1HZAA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzaA00
1TWFH 1D8LA 4YWKA 1M1KC 1V1QA 3CCEA 4NXMQ 2XTIA 3S1NH 4LF8Q 4NPSA 3IRBA 4X66L 1HR0W 2CCZA 5IE8A 3J7ZC 1OXVA 1XPOA 4DV7Q 1Y1VG 1P16A 1I3QH 4LF5L 3OYYA 4AQYQ 5FLXc 5GROA 4RG1A 4Y52H 4LF8L 3HOUG 2AWOA 3I7FA 1FVIA 3S1QH 4L5TA 4YWMA 4DV7L 4PZ8A 5IYCH 1L1OC 4QIWE 4LWCA 3UE0A 4O2DA 3W1GA 4AQYL 3U4VA 5M3MG 2NVYH 1BBUA 3KF6B 4DV0L 4XIGS 1M90C 5IP7H 2F52A 4HJ7A 4C3IH 4JC0A 4GNXB 3RN5A 4DUZQ 1VS0A 2UUBQ 2HIXA 1X54A 3JC66 1KQSA 1D7QA 3MEFA 1IXRA 4A3DH 3I4OA 1A62A 1CKOA 2IT1A 1VQCA 4JBWA 3PO3G 3UE1A 4MZ9A 4OWXB 2Q2UA 1MJCA 5M5WH 3S14H 4YWLA 1PYBA 4MTNA 1VQPA 1NBWA 1PYSB 3RLNA 1VQKA 2OCEA 4BBRG 4AYBG 2E2JH 3M4PA 3GTLH 2R7ZH 1E22A 2UUAQ 2WP8J 4NB3A 5GQOA 1OXXK 4A76A 1HZAA 4K0KQ 4A3LH 3E0EA 3CCQA 3D0FA 2L15A 4KI0A 4JBMA 3G71A 1GO3E 4BY7H 2JE6I 4DV3L 3K0XA 4C2MH 2JQOA 4DKAC 1XNRQ 2OWOA 3PO2G 3PGZA 4YY3Q 4GOPA 4K0KL 2NZOA 2AHOB 4X65Q 2VUMG 1EIYB 3BZKA 1EQQA 1GM5A 1QVGA 1VQ4A 2E2HH 1VQ6A 1FJGQ 1BBWA 1XNRL 2WFWA 2BA0A 2E8GA 4A3FG 4YY3L 4DUYL 4X65L 2B63H 2WAQE 5ELNA 1EWIA 3G4SA 5C44G 1N34Q 1FJGL 4DR7L 2JEBI 2R6GA 1YIJA 3MXNB 4HJ8A 2WB1G 1Q82C 2ZM6L 1NJIC 3ERSX 1CKMA 1WFQA 2Z0SA 3J80i 1KL9A 4C3JH 2UXDQ 2GVBA 2ALYB 2R7FA 5H1SE 2AKWB 2B3GA 3F2CA 4DV1L 5IYCG 4IO9A 1VQNA 1X3EA 4A3KH 5M5XH 3HFZB 4FDBA 3AEVA 4XTCS 1KIXA 2UXDL 2F4VQ 4KLKA 4GLXA 2VNUD 1VQ5A 2AWNA 1HZCA 1DGSA 3M4QA 5IP7G 4YCUA 2LSSA 4IOAA 3KFUA 4OONA 3AYHB 2Q2TA 1G51A 2H5XA 2PI2A 4KHPQ 1N9WA 3CC4A 4DR4Q 1K3RA 4UP8A 2KCTA 3CCMA 3RNUA 4JI4Q 1R9TH 1HNWQ 1HNXQ 1EIFA 1LTLA 3KYHC 1X3GA 4JI7Q 2OTLA 2DGYA 1GKHA 4GN3B 3HOWH 4TVAB 5C0XJ 1HNZQ 4DR4L 4JI4L 2MO1A 2UXBQ 4JI0L 4L5QA 3WWVA 1HNWL 4DV5L 1HNXL 1VQAA 3NBHB 4JI7L 2VY3A 3EBEA 1C0AA 5IYDH 4OO1G 4A3GH 4PZ6A 1HNZL 3H3VI 3H0GH 3OTOL 2UXBL 3J80c 3GTMH 1B8AA 1UEBA 1YHBA 3K7UC 1LUZA 4HIMA 2LXKA 1X56A 2R7ZG 2N3SA 2HHHL 4LF4Q 1NMGA 3I55A 1AH9A 4P75A 4DK3C 5C4XH 2EQSA 1N32Q 4LFCQ 3CCUA 4GKKL 4QJFA 4A3LG 2E2IH 4JOIA 1VQJA 4A3BH 4DPGA 1CSQA 4LF4L 1XNQL 1IYJB 4BY7G 1HH2P 3I2ZA 1N32L 1UE6A 4LFCL 2UUCQ 1V43A 3PIPA 1SLJA 3PSIA 2Z6KA 5J3BA 2LXJA 4PG3A 4P72A 3CC2A 4LF9L 3S16H 4A3MH 5FJ8G 1N36L 1U5KA 2UUCL 1N33L 1BKBA 5GAHC 3S1MH 1YITA 2VW9A 4QL5A 2I5MX 1K83H 3KOJA 3PUYA 4BA1I 3AFPA 4DNIA 2VQEQ 1PH3A 2B63G 2VL6A 3CQZH 1PV4A 4GS3A 2Q2IA 5DLQE 1LM0A 3TEHB 1Q7YC 1J5EQ 4BXXH 2VQFL 4GLVB 4HJ9A 1V9PA 4IPGA 1A63A 4GN5A 1KAWA 2UXCQ 1S40A 1B7YB 4A3KG 3EIVA 1J5EL 3A5ZB 2CWPA 2HQLA 4C3HH 4IFDG 1K0RA 3JAMc 2K5HA 4NXML 1YBYA 3A0JA 2UXCL 3T1YQ 1X3FA 3KDFA 4Y7NH 2K14A 3CCSA 2K50A 2ZTCA 2MO0A 4JG2A 1QZGA 4LW1A 1I5FA 2OTJA 2NVTH 4GN4B 4GOPC 4J15A 2C35B 4DR3Q 1A0IA 5LMNQ 3A5UA 3HOWG 1ASYA 4QGUA 2CKZB 1XMQQ 3G6EA 3S2DH 4IJLA 5IYDG 1JJCB 3RZOH 2JA7H 1XJVA 3I56A 3HOXG 3HOZH 4A3GG 2I5LX 3H0GG 2K75A 1YNXA 1Q1BA 2K5NA 4A3CH 1NTGA 2ZTEA 1XMQL 2N78A 2ID0A 4OWTB 4DR6Q 3CW2C 4DUZL 1SROA 2JA6H 5JJLA 2ZJPA 2YYZA 2PQAB 1IBLQ 2UUBL 5C4XG 1U0LA 1X65A 2YTVA 3CC7A 4P73A 4DV4Q 2YU9H 4TQUS 4EQ5A 4DR6L 1HJPA 1SMXA 3H15A 4LF6Q 3NENA 1XPRA 3TRZA 1IBLL 1H95A 2PMZE 1XPUA 1Z9FA 1Q81C 1HR0Q 4JI1Q 1OXTA 2KBNA 2RF4A 3TS2A 3GO5A 1QUQA 3E9IA 4ALPA 5IP9H 1I50H 1EUJA 1VQGA 3STBC 1EQRA 4A3MG 2PNHA 1GVPA 3K7AH 2A19A 3S15H 1RL2A 4L5RC 4X64Q 1X55A 5C0XG 5BR8Q 2UUAL 2HT1A 2OQ0A 2E5LQ 3M9BA 3EN2A 4BBSH 2I5HA 1EFWA 1VQIA 3G48A 2WAQG 2NN6G 3ULJA 1EYGA 4X64L 4OWWB 4O0AA 4GNXC 2I0QA 3KLWA 5IYBH 1IL2A 3ICEA 1KC8C 1CSPA 1WJJA 2GN5A 2KENA 1B70B 2R7DA 3KJOA 3UDGA 4IPHA 3AQQA 4R4OA 3CPWA 4NXNQ 1S3OA 3M7NA 3M85A 1WCMH 5IWAQ 1Y1WH 1TWCH 3KDFB 3UDFA 2KHJA 1MJEA 4EX5A 4JYAQ 3GTQH 1KXLA 4NXNL 1N34L 4B3TQ 2JJQA 4R4QA 2NVXH 1L1OA 1OTCA 2VZAA 5IWAL 5C3EH 2IX1A 1X6OA 4JI5Q 3M3YH 3U50C 2YV5A 2FXQA 4JI8Q 5HY6A 1VQOA 5GAGC 4DV2Q 1UWVA 1AE3A 3HOZG 2JA7G 3D31A 4L5SA 2F4VL 1JJ2A 3CMAA 2ZJRA 4A3CG 4OXPA 4JI8L 1PH7A 3RZDH 5JJIA 4IPCA 1E1OA 4LFAQ 4B3RQ 3T1HQ 4PMWA 2VS1A 4A3DG 1I6HH 3BU2A 4KHPL 3SGIA 2JA6G 4GLAC 3HKZE 2RHSB 2PI2E 3AFQA 4GKJQ 3M4OH 1WI5A 1FL0A 3I4NH 2JK8A 2KHIA 4B3RL 3PV0A 3T1HL 1MKHA 3FHWA 4GKJL 4JI3Q 3HOYH 3F2BA 1QUQB 1VCIA 2A8VA 1G6PA 2PQAA 4IPDA 5IP9G 1YHQA 2N8NA 5C4JH 4A3JH 1PA6A 2ES2A 1L2FA 1IBMQ 1IZ6A 4LUZA 3HKSA 4KHZA 1K9MC 1YVCA 3H3VH 4QQBX 4A93H 3CCLA 4A3EH 2NVQH 2BH2A 4JV5Q 4UPAA 3LGJA 2K4KA 3S17H 2Y0SE 4LFBQ 5IYBG 1I94Q 5ELOA 2YTYA 3NEMA 3ULPA 4POGA 1HZBA 4JV5L 1TXYA 4X62Q 4P71A 2CWAA 4WJ3M 4A3IH 1G291 5E7NA 2Q2HA 1OXSC 1E24A 2ATWA 1KRSA 1NY4A 2K52A 1WCMG 3I4MH 1RIPA 1SR3A 4R1JA 4AH6A 3KJPA 4DR2Q 1LYLA 1N8RC 2VQEL 5M3FH 2JA8H 1L1OB 1Y14B 2JA8G 3L2PA 5C3EG 5LMNW 4DR2L 1PHJA 4DR1Q 4B3MQ 5HGQA 1PH6A 1UE5A 4MNOA 4DR1L 1KRTA 4B3ML 5GADC 1SN8A 3U58A 3K8AA 4X6AH 1IBKQ 1SFOH 2D0PA 2YTXA 3T1YL 1J6QA 2NZHA 1PVOA 3RLFA 3TQYA 3K80C 4X66Q 1QZHA 1Q86C 2ASBA 3K81C 4APVA 3GTJH 4JI2Q 3CAMA 3GTPH 4LF5Q 2HIVA 1UE1A 3I4NG 4A3FH 4LF7Q 2JEAI 4DR3L 5EAYA 5LMNL 3ULLA 3F2DA 1VQLA 5C44H 3TS0A 4JI2L 1PH4A 2ZTDA 3CCVA 3S24A 3GD7A 1SE8A 3HOYG 4R4CA 4LF7L 4DV6Q 1GD7A 4DV0Q 1YJ9A 5JEAJ 1JB7A 4A3JG 4IOCA 1PH5A 3FP9A 2JA5H 4DV6L 3GTKH 4A93G 1Q8KA 4A3EG 1JT8A 1PH9A 3UDIA 1HZ9A 4DV4L 4H02A 3L7ZC 4RMFA 3U4ZA 1VQEA 2R92H 4LF6L 3FKIH 4JBJA 5FLMH 4HJAA 3S1RH 5JJKA 3PIOA 4OO1I 2QGQA 1TWGH 2GVAA 2BH8A 1HR0L 1CKNA 4JI1L 3PUWA 3CXCA 4P74A 4A3IG 5M5YH 3PCOB 4A75A 3I4MG 4HJ5A 2K5VA 1FGUA 1PH8A 4UP7A 1YI2A 4BXXG 5M3FG 1MIUA 1XTDA 3DM3A 4YCWA 5BR8L 3OW2A 2IHFA 1BVSA 1PFSA 4R4TA 1PH1A 2E5LL 2ZJQA 4JI6Q 4POFA 1Q1EA 4IJHA 1VQDA 1K73C 2R93H 4UP9A 3BJUA 5IT9c 3CPFA 4DV3Q 4JI6L 3Q8DA 3HOVH 1NE3A 1C7YA 3BZCA 4IFDJ 2QEXA 3E9HA 3L0OA 2A1AA 3NELA 5GAEC 4YHHQ 3B6YA 2AMCB 1W2BA 4JOIC 4AYBE 4QY7A 2IX0A 3CCJA 3J81j 1VQ9A 3CD6A 4DUYQ 4A4IA 4B3SQ 2MFIA 1KD1C 1C9OA 4YHHL 3RLOA 2Z6KC 4JYAL 1JJGA 1OXUA 3CF5A 4B3TL 4DR7Q 1E3PA 1NMFA 4LNQA 4JI5L 2EXDA 1YJNA 5FJ8H 2RHQB 4BY1H 4B3SL 2ZM6Q 1O7IA 3HKZG 3RN2A 2N49A 3RR5A 2MNAA 4R4IA 4DV1Q 4IFDI 2OQKA 3PF5A 4DV2L 4LUVA 3F1ZA 4DAMA 2DUDA 1K8GA 2XGTA 3F8TA 4LUOA 4LFAL 2UU9Q 4JBKA 2JA5G 2WB1E 1VQ8A 4DAYB 3TREA 2QA4A 1VQFA 1Y1VH 4HIKA 1X9NA 2CQOA 2BA1A 4HIDA 4DR5Q 1YJWA 1QVCA 1VQMA 2R92G 3HOUH 3FKIG 1UE7A 3W1BA 4YCVA 1A8VA 1W3SA 5FLMG 2UU9L 4BA2I 4JI0Q 1CKNB 4PZ7A 2RCNA 4JI3L 2Y0SG 1KHIA 2IHEA 4DV5Q 1E1TA 4DR5L 3GTOH 2D0OA 4UY8C 5M3MH 2V1CC 1L0WA 1YEZA 3KF6A 3PUVA 2B29A 2CFMA 3GTGH 3OTOQ 4BBSG 2F3IA 4WJ4A 1Q46A 1Z47A 1IBML 4GNXA 3ZJYC 2EIFA 3DLLA 2HHHQ 4A3BG 3HOXH 1WYDA 1YZ6A 1T9HA 4ME3A 1TWHH 4GKKQ 3CP0A 3J81i 1YHAA 4LFBL 1E7ZA 2R93G 4OX9Q 1P8LA 3CMEA 5JEAG 1I94L 1XNQQ 3HOVG 1VQHA 1Y1WG 3PO3H 2JA9A 4X62L 3ER0A 5LMUQ 3JAMi 3CCRA 3UDXA 1ASZA 3KF8B 5C0XI 3PF4A 4OX9L 5K36G 4LF9Q 4GOPB 1VQ7A 1N36Q 1EOVA 3PUXA 3STBD 1N33Q 4BBRH 4DK6C 5LMUL 2IY5B 1CUKA 2NN6I 1WOCA 1PH2A 5AJ3Q 1Q12A 3A74A 3VDYA 3S2HH 1K8AC 4BY1G 1JE5A 3W5OA 1XMOQ 1SRUA 3GDEA 5IY0A 2MQHA 4JCVE 2VQFQ 3PUZA 3J7A5 1TWAH 5AJ3L 4HIOA 1S72A 3PO2H 1AE2A 2D62A 2KCMA 4AIMA 1JMCA 2VUMH 1XMOL 1IBKL 1QVFA 3J81c 1VQBA
chains in the Genus database with same CATH superfamily
2NB0A 4X66L 2CCZA 1GUWA 1VF7A 2FJ2A 1P16A 2LKVA 4Y52H 2AWOA 3LWUA 2DY8A 4OEMB 5IYCH 1L1OC 3M4YA 1STNA 3DWPA 3NXWA 4AQYL 1JE4A 5KRUA 4DV0L 4XIGS 3D8GA 4DK1A 4EVOA 3NSWA 2EOTA 1SNMA 4GNXB 2HIXA 1I4PA 1QCBD 2LS01 1KQSA 3MEFA 1IXRA 4A3DH 4ZKBB 3PIO3 1A62A 1CKOA 3PO3G 3K7AB 2CQAA 1MJCA 4YWLA 1PYBA 3BYYB 1LTTD 1IW7D 1PYSB 4BBRG 3M4PA 3GTLH 1EL0A 2UUAQ 5J39A 1TKWB 4NB3A 3E0EA 4KD3A 1QB5D 3DWAA 3G71A 4DV3L 4DKAC 2OWOA 3PO2G 4YY3Q 4X65Q 5CR3A 3EJIA 1FJGQ 1XNRL 2M2LA 3QB3A 1SBBB 3WOEA 1A3TA 2BA0A 4DUYL 1C8CA 4DR7L 5C44G 2WKCA 1TIID 2JEBI 2ZM6L 1CKMA 3J80i 3AU7A 1KL9A 4HMJA 2ALYB 2AKWB 4CJ2C 3F2CA 5IYCG 1RODA 4N8FA 4A3KH 5M5XH 3HFZB 3AEVA 4XQQA 4XTCS 3T13A 5IODA 4ZUJA 4KN7C 4BS9A 4ODGA 5IT9E 3I4NB 4CKBA 2B2UA 3IFTA 3AYHB 4OONA 2Q2TA 3CC4A 1F9SA 1Q8IA 4UP8A 3KYHC 4RAUC 3J7AV 1BNZA 3HOWH 4ZQ3A 1HNZQ 1S5BD 4JI4L 1H9RA 1TS4A 5CV4A 2UXBQ 4L5QA 4X3KA 3C1FA 1CK1A 4JI7L 4A93B 4PZ6A 1EYAA 3H0GH 3A56A 5BN3A 3OTOL 1WTQA 1YHBA 1X56A 5CBEE 4LF4Q 1ET9A 4LFCQ 1R4QB 4HMIA 1LTBD 1VQJA 1QWYA 1K0SA 1SYFA 5FO9B 3QR8A 2X6LA 1N32L 2UUCQ 1SLJA 5CV6A 5IOCA 1N36L 4RCNA 1U5KA 2F0NA 4UAIA 2IX3A 1N33L 1YITA 2VW9A 5A2QE 5IGCA 1K83H 1Y8NB 3CQZH 2Z4IA 1PV4A 1Q7YC 2Q2IA 3TEHB 4HJ9A 1A63A 1X3PA 5C3XA 1B7YB 3D3RA 4A3KG 3P7JA 1S5FD 5JVH3 2CWPA 2QEJC 2E74C 1CQVA 1ENFA 2HQLA 5KYIA 3OWEB 3ERQA 1K0RA 2NTTA 3JAMc 1A2TA 4ZUIA 2I46A 2B2WA 2K50A 2ZTCA 5C44B 3HRZC 1I5FA 2OTJA 3HOWG 4DR3Q 1A0IA 3A5UA 1F9RA 1CFMA 1Q90A 4FF4A 5JAVA 3RZOH 2JA7H 3HOZH 3H0GG 3K5NA 2N78A 4DR6Q 4KHVA 4DUZL 5JJLA 3V2TA 2IW3A 1GUGA 1U0LA 2YTVA 3CC7A 4P73A 4DV4Q 3H94A 2A5HA 1Z9FA 5L37A 1HR0Q 2G5DA 5FLXE 1B50A 1QUQA 3BDCA 5E4XA 5KYLA 1EUJA 3ONAB 2A19A 3TP6A 1RL2A 2IL8A 2R3ZA 3GTLB 