3ITPA

Crystal structure of staphylococcal nuclease variant delta+phs f34k at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTKRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nuclease A
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS F34K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3itpA00
4KHVA 1II3A 5CV6A 3U9OA 1F2YA 5JOBA 5C3WA 4WRDA 2EXZA 1U9RA 4KY6A 1EY8A 4H7BA 4IZ8A 4NDXA 5CV5A 4DFAA 3OSOA 5DAUA 5KIXA 5C5LA 3TP8A 5K5PA 4KTAA 4QB4A 5ISRA 1EY9A 1AEXA 5CV4A 4DU9A 3LX0A 2F0JA 3T16A 5C4ZA 3OMCA 2EYOA 4OL7A 2KHSA 1SNCA 4DF7A 5I9PA 1A2TA 1A3VA 1EYDA 4KY5A 3D4DA 2F0TA 3MHBA 3PMFA 5NUCA 4B9XA 4KY7A 3NQTA 4ZQ3A 4K5XA 5C4HA 3DMUA 1STBA 1EZ6A 1SNQA 1STGA 2EYFA 1EZ8A 4ZUIA 1JOQA 1STHA 1TQOA 1SYBA 2EYLA 1TR5A 2RBMA 3BDCA 5CR3A 4HTHA 1EY4A 3S9WA 4IALA 1EY0A 2SOBA 3EVQA 4KD3A 1KDAA 1SNPA 4EVOA 5KRUA 3TP6A 2KQ3A 3E5SA 3MEHA 3EJIA 5CV8A 1EY7A 1NSNS 1STAA 2F0LA 3NHHA 5DEHA 3BDLA 1F2ZA 5E3FA 4NP5A 1NUCA 3OMGA 1ENCA 2PYKA 2F0DA 2QDBA 4IUNA 5IODA 4QMGA 5KYLA 1ENAA 1SYCA 1SNOA 2F0PA 2F0QA 3HEJA 2F0EA 1SYEA 2EYMA 2F0KA 2SNSA 4J1MA 2RDFA 2EYJA 5IGGA 3MZ5A 3T13A 4K8JA 3MXPA 4TRDA 2LKVA 4PMCA 1KABA 3TP7A 1JOOA 3TP5A 3OWFA 3P1HA 3D6CA 4G57A 4KJOA 4EQOA 3P75A 5KEEA 4RKBA 3C1FA 1RKNA 3NUCA 5IGDA 3SXHA 3VA5A 2F0VA 3HZXA 3RUZA 3QOLA 5IGEA 2SNMA 4ODGA 5I9OA 4YIJA 4EQPA 5IIFA 4KJNA 3QB3A 5JAVA 4S3SA 4K2KA 5CGKA 2F0WA 1SYDA 5C6AA 5IGFA 4HMIA 3D8GA 5M9OA 1EYAA 1A3TA 3R3OA 5HURA 1KDCA 4ZUJA 4R8NA 5J22A 2M00A 2EY5A 1JOKA 4NMZA 1IHZA 5F2DA 2EYPA 4ID6A 5KYIA 2PZWA 5CV7A 5E1FA 1F2MA 3D4WA 3NP8A 4MIUA 5J1ZA 1STNA 5J39A 1A3UA 5CC4A 2PZUA 4K14A 5IGBA 1KDBA 5EKLA 4DGZA 2OEOA 4PNYA 3SK4A 2O4XA 2F0FA 3ITPA 5CV9A 5IOCA 2WACA 3EROA 5C3XA 2F0OA 3DHQA 2F0IA 3SHLA 3TMEA 5I6YA 2F0NA 5C5MA 2OF1A 2HQEA 2PZTA 4K2LA 2EY1A 3NK9A 1SNDA 1SNMA 2F0HA 4PMBA 5HGTA 1JORA 4J6HA 2ENBA 1SYFA 4K5WA 2F0SA 4E6IA 4EQNA 2F3VA 4K6DA 1EY5A 2PQEA 2F0MA 3ERQA 3SK8A 4F8MA 1STYA 1TT2A 4N9TA 1A2UA 2PW7A 5EKKA 2OXPA 4HMJA 1EY6A 3SR1A 1EYCA 4K5VA 4KD4A 3MVVA 3QOJA 4F7XA 2NUCA 5IGCA 2EYHA 2PW5A 1SYGA 4NKLA 2RKSA 4K8IA 4WORA 3SK5A 1KAAA 2EY6A 4KV6A 3SK6A 3V2TA 5KGUA 2F0GA 3C1EA 1EQVA 4B9WA 5I6WA 2F0UA 4LAAA 3NXWA 4ME5A 4QF4A 4RKLA 4N9PA 5EGTA 3H6MA 4I65A 2F3WA 2EY2A
chains in the Genus database with same CATH superfamily
4B3ML 1PLFA 1WI5A 4LF4Q 2B2WC 3F2UA 2ZTCA 4FP5D 2QA4A 4JI4Q 2MO1A 1HQRD 4CDFC 2DNCA 2JYOA 5EPLA 5T1GA 1PZID 4C3JB 1A2TA 4JI7L 4DR4L 5IT9E 2VZAA 4B9XA 5C4HA 1WCMB 1TXYA 2N8NA 4BWGB 4LF8Q 4QUFA 2BA1A 1CZGA 2X69A 1RTOA 4DV2Q 2PQAB 2EE1A 1TWHB 1STAA 1JMCA 4ZRZA 2JA7H 4JI2L 1F2LA 1KD1C 1X3PA 1CKMA 1X55A 4X65Q 3TS2A 1DOKA 3CQZB 2JSOA 1V1OA 1CSQA 1V8QA 4HEDA 3NWSA 3D6CA 5IP7H 1K9MC 2HT1A 4LFBL 1E1TA 2DN8A 4KKSA 3W1GA 4XDXA 3PSIA 4EQPA 3U58A 3GTLH 1DONA 2NN6H 2WP8J 1YJ9A 1PH7A 1TY0A 1CKNA 5EKIA 1J9OA 1Y1VH 1EUJA 4A3BB 3D0FA 3WOEA 2UXCQ 1I50H 1JB7A 3D4RA 3HOVH 4OELB 5I4DA 2WAQB 4LF5L 1OXUA 1UWVA 4JBMA 2PZUA 2PMZE 5HGQA 5IYBH 2EJMA 3OIQA 3P7JA 4DR7Q 4FXGC 2MP1A 4A3KH 1SNDA 2NZ1D 2VUMB 2HIVA 4E6IA 3K5OA 3NELA 3KBGA 3ERQA 1IKLA 1HFGA 3SR1A 4HMJA 1VQJA 1HZAA 5J3BA 3FHWA 4UP9A 1SYGA 3HOXB 1B9NA 4C1NI 1Q82C 3KBXA 4JOIC 1EU3A 3A55A 3I4MH 4A93G 3F8TA 1RCVD 2B63H 2R7FA 4DR2Q 3M3YH 4BBSB 1W2BA 3KJPA 4FYDA 4LF6L 3VR6A 4DR5Q 4IN3A 2KCTA 4MZ9A 2QILA 4POFA 2R92B 3I2ZA 1PHJA 3O13A 1MKHA 2NVYH 3PO2G 2NVQB 1NR2A 1VQMA 2YV5A 1ZXTA 3DWPA 2OTLA 3K81C 1HUNA 3OMCA 1TWFH 4A3DG 1EYDA 1WD0A 2F0TA 3FPPA 1SMYC 1VQFA 2VS1A 3NTIA 4K5XA 4GN5A 4LK1C 2RBMA 4KLKA 1K8AC 1UUPA 2NBFA 2HCIA 5ELCA 5JPMC 1IBKL 5C44B 3GTKB 2B2UA 5CV8A 1NSNS 3MAQA 5IY0A 1IYJB 2DGYA 3T1HQ 5KYLA 1ENAA 1T5XD 2AQ3B 3KYHC 1IBLL 2Z6BA 1SYEA 1KL9A 1PFNA 1Y8PB 4ALPA 5FJ8G 3AQQA 2K33A 1MJEA 1W6JA 1K73C 5KEEA 4YHHL 1JWUD 2Y0SB 3SE0A 5IYDH 4KHZA 3VA5A 1EOTA 3QOLA 4ODGA 1JC7A 4IUQA 3S1MH 1PYWD 4FF4A 4C3IH 2QDLA 3A8JE 5M3MG 3I4NG 4AYBB 4HJ9A 3GTPH 1G6PA 1I6HH 5J1ZA 2UXDL 2AQ1B 1S5ED 2LXKA 4BBRH 2MO0A 3DWAA 2KJXA 3C2PA 2OF1A 4DA2A 2I46A 2MQHA 3IL8A 5HGTA 1R4PB 3K58A 1BBUA 2PQEA 3A7AB 5FO9B 4N8X1 3H3VC 3RZOB 1JE5A 4GNXA 3CF5A 3JAME 2EPBA 1I3QB 4PMWA 1GVPA 1KAAA 3RR5A 3NPPA 2IHFA 2SDFA 5M3FB 4DV0L 3DM1A 1H9JA 2QF7A 4N9PA 5DLQE 3EFXD 2F3WA 1II3A 1A63A 1PH4A 1IZ6A 1EY8A 4IZ8A 5TSSA 2HCCA 2HUGA 2RDGA 2PI2E 1ICFB 2HDMA 4DPGA 2R93G 1SSOA 2JEBI 1EIFA 1SNCA 3CC7A 3CCSA 1VQ8A 4A3LH 4B3SL 2XWJB 2X6GA 1SLJA 3CMAA 1B3QA 1O78A 2XVSA 1Q8IA 1HNWQ 1EZ6A 2K05A 1EZ8A 2N49A 4RMFA 1SE2A 2DJFC 5CR3A 1AP0A 2L11A 4JCVE 4KN7C 2SOBA 3EVQA 2IHEA 4AIMA 3MEHA 5DNFA 2A5HA 2E2JB 3VA7A 5C4XB 1IL2A 1HH2P 4DUZQ 4AQYL 4QMGA 2ZJQA 4A3JB 4CHTB 2SNSA 5LMUQ 3KF8A 3JC66 1HQMC 3T13A 1XTDA 1QZHA 3EQLC 1V1PA 4JI3Q 4RGTA 3S14B 4OIKA 5I9OA 3CCJA 4GOPA 2FMMA 2E8GA 3QB3A 4MTNA 4RGOS 5C3EH 2RDHA 3D8GA 1TIID 1X3GA 5JPNC 3UDGA 2F3IA 1B3AA 1SE4A 1T9HA 1HNXL 1UE6A 4BY1H 1P16A 1TU2B 3PGZA 4NMZA 2PNHA 2B2WA 1GHKA 2K5QA 2AHOB 3MEFA 4JC0A 1PTOF 1KC8C 2WB1E 5IGBA 1YJWA 2J0TD 3BZCA 2HHHQ 2B2VA 3K7AB 3NK9A 1J5EQ 2ENBA 2DJGC 4EQNA 4DAMA 3PUVA 1KQSA 2JXMB 2A6HD 3VYSA 1IW7C 1GUGA 4F7XA 1ENFA 5JEAG 4A3GH 2EVBA 3A7LA 4KV6A 1YEZA 1G2TA 4MN3A 1L1OB 1J8IA 4OX9L 4DXFA 4RKLA 3H6MA 4I65A 4LF7L 1Y1WH 3ER0A 4LW1A 4HCEA 3CAMA 3L3OC 2PI2A 3HOZG 3QIAA 5KIXA 5C0XH 4H44C 2C35B 3FPUB 4QQBX 5JJIA 3LX0A 2PO4A 3K0XA 5C4ZA 4JI6Q 2AUKA 1DM0B 1EWIA 4B08A 4DV3L 3S16B 3H3VH 1STBA 5IE8A 2R6GA 3OOCA 3U50C 1FVIA 4LFAQ 3J80i 3ULJA 4QY7A 3CCUA 1LABA 2Q8TA 4JI8Q 3HOYG 3S1NH 4X3UA 2ZM6L 4J1MA 2F0EA 3HOWH 2A69D 2PNRC 2EYJA 1PRTB 2A73B 3P20A 1Z9FA 4TRDA 3TP5A 4JI4L 3P1HA 1HCZA 2B2YA 1CA5A 4BXXH 3IFDA 1CA6A 2PQAA 4B3TL 4Z9CB 5IGEA 3N52A 1FGBD 3OIPA 2JA8H 4P71A 1D2BA 4KJNA 1Q3LA 2CQOA 1L1OC 4BY7H 3D6WA 4JOIA 2MFIA 3T1YQ 4A3IG 1VCIA 1ML0D 1A3TA 2H5XA 2EIFA 2EY5A 3DM3A 5ELEA 1ZYRC 2EYPA 2RQXA 2RCNA 4A3FH 3TBIB 2JA7B 2Y0SE 3PUXA 2K5DA 2OEOA 3G71A 2AQ2B 1HA6A 1I6VC 2PMZB 2C9OA 3LGJA 3F1ZA 1HZCA 1SNMA 1VF7A 1YNJD 3L0OA 1Q1BA 3CXCA 4DR1Q 3J7A5 1EIHA 1HTPA 4AYBE 4DR3L 4PG3A 1TWCH 3ZYYX 1WJJA 3GTLB 4JI1L 2WKDA 3X3MA 4L5QA 1A0IA 2I5MX 1SRUA 1RIPA 3U4VA 1Y1VB 3EBEA 4I7AA 4ZCKA 4GNXB 2L4NA 5A35A 4IJLA 1PH6A 2NZOA 3J7YW 3G7LA 4GLAC 1L0WA 1GHJA 3HOVB 4C3JG 2Z6KA 3AFPA 1PH9A 1VQLA 5EAYA 1I94Q 2IY5B 4X64Q 1U4LA 2F4VL 1XNRL 3FRPB 2ZT9C 2J7ZA 5K5PA 3ICEA 3M4OH 4A3KB 1EY9A 4YWMA 3RD4A 3SGIA 2ASBA 1QCBD 4U68A 4APVA 1F77A 4GKKL 1KLGD 3CRLC 5NUCA 3CPFA 2VQEQ 4LF9L 2LSSA 4ZQ3A 4CKCA 1QWYA 3AEVA 1STHA 2YYZA 1TR5A 2E76C 1PYBA 1QG7A 4IPGA 4KD3A 4JI0Q 4RHRA 2A1AA 3I4MB 4LUOA 3E5SA 2NWGA 2B63B 3M3YB 2A68D 1N36Q 1FD7D 1ENCA 2PYKA 3EA6A 4X3KA 5FLXc 1UAPA 3E3XA 1D5XC 2HIXA 3CMEA 3HEJA 2D0PA 1SROA 2F0KA 4XQJA 2RCFA 1DD2A 1OO9B 1N8RC 1PTOH 1JOOA 1F9QA 2JA5H 1JWMD 3OWEB 1LO5D 3OTOL 4A3BG 4DR6Q 5ELFA 1LUZA 2F0VA 2Z4HA 1TWFB 2TMPA 5ELBA 2WAQG 4A93H 1EU4A 1PZJD 2A74C 4A3MH 4S3SA 2XRQD 3HKZB 5IGFA 2N3SA 2LS01 4HJ5A 3J7AF 2QCPX 1RTNA 2JJQA 4I7ZC 4X62Q 4DNTB 2VUMG 4DXGA 3W1BA 1XMQL 4MIUA 1ILQA 2K28A 3CKIB 1VQ7A 3K57A 1CTMA 3TDQA 4IUUA 2AKWB 2E5LQ 3EROA 4O1NA 2FJ2A 1B1ZA 3DHQA 3S1RH 3BVGA 4CJ0B 4JK1C 5C5MA 1C4QA 2PZTA 3MFGA 4K2LA 4X66L 2VB2X 2B8FA 4BBSG 5BN5A 3L9AX 1GUSA 4LUZA 1LLRD 1KNAA 2BA0A 1OXXK 3S1MB 2AMCB 4O42A 3UDIA 3QOJA 2EJFC 2A6ED 2NTSA 1EYGA 2R92G 4C3IB 1PA6A 2ICEC 1ASYA 2D0OA 4BA1I 3BU2A 4LWCA 1GD7A 1D8LA 4B9WA 1LACA 3TN2A 3NXWA 4ME5A 1KRTA 3M7NA 2MUYA 3GTPB 1I6HB 1WTQA 2MPMA 4OHJA 3U9OA 3K5NA 1JE4A 4BBRB 3IAYA 1G2SA 4CJ1B 3HP3A 3VDYA 2IX3A 1EEID 2KENA 4DV7L 1AE2A 1HA5A 5C44G 2UUBQ 1PRTD 2UUCL 3J80E 1KRSA 1TVXA 1SE3A 2B3GA 3FVQA 4DF7A 5GAGC 4KY5A 2Z1CA 2NTTA 4FF1A 4HSVA 4RFBA 4DK6C 1JOQA 2EYLA 4Q0FA 2XSCA 2B2TC 3A54A 1HR0Q 1N33L 1KDAA 3CC2A 5M5YB 1LT3D 2F0LA 4DAVA 5IYCG 1RL2A 5LMNL 5BN4A 5KNBA 3G6JB 1SNOA 1GUWA 1G51A 2EDGA 1E1OA 3H09A 3TP7A 2BH2A 1I4HA 4UPAA 5IP9G 4AYBG 2DNEA 5CORA 3ERSX 4NW2A 4XIGS 2XNAC 3NTHA 3GD7A 4V190 2ZTEA 3TZDA 1S3OA 2E75C 1QILA 4PZ6A 3GTOH 4ZUJA 1XMOL 1PFMA 4FNFA 3T4AC 2E74C 4TQUS 5KYIA 5CV7A 5FOBB 2IJ0A 1N34Q 3E9HA 2R93H 1PH2A 1HNZQ 2QW7A 2WB1B 3FDTA 5CV9A 3M4YA 2QKIC 3T56B 3OPOA 2HQEA 2KCMA 5M3FG 1IBML 1YIJA 2Q2TA 1RHPA 4JYAQ 1VQ6A 4IUTA 2F3VA 1TT2A 4GKJL 3PF5A 5C3EB 4NKLA 2B29A 4NXML 1X3QA 1NR4A 1VQBA 4B3RL 4BY1B 1DYQA 2K75A 4LJZC 4OO1G 2JK8A 1HJPA 3UE0A 4NDXA 2N78A 4DFAA 1FNUA 1BCPD 5G3LD 3M4PA 2O5JC 1AEXA 1V9PA 2V4DA 4P2CB 4JBJA 1L1OA 1O7LA 1NY4A 1PZKD 4XXEA 3PMFA 4HJAA 2G5DA 5FLMG 4A3JG 2F1MA 1NMFA 4A3GB 1Q8KA 1BQQT 3TS0A 4DV1L 4IO9A 2R61A 1I4RA 2Q8RE 3VYUA 1JB3A 1F2ZA 2HD3A 1Y1WB 5JJLA 2QDBA 4G7HC 2F0PA 