1HZAA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
molecule keywords COLD SHOCK PROTEIN CSPB
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzaA00
1CSQA 1WCMG 1HZCA 1SFOH 4UY8C 3PF5A 2E8GA 3GDEA 2XGTA 3ULLA 3S2HH 2PNHA 1HNXQ 4B3RL 3W1GA 1XPOA 1QZHA 2OTJA 4QIWE 4YY3Q 2KHJA 4L5QA 1HNXL 4QQBX 5IYDG 4A3FG 3A0JA 4BBSG 4IJLA 3CCQA 1Q82C 2Q2UA 2NVXH 1LM0A 1YBYA 2LXKA 1Y1VG 1YEZA 3A5UA 4DV6L 4R4OA 1VQIA 4GS3A 4GLAC 4PMWA 5LMNL 1K73C 1VQBA 1I94Q 4AYBG 2HHHQ 3M85A 4LF5Q 1JE5A 2K5NA 1GO3E 3A5ZB 1VQ7A 2R93G 3F2BA 4DV6Q 3CCVA 4IFDJ 1BBUA 3PV0A 1TWGH 1G291 4X65L 2R7ZG 3CCMA 3L2PA 4DV3L 2ZJQA 5AJ3Q 2PQAB 3ULPA 4AQYL 2Z6KC 3CCRA 4DR1Q 3FKIH 1XTDA 4X65Q 1YHBA 3GTQH 2PQAA 4GKKQ 4JOIA 1B7YB 4R1JA 1N36L 3EBEA 5M5XH 3ER0A 2K5HA 2H5XA 1VQPA 1N32L 2ZM6Q 3GD7A 1L1OB 1YHQA 5IY0A 4GN4B 1N36Q 1QUQB 4B3MQ 3CD6A 1K8AC 1CSPA 2JJQA 5C0XI 4DR5L 2CKZB 4DV5L 3S14H 2AKWB 2E2HH 1PHJA 4YHHL 2YYZA 2WB1E 3UDIA 2ASBA 4LW1A 3U4VA 1XMQQ 3DLLA 2EIFA 3U58A 2IX1A 5GQOA 3HKZG 4DV1L 2Z0SA 3HOWH 2NVYH 3STBD 4GN3B 2RF4A 4XIGS 3KOJA 4MNOA 2JA5G 1E3PA 1UWVA 3W1BA 2GVBA 3CPWA 1HNWL 1KL9A 4OXPA 4DNIA 1AE3A 1KRSA 2N78A 4YWLA 5K36G 1EIYB 1VQFA 3RLNA 3OTOQ 4OX9L 3S1QH 5JEAJ 1HNWQ 4IO9A 1XPRA 5H1SE 2MFIA 1X3GA 1NBWA 4X64L 4BY1H 4DR4Q 5JJLA 1JB7A 5IT9c 2KCMA 3BJUA 1NJIC 1K3RA 3HFZB 1HZ9A 4B3RQ 4B3TL 1D7QA 1TXYA 1GVPA 1B8AA 2R6GA 4LFCL 4C3IH 1N9WA 2OTLA 1E7ZA 4HJ9A 1PYBA 3KDFA 4A3FH 3BU2A 5IYDH 3KYHC 5C0XG 1CKNB 1XMOQ 3HOWG 2HQLA 4DR6Q 4OWXB 3RLOA 3VDYA 2E5LQ 4TVAB 1EWIA 3PUVA 5IP9H 2UUCL 4JI3Q 1CKOA 3JAMc 4Y7NH 2VQEL 4JBKA 3KF6A 1Q86C 3PIOA 4YCWA 4HIOA 4A75A 4LF5L 4HIMA 3PSIA 1X65A 1FJGQ 1KAWA 5BR8L 1KHIA 1PA6A 1I94L 2VQEQ 4P74A 3K7UC 1HR0Q 4LF6Q 4NXNL 2K52A 4NPSA 2JA6H 4QGUA 4X62Q 1ASYA 4BBSH 4JCVE 3W5OA 2IT1A 4LF8Q 3K81C 1C0AA 1IXRA 4JI8Q 1N34L 4P72A 1IBLQ 3E9HA 3TEHB 1UE6A 5M3FG 5FLXc 5GAEC 1M1KC 2LSSA 4YCUA 2F3IA 3HOXH 2ZM6L 4DR1L 2JA5H 1A63A 1L1OC 1IBLL 1UE7A 1JT8A 1WI5A 4AYBE 1Q8KA 1VQLA 4KHZA 4HIKA 5DLQE 4QY7A 3J80i 4AIMA 1VQOA 4GOPB 4L5TA 3KLWA 1FGUA 1BKBA 4YHHQ 2MO0A 4MTNA 4DR5Q 1E1TA 3H0GH 3K7AH 4APVA 5C44H 1LYLA 3S16H 4A3BH 4DV4L 4DR7Q 5IP9G 2NVQH 2PMZE 3AFQA 1P8LA 3I7FA 2I5LX 2F52A 1J6QA 3ICEA 3TS2A 1VQ9A 1Q46A 3CXCA 4LF4Q 2KCTA 1V1QA 4A3KG 4OWTB 5AJ3L 3CF5A 4IOAA 4BXXH 3AYHB 4JBMA 1FVIA 4FDBA 5JJIA 4JBJA 1Q12A 2WAQG 1FL0A 3S1RH 2BH8A 1MJEA 1YVCA 3L0OA 4YCVA 2UU9Q 2EXDA 4IPHA 1QVFA 2Q2HA 4LF7L 3UE1A 1JMCA 3HOXG 2UUAL 3PO3G 2VNUD 4B3ML 1X55A 1YJ9A 3PF4A 1WYDA 4GOPA 2Y0SE 1LTLA 4DAMA 4JI6L 4A93G 4LFCQ 1VQGA 2Q2TA 1PH6A 4JI5Q 3SGIA 4A3DH 1VQ6A 2CFMA 4YWKA 3GTPH 2IY5B 4DR6L 2YTVA 3GTJH 4JV5L 1DGSA 1SLJA 4A3LG 1AE2A 2VZAA 4DR3Q 1OXVA 2UXCQ 2UUCQ 3J7ZC 1HNZQ 3CCJA 1Y14B 3I2ZA 3I56A 1B70B 2D0OA 4A3DG 1H95A 2JA7H 4OO1I 4GLXA 4JI3L 2D62A 4JOIC 2HT1A 2VY3A 4IPCA 4XTCS 1HNZL 2XTIA 1S40A 1PVOA 1FJGL 3UDFA 4O0AA 3UDXA 4ALPA 4IFDG 4C3HH 3KJPA 3J81j 4LNQA 1TWFH 3MEFA 1XNRQ 4HJ7A 1N33Q 3ERSX 1T9HA 5IWAQ 2JA7G 2VUMG 3I4NH 1XNQL 3PO2G 3PUZA 4EX5A 2N8NA 2MNAA 3AQQA 2NZHA 1EUJA 3I4MH 4JYAQ 5BR8Q 1HR0L 5C4XH 1CKNA 3F2CA 4R4CA 1YITA 1PH2A 1NY4A 1PH4A 4PG3A 1EYGA 3J80c 2A1AA 1XMOL 1GD7A 4JI2Q 5M5WH 1Q7YC 4BY7G 2JQOA 1KQSA 1BVSA 2CWAA 1C9OA 2NZOA 2RHSB 3KF6B 5IYCG 4A3MG 5C0XJ 2F4VL 4L5RC 2Y0SG 3PCOB 1JJCB 4P75A 5HGQA 4DAYB 1WOCA 4BA2I 1UEBA 4GNXC 4NB3A 4UP8A 2KENA 4BY7H 2OWOA 1GKHA 4DV5Q 1Z47A 3RZDH 1YJWA 1G51A 1L0WA 4DV4Q 1YZ6A 2HHHL 4DR7L 5FLMH 2JA8G 1N8RC 3CCLA 1JJ2A 4H02A 1VQCA 3CP0A 2DUDA 2YV5A 4JI1L 4RMFA 4LFAQ 2D0PA 2WP8J 1W3SA 5LMUL 2GN5A 4DV1Q 4ME3A 1HR0W 4JC0A 4NXNQ 2BH2A 3I4NG 2VUMH 4BXXG 3CQZH 4LF9L 3MXNB 4K0KQ 2R92H 3B6YA 1IBKQ 1NMFA 1PH8A 5FJ8G 3J81c 3CPFA 3H15A 4A3JH 4DUYL 4GKJL 4KLKA 1UE5A 2K14A 2QGQA 2UUAQ 1KXLA 4HJ5A 4OX9Q 3HOYG 1PH7A 2UUBL 4OO1G 4LF7Q 1N32Q 2R7ZH 4JG2A 3M4PA 4OWWB 3NEMA 2MO1A 4DUZL 2UXBL 1HZAA 4WJ4A 4X6AH 1KIXA 2I5MX 4DV7L 1K0RA 1RL2A 4B3TQ 3S1MH 1L1OA 4BY1G 4IOCA 4WJ3M 2UXBQ 2DGYA 3PGZA 1U5KA 4A3CG 4A3LH 1EFWA 4RG1A 3UE0A 4PZ7A 1C7YA 4JI5L 1J5EQ 4LUOA 2IX0A 1JJGA 1E1OA 3U50C 4A3IH 1GM5A 4IPGA 5GAGC 3CCSA 5C4XG 1TWCH 3FP9A 1SMXA 2B63H 3S17H 3PO3H 2R93H 2QA4A 2JA9A 2EQSA 1LUZA 1QUQA 1PH9A 1YNXA 3UDGA 2RHQB 1I6HH 3OTOL 4PZ8A 3DM3A 5LMNW 1IBMQ 2ZJRA 4JI7L 1ASZA 4R4IA 4DK6C 2E2IH 3HOYH 5IYBG 3A74A 3K8AA 1SN8A 4MZ9A 4DR2Q 1CUKA 1IYJB 5IP7H 1MKHA 5M3MH 4JI7Q 4X62L 1O7IA 4JYAL 1VQEA 2CQOA 3I4MG 3T1YL 4DR2L 4BA1I 1N34Q 2I5HA 2OQKA 3D0FA 1XPUA 2WAQE 4DV3Q 2ALYB 5IWAL 3E0EA 1A0IA 2KBNA 5IYCH 1TWAH 1IL2A 2YTXA 4LWCA 4GKKL 2LXJA 4DR3L 2UXCL 4JI0L 1Y1WH 4LFBL 3HKZE 1G6PA 4JBWA 1X54A 5IE8A 3F1ZA 4LUVA 1X9NA 2JK8A 4C2MH 2F4VQ 2PI2E 1SE8A 5ELOA 4B3SL 1A62A 1V9PA 1VQ4A 4LFBQ 4HIDA 3KJOA 1WJJA 2MQHA 4IJHA 3HOUG 3NENA 1EQRA 4TQUS 4BBRG 5C3EG 1X3EA 1UE1A 2QEXA 1PH3A 3HOVG 3H3VH 5J3BA 4P71A 3M7NA 4O2DA 4DV0Q 3JAMi 3L7ZC 4GOPC 1HZBA 1K8GA 3GO5A 4DKAC 4A93H 2AHOB 3NBHB 5GAHC 4A3KH 3WWVA 5M5YH 3LGJA 3ULJA 4DV0L 4JI8L 2ES2A 1L2FA 4HJ8A 3H3VI 3EN2A 4DUYQ 1YI2A 4LF9Q 2NVTH 4GKJQ 5E7NA 3PUXA 4DK3C 1VCIA 3FHWA 5FLMG 2BA0A 2JA8H 2JEBI 5GADC 1VQMA 1KRTA 3PUYA 3AEVA 1YHAA 4PZ6A 4JI6Q 3CAMA 4X66Q 4IPDA 3BZKA 2AWOA 3EIVA 4POFA 3AFPA 2R92G 1HJPA 2YTYA 3E9IA 5M3FH 1V43A 3RN5A 4A3GG 3PUWA 1OXXK 2K5VA 2C35B 1I5FA 3FKIG 2RCNA 2VQFQ 5LMUQ 3S1NH 1Q81C 1IZ6A 1PH5A 2A8VA 3KFUA 2NN6G 5C44G 1K83H 1MIUA 4YY3L 1VQ5A 3CC2A 5JEAG 2N49A 3HKSA 4YWMA 3JC66 3K80C 2HIXA 4EQ5A 4A3EG 3GTMH 3M4QA 1AH9A 1IBML 1SRUA 3TRZA 4L5SA 2Q2IA 1XJVA 4LUZA 2UU9L 1N33L 1E22A 4GLVB 2R7DA 4NXMQ 4JI4Q 3NELA 2AMCB 4QL5A 2YU9H 5HY6A 2AWNA 2KHIA 3OYYA 1M90C 1XNQQ 4GNXA 1VS0A 4NXML 1NTGA 4QJFA 4C3JH 1VQ8A 1QVCA 4LF6L 1S72A 1I50H 1I3QH 2VS1A 1KD1C 4AQYQ 1J5EL 3PO2H 4A3GH 3CCEA 1X56A 3T1YQ 2I0QA 2UXDQ 2L15A 3KF8B 2ATWA 1EQQA 4A3BG 3RLFA 4JV5Q 4JI2L 1WCMH 1PFSA 1Q1EA 4JI0Q 5IYBH 3I55A 3U4ZA 2OQ0A 1EIFA 3RNUA 2UXDL 5IP7G 3GTKH 3CMAA 2HIVA 3HOZH 3TREA 4A4IA 5LMNQ 3HOUH 3CW2C 1Z9FA 2E5LL 3S2DH 4B3SQ 1D8LA 1YIJA 1BBWA 5GROA 4BBRH 5C3EH 1QVGA 3G71A 3STBC 1NMGA 1SROA 4J15A 5EAYA 1VQNA 4DV2Q 3M9BA 3RZOH 4A3EH 1X6OA 3S15H 1YJNA 3Q8DA 3CC7A 2B63G 3M4OH 1Y1VH 4JI1Q 4DV2L 2B29A 4K0KL 1IBKL 2JA6G 1E24A 1Y1WG 4LF4L 3BZCA 1PH1A 2GVAA 4A3CH 1HH2P 2R7FA 1EOVA 3PIPA 2CWPA 1W2BA 4Y52H 3TS0A 1CKMA 1R9TH 3K0XA 4A76A 4A3JG 2IHFA 4R4TA 4IFDI 1OXTA 2BA1A 1A8VA 5FJ8H 3TQYA 5ELNA 5M3MG 4GNXB 4LF8L 1RIPA 2B3GA 4DUZQ 1KC8C 3CC4A 2WB1G 3G4SA 3RR5A 2UUBQ 2ID0A 3GTLH 4OONA 4GN5A 3HOZG 3F8TA 2K4KA 3I4OA 3J7A5 5C4JH 2ZJPA 4UPAA 4DV7Q 3RN2A 4DR4L 3H0GG 1SR3A 1VQJA 1X3FA 2A19A 1VQAA 2ZTDA 1OTCA 1MJCA 2K50A 1TWHH 4A3MH 2VQFL 1XMQL 3M3YH 1NE3A 3S24A 4DPGA 3CMEA 2FXQA 3OW2A 3G48A 2ZTCA 4LFAL 1WFQA 3IRBA 1QZGA 2ZTEA 3CCUA 1VQKA 2N3SA 2K75A 2VL6A 1K9MC 3GTGH 4A3IG 2WFWA 3ZJYC 3KDFB 3F2DA 2JE6I 1VQDA 1OXSC 2OCEA 3HOVH 5JJKA 3D31A 4POGA 1PV4A 2CCZA 4UP9A 1S3OA 4P73A 3J81i 3GTOH 4KHPQ 3T1HL 2NN6I 1VQHA 2E2JH 4X66L 1XNRL 4X64Q 4HJAA 3G6EA 4KI0A 2VW9A 4KHPL 2Z6KA 3T1HQ 1OXUA 1Q1BA 1P16A 1U0LA 2IHEA 4AH6A 4JI4L 4UP7A 2JEAI 4R4QA 2PI2A 2V1CC 1PYSB
chains in the Genus database with same CATH superfamily
3ND9A 1WCMG 1HZCA 3QO2A 2EYLA 4L6TB 2RDGA 3PF5A 3GDEA 3S2HH 1HNXQ 2PNRC 1QG7A 1R4QB 3BS1A 4FXGC 1MBYA 4QQBX 5IYDG 3CCQA 4ZUJA 1CQFA 1Y1VG 1YEZA 3H6MA 1KDBA 2HHHQ 3M85A 5F2DA 2K5NA 1GO3E 2BOSA 2E75C 2JP1A 3A5ZB 3OIQA 1G291 1VF7A 2R7ZG 2Z1CA 4DV3L 2EYHA 1ICWA 4K5WA 1EY9A 4K8JA 1IKLA 3RMHA 3GTJB 4JOIA 3EBEA 5M5XH 1NR2A 3ER0A 1E2WA 4E6IA 5FLXL 1N32L 1WTQA 3FDTA 1WTWA 4GN4B 1N36Q 5T1GA 4DR5L 1CZGA 4FVMA 3NWTA 4CJ2C 3U58A 1ET6A 4DV1L 3HOWH 2ZT9C 2ZXOA 3HP3A 3S2DB 3K7AB 1HNWL 2XVSA 1KL9A 4OXPA 2H4OA 1AE3A 5K36G 3J81L 1VQFA 3RLNA 3S1QH 2FHTA 5CC4A 2ICEC 1SE3A 1JOOA 2KCNA 2IW3A 1WTVA 4BY1H 3BJUA 2V4DA 3TBIB 1NJIC 1K3RA 2R6GA 2K5DA 1AZQA 3KLRA 4HR7B 5IYDH 2H1EA 1TR5A 5C0XG 5L37A 3R2TA 3PUVA 1K28A 4JI3Q 4K8IA 3MWYW 3AMUA 4JBKA 3NBIA 3KF6A 1EOTA 1Q86C 1FJGQ 2IWHA 1KDCA 2K04A 3IFTA 2NZ1D 5CV4A 2CW0D 4LF8Q 1S5ED 1QILA 3I8ZA 5M3FG 2LSSA 4RKLA 2N55A 1IBLL 1WI5A 4AYBE 1Q8KA 1O78A 3QB3A 4FYDA 2K7VA 1VQOA 4GOPB 1FGUA 3A7AB 1BKBA 1MGSA 2MO0A 5KNBA 2RVLA 2E2IB 3S1MB 5IP9G 3L3OC 4HCEA 3AFQA 2EE1A 1XXGA 2F52A 5EQ0A 3DMUA 1V1QA 5AJ3L 4IOAA 5DAUA 1IYVA 3X3NA 5C5MA 2OF1A 4XYQA 4JPBW 4FDBA 3RD4A 5IODA 1MJEA 4X3TA 4IZ8A 4IPHA 3NTKA 1JMCA 4K6DA 3NTIA 1E2ZA 4N8X1 3PF4A 2B2UC 1WYDA 5IOCA 4RGMA 1L0XB 4JI5Q 1BCPD 5CBAE 4Y7NB 4YWKA 1DGSA 1ONLA 2CHBD 1HNZQ 1B70B 2JA7H 4OO1I 2XWBB 3S2HB 4JOIC 2HT1A 1FJGL 2OT2A 4LK1C 1K0SA 4IFDG 2L9HA 4LNQA 1XNRQ 1F9SA 5AFWA 2JA7G 2Z6BA 3I4NH 2NVYB 2N8NA 2BDNA 3NQIA 3JAML 1EUJA 4JYAQ 4XQJA 5FK9C 1EYGA 1NY4A 4PG3A 4JI2Q 4BY7G 2PZWA 1STGA 5IYCG 3KF6B 4MN3A 4L5RC 1KNAA 2PCFB 4DAYB 1QE6A 4BY7H 4XDXA 2OWOA 1D1IA 1G51A 5J22A 3OWEB 2HHHL 2FFKB 2JA8G 2KEDA 1AW7A 4H02A 4RMFA 5LMUL 2WP8J 1HR0W 4ME3A 3MXNB 4K0KQ 2PZUA 1PH8A 4XQQA 4DUYL 1UE5A 4RGOS 4ZAIA 2SNSA 1CM9A 3HOYG 2F0LA 4F87A 1BBXC 4LF7Q 1N32Q 4DK1A 4OWWB 2B2UA 4DUZL 2UXBL 2A69C 1KIXA 2I5MX 2XRSD 4BY1G 1BR9A 4A3LH 1J5EQ 1STNA 1JJGA 1GM5A 4JW0A 3C46A 4HAEA 3HOXB 1SNPA 3GTOB 5C0XH 3S17H 3J80E 2EDGA 2R93H 2JA9A 2RA4A 4CHTB 2F0NA 2EQSA 3DWPA 1YNXA 2RHQB 3R3OA 5LMNW 2K01A 1MSGA 4LAAA 4KKSA 5IGDA 2ZJRA 4S3SA 4MIUA 3K8AA 1JICA 3A8IE 1SFOB 1RTOA 1MKHA 2L4NA 4X62L 1K83B 4Q5VA 4JYAL 3I4MG 1I4GA 1JWMD 2I5HA 4A3DB 2M2LA 4IALA 3DXJC 2YTXA 