2PI2E

Full-length replication protein a subunits rpa14 and rpa32
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication, dna binding protein
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 117
sequence length 117
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pi2E00
3HOWH 4AYBG 4X6AH 1E24A 4JV5Q 3KDFA 3CC2A 4DUZL 4B3MQ 3M4QA 2I5MX 1Q1EA 1IBML 4IFDG 3KF8B 3CCMA 4DR5L 4HIKA 3T1HQ 1KQSA 2B63H 3GTPH 1EIYB 1VQ5A 2VY3A 1Y1VG 2R92H 5M5XH 4JI5L 5GAEC 2NN6I 2ZM6L 4A3DG 3KJOA 1VQ8A 2NVTH 4DR7L 1N34L 1KHIA 1VCIA 4BBRH 2EXDA 1H95A 3T1YQ 2JEAI 4QJFA 4JI0L 2D0OA 1VQ6A 2KHJA 4O0AA 2DUDA 1NTGA 3CW2C 3S1NH 2VS1A 2E5LL 1HZ9A 1WCMH 3NELA 4UPAA 4DKAC 4RG1A 4R4CA 3I55A 3L0OA 2ATWA 2CQOA 2D0PA 2UUAQ 1GKHA 1IBLL 1O7IA 4DR2L 2EQSA 2PQAA 4NB3A 4POGA 5LMNW 1QVFA 2Z6KC 4AIMA 1B70B 2YYZA 2UXDL 5C44H 2BH8A 2LXKA 3HOYG 3RN5A 1T9HA 3CCUA 1S3OA 2MO0A 3HKSA 4R4QA 3TREA 3U4ZA 5GROA 2AWOA 4LW1A 4TVAB 4A3LH 3KDFB 3GTMH 4NXNL 4DV5L 1N8RC 1E3PA 5IYDH 3HOZG 3KFUA 4MZ9A 1NMGA 1AE2A 1K3RA 2A1AA 2IX1A 4R1JA 1WI5A 3KF6A 2VUMH 4DR4L 2I5HA 3F2BA 1N33Q 3UE0A 4BXXH 4LF5L 2PI2A 2RCNA 4HIOA 1PH7A 4YWKA 4BBSH 1E1TA 3NBHB 3HFZB 3JAMi 1ASZA 3CPFA 4L5SA 2CKZB 3EBEA 4A93G 4JI7L 4DR6Q 4HJAA 3H0GG 3CP0A 4JI1Q 1X65A 3PF4A 3TS2A 4LFCL 4JI4L 1XMQQ 2ZJQA 2IHFA 3HOXG 4B3SQ 2IHEA 2PQAB 1N36L 4UY8C 4JI2L 2NZHA 2GN5A 4JG2A 1MKHA 2RHSB 4IOCA 1IBKQ 4JYAL 4IO9A 1A0IA 1HNWQ 4YWLA 5C3EG 3HOVH 3L7ZC 1Y1WH 3CD6A 4DV0L 3TEHB 5IYBG 3ER0A 1J5EQ 1VQPA 4DUYQ 1LYLA 1SROA 1SMXA 1OXUA 2NN6G 2ZJPA 3CCVA 2Q2TA 4K0KQ 3PF5A 1QVGA 4A3IG 1PH3A 4LUVA 4X64Q 1X56A 1XPOA 1JJ2A 1EUJA 2Z6KA 3S2HH 4LF6L 1JJGA 2QEXA 1UE7A 5JEAJ 3F2DA 2ASBA 4A3EG 5IYCG 2Y0SG 1UE6A 5IP7H 1P16A 3WWVA 3IRBA 4KHPL 3MXNB 4C3IH 3S1QH 2JQOA 1X9NA 1BBWA 4LFBQ 4UP7A 4YY3Q 1OXVA 1J6QA 1HNXL 2WP8J 3K80C 2IY5B 4HIMA 5JJKA 1DGSA 5AJ3L 1HNZQ 4DNIA 2OWOA 1VS0A 5FLMH 4JOIC 4H02A 2UXBL 1WYDA 4A3MG 3I4NG 2K5NA 3I4MH 3SGIA 3PO3G 1XNQL 1JJCB 1K9MC 3CC4A 1L2FA 1XNRL 2N3SA 4L5TA 2JA8G 3K8AA 3I4NH 1E22A 4DV6Q 2DGYA 3K81C 1JT8A 1QUQB 4AQYL 1EIFA 4KI0A 1VQGA 4JI8L 1LUZA 3RLOA 2YTVA 4APVA 4XTCS 1NY4A 5LMNQ 2GVBA 2CWPA 3KLWA 1VQ4A 3RZOH 1FL0A 3S1RH 4DK6C 5H1SE 4R4OA 2FXQA 2VW9A 1OXSC 4OO1I 2B29A 2BA1A 4A3KH 4X66L 1UWVA 1X3EA 4DV1Q 4GKKL 1VQAA 2K5VA 4UP9A 4B3TL 1IBMQ 1I6HH 2RHQB 2VZAA 3FKIH 3B6YA 4DR5Q 2ZJRA 4ME3A 4DV7L 5IP9H 1I94Q 4NXML 2KCTA 1PH6A 5IWAQ 3S16H 4DV3L 2E2JH 4L5QA 3CF5A 2UUBL 5HY6A 1A62A 3PSIA 1Z47A 2F4VL 4QL5A 5FLXc 4A3GH 3D31A 3FHWA 2QGQA 2PNHA 1B7YB 2R93G 1C0AA 4JC0A 1G6PA 2ALYB 2JA9A 2E5LQ 4HJ9A 1XJVA 4JBMA 1LTLA 1BKBA 1G291 5JJIA 3A74A 4LF7L 5GQOA 4IOAA 4LFAQ 4LF8Q 1YHBA 2R7FA 2WB1E 2R7ZH 4HJ5A 4IJHA 3STBD 1X55A 4A3DH 3RR5A 1VQIA 4IPCA 2HIVA 4LUZA 4GS3A 3G48A 2Q2UA 2I5LX 1ASYA 1RIPA 3GTKH 3EN2A 1TXYA 2R7DA 3PGZA 4QY7A 4BY1G 3M7NA 1KD1C 1CSPA 1S40A 1L0WA 1KL9A 1YITA 1PV4A 5M5YH 3HOWG 4A3BH 4GKJL 1XPRA 4DV2L 3J7A5 5K36G 1NBWA 2Z0SA 3TQYA 4JBJA 3RLNA 5IYDG 5BR8L 2E8GA 2B63G 1SFOH 5LMUL 1GD7A 4JI3Q 2K75A 2R92G 1VQNA 1CUKA 3Q8DA 3MEFA 3UDIA 1SE8A 2K4KA 3I4OA 2CWAA 3S14H 2JA6H 4B3RL 2YV5A 4BBRG 1KXLA 2JA5H 1HR0L 2VQEL 3M4PA 2N49A 3UE1A 3DLLA 4HIDA 4JV5L 1WCMG 3GD7A 1KC8C 4B3ML 1FJGQ 1EFWA 4DAYB 1EYGA 4WJ4A 3VDYA 1CKNB 3T1HL 3UDFA 1YEZA 1XMOL 3CXCA 2QA4A 4A3CH 3HOUH 4BA1I 2JA7H 4OO1G 1N32Q 4DPGA 1UE5A 2OTJA 4LF4L 1TWGH 3E0EA 2UUCL 5C44G 4X65Q 2IX0A 1U5KA 3T1YL 2WAQE 4DR1Q 1VQCA 4YCWA 2YU9H 4QGUA 3PUYA 4GN4B 2AKWB 4OWXB 4A3LG 1HZAA 3W5OA 3S2DH 2F3IA 4LWCA 3STBC 5M3MH 4YHHQ 4BY7H 4LF6Q 4DR3L 3U4VA 4JI6Q 3CCSA 2CCZA 2JE6I 2UUAL 3HKZE 3H3VH 3PO3H 2K50A 3G71A 4BY1H 1QUQA 3GTLH 4BXXG 1HR0W 4PMWA 4J15A 4GNXC 5C4XH 4YWMA 4A3JH 1R9TH 1KRSA 3S15H 4BBSG 1JE5A 3GTJH 3EIVA 1V1QA 1QZGA 2CFMA 5AJ3Q 1V9PA 4GOPB 1VQ9A 4Y7NH 1IYJB 1L1OC 4OWTB 2UXBQ 2WAQG 2OQKA 3CMEA 1CKOA 3PUXA 1XNRQ 1K8AC 1KIXA 4PZ6A 4QIWE 4AH6A 3G6EA 1N33L 2KCMA 1GM5A 3AFPA 2A8VA 1WOCA 3HOVG 3AEVA 4OONA 1Y1WG 3PUWA 1CKMA 3W1GA 3CCRA 4KHZA 2BH2A 4QQBX 1FGUA 1VQJA 1Q8KA 4GN3B 1W2BA 2PMZE 3A0JA 4JI1L 1P8LA 3F1ZA 1Q86C 2UU9L 1XMQL 3PCOB 4C3JH 4IPGA 3AFQA 4LF9Q 4GKKQ 4HJ8A 4JCVE 5IP7G 1IBKL 3OTOQ 3FP9A 5GAGC 1HNWL 1X3GA 2VQFQ 4IPDA 1IL2A 3PO2H 1UE1A 1XPUA 1J5EL 3BZCA 1IZ6A 4DV3Q 2HHHL 2VL6A 3ULJA 3PIOA 4DUYL 2JEBI 4K0KL 1TWHH 1VQEA 3K0XA 1EWIA 1YVCA 2L15A 4X62Q 4X64L 3CMAA 5M3FH 2HIXA 1SR3A 5FLMG 3CCEA 1Y14B 3GDEA 1PYBA 4A3FH 4IFDJ 1IXRA 4IJLA 3I4MG 4DUZQ 1E1OA 3BU2A 1C7YA 4JBKA 3E9HA 4LF7Q 2UXCL 4O2DA 3GTGH 5JEAG 4GOPC 4L5RC 4JI5Q 4MTNA 1YJ9A 3S17H 2ZM6Q 2NZOA 4DR7Q 3J80c 3RLFA 1Q12A 4AYBE 5FJ8H 1L1OA 1PHJA 1N34Q 1EQRA 4LFBL 4YY3L 2Q2HA 4JI0Q 2YTYA 1GO3E 2JK8A 1HNZL 2N78A 2WFWA 2LSSA 1VQHA 4DV4L 4C2MH 3KOJA 1HJPA 1QVCA 4A3KG 3J81c 3F2CA 3I56A 4A75A 4FDBA 1CKNA 1HH2P 2Q2IA 4DV6L 3FKIG 4DR2Q 1Y1VH 1PH5A 1G51A 1IBLQ 5LMUQ 5IP9G 4OWWB 4JBWA 4JOIA 2UXDQ 3F8TA 2JJQA 1A8VA 3OW2A 5C4JH 4B3RQ 2HT1A 4P74A 5ELOA 4TQUS 4A3GG 4RMFA 1HZBA 1PH9A 5DLQE 5J3BA 2B3GA 3A5ZB 4PG3A 1HR0Q 1U0LA 2XGTA 3M9BA 3H3VI 1SRUA 4NXNQ 2ID0A 4DV5Q 4GNXB 1YZ6A 2AWNA 3PUVA 4DV1L 2OTLA 5M5WH 2YTXA 4DK3C 3DM3A 4ALPA 1PH2A 1YNXA 3AYHB 1PH8A 3BZKA 4R4IA 1XMOQ 5IT9c 3M3YH 1I94L 2R7ZG 4DR4Q 1YJNA 1EOVA 1L1OB 5IWAL 1Q81C 4LF5Q 4GN5A 3HOYH 4LF4Q 2UUCQ 1M90C 3CCJA 1X54A 1JMCA 2WB1G 3RZDH 1NE3A 2MFIA 1SN8A 1D8LA 4JI7Q 4OX9L 2LXJA 3D0FA 5EAYA 4A3BG 1K83H 1BVSA 1WFQA 4GOPA 4GLXA 4LFCQ 4JI4Q 3HOZH 4A76A 3ULPA 1NJIC 4LFAL 4DR3Q 2BA0A 3RN2A 1N36Q 4LF8L 1Q82C 1N9WA 1WJJA 4YCVA 4JI2Q 3K7UC 4JYAQ 4WJ3M 1D7QA 4A4IA 1BBUA 1LM0A 3I7FA 1MJEA 3M4OH 4DV0Q 2I0QA 2JA6G 1TWCH 1EQQA 1I50H 4A93H 3UDGA 1AE3A 3H0GH 3JC66 2JA5G 3ZJYC 1K8GA 1HZCA 3PIPA 2K5HA 3U50C 3H15A 3ICEA 2ES2A 4GLVB 2ZTEA 1PA6A 2OCEA 3HOXH 1CSQA 4P73A 3TRZA 2K52A 2H5XA 4A3CG 2VUMG 1GVPA 4JI3L 3U58A 2JA7G 1VQFA 3HOUG 1PH4A 1M1KC 4KHPQ 5C3EH 3TS0A 4OXPA 1YHQA 5IYBH 2MNAA 1Q7YC 3JAMc 2MQHA 4EX5A 1AH9A 1Q1BA 1HNXQ 4HJ7A 5C0XI 3RNUA 3KYHC 2EIFA 4A3IH 4DAMA 2Y0SE 1I5FA 3I2ZA 3PUZA 4R4TA 3G4SA 3M85A 4YCUA 5GAHC 1FJGL 2F52A 5M3MG 2NVYH 2UU9Q 4BY7G 1E7ZA 1XNQQ 2KENA 4GLAC 3J7ZC 5IYCH 4A3EH 1KAWA 1PVOA 1N32L 2NVXH 1S72A 1FVIA 3CCLA 4AQYQ 1W3SA 3KJPA 3CAMA 4JI8Q 4X65L 3HKZG 4A3JG 5C4XG 4DR1L 4Y52H 1X3FA 2HHHQ 4DR6L 1QZHA 1XTDA 3E9IA 1PYSB 5C0XJ 4KLKA 1YIJA 2D62A 1YJWA 2E2HH 4IFDI 4A3MH 1NMFA 1SLJA 2PI2E 3LGJA 4NPSA 1Q46A 3UDXA 4YHHL 3CC7A 1OXTA 1YHAA 2C35B 4X66Q 4B3SL 4JI6L 4EQ5A 4B3TQ 2JA8H 3KF6B 1VQKA 2RF4A 5ELNA 2A19A 1X6OA 2UXCQ 3PV0A 4DV7Q 4NXMQ 1A63A 1JB7A 4PZ8A 3OYYA 3J81j 3S1MH 2UUBQ 2F4VQ 3GO5A 2E2IH 1TWAH 3GTOH 2HQLA 2ZTCA 3NEMA 3W1BA 1OXXK 3K7AH 4P72A 1PFSA 3NENA 4XIGS 5GADC 1YI2A 4LNQA 4DV4Q 1OTCA 2N8NA 1I3QH 4IPHA 4GNXA 1B8AA 2XTIA 3GTQH 1C9OA 3L2PA 3BJUA 1KRTA 2AHOB 2K14A 5JJLA 4C3HH 2GVAA 2V1CC 3ERSX 3AQQA 3PO2G 1VQDA 4MNOA 4PZ7A 5IY0A 3CPWA 3J80i 2KBNA 1VQMA 2R93H 5M3FG 4GKJQ 1VQBA 5IE8A 1K0RA 5HGQA 4DV2Q 5C0XG 1UEBA 2AMCB 1MJCA 4A3FG 1VQOA 4LF9L 2NVQH 2VNUD 1TWFH 3J81i 4LUOA 1K73C 1MIUA 1RL2A 4P71A 5BR8Q 1V43A 2KHIA 3S24A 1VQ7A 4POFA 4BA2I 3OTOL 1YBYA 3CCQA 2OQ0A 2VQFL 2MO1A 1Z9FA 5E7NA 4P75A 5FJ8G 5LMNL 4UP8A 3CQZH 1PH1A 2IT1A 2R6GA 3ULLA 3A5UA 1VQLA 2ZTDA 2VQEQ 4X62L 4OX9Q
chains in the Genus database with same CATH superfamily
2A6HC 4AYBG 3MFGA 1E24A 1ENFA 4JV5Q 4N8FA 1WTOA 2I5MX 1Q1EA 3CCMA 2V4DA 2FFKB 2R92B 4A3DG 5M5XB 1ZYRC 3FDTA 4XXEA 1CK1A 1H95A 1BDOA 1B3AA 1GOZA 4QJFA 2EZVA 4JI0L 4KV6A 2DUDA 1DXMA 3CW2C 3S1NH 2VS1A 2E5LL 2J0TD 4DKAC 3L0OA 3M4YA 1SDFA 1GKHA 4OO1H 1ET9A 2PQAA 2Z4IA 2YYZA 5DNFA 5C44H 3C46A 2F0OA 3E5SA 1H9JA 1T9HA 3RN5A 2F0VA 1EY5A 3URYA 1SNPA 3DHQA 2BE5D 3IL8A 3RMHA 1GUGA 2F4IA 3GTMH 1B50A 4DV5L 2NBFA 3HOZG 1RCVD 3A56A 1V1PA 1TIID 2RVLA 1K3RA 1K8MA 2OF1A 2IX1A 2VUMH 3KF6A 1QB5D 2I5HA 4ZAIA 4CHTB 4IUVA 4BXXH 1MSHA 2PI2A 2RCNA 3MXNA 3R93A 4BBSH 4OGQC 1VF5C 3BVZA 3HFZB 5CBEE 1IKLA 3JAMi 2MUYA 3EBEA 4A93G 1EQVA 4HJAA 4JI1Q 2WACA 3HOXG 5EKKA 1F2MA 2IHEA 1A2TA 2KUMA 4JG2A 2B2VA 1FNWA 4IO9A 3CD6A 4DV0L 3TEHB 3ER0A 3OMGA 1PTOC 4DN4M 4IN3A 3D4RA 1VMCA 2Q2TA 1CI3M 3J81L 2ZJPA 3PF5A 1QVGA 2EYHA 4LUVA 3SK6A 2Z6KA 3Q22A 4FF3A 3N52A 2QEXA 1STNA 3TP8A 1SJHD 4CJ0B 4A3EG 2Y0SG 1UE6A 4RHSA 5IP7H 1TS3A 3WWVA 4KHPL 2H1EA 3S1QH 1S5BD 4YY3Q 1J6QA 1HNXL 2WP8J 2OWOA 5IT9L 3I73A 2IPKD 3I4NG 2XIWA 1L2FA 2N3SA 3MTSA 4F87A 3J7AF 5FOBB 1VQGA 5EKLA 4APVA 1FNVA 1NY4A 4RCOA 3DM1A 3U9OA 2FHTA 4RAUC 4R4OA 3S1RB 1OXSC 4X66L 1IYUA 4DV1Q 1PYWD 3DMUA 1F2YA 5I9OA 2CVRA 3B6YA 4DV7L 4FO2A 5IWAQ 5E3FA 1A62A 2RQXA 1TY2A 4QL5A 5FLXc 4TRDA 4X3SA 1GHKA 1B7YB 5CMDA 4JC0A 1STEA 4JBMA 4K2KA 3Q23A 3HGBA 4IOAA 2CQAA 4LFAQ 1J8IA 1H9KA 5AFWA 1O78A 1YHBA 4J1MA 3J7YW 5KYLA 2NZ1D 1HHVA 1X55A 4IQZA 3EVQA 2F0PA 1VQIA 4IPCA 1IW7C 2I5LX 3NBHA 1SJED 1Z7TA 4H0LC 2Q8TA 2F03A 1RIPA 2EJMA 3GTKH 3PGZA 3Q6SA 1CSPA 1S40A 1L0WA 4A3BH 4F8MA 5IYDG 2E8GA 2J7ZA 4CKEA 2KEDA 4JI3Q 2R92G 1VF7A 2OEOA 3UDIA 4GZYC 2CWAA 3VYSA 1GXDC 5J39A 2JA6B 5C4ZA 2XSCA 3ND8A 3M4PA 2N49A 3DLLA 1EY4A 2B8GA 4JV5L 4C1NK 3GD7A 5FLXE 3BYYB 2MP1A 1CA6A 3VR3A 2MGSA 4DAYB 4WJ4A 1CKNB 1JOKA 4DXFA 5DM73 2VUMB 1UE5A 1HA5A 3MXGA 3E0EA 2UUCL 4X65Q 3EA6A 1R4PB 2WAQE 4DR1Q 4H7BA 2Q8IB 2QEJC 4QGUA 2QW7A 2YU9B 4A3LG 4YHHQ 2NYZD 3S2DB 1RD9D 4DR3L 4JI6Q 3CCSA 1AZPA 2CCZA 2HD3A 4B9XA 4BY7B 1H9SB 4MIUA 3ERQA 3SXHA 4DA2A 3QIAA 4PMWA 4GNXC 4ZYSA 1R9TH 3GTLB 2KCNA 4A3JB 1JE5A 1X3PA 