2PI2E

Full-length replication protein a subunits rpa14 and rpa32
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication, dna binding protein
total genus 27
structure length 117
sequence length 117
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pi2E00
2JA6G 5GAGC 4OONA 1CSQA 1G291 2R7DA 2YTVA 1N32Q 3S2DH 1C0AA 3G71A 2OQKA 4JI3L 2R92H 2EIFA 2B29A 4JYAQ 4IPHA 2D0OA 4GNXB 2IHFA 4DV5Q 2N3SA 4PZ8A 4YWMA 3GTQH 2XTIA 1KAWA 1KC8C 3FKIH 3KJOA 4LFCL 3U50C 1CKNA 4P72A 5FJ8G 5LMUQ 2F4VL 5JJLA 1HR0L 4EQ5A 3G48A 4JI6L 2KBNA 4OWTB 4DR2L 4DUZL 2RCNA 5IYCG 5H1SE 3D31A 4X66Q 4A3CH 4A4IA 3OTOL 3HOXG 3HKZG 4QGUA 1EQQA 2UXCQ 5C4XG 4KHPQ 2IX0A 1X3FA 3KLWA 1OXTA 3J80i 4A93G 2R93H 4DV2L 1NBWA 3I2ZA 2VUMG 3GTKH 4AYBG 1UE1A 3HKZE 1PA6A 2QEXA 4LFAQ 3EBEA 1HZBA 1YVCA 3S24A 1VQMA 4JI4Q 3GTJH 4LF9L 3BZKA 3J7A5 4A3FH 1X3GA 3CAMA 1JMCA 1N9WA 1EUJA 2JA7G 1VQDA 4OX9Q 3AYHB 2B63H 1K0RA 5M5XH 3CD6A 3BJUA 1YHQA 1XPRA 1YHBA 2K14A 1IBMQ 1A63A 2R6GA 4YCWA 5IWAL 4XIGS 4JI4L 1PFSA 3RZDH 4DV6L 1B70B 2NZOA 2VQEL 2IY5B 5JEAG 4OX9L 3CC7A 1X65A 4GNXC 4LW1A 1K8AC 3UDGA 1E24A 2HQLA 3PO3G 1PH5A 1VQKA 2JA8H 1W2BA 4DK3C 4JCVE 2UXDL 5M5YH 1JJGA 4DR5Q 2LSSA 4LF5Q 3ULLA 5GAHC 3CCQA 3ULJA 1HZ9A 3AFQA 2WP8J 2N49A 2WB1G 3S14H 3UDFA 2VS1A 4IFDI 2LXJA 4GOPB 4GNXA 4QY7A 4TQUS 4UP7A 2CKZB 2LXKA 4QL5A 2I5HA 4A3IH 3A74A 3TRZA 4DV4L 1I94L 1WOCA 1T9HA 1W3SA 1OXXK 2XGTA 4R4TA 4LFBQ 1V1QA 3PSIA 4YY3L 4UY8C 4B3ML 5AJ3L 4BY1G 3KFUA 4R4OA 1A62A 5M5WH 5C0XJ 1IBLL 4NXNQ 4JBKA 5HY6A 1XNQQ 1KQSA 2AMCB 1YJNA 1MIUA 1P8LA 3F2CA 1D7QA 1VQOA 5IP9H 1VQAA 3PIOA 3PO2G 1OTCA 1VQJA 2ES2A 3F2DA 4YWKA 2BA1A 3S16H 4DV0Q 1A0IA 4JI7L 3UE0A 4L5QA 1TXYA 3TQYA 1PH8A 4NPSA 3M7NA 1I6HH 1G51A 3RLNA 2KENA 1EOVA 2VNUD 4HIOA 3K80C 4BY7G 1HNWQ 2OTJA 3L2PA 2YV5A 1N33L 3CF5A 1GVPA 1NTGA 3M4QA 1KHIA 2EXDA 4QJFA 2IHEA 2UUBL 4DR6L 1WFQA 2JA5H 1CSPA 4XTCS 4AH6A 5IYBH 1VQGA 3CPFA 3H15A 4A3BG 1R9TH 1QZHA 1NE3A 4DR4Q 2WAQG 1OXVA 4NB3A 2VQFQ 3CXCA 4HIMA 5IP7G 3HKSA 1Y1VG 4GOPC 2ID0A 1VQ4A 2NVXH 1N34Q 3GTPH 1X56A 2E5LL 1HZAA 3HOZG 4GS3A 2HHHL 3OW2A 2ZTCA 1Q8KA 3VDYA 2A1AA 2JK8A 3KDFB 4KI0A 4DR3Q 2WAQE 4GN3B 4LF4Q 1XPUA 5DLQE 4A75A 1YJ9A 1J6QA 2K5HA 4WJ3M 4GOPA 1IZ6A 3A5UA 1VCIA 3H0GG 3ULPA 3CC4A 4OO1G 1JJCB 5BR8Q 1XTDA 2DUDA 2BA0A 1PVOA 3CCUA 4GLVB 1E7ZA 5GROA 1WCMH 1TWHH 4UPAA 3S1RH 3CQZH 4POGA 3AFPA 3T1HL 1FJGL 2PNHA 4QIWE 4DUYL 3I4NH 2YTYA 1S40A 4IPDA 3CCLA 3DM3A 2ZM6L 3CCSA 3I55A 2AWOA 2KHJA 3HOWH 4JI3Q 3H0GH 5C3EH 5M3MH 2E2HH 3S15H 1XPOA 4ME3A 4JBWA 4JOIC 4YCUA 1EIYB 2UUAL 4B3TQ 5GADC 4LFCQ 2YTXA 2F4VQ 1YJWA 4A3DG 2I5LX 4P73A 5FLMG 5C44G 1HR0Q 4JI6Q 4H02A 2MFIA 2HIVA 4APVA 3PV0A 3I7FA 1IYJB 3NBHB 4DUZQ 4DR2Q 4JI8L 4PZ7A 2IX1A 3M4PA 2MQHA 1E3PA 4DNIA 2Q2HA 2JA6H 4B3TL 1FGUA 5JJKA 2NVYH 3OTOQ 4IJHA 2Z6KC 1IBKL 3HFZB 4JOIA 4UP8A 2CWPA 3H3VI 3MXNB 5IY0A 1UE7A 1KIXA 2CCZA 1QZGA 1G6PA 5HGQA 3GTLH 1E1OA 4DV2Q 3HOVG 3PCOB 1XNRL 4PZ6A 1U5KA 3NELA 3ER0A 4YHHL 1FVIA 2AKWB 2F52A 4BBSG 2VW9A 1GKHA 5FJ8H 2I5MX 4OWXB 1JB7A 2Z6KA 4DV1L 1YHAA 4R4QA 4LF9Q 3GTMH 4JBMA 4R4CA 1K83H 1TWCH 2ZTEA 4Y52H 1I50H 5IYCH 4LUVA 4GN5A 3KF6B 2F3IA 3TS0A 1XMQL 1O7IA 3TEHB 3ZJYC 3HOXH 1Q1BA 1UWVA 4LUOA 5C4XH 4HIDA 1QVCA 5IWAQ 2VY3A 2BH2A 3KDFA 3JAMi 1K73C 3U4ZA 4A93H 2ZTDA 1I5FA 4DV6Q 1BBUA 5C0XG 4HJ5A 1SLJA 3TS2A 4KHZA 2VQEQ 1YBYA 2K5VA 2MNAA 1YIJA 4BBRG 1SN8A 3KJPA 1J5EQ 1VQEA 2VUMH 4AYBE 1D8LA 4A3KG 1IL2A 4DR1L 3M3YH 2UXDQ 3D0FA 1LYLA 3JAMc 2E2IH 1PH7A 2B3GA 2MO0A 1J5EL 4JV5L 2KCMA 1PV4A 2JA7H 2OTLA 1EQRA 4AIMA 2AWNA 3GDEA 3RLOA 1U0LA 1JJ2A 1HNXL 2ASBA 1X55A 3CCEA 1SROA 2H5XA 4NXML 2UXBL 2K50A 3RR5A 4A3JG 4R1JA 3B6YA 4DV4Q 1I94Q 4A3MG 2K52A 2GVBA 1TWFH 4YY3Q 3H3VH 4B3MQ 5AJ3Q 3PO3H 1IBLQ 4X62L 3Q8DA 1Q1EA 1Z9FA 1H95A 4AQYL 1Q46A 3K7AH 2NN6G 4HIKA 4A3GG 2E2JH 1C9OA 3AEVA 2R7ZG 2DGYA 3UDIA 2WB1E 3J81c 4HJ9A 4JI0L 1B8AA 4L5SA 4JI7Q 2GVAA 3A5ZB 2R7FA 3E9IA 1FL0A 4JI2L 1GO3E 2E8GA 3OYYA 4DV3Q 1MJEA 4A3LG 1QUQA 5LMNL 2D62A 3W1BA 4DK6C 2R7ZH 1N33Q 4DR7L 4OO1I 4DR6Q 1Y14B 1VQ9A 2UUBQ 4BY1H 3LGJA 3I56A 3RLFA 1HR0W 3KF6A 4DV3L 1HNZL 1B7YB 1VQCA 1L2FA 5ELNA 3IRBA 1VQFA 1VQLA 3T1YL 3PO2H 3TREA 3S1QH 3FP9A 4L5TA 2Q2IA 3ICEA 4PG3A 2PI2E 4BY7H 3K0XA 1SMXA 1OXSC 2E5LQ 1JE5A 1XMOL 2RHSB 2HHHQ 1S3OA 4DAMA 5C4JH 1X9NA 2VZAA 1K9MC 1NMGA 3GTGH 2A8VA 3WWVA 1PH9A 4P74A 2EQSA 3HOYG 2C35B 1PH1A 4GLXA 3RN5A 4LF7L 3HOUG 1KRTA 2OQ0A 1VQHA 1XJVA 3K8AA 5IYDG 4JG2A 2BH8A 2K4KA 4A3BH 2JQOA 4EX5A 4B3RL 1FJGQ 1Q12A 3T1HQ 4DUYQ 1KD1C 2HIXA 5IP7H 1Y1VH 1RL2A 2ZM6Q 3M85A 3STBD 2KCTA 2NVQH 3HOZH 1TWAH 1VQBA 3CCJA 4IJLA 3BZCA 3KOJA 4JI1L 2UUAQ 1VQ8A 4A3EG 1N8RC 1HH2P 2JJQA 1RIPA 5IE8A 1Y1WG 3NENA 1PH3A 2AHOB 1K8GA 4GKKL 2Y0SG 1VQIA 2UU9L 5M3FG 3MEFA 4JI8Q 2OCEA 5FLXc 5C0XI 4IO9A 1MJCA 2A19A 3STBC 1IBKQ 2CFMA 4C3HH 2WFWA 4O2DA 2UUCL 3CC2A 2Y0SE 3PUZA 3CMEA 1WYDA 1X3EA 1XNRQ 2QGQA 4TVAB 1L1OC 2PI2A 3S1MH 3JC66 4YHHQ 1Q81C 1S72A 1Q7YC 2HT1A 1A8VA 3U4VA 1VQ5A 4DV1Q 4A3DH 1YEZA 1LM0A 5FLMH 5C44H 4DV7L 2R92G 3RZOH 4C3JH 3S1NH 1KRSA 1BBWA 1KL9A 4R4IA 1L0WA 1QVGA 1MKHA 1V43A 2IT1A 1QUQB 1XMQQ 1L1OA 3FKIG 4IFDJ 4P75A 1N36L 2N78A 2V1CC 4WJ4A 1SE8A 4B3SL 2OWOA 1YNXA 3HOVH 2PMZE 4FDBA 2N8NA 2NN6I 3UE1A 4A3CG 4MZ9A 3J81j 1PH2A 3GD7A 1N32L 4BBSH 4LUZA 1E1TA 3PUYA 4DR1Q 3K81C 3GTOH 1VS0A 2KHIA 1I3QH 3EN2A 4QQBX 2R93G 4JYAL 3GO5A 4IPCA 1CUKA 4C2MH 3CCRA 4JV5Q 4DV5L 2Q2UA 2JE6I 3NEMA 3CW2C 4LF8Q 1UE5A 1M90C 1ASYA 4L5RC 1E22A 1AE2A 1TWGH 2ZJPA 3FHWA 5LMUL 1HNXQ 4GKJQ 3KYHC 2UXBQ 4NXMQ 1WJJA 3A0JA 3E0EA 2PQAA 4YCVA 4A3FG 1VQNA 2I0QA 5IT9c 2B63G 4BBRH 4LF8L 4LNQA 3EIVA 4X66L 1GD7A 4DAYB 4BA2I 2MO1A 4IPGA 1QVFA 2UXCL 4HJ8A 4HJ7A 1HZCA 3PUWA 4KLKA 4X62Q 4A3KH 4KHPL 4UP9A 3U58A 4AQYQ 3L7ZC 3J80c 2JA9A 3J81i 1OXUA 2CWAA 2L15A 1SR3A 3E9HA 1UEBA 4GN4B 4OXPA 4POFA 4JI0Q 1UE6A 4LWCA 2ZJRA 4LFAL 2JA8G 4IOCA 5J3BA 4JI2Q 3W1GA 4P71A 3J7ZC 4A3JH 2YU9H 5LMNQ 3CPWA 4A3MH 2K5NA 1KXLA 4DR7Q 1BVSA 1IBML 2Z0SA 1PH6A 1Q82C 4YWLA 4A3IG 1HNZQ 4X65Q 2GN5A 4A3GH 3PUXA 4X6AH 3T1YQ 3DLLA 2D0PA 1VQ7A 1EWIA 4OWWB 1WI5A 4BA1I 2VL6A 3CP0A 3S17H 1VQPA 4DR5L 5EAYA 3PGZA 4X65L 4LF5L 3SGIA 4LF6Q 4A3LH 1YZ6A 1Z47A 1LTLA 5IP9G 1XMOQ 4DPGA 4J15A 2NVTH 1V9PA 4RG1A 1SRUA 3F2BA 4LF7Q 3ERSX 2CQOA 4LF6L 1YI2A 1PHJA 3CCVA 1BKBA 4LFBL 4Y7NH 1L1OB 1VQ6A 4A76A 2JEAI 1EIFA 1M1KC 4B3RQ 2JA5G 4ALPA 3I4MG 4NXNL 2Q2TA 3PUVA 1AE3A 3BU2A 5JEAJ 5IYBG 3K7UC 1NY4A 3UDXA 1XNQL 3G6EA 4K0KQ 1X6OA 2YYZA 5GAEC 3F1ZA 1ASZA 1NJIC 1CKNB 4PMWA 2QA4A 4DV0L 1PYSB 1EYGA 3S2HH 3PF5A 4JC0A 4C3IH 4JI1Q 3I4MH 3HOUH 3HOYH 4BXXH 4IOAA 4K0KL 5K36G 3PIPA 1EFWA 1HNWL 1P16A 4IFDG 1NMFA 1LUZA 5IYDH 3AQQA 4GKKQ 1JT8A 5GQOA 3L0OA 4X64Q 2UU9Q 4HJAA 2ZJQA 4GKJL 1AH9A 1PYBA 4GLAC 2PQAB 3CMAA 1CKOA 4MNOA 3M4OH 5JJIA 1IXRA 2UUCQ 3I4OA 4X64L 1PH4A 2FXQA 4RMFA 2RHQB 1WCMG 2RF4A 4DR4L 4BXXG 2VQFL 3I4NG 4A3EH 4DKAC 3G4SA 1N34L 4JBJA 1Y1WH 3HOWG 1HJPA 4DV7Q 2JEBI 5E7NA 5C3EG 5M3MG 3RN2A 3RNUA 1Q86C 3F8TA 5M3FH 4JI5Q 1CKMA 4LF4L 4DR3L 4O0AA 3CCMA 3PF4A 1DGSA 4MTNA 1N36Q 1K3RA 1X54A 2ALYB 2NZHA 5LMNW 2K75A 1C7YA 2ATWA 3W5OA 5ELOA 3M9BA 5BR8L 1GM5A 4B3SQ 4JI5L 3KF8B 1SFOH 1YITA
chains in the Genus database with same CATH superfamily
5KNCA 4OONA 2QDBA 1G291 2YTVA 4WFN3 1QE6A 1CQVA 3S2DH 2OQKA 1UEAB 2R92H 2L5TA 5DM73 4J6HA 4FXKC 4GNXB 4DV5Q 1IW7C 2N3SA 3LX0A 1MBYA 4YWMA 3GTQH 2L0CA 3A54A 1TS2A 1KC8C 5FKAC 3KJOA 3U50C 1EY8A 2F4VL 1CM9A 5JJLA 1HR0L 1GUTA 2R93B 3TZDA 5H1SE 2O5IC 4KHPQ 4A93G 5K5PA 2L9HA 1W6KA 3J81E 5M5XB 1UE1A 2X6GA 1YVCA 4RFBA 3J7A5 1O7LA 5EKIA 1GOZA 3CD6A 1TVXA 2OF1A 3N52A 2EJGC 4XIGS 2CH4A 1B70B 2IY5B 2VQEL 5CV5A 3CC7A 3S14B 1X65A 4GNXC 1K8AC 3UDGA 5C4HA 1E24A 2JA8H 1W2BA 1JJGA 2UXDL 2IJ0A 5LHY1 2LSSA 3HRZC 2NBFA 5GAHC 1IL8A 5A2QL 2N49A 2WB1G 3UDFA 3I72A 2I5HA 4A3IH 3HG9A 1W3SA 1OXXK 1KDCA 1HXYD 4OHJA 4UY8C 2N55A 3T53B 5AJ3L 3KFUA 1VF5C 2PCFB 4R4OA 5M5WH 4ME5A 4CJ2C 1KQSA 2AMCB 1Y8OB 1VQAA 4ULLA 2ES2A 1VQJA 3F2DA 1W6JA 4CJ0B 4KKSA 1PH8A 3M7NA 3IAYA 1EOVA 2VNUD 3D8GA 3K80C 4BY7G 3VYUA 5CV7A 2YV5A 1N33L 2D2CC 3MHBA 4GKJQ 1KHIA 1TR5A 4OELB 1TS3A 4IALA 2Z9HA 5IYBH 2CHBD 1NR2A 3OIPA 3CXCA 4HIMA 3C1FA 2B2TC 1Y1VG 3E3XA 4IZ8A 1KNAA 3FDTA 1SNMA 2E5LL 1Q8KA 2EY1A 3VDYA 4KMUC 1WCMB 4HCEA 4LF4Q 1EU4A 3I4NB 4LJZC 3ULPA 3H0GG 3HOWB 5BR8Q 5C3EB 1XTDA 3S15B 1TWHH 3CQZH 4POGA 3AFPA 3HGBA 3T1HL 2A6EC 1XTCD 1PTOD 4H44C 2KHJA 5M3MH 3X3NA 4YCUA 1EU3A 4B3TQ 2G9HD 1TKWB 4LFCQ 1YJWA 4A3DG 4P73A 2PO4A 2MFIA 2HIVA 4LK1C 4APVA 3MXUA 2IX1A 1E3PA 2Q2HA 5IT9E 2A74C 2NVYH 1IBKL 3L9AX 4UP8A 5G3LF 3H3VI 2EYMA 1SNQA 2CCZA 1QZGA 4X3UA 1TWCB 1BBXC 1HQMC 1PRTD 3MFYA 3PCOB 4XYQA 4YHHL 4G4KA 4UAIA 1EY6A 5IGGA 4OWXB 2IL8A 4R4QA 3PIP3 1AZPA 4A93B 1TS5A 4R4CA 1I50H 4LUVA 3MVVA 2L55A 3TEHB 3HOXH 3BS1A 2BH2A 4LUOA 3M3YB 5CV8A 5IWAQ 1V1PB 3KDFA 3U4ZA 2V4DA 4DV6Q 1BBUA 4HJ5A 1F9PA 4KHZA 4V0BA 3QOJA 4AYBE 5J22A 3V2TA 3VR6A 2CVRA 1PH7A 2MGSA 1J5EL 2KCMA 5EQ0A 2AWNA 1HNXL 1X55A 3KK7A 4NMZA 2H5XA 4YIJA 2K50A 1JOKA 1B9MA 4BWGB 2SDFA 4R1JA 2WV6D 1E2VA 3B6YA 2E2JB 5JEAH 2WB1B 1SNCA 1TWFH 3H3VH 4B3MQ 3PO3H 1Z9FA 1RODA 1O7YA 1KTKA 3S9WA 1K8OA 1LLRD 5FLXL 2R7ZG 5CV9A 3MXNA 3Q24A 4JI7Q 2GVAA 2R7FA 1GO3E 2LY7A 1QUQA 1D5ZC 4OO1I 1PMRA 1Y14B 1HR0W 1MSHA 4DV3L 1HA5A 4BY7B 2F0KA 3PO2H 5J39A 3T1YL 2F0QA 3GTGB 3I73A 4HAEA 4H7BA 1B3AA 4F88A 1MGSA 2PI2E 2K01A 