2PI2E

Full-length replication protein a subunits rpa14 and rpa32
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
VDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Full-length Human RPA14/32 Complex Gives Insights into the Mechanism of DNA Binding and Complex Formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication, dna binding protein
molecule keywords Replication protein A 32 kDa subunit
total genus 27
structure length 117
sequence length 117
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pi2E00
2K50A 1TWHH 4HIKA 2VNUD 3IRBA 1K8AC 1X54A 1NMGA 1VQ8A 4AIMA 4X64Q 4UY8C 4DV4Q 4DUYL 4ME3A 3TQYA 1A0IA 3CMEA 3U58A 1I94Q 1IBLQ 3PCOB 3JC66 1NTGA 3H0GG 4GN5A 4YWMA 1IXRA 2OCEA 5IWAL 1S3OA 2N8NA 3AEVA 1JJ2A 5FLMH 4JYAQ 1N36L 1KRSA 3J81i 4LF4Q 4YY3L 4IOCA 2F52A 1RIPA 2C35B 3CP0A 1X65A 4WJ3M 1JJGA 4DV6Q 2YYZA 4Y52H 3GTQH 1H95A 1VQDA 5C3EH 4DK6C 4GS3A 1SN8A 3STBC 2QA4A 1HNXL 5GAEC 3A5UA 2E8GA 3BZCA 4KLKA 4MTNA 2VQFL 1V9PA 1KXLA 4DR4Q 2UXBQ 1YJNA 1PH1A 4JI4L 2VL6A 4BBSG 4DPGA 1BBUA 3RNUA 3CCQA 2AKWB 3GDEA 5J3BA 4IPDA 2VW9A 3FKIH 4JI4Q 1FJGL 1E1OA 1L1OA 1VQLA 2D0OA 4Y7NH 2BH2A 4DV3L 3CCRA 3PO2G 3GTOH 1LUZA 4OONA 4DV2L 4DV7L 2JA8H 3BJUA 3RLNA 3H3VI 1N33L 3S15H 3GD7A 4GKKL 1HNXQ 1X56A 2UXBL 4BBRG 2OWOA 3FP9A 4L5TA 3U4ZA 4LF6Q 1KRTA 1L0WA 4LF4L 3KJPA 4A3EH 4JI2Q 2YTXA 4QJFA 4JCVE 4A3JG 3PF5A 4YWLA 4O2DA 1YHAA 1HZAA 2ES2A 4JV5L 4DV0L 5M3MH 1VQIA 2B63H 1HNZQ 3K81C 4QQBX 4DV4L 4YWKA 1LTLA 1K73C 3EBEA 4DUYQ 1B70B 1VQ5A 4JI6Q 1YVCA 4ALPA 1EQQA 3HOZH 4BXXG 1Z47A 2LSSA 4P74A 4DV2Q 2OQKA 3F8TA 4RG1A 4BY7H 2N3SA 4JI2L 1FVIA 4DR7Q 4B3RQ 2K4KA 5EAYA 1GM5A 1NJIC 1C0AA 2R6GA 4DR2Q 3KLWA 5JEAJ 4LF9L 3ERSX 1YJWA 1QZHA 3NELA 4DR3Q 3S1QH 4IPCA 4A3MH 1OXXK 3CCVA 2AMCB 1OTCA 2I5LX 3K7AH 4JI1L 4JI1Q 5M3FH 3T1YL 3D0FA 4MNOA 3PUZA 1Z9FA 2ALYB 2IHFA 5IYBG 3H15A 5LMUL 1IBKL 1PH7A 2UU9Q 4LFAL 4A3GH 3UDXA 5ELNA 4NPSA 2Z0SA 1E3PA 2EIFA 3M3YH 3FHWA 2V1CC 4DV1Q 4KHPQ 1GKHA 4KI0A 1QZGA 4DR7L 3HOWG 4A3FG 4A3DH 4LUOA 4DV5Q 3PUWA 3UDIA 3PIPA 1C7YA 3RN5A 5IWAQ 1HZ9A 4A75A 1L2FA 4X66Q 1IBMQ 2YU9H 2IT1A 1V1QA 2KHIA 4AYBG 5IP9H 2ZJRA 3M85A 1J5EL 2PNHA 2RHQB 2DGYA 1EQRA 2YV5A 4JI6L 4JI3Q 2BA0A 2K52A 4LF7Q 1K3RA 1BKBA 1NBWA 3STBD 1Y1WG 1WI5A 4JI5Q 2LXJA 3UE1A 3UDFA 4YCVA 3AYHB 3F1ZA 2HT1A 4A3GG 3S2HH 2B29A 2KHJA 1TWCH 1VQ9A 4KHZA 3KJOA 1WCMG 1VCIA 5HY6A 4YHHL 1Q7YC 2E2JH 1Q1EA 1UWVA 2OTLA 1G51A 4H02A 3G71A 1YIJA 4JV5Q 3U50C 1Q82C 1K0RA 2R93H 1PH2A 3RZOH 3CW2C 1KD1C 2PMZE 2UXDL 1I94L 4GOPA 2NZHA 3DLLA 3CPFA 2MNAA 2K75A 4LFAQ 2VUMG 4DAYB 2R92G 4GKJL 1CSQA 1X55A 1Y1WH 1UE6A 3T1YQ 1EFWA 2ZJPA 4B3MQ 4GLVB 1RL2A 1WOCA 5IP9G 1XNQQ 1T9HA 2JA6G 1YZ6A 1PH5A 3AFQA 1VQMA 3PO3G 4BXXH 1E24A 2XGTA 2NVQH 3H0GH 4X62L 3RZDH 3RR5A 3ULJA 4QIWE 4DV3Q 4LF5L 3KF6A 4LFCQ 2ASBA 2A8VA 1PVOA 1X6OA 2VS1A 3K7UC 1G6PA 5JEAG 2RCNA 3NBHB 5C0XG 1VQCA 3W1GA 2N78A 1UE7A 3GTJH 1HNWL 1NE3A 2YTVA 3RLFA 5JJIA 2HQLA 2AWNA 4OWXB 1I50H 4EX5A 4R4TA 3PIOA 4A3BH 3K8AA 3HOZG 4GNXB 3HOYH 4LW1A 2CWPA 3F2DA 2F3IA 1XJVA 1A62A 1B7YB 1QVCA 2Y0SE 5BR8Q 4K0KQ 3CPWA 1SROA 1OXUA 4YHHQ 2UUCL 4IOAA 1SR3A 4AQYQ 2PQAA 4BBSH 4OO1G 2FXQA 4LUVA 4JI7L 3G4SA 2K5HA 3RN2A 1VQFA 1IBLL 4YY3Q 3PF4A 1FL0A 2JA5G 4IFDG 1PYSB 4LF7L 2Y0SG 3HKZE 4JOIC 4JI0Q 1IBML 5HGQA 3CCLA 3I4OA 4PZ7A 3CF5A 4HJAA 4LF8Q 2UXCL 4RMFA 1NMFA 4B3SQ 4A3CH 4JI3L 2K5NA 1Q86C 4X65L 4DR6L 4MZ9A 2ZJQA 3MEFA 1YBYA 4A76A 3TRZA 1HH2P 1OXTA 3Q8DA 2WAQE 2B63G 4LWCA 4AQYL 3HOXG 3I55A 1XNRL 4A3DG 2NN6G 5AJ3Q 3M4QA 5E7NA 4A3JH 1PH8A 1EYGA 4JI8Q 4NXNL 5C3EG 4HIOA 3J7ZC 3HOVG 1VQ6A 1KIXA 1HZBA 2WB1G 3CC4A 2R92H 4R4IA 4L5SA 1N33Q 2NZOA 3CCJA 4NXNQ 1VQAA 2OQ0A 2VZAA 1PFSA 1KC8C 2JQOA 5FLMG 4A3CG 2A1AA 4BY7G 4DUZL 2VQEQ 4HIMA 2KCMA 3OW2A 4XTCS 4JG2A 2N49A 3NENA 4LUZA 4AH6A 3CC2A 4B3TL 1Q1BA 2YTYA 4PZ8A 1VQOA 2ZTEA 1YITA 1VQJA 1HZCA 2K5VA 1YJ9A 4P73A 1YHQA 2PI2E 2R7DA 4JYAL 3TEHB 1O7IA 3E9IA 5C44G 5IYBH 1XMOQ 4GN3B 5C0XJ 1Y14B 3J80i 2JEAI 1VQGA 1JB7A 3KYHC 3T1HQ 3HOYG 1L1OC 4LFBL 2NN6I 1LM0A 2EQSA 2E2IH 1I5FA 3FKIG 2JA6H 3G48A 3I2ZA 2WP8J 5M5YH 1CKMA 3K0XA 1X3EA 2R7ZG 1W3SA 2HIXA 1YHBA 3CCSA 4A3BG 1I3QH 4NXMQ 3BU2A 1MIUA 2UUCQ 2BH8A 1AE3A 3KFUA 1A8VA 3H3VH 2IX0A 3GTGH 3J7A5 4EQ5A 3EN2A 1J6QA 4IO9A 3S2DH 2LXKA 2B3GA 3E9HA 4DAMA 4A3KH 5M5WH 3DM3A 3I4MH 1QUQB 4GNXC 4GOPB 1N8RC 4LF5Q 4LNQA 4A3IG 4GN4B 4BY1G 5C4XH 1HJPA 1HNWQ 1PA6A 1D7QA 5IYCG 4WJ4A 5ELOA 2JA7G 4L5QA 2IHEA 3CXCA 1VS0A 1XMQL 2ID0A 1TWFH 1I6HH 1IYJB 1UEBA 1V43A 2AHOB 3OYYA 4P72A 2ZM6L 3S1MH 2JJQA 3CQZH 1EUJA 2MFIA 2JEBI 5IE8A 4A4IA 4X65Q 2VUMH 1PH6A 4OO1I 3ZJYC 3S1RH 4R4CA 1N32Q 4DR3L 1Q8KA 2UUAL 4YCWA 3EIVA 2Q2IA 3S14H 2VQFQ 3CCUA 1OXVA 1XTDA 2HIVA 3W1BA 4FDBA 5IYDH 4HJ7A 2JA7H 2E5LQ 3I7FA 2OTJA 2UXDQ 1GD7A 2R7FA 1MKHA 1CKNB 4GLAC 1VQBA 4TVAB 3J81c 2JA9A 3AFPA 3BZKA 1S40A 4JI5L 4GLXA 1PH4A 2E5LL 4DR6Q 1VQ7A 1EIFA 4P71A 3S17H 3KOJA 1N32L 1DGSA 4IJHA 4X64L 4K0KL 4A3LH 2IY5B 3B6YA 1XMOL 1AE2A 1X3GA 4X66L 5C0XI 1PYBA 3K80C 5IY0A 1JT8A 3W5OA 3PSIA 1WFQA 3ICEA 1TXYA 3A5ZB 3PO3H 3WWVA 4YCUA 2XTIA 1PH9A 4DV0Q 3ER0A 2WB1E 4PG3A 1PH3A 3PUXA 4OWTB 5IYCH 4R1JA 3U4VA 4OWWB 1HR0W 4DUZQ 1YNXA 1C9OA 3GTLH 5DLQE 1E22A 5GQOA 4DV1L 5FJ8G 4B3TQ 1XPUA 2HHHQ 5C44H 1A63A 5M3MG 1X3FA 3M4PA 3F2CA 2VQEL 1HR0L 1KHIA 3OTOL 2Q2HA 1HR0Q 2UUBL 2UUBQ 3M4OH 4GKKQ 1CKNA 2E2HH 4B3ML 1Q46A 2WAQG 3HOUG 4JI8L 3ULPA 4OX9L 4DR1Q 2F4VQ 4DNIA 2AWOA 4C2MH 4B3RL 1TWGH 3J81j 1R9TH 2ZTDA 2CKZB 1W2BA 4BY1H 4JBMA 4LF9Q 2JK8A 1CSPA 2CWAA 4JOIA 3ULLA 2IX1A 2R7ZH 2CQOA 4UP8A 1K9MC 2D0PA 1CKOA 3GO5A 5GADC 5IT9c 1ASZA 1XPOA 5LMNL 4A3MG 1EWIA 2JA5H 4JBKA 3A0JA 2JE6I 2MQHA 1SMXA 3S16H 2CCZA 3MXNB 4GKJQ 1Y1VG 4XIGS 2EXDA 3HKSA 4JBJA 1N9WA 3JAMi 2NVXH 3I4NH 3RLOA 2UXCQ 3KDFB 1QVGA 4LF8L 4A3IH 1D8LA 2A19A 2WFWA 1N34Q 4OXPA 2KBNA 5IP7H 4A93H 4GOPC 3I4MG 4NB3A 3A74A 3HOXH 4GNXA 4A3FH 3GTKH 4KHPL 4AYBE 1MJCA 4JI7Q 4LF6L 4POGA 3PO2H 3LGJA 2MO0A 2Z6KC 3T1HL 1S72A 4BBRH 3SGIA 1UE1A 2K14A 5C4JH 4A3LG 5LMUQ 1JE5A 1WJJA 1J5EQ 2NVTH 4LFBQ 2Q2TA 4OX9Q 2JA8G 1VQEA 1E7ZA 5M3FG 1BBWA 3TREA 5JJLA 1Y1VH 5IYDG 3GTMH 1IZ6A 2D62A 5GAGC 4A3EG 1XMQQ 5M5XH 1FJGQ 1JJCB 1U5KA 1VQHA 4APVA 2ZM6Q 2HHHL 2NVYH 3M7NA 2R93G 1KQSA 3HKZG 4IPGA 4X62Q 1XNRQ 1UE5A 5FLXc 4A93G 5GROA 2Z6KA 1JMCA 1EOVA 3HOWH 3JAMc 3CCEA 4DR4L 1SRUA 1BVSA 5FJ8H 1QUQA 3S24A 2KENA 4UPAA 4DR1L 3NEMA 4C3HH 3F2BA 2F4VL 3S1NH 4IFDI 2PI2A 2KCTA 1Q81C 5K36G 3I56A 3KF6B 1CUKA 1Q12A 4O0AA 4DR5Q 1B8AA 1XNQL 1OXSC 3L2PA 2L15A 4HJ9A 3VDYA 4B3SL 3HOUH 1P16A 4UP7A 1WYDA 4IFDJ 4DV6L 3PUYA 4R4QA 3L7ZC 4JI0L 1QVFA 4L5RC 4POFA 4A3KG 5IP7G 3PV0A 2I0QA 2BA1A 2H5XA 1KAWA 3TS0A 3AQQA 4NXML 1YEZA 1VQPA 2CFMA 4UP9A 1XPRA 2GVBA 1K83H 1E1TA 3TS2A 4C3JH 5LMNW 1FGUA 1N36Q 1GO3E 3PUVA 4HIDA 3CCMA 3HFZB 3CAMA 5BR8L 1ASYA 1VQNA 1TWAH 2ZTCA 1N34L 3GTPH 4QGUA 3J80c 2GN5A 3CMAA 4DV5L 4HJ5A 1X9NA 4X6AH 4BA1I 2ATWA 5LMNQ 1KL9A 3CC7A 3I4NG 1HNZL 5C4XG 2I5HA 3KF8B 3L0OA 4QY7A 2MO1A 2GVAA 1GVPA 1M1KC 1PHJA 3D31A 1WCMH 1EIYB 1K8GA 3M9BA 1SFOH 2RF4A 4IJLA 5GAHC 4HJ8A 1IBKQ 2UU9L 3UDGA 4PMWA 3PGZA 2VY3A 2QEXA 1M90C 2UUAQ 4PZ6A 1SE8A 1L1OB 4DR5L 1VQKA 1U0LA 1VQ4A 1PV4A 4QL5A 4JC0A 1SLJA 2PQAB 3E0EA 4R4OA 4DK3C 4DV7Q 2RHSB 4P75A 3CD6A 5JJKA 4IPHA 4C3IH 2QGQA 3OTOQ 2DUDA 1IL2A 1AH9A 3UE0A 1G291 4LFCL 1P8LA 1LYLA 4TQUS 4DR2L 1YI2A 4JBWA 1NY4A 5AJ3L 2I5MX 3G6EA 4BA2I 3HOVH 5H1SE 2Q2UA 1MJEA 4DKAC 4J15A 3KDFA
chains in the Genus database with same CATH superfamily
1EU4A 1TWHH 1NCVA 3FVQA 4RGTA 1YNJD 1X54A 2B2WC 1K8AC 1VQ8A 3A8JE 2PMZB 1FNUA 3T56B 4ME3A 2KECA 1JWUD 1ILQA 3PCOB 3X3NA 1IW7D 1K8OA 3DM1A 1S3OA 2CHBD 3JAML 1JJ2A 4JYAQ 1I6HB 3K7AB 4OEMB 3J81i 4YY3L 4A3MB 3SXHA 1UEAB 3MVVA 3J80L 2C35B 3CP0A 4HMJA 1S5BD 5EPLA 4WJ3M 3GTQB 1ONLA 1T5EA 3GQBA 5FK9C 2QA4A 1HNXL 5GAEC 4KLKA 3HZXA 5I6WA 2EY1A 2FINB 1YJNA 1PH1A 4O1NA 4JI4L 4QCLA 5IODA 1BBUA 2L4NA 3NPPA 5T1GA 4FYDA 5D65A 3FEWX 1VMPA 2D0OA 1JCKB 3CCRA 1PYWD 4DV2L 1SE2A 3H3VI 2C9OA 1N33L 3S15H 3GD7A 4IN3A 1WTQA 2A5HA 3FP9A 1SMYD 2JYOA 1RTNA 1L0WA 4A3EH 1HXYD 4JI2Q 4JCVE 1PTOB 1V1PB 4YWLA 2NBFA 4KKSA 1YHAA 2ES2A 5M3MH 1HNZQ 1RKNA 3H91A 3K81C 5DNFA 1PXUA 1K73C 2RBMA 4KN4C 3T16A 1D6EC 2Z6BA 4ALPA 1G6ZA 1MD2D 2LSSA 3OWEB 3MWYW 4DV2Q 4BY7H 1O7YA 1FVIA 5EAYA 3SDZA 2R6GA 3D4RA 3KLWA 5JEAJ 4LF9L 1YJWA 5ELBA 1QZHA 3NELA 4QUFA 3CCVA 1SNMA 4R8NA 1OTCA 3MFYA 4MN3A 4JI1L 4OGQC 3VYSA 2DNEA 3J7YW 5M3FH 2CH4A 1IBKL 1AN8A 3VYTA 3I73A 2TSSA 2Z0SA 3FHWA 3QB3A 4DV1Q 3BS1A 4A3DH 1PTOC 4LUOA 3PUWA 3PIPA 4BS9A 4A3GB 3S1RB 2A69C 1IBMQ 1LT4D 1HFGA 2KHIA 5IP9H 4JI6L 3M85A 2DGYA 1EQRA 1V1OA 4JI3Q 1BKBA 1NBWA 3TP6A 4WRDA 4JI5Q 3GTMB 2LXJA 3BVMA 3X3MA 3MTSA 1H9KA 1Q1EA 1UWVA 3TP7A 4JV5Q 1YIJA 1K0RA 5DM63 4DK1A 4F87A 3CPFA 2K75A 4GKJL 5A2QE 2DY7A 2TMPA 3D3RA 5IP9G 1XYIA 1XNQQ 2DJGC 1I3QB 3PO3G 1TIID 3HG9A 4BXXH 3H0GH 5IT9L 3A54A 4V0BA 2A8VA 1PVOA 4ZK9B 5JEAG 1U4RA 2WAQB 1WTVA 1NE3A 3V2TA 1BNZA 5JJIA 2F0JA 2AWNA 5FO7B 4CKCA 4EX5A 3PIOA 3K8AA 3V96A 3HOYH 5T1IA 2F3IA 1A62A 1QVCA 2JA8B 3CPWA 4YHHQ 1QNKA 2KOLA 4OO1G 2SOBA 3KF8A 4JI7L 3MFGA 3MXNA 3G4SA 2K5HA 3RN2A 3S1NB 3E3XA 2E2HB 3T13A 3QOLA 5HURA 4ZUJA 4HJAA 1I4PA 1NMFA 3O13A 4X65L 1STEA 4MZ9A 1R4QB 4RAUC 3MEFA 1BCPB 1A2UA 2BDNA 4FVMA 4F88A 2WAQE 4LWCA 4AQYL 4CGYB 4A3DG 2F3VA 2NN6G 3M4QA 3VR6A 4QMGA 2WACA 1KLUD 4FXDA 4L5SA 2P5ZX 2NTTA 1X3QA 3RUZA 2A69D 