3S15H 2E5LQ 1JOOA 4BBSH 4L63B 5JJZA 2XNAC 4X64L 2TMPA 1GUOA 5IYBH 2K1BA 3ICEA 4WFN3 3UDGA 4R4OA 5IWAQ 3KDFB 3C2PA 1MJEA 1ZEQX 4ILWA 3GTQH 4NXNL 2IX1A 5C3EH 3BDLA 1EYCA 1SYBA 3U50C 1HXYD 3O13A 1V8QA 5GAGC 2OEOA 4G4KA 3HOZG 2JA7G 2KA7A 1Y1VB 4L5SA 1PLFA 2ICIA 3Q22A 1GUSA 4UDUC 4JI8L 4LFAQ 3T1HQ 2WV6D 1G8ZD 1Y69U 4GKJQ 2JK8A 5M3MB 3V05A 1XTCD 1S5ED 3MHBA 4XT3B 5AFWA 3U9SA 2RDHA 1JOKA 3F2BA 3BYTB 1F9QA 2PQAA 1YHQA 4A3JH 2F0SA 1PA6A 1L2FA 4KHZA 2NVQH 1RDPD 4JV5Q 4UPAA 2K05A 5DEHA 5BN5A 3S17H 1RTOA 5IYBG 1I94Q 2YTYA 4WJ3M 1I4RA 1KDAA 4AYBB 4A3IH 1NAPA 1OXSC 3S2HB 1E24A 2EJMA 2F1MA 1KRSA 1SR3A 4AH6A 4DR2Q 1K83B 2VQEL 2JA8H 1L1OB 1UNSA 3CQZB 3NTIA 3I91A 5LMNW 5C3EG 3UI2A 4C1NI 3VYTA 4R8IA 5HGQA 1AP0A 4TRDA 1PH6A 1IKMA 1UE5A 3S1NB 4HAEA 3G6JB 3MFYA 4NMZA 2BCOA 4B3ML 2D5DA 2PCFB 5GADC 5EPJA 2B2VA 2R61A 1WD1A 1HUNA 2YTXA 4XQNA 2NZHA 1PVOA 3RLFA 3TQYA 3KUPA 3GTJH 1I6VC 1UE1A 2NVYB 1B1ZA 3HGBA 2JEAI 1VQLA 3TS0A 4JI2L 3CCVA 3S24A 2EYFA 3FEWX 3RZOB 2JA7B 1F9PA 4WJWA 2BOSA 4A3JG 4IOCA 3FP9A 1LTID 1MGSA 1JORA 5FO8B 4MIUA 5I9OA 5C3WA 3UDIA 4KMUC 2QDBA 1EY0A 1YNJD 1VQEA 5I6WA 4LF6L 3FKIH 4JBJA 5FLMH 3S1RH 2D9UA 2QGQA 5KNDA 2BH8A 3VYRA 1CKNA 1DJRD 4KD4A 4A3IG 2R7ZB 4A75A 4XYQA 1M8AA 2K5VA 4CBVA 4M1UB 4ME5A 1PH8A 3S15B 3EFXD 1DONA 3SEBA 1BCPF 1YI2A 2JA8G 4A3BH 1PH1A 3OW2A 4R4TA 1PFSA 2OT2A 3GV6A 1AN8A 1Q1EA 1XYIA 3BJUA 4NKLA 1JICA 1LT6D 3E9HA 3L0OA 3NELA 4YHHQ 1SXTA 1W2BA 3KF8A 1PFBA 2Z6BA 2Q8TA 1XX8A 4RGNA 3J81j 3CD6A 3P20A 4C3JB 4JYAL 1JJGA 2Z6KC 1OXUA 5C3EB 1NMFA 3K59A 3SK5A 2EXDA 1YJNA 4B3SL 1O7IA 3HKZG 3FPPA 5T1GA 3PF5A 4XDXA 1I4XA 4DAMA 2ENBA 1J8IA 3F8TA 3GV3A 1SJHD 1YNNC 2E75C 1D5ZC 1VQ8A 2V4DA 1EYDA 2CQOA 3TZUA 4HIDA 1CI3M 1QVCA 1STHA 3RMHA 3A54A 1J9OA 3VA7A 3FKIG 1UE7A 3HP3A 5FLMG 2UU9L 2B2VC 4JI0Q 4JI3L 2Y0SG 1KHIA 1HA6A 1EEFD 2D0OA 5EQ0A 1H9SA 4UY8C 1YEZA 3KF6A 3V96A 3NE5B 2F3IA 1TY0A 1U4MA 5LL6S 5NUCA 1IBML 4Q5VA 4A3BG 5EKIA 1B9MA 5I2YA 1T9HA 4GKKQ 2JN4A 3S9WA 4OX9Q 3R2IA 3S16B 1STEA 1Y1WG 2JA9A 5KGUA 1ASZA 3PF4A 1D1IA 3CRKC 2MUYA 2HDLA 1D6EC 2Z9HA 3GQBA 2VXWA 2F03A 4DK6C 2IY5B 4JW0A 5J1ZA 3VDYA 1SE4A 5I2XA 2BE5C 5K5PA 3HG9A 3NTHA 1XMOQ 2EXZA 3A8JE 5IY0A 2VQFQ 3J7A5 1K8MA 4MTKA 4RGOS 4OIJA 2D62A 1PYWD 2XN9C 4Y7NB 2VUMH 1T5XD 1UEAB 2NVTB 1TWFH 1OO9B 1D8LA 4NXMQ 1V1QA 2EYPA 1TU2B 3JAML 1DYQA 1I3QH 2K04A 3OYYA 4V0BA 1BXTA 1MSGA 2D2CC 5GROA 2PW5A 3BVZA 3MXNA 4K6DA 4PZ8A 2ZXOA 4QIWE 2F0JA 2RA4A 1BBUA 4C3IH 2QKIC 3A7AB 3RN5A 2FMCA 1X54A 3JC66 3OIQA 2RKSA 3C3LA 2XVSA 1D7QA 1B53A 3I4OA 3R8BA 1CA5A 1VQCA 3UE1A 2Y0SB 4MZ9A 4OELB 2F0GA 4OWXB 1SMYD 3U9OA 4B08A 1QG7A 3S14H 4OO1H 5FO7B 1VQPA 2EJGC 3MXGA 1VQKA 3RLNA 4A3BB 2EY5A 1E22A 2WP8J 1OXXK 3AB9A 1R4PB 1HZAA 1NSNS 1GO3E 1Y1WB 4B9XA 5E3FA 5D14A 1Y8OB 2EYMA 2AHOB 2NZOA 2VUMG 1EU4A 4HSVA 1ONLA 1TR5A 1EQQA 1QVGA 1GM5A 1VQ4A 4C56C 2E2HH 1VQ6A 2K7VA 1D1KA 2WFWA 4XXEA 4YY3L 2C5CA 2WKDA 4X65L 2WAQE 5DAUA 1FJGL 2R6GA 2F0IA 2WB1G 1E0BA 1DOKA 1NJIC 3ERSX 2UXDQ 3URYA 2FINB 2R7FA 4NDXA 3RZDB 1X3EA 2DNCA 2XWJB 5LHY1 4GLXA 1O80A 3M4OB 2VNUD 1HZCA 2LSSA 3TDQA 4C3IG 1KAAA 1TS3A 4KHPQ 4DR4Q 2WACA 2KCTA 1R9TH 1HNWQ 1HNXQ 1LTLA 1YNJC 4HN7A 3HOYB 2PMZB 4TVAB 2RCFA 4K2KA 3FPUB 1D2BA 1VQAA 3NBHB 2VY3A 2H4OA 4OO1G 1HNZL 1KABA 2UXBL 3J80c 1QJOA 3GTMH 4RHSA 2HHHL 1M4VA 4P75A 4MHEA 4L8JA 1ICFB 2PNRC 4H0LC 1O7LA 4LF4L 1XNQL 1IYJB 3E3XA 1UE6A 4LFCL 1WVLA 5M3FB 1V43A 5TSSA 3PMFA 3EROA 3PSIA 2G9HD 2IPKD 5CV5A 2PZUA 4FNFA 4J1MA 4LF9L 5FJ8G 3PIP3 2UUCL 3E6ZX 5GAHC 3AFPA 4DNIA 1ESRA 2DN8A 5HGTA 4GS3A 1LM0A 4K6LA 4BWGB 2NTSA 4GLVB 3H3VC 4GN5A 1KAWA 1SYGA 3EIVA 2WIIB 3ZYYX 2NBFA 3T51B 3GTPB 2A69C 4C3HH 4F88A 5F2DA 1YBYA 2I07B 2F0FA 2K14A 2F0PA 4QB4A 4XQJA 4GN4B 4J15A 1D5MC 2KHSA 1WTWA 1XMQQ 1AZPA 2JA5B 4IJLA 3R93A 1LT3D 2L0CA 3GP7A 1V1PB 4A3CH 1YNXA 1EZ8A 4IUVA 1NTGA 2R92B 4H13C 2ID0A 3CW2C 4KJOA 4RH6A 2JA6H 1CT1D 1IBLQ 2UUBL 2PQAB 3J81E 1CQFA 1XWEA 2RSOA 4XYOA 1Y8PB 4TQUS 4EQ5A 4RFBA 4DR6L 3NWTA 1H95A 2J4XA 3JAME 3S14B 2RF4A 3KK7A 1CM9A 3GO5A 3IL8A 4ALPA 2HUGA 4DNRB 2DY7A 4DXFA 5IP9H 1GVPA 1EEID 1X55A 1H9KA 2EYOA 3VYUA 2OQ0A 1PTOC 4O0AA 3KLWA 1BO0A 1KC8C 1B70B 1BUVT 3KJOA 1K8OA 4IPHA 2HCCA 3MC0B 1LABA 4C3HG 1RKNA 1TWCH 4BY1B 4O1NA 2L9HA 1N34L 2NVXH 5IWAL 4JI5Q 3H6MA 3VA5A 3M3YH 2NWGA 2FXQA 1STAA 1VQOA 4DV2Q 4Q0FA 3SE0A 4EQNA 2F4VL 2F0EA 3CMAA 4A3CG 4ZRZA 2QF7A 4OXPA 2ZXPA 5EBCA 2LMCB 4B3RQ 4FXKC 4PMWA 4A3DG 1I6HH 5FOBB 2RDGA 3SVMA 2JA6G 2HDMA 2K6AA 3MWYW 2RHSB 4FO2A 2PI2E 3AFQA 4GLAC 1R9TB 3T1HL 5KEEA 1MKHA 2XIWA 3FHWA 4GKJL 2QW7A 1SMYC 3QJYA 1QNUA 2A8VA 1G6PA 1TWHB 4IPDA 5IP9G 2N8NA 2BDOA 5C4JH 1WTPA 3HKSA 1U9RA 1K9MC 3PO3B 3H3VH 3CCLA 4A3EH 2K4KA 4LFBQ 1DM0B 5EGTA 3ULPA 1EY8A 3K6OA 4JV5L 4BBRB 1TXYA 4X62Q 2CWAA 5E7NA 2Q2HA 1F2LA 3I4MH 3Q23A 4R1JA 3EA6A 1SYDA 3I70A 3OIPA 2K28A 1Y14B 5EBDA 3PO2B 4DR2L 2KEDA 4KTAA 2F0LA 1G2TA 2O5IC 3H09A 4FF1A 4Z9CB 1KRTA 3MVVA 4X6AH 3MXUA 1IBKQ 4K5XA 3CU7A 3T1YL 1J6QA 3TP5A 4X66Q 1QZHA 3LNNA 1MBYA 1JOQA 4H44C 4I65A 4A3FH 4DAPA 5EAYA 5LMNL 3ULLA 3F2DA 1SYEA 2O4XA 1ENCA 4X3TA 2ZTDA 1YNND 4R4CA 1HA5A 4DV6Q 1GD7A 4DV0Q 1AW7A 1YJ9A 1JB7A 4A3DB 1PTOH 3GTKH 1JT8A 4A3EG 1PZJD 4N9PA 4DAYA 2EVBA 2B2UC 4HEDA 4RCOA 5ELFA 2A6ED 3QIAA 1JWSD 4OO1I 3EQLC 1TWGH 2GVAA 4IQZA 4JI1L 3PUWA 4P74A 5HURA 1EY5A 5M5YH 4K8JA 2EYLA 1GJXA 3SK6A 3I4MG 2AUJD 1FGUA 3VR4A 1SNOA 5BR8L 4YCWA 2OXPA 4JI6Q 1BVSA 1AFPA 4LAAA 1G91A 2F4IA 3NBIA 2R93H 4UP9A 1RHPA 5CYUA 5IT9c 3CPFA 4DV3Q 3HOVH 3Q8DA 1NE3A 4IFDJ 2QEXA 1I4QA 4DA2A 5GAEC 3B6YA 2AMCB 4B9WA 4AYBE 5KIXA 1CZWA 2BE5D 1VQ9A 4DUYQ 2MPMA 2MFIA 4YHHL 3X3MA 1NCVA 4B3TL 4DR7Q 5ELBA 1E3PA 4A3KB 5M5XB 2EDGA 3OOCA 2ZM6Q 3RN2A 5IIFA 2KVMA 2N49A 2KUMA 2OQKA 4L6TB 4CJ0B 1MD2D 2DUDA 4XT1B 3NWSA 1ILQA 2L12A 2XGTA 4LUOA 3A7LA 3HOWB 2XRSD 4JBKA 1FD7D 1VQFA 4KK7A 2AQ1B 3ND8A 5EKKA 3IKJA 4DR5Q 3C1EA 1YJWA 1VQMA 3HOUH 1HFNA 3H0GB 4OL7A 4YCVA 2B2WC 4PZ7A 3WOFA 3GTOH 2A6HC 2EZVA 2CFMA 3GTGH 3OTOQ 4BBSG 5C4JB 3NQIA 2L5TA 3TP8A 4GNXA 2EIFA 3D6WA 2FHTA 3HOXH 4A3EB 3D4DA 5CBAE 1KLGD 1RF2D 2PZWA 3BZDB 4HCEA 3W2DA 3J80L 3J81i 2R93G 1K28A 3MA2B 3HOVG 5CMDA 1W6KA 1ZXTA 2L4NA 5CV8A 3A55A 3ER0A 3JAMi 4OX9L 1D5XC 2KOLA 1B3AA 1N36Q 1N33Q 2F0QA 1XXGA 1Q12A 3A74A 1AEXA 1LT4D 4YIJA 1JE5A 1VMCA 3GDEA 1B2TA 3VR5A 3DWQA 1TWAH 3LX0A 4HIOA 1QOHA 1S72A 2KECA 1JMCA 1XMOL 4YWKA 1SYCA 2PYKA 4LF8Q 4NPSA 1TY2A 3IRBA 5IE8A 1F2MA 1TQOA 2RQXA 4DV7Q 5CC4A 2JYOA 4LF5L 5FLXc 3HOZB 1BCPC 2L11A 2MGSA 3I7FA 1FVIA 3HOUG 4L5TA 3S1QH 1JWUD 3SHLA 1NR2A 4YWMA 3NTKA 3UE0A 4O2DA 1WTHA 1FYCA 1M90C 5IP7H 1PTOB 3WDNA 3GTKB 4DUZQ 4JK1C 1VS0A 3Q0AA 3DHQA 2IWHA 1KNEA 1U4PA 1FR3A 1HQRD 2IT1A 3ITPA 5D65A 1EFID 4CGYB 5M5WH 4MTNA 4BBSB 3I90A 5KNCA 1DXMA 1QILA 2OCEA 2E2JH 5GQOA 4RGTA 4A76A 4HTHA 4K0KQ 4KI0A 2L15A 1LTRD 2P5ZX 2JE6I 2PZTA 2M00A 2JQOA 3E5SA 1S5DD 4GOPA 5CORA 3GTQB 1EIYB 3TBIB 1BBWA 2E8GA 2HQEA 4M8AA 2B63H 1EWIA 2AQ2B 5JOBA 1YIJA 1Q82C 5DM63 1O7YA 1WFQA 1II3A 5H1SE 4IO9A 2A69D 1UAPA 2OF1A 4DV1L 2J7ZA 2B2TA 2UXDL 2AWNA 3M4QA 1DGSA 3H91A 5IP7G 4RHRA 1G51A 2H5XA 2PI2A 1N9WA 1EWHA 1BDOA 2F3VA 3CCMA 3RNUA 4NW2A 1G2SA 1X3GA 4OHJA 3QWNA 2A6EC 1GKHA 2DGYA 2N88A 4U673 2TSSA 5C0XJ 2OTLA 4DR4L 4A3JB 2RDFA 3WWVA 1HNWL 4DV5L 1HNXL 1EU3A 3EBEA 4PQXA 2NVQB 3N6RA 3H3VI 3S17B 2SNMA 5IGEA 5I6YA 2EY1A 1NMGA 4IUTA 4A3IB 4LK1C 4QJFA 1JR0D 4P2CB 1SDFA 4QF4A 4JOIA 2JA8B 3MTSA 3PIPA 4KY7A 4X3UA 1V1OA 5J3BA 1MSHA 4P72A 4RWSC 4A3MH 5ISRA 4IUPA 1BKBA 1PTOD 2I5MX 2PW7A 3KOJA 3PUYA 5C0XH 2VQEQ 2B63G 2VL6A 4DNTB 4WRDA 5DLQE 1J5EQ 4TKOB 4BXXH 2LY7A 1V9PA 1E2VA 2UXCQ 3R3OA 2WINB 3P75A 3A5ZB 3GTJB 3A0JA 3HKZB 1X3FA 3KDFA 5CV9A 3SDZA 2MO0A 1QZGA 4LW1A 3LWEA 4GOPC 4KY6A 4QGUA 2K5WA 4FP5D 1FGBD 1FNUA 3G6EA 3S2DH 4KY5A 1XJVA 3I56A 2I5LX 3OPOA 1XMQL 3FKIB 3S1RB 1B44D 2YYZA 5DNFA 1X65A 1GHJA 5D3IB 4CKCA 2F0TA 1SMXA 4LF6Q 1XPRA 3TRZA 1IBLL 2PMZE 1XPUA 1PZID 2KBNA 1A6XA 4QMGA 1I50H 4A3MG 3K7AH 4L5RC 5C0XG 2UUAL 2DJFC 5COYA 5JPMC 3M9BA 3EN2A 3KLRA 1VQIA 3G48A 2WAQG 4OWWB 1EYGA 2EY6A 3KLSA 2PQEA 4H7BA 1PFMA 1EQTA 2MHVA 2R7DA 1RTNA 3AQQA 3N52A 5IT9L 3M7NA 3I8ZA 3NUCA 1PRTC 2QILA 2RBMA 5E4WC 3UDFA 1GUNA 2XSCA 4EX5A 4JYAQ 2QCPX 1BR9A 2H1EA 2JJQA 3R2TA 1L1OA 1H9MA 5C4ZA 4ULLA 1B3QA 4PMBA 1ZYRD 2YV5A 3T56B 1LACA 1AE3A 2GA4B 1JJ2A 2ZJRA 4RGMA 4IPCA 1E1OA 1LTSD 2VS1A 3BU2A 1U4LA 4F7XA 3P1HA 3I4NH 1C48A 4B3RL 3PV0A 1JQYD 3FMCA 1TS2A 3A8KE 1IHZA 1RD9D 3D4WA 4JI3Q 2AQ3B 5T1IA 4E6IA 1QUQB 1VCIA 1E2ZA 2ES2A 1IBMQ 3BVGA 4FXDA 4QQBX 4A93H 4FYDA 3LGJA 1C4QA 3W3AA 3EVQA 5ELOA 1KNAA 3NEMA 4POGA 1HZBA 1EY9A 1KXLA 4P71A 4EQPA 2X6GA 4KKUA 4A3MB 1DOLA 1DOMA 1PZKD 1LYLA 1S5CD 1EIGA 4DGZA 1LTAD 2Z1CA 1PHJA 2VUMB 4DR1Q 1CHQD 1TWFB 