3K0XA 2PNRC 2A73B 3M7GA 1S3OA 2RSOA 4FP5D 4C3IG 4P74A 1EY9A 3RN5A 1Y1VB 5IYDG 2BH8A 1LT3D 1PTOH 3OSOA 3URYA 1UAPA 2LKVA 1RCVD 3DEPA 1FJGQ 1GHKA 1STYA 1SDFA 1TY2A 4LMQD 2H4OA 2KCTA 3H0GB 4RA8A 5EGTA 3T16A 2NVQH 3HOZH 1TWAH 1VQBA 3CCJA 4IJLA 3K5NA 4K2LA 4RAUC 5CR3A 4ZCKA 1N8RC 4R9WA 1FYCA 4K6LA 3CRLC 3NENA 4OO1H 5C3WA 3MEFA 4JI8Q 3TP5A 2A68C 5FLXc 5C0XI 1AP0A 1NNXA 1MJCA 2A19A 1EZ6A 2CW0D 3N6RA 4C3HH 2WFWA 3J7AV 4A3DB 3CC2A 3GTLB 4ZQ3A 3PUZA 1WYDA 3TDQA 1X3EA 2HDLA 2K05A 2QGQA 4TVAB 1B1ZA 5FLMH 3K5OA 1T5EA 1KL9A 1MKHA 1S5CD 1XMQQ 4P75A 5C4XB 4N9TA 2KHSA 3OIQA 1JORA 2I46A 3EQLC 4B3SL 3BYYB 2PPBC 4ZKBB 3JAME 2F03A 2L1BA 4FNFA 3D4DA 1MD2D 4LUZA 3NXWA 3K81C 4DR1Q 3EN2A 1I3QH 2DJGC 3GO5A 4ZUJA 1CUKA 4C2MH 3T4AC 4DV5L 2N88A 2JE6I 3NEMA 1SXTA 4LF8Q 3P75A 1UE5A 1ASYA 1E22A 2ZJPA 1KLUD 2KA7A 2UXBQ 2EDGA 1D5XC 2PQAA 4A3FG 5C0XH 2I0QA 4DN4M 1HQRD 1D1KA 4KHVA 2RA4A 2MO1A 5DM63 2B2VA 3BVGA 4KHPL 3MEHA 3BVZA 4R8NA 1PTOF 2G9DA 1OXUA 1VMPA 1UE6A 2K5DA 1B44D 2ZJRA 4HMIA 4WJWA 3W1GA 3AU7A 5LMNQ 2R7ZB 3H94A 4DR7Q 1C48A 1JWMD 4YWLA 3FMCA 4HSPA 4A3GH 3KBXA 5CV4A 4OWWB 3NBIA 4BA1I 1YNNC 2VL6A 4DA2A 1O80A 2J4XA 3SGIA 4DXGA 1V1OA 2B2WA 1G2SA 2ZXPA 5C4ZA 1LTLA 1B2TA 5FO8B 1V9PA 1STHA 2PZWA 4LF7Q 3ERSX 1PDQA 1BKBA 4Y7NH 1DCZA 3IFDA 4QF4A 4C3IB 4ALPA 5EPJA 5A2QE 2Q2TA 3D4WA 3I4MG 1AE3A 1NY4A 3UDXA 4FXDA 1BXTA 1ASZA 3WOFA 1NJIC 3MC0B 1EYGA 1Z7TA 1IYVA 4JI1Q 3HOYH 1D5MC 2EYOA 2SEBD 3OMCA 1NMFA 1LUZA 5JAVA 4GKKQ 3GQBA 3L0OA 4X64Q 2UU9Q 4GKJL 1PYBA 3E0JA 4IUQA 4MNOA 3M4OH 3NWTA 1QOHA 1AN8A 3I4OA 3EFXD 5DNFA 1U4PA 1HCZA 5E3FA 3C46A 1Y1WH 1HJPA 4DV7Q 2EVBA 3F8TA 2QEJC 5M3FH 4JI5Q 4LF4L 1EOTA 2IPKD 1DGSA 3G7LA 1K3RA 2PZUA 2K75A 5BR8L 5ELBA 1GM5A 3W2DA 1VQ9A 1SFOH 1YITA 1MHWC 1C0AA 3G6JB 2RBMA 4QUFA 2LS01 3G71A 3MFGA 1EIGA 2AUJD 1JOQA 2D0OA 1F2LA 1EYCA 4FXGC 4KTAA 3WOEA 4LFCL 4P72A 4EQ5A 2RCNA 1DOLA 5HGTA 5BN5A 1O78A 1KDBA 4RCOA 2RDGA 3SHLA 4FVMA 5C6AA 2IX0A 3KLWA 1ZYRD 5CMDA 4A3FB 2KCNA 4XT3B 3U9SA 4EVOA 3GTKH 3A55A 2XWJB 3I8ZA 2QEXA 3GTJH 3RZDB 3CAMA 2JXMB 2K03A 2JA7G 1ENFA 2WACA 3K0YA 2B63H 1K0RA 2TMPA 4UHVA 2MUYA 5IWAL 2PW7A 3F2UA 2XIWA 5E4WC 4JI4L 1PFSA 5M5YB 4DV6L 3ND9A 1B4OA 4EQOA 3P20A 1NAPA 4OX9L 2K5QA 3SDZA 2F3VA 2HQLA 1VQKA 4DR5Q 4LF5Q 2EYLA 3ULLA 3ULJA 1HZ9A 3AFQA 5CBAE 1VDZA 4EQNA 2ZXOA 1SEBD 1PFBA 3MTSA 2VB3X 2QILA 1FNWA 1CQFA 3TRZA 3QJYA 1S4ZA 1T9HA 2XGTA 4R4TA 2MHVA 4K8IA 3PSIA 1RTNA 1UUPA 1A15A 4B3ML 1UNSA 2O4XA 1A62A 1JCKB 3BDLA 1I6HB 1SJED 5HY6A 3TMEA 1YJNA 1VQOA 3PIOA 1GUGA 3GP7A 4DV0Q 4JI7L 4KV6A 1LTTD 3TQYA 1J9OA 1IKMA 4NPSA 3I4MB 3KLSX 2KENA 1BCPB 5IGCA 5KIXA 1BO0A 2OTJA 3L2PA 3CF5A 2EXDA 4JW0A 1SAPA 1WFQA 1JQYD 2E74C 3I90A 5FLXE 2JA5H 5ISRA 1VQGA 3NQTA 4TSSA 1SYDA 2EZVA 3H15A 1R9TH 3NK9A 1QZHA 4DR4Q 1KNEA 1OXVA 5BN4A 5JOBA 5K36H 2ID0A 1VQ4A 1F9RA 2NVXH 1FD7D 3GTPH 1XYIA 4K2KA 2NTTA 1HZAA 2A1AA 4MIUA 2M00A 2EYPA 2MPMA 1CHQD 3KDFB 3A56A 3S16B 1CFMA 1EWCA 1J6QA 1HUMA 4GOPA 1IZ6A 1VCIA 2EXZA 2K04A 1WTPA 2E2HB 1E7ZA 4FF4A 4UPAA 1NUCA 4PMBA 1FJGL 2C5CA 1TQOA 2YTYA 3EA6A 1S40A 1H9JA 4KN7C 2NTSA 3DM3A 1PRTB 3H0GH 1BCPC 1WTVA 4PMCA 1XPOA 4JBWA 3D4RA 1RD9D 4F8MA 3FKIB 5ELFA 2OT2A 3KBGA 2I5LX 3QG1A 4KKTA 4C3JG 5CGKA 5I4DA 3PV0A 4JI8L 3M4PA 5JPNC 2JA6H 5JJKA 1EY7A 3OTOQ 4IJHA 1D2BA 3FVQA 3HFZB 2WKDA 3MXNB 4QMGA 3PQIA 3GTLH 1E1OA 4DV2Q 5CC4A 4BBSG 5FJ8H 1JB7A 2Z6KA 1YHAA 4ZKCB 2RSNA 4G7ZC 1K83H 2Z4HA 2ZTEA 5JVG3 3C2PA 3SR1A 5IYCH 3K59A 1Z6HA 4UDUC 3TS0A 1XMQL 3ZJYC 5C4XH 2VY3A 3K6OA 5I9OA 1PRTC 3TS2A 1SLJA 1G2TA 1YBYA 3R2TA 1SN8A 4BBRG 3KJPA 2JA7B 2VUMH 1ILPA 4A3KG 1IL2A 1LTBD 4DR1L 3WDNA 3JAMc 4V190 1SSOA 1Q90A 1XX8A 2B3GA 2XVSA 1Q3LA 1EQRA 1B3QA 1HFNA 3GDEA 1HHVA 5COYA 2UXBL 3L3OC 3RR5A 4A3JG 4DV4Q 1I94Q 4A3MG 2K52A 1O7ZA 2GVBA 2NYZD 3NBHA 1IBLQ 4L8JA 3Q8DA 1Q1EA 1H95A 4E6IA 3K7AH 2NN6G 4DAVA 1WTQA 2DGYA 4HJ9A 2WB1E 1B8AA 5D14A 4OEMB 1FL0A 1MJEA 3AMUA 5LMNL 2D62A 4DK6C 2R7ZH 4DR7L 2XWBB 2L4NA 1DYQA 1EQVA 4DR6Q 4BY1H 4KY6A 3OOCA 3LGJA 3S1QB 1WTXA 3IRBA 3C3LA 2BE5C 2Z1CA 1VQFA 5ELDA 2XSCA 2F0WA 4N8FA 2XNAC 4XXEA 5C4JB 3NP8A 3TN2A 3D3RA 1KLGD 1Q8IA 2Q2IA 3ICEA 2GA4B 3T51B 3NTHA 1SYFA 2PZTA 4X3SA 4QUCA 1NMGA 2A8VA 3WWVA 1PH9A 2EQSA 2C35B 4LF7L 2Z4IA 1JOOA 1VQHA 1XJVA 4A3BH 4DUYQ 1I4QA 5IP7H 3M85A 2JYOA 3VR3A 5L37A 2D9UA 3BVMA 3KOJA 4JI1L 4A3EG 2JJQA 3FPPA 1TT2A 3TBIB 1PH3A 1K8GA 4GKKL 2QF7A 1G6ZA 2Y0SG 1EFID 1SNOA 2UU9L 1IHZA 2OCEA 2QDLA 1GUOA 2CFMA 4U673 1AZQA 3S1NB 4C3JB 2Y0SE 3PIO3 1K8MA 4G7HC 1Q81C 1S72A 2BDNA 1A8VA 3GTMB 2R92G 5C44H 4DV7L 2EYFA 2PMZB 1SYEA 1U9RA 1V43A 2CW0C 4IUTA 1L1OA 3P7JA 4BBSB 3GTOB 2N78A 3SVMA 1SE8A 4G57A 3HOVH 4KY5A 1PH2A 2RQXA 1XXGA 1II3A 3Q22A 1E1TA 5KYIA 4M8AA 1VS0A 4ILWA 2MJ8A 4IPCA 4JV5Q 1STBA 2Q2UA 4BBRB 3CW2C 2A69D 3DM1A 2B2VC 1M90C 1TWGH 3FHWA 3KYHC 2CH4W 4A3KB 1WJJA 3CU7A 1I4GA 1ONLA 1HTLD 4BA2I 4X62Q 2HDMA 4QCLA 4F7XA 2FFKB 2QW7A 2L15A 4A3MB 4GN4B 4POFA 4LWCA 1X32A 3ONAB 2JA8G 1QCBD 5J3BA 1Y8PB 1JB3A 2YU9H 1SE4A 3QR8A 2FJ2A 2K32A 2M2LA 2K5NA 3KLRA 2HQEA 3KF8A 3HZXA 3S17B 2B2WC 4A3IG 1HNZQ 2F0NA 4X65Q 1SYCA 2F1MA 1QNKA 1H9RA 2Q8TA 3DLLA 1EWIA 1ESFA 1SNDA 2SNSA 4C1NK 3CP0A 2JP1A 1VQPA 4DR5L 4LF5L 5T1GA 4LF6Q 4A3LH 3A8KE 1YZ6A 1J8IA 4MN3A 2OXPA 1LTID 2NVTH 3DWPA 1SRUA 1YI2A 4IQZA 5KYLA 1MSGA 4A76A 2JEAI 3H6MA 3BYTB 4B3RQ 2E2DC 3PUVA 5JEAJ 5IYBG 4K0KQ 2F0VA 1IKLA 3G6EA 1X6OA 4DV0L 2QA4A 4WRDA 3S2HH 1SYBA 4JC0A 1TS4A 4X3TA 3HOUH 3I4MH 1RHPA 1X3PA 1EFWA 2HUGA 1JT8A 3IKJA 1BUVT 3AQQA 5GQOA 1WTRA 3CMAA 1CKOA 1MI2A 4A3EB 4FO2A 3VR2A 1C8CA 1PH4A 3AB9A 2Y0SB 2WKCA 2RF4A 4DR4L 3S1MB 1DXMA 1GUWA 4B9XA 1Q86C 5M3MG 3RNUA 4KKUA 3TP8A 1CKMA 2LMCB 4DFAA 4XQNA 5J1ZA 3S2DB 1N36Q 1EEFD 5LMNW 2ALYB 1C7YA 2R92B 3W5OA 1Y8NB 3HP3A 1KDAA 5GAGC 3GTQB 1CSQA 1S5DD 1GXDC 1PLFA 4GZYC 2NB0A 2EIFA 2B29A 2B2YA 5IGFA 1A3TA 4PZ8A 2JSOA 1KAWA 3FKIH 2B8GA 1CKNA 3G48A 2KBNA 4OWTB 2KCCA 4A3CH 1D1IA 4A4IA 3NSWA 4R8IA 3OTOL 3HOXG 5IGBA 1EQQA 1S5ED 2R93H 3J80i 4JK1C 4DV2L 3I2ZA 3T13A 1PA6A 1HZBA 1LT4D 3S24A 1SMYC 2MP1A 2EE1A 3NTIA 1JMCA 1EUJA 4H13C 5ELEA 4HTHA 2F3WA 4K5XA 5M5XH 1YHQA 2K14A 1IBMQ 5CYUA 1ZYRC 2R6GA 4YCWA 4CBVA 5JVH3 2JA8B 2NZOA 1B9NA 5JEAG 4RHSA 4ZYSA 4LW1A 4ZUIA 3PO3G 1AEXA 4DK3C 4JCVE 4A3IB 4KJNA 3CCQA 1ESRA 3S14H 1EL0A 4IFDI 4GOPB 4QY7A 4IN3A 5M5WB 3A74A 4DV4L 4Q0FA 1I94L 1F2MA 1WOCA 4LFBQ 4FYDA 2RDFA 4MTKA 3E5SA 5I6WA 1IBLL 3A8IE 5C0XJ 4NXNQ 1BQQT 2BDOA 1LTGD 1MIUA 1P8LA 3F2CA 5IP9H 3PO2G 4NDXA 1U4RA 2VB2X 4YWKA 1A0IA 1DOKA 2DY7A 1TXYA 4DNRB 4HIOA 4EGVA 1WTOA 2A6HD 1TU2B 4NP5A 2O5JC 1V1PA 1GVPA 1NTGA 4DR6L 2IHEA 4XDXA 1EY0A 4U68A 1H9MA 3CPFA 5EKKA 1GUSA 3MWYW 3HKSA 4GOPC 1ENCA 3I4LA 4IFDH 1KAAA 2PQEA 4GS3A 3HOZG 2ZTCA 2XRSD 2JK8A 4KI0A 3CQZB 1ZEQX 4DR3Q 1CT1D 5DLQE 4QIWB 4A75A 1F2YA 2X69A 4OO1G 2F0UA 1JJCB 2ICIA 1LT6D 5M3MB 1PVOA 5C5MA 3CCUA 4GLVB 1WCMH 4BXXH 4QB4A 5DEHA 1BOSA 2PNHA 4DUYL 3I4NH 1D6EC 3C1EA 4PNYA 3CCLA 4C3HG 3CCSA 3MAQA 2AWOA 3HOWH 4JI3Q 4L63B 5C3EH 3S15H 4K6DA 2P5ZX 4ME3A 1EIYB 2NVYB 5D3DA 2DNCA 2NZ1D 3K58A 2K7VA 4P2CB 5FLMG 2DN8A 4JI6Q 4DR2Q 4DUZQ 2EY5A 4ODGA 2KECA 3NBHB 2MQHA 4B3TL 1FGUA 4PQXA 4Q5VA 2Z6KC 4JOIA 1TIID 2CWPA 5IY0A 2EOTA 3NWSA 1G6PA 3SXHA 1I50B 2EPBA 4MHEA 1WD0A 2RCFA 3NELA 3ER0A 3LNNA 1FVIA 2AKWB 2E75C 2F52A 3HOXB 2VW9A 1E2ZA 2R3ZA 5FK9C 4LF9Q 3GTMH 1C4QA 4JBMA 1TWCH 4Y52H 1GUNA 1OO9B 4GN5A 4EQPA 2F3IA 4N8X1 1Q1BA 1FNUA 1K73C 4FF3A 4A93H 1QILA 4CKEA 1NCVA 5JPMC 5C0XG 1YIJA 1J5EQ 3DMUA 1DM0B 3QWNA 1VQEA 3M3YH 5E1FA 1CTMA 3D0FA 2J0TD 5C3XA 4M1UB 3KUPA 3QB3A 4JV5L 2DY8A 1PV4A 4IUVA 3DUZA 4AIMA 1TWFB 1JJ2A 3PO3B 1SROA 3EJIA 3R2IA 4DAPA 4CKCA 3CHBD 4YY3Q 2X6LA 2B2UA 3D6CA 4X62L 3M4YA 4A3GG 2E2JH 3E6ZX 1C9OA 4NKLA 2EYJA 1HUNA 3GV3A 4L5SA 4S3SA 4CJ1B 4XYOA 1RF2D 3OYYA 4DV3Q 3QO2A 4PV1C 3VA5A 3ND8A 2WIIB 3H91A 3PO2B 3SK8A 5IOCA 4G7OC 2UUBQ 4J1MA 3RLFA 2AQ1B 3KF6A 1HNZL 1QWYA 1L2FA 1EY4A 2KUMA 1S5BD 5KNBA 4XQJA 1U4LA 3TREA 5I2XA 3FP9A 2F0EA 4L5TA 3H3VC 4PG3A 4BY7H 1SMXA 1OXSC 1STEA 2HHHQ 1PTOB 3I70A 2BOSA 2FINB 1L0XB 2VZAA 1K9MC 3GTGH 3HOYG 1PH1A 1CA6A 4ZAIA 1KRTA 2OQ0A 2NVQB 4JG2A 2K4KA 3HOZB 1TWAB 2JQOA 4EX5A 3S1RB 5LL6S 5LL6X 4B3RL 4K8JA 2HIXA 1Y1VH 3PMFA 1RDPD 2ZM6Q 3TZUA 3STBD 4I7AA 2IX3A 4CKBA 1STNA 1PFMA 2UUAQ 1VQ8A 3MXPA 4C3HB 3J80L 1RIPA 5IE8A 1Y1WG 1HRJA 2AHOB 1VQIA 1CZGA 5FO9B 5M3FG 5KEEA 3NE5B 3EVQA 1HA6A 1ICFB 3FEWX 4JVZA 1X3QA 3ERQA 1CA5A 2F0OA 1M4VA 1XNRQ 1L1OC 3BG3A 2PI2A 1PTOC 3S1MH 1Q7YC 3U4VA 3LWUA 2Z6BA 2ZT9C 3NPPA 4CGYB 4DV1Q 1YEZA 4A3DH 2PYKA 1PZKD 3RMHA 1QVGA 2IT1A 2J7ZA 1QUQB 1DJRD 3DWQA 1N36L 1I3QB 2V1CC 1BDOA 4C2MB 1PFNA 4XT1B 2PMZE 1L0YB 2N8NA 4FDBA 4KD4A 2Q8IB 3UE1A 1M8AA 1I4RA 5F2DA 4RGNA 3T56B 2E2IB 5D3IB 1JC7A 3R8BA 2F0TA 4L5RC 1AE2A 4NXMQ 3A0JA 3E0EA 4YCVA 1LTAD 2LFNA 4NW2A 2B63G 4LF8L 4LNQA 4KN4C 5DAUA 1QVFA 1WTHA 3PUWA 2K5WA 2NWGA 4UP9A 5BN3A 3U58A 4AQYQ 3L7ZC 3J80c 2JA9A 3J81i 2A69C 3BDOA 1SR3A 1UEBA 2KOLA 4JI0Q 2KJXA 3K57A 4IOCA 5KNDA 5AFWA 4JI2Q 4P71A 1QG7A 3J7ZC 4A3GB 1PZJD 3CPWA 1KXLA 3OMGA 5HURA 1BVSA 4IUUA 1IBML 2K33A 4C1NI 1YNJD 2F0SA 2EY6A 1EZ8A 5M9OA 4X6AH 3PUXA 1VQ7A 1DOMA 2D0PA 4ID6A 1WI5A 1Y69U 2RDHA 3K5MA 5EAYA 1LABA 3PGZA 1RJTA 4Y7NB 4HR7B 2DNEA 1XMOQ 2D5DA 3J7AF 4J15A 1ET9A 3F2BA 5IGEA 2CQOA 3SK4A 1PHJA 3CCVA 3BZDB 4CDDC 4LFBL 4RHRA 1H9SA 2F4IA 1QNUA 1A3UA 2JA5G 3W3AA 4NXNL 