2PI2E

Full-length replication protein a subunits rpa14 and rpa32
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication, dna binding protein
molecule keywords Replication protein A 32 kDa subunit
total genus 27
structure length 117
sequence length 117
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pi2E00
3PF5A 1DGSA 1NY4A 4HIKA 4IPHA 3RLFA 4A76A 2Q2TA 4R4TA 1HR0L 1BVSA 2I5MX 5IP7H 2UXDL 2HQLA 1CKMA 3CCUA 2A8VA 1U5KA 4KHZA 2IY5B 2PI2E 2F3IA 4A3JH 4DUYL 2E2IH 2UXCL 1N9WA 1SFOH 3HOWG 1OXUA 2B3GA 4LW1A 1X3EA 3S1QH 3PO3H 3S24A 2K52A 1VQAA 2JEAI 1XNRL 1PH6A 4APVA 1LYLA 4KHPQ 1EYGA 3J81j 2DUDA 2KHIA 3W1GA 1L1OB 1UEBA 3CCJA 4LF7Q 1XNRQ 4B3RQ 4YCVA 1EUJA 1VQCA 3TREA 3M3YH 3PO2H 2D62A 2YYZA 4C3JH 1CSPA 5J3BA 3ICEA 4A3LG 4A3CG 3PO3G 4GKJL 4GOPC 2BA0A 3A0JA 1TWHH 3F1ZA 3GDEA 1QZGA 3HOYH 3I4NH 1A0IA 1VQFA 1Q1EA 4FDBA 3D0FA 5FJ8H 3WWVA 1TWCH 1QVGA 2VL6A 1M1KC 4A3LH 2K50A 3PUXA 1AE3A 3CXCA 4LF5L 4DR2L 4GN4B 4DR6L 3GTKH 4XTCS 4GLVB 5IYBH 2R6GA 1IXRA 2WAQE 1K0RA 1Y1VG 4UP8A 2EIFA 5BR8Q 1GD7A 2F4VQ 3HOUG 1KXLA 1IBKQ 1GO3E 1L2FA 2A19A 2KCTA 4DV0L 4JI4Q 1YJWA 2UXBL 3I4MG 1PYBA 3G71A 3U58A 4IJLA 1Y1VH 4LUZA 1EQQA 4DR5L 2IHFA 3L2PA 1HNZQ 1VQLA 4JBJA 3J81i 2OTLA 2HHHL 3GO5A 3K7AH 1QVFA 4BXXG 5HY6A 3MXNB 2HHHQ 1Y14B 2HT1A 1YHQA 1G291 2UUAQ 2NVYH 4IJHA 3BZCA 4JOIA 1TXYA 4HJAA 5AJ3L 1N34Q 1D7QA 5GROA 3CQZH 3HFZB 2N49A 3Q8DA 1PH8A 4BBSG 3MEFA 4JI8Q 4MNOA 4OXPA 2OTJA 4DNIA 5IYDH 4LF8L 1YHAA 2VQFL 3G6EA 2A1AA 2MO0A 4JI0L 4DR3L 3CPWA 3CP0A 4DR4L 1X65A 1YITA 1Q82C 3KF6B 4LUVA 2YTXA 1L1OA 1VQ5A 5FLMG 3E9IA 1KD1C 4OWWB 1V43A 1HNXQ 3CCEA 4KI0A 5C44H 4A3BH 2HIVA 3L0OA 1Y1WH 4GOPB 1K8AC 1NE3A 4BA1I 1I94Q 4NXML 4L5RC 3M4OH 1VQ8A 2Z0SA 4LWCA 5M5YH 2D0OA 1JT8A 4O2DA 3RZDH 1IYJB 4DUZL 2QGQA 1XPUA 5IY0A 2K75A 1KRSA 4MZ9A 3CF5A 2JE6I 3FKIH 4C2MH 2UU9L 5JJIA 1YNXA 1QUQA 1QVCA 3A5ZB 2Q2IA 1YI2A 1PH7A 4DR2Q 4JI3Q 2Z6KC 3KJOA 1B70B 4RMFA 2HIXA 2JA7G 5EAYA 1HR0Q 4OX9L 4DV2L 4LFAL 3H15A 4LF8Q 2ZTDA 3I4OA 2L15A 4JV5L 3ER0A 3GTLH 1PH9A 1G51A 2KENA 1VQ7A 3HOXH 1FGUA 1PFSA 2B29A 3HOZG 4PMWA 1CKNB 2ID0A 4AYBE 4LF7L 4BY7H 3GTQH 1NMFA 1X54A 3G48A 4JG2A 3I7FA 1HR0W 2JJQA 2R7DA 2QEXA 4A3KH 1B8AA 2MNAA 1PHJA 1OXTA 1VS0A 4A3IH 2JA5G 3KDFB 3S14H 3CCVA 4HIOA 1PA6A 3HOVH 2GVAA 3OW2A 1NTGA 4LFAQ 4EQ5A 4X65L 3CPFA 3HKZE 3KOJA 2YTYA 5LMNW 2R92H 4DR7Q 4BXXH 4NXNQ 1K3RA 3CAMA 4POGA 1FJGL 1WCMG 1CKNA 3TEHB 4DKAC 4LF6Q 5HGQA 1E1TA 5BR8L 1OXXK 4X64Q 1FJGQ 3CCRA 4QJFA 3GD7A 2YV5A 5FJ8G 4BY1H 1I5FA 3ZJYC 4GOPA 2ES2A 1PH5A 4DR7L 5K36G 4X65Q 4DV6L 1W3SA 1XMOQ 4B3TL 1A63A 2EXDA 4DAYB 1IBML 2NVXH 2IX0A 4NXNL 1EIYB 2ASBA 1FVIA 1VQDA 4X62L 4A3EG 3PIPA 2JA8G 1BBWA 4KLKA 5IE8A 2JA7H 4YCWA 3EBEA 4P72A 4LNQA 4JI2Q 3L7ZC 1JJGA 1HZAA 1SRUA 1BKBA 1LUZA 5JEAG 4B3TQ 4OO1I 3I4MH 1PH4A 5M3FH 1Y1WG 1VQIA 1HNWL 4YWMA 3M4QA 4DV6Q 2ZM6L 3F2DA 1XMOL 4DV7Q 4R4QA 1OXSC 2PI2A 5M5XH 3OTOQ 2AKWB 3LGJA 4OONA 3UE0A 1S3OA 4PZ8A 5IP7G 5IYBG 3KJPA 3K8AA 1KC8C 4AH6A 3EIVA 1MJCA 1D8LA 2ZJQA 2IHEA 4A3FH 3FP9A 2CWAA 4JI8L 4X66L 1P16A 1Q46A 3AFPA 3CD6A 3TS2A 5IYDG 4YHHQ 3J81c 1Z9FA 3OTOL 1YIJA 3B6YA 1KQSA 2B63H 2WB1G 2UUAL 2JA6H 2MQHA 3HOYG 4IFDI 5LMUL 3D31A 4YWLA 3J7ZC 4DV7L 1KL9A 2Q2UA 1VQGA 2WP8J 2JQOA 4YY3L 5C4JH 1TWAH 1E3PA 3J80c 4JI6Q 4JI4L 4DK3C 4P75A 1I3QH 4NXMQ 4DV1Q 1MJEA 4A93G 3NELA 4JI1L 1X6OA 5M3MG 2WB1E 4LF4L 1Q8KA 3M7NA 4JBMA 2N78A 3CCMA 4DV2Q 4BY1G 3A74A 2R93G 1IBLQ 4A93H 4B3SQ 1N32L 4JI5Q 3I55A 4DR3Q 4A3MG 4WJ3M 1EQRA 2PQAA 3W1BA 3H3VI 1FL0A 1MKHA 3M4PA 3JC66 4C3IH 2VY3A 4BY7G 3DLLA 1AH9A 4JI1Q 4LF4Q 4GNXA 1PYSB 1C7YA 4IOCA 1WJJA 2LXKA 3UDXA 1KAWA 2ALYB 5IWAQ 2GVBA 1JJ2A 4A3DH 4A3MH 4LF9Q 1IZ6A 4GKKL 4DPGA 3VDYA 4ALPA 1YVCA 4JOIC 2YU9H 5IP9G 2NZHA 1RL2A 4PZ6A 4PZ7A 1J5EL 1HZCA 2VNUD 3ULLA 5IYCH 1X3FA 4KHPL 1J5EQ 3I56A 3F8TA 4IPDA 1E22A 4AIMA 4GNXB 4RG1A 1EIFA 1XPRA 5JEAJ 2YTVA 4JV5Q 1VQHA 2CCZA 3E9HA 3H0GG 3U50C 3F2CA 1N36Q 1WFQA 4DV0Q 3S2HH 3TQYA 3A5UA 2PNHA 1YJNA 2Y0SE 3JAMi 1N36L 2F52A 4J15A 4BBRH 4HJ5A 4B3RL 1VQMA 4OX9Q 4OWTB 2BH8A 1XPOA 4X6AH 2AWOA 3CMEA 3ERSX 3PUWA 2PQAB 2OQ0A 1SMXA 3OYYA 2UUBL 4HIDA 2OWOA 2JA9A 4BBRG 2AHOB 5JJLA 1UE6A 2AWNA 3TS0A 2KHJA 1C9OA 4JC0A 2UUCQ 1TWGH 1XJVA 1P8LA 5JJKA 4X62Q 4JBWA 1UWVA 3I4NG 1YHBA 1IL2A 1I6HH 4GKJQ 1IBKL 1L0WA 5ELNA 1M90C 3CC4A 2UXBQ 1PVOA 2E2JH 5ELOA 2NVQH 4XIGS 3JAMc 4H02A 3G4SA 4LFBL 1VQJA 2IT1A 1QZHA 2ZJPA 1YBYA 3GTPH 4A75A 2UUBQ 4Y52H 2BA1A 4LF6L 3UDFA 1HNXL 4DUYQ 4QL5A 2UXCQ 1BBUA 4YHHL 1K83H 1SR3A 1O7IA 1U0LA 1VQBA 4YCUA 3FKIG 4QY7A 3J80i 2VQEQ 3K80C 4R4CA 2OCEA 4JI0Q 4UY8C 4DR6Q 1I50H 1K73C 1PH1A 3CCLA 3GTMH 2VQFQ 5FLXc 3HKZG 3PV0A 1VQOA 1YJ9A 3STBC 3K0XA 2VS1A 4R4IA 1JMCA 5E7NA 1UE1A 1LTLA 1HJPA 4B3MQ 2VQEL 3S1RH 1NBWA 3AEVA 5IP9H 2DGYA 1NJIC 1YEZA 2Z6KA 3HOVG 4Y7NH 3KFUA 1HNWQ 3CW2C 1OTCA 2NN6I 1V9PA 4A3GH 1GM5A 3PUZA 2R92G 4PG3A 2C35B 3CCSA 4GNXC 4A3KG 3S17H 3U4ZA 1Q7YC 1JJCB 2D0PA 4TVAB 5DLQE 1PH3A 2VUMG 1VQ6A 1H95A 4IPGA 3PO2G 3U4VA 1S72A 1X9NA 4IO9A 1X3GA 2K4KA 5C4XH 3RLOA 4TQUS 3FHWA 1WI5A 2CWPA 2JK8A 2VW9A 1K8GA 1IBMQ 1C0AA 3M9BA 4X66Q 1A8VA 3BJUA 2V1CC 5C0XI 4DV5L 2E5LL 4IPCA 4JI3L 4UP7A 1YZ6A 3K7UC 4NPSA 4DV3Q 2WAQG 4NB3A 4A3FG 4JI7L 2RHSB 1X55A 3PSIA 4GS3A 3CC7A 3CCQA 4HJ9A 4B3SL 1N32Q 1Q12A 3J7A5 4LFCQ 3S15H 1X56A 2KCMA 3ULPA 1IBLL 4GLXA 2NZOA 4JI7Q 2ZJRA 3UE1A 2I5LX 1S40A 4P71A 2E5LQ 3CC2A 3TRZA 1GKHA 2K5HA 2WFWA 4IFDG 5GAEC 1EOVA 1XMQQ 3KYHC 4QGUA 4DV1L 3NBHB 1K9MC 1SROA 3E0EA 1E24A 1CUKA 5GAHC 5M3MH 4JBKA 4JI6L 3KDFA 1ASZA 5GADC 4QIWE 1N8RC 4A3CH 2K5VA 1EWIA 5GQOA 2XGTA 2R7ZG 4A3IG 2JA5H 3M85A 3KF6A 5M3FG 1QUQB 5GAGC 1GVPA 3T1YL 3PIOA 2K5NA 4POFA 5IWAL 3T1HL 2E2HH 2VZAA 2GN5A 1VCIA 1SN8A 2IX1A 1CSQA 3T1HQ 4O0AA 1CKOA 1SLJA 1WOCA 2LXJA 1VQPA 1Q81C 1AE2A 2MO1A 1UE5A 2NN6G 1XNQL 3H3VH 3PCOB 3HOUH 4YWKA 4K0KQ 1E7ZA 4AQYQ 1XMQL 3S2DH 2I5HA 4HJ8A 1MIUA 4UPAA 2VUMH 5IT9c 2AMCB 2PMZE 2B63G 4A3DG 4LFBQ 3RNUA 1J6QA 4JI2L 5LMNQ 4A4IA 3S1MH 5C4XG 3NEMA 4HIMA 4AQYL 5C3EH 1L1OC 4YY3Q 4OO1G 1A62A 2K14A 2UUCL 1SE8A 2CKZB 1N33Q 1VQNA 4GN3B 1XNQQ 3S16H 2QA4A 4K0KL 2E8GA 3AYHB 4A3JG 4LF5Q 3RR5A 1HZ9A 4L5SA 3I2ZA 3PGZA 4WJ4A 4X64L 5M5WH 2ZTEA 4IOAA 4UP9A 1HZBA 3RZOH 3H0GH 4QQBX 4P73A 5C44G 2CQOA 2RHQB 4A3EH 1VQKA 3HKSA 1WYDA 4R1JA 2Y0SG 3UDIA 1N33L 1ASYA 2CFMA 2NVTH 4BA2I 2H5XA 2JEBI 4JCVE 3IRBA 3HOWH 4HJ7A 2ATWA 3UDGA 4C3HH 3W5OA 4DV4Q 4OWXB 1OXVA 2XTIA 3ULJA 3NENA 2ZM6Q 4DR1L 2JA6G 2R7ZH 1PV4A 1V1QA 1B7YB 1Q1BA 1VQ9A 3AQQA 4DK6C 4MTNA 4JYAL 1VQEA 3STBD 3S1NH 4B3ML 4BBSH 4DR1Q 5LMUQ 4A3GG 4GLAC 3GTJH 4GN5A 5C0XJ 3K81C 3F2BA 3KF8B 4DV4L 4DR5Q 1HNZL 1R9TH 4DR4Q 1WCMH 2KBNA 2Q2HA 1LM0A 3RN5A 2UXDQ 1E1OA 2FXQA 3SGIA 3RN2A 4JYAQ 4LF9L 3DM3A 2F4VL 4DAMA 1Q86C 3RLNA 1RIPA 4GKKQ 3T1YQ 3PUYA 1XTDA 5FLMH 5AJ3Q 2EQSA 4R4OA 1N34L 1EFWA 3GTGH 2LSSA 3PF4A 2N8NA 1T9HA 4ME3A 2I0QA 3HOXG 3HOZH 4A3BG 2JA8H 1KHIA 4IFDJ 1HH2P 4EX5A 2RF4A 4JI5L 2ZTCA 1UE7A 1W2BA 1G6PA 3AFQA 1KIXA 2MFIA 1KRTA 4DV3L 3BZKA 2UU9Q 4L5TA 4DV5Q 3BU2A 4AYBG 4DUZQ 4P74A 1I94L 1VQ4A 1TWFH 2RCNA 3EN2A 5C3EG 5LMNL 1PH2A 1JE5A 2R7FA 4LUOA 3GTOH 2R93H 5C0XG 2BH2A 1JB7A 3KLWA 5IYCG 4L5QA 4LFCL 1Z47A 2OQKA 2N3SA 3CMAA 5H1SE 1NMGA 3PUVA
chains in the Genus database with same CATH superfamily
1DGSA 1NY4A 2Q2TA 4R4TA 4XQNA 1CKMA 4NKLA 3DMUA 4A3JH 4DUYL 2E2IH 1JR0D 1LT3D 3HOWG 3I8ZA 1KAAA 1TWAB 1CK1A 4OO1H 2K52A 3P75A 5TSSA 4APVA 1EYGA 4RAUC 2KHIA 3CCJA 3TREA 2YYZA 4C3JH 3ICEA 2JA8B 1QZGA 1D1IA 1XWEA 5CC4A 4K8JA 1B50A 1GHKA 4A3LH 1LTGD 4LF5L 2F0GA 4DR6L 3GTKH 2D5DA 1K0RA 1WCMB 4UP8A 5BR8Q 3QWNA 2F4VQ 1O7LA 5IODA 2D2CC 3Q0AA 3JAML 4NW2A 4BS9A 4IJLA 1Y1VH 3G71A 4DR5L 3RD4A 1TY0A 4K2KA 5M5YB 2HHHQ 1Y14B 1G291 3C1FA 4JOIA 4ZK9B 3I4MB 2RSNA 5EKIA 1W6KA 4HJAA 4FO2A 3NQIA 3CQZH 3MEFA 4MNOA 4OXPA 1EY7A 2L1BA 4DR3L 3CPWA 3CP0A 1YITA 3F2UA 5CV7A 1QOHA 5D65A 1L1OA 5FLMG 3CCEA 2HIVA 3J81L 2AUJD 1K8AC 3M4OH 1VQ8A 4JK1C 1S5DD 4O2DA 4DUZL 1T5XD 4HSPA 3BVMA 1KRSA 2Y0SB 3C1EA 5JOBA 1HQRD 1SJHD 2BDNA 3A5ZB 4RCOA 4GZYC 2VXWA 4ABNA 1PH7A 5T1IA 1MHWC 4DR2Q 1GUWA 1GHJA 2BDOA 2JA7G 1HR0Q 3H15A 2G5DA 3NTIA 4HAEA 5JPNC 4QMGA 3HOXH 3HOZG 2IPKD 4AYBE 3GTQH 5LL6X 4JG2A 4R9WA 2K01A 2R7DA 2QEXA 1B8AA 1PHJA 5KYLA 1OXTA 3KDFB 3CCVA 2GVAA 1STGA 3OW2A 3T13A 2R92H 2O2LD 3R93A 1HTLD 4BXXH 3GV3A 5EPKA 5HGTA 4Y7NB 1JCKB 4POGA 1Y1VB 4A3JB 3DHQA 5HGQA 1LLRD 1E1TA 4QJFA 4IUUA 1PRTC 2EY1A 1SE2A 3TZDA 5ELDA 1PRTF 4KV6A 1EIYB 4QCLA 1FVIA 4IQZA 1MD2D 4A3DB 1BBWA 4KLKA 4YCWA 2EZVA 3U9SA 3TDQA 4IFDH 5JEAG 5C4JB 2Q8IB 1TS3A 3URYA 1QWYA 4E6IA 3S1QB 3O13A 3R2TA 1QILA 1KC8C 4BWGB 4QB4A 2FJ2A 5IGGA 2IHEA 4A3FH 3FP9A 4X66L 3TS2A 3DUZA 2RBMA 3NK9A 2B63H 2WB1G 2UUAL 2KA7A 1I4XA 2RCFA 3M4YA 4ZAIA 5KGUA 2WP8J 4YY3L 1CTMA 1K0SA 4JI4L 4DK3C 5ELFA 4P75A 1I3QH 2G9HD 1F77A 2H4OA 5EBDA 2WINB 3NELA 2M9VA 3J7AV 5M3MG 1X6OA 4JBMA 2N78A 1XYIA 4BY1G 2E2JB 2R93G 4B3SQ 1BCPB 4DK0A 4WJ3M 1EQRA 4MIUA 4MN3A 1FL0A 4DN4M 1JOKA 2PQEA 3DLLA 4LF4Q 4M1UB 1SNMA 1PYSB 3MAQA 2PYKA 1AEXA 4H44C 2QEJC 4A3MH 1IZ6A 1EYCA 4DPGA 4CDFC 1IL8A 2F1MA 1YVCA 1V8QA 2YU9H 3MXUA 1RL2A 1X3QA 2BE5C 3D4WA 1JOQA 1JE4A 4CDDC 5A35A 2VNUD 4NP5A 3CKIB 3HZXA 1J5EQ 3I56A 1KTKA 1L0XB 1SNOA 4IPDA 5D3DA 3VYTA 1BXTA 4RG1A 4OELB 1SAPA 4CGYB 3DXJC 1N36Q 3NBIA 3TQYA 3KBGA 2PNHA 3IL8A 2Y0SE 1YJNA 4RHRA 1SNQA 3I90A 4B3RL 4OWTB 1MI2A 4X6AH 