3K58A 4A3CG 5CMDA 1TKWB 2X69A 3M7GA 1O78A 4AH6A 5FLXL 2B2UA 2YTYA 3S16B 4PZ8A 1G8ZD 2ZTEA 1YITA 1HZCA 1YHQA 4P73A 2RDGA 3TEHB 1D5XC 5C44G 3PIO3 4GN3B 5C0XJ 5I9OA 1KLGD 1Y14B 4HN7A 3J80i 3GTJB 1JB7A 3T1HQ 5I6YA 2NN6I 4IURA 2EOTA 1JOOA 4NDXA 1AZPA 4C3IG 4L63B 1NAPA 3G48A 3I2ZA 3I4MB 2OF1A 3SK6A 3K0XA 5JEAH 3AMUA 3H0GB 3LNNA 1I3QH 4ZQ3A 2JXMB 1MIUA 1A8VA 4UHVA 4X3KA 1CK1A 4EQ5A 1J6QA 2HUGA 5D3DA 3K5LA 3DM3A 1MBYA 5E1FA 2PNRC 1HNWQ 3DMUA 4MHEA 5IYCG 3U9OA 1EY7A 2IHEA 1E0BA 4RH6A 1TWFH 2SDFA 2ZM6L 4K8JA 3S1MH 4KY5A 2JJQA 4X65Q 4HEDA 2MFIA 4A4IA 4OO1I 3S1RH 4R4CA 3P1HA 1VDZA 2VQFQ 1XTDA 4FDBA 2JA7H 2E5LQ 1O7ZA 2EE1A 1GD7A 2KA7A 1MKHA 4GLAC 3AFPA 1KTKA 1S40A 1PH4A 4A3JB 1VQ7A 3KOJA 3MA2B 1DGSA 1LTAD 1RCVD 4IJHA 4X64L 1B3AA 1M4VA 4A3LH 2IY5B 1NR2A 4C3IB 3F2UA 5IY0A 3PSIA 4ZLTF 3PO3H 4YCUA 1PH9A 3ER0A 3AU7A 3QWNA 4DK0A 4PG3A 1PH3A 4DUZQ 1ZYRC 4EVOA 4DV1L 1ICFB 4B3TQ 4DA2A 5C44H 2K33A 1SNCA 5M3MG 1X3FA 3M4PA 1GJXA 2UUBL 1S5DD 5KNDA 1HR0Q 1H9SA 1CKNA 3D8GA 2WAQG 2F4VQ 1D1KA 3FPPA 2AWOA 4B3RL 4M8AA 2E2IB 5C4XG 1CHQD 3OMCA 3ULLA 2EXZA 4IUUA 2D0PA 3GO5A 3EFXD 4KMUC 1EWIA 4JBKA 2JE6I 3J7AV 3DWAA 3S16H 5EGTA 2B8FA 4GKJQ 2EXDA 2NVXH 4XT1B 2UXCQ 1QVGA 2QEJC 2E75C 1GXDC 5IP7H 4A93H 4CDCC 2MJ8A 4A3FH 3GTKH 1DCZA 1MJCA 4POGA 1DZ1A 2EY2A 2Z6KC 1PZKD 4HSVA 2RSOA 2XIWA 4PV1C 1WJJA 4K8IA 2JA8G 1CFMA 1WD0A 1CM9A 1IKMA 2ZT9C 3GTMH 4JK1C 2L12A 1EIHA 1FJGQ 5CBEE 4APVA 1E2VA 2K04A 3HKZG 2SNSA 1XNRQ 1UE5A 3NWSA 5FLXc 1JMCA 4DR4L 1IW7C 2C5CA 2F4VL 1ML0D 4IFDI 3M3YB 1GUNA 4TKOB 3MXGA 3KF6B 1CUKA 2E74C 2KVMA 4DR5Q 1OXSC 3L2PA 2L15A 3HOUH 3LWEA 3NK9A 1TVXA 4JI0L 4K5VA 2LFNA 4JW0A 1MSGA 1DOMA 2Z1CA 3MHBA 3AQQA 3C1EA 1RDPD 1EYCA 2JA5B 5DEHA 2ZXOA 2GVBA 5FO9B 3S9WA 5CC4A 3TS2A 5JOBA 1ET6A 1TWAH 2ZTCA 2Q8IB 3J80c 4DXGA 2GN5A 5ELCA 4HJ5A 3G6JB 3NHHA 1KL9A 1EWHA 3I4NG 4DN4M 1HNZL 1BBXC 3PQIA 2N55A 2A6HC 5E4WC 1F9PA 4QY7A 1HUMA 1M1KC 1EQTA 4HR7B 1SFOH 2RF4A 4HJ8A 1IBKQ 4DFAA 5IGGA 3JAME 3PGZA 1PFNA 1U0LA 2O4XA 4QL5A 1DONA 4DK3C 2KQ3A 4DXFA 5JJKA 1PRTC 4LJZC 2QGQA 4C1NK 2DUDA 4LFCL 1P8LA 3S17B 2B2YA 1LYLA 4N9PA 4DR2L 1FNWA 4BY1B 1MGSA 2XVSA 3G6EA 1JWMD 3HOVH 1EQVA 4C2MB 5IGFA 2K01A 2WIIB 2HQEA 4HIKA 3NUCA 4LAAA 1NMGA 3BVZA 4IQZA 4DUYL 1I94Q 1A0IA 1IBLQ 2ICEC 1NTGA 3H0GG 4GN5A 1TWFB 2VB3X 2EYLA 4LF4Q 4IOCA 4XQJA 4RHRA 1RIPA 3K5MA 1IYVA 4FF4A 4DV6Q 1OO9B 4RGMA 4Y52H 3GTQH 4C3HG 1H95A 1G91A 3STBC 3A5UA 3BZCA 4MTNA 1IYUA 1F9SA 4K14A 4U673 1SEBD 3A8IE 3PMFA 1KXLA 2IPKD 4DR4Q 3NBHA 3C3LA 4DPGA 3CCQA 2AKWB 2O5IC 5J3BA 4IPDA 3Q23A 1FNVA 4FF2A 4XYQA 3PO2G 3MZ5A 3GTOH 2B63B 4ZKBB 2KHSA 3NQTA 1ZXTA 4XQNA 5LHY1 4NW2A 2IW3A 5JPMC 4GKKL 4BBRG 5M3MB 3Q24A 1PTOH 3U4ZA 4ZCKA 1EY4A 4QJFA 1ZKOA 2NN6H 2F0TA 1VQIA 4OIJA 2LS01 2B63H 1K28A 4YWKA 1JE4A 1LTLA 4V190 4H0LC 1JOQA 1B70B 1Y1WB 5C4ZA 1YVCA 1Z47A 1EOTA 3ZYYX 1ENCA 4ABNA 4CHTB 3ITPA 5ISRA 1WTWA 1SDFA 4DR3Q 1HPCA 1B44D 3K7AH 3ONAB 1S5ED 4IALA 2JA6B 4JI1Q 3T1YL 4MNOA 5IYBG 2IHFA 2MHVA 4LFAL 5C3XA 3UDXA 1HRJA 3BDOA 5CYUA 4NPSA 2L5TA 2N88A 1LT3D 1VMCA 2MUYA 1GKHA 1QZGA 4DR7L 1LTID 4DNTB 3UDIA 2G9DA 2M2LA 5IWAQ 2YU9H 2NVYB 1J5EL 1V1QA 1X32A 4AYBG 1HQMC 2PNHA 2YV5A 4HTHA 4LF7Q 4C1NI 1BCPF 1WI5A 2BCOA 1VF7A 4CKEA 3UE1A 3UDFA 4YCVA 3F1ZA 2HT1A 2M9VA 4KHZA 1ESFA 1QG7A 1LTGD 1F2LA 3FRPB 5COYA 3K5OA 3NTIA 2R93H 2NVTB 3W3AA 2PMZE 1KD1C 1I94L 2NZHA 2HCIA 5KEEA 2NVQB 4LFAQ 4DAYB 3TP8A 2R92G 2PZWA 1CSQA 1X55A 1UE6A 4CDEC 5HGTA 3PO2B 1U4MA 4QB4A 4EGVA 3EJIA 1WOCA 2RDFA 1KAAA 1VQMA 5A2QL 1JICA 4X62L 3TN2A 2PCFB 1TWAB 2J0TD 1D1IA 2NWGA 4KN7C 1I4QA 2PZUA 1VQCA 2L0CA 3W1GA 1UE7A 3GTJH 2YTVA 1I50H 1E2ZA 2GA4B 4GNXB 4LW1A 1PMRA 1WTPA 1LTRD 4K2LA 4K5XA 2Y0SE 5BR8Q 1J8IA 1LT5D 1STAA 3J81E 2J7ZA 4BBSH 3SK5A 2DN8A 4FNFA 2DJFC 5F2DA 3T53B 4IFDG 2B2TA 4YY3Q 2NB0A 1PYSB 1EWCA 3R3OA 4JOIC 1IBML 5HGQA 1LTTD 4LF8Q 1EEID 1NSNS 4A3CH 4JI3L 2K5NA 3L9AX 1JORA 2CW0C 5EPKA 1ICWA 1QOHA 1PLFA 1J9OA 2E2JB 5M5XB 1OXTA 1SE4A 3Q8DA 1H9SB 4IZ8A 3HOXG 4UDUC 1XNRL 1ZYRD 3NSWA 1EYGA 4JI8Q 2LMCB 3J7ZC 3GTKB 1YNND 3TZUA 2F03A 4J6HA 1N33Q 2EYFA 3P20A 2OQ0A 2EJFC 3DEOA 4Q0FA 2A1AA 2KCMA 3OW2A 4E6IA 2N49A 2AQ1B 4LUZA 5KYIA 3CC2A 1Q1BA 3C2PA 1VQOA 1VQJA 1PFMA 1YJ9A 5JAVA 5C0XH 2B2UC 2KJXA 3I4LA 3E9IA 1XMOQ 2PW7A 4ZUIA 1HHVA 1VQGA 2EQSA 2B39A 4X3TA 5M5WB 5M5YH 4KHVA 1QB5D 2EYMA 2HIXA 3HOZB 3R8BA 2ENBA 1Q90A 4NKLA 2FMCA 1LV9A 4NXMQ 2UUCQ 2BH8A 1AE3A 4XDXA 3OOCA 4G7HC 2D5DA 3C46A 3J7A5 4IO9A 2LXKA 5CV5A 2B3GA 5M5WH 4GNXC 4LNQA 1SJED 4BY1G 4A3IG 5C3EB 1BCPD 2IWHA 4P2CB 4WJ4A 3KUPA 2JA7G 4L5QA 3CXCA 4X3SA 1VS0A 4DAVA 1I6HH 1IYJB 1UEBA 2AHOB 1EY5A 4JPBW 2M00A 4L8JA 3CQZH 1ET9A 1YNJC 3ZJYC 4IUPA 2Q2IA 2E76C 3CCUA 2HIVA 1PDQA 3FKIB 5IYDH 4FO2A 4HJ7A 2R92B 1DJRD 4H13C 2R7FA 3S14B 1GOZA 1SBBB 2HDMA 3B6YA 1B50A 2JP1A 5CR3A 4G7ZC 1PYBA 4FXKC 4QUCA 3W5OA 3ICEA 1TXYA 2RKSA 4ID6A 3WWVA 2XTIA 4NMZA 4DV0Q 2WB1E 1WTXA 4BY7B 5IYCH 3U4VA 3GTLH 4OWWB 1QE6A 1YNXA 2EY6A 1B3QA 1EY9A 1NR4A 3K57A 3KBXA 2K28A 2VQEL 3OTOL 2UUBQ 1EY8A 4GKKQ 5EBDA 4EQPA 1Q46A 4B3ML 3WOEA 4KJOA 4DNIA 3DUZA 3J81j 1R9TH 4JBMA 2CKZB 2IX1A 2R7ZH 2CWAA 4JOIA 3MXUA 2CQOA 2SNMA 1K9MC 2CQAA 4ZKCB 5IT9c 1A2TA 5LMNL 1HFNA 3A0JA 2MQHA 3NTHA 1SMXA 4BWGB 2B2VA 3RLOA 3KDFB 4A3IH 1D8LA 2A19A 2WFWA 3RZDB 1N34Q 4GOPC 4NB3A 3HOXH 4GNXA 2Z8LA 4AYBE 4LF6L 3PO2H 1XX8A 1K8MA 3RZOB 1TS5A 3I90A 1D5MC 4WFN3 1S72A 2F0MA 5KGUA 3SGIA 2K14A 5LMUQ 4LFBQ 2NVTH 1R4PB 1CQVA 1F2MA 1O7LA 1Y1VH 5IYDG 1IZ6A 1XMQQ 2EJMA 4BBRB 1VQHA 5M9OA 3HRZC 4X62Q 1CI3M 3VR3A 5FJ8H 1Y69U 4EQOA 2KENA 4C3HH 3S1NH 1O80A 1EZ8A 1GHJA 1STHA 2KCTA 1Q81C 2ZXRA 2K1BA 1SYBA 1U4LA 1WYDA 4KTAA 3J80E 5LL6X 4R4QA 3L7ZC 3VYRA 1G2SA 1SNDA 3PV0A 5IP7G 3VR2A 4R9WA 1KAWA 2Y0SB 3TS0A 4NXML 1EL0A 4HMIA 2EYJA 1BUVT 2CFMA 4UP9A 4CJ2C 2QCPX 5D14A 1BQQT 2F0UA 1UUPA 4A3BB 1FGUA 1N36Q 1GO3E 4HIDA 1SMYC 1ASYA 3CAMA 3VR5A 1VQNA 3IL8A 1N34L 4QGUA 1F9QA 3HEJA 1X9NA 2ATWA 3CC7A 1JB3A 4RGOS 3I70A 1DXMA 3L0OA 2L9HA 2GVAA 5C4HA 1PHJA 4OELB 1WCMH 1HCZA 3M9BA 1GUSA 1C4QA 1B9MA 4IJLA 5FLXE 3UDGA 5K5PA 5J39A 1X3PA 2VY3A 2WV6D 1U4PA 1M90C 1SE8A 3D4DA 4DR5L 2F0NA 4JC0A 3E0EA 3ND9A 4R4OA 4N9TA 3CD6A 1W6JA 4C3JB 4IPHA 1II3A 2PYKA 1F2YA 1HA5A 1TWCB 4I7ZC 3PIP3 2O5JC 5CV8A 5JVH3 5EBCA 4RCOA 1NY4A 5AJ3L 4K2KA 2I5MX 4BA2I 5KRUA 3IRBA 4Y7NB 4AIMA 5EKIA 1PTOF 3TQYA 4CDDC 1CQFA 3JC66 4YWMA 1F77A 2N8NA 3AEVA 5I2YA 1SYDA 2F52A 1X65A 2YYZA 4EQNA 4OHJA 4TRDA 1VQDA 2RDHA 3NTKA 4DK6C 4GS3A 1SN8A 3IAYA 5K36H 4B9XA 4N8X1 2K5DA 4S3SA 1SNPA 4L6TB 2UXBQ 1I6VC 3LWUA 2KCNA 4IUTA 4BBSG 3MAQA 4RA8A 2K05A 2VB2X 3K6OA 4FF1A 4Y7NH 2D9UA 4DV3L 1SAPA 4H44C 4OONA 5KIXA 3BJUA 3RLNA 4RCNA 3K0YA 4ZAIA 3CQZB 1X56A 2XWBB 2UXBL 2OWOA 3D6CA 4LF6Q 1ENFA 2B2YC 4LF4L 4A3JG 4O2DA 2QF7A 3OIPA 2AUKA 3J7AF 5C5LA 4QQBX 1LACA 4DV4L 3S2DB 3EVQA 1WCMB 2EYPA 4PNYA 5AFWA 3EBEA 1QILA 4DAYA 1EQQA 4BXXG 4K6DA 3FMCA 3A8KE 3KLRA 2OQKA 3QR8A 5EQ0A 5BN5A 1B4OA 1S5CD 3F8TA 4RG1A 4JI2L 4C3JG 4DR7Q 4KKTA 5IT9E 1FR3A 1GM5A 2B2WA 3KLSX 4GZYC 4XT3B 3S1QH 1RHPA 4A3MH 2QDLA 4RKLA 1OXXK 1YNNC 2QKIC 1GUTA 1TS2A 3A56A 3DHQA 3GP7A 3SR1A 3D0FA 3PUZA 3H15A 2UU9Q 2RCFA 5ELNA 1IKLA 2F0GA 1E3PA 2EIFA 2ZXPA 5CV7A 1TWHB 2V1CC 5J1ZA 2FHTA 4DV5Q 1C7YA 3RN5A 1XTCD 5BN4A 1L2FA 2ZJRA 2KCCA 2BA0A 2Z9HA 1K3RA 3DWPA 2CH4W 2I46A 3AYHB 4ILWA 2KHJA 1WCMG 3BYYB 1N32Q 2E2JH 1ESRA 2OTLA 1G51A 4H02A 2K7VA 3U50C 1Q82C 1CHPD 1PH2A 3SHLA 3RZOH 3DLLA 5JVG3 3R2IA 3BG3A 1Y1WH 4ME5A 1EFWA 2ZJPA 2DNCA 4GLVB 1RL2A 1F9RA 2EVBA 3Q6SA 1E24A 2XGTA 3RZDH 1H9MA 3EQLC 3RR5A 4IFDH 4QIWE 4LF5L 3KF6A 2NVXB 1B53A 1S5FD 2VS1A 3K7UC 1G6PA 3OSOA 3NBHB 1RODA 2N78A 1HNWL 1I50B 1I4RA 3RLFA 2HQLA 4OWXB 3N52A 2CWPA 3F2DA 1XJVA 4K0KQ 4FF3A 1SROA 1JC7A 1BO0A 4AQYQ 2PQAA 4PQXA 4LUVA 2XNAC 3PF4A 1FL0A 4LF7L 2I07B 2F0WA 4HCEA 1PRTB 4YIJA 1JR0D 3CCLA 2AUJD 4PZ7A 3CF5A 3HOWB 3OIQA 1JOKA 3H6MA 4DAPA 4DR6L 1GHKA 1TY2A 2G5DA 4A76A 3I55A 5C4JB 5KYLA 5E7NA 2F1MA 1PH8A 1EY0A 3NQIA 3CHBD 5I9PA 4R8IA 1HZBA 1Z6HA 3BYTB 3D6WA 3CC4A 3I8ZA 4R4IA 2F0HA 3VYUA 3TZDA 2QW7A 2VZAA 3CCJA 1KC8C 4NXNQ 2JQOA 5FLMG 4BY7G 4DUZL 2VQEQ 2WB1B 3NENA 4F7XA 5C3WA 2H4OA 4A3IB 4DGZA 5DAUA 3SE0A 4HCSA 1WTOA 2K5VA 4JYAL 2R7DA 2BDOA 1AFPA 3W2DA 3DWQA 1Q3LA 1V1PA 3HOYG 3KYHC 1L1OC 2NUCA 1LM0A 2JN4A 3QOJA 1HQRD 1I5FA 3FKIG 2WP8J 1CKMA 1B2TA 3M4OB 2BOSA 3RD4A 1X3EA 2R7ZG 1W3SA 4A3BG 1YHBA 3CCSA 1FD7D 1LTSD 5E3FA 3M4YA 2IX0A 2RA4A 3GTGH 4XXEA 3Q0AA 3S2DH 2F0SA 3E9HA 4IUNA 4DAMA 4A3KH 3I4MH 4GOPB 1N8RC 1CTMA 5C4XH 1HJPA 4MTKA 1PA6A 1D7QA 2FMMA 2A74C 1MSHA 2MPMA 3A55A 1XMQL 1AW7A 2ID0A 3URYA 1V43A 3OYYA 4JVZA 2VUMH 3QO2A 1Q8KA 2UUAL 4YCWA 3EIVA 3GTOB 3S14H 2QDBA 4F8MA 2OTJA 2VUMB 1CKNB 1VQBA 4IUQA 2JA9A 2HCCA 3BZKA 5A35A 2Q8TA 1L0XB 4DR6Q 4I7AA 1EIFA 1FGBD 5NUCA 4CJ0B 1N32L 4K0KL 1RD9D 1AE2A 4X66L 5C0XI 1JT8A 3E5SA 3TDQA 5J22A 4J1MA 2R61A 2F0LA 5C4XB 1ENAA 4UAIA 1SSOA 4QF4A 4R1JA 2X6GA 2OXPA 1C9OA 3NE5B 3OWFA 5DLQE 1E22A 4A3FB 5EPJA 4J8QA 2HHHQ 1A63A 3WDNA 4KJNA 4FP5D 1NNXA 3M4OH 2OEOA 3HOUG 1A3VA 4OX9L 1EFID 4LK1C 4DR1Q 4C2MH 5M5YB 1TWGH 4K5WA 2ZTDA 4LF9Q 4A3BH 2A6ED 1MHWC 1CSPA 2JK8A 2O2LD 3K59A 2R7ZB 2WKCA 3VA7A 1L0YB 2IX3A 2XRSD 1B9NA 2CCZA 1ILPA 3MXNB 2A68D 1Y1VG 4XIGS 3FDTA 1WVLA 1BR9A 2K03A 4HSPA 3I4NH 4LF8L 3E0JA 1A3TA 4WORA 2FFKB 3I4MG 3A74A 1LLRD 4CKBA 3BVGA 3QG1A 3TSSA 3KLSA 2KEDA 5C4JH 4A3LG 3I91A 1JE5A 3G7LA 5I4DA 2ICIA 