2UXCL 4JI0L 1G6PA 1SE4A 2R3ZA 3F1ZA 5IE8A 4C2MH 2PI2E 4B3SL 1I50B 1A62A 1SNCA 1CFMA 3OOCA 1Y8PB 3HOUG 1I4PA 1QNUA 5ISRA 5C3EG 3MFGA 3TZDA 3H3VH 4P71A 1IL8A 3SK5A 1SAPA 4GOPC 3GTPB 4J1MA 1EFID 4A93H 2Q8RE 5GAHC 2G9DA 3WWVA 1DOMA 2CW0C 3LGJA 4KJOA 3H3VI 3EN2A 3I91A 1YI2A 3GTGB 4GKJQ 1FNUA 2L12A 4H44C 4N8FA 4DK3C 1VCIA 2L0CA 3F2UA 1WTHA 3M4OB 2RKSA 5EKKA 2JEBI 1KRTA 2XSCA 4PZ6A 1TVXA 4IPDA 3I3CA 2AWOA 1GHKA 3FRPB 1WD1A 2F0JA 2YTYA 1V43A 4A3GG 5I9PA 1OXXK 2K5VA 5IT9L 2EJMA 2RCNA 1Z7TA 3S1NH 3NK9A 1PXUA 3QIAA 1B3AA 2B8FA 5C44G 1B2TA 1K83H 1MIUA 1AFPA 2N49A 3HKSA 2Z8LA 4EQ5A 4A3EG 3M4QA 3MXUA 1I6VC 2E76C 5K36H 1RJTA 1IBML 1JB3A 2L1BA 4K14A 5FO8B 5IIFA 2R7DA 1JWSD 3MHBA 3PIP3 4JI4Q 4QL5A 2AMCB 4XT1B 1XNQQ 3D4RA 4F8MA 3NTHA 4NXML 1NUCA 4QJFA 1VQ8A 1V8QA 1FNVA 1I50H 1I3QH 2FJ2A 4LF6L 1SYCA 3DM1A 3PO2H 3VR6A 3CCEA 3S17B 1FR3A 1DM0B 5KNCA 1U4RA 2OQ0A 5A35A 1EQVA 3GTKH 2R7ZB 4A4IA 5LMNQ 1A15A 3DHQA 1G2SA 2E5LL 3L9AX 3TDQA 1YIJA 5GROA 1RCVD 4BBRH 1T5EA 4I7ZC 3G71A 4ZCKA 1SROA 2JYOA 4PNYA 1EWCA 5CBEE 2Z9HA 2F0EA 2FMCA 3CC7A 2B63G 2WAQB 1J8IA 1TY2A 3M4OH 2JA6G 1Y1WG 2F0UA 1EOVA 5M9OA 1CKMA 1R9TH 3K0XA 4R4TA 5KYIA 2B3GA 4FF1A 2UUBQ 4K5VA 3IL8A 3GTLH 2KECA 3HOZG 3S1QB 5IGFA 1GUOA 2K4KA 3I4OA 3J7A5 1QJOA 3GQBA 4UPAA 4DR4L 5JOBA 3TP5A 1VQAA 4OIJA 3LWEA 3T4AC 2K50A 3MVVA 4A3MH 2MUYA 2QDLA 2Y0SB 3CCUA 3T51B 4G7HC 2A6HD 1QB5D 3GTGH 5IGCA 1VQDA 2OCEA 5EPJA 4KN4C 4P73A 3J81i 4KHPQ 2NN6I 1VQHA 4CJ0B 2IX3A 2F0DA 4X66L 2PO4A 2Z6KA 1Q1BA 1U0LA 4AH6A 4JI4L 4ZKCB 1STEA 4RAUC 4G57A 4K5XA 4R4QA 4RA8A 3H91A 4IUVA 2QF7A 1SFOH 2PNHA 1XPOA 3WOEA 4QIWE 4XYOA 2IJ0A 4L5QA 1HXYD 1Q82C 1YBYA 1TKWB 3A5UA 1W6KA 5LMNL 4PMWA 1LTID 4K2KA 4U673 4LMQD 5M3FB 5C4XB 1VQ7A 4DV6Q 1BBUA 1CQVA 3PV0A 1PTOD 3CCMA 4B9XA 1HPCA 1A6XA 3J7AV 1NCVA 3D6WA 3OMCA 3CCRA 3DEOA 3P1HA 4X65Q 1YHBA 1EEID 2L5TA 4C3JG 1VMPA 2H5XA 1VQPA 1YHQA 2K28A 2N88A 4LJZC 5EGTA 1K8AC 2JJQA 5DM63 1CT1D 4V0BA 4YHHL 1XMQQ 3U4VA 2IX1A 2O5IC 1EY4A 2Z0SA 1G91A 1LTGD 4I7AA 1ESRA 4XIGS 3KOJA 1E3PA 1UWVA 3W1BA 2GVBA 2MGSA 4ME5A 4ZKBB 3H3VC 3H0GB 3OSOA 1SXTA 4DNIA 4YWLA 1EIYB 4FXDA 5JEAJ 5FO9B 4IO9A 3RUZA 1XPRA 1YNJC 2MFIA 1X3GA 5CR3A 1NBWA 4UDUC 5E4WC 1JB7A 5IT9c 1TWFB 1QOHA 1D7QA 4B3TL 5CGKA 1B50A 1AZPA 1N9WA 3OW7A 1PYBA 3KDFA 1BOSA 2M9VA 4DF7A 1HRJA 5JPNC 3HOVB 4ZQ3A 3BZDB 3BVMA 5IP9H 5A2QE 2F1MA 1Y69U 1CA5A 4BY7B 5CV7A 4HIOA 1BXTA 2KVMA 3PSIA 4WFN3 3AB9A 1PA6A 3JAME 4P74A 3K7UC 1NNXA 2VQEQ 4LF6Q 2X6LA 1ASYA 4BBSH 2MHVA 4C3IG 3CRLC 4CDCC 1N34L 3TEHB 5FLXc 1M1KC 2VB3X 3P20A 1RF2D 4PV1C 4HIKA 3J80i 3NQTA 1R9TB 4ILWA 4K2LA 4C3HG 4YHHQ 1PRTD 1GXDC 4KV6A 4MTNA 1E1TA 3K7AH 4APVA 5C44H 4A3BH 4HMIA 2NVQH 1P8LA 1J6QA 1Q46A 4A3KG 2DJFC 3CF5A 4BXXH 1EY6A 3AYHB 4JBMA 1EIGA 4YIJA 5JJIA 3S1RH 4DXGA 3L0OA 4YCVA 2KCCA 1PRTC 2EXDA 1QVFA 4LF7L 3HOXG 3PO3G 1NR4A 3CQZB 4B3ML 2VNUD 2A5HA 5CV8A 1JORA 4JI6L 1LTLA 1SYBA 4LFCQ 4RCOA 1EY7A 1VQGA 2Z4HA 2Q2TA 1JOQA 4IUUA 2X6GA 3SGIA 1DOLA 1EU4A 4A3DH 3EA6A 3WDNA 3GTJH 1G8ZD 2VZAA 4DR3Q 1OXVA 5G3LD 1H9RA 4A3DG 4GLXA 2D62A 2IPKD 4XTCS 3FEWX 3O13A 4CDFC 3TP6A 3UDFA 5BN3A 1UUPA 4N9PA 1VF5C 1TWFH 4OELB 1N33Q 3ERSX 5IWAQ 2VUMG 3BDCA 3HRZC 4ZRZA 3PO2G 2PZTA 1BDOA 3CU7A 3AQQA 2NZHA 4N9TA 2JXMB 1CKNA 4L8JA 3F2CA 3SE0A 1PH2A 1PH4A 2XWJB 5C3EB 1DD2A 1MHWC 2A1AA 1XMOL 1Q7YC 3T16A 3EVQA 2NBFA 5C0XJ 2A73B 1JJCB 1Q8IA 4JVZA 1WOCA 1B53A 4MHEA 3GTMB 2DNEA 2Z4IA 1Z47A 4DV4Q 1YZ6A 4DR7L 1F2ZA 2WKCA 3BDOA 5FLMH 1IYUA 1VQCA 2WV6D 3CP0A 2O5JC 1H9KA 4A3FB 4LFAQ 4KMUC 2BH2A 4NXNQ 4DV1Q 3MC0B 4JC0A 3CQZH 1MSHA 3B6YA 2XIWA 4B08A 1K8OA 3ND8A 3P75A 4GKJL 4KLKA 3K57A 1PH7A 3CKIB 1GUGA 4JG2A 3M4PA 3NEMA 2MO1A 1Q90A 3M3YB 1HZAA 5C44B 4WJ4A 3HG9A 4DV7L 1K0RA 1RL2A 3SDZA 5IT9E 5EJWA 2BE5D 2TSSA 2NVQB 1L1OA 3PGZA 4A3EB 1I6HB 4A3CG 1EFWA 4PZ7A 5G3LF 4IUPA 1E2VA 1Y1VB 2A69D 4LUOA 4CKCA 5KNDA 1E1OA 3U50C 2B2WA 4IPGA 2SOBA 1UEAB 3FP9A 2F3VA 3MXPA 1SMXA 1MI2A 2QA4A 4QMGA 1R4PB 1QUQA 3UDGA 1PFBA 4J8QA 1PTOF 3TP8A 1PLFA 3DM3A 1IBMQ 1I4HA 4R4IA 1X32A 2E2IH 3DWAA 1HQMC 3A74A 4DR2Q 1CUKA 2K05A 5IP7H 2B2YA 4JI7Q 4DN4M 2QCPX 1U4LA 4BWGB 1S5CD 5KIXA 2RDFA 5IWAL 2RBMA 2G5DA 2FINB 3E0EA 2NVXB 5ELEA 4GKKL 2ENBA 4LFBL 1X54A 4LUVA 3HZXA 2F4IA 1LABA 2ICIA 3KJOA 1JWUD 4IJHA 2F0SA 3TSSA 3E6ZX 1HCZA 1X3EA 1UE1A 1D5MC 3HGBA 5J3BA 4DAYA 2E2DC 4O2DA 4DV0Q 1HZBA 4DKAC 1F9PA 1D2BA 5M5YH 4CDEC 4OIKA 1L2FA 2NVTH 5E7NA 2CH4W 1SNOA 5ELDA 5GADC 3PUYA 3CAMA 1XTCD 4POFA 4KN7C 2R92G 4IN3A 3RN5A 1IHZA 1Q81C 3VYSA 3BG3A 2HCIA 2A8VA 4OGQC 5CV5A 1LO5D 3A7LA 1PFMA 3FPUB 3CC2A 1HUMA 5FO7B 4RHSA 4WRDA 3JC66 2HIXA 1AEXA 1SRUA 4LUZA 2ZXPA 2P5ZX 2K33A 1SEBD 3OYYA 2EY2A 1VS0A 2EYPA 3D8GA 2K5WA 2D9UA 5EBCA 3G7LA 1FNWA 2VS1A 4C56C 4A3GH 4Q0FA 1EYAA 2I0QA 2UXDQ 2L15A 4A3BG 1GUSA 4JI2L 1WTXA 5A2QL 1F2LA 3RNUA 1UNSA 2L55A 4IUQA 5IP7G 1V1OA 3HOUH 4A93B 3QOJA 3BVGA 5BN4A 2EPBA 2X69A 3ITPA 3STBC 1IW7C 1VQNA 4DV2Q 4FNFA 3S15H 1PMRA 4NW2A 1SNQA 1ZYRD 2NB0A 4RH6A 2B29A 2K5QA 3KF8A 1IBKL 1VMCA 4LF4L 1KTKA 5JJZA 1HH2P 2R7FA 1W2BA 2CWPA 1EYDA 4A76A 4LF8L 1TS4A 4RWSC 1E0BA 1RIPA 4X3UA 4G4KA 3CC4A 3G4SA 1EYCA 3W2DA 1SYDA 4DFAA 2GA4B 2ZJPA 3H0GG 1X3FA 4TRDA 1O7LA 1SNMA 4QUCA 1XMQL 3M3YH 1NE3A 4DPGA 4RGNA 3OW2A 2FXQA 2F0GA 3G48A 3TZUA 4LFAL 1TU2B 3CRKC 1VQKA 1AN8A 2OXPA 1HA6A 1PTOC 3KDFB 2SEBD 3F2DA 1C8CA 1OXSC 3HOVH 1LTTD 4PQXA 3D31A 1K3BC 1TS3A 1S3OA 3GTOH 2K32A 5LL6X 3G6EA 1C4QA 3T1HQ 1P16A 4FP5D 1PYSB 5D14A 1CSQA 1BCPF 2EJGC 2K6AA 3C2PA 3ULLA 2XGTA 4FF2A 1QZHA 3SK4A 4Z9CB 4YY3Q 2KHJA 1HNXL 3A0JA 4EGVA 4BBSG 2KOLA 2B2YC 2Q2UA 1LM0A 2LXKA 4C3IB 2PYKA 1VQIA 2F0FA 1VQBA 2A68C 4HN7A 4AYBG 3VYTA 4KD4A 2WINB 3AU7A 3E5SA 1J9OA 4IFDJ 4KY5A 5AJ3Q 2PQAB 3ULPA 4AQYL 1SYEA 1V1PB 2Z6KC 3FKIH 1XTDA 4HSPA 3QG1A 3GTQH 4QF4A 4HCSA 2QEJC 4GKKQ 4NKLA 2EJFC 1B7YB 1N36L 3M7GA 2FMMA 3GD7A 3DWQA 5IY0A 3R93A 5I4DA 1PYWD 1QUQB 5E4XA 1CSPA 4DV5L 3NHHA 4FF4A 3DEPA 4ULLA 1PHJA 5IGGA 2ASBA 2WB1E 1ZYRC 4LW1A 3DLLA 4EVOA 4IURA 3IAYA 1RKNA 3HKZG 5J1ZA 2J4XA 3A56A 1H9SA 4GN3B 3STBD 4MNOA 2JA5G 1S4ZA 3QR8A 4ZK9B 3MAQA 2J7ZA 1DCZA 1II3A 1TQOA 2KEEA 4ZYSA 4OX9L 3G6JB 4PMBA 1HNWQ 1SMYC 5H1SE 1QWYA 4IUTA 2VXWA 2XN9C 4A3IB 5JJLA 1PTOH 4DU9A 2KCMA 2EXZA 3I73A 4R8IA 1A2UA 2LY7A 2DY8A 1TXYA 1GVPA 4LFCL 4C3IH 2OTLA 4EQPA 2LFNA 2O4XA 3BU2A 3KYHC 2F0VA 2RQXA 4WORA 2RDHA 3PO2B 4OWXB 3RLOA 3U9SA 2E5LQ 4R8NA 1EWIA 2XRQD 2DN8A 1TIID 2UUCL 3FKIB 5KGUA 3MEHA 3JAMc 2KA7A 4LF5L 3PIOA 4A75A 1KDAA 2J0TD 1KAWA 1SNDA 3HEJA 2K52A 4NPSA 2JA6H 4X62Q 2DNCA 5EKIA 2G9HD 4DAVA 1XX8A 3W5OA 1S5BD 2IT1A 2KUMA 3K81C 4JI8Q 1IBLQ 4P72A 1LTSD 5CV6A 3E9HA 1UE6A 3V05A 4CKEA 2JA5H 1LV9A 1AP0A 1VQLA 2DJGC 5DLQE 1H9JA 4QY7A 2F0MA 1DYQA 5CORA 2EY6A 3H0GH 2D2CC 3S16H 5C3XA 4DV4L 4DR7Q 4C1NI 3I7FA 2I5LX 3TS2A 1FD7D 1H9MA 1I6HH 4Y52H 3CXCA 4LF4Q 2NUCA 4OWTB 1YNNC 2NWGA 1TS5A 4O1NA 5BN5A 2A6EC 2PW7A 1GJXA 2QDBA 4RCNA 3RZDB 1HFGA 4JBJA 3R8BA 2F0WA 2BH8A 1F9RA 5DEHA 4NDXA 3UE1A 3Q23A 5JAVA 1FYCA 1ENCA 3E0JA 4IUNA 1YJ9A 2B2VC 3C1FA 1LTAD 2Y0SE 3MZ5A 5M3MB 4KJNA 1PH6A 2WB1B 3MTSA 3GTPH 3A8JE 1AE2A 2UXCQ 4TKOB 2UUCQ 5EPKA 3J7ZC 5E1FA 2JA6B 4OO1H 3I2ZA 1O7ZA 1Y1WB 1H95A 2MPMA 1PVOA 4IPCA 1HNZL 2C5CA 1S40A 2O2LD 4O0AA 4C3HH 1BCPB 3J81j 3MEFA 3NWSA 4HJ7A 1OO9B 1GUNA 1XNQL 3PUZA 3HOZB 4EQNA 5HGTA 1SMYD 5C4XH 1YNJD 3I70A 1SDFA 1YITA 4CJ1B 5M5YB 1GD7A 5M5WH 3A54A 1BVSA 2CWAA 2RHSB 4A3MG 4FF3A 1DZ1A 1HTLD 2Y0SG 5HGQA 3C1EA 3J80L 1S5FD 4BA2I 1UEBA 4GNXC 4NB3A 3N52A 1YJWA 1L0WA 4GZYC 5ELFA 4IFDH 1EY0A 1N8RC 3CCLA 2EYMA 1JJ2A 4K6LA 2YV5A 4JI1L 3KBXA 2D0PA 1F77A 2GN5A 1XYIA 3I4NG 4LF9L 2R92H 1O7YA 3H15A 2QGQA 3BVZA 2K1BA 1RD9D 1KXLA 2Q8IB 3Q0AA 4KHVA 4OO1G 2R7ZH 1TS2A 4X6AH 2AQ3B 3KLSX 4HSVA 1KNEA 5TSSA 4DNTB 2LMCB 1G6ZA 2UXBQ 2DGYA 3SK6A 2CVRA 1U5KA 2EY5A 1D1KA 3BYYB 4KKTA 3CHBD 4A3IH 2EYFA 5GAGC 3CCSA 5C4XG 4C1NK 1TWCH 2B63H 1JQYD 1U4PA 1PRTF 1LUZA 1ASZA 4A3BB 3T56B 1SN8A 4MZ9A 4OHJA 1IYJB 1B44D 1S5DD 5M3MH 5C4JB 1O7IA 2CQOA 4BA1I 2OQKA 2WAQE 5DNFA 2ALYB 2K03A 1ENAA 1A0IA 2KBNA 5IYCH 3KBGA 3U9OA 3MXNA 3MFYA 4LWCA 2YU9B 2LXJA 2RCFA 3ONAB 2AQ2B 3Q6SA 1Y1WH 3HS0C 2F4VQ 3NUCA 1WTRA 2A6ED 2HD3A 1V9PA 1DONA 4HIDA 2I46A 3NENA 1EQRA 4TQUS 4BBRG 2ZXRA 1PH3A 4HEDA 5DM73 5C4HA 1VDZA 3GO5A 2AHOB 3NBHB 4A3KH 4KY7A 3K5LA 3ULJA 3H09A 4JI8L 2ES2A 2PW5A 4LF9Q 1HQRD 1EEFD 1O80A 2QILA 2JA8H 1YHAA 1A3TA 1RDPD 1JC7A 4X66Q 3BZKA 3PUWA 2WIIB 5LMUQ 1IZ6A 2NN6G 4YWMA 3GTMH 1AH9A 1X3PA 5LL6S 1BF4A 4L5SA 2Q2IA 1XJVA 5COYA 4V190 1E22A 4NXMQ 3NELA 1M90C 2AWNA 2KHIA 3T13A 2RSNA 3SR1A 4GNXA 4O42A 1JE4A 1NSNS 1NTGA 4C3JH 3T53B 3URYA 1QVCA 5C4ZA 2EYOA 5IGBA 3LWUA 1J5EL 2LKVA 4C3HB 3VYRA 5D65A 1D6EC 1EQQA 2ATWA 3RLFA 1CI3M 1WCMH 1PFSA 1Q1EA 2SDFA 1PZKD 5IYBH 3U4ZA 3K0YA 1EQTA 3ERQA 1JR0D 4M8AA 1F2YA 2HIVA 3S2DH 1Z9FA 3K5NA 2Q8TA 2BDOA 4A3KB 1D8LA 4KTAA 1BBWA 1QVGA 5C3EH 2B2WC 5EBDA 1NMGA 4F7XA 1BCPC 4A3EH 3D4WA 3DUZA 2F0PA 1YJNA 3Q8DA 3BYTB 1SJED 1G2TA 1Y1VH 4K0KL 1E24A 2QKIC 3EQLC 2GVAA 1PH1A 3J7AF 4A3CH 1STHA 1F9QA 1ICFB 3TS0A 1SYFA 4A3JG 4DGZA 2D5DA 3KK7A 5KRUA 3Q24A 4IFDI 1A8VA 5FJ8H 3TQYA 5I2YA 3R2IA 5CYUA 4DUZQ 2CQAA 1KC8C 1I4QA 3RR5A 3M4YA 2ID0A 2PQEA 4OONA 2A68D 3F8TA 2C9OA 4DV7Q 3RN2A 4ABNA 5I9OA 1SR3A 1EZ8A 2A19A 4R9WA 2ZTDA 5JPMC 1JCKB 1OTCA 1LTBD 2VQFL 3S24A 3CMEA 2AUJD 2ZTCA 5M5XB 1WFQA 2ZTEA 2N3SA 5FOBB 