3ITPA

Crystal structure of staphylococcal nuclease variant delta+phs f34k at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTKRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS F34K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3itpA00
2EYPA 3D4DA 3TMEA 5CC4A 2F0HA 2F0OA 2SOBA 4IZ8A 3EVQA 4RKLA 1STHA 3EJIA 5I6YA 1AEXA 2EYJA 2PQEA 1EY4A 1SYFA 2EYHA 3SXHA 1EQVA 3TP7A 1A3VA 5C3WA 5C6AA 5E3FA 5IGCA 1STAA 3D6CA 1TT2A 1U9RA 4RKBA 5HGTA 3NXWA 2SNMA 4QF4A 5K5PA 3PMFA 4J6HA 4KD3A 3S9WA 1A3TA 5J1ZA 3OMCA 2EY1A 1KAAA 2KQ3A 1SYCA 2F0IA 3ERQA 3C1EA 4HMJA 1EY0A 1SYEA 2F0SA 3C1FA 3MXPA 4KV6A 1TQOA 4N9PA 5KRUA 1SYDA 4EQNA 3OWFA 4K8JA 3SR1A 5IGGA 2EY2A 3TP6A 2F0QA 3BDCA 3D8GA 3HEJA 4EQOA 2F0DA 2F3WA 2OEOA 1EY9A 4IUNA 2F0MA 2EY6A 1STGA 2OF1A 3MVVA 3NQTA 3P1HA 4PMBA 2PZWA 2EYOA 4DGZA 1SYGA 5C4ZA 1SNCA 2PYKA 4WORA 2F0PA 3D4WA 5CV4A 5CV5A 1F2MA 4ZQ3A 5J22A 1KDAA 2F0UA 4TRDA 4KY5A 4PMCA 5NUCA 1SNMA 1JOQA 5IGEA 5CV7A 1STYA 4K2LA 5IGDA 5JAVA 2F0JA 2M00A 2OXPA 1EZ6A 1SNQA 2WACA 4KJOA 1STBA 3MEHA 5JOBA 1KDCA 2F0LA 3ITPA 3NP8A 5DAUA 4DFAA 1NUCA 4B9WA 3HZXA 1IHZA 2SNSA 3NUCA 5F2DA 4KY7A 4F8MA 4ODGA 3U9OA 5KYIA 3QOLA 3SK6A 4G57A 2RDFA 1EY8A 1EZ8A 4K5XA 1ENCA 3V2TA 4S3SA 2LKVA 4B9XA 1SNOA 4KY6A 2F0KA 3OMGA 3T16A 5KIXA 4HMIA 1JORA 1JOKA 2EYMA 3MZ5A 1A3UA 2F0WA 3T13A 4DF7A 5IODA 2ENBA 5KGUA 3P75A 4K5WA 3TP8A 3SK4A 4HTHA 4ID6A 5EKLA 5IOCA 4K6DA 5E1FA 3QB3A 2EXZA 4PNYA 4DU9A 1F2ZA 5C3XA 3TP5A 5CGKA 5EKKA 2O4XA 5C5MA 5C5LA 4E6IA 4NDXA 5EGTA 2NUCA 4F7XA 4KTAA 2F0TA 2PZUA 1EYCA 1RKNA 3E5SA 4KJNA 4N9TA 4K2KA 1EY7A 1NSNS 4LAAA 3H6MA 3RUZA 4ZUIA 2EYLA 5I6WA 4J1MA 4YIJA 4OL7A 1SNPA 5IGBA 2F0FA 4K14A 1EY6A 5CV6A 3MHBA 4EQPA 5HURA 2PZTA 3NHHA 3SK8A 5IIFA 4R8NA 3VA5A 1STNA 5M9OA 1F2YA 1JOOA 1KDBA 3NK9A 4ME5A 2F0GA 4I65A 2KHSA 4QMGA 1KABA 5ISRA 4K5VA 5C4HA 1SNDA 3EROA 1A2TA 3R3OA 4MIUA 5KEEA 4WRDA 1TR5A 2PW5A 4KD4A 3DMUA 3BDLA 4EVOA 1EY5A 1EYDA 2F0NA 2HQEA 2RKSA 4H7BA 2RBMA 1A2UA 1II3A 4NMZA 2EYFA 2F0VA 4NKLA 2PW7A 3LX0A 3OSOA 3QOJA 4NP5A 4IALA 1EYAA 4ZUJA 2EY5A 5I9PA 5DEHA 4K8IA 1SYBA 2F0EA 5IGFA 5J39A 3SHLA 2QDBA 3DHQA 4KHVA 1ENAA 3SK5A 4QB4A 5CR3A 5I9OA 5CV9A 5CV8A 2F3VA 5KYLA
chains in the Genus database with same CATH superfamily
2EYPA 3NBHB 2BA0A 3CRLC 4RKLA 2LS01 5EAYA 2CW0D 2NVTH 3HGBA 2E76C 1CHQD 1SMYC 1FGUA 1FNVA 3QG1A 2MGSA 1N34Q 1U9RA 4OO1I 5M3MH 1XMOQ 3K8AA 4J6HA 2XVSA 1SYEA 1PVOA 1HNWL 2Z9HA 5IP9H 4DXFA 3CCMA 2QW7A 2RA4A 3U4VA 1UAPA 3L9AX 2PYKA 3UDFA 1V43A 2ZT9C 3D4WA 1DM0B 3IKJA 4OO1G 2NVQB 1AE3A 1CT1D 1YHQA 2UXDL 4Y7NH 1SNQA 5ISRA 4A3EB 3T1HQ 3JAMc 2VY3A 3Q23A 3V05A 2Y0SG 4DR1Q 1PYSB 1LO5D 2D2CC 5BN5A 3J7A5 1FYCA 1X55A 3F2CA 1CHPD 2O2LD 4JCVE 1G291 4A93H 2A69C 2CFMA 5A2QE 3PUZA 1U4MA 1XMQQ 4RG1A 1EWHA 4KI0A 3J7AV 5TSSA 4OWWB 4QGUA 1LT3D 5EKKA 5C5MA 5K36G 4LFBQ 1QB5D 4QCLA 2KUMA 3M4OH 1JQYD 1TS3A 3CW2C 1VMCA 4ZUIA 3AMUA 3AFQA 4J1MA 4GOPC 4R9WA 3MTSA 1KQSA 2HDMA 4O42A 3MHBA 4ULLA 5FO7B 1SXTA 4RWSC 1F2YA 4JI2L 2UUBL 4MZ9A 2GVBA 5IYDH 4A3MG 1VQCA 4C3HG 4M8AA 1CQVA 3HOXH 4EQOA 4DNIA 1C48A 3HG9A 3LX0A 4CDEC 4CKEA 4K8IA 1ET9A 3BVGA 3W1BA 4RGNA 4GLXA 1HZCA 2WIIB 2JEBI 1HQMC 3Q22A 1HNXL 1JB3A 4RGOS 4QIWE 1UNSA 1WCMH 1I6HB 4X64L 3C3LA 2KECA 3HOUG 1K8OA 5I6YA 1C8CA 4ME3A 1CKNB 1X6OA 2EXDA 1MJCA 1B50A 2FJ2A 2KCCA 1ML0D 1YJ9A 4LWCA 2RCNA 1XNRL 1XPRA 4RHSA 4CHTB 1TS2A 3D8GA 1D8LA 2I5HA 3BJUA 3KLSX 4JI3Q 4DV4L 1VQEA 4UHVA 3A0JA 1EOTA 4GN3B 1NMFA 4OONA 3T53B 5L37A 3CMEA 3PF5A 1PH7A 3S1MB 5C0XJ 3MFYA 2I07B 3X3MA 5M3FH 1STYA 2E5LQ 4DN4M 4BY1G 3MA2B 4HIKA 3PUVA 1PH5A 1A0IA 3RZOB 3K7UC 3KF6B 2K33A 4DUYL 1M90C 3LNNA 1I4GA 4S3SA 3E9HA 1GO3E 1ZYRD 2F0KA 4GS3A 1ZKOA 1IBMQ 1S72A 3I72A 4MHEA 4XIGS 4YY3L 1AP0A 4HTHA 2BE5C 2Q8TA 5M3MG 3NTHA 2NUCA 3QIAA 3STBD 1GD7A 1I50H 3MC0B 2MNAA 2YU9B 1XPUA 5ELCA 3DWPA 4U68A 2KEEA 5I6WA 5COYA 1WI5A 2K52A 1RIPA 3MXNB 4K14A 2R7DA 1LTBD 3VA5A 1O7YA 1S40A 3N52A 2A6HD 2LXJA 4LFCQ 4XYQA 3S1QH 2A19A 3R3OA 3RMHA 2BDNA 2CWPA 3BDLA 2N49A 4QIWB 4BS9A 1J6QA 4LUVA 1T9HA 4IUQA 2K4KA 4YCUA 1TWHH 4A4IA 4L8JA 3M85A 5EQ0A 3I4MH 4J15A 1EYGA 3UDXA 2B8GA 5JVH3 1WTWA 2MP1A 1EU4A 2WKDA 3R93A 4BBRB 4QUCA 4RHRA 2NVXH 4XQNA 4HJ7A 1XYIA 1BF4A 4X6AH 1Y14B 4A3KB 3K0YA 5IT9c 4A93G 2F0OA 1LTRD 2PNRC 4GKKL 1ICWA 2KHIA 1A3VA 5C3EH 5E3FA 1X32A 1SMYD 1FD7D 2TSSA 2B3GA 4KD3A 3OMCA 4DV7L 1CQFA 4C2MB 5C4JH 3GTKB 2EY2A 5C0XH 4LF4L 5IY0A 1HQRD 1K83B 2MHVA 2WV6D 4FF1A 4NXNQ 1K3BC 3M4QA 4CDDC 1R9TH 1GUTA 3PO2H 5IYDG 4KN7C 4A3JH 1E2VA 4RCNA 3EN2A 4EVOA 3HOXG 1STBA 1YBYA 3H3VH 1MSGA 5F2DA 3M3YH 1G2SA 5LL6X 1V8QA 3I8ZA 2JSOA 2HHHL 3S14H 4KY6A 4C56C 4QJFA 4ZYSA 4DUZL 1C9OA 1L0XB 2A69D 2ENBA 1TWGB 1DJRD 1VMPA 4POFA 2L4NA 3A8JE 2CH4W 3GV6A 5H1SE 1Y1WH 2XSCA 1U4RA 4DR4Q 4N8X1 4X62L 1F2ZA 4P2CB 5D3DA 5J3BA 3BS1A 3S1NH 4FF4A 2JA5H 1N32Q 1Z47A 3X3NA 4A3IH 1IKLA 3PCOB 1E22A 1H9SB 3MFGA 3VA7A 1BVSA 1Q90A 2A1AA 2WAQG 1VS0A 2ZM6L 4BXXH 1WTQA 4JK1C 2VNUD 3TDQA 4B3RQ 4FYDA 2R7ZH 2E2IB 1MIUA 2NN6H 3Q8DA 1KDBA 2NBFA 5KNCA 4ABNA 2A5HA 1A2TA 4KD4A 1F9QA 5M5XB 1YITA 1G6ZA 3E0JA 3HP3A 3FPUB 4NMZA 4IURA 1EQRA 1VQHA 3ULPA 1WFQA 3CCLA 2JA6H 4LF5Q 3H0GB 1SYBA 3S16B 3HOWB 3G6EA 3S24A 4DA2A 4JI1L 3U58A 4JOIC 3D31A 3RR5A 2K5WA 2FMMA 1EQVA 5IGCA 2G9HD 1WD0A 3S17B 4DK6C 2A68C 4KN4C 2O5JC 1OXVA 1W6JA 3PF4A 1IW7C 1TWHB 4K8JA 5IGGA 1IBKL 3H94A 1TWAH 1AW7A 1EUJA 1LABA 1TIID 4L5QA 1E3PA 2EY6A 1T5EA 3PUWA 4B3ML 4O0AA 5CV7A 3I56A 2LSSA 3P20A 4KJOA 2PO4A 1HUMA 3NBIA 1H9JA 1IHZA 1SEBD 4R4TA 2SNSA 3NUCA 3I4MG 2KENA 4JG2A 3CU7A 3TQYA 1PH8A 2IT1A 1D6EC 3OIQA 1HNZL 1QZHA 1N9WA 4OELB 1MJEA 2DJGC 1JOKA 2JE6I 2GA4B 3T13A 4DF7A 4B3TQ 1BCPB 5KGUA 3GTMB 4DR6L 2QA4A 1YJWA 1TY0A 5C3EG 2MO1A 4XT3B 1CUKA 3PO2B 2L15A 1VQAA 2E8GA 5CGKA 3WOEA 2M9VA 3HOYH 2F0TA 2OWOA 2HT1A 1XX8A 2QILA 4AYBB 1EIYB 3H3VI 5C0XG 4FNFA 1VQBA 2WB1B 1PH4A 1MHWC 2IX3A 5CV6A 5DLQE 5AFWA 3J7YW 4A75A 1PH2A 4NB3A 4R8NA 1B7YB 1STNA 2CQAA 4HSPA 1YZ6A 1KABA 1BCPF 2Z4HA 4GN5A 3AB9A 4CGYB 3KF8A 1EYDA 2UUCQ 2K75A 4DV5Q 1LACA 4R4IA 2Z6KA 3RZDH 4WJ3M 4DXGA 4HAEA 1JWUD 1MKHA 1MSHA 2N8NA 4OWTB 3J80E 3GTJH 1VQKA 4GKJQ 4F88A 3BU2A 3FP9A 1UE1A 1DGSA 1YNNC 1WTRA 2AUJD 1TXYA 1PH6A 2UXCL 1XTCD 2SOBA 2Z0SA 1XJVA 5FLXc 3ULJA 1EY4A 4UP8A 3R8BA 1GOZA 5CBEE 3OTOL 3FKIB 2OTLA 1V1PB 3NXWA 4JI5Q 2QF7A 1B70B 4BY7G 1J9OA 3ERSX 1OXTA 5CV4A 4A3IG 4LUZA 4EQNA 3SR1A 2RVLA 1SE3A 4KLKA 4BXXG 4CJ0B 2BDOA 3F2UA 3J80i 2QKIC 1H9MA 3NQTA 2ZXOA 4PMBA 1NJIC 2R7ZG 3E6ZX 2NN6G 1JE5A 5LMNW 4ZQ3A 3WWVA 1WTXA 5LMUQ 4ZCKA 5IP7H 1Z9FA 1UUPA 5IGDA 5AJ3Q 2B2VC 2F0LA 4FDBA 4IFDJ 1NUCA 1PTOB 1NR2A 4IPCA 4DK3C 2JA6G 5FK9C 3F2BA 4ODGA 2RDHA 4DAYB 4NXML 4Q0FA 2XIWA 2CWAA 4WJ4A 1QNUA 3JAME 4FF2A 5M5WB 3PUXA 1XXGA 1QJOA 1WVLA 3HOZH 3P75A 4A3GB 1LTAD 1SN8A 3W3AA 4EQ5A 2AUKA 4JYAL 1KNEA 3GTQB 3A8KE 1BXTA 1IYUA 1STEA 3TZUA 1PTOF 1L0YB 1XTDA 2Y0SE 4QUFA 4DV0Q 2E2JB 1HZAA 4HJ9A 3HKSA 2FINB 3IFTA 4OGQC 4H0LC 4OL7A 5LL6S 5IYBH 1V1QA 3S15H 5EPJA 5M9OA 3S2HB 1Q3LA 2D62A 3KK7A 4H13C 1CKMA 3KOJA 1CFMA 1I3QH 4FVMA 3A5UA 1K0SA 1N36Q 3FDTA 1Q7YC 2AQ2B 4TSSA 1BUVT 1LTTD 4DR2L 4EGVA 2HCCA 3BG3A 2B2UC 2O5IC 2F0EA 2N3SA 2E74C 2ID0A 3FRPB 1R4QB 4A76A 4K0KL 2M2LA 2K05A 4R1JA 1NMGA 1M1KC 4RGMA 3ZYYX 1BDOA 1Y1VG 2R3ZA 1PFMA 2MFIA 1HTPA 2ICEC 3GQBA 2L55A 2D9UA 4B3SQ 4DV6L 1BCPC 2UU9L 3GTGB 1BOSA 2A68D 1VF5C 1Q86C 1IL8A 3CCJA 4HMJA 2F0IA 4JI8L 2F0SA 3C1FA 4UDUC 4APVA 2AQ3B 3CHBD 2FFKB 5JVG3 1QVCA 3I4NG 1IBLQ 5ELOA 4ZAIA 1LT5D 2KEDA 2EJFC 3E0EA 4IN3A 4IUVA 4IFDH 1N33L 4V0BA 5CV5A 2I0QA 1F2MA 3IAYA 1UEAB 4J8QA 2NZHA 2QEJC 1X9NA 3KFUA 5IGEA 1DOKA 4GOPA 1R4PB 1NTGA 3AU7A 2Z6BA 4H02A 4DFAA 2IX0A 3GTPB 2UUAQ 1Y69U 4POGA 1I94Q 4JI6Q 3J81j 3OHXC 2Y0SB 4Y52H 1SR3A 3OMGA 5IT9L 2VB2X 4QY7A 3GTOB 3TRZA 1IYVA 4IPHA 2VL6A 3RN2A 4X66L 5JPNC 1ILQA 1GUNA 4DNRB 4K5WA 3UE1A 1BBUA 1JC7A 4RH6A 2EZVA 1YJNA 3VR6A 3VYUA 1NE3A 4GNXB 3PIOA 4G7HC 2XWJB 3OIPA 2K5VA 1SROA 1UE5A 5E4XA 3T1YQ 1WTOA 4TVAB 4C3JG 2F52A 1LLRD 1PRTB 4YCWA 4X3SA 1MI2A 4L5SA 4EQPA 4X65Q 3NHHA 1QWYA 1BR9A 2R61A 5LMNL 2NVYH 3AQQA 4C3IH 1B53A 5GQOA 4K5VA 3EFXD 1JJ2A 1G8ZD 1DZ1A 1EEFD 2K32A 4IOAA 3FVQA 4PZ7A 5IP7G 4DR5L 1PH1A 2L12A 3UDIA 1Q8KA 4H7BA 2B2YA 3ULLA 4ZKCB 4JI7Q 4A3MB 2E2HH 4C3HB 4YWLA 4DV1Q 1G91A 1PTOC 1W3SA 3AFPA 1FR3A 2PPBC 1PRTF 4JV5L 2ALYB 1EWIA 1IXRA 1YNND 4I7AA 4XXEA 1XNQQ 3UE0A 1PH3A 5HGQA 2R92H 2K5HA 1VQFA 3HOZG 4AIMA 2MO0A 2F4VL 3HOUB 1SFOH 4DV3L 3CC4A 4YWKA 3G71A 3KJOA 2VQEL 2Q2UA 2ICIA 1EY0A 4NW2A 2CCZA 3TSSA 3NBHA 1Q1EA 2CH4A 5IYBG 