1D2BA 1VQEA 2EDGA 1BBWA 3HGBA 3TREA 2D62A 5EJWA 5GAGC 4A3EG 3LX0A 3I3CA 4K6LA 1U5KA 2ZM6Q 3WOFA 2NVYH 2R93G 1KQSA 4IPGA 3OW7A 3HOWH 4IUVA 3JAMc 1KDAA 1SRUA 1QUQA 2JA7B 4UPAA 4DR1L 1CZGA 3NEMA 3F2BA 1I4HA 2F0FA 2PI2A 2Z4IA 5K36G 1V8QA 3I4NB 1S4ZA 1B8AA 3VDYA 4B3SL 5G3LD 4X3UA 4LMQD 1P16A 5FKAC 4IFDJ 4DV6L 3PUYA 4POFA 5CORA 2BA1A 4B08A 1VQPA 1XPRA 1GUWA 1K83H 1E1TA 1FYCA 2A6EC 1LABA 1SXTA 2K5QA 5LMNW 3PUVA 1TU2B 3CCMA 1HTLD 5BR8L 1K3BC 3GTPH 4DV5L 2F0EA 1PZID 4BA1I 3DEPA 1EEFD 2L55A 3CU7A 2I5HA 3KF8B 1PFBA 4RFBA 1AZQA 5CV9A 2MO1A 4XYOA 3D31A 3K5NA 1EIYB 2UU9L 3CRKC 2EYHA 2QILA 4PMWA 3BZDB 3OHXC 1GUGA 1STBA 2UUAQ 2A6HD 1PV4A 3GTPB 1SLJA 3R93A 4P75A 2J4XA 1K83B 1IL2A 4QIWB 3T51B 1IHZA 5L37A 1BCPC 4DKAC 4J15A 2QEXA 2KEEA 3VR4A 2K50A 2VNUD 3I72A 4X64Q 4UY8C 4DV4Q 4C3HB 3H94A 3CMEA 3U58A 2AQ3B 1IXRA 2OCEA 5IWAL 3C1FA 5FLMH 3QIAA 1N36L 2F3WA 1KRSA 3H09A 1JJGA 5C3EH 1A6XA 2XWJB 2E8GA 4Z9CB 2VQFL 5CBAE 5C5MA 4A3KB 3ERQA 1V9PA 1XXGA 3UI2A 5EKKA 4FXGC 2VXWA 3GTGB 2VL6A 3RNUA 2LY7A 3GDEA 2VW9A 3FKIH 4JI4Q 1FJGL 1E1OA 1L1OA 3KK7A 1VQLA 2BH2A 4RKBA 2B8GA 3MC0B 1QNUA 1LUZA 4DV7L 2JA8H 1MI2A 1SE3A 4NP5A 3OMGA 1HNXQ 4PMCA 3R2TA 1K0SA 1H9RA 4L5TA 1GUOA 1KRTA 5DM73 3KJPA 2YTXA 3PF5A 2BE5C 5I2XA 1HZAA 1TWGB 4JV5L 4DV0L 3FPUB 2RSNA 2PO4A 4PMBA 4RWSC 1Y8OB 4DUYQ 1VQ5A 4JI6Q 4OIKA 1QWYA 1SYCA 3HOZH 1EYDA 4P74A 1Z7TA 1C8CA 1TS3A 1M8AA 2N3SA 4B3RQ 2K4KA 1NJIC 1C0AA 4DR2Q 3L3OC 5CV4A 3ERSX 1DYQA 1DOKA 4IPCA 2NTSA 2AMCB 5D3IB 2I5LX 3J81L 4KD3A 4G7OC 4KY6A 1KNAA 4B3MQ 1Z9FA 2ALYB 5LMUL 4A3GH 4G57A 1PH7A 1CA6A 3HOUB 4C56C 3M3YH 4KHPQ 4KI0A 3GV6A 3HOWG 5ELFA 1DD2A 4A3FG 1A15A 1RJTA 1HZ9A 2MGSA 1KDCA 4A75A 2F0QA 2XN9C 4I65A 4X66Q 2IT1A 4LFBL 2JA6H 1IL8A 2RHQB 2K52A 3STBD 2IJ0A 1Y1VB 3NXWA 1Y1WG 3P7JA 3S2HH 4A3GG 2B29A 3NBIA 1DM0B 1TWCH 1KNEA 4CDFC 1VQ9A 3KJOA 4TSSA 1VCIA 5HY6A 4YHHL 1Q7YC 4KK7A 1HA6A 3EA6A 3G71A 1TY0A 1PRTF 2LKVA 3N6RA 3CW2C 5IGEA 2UXDL 4GOPA 2MNAA 2VUMG 4MIUA 5IGCA 3GV3A 2Z4HA 3T1YQ 2B2TC 1BDOA 2JA6G 1T9HA 1YZ6A 1PH5A 3AFQA 2WKDA 1WTHA 2NVQH 2FJ2A 3ULJA 2JSOA 4DV3Q 4LFCQ 3SK8A 2PPBC 2ASBA 1X6OA 4OL7A 2SEBD 2F0KA 2RCNA 5C0XG 4DF7A 1SYFA 2K5WA 3DXJC 4R4TA 2K6AA 3HOZG 3D4WA 3IKJA 1B7YB 1UNSA 1EYAA 1W6KA 1I4GA 4CBVA 3CRLC 1OXUA 2UUCL 4IOAA 1SR3A 1SYEA 2PZTA 2FXQA 2F4IA 2PQEA 4KV6A 3SVMA 5CGKA 1VQFA 4XQQA 1IBLL 4Q5VA 2JA5G 3A7AB 1NUCA 1AP0A 2Y0SG 2CW0D 4KKUA 3HKZE 3GTLB 4JI0Q 5ELDA 3I4OA 5JPNC 2UXCL 4RMFA 4B3SQ 3SEBA 5FO8B 5LL6S 1Q86C 2ZJQA 4OO1H 1YBYA 2R3ZA 2X6LA 3TRZA 1HH2P 3H3VC 2B63G 1Y8NB 5AJ3Q 2RVLA 3V05A 4A3JH 3U9SA 4NXNL 4ODGA 5C3EG 4HIOA 4ULLA 5E4XA 3HOVG 1QCBD 1VQ6A 1KIXA 2WB1G 1TQOA 2R92H 2NZOA 2EJGC 1VQAA 1PFSA 1D5ZC 4A93B 4HIMA 3HKZB 4XTCS 4JG2A 3HOVB 4B3TL 1LT6D 4O42A 3S1MB 4B9WA 3MEHA 2XRQD 5IOCA 4H7BA 2F0PA 5G3LF 2PI2E 1O7IA 5FOBB 1SNQA 4DNRB 3MXPA 5IYBH 3ND8A 3SK4A 2A68C 4RGNA 1R9TB 1JQYD 1SNOA 2JEAI 2HD3A 2E2IH 1STGA 1STNA 2HDLA 2BE5D 2AQ2B 2DY8A 3BU2A 4AYBB 2F0VA 3KFUA 2A73B 2F0IA 3H3VH 5C44B 2EYOA 1JWSD 2NYZD 3EN2A 1PZJD 1VF5C 1QUQB 2R93B 4LF5Q 4GN4B 4ZYSA 3BDLA 1LTBD 4WJWA 5ELOA 1BXTA 3IFDA 1U9RA 3KBGA 1RF2D 1TR5A 2F0DA 3HS0C 4P72A 1PRTD 5IE8A 1EUJA 2JEBI 1PH6A 3IFTA 1CZWA 4DR3L 1UAPA 1OXVA 4U68A 1HUNA 3W1BA 3I7FA 2UXDQ 1SJHD 4TVAB 3J81c 1BF4A 3OPOA 2KUMA 4JI5L 4GLXA 1I4XA 2E5LL 2EY5A 4P71A 3S17H 3VA5A 1XMOL 1X3GA 1KDBA 2K32A 3K80C 1WFQA 3S1QB 3A5ZB 4KY7A 2IL8A 2F0OA 3PUXA 4OWTB 4CJ1B 5IGDA 1HR0W 1SFOB 5CV6A 5GQOA 3BDCA 5FJ8G 5EKLA 1XPUA 2WINB 4DU9A 3F2CA 2EPBA 1HR0L 1KHIA 2Q2HA 2E2HH 1LO5D 4JI8L 3ULPA 3A7LA 2H1EA 2MP1A 1W2BA 4BY1H 1EZ6A 2V4DA 4UP8A 1ASZA 1CKOA 4M1UB 5GADC 2JA5H 1XPOA 4A3MG 5BN3A 2Q8RE 3NP8A 1T5XD 5TSSA 1G2TA 3HKSA 4JBJA 1N9WA 3JAMi 1SYGA 4OXPA 2KBNA 2NZ1D 1TT2A 1BOSA 4KHPL 2G9HD 3P75A 4JI7Q 3LGJA 2MO0A 3QJYA 3T1HL 1WTRA 4BBRH 3RMHA 1UE1A 1EIGA 1J5EQ 3E6ZX 1CA5A 2Q2TA 4G4KA 4OX9Q 2EZVA 1E7ZA 5M3FG 5JJLA 3NWTA 4KD4A 5KNCA 5M5XH 1XWEA 3S2HB 1JJCB 5KNBA 3M7NA 3Q22A 2HHHL 1RTOA 1F2ZA 2L11A 4A93G 5GROA 2Z6KA 1EOVA 4A3DB 1DOLA 3CCEA 1BVSA 3HOXB 2B2VC 3S24A 3EROA 3I56A 4BBSB 4O0AA 1Q12A 2E2DC 3HP3A 1XNQL 4HJ9A 4RHSA 4UP7A 1PTOD 3CKIB 5M3FB 1QVFA 5C6AA 4L5RC 4A3KG 3TMEA 2I0QA 2H5XA 1ZEQX 1YEZA 1CT1D 3HOYB 2L1BA 3TP5A 1EY6A 3TBIB 4C3JH 5IIFA 3HFZB 2PW5A 1Q8IA 2RQXA 3CMAA 4X6AH 2XSCA 5LMNQ 1E2WA 4N8FA 1QJOA 1GVPA 1AEXA 1C48A 1STYA 1K8GA 5GAHC 1B1ZA 5JJZA 4PZ6A 1L1OB 2CVRA 4ZRZA 1VQKA 2D2CC 1VQ4A 3PO3B 4A3EB 1EU3A 1A3UA 1HTPA 2OT2A 1H9JA 2PQAB 1TS4A 4DV7Q 2RHSB 4HAEA 4C3IH 1Y8PB 3OTOQ 1AH9A 5ELEA 3UE0A 1G291 3T4AC 1YI2A 4TQUS 2YU9B 4JBWA 1WD1A 5H1SE 5IGBA 2Q2UA 1MJEA 3S15B 3AB9A 1KABA 3KDFA
chains in the Genus database with same CATH topology
2K50A 1TWHH 4HIKA 2VNUD 3IRBA 1K8AC 1X54A 1NMGA 1VQ8A 4AIMA 4X64Q 4UY8C 4DV4Q 4DUYL 4ME3A 3TQYA 1A0IA 3CMEA 3U58A 1I94Q 1IBLQ 3PCOB 3JC66 1NTGA 3H0GG 4GN5A 4YWMA 1IXRA 2OCEA 5IWAL 1S3OA 2N8NA 3AEVA 1JJ2A 5FLMH 4JYAQ 1N36L 1KRSA 3J81i 4LF4Q 4YY3L 4IOCA 2F52A 1RIPA 2C35B 3CP0A 1X65A 4WJ3M 1JJGA 4DV6Q 2YYZA 4Y52H 3GTQH 1H95A 1VQDA 5C3EH 4DK6C 4GS3A 1SN8A 3STBC 2QA4A 1HNXL 5GAEC 3A5UA 2E8GA 3BZCA 4KLKA 4MTNA 2VQFL 1V9PA 1KXLA 4DR4Q 2UXBQ 1YJNA 1PH1A 4JI4L 2VL6A 4BBSG 4DPGA 1BBUA 3RNUA 3CCQA 2AKWB 3GDEA 5J3BA 4IPDA 2VW9A 3FKIH 4JI4Q 1FJGL 1E1OA 1L1OA 1VQLA 2D0OA 4Y7NH 2BH2A 4DV3L 3CCRA 3PO2G 3GTOH 1LUZA 4OONA 4DV2L 4DV7L 2JA8H 3BJUA 3RLNA 3H3VI 1N33L 3S15H 3GD7A 4GKKL 1HNXQ 1X56A 2UXBL 4BBRG 2OWOA 3FP9A 4L5TA 3U4ZA 4LF6Q 1KRTA 1L0WA 4LF4L 3KJPA 4A3EH 4JI2Q 2YTXA 4QJFA 4JCVE 4A3JG 3PF5A 4YWLA 4O2DA 1YHAA 1HZAA 2ES2A 4JV5L 4DV0L 5M3MH 1VQIA 2B63H 1HNZQ 3K81C 4QQBX 4DV4L 4YWKA 1LTLA 1K73C 3EBEA 4DUYQ 1B70B 1VQ5A 4JI6Q 1YVCA 4ALPA 1EQQA 3HOZH 4BXXG 1Z47A 2LSSA 4P74A 4DV2Q 2OQKA 3F8TA 4RG1A 4BY7H 2N3SA 4JI2L 1FVIA 4DR7Q 4B3RQ 2K4KA 5EAYA 1GM5A 1NJIC 1C0AA 2R6GA 4DR2Q 3KLWA 5JEAJ 4LF9L 3ERSX 1YJWA 1QZHA 3NELA 4DR3Q 3S1QH 4IPCA 4A3MH 1OXXK 3CCVA 2AMCB 1OTCA 2I5LX 3K7AH 4JI1L 4JI1Q 5M3FH 3T1YL 3D0FA 4MNOA 3PUZA 1Z9FA 2ALYB 2IHFA 5IYBG 3H15A 5LMUL 1IBKL 1PH7A 2UU9Q 4LFAL 4A3GH 3UDXA 5ELNA 4NPSA 2Z0SA 1E3PA 2EIFA 3M3YH 3FHWA 2V1CC 4DV1Q 4KHPQ 1GKHA 4KI0A 1QZGA 4DR7L 3HOWG 4A3FG 4A3DH 4LUOA 4DV5Q 3PUWA 3UDIA 3PIPA 1C7YA 3RN5A 5IWAQ 1HZ9A 4A75A 1L2FA 4X66Q 1IBMQ 2YU9H 2IT1A 1V1QA 2KHIA 4AYBG 5IP9H 2ZJRA 3M85A 1J5EL 2PNHA 2RHQB 2DGYA 1EQRA 2YV5A 4JI6L 4JI3Q 2BA0A 2K52A 4LF7Q 1K3RA 1BKBA 1NBWA 3STBD 1Y1WG 1WI5A 4JI5Q 2LXJA 3UE1A 3UDFA 4YCVA 3AYHB 3F1ZA 2HT1A 4A3GG 3S2HH 2B29A 2KHJA 1TWCH 1VQ9A 4KHZA 3KJOA 1WCMG 1VCIA 5HY6A 4YHHL 1Q7YC 2E2JH 1Q1EA 1UWVA 2OTLA 1G51A 4H02A 3G71A 1YIJA 4JV5Q 3U50C 1Q82C 1K0RA 2R93H 1PH2A 3RZOH 3CW2C 1KD1C 2PMZE 2UXDL 1I94L 4GOPA 2NZHA 3DLLA 3CPFA 2MNAA 2K75A 4LFAQ 2VUMG 4DAYB 2R92G 4GKJL 1CSQA 1X55A 1Y1WH 1UE6A 3T1YQ 1EFWA 2ZJPA 4B3MQ 4GLVB 1RL2A 1WOCA 5IP9G 1XNQQ 1T9HA 2JA6G 1YZ6A 1PH5A 3AFQA 1VQMA 3PO3G 4BXXH 1E24A 2XGTA 2NVQH 3H0GH 4X62L 3RZDH 3RR5A 3ULJA 4QIWE 4DV3Q 4LF5L 3KF6A 4LFCQ 2ASBA 2A8VA 1PVOA 1X6OA 2VS1A 3K7UC 1G6PA 5JEAG 2RCNA 3NBHB 5C0XG 1VQCA 3W1GA 2N78A 1UE7A 3GTJH 1HNWL 1NE3A 2YTVA 3RLFA 5JJIA 2HQLA 2AWNA 4OWXB 1I50H 4EX5A 4R4TA 3PIOA 4A3BH 3K8AA 3HOZG 4GNXB 3HOYH 4LW1A 2CWPA 3F2DA 2F3IA 1XJVA 1A62A 1B7YB 1QVCA 2Y0SE 5BR8Q 4K0KQ 3CPWA 1SROA 1OXUA 4YHHQ 2UUCL 4IOAA 1SR3A 4AQYQ 2PQAA 4BBSH 4OO1G 2FXQA 4LUVA 4JI7L 3G4SA 2K5HA 3RN2A 1VQFA 1IBLL 4YY3Q 3PF4A 1FL0A 2JA5G 4IFDG 1PYSB 4LF7L 2Y0SG 3HKZE 4JOIC 4JI0Q 1IBML 5HGQA 3CCLA 3I4OA 4PZ7A 3CF5A 4HJAA 4LF8Q 2UXCL 4RMFA 1NMFA 4B3SQ 4A3CH 4JI3L 2K5NA 1Q86C 4X65L 4DR6L 4MZ9A 2ZJQA 3MEFA 1YBYA 4A76A 3TRZA 1HH2P 1OXTA 3Q8DA 2WAQE 2B63G 4LWCA 4AQYL 3HOXG 3I55A 1XNRL 4A3DG 2NN6G 5AJ3Q 3M4QA 5E7NA 4A3JH 1PH8A 1EYGA 4JI8Q 4NXNL 5C3EG 4HIOA 3J7ZC 3HOVG 1VQ6A 1KIXA 1HZBA 2WB1G 3CC4A 2R92H 4R4IA 4L5SA 1N33Q 2NZOA 3CCJA 4NXNQ 1VQAA 2OQ0A 2VZAA 1PFSA 1KC8C 2JQOA 5FLMG 4A3CG 2A1AA 4BY7G 4DUZL 2VQEQ 4HIMA 2KCMA 3OW2A 4XTCS 4JG2A 2N49A 3NENA 4LUZA 4AH6A 3CC2A 4B3TL 1Q1BA 2YTYA 4PZ8A 1VQOA 2ZTEA 1YITA 1VQJA 1HZCA 2K5VA 1YJ9A 4P73A 1YHQA 2PI2E 2R7DA 4JYAL 3TEHB 1O7IA 3E9IA 5C44G 5IYBH 1XMOQ 4GN3B 5C0XJ 1Y14B 3J80i 2JEAI 1VQGA 1JB7A 3KYHC 3T1HQ 3HOYG 1L1OC 4LFBL 2NN6I 1LM0A 2EQSA 2E2IH 1I5FA 3FKIG 2JA6H 3G48A 3I2ZA 2WP8J 5M5YH 1CKMA 3K0XA 1X3EA 2R7ZG 1W3SA 2HIXA 1YHBA 3CCSA 4A3BG 1I3QH 4NXMQ 3BU2A 1MIUA 2UUCQ 2BH8A 1AE3A 3KFUA 1A8VA 3H3VH 2IX0A 3GTGH 3J7A5 4EQ5A 3EN2A 1J6QA 4IO9A 3S2DH 2LXKA 2B3GA 3E9HA 4DAMA 4A3KH 5M5WH 3DM3A 3I4MH 1QUQB 4GNXC 4GOPB 1N8RC 4LF5Q 4LNQA 4A3IG 4GN4B 4BY1G 5C4XH 1HJPA 1HNWQ 1PA6A 1D7QA 5IYCG 4WJ4A 5ELOA 2JA7G 4L5QA 2IHEA 3CXCA 1VS0A 1XMQL 2ID0A 1TWFH 1I6HH 1IYJB 1UEBA 1V43A 2AHOB 3OYYA 4P72A 2ZM6L 3S1MH 2JJQA 3CQZH 1EUJA 2MFIA 2JEBI 5IE8A 4A4IA 4X65Q 2VUMH 1PH6A 4OO1I 3ZJYC 3S1RH 4R4CA 1N32Q 4DR3L 1Q8KA 2UUAL 4YCWA 3EIVA 2Q2IA 3S14H 2VQFQ 3CCUA 1OXVA 1XTDA 2HIVA 3W1BA 4FDBA 5IYDH 4HJ7A 2JA7H 2E5LQ 3I7FA 2OTJA 2UXDQ 1GD7A 2R7FA 1MKHA 1CKNB 4GLAC 1VQBA 4TVAB 3J81c 2JA9A 3AFPA 3BZKA 1S40A 4JI5L 4GLXA 1PH4A 2E5LL 4DR6Q 1VQ7A 1EIFA 4P71A 3S17H 3KOJA 1N32L 1DGSA 4IJHA 4X64L 4K0KL 4A3LH 2IY5B 3B6YA 1XMOL 1AE2A 1X3GA 4X66L 5C0XI 1PYBA 3K80C 5IY0A 1JT8A 3W5OA 3PSIA 1WFQA 3ICEA 1TXYA 3A5ZB 3PO3H 3WWVA 4YCUA 2XTIA 1PH9A 4DV0Q 3ER0A 2WB1E 4PG3A 1PH3A 3PUXA 4OWTB 5IYCH 4R1JA 3U4VA 4OWWB 1HR0W 4DUZQ 1YNXA 1C9OA 3GTLH 5DLQE 1E22A 5GQOA 4DV1L 5FJ8G 4B3TQ 