3HOYB 3K7UC 4DAYA 3VR5A 4RKBA 3F1ZA 2G5DA 1CKNB 4PMWA 4K5VA 1PYSB 4C3IH 1STGA 4ZLTF 5NUCA 3M4OB 4IOAA 5K36G 2WINB 3IFTA 5IYDH 1I4HA 3SE0A 2ZJQA 1AH9A 2AUKA 4GLAC 2PQAB 2A5HA 3TP6A 5JJIA 1Y1WB 4FF1A 2UUCQ 4X64L 5IODA 5M3FB 1BCPD 1DONA 3OPOA 4FF2A 3DXJC 3G4SA 1WVLA 4JBJA 4WORA 1AFPA 3RZOB 2JEBI 5E7NA 1SFOB 4DR3L 1IW7D 4O0AA 2EJMA 3PF4A 4MTNA 2B2YC 1X54A 2NZHA 2ATWA 3DEOA 1G8ZD 3M9BA 4JI5L 2OEOA 1LO5D 2JA6G 4KD3A 2R7DA 1N32Q 1WD1A 3DWAA 3U9OA 3Q23A 2I07B 4JI3L 4JYAQ 4IPHA 2F0LA 2IHFA 2XTIA 1LTRD 5FJ8G 5LMUQ 4JI6L 4DR2L 4DUZL 2KVMA 1VF7A 2Q8RE 5IYCG 1DZ1A 3D31A 4X66Q 1PZID 2L11A 3GTKB 3HKZG 5EBDA 4ABNA 2AQ3B 4QGUA 2UXCQ 5C4XG 1JWUD 5IIFA 1X3FA 1OXTA 4J8QA 3GTJB 5E4XA 1NBWA 4RWSC 3GV6A 2B63B 2F0GA 5FO7B 2VUMG 3P1HA 4AYBG 1GJXA 3O13A 3HKZE 2F0PA 1F77A 4LFAQ 3EBEA 1VQMA 4JI4Q 4LF9L 3BZKA 4A3JB 4A3FH 1X3GA 1N9WA 1VQDA 4OX9Q 3AYHB 3NQIA 3BJUA 5I2YA 1XPRA 1SJHD 1YHBA 2F0JA 1A63A 1G91A 2HD3A 1EEID 5T1IA 2ZXRA 3RZDH 3IL8A 5D65A 5FOBB 2FHTA 1PH5A 2VXWA 2E76C 5M5YH 2JN4A 2WP8J 2VS1A 2LXJA 5CBEE 4GNXA 4TQUS 1K0SA 4UP7A 2CKZB 2LXKA 4QL5A 4HEDA 2L12A 1PYWD 5IGDA 1V1QA 2BE5D 4YY3L 1JR0D 3NHHA 4BY1G 1LV9A 2KEDA 4JBKA 1XNQQ 1D7QA 4RGMA 1E0BA 1OTCA 5KRUA 2BA1A 1LTSD 3UE0A 1FGBD 4L5QA 2JA5B 1I6HH 1G51A 3RLNA 2RVLA 4LAAA 2SOBA 1HNWQ 3BDCA 1R9TB 4N9PA 5C5LA 3MA2B 3M4QA 2XRQD 4QJFA 3A7LA 4OGQC 2UUBL 3EROA 1CSPA 4XTCS 4AH6A 2K28A 3V96A 3GTPB 2NVXB 2ICEC 2F0IA 4A3BG 4CDCC 2TSSA 1NE3A 1EY5A 2WAQG 4NB3A 2VQFQ 4ZRZA 3Q6SA 3VA7A 5IP7G 3NUCA 4CDFC 2A6HC 2A6ED 1N34Q 1X56A 2HHHL 5CORA 1XWEA 5JJZA 1HTPA 3OW2A 4RCNA 1XPUA 2WAQE 4GN3B 5CV6A 1YJ9A 2K5HA 2B2TA 1F2ZA 3A5UA 2EYHA 3OWEB 3CC4A 2DUDA 2BA0A 5GROA 3S1RH 3S16H 1LACA 4QIWE 3FPUB 1IYUA 1E2WA 4IPDA 2ZM6L 3I55A 4OL7A 3SEBA 2E2HH 2C9OA 1EWHA 2JA6B 4JOIC 2UUAL 1SBBB 5GADC 4K14A 2YTXA 3FRPB 2F4VQ 1B53A 4I7ZC 1HR0Q 5C44G 3J81L 1K28A 4H02A 4WJ3M 3I7FA 1IYJB 4PZ7A 4HN7A 4DNIA 1QB5D 3Q0AA 1UE7A 1KIXA 5HGQA 1K83B 3HOVG 1QJOA 1A2UA 3J80E 1XNRL 1EYDA 4PZ6A 1U5KA 3HKZB 2Z8LA 1GKHA 3QIAA 2I5MX 3MXGA 4DV1L 4K5WA 1R4PB 3KF6B 2IWHA 2VUMB 2F0DA 1O7IA 4AYBB 4HIDA 4L6TB 3VR4A 1UWVA 1CZWA 1QVCA 5A35A 3JAMi 3NTKA 2ZTDA 1I5FA 2CQAA 3VYTA 1ZXTA 1VQLA 2VQEQ 2K5VA 2MNAA 5KGUA 2B8FA 1CHPD 1PXUA 1BCPF 1D8LA 2UXDQ 1LYLA 2E2IH 2MO0A 2ENBA 2JA7H 2OTLA 3VYSA 1NR4A 2B2UC 3RLOA 1U0LA 1A2TA 2ASBA 3CCEA 4NXML 4DF7A 4B08A 3K7AB 5EPKA 3DHQA 1HPCA 5EBCA 3HS0C 3ZYYX 5AJ3Q 1FR3A 4AQYL 1Q46A 4HIKA 3AEVA 1BF4A 3J81c 2M9VA 3UDIA 4JI0L 1DD2A 4F87A 4DK1A 3A5ZB 2SNMA 4BY1B 3E9IA 4JI2L 2E8GA 4DK0A 1A3VA 1JE4A 4A3LG 4DU9A 3A8JE 3W1BA 1N33Q 3MZ5A 1CK1A 3V05A 1ENAA 1PRTF 1ZKOA 3I56A 1B7YB 1VQCA 5ELNA 4X3KA 1SYGA 1V8QA 1SNPA 4TRDA 1I6VC 3S1QH 3H09A 2E5LQ 1JE5A 1XMOL 4A3BB 2RHSB 4DAMA 3RUZA 5C4JH 1X9NA 2QKIC 2WAQB 3HOUG 4GLXA 1CI3M 5I6YA 4IUNA 3K8AA 3R3OA 4CHTB 4DNTB 3I3CA 1B50A 1TWHB 3D6WA 1RTOA 1Q12A 3T1HQ 1KD1C 2A68D 4OIKA 1RL2A 3TSSA 5IT9L 1U4MA 2K1BA 3BZCA 1H9KA 1HH2P 3K5LA 2IW3A 1ML0D 4IO9A 3STBC 1IBKQ 1SE2A 2F0HA 4O42A 3VYRA 4O2DA 5C44B 2UUCL 3CMEA 2F0MA 4IURA 1LT5D 2O2LD 3JC66 4YHHQ 2HT1A 1RKNA 2R61A 1VQ5A 1EIHA 3R93A 1LM0A 3S1NH 1I4XA 4C3JH 3RZOH 1ICWA 3HOVB 1KRSA 3OHXC 1BBWA 4R4IA 1L0WA 5TSSA 4IFDJ 3FKIG 2FMMA 1JICA 4XQQA 3RD4A 2F0FA 4HSVA 4WJ4A 3SK6A 4KJOA 4BS9A 2OWOA 1YNXA 1JWSD 2KEEA 2NN6I 4A3CG 4HCSA 4MZ9A 3J81j 3GD7A 1N32L 1TWGB 4BBSH 2DJFC 3PUYA 3GTOH 4QQBX 2KHIA 2R93G 3OW7A 2QCPX 4JYAL 1R4QB 3CCRA 1SMYD 4I65A 4HMJA 3I91A 2FMCA 3SK5A 2HCIA 1HNXQ 1ILQA 5LMUL 4O1NA 3LWEA 1H9SB 5EPLA 3OWFA 1F9SA 1VQNA 5ELCA 5IT9c 4BBRH 5I9PA 3EIVA 4X66L 1GD7A 4DAYB 4IPGA 2UXCL 4HJ8A 4HJ7A 1HZCA 4KLKA 4A3KH 1AW7A 2H1EA 2YU9B 2CWAA 4OXPA 3E9HA 5EJWA 1VMCA 4LFAL 1YNND 4KK7A 1S5FD 4A3JH 1I4PA 4A3MH 4DXFA 2AQ2B 4KY7A 2Z0SA 1PH6A 1Q82C 1WTWA 1BNZA 2GN5A 2NN6H 3ITPA 3KLSA 3T1YQ 2KQ3A 1TY0A 4C56C 2NVTB 4JPBW 3TP7A 2NUCA 3S17H 2K6AA 4X65L 1A6XA 1Z47A 5IP9G 2RKSA 1K3BC 4DPGA 1YNJC 4B9WA 2EJFC 4RG1A 1ET6A 1KABA 4Z9CB 4LF6L 3CKIB 1NSNS 3CRKC 4RH6A 1L1OB 2HCCA 1VQ6A 1F9QA 1SE3A 1EIFA 3S2HB 1M1KC 4ZK9B 1STAA 5G3LD 3HOUB 3BU2A 1XNQL 4RGOS 2YYZA 5GAEC 1FNVA 3PF5A 2BCOA 2XN9C 4K0KL 5EKLA 3PIPA 1EQTA 1HNWL 1P16A 4IFDG 3X3MA 3QOLA 4HJAA 2EY2A 2PW5A 3J7YW 1IXRA 1GHJA 4CDEC 2FXQA 3A7AB 4RMFA 4OIJA 2RHQB 1WCMG 4BXXG 2VQFL 3HEJA 4IUPA 3I4NG 2B39A 4A3EH 4DKAC 4H0LC 3JAML 1N34L 4TKOB 1EYAA 3HOWG 5C3EG 3RN2A 1HFGA 4RGTA 1T5XD 3CCMA 1BR9A 5ELOA 4B3SQ 3UI2A 4RKLA 3KF8B 4DGZA
chains in the Genus database with same CATH topology
2JA6G 5GAGC 4OONA 1CSQA 1G291 2R7DA 2YTVA 1N32Q 3S2DH 1C0AA 3G71A 2OQKA 4JI3L 2R92H 2EIFA 2B29A 4JYAQ 4IPHA 2D0OA 4GNXB 2IHFA 4DV5Q 2N3SA 4PZ8A 4YWMA 3GTQH 2XTIA 1KAWA 1KC8C 3FKIH 3KJOA 4LFCL 3U50C 1CKNA 4P72A 5FJ8G 5LMUQ 2F4VL 5JJLA 1HR0L 4EQ5A 3G48A 4JI6L 2KBNA 4OWTB 4DR2L 4DUZL 2RCNA 5IYCG 5H1SE 3D31A 4X66Q 4A3CH 4A4IA 3OTOL 3HOXG 3HKZG 4QGUA 1EQQA 2UXCQ 5C4XG 4KHPQ 2IX0A 1X3FA 3KLWA 1OXTA 3J80i 4A93G 2R93H 4DV2L 1NBWA 3I2ZA 2VUMG 3GTKH 4AYBG 1UE1A 3HKZE 1PA6A 2QEXA 4LFAQ 3EBEA 1HZBA 1YVCA 3S24A 1VQMA 4JI4Q 3GTJH 4LF9L 3BZKA 3J7A5 4A3FH 1X3GA 3CAMA 1JMCA 1N9WA 1EUJA 2JA7G 1VQDA 4OX9Q 3AYHB 2B63H 1K0RA 5M5XH 3CD6A 3BJUA 1YHQA 1XPRA 1YHBA 2K14A 1IBMQ 1A63A 2R6GA 4YCWA 5IWAL 4XIGS 4JI4L 1PFSA 3RZDH 4DV6L 1B70B 2NZOA 2VQEL 2IY5B 5JEAG 4OX9L 3CC7A 1X65A 4GNXC 4LW1A 1K8AC 3UDGA 1E24A 2HQLA 3PO3G 1PH5A 1VQKA 2JA8H 1W2BA 4DK3C 4JCVE 2UXDL 5M5YH 1JJGA 4DR5Q 2LSSA 4LF5Q 3ULLA 5GAHC 3CCQA 3ULJA 1HZ9A 3AFQA 2WP8J 2N49A 2WB1G 3S14H 3UDFA 2VS1A 4IFDI 2LXJA 4GOPB 4GNXA 4QY7A 4TQUS 4UP7A 2CKZB 2LXKA 4QL5A 2I5HA 4A3IH 3A74A 3TRZA 4DV4L 1I94L 1WOCA 1T9HA 1W3SA 1OXXK 2XGTA 4R4TA 4LFBQ 1V1QA 3PSIA 4YY3L 4UY8C 4B3ML 5AJ3L 4BY1G 3KFUA 4R4OA 1A62A 5M5WH 5C0XJ 1IBLL 4NXNQ 4JBKA 5HY6A 1XNQQ 1KQSA 2AMCB 1YJNA 1MIUA 1P8LA 3F2CA 1D7QA 1VQOA 5IP9H 1VQAA 3PIOA 3PO2G 1OTCA 1VQJA 2ES2A 3F2DA 4YWKA 2BA1A 3S16H 4DV0Q 1A0IA 4JI7L 3UE0A 4L5QA 1TXYA 3TQYA 1PH8A 4NPSA 3M7NA 1I6HH 1G51A 3RLNA 2KENA 1EOVA 2VNUD 4HIOA 3K80C 4BY7G 1HNWQ 2OTJA 3L2PA 2YV5A 1N33L 3CF5A 1GVPA 1NTGA 3M4QA 1KHIA 2EXDA 4QJFA 2IHEA 2UUBL 4DR6L 1WFQA 2JA5H 1CSPA 4XTCS 4AH6A 5IYBH 1VQGA 3CPFA 3H15A 4A3BG 1R9TH 1QZHA 1NE3A 4DR4Q 2WAQG 1OXVA 4NB3A 2VQFQ 3CXCA 4HIMA 5IP7G 3HKSA 1Y1VG 4GOPC 2ID0A 1VQ4A 2NVXH 1N34Q 3GTPH 1X56A 2E5LL 1HZAA 3HOZG 4GS3A 2HHHL 3OW2A 2ZTCA 1Q8KA 3VDYA 2A1AA 2JK8A 3KDFB 4KI0A 4DR3Q 2WAQE 4GN3B 4LF4Q 1XPUA 5DLQE 4A75A 1YJ9A 1J6QA 2K5HA 4WJ3M 4GOPA 1IZ6A 3A5UA 1VCIA 3H0GG 3ULPA 3CC4A 4OO1G 1JJCB 5BR8Q 1XTDA 2DUDA 2BA0A 1PVOA 3CCUA 4GLVB 1E7ZA 5GROA 1WCMH 1TWHH 4UPAA 3S1RH 3CQZH 4POGA 3AFPA 3T1HL 1FJGL 2PNHA 4QIWE 4DUYL 3I4NH 2YTYA 1S40A 4IPDA 3CCLA 3DM3A 2ZM6L 3CCSA 3I55A 2AWOA 2KHJA 3HOWH 4JI3Q 3H0GH 5C3EH 5M3MH 2E2HH 3S15H 1XPOA 4ME3A 4JBWA 4JOIC 4YCUA 1EIYB 2UUAL 4B3TQ 5GADC 4LFCQ 2YTXA 2F4VQ 1YJWA 4A3DG 2I5LX 4P73A 5FLMG 5C44G 1HR0Q 4JI6Q 4H02A 2MFIA 2HIVA 4APVA 3PV0A 3I7FA 1IYJB 3NBHB 4DUZQ 4DR2Q 4JI8L 4PZ7A 2IX1A 3M4PA 2MQHA 1E3PA 4DNIA 2Q2HA 2JA6H 4B3TL 1FGUA 5JJKA 2NVYH 3OTOQ 4IJHA 2Z6KC 1IBKL 3HFZB 4JOIA 4UP8A 2CWPA 3H3VI 3MXNB 5IY0A 1UE7A 1KIXA 2CCZA 1QZGA 1G6PA 5HGQA 3GTLH 1E1OA 4DV2Q 3HOVG 3PCOB 1XNRL 4PZ6A 1U5KA 3NELA 3ER0A 4YHHL 1FVIA 2AKWB 2F52A 4BBSG 2VW9A 1GKHA 5FJ8H 2I5MX 4OWXB 1JB7A 2Z6KA 4DV1L 1YHAA 4R4QA 4LF9Q 3GTMH 4JBMA 4R4CA 1K83H 1TWCH 2ZTEA 4Y52H 1I50H 5IYCH 4LUVA 4GN5A 3KF6B 2F3IA 3TS0A 1XMQL 1O7IA 3TEHB 3ZJYC 3HOXH 1Q1BA 1UWVA 4LUOA 5C4XH 4HIDA 1QVCA 5IWAQ 2VY3A 2BH2A 3KDFA 3JAMi 1K73C 3U4ZA 4A93H 2ZTDA 1I5FA 4DV6Q 1BBUA 5C0XG 4HJ5A 1SLJA 3TS2A 4KHZA 2VQEQ 1YBYA 2K5VA 2MNAA 1YIJA 4BBRG 1SN8A 3KJPA 1J5EQ 1VQEA 2VUMH 4AYBE 1D8LA 4A3KG 1IL2A 4DR1L 3M3YH 2UXDQ 3D0FA 1LYLA 3JAMc 2E2IH 1PH7A 2B3GA 2MO0A 1J5EL 4JV5L 2KCMA 1PV4A 2JA7H 2OTLA 1EQRA 4AIMA 2AWNA 3GDEA 3RLOA 1U0LA 1JJ2A 1HNXL 2ASBA 1X55A 3CCEA 1SROA 2H5XA 4NXML 2UXBL 2K50A 3RR5A 4A3JG 4R1JA 3B6YA 4DV4Q 1I94Q 4A3MG 2K52A 2GVBA 1TWFH 4YY3Q 3H3VH 4B3MQ 5AJ3Q 3PO3H 1IBLQ 4X62L 3Q8DA 1Q1EA 1Z9FA 1H95A 4AQYL 1Q46A 3K7AH 2NN6G 4HIKA 4A3GG 2E2JH 1C9OA 3AEVA 2R7ZG 2DGYA 3UDIA 2WB1E 3J81c 4HJ9A 4JI0L 1B8AA 4L5SA 4JI7Q 2GVAA 3A5ZB 2R7FA 3E9IA 1FL0A 4JI2L 1GO3E 2E8GA 3OYYA 4DV3Q 1MJEA 4A3LG 1QUQA 5LMNL 2D62A 3W1BA 4DK6C 2R7ZH 1N33Q 4DR7L 4OO1I 4DR6Q 1Y14B 1VQ9A 2UUBQ 4BY1H 3LGJA 3I56A 3RLFA 1HR0W 3KF6A 4DV3L 1HNZL 1B7YB 1VQCA 1L2FA 5ELNA 3IRBA 1VQFA 1VQLA 3T1YL 3PO2H 3TREA 3S1QH 3FP9A 4L5TA 2Q2IA 3ICEA 4PG3A 2PI2E 4BY7H 3K0XA 1SMXA 1OXSC 2E5LQ 1JE5A 1XMOL 2RHSB 2HHHQ 1S3OA 4DAMA 5C4JH 1X9NA 2VZAA 1K9MC 1NMGA 3GTGH 2A8VA 3WWVA 1PH9A 4P74A 2EQSA 3HOYG 2C35B 1PH1A 4GLXA 3RN5A 4LF7L 3HOUG 1KRTA 2OQ0A 1VQHA 1XJVA 3K8AA 5IYDG 4JG2A 2BH8A 2K4KA 4A3BH 2JQOA 4EX5A 4B3RL 1FJGQ 1Q12A 3T1HQ 4DUYQ 1KD1C 2HIXA 5IP7H 1Y1VH 1RL2A 2ZM6Q 3M85A 3STBD 2KCTA 2NVQH 3HOZH 1TWAH 1VQBA 3CCJA 4IJLA 3BZCA 3KOJA 4JI1L 2UUAQ 1VQ8A 4A3EG 1N8RC 1HH2P 2JJQA 1RIPA 5IE8A 1Y1WG 3NENA 1PH3A 2AHOB 1K8GA 4GKKL 2Y0SG 1VQIA 2UU9L 5M3FG 3MEFA 4JI8Q 2OCEA 5FLXc 5C0XI 4IO9A 1MJCA 2A19A 3STBC 1IBKQ 2CFMA 4C3HH 2WFWA 4O2DA 2UUCL 3CC2A 2Y0SE 3PUZA 3CMEA 1WYDA 1X3EA 1XNRQ 2QGQA 4TVAB 1L1OC 2PI2A 3S1MH 3JC66 4YHHQ 1Q81C 1S72A 1Q7YC 2HT1A 1A8VA 3U4VA 1VQ5A 4DV1Q 4A3DH 1YEZA 1LM0A 5FLMH 5C44H 4DV7L 2R92G 3RZOH 4C3JH 3S1NH 1KRSA 1BBWA 1KL9A 4R4IA 1L0WA 1QVGA 1MKHA 1V43A 2IT1A 1QUQB 1XMQQ 1L1OA 3FKIG 4IFDJ 