3FPUB 1I4QA 4FVMA 4OL7A 3OYYA 1DXMA 4HIDA 1Z7TA 2EE1A 1BF4A 2AHOB 2AWNA 5FO8B 5A2QE 1STYA 1U4PA 3I4NG 1YHBA 2EJFC 1IL2A 3TP8A 4XDXA 1M90C 2B63B 1RODA 1DONA 4KY5A 1Y8OB 2ZJPA 4A75A 2UUBQ 1I6VC 5I4DA 3UDFA 1HNXL 2UXCQ 3FRPB 1BBUA 2L12A 1SR3A 4YCUA 1U0LA 1VQBA 4QY7A 4Z9CB 4R4CA 3RUZA 3S15B 1CZGA 3HKZG 3PV0A 1RF2D 4KD4A 2VS1A 5IIFA 4R4IA 3S1MB 1JMCA 5E7NA 2B2UA 3KLRA 2DJFC 3PO2B 1S4ZA 3H0GB 1NJIC 3HOVG 4Y7NH 3CW2C 1GM5A 2OEOA 4JYAQ 2C35B 3H09A 4GNXC 1H9KA 1Q7YC 1JJCB 5IGBA 2D0PA 3QOLA 1VQ6A 1IKLA 4V190 3QO2A 3QIAA 2F3VA 1M8AA 1X3GA 1WI5A 4DV5L 2E5LL 4IPCA 4JI3L 4DV3Q 2NZ1D 4A3FG 4YIJA 3CCQA 4K6LA 2A68D 1CQFA 1Q12A 3LWEA 3J7A5 2XWJB 4HMIA 1O80A 1IBLL 4JI7Q 3UE1A 1S40A 3G7LA 1BQQT 4IFDG 2B2YA 4DV1L 1K9MC 5GAHC 5M3MH 2AQ1B 4JI6L 4PMBA 4A3CH 3A7AB 4KKSA 2JA5H 4RCNA 3IAYA 1EY6A 4OIKA 3D6CA 3KF6A 5M3FG 1GVPA 2E2HH 2NVYB 3Q6SA 1TKWB 2GN5A 2DY8A 3S1RB 3VR6A 1WOCA 1Q81C 1UE5A 1CFMA 4K0KQ 2NUCA 1TQOA 1LTID 1MIUA 3T16A 2PMZE 2NVQB 4KK7A 4HCSA 5KEEA 3RNUA 4KTAA 5C4XG 2L55A 3GTKB 4QF4A 1G91A 3NBHA 1DM0B 4OO1G 4YY3Q 5I9OA 3K57A 3X3MA 1A62A 1I6HB 5J1ZA 2CKZB 1AP0A 1JT8A 2F0FA 3OW7A 4K0KL 1DD2A 2E8GA 4XXEA 3RR5A 4L5SA 1L0YB 3PGZA 4RKBA 1RCVD 4XYOA 2CQOA 4R1JA 1JOOA 1N33L 1ASYA 2H5XA 1R9TB 3HOWH 3K5OA 3UDGA 3W5OA 4X3UA 5DM63 1LT6D 2JA6G 2R7ZH 1VQ9A 3AQQA 4MTNA 4JYAL 3S1NH 4B3ML 4OHJA 4A3GG 1HNZL 3GTJH 5C0XJ 4C56C 4DR4Q 3KLSA 3RN5A 1LM0A 3RN2A 3DM3A 2F4VL 4DAMA 1Q86C 1EOTA 1RIPA 1Y8PB 3RZOB 1AFPA 2N8NA 3MHBA 2EYOA 4WJWA 3HOXG 3HOZH 4A3BG 2JA8H 3SK6A 1PFNA 1HH2P 2L0CA 2ZTCA 3OPOA 1KRTA 5C3EB 1TS2A 5K5PA 4L5TA 5HURA 5COYA 2I46A 5FLXL 1I4GA 1VQ4A 5C3EG 3U9OA 1PH2A 3GTGB 1JE5A 3TMEA 2F0PA 1HUMA 1JB7A 3HOYB 2HD3A 4LFCL 2OQKA 3S14B 1LTAD 3C46A 4OEMB 5I6YA 3HOWB 4HIKA 4IPHA 3P7JA 1BVSA 3CCUA 4H7BA 2PI2E 2UXCL 1EY9A 1N9WA 5EKKA 1SFOH 2B3GA 2PW7A 3A8JE 4PQXA 4LW1A 5JVH3 5IGDA 2O4XA 3S24A 1FR3A 2JEAI 1GJXA 1PTOH 4JVZA 2EJGC 3AU7A 4IZ8A 2EYMA 3W1GA 1XNRQ 2JA6B 1B2TA 4LF7Q 2EYJA 4YCVA 1VQCA 4A3CG 5J3BA 1BCPD 2KQ3A 1F2YA 3F1ZA 2TMPA 2CH4A 4AYBB 1G6ZA 1A0IA 2GA4B 1VQFA 1D5ZC 2N88A 1TWCH 1M1KC 3HOUB 1AE3A 3BYTB 4DA2A 1RTNA 5IYBH 1SYCA 4KJOA 3SR1A 2BOSA 1PFMA 1GD7A 1KXLA 3HOUG 1B53A 1IBKQ 1ENCA 5C4XB 1PYBA 3U58A 4LUZA 1HNZQ 1O78A 1PRTB 2IHFA 3WDNA 1VQLA 4C3IG 2HHHL 2KHSA 4K8IA 4C3HB 2Z8LA 4U673 5ISRA 5C0XH 4RA8A 1WTVA 1QVFA 2HT1A 2CW0D 3PQIA 2IL8A 2UUAQ 2NVYH 4XQJA 3BZCA 4QIWB 1TXYA 5EQ0A 5AJ3L 1N34Q 3HFZB 4BBSG 3OSOA 5KIXA 3G6EA 1PMRA 5JVG3 2MO0A 3R2IA 1X65A 1Q82C 4L8JA 1EU3A 5DEHA 5FO7B 4FF3A 2YTXA 3Q24A 4OWWB 3E9IA 3EA6A 4KI0A 2CH4W 1Y1WH 4GOPB 5KYIA 4BA1I 4NXML 1F2ZA 2Z0SA 3TZUA 5IGEA 5M5YH 3D4DA 1H9MA 4ZCKA 5EJWA 2QGQA 1XPUA 3TSSA 2KCCA 2K75A 3CF5A 1TT2A 2JE6I 2PZUA 5JAVA 1ET9A 2UU9L 1B3QA 1YNXA 1QVCA 2BCOA 3M7GA 5BN4A 2B8FA 3FMCA 4JI3Q 3HOXB 3KJOA 1SNCA 5FLXE 2J4XA 1ONLA 4RMFA 4K6DA 4DV2L 4JV5L 3ER0A 2KENA 1BR9A 2ZT9C 1VQ7A 5KNCA 1PFSA 4PMWA 4BY7H 5G3LF 1X54A 3L9AX 3G48A 2KJXA 1CA5A 2JJQA 1RHPA 1VS0A 4A3IH 4IUTA 3S14H 4HIOA 3HOVH 1GUTA 3HKZE 2O5JC 3I3CA 3CAMA 4ZYSA 1LT5D 2DJGC 4DKAC 3RMHA 4CJ0B 1OXXK 4HSVA 3H91A 4X64Q 5C5LA 1FNVA 1I5FA 1BBXC 2ES2A 2RDFA 2QILA 1TWGB 1W3SA 4DV6L 2Q8RE 1IBML 2IX0A 4H13C 4X62L 4A3EG 3PIPA 1SYDA 1ILPA 5IE8A 1GUGA 3PO3B 4LNQA 4P72A 4RFBA 3L7ZC 1DOKA 5EGTA 1F9PA 1V1PB 4B3TQ 1STBA 5EBCA 5M3FH 3DWQA 3Q23A 4YWMA 2IWHA 1SYBA 4DV6Q 1U4MA 4DV7Q 2OT2A 3OTOQ 5M5XH 2AKWB 4OONA 4RHSA 3Q22A 4PZ8A 5IYBG 1SDFA 3K8AA 4TKOB 2CWAA 1P16A 3AFPA 1NUCA 5IYDG 4DXGA 3MZ5A 3J81c 1WD0A 1TWFB 1Z9FA 1YIJA 3B6YA 1KQSA 5DNFA 2JA6H 2DNCA 2MQHA 1F2LA 4IFDI 5LMUL 2RA4A 4X3KA 4F7XA 2E76C 4YWLA 1BCPF 4DV7L 1KL9A 3LWUA 1Q8IA 2HDLA 4JI6Q 3GP7A 1K83B 4NXMQ 4DV1Q 1MJEA 4A93G 1E2WA 4LF4L 2R61A 4G7OC 5ELCA 3SDZA 5C3WA 2F0UA 4A93H 1N32L 2BE5D 2JSOA 3I55A 4DR3Q 4A3MG 3CRLC 2F4IA 2PQAA 2H1EA 1MKHA 4C3IH 2VY3A 2R93B 2J7ZA 3OMCA 4IOCA 1WJJA 2LXKA 4ZRZA 4A3FB 1KAWA 3FVQA 2GVBA 1JJ2A 3BDOA 3I91A 3VDYA 1V1OA 2QCPX 2EVBA 1T5EA 4IUQA 4A3KB 5E4XA 4PZ7A 3IFDA 1J5EL 1HTPA 3GTJB 3A56A 1TIID 5IYCH 1X3FA 2EYLA 1NNXA 2KECA 1EWCA 3MA2B 1XPRA 4X3TA 5JEAJ 2YTVA 2CCZA 3E9HA 3H0GG 1WFQA 4QUCA 3VR2A 3A5UA 4CDEC 4J8QA 2F52A 1EEID 1SBBB 2BH8A 1XPOA 3CMEA 3NQTA 5M5WB 1SXTA 2OQ0A 2PQAB 3K5LA 1K8MA 5F2DA 2HDMA 2OWOA 2JA9A 1JORA 5JJLA 1ZXTA 1C9OA 1XJVA 1KNEA 4X62Q 2KCNA 4JBWA 4OIJA 4CKEA 4GKJQ 1IYUA 1SE3A 5ELNA 2UXBQ 2NN6H 5ELOA 2NVQH 4H02A 4LFBL 1NR4A 4RGTA 1RJTA 4Y52H 4DUYQ 4YHHL 1K83H 3J80i 3FKIG 2F0HA 4JI0Q 3K80C 2EY6A 2F0JA 1K73C 1PH1A 3GTMH 2VQFQ 1YJ9A 1VQOA 3SEBA 1FNUA 3VA7A 2FMCA 1YEZA 1QCBD 1OTCA 2PZTA 3PUZA 3CCSA 4A3KG 3U4ZA 4MTKA 1PZKD 1PH3A 4EQOA 4JPBW 5C5MA 5M5XB 3ITPA 4IO9A 2JK8A 2CWPA 1K8GA 4LK1C 2MUYA 2JP1A 1C0AA 1EYAA 2F0SA 3BJUA 5C0XI 3K7UC 2A6ED 4NB3A 2DNEA 1D2BA 4ZKBB 2RHSB 3NP8A 4GS3A 4IUVA 3CC7A 4HJ9A 4IN3A 1N32Q 4N8FA 2KEDA 5C6AA 4HN7A 1Y69U 3HGBA 2ZJRA 1LACA 4BY1B 4S3SA 5C3XA 3TRZA 3VYUA 1GKHA 3V96A 3TP5A 1DJRD 2XVSA 4G7ZC 5GAEC 1EOVA 2ZXRA 1PXUA 1XMQQ 1E24A 1CUKA 5AFWA 4JBKA 3KDFA 4FXKC 3SHLA 2SOBA 1N8RC 2K5VA 1EWIA 1ESRA 1JC7A 2XGTA 3EVQA 1ML0D 3FDTA 3M85A 3NPPA 3OIPA 3T1YL 3GTPB 2VZAA 3UI2A 2DY7A 1EWHA 1I4HA 3S9WA 4O0AA 4UAIA 1EQVA 3FKIB 4C2MB 2LXJA 1VQPA 1BCPC 2MO1A 3S2HB 1XNQL 3HOUH 1U4RA 4AQYQ 1XMQL 3S2DH 2I5HA 3VYSA 1HFNA 4LFBQ 1EFID 2ZXPA 2A69C 3S1MH 1JB3A 3WOFA 1D5MC 3BG3A 4HIMA 2Z4IA 1MSGA 1WD1A 2NTSA 1N33Q 1SE8A 2QA4A 4LF5Q 3BDCA 1HZ9A 2XIWA 3I2ZA 5E4WC 4X64L 5M5WH 4J1MA 4UP9A 1SFOB 3RZOH 3H0GH 4P73A 3R8BA 5LHY1 4C3JB 3AMUA 1PZJD 1ZKOA 2VB3X 4DV4Q 2PCFB 1OXVA 2XTIA 3ULJA 3NENA 1PV4A 2ZXOA 1V1QA 1B7YB 1PTOB 1Q1BA 5FOBB 1IYVA 5T1GA 4BBSH 4GLAC 4DR5Q 4DV4L 2E75C 2SEBD 4OGQC 4K14A 4M8AA 2CHBD 2PNRC 4N9PA 2B2WC 4KMUC 1A2UA 3VR3A 1FGBD 3TBIB 1XTDA 1EFWA 2LSSA 4BBSB 4I65A 1B9NA 1NCVA 4IFDJ 1DYQA 4EX5A 2RF4A 2SDFA 2X6GA 1UE7A 1W2BA 1G6PA 2UU9Q 1JWUD 5EPLA 4WRDA 3I72A 4DUZQ 4A93B 4UDUC 4P74A 1CI3M 2HCIA 2R93H 1EU4A 3HOZB 3H6MA 3KLWA 5IYCG 1KDAA 3PIO3 1Z47A 1DZ1A 1O7YA 2NVXB 5CBEE 3CMAA 5H1SE 3RLFA 1HR0L 1AW7A 2I5MX 2F0NA 4IALA 2IY5B 2F0EA 2M2LA 2F3IA 1I3QB 2JA5B 1X3EA 4RWSC 1HPCA 1XNRL 1JICA 1SE4A 1PH6A 1LYLA 3J80E 2DUDA 1UEBA 2XRQD 3MC0B 3VYRA 5NUCA 1WVLA 2LMCB 4A3LG 3PO3G 4Q0FA 5FO9B 1UEAB 2BA0A 1SYGA 1TWHH 2CVRA 3A0JA 3FEWX 4X3SA 4CKCA 4A3EB 3HOYH 5CORA 4CJ1B 1Q1EA 4KKTA 3D0FA 3WWVA 2KEEA 4RGOS 2VL6A 2K50A 3LX0A 3PUXA 4GN4B 5D3IB 4XTCS 1EYDA 4GLVB 2R6GA 1ENFA 2EIFA 2MP1A 2CW0C 1DOMA 1L2FA 1B4OA 2A19A 2KCTA 4DV0L 1E2VA 1RKNA 1YJWA 2UXBL 3I4MG 4C1NK 1JWSD 4FP5D 3HG9A 5JJZA 4JBJA 2OTLA 3GO5A 1HA6A 3D8GA 2EJMA 3K7AH 4BXXG 3MXNB 4IJHA 1OO9B 4DAVA 4A3BB 1D7QA 2OTJA 2VQFL 2Z4HA 3A54A 4KY7A 4JI0L 3CRKC 4A3IB 4HEDA 2WIIB 2F0QA 1KD1C 1V43A 1SNPA 1HNXQ 3L0OA 1I94Q 4LWCA 3RZDH 5BN3A 1IHZA 5JPMC 1BO0A 5JJIA 3FKIH 4C2MH 1QUQA 2KUMA 1EIGA 3MEHA 3V05A 1YI2A 4CBVA 1HHVA 4DNTB 4DAYA 1CT1D 5EAYA 2LKVA 2ZTDA 3I4OA 2L15A 4A3GB 5KNDA 1PH9A 3M4OB 1U4LA 3ND8A 3P1HA 1G51A 1FGUA 1ICWA 1LO5D 2B29A 1WTPA 1CKNB 2ID0A 4Q5VA 3I7FA 1HR0W 2LS01 2EYFA 4A3KH 4O42A 3IKJA 2JA5G 1QJOA 1PA6A 1AN8A 1ILQA 1NTGA 4X65L 3CPFA 3BDLA 3KOJA 4XT3B 1PTOF 1FJGL 1CKNA 5FKAC 3J80L 3E6ZX 4EQNA 5BR8L 1BUVT 5L37A 1X32A 3CCRA 5FJ8G 3GD7A 4R8IA 2K1BA 4BY1H 4GOPA 3M3YB 1PH5A 1A63A 1TWCB 4DAYB 2NVXH 4NXNL 1VQDA 3D6WA 4KN7C 4KN4C 2JA7H 3EBEA 4HR7B 1HZAA 2F0DA 5CR3A 4IURA 3DEPA 4OO1I 3I4MH 4HCEA 1PH4A 4BBRB 2RSOA 1VQIA 1HNWL 1PRTD 3M4QA 2ZM6L 3F2DA 4ME5A 3HEJA 2A73B 1I50B 3H3VC 3LGJA 5IP7G 4L6TB 3KJPA 4ILWA 2ZJQA 5EPJA 3ZYYX 1I4RA 1QNKA 4WFN3 3OTOL 5E1FA 1PTOD 3HOYG 4FXGC 2F0TA 5DAUA 2Q2UA 2JQOA 1TVXA 2PW5A 3N6RA 4F8MA 3BZDB 4QUFA 3HS0C 4DAPA 3M7NA 1RTOA 4DV2Q 3A74A 5KRUA 5KNBA 1IBLQ 4IUPA 3VA5A 3OIQA 4JI5Q 3G6JB 1F2MA 2WKCA 5CV4A 3M4PA 5K36H 1AH9A 4G7HC 2EYHA 4JI1Q 4GNXA 4ZQ3A 5IWAQ 4LMQD 2A5HA 2WV6D 2PPBC 4PZ6A 3OMGA 5JEAH 5ELBA 1LTSD 5I2XA 4KHPL 1PFBA 2RVLA 1SNDA 4AIMA 4GNXB 1EIFA 3E0JA 3S1NB 2B2YC 3HKZB 5D14A 4JV5Q 2IX3A 1VQHA 1CZWA 3U50C 3S2HH 2XN9C 3T51B 4DV0Q 1EY0A 4J15A 4BBRH 3MFYA 1F9SA 1VF7A 4OX9Q 2O5IC 3PUWA 5IT9E 1SMXA 2WACA 2ENBA 4LJZC 2UUBL 1H9SB 1Y8NB 1D5XC 2HQEA 2IJ0A 3NTHA 3S16B 4JC0A 1DCZA 5JJKA 1A2TA 1UWVA 1G8ZD 1I6HH 3CC4A 3MXPA 4XIGS 3G4SA 1QZHA 3KLSX 1YBYA 3GTPH 1YNJC 2BA1A 4LF6L 2JYOA 5C4ZA 2VQEQ 1O7IA 4B3RQ 3DWAA 3DM1A 1NSNS 4TRDA 3W2DA 5EKLA 4DR6Q 1I50H 3CCLA 5FLXc 3WOEA 1W6JA 3K0XA 1UE1A 2KVMA 4B3MQ 3SE0A 2VQEL 1NBWA 3AEVA 5IP9H 3W3AA 3KFUA 2A6EC 4EGVA 1HNWQ 1V9PA 1Q90A 3EQLC 1IKMA 5J22A 3S17H 1G2TA 2B2VC 1FD7D 5DLQE 4RH6A 1H95A 4IPGA 1II3A 1S72A 1DOLA 4ODGA 5C4XH 1PTOC 4TQUS 3FHWA 2VW9A 3K6OA 2V1CC 1BOSA 4UP7A 1YZ6A 4NPSA 2LFNA 2WAQG 4JI7L 1GUOA 1X55A 3FPPA 2XWBB 3PSIA 2F0KA 2E74C 1H9JA 4B3SL 3MVVA 4K5XA 3GV6A 4LFCQ 5M3MB 2L4NA 4ZUIA 1X56A 5I2YA 3ULPA 4GLXA 1RDPD 2B2WA 3QOJA 1TY2A 2E5LQ 3MXGA 4DXFA 2K5HA 4WORA 2RKSA 2B2TC 3DWPA 2F0OA 4K5VA 3TP6A 4QGUA 3NBHB 3E0EA 5I9PA 3QG1A 2WB1B 1ASZA 5GADC 4QIWE 3SK8A 2IW3A 1TS4A 2R7ZG 4F87A 1QUQB 3PO2H 1ZYRD 4FXDA 3PIOA 4POFA 5IWAL 3CHBD 3T1HL 3CQZB 2MHVA 1SN8A 2OF1A 2FFKB 1CSQA 1EL0A 2A69D 3IFTA 1SLJA 1AE2A 1EQTA 5ELEA 2EOTA 5FK9C 3H3VH 3NUCA 2EXZA 4YWKA 4ZKCB 4MHEA 1E7ZA 1GUSA 4UPAA 2VUMH 5IT9c 2AMCB 2B63G 4A3DG 2FHTA 5IGCA 3I4NB 4JI2L 5LMNQ 2N55A 1NR2A 3NEMA 1ET6A 5C3EH 5E3FA 2K14A 1VQNA 4GN3B 2M00A 3J7YW 3T56B 4A3JG 4WJ4A 2ZTEA 2Q8TA 1HZBA 1HRJA 4QQBX 2NB0A 2RHQB 3KF8A 3K5NA 1VQKA 