1XPUA 2HHHQ 5C44H 1A63A 5M3MG 1X3FA 3M4PA 3F2CA 2VQEL 1HR0L 1KHIA 3OTOL 2Q2HA 1HR0Q 2UUBL 2UUBQ 3M4OH 4GKKQ 1CKNA 2E2HH 4B3ML 1Q46A 2WAQG 3HOUG 4JI8L 3ULPA 4OX9L 4DR1Q 2F4VQ 4DNIA 2AWOA 4C2MH 4B3RL 1TWGH 3J81j 1R9TH 2ZTDA 2CKZB 1W2BA 4BY1H 4JBMA 4LF9Q 2JK8A 1CSPA 2CWAA 4JOIA 3ULLA 2IX1A 2R7ZH 2CQOA 4UP8A 1K9MC 2D0PA 1CKOA 3GO5A 5GADC 5IT9c 1ASZA 1XPOA 5LMNL 4A3MG 1EWIA 2JA5H 4JBKA 3A0JA 2JE6I 2MQHA 1SMXA 3S16H 2CCZA 3MXNB 4GKJQ 1Y1VG 4XIGS 2EXDA 3HKSA 4JBJA 1N9WA 3JAMi 2NVXH 3I4NH 3RLOA 2UXCQ 3KDFB 1QVGA 4LF8L 4A3IH 1D8LA 2A19A 2WFWA 1N34Q 4OXPA 2KBNA 5IP7H 4A93H 4GOPC 3I4MG 4NB3A 3A74A 3HOXH 4GNXA 4A3FH 3GTKH 4KHPL 4AYBE 1MJCA 4JI7Q 4LF6L 4POGA 3PO2H 3LGJA 2MO0A 2Z6KC 3T1HL 1S72A 4BBRH 3SGIA 1UE1A 2K14A 5C4JH 4A3LG 5LMUQ 1JE5A 1WJJA 1J5EQ 2NVTH 4LFBQ 2Q2TA 4OX9Q 2JA8G 1VQEA 1E7ZA 5M3FG 1BBWA 3TREA 5JJLA 1Y1VH 5IYDG 3GTMH 1IZ6A 2D62A 5GAGC 4A3EG 1XMQQ 5M5XH 1FJGQ 1JJCB 1U5KA 1VQHA 4APVA 2ZM6Q 2HHHL 2NVYH 3M7NA 2R93G 1KQSA 3HKZG 4IPGA 4X62Q 1XNRQ 1UE5A 5FLXc 4A93G 5GROA 2Z6KA 1JMCA 1EOVA 3HOWH 3JAMc 3CCEA 4DR4L 1SRUA 1BVSA 5FJ8H 1QUQA 3S24A 2KENA 4UPAA 4DR1L 3NEMA 4C3HH 3F2BA 2F4VL 3S1NH 4IFDI 2PI2A 2KCTA 1Q81C 5K36G 3I56A 3KF6B 1CUKA 1Q12A 4O0AA 4DR5Q 1B8AA 1XNQL 1OXSC 3L2PA 2L15A 4HJ9A 3VDYA 4B3SL 3HOUH 1P16A 4UP7A 1WYDA 4IFDJ 4DV6L 3PUYA 4R4QA 3L7ZC 4JI0L 1QVFA 4L5RC 4POFA 4A3KG 5IP7G 3PV0A 2I0QA 2BA1A 2H5XA 1KAWA 3TS0A 3AQQA 4NXML 1YEZA 1VQPA 2CFMA 4UP9A 1XPRA 2GVBA 1K83H 1E1TA 3TS2A 4C3JH 5LMNW 1FGUA 1N36Q 1GO3E 3PUVA 4HIDA 3CCMA 3HFZB 3CAMA 5BR8L 1ASYA 1VQNA 1TWAH 2ZTCA 1N34L 3GTPH 4QGUA 3J80c 2GN5A 3CMAA 4DV5L 4HJ5A 1X9NA 4X6AH 4BA1I 2ATWA 5LMNQ 1KL9A 3CC7A 3I4NG 1HNZL 5C4XG 2I5HA 3KF8B 3L0OA 4QY7A 2MO1A 2GVAA 1GVPA 1M1KC 1PHJA 3D31A 1WCMH 1EIYB 1K8GA 3M9BA 1SFOH 2RF4A 4IJLA 5GAHC 4HJ8A 1IBKQ 2UU9L 3UDGA 4PMWA 3PGZA 2VY3A 2QEXA 1M90C 2UUAQ 4PZ6A 1SE8A 1L1OB 4DR5L 1VQKA 1U0LA 1VQ4A 1PV4A 4QL5A 4JC0A 1SLJA 2PQAB 3E0EA 4R4OA 4DK3C 4DV7Q 2RHSB 4P75A 3CD6A 5JJKA 4IPHA 4C3IH 2QGQA 3OTOQ 2DUDA 1IL2A 1AH9A 3UE0A 1G291 4LFCL 1P8LA 1LYLA 4TQUS 4DR2L 1YI2A 4JBWA 1NY4A 5AJ3L 2I5MX 3G6EA 4BA2I 3HOVH 5H1SE 2Q2UA 1MJEA 4DKAC 4J15A 3KDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K50 A;  1TWH H;  4HIK A;  2VNU D;  3IRB A;  1K8A C;  1X54 A;  1NMG A;  1VQ8 A;  4AIM A;  4X64 Q;  4UY8 C;  4DV4 Q;  4DUY L;  4ME3 A;  3TQY A;  1A0I A;  3CME A;  3U58 A;  1I94 Q;  1IBL Q;  3PCO B;  3JC6 6;  1NTG A;  3H0G G;  4GN5 A;  4YWM A;  1IXR A;  2OCE A;  5IWA L;  1S3O A;  2N8N A;  3AEV A;  1JJ2 A;  5FLM H;  4JYA Q;  1N36 L;  1KRS A;  3J81 i;  4LF4 Q;  4YY3 L;  4IOC A;  2F52 A;  1RIP A;  2C35 B;  3CP0 A;  1X65 A;  4WJ3 M;  1JJG A;  4DV6 Q;  2YYZ A;  4Y52 H;  3GTQ H;  1H95 A;  1VQD A;  5C3E H;  4DK6 C;  4GS3 A;  1SN8 A;  3STB C;  2QA4 A;  1HNX L;  5GAE C;  3A5U A;  2E8G A;  3BZC A;  4KLK A;  4MTN A;  2VQF L;  1V9P A;  1KXL A;  4DR4 Q;  2UXB Q;  1YJN A;  1PH1 A;  4JI4 L;  2VL6 A;  4BBS G;  4DPG A;  1BBU A;  3RNU A;  3CCQ A;  2AKW B;  3GDE A;  5J3B A;  4IPD A;  2VW9 A;  3FKI H;  4JI4 Q;  1FJG L;  1E1O A;  1L1O A;  1VQL A;  2D0O A;  4Y7N H;  2BH2 A;  4DV3 L;  3CCR A;  3PO2 G;  3GTO H;  1LUZ A;  4OON A;  4DV2 L;  4DV7 L;  2JA8 H;  3BJU A;  3RLN A;  3H3V I;  1N33 L;  3S15 H;  3GD7 A;  4GKK L;  1HNX Q;  1X56 A;  2UXB L;  4BBR G;  2OWO A;  3FP9 A;  4L5T A;  3U4Z A;  4LF6 Q;  1KRT A;  1L0W A;  4LF4 L;  3KJP A;  4A3E H;  4JI2 Q;  2YTX A;  4QJF A;  4JCV E;  4A3J G;  3PF5 A;  4YWL A;  4O2D A;  1YHA A;  1HZA A;  2ES2 A;  4JV5 L;  4DV0 L;  5M3M H;  1VQI A;  2B63 H;  1HNZ Q;  3K81 C;  4QQB X;  4DV4 L;  4YWK A;  1LTL A;  1K73 C;  3EBE A;  4DUY Q;  1B70 B;  1VQ5 A;  4JI6 Q;  1YVC A;  4ALP A;  1EQQ A;  3HOZ H;  4BXX G;  1Z47 A;  2LSS A;  4P74 A;  4DV2 Q;  2OQK A;  3F8T A;  4RG1 A;  4BY7 H;  2N3S A;  4JI2 L;  1FVI A;  4DR7 Q;  4B3R Q;  2K4K A;  5EAY A;  1GM5 A;  1NJI C;  1C0A A;  2R6G A;  4DR2 Q;  3KLW A;  5JEA J;  4LF9 L;  3ERS X;  1YJW A;  1QZH A;  3NEL A;  4DR3 Q;  3S1Q H;  4IPC A;  4A3M H;  1OXX K;  3CCV A;  2AMC B;  1OTC A;  2I5L X;  3K7A H;  4JI1 L;  4JI1 Q;  5M3F H;  3T1Y L;  3D0F A;  4MNO A;  3PUZ A;  1Z9F A;  2ALY B;  2IHF A;  5IYB G;  3H15 A;  5LMU L;  1IBK L;  1PH7 A;  2UU9 Q;  4LFA L;  4A3G H;  3UDX A;  5ELN A;  4NPS A;  2Z0S A;  1E3P A;  2EIF A;  3M3Y H;  3FHW A;  2V1C C;  4DV1 Q;  4KHP Q;  1GKH A;  4KI0 A;  1QZG A;  4DR7 L;  3HOW G;  4A3F G;  4A3D H;  4LUO A;  4DV5 Q;  3PUW A;  3UDI A;  3PIP A;  1C7Y A;  3RN5 A;  5IWA Q;  1HZ9 A;  4A75 A;  1L2F A;  4X66 Q;  1IBM Q;  2YU9 H;  2IT1 A;  1V1Q A;  2KHI A;  4AYB G;  5IP9 H;  2ZJR A;  3M85 A;  1J5E L;  2PNH A;  2RHQ B;  2DGY A;  1EQR A;  2YV5 A;  4JI6 L;  4JI3 Q;  2BA0 A;  2K52 A;  4LF7 Q;  1K3R A;  1BKB A;  1NBW A;  3STB D;  1Y1W G;  1WI5 A;  4JI5 Q;  2LXJ A;  3UE1 A;  3UDF A;  4YCV A;  3AYH B;  3F1Z A;  2HT1 A;  4A3G G;  3S2H H;  2B29 A;  2KHJ A;  1TWC H;  1VQ9 A;  4KHZ A;  3KJO A;  1WCM G;  1VCI A;  5HY6 A;  4YHH L;  1Q7Y C;  2E2J H;  1Q1E A;  1UWV A;  2OTL A;  1G51 A;  4H02 A;  3G71 A;  1YIJ A;  4JV5 Q;  3U50 C;  1Q82 C;  1K0R A;  2R93 H;  1PH2 A;  3RZO H;  3CW2 C;  1KD1 C;  2PMZ E;  2UXD L;  1I94 L;  4GOP A;  2NZH A;  3DLL A;  3CPF A;  2MNA A;  2K75 A;  4LFA Q;  2VUM G;  4DAY B;  2R92 G;  4GKJ L;  1CSQ A;  1X55 A;  1Y1W H;  1UE6 A;  3T1Y Q;  1EFW A;  2ZJP A;  4B3M Q;  4GLV B;  1RL2 A;  1WOC A;  5IP9 G;  1XNQ Q;  1T9H A;  2JA6 G;  1YZ6 A;  1PH5 A;  3AFQ A;  1VQM A;  3PO3 G;  4BXX H;  1E24 A;  2XGT A;  2NVQ H;  3H0G H;  4X62 L;  3RZD H;  3RR5 A;  3ULJ A;  4QIW E;  4DV3 Q;  4LF5 L;  3KF6 A;  4LFC Q;  2ASB A;  2A8V A;  1PVO A;  1X6O A;  2VS1 A;  3K7U C;  1G6P A;  5JEA G;  2RCN A;  3NBH B;  5C0X G;  1VQC A;  3W1G A;  2N78 A;  1UE7 A;  3GTJ H;  1HNW L;  1NE3 A;  2YTV A;  3RLF A;  5JJI A;  2HQL A;  2AWN A;  4OWX B;  1I50 H;  4EX5 A;  4R4T A;  3PIO A;  4A3B H;  3K8A A;  3HOZ G;  4GNX B;  3HOY H;  4LW1 A;  2CWP A;  3F2D A;  2F3I A;  1XJV A;  1A62 A;  1B7Y B;  1QVC A;  2Y0S E;  5BR8 Q;  4K0K Q;  3CPW A;  1SRO A;  1OXU A;  4YHH Q;  2UUC L;  4IOA A;  1SR3 A;  4AQY Q;  2PQA A;  4BBS H;  4OO1 G;  2FXQ A;  4LUV A;  4JI7 L;  3G4S A;  2K5H A;  3RN2 A;  1VQF A;  1IBL L;  4YY3 Q;  3PF4 A;  1FL0 A;  2JA5 G;  4IFD G;  1PYS B;  4LF7 L;  2Y0S G;  3HKZ E;  4JOI C;  4JI0 Q;  1IBM L;  5HGQ A;  3CCL A;  3I4O A;  4PZ7 A;  3CF5 A;  4HJA A;  4LF8 Q;  2UXC L;  4RMF A;  1NMF A;  4B3S Q;  4A3C H;  4JI3 L;  2K5N A;  1Q86 C;  4X65 L;  4DR6 L;  4MZ9 A;  2ZJQ A;  3MEF A;  1YBY A;  4A76 A;  3TRZ A;  1HH2 P;  1OXT A;  3Q8D A;  2WAQ E;  2B63 G;  4LWC A;  4AQY L;  3HOX G;  3I55 A;  1XNR L;  4A3D G;  2NN6 G;  5AJ3 Q;  3M4Q A;  5E7N A;  4A3J H;  1PH8 A;  1EYG A;  4JI8 Q;  4NXN L;  5C3E G;  4HIO A;  3J7Z C;  3HOV G;  1VQ6 A;  1KIX A;  1HZB A;  2WB1 G;  3CC4 A;  2R92 H;  4R4I A;  4L5S A;  1N33 Q;  2NZO A;  3CCJ A;  4NXN Q;  1VQA A;  2OQ0 A;  2VZA A;  1PFS A;  1KC8 C;  2JQO A;  5FLM G;  4A3C G;  2A1A A;  4BY7 G;  4DUZ L;  2VQE Q;  4HIM A;  2KCM A;  3OW2 A;  4XTC S;  4JG2 A;  2N49 A;  3NEN A;  4LUZ A;  4AH6 A;  3CC2 A;  4B3T L;  1Q1B A;  2YTY A;  4PZ8 A;  1VQO A;  2ZTE A;  1YIT A;  1VQJ A;  1HZC A;  2K5V A;  1YJ9 A;  4P73 A;  1YHQ A;  2PI2 E;  2R7D A;  4JYA L;  3TEH B;  1O7I A;  3E9I A;  5C44 G;  5IYB H;  1XMO Q;  4GN3 B;  5C0X J;  1Y14 B;  3J80 i;  2JEA I;  1VQG A;  1JB7 A;  3KYH C;  3T1H Q;  3HOY G;  1L1O C;  4LFB L;  2NN6 I;  1LM0 A;  2EQS A;  2E2I H;  1I5F A;  3FKI G;  2JA6 H;  3G48 A;  3I2Z A;  2WP8 J;  5M5Y H;  1CKM A;  3K0X A;  1X3E A;  2R7Z G;  1W3S A;  2HIX A;  1YHB A;  3CCS A;  4A3B G;  1I3Q H;  4NXM Q;  3BU2 A;  1MIU A;  2UUC Q;  2BH8 A;  1AE3 A;  3KFU A;  1A8V A;  3H3V H;  2IX0 A;  3GTG H;  3J7A 5;  4EQ5 A;  3EN2 A;  1J6Q A;  4IO9 A;  3S2D H;  2LXK A;  2B3G A;  3E9H A;  4DAM A;  4A3K H;  5M5W H;  3DM3 A;  3I4M H;  1QUQ B;  4GNX C;  4GOP B;  1N8R C;  4LF5 Q;  4LNQ A;  4A3I G;  4GN4 B;  4BY1 G;  5C4X H;  1HJP A;  1HNW Q;  1PA6 A;  1D7Q A;  5IYC G;  4WJ4 A;  5ELO A;  2JA7 G;  4L5Q A;  2IHE A;  3CXC A;  1VS0 A;  1XMQ L;  2ID0 A;  1TWF H;  1I6H H;  1IYJ B;  1UEB A;  1V43 A;  2AHO B;  3OYY A;  4P72 A;  2ZM6 L;  3S1M H;  2JJQ A;  3CQZ H;  1EUJ A;  2MFI A;  2JEB I;  5IE8 A;  4A4I A;  4X65 Q;  2VUM H;  1PH6 A;  4OO1 I;  3ZJY C;  3S1R H;  4R4C A;  1N32 Q;  4DR3 L;  1Q8K A;  2UUA L;  4YCW A;  3EIV A;  2Q2I A;  3S14 H;  2VQF Q;  3CCU A;  1OXV A;  1XTD A;  2HIV A;  3W1B A;  4FDB A;  5IYD H;  4HJ7 A;  2JA7 H;  2E5L Q;  3I7F A;  2OTJ A;  2UXD Q;  1GD7 A;  2R7F A;  1MKH A;  1CKN B;  4GLA C;  1VQB A;  4TVA B;  3J81 c;  2JA9 A;  3AFP A;  3BZK A;  1S40 A;  4JI5 L;  4GLX A;  1PH4 A;  2E5L L;  4DR6 Q;  1VQ7 A;  1EIF A;  4P71 A;  3S17 H;  3KOJ A;  1N32 L;  1DGS A;  4IJH A;  4X64 L;  4K0K L;  4A3L H;  2IY5 B;  3B6Y A;  1XMO L;  1AE2 A;  1X3G A;  4X66 L;  5C0X I;  1PYB A;  3K80 C;  5IY0 A;  1JT8 A;  3W5O A;  3PSI A;  1WFQ A;  3ICE A;  1TXY A;  3A5Z B;  3PO3 H;  3WWV A;  4YCU A;  2XTI A;  1PH9 A;  4DV0 Q;  3ER0 A;  2WB1 E;  4PG3 A;  1PH3 A;  3PUX A;  4OWT B;  5IYC H;  4R1J A;  3U4V A;  4OWW B;  1HR0 W;  4DUZ Q;  1YNX A;  1C9O A;  3GTL H;  5DLQ E;  1E22 A;  5GQO A;  4DV1 L;  5FJ8 G;  4B3T Q;  1XPU A;  2HHH Q;  5C44 H;  1A63 A;  5M3M G;  1X3F A;  3M4P A;  3F2C A;  2VQE L;  1HR0 L;  1KHI A;  3OTO L;  2Q2H A;  