1HZAA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
molecule keywords COLD SHOCK PROTEIN CSPB
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzaA00
2YTVA 1N36L 4DV5Q 3HOUH 4JBWA 2BH8A 2B29A 2VQFQ 1VQAA 3GTGH 4IPGA 1SFOH 1VQJA 2ZM6Q 3NBHB 3CAMA 1I94L 3BJUA 5IWAL 4DR3L 4A3IH 1VQDA 2HIVA 3F2DA 2UUBL 3GTQH 3RR5A 4DV1Q 3D31A 1Z47A 4LNQA 3RLNA 1QVFA 1EOVA 3PUWA 4DV3L 2ATWA 3W1BA 4HJ5A 2I5HA 3J80i 4DAYB 3RNUA 1YJNA 4DR2Q 4X64Q 4NXNQ 3AEVA 2R93H 1SN8A 3FKIH 4DV5L 2R93G 3BU2A 4GKJQ 4QY7A 1X3FA 4LF6L 2Q2HA 5C4JH 1V43A 4OWTB 1XMQQ 3F1ZA 1B70B 2VQFL 3KJPA 4JI5Q 2UXDQ 3GTJH 4JI0Q 3T1YL 1SE8A 1Y1VH 4DR1L 2CFMA 2PQAB 1PV4A 5JJKA 4AH6A 2ES2A 2JEAI 1PH1A 1HNWQ 2JA7G 1IL2A 4WJ4A 2JA6G 4YHHL 1K8AC 2WAQE 4P72A 3ICEA 3PIPA 2HT1A 4QIWE 1JE5A 3CMAA 1U5KA 1V1QA 4YCVA 1L0WA 5M5WH 3OTOQ 4LF6Q 1KL9A 1QUQB 1QVCA 2D0OA 4JI3L 2CCZA 4JBKA 1S72A 3I4MH 3M7NA 1PH5A 2CWAA 1TWGH 1EQRA 1VQBA 4OONA 1QUQA 2R92G 1DGSA 4KHPL 1HR0Q 4Y52H 3CXCA 1YHAA 1GO3E 4P74A 5IYBG 2QEXA 4GNXA 1R9TH 5H1SE 4POFA 4NPSA 2ZM6L 1FJGL 2IY5B 1J5EL 1PFSA 2K5NA 2A1AA 4DR3Q 3VDYA 2VNUD 4DV7L 4YHHQ 3CCVA 4A4IA 4JI4L 2JEBI 4UP7A 3I56A 3S1NH 2ZTEA 2MO1A 3CW2C 3ULJA 3H3VI 1OTCA 2HHHL 3JAMi 4B3RL 1Q82C 1N34Q 1SRUA 3PSIA 2LSSA 3JC66 3CP0A 4BY7G 4X64L 4JI3Q 4DR4Q 4B3TQ 3L7ZC 1VQKA 1IBLL 1HJPA 5GAEC 4UP9A 1XPUA 1LUZA 1X56A 5M3FH 3TQYA 4DV0L 4AYBG 2UU9Q 5IYBH 2Y0SE 1AE3A 1KRSA 1UE7A 2E2HH 2JA5G 5K36G 1VQ6A 1X3GA 4JI5L 4ALPA 1NJIC 2UXDL 3U4ZA 3NELA 1NE3A 2E2JH 2H5XA 2ALYB 5FJ8G 2ZTCA 4DR7L 1YVCA 4QQBX 1C7YA 2R7ZG 3H0GG 3AFPA 1HZ9A 2PMZE 4DR6L 1N34L 1HZBA 4HJAA 4K0KQ 2IHEA 1BBWA 3K80C 4A3LH 1PH6A 4DR4L 4X66L 5C44H 4GOPB 1Q86C 4LF9Q 1E1TA 1D8LA 4YWLA 2R92H 5IYDH 3M9BA 1CKNA 1HNZQ 3U4VA 3GTMH 4B3TL 2BA1A 3U58A 3KF6B 1UEBA 3CCMA 3HOXH 3S1RH 1N8RC 4JI6L 4A3KG 2OWOA 4GKKL 3I4NH 3PO2G 2I0QA 4NXML 3PUVA 1WYDA 4A3JG 1JT8A 4PZ6A 1RIPA 3PIOA 4IPHA 5IP9H 2JK8A 5FJ8H 4QL5A 4DV1L 2QGQA 3G48A 4DPGA 4X62L 1X9NA 3PUYA 1JB7A 1JMCA 2K14A 1Q8KA 2K5VA 2UUAQ 2B63G 4JYAQ 1D7QA 1QVGA 4B3SL 1IXRA 5M3FG 1VQFA 1OXVA 4HIOA 3GTLH 3GTKH 4DK6C 2WB1G 2XGTA 1VQMA 1SMXA 5BR8Q 3KJOA 1TWFH 4L5SA 3GTOH 2VUMG 1A62A 4PZ7A 1WJJA 2F3IA 1VS0A 1PVOA 2GVAA 1JJCB 5JJLA 1A63A 4IOAA 4BA2I 3PCOB 4A3EH 1VQNA 4NXMQ 2N78A 3J81j 1I6HH 3KDFB 4POGA 4GKKQ 3HOVG 2Q2UA 2F4VQ 1A0IA 1NBWA 3W1GA 2KENA 2DGYA 2NVTH 4P71A 1ASYA 2UU9L 2NZOA 4RG1A 3UE1A 3M85A 3PUXA 3D0FA 3F2BA 2UXCQ 3U50C 4YCWA 4A3DG 3CCQA 1TWAH 3ULPA 2BA0A 3F2CA 4JI6Q 1Q1BA 2RHSB 4OX9L 2UUBQ 2JA6H 3I4NG 1CSPA 1G51A 2XTIA 4TQUS 4JI8Q 5M5YH 3CCJA 3UDGA 1MJEA 1BKBA 1SR3A 4A3KH 1N33L 3F8TA 3UDIA 4A3FH 3G71A 3T1HQ 2K5HA 3HOYH 2CQOA 4A3FG 3HOYG 1VQ9A 1G291 3I4MG 2NVXH 1BVSA 1PYBA 2PI2A 4QGUA 3K7UC 1XPRA 1XNQL 4LW1A 1CKNB 1OXUA 1OXSC 4KHPQ 1QZHA 4DV2L 1HZCA 3UDFA 2KBNA 3JAMc 1K8GA 2B3GA 4IJHA 4JV5L 1NTGA 2ZTDA 4IO9A 2K50A 2V1CC 3FKIG 5AJ3L 1VQPA 4DV7Q 1YHQA 5ELNA 1EQQA 1B8AA 4AIMA 3T1YQ 1L1OA 4JOIC 1Q46A 4KLKA 4XTCS 3SGIA 4X62Q 4DV4L 2HIXA 5GQOA 4A3EG 2JA5H 3KYHC 1HZAA 4YCUA 1HNWL 4EX5A 2VUMH 3M4OH 5E7NA 3M3YH 1VQCA 1MIUA 4OO1G 1X3EA 1PH8A 5M3MH 3RN5A 5JJIA 1MKHA 1T9HA 3IRBA 5HGQA 5IE8A 1XMOL 2NN6G 1GVPA 1KD1C 3A5UA 4LFBL 5FLMH 4IJLA 5C0XJ 4BY1H 1HNXQ 3MEFA 5IP7G 4JI2L 4LF4L 2VL6A 5GADC 1GM5A 4DV6Q 1XTDA 1YIJA 2I5LX 4LFCQ 2KHIA 5C3EH 2AWOA 2UUCL 3S16H 2YTXA 3GD7A 1RL2A 3CPWA 4BBSG 2JJQA 1P16A 2D0PA 4GOPA 5C0XG 2E8GA 3G6EA 1I5FA 2IX1A 4JI1Q 4Y7NH 1YJWA 4R4QA 4YWKA 2IHFA 4J15A 4DUYL 1EIYB 4DR2L 3A74A 3J81c 5IYDG 4P75A 2NVQH 3RZOH 1EUJA 3CCRA 2HHHQ 1VQHA 3NEMA 3T1HL 4B3RQ 1L1OC 2L15A 1EFWA 1NY4A 4JG2A 4L5TA 4BY1G 4APVA 1KHIA 4IFDJ 4DV6L 1UE1A 3TEHB 2IT1A 4JI2Q 1HNXL 2JA9A 4HIDA 4DKAC 4A3BH 1E7ZA 3CMEA 2R6GA 4R4OA 3S14H 1J5EQ 2UUAL 2UUCQ 2OTJA 4IPDA 4OO1I 3E9IA 1UE5A 3KLWA 1K9MC 1L2FA 1O7IA 1L1OB 4BXXG 1OXXK 3E9HA 2R7DA 4DR7Q 1K83H 1YHBA 4B3SQ 2YV5A 3NENA 1K3RA 1LM0A 4YWMA 4BY7H 2EIFA 1S3OA 2LXKA 4GLVB 3HKZE 1VQ8A 5BR8L 1WI5A 4IPCA 2NVYH 2VQEL 4DUYQ 3CC2A 2NN6I 2MFIA 5IYCG 3ER0A 3K8AA 5JEAG 1YITA 3PGZA 1OXTA 4JCVE 2VW9A 5IP9G 3S24A 1Y1WG 4OWWB 1G6PA 3HOWG 2CKZB 4GLAC 3HKZG 3K0XA 1TWCH 4X65L 3GDEA 2UXCL 3EIVA 1QZGA 4JI4Q 3B6YA 3CPFA 1Q1EA 4LFAQ 4DK3C 5C44G 2D62A 1CSQA 1VQ7A 3HOUG 2WFWA 3MXNB 5LMNQ 1WCMH 3PO3G 4X66Q 1CKMA 3PUZA 4MTNA 3PO2H 1N9WA 1PA6A 3W5OA 2EQSA 1Q81C 2Q2IA 3HOXG 1EIFA 2E2IH 4PMWA 3GTPH 4O2DA 4GLXA 1P8LA 1TXYA 1YI2A 4JI7Q 2MQHA 1UE6A 3LGJA 2KCTA 4O0AA 4DV2Q 5C4XG 2MNAA 1XJVA 1JJ2A 4A76A 4A3CH 3GO5A 4LF5L 1KRTA 1VQLA 1K0RA 2NZHA 3STBC 1PHJA 1I94Q 4A3DH 4KHZA 2WAQG 5C3EG 2RCNA 1E24A 4PZ8A 3S2HH 3L2PA 3HOZH 1IZ6A 4GN5A 2C35B 3ULLA 1PH7A 4GNXC 2PI2E 2VS1A 4A3MG 4OWXB 2YU9H 1A8VA 2RF4A 1X6OA 4LUOA 1X55A 2EXDA 2Z6KC 4PG3A 2AHOB 4MNOA 4BA1I 4DV4Q 4HIMA 4QJFA 1VQ4A 5M3MG 1IBMQ 4LF8Q 3J7A5 3HOVH 2B63H 5ELOA 3EBEA 2YTYA 3PV0A 2JA8G 4DUZL 2OTLA 4GOPC 4BXXH 3DM3A 1FGUA 3KFUA 2CWPA 1XMQL 2E5LL 5J3BA 2OQ0A 4DNIA 4H02A 3CCUA 1NMGA 3HKSA 2FXQA 3BZKA 2K52A 2VY3A 1SLJA 1PH4A 4LF4Q 3S15H 1NMFA 4WJ3M 1FJGQ 3AFQA 4LFCL 2LXJA 3TREA 4R1JA 1PH3A 4DR1Q 3OW2A 2HQLA 4GN3B 2DUDA 5C4XH 4DV3Q 4AQYL 4A3MH 3CF5A 1CUKA 1HH2P 4A3JH 4OXPA 1KC8C 1WCMG 1VQ5A 1N33Q 1XNRQ 4JYAL 3E0EA 3EN2A 1IBKQ 1E3PA 1LYLA 4NXNL 4JI1L 2N3SA 4R4TA 2ZJQA 4LWCA 4XIGS 4DR5L 1XPOA 3K7AH 2YYZA 4DUZQ 3G4SA 1ASZA 3OTOL 1LTLA 1M90C 5M5XH 3RN2A 2WP8J 4HIKA 1Y1VG 2QA4A 4A3CG 3DLLA 3L0OA 3I2ZA 5JEAJ 3J81i 1XMOQ 2K75A 4JI0L 4JBJA 4HJ7A 1W2BA 4DR6Q 3UE0A 1KXLA 1PYSB 1WOCA 1HR0L 4C3HH 1TWHH 4IOCA 2R7ZH 5AJ3Q 4JOIA 3J7ZC 3HFZB 3STBD 2KCMA 1B7YB 3ZJYC 3H0GH 3ERSX 3WWVA 1EWIA 3M4PA 2ASBA 3K81C 5IP7H 2ZJRA 1YBYA 4A3GH 4LUVA 2GN5A 3HOWH 1SROA 1I3QH 2OCEA 5FLMG 1GD7A 1PH9A 3CC4A 3KF8B 4X6AH 1BBUA 1VQEA 4DR5Q 3A0JA 1YJ9A 4JBMA 2JE6I 2Z6KA 2BH2A 2RHQB 3AQQA 1IBML 4LF8L 4P73A 1YEZA 1EYGA 4JC0A 2F52A 1K73C 3KOJA 1V9PA 1Q12A 2AMCB 3AYHB 3OYYA 4NB3A 2A8VA 2I5MX 5FLXc 4A3IG 3S1QH 1N32Q 4DV0Q 1S40A 3RLOA 4L5RC 4A93G 1YNXA 4EQ5A 3H3VH 3KF6A 3BZCA 1WFQA 2UXBQ 4C3IH 1E1OA 5IT9c 2ID0A 2WB1E 5GAGC 3HOZG 1AE2A 3S1MH 4UP8A 1VQOA 5LMNL 3CQZH 4K0KL 4GN4B 1PH2A 4L5QA 1X65A 4UPAA 4LF7Q 1VQGA 5LMUL 2Q2TA 4C2MH 4MZ9A 2AWNA 2MO0A 3A5ZB 3I55A 3FHWA 4A3BG 1Q7YC 3S17H 3PF5A 4GNXB 3PF4A 1HNZL 3S2DH 1AH9A 2N49A 2Y0SG 4IFDG 1VQIA 5GAHC 4A93H 2R7FA 3H15A 4LF5Q 2N8NA 2AKWB 5EAYA 1U0LA 4FDBA 1KIXA 1MJCA 4LUZA 5IYCH 4HJ8A 4TVAB 1KAWA 1W3SA 1J6QA 4KI0A 4A75A 4OX9Q 4R4IA 4IFDI 1UWVA 1Y1WH 3UDXA 4BBRH 5LMUQ 4YY3Q 1FL0A 1YZ6A 4GS3A 3FP9A 4BBRG 4LF9L 3RLFA 4BBSH 3CD6A 4GKJL 3J80c 1Y14B 4LFAL 1GKHA 2VQEQ 4HJ9A 4UY8C 2JA8H 1XNQQ 2PNHA 2PQAA 4ME3A 4C3JH 2ZJPA 5LMNW 1N36Q 2GVBA 1FVIA 1Z9FA 1IBLQ 2IX0A 4AYBE 5IY0A 4B3MQ 4A3GG 5GROA 3I4OA 2JQOA 4JV5Q 1I50H 2E5LQ 4JI7L 5DLQE 1IYJB 2OQKA 2KHJA 3M4QA 2F4VL 2K4KA 1E22A 1N32L 1C9OA 2VZAA 1HR0W 3I7FA 4X65Q 1XNRL 3PO3H 5IWAQ 1X54A 1KQSA 3CCSA 1C0AA 4AQYQ 2UXBL 3CC7A 5C0XI 2A19A 3CCEA 1H95A 1VCIA 1CKOA 4JI8L 3TS0A 2JA7H 1M1KC 1IBKL 3TS2A 4YY3L 5HY6A 2Z0SA 4R4CA 4B3ML 4A3LG 3RZDH 3Q8DA 3CCLA 4LF7L 4RMFA 3TRZA 3KDFA 1JJGA 4DAMA 4LFBQ
chains in the Genus database with same CATH superfamily
3HOUH 3SK8A 2VQFQ 1VQAA 3GTGH 1SFOH 1VDZA 4IUPA 2ZM6Q 5C0XH 3BJUA 5IWAL 4DR3L 4A3IH 2K28A 5JVH3 2UUBL 2K01A 3S1QB 2FINB 1BR9A 1QVFA 4DFAA 3W1BA 4Y7NB 5I2XA 2I5HA 3J80i 1AN8A 3RNUA 1YJNA 2HDMA 1QB5D 3AEVA 2R93H 3FKIH 3FPUB 2R93G 5KGUA 3SR1A 4QY7A 4GKJQ 1V43A 1XMQQ 3I90A 3F1ZA 2LS01 2R92B 4Q0FA 5EKKA 1EYAA 3GTJH 1YNJC 3FEWX 2CW0D 1A2UA 4X3SA 2ZXRA 1PV4A 5JJKA 5M5WB 1HNWQ 2LMCB 4CJ2C 2R61A 1BO0A 4P72A 1I6HB 3CMAA 2KJXA 1HUNA 1AFPA 1KL9A 1QVCA 2D0OA 2A68C 5HGTA 3M7NA 5BN5A 1PH5A 2CWAA 3SK6A 3GTOB 1EQRA 3NQTA 5D65A 1DGSA 2MHVA 1KAAA 4EGVA 1E2VA 2IJ0A 1A3UA 1YHAA 4P74A 5IYBG 2QEXA 3GTKB 4RGTA 5H1SE 4A3FB 1PMRA 4NKLA 2A1AA 5M5XB 5CV7A 1SSOA 1KNEA 2D9UA 3I56A 3C2PA 1H9SB 1LT6D 3CW2C 3KLSX 3ULJA 2CH4W 1VMPA 3I73A 1DONA 4RGMA 5IGEA 3EQLC 3PSIA 3EA6A 3QB3A 5T1GA 1XPUA 1D6EC 1X56A 5M3FH 4DV0L 1FYCA 3V2TA 1HTPA 4ALPA 1NJIC 1YVCA 3OHXC 4L6TB 4OEMB 1HZ9A 3AFPA 2PMZE 3IKJA 4K0KQ 1HZBA 1QILA 2EYFA 2IHEA 3WOFA 3K80C 4A3LH 3HKZB 5EPJA 2XWBB 1E1TA 3LNNA 3O13A 4YWLA 2X6GA 5IYDH 1CKNA 2ZXPA 2IX3A 2BA1A 3J80E 3U58A 2EZVA 1UEBA 3HOXH 4A3KG 5F2DA 2BDNA 1RD9D 3PIOA 2AUKA 1JB7A 1JMCA 3QOJA 1UUPA 2K14A 1Q8KA 4IUTA 1DOLA 2FMCA 2B63G 4JYAQ 5KEEA 5KNCA 4HIOA 2WB1G 1SMXA 5BR8Q 3KJOA 1TWFH 2QEJC 2QF7A 1GHKA 1VS0A 3Q0AA 2GVAA 1JJCB 3BG3A 1CA6A 4IOAA 2PZWA 2MP1A 4CGYB 4A3EH 4K6DA 1Z7TA 2N78A 1I6HH 4CKBA 1FGBD 3HOVG 1EY7A 2KENA 2HD3A 5CGKA 2NVTH 3DEPA 3A7LA 2WB1B 3PUXA 3F2BA 4A3DG 3CCQA 3F2CA 2JA6H 1Q1BA 2E76C 4OX9L 2UUBQ 3I4NG 3TBIB 1MJEA 2XTIA 3F8TA 3R2TA 4A3FH 2KUMA 4A3FG 1VQ9A 1B1ZA 3I4MG 2E75C 2PI2A 1XPRA 3K7UC 4LW1A 2VXWA 4DV2L 1NR4A 1SE2A 1EWCA 3D8GA 4ZKBB 1F77A 1NTGA 3F2UA 2ZTDA 1ONLA 2EY1A 2V1CC 5CBEE 1LACA 1VQPA 1NAPA 5ELNA 1BBXC 1ILPA 3HOUB 2IW3A 3Q24A 1H9JA 4JOIC 4KLKA 5M3FB 3S1MB 5GQOA 3NTKA 1HNWL 3KYHC 2F0IA 1F2LA 1TU2B 3FDTA 4EX5A 5KYIA 2K05A 4OO1H 5FLXE 1TS2A 1X3EA 1PH8A 4OO1G 5HGQA 5KRUA 1XMOL 1DJRD 2CVRA 1PRTC 5FLMH 5FLXL 3PIO3 2WINB 5EJWA 3OWEB 4CBVA 2FMMA 3MEFA 1PZKD 3CQZB 3Q22A 4G7HC 4DV6Q 1XTDA 1ZXTA 2I5LX 3QWNA 2R93B 2NYZD 1K28A 5C3EH 2UUCL 1RL2A 2Q8TA 3CPWA 1U4PA 1LTTD 1P16A 3I3CA 3S2DB 1I5FA 3GTJB 1YNND 4M8AA 1II3A 2IHFA 4DUYL 2M2LA 3K7AB 3J81c 1KTKA 4P75A 4KN4C 2HHHQ 3T1HL 4FF3A 