3HKSA 1WYDA 5CYUA 2Y0SG 2NVTH 1GOZA 3T4AC 2C5CA 4BA2I 3IRBA 1YNJD 1C4QA 4HJ7A 4C3HH 1R4QB 1KNAA 4OWXB 2ICEC 2ZM6Q 4N8X1 1STNA 1D1KA 2FINB 3STBD 3BVZA 3LNNA 4DR1Q 3QB3A 5LMUQ 4GN5A 3F2BA 3KF8B 3EROA 1R9TH 2KBNA 3OWFA 2UXDQ 1E1OA 2K5QA 2FXQA 3SGIA 3RLNA 1JQYD 1B3AA 3T1YQ 3ND9A 1CQVA 5AJ3Q 4R4OA 4CHTB 1N34L 3PF4A 3QJYA 1S5BD 4ME3A 3P20A 3TP7A 2I0QA 4B9XA 4CKBA 3GTOB 5IOCA 1KIXA 3V2TA 2MFIA 1HUNA 1LTTD 2EY2A 3BZKA 4UHVA 3BU2A 3NHHA 3PIP3 4I7AA 1MSHA 4EQPA 4NDXA 1TWFH 3GTOH 1A3VA 3TN2A 5C0XG 2L5TA 4L5QA 3KK7A 2XNAC 2F0WA 1NMGA 3PUVA 4CJ2C 1X3PA 3PF5A 2Z1CA 1HFGA 4A76A 3NXWA 2UXDL 5IP7H 4DK1A 2HQLA 2A8VA 1U5KA 1XX8A 4KHZA 1KABA 1WTWA 1OXUA 4P2CB 3S1QH 1I4PA 1SMYC 3PO3H 1VQAA 3E5SA 1EZ6A 4O1NA 2B39A 3EJIA 2D9UA 2XSCA 4KHPQ 3J81j 1EY8A 1L1OB 4PV1C 2NWGA 1EUJA 3M3YH 1UAPA 4B9WA 2D62A 4GKJL 1CSPA 4C1NI 3K0YA 4GOPC 3GDEA 4PMCA 3I4NH 2E2HB 1B44D 4FDBA 3OHXC 5FJ8H 4FF4A 2Z9HA 1QVGA 3CXCA 2K05A 1A3UA 4DR2L 4HMJA 1VF5C 1IXRA 2WAQE 1E0BA 1Y1VG 1EY5A 3MFGA 1GO3E 1HCZA 4IUNA 4JI4Q 1ICFB 1EQQA 3L2PA 3JAME 3J81i 4G57A 1VMPA 2MJ8A 5DM73 5HY6A 1WTHA 4L63B 1YHQA 3ONAB 2QF7A 3NSWA 1QE6A 1BNZA 3K5MA 5GROA 1PH8A 2N49A 3Q8DA 4C3JG 3GTQB 5IYDH 4JI8Q 1EY4A 1KDBA 4DNIA 1UUPA 4LF8L 1YHAA 2JA7B 2FMMA 5A2QL 2K03A 2A1AA 4DR4L 3R3OA 1A15A 3KF6B 4LUVA 1VQ5A 2F0VA 5CBAE 4DU9A 5C44H 3K59A 4A3BH 4G4KA 1EEFD 1NE3A 2PMZB 4L5RC 2K33A 3I70A 4XYQA 2D0OA 4KJNA 2K5WA 5LL6S 3H94A 1IYJB 1GXDC 1B9MA 3NTKA 5IY0A 4FYDA 4MZ9A 1EZ8A 1LV9A 5C44B 1TWHB 2Q2IA 1HA5A 4U68A 5IT9L 5CV9A 3KUPA 1XTCD 2Z6KC 2WAQB 4FF1A 1QNUA 1B70B 2HIXA 3K7AB 4OX9L 4LFAL 2AQ3B 4LF8Q 2K6AA 3GTLH 3K58A 2E2DC 4RKLA 1D6EC 4LF7L 1NMFA 3I73A 2HUGA 3C2PA 2K5DA 1LT4D 2MNAA 4V0BA 1SMYD 3RZDB 4XT1B 4LFAQ 4EQ5A 5LMNW 2YTYA 4DR7Q 4NXNQ 1K3RA 3BYYB 1WCMG 3J81E 3TEHB 4LF6Q 1V1PA 3A55A 1FJGQ 1NAPA 2YV5A 2NYZD 3ZJYC 4DR7L 5I6WA 5K36G 4NMZA 3OWEB 4X65Q 1XMOQ 4B3TL 2YU9B 1S5FD 4FNFA 2EXDA 1PYWD 2ASBA 2JA8G 1LTRD 1TR5A 5M9OA 4JI2Q 1K3BC 1JJGA 1SRUA 1BKBA 1LUZA 2JXMB 1Y1WG 3C3LA 1SYFA 2EY5A 2JN4A 1XMOL 1FNWA 4R4QA 1OXSC 2PI2A 1KDCA 3UE0A 1S3OA 3PMFA 1Z6HA 4TSSA 4AH6A 1MJCA 1D8LA 3EIVA 1EIHA 2K7VA 2LY7A 1G2SA 1Q46A 2RDHA 4JI8L 3CD6A 2MGSA 3BS1A 1H9RA 4YHHQ 2XRSD 4FF2A 2DN8A 1Q3LA 2NTTA 3D31A 1S5ED 3J7ZC 3SVMA 1ESFA 3A8KE 1VQGA 5C4JH 1TWAH 1E3PA 3BVGA 3J80c 3I4LA 2QDBA 3VR4A 4DFAA 1SJED 2OXPA 1J9OA 4JI1L 2WB1E 1Q8KA 5G3LD 3CCMA 4KD3A 3QR8A 2F0IA 5CMDA 2B2TA 2KOLA 1J8IA 3H3VI 3W1BA 4BY7G 3JC66 2WKDA 2P5ZX 2HCCA 1C7YA 1SEBD 3UDXA 2ALYB 1C8CA 4A3DH 2R7ZB 4LF9Q 4RGMA 4GKKL 3D4RA 3J7AF 4ID6A 4ALPA 4JOIC 5IP9G 2NZHA 4EVOA 1HZCA 5CV6A 3ULLA 1PLFA 3F8TA 1E22A 1A6XA 2R3ZA 3SK4A 3F2CA 3X3NA 4N9TA 3JAMi 5C4HA 1FYCA 1N36L 4HJ5A 5M3FB 4ULLA 1VQMA 3HRZC 1YNND 2AWOA 3ERSX 4A3MB 2SNSA 4ZUJA 4BBRG 3CU7A 3N52A 1UE6A 1RD9D 2ICIA 3TS0A 2KHJA 1S5CD 2UUCQ 3GTLB 1TWGH 1P8LA 2L9HA 3NWTA 2NVTB 1AZQA 1IBKL 1GUNA 1L0WA 1PVOA 2E2JH 3JAMc 1B1ZA 1VQJA 2IT1A 1SYEA 3OOCA 1STHA 3NE5B 4QL5A 3GQBA 1MBYA 4UY8C 1CHPD 2OCEA 1IW7C 2F03A 4B08A 2EPBA 3A7LA 3STBC 1STEA 4ZLTF 4R8NA 2PZWA 1LTLA 1K28A 1HJPA 2B8GA 5BN5A 3S1RH 2DGYA 2Z6KA 1U9RA 4K2LA 2NN6I 3NWSA 4A3GH 2R92G 4PG3A 4XQQA 3E3XA 3GTMB 1SSOA 2VB2X 5CV8A 5CV5A 3HOVB 4TVAB 2VUMG 5CGKA 3PO2G 3U4VA 1X9NA 2QKIC 1CHQD 2K4KA 3RLOA 1QB5D 4H0LC 1IBMQ 3M9BA 4X66Q 1A8VA 2A6HD 4BY7B 3L3OC 1VDZA 4DNRB 2X6LA 3SK5A 2Z6BA 1WTQA 3S2DB 4JW0A 4PNYA 4HTHA 5IGFA 1LTBD 3S15H 2KCMA 2NZOA 1Y1WB 2I5LX 3T53B 3HP3A 4P71A 3SXHA 4I7ZC 3CC2A 1ZYRC 2WFWA 2J0TD 2A74C 1WTOA 3KYHC 2VUMB 1SROA 2AUKA 4CDCC 1H9SA 1XXGA 2RDGA 2R92B 5J39A 3VR5A 5GQOA 3AB9A 2MPMA 4A3IG 2K28A 2TSSA 5GAGC 2K32A 2K5NA 4K5WA 3MXNA 1AZPA 1VCIA 2IX1A 3T1HQ 2NBFA 1CKOA 1E2ZA 1R4PB 2F0LA 1ENAA 2NN6G 3PCOB 1F9RA 2I07B 1A3TA 4HJ8A 3DEOA 2F0MA 1KLGD 1YNNC 1J6QA 1VMCA 2QW7A 4A4IA 2CQAA 2SNMA 4AQYL 1L1OC 2UUCL 1XNQQ 3S16H 1WTXA 1JWMD 3AYHB 1UNSA 1PDQA 2K04A 3S17B 1M4VA 4IOAA 3MWYW 4KY6A 2EDGA 5C44G 1HQMC 4A3EH 1F9QA 3UDIA 2CFMA 2JEBI 1O7ZA 4JCVE 3A8IE 2PO4A 2ATWA 4F88A 4DF7A 1ZEQX 4DR1L 4J6HA 1IW7D 1C48A 1PZID 4DK6C 4DGZA 2V4DA 1STAA 1VQEA 2L11A 1CA6A 4C3HG 1BDOA 1LABA 3K81C 4C3IB 1TU2B 1WCMH 2Q2HA 2B2VA 1KLUD 4LF9L 4GKKQ 3MTSA 2EYPA 2QDLA 3D3RA 3PUYA 5FLMH 2EQSA 3GTGH 1MGSA 2F3WA 1T9HA 3KBXA 4KKUA 1KHIA 4JI5L 2A6HC 3AFQA 1CM9A 4KHVA 4DV3L 1WTRA 2X69A 4DV5Q 2AQ2B 4AYBG 3EFXD 2A68C 1I94L 1TS5A 4LAAA 2RCNA 3EN2A 5LMNL 2C9OA 1QG7A 2R7FA 4LUOA 2BH2A 2E2IB 1HXYD 1K8OA 2RQXA 2G9DA 2N3SA 4RGNA 2B2UC 3ERQA
chains in the Genus database with same CATH topology
3PF5A 1DGSA 1NY4A 4HIKA 4IPHA 3RLFA 4A76A 2Q2TA 4R4TA 1HR0L 1BVSA 2I5MX 5IP7H 2UXDL 2HQLA 1CKMA 3CCUA 2A8VA 1U5KA 4KHZA 2IY5B 2PI2E 2F3IA 4A3JH 4DUYL 2E2IH 2UXCL 1N9WA 1SFOH 3HOWG 1OXUA 2B3GA 4LW1A 1X3EA 3S1QH 3PO3H 3S24A 2K52A 1VQAA 2JEAI 1XNRL 1PH6A 4APVA 1LYLA 4KHPQ 1EYGA 3J81j 2DUDA 2KHIA 3W1GA 1L1OB 1UEBA 3CCJA 4LF7Q 1XNRQ 4B3RQ 4YCVA 1EUJA 1VQCA 3TREA 3M3YH 3PO2H 2D62A 2YYZA 4C3JH 1CSPA 5J3BA 3ICEA 4A3LG 4A3CG 3PO3G 4GKJL 4GOPC 2BA0A 3A0JA 1TWHH 3F1ZA 3GDEA 1QZGA 3HOYH 3I4NH 1A0IA 1VQFA 1Q1EA 4FDBA 3D0FA 5FJ8H 3WWVA 1TWCH 1QVGA 2VL6A 1M1KC 4A3LH 2K50A 3PUXA 1AE3A 3CXCA 4LF5L 4DR2L 4GN4B 4DR6L 3GTKH 4XTCS 4GLVB 5IYBH 2R6GA 1IXRA 2WAQE 1K0RA 1Y1VG 4UP8A 2EIFA 5BR8Q 1GD7A 2F4VQ 3HOUG 1KXLA 1IBKQ 1GO3E 1L2FA 2A19A 2KCTA 4DV0L 4JI4Q 1YJWA 2UXBL 3I4MG 1PYBA 3G71A 3U58A 4IJLA 1Y1VH 4LUZA 1EQQA 4DR5L 2IHFA 3L2PA 1HNZQ 1VQLA 4JBJA 3J81i 2OTLA 2HHHL 3GO5A 3K7AH 1QVFA 4BXXG 5HY6A 3MXNB 2HHHQ 1Y14B 2HT1A 1YHQA 1G291 2UUAQ 2NVYH 4IJHA 3BZCA 4JOIA 1TXYA 4HJAA 5AJ3L 1N34Q 1D7QA 5GROA 3CQZH 3HFZB 2N49A 3Q8DA 1PH8A 4BBSG 3MEFA 4JI8Q 4MNOA 4OXPA 2OTJA 4DNIA 5IYDH 4LF8L 1YHAA 2VQFL 3G6EA 2A1AA 2MO0A 4JI0L 4DR3L 3CPWA 3CP0A 4DR4L 1X65A 1YITA 1Q82C 3KF6B 4LUVA 2YTXA 1L1OA 1VQ5A 5FLMG 3E9IA 1KD1C 4OWWB 1V43A 1HNXQ 3CCEA 4KI0A 5C44H 4A3BH 2HIVA 3L0OA 1Y1WH 4GOPB 1K8AC 1NE3A 4BA1I 1I94Q 4NXML 4L5RC 3M4OH 1VQ8A 2Z0SA 4LWCA 5M5YH 2D0OA 1JT8A 4O2DA 3RZDH 1IYJB 4DUZL 2QGQA 1XPUA 5IY0A 2K75A 1KRSA 4MZ9A 3CF5A 2JE6I 3FKIH 4C2MH 2UU9L 5JJIA 1YNXA 1QUQA 1QVCA 3A5ZB 2Q2IA 1YI2A 1PH7A 4DR2Q 4JI3Q 2Z6KC 3KJOA 1B70B 4RMFA 2HIXA 2JA7G 5EAYA 1HR0Q 4OX9L 4DV2L 4LFAL 3H15A 4LF8Q 2ZTDA 3I4OA 2L15A 4JV5L 3ER0A 3GTLH 1PH9A 1G51A 2KENA 1VQ7A 3HOXH 1FGUA 1PFSA 2B29A 3HOZG 4PMWA 1CKNB 2ID0A 4AYBE 4LF7L 4BY7H 3GTQH 1NMFA 1X54A 3G48A 4JG2A 3I7FA 1HR0W 2JJQA 2R7DA 2QEXA 4A3KH 1B8AA 2MNAA 1PHJA 1OXTA 1VS0A 4A3IH 2JA5G 3KDFB 3S14H 3CCVA 4HIOA 1PA6A 3HOVH 2GVAA 3OW2A 1NTGA 4LFAQ 4EQ5A 4X65L 3CPFA 3HKZE 3KOJA 2YTYA 5LMNW 2R92H 4DR7Q 4BXXH 4NXNQ 1K3RA 3CAMA 4POGA 1FJGL 1WCMG 1CKNA 3TEHB 4DKAC 4LF6Q 5HGQA 1E1TA 5BR8L 1OXXK 4X64Q 1FJGQ 3CCRA 4QJFA 3GD7A 2YV5A 5FJ8G 4BY1H 1I5FA 3ZJYC 4GOPA 2ES2A 1PH5A 4DR7L 5K36G 4X65Q 4DV6L 1W3SA 1XMOQ 4B3TL 1A63A 2EXDA 4DAYB 1IBML 2NVXH 2IX0A 4NXNL 1EIYB 2ASBA 1FVIA 1VQDA 4X62L 4A3EG 3PIPA 2JA8G 1BBWA 4KLKA 5IE8A 2JA7H 4YCWA 3EBEA 4P72A 4LNQA 4JI2Q 3L7ZC 1JJGA 1HZAA 1SRUA 1BKBA 1LUZA 5JEAG 4B3TQ 4OO1I 3I4MH 1PH4A 5M3FH 1Y1WG 1VQIA 1HNWL 4YWMA 3M4QA 4DV6Q 2ZM6L 3F2DA 1XMOL 4DV7Q 4R4QA 1OXSC 2PI2A 5M5XH 3OTOQ 2AKWB 3LGJA 4OONA 3UE0A 1S3OA 4PZ8A 5IP7G 5IYBG 3KJPA 3K8AA 1KC8C 4AH6A 3EIVA 1MJCA 1D8LA 2ZJQA 2IHEA 4A3FH 3FP9A 2CWAA 4JI8L 4X66L 1P16A 1Q46A 3AFPA 3CD6A 3TS2A 5IYDG 4YHHQ 3J81c 1Z9FA 3OTOL 1YIJA 3B6YA 1KQSA 2B63H 2WB1G 2UUAL 2JA6H 2MQHA 3HOYG 4IFDI 5LMUL 3D31A 4YWLA 3J7ZC 4DV7L 1KL9A 2Q2UA 1VQGA 2WP8J 2JQOA 4YY3L 5C4JH 1TWAH 1E3PA 3J80c 4JI6Q 4JI4L 4DK3C 4P75A 1I3QH 4NXMQ 4DV1Q 1MJEA 4A93G 3NELA 4JI1L 1X6OA 5M3MG 2WB1E 4LF4L 1Q8KA 3M7NA 4JBMA 2N78A 3CCMA 4DV2Q 4BY1G 3A74A 2R93G 1IBLQ 4A93H 4B3SQ 1N32L 4JI5Q 3I55A 4DR3Q 4A3MG 4WJ3M 1EQRA 2PQAA 3W1BA 3H3VI 1FL0A 1MKHA 3M4PA 3JC66 4C3IH 2VY3A 4BY7G 3DLLA 1AH9A 4JI1Q 4LF4Q 4GNXA 1PYSB 1C7YA 4IOCA 1WJJA 2LXKA 3UDXA 1KAWA 2ALYB 5IWAQ 2GVBA 1JJ2A 4A3DH 4A3MH 4LF9Q 1IZ6A 4GKKL 4DPGA 3VDYA 4ALPA 1YVCA 4JOIC 2YU9H 5IP9G 2NZHA 1RL2A 4PZ6A 4PZ7A 1J5EL 1HZCA 2VNUD 3ULLA 5IYCH 1X3FA 4KHPL 1J5EQ 3I56A 3F8TA 4IPDA 1E22A 4AIMA 4GNXB 4RG1A 1EIFA 1XPRA 5JEAJ 2YTVA 4JV5Q 1VQHA 2CCZA 3E9HA 3H0GG 3U50C 3F2CA 1N36Q 1WFQA 4DV0Q 3S2HH 3TQYA 3A5UA 2PNHA 1YJNA 2Y0SE 3JAMi 1N36L 2F52A 4J15A 4BBRH 4HJ5A 4B3RL 1VQMA 4OX9Q 4OWTB 2BH8A 1XPOA 4X6AH 2AWOA 3CMEA 3ERSX 3PUWA 2PQAB 2OQ0A 1SMXA 3OYYA 2UUBL 4HIDA 2OWOA 2JA9A 4BBRG 2AHOB 5JJLA 1UE6A 2AWNA 3TS0A 2KHJA 1C9OA 4JC0A 2UUCQ 1TWGH 1XJVA 1P8LA 5JJKA 4X62Q 4JBWA 1UWVA 3I4NG 1YHBA 1IL2A 1I6HH 4GKJQ 1IBKL 1L0WA 5ELNA 1M90C 3CC4A 2UXBQ 1PVOA 2E2JH 5ELOA 2NVQH 4XIGS 3JAMc 4H02A 3G4SA 4LFBL 1VQJA 2IT1A 1QZHA 2ZJPA 1YBYA 3GTPH 4A75A 2UUBQ 4Y52H 2BA1A 4LF6L 3UDFA 1HNXL 4DUYQ 4QL5A 2UXCQ 1BBUA 4YHHL 1K83H 1SR3A 1O7IA 1U0LA 1VQBA 4YCUA 3FKIG 4QY7A 3J80i 2VQEQ 3K80C 4R4CA 2OCEA 4JI0Q 4UY8C 4DR6Q 1I50H 1K73C 1PH1A 3CCLA 3GTMH 2VQFQ 5FLXc 3HKZG 3PV0A 1VQOA 1YJ9A 3STBC 3K0XA 2VS1A 4R4IA 1JMCA 5E7NA 1UE1A 1LTLA 1HJPA 4B3MQ 2VQEL 3S1RH 1NBWA 3AEVA 5IP9H 2DGYA 1NJIC 1YEZA 2Z6KA 3HOVG 4Y7NH 3KFUA 1HNWQ 3CW2C 1OTCA 2NN6I 1V9PA 4A3GH 1GM5A 3PUZA 2R92G 4PG3A 2C35B 3CCSA 4GNXC 4A3KG 3S17H 3U4ZA 1Q7YC 1JJCB 2D0PA 4TVAB 5DLQE 1PH3A 2VUMG 1VQ6A 1H95A 4IPGA 3PO2G 3U4VA 1S72A 1X9NA 4IO9A 1X3GA 2K4KA 5C4XH 3RLOA 4TQUS 3FHWA 1WI5A 2CWPA 2JK8A 2VW9A 1K8GA 1IBMQ 1C0AA 3M9BA 4X66Q 1A8VA 3BJUA 2V1CC 5C0XI 4DV5L 2E5LL 