1HR0 Q;  2UUB L;  2UUB Q;  3M4O H;  4GKK Q;  1CKN A;  2E2H H;  4B3M L;  1Q46 A;  2WAQ G;  3HOU G;  4JI8 L;  3ULP A;  4OX9 L;  4DR1 Q;  2F4V Q;  4DNI A;  2AWO A;  4C2M H;  4B3R L;  1TWG H;  3J81 j;  1R9T H;  2ZTD A;  2CKZ B;  1W2B A;  4BY1 H;  4JBM A;  4LF9 Q;  2JK8 A;  1CSP A;  2CWA A;  4JOI A;  3ULL A;  2IX1 A;  2R7Z H;  2CQO A;  4UP8 A;  1K9M C;  2D0P A;  1CKO A;  3GO5 A;  5GAD C;  5IT9 c;  1ASZ A;  1XPO A;  5LMN L;  4A3M G;  1EWI A;  2JA5 H;  4JBK A;  3A0J A;  2JE6 I;  2MQH A;  1SMX A;  3S16 H;  2CCZ A;  3MXN B;  4GKJ Q;  1Y1V G;  4XIG S;  2EXD A;  3HKS A;  4JBJ A;  1N9W A;  3JAM i;  2NVX H;  3I4N H;  3RLO A;  2UXC Q;  3KDF B;  1QVG A;  4LF8 L;  4A3I H;  1D8L A;  2A19 A;  2WFW A;  1N34 Q;  4OXP A;  2KBN A;  5IP7 H;  4A93 H;  4GOP C;  3I4M G;  4NB3 A;  3A74 A;  3HOX H;  4GNX A;  4A3F H;  3GTK H;  4KHP L;  4AYB E;  1MJC A;  4JI7 Q;  4LF6 L;  4POG A;  3PO2 H;  3LGJ A;  2MO0 A;  2Z6K C;  3T1H L;  1S72 A;  4BBR H;  3SGI A;  1UE1 A;  2K14 A;  5C4J H;  4A3L G;  5LMU Q;  1JE5 A;  1WJJ A;  1J5E Q;  2NVT H;  4LFB Q;  2Q2T A;  4OX9 Q;  2JA8 G;  1VQE A;  1E7Z A;  5M3F G;  1BBW A;  3TRE A;  5JJL A;  1Y1V H;  5IYD G;  3GTM H;  1IZ6 A;  2D62 A;  5GAG C;  4A3E G;  1XMQ Q;  5M5X H;  1FJG Q;  1JJC B;  1U5K A;  1VQH A;  4APV A;  2ZM6 Q;  2HHH L;  2NVY H;  3M7N A;  2R93 G;  1KQS A;  3HKZ G;  4IPG A;  4X62 Q;  1XNR Q;  1UE5 A;  5FLX c;  4A93 G;  5GRO A;  2Z6K A;  1JMC A;  1EOV A;  3HOW H;  3JAM c;  3CCE A;  4DR4 L;  1SRU A;  1BVS A;  5FJ8 H;  1QUQ A;  3S24 A;  2KEN A;  4UPA A;  4DR1 L;  3NEM A;  4C3H H;  3F2B A;  2F4V L;  3S1N H;  4IFD I;  2PI2 A;  2KCT A;  1Q81 C;  5K36 G;  3I56 A;  3KF6 B;  1CUK A;  1Q12 A;  4O0A A;  4DR5 Q;  1B8A A;  1XNQ L;  1OXS C;  3L2P A;  2L15 A;  4HJ9 A;  3VDY A;  4B3S L;  3HOU H;  1P16 A;  4UP7 A;  1WYD A;  4IFD J;  4DV6 L;  3PUY A;  4R4Q A;  3L7Z C;  4JI0 L;  1QVF A;  4L5R C;  4POF A;  4A3K G;  5IP7 G;  3PV0 A;  2I0Q A;  2BA1 A;  2H5X A;  1KAW A;  3TS0 A;  3AQQ A;  4NXM L;  1YEZ A;  1VQP A;  2CFM A;  4UP9 A;  1XPR A;  2GVB A;  1K83 H;  1E1T A;  3TS2 A;  4C3J H;  5LMN W;  1FGU A;  1N36 Q;  1GO3 E;  3PUV A;  4HID A;  3CCM A;  3HFZ B;  3CAM A;  5BR8 L;  1ASY A;  1VQN A;  1TWA H;  2ZTC A;  1N34 L;  3GTP H;  4QGU A;  3J80 c;  2GN5 A;  3CMA A;  4DV5 L;  4HJ5 A;  1X9N A;  4X6A H;  4BA1 I;  2ATW A;  5LMN Q;  1KL9 A;  3CC7 A;  3I4N G;  1HNZ L;  5C4X G;  2I5H A;  3KF8 B;  3L0O A;  4QY7 A;  2MO1 A;  2GVA A;  1GVP A;  1M1K C;  1PHJ A;  3D31 A;  1WCM H;  1EIY B;  1K8G A;  3M9B A;  1SFO H;  2RF4 A;  4IJL A;  5GAH C;  4HJ8 A;  1IBK Q;  2UU9 L;  3UDG A;  4PMW A;  3PGZ A;  2VY3 A;  2QEX A;  1M90 C;  2UUA Q;  4PZ6 A;  1SE8 A;  1L1O B;  4DR5 L;  1VQK A;  1U0L A;  1VQ4 A;  1PV4 A;  4QL5 A;  4JC0 A;  1SLJ A;  2PQA B;  3E0E A;  4R4O A;  4DK3 C;  4DV7 Q;  2RHS B;  4P75 A;  3CD6 A;  5JJK A;  4IPH A;  4C3I H;  2QGQ A;  3OTO Q;  2DUD A;  1IL2 A;  1AH9 A;  3UE0 A;  1G29 1;  4LFC L;  1P8L A;  1LYL A;  4TQU S;  4DR2 L;  1YI2 A;  4JBW A;  1NY4 A;  5AJ3 L;  2I5M X;  3G6E A;  4BA2 I;  3HOV H;  5H1S E;  2Q2U A;  1MJE A;  4DKA C;  4J15 A;  3KDF A; 
#chains in the Genus database with same CATH topology
 1EU4 A;  1TWH H;  1NCV A;  3FVQ A;  4RGT A;  1YNJ D;  1X54 A;  2B2W C;  1K8A C;  1VQ8 A;  3A8J E;  2PMZ B;  1FNU A;  3T56 B;  4ME3 A;  2KEC A;  1JWU D;  1ILQ A;  3PCO B;  3X3N A;  1IW7 D;  1K8O A;  3DM1 A;  1S3O A;  2CHB D;  3JAM L;  1JJ2 A;  4JYA Q;  1I6H B;  3K7A B;  4OEM B;  3J81 i;  4YY3 L;  4A3M B;  3SXH A;  1UEA B;  3MVV A;  3J80 L;  2C35 B;  3CP0 A;  4HMJ A;  1S5B D;  5EPL A;  4WJ3 M;  3GTQ B;  1ONL A;  1T5E A;  3GQB A;  5FK9 C;  2QA4 A;  1HNX L;  5GAE C;  4KLK A;  3HZX A;  5I6W A;  2EY1 A;  2FIN B;  1YJN A;  1PH1 A;  4O1N A;  4JI4 L;  4QCL A;  5IOD A;  1BBU A;  2L4N A;  3NPP A;  5T1G A;  4FYD A;  5D65 A;  3FEW X;  1VMP A;  2D0O A;  1JCK B;  3CCR A;  1PYW D;  4DV2 L;  1SE2 A;  3H3V I;  2C9O A;  1N33 L;  3S15 H;  3GD7 A;  4IN3 A;  1WTQ A;  2A5H A;  3FP9 A;  1SMY D;  2JYO A;  1RTN A;  1L0W A;  4A3E H;  1HXY D;  4JI2 Q;  4JCV E;  1PTO B;  1V1P B;  4YWL A;  2NBF A;  4KKS A;  1YHA A;  2ES2 A;  5M3M H;  1HNZ Q;  1RKN A;  3H91 A;  3K81 C;  5DNF A;  1PXU A;  1K73 C;  2RBM A;  4KN4 C;  3T16 A;  1D6E C;  2Z6B A;  4ALP A;  1G6Z A;  1MD2 D;  2LSS A;  3OWE B;  3MWY W;  4DV2 Q;  4BY7 H;  1O7Y A;  1FVI A;  5EAY A;  3SDZ A;  2R6G A;  3D4R A;  3KLW A;  5JEA J;  4LF9 L;  1YJW A;  5ELB A;  1QZH A;  3NEL A;  4QUF A;  3CCV A;  1SNM A;  4R8N A;  1OTC A;  3MFY A;  4MN3 A;  4JI1 L;  4OGQ C;  3VYS A;  2DNE A;  3J7Y W;  5M3F H;  2CH4 A;  1IBK L;  1AN8 A;  3VYT A;  3I73 A;  2TSS A;  2Z0S A;  3FHW A;  3QB3 A;  4DV1 Q;  3BS1 A;  4A3D H;  1PTO C;  4LUO A;  3PUW A;  3PIP A;  4BS9 A;  4A3G B;  3S1R B;  2A69 C;  1IBM Q;  1LT4 D;  1HFG A;  2KHI A;  5IP9 H;  4JI6 L;  3M85 A;  2DGY A;  1EQR A;  1V1O A;  4JI3 Q;  1BKB A;  1NBW A;  3TP6 A;  4WRD A;  4JI5 Q;  3GTM B;  2LXJ A;  3BVM A;  3X3M A;  3MTS A;  1H9K A;  1Q1E A;  1UWV A;  3TP7 A;  4JV5 Q;  1YIJ A;  1K0R A;  5DM6 3;  4DK1 A;  4F87 A;  3CPF A;  2K75 A;  4GKJ L;  5A2Q E;  2DY7 A;  2TMP A;  3D3R A;  5IP9 G;  1XYI A;  1XNQ Q;  2DJG C;  1I3Q B;  3PO3 G;  1TII D;  3HG9 A;  4BXX H;  3H0G H;  5IT9 L;  3A54 A;  4V0B A;  2A8V A;  1PVO A;  4ZK9 B;  5JEA G;  1U4R A;  2WAQ B;  1WTV A;  1NE3 A;  3V2T A;  1BNZ A;  5JJI A;  2F0J A;  2AWN A;  5FO7 B;  4CKC A;  4EX5 A;  3PIO A;  3K8A A;  3V96 A;  3HOY H;  5T1I A;  2F3I A;  1A62 A;  1QVC A;  2JA8 B;  3CPW A;  4YHH Q;  1QNK A;  2KOL A;  4OO1 G;  2SOB A;  3KF8 A;  4JI7 L;  3MFG A;  3MXN A;  3G4S A;  2K5H A;  3RN2 A;  3S1N B;  3E3X A;  2E2H B;  3T13 A;  3QOL A;  5HUR A;  4ZUJ A;  4HJA A;  1I4P A;  1NMF A;  3O13 A;  4X65 L;  1STE A;  4MZ9 A;  1R4Q B;  4RAU C;  3MEF A;  1BCP B;  1A2U A;  2BDN A;  4FVM A;  4F88 A;  2WAQ E;  4LWC A;  4AQY L;  4CGY B;  4A3D G;  2F3V A;  2NN6 G;  3M4Q A;  3VR6 A;  4QMG A;  2WAC A;  1KLU D;  4FXD A;  4L5S A;  2P5Z X;  2NTT A;  1X3Q A;  3RUZ A;  2A69 D;  3K58 A;  4A3C G;  5CMD A;  1TKW B;  2X69 A;  3M7G A;  1O78 A;  4AH6 A;  5FLX L;  2B2U A;  2YTY A;  3S16 B;  4PZ8 A;  1G8Z D;  2ZTE A;  1YIT A;  1HZC A;  1YHQ A;  4P73 A;  2RDG A;  3TEH B;  1D5X C;  5C44 G;  3PIO 3;  4GN3 B;  5C0X J;  5I9O A;  1KLG D;  1Y14 B;  4HN7 A;  3J80 i;  3GTJ B;  1JB7 A;  3T1H Q;  5I6Y A;  2NN6 I;  4IUR A;  2EOT A;  1JOO A;  4NDX A;  1AZP A;  4C3I G;  4L63 B;  1NAP A;  3G48 A;  3I2Z A;  3I4M B;  2OF1 A;  3SK6 A;  3K0X A;  5JEA H;  3AMU A;  3H0G B;  3LNN A;  1I3Q H;  4ZQ3 A;  2JXM B;  1MIU A;  1A8V A;  4UHV A;  4X3K A;  1CK1 A;  4EQ5 A;  1J6Q A;  2HUG A;  5D3D A;  3K5L A;  3DM3 A;  1MBY A;  5E1F A;  2PNR C;  1HNW Q;  3DMU A;  4MHE A;  5IYC G;  3U9O A;  1EY7 A;  2IHE A;  1E0B A;  4RH6 A;  1TWF H;  2SDF A;  2ZM6 L;  4K8J A;  3S1M H;  4KY5 A;  2JJQ A;  4X65 Q;  4HED A;  2MFI A;  4A4I A;  4OO1 I;  3S1R H;  4R4C A;  3P1H A;  1VDZ A;  2VQF Q;  1XTD A;  4FDB A;  2JA7 H;  2E5L Q;  1O7Z A;  2EE1 A;  1GD7 A;  2KA7 A;  1MKH A;  4GLA C;  3AFP A;  1KTK A;  1S40 A;  1PH4 A;  4A3J B;  1VQ7 A;  3KOJ A;  3MA2 B;  1DGS A;  1LTA D;  1RCV D;  4IJH A;  4X64 L;  1B3A A;  1M4V A;  4A3L H;  2IY5 B;  1NR2 A;  4C3I B;  3F2U A;  5IY0 A;  3PSI A;  4ZLT F;  3PO3 H;  4YCU A;  1PH9 A;  3ER0 A;  3AU7 A;  3QWN A;  4DK0 A;  4PG3 A;  1PH3 A;  4DUZ Q;  1ZYR C;  4EVO A;  4DV1 L;  1ICF B;  4B3T Q;  4DA2 A;  5C44 H;  2K33 A;  1SNC A;  5M3M G;  1X3F A;  3M4P A;  1GJX A;  2UUB L;  1S5D D;  5KND A;  1HR0 Q;  1H9S A;  1CKN A;  3D8G A;  2WAQ G;  2F4V Q;  1D1K A;  3FPP A;  2AWO A;  4B3R L;  4M8A A;  2E2I B;  5C4X G;  1CHQ D;  3OMC A;  3ULL A;  2EXZ A;  4IUU A;  2D0P A;  3GO5 A;  3EFX D;  4KMU C;  1EWI A;  4JBK A;  2JE6 I;  3J7A V;  3DWA A;  3S16 H;  5EGT A;  2B8F A;  4GKJ Q;  2EXD A;  2NVX H;  4XT1 B;  2UXC Q;  1QVG A;  2QEJ C;  2E75 C;  1GXD C;  5IP7 H;  4A93 H;  4CDC C;  2MJ8 A;  4A3F H;  3GTK H;  1DCZ A;  1MJC A;  4POG A;  1DZ1 A;  2EY2 A;  2Z6K C;  1PZK D;  4HSV A;  2RSO A;  2XIW A;  4PV1 C;  1WJJ A;  4K8I A;  2JA8 G;  1CFM A;  1WD0 A;  1CM9 A;  1IKM A;  2ZT9 C;  3GTM H;  4JK1 C;  2L12 A;  1EIH A;  1FJG Q;  5CBE E;  4APV A;  1E2V A;  2K04 A;  3HKZ G;  2SNS A;  1XNR Q;  1UE5 A;  3NWS A;  5FLX c;  1JMC A;  4DR4 L;  1IW7 C;  2C5C A;  2F4V L;  1ML0 D;  4IFD I;  3M3Y B;  1GUN A;  4TKO B;  3MXG A;  3KF6 B;  1CUK A;  2E74 C;  2KVM A;  4DR5 Q;  1OXS C;  3L2P A;  2L15 A;  3HOU H;  3LWE A;  3NK9 A;  1TVX A;  4JI0 L;  4K5V A;  2LFN A;  4JW0 A;  1MSG A;  1DOM A;  2Z1C A;  3MHB A;  3AQQ A;  3C1E A;  1RDP D;  1EYC A;  2JA5 B;  5DEH A;  2ZXO A;  2GVB A;  5FO9 B;  3S9W A;  5CC4 A;  3TS2 A;  5JOB A;  1ET6 A;  1TWA H;  2ZTC A;  2Q8I B;  3J80 c;  4DXG A;  2GN5 A;  5ELC A;  4HJ5 A;  3G6J B;  3NHH A;  1KL9 A;  1EWH A;  3I4N G;  4DN4 M;  1HNZ L;  1BBX C;  3PQI A;  2N55 A;  2A6H C;  5E4W C;  1F9P A;  4QY7 A;  1HUM A;  1M1K C;  1EQT A;  4HR7 B;  1SFO H;  2RF4 A;  4HJ8 A;  1IBK Q;  4DFA A;  5IGG A;  3JAM E;  3PGZ A;  1PFN A;  1U0L A;  2O4X A;  4QL5 A;  1DON A;  4DK3 C;  2KQ3 A;  4DXF A;  5JJK A;  1PRT C;  4LJZ C;  2QGQ A;  4C1N K;  2DUD A;  4LFC L;  1P8L A;  3S17 B;  2B2Y A;  1LYL A;  4N9P A;  4DR2 L;  1FNW A;  4BY1 B;  1MGS A;  2XVS A;  3G6E A;  1JWM D;  3HOV H;  1EQV A;  4C2M B;  5IGF A;  2K01 A;  2WII B;  