3ITPA

Crystal structure of staphylococcal nuclease variant delta+phs f34k at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTKRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclease A
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS F34K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3itpA00
4K8JA 4KHVA 3SK8A 5I6YA 3MXPA 2F0MA 5JAVA 4I65A 5I9PA 3TP6A 2EYJA 1KABA 3OMGA 3QOLA 4DGZA 3DMUA 4ME5A 5KYLA 5CV9A 2F0OA 4S3SA 3P1HA 4WORA 1KAAA 3NHHA 2OXPA 5C4ZA 4E6IA 4J1MA 3OWFA 5ISRA 5C3WA 5EKLA 5I6WA 1EZ8A 1SYCA 2EYPA 1JOQA 4ZQ3A 4OL7A 3HEJA 1EY0A 1STGA 2F0JA 4N9PA 4QF4A 3VA5A 5E1FA 3MZ5A 4K5WA 3TP5A 4H7BA 3QOJA 1EY6A 2F0EA 5IGGA 5IIFA 5CV7A 1II3A 4K5VA 2F0FA 1SNQA 2F0QA 3BDCA 4ID6A 1NUCA 1SNOA 4K2LA 4ODGA 3P75A 4DFAA 4DU9A 5KIXA 2F0PA 4K5XA 2F3WA 3ERQA 3OMCA 1STHA 2EXZA 3EVQA 1KDCA 1EYDA 4R8NA 1TR5A 2EY5A 2SNSA 3E5SA 1EYAA 2RDFA 4NP5A 1KDAA 1SNPA 2RBMA 1SYDA 2WACA 3MHBA 3T16A 4F7XA 3S9WA 1F2YA 2F0KA 2ENBA 5C6AA 2F0SA 2PW7A 4YIJA 3EROA 1A3VA 1EY8A 2F0NA 5CV8A 4EVOA 2PW5A 1SNCA 5EGTA 3EJIA 5J22A 2KHSA 5KRUA 4NMZA 3H6MA 3NUCA 2EY2A 2F3VA 1TQOA 1RKNA 3TP8A 2PZTA 2F0HA 2PZWA 5M9OA 5IODA 3C1FA 1JORA 3DHQA 5IGBA 3NK9A 4KY6A 4IZ8A 5CGKA 1U9RA 1JOKA 3TP7A 4PMCA 4EQPA 4RKBA 4K14A 2OF1A 1F2ZA 1KDBA 1EQVA 4KY7A 4WRDA 4QB4A 1EY7A 5F2DA 4F8MA 1EY9A 3SHLA 5IGDA 2LKVA 4KD3A 4N9TA 3D8GA 4KD4A 5C5LA 4KJNA 1NSNS 5HURA 1EYCA 4K8IA 4KY5A 4HMIA 5JOBA 5CV4A 4EQNA 4TRDA 4B9XA 4B9WA 5IOCA 1ENAA 3OSOA 2F0UA 4EQOA 4KV6A 3C1EA 1SYFA 2RKSA 2QDBA 4IALA 4HMJA 2SOBA 4PNYA 5HGTA 5KYIA 4LAAA 4NDXA 5IGCA 1A2UA 3SK6A 3T13A 5I9OA 1JOOA 5EKKA 1STYA 3NQTA 1SNMA 2PZUA 4ZUIA 4RKLA 3BDLA 2M00A 4DF7A 1ENCA 2F0WA 4MIUA 5DEHA 3V2TA 3U9OA 3PMFA 3MEHA 2F0DA 1TT2A 4IUNA 1EZ6A 5J1ZA 3SK4A 4PMBA 1STBA 2PYKA 5IGEA 3D6CA 2F0TA 3HZXA 2EY1A 1SYGA 2EYOA 4NKLA 1AEXA 4QMGA 5C5MA 2HQEA 2KQ3A 5CC4A 4G57A 5DAUA 5NUCA 3SR1A 2EY6A 5C3XA 5C4HA 1STNA 1A3TA 3NXWA 1SNDA 4K6DA 1EY5A 2EYMA 5KGUA 1A3UA 2EYFA 1SYEA 1EY4A 3ITPA 2F0LA 2F0GA 3MVVA 2EYLA 3NP8A 1STAA 2EYHA 2OEOA 5CR3A 1SYBA 5E3FA 4KTAA 3LX0A 4ZUJA 3TMEA 4HTHA 5CV5A 5J39A 2PQEA 5CV6A 3QB3A 1A2TA 5KEEA 3R3OA 2F0IA 2NUCA 4J6HA 3D4DA 3SK5A 4KJOA 4K2KA 1IHZA 1F2MA 3RUZA 3SXHA 3D4WA 2SNMA 5K5PA 5IGFA 2F0VA 2O4XA
chains in the Genus database with same CATH superfamily
3KBGA 2DJGC 3TDQA 1S40A 4HJ8A 2ASBA 2MO0A 2MO1A 1JWUD 1CKNA 4HSVA 2FFKB 1Y1VB 2Z6BA 4ZCKA 1JOQA 4XYOA 1I5FA 1MHWC 3Q23A 1ASYA 4ZLTF 2H5XA 1Z47A 3BVGA 4HCEA 2EJFC 4X65Q 4QUFA 3CCMA 1WVLA 1W6KA 2BA0A 2K01A 1JB3A 2F0FA 3S1NH 5CORA 5KIXA 4GLAC 1DOMA 2E8GA 3G6JB 1K0SA 2F0PA 4OONA 3RLNA 4R4IA 4C3JB 2EOTA 2PNRC 4F88A 3G4SA 1E2WA 1UNSA 4YWKA 3V96A 3ND8A 1SSOA 3TZUA 1PYSB 2VW9A 4EVOA 3UE1A 5EGTA 1WTOA 4Y7NB 4JI2Q 3K80C 4YCUA 3S1MB 3I4LA 1DOKA 5A2QL 4LF9L 4FYDA 4YWMA 1PFMA 1VQFA 5F2DA 4DV4Q 3STBC 2WV6D 4JV5L 4YHHQ 4XQNA 1JE4A 1WTPA 3AEVA 4OGQC 2YU9B 1EWIA 2WAQG 5H1SE 5I2XA 3U9SA 4B9XA 4JI1L 4IALA 5HGTA 2SOBA 2VNUD 2WKDA 5IGCA 2XWBB 1Q46A 2F4VQ 3Q22A 2PZUA 1HUNA 2K28A 1WTWA 2A73B 1A15A 3GTLB 2BDNA 2BE5C 1QJOA 2ZM6Q 1NAPA 2PPBC 2R93B 4H13C 4HJAA 1R4QB 1C8CA 2Z4HA 1L2FA 3FPPA 1I4HA 4DK6C 4L5RC 1K8OA 5M3MG 1PFNA 3A8KE 2UXBL 3NQIA 5D3IB 3D0FA 1PRTC 1A3UA 4ZRZA 1ONLA 2K32A 2F0GA 1E3PA 4A3IB 2PI2A 1HR0Q 1B70B 3OOCA 1Q8IA 3K8AA 3TMEA 3HOXB 2ICEC 4CJ0B 2H4OA 1Q81C 1V1QA 2FJ2A 3F1ZA 4HIOA 4IQZA 2E2HH 2CVRA 2Z6KA 4KJOA 1NE3A 2L4NA 3D4WA 1X9NA 4Y52H 4LFCL 4KN7C 2IY5B 3PIPA 4DR3L 1G51A 2F0MA 3M4PA 4DR1L 2HT1A 5M3MH 2KHIA 1SAPA 2PCFB 1KRSA 4UP8A 5LMNW 2QW7A 3IKJA 4E6IA 2EZVA 4CGYB 1DJRD 3GTPB 2IW3A 1HNWL 1ICWA 1SRUA 1TWCH 3T1YL 1HR0W 1E1OA 1LTID 5FLXE 4KHZA 2A6HD 1SNOA 3URYA 5EQ0A 4K5XA 1ZYRC 1Q1EA 1EYDA 2SNSA 4X6AH 2RDFA 1WYDA 1YNNC 2AWNA 1CQFA 5C6AA 2F0SA 3KLRA 3EROA 2AMCB 4DAYB 5CV8A 1UE1A 5LHY1 5EPJA 3EJIA 3I4MG 1PFSA 2L11A 4A3CG 4FF2A 1DONA 1BOSA 3H91A 1JORA 3NK9A 3H3VC 1U9RA 2EVBA 5M5XB 3PIP3 5FLXc 5C4JB 1N33L 4IPCA 1IW7C 3K7AH 4LF7L 4O1NA 4MTNA 1EQQA 3TS0A 1ENFA 3I7FA 3PSIA 2M2LA 4LF9Q 1D7QA 2AHOB 4IUVA 3I4MH 3SEBA 1SNMA 4JV5Q 4A3CH 1HRJA 1G6PA 4TVAB 2NVYB 3OWEB 2F0DA 3KK7A 4QIWB 1PH5A 3DEPA 1TS2A 4JI1Q 4PG3A 1VDZA 4GOPC 5C5MA 3I2ZA 4ALPA 2GA4B 1IBKL 5C3XA 5C4HA 3I3CA 1CKNB 2RCFA 1VQPA 1O78A 2MPMA 4QUCA 2OEOA 4DKAC 5CR3A 1SYBA 1KD1C 1VQ5A 1MI2A 1L0YB 2E76C 1KNAA 2PQEA 3M4OH 3F2CA 4CKCA 1K8MA 4X64L 1XXGA 4C3IG 1NR2A 1YHAA 5JVG3 2K14A 2UXBQ 1EU4A 4OWXB 2A69C 3SK8A 5JAVA 1SMXA 3SVMA 1PTOD 3BS1A 2D0PA 1Q90A 2XSCA 2OTLA 1L0XB 4PZ6A 3RLFA 1FNVA 1RCVD 1X3FA 2K04A 1V43A 2WAQE 4GKKL 3MWYW 5HY6A 2NTTA 3A56A 1G8ZD 2I07B 3FKIB 4LFCQ 1C0AA 5ELOA 1DM0B 2EJGC 2J7ZA 4DR3Q 4A3KG 5A2QE 4DR1Q 1AZPA 4C3IH 1SE8A 3BDCA 1TWHB 4ODGA 3S2HH 3VYRA 2OT2A 3HOYG 3BG3A 4A3MB 2R7FA 3MEFA 5M5YH 1XMQL 2E5LL 2ES2A 1SNPA 1D1IA 4IUUA 2EXDA 4APVA 1HNWQ 1AW7A 1LV9A 1M8AA 1RODA 2LXKA 3T1YQ 4A3EB 5J3BA 5JPNC 2LS01 5BN5A 5J22A 4DV3L 2KHSA 2JA8G 3G48A 3GQBA 2RA4A 4LF8L 1Y1WB 3CCQA 1YEZA 4A3KH 4PMWA 4GN3B 1BNZA 3HOYH 1EY9A 3KF6A 2R6GA 1KXLA 4NXNL 4KD4A 3I4NG 5HURA 1PH3A 5JOBA 2RHSB 3KF8A 4G7HC 4UAIA 1SMYC 5FK9C 3C2PA 5EJWA 1STYA 2JA8H 1KRTA 1N33Q 2UUCL 2F0WA 2JA6G 1O7LA 4LF7Q 3S1RB 1IYVA 3ULLA 5D65A 1PTOB 1CSQA 1H9KA 4L5TA 3I4NH 1PHJA 2VUMG 3ONAB 2WB1G 4K6DA 2LFNA 3ITPA 2F0LA 3KLWA 3PUWA 3ER0A 3UI2A 3KLSA 2CWPA 1CA5A 5C0XG 2OCEA 1G2TA 1K83B 1IBKQ 2JA6H 3QJYA 4J6HA 4TSSA 2D0OA 3SDZA 3GP7A 4K6LA 2MFIA 5FO7B 1YI2A 2MHVA 4DV6L 2B63B 4GNXB 4YWLA 3K7UC 2D5DA 1UE5A 1EIGA 3TP6A 2L15A 2VUMH 3PO3B 4X64Q 2B29A 3MXNB 4CJ1B 1SYCA 3AU7A 1EY0A 5C0XH 4JI3L 4C2MB 1EIFA 1ESFA 1I3QH 1H9MA 1PLFA 2HD3A 3FDTA 1YNJC 4HSPA 1IXRA 1LM0A 4M1UB 3CD6A 4GKKQ 3NWSA 2X6GA 3K57A 4BA2I 3MHBA 1SYDA 2RF4A 5IYDG 2Q2UA 4JI0L 3S1QB 4XIGS 1PZJD 1RD9D 4HJ5A 2IX0A 1B4OA 1TWGB 3GTMB 3H6MA 1X32A 1KNEA 1SROA 2F4IA 2BH2A 1JQYD 4LF4L 1RHPA 3JAML 4RH6A 1XMQQ 2E5LQ 1HXYD 4CDFC 3EA6A 3PV0A 4ZKCB 3K59A 4BA1I 1NSNS 4DV3Q 5EKIA 1R9TB 2Q2TA 2IL8A 5IYDH 1HQMC 1CKMA 1WCMB 1SYFA 5C0XI 3PO2G 3FPUB 3SK6A 3H0GB 4BY7B 3LWUA 3S1MH 2RHQB 2HHHL 2K33A 4NXNQ 4ABNA 1P16A 2RSNA 4IUNA 3CAMA 3Q6SA 1MIUA 1PTOC 2PYKA 3DWPA 2Z0SA 3HZXA 3H3VH 2EY1A 2D62A 5COYA 2Y0SE 5ELEA 2CKZB 3M4QA 3SR1A 3CCUA 4L5SA 1R4PB 4B3SL 3J81L 2UUCQ 3F2UA 3HOVB 3L3OC 5EBDA 2KCTA 4A3IG 3PO2H 3HG9A 3M85A 3J7ZC 3LGJA 3NENA 3CC7A 1PH7A 2AQ3B 3F8TA 2O2LD 2K03A 1V1PB 2K5VA 2J4XA 1MKHA 3CC4A 4DN4M 4GNXC 3K81C 3WDNA 1CHPD 4AYBB 2B39A 2L12A 2VXWA 3JC66 1SN8A 4JW0A 3F2DA 4JK1C 3I56A 5BR8L 2R61A 2DY8A 5G3LF 5IT9E 3T56B 1Y8PB 1I94L 4A3IH 2CW0C 3KUPA 1AP0A 1HTLD 5C3WA 1GM5A 4DV6Q 2NVQH 5M5WB 1RF2D 3T1HL 2XN9C 4H7BA 4R9WA 2F0EA 1L1OC 2LMCB 3H3VI 2FMCA 3KF6B 4IUQA 1FR3A 4RCOA 2KEEA 2KOLA 4KKTA 1QE6A 3M3YB 1STHA 1GUOA 3PUVA 4FXKC 1WFQA 3W5OA 1B44D 4JI3Q 1A3VA 5FO8B 1DD2A 2A6ED 4G4KA 1XPRA 4NMZA 5IT9c 1GUTA 3TP8A 3X3NA 1HJPA 1TXYA 1PZKD 4EQPA 1SEBD 4JI0Q 1WTVA 4WRDA 3T53B 4RG1A 5E4WC 4POGA 3N6RA 1BF4A 4KD3A 5DM63 1OXXK 4K8IA 4KY5A 3F2BA 4GOPA 4EQNA 4LF4Q 4IFDJ 4KV6A 3RZDB 4HIDA 1IKLA 1YVCA 1VS0A 1X54A 4ZAIA 3HOUG 4RAUC 4QY7A 3GTGH 2DY7A 1K8GA 2K7VA 2KJXA 4LF6L 2I5MX 4QMGA 3HRZC 4HCSA 1QUQA 5C4JH 1QVCA 1I4PA 1RTOA 1OXVA 2HHHQ 2DNEA 1FGUA 1B8AA 1C7YA 3A0JA 3HOUH 1PH4A 4A3DB 1ESRA 3MTSA 3TN2A 1D8LA 3M4YA 3OTOL 1VQNA 4DV0L 3I4OA 4B3SQ 2B2UC 2B3GA 1VQMA 1C4QA 4B08A 4A93B 1CA6A 1BCPD 4LNQA 1CQVA 3KYHC 3QIAA 1QG7A 3KFUA 1G291 1HNXL 4IO9A 2MP1A 1H9SB 2JA7G 4RGOS 3KLSX 2VQFL 1BKBA 3VR6A 3FKIG 3ULPA 1NJIC 5C3EB 1PYWD 3RLOA 3U50C 1II3A 3JAME 1SNQA 3VYTA 5BR8Q 1PH8A 3HKZB 3NEMA 4BWGB 1SFOH 3PCOB 1I94Q 1PTOF 2WACA 3KJPA 4JI7L 2K5WA 3BZDB 3T1HQ 4NXML 2IJ0A 1EY8A 3CU7A 3J7AV 1CK1A 2JA7H 2HUGA 3S2DB 4MTKA 4A3GB 2PZTA 1IL8A 1LABA 3FKIH 1EIHA 1X6OA 2VL6A 2D9UA 1HZBA 3CC2A 1JC7A 3IAYA 2PQAB 5ELFA 1ICFB 1TWHH 2Q8IB 1WTRA 4LWCA 3G6EA 3JAMc 2Z4IA 3M7NA 3DWQA 1JMCA 2UUBL 4EGVA 1BBXC 5AJ3L 3QR8A 4ME3A 1GHJA 1EOTA 5IP9G 3J81j 4UP7A 4LJZC 2B2TC 4XDXA 4DAPA 1FNWA 2RDHA 4KK7A 5GAEC 2M00A 2VB3X 3A7AB 3R2IA 4AH6A 1PH2A 1LACA 2L55A 1STBA 3VR4A 1BCPB 3ICEA 1X55A 1PH9A 5EAYA 5CYUA 3UE0A 3CMEA 4G7OC 1SYEA 4B3TL 3HOZB 4HAEA 2JA9A 5IP9H 4BBRG 3RZOB 2A68D 3I72A 4HTHA 4LF6Q 1E2VA 3R93A 1H9JA 2JN4A 1BQQT 3S1RH 5C4XB 4NW2A 3HOWB 3NTKA 3CCLA 2IWHA 5IGGA 1CKOA 2A6EC 3DEOA 4A3BB 1I50B 3VR5A 3QOLA 4KN4C 2HCCA 1GHKA 1A0IA 1M4VA 4PQXA 3PO3G 2ATWA 3T51B 5E7NA 1JJCB 3CQZB 3OTOQ 4BBRH 2PMZB 4OIJA 1VQKA 1STEA 2HIXA 5JPMC 3CCRA 4X3UA 4DV0Q 4YY3L 2F0JA 3CMAA 2OQKA 4K5WA 4OWWB 1K83H 4O42A 1NUCA 3KJOA 1Z6HA 4IPDA 1HNXQ 2UU9L 4P75A 1VQ4A 1KDCA 1HA5A 4QIWE 4OXPA 