5K5PA 2VL6A 3SXHA 1K9MC 1HA5A 4A3IG 3ZJYC 3NBHA 2JE6I 3C3LA 2JA8B 5JJKA 1NAPA 4POGA 4UP9A 3I90A 5C6AA 3V96A 3X3MA 2KJXA 3E3XA 4HJAA 3N6RA 4KHPL 1OXUA 4DNRB 1W6JA 2IHEA 4UP7A 1T5XD 2WACA 2PI2A 1PFNA 1EIFA 1CK1A 2V1CC 4G7OC 4UY8C 4B3RL 2E8GA 2OTJA 2NVTB 4M1UB 3W1GA 4ZLTF 4QIWB 4A3FG 4MTKA 4P2CB 4IJLA 3A55A 2B8GA 2NVXH 1YNND 4DV6L 4R4OA 4GS3A 4GLAC 1K73C 2RSOA 1I94Q 2SNMA 2R61A 3OPOA 3GP7A 2B2TA 1JE5A 4LF5Q 2R93G 3F2BA 3S16B 3CCVA 1TWGH 2EOTA 4X65L 3L2PA 5CMDA 1SE2A 2EY1A 2ZJQA 3GV3A 4DR1Q 2PQAA 5KYLA 4R1JA 3QWNA 2K5HA 1ZKOA 3S9WA 2ZM6Q 1L1OB 2TMPA 3CD6A 4B3MQ 5C0XI 2CKZB 3S14H 2MP1A 2AKWB 2E2HH 2HUGA 2YYZA 3UDIA 3EROA 2EIFA 5E3FA 5GQOA 3D6CA 3Q22A 1STAA 2NVYH 2RF4A 2HDMA 3FMCA 2HQEA 1I4XA 5JEAH 3HOUB 3CPWA 1WD0A 3J81E 1QCBD 2NTSA 3KUPA 1TT2A 1KRSA 2N78A 4HMJA 1F2MA 4PMCA 3OTOQ 4XT3B 3D3RA 2F0TA 4X64L 4DR4Q 5CV9A 4QB4A 3NPPA 1U4MA 1XWEA 3HFZB 1HZ9A 4B3RQ 1SSOA 1B8AA 4L63B 3PMFA 1QNKA 4IQZA 1ML0D 2L11A 1E7ZA 4HJ9A 4A3FH 4H0LC 3NE5B 1XMOQ 1CKNB 3HOWG 5FLXE 2HQLA 3UI2A 4DR6Q 1PZID 4A3GB 3VDYA 2BE5C 4TVAB 4DK0A 1CKOA 1BQQT 1WCMB 3GTQB 2VB2X 4Y7NH 2VQEL 4YCWA 4TSSA 4HIMA 4A3MB 1X65A 2F0KA 4OEMB 3VR2A 5BR8L 1KHIA 1I94L 1HR0Q 3PIO3 3V2TA 4NXNL 3NP8A 4QGUA 1CA6A 4JCVE 3TP7A 3S15B 1C0AA 1IXRA 3NSWA 2R92B 5GAEC 2ZM6L 4YCUA 2F3IA 3HOXH 4DR1L 1A63A 1L1OC 1UE7A 1JT8A 4KHZA 3I4NB 4U68A 3VR3A 3QOLA 4AIMA 1KLGD 3KLWA 4L5TA 5C5LA 5I6YA 3OMGA 1SJHD 4DR5Q 1LYLA 1TWGB 2PMZE 1X3QA 3ICEA 1VQ9A 1PDQA 2KCTA 3K59A 1PTOB 2DY7A 4UAIA 1FVIA 3I72A 3IFDA 2B63B 1L0YB 1Q12A 2WAQG 1FL0A 2F0HA 1YVCA 2UU9Q 2F0QA 2Q2HA 4C2MB 2UUAL 3S14B 3S1NB 3NXWA 1X55A 5JVG3 4GOPA 1RTNA 4DAMA 1Y8OB 4A93G 1CZWA 5C3WA 2B2TC 5JVH3 4CDDC 1VQ6A 2CFMA 2IY5B 4DR6L 2YTVA 4UHVA 4JV5L 1SLJA 4A3LG 4XQNA 1GUTA 1FGBD 3CCJA 1Y14B 3I56A 3OWFA 2D0OA 4CKBA 4JI3L 1HUNA 2F03A 2VY3A 2XTIA 5HURA 3UDXA 3ZYYX 4ALPA 2IL8A 1HTPA 3KJPA 3K5MA 3EJIA 4CGYB 1T9HA 4FXKC 3J7YW 3VA5A 4EX5A 2WKDA 2MNAA 3MXGA 3GTKB 2A74C 1KAAA 3I4MH 5BR8Q 1HR0L 2HCCA 4R4CA 3TMEA 4BBRB 3FPPA 3J80c 2JQOA 1KQSA 2NZOA 1C9OA 2F4VL 3PCOB 3QJYA 4P75A 3D4DA 4UP8A 3A8KE 2KENA 3VYUA 1GKHA 4DV5Q 3RZDH 1KLUD 1EWHA 3LNNA 4HTHA 5I6WA 4F88A 2DUDA 4XXEA 1W3SA 2EYJA 4BXXG 2VUMH 1I3QB 2F0IA 3EFXD 1IBKQ 1NMFA 3GTLB 2E2HB 5FJ8G 1I4RA 1H9SB 5I2XA 3CPFA 4QUFA 3J81c 4A3JH 5EPLA 1LACA 2K14A 1EU3A 2UUAQ 1IKMA 4HJ5A 4OX9Q 2UUBL 1TWHB 2EVBA 4KKUA 2PMZB 4B3TQ 3S1MH 1WTPA 1SBBB 4IOCA 4EQOA 4WJ3M 4RGTA 4KK7A 4BBSB 4RG1A 3UE0A 3K58A 3OHXC 1C7YA 4C3JB 4JI5L 2IX0A 2EZVA 4AYBB 1MD2D 1V1PA 3PO3H 2E2JB 1KABA 3GV6A 1STBA 1PH9A 2F3WA 2XNAC 3OTOL 4PZ8A 3VR4A 3VA7A 4JI7L 4DK6C 3HOYH 5IYBG 1A3UA 1DJRD 5M5WB 1TY0A 3RZOB 2E74C 3H94A 5ELBA 1VQEA 1SYGA 3T1YL 4DR2L 1N34Q 3D0FA 1XPUA 4DV3Q 3LX0A 1D5ZC 1GOZA 2JN4A 3P7JA 1RODA 1TWAH 1IL2A 4J6HA 4B9WA 1LT4D 2NYZD 3S1RB 4DR3L 5IGEA 3HKZE 4JBWA 2JA7B 1X9NA 2JK8A 1SE8A 3HKZB 1LT3D 5ELOA 4LFBQ 1VQ4A 5NUCA 1WJJA 2MQHA 2JA5B 5D3IB 1EIHA 4A3JB 1C48A 2QEXA 3HOVG 1ZXTA 4RHRA 2NN6H 3OIPA 3MA2B 3M7NA 3JAMi 3L7ZC 2B2VA 1BUVT 1K8GA 4NMZA 2AUKA 4DV0L 1ILPA 4HJ8A 4DUYQ 1EL0A 3PUXA 3FHWA 2KQ3A 2BA0A 5FLMG 1VQMA 3AEVA 1RHPA 3PQIA 4JI6Q 4DAPA 1LT6D 4WJWA 4X3KA 3EIVA 3AFPA 1HJPA 1BNZA 1GUWA 3E9IA 5M3FH 2PPBC 4X3SA 2C35B 1I5FA 3FKIG 4RFBA 2VQFQ 3HOYB 1PH5A 3KFUA 2JSOA 3WOFA 4YY3L 1A3VA 1VQ5A 5JEAG 4FO2A 4G7ZC 4BY1B 3SEBA 3K80C 3SK8A 5EKLA 2HDLA 3TRZA 3FVQA 2BCOA 2UU9L 1TWAB 4GLVB 4CBVA 1N33L 2F0OA 4OL7A 2B39A 2OEOA 2YU9H 4ODGA 5HY6A 1HHVA 5FKAC 1U9RA 3I4LA 4KY6A 2NTTA 1S72A 3SHLA 5D3DA 2KHSA 2A6HC 3BDLA 4DA2A 4AQYQ 1KD1C 1STYA 1EY8A 1DXMA 1X56A 1B1ZA 5ELCA 3T1YQ 3KF8B 4QCLA 3PO3B 3KLSA 4KD3A 1D5XC 3K6OA 5T1IA 4JV5Q 3TN2A 2R93B 1CHQD 4JI0Q 1A2TA 3I55A 2UXDL 1Y8NB 3CMAA 1Q3LA 3HOZH 1JOKA 3TREA 3I4MB 3CW2C 1B9NA 1WVLA 4B3SQ 2CH4A 2MJ8A 4NP5A 4J15A 5EAYA 1ZEQX 3RZOH 3M9BA 1BO0A 1X6OA 1B4OA 1B9MA 1LLRD 1ILQA 1GHJA 5J39A 4JI1Q 4DV2L 3BZCA 1WTOA 3PIPA 1IW7D 3VR5A 2AQ1B 2IHFA 1OXTA 2BA1A 5ELNA 5M3MG 4GNXB 2M00A 2VUMB 2WB1G 1M8AA 3W3AA 4ZUIA 4GN5A 1B3QA 1CHPD 1LTRD 4I65A 4H13C 1K8MA 5C4JH 4ID6A 1UAPA 1VQJA 3SVMA 2LS01 2QW7A 1MJCA 1PRTB 1CTMA 1TWHH 4BS9A 1DOKA 3IRBA 1QZGA 1HFNA 4H7BA 2K75A 2I07B 1ET9A 2WFWA 1ESFA 5KEEA 1M4VA 1EZ6A 5LHY1 1PV4A 2CCZA 1ENFA 1PZJD 3T1HL 4RKBA 1TWCB 1Z6HA 3HOWB 2E2JH 3IKJA 1XNRL 4X64Q 4KI0A 2VW9A 1EY5A 4DXFA 4JK1C 2JEAI 3K5OA 1LT5D
chains in the Genus database with same CATH topology
1CSQA 1WCMG 1HZCA 1SFOH 4UY8C 3PF5A 2E8GA 3GDEA 2XGTA 3ULLA 3S2HH 2PNHA 1HNXQ 4B3RL 3W1GA 1XPOA 1QZHA 2OTJA 4QIWE 4YY3Q 2KHJA 4L5QA 1HNXL 4QQBX 5IYDG 4A3FG 3A0JA 4BBSG 4IJLA 3CCQA 1Q82C 2Q2UA 2NVXH 1LM0A 1YBYA 2LXKA 1Y1VG 1YEZA 3A5UA 4DV6L 4R4OA 1VQIA 4GS3A 4GLAC 4PMWA 5LMNL 1K73C 1VQBA 1I94Q 4AYBG 2HHHQ 3M85A 4LF5Q 1JE5A 2K5NA 1GO3E 3A5ZB 1VQ7A 2R93G 3F2BA 4DV6Q 3CCVA 4IFDJ 1BBUA 3PV0A 1TWGH 1G291 4X65L 2R7ZG 3CCMA 3L2PA 4DV3L 2ZJQA 5AJ3Q 2PQAB 3ULPA 4AQYL 2Z6KC 3CCRA 4DR1Q 3FKIH 1XTDA 4X65Q 1YHBA 3GTQH 2PQAA 4GKKQ 4JOIA 1B7YB 4R1JA 1N36L 3EBEA 5M5XH 3ER0A 2K5HA 2H5XA 1VQPA 1N32L 2ZM6Q 3GD7A 1L1OB 1YHQA 5IY0A 4GN4B 1N36Q 1QUQB 4B3MQ 3CD6A 1K8AC 1CSPA 2JJQA 5C0XI 4DR5L 2CKZB 4DV5L 3S14H 2AKWB 2E2HH 1PHJA 4YHHL 2YYZA 2WB1E 3UDIA 2ASBA 4LW1A 3U4VA 1XMQQ 3DLLA 2EIFA 3U58A 2IX1A 5GQOA 3HKZG 4DV1L 2Z0SA 3HOWH 2NVYH 3STBD 4GN3B 2RF4A 4XIGS 3KOJA 4MNOA 2JA5G 1E3PA 1UWVA 3W1BA 2GVBA 3CPWA 1HNWL 1KL9A 4OXPA 4DNIA 1AE3A 1KRSA 2N78A 4YWLA 5K36G 1EIYB 1VQFA 3RLNA 3OTOQ 4OX9L 3S1QH 5JEAJ 1HNWQ 4IO9A 1XPRA 5H1SE 2MFIA 1X3GA 1NBWA 4X64L 4BY1H 4DR4Q 5JJLA 1JB7A 5IT9c 2KCMA 3BJUA 1NJIC 1K3RA 3HFZB 1HZ9A 4B3RQ 4B3TL 1D7QA 1TXYA 1GVPA 1B8AA 2R6GA 4LFCL 4C3IH 1N9WA 2OTLA 1E7ZA 4HJ9A 1PYBA 3KDFA 4A3FH 3BU2A 5IYDH 3KYHC 5C0XG 1CKNB 1XMOQ 3HOWG 2HQLA 4DR6Q 4OWXB 3RLOA 3VDYA 2E5LQ 4TVAB 1EWIA 3PUVA 5IP9H 2UUCL 4JI3Q 1CKOA 3JAMc 4Y7NH 2VQEL 4JBKA 3KF6A 1Q86C 3PIOA 4YCWA 4HIOA 4A75A 4LF5L 4HIMA 3PSIA 1X65A 1FJGQ 1KAWA 5BR8L 1KHIA 1PA6A 1I94L 2VQEQ 4P74A 3K7UC 1HR0Q 4LF6Q 4NXNL 2K52A 4NPSA 2JA6H 4QGUA 4X62Q 1ASYA 4BBSH 4JCVE 3W5OA 2IT1A 4LF8Q 3K81C 1C0AA 1IXRA 4JI8Q 1N34L 4P72A 1IBLQ 3E9HA 3TEHB 1UE6A 5M3FG 5FLXc 5GAEC 1M1KC 2LSSA 4YCUA 2F3IA 3HOXH 2ZM6L 4DR1L 2JA5H 1A63A 1L1OC 1IBLL 1UE7A 1JT8A 1WI5A 4AYBE 1Q8KA 1VQLA 4KHZA 4HIKA 5DLQE 4QY7A 3J80i 4AIMA 1VQOA 4GOPB 4L5TA 3KLWA 1FGUA 1BKBA 4YHHQ 2MO0A 4MTNA 4DR5Q 1E1TA 3H0GH 3K7AH 4APVA 5C44H 1LYLA 3S16H 4A3BH 4DV4L 4DR7Q 5IP9G 2NVQH 2PMZE 3AFQA 1P8LA 3I7FA 2I5LX 2F52A 1J6QA 3ICEA 3TS2A 1VQ9A 1Q46A 3CXCA 4LF4Q 2KCTA 1V1QA 4A3KG 4OWTB 5AJ3L 3CF5A 4IOAA 4BXXH 3AYHB 4JBMA 1FVIA 4FDBA 5JJIA 4JBJA 1Q12A 2WAQG 1FL0A 3S1RH 2BH8A 1MJEA 1YVCA 3L0OA 4YCVA 2UU9Q 2EXDA 4IPHA 1QVFA 2Q2HA 4LF7L 3UE1A 1JMCA 3HOXG 2UUAL 3PO3G 2VNUD 4B3ML 1X55A 1YJ9A 3PF4A 1WYDA 4GOPA 2Y0SE 1LTLA 4DAMA 4JI6L 4A93G 4LFCQ 1VQGA 2Q2TA 1PH6A 4JI5Q 3SGIA 4A3DH 1VQ6A 2CFMA 4YWKA 3GTPH 2IY5B 4DR6L 2YTVA 3GTJH 4JV5L 1DGSA 1SLJA 4A3LG 1AE2A 2VZAA 4DR3Q 1OXVA 2UXCQ 2UUCQ 3J7ZC 1HNZQ 3CCJA 1Y14B 3I2ZA 3I56A 1B70B 2D0OA 4A3DG 1H95A 2JA7H 4OO1I 4GLXA 4JI3L 2D62A 4JOIC 2HT1A 2VY3A 4IPCA 4XTCS 1HNZL 2XTIA 1S40A 1PVOA 1FJGL 3UDFA 4O0AA 3UDXA 4ALPA 4IFDG 4C3HH 3KJPA 3J81j 4LNQA 1TWFH 3MEFA 1XNRQ 4HJ7A 1N33Q 3ERSX 1T9HA 5IWAQ 2JA7G 2VUMG 3I4NH 1XNQL 3PO2G 3PUZA 4EX5A 2N8NA 2MNAA 3AQQA 2NZHA 1EUJA 3I4MH 4JYAQ 5BR8Q 1HR0L 5C4XH 1CKNA 3F2CA 4R4CA 1YITA 1PH2A 1NY4A 1PH4A 4PG3A 1EYGA 3J80c 2A1AA 1XMOL 1GD7A 4JI2Q 5M5WH 1Q7YC 4BY7G 2JQOA 1KQSA 1BVSA 2CWAA 1C9OA 2NZOA 2RHSB 3KF6B 5IYCG 4A3MG 5C0XJ 2F4VL 4L5RC 2Y0SG 3PCOB 1JJCB 4P75A 5HGQA 4DAYB 1WOCA 4BA2I 1UEBA 4GNXC 4NB3A 4UP8A 2KENA 4BY7H 2OWOA 1GKHA 4DV5Q 1Z47A 3RZDH 1YJWA 1G51A 1L0WA 4DV4Q 1YZ6A 2HHHL 4DR7L 5FLMH 2JA8G 1N8RC 3CCLA 1JJ2A 4H02A 1VQCA 3CP0A 2DUDA 2YV5A 4JI1L 4RMFA 4LFAQ 2D0PA 2WP8J 1W3SA 5LMUL 2GN5A 4DV1Q 4ME3A 1HR0W 4JC0A 4NXNQ 2BH2A 3I4NG 2VUMH 4BXXG 3CQZH 4LF9L 3MXNB 4K0KQ 2R92H 3B6YA 1IBKQ 1NMFA 1PH8A 5FJ8G 3J81c 3CPFA 3H15A 4A3JH 4DUYL 4GKJL 4KLKA 1UE5A 2K14A 2QGQA 2UUAQ 1KXLA 4HJ5A 4OX9Q 3HOYG 1PH7A 2UUBL 4OO1G 4LF7Q 1N32Q 2R7ZH 4JG2A 3M4PA 4OWWB 3NEMA 2MO1A 4DUZL 2UXBL 1HZAA 4WJ4A 4X6AH 1KIXA 2I5MX 4DV7L 1K0RA 1RL2A 4B3TQ 3S1MH 1L1OA 4BY1G 4IOCA 4WJ3M 2UXBQ 2DGYA 3PGZA 1U5KA 4A3CG 4A3LH 1EFWA 4RG1A 3UE0A 4PZ7A 1C7YA 4JI5L 1J5EQ 4LUOA 2IX0A 1JJGA 1E1OA 3U50C 4A3IH 1GM5A 4IPGA 5GAGC 3CCSA 5C4XG 1TWCH 3FP9A 1SMXA 2B63H 3S17H 3PO3H 2R93H 2QA4A 2JA9A 2EQSA 1LUZA 1QUQA 1PH9A 1YNXA 3UDGA 2RHQB 1I6HH 3OTOL 4PZ8A 3DM3A 5LMNW 1IBMQ 2ZJRA 4JI7L 1ASZA 4R4IA 4DK6C 2E2IH 3HOYH 5IYBG 3A74A 3K8AA 1SN8A 4MZ9A 4DR2Q 1CUKA 1IYJB 5IP7H 1MKHA 5M3MH 4JI7Q 4X62L 1O7IA 4JYAL 1VQEA 2CQOA 3I4MG 3T1YL 4DR2L 4BA1I 1N34Q 2I5HA 2OQKA 3D0FA 1XPUA 2WAQE 4DV3Q 2ALYB 5IWAL 3E0EA 1A0IA 2KBNA 5IYCH 1TWAH 1IL2A 2YTXA 4LWCA 4GKKL 2LXJA 4DR3L 2UXCL 4JI0L 1Y1WH 4LFBL 3HKZE 1G6PA 4JBWA 1X54A 5IE8A 3F1ZA 4LUVA 1X9NA 2JK8A 4C2MH 2F4VQ 2PI2E 1SE8A 5ELOA 4B3SL 1A62A 1V9PA 1VQ4A 4LFBQ 4HIDA 3KJOA 1WJJA 2MQHA 4IJHA 3HOUG 3NENA 1EQRA 4TQUS 4BBRG 5C3EG 1X3EA 1UE1A 2QEXA 1PH3A 3HOVG 3H3VH 5J3BA 4P71A 3M7NA 4O2DA 4DV0Q 3JAMi 3L7ZC 4GOPC 1HZBA 1K8GA 3GO5A 4DKAC 4A93H 2AHOB 3NBHB 5GAHC 4A3KH 3WWVA 5M5YH 3LGJA 3ULJA 4DV0L 4JI8L 2ES2A 1L2FA 4HJ8A 3H3VI 3EN2A 4DUYQ 1YI2A 4LF9Q 2NVTH 4GKJQ 5E7NA 3PUXA 4DK3C 1VCIA 3FHWA 5FLMG 2BA0A 2JA8H 2JEBI 5GADC 1VQMA 1KRTA 