2HQE A;  4HIK A;  3NUC A;  4LAA A;  1NMG A;  3BVZ A;  4IQZ A;  4DUY L;  1I94 Q;  1A0I A;  1IBL Q;  2ICE C;  1NTG A;  3H0G G;  4GN5 A;  1TWF B;  2VB3 X;  2EYL A;  4LF4 Q;  4IOC A;  4XQJ A;  4RHR A;  1RIP A;  3K5M A;  1IYV A;  4FF4 A;  4DV6 Q;  1OO9 B;  4RGM A;  4Y52 H;  3GTQ H;  4C3H G;  1H95 A;  1G91 A;  3STB C;  3A5U A;  3BZC A;  4MTN A;  1IYU A;  1F9S A;  4K14 A;  4U67 3;  1SEB D;  3A8I E;  3PMF A;  1KXL A;  2IPK D;  4DR4 Q;  3NBH A;  3C3L A;  4DPG A;  3CCQ A;  2AKW B;  2O5I C;  5J3B A;  4IPD A;  3Q23 A;  1FNV A;  4FF2 A;  4XYQ A;  3PO2 G;  3MZ5 A;  3GTO H;  2B63 B;  4ZKB B;  2KHS A;  3NQT A;  1ZXT A;  4XQN A;  5LHY 1;  4NW2 A;  2IW3 A;  5JPM C;  4GKK L;  4BBR G;  5M3M B;  3Q24 A;  1PTO H;  3U4Z A;  4ZCK A;  1EY4 A;  4QJF A;  1ZKO A;  2NN6 H;  2F0T A;  1VQI A;  4OIJ A;  2LS0 1;  2B63 H;  1K28 A;  4YWK A;  1JE4 A;  1LTL A;  4V19 0;  4H0L C;  1JOQ A;  1B70 B;  1Y1W B;  5C4Z A;  1YVC A;  1Z47 A;  1EOT A;  3ZYY X;  1ENC A;  4ABN A;  4CHT B;  3ITP A;  5ISR A;  1WTW A;  1SDF A;  4DR3 Q;  1HPC A;  1B44 D;  3K7A H;  3ONA B;  1S5E D;  4IAL A;  2JA6 B;  4JI1 Q;  3T1Y L;  4MNO A;  5IYB G;  2IHF A;  2MHV A;  4LFA L;  5C3X A;  3UDX A;  1HRJ A;  3BDO A;  5CYU A;  4NPS A;  2L5T A;  2N88 A;  1LT3 D;  1VMC A;  2MUY A;  1GKH A;  1QZG A;  4DR7 L;  1LTI D;  4DNT B;  3UDI A;  2G9D A;  2M2L A;  5IWA Q;  2YU9 H;  2NVY B;  1J5E L;  1V1Q A;  1X32 A;  4AYB G;  1HQM C;  2PNH A;  2YV5 A;  4HTH A;  4LF7 Q;  4C1N I;  1BCP F;  1WI5 A;  2BCO A;  1VF7 A;  4CKE A;  3UE1 A;  3UDF A;  4YCV A;  3F1Z A;  2HT1 A;  2M9V A;  4KHZ A;  1ESF A;  1QG7 A;  1LTG D;  1F2L A;  3FRP B;  5COY A;  3K5O A;  3NTI A;  2R93 H;  2NVT B;  3W3A A;  2PMZ E;  1KD1 C;  1I94 L;  2NZH A;  2HCI A;  5KEE A;  2NVQ B;  4LFA Q;  4DAY B;  3TP8 A;  2R92 G;  2PZW A;  1CSQ A;  1X55 A;  1UE6 A;  4CDE C;  5HGT A;  3PO2 B;  1U4M A;  4QB4 A;  4EGV A;  3EJI A;  1WOC A;  2RDF A;  1KAA A;  1VQM A;  5A2Q L;  1JIC A;  4X62 L;  3TN2 A;  2PCF B;  1TWA B;  2J0T D;  1D1I A;  2NWG A;  4KN7 C;  1I4Q A;  2PZU A;  1VQC A;  2L0C A;  3W1G A;  1UE7 A;  3GTJ H;  2YTV A;  1I50 H;  1E2Z A;  2GA4 B;  4GNX B;  4LW1 A;  1PMR A;  1WTP A;  1LTR D;  4K2L A;  4K5X A;  2Y0S E;  5BR8 Q;  1J8I A;  1LT5 D;  1STA A;  3J81 E;  2J7Z A;  4BBS H;  3SK5 A;  2DN8 A;  4FNF A;  2DJF C;  5F2D A;  3T53 B;  4IFD G;  2B2T A;  4YY3 Q;  2NB0 A;  1PYS B;  1EWC A;  3R3O A;  4JOI C;  1IBM L;  5HGQ A;  1LTT D;  4LF8 Q;  1EEI D;  1NSN S;  4A3C H;  4JI3 L;  2K5N A;  3L9A X;  1JOR A;  2CW0 C;  5EPK A;  1ICW A;  1QOH A;  1PLF A;  1J9O A;  2E2J B;  5M5X B;  1OXT A;  1SE4 A;  3Q8D A;  1H9S B;  4IZ8 A;  3HOX G;  4UDU C;  1XNR L;  1ZYR D;  3NSW A;  1EYG A;  4JI8 Q;  2LMC B;  3J7Z C;  3GTK B;  1YNN D;  3TZU A;  2F03 A;  4J6H A;  1N33 Q;  2EYF A;  3P20 A;  2OQ0 A;  2EJF C;  3DEO A;  4Q0F A;  2A1A A;  2KCM A;  3OW2 A;  4E6I A;  2N49 A;  2AQ1 B;  4LUZ A;  5KYI A;  3CC2 A;  1Q1B A;  3C2P A;  1VQO A;  1VQJ A;  1PFM A;  1YJ9 A;  5JAV A;  5C0X H;  2B2U C;  2KJX A;  3I4L A;  3E9I A;  1XMO Q;  2PW7 A;  4ZUI A;  1HHV A;  1VQG A;  2EQS A;  2B39 A;  4X3T A;  5M5W B;  5M5Y H;  4KHV A;  1QB5 D;  2EYM A;  2HIX A;  3HOZ B;  3R8B A;  2ENB A;  1Q90 A;  4NKL A;  2FMC A;  1LV9 A;  4NXM Q;  2UUC Q;  2BH8 A;  1AE3 A;  4XDX A;  3OOC A;  4G7H C;  2D5D A;  3C46 A;  3J7A 5;  4IO9 A;  2LXK A;  5CV5 A;  2B3G A;  5M5W H;  4GNX C;  4LNQ A;  1SJE D;  4BY1 G;  4A3I G;  5C3E B;  1BCP D;  2IWH A;  4P2C B;  4WJ4 A;  3KUP A;  2JA7 G;  4L5Q A;  3CXC A;  4X3S A;  1VS0 A;  4DAV A;  1I6H H;  1IYJ B;  1UEB A;  2AHO B;  1EY5 A;  4JPB W;  2M00 A;  4L8J A;  3CQZ H;  1ET9 A;  1YNJ C;  3ZJY C;  4IUP A;  2Q2I A;  2E76 C;  3CCU A;  2HIV A;  1PDQ A;  3FKI B;  5IYD H;  4FO2 A;  4HJ7 A;  2R92 B;  1DJR D;  4H13 C;  2R7F A;  3S14 B;  1GOZ A;  1SBB B;  2HDM A;  3B6Y A;  1B50 A;  2JP1 A;  5CR3 A;  4G7Z C;  1PYB A;  4FXK C;  4QUC A;  3W5O A;  3ICE A;  1TXY A;  2RKS A;  4ID6 A;  3WWV A;  2XTI A;  4NMZ A;  4DV0 Q;  2WB1 E;  1WTX A;  4BY7 B;  5IYC H;  3U4V A;  3GTL H;  4OWW B;  1QE6 A;  1YNX A;  2EY6 A;  1B3Q A;  1EY9 A;  1NR4 A;  3K57 A;  3KBX A;  2K28 A;  2VQE L;  3OTO L;  2UUB Q;  1EY8 A;  4GKK Q;  5EBD A;  4EQP A;  1Q46 A;  4B3M L;  3WOE A;  4KJO A;  4DNI A;  3DUZ A;  3J81 j;  1R9T H;  4JBM A;  2CKZ B;  2IX1 A;  2R7Z H;  2CWA A;  4JOI A;  3MXU A;  2CQO A;  2SNM A;  1K9M C;  2CQA A;  4ZKC B;  5IT9 c;  1A2T A;  5LMN L;  1HFN A;  3A0J A;  2MQH A;  3NTH A;  1SMX A;  4BWG B;  2B2V A;  3RLO A;  3KDF B;  4A3I H;  1D8L A;  2A19 A;  2WFW A;  3RZD B;  1N34 Q;  4GOP C;  4NB3 A;  3HOX H;  4GNX A;  2Z8L A;  4AYB E;  4LF6 L;  3PO2 H;  1XX8 A;  1K8M A;  3RZO B;  1TS5 A;  3I90 A;  1D5M C;  4WFN 3;  1S72 A;  2F0M A;  5KGU A;  3SGI A;  2K14 A;  5LMU Q;  4LFB Q;  2NVT H;  1R4P B;  1CQV A;  1F2M A;  1O7L A;  1Y1V H;  5IYD G;  1IZ6 A;  1XMQ Q;  2EJM A;  4BBR B;  1VQH A;  5M9O A;  3HRZ C;  4X62 Q;  1CI3 M;  3VR3 A;  5FJ8 H;  1Y69 U;  4EQO A;  2KEN A;  4C3H H;  3S1N H;  1O80 A;  1EZ8 A;  1GHJ A;  1STH A;  2KCT A;  1Q81 C;  2ZXR A;  2K1B A;  1SYB A;  1U4L A;  1WYD A;  4KTA A;  3J80 E;  5LL6 X;  4R4Q A;  3L7Z C;  3VYR A;  1G2S A;  1SND A;  3PV0 A;  5IP7 G;  3VR2 A;  4R9W A;  1KAW A;  2Y0S B;  3TS0 A;  4NXM L;  1EL0 A;  4HMI A;  2EYJ A;  1BUV T;  2CFM A;  4UP9 A;  4CJ2 C;  2QCP X;  5D14 A;  1BQQ T;  2F0U A;  1UUP A;  4A3B B;  1FGU A;  1N36 Q;  1GO3 E;  4HID A;  1SMY C;  1ASY A;  3CAM A;  3VR5 A;  1VQN A;  3IL8 A;  1N34 L;  4QGU A;  1F9Q A;  3HEJ A;  1X9N A;  2ATW A;  3CC7 A;  1JB3 A;  4RGO S;  3I70 A;  1DXM A;  3L0O A;  2L9H A;  2GVA A;  5C4H A;  1PHJ A;  4OEL B;  1WCM H;  1HCZ A;  3M9B A;  1GUS A;  1C4Q A;  1B9M A;  4IJL A;  5FLX E;  3UDG A;  5K5P A;  5J39 A;  1X3P A;  2VY3 A;  2WV6 D;  1U4P A;  1M90 C;  1SE8 A;  3D4D A;  4DR5 L;  2F0N A;  4JC0 A;  3E0E A;  3ND9 A;  4R4O A;  4N9T A;  3CD6 A;  1W6J A;  4C3J B;  4IPH A;  1II3 A;  2PYK A;  1F2Y A;  1HA5 A;  1TWC B;  4I7Z C;  3PIP 3;  2O5J C;  5CV8 A;  5JVH 3;  5EBC A;  4RCO A;  1NY4 A;  5AJ3 L;  4K2K A;  2I5M X;  4BA2 I;  5KRU A;  3IRB A;  4Y7N B;  4AIM A;  5EKI A;  1PTO F;  3TQY A;  4CDD C;  1CQF A;  3JC6 6;  4YWM A;  1F77 A;  2N8N A;  3AEV A;  5I2Y A;  1SYD A;  2F52 A;  1X65 A;  2YYZ A;  4EQN A;  4OHJ A;  4TRD A;  1VQD A;  2RDH A;  3NTK A;  4DK6 C;  4GS3 A;  1SN8 A;  3IAY A;  5K36 H;  4B9X A;  4N8X 1;  2K5D A;  4S3S A;  1SNP A;  4L6T B;  2UXB Q;  1I6V C;  3LWU A;  2KCN A;  4IUT A;  4BBS G;  3MAQ A;  4RA8 A;  2K05 A;  2VB2 X;  3K6O A;  4FF1 A;  4Y7N H;  2D9U A;  4DV3 L;  1SAP A;  4H44 C;  4OON A;  5KIX A;  3BJU A;  3RLN A;  4RCN A;  3K0Y A;  4ZAI A;  3CQZ B;  1X56 A;  2XWB B;  2UXB L;  2OWO A;  3D6C A;  4LF6 Q;  1ENF A;  2B2Y C;  4LF4 L;  4A3J G;  4O2D A;  2QF7 A;  3OIP A;  2AUK A;  3J7A F;  5C5L A;  4QQB X;  1LAC A;  4DV4 L;  3S2D B;  3EVQ A;  1WCM B;  2EYP A;  4PNY A;  5AFW A;  3EBE A;  1QIL A;  4DAY A;  1EQQ A;  4BXX G;  4K6D A;  3FMC A;  3A8K E;  3KLR A;  2OQK A;  3QR8 A;  5EQ0 A;  5BN5 A;  1B4O A;  1S5C D;  3F8T A;  4RG1 A;  4JI2 L;  4C3J G;  4DR7 Q;  4KKT A;  5IT9 E;  1FR3 A;  1GM5 A;  2B2W A;  3KLS X;  4GZY C;  4XT3 B;  3S1Q H;  1RHP A;  4A3M H;  2QDL A;  4RKL A;  1OXX K;  1YNN C;  2QKI C;  1GUT A;  1TS2 A;  3A56 A;  3DHQ A;  3GP7 A;  3SR1 A;  3D0F A;  3PUZ A;  3H15 A;  2UU9 Q;  2RCF A;  5ELN A;  1IKL A;  2F0G A;  1E3P A;  2EIF A;  2ZXP A;  5CV7 A;  1TWH B;  2V1C C;  5J1Z A;  2FHT A;  4DV5 Q;  1C7Y A;  3RN5 A;  1XTC D;  5BN4 A;  1L2F A;  2ZJR A;  2KCC A;  2BA0 A;  2Z9H A;  1K3R A;  3DWP A;  2CH4 W;  2I46 A;  3AYH B;  4ILW A;  2KHJ A;  1WCM G;  3BYY B;  1N32 Q;  2E2J H;  1ESR A;  2OTL A;  1G51 A;  4H02 A;  2K7V A;  3U50 C;  1Q82 C;  1CHP D;  1PH2 A;  3SHL A;  3RZO H;  3DLL A;  5JVG 3;  3R2I A;  3BG3 A;  1Y1W H;  4ME5 A;  1EFW A;  2ZJP A;  2DNC A;  4GLV B;  1RL2 A;  1F9R A;  2EVB A;  3Q6S A;  1E24 A;  2XGT A;  3RZD H;  1H9M A;  3EQL C;  3RR5 A;  4IFD H;  4QIW E;  4LF5 L;  3KF6 A;  2NVX B;  1B53 A;  1S5F D;  2VS1 A;  3K7U C;  1G6P A;  3OSO A;  3NBH B;  1ROD A;  2N78 A;  1HNW L;  1I50 B;  1I4R A;  3RLF A;  2HQL A;  4OWX B;  3N52 A;  2CWP A;  3F2D A;  1XJV A;  4K0K Q;  4FF3 A;  1SRO A;  1JC7 A;  1BO0 A;  4AQY Q;  2PQA A;  4PQX A;  4LUV A;  2XNA C;  3PF4 A;  1FL0 A;  4LF7 L;  2I07 B;  2F0W A;  4HCE A;  1PRT B;  4YIJ A;  1JR0 D;  3CCL A;  2AUJ D;  4PZ7 A;  3CF5 A;  3HOW B;  3OIQ A;  1JOK A;  3H6M A;  4DAP A;  4DR6 L;  1GHK A;  1TY2 A;  2G5D A;  4A76 A;  3I55 A;  5C4J B;  5KYL A;  5E7N A;  2F1M A;  1PH8 A;  1EY0 A;  3NQI A;  3CHB D;  5I9P A;  4R8I A;  1HZB A;  1Z6H A;  3BYT B;  3D6W A;  3CC4 A;  3I8Z A;  4R4I A;  2F0H A;  3VYU A;  3TZD A;  2QW7 A;  2VZA A;  3CCJ A;  1KC8 C;  4NXN Q;  2JQO A;  5FLM G;  4BY7 G;  4DUZ L;  2VQE Q;  2WB1 B;  3NEN A;  4F7X A;  5C3W A;  2H4O A;  4A3I B;  4DGZ A;  5DAU A;  3SE0 A;  4HCS A;  1WTO A;  2K5V A;  4JYA L;  2R7D A;  2BDO A;  1AFP A;  3W2D A;  3DWQ A;  1Q3L A;  1V1P A;  3HOY G;  3KYH C;  1L1O C;  2NUC A;  1LM0 A;  2JN4 A;  3QOJ A;  1HQR D;  1I5F A;  3FKI G;  2WP8 J;  1CKM A;  1B2T A;  3M4O B;  2BOS A;  3RD4 A;  1X3E A;  2R7Z G;  1W3S A;  4A3B G;  1YHB A;  3CCS A;  1FD7 D;  1LTS D;  5E3F A;  3M4Y A;  2IX0 A;  2RA4 A;  3GTG H;  4XXE A;  3Q0A A;  3S2D H;  2F0S A;  3E9H A;  4IUN A;  4DAM A;  4A3K