2RSOA 4MNOA 3CP0A 1N34L 2N55A 4TRDA 1XMOL 3T4AC 3TBIB 2VUMH 3TS0A 2F0JA 3EA6A 4JBJA 3K6OA 3ZJYC 4BY1B 2MUYA 1HR0W 3TS2A 4OHJA 2F1MA 4HIDA 1VQGA 3HRZC 1JORA 4P71A 1BO0A 1B2TA 1N8RC 1B8AA 1S5FD 1OTCA 1WD1A 2PQAB 4JC0A 4K6LA 1S5CD 2PI2E 3T1HL 3BYTB 4LFAQ 4K6DA 1UE7A 1H9KA 2EXZA 4DU9A 2NVTB 3D6WA 1D5ZC 3DEPA 2EQSA 3OPOA 1EEID 1F9RA 1I4PA 4DR1L 1D5XC 1PDQA 4XQQA 5M3MB 4KTAA 2PZUA 5BR8Q 1RKNA 2OTJA 3EBEA 4R4OA 1EY7A 5JJIA 1QUQB 3DWQA 2F0FA 4B08A 1RHPA 2F4IA 4AQYQ 1XMQL 5JEAJ 4IFDG 4OX9Q 2B8FA 3K0XA 3G4SA 1PFNA 4KHZA 1UWVA 4LFBL 3TN2A 2BH2A 1FJGQ 2HUGA 3CCEA 2EYFA 4G7OC 2VZAA 4LF8Q 5C44H 4Y7NB 2WAQE 2LMCB 1SAPA 4O2DA 4PG3A 1VQPA 1C0AA 1TWFH 1D1IA 1HR0Q 1A62A 2KA7A 1KRTA 4KKSA 3SVMA 3PSIA 4HIMA 1RODA 2JXMB 4IZ8A 2X6GA 4HSVA 3EVQA 3VR5A 1CZWA 3EJIA 1AEXA 1Z7TA 3CAMA 5C6AA 4A93B 3D6CA 5LHY1 1HXYD 2SNMA 5E7NA 1U5KA 3CCSA 1BCPD 1MBYA 1A3TA 2ZJQA 2R6GA 4A3DH 4GNXC 1JWMD 2XRSD 2F0QA 3RLFA 1CKNA 1STGA 2OF1A 3M4OB 1PRTC 1B9MA 2L9HA 2J0TD 4C3IG 3HS0C 3J81E 5J22A 1L1OB 3Q24A 4PMCA 3A8IE 1DD2A 5IWAQ 1Q82C 2OXPA 1QVGA 4CKBA 4X3KA 3PO3H 3I7FA 2R93H 2OCEA 2AKWB 3HOXB 2JA9A 4JI3L 3RLOA 2C5CA 1EZ8A 2KVMA 4ILWA 4DR3Q 3UDGA 4O1NA 1SNOA 2Q2HA 4RGTA 5ELBA 1VQ4A 1QVFA 4BA1I 2R92G 5FLXL 2F0WA 3CC7A 2E5LL 4P72A 1WCMB 3J81i 4XT1B 1NY4A 3KF6A 2DNEA 3PIPA 3AEVA 4JOIA 4JBWA 1PYBA 3NSWA 1CTMA 1AN8A 5JEAH 2AQ1B 1EWCA 1GKHA 1HH2P 1E2ZA 2MPMA 4FO2A 3CKIB 1IBML 1GUWA 2L11A 2ZXRA 2DJFC 4M1UB 1VQJA 4RA8A 4UY8C 2C9OA 3E3XA 1F9PA 1AFPA 5EJWA 4JVZA 2OQ0A 4IOCA 4FXKC 5A35A 2VUMG 1J8IA 5ELEA 2RBMA 2PCFB 1YVCA 1A2UA 2PNHA 2JJQA 5M3FB 4BY7H 4LMQD 3MXNA 5I9PA 2WKCA 4JPBW 3SHLA 1PTOD 2FMCA 3N6RA 1FVIA 5I9OA 4X3UA 4P75A 3I70A 1U0LA 4LFCL 1Q1BA 4IUUA 2ZTCA 1ICFB 2B39A 1YEZA 2HDLA 1SYFA 3S2DH 4CJ2C 3HOVH 1J5EQ 1TT2A 1IZ6A 2UXBQ 3CCQA 3EIVA 4P73A 2RF4A 1WYDA 1LTLA 3H91A 5KRUA 1HA5A 1I5FA 1VQOA 3OWFA 3SGIA 2A6EC 3TP6A 3K57A 2NTSA 1HTLD 1Y8OB 4IUNA 1I50B 3K59A 3P1HA 2PZWA 4WORA 2F0PA 1K0RA 3TEHB 1KDAA 1VQ6A 4LF9Q 5DM73 2IJ0A 5NUCA 5KNBA 4LF6Q 1YNJC 4A3FH 3GV3A 3K5LA 1DOMA 1EZ6A 3S1QB 4ZKBB 3ITPA 1PV4A 5C4XH 2Q8IB 5C44G 3K7AH 2JA7H 4ALPA 5M5YH 3I4MB 1X3PA 4NXNL 1EQQA 3CCVA 3VYSA 2C35B 2K6AA 1SBBB 4JI4Q 2NVXB 1ESRA 1A3UA 1KRSA 1K73C 3M4YA 4YHHQ 3O13A 5CMDA 2VQFQ 4FF3A 5EKLA 1KLGD 3FMCA 1L2FA 1CZGA 3TP5A 3GP7A 4DK0A 5C3EB 5C5LA 4TKOB 1TWCH 4A3DG 2N88A 2K01A 3R2IA 2JYOA 2KCNA 5C4JB 1MGSA 1NCVA 2RHQB 4BBSH 2CQOA 5C0XI 1ESFA 1Y1VH 2F0GA 4JI0Q 2H5XA 3J80L 5C4HA 3EROA 4DR4L 2PW5A 3E9IA 1Q8IA 1WOCA 3NENA 3P7JA 4DV2Q 1R9TB 1N32L 1L1OC 1H9SA 2HQEA 2Q2TA 2ES2A 1I4HA 3UI2A 2F0VA 1QG7A 3PO3G 2R93G 5HY6A 4A3JB 1B3QA 2EY5A 1O80A 5DEHA 2X69A 1Y8NB 2IW3A 4B3RL 3I4NH 1H95A 1AZQA 1UEBA 1VCIA 2JA8H 1BBWA 3M3YB 1EQTA 1SDFA 2B2VA 4Q5VA 2HCIA 2F0HA 3EQLC 2KCMA 5D3IB 1LYLA 3S14B 3SXHA 1VQLA 2EYHA 3WOFA 1KIXA 1AH9A 3KBXA 1PZKD 4LF5L 3GTLH 5J1ZA 2EY1A 1I4RA 3C1EA 4V190 1Y1WB 5FJ8G 5JEAG 3S1NB 2PMZE 2ASBA 1AZPA 1P16A 2JA5B 4A3IB 3B6YA 2F3WA 1E0BA 2K14A 2R7FA 1Y8PB 4LF7Q 5C4ZA 1PRTD 2B63H 2R7ZB 2DN8A 1JOQA 1QE6A 2NN6I 3KDFB 3MEFA 4HCEA 3D4RA 4XDXA 1SLJA 1PXUA 2K5NA 5JOBA 1O78A 4AYBG 1KDCA 1YI2A 2KCTA 4LJZC 4B9WA 3J7ZC 3CQZH 3BZKA 4C3JH 3SK6A 3S1RH 1VQ5A 1EFID 1LT4D 2RDFA 4A3BH 3OW7A 4K5XA 2JA6B 4KHPQ 3W5OA 1A8VA 1DCZA 1LM0A 1KC8C 1W6KA 3G6JB 3CPFA 4N8FA 3MXGA 3T51B 1GUGA 3SK4A 1G6PA 2L1BA 3HOVG 4RCOA 3QB3A 3CXCA 1KL9A 3I3CA 5EGTA 4DR7Q 5D65A 1B9NA 2ATWA 2B2TA 4N9TA 2KJXA 1XPOA 5KNDA 1C4QA 1SNPA 3QO2A 4PV1C 4B3TL 3J7AF 1H9RA 1TWAB 2SDFA 2NVQH 3L0OA 4A3EH 2K1BA 1MD2D 1O7ZA 4JBMA 4A3FG 3HFZB 1B1ZA 3PGZA 3NPPA 5EBDA 1K8MA 2IPKD 1VQ7A 5JJZA 4A3CH 5D14A 5C4XG 1U4PA 4HIOA 1E1OA 1GHJA 3KBGA 2JA7G 4YWMA 1TKWB 1HNWQ 1ET6A 5CR3A 5CV9A 2L0CA 5ELDA 4QL5A 1EIFA 2ZTDA 3D4DA 2PMZB 3PIP3 1JB7A 3JAMi 3L3OC 1FL0A 1W2BA 3DXJC 2UUCL 5G3LF 1YNXA 4DV5L 3HKZG 1X3QA 5I4DA 1YHBA 1LT6D 2EVBA 1SYCA 2HIXA 3IL8A 1AE2A 4GKJL 2UXDQ 1S3OA 4R8IA 1TQOA 1SYDA 3SE0A 2RSNA 2B2WC 2WINB 2A6ED 1E2WA 5CYUA 1M4VA 3HOYB 3K58A 4LK1C 4BBSG 4H44C 1HRJA 1SNCA 2YTVA 3CF5A 1V1PA 4CKCA 1S5DD 1VQDA 4JI5L 1M8AA 1SNMA 1YNJD 2EPBA 1QNKA 1GHKA 2BA1A 3I4OA 4TQUS 3QOLA 2I5LX 1KHIA 2DUDA 4MTKA 1I6HH 3KUPA 3OYYA 3RZDB 4CDCC 2JA8G 2LKVA 3GTJB 1VQNA 3VR2A 3H3VC 1I4XA 3DEOA 5LMUL 2YTYA 3DWAA 5IODA 5JJKA 1PFBA 4BWGB 2EJMA 3TP8A 5AJ3L 4RMFA 1G51A 4OIKA 1F77A 3FHWA 4JI2Q 3J80c 2UUBQ 4PNYA 2K04A 4DAYA 3A7AB 4XQJA 4QQBX 5A2QL 3E5SA 4HN7A 4KJNA 2QDLA 3Q6SA 5CBAE 1KAWA 3S1MH 1EIHA 1LUZA 4G4KA 4EX5A 5HURA 3M7NA 3KLRA 4L5RC 3R2TA 1B44D 1HNXQ 1Q81C 1ASYA 1RL2A 1PMRA 1JOOA 1BBXC 2B63G 2J4XA 2QCPX 3GDEA 5CORA 3RD4A 4X64Q 1EFWA 3K80C 1JICA 4DV0L 4C1NK 3RZOH 4IALA 4PZ8A 2GN5A 5J39A 4A3BG 3VDYA 1XNRQ 1ENAA 3VYTA 4BA2I 1KLUD 1EIGA 2Z1CA 4DV4Q 3D0FA 2EYJA 4L5TA 4F87A 1PH9A 1N36L 3NE5B 1STAA 1GM5A 1A15A 5HGTA 2ZTEA 2Z4IA 3HOZB 3A5ZB 5K5PA 3S9WA 2YU9H 4KV6A 4HEDA 4KKTA 2A8VA 5FO8B 2VB3X 4UP9A 4IPDA 1U4LA 4PMWA 3ND8A 3HEJA 3C46A 2LFNA 3W2DA 4DUYQ 1CI3M 3G48A 2HIVA 4B3SL 1K3RA 3ICEA 1B3AA 1JJGA 2F0UA 3S15B 4A3EG 4U673 3NQIA 3FPPA 1V1OA 4K2LA 4YY3Q 3MEHA 5IT9E 4HJAA 1I3QB 1IBLL 1K9MC 4BBRH 4A3CG 4KY7A 2MQHA 3RLNA 4RAUC 1EY8A 2YTXA 4A3KH 4OWXB 4Z9CB 5BN3A 1K8GA 2AWNA 4ZK9B 2EYMA 3K5MA 4LUOA 4OXPA 2TMPA 2ZJRA 5BN4A 2V4DA 3RNUA 3CCUA 3DM3A 5IOCA 1E7ZA 4C2MH 2UUAL 3PV0A 3T56B 2DY7A 2V1CC 3GTKH 1I94L 4JI6L 1K83H 1EYCA 2YV5A 4GN4B 1NSNS 2YYZA 3MAQA 2B29A 3CC2A 2JN4A 1C7YA 5ELNA 3SK8A 1X54A 5IIFA 4NPSA 4DK1A 2XRQD 4CDFC 2CHBD 3OWEB 4GNXA 2CVRA 1KXLA 4A3LH 3KJPA 2G9DA 4IFDI 4GKKQ 3NWTA 3MWYW 3L2PA 4KKUA 3G7LA 3DLLA 3T1YL 2BH8A 3DUZA 2K5DA 4ZUJA 3VYRA 1CM9A 2XNAC 4DV7Q 4KK7A 4R4CA 1NR4A 4IO9A 2OQKA 4X65L 3BVMA 3KLSA 3DHQA 1HCZA 2B2YC 1TWGH 5DNFA 2F3VA 1RTNA 4LF4Q 5KYLA 1X65A 1STHA 5GAGC 3TP7A 1XWEA 1DXMA 3QR8A 1HFNA 4JI7L 1JWSD 1JMCA 4QF4A 4CJ1B 4DV1L 3I73A 2N78A 4HJ5A 1X3EA 1TS5A 3ERQA 3J81L 2EJGC 4N9PA 2Q2IA 3M4PA 1TU2B 2E2IH 1XNQL 3H09A 3A54A 1SMXA 2EYOA 5M5XH 2HHHQ 3A55A 1SE4A 2JP1A 5IE8A 1QOHA 2X6LA 3GO5A 2A74C 4IUTA 4C1NI 4DUZQ 1BKBA 2NWGA 2NVYB 4C3IB 1LTGD 5JAVA 5I2YA 3H0GH 1JR0D 3S16H 5E4WC 3GD7A 1OO9B 5DAUA 3HOWH 4X62Q 1V9PA 2HD3A 4F8MA 5IP9G 1NNXA 1Z6HA 2E2HB 3NEMA 4I7ZC 1KNAA 2E75C 5EBCA 4B9XA 2E2DC 3T16A 3CRKC 4OEMB 2ZM6Q 3S17H 3D3RA 4L63B 5JPMC 2RHSB 1OXXK 2KOLA 3IFDA 4ID6A 2R92B 1RCVD 5E1FA 3DM1A 4ZRZA 3KLWA 1ASZA 5ELFA 1GUSA 1LTID 1SFOB 3NWSA 4NDXA 4F7XA 1CSQA 5FO9B 1D1KA 1DYQA 2K28A 2D0PA 4DNTB 1S4ZA 1RTOA 1S5BD 2PQAA 3PUYA 1HA6A 1PZID 1NAPA 5T1GA 4ME5A 3BZCA 4IJLA 4LFAL 4JI1Q 3TZDA 4MIUA 1HUNA 2G5DA 4WRDA 1IL2A 3V96A 2P5ZX 3U50C 3MXUA 5BR8L 4NKLA 4NP5A 1SE2A 2VUMB 4BBRG 1QUQA 5FJ8H 1RF2D 1ENFA 3M7GA 4OIJA 3OW2A 4A3KG 2DY8A 4AQYL 3GTMH 1A6XA 5CV8A 1IBKQ 4GLVB 4OX9L 1X3GA 2K5QA 2NZOA 1TVXA 2WAQB 4IPGA 4DAMA 3I4LA 1PHJA 1FJGL 4B3MQ 4P74A 4LF8L 1D7QA 1KAAA 3OOCA 4DAPA 1D2BA 2AMCB 1T5XD 1HR0L 4PQXA 1CA5A 4L6TB 1JJCB 2F0MA 2H1EA 1O7IA 3MVVA 1WCMG 1GJXA 1HNZQ 1TS4A 5FLMH 3PIO3 3F1ZA 2ZJPA 1ONLA 4A3LG 4X3TA 2I5MX 4DR6Q 2M00A 2WACA 3A7LA 5G3LD 4JBKA 3NP8A 4AH6A 2XTIA 3I91A 2LXKA 3WDNA 5FLXE 2NB0A 3ONAB 4HJ8A 1RDPD 1YHAA 1CK1A 3V2TA 2F3IA 1L1OA 5C44B 1IYJB 3SDZA 4HMIA 3FKIH 1TWFB 3I55A 2I46A 5IWAL 2EE1A 3RN5A 5M3FG 3NTIA 3I2ZA 1E1TA 2PI2A 5EKIA 2CKZB 4G7ZC 3TREA 4AYBE 1OXSC 2WB1E 2RCFA 3AYHB 5C3XA 5IYCH 2KBNA 1X56A 1F9SA 5GAHC 4PZ6A 3KF8B 1KD1C 4DR3L 1YIJA 3L7ZC 1TY2A 4LAAA 3H6MA 2EYLA 3VR4A 4A3DB 3A74A 1WJJA 2L5TA 2PZTA 3QJYA 1LV9A 4ZLTF 5I2XA 3NTKA 4I65A 4QMGA 1S5ED 1HZBA 2UXCQ 3LWEA 1E24A 1PTOH 4IJHA 5GROA 3JC66 1JCKB 3H0GG 3OTOQ 1SE8A 1II3A 3HOWG 1EYAA 3J81c 2AHOB 5IGFA 3PO3B 2R93B 4KHVA 5M5WH 2Z8LA 4A3GH 1HZ9A 3TMEA 2K50A 2IX1A 3LGJA 4UAIA 2CW0C 1A63A 2OT2A 3GTQH 2XN9C 2DGYA 2J7ZA 2PQEA 1PFSA 2H4OA 1SSOA 4RKBA 3Q0AA 2E2JH 1B4OA 3PMFA 2K7VA 4MN3A 1D5MC 3MXPA 1LTSD 4XYOA 3IRBA 4RFBA 1WTVA 2IL8A 4FP5D 3S2HH 4NXMQ 2NZ1D 1VF7A 1Q46A 3LWUA 1J5EL 1F2LA 1GUOA 2UXBL 1QCBD 4LW1A 3HKZE 4LNQA 5EPLA 3CD6A 2QGQA 3ND9A 2BE5D 3SEBA 4WJWA 4JYAQ 4DPGA 3U9SA 2VW9A 3U9OA 2VS1A 1O7LA 4G57A 3K5OA 3A56A 4BY7B 1K28A 3NELA 1Q12A 5T1IA 2HQLA 2BCOA 1RD9D 2RDGA 1NBWA 5KIXA 4HCSA 4LF9L 4LF6L 2IHFA 3MZ5A 1VQIA 3PO2G 2F03A 3GTGH 1FNUA 1P8LA 2JEAI 4A3JG 2WFWA 3JAML 3S2DB 3HOVB 2WB1G 4E6IA 3CCRA 2IHEA 4DR2Q 3H15A 1SJHD 3RUZA 1JT8A 4JI4L 1IKMA 2K03A 2BOSA 4K0KQ 2AWOA 2NTTA 4UPAA 4YHHL 2VQFL 1BNZA 5FLMG 1KTKA 4OO1H 5KEEA 2B2UA 1TR5A 4R4QA 3GTPH 2B2WA 1Y1WG 1PA6A 1VQMA 1EY5A 2RQXA 2VXWA 2IWHA 4DV6Q 2JA5G 2D5DA 2PW7A 3OSOA 3QOJA 4A3FB 2UU9Q 1SJED 1CSPA 1VDZA 2JQOA 4JI8Q 4HR7B 3GTOH 2EOTA 2QDBA 3U4ZA 3SK5A 2QEXA 1HJPA 5C4XB 1UE6A 1CA6A 4UP7A 4JI0L 3K7AB 5DM63 2JA7B 3FKIG 4DKAC 2MJ8A 5CC4A 1WTHA 5M5YB 2GVAA 4DV2L 2A73B 2KHJA 1GVPA 1ILPA 4CBVA 1PLFA 3PQIA 1N33Q 1ZEQX 1PZJD 1QILA 5IYCG 1GXDC 2Q8RE 2KQ3A 4XTCS 5C3WA 3HKZB 1VQ8A 5K36H 1PYWD 1WTPA 2LY7A 4GOPB 3K81C 3BZDB 2EIFA 3BDCA 2F0DA 2OEOA 4WFN3 1EY9A 1TWCB 4IQZA 3I90A 4DGZA 1SYGA 1RJTA 2NYZD 2XWBB 2Z6KC 5GADC 3M9BA 1X3FA 4BBSB 1DONA 4KY5A 2D0OA 4A3MH 1BQQT 1L0WA 4C3HH 4X66Q 1Y1VB 3C2PA 3BDOA 3FEWX 2FHTA 3HZXA 1HFGA 2EDGA 3BYYB 5KYIA 2XGTA 1VQ9A 3CPWA 1ENCA 4LF7L 3BVZA 1ZYRC 2JK8A 2IY5B 3URYA 3I4NB 3KDFA 4A3GG 3HOUH 2SEBD 2JA8B 3QWNA 1FGBD 5LMNQ 3F2DA 4GZYC 1I4QA 5JJLA 1DOLA 4DR5Q 2O4XA 4JW0A 1G2TA 3STBC 3GTLB 4KMUC 4KHPL 1HHVA 2ZXPA 4K2KA 3K5NA 1EU3A 3ER0A 5IGBA 4YIJA 2WP8J 4FXGC 4GLAC 1EY6A 5FKAC 1CKOA 1FNWA 4JV5Q 3F8TA 2A6HC 3W1GA 4DAVA 3NK9A 5EPKA 1ZXTA 2B2TC 2KHSA 4MTNA 1K8AC 1EOVA 1SNDA 1HPCA 4FXDA 3DMUA 4YCVA 2B63B 1JE4A 4BY1H 2F0NA 2RKSA 1QZGA 2F4VQ 1I6VC 2DNCA 4IUPA 4DR7L 3VR3A 5FOBB 4DV3Q 1EL0A 3KYHC 2VQEQ 3HOYG 3CMAA 1IW7D 1SRUA 1OXUA 4QB4A 5GAEC 3CQZB 2FXQA 4C3JB 3S1RB 4A3BB