1GUSA 3D6WA 1F2YA 2VQFQ 4DR7L 3M9BA 1IBLL 3PO3H 3CP0A 3H15A 4XT1B 2PO4A 2PW5A 4LW1A 4FF1A 2MNAA 2E2IH 4DV5L 1EOVA 5C44B 1QVFA 2NVTB 2KVMA 1K3BC 1X3PA 1K73C 4O2DA 3RNUA 1KDBA 4NXMQ 4QB4A 3MXUA 2OTJA 1SDFA 4A75A 4FO2A 4L6TB 1VQ7A 1Q7YC 3IL8A 1AE3A 1B3QA 3K5OA 3Q8DA 1A2UA 5I9OA 2XRQD 3K5MA 2VQEL 3GTMH 3EFXD 3H0GG 1MJEA 3FHWA 4BY7G 4RKLA 3Q24A 3U58A 4DF7A 4ZYSA 3P20A 2UUBQ 3U9OA 5EPKA 1SJHD 4L8JA 5IGEA 1IZ6A 4CBVA 5AJ3Q 4KHPL 1B9MA 1VQOA 1IL2A 2JJQA 2KUMA 3IRBA 1R9TH 4OWTB 3OIQA 1DZ1A 1YZ6A 2G9DA 4I7ZC 1STAA 5E3FA 1KL9A 2DUDA 3GTOB 3H0GH 5CV6A 4YCWA 3AQQA 4HJ7A 2NUCA 4JOIA 5JEAJ 3RUZA 1Y69U 1TWAB 3E0JA 4B3TQ 4H0LC 4XYQA 2Z8LA 2EYJA 3NTIA 1VQAA 4GKJL 2JXMB 5GROA 3PIOA 4ME5A 1K28A 1UEBA 3S15B 2PI2E 1IBML 3KDFA 1HZCA 2TMPA 1EQRA 4QF4A 5E1FA 3TP5A 2KBNA 1ZXTA 1SBBB 2F0QA 1Q12A 2PNHA 3P75A 1FYCA 3MFGA 3UDGA 2F3WA 4LFBL 4NP5A 1EYAA 1GUWA 1HH2P 4R4CA 1N34L 4H44C 4YY3Q 2X69A 2I0QA 2ENBA 3EBEA 2KHJA 5IP7G 1QB5D 4CDCC 5ELBA 4WFN3 2LY7A 5IYCG 1WJJA 3NUCA 3C3LA 2OWOA 4CJ2C 1Q86C 2UU9Q 1QOHA 2N88A 1N8RC 3C1FA 1L0WA 2QILA 4DR7Q 1IBLQ 2NVXB 2Y0SG 4GLXA 1B3AA 1EQTA 3NE5B 2C35B 2NZ1D 3CPFA 4KJNA 1DOLA 1EYCA 3PIO3 2O5JC 3W2DA 3GTKH 4DV5Q 1JR0D 2ID0A 3TBIB 1GUGA 2A68C 4FNFA 4TRDA 3S16H 5IP7H 4UY8C 2JEBI 1WD0A 3X3MA 1ET6A 1T9HA 1E1TA 3GO5A 5LMUL 1PV4A 5IYCH 2CCZA 2E75C 1JWSD 1PRTF 1HQRD 5M3FG 2QA4A 4CDEC 3OW7A 1IKMA 1CHQD 3TZDA 2F3IA 3BDLA 3S1NB 3V2TA 1NBWA 4OX9L 2EIFA 3G71A 1F9SA 3RN2A 5FOBB 2CH4A 2K5QA 1EZ6A 1BO0A 3CCEA 3CKIB 4B3ML 1S5FD 2HDLA 1DXMA 1RL2A 2F1MA 2JSOA 5DAUA 1QNUA 2NB0A 2ZXOA 2VQEQ 1HUMA 1A3TA 2B2VC 4I7AA 2A8VA 2KCCA 1AE2A 2CQOA 1EL0A 3OW2A 2L0CA 5EBCA 1C48A 2OQ0A 1TS4A 1UEAB 1KTKA 5M3FH 4KHPQ 4A3DG 3I70A 4HN7A 2NZHA 3EQLC 5ELDA 2JA5G 5BN4A 1WD1A 3L0OA 5K5PA 5IGFA 3RN5A 1I4GA 3K0XA 4LUZA 1AH9A 2BA1A 1EU3A 1V9PA 4R8IA 1A63A 5I9PA 4HIMA 1HFNA 1WTQA 2BOSA 4RGTA 3K6OA 1J5EL 1TWFH 5CV9A 1E2ZA 2GVAA 4DR2L 3E9IA 1U4PA 1SXTA 4AIMA 1QZGA 3BYTB 2A6HC 3M7GA 1XPUA 3GTQH 5K36G 4N9PA 4C1NI 2ALYB 4A3DH 1VF7A 1BUVT 4RA8A 2KECA 4K5VA 4FVMA 2JA5H 2KCMA 2Q8TA 4GKJQ 4FXDA 3HS0C 1HHVA 2CQAA 2VZAA 3HKZG 4LF5L 1UWVA 2R3ZA 3HP3A 2EY5A 4C3HB 1YHQA 3VA7A 1VQHA 1IBMQ 4A3FB 2R7DA 2TSSA 3SGIA 3A55A 1CZWA 5GAHC 3K5LA 1FNUA 1LLRD 3BU2A 1Z9FA 1Y1VG 2F3VA 3EIVA 1M90C 2F0HA 5K36H 2FHTA 4LFBQ 2QEXA 3E0EA 2E2HB 1AN8A 2A5HA 2K5NA 4U673 1N34Q 4DNRB 1KQSA 2R7ZB 2FINB 2NWGA 3E6ZX 3WOFA 5IYBG 3BVMA 2UXCL 2WIIB 1S4ZA 3L9AX 4UPAA 4P2CB 4C3JG 5M3MB 1K0RA 4HMIA 3FMCA 4AYBE 1EIYB 5ELCA 3MXGA 4JI8L 3CRKC 1S5BD 4TKOB 1CI3M 1QWYA 1TWCB 1Y1VH 2HQLA 5I2YA 3E9HA 4XTCS 1LT3D 4P74A 1E0BA 5IYBH 1VQ8A 1HCZA 2C9OA 5LMUQ 4C3JH 2YYZA 1STNA 4JC0A 3T4AC 2NZOA 1MBYA 1XNRL 2EYMA 4RGNA 3MVVA 1LUZA 4LF8Q 4OX9Q 3NP8A 1CFMA 2CHBD 4KI0A 4R1JA 3HOZG 1U4RA 4L63B 3KDFB 4B3MQ 4V190 4Y7NH 2DN8A 2Z6KC 3MA2B 3QWNA 1S5ED 2AUJD 2F0IA 4P71A 4JPBW 3B6YA 3SXHA 1O7IA 3HOWG 2AUKA 3K7AB 3S24A 1WI5A 1XJVA 2R93G 4UHVA 5I6YA 1FL0A 1Y14B 1DYQA 1Q1BA 2YU9H 4ILWA 1GOZA 2P5ZX 3P1HA 1KAAA 3NHHA 5C4ZA 3I4MB 3TQYA 5I6WA 1EZ8A 1H95A 4FXGC 1PZID 4NB3A 3BZKA 1LTTD 3VA5A 3HOXG 2ZTCA 4J8QA 3NBHA 1RDPD 4K2LA 4K0KL 1EWCA 1J5EQ 3GTLH 3S14B 2A1AA 3HOWH 1XPOA 2R93H 4DR2Q 3EVQA 3CCJA 1W2BA 1TR5A 3GD7A 1RJTA 3J7AF 2F0KA 1ZKOA 1XWEA 3K0YA 3FP9A 4YIJA 2RQXA 1PMRA 3CQZH 3M4OB 5M9OA 2EDGA 1B1ZA 3HOXH 4GZYC 1TU2B 3OPOA 1ET9A 1T5XD 5C44G 2O5IC 1O80A 1XX8A 3A8JE 2OF1A 1D5XC 1JT8A 1J6QA 1ILPA 2K1BA 1QCBD 2KENA 3KF8B 4DXGA 1FJGL 3A5ZB 1D5ZC 2RDGA 2Z1CA 1OTCA 5IOCA 2F0UA 5IE8A 3JAMi 1LTAD 3MAQA 4LAAA 4MHEA 2ZJRA 2L5TA 4RGMA 1GO3E 4DK3C 3GTPH 5FO9B 4LUOA 2UXCQ 3GV3A 1LT5D 4N8FA 4PZ7A 4A3JB 3TREA 4C3IB 5C44H 3KBXA 1SE2A 4PMBA 3J7YW 3UDFA 1PYBA 2F03A 5M5YB 3ERSX 4JI8Q 2BE5D 4BY1B 3HKZE 2A74C 3W1BA 2NYZD 2JK8A 3TSSA 1YITA 1I4RA 4WJ3M 3AFPA 3A8IE 1KLGD 2XRSD 4XQQA 2XVSA 1VCIA 3BJUA 4CDDC 1F9PA 1NMFA 3QB3A 1X3QA 3D4DA 2D2CC 1IHZA 1XNRQ 4DV7L 3DM3A 1I4QA 2C5CA 3J81i 5M5XH 3BYYB 2F0VA 2EQSA 1F2LA 5CBEE 1YJNA 1TIID 1XMOL 1Q82C 1LO5D 2LXJA 2VY3A 3I73A 2EE1A 1YJWA 4IN3A 1NCVA 4DUYL 2JA8B 4F87A 4UDUC 4HEDA 4O0AA 1CUKA 4OELB 4R4OA 3HGBA 1XTCD 2NVYH 1X65A 1X3EA 4ID6A 4DU9A 1BVSA 1JE5A 2LSSA 3ERQA 3I4NB 4R8NA 1KDAA 1EYGA 1ZYRD 4KLKA 3K58A 2ZTEA 1E22A 3PUXA 1VQGA 1YNND 3U4ZA 1LTGD 4DAYA 5JJIA 5LMNL 4JBKA 3S15H 2EY2A 3L2PA 2JA6B 1OO9B 3TRZA 1N32L 5IGBA 4BBSB 1D6EC 1F9QA 4R4TA 4CKBA 2K6AA 1M1KC 3S17B 2LKVA 2HDMA 3W3AA 1U0LA 1DCZA 4DXFA 1KLUD 4GN5A 2VUMB 1I4XA 2WB1B 4A3MG 1HPCA 5GAGC 5DM73 2V1CC 5CV4A 4H02A 5JVH3 5D14A 1HZ9A 3PUYA 3CPWA 4A3EG 3RD4A 1K8AC 1I3QB 3H94A 3CRLC 4V0BA 4IUPA 2PMZE 1X56A 4RWSC 1Y1WG 2UUAL 3BVZA 1FJGQ 5GADC 2QEJC 1KHIA 2N78A 2N8NA 4NKLA 5JJZA 1WOCA 2IHFA 4TQUS 4G57A 4A3MH 4DNTB 3NXWA 3VYSA 3DWAA 1U4LA 4A3EH 3J81E 2QGQA 3BDOA 2WFWA 1B2TA 1Q3LA 2K5DA 5EPLA 3NBHB 2JYOA 1Y1WH 3OYYA 4K2KA 1U4MA 1F2MA 2ZTDA 1YIJA 4OO1G 2XGTA 2PW7A 1C9OA 2A69D 1EFWA 3EN2A 4DGZA 1EEFD 2F0OA 2E2DC 1I6VC 4DV7Q 1E24A 4C1NK 2VB2X 2AKWB 3J81c 1EY6A 1AZQA 1XMOQ 1KIXA 2RCNA 4OO1H 1JB7A 4X3SA 1TS3A 4DUYQ 3Q0AA 3MC0B 1HNZL 1PTOH 1JWMD 2B63G 4C3HG 4A3FG 1LTSD 4HIKA 3PO2B 1LTLA 2F0NA 1SNCA 1HFGA 3AFQA 1HZAA 5KRUA 4IURA 1PFBA 1OXSC 3LWEA 2HIVA 2YTYA 3OIPA 4BS9A 3I91A 2R92B 2EPBA 3DHQA 4IZ8A 2DGYA 2R7ZG 1B7YB 3UDXA 4RKBA 1J9OA 2XWJB 4KY7A 1EY7A 2Q8RE 4C56C 4F8MA 2AWOA 5DNFA 5LMNQ 4GOPB 2YTVA 4JI5L 2B63H 4C3HH 4A3FH 5A35A 1I6HB 1F77A 3OSOA 4EQOA 5E4XA 5G3LD 3C1EA 1N32Q 5KYIA 4PNYA 2IX3A 5C0XJ 3NBIA 2NVQB 1MD2D 1QNKA 1SMYD 4G7ZC 4C2MH 1ENCA 4IJHA 4OO1I 3KOJA 2R7ZH 3PQIA 1EFID 4GLVB 5J1ZA 2I46A 4DR5L 1OXTA 4OIKA 3D6CA 4JI7Q 1VQBA 1QUQB 2EYOA 5CC4A 1K3RA 4PV1C 3PF5A 1FGBD 3NWTA 4J15A 2EYFA 1EY4A 3J7A5 1WTHA 1E7ZA 1NNXA 3S1QH 3R2TA 2EYHA 4DV2L 2UUAQ 1GD7A 1WCMG 1TWGH 4IFDG 4BXXG 3LX0A 4ZUJA 1MSHA 5CV5A 1XYIA 1NMGA 1PDQA 2FXQA 2B2WC 4ZKBB 1D1KA 3C46A 3SK5A 3VYUA 1BCPC 2NN6G 3E3XA 3ND9A 4GNXA 2E74C 4DR6L 2XTIA 1WCMH 3MXNA 4IFDH 3HOVG 2EYPA 4BXXH 3HFZB 5L37A 3A74A 3GTGB 4N8X1 4BY7H 4DAMA 3GV6A 1KC8C 3NPPA 4L5QA 1VQJA 5D3DA 3CCVA 5TSSA 1L1OA 1YNJD 2NN6H 2EXZA 4JG2A 5EKKA 2JQOA 1MSGA 3WWVA 4AYBG 5I4DA 3LNNA 4RFBA 1F9RA 3NELA 3HOUB 3HOVH 3VR2A 1W6JA 3OHXC 3PF4A 1HNZQ 2MUYA 5CGKA 1VQEA 4RMFA 1S5DD 2K05A 1U5KA 1EQVA 3S14H 3GTJB 3SHLA 2GN5A 5C5LA 1ILQA 4MZ9A 5IWAL 4IFDI 1Y8OB 4NPSA 2RKSA 1D2BA 4AQYL 1JOOA 5BN3A 3NQTA 1BDOA 1GVPA 1TS5A 4ZUIA 2V4DA 4A3JG 2E2JB 3IFTA 5M5WH 4JI5Q 1PH1A 4QQBX 4YCVA 2NN6I 1S5CD 3SK4A 1SFOB 1SLJA 1YNXA 2HQEA 2KQ3A 3M3YH 3VDYA 4BY1G 2EY6A 4EQ5A 1G6ZA 2A19A 3AMUA 2ZJPA 2JA7B 2EYLA 3D3RA 4UP9A 2QF7A 1UE7A 4DR5Q 4A3JH 3K5NA 2IX1A 4X3TA 1O7ZA 1V1PA 1MJCA 2ZJQA 2SNMA 1BR9A 1CZGA 2K50A 5FLMG 3A54A 4RCNA 4DV2Q 4K8JA 4JI6L 4I65A 4BY1H 1CSPA 2B2UA 1KABA 5IT9L 2JE6I 1SR3A 2J0TD 1W3SA 4HR7B 2XNAC 1PH6A 4OEMB 1VQ9A 4S3SA 4J1MA 2B2YC 4POFA 2QDLA 1LTRD 3DM1A 4ZQ3A 4OL7A 3RZDH 2Q2HA 2N55A 3G7LA 2BDOA 5KNDA 3J80L 4HJ9A 4XT3B 2CW0D 3QOJA 1EWHA 2N3SA 4A76A 1VMCA 4DUZL 4FF3A 1NY4A 3AYHB 2WINB 3I55A 4LMQD 4DR6Q 1TY2A 5FLMH 3CF5A 3OMCA 2SEBD 1NTGA 4KMUC 4FF4A 1S3OA 3IFDA 3T16A 4F7XA 4IJLA 4A93G 1SE4A 1V8QA 2L1BA 2NBFA 4DR4L 1GUNA 2DJFC 3BZCA 3CCSA 1N9WA 4MN3A 1CM9A 1RKNA 4IOCA 4IPGA 4M8AA 3AB9A 4KY6A 1EEID 5C3EG 4BBSG 5KNBA 1JOKA 4PMCA 1IYJB 1Z7TA 4K14A 1X3GA 2QKIC 1TKWB 1FD7D 2NTSA 4DV1L 4IPHA 1BCPF 1IYUA 3A5UA 2K75A 2WAQB 4A93H 3VR3A 1YHBA 4R4QA 5HGQA 1QZHA 4BBRB 1VQLA 1Q8KA 4NDXA 2B8FA 5DLQE 1N36L 4P72A 5T1IA 3H09A 4A3GG 3GDEA 2CH4W 1VQCA 4KKUA 4U68A 3ZYYX 4LFAL 4MIUA 5ELNA 1EUJA 5C3EH 4BBSH 3MEHA 2B2TA 1GKHA 4GS3A 2MJ8A 2YV5A 2X6LA 1A6XA 2F0TA 5IWAQ 3CXCA 1AEXA 3S17H 4AQYQ 5KNCA 1LT6D 2WKCA 1UE6A 1SNDA 4ZK9B 2ZXRA 5KGUA 1BBUA 4DA2A 1XTDA 2N49A 4DAVA 1XNQL 2E2IB 4LUVA 1VQIA 1RTNA 4A4IA 2I5LX 5J39A 3S2DH 4A3GH 3U4VA 1RIPA 2F52A 1L1OB 3I8ZA 2AQ1B 2MQHA 4WJWA 2O4XA 1H9RA 3MXPA 2MGSA 3J80i 3DMUA 2K5HA 5KYLA 1B50A 4FP5D 4WORA 1CTMA 5AFWA 1H9SA 5IY0A 5T1GA 3TEHB 4FDBA 1B9NA 1TVXA 1JCKB 3MZ5A 5CBAE 4JVZA 4JI6Q 5FKAC 5IIFA 1YBYA 1PVOA 5LL6S 4B3RL 5C4XG 2KA7A 5JEAG 1GXDC 4QCLA 4DPGA 1DGSA 2RBMA 3W1GA 4X62L 3V05A 3S9WA 4A3BG 3NTHA 4QJFA 2GVBA 2SDFA 2AQ2B 2UXDL 1LYLA 2QCPX 4DUZQ 3HOZH 2L9HA 1TY0A 1TQOA 2K4KA 2PZWA 4RHRA 1NR4A 3RZOH 4MNOA 2R92G 3A7LA 3TP7A 3DLLA 2PQAA 4QGUA 4DR4Q 5C4XH 5IGDA 4EX5A 5JEAH 1SE3A 3PGZA 1QILA 1CT1D 4DK0A 1HTPA 4A3BH 1I50H 4B9WA 1ENAA 4X66L 4GN4B 4HMJA 4Q0FA 2Z9HA 1YJ9A 4IUTA 3ZJYC 4RHSA 4JI4L 2H1EA 4LF5Q 4DV1Q 2ICIA 2DNCA 2BH8A 2R92H 2JP1A 1OXUA 4P73A 1VQDA 3D4RA 4CKEA 2EJMA 2B2WA 1O7YA 2CWAA 3QG1A 4JYAL 1N36Q 3O13A 4DNIA 3STBD 2Q2IA 1EY5A 1UUPA 3UDIA 4LFAQ 1I6HH 2I5HA 3PUZA 4JOIC 4XQJA 1T5EA 2CFMA 3J80E 4QL5A 2IHEA 1LT4D 2NVTH 2BCOA 3P7JA 3S2HB 1J8IA 4Z9CB 2HCIA 4X65L 1PA6A 4WJ4A 1ZEQX 1XNQQ 4KHVA 1A8VA 3GTKB 4JBJA 4LK1C 3OMGA 3S16B 1JJGA 1G91A 3RMHA 2WB1E 2G9HD 1WTXA 2OXPA 2ZXPA 5ISRA 3OWFA 4DK1A 5EKLA 1ML0D 3HEJA 1QVGA 1PRTD 1V1OA 1STGA 1ASZA 4A3KB 2M9VA 3SE0A 5CV7A 2Y0SB 3WOEA 1JJ2A 4DFAA 4JI2L 4JBMA 3HOYB 3J80c 2B8GA 2K52A 1VQ6A 5JJLA 3E5SA 1BBWA 3ULJA 3DXJC 3R8BA 1VMPA 1HA6A 5GQOA 5FJ8G 1K9MC 4DV4L 2RSOA 2RVLA 1FVIA 4YHHL 5M3FB 3L7ZC 3D31A 3CHBD 2IPKD 4Q5VA 5FLXL 3GTOH 4B3RQ 5IODA 4X62Q 4JCVE 2KEDA 2ZT9C 4A3LG 4XXEA 1F2ZA 4OHJA 2F4VL 2JEAI 4KKSA 2UXDQ 2KCNA 1A62A 1S72A 4N9TA 1Y8NB 1TWAH 4X3KA 3D8GA 1G2SA 1D5MC 1VF5C 1TWFB 2ZM6L 4ULLA 5FJ8H 2QDBA 2G5DA 3FVQA 3TS2A 3T13A 3MFYA 3GTQB 2WP8J 4K0KQ 3CW2C 2VS1A 2JA5B 5DEHA 2YTXA 3PMFA 1HR0L 1JICA 1TT2A 1P8LA 4A3LH 5LL6X 2IT1A 4X66Q 1BXTA 1SYGA 5CMDA 1PXUA 3GTJH 2FMMA 5NUCA 3NSWA 4JI4Q 1B53A 3I90A 2XIWA 1KAWA 3RR5A 1IW7D 3HKSA 4IOAA 3N52A 2B2VA 1PRTB 1SJED 4JBWA 1AFPA 1UAPA 3FRPB 4KTAA 4CHTB 2B2YA 3QO2A 1A2TA 3FEWX 5KEEA 4JYAQ 3R3OA 3DUZA 2E2JH 1MGSA 1LTBD 4PZ8A 5JJKA 2NVXH 1GJXA