2F0QA 5IIFA 1CQVA 4RCNA 1FJGL 1AH9A 2VQFL 3GTMH 2XIWA 2CW0D 4YCUA 2H1EA 1KABA 4PMCA 1A15A 1YNND 2K50A 1N9WA 1QB5D 4RKBA 2NVXH 2E2HH 1LV9A 2MHVA 1S5BD 4X3TA 4YIJA 1U4MA 5IWAL 2KVMA 1ZKOA 5CGKA 3I91A 1ASZA 4JW0A 3ONAB 3HOUG 5HURA 1SDFA 4ID6A 1EFID 2D5DA 3S1NB 1FR3A 3AU7A 4GN3B 5AJ3L 1LTGD 1LTID 5L37A 2AWNA 1XNQQ 4HJ7A 1STEA 4DUYL 1KIXA 3QG1A 3TSSA 3CPWA 1BOSA 4C1NK 3VR3A 2QGQA 2EY1A 3KOJA 2ID0A 1JORA 3HKZE 2OQKA 1WVLA 3S2DH 2Q2UA 1O7ZA 5EPKA 2JA8B 5I2YA 4DV6L 4BY7B 4KD4A 4LFCQ 2RKSA 3CHBD 3T1YL 1YJNA 2L55A 3K6OA 2K14A 4L6TB 3T16A 4JI5L 4A3FB 1IXRA 3J80L 3Q23A 5GROA 2EXDA 3AYHB 2EXZA 3MFYA 2UU9Q 3X3NA 2KUMA 1PXUA 1D7QA 3R8BA 1K8GA 3TQYA 1MGSA 4QB4A 5ISRA 1JCKB 1YNXA 1E24A 3ND8A 3TRZA 2WIIB 1U4RA 1TWCB 2F03A 2ZTDA 4DV5L 3OYYA 1EQRA 4PQXA 3CRKC 5FO8B 4JV5L 1QVCA 4UP7A 3MC0B 4IFDI 1RJTA 1SR3A 4L5TA 4XQQA 1CKOA 3NHHA 1M1KC 1OTCA 1H95A 1UE5A 3OMGA 1SMXA 3E6ZX 2RDFA 2KCCA 3DWQA 1GJXA 4B3MQ 4K8JA 1TKWB 1VQGA 1J6QA 1YHQA 3M4OB 3P75A 1U4PA 4FVMA 3C1FA 1DOMA 4JVZA 1S5CD 5LHY1 2C5CA 1E2ZA 2P5ZX 3CW2C 1MD2D 1SJHD 1GOZA 2FINB 4WJWA 1SYDA 5C6AA 2RSOA 4JI7Q 4DR4Q 3KJOA 2E2IH 2CH4W 1V43A 1EYAA 3PO3H 2EZVA 4R8NA 5IP7G 4RH6A 4DV4L 2PPBC 1QVGA 4OO1I 5CYUA 1SBBB 5FLXL 3G4SA 4K14A 2J4XA 4DGZA 2NN6G 4PNYA 1HFNA 1SJED 5IOCA 2KHIA 3ITPA 1A8VA 1Q46A 4HCSA 4JI2Q 4NPSA 4Y52H 1Y1VG 2JA5B 3MTSA 3CQZH 4YWKA 1LYLA 1EY5A 3BJUA 3I90A 3HOVG 4BS9A 4LFBQ 4A93B 3A8IE 1EYCA 2VL6A 2B2TA 4RA8A 4A3MB 4QJFA 5IYBG 4K0KL 3K7UC 3FKIH 5LL6S 1QNKA 4A3KG 4X3SA 1B2TA 1AE3A 1S5DD 3ULLA 3LNNA 1NCVA 3H0GG 4C2MH 1IYVA 1W6KA 4KHVA 5CV6A 5JEAJ 2R7DA 1HTLD 2UXBL 1H9KA 4NXNL 3J81c 3IKJA 1BR9A 4LF5Q 2E5LL 5CV5A 3OSOA 2I5HA 1YNJC 3R93A 3S1RB 4A3EH 2RVLA 3DEPA 4EX5A 2V1CC 4RAUC 2ZJRA 2NVTH 2JA6H 1RODA 2B63G 2KHSA 1G8ZD 3Q0AA 3DEOA 1AZPA 4ULLA 2EYFA 3K8AA 3NBHB 1K83H 4C3HG 1U0LA 4FF2A 3PUZA 4ABNA 3S9WA 3WOFA 3PIOA 1Q90A 1GXDC 2KQ3A 2JEAI 2R7ZG 1VQHA 2RSNA 2FFKB 1Y14B 1PTOC 4OGQC 3PV0A 5IODA 2CH4A 4DK0A 1I5FA 5DAUA 1C0AA 3LWEA 2EYMA 4LF6Q 1YBYA 3HKZG 1D5ZC 2LKVA 5JVH3 1X54A 5BR8L 2D9UA 4CJ2C 3SXHA 1X3FA 3DXJC 3HZXA 5EQ0A 4OWTB 2H4OA 4R8IA 2K4KA 4KHPL 2UUAL 2I5LX 1B8AA 3G48A 1CHPD 2BDOA 4YY3L 3IFTA 1LTSD 4OONA 3B6YA 1TS4A 4IPCA 2A68C 1HZ9A 1B53A 4LF4L 5F2DA 3J81j 5IYDG 1BUVT 3S15H 3NP8A 4R4IA 3KLWA 4H0LC 5EBDA 4OWWB 1KDBA 2GVBA 2O4XA 5D3IB 2F0FA 1S5FD 3HGBA 1GUTA 1IBLQ 4R4QA 4HIMA 4K5WA 4K6DA 3CCVA 4LF8L 4F8MA 1UEAB 2M9VA 3RMHA 4YHHQ 2OXPA 1VQPA 2Q2IA 4V0BA 3SDZA 4DV2L 5IGCA 4P73A 4R1JA 2ES2A 5DM73 5E4WC 3VYTA 4FF3A 3BS1A 2R3ZA 5LMNW 3GTOB 5K36G 3NBIA 2F0UA 4X65L 4OXPA 2R93B 5JOBA 5EBCA 4F87A 2JA9A 4KY6A 1PRTF 1QOHA 3CP0A 3RN5A 2UXDQ 2D2CC 3Q6SA 1QZGA 1UEBA 4JPBW 4XQNA 4LUVA 2IT1A 4J8QA 4M1UB 3BVMA 1PYSB 1TWGH 3D4DA 1PH5A 4R4OA 1BXTA 1VMCA 4OWXB 3KLSA 1UE1A 1JR0D 3DMUA 2UXCL 1SNQA 1I50B 1CK1A 1TQOA 2MJ8A 3M9BA 1EY4A 4CKEA 5T1IA 1E22A 1SNPA 1Y8OB 4CDEC 2KBNA 1WCMG 1IW7D 4A75A 3AMUA 3QJYA 1I4XA 2F0DA 4DV0Q 4DR7L 4J15A 3KDFA 3VYRA 1SE8A 2NN6I 5DM63 3R2IA 2K52A 4RGNA 5COYA 4MHEA 5C4JH 4DAYA 5IT9c 4R4CA 2QEJC 1NTGA 3L2PA 3RUZA 2HDLA 3I7FA 2Z0SA 3VR5A 2GA4B 2WB1G 4B3SQ 4DR2L 4HAEA 1PV4A 1EWHA 3TEHB 4DR5L 2JE6I 1VQ4A 1HZBA 3URYA 3I72A 4KN4C 2NVYB 1F9PA 3TREA 1BBXC 2K01A 1CI3M 4RG1A 1QE6A 1LTLA 3GTMB 2F0OA 4AQYQ 2IWHA 3E0EA 3SHLA 5I6YA 5FLMH 3W5OA 2L0CA 3A5UA 2TSSA 2NVXB 2VB3X 4BY1G 2E2HB 3A56A 1CFMA 1DCZA 1Q81C 3I4LA 1B4OA 1BDOA 3MWYW 1KLUD 2XN9C 1A2UA 2SEBD 3KFUA 2IW3A 3MVVA 2ICIA 3D3RA 2EYHA 3KK7A 3PO2H 4KI0A 4UAIA 1O7IA 5FK9C 3SK6A 1NJIC 4ZAIA 5D65A 3T1HL 1Z47A 1HXYD 4QF4A 4A3DH 3BZDB 5GADC 2KOLA 1BCPF 2RA4A 4G4KA 5G3LF 3STBD 3HOXG 1HNXQ 4X6AH 5C3WA 5GQOA 4RWSC 2EJGC 1SFOH 4WJ3M 4A3GG 1D5MC 1UE7A 3RNUA 5CV4A 3V05A 2I07B 1Q1EA 3GP7A 2YU9H 3HOUH 2XRSD 3S2DB 1A3VA 1I4QA 2L1BA 1PH1A 2G9DA 2HQLA 5HY6A 4QL5A 5FJ8H 3HG9A 3CCMA 1L0XB 4A3CG 1H9RA 1SAPA 3GQBA 1K8MA 4LMQD 5C0XG 3PIPA 3M7GA 3MXNB 3TP6A 2L9HA 1EY7A 3BYYB 2AWOA 1G91A 3RLOA 1PMRA 2WV6D 5D14A 4OX9Q 1VQKA 4LF7Q 1OXSC 1LM0A 1MSGA 1MIUA 3A5ZB 5M3MH 1F9SA 3I4NH 4GZYC 2OT2A 1HRJA 4G57A 1H9SB 5IGDA 5D3DA 2M2LA 1EQQA 2BE5D 4CKBA 2WFWA 3LWUA 3VR4A 2KHJA 2DY8A 1NNXA 2Y0SG 4FXKC 3SEBA 1YHAA 4DV3Q 1LTRD 4ILWA 1VS0A 2LY7A 2M00A 4KMUC 1RDPD 5E7NA 4O0AA 4BXXG 2ZJPA 3C3LA 3D4WA 1G291 2JA8G 1TS2A 1K3BC 2CW0C 4Q5VA 4BY7G 1WTPA 1VQ9A 3I56A 4IFDJ 1E3PA 1CM9A 2WINB 3TMEA 3JAMi 1N32Q 2ZM6Q 4A76A 4P72A 4QUCA 3KUPA 4QIWB 4R9WA 1HNWL 4JBKA 4A3FG 3QWNA 4UHVA 2K5NA 2B2VC 2CWAA 4IFDG 4B3TQ 2PW5A 2E2IB 3S17H 3PO3B 3C1EA 4NB3A 2L5TA 5BN3A 4DUZL 1CT1D 4DNRB 1YITA 5EGTA 5LMUL 2ZXRA 1QJOA 2BH8A 4IUPA 1ET9A 4H7BA 4JI3L 1Y8NB 4TSSA 5FLXE 1S72A 2IL8A 1CUKA 4L63B 1KTKA 1YZ6A 1BF4A 2PCFB 2VXWA 3JAMc 3NWTA 1X56A 1EIYB 1SEBD 4CGYB 1STGA 2F4IA 2KA7A 3BDCA 1X65A 2RF4A 5M5XH 4DR3Q 4HTHA 2A8VA 3FKIB 2E2DC 1EY0A 4JI1Q 3A8KE 2Z8LA 5KNCA 2GN5A 2A19A 3EJIA 3PUYA 1ESFA 3R2TA 4C2MB 3WWVA 1O80A 1TY2A 4IUNA 3NSWA 2HHHL 1NE3A 2IX1A 2B39A 3J81L 4ZKBB 1J5EL 5IGGA 3MZ5A 2VW9A 1OXTA 1LTBD 3NBHA 4A3EB 5A2QL 1XPUA 3OWFA 2OCEA 1M8AA 4KJOA 2VNUD 5C4XG 3KDFB 2X6LA 1HHVA 4TVAB 2NVTB 2CKZB 3OW2A 3U9SA 2F4VQ 3GTGH 3MXUA 2JA6B 1XXGA 3GTJH 1XNRQ 2K5WA 3RZDH 4DAYB 1U5KA 4KK7A 1A6XA 3V96A 3H0GH 2B2YC 3F2CA 2F0WA 1AN8A 1SN8A 4GKKQ 1K83B 4HIDA 1ZEQX 2O5IC 5ELOA 2OQ0A 4YCWA 4LF9Q 1KDCA 2JA5G 2L15A 3S1QH 2L12A 1EEFD 4U673 1JJCB 2B8GA 4L8JA 1DOLA 2K5VA 1LTAD 3CU7A 2K04A 1WTVA 5JEAH 4A3MG 1GKHA 3RN2A 4JI6L 4PZ8A 4XTCS 2WKCA 4PMBA 1QUQB 4C3HH 4R4TA 1JICA 2F0SA 1S4ZA 4L5RC 1P8LA 1GUOA 2F0MA 3OTOQ 2R7ZH 3WDNA 4LFAL 4HN7A 1E2WA 3HOZH 3GTQH 3S2HH 3MXGA 2G9HD 4K8IA 4WORA 5C0XI 3T51B 4HIKA 1EQVA 4JI8L 5I6WA 4XT3B 1Q86C 4IQZA 3HOWB 2I0QA 3S15B 4IUVA 2K03A 3GV6A 1PFBA 4FDBA 1PFSA 4XYOA 4H13C 1L0YB 4POGA 1XMQQ 1C9OA 3H3VI 3UI2A 5C5LA 3TP8A 3NTKA 2RHQB 2Z6KC 2N88A 1WD1A 3H91A 4Y7NH 1BNZA 3HOYH 4X66Q 1HR0W 4KY7A 1WOCA 5M5WH 5ELNA 5I2XA 2JN4A 1TS3A 3I8ZA 1B9MA 4IALA 3PIO3 1TWAH 1B7YB 3NENA 3QR8A 2EOTA 1MBYA 3K5MA 4ME3A 1R9TH 5FO7B 2QEXA 4M8AA 2A6HC 4DR1L 4A3IH 4IURA 1XJVA 1JWSD 2LFNA 3NUCA 1PVOA 3GDEA 1C7YA 3GO5A 2OWOA 2NB0A 1EOVA 3CCRA 3K5LA 4DV7Q 5K36H 1DZ1A 1TWGB 5GAHC 3A74A 4HR7B 2UUCQ 3F2DA 1KNEA 1NAPA 4OEMB 1I94L 1IHZA 4X64L 1YHBA 2PZWA 1CSPA 5E1FA 5EJWA 4K6LA 1WTOA 4O2DA 1WTWA 1N33Q 3NE5B 5M5YH 1IKMA 3DUZA 2RHSB 1X6OA 5JJZA 3PUWA 1XPRA 2WACA 4XYQA 1FGUA 5LMNQ 5LL6X 2F0IA 5CBAE 5C4JB 1XPOA 1X3EA 5IT9L 3BZKA 1O7YA 2JA7G 1T5EA 2VQEL 4RHSA 4C3JH 2KEEA 3AB9A 4ZKCB 2NYZD 2O2LD 1Z6HA 1WCMH 4GLXA 4JI0L 2GVAA 2NUCA 1SMYD 2ZXPA 3J81i 3V2TA 2A69C 3NEMA 1N36L 2BDNA 1TWHH 4DK3C 2ATWA 1W3SA 2ALYB 1HPCA 2EY2A 1XMOQ 2YTXA 1PTOB 4QIWE 1H9MA 4WRDA 3I73A 3U4ZA 4DR6L 4N8FA 1K8OA 3F2BA 4P75A 1CQFA 4IJHA 3HFZB 3HS0C 1PH3A 3KF6A 4DU9A 3Q22A 3OHXC 4A4IA 3NQIA 2EYOA 3H94A 1L2FA 4ZYSA 3W2DA 3E0JA 1IBMQ 4MNOA 4PV1C 3KLSX 3CCQA 4X62L 2BCOA 3EN2A 1SYBA 3PO2B 4JBWA 1AFPA 4GKJQ 3KLRA 4A3BH 2K1BA 3IRBA 3J7AV 4BA2I 1YVCA 1KXLA 2KEDA 4F88A 3N6RA 4KKTA 5KNDA 4NXMQ 4A3DB 3E9IA 1UNSA 3C46A 4B3RQ 1CKNB 2JQOA 3I4MG 2EQSA 1SFOB 3MXPA 2CVRA 1R4QB 2VUMH 1I4PA 2F52A 3CC4A 3MXNA 2CFMA 1AZQA 2YU9B 3HOUB 1EIGA 4IOAA 3AFQA 3PQIA 2LXJA 1SXTA 3H15A 1GM5A 4CDDC 1ET6A 4UDUC 3HOXH 1B70B 1EWCA 1WTXA 3I55A 3CCEA 1K3RA 1TS5A 4BBSH 1BKBA 1H9SA 2WAQE 1X9NA 2NZHA 2Q8IB 1STNA 1A3UA 4DV1Q 2R92H 3I4OA 2UUBL 4HIOA 2NVQH 5M3MB 2F0NA 2N55A 3K80C 3I4NB 1VF5C 4A3CH 1FJGQ 2F0HA 4HSPA 4PZ7A 2VQFQ 2K32A 1ESRA 2CQAA 5EPJA 3SK8A 1STYA 2PW7A 3Q8DA 1HR0L 1EY6A 4C56C 4K5VA 4G7OC 1WTHA 2BOSA 4L5SA 5CMDA 1LTTD 2K7VA 1JJ2A 1DGSA 2F0GA 5KGUA 5IWAQ 1EL0A 1IBKQ 5C44H 3GTKH 4GLVB 1E7ZA 3CCLA 1WTRA 4ZK9B 4DNIA 4C3IG 2LMCB 1DXMA 3HRZC 1F9RA 1BO0A 1N32L 5AJ3Q 1PH8A 1ONLA 1VDZA 4BBRG 1LT6D 5IYCH 4OL7A 2CHBD 4DUYQ 3UDFA 5I9PA 1Q7YC 3I70A 3MHBA 4DK1A 1GUNA 2FXQA 4ZLTF 4G7ZC 3BDOA 4EQ5A 1OXVA 5H1SE 1M90C 1VQOA 3PIP3 4DV6Q 3DLLA 5IP9H 1N34L 3G6EA 3S17B 1CZWA 1IL8A 3QO2A 3STBC 1HNZL 4RGMA 5E3FA 1D6EC 3M85A 1QNUA 3ND9A 5KRUA 1Y69U 1D1IA 4DAPA 4JI5Q 4JYAL 3J80c 4HJ8A 5E4XA 3BYTB 3D31A 4EQOA 3RLFA 3J7ZC 2A6EC 4IFDH 2K5HA 1JT8A 5AFWA 3JAML 1LT4D 3K0YA 3PF4A 3TZUA 2KECA 1AW7A 1NBWA 1MJCA 1XX8A 2OTJA 3RZOH 1RD9D 1RF2D 1XTCD 2DY7A 1VQEA 4IPDA 4LNQA 1I3QH 4WFN3 3S24A 4HMIA 5M9OA 1FYCA 1BVSA 5M5XB 1I4GA 4DN4M 5M3FH 4A3LG 5ELDA 5J22A 4DV5Q 1JOKA 2KCNA 1V1QA 4YCVA 3UDXA 2AUJD 2B2UC 5J39A 4JV5Q 5CC4A 1PRTC 2K6AA 4CBVA 2IPKD 4CDCC 1HUMA 1VQDA 5EKLA 3SK4A 2Q2HA 5JJKA 1K0SA 5C3XA 3HKSA 1MI2A 1B44D 3PO3G 4UP8A 1PTOD 3J81E 4RCOA 2BE5C 4J6HA 1SYFA 4OO1H 1BBWA 3GTGB 3GTJB 1EFWA 4IPHA 5A2QE 2CWPA 4N9TA 1K0RA 3RZDB 1PDQA 2XGTA 3SVMA 3H0GB 1MHWC 2Z4IA 3ULPA 3SK5A 1KHIA 2EY6A 3PCOB 3W3AA 3S1QB 4KKUA 1FNVA 1FL0A 4H02A 1YI2A 2E2JH 1QUQA 4FXDA 5C4XH 5C3EG 4DKAC 1F2YA 4GS3A 4A3JH 1CHQD 1X32A 4DV4Q 1U9RA 4IOCA 1IYUA 1Z7TA 2JP1A 1BCPB 4KTAA 3FKIG 4XT1B 2F0JA 4C3HB 4WJ4A 3S14H 1QVFA 3GV3A 3L7ZC 1FNWA 2R7ZB 3KF6B 4OIJA 4AH6A 3RLNA 3NQTA 3KF8B 3HOZB 2IX0A 1S40A 3FP9A 3GTQB 3S2HB 4ZUIA 2MGSA 4GNXC 3VR2A 1JQYD 1V1PB 4A3EG 4EVOA 1B50A 4K0KQ 4JG2A 2JA6G 5DEHA 1DJRD 3BDLA 4GOPB 4NP5A 1NUCA 1XNQL 1ZYRD 4P74A 1SYCA 2VY3A 3A0JA 3EIVA 3M4QA 5C0XJ 3CD6A 1Q12A 1VQCA 4EGVA 1C8CA 1VQIA 2UXBQ 3K7AH 1Y1WG 4NXNQ 1RKNA 1NMGA 4TKOB 1M4VA 2SNMA 3MA2B 4LFCL 1ICWA 4Y7NB 3HOYB 1D1KA 3FMCA 2MNAA 1WFQA 2YTYA 5JAVA 4K2KA 4MTKA 5CBEE 5M5WB 2D62A 1C48A 1G6ZA 3BVZA 3T53B 1XYIA 2ZXOA 1GO3E 3R3OA 3Q24A 1TWAB 1E0BA 3I3CA 1A62A 1BCPC 1F2MA 3ZJYC 2UU9L 1VQ5A 3FEWX 5FKAC 1R9TB 2YTVA 1EQTA 1MSHA 1VQNA 4GN4B 3BG3A 4QCLA 2DUDA 4A3IB 5GAEC 4FO2A 3K59A 1WYDA 5JVG3 2Z9HA 1E2VA 1ILPA 4UY8C 3HOWG 5BR8Q 3UE1A 5EKKA 4YWLA 3S16H 2XWBB 4QGUA 1XWEA 2FMCA 4GOPC 3OW7A 1K28A 1LT5D 1VMPA 4KHPQ 2UUAQ 2FHTA 1KAWA 2CCZA 4LAAA 4YY3Q 1YNNC 1JJGA 1VQAA 2XTIA