4P75A 1N36L 2N78A 2V1CC 4WJ4A 1SE8A 4B3SL 2OWOA 1YNXA 3HOVH 2PMZE 4FDBA 2N8NA 2NN6I 3UE1A 4A3CG 4MZ9A 3J81j 1PH2A 3GD7A 1N32L 4BBSH 4LUZA 1E1TA 3PUYA 4DR1Q 3K81C 3GTOH 1VS0A 2KHIA 1I3QH 3EN2A 4QQBX 2R93G 4JYAL 3GO5A 4IPCA 1CUKA 4C2MH 3CCRA 4JV5Q 4DV5L 2Q2UA 2JE6I 3NEMA 3CW2C 4LF8Q 1UE5A 1M90C 1ASYA 4L5RC 1E22A 1AE2A 1TWGH 2ZJPA 3FHWA 5LMUL 1HNXQ 4GKJQ 3KYHC 2UXBQ 4NXMQ 1WJJA 3A0JA 3E0EA 2PQAA 4YCVA 4A3FG 1VQNA 2I0QA 5IT9c 2B63G 4BBRH 4LF8L 4LNQA 3EIVA 4X66L 1GD7A 4DAYB 4BA2I 2MO1A 4IPGA 1QVFA 2UXCL 4HJ8A 4HJ7A 1HZCA 3PUWA 4KLKA 4X62Q 4A3KH 4KHPL 4UP9A 3U58A 4AQYQ 3L7ZC 3J80c 2JA9A 3J81i 1OXUA 2CWAA 2L15A 1SR3A 3E9HA 1UEBA 4GN4B 4OXPA 4POFA 4JI0Q 1UE6A 4LWCA 2ZJRA 4LFAL 2JA8G 4IOCA 5J3BA 4JI2Q 3W1GA 4P71A 3J7ZC 4A3JH 2YU9H 5LMNQ 3CPWA 4A3MH 2K5NA 1KXLA 4DR7Q 1BVSA 1IBML 2Z0SA 1PH6A 1Q82C 4YWLA 4A3IG 1HNZQ 4X65Q 2GN5A 4A3GH 3PUXA 4X6AH 3T1YQ 3DLLA 2D0PA 1VQ7A 1EWIA 4OWWB 1WI5A 4BA1I 2VL6A 3CP0A 3S17H 1VQPA 4DR5L 5EAYA 3PGZA 4X65L 4LF5L 3SGIA 4LF6Q 4A3LH 1YZ6A 1Z47A 1LTLA 5IP9G 1XMOQ 4DPGA 4J15A 2NVTH 1V9PA 4RG1A 1SRUA 3F2BA 4LF7Q 3ERSX 2CQOA 4LF6L 1YI2A 1PHJA 3CCVA 1BKBA 4LFBL 4Y7NH 1L1OB 1VQ6A 4A76A 2JEAI 1EIFA 1M1KC 4B3RQ 2JA5G 4ALPA 3I4MG 4NXNL 2Q2TA 3PUVA 1AE3A 3BU2A 5JEAJ 5IYBG 3K7UC 1NY4A 3UDXA 1XNQL 3G6EA 4K0KQ 1X6OA 2YYZA 5GAEC 3F1ZA 1ASZA 1NJIC 1CKNB 4PMWA 2QA4A 4DV0L 1PYSB 1EYGA 3S2HH 3PF5A 4JC0A 4C3IH 4JI1Q 3I4MH 3HOUH 3HOYH 4BXXH 4IOAA 4K0KL 5K36G 3PIPA 1EFWA 1HNWL 1P16A 4IFDG 1NMFA 1LUZA 5IYDH 3AQQA 4GKKQ 1JT8A 5GQOA 3L0OA 4X64Q 2UU9Q 4HJAA 2ZJQA 4GKJL 1AH9A 1PYBA 4GLAC 2PQAB 3CMAA 1CKOA 4MNOA 3M4OH 5JJIA 1IXRA 2UUCQ 3I4OA 4X64L 1PH4A 2FXQA 4RMFA 2RHQB 1WCMG 2RF4A 4DR4L 4BXXG 2VQFL 3I4NG 4A3EH 4DKAC 3G4SA 1N34L 4JBJA 1Y1WH 3HOWG 1HJPA 4DV7Q 2JEBI 5E7NA 5C3EG 5M3MG 3RN2A 3RNUA 1Q86C 3F8TA 5M3FH 4JI5Q 1CKMA 4LF4L 4DR3L 4O0AA 3CCMA 3PF4A 1DGSA 4MTNA 1N36Q 1K3RA 1X54A 2ALYB 2NZHA 5LMNW 2K75A 1C7YA 2ATWA 3W5OA 5ELOA 3M9BA 5BR8L 1GM5A 4B3SQ 4JI5L 3KF8B 1SFOH 1YITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 G;  5GAG C;  4OON A;  1CSQ A;  1G29 1;  2R7D A;  2YTV A;  1N32 Q;  3S2D H;  1C0A A;  3G71 A;  2OQK A;  4JI3 L;  2R92 H;  2EIF A;  2B29 A;  4JYA Q;  4IPH A;  2D0O A;  4GNX B;  2IHF A;  4DV5 Q;  2N3S A;  4PZ8 A;  4YWM A;  3GTQ H;  2XTI A;  1KAW A;  1KC8 C;  3FKI H;  3KJO A;  4LFC L;  3U50 C;  1CKN A;  4P72 A;  5FJ8 G;  5LMU Q;  2F4V L;  5JJL A;  1HR0 L;  4EQ5 A;  3G48 A;  4JI6 L;  2KBN A;  4OWT B;  4DR2 L;  4DUZ L;  2RCN A;  5IYC G;  5H1S E;  3D31 A;  4X66 Q;  4A3C H;  4A4I A;  3OTO L;  3HOX G;  3HKZ G;  4QGU A;  1EQQ A;  2UXC Q;  5C4X G;  4KHP Q;  2IX0 A;  1X3F A;  3KLW A;  1OXT A;  3J80 i;  4A93 G;  2R93 H;  4DV2 L;  1NBW A;  3I2Z A;  2VUM G;  3GTK H;  4AYB G;  1UE1 A;  3HKZ E;  1PA6 A;  2QEX A;  4LFA Q;  3EBE A;  1HZB A;  1YVC A;  3S24 A;  1VQM A;  4JI4 Q;  3GTJ H;  4LF9 L;  3BZK A;  3J7A 5;  4A3F H;  1X3G A;  3CAM A;  1JMC A;  1N9W A;  1EUJ A;  2JA7 G;  1VQD A;  4OX9 Q;  3AYH B;  2B63 H;  1K0R A;  5M5X H;  3CD6 A;  3BJU A;  1YHQ A;  1XPR A;  1YHB A;  2K14 A;  1IBM Q;  1A63 A;  2R6G A;  4YCW A;  5IWA L;  4XIG S;  4JI4 L;  1PFS A;  3RZD H;  4DV6 L;  1B70 B;  2NZO A;  2VQE L;  2IY5 B;  5JEA G;  4OX9 L;  3CC7 A;  1X65 A;  4GNX C;  4LW1 A;  1K8A C;  3UDG A;  1E24 A;  2HQL A;  3PO3 G;  1PH5 A;  1VQK A;  2JA8 H;  1W2B A;  4DK3 C;  4JCV E;  2UXD L;  5M5Y H;  1JJG A;  4DR5 Q;  2LSS A;  4LF5 Q;  3ULL A;  5GAH C;  3CCQ A;  3ULJ A;  1HZ9 A;  3AFQ A;  2WP8 J;  2N49 A;  2WB1 G;  3S14 H;  3UDF A;  2VS1 A;  4IFD I;  2LXJ A;  4GOP B;  4GNX A;  4QY7 A;  4TQU S;  4UP7 A;  2CKZ B;  2LXK A;  4QL5 A;  2I5H A;  4A3I H;  3A74 A;  3TRZ A;  4DV4 L;  1I94 L;  1WOC A;  1T9H A;  1W3S A;  1OXX K;  2XGT A;  4R4T A;  4LFB Q;  1V1Q A;  3PSI A;  4YY3 L;  4UY8 C;  4B3M L;  5AJ3 L;  4BY1 G;  3KFU A;  4R4O A;  1A62 A;  5M5W H;  5C0X J;  1IBL L;  4NXN Q;  4JBK A;  5HY6 A;  1XNQ Q;  1KQS A;  2AMC B;  1YJN A;  1MIU A;  1P8L A;  3F2C A;  1D7Q A;  1VQO A;  5IP9 H;  1VQA A;  3PIO A;  3PO2 G;  1OTC A;  1VQJ A;  2ES2 A;  3F2D A;  4YWK A;  2BA1 A;  3S16 H;  4DV0 Q;  1A0I A;  4JI7 L;  3UE0 A;  4L5Q A;  1TXY A;  3TQY A;  1PH8 A;  4NPS A;  3M7N A;  1I6H H;  1G51 A;  3RLN A;  2KEN A;  1EOV A;  2VNU D;  4HIO A;  3K80 C;  4BY7 G;  1HNW Q;  2OTJ A;  3L2P A;  2YV5 A;  1N33 L;  3CF5 A;  1GVP A;  1NTG A;  3M4Q A;  1KHI A;  2EXD A;  4QJF A;  2IHE A;  2UUB L;  4DR6 L;  1WFQ A;  2JA5 H;  1CSP A;  4XTC S;  4AH6 A;  5IYB H;  1VQG A;  3CPF A;  3H15 A;  4A3B G;  1R9T H;  1QZH A;  1NE3 A;  4DR4 Q;  2WAQ G;  1OXV A;  4NB3 A;  2VQF Q;  3CXC A;  4HIM A;  5IP7 G;  3HKS A;  1Y1V G;  4GOP C;  2ID0 A;  1VQ4 A;  2NVX H;  1N34 Q;  3GTP H;  1X56 A;  2E5L L;  1HZA A;  3HOZ G;  4GS3 A;  2HHH L;  3OW2 A;  2ZTC A;  1Q8K A;  3VDY A;  2A1A A;  2JK8 A;  3KDF B;  4KI0 A;  4DR3 Q;  2WAQ E;  4GN3 B;  4LF4 Q;  1XPU A;  5DLQ E;  4A75 A;  1YJ9 A;  1J6Q A;  2K5H A;  4WJ3 M;  4GOP A;  1IZ6 A;  3A5U A;  1VCI A;  3H0G G;  3ULP A;  3CC4 A;  4OO1 G;  1JJC B;  5BR8 Q;  1XTD A;  2DUD A;  2BA0 A;  1PVO A;  3CCU A;  4GLV B;  1E7Z A;  5GRO A;  1WCM H;  1TWH H;  4UPA A;  3S1R H;  3CQZ H;  4POG A;  3AFP A;  3T1H L;  1FJG L;  2PNH A;  4QIW E;  4DUY L;  3I4N H;  2YTY A;  1S40 A;  4IPD A;  3CCL A;  3DM3 A;  2ZM6 L;  3CCS A;  3I55 A;  2AWO A;  2KHJ A;  3HOW H;  4JI3 Q;  3H0G H;  5C3E H;  5M3M H;  2E2H H;  3S15 H;  1XPO A;  4ME3 A;  4JBW A;  4JOI C;  4YCU A;  1EIY B;  2UUA L;  4B3T Q;  5GAD C;  4LFC Q;  2YTX A;  2F4V Q;  1YJW A;  4A3D G;  2I5L X;  4P73 A;  5FLM G;  5C44 G;  1HR0 Q;  4JI6 Q;  4H02 A;  2MFI A;  2HIV A;  4APV A;  3PV0 A;  3I7F A;  1IYJ B;  3NBH B;  4DUZ Q;  4DR2 Q;  4JI8 L;  4PZ7 A;  2IX1 A;  3M4P A;  2MQH A;  1E3P A;  4DNI A;  2Q2H A;  2JA6 H;  4B3T L;  1FGU A;  5JJK A;  2NVY H;  3OTO Q;  4IJH A;  2Z6K C;  1IBK L;  3HFZ B;  4JOI A;  4UP8 A;  2CWP A;  3H3V I;  3MXN B;  5IY0 A;  1UE7 A;  1KIX A;  2CCZ A;  1QZG A;  1G6P A;  5HGQ A;  3GTL H;  1E1O A;  4DV2 Q;  3HOV G;  3PCO B;  1XNR L;  4PZ6 A;  1U5K A;  3NEL A;  3ER0 A;  4YHH L;  1FVI A;  2AKW B;  2F52 A;  4BBS G;  2VW9 A;  1GKH A;  5FJ8 H;  2I5M X;  4OWX B;  1JB7 A;  2Z6K A;  4DV1 L;  1YHA A;  4R4Q A;  4LF9 Q;  3GTM H;  4JBM A;  4R4C A;  1K83 H;  1TWC H;  2ZTE A;  4Y52 H;  1I50 H;  5IYC H;  4LUV A;  4GN5 A;  3KF6 B;  2F3I A;  3TS0 A;  1XMQ L;  1O7I A;  3TEH B;  3ZJY C;  3HOX H;  1Q1B A;  1UWV A;  4LUO A;  5C4X H;  4HID A;  1QVC A;  5IWA Q;  2VY3 A;  2BH2 A;  3KDF A;  3JAM i;  1K73 C;  3U4Z A;  4A93 H;  2ZTD A;  1I5F A;  4DV6 Q;  1BBU A;  5C0X G;  4HJ5 A;  1SLJ A;  3TS2 A;  4KHZ A;  2VQE Q;  1YBY A;  2K5V A;  2MNA A;  1YIJ A;  4BBR G;  1SN8 A;  3KJP A;  1J5E Q;  1VQE A;  2VUM H;  4AYB E;  1D8L A;  4A3K G;  1IL2 A;  4DR1 L;  3M3Y H;  2UXD Q;  3D0F A;  1LYL A;  3JAM c;  2E2I H;  1PH7 A;  2B3G A;  2MO0 A;  1J5E L;  4JV5 L;  2KCM A;  1PV4 A;  2JA7 H;  2OTL A;  1EQR A;  4AIM A;  2AWN A;  3GDE A;  3RLO A;  1U0L A;  1JJ2 A;  1HNX L;  2ASB A;  1X55 A;  3CCE A;  1SRO A;  2H5X A;  4NXM L;  2UXB L;  2K50 A;  3RR5 A;  4A3J G;  4R1J A;  3B6Y A;  4DV4 Q;  1I94 Q;  4A3M G;  2K52 A;  2GVB A;  1TWF H;  4YY3 Q;  3H3V H;  4B3M Q;  5AJ3 Q;  3PO3 H;  1IBL Q;  4X62 L;  3Q8D A;  1Q1E A;  1Z9F A;  1H95 A;  4AQY L;  1Q46 A;  3K7A H;  2NN6 G;  4HIK A;  4A3G G;  2E2J H;  1C9O A;  3AEV A;  2R7Z G;  2DGY A;  3UDI A;  2WB1 E;  3J81 c;  4HJ9 A;  4JI0 L;  1B8A A;  4L5S A;  4JI7 Q;  2GVA A;  3A5Z B;  2R7F A;  3E9I A;  1FL0 A;  4JI2 L;  1GO3 E;  2E8G A;  3OYY A;  4DV3 Q;  1MJE A;  4A3L G;  1QUQ A;  5LMN L;  2D62 A;  3W1B A;  4DK6 C;  2R7Z H;  1N33 Q;  4DR7 L;  4OO1 I;  4DR6 Q;  1Y14 B;  1VQ9 A;  2UUB Q;  4BY1 H;  3LGJ A;  3I56 A;  3RLF A;  1HR0 W;  3KF6 A;  4DV3 L;  1HNZ L;  1B7Y B;  1VQC A;  1L2F A;  5ELN A;  3IRB A;  1VQF A;  1VQL A;  3T1Y L;  3PO2 H;  3TRE A;  3S1Q H;  3FP9 A;  4L5T A;  2Q2I A;  3ICE A;  4PG3 A;  2PI2 E;  4BY7 H;  3K0X A;  1SMX A;  1OXS C;  2E5L Q;  1JE5 A;  1XMO L;  2RHS B;  2HHH Q;  1S3O A;  4DAM A;  5C4J H;  1X9N A;  2VZA A;  1K9M C;  1NMG A;  3GTG H;  2A8V A;  3WWV A;  1PH9 A;  4P74 A;  2EQS A;  3HOY G;  2C35 B;  1PH1 A;  4GLX A;  3RN5 A;  4LF7 L;  3HOU G;  1KRT A;  2OQ0 A;  1VQH A;  1XJV A;  3K8A A;  5IYD G;  4JG2 A;  2BH8 A;  2K4K A;  4A3B H;  2JQO A;  4EX5 A;  4B3R L;  1FJG Q;  1Q12 A;  3T1H Q;  4DUY Q;  1KD1 C;  2HIX A;  5IP7 H;  1Y1V H;  1RL2 A;  2ZM6 Q;  3M85 A;  3STB D;  2KCT A;  2NVQ H;  3HOZ H;  1TWA H;  1VQB A;  3CCJ A;  4IJL A;  3BZC A;  3KOJ A;  4JI1 L;  2UUA Q;  1VQ8 A;  4A3E G;  1N8R C;  1HH2 P;  2JJQ A;  1RIP A;  5IE8 A;  1Y1W G;  3NEN A;  1PH3 A;  2AHO B;  1K8G A;  4GKK L;  2Y0S G;  1VQI A;  2UU9 L;  5M3F G;  3MEF A;  4JI8 Q;  2OCE A;  5FLX c;  5C0X I;  4IO9 A;  1MJC A;  2A19 A;  3STB C;  1IBK Q;  2CFM A;  4C3H H;  2WFW A;  4O2D A;  2UUC L;  3CC2 A;  2Y0S E;  3PUZ A;  3CME A;  1WYD A;  1X3E A;  1XNR Q;  2QGQ A;  4TVA B;  1L1O C;  2PI2 A;  3S1M H;  3JC6 6;  4YHH Q;  1Q81 C;  1S72 A;  1Q7Y C;  2HT1 A;  1A8V A;  3U4V A;  1VQ5 A;  4DV1 Q;  4A3D H;  1YEZ A;  1LM0 A;  5FLM H;  5C44 H;  4DV7 L;  2R92 G;  3RZO H;  4C3J H;  3S1N H;  1KRS A;  1BBW A;  1KL9 A;  4R4I A;  1L0W A;  1QVG A;  1MKH A;  1V43 A;  2IT1 A;  1QUQ B;  1XMQ Q;  1L1O A;  3FKI G;  4IFD J;  4P75 