2F0MA 1JC7A 1HRJA 1EZ6A 3U58A 1SN8A 3K8AA 4FXGC 4FF2A 5LL6X 1I3QB 2J0TD 2WB1B 3DM1A 4X3SA 3SXHA 3K80C 4KKSA 5C6AA 1HHVA 2ASBA 3K81C 3I4NG 2CW0C 4QUFA 2HIVA 1WTOA 4LF7Q 4DR3L 5C44H 1PXUA 4C3IB 5FLXL 3S2DB 1O7ZA 1JB3A 4EGVA 4DV6L 4A93G 4LMQD 1A3VA 4DV4L 4H02A 4RMFA 2FMMA 3U4ZA 2A6HD 2K32A 1HR0L 3DUZA 4HCSA 3CXCA 3PCOB 1ML0D 2QDLA 1I50B 3CRLC 5A35A 3L3OC 2C9OA 3CKIB 1XTDA 1CHPD 5FKAC 2IHFA 1BBXC 2ZJQA 2E5LL 3VYSA 5G3LD 4POFA 1K73C 2E2HB 3I3CA 1DD2A 4JI6L 1IYVA 1HTLD 3BZCA 5IGGA 3FVQA 5K36H 1WTXA 1F2ZA 3CCJA 1W6JA 3NP8A 1F77A 4A4IA 1RJTA 2SEBD 1ZKOA 4KJNA 2F0KA 4LNQA 2RHQB 4CJ1B 2BDNA 3D6CA 2EPBA 4K8IA 3TMEA 3RR5A 5JPNC 2MNAA 4R4IA 4LUVA 5IGFA 3K5LA 2PPBC 1SE2A 3M7GA 4LFAL 1BCPD 4PNYA 1STBA 3K5MA 5D3DA 2QA4A 1X9NA 1Y1VH 1UUPA 2G9DA 1CTMA 1GUTA 2JP1A 3J7YW 1QE6A 3W1BA 1PTOF 1A8VA 1W3SA 2DNEA 4BA2I 1IYUA 3GTMB 3VR2A 1CKNB 2RCNA 3E0JA 2IHEA 4DR5L 5M3MH 3PUVA 3QO2A 5CGKA 2DJGC 3TSSA 1Z47A 2HHHQ 1WYDA 1YZ6A 4ME3A 3CP0A 2CH4W 2A68C 4QUCA 1VDZA 1TT2A 4PV1C 1P8LA 3CMEA 1I94L 1XNQQ 2SOBA 3KBXA 3T53B 4CKEA 5LMUQ 3UDXA 3KF8B 5C0XI 5K36G 4RKLA 4LF9Q 1VF5C 4GOPB 1VQ7A 4LJZC 3STBD 3PUXA 5M9OA 1CUKA 1WOCA 2MJ8A 1PH2A 5AJ3Q 3S2HH 1K8AC 3PQIA 3OW7A 3W5OA 1SRUA 2SDFA 1ZYRC 4JCVE 4C3HB 1MHWC 3PUZA 2EYHA 4IUQA 2KCMA 1KDBA 3L9AX 3J81c 1O78A 1M1KC 3S1NH 3CCEA 5BN4A 2XTIA 1HR0W 3J7ZC 1OXVA 2F0HA 3IAYA 1XPOA 1KDCA 1Y1VG 1S4ZA 4AQYQ 4RG1A 5IGBA 2SNSA 4LF8L 2K01A 4DV7L 4LWCA 3W1GA 1H9SB 1SJED 3U4VA 5M3MG 2NVYH 3KF6B 2AUKA 2JA6B 2KQ3A 2F52A 4HJ7A 1HQMC 2KCCA 1I4GA 4JC0A 4DU9A 1BQQT 1WTVA 5EJWA 2UUBQ 1FNVA 1SSOA 4HR7B 1PRTB 4JBWA 5I9PA 4OIKA 3T4AC 3NBHA 2Q2UA 1WTRA 1SAPA 2X69A 1NBWA 2F0WA 4AYBG 4C1NK 3QOJA 2R7ZH 3FDTA 5C4HA 1LTGD 4A3LH 3CCQA 3D0FA 4G7OC 2XRQD 4JBMA 1KLUD 4BY7H 1XNRQ 1TWCB 3K0XA 4U68A 4C2MH 3MXPA 3PGZA 4K0KL 2F0DA 3BZKA 2NVXB 3M3YB 1SNQA 4A3FG 3OMCA 2K5DA 4N9TA 5ELNA 3HS0C 1PMRA 3G4SA 1N34Q 1F2YA 2XWBB 1Z7TA 4J8QA 4JVZA 3MXNB 5I4DA 4HJ8A 3K58A 2K03A 2Z0SA 4C3JH 2Q8RE 2GVBA 2B3GA 1VQNA 2JXMB 1I6HB 3BG3A 1HTPA 4FDBA 1KIXA 2F4VQ 1Z6HA 4KLKA 1VQ5A 4IFDH 5EPKA 4YCUA 1I4HA 4IOAA 3KFUA 4ZK9B 3OMGA 4TSSA 4F87A 2JSOA 1K3RA 4JI4Q 4DFAA 5ELDA 1EIFA 4JI7Q 3MFGA 2KJXA 1AZQA 4GN3B 2MO1A 4JI0L 2IJ0A 2L55A 1C0AA 5IYDH 2F0VA 4HSPA 4A3GH 1V1PA 1B8AA 1UEBA 4HIMA 3K7UC 1LUZA 2LXKA 5FK9C 2R7ZG 2N3SA 5JVG3 3I55A 1AH9A 4I7ZC 1H9JA 4DK3C 5C4XH 2EQSA 1N32Q 3CCUA 2L1BA 4GKKL 4A3LG 1IW7C 2E2IH 3I4MB 3SK8A 4DPGA 1CSQA 4BY7G 4CDDC 1HH2P 2O5JC 1VMPA 3I2ZA 4DK0A 3VR6A 2Z6KA 5IGDA 4R9WA 1X3QA 2B39A 1GHKA 2LXJA 2VB2X 4PG3A 3CC2A 3S16H 4FVMA 3S1MH 4QL5A 4BA1I 1PH3A 3RUZA 1A3UA 5ELCA 3BS1A 2NN6H 3AMUA 4C3JG 2VQFL 4IPGA 1PRTD 3OWFA 4CDEC 1S40A 1B9NA 1J5EL 5C5MA 4IFDG 1NNXA 2K5HA 4NXML 4A3FB 2UXCL 3T1YQ 1STYA 3KBGA 3NHHA 4KV6A 4Y7NH 3CCSA 1ET6A 4JG2A 1LO5D 4GZYC 3I73A 4G7HC 2NVTH 2K33A 2C35B 5LMNQ 1ASYA 2CKZB 5G3LF 4N8X1 3QOLA 5IYDG 1JJCB 2HD3A 4ZYSA 3HOXG 4A3GG 3F2UA 2K75A 1NUCA 1Q1BA 2K5NA 4KN4C 1QNKA 2ZTEA 4F8MA 4OWTB 2CVRA 4CDFC 1SROA 1TWGB 2ZJPA 1BF4A 5C4XG 4MN3A 5M5YB 4CDCC 2YU9H 1HJPA 3DEOA 3H15A 3NENA 4IUNA 4ZLTF 1Q81C 4G57A 4JI1Q 1IL8A 2F0UA 3BVMA 1OXTA 4R8NA 3TS2A 2ICEC 1Q3LA 3E9IA 4CHTB 1VQGA 1U4RA 3STBC 1EQRA 2PNHA 2R93B 1MI2A 4X64Q 1JWMD 3HOVB 5BR8Q 1ILPA 2HT1A 2Z4HA 2Z8LA 1GXDC 2HCIA 3CHBD 2I5HA 1EFWA 2M9VA 2NN6G 3ULJA 3Q24A 4BY7B 4GNXC 2I0QA 3T16A 2VB3X 2A73B 4C2MB 1IL2A 4PMCA 4S3SA 1PFNA 1CSPA 1SNCA 1WJJA 2GN5A 2KENA 3OHXC 4G7ZC 4IALA 3CPWA 4NXNQ 1S3OA 3FRPB 3M85A 1WCMH 1Y1WH 3TN2A 2KHJA 4B3TQ 4R4QA 1OTCA 2VZAA 2B2YA 4IUUA 1X6OA 2ZXRA 2EJFC 1DCZA 1L0YB 3K57A 1SEBD 3MZ5A 4JI8Q 3A8IE 5HY6A 4K5WA 1UWVA 2KEEA 4KKTA 3D31A 2LFNA 2F0OA 1EIHA 2CW0D 3VR3A 1NR4A 3RZDH 1PH7A 3HOUB 5JJIA 4KHPL 1L0XB 3SGIA 1CA6A 3HKZE 4FF3A 3M4OH 1WI5A 1FL0A 3GTOB 2KHIA 2F3WA 2PO4A 4ZAIA 2EYJA 3GTGB 1HFGA 3G7LA 3HOYH 3HOXB 4A3GB 1JCKB 1PDQA 3SR1A 1IZ6A 4LUZA 1YVCA 5C4XB 4ZCKA 1EY6A 3J7AF 2BH2A 2E2IB 2ZT9C 3DEPA 2Y0SE 1T5EA 1TVXA 3SK4A 3C46A 1B4OA 2RVLA 1EOTA 2MP1A 1ICWA 1G291 2ATWA 1HCZA 1NY4A 2FFKB 2K52A 1WCMG 2NUCA 1RIPA 3QG1A 3KJPA 3S1MB 3RD4A 1N8RC 1WD0A 1TWAB 5M3FH 3ND9A 5CV7A 3I4LA 1E2WA 3L2PA 3J80E 4B3MQ 4UHVA 5EKLA 4IURA 4MNOA 4K5VA 4I7AA 2NYZD 4DR1L 3MEHA 5E1FA 1SFOH 2D0PA 1EY7A 3S1QB 1Q86C 3J81L 4APVA 3NPPA 4JI2Q 2CHBD 3CAMA 3OSOA 3TZDA 4LF5Q 3GTPH 4ID6A 4O42A 4ZKCB 1PH4A 1KTKA 1SE8A 3GD7A 1HUMA 3HOYG 4LF7L 5JEAJ 1IKLA 3KLSX 4DN4M 2B2YC 1PH5A 2B2TC 2JA5H 2CH4A 1Q8KA 3BDOA 1PH9A 1HZ9A 3L7ZC 2YU9B 2R92H 5M5WB 4HJAA 5JJKA 5C5LA 2RSNA 3PIOA 4WORA 2E2JB 1G6ZA 3K0YA 4HJ5A 3DXJC 2A74C 3IFDA 4UP7A 1K3BC 2A68D 2O2LD 3HEJA 4BXXG 5M3FG 1MIUA 4J6HA 3DM3A 4K14A 1SE3A 4IJHA 1VQDA 4K2LA 2K5QA 5ELEA 3NQTA 3I72A 5JEAH 3K5OA 1C7YA 1A15A 2E76C 2A1AA 1DZ1A 4JPBW 2B63B 1EWCA 2B8GA 4JOIC 4QY7A 1WCMB 2IX0A 3MAQA 4B3SQ 1KD1C 1C9OA 3RLOA 2NZ1D 3CF5A 3D4RA 1BOSA 2N55A 1RCVD 4JI5L 5FJ8H 4BY1H 2KCNA 4QIWB 4DV1Q 4IFDI 4DV2L 3F1ZA 4IZ8A 2Q8IB 1EY4A 1GOZA 5DM73 1K8GA 1SNDA 5EPLA 3NK9A 1STGA 1CZGA 3X3NA 2UU9Q 2JA5G 2WB1E 4DAYB 3TREA 4HIKA 4OGQC 2BA1A 2R92G 1HPCA 1X32A 1ESFA 5A2QL 4DV5Q 1E1TA 3HZXA 2V1CC 1L0WA 2B29A 1TS5A 4RKBA 2B8FA 1FNWA 1PRTF 4WJ4A 1Q46A 2EE1A 4ABNA 1LV9A 3ZJYC 1EQVA 3DLLA 1ENAA 1TWHH 4DXGA 1YHAA 4LFBL 1E7ZA 3TP7A 5J22A 3PO3H 5JEAG 1BCPB 1VQHA 4RA8A 4X62L 2E2DC 1A2UA 3CCRA 3Q6SA 1LLRD 4EQOA 4DF7A 2WAQB 1EOVA 4BBRH 5LMUL 4V190 2NN6I 3DMUA 2EY2A 1SNPA 4BY1G 4NP5A 1LT5D 2MQHA 4IN3A 5AJ3L 4DAVA 3PO2H 1AE2A 4AIMA 5KNBA 4QCLA 1SFOB 1IBKL 1QVFA 1VQBA
chains in the Genus database with same CATH topology
1TWFH 1D8LA 4YWKA 1M1KC 1V1QA 3CCEA 4NXMQ 2XTIA 3S1NH 4LF8Q 4NPSA 3IRBA 4X66L 1HR0W 2CCZA 5IE8A 3J7ZC 1OXVA 1XPOA 4DV7Q 1Y1VG 1P16A 1I3QH 4LF5L 3OYYA 4AQYQ 5FLXc 5GROA 4RG1A 4Y52H 4LF8L 3HOUG 2AWOA 3I7FA 1FVIA 3S1QH 4L5TA 4YWMA 4DV7L 4PZ8A 5IYCH 1L1OC 4QIWE 4LWCA 3UE0A 4O2DA 3W1GA 4AQYL 3U4VA 5M3MG 2NVYH 1BBUA 3KF6B 4DV0L 4XIGS 1M90C 5IP7H 2F52A 4HJ7A 4C3IH 4JC0A 4GNXB 3RN5A 4DUZQ 1VS0A 2UUBQ 2HIXA 1X54A 3JC66 1KQSA 1D7QA 3MEFA 1IXRA 4A3DH 3I4OA 1A62A 1CKOA 2IT1A 1VQCA 4JBWA 3PO3G 3UE1A 4MZ9A 4OWXB 2Q2UA 1MJCA 5M5WH 3S14H 4YWLA 1PYBA 4MTNA 1VQPA 1NBWA 1PYSB 3RLNA 1VQKA 2OCEA 4BBRG 4AYBG 2E2JH 3M4PA 3GTLH 2R7ZH 1E22A 2UUAQ 2WP8J 4NB3A 5GQOA 1OXXK 4A76A 1HZAA 4K0KQ 4A3LH 3E0EA 3CCQA 3D0FA 2L15A 4KI0A 4JBMA 3G71A 1GO3E 4BY7H 2JE6I 4DV3L 3K0XA 4C2MH 2JQOA 4DKAC 1XNRQ 2OWOA 3PO2G 3PGZA 4YY3Q 4GOPA 4K0KL 2NZOA 2AHOB 4X65Q 2VUMG 1EIYB 3BZKA 1EQQA 1GM5A 1QVGA 1VQ4A 2E2HH 1VQ6A 1FJGQ 1BBWA 1XNRL 2WFWA 2BA0A 2E8GA 4A3FG 4YY3L 4DUYL 4X65L 2B63H 2WAQE 5ELNA 1EWIA 3G4SA 5C44G 1N34Q 1FJGL 4DR7L 2JEBI 2R6GA 1YIJA 3MXNB 4HJ8A 2WB1G 1Q82C 2ZM6L 1NJIC 3ERSX 1CKMA 1WFQA 2Z0SA 3J80i 1KL9A 4C3JH 2UXDQ 2GVBA 2ALYB 2R7FA 5H1SE 2AKWB 2B3GA 3F2CA 4DV1L 5IYCG 4IO9A 1VQNA 1X3EA 4A3KH 5M5XH 3HFZB 4FDBA 3AEVA 4XTCS 1KIXA 2UXDL 2F4VQ 4KLKA 4GLXA 2VNUD 1VQ5A 2AWNA 1HZCA 1DGSA 3M4QA 5IP7G 4YCUA 2LSSA 4IOAA 3KFUA 4OONA 3AYHB 2Q2TA 1G51A 2H5XA 2PI2A 4KHPQ 1N9WA 3CC4A 4DR4Q 1K3RA 4UP8A 2KCTA 3CCMA 3RNUA 4JI4Q 1R9TH 1HNWQ 1HNXQ 1EIFA 1LTLA 3KYHC 1X3GA 4JI7Q 2OTLA 2DGYA 1GKHA 4GN3B 3HOWH 4TVAB 5C0XJ 1HNZQ 4DR4L 4JI4L 2MO1A 2UXBQ 4JI0L 4L5QA 3WWVA 1HNWL 4DV5L 1HNXL 1VQAA 3NBHB 4JI7L 2VY3A 3EBEA 1C0AA 5IYDH 4OO1G 4A3GH 4PZ6A 1HNZL 3H3VI 3H0GH 3OTOL 2UXBL 3J80c 3GTMH 1B8AA 1UEBA 1YHBA 3K7UC 1LUZA 4HIMA 2LXKA 1X56A 2R7ZG 2N3SA 2HHHL 4LF4Q 1NMGA 3I55A 1AH9A 4P75A 4DK3C 5C4XH 2EQSA 1N32Q 4LFCQ 3CCUA 4GKKL 4QJFA 4A3LG 2E2IH 4JOIA 1VQJA 4A3BH 4DPGA 1CSQA 4LF4L 1XNQL 1IYJB 4BY7G 1HH2P 3I2ZA 1N32L 1UE6A 4LFCL 2UUCQ 1V43A 3PIPA 1SLJA 3PSIA 2Z6KA 5J3BA 2LXJA 4PG3A 4P72A 3CC2A 4LF9L 3S16H 4A3MH 5FJ8G 1N36L 1U5KA 2UUCL 1N33L 1BKBA 5GAHC 3S1MH 1YITA 2VW9A 4QL5A 2I5MX 1K83H 3KOJA 3PUYA 4BA1I 3AFPA 4DNIA 2VQEQ 1PH3A 2B63G 2VL6A 3CQZH 1PV4A 4GS3A 2Q2IA 5DLQE 1LM0A 3TEHB 1Q7YC 1J5EQ 4BXXH 2VQFL 4GLVB 4HJ9A 1V9PA 4IPGA 1A63A 4GN5A 1KAWA 2UXCQ 1S40A 1B7YB 4A3KG 3EIVA 1J5EL 3A5ZB 2CWPA 2HQLA 4C3HH 4IFDG 1K0RA 3JAMc 2K5HA 4NXML 1YBYA 3A0JA 2UXCL 3T1YQ 1X3FA 3KDFA 4Y7NH 2K14A 3CCSA 2K50A 2ZTCA 2MO0A 4JG2A 1QZGA 4LW1A 1I5FA 2OTJA 2NVTH 4GN4B 4GOPC 4J15A 2C35B 4DR3Q 1A0IA 5LMNQ 3A5UA 3HOWG 1ASYA 4QGUA 2CKZB 1XMQQ 3G6EA 3S2DH 4IJLA 5IYDG 1JJCB 3RZOH 2JA7H 1XJVA 3I56A 3HOXG 3HOZH 4A3GG 2I5LX 3H0GG 2K75A 1YNXA 1Q1BA 2K5NA 4A3CH 1NTGA 2ZTEA 1XMQL 2N78A 2ID0A 4OWTB 4DR6Q 3CW2C 4DUZL 1SROA 2JA6H 5JJLA 2ZJPA 2YYZA 2PQAB 1IBLQ 2UUBL 5C4XG 1U0LA 1X65A 2YTVA 3CC7A 4P73A 4DV4Q 2YU9H 4TQUS 4EQ5A 4DR6L 1HJPA 1SMXA 3H15A 4LF6Q 3NENA 1XPRA 3TRZA 1IBLL 1H95A 2PMZE 1XPUA 1Z9FA 1Q81C 1HR0Q 4JI1Q 1OXTA 2KBNA 2RF4A 3TS2A 3GO5A 1QUQA 3E9IA 4ALPA 5IP9H 1I50H 1EUJA 1VQGA 3STBC 1EQRA 4A3MG 2PNHA 1GVPA 3K7AH 2A19A 3S15H 