chains in the Genus database with same CATH topology
1PLFA 2B2WC 3F2UA 4FP5D 1HQRD 2DNCA 2JYOA 5EPLA 5T1GA 1PZID 4C3JB 1A2TA 5IT9E 4B9XA 5C4HA 1WCMB 4BWGB 4QUFA 2BA1A 1CZGA 2X69A 1RTOA 2EE1A 1TWHB 1STAA 4ZRZA 1F2LA 1X3PA 1DOKA 3CQZB 2JSOA 1V1OA 1V8QA 4HEDA 3NWSA 3D6CA 2DN8A 4KKSA 4XDXA 4EQPA 1DONA 2NN6H 2WP8J 1TY0A 5EKIA 1J9OA 4A3BB 3WOEA 3D4RA 5I4DA 2WAQB 1OXUA 2PZUA 2EJMA 3OIQA 3P7JA 4FXGC 2MP1A 1SNDA 2NZ1D 2VUMB 4E6IA 3K5OA 3KBGA 3ERQA 1IKLA 1HFGA 3SR1A 4HMJA 1SYGA 3HOXB 1B9NA 4C1NI 3KBXA 1EU3A 3A55A 1RCVD 4BBSB 4FYDA 3VR6A 4IN3A 2QILA 2R92B 3O13A 2NVQB 1NR2A 1ZXTA 3DWPA 1HUNA 3OMCA 1EYDA 1WD0A 2F0TA 3FPPA 1SMYC 3NTIA 4K5XA 4LK1C 2RBMA 1UUPA 2NBFA 2HCIA 5ELCA 5JPMC 5C44B 3GTKB 2B2UA 5CV8A 1NSNS 3MAQA 5KYLA 1ENAA 1T5XD 2AQ3B 1SYEA 1Y8PB 1PFNA 2K33A 1W6JA 5KEEA 1JWUD 2Y0SB 3SE0A 4KHZA 3VA5A 1EOTA 3QOLA 4ODGA 1JC7A 4IUQA 1PYWD 4FF4A 3A8JE 4AYBB 5J1ZA 2AQ1B 1S5ED 3DWAA 2KJXA 3C2PA 2OF1A 4DA2A 2I46A 3IL8A 5HGTA 1R4PB 3K58A 2PQEA 3A7AB 5FO9B 3H3VC 3RZOB 3JAME 2EPBA 1I3QB 4PMWA 1KAAA 3NPPA 2SDFA 5M3FB 3DM1A 1H9JA 2QF7A 4N9PA 3EFXD 2F3WA 1II3A 1EY8A 4IZ8A 5TSSA 2HCCA 2HUGA 2RDGA 2HDMA 1SSOA 2JEBI 1SNCA 2XWJB 2X6GA 1O78A 2XVSA 1Q8IA 1EZ6A 2K05A 1EZ8A 1SE2A 5CR3A 1AP0A 2L11A 4KN7C 2SOBA 3EVQA 3MEHA 5DNFA 2A5HA 2E2JB 3VA7A 5C4XB 4QMGA 4A3JB 4CHTB 2SNSA 3KF8A 3T13A 1HQMC 3EQLC 1V1PA 4RGTA 3S14B 4OIKA 5I9OA 2FMMA 3QB3A 4RGOS 2RDHA 3D8GA 1TIID 5JPNC 1B3AA 1SE4A 1TU2B 4NMZA 2B2WA 1GHKA 2K5QA 1PTOF 5IGBA 2J0TD 2B2VA 3K7AB 3NK9A 2ENBA 4EQNA 3PUVA 2JXMB 2A6HD 3VYSA 1IW7C 1GUGA 4F7XA 1ENFA 5JEAG 2EVBA 3A7LA 4KV6A 1G2TA 4MN3A 1J8IA 4DXFA 4RKLA 3H6MA 4I65A 4HCEA 3L3OC 3QIAA 5KIXA 5C0XH 4H44C 3FPUB 3LX0A 2PO4A 5C4ZA 2AUKA 1DM0B 4B08A 3S16B 1STBA 2R6GA 3OOCA 1LABA 2Q8TA 4X3UA 4J1MA 2F0EA 2A69D 2PNRC 2EYJA 1PRTB 2A73B 3P20A 4TRDA 3TP5A 3P1HA 1HCZA 2B2YA 1CA5A 3IFDA 1CA6A 4Z9CB 5IGEA 3N52A 1FGBD 3OIPA 1D2BA 4KJNA 1Q3LA 3D6WA 1VCIA 1ML0D 1A3TA 2EY5A 5ELEA 1ZYRC 2EYPA 2RQXA 3TBIB 2JA7B 3PUXA 2K5DA 2OEOA 2AQ2B 1HA6A 1I6VC 2PMZB 2C9OA 1SNMA 1VF7A 1YNJD 1Q1BA 1EIHA 1HTPA 3ZYYX 3GTLB 2WKDA 3X3MA 1Y1VB 2L4NA 5A35A 3J7YW 3G7LA 3HOVB 1GHJA 4C3JG 1U4LA 3FRPB 2ZT9C 2J7ZA 5K5PA 4A3KB 1EY9A 3RD4A 1QCBD 4U68A 1F77A 1KLGD 3CRLC 5NUCA 4ZQ3A 4CKCA 1QWYA 1STHA 2YYZA 1TR5A 2E76C 1QG7A 4KD3A 4RHRA 3I4MB 3E5SA 2NWGA 2B63B 3M3YB 2A68D 1FD7D 1ENCA 2PYKA 3EA6A 4X3KA 1UAPA 1D5XC 3HEJA 2F0KA 4XQJA 1DD2A 1OO9B 1PTOH 1JOOA 1F9QA 1JWMD 3OWEB 1LO5D 5ELFA 2F0VA 2Z4HA 1TWFB 2TMPA 5ELBA 1EU4A 1PZJD 2A74C 4S3SA 2XRQD 3HKZB 5IGFA 2LS01 3J7AF 2QCPX 1RTNA 4I7ZC 4DNTB 4DXGA 4MIUA 1ILQA 2K28A 3CKIB 3K57A 1CTMA 3TDQA 4IUUA 3EROA 4O1NA 2FJ2A 1B1ZA 3DHQA 3BVGA 4CJ0B 4JK1C 5C5MA 1C4QA 2PZTA 3MFGA 4K2LA 2VB2X 2B8FA 5BN5A 3L9AX 1GUSA 1LLRD 1KNAA 2BA0A 1OXXK 3S1MB 4O42A 3QOJA 2EJFC 2A6ED 2NTSA 4C3IB 2ICEC 4BA1I 4B9WA 1LACA 3TN2A 3NXWA 4ME5A 3M7NA 2MUYA 3GTPB 1I6HB 1WTQA 2MPMA 4OHJA 3U9OA 3K5NA 1JE4A 4BBRB 3IAYA 1G2SA 4CJ1B 3HP3A 2IX3A 1EEID 1HA5A 1PRTD 3J80E 1TVXA 1SE3A 3FVQA 4DF7A 4KY5A 2Z1CA 2NTTA 4FF1A 4HSVA 4RFBA 1JOQA 2EYLA 4Q0FA 2XSCA 2B2TC 3A54A 1KDAA 5M5YB 1LT3D 2F0LA 4DAVA 5BN4A 5KNBA 3G6JB 1SNOA 1GUWA 2EDGA 3H09A 3TP7A 1I4HA 2DNEA 5CORA 4NW2A 4XIGS 2XNAC 3NTHA 3GD7A 4V190 3TZDA 2E75C 1QILA 4ZUJA 1PFMA 4FNFA 3T4AC 2E74C 4TQUS 5KYIA 5CV7A 5FOBB 2IJ0A 2WB1B 3FDTA 5CV9A 3M4YA 2QKIC 3T56B 3OPOA 2HQEA 1RHPA 4IUTA 2F3VA 1TT2A 5C3EB 4NKLA 1X3QA 1NR4A 4BY1B 1DYQA 4LJZC 4OO1G 4NDXA 4DFAA 1FNUA 1BCPD 5G3LD 2O5JC 1AEXA 2V4DA 4P2CB 1O7LA 1PZKD 4XXEA 3PMFA 2F1MA 4A3GB 1BQQT 2R61A 1I4RA 2Q8RE 3VYUA 1JB3A 1F2ZA 1Y1WB 2QDBA 4G7HC 2F0PA 2F0QA 5IIFA 1CQVA 4RCNA 2XIWA 2CW0D 2H1EA 1KABA 4PMCA 1A15A 1YNND 1QB5D 4RKBA 1LV9A 2MHVA 1S5BD 4X3TA 4YIJA 1U4MA 2KVMA 1ZKOA 5CGKA 3I91A 3ONAB 5HURA 1SDFA 4ID6A 1EFID 2D5DA 3S1NB 1FR3A 3AU7A 1LTGD 1LTID 2AWNA 1STEA 3QG1A 3TSSA 1BOSA 4C1NK 3VR3A 2EY1A 1JORA 2ID0A 1WVLA 1O7ZA 5EPKA 2JA8B 5I2YA 4BY7B 4KD4A 2RKSA 3CHBD 2L55A 3K6OA 4L6TB 3T16A 4A3FB 3J80L 3Q23A 2EXZA 3MFYA 3X3NA 2KUMA 1PXUA 3R8BA 1MGSA 4QB4A 5ISRA 1JCKB 3ND8A 2WIIB 1U4RA 1TWCB 2F03A 4PQXA 3CRKC 5FO8B 4IFDI 3MC0B 1RJTA 4XQQA 3NHHA 3OMGA 3E6ZX 2RDFA 2KCCA 3DWQA 1GJXA 4K8JA 1TKWB 3M4OB 3P75A 1U4PA 4FVMA 3C1FA 1DOMA 5LHY1 1S5CD 2C5CA 1E2ZA 1MD2D 1SJHD 1GOZA 2FINB 4WJWA 1SYDA 5C6AA 2RSOA 1V43A 1EYAA 2EZVA 4R8NA 4RH6A 2PPBC 4OO1I 5CYUA 1SBBB 5FLXL 4K14A 2J4XA 4DGZA 2NN6G 4PNYA 1HFNA 1SJED 5IOCA 3ITPA 4HCSA 2JA5B 3MTSA 1EY5A 3I90A 4BS9A 4A93B 3A8IE 1EYCA 2B2TA 4RA8A 4A3MB 5LL6S 1QNKA 4X3SA 1B2TA 1S5DD 3LNNA 1NCVA 1IYVA 1W6KA 4KHVA 5CV6A 5JEAJ 1HTLD 1H9KA 3IKJA 1BR9A 5CV5A 3OSOA 3R93A 1YNJC 3S1RB 2RVLA 3DEPA 4RAUC 1RODA 2KHSA 1G8ZD 3Q0AA 3DEOA 1AZPA 4ULLA 2EYFA 4C3HG 4FF2A 3PUZA 4ABNA 3S9WA 3WOFA 1Q90A 1GXDC 2KQ3A 2JEAI 2RSNA 2FFKB 1PTOC 4OGQC 3PV0A 5IODA 4DK0A 5DAUA 3LWEA 2EYMA 1D5ZC 2LKVA 5JVH3 2D9UA 4CJ2C 3SXHA 3DXJC 3HZXA 5EQ0A 2H4OA 4R8IA 1CHPD 2BDOA 3IFTA 1LTSD 1TS4A 2A68C 1B53A 5F2DA 1BUVT 3NP8A 4H0LC 5EBDA 1KDBA 2O4XA 5D3IB 2F0FA 1S5FD 3HGBA 1GUTA 4K5WA 4K6DA 4F8MA 1UEAB 2M9VA 3RMHA 2OXPA 4V0BA 3SDZA 5IGCA 5DM73 5E4WC 3VYTA 4FF3A 3BS1A 2R3ZA 3GTOB 5K36G 3NBIA 2F0UA 2R93B 5JOBA 5EBCA 4F87A 4KY6A 1PRTF 1QOHA 2D2CC 3Q6SA 4XQNA 2IT1A 4J8QA 4M1UB 3BVMA 3D4DA 1BXTA 1VMCA 3KLSA 1JR0D 3DMUA 1SNQA 1I50B 1CK1A 1TQOA 2MJ8A 1EY4A 4CKEA 5T1IA 1SNPA 1Y8OB 1IW7D 3AMUA 3QJYA 1I4XA 2F0DA 3VYRA 5DM63 2NN6I 3R2IA 4RGNA 5COYA 4MHEA 4DAYA 2QEJC 3RUZA 2HDLA 3VR5A 2GA4B 4HAEA 1EWHA 2JE6I 3URYA 3I72A 4KN4C 2NVYB 1F9PA 1BBXC 2K01A 1CI3M 1QE6A 3GTMB 2F0OA 2IWHA 3SHLA 5I6YA 2L0CA 2NVXB 2TSSA 2VB3X 2E2HB 3A56A 1CFMA 1DCZA 3I4LA 1B4OA 1BDOA 3MWYW 1KLUD 2XN9C 1A2UA 2SEBD 2IW3A 3MVVA 2ICIA 3D3RA 2EYHA 3KK7A 4KI0A 4UAIA 5FK9C 3SK6A 4ZAIA 5D65A 1Z47A 1HXYD 4QF4A 3BZDB 2KOLA 1BCPF 2RA4A 4G4KA 5G3LF 5C3WA 4RWSC 2EJGC 1D5MC 5CV4A 3V05A 2I07B 1Q1EA 3GP7A 3S2DB 2XRSD 1A3VA 1I4QA 2L1BA 2G9DA 3HG9A 1L0XB 1H9RA 1SAPA 3GQBA 1K8MA 4LMQD 5C0XG 3M7GA 3TP6A 2L9HA 1EY7A 3BYYB 2AWOA 1G91A 1PMRA 2WV6D 5D14A 1OXSC 4GZYC 1MSGA 1F9SA 2OT2A 1HRJA 4G57A 1H9SB 5IGDA 5D3DA 2M2LA 2BE5D 4CKBA 3LWUA 3VR4A 2DY8A 4FXKC 3SEBA 1LTRD 4ILWA 2LY7A 2M00A 4KMUC 1RDPD 3C3LA 3D4WA 1G291 1TS2A 2CW0C 4Q5VA 1WTPA 4IFDJ 2WINB 1CM9A 3TMEA 4QUCA 3KUPA 4QIWB 4R9WA 3QWNA 2B2VC 4IFDG 2PW5A 2E2IB 3PO3B 3C1EA 2L5TA 5BN3A 1CT1D 4DNRB 5EGTA 2ZXRA 1QJOA 4IUPA 1ET9A 4H7BA 1Y8NB 4TSSA 5FLXE 2IL8A 4L63B 1KTKA 1BF4A 2PCFB 2VXWA 3NWTA 1SEBD 4CGYB 1STGA 2F4IA 2KA7A 3BDCA 4HTHA 3FKIB 2E2DC 1EY0A 3A8KE 2Z8LA 5KNCA 3EJIA 3PUYA 1ESFA 3R2TA 4C2MB 1O80A 1TY2A 4IUNA 3NSWA 2IX1A 2B39A 3J81L 4ZKBB 5IGGA 3MZ5A 1OXTA 1LTBD 3NBHA 4A3EB 5A2QL 3OWFA 2VNUD 1M8AA 4KJOA 1HHVA 2X6LA 2NVTB 3U9SA 3MXUA 2JA6B 1XXGA 2K5WA 4KK7A 1A6XA 3V96A 2B2YC 2F0WA 1AN8A 1K83B 2O5IC 1ZEQX 1KDCA 2L12A 1EEFD 4U673 4L8JA 2B8GA 1DOLA 1LTAD 3CU7A 2K04A 1WTVA 5JEAH 4XTCS 2WKCA 4PMBA 1JICA 2F0SA 1S4ZA 1GUOA 2F0MA 3WDNA 4HN7A 1E2WA 3MXGA 2G9HD 4K8IA 4WORA 5C0XI 3T51B 1EQVA 5I6WA 4XT3B 4IQZA 3HOWB 3S15B 4IUVA 2K03A 3GV6A 1PFBA 4XYOA 4H13C 1L0YB 3UI2A 5C5LA 3TP8A 3NTKA 2N88A 1WD1A 3H91A 1BNZA 4KY7A 5I2XA 1TS3A 3I8ZA 1B9MA 4IALA 3PIO3 2EOTA 1MBYA 3K5MA 5FO7B 4M8AA 2A6HC 4IURA 1JWSD 2LFNA 3NUCA 3GO5A 2NB0A 3K5LA 5K36H 1DZ1A 1TWGB 4HR7B 1KNEA 1NAPA 1IHZA 2PZWA 5E1FA 5EJWA 1WTOA 4K6LA 1WTWA 3NE5B 1IKMA 3DUZA 5JJZA 3PUWA 2WACA 4XYQA 