chains in the Genus database with same CATH topology
3KBGA 3TDQA 1JWUD 4HSVA 2FFKB 1Y1VB 1JOQA 4XYOA 3Q23A 4ZLTF 3BVGA 1Z47A 4HCEA 2EJFC 4QUFA 1WVLA 1W6KA 2BA0A 2K01A 1JB3A 2F0FA 5CORA 5KIXA 1DOMA 3G6JB 2F0PA 4C3JB 2EOTA 2PNRC 4F88A 1E2WA 1UNSA 3V96A 3ND8A 1SSOA 3TZUA 4EVOA 5EGTA 1WTOA 4Y7NB 3S1MB 3I4LA 1DOKA 5A2QL 4FYDA 1PFMA 5F2DA 2WV6D 4XQNA 1JE4A 1WTPA 4OGQC 2YU9B 5I2XA 3U9SA 4B9XA 4IALA 5HGTA 2SOBA 2VNUD 2WKDA 5IGCA 2XWBB 3Q22A 2PZUA 1HUNA 2K28A 1WTWA 2A73B 1A15A 3GTLB 2BDNA 2BE5C 1QJOA 1NAPA 2PPBC 2R93B 4H13C 1R4QB 1C8CA 2Z4HA 3FPPA 1I4HA 1K8OA 1PFNA 3A8KE 3NQIA 5D3IB 1PRTC 1A3UA 4ZRZA 1ONLA 2K32A 2F0GA 4A3IB 3OOCA 1Q8IA 3TMEA 3HOXB 2ICEC 4CJ0B 2H4OA 2FJ2A 4IQZA 2CVRA 4KJOA 2L4NA 3D4WA 4KN7C 2F0MA 1SAPA 2PCFB 4E6IA 3IKJA 2EZVA 3GTPB 4CGYB 1DJRD 2IW3A 1ICWA 1LTID 5FLXE 4KHZA 2A6HD 1SNOA 3URYA 5EQ0A 4K5XA 1ZYRC 1Q1EA 1EYDA 2SNSA 2RDFA 1YNNC 2AWNA 1CQFA 5C6AA 2F0SA 3KLRA 3EROA 5CV8A 5LHY1 5EPJA 3EJIA 2L11A 4FF2A 1DONA 1BOSA 3H91A 1JORA 3NK9A 3H3VC 1U9RA 2EVBA 5M5XB 3PIP3 5C4JB 1IW7C 4O1NA 1ENFA 2M2LA 4IUVA 3SEBA 1SNMA 1HRJA 2NVYB 3OWEB 2F0DA 3KK7A 4QIWB 3DEPA 1TS2A 1VDZA 5C5MA 2GA4B 5C3XA 5C4HA 3I3CA 1O78A 2MPMA 4QUCA 2OEOA 5CR3A 1SYBA 1MI2A 1L0YB 2E76C 1KNAA 2PQEA 4CKCA 1K8MA 1XXGA 4C3IG 1NR2A 5JVG3 1EU4A 2A69C 3SK8A 5JAVA 3SVMA 1PTOD 3BS1A 1Q90A 2XSCA 1L0XB 3RLFA 1FNVA 1RCVD 2K04A 1V43A 3MWYW 2NTTA 3A56A 1G8ZD 2I07B 3FKIB 1DM0B 2EJGC 2J7ZA 5A2QE 1AZPA 3BDCA 1TWHB 4ODGA 3VYRA 2OT2A 3BG3A 4A3MB 1SNPA 1D1IA 4IUUA 1AW7A 1LV9A 1M8AA 1RODA 4A3EB 5JPNC 2LS01 5BN5A 5J22A 2KHSA 3GQBA 2RA4A 1Y1WB 4PMWA 1BNZA 1EY9A 2R6GA 4KD4A 5HURA 5JOBA 3KF8A 4G7HC 4UAIA 1SMYC 5FK9C 3C2PA 5EJWA 1STYA 2F0WA 1O7LA 3S1RB 1IYVA 5D65A 1PTOB 1H9KA 3ONAB 4K6DA 2LFNA 3ITPA 2F0LA 3PUWA 3UI2A 3KLSA 1CA5A 5C0XG 1G2TA 1K83B 3QJYA 4J6HA 4TSSA 3SDZA 3GP7A 4K6LA 5FO7B 2MHVA 2B63B 2D5DA 1EIGA 3TP6A 3PO3B 4CJ1B 1SYCA 3AU7A 1EY0A 5C0XH 4C2MB 1ESFA 1H9MA 1PLFA 3FDTA 1YNJC 4HSPA 4M1UB 3NWSA 2X6GA 3K57A 4BA2I 3MHBA 1SYDA 3S1QB 4XIGS 1PZJD 1RD9D 2IX0A 1B4OA 1TWGB 3GTMB 3H6MA 1X32A 1KNEA 2F4IA 1JQYD 1RHPA 3JAML 4RH6A 1HXYD 3EA6A 4ZKCB 3PV0A 3K59A 4BA1I 1NSNS 5EKIA 1R9TB 2IL8A 1HQMC 1WCMB 1SYFA 5C0XI 3FPUB 3SK6A 3H0GB 4BY7B 3LWUA 2K33A 4ABNA 2RSNA 4IUNA 3Q6SA 1PTOC 2PYKA 3DWPA 3HZXA 2EY1A 2D62A 5COYA 5ELEA 3SR1A 1R4PB 3J81L 3F2UA 3HOVB 5EBDA 3L3OC 3HG9A 3M85A 2AQ3B 2O2LD 2K03A 1V1PB 2J4XA 4DN4M 3WDNA 1CHPD 4AYBB 2B39A 2L12A 2VXWA 4JK1C 2R61A 2DY8A 5G3LF 5IT9E 3T56B 1Y8PB 2CW0C 3KUPA 1AP0A 1HTLD 5C3WA 5M5WB 1RF2D 2XN9C 4H7BA 4R9WA 2F0EA 2LMCB 2FMCA 4IUQA 1FR3A 4RCOA 2KEEA 2KOLA 4KKTA 1QE6A 3M3YB 1STHA 1GUOA 3PUVA 4FXKC 1B44D 1A3VA 5FO8B 1DD2A 2A6ED 4G4KA 4NMZA 1GUTA 3TP8A 3X3NA 1PZKD 4EQPA 1SEBD 1WTVA 4WRDA 3T53B 5E4WC 3N6RA 1BF4A 4KD3A 5DM63 1OXXK 4K8IA 4KY5A 4EQNA 4IFDJ 4KV6A 3RZDB 1IKLA 4ZAIA 4RAUC 2DY7A 2K7VA 2KJXA 4QMGA 3HRZC 4HCSA 1I4PA 1RTOA 1OXVA 2DNEA 4A3DB 1ESRA 3MTSA 3TN2A 3M4YA 2B2UC 1C4QA 4B08A 4A93B 1CA6A 1BCPD 1CQVA 3QIAA 1QG7A 1G291 2MP1A 1H9SB 4RGOS 3KLSX 3VR6A 5C3EB 1PYWD 1II3A 3JAME 1SNQA 3VYTA 3HKZB 4BWGB 1PTOF 2WACA 2K5WA 3BZDB 2IJ0A 1EY8A 3CU7A 3J7AV 1CK1A 2HUGA 3S2DB 4A3GB 2PZTA 1IL8A 1LABA 1EIHA 2D9UA 1JC7A 3IAYA 5ELFA 2Q8IB 1WTRA 2Z4IA 3M7NA 3DWQA 4EGVA 1BBXC 1GHJA 1EOTA 4LJZC 2B2TC 4XDXA 4DAPA 1FNWA 2RDHA 4KK7A 2M00A 2VB3X 3A7AB 3R2IA 1LACA 2L55A 1STBA 3VR4A 1BCPB 5CYUA 4G7OC 1SYEA 3HOZB 4HAEA 3RZOB 2A68D 3I72A 4HTHA 1E2VA 3R93A 1H9JA 1BQQT 5C4XB 4NW2A 3HOWB 3NTKA 2IWHA 5IGGA 2A6EC 3DEOA 4A3BB 1I50B 3VR5A 3QOLA 4KN4C 2HCCA 1GHKA 1M4VA 4PQXA 3T51B 3CQZB 2PMZB 4OIJA 1STEA 5JPMC 4X3UA 2F0JA 4K5WA 4O42A 1NUCA 1Z6HA 1KDCA 1HA5A 1GUSA 3D6WA 1F2YA 4XT1B 2PO4A 2PW5A 4FF1A 5C44B 2NVTB 2KVMA 1X3PA 1KDBA 4QB4A 3MXUA 1SDFA 4FO2A 4L6TB 3IL8A 3K5OA 1A2UA 5I9OA 2XRQD 3K5MA 3EFXD 4RKLA 3Q24A 4DF7A 4ZYSA 3P20A 3U9OA 5EPKA 1SJHD 4L8JA 5IGEA 4CBVA 1B9MA 2KUMA 3OIQA 1DZ1A 2G9DA 4I7ZC 1STAA 5E3FA 3GTOB 5CV6A 2NUCA 5JEAJ 3RUZA 1Y69U 1TWAB 3E0JA 4H0LC 4XYQA 2Z8LA 2EYJA 3NTIA 2JXMB 4ME5A 3S15B 2TMPA 4QF4A 5E1FA 3TP5A 1ZXTA 1SBBB 2F0QA 1Q12A 3P75A 1FYCA 3MFGA 2F3WA 4NP5A 1EYAA 1GUWA 4H44C 2X69A 2ENBA 1QB5D 5ELBA 4WFN3 2LY7A 3NUCA 3C3LA 4CJ2C 1QOHA 2N88A 3C1FA 2QILA 2NVXB 1B3AA 1EQTA 3NE5B 2NZ1D 4KJNA 3PIO3 1DOLA 1EYCA 2O5JC 3W2DA 1JR0D 2ID0A 3TBIB 1GUGA 2A68C 4FNFA 4TRDA 2JEBI 1WD0A 3X3MA 1ET6A 3GO5A 2E75C 1JWSD 1PRTF 1HQRD 3OW7A 1IKMA 1CHQD 3TZDA 3BDLA 3S1NB 3V2TA 1F9SA 5FOBB 2K5QA 1EZ6A 1BO0A 3CKIB 1S5FD 2HDLA 1DXMA 2F1MA 2JSOA 5DAUA 1QNUA 2NB0A 2ZXOA 1HUMA 1A3TA 2B2VC 2KCCA 1EL0A 2L0CA 5EBCA 1C48A 1TS4A 1UEAB 1KTKA 3I70A 4HN7A 3EQLC 5ELDA 5BN4A 1WD1A 5K5PA 5IGFA 1I4GA 2BA1A 1EU3A 4R8IA 5I9PA 1HFNA 1WTQA 2BOSA 4RGTA 3K6OA 5CV9A 1E2ZA 1U4PA 1SXTA 3BYTB 2A6HC 3M7GA 5K36G 4N9PA 4C1NI 1VF7A 1BUVT 4RA8A 2KECA 4K5VA 4FVMA 2Q8TA 4FXDA 3HS0C 1HHVA 2CQAA 2R3ZA 3HP3A 2EY5A 4C3HB 3VA7A 4A3FB 2TSSA 3A55A 1CZWA 3K5LA 1FNUA 1LLRD 2F3VA 2F0HA 5K36H 2FHTA 2E2HB 1AN8A 2A5HA 4U673 2R7ZB 4DNRB 2FINB 2NWGA 3E6ZX 3WOFA 3BVMA 2WIIB 1S4ZA 3L9AX 4P2CB 4C3JG 5M3MB 4HMIA 3FMCA 5ELCA 3MXGA 3CRKC 1S5BD 4TKOB 1CI3M 1QWYA 1TWCB 5I2YA 4XTCS 1LT3D 1E0BA 1HCZA 2C9OA 2YYZA 1STNA 3T4AC 1MBYA 2EYMA 4RGNA 3MVVA 3NP8A 1CFMA 2CHBD 4KI0A 1U4RA 4L63B 4V190 2DN8A 3MA2B 3QWNA 1S5ED 2AUJD 2F0IA 3SXHA 2AUKA 3K7AB 5I6YA 1DYQA 1Q1BA 4ILWA 1GOZA 3P1HA 5C4ZA 1KAAA 3NHHA 3I4MB 5I6WA 1EZ8A 4FXGC 1PZID 1LTTD 3VA5A 4J8QA 3NBHA 1RDPD 4K2LA 1EWCA 3S14B 3EVQA 1TR5A 3GD7A 1RJTA 3J7AF 2F0KA 1ZKOA 1XWEA 3K0YA 4YIJA 2RQXA 1PMRA 3M4OB 5M9OA 2EDGA 1B1ZA 4GZYC 1TU2B 3OPOA 1ET9A 1T5XD 2O5IC 1O80A 1XX8A 3A8JE 2OF1A 1D5XC 1ILPA 2K1BA 1QCBD 4DXGA 1D5ZC 2RDGA 2Z1CA 5IOCA 2F0UA 1LTAD 3MAQA 4LAAA 4MHEA 2L5TA 4RGMA 5FO9B 3GV3A 1LT5D 4A3JB 4C3IB 3KBXA 1SE2A 4PMBA 3J7YW 2F03A 5M5YB 2BE5D 4BY1B 2A74C 2NYZD 3TSSA 1I4RA 3A8IE 1KLGD 2XRSD 4XQQA 2XVSA 1VCIA 1F9PA 3QB3A 1X3QA 3D4DA 2D2CC 1IHZA 1I4QA 2C5CA 3BYYB 2F0VA 1F2LA 5CBEE 1TIID 1LO5D 3I73A 2EE1A 4IN3A 1NCVA 2JA8B 4F87A 4UDUC 4HEDA 3HGBA 1XTCD 4DU9A 4ID6A 3ERQA 3I4NB 4R8NA 1KDAA 1ZYRD 3K58A 3PUXA 1YNND 1LTGD 4DAYA 2EY2A 2JA6B 1OO9B 5IGBA 4BBSB 1D6EC 1F9QA 4CKBA 2K6AA 3S17B 2LKVA 2HDMA 3W3AA 1DCZA 4DXFA 1KLUD 2VUMB 1I4XA 2WB1B 1HPCA 5DM73 5CV4A 5JVH3 5D14A 3PUYA 3RD4A 1I3QB 3H94A 3CRLC 4V0BA 4IUPA 4RWSC 3BVZA 2QEJC 4NKLA 5JJZA 4TQUS 4G57A 4DNTB 3NXWA 3VYSA 3DWAA 1U4LA 3J81E 3BDOA 1B2TA 1Q3LA 2K5DA 5EPLA 2JYOA 4K2KA 1U4MA 1F2MA 4OO1G 2PW7A 2A69D 4DGZA 1EEFD 2F0OA 2E2DC 1I6VC 4C1NK 2VB2X 1EY6A 1AZQA 4OO1H 4X3SA 1TS3A 3Q0AA 3MC0B 1PTOH 1JWMD 4C3HG 1LTSD 3PO2B 2F0NA 1SNCA 1HFGA 5KRUA 4IURA 1PFBA 1OXSC 3LWEA 3OIPA 4BS9A 3I91A 2R92B 2EPBA 3DHQA 4IZ8A 4RKBA 1J9OA 2XWJB 4KY7A 4F8MA 1EY7A 4C56C 2Q8RE 2AWOA 5DNFA 5A35A 1I6HB 1F77A 3OSOA 4EQOA 5E4XA 5G3LD 3C1EA 5KYIA 4PNYA 2IX3A 5C0XJ 3NBIA 2NVQB 1MD2D 1QNKA 1SMYD 4G7ZC 1ENCA 4OO1I 1EFID 5J1ZA 2I46A 1OXTA 4OIKA 3D6CA 2EYOA 5CC4A 4PV1C 1FGBD 3NWTA 2EYFA 1EY4A 2EYHA 3R2TA 4IFDG 3LX0A 4ZUJA 1MSHA 5CV5A 1XYIA 1PDQA 2B2WC 4ZKBB 1D1KA 3C46A 3SK5A 3VYUA 1BCPC 2NN6G 3ND9A 2E74C 3MXNA 4IFDH 2EYPA 3GTGB 3GV6A 3NPPA 5D3DA 5TSSA 1YNJD 2NN6H 2EXZA 5EKKA 1MSGA 5I4DA 3LNNA 4RFBA 1F9RA 3HOUB 3VR2A 1W6JA 3OHXC 2MUYA 5CGKA 1S5DD 2K05A 1EQVA 3GTJB 3SHLA 5C5LA 1ILQA 4IFDI 1Y8OB 2RKSA 1D2BA 1JOOA 5BN3A 3NQTA 1BDOA 4ZUIA 1TS5A 2V4DA 2E2JB 3IFTA 2NN6I 1S5CD 3SK4A 