A;  1N36 L;  2N78 A;  2V1C C;  4WJ4 A;  1SE8 A;  4B3S L;  2OWO A;  1YNX A;  3HOV H;  2PMZ E;  4FDB A;  2N8N A;  2NN6 I;  3UE1 A;  4A3C G;  4MZ9 A;  3J81 j;  1PH2 A;  3GD7 A;  1N32 L;  4BBS H;  4LUZ A;  1E1T A;  3PUY A;  4DR1 Q;  3K81 C;  3GTO H;  1VS0 A;  2KHI A;  1I3Q H;  3EN2 A;  4QQB X;  2R93 G;  4JYA L;  3GO5 A;  4IPC A;  1CUK A;  4C2M H;  3CCR A;  4JV5 Q;  4DV5 L;  2Q2U A;  2JE6 I;  3NEM A;  3CW2 C;  4LF8 Q;  1UE5 A;  1M90 C;  1ASY A;  4L5R C;  1E22 A;  1AE2 A;  1TWG H;  2ZJP A;  3FHW A;  5LMU L;  1HNX Q;  4GKJ Q;  3KYH C;  2UXB Q;  4NXM Q;  1WJJ A;  3A0J A;  3E0E A;  2PQA A;  4YCV A;  4A3F G;  1VQN A;  2I0Q A;  5IT9 c;  2B63 G;  4BBR H;  4LF8 L;  4LNQ A;  3EIV A;  4X66 L;  1GD7 A;  4DAY B;  4BA2 I;  2MO1 A;  4IPG A;  1QVF A;  2UXC L;  4HJ8 A;  4HJ7 A;  1HZC A;  3PUW A;  4KLK A;  4X62 Q;  4A3K H;  4KHP L;  4UP9 A;  3U58 A;  4AQY Q;  3L7Z C;  3J80 c;  2JA9 A;  3J81 i;  1OXU A;  2CWA A;  2L15 A;  1SR3 A;  3E9H A;  1UEB A;  4GN4 B;  4OXP A;  4POF A;  4JI0 Q;  1UE6 A;  4LWC A;  2ZJR A;  4LFA L;  2JA8 G;  4IOC A;  5J3B A;  4JI2 Q;  3W1G A;  4P71 A;  3J7Z C;  4A3J H;  2YU9 H;  5LMN Q;  3CPW A;  4A3M H;  2K5N A;  1KXL A;  4DR7 Q;  1BVS A;  1IBM L;  2Z0S A;  1PH6 A;  1Q82 C;  4YWL A;  4A3I G;  1HNZ Q;  4X65 Q;  2GN5 A;  4A3G H;  3PUX A;  4X6A H;  3T1Y Q;  3DLL A;  2D0P A;  1VQ7 A;  1EWI A;  4OWW B;  1WI5 A;  4BA1 I;  2VL6 A;  3CP0 A;  3S17 H;  1VQP A;  4DR5 L;  5EAY A;  3PGZ A;  4X65 L;  4LF5 L;  3SGI A;  4LF6 Q;  4A3L H;  1YZ6 A;  1Z47 A;  1LTL A;  5IP9 G;  1XMO Q;  4DPG A;  4J15 A;  2NVT H;  1V9P A;  4RG1 A;  1SRU A;  3F2B A;  4LF7 Q;  3ERS X;  2CQO A;  4LF6 L;  1YI2 A;  1PHJ A;  3CCV A;  1BKB A;  4LFB L;  4Y7N H;  1L1O B;  1VQ6 A;  4A76 A;  2JEA I;  1EIF A;  1M1K C;  4B3R Q;  2JA5 G;  4ALP A;  3I4M G;  4NXN L;  2Q2T A;  3PUV A;  1AE3 A;  3BU2 A;  5JEA J;  5IYB G;  3K7U C;  1NY4 A;  3UDX A;  1XNQ L;  3G6E A;  4K0K Q;  1X6O A;  2YYZ A;  5GAE C;  3F1Z A;  1ASZ A;  1NJI C;  1CKN B;  4PMW A;  2QA4 A;  4DV0 L;  1PYS B;  1EYG A;  3S2H H;  3PF5 A;  4JC0 A;  4C3I H;  4JI1 Q;  3I4M H;  3HOU H;  3HOY H;  4BXX H;  4IOA A;  4K0K L;  5K36 G;  3PIP A;  1EFW A;  1HNW L;  1P16 A;  4IFD G;  1NMF A;  1LUZ A;  5IYD H;  3AQQ A;  4GKK Q;  1JT8 A;  5GQO A;  3L0O A;  4X64 Q;  2UU9 Q;  4HJA A;  2ZJQ A;  4GKJ L;  1AH9 A;  1PYB A;  4GLA C;  2PQA B;  3CMA A;  1CKO A;  4MNO A;  3M4O H;  5JJI A;  1IXR A;  2UUC Q;  3I4O A;  4X64 L;  1PH4 A;  2FXQ A;  4RMF A;  2RHQ B;  1WCM G;  2RF4 A;  4DR4 L;  4BXX G;  2VQF L;  3I4N G;  4A3E H;  4DKA C;  3G4S A;  1N34 L;  4JBJ A;  1Y1W H;  3HOW G;  1HJP A;  4DV7 Q;  2JEB I;  5E7N A;  5C3E G;  5M3M G;  3RN2 A;  3RNU A;  1Q86 C;  3F8T A;  5M3F H;  4JI5 Q;  1CKM A;  4LF4 L;  4DR3 L;  4O0A A;  3CCM A;  3PF4 A;  1DGS A;  4MTN A;  1N36 Q;  1K3R A;  1X54 A;  2ALY B;  2NZH A;  5LMN W;  2K75 A;  1C7Y A;  2ATW A;  3W5O A;  5ELO A;  3M9B A;  5BR8 L;  1GM5 A;  4B3S Q;  4JI5 L;  3KF8 B;  1SFO H;  1YIT A; 
#chains in the Genus database with same CATH topology
 5KNC A;  4OON A;  2QDB A;  1G29 1;  2YTV A;  4WFN 3;  1QE6 A;  1CQV A;  3S2D H;  2OQK A;  1UEA B;  2R92 H;  2L5T A;  5DM7 3;  4J6H A;  4FXK C;  4GNX B;  4DV5 Q;  1IW7 C;  2N3S A;  3LX0 A;  1MBY A;  4YWM A;  3GTQ H;  2L0C A;  3A54 A;  1TS2 A;  1KC8 C;  5FKA C;  3KJO A;  3U50 C;  1EY8 A;  2F4V L;  1CM9 A;  5JJL A;  1HR0 L;  1GUT A;  2R93 B;  3TZD A;  5H1S E;  2O5I C;  4KHP Q;  4A93 G;  5K5P A;  2L9H A;  1W6K A;  3J81 E;  5M5X B;  1UE1 A;  2X6G A;  1YVC A;  4RFB A;  3J7A 5;  1O7L A;  5EKI A;  1GOZ A;  3CD6 A;  1TVX A;  2OF1 A;  3N52 A;  2EJG C;  4XIG S;  2CH4 A;  1B70 B;  2IY5 B;  2VQE L;  5CV5 A;  3CC7 A;  3S14 B;  1X65 A;  4GNX C;  1K8A C;  3UDG A;  5C4H A;  1E24 A;  2JA8 H;  1W2B A;  1JJG A;  2UXD L;  2IJ0 A;  5LHY 1;  2LSS A;  3HRZ C;  2NBF A;  5GAH C;  1IL8 A;  5A2Q L;  2N49 A;  2WB1 G;  3UDF A;  3I72 A;  2I5H A;  4A3I H;  3HG9 A;  1W3S A;  1OXX K;  1KDC A;  1HXY D;  4OHJ A;  4UY8 C;  2N55 A;  3T53 B;  5AJ3 L;  3KFU A;  1VF5 C;  2PCF B;  4R4O A;  5M5W H;  4ME5 A;  4CJ2 C;  1KQS A;  2AMC B;  1Y8O B;  1VQA A;  4ULL A;  2ES2 A;  1VQJ A;  3F2D A;  1W6J A;  4CJ0 B;  4KKS A;  1PH8 A;  3M7N A;  3IAY A;  1EOV A;  2VNU D;  3D8G A;  3K80 C;  4BY7 G;  3VYU A;  5CV7 A;  2YV5 A;  1N33 L;  2D2C C;  3MHB A;  4GKJ Q;  1KHI A;  1TR5 A;  4OEL B;  1TS3 A;  4IAL A;  2Z9H A;  5IYB H;  2CHB D;  1NR2 A;  3OIP A;  3CXC A;  4HIM A;  3C1F A;  2B2T C;  1Y1V G;  3E3X A;  4IZ8 A;  1KNA A;  3FDT A;  1SNM A;  2E5L L;  1Q8K A;  2EY1 A;  3VDY A;  4KMU C;  1WCM B;  4HCE A;  4LF4 Q;  1EU4 A;  3I4N B;  4LJZ C;  3ULP A;  3H0G G;  3HOW B;  5BR8 Q;  5C3E B;  1XTD A;  3S15 B;  1TWH H;  3CQZ H;  4POG A;  3AFP A;  3HGB A;  3T1H L;  2A6E C;  1XTC D;  1PTO D;  4H44 C;  2KHJ A;  5M3M H;  3X3N A;  4YCU A;  1EU3 A;  4B3T Q;  2G9H D;  1TKW B;  4LFC Q;  1YJW A;  4A3D G;  4P73 A;  2PO4 A;  2MFI A;  2HIV A;  4LK1 C;  4APV A;  3MXU A;  2IX1 A;  1E3P A;  2Q2H A;  5IT9 E;  2A74 C;  2NVY H;  1IBK L;  3L9A X;  4UP8 A;  5G3L F;  3H3V I;  2EYM A;  1SNQ A;  2CCZ A;  1QZG A;  4X3U A;  1TWC B;  1BBX C;  1HQM C;  1PRT D;  3MFY A;  3PCO B;  4XYQ A;  4YHH L;  4G4K A;  4UAI A;  1EY6 A;  5IGG A;  4OWX B;  2IL8 A;  4R4Q A;  3PIP 3;  1AZP A;  4A93 B;  1TS5 A;  4R4C A;  1I50 H;  4LUV A;  3MVV A;  2L55 A;  3TEH B;  3HOX H;  3BS1 A;  2BH2 A;  4LUO A;  3M3Y B;  5CV8 A;  5IWA Q;  1V1P B;  3KDF A;  3U4Z A;  2V4D A;  4DV6 Q;  1BBU A;  4HJ5 A;  1F9P A;  4KHZ A;  4V0B A;  3QOJ A;  4AYB E;  5J22 A;  3V2T A;  3VR6 A;  2CVR A;  1PH7 A;  2MGS A;  1J5E L;  2KCM A;  5EQ0 A;  2AWN A;  1HNX L;  1X55 A;  3KK7 A;  4NMZ A;  2H5X A;  4YIJ A;  2K50 A;  1JOK A;  1B9M A;  4BWG B;  2SDF A;  4R1J A;  2WV6 D;  1E2V A;  3B6Y A;  2E2J B;  5JEA H;  2WB1 B;  1SNC A;  1TWF H;  3H3V H;  4B3M Q;  3PO3 H;  1Z9F A;  1ROD A;  1O7Y A;  1KTK A;  3S9W A;  1K8O A;  1LLR D;  5FLX L;  2R7Z G;  5CV9 A;  3MXN A;  3Q24 A;  4JI7 Q;  2GVA A;  2R7F A;  1GO3 E;  2LY7 A;  1QUQ A;  1D5Z C;  4OO1 I;  1PMR A;  1Y14 B;  1HR0 W;  1MSH A;  4DV3 L;  1HA5 A;  4BY7 B;  2F0K A;  3PO2 H;  5J39 A;  3T1Y L;  2F0Q A;  3GTG B;  3I73 A;  4HAE A;  4H7B A;  1B3A A;  4F88 A;  1MGS A;  2PI2 E;  2K01 A;  3K0X A;  2PNR C;  2A73 B;  3M7G A;  1S3O A;  2RSO A;  4FP5 D;  4C3I G;  4P74 A;  1EY9 A;  3RN5 A;  1Y1V B;  5IYD G;  2BH8 A;  1LT3 D;  1PTO H;  3OSO A;  3URY A;  1UAP A;  2LKV A;  1RCV D;  3DEP A;  1FJG Q;  1GHK A;  1STY A;  1SDF A;  1TY2 A;  4LMQ D;  2H4O A;  2KCT A;  3H0G B;  4RA8 A;  5EGT A;  3T16 A;  2NVQ H;  3HOZ H;  1TWA H;  1VQB A;  3CCJ A;  4IJL A;  3K5N A;  4K2L A;  4RAU C;  5CR3 A;  4ZCK A;  1N8R C;  4R9W A;  1FYC A;  4K6L A;  3CRL C;  3NEN A;  4OO1 H;  5C3W A;  3MEF A;  4JI8 Q;  3TP5 A;  2A68 C;  5FLX c;  5C0X I;  1AP0 A;  1NNX A;  1MJC A;  2A19 A;  1EZ6 A;  2CW0 D;  3N6R A;  4C3H H;  2WFW A;  3J7A V;  4A3D B;  3CC2 A;  3GTL B;  4ZQ3 A;  3PUZ A;  1WYD A;  3TDQ A;  1X3E A;  2HDL A;  2K05 A;  2QGQ A;  4TVA B;  1B1Z A;  5FLM H;  3K5O A;  1T5E A;  1KL9 A;  1MKH A;  1S5C D;  1XMQ Q;  4P75 A;  5C4X B;  4N9T A;  2KHS A;  3OIQ A;  1JOR A;  2I46 A;  3EQL C;  4B3S L;  3BYY B;  2PPB C;  4ZKB B;  3JAM E;  2F03 A;  2L1B A;  4FNF A;  3D4D A;  1MD2 D;  4LUZ A;  3NXW A;  3K81 C;  4DR1 Q;  3EN2 A;  1I3Q H;  2DJG C;  3GO5 A;  4ZUJ A;  1CUK A;  4C2M H;  3T4A C;  4DV5 L;  2N88 A;  2JE6 I;  3NEM A;  1SXT A;  4LF8 Q;  3P75 A;  1UE5 A;  1ASY A;  1E22 A;  2ZJP A;  1KLU D;  2KA7 A;  2UXB Q;  2EDG A;  1D5X C;  2PQA A;  4A3F G;  5C0X H;  2I0Q A;  4DN4 M;  1HQR D;  1D1K A;  4KHV A;  2RA4 A;  2MO1 A;  5DM6 3;  2B2V A;  3BVG A;  4KHP L;  3MEH A;  3BVZ A;  4R8N A;  1PTO F;  2G9D A;  1OXU A;  1VMP A;  1UE6 A;  2K5D A;  1B44 D;  2ZJR A;  4HMI A;  4WJW A;  3W1G A;  3AU7 A;  5LMN Q;  2R7Z B;  3H94 A;  4DR7 Q;  1C48 A;  1JWM D;  4YWL A;  3FMC A;  4HSP A;  4A3G H;  3KBX A;  5CV4 A;  4OWW B;  3NBI A;  4BA1 I;  1YNN C;  2VL6 A;  4DA2 A;  1O80 A;  2J4X A;  3SGI A;  4DXG A;  1V1O A;  2B2W A;  1G2S A;  2ZXP A;  5C4Z A;  1LTL A;  1B2T A;  5FO8 B;  1V9P A;  1STH A;  2PZW A;  4LF7 Q;  3ERS X;  1PDQ A;  1BKB A;  4Y7N H;  1DCZ A;  3IFD A;  4QF4 A;  4C3I B;  4ALP A;  5EPJ A;  5A2Q E;  2Q2T A;  3D4W A;  3I4M G;  1AE3 A;  1NY4 A;  3UDX A;  4FXD A;  1BXT A;  1ASZ A;  3WOF A;  1NJI C;  3MC0 B;  1EYG A;  1Z7T A;  1IYV A;  4JI1 Q;  3HOY H;  1D5M C;  2EYO A;  2SEB D;  3OMC A;  1NMF A;  1LUZ A;  5JAV A;  4GKK Q;  3GQB A;  3L0O A;  4X64 Q;  2UU9 Q;  4GKJ L;  1PYB A;  3E0J A;  4IUQ A;  4MNO A;  3M4O H;  3NWT A;  1QOH A;  1AN8 A;  3I4O A;  3EFX D;  5DNF A;  1U4P A;  1HCZ A;  5E3F A;  3C46 A;  1Y1W H;  1HJP A;  4DV7 Q;  2EVB A;  3F8T A;  2QEJ C;  5M3F H;  4JI5 Q;  4LF4 L;  1EOT A;  2IPK D;  1DGS A;  3G7L A;  1K3R A;  2PZU A;  2K75 A;  5BR8 L;  5ELB A;  1GM5 A;  3W2D A;  1VQ9 A;  1SFO H;  1YIT A;  1MHW C;  1C0A A;  3G6J B;  2RBM A;  4QUF A;  2LS0 1;  3G71 A;  3MFG A;  1EIG A;  2AUJ D;  1JOQ A;  2D0O A;  1F2L A;  1EYC A;  4FXG C;  4KTA A;  3WOE A;  4LFC L;  4P72 A;  4EQ5 A;  2RCN A;  1DOL A;  5HGT A;  5BN5 A;  1O78 A;  1KDB A;  4RCO A;  2RDG A;  3SHL A;  4FVM A;  5C6A A;  2IX0 A;  3KLW A;  1ZYR D;  5CMD A;  4A3F B;  2KCN A;  4XT3 B;  3U9S A;  4EVO A;  3GTK H;  3A55 A;  2XWJ B;  