5LL6X 2F0IA 5CBAE 5C4JB 5IT9L 1O7YA 1T5EA 4RHSA 2KEEA 3AB9A 4ZKCB 2NYZD 2O2LD 1Z6HA 2NUCA 1SMYD 2ZXPA 3V2TA 2A69C 2BDNA 1HPCA 2EY2A 1PTOB 4WRDA 1H9MA 3I73A 1K8OA 1CQFA 3HS0C 4DU9A 3Q22A 3OHXC 3NQIA 2EYOA 3H94A 4ZYSA 3W2DA 3E0JA 4PV1C 3KLSX 2BCOA 1SYBA 3PO2B 4JBWA 1AFPA 3KLRA 2K1BA 3J7AV 4BA2I 2KEDA 4F88A 3N6RA 4KKTA 5KNDA 4A3DB 1UNSA 3C46A 1SFOB 3MXPA 2CVRA 1R4QB 1I4PA 3MXNA 2YU9B 1AZQA 3HOUB 1EIGA 1SXTA 1ET6A 4UDUC 1EWCA 1WTXA 1TS5A 1H9SA 2Q8IB 1STNA 1A3UA 5M3MB 2F0NA 2N55A 3I4NB 1VF5C 2F0HA 4HSPA 2K32A 1ESRA 2CQAA 5EPJA 3SK8A 1STYA 2PW7A 1EY6A 4C56C 4K5VA 4G7OC 2BOSA 5CMDA 1LTTD 2K7VA 5KGUA 2F0GA 1EL0A 1WTRA 4ZK9B 4C3IG 2LMCB 1DXMA 3HRZC 1F9RA 1BO0A 1ONLA 1VDZA 1LT6D 4OL7A 2CHBD 5I9PA 3I70A 3MHBA 4DK1A 1GUNA 4ZLTF 4G7ZC 3BDOA 1OXVA 3PIP3 3S17B 1CZWA 1IL8A 3QO2A 4RGMA 5E3FA 1D6EC 3M85A 1QNUA 3ND9A 5KRUA 1Y69U 1D1IA 4DAPA 5E4XA 3BYTB 3D31A 4EQOA 3RLFA 4IFDH 2A6EC 5AFWA 3JAML 1LT4D 3K0YA 3TZUA 2KECA 1AW7A 1XX8A 1RD9D 1RF2D 1XTCD 2DY7A 4WFN3 4HMIA 5M9OA 1FYCA 5M5XB 1I4GA 4DN4M 5ELDA 5J22A 1JOKA 2KCNA 2AUJD 2B2UC 5J39A 5CC4A 1PRTC 2K6AA 4CBVA 2IPKD 1HUMA 5EKLA 3SK4A 5C3XA 1MI2A 1B44D 1PTOD 3J81E 4RCOA 2BE5C 4J6HA 1SYFA 4OO1H 3GTGB 3GTJB 5A2QE 4N9TA 3RZDB 1PDQA 3SVMA 3H0GB 2Z4IA 3SK5A 2EY6A 3W3AA 3S1QB 4KKUA 1FNVA 4FXDA 1F2YA 1CHQD 1X32A 1U9RA 1IYUA 1Z7TA 2JP1A 1BCPB 4KTAA 4XT1B 2F0JA 4C3HB 3GV3A 3L7ZC 1FNWA 2R7ZB 4OIJA 3NQTA 3HOZB 2IX0A 3GTQB 3S2HB 4ZUIA 2MGSA 3VR2A 1JQYD 1V1PB 4EVOA 1B50A 5DEHA 1DJRD 3BDLA 4NP5A 1NUCA 1ZYRD 1SYCA 5C0XJ 1Q12A 4EGVA 1C8CA 1RKNA 4TKOB 1M4VA 2SNMA 3MA2B 4Y7NB 1ICWA 3HOYB 1D1KA 3FMCA 5JAVA 4K2KA 5CBEE 5M5WB 2D62A 1C48A 1G6ZA 3BVZA 3T53B 1XYIA 2ZXOA 3R3OA 3Q24A 1TWAB 1E0BA 3I3CA 1BCPC 1F2MA 3FEWX 5FKAC 1R9TB 1EQTA 1MSHA 3BG3A 4QCLA 4A3IB 4FO2A 3K59A 5JVG3 1E2VA 1ILPA 5EKKA 2XWBB 1XWEA 2FMCA 3OW7A 1LT5D 1VMPA 2FHTA 4LAAA 1YNNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHV A;  1II3 A;  5CV6 A;  3U9O A;  1F2Y A;  5JOB A;  5C3W A;  4WRD A;  2EXZ A;  1U9R A;  4KY6 A;  1EY8 A;  4H7B A;  4IZ8 A;  4NDX A;  5CV5 A;  4DFA A;  3OSO A;  5DAU A;  5KIX A;  5C5L A;  3TP8 A;  5K5P A;  4KTA A;  4QB4 A;  5ISR A;  1EY9 A;  1AEX A;  5CV4 A;  4DU9 A;  3LX0 A;  2F0J A;  3T16 A;  5C4Z A;  3OMC A;  2EYO A;  4OL7 A;  2KHS A;  1SNC A;  4DF7 A;  5I9P A;  1A2T A;  1A3V A;  1EYD A;  4KY5 A;  3D4D A;  2F0T A;  3MHB A;  3PMF A;  5NUC A;  4B9X A;  4KY7 A;  3NQT A;  4ZQ3 A;  4K5X A;  5C4H A;  3DMU A;  1STB A;  1EZ6 A;  1SNQ A;  1STG A;  2EYF A;  1EZ8 A;  4ZUI A;  1JOQ A;  1STH A;  1TQO A;  1SYB A;  2EYL A;  1TR5 A;  2RBM A;  3BDC A;  5CR3 A;  4HTH A;  1EY4 A;  3S9W A;  4IAL A;  1EY0 A;  2SOB A;  3EVQ A;  4KD3 A;  1KDA A;  1SNP A;  4EVO A;  5KRU A;  3TP6 A;  2KQ3 A;  3E5S A;  3MEH A;  3EJI A;  5CV8 A;  1EY7 A;  1NSN S;  1STA A;  2F0L A;  3NHH A;  5DEH A;  3BDL A;  1F2Z A;  5E3F A;  4NP5 A;  1NUC A;  3OMG A;  1ENC A;  2PYK A;  2F0D A;  2QDB A;  4IUN A;  5IOD A;  4QMG A;  5KYL A;  1ENA A;  1SYC A;  1SNO A;  2F0P A;  2F0Q A;  3HEJ A;  2F0E A;  1SYE A;  2EYM A;  2F0K A;  2SNS A;  4J1M A;  2RDF A;  2EYJ A;  5IGG A;  3MZ5 A;  3T13 A;  4K8J A;  3MXP A;  4TRD A;  2LKV A;  4PMC A;  1KAB A;  3TP7 A;  1JOO A;  3TP5 A;  3OWF A;  3P1H A;  3D6C A;  4G57 A;  4KJO A;  4EQO A;  3P75 A;  5KEE A;  4RKB A;  3C1F A;  1RKN A;  3NUC A;  5IGD A;  3SXH A;  3VA5 A;  2F0V A;  3HZX A;  3RUZ A;  3QOL A;  5IGE A;  2SNM A;  4ODG A;  5I9O A;  4YIJ A;  4EQP A;  5IIF A;  4KJN A;  3QB3 A;  5JAV A;  4S3S A;  4K2K A;  5CGK A;  2F0W A;  1SYD A;  5C6A A;  5IGF A;  4HMI A;  3D8G A;  5M9O A;  1EYA A;  1A3T A;  3R3O A;  5HUR A;  1KDC A;  4ZUJ A;  4R8N A;  5J22 A;  2M00 A;  2EY5 A;  1JOK A;  4NMZ A;  1IHZ A;  5F2D A;  2EYP A;  4ID6 A;  5KYI A;  2PZW A;  5CV7 A;  5E1F A;  1F2M A;  3D4W A;  3NP8 A;  4MIU A;  5J1Z A;  1STN A;  5J39 A;  1A3U A;  5CC4 A;  2PZU A;  4K14 A;  5IGB A;  1KDB A;  5EKL A;  4DGZ A;  2OEO A;  4PNY A;  3SK4 A;  2O4X A;  2F0F A;  3ITP A;  5CV9 A;  5IOC A;  2WAC A;  3ERO A;  5C3X A;  2F0O A;  3DHQ A;  2F0I A;  3SHL A;  3TME A;  5I6Y A;  2F0N A;  5C5M A;  2OF1 A;  2HQE A;  2PZT A;  4K2L A;  2EY1 A;  3NK9 A;  1SND A;  1SNM A;  2F0H A;  4PMB A;  5HGT A;  1JOR A;  4J6H A;  2ENB A;  1SYF A;  4K5W A;  2F0S A;  4E6I A;  4EQN A;  2F3V A;  4K6D A;  1EY5 A;  2PQE A;  2F0M A;  3ERQ A;  3SK8 A;  4F8M A;  1STY A;  1TT2 A;  4N9T A;  1A2U A;  2PW7 A;  5EKK A;  2OXP A;  4HMJ A;  1EY6 A;  3SR1 A;  1EYC A;  4K5V A;  4KD4 A;  3MVV A;  3QOJ A;  4F7X A;  2NUC A;  5IGC A;  2EYH A;  2PW5 A;  1SYG A;  4NKL A;  2RKS A;  4K8I A;  4WOR A;  3SK5 A;  1KAA A;  2EY6 A;  4KV6 A;  3SK6 A;  3V2T A;  5KGU A;  2F0G A;  3C1E A;  1EQV A;  4B9W A;  5I6W A;  2F0U A;  4LAA A;  3NXW A;  4ME5 A;  4QF4 A;  4RKL A;  4N9P A;  5EGT A;  3H6M A;  4I65 A;  2F3W A;  2EY2 A; 
#chains in the Genus database with same CATH topology
 4B3M L;  1PLF A;  1WI5 A;  4LF4 Q;  2B2W C;  3F2U A;  2ZTC A;  4FP5 D;  2QA4 A;  4JI4 Q;  2MO1 A;  1HQR D;  4CDF C;  2DNC A;  2JYO A;  5EPL A;  5T1G A;  1PZI D;  4C3J B;  1A2T A;  4JI7 L;  4DR4 L;  5IT9 E;  2VZA A;  4B9X A;  5C4H A;  1WCM B;  1TXY A;  2N8N A;  4BWG B;  4LF8 Q;  4QUF A;  2BA1 A;  1CZG A;  2X69 A;  1RTO A;  4DV2 Q;  2PQA B;  2EE1 A;  1TWH B;  1STA A;  1JMC A;  4ZRZ A;  2JA7 H;  4JI2 L;  1F2L A;  1KD1 C;  1X3P A;  1CKM A;  1X55 A;  4X65 Q;  3TS2 A;  1DOK A;  3CQZ B;  2JSO A;  1V1O A;  1CSQ A;  1V8Q A;  4HED A;  3NWS A;  3D6C A;  5IP7 H;  1K9M C;  2HT1 A;  4LFB L;  1E1T A;  2DN8 A;  4KKS A;  3W1G A;  4XDX A;  3PSI A;  4EQP A;  3U58 A;  3GTL H;  1DON A;  2NN6 H;  2WP8 J;  1YJ9 A;  1PH7 A;  1TY0 A;  1CKN A;  5EKI A;  1J9O A;  1Y1V H;  1EUJ A;  4A3B B;  3D0F A;  3WOE A;  2UXC Q;  1I50 H;  1JB7 A;  3D4R A;  3HOV H;  4OEL B;  5I4D A;  2WAQ B;  4LF5 L;  1OXU A;  1UWV A;  4JBM A;  2PZU A;  2PMZ E;  5HGQ A;  5IYB H;  2EJM A;  3OIQ A;  3P7J A;  4DR7 Q;  4FXG C;  2MP1 A;  4A3K H;  1SND A;  2NZ1 D;  2VUM B;  2HIV A;  4E6I A;  3K5O A;  3NEL A;  3KBG A;  3ERQ A;  1IKL A;  1HFG A;  3SR1 A;  4HMJ A;  1VQJ A;  1HZA A;  5J3B A;  3FHW A;  4UP9 A;  1SYG A;  3HOX B;  1B9N A;  4C1N I;  1Q82 C;  3KBX A;  4JOI C;  1EU3 A;  3A55 A;  3I4M H;  4A93 G;  3F8T A;  1RCV D;  2B63 H;  2R7F A;  4DR2 Q;  3M3Y H;  4BBS B;  1W2B A;  3KJP A;  4FYD A;  4LF6 L;  3VR6 A;  4DR5 Q;  4IN3 A;  2KCT A;  4MZ9 A;  2QIL A;  4POF A;  2R92 B;  3I2Z A;  1PHJ A;  3O13 A;  1MKH A;  2NVY H;  3PO2 G;  2NVQ B;  1NR2 A;  1VQM A;  2YV5 A;  1ZXT A;  3DWP A;  2OTL A;  3K81 C;  1HUN A;  3OMC A;  1TWF H;  4A3D G;  1EYD A;  1WD0 A;  2F0T A;  3FPP A;  1SMY C;  1VQF A;  2VS1 A;  3NTI A;  4K5X A;  4GN5 A;  4LK1 C;  2RBM A;  4KLK A;  1K8A C;  1UUP A;  2NBF A;  2HCI A;  5ELC A;  5JPM C;  1IBK L;  5C44 B;  3GTK B;  2B2U A;  5CV8 A;  1NSN S;  3MAQ A;  5IY0 A;  1IYJ B;  2DGY A;  3T1H Q;  5KYL A;  1ENA A;  1T5X D;  2AQ3 B;  3KYH C;  1IBL L;  2Z6B A;  1SYE A;  1KL9 A;  1PFN A;  1Y8P B;  4ALP A;  5FJ8 G;  3AQQ A;  2K33 A;  1MJE A;  1W6J A;  1K73 C;  5KEE A;  4YHH L;  1JWU D;  2Y0S B;  3SE0 A;  5IYD H;  4KHZ A;  3VA5 A;  1EOT A;  3QOL A;  4ODG A;  1JC7 A;  4IUQ A;  3S1M H;  1PYW D;  4FF4 A;  4C3I H;  2QDL A;  3A8J E;  5M3M G;  3I4N G;  4AYB B;  4HJ9 A;  3GTP H;  1G6P A;  1I6H H;  5J1Z A;  2UXD L;  2AQ1 B;  1S5E D;  2LXK A;  4BBR H;  2MO0 A;  3DWA A;  2KJX A;  3C2P A;  2OF1 A;  4DA2 A;  2I46 A;  2MQH A;  3IL8 A;  5HGT A;  1R4P B;  3K58 A;  1BBU A;  2PQE A;  3A7A B;  5FO9 B;  4N8X 1;  3H3V C;  3RZO B;  1JE5 A;  4GNX A;  3CF5 A;  3JAM E;  2EPB A;  1I3Q B;  4PMW A;  1GVP A;  1KAA A;  3RR5 A;  3NPP A;  2IHF A;  2SDF A;  5M3F B;  4DV0 L;  3DM1 A;  1H9J A;  2QF7 A;  4N9P A;  5DLQ E;  3EFX D;  2F3W A;  1II3 A;  1A63 A;  1PH4 A;  1IZ6 A;  1EY8 A;  4IZ8 A;  5TSS A;  2HCC A;  2HUG A;  2RDG A;  2PI2 E;  1ICF B;  2HDM A;  4DPG A;  2R93 G;  1SSO A;  2JEB I;  1EIF A;  1SNC A;  3CC7 A;  3CCS A;  1VQ8 A;  4A3L H;  4B3S L;  2XWJ B;  2X6G A;  1SLJ A;  3CMA A;  1B3Q A;  1O78 A;  2XVS A;  1Q8I A;  1HNW Q;  1EZ6 A;  2K05 A;  1EZ8 A;  2N49 A;  4RMF A;  1SE2 A;  2DJF C;  5CR3 A;  1AP0 A;  2L11 A;  4JCV E;  4KN7 C;  2SOB A;  3EVQ A;  2IHE A;  4AIM A;  3MEH A;  5DNF A;  2A5H A;  2E2J B;  3VA7 A;  5C4X B;  1IL2 A;  1HH2 P;  4DUZ Q;  4AQY L;  4QMG A;  2ZJQ A;  4A3J B;  4CHT B;  2SNS A;  5LMU Q;  3KF8 A;  3JC6 6;  1HQM C;  3T13 A;  1XTD A;  1QZH A;  3EQL C;  1V1P A;  4JI3 Q;  4RGT A;  3S14 B;  4OIK A;  5I9O A;  3CCJ A;  4GOP A;  2FMM A;  