1QZGA 1JORA 3NHHA 1V9PA 4KMUC 4OWTB 4RHRA 2DJFC 3MFYA 2A6ED 1XNRQ 2F0UA 4PZ6A 1EYAA 3G6EA 2A8VA 2KCMA 1Y1WG 4LMQD 3W1GA 2D5DA 3CCRA 1FGUA 1VQJA 4V0BA 1QJOA 4JI1L 1P8LA 3F1ZA 1Q86C 4C3JH 1A2UA 3AFQA 4HJ8A 1DD2A 1EY9A 2N55A 3UI2A 2G9HD 4EQNA 3FP9A 4IPDA 1IZ6A 3PO2B 4XT3B 1YVCA 4B9WA 5FLMG 1TR5A 1IXRA 2L12A 4DUZQ 1E1OA 2J4XA 4LF7Q 4J8QA 2NZOA 3R2TA 4G7ZC 4AYBE 3I90A 5FJ8H 1SE2A 1EQRA 4YY3L 2YTYA 2JK8A 3A8IE 1DOKA 3R3OA 4WRDA 1S5ED 3X3NA 2Q8RE 4L63B 5CV6A 3J81c 3K59A 1U4PA 3OSOA 5C6AA 1BR9A 3VYRA 3R8BA 4OWWB 2HDLA 3F8TA 3T16A 5FO9B 3OW2A 4TQUS 1KNAA 1HZBA 4IUPA 1RJTA 3MAQA 3OMCA 1HR0Q 1U0LA 2XGTA 3HZXA 1SRUA 3SR1A 2KA7A 3K5OA 4DV1L 2OTLA 2YTXA 1FNUA 1PZID 4ODGA 1PH2A 3FPPA 3M3YH 5IT9c 4CDEC 4UHVA 4KHVA 5IWAL 1Q81C 5J22A 4XYQA 3RZDH 4DFAA 1SN8A 4JI7Q 4KTAA 2PYKA 2B2VC 1RTNA 2DY7A 3W3AA 4ZKBB 4GLXA 1K83B 3I8ZA 1SXTA 3HOZH 1JB3A 1NJIC 4LFAL 1ICWA 1Q82C 4K6DA 1LLRD 4JYAQ 5IODA 1D7QA 1Q8IA 3J81E 3I7FA 4ME5A 1E2VA 1KLGD 2JA6G 1TWCH 4ZKCB 4A93H 1I50B 1HZCA 3OIQA 3U50C 3HOXH 4P73A 5F2DA 4EVOA 2K52A 4A3CG 1BXTA 4JI3L 2VUMG 3HOUG 1STHA 2B2TC 2MQHA 5IT9E 5C0XI 1HRJA 1DYQA 2WKDA 2KQ3A 2QCPX 2Y0SE 4R4TA 4A3IB 1EFID 4YCUA 1ESRA 1XWEA 3SE0A 3D4DA 1SAPA 2F52A 4BY7G 4HMJA 4A3EH 1ILPA 2AQ2B 1KAWA 3KUPA 1S72A 1FVIA 1W3SA 4X65L 4A3JG 3QJYA 4DR1L 5G3LF 4KJNA 1QZHA 4WJWA 4K5VA 2D62A 4NPSA 3I4NH 1U9RA 1Q46A 2MJ8A 4YHHL 1YNND 4JI6L 4B3TQ 1VQKA 1EWHA 2A19A 2UXCQ 3PV0A 4NXMQ 2BE5C 1EY7A 3LX0A 1O7LA 3S1MH 3GO5A 3C3LA 2E2IB 3T51B 1OXXK 2QF7A 1FR3A 4N9PA 5GADC 2JXMB 2RCFA 2N8NA 1I3QH 3L2PA 1EEID 1PRTB 2AHOB 4PQXA 2GVAA 4C3HB 3QG1A 2ENBA 3PO2G 2N88A 5IY0A 3CPWA 3TDQA 2KBNA 2PPBC 4GKJQ 3I72A 5C0XG 2NVQH 1BCPF 1TWFH 1XXGA 3J81i 1K73C 1MIUA 5BR8Q 3NTIA 2KHIA 3S24A 1VQ7A 4POFA 2FINB 1YBYA 1WD1A 4HAEA 4P75A 5LMNL 4R8IA 2R6GA 1VQLA 4KN4C 2ZTDA 1C48A 2CH4A 3P75A 3HOWB 5IIFA 4DUZL 4B3MQ 1IBML 5IYDH 3T1HQ 4HIKA 2VY3A 2B63B 2R92H 5M5XH 1LT5D 3GTPB 1VQ8A 2ZXPA 1KHIA 5LL6X 2NVTB 2FMCA 3SK4A 4BBRB 4ZRZA 1PRTC 1EY0A 3S9WA 1NTGA 1K3BC 1NUCA 5I6YA 3NELA 4RG1A 1WCMB 3I91A 4R4CA 2ATWA 5LMNW 4AIMA 5K5PA 2LXKA 3HOYG 4NP5A 1HQMC 5GROA 1ENAA 4A3LH 1E3PA 3HOXB 3KFUA 1WTXA 1NMGA 1AE2A 2A1AA 1D1IA 4OL7A 1N33Q 3F2BA 4OIKA 1EOTA 4JI7L 2VB3X 1SNMA 3CP0A 1X65A 4B3SQ 2F1MA 2L4NA 3GQBA 1D2BA 3J80L 1M8AA 2LS01 4UY8C 2GN5A 2K33A 2RHSB 4IOCA 4JYAL 1EIHA 1HNWQ 4IURA 2K5DA 3L7ZC 1Y1WH 1J5EQ 5IYBG 3GV3A 3MWYW 1D5ZC 1SROA 3CCVA 4A3IG 1X56A 5DM63 1T5XD 4LF6L 1JJGA 4TKOB 5JEAJ 1JE4A 4I7ZC 2A68D 1X9NA 1BBWA 4C3IB 2K5QA 5EKIA 4HSVA 4L6TB 1K0SA 1OXVA 3K80C 2O5IC 1DGSA 3NPPA 5C3XA 2JP1A 3TSSA 1D5MC 1VS0A 5FLMH 2UXBL 4A3MG 1NR2A 3P7JA 1K9MC 1EY8A 3G6JB 4FVMA 2DGYA 1QUQB 4X3KA 3QOJA 4KI0A 3VR5A 1MHWC 2GVBA 3A7AB 3KLWA 2P5ZX 3S1RH 2EPBA 4DK6C 5ISRA 3EQLC 2BA1A 1F77A 1UWVA 1X3EA 4O42A 4GKKL 1HXYD 1HTPA 4KD4A 4B3TL 1TWFB 4UP9A 1EZ6A 5LHY1 4DR5Q 1I6HB 4C3HG 1I94Q 4NXML 2KCTA 1HTLD 4DV3L 4L5QA 3CF5A 5HY6A 3PSIA 1Z47A 3FHWA 2LY7A 2F0WA 1GUWA 1G6PA 2ALYB 2L9HA 5C4HA 1XJVA 4DNTB 4DAYA 2R7FA 4FXGC 1IHZA 3STBD 2R7ZB 3T13A 3RR5A 2HIVA 3BVGA 2WB1B 3SVMA 1LV9A 1PV4A 1YITA 3HOWG 4GKJL 2JSOA 1SBBB 1MSGA 1XPRA 3TZUA 1PTOB 3RD4A 5K36G 5G3LD 4JBJA 1ICFB 5BR8L 3O13A 2B63G 5LMUL 2K75A 3NXWA 4XT1B 3WOEA 1CUKA 1WVLA 4Z9CB 4B3RL 2JA6H 4BBRG 3PIO3 1O7YA 1BBXC 3UE1A 2JA5B 1WCMG 4B3ML 1I6VC 1EFWA 3T1HL 1AP0A 1GUOA 1XMOL 4N8X1 4A3CH 3HOUH 3H94A 2SNMA 2EYPA 4DPGA 2IX0A 1U5KA 1TWGB 2BCOA 2GA4B 2KEEA 1AZQA 1SE3A 2YU9H 1ONLA 3AU7A 1NCVA 1A3UA 1TS4A 4QUCA 4OWXB 4OELB 1XYIA 3S2DH 3T56B 4BY7H 2EYLA 2FMMA 5M3MB 3U4VA 1PXUA 2BOSA 4CGYB 3BDOA 3V96A 4ID6A 4M8AA 3GTLH 4A3JH 1Y1WB 1BCPD 3S15B 3HKZB 5C4XB 2A69C 3TP5A 5I6WA 2CFMA 5AJ3Q 3A8KE 1VQ9A 1L1OC 4FNFA 2OQKA 4EQOA 4Y7NB 2CW0D 4YIJA 5KGUA 4K5XA 1K8AC 1N33L 3AFPA 1FGBD 4TSSA 1CKMA 4KHZA 2BH2A 3DEOA 4KKTA 3QR8A 4QIWB 4GN3B 1W2BA 2RDGA 3PCOB 4LF9Q 1I4RA 3OTOQ 1HNWL 1X3GA 1W6JA 4C3IG 1RHPA 1IL2A 3PO2H 1XPUA 4RFBA 1J5EL 1K28A 3BZCA 1I4QA 2HHHL 3PIOA 3VYTA 3H3VC 1EWIA 2L15A 5CR3A 2K28A 4X62Q 5M3FB 1SR3A 1PYBA 5C0XH 5BN5A 1B9MA 1WTHA 4A3FB 4JBKA 5ELFA 2E76C 1MD2D 3U9SA 2DNEA 5JEAG 4L5RC 2RA4A 4X3TA 2F0NA 3GTGB 2ZM6Q 2LFNA 1KDBA 3J80c 5CV7A 3KBXA 4MTKA 2EJFC 4CDDC 2B2UA 3Q0AA 1VQHA 4RKBA 3KOJA 2NB0A 1QVCA 4C2MB 3F2CA 1SYFA 1TS5A 1EEFD 5IGBA 2Q2IA 3BZDB 3FKIG 2A73B 5JOBA 1CFMA 2LMCB 5IP9G 1Y1VB 4JOIA 4CDCC 2UXDQ 5C4JH 1I4XA 1YNNC 2B3GA 4PG3A 2HDMA 2Z4HA 1C8CA 1YNJD 3H3VI 4GNXB 2AWNA 1EU3A 3DM3A 4ALPA 5M5WB 3A7LA 1PH8A 3BDCA 3NP8A 1I94L 2R7ZG 2C5CA 4DR4Q 1EOVA 3E6ZX 3FEWX 3DUZA 4LF5Q 3GP7A 1KNEA 3HOYH 2X6LA 4LF4Q 1PZJD 1X54A 1MI2A 2WB1G 1QILA 2MFIA 1D8LA 3IAYA 4L8JA 4OX9L 1B9NA 3D0FA 3J80E 1K83H 4GOPA 1IKMA 4LFCQ 4O1NA 1QNKA 4NW2A 4ZK9B 4YCVA 3HOUB 1CHPD 1J9OA 1V8QA 3M4OB 1GUNA 1I50H 4FP5D 3UDGA 1HA6A 2JA5G 3JC66 2KVMA 1SE4A 1K8GA 4V190 1QG7A 3A54A 3NUCA 3D4WA 2ES2A 3AMUA 4GLVB 1A6XA 1CSQA 2OXPA 3K57A 1SNOA 4KN7C 4PNYA 5KRUA 3NQTA 2DY8A 5C3EB 5IYBH 3DWQA 4EX5A 1SMYC 5D3DA 4IZ8A 4HJ7A 3SK5A 4A3IH 3CRKC 3PUZA 1I5FA 3G7LA 3G4SA 2E2DC 5EGTA 4B08A 5M3MG 2UU9Q 1E7ZA 1XNQQ 3OIPA 4UDUC 2KJXA 2HCIA 1DCZA 3VA5A 1PVOA 1STAA 3CCLA 5IGEA 3HKZG 5C4XG 4Y52H 1X3FA 2K7VA 4LJZC 5C0XJ 4LAAA 1WD0A 1CTMA 4A3MH 1SNQA 2E2HB 3BS1A 1OXTA 1YHAA 2C35B 1V1PB 3K5MA 3KF6B 2A6HD 2RF4A 5ELNA 1A63A 2NUCA 4PZ8A 2F4VQ 2E2IH 2HQLA 3NEMA 4IUUA 1STYA 3K7AB 1ZYRD 4DV4Q 3HG9A 1OTCA 4G4KA 3SEBA 5I9PA 1B8AA 2XTIA 1WTRA 1F9RA 1S5DD 3BJUA 2K14A 4C3HH 1SSOA 2O2LD 4HEDA 2V1CC 1VQDA 2D9UA 3NWTA 3J80i 1E2WA 1VQMA 1BNZA 5M3FG 2HCCA 2SNSA 1VQBA 5IE8A 1K0RA 4A3FG 1VQOA 2AMCB 2XRSD 4LF9L 4P71A 3FRPB 1V43A 1EYDA 3OTOL 1H9MA 3CCQA 2OQ0A 2WKCA 2MO1A 3QWNA 5C4JB 3CQZH 2RBMA 2IT1A 1PH1A 1NAPA 3A5UA 4RGTA 5ELCA 2VQEQ 4X62L 3HOWH 4X6AH 3CC2A 5FO7B 1LTRD 3M4QA 5K36H 2A68C 1SYDA 4HTHA 3KF8B 4HR7B 1KQSA 2B63H 3GTPH 2EYFA 1VQ5A 1Y1VG 1KAAA 2NN6I 4QMGA 2ZM6L 3KJOA 2NVTH 1LTAD 2EXDA 4BBRH 3HOYB 5D14A 1EY6A 2JEAI 1X3QA 3LWEA 1B2TA 4O0AA 5FK9C 3X3MA 1WCMH 4UPAA 4EGVA 1EWCA 2PZTA 2CHBD 2CQOA 2UUAQ 5ELDA 3BYTB 1H9RA 1O7IA 2F0LA 4PV1C 4NB3A 4POGA 2WIIB 1SNCA 2K05A 2X69A 2Z6KC 2UXDL 1B70B 2BH8A 3CCUA 1S3OA 4FYDA 3TREA 2XNAC 1D6EC 3U4ZA 2AWOA 3KDFB 4JVZA 4DK1A 1HQRD 1N8RC 1AFPA 1D1KA 1XX8A 4MZ9A 3MHBA 2TMPA 4R1JA 1WI5A 4DR4L 1E0BA 3UE0A 4LF5L 1PH7A 4CKCA 3K5LA 1AEXA 1W6KA 1DJRD 1E1TA 2XN9C 3NBHB 1ASZA 3FMCA 4DR6Q 2G5DA 1PZKD 1WTVA 3TS2A 3WDNA 4LFCL 3ZYYX 1UUPA 1XMQQ 1KDAA 2D2CC 2ZJQA 4Q0FA 5BN3A 3I70A 5IOCA 2NZHA 1IBKQ 3HS0C 3VR2A 4YWLA 5C3EG 2XVSA 3HOVB 1AW7A 4U68A 1VQPA 4DUYQ 1OXUA 2NN6G 3TMEA 1II3A 1EUJA 1LABA 4A3MB 1STBA 3S2HB 1UE7A 3F2DA 5IYCG 2G9DA 4NKLA 2F0DA 1RF2D 4R8NA 2KOLA 4C3IH 4UP7A 2F0TA 1PFNA 2IY5B 4HIMA 1ZXTA 5JJKA 2L55A 3T53B 4JOIC 4H02A 1IW7D 4K8JA 3SGIA 1XNQL 1JJCB 3I4MB 2NWGA 1G8ZD 3CC4A 1XNRL 1E22A 4DV6Q 5JEAH 1WTPA 4CDFC 1EIFA 5T1GA 4HCEA 4G57A 3RLOA 2YTVA 2AUJD 3TBIB 2CWPA 3RZOH 1FL0A 5H1SE 4EQPA 2VW9A 3VA7A 4A3KB 1VQAA 2K5VA 4RKLA 1I6HH 2RHQB 2VZAA 3FKIH 1KTKA 2EYOA 4ME3A 5IP9H 3SK8A 5L37A 3H91A 2F4VL 3S16B 2E2JB 1VDZA 4OEMB 1K8OA 4A3GB 3CQZB 2TSSA 4KY7A 2JA9A 2E5LQ 4HJ9A 3DWAA 4LF7L 5D3IB 1QNUA 2K01A 5I2XA 1I4PA 4JPBW 3E3XA 4HCSA 2C9OA 4CBVA 2WB1E 2R7ZH 4LUZA 4QUFA 1ASYA 3EN2A 3KLSX 1TXYA 2R7DA 3TZDA 1LT6D 3M7NA 1SEBD 1KL9A 1LT4D 1IL8A 1PTOH 3LWUA 2FJ2A 5M5YB 3J7A5 1NBWA 2Z0SA 2Z6BA 3RLNA 5LL6S 4RGMA 1GD7A 1SFOH 4XQQA 1A15A 1VQNA 3Q8DA 3MEFA 1SE8A 2K4KA 5CBAE 2L0CA 3S14B 1Z6HA 1PRTF 2JA5H 1HR0L 2PW5A 2VQEL 1KC8C 4ZUJA 2F3VA 1FJGQ 3VDYA 1U4RA 4MN3A 3UDFA 1FD7D 4DNRB 3CXCA 2VB2X 3PMFA 1PFMA 2JA7B 1ESFA 1TWGH 3RUZA 1HUMA 4XDXA 2RDFA 2VXWA 3DEPA 2AKWB 1RDPD 4LWCA 5M3MH 1EQTA 2MHVA 3H3VH 2UUAL 3HKZE 2KECA 1AN8A 4KKSA 1HR0W 4J15A 3S15H 1B53A 4YWMA 5C4XH 1NSNS 1WTWA 1RODA 3Q24A 1QCBD 3EIVA 1V1QA 3NSWA 1Y69U 3GTJB 2EVBA 2RSOA 4Y7NH 1IYJB 2WAQG 4E6IA 1U4LA 1CKOA 3PUXA 5M9OA 4C56C 4QIWE 4AH6A 1TT2A 2XRQD 1WOCA 5CC4A 3AEVA 4OONA 3HOVG 3C1EA 4KKUA 1F2ZA 5E4WC 4QQBX 1Q8KA 1O80A 1VMPA 2B2WA 3OHXC 1KDCA 1XMQL 4DGZA 2JYOA 1LT3D 4JCVE 2PMZB 1IBKL 4QCLA 5GAGC 1F2LA 3PQIA 2VQFQ 1UE1A 4RWSC 2VL6A 1CHQD 3K6OA 4FXKC 3ULJA 4DUYL 2JEBI 3OWEB 1TWHH 1VQEA 2R61A 3K0XA 5EBCA 5M3FH 2E75C 3RZOB 2HIXA 3PIP3 3CCEA 1Y14B 5IGDA 4A3FH 1ZKOA 4IFDJ 2M00A 3I4MG 3EROA 3BU2A 1C7YA 5EQ0A 2ICIA 2UXCL 4O2DA 1LTBD 3FKIB 3GTGH 3NE5B 4JI5Q 2L5TA 4MTNA 5ELBA 3KLRA 4QF4A 3S17H 4DR7Q 1PHJA 3RLFA 1N34Q 1R4QB 1KLUD 4H44C 3W2DA 2Q2HA 3ONAB 5A35A 1GO3E 2A6EC 1EL0A 3NTKA 2F0MA 4C2MH 1HJPA 2EJGC 4A3KG 3I56A 4FDBA 1CKNA 3OWFA 1HH2P 4DV6L 3SDZA 1IBLQ 4DR2Q 1Y1VH 5FO8B 4S3SA 2ZT9C 1A8VA 2HUGA 5EPJA 4A3GG 1PLFA 1V1OA 5DLQE 1TKWB 2PZWA 4NXNQ 1YZ6A 1HFGA 5M5WH 2QILA 2M9VA 3BZKA 1SFOB 1H9SA 1JQYD 3DWPA 1GHJA 1L1OB 4I7AA 2UUCQ 3CCJA 4ABNA 5CV5A 1JMCA 1NE3A 2LXJA 5FKAC 2QKIC 5T1IA 4JI4Q 1A3VA 1PDQA 4A76A 3ULPA 4DR3Q 2BA0A 3RN2A 1N36Q 3P1HA 1WJJA 4JI2Q 3K7UC 4WJ3M 4A4IA 1S5FD 1BBUA 1LACA 1MJEA 2AUKA 3M4OH 2B2YA 2SEBD 5E1FA 2SDFA 4ZQ3A 1JWSD 3PIPA 3H0GB 2K5HA 3ICEA 5BN4A 2ZTEA 1PA6A 2OCEA 2B8FA 1JWMD 2BDOA 2EY6A 2EY2A 2H5XA 1DOMA 1GVPA 3NK9A 2JA7G 1VQFA 2Z8LA 5DEHA 1M1KC 2F0FA 5C3EH 3TS0A 4OXPA 2IW3A 4X3UA 1YHQA 2MNAA 4J6HA 1Q1BA 2NN6H 1WTQA 2EIFA 4C1NI 3I2ZA 5I4DA 2F0IA 4F88A 3M85A 1FJGL 2F0GA 2K32A 2NVYB 3J7ZC 5IYCH 1G91A 5HGTA 1BUVT 2NVXB 4AQYQ 1PTOF 4JI8Q 5A2QL 2Z1CA 1CQFA 5IGGA 1PYSB 3EFXD 2IL8A 4NMZA 1YIJA 4HMIA 4K8IA 