1M4VA 4C1NI 1SDFA 2L15A 3HOVB 2F0TA 2Z4IA 4JG2A 4APVA 1SNQA 1KHIA 2NWGA 4DV6L 1F9PA 3TEHB 1TWFB 4A3BH 3CMEA 1J5EQ 3MWYW 1PTOH 3DWAA 2UUAL 2OTJA 1NSNS 1L2FA 3C3LA 1PZID 5CMDA 1SNDA 2JA7B 1K3RA 4GLVB 1HUMA 5K5PA 1WI5A 2NTTA 1B2TA 2NN6I 3DXJC 5IYCG 3M4YA 1V1PA 1TWGB 1YITA 2B2UC 1TWCB 4C3JG 1R4QB 2VW9A 4OIKA 4OWWB 2JP1A 4KMUC 2B2UA 2CKZB 4GLAC 3HKZG 3K0XA 2K03A 2L4NA 1SYEA 2RDGA 3GDEA 5KNDA 1KDCA 3TN2A 3EIVA 4IQZA 1QZGA 2ICIA 4H13C 5C44G 3EJIA 3PO3G 1WCMH 4X66Q 1CQFA 4MTNA 3PO2H 1N9WA 3W5OA 2Q2IA 4K5VA 3GTPH 2ZXOA 4AYBB 1J8IA 4DN4M 3S2HB 1EY5A 1STBA 4ULLA 1CQVA 1VQLA 2NZHA 4JW0A 3STBC 2WAQG 3DWPA 4I65A 4GNXC 2VS1A 4JK1C 5C5LA 1X6OA 1X55A 4BA1I 2AHOB 5IODA 5EGTA 4A3DB 4KJOA 4CKCA 5M3MG 4L63B 1BCPC 3GV6A 4CDDC 2YTYA 5ELBA 1SNCA 4XYQA 3VR6A 4GOPC 2JA8G 4C2MB 2CWPA 4DNIA 5KYLA 1NMGA 1O78A 2TSSA 1SLJA 4LF4Q 4WJ3M 1EZ6A 3S15H 3I72A 1ZYRD 4LFCL 1RHPA 3NK9A 2LXJA 4PMBA 3PO3B 1CM9A 4DR1Q 4A3MH 5NUCA 4GN3B 4DV3Q 4OXPA 1VQ5A 1RTOA 1WCMG 3E0EA 3MFYA 2N3SA 2AQ2B 1SAPA 3R3OA 3R2IA 4OGQC 4DUZQ 1LTLA 2L0CA 1I6VC 1SMYD 2QA4A 1PFBA 5JEAJ 3J81i 1FR3A 2K75A 4C3JB 2EYPA 4JBJA 4HJ7A 1SFOB 1HPCA 2PW7A 4IOCA 4XYOA 1IHZA 3IFTA 5AJ3Q 3MZ5A 4JOIA 3J7ZC 3HFZB 3KUPA 3HEJA 2JN4A 2KCMA 1CTMA 3ZJYC 3H0GH 1XX8A 1LTAD 1EWIA 1I4RA 5IGGA 3K81C 5IP7H 4KV6A 1YBYA 2ZJRA 1TWHB 4LUVA 1K83B 1SROA 3CC4A 1GD7A 2LY7A 3IL8A 2R3ZA 1ILQA 1E0BA 4ZRZA 3FKIB 2BH2A 2XWJB 4JC0A 1WTOA 1K73C 1V9PA 3OYYA 4NB3A 4PMCA 1YNXA 3KF6A 5ELCA 1IKMA 2B2WC 4C3IH 3QO2A 3E0JA 1IW7D 4XDXA 1AE2A 3MHBA 1VQOA 1QOHA 2PZUA 3CQZH 2B63B 2A6EC 1UNSA 1VQGA 2F0HA 2K5DA 2AWNA 4A93B 1PTOC 3A5ZB 3S16B 4DU9A 4CKEA 3S2DH 2DY7A 3NHHA 4X3UA 5DM73 4DXGA 4IALA 1GUGA 3H15A 4FDBA 1GJXA 2A69C 4OX9Q 2WACA 1Y1WH 5LMUQ 1YZ6A 3FP9A 2NVYB 2V4DA 3RLFA 1Y14B 4LFAL 2VQEQ 5EQ0A 2PNHA 4ME3A 5C6AA 5LMNW 2E5LQ 1Z9FA 1A6XA 3OIPA 1TVXA 3TP8A 2KHJA 1STYA 2XVSA 1SNMA 1HR0W 2F0QA 1KQSA 3NBIA 2AUJD 2UXBL 2O5JC 5DAUA 2A19A 4ID6A 4IUUA 3TSSA 2EJFC 2B2WA 2FHTA 1CKOA 1G2SA 4PNYA 4YY3L 3FPPA 1A3VA 1D5MC 3MXUA 4A3LG 3Q8DA 1QNUA 1TIID 2B2TC 2A74C 2F0PA 4DXFA 3TRZA 1S4ZA 2I46A 4JBWA 4BY1B 5M9OA 4C1NK 1CA5A 3CAMA 2IPKD 5M3MB 5IGCA 5C44B 1STGA 3RR5A 3D31A 3GP7A 1ZEQX 3RLNA 4FP5D 3PUWA 1CT1D 4DV3L 1D1KA 5IGFA 4X64Q 1AEXA 1SN8A 4DA2A 3M4OB 2JSOA 1X3FA 4KKUA 5I9PA 5CORA 5C5MA 1CI3M 3KJPA 4JI5Q 2UXDQ 3NBHA 2XRSD 2MJ8A 1STNA 2EY2A 3T1YL 2CHBD 1SE8A 3I91A 3RZOB 3KLSA 2NVQB 4ZCKA 2ES2A 4BBRB 4O1NA 4WJ4A 2JA6G 2EE1A 2WAQE 3ICEA 3PIPA 1U5KA 1XWEA 3OTOQ 3BVZA 4KK7A 1S72A 4L8JA 3I4MH 3QR8A 3VA7A 2Q8RE 4ME5A 4KHPL 1HR0Q 4OHJA 4BY7B 1GO3E 4I7AA 1R9TH 1FJGL 4POFA 4NPSA 2NB0A 1GXDC 4DR3Q 1B44D 2EY6A 2JEBI 3S1NH 2N88A 2HHHL 3TZUA 2LSSA 3EVQA 2E2HB 2E2IB 4DR4Q 3ONAB 4B3TQ 1EWHA 1VQKA 2QW7A 1YNNC 3NUCA 5GAEC 1A15A 2QDBA 1LUZA 3A56A 3TQYA 5K36G 5IYBH 1C4QA 3S9WA 4OL7A 2H5XA 1CHQD 5FJ8G 2ZTCA 1TS4A 1EY0A 3KF8A 3VA5A 2H4OA 3PIP3 1BBWA 1PH6A 1SE4A 3H91A 3S17B 3BDLA 4DR4L 1B53A 1IYUA 1G8ZD 5FKAC 4C3IB 5C44H 1D8LA 4CDEC 1U4MA 4B3TL 3MFGA 3BZDB 4LK1C 1N8RC 2OWOA 3I4NH 3PO2G 4NXML 1Y1VB 4A3JG 1WYDA 4PZ6A 3FVQA 5IP9H 3GTMB 4DV1L 4QL5A 1EQTA 1SYFA 4X62L 1X9NA 3PUYA 3S1RB 4RCNA 4DNRB 3GTQB 2UUAQ 1D7QA 1SXTA 2B2YA 4R8IA 2RDFA 3DEOA 4B3SL 1VQFA 1PFMA 4FF2A 2YU9B 4DK6C 2XGTA 1VQMA 4L5SA 1HRJA 2VUMG 1A62A 2EOTA 4PZ7A 1WJJA 1H9KA 1EL0A 2NBFA 3PCOB 4BWGB 1MGSA 3MEHA 3KDFB 4POGA 3I8ZA 2PCFB 2F4VQ 1A0IA 3MXNA 3I4MB 4P71A 2UU9L 4RG1A 1L0XB 1IL8A 1I4XA 4YCWA 4QCLA 1TWAH 3LWEA 2BA0A 3ULPA 2RHSB 1CSPA 4TQUS 4JI8Q 1HQRD 1N33L 3UDIA 1RDPD 1WTHA 2CQOA 4KJNA 2O5IC 1ZYRC 1G291 3NTHA 1OXUA 1OXSC 1S5DD 4A3KB 2KBNA 4IJHA 2G9DA 3E3XA 4WFN3 5LL6X 2Z4HA 1YHQA 1EQQA 1B8AA 1MSGA 4AIMA 5I2YA 4QUCA 3T1YQ 1L1OA 1BOSA 3SGIA 2JA5H 4DV4L 3W3AA 1RODA 2VUMH 4K14A 1D5XC 1O7LA 1MIUA 2F0UA 2KOLA 2EY5A 3H94A 5M3MH 4F7XA 3RN5A 3IRBA 1ENAA 1LLRD 3A5UA 3PO2B 3DWQA 3GTGB 1G2TA 4H7BA 2VL6A 5GADC 5IGBA 1GM5A 4K8JA 2KHIA 2AWOA 3QIAA 5E4WC 2F4IA 1W6JA 5D14A 2G5DA 4Y7NH 1IKLA 4YWKA 3A74A 2NVQH 3RZOH 4B3RQ 3K5OA 2L5TA 1NY4A 4L5TA 5EKLA 1B4OA 4FXDA 3SXHA 5C4XB 2L9HA 5CV8A 2JA9A 5C3XA 1WTQA 1K8OA 2R6GA 1WVLA 4R4OA 1QJOA 1UAPA 3S14H 4IPDA 3E9IA 1JR0D 3E9HA 1K83H 4A3MB 3NENA 3OIQA 4BY7H 2EIFA 1J9OA 4RCOA 2WAQB 1VQ8A 5LHY1 2MFIA 3K8AA 4TKOB 2WKCA 3S1NB 2DY8A 1EIGA 2C9OA 3J7AV 1EU3A 4JCVE 3NXWA 1AZPA 2QKIC 2RQXA 3W2DA 4EQPA 1I50B 5L37A 1Q90A 3OMCA 1ENCA 4OIJA 4X3TA 1PRTB 2UXCL 5FK9C 4DAPA 1MSHA 1JB3A 3B6YA 1Q1EA 4LFAQ 4DK3C 2D62A 4N8X1 1CKMA 3PUZA 1DYQA 3I70A 1Q81C 2JA5B 4PMWA 4O2DA 4GLXA 1TXYA 1W6KA 2OXPA 4UHVA 1UE6A 1GUNA 3LGJA 1JJ2A 2RVLA 4A76A 2DJFC 3T51B 1E24A 4PZ8A 3HOZH 2C35B 2PI2E 1BXTA 4EQNA 2EXDA 2Z6KC 4PG3A 4HIMA 4EQOA 1IBMQ 1JOQA 2B63H 5IT9L 3EBEA 3PV0A 1L0YB 3DM3A 3CCUA 3HKSA 5JPMC 5C4JB 2PO4A 2K52A 4NW2A 1PH4A 1NMFA 1TQOA 4HEDA 1FJGQ 1A3TA 3TREA 3D6WA 1QNKA 4AQYL 5C4XH 1R4PB 1CUKA 1XNRQ 1PRTD 3VR4A 4JI1L 4R4TA 1KABA 4XIGS 4WRDA 1Y8PB 1EFID 2YYZA 1BCPD 3H6MA 3RUZA 3SVMA 4B9XA 1DM0B 3D4DA 3FMCA 4R9WA 1SBBB 2Z1CA 1LTID 1KXLA 1WOCA 4C3HH 2L1BA 1BUVT 4CHTB 1DZ1A 3TP5A 1IYVA 3CRLC 2ASBA 1PYWD 2R7ZB 5I6YA 4JVZA 3HOWH 5DEHA 4HMIA 4YIJA 2FFKB 1BBUA 4JBMA 3A0JA 1JC7A 2JE6I 2Z6KA 1LT5D 4P73A 1DD2A 1EYGA 2F52A 3KOJA 3AYHB 2A8VA 1N32Q 1K0SA 4A3IG 4DV0Q 2RSNA 2CQAA 1C48A 4QB4A 2VB2X 4A93G 1JORA 1TKWB 3NQIA 4RAUC 3S1MH 2F0GA 4ZYSA 4FXGC 5LMNL 5CYUA 4K0KL 3GTLB 3TDQA 3JAME 5HURA 3CU7A 3PF5A 1LV9A 2HQEA 2OF1A 1RJTA 2F0EA 3NP8A 1VQIA 3OW7A 2XIWA 3H09A 3R93A 5GAHC 4RFBA 2Z6BA 4LF5Q 5EAYA 4C3IG 2RSOA 1MJCA 4HJ8A 3HS0C 4TVAB 1KAWA 2BE5D 1H9MA 1J6QA 4KI0A 4A75A 4BBRH 4YY3Q 1FL0A 3TMEA 4BBRG 4ZK9B 4LF9L 4BBSH 4GKJL 2DNEA 1JCKB 3C1FA 3VR5A 1GKHA 4UY8C 1NNXA 1XNQQ 1WTRA 2ZJPA 3KBXA 1WTWA 1FVIA 3CRKC 4AYBE 1I4GA 2F0MA 5I4DA 2Z9HA 5CC4A 4JI7L 2JA8B 2K4KA 1D2BA 3LWUA 2D2CC 2VZAA 3I7FA 4X65Q 2IWHA 1SYCA 2B2YC 3VR2A 3TS0A 2JA7H 2LKVA 1IBKL 3TS2A 1ENFA 2F0FA 5A2QL 1BDOA 1DXMA 1BQQT 2EPBA 1T5XD 4RKLA 4DAMA 4LFBQ 4RA8A 2YTVA 1N36L 2EYJA 3VYRA 2B29A 1S5BD 4G7ZC 1O7ZA 4KN7C 1SJHD 3NBHB 1S5ED 1I94L 1TS3A 5JPNC 2MGSA 3F2DA 1S5FD 1S5CD 1EOTA 3GTQH 4DV1Q 3L9AX 4LNQA 2ATWA 1EOVA 2B2VC 4TSSA 4HJ5A 1PTOD 4WJWA 1VF5C 5JJZA 3BU2A 3GTPB 4LF6L 2Q2HA 3J7AF 2A6ED 1SYBA 5TSSA 1B70B 2K7VA 5E1FA 5C4HA 3DMUA 1H9SA 2AQ1B 4H44C 5EPLA 1Y1VH 4DR1L 2PQAB 4AH6A 4RH6A 2JA7G 3D3RA 1IL2A 4YHHL 1K8AC 1JOKA 4MN3A 2HT1A 1SJED 1V1QA 1L0WA 5M5WH 3NPPA 4RHSA 1ICFB 2RCFA 4QIWB 2KQ3A 4JI3L 3D6CA 2CCZA 2M9VA 2OT2A 1GUTA 1VQBA 5EKIA 3U9SA 2HDLA 4HN7A 4GNXA 2ZM6L 3HOYB 4HCEA 4ZUIA 1WTVA 4YHHQ 4A4IA 3WOEA 2F0WA 5EPKA 2ZTEA 2MO1A 5JEAH 4B3RL 4CDFC 1Q82C 3TP6A 1GUOA 1SRUA 4JPBW 4U68A 3CP0A 4BY7G 3H3VC 4X64L 4JI3Q 1IBLL 1HJPA 3VYSA 4UP9A 1B9MA 4MIUA 5E4XA 4AYBG 2JA5G 1AE3A 1KRSA 1UE7A 4JI5L 2UXDL 3E5SA 3U4ZA 3M3YB 3NELA 1NE3A 2E2JH 4F8MA 2ALYB 2PQEA 5FO7B 4DR7L 4QQBX 1F9RA 1HTLD 1C7YA 2C5CA 2R7ZG 1ESRA 3P7JA 4MHEA 4HJAA 3OWFA 4X66L 2QILA 4LF9Q 3CKIB 5ELDA 1HNZQ 3U4VA 1DOKA 4FO2A 3KF6B 2WKDA 4R8NA 2EJGC 2OEOA 1PZJD 4ODGA 4IPHA 2JK8A 5FJ8H 2QGQA 4LAAA 2EYMA 2A6HC 3RMHA 1DOMA 4UAIA 1QVGA 1IXRA 1MBYA 4Q5VA 1CZGA 1PXUA 4ZQ3A 2F3IA 1A63A 4NXMQ 3WDNA 2H1EA 4XXEA 4QMGA 1SNOA 3J81j 4IURA 3IFDA 2Q2UA 2EVBA 1NBWA 3J81L 4B9WA 4HMJA 1ASYA 2HCCA 3U50C 4JI6Q 2O4XA 4B08A 1G51A 4XQQA 1F2ZA 2O2LD 3D4WA 3G71A 2K5HA 3T1HQ 3HOYH 3DM1A 3HOYG 1F9SA 2NVXH 1BVSA 1PYBA 1XNQL 1LT3D 1CKNB 3SDZA 5DM63 1QZHA 1HZCA 3CHBD 3UDFA 3JAMc 1K8GA 4EVOA 1WTXA 4IO9A 1PRTF 1EY4A 3FKIG 3NTIA 4DV7Q 4KD4A 1ZKOA 5LL6S 1EYCA 1Q46A 3M7GA 4X62Q 4JI6L 1HZAA 4YCUA 3M4OH 1SMYC 1VQCA 3M3YH 5EBDA 3UI2A 5FO8B 4ZUJA 1I3QB 2NN6G 2DN8A 5BN3A 3C46A 1GVPA 1KD1C 4LFBL 1KNAA 5CV9A 4RGNA 1NR2A 2K04A 3RD4A 4BY1H 5IP7G 4LF4L 5JVG3 1YIJA 5BN4A 3FRPB 3GD7A 3VR3A 2KEEA 3D4RA 2JJQA 5C0XG 2E8GA 3ZYYX 2IX1A 3HOZB 1EIYB 1SYDA 1X3PA 1EUJA 3CCRA 3BYYB 1VQHA 3NEMA 4HR7B 4G57A 2ENBA 3KK7A 4HSPA 2BDOA 3MTSA 2J7ZA 1K9MC 3N52A 5M5YB 1CZWA 1L1OB 3J81E 4DR7Q 2AQ3B 5J39A 1LM0A 3NSWA 5BR8L 1FNWA 3A8IE 1ET9A 4I7ZC 3V96A 1QCBD 3ER0A 1WD0A 1JWUD 3MA2B 1OXTA 2QCPX 5FO9B 1E2ZA 4CJ0B 4LMQD 3S24A 1Y1WG 4A3GB 1G6PA 3QOLA 3NWTA 3HOWG 1TWCH 1I4HA 1STAA 4JI4Q 2KEDA 2KECA 1D5ZC 3HOUG 2WFWA 3MXNB 5LMNQ 3TP7A 1K3BC 3HOWB 1U4LA 2EQSA 2E2IH 3GV3A 1BCPB 4JI7Q 2MQHA 5C4XG 2KCTA 4O0AA 4DV2Q 1SE3A 1JOOA 1XJVA 4A3CH 3MAQA 1KRTA 1K0RA 5D3IB 1PHJA 4A3DH 4ZLTF 5C3EG 2RCNA 3S2HH 2RDHA 1PH7A 2YU9H 1HXYD 4OWXB 2K6AA 1A8VA 2RF4A 2KHSA 1WTPA 3AB9A 1F2YA 4PQXA 4QJFA 1VQ4A 4CJ1B 2J0TD 4LF8Q 3J7A5 5I6WA 3SE0A 5ELOA 1ICWA 1K8MA 1FGUA 3KFUA 1XMQL 2E5LL 5J3BA 2OQ0A 4H02A 4HTHA 2FXQA 3BS1A 3HZXA 1TWAB 3OW2A 2HQLA 2DUDA 1KC8C 1HH2P 4E6IA 3K5LA 5T1IA 3S15B 1BCPF 3EN2A 4H0LC 2ZJQA 1PDQA 3TZDA 1XPOA 1ASZA 3MXGA 4FXKC 5M5XH 3HP3A 3T13A 3Q23A 4A3CG 3L0OA 4FVMA 2LFNA 2J4XA 5IGDA 3BDCA 2A73B 1TWHH 4F87A 4ZAIA 1XYIA 3WWVA 3RZDB 4A3GH 1MI2A 2CH4A 4IN3A 1FNUA 4X6AH 4DR5Q 1VQEA 1Q3LA 4GZYC 1HFGA 4K2KA 1IBML 1YEZA 1B9NA 3A7AB 1PTOF 1Q12A 1IW7C 1TR5A 2AMCB 2ICEC 3RLOA 3OSOA 2E2DC 3H3VH 3K6OA 2EYLA 1WFQA 2ZT9C 3BZCA 2UXBQ 1EYDA 1CHPD 1GUWA 1H9RA 4C56C 1LABA 4IUQA 4UP8A 2PZTA 2NTSA 4GN4B 1PH2A 4L5QA 1X65A 4UPAA 2BOSA 4LF7Q 4KKSA 5A2QE 4GNXB 5C3WA 3PF4A 2N49A 2Y0SG 4IFDG 1EIHA 4IUVA 2M00A 1KLUD 3S14B 4A93H 3HOXB 2AKWB 2NVTB 1U0LA 1KIXA 5IYCH 5K36H 5AFWA 2WV6D 1W3SA 2RA4A 2JA6B 4R4IA 1SNPA 2F0NA 1RKNA 1UWVA 3UDXA 1G6ZA 4HSVA 