3PUYA 3AEVA 1YHAA 4PZ6A 4JI6Q 3CAMA 4X66Q 4IPDA 3BZKA 2AWOA 3EIVA 4POFA 3AFPA 2R92G 1HJPA 2YTYA 3E9IA 5M3FH 1V43A 3RN5A 4A3GG 3PUWA 1OXXK 2K5VA 2C35B 1I5FA 3FKIG 2RCNA 2VQFQ 5LMUQ 3S1NH 1Q81C 1IZ6A 1PH5A 2A8VA 3KFUA 2NN6G 5C44G 1K83H 1MIUA 4YY3L 1VQ5A 3CC2A 5JEAG 2N49A 3HKSA 4YWMA 3JC66 3K80C 2HIXA 4EQ5A 4A3EG 3GTMH 3M4QA 1AH9A 1IBML 1SRUA 3TRZA 4L5SA 2Q2IA 1XJVA 4LUZA 2UU9L 1N33L 1E22A 4GLVB 2R7DA 4NXMQ 4JI4Q 3NELA 2AMCB 4QL5A 2YU9H 5HY6A 2AWNA 2KHIA 3OYYA 1M90C 1XNQQ 4GNXA 1VS0A 4NXML 1NTGA 4QJFA 4C3JH 1VQ8A 1QVCA 4LF6L 1S72A 1I50H 1I3QH 2VS1A 1KD1C 4AQYQ 1J5EL 3PO2H 4A3GH 3CCEA 1X56A 3T1YQ 2I0QA 2UXDQ 2L15A 3KF8B 2ATWA 1EQQA 4A3BG 3RLFA 4JV5Q 4JI2L 1WCMH 1PFSA 1Q1EA 4JI0Q 5IYBH 3I55A 3U4ZA 2OQ0A 1EIFA 3RNUA 2UXDL 5IP7G 3GTKH 3CMAA 2HIVA 3HOZH 3TREA 4A4IA 5LMNQ 3HOUH 3CW2C 1Z9FA 2E5LL 3S2DH 4B3SQ 1D8LA 1YIJA 1BBWA 5GROA 4BBRH 5C3EH 1QVGA 3G71A 3STBC 1NMGA 1SROA 4J15A 5EAYA 1VQNA 4DV2Q 3M9BA 3RZOH 4A3EH 1X6OA 3S15H 1YJNA 3Q8DA 3CC7A 2B63G 3M4OH 1Y1VH 4JI1Q 4DV2L 2B29A 4K0KL 1IBKL 2JA6G 1E24A 1Y1WG 4LF4L 3BZCA 1PH1A 2GVAA 4A3CH 1HH2P 2R7FA 1EOVA 3PIPA 2CWPA 1W2BA 4Y52H 3TS0A 1CKMA 1R9TH 3K0XA 4A76A 4A3JG 2IHFA 4R4TA 4IFDI 1OXTA 2BA1A 1A8VA 5FJ8H 3TQYA 5ELNA 5M3MG 4GNXB 4LF8L 1RIPA 2B3GA 4DUZQ 1KC8C 3CC4A 2WB1G 3G4SA 3RR5A 2UUBQ 2ID0A 3GTLH 4OONA 4GN5A 3HOZG 3F8TA 2K4KA 3I4OA 3J7A5 5C4JH 2ZJPA 4UPAA 4DV7Q 3RN2A 4DR4L 3H0GG 1SR3A 1VQJA 1X3FA 2A19A 1VQAA 2ZTDA 1OTCA 1MJCA 2K50A 1TWHH 4A3MH 2VQFL 1XMQL 3M3YH 1NE3A 3S24A 4DPGA 3CMEA 2FXQA 3OW2A 3G48A 2ZTCA 4LFAL 1WFQA 3IRBA 1QZGA 2ZTEA 3CCUA 1VQKA 2N3SA 2K75A 2VL6A 1K9MC 3GTGH 4A3IG 2WFWA 3ZJYC 3KDFB 3F2DA 2JE6I 1VQDA 1OXSC 2OCEA 3HOVH 5JJKA 3D31A 4POGA 1PV4A 2CCZA 4UP9A 1S3OA 4P73A 3J81i 3GTOH 4KHPQ 3T1HL 2NN6I 1VQHA 2E2JH 4X66L 1XNRL 4X64Q 4HJAA 3G6EA 4KI0A 2VW9A 4KHPL 2Z6KA 3T1HQ 1OXUA 1Q1BA 1P16A 1U0LA 2IHEA 4AH6A 4JI4L 4UP7A 2JEAI 4R4QA 2PI2A 2V1CC 1PYSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSQ A;  1WCM G;  1HZC A;  1SFO H;  4UY8 C;  3PF5 A;  2E8G A;  3GDE A;  2XGT A;  3ULL A;  3S2H H;  2PNH A;  1HNX Q;  4B3R L;  3W1G A;  1XPO A;  1QZH A;  2OTJ A;  4QIW E;  4YY3 Q;  2KHJ A;  4L5Q A;  1HNX L;  4QQB X;  5IYD G;  4A3F G;  3A0J A;  4BBS G;  4IJL A;  3CCQ A;  1Q82 C;  2Q2U A;  2NVX H;  1LM0 A;  1YBY A;  2LXK A;  1Y1V G;  1YEZ A;  3A5U A;  4DV6 L;  4R4O A;  1VQI A;  4GS3 A;  4GLA C;  4PMW A;  5LMN L;  1K73 C;  1VQB A;  1I94 Q;  4AYB G;  2HHH Q;  3M85 A;  4LF5 Q;  1JE5 A;  2K5N A;  1GO3 E;  3A5Z B;  1VQ7 A;  2R93 G;  3F2B A;  4DV6 Q;  3CCV A;  4IFD J;  1BBU A;  3PV0 A;  1TWG H;  1G29 1;  4X65 L;  2R7Z G;  3CCM A;  3L2P A;  4DV3 L;  2ZJQ A;  5AJ3 Q;  2PQA B;  3ULP A;  4AQY L;  2Z6K C;  3CCR A;  4DR1 Q;  3FKI H;  1XTD A;  4X65 Q;  1YHB A;  3GTQ H;  2PQA A;  4GKK Q;  4JOI A;  1B7Y B;  4R1J A;  1N36 L;  3EBE A;  5M5X H;  3ER0 A;  2K5H A;  2H5X A;  1VQP A;  1N32 L;  2ZM6 Q;  3GD7 A;  1L1O B;  1YHQ A;  5IY0 A;  4GN4 B;  1N36 Q;  1QUQ B;  4B3M Q;  3CD6 A;  1K8A C;  1CSP A;  2JJQ A;  5C0X I;  4DR5 L;  2CKZ B;  4DV5 L;  3S14 H;  2AKW B;  2E2H H;  1PHJ A;  4YHH L;  2YYZ A;  2WB1 E;  3UDI A;  2ASB A;  4LW1 A;  3U4V A;  1XMQ Q;  3DLL A;  2EIF A;  3U58 A;  2IX1 A;  5GQO A;  3HKZ G;  4DV1 L;  2Z0S A;  3HOW H;  2NVY H;  3STB D;  4GN3 B;  2RF4 A;  4XIG S;  3KOJ A;  4MNO A;  2JA5 G;  1E3P A;  1UWV A;  3W1B A;  2GVB A;  3CPW A;  1HNW L;  1KL9 A;  4OXP A;  4DNI A;  1AE3 A;  1KRS A;  2N78 A;  4YWL A;  5K36 G;  1EIY B;  1VQF A;  3RLN A;  3OTO Q;  4OX9 L;  3S1Q H;  5JEA J;  1HNW Q;  4IO9 A;  1XPR A;  5H1S E;  2MFI A;  1X3G A;  1NBW A;  4X64 L;  4BY1 H;  4DR4 Q;  5JJL A;  1JB7 A;  5IT9 c;  2KCM A;  3BJU A;  1NJI C;  1K3R A;  3HFZ B;  1HZ9 A;  4B3R Q;  4B3T L;  1D7Q A;  1TXY A;  1GVP A;  1B8A A;  2R6G A;  4LFC L;  4C3I H;  1N9W A;  2OTL A;  1E7Z A;  4HJ9 A;  1PYB A;  3KDF A;  4A3F H;  3BU2 A;  5IYD H;  3KYH C;  5C0X G;  1CKN B;  1XMO Q;  3HOW G;  2HQL A;  4DR6 Q;  4OWX B;  3RLO A;  3VDY A;  2E5L Q;  4TVA B;  1EWI A;  3PUV A;  5IP9 H;  2UUC L;  4JI3 Q;  1CKO A;  3JAM c;  4Y7N H;  2VQE L;  4JBK A;  3KF6 A;  1Q86 C;  3PIO A;  4YCW A;  4HIO A;  4A75 A;  4LF5 L;  4HIM A;  3PSI A;  1X65 A;  1FJG Q;  1KAW A;  5BR8 L;  1KHI A;  1PA6 A;  1I94 L;  2VQE Q;  4P74 A;  3K7U C;  1HR0 Q;  4LF6 Q;  4NXN L;  2K52 A;  4NPS A;  2JA6 H;  4QGU A;  4X62 Q;  1ASY A;  4BBS H;  4JCV E;  3W5O A;  2IT1 A;  4LF8 Q;  3K81 C;  1C0A A;  1IXR A;  4JI8 Q;  1N34 L;  4P72 A;  1IBL Q;  3E9H A;  3TEH B;  1UE6 A;  5M3F G;  5FLX c;  5GAE C;  1M1K C;  2LSS A;  4YCU A;  2F3I A;  3HOX H;  2ZM6 L;  4DR1 L;  2JA5 H;  1A63 A;  1L1O C;  1IBL L;  1UE7 A;  1JT8 A;  1WI5 A;  4AYB E;  1Q8K A;  1VQL A;  4KHZ A;  4HIK A;  5DLQ E;  4QY7 A;  3J80 i;  4AIM A;  1VQO A;  4GOP B;  4L5T A;  3KLW A;  1FGU A;  1BKB A;  4YHH Q;  2MO0 A;  4MTN A;  4DR5 Q;  1E1T A;  3H0G H;  3K7A H;  4APV A;  5C44 H;  1LYL A;  3S16 H;  4A3B H;  4DV4 L;  4DR7 Q;  5IP9 G;  2NVQ H;  2PMZ E;  3AFQ A;  1P8L A;  3I7F A;  2I5L X;  2F52 A;  1J6Q A;  3ICE A;  3TS2 A;  1VQ9 A;  1Q46 A;  3CXC A;  4LF4 Q;  2KCT A;  1V1Q A;  4A3K G;  4OWT B;  5AJ3 L;  3CF5 A;  4IOA A;  4BXX H;  3AYH B;  4JBM A;  1FVI A;  4FDB A;  5JJI A;  4JBJ A;  1Q12 A;  2WAQ G;  1FL0 A;  3S1R H;  2BH8 A;  1MJE A;  1YVC A;  3L0O A;  4YCV A;  2UU9 Q;  2EXD A;  4IPH A;  1QVF A;  2Q2H A;  4LF7 L;  3UE1 A;  1JMC A;  3HOX G;  2UUA L;  3PO3 G;  2VNU D;  4B3M L;  1X55 A;  1YJ9 A;  3PF4 A;  1WYD A;  4GOP A;  2Y0S E;  1LTL A;  4DAM A;  4JI6 L;  4A93 G;  4LFC Q;  1VQG A;  2Q2T A;  1PH6 A;  4JI5 Q;  3SGI A;  4A3D H;  1VQ6 A;  2CFM A;  4YWK A;  3GTP H;  2IY5 B;  4DR6 L;  2YTV A;  3GTJ H;  4JV5 L;  1DGS A;  1SLJ A;  4A3L G;  1AE2 A;  2VZA A;  4DR3 Q;  1OXV A;  2UXC Q;  2UUC Q;  3J7Z C;  1HNZ Q;  3CCJ A;  1Y14 B;  3I2Z A;  3I56 A;  1B70 B;  2D0O A;  4A3D G;  1H95 A;  2JA7 H;  4OO1 I;  4GLX A;  4JI3 L;  2D62 A;  4JOI C;  2HT1 A;  2VY3 A;  4IPC A;  4XTC S;  1HNZ L;  2XTI A;  1S40 A;  1PVO A;  1FJG L;  3UDF A;  4O0A A;  3UDX A;  4ALP A;  4IFD G;  4C3H H;  3KJP A;  3J81 j;  4LNQ A;  1TWF H;  3MEF A;  1XNR Q;  4HJ7 A;  1N33 Q;  3ERS X;  1T9H A;  5IWA Q;  2JA7 G;  2VUM G;  3I4N H;  1XNQ L;  3PO2 G;  3PUZ A;  4EX5 A;  2N8N A;  2MNA A;  3AQQ A;  2NZH A;  1EUJ A;  3I4M H;  4JYA Q;  5BR8 Q;  1HR0 L;  5C4X H;  1CKN A;  3F2C A;  4R4C A;  1YIT A;  1PH2 A;  1NY4 A;  1PH4 A;  4PG3 A;  1EYG A;  3J80 c;  2A1A A;  1XMO L;  1GD7 A;  4JI2 Q;  5M5W H;  1Q7Y C;  4BY7 G;  2JQO A;  1KQS A;  1BVS A;  2CWA A;  1C9O A;  2NZO A;  2RHS B;  3KF6 B;  5IYC G;  4A3M G;  5C0X J;  2F4V L;  4L5R C;  2Y0S G;  3PCO B;  1JJC B;  4P75 A;  5HGQ A;  4DAY B;  1WOC A;  4BA2 I;  1UEB A;  4GNX C;  4NB3 A;  4UP8 A;  2KEN A;  4BY7 H;  2OWO A;  1GKH A;  4DV5 Q;  1Z47 A;  3RZD H;  1YJW A;  1G51 A;  1L0W A;  4DV4 Q;  1YZ6 A;  2HHH L;  4DR7 L;  5FLM H;  2JA8 G;  1N8R C;  3CCL A;  1JJ2 A;  4H02 A;  1VQC A;  3CP0 A;  2DUD A;  2YV5 A;  4JI1 L;  4RMF A;  4LFA Q;  2D0P A;  2WP8 J;  1W3S A;  5LMU L;  2GN5 A;  4DV1 Q;  4ME3 A;  1HR0 W;  4JC0 A;  4NXN Q;  2BH2 A;  3I4N G;  2VUM H;  4BXX G;  3CQZ H;  4LF9 L;  3MXN B;  4K0K Q;  2R92 H;  3B6Y A;  1IBK Q;  1NMF A;  1PH8 A;  5FJ8 G;  3J81 c;  3CPF A;  3H15 A;  4A3J H;  4DUY L;  4GKJ L;  4KLK A;  1UE5 A;  2K14 A;  2QGQ A;  2UUA Q;  1KXL A;  4HJ5 A;  4OX9 Q;  3HOY G;  1PH7 A;  2UUB L;  4OO1 G;  4LF7 Q;  1N32 Q;  2R7Z H;  4JG2 A;  3M4P A;  4OWW B;  3NEM A;  2MO1 A;  4DUZ L;  2UXB L;  1HZA A;  4WJ4 A;  4X6A H;  1KIX A;  2I5M X;  4DV7 L;  1K0R A;  1RL2 A;  4B3T Q;  3S1M H;  1L1O A;  4BY1 G;  4IOC A;  4WJ3 M;  2UXB Q;  2DGY A;  3PGZ A;  1U5K A;  4A3C G;  4A3L H;  1EFW A;  4RG1 A;  3UE0 A;  4PZ7 A;  1C7Y A;  4JI5 L;  1J5E Q;  4LUO A;  2IX0 A;  1JJG A;  1E1O A;  3U50 C;  4A3I H;  1GM5 A;  4IPG A;  5GAG C;  3CCS A;  5C4X G;  1TWC H;  3FP9 A;  1SMX A;  2B63 H;  3S17 H;  3PO3 H;  2R93 H;  2QA4 A;  2JA9 A;  2EQS A;  1LUZ A;  1QUQ A;  1PH9 A;  1YNX A;  3UDG A;  2RHQ B;  1I6H H;  3OTO L;  4PZ8 A;  3DM3 A;  5LMN W;  1IBM Q;  2ZJR A;  4JI7 L;  1ASZ A;  4R4I A;  4DK6 C;  2E2I H;  3HOY H;  5IYB G;  3A74 A;  3K8A A;  1SN8 A;  4MZ9 A;  4DR2 Q;  1CUK A;  1IYJ B;  5IP7 H;  1MKH A;  5M3M H;  4JI7 Q;  4X62 L;  1O7I A;  4JYA L;  1VQE A;  2CQO A;  3I4M G;  3T1Y L;  4DR2 L;  4BA1 I;  1N34 Q;  2I5H A;  2OQK A;  3D0F A;  1XPU A;  2WAQ E;  4DV3 Q;  2ALY B;  5IWA L;  3E0E A;  1A0I A;  2KBN A;  5IYC H;  1TWA H;  1IL2 A;  2YTX A;  4LWC A;  4GKK L;  2LXJ A;  4DR3 L;  2UXC L;  4JI0 L;  1Y1W H;  4LFB L;  3HKZ E;  1G6P A;  4JBW A;  1X54 A;  5IE8 A;  3F1Z A;  4LUV A;  1X9N A;  2JK8 A;  4C2M H;  2F4V Q;  2PI2 E;  1SE8 A;  5ELO A;  4B3S L;  1A62 A;  1V9P A;  1VQ4 A;  4LFB Q;  4HID A;  3KJO A;  1WJJ A;  2MQH A;  4IJH A;  3HOU G;  3NEN A;  1EQR A;  4TQU S;  4BBR G;  5C3E G;  1X3E A;  1UE1 A;  2QEX A;  1PH3 A;  3HOV G;  3H3V H;  5J3B A;  4P71 A;  3M7N A;  4O2D A;  4DV0 Q;  3JAM i;  3L7Z C;  4GOP C;  1HZB A;  1K8G A;  3GO5 A;  4DKA C;  4A93 H;  2AHO B;  3NBH B;  5GAH C;  4A3K H;  3WWV A;  5M5Y H;  3LGJ A;  3ULJ A;  4DV0 L;  4JI8 L;  2ES2 A;  1L2F A;  4HJ8 A;  3H3V I;  3EN2 A;  4DUY Q;  1YI2 A;  4LF9 Q;  2NVT H;  4GKJ Q;  5E7N A;  3PUX A;  4DK3 C;  1VCI A;  3FHW A;  5FLM G;  2BA0 A;  2JA8 