2E2HH 4IFDI 3BDLA 2PI2E 3UDXA 4B3SL 3CC7A 3PO3B 4EQ5A 1JWUD 3AB9A 2JA8B 1X6OA 2F0SA 4F7XA 1JB7A 1GUSA 3OYYA 5EJWA 2UUBQ 2RKSA 5EPLA 4ZUIA 4Q5VA 2DN8A 1TWAB 3GTOB 1L0YB 3K7AH 1TWHB 4HSPA 3NENA 4LNQA 3V05A 4FF4A 2B2TA 4IPHA 2ZXRA 1PRTD 1C9OA 1CT1D 3GTQB 5KNCA 5JJLA 3KF8A 4DU9A 5J1ZA 3S17B 3AQQA 4QB4A 2R93B 5C5MA 4H13C 2NTSA 4R9WA 2RDHA 5HGQA 4DV2Q 1MJCA 5JPMC 4LUOA 1IYVA 2JN4A 1PFBA 1JICA 4BA2I 2Z9HA 2VQFL 1UNSA 4UP8A 3M7GA 2H4OA 3NQIA 3L9AX 1C4QA 1LTTD 4BY1B 3V2TA 3KDFA 4PMCA 4IUQA 5CV8A 1HUNA 3BVMA 4IFDG 4DR5L 1EIYB 3QO2A 5GAEC 4JI5L 1LTSD 4DR7L 2A5HA 2MPMA 1VCIA 4RGNA 1N34L 1U4MA 1GJXA 3T1YQ 2K6AA 2D0OA 2KHJA 4JK1C 2I46A 2QDLA 1HZ9A 3S1NB 4LK1C 5CV9A 5EPKA 3I55A 3MXUA 2D0PA 1IBLL 1VQ6A 4DR2L 2EQSA 3TP6A 3KK7A 1QVFA 1CZGA 2AQ3B 5C44B 2MO0A 3HKSA 4R4QA 5KNDA 4LW1A 1EU4A 1SYEA 4TVAB 3EJIA 4K14A 4XQJA 2PW7A 1TVXA 4NXNL 1JC7A 3GTMB 4ILWA 3D6WA 5CYUA 1O7ZA 3TP7A 3C1FA 2B2WC 1B3QA 4HIOA 4YWKA 4BBSB 1LO5D 3CPFA 4L5SA 2CKZB 2F0EA 3HRZC 3H0GG 1JR0D 3IKJA 3PF4A 4RGOS 4JI4L 2EXZA 2IHFA 2PQAB 3CRLC 1N36L 4JI2L 2F3WA 1MKHA 1A0IA 3HOVH 3MXPA 1JOQA 1LYLA 4K2LA 1SMXA 4RH6A 4K0KQ 1PH3A 3IFDA 4X64Q 1XPOA 5KYIA 1JJ2A 3S2HH 1XTCD 2WV6D 1TS2A 5HURA 1PMRA 2ASBA 1P16A 3IRBA 3MXNB 1MGSA 2JQOA 4KY6A 3S1QB 4LFBQ 2F0HA 1UAPA 5CV4A 2K1BA 5AJ3L 1HNZQ 4DNIA 1Y8PB 1WYDA 2EYMA 1M4VA 2EOTA 2K5NA 3I4MH 3PO3G 2ICEC 4OIJA 4L5TA 2JA8G 3K8AA 2OT2A 4IUTA 3K81C 2O5JC 1JT8A 5KNBA 4AQYL 2O4XA 3KBGA 4JI8L 2CH4W 1LUZA 4XTCS 5LMNQ 2LKVA 1VQ4A 2I07B 5IGFA 1HPCA 1ZEQX 2FXQA 4OO1I 2B29A 4A3KH 1T5EA 3VYUA 4BS9A 1IBMQ 3WOFA 2F0KA 2ZJRA 4DAVA 4CJ1B 1PH6A 1Y8OB 3S16H 2E2JH 4FXDA 2UUBL 1L0XB 5D65A 4A3GH 1FYCA 1DONA 3D31A 1C0AA 2QGQA 2PNHA 2R93G 3K58A 2AQ1B 5JPNC 3CKIB 2B2YC 1LTLA 1BKBA 1G291 3OW7A 3A74A 5JJIA 5GQOA 2EE1A 2PQEA 1A3TA 4JW0A 3JAML 1BQQT 4LF8Q 1SYBA 4HJ5A 4IJHA 4A3DH 4GS3A 3G48A 4I65A 5JVG3 2Q2UA 1EIGA 2X6GA 2RSNA 3NBIA 4QY7A 4BY1G 1KD1C 3GTKB 5M5YH 3H09A 1PTOD 4DV2L 4A3BB 2DNCA 4U673 1TY0A 2A69D 2K5WA 3TQYA 3H6MA 2QDBA 2M2LA 3J7AV 3A8JE 3I4OA 3S14H 2YV5A 1KXLA 4G7HC 3QOLA 4HIDA 1JCKB 1Q3LA 4OHJA 1EYGA 2NTTA 5EBDA 3SHLA 3ITPA 1YEZA 5I2YA 5A2QE 2QA4A 1QE6A 4BA1I 1BOSA 2JA7H 4OO1G 1N32Q 1I4GA 2OTJA 4LF4L 5C44G 1CQVA 3T1YL 3VR6A 2PCFB 1VQCA 4YCWA 4CJ2C 2IJ0A 2HQEA 3NWSA 3PUYA 4GN4B 1HZAA 3W5OA 5E4XA 1TQOA 2F3IA 4UAIA 3STBC 2WAQB 3T4AC 4LF6Q 2JE6I 5ELEA 2L11A 2K50A 5JVH3 3G71A 2KHSA 1QWYA 4M1UB 1QUQA 4BXXG 2F0QA 4IALA 4BBSG 2EYJA 4IUNA 1KRSA 5COYA 2IWHA 1R9TB 3KLSA 1BCPB 3C2PA 3GTJH 4ZCKA 4GOPB 3NTHA 2UXBQ 3CMEA 4DK0A 5JAVA 2B2UC 1KIXA 4KY5A 1GM5A 1B4OA 4CKBA 3PUWA 2WINB 1RTOA 1Y8NB 3MVVA 3D6CA 2PMZE 3A0JA 4RCNA 1ML0D 4K5WA 2UU9L 4IPGA 4C3JB 4GKKQ 5IP7G 5C5LA 3MZ5A 3FPUB 3QB3A 4DV3Q 4K0KL 3CMAA 1G2SA 4X64L 3F2UA 1UEAB 2K03A 4MHEA 3GDEA 4DAPA 4IJLA 2PO4A 5DAUA 3E9HA 1BCPC 4WORA 4GOPC 2KCCA 1YJ9A 1OO9B 3LNNA 1Q12A 4LFBL 1L1OA 4FF1A 4NDXA 2CW0C 1EZ8A 4K6LA 4JI0Q 3ND9A 2ZXOA 4PMBA 1HNZL 2N78A 2WFWA 1DOLA 2LSSA 2XWJB 4DV4L 4RA8A 4AYBB 4A75A 4IFDH 1PH5A 1G51A 4KK7A 5LMUQ 4JBWA 1CA5A 5CORA 2JJQA 4FF2A 4WFN3 4A3DB 2BDNA 2EDGA 3CHBD 3HP3A 4P74A 5ELOA 2HT1A 4B3RQ 2XWBB 4RMFA 2L1BA 4ZLTF 3I4LA 5C3WA 5J3BA 1PH9A 5KIXA 3A5ZB 3M9BA 3IFTA 2ID0A 4DV5Q 3OPOA 3PUVA 1SMYD 4DK3C 1YNXA 3FVQA 3AYHB 4R4IA 1XMOQ 1SYCA 3M3YB 2EY1A 1YJNA 1G6ZA 4GN5A 1M90C 1DM0B 1HCZA 3RZDB 5CGKA 5EAYA 4A3BG 1EYCA 1BVSA 1WFQA 4ULLA 2PZUA 2K04A 1Q90A 3HOZB 4LF8L 1N9WA 4DXGA 1NR4A 2SOBA 1X32A 1ILQA 1LM0A 1G2TA 1TU2B 4DV0Q 3OOCA 2R3ZA 2I0QA 3K0YA 1B44D 1EQQA 1TWCB 1AE3A 2E74C 3H0GH 4A93B 3ZJYC 3L3OC 1ENCA 4XYOA 3H15A 3TRZA 1GUTA 3U58A 4KHPQ 1SYGA 1E2ZA 2DJGC 1PH4A 3P20A 1YNJC 1Q7YC 3JAMc 1AH9A 1HNXQ 3RNUA 3KYHC 1D5XC 4DAMA 3BG3A 3D3RA 1ET6A 4XQNA 5GAHC 1B1ZA 2NVYH 2KENA 3A55A 4GLAC 2F0JA 1BF4A 4DF7A 5FLXL 4A3EB 1N32L 2Y0SB 1KABA 2NVXH 1S5CD 3HEJA 3KJPA 3CAMA 2A74C 1I4HA 5KEEA 5NUCA 2HHHQ 4DR6L 1XTDA 3E9IA 1CM9A 4KLKA 1YJWA 1QOHA 3E0JA 3LGJA 1NMFA 1SLJA 4KJOA 3PO3H 3I4NB 4X66Q 1HFNA 4KD3A 3DXJC 5IGCA 3VR4A 2JA8H 5JJZA 3TN2A 1F9QA 3MA2B 4DV7Q 3J81j 3D8GA 1LTID 2IX3A 1TWAH 3GTOH 3S1MB 2ZTCA 3W1BA 3I3CA 4P2CB 4P72A 1PFSA 4XIGS 3JAME 1YI2A 4C3JG 1SNDA 4GNXA 3GTQH 3N6RA 1I3QB 1RKNA 1KRTA 3K5NA 2EY5A 1F9SA 3CU7A 5TSSA 1F9PA 3ERSX 4HN7A 1STGA 4MNOA 1MBYA 4PZ7A 1CZWA 4N9TA 3R2IA 2R93H 3MC0B 4BWGB 1S4ZA 4G7OC 1UEBA 1DZ1A 2VNUD 2NVQB 1RL2A 1LTGD 3GV6A 2PNRC 1NNXA 1BO0A 1Z9FA 5E7NA 5FJ8G 3MEHA 1JOOA 2B39A 3ULLA 4BY1H 4OX9Q
chains in the Genus database with same CATH topology
3HOWH 4AYBG 4X6AH 1E24A 4JV5Q 3KDFA 3CC2A 4DUZL 4B3MQ 3M4QA 2I5MX 1Q1EA 1IBML 4IFDG 3KF8B 3CCMA 4DR5L 4HIKA 3T1HQ 1KQSA 2B63H 3GTPH 1EIYB 1VQ5A 2VY3A 1Y1VG 2R92H 5M5XH 4JI5L 5GAEC 2NN6I 2ZM6L 4A3DG 3KJOA 1VQ8A 2NVTH 4DR7L 1N34L 1KHIA 1VCIA 4BBRH 2EXDA 1H95A 3T1YQ 2JEAI 4QJFA 4JI0L 2D0OA 1VQ6A 2KHJA 4O0AA 2DUDA 1NTGA 3CW2C 3S1NH 2VS1A 2E5LL 1HZ9A 1WCMH 3NELA 4UPAA 4DKAC 4RG1A 4R4CA 3I55A 3L0OA 2ATWA 2CQOA 2D0PA 2UUAQ 1GKHA 1IBLL 1O7IA 4DR2L 2EQSA 2PQAA 4NB3A 4POGA 5LMNW 1QVFA 2Z6KC 4AIMA 1B70B 2YYZA 2UXDL 5C44H 2BH8A 2LXKA 3HOYG 3RN5A 1T9HA 3CCUA 1S3OA 2MO0A 3HKSA 4R4QA 3TREA 3U4ZA 5GROA 2AWOA 4LW1A 4TVAB 4A3LH 3KDFB 3GTMH 4NXNL 4DV5L 1N8RC 1E3PA 5IYDH 3HOZG 3KFUA 4MZ9A 1NMGA 1AE2A 1K3RA 2A1AA 2IX1A 4R1JA 1WI5A 3KF6A 2VUMH 4DR4L 2I5HA 3F2BA 1N33Q 3UE0A 4BXXH 4LF5L 2PI2A 2RCNA 4HIOA 1PH7A 4YWKA 4BBSH 1E1TA 3NBHB 3HFZB 3JAMi 1ASZA 3CPFA 4L5SA 2CKZB 3EBEA 4A93G 4JI7L 4DR6Q 4HJAA 3H0GG 3CP0A 4JI1Q 1X65A 3PF4A 3TS2A 4LFCL 4JI4L 1XMQQ 2ZJQA 2IHFA 3HOXG 4B3SQ 2IHEA 2PQAB 1N36L 4UY8C 4JI2L 2NZHA 2GN5A 4JG2A 1MKHA 2RHSB 4IOCA 1IBKQ 4JYAL 4IO9A 1A0IA 1HNWQ 4YWLA 5C3EG 3HOVH 3L7ZC 1Y1WH 3CD6A 4DV0L 3TEHB 5IYBG 3ER0A 1J5EQ 1VQPA 4DUYQ 1LYLA 1SROA 1SMXA 1OXUA 2NN6G 2ZJPA 3CCVA 2Q2TA 4K0KQ 3PF5A 1QVGA 4A3IG 1PH3A 4LUVA 4X64Q 1X56A 1XPOA 1JJ2A 1EUJA 2Z6KA 3S2HH 4LF6L 1JJGA 2QEXA 1UE7A 5JEAJ 3F2DA 2ASBA 4A3EG 5IYCG 2Y0SG 1UE6A 5IP7H 1P16A 3WWVA 3IRBA 4KHPL 3MXNB 4C3IH 3S1QH 2JQOA 1X9NA 1BBWA 4LFBQ 4UP7A 4YY3Q 1OXVA 1J6QA 1HNXL 2WP8J 3K80C 2IY5B 4HIMA 5JJKA 1DGSA 5AJ3L 1HNZQ 4DNIA 2OWOA 1VS0A 5FLMH 4JOIC 4H02A 2UXBL 1WYDA 4A3MG 3I4NG 2K5NA 3I4MH 3SGIA 3PO3G 1XNQL 1JJCB 1K9MC 3CC4A 1L2FA 1XNRL 2N3SA 4L5TA 2JA8G 3K8AA 3I4NH 1E22A 4DV6Q 2DGYA 3K81C 1JT8A 1QUQB 4AQYL 1EIFA 4KI0A 1VQGA 4JI8L 1LUZA 3RLOA 2YTVA 4APVA 4XTCS 1NY4A 5LMNQ 2GVBA 2CWPA 3KLWA 1VQ4A 3RZOH 1FL0A 3S1RH 4DK6C 5H1SE 4R4OA 2FXQA 2VW9A 1OXSC 4OO1I 2B29A 2BA1A 4A3KH 4X66L 1UWVA 1X3EA 4DV1Q 4GKKL 1VQAA 2K5VA 4UP9A 4B3TL 1IBMQ 1I6HH 2RHQB 2VZAA 3FKIH 3B6YA 4DR5Q 2ZJRA 4ME3A 4DV7L 5IP9H 1I94Q 4NXML 2KCTA 1PH6A 5IWAQ 3S16H 4DV3L 2E2JH 4L5QA 3CF5A 2UUBL 5HY6A 1A62A 3PSIA 1Z47A 2F4VL 4QL5A 5FLXc 4A3GH 3D31A 3FHWA 2QGQA 2PNHA 1B7YB 2R93G 1C0AA 4JC0A 1G6PA 2ALYB 2JA9A 2E5LQ 4HJ9A 1XJVA 4JBMA 1LTLA 1BKBA 1G291 5JJIA 3A74A 4LF7L 5GQOA 4IOAA 4LFAQ 4LF8Q 1YHBA 2R7FA 2WB1E 2R7ZH 4HJ5A 4IJHA 3STBD 1X55A 4A3DH 3RR5A 1VQIA 4IPCA 2HIVA 4LUZA 4GS3A 3G48A 2Q2UA 2I5LX 1ASYA 1RIPA 3GTKH 3EN2A 1TXYA 2R7DA 3PGZA 4QY7A 4BY1G 3M7NA 1KD1C 1CSPA 1S40A 1L0WA 1KL9A 1YITA 1PV4A 5M5YH 3HOWG 4A3BH 4GKJL 1XPRA 4DV2L 3J7A5 5K36G 1NBWA 2Z0SA 3TQYA 4JBJA 3RLNA 5IYDG 5BR8L 2E8GA 2B63G 1SFOH 5LMUL 1GD7A 4JI3Q 2K75A 2R92G 1VQNA 1CUKA 3Q8DA 3MEFA 3UDIA 1SE8A 2K4KA 3I4OA 2CWAA 3S14H 2JA6H 4B3RL 2YV5A 4BBRG 1KXLA 2JA5H 1HR0L 2VQEL 3M4PA 2N49A 3UE1A 3DLLA 4HIDA 4JV5L 1WCMG 3GD7A 1KC8C 4B3ML 1FJGQ 1EFWA 4DAYB 1EYGA 4WJ4A 3VDYA 1CKNB 3T1HL 3UDFA 1YEZA 1XMOL 3CXCA 2QA4A 4A3CH 3HOUH 4BA1I 2JA7H 4OO1G 1N32Q 4DPGA 1UE5A 2OTJA 4LF4L 1TWGH 3E0EA 2UUCL 5C44G 4X65Q 2IX0A 1U5KA 3T1YL 2WAQE 4DR1Q 1VQCA 4YCWA 2YU9H 4QGUA 3PUYA 4GN4B 2AKWB 4OWXB 4A3LG 1HZAA 3W5OA 3S2DH 2F3IA 4LWCA 3STBC 5M3MH 4YHHQ 4BY7H 4LF6Q 4DR3L 3U4VA 4JI6Q 3CCSA 2CCZA 2JE6I 2UUAL 3HKZE 3H3VH 3PO3H 2K50A 3G71A 4BY1H 1QUQA 3GTLH 4BXXG 1HR0W 4PMWA 4J15A 4GNXC 5C4XH 4YWMA 4A3JH 1R9TH 1KRSA 3S15H 4BBSG 1JE5A 3GTJH 3EIVA 1V1QA 1QZGA 2CFMA 5AJ3Q 1V9PA 4GOPB 1VQ9A 4Y7NH 1IYJB 1L1OC 4OWTB 2UXBQ 2WAQG 2OQKA 3CMEA 1CKOA 3PUXA 1XNRQ 1K8AC 1KIXA 4PZ6A 4QIWE 4AH6A 3G6EA 1N33L 2KCMA 1GM5A 3AFPA 2A8VA 1WOCA 3HOVG 3AEVA 4OONA 1Y1WG 3PUWA 1CKMA 3W1GA 3CCRA 4KHZA 2BH2A 4QQBX 1FGUA 1VQJA 1Q8KA 4GN3B 1W2BA 2PMZE 3A0JA 4JI1L 1P8LA 3F1ZA 1Q86C 2UU9L 1XMQL 3PCOB 4C3JH 4IPGA 3AFQA 4LF9Q 4GKKQ 4HJ8A 4JCVE 5IP7G 1IBKL 3OTOQ 3FP9A 5GAGC 1HNWL 1X3GA 2VQFQ 4IPDA 1IL2A 3PO2H 1UE1A 1XPUA 1J5EL 3BZCA 1IZ6A 4DV3Q 2HHHL 2VL6A 3ULJA 3PIOA 4DUYL 2JEBI 4K0KL 1TWHH 1VQEA 3K0XA 1EWIA 1YVCA 2L15A 4X62Q 4X64L 3CMAA 5M3FH 2HIXA 1SR3A 5FLMG 3CCEA 1Y14B 3GDEA 1PYBA 4A3FH 4IFDJ 1IXRA 4IJLA 3I4MG 4DUZQ 1E1OA 3BU2A 1C7YA 4JBKA 3E9HA 4LF7Q 2UXCL 4O2DA 3GTGH 5JEAG 4GOPC 4L5RC 4JI5Q 4MTNA 1YJ9A 3S17H 2ZM6Q 2NZOA 4DR7Q 3J80c 3RLFA 1Q12A 4AYBE 5FJ8H 1L1OA 1PHJA 1N34Q 1EQRA 4LFBL 4YY3L 2Q2HA 4JI0Q 2YTYA 1GO3E 2JK8A 1HNZL 2N78A 2WFWA 2LSSA 1VQHA 4DV4L 4C2MH 3KOJA 1HJPA 1QVCA 4A3KG 3J81c 3F2CA 3I56A 4A75A 4FDBA 1CKNA 1HH2P 2Q2IA 4DV6L 3FKIG 4DR2Q 1Y1VH 1PH5A 1G51A 1IBLQ 5LMUQ 5IP9G 4OWWB 4JBWA 4JOIA 2UXDQ 3F8TA 2JJQA 1A8VA 3OW2A 5C4JH 4B3RQ 2HT1A 4P74A 5ELOA 4TQUS 4A3GG 4RMFA 1HZBA 1PH9A 5DLQE 5J3BA 2B3GA 3A5ZB 4PG3A 1HR0Q 1U0LA 2XGTA 3M9BA 3H3VI 1SRUA 4NXNQ 2ID0A 4DV5Q 4GNXB 1YZ6A 2AWNA 3PUVA 4DV1L 2OTLA 5M5WH 2YTXA 4DK3C 3DM3A 4ALPA 1PH2A 1YNXA 3AYHB 1PH8A 3BZKA 