2X69A 4GS3A 3SEBA 2G9HD 1KLGD 4HJ9A 1T5EA 1DCZA 2PQAA 1N36Q 1Y1WB 2E74C 1B3AA 4A3GG 1JWMD 2MPMA 3ND8A 1I50H 1PFNA 5DLQE 1IYJB 1EQVA 1WD1A 2F0OA 1C9OA 1CK1A 1Z6HA 5CV4A 2TMPA 1MD2D 1C0AA 3CC7A 3CCEA 1H95A 1VCIA 1Y8OB 4UDUC 4K8IA 5HY6A 1B50A 5C4ZA 3RZDH 2CW0C 3P20A 4RMFA 3KDFA 4IFDH 3JAML 4DV5Q 1U4RA 2BH8A 1HFNA 1HQMC 2SDFA 3DHQA 4IPGA 2Q8IB 3V05A 5ELFA 1VQJA 4OELB 3T16A 4QF4A 3K5NA 1VQDA 2HIVA 2K5WA 2KVMA 4G7OC 1TY0A 1Z47A 3BVMA 4K6LA 2NUCA 4DAYB 3C1EA 4RGOS 4DR2Q 5C3EB 4NMZA 4NXNQ 1AP0A 4DV5L 3KLRA 3A8JE 5A35A 5C4JH 4KY5A 1EEID 4K5WA 4OWTB 3SK5A 2VQFL 2SNSA 4JI0Q 1ML0D 1F9QA 1TT2A 3HRZC 4V190 1PTOB 2CFMA 2JEAI 1PH1A 3X3NA 3NE5B 1RF2D 2F0LA 3LX0A 3IAYA 4QIWE 1JE5A 3L3OC 4YCVA 3SK4A 1F2MA 4LF6Q 1QUQB 4JBKA 4KY6A 1RTNA 1TWGH 4OONA 5CBAE 1QUQA 2R92G 3A8KE 2Y0SB 4Y52H 3CXCA 2L55A 3X3MA 4NDXA 5CV5A 2IY5B 3T53B 4N9TA 1XTCD 2P5ZX 1PFSA 1J5EL 2K5NA 3VDYA 2VNUD 1HA6A 4J1MA 4DV7L 3CCVA 1EU4A 5G3LF 4JI4L 3T56B 4UP7A 1ET6A 3H3VI 1OTCA 3HGBA 3JAMi 2HCIA 2F03A 1N34Q 1A2TA 3JC66 5DNFA 1JE4A 5IT9E 3L7ZC 1AZQA 4LJZC 4CDCC 2NVXB 4RWSC 2UU9Q 4DR6L 5IOCA 2Y0SE 2E2HH 1VQ6A 1X3GA 4DK1A 3K57A 5G3LD 1Y69U 2DJGC 4XQJA 4K2LA 3H0GG 1QE6A 5FOBB 1N34L 1LTSD 4RHRA 1BNZA 4GOPB 3VYUA 3I4LA 1Q86C 5E3FA 2R92H 2WIIB 3M9BA 4ILWA 3GTMH 1EY9A 3A54A 3CCMA 3S1RH 1CFMA 3E6ZX 4GKKL 2L12A 2I0QA 3PUVA 1JT8A 1RIPA 2SEBD 3G48A 4DPGA 2K5VA 1LTBD 5M3FG 2XN9C 1LTGD 1OXVA 3GTLH 1GOZA 3GTOH 4XT3B 2MUYA 1RCVD 1PVOA 5JJLA 3J80L 4BA2I 1QG7A 1VQNA 2SOBA 4GKKQ 5KIXA 5CR3A 2I07B 3W1GA 2F1MA 2DGYA 4XQNA 1U9RA 2NZOA 3UE1A 5CV6A 3M85A 2NZ1D 3D0FA 2UXCQ 2PYKA 5ELEA 2KCCA 4HCSA 3CCJA 5M5YH 3UDGA 1BKBA 1SR3A 4A3KH 4BBSB 1X32A 4QGUA 4DK0A 4M1UB 4KHPQ 2K1BA 5COYA 1FD7D 2B3GA 4JV5L 4DGZA 1EY8A 1NUCA 3K5MA 3K0YA 2K50A 4K5XA 5AJ3L 2VUMB 2GA4B 4F88A 1MHWC 2B2VA 5EBCA 1PLFA 2F0DA 1EZ8A 2B8FA 3NWSA 1HHVA 4P2CB 4XTCS 2HIXA 3H0GB 4A3EG 3ERQA 2JXMB 2A5HA 2A69D 5E7NA 1TS5A 1Y8NB 2KA7A 5JJIA 1MKHA 1T9HA 5IE8A 1SYGA 1AW7A 1EEFD 2B2TA 4IJLA 1HA5A 5C0XJ 1HNXQ 4JI2L 3KBGA 2B8GA 4KD3A 4LFCQ 3S16H 2YTXA 2F0KA 4BBSG 2PPBC 3R8BA 3U9OA 2D0PA 4GOPA 3G6EA 1TY2A 2SNMA 4JI1Q 1YJWA 4IZ8A 4R4QA 2F3WA 2A6HD 4J15A 4DR2L 5IYDG 4FYDA 1ESFA 4NP5A 1L1OC 1EFWA 3QJYA 4BY1G 4IFDJ 1JICA 1UE1A 2IT1A 3AU7A 3BYTB 4JI2Q 1HNXL 3URYA 4HIDA 3G6JB 1JQYD 1E7ZA 4DKAC 4FF1A 4J8QA 3MVVA 2UUCQ 4QUFA 4OO1I 1UE5A 3KLWA 1O7IA 3DUZA 4PV1C 1GUSA 1OXXK 4BXXG 1G91A 5D3DA 2R7DA 1YHBA 4B3SQ 2YV5A 4YWMA 1S3OA 2LXKA 3HKZE 4IPCA 2NVYH 2VQEL 4DUYQ 3CC2A 5JAVA 2FJ2A 5JEAG 3PGZA 4S3SA 1D1IA 5IP9G 4IUNA 3OOCA 2Z8LA 2XNAC 4X65L 2D5DA 3OMGA 1V1OA 4KHVA 1LO5D 3CPFA 3HG9A 2F0JA 3P75A 3SHLA 1VQ7A 1CSQA 1V8QA 2DNCA 1PA6A 1M8AA 3HOXG 1EIFA 1P8LA 1YI2A 4XT1B 4DF7A 2MNAA 2BCOA 3GO5A 2F0SA 4LF5L 3ITPA 1I94Q 3VYTA 4KHZA 2E2JB 4ZKCB 2K32A 4KTAA 3L2PA 3QG1A 1IZ6A 4GN5A 4X3KA 3ULLA 4A3MG 1QWYA 5J22A 4O42A 4LUOA 4DV4Q 4MNOA 2XRQD 2L11A 2JYOA 4N9PA 4DAYA 1JWSD 1HCZA 4HAEA 2EDGA 1SEBD 3HOVH 4KY7A 2PNRC 4DUZL 2OTLA 4BXXH 2K33A 2X6LA 3BZKA 2VY3A 2A68D 3AFQA 5JOBA 4R1JA 1PH3A 2HUGA 3EROA 4WORA 3A55A 1FNVA 1VMCA 3CF5A 4A3JH 4U673 1N33Q 4JYAL 1C8CA 2F3VA 1IBKQ 1E3PA 1LYLA 2PMZB 4NXNL 4LWCA 4BS9A 4DR5L 3K7AH 3G4SA 3OTOL 4C3HB 1M90C 3RN2A 2WP8J 3T4AC 4HIKA 1Y1VG 3DLLA 3I2ZA 1V1PB 1XMOQ 4JI0L 2EYOA 1W2BA 4DR6Q 5J1ZA 3UE0A 1O7YA 1PYSB 4DAVA 1HR0L 2BE5C 2R7ZH 4A3BB 1GHJA 4N8FA 1LT4D 1NCVA 3STBD 1KDAA 1B7YB 3ERSX 3MC0B 3M4PA 1R9TB 1X3QA 2EJMA 4ABNA 1WCMB 2EYHA 2GN5A 4V0BA 4G4KA 5FLMG 1I3QH 2OCEA 5KNBA 1PH9A 2QDLA 3KF8B 1YJ9A 3K59A 2RHQB 3AQQA 3BDOA 4LF8L 4A3IB 3BVGA 1UEAB 4FNFA 5IIFA 3S1QH 2I5MX 5FLXc 2KCNA 2NN6H 2PW5A 1STHA 1S40A 4Z9CB 4L5RC 1XXGA 3PMFA 4EQ5A 3AMUA 1E1OA 3PQIA 5IT9c 2ID0A 2WB1E 5GAGC 1STEA 3HOZG 3I4NB 3J7YW 5I9OA 3K58A 3GQBA 1BF4A 5LMUL 2Q2TA 1VF7A 4C2MH 1KDBA 2MO0A 4MZ9A 3I55A 3FHWA 4A3BG 1Q7YC 3P1HA 3S17H 1E2WA 2VB3X 2B39A 1HNZL 1AH9A 5ISRA 4J6HA 2R7FA 2N8NA 4LUZA 4FF4A 1I4QA 4TRDA 3MXPA 4A3EB 4IFDI 2IL8A 2XSCA 3CD6A 3J80c 2JA8H 2EXZA 1Q8IA 4C3JH 4A3JB 3GTKH 4B3MQ 2GVBA 1YNJD 1IBLQ 2IX0A 1I4PA 1O80A 5IY0A 5GROA 3I4OA 2JQOA 2K5QA 4JV5Q 2OQKA 3M4QA 3OPOA 2F4VL 4KKTA 4MTKA 1E22A 3G7LA 1B3QA 4C3HG 1N32L 2RKSA 1XNRL 3PO3H 5IWAQ 4RKBA 1X54A 3CCSA 4AQYQ 5C0XI 3EFXD 1EY6A 1OO9B 4JI8L 3ND9A 1M1KC 2Z0SA 4R4CA 2RBMA 3N6RA 4B3ML 2F0VA 3Q6SA 3CCLA 4LF7L 2N55A 1JJGA 1LTRD 4DNTB
chains in the Genus database with same CATH topology
2YTVA 1N36L 4DV5Q 3HOUH 4JBWA 2BH8A 2B29A 2VQFQ 1VQAA 3GTGH 4IPGA 1SFOH 1VQJA 2ZM6Q 3NBHB 3CAMA 1I94L 3BJUA 5IWAL 4DR3L 4A3IH 1VQDA 2HIVA 3F2DA 2UUBL 3GTQH 3RR5A 4DV1Q 3D31A 1Z47A 4LNQA 3RLNA 1QVFA 1EOVA 3PUWA 4DV3L 2ATWA 3W1BA 4HJ5A 2I5HA 3J80i 4DAYB 3RNUA 1YJNA 4DR2Q 4X64Q 4NXNQ 3AEVA 2R93H 1SN8A 3FKIH 4DV5L 2R93G 3BU2A 4GKJQ 4QY7A 1X3FA 4LF6L 2Q2HA 5C4JH 1V43A 4OWTB 1XMQQ 3F1ZA 1B70B 2VQFL 3KJPA 4JI5Q 2UXDQ 3GTJH 4JI0Q 3T1YL 1SE8A 1Y1VH 4DR1L 2CFMA 2PQAB 1PV4A 5JJKA 4AH6A 2ES2A 2JEAI 1PH1A 1HNWQ 2JA7G 1IL2A 4WJ4A 2JA6G 4YHHL 1K8AC 2WAQE 4P72A 3ICEA 3PIPA 2HT1A 4QIWE 1JE5A 3CMAA 1U5KA 1V1QA 4YCVA 1L0WA 5M5WH 3OTOQ 4LF6Q 1KL9A 1QUQB 1QVCA 2D0OA 4JI3L 2CCZA 4JBKA 1S72A 3I4MH 3M7NA 1PH5A 2CWAA 1TWGH 1EQRA 1VQBA 4OONA 1QUQA 2R92G 1DGSA 4KHPL 1HR0Q 4Y52H 3CXCA 1YHAA 1GO3E 4P74A 5IYBG 2QEXA 4GNXA 1R9TH 5H1SE 4POFA 4NPSA 2ZM6L 1FJGL 2IY5B 1J5EL 1PFSA 2K5NA 2A1AA 4DR3Q 3VDYA 2VNUD 4DV7L 4YHHQ 3CCVA 4A4IA 4JI4L 2JEBI 4UP7A 3I56A 3S1NH 2ZTEA 2MO1A 3CW2C 3ULJA 3H3VI 1OTCA 2HHHL 3JAMi 4B3RL 1Q82C 1N34Q 1SRUA 3PSIA 2LSSA 3JC66 3CP0A 4BY7G 4X64L 4JI3Q 4DR4Q 4B3TQ 3L7ZC 1VQKA 1IBLL 1HJPA 5GAEC 4UP9A 1XPUA 1LUZA 1X56A 5M3FH 3TQYA 4DV0L 4AYBG 2UU9Q 5IYBH 2Y0SE 1AE3A 1KRSA 1UE7A 2E2HH 2JA5G 5K36G 1VQ6A 1X3GA 4JI5L 4ALPA 1NJIC 2UXDL 3U4ZA 3NELA 1NE3A 2E2JH 2H5XA 2ALYB 5FJ8G 2ZTCA 4DR7L 1YVCA 4QQBX 1C7YA 2R7ZG 3H0GG 3AFPA 1HZ9A 2PMZE 4DR6L 1N34L 1HZBA 4HJAA 4K0KQ 2IHEA 1BBWA 3K80C 4A3LH 1PH6A 4DR4L 4X66L 5C44H 4GOPB 1Q86C 4LF9Q 1E1TA 1D8LA 4YWLA 2R92H 5IYDH 3M9BA 1CKNA 1HNZQ 3U4VA 3GTMH 4B3TL 2BA1A 3U58A 3KF6B 1UEBA 3CCMA 3HOXH 3S1RH 1N8RC 4JI6L 4A3KG 2OWOA 4GKKL 3I4NH 3PO2G 2I0QA 4NXML 3PUVA 1WYDA 4A3JG 1JT8A 4PZ6A 1RIPA 3PIOA 4IPHA 5IP9H 2JK8A 5FJ8H 4QL5A 4DV1L 2QGQA 3G48A 4DPGA 4X62L 1X9NA 3PUYA 1JB7A 1JMCA 2K14A 1Q8KA 2K5VA 2UUAQ 2B63G 4JYAQ 1D7QA 1QVGA 4B3SL 1IXRA 5M3FG 1VQFA 1OXVA 4HIOA 3GTLH 3GTKH 4DK6C 2WB1G 2XGTA 1VQMA 1SMXA 5BR8Q 3KJOA 1TWFH 4L5SA 3GTOH 2VUMG 1A62A 4PZ7A 1WJJA 2F3IA 1VS0A 1PVOA 2GVAA 1JJCB 5JJLA 1A63A 4IOAA 4BA2I 3PCOB 4A3EH 1VQNA 4NXMQ 2N78A 3J81j 1I6HH 3KDFB 4POGA 4GKKQ 3HOVG 2Q2UA 2F4VQ 1A0IA 1NBWA 3W1GA 2KENA 2DGYA 2NVTH 4P71A 1ASYA 2UU9L 2NZOA 4RG1A 3UE1A 3M85A 3PUXA 3D0FA 3F2BA 2UXCQ 3U50C 4YCWA 4A3DG 3CCQA 1TWAH 3ULPA 2BA0A 3F2CA 4JI6Q 1Q1BA 2RHSB 4OX9L 2UUBQ 2JA6H 3I4NG 1CSPA 1G51A 2XTIA 4TQUS 4JI8Q 5M5YH 3CCJA 3UDGA 1MJEA 1BKBA 1SR3A 4A3KH 1N33L 3F8TA 3UDIA 4A3FH 3G71A 3T1HQ 2K5HA 3HOYH 2CQOA 4A3FG 3HOYG 1VQ9A 1G291 3I4MG 2NVXH 1BVSA 1PYBA 2PI2A 4QGUA 3K7UC 1XPRA 1XNQL 4LW1A 1CKNB 1OXUA 1OXSC 4KHPQ 1QZHA 4DV2L 1HZCA 3UDFA 2KBNA 3JAMc 1K8GA 2B3GA 4IJHA 4JV5L 1NTGA 2ZTDA 4IO9A 2K50A 2V1CC 3FKIG 5AJ3L 1VQPA 4DV7Q 1YHQA 5ELNA 1EQQA 1B8AA 4AIMA 3T1YQ 1L1OA 4JOIC 1Q46A 4KLKA 4XTCS 3SGIA 4X62Q 4DV4L 2HIXA 5GQOA 4A3EG 2JA5H 3KYHC 1HZAA 4YCUA 1HNWL 4EX5A 2VUMH 3M4OH 5E7NA 3M3YH 1VQCA 1MIUA 4OO1G 1X3EA 1PH8A 5M3MH 3RN5A 5JJIA 1MKHA 1T9HA 3IRBA 5HGQA 5IE8A 1XMOL 2NN6G 1GVPA 1KD1C 3A5UA 4LFBL 5FLMH 4IJLA 5C0XJ 4BY1H 1HNXQ 3MEFA 5IP7G 4JI2L 4LF4L 2VL6A 5GADC 1GM5A 4DV6Q 1XTDA 1YIJA 2I5LX 4LFCQ 2KHIA 5C3EH 2AWOA 2UUCL 3S16H 2YTXA 3GD7A 1RL2A 3CPWA 4BBSG 2JJQA 1P16A 2D0PA 4GOPA 5C0XG 2E8GA 3G6EA 1I5FA 2IX1A 4JI1Q 4Y7NH 1YJWA 4R4QA 4YWKA 2IHFA 4J15A 4DUYL 1EIYB 4DR2L 3A74A 3J81c 5IYDG 4P75A 2NVQH 3RZOH 1EUJA 3CCRA 2HHHQ 1VQHA 3NEMA 3T1HL 4B3RQ 1L1OC 2L15A 1EFWA 1NY4A 4JG2A 4L5TA 4BY1G 4APVA 1KHIA 4IFDJ 4DV6L 1UE1A 3TEHB 2IT1A 4JI2Q 1HNXL 2JA9A 4HIDA 4DKAC 4A3BH 1E7ZA 3CMEA 2R6GA 4R4OA 3S14H 1J5EQ 2UUAL 2UUCQ 2OTJA 4IPDA 4OO1I 3E9IA 1UE5A 3KLWA 1K9MC 1L2FA 1O7IA 1L1OB 4BXXG 1OXXK 3E9HA 2R7DA 4DR7Q 1K83H 1YHBA 4B3SQ 2YV5A 3NENA 1K3RA 1LM0A 4YWMA 4BY7H 2EIFA 1S3OA 2LXKA 4GLVB 3HKZE 1VQ8A 5BR8L 1WI5A 4IPCA 2NVYH 2VQEL 4DUYQ 3CC2A 2NN6I 2MFIA 5IYCG 3ER0A 3K8AA 5JEAG 1YITA 3PGZA 1OXTA 4JCVE 2VW9A 5IP9G 3S24A 1Y1WG 4OWWB 1G6PA 3HOWG 2CKZB 4GLAC 3HKZG 3K0XA 1TWCH 4X65L 3GDEA 2UXCL 3EIVA 1QZGA 4JI4Q 3B6YA 3CPFA 1Q1EA 4LFAQ 4DK3C 5C44G 2D62A 1CSQA 1VQ7A 3HOUG 2WFWA 3MXNB 5LMNQ 1WCMH 3PO3G 4X66Q 1CKMA 3PUZA 4MTNA 3PO2H 1N9WA 1PA6A 3W5OA 2EQSA 1Q81C 2Q2IA 3HOXG 1EIFA 2E2IH 4PMWA 3GTPH 4O2DA 4GLXA 1P8LA 1TXYA 1YI2A 4JI7Q 2MQHA 1UE6A 3LGJA 2KCTA 4O0AA 4DV2Q 5C4XG 2MNAA 1XJVA 1JJ2A 4A76A 4A3CH 3GO5A 4LF5L 1KRTA 1VQLA 1K0RA 2NZHA 3STBC 1PHJA 1I94Q 4A3DH 4KHZA 2WAQG 5C3EG 2RCNA 1E24A 4PZ8A 3S2HH 3L2PA 3HOZH 1IZ6A 4GN5A 2C35B 3ULLA 1PH7A 4GNXC 2PI2E 2VS1A 4A3MG 4OWXB 2YU9H 1A8VA 2RF4A 1X6OA 4LUOA 1X55A 2EXDA 2Z6KC 4PG3A 2AHOB 4MNOA 4BA1I 4DV4Q 4HIMA 4QJFA 1VQ4A 5M3MG 1IBMQ 4LF8Q 3J7A5 3HOVH 2B63H 5ELOA 3EBEA 2YTYA 3PV0A 2JA8G 4DUZL 2OTLA 4GOPC 4BXXH 3DM3A 1FGUA 3KFUA 2CWPA 1XMQL 2E5LL 5J3BA 2OQ0A 4DNIA 4H02A 3CCUA 1NMGA 3HKSA 2FXQA 3BZKA 2K52A 2VY3A 1SLJA 1PH4A 4LF4Q 3S15H 1NMFA 4WJ3M 1FJGQ 3AFQA 4LFCL 2LXJA 3TREA 4R1JA 1PH3A 4DR1Q 3OW2A 2HQLA 4GN3B 2DUDA 5C4XH 