H;  3I4M H;  4GOP B;  1N8R C;  1CTM A;  5C4X H;  1HJP A;  4MTK A;  1PA6 A;  1D7Q A;  2FMM A;  2A74 C;  1MSH A;  2MPM A;  3A55 A;  1XMQ L;  1AW7 A;  2ID0 A;  3URY A;  1V43 A;  3OYY A;  4JVZ A;  2VUM H;  3QO2 A;  1Q8K A;  2UUA L;  4YCW A;  3EIV A;  3GTO B;  3S14 H;  2QDB A;  4F8M A;  2OTJ A;  2VUM B;  1CKN B;  1VQB A;  4IUQ A;  2JA9 A;  2HCC A;  3BZK A;  5A35 A;  2Q8T A;  1L0X B;  4DR6 Q;  4I7A A;  1EIF A;  1FGB D;  5NUC A;  4CJ0 B;  1N32 L;  4K0K L;  1RD9 D;  1AE2 A;  4X66 L;  5C0X I;  1JT8 A;  3E5S A;  3TDQ A;  5J22 A;  4J1M A;  2R61 A;  2F0L A;  5C4X B;  1ENA A;  4UAI A;  1SSO A;  4QF4 A;  4R1J A;  2X6G A;  2OXP A;  1C9O A;  3NE5 B;  3OWF A;  5DLQ E;  1E22 A;  4A3F B;  5EPJ A;  4J8Q A;  2HHH Q;  1A63 A;  3WDN A;  4KJN A;  4FP5 D;  1NNX A;  3M4O H;  2OEO A;  3HOU G;  1A3V A;  4OX9 L;  1EFI D;  4LK1 C;  4DR1 Q;  4C2M H;  5M5Y B;  1TWG H;  4K5W A;  2ZTD A;  4LF9 Q;  4A3B H;  2A6E D;  1MHW C;  1CSP A;  2JK8 A;  2O2L D;  3K59 A;  2R7Z B;  2WKC A;  3VA7 A;  1L0Y B;  2IX3 A;  2XRS D;  1B9N A;  2CCZ A;  1ILP A;  3MXN B;  2A68 D;  1Y1V G;  4XIG S;  3FDT A;  1WVL A;  1BR9 A;  2K03 A;  4HSP A;  3I4N H;  4LF8 L;  3E0J A;  1A3T A;  4WOR A;  2FFK B;  3I4M G;  3A74 A;  1LLR D;  4CKB A;  3BVG A;  3QG1 A;  3TSS A;  3KLS A;  2KED A;  5C4J H;  4A3L G;  3I91 A;  1JE5 A;  3G7L A;  5I4D A;  2ICI A;  1D2B A;  1VQE A;  2EDG A;  1BBW A;  3HGB A;  3TRE A;  2D62 A;  5EJW A;  5GAG C;  4A3E G;  3LX0 A;  3I3C A;  4K6L A;  1U5K A;  2ZM6 Q;  3WOF A;  2NVY H;  2R93 G;  1KQS A;  4IPG A;  3OW7 A;  3HOW H;  4IUV A;  3JAM c;  1KDA A;  1SRU A;  1QUQ A;  2JA7 B;  4UPA A;  4DR1 L;  1CZG A;  3NEM A;  3F2B A;  1I4H A;  2F0F A;  2PI2 A;  2Z4I A;  5K36 G;  1V8Q A;  3I4N B;  1S4Z A;  1B8A A;  3VDY A;  4B3S L;  5G3L D;  4X3U A;  4LMQ D;  1P16 A;  5FKA C;  4IFD J;  4DV6 L;  3PUY A;  4POF A;  5COR A;  2BA1 A;  4B08 A;  1VQP A;  1XPR A;  1GUW A;  1K83 H;  1E1T A;  1FYC A;  2A6E C;  1LAB A;  1SXT A;  2K5Q A;  5LMN W;  3PUV A;  1TU2 B;  3CCM A;  1HTL D;  5BR8 L;  1K3B C;  3GTP H;  4DV5 L;  2F0E A;  1PZI D;  4BA1 I;  3DEP A;  1EEF D;  2L55 A;  3CU7 A;  2I5H A;  3KF8 B;  1PFB A;  4RFB A;  1AZQ A;  5CV9 A;  2MO1 A;  4XYO A;  3D31 A;  3K5N A;  1EIY B;  2UU9 L;  3CRK C;  2EYH A;  2QIL A;  4PMW A;  3BZD B;  3OHX C;  1GUG A;  1STB A;  2UUA Q;  2A6H D;  1PV4 A;  3GTP B;  1SLJ A;  3R93 A;  4P75 A;  2J4X A;  1K83 B;  1IL2 A;  4QIW B;  3T51 B;  1IHZ A;  5L37 A;  1BCP C;  4DKA C;  4J15 A;  2QEX A;  2KEE A;  3VR4 A;  2K50 A;  2VNU D;  3I72 A;  4X64 Q;  4UY8 C;  4DV4 Q;  4C3H B;  3H94 A;  3CME A;  3U58 A;  2AQ3 B;  1IXR A;  2OCE A;  5IWA L;  3C1F A;  5FLM H;  3QIA A;  1N36 L;  2F3W A;  1KRS A;  3H09 A;  1JJG A;  5C3E H;  1A6X A;  2XWJ B;  2E8G A;  4Z9C B;  2VQF L;  5CBA E;  5C5M A;  4A3K B;  3ERQ A;  1V9P A;  1XXG A;  3UI2 A;  5EKK A;  4FXG C;  2VXW A;  3GTG B;  2VL6 A;  3RNU A;  2LY7 A;  3GDE A;  2VW9 A;  3FKI H;  4JI4 Q;  1FJG L;  1E1O A;  1L1O A;  3KK7 A;  1VQL A;  2BH2 A;  4RKB A;  2B8G A;  3MC0 B;  1QNU A;  1LUZ A;  4DV7 L;  2JA8 H;  1MI2 A;  1SE3 A;  4NP5 A;  3OMG A;  1HNX Q;  4PMC A;  3R2T A;  1K0S A;  1H9R A;  4L5T A;  1GUO A;  1KRT A;  5DM7 3;  3KJP A;  2YTX A;  3PF5 A;  2BE5 C;  5I2X A;  1HZA A;  1TWG B;  4JV5 L;  4DV0 L;  3FPU B;  2RSN A;  2PO4 A;  4PMB A;  4RWS C;  1Y8O B;  4DUY Q;  1VQ5 A;  4JI6 Q;  4OIK A;  1QWY A;  1SYC A;  3HOZ H;  1EYD A;  4P74 A;  1Z7T A;  1C8C A;  1TS3 A;  1M8A A;  2N3S A;  4B3R Q;  2K4K A;  1NJI C;  1C0A A;  4DR2 Q;  3L3O C;  5CV4 A;  3ERS X;  1DYQ A;  1DOK A;  4IPC A;  2NTS A;  2AMC B;  5D3I B;  2I5L X;  3J81 L;  4KD3 A;  4G7O C;  4KY6 A;  1KNA A;  4B3M Q;  1Z9F A;  2ALY B;  5LMU L;  4A3G H;  4G57 A;  1PH7 A;  1CA6 A;  3HOU B;  4C56 C;  3M3Y H;  4KHP Q;  4KI0 A;  3GV6 A;  3HOW G;  5ELF A;  1DD2 A;  4A3F G;  1A15 A;  1RJT A;  1HZ9 A;  2MGS A;  1KDC A;  4A75 A;  2F0Q A;  2XN9 C;  4I65 A;  4X66 Q;  2IT1 A;  4LFB L;  2JA6 H;  1IL8 A;  2RHQ B;  2K52 A;  3STB D;  2IJ0 A;  1Y1V B;  3NXW A;  1Y1W G;  3P7J A;  3S2H H;  4A3G G;  2B29 A;  3NBI A;  1DM0 B;  1TWC H;  1KNE A;  4CDF C;  1VQ9 A;  3KJO A;  4TSS A;  1VCI A;  5HY6 A;  4YHH L;  1Q7Y C;  4KK7 A;  1HA6 A;  3EA6 A;  3G71 A;  1TY0 A;  1PRT F;  2LKV A;  3N6R A;  3CW2 C;  5IGE A;  2UXD L;  4GOP A;  2MNA A;  2VUM G;  4MIU A;  5IGC A;  3GV3 A;  2Z4H A;  3T1Y Q;  2B2T C;  1BDO A;  2JA6 G;  1T9H A;  1YZ6 A;  1PH5 A;  3AFQ A;  2WKD A;  1WTH A;  2NVQ H;  2FJ2 A;  3ULJ A;  2JSO A;  4DV3 Q;  4LFC Q;  3SK8 A;  2PPB C;  2ASB A;  1X6O A;  4OL7 A;  2SEB D;  2F0K A;  2RCN A;  5C0X G;  4DF7 A;  1SYF A;  2K5W A;  3DXJ C;  4R4T A;  2K6A A;  3HOZ G;  3D4W A;  3IKJ A;  1B7Y B;  1UNS A;  1EYA A;  1W6K A;  1I4G A;  4CBV A;  3CRL C;  1OXU A;  2UUC L;  4IOA A;  1SR3 A;  1SYE A;  2PZT A;  2FXQ A;  2F4I A;  2PQE A;  4KV6 A;  3SVM A;  5CGK A;  1VQF A;  4XQQ A;  1IBL L;  4Q5V A;  2JA5 G;  3A7A B;  1NUC A;  1AP0 A;  2Y0S G;  2CW0 D;  4KKU A;  3HKZ E;  3GTL B;  4JI0 Q;  5ELD A;  3I4O A;  5JPN C;  2UXC L;  4RMF A;  4B3S Q;  3SEB A;  5FO8 B;  5LL6 S;  1Q86 C;  2ZJQ A;  4OO1 H;  1YBY A;  2R3Z A;  2X6L A;  3TRZ A;  1HH2 P;  3H3V C;  2B63 G;  1Y8N B;  5AJ3 Q;  2RVL A;  3V05 A;  4A3J H;  3U9S A;  4NXN L;  4ODG A;  5C3E G;  4HIO A;  4ULL A;  5E4X A;  3HOV G;  1QCB D;  1VQ6 A;  1KIX A;  2WB1 G;  1TQO A;  2R92 H;  2NZO A;  2EJG C;  1VQA A;  1PFS A;  1D5Z C;  4A93 B;  4HIM A;  3HKZ B;  4XTC S;  4JG2 A;  3HOV B;  4B3T L;  1LT6 D;  4O42 A;  3S1M B;  4B9W A;  3MEH A;  2XRQ D;  5IOC A;  4H7B A;  2F0P A;  5G3L F;  2PI2 E;  1O7I A;  5FOB B;  1SNQ A;  4DNR B;  3MXP A;  5IYB H;  3ND8 A;  3SK4 A;  2A68 C;  4RGN A;  1R9T B;  1JQY D;  1SNO A;  2JEA I;  2HD3 A;  2E2I H;  1STG A;  1STN A;  2HDL A;  2BE5 D;  2AQ2 B;  2DY8 A;  3BU2 A;  4AYB B;  2F0V A;  3KFU A;  2A73 B;  2F0I A;  3H3V H;  5C44 B;  2EYO A;  1JWS D;  2NYZ D;  3EN2 A;  1PZJ D;  1VF5 C;  1QUQ B;  2R93 B;  4LF5 Q;  4GN4 B;  4ZYS A;  3BDL A;  1LTB D;  4WJW A;  5ELO A;  1BXT A;  3IFD A;  1U9R A;  3KBG A;  1RF2 D;  1TR5 A;  2F0D A;  3HS0 C;  4P72 A;  1PRT D;  5IE8 A;  1EUJ A;  2JEB I;  1PH6 A;  3IFT A;  1CZW A;  4DR3 L;  1UAP A;  1OXV A;  4U68 A;  1HUN A;  3W1B A;  3I7F A;  2UXD Q;  1SJH D;  4TVA B;  3J81 c;  1BF4 A;  3OPO A;  2KUM A;  4JI5 L;  4GLX A;  1I4X A;  2E5L L;  2EY5 A;  4P71 A;  3S17 H;  3VA5 A;  1XMO L;  1X3G A;  1KDB A;  2K32 A;  3K80 C;  1WFQ A;  3S1Q B;  3A5Z B;  4KY7 A;  2IL8 A;  2F0O A;  3PUX A;  4OWT B;  4CJ1 B;  5IGD A;  1HR0 W;  1SFO B;  5CV6 A;  5GQO A;  3BDC A;  5FJ8 G;  5EKL A;  1XPU A;  2WIN B;  4DU9 A;  3F2C A;  2EPB A;  1HR0 L;  1KHI A;  2Q2H A;  2E2H H;  1LO5 D;  4JI8 L;  3ULP A;  3A7L A;  2H1E A;  2MP1 A;  1W2B A;  4BY1 H;  1EZ6 A;  2V4D A;  4UP8 A;  1ASZ A;  1CKO A;  4M1U B;  5GAD C;  2JA5 H;  1XPO A;  4A3M G;  5BN3 A;  2Q8R E;  3NP8 A;  1T5X D;  5TSS A;  1G2T A;  3HKS A;  4JBJ A;  1N9W A;  3JAM i;  1SYG A;  4OXP A;  2KBN A;  2NZ1 D;  1TT2 A;  1BOS A;  4KHP L;  2G9H D;  3P75 A;  4JI7 Q;  3LGJ A;  2MO0 A;  3QJY A;  3T1H L;  1WTR A;  4BBR H;  3RMH A;  1UE1 A;  1EIG A;  1J5E Q;  3E6Z X;  1CA5 A;  2Q2T A;  4G4K A;  4OX9 Q;  2EZV A;  1E7Z A;  5M3F G;  5JJL A;  3NWT A;  4KD4 A;  5KNC A;  5M5X H;  1XWE A;  3S2H B;  1JJC B;  5KNB A;  3M7N A;  3Q22 A;  2HHH L;  1RTO A;  1F2Z A;  2L11 A;  4A93 G;  5GRO A;  2Z6K A;  1EOV A;  4A3D B;  1DOL A;  3CCE A;  1BVS A;  3HOX B;  2B2V C;  3S24 A;  3ERO A;  3I56 A;  4BBS B;  4O0A A;  1Q12 A;  2E2D C;  3HP3 A;  1XNQ L;  4HJ9 A;  4RHS A;  4UP7 A;  1PTO D;  3CKI B;  5M3F B;  1QVF A;  5C6A A;  4L5R C;  4A3K G;  3TME A;  2I0Q A;  2H5X A;  1ZEQ X;  1YEZ A;  1CT1 D;  3HOY B;  2L1B A;  3TP5 A;  1EY6 A;  3TBI B;  4C3J H;  5IIF A;  3HFZ B;  2PW5 A;  1Q8I A;  2RQX A;  3CMA A;  4X6A H;  2XSC A;  5LMN Q;  1E2W A;  4N8F A;  1QJO A;  1GVP A;  1AEX A;  1C48 A;  1STY A;  1K8G A;  5GAH C;  1B1Z A;  5JJZ A;  4PZ6 A;  1L1O B;  2CVR A;  4ZRZ A;  1VQK A;  2D2C C;  1VQ4 A;  3PO3 B;  4A3E B;  1EU3 A;  1A3U A;  1HTP A;  2OT2 A;  1H9J A;  2PQA B;  1TS4 A;  4DV7 Q;  2RHS B;  4HAE A;  4C3I H;  1Y8P B;  3OTO Q;  1AH9 A;  5ELE A;  3UE0 A;  1G29 1;  3T4A C;  1YI2 A;  4TQU S;  2YU9 B;  4JBW A;  1WD1 A;  5H1S E;  5IGB A;  2Q2U A;  1MJE A;  3S15 B;  3AB9 A;  1KAB A;  3KDF A; 
#chains in the Genus database with same CATH homology