1RL2A 4L5RC 4X64Q 1X55A 5C0XG 5BR8Q 2UUAL 2HT1A 2OQ0A 2E5LQ 3M9BA 3EN2A 4BBSH 2I5HA 1EFWA 1VQIA 3G48A 2WAQG 2NN6G 3ULJA 1EYGA 4X64L 4OWWB 4O0AA 4GNXC 2I0QA 3KLWA 5IYBH 1IL2A 3ICEA 1KC8C 1CSPA 1WJJA 2GN5A 2KENA 1B70B 2R7DA 3KJOA 3UDGA 4IPHA 3AQQA 4R4OA 3CPWA 4NXNQ 1S3OA 3M7NA 3M85A 1WCMH 5IWAQ 1Y1WH 1TWCH 3KDFB 3UDFA 2KHJA 1MJEA 4EX5A 4JYAQ 3GTQH 1KXLA 4NXNL 1N34L 4B3TQ 2JJQA 4R4QA 2NVXH 1L1OA 1OTCA 2VZAA 5IWAL 5C3EH 2IX1A 1X6OA 4JI5Q 3M3YH 3U50C 2YV5A 2FXQA 4JI8Q 5HY6A 1VQOA 5GAGC 4DV2Q 1UWVA 1AE3A 3HOZG 2JA7G 3D31A 4L5SA 2F4VL 1JJ2A 3CMAA 2ZJRA 4A3CG 4OXPA 4JI8L 1PH7A 3RZDH 5JJIA 4IPCA 1E1OA 4LFAQ 4B3RQ 3T1HQ 4PMWA 2VS1A 4A3DG 1I6HH 3BU2A 4KHPL 3SGIA 2JA6G 4GLAC 3HKZE 2RHSB 2PI2E 3AFQA 4GKJQ 3M4OH 1WI5A 1FL0A 3I4NH 2JK8A 2KHIA 4B3RL 3PV0A 3T1HL 1MKHA 3FHWA 4GKJL 4JI3Q 3HOYH 3F2BA 1QUQB 1VCIA 2A8VA 1G6PA 2PQAA 4IPDA 5IP9G 1YHQA 2N8NA 5C4JH 4A3JH 1PA6A 2ES2A 1L2FA 1IBMQ 1IZ6A 4LUZA 3HKSA 4KHZA 1K9MC 1YVCA 3H3VH 4QQBX 4A93H 3CCLA 4A3EH 2NVQH 2BH2A 4JV5Q 4UPAA 3LGJA 2K4KA 3S17H 2Y0SE 4LFBQ 5IYBG 1I94Q 5ELOA 2YTYA 3NEMA 3ULPA 4POGA 1HZBA 4JV5L 1TXYA 4X62Q 4P71A 2CWAA 4WJ3M 4A3IH 1G291 5E7NA 2Q2HA 1OXSC 1E24A 2ATWA 1KRSA 1NY4A 2K52A 1WCMG 3I4MH 1RIPA 1SR3A 4R1JA 4AH6A 3KJPA 4DR2Q 1LYLA 1N8RC 2VQEL 5M3FH 2JA8H 1L1OB 1Y14B 2JA8G 3L2PA 5C3EG 5LMNW 4DR2L 1PHJA 4DR1Q 4B3MQ 5HGQA 1PH6A 1UE5A 4MNOA 4DR1L 1KRTA 4B3ML 5GADC 1SN8A 3U58A 3K8AA 4X6AH 1IBKQ 1SFOH 2D0PA 2YTXA 3T1YL 1J6QA 2NZHA 1PVOA 3RLFA 3TQYA 3K80C 4X66Q 1QZHA 1Q86C 2ASBA 3K81C 4APVA 3GTJH 4JI2Q 3CAMA 3GTPH 4LF5Q 2HIVA 1UE1A 3I4NG 4A3FH 4LF7Q 2JEAI 4DR3L 5EAYA 5LMNL 3ULLA 3F2DA 1VQLA 5C44H 3TS0A 4JI2L 1PH4A 2ZTDA 3CCVA 3S24A 3GD7A 1SE8A 3HOYG 4R4CA 4LF7L 4DV6Q 1GD7A 4DV0Q 1YJ9A 5JEAJ 1JB7A 4A3JG 4IOCA 1PH5A 3FP9A 2JA5H 4DV6L 3GTKH 4A93G 1Q8KA 4A3EG 1JT8A 1PH9A 3UDIA 1HZ9A 4DV4L 4H02A 3L7ZC 4RMFA 3U4ZA 1VQEA 2R92H 4LF6L 3FKIH 4JBJA 5FLMH 4HJAA 3S1RH 5JJKA 3PIOA 4OO1I 2QGQA 1TWGH 2GVAA 2BH8A 1HR0L 1CKNA 4JI1L 3PUWA 3CXCA 4P74A 4A3IG 5M5YH 3PCOB 4A75A 3I4MG 4HJ5A 2K5VA 1FGUA 1PH8A 4UP7A 1YI2A 4BXXG 5M3FG 1MIUA 1XTDA 3DM3A 4YCWA 5BR8L 3OW2A 2IHFA 1BVSA 1PFSA 4R4TA 1PH1A 2E5LL 2ZJQA 4JI6Q 4POFA 1Q1EA 4IJHA 1VQDA 1K73C 2R93H 4UP9A 3BJUA 5IT9c 3CPFA 4DV3Q 4JI6L 3Q8DA 3HOVH 1NE3A 1C7YA 3BZCA 4IFDJ 2QEXA 3E9HA 3L0OA 2A1AA 3NELA 5GAEC 4YHHQ 3B6YA 2AMCB 1W2BA 4JOIC 4AYBE 4QY7A 2IX0A 3CCJA 3J81j 1VQ9A 3CD6A 4DUYQ 4A4IA 4B3SQ 2MFIA 1KD1C 1C9OA 4YHHL 3RLOA 2Z6KC 4JYAL 1JJGA 1OXUA 3CF5A 4B3TL 4DR7Q 1E3PA 1NMFA 4LNQA 4JI5L 2EXDA 1YJNA 5FJ8H 2RHQB 4BY1H 4B3SL 2ZM6Q 1O7IA 3HKZG 3RN2A 2N49A 3RR5A 2MNAA 4R4IA 4DV1Q 4IFDI 2OQKA 3PF5A 4DV2L 4LUVA 3F1ZA 4DAMA 2DUDA 1K8GA 2XGTA 3F8TA 4LUOA 4LFAL 2UU9Q 4JBKA 2JA5G 2WB1E 1VQ8A 4DAYB 3TREA 2QA4A 1VQFA 1Y1VH 4HIKA 1X9NA 2CQOA 2BA1A 4HIDA 4DR5Q 1YJWA 1QVCA 1VQMA 2R92G 3HOUH 3FKIG 1UE7A 3W1BA 4YCVA 1A8VA 1W3SA 5FLMG 2UU9L 4BA2I 4JI0Q 1CKNB 4PZ7A 2RCNA 4JI3L 2Y0SG 1KHIA 2IHEA 4DV5Q 1E1TA 4DR5L 3GTOH 2D0OA 4UY8C 5M3MH 2V1CC 1L0WA 1YEZA 3KF6A 3PUVA 2B29A 2CFMA 3GTGH 3OTOQ 4BBSG 2F3IA 4WJ4A 1Q46A 1Z47A 1IBML 4GNXA 3ZJYC 2EIFA 3DLLA 2HHHQ 4A3BG 3HOXH 1WYDA 1YZ6A 1T9HA 4ME3A 1TWHH 4GKKQ 3CP0A 3J81i 1YHAA 4LFBL 1E7ZA 2R93G 4OX9Q 1P8LA 3CMEA 5JEAG 1I94L 1XNQQ 3HOVG 1VQHA 1Y1WG 3PO3H 2JA9A 4X62L 3ER0A 5LMUQ 3JAMi 3CCRA 3UDXA 1ASZA 3KF8B 5C0XI 3PF4A 4OX9L 5K36G 4LF9Q 4GOPB 1VQ7A 1N36Q 1EOVA 3PUXA 3STBD 1N33Q 4BBRH 4DK6C 5LMUL 2IY5B 1CUKA 2NN6I 1WOCA 1PH2A 5AJ3Q 1Q12A 3A74A 3VDYA 3S2HH 1K8AC 4BY1G 1JE5A 3W5OA 1XMOQ 1SRUA 3GDEA 5IY0A 2MQHA 4JCVE 2VQFQ 3PUZA 3J7A5 1TWAH 5AJ3L 4HIOA 1S72A 3PO2H 1AE2A 2D62A 2KCMA 4AIMA 1JMCA 2VUMH 1XMOL 1IBKL 1QVFA 3J81c 1VQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  1D8L A;  4YWK A;  1M1K C;  1V1Q A;  3CCE A;  4NXM Q;  2XTI A;  3S1N H;  4LF8 Q;  4NPS A;  3IRB A;  4X66 L;  1HR0 W;  2CCZ A;  5IE8 A;  3J7Z C;  1OXV A;  1XPO A;  4DV7 Q;  1Y1V G;  1P16 A;  1I3Q H;  4LF5 L;  3OYY A;  4AQY Q;  5FLX c;  5GRO A;  4RG1 A;  4Y52 H;  4LF8 L;  3HOU G;  2AWO A;  3I7F A;  1FVI A;  3S1Q H;  4L5T A;  4YWM A;  4DV7 L;  4PZ8 A;  5IYC H;  1L1O C;  4QIW E;  4LWC A;  3UE0 A;  4O2D A;  3W1G A;  4AQY L;  3U4V A;  5M3M G;  2NVY H;  1BBU A;  3KF6 B;  4DV0 L;  4XIG S;  1M90 C;  5IP7 H;  2F52 A;  4HJ7 A;  4C3I H;  4JC0 A;  4GNX B;  3RN5 A;  4DUZ Q;  1VS0 A;  2UUB Q;  2HIX A;  1X54 A;  3JC6 6;  1KQS A;  1D7Q A;  3MEF A;  1IXR A;  4A3D H;  3I4O A;  1A62 A;  1CKO A;  2IT1 A;  1VQC A;  4JBW A;  3PO3 G;  3UE1 A;  4MZ9 A;  4OWX B;  2Q2U A;  1MJC A;  5M5W H;  3S14 H;  4YWL A;  1PYB A;  4MTN A;  1VQP A;  1NBW A;  1PYS B;  3RLN A;  1VQK A;  2OCE A;  4BBR G;  4AYB G;  2E2J H;  3M4P A;  3GTL H;  2R7Z H;  1E22 A;  2UUA Q;  2WP8 J;  4NB3 A;  5GQO A;  1OXX K;  4A76 A;  1HZA A;  4K0K Q;  4A3L H;  3E0E A;  3CCQ A;  3D0F A;  2L15 A;  4KI0 A;  4JBM A;  3G71 A;  1GO3 E;  4BY7 H;  2JE6 I;  4DV3 L;  3K0X A;  4C2M H;  2JQO A;  4DKA C;  1XNR Q;  2OWO A;  3PO2 G;  3PGZ A;  4YY3 Q;  4GOP A;  4K0K L;  2NZO A;  2AHO B;  4X65 Q;  2VUM G;  1EIY B;  3BZK A;  1EQQ A;  1GM5 A;  1QVG A;  1VQ4 A;  2E2H H;  1VQ6 A;  1FJG Q;  1BBW A;  1XNR L;  2WFW A;  2BA0 A;  2E8G A;  4A3F G;  4YY3 L;  4DUY L;  4X65 L;  2B63 H;  2WAQ E;  5ELN A;  1EWI A;  3G4S A;  5C44 G;  1N34 Q;  1FJG L;  4DR7 L;  2JEB I;  2R6G A;  1YIJ A;  3MXN B;  4HJ8 A;  2WB1 G;  1Q82 C;  2ZM6 L;  1NJI C;  3ERS X;  1CKM A;  1WFQ A;  2Z0S A;  3J80 i;  1KL9 A;  4C3J H;  2UXD Q;  2GVB A;  2ALY B;  2R7F A;  5H1S E;  2AKW B;  2B3G A;  3F2C A;  4DV1 L;  5IYC G;  4IO9 A;  1VQN A;  1X3E A;  4A3K H;  5M5X H;  3HFZ B;  4FDB A;  3AEV A;  4XTC S;  1KIX A;  2UXD L;  2F4V Q;  4KLK A;  4GLX A;  2VNU D;  1VQ5 A;  2AWN A;  1HZC A;  1DGS A;  3M4Q A;  5IP7 G;  4YCU A;  2LSS A;  4IOA A;  3KFU A;  4OON A;  3AYH B;  2Q2T A;  1G51 A;  2H5X A;  2PI2 A;  4KHP Q;  1N9W A;  3CC4 A;  4DR4 Q;  1K3R A;  4UP8 A;  2KCT A;  3CCM A;  3RNU A;  4JI4 Q;  1R9T H;  1HNW Q;  1HNX Q;  1EIF A;  1LTL A;  3KYH C;  1X3G A;  4JI7 Q;  2OTL A;  2DGY A;  1GKH A;  4GN3 B;  3HOW H;  4TVA B;  5C0X J;  1HNZ Q;  4DR4 L;  4JI4 L;  2MO1 A;  2UXB Q;  4JI0 L;  4L5Q A;  3WWV A;  1HNW L;  4DV5 L;  1HNX L;  1VQA A;  3NBH B;  4JI7 L;  2VY3 A;  3EBE A;  1C0A A;  5IYD H;  4OO1 G;  4A3G H;  4PZ6 A;  1HNZ L;  3H3V I;  3H0G H;  3OTO L;  2UXB L;  3J80 c;  3GTM H;  1B8A A;  1UEB A;  1YHB A;  3K7U C;  1LUZ A;  4HIM A;  2LXK A;  1X56 A;  2R7Z G;  2N3S A;  2HHH L;  4LF4 Q;  1NMG A;  3I55 A;  1AH9 A;  4P75 A;  4DK3 C;  5C4X H;  2EQS A;  1N32 Q;  4LFC Q;  3CCU A;  4GKK L;  4QJF A;  4A3L G;  2E2I H;  4JOI A;  1VQJ A;  4A3B H;  4DPG A;  1CSQ A;  4LF4 L;  1XNQ L;  1IYJ B;  4BY7 G;  1HH2 P;  3I2Z A;  1N32 L;  1UE6 A;  4LFC L;  2UUC Q;  1V43 A;  3PIP A;  1SLJ A;  3PSI A;  2Z6K A;  5J3B A;  2LXJ A;  4PG3 A;  4P72 A;  3CC2 A;  4LF9 L;  3S16 H;  4A3M H;  5FJ8 G;  1N36 L;  1U5K A;  2UUC L;  1N33 L;  1BKB A;  5GAH C;  3S1M H;  1YIT A;  2VW9 A;  4QL5 A;  2I5M X;  1K83 H;  3KOJ A;  3PUY A;  4BA1 I;  3AFP A;  4DNI A;  2VQE Q;  1PH3 A;  2B63 G;  2VL6 A;  3CQZ H;  1PV4 A;  4GS3 A;  2Q2I A;  5DLQ E;  1LM0 A;  3TEH B;  1Q7Y C;  1J5E Q;  4BXX H;  2VQF L;  4GLV B;  4HJ9 A;  1V9P A;  4IPG A;  1A63 A;  4GN5 A;  1KAW A;  2UXC Q;  1S40 A;  1B7Y B;  4A3K G;  3EIV A;  1J5E L;  3A5Z B;  2CWP A;  2HQL A;  4C3H H;  4IFD G;  1K0R A;  3JAM c;  2K5H A;  4NXM L;  1YBY A;  3A0J A;  2UXC L;  3T1Y Q;  1X3F A;  3KDF A;  4Y7N H;  2K14 A;  3CCS A;  2K50 A;  2ZTC A;  2MO0 A;  4JG2 A;  1QZG A;  4LW1 A;  1I5F A;  2OTJ A;  2NVT H;  4GN4 B;  4GOP C;  4J15 A;  2C35 B;  4DR3 Q;  1A0I A;  5LMN Q;  3A5U A;  3HOW G;  1ASY A;  4QGU A;  2CKZ B;  1XMQ Q;  3G6E A;  3S2D H;  4IJL A;  5IYD G;  1JJC B;  3RZO H;  2JA7 H;  1XJV A;  3I56 A;  3HOX G;  3HOZ H;  4A3G G;  2I5L X;  3H0G G;  2K75 A;  1YNX A;  1Q1B A;  2K5N A;  4A3C H;  1NTG A;  2ZTE A;  1XMQ L;  2N78 A;  2ID0 A;  4OWT B;  4DR6 Q;  3CW2 C;  4DUZ L;  1SRO A;  2JA6 H;  5JJL A;  2ZJP A;  2YYZ A;  2PQA B;  1IBL Q;  2UUB L;  5C4X G;  1U0L A;  1X65 A;  2YTV A;  3CC7 A;  4P73 A;  4DV4 Q;  2YU9 H;  4TQU S;  4EQ5 A;  4DR6 L;  1HJP A;  1SMX A;  3H15 A;  4LF6 Q;  3NEN A;  1XPR A;  3TRZ A;  1IBL L;  1H95 A;  2PMZ E;  1XPU A;  1Z9F A;  1Q81 C;  1HR0 Q;  4JI1 Q;  1OXT A;  2KBN A;  2RF4 A;  3TS2 A;  3GO5 A;  1QUQ A;  3E9I A;  4ALP A;  5IP9 H;  1I50 H;  1EUJ A;  1VQG A;  3STB C;  1EQR A;  4A3M G;  2PNH A;  1GVP A;  3K7A H;  2A19 A;  3S15 H;  1RL2 A;  4L5R C;  4X64 Q;  1X55 A;  5C0X G;  5BR8 Q;  2UUA L;  2HT1 A;  2OQ0 A;  2E5L Q;  3M9B A;  3EN2 A;  4BBS H;  2I5H A;  1EFW A;  1VQI A;  3G48 A;  2WAQ G;  2NN6 G;  3ULJ A;  1EYG A;  4X64 L;  4OWW B;  