4DV3Q 4AQYL 4A3MH 3CF5A 1CUKA 1HH2P 4A3JH 4OXPA 1KC8C 1WCMG 1VQ5A 1N33Q 1XNRQ 4JYAL 3E0EA 3EN2A 1IBKQ 1E3PA 1LYLA 4NXNL 4JI1L 2N3SA 4R4TA 2ZJQA 4LWCA 4XIGS 4DR5L 1XPOA 3K7AH 2YYZA 4DUZQ 3G4SA 1ASZA 3OTOL 1LTLA 1M90C 5M5XH 3RN2A 2WP8J 4HIKA 1Y1VG 2QA4A 4A3CG 3DLLA 3L0OA 3I2ZA 5JEAJ 3J81i 1XMOQ 2K75A 4JI0L 4JBJA 4HJ7A 1W2BA 4DR6Q 3UE0A 1KXLA 1PYSB 1WOCA 1HR0L 4C3HH 1TWHH 4IOCA 2R7ZH 5AJ3Q 4JOIA 3J7ZC 3HFZB 3STBD 2KCMA 1B7YB 3ZJYC 3H0GH 3ERSX 3WWVA 1EWIA 3M4PA 2ASBA 3K81C 5IP7H 2ZJRA 1YBYA 4A3GH 4LUVA 2GN5A 3HOWH 1SROA 1I3QH 2OCEA 5FLMG 1GD7A 1PH9A 3CC4A 3KF8B 4X6AH 1BBUA 1VQEA 4DR5Q 3A0JA 1YJ9A 4JBMA 2JE6I 2Z6KA 2BH2A 2RHQB 3AQQA 1IBML 4LF8L 4P73A 1YEZA 1EYGA 4JC0A 2F52A 1K73C 3KOJA 1V9PA 1Q12A 2AMCB 3AYHB 3OYYA 4NB3A 2A8VA 2I5MX 5FLXc 4A3IG 3S1QH 1N32Q 4DV0Q 1S40A 3RLOA 4L5RC 4A93G 1YNXA 4EQ5A 3H3VH 3KF6A 3BZCA 1WFQA 2UXBQ 4C3IH 1E1OA 5IT9c 2ID0A 2WB1E 5GAGC 3HOZG 1AE2A 3S1MH 4UP8A 1VQOA 5LMNL 3CQZH 4K0KL 4GN4B 1PH2A 4L5QA 1X65A 4UPAA 4LF7Q 1VQGA 5LMUL 2Q2TA 4C2MH 4MZ9A 2AWNA 2MO0A 3A5ZB 3I55A 3FHWA 4A3BG 1Q7YC 3S17H 3PF5A 4GNXB 3PF4A 1HNZL 3S2DH 1AH9A 2N49A 2Y0SG 4IFDG 1VQIA 5GAHC 4A93H 2R7FA 3H15A 4LF5Q 2N8NA 2AKWB 5EAYA 1U0LA 4FDBA 1KIXA 1MJCA 4LUZA 5IYCH 4HJ8A 4TVAB 1KAWA 1W3SA 1J6QA 4KI0A 4A75A 4OX9Q 4R4IA 4IFDI 1UWVA 1Y1WH 3UDXA 4BBRH 5LMUQ 4YY3Q 1FL0A 1YZ6A 4GS3A 3FP9A 4BBRG 4LF9L 3RLFA 4BBSH 3CD6A 4GKJL 3J80c 1Y14B 4LFAL 1GKHA 2VQEQ 4HJ9A 4UY8C 2JA8H 1XNQQ 2PNHA 2PQAA 4ME3A 4C3JH 2ZJPA 5LMNW 1N36Q 2GVBA 1FVIA 1Z9FA 1IBLQ 2IX0A 4AYBE 5IY0A 4B3MQ 4A3GG 5GROA 3I4OA 2JQOA 4JV5Q 1I50H 2E5LQ 4JI7L 5DLQE 1IYJB 2OQKA 2KHJA 3M4QA 2F4VL 2K4KA 1E22A 1N32L 1C9OA 2VZAA 1HR0W 3I7FA 4X65Q 1XNRL 3PO3H 5IWAQ 1X54A 1KQSA 3CCSA 1C0AA 4AQYQ 2UXBL 3CC7A 5C0XI 2A19A 3CCEA 1H95A 1VCIA 1CKOA 4JI8L 3TS0A 2JA7H 1M1KC 1IBKL 3TS2A 4YY3L 5HY6A 2Z0SA 4R4CA 4B3ML 4A3LG 3RZDH 3Q8DA 3CCLA 4LF7L 4RMFA 3TRZA 3KDFA 1JJGA 4DAMA 4LFBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTV A;  1N36 L;  4DV5 Q;  3HOU H;  4JBW A;  2BH8 A;  2B29 A;  2VQF Q;  1VQA A;  3GTG H;  4IPG A;  1SFO H;  1VQJ A;  2ZM6 Q;  3NBH B;  3CAM A;  1I94 L;  3BJU A;  5IWA L;  4DR3 L;  4A3I H;  1VQD A;  2HIV A;  3F2D A;  2UUB L;  3GTQ H;  3RR5 A;  4DV1 Q;  3D31 A;  1Z47 A;  4LNQ A;  3RLN A;  1QVF A;  1EOV A;  3PUW A;  4DV3 L;  2ATW A;  3W1B A;  4HJ5 A;  2I5H A;  3J80 i;  4DAY B;  3RNU A;  1YJN A;  4DR2 Q;  4X64 Q;  4NXN Q;  3AEV A;  2R93 H;  1SN8 A;  3FKI H;  4DV5 L;  2R93 G;  3BU2 A;  4GKJ Q;  4QY7 A;  1X3F A;  4LF6 L;  2Q2H A;  5C4J H;  1V43 A;  4OWT B;  1XMQ Q;  3F1Z A;  1B70 B;  2VQF L;  3KJP A;  4JI5 Q;  2UXD Q;  3GTJ H;  4JI0 Q;  3T1Y L;  1SE8 A;  1Y1V H;  4DR1 L;  2CFM A;  2PQA B;  1PV4 A;  5JJK A;  4AH6 A;  2ES2 A;  2JEA I;  1PH1 A;  1HNW Q;  2JA7 G;  1IL2 A;  4WJ4 A;  2JA6 G;  4YHH L;  1K8A C;  2WAQ E;  4P72 A;  3ICE A;  3PIP A;  2HT1 A;  4QIW E;  1JE5 A;  3CMA A;  1U5K A;  1V1Q A;  4YCV A;  1L0W A;  5M5W H;  3OTO Q;  4LF6 Q;  1KL9 A;  1QUQ B;  1QVC A;  2D0O A;  4JI3 L;  2CCZ A;  4JBK A;  1S72 A;  3I4M H;  3M7N A;  1PH5 A;  2CWA A;  1TWG H;  1EQR A;  1VQB A;  4OON A;  1QUQ A;  2R92 G;  1DGS A;  4KHP L;  1HR0 Q;  4Y52 H;  3CXC A;  1YHA A;  1GO3 E;  4P74 A;  5IYB G;  2QEX A;  4GNX A;  1R9T H;  5H1S E;  4POF A;  4NPS A;  2ZM6 L;  1FJG L;  2IY5 B;  1J5E L;  1PFS A;  2K5N A;  2A1A A;  4DR3 Q;  3VDY A;  2VNU D;  4DV7 L;  4YHH Q;  3CCV A;  4A4I A;  4JI4 L;  2JEB I;  4UP7 A;  3I56 A;  3S1N H;  2ZTE A;  2MO1 A;  3CW2 C;  3ULJ A;  3H3V I;  1OTC A;  2HHH L;  3JAM i;  4B3R L;  1Q82 C;  1N34 Q;  1SRU A;  3PSI A;  2LSS A;  3JC6 6;  3CP0 A;  4BY7 G;  4X64 L;  4JI3 Q;  4DR4 Q;  4B3T Q;  3L7Z C;  1VQK A;  1IBL L;  1HJP A;  5GAE C;  4UP9 A;  1XPU A;  1LUZ A;  1X56 A;  5M3F H;  3TQY A;  4DV0 L;  4AYB G;  2UU9 Q;  5IYB H;  2Y0S E;  1AE3 A;  1KRS A;  1UE7 A;  2E2H H;  2JA5 G;  5K36 G;  1VQ6 A;  1X3G A;  4JI5 L;  4ALP A;  1NJI C;  2UXD L;  3U4Z A;  3NEL A;  1NE3 A;  2E2J H;  2H5X A;  2ALY B;  5FJ8 G;  2ZTC A;  4DR7 L;  1YVC A;  4QQB X;  1C7Y A;  2R7Z G;  3H0G G;  3AFP A;  1HZ9 A;  2PMZ E;  4DR6 L;  1N34 L;  1HZB A;  4HJA A;  4K0K Q;  2IHE A;  1BBW A;  3K80 C;  4A3L H;  1PH6 A;  4DR4 L;  4X66 L;  5C44 H;  4GOP B;  1Q86 C;  4LF9 Q;  1E1T A;  1D8L A;  4YWL A;  2R92 H;  5IYD H;  3M9B A;  1CKN A;  1HNZ Q;  3U4V A;  3GTM H;  4B3T L;  2BA1 A;  3U58 A;  3KF6 B;  1UEB A;  3CCM A;  3HOX H;  3S1R H;  1N8R C;  4JI6 L;  4A3K G;  2OWO A;  4GKK L;  3I4N H;  3PO2 G;  2I0Q A;  4NXM L;  3PUV A;  1WYD A;  4A3J G;  1JT8 A;  4PZ6 A;  1RIP A;  3PIO A;  4IPH A;  5IP9 H;  2JK8 A;  5FJ8 H;  4QL5 A;  4DV1 L;  2QGQ A;  3G48 A;  4DPG A;  4X62 L;  1X9N A;  3PUY A;  1JB7 A;  1JMC A;  2K14 A;  1Q8K A;  2K5V A;  2UUA Q;  2B63 G;  4JYA Q;  1D7Q A;  1QVG A;  4B3S L;  1IXR A;  5M3F G;  1VQF A;  1OXV A;  4HIO A;  3GTL H;  3GTK H;  4DK6 C;  2WB1 G;  2XGT A;  1VQM A;  1SMX A;  5BR8 Q;  3KJO A;  1TWF H;  4L5S A;  3GTO H;  2VUM G;  1A62 A;  4PZ7 A;  1WJJ A;  2F3I A;  1VS0 A;  1PVO A;  2GVA A;  1JJC B;  5JJL A;  1A63 A;  4IOA A;  4BA2 I;  3PCO B;  4A3E H;  1VQN A;  4NXM Q;  2N78 A;  3J81 j;  1I6H H;  3KDF B;  4POG A;  4GKK Q;  3HOV G;  2Q2U A;  2F4V Q;  1A0I A;  1NBW A;  3W1G A;  2KEN A;  2DGY A;  2NVT H;  4P71 A;  1ASY A;  2UU9 L;  2NZO A;  4RG1 A;  3UE1 A;  3M85 A;  3PUX A;  3D0F A;  3F2B A;  2UXC Q;  3U50 C;  4YCW A;  4A3D G;  3CCQ A;  1TWA H;  3ULP A;  2BA0 A;  3F2C A;  4JI6 Q;  1Q1B A;  2RHS B;  4OX9 L;  2UUB Q;  2JA6 H;  3I4N G;  1CSP A;  1G51 A;  2XTI A;  4TQU S;  4JI8 Q;  5M5Y H;  3CCJ A;  3UDG A;  1MJE A;  1BKB A;  1SR3 A;  4A3K H;  1N33 L;  3F8T A;  3UDI A;  4A3F H;  3G71 A;  3T1H Q;  2K5H A;  3HOY H;  2CQO A;  4A3F G;  3HOY G;  1VQ9 A;  1G29 1;  3I4M G;  2NVX H;  1BVS A;  1PYB A;  2PI2 A;  4QGU A;  3K7U C;  1XPR A;  1XNQ L;  4LW1 A;  1CKN B;  1OXU A;  1OXS C;  4KHP Q;  1QZH A;  4DV2 L;  1HZC A;  3UDF A;  2KBN A;  3JAM c;  1K8G A;  2B3G A;  4IJH A;  4JV5 L;  1NTG A;  2ZTD A;  4IO9 A;  2K50 A;  2V1C C;  3FKI G;  5AJ3 L;  1VQP A;  4DV7 Q;  1YHQ A;  5ELN A;  1EQQ A;  1B8A A;  4AIM A;  3T1Y Q;  1L1O A;  4JOI C;  1Q46 A;  4KLK A;  4XTC S;  3SGI A;  4X62 Q;  4DV4 L;  2HIX A;  5GQO A;  4A3E G;  2JA5 H;  3KYH C;  1HZA A;  4YCU A;  1HNW L;  4EX5 A;  2VUM H;  3M4O H;  5E7N A;  3M3Y H;  1VQC A;  1MIU A;  4OO1 G;  1X3E A;  1PH8 A;  5M3M H;  3RN5 A;  5JJI A;  1MKH A;  1T9H A;  3IRB A;  5HGQ A;  5IE8 A;  1XMO L;  2NN6 G;  1GVP A;  1KD1 C;  3A5U A;  4LFB L;  5FLM H;  4IJL A;  5C0X J;  4BY1 H;  1HNX Q;  3MEF A;  5IP7 G;  4JI2 L;  4LF4 L;  2VL6 A;  5GAD C;  1GM5 A;  4DV6 Q;  1XTD A;  1YIJ A;  2I5L X;  4LFC Q;  2KHI A;  5C3E H;  2AWO A;  2UUC L;  3S16 H;  2YTX A;  3GD7 A;  1RL2 A;  3CPW A;  4BBS G;  2JJQ A;  1P16 A;  2D0P A;  4GOP A;  5C0X G;  2E8G A;  3G6E A;  1I5F A;  2IX1 A;  4JI1 Q;  4Y7N H;  1YJW A;  4R4Q A;  4YWK A;  2IHF A;  4J15 A;  4DUY L;  1EIY B;  4DR2 L;  3A74 A;  3J81 c;  5IYD G;  4P75 A;  2NVQ H;  3RZO H;  1EUJ A;  3CCR A;  2HHH Q;  1VQH A;  3NEM A;  3T1H L;  4B3R Q;  1L1O C;  2L15 A;  1EFW A;  1NY4 A;  4JG2 A;  4L5T A;  4BY1 G;  4APV A;  1KHI A;  4IFD J;  4DV6 L;  1UE1 A;  3TEH B;  2IT1 A;  4JI2 Q;  1HNX L;  2JA9 A;  4HID A;  4DKA C;  4A3B H;  1E7Z A;  3CME A;  2R6G A;  4R4O A;  3S14 H;  1J5E Q;  2UUA L;  2UUC Q;  2OTJ A;  4IPD A;  4OO1 I;  3E9I A;  1UE5 A;  3KLW A;  1K9M C;  1L2F A;  1O7I A;  1L1O B;  4BXX G;  1OXX K;  3E9H A;  2R7D A;  4DR7 Q;  1K83 H;  1YHB A;  4B3S Q;  2YV5 A;  3NEN A;  1K3R A;  1LM0 A;  4YWM A;  4BY7 H;  2EIF A;  1S3O A;  2LXK A;  4GLV B;  3HKZ E;  1VQ8 A;  5BR8 L;  1WI5 A;  4IPC A;  2NVY H;  2VQE L;  4DUY Q;  3CC2 A;  2NN6 I;  2MFI A;  5IYC G;  3ER0 A;  3K8A A;  5JEA G;  1YIT A;  3PGZ A;  1OXT A;  4JCV E;  2VW9 A;  5IP9 G;  3S24 A;  1Y1W G;  4OWW B;  1G6P A;  3HOW G;  2CKZ B;  4GLA C;  3HKZ G;  3K0X A;  1TWC H;  4X65 L;  3GDE A;  2UXC L;  3EIV A;  1QZG A;  4JI4 Q;  3B6Y A;  3CPF A;  1Q1E A;  4LFA Q;  4DK3 C;  5C44 G;  2D62 A;  1CSQ A;  1VQ7 A;  3HOU G;  2WFW A;  3MXN B;  5LMN Q;  1WCM H;  3PO3 G;  4X66 Q;  1CKM A;  3PUZ A;  4MTN A;  3PO2 H;  1N9W A;  1PA6 A;  3W5O A;  2EQS A;  1Q81 C;  2Q2I A;  3HOX G;  1EIF A;  2E2I H;  4PMW A;  3GTP H;  4O2D A;  4GLX A;  1P8L A;  1TXY A;  1YI2 A;  4JI7 Q;  2MQH A;  1UE6 A;  3LGJ A;  2KCT A;  4O0A A;  4DV2 Q;  5C4X G;  2MNA A;  1XJV A;  1JJ2 A;  4A76 A;  4A3C H;  3GO5 A;  4LF5 L;  1KRT A;  1VQL A;  1K0R A;  2NZH A;  3STB C;  1PHJ A;  1I94 Q;  4A3D H;  4KHZ A;  2WAQ G;  5C3E G;  2RCN A;  1E24 A;  4PZ8 A;  3S2H H;  3L2P A;  3HOZ H;  1IZ6 A;  4GN5 A;  2C35 B;  3ULL A;  1PH7 A;  4GNX C;  2PI2 E;  2VS1 A;  4A3M G;  4OWX B;  2YU9 H;  1A8V A;  2RF4 A;  1X6O A;  4LUO A;  1X55 A;  2EXD A;  2Z6K C;  4PG3 A;  2AHO B;  4MNO A;  4BA1 I;  4DV4 Q;  4HIM A;  4QJF A;  1VQ4 A;  5M3M G;  1IBM Q;  4LF8 Q;  3J7A 5;  3HOV H;  2B63 H;  5ELO A;  3EBE A;  2YTY A;  3PV0 A;  2JA8 G;  4DUZ L;  2OTL A;  4GOP C;  4BXX H;  3DM3 A;  1FGU A;  3KFU A;  2CWP A;  1XMQ L;  2E5L L;  5J3B A;  2OQ0 A;  4DNI A;  4H02 A;  3CCU A;  1NMG A;  3HKS A;  2FXQ A;  3BZK A;  2K52 A;  2VY3 A;  1SLJ A;  1PH4 A;  4LF4 Q;  3S15 H;  1NMF A;  4WJ3 M;  1FJG Q;  3AFQ A;  4LFC L;  2LXJ A;  3TRE A;  4R1J A;  1PH3 A;  4DR1 Q;  3OW2 