTK B;  3K6O A;  1WTX A;  1XYI A;  1UAP A;  5FKA C;  3HS0 C;  1S5F D;  2F0F A;  5TSS A;  3D4W A;  4DA2 A;  4H0L C;  5KNC A;  4C2M B;  1BF4 A;  1GUS A;  2F1M A;  4A3B B;  1ML0 D;  2BDN A;  3S16 B;  2HQE A;  3BS1 A;  4QUF A;  1C8C A;  3OIQ A;  3TP5 A;  4FF2 A;  2QEJ C;  2F0M A;  4DAP A;  1TII D;  4U67 3;  2R93 B;  2EYH A;  1LAC A;  2R92 B;  1U4R A;  4OO1 I;  1IW7 D;  1BBX C;  5A35 A;  4C3I G;  4F88 A;  4DK1 A;  1KLG D;  3T4A C;  5JJZ A;  3OIP A;  2BOS A;  1BXT A;  3FDT A;  4IUN A;  2D2C C;  4PMW A;  2HDM A;  3NTH A;  2LKV A;  2M00 A;  4A3G B;  2RVL A;  3DWP A;  4IUU A;  1KAB A;  3OW7 A;  1Q90 A;  2EJG C;  1WTP A;  4IFD H;  1OXT A;  1KNA A;  5IOD A;  4A3F B;  2NN6 G;  1EL0 A;  5EJW A;  3K5L A;  3S1M B;  3OOC A;  1DOL A;  3V96 A;  3FPP A;  1RCV D;  1PZK D;  2KQ3 A;  2FMM A;  1F9R A;  4R8I A;  1CA6 A;  5C4X B;  1PMR A;  1B3A A;  4IQZ A;  2WKC A;  3HGB A;  3M7N A;  1PRT C;  1Y69 U;  2HCC A;  5KND A;  2F0S A;  2PPB C;  5IGG A;  3BYT B;  5LL6 X;  1K8O A;  1OXS C;  4R9W A;  1PTO D;  1BCP D;  2EYO A;  2K1B A;  3D4D A;  4XQJ A;  3C1F A;  1ENA A;  2OT2 A;  4F8M A;  3K59 A;  5C3E B;  2O4X A;  5CC4 A;  1HFG A;  3I4L A;  1EY7 A;  1VF7 A;  3EFX D;  3ND9 A;  1S5E D;  1TY0 A;  5JEA J;  3OHX C;  2KCN A;  1DON A;  3QIA A;  3TSS A;  2CW0 C;  2BE5 D;  1HTL D;  1LT6 D;  3GTM B;  3H0G B;  4A3D B;  3K58 A;  3Q22 A;  1A3U A;  1D6E C;  1PRT B;  1HFN A;  1EY4 A;  1S4Z A;  4CKC A;  1DCZ A;  2F0P A;  3FPU B;  2KCC A;  3M3Y B;  1D5X C;  2IX1 A;  1KNE A;  1GUT A;  1BR9 A;  1HRJ A;  4L6T B;  2F0U A;  2MPM A;  4LAA A;  2A68 D;  2A74 C;  3R2T A;  3VYU A;  3SXH A;  3VR2 A;  1JOO A;  2QIL A;  3QWN A;  5KYI A;  3VA7 A;  4E6I A;  3RMH A;  2BA1 A;  3NWS A;  1D2B A;  2K6A A;  4HSV A;  5KGU A;  2E75 C;  3J81 E;  3BVZ A;  2E2H B;  3I72 A;  3S9W A;  3H09 A;  2XRQ D;  1TS5 A;  1SE3 A;  2A73 B;  1D5Z C;  3UI2 A;  3MTS A;  2O2L D;  2O5I C;  1VMP A;  4HED A;  2A6E C;  3SK5 A;  2BA0 A;  5CV6 A;  3BVG A;  1A3T A;  1EWH A;  4KJO A;  5D65 A;  1K83 B;  4LK1 C;  3NSW A;  1LTA D;  4KHV A;  1LTI D;  4IUV A;  1PZJ D;  5FO9 B;  1A2U A;  5M9O A;  1WTO A;  1EWC A;  3CU7 A;  1RKN A;  4O42 A;  1SFO B;  2YU9 B;  3I70 A;  3HOX B;  2EYF A;  3SEB A;  4CBV A;  1U9R A;  1V43 A;  3ITP A;  3TP7 A;  1X32 A;  2D5D A;  1GUO A;  3KLS X;  4QUC A;  2Q8R E;  3CRK C;  4XT1 B;  4A3K B;  1H9M A;  5I6Y A;  2NZ1 D;  2VUM B;  1TWC B;  5G3L F;  1LT5 D;  5CV9 A;  4O1N A;  1DJR D;  5BN5 A;  1STA A;  2E74 C;  3IL8 A;  4B08 A;  4FNF A;  2A6H C;  2JYO A;  2AUK A;  3SK8 A;  2FHT A;  1F9Q A;  