4IPCA 4JI3L 4UP7A 1YZ6A 3K7UC 4NPSA 4DV3Q 2WAQG 4NB3A 4A3FG 4JI7L 2RHSB 1X55A 3PSIA 4GS3A 3CC7A 3CCQA 4HJ9A 4B3SL 1N32Q 1Q12A 3J7A5 4LFCQ 3S15H 1X56A 2KCMA 3ULPA 1IBLL 4GLXA 2NZOA 4JI7Q 2ZJRA 3UE1A 2I5LX 1S40A 4P71A 2E5LQ 3CC2A 3TRZA 1GKHA 2K5HA 2WFWA 4IFDG 5GAEC 1EOVA 1XMQQ 3KYHC 4QGUA 4DV1L 3NBHB 1K9MC 1SROA 3E0EA 1E24A 1CUKA 5GAHC 5M3MH 4JBKA 4JI6L 3KDFA 1ASZA 5GADC 4QIWE 1N8RC 4A3CH 2K5VA 1EWIA 5GQOA 2XGTA 2R7ZG 4A3IG 2JA5H 3M85A 3KF6A 5M3FG 1QUQB 5GAGC 1GVPA 3T1YL 3PIOA 2K5NA 4POFA 5IWAL 3T1HL 2E2HH 2VZAA 2GN5A 1VCIA 1SN8A 2IX1A 1CSQA 3T1HQ 4O0AA 1CKOA 1SLJA 1WOCA 2LXJA 1VQPA 1Q81C 1AE2A 2MO1A 1UE5A 2NN6G 1XNQL 3H3VH 3PCOB 3HOUH 4YWKA 4K0KQ 1E7ZA 4AQYQ 1XMQL 3S2DH 2I5HA 4HJ8A 1MIUA 4UPAA 2VUMH 5IT9c 2AMCB 2PMZE 2B63G 4A3DG 4LFBQ 3RNUA 1J6QA 4JI2L 5LMNQ 4A4IA 3S1MH 5C4XG 3NEMA 4HIMA 4AQYL 5C3EH 1L1OC 4YY3Q 4OO1G 1A62A 2K14A 2UUCL 1SE8A 2CKZB 1N33Q 1VQNA 4GN3B 1XNQQ 3S16H 2QA4A 4K0KL 2E8GA 3AYHB 4A3JG 4LF5Q 3RR5A 1HZ9A 4L5SA 3I2ZA 3PGZA 4WJ4A 4X64L 5M5WH 2ZTEA 4IOAA 4UP9A 1HZBA 3RZOH 3H0GH 4QQBX 4P73A 5C44G 2CQOA 2RHQB 4A3EH 1VQKA 3HKSA 1WYDA 4R1JA 2Y0SG 3UDIA 1N33L 1ASYA 2CFMA 2NVTH 4BA2I 2H5XA 2JEBI 4JCVE 3IRBA 3HOWH 4HJ7A 2ATWA 3UDGA 4C3HH 3W5OA 4DV4Q 4OWXB 1OXVA 2XTIA 3ULJA 3NENA 2ZM6Q 4DR1L 2JA6G 2R7ZH 1PV4A 1V1QA 1B7YB 1Q1BA 1VQ9A 3AQQA 4DK6C 4MTNA 4JYAL 1VQEA 3STBD 3S1NH 4B3ML 4BBSH 4DR1Q 5LMUQ 4A3GG 4GLAC 3GTJH 4GN5A 5C0XJ 3K81C 3F2BA 3KF8B 4DV4L 4DR5Q 1HNZL 1R9TH 4DR4Q 1WCMH 2KBNA 2Q2HA 1LM0A 3RN5A 2UXDQ 1E1OA 2FXQA 3SGIA 3RN2A 4JYAQ 4LF9L 3DM3A 2F4VL 4DAMA 1Q86C 3RLNA 1RIPA 4GKKQ 3T1YQ 3PUYA 1XTDA 5FLMH 5AJ3Q 2EQSA 4R4OA 1N34L 1EFWA 3GTGH 2LSSA 3PF4A 2N8NA 1T9HA 4ME3A 2I0QA 3HOXG 3HOZH 4A3BG 2JA8H 1KHIA 4IFDJ 1HH2P 4EX5A 2RF4A 4JI5L 2ZTCA 1UE7A 1W2BA 1G6PA 3AFQA 1KIXA 2MFIA 1KRTA 4DV3L 3BZKA 2UU9Q 4L5TA 4DV5Q 3BU2A 4AYBG 4DUZQ 4P74A 1I94L 1VQ4A 1TWFH 2RCNA 3EN2A 5C3EG 5LMNL 1PH2A 1JE5A 2R7FA 4LUOA 3GTOH 2R93H 5C0XG 2BH2A 1JB7A 3KLWA 5IYCG 4L5QA 4LFCL 1Z47A 2OQKA 2N3SA 3CMAA 5H1SE 1NMGA 3PUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PF5 A;  1DGS A;  1NY4 A;  4HIK A;  4IPH A;  3RLF A;  4A76 A;  2Q2T A;  4R4T A;  1HR0 L;  1BVS A;  2I5M X;  5IP7 H;  2UXD L;  2HQL A;  1CKM A;  3CCU A;  2A8V A;  1U5K A;  4KHZ A;  2IY5 B;  2PI2 E;  2F3I A;  4A3J H;  4DUY L;  2E2I H;  2UXC L;  1N9W A;  1SFO H;  3HOW G;  1OXU A;  2B3G A;  4LW1 A;  1X3E A;  3S1Q H;  3PO3 H;  3S24 A;  2K52 A;  1VQA A;  2JEA I;  1XNR L;  1PH6 A;  4APV A;  1LYL A;  4KHP Q;  1EYG A;  3J81 j;  2DUD A;  2KHI A;  3W1G A;  1L1O B;  1UEB A;  3CCJ A;  4LF7 Q;  1XNR Q;  4B3R Q;  4YCV A;  1EUJ A;  1VQC A;  3TRE A;  3M3Y H;  3PO2 H;  2D62 A;  2YYZ A;  4C3J H;  1CSP A;  5J3B A;  3ICE A;  4A3L G;  4A3C G;  3PO3 G;  4GKJ L;  4GOP C;  2BA0 A;  3A0J A;  1TWH H;  3F1Z A;  3GDE A;  1QZG A;  3HOY H;  3I4N H;  1A0I A;  1VQF A;  1Q1E A;  4FDB A;  3D0F A;  5FJ8 H;  3WWV A;  1TWC H;  1QVG A;  2VL6 A;  1M1K C;  4A3L H;  2K50 A;  3PUX A;  1AE3 A;  3CXC A;  4LF5 L;  4DR2 L;  4GN4 B;  4DR6 L;  3GTK H;  4XTC S;  4GLV B;  5IYB H;  2R6G A;  1IXR A;  2WAQ E;  1K0R A;  1Y1V G;  4UP8 A;  2EIF A;  5BR8 Q;  1GD7 A;  2F4V Q;  3HOU G;  1KXL A;  1IBK Q;  1GO3 E;  1L2F A;  2A19 A;  2KCT A;  4DV0 L;  4JI4 Q;  1YJW A;  2UXB L;  3I4M G;  1PYB A;  3G71 A;  3U58 A;  4IJL A;  1Y1V H;  4LUZ A;  1EQQ A;  4DR5 L;  2IHF A;  3L2P A;  1HNZ Q;  1VQL A;  4JBJ A;  3J81 i;  2OTL A;  2HHH L;  3GO5 A;  3K7A H;  1QVF A;  4BXX G;  5HY6 A;  3MXN B;  2HHH Q;  1Y14 B;  2HT1 A;  1YHQ A;  1G29 1;  2UUA Q;  2NVY H;  4IJH A;  3BZC A;  4JOI A;  1TXY A;  4HJA A;  5AJ3 L;  1N34 Q;  1D7Q A;  5GRO A;  3CQZ H;  3HFZ B;  2N49 A;  3Q8D A;  1PH8 A;  4BBS G;  3MEF A;  4JI8 Q;  4MNO A;  4OXP A;  2OTJ A;  4DNI A;  5IYD H;  4LF8 L;  1YHA A;  2VQF L;  3G6E A;  2A1A A;  2MO0 A;  4JI0 L;  4DR3 L;  3CPW A;  3CP0 A;  4DR4 L;  1X65 A;  1YIT A;  1Q82 C;  3KF6 B;  4LUV A;  2YTX A;  1L1O A;  1VQ5 A;  5FLM G;  3E9I A;  1KD1 C;  4OWW B;  1V43 A;  1HNX Q;  3CCE A;  4KI0 A;  5C44 H;  4A3B H;  2HIV A;  3L0O A;  1Y1W H;  4GOP B;  1K8A C;  1NE3 A;  4BA1 I;  1I94 Q;  4NXM L;  4L5R C;  3M4O H;  1VQ8 A;  2Z0S A;  4LWC A;  5M5Y H;  2D0O A;  1JT8 A;  4O2D A;  3RZD H;  1IYJ B;  4DUZ L;  2QGQ A;  1XPU A;  5IY0 A;  2K75 A;  1KRS A;  4MZ9 A;  3CF5 A;  2JE6 I;  3FKI H;  4C2M H;  2UU9 L;  5JJI A;  1YNX A;  1QUQ A;  1QVC A;  3A5Z B;  2Q2I A;  1YI2 A;  1PH7 A;  4DR2 Q;  4JI3 Q;  2Z6K C;  3KJO A;  1B70 B;  4RMF A;  2HIX A;  2JA7 G;  5EAY A;  1HR0 Q;  4OX9 L;  4DV2 L;  4LFA L;  3H15 A;  4LF8 Q;  2ZTD A;  3I4O A;  2L15 A;  4JV5 L;  3ER0 A;  3GTL H;  1PH9 A;  1G51 A;  2KEN A;  1VQ7 A;  3HOX H;  1FGU A;  1PFS A;  2B29 A;  3HOZ G;  4PMW A;  1CKN B;  2ID0 A;  4AYB E;  4LF7 L;  4BY7 H;  3GTQ H;  1NMF A;  1X54 A;  3G48 A;  4JG2 A;  3I7F A;  1HR0 W;  2JJQ A;  2R7D A;  2QEX A;  4A3K H;  1B8A A;  2MNA A;  1PHJ A;  1OXT A;  1VS0 A;  4A3I H;  2JA5 G;  3KDF B;  3S14 H;  3CCV A;  4HIO A;  1PA6 A;  3HOV H;  2GVA A;  3OW2 A;  1NTG A;  4LFA Q;  4EQ5 A;  4X65 L;  3CPF A;  3HKZ E;  3KOJ A;  2YTY A;  5LMN W;  2R92 H;  4DR7 Q;  4BXX H;  4NXN Q;  1K3R A;  3CAM A;  4POG A;  1FJG L;  1WCM G;  1CKN A;  3TEH B;  4DKA C;  4LF6 Q;  5HGQ A;  1E1T A;  5BR8 L;  1OXX K;  4X64 Q;  1FJG Q;  3CCR A;  4QJF A;  3GD7 A;  2YV5 A;  5FJ8 G;  4BY1 H;  1I5F A;  3ZJY C;  4GOP A;  2ES2 A;  1PH5 A;  4DR7 L;  5K36 G;  4X65 Q;  4DV6 L;  1W3S A;  1XMO Q;  4B3T L;  1A63 A;  2EXD A;  4DAY B;  1IBM L;  2NVX H;  2IX0 A;  4NXN L;  1EIY B;  2ASB A;  1FVI A;  1VQD A;  4X62 L;  4A3E G;  3PIP A;  2JA8 G;  1BBW A;  4KLK A;  5IE8 A;  2JA7 H;  4YCW A;  3EBE A;  4P72 A;  4LNQ A;  4JI2 Q;  3L7Z C;  1JJG A;  1HZA A;  1SRU A;  1BKB A;  1LUZ A;  5JEA G;  4B3T Q;  4OO1 I;  3I4M H;  1PH4 A;  5M3F H;  1Y1W G;  1VQI A;  1HNW L;  4YWM A;  3M4Q A;  4DV6 Q;  2ZM6 L;  3F2D A;  1XMO L;  4DV7 Q;  4R4Q A;  1OXS C;  2PI2 A;  5M5X H;  3OTO Q;  2AKW B;  3LGJ A;  4OON A;  3UE0 A;  1S3O A;  4PZ8 A;  5IP7 G;  5IYB G;  3KJP A;  3K8A A;  1KC8 C;  4AH6 A;  3EIV A;  1MJC A;  1D8L A;  2ZJQ A;  2IHE A;  4A3F H;  3FP9 A;  2CWA A;  4JI8 L;  4X66 L;  1P16 A;  1Q46 A;  3AFP A;  3CD6 A;  3TS2 A;  5IYD G;  4YHH Q;  3J81 c;  1Z9F A;  3OTO L;  1YIJ A;  3B6Y A;  1KQS A;  2B63 H;  2WB1 G;  2UUA L;  2JA6 H;  2MQH A;  3HOY G;  4IFD I;  5LMU L;  3D31 A;  4YWL A;  3J7Z C;  4DV7 L;  1KL9 A;  2Q2U A;  1VQG A;  2WP8 J;  2JQO A;  4YY3 L;  5C4J H;  1TWA H;  1E3P A;  3J80 c;  4JI6 Q;  4JI4 L;  4DK3 C;  4P75 A;  1I3Q H;  4NXM Q;  4DV1 Q;  1MJE A;  4A93 G;  3NEL A;  4JI1 L;  1X6O A;  5M3M G;  2WB1 E;  4LF4 L;  1Q8K A;  3M7N A;  4JBM A;  2N78 A;  3CCM A;  4DV2 Q;  4BY1 G;  3A74 A;  2R93 G;  1IBL Q;  4A93 H;  4B3S Q;  1N32 L;  4JI5 Q;  3I55 A;  4DR3 Q;  4A3M G;  4WJ3 M;  1EQR A;  2PQA A;  3W1B A;  3H3V I;  1FL0 A;  1MKH A;  3M4P A;  3JC6 6;  4C3I H;  2VY3 A;  4BY7 G;  3DLL A;  1AH9 A;  4JI1 Q;  4LF4 Q;  4GNX A;  1PYS B;  1C7Y A;  4IOC A;  1WJJ A;  2LXK A;  3UDX A;  1KAW A;  2ALY B;  5IWA Q;  2GVB A;  1JJ2 A;  4A3D H;  4A3M H;  4LF9 Q;  1IZ6 A;  4GKK L;  4DPG A;  3VDY A;  4ALP A;  1YVC A;  4JOI C;  2YU9 H;  5IP9 G;  2NZH A;  1RL2 A;  4PZ6 A;  4PZ7 A;  1J5E L;  1HZC A;  2VNU D;  3ULL A;  5IYC H;  1X3F A;  4KHP L;  1J5E Q;  3I56 A;  3F8T A;  4IPD A;  1E22 A;  4AIM A;  4GNX B;  4RG1 A;  1EIF A;  1XPR A;  5JEA J;  2YTV A;  4JV5 Q;  1VQH A;  2CCZ A;  3E9H A;  3H0G G;  3U50 C;  3F2C A;  1N36 Q;  1WFQ A;  4DV0 Q;  3S2H H;  3TQY A;  3A5U A;  2PNH A;  1YJN A;  2Y0S E;  3JAM i;  1N36 L;  2F52 A;  4J15 A;  4BBR H;  4HJ5 A;  4B3R L;  1VQM A;  4OX9 Q;  4OWT B;  2BH8 A;  1XPO A;  4X6A H;  2AWO A;  3CME A;  3ERS X;  3PUW A;  2PQA B;  2OQ0 A;  1SMX A;  3OYY A;  2UUB L;  4HID A;  2OWO A;  2JA9 A;  4BBR G;  2AHO B;  5JJL A;  1UE6 A;  2AWN A;  3TS0 A;  2KHJ A;  1C9O A;  4JC0 A;  2UUC Q;  1TWG H;  1XJV A;  1P8L A;  5JJK A;  4X62 Q;  4JBW A;  1UWV A;  3I4N G;  1YHB A;  1IL2 A;  1I6H H;  4GKJ Q;  1IBK L;  1L0W A;  5ELN A;  1M90 C;  3CC4 A;  2UXB Q;  1PVO A;  2E2J H;  5ELO A;  2NVQ H;  4XIG S;  3JAM c;  4H02 A;  3G4S A;  4LFB L;  1VQJ A;  2IT1 A;  1QZH A;  2ZJP A;  1YBY A;  3GTP H;  4A75 A;  2UUB Q;  4Y52 H;  2BA1 A;  4LF6 L;  3UDF A;  1HNX L;  4DUY Q;  4QL5 A;  2UXC Q;  1BBU A;  4YHH L;  1K83 H;  1SR3 A;  1O7I A;  1U0L A;  1VQB A;  4YCU A;  3FKI G;  4QY7 A;  3J80 i;  2VQE Q;  3K80 C;  4R4C A;  2OCE A;  4JI0 Q;  4UY8 C;  4DR6 Q;  1I50 H;  1K73 C;  1PH1 A;  3CCL A;  3GTM H;  2VQF Q;  5FLX c;  3HKZ G;  3PV0 A;  1VQO A;  1YJ9 A;  3STB C;  3K0X A;  2VS1 A;  4R4I A;  1JMC A;  5E7N A;  1UE1 A;  1LTL A;  1HJP A;  4B3M Q;  2VQE L;  3S1R H;  1NBW A;  3AEV A;  5IP9 H;  2DGY A;  1NJI C;  1YEZ A;  2Z6K A;  3HOV G;  4Y7N H;  3KFU A;  1HNW Q;  3CW2 C;  1OTC A;  2NN6 I;  1V9P A;  4A3G H;  1GM5 A;  3PUZ A;  2R92 G;  4PG3 A;  2C35 B;  3CCS A;  4GNX C;  4A3K G;  3S17 H;  3U4Z A;  1Q7Y C;  1JJC B;  2D0P A;  4TVA B;  5DLQ E;  1PH3 A;  2VUM G;  1VQ6 A;  1H95 A;  4IPG A;  3PO2 G;  3U4V A;  1S72 A;  1X9N A;  4IO9 A;  1X3G A;  2K4K A;  5C4X H;  3RLO A;  4TQU S;  3FHW A;  1WI5 A;  2CWP A;  2JK8 A;  2VW9 A;  1K8G A;  1IBM Q;  1C0A A;  3M9B A;  4X66 Q;  1A8V A;  3BJU A;  2V1C C;  5C0X I;  4DV5 L;  2E5L L;  4IPC A;  4JI3 L;  4UP7 A;  1YZ6 