4R4IA 1XMOQ 5IT9c 3M3YH 1I94L 2R7ZG 4DR4Q 1YJNA 1EOVA 1L1OB 5IWAL 1Q81C 4LF5Q 4GN5A 3HOYH 4LF4Q 2UUCQ 1M90C 3CCJA 1X54A 1JMCA 2WB1G 3RZDH 1NE3A 2MFIA 1SN8A 1D8LA 4JI7Q 4OX9L 2LXJA 3D0FA 5EAYA 4A3BG 1K83H 1BVSA 1WFQA 4GOPA 4GLXA 4LFCQ 4JI4Q 3HOZH 4A76A 3ULPA 1NJIC 4LFAL 4DR3Q 2BA0A 3RN2A 1N36Q 4LF8L 1Q82C 1N9WA 1WJJA 4YCVA 4JI2Q 3K7UC 4JYAQ 4WJ3M 1D7QA 4A4IA 1BBUA 1LM0A 3I7FA 1MJEA 3M4OH 4DV0Q 2I0QA 2JA6G 1TWCH 1EQQA 1I50H 4A93H 3UDGA 1AE3A 3H0GH 3JC66 2JA5G 3ZJYC 1K8GA 1HZCA 3PIPA 2K5HA 3U50C 3H15A 3ICEA 2ES2A 4GLVB 2ZTEA 1PA6A 2OCEA 3HOXH 1CSQA 4P73A 3TRZA 2K52A 2H5XA 4A3CG 2VUMG 1GVPA 4JI3L 3U58A 2JA7G 1VQFA 3HOUG 1PH4A 1M1KC 4KHPQ 5C3EH 3TS0A 4OXPA 1YHQA 5IYBH 2MNAA 1Q7YC 3JAMc 2MQHA 4EX5A 1AH9A 1Q1BA 1HNXQ 4HJ7A 5C0XI 3RNUA 3KYHC 2EIFA 4A3IH 4DAMA 2Y0SE 1I5FA 3I2ZA 3PUZA 4R4TA 3G4SA 3M85A 4YCUA 5GAHC 1FJGL 2F52A 5M3MG 2NVYH 2UU9Q 4BY7G 1E7ZA 1XNQQ 2KENA 4GLAC 3J7ZC 5IYCH 4A3EH 1KAWA 1PVOA 1N32L 2NVXH 1S72A 1FVIA 3CCLA 4AQYQ 1W3SA 3KJPA 3CAMA 4JI8Q 4X65L 3HKZG 4A3JG 5C4XG 4DR1L 4Y52H 1X3FA 2HHHQ 4DR6L 1QZHA 1XTDA 3E9IA 1PYSB 5C0XJ 4KLKA 1YIJA 2D62A 1YJWA 2E2HH 4IFDI 4A3MH 1NMFA 1SLJA 2PI2E 3LGJA 4NPSA 1Q46A 3UDXA 4YHHL 3CC7A 1OXTA 1YHAA 2C35B 4X66Q 4B3SL 4JI6L 4EQ5A 4B3TQ 2JA8H 3KF6B 1VQKA 2RF4A 5ELNA 2A19A 1X6OA 2UXCQ 3PV0A 4DV7Q 4NXMQ 1A63A 1JB7A 4PZ8A 3OYYA 3J81j 3S1MH 2UUBQ 2F4VQ 3GO5A 2E2IH 1TWAH 3GTOH 2HQLA 2ZTCA 3NEMA 3W1BA 1OXXK 3K7AH 4P72A 1PFSA 3NENA 4XIGS 5GADC 1YI2A 4LNQA 4DV4Q 1OTCA 2N8NA 1I3QH 4IPHA 4GNXA 1B8AA 2XTIA 3GTQH 1C9OA 3L2PA 3BJUA 1KRTA 2AHOB 2K14A 5JJLA 4C3HH 2GVAA 2V1CC 3ERSX 3AQQA 3PO2G 1VQDA 4MNOA 4PZ7A 5IY0A 3CPWA 3J80i 2KBNA 1VQMA 2R93H 5M3FG 4GKJQ 1VQBA 5IE8A 1K0RA 5HGQA 4DV2Q 5C0XG 1UEBA 2AMCB 1MJCA 4A3FG 1VQOA 4LF9L 2NVQH 2VNUD 1TWFH 3J81i 4LUOA 1K73C 1MIUA 1RL2A 4P71A 5BR8Q 1V43A 2KHIA 3S24A 1VQ7A 4POFA 4BA2I 3OTOL 1YBYA 3CCQA 2OQ0A 2VQFL 2MO1A 1Z9FA 5E7NA 4P75A 5FJ8G 5LMNL 4UP8A 3CQZH 1PH1A 2IT1A 2R6GA 3ULLA 3A5UA 1VQLA 2ZTDA 2VQEQ 4X62L 4OX9Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW H;  4AYB G;  4X6A H;  1E24 A;  4JV5 Q;  3KDF A;  3CC2 A;  4DUZ L;  4B3M Q;  3M4Q A;  2I5M X;  1Q1E A;  1IBM L;  4IFD G;  3KF8 B;  3CCM A;  4DR5 L;  4HIK A;  3T1H Q;  1KQS A;  2B63 H;  3GTP H;  1EIY B;  1VQ5 A;  2VY3 A;  1Y1V G;  2R92 H;  5M5X H;  4JI5 L;  5GAE C;  2NN6 I;  2ZM6 L;  4A3D G;  3KJO A;  1VQ8 A;  2NVT H;  4DR7 L;  1N34 L;  1KHI A;  1VCI A;  4BBR H;  2EXD A;  1H95 A;  3T1Y Q;  2JEA I;  4QJF A;  4JI0 L;  2D0O A;  1VQ6 A;  2KHJ A;  4O0A A;  2DUD A;  1NTG A;  3CW2 C;  3S1N H;  2VS1 A;  2E5L L;  1HZ9 A;  1WCM H;  3NEL A;  4UPA A;  4DKA C;  4RG1 A;  4R4C A;  3I55 A;  3L0O A;  2ATW A;  2CQO A;  2D0P A;  2UUA Q;  1GKH A;  1IBL L;  1O7I A;  4DR2 L;  2EQS A;  2PQA A;  4NB3 A;  4POG A;  5LMN W;  1QVF A;  2Z6K C;  4AIM A;  1B70 B;  2YYZ A;  2UXD L;  5C44 H;  2BH8 A;  2LXK A;  3HOY G;  3RN5 A;  1T9H A;  3CCU A;  1S3O A;  2MO0 A;  3HKS A;  4R4Q A;  3TRE A;  3U4Z A;  5GRO A;  2AWO A;  4LW1 A;  4TVA B;  4A3L H;  3KDF B;  3GTM H;  4NXN L;  4DV5 L;  1N8R C;  1E3P A;  5IYD H;  3HOZ G;  3KFU A;  4MZ9 A;  1NMG A;  1AE2 A;  1K3R A;  2A1A A;  2IX1 A;  4R1J A;  1WI5 A;  3KF6 A;  2VUM H;  4DR4 L;  2I5H A;  3F2B A;  1N33 Q;  3UE0 A;  4BXX H;  4LF5 L;  2PI2 A;  2RCN A;  4HIO A;  1PH7 A;  4YWK A;  4BBS H;  1E1T A;  3NBH B;  3HFZ B;  3JAM i;  1ASZ A;  3CPF A;  4L5S A;  2CKZ B;  3EBE A;  4A93 G;  4JI7 L;  4DR6 Q;  4HJA A;  3H0G G;  3CP0 A;  4JI1 Q;  1X65 A;  3PF4 A;  3TS2 A;  4LFC L;  4JI4 L;  1XMQ Q;  2ZJQ A;  2IHF A;  3HOX G;  4B3S Q;  2IHE A;  2PQA B;  1N36 L;  4UY8 C;  4JI2 L;  2NZH A;  2GN5 A;  4JG2 A;  1MKH A;  2RHS B;  4IOC A;  1IBK Q;  4JYA L;  4IO9 A;  1A0I A;  1HNW Q;  4YWL A;  5C3E G;  3HOV H;  3L7Z C;  1Y1W H;  3CD6 A;  4DV0 L;  3TEH B;  5IYB G;  3ER0 A;  1J5E Q;  1VQP A;  4DUY Q;  1LYL A;  1SRO A;  1SMX A;  1OXU A;  2NN6 G;  2ZJP A;  3CCV A;  2Q2T A;  4K0K Q;  3PF5 A;  1QVG A;  4A3I G;  1PH3 A;  4LUV A;  4X64 Q;  1X56 A;  1XPO A;  1JJ2 A;  1EUJ A;  2Z6K A;  3S2H H;  4LF6 L;  1JJG A;  2QEX A;  1UE7 A;  5JEA J;  3F2D A;  2ASB A;  4A3E G;  5IYC G;  2Y0S G;  1UE6 A;  5IP7 H;  1P16 A;  3WWV A;  3IRB A;  4KHP L;  3MXN B;  4C3I H;  3S1Q H;  2JQO A;  1X9N A;  1BBW A;  4LFB Q;  4UP7 A;  4YY3 Q;  1OXV A;  1J6Q A;  1HNX L;  2WP8 J;  3K80 C;  2IY5 B;  4HIM A;  5JJK A;  1DGS A;  5AJ3 L;  1HNZ Q;  4DNI A;  2OWO A;  1VS0 A;  5FLM H;  4JOI C;  4H02 A;  2UXB L;  1WYD A;  4A3M G;  3I4N G;  2K5N A;  3I4M H;  3SGI A;  3PO3 G;  1XNQ L;  1JJC B;  1K9M C;  3CC4 A;  1L2F A;  1XNR L;  2N3S A;  4L5T A;  2JA8 G;  3K8A A;  3I4N H;  1E22 A;  4DV6 Q;  2DGY A;  3K81 C;  1JT8 A;  1QUQ B;  4AQY L;  1EIF A;  4KI0 A;  1VQG A;  4JI8 L;  1LUZ A;  3RLO A;  2YTV A;  4APV A;  4XTC S;  1NY4 A;  5LMN Q;  2GVB A;  2CWP A;  3KLW A;  1VQ4 A;  3RZO H;  1FL0 A;  3S1R H;  4DK6 C;  5H1S E;  4R4O A;  2FXQ A;  2VW9 A;  1OXS C;  4OO1 I;  2B29 A;  2BA1 A;  4A3K H;  4X66 L;  1UWV A;  1X3E A;  4DV1 Q;  4GKK L;  1VQA A;  2K5V A;  4UP9 A;  4B3T L;  1IBM Q;  1I6H H;  2RHQ B;  2VZA A;  3FKI H;  3B6Y A;  4DR5 Q;  2ZJR A;  4ME3 A;  4DV7 L;  5IP9 H;  1I94 Q;  4NXM L;  2KCT A;  1PH6 A;  5IWA Q;  3S16 H;  4DV3 L;  2E2J H;  4L5Q A;  3CF5 A;  2UUB L;  5HY6 A;  1A62 A;  3PSI A;  1Z47 A;  2F4V L;  4QL5 A;  5FLX c;  4A3G H;  3D31 A;  3FHW A;  2QGQ A;  2PNH A;  1B7Y B;  2R93 G;  1C0A A;  4JC0 A;  1G6P A;  2ALY B;  2JA9 A;  2E5L Q;  4HJ9 A;  1XJV A;  4JBM A;  1LTL A;  1BKB A;  1G29 1;  5JJI A;  3A74 A;  4LF7 L;  5GQO A;  4IOA A;  4LFA Q;  4LF8 Q;  1YHB A;  2R7F A;  2WB1 E;  2R7Z H;  4HJ5 A;  4IJH A;  3STB D;  1X55 A;  4A3D H;  3RR5 A;  1VQI A;  4IPC A;  2HIV A;  4LUZ A;  4GS3 A;  3G48 A;  2Q2U A;  2I5L X;  1ASY A;  1RIP A;  3GTK H;  3EN2 A;  1TXY A;  2R7D A;  3PGZ A;  4QY7 A;  4BY1 G;  3M7N A;  1KD1 C;  1CSP A;  1S40 A;  1L0W A;  1KL9 A;  1YIT A;  1PV4 A;  5M5Y H;  3HOW G;  4A3B H;  4GKJ L;  1XPR A;  4DV2 L;  3J7A 5;  5K36 G;  1NBW A;  2Z0S A;  3TQY A;  4JBJ A;  3RLN A;  5IYD G;  5BR8 L;  2E8G A;  2B63 G;  1SFO H;  5LMU L;  1GD7 A;  4JI3 Q;  2K75 A;  2R92 G;  1VQN A;  1CUK A;  3Q8D A;  3MEF A;  3UDI A;  1SE8 A;  2K4K A;  3I4O A;  2CWA A;  3S14 H;  2JA6 H;  4B3R L;  2YV5 A;  4BBR G;  1KXL A;  2JA5 H;  1HR0 L;  2VQE L;  3M4P A;  2N49 A;  3UE1 A;  3DLL A;  4HID A;  4JV5 L;  1WCM G;  3GD7 A;  1KC8 C;  4B3M L;  1FJG Q;  1EFW A;  4DAY B;  1EYG A;  4WJ4 A;  3VDY A;  1CKN B;  3T1H L;  3UDF A;  1YEZ A;  1XMO L;  3CXC A;  2QA4 A;  4A3C H;  3HOU H;  4BA1 I;  2JA7 H;  4OO1 G;  1N32 Q;  4DPG A;  1UE5 A;  2OTJ A;  4LF4 L;  1TWG H;  3E0E A;  2UUC L;  5C44 G;  4X65 Q;  2IX0 A;  1U5K A;  3T1Y L;  2WAQ E;  4DR1 Q;  1VQC A;  4YCW A;  2YU9 H;  4QGU A;  3PUY A;  4GN4 B;  2AKW B;  4OWX B;  4A3L G;  1HZA A;  3W5O A;  3S2D H;  2F3I A;  4LWC A;  3STB C;  5M3M H;  4YHH Q;  4BY7 H;  4LF6 Q;  4DR3 L;  3U4V A;  4JI6 Q;  3CCS A;  2CCZ A;  2JE6 I;  2UUA L;  3HKZ E;  3H3V H;  3PO3 H;  2K50 A;  3G71 A;  4BY1 H;  1QUQ A;  3GTL H;  4BXX G;  1HR0 W;  4PMW A;  4J15 A;  4GNX C;  5C4X H;  4YWM A;  4A3J H;  1R9T H;  1KRS A;  3S15 H;  4BBS G;  1JE5 A;  3GTJ H;  3EIV A;  1V1Q A;  1QZG A;  2CFM A;  5AJ3 Q;  1V9P A;  4GOP B;  1VQ9 A;  4Y7N H;  1IYJ B;  1L1O C;  4OWT B;  2UXB Q;  2WAQ G;  2OQK A;  3CME A;  1CKO A;  3PUX A;  1XNR Q;  1K8A C;  1KIX A;  4PZ6 A;  4QIW E;  4AH6 A;  3G6E A;  1N33 L;  2KCM A;  1GM5 A;  3AFP A;  2A8V A;  1WOC A;  3HOV G;  3AEV A;  4OON A;  1Y1W G;  3PUW A;  1CKM A;  3W1G A;  3CCR A;  4KHZ A;  2BH2 A;  4QQB X;  1FGU A;  1VQJ A;  1Q8K A;  4GN3 B;  1W2B A;  2PMZ E;  3A0J A;  4JI1 L;  1P8L A;  3F1Z A;  1Q86 C;  2UU9 L;  1XMQ L;  3PCO B;  4C3J H;  4IPG A;  3AFQ A;  4LF9 Q;  4GKK Q;  4HJ8 A;  4JCV E;  5IP7 G;  1IBK L;  3OTO Q;  3FP9 A;  5GAG C;  1HNW L;  1X3G A;  2VQF Q;  4IPD A;  1IL2 A;  3PO2 H;  1UE1 A;  1XPU A;  1J5E L;  3BZC A;  1IZ6 A;  4DV3 Q;  2HHH L;  2VL6 A;  3ULJ A;  3PIO A;  4DUY L;  2JEB I;  4K0K L;  1TWH H;  1VQE A;  3K0X A;  1EWI A;  1YVC A;  2L15 A;  4X62 Q;  4X64 L;  3CMA A;  5M3F H;  2HIX A;  1SR3 A;  5FLM G;  3CCE A;  1Y14 B;  3GDE A;  1PYB A;  4A3F H;  4IFD J;  1IXR A;  4IJL A;  3I4M G;  4DUZ Q;  1E1O A;  3BU2 A;  1C7Y A;  4JBK A;  3E9H A;  4LF7 Q;  2UXC L;  4O2D A;  3GTG H;  5JEA G;  4GOP C;  4L5R C;  4JI5 Q;  4MTN A;  1YJ9 A;  3S17 H;  2ZM6 Q;  2NZO A;  4DR7 Q;  3J80 c;  3RLF A;  1Q12 A;  4AYB E;  5FJ8 H;  1L1O A;  1PHJ A;  1N34 Q;  1EQR A;  4LFB L;  4YY3 L;  2Q2H A;  4JI0 Q;  2YTY A;  1GO3 E;  2JK8 A;  1HNZ L;  2N78 A;  2WFW A;  2LSS A;  1VQH A;  4DV4 L;  4C2M H;  3KOJ A;  1HJP A;  1QVC A;  4A3K G;  3J81 c;  3F2C A;  3I56 A;  4A75 A;  4FDB A;  1CKN A;  1HH2 P;  2Q2I A;  4DV6 L;  3FKI G;  4DR2 Q;  1Y1V H;  1PH5 A;  1G51 A;  1IBL Q;  5LMU Q;  5IP9 G;  4OWW B;  4JBW A;  4JOI A;  2UXD Q;  3F8T A;  2JJQ A;  1A8V A;  3OW2 A;  5C4J H;  4B3R Q;  2HT1 A;  4P74 A;  5ELO A;  4TQU S;  4A3G G;  4RMF A;  1HZB A;  1PH9 A;  5DLQ E;  5J3B A;  2B3G A;  3A5Z B;  4PG3 A;  1HR0 Q;  1U0L A;  2XGT A;  3M9B A;  3H3V I;  1SRU A;  4NXN Q;  2ID0 A;  4DV5 Q;  4GNX B;  1YZ6 A;  2AWN A;  3PUV A;  4DV1 L;  2OTL A;  5M5W H;  2YTX A;  4DK3 C;  3DM3 A;  4ALP A;  1PH2 A;  1YNX A;  3AYH B;  1PH8 A;  3BZK A;  4R4I A;  1XMO