1SFOB 2HQEA 2KQ3A 2EY6A 1G6ZA 3AMUA 2JA7B 2EYLA 3D3RA 2QF7A 3K5NA 2IX1A 4X3TA 1O7ZA 1V1PA 2SNMA 1BR9A 1CZGA 3A54A 4RCNA 4K8JA 4I65A 2B2UA 1KABA 5IT9L 2JE6I 2J0TD 4HR7B 2XNAC 4S3SA 4J1MA 2B2YC 1LTRD 3DM1A 4ZQ3A 4OL7A 2N55A 3G7LA 2BDOA 5KNDA 3J80L 4XT3B 2CW0D 3QOJA 1EWHA 1VMCA 4FF3A 2WINB 4LMQD 1TY2A 3OMCA 2SEBD 4KMUC 4FF4A 3IFDA 3T16A 4F7XA 1SE4A 1V8QA 2L1BA 2NBFA 1GUNA 4MN3A 1CM9A 1RKNA 4M8AA 3AB9A 4KY6A 1EEID 5KNBA 1JOKA 4PMCA 1Z7TA 4K14A 2QKIC 1TKWB 1FD7D 2NTSA 1BCPF 1IYUA 2WAQB 3VR3A 4BBRB 4NDXA 2B8FA 5T1IA 3H09A 4KKUA 4U68A 3ZYYX 4MIUA 3MEHA 2B2TA 2MJ8A 2X6LA 1A6XA 2F0TA 1AEXA 5KNCA 1LT6D 2WKCA 1SNDA 4ZK9B 2ZXRA 5KGUA 4DA2A 4DAVA 2E2IB 1RTNA 5J39A 3I8ZA 2AQ1B 4WJWA 2O4XA 1H9RA 3MXPA 2MGSA 3DMUA 5KYLA 1B50A 4FP5D 4WORA 1CTMA 5AFWA 1H9SA 5T1GA 1B9NA 1TVXA 1JCKB 3MZ5A 5CBAE 5FKAC 5IIFA 5LL6S 2KA7A 5JEAG 1GXDC 4QCLA 2RBMA 3V05A 3S9WA 3NTHA 2SDFA 2AQ2B 2QCPX 2L9HA 1TY0A 1TQOA 2PZWA 4RHRA 1NR4A 3A7LA 3TP7A 5IGDA 5JEAH 1SE3A 1QILA 1CT1D 4DK0A 1HTPA 4B9WA 1ENAA 4HMJA 4Q0FA 4IUTA 4RHSA 2H1EA 2ICIA 2DNCA 2JP1A 1OXUA 3D4RA 4CKEA 2EJMA 2B2WA 1O7YA 3QG1A 3O13A 1EY5A 1UUPA 3PUZA 4XQJA 1T5EA 3J80E 1LT4D 2BCOA 3P7JA 3S2HB 1J8IA 4Z9CB 2HCIA 1ZEQX 4KHVA 3GTKB 4LK1C 3OMGA 3S16B 1G91A 3RMHA 2G9HD 1WTXA 2OXPA 2ZXPA 5ISRA 3OWFA 4DK1A 5EKLA 1ML0D 3HEJA 1PRTD 1V1OA 1STGA 4A3KB 2M9VA 3SE0A 5CV7A 2Y0SB 3WOEA 4DFAA 3HOYB 2B8GA 3E5SA 3DXJC 3R8BA 1VMPA 1HA6A 2RSOA 2RVLA 5M3FB 3L7ZC 3D31A 3CHBD 2IPKD 4Q5VA 5FLXL 5IODA 2KEDA 2ZT9C 4XXEA 1F2ZA 4OHJA 2JEAI 4KKSA 2KCNA 4N9TA 1Y8NB 4X3KA 3D8GA 1G2SA 1D5MC 1VF5C 1TWFB 4ULLA 2QDBA 3FVQA 3T13A 3MFYA 3GTQB 2WP8J 2JA5B 5DEHA 3PMFA 1JICA 1TT2A 5LL6X 2IT1A 1BXTA 1SYGA 5CMDA 1PXUA 2FMMA 5NUCA 3NSWA 1B53A 3I90A 2XIWA 1IW7D 3N52A 2B2VA 1PRTB 1SJED 4JBWA 1AFPA 1UAPA 3FRPB 4KTAA 4CHTB 2B2YA 3QO2A 1A2TA 3FEWX 5KEEA 3R3OA 3DUZA 1MGSA 1LTBD 1GJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K8J A;  4KHV A;  3SK8 A;  5I6Y A;  3MXP A;  2F0M A;  5JAV A;  4I65 A;  5I9P A;  3TP6 A;  2EYJ A;  1KAB A;  3OMG A;  3QOL A;  4DGZ A;  3DMU A;  4ME5 A;  5KYL A;  5CV9 A;  2F0O A;  4S3S A;  3P1H A;  4WOR A;  1KAA A;  3NHH A;  2OXP A;  5C4Z A;  4E6I A;  4J1M A;  3OWF A;  5ISR A;  5C3W A;  5EKL A;  5I6W A;  1EZ8 A;  1SYC A;  2EYP A;  1JOQ A;  4ZQ3 A;  4OL7 A;  3HEJ A;  1EY0 A;  1STG A;  2F0J A;  4N9P A;  4QF4 A;  3VA5 A;  5E1F A;  3MZ5 A;  4K5W A;  3TP5 A;  4H7B A;  3QOJ A;  1EY6 A;  2F0E A;  5IGG A;  5IIF A;  5CV7 A;  1II3 A;  4K5V A;  2F0F A;  1SNQ A;  2F0Q A;  3BDC A;  4ID6 A;  1NUC A;  1SNO A;  4K2L A;  4ODG A;  3P75 A;  4DFA A;  4DU9 A;  5KIX A;  2F0P A;  4K5X A;  2F3W A;  3ERQ A;  3OMC A;  1STH A;  2EXZ A;  3EVQ A;  1KDC A;  1EYD A;  4R8N A;  1TR5 A;  2EY5 A;  2SNS A;  3E5S A;  1EYA A;  2RDF A;  4NP5 A;  1KDA A;  1SNP A;  2RBM A;  1SYD A;  2WAC A;  3MHB A;  3T16 A;  4F7X A;  3S9W A;  1F2Y A;  2F0K A;  2ENB A;  5C6A A;  2F0S A;  2PW7 A;  4YIJ A;  3ERO A;  1A3V A;  1EY8 A;  2F0N A;  5CV8 A;  4EVO A;  2PW5 A;  1SNC A;  5EGT A;  3EJI A;  5J22 A;  2KHS A;  5KRU A;  4NMZ A;  3H6M A;  3NUC A;  2EY2 A;  2F3V A;  1TQO A;  1RKN A;  3TP8 A;  2PZT A;  2F0H A;  2PZW A;  5M9O A;  5IOD A;  3C1F A;  1JOR A;  3DHQ A;  5IGB A;  3NK9 A;  4KY6 A;  4IZ8 A;  5CGK A;  1U9R A;  1JOK A;  3TP7 A;  4PMC A;  4EQP A;  4RKB A;  4K14 A;  2OF1 A;  1F2Z A;  1KDB A;  1EQV A;  4KY7 A;  4WRD A;  4QB4 A;  1EY7 A;  5F2D A;  4F8M A;  1EY9 A;  3SHL A;  5IGD A;  2LKV A;  4KD3 A;  4N9T A;  3D8G A;  4KD4 A;  5C5L A;  4KJN A;  1NSN S;  5HUR A;  1EYC A;  4K8I A;  4KY5 A;  4HMI A;  5JOB A;  5CV4 A;  4EQN A;  4TRD A;  4B9X A;  4B9W A;  5IOC A;  1ENA A;  3OSO A;  2F0U A;  4EQO A;  4KV6 A;  3C1E A;  1SYF A;  2RKS A;  2QDB A;  4IAL A;  4HMJ A;  2SOB A;  4PNY A;  5HGT A;  5KYI A;  4LAA A;  4NDX A;  5IGC A;  1A2U A;  3SK6 A;  3T13 A;  5I9O A;  1JOO A;  5EKK A;  1STY A;  3NQT A;  1SNM A;  2PZU A;  4ZUI A;  4RKL A;  3BDL A;  2M00 A;  4DF7 A;  1ENC A;  2F0W A;  4MIU A;  5DEH A;  3V2T A;  3U9O A;  3PMF A;  3MEH A;  2F0D A;  1TT2 A;  4IUN A;  1EZ6 A;  5J1Z A;  3SK4 A;  4PMB A;  1STB A;  2PYK A;  5IGE A;  3D6C A;  2F0T A;  3HZX A;  2EY1 A;  1SYG A;  2EYO A;  4NKL A;  1AEX A;  4QMG A;  5C5M A;  2HQE A;  2KQ3 A;  5CC4 A;  4G57 A;  5DAU A;  5NUC A;  3SR1 A;  2EY6 A;  5C3X A;  5C4H A;  1STN A;  1A3T A;  3NXW A;  1SND A;  4K6D A;  1EY5 A;  2EYM A;  5KGU A;  1A3U A;  2EYF A;  1SYE A;  1EY4 A;  3ITP A;  2F0L A;  2F0G A;  3MVV A;  2EYL A;  3NP8 A;  1STA A;  2EYH A;  2OEO A;  5CR3 A;  1SYB A;  5E3F A;  4KTA A;  3LX0 A;  4ZUJ A;  3TME A;  4HTH A;  5CV5 A;  5J39 A;  2PQE A;  5CV6 A;  3QB3 A;  1A2T A;  5KEE A;  3R3O A;  2F0I A;  2NUC A;  4J6H A;  3D4D A;  3SK5 A;  4KJO A;  4K2K A;  1IHZ A;  1F2M A;  3RUZ A;  3SXH A;  3D4W A;  2SNM A;  5K5P A;  5IGF A;  2F0V A;  2O4X A; 
#chains in the Genus database with same CATH topology
 3KBG A;  2DJG C;  3TDQ A;  1S40 A;  4HJ8 A;  2ASB A;  2MO0 A;  2MO1 A;  1JWU D;  1CKN A;  4HSV A;  2FFK B;  1Y1V B;  2Z6B A;  4ZCK A;  1JOQ A;  4XYO A;  1I5F A;  1MHW C;  3Q23 A;  1ASY A;  4ZLT F;  2H5X A;  1Z47 A;  3BVG A;  4HCE A;  2EJF C;  4X65 Q;  4QUF A;  3CCM A;  1WVL A;  1W6K A;  2BA0 A;  2K01 A;  1JB3 A;  2F0F A;  3S1N H;  5COR A;  5KIX A;  4GLA C;  1DOM A;  2E8G A;  3G6J B;  1K0S A;  2F0P A;  4OON A;  3RLN A;  4R4I A;  4C3J B;  2EOT A;  2PNR C;  4F88 A;  3G4S A;  1E2W A;  1UNS A;  4YWK A;  3V96 A;  3ND8 A;  1SSO A;  3TZU A;  1PYS B;  2VW9 A;  4EVO A;  3UE1 A;  5EGT A;  1WTO A;  4Y7N B;  4JI2 Q;  3K80 C;  4YCU A;  3S1M B;  3I4L A;  1DOK A;  5A2Q L;  4LF9 L;  4FYD A;  4YWM A;  1PFM A;  1VQF A;  5F2D A;  4DV4 Q;  3STB C;  2WV6 D;  4JV5 L;  4YHH Q;  4XQN A;  1JE4 A;  1WTP A;  3AEV A;  4OGQ C;  2YU9 B;  1EWI A;  2WAQ G;  5H1S E;  5I2X A;  3U9S A;  4B9X A;  4JI1 L;  4IAL A;  5HGT A;  2SOB A;  2VNU D;  2WKD A;  5IGC A;  2XWB B;  1Q46 A;  2F4V Q;  3Q22 A;  2PZU A;  1HUN A;  2K28 A;  1WTW A;  2A73 B;  1A15 A;  3GTL B;  2BDN A;  2BE5 C;  1QJO A;  2ZM6 Q;  1NAP A;  2PPB C;  2R93 B;  4H13 C;  4HJA A;  1R4Q B;  1C8C A;  2Z4H A;  1L2F A;  3FPP A;  1I4H A;  4DK6 C;  4L5R C;  1K8O A;  5M3M G;  1PFN A;  3A8K E;  2UXB L;  3NQI A;  5D3I B;  3D0F A;  1PRT C;  1A3U A;  4ZRZ A;  1ONL A;  2K32 A;  2F0G A;  1E3P A;  4A3I B;  2PI2 A;  1HR0 Q;  1B70 B;  3OOC A;  1Q8I A;  3K8A A;  3TME A;  3HOX B;  2ICE C;  4CJ0 B;  2H4O A;  1Q81 C;  1V1Q A;  2FJ2 A;  3F1Z A;  4HIO A;  4IQZ A;  2E2H H;  2CVR A;  2Z6K A;  4KJO A;  1NE3 A;  2L4N A;  3D4W A;  1X9N A;  4Y52 H;  4LFC L;  4KN7 C;  2IY5 B;  3PIP A;  4DR3 L;  1G51 A;  2F0M A;  3M4P A;  4DR1 L;  2HT1 A;  5M3M H;  2KHI A;  1SAP A;  2PCF B;  1KRS A;  4UP8 A;  5LMN W;  2QW7 A;  3IKJ A;  4E6I A;  2EZV A;  4CGY B;  1DJR D;  3GTP B;  2IW3 A;  1HNW L;  1ICW A;  1SRU A;  1TWC H;  3T1Y L;  1HR0 W;  1E1O A;  1LTI D;  5FLX E;  4KHZ A;  2A6H D;  1SNO A;  3URY A;  5EQ0 A;  4K5X A;  1ZYR C;  1Q1E A;  1EYD A;  2SNS A;  4X6A H;  2RDF A;  1WYD A;  1YNN C;  2AWN A;  1CQF A;  5C6A A;  2F0S A;  3KLR A;  3ERO A;  2AMC B;  4DAY B;  5CV8 A;  1UE1 A;  5LHY 1;  5EPJ A;  3EJI A;  3I4M G;  1PFS A;  2L11 A;  4A3C G;  4FF2 A;  1DON A;  1BOS A;  3H91 A;  1JOR A;  3NK9 A;  3H3V C;  1U9R A;  2EVB A;  5M5X B;  3PIP 3;  5FLX c;  5C4J B;  1N33 L;  4IPC A;  1IW7 C;  3K7A H;  4LF7 L;  4O1N A;  4MTN A;  1EQQ A;  3TS0 A;  1ENF A;  3I7F A;  3PSI A;  2M2L A;  4LF9 Q;  1D7Q A;  2AHO B;  4IUV A;  3I4M H;  3SEB A;  1SNM A;  4JV5 Q;  4A3C H;  1HRJ A;  1G6P A;  4TVA B;  2NVY B;  3OWE B;  2F0D A;  3KK7 A;  4QIW B;  1PH5 A;  3DEP A;  1TS2 A;  4JI1 Q;  4PG3 A;  1VDZ A;  4GOP C;  5C5M A;  3I2Z A;  4ALP A;  2GA4 B;  1IBK L;  5C3X A;  5C4H A;  3I3C A;  1CKN B;  2RCF A;  1VQP A;  1O78 A;  2MPM A;  4QUC A;  2OEO A;  4DKA C;  5CR3 A;  1SYB A;  1KD1 C;  1VQ5 A;  1MI2 A;  1L0Y B;  2E76 C;  1KNA A;  2PQE A;  3M4O H;  3F2C A;  4CKC A;  1K8M A;  4X64 L;  1XXG A;  4C3I G;  1NR2 A;  1YHA A;  5JVG 3;  2K14 A;  2UXB Q;  1EU4 A;  4OWX B;  2A69 C;  3SK8 A;  5JAV A;  1SMX A;  3SVM A;  1PTO D;  3BS1 A;  2D0P A;  1Q90 A;  2XSC A;  2OTL A;  1L0X B;  4PZ6 A;  3RLF A;  1FNV A;  1RCV D;  1X3F A;  2K04 A;  1V43 A;  2WAQ E;  4GKK L;  3MWY W;  5HY6 A;  2NTT A;  3A56 A;  1G8Z D;  2I07 B;  3FKI B;  4LFC Q;  1C0A A;  5ELO A;  1DM0 B;  2EJG C;  2J7Z A;  4DR3 Q;  4A3K G;  5A2Q E;  4DR1 Q;  1AZP A;  4C3I H;  1SE8 A;  3BDC A;  1TWH B;  4ODG A;  3S2H H;  3VYR A;  2OT2 A;  3HOY G;  3BG3 A;  4A3M B;  2R7F A;  3MEF