4O0A A;  4GNX C;  2I0Q A;  3KLW A;  5IYB H;  1IL2 A;  3ICE A;  1KC8 C;  1CSP A;  1WJJ A;  2GN5 A;  2KEN A;  1B70 B;  2R7D A;  3KJO A;  3UDG A;  4IPH A;  3AQQ A;  4R4O A;  3CPW A;  4NXN Q;  1S3O A;  3M7N A;  3M85 A;  1WCM H;  5IWA Q;  1Y1W H;  1TWC H;  3KDF B;  3UDF A;  2KHJ A;  1MJE A;  4EX5 A;  4JYA Q;  3GTQ H;  1KXL A;  4NXN L;  1N34 L;  4B3T Q;  2JJQ A;  4R4Q A;  2NVX H;  1L1O A;  1OTC A;  2VZA A;  5IWA L;  5C3E H;  2IX1 A;  1X6O A;  4JI5 Q;  3M3Y H;  3U50 C;  2YV5 A;  2FXQ A;  4JI8 Q;  5HY6 A;  1VQO A;  5GAG C;  4DV2 Q;  1UWV A;  1AE3 A;  3HOZ G;  2JA7 G;  3D31 A;  4L5S A;  2F4V L;  1JJ2 A;  3CMA A;  2ZJR A;  4A3C G;  4OXP A;  4JI8 L;  1PH7 A;  3RZD H;  5JJI A;  4IPC A;  1E1O A;  4LFA Q;  4B3R Q;  3T1H Q;  4PMW A;  2VS1 A;  4A3D G;  1I6H H;  3BU2 A;  4KHP L;  3SGI A;  2JA6 G;  4GLA C;  3HKZ E;  2RHS B;  2PI2 E;  3AFQ A;  4GKJ Q;  3M4O H;  1WI5 A;  1FL0 A;  3I4N H;  2JK8 A;  2KHI A;  4B3R L;  3PV0 A;  3T1H L;  1MKH A;  3FHW A;  4GKJ L;  4JI3 Q;  3HOY H;  3F2B A;  1QUQ B;  1VCI A;  2A8V A;  1G6P A;  2PQA A;  4IPD A;  5IP9 G;  1YHQ A;  2N8N A;  5C4J H;  4A3J H;  1PA6 A;  2ES2 A;  1L2F A;  1IBM Q;  1IZ6 A;  4LUZ A;  3HKS A;  4KHZ A;  1K9M C;  1YVC A;  3H3V H;  4QQB X;  4A93 H;  3CCL A;  4A3E H;  2NVQ H;  2BH2 A;  4JV5 Q;  4UPA A;  3LGJ A;  2K4K A;  3S17 H;  2Y0S E;  4LFB Q;  5IYB G;  1I94 Q;  5ELO A;  2YTY A;  3NEM A;  3ULP A;  4POG A;  1HZB A;  4JV5 L;  1TXY A;  4X62 Q;  4P71 A;  2CWA A;  4WJ3 M;  4A3I H;  1G29 1;  5E7N A;  2Q2H A;  1OXS C;  1E24 A;  2ATW A;  1KRS A;  1NY4 A;  2K52 A;  1WCM G;  3I4M H;  1RIP A;  1SR3 A;  4R1J A;  4AH6 A;  3KJP A;  4DR2 Q;  1LYL A;  1N8R C;  2VQE L;  5M3F H;  2JA8 H;  1L1O B;  1Y14 B;  2JA8 G;  3L2P A;  5C3E G;  5LMN W;  4DR2 L;  1PHJ A;  4DR1 Q;  4B3M Q;  5HGQ A;  1PH6 A;  1UE5 A;  4MNO A;  4DR1 L;  1KRT A;  4B3M L;  5GAD C;  1SN8 A;  3U58 A;  3K8A A;  4X6A H;  1IBK Q;  1SFO H;  2D0P A;  2YTX A;  3T1Y L;  1J6Q A;  2NZH A;  1PVO A;  3RLF A;  3TQY A;  3K80 C;  4X66 Q;  1QZH A;  1Q86 C;  2ASB A;  3K81 C;  4APV A;  3GTJ H;  4JI2 Q;  3CAM A;  3GTP H;  4LF5 Q;  2HIV A;  1UE1 A;  3I4N G;  4A3F H;  4LF7 Q;  2JEA I;  4DR3 L;  5EAY A;  5LMN L;  3ULL A;  3F2D A;  1VQL A;  5C44 H;  3TS0 A;  4JI2 L;  1PH4 A;  2ZTD A;  3CCV A;  3S24 A;  3GD7 A;  1SE8 A;  3HOY G;  4R4C A;  4LF7 L;  4DV6 Q;  1GD7 A;  4DV0 Q;  1YJ9 A;  5JEA J;  1JB7 A;  4A3J G;  4IOC A;  1PH5 A;  3FP9 A;  2JA5 H;  4DV6 L;  3GTK H;  4A93 G;  1Q8K A;  4A3E G;  1JT8 A;  1PH9 A;  3UDI A;  1HZ9 A;  4DV4 L;  4H02 A;  3L7Z C;  4RMF A;  3U4Z A;  1VQE A;  2R92 H;  4LF6 L;  3FKI H;  4JBJ A;  5FLM H;  4HJA A;  3S1R H;  5JJK A;  3PIO A;  4OO1 I;  2QGQ A;  1TWG H;  2GVA A;  2BH8 A;  1HR0 L;  1CKN A;  4JI1 L;  3PUW A;  3CXC A;  4P74 A;  4A3I G;  5M5Y H;  3PCO B;  4A75 A;  3I4M G;  4HJ5 A;  2K5V A;  1FGU A;  1PH8 A;  4UP7 A;  1YI2 A;  4BXX G;  5M3F G;  1MIU A;  1XTD A;  3DM3 A;  4YCW A;  5BR8 L;  3OW2 A;  2IHF A;  1BVS A;  1PFS A;  4R4T A;  1PH1 A;  2E5L L;  2ZJQ A;  4JI6 Q;  4POF A;  1Q1E A;  4IJH A;  1VQD A;  1K73 C;  2R93 H;  4UP9 A;  3BJU A;  5IT9 c;  3CPF A;  4DV3 Q;  4JI6 L;  3Q8D A;  3HOV H;  1NE3 A;  1C7Y A;  3BZC A;  4IFD J;  2QEX A;  3E9H A;  3L0O A;  2A1A A;  3NEL A;  5GAE C;  4YHH Q;  3B6Y A;  2AMC B;  1W2B A;  4JOI C;  4AYB E;  4QY7 A;  2IX0 A;  3CCJ A;  3J81 j;  1VQ9 A;  3CD6 A;  4DUY Q;  4A4I A;  4B3S Q;  2MFI A;  1KD1 C;  1C9O A;  4YHH L;  3RLO A;  2Z6K C;  4JYA L;  1JJG A;  1OXU A;  3CF5 A;  4B3T L;  4DR7 Q;  1E3P A;  1NMF A;  4LNQ A;  4JI5 L;  2EXD A;  1YJN A;  5FJ8 H;  2RHQ B;  4BY1 H;  4B3S L;  2ZM6 Q;  1O7I A;  3HKZ G;  3RN2 A;  2N49 A;  3RR5 A;  2MNA A;  4R4I A;  4DV1 Q;  4IFD I;  2OQK A;  3PF5 A;  4DV2 L;  4LUV A;  3F1Z A;  4DAM A;  2DUD A;  1K8G A;  2XGT A;  3F8T A;  4LUO A;  4LFA L;  2UU9 Q;  4JBK A;  2JA5 G;  2WB1 E;  1VQ8 A;  4DAY B;  3TRE A;  2QA4 A;  1VQF A;  1Y1V H;  4HIK A;  1X9N A;  2CQO A;  2BA1 A;  4HID A;  4DR5 Q;  1YJW A;  1QVC A;  1VQM A;  2R92 G;  3HOU H;  3FKI G;  1UE7 A;  3W1B A;  4YCV A;  1A8V A;  1W3S A;  5FLM G;  2UU9 L;  4BA2 I;  4JI0 Q;  1CKN B;  4PZ7 A;  2RCN A;  4JI3 L;  2Y0S G;  1KHI A;  2IHE A;  4DV5 Q;  1E1T A;  4DR5 L;  3GTO H;  2D0O A;  4UY8 C;  5M3M H;  2V1C C;  1L0W A;  1YEZ A;  3KF6 A;  3PUV A;  2B29 A;  2CFM A;  3GTG H;  3OTO Q;  4BBS G;  2F3I A;  4WJ4 A;  1Q46 A;  1Z47 A;  1IBM L;  4GNX A;  3ZJY C;  2EIF A;  3DLL A;  2HHH Q;  4A3B G;  3HOX H;  1WYD A;  1YZ6 A;  1T9H A;  4ME3 A;  1TWH H;  4GKK Q;  3CP0 A;  3J81 i;  1YHA A;  4LFB L;  1E7Z A;  2R93 G;  4OX9 Q;  1P8L A;  3CME A;  5JEA G;  1I94 L;  1XNQ Q;  3HOV G;  1VQH A;  1Y1W G;  3PO3 H;  2JA9 A;  4X62 L;  3ER0 A;  5LMU Q;  3JAM i;  3CCR A;  3UDX A;  1ASZ A;  3KF8 B;  5C0X I;  3PF4 A;  4OX9 L;  5K36 G;  4LF9 Q;  4GOP B;  1VQ7 A;  1N36 Q;  1EOV A;  3PUX A;  3STB D;  1N33 Q;  4BBR H;  4DK6 C;  5LMU L;  2IY5 B;  1CUK A;  2NN6 I;  1WOC A;  1PH2 A;  5AJ3 Q;  1Q12 A;  3A74 A;  3VDY A;  3S2H H;  1K8A C;  4BY1 G;  1JE5 A;  3W5O A;  1XMO Q;  1SRU A;  3GDE A;  5IY0 A;  2MQH A;  4JCV E;  2VQF Q;  3PUZ A;  3J7A 5;  1TWA H;  5AJ3 L;  4HIO A;  1S72 A;  3PO2 H;  1AE2 A;  2D62 A;  2KCM A;  4AIM A;  1JMC A;  2VUM H;  1XMO L;  1IBK L;  1QVF A;  3J81 c;  1VQB A; 
#chains in the Genus database with same CATH topology
 2NB0 A;  4X66 L;  2CCZ A;  1GUW A;  1VF7 A;  2FJ2 A;  1P16 A;  2LKV A;  4Y52 H;  2AWO A;  3LWU A;  2DY8 A;  4OEM B;  5IYC H;  1L1O C;  3M4Y A;  1STN A;  3DWP A;  3NXW A;  4AQY L;  1JE4 A;  5KRU A;  4DV0 L;  4XIG S;  3D8G A;  4DK1 A;  4EVO A;  3NSW A;  2EOT A;  1SNM A;  4GNX B;  2HIX A;  1I4P A;  1QCB D;  2LS0 1;  1KQS A;  3MEF A;  1IXR A;  4A3D H;  4ZKB B;  3PIO 3;  1A62 A;  1CKO A;  3PO3 G;  3K7A B;  2CQA A;  1MJC A;  4YWL A;  1PYB A;  3BYY B;  1LTT D;  1IW7 D;  1PYS B;  4BBR G;  3M4P A;  3GTL H;  1EL0 A;  2UUA Q;  5J39 A;  1TKW B;  4NB3 A;  3E0E A;  4KD3 A;  1QB5 D;  3DWA A;  3G71 A;  4DV3 L;  4DKA C;  2OWO A;  3PO2 G;  4YY3 Q;  4X65 Q;  5CR3 A;  3EJI A;  1FJG Q;  1XNR L;  2M2L A;  3QB3 A;  1SBB B;  3WOE A;  1A3T A;  2BA0 A;  4DUY L;  1C8C A;  4DR7 L;  5C44 G;  2WKC A;  1TII D;  2JEB I;  2ZM6 L;  1CKM A;  3J80 i;  3AU7 A;  1KL9 A;  4HMJ A;  2ALY B;  2AKW B;  4CJ2 C;  3F2C A;  5IYC G;  1ROD A;  4N8F A;  4A3K H;  5M5X H;  3HFZ B;  3AEV A;  4XQQ A;  4XTC S;  3T13 A;  5IOD A;  4ZUJ A;  4KN7 C;  4BS9 A;  4ODG A;  5IT9 E;  3I4N B;  4CKB A;  2B2U A;  3IFT A;  3AYH B;  4OON A;  2Q2T A;  3CC4 A;  1F9S A;  1Q8I A;  4UP8 A;  3KYH C;  4RAU C;  3J7A V;  1BNZ A;  3HOW H;  4ZQ3 A;  1HNZ Q;  1S5B D;  4JI4 L;  1H9R A;  1TS4 A;  5CV4 A;  2UXB Q;  4L5Q A;  4X3K A;  3C1F A;  1CK1 A;  4JI7 L;  4A93 B;  4PZ6 A;  1EYA A;  3H0G H;  3A56 A;  5BN3 A;  3OTO L;  1WTQ A;  1YHB A;  1X56 A;  5CBE E;  4LF4 Q;  1ET9 A;  4LFC Q;  1R4Q B;  4HMI A;  1LTB D;  1VQJ A;  1QWY A;  1K0S A;  1SYF A;  5FO9 B;  3QR8 A;  2X6L A;  1N32 L;  2UUC Q;  1SLJ A;  5CV6 A;  5IOC A;  1N36 L;  4RCN A;  1U5K A;  2F0N A;  4UAI A;  2IX3 A;  1N33 L;  1YIT A;  2VW9 A;  5A2Q E;  5IGC A;  1K83 H;  1Y8N B;  3CQZ H;  2Z4I A;  1PV4 A;  1Q7Y C;  2Q2I A;  3TEH B;  4HJ9 A;  1A63 A;  1X3P A;  5C3X A;  1B7Y B;  3D3R A;  4A3K G;  3P7J A;  1S5F D;  5JVH 3;  2CWP A;  2QEJ C;  2E74 C;  1CQV A;  1ENF A;  2HQL A;  5KYI A;  3OWE B;  3ERQ A;  1K0R A;  2NTT A;  3JAM c;  1A2T A;  4ZUI A;  2I46 A;  2B2W A;  2K50 A;  2ZTC A;  5C44 B;  3HRZ C;  1I5F A;  2OTJ A;  3HOW G;  4DR3 Q;  1A0I A;  3A5U A;  1F9R A;  1CFM A;  1Q90 A;  4FF4 A;  5JAV A;  3RZO H;  2JA7 H;  3HOZ H;  3H0G G;  3K5N A;  2N78 A;  4DR6 Q;  4KHV A;  4DUZ L;  5JJL A;  3V2T A;  2IW3 A;  1GUG A;  1U0L A;  2YTV A;  3CC7 A;  4P73 A;  4DV4 Q;  3H94 A;  2A5H A;  1Z9F A;  5L37 A;  1HR0 Q;  2G5D A;  5FLX E;  1B50 A;  1QUQ A;  3BDC A;  5E4X A;  5KYL A;  1EUJ A;  3ONA B;  2A19 A;  3TP6 A;  1RL2 A;  2IL8 A;  2R3Z A;  3GTL B;  3S15 H;  2E5L Q;  1JOO A;  4BBS H;  4L63 B;  5JJZ A;  2XNA C;  4X64 L;  2TMP A;  1GUO A;  5IYB H;  2K1B A;  3ICE A;  4WFN 3;  3UDG A;  4R4O A;  5IWA Q;  3KDF B;  3C2P A;  1MJE A;  1ZEQ X;  4ILW A;  3GTQ H;  4NXN L;  2IX1 A;  5C3E H;  3BDL A;  1EYC A;  1SYB A;  3U50 C;  1HXY D;  3O13 A;  1V8Q A;  5GAG C;  2OEO A;  4G4K A;  3HOZ G;  2JA7 G;  2KA7 A;  1Y1V B;  4L5S A;  1PLF A;  2ICI A;  3Q22 A;  1GUS A;  4UDU C;  4JI8 L;  4LFA Q;  3T1H Q;  2WV6 D;  1G8Z D;  1Y69 U;  4GKJ Q;  2JK8 A;  5M3M B;  3V05 A;  1XTC D;  1S5E D;  3MHB A;  4XT3 B;  5AFW A;  3U9S A;  2RDH A;  1JOK A;  3F2B A;  3BYT B;  1F9Q A;  2PQA A;  1YHQ A;  4A3J H;  2F0S A;  1PA6 A;  1L2F A;  4KHZ A;  2NVQ H;  1RDP D;  4JV5 Q;  4UPA A;  2K05 