Q;  5IT9 c;  3M3Y H;  1I94 L;  2R7Z G;  4DR4 Q;  1YJN A;  1EOV A;  1L1O B;  5IWA L;  1Q81 C;  4LF5 Q;  4GN5 A;  3HOY H;  4LF4 Q;  2UUC Q;  1M90 C;  3CCJ A;  1X54 A;  1JMC A;  2WB1 G;  3RZD H;  1NE3 A;  2MFI A;  1SN8 A;  1D8L A;  4JI7 Q;  4OX9 L;  2LXJ A;  3D0F A;  5EAY A;  4A3B G;  1K83 H;  1BVS A;  1WFQ A;  4GOP A;  4GLX A;  4LFC Q;  4JI4 Q;  3HOZ H;  4A76 A;  3ULP A;  1NJI C;  4LFA L;  4DR3 Q;  2BA0 A;  3RN2 A;  1N36 Q;  4LF8 L;  1Q82 C;  1N9W A;  1WJJ A;  4YCV A;  4JI2 Q;  3K7U C;  4JYA Q;  4WJ3 M;  1D7Q A;  4A4I A;  1BBU A;  1LM0 A;  3I7F A;  1MJE A;  3M4O H;  4DV0 Q;  2I0Q A;  2JA6 G;  1TWC H;  1EQQ A;  1I50 H;  4A93 H;  3UDG A;  1AE3 A;  3H0G H;  3JC6 6;  2JA5 G;  3ZJY C;  1K8G A;  1HZC A;  3PIP A;  2K5H A;  3U50 C;  3H15 A;  3ICE A;  2ES2 A;  4GLV B;  2ZTE A;  1PA6 A;  2OCE A;  3HOX H;  1CSQ A;  4P73 A;  3TRZ A;  2K52 A;  2H5X A;  4A3C G;  2VUM G;  1GVP A;  4JI3 L;  3U58 A;  2JA7 G;  1VQF A;  3HOU G;  1PH4 A;  1M1K C;  4KHP Q;  5C3E H;  3TS0 A;  4OXP A;  1YHQ A;  5IYB H;  2MNA A;  1Q7Y C;  3JAM c;  2MQH A;  4EX5 A;  1AH9 A;  1Q1B A;  1HNX Q;  4HJ7 A;  5C0X I;  3RNU A;  3KYH C;  2EIF A;  4A3I H;  4DAM A;  2Y0S E;  1I5F A;  3I2Z A;  3PUZ A;  4R4T A;  3G4S A;  3M85 A;  4YCU A;  5GAH C;  1FJG L;  2F52 A;  5M3M G;  2NVY H;  2UU9 Q;  4BY7 G;  1E7Z A;  1XNQ Q;  2KEN A;  4GLA C;  3J7Z C;  5IYC H;  4A3E H;  1KAW A;  1PVO A;  1N32 L;  2NVX H;  1S72 A;  1FVI A;  3CCL A;  4AQY Q;  1W3S A;  3KJP A;  3CAM A;  4JI8 Q;  4X65 L;  3HKZ G;  4A3J G;  5C4X G;  4DR1 L;  4Y52 H;  1X3F A;  2HHH Q;  4DR6 L;  1QZH A;  1XTD A;  3E9I A;  1PYS B;  5C0X J;  4KLK A;  1YIJ A;  2D62 A;  1YJW A;  2E2H H;  4IFD I;  4A3M H;  1NMF A;  1SLJ A;  2PI2 E;  3LGJ A;  4NPS A;  1Q46 A;  3UDX A;  4YHH L;  3CC7 A;  1OXT A;  1YHA A;  2C35 B;  4X66 Q;  4B3S L;  4JI6 L;  4EQ5 A;  4B3T Q;  2JA8 H;  3KF6 B;  1VQK A;  2RF4 A;  5ELN A;  2A19 A;  1X6O A;  2UXC Q;  3PV0 A;  4DV7 Q;  4NXM Q;  1A63 A;  1JB7 A;  4PZ8 A;  3OYY A;  3J81 j;  3S1M H;  2UUB Q;  2F4V Q;  3GO5 A;  2E2I H;  1TWA H;  3GTO H;  2HQL A;  2ZTC A;  3NEM A;  3W1B A;  1OXX K;  3K7A H;  4P72 A;  1PFS A;  3NEN A;  4XIG S;  5GAD C;  1YI2 A;  4LNQ A;  4DV4 Q;  1OTC A;  2N8N A;  1I3Q H;  4IPH A;  4GNX A;  1B8A A;  2XTI A;  3GTQ H;  1C9O A;  3L2P A;  3BJU A;  1KRT A;  2AHO B;  2K14 A;  5JJL A;  4C3H H;  2GVA A;  2V1C C;  3ERS X;  3AQQ A;  3PO2 G;  1VQD A;  4MNO A;  4PZ7 A;  5IY0 A;  3CPW A;  3J80 i;  2KBN A;  1VQM A;  2R93 H;  5M3F G;  4GKJ Q;  1VQB A;  5IE8 A;  1K0R A;  5HGQ A;  4DV2 Q;  5C0X G;  1UEB A;  2AMC B;  1MJC A;  4A3F G;  1VQO A;  4LF9 L;  2NVQ H;  2VNU D;  1TWF H;  3J81 i;  4LUO A;  1K73 C;  1MIU A;  1RL2 A;  4P71 A;  5BR8 Q;  1V43 A;  2KHI A;  3S24 A;  1VQ7 A;  4POF A;  4BA2 I;  3OTO L;  1YBY A;  3CCQ A;  2OQ0 A;  2VQF L;  2MO1 A;  1Z9F A;  5E7N A;  4P75 A;  5FJ8 G;  5LMN L;  4UP8 A;  3CQZ H;  1PH1 A;  2IT1 A;  2R6G A;  3ULL A;  3A5U A;  1VQL A;  2ZTD A;  2VQE Q;  4X62 L;  4OX9 Q; 
#chains in the Genus database with same CATH topology
 2A6H C;  4AYB G;  3MFG A;  1E24 A;  1ENF A;  4JV5 Q;  4N8F A;  1WTO A;  2I5M X;  1Q1E A;  3CCM A;  2V4D A;  2FFK B;  2R92 B;  4A3D G;  5M5X B;  1ZYR C;  3FDT A;  4XXE A;  1CK1 A;  1H95 A;  1BDO A;  1B3A A;  1GOZ A;  4QJF A;  2EZV A;  4JI0 L;  4KV6 A;  2DUD A;  1DXM A;  3CW2 C;  3S1N H;  2VS1 A;  2E5L L;  2J0T D;  4DKA C;  3L0O A;  3M4Y A;  1SDF A;  1GKH A;  4OO1 H;  1ET9 A;  2PQA A;  2Z4I A;  2YYZ A;  5DNF A;  5C44 H;  3C46 A;  2F0O A;  3E5S A;  1H9J A;  1T9H A;  3RN5 A;  2F0V A;  1EY5 A;  3URY A;  1SNP A;  3DHQ A;  2BE5 D;  3IL8 A;  3RMH A;  1GUG A;  2F4I A;  3GTM H;  1B50 A;  4DV5 L;  2NBF A;  3HOZ G;  1RCV D;  3A56 A;  1V1P A;  1TII D;  2RVL A;  1K3R A;  1K8M A;  2OF1 A;  2IX1 A;  2VUM H;  3KF6 A;  1QB5 D;  2I5H A;  4ZAI A;  4CHT B;  4IUV A;  4BXX H;  1MSH A;  2PI2 A;  2RCN A;  3MXN A;  3R93 A;  4BBS H;  4OGQ C;  1VF5 C;  3BVZ A;  3HFZ B;  5CBE E;  1IKL A;  3JAM i;  2MUY A;  3EBE A;  4A93 G;  1EQV A;  4HJA A;  4JI1 Q;  2WAC A;  3HOX G;  5EKK A;  1F2M A;  2IHE A;  1A2T A;  2KUM A;  4JG2 A;  2B2V A;  1FNW A;  4IO9 A;  3CD6 A;  4DV0 L;  3TEH B;  3ER0 A;  3OMG A;  1PTO C;  4DN4 M;  4IN3 A;  3D4R A;  1VMC A;  2Q2T A;  1CI3 M;  3J81 L;  2ZJP A;  3PF5 A;  1QVG A;  2EYH A;  4LUV A;  3SK6 A;  2Z6K A;  3Q22 A;  4FF3 A;  3N52 A;  2QEX A;  1STN A;  3TP8 A;  1SJH D;  4CJ0 B;  4A3E G;  2Y0S G;  1UE6 A;  4RHS A;  5IP7 H;  1TS3 A;  3WWV A;  4KHP L;  2H1E A;  3S1Q H;  1S5B D;  4YY3 Q;  1J6Q A;  1HNX L;  2WP8 J;  2OWO A;  5IT9 L;  3I73 A;  2IPK D;  3I4N G;  2XIW A;  1L2F A;  2N3S A;  3MTS A;  4F87 A;  3J7A F;  5FOB B;  1VQG A;  5EKL A;  4APV A;  1FNV A;  1NY4 A;  4RCO A;  3DM1 A;  3U9O A;  2FHT A;  4RAU C;  4R4O A;  3S1R B;  1OXS C;  4X66 L;  1IYU A;  4DV1 Q;  1PYW D;  3DMU A;  1F2Y A;  5I9O A;  2CVR A;  3B6Y A;  4DV7 L;  4FO2 A;  5IWA Q;  5E3F A;  1A62 A;  2RQX A;  1TY2 A;  4QL5 A;  5FLX c;  4TRD A;  4X3S A;  1GHK A;  1B7Y B;  5CMD A;  4JC0 A;  1STE A;  4JBM A;  4K2K A;  3Q23 A;  3HGB A;  4IOA A;  2CQA A;  4LFA Q;  1J8I A;  1H9K A;  5AFW A;  1O78 A;  1YHB A;  4J1M A;  3J7Y W;  5KYL A;  2NZ1 D;  1HHV A;  1X55 A;  4IQZ A;  3EVQ A;  2F0P A;  1VQI A;  4IPC A;  1IW7 C;  2I5L X;  3NBH A;  1SJE D;  1Z7T A;  4H0L C;  2Q8T A;  2F03 A;  1RIP A;  2EJM A;  3GTK H;  3PGZ A;  3Q6S A;  1CSP A;  1S40 A;  1L0W A;  4A3B H;  4F8M A;  5IYD G;  2E8G A;  2J7Z A;  4CKE A;  2KED A;  4JI3 Q;  2R92 G;  1VF7 A;  2OEO A;  3UDI A;  4GZY C;  2CWA A;  3VYS A;  1GXD C;  5J39 A;  2JA6 B;  5C4Z A;  2XSC A;  3ND8 A;  3M4P A;  2N49 A;  3DLL A;  1EY4 A;  2B8G A;  4JV5 L;  4C1N K;  3GD7 A;  5FLX E;  3BYY B;  2MP1 A;  1CA6 A;  3VR3 A;  2MGS A;  4DAY B;  4WJ4 A;  1CKN B;  1JOK A;  4DXF A;  5DM7 3;  2VUM B;  1UE5 A;  1HA5 A;  3MXG A;  3E0E A;  2UUC L;  4X65 Q;  3EA6 A;  1R4P B;  2WAQ E;  4DR1 Q;  4H7B A;  2Q8I B;  2QEJ C;  4QGU A;  2QW7 A;  2YU9 B;  4A3L G;  4YHH Q;  2NYZ D;  3S2D B;  1RD9 D;  4DR3 L;  4JI6 Q;  3CCS A;  1AZP A;  2CCZ A;  2HD3 A;  4B9X A;  4BY7 B;  1H9S B;  4MIU A;  3ERQ A;  3SXH A;  4DA2 A;  3QIA A;  4PMW A;  4GNX C;  4ZYS A;  1R9T H;  3GTL B;  2KCN A;  4A3J B;  1JE5 A;  1X3P A;  1QZG A;  1JOR A;  3NHH A;  1V9P A;  4KMU C;  4OWT B;  4RHR A;  2DJF C;  3MFY A;  2A6E D;  1XNR Q;  2F0U A;  4PZ6 A;  1EYA A;  3G6E A;  2A8V A;  2KCM A;  1Y1W G;  4LMQ D;  3W1G A;  2D5D A;  3CCR A;  1FGU A;  1VQJ A;  4V0B A;  1QJO A;  4JI1 L;  1P8L A;  3F1Z A;  1Q86 C;  4C3J H;  1A2U A;  3AFQ A;  4HJ8 A;  1DD2 A;  1EY9 A;  2N55 A;  3UI2 A;  2G9H D;  4EQN A;  3FP9 A;  4IPD A;  1IZ6 A;  3PO2 B;  4XT3 B;  1YVC A;  4B9W A;  5FLM G;  1TR5 A;  1IXR A;  2L12 A;  4DUZ Q;  1E1O A;  2J4X A;  4LF7 Q;  4J8Q A;  2NZO A;  3R2T A;  4G7Z C;  4AYB E;  3I90 A;  5FJ8 H;  1SE2 A;  1EQR A;  4YY3 L;  2YTY A;  2JK8 A;  3A8I E;  1DOK A;  3R3O A;  4WRD A;  1S5E D;  3X3N A;  2Q8R E;  4L63 B;  5CV6 A;  3J81 c;  3K59 A;  1U4P A;  3OSO A;  5C6A A;  1BR9 A;  3VYR A;  3R8B A;  4OWW B;  2HDL A;  3F8T A;  3T16 A;  5FO9 B;  3OW2 A;  4TQU S;  1KNA A;  1HZB A;  4IUP A;  1RJT A;  3MAQ A;  3OMC A;  1HR0 Q;  1U0L A;  2XGT A;  3HZX A;  1SRU A;  3SR1 A;  2KA7 A;  3K5O A;  4DV1 L;  2OTL A;  2YTX A;  1FNU A;  1PZI D;  4ODG A;  1PH2 A;  3FPP A;  3M3Y H;  5IT9 c;  4CDE C;  4UHV A;  4KHV A;  5IWA L;  1Q81 C;  5J22 A;  4XYQ A;  3RZD H;  4DFA A;  1SN8 A;  4JI7 Q;  4KTA A;  2PYK A;  2B2V C;  1RTN A;  2DY7 A;  3W3A A;  4ZKB B;  4GLX A;  1K83 B;  3I8Z A;  1SXT A;  3HOZ H;  1JB3 A;  1NJI C;  4LFA L;  1ICW A;  1Q82 C;  4K6D A;  1LLR D;  4JYA Q;  5IOD A;  1D7Q A;  1Q8I A;  3J81 E;  3I7F A;  4ME5 A;  1E2V A;  1KLG D;  2JA6 G;  1TWC H;  4ZKC B;  4A93 H;  1I50 B;  1HZC A;  3OIQ A;  3U50 C;  3HOX H;  4P73 A;  5F2D A;  4EVO A;  2K52 A;  4A3C G;  1BXT A;  4JI3 L;  2VUM G;  3HOU G;  1STH A;  2B2T C;  2MQH A;  5IT9 E;  5C0X I;  1HRJ A;  1DYQ A;  2WKD A;  2KQ3 A;  2QCP X;  2Y0S E;  4R4T A;  4A3I B;  1EFI D;  4YCU A;  1ESR A;  1XWE A;  3SE0 A;  3D4D A;  1SAP A;  2F52 A;  4BY7 G;  4HMJ A;  4A3E H;  1ILP A;  2AQ2 B;  1KAW A;  3KUP A;  1S72 A;  1FVI A;  1W3S A;  4X65 L;  4A3J G;  3QJY A;  4DR1 L;  5G3L F;  4KJN A;  1QZH A;  4WJW A;  4K5V A;  2D62 A;  4NPS A;  3I4N H;  1U9R A;  1Q46 A;  2MJ8 A;  4YHH L;  1YNN D;  4JI6 L;  4B3T Q;  1VQK A;  1EWH A;  2A19 A;  2UXC Q;  3PV0 A;  4NXM Q;  2BE5 C;  1EY7 A;  3LX0 A;  1O7L A;  3S1M H;  3GO5 A;  3C3L A;  2E2I B;  3T51 B;  1OXX K;  2QF7 A;  1FR3 A;  4N9P A;  5GAD C;  2JXM B;  2RCF A;  2N8N A;  1I3Q H;  3L2P A;  1EEI D;  1PRT B;  2AHO B;  4PQX A;  2GVA A;  4C3H B;  3QG1 A;  2ENB A;  3PO2 G;  2N88 A;  5IY0 A;  3CPW A;  3TDQ A;  2KBN A;  2PPB C;  4GKJ Q;  3I72 A;  5C0X G;  2NVQ H;  1BCP F;  1TWF H;  1XXG A;  3J81 i;  1K73 C;  1MIU A;  5BR8 Q;  3NTI A;  2KHI A;  3S24 A;  1VQ7 A;  4POF A;  2FIN B;  1YBY A;  1WD1 A;  4HAE A;  4P75 A;  5LMN L;  4R8I A;  2R6G A;  1VQL A;  4KN4 C;  2ZTD A;  1C48 A;  2CH4 A;  3P75 A;  3HOW B;  5IIF A;  4DUZ L;  4B3M Q;  1IBM L;  5IYD H;  3T1H Q;  4HIK A;  2VY3 A;  2B63 B;  2R92 H;  5M5X H;  1LT5 D;  3GTP B;  1VQ8 A;  2ZXP A;  1KHI A;  5LL6 X;  2NVT B;  2FMC A;  3SK4 A;  4BBR B;  4ZRZ A;  1PRT C;  1EY0 A;  3S9W A;  1NTG A;  1K3B C;  1NUC A;  5I6Y A;  