2PI2E

Full-length replication protein a subunits rpa14 and rpa32
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
b'VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication, dna binding protein
total genus 27
structure length 117
sequence length 117
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pi2E00
1C7YA 1GM5A 4A76A 1YBYA 1A0IA 2HIXA 1VQDA 3KYHC 3G48A 4PZ6A 5IYBG 4DV2Q 1Q81C 5GAHC 3I55A 4HJ7A 4JCVE 2YU9H 1WCMH 5C4XH 4BA1I 4DV7Q 4QIWE 1OTCA 2UUCL 4QY7A 5IT9c 4JBWA 3UDGA 2R93G 1Y1VG 4LUZA 2VL6A 1AE3A 4O2DA 4A3BG 4J15A 3G71A 3AEVA 3ULJA 1Q1BA 1NJIC 1X56A 4A3IG 4YWMA 2R7ZG 4DV2L 2CCZA 3S2DH 5GROA 1VQKA 2VQFL 3K8AA 1N36Q 1CKOA 1UE7A 3IRBA 4DV7L 1CKNB 1VQ9A 2ZJRA 2JA6G 1Y1WG 1I94L 3BZKA 5IYCH 1PH5A 2PNHA 1PA6A 2L15A 3J7A5 4A93G 2R92H 1I6HH 1G51A 2MO0A 2BH2A 1C9OA 4YY3Q 1VQ7A 3PO3H 1E1OA 4L5QA 3ULLA 2UU9Q 4JI7L 4HIMA 1GVPA 1HZCA 5C44H 3CMAA 3PO2G 1E22A 1WFQA 5IP7H 1L1OC 2K4KA 1K83H 3BZCA 4A3DH 2YTYA 1O7IA 1YHQA 4QL5A 2GVBA 1PV4A 1GD7A 3PUZA 3PF5A 4FDBA 2F3IA 2UU9L 3M4OH 3GO5A 2WP8J 1Z47A 3I4MG 3HOXG 2D62A 2K5HA 1P8LA 1X3FA 3PUWA 3M3YH 3BJUA 5M3MG 3CXCA 1QVGA 1N33Q 5HY6A 2E5LQ 4X65Q 1EWIA 4JI3Q 1PYBA 4X64Q 4BBSH 5E7NA 2WAQE 4AQYQ 1K8AC 4DV0L 1VQ8A 2JA7G 1D8LA 1RIPA 5IP9G 4GOPA 4A3KG 2E2HH 1SRUA 2C35B 4A3LH 1X9NA 1SLJA 2R93H 1HH2P 1IXRA 2AWNA 4C3JH 3GTKH 5IE8A 4X6AH 1OXTA 4B3SQ 4GS3A 4DV1Q 1N33L 2PQAA 2E2JH 2E5LL 4X65L 4JI3L 3KDFA 1QUQA 1PYSB 4P74A 4BBRH 1V1QA 4X64L 5FJ8G 4DV6Q 3GD7A 4AQYL 3CAMA 3HOZG 3CC4A 1VQGA 2VUMH 3TREA 1U5KA 3HOVH 2I5LX 1TWFH 4HJAA 2WAQG 2MQHA 4B3SL 4OO1G 4OONA 4DV1L 1WOCA 1Q7YC 2KHIA 2JE6I 2YTXA 4ME3A 3HOYH 3PUVA 5FLXc 4DV6L 1VQAA 1R9TH 4A3CH 5HGQA 1HJPA 2UXDQ 4JI5Q 1KC8C 1NMGA 2PI2E 1PH3A 4P71A 3TQYA 3CW2C 1LYLA 2KBNA 4LUOA 5EAYA 3RZOH 4LF4Q 2AKWB 2EIFA 4MNOA 1JB7A 2ES2A 5K36G 5IY0A 3RLOA 4BXXH 1W2BA 1CKNA 1SR3A 3MEFA 1PH2A 4R4CA 4YHHL 2UXDL 2BA1A 1L2FA 4IPGA 4JI5L 4DK3C 4NXMQ 4BA2I 4H02A 2B63G 4Y52H 3KOJA 1IL2A 4DUYQ 3NENA 3S1NH 1TWHH 4DR5Q 4B3TQ 1XMQL 4UP7A 2VZAA 4AYBE 4GNXA 1YJWA 4LF4L 4A3GG 4DK6C 3FHWA 3K80C 3NEMA 3I7FA 1U0LA 4IFDJ 4GKJQ 1PFSA 1DGSA 1FL0A 3A5ZB 4R4IA 3A5UA 2GN5A 1JE5A 1Q86C 4NXML 3GTPH 1XPOA 2I5MX 4GOPB 1TWAH 4DR5L 4B3TL 1XNQL 3TS0A 2ALYB 1UWVA 1X3EA 2HT1A 3GTGH 3H3VH 1GO3E 1EIFA 3D0FA 2N8NA 5DLQE 4GKJL 4BBSG 5BR8Q 1IBMQ 3KF6B 2Y0SE 4AYBG 4R4TA 3HKZE 2A1AA 4IPDA 1QVFA 5GQOA 4EQ5A 3CMEA 4A3LG 1FGUA 3JAMi 2NVQH 4BY1H 2DUDA 5IWAQ 1N32Q 1OXUA 1B8AA 4JI6Q 1PH8A 3DM3A 5BR8L 1IBML 3D31A 5ELOA 2R6GA 3H15A 2MFIA 2E2IH 3S14H 1OXXK 4DR6Q 3DLLA 4OWXB 4LF6Q 4O0AA 2AHOB 1V43A 1D7QA 2YTVA 2Q2HA 3ULPA 3CCJA 2HIVA 2Y0SG 4GN3B 1YEZA 2D0OA 4L5RC 4DAYB 1NE3A 5IWAL 4JBKA 1IBKQ 1HNWQ 4LUVA 3K0XA 1N32L 4JI6L 1EYGA 4BY7H 4A75A 1QZGA 2HHHQ 4L5SA 4DR6L 1UEBA 4L5TA 2CKZB 4LF6L 4IFDG 1XJVA 2DGYA 1W3SA 5M3FH 3EN2A 4XTCS 4DR4Q 1MJCA 1LM0A 2RHSB 1HZ9A 2JA5G 4HJ9A 1VQBA 4A3FG 4C3HH 1HNWL 1IBKL 1XPUA 3M4QA 1KAWA 1Y14B 3CP0A 5FLMG 4GNXB 3U4VA 3RN5A 4LFCQ 2B29A 1N36L 2HHHL 1VQJA 1I50H 3HKSA 4JC0A 1YITA 4A3EH 2KENA 2CWPA 1OXSC 1X3GA 1Z9FA 1EQRA 1VQFA 1NTGA 1S72A 4JBMA 1YHBA 3PF4A 2ZJPA 1IZ6A 4DR4L 2LSSA 4LFBQ 2OTJA 4YY3L 4C3IH 4DV4Q 1VQOA 1VQEA 1KRTA 2VW9A 5M5YH 4LFCL 4XIGS 3KFUA 4DV3Q 4P72A 4DAMA 1XTDA 3STBC 4DNIA 3VDYA 3PV0A 2UXCQ 1EOVA 3AYHB 3SGIA 5LMNW 5IYDH 1VQ5A 3HOUH 3HOWG 1NMFA 1J6QA 3E0EA 3H0GG 2OQ0A 3KJOA 1KIXA 1KRSA 4LFBL 3G6EA 5C0XJ 4PZ8A 3CCVA 4NPSA 3BU2A 4DV4L 4GOPC 3JAMc 1CSPA 2JA8G 3J7ZC 1LUZA 1C0AA 2Q2IA 2D0PA 3PUYA 4IPCA 4DV3L 3FP9A 2JEAI 2UXCL 3KJPA 1Q8KA 3S2HH 4IFDI 2F52A 1WYDA 4EX5A 1K8GA 1L0WA 1A63A 4OWTB 3KF6A 3J81i 1PHJA 4AIMA 2R92G 4JBJA 4POGA 1JJGA 1YJNA 4A3MH 4IJLA 1KL9A 3J80i 3M85A 3G4SA 1K3RA 2XGTA 3L7ZC 3S17H 3CCRA 2MO1A 2LXKA 1VQCA 4UP8A 1K9MC 3CC7A 2UUAQ 1WCMG 1PH9A 1E24A 1SROA 5GAGC 5C4XG 5LMUQ 4A3JH 4RMFA 3RNUA 1M1KC 1SN8A 3TEHB 4JI0Q 2OTLA 2XTIA 4JI1Q 1KXLA 1H95A 3PUXA 5IYBH 3F2CA 4DR7Q 3I4NH 1J5EQ 2K52A 2V1CC 3U4ZA 2UUAL 3CPFA 4K0KQ 1I3QH 3KLWA 3GTJH 1BKBA 1Y1VH 2IT1A 5IYCG 1B70B 5C4JH 5LMUL 1VQLA 4DV5Q 3W1GA 5AJ3Q 4JI0L 4A3BH 2ZTCA 4KLKA 1VQ4A 1EQQA 1PH6A 3ZJYC 4JV5Q 1JJ2A 3UDFA 4A3IH 1LTLA 2R7ZH 2ZTEA 4B3RQ 4YCVA 3PO3G 4DR7L 1HR0W 4PMWA 1HR0Q 5C0XG 2E8GA 4UP9A 5C44G 3JC66 3CCMA 4JI2Q 4GNXC 1J5EL 2JA6H 1VQHA 5IP7G 1Y1WH 1PH7A 3S1MH 4K0KL 1EFWA 4UPAA 4AH6A 1AH9A 4YCUA 5AJ3L 2ZTDA 4A93H 4JV5L 4A3DG 3CC2A 2CFMA 4DR1Q 4R1JA 4B3RL 5GADC 1HNXQ 3NBHB 1QZHA 3GTOH 3PO2H 2N3SA 4DUYL 1JJCB 2NN6G 5ELNA 4DR2Q 1HR0L 4OO1I 1L1OB 3AFPA 4HIKA 2Q2UA 4JI2L 4IOAA 4OXPA 1WJJA 3CCSA 3HOUG 5JJKA 2UUBQ 4NXNQ 1HNZQ 2KHJA 1HZBA 3RN2A 2NVTH 1S3OA 4DR1L 2A19A 1HNXL 1NBWA 1YZ6A 2BH8A 4KI0A 3S15H 1YJ9A 2F4VQ 2JK8A 3PCOB 3HOXH 4DR2L 3I4MH 1IYJB 2KCMA 3J80c 1B7YB 5M3MH 3FKIH 2H5XA 3AFQA 4YCWA 1UE5A 1N8RC 4LNQA 1G6PA 2Z6KC 2Z6KA 4TQUS 4NXNL 3T1YQ 1HNZL 1ASZA 4BBRG 1A8VA 5JEAJ 2JA7H 5IP9H 1VCIA 4JI4Q 4GLVB 4PG3A 1K73C 2I5HA 1X55A 3I2ZA 1FJGQ 1CKMA 2F4VL 2VUMG 2ID0A 3HOVG 4UY8C 3S1QH 2YV5A 3E9HA 3S1RH 1WI5A 1K0RA 2K50A 4POFA 3STBD 2QA4A 1X54A 2NZOA 5M5WH 2VQEQ 3EIVA 3HKZG 2UXBQ 1G291 5FJ8H 4LWCA 3HOYG 2B3GA 1HZAA 1M90C 3HOZH 4A3CG 1XMOQ 1YHAA 3S24A 1FJGL 2NN6I 3GDEA 2ATWA 4IOCA 3OYYA 2VQFQ 3I4NG 2CWAA 2QEXA 2ZJQA 2IHFA 2A8VA 3W1BA 2VQEL 2BA0A 1UE6A 1I94Q 2GVAA 2UXBL 1NY4A 3F2DA 4BXXG 1CUKA 1SMXA 3A0JA 1VQPA 4DR3Q 1XMOL 2NVXH 2HQLA 1TXYA 2LXJA 4JG2A 1VS0A 4LF8Q 1N34Q 3K7AH 4OWWB 3KF8B 3TS2A 4LFAQ 2PI2A 4NB3A 1VQMA 3MXNB 4MTNA 4P73A 1MKHA 4DR3L 3NELA 2B63H 1VQ6A 1UE1A 1SE8A 5LMNQ 2N49A 4LF8L 1N34L 5JEAG 3Q8DA 4A3GH 2CQOA 5JJLA 3CF5A 3UE0A 1L1OA 4GLXA 3ERSX 1EIYB 4LFAL 1VQIA 1Q82C 4QQBX 2IY5B 3GTMH 1YI2A 2K5NA 1QVCA 3OTOQ 1YIJA 3PIPA 4DV0Q 2VNUD 2JA9A 4HIDA 1ASYA 2K5VA 1T9HA 2OWOA 5LMNL 3ICEA 4JI8Q 2RCNA 2WB1E 3HFZB 3UDIA 4WJ3M 3CCQA 4P75A 2EXDA 3FKIG 3I56A 1BVSA 4BY1G 5GAEC 2K75A 4X62Q 3RZDH 1PH1A 4ALPA 2MNAA 2NZHA 2RF4A 3GTQH 4HJ8A 1BBWA 1KQSA 3OTOL 4LF5Q 1E3PA 2Z0SA 5J3BA 4Y7NH 3TRZA 4LF9Q 4JI8L 5C3EH 1IBLQ 4R4QA 4OX9Q 1E1TA 2NVYH 1CSQA 3CPWA 3U58A 3F8TA 1E7ZA 3CCEA 4WJ4A 2R7DA 4APVA 3LGJA 3T1HQ 3L2PA 2RHQB 4X62L 3PIOA 2AMCB 2OCEA 3E9IA 3RLNA 2I0QA 2WB1G 1VQNA 4LF5L 4DKAC 4MZ9A 4BY7G 1A62A 1KD1C 2IHEA 3UE1A 4YWKA 4LF9L 4GKKQ 1P16A 1X65A 1IBLL 1JT8A 4OX9L 5M3FG 1JMCA 3CD6A 4JI1L 2N78A 4KHPQ 3CQZH 3T1HL 3RLFA 1Q46A 3RR5A 4LW1A 3H3VI 4TVAB 4X66Q 3B6YA 1S40A 4QGUA 3F1ZA 1N9WA 3UDXA 1SFOH 4YHHQ 2OQKA 4GKKL 1Q12A 4A3EG 4RG1A 4IO9A 4DV5L 5H1SE 2ZM6Q 4GLAC 1TWGH 2JA5H 1RL2A 1YVCA 4KHPL 3M7NA 4PZ7A 1GKHA 1XMQQ 4A3FH 4C2MH 3PGZA 3K81C 4X66L 4IJHA 3I4OA 5FLMH 3WWVA 4DUZQ 1XPRA 2FXQA 2JJQA 5IYDG 4LF7Q 3ER0A 3M9BA 4JYAQ 1MIUA 2VS1A 2WFWA 1FVIA 4DPGA 1PVOA 2ZM6L 3S16H 3J81c 4A4IA 2YYZA 1Q1EA 1XNQQ 2IX0A 1TWCH 3PSIA 2JQOA 1XNRQ 3CCUA 4GN4B 1AE2A 2PMZE 4DUZL 1MJEA 5JJIA 2KCTA 3GTLH 4LF7L 2R7FA 3HOWH 1X6OA 4GN5A 3CCLA 2ASBA 3H0GH 4JYAL 2UUBL 2AWOA 4B3MQ 3M4PA 3K7UC 2K14A 4IPHA 3AQQA 3F2BA 4A3KH 4QJFA 4JI7Q 2IX1A 2JA8H 4YWLA 3OW2A 4JOIA 4JOIC 4A3MG 5C0XI 2VY3A 1XNRL 2Q2TA 4HIOA 2PQAB 2QGQA 3KDFB 1QUQB 1PH4A 1BBUA 1I5FA 1YNXA 5M5XH 2UUCQ 2JEBI 3EBEA 3T1YL 1KHIA 3J81j 1V9PA 4R4OA 3U50C 1EUJA 5C3EG 4HJ5A 4A3JG 4B3ML 4JI4L 1OXVA 2EQSA 3A74A 3L0OA 4KHZA 3W5OA
chains in the Genus database with same CATH superfamily
2O5IC 1A0IA 4DV2Q 5IYBG 4DXFA 1U4MA 4RKLA 3GTJB 4BA1I 3NPPA 3PMFA 2KCNA 4A3BB 4O2DA 4A3IB 4A3BG 4J15A 2R7ZB 2KOLA 3ULJA 1NJIC 5I9PA 4A3IG 2R7ZG 4DV2L 2CCZA 3S2DH 2VQFL 3S1MB 1CKOA 2ZT9C 3H09A 1I94L 3FPPA 2PW7A 3BZKA 2L15A 3MXPA 1VQ7A 3PO3H 5ELFA 2EY1A 1HZCA 5DAUA 1PZID 4CJ2C 3G6JB 3K59A 3S15B 1HFNA 2GVBA 1PV4A 3PF5A 4FDBA 3M4OH 1A15A 1Z47A 1P8LA 3K5MA 3M3YH 1EYAA 3CXCA 1QVGA 1VMCA 5HY6A 1SSOA 4BBSH 1VQ8A 3F2UA 5IP9G 4A3KG 1SRUA 4ZUJA 2K03A 4J1MA 1DXMA 3LWUA 4X6AH 2EYPA 2MP1A 5M5WB 4B3SQ 4GS3A 4FF1A 4DV1Q 2PQAA 3HOZB 3GD7A 5KGUA 2PZWA 4C56C 3HOZG 3CC4A 2WAQB 3HOVH 1F9RA 2WAQG 4B3SL 1W6KA 1SYCA 2SDFA 4DV1L 2KHIA 1H9JA 3NHHA 2JE6I 2YTXA 4ME3A 3HOYH 2KQ3A 1GOZA 1SYFA 1R9TH 4A3CH 2WKCA 2UXDQ 1CTMA 1O78A 3K7AB 1TU2B 4P71A 1ICWA 4LUOA 3RZOH 2ES2A 5IGCA 5CV8A 2VB2X 1W2BA 1CZGA 1SR3A 3MEFA 4YHHL 2B63B 2UXDL 2BA1A 4Y52H 2F3WA 2B63G 2F0GA 4Q0FA 2RSNA 1U9RA 2MPMA 1KLGD 4HAEA 3FHWA 3GTMB 4IUQA 2QW7A 2PYKA 1FL0A 2RA4A 3A5ZB 3LX0A 4R4IA 3MVVA 4K5XA 1TY0A 4GOPB 1TWAH 1DOKA 3Q6SA 2DNEA 3TS0A 2ALYB 2M9VA 5EQ0A 3P1HA 1EIFA 1CQFA 4DAVA 3R93A 4ZKCB 2JN4A 2MHVA 2Z6BA 2E2DC 3BVMA 4BY1H 2DUDA 1N32Q 3BS1A 2I07B 3D31A 2R6GA 3H15A 2F0VA 1Y8NB 2HUGA 2E2IH 1OXXK 3OWEB 3J80L 3S14H 5CBAE 1F9QA 1Q8IA 1J9OA 3MC0B 1N32L 3K0XA 1BUVT 4BY7H 1UEBA 1B53A 4U673 4S3SA 1ZEQX 1XJVA 4EGVA 5M3FH 4XTCS 4KK7A 4FVMA 2PW5A 1Y14B 3RN5A 5C0XH 2A6ED 1I50H 4JC0A 1PTOF 4A3EH 4DU9A 2ZXPA 1Z9FA 1YHBA 3U9SA 4C3IH 4DV4Q 1HQMC 2B2WA 1VQEA 2VW9A 3KFUA 4N9TA 3VDYA 1S5FD 2F0NA 5DEHA 5CV5A 3SGIA 5KNBA 1CZWA 2OQ0A 1BQQT 3CCVA 3IFTA 4DV4L 3LNNA 1A2TA 1C0AA 2HCIA 3SEBA 3K58A 3NP8A 2K05A 2F52A 1QE6A 2LKVA 1JB3A 4K6DA 5FO9B 4R8IA 5JVH3 1SNMA 3G4SA 1WCMB 5E4XA 2A6HD 1UUPA 1VQCA 4UP8A 3IL8A 1WCMG 1PH9A 4F87A 4RMFA 1SN8A 2WIIB 3TDQA 1A3UA 1W6JA 5IYBH 1J5EQ 2DY8A 1RCVD 1X3QA 5T1IA 4K0KQ 3UI2A 4NMZA 4ZUIA 3GTJH 4B9WA 3AB9A 3W1GA 4A3BH 2QILA 4JV5Q 1EQQA 4KLKA 1PH6A 4WJWA 1JJ2A 2XNAC 4A3IH 2R7ZH 1LTRD 2KCCA 1HR0Q 1J5EL 2E8GA 2OXPA 1SMYD 1VQHA 4H44C 5IP7G 4RGTA 3S1MH 4K0KL 4KN4C 4A3DB 4UPAA 3VYSA 1AH9A 2ZTDA 