chains in the Genus database with same CATH topology
2EYPA 2BA0A 3CRLC 4RKLA 2LS01 2CW0D 3HGBA 2E76C 1CHQD 1SMYC 3QG1A 1FNVA 2MGSA 1U9RA 4OO1I 4J6HA 2XVSA 1SYEA 4DXFA 2RA4A 1UAPA 3L9AX 2PYKA 1V43A 2ZT9C 3D4WA 1DM0B 3IKJA 4OO1G 2NVQB 1CT1D 1SNQA 5ISRA 4A3EB 3Q23A 3V05A 1LO5D 2D2CC 5BN5A 1FYCA 1CHPD 2O2LD 1G291 2A69C 5A2QE 3PUZA 1U4MA 1EWHA 4KI0A 3J7AV 5TSSA 1LT3D 5EKKA 5C5MA 5K36G 1QB5D 4QCLA 2KUMA 1JQYD 1TS3A 1VMCA 4ZUIA 3AMUA 4J1MA 4R9WA 3MTSA 2HDMA 4O42A 3MHBA 4ULLA 5FO7B 1SXTA 4RWSC 1F2YA 4C3HG 4M8AA 1CQVA 4EQOA 1C48A 3HG9A 3LX0A 4CKEA 4K8IA 1ET9A 3BVGA 4RGNA 2WIIB 2JEBI 1HQMC 3Q22A 1JB3A 4RGOS 1UNSA 1I6HB 3C3LA 2KECA 1K8OA 5I6YA 1C8CA 1B50A 2FJ2A 2KCCA 1ML0D 4RHSA 4CHTB 1TS2A 3D8GA 3KLSX 1EOTA 3T53B 3S1MB 5C0XJ 3MFYA 2I07B 3X3MA 1STYA 4DN4M 3MA2B 3PUVA 3RZOB 2K33A 3LNNA 1I4GA 4S3SA 2F0KA 1ZYRD 1ZKOA 3I72A 4MHEA 4XIGS 1AP0A 4HTHA 2BE5C 2Q8TA 3NTHA 2NUCA 3QIAA 3MC0B 2YU9B 5ELCA 3DWPA 4U68A 2KEEA 5I6WA 5COYA 4K14A 1LTBD 3VA5A 1O7YA 3N52A 2A6HD 4XYQA 3RMHA 3R3OA 2BDNA 3BDLA 4QIWB 4BS9A 4IUQA 4L8JA 3M85A 5EQ0A 2B8GA 5JVH3 1WTWA 2MP1A 1EU4A 2WKDA 3R93A 4BBRB 4QUCA 4RHRA 4XQNA 1XYIA 1BF4A 4A3KB 3K0YA 2F0OA 1LTRD 2PNRC 1ICWA 1A3VA 5E3FA 1X32A 1SMYD 1FD7D 2TSSA 4KD3A 3OMCA 1CQFA 4C2MB 3GTKB 2EY2A 5C0XH 1HQRD 1K83B 2MHVA 2WV6D 4FF1A 1GUTA 4KN7C 1E2VA 4RCNA 4EVOA 1STBA 1MSGA 5F2DA 1G2SA 5LL6X 1V8QA 3I8ZA 2JSOA 4KY6A 4C56C 4ZYSA 1L0XB 2A69D 2ENBA 1TWGB 1DJRD 1VMPA 2L4NA 3A8JE 3GV6A 2XSCA 1U4RA 1F2ZA 4P2CB 5D3DA 3BS1A 4FF4A 1Z47A 3X3NA 1IKLA 1H9SB 3MFGA 3VA7A 1Q90A 1WTQA 4JK1C 2VNUD 3TDQA 4FYDA 2E2IB 2NN6H 1KDBA 2NBFA 5KNCA 4ABNA 2A5HA 1A2TA 4KD4A 1F9QA 5M5XB 1G6ZA 3E0JA 3HP3A 3FPUB 4NMZA 4IURA 3H0GB 1SYBA 3S16B 3HOWB 4DA2A 3D31A 2K5WA 2FMMA 1EQVA 5IGCA 2G9HD 1WD0A 3S17B 2A68C 4KN4C 2O5JC 1OXVA 1W6JA 1IW7C 1TWHB 4K8JA 5IGGA 3H94A 1AW7A 1LABA 1TIID 2EY6A 1T5EA 3PUWA 5CV7A 3P20A 4KJOA 2PO4A 1HUMA 3NBIA 1H9JA 1IHZA 1SEBD 2SNSA 3NUCA 3CU7A 2IT1A 1D6EC 3OIQA 1JOKA 2JE6I 2GA4B 3T13A 4DF7A 1BCPB 5KGUA 3GTMB 1TY0A 4XT3B 3PO2B 5CGKA 3WOEA 2M9VA 2F0TA 1XX8A 2QILA 4AYBB 5C0XG 4FNFA 2WB1B 2IX3A 5CV6A 5AFWA 3J7YW 4R8NA 1STNA 2CQAA 4HSPA 1KABA 1BCPF 2Z4HA 3AB9A 4CGYB 3KF8A 1EYDA 1LACA 4DXGA 4HAEA 1JWUD 1MSHA 3J80E 4F88A 1YNNC 1WTRA 2AUJD 1XTCD 2SOBA 1EY4A 3R8BA 5CBEE 1GOZA 3FKIB 1V1PB 3NXWA 2QF7A 1J9OA 5CV4A 1OXTA 4EQNA 3SR1A 2RVLA 1SE3A 4CJ0B 2BDOA 3F2UA 2QKIC 1H9MA 3NQTA 2ZXOA 4PMBA 3E6ZX 2NN6G 4ZQ3A 1WTXA 1UUPA 5IGDA 2B2VC 2F0LA 4IFDJ 1NUCA 1PTOB 1NR2A 5FK9C 4ODGA 2RDHA 4Q0FA 2XIWA 1QNUA 3JAME 4FF2A 5M5WB 3PUXA 1XXGA 1QJOA 1WVLA 3P75A 4A3GB 1LTAD 3W3AA 2AUKA 1KNEA 3GTQB 3A8KE 1BXTA 1IYUA 1STEA 3TZUA 1PTOF 1L0YB 4QUFA 2E2JB 2FINB 3IFTA 4OGQC 4H0LC 4OL7A 5LL6S 5EPJA 5M9OA 3S2HB 1Q3LA 2D62A 3KK7A 4H13C 1CFMA 4FVMA 3FDTA 2AQ2B 4TSSA 1BUVT 1LTTD 4EGVA 2HCCA 3BG3A 2B2UC 2O5IC 2F0EA 2E74C 2ID0A 3FRPB 1R4QB 2M2LA 2K05A 4RGMA 3ZYYX 1BDOA 2R3ZA 1PFMA 1HTPA 2ICEC 3GQBA 2L55A 2D9UA 1BCPC 3GTGB 1BOSA 2A68D 1VF5C 1IL8A 4HMJA 2F0IA 2F0SA 3C1FA 4UDUC 2AQ3B 3CHBD 2FFKB 5JVG3 4ZAIA 1LT5D 2KEDA 2EJFC 4IN3A 4IUVA 4IFDH 4V0BA 5CV5A 1F2MA 3IAYA 1UEAB 4J8QA 2QEJC 5IGEA 1DOKA 1R4PB 3AU7A 4DFAA 2IX0A 3GTPB 1Y69U 3OHXC 2Y0SB 3OMGA 5IT9L 2VB2X 3GTOB 1IYVA 5JPNC 1ILQA 1GUNA 4DNRB 4K5WA 1JC7A 4RH6A 2EZVA 3VR6A 3VYUA 4G7HC 2XWJB 3OIPA 5E4XA 1WTOA 4C3JG 1LLRD 1PRTB 4X3SA 1MI2A 4EQPA 1QWYA 1BR9A 2R61A 3NHHA 1B53A 4K5VA 3EFXD 1G8ZD 1DZ1A 1EEFD 2K32A 3FVQA 2L12A 4H7BA 2B2YA 4ZKCB 4A3MB 4C3HB 1G91A 1PTOC 1FR3A 2PPBC 1PRTF 1YNND 4XXEA 3HOUB 2ICIA 1EY0A 4NW2A 3TSSA 3NBHA 1Q1EA 2RSOA 2N55A 4TRDA 3T4AC 3TBIB 2F0JA 3EA6A 3K6OA 4BY1B 2MUYA 4OHJA 2F1MA 3HRZC 1JORA 1BO0A 1B2TA 1S5FD 1WD1A 4K6LA 1S5CD 3BYTB 4K6DA 1H9KA 2EXZA 4DU9A 2NVTB 3D6WA 1D5ZC 3DEPA 3OPOA 1EEID 1F9RA 1I4PA 1D5XC 1PDQA 4XQQA 5M3MB 4KTAA 2PZUA 1RKNA 1EY7A 3DWQA 2F0FA 4B08A 1RHPA 2F4IA 5JEAJ 4IFDG 2B8FA 1PFNA 4KHZA 3TN2A 2HUGA 2EYFA 4G7OC 4Y7NB 2LMCB 1SAPA 1D1IA 2KA7A 4KKSA 3SVMA 1RODA 2JXMB 4IZ8A 2X6GA 4HSVA 3EVQA 3VR5A 1CZWA 3EJIA 1AEXA 1Z7TA 5C6AA 4A93B 3D6CA 5LHY1 1HXYD 2SNMA 1BCPD 1MBYA 1A3TA 2R6GA 1JWMD 2XRSD 3RLFA 2F0QA 1STGA 2OF1A 3M4OB 1PRTC 1B9MA 2L9HA 2J0TD 4C3IG 3HS0C 3J81E 5J22A 3Q24A 4PMCA 3A8IE 1DD2A 2OXPA 4CKBA 4X3KA 3HOXB 2C5CA 1EZ8A 2KVMA 4ILWA 4O1NA 1SNOA 4RGTA 5ELBA 4BA1I 5FLXL 2F0WA 1WCMB 4XT1B 2DNEA 4JBWA 3NSWA 1CTMA 1AN8A 5JEAH 2AQ1B 1EWCA 1E2ZA 2MPMA 4FO2A 3CKIB 1GUWA 2L11A 2ZXRA 4M1UB 4RA8A 2C9OA 1F9PA 1AFPA 5EJWA 4FXKC 5A35A 1J8IA 5ELEA 2RBMA 2PCFB 1A2UA 5M3FB 4LMQD 3MXNA 5I9PA 2WKCA 3SHLA 1PTOD 2FMCA 3N6RA 5I9OA 4X3UA 3I70A 1Q1BA 4IUUA 2B39A 2HDLA 1SYFA 4CJ2C 1TT2A 3H91A 5KRUA 1HA5A 3OWFA 2A6EC 3TP6A 3K57A 2NTSA 1HTLD 1Y8OB 4IUNA 1I50B 3K59A 3P1HA 2PZWA 4WORA 2F0PA 1KDAA 5DM73 2IJ0A 5NUCA 5KNBA 1YNJC 3GV3A 3K5LA 1DOMA 1EZ6A 3S1QB 4ZKBB 3ITPA 2Q8IB 3I4MB 1X3PA 3VYSA 2K6AA 1SBBB 2NVXB 1ESRA 1A3UA 3M4YA 3O13A 5CMDA 4FF3A 5EKLA 1KLGD 3FMCA 1CZGA 3TP5A 3GP7A 4DK0A 5C3EB 5C5LA 4TKOB 2N88A 2K01A 3R2IA 2JYOA 2KCNA 5C4JB 1MGSA 1NCVA 5C0XI 1ESFA 2F0GA 3J80L 5C4HA 3EROA 2PW5A 1Q8IA 3P7JA 1R9TB 1H9SA 2HQEA 1I4HA 3UI2A 2F0VA 1QG7A 4A3JB 2EY5A 1O80A 5DEHA 2X69A 1Y8NB 2IW3A 1AZQA 1VCIA 3M3YB 1EQTA 1SDFA 2B2VA 4Q5VA 2HCIA 2F0HA 3EQLC 5D3IB 3S14B 3SXHA 2EYHA 3WOFA 3KBXA 1PZKD 5J1ZA 2EY1A 1I4RA 3C1EA 4V190 1Y1WB 5JEAG 3S1NB 1AZPA 2JA5B 4A3IB 2F3WA 1E0BA 1Y8PB 5C4ZA 1PRTD 2R7ZB 2DN8A 1JOQA 1QE6A 2NN6I 4HCEA 3D4RA 4XDXA 1PXUA 5JOBA 1O78A 1KDCA 4LJZC 4B9WA 3SK6A 1EFID 1LT4D 2RDFA 3OW7A 4K5XA 2JA6B 1DCZA 1W6KA 3G6JB 3MXGA 3T51B 1GUGA 3SK4A 2L1BA 4RCOA 3QB3A 3I3CA 5EGTA 5D65A 1B9NA 2B2TA 4N9TA 2KJXA 5KNDA 1C4QA 1SNPA 3QO2A 4PV1C 3J7AF 1H9RA 1TWAB 2SDFA 2K1BA 1MD2D 1O7ZA 1B1ZA 3NPPA 5EBDA 1K8MA 2IPKD 5JJZA 5D14A 1U4PA 1GHJA 3KBGA 1TKWB 1ET6A 5CR3A 5CV9A 2L0CA 5ELDA 3D4DA 2PMZB 3PIP3 3L3OC 3DXJC 5G3LF 1X3QA 5I4DA 1LT6D 2EVBA 1SYCA 3IL8A 4R8IA 1TQOA 1SYDA 3SE0A 2RSNA 2B2WC 2WINB 2A6ED 1E2WA 5CYUA 1M4VA 3HOYB 3K58A 4LK1C 4H44C 1HRJA 1SNCA 1V1PA 4CKCA 1S5DD 1M8AA 1SNMA 1YNJD 2EPBA 1QNKA 1GHKA 2BA1A 4TQUS 3QOLA 3KUPA 3RZDB 2LKVA 3GTJB 3VR2A 3H3VC 1I4XA 3DEOA 3DWAA 5IODA 1PFBA 4BWGB 2EJMA 3TP8A 4OIKA 1F77A 4PNYA 4DAYA 2K04A 3A7AB 4XQJA 5A2QL 3E5SA 4HN7A 4KJNA 3Q6SA 5CBAE 1EIHA 4G4KA 5HURA 3M7NA 3KLRA 3R2TA 1B44D 1PMRA 1JOOA 1BBXC 2J4XA 2QCPX 5CORA 3RD4A 1JICA 4C1NK 4IALA 5J39A 1ENAA 3VYTA 4BA2I 1KLUD 1EIGA 2Z1CA 2EYJA 4F87A 3NE5B 1STAA 1A15A 5HGTA 2Z4IA 3HOZB 5K5PA 3S9WA 4KV6A 4HEDA 4KKTA 5FO8B 2VB3X 1U4LA 4PMWA 3ND8A 3HEJA 3C46A 2LFNA 3W2DA 1CI3M 1B3AA 2F0UA 3S15B 4U673 3NQIA 3FPPA 1V1OA 4K2LA 3MEHA 5IT9E 1I3QB 4KY7A 4RAUC 1EY8A 4Z9CB 5BN3A 2AWNA 4ZK9B 2EYMA 3K5MA 2TMPA 5BN4A 2V4DA 5IOCA 3PV0A 3T56B 2DY7A 1EYCA 1NSNS 2YYZA 3MAQA 3SK8A 5IIFA 4DK1A 2XRQD 2CHBD 3OWEB 2CVRA 2G9DA 4IFDI 3NWTA 3MWYW 4KKUA 3G7LA 3DUZA 2K5DA 4ZUJA 3VYRA 1CM9A 2XNAC 4KK7A 1NR4A 3BVMA 3KLSA 3DHQA 1HCZA 2B2YC 5DNFA 2F3VA 1RTNA 5KYLA 1STHA 3TP7A 1XWEA 1DXMA 1HFNA 1JWSD 4QF4A 4CJ1B 3I73A 1TS5A 3ERQA 3J81L 2EJGC 4N9PA 1TU2B 3H09A 3A54A 2EYOA 3A55A 1SE4A 2JP1A 1QOHA 2X6LA 3GO5A 2A74C 4IUTA 4C1NI 2NWGA 2NVYB 4C3IB 1LTGD 5JAVA 5I2YA 1JR0D 5E4WC 3GD7A 1OO9B 5DAUA 4F8MA 1Z6HA 2E2HB 4I7ZC 1KNAA 2E75C 5EBCA 4B9XA 2E2DC 3T16A 3CRKC 3D3RA 4L63B 5JPMC 1OXXK 2KOLA 3IFDA 4ID6A 2R92B 1RCVD 5E1FA 3DM1A 4ZRZA 5ELFA 1GUSA 1LTID 1SFOB 3NWSA 4NDXA 4F7XA 5FO9B 1D1KA 1DYQA 2K28A 4DNTB 1S4ZA 1RTOA 