H;  2JEB I;  5GAD C;  1VQM A;  1KRT A;  3PUY A;  3AEV A;  1YHA A;  4PZ6 A;  4JI6 Q;  3CAM A;  4X66 Q;  4IPD A;  3BZK A;  2AWO A;  3EIV A;  4POF A;  3AFP A;  2R92 G;  1HJP A;  2YTY A;  3E9I A;  5M3F H;  1V43 A;  3RN5 A;  4A3G G;  3PUW A;  1OXX K;  2K5V A;  2C35 B;  1I5F A;  3FKI G;  2RCN A;  2VQF Q;  5LMU Q;  3S1N H;  1Q81 C;  1IZ6 A;  1PH5 A;  2A8V A;  3KFU A;  2NN6 G;  5C44 G;  1K83 H;  1MIU A;  4YY3 L;  1VQ5 A;  3CC2 A;  5JEA G;  2N49 A;  3HKS A;  4YWM A;  3JC6 6;  3K80 C;  2HIX A;  4EQ5 A;  4A3E G;  3GTM H;  3M4Q A;  1AH9 A;  1IBM L;  1SRU A;  3TRZ A;  4L5S A;  2Q2I A;  1XJV A;  4LUZ A;  2UU9 L;  1N33 L;  1E22 A;  4GLV B;  2R7D A;  4NXM Q;  4JI4 Q;  3NEL A;  2AMC B;  4QL5 A;  2YU9 H;  5HY6 A;  2AWN A;  2KHI A;  3OYY A;  1M90 C;  1XNQ Q;  4GNX A;  1VS0 A;  4NXM L;  1NTG A;  4QJF A;  4C3J H;  1VQ8 A;  1QVC A;  4LF6 L;  1S72 A;  1I50 H;  1I3Q H;  2VS1 A;  1KD1 C;  4AQY Q;  1J5E L;  3PO2 H;  4A3G H;  3CCE A;  1X56 A;  3T1Y Q;  2I0Q A;  2UXD Q;  2L15 A;  3KF8 B;  2ATW A;  1EQQ A;  4A3B G;  3RLF A;  4JV5 Q;  4JI2 L;  1WCM H;  1PFS A;  1Q1E A;  4JI0 Q;  5IYB H;  3I55 A;  3U4Z A;  2OQ0 A;  1EIF A;  3RNU A;  2UXD L;  5IP7 G;  3GTK H;  3CMA A;  2HIV A;  3HOZ H;  3TRE A;  4A4I A;  5LMN Q;  3HOU H;  3CW2 C;  1Z9F A;  2E5L L;  3S2D H;  4B3S Q;  1D8L A;  1YIJ A;  1BBW A;  5GRO A;  4BBR H;  5C3E H;  1QVG A;  3G71 A;  3STB C;  1NMG A;  1SRO A;  4J15 A;  5EAY A;  1VQN A;  4DV2 Q;  3M9B A;  3RZO H;  4A3E H;  1X6O A;  3S15 H;  1YJN A;  3Q8D A;  3CC7 A;  2B63 G;  3M4O H;  1Y1V H;  4JI1 Q;  4DV2 L;  2B29 A;  4K0K L;  1IBK L;  2JA6 G;  1E24 A;  1Y1W G;  4LF4 L;  3BZC A;  1PH1 A;  2GVA A;  4A3C H;  1HH2 P;  2R7F A;  1EOV A;  3PIP A;  2CWP A;  1W2B A;  4Y52 H;  3TS0 A;  1CKM A;  1R9T H;  3K0X A;  4A76 A;  4A3J G;  2IHF A;  4R4T A;  4IFD I;  1OXT A;  2BA1 A;  1A8V A;  5FJ8 H;  3TQY A;  5ELN A;  5M3M G;  4GNX B;  4LF8 L;  1RIP A;  2B3G A;  4DUZ Q;  1KC8 C;  3CC4 A;  2WB1 G;  3G4S A;  3RR5 A;  2UUB Q;  2ID0 A;  3GTL H;  4OON A;  4GN5 A;  3HOZ G;  3F8T A;  2K4K A;  3I4O A;  3J7A 5;  5C4J H;  2ZJP A;  4UPA A;  4DV7 Q;  3RN2 A;  4DR4 L;  3H0G G;  1SR3 A;  1VQJ A;  1X3F A;  2A19 A;  1VQA A;  2ZTD A;  1OTC A;  1MJC A;  2K50 A;  1TWH H;  4A3M H;  2VQF L;  1XMQ L;  3M3Y H;  1NE3 A;  3S24 A;  4DPG A;  3CME A;  2FXQ A;  3OW2 A;  3G48 A;  2ZTC A;  4LFA L;  1WFQ A;  3IRB A;  1QZG A;  2ZTE A;  3CCU A;  1VQK A;  2N3S A;  2K75 A;  2VL6 A;  1K9M C;  3GTG H;  4A3I G;  2WFW A;  3ZJY C;  3KDF B;  3F2D A;  2JE6 I;  1VQD A;  1OXS C;  2OCE A;  3HOV H;  5JJK A;  3D31 A;  4POG A;  1PV4 A;  2CCZ A;  4UP9 A;  1S3O A;  4P73 A;  3J81 i;  3GTO H;  4KHP Q;  3T1H L;  2NN6 I;  1VQH A;  2E2J H;  4X66 L;  1XNR L;  4X64 Q;  4HJA A;  3G6E A;  4KI0 A;  2VW9 A;  4KHP L;  2Z6K A;  3T1H Q;  1OXU A;  1Q1B A;  1P16 A;  1U0L A;  2IHE A;  4AH6 A;  4JI4 L;  4UP7 A;  2JEA I;  4R4Q A;  2PI2 A;  2V1C C;  1PYS B; 
#chains in the Genus database with same CATH topology
 3ND9 A;  1WCM G;  1HZC A;  3QO2 A;  2EYL A;  4L6T B;  2RDG A;  3PF5 A;  3GDE A;  3S2H H;  1HNX Q;  2PNR C;  1QG7 A;  1R4Q B;  3BS1 A;  4FXG C;  1MBY A;  4QQB X;  5IYD G;  3CCQ A;  4ZUJ A;  1CQF A;  1Y1V G;  1YEZ A;  3H6M A;  1KDB A;  2HHH Q;  3M85 A;  5F2D A;  2K5N A;  1GO3 E;  2BOS A;  2E75 C;  2JP1 A;  3A5Z B;  3OIQ A;  1G29 1;  1VF7 A;  2R7Z G;  2Z1C A;  4DV3 L;  2EYH A;  1ICW A;  4K5W A;  1EY9 A;  4K8J A;  1IKL A;  3RMH A;  3GTJ B;  4JOI A;  3EBE A;  5M5X H;  1NR2 A;  3ER0 A;  1E2W A;  4E6I A;  5FLX L;  1N32 L;  1WTQ A;  3FDT A;  1WTW A;  4GN4 B;  1N36 Q;  5T1G A;  4DR5 L;  1CZG A;  4FVM A;  3NWT A;  4CJ2 C;  3U58 A;  1ET6 A;  4DV1 L;  3HOW H;  2ZT9 C;  2ZXO A;  3HP3 A;  3S2D B;  3K7A B;  1HNW L;  2XVS A;  1KL9 A;  4OXP A;  2H4O A;  1AE3 A;  5K36 G;  3J81 L;  1VQF A;  3RLN A;  3S1Q H;  2FHT A;  5CC4 A;  2ICE C;  1SE3 A;  1JOO A;  2KCN A;  2IW3 A;  1WTV A;  4BY1 H;  3BJU A;  2V4D A;  3TBI B;  1NJI C;  1K3R A;  2R6G A;  2K5D A;  1AZQ A;  3KLR A;  4HR7 B;  5IYD H;  2H1E A;  1TR5 A;  5C0X G;  5L37 A;  3R2T A;  3PUV A;  1K28 A;  4JI3 Q;  4K8I A;  3MWY W;  3AMU A;  4JBK A;  3NBI A;  3KF6 A;  1EOT A;  1Q86 C;  1FJG Q;  2IWH A;  1KDC A;  2K04 A;  3IFT A;  2NZ1 D;  5CV4 A;  2CW0 D;  4LF8 Q;  1S5E D;  1QIL A;  3I8Z A;  5M3F G;  2LSS A;  4RKL A;  2N55 A;  1IBL L;  1WI5 A;  4AYB E;  1Q8K A;  1O78 A;  3QB3 A;  4FYD A;  2K7V A;  1VQO A;  4GOP B;  1FGU A;  3A7A B;  1BKB A;  1MGS A;  2MO0 A;  5KNB A;  2RVL A;  2E2I B;  3S1M B;  5IP9 G;  3L3O C;  4HCE A;  3AFQ A;  2EE1 A;  1XXG A;  2F52 A;  5EQ0 A;  3DMU A;  1V1Q A;  5AJ3 L;  4IOA A;  5DAU A;  1IYV A;  3X3N A;  5C5M A;  2OF1 A;  4XYQ A;  4JPB W;  4FDB A;  3RD4 A;  5IOD A;  1MJE A;  4X3T A;  4IZ8 A;  4IPH A;  3NTK A;  1JMC A;  4K6D A;  3NTI A;  1E2Z A;  4N8X 1;  3PF4 A;  2B2U C;  1WYD A;  5IOC A;  4RGM A;  1L0X B;  4JI5 Q;  1BCP D;  5CBA E;  4Y7N B;  4YWK A;  1DGS A;  1ONL A;  2CHB D;  1HNZ Q;  1B70 B;  2JA7 H;  4OO1 I;  2XWB B;  3S2H B;  4JOI C;  2HT1 A;  1FJG L;  2OT2 A;  4LK1 C;  1K0S A;  4IFD G;  2L9H A;  4LNQ A;  1XNR Q;  1F9S A;  5AFW A;  2JA7 G;  2Z6B A;  3I4N H;  2NVY B;  2N8N A;  2BDN A;  3NQI A;  3JAM L;  1EUJ A;  4JYA Q;  4XQJ A;  5FK9 C;  1EYG A;  1NY4 A;  4PG3 A;  4JI2 Q;  4BY7 G;  2PZW A;  1STG A;  5IYC G;  3KF6 B;  4MN3 A;  4L5R C;  1KNA A;  2PCF B;  4DAY B;  1QE6 A;  4BY7 H;  4XDX A;  2OWO A;  1D1I A;  1G51 A;  5J22 A;  3OWE B;  2HHH L;  2FFK B;  2JA8 G;  2KED A;  1AW7 A;  4H02 A;  4RMF A;  5LMU L;  2WP8 J;  1HR0 W;  4ME3 A;  3MXN B;  4K0K Q;  2PZU A;  1PH8 A;  4XQQ A;  4DUY L;  1UE5 A;  4RGO S;  4ZAI A;  2SNS A;  1CM9 A;  3HOY G;  2F0L A;  4F87 A;  1BBX C;  4LF7 Q;  1N32 Q;  4DK1 A;  4OWW B;  2B2U A;  4DUZ L;  2UXB L;  2A69 C;  1KIX A;  2I5M X;  2XRS D;  4BY1 G;  1BR9 A;  4A3L H;  1J5E Q;  1STN A;  1JJG A;  1GM5 A;  4JW0 A;  3C46 A;  4HAE A;  3HOX B;  1SNP A;  3GTO B;  5C0X H;  3S17 H;  3J80 E;  2EDG A;  2R93 H;  2JA9 A;  2RA4 A;  4CHT B;  2F0N A;  2EQS A;  3DWP A;  1YNX A;  2RHQ B;  3R3O A;  5LMN W;  2K01 A;  1MSG A;  4LAA A;  4KKS A;  5IGD A;  2ZJR A;  4S3S A;  4MIU A;  3K8A A;  1JIC A;  3A8I E;  1SFO B;  1RTO A;  1MKH A;  2L4N A;  4X62 L;  1K83 B;  4Q5V A;  4JYA L;  3I4M G;  1I4G A;  1JWM D;  2I5H A;  4A3D B;  2M2L A;  4IAL A;  3DXJ C;  2YTX A;  2UXC L;  4JI0 L;  1G6P A;  1SE4 A;  2R3Z A;  3F1Z A;  5IE8 A;  4C2M H;  2PI2 E;  4B3S L;  1I50 B;  1A62 A;  1SNC A;  1CFM A;  3OOC A;  1Y8P B;  3HOU G;  1I4P A;  1QNU A;  5ISR A;  5C3E G;  3MFG A;  3TZD A;  3H3V H;  4P71 A;  1IL8 A;  3SK5 A;  1SAP A;  4GOP C;  3GTP B;  4J1M A;  1EFI D;  4A93 H;  2Q8R E;  5GAH C;  2G9D A;  3WWV A;  1DOM A;  2CW0 C;  3LGJ A;  4KJO A;  3H3V I;  3EN2 A;  3I91 A;  1YI2 A;  3GTG B;  4GKJ Q;  1FNU A;  2L12 A;  4H44 C;  4N8F A;  4DK3 C;  1VCI A;  2L0C A;  3F2U A;  1WTH A;  3M4O B;  2RKS A;  5EKK A;  2JEB I;  1KRT A;  2XSC A;  4PZ6 A;  1TVX A;  4IPD A;  3I3C A;  2AWO A;  1GHK A;  3FRP B;  1WD1 A;  2F0J A;  2YTY A;  1V43 A;  4A3G G;  5I9P A;  1OXX K;  2K5V A;  5IT9 L;  2EJM A;  2RCN A;  1Z7T A;  3S1N H;  3NK9 A;  1PXU A;  3QIA A;  1B3A A;  2B8F A;  5C44 G;  1B2T A;  1K83 H;  1MIU A;  1AFP A;  2N49 A;  3HKS A;  2Z8L A;  4EQ5 A;  4A3E G;  3M4Q A;  3MXU A;  1I6V C;  2E76 C;  5K36 H;  1RJT A;  1IBM L;  1JB3 A;  2L1B A;  4K14 A;  5FO8 B;  5IIF A;  2R7D A;  1JWS D;  3MHB A;  3PIP 3;  4JI4 Q;  4QL5 A;  2AMC B;  4XT1 B;  1XNQ Q;  3D4R A;  4F8M A;  3NTH A;  4NXM L;  1NUC A;  4QJF A;  1VQ8 A;  1V8Q A;  1FNV A;  1I50 H;  1I3Q H;  2FJ2 A;  4LF6 L;  1SYC A;  3DM1 A;  3PO2 H;  3VR6 A;  3CCE A;  3S17 B;  1FR3 A;  1DM0 B;  5KNC A;  1U4R A;  2OQ0 A;  5A35 A;  1EQV A;  3GTK H;  2R7Z B;  4A4I A;  5LMN Q;  1A15 A;  3DHQ A;  1G2S A;  2E5L L;  3L9A X;  3TDQ A;  1YIJ A;  5GRO A;  1RCV D;  4BBR H;  1T5E A;  4I7Z C;  3G71 A;  4ZCK A;  1SRO A;  2JYO A;  4PNY A;  1EWC A;  5CBE E;  2Z9H A;  2F0E A;  2FMC A;  3CC7 A;  2B63 G;  2WAQ B;  1J8I A;  1TY2 A;  3M4O H;  2JA6 G;  1Y1W G;  2F0U A;  1EOV A;  5M9O A;  1CKM A;  1R9T H;  3K0X A;  4R4T A;  5KYI A;  2B3G A;  4FF1 A;  2UUB Q;  4K5V A;  3IL8 A;  3GTL H;  2KEC A;  3HOZ G;  3S1Q B;  5IGF A;  1GUO A;  2K4K A;  3I4O A;  3J7A 5;  1QJO A;  3GQB A;  4UPA A;  4DR4 L;  5JOB A;  3TP5 A;  1VQA A;  4OIJ A;  3LWE A;  3T4A C;  2K50 A;  3MVV A;  4A3M H;  2MUY A;  2QDL A;  2Y0S B;  3CCU A;  3T51 B;  4G7H C;  2A6H D;  1QB5 D;  3GTG H;  5IGC A;  1VQD A;  2OCE A;  5EPJ A;  4KN4 C;  4P73 A;  3J81 i;  4KHP Q;  2NN6 I;  1VQH A;  4CJ0 B;  2IX3 A;  2F0D A;  4X66 L;  2PO4 A;  2Z6K A;  1Q1B A;  1U0L A;  4AH6 A;  4JI4 L;  4ZKC B;  1STE A;  4RAU C;  4G57 A;  4K5X A;  4R4Q A;  4RA8 A;  3H91 A;  4IUV A;  2QF7 A;  1SFO H;  2PNH A;  1XPO A;  3WOE A;  4QIW E;  4XYO A;  2IJ0 A;  4L5Q A;  1HXY D;  1Q82 C;  1YBY A;  1TKW B;  3A5U A;  1W6K A;  5LMN L;  4PMW A;  1LTI D;  4K2K A;  4U67 3;  4LMQ D;  5M3F B;  5C4X B;  1VQ7 A;  4DV6 Q;  1BBU A;  1CQV A;  3PV0 A;  1PTO D;  3CCM A;  4B9X A;  1HPC A;  1A6X A;  3J7A V;  1NCV A;  3D6W A;  3OMC A;  3CCR A;  3DEO A;  3P1H A;  4X65 Q;  1YHB A;  1EEI D;  2L5T A;  4C3J G;  1VMP A;  2H5X A;  1VQP A;  1YHQ A;  2K28 A;  2N88 A;  4LJZ C;  5EGT A;  1K8A C;  2JJQ A;  5DM6 3;  1CT1 D;  4V0B A;  