4JV5L 4A3DG 1G8ZD 2CFMA 3NBHB 2G9HD 1QZHA 3T13A 4OO1I 5ELNA 1HR0L 5C5LA 1QOHA 1SDFA 3W2DA 5KRUA 1UNSA 2F0OA 2UUBQ 4NXNQ 4FF2A 2KHJA 4YIJA 1EOTA 3S15H 4KI0A 5CV9A 4C3JB 2F4VQ 3GTKB 1IYJB 4C3JG 2H5XA 2J7ZA 4BBRB 1BCPB 1UE5A 4NXNL 4TQUS 5F2DA 4KD4A 4LK1C 4BBRG 5IP9H 1VCIA 4JI4Q 4LMQD 3TZDA 4F88A 2I5HA 3EFXD 1PRTD 1FJGQ 2F4VL 1QWYA 3LWEA 5C4ZA 1FNVA 1I4RA 1WI5A 1EZ8A 2K50A 5CYUA 4TRDA 2NZOA 5M5WH 2VQEQ 1D6EC 2UXBQ 4LWCA 2B3GA 3HOZH 5A2QE 5CBEE 3S24A 1XMOQ 1JR0D 2EY5A 1WTRA 1FJGL 1F2ZA 1IW7C 4XYQA 3I91A 1RODA 3KLSA 2QEXA 2ZJQA 2A8VA 4ULLA 2VQEL 2UXBL 5A2QL 4QB4A 1WD1A 4BXXG 2EE1A 1CUKA 5K5PA 4BWGB 3A0JA 5C4HA 1ENFA 1XMOL 1TXYA 4JG2A 3S1NB 3EROA 3K7AH 4OWWB 5EKKA 1HUNA 3WOEA 2QEJC 4MTNA 4ID6A 2B63H 1UE1A 1SE8A 2N49A 2VB3X 3Q8DA 1GUTA 5LHY1 3CF5A 4GLXA 1WD0A 1EIYB 4QQBX 1VQIA 4PNYA 2IY5B 3GTMH 2K5NA 1QVCA 1STBA 3OTOQ 3PIPA 3Q23A 2VNUD 2JA9A 4HIDA 1T9HA 3ICEA 1TIID 1NNXA 1S5ED 3CKIB 2WB1E 4CBVA 1HA6A 3D4RA 4WJ3M 4B08A 1ILQA 2EXDA 3FKIG 1IKLA 1BVSA 3I56A 5GAEC 2K75A 5IGFA 1U4LA 3BYTB 4ALPA 2NZHA 4TKOB 2RF4A 1WTPA 1KQSA 3OIQA 3OTOL 4LF5Q 2KA7A 1DOLA 4K5WA 4LF9Q 1PYWD 3SR1A 1E1TA 3U58A 2F0HA 2B2VA 1LTGD 1I4PA 3T1HQ 1B2TA 2HQEA 2RHQB 3X3MA 3RLNA 2I0QA 4LF5L 1TS4A 4CHTB 1NSNS 2IHEA 1DCZA 1WTVA 4LF9L 1JT8A 3VA5A 1LTTD 2N78A 4JI1L 2HDLA 3T1HL 3RR5A 3M4YA 4K5VA 3H3VI 4TVAB 3TP6A 3F1ZA 2F0DA 2EYLA 5JOBA 4CKBA 1Y69U 4RAUC 4PZ7A 3E6ZX 5M5YB 3PGZA 5I9OA 4IJHA 3NBIA 1E2VA 1PDQA 4DUZQ 2FXQA 5KNDA 3HOUB 4KJNA 4JYAQ 1ML0D 3I4LA 5C6AA 3NTIA 1PVOA 2F0EA 3K6OA 4OEMB 1U4PA 4L8JA 3S9WA 2C5CA 1K0SA 2DN8A 3PSIA 2JQOA 1SNPA 4FXGC 1AE2A 4DUZL 1EU4A 4NDXA 2AUJD 4JYAL 1X6OA 1M4VA 3N6RA 3NUCA 1JOKA 5CGKA 4B3MQ 3M4PA 4DNTB 2K14A 3AQQA 4A3MB 2IX1A 3MEHA 4YWLA 1XYIA 4A3MG 3S17B 3TN2A 4HIOA 1T5XD 5CC4A 1TR5A 3KDFB 1QUQB 2B8GA 2UUCQ 2F0TA 1V9PA 2BOSA 4B3ML 4HJ5A 1ZYRD 4ZRZA 3L0OA 1YBYA 1AN8A 3I4NB 1WCMH 1O7YA 4DV7Q 2UUCL 4QIWE 5C4JB 2NTTA 4QY7A 3UDGA 1O7ZA 2VL6A 1AE3A 3R8BA 3G71A 3AEVA 3CHBD 5D3DA 4QMGA 2MUYA 1RD9D 3A8JE 4DV7L 1CKNB 4G4KA 1PH5A 2PNHA 2F0UA 1PA6A 2EY6A 2F03A 2X6LA 3J7A5 4G7HC 3H91A 5BN5A 4C1NI 4L5QA 3ULLA 2UU9Q 2L4NA 1GVPA 4HIMA 1K28A 3R2TA 3URYA 1SYGA 1WFQA 2X69A 5IP7H 1NUCA 2K4KA 3CRLC 1HHVA 1E2ZA 3VR3A 4A3DH 2YTYA 3VYUA 1YHQA 4QL5A 3I4MB 4N8FA 1CM9A 2UU9L 2WP8J 5M3MB 3I4MG 1EU3A 1QG7A 5ELEA 1X3FA 1GUNA 1H9SB 5M3MG 1N33Q 4FXKC 5ELBA 1PYBA 2EDGA 3RUZA 4RWSC 4X64Q 3VR4A 4IURA 1K8AC 3D4DA 1D8LA 1RIPA 4GOPA 5G3LD 2JSOA 2PNRC 4EQNA 1SLJA 3S1RB 1V1PB 4C3JH 4ZYSA 3GTKH 5IE8A 1OXTA 1N33L 1JICA 2A6EC 3DWAA 2PZTA 4X64L 4BBRH 1V1QA 5FJ8G 4EVOA 1STYA 2FJ2A 3CU7A 1EY0A 1VQGA 1U5KA 1I4GA 5IGGA 4OO1G 4OONA 2H1EA 1VMPA 3KK7A 5FLXE 4FNFA 1KAAA 2EYHA 5FLXc 1RF2D 1I6VC 1VQAA 2NVXB 4MIUA 5HGQA 4A3EB 1SBBB 4JI5Q 1KC8C 4KJOA 2A73B 2QCPX 2RDFA 4M1UB 1PH3A 1DOMA 3TQYA 5FLXL 4H0LC 1LYLA 4DK1A 3VR6A 1I4QA 4MNOA 1HPCA 5IY0A 3RLOA 4BXXH 3OSOA 2XIWA 2CQAA 1GUSA 1L2FA 4IPGA 4JI5L 4NXMQ 3GP7A 4DUYQ 2FMCA 3S1NH 3KBGA 3Q22A 1XMQL 4AYBE 1ENAA 4KKSA 4HTHA 3I7FA 3NSWA 2A6HC 1PFSA 3A5UA 1SNCA 4NXML 2JYOA 1TS3A 1EFID 3A7LA 1XNQL 1F2YA 3I70A 1JCKB 1X3EA 5ELCA 3GTQB 1GO3E 2NZ1D 1H9MA 2N8NA 5DLQE 2Y0SE 1DONA 1EEID 3A7AB 3HKZE 1QVFA 4ZAIA 4A3LG 4N8X1 4UAIA 4O42A 4X3TA 3JAMi 4CDCC 3QOJA 4TSSA 3A54A 4JI6Q 1PH8A 5EPKA 1SMYC 4BS9A 2O5JC 2Q8RE 3BVGA 2AHOB 1V43A 1XWEA 3CQZB 2RKSA 3V2TA 1ILPA 4GN3B 1YEZA 2D2CC 4ZLTF 3K5LA 1IBKQ 4LUVA 3FEWX 4JI6L 1Z7TA 1T5EA 3C1FA 4A75A 1QZGA 2HHHQ 4L5SA 2F0QA 2JA5B 1JQYD 3OHXC 1W3SA 2SOBA 3EN2A 1STGA 1K3BC 1LM0A 1L0XB 1HZ9A 2RHSB 4HJ9A 4A3FB 1VQBA 2JA5G 4A3FG 1IBKL 3M4QA 4RKBA 3CP0A 2HHHL 3HKSA 1CT1D 3TMEA 3S16B 4B9XA 1EQRA 1VQFA 1NTGA 1PXUA 5EPLA 4LFBQ 1TWCB 2BCOA 1PRTC 1VQOA 1KRTA 1NAPA 5M5YH 2V4DA 4XIGS 3HOWB 2RQXA 4DNIA 3PIP3 2UXCQ 3T56B 4HCEA 3HOUH 1NMFA 1J6QA 3E0EA 4RHSA 3HOWG 3KJOA 4A3KB 3HRZC 4LFBL 1I4XA 1FYCA 1YNJD 4PZ8A 3BU2A 1B3QA 3NQIA 5EPJA 4IUPA 1LUZA 4RH6A 2EYFA 1AZQA 1JWSD 2UXCL 1Q8KA 3HGBA 4IFDI 1WYDA 2KUMA 1L0WA 3KF6A 4DFAA 4JBJA 4KY5A 4A3MH 4IQZA 5J22A 4IJLA 2RSOA 1KL9A 1MD2D 3M85A 1K3RA 2XGTA 3S17H 3T16A 2YU9B 2MO1A 2LXKA 1LACA 5GAGC 1B4OA 1M1KC 2OTLA 5J39A 4XDXA 1H95A 4DR7Q 2FHTA 3I4NH 2K52A 3U4ZA 1BKBA 5C4JH 1I6HB 4DN4M 2ZTCA 4MN3A 4IN3A 2ZTEA 4YCVA 4DR7L 5C44B 2N88A 1EL0A 4UP9A 5C44G 1EYDA 4GNXC 4JVZA 4KHVA 3FDTA 4AH6A 2R61A 3TSSA 2NUCA 2Z4IA 3E5SA 3CC2A 4K8JA 4R1JA 1TS5A 2N3SA 4HMJA 1JJCB 2NN6G 3SK8A 1L1OB 4IOAA 4OXPA 1WJJA 1FR3A 3J81E 5JJKA 2C9OA 1EY5A 2E2HB 1FD7D 2K01A 1NBWA 1YZ6A 2BH8A 1YJ9A 4V190 2JK8A 1EQVA 3VYRA 3J80E 3I4MH 2KCMA 3SK4A 3TZUA 1EIGA 5M3MH 3J80c 3J81L 3AFQA 5IODA 1G6PA 1N8RC 2Z6KA 3T1YQ 1KNAA 2KECA 3C2PA 4GLVB 1A3VA 5KIXA 1VF7A 3K5OA 5IOCA 2VUMB 1IYUA 2QF7A 1K73C 1BCPF 2VUMG 2ID0A 3EQLC 3GQBA 3S1RH 4POFA 1X54A 3EIVA 5FJ8H 2EYMA 2K33A 1C8CA 5DNFA 3IAYA 1Q90A 5KNCA 1MGSA 3VA7A 1I4HA 2CWAA 4IUVA 2AQ2B 4XYOA 2F0LA 1CA5A 1VQPA 4DR3Q 2NVXH 2HQLA 1TWHB 2F0PA 1NR2A 3MA2B 1NR4A 1QNUA 3SHLA 3GTPB 4DR3L 3T53B 4XQNA 1HTLD 4KY7A 1ZYRC 4CDDC 2VXWA 4LJZC 4E6IA 3L3OC 4K6LA 2CQOA 2BE5D 3GTGB 4HR7B 4G57A 3O13A 1EY7A 1YIJA 2F0IA 4MHEA 4DV0Q 2K5VA 2NVQB 2B2UA 1F2MA 1PTOD 5HGTA 3I8ZA 1LT5D 4IUNA 1PH1A 2MNAA 4R9WA 3GTQH 1E3PA 1WTWA 3TRZA 3E3XA 3F8TA 5ISRA 4WJ4A 2R7DA 2J4XA 2WB1B 2OCEA 1WTXA 2WB1G 1VQNA 3HZXA 4G7ZC 1KD1C 2ICEC 3UE1A 1LO5D 4YWKA 1HXYD 3EA6A 1P16A 3KLRA 3NK9A 1JMCA 4C3HB 3CQZH 3MAQA 3E0JA 1LTSD 4C3HG 2X6GA 2K7VA 1B9NA 2L0CA 3BYYB 1EY6A 1SNQA 3MWYW 4RG1A 2ZM6Q 2JA5H 1YVCA 1GKHA 4MTKA 4A3FH 3K81C 2OT2A 5CV4A 4NW2A 5E4WC 3P20A 3MXNA 4LF7Q 1L0YB 3ER0A 4JW0A 1MIUA 2ZM6L 3S16H 1PLFA 1EWHA 4A4IA 2YYZA 1EY4A 1S5CD 1TWCH 3SDZA 2Z1CA 1XNRQ 3H3VC 2PMZE 3WDNA 3D6WA 1SAPA 4LF7L 3HOWH 5I6WA 2ASBA 1E0BA 5AFWA 3DWPA 2UUBL 2AWOA 3K0YA 4J6HA 4IPHA 2NWGA 3F2BA 4QJFA 4KTAA 4A3KH 3V05A 3OW2A 4JOIA 3AMUA 5C0XI 1S5BD 1XNRL 1CI3M 2PQAB 2LS01 2QGQA 5LL6S 1OO9B 1BBUA 3HS0C 1I5FA 1KHIA 5J1ZA 5C3EG 3HP3A 4JI4L 4KHZA 3A74A 1SNOA 1V1PA 3D3RA 4A76A 1GM5A 2HIXA 1VQDA 3KYHC 3G48A 1Q81C 1JORA 4JCVE 4H13C 5IT9E 2YU9H 2R93B 1OTCA 2N55A 5IT9c 4JBWA 1KDAA 2R93G 1BBXC 4CDEC 1Q1BA 4YWMA 2ICIA 5GROA 5IT9L 3MFYA 1O80A 3MHBA 1Y1WB 1N36Q 2K1BA 1VQ9A 1Y1WG 2LY7A 1BO0A 1LTAD 1PMRA 4QIWB 1I6HH 3T51B 2MO0A 2BH2A 4YY3Q 3GTOB 2XSCA 3V96A 1CFMA 5C44H 5JJZA 1E22A 1L1OC 4O1NA 1O7IA 1HQRD 5C3XA 3BDOA 3PUZA 1C48A 2F3IA 3H6MA 2NN6H 3GO5A 2F3VA 2F0SA 3FKIB 1S4ZA 2RDHA 4DA2A 1JOQA 3BJUA 4X3KA 1B44D 1QNKA 4JI3Q 1X32A 1SJHD 4OELB 1GXDC 1EWCA 2E2HH 1X9NA 4XQJA 2WKDA 1HH2P 1CA6A 3OPOA 1IXRA 2K28A 1ESRA 1HTPA 4JI3L 1PYSB 4DV6Q 4KN7C 3CAMA 3OOCA 1IL8A 2DJGC 2VUMH 3NXWA 2B8FA 2FMMA 4RGNA 2XRQD 4HJAA 2MQHA 3ZYYX 4DF7A 1WOCA 3J7YW 4DV6L 3C3LA 1HJPA 1BDOA 2A69D 1NMGA 2PI2E 4RCOA 1JOOA 4RGOS 1XXGA 1YNJC 3CW2C 2KBNA 4PMBA 2AKWB 5K36G 3CRKC 4R4CA 3SK6A 1TQOA 5EKLA 4IUUA 4BA2I 2F0WA 3KOJA 1PRTB 1IL2A 4A3GB 3NENA 5T1GA 1TWHH 4A3GG 4DK6C 4KY6A 2IJ0A 5EGTA 3NEMA 1U0LA 1DGSA 3TP5A 1Q86C 3GTPH 1XPOA 1HRJA 3NE5B 4ILWA 1SJED 3I3CA 1UWVA 1SYDA 2K32A 3GTGH 4AYBB 4BBSG 5BR8Q 4AYBG 2IPKD 2SEBD 2MGSA 4IPDA 1ZXTA 4EQ5A 3CMEA 3SK5A 2NVQH 1IKMA 5I2YA 5IWAQ 4Q5VA 1OXUA 1B8AA 3DM3A 5BR8L 3K5NA 2G5DA 2DY7A 4DR6Q 4K8IA 3DLLA 1U4RA 1WTHA 2Y0SB 1MSHA 2YTVA 5IGBA 3U9OA 5C3WA 3CCJA 2Y0SG 1XTCD 2KEEA 2D0OA 5KEEA 4DAYB 1NE3A 5IWAL 1HNWQ 1SXTA 1SFOB 1KABA 2K6AA 4DR6L 2SNMA 1TWGB 3OIPA 1HCZA 2HCCA 5FO7B 4C3HH 1HNWL 4GNXB 5FLMG 3U4VA 1VQJA 4QUFA 1TVXA 1EZ6A 2CWPA 1KNEA 2HDMA 4N9PA 3QJYA 1S72A 2KJXA 3PF4A 1J8IA 2LSSA 2PQEA 3DWQA 4G7OC 5G3LF 4V0BA 3GTLB 4P72A 4DAMA 1XTDA 3PV0A 1EOVA 3AYHB 3H0GB 4DAPA 4ZK9B 1VQ5A 1ESFA 5EJWA 2EXZA 3H0GG 3TBIB 3KBXA 1KRSA 5EKIA 3WOFA 3G6EA 3BDLA 4J8QA 5C0XJ 4FF4A 4NPSA 1CSPA 4FF3A 5D14A 3J7ZC 5C5MA 5CORA 1LLRD 2JXMB 2OEOA 3BG3A 4IPCA 2JEAI 3KJPA 4EX5A 2B2YA 4XXEA 4OWTB 4FP5D 4POGA 1LT3D 1V8QA 2O4XA 3DEPA 2F0MA 3L7ZC 1TT2A 5DM73 1PFBA 5C4XB 2UUAQ 1K9MC 3CC7A 3ERQA 5C4XG 1E24A 1A6XA 2Z4HA 3I90A 4HCSA 3RNUA 3TEHB 4OGQC 1KXLA 4H7BA 2B2TA 5IGEA 1PZJD 3MXUA 2BE5C 2NYZD 2V1CC 2UUAL 4HSPA 3CPFA 3QG1A 2R93H 2IT1A 2B39A 5IYCG 2R3ZA 4DV5Q 2F0KA 1VQ4A 3ZJYC 3UDFA 1LTLA 3TP8A 1HR0W 2H4OA 1PTOC 5C0XG 3JC66 1IYVA 1K83B 1Y1WH 2DJFC 4K2KA 3EVQA 3DUZA 4OIJA 4YCUA 2DNCA 5GADC 1HNXQ 3GTOH 4XQQA 1D2BA 3SXHA 4DUYL 1V1OA 4HIKA 2M00A 1RJTA 3G7LA 2A68D 2NVTH 1S3OA 4IUTA 4R8NA 2L5TA 1HNXL 1QB5D 2FFKB 1PFMA 5D3IB 4KMUC 2E2JB 3FKIH 4YCWA 1E2WA 4LNQA 4OL7A 2Z6KC 2ENBA 3FPUB 3QO2A 1A8VA 5JEAJ 2CHBD 5FOBB 3GV3A 4PG3A 4ABNA 3I2ZA 1TWFB 4UY8C 3E9HA 2XWBB 3STBD 1Y8PB 1G291 4I65A 1HZAA 3BZDB 2K5QA 3GDEA 2FINB 4IOCA 1QILA 2VQFQ 2EZVA 2IHFA 4XT3B 1I94Q 2GVAA 3ND9A 3F2DA 2AQ1B 1SMXA 4QCLA 1EY8A 2CVRA 1ENCA 3OW7A 2LXJA 1VS0A 4LF8Q 1VDZA 4RCNA 1B1ZA 3KF8B 1B3AA 2B2WC 2PO4A 5K36H 2P5ZX 4LFAQ 2PI2A 4NB3A 4U68A 2J0TD 1MKHA 2EYOA 4KKUA 3NELA 2XVSA 5LMNQ 4UHVA 4LF8L 3MFGA 5JEAG 3NBHA 1EQTA 4A3GH 5JJLA 4LFAL 1D5XC 4RGMA 4CKEA 5JPNC 1SE3A 4LAAA 2OWOA 5LMNL 2D5DA 3HEJA 2B2UC 2XRSD 4K14A 2CW0D 1PFNA 1II3A 2K5WA 4PMCA 4P75A 3I72A 4X62Q 1EYCA 3NQTA 4HJ8A 1BBWA 1Q3LA 1SYEA 5J3BA 1D5MC 3VYTA 1IBLQ 1CSQA 4L63B 1E7ZA 3CCEA 2G9DA 2EYJA 4APVA 3LGJA 4XT1B 4X62L 3E9IA 4MZ9A 5ELDA 3NTHA 4GKKQ 1F2LA 1X65A 1IBLL 3CD6A 1UEAB 5I4DA 1D5ZC 4X66Q 1S40A 2KEDA 4QF4A 5A35A 5LL6X 3KUPA 1SFOH 4YHHQ 1GHJA 1CK1A 4GKKL 1Q12A 1JC7A 4IO9A 5H1SE 1TWGH 2EJMA 1RL2A 3M7NA 1SEBD 1STNA 4X66L 