A;  5M5Y H;  1XMQ L;  2E5L L;  2ES2 A;  1SNP A;  1D1I A;  4IUU A;  2EXD A;  4APV A;  1HNW Q;  1AW7 A;  1LV9 A;  1M8A A;  1ROD A;  2LXK A;  3T1Y Q;  4A3E B;  5J3B A;  5JPN C;  2LS0 1;  5BN5 A;  5J22 A;  4DV3 L;  2KHS A;  2JA8 G;  3G48 A;  3GQB A;  2RA4 A;  4LF8 L;  1Y1W B;  3CCQ A;  1YEZ A;  4A3K H;  4PMW A;  4GN3 B;  1BNZ A;  3HOY H;  1EY9 A;  3KF6 A;  2R6G A;  1KXL A;  4NXN L;  4KD4 A;  3I4N G;  5HUR A;  1PH3 A;  5JOB A;  2RHS B;  3KF8 A;  4G7H C;  4UAI A;  1SMY C;  5FK9 C;  3C2P A;  5EJW A;  1STY A;  2JA8 H;  1KRT A;  1N33 Q;  2UUC L;  2F0W A;  2JA6 G;  1O7L A;  4LF7 Q;  3S1R B;  1IYV A;  3ULL A;  5D65 A;  1PTO B;  1CSQ A;  1H9K A;  4L5T A;  3I4N H;  1PHJ A;  2VUM G;  3ONA B;  2WB1 G;  4K6D A;  2LFN A;  3ITP A;  2F0L A;  3KLW A;  3PUW A;  3ER0 A;  3UI2 A;  3KLS A;  2CWP A;  1CA5 A;  5C0X G;  2OCE A;  1G2T A;  1K83 B;  1IBK Q;  2JA6 H;  3QJY A;  4J6H A;  4TSS A;  2D0O A;  3SDZ A;  3GP7 A;  4K6L A;  2MFI A;  5FO7 B;  1YI2 A;  2MHV A;  4DV6 L;  2B63 B;  4GNX B;  4YWL A;  3K7U C;  2D5D A;  1UE5 A;  1EIG A;  3TP6 A;  2L15 A;  2VUM H;  3PO3 B;  4X64 Q;  2B29 A;  3MXN B;  4CJ1 B;  1SYC A;  3AU7 A;  1EY0 A;  5C0X H;  4JI3 L;  4C2M B;  1EIF A;  1ESF A;  1I3Q H;  1H9M A;  1PLF A;  2HD3 A;  3FDT A;  1YNJ C;  4HSP A;  1IXR A;  1LM0 A;  4M1U B;  3CD6 A;  4GKK Q;  3NWS A;  2X6G A;  3K57 A;  4BA2 I;  3MHB A;  1SYD A;  2RF4 A;  5IYD G;  2Q2U A;  4JI0 L;  3S1Q B;  4XIG S;  1PZJ D;  1RD9 D;  4HJ5 A;  2IX0 A;  1B4O A;  1TWG B;  3GTM B;  3H6M A;  1X32 A;  1KNE A;  1SRO A;  2F4I A;  2BH2 A;  1JQY D;  4LF4 L;  1RHP A;  3JAM L;  4RH6 A;  1XMQ Q;  2E5L Q;  1HXY D;  4CDF C;  3EA6 A;  3PV0 A;  4ZKC B;  3K59 A;  4BA1 I;  1NSN S;  4DV3 Q;  5EKI A;  1R9T B;  2Q2T A;  2IL8 A;  5IYD H;  1HQM C;  1CKM A;  1WCM B;  1SYF A;  5C0X I;  3PO2 G;  3FPU B;  3SK6 A;  3H0G B;  4BY7 B;  3LWU A;  3S1M H;  2RHQ B;  2HHH L;  2K33 A;  4NXN Q;  4ABN A;  1P16 A;  2RSN A;  4IUN A;  3CAM A;  3Q6S A;  1MIU A;  1PTO C;  2PYK A;  3DWP A;  2Z0S A;  3HZX A;  3H3V H;  2EY1 A;  2D62 A;  5COY A;  2Y0S E;  5ELE A;  2CKZ B;  3M4Q A;  3SR1 A;  3CCU A;  4L5S A;  1R4P B;  4B3S L;  3J81 L;  2UUC Q;  3F2U A;  3HOV B;  3L3O C;  5EBD A;  2KCT A;  4A3I G;  3PO2 H;  3HG9 A;  3M85 A;  3J7Z C;  3LGJ A;  3NEN A;  3CC7 A;  1PH7 A;  2AQ3 B;  3F8T A;  2O2L D;  2K03 A;  1V1P B;  2K5V A;  2J4X A;  1MKH A;  3CC4 A;  4DN4 M;  4GNX C;  3K81 C;  3WDN A;  1CHP D;  4AYB B;  2B39 A;  2L12 A;  2VXW A;  3JC6 6;  1SN8 A;  4JW0 A;  3F2D A;  4JK1 C;  3I56 A;  5BR8 L;  2R61 A;  2DY8 A;  5G3L F;  5IT9 E;  3T56 B;  1Y8P B;  1I94 L;  4A3I H;  2CW0 C;  3KUP A;  1AP0 A;  1HTL D;  5C3W A;  1GM5 A;  4DV6 Q;  2NVQ H;  5M5W B;  1RF2 D;  3T1H L;  2XN9 C;  4H7B A;  4R9W A;  2F0E A;  1L1O C;  2LMC B;  3H3V I;  2FMC A;  3KF6 B;  4IUQ A;  1FR3 A;  4RCO A;  2KEE A;  2KOL A;  4KKT A;  1QE6 A;  3M3Y B;  1STH A;  1GUO A;  3PUV A;  4FXK C;  1WFQ A;  3W5O A;  1B44 D;  4JI3 Q;  1A3V A;  5FO8 B;  1DD2 A;  2A6E D;  4G4K A;  1XPR A;  4NMZ A;  5IT9 c;  1GUT A;  3TP8 A;  3X3N A;  1HJP A;  1TXY A;  1PZK D;  4EQP A;  1SEB D;  4JI0 Q;  1WTV A;  4WRD A;  3T53 B;  4RG1 A;  5E4W C;  4POG A;  3N6R A;  1BF4 A;  4KD3 A;  5DM6 3;  1OXX K;  4K8I A;  4KY5 A;  3F2B A;  4GOP A;  4EQN A;  4LF4 Q;  4IFD J;  4KV6 A;  3RZD B;  4HID A;  1IKL A;  1YVC A;  1VS0 A;  1X54 A;  4ZAI A;  3HOU G;  4RAU C;  4QY7 A;  3GTG H;  2DY7 A;  1K8G A;  2K7V A;  2KJX A;  4LF6 L;  2I5M X;  4QMG A;  3HRZ C;  4HCS A;  1QUQ A;  5C4J H;  1QVC A;  1I4P A;  1RTO A;  1OXV A;  2HHH Q;  2DNE A;  1FGU A;  1B8A A;  1C7Y A;  3A0J A;  3HOU H;  1PH4 A;  4A3D B;  1ESR A;  3MTS A;  3TN2 A;  1D8L A;  3M4Y A;  3OTO L;  1VQN A;  4DV0 L;  3I4O A;  4B3S Q;  2B2U C;  2B3G A;  1VQM A;  1C4Q A;  4B08 A;  4A93 B;  1CA6 A;  1BCP D;  4LNQ A;  1CQV A;  3KYH C;  3QIA A;  1QG7 A;  3KFU A;  1G29 1;  1HNX L;  4IO9 A;  2MP1 A;  1H9S B;  2JA7 G;  4RGO S;  3KLS X;  2VQF L;  1BKB A;  3VR6 A;  3FKI G;  3ULP A;  1NJI C;  5C3E B;  1PYW D;  3RLO A;  3U50 C;  1II3 A;  3JAM E;  1SNQ A;  3VYT A;  5BR8 Q;  1PH8 A;  3HKZ B;  3NEM A;  4BWG B;  1SFO H;  3PCO B;  1I94 Q;  1PTO F;  2WAC A;  3KJP A;  4JI7 L;  2K5W A;  3BZD B;  3T1H Q;  4NXM L;  2IJ0 A;  1EY8 A;  3CU7 A;  3J7A V;  1CK1 A;  2JA7 H;  2HUG A;  3S2D B;  4MTK A;  4A3G B;  2PZT A;  1IL8 A;  1LAB A;  3FKI H;  1EIH A;  1X6O A;  2VL6 A;  2D9U A;  1HZB A;  3CC2 A;  1JC7 A;  3IAY A;  2PQA B;  5ELF A;  1ICF B;  1TWH H;  2Q8I B;  1WTR A;  4LWC A;  3G6E A;  3JAM c;  2Z4I A;  3M7N A;  3DWQ A;  1JMC A;  2UUB L;  4EGV A;  1BBX C;  5AJ3 L;  3QR8 A;  4ME3 A;  1GHJ A;  1EOT A;  5IP9 G;  3J81 j;  4UP7 A;  4LJZ C;  2B2T C;  4XDX A;  4DAP A;  1FNW A;  2RDH A;  4KK7 A;  5GAE C;  2M00 A;  2VB3 X;  3A7A B;  3R2I A;  4AH6 A;  1PH2 A;  1LAC A;  2L55 A;  1STB A;  3VR4 A;  1BCP B;  3ICE A;  1X55 A;  1PH9 A;  5EAY A;  5CYU A;  3UE0 A;  3CME A;  4G7O C;  1SYE A;  4B3T L;  3HOZ B;  4HAE A;  2JA9 A;  5IP9 H;  4BBR G;  3RZO B;  2A68 D;  3I72 A;  4HTH A;  4LF6 Q;  1E2V A;  3R93 A;  1H9J A;  2JN4 A;  1BQQ T;  3S1R H;  5C4X B;  4NW2 A;  3HOW B;  3NTK A;  3CCL A;  2IWH A;  5IGG A;  1CKO A;  2A6E C;  3DEO A;  4A3B B;  1I50 B;  3VR5 A;  3QOL A;  4KN4 C;  2HCC A;  1GHK A;  1A0I A;  1M4V A;  4PQX A;  3PO3 G;  2ATW A;  3T51 B;  5E7N A;  1JJC B;  3CQZ B;  3OTO Q;  4BBR H;  2PMZ B;  4OIJ A;  1VQK A;  1STE A;  2HIX A;  5JPM C;  3CCR A;  4X3U A;  4DV0 Q;  4YY3 L;  2F0J A;  3CMA A;  2OQK A;  4K5W A;  4OWW B;  1K83 H;  4O42 A;  1NUC A;  3KJO A;  1Z6H A;  4IPD A;  1HNX Q;  2UU9 L;  4P75 A;  1VQ4 A;  1KDC A;  1HA5 A;  4QIW E;  4OXP A;  1GUS A;  3D6W A;  1F2Y A;  2VQF Q;  4DR7 L;  3M9B A;  1IBL L;  3PO3 H;  3CP0 A;  3H15 A;  4XT1 B;  2PO4 A;  2PW5 A;  4LW1 A;  4FF1 A;  2MNA A;  2E2I H;  4DV5 L;  1EOV A;  5C44 B;  1QVF A;  2NVT B;  2KVM A;  1K3B C;  1X3P A;  1K73 C;  4O2D A;  3RNU A;  1KDB A;  4NXM Q;  4QB4 A;  3MXU A;  2OTJ A;  1SDF A;  4A75 A;  4FO2 A;  4L6T B;  1VQ7 A;  1Q7Y C;  3IL8 A;  1AE3 A;  1B3Q A;  3K5O A;  3Q8D A;  1A2U A;  5I9O A;  2XRQ D;  3K5M A;  2VQE L;  3GTM H;  3EFX D;  3H0G G;  1MJE A;  3FHW A;  4BY7 G;  4RKL A;  3Q24 A;  3U58 A;  4DF7 A;  4ZYS A;  3P20 A;  2UUB Q;  3U9O A;  5EPK A;  1SJH D;  4L8J A;  5IGE A;  1IZ6 A;  4CBV A;  5AJ3 Q;  4KHP L;  1B9M A;  1VQO A;  1IL2 A;  2JJQ A;  2KUM A;  3IRB A;  1R9T H;  4OWT B;  3OIQ A;  1DZ1 A;  1YZ6 A;  2G9D A;  4I7Z C;  1STA A;  5E3F A;  1KL9 A;  2DUD A;  3GTO B;  3H0G H;  5CV6 A;  4YCW A;  3AQQ A;  4HJ7 A;  2NUC A;  4JOI A;  5JEA J;  3RUZ A;  1Y69 U;  1TWA B;  3E0J A;  4B3T Q;  4H0L C;  4XYQ A;  2Z8L A;  2EYJ A;  3NTI A;  1VQA A;  4GKJ L;  2JXM B;  5GRO A;  3PIO A;  4ME5 A;  1K28 A;  1UEB A;  3S15 B;  2PI2 E;  1IBM L;  3KDF A;  1HZC A;  2TMP A;  1EQR A;  4QF4 A;  5E1F A;  3TP5 A;  2KBN A;  1ZXT A;  1SBB B;  2F0Q A;  1Q12 A;  2PNH A;  3P75 A;  1FYC A;  3MFG A;  3UDG A;  2F3W A;  4LFB L;  4NP5 A;  1EYA A;  1GUW A;  1HH2 P;  4R4C A;  1N34 L;  4H44 C;  4YY3 Q;  2X69 A;  2I0Q A;  2ENB A;  3EBE A;  2KHJ A;  5IP7 G;  1QB5 D;  4CDC C;  5ELB A;  4WFN 3;  2LY7 A;  5IYC G;  1WJJ A;  3NUC A;  3C3L A;  2OWO A;  4CJ2 C;  1Q86 C;  2UU9 Q;  1QOH A;  2N88 A;  1N8R C;  3C1F A;  1L0W A;  2QIL A;  4DR7 Q;  1IBL Q;  2NVX B;  2Y0S G;  4GLX A;  1B3A A;  1EQT A;  3NE5 B;  2C35 B;  2NZ1 D;  3CPF A;  4KJN A;  1DOL A;  1EYC A;  3PIO 3;  2O5J C;  3W2D A;  3GTK H;  4DV5 Q;  1JR0 D;  2ID0 A;  3TBI B;  1GUG A;  2A68 C;  4FNF A;  4TRD A;  3S16 H;  5IP7 H;  4UY8 C;  2JEB I;  1WD0 A;  3X3M A;  1ET6 A;  1T9H A;  1E1T A;  3GO5 A;  5LMU L;  1PV4 A;  5IYC H;  2CCZ A;  2E75 C;  1JWS D;  1PRT F;  1HQR D;  5M3F G;  2QA4 A;  4CDE C;  3OW7 A;  1IKM A;  1CHQ D;  3TZD A;  2F3I A;  3BDL A;  3S1N B;  3V2T A;  1NBW A;  4OX9 L;  2EIF A;  3G71 A;  1F9S A;  3RN2 A;  5FOB B;  2CH4 A;  2K5Q A;  1EZ6 A;  1BO0 A;  3CCE A;  3CKI B;  4B3M L;  1S5F D;  2HDL A;  1DXM A;  1RL2 A;  2F1M A;  2JSO A;  5DAU A;  1QNU A;  2NB0 A;  2ZXO A;  2VQE Q;  1HUM A;  1A3T A;  2B2V C;  4I7A A;  2A8V A;  2KCC A;  1AE2 A;  2CQO A;  1EL0 A;  3OW2 A;  2L0C A;  5EBC A;  1C48 A;  2OQ0 A;  1TS4 A;  1UEA B;  1KTK A;  5M3F H;  4KHP Q;  4A3D G;  3I70 A;  4HN7 A;  2NZH A;  3EQL C;  5ELD A;  2JA5 G;  5BN4 A;  1WD1 A;  3L0O A;  5K5P A;  5IGF A;  3RN5 A;  1I4G A;  3K0X A;  4LUZ A;  1AH9 A;  2BA1 A;  1EU3 A;  1V9P A;  4R8I A;  1A63 A;  5I9P A;  4HIM A;  1HFN A;  1WTQ A;  2BOS A;  4RGT A;  3K6O A;  1J5E L;  1TWF H;  