1S5BD 3PUYA 1HA6A 1PZID 1NAPA 5T1GA 4ME5A 3TZDA 4MIUA 1HUNA 4WRDA 3V96A 3MXUA 4NKLA 4NP5A 1SE2A 2VUMB 1RF2D 1ENFA 3M7GA 4OIJA 2DY8A 1A6XA 5CV8A 2K5QA 1TVXA 2WAQB 3I4LA 1KAAA 3OOCA 4DAPA 1D2BA 1T5XD 4PQXA 1CA5A 4L6TB 2F0MA 2H1EA 3MVVA 1GJXA 1TS4A 3PIO3 1ONLA 4X3TA 2M00A 2WACA 3A7LA 5G3LD 3NP8A 3I91A 3WDNA 5FLXE 2NB0A 3ONAB 1RDPD 1CK1A 3V2TA 5C44B 3SDZA 4HMIA 1TWFB 2I46A 2EE1A 3NTIA 5EKIA 4G7ZC 1OXSC 5C3XA 1F9SA 3L7ZC 1TY2A 4LAAA 3H6MA 2EYLA 3VR4A 4A3DB 2L5TA 2PZTA 3QJYA 1LV9A 4ZLTF 5I2XA 3NTKA 4I65A 4QMGA 1S5ED 3LWEA 1PTOH 1JCKB 1II3A 1EYAA 5IGFA 3PO3B 2R93B 4KHVA 2Z8LA 3TMEA 2IX1A 4UAIA 2CW0C 2OT2A 2XN9C 2PQEA 2J7ZA 2H4OA 1SSOA 4RKBA 3Q0AA 1B4OA 3PMFA 2K7VA 4MN3A 1D5MC 3MXPA 1LTSD 4XYOA 4RFBA 1WTVA 2IL8A 4FP5D 2NZ1D 1VF7A 3LWUA 1F2LA 1GUOA 1QCBD 5EPLA 3ND9A 2BE5D 3SEBA 4WJWA 3U9SA 3U9OA 1O7LA 4G57A 3K5OA 3A56A 4BY7B 1Q12A 5T1IA 2BCOA 1RD9D 2RDGA 5KIXA 4HCSA 3MZ5A 2F03A 1FNUA 2JEAI 3JAML 3S2DB 3HOVB 4E6IA 1SJHD 3RUZA 1IKMA 2K03A 2BOSA 2AWOA 2NTTA 1BNZA 1KTKA 4OO1H 5KEEA 2B2UA 1TR5A 2B2WA 1EY5A 2RQXA 2VXWA 2IWHA 2D5DA 2PW7A 3OSOA 3QOJA 4A3FB 1SJED 1VDZA 4HR7B 2EOTA 2QDBA 3SK5A 5C4XB 1CA6A 3K7AB 5DM63 2JA7B 5CC4A 2MJ8A 5M5YB 2A73B 1ILPA 4CBVA 1PLFA 1ZEQX 1PZJD 1QILA 1GXDC 2Q8RE 2KQ3A 4XTCS 5C3WA 3HKZB 5K36H 1PYWD 1WTPA 2LY7A 3BZDB 3BDCA 2F0DA 2OEOA 4WFN3 1EY9A 1TWCB 4IQZA 3I90A 4DGZA 1SYGA 1RJTA 2NYZD 2XWBB 4BBSB 1DONA 4KY5A 1BQQT 3C2PA 1Y1VB 3BDOA 3FEWX 2FHTA 3HZXA 1HFGA 2EDGA 3BYYB 5KYIA 1ENCA 3BVZA 1ZYRC 3URYA 3I4NB 2SEBD 2JA8B 3QWNA 1FGBD 4GZYC 1I4QA 1DOLA 2O4XA 1G2TA 3GTLB 4KMUC 1HHVA 2ZXPA 4K2KA 3K5NA 1EU3A 5IGBA 4YIJA 2WP8J 4FXGC 5FKAC 1EY6A 1FNWA 2A6HC 4DAVA 3NK9A 5EPKA 1ZXTA 2B2TC 2KHSA 1SNDA 1HPCA 4FXDA 3DMUA 2B63B 1JE4A 2F0NA 2RKSA 1I6VC 2DNCA 4IUPA 3VR3A 5FOBB 1EL0A 1IW7D 1OXUA 4QB4A 3CQZB 4C3JB 3S1RB 4A3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYP A;  3D4D A;  3TME A;  5CC4 A;  2F0H A;  2F0O A;  2SOB A;  4IZ8 A;  3EVQ A;  4RKL A;  1STH A;  3EJI A;  5I6Y A;  1AEX A;  2EYJ A;  2PQE A;  1EY4 A;  1SYF A;  2EYH A;  3SXH A;  1EQV A;  3TP7 A;  1A3V A;  5C3W A;  5C6A A;  5E3F A;  5IGC A;  1STA A;  3D6C A;  1TT2 A;  1U9R A;  4RKB A;  5HGT A;  3NXW A;  2SNM A;  4QF4 A;  5K5P A;  3PMF A;  4J6H A;  4KD3 A;  3S9W A;  1A3T A;  5J1Z A;  3OMC A;  2EY1 A;  1KAA A;  2KQ3 A;  1SYC A;  2F0I A;  3ERQ A;  3C1E A;  4HMJ A;  1EY0 A;  1SYE A;  2F0S A;  3C1F A;  3MXP A;  4KV6 A;  1TQO A;  4N9P A;  5KRU A;  1SYD A;  4EQN A;  3OWF A;  4K8J A;  3SR1 A;  5IGG A;  2EY2 A;  3TP6 A;  2F0Q A;  3BDC A;  3D8G A;  3HEJ A;  4EQO A;  2F0D A;  2F3W A;  2OEO A;  1EY9 A;  4IUN A;  2F0M A;  2EY6 A;  1STG A;  2OF1 A;  3MVV A;  3NQT A;  3P1H A;  4PMB A;  2PZW A;  2EYO A;  4DGZ A;  1SYG A;  5C4Z A;  1SNC A;  2PYK A;  4WOR A;  2F0P A;  3D4W A;  5CV4 A;  5CV5 A;  1F2M A;  4ZQ3 A;  5J22 A;  1KDA A;  2F0U A;  4TRD A;  4KY5 A;  4PMC A;  5NUC A;  1SNM A;  1JOQ A;  5IGE A;  5CV7 A;  1STY A;  4K2L A;  5IGD A;  5JAV A;  2F0J A;  2M00 A;  2OXP A;  1EZ6 A;  1SNQ A;  2WAC A;  4KJO A;  1STB A;  3MEH A;  5JOB A;  1KDC A;  2F0L A;  3ITP A;  3NP8 A;  5DAU A;  4DFA A;  1NUC A;  4B9W A;  3HZX A;  1IHZ A;  2SNS A;  3NUC A;  5F2D A;  4KY7 A;  4F8M A;  4ODG A;  3U9O A;  5KYI A;  3QOL A;  3SK6 A;  4G57 A;  2RDF A;  1EY8 A;  1EZ8 A;  4K5X A;  1ENC A;  3V2T A;  4S3S A;  2LKV A;  4B9X A;  1SNO A;  4KY6 A;  2F0K A;  3OMG A;  3T16 A;  5KIX A;  4HMI A;  1JOR A;  1JOK A;  2EYM A;  3MZ5 A;  1A3U A;  2F0W A;  3T13 A;  4DF7 A;  5IOD A;  2ENB A;  5KGU A;  3P75 A;  4K5W A;  3TP8 A;  3SK4 A;  4HTH A;  4ID6 A;  5EKL A;  5IOC A;  4K6D A;  5E1F A;  3QB3 A;  2EXZ A;  4PNY A;  4DU9 A;  1F2Z A;  5C3X A;  3TP5 A;  5CGK A;  5EKK A;  2O4X A;  5C5M A;  5C5L A;  4E6I A;  4NDX A;  5EGT A;  2NUC A;  4F7X A;  4KTA A;  2F0T A;  2PZU A;  1EYC A;  1RKN A;  3E5S A;  4KJN A;  4N9T A;  4K2K A;  1EY7 A;  1NSN S;  4LAA A;  3H6M A;  3RUZ A;  4ZUI A;  2EYL A;  5I6W A;  4J1M A;  4YIJ A;  4OL7 A;  1SNP A;  5IGB A;  2F0F A;  4K14 A;  1EY6 A;  5CV6 A;  3MHB A;  4EQP A;  5HUR A;  2PZT A;  3NHH A;  3SK8 A;  5IIF A;  4R8N A;  3VA5 A;  1STN A;  5M9O A;  1F2Y A;  1JOO A;  1KDB A;  3NK9 A;  4ME5 A;  2F0G A;  4I65 A;  2KHS A;  4QMG A;  1KAB A;  5ISR A;  4K5V A;  5C4H A;  1SND A;  3ERO A;  1A2T A;  3R3O A;  4MIU A;  5KEE A;  4WRD A;  1TR5 A;  2PW5 A;  4KD4 A;  3DMU A;  3BDL A;  4EVO A;  1EY5 A;  1EYD A;  2F0N A;  2HQE A;  2RKS A;  4H7B A;  2RBM A;  1A2U A;  1II3 A;  4NMZ A;  2EYF A;  2F0V A;  4NKL A;  2PW7 A;  3LX0 A;  3OSO A;  3QOJ A;  4NP5 A;  4IAL A;  1EYA A;  4ZUJ A;  2EY5 A;  5I9P A;  5DEH A;  4K8I A;  1SYB A;  2F0E A;  5IGF A;  5J39 A;  3SHL A;  2QDB A;  3DHQ A;  4KHV A;  1ENA A;  3SK5 A;  4QB4 A;  5CR3 A;  5I9O A;  5CV9 A;  5CV8 A;  2F3V A;  5KYL A; 
#chains in the Genus database with same CATH topology
 2EYP A;  3NBH B;  2BA0 A;  3CRL C;  4RKL A;  2LS0 1;  5EAY A;  2CW0 D;  2NVT H;  3HGB A;  2E76 C;  1CHQ D;  1SMY C;  1FGU A;  1FNV A;  3QG1 A;  2MGS A;  1N34 Q;  1U9R A;  4OO1 I;  5M3M H;  1XMO Q;  3K8A A;  4J6H A;  2XVS A;  1SYE A;  1PVO A;  1HNW L;  2Z9H A;  5IP9 H;  4DXF A;  3CCM A;  2QW7 A;  2RA4 A;  3U4V A;  1UAP A;  3L9A X;  2PYK A;  3UDF A;  1V43 A;  2ZT9 C;  3D4W A;  1DM0 B;  3IKJ A;  4OO1 G;  2NVQ B;  1AE3 A;  1CT1 D;  1YHQ A;  2UXD L;  4Y7N H;  1SNQ A;  5ISR A;  4A3E B;  3T1H Q;  3JAM c;  2VY3 A;  3Q23 A;  3V05 A;  2Y0S G;  4DR1 Q;  1PYS B;  1LO5 D;  2D2C C;  5BN5 A;  3J7A 5;  1FYC A;  1X55 A;  3F2C A;  1CHP D;  2O2L D;  4JCV E;  1G29 1;  4A93 H;  2A69 C;  2CFM A;  5A2Q E;  3PUZ A;  1U4M A;  1XMQ Q;  4RG1 A;  1EWH A;  4KI0 A;  3J7A V;  5TSS A;  4OWW B;  4QGU A;  1LT3 D;  5EKK A;  5C5M A;  5K36 G;  4LFB Q;  1QB5 D;  4QCL A;  2KUM A;  3M4O H;  1JQY D;  1TS3 A;  3CW2 C;  1VMC A;  4ZUI A;  3AMU A;  3AFQ A;  4J1M A;  4GOP C;  4R9W A;  3MTS A;  1KQS A;  2HDM A;  4O42 A;  3MHB A;  4ULL A;  5FO7 B;  1SXT A;  4RWS C;  1F2Y A;  4JI2 L;  2UUB L;  4MZ9 A;  2GVB A;  5IYD H;  4A3M G;  1VQC A;  4C3H G;  4M8A A;  1CQV A;  3HOX H;  4EQO A;  4DNI A;  1C48 A;  3HG9 A;  3LX0 A;  4CDE C;  4CKE A;  4K8I A;  1ET9 A;  3BVG A;  3W1B A;  4RGN A;  4GLX A;  1HZC A;  2WII B;  2JEB I;  1HQM C;  3Q22 A;  1HNX L;  1JB3 A;  4RGO S;  4QIW E;  1UNS A;  1WCM H;  1I6H B;  4X64 L;  3C3L A;  2KEC A;  3HOU G;  1K8O A;  5I6Y A;  1C8C A;  4ME3 A;  1CKN B;  1X6O A;  2EXD A;  1MJC A;  1B50 A;  2FJ2 A;  2KCC A;  1ML0 D;  1YJ9 A;  4LWC A;  2RCN A;  1XNR L;  1XPR A;  4RHS A;  4CHT B;  1TS2 A;  3D8G A;  1D8L A;  2I5H A;  3BJU A;  3KLS X;  4JI3 Q;  4DV4 L;  1VQE A;  4UHV A;  3A0J A;  1EOT A;  4GN3 B;  1NMF A;  4OON A;  3T53 B;  5L37 A;  3CME A;  3PF5 A;  1PH7 A;  3S1M B;  5C0X J;  3MFY A;  2I07 B;  3X3M A;  5M3F H;  1STY A;  2E5L Q;  4DN4 M;  4BY1 G;  3MA2 B;  4HIK A;  3PUV A;  1PH5 A;  1A0I A;  3RZO B;  3K7U C;  3KF6 B;  2K33 A;  4DUY L;  1M90 C;  3LNN A;  1I4G A;  4S3S A;  3E9H A;  1GO3 E;  1ZYR D;  2F0K A;  4GS3 A;  1ZKO A;  1IBM Q;  1S72 A;  3I72 A;  4MHE A;  4XIG S;  4YY3 L;  1AP0 A;  4HTH A;  2BE5 C;  2Q8T A;  5M3M G;  3NTH A;  2NUC A;  3QIA A;  3STB D;  1GD7 A;  1I50 H;  3MC0 B;  2MNA A;  2YU9 B;  1XPU A;  5ELC A;  3DWP A;  4U68 A;  2KEE A;  5I6W A;  5COY A;  1WI5 A;  2K52 A;  1RIP A;  3MXN B;  4K14 A;  2R7D A;  1LTB D;  3VA5 A;  1O7Y A;  1S40 A;  3N52 A;  2A6H D;  2LXJ A;  4LFC Q;  4XYQ A;  3S1Q H;  2A19 A;  3R3O A;  3RMH A;  2BDN A;  2CWP A;  3BDL A;  2N49 A;  4QIW B;  4BS9 A;  1J6Q A;  4LUV A;  1T9H A;  4IUQ A;  2K4K A;  4YCU A;  1TWH H;  4A4I A;  4L8J A;  3M85 A;  5EQ0 A;  3I4M H;  4J15 A;  1EYG A;  3UDX A;  2B8G A;  5JVH 3;  1WTW A;  2MP1 A;  1EU4 A;  2WKD A;  3R93 A;  4BBR B;  4QUC A;  4RHR A;  2NVX H;  4XQN A;  4HJ7 A;  1XYI A;  1BF4 A;  4X6A H;  1Y14 B;  4A3K B;  3K0Y A;  5IT9 c;  4A93 G;  2F0O A;  1LTR D;  2PNR C;  4GKK L;  1ICW A;  2KHI A;  1A3V A;  5C3E H;  5E3F A;  1X32 A;  1SMY D;  1FD7 D;  2TSS A;  2B3G A;  4KD3 A;  3OMC A;  4DV7 L;  1CQF A;  4C2M B;  5C4J H;  3GTK B;  2EY2 A;  5C0X H;  4LF4 L;  5IY0 A;  1HQR D;  1K83 B;  2MHV A;  2WV6 D;  4FF1 A;  4NXN Q;  1K3B C;  3M4Q A;  4CDD C;  1R9T H;  1GUT A;  3PO2 H;  5IYD G;  4KN7 C;  4A3J H;  1E2V A;  4RCN A;  3EN2 A;  4EVO A;  3HOX G;  1STB A;  1YBY A;  3H3V H;  1MSG A;  5F2D A;  3M3Y H;  1G2S A;  5LL6 X;  1V8Q A;  3I8Z A;  2JSO A;  2HHH L;  3S14 H;  4KY6 A;  4C56 C;  4QJF A;  4ZYS A;  4DUZ L;  1C9O A;  1L0X B;  2A69 D;  2ENB A;  1TWG B;  1DJR D;  1VMP A;  