5TSSA 3I4OA 5FLMH 3WWVA 2SNSA 1F77A 2JJQA 1BOSA 5IYDG 3M9BA 1IHZA 5EBCA 1FVIA 1UAPA 4HN7A 4WFN3 3J81c 2IL8A 4ZKBB 4FYDA 2EJFC 2Z8LA 2D9UA 2K5DA 2O2LD 4GN4B 3CCUA 3S2HB 1MJEA 3GTLH 4GN5A 3CCLA 1XX8A 3H0GH 1HFGA 2Q8IB 4JI7Q 2A69C 1YNNC 2JP1A 2WINB 4JOIC 4KKTA 2VY3A 4F8MA 2Q2TA 4X3SA 1PZKD 1KDBA 2M2LA 5EBDA 4A3JB 2KVMA 2JEBI 2PMZB 3T1YL 4A3JG 2F4IA 1OXVA 4JI7L 2R7FA 1C7YA 1SYBA 4PZ6A 3IFDA 5GAHC 3I55A 4HJ7A 4OO1H 2E75C 1K8MA 1HUMA 2LMCB 1I3QB 2A5HA 5C4XH 1Y1VB 4CJ0B 1DZ1A 1Y1VG 4LUZA 3NWTA 3X3NA 1Z6HA 3M7GA 1X56A 1VQKA 3PQIA 2JA6B 3K8AA 1BCPD 1UE7A 3IRBA 2JA6G 2ZJRA 5IYCH 4A93B 4A93G 1G51A 1C9OA 2F0FA 2EJGC 3MXGA 3PO2B 1E1OA 2GA4B 1LTID 1RTNA 3PO2G 3CMAA 2PPBC 4PV1C 1K83H 3BZCA 1DM0B 4F7XA 1GD7A 3HOXB 1TS2A 2EOTA 3HOXG 2QKIC 2D62A 2K5HA 2F1MA 3PUWA 2ZXRA 5CR3A 2E5LQ 4X65Q 1EWIA 2JA7B 5E7NA 2WAQE 4AQYQ 4DV0L 5IIFA 2JA7G 1M8AA 1H9KA 1AEXA 2C35B 4A3LH 3S1QB 1EIHA 2AWNA 2B2VC 4RHRA 4QUCA 1ET9A 5I6YA 2E2JH 2E5LL 2TSSA 4X65L 3KDFA 1QUQA 4P74A 4AQYL 5BN3A 3TREA 3PIO3 4FO2A 1DJRD 2I5LX 1TWFH 1CQVA 5NUCA 4L6TB 4RA8A 1Q7YC 3ONAB 4WORA 1RDPD 3PUVA 5BN4A 3OMCA 1G2TA 3N52A 3C46A 2PZUA 4DAYA 5FK9C 1G6ZA 1NCVA 5EAYA 1AZPA 4LF4Q 2EIFA 3GV6A 1JB7A 4ZQ3A 1CKNA 1PH2A 3T4AC 1F9PA 4DK3C 4H02A 5HURA 1AP0A 4DR5Q 4B3TQ 4UP7A 2VZAA 4GNXA 1YJWA 4LF4L 3K80C 4IFDJ 1PRTF 4GKJQ 2GN5A 3BVZA 1JE5A 5IGDA 1ET6A 4K2LA 5JEAH 2I5MX 5JVG3 4DR5L 4B3TL 1BNZA 4ME5A 3RZDB 3NWSA 2HT1A 3H3VH 5KYIA 1H9SA 3D0FA 3SE0A 4GKJL 1WTQA 1IBMQ 3KF6B 2NTSA 4Y7NB 5C3EB 4R4TA 2A1AA 2AUKA 2NVYB 5GQOA 4WRDA 1FGUA 1EY9A 2IW3A 1F9SA 5ELOA 1IBML 1BR9A 3Q24A 2MFIA 4OWXB 4LF6Q 4O0AA 1D7QA 2Q2HA 1VF5C 3TP7A 3ULPA 1BF4A 2HIVA 2NB0A 1FNWA 3QB3A 4L5RC 2A74C 3MTSA 4JBKA 2EPBA 2KHSA 2L11A 1EYGA 2RBMA 3D6CA 2CKZB 4L5TA 4LF6L 4IFDG 2A68C 2DGYA 4I7ZC 1Y8OB 4DR4Q 1MJCA 4C2MB 1PTOB 1XPUA 1FGBD 1KAWA 1SE2A 3ITPA 3A56A 4NKLA 4LFCQ 2B29A 1N36L 1QJOA 4P2CB 1YITA 2KENA 1OXSC 4GZYC 1X3GA 2NVTB 3D4WA 2IX3A 2NBFA 4JBMA 4DR4L 2ZJPA 1IZ6A 2OTJA 1JE4A 2XN9C 4YY3L 2AQ3B 3W3AA 4LFCL 4DV3Q 3STBC 5DM63 5IYDH 5LMNW 2QDBA 1LT6D 3DMUA 1STHA 1KIXA 3Q0AA 3JAME 5FKAC 4EQPA 2JA8B 4DXGA 5FO8B 2EVBA 1G2SA 3JAMc 4GOPC 1X3PA 2JA8G 2E74C 1O7LA 2Q2IA 2D0PA 3PUYA 4DV3L 3FP9A 5M5XB 3S2HH 3QWNA 1K8GA 2R92B 1HA5A 3JAML 1FNUA 2B2YC 1A63A 3J81i 4NP5A 2MJ8A 1PHJA 4AIMA 2R92G 2RCFA 2OF1A 5CV6A 1GUWA 3A8KE 1JJGA 1YJNA 2EY2A 3J80i 4DK0A 3VR2A 3CCRA 1SE4A 1SROA 3P7JA 5LMUQ 4A3JH 3QR8A 2TMPA 4JI0Q 2XTIA 4JI1Q 2B2TC 3S2DB 1YNND 3PUXA 3F2CA 2E76C 4M8AA 5L37A 1I3QH 3KLWA 5LMUL 1VQLA 1Y1VH 1B70B 3I73A 5AJ3Q 4JI0L 3PO3B 4B3RQ 4RFBA 3PO3G 1DD2A 2CW0C 4PMWA 1MSGA 3CCMA 4JI2Q 2JA6H 5CMDA 1PH7A 1ZKOA 3QIAA 1EFWA 5AJ3L 4A93H 1STAA 4DR1Q 4B3RL 3M4OB 3KF8A 3BDCA 4DR2Q 3PO2H 1QCBD 5JAVA 5E3FA 3M3YB 3AFPA 2Q2UA 4JI2L 2L9HA 1BXTA 2CH4A 3DEOA 3ND8A 3CCSA 4BBSB 1AW7A 3HOUG 3J7AV 5COYA 5KYLA 1HZBA 3RN2A 1HNZQ 5M9OA 4DR1L 2A19A 3SVMA 1TY2A 3PCOB 4DR2L 3HOXH 3R3OA 2F0JA 1B7YB 3HG9A 1MHWC 3A55A 1A2UA 1ASZA 1HNZL 2JA7H 1JWMD 1DYQA 3HOVB 1X55A 1WVLA 1CKMA 5CV7A 3HOVG 3S1QH 2BDOA 2YV5A 4CKCA 3HKZB 1K0RA 2QA4A 4PQXA 3HOYB 3HKZG 1R9TB 3HOYG 1A3TA 1M90C 3RMHA 3FMCA 4A3CG 4ODGA 1YHAA 2NN6I 2ATWA 4CDFC 1K8OA 3RZOB 1B50A 1CHQD 2LFNA 3OYYA 3I4NG 1LTBD 4FXDA 3R2IA 3W1BA 2BA0A 1UE6A 1NY4A 1EEFD 1GHKA 1GUGA 3FRPB 4CJ1B 2Q8TA 1N34Q 4Z9CB 1WTOA 2XWJB 3TS2A 2IWHA 2RVLA 3DM1A 2CH4W 3QOLA 4HMIA 5JPMC 1VQMA 3MXNB 3MZ5A 4ZCKA 1D1IA 4P73A 1VQ6A 1MI2A 1TWAB 1N34L 3C1EA 1ONLA 1RTOA 3H94A 4EQOA 3UE0A 1L1OA 2ZXOA 3ERSX 4C1NK 1Q82C 1YI2A 1R4PB 1ASYA 4JI8Q 1RKNA 2RCNA 5I2XA 3HFZB 1RHPA 3UDIA 3CCQA 3DHQA 4BY1B 1C4QA 4BY1G 3RZDH 5E1FA 2E2IB 3S14B 1BCPC 4CGYB 5D65A 1STEA 1KDCA 2HD3A 2Z0SA 4Y7NH 4IALA 4JI8L 5C3EH 4R4QA 4OX9Q 2NVYH 4OIKA 3CPWA 1AFPA 2BDNA 1JWUD 3L9AX 3L2PA 1H9RA 3PIOA 2AMCB 4BY7B 3IKJA 4DKAC 4BY7G 1A62A 5M3FB 1KTKA 4OX9L 4I7AA 1R4QB 2L1BA 5M3FG 4UDUC 4KHPQ 3RLFA 1Q46A 3OMGA 4LW1A 3B6YA 4QGUA 2PCFB 3A8IE 1I50B 1N9WA 3UDXA 4JK1C 2OQKA 4IFDH 4A3EG 3K57A 4DV5L 1B9MA 4GLAC 4C3IB 1G91A 4KHPL 1MBYA 1XMQQ 1CHPD 4C3IG 4C2MH 1GJXA 3RD4A 1PTOH 1XPRA 3KLSX 4X3UA 3P75A 2L12A 3J7AF 1D1KA 2VS1A 2QDLA 2WFWA 3VR5A 4DPGA 4JPBW 1IW7D 2I46A 1Q1EA 1SNDA 2K04A 1XNQQ 2IX0A 1LT4D 5JJIA 2KCTA 2WACA 1KLUD 3K7UC 4DGZA 1ICFB 2WV6D 3DXJC 3EJIA 2JA8H 2Z9HA 4OHJA 3AU7A 1LABA 4KD3A 2RDGA 3NTKA 4HEDA 1PH4A 1LV9A 4HSVA 1YNXA 5M5XH 1GUOA 3EBEA 3OWFA 2R92H 3J81j 4IZ8A 1TKWB 2L55A 1EUJA 4R4OA 3U50C 4KV6A 3FVQA 1S5DD 4DNRB 2EQSA 3D8GA 3W5OA
chains in the Genus database with same CATH topology
1C7YA 1GM5A 4A76A 1YBYA 1A0IA 2HIXA 1VQDA 3KYHC 3G48A 4PZ6A 5IYBG 4DV2Q 1Q81C 5GAHC 3I55A 4HJ7A 4JCVE 2YU9H 1WCMH 5C4XH 4BA1I 4DV7Q 4QIWE 1OTCA 2UUCL 4QY7A 5IT9c 4JBWA 3UDGA 2R93G 1Y1VG 4LUZA 2VL6A 1AE3A 4O2DA 4A3BG 4J15A 3G71A 3AEVA 3ULJA 1Q1BA 1NJIC 1X56A 4A3IG 4YWMA 2R7ZG 4DV2L 2CCZA 3S2DH 5GROA 1VQKA 2VQFL 3K8AA 1N36Q 1CKOA 1UE7A 3IRBA 4DV7L 1CKNB 1VQ9A 2ZJRA 2JA6G 1Y1WG 1I94L 3BZKA 5IYCH 1PH5A 2PNHA 1PA6A 2L15A 3J7A5 4A93G 2R92H 1I6HH 1G51A 2MO0A 2BH2A 1C9OA 4YY3Q 1VQ7A 3PO3H 1E1OA 4L5QA 3ULLA 2UU9Q 4JI7L 4HIMA 1GVPA 1HZCA 5C44H 3CMAA 3PO2G 1E22A 1WFQA 5IP7H 1L1OC 2K4KA 1K83H 3BZCA 4A3DH 2YTYA 1O7IA 1YHQA 4QL5A 2GVBA 1PV4A 1GD7A 3PUZA 3PF5A 4FDBA 2F3IA 2UU9L 3M4OH 3GO5A 2WP8J 1Z47A 3I4MG 3HOXG 2D62A 2K5HA 1P8LA 1X3FA 3PUWA 3M3YH 3BJUA 5M3MG 3CXCA 1QVGA 1N33Q 5HY6A 2E5LQ 4X65Q 1EWIA 4JI3Q 1PYBA 4X64Q 4BBSH 5E7NA 2WAQE 4AQYQ 1K8AC 4DV0L 1VQ8A 2JA7G 1D8LA 1RIPA 5IP9G 4GOPA 4A3KG 2E2HH 1SRUA 2C35B 4A3LH 1X9NA 1SLJA 2R93H 1HH2P 1IXRA 2AWNA 4C3JH 3GTKH 5IE8A 4X6AH 1OXTA 4B3SQ 4GS3A 4DV1Q 1N33L 2PQAA 2E2JH 2E5LL 4X65L 4JI3L 3KDFA 1QUQA 1PYSB 4P74A 4BBRH 1V1QA 4X64L 5FJ8G 4DV6Q 3GD7A 4AQYL 3CAMA 3HOZG 3CC4A 1VQGA 2VUMH 3TREA 1U5KA 3HOVH 2I5LX 1TWFH 4HJAA 2WAQG 2MQHA 4B3SL 4OO1G 4OONA 4DV1L 1WOCA 1Q7YC 2KHIA 2JE6I 2YTXA 4ME3A 3HOYH 3PUVA 5FLXc 4DV6L 1VQAA 1R9TH 4A3CH 5HGQA 1HJPA 2UXDQ 4JI5Q 1KC8C 1NMGA 2PI2E 1PH3A 4P71A 3TQYA 3CW2C 1LYLA 2KBNA 4LUOA 5EAYA 3RZOH 4LF4Q 2AKWB 2EIFA 4MNOA 1JB7A 2ES2A 5K36G 5IY0A 3RLOA 4BXXH 1W2BA 1CKNA 1SR3A 3MEFA 1PH2A 4R4CA 4YHHL 2UXDL 2BA1A 1L2FA 4IPGA 4JI5L 4DK3C 4NXMQ 4BA2I 4H02A 2B63G 4Y52H 3KOJA 1IL2A 4DUYQ 3NENA 3S1NH 1TWHH 4DR5Q 4B3TQ 1XMQL 4UP7A 2VZAA 4AYBE 4GNXA 1YJWA 4LF4L 4A3GG 4DK6C 3FHWA 3K80C 3NEMA 3I7FA 1U0LA 4IFDJ 4GKJQ 1PFSA 1DGSA 1FL0A 3A5ZB 4R4IA 3A5UA 2GN5A 1JE5A 1Q86C 4NXML 3GTPH 1XPOA 2I5MX 4GOPB 1TWAH 4DR5L 4B3TL 1XNQL 3TS0A 2ALYB 1UWVA 1X3EA 2HT1A 3GTGH 3H3VH 1GO3E 1EIFA 3D0FA 2N8NA 5DLQE 4GKJL 4BBSG 5BR8Q 1IBMQ 3KF6B 2Y0SE 4AYBG 4R4TA 3HKZE 2A1AA 4IPDA 1QVFA 5GQOA 4EQ5A 3CMEA 4A3LG 1FGUA 3JAMi 2NVQH 4BY1H 2DUDA 5IWAQ 1N32Q 1OXUA 1B8AA 4JI6Q 1PH8A 3DM3A 5BR8L 1IBML 3D31A 5ELOA 2R6GA 3H15A 2MFIA 2E2IH 3S14H 1OXXK 4DR6Q 3DLLA 4OWXB 4LF6Q 4O0AA 2AHOB 1V43A 1D7QA 2YTVA 2Q2HA 3ULPA 3CCJA 2HIVA 2Y0SG 4GN3B 1YEZA 2D0OA 4L5RC 4DAYB 1NE3A 5IWAL 4JBKA 1IBKQ 1HNWQ 4LUVA 3K0XA 1N32L 4JI6L 1EYGA 4BY7H 4A75A 1QZGA 2HHHQ 4L5SA 4DR6L 1UEBA 4L5TA 2CKZB 4LF6L 4IFDG 1XJVA 2DGYA 1W3SA 5M3FH 3EN2A 4XTCS 4DR4Q 1MJCA 1LM0A 2RHSB 1HZ9A 2JA5G 4HJ9A 1VQBA 4A3FG 4C3HH 1HNWL 1IBKL 1XPUA 3M4QA 1KAWA 1Y14B 3CP0A 5FLMG 4GNXB 3U4VA 3RN5A 4LFCQ 2B29A 1N36L 2HHHL 1VQJA 1I50H 3HKSA 4JC0A 1YITA 4A3EH 2KENA 2CWPA 1OXSC 1X3GA 1Z9FA 1EQRA 1VQFA 1NTGA 1S72A 4JBMA 1YHBA 3PF4A 2ZJPA 1IZ6A 4DR4L 2LSSA 4LFBQ 2OTJA 4YY3L 4C3IH 4DV4Q 1VQOA 1VQEA 1KRTA 2VW9A 5M5YH 4LFCL 4XIGS 3KFUA 4DV3Q 4P72A 4DAMA 1XTDA 3STBC 4DNIA 3VDYA 3PV0A 2UXCQ 1EOVA 3AYHB 3SGIA 5LMNW 5IYDH 1VQ5A 3HOUH 3HOWG 1NMFA 1J6QA 3E0EA 3H0GG 2OQ0A 3KJOA 1KIXA 1KRSA 4LFBL 3G6EA 5C0XJ 4PZ8A 3CCVA 4NPSA 3BU2A 4DV4L 4GOPC 3JAMc 1CSPA 2JA8G 3J7ZC 1LUZA 1C0AA 2Q2IA 2D0PA 3PUYA 4IPCA 4DV3L 3FP9A 2JEAI 2UXCL 3KJPA 1Q8KA 3S2HH 4IFDI 2F52A 1WYDA 4EX5A 1K8GA 1L0WA 1A63A 4OWTB 3KF6A 3J81i 1PHJA 4AIMA 2R92G 4JBJA 4POGA 1JJGA 1YJNA 4A3MH 4IJLA 1KL9A 3J80i 3M85A 3G4SA 1K3RA 2XGTA 3L7ZC 3S17H 3CCRA 2MO1A 2LXKA 1VQCA 4UP8A 1K9MC 3CC7A 2UUAQ 1WCMG 1PH9A 1E24A 1SROA 5GAGC 5C4XG 5LMUQ 4A3JH 4RMFA 3RNUA 1M1KC 1SN8A 3TEHB 4JI0Q 2OTLA 2XTIA 4JI1Q 1KXLA 1H95A 3PUXA 5IYBH 3F2CA 4DR7Q 3I4NH 1J5EQ 2K52A 2V1CC 3U4ZA 2UUAL 3CPFA 4K0KQ 1I3QH 3KLWA 3GTJH 1BKBA 1Y1VH 2IT1A 5IYCG 1B70B 5C4JH 5LMUL 1VQLA 4DV5Q 3W1GA 5AJ3Q 4JI0L 4A3BH 2ZTCA 4KLKA 1VQ4A 1EQQA 1PH6A 3ZJYC 4JV5Q 1JJ2A 3UDFA 4A3IH 1LTLA 2R7ZH 2ZTEA 4B3RQ 4YCVA 3PO3G 4DR7L 1HR0W 4PMWA 1HR0Q 5C0XG 2E8GA 4UP9A 5C44G 3JC66 3CCMA 4JI2Q 4GNXC 1J5EL 2JA6H 1VQHA 5IP7G 1Y1WH 1PH7A 3S1MH 4K0KL 1EFWA 4UPAA 4AH6A 1AH9A 4YCUA 5AJ3L 2ZTDA 4A93H 4JV5L 4A3DG 3CC2A 2CFMA 4DR1Q 4R1JA 4B3RL 5GADC 1HNXQ 3NBHB 1QZHA 3GTOH 3PO2H 2N3SA 4DUYL 1JJCB 2NN6G 5ELNA 4DR2Q 1HR0L 4OO1I 1L1OB 3AFPA 4HIKA 2Q2UA 4JI2L 4IOAA 4OXPA 1WJJA 3CCSA 3HOUG 5JJKA 2UUBQ 4NXNQ 1HNZQ 2KHJA 1HZBA 3RN2A 2NVTH 1S3OA 4DR1L 2A19A 1HNXL 1NBWA 1YZ6A 2BH8A 4KI0A 3S15H 1YJ9A 2F4VQ 2JK8A 3PCOB 3HOXH 4DR2L 3I4MH 1IYJB 2KCMA 3J80c 1B7YB 5M3MH 3FKIH 2H5XA 3AFQA 4YCWA 1UE5A 1N8RC 4LNQA 1G6PA 2Z6KC 2Z6KA 4TQUS 4NXNL 3T1YQ 1HNZL 1ASZA 4BBRG 1A8VA 5JEAJ 2JA7H 5IP9H 1VCIA 4JI4Q 4GLVB 4PG3A 1K73C 2I5HA 1X55A 3I2ZA 1FJGQ 1CKMA 2F4VL 2VUMG 2ID0A 3HOVG 4UY8C 3S1QH 2YV5A 3E9HA 3S1RH 1WI5A 1K0RA 2K50A 4POFA 3STBD 2QA4A 1X54A 2NZOA 5M5WH 2VQEQ 3EIVA 3HKZG 2UXBQ 1G291 5FJ8H 4LWCA 3HOYG 2B3GA 1HZAA 1M90C 3HOZH 4A3CG 1XMOQ 