5CV9 A;  1E2Z A;  2GVA A;  4DR2 L;  3E9I A;  1U4P A;  1SXT A;  4AIM A;  1QZG A;  3BYT B;  2A6H C;  3M7G A;  1XPU A;  3GTQ H;  5K36 G;  4N9P A;  4C1N I;  2ALY B;  4A3D H;  1VF7 A;  1BUV T;  4RA8 A;  2KEC A;  4K5V A;  4FVM A;  2JA5 H;  2KCM A;  2Q8T A;  4GKJ Q;  4FXD A;  3HS0 C;  1HHV A;  2CQA A;  2VZA A;  3HKZ G;  4LF5 L;  1UWV A;  2R3Z A;  3HP3 A;  2EY5 A;  4C3H B;  1YHQ A;  3VA7 A;  1VQH A;  1IBM Q;  4A3F B;  2R7D A;  2TSS A;  3SGI A;  3A55 A;  1CZW A;  5GAH C;  3K5L A;  1FNU A;  1LLR D;  3BU2 A;  1Z9F A;  1Y1V G;  2F3V A;  3EIV A;  1M90 C;  2F0H A;  5K36 H;  2FHT A;  4LFB Q;  2QEX A;  3E0E A;  2E2H B;  1AN8 A;  2A5H A;  2K5N A;  4U67 3;  1N34 Q;  4DNR B;  1KQS A;  2R7Z B;  2FIN B;  2NWG A;  3E6Z X;  3WOF A;  5IYB G;  3BVM A;  2UXC L;  2WII B;  1S4Z A;  3L9A X;  4UPA A;  4P2C B;  4C3J G;  5M3M B;  1K0R A;  4HMI A;  3FMC A;  4AYB E;  1EIY B;  5ELC A;  3MXG A;  4JI8 L;  3CRK C;  1S5B D;  4TKO B;  1CI3 M;  1QWY A;  1TWC B;  1Y1V H;  2HQL A;  5I2Y A;  3E9H A;  4XTC S;  1LT3 D;  4P74 A;  1E0B A;  5IYB H;  1VQ8 A;  1HCZ A;  2C9O A;  5LMU Q;  4C3J H;  2YYZ A;  1STN A;  4JC0 A;  3T4A C;  2NZO A;  1MBY A;  1XNR L;  2EYM A;  4RGN A;  3MVV A;  1LUZ A;  4LF8 Q;  4OX9 Q;  3NP8 A;  1CFM A;  2CHB D;  4KI0 A;  4R1J A;  3HOZ G;  1U4R A;  4L63 B;  3KDF B;  4B3M Q;  4V19 0;  4Y7N H;  2DN8 A;  2Z6K C;  3MA2 B;  3QWN A;  1S5E D;  2AUJ D;  2F0I A;  4P71 A;  4JPB W;  3B6Y A;  3SXH A;  1O7I A;  3HOW G;  2AUK A;  3K7A B;  3S24 A;  1WI5 A;  1XJV A;  2R93 G;  4UHV A;  5I6Y A;  1FL0 A;  1Y14 B;  1DYQ A;  1Q1B A;  2YU9 H;  4ILW A;  1GOZ A;  2P5Z X;  3P1H A;  1KAA A;  3NHH A;  5C4Z A;  3I4M B;  3TQY A;  5I6W A;  1EZ8 A;  1H95 A;  4FXG C;  1PZI D;  4NB3 A;  3BZK A;  1LTT D;  3VA5 A;  3HOX G;  2ZTC A;  4J8Q A;  3NBH A;  1RDP D;  4K2L A;  4K0K L;  1EWC A;  1J5E Q;  3GTL H;  3S14 B;  2A1A A;  3HOW H;  1XPO A;  2R93 H;  4DR2 Q;  3EVQ A;  3CCJ A;  1W2B A;  1TR5 A;  3GD7 A;  1RJT A;  3J7A F;  2F0K A;  1ZKO A;  1XWE A;  3K0Y A;  3FP9 A;  4YIJ A;  2RQX A;  1PMR A;  3CQZ H;  3M4O B;  5M9O A;  2EDG A;  1B1Z A;  3HOX H;  4GZY C;  1TU2 B;  3OPO A;  1ET9 A;  1T5X D;  5C44 G;  2O5I C;  1O80 A;  1XX8 A;  3A8J E;  2OF1 A;  1D5X C;  1JT8 A;  1J6Q A;  1ILP A;  2K1B A;  1QCB D;  2KEN A;  3KF8 B;  4DXG A;  1FJG L;  3A5Z B;  1D5Z C;  2RDG A;  2Z1C A;  1OTC A;  5IOC A;  2F0U A;  5IE8 A;  3JAM i;  1LTA D;  3MAQ A;  4LAA A;  4MHE A;  2ZJR A;  2L5T A;  4RGM A;  1GO3 E;  4DK3 C;  3GTP H;  5FO9 B;  4LUO A;  2UXC Q;  3GV3 A;  1LT5 D;  4N8F A;  4PZ7 A;  4A3J B;  3TRE A;  4C3I B;  5C44 H;  3KBX A;  1SE2 A;  4PMB A;  3J7Y W;  3UDF A;  1PYB A;  2F03 A;  5M5Y B;  3ERS X;  4JI8 Q;  2BE5 D;  4BY1 B;  3HKZ E;  2A74 C;  3W1B A;  2NYZ D;  2JK8 A;  3TSS A;  1YIT A;  1I4R A;  4WJ3 M;  3AFP A;  3A8I E;  1KLG D;  2XRS D;  4XQQ A;  2XVS A;  1VCI A;  3BJU A;  4CDD C;  1F9P A;  1NMF A;  3QB3 A;  1X3Q A;  3D4D A;  2D2C C;  1IHZ A;  1XNR Q;  4DV7 L;  3DM3 A;  1I4Q A;  2C5C A;  3J81 i;  5M5X H;  3BYY B;  2F0V A;  2EQS A;  1F2L A;  5CBE E;  1YJN A;  1TII D;  1XMO L;  1Q82 C;  1LO5 D;  2LXJ A;  2VY3 A;  3I73 A;  2EE1 A;  1YJW A;  4IN3 A;  1NCV A;  4DUY L;  2JA8 B;  4F87 A;  4UDU C;  4HED A;  4O0A A;  1CUK A;  4OEL B;  4R4O A;  3HGB A;  1XTC D;  2NVY H;  1X65 A;  1X3E A;  4ID6 A;  4DU9 A;  1BVS A;  1JE5 A;  2LSS A;  3ERQ A;  3I4N B;  4R8N A;  1KDA A;  1EYG A;  1ZYR D;  4KLK A;  3K58 A;  2ZTE A;  1E22 A;  3PUX A;  1VQG A;  1YNN D;  3U4Z A;  1LTG D;  4DAY A;  5JJI A;  5LMN L;  4JBK A;  3S15 H;  2EY2 A;  3L2P A;  2JA6 B;  1OO9 B;  3TRZ A;  1N32 L;  5IGB A;  4BBS B;  1D6E C;  1F9Q A;  4R4T A;  4CKB A;  2K6A A;  1M1K C;  3S17 B;  2LKV A;  2HDM A;  3W3A A;  1U0L A;  1DCZ A;  4DXF A;  1KLU D;  4GN5 A;  2VUM B;  1I4X A;  2WB1 B;  4A3M G;  1HPC A;  5GAG C;  5DM7 3;  2V1C C;  5CV4 A;  4H02 A;  5JVH 3;  5D14 A;  1HZ9 A;  3PUY A;  3CPW A;  4A3E G;  3RD4 A;  1K8A C;  1I3Q B;  3H94 A;  3CRL C;  4V0B A;  4IUP A;  2PMZ E;  1X56 A;  4RWS C;  1Y1W G;  2UUA L;  3BVZ A;  1FJG Q;  5GAD C;  2QEJ C;  1KHI A;  2N78 A;  2N8N A;  4NKL A;  5JJZ A;  1WOC A;  2IHF A;  4TQU S;  4G57 A;  4A3M H;  4DNT B;  3NXW A;  3VYS A;  3DWA A;  1U4L A;  4A3E H;  3J81 E;  2QGQ A;  3BDO A;  2WFW A;  1B2T A;  1Q3L A;  2K5D A;  5EPL A;  3NBH B;  2JYO A;  1Y1W H;  3OYY A;  4K2K A;  1U4M A;  1F2M A;  2ZTD A;  1YIJ A;  4OO1 G;  2XGT A;  2PW7 A;  1C9O A;  2A69 D;  1EFW A;  3EN2 A;  4DGZ A;  1EEF D;  2F0O A;  2E2D C;  1I6V C;  4DV7 Q;  1E24 A;  4C1N K;  2VB2 X;  2AKW B;  3J81 c;  1EY6 A;  1AZQ A;  1XMO Q;  1KIX A;  2RCN A;  4OO1 H;  1JB7 A;  4X3S A;  1TS3 A;  4DUY Q;  3Q0A A;  3MC0 B;  1HNZ L;  1PTO H;  1JWM D;  2B63 G;  4C3H G;  4A3F G;  1LTS D;  4HIK A;  3PO2 B;  1LTL A;  2F0N A;  1SNC A;  1HFG A;  3AFQ A;  1HZA A;  5KRU A;  4IUR A;  1PFB A;  1OXS C;  3LWE A;  2HIV A;  2YTY A;  3OIP A;  4BS9 A;  3I91 A;  2R92 B;  2EPB A;  3DHQ A;  4IZ8 A;  2DGY A;  2R7Z G;  1B7Y B;  3UDX A;  4RKB A;  1J9O A;  2XWJ B;  4KY7 A;  1EY7 A;  2Q8R E;  4C56 C;  4F8M A;  2AWO A;  5DNF A;  5LMN Q;  4GOP B;  2YTV A;  4JI5 L;  2B63 H;  4C3H H;  4A3F H;  5A35 A;  1I6H B;  1F77 A;  3OSO A;  4EQO A;  5E4X A;  5G3L D;  3C1E A;  1N32 Q;  5KYI A;  4PNY A;  2IX3 A;  5C0X J;  3NBI A;  2NVQ B;  1MD2 D;  1QNK A;  1SMY D;  4G7Z C;  4C2M H;  1ENC A;  4IJH A;  4OO1 I;  3KOJ A;  2R7Z H;  3PQI A;  1EFI D;  4GLV B;  5J1Z A;  2I46 A;  4DR5 L;  1OXT A;  4OIK A;  3D6C A;  4JI7 Q;  1VQB A;  1QUQ B;  2EYO A;  5CC4 A;  1K3R A;  4PV1 C;  3PF5 A;  1FGB D;  3NWT A;  4J15 A;  2EYF A;  1EY4 A;  3J7A 5;  1WTH A;  1E7Z A;  1NNX A;  3S1Q H;  3R2T A;  2EYH A;  4DV2 L;  2UUA Q;  1GD7 A;  1WCM G;  1TWG H;  4IFD G;  4BXX G;  3LX0 A;  4ZUJ A;  1MSH A;  5CV5 A;  1XYI A;  1NMG A;  1PDQ A;  2FXQ A;  2B2W C;  4ZKB B;  1D1K A;  3C46 A;  3SK5 A;  3VYU A;  1BCP C;  2NN6 G;  3E3X A;  3ND9 A;  4GNX A;  2E74 C;  4DR6 L;  2XTI A;  1WCM H;  3MXN A;  4IFD H;  3HOV G;  2EYP A;  4BXX H;  3HFZ B;  5L37 A;  3A74 A;  3GTG B;  4N8X 1;  4BY7 H;  4DAM A;  3GV6 A;  1KC8 C;  3NPP A;  4L5Q A;  1VQJ A;  5D3D A;  3CCV A;  5TSS A;  1L1O A;  1YNJ D;  2NN6 H;  2EXZ A;  4JG2 A;  5EKK A;  2JQO A;  1MSG A;  3WWV A;  4AYB G;  5I4D A;  3LNN A;  4RFB A;  1F9R A;  3NEL A;  3HOU B;  3HOV H;  3VR2 A;  1W6J A;  3OHX C;  3PF4 A;  1HNZ Q;  2MUY A;  5CGK A;  1VQE A;  4RMF A;  1S5D D;  2K05 A;  1U5K A;  1EQV A;  3S14 H;  3GTJ B;  3SHL A;  2GN5 A;  5C5L A;  1ILQ A;  4MZ9 A;  5IWA L;  4IFD I;  1Y8O B;  4NPS A;  2RKS A;  1D2B A;  4AQY L;  1JOO A;  5BN3 A;  3NQT A;  1BDO A;  1GVP A;  1TS5 A;  4ZUI A;  2V4D A;  4A3J G;  2E2J B;  3IFT A;  5M5W H;  4JI5 Q;  1PH1 A;  4QQB X;  4YCV A;  2NN6 I;  1S5C D;  3SK4 A;  1SFO B;  1SLJ A;  1YNX A;  2HQE A;  2KQ3 A;  3M3Y H;  3VDY A;  4BY1 G;  2EY6 A;  4EQ5 A;  1G6Z A;  2A19 A;  3AMU A;  2ZJP A;  2JA7 B;  2EYL A;  3D3R A;  4UP9 A;  2QF7 A;  1UE7 A;  4DR5 Q;  4A3J H;  3K5N A;  2IX1 A;  4X3T A;  1O7Z A;  1V1P A;  1MJC A;  2ZJQ A;  2SNM A;  1BR9 A;  1CZG A;  2K50 A;  5FLM G;  3A54 A;  4RCN A;  4DV2 Q;  4K8J A;  4JI6 L;  4I65 A;  4BY1 H;  1CSP A;  2B2U A;  1KAB A;  5IT9 L;  2JE6 I;  1SR3 A;  2J0T D;  1W3S A;  4HR7 B;  2XNA C;  1PH6 A;  4OEM B;  1VQ9 A;  4S3S A;  4J1M A;  2B2Y C;  4POF A;  2QDL A;  1LTR D;  3DM1 A;  4ZQ3 A;  4OL7 A;  3RZD H;  2Q2H A;  2N55 A;  3G7L A;  2BDO A;  5KND A;  3J80 L;  4HJ9 A;  4XT3 B;  2CW0 D;  3QOJ A;  1EWH A;  2N3S A;  4A76 A;  1VMC A;  4DUZ L;  4FF3 A;  1NY4 A;  3AYH B;  2WIN B;  3I55 A;  4LMQ D;  4DR6 Q;  1TY2 A;  5FLM H;  3CF5 A;  3OMC A;  2SEB D;  1NTG A;  4KMU C;  4FF4 A;  1S3O A;  3IFD A;  3T16 A;  4F7X A;  4IJL A;  4A93 G;  1SE4 A;  1V8Q A;  2L1B A;  2NBF A;  4DR4 L;  1GUN A;  2DJF C;  3BZC A;  3CCS A;  1N9W A;  4MN3 A;  1CM9 A;  1RKN A;  4IOC A;  4IPG A;  4M8A A;  3AB9 A;  4KY6 A;  1EEI D;  5C3E G;  4BBS G;  5KNB A;  1JOK A;  4PMC A;  1IYJ B;  1Z7T A;  4K14 A;  1X3G A;  2QKI C;  1TKW B;  1FD7 D;  2NTS A;  4DV1 L;  4IPH A;  1BCP F;  1IYU A;  3A5U A;  2K75 A;  2WAQ B;  4A93 H;  3VR3 A;  1YHB A;  4R4Q A;  5HGQ A;  1QZH A;  4BBR B;  1VQL A;  1Q8K A;  4NDX A;  2B8F A;  5DLQ E;  1N36 L;  4P72 A;  5T1I A;  3H09 A;  4A3G G;  3GDE A;  2CH4 W;  1VQC A;  4KKU A;  4U68 A;  3ZYY X;  4LFA L;  4MIU A;  5ELN A;  1EUJ A;  5C3E H;  4BBS H;  3MEH A;  2B2T A;  1GKH A;  4GS3 A;  2MJ8 A;  2YV5 A;  2X6L A;  1A6X A;  2F0T A;  5IWA Q;  3CXC A;  1AEX A;  3S17 H;  4AQY Q;  5KNC A;  1LT6 D;  2WKC A;  