A;  5DEH A;  5BN5 A;  3S17 H;  1RTO A;  5IYB G;  1I94 Q;  2YTY A;  4WJ3 M;  1I4R A;  1KDA A;  4AYB B;  4A3I H;  1NAP A;  1OXS C;  3S2H B;  1E24 A;  2EJM A;  2F1M A;  1KRS A;  1SR3 A;  4AH6 A;  4DR2 Q;  1K83 B;  2VQE L;  2JA8 H;  1L1O B;  1UNS A;  3CQZ B;  3NTI A;  3I91 A;  5LMN W;  5C3E G;  3UI2 A;  4C1N I;  3VYT A;  4R8I A;  5HGQ A;  1AP0 A;  4TRD A;  1PH6 A;  1IKM A;  1UE5 A;  3S1N B;  4HAE A;  3G6J B;  3MFY A;  4NMZ A;  2BCO A;  4B3M L;  2D5D A;  2PCF B;  5GAD C;  5EPJ A;  2B2V A;  2R61 A;  1WD1 A;  1HUN A;  2YTX A;  4XQN A;  2NZH A;  1PVO A;  3RLF A;  3TQY A;  3KUP A;  3GTJ H;  1I6V C;  1UE1 A;  2NVY B;  1B1Z A;  3HGB A;  2JEA I;  1VQL A;  3TS0 A;  4JI2 L;  3CCV A;  3S24 A;  2EYF A;  3FEW X;  3RZO B;  2JA7 B;  1F9P A;  4WJW A;  2BOS A;  4A3J G;  4IOC A;  3FP9 A;  1LTI D;  1MGS A;  1JOR A;  5FO8 B;  4MIU A;  5I9O A;  5C3W A;  3UDI A;  4KMU C;  2QDB A;  1EY0 A;  1YNJ D;  1VQE A;  5I6W A;  4LF6 L;  3FKI H;  4JBJ A;  5FLM H;  3S1R H;  2D9U A;  2QGQ A;  5KND A;  2BH8 A;  3VYR A;  1CKN A;  1DJR D;  4KD4 A;  4A3I G;  2R7Z B;  4A75 A;  4XYQ A;  1M8A A;  2K5V A;  4CBV A;  4M1U B;  4ME5 A;  1PH8 A;  3S15 B;  3EFX D;  1DON A;  3SEB A;  1BCP F;  1YI2 A;  2JA8 G;  4A3B H;  1PH1 A;  3OW2 A;  4R4T A;  1PFS A;  2OT2 A;  3GV6 A;  1AN8 A;  1Q1E A;  1XYI A;  3BJU A;  4NKL A;  1JIC A;  1LT6 D;  3E9H A;  3L0O A;  3NEL A;  4YHH Q;  1SXT A;  1W2B A;  3KF8 A;  1PFB A;  2Z6B A;  2Q8T A;  1XX8 A;  4RGN A;  3J81 j;  3CD6 A;  3P20 A;  4C3J B;  4JYA L;  1JJG A;  2Z6K C;  1OXU A;  5C3E B;  1NMF A;  3K59 A;  3SK5 A;  2EXD A;  1YJN A;  4B3S L;  1O7I A;  3HKZ G;  3FPP A;  5T1G A;  3PF5 A;  4XDX A;  1I4X A;  4DAM A;  2ENB A;  1J8I A;  3F8T A;  3GV3 A;  1SJH D;  1YNN C;  2E75 C;  1D5Z C;  1VQ8 A;  2V4D A;  1EYD A;  2CQO A;  3TZU A;  4HID A;  1CI3 M;  1QVC A;  1STH A;  3RMH A;  3A54 A;  1J9O A;  3VA7 A;  3FKI G;  1UE7 A;  3HP3 A;  5FLM G;  2UU9 L;  2B2V C;  4JI0 Q;  4JI3 L;  2Y0S G;  1KHI A;  1HA6 A;  1EEF D;  2D0O A;  5EQ0 A;  1H9S A;  4UY8 C;  1YEZ A;  3KF6 A;  3V96 A;  3NE5 B;  2F3I A;  1TY0 A;  1U4M A;  5LL6 S;  5NUC A;  1IBM L;  4Q5V A;  4A3B G;  5EKI A;  1B9M A;  5I2Y A;  1T9H A;  4GKK Q;  2JN4 A;  3S9W A;  4OX9 Q;  3R2I A;  3S16 B;  1STE A;  1Y1W G;  2JA9 A;  5KGU A;  1ASZ A;  3PF4 A;  1D1I A;  3CRK C;  2MUY A;  2HDL A;  1D6E C;  2Z9H A;  3GQB A;  2VXW A;  2F03 A;  4DK6 C;  2IY5 B;  4JW0 A;  5J1Z A;  3VDY A;  1SE4 A;  5I2X A;  2BE5 C;  5K5P A;  3HG9 A;  3NTH A;  1XMO Q;  2EXZ A;  3A8J E;  5IY0 A;  2VQF Q;  3J7A 5;  1K8M A;  4MTK A;  4RGO S;  4OIJ A;  2D62 A;  1PYW D;  2XN9 C;  4Y7N B;  2VUM H;  1T5X D;  1UEA B;  2NVT B;  1TWF H;  1OO9 B;  1D8L A;  4NXM Q;  1V1Q A;  2EYP A;  1TU2 B;  3JAM L;  1DYQ A;  1I3Q H;  2K04 A;  3OYY A;  4V0B A;  1BXT A;  1MSG A;  2D2C C;  5GRO A;  2PW5 A;  3BVZ A;  3MXN A;  4K6D A;  4PZ8 A;  2ZXO A;  4QIW E;  2F0J A;  2RA4 A;  1BBU A;  4C3I H;  2QKI C;  3A7A B;  3RN5 A;  2FMC A;  1X54 A;  3JC6 6;  3OIQ A;  2RKS A;  3C3L A;  2XVS A;  1D7Q A;  1B53 A;  3I4O A;  3R8B A;  1CA5 A;  1VQC A;  3UE1 A;  2Y0S B;  4MZ9 A;  4OEL B;  2F0G A;  4OWX B;  1SMY D;  3U9O A;  4B08 A;  1QG7 A;  3S14 H;  4OO1 H;  5FO7 B;  1VQP A;  2EJG C;  3MXG A;  1VQK A;  3RLN A;  4A3B B;  2EY5 A;  1E22 A;  2WP8 J;  1OXX K;  3AB9 A;  1R4P B;  1HZA A;  1NSN S;  1GO3 E;  1Y1W B;  4B9X A;  5E3F A;  5D14 A;  1Y8O B;  2EYM A;  2AHO B;  2NZO A;  2VUM G;  1EU4 A;  4HSV A;  1ONL A;  1TR5 A;  1EQQ A;  1QVG A;  1GM5 A;  1VQ4 A;  4C56 C;  2E2H H;  1VQ6 A;  2K7V A;  1D1K A;  2WFW A;  4XXE A;  4YY3 L;  2C5C A;  2WKD A;  4X65 L;  2WAQ E;  5DAU A;  1FJG L;  2R6G A;  2F0I A;  2WB1 G;  1E0B A;  1DOK A;  1NJI C;  3ERS X;  2UXD Q;  3URY A;  2FIN B;  2R7F A;  4NDX A;  3RZD B;  1X3E A;  2DNC A;  2XWJ B;  5LHY 1;  4GLX A;  1O80 A;  3M4O B;  2VNU D;  1HZC A;  2LSS A;  3TDQ A;  4C3I G;  1KAA A;  1TS3 A;  4KHP Q;  4DR4 Q;  2WAC A;  2KCT A;  1R9T H;  1HNW Q;  1HNX Q;  1LTL A;  1YNJ C;  4HN7 A;  3HOY B;  2PMZ B;  4TVA B;  2RCF A;  4K2K A;  3FPU B;  1D2B A;  1VQA A;  3NBH B;  2VY3 A;  2H4O A;  4OO1 G;  1HNZ L;  1KAB A;  2UXB L;  3J80 c;  1QJO A;  3GTM H;  4RHS A;  2HHH L;  1M4V A;  4P75 A;  4MHE A;  4L8J A;  1ICF B;  2PNR C;  4H0L C;  1O7L A;  4LF4 L;  1XNQ L;  1IYJ B;  3E3X A;  1UE6 A;  4LFC L;  1WVL A;  5M3F B;  1V43 A;  5TSS A;  3PMF A;  3ERO A;  3PSI A;  2G9H D;  2IPK D;  5CV5 A;  2PZU A;  4FNF A;  4J1M A;  4LF9 L;  5FJ8 G;  3PIP 3;  2UUC L;  3E6Z X;  5GAH C;  3AFP A;  4DNI A;  1ESR A;  2DN8 A;  5HGT A;  4GS3 A;  1LM0 A;  4K6L A;  4BWG B;  2NTS A;  4GLV B;  3H3V C;  4GN5 A;  1KAW A;  1SYG A;  3EIV A;  2WII B;  3ZYY X;  2NBF A;  3T51 B;  3GTP B;  2A69 C;  4C3H H;  4F88 A;  5F2D A;  1YBY A;  2I07 B;  2F0F A;  2K14 A;  2F0P A;  4QB4 A;  4XQJ A;  4GN4 B;  4J15 A;  1D5M C;  2KHS A;  1WTW A;  1XMQ Q;  1AZP A;  2JA5 B;  4IJL A;  3R93 A;  1LT3 D;  2L0C A;  3GP7 A;  1V1P B;  4A3C H;  1YNX A;  1EZ8 A;  4IUV A;  1NTG A;  2R92 B;  4H13 C;  2ID0 A;  3CW2 C;  4KJO A;  4RH6 A;  2JA6 H;  1CT1 D;  1IBL Q;  2UUB L;  2PQA B;  3J81 E;  1CQF A;  1XWE A;  2RSO A;  4XYO A;  1Y8P B;  4TQU S;  4EQ5 A;  4RFB A;  4DR6 L;  3NWT A;  1H95 A;  2J4X A;  3JAM E;  3S14 B;  2RF4 A;  3KK7 A;  1CM9 A;  3GO5 A;  3IL8 A;  4ALP A;  2HUG A;  4DNR B;  2DY7 A;  4DXF A;  5IP9 H;  1GVP A;  1EEI D;  1X55 A;  1H9K A;  2EYO A;  3VYU A;  2OQ0 A;  1PTO C;  4O0A A;  3KLW A;  1BO0 A;  1KC8 C;  1B70 B;  1BUV T;  3KJO A;  1K8O A;  4IPH A;  2HCC A;  3MC0 B;  1LAB A;  4C3H G;  1RKN A;  1TWC H;  4BY1 B;  4O1N A;  2L9H A;  1N34 L;  2NVX H;  5IWA L;  4JI5 Q;  3H6M A;  3VA5 A;  3M3Y H;  2NWG A;  2FXQ A;  1STA A;  1VQO A;  4DV2 Q;  4Q0F A;  3SE0 A;  4EQN A;  2F4V L;  2F0E A;  3CMA A;  4A3C G;  4ZRZ A;  2QF7 A;  4OXP A;  2ZXP A;  5EBC A;  2LMC B;  4B3R Q;  4FXK C;  4PMW A;  4A3D G;  1I6H H;  5FOB B;  2RDG A;  3SVM A;  2JA6 G;  2HDM A;  2K6A A;  3MWY W;  2RHS B;  4FO2 A;  2PI2 E;  3AFQ A;  4GLA C;  1R9T B;  3T1H L;  5KEE A;  1MKH A;  2XIW A;  3FHW A;  4GKJ L;  2QW7 A;  1SMY C;  3QJY A;  1QNU A;  2A8V A;  1G6P A;  1TWH B;  4IPD A;  5IP9 G;  2N8N A;  2BDO A;  5C4J H;  1WTP A;  3HKS A;  1U9R A;  1K9M C;  3PO3 B;  3H3V H;  3CCL A;  4A3E H;  2K4K A;  4LFB Q;  1DM0 B;  5EGT A;  3ULP A;  1EY8 A;  3K6O A;  4JV5 L;  4BBR B;  1TXY A;  4X62 Q;  2CWA A;  5E7N A;  2Q2H A;  1F2L A;  3I4M H;  3Q23 A;  4R1J A;  3EA6 A;  1SYD A;  3I70 A;  3OIP A;  2K28 A;  1Y14 B;  5EBD A;  3PO2 B;  4DR2 L;  2KED A;  4KTA A;  2F0L A;  1G2T A;  2O5I C;  3H09 A;  4FF1 A;  4Z9C B;  1KRT A;  3MVV A;  4X6A H;  3MXU A;  1IBK Q;  4K5X A;  3CU7 A;  3T1Y L;  1J6Q A;  3TP5 A;  4X66 Q;  1QZH A;  3LNN A;  1MBY A;  1JOQ A;  4H44 C;  4I65 A;  4A3F H;  4DAP A;  5EAY A;  5LMN L;  3ULL A;  3F2D A;  1SYE A;  2O4X A;  1ENC A;  4X3T A;  2ZTD A;  1YNN D;  4R4C A;  1HA5 A;  4DV6 Q;  1GD7 A;  4DV0 Q;  1AW7 A;  1YJ9 A;  1JB7 A;  4A3D B;  1PTO H;  3GTK H;  1JT8 A;  4A3E G;  1PZJ D;  4N9P A;  4DAY A;  2EVB A;  2B2U C;  4HED A;  4RCO A;  5ELF A;  2A6E D;  3QIA A;  1JWS D;  4OO1 I;  3EQL C;  1TWG H;  2GVA A;  4IQZ A;  4JI1 L;  3PUW A;  4P74 A;  5HUR A;  1EY5 A;  5M5Y H;  4K8J A;  2EYL A;  1GJX A;  3SK6 A;  3I4M G;  2AUJ D;  1FGU A;  3VR4 A;  1SNO A;  5BR8 L;  4YCW A;  2OXP A;  4JI6 Q;  1BVS A;  1AFP A;  4LAA A;  1G91 A;  2F4I A;  3NBI A;  2R93 H;  4UP9 A;  1RHP A;  5CYU A;  5IT9 c;  3CPF A;  4DV3 Q;  3HOV H;  3Q8D A;  1NE3 A;  4IFD J;  2QEX A;  1I4Q A;  4DA2 A;  5GAE C;  3B6Y A;  2AMC B;  4B9W A;  4AYB E;  5KIX A;  1CZW A;  2BE5 D;  1VQ9 A;  4DUY Q;  2MPM A;  2MFI A;  4YHH L;  3X3M A;  1NCV A;  4B3T L;  4DR7 Q;  5ELB A;  1E3P A;  4A3K B;  5M5X B;  2EDG A;  3OOC A;  2ZM6 Q;  3RN2 A;  5IIF A;  2KVM A;  2N49 A;  2KUM A;  2OQK A;  4L6T B;  4CJ0 B;  1MD2 D;  2DUD A;  4XT1 B;  3NWS A;  1ILQ A;  2L12 A;  2XGT A;  4LUO A;  3A7L A;  3HOW B;  2XRS D;  4JBK A;  1FD7 D;  1VQF A;  4KK7 A;  2AQ1 B;  3ND8 A;  5EKK A;  3IKJ A;  4DR5 Q;  3C1E A;  1YJW A;  1VQM A;  3HOU H;  1HFN A;  3H0G B;  4OL7 A;  4YCV A;  2B2W C;  4PZ7 A;  3WOF A;  3GTO H;  2A6H C;  2EZV A;  2CFM A;  3GTG H;  3OTO Q;  4BBS G;  5C4J B;  3NQI A;  2L5T A;  3TP8 A;  4GNX A;  2EIF A;  3D6W A;  2FHT A;  3HOX H;  4A3E B;  3D4D A;  5CBA E;  1KLG D;  1RF2 D;  2PZW A;  3BZD B;  4HCE A;  3W2D A;  3J80 L;  3J81 i;  2R93 G;  1K28 A;  3MA2 B;  3HOV G;  5CMD A;  1W6K A;  1ZXT A;  2L4N A;  5CV8 A;  3A55 A;  3ER0 A;  3JAM i;  4OX9 L;  1D5X C;  2KOL A;  1B3A A;  1N36 Q;  1N33 Q;  2F0Q A;  1XXG A;  1Q12 A;  3A74 A;  1AEX A;  1LT4 D;  4YIJ A;  1JE5 A;  1VMC A;  3GDE A;  1B2T A;  3VR5 A;  3DWQ A;  1TWA H;  