4POF A;  2L4N A;  3A8J E;  2CH4 W;  3GV6 A;  5H1S E;  1Y1W H;  2XSC A;  1U4R A;  4DR4 Q;  4N8X 1;  4X62 L;  1F2Z A;  4P2C B;  5D3D A;  5J3B A;  3BS1 A;  3S1N H;  4FF4 A;  2JA5 H;  1N32 Q;  1Z47 A;  3X3N A;  4A3I H;  1IKL A;  3PCO B;  1E22 A;  1H9S B;  3MFG A;  3VA7 A;  1BVS A;  1Q90 A;  2A1A A;  2WAQ G;  1VS0 A;  2ZM6 L;  4BXX H;  1WTQ A;  4JK1 C;  2VNU D;  3TDQ A;  4B3R Q;  4FYD A;  2R7Z H;  2E2I B;  1MIU A;  2NN6 H;  3Q8D A;  1KDB A;  2NBF A;  5KNC A;  4ABN A;  2A5H A;  1A2T A;  4KD4 A;  1F9Q A;  5M5X B;  1YIT A;  1G6Z A;  3E0J A;  3HP3 A;  3FPU B;  4NMZ A;  4IUR A;  1EQR A;  1VQH A;  3ULP A;  1WFQ A;  3CCL A;  2JA6 H;  4LF5 Q;  3H0G B;  1SYB A;  3S16 B;  3HOW B;  3G6E A;  3S24 A;  4DA2 A;  4JI1 L;  3U58 A;  4JOI C;  3D31 A;  3RR5 A;  2K5W A;  2FMM A;  1EQV A;  5IGC A;  2G9H D;  1WD0 A;  3S17 B;  4DK6 C;  2A68 C;  4KN4 C;  2O5J C;  1OXV A;  1W6J A;  3PF4 A;  1IW7 C;  1TWH B;  4K8J A;  5IGG A;  1IBK L;  3H94 A;  1TWA H;  1AW7 A;  1EUJ A;  1LAB A;  1TII D;  4L5Q A;  1E3P A;  2EY6 A;  1T5E A;  3PUW A;  4B3M L;  4O0A A;  5CV7 A;  3I56 A;  2LSS A;  3P20 A;  4KJO A;  2PO4 A;  1HUM A;  3NBI A;  1H9J A;  1IHZ A;  1SEB D;  4R4T A;  2SNS A;  3NUC A;  3I4M G;  2KEN A;  4JG2 A;  3CU7 A;  3TQY A;  1PH8 A;  2IT1 A;  1D6E C;  3OIQ A;  1HNZ L;  1QZH A;  1N9W A;  4OEL B;  1MJE A;  2DJG C;  1JOK A;  2JE6 I;  2GA4 B;  3T13 A;  4DF7 A;  4B3T Q;  1BCP B;  5KGU A;  3GTM B;  4DR6 L;  2QA4 A;  1YJW A;  1TY0 A;  5C3E G;  2MO1 A;  4XT3 B;  1CUK A;  3PO2 B;  2L15 A;  1VQA A;  2E8G A;  5CGK A;  3WOE A;  2M9V A;  3HOY H;  2F0T A;  2OWO A;  2HT1 A;  1XX8 A;  2QIL A;  4AYB B;  1EIY B;  3H3V I;  5C0X G;  4FNF A;  1VQB A;  2WB1 B;  1PH4 A;  1MHW C;  2IX3 A;  5CV6 A;  5DLQ E;  5AFW A;  3J7Y W;  4A75 A;  1PH2 A;  4NB3 A;  4R8N A;  1B7Y B;  1STN A;  2CQA A;  4HSP A;  1YZ6 A;  1KAB A;  1BCP F;  2Z4H A;  4GN5 A;  3AB9 A;  4CGY B;  3KF8 A;  1EYD A;  2UUC Q;  2K75 A;  4DV5 Q;  1LAC A;  4R4I A;  2Z6K A;  3RZD H;  4WJ3 M;  4DXG A;  4HAE A;  1JWU D;  1MKH A;  1MSH A;  2N8N A;  4OWT B;  3J80 E;  3GTJ H;  1VQK A;  4GKJ Q;  4F88 A;  3BU2 A;  3FP9 A;  1UE1 A;  1DGS A;  1YNN C;  1WTR A;  2AUJ D;  1TXY A;  1PH6 A;  2UXC L;  1XTC D;  2SOB A;  2Z0S A;  1XJV A;  5FLX c;  3ULJ A;  1EY4 A;  4UP8 A;  3R8B A;  1GOZ A;  5CBE E;  3OTO L;  3FKI B;  2OTL A;  1V1P B;  3NXW A;  4JI5 Q;  2QF7 A;  1B70 B;  4BY7 G;  1J9O A;  3ERS X;  1OXT A;  5CV4 A;  4A3I G;  4LUZ A;  4EQN A;  3SR1 A;  2RVL A;  1SE3 A;  4KLK A;  4BXX G;  4CJ0 B;  2BDO A;  3F2U A;  3J80 i;  2QKI C;  1H9M A;  3NQT A;  2ZXO A;  4PMB A;  1NJI C;  2R7Z G;  3E6Z X;  2NN6 G;  1JE5 A;  5LMN W;  4ZQ3 A;  3WWV A;  1WTX A;  5LMU Q;  4ZCK A;  5IP7 H;  1Z9F A;  1UUP A;  5IGD A;  5AJ3 Q;  2B2V C;  2F0L A;  4FDB A;  4IFD J;  1NUC A;  1PTO B;  1NR2 A;  4IPC A;  4DK3 C;  2JA6 G;  5FK9 C;  3F2B A;  4ODG A;  2RDH A;  4DAY B;  4NXM L;  4Q0F A;  2XIW A;  2CWA A;  4WJ4 A;  1QNU A;  3JAM E;  4FF2 A;  5M5W B;  3PUX A;  1XXG A;  1QJO A;  1WVL A;  3HOZ H;  3P75 A;  4A3G B;  1LTA D;  1SN8 A;  3W3A A;  4EQ5 A;  2AUK A;  4JYA L;  1KNE A;  3GTQ B;  3A8K E;  1BXT A;  1IYU A;  1STE A;  3TZU A;  1PTO F;  1L0Y B;  1XTD A;  2Y0S E;  4QUF A;  4DV0 Q;  2E2J B;  1HZA A;  4HJ9 A;  3HKS A;  2FIN B;  3IFT A;  4OGQ C;  4H0L C;  4OL7 A;  5LL6 S;  5IYB H;  1V1Q A;  3S15 H;  5EPJ A;  5M9O A;  3S2H B;  1Q3L A;  2D62 A;  3KK7 A;  4H13 C;  1CKM A;  3KOJ A;  1CFM A;  1I3Q H;  4FVM A;  3A5U A;  1K0S A;  1N36 Q;  3FDT A;  1Q7Y C;  2AQ2 B;  4TSS A;  1BUV T;  1LTT D;  4DR2 L;  4EGV A;  2HCC A;  3BG3 A;  2B2U C;  2O5I C;  2F0E A;  2N3S A;  2E74 C;  2ID0 A;  3FRP B;  1R4Q B;  4A76 A;  4K0K L;  2M2L A;  2K05 A;  4R1J A;  1NMG A;  1M1K C;  4RGM A;  3ZYY X;  1BDO A;  1Y1V G;  2R3Z A;  1PFM A;  2MFI A;  1HTP A;  2ICE C;  3GQB A;  2L55 A;  2D9U A;  4B3S Q;  4DV6 L;  1BCP C;  2UU9 L;  3GTG B;  1BOS A;  2A68 D;  1VF5 C;  1Q86 C;  1IL8 A;  3CCJ A;  4HMJ A;  2F0I A;  4JI8 L;  2F0S A;  3C1F A;  4UDU C;  4APV A;  2AQ3 B;  3CHB D;  2FFK B;  5JVG 3;  1QVC A;  3I4N G;  1IBL Q;  5ELO A;  4ZAI A;  1LT5 D;  2KED A;  2EJF C;  3E0E A;  4IN3 A;  4IUV A;  4IFD H;  1N33 L;  4V0B A;  5CV5 A;  2I0Q A;  1F2M A;  3IAY A;  1UEA B;  4J8Q A;  2NZH A;  2QEJ C;  1X9N A;  3KFU A;  5IGE A;  1DOK A;  4GOP A;  1R4P B;  1NTG A;  3AU7 A;  2Z6B A;  4H02 A;  4DFA A;  2IX0 A;  3GTP B;  2UUA Q;  1Y69 U;  4POG A;  1I94 Q;  4JI6 Q;  3J81 j;  3OHX C;  2Y0S B;  4Y52 H;  1SR3 A;  3OMG A;  5IT9 L;  2VB2 X;  4QY7 A;  3GTO B;  3TRZ A;  1IYV A;  4IPH A;  2VL6 A;  3RN2 A;  4X66 L;  5JPN C;  1ILQ A;  1GUN A;  4DNR B;  4K5W A;  3UE1 A;  1BBU A;  1JC7 A;  4RH6 A;  2EZV A;  1YJN A;  3VR6 A;  3VYU A;  1NE3 A;  4GNX B;  3PIO A;  4G7H C;  2XWJ B;  3OIP A;  2K5V A;  1SRO A;  1UE5 A;  5E4X A;  3T1Y Q;  1WTO A;  4TVA B;  4C3J G;  2F52 A;  1LLR D;  1PRT B;  4YCW A;  4X3S A;  1MI2 A;  4L5S A;  4EQP A;  4X65 Q;  3NHH A;  1QWY A;  1BR9 A;  2R61 A;  5LMN L;  2NVY H;  3AQQ A;  4C3I H;  1B53 A;  5GQO A;  4K5V A;  3EFX D;  1JJ2 A;  1G8Z D;  1DZ1 A;  1EEF D;  2K32 A;  4IOA A;  3FVQ A;  4PZ7 A;  5IP7 G;  4DR5 L;  1PH1 A;  2L12 A;  3UDI A;  1Q8K A;  4H7B A;  2B2Y A;  3ULL A;  4ZKC B;  4JI7 Q;  4A3M B;  2E2H H;  4C3H B;  4YWL A;  4DV1 Q;  1G91 A;  1PTO C;  1W3S A;  3AFP A;  1FR3 A;  2PPB C;  1PRT F;  4JV5 L;  2ALY B;  1EWI A;  1IXR A;  1YNN D;  4I7A A;  4XXE A;  1XNQ Q;  3UE0 A;  1PH3 A;  5HGQ A;  2R92 H;  2K5H A;  1VQF A;  3HOZ G;  4AIM A;  2MO0 A;  2F4V L;  3HOU B;  1SFO H;  4DV3 L;  3CC4 A;  4YWK A;  3G71 A;  3KJO A;  2VQE L;  2Q2U A;  2ICI A;  1EY0 A;  4NW2 A;  2CCZ A;  3TSS A;  3NBH A;  1Q1E A;  2CH4 A;  5IYB G;  2RSO A;  4MNO A;  3CP0 A;  1N34 L;  2N55 A;  4TRD A;  1XMO L;  3T4A C;  3TBI B;  2VUM H;  3TS0 A;  2F0J A;  3EA6 A;  4JBJ A;  3K6O A;  3ZJY C;  4BY1 B;  2MUY A;  1HR0 W;  3TS2 A;  4OHJ A;  2F1M A;  4HID A;  1VQG A;  3HRZ C;  1JOR A;  4P71 A;  1BO0 A;  1B2T A;  1N8R C;  1B8A A;  1S5F D;  1OTC A;  1WD1 A;  2PQA B;  4JC0 A;  4K6L A;  1S5C D;  2PI2 E;  3T1H L;  3BYT B;  4LFA Q;  4K6D A;  1UE7 A;  1H9K A;  2EXZ A;  4DU9 A;  2NVT B;  3D6W A;  1D5Z C;  3DEP A;  2EQS A;  3OPO A;  1EEI D;  1F9R A;  1I4P A;  4DR1 L;  1D5X C;  1PDQ A;  4XQQ A;  5M3M B;  4KTA A;  2PZU A;  5BR8 Q;  1RKN A;  2OTJ A;  3EBE A;  4R4O A;  1EY7 A;  5JJI A;  1QUQ B;  3DWQ A;  2F0F A;  4B08 A;  1RHP A;  2F4I A;  4AQY Q;  1XMQ L;  5JEA J;  4IFD G;  4OX9 Q;  2B8F A;  3K0X A;  3G4S A;  1PFN A;  4KHZ A;  1UWV A;  4LFB L;  3TN2 A;  2BH2 A;  1FJG Q;  2HUG A;  3CCE A;  2EYF A;  4G7O C;  2VZA A;  4LF8 Q;  5C44 H;  4Y7N B;  2WAQ E;  2LMC B;  1SAP A;  4O2D A;  4PG3 A;  1VQP A;  1C0A A;  1TWF H;  1D1I A;  1HR0 Q;  1A62 A;  2KA7 A;  1KRT A;  4KKS A;  3SVM A;  3PSI A;  4HIM A;  1ROD A;  2JXM B;  4IZ8 A;  2X6G A;  4HSV A;  3EVQ A;  3VR5 A;  1CZW A;  3EJI A;  1AEX A;  1Z7T A;  3CAM A;  5C6A A;  4A93 B;  3D6C A;  5LHY 1;  1HXY D;  2SNM A;  5E7N A;  1U5K A;  3CCS A;  1BCP D;  1MBY A;  1A3T A;  2ZJQ A;  2R6G A;  4A3D H;  4GNX C;  1JWM D;  2XRS D;  2F0Q A;  3RLF A;  1CKN A;  1STG A;  2OF1 A;  3M4O B;  1PRT C;  1B9M A;  2L9H A;  2J0T D;  4C3I G;  3HS0 C;  3J81 E;  5J22 A;  1L1O B;  3Q24 A;  4PMC A;  3A8I E;  1DD2 A;  5IWA Q;  1Q82 C;  2OXP A;  1QVG A;  4CKB A;  4X3K A;  3PO3 H;  3I7F A;  2R93 H;  2OCE A;  2AKW B;  3HOX B;  2JA9 A;  4JI3 L;  3RLO A;  2C5C A;  1EZ8 A;  2KVM A;  4ILW A;  4DR3 Q;  3UDG A;  4O1N A;  1SNO A;  2Q2H A;  4RGT A;  5ELB A;  1VQ4 A;  1QVF A;  4BA1 I;  2R92 G;  5FLX L;  2F0W A;  3CC7 A;  2E5L L;  4P72 A;  1WCM B;  3J81 i;  4XT1 B;  1NY4 A;  3KF6 A;  2DNE A;  3PIP A;  3AEV A;  4JOI A;  4JBW A;  1PYB A;  3NSW A;  1CTM A;  1AN8 A;  5JEA H;  2AQ1 B;  1EWC A;  1GKH A;  1HH2 P;  1E2Z A;  2MPM A;  4FO2 A;  3CKI B;  1IBM L;  1GUW A;  2L11 A;  2ZXR A;  2DJF C;  4M1U B;  1VQJ A;  4RA8 A;  4UY8 C;  2C9O A;  3E3X A;  1F9P A;  1AFP A;  5EJW A;  4JVZ A;  2OQ0 A;  4IOC A;  4FXK C;  5A35 A;  2VUM G;  1J8I A;  5ELE A;  2RBM A;  2PCF B;  1YVC A;  1A2U A;  2PNH A;  2JJQ A;  5M3F B;  4BY7 H;  4LMQ D;  3MXN A;  5I9P A;  2WKC A;  4JPB W;  3SHL A;  1PTO D;  2FMC A;  3N6R A;  1FVI A;  5I9O A;  4X3U A;  4P75 A;  3I70 A;  1U0L A;  4LFC L;  1Q1B A;  4IUU A;  2ZTC A;  1ICF B;  2B39 A;  1YEZ A;  2HDL A;  1SYF A;  3S2D H;  4CJ2 C;  3HOV H;  1J5E Q;  1TT2 A;  1IZ6 A;  2UXB Q;  3CCQ A;  3EIV A;  4P73 A;  2RF4 A;  1WYD A;  1LTL A;  3H91 A;  5KRU A;  1HA5 A;  1I5F A;  1VQO A;  3OWF A;  3SGI A;  2A6E C;  3TP6 A;  3K57 A;  2NTS A;  1HTL D;  1Y8O B;  4IUN A;  1I50 B;  3K59 A;  3P1H A;  2PZW A;  4WOR A;  2F0P A;  1K0R A;  3TEH B;  1KDA A;  1VQ6 A;  4LF9 Q;  5DM7 3;  2IJ0 A;  5NUC A;  5KNB A;  4LF6 Q;  1YNJ C;  4A3F H;  3GV3 A;  3K5L A;  1DOM A;  1EZ6 A;  3S1Q B;  4ZKB B;  3ITP A;  1PV4 A;  5C4X H;  2Q8I B;  5C44 G;  3K7A H;  2JA7 H;  4ALP A;  5M5Y H;  3I4M B;  1X3P A;  4NXN L;  1EQQ A;  3CCV A;  3VYS A;  2C35 B;  2K6A A;  1SBB B;  4JI4 Q;  2NVX B;  1ESR A;  1A3U A;  1KRS A;  1K73 C;  3M4Y A;  4YHH Q;  3O13 A;  5CMD A;  2VQF Q;  4FF3 A;  5EKL A;  1KLG D;  3FMC A;  1L2F A;  1CZG A;  3TP5 A;  3GP7 A;  4DK0 A;  5C3E B;  5C5L A;  4TKO B;  1TWC H;  4A3D G;  2N88 A;  2K01 A;  3R2I A;  2JYO A;  2KCN A;  5C4J B;  1MGS A;  1NCV A;  2RHQ B;  4BBS H;  2CQO A;  5C0X I;  1ESF A;  1Y1V H;  2F0G A;  4JI0 Q;  2H5X A;  3J80 L;  5C4H A;  3ERO A;  4DR4 L;  2PW5 A;  3E9I A;  1Q8I A;  1WOC A;  3NEN A;  3P7J A;  4DV2 Q;  1R9T B;  1N32 L;  1L1O C;  1H9S A;  2HQE A;  2Q2T A;  2ES2 A;  1I4H A;  3UI2 A;  2F0V A;  1QG7 A;  3PO3 G;  2R93 G;  5HY6 A;  4A3J B;  1B3Q A;  2EY5 A;  1O80 A;  5DEH A;  2X69 A;  1Y8N B;  2IW3 A;  4B3R L;  3I4N H;  1H95 A;  1AZQ A;  1UEB A;  1VCI A;  2JA8 H;  1BBW A;  3M3Y B;  1EQT A;  1SDF A;  2B2V A;  4Q5V A;  2HCI A;  2F0H A;  3EQL C;  2KCM A;  5D3I B;  1LYL A;  3S14 B;  3SXH A;  1VQL A;  2EYH A;  3WOF A;  1KIX A;  1AH9 A;  3KBX A;  1PZK D;  4LF5 L;  3GTL H;  5J1Z A;  2EY1 A;  1I4R A;  3C1E A;  4V19 0;  1Y1W B;  5FJ8 G;  5JEA G;  3S1N B;  2PMZ E;  2ASB A;  1AZP A;  1P16 A;  2JA5 B;  4A3I B;  3B6Y A;  2F3W A;  1E0B A;  2K14 A;  2R7F A;  1Y8P B;  4LF7 Q;  5C4Z A;  1PRT D;  2B63 H;  2R7Z B;  2DN8 A;  1JOQ A;  1QE6 A;  2NN6 I;  3KDF B;  3MEF A;  4HCE A;  3D4R A;  4XDX A;  1SLJ A;  1PXU A;  2K5N A;  5JOB A;  1O78 A;  4AYB G;  1KDC A;  1YI2 A;  2KCT A;  4LJZ C;  4B9W A;  3J7Z C;  3CQZ H;  3BZK A;  4C3J H;  3SK6 A;  3S1R H;  1VQ5 A;  1EFI D;  1LT4 D;  2RDF A;  4A3B H;  3OW7 A;  4K5X A;  2JA6 B;  4KHP Q;  3W5O A;  1A8V A;  1DCZ A;  1LM0 A;  1KC8 C;  1W6K A;  3G6J B;  3CPF A;  4N8F A;  3MXG A;  3T51 B;  1GUG A;  3SK4 A;  1G6P A;  2L1B A;  3HOV G;  4RCO A;  3QB3 A;  3CXC A;  1KL9 A;  3I3C A;  5EGT A;  4DR7 Q;  5D65 A;  1B9N A;  2ATW A;  2B2T A;  4N9T A;  2KJX A;  1XPO A;  5KND A;  1C4Q A;  1SNP A;  3QO2 A;  4PV1 C;  4B3T L;  3J7A F;  1H9R A;  1TWA B;  2SDF A;  2NVQ H;  3L0O A;  4A3E H;  2K1B A;  1MD2 D;  1O7Z A;  4JBM A;  4A3F G;  3HFZ B;  1B1Z A;  3PGZ A;  3NPP A;  5EBD A;  1K8M A;  2IPK D;  1VQ7 A;  5JJZ A;  4A3C H;  5D14 A;  5C4X G;  1U4P A;  4HIO A;  1E1O A;  1GHJ A;  3KBG A;  2JA7 G;  4YWM A;  1TKW B;  1HNW Q;  1ET6 A;  5CR3 A;  5CV9 A;  2L0C A;  5ELD A;  4QL5 A;  1EIF A;  2ZTD A;  3D4D A;  2PMZ B;  3PIP 3;  1JB7 A;  3JAM i;  3L3O C;  1FL0 A;  1W2B A;  3DXJ C;  2UUC L;  5G3L F;  1YNX A;  4DV5 L;  3HKZ G;  1X3Q A;  5I4D A;  1YHB A;  1LT6 D;  2EVB A;  1SYC A;  2HIX A;  3IL8 A;  1AE2 A;  4GKJ L;  2UXD Q;  1S3O A;  4R8I A;  1TQO A;  1SYD A;  3SE0 A;  2RSN A;  2B2W C;  2WIN B;  2A6E D;  1E2W A;  5CYU A;  1M4V A;  3HOY B;  3K58 A;  4LK1 C;  4BBS G;  4H44 C;  1HRJ A;  1SNC A;  2YTV A;  3CF5 A;  1V1P A;  4CKC A;  1S5D D;  1VQD A;  4JI5 L;  1M8A A;  1SNM A;  1YNJ D;  2EPB A;  1QNK A;  1GHK A;  2BA1 A;  3I4O A;  4TQU S;  3QOL A;  2I5L X;  1KHI A;  2DUD A;  4MTK A;  1I6H H;  3KUP A;  3OYY A;  3RZD B;  4CDC C;  2JA8 G;  2LKV A;  3GTJ B;  1VQN A;  3VR2 A;  3H3V C;  1I4X A;  3DEO A;  5LMU L;  2YTY A;  3DWA A;  5IOD A;  5JJK A;  1PFB A;  4BWG B;  2EJM A;  3TP8 A;  5AJ3 L;  4RMF A;  1G51 A;  4OIK A;  1F77 A;  3FHW A;  4JI2 Q;  3J80 c;  2UUB Q;  4PNY A;  2K04 A;  4DAY A;  3A7A B;  4XQJ A;  4QQB X;  5A2Q L;  3E5S A;  4HN7 A;  4KJN A;  2QDL A;  3Q6S A;  5CBA E;  1KAW A;  3S1M H;  1EIH A;  1LUZ A;  4G4K A;  4EX5 A;  5HUR A;  3M7N A;  3KLR A;  4L5R C;  3R2T A;  1B44 D;  1HNX Q;  1Q81 C;  1ASY A;  1RL2 A;  1PMR A;  1JOO A;  1BBX C;  2B63 G;  2J4X A;  2QCP X;  3GDE A;  5COR A;  3RD4 A;  4X64 Q;  1EFW A;  3K80 C;  1JIC A;  4DV0 L;  4C1N K;  3RZO H;  4IAL A;  4PZ8 A;  2GN5 A;  5J39 A;  4A3B G;  3VDY A;  1XNR Q;  1ENA A;  3VYT A;  4BA2 I;  1KLU D;  1EIG A;  2Z1C A;  4DV4 Q;  3D0F A;  2EYJ A;  4L5T A;  4F87 A;  1PH9 A;  1N36 L;  3NE5 B;  1STA A;  1GM5 A;  1A15 A;  5HGT A;  2ZTE A;  2Z4I A;  3HOZ B;  3A5Z B;  5K5P A;  3S9W A;  2YU9 H;  4KV6 A;  4HED A;  4KKT A;  2A8V A;  5FO8 B;  2VB3 X;  4UP9 A;  4IPD A;  1U4L A;  4PMW A;  3ND8 A;  3HEJ A;  3C46 A;  2LFN A;  3W2D A;  4DUY Q;  1CI3 M;  3G48 A;  2HIV A;  4B3S L;  1K3R A;  3ICE A;  1B3A A;  1JJG A;  2F0U A;  3S15 B;  4A3E G;  4U67 3;  3NQI A;  3FPP A;  1V1O A;  4K2L A;  4YY3 Q;  3MEH A;  5IT9 E;  4HJA A;  1I3Q B;  1IBL L;  1K9M C;  4BBR H;  4A3C G;  4KY7 A;  2MQH A;  3RLN A;  4RAU C;  1EY8 A;  2YTX A;  4A3K H;  4OWX B;  4Z9C B;  5BN3 A;  1K8G A;  2AWN A;  4ZK9 B;  2EYM A;  3K5M A;  4LUO A;  4OXP A;  2TMP A;  2ZJR A;  5BN4 A;  2V4D A;  3RNU A;  3CCU A;  3DM3 A;  5IOC A;  1E7Z A;  4C2M H;  2UUA L;  3PV0 A;  3T56 B;  2DY7 A;  2V1C C;  3GTK H;  1I94 L;  4JI6 L;  1K83 H;  1EYC A;  2YV5 A;  4GN4 B;  1NSN S;  2YYZ A;  3MAQ A;  2B29 A;  3CC2 A;  2JN4 A;  1C7Y A;  5ELN A;  3SK8 A;  1X54 A;  5IIF A;  4NPS A;  4DK1 A;  2XRQ D;  4CDF C;  2CHB D;  3OWE B;  4GNX A;  2CVR A;  1KXL A;  4A3L H;  3KJP A;  2G9D A;  4IFD I;  4GKK Q;  3NWT A;  3MWY W;  3L2P A;  4KKU A;  3G7L A;  3DLL A;  3T1Y L;  2BH8 A;  3DUZ A;  2K5D A;  4ZUJ A;  3VYR A;  1CM9 A;  2XNA C;  4DV7 Q;  4KK7 A;  4R4C A;  1NR4 A;  4IO9 A;  2OQK A;  4X65 L;  3BVM A;  3KLS A;  3DHQ A;  1HCZ A;  2B2Y C;  1TWG H;  5DNF A;  2F3V A;  1RTN A;  4LF4 Q;  5KYL A;  1X65 A;  1STH A;  5GAG C;  3TP7 A;  1XWE A;  1DXM A;  3QR8 A;  1HFN A;  4JI7 L;  1JWS D;  1JMC A;  4QF4 A;  4CJ1 B;  4DV1 L;  3I73 A;  2N78 A;  4HJ5 A;  1X3E A;  1TS5 A;  3ERQ A;  3J81 L;  2EJG C;  4N9P A;  2Q2I A;  3M4P A;  1TU2 B;  2E2I H;  1XNQ L;  3H09 A;  3A54 A;  1SMX A;  2EYO A;  5M5X H;  2HHH Q;  3A55 A;  1SE4 A;  2JP1 A;  5IE8 A;  1QOH A;  2X6L A;  3GO5 A;  2A74 C;  4IUT A;  4C1N I;  4DUZ Q;  1BKB A;  2NWG A;  2NVY B;  4C3I B;  1LTG D;  5JAV A;  5I2Y A;  3H0G H;  1JR0 D;  3S16 H;  5E4W C;  3GD7 A;  1OO9 B;  5DAU A;  3HOW H;  4X62 Q;  1V9P A;  2HD3 A;  4F8M A;  5IP9 G;  1NNX A;  1Z6H A;  2E2H B;  3NEM A;  4I7Z C;  1KNA A;  2E75 C;  5EBC A;  4B9X A;  2E2D C;  3T16 A;  3CRK C;  4OEM B;  2ZM6 Q;  3S17 H;  3D3R A;  4L63 B;  5JPM C;  2RHS B;  1OXX K;  2KOL A;  3IFD A;  4ID6 A;  2R92 B;  1RCV D;  5E1F A;  3DM1 A;  4ZRZ A;  3KLW A;  1ASZ A;  5ELF A;  1GUS A;  1LTI D;  1SFO B;  3NWS A;  4NDX A;  4F7X A;  1CSQ A;  5FO9 B;  1D1K A;  1DYQ A;  2K28 A;  2D0P A;  4DNT B;  1S4Z A;  1RTO A;  1S5B D;  2PQA A;  3PUY A;  1HA6 A;  1PZI D;  1NAP A;  5T1G A;  4ME5 A;  3BZC A;  4IJL A;  4LFA L;  4JI1 Q;  3TZD A;  4MIU A;  1HUN A;  2G5D A;  4WRD A;  1IL2 A;  3V96 A;  2P5Z X;  3U50 C;  3MXU A;  5BR8 L;  4NKL A;  4NP5 A;  1SE2 A;  2VUM B;  4BBR G;  1QUQ A;  5FJ8 H;  1RF2 D;  1ENF A;  3M7G A;  4OIJ A;  3OW2 A;  4A3K G;  2DY8 A;  4AQY L;  3GTM H;  1A6X A;  5CV8 A;  1IBK Q;  4GLV B;  4OX9 L;  1X3G A;  2K5Q A;  2NZO A;  1TVX A;  2WAQ B;  4IPG A;  4DAM A;  3I4L A;  1PHJ A;  1FJG L;  4B3M Q;  4P74 A;  4LF8 L;  1D7Q A;  1KAA A;  3OOC A;  4DAP A;  1D2B A;  2AMC B;  1T5X D;  1HR0 L;  4PQX A;  1CA5 A;  4L6T B;  1JJC B;  2F0M A;  2H1E A;  1O7I A;  3MVV A;  1WCM G;  1GJX A;  1HNZ Q;  1TS4 A;  5FLM H;  3PIO 3;  3F1Z A;  2ZJP A;  1ONL A;  4A3L G;  4X3T A;  2I5M X;  4DR6 Q;  2M00 A;  2WAC A;  3A7L A;  5G3L D;  4JBK A;  3NP8 A;  4AH6 A;  2XTI A;  3I91 A;  2LXK A;  3WDN A;  5FLX E;  2NB0 A;  3ONA B;  4HJ8 A;  1RDP D;  1YHA A;  1CK1 A;  3V2T A;  2F3I A;  1L1O A;  5C44 B;  1IYJ B;  3SDZ A;  4HMI A;  3FKI H;  1TWF B;  3I55 A;  2I46 A;  5IWA L;  2EE1 A;  3RN5 A;  5M3F G;  3NTI A;  3I2Z A;  1E1T A;  2PI2 A;  5EKI A;  2CKZ B;  4G7Z C;  3TRE A;  4AYB E;  1OXS C;  2WB1 E;  2RCF A;  3AYH B;  5C3X A;  5IYC H;  2KBN A;  1X56 A;  1F9S A;  5GAH C;  4PZ6 A;  3KF8 B;  1KD1 C;  4DR3 L;  1YIJ A;  3L7Z C;  1TY2 A;  4LAA A;  3H6M A;  2EYL A;  3VR4 A;  4A3D B;  3A74 A;  1WJJ A;  2L5T A;  2PZT A;  3QJY A;  1LV9 A;  4ZLT F;  5I2X A;  3NTK A;  4I65 A;  4QMG A;  1S5E D;  1HZB A;  2UXC Q;  3LWE A;  1E24 A;  1PTO H;  4IJH A;  5GRO A;  3JC6 6;  1JCK B;  3H0G G;  3OTO Q;  1SE8 A;  1II3 A;  3HOW G;  1EYA A;  3J81 