A;  2HQL A;  4GN3 B;  2DUD A;  5C4X H;  4DV3 Q;  4AQY L;  4A3M H;  3CF5 A;  1CUK A;  1HH2 P;  4A3J H;  4OXP A;  1KC8 C;  1WCM G;  1VQ5 A;  1N33 Q;  1XNR Q;  4JYA L;  3E0E A;  3EN2 A;  1IBK Q;  1E3P A;  1LYL A;  4NXN L;  4JI1 L;  2N3S A;  4R4T A;  2ZJQ A;  4LWC A;  4XIG S;  4DR5 L;  1XPO A;  3K7A H;  2YYZ A;  4DUZ Q;  3G4S A;  1ASZ A;  3OTO L;  1LTL A;  1M90 C;  5M5X H;  3RN2 A;  2WP8 J;  4HIK A;  1Y1V G;  2QA4 A;  4A3C G;  3DLL A;  3L0O A;  3I2Z A;  5JEA J;  3J81 i;  1XMO Q;  2K75 A;  4JI0 L;  4JBJ A;  4HJ7 A;  1W2B A;  4DR6 Q;  3UE0 A;  1KXL A;  1PYS B;  1WOC A;  1HR0 L;  4C3H H;  1TWH H;  4IOC A;  2R7Z H;  5AJ3 Q;  4JOI A;  3J7Z C;  3HFZ B;  3STB D;  2KCM A;  1B7Y B;  3ZJY C;  3H0G H;  3ERS X;  3WWV A;  1EWI A;  3M4P A;  2ASB A;  3K81 C;  5IP7 H;  2ZJR A;  1YBY A;  4A3G H;  4LUV A;  2GN5 A;  3HOW H;  1SRO A;  1I3Q H;  2OCE A;  5FLM G;  1GD7 A;  1PH9 A;  3CC4 A;  3KF8 B;  4X6A H;  1BBU A;  1VQE A;  4DR5 Q;  3A0J A;  1YJ9 A;  4JBM A;  2JE6 I;  2Z6K A;  2BH2 A;  2RHQ B;  3AQQ A;  1IBM L;  4LF8 L;  4P73 A;  1YEZ A;  1EYG A;  4JC0 A;  2F52 A;  1K73 C;  3KOJ A;  1V9P A;  1Q12 A;  2AMC B;  3AYH B;  3OYY A;  4NB3 A;  2A8V A;  2I5M X;  5FLX c;  4A3I G;  3S1Q H;  1N32 Q;  4DV0 Q;  1S40 A;  3RLO A;  4L5R C;  4A93 G;  1YNX A;  4EQ5 A;  3H3V H;  3KF6 A;  3BZC A;  1WFQ A;  2UXB Q;  4C3I H;  1E1O A;  5IT9 c;  2ID0 A;  2WB1 E;  5GAG C;  3HOZ G;  1AE2 A;  3S1M H;  4UP8 A;  1VQO A;  5LMN L;  3CQZ H;  4K0K L;  4GN4 B;  1PH2 A;  4L5Q A;  1X65 A;  4UPA A;  4LF7 Q;  1VQG A;  5LMU L;  2Q2T A;  4C2M H;  4MZ9 A;  2AWN A;  2MO0 A;  3A5Z B;  3I55 A;  3FHW A;  4A3B G;  1Q7Y C;  3S17 H;  3PF5 A;  4GNX B;  3PF4 A;  1HNZ L;  3S2D H;  1AH9 A;  2N49 A;  2Y0S G;  4IFD G;  1VQI A;  5GAH C;  4A93 H;  2R7F A;  3H15 A;  4LF5 Q;  2N8N A;  2AKW B;  5EAY A;  1U0L A;  4FDB A;  1KIX A;  1MJC A;  4LUZ A;  5IYC H;  4HJ8 A;  4TVA B;  1KAW A;  1W3S A;  1J6Q A;  4KI0 A;  4A75 A;  4OX9 Q;  4R4I A;  4IFD I;  1UWV A;  1Y1W H;  3UDX A;  4BBR H;  5LMU Q;  4YY3 Q;  1FL0 A;  1YZ6 A;  4GS3 A;  3FP9 A;  4BBR G;  4LF9 L;  3RLF A;  4BBS H;  3CD6 A;  4GKJ L;  3J80 c;  1Y14 B;  4LFA L;  1GKH A;  2VQE Q;  4HJ9 A;  4UY8 C;  2JA8 H;  1XNQ Q;  2PNH A;  2PQA A;  4ME3 A;  4C3J H;  2ZJP A;  5LMN W;  1N36 Q;  2GVB A;  1FVI A;  1Z9F A;  1IBL Q;  2IX0 A;  4AYB E;  5IY0 A;  4B3M Q;  4A3G G;  5GRO A;  3I4O A;  2JQO A;  4JV5 Q;  1I50 H;  2E5L Q;  4JI7 L;  5DLQ E;  1IYJ B;  2OQK A;  2KHJ A;  3M4Q A;  2F4V L;  2K4K A;  1E22 A;  1N32 L;  1C9O A;  2VZA A;  1HR0 W;  3I7F A;  4X65 Q;  1XNR L;  3PO3 H;  5IWA Q;  1X54 A;  1KQS A;  3CCS A;  1C0A A;  4AQY Q;  2UXB L;  3CC7 A;  5C0X I;  2A19 A;  3CCE A;  1H95 A;  1VCI A;  1CKO A;  4JI8 L;  3TS0 A;  2JA7 H;  1M1K C;  1IBK L;  3TS2 A;  4YY3 L;  5HY6 A;  2Z0S A;  4R4C A;  4B3M L;  4A3L G;  3RZD H;  3Q8D A;  3CCL A;  4LF7 L;  4RMF A;  3TRZ A;  3KDF A;  1JJG A;  4DAM A;  4LFB Q; 
#chains in the Genus database with same CATH topology
 3HOU H;  3SK8 A;  2VQF Q;  1VQA A;  3GTG H;  1SFO H;  1VDZ A;  4IUP A;  2ZM6 Q;  5C0X H;  3BJU A;  5IWA L;  4DR3 L;  4A3I H;  2K28 A;  5JVH 3;  2UUB L;  2K01 A;  3S1Q B;  2FIN B;  1BR9 A;  1QVF A;  4DFA A;  3W1B A;  4Y7N B;  5I2X A;  2I5H A;  3J80 i;  1AN8 A;  3RNU A;  1YJN A;  2HDM A;  1QB5 D;  3AEV A;  2R93 H;  3FKI H;  3FPU B;  2R93 G;  5KGU A;  3SR1 A;  4QY7 A;  4GKJ Q;  1V43 A;  1XMQ Q;  3I90 A;  3F1Z A;  2LS0 1;  2R92 B;  4Q0F A;  5EKK A;  1EYA A;  3GTJ H;  1YNJ C;  3FEW X;  2CW0 D;  1A2U A;  4X3S A;  2ZXR A;  1PV4 A;  5JJK A;  5M5W B;  1HNW Q;  2LMC B;  4CJ2 C;  2R61 A;  1BO0 A;  4P72 A;  1I6H B;  3CMA A;  2KJX A;  1HUN A;  1AFP A;  1KL9 A;  1QVC A;  2D0O A;  2A68 C;  5HGT A;  3M7N A;  5BN5 A;  1PH5 A;  2CWA A;  3SK6 A;  3GTO B;  1EQR A;  3NQT A;  5D65 A;  1DGS A;  2MHV A;  1KAA A;  4EGV A;  1E2V A;  2IJ0 A;  1A3U A;  1YHA A;  4P74 A;  5IYB G;  2QEX A;  3GTK B;  4RGT A;  5H1S E;  4A3F B;  1PMR A;  4NKL A;  2A1A A;  5M5X B;  5CV7 A;  1SSO A;  1KNE A;  2D9U A;  3I56 A;  3C2P A;  1H9S B;  1LT6 D;  3CW2 C;  3KLS X;  3ULJ A;  2CH4 W;  1VMP A;  3I73 A;  1DON A;  4RGM A;  5IGE A;  3EQL C;  3PSI A;  3EA6 A;  3QB3 A;  5T1G A;  1XPU A;  1D6E C;  1X56 A;  5M3F H;  4DV0 L;  1FYC A;  3V2T A;  1HTP A;  4ALP A;  1NJI C;  1YVC A;  3OHX C;  4L6T B;  4OEM B;  1HZ9 A;  3AFP A;  2PMZ E;  3IKJ A;  4K0K Q;  1HZB A;  1QIL A;  2EYF A;  2IHE A;  3WOF A;  3K80 C;  4A3L H;  3HKZ B;  5EPJ A;  2XWB B;  1E1T A;  3LNN A;  3O13 A;  4YWL A;  2X6G A;  5IYD H;  1CKN A;  2ZXP A;  2IX3 A;  2BA1 A;  3J80 E;  3U58 A;  2EZV A;  1UEB A;  3HOX H;  4A3K G;  5F2D A;  2BDN A;  1RD9 D;  3PIO A;  2AUK A;  1JB7 A;  1JMC A;  3QOJ A;  1UUP A;  2K14 A;  1Q8K A;  4IUT A;  1DOL A;  2FMC A;  2B63 G;  4JYA Q;  5KEE A;  5KNC A;  4HIO A;  2WB1 G;  1SMX A;  5BR8 Q;  3KJO A;  1TWF H;  2QEJ C;  2QF7 A;  1GHK A;  1VS0 A;  3Q0A A;  2GVA A;  1JJC B;  3BG3 A;  1CA6 A;  4IOA A;  2PZW A;  2MP1 A;  4CGY B;  4A3E H;  4K6D A;  1Z7T A;  2N78 A;  1I6H H;  4CKB A;  1FGB D;  3HOV G;  1EY7 A;  2KEN A;  2HD3 A;  5CGK A;  2NVT H;  3DEP A;  3A7L A;  2WB1 B;  3PUX A;  3F2B A;  4A3D G;  3CCQ A;  3F2C A;  2JA6 H;  1Q1B A;  2E76 C;  4OX9 L;  2UUB Q;  3I4N G;  3TBI B;  1MJE A;  2XTI A;  3F8T A;  3R2T A;  4A3F H;  2KUM A;  4A3F G;  1VQ9 A;  1B1Z A;  3I4M G;  2E75 C;  2PI2 A;  1XPR A;  3K7U C;  4LW1 A;  2VXW A;  4DV2 L;  1NR4 A;  1SE2 A;  1EWC A;  3D8G A;  4ZKB B;  1F77 A;  1NTG A;  3F2U A;  2ZTD A;  1ONL A;  2EY1 A;  2V1C C;  5CBE E;  1LAC A;  1VQP A;  1NAP A;  5ELN A;  1BBX C;  1ILP A;  3HOU B;  2IW3 A;  3Q24 A;  1H9J A;  4JOI C;  4KLK A;  5M3F B;  3S1M B;  5GQO A;  3NTK A;  1HNW L;  3KYH C;  2F0I A;  1F2L A;  1TU2 B;  3FDT A;  4EX5 A;  5KYI A;  2K05 A;  4OO1 H;  5FLX E;  1TS2 A;  1X3E A;  1PH8 A;  4OO1 G;  5HGQ A;  5KRU A;  1XMO L;  1DJR D;  2CVR A;  1PRT C;  5FLM H;  5FLX L;  3PIO 3;  2WIN B;  5EJW A;  3OWE B;  4CBV A;  2FMM A;  3MEF A;  1PZK D;  3CQZ B;  3Q22 A;  4G7H C;  4DV6 Q;  1XTD A;  1ZXT A;  2I5L X;  3QWN A;  2R93 B;  2NYZ D;  1K28 A;  5C3E H;  2UUC L;  1RL2 A;  2Q8T A;  3CPW A;  1U4P A;  1LTT D;  1P16 A;  3I3C A;  3S2D B;  1I5F A;  3GTJ B;  1YNN D;  4M8A A;  1II3 A;  2IHF A;  4DUY L;  2M2L A;  3K7A B;  3J81 c;  1KTK A;  4P75 A;  4KN4 C;  2HHH Q;  3T1H L;  4FF3 A;  1M4V A;  4C1N I;  1SDF A;  2L15 A;  3HOV B;  2F0T A;  2Z4I A;  4JG2 A;  4APV A;  1SNQ A;  1KHI A;  2NWG A;  4DV6 L;  1F9P A;  3TEH B;  1TWF B;  4A3B H;  3CME A;  1J5E Q;  3MWY W;  1PTO H;  3DWA A;  2UUA L;  2OTJ A;  1NSN S;  1L2F A;  3C3L A;  1PZI D;  5CMD A;  1SND A;  2JA7 B;  1K3R A;  4GLV B;  1HUM A;  5K5P A;  1WI5 A;  2NTT A;  1B2T A;  2NN6 I;  3DXJ C;  5IYC G;  3M4Y A;  1V1P A;  1TWG B;  1YIT A;  2B2U C;  1TWC B;  4C3J G;  1R4Q B;  2VW9 A;  4OIK A;  4OWW B;  2JP1 A;  4KMU C;  2B2U A;  2CKZ B;  4GLA C;  3HKZ G;  3K0X A;  2K03 A;  2L4N A;  1SYE A;  2RDG A;  3GDE A;  5KND A;  1KDC A;  3TN2 A;  3EIV A;  4IQZ A;  1QZG A;  2ICI A;  4H13 C;  5C44 G;  3EJI A;  3PO3 G;  1WCM H;  4X66 Q;  1CQF A;  4MTN A;  3PO2 H;  1N9W A;  3W5O A;  2Q2I A;  4K5V A;  3GTP H;  2ZXO A;  4AYB B;  1J8I A;  4DN4 M;  3S2H B;  1EY5 A;  1STB A;  4ULL A;  1CQV A;  1VQL A;  2NZH A;  4JW0 A;  3STB C;  2WAQ G;  3DWP A;  4I65 A;  4GNX C;  2VS1 A;  4JK1 C;  5C5L A;  1X6O A;  1X55 A;  4BA1 I;  2AHO B;  5IOD A;  5EGT A;  4A3D B;  4KJO A;  4CKC A;  5M3M G;  4L63 B;  1BCP C;  3GV6 A;  4CDD C;  2YTY A;  5ELB A;  1SNC A;  4XYQ A;  3VR6 A;  4GOP C;  2JA8 G;  4C2M B;  2CWP A;  4DNI A;  5KYL A;  1NMG A;  1O78 A;  2TSS A;  1SLJ A;  4LF4 Q;  4WJ3 M;  1EZ6 A;  3S15 H;  3I72 A;  1ZYR D;  4LFC L;  1RHP A;  3NK9 A;  2LXJ A;  4PMB A;  3PO3 B;  1CM9 A;  4DR1 Q;  4A3M H;  5NUC A;  4GN3 B;  4DV3 Q;  4OXP A;  1VQ5 A;  1RTO A;  1WCM G;  3E0E A;  3MFY A;  2N3S A;  2AQ2 B;  1SAP A;  3R3O A;  3R2I A;  4OGQ C;  4DUZ Q;  1LTL A;  2L0C A;  1I6V C;  1SMY D;  2QA4 A;  1PFB A;  5JEA J;  3J81 i;  1FR3 A;  2K75 A;  4C3J B;  2EYP A;  4JBJ A;  4HJ7 A;  1SFO B;  1HPC A;  2PW7 A;  4IOC A;  4XYO A;  1IHZ A;  3IFT A;  5AJ3 Q;  3MZ5 A;  4JOI A;  3J7Z C;  3HFZ B;  3KUP A;  3HEJ A;  2JN4 A;  2KCM A;  1CTM A;  3ZJY C;  3H0G H;  1XX8 A;  1LTA D;  1EWI A;  1I4R A;  5IGG A;  3K81 C;  5IP7 H;  4KV6 A;  1YBY A;  2ZJR A;  1TWH B;  4LUV A;  1K83 B;  1SRO A;  3CC4 A;  1GD7 A;  2LY7 A;  3IL8 A;  2R3Z A;  1ILQ A;  1E0B A;  4ZRZ A;  3FKI B;  2BH2 A;  2XWJ B;  4JC0 A;  1WTO A;  1K73 C;  1V9P A;  3OYY A;  4NB3 A;  4PMC A;  1YNX A;  3KF6 A;  5ELC A;  1IKM A;  2B2W C;  4C3I H;  3QO2 A;  3E0J A;  1IW7 D;  4XDX A;  1AE2 A;  3MHB A;  1VQO A;  1QOH A;  2PZU A;  3CQZ H;  2B63 B;  2A6E C;  1UNS A;  1VQG A;  2F0H A;  2K5D A;  2AWN A;  4A93 B;  1PTO C;  3A5Z B;  3S16 B;  4DU9 A;  4CKE A;  3S2D H;  2DY7 A;  3NHH A;  4X3U A;  5DM7 3;  4DXG A;  4IAL A;  1GUG A;  3H15 A;  4FDB A;  1GJX A;  2A69 C;  4OX9 Q;  2WAC A;  1Y1W H;  5LMU Q;  1YZ6 A;  3FP9 A;  2NVY B;  2V4D A;  3RLF A;  1Y14 B;  4LFA L;  2VQE Q;  5EQ0 A;  2PNH A;  4ME3 A;  5C6A A;  5LMN W;  2E5L Q;  1Z9F A;  1A6X A;  3OIP A;  1TVX A;  3TP8 A;  2KHJ A;  1STY A;  2XVS A;  1SNM A;  1HR0 W;  2F0Q A;  1KQS A;  3NBI A;  2AUJ D;  2UXB L;  2O5J C;  5DAU A;  2A19 A;  4ID6 A;  4IUU A;  