1YHAA 3S24A 1FJGL 2NN6I 3GDEA 2ATWA 4IOCA 3OYYA 2VQFQ 3I4NG 2CWAA 2QEXA 2ZJQA 2IHFA 2A8VA 3W1BA 2VQEL 2BA0A 1UE6A 1I94Q 2GVAA 2UXBL 1NY4A 3F2DA 4BXXG 1CUKA 1SMXA 3A0JA 1VQPA 4DR3Q 1XMOL 2NVXH 2HQLA 1TXYA 2LXJA 4JG2A 1VS0A 4LF8Q 1N34Q 3K7AH 4OWWB 3KF8B 3TS2A 4LFAQ 2PI2A 4NB3A 1VQMA 3MXNB 4MTNA 4P73A 1MKHA 4DR3L 3NELA 2B63H 1VQ6A 1UE1A 1SE8A 5LMNQ 2N49A 4LF8L 1N34L 5JEAG 3Q8DA 4A3GH 2CQOA 5JJLA 3CF5A 3UE0A 1L1OA 4GLXA 3ERSX 1EIYB 4LFAL 1VQIA 1Q82C 4QQBX 2IY5B 3GTMH 1YI2A 2K5NA 1QVCA 3OTOQ 1YIJA 3PIPA 4DV0Q 2VNUD 2JA9A 4HIDA 1ASYA 2K5VA 1T9HA 2OWOA 5LMNL 3ICEA 4JI8Q 2RCNA 2WB1E 3HFZB 3UDIA 4WJ3M 3CCQA 4P75A 2EXDA 3FKIG 3I56A 1BVSA 4BY1G 5GAEC 2K75A 4X62Q 3RZDH 1PH1A 4ALPA 2MNAA 2NZHA 2RF4A 3GTQH 4HJ8A 1BBWA 1KQSA 3OTOL 4LF5Q 1E3PA 2Z0SA 5J3BA 4Y7NH 3TRZA 4LF9Q 4JI8L 5C3EH 1IBLQ 4R4QA 4OX9Q 1E1TA 2NVYH 1CSQA 3CPWA 3U58A 3F8TA 1E7ZA 3CCEA 4WJ4A 2R7DA 4APVA 3LGJA 3T1HQ 3L2PA 2RHQB 4X62L 3PIOA 2AMCB 2OCEA 3E9IA 3RLNA 2I0QA 2WB1G 1VQNA 4LF5L 4DKAC 4MZ9A 4BY7G 1A62A 1KD1C 2IHEA 3UE1A 4YWKA 4LF9L 4GKKQ 1P16A 1X65A 1IBLL 1JT8A 4OX9L 5M3FG 1JMCA 3CD6A 4JI1L 2N78A 4KHPQ 3CQZH 3T1HL 3RLFA 1Q46A 3RR5A 4LW1A 3H3VI 4TVAB 4X66Q 3B6YA 1S40A 4QGUA 3F1ZA 1N9WA 3UDXA 1SFOH 4YHHQ 2OQKA 4GKKL 1Q12A 4A3EG 4RG1A 4IO9A 4DV5L 5H1SE 2ZM6Q 4GLAC 1TWGH 2JA5H 1RL2A 1YVCA 4KHPL 3M7NA 4PZ7A 1GKHA 1XMQQ 4A3FH 4C2MH 3PGZA 3K81C 4X66L 4IJHA 3I4OA 5FLMH 3WWVA 4DUZQ 1XPRA 2FXQA 2JJQA 5IYDG 4LF7Q 3ER0A 3M9BA 4JYAQ 1MIUA 2VS1A 2WFWA 1FVIA 4DPGA 1PVOA 2ZM6L 3S16H 3J81c 4A4IA 2YYZA 1Q1EA 1XNQQ 2IX0A 1TWCH 3PSIA 2JQOA 1XNRQ 3CCUA 4GN4B 1AE2A 2PMZE 4DUZL 1MJEA 5JJIA 2KCTA 3GTLH 4LF7L 2R7FA 3HOWH 1X6OA 4GN5A 3CCLA 2ASBA 3H0GH 4JYAL 2UUBL 2AWOA 4B3MQ 3M4PA 3K7UC 2K14A 4IPHA 3AQQA 3F2BA 4A3KH 4QJFA 4JI7Q 2IX1A 2JA8H 4YWLA 3OW2A 4JOIA 4JOIC 4A3MG 5C0XI 2VY3A 1XNRL 2Q2TA 4HIOA 2PQAB 2QGQA 3KDFB 1QUQB 1PH4A 1BBUA 1I5FA 1YNXA 5M5XH 2UUCQ 2JEBI 3EBEA 3T1YL 1KHIA 3J81j 1V9PA 4R4OA 3U50C 1EUJA 5C3EG 4HJ5A 4A3JG 4B3ML 4JI4L 1OXVA 2EQSA 3A74A 3L0OA 4KHZA 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7Y A;  1GM5 A;  4A76 A;  1YBY A;  1A0I A;  2HIX A;  1VQD A;  3KYH C;  3G48 A;  4PZ6 A;  5IYB G;  4DV2 Q;  1Q81 C;  5GAH C;  3I55 A;  4HJ7 A;  4JCV E;  2YU9 H;  1WCM H;  5C4X H;  4BA1 I;  4DV7 Q;  4QIW E;  1OTC A;  2UUC L;  4QY7 A;  5IT9 c;  4JBW A;  3UDG A;  2R93 G;  1Y1V G;  4LUZ A;  2VL6 A;  1AE3 A;  4O2D A;  4A3B G;  4J15 A;  3G71 A;  3AEV A;  3ULJ A;  1Q1B A;  1NJI C;  1X56 A;  4A3I G;  4YWM A;  2R7Z G;  4DV2 L;  2CCZ A;  3S2D H;  5GRO A;  1VQK A;  2VQF L;  3K8A A;  1N36 Q;  1CKO A;  1UE7 A;  3IRB A;  4DV7 L;  1CKN B;  1VQ9 A;  2ZJR A;  2JA6 G;  1Y1W G;  1I94 L;  3BZK A;  5IYC H;  1PH5 A;  2PNH A;  1PA6 A;  2L15 A;  3J7A 5;  4A93 G;  2R92 H;  1I6H H;  1G51 A;  2MO0 A;  2BH2 A;  1C9O A;  4YY3 Q;  1VQ7 A;  3PO3 H;  1E1O A;  4L5Q A;  3ULL A;  2UU9 Q;  4JI7 L;  4HIM A;  1GVP A;  1HZC A;  5C44 H;  3CMA A;  3PO2 G;  1E22 A;  1WFQ A;  5IP7 H;  1L1O C;  2K4K A;  1K83 H;  3BZC A;  4A3D H;  2YTY A;  1O7I A;  1YHQ A;  4QL5 A;  2GVB A;  1PV4 A;  1GD7 A;  3PUZ A;  3PF5 A;  4FDB A;  2F3I A;  2UU9 L;  3M4O H;  3GO5 A;  2WP8 J;  1Z47 A;  3I4M G;  3HOX G;  2D62 A;  2K5H A;  1P8L A;  1X3F A;  3PUW A;  3M3Y H;  3BJU A;  5M3M G;  3CXC A;  1QVG A;  1N33 Q;  5HY6 A;  2E5L Q;  4X65 Q;  1EWI A;  4JI3 Q;  1PYB A;  4X64 Q;  4BBS H;  5E7N A;  2WAQ E;  4AQY Q;  1K8A C;  4DV0 L;  1VQ8 A;  2JA7 G;  1D8L A;  1RIP A;  5IP9 G;  4GOP A;  4A3K G;  2E2H H;  1SRU A;  2C35 B;  4A3L H;  1X9N A;  1SLJ A;  2R93 H;  1HH2 P;  1IXR A;  2AWN A;  4C3J H;  3GTK H;  5IE8 A;  4X6A H;  1OXT A;  4B3S Q;  4GS3 A;  4DV1 Q;  1N33 L;  2PQA A;  2E2J H;  2E5L L;  4X65 L;  4JI3 L;  3KDF A;  1QUQ A;  1PYS B;  4P74 A;  4BBR H;  1V1Q A;  4X64 L;  5FJ8 G;  4DV6 Q;  3GD7 A;  4AQY L;  3CAM A;  3HOZ G;  3CC4 A;  1VQG A;  2VUM H;  3TRE A;  1U5K A;  3HOV H;  2I5L X;  1TWF H;  4HJA A;  2WAQ G;  2MQH A;  4B3S L;  4OO1 G;  4OON A;  4DV1 L;  1WOC A;  1Q7Y C;  2KHI A;  2JE6 I;  2YTX A;  4ME3 A;  3HOY H;  3PUV A;  5FLX c;  4DV6 L;  1VQA A;  1R9T H;  4A3C H;  5HGQ A;  1HJP A;  2UXD Q;  4JI5 Q;  1KC8 C;  1NMG A;  2PI2 E;  1PH3 A;  4P71 A;  3TQY A;  3CW2 C;  1LYL A;  2KBN A;  4LUO A;  5EAY A;  3RZO H;  4LF4 Q;  2AKW B;  2EIF A;  4MNO A;  1JB7 A;  2ES2 A;  5K36 G;  5IY0 A;  3RLO A;  4BXX H;  1W2B A;  1CKN A;  1SR3 A;  3MEF A;  1PH2 A;  4R4C A;  4YHH L;  2UXD L;  2BA1 A;  1L2F A;  4IPG A;  4JI5 L;  4DK3 C;  4NXM Q;  4BA2 I;  4H02 A;  2B63 G;  4Y52 H;  3KOJ A;  1IL2 A;  4DUY Q;  3NEN A;  3S1N H;  1TWH H;  4DR5 Q;  4B3T Q;  1XMQ L;  4UP7 A;  2VZA A;  4AYB E;  4GNX A;  1YJW A;  4LF4 L;  4A3G G;  4DK6 C;  3FHW A;  3K80 C;  3NEM A;  3I7F A;  1U0L A;  4IFD J;  4GKJ Q;  1PFS A;  1DGS A;  1FL0 A;  3A5Z B;  4R4I A;  3A5U A;  2GN5 A;  1JE5 A;  1Q86 C;  4NXM L;  3GTP H;  1XPO A;  2I5M X;  4GOP B;  1TWA H;  4DR5 L;  4B3T L;  1XNQ L;  3TS0 A;  2ALY B;  1UWV A;  1X3E A;  2HT1 A;  3GTG H;  3H3V H;  1GO3 E;  1EIF A;  3D0F A;  2N8N A;  5DLQ E;  4GKJ L;  4BBS G;  5BR8 Q;  1IBM Q;  3KF6 B;  2Y0S E;  4AYB G;  4R4T A;  3HKZ E;  2A1A A;  4IPD A;  1QVF A;  5GQO A;  4EQ5 A;  3CME A;  4A3L G;  1FGU A;  3JAM i;  2NVQ H;  4BY1 H;  2DUD A;  5IWA Q;  1N32 Q;  1OXU A;  1B8A A;  4JI6 Q;  1PH8 A;  3DM3 A;  5BR8 L;  1IBM L;  3D31 A;  5ELO A;  2R6G A;  3H15 A;  2MFI A;  2E2I H;  3S14 H;  1OXX K;  4DR6 Q;  3DLL A;  4OWX B;  4LF6 Q;  4O0A A;  2AHO B;  1V43 A;  1D7Q A;  2YTV A;  2Q2H A;  3ULP A;  3CCJ A;  2HIV A;  2Y0S G;  4GN3 B;  1YEZ A;  2D0O A;  4L5R C;  4DAY B;  1NE3 A;  5IWA L;  4JBK A;  1IBK Q;  1HNW Q;  4LUV A;  3K0X A;  1N32 L;  4JI6 L;  1EYG A;  4BY7 H;  4A75 A;  1QZG A;  2HHH Q;  4L5S A;  4DR6 L;  1UEB A;  4L5T A;  2CKZ B;  4LF6 L;  4IFD G;  1XJV A;  2DGY A;  1W3S A;  5M3F H;  3EN2 A;  4XTC S;  4DR4 Q;  1MJC A;  1LM0 A;  2RHS B;  1HZ9 A;  2JA5 G;  4HJ9 A;  1VQB A;  4A3F G;  4C3H H;  1HNW L;  1IBK L;  1XPU A;  3M4Q A;  1KAW A;  1Y14 B;  3CP0 A;  5FLM G;  4GNX B;  3U4V A;  3RN5 A;  4LFC Q;  2B29 A;  1N36 L;  2HHH L;  1VQJ A;  1I50 H;  3HKS A;  4JC0 A;  1YIT A;  4A3E H;  2KEN A;  2CWP A;  1OXS C;  1X3G A;  1Z9F A;  1EQR A;  1VQF A;  1NTG A;  1S72 A;  4JBM A;  1YHB A;  3PF4 A;  2ZJP A;  1IZ6 A;  4DR4 L;  2LSS A;  4LFB Q;  2OTJ A;  4YY3 L;  4C3I H;  4DV4 Q;  1VQO A;  1VQE A;  1KRT A;  2VW9 A;  5M5Y H;  4LFC L;  4XIG S;  3KFU A;  4DV3 Q;  4P72 A;  4DAM A;  1XTD A;  3STB C;  4DNI A;  3VDY A;  3PV0 A;  2UXC Q;  1EOV A;  3AYH B;  3SGI A;  5LMN W;  5IYD H;  1VQ5 A;  3HOU H;  3HOW G;  1NMF A;  1J6Q A;  3E0E A;  3H0G G;  2OQ0 A;  3KJO A;  1KIX A;  1KRS A;  4LFB L;  3G6E A;  5C0X J;  4PZ8 A;  3CCV A;  4NPS A;  3BU2 A;  4DV4 L;  4GOP C;  3JAM c;  1CSP A;  2JA8 G;  3J7Z C;  1LUZ A;  1C0A A;  2Q2I A;  2D0P A;  3PUY A;  4IPC A;  4DV3 L;  3FP9 A;  2JEA I;  2UXC L;  3KJP A;  1Q8K A;  3S2H H;  4IFD I;  2F52 A;  1WYD A;  4EX5 A;  1K8G A;  1L0W A;  1A63 A;  4OWT B;  3KF6 A;  3J81 i;  1PHJ A;  4AIM A;  2R92 G;  4JBJ A;  4POG A;  1JJG A;  1YJN A;  4A3M H;  4IJL A;  1KL9 A;  3J80 i;  3M85 A;  3G4S A;  1K3R A;  2XGT A;  3L7Z C;  3S17 H;  3CCR A;  2MO1 A;  2LXK A;  1VQC A;  4UP8 A;  1K9M C;  3CC7 A;  2UUA Q;  1WCM G;  1PH9 A;  1E24 A;  1SRO A;  5GAG C;  5C4X G;  5LMU Q;  4A3J H;  4RMF A;  3RNU A;  1M1K C;  1SN8 A;  3TEH B;  4JI0 Q;  2OTL A;  2XTI A;  4JI1 Q;  1KXL A;  1H95 A;  3PUX A;  5IYB H;  3F2C A;  4DR7 Q;  3I4N H;  1J5E Q;  2K52 A;  2V1C C;  3U4Z A;  2UUA L;  3CPF A;  4K0K Q;  1I3Q H;  3KLW A;  3GTJ H;  1BKB A;  1Y1V H;  2IT1 A;  5IYC G;  1B70 B;  5C4J H;  5LMU L;  1VQL A;  4DV5 Q;  3W1G A;  5AJ3 Q;  4JI0 L;  4A3B H;  2ZTC A;  4KLK A;  1VQ4 A;  1EQQ A;  1PH6 A;  3ZJY C;  4JV5 Q;  1JJ2 A;  3UDF A;  4A3I H;  1LTL A;  2R7Z H;  2ZTE A;  4B3R Q;  4YCV A;  3PO3 G;  4DR7 L;  1HR0 W;  4PMW A;  1HR0 Q;  5C0X G;  2E8G A;  4UP9 A;  5C44 G;  3JC6 6;  3CCM A;  4JI2 Q;  4GNX C;  1J5E L;  2JA6 H;  1VQH A;  5IP7 G;  1Y1W H;  1PH7 A;  3S1M H;  4K0K L;  1EFW A;  4UPA A;  4AH6 A;  1AH9 A;  4YCU A;  5AJ3 L;  2ZTD A;  4A93 H;  4JV5 L;  4A3D G;  3CC2 A;  2CFM A;  4DR1 Q;  4R1J A;  4B3R L;  5GAD C;  1HNX Q;  3NBH B;  1QZH A;  3GTO H;  3PO2 H;  2N3S A;  4DUY L;  1JJC B;  2NN6 G;  5ELN A;  4DR2 Q;  1HR0 L;  4OO1 I;  1L1O B;  3AFP A;  4HIK A;  2Q2U A;  4JI2 L;  4IOA A;  4OXP A;  1WJJ A;  3CCS A;  3HOU G;  5JJK A;  2UUB Q;  4NXN Q;  1HNZ Q;  2KHJ A;  1HZB A;  3RN2 A;  2NVT H;  1S3O A;  4DR1 L;  2A19 A;  1HNX L;  1NBW A;  1YZ6 A;  2BH8 A;  4KI0 A;  3S15 H;  1YJ9 A;  2F4V Q;  2JK8 A;  3PCO B;  3HOX H;  4DR2 L;  3I4M H;  1IYJ B;  2KCM A;  3J80 c;  1B7Y B;  5M3M H;  3FKI H;  2H5X A;  3AFQ A;  4YCW A;  1UE5 A;  1N8R C;  4LNQ A;  1G6P A;  2Z6K C;  2Z6K A;  4TQU S;  4NXN L;  3T1Y Q;  1HNZ L;  1ASZ A;  4BBR G;  1A8V A;  5JEA J;  2JA7 H;  5IP9 H;  1VCI A;  4JI4 Q;  4GLV B;  4PG3 A;  1K73 C;  2I5H A;  1X55 A;  3I2Z A;  1FJG Q;  1CKM A;  2F4V L;  2VUM G;  2ID0 A;  3HOV G;  4UY8 C;  3S1Q H;  2YV5 A;  3E9H A;  3S1R H;  1WI5 A;  1K0R A;  2K50 A;  4POF A;  3STB D;  2QA4 A;  1X54 A;  2NZO A;  5M5W H;  2VQE Q;  3EIV A;  3HKZ G;  2UXB Q;  1G29 1;  5FJ8 H;  4LWC A;  3HOY G;  2B3G A;  1HZA A;  1M90 C;  3HOZ H;  4A3C G;  1XMO Q;  1YHA A;  3S24 A;  1FJG L;  2NN6 