3I8Z A;  2QEX A;  3GTJ H;  3RZD B;  3CAM A;  2JXM B;  2K03 A;  2JA7 G;  1ENF A;  2WAC A;  3K0Y A;  2B63 H;  1K0R A;  2TMP A;  4UHV A;  2MUY A;  5IWA L;  2PW7 A;  3F2U A;  2XIW A;  5E4W C;  4JI4 L;  1PFS A;  5M5Y B;  4DV6 L;  3ND9 A;  1B4O A;  4EQO A;  3P20 A;  1NAP A;  4OX9 L;  2K5Q A;  3SDZ A;  2F3V A;  2HQL A;  1VQK A;  4DR5 Q;  4LF5 Q;  2EYL A;  3ULL A;  3ULJ A;  1HZ9 A;  3AFQ A;  5CBA E;  1VDZ A;  4EQN A;  2ZXO A;  1SEB D;  1PFB A;  3MTS A;  2VB3 X;  2QIL A;  1FNW A;  1CQF A;  3TRZ A;  3QJY A;  1S4Z A;  1T9H A;  2XGT A;  4R4T A;  2MHV A;  4K8I A;  3PSI A;  1RTN A;  1UUP A;  1A15 A;  4B3M L;  1UNS A;  2O4X A;  1A62 A;  1JCK B;  3BDL A;  1I6H B;  1SJE D;  5HY6 A;  3TME A;  1YJN A;  1VQO A;  3PIO A;  1GUG A;  3GP7 A;  4DV0 Q;  4JI7 L;  4KV6 A;  1LTT D;  3TQY A;  1J9O A;  1IKM A;  4NPS A;  3I4M B;  3KLS X;  2KEN A;  1BCP B;  5IGC A;  5KIX A;  1BO0 A;  2OTJ A;  3L2P A;  3CF5 A;  2EXD A;  4JW0 A;  1SAP A;  1WFQ A;  1JQY D;  2E74 C;  3I90 A;  5FLX E;  2JA5 H;  5ISR A;  1VQG A;  3NQT A;  4TSS A;  1SYD A;  2EZV A;  3H15 A;  1R9T H;  3NK9 A;  1QZH A;  4DR4 Q;  1KNE A;  1OXV A;  5BN4 A;  5JOB A;  5K36 H;  2ID0 A;  1VQ4 A;  1F9R A;  2NVX H;  1FD7 D;  3GTP H;  1XYI A;  4K2K A;  2NTT A;  1HZA A;  2A1A A;  4MIU A;  2M00 A;  2EYP A;  2MPM A;  1CHQ D;  3KDF B;  3A56 A;  3S16 B;  1CFM A;  1EWC A;  1J6Q A;  1HUM A;  4GOP A;  1IZ6 A;  1VCI A;  2EXZ A;  2K04 A;  1WTP A;  2E2H B;  1E7Z A;  4FF4 A;  4UPA A;  1NUC A;  4PMB A;  1FJG L;  2C5C A;  1TQO A;  2YTY A;  3EA6 A;  1S40 A;  1H9J A;  4KN7 C;  2NTS A;  3DM3 A;  1PRT B;  3H0G H;  1BCP C;  1WTV A;  4PMC A;  1XPO A;  4JBW A;  3D4R A;  1RD9 D;  4F8M A;  3FKI B;  5ELF A;  2OT2 A;  3KBG A;  2I5L X;  3QG1 A;  4KKT A;  4C3J G;  5CGK A;  5I4D A;  3PV0 A;  4JI8 L;  3M4P A;  5JPN C;  2JA6 H;  5JJK A;  1EY7 A;  3OTO Q;  4IJH A;  1D2B A;  3FVQ A;  3HFZ B;  2WKD A;  3MXN B;  4QMG A;  3PQI A;  3GTL H;  1E1O A;  4DV2 Q;  5CC4 A;  4BBS G;  5FJ8 H;  1JB7 A;  2Z6K A;  1YHA A;  4ZKC B;  2RSN A;  4G7Z C;  1K83 H;  2Z4H A;  2ZTE A;  5JVG 3;  3C2P A;  3SR1 A;  5IYC H;  3K59 A;  1Z6H A;  4UDU C;  3TS0 A;  1XMQ L;  3ZJY C;  5C4X H;  2VY3 A;  3K6O A;  5I9O A;  1PRT C;  3TS2 A;  1SLJ A;  1G2T A;  1YBY A;  3R2T A;  1SN8 A;  4BBR G;  3KJP A;  2JA7 B;  2VUM H;  1ILP A;  4A3K G;  1IL2 A;  1LTB D;  4DR1 L;  3WDN A;  3JAM c;  4V19 0;  1SSO A;  1Q90 A;  1XX8 A;  2B3G A;  2XVS A;  1Q3L A;  1EQR A;  1B3Q A;  1HFN A;  3GDE A;  1HHV A;  5COY A;  2UXB L;  3L3O C;  3RR5 A;  4A3J G;  4DV4 Q;  1I94 Q;  4A3M G;  2K52 A;  1O7Z A;  2GVB A;  2NYZ D;  3NBH A;  1IBL Q;  4L8J A;  3Q8D A;  1Q1E A;  1H95 A;  4E6I A;  3K7A H;  2NN6 G;  4DAV A;  1WTQ A;  2DGY A;  4HJ9 A;  2WB1 E;  1B8A A;  5D14 A;  4OEM B;  1FL0 A;  1MJE A;  3AMU A;  5LMN L;  2D62 A;  4DK6 C;  2R7Z H;  4DR7 L;  2XWB B;  2L4N A;  1DYQ A;  1EQV A;  4DR6 Q;  4BY1 H;  4KY6 A;  3OOC A;  3LGJ A;  3S1Q B;  1WTX A;  3IRB A;  3C3L A;  2BE5 C;  2Z1C A;  1VQF A;  5ELD A;  2XSC A;  2F0W A;  4N8F A;  2XNA C;  4XXE A;  5C4J B;  3NP8 A;  3TN2 A;  3D3R A;  1KLG D;  1Q8I A;  2Q2I A;  3ICE A;  2GA4 B;  3T51 B;  3NTH A;  1SYF A;  2PZT A;  4X3S A;  4QUC A;  1NMG A;  2A8V A;  3WWV A;  1PH9 A;  2EQS A;  2C35 B;  4LF7 L;  2Z4I A;  1JOO A;  1VQH A;  1XJV A;  4A3B H;  4DUY Q;  1I4Q A;  5IP7 H;  3M85 A;  2JYO A;  3VR3 A;  5L37 A;  2D9U A;  3BVM A;  3KOJ A;  4JI1 L;  4A3E G;  2JJQ A;  3FPP A;  1TT2 A;  3TBI B;  1PH3 A;  1K8G A;  4GKK L;  2QF7 A;  1G6Z A;  2Y0S G;  1EFI D;  1SNO A;  2UU9 L;  1IHZ A;  2OCE A;  2QDL A;  1GUO A;  2CFM A;  4U67 3;  1AZQ A;  3S1N B;  4C3J B;  2Y0S E;  3PIO 3;  1K8M A;  4G7H C;  1Q81 C;  1S72 A;  2BDN A;  1A8V A;  3GTM B;  2R92 G;  5C44 H;  4DV7 L;  2EYF A;  2PMZ B;  1SYE A;  1U9R A;  1V43 A;  2CW0 C;  4IUT A;  1L1O A;  3P7J A;  4BBS B;  3GTO B;  2N78 A;  3SVM A;  1SE8 A;  4G57 A;  3HOV H;  4KY5 A;  1PH2 A;  2RQX A;  1XXG A;  1II3 A;  3Q22 A;  1E1T A;  5KYI A;  4M8A A;  1VS0 A;  4ILW A;  2MJ8 A;  4IPC A;  4JV5 Q;  1STB A;  2Q2U A;  4BBR B;  3CW2 C;  2A69 D;  3DM1 A;  2B2V C;  1M90 C;  1TWG H;  3FHW A;  3KYH C;  2CH4 W;  4A3K B;  1WJJ A;  3CU7 A;  1I4G A;  1ONL A;  1HTL D;  4BA2 I;  4X62 Q;  2HDM A;  4QCL A;  4F7X A;  2FFK B;  2QW7 A;  2L15 A;  4A3M B;  4GN4 B;  4POF A;  4LWC A;  1X32 A;  3ONA B;  2JA8 G;  1QCB D;  5J3B A;  1Y8P B;  1JB3 A;  2YU9 H;  1SE4 A;  3QR8 A;  2FJ2 A;  2K32 A;  2M2L A;  2K5N A;  3KLR A;  2HQE A;  3KF8 A;  3HZX A;  3S17 B;  2B2W C;  4A3I G;  1HNZ Q;  2F0N A;  4X65 Q;  1SYC A;  2F1M A;  1QNK A;  1H9R A;  2Q8T A;  3DLL A;  1EWI A;  1ESF A;  1SND A;  2SNS A;  4C1N K;  3CP0 A;  2JP1 A;  1VQP A;  4DR5 L;  4LF5 L;  5T1G A;  4LF6 Q;  4A3L H;  3A8K E;  1YZ6 A;  1J8I A;  4MN3 A;  2OXP A;  1LTI D;  2NVT H;  3DWP A;  1SRU A;  1YI2 A;  4IQZ A;  5KYL A;  1MSG A;  4A76 A;  2JEA I;  3H6M A;  3BYT B;  4B3R Q;  2E2D C;  3PUV A;  5JEA J;  5IYB G;  4K0K Q;  2F0V A;  1IKL A;  3G6E A;  1X6O A;  4DV0 L;  2QA4 A;  4WRD A;  3S2H H;  1SYB A;  4JC0 A;  1TS4 A;  4X3T A;  3HOU H;  3I4M H;  1RHP A;  1X3P A;  1EFW A;  2HUG A;  1JT8 A;  3IKJ A;  1BUV T;  3AQQ A;  5GQO A;  1WTR A;  3CMA A;  1CKO A;  1MI2 A;  4A3E B;  4FO2 A;  3VR2 A;  1C8C A;  1PH4 A;  3AB9 A;  2Y0S B;  2WKC A;  2RF4 A;  4DR4 L;  3S1M B;  1DXM A;  1GUW A;  4B9X A;  1Q86 C;  5M3M G;  3RNU A;  4KKU A;  3TP8 A;  1CKM A;  2LMC B;  4DFA A;  4XQN A;  5J1Z A;  3S2D B;  1N36 Q;  1EEF D;  5LMN W;  2ALY B;  1C7Y A;  2R92 B;  3W5O A;  1Y8N B;  3HP3 A;  1KDA A;  5GAG C;  3GTQ B;  1CSQ A;  1S5D D;  1GXD C;  1PLF A;  4GZY C;  2NB0 A;  2EIF A;  2B29 A;  2B2Y A;  5IGF A;  1A3T A;  4PZ8 A;  2JSO A;  1KAW A;  3FKI H;  2B8G A;  1CKN A;  3G48 A;  2KBN A;  4OWT B;  2KCC A;  4A3C H;  1D1I A;  4A4I A;  3NSW A;  4R8I A;  3OTO L;  3HOX G;  5IGB A;  1EQQ A;  1S5E D;  2R93 H;  3J80 i;  4JK1 C;  4DV2 L;  3I2Z A;  3T13 A;  1PA6 A;  1HZB A;  1LT4 D;  3S24 A;  1SMY C;  2MP1 A;  2EE1 A;  3NTI A;  1JMC A;  1EUJ A;  4H13 C;  5ELE A;  4HTH A;  2F3W A;  4K5X A;  5M5X H;  1YHQ A;  2K14 A;  1IBM Q;  5CYU A;  1ZYR C;  2R6G A;  4YCW A;  4CBV A;  5JVH 3;  2JA8 B;  2NZO A;  1B9N A;  5JEA G;  4RHS A;  4ZYS A;  4LW1 A;  4ZUI A;  3PO3 G;  1AEX A;  4DK3 C;  4JCV E;  4A3I B;  4KJN A;  3CCQ A;  1ESR A;  3S14 H;  1EL0 A;  4IFD I;  4GOP B;  4QY7 A;  4IN3 A;  5M5W B;  3A74 A;  4DV4 L;  4Q0F A;  1I94 L;  1F2M A;  1WOC A;  4LFB Q;  4FYD A;  2RDF A;  4MTK A;  3E5S A;  5I6W A;  1IBL L;  3A8I E;  5C0X J;  4NXN Q;  1BQQ T;  2BDO A;  1LTG D;  1MIU A;  1P8L A;  3F2C A;  5IP9 H;  3PO2 G;  4NDX A;  1U4R A;  2VB2 X;  4YWK A;  1A0I A;  1DOK A;  2DY7 A;  1TXY A;  4DNR B;  4HIO A;  4EGV A;  1WTO A;  2A6H D;  1TU2 B;  4NP5 A;  2O5J C;  1V1P A;  1GVP A;  1NTG A;  4DR6 L;  2IHE A;  4XDX A;  1EY0 A;  4U68 A;  1H9M A;  3CPF A;  5EKK A;  1GUS A;  3MWY W;  3HKS A;  4GOP C;  1ENC A;  3I4L A;  4IFD H;  1KAA A;  2PQE A;  4GS3 A;  3HOZ G;  2ZTC A;  2XRS D;  2JK8 A;  4KI0 A;  3CQZ B;  1ZEQ X;  4DR3 Q;  1CT1 D;  5DLQ E;  4QIW B;  4A75 A;  1F2Y A;  2X69 A;  4OO1 G;  2F0U A;  1JJC B;  2ICI A;  1LT6 D;  5M3M B;  1PVO A;  5C5M A;  3CCU A;  4GLV B;  1WCM H;  4BXX H;  4QB4 A;  5DEH A;  1BOS A;  2PNH A;  4DUY L;  3I4N H;  1D6E C;  3C1E A;  4PNY A;  3CCL A;  4C3H G;  3CCS A;  3MAQ A;  2AWO A;  3HOW H;  4JI3 Q;  4L63 B;  5C3E H;  3S15 H;  4K6D A;  2P5Z X;  4ME3 A;  1EIY B;  2NVY B;  5D3D A;  2DNC A;  2NZ1 D;  3K58 A;  2K7V A;  4P2C B;  5FLM G;  2DN8 A;  4JI6 Q;  4DR2 Q;  4DUZ Q;  2EY5 A;  4ODG A;  2KEC A;  3NBH B;  2MQH A;  4B3T L;  1FGU A;  4PQX A;  4Q5V A;  2Z6K C;  4JOI A;  1TII D;  2CWP A;  5IY0 A;  2EOT A;  3NWS A;  1G6P A;  3SXH A;  1I50 B;  2EPB A;  4MHE A;  1WD0 A;  2RCF A;  3NEL A;  3ER0 A;  3LNN A;  1FVI A;  2AKW B;  2E75 C;  2F52 A;  3HOX B;  2VW9 A;  1E2Z A;  2R3Z A;  5FK9 C;  4LF9 Q;  3GTM H;  1C4Q A;  4JBM A;  1TWC H;  4Y52 H;  1GUN A;  1OO9 B;  4GN5 A;  4EQP A;  2F3I A;  4N8X 1;  1Q1B A;  1FNU A;  1K73 C;  4FF3 A;  4A93 H;  1QIL A;  4CKE A;  1NCV A;  5JPM C;  5C0X G;  1YIJ A;  1J5E Q;  3DMU A;  1DM0 B;  3QWN A;  1VQE A;  3M3Y H;  5E1F A;  1CTM A;  3D0F A;  2J0T D;  5C3X A;  4M1U B;  3KUP A;  3QB3 A;  4JV5 L;  2DY8 A;  1PV4 A;  4IUV A;  3DUZ A;  4AIM A;  1TWF B;  1JJ2 A;  3PO3 B;  1SRO A;  3EJI A;  3R2I A;  4DAP A;  4CKC A;  3CHB D;  4YY3 Q;  2X6L A;  2B2U A;  3D6C A;  4X62 L;  3M4Y A;  4A3G G;  2E2J H;  3E6Z X;  1C9O A;  4NKL A;  2EYJ A;  1HUN A;  3GV3 A;  4L5S A;  4S3S A;  4CJ1 B;  4XYO A;  1RF2 D;  3OYY A;  4DV3 Q;  3QO2 A;  4PV1 C;  3VA5 A;  3ND8 A;  2WII B;  3H91 A;  3PO2 B;  3SK8 A;  5IOC A;  4G7O C;  2UUB Q;  4J1M A;  3RLF A;  2AQ1 B;  3KF6 A;  1HNZ L;  1QWY A;  1L2F A;  1EY4 A;  2KUM A;  1S5B D;  5KNB A;  4XQJ A;  1U4L A;  3TRE A;  5I2X A;  3FP9 A;  2F0E A;  4L5T A;  3H3V C;  4PG3 A;  4BY7 H;  1SMX A;  1OXS C;  1STE A;  2HHH Q;  1PTO B;  3I70 A;  2BOS A;  2FIN B;  1L0X B;  2VZA A;  1K9M C;  3GTG H;  3HOY G;  1PH1 A;  1CA6 A;  4ZAI A;  1KRT A;  2OQ0 A;  2NVQ B;  4JG2 A;  2K4K A;  3HOZ B;  1TWA B;  2JQO A;  4EX5 A;  3S1R B;  5LL6 S;  5LL6 X;  4B3R L;  4K8J A;  2HIX A;  1Y1V H;  3PMF A;  1RDP D;  2ZM6 Q;  3TZU A;  3STB D;  4I7A A;  2IX3 A;  4CKB A;  1STN A;  1PFM A;  2UUA Q;  1VQ8 A;  3MXP A;  