c;  2AHO B;  5IGF A;  3PO3 B;  2R93 B;  4KHV A;  5M5W H;  2Z8L A;  4A3G H;  1HZ9 A;  3TME A;  2K50 A;  2IX1 A;  3LGJ A;  4UAI A;  2CW0 C;  1A63 A;  2OT2 A;  3GTQ H;  2XN9 C;  2DGY A;  2J7Z A;  2PQE A;  1PFS A;  2H4O A;  1SSO A;  4RKB A;  3Q0A A;  2E2J H;  1B4O A;  3PMF A;  2K7V A;  4MN3 A;  1D5M C;  3MXP A;  1LTS D;  4XYO A;  3IRB A;  4RFB A;  1WTV A;  2IL8 A;  4FP5 D;  3S2H H;  4NXM Q;  2NZ1 D;  1VF7 A;  1Q46 A;  3LWU A;  1J5E L;  1F2L A;  1GUO A;  2UXB L;  1QCB D;  4LW1 A;  3HKZ E;  4LNQ A;  5EPL A;  3CD6 A;  2QGQ A;  3ND9 A;  2BE5 D;  3SEB A;  4WJW A;  4JYA Q;  4DPG A;  3U9S A;  2VW9 A;  3U9O A;  2VS1 A;  1O7L A;  4G57 A;  3K5O A;  3A56 A;  4BY7 B;  1K28 A;  3NEL A;  1Q12 A;  5T1I A;  2HQL A;  2BCO A;  1RD9 D;  2RDG A;  1NBW A;  5KIX A;  4HCS A;  4LF9 L;  4LF6 L;  2IHF A;  3MZ5 A;  1VQI A;  3PO2 G;  2F03 A;  3GTG H;  1FNU A;  1P8L A;  2JEA I;  4A3J G;  2WFW A;  3JAM L;  3S2D B;  3HOV B;  2WB1 G;  4E6I A;  3CCR A;  2IHE A;  4DR2 Q;  3H15 A;  1SJH D;  3RUZ A;  1JT8 A;  4JI4 L;  1IKM A;  2K03 A;  2BOS A;  4K0K Q;  2AWO A;  2NTT A;  4UPA A;  4YHH L;  2VQF L;  1BNZ A;  5FLM G;  1KTK A;  4OO1 H;  5KEE A;  2B2U A;  1TR5 A;  4R4Q A;  3GTP H;  2B2W A;  1Y1W G;  1PA6 A;  1VQM A;  1EY5 A;  2RQX A;  2VXW A;  2IWH A;  4DV6 Q;  2JA5 G;  2D5D A;  2PW7 A;  3OSO A;  3QOJ A;  4A3F B;  2UU9 Q;  1SJE D;  1CSP A;  1VDZ A;  2JQO A;  4JI8 Q;  4HR7 B;  3GTO H;  2EOT A;  2QDB A;  3U4Z A;  3SK5 A;  2QEX A;  1HJP A;  5C4X B;  1UE6 A;  1CA6 A;  4UP7 A;  4JI0 L;  3K7A B;  5DM6 3;  2JA7 B;  3FKI G;  4DKA C;  2MJ8 A;  5CC4 A;  1WTH A;  5M5Y B;  2GVA A;  4DV2 L;  2A73 B;  2KHJ A;  1GVP A;  1ILP A;  4CBV A;  1PLF A;  3PQI A;  1N33 Q;  1ZEQ X;  1PZJ D;  1QIL A;  5IYC G;  1GXD C;  2Q8R E;  2KQ3 A;  4XTC S;  5C3W A;  3HKZ B;  1VQ8 A;  5K36 H;  1PYW D;  1WTP A;  2LY7 A;  4GOP B;  3K81 C;  3BZD B;  2EIF A;  3BDC A;  2F0D A;  2OEO A;  4WFN 3;  1EY9 A;  1TWC B;  4IQZ A;  3I90 A;  4DGZ A;  1SYG A;  1RJT A;  2NYZ D;  2XWB B;  2Z6K C;  5GAD C;  3M9B A;  1X3F A;  4BBS B;  1DON A;  4KY5 A;  2D0O A;  4A3M H;  1BQQ T;  1L0W A;  4C3H H;  4X66 Q;  1Y1V B;  3C2P A;  3BDO A;  3FEW X;  2FHT A;  3HZX A;  1HFG A;  2EDG A;  3BYY B;  5KYI A;  2XGT A;  1VQ9 A;  3CPW A;  1ENC A;  4LF7 L;  3BVZ A;  1ZYR C;  2JK8 A;  2IY5 B;  3URY A;  3I4N B;  3KDF A;  4A3G G;  3HOU H;  2SEB D;  2JA8 B;  3QWN A;  1FGB D;  5LMN Q;  3F2D A;  4GZY C;  1I4Q A;  5JJL A;  1DOL A;  4DR5 Q;  2O4X A;  4JW0 A;  1G2T A;  3STB C;  3GTL B;  4KMU C;  4KHP L;  1HHV A;  2ZXP A;  4K2K A;  3K5N A;  1EU3 A;  3ER0 A;  5IGB A;  4YIJ A;  2WP8 J;  4FXG C;  4GLA C;  1EY6 A;  5FKA C;  1CKO A;  1FNW A;  4JV5 Q;  3F8T A;  2A6H C;  3W1G A;  4DAV A;  3NK9 A;  5EPK A;  1ZXT A;  2B2T C;  2KHS A;  4MTN A;  1K8A C;  1EOV A;  1SND A;  1HPC A;  4FXD A;  3DMU A;  4YCV A;  2B63 B;  1JE4 A;  4BY1 H;  2F0N A;  2RKS A;  1QZG A;  2F4V Q;  1I6V C;  2DNC A;  4IUP A;  4DR7 L;  3VR3 A;  5FOB B;  4DV3 Q;  1EL0 A;  3KYH C;  2VQE Q;  3HOY G;  3CMA A;  1IW7 D;  1SRU A;  1OXU A;  4QB4 A;  5GAE C;  3CQZ B;  2FXQ A;  4C3J B;  3S1R B;  4A3B B; 
#chains in the Genus database with same CATH homology
 2EYP A;  2BA0 A;  3CRL C;  4RKL A;  2LS0 1;  2CW0 D;  3HGB A;  2E76 C;  1CHQ D;  1SMY C;  3QG1 A;  1FNV A;  2MGS A;  1U9R A;  4OO1 I;  4J6H A;  2XVS A;  1SYE A;  4DXF A;  2RA4 A;  1UAP A;  3L9A X;  2PYK A;  1V43 A;  2ZT9 C;  3D4W A;  1DM0 B;  3IKJ A;  4OO1 G;  2NVQ B;  1CT1 D;  1SNQ A;  5ISR A;  4A3E B;  3Q23 A;  3V05 A;  1LO5 D;  2D2C C;  5BN5 A;  1FYC A;  1CHP D;  2O2L D;  1G29 1;  2A69 C;  5A2Q E;  3PUZ A;  1U4M A;  1EWH A;  4KI0 A;  3J7A V;  5TSS A;  1LT3 D;  5EKK A;  5C5M A;  5K36 G;  1QB5 D;  4QCL A;  2KUM A;  1JQY D;  1TS3 A;  1VMC A;  4ZUI A;  3AMU A;  4J1M A;  4R9W A;  3MTS A;  2HDM A;  4O42 A;  3MHB A;  4ULL A;  5FO7 B;  1SXT A;  4RWS C;  1F2Y A;  4C3H G;  4M8A A;  1CQV A;  4EQO A;  1C48 A;  3HG9 A;  3LX0 A;  4CKE A;  4K8I A;  1ET9 A;  3BVG A;  4RGN A;  2WII B;  2JEB I;  1HQM C;  3Q22 A;  1JB3 A;  4RGO S;  1UNS A;  1I6H B;  3C3L A;  2KEC A;  1K8O A;  5I6Y A;  1C8C A;  1B50 A;  2FJ2 A;  2KCC A;  1ML0 D;  4RHS A;  4CHT B;  1TS2 A;  3D8G A;  3KLS X;  1EOT A;  3T53 B;  3S1M B;  5C0X J;  3MFY A;  2I07 B;  3X3M A;  1STY A;  4DN4 M;  3MA2 B;  3PUV A;  3RZO B;  2K33 A;  3LNN A;  1I4G A;  4S3S A;  2F0K A;  1ZYR D;  1ZKO A;  3I72 A;  4MHE A;  4XIG S;  1AP0 A;  4HTH A;  2BE5 C;  2Q8T A;  3NTH A;  2NUC A;  3QIA A;  3MC0 B;  2YU9 B;  5ELC A;  3DWP A;  4U68 A;  2KEE A;  5I6W A;  5COY A;  4K14 A;  1LTB D;  3VA5 A;  1O7Y A;  3N52 A;  2A6H D;  4XYQ A;  3RMH A;  3R3O A;  2BDN A;  3BDL A;  4QIW B;  4BS9 A;  4IUQ A;  4L8J A;  3M85 A;  5EQ0 A;  2B8G A;  5JVH 3;  1WTW A;  2MP1 A;  1EU4 A;  2WKD A;  3R93 A;  4BBR B;  4QUC A;  4RHR A;  4XQN A;  1XYI A;  1BF4 A;  4A3K B;  3K0Y A;  2F0O A;  1LTR D;  2PNR C;  1ICW A;  1A3V A;  5E3F A;  1X32 A;  1SMY D;  1FD7 D;  2TSS A;  4KD3 A;  3OMC A;  1CQF A;  4C2M B;  3GTK B;  2EY2 A;  5C0X H;  1HQR D;  1K83 B;  2MHV A;  2WV6 D;  4FF1 A;  1GUT A;  4KN7 C;  1E2V A;  4RCN A;  4EVO A;  1STB A;  1MSG A;  5F2D A;  1G2S A;  5LL6 X;  1V8Q A;  3I8Z A;  2JSO A;  4KY6 A;  4C56 C;  4ZYS A;  1L0X B;  2A69 D;  2ENB A;  1TWG B;  1DJR D;  1VMP A;  2L4N A;  3A8J E;  3GV6 A;  2XSC A;  1U4R A;  1F2Z A;  4P2C B;  5D3D A;  3BS1 A;  4FF4 A;  1Z47 A;  3X3N A;  1IKL A;  1H9S B;  3MFG A;  3VA7 A;  1Q90 A;  1WTQ A;  4JK1 C;  2VNU D;  3TDQ A;  4FYD A;  2E2I B;  2NN6 H;  1KDB A;  2NBF A;  5KNC A;  4ABN A;  2A5H A;  1A2T A;  4KD4 A;  1F9Q A;  5M5X B;  1G6Z A;  3E0J A;  3HP3 A;  3FPU B;  4NMZ A;  4IUR A;  3H0G B;  1SYB A;  3S16 B;  3HOW B;  4DA2 A;  3D31 A;  2K5W A;  2FMM A;  1EQV A;  5IGC A;  2G9H D;  1WD0 A;  3S17 B;  2A68 C;  4KN4 C;  2O5J C;  1OXV A;  1W6J A;  1IW7 C;  1TWH B;  4K8J A;  5IGG A;  3H94 A;  1AW7 A;  1LAB A;  1TII D;  2EY6 A;  1T5E A;  3PUW A;  5CV7 A;  3P20 A;  4KJO A;  2PO4 A;  1HUM A;  3NBI A;  1H9J A;  1IHZ A;  1SEB D;  2SNS A;  3NUC A;  3CU7 A;  2IT1 A;  1D6E C;  3OIQ A;  1JOK A;  2JE6 I;  2GA4 B;  3T13 A;  4DF7 A;  1BCP B;  5KGU A;  3GTM B;  1TY0 A;  4XT3 B;  3PO2 B;  5CGK A;  3WOE A;  2M9V A;  2F0T A;  1XX8 A;  2QIL A;  4AYB B;  5C0X G;  4FNF A;  2WB1 B;  2IX3 A;  5CV6 A;  5AFW A;  3J7Y W;  4R8N A;  1STN A;  2CQA A;  4HSP A;  1KAB A;  1BCP F;  2Z4H A;  3AB9 A;  4CGY B;  3KF8 A;  1EYD A;  1LAC A;  4DXG A;  4HAE A;  1JWU D;  1MSH A;  3J80 E;  4F88 A;  1YNN C;  1WTR A;  2AUJ D;  1XTC D;  2SOB A;  1EY4 A;  3R8B A;  5CBE E;  1GOZ A;  3FKI B;  1V1P B;  3NXW A;  2QF7 A;  1J9O A;  5CV4 A;  1OXT A;  4EQN A;  3SR1 A;  2RVL A;  1SE3 A;  4CJ0 B;  2BDO A;  3F2U A;  2QKI C;  1H9M A;  3NQT A;  2ZXO A;  4PMB A;  3E6Z X;  2NN6 G;  4ZQ3 A;  1WTX A;  1UUP A;  5IGD A;  2B2V C;  2F0L A;  4IFD J;  1NUC A;  1PTO B;  1NR2 A;  5FK9 C;  4ODG A;  2RDH A;  4Q0F A;  2XIW A;  1QNU A;  3JAM E;  4FF2 A;  5M5W B;  3PUX A;  1XXG A;  1QJO A;  1WVL A;  3P75 A;  4A3G B;  1LTA D;  3W3A A;  2AUK A;  1KNE A;  3GTQ B;  3A8K E;  1BXT A;  1IYU A;  1STE A;  3TZU A;  1PTO F;  1L0Y B;  4QUF A;  2E2J B;  2FIN B;  3IFT A;  4OGQ C;  4H0L C;  4OL7 A;  5LL6 S;  5EPJ A;  5M9O A;  3S2H B;  1Q3L A;  2D62 A;  3KK7 A;  4H13 C;  1CFM A;  4FVM A;  3FDT A;  2AQ2 B;  4TSS A;  1BUV T;  1LTT D;  4EGV A;  2HCC A;  3BG3 A;  2B2U C;  2O5I C;  2F0E A;  2E74 C;  2ID0 A;  3FRP B;  1R4Q B;  2M2L A;  2K05 A;  4RGM A;  3ZYY X;  1BDO A;  2R3Z A;  1PFM A;  1HTP A;  2ICE C;  3GQB A;  2L55 A;  2D9U A;  1BCP C;  3GTG B;  1BOS A;  2A68 D;  1VF5 C;  1IL8 A;  4HMJ A;  2F0I A;  2F0S A;  3C1F A;  4UDU C;  2AQ3 B;  3CHB D;  2FFK B;  5JVG 3;  4ZAI A;  1LT5 D;  2KED A;  2EJF C;  4IN3 A;  4IUV A;  4IFD H;  4V0B A;  5CV5 A;  1F2M A;  3IAY A;  1UEA B;  4J8Q A;  2QEJ C;  5IGE A;  1DOK A;  1R4P B;  3AU7 A;  4DFA A;  2IX0 A;  3GTP B;  1Y69 U;  3OHX C;  2Y0S B;  3OMG A;  5IT9 L;  2VB2 X;  3GTO B;  1IYV A;  5JPN C;  1ILQ A;  1GUN A;  4DNR B;  4K5W A;  1JC7 A;  4RH6 A;  2EZV A;  3VR6 A;  3VYU A;  4G7H C;  2XWJ B;  3OIP A;  5E4X A;  1WTO A;  4C3J G;  1LLR D;  1PRT B;  4X3S A;  1MI2 A;  4EQP A;  1QWY A;  1BR9 A;  2R61 A;  3NHH A;  1B53 A;  4K5V A;  3EFX D;  1G8Z D;  1DZ1 A;  1EEF D;  2K32 A;  3FVQ A;  2L12 A;  4H7B A;  2B2Y A;  4ZKC B;  4A3M B;  4C3H B;  1G91 A;  1PTO C;  1FR3 A;  2PPB C;  1PRT F;  1YNN D;  4XXE A;  3HOU B;  2ICI A;  1EY0 A;  4NW2 A;  3TSS A;  3NBH A;  1Q1E A;  2RSO A;  2N55 A;  4TRD