A;  3K7U C;  4NPS A;  4DV3 Q;  2WAQ G;  4NB3 A;  4A3F G;  4JI7 L;  2RHS B;  1X55 A;  3PSI A;  4GS3 A;  3CC7 A;  3CCQ A;  4HJ9 A;  4B3S L;  1N32 Q;  1Q12 A;  3J7A 5;  4LFC Q;  3S15 H;  1X56 A;  2KCM A;  3ULP A;  1IBL L;  4GLX A;  2NZO A;  4JI7 Q;  2ZJR A;  3UE1 A;  2I5L X;  1S40 A;  4P71 A;  2E5L Q;  3CC2 A;  3TRZ A;  1GKH A;  2K5H A;  2WFW A;  4IFD G;  5GAE C;  1EOV A;  1XMQ Q;  3KYH C;  4QGU A;  4DV1 L;  3NBH B;  1K9M C;  1SRO A;  3E0E A;  1E24 A;  1CUK A;  5GAH C;  5M3M H;  4JBK A;  4JI6 L;  3KDF A;  1ASZ A;  5GAD C;  4QIW E;  1N8R C;  4A3C H;  2K5V A;  1EWI A;  5GQO A;  2XGT A;  2R7Z G;  4A3I G;  2JA5 H;  3M85 A;  3KF6 A;  5M3F G;  1QUQ B;  5GAG C;  1GVP A;  3T1Y L;  3PIO A;  2K5N A;  4POF A;  5IWA L;  3T1H L;  2E2H H;  2VZA A;  2GN5 A;  1VCI A;  1SN8 A;  2IX1 A;  1CSQ A;  3T1H Q;  4O0A A;  1CKO A;  1SLJ A;  1WOC A;  2LXJ A;  1VQP A;  1Q81 C;  1AE2 A;  2MO1 A;  1UE5 A;  2NN6 G;  1XNQ L;  3H3V H;  3PCO B;  3HOU H;  4YWK A;  4K0K Q;  1E7Z A;  4AQY Q;  1XMQ L;  3S2D H;  2I5H A;  4HJ8 A;  1MIU A;  4UPA A;  2VUM H;  5IT9 c;  2AMC B;  2PMZ E;  2B63 G;  4A3D G;  4LFB Q;  3RNU A;  1J6Q A;  4JI2 L;  5LMN Q;  4A4I A;  3S1M H;  5C4X G;  3NEM A;  4HIM A;  4AQY L;  5C3E H;  1L1O C;  4YY3 Q;  4OO1 G;  1A62 A;  2K14 A;  2UUC L;  1SE8 A;  2CKZ B;  1N33 Q;  1VQN A;  4GN3 B;  1XNQ Q;  3S16 H;  2QA4 A;  4K0K L;  2E8G A;  3AYH B;  4A3J G;  4LF5 Q;  3RR5 A;  1HZ9 A;  4L5S A;  3I2Z A;  3PGZ A;  4WJ4 A;  4X64 L;  5M5W H;  2ZTE A;  4IOA A;  4UP9 A;  1HZB A;  3RZO H;  3H0G H;  4QQB X;  4P73 A;  5C44 G;  2CQO A;  2RHQ B;  4A3E H;  1VQK A;  3HKS A;  1WYD A;  4R1J A;  2Y0S G;  3UDI A;  1N33 L;  1ASY A;  2CFM A;  2NVT H;  4BA2 I;  2H5X A;  2JEB I;  4JCV E;  3IRB A;  3HOW H;  4HJ7 A;  2ATW A;  3UDG A;  4C3H H;  3W5O A;  4DV4 Q;  4OWX B;  1OXV A;  2XTI A;  3ULJ A;  3NEN A;  2ZM6 Q;  4DR1 L;  2JA6 G;  2R7Z H;  1PV4 A;  1V1Q A;  1B7Y B;  1Q1B A;  1VQ9 A;  3AQQ A;  4DK6 C;  4MTN A;  4JYA L;  1VQE A;  3STB D;  3S1N H;  4B3M L;  4BBS H;  4DR1 Q;  5LMU Q;  4A3G G;  4GLA C;  3GTJ H;  4GN5 A;  5C0X J;  3K81 C;  3F2B A;  3KF8 B;  4DV4 L;  4DR5 Q;  1HNZ L;  1R9T H;  4DR4 Q;  1WCM H;  2KBN A;  2Q2H A;  1LM0 A;  3RN5 A;  2UXD Q;  1E1O A;  2FXQ A;  3SGI A;  3RN2 A;  4JYA Q;  4LF9 L;  3DM3 A;  2F4V L;  4DAM A;  1Q86 C;  3RLN A;  1RIP A;  4GKK Q;  3T1Y Q;  3PUY A;  1XTD A;  5FLM H;  5AJ3 Q;  2EQS A;  4R4O A;  1N34 L;  1EFW A;  3GTG H;  2LSS A;  3PF4 A;  2N8N A;  1T9H A;  4ME3 A;  2I0Q A;  3HOX G;  3HOZ H;  4A3B G;  2JA8 H;  1KHI A;  4IFD J;  1HH2 P;  4EX5 A;  2RF4 A;  4JI5 L;  2ZTC A;  1UE7 A;  1W2B A;  1G6P A;  3AFQ A;  1KIX A;  2MFI A;  1KRT A;  4DV3 L;  3BZK A;  2UU9 Q;  4L5T A;  4DV5 Q;  3BU2 A;  4AYB G;  4DUZ Q;  4P74 A;  1I94 L;  1VQ4 A;  1TWF H;  2RCN A;  3EN2 A;  5C3E G;  5LMN L;  1PH2 A;  1JE5 A;  2R7F A;  4LUO A;  3GTO H;  2R93 H;  5C0X G;  2BH2 A;  1JB7 A;  3KLW A;  5IYC G;  4L5Q A;  4LFC L;  1Z47 A;  2OQK A;  2N3S A;  3CMA A;  5H1S E;  1NMG A;  3PUV A; 
#chains in the Genus database with same CATH topology
 1DGS A;  1NY4 A;  2Q2T A;  4R4T A;  4XQN A;  1CKM A;  4NKL A;  3DMU A;  4A3J H;  4DUY L;  2E2I H;  1JR0 D;  1LT3 D;  3HOW G;  3I8Z A;  1KAA A;  1TWA B;  1CK1 A;  4OO1 H;  2K52 A;  3P75 A;  5TSS A;  4APV A;  1EYG A;  4RAU C;  2KHI A;  3CCJ A;  3TRE A;  2YYZ A;  4C3J H;  3ICE A;  2JA8 B;  1QZG A;  1D1I A;  1XWE A;  5CC4 A;  4K8J A;  1B50 A;  1GHK A;  4A3L H;  1LTG D;  4LF5 L;  2F0G A;  4DR6 L;  3GTK H;  2D5D A;  1K0R A;  1WCM B;  4UP8 A;  5BR8 Q;  3QWN A;  2F4V Q;  1O7L A;  5IOD A;  2D2C C;  3Q0A A;  3JAM L;  4NW2 A;  4BS9 A;  4IJL A;  1Y1V H;  3G71 A;  4DR5 L;  3RD4 A;  1TY0 A;  4K2K A;  5M5Y B;  2HHH Q;  1Y14 B;  1G29 1;  3C1F A;  4JOI A;  4ZK9 B;  3I4M B;  2RSN A;  5EKI A;  1W6K A;  4HJA A;  4FO2 A;  3NQI A;  3CQZ H;  3MEF A;  4MNO A;  4OXP A;  1EY7 A;  2L1B A;  4DR3 L;  3CPW A;  3CP0 A;  1YIT A;  3F2U A;  5CV7 A;  1QOH A;  5D65 A;  1L1O A;  5FLM G;  3CCE A;  2HIV A;  3J81 L;  2AUJ D;  1K8A C;  3M4O H;  1VQ8 A;  4JK1 C;  1S5D D;  4O2D A;  4DUZ L;  1T5X D;  4HSP A;  3BVM A;  1KRS A;  2Y0S B;  3C1E A;  5JOB A;  1HQR D;  1SJH D;  2BDN A;  3A5Z B;  4RCO A;  4GZY C;  2VXW A;  4ABN A;  1PH7 A;  5T1I A;  1MHW C;  4DR2 Q;  1GUW A;  1GHJ A;  2BDO A;  2JA7 G;  1HR0 Q;  3H15 A;  2G5D A;  3NTI A;  4HAE A;  5JPN C;  4QMG A;  3HOX H;  3HOZ G;  2IPK D;  4AYB E;  3GTQ H;  5LL6 X;  4JG2 A;  4R9W A;  2K01 A;  2R7D A;  2QEX A;  1B8A A;  1PHJ A;  5KYL A;  1OXT A;  3KDF B;  3CCV A;  2GVA A;  1STG A;  3OW2 A;  3T13 A;  2R92 H;  2O2L D;  3R93 A;  1HTL D;  4BXX H;  3GV3 A;  5EPK A;  5HGT A;  4Y7N B;  1JCK B;  4POG A;  1Y1V B;  4A3J B;  3DHQ A;  5HGQ A;  1LLR D;  1E1T A;  4QJF A;  4IUU A;  1PRT C;  2EY1 A;  1SE2 A;  3TZD A;  5ELD A;  1PRT F;  4KV6 A;  1EIY B;  4QCL A;  1FVI A;  4IQZ A;  1MD2 D;  4A3D B;  1BBW A;  4KLK A;  4YCW A;  2EZV A;  3U9S A;  3TDQ A;  4IFD H;  5JEA G;  5C4J B;  2Q8I B;  1TS3 A;  3URY A;  1QWY A;  4E6I A;  3S1Q B;  3O13 A;  3R2T A;  1QIL A;  1KC8 C;  4BWG B;  4QB4 A;  2FJ2 A;  5IGG A;  2IHE A;  4A3F H;  3FP9 A;  4X66 L;  3TS2 A;  3DUZ A;  2RBM A;  3NK9 A;  2B63 H;  2WB1 G;  2UUA L;  2KA7 A;  1I4X A;  2RCF A;  3M4Y A;  4ZAI A;  5KGU A;  2WP8 J;  4YY3 L;  1CTM A;  1K0S A;  4JI4 L;  4DK3 C;  5ELF A;  4P75 A;  1I3Q H;  2G9H D;  1F77 A;  2H4O A;  5EBD A;  2WIN B;  3NEL A;  2M9V A;  3J7A V;  5M3M G;  1X6O A;  4JBM A;  2N78 A;  1XYI A;  4BY1 G;  2E2J B;  2R93 G;  4B3S Q;  1BCP B;  4DK0 A;  4WJ3 M;  1EQR A;  4MIU A;  4MN3 A;  1FL0 A;  4DN4 M;  1JOK A;  2PQE A;  3DLL A;  4LF4 Q;  4M1U B;  1SNM A;  1PYS B;  3MAQ A;  2PYK A;  1AEX A;  4H44 C;  2QEJ C;  4A3M H;  1IZ6 A;  1EYC A;  4DPG A;  4CDF C;  1IL8 A;  2F1M A;  1YVC A;  1V8Q A;  2YU9 H;  3MXU A;  1RL2 A;  1X3Q A;  2BE5 C;  3D4W A;  1JOQ A;  1JE4 A;  4CDD C;  5A35 A;  2VNU D;  4NP5 A;  3CKI B;  3HZX A;  1J5E Q;  3I56 A;  1KTK A;  1L0X B;  1SNO A;  4IPD A;  5D3D A;  3VYT A;  1BXT A;  4RG1 A;  4OEL B;  1SAP A;  4CGY B;  3DXJ C;  1N36 Q;  3NBI A;  3TQY A;  3KBG A;  2PNH A;  3IL8 A;  2Y0S E;  1YJN A;  4RHR A;  1SNQ A;  3I90 A;  4B3R L;  4OWT B;  1MI2 A;  4X6A H;  3FPU B;  1I4Q A;  4FVM A;  4OL7 A;  3OYY A;  1DXM A;  4HID A;  1Z7T A;  2EE1 A;  1BF4 A;  2AHO B;  2AWN A;  5FO8 B;  5A2Q E;  1STY A;  1U4P A;  3I4N G;  1YHB A;  2EJF C;  1IL2 A;  3TP8 A;  4XDX A;  1M90 C;  2B63 B;  1ROD A;  1DON A;  4KY5 A;  1Y8O B;  2ZJP A;  4A75 A;  2UUB Q;  1I6V C;  5I4D A;  3UDF A;  1HNX L;  2UXC Q;  3FRP B;  1BBU A;  2L12 A;  1SR3 A;  4YCU A;  1U0L A;  1VQB A;  4QY7 A;  4Z9C B;  4R4C A;  3RUZ A;  3S15 B;  1CZG A;  3HKZ G;  3PV0 A;  1RF2 D;  4KD4 A;  2VS1 A;  5IIF A;  4R4I A;  3S1M B;  1JMC A;  5E7N A;  2B2U A;  3KLR A;  2DJF C;  3PO2 B;  1S4Z A;  3H0G B;  1NJI C;  3HOV G;  4Y7N H;  3CW2 C;  1GM5 A;  2OEO A;  4JYA Q;  2C35 B;  3H09 A;  4GNX C;  1H9K A;  1Q7Y C;  1JJC B;  5IGB A;  2D0P A;  3QOL A;  1VQ6 A;  1IKL A;  4V19 0;  3QO2 A;  3QIA A;  2F3V A;  1M8A A;  1X3G A;  1WI5 A;  4DV5 L;  2E5L L;  4IPC A;  4JI3 L;  4DV3 Q;  2NZ1 D;  4A3F G;  4YIJ A;  3CCQ A;  4K6L A;  2A68 D;  1CQF A;  1Q12 A;  3LWE A;  3J7A 5;  2XWJ B;  4HMI A;  1O80 A;  1IBL L;  4JI7 Q;  3UE1 A;  1S40 A;  3G7L A;  1BQQ T;  4IFD G;  2B2Y A;  4DV1 L;  1K9M C;  5GAH C;  5M3M H;  2AQ1 B;  4JI6 L;  4PMB A;  4A3C H;  3A7A B;  4KKS A;  2JA5 H;  4RCN A;  3IAY A;  1EY6 A;  4OIK A;  3D6C A;  3KF6 A;  5M3F G;  1GVP A;  2E2H H;  2NVY B;  3Q6S A;  1TKW B;  2GN5 A;  2DY8 A;  3S1R B;  3VR6 A;  1WOC A;  1Q81 C;  1UE5 A;  1CFM A;  4K0K Q;  2NUC A;  1TQO A;  1LTI D;  1MIU A;  3T16 A;  2PMZ E;  2NVQ B;  4KK7 A;  4HCS A;  5KEE A;  3RNU A;  4KTA A;  5C4X G;  2L55 A;  3GTK B;  4QF4 A;  1G91 A;  3NBH A;  1DM0 B;  4OO1 G;  4YY3 Q;  5I9O A;  3K57 A;  3X3M A;  1A62 A;  1I6H B;  5J1Z A;  2CKZ B;  1AP0 A;  1JT8 A;  2F0F A;  3OW7 A;  4K0K L;  1DD2 A;  2E8G A;  4XXE A;  3RR5 A;  4L5S A;  1L0Y B;  3PGZ A;  4RKB A;  1RCV D;  4XYO A;  2CQO A;  4R1J A;  1JOO A;  1N33 L;  1ASY A;  2H5X A;  1R9T B;  3HOW H;  3K5O A;  3UDG A;  3W5O A;  4X3U A;  5DM6 3;  1LT6 D;  2JA6 G;  2R7Z H;  1VQ9 A;  3AQQ A;  4MTN A;  4JYA L;  3S1N H;  4B3M L;  4OHJ A;  4A3G G;  1HNZ L;  3GTJ H;  5C0X J;  4C56 C;  4DR4 Q;  3KLS A;  3RN5 A;  1LM0 A;  3RN2 A;  3DM3 A;  2F4V L;  4DAM A;  1Q86 C;  1EOT A;  1RIP A;  1Y8P B;  3RZO B;  1AFP A;  2N8N A;  3MHB A;  2EYO A;  4WJW A;  3HOX G;  3HOZ H;  4A3B G;  2JA8 H;  3SK6 A;  1PFN A;  1HH2 P;  2L0C A;  2ZTC A;  3OPO A;  1KRT A;  5C3E B;  1TS2 A;  5K5P A;  4L5T A;  5HUR A;  5COY A;  2I46 A;  5FLX L;  1I4G A;  1VQ4 A;  5C3E G;  3U9O A;  1PH2 A;  3GTG B;  1JE5 A;  3TME A;  2F0P A;  1HUM A;  1JB7 A;  3HOY B;  2HD3 A;  4LFC L;  2OQK A;  3S14 B;  1LTA D;  3C46 A;  4OEM B;  5I6Y A;  3HOW B;  4HIK A;  4IPH A;  3P7J A;  1BVS A;  3CCU A;  4H7B A;  2PI2 E;  2UXC L;  1EY9 A;  1N9W A;  5EKK A;  1SFO H;  2B3G A;  2PW7 A;  3A8J E;  4PQX A;  4LW1 A;  5JVH 3;  5IGD A;  2O4X A;  3S24 A;  1FR3 A;  2JEA I;  1GJX A;  1PTO H;  4JVZ A;  2EJG C;  3AU7 A;  4IZ8 A;  2EYM A;  3W1G A;  1XNR Q;  2JA6 B;  1B2T A;  4LF7 Q;  2EYJ A;  4YCV A;  1VQC A;  4A3C G;  5J3B A;  1BCP D;  2KQ3 A;  1F2Y A;  3F1Z A;  2TMP A;  2CH4 A;  4AYB B;  1G6Z A;  1A0I