I;  3GDE A;  2ATW A;  4IOC A;  3OYY A;  2VQF Q;  3I4N G;  2CWA A;  2QEX A;  2ZJQ A;  2IHF A;  2A8V A;  3W1B A;  2VQE L;  2BA0 A;  1UE6 A;  1I94 Q;  2GVA A;  2UXB L;  1NY4 A;  3F2D A;  4BXX G;  1CUK A;  1SMX A;  3A0J A;  1VQP A;  4DR3 Q;  1XMO L;  2NVX H;  2HQL A;  1TXY A;  2LXJ A;  4JG2 A;  1VS0 A;  4LF8 Q;  1N34 Q;  3K7A H;  4OWW B;  3KF8 B;  3TS2 A;  4LFA Q;  2PI2 A;  4NB3 A;  1VQM A;  3MXN B;  4MTN A;  4P73 A;  1MKH A;  4DR3 L;  3NEL A;  2B63 H;  1VQ6 A;  1UE1 A;  1SE8 A;  5LMN Q;  2N49 A;  4LF8 L;  1N34 L;  5JEA G;  3Q8D A;  4A3G H;  2CQO A;  5JJL A;  3CF5 A;  3UE0 A;  1L1O A;  4GLX A;  3ERS X;  1EIY B;  4LFA L;  1VQI A;  1Q82 C;  4QQB X;  2IY5 B;  3GTM H;  1YI2 A;  2K5N A;  1QVC A;  3OTO Q;  1YIJ A;  3PIP A;  4DV0 Q;  2VNU D;  2JA9 A;  4HID A;  1ASY A;  2K5V A;  1T9H A;  2OWO A;  5LMN L;  3ICE A;  4JI8 Q;  2RCN A;  2WB1 E;  3HFZ B;  3UDI A;  4WJ3 M;  3CCQ A;  4P75 A;  2EXD A;  3FKI G;  3I56 A;  1BVS A;  4BY1 G;  5GAE C;  2K75 A;  4X62 Q;  3RZD H;  1PH1 A;  4ALP A;  2MNA A;  2NZH A;  2RF4 A;  3GTQ H;  4HJ8 A;  1BBW A;  1KQS A;  3OTO L;  4LF5 Q;  1E3P A;  2Z0S A;  5J3B A;  4Y7N H;  3TRZ A;  4LF9 Q;  4JI8 L;  5C3E H;  1IBL Q;  4R4Q A;  4OX9 Q;  1E1T A;  2NVY H;  1CSQ A;  3CPW A;  3U58 A;  3F8T A;  1E7Z A;  3CCE A;  4WJ4 A;  2R7D A;  4APV A;  3LGJ A;  3T1H Q;  3L2P A;  2RHQ B;  4X62 L;  3PIO A;  2AMC B;  2OCE A;  3E9I A;  3RLN A;  2I0Q A;  2WB1 G;  1VQN A;  4LF5 L;  4DKA C;  4MZ9 A;  4BY7 G;  1A62 A;  1KD1 C;  2IHE A;  3UE1 A;  4YWK A;  4LF9 L;  4GKK Q;  1P16 A;  1X65 A;  1IBL L;  1JT8 A;  4OX9 L;  5M3F G;  1JMC A;  3CD6 A;  4JI1 L;  2N78 A;  4KHP Q;  3CQZ H;  3T1H L;  3RLF A;  1Q46 A;  3RR5 A;  4LW1 A;  3H3V I;  4TVA B;  4X66 Q;  3B6Y A;  1S40 A;  4QGU A;  3F1Z A;  1N9W A;  3UDX A;  1SFO H;  4YHH Q;  2OQK A;  4GKK L;  1Q12 A;  4A3E G;  4RG1 A;  4IO9 A;  4DV5 L;  5H1S E;  2ZM6 Q;  4GLA C;  1TWG H;  2JA5 H;  1RL2 A;  1YVC A;  4KHP L;  3M7N A;  4PZ7 A;  1GKH A;  1XMQ Q;  4A3F H;  4C2M H;  3PGZ A;  3K81 C;  4X66 L;  4IJH A;  3I4O A;  5FLM H;  3WWV A;  4DUZ Q;  1XPR A;  2FXQ A;  2JJQ A;  5IYD G;  4LF7 Q;  3ER0 A;  3M9B A;  4JYA Q;  1MIU A;  2VS1 A;  2WFW A;  1FVI A;  4DPG A;  1PVO A;  2ZM6 L;  3S16 H;  3J81 c;  4A4I A;  2YYZ A;  1Q1E A;  1XNQ Q;  2IX0 A;  1TWC H;  3PSI A;  2JQO A;  1XNR Q;  3CCU A;  4GN4 B;  1AE2 A;  2PMZ E;  4DUZ L;  1MJE A;  5JJI A;  2KCT A;  3GTL H;  4LF7 L;  2R7F A;  3HOW H;  1X6O A;  4GN5 A;  3CCL A;  2ASB A;  3H0G H;  4JYA L;  2UUB L;  2AWO A;  4B3M Q;  3M4P A;  3K7U C;  2K14 A;  4IPH A;  3AQQ A;  3F2B A;  4A3K H;  4QJF A;  4JI7 Q;  2IX1 A;  2JA8 H;  4YWL A;  3OW2 A;  4JOI A;  4JOI C;  4A3M G;  5C0X I;  2VY3 A;  1XNR L;  2Q2T A;  4HIO A;  2PQA B;  2QGQ A;  3KDF B;  1QUQ B;  1PH4 A;  1BBU A;  1I5F A;  1YNX A;  5M5X H;  2UUC Q;  2JEB I;  3EBE A;  3T1Y L;  1KHI A;  3J81 j;  1V9P A;  4R4O A;  3U50 C;  1EUJ A;  5C3E G;  4HJ5 A;  4A3J G;  4B3M L;  4JI4 L;  1OXV A;  2EQS A;  3A74 A;  3L0O A;  4KHZ A;  3W5O A; 
#chains in the Genus database with same CATH topology
 2O5I C;  1A0I A;  4DV2 Q;  5IYB G;  4DXF A;  1U4M A;  4RKL A;  3GTJ B;  4BA1 I;  3NPP A;  3PMF A;  2KCN A;  4A3B B;  4O2D A;  4A3I B;  4A3B G;  4J15 A;  2R7Z B;  2KOL A;  3ULJ A;  1NJI C;  5I9P A;  4A3I G;  2R7Z G;  4DV2 L;  2CCZ A;  3S2D H;  2VQF L;  3S1M B;  1CKO A;  2ZT9 C;  3H09 A;  1I94 L;  3FPP A;  2PW7 A;  3BZK A;  2L15 A;  3MXP A;  1VQ7 A;  3PO3 H;  5ELF A;  2EY1 A;  1HZC A;  5DAU A;  1PZI D;  4CJ2 C;  3G6J B;  3K59 A;  3S15 B;  1HFN A;  2GVB A;  1PV4 A;  3PF5 A;  4FDB A;  3M4O H;  1A15 A;  1Z47 A;  1P8L A;  3K5M A;  3M3Y H;  1EYA A;  3CXC A;  1QVG A;  1VMC A;  5HY6 A;  1SSO A;  4BBS H;  1VQ8 A;  3F2U A;  5IP9 G;  4A3K G;  1SRU A;  4ZUJ A;  2K03 A;  4J1M A;  1DXM A;  3LWU A;  4X6A H;  2EYP A;  2MP1 A;  5M5W B;  4B3S Q;  4GS3 A;  4FF1 A;  4DV1 Q;  2PQA A;  3HOZ B;  3GD7 A;  5KGU A;  2PZW A;  4C56 C;  3HOZ G;  3CC4 A;  2WAQ B;  3HOV H;  1F9R A;  2WAQ G;  4B3S L;  1W6K A;  1SYC A;  2SDF A;  4DV1 L;  2KHI A;  1H9J A;  3NHH A;  2JE6 I;  2YTX A;  4ME3 A;  3HOY H;  2KQ3 A;  1GOZ A;  1SYF A;  1R9T H;  4A3C H;  2WKC A;  2UXD Q;  1CTM A;  1O78 A;  3K7A B;  1TU2 B;  4P71 A;  1ICW A;  4LUO A;  3RZO H;  2ES2 A;  5IGC A;  5CV8 A;  2VB2 X;  1W2B A;  1CZG A;  1SR3 A;  3MEF A;  4YHH L;  2B63 B;  2UXD L;  2BA1 A;  4Y52 H;  2F3W A;  2B63 G;  2F0G A;  4Q0F A;  2RSN A;  1U9R A;  2MPM A;  1KLG D;  4HAE A;  3FHW A;  3GTM B;  4IUQ A;  2QW7 A;  2PYK A;  1FL0 A;  2RA4 A;  3A5Z B;  3LX0 A;  4R4I A;  3MVV A;  4K5X A;  1TY0 A;  4GOP B;  1TWA H;  1DOK A;  3Q6S A;  2DNE A;  3TS0 A;  2ALY B;  2M9V A;  5EQ0 A;  3P1H A;  1EIF A;  1CQF A;  4DAV A;  3R93 A;  4ZKC B;  2JN4 A;  2MHV A;  2Z6B A;  2E2D C;  3BVM A;  4BY1 H;  2DUD A;  1N32 Q;  3BS1 A;  2I07 B;  3D31 A;  2R6G A;  3H15 A;  2F0V A;  1Y8N B;  2HUG A;  2E2I H;  1OXX K;  3OWE B;  3J80 L;  3S14 H;  5CBA E;  1F9Q A;  1Q8I A;  1J9O A;  3MC0 B;  1N32 L;  3K0X A;  1BUV T;  4BY7 H;  1UEB A;  1B53 A;  4U67 3;  4S3S A;  1ZEQ X;  1XJV A;  4EGV A;  5M3F H;  4XTC S;  4KK7 A;  4FVM A;  2PW5 A;  1Y14 B;  3RN5 A;  5C0X H;  2A6E D;  1I50 H;  4JC0 A;  1PTO F;  4A3E H;  4DU9 A;  2ZXP A;  1Z9F A;  1YHB A;  3U9S A;  4C3I H;  4DV4 Q;  1HQM C;  2B2W A;  1VQE A;  2VW9 A;  3KFU A;  4N9T A;  3VDY A;  1S5F D;  2F0N A;  5DEH A;  5CV5 A;  3SGI A;  5KNB A;  1CZW A;  2OQ0 A;  1BQQ T;  3CCV A;  3IFT A;  4DV4 L;  3LNN A;  1A2T A;  1C0A A;  2HCI A;  3SEB A;  3K58 A;  3NP8 A;  2K05 A;  2F52 A;  1QE6 A;  2LKV A;  1JB3 A;  4K6D A;  5FO9 B;  4R8I A;  5JVH 3;  1SNM A;  3G4S A;  1WCM B;  5E4X A;  2A6H D;  1UUP A;  1VQC A;  4UP8 A;  3IL8 A;  1WCM G;  1PH9 A;  4F87 A;  4RMF A;  1SN8 A;  2WII B;  3TDQ A;  1A3U A;  1W6J A;  5IYB H;  1J5E Q;  2DY8 A;  1RCV D;  1X3Q A;  5T1I A;  4K0K Q;  3UI2 A;  4NMZ A;  4ZUI A;  3GTJ H;  4B9W A;  3AB9 A;  3W1G A;  4A3B H;  2QIL A;  4JV5 Q;  1EQQ A;  4KLK A;  1PH6 A;  4WJW A;  1JJ2 A;  2XNA C;  4A3I H;  2R7Z H;  1LTR D;  2KCC A;  1HR0 Q;  1J5E L;  2E8G A;  2OXP A;  1SMY D;  1VQH A;  4H44 C;  5IP7 G;  4RGT A;  3S1M H;  4K0K L;  4KN4 C;  4A3D B;  4UPA A;  3VYS A;  1AH9 A;  2ZTD A;  4JV5 L;  4A3D G;  1G8Z D;  2CFM A;  3NBH B;  2G9H D;  1QZH A;  3T13 A;  4OO1 I;  5ELN A;  1HR0 L;  5C5L A;  1QOH A;  1SDF A;  3W2D A;  5KRU A;  1UNS A;  2F0O A;  2UUB Q;  4NXN Q;  4FF2 A;  2KHJ A;  4YIJ A;  1EOT A;  3S15 H;  4KI0 A;  5CV9 A;  4C3J B;  2F4V Q;  3GTK B;  1IYJ B;  4C3J G;  2H5X A;  2J7Z A;  4BBR B;  1BCP B;  1UE5 A;  4NXN L;  4TQU S;  5F2D A;  4KD4 A;  4LK1 C;  4BBR G;  5IP9 H;  1VCI A;  4JI4 Q;  4LMQ D;  3TZD A;  4F88 A;  2I5H A;  3EFX D;  1PRT D;  1FJG Q;  2F4V L;  1QWY A;  3LWE A;  5C4Z A;  1FNV A;  1I4R A;  1WI5 A;  1EZ8 A;  2K50 A;  5CYU A;  4TRD A;  2NZO A;  5M5W H;  2VQE Q;  1D6E C;  2UXB Q;  4LWC A;  2B3G A;  3HOZ H;  5A2Q E;  5CBE E;  3S24 A;  1XMO Q;  1JR0 D;  2EY5 A;  1WTR A;  1FJG L;  1F2Z A;  1IW7 C;  4XYQ A;  3I91 A;  1ROD A;  3KLS A;  2QEX A;  2ZJQ A;  2A8V A;  4ULL A;  2VQE L;  2UXB L;  5A2Q L;  4QB4 A;  1WD1 A;  4BXX G;  2EE1 A;  1CUK A;  5K5P A;  4BWG B;  3A0J A;  5C4H A;  1ENF A;  1XMO L;  1TXY A;  4JG2 A;  3S1N B;  3ERO A;  3K7A H;  4OWW B;  5EKK A;  1HUN A;  3WOE A;  2QEJ C;  4MTN A;  4ID6 A;  2B63 H;  1UE1 A;  1SE8 A;  2N49 A;  2VB3 X;  3Q8D A;  1GUT A;  5LHY 1;  3CF5 A;  4GLX A;  1WD0 A;  1EIY B;  4QQB X;  1VQI A;  4PNY A;  2IY5 B;  3GTM H;  2K5N A;  1QVC A;  1STB A;  3OTO Q;  3PIP A;  3Q23 A;  2VNU D;  2JA9 A;  4HID A;  1T9H A;  3ICE A;  1TII D;  1NNX A;  1S5E D;  3CKI B;  2WB1 E;  4CBV A;  1HA6 A;  3D4R A;  4WJ3 M;  4B08 A;  1ILQ A;  2EXD A;  3FKI G;  1IKL A;  1BVS A;  3I56 A;  5GAE C;  2K75 A;  5IGF A;  1U4L A;  3BYT B;  4ALP A;  2NZH A;  4TKO B;  2RF4 A;  1WTP A;  1KQS A;  3OIQ A;  3OTO L;  4LF5 Q;  2KA7 A;  1DOL A;  4K5W A;  4LF9 Q;  1PYW D;  3SR1 A;  1E1T A;  3U58 A;  2F0H A;  2B2V A;  1LTG D;  1I4P A;  3T1H Q;  1B2T A;  2HQE A;  2RHQ B;  3X3M A;  3RLN A;  2I0Q A;  4LF5 L;  1TS4 A;  4CHT B;  1NSN S;  2IHE A;  1DCZ A;  1WTV A;  4LF9 L;  1JT8 A;  3VA5 A;  1LTT D;  2N78 A;  4JI1 L;  2HDL A;  3T1H L;  3RR5 A;  3M4Y A;  4K5V A;  3H3V I;  4TVA B;  3TP6 A;  3F1Z A;  2F0D A;  2EYL A;  5JOB A;  4CKB A;  1Y69 U;  4RAU C;  4PZ7 A;  3E6Z X;  5M5Y B;  3PGZ A;  5I9O A;  4IJH A;  3NBI A;  1E2V A;  1PDQ A;  4DUZ Q;  2FXQ A;  5KND A;  3HOU B;  4KJN A;  4JYA Q;  1ML0 D;  3I4L A;  5C6A A;  3NTI A;  1PVO A;  2F0E A;  3K6O A;  4OEM B;  1U4P A;  4L8J A;  3S9W A;  2C5C A;  1K0S A;  2DN8 A;  3PSI A;  2JQO A;  1SNP A;  4FXG C;  1AE2 A;  4DUZ L;  1EU4 A;  4NDX A;  2AUJ D;  4JYA L;  1X6O A;  1M4V A;  3N6R A;  3NUC A;  1JOK A;  5CGK A;  4B3M Q;  3M4P A;  4DNT B;  2K14 A;  3AQQ A;  4A3M B;  2IX1 A;  3MEH A;  4YWL A;  1XYI A;  4A3M G;  3S17 B;  3TN2 A;  4HIO A;  1T5X D;  5CC4 A;  1TR5 A;  3KDF B;  1QUQ B;  2B8G A;  2UUC Q;  2F0T A;  1V9P A;  2BOS A;  4B3M L;  4HJ5 A;  1ZYR D;  4ZRZ A;  3L0O A;  1YBY A;  1AN8 A;  3I4N B;  1WCM H;  1O7Y A;  4DV7 Q;  2UUC L;  4QIW E;  5C4J B;  2NTT A;  4QY7 A;  3UDG A;  1O7Z A;  2VL6 A;  1AE3 A;  3R8B A;  3G71 A;  3AEV A;  3CHB D;  5D3D A;  4QMG A;  2MUY A;  1RD9 D;  3A8J E;  4DV7 L;  1CKN B;  4G4K A;  1PH5 A;  2PNH A;  2F0U A;  