4C3H B;  3J80 L;  1RIP A;  5IE8 A;  1Y1W G;  1HRJ A;  2AHO B;  1VQI A;  1CZG A;  5FO9 B;  5M3F G;  5KEE A;  3NE5 B;  3EVQ A;  1HA6 A;  1ICF B;  3FEW X;  4JVZ A;  1X3Q A;  3ERQ A;  1CA5 A;  2F0O A;  1M4V A;  1XNR Q;  1L1O C;  3BG3 A;  2PI2 A;  1PTO C;  3S1M H;  1Q7Y C;  3U4V A;  3LWU A;  2Z6B A;  2ZT9 C;  3NPP A;  4CGY B;  4DV1 Q;  1YEZ A;  4A3D H;  2PYK A;  1PZK D;  3RMH A;  1QVG A;  2IT1 A;  2J7Z A;  1QUQ B;  1DJR D;  3DWQ A;  1N36 L;  1I3Q B;  2V1C C;  1BDO A;  4C2M B;  1PFN A;  4XT1 B;  2PMZ E;  1L0Y B;  2N8N A;  4FDB A;  4KD4 A;  2Q8I B;  3UE1 A;  1M8A A;  1I4R A;  5F2D A;  4RGN A;  3T56 B;  2E2I B;  5D3I B;  1JC7 A;  3R8B A;  2F0T A;  4L5R C;  1AE2 A;  4NXM Q;  3A0J A;  3E0E A;  4YCV A;  1LTA D;  2LFN A;  4NW2 A;  2B63 G;  4LF8 L;  4LNQ A;  4KN4 C;  5DAU A;  1QVF A;  1WTH A;  3PUW A;  2K5W A;  2NWG A;  4UP9 A;  5BN3 A;  3U58 A;  4AQY Q;  3L7Z C;  3J80 c;  2JA9 A;  3J81 i;  2A69 C;  3BDO A;  1SR3 A;  1UEB A;  2KOL A;  4JI0 Q;  2KJX A;  3K57 A;  4IOC A;  5KND A;  5AFW A;  4JI2 Q;  4P71 A;  1QG7 A;  3J7Z C;  4A3G B;  1PZJ D;  3CPW A;  1KXL A;  3OMG A;  5HUR A;  1BVS A;  4IUU A;  1IBM L;  2K33 A;  4C1N I;  1YNJ D;  2F0S A;  2EY6 A;  1EZ8 A;  5M9O A;  4X6A H;  3PUX A;  1VQ7 A;  1DOM A;  2D0P A;  4ID6 A;  1WI5 A;  1Y69 U;  2RDH A;  3K5M A;  5EAY A;  1LAB A;  3PGZ A;  1RJT A;  4Y7N B;  4HR7 B;  2DNE A;  1XMO Q;  2D5D A;  3J7A F;  4J15 A;  1ET9 A;  3F2B A;  5IGE A;  2CQO A;  3SK4 A;  1PHJ A;  3CCV A;  3BZD B;  4CDD C;  4LFB L;  4RHR A;  1H9S A;  2F4I A;  1QNU A;  1A3U A;  2JA5 G;  3W3A A;  4NXN L;  3HOY B;  3K7U C;  4DAY A;  3VR5 A;  4RKB A;  3F1Z A;  2G5D A;  1CKN B;  4PMW A;  4K5V A;  1PYS B;  4C3I H;  1STG A;  4ZLT F;  5NUC A;  3M4O B;  4IOA A;  5K36 G;  2WIN B;  3IFT A;  5IYD H;  1I4H A;  3SE0 A;  2ZJQ A;  1AH9 A;  2AUK A;  4GLA C;  2PQA B;  2A5H A;  3TP6 A;  5JJI A;  1Y1W B;  4FF1 A;  2UUC Q;  4X64 L;  5IOD A;  5M3F B;  1BCP D;  1DON A;  3OPO A;  4FF2 A;  3DXJ C;  3G4S A;  1WVL A;  4JBJ A;  4WOR A;  1AFP A;  3RZO B;  2JEB I;  5E7N A;  1SFO B;  4DR3 L;  1IW7 D;  4O0A A;  2EJM A;  3PF4 A;  4MTN A;  2B2Y C;  1X54 A;  2NZH A;  2ATW A;  3DEO A;  1G8Z D;  3M9B A;  4JI5 L;  2OEO A;  1LO5 D;  2JA6 G;  4KD3 A;  2R7D A;  1N32 Q;  1WD1 A;  3DWA A;  3U9O A;  3Q23 A;  2I07 B;  4JI3 L;  4JYA Q;  4IPH A;  2F0L A;  2IHF A;  2XTI A;  1LTR D;  5FJ8 G;  5LMU Q;  4JI6 L;  4DR2 L;  4DUZ L;  2KVM A;  1VF7 A;  2Q8R E;  5IYC G;  1DZ1 A;  3D31 A;  4X66 Q;  1PZI D;  2L11 A;  3GTK B;  3HKZ G;  5EBD A;  4ABN A;  2AQ3 B;  4QGU A;  2UXC Q;  5C4X G;  1JWU D;  5IIF A;  1X3F A;  1OXT A;  4J8Q A;  3GTJ B;  5E4X A;  1NBW A;  4RWS C;  3GV6 A;  2B63 B;  2F0G A;  5FO7 B;  2VUM G;  3P1H A;  4AYB G;  1GJX A;  3O13 A;  3HKZ E;  2F0P A;  1F77 A;  4LFA Q;  3EBE A;  1VQM A;  4JI4 Q;  4LF9 L;  3BZK A;  4A3J B;  4A3F H;  1X3G A;  1N9W A;  1VQD A;  4OX9 Q;  3AYH B;  3NQI A;  3BJU A;  5I2Y A;  1XPR A;  1SJH D;  1YHB A;  2F0J A;  1A63 A;  1G91 A;  2HD3 A;  1EEI D;  5T1I A;  2ZXR A;  3RZD H;  3IL8 A;  5D65 A;  5FOB B;  2FHT A;  1PH5 A;  2VXW A;  2E76 C;  5M5Y H;  2JN4 A;  2WP8 J;  2VS1 A;  2LXJ A;  5CBE E;  4GNX A;  4TQU S;  1K0S A;  4UP7 A;  2CKZ B;  2LXK A;  4QL5 A;  4HED A;  2L12 A;  1PYW D;  5IGD A;  1V1Q A;  2BE5 D;  4YY3 L;  1JR0 D;  3NHH A;  4BY1 G;  1LV9 A;  2KED A;  4JBK A;  1XNQ Q;  1D7Q A;  4RGM A;  1E0B A;  1OTC A;  5KRU A;  2BA1 A;  1LTS D;  3UE0 A;  1FGB D;  4L5Q A;  2JA5 B;  1I6H H;  1G51 A;  3RLN A;  2RVL A;  4LAA A;  2SOB A;  1HNW Q;  3BDC A;  1R9T B;  4N9P A;  5C5L A;  3MA2 B;  3M4Q A;  2XRQ D;  4QJF A;  3A7L A;  4OGQ C;  2UUB L;  3ERO A;  1CSP A;  4XTC S;  4AH6 A;  2K28 A;  3V96 A;  3GTP B;  2NVX B;  2ICE C;  2F0I A;  4A3B G;  4CDC C;  2TSS A;  1NE3 A;  1EY5 A;  2WAQ G;  4NB3 A;  2VQF Q;  4ZRZ A;  3Q6S A;  3VA7 A;  5IP7 G;  3NUC A;  4CDF C;  2A6H C;  2A6E D;  1N34 Q;  1X56 A;  2HHH L;  5COR A;  1XWE A;  5JJZ A;  1HTP A;  3OW2 A;  4RCN A;  1XPU A;  2WAQ E;  4GN3 B;  5CV6 A;  1YJ9 A;  2K5H A;  2B2T A;  1F2Z A;  3A5U A;  2EYH A;  3OWE B;  3CC4 A;  2DUD A;  2BA0 A;  5GRO A;  3S1R H;  3S16 H;  1LAC A;  4QIW E;  3FPU B;  1IYU A;  1E2W A;  4IPD A;  2ZM6 L;  3I55 A;  4OL7 A;  3SEB A;  2E2H H;  2C9O A;  1EWH A;  2JA6 B;  4JOI C;  2UUA L;  1SBB B;  5GAD C;  4K14 A;  2YTX A;  3FRP B;  2F4V Q;  1B53 A;  4I7Z C;  1HR0 Q;  5C44 G;  3J81 L;  1K28 A;  4H02 A;  4WJ3 M;  3I7F A;  1IYJ B;  4PZ7 A;  4HN7 A;  4DNI A;  1QB5 D;  3Q0A A;  1UE7 A;  1KIX A;  5HGQ A;  1K83 B;  3HOV G;  1QJO A;  1A2U A;  3J80 E;  1XNR L;  1EYD A;  4PZ6 A;  1U5K A;  3HKZ B;  2Z8L A;  1GKH A;  3QIA A;  2I5M X;  3MXG A;  4DV1 L;  4K5W A;  1R4P B;  3KF6 B;  2IWH A;  2VUM B;  2F0D A;  1O7I A;  4AYB B;  4HID A;  4L6T B;  3VR4 A;  1UWV A;  1CZW A;  1QVC A;  5A35 A;  3JAM i;  3NTK A;  2ZTD A;  1I5F A;  2CQA A;  3VYT A;  1ZXT A;  1VQL A;  2VQE Q;  2K5V A;  2MNA A;  5KGU A;  2B8F A;  1CHP D;  1PXU A;  1BCP F;  1D8L A;  2UXD Q;  1LYL A;  2E2I H;  2MO0 A;  2ENB A;  2JA7 H;  2OTL A;  3VYS A;  1NR4 A;  2B2U C;  3RLO A;  1U0L A;  1A2T A;  2ASB A;  3CCE A;  4NXM L;  4DF7 A;  4B08 A;  3K7A B;  5EPK A;  3DHQ A;  1HPC A;  5EBC A;  3HS0 C;  3ZYY X;  5AJ3 Q;  1FR3 A;  4AQY L;  1Q46 A;  4HIK A;  3AEV A;  1BF4 A;  3J81 c;  2M9V A;  3UDI A;  4JI0 L;  1DD2 A;  4F87 A;  4DK1 A;  3A5Z B;  2SNM A;  4BY1 B;  3E9I A;  4JI2 L;  2E8G A;  4DK0 A;  1A3V A;  1JE4 A;  4A3L G;  4DU9 A;  3A8J E;  3W1B A;  1N33 Q;  3MZ5 A;  1CK1 A;  3V05 A;  1ENA A;  1PRT F;  1ZKO A;  3I56 A;  1B7Y B;  1VQC A;  5ELN A;  4X3K A;  1SYG A;  1V8Q A;  1SNP A;  4TRD A;  1I6V C;  3S1Q H;  3H09 A;  2E5L Q;  1JE5 A;  1XMO L;  4A3B B;  2RHS B;  4DAM A;  3RUZ A;  5C4J H;  1X9N A;  2QKI C;  2WAQ B;  3HOU G;  4GLX A;  1CI3 M;  5I6Y A;  4IUN A;  3K8A A;  3R3O A;  4CHT B;  4DNT B;  3I3C A;  1B50 A;  1TWH B;  3D6W A;  1RTO A;  1Q12 A;  3T1H Q;  1KD1 C;  2A68 D;  4OIK A;  1RL2 A;  3TSS A;  5IT9 L;  1U4M A;  2K1B A;  3BZC A;  1H9K A;  1HH2 P;  3K5L A;  2IW3 A;  1ML0 D;  4IO9 A;  3STB C;  1IBK Q;  1SE2 A;  2F0H A;  4O42 A;  3VYR A;  4O2D A;  5C44 B;  2UUC L;  3CME A;  2F0M A;  4IUR A;  1LT5 D;  2O2L D;  3JC6 6;  4YHH Q;  2HT1 A;  1RKN A;  2R61 A;  1VQ5 A;  1EIH A;  3R93 A;  1LM0 A;  3S1N H;  1I4X A;  4C3J H;  3RZO H;  1ICW A;  3HOV B;  1KRS A;  3OHX C;  1BBW A;  4R4I A;  1L0W A;  5TSS A;  4IFD J;  3FKI G;  2FMM A;  1JIC A;  4XQQ A;  3RD4 A;  2F0F A;  4HSV A;  4WJ4 A;  3SK6 A;  4KJO A;  4BS9 A;  2OWO A;  1YNX A;  1JWS D;  2KEE A;  2NN6 I;  4A3C G;  4HCS A;  4MZ9 A;  3J81 j;  3GD7 A;  1N32 L;  1TWG B;  4BBS H;  2DJF C;  3PUY A;  3GTO H;  4QQB X;  2KHI A;  2R93 G;  3OW7 A;  2QCP X;  4JYA L;  1R4Q B;  3CCR A;  1SMY D;  4I65 A;  4HMJ A;  3I91 A;  2FMC A;  3SK5 A;  2HCI A;  1HNX Q;  1ILQ A;  5LMU L;  4O1N A;  3LWE A;  1H9S B;  5EPL A;  3OWF A;  1F9S A;  1VQN A;  5ELC A;  5IT9 c;  4BBR H;  5I9P A;  3EIV A;  4X66 L;  1GD7 A;  4DAY B;  4IPG A;  2UXC L;  4HJ8 A;  4HJ7 A;  1HZC A;  4KLK A;  4A3K H;  1AW7 A;  2H1E A;  2YU9 B;  2CWA A;  4OXP A;  3E9H A;  5EJW A;  1VMC A;  4LFA L;  1YNN D;  4KK7 A;  1S5F D;  4A3J H;  1I4P A;  4A3M H;  4DXF A;  2AQ2 B;  4KY7 A;  2Z0S A;  1PH6 A;  1Q82 C;  1WTW A;  1BNZ A;  2GN5 A;  2NN6 H;  3ITP A;  3KLS A;  3T1Y Q;  2KQ3 A;  1TY0 A;  4C56 C;  2NVT B;  4JPB W;  3TP7 A;  2NUC A;  3S17 H;  2K6A A;  4X65 L;  1A6X A;  1Z47 A;  5IP9 G;  2RKS A;  1K3B C;  4DPG A;  1YNJ C;  4B9W A;  2EJF C;  4RG1 A;  1ET6 A;  1KAB A;  4Z9C B;  4LF6 L;  3CKI B;  1NSN S;  3CRK C;  4RH6 A;  1L1O B;  2HCC A;  1VQ6 A;  1F9Q A;  1SE3 A;  1EIF A;  3S2H B;  1M1K C;  4ZK9 B;  1STA A;  5G3L D;  3HOU B;  3BU2 A;  1XNQ L;  4RGO S;  2YYZ A;  5GAE C;  1FNV A;  3PF5 A;  2BCO A;  2XN9 C;  4K0K L;  5EKL A;  3PIP A;  1EQT A;  1HNW L;  1P16 A;  4IFD G;  3X3M A;  3QOL A;  4HJA A;  2EY2 A;  2PW5 A;  3J7Y W;  1IXR A;  1GHJ A;  4CDE C;  2FXQ A;  3A7A B;  4RMF A;  4OIJ A;  2RHQ B;  1WCM G;  4BXX G;  2VQF L;  3HEJ A;  4IUP A;  3I4N G;  2B39 A;  4A3E H;  4DKA C;  4H0L C;  3JAM L;  1N34 L;  4TKO B;  1EYA A;  3HOW G;  5C3E G;  3RN2 A;  1HFG A;  4RGT A;  1T5X D;  3CCM A;  1BR9 A;  5ELO A;  4B3S Q;  3UI2 A;  4RKL A;  3KF8 B;  4DGZ A; 
#chains in the Genus database with same CATH homology