3LX0 A;  4HIO A;  1QOH A;  1S72 A;  2KEC A;  1JMC A;  1XMO L;  4YWK A;  1SYC A;  2PYK A;  4LF8 Q;  4NPS A;  1TY2 A;  3IRB A;  5IE8 A;  1F2M A;  1TQO A;  2RQX A;  4DV7 Q;  5CC4 A;  2JYO A;  4LF5 L;  5FLX c;  3HOZ B;  1BCP C;  2L11 A;  2MGS A;  3I7F A;  1FVI A;  3HOU G;  4L5T A;  3S1Q H;  1JWU D;  3SHL A;  1NR2 A;  4YWM A;  3NTK A;  3UE0 A;  4O2D A;  1WTH A;  1FYC A;  1M90 C;  5IP7 H;  1PTO B;  3WDN A;  3GTK B;  4DUZ Q;  4JK1 C;  1VS0 A;  3Q0A A;  3DHQ A;  2IWH A;  1KNE A;  1U4P A;  1FR3 A;  1HQR D;  2IT1 A;  3ITP A;  5D65 A;  1EFI D;  4CGY B;  5M5W H;  4MTN A;  4BBS B;  3I90 A;  5KNC A;  1DXM A;  1QIL A;  2OCE A;  2E2J H;  5GQO A;  4RGT A;  4A76 A;  4HTH A;  4K0K Q;  4KI0 A;  2L15 A;  1LTR D;  2P5Z X;  2JE6 I;  2PZT A;  2M00 A;  2JQO A;  3E5S A;  1S5D D;  4GOP A;  5COR A;  3GTQ B;  1EIY B;  3TBI B;  1BBW A;  2E8G A;  2HQE A;  4M8A A;  2B63 H;  1EWI A;  2AQ2 B;  5JOB A;  1YIJ A;  1Q82 C;  5DM6 3;  1O7Y A;  1WFQ A;  1II3 A;  5H1S E;  4IO9 A;  2A69 D;  1UAP A;  2OF1 A;  4DV1 L;  2J7Z A;  2B2T A;  2UXD L;  2AWN A;  3M4Q A;  1DGS A;  3H91 A;  5IP7 G;  4RHR A;  1G51 A;  2H5X A;  2PI2 A;  1N9W A;  1EWH A;  1BDO A;  2F3V A;  3CCM A;  3RNU A;  4NW2 A;  1G2S A;  1X3G A;  4OHJ A;  3QWN A;  2A6E C;  1GKH A;  2DGY A;  2N88 A;  4U67 3;  2TSS A;  5C0X J;  2OTL A;  4DR4 L;  4A3J B;  2RDF A;  3WWV A;  1HNW L;  4DV5 L;  1HNX L;  1EU3 A;  3EBE A;  4PQX A;  2NVQ B;  3N6R A;  3H3V I;  3S17 B;  2SNM A;  5IGE A;  5I6Y A;  2EY1 A;  1NMG A;  4IUT A;  4A3I B;  4LK1 C;  4QJF A;  1JR0 D;  4P2C B;  1SDF A;  4QF4 A;  4JOI A;  2JA8 B;  3MTS A;  3PIP A;  4KY7 A;  4X3U A;  1V1O A;  5J3B A;  1MSH A;  4P72 A;  4RWS C;  4A3M H;  5ISR A;  4IUP A;  1BKB A;  1PTO D;  2I5M X;  2PW7 A;  3KOJ A;  3PUY A;  5C0X H;  2VQE Q;  2B63 G;  2VL6 A;  4DNT B;  4WRD A;  5DLQ E;  1J5E Q;  4TKO B;  4BXX H;  2LY7 A;  1V9P A;  1E2V A;  2UXC Q;  3R3O A;  2WIN B;  3P75 A;  3A5Z B;  3GTJ B;  3A0J A;  3HKZ B;  1X3F A;  3KDF A;  5CV9 A;  3SDZ A;  2MO0 A;  1QZG A;  4LW1 A;  3LWE A;  4GOP C;  4KY6 A;  4QGU A;  2K5W A;  4FP5 D;  1FGB D;  1FNU A;  3G6E A;  3S2D H;  4KY5 A;  1XJV A;  3I56 A;  2I5L X;  3OPO A;  1XMQ L;  3FKI B;  3S1R B;  1B44 D;  2YYZ A;  5DNF A;  1X65 A;  1GHJ A;  5D3I B;  4CKC A;  2F0T A;  1SMX A;  4LF6 Q;  1XPR A;  3TRZ A;  1IBL L;  2PMZ E;  1XPU A;  1PZI D;  2KBN A;  1A6X A;  4QMG A;  1I50 H;  4A3M G;  3K7A H;  4L5R C;  5C0X G;  2UUA L;  2DJF C;  5COY A;  5JPM C;  3M9B A;  3EN2 A;  3KLR A;  1VQI A;  3G48 A;  2WAQ G;  4OWW B;  1EYG A;  2EY6 A;  3KLS A;  2PQE A;  4H7B A;  1PFM A;  1EQT A;  2MHV A;  2R7D A;  1RTN A;  3AQQ A;  3N52 A;  5IT9 L;  3M7N A;  3I8Z A;  3NUC A;  1PRT C;  2QIL A;  2RBM A;  5E4W C;  3UDF A;  1GUN A;  2XSC A;  4EX5 A;  4JYA Q;  2QCP X;  1BR9 A;  2H1E A;  2JJQ A;  3R2T A;  1L1O A;  1H9M A;  5C4Z A;  4ULL A;  1B3Q A;  4PMB A;  1ZYR D;  2YV5 A;  3T56 B;  1LAC A;  1AE3 A;  2GA4 B;  1JJ2 A;  2ZJR A;  4RGM A;  4IPC A;  1E1O A;  1LTS D;  2VS1 A;  3BU2 A;  1U4L A;  4F7X A;  3P1H A;  3I4N H;  1C48 A;  4B3R L;  3PV0 A;  1JQY D;  3FMC A;  1TS2 A;  3A8K E;  1IHZ A;  1RD9 D;  3D4W A;  4JI3 Q;  2AQ3 B;  5T1I A;  4E6I A;  1QUQ B;  1VCI A;  1E2Z A;  2ES2 A;  1IBM Q;  3BVG A;  4FXD A;  4QQB X;  4A93 H;  4FYD A;  3LGJ A;  1C4Q A;  3W3A A;  3EVQ A;  5ELO A;  1KNA A;  3NEM A;  4POG A;  1HZB A;  1EY9 A;  1KXL A;  4P71 A;  4EQP A;  2X6G A;  4KKU A;  4A3M B;  1DOL A;  1DOM A;  1PZK D;  1LYL A;  1S5C D;  1EIG A;  4DGZ A;  1LTA D;  2Z1C A;  1PHJ A;  2VUM B;  4DR1 Q;  1CHQ D;  1TWF B;  2F0M A;  1JC7 A;  1HRJ A;  1EZ6 A;  3U58 A;  1SN8 A;  3K8A A;  4FXG C;  4FF2 A;  5LL6 X;  1I3Q B;  2J0T D;  2WB1 B;  3DM1 A;  4X3S A;  3SXH A;  3K80 C;  4KKS A;  5C6A A;  1HHV A;  2ASB A;  3K81 C;  3I4N G;  2CW0 C;  4QUF A;  2HIV A;  1WTO A;  4LF7 Q;  4DR3 L;  5C44 H;  1PXU A;  4C3I B;  5FLX L;  3S2D B;  1O7Z A;  1JB3 A;  4EGV A;  4DV6 L;  4A93 G;  4LMQ D;  1A3V A;  4DV4 L;  4H02 A;  4RMF A;  2FMM A;  3U4Z A;  2A6H D;  2K32 A;  1HR0 L;  3DUZ A;  4HCS A;  3CXC A;  3PCO B;  1ML0 D;  2QDL A;  1I50 B;  3CRL C;  5A35 A;  3L3O C;  2C9O A;  3CKI B;  1XTD A;  1CHP D;  5FKA C;  2IHF A;  1BBX C;  2ZJQ A;  2E5L L;  3VYS A;  5G3L D;  4POF A;  1K73 C;  2E2H B;  3I3C A;  1DD2 A;  4JI6 L;  1IYV A;  1HTL D;  3BZC A;  5IGG A;  3FVQ A;  5K36 H;  1WTX A;  1F2Z A;  3CCJ A;  1W6J A;  3NP8 A;  1F77 A;  4A4I A;  1RJT A;  2SEB D;  1ZKO A;  4KJN A;  2F0K A;  4LNQ A;  2RHQ B;  4CJ1 B;  2BDN A;  3D6C A;  2EPB A;  4K8I A;  3TME A;  3RR5 A;  5JPN C;  2MNA A;  4R4I A;  4LUV A;  5IGF A;  3K5L A;  2PPB C;  1SE2 A;  3M7G A;  4LFA L;  1BCP D;  4PNY A;  1STB A;  3K5M A;  5D3D A;  2QA4 A;  1X9N A;  1Y1V H;  1UUP A;  2G9D A;  1CTM A;  1GUT A;  2JP1 A;  3J7Y W;  1QE6 A;  3W1B A;  1PTO F;  1A8V A;  1W3S A;  2DNE A;  4BA2 I;  1IYU A;  3GTM B;  3VR2 A;  1CKN B;  2RCN A;  3E0J A;  2IHE A;  4DR5 L;  5M3M H;  3PUV A;  3QO2 A;  5CGK A;  2DJG C;  3TSS A;  1Z47 A;  2HHH Q;  1WYD A;  1YZ6 A;  4ME3 A;  3CP0 A;  2CH4 W;  2A68 C;  4QUC A;  1VDZ A;  1TT2 A;  4PV1 C;  1P8L A;  3CME A;  1I94 L;  1XNQ Q;  2SOB A;  3KBX A;  3T53 B;  4CKE A;  5LMU Q;  3UDX A;  3KF8 B;  5C0X I;  5K36 G;  4RKL A;  4LF9 Q;  1VF5 C;  4GOP B;  1VQ7 A;  4LJZ C;  3STB D;  3PUX A;  5M9O A;  1CUK A;  1WOC A;  2MJ8 A;  1PH2 A;  5AJ3 Q;  3S2H H;  1K8A C;  3PQI A;  3OW7 A;  3W5O A;  1SRU A;  2SDF A;  1ZYR C;  4JCV E;  4C3H B;  1MHW C;  3PUZ A;  2EYH A;  4IUQ A;  2KCM A;  1KDB A;  3L9A X;  3J81 c;  1O78 A;  1M1K C;  3S1N H;  3CCE A;  5BN4 A;  2XTI A;  1HR0 W;  3J7Z C;  1OXV A;  2F0H A;  3IAY A;  1XPO A;  1KDC A;  1Y1V G;  1S4Z A;  4AQY Q;  4RG1 A;  5IGB A;  2SNS A;  4LF8 L;  2K01 A;  4DV7 L;  4LWC A;  3W1G A;  1H9S B;  1SJE D;  3U4V A;  5M3M G;  2NVY H;  3KF6 B;  2AUK A;  2JA6 B;  2KQ3 A;  2F52 A;  4HJ7 A;  1HQM C;  2KCC A;  1I4G A;  4JC0 A;  4DU9 A;  1BQQ T;  1WTV A;  5EJW A;  2UUB Q;  1FNV A;  1SSO A;  4HR7 B;  1PRT B;  4JBW A;  5I9P A;  4OIK A;  3T4A C;  3NBH A;  2Q2U A;  1WTR A;  1SAP A;  2X69 A;  1NBW A;  2F0W A;  4AYB G;  4C1N K;  3QOJ A;  2R7Z H;  3FDT A;  5C4H A;  1LTG D;  4A3L H;  3CCQ A;  3D0F A;  4G7O C;  2XRQ D;  4JBM A;  1KLU D;  4BY7 H;  1XNR Q;  1TWC B;  3K0X A;  4U68 A;  4C2M H;  3MXP A;  3PGZ A;  4K0K L;  2F0D A;  3BZK A;  2NVX B;  3M3Y B;  1SNQ A;  4A3F G;  3OMC A;  2K5D A;  4N9T A;  5ELN A;  3HS0 C;  1PMR A;  3G4S A;  1N34 Q;  1F2Y A;  2XWB B;  1Z7T A;  4J8Q A;  4JVZ A;  3MXN B;  5I4D A;  4HJ8 A;  3K58 A;  2K03 A;  2Z0S A;  4C3J H;  2Q8R E;  2GVB A;  2B3G A;  1VQN A;  2JXM B;  1I6H B;  3BG3 A;  1HTP A;  4FDB A;  1KIX A;  2F4V Q;  1Z6H A;  4KLK A;  1VQ5 A;  4IFD H;  5EPK A;  4YCU A;  1I4H A;  4IOA A;  3KFU A;  4ZK9 B;  3OMG A;  4TSS A;  4F87 A;  2JSO A;  1K3R A;  4JI4 Q;  4DFA A;  5ELD A;  1EIF A;  4JI7 Q;  3MFG A;  2KJX A;  1AZQ A;  4GN3 B;  2MO1 A;  4JI0 L;  2IJ0 A;  2L55 A;  1C0A A;  5IYD H;  2F0V A;  4HSP A;  4A3G H;  1V1P A;  1B8A A;  1UEB A;  4HIM A;  3K7U C;  1LUZ A;  2LXK A;  5FK9 C;  2R7Z G;  2N3S A;  5JVG 3;  3I55 A;  1AH9 A;  4I7Z C;  1H9J A;  4DK3 C;  5C4X H;  2EQS A;  1N32 Q;  3CCU A;  2L1B A;  4GKK L;  4A3L G;  1IW7 C;  2E2I H;  3I4M B;  3SK8 A;  4DPG A;  1CSQ A;  4BY7 G;  4CDD C;  1HH2 P;  2O5J C;  1VMP A;  3I2Z A;  4DK0 A;  3VR6 A;  2Z6K A;  5IGD A;  4R9W A;  1X3Q A;  2B39 A;  1GHK A;  2LXJ A;  2VB2 X;  4PG3 A;  3CC2 A;  3S16 H;  4FVM A;  3S1M H;  4QL5 A;  4BA1 I;  1PH3 A;  3RUZ A;  1A3U A;  5ELC A;  3BS1 A;  2NN6 H;  3AMU A;  4C3J G;  2VQF L;  4IPG A;  1PRT D;  3OWF A;  4CDE C;  1S40 A;  1B9N A;  1J5E L;  5C5M A;  4IFD G;  1NNX A;  2K5H A;  4NXM L;  4A3F B;  2UXC L;  3T1Y Q;  1STY A;  3KBG A;  3NHH A;  4KV6 A;  4Y7N H;  3CCS A;  1ET6 A;  4JG2 A;  1LO5 D;  4GZY C;  3I73 A;  4G7H C;  2NVT H;  2K33 A;  2C35 B;  5LMN Q;  1ASY A;  2CKZ B;  5G3L F;  4N8X 1;  3QOL A;  5IYD G;  1JJC B;  2HD3 A;  4ZYS A;  3HOX G;  4A3G G;  3F2U A;  2K75 A;  1NUC A;  1Q1B A;  2K5N A;  4KN4 C;  1QNK A;  2ZTE A;  4F8M A;  4OWT B;  2CVR A;  4CDF C;  1SRO A;  1TWG B;  2ZJP A;  1BF4 A;  5C4X G;  4MN3 A;  5M5Y B;  4CDC C;  2YU9 H;  1HJP A;  3DEO A;  3H15 A;  3NEN A;  4IUN A;  4ZLT F;  1Q81 C;  4G57 A;  4JI1 Q;  1IL8 A;  2F0U A;  3BVM A;  1OXT A;  4R8N A;  3TS2 A;  2ICE C;  1Q3L A;  3E9I A;  4CHT B;  1VQG A;  1U4R A;  3STB C;  1EQR A;  2PNH A;  2R93 B;  1MI2 A;  4X64 Q;  1JWM D;  3HOV B;  5BR8 Q;  1ILP A;  2HT1 A;  2Z4H A;  2Z8L A;  1GXD C;  2HCI A;  3CHB D;  2I5H A;  1EFW A;  2M9V A;  2NN6 G;  3ULJ A;  3Q24 A;  4BY7 B;  4GNX C;  2I0Q A;  3T16 A;  2VB3 X;  2A73 B;  4C2M B;  1IL2 A;  4PMC A;  4S3S A;  1PFN A;  1CSP