2E8G A;  3QB3 A;  4MTN A;  4RGO S;  5C3E H;  2RDH A;  3D8G A;  1TII D;  1X3G A;  5JPN C;  3UDG A;  2F3I A;  1B3A A;  1SE4 A;  1T9H A;  1HNX L;  1UE6 A;  4BY1 H;  1P16 A;  1TU2 B;  3PGZ A;  4NMZ A;  2PNH A;  2B2W A;  1GHK A;  2K5Q A;  2AHO B;  3MEF A;  4JC0 A;  1PTO F;  1KC8 C;  2WB1 E;  5IGB A;  1YJW A;  2J0T D;  3BZC A;  2HHH Q;  2B2V A;  3K7A B;  3NK9 A;  1J5E Q;  2ENB A;  2DJG C;  4EQN A;  4DAM A;  3PUV A;  1KQS A;  2JXM B;  2A6H D;  3VYS A;  1IW7 C;  1GUG A;  4F7X A;  1ENF A;  5JEA G;  4A3G H;  2EVB A;  3A7L A;  4KV6 A;  1YEZ A;  1G2T A;  4MN3 A;  1L1O B;  1J8I A;  4OX9 L;  4DXF A;  4RKL A;  3H6M A;  4I65 A;  4LF7 L;  1Y1W H;  3ER0 A;  4LW1 A;  4HCE A;  3CAM A;  3L3O C;  2PI2 A;  3HOZ G;  3QIA A;  5KIX A;  5C0X H;  4H44 C;  2C35 B;  3FPU B;  4QQB X;  5JJI A;  3LX0 A;  2PO4 A;  3K0X A;  5C4Z A;  4JI6 Q;  2AUK A;  1DM0 B;  1EWI A;  4B08 A;  4DV3 L;  3S16 B;  3H3V H;  1STB A;  5IE8 A;  2R6G A;  3OOC A;  3U50 C;  1FVI A;  4LFA Q;  3J80 i;  3ULJ A;  4QY7 A;  3CCU A;  1LAB A;  2Q8T A;  4JI8 Q;  3HOY G;  3S1N H;  4X3U A;  2ZM6 L;  4J1M A;  2F0E A;  3HOW H;  2A69 D;  2PNR C;  2EYJ A;  1PRT B;  2A73 B;  3P20 A;  1Z9F A;  4TRD A;  3TP5 A;  4JI4 L;  3P1H A;  1HCZ A;  2B2Y A;  1CA5 A;  4BXX H;  3IFD A;  1CA6 A;  2PQA A;  4B3T L;  4Z9C B;  5IGE A;  3N52 A;  1FGB D;  3OIP A;  2JA8 H;  4P71 A;  1D2B A;  4KJN A;  1Q3L A;  2CQO A;  1L1O C;  4BY7 H;  3D6W A;  4JOI A;  2MFI A;  3T1Y Q;  4A3I G;  1VCI A;  1ML0 D;  1A3T A;  2H5X A;  2EIF A;  2EY5 A;  3DM3 A;  5ELE A;  1ZYR C;  2EYP A;  2RQX A;  2RCN A;  4A3F H;  3TBI B;  2JA7 B;  2Y0S E;  3PUX A;  2K5D A;  2OEO A;  3G71 A;  2AQ2 B;  1HA6 A;  1I6V C;  2PMZ B;  2C9O A;  3LGJ A;  3F1Z A;  1HZC A;  1SNM A;  1VF7 A;  1YNJ D;  3L0O A;  1Q1B A;  3CXC A;  4DR1 Q;  3J7A 5;  1EIH A;  1HTP A;  4AYB E;  4DR3 L;  4PG3 A;  1TWC H;  3ZYY X;  1WJJ A;  3GTL B;  4JI1 L;  2WKD A;  3X3M A;  4L5Q A;  1A0I A;  2I5M X;  1SRU A;  1RIP A;  3U4V A;  1Y1V B;  3EBE A;  4I7A A;  4ZCK A;  4GNX B;  2L4N A;  5A35 A;  4IJL A;  1PH6 A;  2NZO A;  3J7Y W;  3G7L A;  4GLA C;  1L0W A;  1GHJ A;  3HOV B;  4C3J G;  2Z6K A;  3AFP A;  1PH9 A;  1VQL A;  5EAY A;  1I94 Q;  2IY5 B;  4X64 Q;  1U4L A;  2F4V L;  1XNR L;  3FRP B;  2ZT9 C;  2J7Z A;  5K5P A;  3ICE A;  3M4O H;  4A3K B;  1EY9 A;  4YWM A;  3RD4 A;  3SGI A;  2ASB A;  1QCB D;  4U68 A;  4APV A;  1F77 A;  4GKK L;  1KLG D;  3CRL C;  5NUC A;  3CPF A;  2VQE Q;  4LF9 L;  2LSS A;  4ZQ3 A;  4CKC A;  1QWY A;  3AEV A;  1STH A;  2YYZ A;  1TR5 A;  2E76 C;  1PYB A;  1QG7 A;  4IPG A;  4KD3 A;  4JI0 Q;  4RHR A;  2A1A A;  3I4M B;  4LUO A;  3E5S A;  2NWG A;  2B63 B;  3M3Y B;  2A68 D;  1N36 Q;  1FD7 D;  1ENC A;  2PYK A;  3EA6 A;  4X3K A;  5FLX c;  1UAP A;  3E3X A;  1D5X C;  2HIX A;  3CME A;  3HEJ A;  2D0P A;  1SRO A;  2F0K A;  4XQJ A;  2RCF A;  1DD2 A;  1OO9 B;  1N8R C;  1PTO H;  1JOO A;  1F9Q A;  2JA5 H;  1JWM D;  3OWE B;  1LO5 D;  3OTO L;  4A3B G;  4DR6 Q;  5ELF A;  1LUZ A;  2F0V A;  2Z4H A;  1TWF B;  2TMP A;  5ELB A;  2WAQ G;  4A93 H;  1EU4 A;  1PZJ D;  2A74 C;  4A3M H;  4S3S A;  2XRQ D;  3HKZ B;  5IGF A;  2N3S A;  2LS0 1;  4HJ5 A;  3J7A F;  2QCP X;  1RTN A;  2JJQ A;  4I7Z C;  4X62 Q;  4DNT B;  2VUM G;  4DXG A;  3W1B A;  1XMQ L;  4MIU A;  1ILQ A;  2K28 A;  3CKI B;  1VQ7 A;  3K57 A;  1CTM A;  3TDQ A;  4IUU A;  2AKW B;  2E5L Q;  3ERO A;  4O1N A;  2FJ2 A;  1B1Z A;  3DHQ A;  3S1R H;  3BVG A;  4CJ0 B;  4JK1 C;  5C5M A;  1C4Q A;  2PZT A;  3MFG A;  4K2L A;  4X66 L;  2VB2 X;  2B8F A;  4BBS G;  5BN5 A;  3L9A X;  1GUS A;  4LUZ A;  1LLR D;  1KNA A;  2BA0 A;  1OXX K;  3S1M B;  2AMC B;  4O42 A;  3UDI A;  3QOJ A;  2EJF C;  2A6E D;  2NTS A;  1EYG A;  2R92 G;  4C3I B;  1PA6 A;  2ICE C;  1ASY A;  2D0O A;  4BA1 I;  3BU2 A;  4LWC A;  1GD7 A;  1D8L A;  4B9W A;  1LAC A;  3TN2 A;  3NXW A;  4ME5 A;  1KRT A;  3M7N A;  2MUY A;  3GTP B;  1I6H B;  1WTQ A;  2MPM A;  4OHJ A;  3U9O A;  3K5N A;  1JE4 A;  4BBR B;  3IAY A;  1G2S A;  4CJ1 B;  3HP3 A;  3VDY A;  2IX3 A;  1EEI D;  2KEN A;  4DV7 L;  1AE2 A;  1HA5 A;  5C44 G;  2UUB Q;  1PRT D;  2UUC L;  3J80 E;  1KRS A;  1TVX A;  1SE3 A;  2B3G A;  3FVQ A;  4DF7 A;  5GAG C;  4KY5 A;  2Z1C A;  2NTT A;  4FF1 A;  4HSV A;  4RFB A;  4DK6 C;  1JOQ A;  2EYL A;  4Q0F A;  2XSC A;  2B2T C;  3A54 A;  1HR0 Q;  1N33 L;  1KDA A;  3CC2 A;  5M5Y B;  1LT3 D;  2F0L A;  4DAV A;  5IYC G;  1RL2 A;  5LMN L;  5BN4 A;  5KNB A;  3G6J B;  1SNO A;  1GUW A;  1G51 A;  2EDG A;  1E1O A;  3H09 A;  3TP7 A;  2BH2 A;  1I4H A;  4UPA A;  5IP9 G;  4AYB G;  2DNE A;  5COR A;  3ERS X;  4NW2 A;  4XIG S;  2XNA C;  3NTH A;  3GD7 A;  4V19 0;  2ZTE A;  3TZD A;  1S3O A;  2E75 C;  1QIL A;  4PZ6 A;  3GTO H;  4ZUJ A;  1XMO L;  1PFM A;  4FNF A;  3T4A C;  2E74 C;  4TQU S;  5KYI A;  5CV7 A;  5FOB B;  2IJ0 A;  1N34 Q;  3E9H A;  2R93 H;  1PH2 A;  1HNZ Q;  2QW7 A;  2WB1 B;  3FDT A;  5CV9 A;  3M4Y A;  2QKI C;  3T56 B;  3OPO A;  2HQE A;  2KCM A;  5M3F G;  1IBM L;  1YIJ A;  2Q2T A;  1RHP A;  4JYA Q;  1VQ6 A;  4IUT A;  2F3V A;  1TT2 A;  4GKJ L;  3PF5 A;  5C3E B;  4NKL A;  2B29 A;  4NXM L;  1X3Q A;  1NR4 A;  1VQB A;  4B3R L;  4BY1 B;  1DYQ A;  2K75 A;  4LJZ C;  4OO1 G;  2JK8 A;  1HJP A;  3UE0 A;  4NDX A;  2N78 A;  4DFA A;  1FNU A;  1BCP D;  5G3L D;  3M4P A;  2O5J C;  1AEX A;  1V9P A;  2V4D A;  4P2C B;  4JBJ A;  1L1O A;  1O7L A;  1NY4 A;  1PZK D;  4XXE A;  3PMF A;  4HJA A;  2G5D A;  5FLM G;  4A3J G;  2F1M A;  1NMF A;  4A3G B;  1Q8K A;  1BQQ T;  3TS0 A;  4DV1 L;  4IO9 A;  2R61 A;  1I4R A;  2Q8R E;  3VYU A;  1JB3 A;  1F2Z A;  2HD3 A;  1Y1W B;  5JJL A;  2QDB A;  4G7H C;  2F0P A;  2F0Q A;  5IIF A;  1CQV A;  4RCN A;  1FJG L;  1AH9 A;  2VQF L;  3GTM H;  2XIW A;  2CW0 D;  4YCU A;  2H1E A;  1KAB A;  4PMC A;  1A15 A;  1YNN D;  2K50 A;  1N9W A;  1QB5 D;  4RKB A;  2NVX H;  2E2H H;  1LV9 A;  2MHV A;  1S5B D;  4X3T A;  4YIJ A;  1U4M A;  5IWA L;  2KVM A;  1ZKO A;  5CGK A;  3I91 A;  1ASZ A;  4JW0 A;  3ONA B;  3HOU G;  5HUR A;  1SDF A;  4ID6 A;  1EFI D;  2D5D A;  3S1N B;  1FR3 A;  3AU7 A;  4GN3 B;  5AJ3 L;  1LTG D;  1LTI D;  5L37 A;  2AWN A;  1XNQ Q;  4HJ7 A;  1STE A;  4DUY L;  1KIX A;  3QG1 A;  3TSS A;  3CPW A;  1BOS A;  4C1N K;  3VR3 A;  2QGQ A;  2EY1 A;  3KOJ A;  2ID0 A;  1JOR A;  3HKZ E;  2OQK A;  1WVL A;  3S2D H;  2Q2U A;  1O7Z A;  5EPK A;  2JA8 B;  5I2Y A;  4DV6 L;  4BY7 B;  4KD4 A;  4LFC Q;  2RKS A;  3CHB D;  3T1Y L;  1YJN A;  2L55 A;  3K6O A;  2K14 A;  4L6T B;  3T16 A;  4JI5 L;  4A3F B;  1IXR A;  3J80 L;  3Q23 A;  5GRO A;  2EXD A;  3AYH B;  2EXZ A;  3MFY A;  2UU9 Q;  3X3N A;  2KUM A;  1PXU A;  1D7Q A;  3R8B A;  1K8G A;  3TQY A;  1MGS A;  4QB4 A;  5ISR A;  1JCK B;  1YNX A;  1E24 A;  3ND8 A;  3TRZ A;  2WII B;  1U4R A;  1TWC B;  2F03 A;  2ZTD A;  4DV5 L;  3OYY A;  1EQR A;  4PQX A;  3CRK C;  5FO8 B;  4JV5 L;  1QVC A;  4UP7 A;  3MC0 B;  4IFD I;  1RJT A;  1SR3 A;  4L5T A;  4XQQ A;  1CKO A;  3NHH A;  1M1K C;  1OTC A;  1H95 A;  1UE5 A;  3OMG A;  1SMX A;  3E6Z X;  2RDF A;  2KCC A;  3DWQ A;  1GJX A;  4B3M Q;  4K8J A;  1TKW B;  1VQG A;  1J6Q A;  1YHQ A;  3M4O B;  3P75 A;  1U4P A;  4FVM A;  3C1F A;  1DOM A;  4JVZ A;  1S5C D;  5LHY 1;  2C5C A;  1E2Z A;  2P5Z X;  3CW2 C;  1MD2 D;  1SJH D;  1GOZ A;  2FIN B;  4WJW A;  1SYD A;  5C6A A;  2RSO A;  4JI7 Q;  4DR4 Q;  3KJO A;  2E2I H;  2CH4 W;  1V43 A;  1EYA A;  3PO3 H;  2EZV A;  4R8N A;  5IP7 G;  4RH6 A;  4DV4 L;  2PPB C;  1QVG A;  4OO1 I;  5CYU A;  1SBB B;  5FLX L;  3G4S A;  4K14 A;  2J4X A;  4DGZ A;  2NN6 G;  4PNY A;  1HFN A;  1SJE D;  5IOC A;  2KHI A;  3ITP A;  1A8V A;  1Q46 A;  4HCS A;  4JI2 Q;  4NPS A;  4Y52 H;  1Y1V G;  2JA5 B;  3MTS A;  3CQZ H;  4YWK A;  1LYL A;  1EY5 A;  3BJU A;  3I90 A;  3HOV G;  4BS9 A;  4LFB Q;  4A93 B;  3A8I E;  1EYC A;  2VL6 A;  2B2T A;  4RA8 A;  4A3M B;  4QJF A;  5IYB G;  4K0K L;  3K7U C;  3FKI H;  5LL6 S;  1QNK A;  4A3K G;  4X3S A;  1B2T A;  1AE3 A;  1S5D D;  3ULL A;  3LNN A;  1NCV A;  3H0G G;  4C2M H;  1IYV A;  1W6K A;  4KHV A;  5CV6 A;  5JEA J;  2R7D A;  1HTL D;  2UXB L;  1H9K A;  4NXN L;  3J81 c;  3IKJ A;  1BR9 A;  4LF5 Q;  2E5L L;  5CV5 A;  3OSO A;  2I5H A;  1YNJ C;  3R93 A;  3S1R B;  4A3E H;  2RVL A;  3DEP A;  4EX5 A;  2V1C C;  4RAU C;  2ZJR A;  2NVT H;  2JA6 H;  1ROD A;  2B63 G;  2KHS A;  1G8Z D;  3Q0A A;  3DEO A;  1AZP A;  4ULL A;  2EYF A;  3K8A A;  3NBH B;  1K83 H;  4C3H G;  1U0L A;  4FF2 A;  3PUZ A;  4ABN A;  3S9W A;  3WOF A;  3PIO A;  1Q90 A;  1GXD C;  2KQ3 A;  