 2K50 A;  1TWH H;  4HIK A;  2VNU D;  3IRB A;  1K8A C;  1X54 A;  1NMG A;  1VQ8 A;  4AIM A;  4X64 Q;  4UY8 C;  4DV4 Q;  4DUY L;  4ME3 A;  3TQY A;  1A0I A;  3CME A;  3U58 A;  1I94 Q;  1IBL Q;  3PCO B;  3JC6 6;  1NTG A;  3H0G G;  4GN5 A;  4YWM A;  1IXR A;  2OCE A;  5IWA L;  1S3O A;  2N8N A;  3AEV A;  1JJ2 A;  5FLM H;  4JYA Q;  1N36 L;  1KRS A;  3J81 i;  4LF4 Q;  4YY3 L;  4IOC A;  2F52 A;  1RIP A;  2C35 B;  3CP0 A;  1X65 A;  4WJ3 M;  1JJG A;  4DV6 Q;  2YYZ A;  4Y52 H;  3GTQ H;  1H95 A;  1VQD A;  5C3E H;  4DK6 C;  4GS3 A;  1SN8 A;  3STB C;  2QA4 A;  1HNX L;  5GAE C;  3A5U A;  2E8G A;  3BZC A;  4KLK A;  4MTN A;  2VQF L;  1V9P A;  1KXL A;  4DR4 Q;  2UXB Q;  1YJN A;  1PH1 A;  4JI4 L;  2VL6 A;  4BBS G;  4DPG A;  1BBU A;  3RNU A;  3CCQ A;  2AKW B;  3GDE A;  5J3B A;  4IPD A;  2VW9 A;  3FKI H;  4JI4 Q;  1FJG L;  1E1O A;  1L1O A;  1VQL A;  2D0O A;  4Y7N H;  2BH2 A;  4DV3 L;  3CCR A;  3PO2 G;  3GTO H;  1LUZ A;  4OON A;  4DV2 L;  4DV7 L;  2JA8 H;  3BJU A;  3RLN A;  3H3V I;  1N33 L;  3S15 H;  3GD7 A;  4GKK L;  1HNX Q;  1X56 A;  2UXB L;  4BBR G;  2OWO A;  3FP9 A;  4L5T A;  3U4Z A;  4LF6 Q;  1KRT A;  1L0W A;  4LF4 L;  3KJP A;  4A3E H;  4JI2 Q;  2YTX A;  4QJF A;  4JCV E;  4A3J G;  3PF5 A;  4YWL A;  4O2D A;  1YHA A;  1HZA A;  2ES2 A;  4JV5 L;  4DV0 L;  5M3M H;  1VQI A;  2B63 H;  1HNZ Q;  3K81 C;  4QQB X;  4DV4 L;  4YWK A;  1LTL A;  1K73 C;  3EBE A;  4DUY Q;  1B70 B;  1VQ5 A;  4JI6 Q;  1YVC A;  4ALP A;  1EQQ A;  3HOZ H;  4BXX G;  1Z47 A;  2LSS A;  4P74 A;  4DV2 Q;  2OQK A;  3F8T A;  4RG1 A;  4BY7 H;  2N3S A;  4JI2 L;  1FVI A;  4DR7 Q;  4B3R Q;  2K4K A;  5EAY A;  1GM5 A;  1NJI C;  1C0A A;  2R6G A;  4DR2 Q;  3KLW A;  5JEA J;  4LF9 L;  3ERS X;  1YJW A;  1QZH A;  3NEL A;  4DR3 Q;  3S1Q H;  4IPC A;  4A3M H;  1OXX K;  3CCV A;  2AMC B;  1OTC A;  2I5L X;  3K7A H;  4JI1 L;  4JI1 Q;  5M3F H;  3T1Y L;  3D0F A;  4MNO A;  3PUZ A;  1Z9F A;  2ALY B;  2IHF A;  5IYB G;  3H15 A;  5LMU L;  1IBK L;  1PH7 A;  2UU9 Q;  4LFA L;  4A3G H;  3UDX A;  5ELN A;  4NPS A;  2Z0S A;  1E3P A;  2EIF A;  3M3Y H;  3FHW A;  2V1C C;  4DV1 Q;  4KHP Q;  1GKH A;  4KI0 A;  1QZG A;  4DR7 L;  3HOW G;  4A3F G;  4A3D H;  4LUO A;  4DV5 Q;  3PUW A;  3UDI A;  3PIP A;  1C7Y A;  3RN5 A;  5IWA Q;  1HZ9 A;  4A75 A;  1L2F A;  4X66 Q;  1IBM Q;  2YU9 H;  2IT1 A;  1V1Q A;  2KHI A;  4AYB G;  5IP9 H;  2ZJR A;  3M85 A;  1J5E L;  2PNH A;  2RHQ B;  2DGY A;  1EQR A;  2YV5 A;  4JI6 L;  4JI3 Q;  2BA0 A;  2K52 A;  4LF7 Q;  1K3R A;  1BKB A;  1NBW A;  3STB D;  1Y1W G;  1WI5 A;  4JI5 Q;  2LXJ A;  3UE1 A;  3UDF A;  4YCV A;  3AYH B;  3F1Z A;  2HT1 A;  4A3G G;  3S2H H;  2B29 A;  2KHJ A;  1TWC H;  1VQ9 A;  4KHZ A;  3KJO A;  1WCM G;  1VCI A;  5HY6 A;  4YHH L;  1Q7Y C;  2E2J H;  1Q1E A;  1UWV A;  2OTL A;  1G51 A;  4H02 A;  3G71 A;  1YIJ A;  4JV5 Q;  3U50 C;  1Q82 C;  1K0R A;  2R93 H;  1PH2 A;  3RZO H;  3CW2 C;  1KD1 C;  2PMZ E;  2UXD L;  1I94 L;  4GOP A;  2NZH A;  3DLL A;  3CPF A;  2MNA A;  2K75 A;  4LFA Q;  2VUM G;  4DAY B;  2R92 G;  4GKJ L;  1CSQ A;  1X55 A;  1Y1W H;  1UE6 A;  3T1Y Q;  1EFW A;  2ZJP A;  4B3M Q;  4GLV B;  1RL2 A;  1WOC A;  5IP9 G;  1XNQ Q;  1T9H A;  2JA6 G;  1YZ6 A;  1PH5 A;  3AFQ A;  1VQM A;  3PO3 G;  4BXX H;  1E24 A;  2XGT A;  2NVQ H;  3H0G H;  4X62 L;  3RZD H;  3RR5 A;  3ULJ A;  4QIW E;  4DV3 Q;  4LF5 L;  3KF6 A;  4LFC Q;  2ASB A;  2A8V A;  1PVO A;  1X6O A;  2VS1 A;  3K7U C;  1G6P A;  5JEA G;  2RCN A;  3NBH B;  5C0X G;  1VQC A;  3W1G A;  2N78 A;  1UE7 A;  3GTJ H;  1HNW L;  1NE3 A;  2YTV A;  3RLF A;  5JJI A;  2HQL A;  2AWN A;  4OWX B;  1I50 H;  4EX5 A;  4R4T A;  3PIO A;  4A3B H;  3K8A A;  3HOZ G;  4GNX B;  3HOY H;  4LW1 A;  2CWP A;  3F2D A;  2F3I A;  1XJV A;  1A62 A;  1B7Y B;  1QVC A;  2Y0S E;  5BR8 Q;  4K0K Q;  3CPW A;  1SRO A;  1OXU A;  4YHH Q;  2UUC L;  4IOA A;  1SR3 A;  4AQY Q;  2PQA A;  4BBS H;  4OO1 G;  2FXQ A;  4LUV A;  4JI7 L;  3G4S A;  2K5H A;  3RN2 A;  1VQF A;  1IBL L;  4YY3 Q;  3PF4 A;  1FL0 A;  2JA5 G;  4IFD G;  1PYS B;  4LF7 L;  2Y0S G;  3HKZ E;  4JOI C;  4JI0 Q;  1IBM L;  5HGQ A;  3CCL A;  3I4O A;  4PZ7 A;  3CF5 A;  4HJA A;  4LF8 Q;  2UXC L;  4RMF A;  1NMF A;  4B3S Q;  4A3C H;  4JI3 L;  2K5N A;  1Q86 C;  4X65 L;  4DR6 L;  4MZ9 A;  2ZJQ A;  3MEF A;  1YBY A;  4A76 A;  3TRZ A;  1HH2 P;  1OXT A;  3Q8D A;  2WAQ E;  2B63 G;  4LWC A;  4AQY L;  3HOX G;  3I55 A;  1XNR L;  4A3D G;  2NN6 G;  5AJ3 Q;  3M4Q A;  5E7N A;  4A3J H;  1PH8 A;  1EYG A;  4JI8 Q;  4NXN L;  5C3E G;  4HIO A;  3J7Z C;  3HOV G;  1VQ6 A;  1KIX A;  1HZB A;  2WB1 G;  3CC4 A;  2R92 H;  4R4I A;  4L5S A;  1N33 Q;  2NZO A;  3CCJ A;  4NXN Q;  1VQA A;  2OQ0 A;  2VZA A;  1PFS A;  1KC8 C;  2JQO A;  5FLM G;  4A3C G;  2A1A A;  4BY7 G;  4DUZ L;  2VQE Q;  4HIM A;  2KCM A;  3OW2 A;  4XTC S;  4JG2 A;  2N49 A;  3NEN A;  4LUZ A;  4AH6 A;  3CC2 A;  4B3T L;  1Q1B A;  2YTY A;  4PZ8 A;  1VQO A;  2ZTE A;  1YIT A;  1VQJ A;  1HZC A;  2K5V A;  1YJ9 A;  4P73 A;  1YHQ A;  2PI2 E;  2R7D A;  4JYA L;  3TEH B;  1O7I A;  3E9I A;  5C44 G;  5IYB H;  1XMO Q;  4GN3 B;  5C0X J;  1Y14 B;  3J80 i;  2JEA I;  1VQG A;  1JB7 A;  3KYH C;  3T1H Q;  3HOY G;  1L1O C;  4LFB L;  2NN6 I;  1LM0 A;  2EQS A;  2E2I H;  1I5F A;  3FKI G;  2JA6 H;  3G48 A;  3I2Z A;  2WP8 J;  5M5Y H;  1CKM A;  3K0X A;  1X3E A;  2R7Z G;  1W3S A;  2HIX A;  1YHB A;  3CCS A;  4A3B G;  1I3Q H;  4NXM Q;  3BU2 A;  1MIU A;  2UUC Q;  2BH8 A;  1AE3 A;  3KFU A;  1A8V A;  3H3V H;  2IX0 A;  3GTG H;  3J7A 5;  4EQ5 A;  3EN2 A;  1J6Q A;  4IO9 A;  3S2D H;  2LXK A;  2B3G A;  3E9H A;  4DAM A;  4A3K H;  5M5W H;  3DM3 A;  3I4M H;  1QUQ B;  4GNX C;  4GOP B;  1N8R C;  4LF5 Q;  4LNQ A;  4A3I G;  4GN4 B;  4BY1 G;  5C4X H;  1HJP A;  1HNW Q;  1PA6 A;  1D7Q A;  5IYC G;  4WJ4 A;  5ELO A;  2JA7 G;  4L5Q A;  2IHE A;  3CXC A;  1VS0 A;  1XMQ L;  2ID0 A;  1TWF H;  1I6H H;  1IYJ B;  1UEB A;  1V43 A;  2AHO B;  3OYY A;  4P72 A;  2ZM6 L;  3S1M H;  2JJQ A;  3CQZ H;  1EUJ A;  2MFI A;  2JEB I;  5IE8 A;  4A4I A;  4X65 Q;  2VUM H;  1PH6 A;  4OO1 I;  3ZJY C;  3S1R H;  4R4C A;  1N32 Q;  4DR3 L;  1Q8K A;  2UUA L;  4YCW A;  3EIV A;  2Q2I A;  3S14 H;  2VQF Q;  3CCU A;  1OXV A;  1XTD A;  2HIV A;  3W1B A;  4FDB A;  5IYD H;  4HJ7 A;  2JA7 H;  2E5L Q;  3I7F A;  2OTJ A;  2UXD Q;  1GD7 A;  2R7F A;  1MKH A;  1CKN B;  4GLA C;  1VQB A;  4TVA B;  3J81 c;  2JA9 A;  3AFP A;  3BZK A;  1S40 A;  4JI5 L;  4GLX A;  1PH4 A;  2E5L L;  4DR6 Q;  1VQ7 A;  1EIF A;  4P71 A;  3S17 H;  3KOJ A;  1N32 L;  1DGS A;  4IJH A;  4X64 L;  4K0K L;  4A3L H;  2IY5 B;  3B6Y A;  1XMO L;  1AE2 A;  1X3G A;  4X66 L;  5C0X I;  1PYB A;  3K80 C;  5IY0 A;  1JT8 A;  3W5O A;  3PSI A;  1WFQ A;  3ICE A;  1TXY A;  3A5Z B;  3PO3 H;  3WWV A;  4YCU A;  2XTI A;  1PH9 A;  4DV0 Q;  3ER0 A;  2WB1 E;  4PG3 A;  1PH3 A;  3PUX A;  4OWT B;  5IYC H;  4R1J A;  3U4V A;  4OWW B;  1HR0 W;  4DUZ Q;  1YNX A;  1C9O A;  3GTL H;  5DLQ E;  1E22 A;  5GQO A;  4DV1 L;  5FJ8 G;  4B3T Q;  1XPU A;  2HHH Q;  5C44 H;  1A63 A;  5M3M G;  1X3F A;  3M4P A;  3F2C A;  2VQE L;  1HR0 L;  1KHI A;  3OTO L;  2Q2H A;  1HR0 Q;  2UUB L;  2UUB Q;  3M4O H;  4GKK Q;  1CKN A;  2E2H H;  4B3M L;  1Q46 A;  2WAQ G;  3HOU G;  4JI8 L;  3ULP A;  4OX9 L;  4DR1 Q;  2F4V Q;  4DNI A;  2AWO A;  4C2M H;  4B3R L;  1TWG H;  3J81 j;  1R9T H;  2ZTD A;  2CKZ B;  1W2B A;  4BY1 H;  4JBM A;  4LF9 Q;  2JK8 A;  1CSP A;  2CWA A;  4JOI A;  3ULL A;  2IX1 A;  2R7Z H;  2CQO A;  4UP8 A;  1K9M C;  2D0P A;  1CKO A;  3GO5 A;  5GAD C;  5IT9 c;  1ASZ A;  1XPO A;  5LMN L;  4A3M G;  1EWI A;  2JA5 H;  4JBK A;  3A0J A;  2JE6 I;  2MQH A;  1SMX A;  3S16 H;  2CCZ A;  3MXN B;  4GKJ Q;  1Y1V G;  4XIG S;  2EXD A;  3HKS A;  4JBJ A;  1N9W A;  3JAM i;  2NVX H;  3I4N H;  3RLO A;  2UXC Q;  3KDF B;  1QVG A;  4LF8 L;  4A3I H;  1D8L A;  2A19 A;  2WFW A;  1N34 Q;  4OXP A;  2KBN A;  5IP7 H;  4A93 H;  4GOP C;  3I4M G;  4NB3 A;  3A74 A;  3HOX H;  4GNX A;  4A3F H;  3GTK H;  4KHP L;  4AYB E;  1MJC A;  4JI7 Q;  4LF6 L;  4POG A;  3PO2 H;  3LGJ A;  2MO0 A;  2Z6K C;  3T1H L;  1S72 A;  4BBR H;  3SGI A;  1UE1 A;  2K14 A;  5C4J H;  4A3L G;  5LMU Q;  1JE5 A;  1WJJ A;  1J5E Q;  2NVT H;  4LFB Q;  2Q2T A;  4OX9 Q;  2JA8 G;  1VQE A;  1E7Z A;  5M3F G;  1BBW A;  3TRE A;  5JJL A;  1Y1V H;  5IYD G;  3GTM H;  1IZ6 A;  2D62 A;  5GAG C;  4A3E G;  1XMQ Q;  5M5X H;  1FJG Q;  1JJC B;  1U5K A;  1VQH A;  4APV A;  2ZM6 Q;  2HHH L;  2NVY H;  3M7N A;  2R93 G;  1KQS A;  3HKZ G;  4IPG A;  4X62 Q;  1XNR Q;  1UE5 A;  5FLX c;  4A93 G;  5GRO A;  2Z6K A;  1JMC A;  1EOV A;  3HOW H;  3JAM c;  3CCE A;  4DR4 L;  1SRU A;  1BVS A;  5FJ8 H;  1QUQ A;  3S24 A;  2KEN A;  4UPA A;  4DR1 L;  3NEM A;  4C3H H;  3F2B A;  2F4V L;  3S1N H;  4IFD I;  2PI2 A;  2KCT A;  1Q81 C;  5K36 G;  3I56 A;  3KF6 B;  1CUK A;  1Q12 A;  4O0A A;  4DR5 Q;  1B8A A;  1XNQ L;  1OXS C;  3L2P A;  2L15 A;  4HJ9 A;  3VDY A;  4B3S L;  3HOU H;  1P16 A;  4UP7 A;  1WYD A;  4IFD J;  4DV6 L;  3PUY A;  4R4Q A;  3L7Z C;  4JI0 L;  1QVF A;  4L5R C;  4POF A;  4A3K G;  5IP7 G;  3PV0 A;  2I0Q A;  2BA1 A;  2H5X A;  1KAW A;  3TS0 A;  3AQQ A;  4NXM L;  1YEZ A;  1VQP A;  2CFM A;  4UP9 A;  1XPR A;  2GVB A;  1K83 H;  1E1T A;  3TS2 A;  4C3J H;  5LMN W;  1FGU A;  1N36 Q;  1GO3 E;  3PUV A;  4HID A;  3CCM A;  3HFZ B;  3CAM A;  5BR8 L;  1ASY A;  1VQN A;  1TWA H;  2ZTC A;  1N34 L;  3GTP H;  4QGU A;  3J80 c;  2GN5 A;  3CMA A;  4DV5 L;  4HJ5 A;  1X9N A;  4X6A H;  4BA1 I;  2ATW A;  5LMN Q;  1KL9 A;  3CC7 A;  3I4N G;  1HNZ L;  5C4X G;  2I5H A;  3KF8 B;  3L0O A;  4QY7 A;  2MO1 A;  2GVA A;  1GVP A;  1M1K C;  1PHJ A;  3D31 A;  1WCM H;  1EIY B;  1K8G A;  3M9B A;  1SFO H;  2RF4 A;  4IJL A;  5GAH C;  4HJ8 A;  1IBK Q;  2UU9 L;  3UDG A;  4PMW A;  3PGZ A;  2VY3 A;  2QEX A;  1M90 C;  2UUA Q;  4PZ6 A;  1SE8 A;  1L1O B;  4DR5 L;  1VQK A;  1U0L A;  1VQ4 A;  1PV4 A;  4QL5 A;  4JC0 A;  1SLJ A;  2PQA B;  3E0E A;  4R4O A;  4DK3 C;  4DV7 Q;  2RHS B;  4P75 A;  3CD6 A;  5JJK A;  4IPH A;  4C3I H;  2QGQ A;  3OTO Q;  2DUD A;  1IL2 A;  1AH9 A;  3UE0 A;  1G29 1;  4LFC L;  1P8L A;  1LYL A;  4TQU S;  4DR2 L;  1YI2 A;  4JBW A;  1NY4 A;  5AJ3 L;  2I5M X;  3G6E A;  4BA2 I;  3HOV H;  5H1S E;  2Q2U A;  1MJE A;  4DKA C;  4J15 A;  3KDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...