A;  2GA4 B;  1VQF A;  1D5Z C;  2N88 A;  1TWC H;  1M1K C;  3HOU B;  1AE3 A;  3BYT B;  4DA2 A;  1RTN A;  5IYB H;  1SYC A;  4KJO A;  3SR1 A;  2BOS A;  1PFM A;  1GD7 A;  1KXL A;  3HOU G;  1B53 A;  1IBK Q;  1ENC A;  5C4X B;  1PYB A;  3U58 A;  4LUZ A;  1HNZ Q;  1O78 A;  1PRT B;  2IHF A;  3WDN A;  1VQL A;  4C3I G;  2HHH L;  2KHS A;  4K8I A;  4C3H B;  2Z8L A;  4U67 3;  5ISR A;  5C0X H;  4RA8 A;  1WTV A;  1QVF A;  2HT1 A;  2CW0 D;  3PQI A;  2IL8 A;  2UUA Q;  2NVY H;  4XQJ A;  3BZC A;  4QIW B;  1TXY A;  5EQ0 A;  5AJ3 L;  1N34 Q;  3HFZ B;  4BBS G;  3OSO A;  5KIX A;  3G6E A;  1PMR A;  5JVG 3;  2MO0 A;  3R2I A;  1X65 A;  1Q82 C;  4L8J A;  1EU3 A;  5DEH A;  5FO7 B;  4FF3 A;  2YTX A;  3Q24 A;  4OWW B;  3E9I A;  3EA6 A;  4KI0 A;  2CH4 W;  1Y1W H;  4GOP B;  5KYI A;  4BA1 I;  4NXM L;  1F2Z A;  2Z0S A;  3TZU A;  5IGE A;  5M5Y H;  3D4D A;  1H9M A;  4ZCK A;  5EJW A;  2QGQ A;  1XPU A;  3TSS A;  2KCC A;  2K75 A;  3CF5 A;  1TT2 A;  2JE6 I;  2PZU A;  5JAV A;  1ET9 A;  2UU9 L;  1B3Q A;  1YNX A;  1QVC A;  2BCO A;  3M7G A;  5BN4 A;  2B8F A;  3FMC A;  4JI3 Q;  3HOX B;  3KJO A;  1SNC A;  5FLX E;  2J4X A;  1ONL A;  4RMF A;  4K6D A;  4DV2 L;  4JV5 L;  3ER0 A;  2KEN A;  1BR9 A;  2ZT9 C;  1VQ7 A;  5KNC A;  1PFS A;  4PMW A;  4BY7 H;  5G3L F;  1X54 A;  3L9A X;  3G48 A;  2KJX A;  1CA5 A;  2JJQ A;  1RHP A;  1VS0 A;  4A3I H;  4IUT A;  3S14 H;  4HIO A;  3HOV H;  1GUT A;  3HKZ E;  2O5J C;  3I3C A;  3CAM A;  4ZYS A;  1LT5 D;  2DJG C;  4DKA C;  3RMH A;  4CJ0 B;  1OXX K;  4HSV A;  3H91 A;  4X64 Q;  5C5L A;  1FNV A;  1I5F A;  1BBX C;  2ES2 A;  2RDF A;  2QIL A;  1TWG B;  1W3S A;  4DV6 L;  2Q8R E;  1IBM L;  2IX0 A;  4H13 C;  4X62 L;  4A3E G;  3PIP A;  1SYD A;  1ILP A;  5IE8 A;  1GUG A;  3PO3 B;  4LNQ A;  4P72 A;  4RFB A;  3L7Z C;  1DOK A;  5EGT A;  1F9P A;  1V1P B;  4B3T Q;  1STB A;  5EBC A;  5M3F H;  3DWQ A;  3Q23 A;  4YWM A;  2IWH A;  1SYB A;  4DV6 Q;  1U4M A;  4DV7 Q;  2OT2 A;  3OTO Q;  5M5X H;  2AKW B;  4OON A;  4RHS A;  3Q22 A;  4PZ8 A;  5IYB G;  1SDF A;  3K8A A;  4TKO B;  2CWA A;  1P16 A;  3AFP A;  1NUC A;  5IYD G;  4DXG A;  3MZ5 A;  3J81 c;  1WD0 A;  1TWF B;  1Z9F A;  1YIJ A;  3B6Y A;  1KQS A;  5DNF A;  2JA6 H;  2DNC A;  2MQH A;  1F2L A;  4IFD I;  5LMU L;  2RA4 A;  4X3K A;  4F7X A;  2E76 C;  4YWL A;  1BCP F;  4DV7 L;  1KL9 A;  3LWU A;  1Q8I A;  2HDL A;  4JI6 Q;  3GP7 A;  1K83 B;  4NXM Q;  4DV1 Q;  1MJE A;  4A93 G;  1E2W A;  4LF4 L;  2R61 A;  4G7O C;  5ELC A;  3SDZ A;  5C3W A;  2F0U A;  4A93 H;  1N32 L;  2BE5 D;  2JSO A;  3I55 A;  4DR3 Q;  4A3M G;  3CRL C;  2F4I A;  2PQA A;  2H1E A;  1MKH A;  4C3I H;  2VY3 A;  2R93 B;  2J7Z A;  3OMC A;  4IOC A;  1WJJ A;  2LXK A;  4ZRZ A;  4A3F B;  1KAW A;  3FVQ A;  2GVB A;  1JJ2 A;  3BDO A;  3I91 A;  3VDY A;  1V1O A;  2QCP X;  2EVB A;  1T5E A;  4IUQ A;  4A3K B;  5E4X A;  4PZ7 A;  3IFD A;  1J5E L;  1HTP A;  3GTJ B;  3A56 A;  1TII D;  5IYC H;  1X3F A;  2EYL A;  1NNX A;  2KEC A;  1EWC A;  3MA2 B;  1XPR A;  4X3T A;  5JEA J;  2YTV A;  2CCZ A;  3E9H A;  3H0G G;  1WFQ A;  4QUC A;  3VR2 A;  3A5U A;  4CDE C;  4J8Q A;  2F52 A;  1EEI D;  1SBB B;  2BH8 A;  1XPO A;  3CME A;  3NQT A;  5M5W B;  1SXT A;  2OQ0 A;  2PQA B;  3K5L A;  1K8M A;  5F2D A;  2HDM A;  2OWO A;  2JA9 A;  1JOR A;  5JJL A;  1ZXT A;  1C9O A;  1XJV A;  1KNE A;  4X62 Q;  2KCN A;  4JBW A;  4OIJ A;  4CKE A;  4GKJ Q;  1IYU A;  1SE3 A;  5ELN A;  2UXB Q;  2NN6 H;  5ELO A;  2NVQ H;  4H02 A;  4LFB L;  1NR4 A;  4RGT A;  1RJT A;  4Y52 H;  4DUY Q;  4YHH L;  1K83 H;  3J80 i;  3FKI G;  2F0H A;  4JI0 Q;  3K80 C;  2EY6 A;  2F0J A;  1K73 C;  1PH1 A;  3GTM H;  2VQF Q;  1YJ9 A;  1VQO A;  3SEB A;  1FNU A;  3VA7 A;  2FMC A;  1YEZ A;  1QCB D;  1OTC A;  2PZT A;  3PUZ A;  3CCS A;  4A3K G;  3U4Z A;  4MTK A;  1PZK D;  1PH3 A;  4EQO A;  4JPB W;  5C5M A;  5M5X B;  3ITP A;  4IO9 A;  2JK8 A;  2CWP A;  1K8G A;  4LK1 C;  2MUY A;  2JP1 A;  1C0A A;  1EYA A;  2F0S A;  3BJU A;  5C0X I;  3K7U C;  2A6E D;  4NB3 A;  2DNE A;  1D2B A;  4ZKB B;  2RHS B;  3NP8 A;  4GS3 A;  4IUV A;  3CC7 A;  4HJ9 A;  4IN3 A;  1N32 Q;  4N8F A;  2KED A;  5C6A A;  4HN7 A;  1Y69 U;  3HGB A;  2ZJR A;  1LAC A;  4BY1 B;  4S3S A;  5C3X A;  3TRZ A;  3VYU A;  1GKH A;  3V96 A;  3TP5 A;  1DJR D;  2XVS A;  4G7Z C;  5GAE C;  1EOV A;  2ZXR A;  1PXU A;  1XMQ Q;  1E24 A;  1CUK A;  5AFW A;  4JBK A;  3KDF A;  4FXK C;  3SHL A;  2SOB A;  1N8R C;  2K5V A;  1EWI A;  1ESR A;  1JC7 A;  2XGT A;  3EVQ A;  1ML0 D;  3FDT A;  3M85 A;  3NPP A;  3OIP A;  3T1Y L;  3GTP B;  2VZA A;  3UI2 A;  2DY7 A;  1EWH A;  1I4H A;  3S9W A;  4O0A A;  4UAI A;  1EQV A;  3FKI B;  4C2M B;  2LXJ A;  1VQP A;  1BCP C;  2MO1 A;  3S2H B;  1XNQ L;  3HOU H;  1U4R A;  4AQY Q;  1XMQ L;  3S2D H;  2I5H A;  3VYS A;  1HFN A;  4LFB Q;  1EFI D;  2ZXP A;  2A69 C;  3S1M H;  1JB3 A;  3WOF A;  1D5M C;  3BG3 A;  4HIM A;  2Z4I A;  1MSG A;  1WD1 A;  2NTS A;  1N33 Q;  1SE8 A;  2QA4 A;  4LF5 Q;  3BDC A;  1HZ9 A;  2XIW A;  3I2Z A;  5E4W C;  4X64 L;  5M5W H;  4J1M A;  4UP9 A;  1SFO B;  3RZO H;  3H0G H;  4P73 A;  3R8B A;  5LHY 1;  4C3J B;  3AMU A;  1PZJ D;  1ZKO A;  2VB3 X;  4DV4 Q;  2PCF B;  1OXV A;  2XTI A;  3ULJ A;  3NEN A;  1PV4 A;  2ZXO A;  1V1Q A;  1B7Y B;  1PTO B;  1Q1B A;  5FOB B;  1IYV A;  5T1G A;  4BBS H;  4GLA C;  4DR5 Q;  4DV4 L;  2E75 C;  2SEB D;  4OGQ C;  4K14 A;  4M8A A;  2CHB D;  2PNR C;  4N9P A;  2B2W C;  4KMU C;  1A2U A;  3VR3 A;  1FGB D;  3TBI B;  1XTD A;  1EFW A;  2LSS A;  4BBS B;  4I65 A;  1B9N A;  1NCV A;  4IFD J;  1DYQ A;  4EX5 A;  2RF4 A;  2SDF A;  2X6G A;  1UE7 A;  1W2B A;  1G6P A;  2UU9 Q;  1JWU D;  5EPL A;  4WRD A;  3I72 A;  4DUZ Q;  4A93 B;  4UDU C;  4P74 A;  1CI3 M;  2HCI A;  2R93 H;  1EU4 A;  3HOZ B;  3H6M A;  3KLW A;  5IYC G;  1KDA A;  3PIO 3;  1Z47 A;  1DZ1 A;  1O7Y A;  2NVX B;  5CBE E;  3CMA A;  5H1S E;  3RLF A;  1HR0 L;  1AW7 A;  2I5M X;  2F0N A;  4IAL A;  2IY5 B;  2F0E A;  2M2L A;  2F3I A;  1I3Q B;  2JA5 B;  1X3E A;  4RWS C;  1HPC A;  1XNR L;  1JIC A;  1SE4 A;  1PH6 A;  1LYL A;  3J80 E;  2DUD A;  1UEB A;  2XRQ D;  3MC0 B;  3VYR A;  5NUC A;  1WVL A;  2LMC B;  4A3L G;  3PO3 G;  4Q0F A;  5FO9 B;  1UEA B;  2BA0 A;  1SYG A;  1TWH H;  2CVR A;  3A0J A;  3FEW X;  4X3S A;  4CKC A;  4A3E B;  3HOY H;  5COR A;  4CJ1 B;  1Q1E A;  4KKT A;  3D0F A;  3WWV A;  2KEE A;  4RGO S;  2VL6 A;  2K50 A;  3LX0 A;  3PUX A;  4GN4 B;  5D3I B;  4XTC S;  1EYD A;  4GLV B;  2R6G A;  1ENF A;  2EIF A;  2MP1 A;  2CW0 C;  1DOM A;  1L2F A;  1B4O A;  2A19 A;  2KCT A;  4DV0 L;  1E2V A;  1RKN A;  1YJW A;  2UXB L;  3I4M G;  4C1N K;  1JWS D;  4FP5 D;  3HG9 A;  5JJZ A;  4JBJ A;  2OTL A;  3GO5 A;  1HA6 A;  3D8G A;  2EJM A;  3K7A H;  4BXX G;  3MXN B;  4IJH A;  1OO9 B;  4DAV A;  4A3B B;  1D7Q A;  2OTJ A;  2VQF L;  2Z4H A;  3A54 A;  4KY7 A;  4JI0 L;  3CRK C;  4A3I B;  4HED A;  2WII B;  2F0Q A;  1KD1 C;  1V43 A;  1SNP A;  1HNX Q;  3L0O A;  1I94 Q;  4LWC A;  3RZD H;  5BN3 A;  1IHZ A;  5JPM C;  1BO0 A;  5JJI A;  3FKI H;  4C2M H;  1QUQ A;  2KUM A;  1EIG A;  3MEH A;  3V05 A;  1YI2 A;  4CBV A;  1HHV A;  4DNT B;  4DAY A;  1CT1 D;  5EAY A;  2LKV A;  2ZTD A;  3I4O A;  2L15 A;  4A3G B;  5KND A;  1PH9 A;  3M4O B;  1U4L A;  3ND8 A;  3P1H A;  1G51 A;  1FGU A;  1ICW A;  1LO5 D;  2B29 A;  1WTP A;  1CKN B;  2ID0 A;  4Q5V A;  3I7F A;  1HR0 W;  2LS0 1;  2EYF A;  4A3K H;  4O42 A;  3IKJ A;  2JA5 G;  1QJO A;  1PA6 A;  1AN8 A;  1ILQ A;  1NTG A;  4X65 L;  3CPF A;  3BDL A;  3KOJ A;  4XT3 B;  1PTO F;  1FJG L;  1CKN A;  5FKA C;  3J80 L;  3E6Z X;  4EQN A;  5BR8 L;  1BUV T;  5L37 A;  1X32 A;  3CCR A;  5FJ8 G;  3GD7 A;  4R8I A;  2K1B A;  4BY1 H;  4GOP A;  3M3Y B;  1PH5 A;  1A63 A;  1TWC B;  4DAY B;  2NVX H;  4NXN L;  1VQD A;  3D6W A;  4KN7 C;  4KN4 C;  2JA7 H;  3EBE A;  4HR7 B;  1HZA A;  2F0D A;  5CR3 A;  4IUR A;  3DEP A;  4OO1 I;  3I4M H;  4HCE A;  1PH4 A;  4BBR B;  2RSO A;  1VQI A;  1HNW L;  1PRT D;  3M4Q A;  2ZM6 L;  3F2D A;  4ME5 A;  3HEJ A;  2A73 B;  1I50 B;  3H3V C;  3LGJ A;  5IP7 G;  4L6T B;  3KJP A;  4ILW A;  2ZJQ A;  5EPJ A;  3ZYY X;  1I4R A;  1QNK A;  4WFN 3;  3OTO L;  5E1F A;  1PTO D;  3HOY G;  4FXG C;  2F0T A;  5DAU A;  2Q2U A;  2JQO A;  1TVX A;  2PW5 A;  3N6R A;  4F8M A;  3BZD B;  4QUF A;  3HS0 C;  4DAP A;  3M7N A;  1RTO A;  4DV2 Q;  3A74 A;  5KRU A;  5KNB A;  1IBL Q;  4IUP A;  3VA5 A;  3OIQ A;  4JI5 Q;  3G6J B;  1F2M A;  2WKC A;  5CV4 A;  3M4P A;  5K36 H;  1AH9 A;  4G7H C;  2EYH A;  4JI1 Q;  4GNX A;  4ZQ3 A;  5IWA Q;  4LMQ D;  2A5H A;  2WV6 D;  2PPB C;  4PZ6 A;  3OMG A;  5JEA H;  5ELB A;  1LTS D;  5I2X A;  4KHP L;  1PFB A;  2RVL A;  1SND A;  4AIM A;  4GNX B;  1EIF A;  3E0J A;  3S1N B;  2B2Y C;  3HKZ B;  5D14 A;  4JV5 Q;  2IX3 A;  1VQH A;  1CZW A;  3U50 C;  3S2H H;  2XN9 C;  3T51 B;  4DV0 Q;  1EY0 A;  4J15 A;  4BBR H;  3MFY A;  1F9S A;  1VF7 A;  4OX9 Q;  2O5I C;  3PUW A;  5IT9 E;  1SMX A;  2WAC A;  2ENB A;  4LJZ C;  2UUB L;  1H9S B;  1Y8N B;  1D5X C;  2HQE A;  2IJ0 A;  3NTH A;  3S16 B;  4JC0 A;  1DCZ A;  5JJK A;  1A2T A;  1UWV A;  1G8Z D;  1I6H H;  3CC4 A;  3MXP A;  4XIG S;  3G4S A;  1QZH A;  3KLS X;  1YBY A;  3GTP H;  1YNJ C;  2BA1 A;  4LF6 L;  2JYO A;  5C4Z A;  2VQE Q;  1O7I A;  4B3R Q;  3DWA A;  3DM1 A;  1NSN S;  4TRD A;  3W2D A;  5EKL A;  4DR6 Q;  1I50 H;  3CCL