3NEL A;  4RG1 A;  1WCM B;  3I91 A;  4R4C A;  2ATW A;  5LMN W;  4AIM A;  5K5P A;  2LXK A;  3HOY G;  4NP5 A;  1HQM C;  5GRO A;  1ENA A;  4A3L H;  1E3P A;  3HOX B;  3KFU A;  1WTX A;  1NMG A;  1AE2 A;  2A1A A;  1D1I A;  4OL7 A;  1N33 Q;  3F2B A;  4OIK A;  1EOT A;  4JI7 L;  2VB3 X;  1SNM A;  3CP0 A;  1X65 A;  4B3S Q;  2F1M A;  2L4N A;  3GQB A;  1D2B A;  3J80 L;  1M8A A;  2LS0 1;  4UY8 C;  2GN5 A;  2K33 A;  2RHS B;  4IOC A;  4JYA L;  1EIH A;  1HNW Q;  4IUR A;  2K5D A;  3L7Z C;  1Y1W H;  1J5E Q;  5IYB G;  3GV3 A;  3MWY W;  1D5Z C;  1SRO A;  3CCV A;  4A3I G;  1X56 A;  5DM6 3;  1T5X D;  4LF6 L;  1JJG A;  4TKO B;  5JEA J;  1JE4 A;  4I7Z C;  2A68 D;  1X9N A;  1BBW A;  4C3I B;  2K5Q A;  5EKI A;  4HSV A;  4L6T B;  1K0S A;  1OXV A;  3K80 C;  2O5I C;  1DGS A;  3NPP A;  5C3X A;  2JP1 A;  3TSS A;  1D5M C;  1VS0 A;  5FLM H;  2UXB L;  4A3M G;  1NR2 A;  3P7J A;  1K9M C;  1EY8 A;  3G6J B;  4FVM A;  2DGY A;  1QUQ B;  4X3K A;  3QOJ A;  4KI0 A;  3VR5 A;  1MHW C;  2GVB A;  3A7A B;  3KLW A;  2P5Z X;  3S1R H;  2EPB A;  4DK6 C;  5ISR A;  3EQL C;  2BA1 A;  1F77 A;  1UWV A;  1X3E A;  4O42 A;  4GKK L;  1HXY D;  1HTP A;  4KD4 A;  4B3T L;  1TWF B;  4UP9 A;  1EZ6 A;  5LHY 1;  4DR5 Q;  1I6H B;  4C3H G;  1I94 Q;  4NXM L;  2KCT A;  1HTL D;  4DV3 L;  4L5Q A;  3CF5 A;  5HY6 A;  3PSI A;  1Z47 A;  3FHW A;  2LY7 A;  2F0W A;  1GUW A;  1G6P A;  2ALY B;  2L9H A;  5C4H A;  1XJV A;  4DNT B;  4DAY A;  2R7F A;  4FXG C;  1IHZ A;  3STB D;  2R7Z B;  3T13 A;  3RR5 A;  2HIV A;  3BVG A;  2WB1 B;  3SVM A;  1LV9 A;  1PV4 A;  1YIT A;  3HOW G;  4GKJ L;  2JSO A;  1SBB B;  1MSG A;  1XPR A;  3TZU A;  1PTO B;  3RD4 A;  5K36 G;  5G3L D;  4JBJ A;  1ICF B;  5BR8 L;  3O13 A;  2B63 G;  5LMU L;  2K75 A;  3NXW A;  4XT1 B;  3WOE A;  1CUK A;  1WVL A;  4Z9C B;  4B3R L;  2JA6 H;  4BBR G;  3PIO 3;  1O7Y A;  1BBX C;  3UE1 A;  2JA5 B;  1WCM G;  4B3M L;  1I6V C;  1EFW A;  3T1H L;  1AP0 A;  1GUO A;  1XMO L;  4N8X 1;  4A3C H;  3HOU H;  3H94 A;  2SNM A;  2EYP A;  4DPG A;  2IX0 A;  1U5K A;  1TWG B;  2BCO A;  2GA4 B;  2KEE A;  1AZQ A;  1SE3 A;  2YU9 H;  1ONL A;  3AU7 A;  1NCV A;  1A3U A;  1TS4 A;  4QUC A;  4OWX B;  4OEL B;  1XYI A;  3S2D H;  3T56 B;  4BY7 H;  2EYL A;  2FMM A;  5M3M B;  3U4V A;  1PXU A;  2BOS A;  4CGY B;  3BDO A;  3V96 A;  4ID6 A;  4M8A A;  3GTL H;  4A3J H;  1Y1W B;  1BCP D;  3S15 B;  3HKZ B;  5C4X B;  2A69 C;  3TP5 A;  5I6W A;  2CFM A;  5AJ3 Q;  3A8K E;  1VQ9 A;  1L1O C;  4FNF A;  2OQK A;  4EQO A;  4Y7N B;  2CW0 D;  4YIJ A;  5KGU A;  4K5X A;  1K8A C;  1N33 L;  3AFP A;  1FGB D;  4TSS A;  1CKM A;  4KHZ A;  2BH2 A;  3DEO A;  4KKT A;  3QR8 A;  4QIW B;  4GN3 B;  1W2B A;  2RDG A;  3PCO B;  4LF9 Q;  1I4R A;  3OTO Q;  1HNW L;  1X3G A;  1W6J A;  4C3I G;  1RHP A;  1IL2 A;  3PO2 H;  1XPU A;  4RFB A;  1J5E L;  1K28 A;  3BZC A;  1I4Q A;  2HHH L;  3PIO A;  3VYT A;  3H3V C;  1EWI A;  2L15 A;  5CR3 A;  2K28 A;  4X62 Q;  5M3F B;  1SR3 A;  1PYB A;  5C0X H;  5BN5 A;  1B9M A;  1WTH A;  4A3F B;  4JBK A;  5ELF A;  2E76 C;  1MD2 D;  3U9S A;  2DNE A;  5JEA G;  4L5R C;  2RA4 A;  4X3T A;  2F0N A;  3GTG B;  2ZM6 Q;  2LFN A;  1KDB A;  3J80 c;  5CV7 A;  3KBX A;  4MTK A;  2EJF C;  4CDD C;  2B2U A;  3Q0A A;  1VQH A;  4RKB A;  3KOJ A;  2NB0 A;  1QVC A;  4C2M B;  3F2C A;  1SYF A;  1TS5 A;  1EEF D;  5IGB A;  2Q2I A;  3BZD B;  3FKI G;  2A73 B;  5JOB A;  1CFM A;  2LMC B;  5IP9 G;  1Y1V B;  4JOI A;  4CDC C;  2UXD Q;  5C4J H;  1I4X A;  1YNN C;  2B3G A;  4PG3 A;  2HDM A;  2Z4H A;  1C8C A;  1YNJ D;  3H3V I;  4GNX B;  2AWN A;  1EU3 A;  3DM3 A;  4ALP A;  5M5W B;  3A7L A;  1PH8 A;  3BDC A;  3NP8 A;  1I94 L;  2R7Z G;  2C5C A;  4DR4 Q;  1EOV A;  3E6Z X;  3FEW X;  3DUZ A;  4LF5 Q;  3GP7 A;  1KNE A;  3HOY H;  2X6L A;  4LF4 Q;  1PZJ D;  1X54 A;  1MI2 A;  2WB1 G;  1QIL A;  2MFI A;  1D8L A;  3IAY A;  4L8J A;  4OX9 L;  1B9N A;  3D0F A;  3J80 E;  1K83 H;  4GOP A;  1IKM A;  4LFC Q;  4O1N A;  1QNK A;  4NW2 A;  4ZK9 B;  4YCV A;  3HOU B;  1CHP D;  1J9O A;  1V8Q A;  3M4O B;  1GUN A;  1I50 H;  4FP5 D;  3UDG A;  1HA6 A;  2JA5 G;  3JC6 6;  2KVM A;  1SE4 A;  1K8G A;  4V19 0;  1QG7 A;  3A54 A;  3NUC A;  3D4W A;  2ES2 A;  3AMU A;  4GLV B;  1A6X A;  1CSQ A;  2OXP A;  3K57 A;  1SNO A;  4KN7 C;  4PNY A;  5KRU A;  3NQT A;  2DY8 A;  5C3E B;  5IYB H;  3DWQ A;  4EX5 A;  1SMY C;  5D3D A;  4IZ8 A;  4HJ7 A;  3SK5 A;  4A3I H;  3CRK C;  3PUZ A;  1I5F A;  3G7L A;  3G4S A;  2E2D C;  5EGT A;  4B08 A;  5M3M G;  2UU9 Q;  1E7Z A;  1XNQ Q;  3OIP A;  4UDU C;  2KJX A;  2HCI A;  1DCZ A;  3VA5 A;  1PVO A;  1STA A;  3CCL A;  5IGE A;  3HKZ G;  5C4X G;  4Y52 H;  1X3F A;  2K7V A;  4LJZ C;  5C0X J;  4LAA A;  1WD0 A;  1CTM A;  4A3M H;  1SNQ A;  2E2H B;  3BS1 A;  1OXT A;  1YHA A;  2C35 B;  1V1P B;  3K5M A;  3KF6 B;  2A6H D;  2RF4 A;  5ELN A;  1A63 A;  2NUC A;  4PZ8 A;  2F4V Q;  2E2I H;  2HQL A;  3NEM A;  4IUU A;  1STY A;  3K7A B;  1ZYR D;  4DV4 Q;  3HG9 A;  1OTC A;  4G4K A;  3SEB A;  5I9P A;  1B8A A;  2XTI A;  1WTR A;  1F9R A;  1S5D D;  3BJU A;  2K14 A;  4C3H H;  1SSO A;  2O2L D;  4HED A;  2V1C C;  1VQD A;  2D9U A;  3NWT A;  3J80 i;  1E2W A;  1VQM A;  1BNZ A;  5M3F G;  2HCC A;  2SNS A;  1VQB A;  5IE8 A;  1K0R A;  4A3F G;  1VQO A;  2AMC B;  2XRS D;  4LF9 L;  4P71 A;  3FRP B;  1V43 A;  1EYD A;  3OTO L;  1H9M A;  3CCQ A;  2OQ0 A;  2WKC A;  2MO1 A;  3QWN A;  5C4J B;  3CQZ H;  2RBM A;  2IT1 A;  1PH1 A;  1NAP A;  3A5U A;  4RGT A;  5ELC A;  2VQE Q;  4X62 L;  3HOW H;  4X6A H;  3CC2 A;  5FO7 B;  1LTR D;  3M4Q A;  5K36 H;  2A68 C;  1SYD A;  4HTH A;  3KF8 B;  4HR7 B;  1KQS A;  2B63 H;  3GTP H;  2EYF A;  1VQ5 A;  1Y1V G;  1KAA A;  2NN6 I;  4QMG A;  2ZM6 L;  3KJO A;  2NVT H;  1LTA D;  2EXD A;  4BBR H;  3HOY B;  5D14 A;  1EY6 A;  2JEA I;  1X3Q A;  3LWE A;  1B2T A;  4O0A A;  5FK9 C;  3X3M A;  1WCM H;  4UPA A;  4EGV A;  1EWC A;  2PZT A;  2CHB D;  2CQO A;  2UUA Q;  5ELD A;  3BYT B;  1H9R A;  1O7I A;  2F0L A;  4PV1 C;  4NB3 A;  4POG A;  2WII B;  1SNC A;  2K05 A;  2X69 A;  2Z6K C;  2UXD L;  1B70 B;  2BH8 A;  3CCU A;  1S3O A;  4FYD A;  3TRE A;  2XNA C;  1D6E C;  3U4Z A;  2AWO A;  3KDF B;  4JVZ A;  4DK1 A;  1HQR D;  1N8R C;  1AFP A;  1D1K A;  1XX8 A;  4MZ9 A;  3MHB A;  2TMP A;  4R1J A;  1WI5 A;  4DR4 L;  1E0B A;  3UE0 A;  4LF5 L;  1PH7 A;  4CKC A;  3K5L A;  1AEX A;  1W6K A;  1DJR D;  1E1T A;  2XN9 C;  3NBH B;  1ASZ A;  3FMC A;  4DR6 Q;  2G5D A;  1PZK D;  1WTV A;  3TS2 A;  3WDN A;  4LFC L;  3ZYY X;  1UUP A;  1XMQ Q;  1KDA A;  2D2C C;  2ZJQ A;  4Q0F A;  5BN3 A;  3I70 A;  5IOC A;  2NZH A;  1IBK Q;  3HS0 C;  3VR2 A;  4YWL A;  5C3E G;  2XVS A;  3HOV B;  1AW7 A;  4U68 A;  1VQP A;  4DUY Q;  1OXU A;  2NN6 G;  3TME A;  1II3 A;  1EUJ A;  1LAB A;  4A3M B;  1STB A;  3S2H B;  1UE7 A;  3F2D A;  5IYC G;  2G9D A;  4NKL A;  2F0D A;  1RF2 D;  4R8N A;  2KOL A;  4C3I H;  4UP7 A;  2F0T A;  1PFN A;  2IY5 B;  4HIM A;  1ZXT A;  5JJK A;  2L55 A;  3T53 B;  4JOI C;  4H02 A;  1IW7 D;  4K8J A;  3SGI A;  1XNQ L;  1JJC B;  3I4M B;  2NWG A;  1G8Z D;  3CC4 A;  1XNR L;  1E22 A;  4DV6 Q;  5JEA H;  1WTP A;  4CDF C;  1EIF A;  5T1G A;  4HCE A;  4G57 A;  3RLO A;  2YTV A;  2AUJ D;  3TBI B;  2CWP A;  3RZO H;  1FL0 A;  5H1S E;  4EQP A;  2VW9 A;  3VA7 A;  4A3K B;  1VQA A;  2K5V A;  4RKL A;  1I6H H;  2RHQ B;  2VZA A;  3FKI H;  1KTK A;  2EYO A;  4ME3 A;  5IP9 H;  3SK8 A;  5L37 A;  3H91 A;  2F4V L;  3S16 B;  2E2J B;  1VDZ A;  4OEM B;  1K8O A;  4A3G B;  3CQZ B;  2TSS A;  4KY7 A;  2JA9 A;  2E5L Q;  4HJ9 A;  3DWA A;  4LF7 L;  5D3I B;  1QNU A;  2K01 A;  5I2X A;  1I4P A;  4JPB W;  3E3X A;  4HCS A;  2C9O A;  4CBV A;  2WB1 E;  2R7Z H;  4LUZ A;  4QUF A;  1ASY A;  3EN2 A;  3KLS X;  1TXY A;  2R7D A;  3TZD A;  1LT6 D;  3M7N A;  1SEB D;  1KL9 A;  1LT4 D;  1IL8 A;  1PTO H;  3LWU A;  2FJ2 A;  5M5Y B;  3J7A 5;  1NBW A;  2Z0S A;  2Z6B A;  3RLN A;  5LL6 S;  4RGM A;  1GD7 A;  1SFO H;  4XQQ A;  1A15 A;  1VQN A;  3Q8D A;  3MEF A;  1SE8 A;  2K4K A;  5CBA E;  2L0C A;  3S14 B;  1Z6H A;  1PRT F;  2JA5 H;  1HR0 L;  2PW5 A;  2VQE L;  1KC8 C;  4ZUJ A;  2F3V A;  1FJG Q;  3VDY A;  1U4R A;  4MN3 A;  3UDF A;  1FD7 D;  4DNR B;  3CXC A;  2VB2 X;  3PMF A;  1PFM A;  2JA7 B;  1ESF A;  1TWG H;  3RUZ A;  1HUM A;  4XDX A;  2RDF A;  2VXW A;  3DEP A;  2AKW B;  1RDP D;  4LWC A;  5M3M H;  1EQT A;  2MHV A;  3H3V H;  2UUA L;  3HKZ E;  2KEC A;  1AN8 A;  4KKS A;  1HR0 W;  4J15 A;  3S15 H;  1B53 A;  4YWM A;  5C4X H;  1NSN S;  1WTW A;  1ROD A;  3Q24 A;  1QCB D;  3EIV A;  1V1Q A;  3NSW A;  1Y69 U;  3GTJ B;  2EVB A;  2RSO A;  4Y7N H;  1IYJ B;  2WAQ G;  4E6I A;  1U4L A;  1CKO A;  3PUX A;  5M9O A;  4C56 C;  4QIW E;  4AH6 A;  1TT2 A;  2XRQ D;  1WOC A;  5CC4 A;  3AEV A;  4OON A;  3HOV G;  3C1E A;  4KKU A;  1F2Z A;  5E4W C;  4QQB X;  1Q8K A;  1O80 A;  1VMP A;  2B2W A;  3OHX C;  1KDC A;  1XMQ L;  4DGZ A;  2JYO A;  1LT3 D;  4JCV E;  2PMZ B;  1IBK L;  4QCL A;  5GAG C;  1F2L A;  3PQI A;  2VQF Q;  1UE1 A;  4RWS C;  2VL6 A;  1CHQ D;  3K6O A;  4FXK C;  3ULJ A;  4DUY L;  2JEB I;  3OWE B;  1TWH H;  1VQE A;  2R61 A;  3K0X A;  5EBC A;  5M3F H;  2E75 C;  3RZO B;  2HIX A;  3PIP 3;  3CCE A;  1Y14 B;  5IGD A;  4A3F H;  1ZKO A;  4IFD J;  2M00 A;  3I4M G;  3ERO A;  3BU2 A;  1C7Y A;  5EQ0 A;  2ICI A;  2UXC L;  4O2D A;  1LTB D;  3FKI