4YHH L;  1XMQ Q;  3U4V A;  2IX1 A;  2O5I C;  1EY4 A;  2Z0S A;  1G91 A;  1LTG D;  4I7A A;  1ESR A;  4XIG S;  3KOJ A;  1E3P A;  1UWV A;  3W1B A;  2GVB A;  2MGS A;  4ME5 A;  4ZKB B;  3H3V C;  3H0G B;  3OSO A;  1SXT A;  4DNI A;  4YWL A;  1EIY B;  4FXD A;  5JEA J;  5FO9 B;  4IO9 A;  3RUZ A;  1XPR A;  1YNJ C;  2MFI A;  1X3G A;  5CR3 A;  1NBW A;  4UDU C;  5E4W C;  1JB7 A;  5IT9 c;  1TWF B;  1QOH A;  1D7Q A;  4B3T L;  5CGK A;  1B50 A;  1AZP A;  1N9W A;  3OW7 A;  1PYB A;  3KDF A;  1BOS A;  2M9V A;  4DF7 A;  1HRJ A;  5JPN C;  3HOV B;  4ZQ3 A;  3BZD B;  3BVM A;  5IP9 H;  5A2Q E;  2F1M A;  1Y69 U;  1CA5 A;  4BY7 B;  5CV7 A;  4HIO A;  1BXT A;  2KVM A;  3PSI A;  4WFN 3;  3AB9 A;  1PA6 A;  3JAM E;  4P74 A;  3K7U C;  1NNX A;  2VQE Q;  4LF6 Q;  2X6L A;  1ASY A;  4BBS H;  2MHV A;  4C3I G;  3CRL C;  4CDC C;  1N34 L;  3TEH B;  5FLX c;  1M1K C;  2VB3 X;  3P20 A;  1RF2 D;  4PV1 C;  4HIK A;  3J80 i;  3NQT A;  1R9T B;  4ILW A;  4K2L A;  4C3H G;  4YHH Q;  1PRT D;  1GXD C;  4KV6 A;  4MTN A;  1E1T A;  3K7A H;  4APV A;  5C44 H;  4A3B H;  4HMI A;  2NVQ H;  1P8L A;  1J6Q A;  1Q46 A;  4A3K G;  2DJF C;  3CF5 A;  4BXX H;  1EY6 A;  3AYH B;  4JBM A;  1EIG A;  4YIJ A;  5JJI A;  3S1R H;  4DXG A;  3L0O A;  4YCV A;  2KCC A;  1PRT C;  2EXD A;  1QVF A;  4LF7 L;  3HOX G;  3PO3 G;  1NR4 A;  3CQZ B;  4B3M L;  2VNU D;  2A5H A;  5CV8 A;  1JOR A;  4JI6 L;  1LTL A;  1SYB A;  4LFC Q;  4RCO A;  1EY7 A;  1VQG A;  2Z4H A;  2Q2T A;  1JOQ A;  4IUU A;  2X6G A;  3SGI A;  1DOL A;  1EU4 A;  4A3D H;  3EA6 A;  3WDN A;  3GTJ H;  1G8Z D;  2VZA A;  4DR3 Q;  1OXV A;  5G3L D;  1H9R A;  4A3D G;  4GLX A;  2D62 A;  2IPK D;  4XTC S;  3FEW X;  3O13 A;  4CDF C;  3TP6 A;  3UDF A;  5BN3 A;  1UUP A;  4N9P A;  1VF5 C;  1TWF H;  4OEL B;  1N33 Q;  3ERS X;  5IWA Q;  2VUM G;  3BDC A;  3HRZ C;  4ZRZ A;  3PO2 G;  2PZT A;  1BDO A;  3CU7 A;  3AQQ A;  2NZH A;  4N9T A;  2JXM B;  1CKN A;  4L8J A;  3F2C A;  3SE0 A;  1PH2 A;  1PH4 A;  2XWJ B;  5C3E B;  1DD2 A;  1MHW C;  2A1A A;  1XMO L;  1Q7Y C;  3T16 A;  3EVQ A;  2NBF A;  5C0X J;  2A73 B;  1JJC B;  1Q8I A;  4JVZ A;  1WOC A;  1B53 A;  4MHE A;  3GTM B;  2DNE A;  2Z4I A;  1Z47 A;  4DV4 Q;  1YZ6 A;  4DR7 L;  1F2Z A;  2WKC A;  3BDO A;  5FLM H;  1IYU A;  1VQC A;  2WV6 D;  3CP0 A;  2O5J C;  1H9K A;  4A3F B;  4LFA Q;  4KMU C;  2BH2 A;  4NXN Q;  4DV1 Q;  3MC0 B;  4JC0 A;  3CQZ H;  1MSH A;  3B6Y A;  2XIW A;  4B08 A;  1K8O A;  3ND8 A;  3P75 A;  4GKJ L;  4KLK A;  3K57 A;  1PH7 A;  3CKI B;  1GUG A;  4JG2 A;  3M4P A;  3NEM A;  2MO1 A;  1Q90 A;  3M3Y B;  1HZA A;  5C44 B;  4WJ4 A;  3HG9 A;  4DV7 L;  1K0R A;  1RL2 A;  3SDZ A;  5IT9 E;  5EJW A;  2BE5 D;  2TSS A;  2NVQ B;  1L1O A;  3PGZ A;  4A3E B;  1I6H B;  4A3C G;  1EFW A;  4PZ7 A;  5G3L F;  4IUP A;  1E2V A;  1Y1V B;  2A69 D;  4LUO A;  4CKC A;  5KND A;  1E1O A;  3U50 C;  2B2W A;  4IPG A;  2SOB A;  1UEA B;  3FP9 A;  2F3V A;  3MXP A;  1SMX A;  1MI2 A;  2QA4 A;  4QMG A;  1R4P B;  1QUQ A;  3UDG A;  1PFB A;  4J8Q A;  1PTO F;  3TP8 A;  1PLF A;  3DM3 A;  1IBM Q;  1I4H A;  4R4I A;  1X32 A;  2E2I H;  3DWA A;  1HQM C;  3A74 A;  4DR2 Q;  1CUK A;  2K05 A;  5IP7 H;  2B2Y A;  4JI7 Q;  4DN4 M;  2QCP X;  1U4L A;  4BWG B;  1S5C D;  5KIX A;  2RDF A;  5IWA L;  2RBM A;  2G5D A;  2FIN B;  3E0E A;  2NVX B;  5ELE A;  4GKK L;  2ENB A;  4LFB L;  1X54 A;  4LUV A;  3HZX A;  2F4I A;  1LAB A;  2ICI A;  3KJO A;  1JWU D;  4IJH A;  2F0S A;  3TSS A;  3E6Z X;  1HCZ A;  1X3E A;  1UE1 A;  1D5M C;  3HGB A;  5J3B A;  4DAY A;  2E2D C;  4O2D A;  4DV0 Q;  1HZB A;  4DKA C;  1F9P A;  1D2B A;  5M5Y H;  4CDE C;  4OIK A;  1L2F A;  2NVT H;  5E7N A;  2CH4 W;  1SNO A;  5ELD A;  5GAD C;  3PUY A;  3CAM A;  1XTC D;  4POF A;  4KN7 C;  2R92 G;  4IN3 A;  3RN5 A;  1IHZ A;  1Q81 C;  3VYS A;  3BG3 A;  2HCI A;  2A8V A;  4OGQ C;  5CV5 A;  1LO5 D;  3A7L A;  1PFM A;  3FPU B;  3CC2 A;  1HUM A;  5FO7 B;  4RHS A;  4WRD A;  3JC6 6;  2HIX A;  1AEX A;  1SRU A;  4LUZ A;  2ZXP A;  2P5Z X;  2K33 A;  1SEB D;  3OYY A;  2EY2 A;  1VS0 A;  2EYP A;  3D8G A;  2K5W A;  2D9U A;  5EBC A;  3G7L A;  1FNW A;  2VS1 A;  4C56 C;  4A3G H;  4Q0F A;  1EYA A;  2I0Q A;  2UXD Q;  2L15 A;  4A3B G;  1GUS A;  4JI2 L;  1WTX A;  5A2Q L;  1F2L A;  3RNU A;  1UNS A;  2L55 A;  4IUQ A;  5IP7 G;  1V1O A;  3HOU H;  4A93 B;  3QOJ A;  3BVG A;  5BN4 A;  2EPB A;  2X69 A;  3ITP A;  3STB C;  1IW7 C;  1VQN A;  4DV2 Q;  4FNF A;  3S15 H;  1PMR A;  4NW2 A;  1SNQ A;  1ZYR D;  2NB0 A;  4RH6 A;  2B29 A;  2K5Q A;  3KF8 A;  1IBK L;  1VMC A;  4LF4 L;  1KTK A;  5JJZ A;  1HH2 P;  2R7F A;  1W2B A;  2CWP A;  1EYD A;  4A76 A;  4LF8 L;  1TS4 A;  4RWS C;  1E0B A;  1RIP A;  4X3U A;  4G4K A;  3CC4 A;  3G4S A;  1EYC A;  3W2D A;  1SYD A;  4DFA A;  2GA4 B;  2ZJP A;  3H0G G;  1X3F A;  4TRD A;  1O7L A;  1SNM A;  4QUC A;  1XMQ L;  3M3Y H;  1NE3 A;  4DPG A;  4RGN A;  3OW2 A;  2FXQ A;  2F0G A;  3G48 A;  3TZU A;  4LFA L;  1TU2 B;  3CRK C;  1VQK A;  1AN8 A;  2OXP A;  1HA6 A;  1PTO C;  3KDF B;  2SEB D;  3F2D A;  1C8C A;  1OXS C;  3HOV H;  1LTT D;  4PQX A;  3D31 A;  1K3B C;  1TS3 A;  1S3O A;  3GTO H;  2K32 A;  5LL6 X;  3G6E A;  1C4Q A;  3T1H Q;  1P16 A;  4FP5 D;  1PYS B;  5D14 A;  1CSQ A;  1BCP F;  2EJG C;  2K6A A;  3C2P A;  3ULL A;  2XGT A;  4FF2 A;  1QZH A;  3SK4 A;  4Z9C B;  4YY3 Q;  2KHJ A;  1HNX L;  3A0J A;  4EGV A;  4BBS G;  2KOL A;  2B2Y C;  2Q2U A;  1LM0 A;  2LXK A;  4C3I B;  2PYK A;  1VQI A;  2F0F A;  1VQB A;  2A68 C;  4HN7 A;  4AYB G;  3VYT A;  4KD4 A;  2WIN B;  3AU7 A;  3E5S A;  1J9O A;  4IFD J;  4KY5 A;  5AJ3 Q;  2PQA B;  3ULP A;  4AQY L;  1SYE A;  1V1P B;  2Z6K C;  3FKI H;  1XTD A;  4HSP A;  3QG1 A;  3GTQ H;  4QF4 A;  4HCS A;  2QEJ C;  4GKK Q;  4NKL A;  2EJF C;  1B7Y B;  1N36 L;  3M7G A;  2FMM A;  3GD7 A;  3DWQ A;  5IY0 A;  3R93 A;  5I4D A;  1PYW D;  1QUQ B;  5E4X A;  1CSP A;  4DV5 L;  3NHH A;  4FF4 A;  3DEP A;  4ULL A;  1PHJ A;  5IGG A;  2ASB A;  2WB1 E;  1ZYR C;  4LW1 A;  3DLL A;  4EVO A;  4IUR A;  3IAY A;  1RKN A;  3HKZ G;  5J1Z A;  2J4X A;  3A56 A;  1H9S A;  4GN3 B;  3STB D;  4MNO A;  2JA5 G;  1S4Z A;  3QR8 A;  4ZK9 B;  3MAQ A;  2J7Z A;  1DCZ A;  1II3 A;  1TQO A;  2KEE A;  4ZYS A;  4OX9 L;  3G6J B;  4PMB A;  1HNW Q;  1SMY C;  5H1S E;  1QWY A;  4IUT A;  2VXW A;  2XN9 C;  4A3I B;  5JJL A;  1PTO H;  4DU9 A;  2KCM A;  2EXZ A;  3I73 A;  4R8I A;  1A2U A;  2LY7 A;  2DY8 A;  1TXY A;  1GVP A;  4LFC L;  4C3I H;  2OTL A;  4EQP A;  2LFN A;  2O4X A;  3BU2 A;  3KYH C;  2F0V A;  2RQX A;  4WOR A;  2RDH A;  3PO2 B;  4OWX B;  3RLO A;  3U9S A;  2E5L Q;  4R8N A;  1EWI A;  2XRQ D;  2DN8 A;  1TII D;  2UUC L;  3FKI B;  5KGU A;  3MEH A;  3JAM c;  2KA7 A;  4LF5 L;  3PIO A;  4A75 A;  1KDA A;  2J0T D;  1KAW A;  1SND A;  3HEJ A;  2K52 A;  4NPS A;  2JA6 H;  4X62 Q;  2DNC A;  5EKI A;  2G9H D;  4DAV A;  1XX8 A;  3W5O A;  1S5B D;  2IT1 A;  2KUM A;  3K81 C;  4JI8 Q;  1IBL Q;  4P72 A;  1LTS D;  5CV6 A;  3E9H A;  1UE6 A;  3V05 A;  4CKE A;  2JA5 H;  1LV9 A;  1AP0 A;  1VQL A;  2DJG C;  5DLQ E;  1H9J A;  4QY7 A;  2F0M A;  1DYQ A;  5COR A;  2EY6 A;  3H0G H;  2D2C C;  3S16 H;  5C3X A;  4DV4 L;  4DR7 Q;  4C1N I;  3I7F A;  2I5L X;  3TS2 A;  1FD7 D;  1H9M A;  1I6H H;  4Y52 H;  3CXC A;  4LF4 Q;  2NUC A;  4OWT B;  1YNN C;  2NWG A;  1TS5 A;  4O1N A;  5BN5 A;  2A6E C;  2PW7 A;  1GJX A;  2QDB A;  4RCN A;  3RZD B;  1HFG A;  4JBJ A;  3R8B A;  2F0W A;  2BH8 A;  1F9R A;  5DEH A;  4NDX A;  3UE1 A;  3Q23 A;  5JAV A;  1FYC A;  1ENC A;  3E0J A;  4IUN A;  1YJ9 A;  2B2V C;  3C1F A;  1LTA D;  2Y0S E;  3MZ5 A;  5M3M B;  4KJN A;  1PH6 A;  2WB1 B;  3MTS A;  3GTP H;  3A8J E;  1AE2 A;  2UXC Q;  4TKO B;  2UUC Q;  5EPK A;  3J7Z C;  5E1F A;  2JA6 B;  4OO1 H;  3I2Z A;  1O7Z A;  1Y1W B;  1H95 A;  2MPM A;  1PVO A;  4IPC A;  1HNZ L;  2C5C A;  1S40 A;  2O2L D;  4O0A A;  4C3H H;  1BCP B;  3J81 j;  3MEF A;  3NWS A;  4HJ7 A;  1OO9 B;  1GUN A;  1XNQ L;  3PUZ A;  3HOZ B;  4EQN A;  5HGT A;  1SMY D;  5C4X H;  1YNJ D;  3I70 A;  1SDF A;  1YIT A;  4CJ1 B;  5M5Y B;  1GD7 A;  5M5W H;  3A54 A;  1BVS A;  2CWA A;  2RHS B;  4A3M G;  4FF3 A;  1DZ1 A;  1HTL D;  2Y0S G;  5HGQ A;  3C1E A;  3J80 L;  1S5F D;  4BA2 I;  1UEB A;  4GNX C;  4NB3 A;  3N52 A;  1YJW A;  1L0W A;  4GZY C;  5ELF A;  4IFD H;  1EY0 A;  1N8R C;  3CCL A;  2EYM A;  1JJ2 A;  4K6L A;  2YV5 A;  4JI1 L;  3KBX A;  2D0P A;  1F77 A;  2GN5 A;  1XYI A;  3I4N G;  4LF9 L;  2R92 H;  1O7Y A;  3H15 A;  2QGQ A;  3BVZ A;  2K1B A;  1RD9 D;  1KXL A;  2Q8I B;  3Q0A A;  4KHV A;  4OO1 G;  2R7Z H;  1TS2 A;  4X6A H;  2AQ3 B;  3KLS X;  4HSV A;  1KNE A;  5TSS A;  4DNT B;  2LMC B;  1G6Z A;  2UXB Q;  2DGY A;  3SK6 A;  2CVR A;  1U5K A;  2EY5 A;  1D1K A;  3BYY B;  4KKT A;  3CHB D;  4A3I H;  2EYF A;  5GAG C;  3CCS A;  5C4X G;  4C1N K;  1TWC H;  2B63 H;  1JQY D;  1U4P A;  1PRT F;  1LUZ A;  1ASZ A;  4A3B B;  3T56 B;  1SN8 A;  4MZ9 A;  4OHJ A;  1IYJ B;  1B44 D;  1S5D D;  5M3M H;  5C4J B;  1O7I A;  2CQO A;  4BA1 I;  2OQK A;  2WAQ E;  5DNF A;  2ALY B;  2K03 A;  1ENA A;  1A0I A;  2KBN A;  5IYC H;  3KBG A;  3U9O A;  3MXN A;  3MFY A;  4LWC A;  2YU9 B;  2LXJ A;  2RCF A;  3ONA B;  2AQ2 B;  3Q6S A;  1Y1W H;  3HS0 C;  2F4V Q;  3NUC A;  1WTR A;  2A6E D;  2HD3 A;  1V9P A;  1DON A;  4HID A;  2I46 A;  3NEN A;  1EQR A;  