A;  5FLX c;  3WOE A;  1W6J A;  3K0X A;  1UE1 A;  2KVM A;  4B3M Q;  3SE0 A;  2VQE L;  1NBW A;  3AEV A;  5IP9 H;  3W3A A;  3KFU A;  2A6E C;  4EGV A;  1HNW Q;  1V9P A;  1Q90 A;  3EQL C;  1IKM A;  5J22 A;  3S17 H;  1G2T A;  2B2V C;  1FD7 D;  5DLQ E;  4RH6 A;  1H95 A;  4IPG A;  1II3 A;  1S72 A;  1DOL A;  4ODG A;  5C4X H;  1PTO C;  4TQU S;  3FHW A;  2VW9 A;  3K6O A;  2V1C C;  1BOS A;  4UP7 A;  1YZ6 A;  4NPS A;  2LFN A;  2WAQ G;  4JI7 L;  1GUO A;  1X55 A;  3FPP A;  2XWB B;  3PSI A;  2F0K A;  2E74 C;  1H9J A;  4B3S L;  3MVV A;  4K5X A;  3GV6 A;  4LFC Q;  5M3M B;  2L4N A;  4ZUI A;  1X56 A;  5I2Y A;  3ULP A;  4GLX A;  1RDP D;  2B2W A;  3QOJ A;  1TY2 A;  2E5L Q;  3MXG A;  4DXF A;  2K5H A;  4WOR A;  2RKS A;  2B2T C;  3DWP A;  2F0O A;  4K5V A;  3TP6 A;  4QGU A;  3NBH B;  3E0E A;  5I9P A;  3QG1 A;  2WB1 B;  1ASZ A;  5GAD C;  4QIW E;  3SK8 A;  2IW3 A;  1TS4 A;  2R7Z G;  4F87 A;  1QUQ B;  3PO2 H;  1ZYR D;  4FXD A;  3PIO A;  4POF A;  5IWA L;  3CHB D;  3T1H L;  3CQZ B;  2MHV A;  1SN8 A;  2OF1 A;  2FFK B;  1CSQ A;  1EL0 A;  2A69 D;  3IFT A;  1SLJ A;  1AE2 A;  1EQT A;  5ELE A;  2EOT A;  5FK9 C;  3H3V H;  3NUC A;  2EXZ A;  4YWK A;  4ZKC B;  4MHE A;  1E7Z A;  1GUS A;  4UPA A;  2VUM H;  5IT9 c;  2AMC B;  2B63 G;  4A3D G;  2FHT A;  5IGC A;  3I4N B;  4JI2 L;  5LMN Q;  2N55 A;  1NR2 A;  3NEM A;  1ET6 A;  5C3E H;  5E3F A;  2K14 A;  1VQN A;  4GN3 B;  2M00 A;  3J7Y W;  3T56 B;  4A3J G;  4WJ4 A;  2ZTE A;  2Q8T A;  1HZB A;  1HRJ A;  4QQB X;  2NB0 A;  2RHQ B;  3KF8 A;  3K5N A;  1VQK A;  3HKS A;  1WYD A;  5CYU A;  2Y0S G;  2NVT H;  1GOZ A;  3T4A C;  2C5C A;  4BA2 I;  3IRB A;  1YNJ D;  1C4Q A;  4HJ7 A;  4C3H H;  1R4Q B;  1KNA A;  4OWX B;  2ICE C;  2ZM6 Q;  4N8X 1;  1STN A;  1D1K A;  2FIN B;  3STB D;  3BVZ A;  3LNN A;  4DR1 Q;  3QB3 A;  5LMU Q;  4GN5 A;  3F2B A;  3KF8 B;  3ERO A;  1R9T H;  2KBN A;  3OWF A;  2UXD Q;  1E1O A;  2K5Q A;  2FXQ A;  3SGI A;  3RLN A;  1JQY D;  1B3A A;  3T1Y Q;  3ND9 A;  1CQV A;  5AJ3 Q;  4R4O A;  4CHT B;  1N34 L;  3PF4 A;  3QJY A;  1S5B D;  4ME3 A;  3P20 A;  3TP7 A;  2I0Q A;  4B9X A;  4CKB A;  3GTO B;  5IOC A;  1KIX A;  3V2T A;  2MFI A;  1HUN A;  1LTT D;  2EY2 A;  3BZK A;  4UHV A;  3BU2 A;  3NHH A;  3PIP 3;  4I7A A;  1MSH A;  4EQP A;  4NDX A;  1TWF H;  3GTO H;  1A3V A;  3TN2 A;  5C0X G;  2L5T A;  4L5Q A;  3KK7 A;  2XNA C;  2F0W A;  1NMG A;  3PUV A;  4CJ2 C;  1X3P A;  3PF5 A;  2Z1C A;  1HFG A;  4A76 A;  3NXW A;  2UXD L;  5IP7 H;  4DK1 A;  2HQL A;  2A8V A;  1U5K A;  1XX8 A;  4KHZ A;  1KAB A;  1WTW A;  1OXU A;  4P2C B;  3S1Q H;  1I4P A;  1SMY C;  3PO3 H;  1VQA A;  3E5S A;  1EZ6 A;  4O1N A;  2B39 A;  3EJI A;  2D9U A;  2XSC A;  4KHP Q;  3J81 j;  1EY8 A;  1L1O B;  4PV1 C;  2NWG A;  1EUJ A;  3M3Y H;  1UAP A;  4B9W A;  2D62 A;  4GKJ L;  1CSP A;  4C1N I;  3K0Y A;  4GOP C;  3GDE A;  4PMC A;  3I4N H;  2E2H B;  1B44 D;  4FDB A;  3OHX C;  5FJ8 H;  4FF4 A;  2Z9H A;  1QVG A;  3CXC A;  2K05 A;  1A3U A;  4DR2 L;  4HMJ A;  1VF5 C;  1IXR A;  2WAQ E;  1E0B A;  1Y1V G;  1EY5 A;  3MFG A;  1GO3 E;  1HCZ A;  4IUN A;  4JI4 Q;  1ICF B;  1EQQ A;  3L2P A;  3JAM E;  3J81 i;  4G57 A;  1VMP A;  2MJ8 A;  5DM7 3;  5HY6 A;  1WTH A;  4L63 B;  1YHQ A;  3ONA B;  2QF7 A;  3NSW A;  1QE6 A;  1BNZ A;  3K5M A;  5GRO A;  1PH8 A;  2N49 A;  3Q8D A;  4C3J G;  3GTQ B;  5IYD H;  4JI8 Q;  1EY4 A;  1KDB A;  4DNI A;  1UUP A;  4LF8 L;  1YHA A;  2JA7 B;  2FMM A;  5A2Q L;  2K03 A;  2A1A A;  4DR4 L;  3R3O A;  1A15 A;  3KF6 B;  4LUV A;  1VQ5 A;  2F0V A;  5CBA E;  4DU9 A;  5C44 H;  3K59 A;  4A3B H;  4G4K A;  1EEF D;  1NE3 A;  2PMZ B;  4L5R C;  2K33 A;  3I70 A;  4XYQ A;  2D0O A;  4KJN A;  2K5W A;  5LL6 S;  3H94 A;  1IYJ B;  1GXD C;  1B9M A;  3NTK A;  5IY0 A;  4FYD A;  4MZ9 A;  1EZ8 A;  1LV9 A;  5C44 B;  1TWH B;  2Q2I A;  1HA5 A;  4U68 A;  5IT9 L;  5CV9 A;  3KUP A;  1XTC D;  2Z6K C;  2WAQ B;  4FF1 A;  1QNU A;  1B70 B;  2HIX A;  3K7A B;  4OX9 L;  4LFA L;  2AQ3 B;  4LF8 Q;  2K6A A;  3GTL H;  3K58 A;  2E2D C;  4RKL A;  1D6E C;  4LF7 L;  1NMF A;  3I73 A;  2HUG A;  3C2P A;  2K5D A;  1LT4 D;  2MNA A;  4V0B A;  1SMY D;  3RZD B;  4XT1 B;  4LFA Q;  4EQ5 A;  5LMN W;  2YTY A;  4DR7 Q;  4NXN Q;  1K3R A;  3BYY B;  1WCM G;  3J81 E;  3TEH B;  4LF6 Q;  1V1P A;  3A55 A;  1FJG Q;  1NAP A;  2YV5 A;  2NYZ D;  3ZJY C;  4DR7 L;  5I6W A;  5K36 G;  4NMZ A;  3OWE B;  4X65 Q;  1XMO Q;  4B3T L;  2YU9 B;  1S5F D;  4FNF A;  2EXD A;  1PYW D;  2ASB A;  2JA8 G;  1LTR D;  1TR5 A;  5M9O A;  4JI2 Q;  1K3B C;  1JJG A;  1SRU A;  1BKB A;  1LUZ A;  2JXM B;  1Y1W G;  3C3L A;  1SYF A;  2EY5 A;  2JN4 A;  1XMO L;  1FNW A;  4R4Q A;  1OXS C;  2PI2 A;  1KDC A;  3UE0 A;  1S3O A;  3PMF A;  1Z6H A;  4TSS A;  4AH6 A;  1MJC A;  1D8L A;  3EIV A;  1EIH A;  2K7V A;  2LY7 A;  1G2S A;  1Q46 A;  2RDH A;  4JI8 L;  3CD6 A;  2MGS A;  3BS1 A;  1H9R A;  4YHH Q;  2XRS D;  4FF2 A;  2DN8 A;  1Q3L A;  2NTT A;  3D31 A;  1S5E D;  3J7Z C;  3SVM A;  1ESF A;  3A8K E;  1VQG A;  5C4J H;  1TWA H;  1E3P A;  3BVG A;  3J80 c;  3I4L A;  2QDB A;  3VR4 A;  4DFA A;  1SJE D;  2OXP A;  1J9O A;  4JI1 L;  2WB1 E;  1Q8K A;  5G3L D;  3CCM A;  4KD3 A;  3QR8 A;  2F0I A;  5CMD A;  2B2T A;  2KOL A;  1J8I A;  3H3V I;  3W1B A;  4BY7 G;  3JC6 6;  2WKD A;  2P5Z X;  2HCC A;  1C7Y A;  1SEB D;  3UDX A;  2ALY B;  1C8C A;  4A3D H;  2R7Z B;  4LF9 Q;  4RGM A;  4GKK L;  3D4R A;  3J7A F;  4ID6 A;  4ALP A;  4JOI C;  5IP9 G;  2NZH A;  4EVO A;  1HZC A;  5CV6 A;  3ULL A;  1PLF A;  3F8T A;  1E22 A;  1A6X A;  2R3Z A;  3SK4 A;  3F2C A;  3X3N A;  4N9T A;  3JAM i;  5C4H A;  1FYC A;  1N36 L;  4HJ5 A;  5M3F B;  4ULL A;  1VQM A;  3HRZ C;  1YNN D;  2AWO A;  3ERS X;  4A3M B;  2SNS A;  4ZUJ A;  4BBR G;  3CU7 A;  3N52 A;  1UE6 A;  1RD9 D;  2ICI A;  3TS0 A;  2KHJ A;  1S5C D;  2UUC Q;  3GTL B;  1TWG H;  1P8L A;  2L9H A;  3NWT A;  2NVT B;  1AZQ A;  1IBK L;  1GUN A;  1L0W A;  1PVO A;  2E2J H;  3JAM c;  1B1Z A;  1VQJ A;  2IT1 A;  1SYE A;  3OOC A;  1STH A;  3NE5 B;  4QL5 A;  3GQB A;  1MBY A;  4UY8 C;  1CHP D;  2OCE A;  1IW7 C;  2F03 A;  4B08 A;  2EPB A;  3A7L A;  3STB C;  1STE A;  4ZLT F;  4R8N A;  2PZW A;  1LTL A;  1K28 A;  1HJP A;  2B8G A;  5BN5 A;  3S1R H;  2DGY A;  2Z6K A;  1U9R A;  4K2L A;  2NN6 I;  3NWS A;  4A3G H;  2R92 G;  4PG3 A;  4XQQ A;  3E3X A;  3GTM B;  1SSO A;  2VB2 X;  5CV8 A;  5CV5 A;  3HOV B;  4TVA B;  2VUM G;  5CGK A;  3PO2 G;  3U4V A;  1X9N A;  2QKI C;  1CHQ D;  2K4K A;  3RLO A;  1QB5 D;  4H0L C;  1IBM Q;  3M9B A;  4X66 Q;  1A8V A;  2A6H D;  4BY7 B;  3L3O C;  1VDZ A;  4DNR B;  2X6L A;  3SK5 A;  2Z6B A;  1WTQ A;  3S2D B;  4JW0 A;  4PNY A;  4HTH A;  5IGF A;  1LTB D;  3S15 H;  2KCM A;  2NZO A;  1Y1W B;  2I5L X;  3T53 B;  3HP3 A;  4P71 A;  3SXH A;  4I7Z C;  3CC2 A;  1ZYR C;  2WFW A;  2J0T D;  2A74 C;  1WTO A;  3KYH C;  2VUM B;  1SRO A;  2AUK A;  4CDC C;  1H9S A;  1XXG A;  2RDG A;  2R92 B;  5J39 A;  3VR5 A;  5GQO A;  3AB9 A;  2MPM A;  4A3I G;  2K28 A;  2TSS A;  5GAG C;  2K32 A;  2K5N A;  4K5W A;  3MXN A;  1AZP A;  1VCI A;  2IX1 A;  3T1H Q;  2NBF A;  1CKO A;  1E2Z A;  1R4P B;  2F0L A;  1ENA A;  2NN6 G;  3PCO B;  1F9R A;  2I07 B;  1A3T A;  4HJ8 A;  3DEO A;  2F0M A;  1KLG D;  1YNN C;  1J6Q A;  1VMC A;  2QW7 A;  4A4I A;  2CQA A;  2SNM A;  4AQY L;  1L1O C;  2UUC L;  1XNQ Q;  3S16 H;  1WTX A;  1JWM D;  3AYH B;  1UNS A;  1PDQ A;  2K04 A;  3S17 B;  1M4V A;  4IOA A;  3MWY W;  4KY6 A;  2EDG A;  5C44 G;  1HQM C;  4A3E H;  1F9Q A;  3UDI A;  2CFM A;  2JEB I;  1O7Z A;  4JCV E;  3A8I E;  2PO4 A;  2ATW A;  4F88 A;  4DF7 A;  1ZEQ X;  4DR1 L;  4J6H A;  1IW7 D;  1C48 A;  1PZI D;  4DK6 C;  4DGZ A;  2V4D A;  1STA A;  1VQE A;  2L11 A;  1CA6 A;  4C3H G;  1BDO A;  1LAB A;  3K81 C;  4C3I B;  1TU2 B;  1WCM H;  2Q2H A;  2B2V A;  1KLU D;  4LF9 L;  4GKK Q;  3MTS A;  2EYP A;  2QDL A;  3D3R A;  3PUY A;  5FLM H;  2EQS A;  3GTG H;  1MGS A;  2F3W A;  1T9H A;  3KBX A;  4KKU A;  1KHI A;  4JI5 L;  2A6H C;  3AFQ A;  1CM9 A;  4KHV A;  4DV3 L;  1WTR A;  2X69 A;  4DV5 Q;  2AQ2 B;  4AYB G;  3EFX D;  2A68 C;  1I94 L;  1TS5 A;  4LAA A;  2RCN A;  3EN2 A;  5LMN L;  2C9O A;  1QG7 A;  2R7F A;  4LUO A;  2BH2 A;  2E2I B;  1HXY D;  1K8O A;  2RQX A;  2G9D A;  2N3S A;  4RGN A;  2B2U C;  3ERQ A; 
#chains in the Genus database with same CATH homology