A;  3T4A C;  3TBI B;  2F0J A;  3EA6 A;  3K6O A;  4BY1 B;  2MUY A;  4OHJ A;  2F1M A;  3HRZ C;  1JOR A;  1BO0 A;  1B2T A;  1S5F D;  1WD1 A;  4K6L A;  1S5C D;  3BYT B;  4K6D A;  1H9K A;  2EXZ A;  4DU9 A;  2NVT B;  3D6W A;  1D5Z C;  3DEP A;  3OPO A;  1EEI D;  1F9R A;  1I4P A;  1D5X C;  1PDQ A;  4XQQ A;  5M3M B;  4KTA A;  2PZU A;  1RKN A;  1EY7 A;  3DWQ A;  2F0F A;  4B08 A;  1RHP A;  2F4I A;  5JEA J;  4IFD G;  2B8F A;  1PFN A;  4KHZ A;  3TN2 A;  2HUG A;  2EYF A;  4G7O C;  4Y7N B;  2LMC B;  1SAP A;  1D1I A;  2KA7 A;  4KKS A;  3SVM A;  1ROD A;  2JXM B;  4IZ8 A;  2X6G A;  4HSV A;  3EVQ A;  3VR5 A;  1CZW A;  3EJI A;  1AEX A;  1Z7T A;  5C6A A;  4A93 B;  3D6C A;  5LHY 1;  1HXY D;  2SNM A;  1BCP D;  1MBY A;  1A3T A;  2R6G A;  1JWM D;  2XRS D;  3RLF A;  2F0Q A;  1STG A;  2OF1 A;  3M4O B;  1PRT C;  1B9M A;  2L9H A;  2J0T D;  4C3I G;  3HS0 C;  3J81 E;  5J22 A;  3Q24 A;  4PMC A;  3A8I E;  1DD2 A;  2OXP A;  4CKB A;  4X3K A;  3HOX B;  2C5C A;  1EZ8 A;  2KVM A;  4ILW A;  4O1N A;  1SNO A;  4RGT A;  5ELB A;  4BA1 I;  5FLX L;  2F0W A;  1WCM B;  4XT1 B;  2DNE A;  4JBW A;  3NSW A;  1CTM A;  1AN8 A;  5JEA H;  2AQ1 B;  1EWC A;  1E2Z A;  2MPM A;  4FO2 A;  3CKI B;  1GUW A;  2L11 A;  2ZXR A;  4M1U B;  4RA8 A;  2C9O A;  1F9P A;  1AFP A;  5EJW A;  4FXK C;  5A35 A;  1J8I A;  5ELE A;  2RBM A;  2PCF B;  1A2U A;  5M3F B;  4LMQ D;  3MXN A;  5I9P A;  2WKC A;  3SHL A;  1PTO D;  2FMC A;  3N6R A;  5I9O A;  4X3U A;  3I70 A;  1Q1B A;  4IUU A;  2B39 A;  2HDL A;  1SYF A;  4CJ2 C;  1TT2 A;  3H91 A;  5KRU A;  1HA5 A;  3OWF A;  2A6E C;  3TP6 A;  3K57 A;  2NTS A;  1HTL D;  1Y8O B;  4IUN A;  1I50 B;  3K59 A;  3P1H A;  2PZW A;  4WOR A;  2F0P A;  1KDA A;  5DM7 3;  2IJ0 A;  5NUC A;  5KNB A;  1YNJ C;  3GV3 A;  3K5L A;  1DOM A;  1EZ6 A;  3S1Q B;  4ZKB B;  3ITP A;  2Q8I B;  3I4M B;  1X3P A;  3VYS A;  2K6A A;  1SBB B;  2NVX B;  1ESR A;  1A3U A;  3M4Y A;  3O13 A;  5CMD A;  4FF3 A;  5EKL A;  1KLG D;  3FMC A;  1CZG A;  3TP5 A;  3GP7 A;  4DK0 A;  5C3E B;  5C5L A;  4TKO B;  2N88 A;  2K01 A;  3R2I A;  2JYO A;  2KCN A;  5C4J B;  1MGS A;  1NCV A;  5C0X I;  1ESF A;  2F0G A;  3J80 L;  5C4H A;  3ERO A;  2PW5 A;  1Q8I A;  3P7J A;  1R9T B;  1H9S A;  2HQE A;  1I4H A;  3UI2 A;  2F0V A;  1QG7 A;  4A3J B;  2EY5 A;  1O80 A;  5DEH A;  2X69 A;  1Y8N B;  2IW3 A;  1AZQ A;  1VCI A;  3M3Y B;  1EQT A;  1SDF A;  2B2V A;  4Q5V A;  2HCI A;  2F0H A;  3EQL C;  5D3I B;  3S14 B;  3SXH A;  2EYH A;  3WOF A;  3KBX A;  1PZK D;  5J1Z A;  2EY1 A;  1I4R A;  3C1E A;  4V19 0;  1Y1W B;  5JEA G;  3S1N B;  1AZP A;  2JA5 B;  4A3I B;  2F3W A;  1E0B A;  1Y8P B;  5C4Z A;  1PRT D;  2R7Z B;  2DN8 A;  1JOQ A;  1QE6 A;  2NN6 I;  4HCE A;  3D4R A;  4XDX A;  1PXU A;  5JOB A;  1O78 A;  1KDC A;  4LJZ C;  4B9W A;  3SK6 A;  1EFI D;  1LT4 D;  2RDF A;  3OW7 A;  4K5X A;  2JA6 B;  1DCZ A;  1W6K A;  3G6J B;  3MXG A;  3T51 B;  1GUG A;  3SK4 A;  2L1B A;  4RCO A;  3QB3 A;  3I3C A;  5EGT A;  5D65 A;  1B9N A;  2B2T A;  4N9T A;  2KJX A;  5KND A;  1C4Q A;  1SNP A;  3QO2 A;  4PV1 C;  3J7A F;  1H9R A;  1TWA B;  2SDF A;  2K1B A;  1MD2 D;  1O7Z A;  1B1Z A;  3NPP A;  5EBD A;  1K8M A;  2IPK D;  5JJZ A;  5D14 A;  1U4P A;  1GHJ A;  3KBG A;  1TKW B;  1ET6 A;  5CR3 A;  5CV9 A;  2L0C A;  5ELD A;  3D4D A;  2PMZ B;  3PIP 3;  3L3O C;  3DXJ C;  5G3L F;  1X3Q A;  5I4D A;  1LT6 D;  2EVB A;  1SYC A;  3IL8 A;  4R8I A;  1TQO A;  1SYD A;  3SE0 A;  2RSN A;  2B2W C;  2WIN B;  2A6E D;  1E2W A;  5CYU A;  1M4V A;  3HOY B;  3K58 A;  4LK1 C;  4H44 C;  1HRJ A;  1SNC A;  1V1P A;  4CKC A;  1S5D D;  1M8A A;  1SNM A;  1YNJ D;  2EPB A;  1QNK A;  1GHK A;  2BA1 A;  4TQU S;  3QOL A;  3KUP A;  3RZD B;  2LKV A;  3GTJ B;  3VR2 A;  3H3V C;  1I4X A;  3DEO A;  3DWA A;  5IOD A;  1PFB A;  4BWG B;  2EJM A;  3TP8 A;  4OIK A;  1F77 A;  4PNY A;  4DAY A;  2K04 A;  3A7A B;  4XQJ A;  5A2Q L;  3E5S A;  4HN7 A;  4KJN A;  3Q6S A;  5CBA E;  1EIH A;  4G4K A;  5HUR A;  3M7N A;  3KLR A;  3R2T A;  1B44 D;  1PMR A;  1JOO A;  1BBX C;  2J4X A;  2QCP X;  5COR A;  3RD4 A;  1JIC A;  4C1N K;  4IAL A;  5J39 A;  1ENA A;  3VYT A;  4BA2 I;  1KLU D;  1EIG A;  2Z1C A;  2EYJ A;  4F87 A;  3NE5 B;  1STA A;  1A15 A;  5HGT A;  2Z4I A;  3HOZ B;  5K5P A;  3S9W A;  4KV6 A;  4HED A;  4KKT A;  5FO8 B;  2VB3 X;  1U4L A;  4PMW A;  3ND8 A;  3HEJ A;  3C46 A;  2LFN A;  3W2D A;  1CI3 M;  1B3A A;  2F0U A;  3S15 B;  4U67 3;  3NQI A;  3FPP A;  1V1O A;  4K2L A;  3MEH A;  5IT9 E;  1I3Q B;  4KY7 A;  4RAU C;  1EY8 A;  4Z9C B;  5BN3 A;  2AWN A;  4ZK9 B;  2EYM A;  3K5M A;  2TMP A;  5BN4 A;  2V4D A;  5IOC A;  3PV0 A;  3T56 B;  2DY7 A;  1EYC A;  1NSN S;  2YYZ A;  3MAQ A;  3SK8 A;  5IIF A;  4DK1 A;  2XRQ D;  2CHB D;  3OWE B;  2CVR A;  2G9D A;  4IFD I;  3NWT A;  3MWY W;  4KKU A;  3G7L A;  3DUZ A;  2K5D A;  4ZUJ A;  3VYR A;  1CM9 A;  2XNA C;  4KK7 A;  1NR4 A;  3BVM A;  3KLS A;  3DHQ A;  1HCZ A;  2B2Y C;  5DNF A;  2F3V A;  1RTN A;  5KYL A;  1STH A;  3TP7 A;  1XWE A;  1DXM A;  1HFN A;  1JWS D;  4QF4 A;  4CJ1 B;  3I73 A;  1TS5 A;  3ERQ A;  3J81 L;  2EJG C;  4N9P A;  1TU2 B;  3H09 A;  3A54 A;  2EYO A;  3A55 A;  1SE4 A;  2JP1 A;  1QOH A;  2X6L A;  3GO5 A;  2A74 C;  4IUT A;  4C1N I;  2NWG A;  2NVY B;  4C3I B;  1LTG D;  5JAV A;  5I2Y A;  1JR0 D;  5E4W C;  3GD7 A;  1OO9 B;  5DAU A;  4F8M A;  1Z6H A;  2E2H B;  4I7Z C;  1KNA A;  2E75 C;  5EBC A;  4B9X A;  2E2D C;  3T16 A;  3CRK C;  3D3R A;  4L63 B;  5JPM C;  1OXX K;  2KOL A;  3IFD A;  4ID6 A;  2R92 B;  1RCV D;  5E1F A;  3DM1 A;  4ZRZ A;  5ELF A;  1GUS A;  1LTI D;  1SFO B;  3NWS A;  4NDX A;  4F7X A;  5FO9 B;  1D1K A;  1DYQ A;  2K28 A;  4DNT B;  1S4Z A;  1RTO A;  1S5B D;  3PUY A;  1HA6 A;  1PZI D;  1NAP A;  5T1G A;  4ME5 A;  3TZD A;  4MIU A;  1HUN A;  4WRD A;  3V96 A;  3MXU A;  4NKL A;  4NP5 A;  1SE2 A;  2VUM B;  1RF2 D;  1ENF A;  3M7G A;  4OIJ A;  2DY8 A;  1A6X A;  5CV8 A;  2K5Q A;  1TVX A;  2WAQ B;  3I4L A;  1KAA A;  3OOC A;  4DAP A;  1D2B A;  1T5X D;  4PQX A;  1CA5 A;  4L6T B;  2F0M A;  2H1E A;  3MVV A;  1GJX A;  1TS4 A;  3PIO 3;  1ONL A;  4X3T A;  2M00 A;  2WAC A;  3A7L A;  5G3L D;  3NP8 A;  3I91 A;  3WDN A;  5FLX E;  2NB0 A;  3ONA B;  1RDP D;  1CK1 A;  3V2T A;  5C44 B;  3SDZ A;  4HMI A;  1TWF B;  2I46 A;  2EE1 A;  3NTI A;  5EKI A;  4G7Z C;  1OXS C;  5C3X A;  1F9S A;  3L7Z C;  1TY2 A;  4LAA A;  3H6M A;  2EYL A;  3VR4 A;  4A3D B;  2L5T A;  2PZT A;  3QJY A;  1LV9 A;  4ZLT F;  5I2X A;  3NTK A;  4I65 A;  4QMG A;  1S5E D;  3LWE A;  1PTO H;  1JCK B;  1II3 A;  1EYA A;  5IGF A;  3PO3 B;  2R93 B;  4KHV A;  2Z8L A;  3TME A;  2IX1 A;  4UAI A;  2CW0 C;  2OT2 A;  2XN9 C;  2PQE A;  2J7Z A;  2H4O A;  1SSO A;  4RKB A;  3Q0A A;  1B4O A;  3PMF A;  2K7V A;  4MN3 A;  1D5M C;  3MXP A;  1LTS D;  4XYO A;  4RFB A;  1WTV A;  2IL8 A;  4FP5 D;  2NZ1 D;  1VF7 A;  3LWU A;  1F2L A;  1GUO A;  1QCB D;  5EPL A;  3ND9 A;  2BE5 D;  3SEB A;  4WJW A;  3U9S A;  3U9O A;  1O7L A;  4G57 A;  3K5O A;  3A56 A;  4BY7 B;  1Q12 A;  5T1I A;  2BCO A;  1RD9 D;  2RDG A;  5KIX A;  4HCS A;  3MZ5 A;  2F03 A;  1FNU A;  2JEA I;  3JAM L;  3S2D B;  3HOV B;  4E6I A;  1SJH D;  3RUZ A;  1IKM A;  2K03 A;  2BOS A;  2AWO A;  2NTT A;  1BNZ A;  1KTK A;  4OO1 H;  5KEE A;  2B2U A;  1TR5 A;  2B2W A;  1EY5 A;  2RQX A;  2VXW A;  2IWH A;  2D5D A;  2PW7 A;  3OSO A;  3QOJ A;  4A3F B;  1SJE D;  1VDZ A;  4HR7 B;  2EOT A;  2QDB A;  3SK5 A;  5C4X B;  1CA6 A;  3K7A B;  5DM6 3;  2JA7 B;  5CC4 A;  2MJ8 A;  5M5Y B;  2A73 B;  1ILP A;  4CBV A;  1PLF A;  1ZEQ X;  1PZJ D;  1QIL A;  1GXD C;  2Q8R E;  2KQ3 A;  4XTC S;  5C3W A;  3HKZ B;  5K36 H;  1PYW D;  1WTP A;  2LY7 A;  3BZD B;  3BDC A;  2F0D A;  2OEO A;  4WFN 3;  1EY9 A;  1TWC B;  4IQZ A;  3I90 A;  4DGZ A;  1SYG A;  1RJT A;  2NYZ D;  2XWB B;  4BBS B;  1DON A;  4KY5 A;  1BQQ T;  3C2P A;  1Y1V B;  3BDO A;  3FEW X;  2FHT A;  3HZX A;  1HFG A;  2EDG A;  3BYY B;  5KYI A;  1ENC A;  3BVZ A;  1ZYR C;  3URY A;  3I4N B;  2SEB D;  2JA8 B;  3QWN A;  1FGB D;  4GZY C;  1I4Q A;  1DOL A;  2O4X A;  1G2T A;  3GTL B;  4KMU C;  1HHV A;  2ZXP A;  4K2K A;  3K5N A;  1EU3 A;  5IGB A;  4YIJ A;  2WP8 J;  4FXG C;  5FKA C;  1EY6 A;  1FNW A;  2A6H C;  4DAV A;  3NK9 A;  5EPK A;  1ZXT A;  2B2T C;  2KHS A;  1SND A;  1HPC A;  4FXD A;  3DMU A;  2B63 B;  1JE4 A;  2F0N A;  2RKS A;  1I6V C;  2DNC A;  4IUP A;  3VR3 A;  5FOB B;  1EL0 A;  1IW7 D;  1OXU A;  4QB4 A;  3CQZ B;  4C3J B;  3S1R B;  4A3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...