4TQU S;  4BBR G;  2ZXR A;  1PH3 A;  4HED A;  5DM7 3;  5C4H A;  1VDZ A;  3GO5 A;  2AHO B;  3NBH B;  4A3K H;  4KY7 A;  3K5L A;  3ULJ A;  3H09 A;  4JI8 L;  2ES2 A;  2PW5 A;  4LF9 Q;  1HQR D;  1EEF D;  1O80 A;  2QIL A;  2JA8 H;  1YHA A;  1A3T A;  1RDP D;  1JC7 A;  4X66 Q;  3BZK A;  3PUW A;  2WII B;  5LMU Q;  1IZ6 A;  2NN6 G;  4YWM A;  3GTM H;  1AH9 A;  1X3P A;  5LL6 S;  1BF4 A;  4L5S A;  2Q2I A;  1XJV A;  5COY A;  4V19 0;  1E22 A;  4NXM Q;  3NEL A;  1M90 C;  2AWN A;  2KHI A;  3T13 A;  2RSN A;  3SR1 A;  4GNX A;  4O42 A;  1JE4 A;  1NSN S;  1NTG A;  4C3J H;  3T53 B;  3URY A;  1QVC A;  5C4Z A;  2EYO A;  5IGB A;  3LWU A;  1J5E L;  2LKV A;  4C3H B;  3VYR A;  5D65 A;  1D6E C;  1EQQ A;  2ATW A;  3RLF A;  1CI3 M;  1WCM H;  1PFS A;  1Q1E A;  2SDF A;  1PZK D;  5IYB H;  3U4Z A;  3K0Y A;  1EQT A;  3ERQ A;  1JR0 D;  4M8A A;  1F2Y A;  2HIV A;  3S2D H;  1Z9F A;  3K5N A;  2Q8T A;  2BDO A;  4A3K B;  1D8L A;  4KTA A;  1BBW A;  1QVG A;  5C3E H;  2B2W C;  5EBD A;  1NMG A;  4F7X A;  1BCP C;  4A3E H;  3D4W A;  3DUZ A;  2F0P A;  1YJN A;  3Q8D A;  3BYT B;  1SJE D;  1G2T A;  1Y1V H;  4K0K L;  1E24 A;  2QKI C;  3EQL C;  2GVA A;  1PH1 A;  3J7A F;  4A3C H;  1STH A;  1F9Q A;  1ICF B;  3TS0 A;  1SYF A;  4A3J G;  4DGZ A;  2D5D A;  3KK7 A;  5KRU A;  3Q24 A;  4IFD I;  1A8V A;  5FJ8 H;  3TQY A;  5I2Y A;  3R2I A;  5CYU A;  4DUZ Q;  2CQA A;  1KC8 C;  1I4Q A;  3RR5 A;  3M4Y A;  2ID0 A;  2PQE A;  4OON A;  2A68 D;  3F8T A;  2C9O A;  4DV7 Q;  3RN2 A;  4ABN A;  5I9O A;  1SR3 A;  1EZ8 A;  2A19 A;  4R9W A;  2ZTD A;  5JPM C;  1JCK B;  1OTC A;  1LTB D;  2VQF L;  3S24 A;  3CME A;  2AUJ D;  2ZTC A;  5M5X B;  1WFQ A;  2ZTE A;  2N3S A;  5FOB B;  5K5P A;  2VL6 A;  3SXH A;  1K9M C;  1HA5 A;  4A3I G;  3ZJY C;  3NBH A;  2JE6 I;  3C3L A;  2JA8 B;  5JJK A;  1NAP A;  4POG A;  4UP9 A;  3I90 A;  5C6A A;  3V96 A;  3X3M A;  2KJX A;  3E3X A;  4HJA A;  3N6R A;  4KHP L;  1OXU A;  4DNR B;  1W6J A;  2IHE A;  4UP7 A;  1T5X D;  2WAC A;  2PI2 A;  1PFN A;  1EIF A;  1CK1 A;  2V1C C;  4G7O C;  4UY8 C;  4B3R L;  2E8G A;  2OTJ A;  2NVT B;  4M1U B;  3W1G A;  4ZLT F;  4QIW B;  4A3F G;  4MTK A;  4P2C B;  4IJL A;  3A55 A;  2B8G A;  2NVX H;  1YNN D;  4DV6 L;  4R4O A;  4GS3 A;  4GLA C;  1K73 C;  2RSO A;  1I94 Q;  2SNM A;  2R61 A;  3OPO A;  3GP7 A;  2B2T A;  1JE5 A;  4LF5 Q;  2R93 G;  3F2B A;  3S16 B;  3CCV A;  1TWG H;  2EOT A;  4X65 L;  3L2P A;  5CMD A;  1SE2 A;  2EY1 A;  2ZJQ A;  3GV3 A;  4DR1 Q;  2PQA A;  5KYL A;  4R1J A;  3QWN A;  2K5H A;  1ZKO A;  3S9W A;  2ZM6 Q;  1L1O B;  2TMP A;  3CD6 A;  4B3M Q;  5C0X I;  2CKZ B;  3S14 H;  2MP1 A;  2AKW B;  2E2H H;  2HUG A;  2YYZ A;  3UDI A;  3ERO A;  2EIF A;  5E3F A;  5GQO A;  3D6C A;  3Q22 A;  1STA A;  2NVY H;  2RF4 A;  2HDM A;  3FMC A;  2HQE A;  1I4X A;  5JEA H;  3HOU B;  3CPW A;  1WD0 A;  3J81 E;  1QCB D;  2NTS A;  3KUP A;  1TT2 A;  1KRS A;  2N78 A;  4HMJ A;  1F2M A;  4PMC A;  3OTO Q;  4XT3 B;  3D3R A;  2F0T A;  4X64 L;  4DR4 Q;  5CV9 A;  4QB4 A;  3NPP A;  1U4M A;  1XWE A;  3HFZ B;  1HZ9 A;  4B3R Q;  1SSO A;  1B8A A;  4L63 B;  3PMF A;  1QNK A;  4IQZ A;  1ML0 D;  2L11 A;  1E7Z A;  4HJ9 A;  4A3F H;  4H0L C;  3NE5 B;  1XMO Q;  1CKN B;  3HOW G;  5FLX E;  2HQL A;  3UI2 A;  4DR6 Q;  1PZI D;  4A3G B;  3VDY A;  2BE5 C;  4TVA B;  4DK0 A;  1CKO A;  1BQQ T;  1WCM B;  3GTQ B;  2VB2 X;  4Y7N H;  2VQE L;  4YCW A;  4TSS A;  4HIM A;  4A3M B;  1X65 A;  2F0K A;  4OEM B;  3VR2 A;  5BR8 L;  1KHI A;  1I94 L;  1HR0 Q;  3PIO 3;  3V2T A;  4NXN L;  3NP8 A;  4QGU A;  1CA6 A;  4JCV E;  3TP7 A;  3S15 B;  1C0A A;  1IXR A;  3NSW A;  2R92 B;  5GAE C;  2ZM6 L;  4YCU A;  2F3I A;  3HOX H;  4DR1 L;  1A63 A;  1L1O C;  1UE7 A;  1JT8 A;  4KHZ A;  3I4N B;  4U68 A;  3VR3 A;  3QOL A;  4AIM A;  1KLG D;  3KLW A;  4L5T A;  5C5L A;  5I6Y A;  3OMG A;  1SJH D;  4DR5 Q;  1LYL A;  1TWG B;  2PMZ E;  1X3Q A;  3ICE A;  1VQ9 A;  1PDQ A;  2KCT A;  3K59 A;  1PTO B;  2DY7 A;  4UAI A;  1FVI A;  3I72 A;  3IFD A;  2B63 B;  1L0Y B;  1Q12 A;  2WAQ G;  1FL0 A;  2F0H A;  1YVC A;  2UU9 Q;  2F0Q A;  2Q2H A;  4C2M B;  2UUA L;  3S14 B;  3S1N B;  3NXW A;  1X55 A;  5JVG 3;  4GOP A;  1RTN A;  4DAM A;  1Y8O B;  4A93 G;  1CZW A;  5C3W A;  2B2T C;  5JVH 3;  4CDD C;  1VQ6 A;  2CFM A;  2IY5 B;  4DR6 L;  2YTV A;  4UHV A;  4JV5 L;  1SLJ A;  4A3L G;  4XQN A;  1GUT A;  1FGB D;  3CCJ A;  1Y14 B;  3I56 A;  3OWF A;  2D0O A;  4CKB A;  4JI3 L;  1HUN A;  2F03 A;  2VY3 A;  2XTI A;  5HUR A;  3UDX A;  3ZYY X;  4ALP A;  2IL8 A;  1HTP A;  3KJP A;  3K5M A;  3EJI A;  4CGY B;  1T9H A;  4FXK C;  3J7Y W;  3VA5 A;  4EX5 A;  2WKD A;  2MNA A;  3MXG A;  3GTK B;  2A74 C;  1KAA A;  3I4M H;  5BR8 Q;  1HR0 L;  2HCC A;  4R4C A;  3TME A;  4BBR B;  3FPP A;  3J80 c;  2JQO A;  1KQS A;  2NZO A;  1C9O A;  2F4V L;  3PCO B;  3QJY A;  4P75 A;  3D4D A;  4UP8 A;  3A8K E;  2KEN A;  3VYU A;  1GKH A;  4DV5 Q;  3RZD H;  1KLU D;  1EWH A;  3LNN A;  4HTH A;  5I6W A;  4F88 A;  2DUD A;  4XXE A;  1W3S A;  2EYJ A;  4BXX G;  2VUM H;  1I3Q B;  2F0I A;  3EFX D;  1IBK Q;  1NMF A;  3GTL B;  2E2H B;  5FJ8 G;  1I4R A;  1H9S B;  5I2X A;  3CPF A;  4QUF A;  3J81 c;  4A3J H;  5EPL A;  1LAC A;  2K14 A;  1EU3 A;  2UUA Q;  1IKM A;  4HJ5 A;  4OX9 Q;  2UUB L;  1TWH B;  2EVB A;  4KKU A;  2PMZ B;  4B3T Q;  3S1M H;  1WTP A;  1SBB B;  4IOC A;  4EQO A;  4WJ3 M;  4RGT A;  4KK7 A;  4BBS B;  4RG1 A;  3UE0 A;  3K58 A;  3OHX C;  1C7Y A;  4C3J B;  4JI5 L;  2IX0 A;  2EZV A;  4AYB B;  1MD2 D;  1V1P A;  3PO3 H;  2E2J B;  1KAB A;  3GV6 A;  1STB A;  1PH9 A;  2F3W A;  2XNA C;  3OTO L;  4PZ8 A;  3VR4 A;  3VA7 A;  4JI7 L;  4DK6 C;  3HOY H;  5IYB G;  1A3U A;  1DJR D;  5M5W B;  1TY0 A;  3RZO B;  2E74 C;  3H94 A;  5ELB A;  1VQE A;  1SYG A;  3T1Y L;  4DR2 L;  1N34 Q;  3D0F A;  1XPU A;  4DV3 Q;  3LX0 A;  1D5Z C;  1GOZ A;  2JN4 A;  3P7J A;  1ROD A;  1TWA H;  1IL2 A;  4J6H A;  4B9W A;  1LT4 D;  2NYZ D;  3S1R B;  4DR3 L;  5IGE A;  3HKZ E;  4JBW A;  2JA7 B;  1X9N A;  2JK8 A;  1SE8 A;  3HKZ B;  1LT3 D;  5ELO A;  4LFB Q;  1VQ4 A;  5NUC A;  1WJJ A;  2MQH A;  2JA5 B;  5D3I B;  1EIH A;  4A3J B;  1C48 A;  2QEX A;  3HOV G;  1ZXT A;  4RHR A;  2NN6 H;  3OIP A;  3MA2 B;  3M7N A;  3JAM i;  3L7Z C;  2B2V A;  1BUV T;  1K8G A;  4NMZ A;  2AUK A;  4DV0 L;  1ILP A;  4HJ8 A;  4DUY Q;  1EL0 A;  3PUX A;  3FHW A;  2KQ3 A;  2BA0 A;  5FLM G;  1VQM A;  3AEV A;  1RHP A;  3PQI A;  4JI6 Q;  4DAP A;  1LT6 D;  4WJW A;  4X3K A;  3EIV A;  3AFP A;  1HJP A;  1BNZ A;  1GUW A;  3E9I A;  5M3F H;  2PPB C;  4X3S A;  2C35 B;  1I5F A;  3FKI G;  4RFB A;  2VQF Q;  3HOY B;  1PH5 A;  3KFU A;  2JSO A;  3WOF A;  4YY3 L;  1A3V A;  1VQ5 A;  5JEA G;  4FO2 A;  4G7Z C;  4BY1 B;  3SEB A;  3K80 C;  3SK8 A;  5EKL A;  2HDL A;  3TRZ A;  3FVQ A;  2BCO A;  2UU9 L;  1TWA B;  4GLV B;  4CBV A;  1N33 L;  2F0O A;  4OL7 A;  2B39 A;  2OEO A;  2YU9 H;  4ODG A;  5HY6 A;  1HHV A;  5FKA C;  1U9R A;  3I4L A;  4KY6 A;  2NTT A;  1S72 A;  3SHL A;  5D3D A;  2KHS A;  2A6H C;  3BDL A;  4DA2 A;  4AQY Q;  1KD1 C;  1STY A;  1EY8 A;  1DXM A;  1X56 A;  1B1Z A;  5ELC A;  3T1Y Q;  3KF8 B;  4QCL A;  3PO3 B;  3KLS A;  4KD3 A;  1D5X C;  3K6O A;  5T1I A;  4JV5 Q;  3TN2 A;  2R93 B;  1CHQ D;  4JI0 Q;  1A2T A;  3I55 A;  2UXD L;  1Y8N B;  3CMA A;  1Q3L A;  3HOZ H;  1JOK A;  3TRE A;  3I4M B;  3CW2 C;  1B9N A;  1WVL A;  4B3S Q;  2CH4 A;  2MJ8 A;  4NP5 A;  4J15 A;  5EAY A;  1ZEQ X;  3RZO H;  3M9B A;  1BO0 A;  1X6O A;  1B4O A;  1B9M A;  1LLR D;  1ILQ A;  1GHJ A;  5J39 A;  4JI1 Q;  4DV2 L;  3BZC A;  1WTO A;  3PIP A;  1IW7 D;  3VR5 A;  2AQ1 B;  2IHF A;  1OXT A;  2BA1 A;  5ELN A;  5M3M G;  4GNX B;  2M00 A;  2VUM B;  2WB1 G;  1M8A A;  3W3A A;  4ZUI A;  4GN5 A;  1B3Q A;  1CHP D;  1LTR D;  4I65 A;  4H13 C;  1K8M A;  5C4J H;  4ID6 A;  1UAP A;  1VQJ A;  3SVM A;  2LS0 1;  2QW7 A;  1MJC A;  1PRT B;  1CTM A;  1TWH H;  4BS9 A;  1DOK A;  3IRB A;  1QZG A;  1HFN A;  4H7B A;  2K75 A;  2I07 B;  1ET9 A;  2WFW A;  1ESF A;  5KEE A;  1M4V A;  1EZ6 A;  5LHY 1;  1PV4 A;  2CCZ A;  1ENF A;  1PZJ D;  3T1H L;  4RKB A;  1TWC B;  1Z6H A;  3HOW B;  2E2J H;  3IKJ A;  1XNR L;  4X64 Q;  4KI0 A;  2VW9 A;  1EY5 A;  4DXF A;  4JK1 C;  2JEA I;  3K5O A;  1LT5 D; 
#chains in the Genus database with same CATH homology