 3PF5 A;  1DGS A;  1NY4 A;  4HIK A;  4IPH A;  3RLF A;  4A76 A;  2Q2T A;  4R4T A;  1HR0 L;  1BVS A;  2I5M X;  5IP7 H;  2UXD L;  2HQL A;  1CKM A;  3CCU A;  2A8V A;  1U5K A;  4KHZ A;  2IY5 B;  2PI2 E;  2F3I A;  4A3J H;  4DUY L;  2E2I H;  2UXC L;  1N9W A;  1SFO H;  3HOW G;  1OXU A;  2B3G A;  4LW1 A;  1X3E A;  3S1Q H;  3PO3 H;  3S24 A;  2K52 A;  1VQA A;  2JEA I;  1XNR L;  1PH6 A;  4APV A;  1LYL A;  4KHP Q;  1EYG A;  3J81 j;  2DUD A;  2KHI A;  3W1G A;  1L1O B;  1UEB A;  3CCJ A;  4LF7 Q;  1XNR Q;  4B3R Q;  4YCV A;  1EUJ A;  1VQC A;  3TRE A;  3M3Y H;  3PO2 H;  2D62 A;  2YYZ A;  4C3J H;  1CSP A;  5J3B A;  3ICE A;  4A3L G;  4A3C G;  3PO3 G;  4GKJ L;  4GOP C;  2BA0 A;  3A0J A;  1TWH H;  3F1Z A;  3GDE A;  1QZG A;  3HOY H;  3I4N H;  1A0I A;  1VQF A;  1Q1E A;  4FDB A;  3D0F A;  5FJ8 H;  3WWV A;  1TWC H;  1QVG A;  2VL6 A;  1M1K C;  4A3L H;  2K50 A;  3PUX A;  1AE3 A;  3CXC A;  4LF5 L;  4DR2 L;  4GN4 B;  4DR6 L;  3GTK H;  4XTC S;  4GLV B;  5IYB H;  2R6G A;  1IXR A;  2WAQ E;  1K0R A;  1Y1V G;  4UP8 A;  2EIF A;  5BR8 Q;  1GD7 A;  2F4V Q;  3HOU G;  1KXL A;  1IBK Q;  1GO3 E;  1L2F A;  2A19 A;  2KCT A;  4DV0 L;  4JI4 Q;  1YJW A;  2UXB L;  3I4M G;  1PYB A;  3G71 A;  3U58 A;  4IJL A;  1Y1V H;  4LUZ A;  1EQQ A;  4DR5 L;  2IHF A;  3L2P A;  1HNZ Q;  1VQL A;  4JBJ A;  3J81 i;  2OTL A;  2HHH L;  3GO5 A;  3K7A H;  1QVF A;  4BXX G;  5HY6 A;  3MXN B;  2HHH Q;  1Y14 B;  2HT1 A;  1YHQ A;  1G29 1;  2UUA Q;  2NVY H;  4IJH A;  3BZC A;  4JOI A;  1TXY A;  4HJA A;  5AJ3 L;  1N34 Q;  1D7Q A;  5GRO A;  3CQZ H;  3HFZ B;  2N49 A;  3Q8D A;  1PH8 A;  4BBS G;  3MEF A;  4JI8 Q;  4MNO A;  4OXP A;  2OTJ A;  4DNI A;  5IYD H;  4LF8 L;  1YHA A;  2VQF L;  3G6E A;  2A1A A;  2MO0 A;  4JI0 L;  4DR3 L;  3CPW A;  3CP0 A;  4DR4 L;  1X65 A;  1YIT A;  1Q82 C;  3KF6 B;  4LUV A;  2YTX A;  1L1O A;  1VQ5 A;  5FLM G;  3E9I A;  1KD1 C;  4OWW B;  1V43 A;  1HNX Q;  3CCE A;  4KI0 A;  5C44 H;  4A3B H;  2HIV A;  3L0O A;  1Y1W H;  4GOP B;  1K8A C;  1NE3 A;  4BA1 I;  1I94 Q;  4NXM L;  4L5R C;  3M4O H;  1VQ8 A;  2Z0S A;  4LWC A;  5M5Y H;  2D0O A;  1JT8 A;  4O2D A;  3RZD H;  1IYJ B;  4DUZ L;  2QGQ A;  1XPU A;  5IY0 A;  2K75 A;  1KRS A;  4MZ9 A;  3CF5 A;  2JE6 I;  3FKI H;  4C2M H;  2UU9 L;  5JJI A;  1YNX A;  1QUQ A;  1QVC A;  3A5Z B;  2Q2I A;  1YI2 A;  1PH7 A;  4DR2 Q;  4JI3 Q;  2Z6K C;  3KJO A;  1B70 B;  4RMF A;  2HIX A;  2JA7 G;  5EAY A;  1HR0 Q;  4OX9 L;  4DV2 L;  4LFA L;  3H15 A;  4LF8 Q;  2ZTD A;  3I4O A;  2L15 A;  4JV5 L;  3ER0 A;  3GTL H;  1PH9 A;  1G51 A;  2KEN A;  1VQ7 A;  3HOX H;  1FGU A;  1PFS A;  2B29 A;  3HOZ G;  4PMW A;  1CKN B;  2ID0 A;  4AYB E;  4LF7 L;  4BY7 H;  3GTQ H;  1NMF A;  1X54 A;  3G48 A;  4JG2 A;  3I7F A;  1HR0 W;  2JJQ A;  2R7D A;  2QEX A;  4A3K H;  1B8A A;  2MNA A;  1PHJ A;  1OXT A;  1VS0 A;  4A3I H;  2JA5 G;  3KDF B;  3S14 H;  3CCV A;  4HIO A;  1PA6 A;  3HOV H;  2GVA A;  3OW2 A;  1NTG A;  4LFA Q;  4EQ5 A;  4X65 L;  3CPF A;  3HKZ E;  3KOJ A;  2YTY A;  5LMN W;  2R92 H;  4DR7 Q;  4BXX H;  4NXN Q;  1K3R A;  3CAM A;  4POG A;  1FJG L;  1WCM G;  1CKN A;  3TEH B;  4DKA C;  4LF6 Q;  5HGQ A;  1E1T A;  5BR8 L;  1OXX K;  4X64 Q;  1FJG Q;  3CCR A;  4QJF A;  3GD7 A;  2YV5 A;  5FJ8 G;  4BY1 H;  1I5F A;  3ZJY C;  4GOP A;  2ES2 A;  1PH5 A;  4DR7 L;  5K36 G;  4X65 Q;  4DV6 L;  1W3S A;  1XMO Q;  4B3T L;  1A63 A;  2EXD A;  4DAY B;  1IBM L;  2NVX H;  2IX0 A;  4NXN L;  1EIY B;  2ASB A;  1FVI A;  1VQD A;  4X62 L;  4A3E G;  3PIP A;  2JA8 G;  1BBW A;  4KLK A;  5IE8 A;  2JA7 H;  4YCW A;  3EBE A;  4P72 A;  4LNQ A;  4JI2 Q;  3L7Z C;  1JJG A;  1HZA A;  1SRU A;  1BKB A;  1LUZ A;  5JEA G;  4B3T Q;  4OO1 I;  3I4M H;  1PH4 A;  5M3F H;  1Y1W G;  1VQI A;  1HNW L;  4YWM A;  3M4Q A;  4DV6 Q;  2ZM6 L;  3F2D A;  1XMO L;  4DV7 Q;  4R4Q A;  1OXS C;  2PI2 A;  5M5X H;  3OTO Q;  2AKW B;  3LGJ A;  4OON A;  3UE0 A;  1S3O A;  4PZ8 A;  5IP7 G;  5IYB G;  3KJP A;  3K8A A;  1KC8 C;  4AH6 A;  3EIV A;  1MJC A;  1D8L A;  2ZJQ A;  2IHE A;  4A3F H;  3FP9 A;  2CWA A;  4JI8 L;  4X66 L;  1P16 A;  1Q46 A;  3AFP A;  3CD6 A;  3TS2 A;  5IYD G;  4YHH Q;  3J81 c;  1Z9F A;  3OTO L;  1YIJ A;  3B6Y A;  1KQS A;  2B63 H;  2WB1 G;  2UUA L;  2JA6 H;  2MQH A;  3HOY G;  4IFD I;  5LMU L;  3D31 A;  4YWL A;  3J7Z C;  4DV7 L;  1KL9 A;  2Q2U A;  1VQG A;  2WP8 J;  2JQO A;  4YY3 L;  5C4J H;  1TWA H;  1E3P A;  3J80 c;  4JI6 Q;  4JI4 L;  4DK3 C;  4P75 A;  1I3Q H;  4NXM Q;  4DV1 Q;  1MJE A;  4A93 G;  3NEL A;  4JI1 L;  1X6O A;  5M3M G;  2WB1 E;  4LF4 L;  1Q8K A;  3M7N A;  4JBM A;  2N78 A;  3CCM A;  4DV2 Q;  4BY1 G;  3A74 A;  2R93 G;  1IBL Q;  4A93 H;  4B3S Q;  1N32 L;  4JI5 Q;  3I55 A;  4DR3 Q;  4A3M G;  4WJ3 M;  1EQR A;  2PQA A;  3W1B A;  3H3V I;  1FL0 A;  1MKH A;  3M4P A;  3JC6 6;  4C3I H;  2VY3 A;  4BY7 G;  3DLL A;  1AH9 A;  4JI1 Q;  4LF4 Q;  4GNX A;  1PYS B;  1C7Y A;  4IOC A;  1WJJ A;  2LXK A;  3UDX A;  1KAW A;  2ALY B;  5IWA Q;  2GVB A;  1JJ2 A;  4A3D H;  4A3M H;  4LF9 Q;  1IZ6 A;  4GKK L;  4DPG A;  3VDY A;  4ALP A;  1YVC A;  4JOI C;  2YU9 H;  5IP9 G;  2NZH A;  1RL2 A;  4PZ6 A;  4PZ7 A;  1J5E L;  1HZC A;  2VNU D;  3ULL A;  5IYC H;  1X3F A;  4KHP L;  1J5E Q;  3I56 A;  3F8T A;  4IPD A;  1E22 A;  4AIM A;  4GNX B;  4RG1 A;  1EIF A;  1XPR A;  5JEA J;  2YTV A;  4JV5 Q;  1VQH A;  2CCZ A;  3E9H A;  3H0G G;  3U50 C;  3F2C A;  1N36 Q;  1WFQ A;  4DV0 Q;  3S2H H;  3TQY A;  3A5U A;  2PNH A;  1YJN A;  2Y0S E;  3JAM i;  1N36 L;  2F52 A;  4J15 A;  4BBR H;  4HJ5 A;  4B3R L;  1VQM A;  4OX9 Q;  4OWT B;  2BH8 A;  1XPO A;  4X6A H;  2AWO A;  3CME A;  3ERS X;  3PUW A;  2PQA B;  2OQ0 A;  1SMX A;  3OYY A;  2UUB L;  4HID A;  2OWO A;  2JA9 A;  4BBR G;  2AHO B;  5JJL A;  1UE6 A;  2AWN A;  3TS0 A;  2KHJ A;  1C9O A;  4JC0 A;  2UUC Q;  1TWG H;  1XJV A;  1P8L A;  5JJK A;  4X62 Q;  4JBW A;  1UWV A;  3I4N G;  1YHB A;  1IL2 A;  1I6H H;  4GKJ Q;  1IBK L;  1L0W A;  5ELN A;  1M90 C;  3CC4 A;  2UXB Q;  1PVO A;  2E2J H;  5ELO A;  2NVQ H;  4XIG S;  3JAM c;  4H02 A;  3G4S A;  4LFB L;  1VQJ A;  2IT1 A;  1QZH A;  2ZJP A;  1YBY A;  3GTP H;  4A75 A;  2UUB Q;  4Y52 H;  2BA1 A;  4LF6 L;  3UDF A;  1HNX L;  4DUY Q;  4QL5 A;  2UXC Q;  1BBU A;  4YHH L;  1K83 H;  1SR3 A;  1O7I A;  1U0L A;  1VQB A;  4YCU A;  3FKI G;  4QY7 A;  3J80 i;  2VQE Q;  3K80 C;  4R4C A;  2OCE A;  4JI0 Q;  4UY8 C;  4DR6 Q;  1I50 H;  1K73 C;  1PH1 A;  3CCL A;  3GTM H;  2VQF Q;  5FLX c;  3HKZ G;  3PV0 A;  1VQO A;  1YJ9 A;  3STB C;  3K0X A;  2VS1 A;  4R4I A;  1JMC A;  5E7N A;  1UE1 A;  1LTL A;  1HJP A;  4B3M Q;  2VQE L;  3S1R H;  1NBW A;  3AEV A;  5IP9 H;  2DGY A;  1NJI C;  1YEZ A;  2Z6K A;  3HOV G;  4Y7N H;  3KFU A;  1HNW Q;  3CW2 C;  1OTC A;  2NN6 I;  1V9P A;  4A3G H;  1GM5 A;  3PUZ A;  2R92 G;  4PG3 A;  2C35 B;  3CCS A;  4GNX C;  4A3K G;  3S17 H;  3U4Z A;  1Q7Y C;  1JJC B;  2D0P A;  4TVA B;  5DLQ E;  1PH3 A;  2VUM G;  1VQ6 A;  1H95 A;  4IPG A;  3PO2 G;  3U4V A;  1S72 A;  1X9N A;  4IO9 A;  1X3G A;  2K4K A;  5C4X H;  3RLO A;  4TQU S;  3FHW A;  1WI5 A;  2CWP A;  2JK8 A;  2VW9 A;  1K8G A;  1IBM Q;  1C0A A;  3M9B A;  4X66 Q;  1A8V A;  3BJU A;  2V1C C;  5C0X I;  4DV5 L;  2E5L L;  4IPC A;  4JI3 L;  4UP7 A;  1YZ6 A;  3K7U C;  4NPS A;  4DV3 Q;  2WAQ G;  4NB3 A;  4A3F G;  4JI7 L;  2RHS B;  1X55 A;  3PSI A;  4GS3 A;  3CC7 A;  3CCQ A;  4HJ9 A;  4B3S L;  1N32 Q;  1Q12 A;  3J7A 5;  4LFC Q;  3S15 H;  1X56 A;  2KCM A;  3ULP A;  1IBL L;  4GLX A;  2NZO A;  4JI7 Q;  2ZJR A;  3UE1 A;  2I5L X;  1S40 A;  4P71 A;  2E5L Q;  3CC2 A;  3TRZ A;  1GKH A;  2K5H A;  2WFW A;  4IFD G;  5GAE C;  1EOV A;  1XMQ Q;  3KYH C;  4QGU A;  4DV1 L;  3NBH B;  1K9M C;  1SRO A;  3E0E A;  1E24 A;  1CUK A;  5GAH C;  5M3M H;  4JBK A;  4JI6 L;  3KDF A;  1ASZ A;  5GAD C;  4QIW E;  1N8R C;  4A3C H;  2K5V A;  1EWI A;  5GQO A;  2XGT A;  2R7Z G;  4A3I G;  2JA5 H;  3M85 A;  3KF6 A;  5M3F G;  1QUQ B;  5GAG C;  1GVP A;  3T1Y L;  3PIO A;  2K5N A;  4POF A;  5IWA L;  3T1H L;  2E2H H;  2VZA A;  2GN5 A;  1VCI A;  1SN8 A;  2IX1 A;  1CSQ A;  3T1H Q;  4O0A A;  1CKO A;  1SLJ A;  1WOC A;  2LXJ A;  1VQP A;  1Q81 C;  1AE2 A;  2MO1 A;  1UE5 A;  2NN6 G;  1XNQ L;  3H3V H;  3PCO B;  3HOU H;  4YWK A;  4K0K Q;  1E7Z A;  4AQY Q;  1XMQ L;  3S2D H;  2I5H A;  4HJ8 A;  1MIU A;  4UPA A;  2VUM H;  5IT9 c;  2AMC B;  2PMZ E;  2B63 G;  4A3D G;  4LFB Q;  3RNU A;  1J6Q A;  4JI2 L;  5LMN Q;  4A4I A;  3S1M H;  5C4X G;  3NEM A;  4HIM A;  4AQY L;  5C3E H;  1L1O C;  4YY3 Q;  4OO1 G;  1A62 A;  2K14 A;  2UUC L;  1SE8 A;  2CKZ B;  1N33 Q;  1VQN A;  4GN3 B;  1XNQ Q;  3S16 H;  2QA4 A;  4K0K L;  2E8G A;  3AYH B;  4A3J G;  4LF5 Q;  3RR5 A;  1HZ9 A;  4L5S A;  3I2Z A;  3PGZ A;  4WJ4 A;  4X64 L;  5M5W H;  2ZTE A;  4IOA A;  4UP9 A;  1HZB A;  3RZO H;  3H0G H;  4QQB X;  4P73 A;  5C44 G;  2CQO A;  2RHQ B;  4A3E H;  1VQK A;  3HKS A;  1WYD A;  4R1J A;  2Y0S G;  3UDI A;  1N33 L;  1ASY A;  2CFM A;  2NVT H;  4BA2 I;  2H5X A;  2JEB I;  4JCV E;  3IRB A;  3HOW H;  4HJ7 A;  2ATW A;  3UDG A;  4C3H H;  3W5O A;  4DV4 Q;  4OWX B;  1OXV A;  2XTI A;  3ULJ A;  3NEN A;  2ZM6 Q;  4DR1 L;  2JA6 G;  2R7Z H;  1PV4 A;  1V1Q A;  1B7Y B;  1Q1B A;  1VQ9 A;  3AQQ A;  4DK6 C;  4MTN A;  4JYA L;  1VQE A;  3STB D;  3S1N H;  4B3M L;  4BBS H;  4DR1 Q;  5LMU Q;  4A3G G;  4GLA C;  3GTJ H;  4GN5 A;  5C0X J;  3K81 C;  3F2B A;  3KF8 B;  4DV4 L;  4DR5 Q;  1HNZ L;  1R9T H;  4DR4 Q;  1WCM H;  2KBN A;  2Q2H A;  1LM0 A;  3RN5 A;  2UXD Q;  1E1O A;  2FXQ A;  3SGI A;  3RN2 A;  4JYA Q;  4LF9 L;  3DM3 A;  2F4V L;  4DAM A;  1Q86 C;  3RLN A;  1RIP A;  4GKK Q;  3T1Y Q;  3PUY A;  1XTD A;  5FLM H;  5AJ3 Q;  2EQS A;  4R4O A;  1N34 L;  1EFW A;  3GTG H;  2LSS A;  3PF4 A;  2N8N A;  1T9H A;  4ME3 A;  2I0Q A;  3HOX G;  3HOZ H;  4A3B G;  2JA8 H;  1KHI A;  4IFD J;  1HH2 P;  4EX5 A;  2RF4 A;  4JI5 L;  2ZTC A;  1UE7 A;  1W2B A;  1G6P A;  3AFQ A;  1KIX A;  2MFI A;  1KRT A;  4DV3 L;  3BZK A;  2UU9 Q;  4L5T A;  4DV5 Q;  3BU2 A;  4AYB G;  4DUZ Q;  4P74 A;  1I94 L;  1VQ4 A;  1TWF H;  2RCN A;  3EN2 A;  5C3E G;  5LMN L;  1PH2 A;  1JE5 A;  2R7F A;  4LUO A;  3GTO H;  2R93 H;  5C0X G;  2BH2 A;  1JB7 A;  3KLW A;  5IYC G;  4L5Q A;  4LFC L;  1Z47 A;  2OQK A;  2N3S A;  3CMA A;  5H1S E;  1NMG A;  3PUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...