4AYB B;  2JEA I;  1EYD A;  3IFT A;  3S14 B;  2RBM A;  3T16 A;  5JVG 3;  4X3U A;  1HA5 A;  1STN A;  3HKZ B;  3P1H A;  3J80 E;  2F0O A;  5C0X J;  2MP1 A;  5IT9 L;  3NQI A;  2CVR A;  2EE1 A;  1ZYR C;  1B1Z A;  4DNR B;  2L11 A;  2LFN A;  2SOB A;  1F2M A;  3CRL C;  4XDX A;  4RCN A;  1EZ6 A;  1OXU A;  2F0T A;  1IHZ A;  4TKO B;  4PMB A;  1CFM A;  3RD4 A;  1DOM A;  3AB9 A;  5C4J B;  2NB0 A;  1AN8 A;  2TSS A;  3GTL B;  1JE4 A;  2ID0 A;  3C1E A;  4OIJ A;  2ICI A;  3NBH A;  1G91 A;  3GV3 A;  1EY5 A;  5LL6 S;  3DUZ A;  4WJW A;  2CQA A;  1B9M A;  4K8J A;  1LT3 D;  3OMG A;  1EZ8 A;  3D4R A;  1B4O A;  4C1N I;  3QOL A;  2NVX B;  2L9H A;  4IUQ A;  4RHS A;  5KIX A;  2MGS A;  3HOZ B;  1RDP D;  4F87 A;  3AMU A;  3WOE A;  3G6J B;  1E2V A;  1TKW B;  5M3F B;  3BDC A;  3S15 B;  2IJ0 A;  2K01 A;  5C6A A;  5D3I B;  2JA8 B;  2HUG A;  2WAC A;  3SR1 A;  4KK7 A;  5CMD A;  1LAB A;  2KED A;  5FK9 C;  4FVM A;  1ONL A;  2E76 C;  2WIN B;  1I4H A;  1R4Q B;  5CR3 A;  4N9T A;  4KMU C;  4HMJ A;  3HZX A;  2RDF A;  1CQV A;  3KLS A;  2K32 A;  1CQF A;  5I2X A;  2WII B;  1STB A;  1A6X A;  2SDF A;  2Z8L A;  5EPK A;  1GOZ A;  4Q0F A;  5DM7 3;  3RUZ A;  2A5H A;  2C5C A;  3NUC A;  2FFK B;  1B9N A;  1EEF D;  5IIF A;  5I9P A;  3IFD A;  5I2Y A;  4RCO A;  4FXD A;  1K8M A;  4KV6 A;  1FNU A;  1I6H B;  1ICW A;  1SEB D;  3VYR A;  1TWA B;  4HCS A;  4J6H A;  2K7V A;  1D5M C;  3NWT A;  1SND A;  3KBG A;  1Q1E A;  1MI2 A;  4V0B A;  4IFD I;  2NUC A;  1PRT F;  3TDQ A;  1JOK A;  1YNN D;  4ID6 A;  3E5S A;  1ESR A;  1FNV A;  3NK9 A;  1LTB D;  3GTP B;  3L7Z C;  3OPO A;  3S1N B;  4TRD A;  4RAU C;  4ZUI A;  4R8N A;  5DNF A;  1RHP A;  4X3T A;  2EJF C;  3VYS A;  3MXU A;  2VNU D;  1JB3 A;  3Q0A A;  4K2L A;  3GTG B;  4YIJ A;  3K7A B;  3VR5 A;  1F9P A;  3VR6 A;  1NCV A;  1S5C D;  5JOB A;  1YNJ C;  2M9V A;  4C3H B;  1A3V A;  2XNA C;  1BDO A;  4A3I B;  5ELE A;  3VYT A;  4A3M B;  2J7Z A;  5HGT A;  4C3J B;  1FR3 A;  3CHB D;  4FXK C;  4JK1 C;  2F0K A;  5E4X A;  2K5W A;  1TT2 A;  3F2U A;  2K03 A;  3FRP B;  5M5Y B;  1V1P A;  2A69 C;  1NAP A;  3KUP A;  1QCB D;  2KEC A;  4N9P A;  1UEA B;  2PW5 A;  5C3X A;  3T13 A;  1ENF A;  2AWN A;  3S2H B;  1ZKO A;  3I73 A;  2B2W C;  3K5M A;  1H9J A;  4DFA A;  3PO2 B;  1Y1V B;  4K5V A;  1J9O A;  1NUC A;  2VB2 X;  4I7Z C;  1H9R A;  2B8G A;  1LO5 D;  1ILP A;  5G3L D;  3V05 A;  3D31 A;  4FF1 A;  4ZYS A;  1QWY A;  4KKU A;  4P2C B;  4RA8 A;  1SNO A;  1DM0 B;  1GUW A;  4CKB A;  5ELD A;  4RWS C;  3BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...