 1CSQ A;  1WCM G;  1HZC A;  1SFO H;  4UY8 C;  3PF5 A;  2E8G A;  3GDE A;  2XGT A;  3ULL A;  3S2H H;  2PNH A;  1HNX Q;  4B3R L;  3W1G A;  1XPO A;  1QZH A;  2OTJ A;  4QIW E;  4YY3 Q;  2KHJ A;  4L5Q A;  1HNX L;  4QQB X;  5IYD G;  4A3F G;  3A0J A;  4BBS G;  4IJL A;  3CCQ A;  1Q82 C;  2Q2U A;  2NVX H;  1LM0 A;  1YBY A;  2LXK A;  1Y1V G;  1YEZ A;  3A5U A;  4DV6 L;  4R4O A;  1VQI A;  4GS3 A;  4GLA C;  4PMW A;  5LMN L;  1K73 C;  1VQB A;  1I94 Q;  4AYB G;  2HHH Q;  3M85 A;  4LF5 Q;  1JE5 A;  2K5N A;  1GO3 E;  3A5Z B;  1VQ7 A;  2R93 G;  3F2B A;  4DV6 Q;  3CCV A;  4IFD J;  1BBU A;  3PV0 A;  1TWG H;  1G29 1;  4X65 L;  2R7Z G;  3CCM A;  3L2P A;  4DV3 L;  2ZJQ A;  5AJ3 Q;  2PQA B;  3ULP A;  4AQY L;  2Z6K C;  3CCR A;  4DR1 Q;  3FKI H;  1XTD A;  4X65 Q;  1YHB A;  3GTQ H;  2PQA A;  4GKK Q;  4JOI A;  1B7Y B;  4R1J A;  1N36 L;  3EBE A;  5M5X H;  3ER0 A;  2K5H A;  2H5X A;  1VQP A;  1N32 L;  2ZM6 Q;  3GD7 A;  1L1O B;  1YHQ A;  5IY0 A;  4GN4 B;  1N36 Q;  1QUQ B;  4B3M Q;  3CD6 A;  1K8A C;  1CSP A;  2JJQ A;  5C0X I;  4DR5 L;  2CKZ B;  4DV5 L;  3S14 H;  2AKW B;  2E2H H;  1PHJ A;  4YHH L;  2YYZ A;  2WB1 E;  3UDI A;  2ASB A;  4LW1 A;  3U4V A;  1XMQ Q;  3DLL A;  2EIF A;  3U58 A;  2IX1 A;  5GQO A;  3HKZ G;  4DV1 L;  2Z0S A;  3HOW H;  2NVY H;  3STB D;  4GN3 B;  2RF4 A;  4XIG S;  3KOJ A;  4MNO A;  2JA5 G;  1E3P A;  1UWV A;  3W1B A;  2GVB A;  3CPW A;  1HNW L;  1KL9 A;  4OXP A;  4DNI A;  1AE3 A;  1KRS A;  2N78 A;  4YWL A;  5K36 G;  1EIY B;  1VQF A;  3RLN A;  3OTO Q;  4OX9 L;  3S1Q H;  5JEA J;  1HNW Q;  4IO9 A;  1XPR A;  5H1S E;  2MFI A;  1X3G A;  1NBW A;  4X64 L;  4BY1 H;  4DR4 Q;  5JJL A;  1JB7 A;  5IT9 c;  2KCM A;  3BJU A;  1NJI C;  1K3R A;  3HFZ B;  1HZ9 A;  4B3R Q;  4B3T L;  1D7Q A;  1TXY A;  1GVP A;  1B8A A;  2R6G A;  4LFC L;  4C3I H;  1N9W A;  2OTL A;  1E7Z A;  4HJ9 A;  1PYB A;  3KDF A;  4A3F H;  3BU2 A;  5IYD H;  3KYH C;  5C0X G;  1CKN B;  1XMO Q;  3HOW G;  2HQL A;  4DR6 Q;  4OWX B;  3RLO A;  3VDY A;  2E5L Q;  4TVA B;  1EWI A;  3PUV A;  5IP9 H;  2UUC L;  4JI3 Q;  1CKO A;  3JAM c;  4Y7N H;  2VQE L;  4JBK A;  3KF6 A;  1Q86 C;  3PIO A;  4YCW A;  4HIO A;  4A75 A;  4LF5 L;  4HIM A;  3PSI A;  1X65 A;  1FJG Q;  1KAW A;  5BR8 L;  1KHI A;  1PA6 A;  1I94 L;  2VQE Q;  4P74 A;  3K7U C;  1HR0 Q;  4LF6 Q;  4NXN L;  2K52 A;  4NPS A;  2JA6 H;  4QGU A;  4X62 Q;  1ASY A;  4BBS H;  4JCV E;  3W5O A;  2IT1 A;  4LF8 Q;  3K81 C;  1C0A A;  1IXR A;  4JI8 Q;  1N34 L;  4P72 A;  1IBL Q;  3E9H A;  3TEH B;  1UE6 A;  5M3F G;  5FLX c;  5GAE C;  1M1K C;  2LSS A;  4YCU A;  2F3I A;  3HOX H;  2ZM6 L;  4DR1 L;  2JA5 H;  1A63 A;  1L1O C;  1IBL L;  1UE7 A;  1JT8 A;  1WI5 A;  4AYB E;  1Q8K A;  1VQL A;  4KHZ A;  4HIK A;  5DLQ E;  4QY7 A;  3J80 i;  4AIM A;  1VQO A;  4GOP B;  4L5T A;  3KLW A;  1FGU A;  1BKB A;  4YHH Q;  2MO0 A;  4MTN A;  4DR5 Q;  1E1T A;  3H0G H;  3K7A H;  4APV A;  5C44 H;  1LYL A;  3S16 H;  4A3B H;  4DV4 L;  4DR7 Q;  5IP9 G;  2NVQ H;  2PMZ E;  3AFQ A;  1P8L A;  3I7F A;  2I5L X;  2F52 A;  1J6Q A;  3ICE A;  3TS2 A;  1VQ9 A;  1Q46 A;  3CXC A;  4LF4 Q;  2KCT A;  1V1Q A;  4A3K G;  4OWT B;  5AJ3 L;  3CF5 A;  4IOA A;  4BXX H;  3AYH B;  4JBM A;  1FVI A;  4FDB A;  5JJI A;  4JBJ A;  1Q12 A;  2WAQ G;  1FL0 A;  3S1R H;  2BH8 A;  1MJE A;  1YVC A;  3L0O A;  4YCV A;  2UU9 Q;  2EXD A;  4IPH A;  1QVF A;  2Q2H A;  4LF7 L;  3UE1 A;  1JMC A;  3HOX G;  2UUA L;  3PO3 G;  2VNU D;  4B3M L;  1X55 A;  1YJ9 A;  3PF4 A;  1WYD A;  4GOP A;  2Y0S E;  1LTL A;  4DAM A;  4JI6 L;  4A93 G;  4LFC Q;  1VQG A;  2Q2T A;  1PH6 A;  4JI5 Q;  3SGI A;  4A3D H;  1VQ6 A;  2CFM A;  4YWK A;  3GTP H;  2IY5 B;  4DR6 L;  2YTV A;  3GTJ H;  4JV5 L;  1DGS A;  1SLJ A;  4A3L G;  1AE2 A;  2VZA A;  4DR3 Q;  1OXV A;  2UXC Q;  2UUC Q;  3J7Z C;  1HNZ Q;  3CCJ A;  1Y14 B;  3I2Z A;  3I56 A;  1B70 B;  2D0O A;  4A3D G;  1H95 A;  2JA7 H;  4OO1 I;  4GLX A;  4JI3 L;  2D62 A;  4JOI C;  2HT1 A;  2VY3 A;  4IPC A;  4XTC S;  1HNZ L;  2XTI A;  1S40 A;  1PVO A;  1FJG L;  3UDF A;  4O0A A;  3UDX A;  4ALP A;  4IFD G;  4C3H H;  3KJP A;  3J81 j;  4LNQ A;  1TWF H;  3MEF A;  1XNR Q;  4HJ7 A;  1N33 Q;  3ERS X;  1T9H A;  5IWA Q;  2JA7 G;  2VUM G;  3I4N H;  1XNQ L;  3PO2 G;  3PUZ A;  4EX5 A;  2N8N A;  2MNA A;  3AQQ A;  2NZH A;  1EUJ A;  3I4M H;  4JYA Q;  5BR8 Q;  1HR0 L;  5C4X H;  1CKN A;  3F2C A;  4R4C A;  1YIT A;  1PH2 A;  1NY4 A;  1PH4 A;  4PG3 A;  1EYG A;  3J80 c;  2A1A A;  1XMO L;  1GD7 A;  4JI2 Q;  5M5W H;  1Q7Y C;  4BY7 G;  2JQO A;  1KQS A;  1BVS A;  2CWA A;  1C9O A;  2NZO A;  2RHS B;  3KF6 B;  5IYC G;  4A3M G;  5C0X J;  2F4V L;  4L5R C;  2Y0S G;  3PCO B;  1JJC B;  4P75 A;  5HGQ A;  4DAY B;  1WOC A;  4BA2 I;  1UEB A;  4GNX C;  4NB3 A;  4UP8 A;  2KEN A;  4BY7 H;  2OWO A;  1GKH A;  4DV5 Q;  1Z47 A;  3RZD H;  1YJW A;  1G51 A;  1L0W A;  4DV4 Q;  1YZ6 A;  2HHH L;  4DR7 L;  5FLM H;  2JA8 G;  1N8R C;  3CCL A;  1JJ2 A;  4H02 A;  1VQC A;  3CP0 A;  2DUD A;  2YV5 A;  4JI1 L;  4RMF A;  4LFA Q;  2D0P A;  2WP8 J;  1W3S A;  5LMU L;  2GN5 A;  4DV1 Q;  4ME3 A;  1HR0 W;  4JC0 A;  4NXN Q;  2BH2 A;  3I4N G;  2VUM H;  4BXX G;  3CQZ H;  4LF9 L;  3MXN B;  4K0K Q;  2R92 H;  3B6Y A;  1IBK Q;  1NMF A;  1PH8 A;  5FJ8 G;  3J81 c;  3CPF A;  3H15 A;  4A3J H;  4DUY L;  4GKJ L;  4KLK A;  1UE5 A;  2K14 A;  2QGQ A;  2UUA Q;  1KXL A;  4HJ5 A;  4OX9 Q;  3HOY G;  1PH7 A;  2UUB L;  4OO1 G;  4LF7 Q;  1N32 Q;  2R7Z H;  4JG2 A;  3M4P A;  4OWW B;  3NEM A;  2MO1 A;  4DUZ L;  2UXB L;  1HZA A;  4WJ4 A;  4X6A H;  1KIX A;  2I5M X;  4DV7 L;  1K0R A;  1RL2 A;  4B3T Q;  3S1M H;  1L1O A;  4BY1 G;  4IOC A;  4WJ3 M;  2UXB Q;  2DGY A;  3PGZ A;  1U5K A;  4A3C G;  4A3L H;  1EFW A;  4RG1 A;  3UE0 A;  4PZ7 A;  1C7Y A;  4JI5 L;  1J5E Q;  4LUO A;  2IX0 A;  1JJG A;  1E1O A;  3U50 C;  4A3I H;  1GM5 A;  4IPG A;  5GAG C;  3CCS A;  5C4X G;  1TWC H;  3FP9 A;  1SMX A;  2B63 H;  3S17 H;  3PO3 H;  2R93 H;  2QA4 A;  2JA9 A;  2EQS A;  1LUZ A;  1QUQ A;  1PH9 A;  1YNX A;  3UDG A;  2RHQ B;  1I6H H;  3OTO L;  4PZ8 A;  3DM3 A;  5LMN W;  1IBM Q;  2ZJR A;  4JI7 L;  1ASZ A;  4R4I A;  4DK6 C;  2E2I H;  3HOY H;  5IYB G;  3A74 A;  3K8A A;  1SN8 A;  4MZ9 A;  4DR2 Q;  1CUK A;  1IYJ B;  5IP7 H;  1MKH A;  5M3M H;  4JI7 Q;  4X62 L;  1O7I A;  4JYA L;  1VQE A;  2CQO A;  3I4M G;  3T1Y L;  4DR2 L;  4BA1 I;  1N34 Q;  2I5H A;  2OQK A;  3D0F A;  1XPU A;  2WAQ E;  4DV3 Q;  2ALY B;  5IWA L;  3E0E A;  1A0I A;  2KBN A;  5IYC H;  1TWA H;  1IL2 A;  2YTX A;  4LWC A;  4GKK L;  2LXJ A;  4DR3 L;  2UXC L;  4JI0 L;  1Y1W H;  4LFB L;  3HKZ E;  1G6P A;  4JBW A;  1X54 A;  5IE8 A;  3F1Z A;  4LUV A;  1X9N A;  2JK8 A;  4C2M H;  2F4V Q;  2PI2 E;  1SE8 A;  5ELO A;  4B3S L;  1A62 A;  1V9P A;  1VQ4 A;  4LFB Q;  4HID A;  3KJO A;  1WJJ A;  2MQH A;  4IJH A;  3HOU G;  3NEN A;  1EQR A;  4TQU S;  4BBR G;  5C3E G;  1X3E A;  1UE1 A;  2QEX A;  1PH3 A;  3HOV G;  3H3V H;  5J3B A;  4P71 A;  3M7N A;  4O2D A;  4DV0 Q;  3JAM i;  3L7Z C;  4GOP C;  1HZB A;  1K8G A;  3GO5 A;  4DKA C;  4A93 H;  2AHO B;  3NBH B;  5GAH C;  4A3K H;  3WWV A;  5M5Y H;  3LGJ A;  3ULJ A;  4DV0 L;  4JI8 L;  2ES2 A;  1L2F A;  4HJ8 A;  3H3V I;  3EN2 A;  4DUY Q;  1YI2 A;  4LF9 Q;  2NVT H;  4GKJ Q;  5E7N A;  3PUX A;  4DK3 C;  1VCI A;  3FHW A;  5FLM G;  2BA0 A;  2JA8 H;  2JEB I;  5GAD C;  1VQM A;  1KRT A;  3PUY A;  3AEV A;  1YHA A;  4PZ6 A;  4JI6 Q;  3CAM A;  4X66 Q;  4IPD A;  3BZK A;  2AWO A;  3EIV A;  4POF A;  3AFP A;  2R92 G;  1HJP A;  2YTY A;  3E9I A;  5M3F H;  1V43 A;  3RN5 A;  4A3G G;  3PUW A;  1OXX K;  2K5V A;  2C35 B;  1I5F A;  3FKI G;  2RCN A;  2VQF Q;  5LMU Q;  3S1N H;  1Q81 C;  1IZ6 A;  1PH5 A;  2A8V A;  3KFU A;  2NN6 G;  5C44 G;  1K83 H;  1MIU A;  4YY3 L;  1VQ5 A;  3CC2 A;  5JEA G;  2N49 A;  3HKS A;  4YWM A;  3JC6 6;  3K80 C;  2HIX A;  4EQ5 A;  4A3E G;  3GTM H;  3M4Q A;  1AH9 A;  1IBM L;  1SRU A;  3TRZ A;  4L5S A;  2Q2I A;  1XJV A;  4LUZ A;  2UU9 L;  1N33 L;  1E22 A;  4GLV B;  2R7D A;  4NXM Q;  4JI4 Q;  3NEL A;  2AMC B;  4QL5 A;  2YU9 H;  5HY6 A;  2AWN A;  2KHI A;  3OYY A;  1M90 C;  1XNQ Q;  4GNX A;  1VS0 A;  4NXM L;  1NTG A;  4QJF A;  4C3J H;  1VQ8 A;  1QVC A;  4LF6 L;  1S72 A;  1I50 H;  1I3Q H;  2VS1 A;  1KD1 C;  4AQY Q;  1J5E L;  3PO2 H;  4A3G H;  3CCE A;  1X56 A;  3T1Y Q;  2I0Q A;  2UXD Q;  2L15 A;  3KF8 B;  2ATW A;  1EQQ A;  4A3B G;  3RLF A;  4JV5 Q;  4JI2 L;  1WCM H;  1PFS A;  1Q1E A;  4JI0 Q;  5IYB H;  3I55 A;  3U4Z A;  2OQ0 A;  1EIF A;  3RNU A;  2UXD L;  5IP7 G;  3GTK H;  3CMA A;  2HIV A;  3HOZ H;  3TRE A;  4A4I A;  5LMN Q;  3HOU H;  3CW2 C;  1Z9F A;  2E5L L;  3S2D H;  4B3S Q;  1D8L A;  1YIJ A;  1BBW A;  5GRO A;  4BBR H;  5C3E H;  1QVG A;  3G71 A;  3STB C;  1NMG A;  1SRO A;  4J15 A;  5EAY A;  1VQN A;  4DV2 Q;  3M9B A;  3RZO H;  4A3E H;  1X6O A;  3S15 H;  1YJN A;  3Q8D A;  3CC7 A;  2B63 G;  3M4O H;  1Y1V H;  4JI1 Q;  4DV2 L;  2B29 A;  4K0K L;  1IBK L;  2JA6 G;  1E24 A;  1Y1W G;  4LF4 L;  3BZC A;  1PH1 A;  2GVA A;  4A3C H;  1HH2 P;  2R7F A;  1EOV A;  3PIP A;  2CWP A;  1W2B A;  4Y52 H;  3TS0 A;  1CKM A;  1R9T H;  3K0X A;  4A76 A;  4A3J G;  2IHF A;  4R4T A;  4IFD I;  1OXT A;  2BA1 A;  1A8V A;  5FJ8 H;  3TQY A;  5ELN A;  5M3M G;  4GNX B;  4LF8 L;  1RIP A;  2B3G A;  4DUZ Q;  1KC8 C;  3CC4 A;  2WB1 G;  3G4S A;  3RR5 A;  2UUB Q;  2ID0 A;  3GTL H;  4OON A;  4GN5 A;  3HOZ G;  3F8T A;  2K4K A;  3I4O A;  3J7A 5;  5C4J H;  2ZJP A;  4UPA A;  4DV7 Q;  3RN2 A;  4DR4 L;  3H0G G;  1SR3 A;  1VQJ A;  1X3F A;  2A19 A;  1VQA A;  2ZTD A;  1OTC A;  1MJC A;  2K50 A;  1TWH H;  4A3M H;  2VQF L;  1XMQ L;  3M3Y H;  1NE3 A;  3S24 A;  4DPG A;  3CME A;  2FXQ A;  3OW2 A;  3G48 A;  2ZTC A;  4LFA L;  1WFQ A;  3IRB A;  1QZG A;  2ZTE A;  3CCU A;  1VQK A;  2N3S A;  2K75 A;  2VL6 A;  1K9M C;  3GTG H;  4A3I G;  2WFW A;  3ZJY C;  3KDF B;  3F2D A;  2JE6 I;  1VQD A;  1OXS C;  2OCE A;  3HOV H;  5JJK A;  3D31 A;  4POG A;  1PV4 A;  2CCZ A;  4UP9 A;  1S3O A;  4P73 A;  3J81 i;  3GTO H;  4KHP Q;  3T1H L;  2NN6 I;  1VQH A;  2E2J H;  4X66 L;  1XNR L;  4X64 Q;  4HJA A;  3G6E A;  4KI0 A;  2VW9 A;  4KHP L;  2Z6K A;  3T1H Q;  1OXU A;  1Q1B A;  1P16 A;  1U0L A;  2IHE A;  4AH6 A;  4JI4 L;  4UP7 A;  2JEA I;  4R4Q A;  2PI2 A;  2V1C C;  1PYS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...