B;  3GTG H;  3NE5 B;  4JI5 Q;  2L5T A;  4MTN A;  5ELB A;  3KLR A;  4QF4 A;  3S17 H;  4DR7 Q;  1PHJ A;  3RLF A;  1N34 Q;  1R4Q B;  1KLU D;  4H44 C;  3W2D A;  2Q2H A;  3ONA B;  5A35 A;  1GO3 E;  2A6E C;  1EL0 A;  3NTK A;  2F0M A;  4C2M H;  1HJP A;  2EJG C;  4A3K G;  3I56 A;  4FDB A;  1CKN A;  3OWF A;  1HH2 P;  4DV6 L;  3SDZ A;  1IBL Q;  4DR2 Q;  1Y1V H;  5FO8 B;  4S3S A;  2ZT9 C;  1A8V A;  2HUG A;  5EPJ A;  4A3G G;  1PLF A;  1V1O A;  5DLQ E;  1TKW B;  2PZW A;  4NXN Q;  1YZ6 A;  1HFG A;  5M5W H;  2QIL A;  2M9V A;  3BZK A;  1SFO B;  1H9S A;  1JQY D;  3DWP A;  1GHJ A;  1L1O B;  4I7A A;  2UUC Q;  3CCJ A;  4ABN A;  5CV5 A;  1JMC A;  1NE3 A;  2LXJ A;  5FKA C;  2QKI C;  5T1I A;  4JI4 Q;  1A3V A;  1PDQ A;  4A76 A;  3ULP A;  4DR3 Q;  2BA0 A;  3RN2 A;  1N36 Q;  3P1H A;  1WJJ A;  4JI2 Q;  3K7U C;  4WJ3 M;  4A4I A;  1S5F D;  1BBU A;  1LAC A;  1MJE A;  2AUK A;  3M4O H;  2B2Y A;  2SEB D;  5E1F A;  2SDF A;  4ZQ3 A;  1JWS D;  3PIP A;  3H0G B;  2K5H A;  3ICE A;  5BN4 A;  2ZTE A;  1PA6 A;  2OCE A;  2B8F A;  1JWM D;  2BDO A;  2EY6 A;  2EY2 A;  2H5X A;  1DOM A;  1GVP A;  3NK9 A;  2JA7 G;  1VQF A;  2Z8L A;  5DEH A;  1M1K C;  2F0F A;  5C3E H;  3TS0 A;  4OXP A;  2IW3 A;  4X3U A;  1YHQ A;  2MNA A;  4J6H A;  1Q1B A;  2NN6 H;  1WTQ A;  2EIF A;  4C1N I;  3I2Z A;  5I4D A;  2F0I A;  4F88 A;  3M85 A;  1FJG L;  2F0G A;  2K32 A;  2NVY B;  3J7Z C;  5IYC H;  1G91 A;  5HGT A;  1BUV T;  2NVX B;  4AQY Q;  1PTO F;  4JI8 Q;  5A2Q L;  2Z1C A;  1CQF A;  5IGG A;  1PYS B;  3EFX D;  2IL8 A;  4NMZ A;  1YIJ A;  4HMI A;  4K8I A;  2E2H H;  4IFD I;  3BDL A;  2PI2 E;  3UDX A;  4B3S L;  3CC7 A;  3PO3 B;  4EQ5 A;  1JWU D;  3AB9 A;  2JA8 B;  1X6O A;  2F0S A;  4F7X A;  1JB7 A;  1GUS A;  3OYY A;  5EJW A;  2UUB Q;  2RKS A;  5EPL A;  4ZUI A;  4Q5V A;  2DN8 A;  1TWA B;  3GTO B;  1L0Y B;  3K7A H;  1TWH B;  4HSP A;  3NEN A;  4LNQ A;  3V05 A;  4FF4 A;  2B2T A;  4IPH A;  2ZXR A;  1PRT D;  1C9O A;  1CT1 D;  3GTQ B;  5KNC A;  5JJL A;  3KF8 A;  4DU9 A;  5J1Z A;  3S17 B;  3AQQ A;  4QB4 A;  2R93 B;  5C5M A;  4H13 C;  2NTS A;  4R9W A;  2RDH A;  5HGQ A;  4DV2 Q;  1MJC A;  5JPM C;  4LUO A;  1IYV A;  2JN4 A;  1PFB A;  1JIC A;  4BA2 I;  2Z9H A;  2VQF L;  1UNS A;  4UP8 A;  3M7G A;  2H4O A;  3NQI A;  3L9A X;  1C4Q A;  1LTT D;  4BY1 B;  3V2T A;  3KDF A;  4PMC A;  4IUQ A;  5CV8 A;  1HUN A;  3BVM A;  4IFD G;  4DR5 L;  1EIY B;  3QO2 A;  5GAE C;  4JI5 L;  1LTS D;  4DR7 L;  2A5H A;  2MPM A;  1VCI A;  4RGN A;  1N34 L;  1U4M A;  1GJX A;  3T1Y Q;  2K6A A;  2D0O A;  2KHJ A;  4JK1 C;  2I46 A;  2QDL A;  1HZ9 A;  3S1N B;  4LK1 C;  5CV9 A;  5EPK A;  3I55 A;  3MXU A;  2D0P A;  1IBL L;  1VQ6 A;  4DR2 L;  2EQS A;  3TP6 A;  3KK7 A;  1QVF A;  1CZG A;  2AQ3 B;  5C44 B;  2MO0 A;  3HKS A;  4R4Q A;  5KND A;  4LW1 A;  1EU4 A;  1SYE A;  4TVA B;  3EJI A;  4K14 A;  4XQJ A;  2PW7 A;  1TVX A;  4NXN L;  1JC7 A;  3GTM B;  4ILW A;  3D6W A;  5CYU A;  1O7Z A;  3TP7 A;  3C1F A;  2B2W C;  1B3Q A;  4HIO A;  4YWK A;  4BBS B;  1LO5 D;  3CPF A;  4L5S A;  2CKZ B;  2F0E A;  3HRZ C;  3H0G G;  1JR0 D;  3IKJ A;  3PF4 A;  4RGO S;  4JI4 L;  2EXZ A;  2IHF A;  2PQA B;  3CRL C;  1N36 L;  4JI2 L;  2F3W A;  1MKH A;  1A0I A;  3HOV H;  3MXP A;  1JOQ A;  1LYL A;  4K2L A;  1SMX A;  4RH6 A;  4K0K Q;  1PH3 A;  3IFD A;  4X64 Q;  1XPO A;  5KYI A;  1JJ2 A;  3S2H H;  1XTC D;  2WV6 D;  1TS2 A;  5HUR A;  1PMR A;  2ASB A;  1P16 A;  3IRB A;  3MXN B;  1MGS A;  2JQO A;  4KY6 A;  3S1Q B;  4LFB Q;  2F0H A;  1UAP A;  5CV4 A;  2K1B A;  5AJ3 L;  1HNZ Q;  4DNI A;  1Y8P B;  1WYD A;  2EYM A;  1M4V A;  2EOT A;  2K5N A;  3I4M H;  3PO3 G;  2ICE C;  4OIJ A;  4L5T A;  2JA8 G;  3K8A A;  2OT2 A;  4IUT A;  3K81 C;  2O5J C;  1JT8 A;  5KNB A;  4AQY L;  2O4X A;  3KBG A;  4JI8 L;  2CH4 W;  1LUZ A;  4XTC S;  5LMN Q;  2LKV A;  1VQ4 A;  2I07 B;  5IGF A;  1HPC A;  1ZEQ X;  2FXQ A;  4OO1 I;  2B29 A;  4A3K H;  1T5E A;  3VYU A;  4BS9 A;  1IBM Q;  3WOF A;  2F0K A;  2ZJR A;  4DAV A;  4CJ1 B;  1PH6 A;  1Y8O B;  3S16 H;  2E2J H;  4FXD A;  2UUB L;  1L0X B;  5D65 A;  4A3G H;  1FYC A;  1DON A;  3D31 A;  1C0A A;  2QGQ A;  2PNH A;  2R93 G;  3K58 A;  2AQ1 B;  5JPN C;  3CKI B;  2B2Y C;  1LTL A;  1BKB A;  1G29 1;  3OW7 A;  3A74 A;  5JJI A;  5GQO A;  2EE1 A;  2PQE A;  1A3T A;  4JW0 A;  3JAM L;  1BQQ T;  4LF8 Q;  1SYB A;  4HJ5 A;  4IJH A;  4A3D H;  4GS3 A;  3G48 A;  4I65 A;  5JVG 3;  2Q2U A;  1EIG A;  2X6G A;  2RSN A;  3NBI A;  4QY7 A;  4BY1 G;  1KD1 C;  3GTK B;  5M5Y H;  3H09 A;  1PTO D;  4DV2 L;  4A3B B;  2DNC A;  4U67 3;  1TY0 A;  2A69 D;  2K5W A;  3TQY A;  3H6M A;  2QDB A;  2M2L A;  3J7A V;  3A8J E;  3I4O A;  3S14 H;  2YV5 A;  1KXL A;  4G7H C;  3QOL A;  4HID A;  1JCK B;  1Q3L A;  4OHJ A;  1EYG A;  2NTT A;  5EBD A;  3SHL A;  3ITP A;  1YEZ A;  5I2Y A;  5A2Q E;  2QA4 A;  1QE6 A;  4BA1 I;  1BOS A;  2JA7 H;  4OO1 G;  1N32 Q;  1I4G A;  2OTJ A;  4LF4 L;  5C44 G;  1CQV A;  3T1Y L;  3VR6 A;  2PCF B;  1VQC A;  4YCW A;  4CJ2 C;  2IJ0 A;  2HQE A;  3NWS A;  3PUY A;  4GN4 B;  1HZA A;  3W5O A;  5E4X A;  1TQO A;  2F3I A;  4UAI A;  3STB C;  2WAQ B;  3T4A C;  4LF6 Q;  2JE6 I;  5ELE A;  2L11 A;  2K50 A;  5JVH 3;  3G71 A;  2KHS A;  1QWY A;  4M1U B;  1QUQ A;  4BXX G;  2F0Q A;  4IAL A;  4BBS G;  2EYJ A;  4IUN A;  1KRS A;  5COY A;  2IWH A;  1R9T B;  3KLS A;  1BCP B;  3C2P A;  3GTJ H;  4ZCK A;  4GOP B;  3NTH A;  2UXB Q;  3CME A;  4DK0 A;  5JAV A;  2B2U C;  1KIX A;  4KY5 A;  1GM5 A;  1B4O A;  4CKB A;  3PUW A;  2WIN B;  1RTO A;  1Y8N B;  3MVV A;  3D6C A;  2PMZ E;  3A0J A;  4RCN A;  1ML0 D;  4K5W A;  2UU9 L;  4IPG A;  4C3J B;  4GKK Q;  5IP7 G;  5C5L A;  3MZ5 A;  3FPU B;  3QB3 A;  4DV3 Q;  4K0K L;  3CMA A;  1G2S A;  4X64 L;  3F2U A;  1UEA B;  2K03 A;  4MHE A;  3GDE A;  4DAP A;  4IJL A;  2PO4 A;  5DAU A;  3E9H A;  1BCP C;  4WOR A;  4GOP C;  2KCC A;  1YJ9 A;  1OO9 B;  3LNN A;  1Q12 A;  4LFB L;  1L1O A;  4FF1 A;  4NDX A;  2CW0 C;  1EZ8 A;  4K6L A;  4JI0 Q;  3ND9 A;  2ZXO A;  4PMB A;  1HNZ L;  2N78 A;  2WFW A;  1DOL A;  2LSS A;  2XWJ B;  4DV4 L;  4RA8 A;  4AYB B;  4A75 A;  4IFD H;  1PH5 A;  1G51 A;  4KK7 A;  5LMU Q;  4JBW A;  1CA5 A;  5COR A;  2JJQ A;  4FF2 A;  4WFN 3;  4A3D B;  2BDN A;  2EDG A;  3CHB D;  3HP3 A;  4P74 A;  5ELO A;  2HT1 A;  4B3R Q;  2XWB B;  4RMF A;  2L1B A;  4ZLT F;  3I4L A;  5C3W A;  5J3B A;  1PH9 A;  5KIX A;  3A5Z B;  3M9B A;  3IFT A;  2ID0 A;  4DV5 Q;  3OPO A;  3PUV A;  1SMY D;  4DK3 C;  1YNX A;  3FVQ A;  3AYH B;  4R4I A;  1XMO Q;  1SYC A;  3M3Y B;  2EY1 A;  1YJN A;  1G6Z A;  4GN5 A;  1M90 C;  1DM0 B;  1HCZ A;  3RZD B;  5CGK A;  5EAY A;  4A3B G;  1EYC A;  1BVS A;  1WFQ A;  4ULL A;  2PZU A;  2K04 A;  1Q90 A;  3HOZ B;  4LF8 L;  1N9W A;  4DXG A;  1NR4 A;  2SOB A;  1X32 A;  1ILQ A;  1LM0 A;  1G2T A;  1TU2 B;  4DV0 Q;  3OOC A;  2R3Z A;  2I0Q A;  3K0Y A;  1B44 D;  1EQQ A;  1TWC B;  1AE3 A;  2E74 C;  3H0G H;  4A93 B;  3ZJY C;  3L3O C;  1ENC A;  4XYO A;  3H15 A;  3TRZ A;  1GUT A;  3U58 A;  4KHP Q;  1SYG A;  1E2Z A;  2DJG C;  1PH4 A;  3P20 A;  1YNJ C;  1Q7Y C;  3JAM c;  1AH9 A;  1HNX Q;  3RNU A;  3KYH C;  1D5X C;  4DAM A;  3BG3 A;  3D3R A;  1ET6 A;  4XQN A;  5GAH C;  1B1Z A;  2NVY H;  2KEN A;  3A55 A;  4GLA C;  2F0J A;  1BF4 A;  4DF7 A;  5FLX L;  4A3E B;  1N32 L;  2Y0S B;  1KAB A;  2NVX H;  1S5C D;  3HEJ A;  3KJP A;  3CAM A;  2A74 C;  1I4H A;  5KEE A;  5NUC A;  2HHH Q;  4DR6 L;  1XTD A;  3E9I A;  1CM9 A;  4KLK A;  1YJW A;  1QOH A;  3E0J A;  3LGJ A;  1NMF A;  1SLJ A;  4KJO A;  3PO3 H;  3I4N B;  4X66 Q;  1HFN A;  4KD3 A;  3DXJ C;  5IGC A;  3VR4 A;  2JA8 H;  5JJZ A;  3TN2 A;  1F9Q A;  3MA2 B;  4DV7 Q;  3J81 j;  3D8G A;  1LTI D;  2IX3 A;  1TWA H;  3GTO H;  3S1M B;  2ZTC A;  3W1B A;  3I3C A;  4P2C B;  4P72 A;  1PFS A;  4XIG S;  3JAM E;  1YI2 A;  4C3J G;  1SND A;  4GNX A;  3GTQ H;  3N6R A;  1I3Q B;  1RKN A;  1KRT A;  3K5N A;  2EY5 A;  1F9S A;  3CU7 A;  5TSS A;  1F9P A;  3ERS X;  4HN7 A;  1STG A;  4MNO A;  1MBY A;  4PZ7 A;  1CZW A;  4N9T A;  3R2I A;  2R93 H;  3MC0 B;  4BWG B;  1S4Z A;  4G7O C;  1UEB A;  1DZ1 A;  2VNU D;  2NVQ B;  1RL2 A;  1LTG D;  3GV6 A;  2PNR C;  1NNX A;  1BO0 A;  1Z9F A;  5E7N A;  5FJ8 G;  3MEH A;  1JOO A;  2B39 A;  3ULL A;  4BY1 H;  4OX9 Q; 
#chains in the Genus database with same CATH homology