2JEA I;  2R7Z G;  1VQH A;  2RSN A;  2FFK B;  1Y14 B;  1PTO C;  4OGQ C;  3PV0 A;  5IOD A;  2CH4 A;  4DK0 A;  1I5F A;  5DAU A;  1C0A A;  3LWE A;  2EYM A;  4LF6 Q;  1YBY A;  3HKZ G;  1D5Z C;  2LKV A;  5JVH 3;  1X54 A;  5BR8 L;  2D9U A;  4CJ2 C;  3SXH A;  1X3F A;  3DXJ C;  3HZX A;  5EQ0 A;  4OWT B;  2H4O A;  4R8I A;  2K4K A;  4KHP L;  2UUA L;  2I5L X;  1B8A A;  3G48 A;  1CHP D;  2BDO A;  4YY3 L;  3IFT A;  1LTS D;  4OON A;  3B6Y A;  1TS4 A;  4IPC A;  2A68 C;  1HZ9 A;  1B53 A;  4LF4 L;  5F2D A;  3J81 j;  5IYD G;  1BUV T;  3S15 H;  3NP8 A;  4R4I A;  3KLW A;  4H0L C;  5EBD A;  4OWW B;  1KDB A;  2GVB A;  2O4X A;  5D3I B;  2F0F A;  1S5F D;  3HGB A;  1GUT A;  1IBL Q;  4R4Q A;  4HIM A;  4K5W A;  4K6D A;  3CCV A;  4LF8 L;  4F8M A;  1UEA B;  2M9V A;  3RMH A;  4YHH Q;  2OXP A;  1VQP A;  2Q2I A;  4V0B A;  3SDZ A;  4DV2 L;  5IGC A;  4P73 A;  4R1J A;  2ES2 A;  5DM7 3;  5E4W C;  3VYT A;  4FF3 A;  3BS1 A;  2R3Z A;  5LMN W;  3GTO B;  5K36 G;  3NBI A;  2F0U A;  4X65 L;  4OXP A;  2R93 B;  5JOB A;  5EBC A;  4F87 A;  2JA9 A;  4KY6 A;  1PRT F;  1QOH A;  3CP0 A;  3RN5 A;  2UXD Q;  2D2C C;  3Q6S A;  1QZG A;  1UEB A;  4JPB W;  4XQN A;  4LUV A;  2IT1 A;  4J8Q A;  4M1U B;  3BVM A;  1PYS B;  1TWG H;  3D4D A;  1PH5 A;  4R4O A;  1BXT A;  1VMC A;  4OWX B;  3KLS A;  1UE1 A;  1JR0 D;  3DMU A;  2UXC L;  1SNQ A;  1I50 B;  1CK1 A;  1TQO A;  2MJ8 A;  3M9B A;  1EY4 A;  4CKE A;  5T1I A;  1E22 A;  1SNP A;  1Y8O B;  4CDE C;  2KBN A;  1WCM G;  1IW7 D;  4A75 A;  3AMU A;  3QJY A;  1I4X A;  2F0D A;  4DV0 Q;  4DR7 L;  4J15 A;  3KDF A;  3VYR A;  1SE8 A;  2NN6 I;  5DM6 3;  3R2I A;  2K52 A;  4RGN A;  5COY A;  4MHE A;  5C4J H;  4DAY A;  5IT9 c;  4R4C A;  2QEJ C;  1NTG A;  3L2P A;  3RUZ A;  2HDL A;  3I7F A;  2Z0S A;  3VR5 A;  2GA4 B;  2WB1 G;  4B3S Q;  4DR2 L;  4HAE A;  1PV4 A;  1EWH A;  3TEH B;  4DR5 L;  2JE6 I;  1VQ4 A;  1HZB A;  3URY A;  3I72 A;  4KN4 C;  2NVY B;  1F9P A;  3TRE A;  1BBX C;  2K01 A;  1CI3 M;  4RG1 A;  1QE6 A;  1LTL A;  3GTM B;  2F0O A;  4AQY Q;  2IWH A;  3E0E A;  3SHL A;  5I6Y A;  5FLM H;  3W5O A;  2L0C A;  3A5U A;  2TSS A;  2NVX B;  2VB3 X;  4BY1 G;  2E2H B;  3A56 A;  1CFM A;  1DCZ A;  1Q81 C;  3I4L A;  1B4O A;  1BDO A;  3MWY W;  1KLU D;  2XN9 C;  1A2U A;  2SEB D;  3KFU A;  2IW3 A;  3MVV A;  2ICI A;  3D3R A;  2EYH A;  3KK7 A;  3PO2 H;  4KI0 A;  4UAI A;  1O7I A;  5FK9 C;  3SK6 A;  1NJI C;  4ZAI A;  5D65 A;  3T1H L;  1Z47 A;  1HXY D;  4QF4 A;  4A3D H;  3BZD B;  5GAD C;  2KOL A;  1BCP F;  2RA4 A;  4G4K A;  5G3L F;  3STB D;  3HOX G;  1HNX Q;  4X6A H;  5C3W A;  5GQO A;  4RWS C;  2EJG C;  1SFO H;  4WJ3 M;  4A3G G;  1D5M C;  1UE7 A;  3RNU A;  5CV4 A;  3V05 A;  2I07 B;  1Q1E A;  3GP7 A;  2YU9 H;  3HOU H;  2XRS D;  3S2D B;  1A3V A;  1I4Q A;  2L1B A;  1PH1 A;  2G9D A;  2HQL A;  5HY6 A;  4QL5 A;  5FJ8 H;  3HG9 A;  3CCM A;  1L0X B;  4A3C G;  1H9R A;  1SAP A;  3GQB A;  1K8M A;  4LMQ D;  5C0X G;  3PIP A;  3M7G A;  3MXN B;  3TP6 A;  2L9H A;  1EY7 A;  3BYY B;  2AWO A;  1G91 A;  3RLO A;  1PMR A;  2WV6 D;  5D14 A;  4OX9 Q;  1VQK A;  4LF7 Q;  1OXS C;  1LM0 A;  1MSG A;  1MIU A;  3A5Z B;  5M3M H;  1F9S A;  3I4N H;  4GZY C;  2OT2 A;  1HRJ A;  4G57 A;  1H9S B;  5IGD A;  5D3D A;  2M2L A;  1EQQ A;  2BE5 D;  4CKB A;  2WFW A;  3LWU A;  3VR4 A;  2KHJ A;  2DY8 A;  1NNX A;  2Y0S G;  4FXK C;  3SEB A;  1YHA A;  4DV3 Q;  1LTR D;  4ILW A;  1VS0 A;  2LY7 A;  2M00 A;  4KMU C;  1RDP D;  5E7N A;  4O0A A;  4BXX G;  2ZJP A;  3C3L A;  3D4W A;  1G29 1;  2JA8 G;  1TS2 A;  1K3B C;  2CW0 C;  4Q5V A;  4BY7 G;  1WTP A;  1VQ9 A;  3I56 A;  4IFD J;  1E3P A;  1CM9 A;  2WIN B;  3TME A;  3JAM i;  1N32 Q;  2ZM6 Q;  4A76 A;  4P72 A;  4QUC A;  3KUP A;  4QIW B;  4R9W A;  1HNW L;  4JBK A;  4A3F G;  3QWN A;  4UHV A;  2K5N A;  2B2V C;  2CWA A;  4IFD G;  4B3T Q;  2PW5 A;  2E2I B;  3S17 H;  3PO3 B;  3C1E A;  4NB3 A;  2L5T A;  5BN3 A;  4DUZ L;  1CT1 D;  4DNR B;  1YIT A;  5EGT A;  5LMU L;  2ZXR A;  1QJO A;  2BH8 A;  4IUP A;  1ET9 A;  4H7B A;  4JI3 L;  1Y8N B;  4TSS A;  5FLX E;  1S72 A;  2IL8 A;  1CUK A;  4L63 B;  1KTK A;  1YZ6 A;  1BF4 A;  2PCF B;  2VXW A;  3JAM c;  3NWT A;  1X56 A;  1EIY B;  1SEB D;  4CGY B;  1STG A;  2F4I A;  2KA7 A;  3BDC A;  1X65 A;  2RF4 A;  5M5X H;  4DR3 Q;  4HTH A;  2A8V A;  3FKI B;  2E2D C;  1EY0 A;  4JI1 Q;  3A8K E;  2Z8L A;  5KNC A;  2GN5 A;  2A19 A;  3EJI A;  3PUY A;  1ESF A;  3R2T A;  4C2M B;  3WWV A;  1O80 A;  1TY2 A;  4IUN A;  3NSW A;  2HHH L;  1NE3 A;  2IX1 A;  2B39 A;  3J81 L;  4ZKB B;  1J5E L;  5IGG A;  3MZ5 A;  2VW9 A;  1OXT A;  1LTB D;  3NBH A;  4A3E B;  5A2Q L;  1XPU A;  3OWF A;  2OCE A;  1M8A A;  4KJO A;  2VNU D;  5C4X G;  3KDF B;  2X6L A;  1HHV A;  4TVA B;  2NVT B;  2CKZ B;  3OW2 A;  3U9S A;  2F4V Q;  3GTG H;  3MXU A;  2JA6 B;  1XXG A;  3GTJ H;  1XNR Q;  2K5W A;  3RZD H;  4DAY B;  1U5K A;  4KK7 A;  1A6X A;  3V96 A;  3H0G H;  2B2Y C;  3F2C A;  2F0W A;  1AN8 A;  1SN8 A;  4GKK Q;  1K83 B;  4HID A;  1ZEQ X;  2O5I C;  5ELO A;  2OQ0 A;  4YCW A;  4LF9 Q;  1KDC A;  2JA5 G;  2L15 A;  3S1Q H;  2L12 A;  1EEF D;  4U67 3;  1JJC B;  2B8G A;  4L8J A;  1DOL A;  2K5V A;  1LTA D;  3CU7 A;  2K04 A;  1WTV A;  5JEA H;  4A3M G;  1GKH A;  3RN2 A;  4JI6 L;  4PZ8 A;  4XTC S;  2WKC A;  4PMB A;  1QUQ B;  4C3H H;  4R4T A;  1JIC A;  2F0S A;  1S4Z A;  4L5R C;  1P8L A;  1GUO A;  2F0M A;  3OTO Q;  2R7Z H;  3WDN A;  4LFA L;  4HN7 A;  1E2W A;  3HOZ H;  3GTQ H;  3S2H H;  3MXG A;  2G9H D;  4K8I A;  4WOR A;  5C0X I;  3T51 B;  4HIK A;  1EQV A;  4JI8 L;  5I6W A;  4XT3 B;  1Q86 C;  4IQZ A;  3HOW B;  2I0Q A;  3S15 B;  4IUV A;  2K03 A;  3GV6 A;  1PFB A;  4FDB A;  1PFS A;  4XYO A;  4H13 C;  1L0Y B;  4POG A;  1XMQ Q;  1C9O A;  3H3V I;  3UI2 A;  5C5L A;  3TP8 A;  3NTK A;  2RHQ B;  2Z6K C;  2N88 A;  1WD1 A;  3H91 A;  4Y7N H;  1BNZ A;  3HOY H;  4X66 Q;  1HR0 W;  4KY7 A;  1WOC A;  5M5W H;  5ELN A;  5I2X A;  2JN4 A;  1TS3 A;  3I8Z A;  1B9M A;  4IAL A;  3PIO 3;  1TWA H;  1B7Y B;  3NEN A;  3QR8 A;  2EOT A;  1MBY A;  3K5M A;  4ME3 A;  1R9T H;  5FO7 B;  2QEX A;  4M8A A;  2A6H C;  4DR1 L;  4A3I H;  4IUR A;  1XJV A;  1JWS D;  2LFN A;  3NUC A;  1PVO A;  3GDE A;  1C7Y A;  3GO5 A;  2OWO A;  2NB0 A;  1EOV A;  3CCR A;  3K5L A;  4DV7 Q;  5K36 H;  1DZ1 A;  1TWG B;  5GAH C;  3A74 A;  4HR7 B;  2UUC Q;  3F2D A;  1KNE A;  1NAP A;  4OEM B;  1I94 L;  1IHZ A;  4X64 L;  1YHB A;  2PZW A;  1CSP A;  5E1F A;  5EJW A;  4K6L A;  1WTO A;  4O2D A;  1WTW A;  1N33 Q;  3NE5 B;  5M5Y H;  1IKM A;  3DUZ A;  2RHS B;  1X6O A;  5JJZ A;  3PUW A;  1XPR A;  2WAC A;  4XYQ A;  1FGU A;  5LMN Q;  5LL6 X;  2F0I A;  5CBA E;  5C4J B;  1XPO A;  1X3E A;  5IT9 L;  3BZK A;  1O7Y A;  2JA7 G;  1T5E A;  2VQE L;  4RHS A;  4C3J H;  2KEE A;  3AB9 A;  4ZKC B;  2NYZ D;  2O2L D;  1Z6H A;  1WCM H;  4GLX A;  4JI0 L;  2GVA A;  2NUC A;  1SMY D;  2ZXP A;  3J81 i;  3V2T A;  2A69 C;  3NEM A;  1N36 L;  2BDN A;  1TWH H;  4DK3 C;  2ATW A;  1W3S A;  2ALY B;  1HPC A;  2EY2 A;  1XMO Q;  2YTX A;  1PTO B;  4QIW E;  1H9M A;  4WRD A;  3I73 A;  3U4Z A;  4DR6 L;  4N8F A;  1K8O A;  3F2B A;  4P75 A;  1CQF A;  4IJH A;  3HFZ B;  3HS0 C;  1PH3 A;  3KF6 A;  4DU9 A;  3Q22 A;  3OHX C;  4A4I A;  3NQI A;  2EYO A;  3H94 A;  1L2F A;  4ZYS A;  3W2D A;  3E0J A;  1IBM Q;  4MNO A;  4PV1 C;  3KLS X;  3CCQ A;  4X62 L;  2BCO A;  3EN2 A;  1SYB A;  3PO2 B;  4JBW A;  1AFP A;  4GKJ Q;  3KLR A;  4A3B H;  2K1B A;  3IRB A;  3J7A V;  4BA2 I;  1YVC A;  1KXL A;  2KED A;  4F88 A;  3N6R A;  4KKT A;  5KND A;  4NXM Q;  4A3D B;  3E9I A;  1UNS A;  3C46 A;  4B3R Q;  1CKN B;  2JQO A;  3I4M G;  2EQS A;  1SFO B;  3MXP A;  2CVR A;  1R4Q B;  2VUM H;  1I4P A;  2F52 A;  3CC4 A;  3MXN A;  2CFM A;  1AZQ A;  2YU9 B;  3HOU B;  1EIG A;  4IOA A;  3AFQ A;  3PQI A;  2LXJ A;  1SXT A;  3H15 A;  1GM5 A;  4CDD C;  1ET6 A;  4UDU C;  3HOX H;  1B70 B;  1EWC A;  1WTX A;  3I55 A;  3CCE A;  1K3R A;  1TS5 A;  4BBS H;  1BKB A;  1H9S A;  2WAQ E;  1X9N A;  2NZH A;  2Q8I B;  1STN A;  1A3U A;  4DV1 Q;  2R92 H;  3I4O A;  2UUB L;  4HIO A;  2NVQ H;  5M3M B;  2F0N A;  2N55 A;  3K80 C;  3I4N B;  1VF5 C;  4A3C H;  1FJG Q;  2F0H A;  4HSP A;  4PZ7 A;  2VQF Q;  2K32 A;  1ESR A;  2CQA A;  5EPJ A;  3SK8 A;  1STY A;  2PW7 A;  3Q8D A;  1HR0 L;  1EY6 A;  4C56 C;  4K5V A;  4G7O C;  1WTH A;  2BOS A;  4L5S A;  5CMD A;  1LTT D;  2K7V A;  1JJ2 A;  1DGS A;  2F0G A;  5KGU A;  5IWA Q;  1EL0 A;  1IBK Q;  5C44 H;  3GTK H;  4GLV B;  1E7Z A;  3CCL A;  1WTR A;  4ZK9 B;  4DNI A;  