3TSS A;  2EJF C;  2B2W A;  2FHT A;  1CKO A;  1G2S A;  4PNY A;  4YY3 L;  3FPP A;  1A3V A;  1D5M C;  3MXU A;  4A3L G;  3Q8D A;  1QNU A;  1TII D;  2B2T C;  2A74 C;  2F0P A;  4DXF A;  3TRZ A;  1S4Z A;  2I46 A;  4JBW A;  4BY1 B;  5M9O A;  4C1N K;  1CA5 A;  3CAM A;  2IPK D;  5M3M B;  5IGC A;  5C44 B;  1STG A;  3RR5 A;  3D31 A;  3GP7 A;  1ZEQ X;  3RLN A;  4FP5 D;  3PUW A;  1CT1 D;  4DV3 L;  1D1K A;  5IGF A;  4X64 Q;  1AEX A;  1SN8 A;  4DA2 A;  3M4O B;  2JSO A;  1X3F A;  4KKU A;  5I9P A;  5COR A;  5C5M A;  1CI3 M;  3KJP A;  4JI5 Q;  2UXD Q;  3NBH A;  2XRS D;  2MJ8 A;  1STN A;  2EY2 A;  3T1Y L;  2CHB D;  1SE8 A;  3I91 A;  3RZO B;  3KLS A;  2NVQ B;  4ZCK A;  2ES2 A;  4BBR B;  4O1N A;  4WJ4 A;  2JA6 G;  2EE1 A;  2WAQ E;  3ICE A;  3PIP A;  1U5K A;  1XWE A;  3OTO Q;  3BVZ A;  4KK7 A;  1S72 A;  4L8J A;  3I4M H;  3QR8 A;  3VA7 A;  2Q8R E;  4ME5 A;  4KHP L;  1HR0 Q;  4OHJ A;  4BY7 B;  1GO3 E;  4I7A A;  1R9T H;  1FJG L;  4POF A;  4NPS A;  2NB0 A;  1GXD C;  4DR3 Q;  1B44 D;  2EY6 A;  2JEB I;  3S1N H;  2N88 A;  2HHH L;  3TZU A;  2LSS A;  3EVQ A;  2E2H B;  2E2I B;  4DR4 Q;  3ONA B;  4B3T Q;  1EWH A;  1VQK A;  2QW7 A;  1YNN C;  3NUC A;  5GAE C;  1A15 A;  2QDB A;  1LUZ A;  3A56 A;  3TQY A;  5K36 G;  5IYB H;  1C4Q A;  3S9W A;  4OL7 A;  2H5X A;  1CHQ D;  5FJ8 G;  2ZTC A;  1TS4 A;  1EY0 A;  3KF8 A;  3VA5 A;  2H4O A;  3PIP 3;  1BBW A;  1PH6 A;  1SE4 A;  3H91 A;  3S17 B;  3BDL A;  4DR4 L;  1B53 A;  1IYU A;  1G8Z D;  5FKA C;  4C3I B;  5C44 H;  1D8L A;  4CDE C;  1U4M A;  4B3T L;  3MFG A;  3BZD B;  4LK1 C;  1N8R C;  2OWO A;  3I4N H;  3PO2 G;  4NXM L;  1Y1V B;  4A3J G;  1WYD A;  4PZ6 A;  3FVQ A;  5IP9 H;  3GTM B;  4DV1 L;  4QL5 A;  1EQT A;  1SYF A;  4X62 L;  1X9N A;  3PUY A;  3S1R B;  4RCN A;  4DNR B;  3GTQ B;  2UUA Q;  1D7Q A;  1SXT A;  2B2Y A;  4R8I A;  2RDF A;  3DEO A;  4B3S L;  1VQF A;  1PFM A;  4FF2 A;  2YU9 B;  4DK6 C;  2XGT A;  1VQM A;  4L5S A;  1HRJ A;  2VUM G;  1A62 A;  2EOT A;  4PZ7 A;  1WJJ A;  1H9K A;  1EL0 A;  2NBF A;  3PCO B;  4BWG B;  1MGS A;  3MEH A;  3KDF B;  4POG A;  3I8Z A;  2PCF B;  2F4V Q;  1A0I A;  3MXN A;  3I4M B;  4P71 A;  2UU9 L;  4RG1 A;  1L0X B;  1IL8 A;  1I4X A;  4YCW A;  4QCL A;  1TWA H;  3LWE A;  2BA0 A;  3ULP A;  2RHS B;  1CSP A;  4TQU S;  4JI8 Q;  1HQR D;  1N33 L;  3UDI A;  1RDP D;  1WTH A;  2CQO A;  4KJN A;  2O5I C;  1ZYR C;  1G29 1;  3NTH A;  1OXU A;  1OXS C;  1S5D D;  4A3K B;  2KBN A;  4IJH A;  2G9D A;  3E3X A;  4WFN 3;  5LL6 X;  2Z4H A;  1YHQ A;  1EQQ A;  1B8A A;  1MSG A;  4AIM A;  5I2Y A;  4QUC A;  3T1Y Q;  1L1O A;  1BOS A;  3SGI A;  2JA5 H;  4DV4 L;  3W3A A;  1ROD A;  2VUM H;  4K14 A;  1D5X C;  1O7L A;  1MIU A;  2F0U A;  2KOL A;  2EY5 A;  3H94 A;  5M3M H;  4F7X A;  3RN5 A;  3IRB A;  1ENA A;  1LLR D;  3A5U A;  3PO2 B;  3DWQ A;  3GTG B;  1G2T A;  4H7B A;  2VL6 A;  5GAD C;  5IGB A;  1GM5 A;  4K8J A;  2KHI A;  2AWO A;  3QIA A;  5E4W C;  2F4I A;  1W6J A;  5D14 A;  2G5D A;  4Y7N H;  1IKL A;  4YWK A;  3A74 A;  2NVQ H;  3RZO H;  4B3R Q;  3K5O A;  2L5T A;  1NY4 A;  4L5T A;  5EKL A;  1B4O A;  4FXD A;  3SXH A;  5C4X B;  2L9H A;  5CV8 A;  2JA9 A;  5C3X A;  1WTQ A;  1K8O A;  2R6G A;  1WVL A;  4R4O A;  1QJO A;  1UAP A;  3S14 H;  4IPD A;  3E9I A;  1JR0 D;  3E9H A;  1K83 H;  4A3M B;  3NEN A;  3OIQ A;  4BY7 H;  2EIF A;  1J9O A;  4RCO A;  2WAQ B;  1VQ8 A;  5LHY 1;  2MFI A;  3K8A A;  4TKO B;  2WKC A;  3S1N B;  2DY8 A;  1EIG A;  2C9O A;  3J7A V;  1EU3 A;  4JCV E;  3NXW A;  1AZP A;  2QKI C;  2RQX A;  3W2D A;  4EQP A;  1I50 B;  5L37 A;  1Q90 A;  3OMC A;  1ENC A;  4OIJ A;  4X3T A;  1PRT B;  2UXC L;  5FK9 C;  4DAP A;  1MSH A;  1JB3 A;  3B6Y A;  1Q1E A;  4LFA Q;  4DK3 C;  2D62 A;  4N8X 1;  1CKM A;  3PUZ A;  1DYQ A;  3I70 A;  1Q81 C;  2JA5 B;  4PMW A;  4O2D A;  4GLX A;  1TXY A;  1W6K A;  2OXP A;  4UHV A;  1UE6 A;  1GUN A;  3LGJ A;  1JJ2 A;  2RVL A;  4A76 A;  2DJF C;  3T51 B;  1E24 A;  4PZ8 A;  3HOZ H;  2C35 B;  2PI2 E;  1BXT A;  4EQN A;  2EXD A;  2Z6K C;  4PG3 A;  4HIM A;  4EQO A;  1IBM Q;  1JOQ A;  2B63 H;  5IT9 L;  3EBE A;  3PV0 A;  1L0Y B;  3DM3 A;  3CCU A;  3HKS A;  5JPM C;  5C4J B;  2PO4 A;  2K52 A;  4NW2 A;  1PH4 A;  1NMF A;  1TQO A;  4HED A;  1FJG Q;  1A3T A;  3TRE A;  3D6W A;  1QNK A;  4AQY L;  5C4X H;  1R4P B;  1CUK A;  1XNR Q;  1PRT D;  3VR4 A;  4JI1 L;  4R4T A;  1KAB A;  4XIG S;  4WRD A;  1Y8P B;  1EFI D;  2YYZ A;  1BCP D;  3H6M A;  3RUZ A;  3SVM A;  4B9X A;  1DM0 B;  3D4D A;  3FMC A;  4R9W A;  1SBB B;  2Z1C A;  1LTI D;  1KXL A;  1WOC A;  4C3H H;  2L1B A;  1BUV T;  4CHT B;  1DZ1 A;  3TP5 A;  1IYV A;  3CRL C;  2ASB A;  1PYW D;  2R7Z B;  5I6Y A;  4JVZ A;  3HOW H;  5DEH A;  4HMI A;  4YIJ A;  2FFK B;  1BBU A;  4JBM A;  3A0J A;  1JC7 A;  2JE6 I;  2Z6K A;  1LT5 D;  4P73 A;  1DD2 A;  1EYG A;  2F52 A;  3KOJ A;  3AYH B;  2A8V A;  1N32 Q;  1K0S A;  4A3I G;  4DV0 Q;  2RSN A;  2CQA A;  1C48 A;  4QB4 A;  2VB2 X;  4A93 G;  1JOR A;  1TKW B;  3NQI A;  4RAU C;  3S1M H;  2F0G A;  4ZYS A;  4FXG C;  5LMN L;  5CYU A;  4K0K L;  3GTL B;  3TDQ A;  3JAM E;  5HUR A;  3CU7 A;  3PF5 A;  1LV9 A;  2HQE A;  2OF1 A;  1RJT A;  2F0E A;  3NP8 A;  1VQI A;  3OW7 A;  2XIW A;  3H09 A;  3R93 A;  5GAH C;  4RFB A;  2Z6B A;  4LF5 Q;  5EAY A;  4C3I G;  2RSO A;  1MJC A;  4HJ8 A;  3HS0 C;  4TVA B;  1KAW A;  2BE5 D;  1H9M A;  1J6Q A;  4KI0 A;  4A75 A;  4BBR H;  4YY3 Q;  1FL0 A;  3TME A;  4BBR G;  4ZK9 B;  4LF9 L;  4BBS H;  4GKJ L;  2DNE A;  1JCK B;  3C1F A;  3VR5 A;  1GKH A;  4UY8 C;  1NNX A;  1XNQ Q;  1WTR A;  2ZJP A;  3KBX A;  1WTW A;  1FVI A;  3CRK C;  4AYB E;  1I4G A;  2F0M A;  5I4D A;  2Z9H A;  5CC4 A;  4JI7 L;  2JA8 B;  2K4K A;  1D2B A;  3LWU A;  2D2C C;  2VZA A;  3I7F A;  4X65 Q;  2IWH A;  1SYC A;  2B2Y C;  3VR2 A;  3TS0 A;  2JA7 H;  2LKV A;  1IBK L;  3TS2 A;  1ENF A;  2F0F A;  5A2Q L;  1BDO A;  1DXM A;  1BQQ T;  2EPB A;  1T5X D;  4RKL A;  4DAM A;  4LFB Q;  4RA8 A;  2YTV A;  1N36 L;  2EYJ A;  3VYR A;  2B29 A;  1S5B D;  4G7Z C;  1O7Z A;  4KN7 C;  1SJH D;  3NBH B;  1S5E D;  1I94 L;  1TS3 A;  5JPN C;  2MGS A;  3F2D A;  1S5F D;  1S5C D;  1EOT A;  3GTQ H;  4DV1 Q;  3L9A X;  4LNQ A;  2ATW A;  1EOV A;  2B2V C;  4TSS A;  4HJ5 A;  1PTO D;  4WJW A;  1VF5 C;  5JJZ A;  3BU2 A;  3GTP B;  4LF6 L;  2Q2H A;  3J7A F;  2A6E D;  1SYB A;  5TSS A;  1B70 B;  2K7V A;  5E1F A;  5C4H A;  3DMU A;  1H9S A;  2AQ1 B;  4H44 C;  5EPL A;  1Y1V H;  4DR1 L;  2PQA B;  4AH6 A;  4RH6 A;  2JA7 G;  3D3R A;  1IL2 A;  4YHH L;  1K8A C;  1JOK A;  4MN3 A;  2HT1 A;  1SJE D;  1V1Q A;  1L0W A;  5M5W H;  3NPP A;  4RHS A;  1ICF B;  2RCF A;  4QIW B;  2KQ3 A;  4JI3 L;  3D6C A;  2CCZ A;  2M9V A;  2OT2 A;  1GUT A;  1VQB A;  5EKI A;  3U9S A;  2HDL A;  4HN7 A;  4GNX A;  2ZM6 L;  3HOY B;  4HCE A;  4ZUI A;  1WTV A;  4YHH Q;  4A4I A;  3WOE A;  2F0W A;  5EPK A;  2ZTE A;  2MO1 A;  5JEA H;  4B3R L;  4CDF C;  1Q82 C;  3TP6 A;  1GUO A;  1SRU A;  4JPB W;  4U68 A;  3CP0 A;  4BY7 G;  3H3V C;  4X64 L;  4JI3 Q;  1IBL L;  1HJP A;  3VYS A;  4UP9 A;  1B9M A;  4MIU A;  5E4X A;  4AYB G;  2JA5 G;  1AE3 A;  1KRS A;  1UE7 A;  4JI5 L;  2UXD L;  3E5S A;  3U4Z A;  3M3Y B;  3NEL A;  1NE3 A;  2E2J H;  4F8M A;  2ALY B;  2PQE A;  5FO7 B;  4DR7 L;  4QQB X;  1F9R A;  1HTL D;  1C7Y A;  2C5C A;  2R7Z G;  1ESR A;  3P7J A;  4MHE A;  4HJA A;  3OWF A;  4X66 L;  2QIL A;  4LF9 Q;  3CKI B;  5ELD A;  1HNZ Q;  3U4V A;  1DOK A;  4FO2 A;  3KF6 B;  2WKD A;  4R8N A;  2EJG C;  2OEO A;  1PZJ D;  4ODG A;  4IPH A;  2JK8 A;  5FJ8 H;  2QGQ A;  4LAA A;  2EYM A;  2A6H C;  3RMH A;  1DOM A;  4UAI A;  1QVG A;  1IXR A;  1MBY A;  4Q5V A;  1CZG A;  1PXU A;  4ZQ3 A;  2F3I A;  1A63 A;  4NXM Q;  3WDN A;  2H1E A;  4XXE A;  4QMG A;  1SNO A;  3J81 j;  4IUR A;  3IFD A;  2Q2U A;  2EVB A;  1NBW A;  3J81 L;  4B9W A;  4HMJ A;  1ASY A;  2HCC A;  3U50 C;  4JI6 Q;  2O4X A;  4B08 A;  1G51 A;  4XQQ A;  1F2Z A;  2O2L D;  3D4W A;  3G71 A;  2K5H A;  3T1H Q;  3HOY H;  3DM1 A;  3HOY G;  1F9S A;  2NVX H;  1BVS A;  1PYB A;  1XNQ L;  1LT3 D;  1CKN B;  3SDZ A;  5DM6 3;  1QZH A;  1HZC A;  3CHB D;  3UDF A;  3JAM c;  1K8G A;  4EVO A;  1WTX A;  4IO9 A;  1PRT F;  1EY4 A;  3FKI G;  3NTI A;  4DV7 Q;  4KD4 A;  1ZKO A;  5LL6 S;  1EYC A;  1Q46 A;  3M7G A;  4X62 Q;  4JI6 L;  1HZA A;  4YCU A;  3M4O H;  1SMY C;  1VQC A;  3M3Y H;  5EBD A;  3UI2 A;  5FO8 B;  4ZUJ A;  1I3Q B;  2NN6 G;  2DN8 A;  5BN3 A;  3C46 A;  1GVP A;  1KD1 C;  4LFB L;  1KNA A;  5CV9 A;  4RGN A;  1NR2 A;  2K04 A;  3RD4 A;  4BY1 H;  5IP7 G;  4LF4 L;  5JVG 3;  1YIJ A;  5BN4 A;  3FRP B;  3GD7 A;  3VR3 A;  2KEE A;  3D4R A;  2JJQ A;  5C0X G;  2E8G A;  3ZYY X;  2IX1 A;  3HOZ B;  1EIY B;  1SYD A;  1X3P A;  1EUJ A;  3CCR A;  3BYY B;  1VQH A;  3NEM A;  4HR7 B;  4G57 A;  2ENB A;  3KK7 A;  4HSP A;  2BDO A;  3MTS A;  2J7Z A;  1K9M C;  3N52 A;  5M5Y B;  1CZW A;  1L1O B;  3J81 E;  4DR7 Q;  2AQ3 B;  5J39 A;  1LM0 A;  3NSW A;  5BR8 L;  1FNW A;  3A8I E;  1ET9 A;  4I7Z C;  3V96 A;  1QCB D;  3ER0 A;  1WD0 A;  1JWU D;  3MA2 B;  1OXT A;  2QCP X;  5FO9 B;  1E2Z A;  4CJ0 B;  4LMQ D;  3S24 A;  1Y1W G;  4A3G B;  1G6P A;  3QOL A;  3NWT A;  3HOW G;  1TWC H;  1I4H A;  1STA A;  4JI4 Q;  2KED A;  2KEC A;  1D5Z C;  3HOU G;  2WFW A;  3MXN B;  5LMN Q;  3TP7 A;  1K3B C;  3HOW B;  1U4L A;  