1PA6 A;  2EY6 A;  2F03 A;  2X6L A;  3J7A 5;  4G7H C;  3H91 A;  5BN5 A;  4C1N I;  4L5Q A;  3ULL A;  2UU9 Q;  2L4N A;  1GVP A;  4HIM A;  1K28 A;  3R2T A;  3URY A;  1SYG A;  1WFQ A;  2X69 A;  5IP7 H;  1NUC A;  2K4K A;  3CRL C;  1HHV A;  1E2Z A;  3VR3 A;  4A3D H;  2YTY A;  3VYU A;  1YHQ A;  4QL5 A;  3I4M B;  4N8F A;  1CM9 A;  2UU9 L;  2WP8 J;  5M3M B;  3I4M G;  1EU3 A;  1QG7 A;  5ELE A;  1X3F A;  1GUN A;  1H9S B;  5M3M G;  1N33 Q;  4FXK C;  5ELB A;  1PYB A;  2EDG A;  3RUZ A;  4RWS C;  4X64 Q;  3VR4 A;  4IUR A;  1K8A C;  3D4D A;  1D8L A;  1RIP A;  4GOP A;  5G3L D;  2JSO A;  2PNR C;  4EQN A;  1SLJ A;  3S1R B;  1V1P B;  4C3J H;  4ZYS A;  3GTK H;  5IE8 A;  1OXT A;  1N33 L;  1JIC A;  2A6E C;  3DWA A;  2PZT A;  4X64 L;  4BBR H;  1V1Q A;  5FJ8 G;  4EVO A;  1STY A;  2FJ2 A;  3CU7 A;  1EY0 A;  1VQG A;  1U5K A;  1I4G A;  5IGG A;  4OO1 G;  4OON A;  2H1E A;  1VMP A;  3KK7 A;  5FLX E;  4FNF A;  1KAA A;  2EYH A;  5FLX c;  1RF2 D;  1I6V C;  1VQA A;  2NVX B;  4MIU A;  5HGQ A;  4A3E B;  1SBB B;  4JI5 Q;  1KC8 C;  4KJO A;  2A73 B;  2QCP X;  2RDF A;  4M1U B;  1PH3 A;  1DOM A;  3TQY A;  5FLX L;  4H0L C;  1LYL A;  4DK1 A;  3VR6 A;  1I4Q A;  4MNO A;  1HPC A;  5IY0 A;  3RLO A;  4BXX H;  3OSO A;  2XIW A;  2CQA A;  1GUS A;  1L2F A;  4IPG A;  4JI5 L;  4NXM Q;  3GP7 A;  4DUY Q;  2FMC A;  3S1N H;  3KBG A;  3Q22 A;  1XMQ L;  4AYB E;  1ENA A;  4KKS A;  4HTH A;  3I7F A;  3NSW A;  2A6H C;  1PFS A;  3A5U A;  1SNC A;  4NXM L;  2JYO A;  1TS3 A;  1EFI D;  3A7L A;  1XNQ L;  1F2Y A;  3I70 A;  1JCK B;  1X3E A;  5ELC A;  3GTQ B;  1GO3 E;  2NZ1 D;  1H9M A;  2N8N A;  5DLQ E;  2Y0S E;  1DON A;  1EEI D;  3A7A B;  3HKZ E;  1QVF A;  4ZAI A;  4A3L G;  4N8X 1;  4UAI A;  4O42 A;  4X3T A;  3JAM i;  4CDC C;  3QOJ A;  4TSS A;  3A54 A;  4JI6 Q;  1PH8 A;  5EPK A;  1SMY C;  4BS9 A;  2O5J C;  2Q8R E;  3BVG A;  2AHO B;  1V43 A;  1XWE A;  3CQZ B;  2RKS A;  3V2T A;  1ILP A;  4GN3 B;  1YEZ A;  2D2C C;  4ZLT F;  3K5L A;  1IBK Q;  4LUV A;  3FEW X;  4JI6 L;  1Z7T A;  1T5E A;  3C1F A;  4A75 A;  1QZG A;  2HHH Q;  4L5S A;  2F0Q A;  2JA5 B;  1JQY D;  3OHX C;  1W3S A;  2SOB A;  3EN2 A;  1STG A;  1K3B C;  1LM0 A;  1L0X B;  1HZ9 A;  2RHS B;  4HJ9 A;  4A3F B;  1VQB A;  2JA5 G;  4A3F G;  1IBK L;  3M4Q A;  4RKB A;  3CP0 A;  2HHH L;  3HKS A;  1CT1 D;  3TME A;  3S16 B;  4B9X A;  1EQR A;  1VQF A;  1NTG A;  1PXU A;  5EPL A;  4LFB Q;  1TWC B;  2BCO A;  1PRT C;  1VQO A;  1KRT A;  1NAP A;  5M5Y H;  2V4D A;  4XIG S;  3HOW B;  2RQX A;  4DNI A;  3PIP 3;  2UXC Q;  3T56 B;  4HCE A;  3HOU H;  1NMF A;  1J6Q A;  3E0E A;  4RHS A;  3HOW G;  3KJO A;  4A3K B;  3HRZ C;  4LFB L;  1I4X A;  1FYC A;  1YNJ D;  4PZ8 A;  3BU2 A;  1B3Q A;  3NQI A;  5EPJ A;  4IUP A;  1LUZ A;  4RH6 A;  2EYF A;  1AZQ A;  1JWS D;  2UXC L;  1Q8K A;  3HGB A;  4IFD I;  1WYD A;  2KUM A;  1L0W A;  3KF6 A;  4DFA A;  4JBJ A;  4KY5 A;  4A3M H;  4IQZ A;  5J22 A;  4IJL A;  2RSO A;  1KL9 A;  1MD2 D;  3M85 A;  1K3R A;  2XGT A;  3S17 H;  3T16 A;  2YU9 B;  2MO1 A;  2LXK A;  1LAC A;  5GAG C;  1B4O A;  1M1K C;  2OTL A;  5J39 A;  4XDX A;  1H95 A;  4DR7 Q;  2FHT A;  3I4N H;  2K52 A;  3U4Z A;  1BKB A;  5C4J H;  1I6H B;  4DN4 M;  2ZTC A;  4MN3 A;  4IN3 A;  2ZTE A;  4YCV A;  4DR7 L;  5C44 B;  2N88 A;  1EL0 A;  4UP9 A;  5C44 G;  1EYD A;  4GNX C;  4JVZ A;  4KHV A;  3FDT A;  4AH6 A;  2R61 A;  3TSS A;  2NUC A;  2Z4I A;  3E5S A;  3CC2 A;  4K8J A;  4R1J A;  1TS5 A;  2N3S A;  4HMJ A;  1JJC B;  2NN6 G;  3SK8 A;  1L1O B;  4IOA A;  4OXP A;  1WJJ A;  1FR3 A;  3J81 E;  5JJK A;  2C9O A;  1EY5 A;  2E2H B;  1FD7 D;  2K01 A;  1NBW A;  1YZ6 A;  2BH8 A;  1YJ9 A;  4V19 0;  2JK8 A;  1EQV A;  3VYR A;  3J80 E;  3I4M H;  2KCM A;  3SK4 A;  3TZU A;  1EIG A;  5M3M H;  3J80 c;  3J81 L;  3AFQ A;  5IOD A;  1G6P A;  1N8R C;  2Z6K A;  3T1Y Q;  1KNA A;  2KEC A;  3C2P A;  4GLV B;  1A3V A;  5KIX A;  1VF7 A;  3K5O A;  5IOC A;  2VUM B;  1IYU A;  2QF7 A;  1K73 C;  1BCP F;  2VUM G;  2ID0 A;  3EQL C;  3GQB A;  3S1R H;  4POF A;  1X54 A;  3EIV A;  5FJ8 H;  2EYM A;  2K33 A;  1C8C A;  5DNF A;  3IAY A;  1Q90 A;  5KNC A;  1MGS A;  3VA7 A;  1I4H A;  2CWA A;  4IUV A;  2AQ2 B;  4XYO A;  2F0L A;  1CA5 A;  1VQP A;  4DR3 Q;  2NVX H;  2HQL A;  1TWH B;  2F0P A;  1NR2 A;  3MA2 B;  1NR4 A;  1QNU A;  3SHL A;  3GTP B;  4DR3 L;  3T53 B;  4XQN A;  1HTL D;  4KY7 A;  1ZYR C;  4CDD C;  2VXW A;  4LJZ C;  4E6I A;  3L3O C;  4K6L A;  2CQO A;  2BE5 D;  3GTG B;  4HR7 B;  4G57 A;  3O13 A;  1EY7 A;  1YIJ A;  2F0I A;  4MHE A;  4DV0 Q;  2K5V A;  2NVQ B;  2B2U A;  1F2M A;  1PTO D;  5HGT A;  3I8Z A;  1LT5 D;  4IUN A;  1PH1 A;  2MNA A;  4R9W A;  3GTQ H;  1E3P A;  1WTW A;  3TRZ A;  3E3X A;  3F8T A;  5ISR A;  4WJ4 A;  2R7D A;  2J4X A;  2WB1 B;  2OCE A;  1WTX A;  2WB1 G;  1VQN A;  3HZX A;  4G7Z C;  1KD1 C;  2ICE C;  3UE1 A;  1LO5 D;  4YWK A;  1HXY D;  3EA6 A;  1P16 A;  3KLR A;  3NK9 A;  1JMC A;  4C3H B;  3CQZ H;  3MAQ A;  3E0J A;  1LTS D;  4C3H G;  2X6G A;  2K7V A;  1B9N A;  2L0C A;  3BYY B;  1EY6 A;  1SNQ A;  3MWY W;  4RG1 A;  2ZM6 Q;  2JA5 H;  1YVC A;  1GKH A;  4MTK A;  4A3F H;  3K81 C;  2OT2 A;  5CV4 A;  4NW2 A;  5E4W C;  3P20 A;  3MXN A;  4LF7 Q;  1L0Y B;  3ER0 A;  4JW0 A;  1MIU A;  2ZM6 L;  3S16 H;  1PLF A;  1EWH A;  4A4I A;  2YYZ A;  1EY4 A;  1S5C D;  1TWC H;  3SDZ A;  2Z1C A;  1XNR Q;  3H3V C;  2PMZ E;  3WDN A;  3D6W A;  1SAP A;  4LF7 L;  3HOW H;  5I6W A;  2ASB A;  1E0B A;  5AFW A;  3DWP A;  2UUB L;  2AWO A;  3K0Y A;  4J6H A;  4IPH A;  2NWG A;  3F2B A;  4QJF A;  4KTA A;  4A3K H;  3V05 A;  3OW2 A;  4JOI A;  3AMU A;  5C0X I;  1S5B D;  1XNR L;  1CI3 M;  2PQA B;  2LS0 1;  2QGQ A;  5LL6 S;  1OO9 B;  1BBU A;  3HS0 C;  1I5F A;  1KHI A;  5J1Z A;  5C3E G;  3HP3 A;  4JI4 L;  4KHZ A;  3A74 A;  1SNO A;  1V1P A;  3D3R A;  4A76 A;  1GM5 A;  2HIX A;  1VQD A;  3KYH C;  3G48 A;  1Q81 C;  1JOR A;  4JCV E;  4H13 C;  5IT9 E;  2YU9 H;  2R93 B;  1OTC A;  2N55 A;  5IT9 c;  4JBW A;  1KDA A;  2R93 G;  1BBX C;  4CDE C;  1Q1B A;  4YWM A;  2ICI A;  5GRO A;  5IT9 L;  3MFY A;  1O80 A;  3MHB A;  1Y1W B;  1N36 Q;  2K1B A;  1VQ9 A;  1Y1W G;  2LY7 A;  1BO0 A;  1LTA D;  1PMR A;  4QIW B;  1I6H H;  3T51 B;  2MO0 A;  2BH2 A;  4YY3 Q;  3GTO B;  2XSC A;  3V96 A;  1CFM A;  5C44 H;  5JJZ A;  1E22 A;  1L1O C;  4O1N A;  1O7I A;  1HQR D;  5C3X A;  3BDO A;  3PUZ A;  1C48 A;  2F3I A;  3H6M A;  2NN6 H;  3GO5 A;  2F3V A;  2F0S A;  3FKI B;  1S4Z A;  2RDH A;  4DA2 A;  1JOQ A;  3BJU A;  4X3K A;  1B44 D;  1QNK A;  4JI3 Q;  1X32 A;  1SJH D;  4OEL B;  1GXD C;  1EWC A;  2E2H H;  1X9N A;  4XQJ A;  2WKD A;  1HH2 P;  1CA6 A;  3OPO A;  1IXR A;  2K28 A;  1ESR A;  1HTP A;  4JI3 L;  1PYS B;  4DV6 Q;  4KN7 C;  3CAM A;  3OOC A;  1IL8 A;  2DJG C;  2VUM H;  3NXW A;  2B8F A;  2FMM A;  4RGN A;  2XRQ D;  4HJA A;  2MQH A;  3ZYY X;  4DF7 A;  1WOC A;  3J7Y W;  4DV6 L;  3C3L A;  1HJP A;  1BDO A;  2A69 D;  1NMG A;  2PI2 E;  4RCO A;  1JOO A;  4RGO S;  1XXG A;  1YNJ C;  3CW2 C;  2KBN A;  4PMB A;  2AKW B;  5K36 G;  3CRK C;  4R4C A;  3SK6 A;  1TQO A;  5EKL A;  4IUU A;  4BA2 I;  2F0W A;  3KOJ A;  1PRT B;  1IL2 A;  4A3G B;  3NEN A;  5T1G A;  1TWH H;  4A3G G;  4DK6 C;  4KY6 A;  2IJ0 A;  5EGT A;  3NEM A;  1U0L A;  1DGS A;  3TP5 A;  1Q86 C;  3GTP H;  1XPO A;  1HRJ A;  3NE5 B;  4ILW A;  1SJE D;  3I3C A;  1UWV A;  1SYD A;  2K32 A;  3GTG H;  4AYB B;  4BBS G;  5BR8 Q;  4AYB G;  2IPK D;  2SEB D;  2MGS A;  4IPD A;  1ZXT A;  4EQ5 A;  3CME A;  3SK5 A;  2NVQ H;  1IKM A;  5I2Y A;  5IWA Q;  4Q5V A;  1OXU A;  1B8A A;  3DM3 A;  5BR8 L;  3K5N A;  2G5D A;  2DY7 A;  4DR6 Q;  4K8I A;  3DLL A;  1U4R A;  1WTH A;  2Y0S B;  1MSH A;  2YTV A;  5IGB A;  3U9O A;  5C3W A;  3CCJ A;  2Y0S G;  1XTC D;  2KEE A;  2D0O A;  5KEE A;  4DAY B;  1NE3 A;  5IWA L;  1HNW Q;  1SXT A;  1SFO B;  1KAB A;  2K6A A;  4DR6 L;  2SNM A;  1TWG B;  3OIP A;  1HCZ A;  2HCC A;  5FO7 B;  4C3H H;  1HNW L;  4GNX B;  5FLM G;  3U4V A;  1VQJ A;  4QUF A;  1TVX A;  1EZ6 A;  2CWP A;  1KNE A;  2HDM A;  4N9P A;  3QJY A;  1S72 A;  2KJX A;  3PF4 A;  1J8I A;  2LSS A;  2PQE A;  3DWQ A;  4G7O C;  5G3L F;  4V0B A;  3GTL B;  4P72 A;  4DAM A;  1XTD A;  3PV0 A;  1EOV A;  3AYH B;  3H0G B;  4DAP A;  4ZK9 B;  1VQ5 A;  1ESF A;  5EJW A;  2EXZ A;  3H0G G;  3TBI B;  3KBX A;  1KRS A;  5EKI A;  3WOF A;  3G6E A;  3BDL A;  4J8Q A;  5C0X J;  4FF4 A;  4NPS A;  1CSP A;  4FF3 A;  5D14 A;  3J7Z C;  5C5M A;  5COR A;  1LLR D;  2JXM B;  2OEO A;  3BG3 A;  4IPC A;  2JEA I;  3KJP A;  4EX5 A;  2B2Y A;  4XXE A;  4OWT B;  4FP5 D;  4POG A;  1LT3 D;  1V8Q A;  2O4X A;  3DEP A;  2F0M A;  3L7Z C;  1TT2 A;  5DM7 3;  1PFB A;  5C4X B;  2UUA Q;  1K9M C;  3CC7 A;  3ERQ A;  5C4X G;  1E24 A;  1A6X A;  2Z4H A;  3I90 A;  4HCS A;  3RNU A;  3TEH B;  4OGQ C;  1KXL A;  4H7B A;  2B2T A;  5IGE A;  1PZJ D;  3MXU A;  2BE5 C;  2NYZ D;  2V1C C;  2UUA L;  4HSP A;  3CPF A;  3QG1 A;  2R93 H;  2IT1 A;  2B39 A;  5IYC G;  2R3Z A;  4DV5 Q;  2F0K A;  1VQ4 A;  3ZJY C;  3UDF A;  1LTL A;  3TP8 A;  1HR0 W;  2H4O A;  1PTO C;  5C0X G;  3JC6 6;  1IYV A;  1K83 B;  1Y1W H;  2DJF C;  4K2K A;  3EVQ A;  3DUZ A;  4OIJ A;  4YCU A;  2DNC A;  5GAD C;  1HNX Q;  3GTO H;  4XQQ A;  1D2B A;  3SXH A;  4DUY L;  1V1O A;  4HIK A;  2M00 A;  1RJT A;  3G7L A;  2A68 D;  2NVT H;  1S3O A;  4IUT A;  