4C3I G;  2LMC B;  1DXM A;  3HRZ C;  1F9R A;  1BO0 A;  1N32 L;  5AJ3 Q;  1PH8 A;  1ONL A;  1VDZ A;  4BBR G;  1LT6 D;  5IYC H;  4OL7 A;  2CHB D;  4DUY Q;  3UDF A;  5I9P A;  1Q7Y C;  3I70 A;  3MHB A;  4DK1 A;  1GUN A;  2FXQ A;  4ZLT F;  4G7Z C;  3BDO A;  4EQ5 A;  1OXV A;  5H1S E;  1M90 C;  1VQO A;  3PIP 3;  4DV6 Q;  3DLL A;  5IP9 H;  1N34 L;  3G6E A;  3S17 B;  1CZW A;  1IL8 A;  3QO2 A;  3STB C;  1HNZ L;  4RGM A;  5E3F A;  1D6E C;  3M85 A;  1QNU A;  3ND9 A;  5KRU A;  1Y69 U;  1D1I A;  4DAP A;  4JI5 Q;  4JYA L;  3J80 c;  4HJ8 A;  5E4X A;  3BYT B;  3D31 A;  4EQO A;  3RLF A;  3J7Z C;  2A6E C;  4IFD H;  2K5H A;  1JT8 A;  5AFW A;  3JAM L;  1LT4 D;  3K0Y A;  3PF4 A;  3TZU A;  2KEC A;  1AW7 A;  1NBW A;  1MJC A;  1XX8 A;  2OTJ A;  3RZO H;  1RD9 D;  1RF2 D;  1XTC D;  2DY7 A;  1VQE A;  4IPD A;  4LNQ A;  1I3Q H;  4WFN 3;  3S24 A;  4HMI A;  5M9O A;  1FYC A;  1BVS A;  5M5X B;  1I4G A;  4DN4 M;  5M3F H;  4A3L G;  5ELD A;  5J22 A;  4DV5 Q;  1JOK A;  2KCN A;  1V1Q A;  4YCV A;  3UDX A;  2AUJ D;  2B2U C;  5J39 A;  4JV5 Q;  5CC4 A;  1PRT C;  2K6A A;  4CBV A;  2IPK D;  4CDC C;  1HUM A;  1VQD A;  5EKL A;  3SK4 A;  2Q2H A;  5JJK A;  1K0S A;  5C3X A;  3HKS A;  1MI2 A;  1B44 D;  3PO3 G;  4UP8 A;  1PTO D;  3J81 E;  4RCO A;  2BE5 C;  4J6H A;  1SYF A;  4OO1 H;  1BBW A;  3GTG B;  3GTJ B;  1EFW A;  4IPH A;  5A2Q E;  2CWP A;  4N9T A;  1K0R A;  3RZD B;  1PDQ A;  2XGT A;  3SVM A;  3H0G B;  1MHW C;  2Z4I A;  3ULP A;  3SK5 A;  1KHI A;  2EY6 A;  3PCO B;  3W3A A;  3S1Q B;  4KKU A;  1FNV A;  1FL0 A;  4H02 A;  1YI2 A;  2E2J H;  1QUQ A;  4FXD A;  5C4X H;  5C3E G;  4DKA C;  1F2Y A;  4GS3 A;  4A3J H;  1CHQ D;  1X32 A;  4DV4 Q;  1U9R A;  4IOC A;  1IYU A;  1Z7T A;  2JP1 A;  1BCP B;  4KTA A;  3FKI G;  4XT1 B;  2F0J A;  4C3H B;  4WJ4 A;  3S14 H;  1QVF A;  3GV3 A;  3L7Z C;  1FNW A;  2R7Z B;  3KF6 B;  4OIJ A;  4AH6 A;  3RLN A;  3NQT A;  3KF8 B;  3HOZ B;  2IX0 A;  1S40 A;  3FP9 A;  3GTQ B;  3S2H B;  4ZUI A;  2MGS A;  4GNX C;  3VR2 A;  1JQY D;  1V1P B;  4A3E G;  4EVO A;  1B50 A;  4K0K Q;  4JG2 A;  2JA6 G;  5DEH A;  1DJR D;  3BDL A;  4GOP B;  4NP5 A;  1NUC A;  1XNQ L;  1ZYR D;  4P74 A;  1SYC A;  2VY3 A;  3A0J A;  3EIV A;  3M4Q A;  5C0X J;  3CD6 A;  1Q12 A;  1VQC A;  4EGV A;  1C8C A;  1VQI A;  2UXB Q;  3K7A H;  1Y1W G;  4NXN Q;  1RKN A;  1NMG A;  4TKO B;  1M4V A;  2SNM A;  3MA2 B;  4LFC L;  1ICW A;  4Y7N B;  3HOY B;  1D1K A;  3FMC A;  2MNA A;  1WFQ A;  2YTY A;  5JAV A;  4K2K A;  4MTK A;  5CBE E;  5M5W B;  2D62 A;  1C48 A;  1G6Z A;  3BVZ A;  3T53 B;  1XYI A;  2ZXO A;  1GO3 E;  3R3O A;  3Q24 A;  1TWA B;  1E0B A;  3I3C A;  1A62 A;  1BCP C;  1F2M A;  3ZJY C;  2UU9 L;  1VQ5 A;  3FEW X;  5FKA C;  1R9T B;  2YTV A;  1EQT A;  1MSH A;  1VQN A;  4GN4 B;  3BG3 A;  4QCL A;  2DUD A;  4A3I B;  5GAE C;  4FO2 A;  3K59 A;  1WYD A;  5JVG 3;  2Z9H A;  1E2V A;  1ILP A;  4UY8 C;  3HOW G;  5BR8 Q;  3UE1 A;  5EKK A;  4YWL A;  3S16 H;  2XWB B;  4QGU A;  1XWE A;  2FMC A;  4GOP C;  3OW7 A;  1K28 A;  1LT5 D;  1VMP A;  4KHP Q;  2UUA Q;  2FHT A;  1KAW A;  2CCZ A;  4LAA A;  4YY3 Q;  1YNN C;  1JJG A;  1VQA A;  2XTI A; 
#chains in the Genus database with same CATH homology
 1PLF A;  2B2W C;  3F2U A;  4FP5 D;  1HQR D;  2DNC A;  2JYO A;  5EPL A;  5T1G A;  1PZI D;  4C3J B;  1A2T A;  5IT9 E;  4B9X A;  5C4H A;  1WCM B;  4BWG B;  4QUF A;  2BA1 A;  1CZG A;  2X69 A;  1RTO A;  2EE1 A;  1TWH B;  1STA A;  4ZRZ A;  1F2L A;  1X3P A;  1DOK A;  3CQZ B;  2JSO A;  1V1O A;  1V8Q A;  4HED A;  3NWS A;  3D6C A;  2DN8 A;  4KKS A;  4XDX A;  4EQP A;  1DON A;  2NN6 H;  2WP8 J;  1TY0 A;  5EKI A;  1J9O A;  4A3B B;  3WOE A;  3D4R A;  5I4D A;  2WAQ B;  1OXU A;  2PZU A;  2EJM A;  3OIQ A;  3P7J A;  4FXG C;  2MP1 A;  1SND A;  2NZ1 D;  2VUM B;  4E6I A;  3K5O A;  3KBG A;  3ERQ A;  1IKL A;  1HFG A;  3SR1 A;  4HMJ A;  1SYG A;  3HOX B;  1B9N A;  4C1N I;  3KBX A;  1EU3 A;  3A55 A;  1RCV D;  4BBS B;  4FYD A;  3VR6 A;  4IN3 A;  2QIL A;  2R92 B;  3O13 A;  2NVQ B;  1NR2 A;  1ZXT A;  3DWP A;  1HUN A;  3OMC A;  1EYD A;  1WD0 A;  2F0T A;  3FPP A;  1SMY C;  3NTI A;  4K5X A;  4LK1 C;  2RBM A;  1UUP A;  2NBF A;  2HCI A;  5ELC A;  5JPM C;  5C44 B;  3GTK B;  2B2U A;  5CV8 A;  1NSN S;  3MAQ A;  5KYL A;  1ENA A;  1T5X D;  2AQ3 B;  1SYE A;  1Y8P B;  1PFN A;  2K33 A;  1W6J A;  5KEE A;  1JWU D;  2Y0S B;  3SE0 A;  4KHZ A;  3VA5 A;  1EOT A;  3QOL A;  4ODG A;  1JC7 A;  4IUQ A;  1PYW D;  4FF4 A;  3A8J E;  4AYB B;  5J1Z A;  2AQ1 B;  1S5E D;  3DWA A;  2KJX A;  3C2P A;  2OF1 A;  4DA2 A;  2I46 A;  3IL8 A;  5HGT A;  1R4P B;  3K58 A;  2PQE A;  3A7A B;  5FO9 B;  3H3V C;  3RZO B;  3JAM E;  2EPB A;  1I3Q B;  4PMW A;  1KAA A;  3NPP A;  2SDF A;  5M3F B;  3DM1 A;  1H9J A;  2QF7 A;  4N9P A;  3EFX D;  2F3W A;  1II3 A;  1EY8 A;  4IZ8 A;  5TSS A;  2HCC A;  2HUG A;  2RDG A;  2HDM A;  1SSO A;  2JEB I;  1SNC A;  2XWJ B;  2X6G A;  1O78 A;  2XVS A;  1Q8I A;  1EZ6 A;  2K05 A;  1EZ8 A;  1SE2 A;  5CR3 A;  1AP0 A;  2L11 A;  4KN7 C;  2SOB A;  3EVQ A;  3MEH A;  5DNF A;  2A5H A;  2E2J B;  3VA7 A;  5C4X B;  4QMG A;  4A3J B;  4CHT B;  2SNS A;  3KF8 A;  3T13 A;  1HQM C;  3EQL C;  1V1P A;  4RGT A;  3S14 B;  4OIK A;  5I9O A;  2FMM A;  3QB3 A;  4RGO S;  2RDH A;  3D8G A;  1TII D;  5JPN C;  1B3A A;  1SE4 A;  1TU2 B;  4NMZ A;  2B2W A;  1GHK A;  2K5Q A;  1PTO F;  5IGB A;  2J0T D;  2B2V A;  3K7A B;  3NK9 A;  2ENB A;  4EQN A;  3PUV A;  2JXM B;  2A6H D;  3VYS A;  1IW7 C;  1GUG A;  4F7X A;  1ENF A;  5JEA G;  2EVB A;  3A7L A;  4KV6 A;  1G2T A;  4MN3 A;  1J8I A;  4DXF A;  4RKL A;  3H6M A;  4I65 A;  4HCE A;  3L3O C;  3QIA A;  5KIX A;  5C0X H;  4H44 C;  3FPU B;  3LX0 A;  2PO4 A;  5C4Z A;  2AUK A;  1DM0 B;  4B08 A;  3S16 B;  1STB A;  2R6G A;  3OOC A;  1LAB A;  2Q8T A;  4X3U A;  4J1M A;  2F0E A;  2A69 D;  2PNR C;  2EYJ A;  1PRT B;  2A73 B;  3P20 A;  4TRD A;  3TP5 A;  3P1H A;  1HCZ A;  2B2Y A;  1CA5 A;  3IFD A;  1CA6 A;  4Z9C B;  5IGE A;  3N52 A;  1FGB D;  3OIP A;  1D2B A;  4KJN A;  1Q3L A;  3D6W A;  1VCI A;  1ML0 D;  1A3T A;  2EY5 A;  5ELE A;  1ZYR C;  2EYP A;  2RQX A;  3TBI B;  2JA7 B;  3PUX A;  2K5D A;  2OEO A;  2AQ2 B;  1HA6 A;  1I6V C;  2PMZ B;  2C9O A;  1SNM A;  1VF7 A;  1YNJ D;  1Q1B A;  1EIH A;  1HTP A;  3ZYY X;  3GTL B;  2WKD A;  3X3M A;  1Y1V B;  2L4N A;  5A35 A;  3J7Y W;  3G7L A;  3HOV B;  1GHJ A;  4C3J G;  1U4L A;  3FRP B;  2ZT9 C;  2J7Z A;  5K5P A;  4A3K B;  1EY9 A;  3RD4 A;  1QCB D;  4U68 A;  1F77 A;  1KLG D;  3CRL C;  5NUC A;  4ZQ3 A;  4CKC A;  1QWY A;  1STH A;  2YYZ A;  1TR5 A;  2E76 C;  1QG7 A;  4KD3 A;  4RHR A;  3I4M B;  3E5S A;  2NWG A;  2B63 B;  3M3Y B;  2A68 D;  1FD7 D;  1ENC A;  2PYK A;  3EA6 A;  4X3K A;  1UAP A;  1D5X C;  3HEJ A;  2F0K A;  4XQJ A;  1DD2 A;  1OO9 B;  1PTO H;  1JOO A;  1F9Q A;  1JWM D;  3OWE B;  1LO5 D;  5ELF A;  2F0V A;  2Z4H A;  1TWF B;  2TMP A;  5ELB A;  1EU4 A;  1PZJ D;  2A74 C;  4S3S A;  2XRQ D;  3HKZ B;  5IGF A;  2LS0 1;  3J7A F;  2QCP X;  1RTN A;  4I7Z C;  4DNT B;  4DXG A;  4MIU A;  1ILQ A;  2K28 A;  3CKI B;  3K57 A;  1CTM A;  3TDQ A;  4IUU A;  3ERO A;  4O1N A;  2FJ2 A;  1B1Z A;  3DHQ A;  3BVG A;  4CJ0 B;  4JK1 C;  5C5M A;  1C4Q A;  2PZT A;  3MFG A;  4K2L A;  2VB2 X;  2B8F A;  5BN5 A;  3L9A X;  1GUS A;  1LLR D;  1KNA A;  2BA0 A;  1OXX K;  3S1M B;  4O42 A;  3QOJ A;  2EJF C;  2A6E D;  2NTS A;  4C3I B;  2ICE C;  4BA1 I;  4B9W A;  1LAC A;  3TN2 A;  3NXW A;  4ME5 A;  3M7N A;  2MUY A;  3GTP B;  1I6H B;  1WTQ A;  2MPM A;  4OHJ A;  3U9O A;  3K5N A;  1JE4 A;  4BBR B;  3IAY A;  1G2S A;  4CJ1 B;  3HP3 A;  2IX3 A;  1EEI D;  1HA5 A;  1PRT D;  3J80 E;  1TVX A;  1SE3 A;  3FVQ A;  4DF7 A;  4KY5 A;  2Z1C A;  2NTT A;  4FF1 A;  4HSV A;  4RFB A;  1JOQ A;  2EYL A;  4Q0F A;  2XSC A;  2B2T C;  3A54 A;  1KDA A;  5M5Y B;  1LT3 D;  2F0L A;  4DAV A;  5BN4 A;  5KNB A;  3G6J B;  1SNO A;  1GUW A;  2EDG A;  3H09 A;  3TP7 A;  1I4H A;  2DNE A;  5COR A;  4NW2 A;  4XIG S;  2XNA C;  3NTH A;  3GD7 A;  4V19 0;  3TZD A;  2E75 C;  1QIL A;  4ZUJ A;  1PFM A;  4FNF A;  3T4A C;  2E74 C;  4TQU S;  5KYI A;  5CV7 A;  5FOB B;  2IJ0 A;  2WB1 B;  3FDT A;  5CV9 A;  3M4Y A;  2QKI C;  3T56 B;  3OPO A;  2HQE A;  1RHP A;  4IUT A;  2F3V A;  1TT2 A;  5C3E B;  4NKL A;  1X3Q A;  1NR4 A;  4BY1 B;  1DYQ A;  4LJZ C;  4OO1 G;  4NDX A;  4DFA A;  1FNU A;  1BCP D;  5G3L D;  2O5J C;  1AEX A;  2V4D A;  4P2C B;  1O7L A;  1PZK D;  4XXE A;  3PMF A;  2F1M A;  4A3G B;  1BQQ T;  2R61 A;  1I4R A;  2Q8R E;  3VYU A;  1JB3 A;  