 3HOW H;  4AYB G;  4X6A H;  1E24 A;  4JV5 Q;  3KDF A;  3CC2 A;  4DUZ L;  4B3M Q;  3M4Q A;  2I5M X;  1Q1E A;  1IBM L;  4IFD G;  3KF8 B;  3CCM A;  4DR5 L;  4HIK A;  3T1H Q;  1KQS A;  2B63 H;  3GTP H;  1EIY B;  1VQ5 A;  2VY3 A;  1Y1V G;  2R92 H;  5M5X H;  4JI5 L;  5GAE C;  2NN6 I;  2ZM6 L;  4A3D G;  3KJO A;  1VQ8 A;  2NVT H;  4DR7 L;  1N34 L;  1KHI A;  1VCI A;  4BBR H;  2EXD A;  1H95 A;  3T1Y Q;  2JEA I;  4QJF A;  4JI0 L;  2D0O A;  1VQ6 A;  2KHJ A;  4O0A A;  2DUD A;  1NTG A;  3CW2 C;  3S1N H;  2VS1 A;  2E5L L;  1HZ9 A;  1WCM H;  3NEL A;  4UPA A;  4DKA C;  4RG1 A;  4R4C A;  3I55 A;  3L0O A;  2ATW A;  2CQO A;  2D0P A;  2UUA Q;  1GKH A;  1IBL L;  1O7I A;  4DR2 L;  2EQS A;  2PQA A;  4NB3 A;  4POG A;  5LMN W;  1QVF A;  2Z6K C;  4AIM A;  1B70 B;  2YYZ A;  2UXD L;  5C44 H;  2BH8 A;  2LXK A;  3HOY G;  3RN5 A;  1T9H A;  3CCU A;  1S3O A;  2MO0 A;  3HKS A;  4R4Q A;  3TRE A;  3U4Z A;  5GRO A;  2AWO A;  4LW1 A;  4TVA B;  4A3L H;  3KDF B;  3GTM H;  4NXN L;  4DV5 L;  1N8R C;  1E3P A;  5IYD H;  3HOZ G;  3KFU A;  4MZ9 A;  1NMG A;  1AE2 A;  1K3R A;  2A1A A;  2IX1 A;  4R1J A;  1WI5 A;  3KF6 A;  2VUM H;  4DR4 L;  2I5H A;  3F2B A;  1N33 Q;  3UE0 A;  4BXX H;  4LF5 L;  2PI2 A;  2RCN A;  4HIO A;  1PH7 A;  4YWK A;  4BBS H;  1E1T A;  3NBH B;  3HFZ B;  3JAM i;  1ASZ A;  3CPF A;  4L5S A;  2CKZ B;  3EBE A;  4A93 G;  4JI7 L;  4DR6 Q;  4HJA A;  3H0G G;  3CP0 A;  4JI1 Q;  1X65 A;  3PF4 A;  3TS2 A;  4LFC L;  4JI4 L;  1XMQ Q;  2ZJQ A;  2IHF A;  3HOX G;  4B3S Q;  2IHE A;  2PQA B;  1N36 L;  4UY8 C;  4JI2 L;  2NZH A;  2GN5 A;  4JG2 A;  1MKH A;  2RHS B;  4IOC A;  1IBK Q;  4JYA L;  4IO9 A;  1A0I A;  1HNW Q;  4YWL A;  5C3E G;  3HOV H;  3L7Z C;  1Y1W H;  3CD6 A;  4DV0 L;  3TEH B;  5IYB G;  3ER0 A;  1J5E Q;  1VQP A;  4DUY Q;  1LYL A;  1SRO A;  1SMX A;  1OXU A;  2NN6 G;  2ZJP A;  3CCV A;  2Q2T A;  4K0K Q;  3PF5 A;  1QVG A;  4A3I G;  1PH3 A;  4LUV A;  4X64 Q;  1X56 A;  1XPO A;  1JJ2 A;  1EUJ A;  2Z6K A;  3S2H H;  4LF6 L;  1JJG A;  2QEX A;  1UE7 A;  5JEA J;  3F2D A;  2ASB A;  4A3E G;  5IYC G;  2Y0S G;  1UE6 A;  5IP7 H;  1P16 A;  3WWV A;  3IRB A;  4KHP L;  3MXN B;  4C3I H;  3S1Q H;  2JQO A;  1X9N A;  1BBW A;  4LFB Q;  4UP7 A;  4YY3 Q;  1OXV A;  1J6Q A;  1HNX L;  2WP8 J;  3K80 C;  2IY5 B;  4HIM A;  5JJK A;  1DGS A;  5AJ3 L;  1HNZ Q;  4DNI A;  2OWO A;  1VS0 A;  5FLM H;  4JOI C;  4H02 A;  2UXB L;  1WYD A;  4A3M G;  3I4N G;  2K5N A;  3I4M H;  3SGI A;  3PO3 G;  1XNQ L;  1JJC B;  1K9M C;  3CC4 A;  1L2F A;  1XNR L;  2N3S A;  4L5T A;  2JA8 G;  3K8A A;  3I4N H;  1E22 A;  4DV6 Q;  2DGY A;  3K81 C;  1JT8 A;  1QUQ B;  4AQY L;  1EIF A;  4KI0 A;  1VQG A;  4JI8 L;  1LUZ A;  3RLO A;  2YTV A;  4APV A;  4XTC S;  1NY4 A;  5LMN Q;  2GVB A;  2CWP A;  3KLW A;  1VQ4 A;  3RZO H;  1FL0 A;  3S1R H;  4DK6 C;  5H1S E;  4R4O A;  2FXQ A;  2VW9 A;  1OXS C;  4OO1 I;  2B29 A;  2BA1 A;  4A3K H;  4X66 L;  1UWV A;  1X3E A;  4DV1 Q;  4GKK L;  1VQA A;  2K5V A;  4UP9 A;  4B3T L;  1IBM Q;  1I6H H;  2RHQ B;  2VZA A;  3FKI H;  3B6Y A;  4DR5 Q;  2ZJR A;  4ME3 A;  4DV7 L;  5IP9 H;  1I94 Q;  4NXM L;  2KCT A;  1PH6 A;  5IWA Q;  3S16 H;  4DV3 L;  2E2J H;  4L5Q A;  3CF5 A;  2UUB L;  5HY6 A;  1A62 A;  3PSI A;  1Z47 A;  2F4V L;  4QL5 A;  5FLX c;  4A3G H;  3D31 A;  3FHW A;  2QGQ A;  2PNH A;  1B7Y B;  2R93 G;  1C0A A;  4JC0 A;  1G6P A;  2ALY B;  2JA9 A;  2E5L Q;  4HJ9 A;  1XJV A;  4JBM A;  1LTL A;  1BKB A;  1G29 1;  5JJI A;  3A74 A;  4LF7 L;  5GQO A;  4IOA A;  4LFA Q;  4LF8 Q;  1YHB A;  2R7F A;  2WB1 E;  2R7Z H;  4HJ5 A;  4IJH A;  3STB D;  1X55 A;  4A3D H;  3RR5 A;  1VQI A;  4IPC A;  2HIV A;  4LUZ A;  4GS3 A;  3G48 A;  2Q2U A;  2I5L X;  1ASY A;  1RIP A;  3GTK H;  3EN2 A;  1TXY A;  2R7D A;  3PGZ A;  4QY7 A;  4BY1 G;  3M7N A;  1KD1 C;  1CSP A;  1S40 A;  1L0W A;  1KL9 A;  1YIT A;  1PV4 A;  5M5Y H;  3HOW G;  4A3B H;  4GKJ L;  1XPR A;  4DV2 L;  3J7A 5;  5K36 G;  1NBW A;  2Z0S A;  3TQY A;  4JBJ A;  3RLN A;  5IYD G;  5BR8 L;  2E8G A;  2B63 G;  1SFO H;  5LMU L;  1GD7 A;  4JI3 Q;  2K75 A;  2R92 G;  1VQN A;  1CUK A;  3Q8D A;  3MEF A;  3UDI A;  1SE8 A;  2K4K A;  3I4O A;  2CWA A;  3S14 H;  2JA6 H;  4B3R L;  2YV5 A;  4BBR G;  1KXL A;  2JA5 H;  1HR0 L;  2VQE L;  3M4P A;  2N49 A;  3UE1 A;  3DLL A;  4HID A;  4JV5 L;  1WCM G;  3GD7 A;  1KC8 C;  4B3M L;  1FJG Q;  1EFW A;  4DAY B;  1EYG A;  4WJ4 A;  3VDY A;  1CKN B;  3T1H L;  3UDF A;  1YEZ A;  1XMO L;  3CXC A;  2QA4 A;  4A3C H;  3HOU H;  4BA1 I;  2JA7 H;  4OO1 G;  1N32 Q;  4DPG A;  1UE5 A;  2OTJ A;  4LF4 L;  1TWG H;  3E0E A;  2UUC L;  5C44 G;  4X65 Q;  2IX0 A;  1U5K A;  3T1Y L;  2WAQ E;  4DR1 Q;  1VQC A;  4YCW A;  2YU9 H;  4QGU A;  3PUY A;  4GN4 B;  2AKW B;  4OWX B;  4A3L G;  1HZA A;  3W5O A;  3S2D H;  2F3I A;  4LWC A;  3STB C;  5M3M H;  4YHH Q;  4BY7 H;  4LF6 Q;  4DR3 L;  3U4V A;  4JI6 Q;  3CCS A;  2CCZ A;  2JE6 I;  2UUA L;  3HKZ E;  3H3V H;  3PO3 H;  2K50 A;  3G71 A;  4BY1 H;  1QUQ A;  3GTL H;  4BXX G;  1HR0 W;  4PMW A;  4J15 A;  4GNX C;  5C4X H;  4YWM A;  4A3J H;  1R9T H;  1KRS A;  3S15 H;  4BBS G;  1JE5 A;  3GTJ H;  3EIV A;  1V1Q A;  1QZG A;  2CFM A;  5AJ3 Q;  1V9P A;  4GOP B;  1VQ9 A;  4Y7N H;  1IYJ B;  1L1O C;  4OWT B;  2UXB Q;  2WAQ G;  2OQK A;  3CME A;  1CKO A;  3PUX A;  1XNR Q;  1K8A C;  1KIX A;  4PZ6 A;  4QIW E;  4AH6 A;  3G6E A;  1N33 L;  2KCM A;  1GM5 A;  3AFP A;  2A8V A;  1WOC A;  3HOV G;  3AEV A;  4OON A;  1Y1W G;  3PUW A;  1CKM A;  3W1G A;  3CCR A;  4KHZ A;  2BH2 A;  4QQB X;  1FGU A;  1VQJ A;  1Q8K A;  4GN3 B;  1W2B A;  2PMZ E;  3A0J A;  4JI1 L;  1P8L A;  3F1Z A;  1Q86 C;  2UU9 L;  1XMQ L;  3PCO B;  4C3J H;  4IPG A;  3AFQ A;  4LF9 Q;  4GKK Q;  4HJ8 A;  4JCV E;  5IP7 G;  1IBK L;  3OTO Q;  3FP9 A;  5GAG C;  1HNW L;  1X3G A;  2VQF Q;  4IPD A;  1IL2 A;  3PO2 H;  1UE1 A;  1XPU A;  1J5E L;  3BZC A;  1IZ6 A;  4DV3 Q;  2HHH L;  2VL6 A;  3ULJ A;  3PIO A;  4DUY L;  2JEB I;  4K0K L;  1TWH H;  1VQE A;  3K0X A;  1EWI A;  1YVC A;  2L15 A;  4X62 Q;  4X64 L;  3CMA A;  5M3F H;  2HIX A;  1SR3 A;  5FLM G;  3CCE A;  1Y14 B;  3GDE A;  1PYB A;  4A3F H;  4IFD J;  1IXR A;  4IJL A;  3I4M G;  4DUZ Q;  1E1O A;  3BU2 A;  1C7Y A;  4JBK A;  3E9H A;  4LF7 Q;  2UXC L;  4O2D A;  3GTG H;  5JEA G;  4GOP C;  4L5R C;  4JI5 Q;  4MTN A;  1YJ9 A;  3S17 H;  2ZM6 Q;  2NZO A;  4DR7 Q;  3J80 c;  3RLF A;  1Q12 A;  4AYB E;  5FJ8 H;  1L1O A;  1PHJ A;  1N34 Q;  1EQR A;  4LFB L;  4YY3 L;  2Q2H A;  4JI0 Q;  2YTY A;  1GO3 E;  2JK8 A;  1HNZ L;  2N78 A;  2WFW A;  2LSS A;  1VQH A;  4DV4 L;  4C2M H;  3KOJ A;  1HJP A;  1QVC A;  4A3K G;  3J81 c;  3F2C A;  3I56 A;  4A75 A;  4FDB A;  1CKN A;  1HH2 P;  2Q2I A;  4DV6 L;  3FKI G;  4DR2 Q;  1Y1V H;  1PH5 A;  1G51 A;  1IBL Q;  5LMU Q;  5IP9 G;  4OWW B;  4JBW A;  4JOI A;  2UXD Q;  3F8T A;  2JJQ A;  1A8V A;  3OW2 A;  5C4J H;  4B3R Q;  2HT1 A;  4P74 A;  5ELO A;  4TQU S;  4A3G G;  4RMF A;  1HZB A;  1PH9 A;  5DLQ E;  5J3B A;  2B3G A;  3A5Z B;  4PG3 A;  1HR0 Q;  1U0L A;  2XGT A;  3M9B A;  3H3V I;  1SRU A;  4NXN Q;  2ID0 A;  4DV5 Q;  4GNX B;  1YZ6 A;  2AWN A;  3PUV A;  4DV1 L;  2OTL A;  5M5W H;  2YTX A;  4DK3 C;  3DM3 A;  4ALP A;  1PH2 A;  1YNX A;  3AYH B;  1PH8 A;  3BZK A;  4R4I A;  1XMO Q;  5IT9 c;  3M3Y H;  1I94 L;  2R7Z G;  4DR4 Q;  1YJN A;  1EOV A;  1L1O B;  5IWA L;  1Q81 C;  4LF5 Q;  4GN5 A;  3HOY H;  4LF4 Q;  2UUC Q;  1M90 C;  3CCJ A;  1X54 A;  1JMC A;  2WB1 G;  3RZD H;  1NE3 A;  2MFI A;  1SN8 A;  1D8L A;  4JI7 Q;  4OX9 L;  2LXJ A;  3D0F A;  5EAY A;  4A3B G;  1K83 H;  1BVS A;  1WFQ A;  4GOP A;  4GLX A;  4LFC Q;  4JI4 Q;  3HOZ H;  4A76 A;  3ULP A;  1NJI C;  4LFA L;  4DR3 Q;  2BA0 A;  3RN2 A;  1N36 Q;  4LF8 L;  1Q82 C;  1N9W A;  1WJJ A;  4YCV A;  4JI2 Q;  3K7U C;  4JYA Q;  4WJ3 M;  1D7Q A;  4A4I A;  1BBU A;  1LM0 A;  3I7F A;  1MJE A;  3M4O H;  4DV0 Q;  2I0Q A;  2JA6 G;  1TWC H;  1EQQ A;  1I50 H;  4A93 H;  3UDG A;  1AE3 A;  3H0G H;  3JC6 6;  2JA5 G;  3ZJY C;  1K8G A;  1HZC A;  3PIP A;  2K5H A;  3U50 C;  3H15 A;  3ICE A;  2ES2 A;  4GLV B;  2ZTE A;  1PA6 A;  2OCE A;  3HOX H;  1CSQ A;  4P73 A;  3TRZ A;  2K52 A;  2H5X A;  4A3C G;  2VUM G;  1GVP A;  4JI3 L;  3U58 A;  2JA7 G;  1VQF A;  3HOU G;  1PH4 A;  1M1K C;  4KHP Q;  5C3E H;  3TS0 A;  4OXP A;  1YHQ A;  5IYB H;  2MNA A;  1Q7Y C;  3JAM c;  2MQH A;  4EX5 A;  1AH9 A;  1Q1B A;  1HNX Q;  4HJ7 A;  5C0X I;  3RNU A;  3KYH C;  2EIF A;  4A3I H;  4DAM A;  2Y0S E;  1I5F A;  3I2Z A;  3PUZ A;  4R4T A;  3G4S A;  3M85 A;  4YCU A;  5GAH C;  1FJG L;  2F52 A;  5M3M G;  2NVY H;  2UU9 Q;  4BY7 G;  1E7Z A;  1XNQ Q;  2KEN A;  4GLA C;  3J7Z C;  5IYC H;  4A3E H;  1KAW A;  1PVO A;  1N32 L;  2NVX H;  1S72 A;  1FVI A;  3CCL A;  4AQY Q;  1W3S A;  3KJP A;  3CAM A;  4JI8 Q;  4X65 L;  3HKZ G;  4A3J G;  5C4X G;  4DR1 L;  4Y52 H;  1X3F A;  2HHH Q;  4DR6 L;  1QZH A;  1XTD A;  3E9I A;  1PYS B;  5C0X J;  4KLK A;  1YIJ A;  2D62 A;  1YJW A;  2E2H H;  4IFD I;  4A3M H;  1NMF A;  1SLJ A;  2PI2 E;  3LGJ A;  4NPS A;  1Q46 A;  3UDX A;  4YHH L;  3CC7 A;  1OXT A;  1YHA A;  2C35 B;  4X66 Q;  4B3S L;  4JI6 L;  4EQ5 A;  4B3T Q;  2JA8 H;  3KF6 B;  1VQK A;  2RF4 A;  5ELN A;  2A19 A;  1X6O A;  2UXC Q;  3PV0 A;  4DV7 Q;  4NXM Q;  1A63 A;  1JB7 A;  4PZ8 A;  3OYY A;  3J81 j;  3S1M H;  2UUB Q;  2F4V Q;  3GO5 A;  2E2I H;  1TWA H;  3GTO H;  2HQL A;  2ZTC A;  3NEM A;  3W1B A;  1OXX K;  3K7A H;  4P72 A;  1PFS A;  3NEN A;  4XIG S;  5GAD C;  1YI2 A;  4LNQ A;  4DV4 Q;  1OTC A;  2N8N A;  1I3Q H;  4IPH A;  4GNX A;  1B8A A;  2XTI A;  3GTQ H;  1C9O A;  3L2P A;  3BJU A;  1KRT A;  2AHO B;  2K14 A;  5JJL A;  4C3H H;  2GVA A;  2V1C C;  3ERS X;  3AQQ A;  3PO2 G;  1VQD A;  4MNO A;  4PZ7 A;  5IY0 A;  3CPW A;  3J80 i;  2KBN A;  1VQM A;  2R93 H;  5M3F G;  4GKJ Q;  1VQB A;  5IE8 A;  1K0R A;  5HGQ A;  4DV2 Q;  5C0X G;  1UEB A;  2AMC B;  1MJC A;  4A3F G;  1VQO A;  4LF9 L;  2NVQ H;  2VNU D;  1TWF H;  3J81 i;  4LUO A;  1K73 C;  1MIU A;  1RL2 A;  4P71 A;  5BR8 Q;  1V43 A;  2KHI A;  3S24 A;  1VQ7 A;  4POF A;  4BA2 I;  3OTO L;  1YBY A;  3CCQ A;  2OQ0 A;  2VQF L;  2MO1 A;  1Z9F A;  5E7N A;  4P75 A;  5FJ8 G;  5LMN L;  4UP8 A;  3CQZ H;  1PH1 A;  2IT1 A;  2R6G A;  3ULL A;  3A5U A;  1VQL A;  2ZTD A;  2VQE Q;  4X62 L;  4OX9 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...