 2JA6 G;  5GAG C;  4OON A;  1CSQ A;  1G29 1;  2R7D A;  2YTV A;  1N32 Q;  3S2D H;  1C0A A;  3G71 A;  2OQK A;  4JI3 L;  2R92 H;  2EIF A;  2B29 A;  4JYA Q;  4IPH A;  2D0O A;  4GNX B;  2IHF A;  4DV5 Q;  2N3S A;  4PZ8 A;  4YWM A;  3GTQ H;  2XTI A;  1KAW A;  1KC8 C;  3FKI H;  3KJO A;  4LFC L;  3U50 C;  1CKN A;  4P72 A;  5FJ8 G;  5LMU Q;  2F4V L;  5JJL A;  1HR0 L;  4EQ5 A;  3G48 A;  4JI6 L;  2KBN A;  4OWT B;  4DR2 L;  4DUZ L;  2RCN A;  5IYC G;  5H1S E;  3D31 A;  4X66 Q;  4A3C H;  4A4I A;  3OTO L;  3HOX G;  3HKZ G;  4QGU A;  1EQQ A;  2UXC Q;  5C4X G;  4KHP Q;  2IX0 A;  1X3F A;  3KLW A;  1OXT A;  3J80 i;  4A93 G;  2R93 H;  4DV2 L;  1NBW A;  3I2Z A;  2VUM G;  3GTK H;  4AYB G;  1UE1 A;  3HKZ E;  1PA6 A;  2QEX A;  4LFA Q;  3EBE A;  1HZB A;  1YVC A;  3S24 A;  1VQM A;  4JI4 Q;  3GTJ H;  4LF9 L;  3BZK A;  3J7A 5;  4A3F H;  1X3G A;  3CAM A;  1JMC A;  1N9W A;  1EUJ A;  2JA7 G;  1VQD A;  4OX9 Q;  3AYH B;  2B63 H;  1K0R A;  5M5X H;  3CD6 A;  3BJU A;  1YHQ A;  1XPR A;  1YHB A;  2K14 A;  1IBM Q;  1A63 A;  2R6G A;  4YCW A;  5IWA L;  4XIG S;  4JI4 L;  1PFS A;  3RZD H;  4DV6 L;  1B70 B;  2NZO A;  2VQE L;  2IY5 B;  5JEA G;  4OX9 L;  3CC7 A;  1X65 A;  4GNX C;  4LW1 A;  1K8A C;  3UDG A;  1E24 A;  2HQL A;  3PO3 G;  1PH5 A;  1VQK A;  2JA8 H;  1W2B A;  4DK3 C;  4JCV E;  2UXD L;  5M5Y H;  1JJG A;  4DR5 Q;  2LSS A;  4LF5 Q;  3ULL A;  5GAH C;  3CCQ A;  3ULJ A;  1HZ9 A;  3AFQ A;  2WP8 J;  2N49 A;  2WB1 G;  3S14 H;  3UDF A;  2VS1 A;  4IFD I;  2LXJ A;  4GOP B;  4GNX A;  4QY7 A;  4TQU S;  4UP7 A;  2CKZ B;  2LXK A;  4QL5 A;  2I5H A;  4A3I H;  3A74 A;  3TRZ A;  4DV4 L;  1I94 L;  1WOC A;  1T9H A;  1W3S A;  1OXX K;  2XGT A;  4R4T A;  4LFB Q;  1V1Q A;  3PSI A;  4YY3 L;  4UY8 C;  4B3M L;  5AJ3 L;  4BY1 G;  3KFU A;  4R4O A;  1A62 A;  5M5W H;  5C0X J;  1IBL L;  4NXN Q;  4JBK A;  5HY6 A;  1XNQ Q;  1KQS A;  2AMC B;  1YJN A;  1MIU A;  1P8L A;  3F2C A;  1D7Q A;  1VQO A;  5IP9 H;  1VQA A;  3PIO A;  3PO2 G;  1OTC A;  1VQJ A;  2ES2 A;  3F2D A;  4YWK A;  2BA1 A;  3S16 H;  4DV0 Q;  1A0I A;  4JI7 L;  3UE0 A;  4L5Q A;  1TXY A;  3TQY A;  1PH8 A;  4NPS A;  3M7N A;  1I6H H;  1G51 A;  3RLN A;  2KEN A;  1EOV A;  2VNU D;  4HIO A;  3K80 C;  4BY7 G;  1HNW Q;  2OTJ A;  3L2P A;  2YV5 A;  1N33 L;  3CF5 A;  1GVP A;  1NTG A;  3M4Q A;  1KHI A;  2EXD A;  4QJF A;  2IHE A;  2UUB L;  4DR6 L;  1WFQ A;  2JA5 H;  1CSP A;  4XTC S;  4AH6 A;  5IYB H;  1VQG A;  3CPF A;  3H15 A;  4A3B G;  1R9T H;  1QZH A;  1NE3 A;  4DR4 Q;  2WAQ G;  1OXV A;  4NB3 A;  2VQF Q;  3CXC A;  4HIM A;  5IP7 G;  3HKS A;  1Y1V G;  4GOP C;  2ID0 A;  1VQ4 A;  2NVX H;  1N34 Q;  3GTP H;  1X56 A;  2E5L L;  1HZA A;  3HOZ G;  4GS3 A;  2HHH L;  3OW2 A;  2ZTC A;  1Q8K A;  3VDY A;  2A1A A;  2JK8 A;  3KDF B;  4KI0 A;  4DR3 Q;  2WAQ E;  4GN3 B;  4LF4 Q;  1XPU A;  5DLQ E;  4A75 A;  1YJ9 A;  1J6Q A;  2K5H A;  4WJ3 M;  4GOP A;  1IZ6 A;  3A5U A;  1VCI A;  3H0G G;  3ULP A;  3CC4 A;  4OO1 G;  1JJC B;  5BR8 Q;  1XTD A;  2DUD A;  2BA0 A;  1PVO A;  3CCU A;  4GLV B;  1E7Z A;  5GRO A;  1WCM H;  1TWH H;  4UPA A;  3S1R H;  3CQZ H;  4POG A;  3AFP A;  3T1H L;  1FJG L;  2PNH A;  4QIW E;  4DUY L;  3I4N H;  2YTY A;  1S40 A;  4IPD A;  3CCL A;  3DM3 A;  2ZM6 L;  3CCS A;  3I55 A;  2AWO A;  2KHJ A;  3HOW H;  4JI3 Q;  3H0G H;  5C3E H;  5M3M H;  2E2H H;  3S15 H;  1XPO A;  4ME3 A;  4JBW A;  4JOI C;  4YCU A;  1EIY B;  2UUA L;  4B3T Q;  5GAD C;  4LFC Q;  2YTX A;  2F4V Q;  1YJW A;  4A3D G;  2I5L X;  4P73 A;  5FLM G;  5C44 G;  1HR0 Q;  4JI6 Q;  4H02 A;  2MFI A;  2HIV A;  4APV A;  3PV0 A;  3I7F A;  1IYJ B;  3NBH B;  4DUZ Q;  4DR2 Q;  4JI8 L;  4PZ7 A;  2IX1 A;  3M4P A;  2MQH A;  1E3P A;  4DNI A;  2Q2H A;  2JA6 H;  4B3T L;  1FGU A;  5JJK A;  2NVY H;  3OTO Q;  4IJH A;  2Z6K C;  1IBK L;  3HFZ B;  4JOI A;  4UP8 A;  2CWP A;  3H3V I;  3MXN B;  5IY0 A;  1UE7 A;  1KIX A;  2CCZ A;  1QZG A;  1G6P A;  5HGQ A;  3GTL H;  1E1O A;  4DV2 Q;  3HOV G;  3PCO B;  1XNR L;  4PZ6 A;  1U5K A;  3NEL A;  3ER0 A;  4YHH L;  1FVI A;  2AKW B;  2F52 A;  4BBS G;  2VW9 A;  1GKH A;  5FJ8 H;  2I5M X;  4OWX B;  1JB7 A;  2Z6K A;  4DV1 L;  1YHA A;  4R4Q A;  4LF9 Q;  3GTM H;  4JBM A;  4R4C A;  1K83 H;  1TWC H;  2ZTE A;  4Y52 H;  1I50 H;  5IYC H;  4LUV A;  4GN5 A;  3KF6 B;  2F3I A;  3TS0 A;  1XMQ L;  1O7I A;  3TEH B;  3ZJY C;  3HOX H;  1Q1B A;  1UWV A;  4LUO A;  5C4X H;  4HID A;  1QVC A;  5IWA Q;  2VY3 A;  2BH2 A;  3KDF A;  3JAM i;  1K73 C;  3U4Z A;  4A93 H;  2ZTD A;  1I5F A;  4DV6 Q;  1BBU A;  5C0X G;  4HJ5 A;  1SLJ A;  3TS2 A;  4KHZ A;  2VQE Q;  1YBY A;  2K5V A;  2MNA A;  1YIJ A;  4BBR G;  1SN8 A;  3KJP A;  1J5E Q;  1VQE A;  2VUM H;  4AYB E;  1D8L A;  4A3K G;  1IL2 A;  4DR1 L;  3M3Y H;  2UXD Q;  3D0F A;  1LYL A;  3JAM c;  2E2I H;  1PH7 A;  2B3G A;  2MO0 A;  1J5E L;  4JV5 L;  2KCM A;  1PV4 A;  2JA7 H;  2OTL A;  1EQR A;  4AIM A;  2AWN A;  3GDE A;  3RLO A;  1U0L A;  1JJ2 A;  1HNX L;  2ASB A;  1X55 A;  3CCE A;  1SRO A;  2H5X A;  4NXM L;  2UXB L;  2K50 A;  3RR5 A;  4A3J G;  4R1J A;  3B6Y A;  4DV4 Q;  1I94 Q;  4A3M G;  2K52 A;  2GVB A;  1TWF H;  4YY3 Q;  3H3V H;  4B3M Q;  5AJ3 Q;  3PO3 H;  1IBL Q;  4X62 L;  3Q8D A;  1Q1E A;  1Z9F A;  1H95 A;  4AQY L;  1Q46 A;  3K7A H;  2NN6 G;  4HIK A;  4A3G G;  2E2J H;  1C9O A;  3AEV A;  2R7Z G;  2DGY A;  3UDI A;  2WB1 E;  3J81 c;  4HJ9 A;  4JI0 L;  1B8A A;  4L5S A;  4JI7 Q;  2GVA A;  3A5Z B;  2R7F A;  3E9I A;  1FL0 A;  4JI2 L;  1GO3 E;  2E8G A;  3OYY A;  4DV3 Q;  1MJE A;  4A3L G;  1QUQ A;  5LMN L;  2D62 A;  3W1B A;  4DK6 C;  2R7Z H;  1N33 Q;  4DR7 L;  4OO1 I;  4DR6 Q;  1Y14 B;  1VQ9 A;  2UUB Q;  4BY1 H;  3LGJ A;  3I56 A;  3RLF A;  1HR0 W;  3KF6 A;  4DV3 L;  1HNZ L;  1B7Y B;  1VQC A;  1L2F A;  5ELN A;  3IRB A;  1VQF A;  1VQL A;  3T1Y L;  3PO2 H;  3TRE A;  3S1Q H;  3FP9 A;  4L5T A;  2Q2I A;  3ICE A;  4PG3 A;  2PI2 E;  4BY7 H;  3K0X A;  1SMX A;  1OXS C;  2E5L Q;  1JE5 A;  1XMO L;  2RHS B;  2HHH Q;  1S3O A;  4DAM A;  5C4J H;  1X9N A;  2VZA A;  1K9M C;  1NMG A;  3GTG H;  2A8V A;  3WWV A;  1PH9 A;  4P74 A;  2EQS A;  3HOY G;  2C35 B;  1PH1 A;  4GLX A;  3RN5 A;  4LF7 L;  3HOU G;  1KRT A;  2OQ0 A;  1VQH A;  1XJV A;  3K8A A;  5IYD G;  4JG2 A;  2BH8 A;  2K4K A;  4A3B H;  2JQO A;  4EX5 A;  4B3R L;  1FJG Q;  1Q12 A;  3T1H Q;  4DUY Q;  1KD1 C;  2HIX A;  5IP7 H;  1Y1V H;  1RL2 A;  2ZM6 Q;  3M85 A;  3STB D;  2KCT A;  2NVQ H;  3HOZ H;  1TWA H;  1VQB A;  3CCJ A;  4IJL A;  3BZC A;  3KOJ A;  4JI1 L;  2UUA Q;  1VQ8 A;  4A3E G;  1N8R C;  1HH2 P;  2JJQ A;  1RIP A;  5IE8 A;  1Y1W G;  3NEN A;  1PH3 A;  2AHO B;  1K8G A;  4GKK L;  2Y0S G;  1VQI A;  2UU9 L;  5M3F G;  3MEF A;  4JI8 Q;  2OCE A;  5FLX c;  5C0X I;  4IO9 A;  1MJC A;  2A19 A;  3STB C;  1IBK Q;  2CFM A;  4C3H H;  2WFW A;  4O2D A;  2UUC L;  3CC2 A;  2Y0S E;  3PUZ A;  3CME A;  1WYD A;  1X3E A;  1XNR Q;  2QGQ A;  4TVA B;  1L1O C;  2PI2 A;  3S1M H;  3JC6 6;  4YHH Q;  1Q81 C;  1S72 A;  1Q7Y C;  2HT1 A;  1A8V A;  3U4V A;  1VQ5 A;  4DV1 Q;  4A3D H;  1YEZ A;  1LM0 A;  5FLM H;  5C44 H;  4DV7 L;  2R92 G;  3RZO H;  4C3J H;  3S1N H;  1KRS A;  1BBW A;  1KL9 A;  4R4I A;  1L0W A;  1QVG A;  1MKH A;  1V43 A;  2IT1 A;  1QUQ B;  1XMQ Q;  1L1O A;  3FKI G;  4IFD J;  4P75 A;  1N36 L;  2N78 A;  2V1C C;  4WJ4 A;  1SE8 A;  4B3S L;  2OWO A;  1YNX A;  3HOV H;  2PMZ E;  4FDB A;  2N8N A;  2NN6 I;  3UE1 A;  4A3C G;  4MZ9 A;  3J81 j;  1PH2 A;  3GD7 A;  1N32 L;  4BBS H;  4LUZ A;  1E1T A;  3PUY A;  4DR1 Q;  3K81 C;  3GTO H;  1VS0 A;  2KHI A;  1I3Q H;  3EN2 A;  4QQB X;  2R93 G;  4JYA L;  3GO5 A;  4IPC A;  1CUK A;  4C2M H;  3CCR A;  4JV5 Q;  4DV5 L;  2Q2U A;  2JE6 I;  3NEM A;  3CW2 C;  4LF8 Q;  1UE5 A;  1M90 C;  1ASY A;  4L5R C;  1E22 A;  1AE2 A;  1TWG H;  2ZJP A;  3FHW A;  5LMU L;  1HNX Q;  4GKJ Q;  3KYH C;  2UXB Q;  4NXM Q;  1WJJ A;  3A0J A;  3E0E A;  2PQA A;  4YCV A;  4A3F G;  1VQN A;  2I0Q A;  5IT9 c;  2B63 G;  4BBR H;  4LF8 L;  4LNQ A;  3EIV A;  4X66 L;  1GD7 A;  4DAY B;  4BA2 I;  2MO1 A;  4IPG A;  1QVF A;  2UXC L;  4HJ8 A;  4HJ7 A;  1HZC A;  3PUW A;  4KLK A;  4X62 Q;  4A3K H;  4KHP L;  4UP9 A;  3U58 A;  4AQY Q;  3L7Z C;  3J80 c;  2JA9 A;  3J81 i;  1OXU A;  2CWA A;  2L15 A;  1SR3 A;  3E9H A;  1UEB A;  4GN4 B;  4OXP A;  4POF A;  4JI0 Q;  1UE6 A;  4LWC A;  2ZJR A;  4LFA L;  2JA8 G;  4IOC A;  5J3B A;  4JI2 Q;  3W1G A;  4P71 A;  3J7Z C;  4A3J H;  2YU9 H;  5LMN Q;  3CPW A;  4A3M H;  2K5N A;  1KXL A;  4DR7 Q;  1BVS A;  1IBM L;  2Z0S A;  1PH6 A;  1Q82 C;  4YWL A;  4A3I G;  1HNZ Q;  4X65 Q;  2GN5 A;  4A3G H;  3PUX A;  4X6A H;  3T1Y Q;  3DLL A;  2D0P A;  1VQ7 A;  1EWI A;  4OWW B;  1WI5 A;  4BA1 I;  2VL6 A;  3CP0 A;  3S17 H;  1VQP A;  4DR5 L;  5EAY A;  3PGZ A;  4X65 L;  4LF5 L;  3SGI A;  4LF6 Q;  4A3L H;  1YZ6 A;  1Z47 A;  1LTL A;  5IP9 G;  1XMO Q;  4DPG A;  4J15 A;  2NVT H;  1V9P A;  4RG1 A;  1SRU A;  3F2B A;  4LF7 Q;  3ERS X;  2CQO A;  4LF6 L;  1YI2 A;  1PHJ A;  3CCV A;  1BKB A;  4LFB L;  4Y7N H;  1L1O B;  1VQ6 A;  4A76 A;  2JEA I;  1EIF A;  1M1K C;  4B3R Q;  2JA5 G;  4ALP A;  3I4M G;  4NXN L;  2Q2T A;  3PUV A;  1AE3 A;  3BU2 A;  5JEA J;  5IYB G;  3K7U C;  1NY4 A;  3UDX A;  1XNQ L;  3G6E A;  4K0K Q;  1X6O A;  2YYZ A;  5GAE C;  3F1Z A;  1ASZ A;  1NJI C;  1CKN B;  4PMW A;  2QA4 A;  4DV0 L;  1PYS B;  1EYG A;  3S2H H;  3PF5 A;  4JC0 A;  4C3I H;  4JI1 Q;  3I4M H;  3HOU H;  3HOY H;  4BXX H;  4IOA A;  4K0K L;  5K36 G;  3PIP A;  1EFW A;  1HNW L;  1P16 A;  4IFD G;  1NMF A;  1LUZ A;  5IYD H;  3AQQ A;  4GKK Q;  1JT8 A;  5GQO A;  3L0O A;  4X64 Q;  2UU9 Q;  4HJA A;  2ZJQ A;  4GKJ L;  1AH9 A;  1PYB A;  4GLA C;  2PQA B;  3CMA A;  1CKO A;  4MNO A;  3M4O H;  5JJI A;  1IXR A;  2UUC Q;  3I4O A;  4X64 L;  1PH4 A;  2FXQ A;  4RMF A;  2RHQ B;  1WCM G;  2RF4 A;  4DR4 L;  4BXX G;  2VQF L;  3I4N G;  4A3E H;  4DKA C;  3G4S A;  1N34 L;  4JBJ A;  1Y1W H;  3HOW G;  1HJP A;  4DV7 Q;  2JEB I;  5E7N A;  5C3E G;  5M3M G;  3RN2 A;  3RNU A;  1Q86 C;  3F8T A;  5M3F H;  4JI5 Q;  1CKM A;  4LF4 L;  4DR3 L;  4O0A A;  3CCM A;  3PF4 A;  1DGS A;  4MTN A;  1N36 Q;  1K3R A;  1X54 A;  2ALY B;  2NZH A;  5LMN W;  2K75 A;  1C7Y A;  2ATW A;  3W5O A;  5ELO A;  3M9B A;  5BR8 L;  1GM5 A;  4B3S Q;  4JI5 L;  3KF8 B;  1SFO H;  1YIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...