1F2Z A;  1Y1W B;  2QDB A;  4G7H C;  2F0P A;  2F0Q A;  5IIF A;  1CQV A;  4RCN A;  2XIW A;  2CW0 D;  2H1E A;  1KAB A;  4PMC A;  1A15 A;  1YNN D;  1QB5 D;  4RKB A;  1LV9 A;  2MHV A;  1S5B D;  4X3T A;  4YIJ A;  1U4M A;  2KVM A;  1ZKO A;  5CGK A;  3I91 A;  3ONA B;  5HUR A;  1SDF A;  4ID6 A;  1EFI D;  2D5D A;  3S1N B;  1FR3 A;  3AU7 A;  1LTG D;  1LTI D;  2AWN A;  1STE A;  3QG1 A;  3TSS A;  1BOS A;  4C1N K;  3VR3 A;  2EY1 A;  1JOR A;  2ID0 A;  1WVL A;  1O7Z A;  5EPK A;  2JA8 B;  5I2Y A;  4BY7 B;  4KD4 A;  2RKS A;  3CHB D;  2L55 A;  3K6O A;  4L6T B;  3T16 A;  4A3F B;  3J80 L;  3Q23 A;  2EXZ A;  3MFY A;  3X3N A;  2KUM A;  1PXU A;  3R8B A;  1MGS A;  4QB4 A;  5ISR A;  1JCK B;  3ND8 A;  2WII B;  1U4R A;  1TWC B;  2F03 A;  4PQX A;  3CRK C;  5FO8 B;  4IFD I;  3MC0 B;  1RJT A;  4XQQ A;  3NHH A;  3OMG A;  3E6Z X;  2RDF A;  2KCC A;  3DWQ A;  1GJX A;  4K8J A;  1TKW B;  3M4O B;  3P75 A;  1U4P A;  4FVM A;  3C1F A;  1DOM A;  5LHY 1;  1S5C D;  2C5C A;  1E2Z A;  1MD2 D;  1SJH D;  1GOZ A;  2FIN B;  4WJW A;  1SYD A;  5C6A A;  2RSO A;  1V43 A;  1EYA A;  2EZV A;  4R8N A;  4RH6 A;  2PPB C;  4OO1 I;  5CYU A;  1SBB B;  5FLX L;  4K14 A;  2J4X A;  4DGZ A;  2NN6 G;  4PNY A;  1HFN A;  1SJE D;  5IOC A;  3ITP A;  4HCS A;  2JA5 B;  3MTS A;  1EY5 A;  3I90 A;  4BS9 A;  4A93 B;  3A8I E;  1EYC A;  2B2T A;  4RA8 A;  4A3M B;  5LL6 S;  1QNK A;  4X3S A;  1B2T A;  1S5D D;  3LNN A;  1NCV A;  1IYV A;  1W6K A;  4KHV A;  5CV6 A;  5JEA J;  1HTL D;  1H9K A;  3IKJ A;  1BR9 A;  5CV5 A;  3OSO A;  3R93 A;  1YNJ C;  3S1R B;  2RVL A;  3DEP A;  4RAU C;  1ROD A;  2KHS A;  1G8Z D;  3Q0A A;  3DEO A;  1AZP A;  4ULL A;  2EYF A;  4C3H G;  4FF2 A;  3PUZ A;  4ABN A;  3S9W A;  3WOF A;  1Q90 A;  1GXD C;  2KQ3 A;  2JEA I;  2RSN A;  2FFK B;  1PTO C;  4OGQ C;  3PV0 A;  5IOD A;  4DK0 A;  5DAU A;  3LWE A;  2EYM A;  1D5Z C;  2LKV A;  5JVH 3;  2D9U A;  4CJ2 C;  3SXH A;  3DXJ C;  3HZX A;  5EQ0 A;  2H4O A;  4R8I A;  1CHP D;  2BDO A;  3IFT A;  1LTS D;  1TS4 A;  2A68 C;  1B53 A;  5F2D A;  1BUV T;  3NP8 A;  4H0L C;  5EBD A;  1KDB A;  2O4X A;  5D3I B;  2F0F A;  1S5F D;  3HGB A;  1GUT A;  4K5W A;  4K6D A;  4F8M A;  1UEA B;  2M9V A;  3RMH A;  2OXP A;  4V0B A;  3SDZ A;  5IGC A;  5DM7 3;  5E4W C;  3VYT A;  4FF3 A;  3BS1 A;  2R3Z A;  3GTO B;  5K36 G;  3NBI A;  2F0U A;  2R93 B;  5JOB A;  5EBC A;  4F87 A;  4KY6 A;  1PRT F;  1QOH A;  2D2C C;  3Q6S A;  4XQN A;  2IT1 A;  4J8Q A;  4M1U B;  3BVM A;  3D4D A;  1BXT A;  1VMC A;  3KLS A;  1JR0 D;  3DMU A;  1SNQ A;  1I50 B;  1CK1 A;  1TQO A;  2MJ8 A;  1EY4 A;  4CKE A;  5T1I A;  1SNP A;  1Y8O B;  1IW7 D;  3AMU A;  3QJY A;  1I4X A;  2F0D A;  3VYR A;  5DM6 3;  2NN6 I;  3R2I A;  4RGN A;  5COY A;  4MHE A;  4DAY A;  2QEJ C;  3RUZ A;  2HDL A;  3VR5 A;  2GA4 B;  4HAE A;  1EWH A;  2JE6 I;  3URY A;  3I72 A;  4KN4 C;  2NVY B;  1F9P A;  1BBX C;  2K01 A;  1CI3 M;  1QE6 A;  3GTM B;  2F0O A;  2IWH A;  3SHL A;  5I6Y A;  2L0C A;  2NVX B;  2TSS A;  2VB3 X;  2E2H B;  3A56 A;  1CFM A;  1DCZ A;  3I4L A;  1B4O A;  1BDO A;  3MWY W;  1KLU D;  2XN9 C;  1A2U A;  2SEB D;  2IW3 A;  3MVV A;  2ICI A;  3D3R A;  2EYH A;  3KK7 A;  4KI0 A;  4UAI A;  5FK9 C;  3SK6 A;  4ZAI A;  5D65 A;  1Z47 A;  1HXY D;  4QF4 A;  3BZD B;  2KOL A;  1BCP F;  2RA4 A;  4G4K A;  5G3L F;  5C3W A;  4RWS C;  2EJG C;  1D5M C;  5CV4 A;  3V05 A;  2I07 B;  1Q1E A;  3GP7 A;  3S2D B;  2XRS D;  1A3V A;  1I4Q A;  2L1B A;  2G9D A;  3HG9 A;  1L0X B;  1H9R A;  1SAP A;  3GQB A;  1K8M A;  4LMQ D;  5C0X G;  3M7G A;  3TP6 A;  2L9H A;  1EY7 A;  3BYY B;  2AWO A;  1G91 A;  1PMR A;  2WV6 D;  5D14 A;  1OXS C;  4GZY C;  1MSG A;  1F9S A;  2OT2 A;  1HRJ A;  4G57 A;  1H9S B;  5IGD A;  5D3D A;  2M2L A;  2BE5 D;  4CKB A;  3LWU A;  3VR4 A;  2DY8 A;  4FXK C;  3SEB A;  1LTR D;  4ILW A;  2LY7 A;  2M00 A;  4KMU C;  1RDP D;  3C3L A;  3D4W A;  1G29 1;  1TS2 A;  2CW0 C;  4Q5V A;  1WTP A;  4IFD J;  2WIN B;  1CM9 A;  3TME A;  4QUC A;  3KUP A;  4QIW B;  4R9W A;  3QWN A;  2B2V C;  4IFD G;  2PW5 A;  2E2I B;  3PO3 B;  3C1E A;  2L5T A;  5BN3 A;  1CT1 D;  4DNR B;  5EGT A;  2ZXR A;  1QJO A;  4IUP A;  1ET9 A;  4H7B A;  1Y8N B;  4TSS A;  5FLX E;  2IL8 A;  4L63 B;  1KTK A;  1BF4 A;  2PCF B;  2VXW A;  3NWT A;  1SEB D;  4CGY B;  1STG A;  2F4I A;  2KA7 A;  3BDC A;  4HTH A;  3FKI B;  2E2D C;  1EY0 A;  3A8K E;  2Z8L A;  5KNC A;  3EJI A;  3PUY A;  1ESF A;  3R2T A;  4C2M B;  1O80 A;  1TY2 A;  4IUN A;  3NSW A;  2IX1 A;  2B39 A;  3J81 L;  4ZKB B;  5IGG A;  3MZ5 A;  1OXT A;  1LTB D;  3NBH A;  4A3E B;  5A2Q L;  3OWF A;  2VNU D;  1M8A A;  4KJO A;  1HHV A;  2X6L A;  2NVT B;  3U9S A;  3MXU A;  2JA6 B;  1XXG A;  2K5W A;  4KK7 A;  1A6X A;  3V96 A;  2B2Y C;  2F0W A;  1AN8 A;  1K83 B;  2O5I C;  1ZEQ X;  1KDC A;  2L12 A;  1EEF D;  4U67 3;  4L8J A;  2B8G A;  1DOL A;  1LTA D;  3CU7 A;  2K04 A;  1WTV A;  5JEA H;  4XTC S;  2WKC A;  4PMB A;  1JIC A;  2F0S A;  1S4Z A;  1GUO A;  2F0M A;  3WDN A;  4HN7 A;  1E2W A;  3MXG A;  2G9H D;  4K8I A;  4WOR A;  5C0X I;  3T51 B;  1EQV A;  5I6W A;  4XT3 B;  4IQZ A;  3HOW B;  3S15 B;  4IUV A;  2K03 A;  3GV6 A;  1PFB A;  4XYO A;  4H13 C;  1L0Y B;  3UI2 A;  5C5L A;  3TP8 A;  3NTK A;  2N88 A;  1WD1 A;  3H91 A;  1BNZ A;  4KY7 A;  5I2X A;  1TS3 A;  3I8Z A;  1B9M A;  4IAL A;  3PIO 3;  2EOT A;  1MBY A;  3K5M A;  5FO7 B;  4M8A A;  2A6H C;  4IUR A;  1JWS D;  2LFN A;  3NUC A;  3GO5 A;  2NB0 A;  3K5L A;  5K36 H;  1DZ1 A;  1TWG B;  4HR7 B;  1KNE A;  1NAP A;  1IHZ A;  2PZW A;  5E1F A;  5EJW A;  1WTO A;  4K6L A;  1WTW A;  3NE5 B;  1IKM A;  3DUZ A;  5JJZ A;  3PUW A;  2WAC A;  4XYQ A;  5LL6 X;  2F0I A;  5CBA E;  5C4J B;  5IT9 L;  1O7Y A;  1T5E A;  4RHS A;  2KEE A;  3AB9 A;  4ZKC B;  2NYZ D;  2O2L D;  1Z6H A;  2NUC A;  1SMY D;  2ZXP A;  3V2T A;  2A69 C;  2BDN A;  1HPC A;  2EY2 A;  1PTO B;  4WRD A;  1H9M A;  3I73 A;  1K8O A;  1CQF A;  3HS0 C;  4DU9 A;  3Q22 A;  3OHX C;  3NQI A;  2EYO A;  3H94 A;  4ZYS A;  3W2D A;  3E0J A;  4PV1 C;  3KLS X;  2BCO A;  1SYB A;  3PO2 B;  4JBW A;  1AFP A;  3KLR A;  2K1B A;  3J7A V;  4BA2 I;  2KED A;  4F88 A;  3N6R A;  4KKT A;  5KND A;  4A3D B;  1UNS A;  3C46 A;  1SFO B;  3MXP A;  2CVR A;  1R4Q B;  1I4P A;  3MXN A;  2YU9 B;  1AZQ A;  3HOU B;  1EIG A;  1SXT A;  1ET6 A;  4UDU C;  1EWC A;  1WTX A;  1TS5 A;  1H9S A;  2Q8I B;  1STN A;  1A3U A;  5M3M B;  2F0N A;  2N55 A;  3I4N B;  1VF5 C;  2F0H A;  4HSP A;  2K32 A;  1ESR A;  2CQA A;  5EPJ A;  3SK8 A;  1STY A;  2PW7 A;  1EY6 A;  4C56 C;  4K5V A;  4G7O C;  2BOS A;  5CMD A;  1LTT D;  2K7V A;  5KGU A;  2F0G A;  1EL0 A;  1WTR A;  4ZK9 B;  4C3I G;  2LMC B;  1DXM A;  3HRZ C;  1F9R A;  1BO0 A;  1ONL A;  1VDZ A;  1LT6 D;  4OL7 A;  2CHB D;  5I9P A;  3I70 A;  3MHB A;  4DK1 A;  1GUN A;  4ZLT F;  4G7Z C;  3BDO A;  1OXV A;  3PIP 3;  3S17 B;  1CZW A;  1IL8 A;  3QO2 A;  4RGM A;  5E3F A;  1D6E C;  3M85 A;  1QNU A;  3ND9 A;  5KRU A;  1Y69 U;  1D1I A;  4DAP A;  5E4X A;  3BYT B;  3D31 A;  4EQO A;  3RLF A;  4IFD H;  2A6E C;  5AFW A;  3JAM L;  1LT4 D;  3K0Y A;  3TZU A;  2KEC A;  1AW7 A;  1XX8 A;  1RD9 D;  1RF2 D;  1XTC D;  2DY7 A;  4WFN 3;  4HMI A;  5M9O A;  1FYC A;  5M5X B;  1I4G A;  4DN4 M;  5ELD A;  5J22 A;  1JOK A;  2KCN A;  2AUJ D;  2B2U C;  5J39 A;  5CC4 A;  1PRT C;  2K6A A;  4CBV A;  2IPK D;  1HUM A;  5EKL A;  3SK4 A;  5C3X A;  1MI2 A;  1B44 D;  1PTO D;  3J81 E;  4RCO A;  2BE5 C;  4J6H A;  1SYF A;  4OO1 H;  3GTG B;  3GTJ B;  5A2Q E;  4N9T A;  3RZD B;  1PDQ A;  3SVM A;  3H0G B;  2Z4I A;  3SK5 A;  2EY6 A;  3W3A A;  3S1Q B;  4KKU A;  1FNV A;  4FXD A;  1F2Y A;  1CHQ D;  1X32 A;  1U9R A;  1IYU A;  1Z7T A;  2JP1 A;  1BCP B;  4KTA A;  4XT1 B;  2F0J A;  4C3H B;  3GV3 A;  3L7Z C;  1FNW A;  2R7Z B;  4OIJ A;  3NQT A;  3HOZ B;  2IX0 A;  3GTQ B;  3S2H B;  4ZUI A;  2MGS A;  3VR2 A;  1JQY D;  1V1P B;  4EVO A;  1B50 A;  5DEH A;  1DJR D;  3BDL A;  4NP5 A;  1NUC A;  1ZYR D;  1SYC A;  5C0X J;  1Q12 A;  4EGV A;  1C8C A;  1RKN A;  4TKO B;  1M4V A;  2SNM A;  3MA2 B;  4Y7N B;  1ICW A;  3HOY B;  1D1K A;  3FMC A;  5JAV A;  4K2K A;  5CBE E;  5M5W B;  2D62 A;  1C48 A;  1G6Z A;  3BVZ A;  3T53 B;  1XYI A;  2ZXO A;  3R3O A;  3Q24 A;  1TWA B;  1E0B A;  3I3C A;  1BCP C;  1F2M A;  3FEW X;  5FKA C;  1R9T B;  1EQT A;  1MSH A;  3BG3 A;  4QCL A;  4A3I B;  4FO2 A;  3K59 A;  5JVG 3;  1E2V A;  1ILP A;  5EKK A;  2XWB B;  1XWE A;  2FMC A;  3OW7 A;  1LT5 D;  1VMP A;  2FHT A;  4LAA A;  1YNN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...