1UE6 A;  1SND A;  4ZK9 B;  2ZXR A;  5KGU A;  1BBU A;  4DA2 A;  1XTD A;  2N49 A;  4DAV A;  1XNQ L;  2E2I B;  4LUV A;  1VQI A;  1RTN A;  4A4I A;  2I5L X;  5J39 A;  3S2D H;  4A3G H;  3U4V A;  1RIP A;  2F52 A;  1L1O B;  3I8Z A;  2AQ1 B;  2MQH A;  4WJW A;  2O4X A;  1H9R A;  3MXP A;  2MGS A;  3J80 i;  3DMU A;  2K5H A;  5KYL A;  1B50 A;  4FP5 D;  4WOR A;  1CTM A;  5AFW A;  1H9S A;  5IY0 A;  5T1G A;  3TEH B;  4FDB A;  1B9N A;  1TVX A;  1JCK B;  3MZ5 A;  5CBA E;  4JVZ A;  4JI6 Q;  5FKA C;  5IIF A;  1YBY A;  1PVO A;  5LL6 S;  4B3R L;  5C4X G;  2KA7 A;  5JEA G;  1GXD C;  4QCL A;  4DPG A;  1DGS A;  2RBM A;  3W1G A;  4X62 L;  3V05 A;  3S9W A;  4A3B G;  3NTH A;  4QJF A;  2GVB A;  2SDF A;  2AQ2 B;  2UXD L;  1LYL A;  2QCP X;  4DUZ Q;  3HOZ H;  2L9H A;  1TY0 A;  1TQO A;  2K4K A;  2PZW A;  4RHR A;  1NR4 A;  3RZO H;  4MNO A;  2R92 G;  3A7L A;  3TP7 A;  3DLL A;  2PQA A;  4QGU A;  4DR4 Q;  5C4X H;  5IGD A;  4EX5 A;  5JEA H;  1SE3 A;  3PGZ A;  1QIL A;  1CT1 D;  4DK0 A;  1HTP A;  4A3B H;  1I50 H;  4B9W A;  1ENA A;  4X66 L;  4GN4 B;  4HMJ A;  4Q0F A;  2Z9H A;  1YJ9 A;  4IUT A;  3ZJY C;  4RHS A;  4JI4 L;  2H1E A;  4LF5 Q;  4DV1 Q;  2ICI A;  2DNC A;  2BH8 A;  2R92 H;  2JP1 A;  1OXU A;  4P73 A;  1VQD A;  3D4R A;  4CKE A;  2EJM A;  2B2W A;  1O7Y A;  2CWA A;  3QG1 A;  4JYA L;  1N36 Q;  3O13 A;  4DNI A;  3STB D;  2Q2I A;  1EY5 A;  1UUP A;  3UDI A;  4LFA Q;  1I6H H;  2I5H A;  3PUZ A;  4JOI C;  4XQJ A;  1T5E A;  2CFM A;  3J80 E;  4QL5 A;  2IHE A;  1LT4 D;  2NVT H;  2BCO A;  3P7J A;  3S2H B;  1J8I A;  4Z9C B;  2HCI A;  4X65 L;  1PA6 A;  4WJ4 A;  1ZEQ X;  1XNQ Q;  4KHV A;  1A8V A;  3GTK B;  4JBJ A;  4LK1 C;  3OMG A;  3S16 B;  1JJG A;  1G91 A;  3RMH A;  2WB1 E;  2G9H D;  1WTX A;  2OXP A;  2ZXP A;  5ISR A;  3OWF A;  4DK1 A;  5EKL A;  1ML0 D;  3HEJ A;  1QVG A;  1PRT D;  1V1O A;  1STG A;  1ASZ A;  4A3K B;  2M9V A;  3SE0 A;  5CV7 A;  2Y0S B;  3WOE A;  1JJ2 A;  4DFA A;  4JI2 L;  4JBM A;  3HOY B;  3J80 c;  2B8G A;  2K52 A;  1VQ6 A;  5JJL A;  3E5S A;  1BBW A;  3ULJ A;  3DXJ C;  3R8B A;  1VMP A;  1HA6 A;  5GQO A;  5FJ8 G;  1K9M C;  4DV4 L;  2RSO A;  2RVL A;  1FVI A;  4YHH L;  5M3F B;  3L7Z C;  3D31 A;  3CHB D;  2IPK D;  4Q5V A;  5FLX L;  3GTO H;  4B3R Q;  5IOD A;  4X62 Q;  4JCV E;  2KED A;  2ZT9 C;  4A3L G;  4XXE A;  1F2Z A;  4OHJ A;  2F4V L;  2JEA I;  4KKS A;  2UXD Q;  2KCN A;  1A62 A;  1S72 A;  4N9T A;  1Y8N B;  1TWA H;  4X3K A;  3D8G A;  1G2S A;  1D5M C;  1VF5 C;  1TWF B;  2ZM6 L;  4ULL A;  5FJ8 H;  2QDB A;  2G5D A;  3FVQ A;  3TS2 A;  3T13 A;  3MFY A;  3GTQ B;  2WP8 J;  4K0K Q;  3CW2 C;  2VS1 A;  2JA5 B;  5DEH A;  2YTX A;  3PMF A;  1HR0 L;  1JIC A;  1TT2 A;  1P8L A;  4A3L H;  5LL6 X;  2IT1 A;  4X66 Q;  1BXT A;  1SYG A;  5CMD A;  1PXU A;  3GTJ H;  2FMM A;  5NUC A;  3NSW A;  4JI4 Q;  1B53 A;  3I90 A;  2XIW A;  1KAW A;  3RR5 A;  1IW7 D;  3HKS A;  4IOA A;  3N52 A;  2B2V A;  1PRT B;  1SJE D;  4JBW A;  1AFP A;  1UAP A;  3FRP B;  4KTA A;  4CHT B;  2B2Y A;  3QO2 A;  1A2T A;  3FEW X;  5KEE A;  4JYA Q;  3R3O A;  3DUZ A;  2E2J H;  1MGS A;  1LTB D;  4PZ8 A;  5JJK A;  2NVX H;  1GJX A; 
#chains in the Genus database with same CATH homology
 3KBG A;  3TDQ A;  1JWU D;  4HSV A;  2FFK B;  1Y1V B;  1JOQ A;  4XYO A;  3Q23 A;  4ZLT F;  3BVG A;  1Z47 A;  4HCE A;  2EJF C;  4QUF A;  1WVL A;  1W6K A;  2BA0 A;  2K01 A;  1JB3 A;  2F0F A;  5COR A;  5KIX A;  1DOM A;  3G6J B;  2F0P A;  4C3J B;  2EOT A;  2PNR C;  4F88 A;  1E2W A;  1UNS A;  3V96 A;  3ND8 A;  1SSO A;  3TZU A;  4EVO A;  5EGT A;  1WTO A;  4Y7N B;  3S1M B;  3I4L A;  1DOK A;  5A2Q L;  4FYD A;  1PFM A;  5F2D A;  2WV6 D;  4XQN A;  1JE4 A;  1WTP A;  4OGQ C;  2YU9 B;  5I2X A;  3U9S A;  4B9X A;  4IAL A;  5HGT A;  2SOB A;  2VNU D;  2WKD A;  5IGC A;  2XWB B;  3Q22 A;  2PZU A;  1HUN A;  2K28 A;  1WTW A;  2A73 B;  1A15 A;  3GTL B;  2BDN A;  2BE5 C;  1QJO A;  1NAP A;  2PPB C;  2R93 B;  4H13 C;  1R4Q B;  1C8C A;  2Z4H A;  3FPP A;  1I4H A;  1K8O A;  1PFN A;  3A8K E;  3NQI A;  5D3I B;  1PRT C;  1A3U A;  4ZRZ A;  1ONL A;  2K32 A;  2F0G A;  4A3I B;  3OOC A;  1Q8I A;  3TME A;  3HOX B;  2ICE C;  4CJ0 B;  2H4O A;  2FJ2 A;  4IQZ A;  2CVR A;  4KJO A;  2L4N A;  3D4W A;  4KN7 C;  2F0M A;  1SAP A;  2PCF B;  4E6I A;  3IKJ A;  2EZV A;  3GTP B;  4CGY B;  1DJR D;  2IW3 A;  1ICW A;  1LTI D;  5FLX E;  4KHZ A;  2A6H D;  1SNO A;  3URY A;  5EQ0 A;  4K5X A;  1ZYR C;  1Q1E A;  1EYD A;  2SNS A;  2RDF A;  1YNN C;  2AWN A;  1CQF A;  5C6A A;  2F0S A;  3KLR A;  3ERO A;  5CV8 A;  5LHY 1;  5EPJ A;  3EJI A;  2L11 A;  4FF2 A;  1DON A;  1BOS A;  3H91 A;  1JOR A;  3NK9 A;  3H3V C;  1U9R A;  2EVB A;  5M5X B;  3PIP 3;  5C4J B;  1IW7 C;  4O1N A;  1ENF A;  2M2L A;  4IUV A;  3SEB A;  1SNM A;  1HRJ A;  2NVY B;  3OWE B;  2F0D A;  3KK7 A;  4QIW B;  3DEP A;  1TS2 A;  1VDZ A;  5C5M A;  2GA4 B;  5C3X A;  5C4H A;  3I3C A;  1O78 A;  2MPM A;  4QUC A;  2OEO A;  5CR3 A;  1SYB A;  1MI2 A;  1L0Y B;  2E76 C;  1KNA A;  2PQE A;  4CKC A;  1K8M A;  1XXG A;  4C3I G;  1NR2 A;  5JVG 3;  1EU4 A;  2A69 C;  3SK8 A;  5JAV A;  3SVM A;  1PTO D;  3BS1 A;  1Q90 A;  2XSC A;  1L0X B;  3RLF A;  1FNV A;  1RCV D;  2K04 A;  1V43 A;  3MWY W;  2NTT A;  3A56 A;  1G8Z D;  2I07 B;  3FKI B;  1DM0 B;  2EJG C;  2J7Z A;  5A2Q E;  1AZP A;  3BDC A;  1TWH B;  4ODG A;  3VYR A;  2OT2 A;  3BG3 A;  4A3M B;  1SNP A;  1D1I A;  4IUU A;  1AW7 A;  1LV9 A;  1M8A A;  1ROD A;  4A3E B;  5JPN C;  2LS0 1;  5BN5 A;  5J22 A;  2KHS A;  3GQB A;  2RA4 A;  1Y1W B;  4PMW A;  1BNZ A;  1EY9 A;  2R6G A;  4KD4 A;  5HUR A;  5JOB A;  3KF8 A;  4G7H C;  4UAI A;  1SMY C;  5FK9 C;  3C2P A;  5EJW A;  1STY A;  2F0W A;  1O7L A;  3S1R B;  1IYV A;  5D65 A;  1PTO B;  1H9K A;  3ONA B;  4K6D A;  2LFN A;  3ITP A;  2F0L A;  3PUW A;  3UI2 A;  3KLS A;  1CA5 A;  5C0X G;  1G2T A;  1K83 B;  3QJY A;  4J6H A;  4TSS A;  3SDZ A;  3GP7 A;  4K6L A;  5FO7 B;  2MHV A;  2B63 B;  2D5D A;  1EIG A;  3TP6 A;  3PO3 B;  4CJ1 B;  1SYC A;  3AU7 A;  1EY0 A;  5C0X H;  4C2M B;  1ESF A;  1H9M A;  1PLF A;  3FDT A;  1YNJ C;  4HSP A;  4M1U B;  3NWS A;  2X6G A;  3K57 A;  4BA2 I;  3MHB A;  1SYD A;  3S1Q B;  4XIG S;  1PZJ D;  1RD9 D;  2IX0 A;  1B4O A;  1TWG B;  3GTM B;  3H6M A;  1X32 A;  1KNE A;  2F4I A;  1JQY D;  1RHP A;  3JAM L;  4RH6 A;  1HXY D;  3EA6 A;  4ZKC B;  3PV0 A;  3K59 A;  4BA1 I;  1NSN S;  5EKI A;  1R9T B;  2IL8 A;  1HQM C;  1WCM B;  1SYF A;  5C0X I;  3FPU B;  3SK6 A;  3H0G B;  4BY7 B;  3LWU A;  2K33 A;  4ABN A;  2RSN A;  4IUN A;  3Q6S A;  1PTO C;  2PYK A;  3DWP A;  3HZX A;  2EY1 A;  2D62 A;  5COY A;  5ELE A;  3SR1 A;  1R4P B;  3J81 L;  3F2U A;  3HOV B;  5EBD A;  3L3O C;  3HG9 A;  3M85 A;  2AQ3 B;  2O2L D;  2K03 A;  1V1P B;  2J4X A;  4DN4 M;  3WDN A;  1CHP D;  4AYB B;  2B39 A;  2L12 A;  2VXW A;  4JK1 C;  2R61 A;  2DY8 A;  5G3L F;  5IT9 E;  3T56 B;  1Y8P B;  2CW0 C;  3KUP A;  1AP0 A;  1HTL D;  5C3W A;  5M5W B;  1RF2 D;  2XN9 C;  4H7B A;  4R9W A;  2F0E A;  2LMC B;  2FMC A;  4IUQ A;  1FR3 A;  4RCO A;  2KEE A;  2KOL A;  4KKT A;  1QE6 A;  3M3Y B;  1STH A;  1GUO A;  3PUV A;  4FXK C;  1B44 D;  1A3V A;  5FO8 B;  1DD2 A;  2A6E D;  4G4K A;  4NMZ A;  1GUT A;  3TP8 A;  3X3N A;  1PZK D;  4EQP A;  1SEB D;  1WTV A;  4WRD A;  3T53 B;  5E4W C;  3N6R A;  1BF4 A;  4KD3 A;  5DM6 3;  1OXX K;  4K8I A;  4KY5 A;  4EQN A;  4IFD J;  4KV6 A;  3RZD B;  1IKL A;  4ZAI A;  4RAU C;  2DY7 A;  2K7V A;  2KJX A;  4QMG A;  3HRZ C;  4HCS A;  1I4P A;  1RTO A;  1OXV A;  2DNE A;  4A3D B;  1ESR A;  3MTS A;  3TN2 A;  3M4Y A;  2B2U C;  1C4Q A;  4B08 A;  4A93 B;  1CA6 A;  1BCP D;  1CQV A;  3QIA A;  1QG7 A;  1G29 1;  2MP1 A;  1H9S B;  4RGO S;  3KLS X;  3VR6 A;  5C3E B;  1PYW D;  1II3 A;  3JAM E;  1SNQ A;  3VYT A;  3HKZ B;  4BWG B;  1PTO F;  2WAC A;  2K5W A;  3BZD B;  2IJ0 A;  1EY8 A;  3CU7 A;  3J7A V;  1CK1 A;  2HUG A;  3S2D B;  4A3G B;  2PZT A;  1IL8 A;  1LAB A;  1EIH A;  2D9U A;  1JC7 A;  3IAY A;  5ELF A;  2Q8I B;  1WTR A;  2Z4I A;  3M7N A;  3DWQ A;  4EGV A;  1BBX C;  1GHJ A;  1EOT A;  4LJZ C;  2B2T C;  4XDX A;  4DAP A;  1FNW A;  2RDH A;  4KK7 A;  2M00 A;  2VB3 X;  3A7A B;  3R2I A;  1LAC A;  2L55 A;  1STB A;  3VR4 A;  1BCP B;  5CYU A;  4G7O C;  1SYE A;  3HOZ B;  4HAE A;  3RZO B;  2A68 D;  3I72 A;  4HTH A;  1E2V A;  3R93 A;  1H9J A;  1BQQ T;  5C4X B;  4NW2 A;  3HOW B;  3NTK A;  2IWH A;  5IGG A;  2A6E C;  3DEO A;  4A3B B;  1I50 B;  3VR5 A;  3QOL A;  4KN4 C;  2HCC A;  1GHK A;  1M4V A;  4PQX A;  3T51 B;  3CQZ B;  2PMZ B;  4OIJ A;  1STE A;  5JPM C;  4X3U A;  2F0J A;  4K5W A;  4O42 A;  1NUC A;  1Z6H A;  1KDC A;  1HA5 A;  1GUS A;  3D6W A;  1F2Y A;  4XT1 B;  2PO4 A;  2PW5 A;  4FF1 A;  5C44 B;  2NVT B;  2KVM A;  1X3P A;  1KDB A;  4QB4 A;  3MXU A;  1SDF A;  4FO2 A;  4L6T B;  3IL8 A;  3K5O A;  1A2U A;  5I9O A;  2XRQ D;  3K5M A;  3EFX D;  4RKL A;  3Q24 A;  4DF7 A;  4ZYS A;  3P20 A;  3U9O A;  5EPK A;  1SJH D;  4L8J A;  5IGE A;  4CBV A;  1B9M A;  2KUM A;  3OIQ A;  1DZ1 A;  2G9D A;  4I7Z C;  1STA A;  5E3F A;  3GTO B;  5CV6 A;  2NUC A;  5JEA J;  3RUZ A;  1Y69 U;  1TWA B;  3E0J A;  4H0L C;  4XYQ A;  2Z8L A;  2EYJ A;  3NTI A;  2JXM B;  4ME5 A;  3S15 B;  2TMP A;  4QF4 A;  5E1F A;  3TP5 A;  1ZXT A;  1SBB B;  2F0Q A;  1Q12 A;  3P75 A;  1FYC A;  3MFG A;  2F3W A;  4NP5 A;  1EYA A;  1GUW A;  4H44 C;  2X69 A;  2ENB A;  1QB5 D;  5ELB A;  4WFN 3;  2LY7 A;  3NUC A;  3C3L A;  4CJ2 C;  1QOH A;  2N88 A;  3C1F A;  2QIL A;  2NVX B;  1B3A A;  1EQT A;  3NE5 B;  2NZ1 D;  4KJN A;  3PIO 3;  1DOL A;  1EYC A;  2O5J C;  3W2D A;  1JR0 D;  2ID0 A;  3TBI B;  1GUG A;  2A68 C;  4FNF A;  4TRD A;  2JEB I;  1WD0 A;  3X3M A;  1ET6 A;  3GO5 A;  2E75 C;  1JWS D;  1PRT F;  1HQR D;  3OW7 A;  1IKM A;  1CHQ D;  3TZD A;  3BDL A;  3S1N B;  3V2T A;  1F9S A;  5FOB B;  2K5Q A;  1EZ6 A;  1BO0 A;  3CKI B;  1S5F D;  2HDL A;  1DXM A;  2F1M A;  2JSO A;  5DAU A;  1QNU A;  2NB0 A;  2ZXO A;  1HUM A;  1A3T A;  2B2V C;  2KCC A;  1EL0 A;  2L0C A;  5EBC A;  1C48 A;  1TS4 A;  1UEA B;  1KTK A;  3I70 A;  4HN7 A;  3EQL C;  5ELD A;  5BN4 A;  1WD1 A;  5K5P A;  5IGF A;  1I4G A;  2BA1 A;  1EU3 A;  4R8I A;  5I9P A;  1HFN A;  1WTQ A;  2BOS A;  4RGT A;  3K6O A;  5CV9 A;  1E2Z A;  1U4P A;  1SXT A;  3BYT B;  2A6H C;  3M7G A;  5K36 G;  4N9P A;  4C1N I;  1VF7 A;  1BUV T;  4RA8 A;  2KEC A;  4K5V A;  4FVM A;  2Q8T A;  4FXD A;  3HS0 C;  1HHV A;  2CQA A;  2R3Z A;  3HP3 A;  2EY5 A;  4C3H B;  3VA7 A;  4A3F B;  2TSS A;  3A55 A;  1CZW A;  3K5L A;  1FNU A;  1LLR D;  2F3V A;  2F0H A;  5K36 H;  2FHT A;  2E2H B;  1AN8 A;  2A5H A;  4U67 3;  2R7Z B;  4DNR B;  2FIN B;  2NWG A;  3E6Z X;  3WOF A;  3BVM A;  2WII B;  1S4Z A;  3L9A X;  4P2C B;  4C3J G;  5M3M B;  4HMI A;  3FMC A;  5ELC A;  3MXG A;  3CRK C;  1S5B D;  4TKO B;  1CI3 M;  1QWY A;  1TWC B;  5I2Y A;  4XTC S;  1LT3 D;  1E0B A;  1HCZ A;  2C9O A;  2YYZ A;  1STN A;  3T4A C;  1MBY A;  2EYM A;  4RGN A;  3MVV A;  3NP8 A;  1CFM A;  2CHB D;  4KI0 A;  1U4R A;  4L63 B;  4V19 0;  2DN8 A;  3MA2 B;  3QWN A;  1S5E D;  2AUJ D;  2F0I A;  3SXH A;  2AUK A;  3K7A B;  5I6Y A;  1DYQ A;  1Q1B A;  4ILW A;  1GOZ A;  3P1H A;  5C4Z A;  1KAA A;  3NHH A;  3I4M B;  5I6W A;  1EZ8 A;  4FXG C;  1PZI D;  1LTT D;  3VA5 A;  4J8Q A;  3NBH A;  1RDP D;  4K2L A;  1EWC A;  3S14 B;  3EVQ A;  1TR5 A;  3GD7 A;  1RJT A;  3J7A F;  2F0K A;  1ZKO A;  1XWE A;  3K0Y A;  4YIJ A;  2RQX A;  1PMR A;  3M4O B;  5M9O A;  2EDG A;  1B1Z A;  4GZY C;  1TU2 B;  3OPO A;  1ET9 A;  1T5X D;  2O5I C;  1O80 A;  1XX8 A;  3A8J E;  2OF1 A;  1D5X C;  1ILP A;  2K1B A;  1QCB D;  4DXG A;  1D5Z C;  2RDG A;  2Z1C A;  5IOC A;  2F0U A;  1LTA D;  3MAQ A;  4LAA A;  4MHE A;  2L5T A;  4RGM A;  5FO9 B;  3GV3 A;  1LT5 D;  4A3J B;  4C3I B;  3KBX A;  1SE2 A;  4PMB A;  3J7Y W;  2F03 A;  5M5Y B;  2BE5 D;  4BY1 B;  2A74 C;  2NYZ D;  3TSS A;  1I4R A;  3A8I E;  1KLG D;  2XRS D;  4XQQ A;  2XVS A;  1VCI A;  1F9P A;  3QB3 A;  1X3Q A;  3D4D A;  2D2C C;  1IHZ A;  1I4Q A;  2C5C A;  3BYY B;  2F0V A;  1F2L A;  5CBE E;  1TII D;  1LO5 D;  3I73 A;  2EE1 A;  4IN3 A;  1NCV A;  2JA8 B;  4F87 A;  4UDU C;  4HED A;  3HGB A;  1XTC D;  4DU9 A;  4ID6 A;  3ERQ A;  3I4N B;  4R8N A;  1KDA A;  1ZYR D;  3K58 A;  3PUX A;  1YNN D;  1LTG D;  4DAY A;  2EY2 A;  2JA6 B;  1OO9 B;  5IGB A;  4BBS B;  1D6E C;  1F9Q A;  4CKB A;  2K6A A;  3S17 B;  2LKV A;  2HDM A;  3W3A A;  1DCZ A;  4DXF A;  1KLU D;  2VUM B;  1I4X A;  2WB1 B;  1HPC A;  5DM7 3;  5CV4 A;  5JVH 3;  5D14 A;  3PUY A;  3RD4 A;  1I3Q B;  3H94 A;  3CRL C;  4V0B A;  4IUP A;  4RWS C;  3BVZ A;  2QEJ C;  4NKL A;  5JJZ A;  4TQU S;  4G57 A;  4DNT B;  3NXW A;  3VYS A;  3DWA A;  1U4L A;  3J81 E;  3BDO A;  1B2T A;  1Q3L A;  2K5D A;  5EPL A;  2JYO A;  4K2K A;  1U4M A;  1F2M A;  4OO1 G;  2PW7 A;  2A69 D;  4DGZ A;  1EEF D;  2F0O A;  2E2D C;  1I6V C;  4C1N K;  2VB2 X;  1EY6 A;  1AZQ A;  4OO1 H;  4X3S A;  1TS3 A;  3Q0A A;  3MC0 B;  1PTO H;  1JWM D;  4C3H G;  1LTS D;  3PO2 B;  2F0N A;  1SNC A;  1HFG A;  5KRU A;  4IUR A;  1PFB A;  1OXS C;  3LWE A;  3OIP A;  4BS9 A;  3I91 A;  2R92 B;  2EPB A;  3DHQ A;  4IZ8 A;  4RKB A;  1J9O A;  2XWJ B;  4KY7 A;  4F8M A;  1EY7 A;  4C56 C;  2Q8R E;  2AWO A;  5DNF A;  5A35 A;  1I6H B;  1F77 A;  3OSO A;  4EQO A;  5E4X A;  5G3L D;  3C1E A;  5KYI A;  4PNY A;  2IX3 A;  5C0X J;  3NBI A;  2NVQ B;  1MD2 D;  1QNK A;  1SMY D;  4G7Z C;  1ENC A;  4OO1 I;  1EFI D;  5J1Z A;  2I46 A;  1OXT A;  4OIK A;  3D6C A;  2EYO A;  5CC4 A;  4PV1 C;  1FGB D;  3NWT A;  2EYF A;  1EY4 A;  2EYH A;  3R2T A;  4IFD G;  3LX0 A;  4ZUJ A;  1MSH A;  5CV5 A;  1XYI A;  1PDQ A;  2B2W C;  4ZKB B;  1D1K A;  3C46 A;  3SK5 A;  3VYU A;  1BCP C;  2NN6 G;  3ND9 A;  2E74 C;  3MXN A;  4IFD H;  2EYP A;  3GTG B;  3GV6 A;  3NPP A;  5D3D A;  5TSS A;  1YNJ D;  2NN6 H;  2EXZ A;  5EKK A;  1MSG A;  5I4D A;  3LNN A;  4RFB A;  1F9R A;  3HOU B;  3VR2 A;  1W6J A;  3OHX C;  2MUY A;  5CGK A;  1S5D D;  2K05 A;  1EQV A;  3GTJ B;  3SHL A;  5C5L A;  1ILQ A;  4IFD I;  1Y8O B;  2RKS A;  1D2B A;  1JOO A;  5BN3 A;  3NQT A;  1BDO A;  4ZUI A;  1TS5 A;  2V4D A;  2E2J B;  3IFT A;  2NN6 I;  1S5C D;  3SK4 A;  1SFO B;  2HQE A;  2KQ3 A;  2EY6 A;  1G6Z A;  3AMU A;  2JA7 B;  2EYL A;  3D3R A;  2QF7 A;  3K5N A;  2IX1 A;  4X3T A;  1O7Z A;  1V1P A;  2SNM A;  1BR9 A;  1CZG A;  3A54 A;  4RCN A;  4K8J A;  4I65 A;  2B2U A;  1KAB A;  5IT9 L;  2JE6 I;  2J0T D;  4HR7 B;  2XNA C;  4S3S A;  4J1M A;  2B2Y C;  1LTR D;  3DM1 A;  4ZQ3 A;  4OL7 A;  2N55 A;  3G7L A;  2BDO A;  5KND A;  3J80 L;  4XT3 B;  2CW0 D;  3QOJ A;  1EWH A;  1VMC A;  4FF3 A;  2WIN B;  4LMQ D;  1TY2 A;  3OMC A;  2SEB D;  4KMU C;  4FF4 A;  3IFD A;  3T16 A;  4F7X A;  1SE4 A;  1V8Q A;  2L1B A;  2NBF A;  1GUN A;  4MN3 A;  1CM9 A;  1RKN A;  4M8A A;  3AB9 A;  4KY6 A;  1EEI D;  5KNB A;  1JOK A;  4PMC A;  1Z7T A;  4K14 A;  2QKI C;  1TKW B;  1FD7 D;  2NTS A;  1BCP F;  1IYU A;  2WAQ B;  3VR3 A;  4BBR B;  4NDX A;  2B8F A;  5T1I A;  3H09 A;  4KKU A;  4U68 A;  3ZYY X;  4MIU A;  3MEH A;  2B2T A;  2MJ8 A;  2X6L A;  1A6X A;  2F0T A;  1AEX A;  5KNC A;  1LT6 D;  2WKC A;  1SND A;  4ZK9 B;  2ZXR A;  5KGU A;  4DA2 A;  4DAV A;  2E2I B;  1RTN A;  5J39 A;  3I8Z A;  2AQ1 B;  4WJW A;  2O4X A;  1H9R A;  3MXP A;  2MGS A;  3DMU A;  5KYL A;  1B50 A;  4FP5 D;  4WOR A;  1CTM A;  5AFW A;  1H9S A;  5T1G A;  1B9N A;  1TVX A;  1JCK B;  3MZ5 A;  5CBA E;  5FKA C;  5IIF A;  5LL6 S;  2KA7 A;  5JEA G;  1GXD C;  4QCL A;  2RBM A;  3V05 A;  3S9W A;  3NTH A;  2SDF A;  2AQ2 B;  2QCP X;  2L9H A;  1TY0 A;  1TQO A;  2PZW A;  4RHR A;  1NR4 A;  3A7L A;  3TP7 A;  5IGD A;  5JEA H;  1SE3 A;  1QIL A;  1CT1 D;  4DK0 A;  1HTP A;  4B9W A;  1ENA A;  4HMJ A;  4Q0F A;  4IUT A;  4RHS A;  2H1E A;  2ICI A;  2DNC A;  2JP1 A;  1OXU A;  3D4R A;  4CKE A;  2EJM A;  2B2W A;  1O7Y A;  3QG1 A;  3O13 A;  1EY5 A;  1UUP A;  3PUZ A;  4XQJ A;  1T5E A;  3J80 E;  1LT4 D;  2BCO A;  3P7J A;  3S2H B;  1J8I A;  4Z9C B;  2HCI A;  1ZEQ X;  4KHV A;  3GTK B;  4LK1 C;  3OMG A;  3S16 B;  1G91 A;  3RMH A;  2G9H D;  1WTX A;  2OXP A;  2ZXP A;  5ISR A;  3OWF A;  4DK1 A;  5EKL A;  1ML0 D;  3HEJ A;  1PRT D;  1V1O A;  1STG A;  4A3K B;  2M9V A;  3SE0 A;  5CV7 A;  2Y0S B;  3WOE A;  4DFA A;  3HOY B;  2B8G A;  3E5S A;  3DXJ C;  3R8B A;  1VMP A;  1HA6 A;  2RSO A;  2RVL A;  5M3F B;  3L7Z C;  3D31 A;  3CHB D;  2IPK D;  4Q5V A;  5FLX L;  5IOD A;  2KED A;  2ZT9 C;  4XXE A;  1F2Z A;  4OHJ A;  2JEA I;  4KKS A;  2KCN A;  4N9T A;  1Y8N B;  4X3K A;  3D8G A;  1G2S A;  1D5M C;  1VF5 C;  1TWF B;  4ULL A;  2QDB A;  3FVQ A;  3T13 A;  3MFY A;  3GTQ B;  2WP8 J;  2JA5 B;  5DEH A;  3PMF A;  1JIC A;  1TT2 A;  5LL6 X;  2IT1 A;  1BXT A;  1SYG A;  5CMD A;  1PXU A;  2FMM A;  5NUC A;  3NSW A;  1B53 A;  3I90 A;  2XIW A;  1IW7 D;  3N52 A;  2B2V A;  1PRT B;  1SJE D;  4JBW A;  1AFP A;  1UAP A;  3FRP B;  4KTA A;  4CHT B;  2B2Y A;  3QO2 A;  1A2T A;  3FEW X;  5KEE A;  3R3O A;  3DUZ A;  1MGS A;  1LTB D;  1GJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...