4R8N A;  2L5T A;  1HNX L;  1QB5 D;  2FFK B;  1PFM A;  5D3I B;  4KMU C;  2E2J B;  3FKI H;  4YCW A;  1E2W A;  4LNQ A;  4OL7 A;  2Z6K C;  2ENB A;  3FPU B;  3QO2 A;  1A8V A;  5JEA J;  2CHB D;  5FOB B;  3GV3 A;  4PG3 A;  4ABN A;  3I2Z A;  1TWF B;  4UY8 C;  3E9H A;  2XWB B;  3STB D;  1Y8P B;  1G29 1;  4I65 A;  1HZA A;  3BZD B;  2K5Q A;  3GDE A;  2FIN B;  4IOC A;  1QIL A;  2VQF Q;  2EZV A;  2IHF A;  4XT3 B;  1I94 Q;  2GVA A;  3ND9 A;  3F2D A;  2AQ1 B;  1SMX A;  4QCL A;  1EY8 A;  2CVR A;  1ENC A;  3OW7 A;  2LXJ A;  1VS0 A;  4LF8 Q;  1VDZ A;  4RCN A;  1B1Z A;  3KF8 B;  1B3A A;  2B2W C;  2PO4 A;  5K36 H;  2P5Z X;  4LFA Q;  2PI2 A;  4NB3 A;  4U68 A;  2J0T D;  1MKH A;  2EYO A;  4KKU A;  3NEL A;  2XVS A;  5LMN Q;  4UHV A;  4LF8 L;  3MFG A;  5JEA G;  3NBH A;  1EQT A;  4A3G H;  5JJL A;  4LFA L;  1D5X C;  4RGM A;  4CKE A;  5JPN C;  1SE3 A;  4LAA A;  2OWO A;  5LMN L;  2D5D A;  3HEJ A;  2B2U C;  2XRS D;  4K14 A;  2CW0 D;  1PFN A;  1II3 A;  2K5W A;  4PMC A;  4P75 A;  3I72 A;  4X62 Q;  1EYC A;  3NQT A;  4HJ8 A;  1BBW A;  1Q3L A;  1SYE A;  5J3B A;  1D5M C;  3VYT A;  1IBL Q;  1CSQ A;  4L63 B;  1E7Z A;  3CCE A;  2G9D A;  2EYJ A;  4APV A;  3LGJ A;  4XT1 B;  4X62 L;  3E9I A;  4MZ9 A;  5ELD A;  3NTH A;  4GKK Q;  1F2L A;  1X65 A;  1IBL L;  3CD6 A;  1UEA B;  5I4D A;  1D5Z C;  4X66 Q;  1S40 A;  2KED A;  4QF4 A;  5A35 A;  5LL6 X;  3KUP A;  1SFO H;  4YHH Q;  1GHJ A;  1CK1 A;  4GKK L;  1Q12 A;  1JC7 A;  4IO9 A;  5H1S E;  1TWG H;  2EJM A;  1RL2 A;  3M7N A;  1SEB D;  1STN A;  4X66 L;  5TSS A;  3I4O A;  5FLM H;  3WWV A;  2SNS A;  1F77 A;  2JJQ A;  1BOS A;  5IYD G;  3M9B A;  1IHZ A;  5EBC A;  1FVI A;  1UAP A;  4HN7 A;  4WFN 3;  3J81 c;  2IL8 A;  4ZKB B;  4FYD A;  2EJF C;  2Z8L A;  2D9U A;  2K5D A;  2O2L D;  4GN4 B;  3CCU A;  3S2H B;  1MJE A;  3GTL H;  4GN5 A;  3CCL A;  1XX8 A;  3H0G H;  1HFG A;  2Q8I B;  4JI7 Q;  2A69 C;  1YNN C;  2JP1 A;  2WIN B;  4JOI C;  4KKT A;  2VY3 A;  4F8M A;  2Q2T A;  4X3S A;  1PZK D;  1KDB A;  2M2L A;  5EBD A;  4A3J B;  2KVM A;  2JEB I;  2PMZ B;  3T1Y L;  4A3J G;  2F4I A;  1OXV A;  4JI7 L;  2R7F A;  1C7Y A;  1SYB A;  4PZ6 A;  3IFD A;  5GAH C;  3I55 A;  4HJ7 A;  4OO1 H;  2E75 C;  1K8M A;  1HUM A;  2LMC B;  1I3Q B;  2A5H A;  5C4X H;  1Y1V B;  4CJ0 B;  1DZ1 A;  1Y1V G;  4LUZ A;  3NWT A;  3X3N A;  1Z6H A;  3M7G A;  1X56 A;  1VQK A;  3PQI A;  2JA6 B;  3K8A A;  1BCP D;  1UE7 A;  3IRB A;  2JA6 G;  2ZJR A;  5IYC H;  4A93 B;  4A93 G;  1G51 A;  1C9O A;  2F0F A;  2EJG C;  3MXG A;  3PO2 B;  1E1O A;  2GA4 B;  1LTI D;  1RTN A;  3PO2 G;  3CMA A;  2PPB C;  4PV1 C;  1K83 H;  3BZC A;  1DM0 B;  4F7X A;  1GD7 A;  3HOX B;  1TS2 A;  2EOT A;  3HOX G;  2QKI C;  2D62 A;  2K5H A;  2F1M A;  3PUW A;  2ZXR A;  5CR3 A;  2E5L Q;  4X65 Q;  1EWI A;  2JA7 B;  5E7N A;  2WAQ E;  4AQY Q;  4DV0 L;  5IIF A;  2JA7 G;  1M8A A;  1H9K A;  1AEX A;  2C35 B;  4A3L H;  3S1Q B;  1EIH A;  2AWN A;  2B2V C;  4RHR A;  4QUC A;  1ET9 A;  5I6Y A;  2E2J H;  2E5L L;  2TSS A;  4X65 L;  3KDF A;  1QUQ A;  4P74 A;  4AQY L;  5BN3 A;  3TRE A;  3PIO 3;  4FO2 A;  1DJR D;  2I5L X;  1TWF H;  1CQV A;  5NUC A;  4L6T B;  4RA8 A;  1Q7Y C;  3ONA B;  4WOR A;  1RDP D;  3PUV A;  5BN4 A;  3OMC A;  1G2T A;  3N52 A;  3C46 A;  2PZU A;  4DAY A;  5FK9 C;  1G6Z A;  1NCV A;  5EAY A;  1AZP A;  4LF4 Q;  2EIF A;  3GV6 A;  1JB7 A;  4ZQ3 A;  1CKN A;  1PH2 A;  3T4A C;  1F9P A;  4DK3 C;  4H02 A;  5HUR A;  1AP0 A;  4DR5 Q;  4B3T Q;  4UP7 A;  2VZA A;  4GNX A;  1YJW A;  4LF4 L;  3K80 C;  4IFD J;  1PRT F;  4GKJ Q;  2GN5 A;  3BVZ A;  1JE5 A;  5IGD A;  1ET6 A;  4K2L A;  5JEA H;  2I5M X;  5JVG 3;  4DR5 L;  4B3T L;  1BNZ A;  4ME5 A;  3RZD B;  3NWS A;  2HT1 A;  3H3V H;  5KYI A;  1H9S A;  3D0F A;  3SE0 A;  4GKJ L;  1WTQ A;  1IBM Q;  3KF6 B;  2NTS A;  4Y7N B;  5C3E B;  4R4T A;  2A1A A;  2AUK A;  2NVY B;  5GQO A;  4WRD A;  1FGU A;  1EY9 A;  2IW3 A;  1F9S A;  5ELO A;  1IBM L;  1BR9 A;  3Q24 A;  2MFI A;  4OWX B;  4LF6 Q;  4O0A A;  1D7Q A;  2Q2H A;  1VF5 C;  3TP7 A;  3ULP A;  1BF4 A;  2HIV A;  2NB0 A;  1FNW A;  3QB3 A;  4L5R C;  2A74 C;  3MTS A;  4JBK A;  2EPB A;  2KHS A;  2L11 A;  1EYG A;  2RBM A;  3D6C A;  2CKZ B;  4L5T A;  4LF6 L;  4IFD G;  2A68 C;  2DGY A;  4I7Z C;  1Y8O B;  4DR4 Q;  1MJC A;  4C2M B;  1PTO B;  1XPU A;  1FGB D;  1KAW A;  1SE2 A;  3ITP A;  3A56 A;  4NKL A;  4LFC Q;  2B29 A;  1N36 L;  1QJO A;  4P2C B;  1YIT A;  2KEN A;  1OXS C;  4GZY C;  1X3G A;  2NVT B;  3D4W A;  2IX3 A;  2NBF A;  4JBM A;  4DR4 L;  2ZJP A;  1IZ6 A;  2OTJ A;  1JE4 A;  2XN9 C;  4YY3 L;  2AQ3 B;  3W3A A;  4LFC L;  4DV3 Q;  3STB C;  5DM6 3;  5IYD H;  5LMN W;  2QDB A;  1LT6 D;  3DMU A;  1STH A;  1KIX A;  3Q0A A;  3JAM E;  5FKA C;  4EQP A;  2JA8 B;  4DXG A;  5FO8 B;  2EVB A;  1G2S A;  3JAM c;  4GOP C;  1X3P A;  2JA8 G;  2E74 C;  1O7L A;  2Q2I A;  2D0P A;  3PUY A;  4DV3 L;  3FP9 A;  5M5X B;  3S2H H;  3QWN A;  1K8G A;  2R92 B;  1HA5 A;  3JAM L;  1FNU A;  2B2Y C;  1A63 A;  3J81 i;  4NP5 A;  2MJ8 A;  1PHJ A;  4AIM A;  2R92 G;  2RCF A;  2OF1 A;  5CV6 A;  1GUW A;  3A8K E;  1JJG A;  1YJN A;  2EY2 A;  3J80 i;  4DK0 A;  3VR2 A;  3CCR A;  1SE4 A;  1SRO A;  3P7J A;  5LMU Q;  4A3J H;  3QR8 A;  2TMP A;  4JI0 Q;  2XTI A;  4JI1 Q;  2B2T C;  3S2D B;  1YNN D;  3PUX A;  3F2C A;  2E76 C;  4M8A A;  5L37 A;  1I3Q H;  3KLW A;  5LMU L;  1VQL A;  1Y1V H;  1B70 B;  3I73 A;  5AJ3 Q;  4JI0 L;  3PO3 B;  4B3R Q;  4RFB A;  3PO3 G;  1DD2 A;  2CW0 C;  4PMW A;  1MSG A;  3CCM A;  4JI2 Q;  2JA6 H;  5CMD A;  1PH7 A;  1ZKO A;  3QIA A;  1EFW A;  5AJ3 L;  4A93 H;  1STA A;  4DR1 Q;  4B3R L;  3M4O B;  3KF8 A;  3BDC A;  4DR2 Q;  3PO2 H;  1QCB D;  5JAV A;  5E3F A;  3M3Y B;  3AFP A;  2Q2U A;  4JI2 L;  2L9H A;  1BXT A;  2CH4 A;  3DEO A;  3ND8 A;  3CCS A;  4BBS B;  1AW7 A;  3HOU G;  3J7A V;  5COY A;  5KYL A;  1HZB A;  3RN2 A;  1HNZ Q;  5M9O A;  4DR1 L;  2A19 A;  3SVM A;  1TY2 A;  3PCO B;  4DR2 L;  3HOX H;  3R3O A;  2F0J A;  1B7Y B;  3HG9 A;  1MHW C;  3A55 A;  1A2U A;  1ASZ A;  1HNZ L;  2JA7 H;  1JWM D;  1DYQ A;  3HOV B;  1X55 A;  1WVL A;  1CKM A;  5CV7 A;  3HOV G;  3S1Q H;  2BDO A;  2YV5 A;  4CKC A;  3HKZ B;  1K0R A;  2QA4 A;  4PQX A;  3HOY B;  3HKZ G;  1R9T B;  3HOY G;  1A3T A;  1M90 C;  3RMH A;  3FMC A;  4A3C G;  4ODG A;  1YHA A;  2NN6 I;  2ATW A;  4CDF C;  1K8O A;  3RZO B;  1B50 A;  1CHQ D;  2LFN A;  3OYY A;  3I4N G;  1LTB D;  4FXD A;  3R2I A;  3W1B A;  2BA0 A;  1UE6 A;  1NY4 A;  1EEF D;  1GHK A;  1GUG A;  3FRP B;  4CJ1 B;  2Q8T A;  1N34 Q;  4Z9C B;  1WTO A;  2XWJ B;  3TS2 A;  2IWH A;  2RVL A;  3DM1 A;  2CH4 W;  3QOL A;  4HMI A;  5JPM C;  1VQM A;  3MXN B;  3MZ5 A;  4ZCK A;  1D1I A;  4P73 A;  1VQ6 A;  1MI2 A;  1TWA B;  1N34 L;  3C1E A;  1ONL A;  1RTO A;  3H94 A;  4EQO A;  3UE0 A;  1L1O A;  2ZXO A;  3ERS X;  4C1N K;  1Q82 C;  1YI2 A;  1R4P B;  1ASY A;  4JI8 Q;  1RKN A;  2RCN A;  5I2X A;  3HFZ B;  1RHP A;  3UDI A;  3CCQ A;  3DHQ A;  4BY1 B;  1C4Q A;  4BY1 G;  3RZD H;  5E1F A;  2E2I B;  3S14 B;  1BCP C;  4CGY B;  5D65 A;  1STE A;  1KDC A;  2HD3 A;  2Z0S A;  4Y7N H;  4IAL A;  4JI8 L;  5C3E H;  4R4Q A;  4OX9 Q;  2NVY H;  4OIK A;  3CPW A;  1AFP A;  2BDN A;  1JWU D;  3L9A X;  3L2P A;  1H9R A;  3PIO A;  2AMC B;  4BY7 B;  3IKJ A;  4DKA C;  4BY7 G;  1A62 A;  5M3F B;  1KTK A;  4OX9 L;  4I7A A;  1R4Q B;  2L1B A;  5M3F G;  4UDU C;  4KHP Q;  3RLF A;  1Q46 A;  3OMG A;  4LW1 A;  3B6Y A;  4QGU A;  2PCF B;  3A8I E;  1I50 B;  1N9W A;  3UDX A;  4JK1 C;  2OQK A;  4IFD H;  4A3E G;  3K57 A;  4DV5 L;  1B9M A;  4GLA C;  4C3I B;  1G91 A;  4KHP L;  1MBY A;  1XMQ Q;  1CHP D;  4C3I G;  4C2M H;  1GJX A;  3RD4 A;  1PTO H;  1XPR A;  3KLS X;  4X3U A;  3P75 A;  2L12 A;  3J7A F;  1D1K A;  2VS1 A;  2QDL A;  2WFW A;  3VR5 A;  4DPG A;  4JPB W;  1IW7 D;  2I46 A;  1Q1E A;  1SND A;  2K04 A;  1XNQ Q;  2IX0 A;  1LT4 D;  5JJI A;  2KCT A;  2WAC A;  1KLU D;  3K7U C;  4DGZ A;  1ICF B;  2WV6 D;  3DXJ C;  3EJI A;  2JA8 H;  2Z9H A;  4OHJ A;  3AU7 A;  1LAB A;  4KD3 A;  2RDG A;  3NTK A;  4HED A;  1PH4 A;  1LV9 A;  4HSV A;  1YNX A;  5M5X H;  1GUO A;  3EBE A;  3OWF A;  2R92 H;  3J81 j;  4IZ8 A;  1TKW B;  2L55 A;  1EUJ A;  4R4O A;  3U50 C;  4KV6 A;  3FVQ A;  1S5D D;  4DNR B;  2EQS A;  3D8G A;  3W5O A; 
#chains in the Genus database with same CATH homology