2EQS A;  2E2I H;  3GV3 A;  1BCP B;  4JI7 Q;  2MQH A;  5C4X G;  2KCT A;  4O0A A;  4DV2 Q;  1SE3 A;  1JOO A;  1XJV A;  4A3C H;  3MAQ A;  1KRT A;  1K0R A;  5D3I B;  1PHJ A;  4A3D H;  4ZLT F;  5C3E G;  2RCN A;  3S2H H;  2RDH A;  1PH7 A;  2YU9 H;  1HXY D;  4OWX B;  2K6A A;  1A8V A;  2RF4 A;  2KHS A;  1WTP A;  3AB9 A;  1F2Y A;  4PQX A;  4QJF A;  1VQ4 A;  4CJ1 B;  2J0T D;  4LF8 Q;  3J7A 5;  5I6W A;  3SE0 A;  5ELO A;  1ICW A;  1K8M A;  1FGU A;  3KFU A;  1XMQ L;  2E5L L;  5J3B A;  2OQ0 A;  4H02 A;  4HTH A;  2FXQ A;  3BS1 A;  3HZX A;  1TWA B;  3OW2 A;  2HQL A;  2DUD A;  1KC8 C;  1HH2 P;  4E6I A;  3K5L A;  5T1I A;  3S15 B;  1BCP F;  3EN2 A;  4H0L C;  2ZJQ A;  1PDQ A;  3TZD A;  1XPO A;  1ASZ A;  3MXG A;  4FXK C;  5M5X H;  3HP3 A;  3T13 A;  3Q23 A;  4A3C G;  3L0O A;  4FVM A;  2LFN A;  2J4X A;  5IGD A;  3BDC A;  2A73 B;  1TWH H;  4F87 A;  4ZAI A;  1XYI A;  3WWV A;  3RZD B;  4A3G H;  1MI2 A;  2CH4 A;  4IN3 A;  1FNU A;  4X6A H;  4DR5 Q;  1VQE A;  1Q3L A;  4GZY C;  1HFG A;  4K2K A;  1IBM L;  1YEZ A;  1B9N A;  3A7A B;  1PTO F;  1Q12 A;  1IW7 C;  1TR5 A;  2AMC B;  2ICE C;  3RLO A;  3OSO A;  2E2D C;  3H3V H;  3K6O A;  2EYL A;  1WFQ A;  2ZT9 C;  3BZC A;  2UXB Q;  1EYD A;  1CHP D;  1GUW A;  1H9R A;  4C56 C;  1LAB A;  4IUQ A;  4UP8 A;  2PZT A;  2NTS A;  4GN4 B;  1PH2 A;  4L5Q A;  1X65 A;  4UPA A;  2BOS A;  4LF7 Q;  4KKS A;  5A2Q E;  4GNX B;  5C3W A;  3PF4 A;  2N49 A;  2Y0S G;  4IFD G;  1EIH A;  4IUV A;  2M00 A;  1KLU D;  3S14 B;  4A93 H;  3HOX B;  2AKW B;  2NVT B;  1U0L A;  1KIX A;  5IYC H;  5K36 H;  5AFW A;  2WV6 D;  1W3S A;  2RA4 A;  2JA6 B;  4R4I A;  1SNP A;  2F0N A;  1RKN A;  1UWV A;  3UDX A;  1G6Z A;  4HSV A;  2X69 A;  4GS3 A;  3SEB A;  2G9H D;  1KLG D;  4HJ9 A;  1T5E A;  1DCZ A;  2PQA A;  1N36 Q;  1Y1W B;  2E74 C;  1B3A A;  4A3G G;  1JWM D;  2MPM A;  3ND8 A;  1I50 H;  1PFN A;  5DLQ E;  1IYJ B;  1EQV A;  1WD1 A;  2F0O A;  1C9O A;  1CK1 A;  1Z6H A;  5CV4 A;  2TMP A;  1MD2 D;  1C0A A;  3CC7 A;  3CCE A;  1H95 A;  1VCI A;  1Y8O B;  4UDU C;  4K8I A;  5HY6 A;  1B50 A;  5C4Z A;  3RZD H;  2CW0 C;  3P20 A;  4RMF A;  3KDF A;  4IFD H;  3JAM L;  4DV5 Q;  1U4R A;  2BH8 A;  1HFN A;  1HQM C;  2SDF A;  3DHQ A;  4IPG A;  2Q8I B;  3V05 A;  5ELF A;  1VQJ A;  4OEL B;  3T16 A;  4QF4 A;  3K5N A;  1VQD A;  2HIV A;  2K5W A;  2KVM A;  4G7O C;  1TY0 A;  1Z47 A;  3BVM A;  4K6L A;  2NUC A;  4DAY B;  3C1E A;  4RGO S;  4DR2 Q;  5C3E B;  4NMZ A;  4NXN Q;  1AP0 A;  4DV5 L;  3KLR A;  3A8J E;  5A35 A;  5C4J H;  4KY5 A;  1EEI D;  4K5W A;  4OWT B;  3SK5 A;  2VQF L;  2SNS A;  4JI0 Q;  1ML0 D;  1F9Q A;  1TT2 A;  3HRZ C;  4V19 0;  1PTO B;  2CFM A;  2JEA I;  1PH1 A;  3X3N A;  3NE5 B;  1RF2 D;  2F0L A;  3LX0 A;  3IAY A;  4QIW E;  1JE5 A;  3L3O C;  4YCV A;  3SK4 A;  1F2M A;  4LF6 Q;  1QUQ B;  4JBK A;  4KY6 A;  1RTN A;  1TWG H;  4OON A;  5CBA E;  1QUQ A;  2R92 G;  3A8K E;  2Y0S B;  4Y52 H;  3CXC A;  2L55 A;  3X3M A;  4NDX A;  5CV5 A;  2IY5 B;  3T53 B;  4N9T A;  1XTC D;  2P5Z X;  1PFS A;  1J5E L;  2K5N A;  3VDY A;  2VNU D;  1HA6 A;  4J1M A;  4DV7 L;  3CCV A;  1EU4 A;  5G3L F;  4JI4 L;  3T56 B;  4UP7 A;  1ET6 A;  3H3V I;  1OTC A;  3HGB A;  3JAM i;  2HCI A;  2F03 A;  1N34 Q;  1A2T A;  3JC6 6;  5DNF A;  1JE4 A;  5IT9 E;  3L7Z C;  1AZQ A;  4LJZ C;  4CDC C;  2NVX B;  4RWS C;  2UU9 Q;  4DR6 L;  5IOC A;  2Y0S E;  2E2H H;  1VQ6 A;  1X3G A;  4DK1 A;  3K57 A;  5G3L D;  1Y69 U;  2DJG C;  4XQJ A;  4K2L A;  3H0G G;  1QE6 A;  5FOB B;  1N34 L;  1LTS D;  4RHR A;  1BNZ A;  4GOP B;  3VYU A;  3I4L A;  1Q86 C;  5E3F A;  2R92 H;  2WII B;  3M9B A;  4ILW A;  3GTM H;  1EY9 A;  3A54 A;  3CCM A;  3S1R H;  1CFM A;  3E6Z X;  4GKK L;  2L12 A;  2I0Q A;  3PUV A;  1JT8 A;  1RIP A;  2SEB D;  3G48 A;  4DPG A;  2K5V A;  1LTB D;  5M3F G;  2XN9 C;  1LTG D;  1OXV A;  3GTL H;  1GOZ A;  3GTO H;  4XT3 B;  2MUY A;  1RCV D;  1PVO A;  5JJL A;  3J80 L;  4BA2 I;  1QG7 A;  1VQN A;  2SOB A;  4GKK Q;  5KIX A;  5CR3 A;  2I07 B;  3W1G A;  2F1M A;  2DGY A;  4XQN A;  1U9R A;  2NZO A;  3UE1 A;  5CV6 A;  3M85 A;  2NZ1 D;  3D0F A;  2UXC Q;  2PYK A;  5ELE A;  2KCC A;  4HCS A;  3CCJ A;  5M5Y H;  3UDG A;  1BKB A;  1SR3 A;  4A3K H;  4BBS B;  1X32 A;  4QGU A;  4DK0 A;  4M1U B;  4KHP Q;  2K1B A;  5COY A;  1FD7 D;  2B3G A;  4JV5 L;  4DGZ A;  1EY8 A;  1NUC A;  3K5M A;  3K0Y A;  2K50 A;  4K5X A;  5AJ3 L;  2VUM B;  2GA4 B;  4F88 A;  1MHW C;  2B2V A;  5EBC A;  1PLF A;  2F0D A;  1EZ8 A;  2B8F A;  3NWS A;  1HHV A;  4P2C B;  4XTC S;  2HIX A;  3H0G B;  4A3E G;  3ERQ A;  2JXM B;  2A5H A;  2A69 D;  5E7N A;  1TS5 A;  1Y8N B;  2KA7 A;  5JJI A;  1MKH A;  1T9H A;  5IE8 A;  1SYG A;  1AW7 A;  1EEF D;  2B2T A;  4IJL A;  1HA5 A;  5C0X J;  1HNX Q;  4JI2 L;  3KBG A;  2B8G A;  4KD3 A;  4LFC Q;  3S16 H;  2YTX A;  2F0K A;  4BBS G;  2PPB C;  3R8B A;  3U9O A;  2D0P A;  4GOP A;  3G6E A;  1TY2 A;  2SNM A;  4JI1 Q;  1YJW A;  4IZ8 A;  4R4Q A;  2F3W A;  2A6H D;  4J15 A;  4DR2 L;  5IYD G;  4FYD A;  1ESF A;  4NP5 A;  1L1O C;  1EFW A;  3QJY A;  4BY1 G;  4IFD J;  1JIC A;  1UE1 A;  2IT1 A;  3AU7 A;  3BYT B;  4JI2 Q;  1HNX L;  3URY A;  4HID A;  3G6J B;  1JQY D;  1E7Z A;  4DKA C;  4FF1 A;  4J8Q A;  3MVV A;  2UUC Q;  4QUF A;  4OO1 I;  1UE5 A;  3KLW A;  1O7I A;  3DUZ A;  4PV1 C;  1GUS A;  1OXX K;  4BXX G;  1G91 A;  5D3D A;  2R7D A;  1YHB A;  4B3S Q;  2YV5 A;  4YWM A;  1S3O A;  2LXK A;  3HKZ E;  4IPC A;  2NVY H;  2VQE L;  4DUY Q;  3CC2 A;  5JAV A;  2FJ2 A;  5JEA G;  3PGZ A;  4S3S A;  1D1I A;  5IP9 G;  4IUN A;  3OOC A;  2Z8L A;  2XNA C;  4X65 L;  2D5D A;  3OMG A;  1V1O A;  4KHV A;  1LO5 D;  3CPF A;  3HG9 A;  2F0J A;  3P75 A;  3SHL A;  1VQ7 A;  1CSQ A;  1V8Q A;  2DNC A;  1PA6 A;  1M8A A;  3HOX G;  1EIF A;  1P8L A;  1YI2 A;  4XT1 B;  4DF7 A;  2MNA A;  2BCO A;  3GO5 A;  2F0S A;  4LF5 L;  3ITP A;  1I94 Q;  3VYT A;  4KHZ A;  2E2J B;  4ZKC B;  2K32 A;  4KTA A;  3L2P A;  3QG1 A;  1IZ6 A;  4GN5 A;  4X3K A;  3ULL A;  4A3M G;  1QWY A;  5J22 A;  4O42 A;  4LUO A;  4DV4 Q;  4MNO A;  2XRQ D;  2L11 A;  2JYO A;  4N9P A;  4DAY A;  1JWS D;  1HCZ A;  4HAE A;  2EDG A;  1SEB D;  3HOV H;  4KY7 A;  2PNR C;  4DUZ L;  2OTL A;  4BXX H;  2K33 A;  2X6L A;  3BZK A;  2VY3 A;  2A68 D;  3AFQ A;  5JOB A;  4R1J A;  1PH3 A;  2HUG A;  3ERO A;  4WOR A;  3A55 A;  1FNV A;  1VMC A;  3CF5 A;  4A3J H;  4U67 3;  1N33 Q;  4JYA L;  1C8C A;  2F3V A;  1IBK Q;  1E3P A;  1LYL A;  2PMZ B;  4NXN L;  4LWC A;  4BS9 A;  4DR5 L;  3K7A H;  3G4S A;  3OTO L;  4C3H B;  1M90 C;  3RN2 A;  2WP8 J;  3T4A C;  4HIK A;  1Y1V G;  3DLL A;  3I2Z A;  1V1P B;  1XMO Q;  4JI0 L;  2EYO A;  1W2B A;  4DR6 Q;  5J1Z A;  3UE0 A;  1O7Y A;  1PYS B;  4DAV A;  1HR0 L;  2BE5 C;  2R7Z H;  4A3B B;  1GHJ A;  4N8F A;  1LT4 D;  1NCV A;  3STB D;  1KDA A;  1B7Y B;  3ERS X;  3MC0 B;  3M4P A;  1R9T B;  1X3Q A;  2EJM A;  4ABN A;  1WCM B;  2EYH A;  2GN5 A;  4V0B A;  4G4K A;  5FLM G;  1I3Q H;  2OCE A;  5KNB A;  1PH9 A;  2QDL A;  3KF8 B;  1YJ9 A;  3K59 A;  2RHQ B;  3AQQ A;  3BDO A;  4LF8 L;  4A3I B;  3BVG A;  1UEA B;  4FNF A;  5IIF A;  3S1Q H;  2I5M X;  5FLX c;  2KCN A;  2NN6 H;  2PW5 A;  1STH A;  1S40 A;  4Z9C B;  4L5R C;  1XXG A;  3PMF A;  4EQ5 A;  3AMU A;  1E1O A;  3PQI A;  5IT9 c;  2ID0 A;  2WB1 E;  5GAG C;  1STE A;  3HOZ G;  3I4N B;  3J7Y W;  5I9O A;  3K58 A;  3GQB A;  1BF4 A;  5LMU L;  2Q2T A;  1VF7 A;  4C2M H;  1KDB A;  2MO0 A;  4MZ9 A;  3I55 A;  3FHW A;  4A3B G;  1Q7Y C;  3P1H A;  3S17 H;  1E2W A;  2VB3 X;  2B39 A;  1HNZ L;  1AH9 A;  5ISR A;  4J6H A;  2R7F A;  2N8N A;  4LUZ A;  4FF4 A;  1I4Q A;  4TRD A;  3MXP A;  4A3E B;  4IFD I;  2IL8 A;  2XSC A;  3CD6 A;  3J80 c;  2JA8 H;  2EXZ A;  1Q8I A;  4C3J H;  4A3J B;  3GTK H;  4B3M Q;  2GVB A;  1YNJ D;  1IBL Q;  2IX0 A;  1I4P A;  1O80 A;  5IY0 A;  5GRO A;  3I4O A;  2JQO A;  2K5Q A;  4JV5 Q;  2OQK A;  3M4Q A;  3OPO A;  2F4V L;  4KKT A;  4MTK A;  1E22 A;  3G7L A;  1B3Q A;  4C3H G;  1N32 L;  2RKS A;  1XNR L;  3PO3 H;  5IWA Q;  4RKB A;  1X54 A;  3CCS A;  4AQY Q;  5C0X I;  3EFX D;  1EY6 A;  1OO9 B;  4JI8 L;  3ND9 A;  1M1K C;  2Z0S A;  4R4C A;  2RBM A;  3N6R A;  4B3M L;  2F0V A;  3Q6S A;  3CCL A;  4LF7 L;  2N55 A;  1JJG A;  1LTR D;  4DNT B; 
#chains in the Genus database with same CATH homology