 1C7Y A;  1GM5 A;  4A76 A;  1YBY A;  1A0I A;  2HIX A;  1VQD A;  3KYH C;  3G48 A;  4PZ6 A;  5IYB G;  4DV2 Q;  1Q81 C;  5GAH C;  3I55 A;  4HJ7 A;  4JCV E;  2YU9 H;  1WCM H;  5C4X H;  4BA1 I;  4DV7 Q;  4QIW E;  1OTC A;  2UUC L;  4QY7 A;  5IT9 c;  4JBW A;  3UDG A;  2R93 G;  1Y1V G;  4LUZ A;  2VL6 A;  1AE3 A;  4O2D A;  4A3B G;  4J15 A;  3G71 A;  3AEV A;  3ULJ A;  1Q1B A;  1NJI C;  1X56 A;  4A3I G;  4YWM A;  2R7Z G;  4DV2 L;  2CCZ A;  3S2D H;  5GRO A;  1VQK A;  2VQF L;  3K8A A;  1N36 Q;  1CKO A;  1UE7 A;  3IRB A;  4DV7 L;  1CKN B;  1VQ9 A;  2ZJR A;  2JA6 G;  1Y1W G;  1I94 L;  3BZK A;  5IYC H;  1PH5 A;  2PNH A;  1PA6 A;  2L15 A;  3J7A 5;  4A93 G;  2R92 H;  1I6H H;  1G51 A;  2MO0 A;  2BH2 A;  1C9O A;  4YY3 Q;  1VQ7 A;  3PO3 H;  1E1O A;  4L5Q A;  3ULL A;  2UU9 Q;  4JI7 L;  4HIM A;  1GVP A;  1HZC A;  5C44 H;  3CMA A;  3PO2 G;  1E22 A;  1WFQ A;  5IP7 H;  1L1O C;  2K4K A;  1K83 H;  3BZC A;  4A3D H;  2YTY A;  1O7I A;  1YHQ A;  4QL5 A;  2GVB A;  1PV4 A;  1GD7 A;  3PUZ A;  3PF5 A;  4FDB A;  2F3I A;  2UU9 L;  3M4O H;  3GO5 A;  2WP8 J;  1Z47 A;  3I4M G;  3HOX G;  2D62 A;  2K5H A;  1P8L A;  1X3F A;  3PUW A;  3M3Y H;  3BJU A;  5M3M G;  3CXC A;  1QVG A;  1N33 Q;  5HY6 A;  2E5L Q;  4X65 Q;  1EWI A;  4JI3 Q;  1PYB A;  4X64 Q;  4BBS H;  5E7N A;  2WAQ E;  4AQY Q;  1K8A C;  4DV0 L;  1VQ8 A;  2JA7 G;  1D8L A;  1RIP A;  5IP9 G;  4GOP A;  4A3K G;  2E2H H;  1SRU A;  2C35 B;  4A3L H;  1X9N A;  1SLJ A;  2R93 H;  1HH2 P;  1IXR A;  2AWN A;  4C3J H;  3GTK H;  5IE8 A;  4X6A H;  1OXT A;  4B3S Q;  4GS3 A;  4DV1 Q;  1N33 L;  2PQA A;  2E2J H;  2E5L L;  4X65 L;  4JI3 L;  3KDF A;  1QUQ A;  1PYS B;  4P74 A;  4BBR H;  1V1Q A;  4X64 L;  5FJ8 G;  4DV6 Q;  3GD7 A;  4AQY L;  3CAM A;  3HOZ G;  3CC4 A;  1VQG A;  2VUM H;  3TRE A;  1U5K A;  3HOV H;  2I5L X;  1TWF H;  4HJA A;  2WAQ G;  2MQH A;  4B3S L;  4OO1 G;  4OON A;  4DV1 L;  1WOC A;  1Q7Y C;  2KHI A;  2JE6 I;  2YTX A;  4ME3 A;  3HOY H;  3PUV A;  5FLX c;  4DV6 L;  1VQA A;  1R9T H;  4A3C H;  5HGQ A;  1HJP A;  2UXD Q;  4JI5 Q;  1KC8 C;  1NMG A;  2PI2 E;  1PH3 A;  4P71 A;  3TQY A;  3CW2 C;  1LYL A;  2KBN A;  4LUO A;  5EAY A;  3RZO H;  4LF4 Q;  2AKW B;  2EIF A;  4MNO A;  1JB7 A;  2ES2 A;  5K36 G;  5IY0 A;  3RLO A;  4BXX H;  1W2B A;  1CKN A;  1SR3 A;  3MEF A;  1PH2 A;  4R4C A;  4YHH L;  2UXD L;  2BA1 A;  1L2F A;  4IPG A;  4JI5 L;  4DK3 C;  4NXM Q;  4BA2 I;  4H02 A;  2B63 G;  4Y52 H;  3KOJ A;  1IL2 A;  4DUY Q;  3NEN A;  3S1N H;  1TWH H;  4DR5 Q;  4B3T Q;  1XMQ L;  4UP7 A;  2VZA A;  4AYB E;  4GNX A;  1YJW A;  4LF4 L;  4A3G G;  4DK6 C;  3FHW A;  3K80 C;  3NEM A;  3I7F A;  1U0L A;  4IFD J;  4GKJ Q;  1PFS A;  1DGS A;  1FL0 A;  3A5Z B;  4R4I A;  3A5U A;  2GN5 A;  1JE5 A;  1Q86 C;  4NXM L;  3GTP H;  1XPO A;  2I5M X;  4GOP B;  1TWA H;  4DR5 L;  4B3T L;  1XNQ L;  3TS0 A;  2ALY B;  1UWV A;  1X3E A;  2HT1 A;  3GTG H;  3H3V H;  1GO3 E;  1EIF A;  3D0F A;  2N8N A;  5DLQ E;  4GKJ L;  4BBS G;  5BR8 Q;  1IBM Q;  3KF6 B;  2Y0S E;  4AYB G;  4R4T A;  3HKZ E;  2A1A A;  4IPD A;  1QVF A;  5GQO A;  4EQ5 A;  3CME A;  4A3L G;  1FGU A;  3JAM i;  2NVQ H;  4BY1 H;  2DUD A;  5IWA Q;  1N32 Q;  1OXU A;  1B8A A;  4JI6 Q;  1PH8 A;  3DM3 A;  5BR8 L;  1IBM L;  3D31 A;  5ELO A;  2R6G A;  3H15 A;  2MFI A;  2E2I H;  3S14 H;  1OXX K;  4DR6 Q;  3DLL A;  4OWX B;  4LF6 Q;  4O0A A;  2AHO B;  1V43 A;  1D7Q A;  2YTV A;  2Q2H A;  3ULP A;  3CCJ A;  2HIV A;  2Y0S G;  4GN3 B;  1YEZ A;  2D0O A;  4L5R C;  4DAY B;  1NE3 A;  5IWA L;  4JBK A;  1IBK Q;  1HNW Q;  4LUV A;  3K0X A;  1N32 L;  4JI6 L;  1EYG A;  4BY7 H;  4A75 A;  1QZG A;  2HHH Q;  4L5S A;  4DR6 L;  1UEB A;  4L5T A;  2CKZ B;  4LF6 L;  4IFD G;  1XJV A;  2DGY A;  1W3S A;  5M3F H;  3EN2 A;  4XTC S;  4DR4 Q;  1MJC A;  1LM0 A;  2RHS B;  1HZ9 A;  2JA5 G;  4HJ9 A;  1VQB A;  4A3F G;  4C3H H;  1HNW L;  1IBK L;  1XPU A;  3M4Q A;  1KAW A;  1Y14 B;  3CP0 A;  5FLM G;  4GNX B;  3U4V A;  3RN5 A;  4LFC Q;  2B29 A;  1N36 L;  2HHH L;  1VQJ A;  1I50 H;  3HKS A;  4JC0 A;  1YIT A;  4A3E H;  2KEN A;  2CWP A;  1OXS C;  1X3G A;  1Z9F A;  1EQR A;  1VQF A;  1NTG A;  1S72 A;  4JBM A;  1YHB A;  3PF4 A;  2ZJP A;  1IZ6 A;  4DR4 L;  2LSS A;  4LFB Q;  2OTJ A;  4YY3 L;  4C3I H;  4DV4 Q;  1VQO A;  1VQE A;  1KRT A;  2VW9 A;  5M5Y H;  4LFC L;  4XIG S;  3KFU A;  4DV3 Q;  4P72 A;  4DAM A;  1XTD A;  3STB C;  4DNI A;  3VDY A;  3PV0 A;  2UXC Q;  1EOV A;  3AYH B;  3SGI A;  5LMN W;  5IYD H;  1VQ5 A;  3HOU H;  3HOW G;  1NMF A;  1J6Q A;  3E0E A;  3H0G G;  2OQ0 A;  3KJO A;  1KIX A;  1KRS A;  4LFB L;  3G6E A;  5C0X J;  4PZ8 A;  3CCV A;  4NPS A;  3BU2 A;  4DV4 L;  4GOP C;  3JAM c;  1CSP A;  2JA8 G;  3J7Z C;  1LUZ A;  1C0A A;  2Q2I A;  2D0P A;  3PUY A;  4IPC A;  4DV3 L;  3FP9 A;  2JEA I;  2UXC L;  3KJP A;  1Q8K A;  3S2H H;  4IFD I;  2F52 A;  1WYD A;  4EX5 A;  1K8G A;  1L0W A;  1A63 A;  4OWT B;  3KF6 A;  3J81 i;  1PHJ A;  4AIM A;  2R92 G;  4JBJ A;  4POG A;  1JJG A;  1YJN A;  4A3M H;  4IJL A;  1KL9 A;  3J80 i;  3M85 A;  3G4S A;  1K3R A;  2XGT A;  3L7Z C;  3S17 H;  3CCR A;  2MO1 A;  2LXK A;  1VQC A;  4UP8 A;  1K9M C;  3CC7 A;  2UUA Q;  1WCM G;  1PH9 A;  1E24 A;  1SRO A;  5GAG C;  5C4X G;  5LMU Q;  4A3J H;  4RMF A;  3RNU A;  1M1K C;  1SN8 A;  3TEH B;  4JI0 Q;  2OTL A;  2XTI A;  4JI1 Q;  1KXL A;  1H95 A;  3PUX A;  5IYB H;  3F2C A;  4DR7 Q;  3I4N H;  1J5E Q;  2K52 A;  2V1C C;  3U4Z A;  2UUA L;  3CPF A;  4K0K Q;  1I3Q H;  3KLW A;  3GTJ H;  1BKB A;  1Y1V H;  2IT1 A;  5IYC G;  1B70 B;  5C4J H;  5LMU L;  1VQL A;  4DV5 Q;  3W1G A;  5AJ3 Q;  4JI0 L;  4A3B H;  2ZTC A;  4KLK A;  1VQ4 A;  1EQQ A;  1PH6 A;  3ZJY C;  4JV5 Q;  1JJ2 A;  3UDF A;  4A3I H;  1LTL A;  2R7Z H;  2ZTE A;  4B3R Q;  4YCV A;  3PO3 G;  4DR7 L;  1HR0 W;  4PMW A;  1HR0 Q;  5C0X G;  2E8G A;  4UP9 A;  5C44 G;  3JC6 6;  3CCM A;  4JI2 Q;  4GNX C;  1J5E L;  2JA6 H;  1VQH A;  5IP7 G;  1Y1W H;  1PH7 A;  3S1M H;  4K0K L;  1EFW A;  4UPA A;  4AH6 A;  1AH9 A;  4YCU A;  5AJ3 L;  2ZTD A;  4A93 H;  4JV5 L;  4A3D G;  3CC2 A;  2CFM A;  4DR1 Q;  4R1J A;  4B3R L;  5GAD C;  1HNX Q;  3NBH B;  1QZH A;  3GTO H;  3PO2 H;  2N3S A;  4DUY L;  1JJC B;  2NN6 G;  5ELN A;  4DR2 Q;  1HR0 L;  4OO1 I;  1L1O B;  3AFP A;  4HIK A;  2Q2U A;  4JI2 L;  4IOA A;  4OXP A;  1WJJ A;  3CCS A;  3HOU G;  5JJK A;  2UUB Q;  4NXN Q;  1HNZ Q;  2KHJ A;  1HZB A;  3RN2 A;  2NVT H;  1S3O A;  4DR1 L;  2A19 A;  1HNX L;  1NBW A;  1YZ6 A;  2BH8 A;  4KI0 A;  3S15 H;  1YJ9 A;  2F4V Q;  2JK8 A;  3PCO B;  3HOX H;  4DR2 L;  3I4M H;  1IYJ B;  2KCM A;  3J80 c;  1B7Y B;  5M3M H;  3FKI H;  2H5X A;  3AFQ A;  4YCW A;  1UE5 A;  1N8R C;  4LNQ A;  1G6P A;  2Z6K C;  2Z6K A;  4TQU S;  4NXN L;  3T1Y Q;  1HNZ L;  1ASZ A;  4BBR G;  1A8V A;  5JEA J;  2JA7 H;  5IP9 H;  1VCI A;  4JI4 Q;  4GLV B;  4PG3 A;  1K73 C;  2I5H A;  1X55 A;  3I2Z A;  1FJG Q;  1CKM A;  2F4V L;  2VUM G;  2ID0 A;  3HOV G;  4UY8 C;  3S1Q H;  2YV5 A;  3E9H A;  3S1R H;  1WI5 A;  1K0R A;  2K50 A;  4POF A;  3STB D;  2QA4 A;  1X54 A;  2NZO A;  5M5W H;  2VQE Q;  3EIV A;  3HKZ G;  2UXB Q;  1G29 1;  5FJ8 H;  4LWC A;  3HOY G;  2B3G A;  1HZA A;  1M90 C;  3HOZ H;  4A3C G;  1XMO Q;  1YHA A;  3S24 A;  1FJG L;  2NN6 I;  3GDE A;  2ATW A;  4IOC A;  3OYY A;  2VQF Q;  3I4N G;  2CWA A;  2QEX A;  2ZJQ A;  2IHF A;  2A8V A;  3W1B A;  2VQE L;  2BA0 A;  1UE6 A;  1I94 Q;  2GVA A;  2UXB L;  1NY4 A;  3F2D A;  4BXX G;  1CUK A;  1SMX A;  3A0J A;  1VQP A;  4DR3 Q;  1XMO L;  2NVX H;  2HQL A;  1TXY A;  2LXJ A;  4JG2 A;  1VS0 A;  4LF8 Q;  1N34 Q;  3K7A H;  4OWW B;  3KF8 B;  3TS2 A;  4LFA Q;  2PI2 A;  4NB3 A;  1VQM A;  3MXN B;  4MTN A;  4P73 A;  1MKH A;  4DR3 L;  3NEL A;  2B63 H;  1VQ6 A;  1UE1 A;  1SE8 A;  5LMN Q;  2N49 A;  4LF8 L;  1N34 L;  5JEA G;  3Q8D A;  4A3G H;  2CQO A;  5JJL A;  3CF5 A;  3UE0 A;  1L1O A;  4GLX A;  3ERS X;  1EIY B;  4LFA L;  1VQI A;  1Q82 C;  4QQB X;  2IY5 B;  3GTM H;  1YI2 A;  2K5N A;  1QVC A;  3OTO Q;  1YIJ A;  3PIP A;  4DV0 Q;  2VNU D;  2JA9 A;  4HID A;  1ASY A;  2K5V A;  1T9H A;  2OWO A;  5LMN L;  3ICE A;  4JI8 Q;  2RCN A;  2WB1 E;  3HFZ B;  3UDI A;  4WJ3 M;  3CCQ A;  4P75 A;  2EXD A;  3FKI G;  3I56 A;  1BVS A;  4BY1 G;  5GAE C;  2K75 A;  4X62 Q;  3RZD H;  1PH1 A;  4ALP A;  2MNA A;  2NZH A;  2RF4 A;  3GTQ H;  4HJ8 A;  1BBW A;  1KQS A;  3OTO L;  4LF5 Q;  1E3P A;  2Z0S A;  5J3B A;  4Y7N H;  3TRZ A;  4LF9 Q;  4JI8 L;  5C3E H;  1IBL Q;  4R4Q A;  4OX9 Q;  1E1T A;  2NVY H;  1CSQ A;  3CPW A;  3U58 A;  3F8T A;  1E7Z A;  3CCE A;  4WJ4 A;  2R7D A;  4APV A;  3LGJ A;  3T1H Q;  3L2P A;  2RHQ B;  4X62 L;  3PIO A;  2AMC B;  2OCE A;  3E9I A;  3RLN A;  2I0Q A;  2WB1 G;  1VQN A;  4LF5 L;  4DKA C;  4MZ9 A;  4BY7 G;  1A62 A;  1KD1 C;  2IHE A;  3UE1 A;  4YWK A;  4LF9 L;  4GKK Q;  1P16 A;  1X65 A;  1IBL L;  1JT8 A;  4OX9 L;  5M3F G;  1JMC A;  3CD6 A;  4JI1 L;  2N78 A;  4KHP Q;  3CQZ H;  3T1H L;  3RLF A;  1Q46 A;  3RR5 A;  4LW1 A;  3H3V I;  4TVA B;  4X66 Q;  3B6Y A;  1S40 A;  4QGU A;  3F1Z A;  1N9W A;  3UDX A;  1SFO H;  4YHH Q;  2OQK A;  4GKK L;  1Q12 A;  4A3E G;  4RG1 A;  4IO9 A;  4DV5 L;  5H1S E;  2ZM6 Q;  4GLA C;  1TWG H;  2JA5 H;  1RL2 A;  1YVC A;  4KHP L;  3M7N A;  4PZ7 A;  1GKH A;  1XMQ Q;  4A3F H;  4C2M H;  3PGZ A;  3K81 C;  4X66 L;  4IJH A;  3I4O A;  5FLM H;  3WWV A;  4DUZ Q;  1XPR A;  2FXQ A;  2JJQ A;  5IYD G;  4LF7 Q;  3ER0 A;  3M9B A;  4JYA Q;  1MIU A;  2VS1 A;  2WFW A;  1FVI A;  4DPG A;  1PVO A;  2ZM6 L;  3S16 H;  3J81 c;  4A4I A;  2YYZ A;  1Q1E A;  1XNQ Q;  2IX0 A;  1TWC H;  3PSI A;  2JQO A;  1XNR Q;  3CCU A;  4GN4 B;  1AE2 A;  2PMZ E;  4DUZ L;  1MJE A;  5JJI A;  2KCT A;  3GTL H;  4LF7 L;  2R7F A;  3HOW H;  1X6O A;  4GN5 A;  3CCL A;  2ASB A;  3H0G H;  4JYA L;  2UUB L;  2AWO A;  4B3M Q;  3M4P A;  3K7U C;  2K14 A;  4IPH A;  3AQQ A;  3F2B A;  4A3K H;  4QJF A;  4JI7 Q;  2IX1 A;  2JA8 H;  4YWL A;  3OW2 A;  4JOI A;  4JOI C;  4A3M G;  5C0X I;  2VY3 A;  1XNR L;  2Q2T A;  4HIO A;  2PQA B;  2QGQ A;  3KDF B;  1QUQ B;  1PH4 A;  1BBU A;  1I5F A;  1YNX A;  5M5X H;  2UUC Q;  2JEB I;  3EBE A;  3T1Y L;  1KHI A;  3J81 j;  1V9P A;  4R4O A;  3U50 C;  1EUJ A;  5C3E G;  4HJ5 A;  4A3J G;  4B3M L;  4JI4 L;  1OXV A;  2EQS A;  3A74 A;  3L0O A;  4KHZ A;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...