 2YTV A;  1N36 L;  4DV5 Q;  3HOU H;  4JBW A;  2BH8 A;  2B29 A;  2VQF Q;  1VQA A;  3GTG H;  4IPG A;  1SFO H;  1VQJ A;  2ZM6 Q;  3NBH B;  3CAM A;  1I94 L;  3BJU A;  5IWA L;  4DR3 L;  4A3I H;  1VQD A;  2HIV A;  3F2D A;  2UUB L;  3GTQ H;  3RR5 A;  4DV1 Q;  3D31 A;  1Z47 A;  4LNQ A;  3RLN A;  1QVF A;  1EOV A;  3PUW A;  4DV3 L;  2ATW A;  3W1B A;  4HJ5 A;  2I5H A;  3J80 i;  4DAY B;  3RNU A;  1YJN A;  4DR2 Q;  4X64 Q;  4NXN Q;  3AEV A;  2R93 H;  1SN8 A;  3FKI H;  4DV5 L;  2R93 G;  3BU2 A;  4GKJ Q;  4QY7 A;  1X3F A;  4LF6 L;  2Q2H A;  5C4J H;  1V43 A;  4OWT B;  1XMQ Q;  3F1Z A;  1B70 B;  2VQF L;  3KJP A;  4JI5 Q;  2UXD Q;  3GTJ H;  4JI0 Q;  3T1Y L;  1SE8 A;  1Y1V H;  4DR1 L;  2CFM A;  2PQA B;  1PV4 A;  5JJK A;  4AH6 A;  2ES2 A;  2JEA I;  1PH1 A;  1HNW Q;  2JA7 G;  1IL2 A;  4WJ4 A;  2JA6 G;  4YHH L;  1K8A C;  2WAQ E;  4P72 A;  3ICE A;  3PIP A;  2HT1 A;  4QIW E;  1JE5 A;  3CMA A;  1U5K A;  1V1Q A;  4YCV A;  1L0W A;  5M5W H;  3OTO Q;  4LF6 Q;  1KL9 A;  1QUQ B;  1QVC A;  2D0O A;  4JI3 L;  2CCZ A;  4JBK A;  1S72 A;  3I4M H;  3M7N A;  1PH5 A;  2CWA A;  1TWG H;  1EQR A;  1VQB A;  4OON A;  1QUQ A;  2R92 G;  1DGS A;  4KHP L;  1HR0 Q;  4Y52 H;  3CXC A;  1YHA A;  1GO3 E;  4P74 A;  5IYB G;  2QEX A;  4GNX A;  1R9T H;  5H1S E;  4POF A;  4NPS A;  2ZM6 L;  1FJG L;  2IY5 B;  1J5E L;  1PFS A;  2K5N A;  2A1A A;  4DR3 Q;  3VDY A;  2VNU D;  4DV7 L;  4YHH Q;  3CCV A;  4A4I A;  4JI4 L;  2JEB I;  4UP7 A;  3I56 A;  3S1N H;  2ZTE A;  2MO1 A;  3CW2 C;  3ULJ A;  3H3V I;  1OTC A;  2HHH L;  3JAM i;  4B3R L;  1Q82 C;  1N34 Q;  1SRU A;  3PSI A;  2LSS A;  3JC6 6;  3CP0 A;  4BY7 G;  4X64 L;  4JI3 Q;  4DR4 Q;  4B3T Q;  3L7Z C;  1VQK A;  1IBL L;  1HJP A;  5GAE C;  4UP9 A;  1XPU A;  1LUZ A;  1X56 A;  5M3F H;  3TQY A;  4DV0 L;  4AYB G;  2UU9 Q;  5IYB H;  2Y0S E;  1AE3 A;  1KRS A;  1UE7 A;  2E2H H;  2JA5 G;  5K36 G;  1VQ6 A;  1X3G A;  4JI5 L;  4ALP A;  1NJI C;  2UXD L;  3U4Z A;  3NEL A;  1NE3 A;  2E2J H;  2H5X A;  2ALY B;  5FJ8 G;  2ZTC A;  4DR7 L;  1YVC A;  4QQB X;  1C7Y A;  2R7Z G;  3H0G G;  3AFP A;  1HZ9 A;  2PMZ E;  4DR6 L;  1N34 L;  1HZB A;  4HJA A;  4K0K Q;  2IHE A;  1BBW A;  3K80 C;  4A3L H;  1PH6 A;  4DR4 L;  4X66 L;  5C44 H;  4GOP B;  1Q86 C;  4LF9 Q;  1E1T A;  1D8L A;  4YWL A;  2R92 H;  5IYD H;  3M9B A;  1CKN A;  1HNZ Q;  3U4V A;  3GTM H;  4B3T L;  2BA1 A;  3U58 A;  3KF6 B;  1UEB A;  3CCM A;  3HOX H;  3S1R H;  1N8R C;  4JI6 L;  4A3K G;  2OWO A;  4GKK L;  3I4N H;  3PO2 G;  2I0Q A;  4NXM L;  3PUV A;  1WYD A;  4A3J G;  1JT8 A;  4PZ6 A;  1RIP A;  3PIO A;  4IPH A;  5IP9 H;  2JK8 A;  5FJ8 H;  4QL5 A;  4DV1 L;  2QGQ A;  3G48 A;  4DPG A;  4X62 L;  1X9N A;  3PUY A;  1JB7 A;  1JMC A;  2K14 A;  1Q8K A;  2K5V A;  2UUA Q;  2B63 G;  4JYA Q;  1D7Q A;  1QVG A;  4B3S L;  1IXR A;  5M3F G;  1VQF A;  1OXV A;  4HIO A;  3GTL H;  3GTK H;  4DK6 C;  2WB1 G;  2XGT A;  1VQM A;  1SMX A;  5BR8 Q;  3KJO A;  1TWF H;  4L5S A;  3GTO H;  2VUM G;  1A62 A;  4PZ7 A;  1WJJ A;  2F3I A;  1VS0 A;  1PVO A;  2GVA A;  1JJC B;  5JJL A;  1A63 A;  4IOA A;  4BA2 I;  3PCO B;  4A3E H;  1VQN A;  4NXM Q;  2N78 A;  3J81 j;  1I6H H;  3KDF B;  4POG A;  4GKK Q;  3HOV G;  2Q2U A;  2F4V Q;  1A0I A;  1NBW A;  3W1G A;  2KEN A;  2DGY A;  2NVT H;  4P71 A;  1ASY A;  2UU9 L;  2NZO A;  4RG1 A;  3UE1 A;  3M85 A;  3PUX A;  3D0F A;  3F2B A;  2UXC Q;  3U50 C;  4YCW A;  4A3D G;  3CCQ A;  1TWA H;  3ULP A;  2BA0 A;  3F2C A;  4JI6 Q;  1Q1B A;  2RHS B;  4OX9 L;  2UUB Q;  2JA6 H;  3I4N G;  1CSP A;  1G51 A;  2XTI A;  4TQU S;  4JI8 Q;  5M5Y H;  3CCJ A;  3UDG A;  1MJE A;  1BKB A;  1SR3 A;  4A3K H;  1N33 L;  3F8T A;  3UDI A;  4A3F H;  3G71 A;  3T1H Q;  2K5H A;  3HOY H;  2CQO A;  4A3F G;  3HOY G;  1VQ9 A;  1G29 1;  3I4M G;  2NVX H;  1BVS A;  1PYB A;  2PI2 A;  4QGU A;  3K7U C;  1XPR A;  1XNQ L;  4LW1 A;  1CKN B;  1OXU A;  1OXS C;  4KHP Q;  1QZH A;  4DV2 L;  1HZC A;  3UDF A;  2KBN A;  3JAM c;  1K8G A;  2B3G A;  4IJH A;  4JV5 L;  1NTG A;  2ZTD A;  4IO9 A;  2K50 A;  2V1C C;  3FKI G;  5AJ3 L;  1VQP A;  4DV7 Q;  1YHQ A;  5ELN A;  1EQQ A;  1B8A A;  4AIM A;  3T1Y Q;  1L1O A;  4JOI C;  1Q46 A;  4KLK A;  4XTC S;  3SGI A;  4X62 Q;  4DV4 L;  2HIX A;  5GQO A;  4A3E G;  2JA5 H;  3KYH C;  1HZA A;  4YCU A;  1HNW L;  4EX5 A;  2VUM H;  3M4O H;  5E7N A;  3M3Y H;  1VQC A;  1MIU A;  4OO1 G;  1X3E A;  1PH8 A;  5M3M H;  3RN5 A;  5JJI A;  1MKH A;  1T9H A;  3IRB A;  5HGQ A;  5IE8 A;  1XMO L;  2NN6 G;  1GVP A;  1KD1 C;  3A5U A;  4LFB L;  5FLM H;  4IJL A;  5C0X J;  4BY1 H;  1HNX Q;  3MEF A;  5IP7 G;  4JI2 L;  4LF4 L;  2VL6 A;  5GAD C;  1GM5 A;  4DV6 Q;  1XTD A;  1YIJ A;  2I5L X;  4LFC Q;  2KHI A;  5C3E H;  2AWO A;  2UUC L;  3S16 H;  2YTX A;  3GD7 A;  1RL2 A;  3CPW A;  4BBS G;  2JJQ A;  1P16 A;  2D0P A;  4GOP A;  5C0X G;  2E8G A;  3G6E A;  1I5F A;  2IX1 A;  4JI1 Q;  4Y7N H;  1YJW A;  4R4Q A;  4YWK A;  2IHF A;  4J15 A;  4DUY L;  1EIY B;  4DR2 L;  3A74 A;  3J81 c;  5IYD G;  4P75 A;  2NVQ H;  3RZO H;  1EUJ A;  3CCR A;  2HHH Q;  1VQH A;  3NEM A;  3T1H L;  4B3R Q;  1L1O C;  2L15 A;  1EFW A;  1NY4 A;  4JG2 A;  4L5T A;  4BY1 G;  4APV A;  1KHI A;  4IFD J;  4DV6 L;  1UE1 A;  3TEH B;  2IT1 A;  4JI2 Q;  1HNX L;  2JA9 A;  4HID A;  4DKA C;  4A3B H;  1E7Z A;  3CME A;  2R6G A;  4R4O A;  3S14 H;  1J5E Q;  2UUA L;  2UUC Q;  2OTJ A;  4IPD A;  4OO1 I;  3E9I A;  1UE5 A;  3KLW A;  1K9M C;  1L2F A;  1O7I A;  1L1O B;  4BXX G;  1OXX K;  3E9H A;  2R7D A;  4DR7 Q;  1K83 H;  1YHB A;  4B3S Q;  2YV5 A;  3NEN A;  1K3R A;  1LM0 A;  4YWM A;  4BY7 H;  2EIF A;  1S3O A;  2LXK A;  4GLV B;  3HKZ E;  1VQ8 A;  5BR8 L;  1WI5 A;  4IPC A;  2NVY H;  2VQE L;  4DUY Q;  3CC2 A;  2NN6 I;  2MFI A;  5IYC G;  3ER0 A;  3K8A A;  5JEA G;  1YIT A;  3PGZ A;  1OXT A;  4JCV E;  2VW9 A;  5IP9 G;  3S24 A;  1Y1W G;  4OWW B;  1G6P A;  3HOW G;  2CKZ B;  4GLA C;  3HKZ G;  3K0X A;  1TWC H;  4X65 L;  3GDE A;  2UXC L;  3EIV A;  1QZG A;  4JI4 Q;  3B6Y A;  3CPF A;  1Q1E A;  4LFA Q;  4DK3 C;  5C44 G;  2D62 A;  1CSQ A;  1VQ7 A;  3HOU G;  2WFW A;  3MXN B;  5LMN Q;  1WCM H;  3PO3 G;  4X66 Q;  1CKM A;  3PUZ A;  4MTN A;  3PO2 H;  1N9W A;  1PA6 A;  3W5O A;  2EQS A;  1Q81 C;  2Q2I A;  3HOX G;  1EIF A;  2E2I H;  4PMW A;  3GTP H;  4O2D A;  4GLX A;  1P8L A;  1TXY A;  1YI2 A;  4JI7 Q;  2MQH A;  1UE6 A;  3LGJ A;  2KCT A;  4O0A A;  4DV2 Q;  5C4X G;  2MNA A;  1XJV A;  1JJ2 A;  4A76 A;  4A3C H;  3GO5 A;  4LF5 L;  1KRT A;  1VQL A;  1K0R A;  2NZH A;  3STB C;  1PHJ A;  1I94 Q;  4A3D H;  4KHZ A;  2WAQ G;  5C3E G;  2RCN A;  1E24 A;  4PZ8 A;  3S2H H;  3L2P A;  3HOZ H;  1IZ6 A;  4GN5 A;  2C35 B;  3ULL A;  1PH7 A;  4GNX C;  2PI2 E;  2VS1 A;  4A3M G;  4OWX B;  2YU9 H;  1A8V A;  2RF4 A;  1X6O A;  4LUO A;  1X55 A;  2EXD A;  2Z6K C;  4PG3 A;  2AHO B;  4MNO A;  4BA1 I;  4DV4 Q;  4HIM A;  4QJF A;  1VQ4 A;  5M3M G;  1IBM Q;  4LF8 Q;  3J7A 5;  3HOV H;  2B63 H;  5ELO A;  3EBE A;  2YTY A;  3PV0 A;  2JA8 G;  4DUZ L;  2OTL A;  4GOP C;  4BXX H;  3DM3 A;  1FGU A;  3KFU A;  2CWP A;  1XMQ L;  2E5L L;  5J3B A;  2OQ0 A;  4DNI A;  4H02 A;  3CCU A;  1NMG A;  3HKS A;  2FXQ A;  3BZK A;  2K52 A;  2VY3 A;  1SLJ A;  1PH4 A;  4LF4 Q;  3S15 H;  1NMF A;  4WJ3 M;  1FJG Q;  3AFQ A;  4LFC L;  2LXJ A;  3TRE A;  4R1J A;  1PH3 A;  4DR1 Q;  3OW2 A;  2HQL A;  4GN3 B;  2DUD A;  5C4X H;  4DV3 Q;  4AQY L;  4A3M H;  3CF5 A;  1CUK A;  1HH2 P;  4A3J H;  4OXP A;  1KC8 C;  1WCM G;  1VQ5 A;  1N33 Q;  1XNR Q;  4JYA L;  3E0E A;  3EN2 A;  1IBK Q;  1E3P A;  1LYL A;  4NXN L;  4JI1 L;  2N3S A;  4R4T A;  2ZJQ A;  4LWC A;  4XIG S;  4DR5 L;  1XPO A;  3K7A H;  2YYZ A;  4DUZ Q;  3G4S A;  1ASZ A;  3OTO L;  1LTL A;  1M90 C;  5M5X H;  3RN2 A;  2WP8 J;  4HIK A;  1Y1V G;  2QA4 A;  4A3C G;  3DLL A;  3L0O A;  3I2Z A;  5JEA J;  3J81 i;  1XMO Q;  2K75 A;  4JI0 L;  4JBJ A;  4HJ7 A;  1W2B A;  4DR6 Q;  3UE0 A;  1KXL A;  1PYS B;  1WOC A;  1HR0 L;  4C3H H;  1TWH H;  4IOC A;  2R7Z H;  5AJ3 Q;  4JOI A;  3J7Z C;  3HFZ B;  3STB D;  2KCM A;  1B7Y B;  3ZJY C;  3H0G H;  3ERS X;  3WWV A;  1EWI A;  3M4P A;  2ASB A;  3K81 C;  5IP7 H;  2ZJR A;  1YBY A;  4A3G H;  4LUV A;  2GN5 A;  3HOW H;  1SRO A;  1I3Q H;  2OCE A;  5FLM G;  1GD7 A;  1PH9 A;  3CC4 A;  3KF8 B;  4X6A H;  1BBU A;  1VQE A;  4DR5 Q;  3A0J A;  1YJ9 A;  4JBM A;  2JE6 I;  2Z6K A;  2BH2 A;  2RHQ B;  3AQQ A;  1IBM L;  4LF8 L;  4P73 A;  1YEZ A;  1EYG A;  4JC0 A;  2F52 A;  1K73 C;  3KOJ A;  1V9P A;  1Q12 A;  2AMC B;  3AYH B;  3OYY A;  4NB3 A;  2A8V A;  2I5M X;  5FLX c;  4A3I G;  3S1Q H;  1N32 Q;  4DV0 Q;  1S40 A;  3RLO A;  4L5R C;  4A93 G;  1YNX A;  4EQ5 A;  3H3V H;  3KF6 A;  3BZC A;  1WFQ A;  2UXB Q;  4C3I H;  1E1O A;  5IT9 c;  2ID0 A;  2WB1 E;  5GAG C;  3HOZ G;  1AE2 A;  3S1M H;  4UP8 A;  1VQO A;  5LMN L;  3CQZ H;  4K0K L;  4GN4 B;  1PH2 A;  4L5Q A;  1X65 A;  4UPA A;  4LF7 Q;  1VQG A;  5LMU L;  2Q2T A;  4C2M H;  4MZ9 A;  2AWN A;  2MO0 A;  3A5Z B;  3I55 A;  3FHW A;  4A3B G;  1Q7Y C;  3S17 H;  3PF5 A;  4GNX B;  3PF4 A;  1HNZ L;  3S2D H;  1AH9 A;  2N49 A;  2Y0S G;  4IFD G;  1VQI A;  5GAH C;  4A93 H;  2R7F A;  3H15 A;  4LF5 Q;  2N8N A;  2AKW B;  5EAY A;  1U0L A;  4FDB A;  1KIX A;  1MJC A;  4LUZ A;  5IYC H;  4HJ8 A;  4TVA B;  1KAW A;  1W3S A;  1J6Q A;  4KI0 A;  4A75 A;  4OX9 Q;  4R4I A;  4IFD I;  1UWV A;  1Y1W H;  3UDX A;  4BBR H;  5LMU Q;  4YY3 Q;  1FL0 A;  1YZ6 A;  4GS3 A;  3FP9 A;  4BBR G;  4LF9 L;  3RLF A;  4BBS H;  3CD6 A;  4GKJ L;  3J80 c;  1Y14 B;  4LFA L;  1GKH A;  2VQE Q;  4HJ9 A;  4UY8 C;  2JA8 H;  1XNQ Q;  2PNH A;  2PQA A;  4ME3 A;  4C3J H;  2ZJP A;  5LMN W;  1N36 Q;  2GVB A;  1FVI A;  1Z9F A;  1IBL Q;  2IX0 A;  4AYB E;  5IY0 A;  4B3M Q;  4A3G G;  5GRO A;  3I4O A;  2JQO A;  4JV5 Q;  1I50 H;  2E5L Q;  4JI7 L;  5DLQ E;  1IYJ B;  2OQK A;  2KHJ A;  3M4Q A;  2F4V L;  2K4K A;  1E22 A;  1N32 L;  1C9O A;  2VZA A;  1HR0 W;  3I7F A;  4X65 Q;  1XNR L;  3PO3 H;  5IWA Q;  1X54 A;  1KQS A;  3CCS A;  1C0A A;  4AQY Q;  2UXB L;  3CC7 A;  5C0X I;  2A19 A;  3CCE A;  1H95 A;  1VCI A;  1CKO A;  4JI8 L;  3TS0 A;  2JA7 H;  1M1K C;  1IBK L;  3TS2 A;  4YY3 L;  5HY6 A;  2Z0S A;  4R4C A;  4B3M L;  4A3L G;  3RZD H;  3Q8D A;  3CCL A;  4LF7 L;  4RMF A;  3TRZ A;  3KDF A;  1JJG A;  4DAM A;  4LFB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...