A;  1SNC A;  1WJJ A;  2GN5 A;  2KEN A;  3OHX C;  4G7Z C;  4IAL A;  3CPW A;  4NXN Q;  1S3O A;  3FRP B;  3M85 A;  1WCM H;  1Y1W H;  3TN2 A;  2KHJ A;  4B3T Q;  4R4Q A;  1OTC A;  2VZA A;  2B2Y A;  4IUU A;  1X6O A;  2ZXR A;  2EJF C;  1DCZ A;  1L0Y B;  3K57 A;  1SEB D;  3MZ5 A;  4JI8 Q;  3A8I E;  5HY6 A;  4K5W A;  1UWV A;  2KEE A;  4KKT A;  3D31 A;  2LFN A;  2F0O A;  1EIH A;  2CW0 D;  3VR3 A;  1NR4 A;  3RZD H;  1PH7 A;  3HOU B;  5JJI A;  4KHP L;  1L0X B;  3SGI A;  1CA6 A;  3HKZ E;  4FF3 A;  3M4O H;  1WI5 A;  1FL0 A;  3GTO B;  2KHI A;  2F3W A;  2PO4 A;  4ZAI A;  2EYJ A;  3GTG B;  1HFG A;  3G7L A;  3HOY H;  3HOX B;  4A3G B;  1JCK B;  1PDQ A;  3SR1 A;  1IZ6 A;  4LUZ A;  1YVC A;  5C4X B;  4ZCK A;  1EY6 A;  3J7A F;  2BH2 A;  2E2I B;  2ZT9 C;  3DEP A;  2Y0S E;  1T5E A;  1TVX A;  3SK4 A;  3C46 A;  1B4O A;  2RVL A;  1EOT A;  2MP1 A;  1ICW A;  1G29 1;  2ATW A;  1HCZ A;  1NY4 A;  2FFK B;  2K52 A;  1WCM G;  2NUC A;  1RIP A;  3QG1 A;  3KJP A;  3S1M B;  3RD4 A;  1N8R C;  1WD0 A;  1TWA B;  5M3F H;  3ND9 A;  5CV7 A;  3I4L A;  1E2W A;  3L2P A;  3J80 E;  4B3M Q;  4UHV A;  5EKL A;  4IUR A;  4MNO A;  4K5V A;  4I7A A;  2NYZ D;  4DR1 L;  3MEH A;  5E1F A;  1SFO H;  2D0P A;  1EY7 A;  3S1Q B;  1Q86 C;  3J81 L;  4APV A;  3NPP A;  4JI2 Q;  2CHB D;  3CAM A;  3OSO A;  3TZD A;  4LF5 Q;  3GTP H;  4ID6 A;  4O42 A;  4ZKC B;  1PH4 A;  1KTK A;  1SE8 A;  3GD7 A;  1HUM A;  3HOY G;  4LF7 L;  5JEA J;  1IKL A;  3KLS X;  4DN4 M;  2B2Y C;  1PH5 A;  2B2T C;  2JA5 H;  2CH4 A;  1Q8K A;  3BDO A;  1PH9 A;  1HZ9 A;  3L7Z C;  2YU9 B;  2R92 H;  5M5W B;  4HJA A;  5JJK A;  5C5L A;  2RSN A;  3PIO A;  4WOR A;  2E2J B;  1G6Z A;  3K0Y A;  4HJ5 A;  3DXJ C;  2A74 C;  3IFD A;  4UP7 A;  1K3B C;  2A68 D;  2O2L D;  3HEJ A;  4BXX G;  5M3F G;  1MIU A;  4J6H A;  3DM3 A;  4K14 A;  1SE3 A;  4IJH A;  1VQD A;  4K2L A;  2K5Q A;  5ELE A;  3NQT A;  3I72 A;  5JEA H;  3K5O A;  1C7Y A;  1A15 A;  2E76 C;  2A1A A;  1DZ1 A;  4JPB W;  2B63 B;  1EWC A;  2B8G A;  4JOI C;  4QY7 A;  1WCM B;  2IX0 A;  3MAQ A;  4B3S Q;  1KD1 C;  1C9O A;  3RLO A;  2NZ1 D;  3CF5 A;  3D4R A;  1BOS A;  2N55 A;  1RCV D;  4JI5 L;  5FJ8 H;  4BY1 H;  2KCN A;  4QIW B;  4DV1 Q;  4IFD I;  4DV2 L;  3F1Z A;  4IZ8 A;  2Q8I B;  1EY4 A;  1GOZ A;  5DM7 3;  1K8G A;  1SND A;  5EPL A;  3NK9 A;  1STG A;  1CZG A;  3X3N A;  2UU9 Q;  2JA5 G;  2WB1 E;  4DAY B;  3TRE A;  4HIK A;  4OGQ C;  2BA1 A;  2R92 G;  1HPC A;  1X32 A;  1ESF A;  5A2Q L;  4DV5 Q;  1E1T A;  3HZX A;  2V1C C;  1L0W A;  2B29 A;  1TS5 A;  4RKB A;  2B8F A;  1FNW A;  1PRT F;  4WJ4 A;  1Q46 A;  2EE1 A;  4ABN A;  1LV9 A;  3ZJY C;  1EQV A;  3DLL A;  1ENA A;  1TWH H;  4DXG A;  1YHA A;  4LFB L;  1E7Z A;  3TP7 A;  5J22 A;  3PO3 H;  5JEA G;  1BCP B;  1VQH A;  4RA8 A;  4X62 L;  2E2D C;  1A2U A;  3CCR A;  3Q6S A;  1LLR D;  4EQO A;  4DF7 A;  2WAQ B;  1EOV A;  4BBR H;  5LMU L;  4V19 0;  2NN6 I;  3DMU A;  2EY2 A;  1SNP A;  4BY1 G;  4NP5 A;  1LT5 D;  2MQH A;  4IN3 A;  5AJ3 L;  4DAV A;  3PO2 H;  1AE2 A;  4AIM A;  5KNB A;  4QCL A;  1SFO B;  1IBK L;  1QVF A;  1VQB A; 
#chains in the Genus database with same CATH homology
 1TWF H;  1D8L A;  4YWK A;  1M1K C;  1V1Q A;  3CCE A;  4NXM Q;  2XTI A;  3S1N H;  4LF8 Q;  4NPS A;  3IRB A;  4X66 L;  1HR0 W;  2CCZ A;  5IE8 A;  3J7Z C;  1OXV A;  1XPO A;  4DV7 Q;  1Y1V G;  1P16 A;  1I3Q H;  4LF5 L;  3OYY A;  4AQY Q;  5FLX c;  5GRO A;  4RG1 A;  4Y52 H;  4LF8 L;  3HOU G;  2AWO A;  3I7F A;  1FVI A;  3S1Q H;  4L5T A;  4YWM A;  4DV7 L;  4PZ8 A;  5IYC H;  1L1O C;  4QIW E;  4LWC A;  3UE0 A;  4O2D A;  3W1G A;  4AQY L;  3U4V A;  5M3M G;  2NVY H;  1BBU A;  3KF6 B;  4DV0 L;  4XIG S;  1M90 C;  5IP7 H;  2F52 A;  4HJ7 A;  4C3I H;  4JC0 A;  4GNX B;  3RN5 A;  4DUZ Q;  1VS0 A;  2UUB Q;  2HIX A;  1X54 A;  3JC6 6;  1KQS A;  1D7Q A;  3MEF A;  1IXR A;  4A3D H;  3I4O A;  1A62 A;  1CKO A;  2IT1 A;  1VQC A;  4JBW A;  3PO3 G;  3UE1 A;  4MZ9 A;  4OWX B;  2Q2U A;  1MJC A;  5M5W H;  3S14 H;  4YWL A;  1PYB A;  4MTN A;  1VQP A;  1NBW A;  1PYS B;  3RLN A;  1VQK A;  2OCE A;  4BBR G;  4AYB G;  2E2J H;  3M4P A;  3GTL H;  2R7Z H;  1E22 A;  2UUA Q;  2WP8 J;  4NB3 A;  5GQO A;  1OXX K;  4A76 A;  1HZA A;  4K0K Q;  4A3L H;  3E0E A;  3CCQ A;  3D0F A;  2L15 A;  4KI0 A;  4JBM A;  3G71 A;  1GO3 E;  4BY7 H;  2JE6 I;  4DV3 L;  3K0X A;  4C2M H;  2JQO A;  4DKA C;  1XNR Q;  2OWO A;  3PO2 G;  3PGZ A;  4YY3 Q;  4GOP A;  4K0K L;  2NZO A;  2AHO B;  4X65 Q;  2VUM G;  1EIY B;  3BZK A;  1EQQ A;  1GM5 A;  1QVG A;  1VQ4 A;  2E2H H;  1VQ6 A;  1FJG Q;  1BBW A;  1XNR L;  2WFW A;  2BA0 A;  2E8G A;  4A3F G;  4YY3 L;  4DUY L;  4X65 L;  2B63 H;  2WAQ E;  5ELN A;  1EWI A;  3G4S A;  5C44 G;  1N34 Q;  1FJG L;  4DR7 L;  2JEB I;  2R6G A;  1YIJ A;  3MXN B;  4HJ8 A;  2WB1 G;  1Q82 C;  2ZM6 L;  1NJI C;  3ERS X;  1CKM A;  1WFQ A;  2Z0S A;  3J80 i;  1KL9 A;  4C3J H;  2UXD Q;  2GVB A;  2ALY B;  2R7F A;  5H1S E;  2AKW B;  2B3G A;  3F2C A;  4DV1 L;  5IYC G;  4IO9 A;  1VQN A;  1X3E A;  4A3K H;  5M5X H;  3HFZ B;  4FDB A;  3AEV A;  4XTC S;  1KIX A;  2UXD L;  2F4V Q;  4KLK A;  4GLX A;  2VNU D;  1VQ5 A;  2AWN A;  1HZC A;  1DGS A;  3M4Q A;  5IP7 G;  4YCU A;  2LSS A;  4IOA A;  3KFU A;  4OON A;  3AYH B;  2Q2T A;  1G51 A;  2H5X A;  2PI2 A;  4KHP Q;  1N9W A;  3CC4 A;  4DR4 Q;  1K3R A;  4UP8 A;  2KCT A;  3CCM A;  3RNU A;  4JI4 Q;  1R9T H;  1HNW Q;  1HNX Q;  1EIF A;  1LTL A;  3KYH C;  1X3G A;  4JI7 Q;  2OTL A;  2DGY A;  1GKH A;  4GN3 B;  3HOW H;  4TVA B;  5C0X J;  1HNZ Q;  4DR4 L;  4JI4 L;  2MO1 A;  2UXB Q;  4JI0 L;  4L5Q A;  3WWV A;  1HNW L;  4DV5 L;  1HNX L;  1VQA A;  3NBH B;  4JI7 L;  2VY3 A;  3EBE A;  1C0A A;  5IYD H;  4OO1 G;  4A3G H;  4PZ6 A;  1HNZ L;  3H3V I;  3H0G H;  3OTO L;  2UXB L;  3J80 c;  3GTM H;  1B8A A;  1UEB A;  1YHB A;  3K7U C;  1LUZ A;  4HIM A;  2LXK A;  1X56 A;  2R7Z G;  2N3S A;  2HHH L;  4LF4 Q;  1NMG A;  3I55 A;  1AH9 A;  4P75 A;  4DK3 C;  5C4X H;  2EQS A;  1N32 Q;  4LFC Q;  3CCU A;  4GKK L;  4QJF A;  4A3L G;  2E2I H;  4JOI A;  1VQJ A;  4A3B H;  4DPG A;  1CSQ A;  4LF4 L;  1XNQ L;  1IYJ B;  4BY7 G;  1HH2 P;  3I2Z A;  1N32 L;  1UE6 A;  4LFC L;  2UUC Q;  1V43 A;  3PIP A;  1SLJ A;  3PSI A;  2Z6K A;  5J3B A;  2LXJ A;  4PG3 A;  4P72 A;  3CC2 A;  4LF9 L;  3S16 H;  4A3M H;  5FJ8 G;  1N36 L;  1U5K A;  2UUC L;  1N33 L;  1BKB A;  5GAH C;  3S1M H;  1YIT A;  2VW9 A;  4QL5 A;  2I5M X;  1K83 H;  3KOJ A;  3PUY A;  4BA1 I;  3AFP A;  4DNI A;  2VQE Q;  1PH3 A;  2B63 G;  2VL6 A;  3CQZ H;  1PV4 A;  4GS3 A;  2Q2I A;  5DLQ E;  1LM0 A;  3TEH B;  1Q7Y C;  1J5E Q;  4BXX H;  2VQF L;  4GLV B;  4HJ9 A;  1V9P A;  4IPG A;  1A63 A;  4GN5 A;  1KAW A;  2UXC Q;  1S40 A;  1B7Y B;  4A3K G;  3EIV A;  1J5E L;  3A5Z B;  2CWP A;  2HQL A;  4C3H H;  4IFD G;  1K0R A;  3JAM c;  2K5H A;  4NXM L;  1YBY A;  3A0J A;  2UXC L;  3T1Y Q;  1X3F A;  3KDF A;  4Y7N H;  2K14 A;  3CCS A;  2K50 A;  2ZTC A;  2MO0 A;  4JG2 A;  1QZG A;  4LW1 A;  1I5F A;  2OTJ A;  2NVT H;  4GN4 B;  4GOP C;  4J15 A;  2C35 B;  4DR3 Q;  1A0I A;  5LMN Q;  3A5U A;  3HOW G;  1ASY A;  4QGU A;  2CKZ B;  1XMQ Q;  3G6E A;  3S2D H;  4IJL A;  5IYD G;  1JJC B;  3RZO H;  2JA7 H;  1XJV A;  3I56 A;  3HOX G;  3HOZ H;  4A3G G;  2I5L X;  3H0G G;  2K75 A;  1YNX A;  1Q1B A;  2K5N A;  4A3C H;  1NTG A;  2ZTE A;  1XMQ L;  2N78 A;  2ID0 A;  4OWT B;  4DR6 Q;  3CW2 C;  4DUZ L;  1SRO A;  2JA6 H;  5JJL A;  2ZJP A;  2YYZ A;  2PQA B;  1IBL Q;  2UUB L;  5C4X G;  1U0L A;  1X65 A;  2YTV A;  3CC7 A;  4P73 A;  4DV4 Q;  2YU9 H;  4TQU S;  4EQ5 A;  4DR6 L;  1HJP A;  1SMX A;  3H15 A;  4LF6 Q;  3NEN A;  1XPR A;  3TRZ A;  1IBL L;  1H95 A;  2PMZ E;  1XPU A;  1Z9F A;  1Q81 C;  1HR0 Q;  4JI1 Q;  1OXT A;  2KBN A;  2RF4 A;  3TS2 A;  3GO5 A;  1QUQ A;  3E9I A;  4ALP A;  5IP9 H;  1I50 H;  1EUJ A;  1VQG A;  3STB C;  1EQR A;  4A3M G;  2PNH A;  1GVP A;  3K7A H;  2A19 A;  3S15 H;  1RL2 A;  4L5R C;  4X64 Q;  1X55 A;  5C0X G;  5BR8 Q;  2UUA L;  2HT1 A;  2OQ0 A;  2E5L Q;  3M9B A;  3EN2 A;  4BBS H;  2I5H A;  1EFW A;  1VQI A;  3G48 A;  2WAQ G;  2NN6 G;  3ULJ A;  1EYG A;  4X64 L;  4OWW B;  4O0A A;  4GNX C;  2I0Q A;  3KLW A;  5IYB H;  1IL2 A;  3ICE A;  1KC8 C;  1CSP A;  1WJJ A;  2GN5 A;  2KEN A;  1B70 B;  2R7D A;  3KJO A;  3UDG A;  4IPH A;  3AQQ A;  4R4O A;  3CPW A;  4NXN Q;  1S3O A;  3M7N A;  3M85 A;  1WCM H;  5IWA Q;  1Y1W H;  1TWC H;  3KDF B;  3UDF A;  2KHJ A;  1MJE A;  4EX5 A;  4JYA Q;  3GTQ H;  1KXL A;  4NXN L;  1N34 L;  4B3T Q;  2JJQ A;  4R4Q A;  2NVX H;  1L1O A;  1OTC A;  2VZA A;  5IWA L;  5C3E H;  2IX1 A;  1X6O A;  4JI5 Q;  3M3Y H;  3U50 C;  2YV5 A;  2FXQ A;  4JI8 Q;  5HY6 A;  1VQO A;  5GAG C;  4DV2 Q;  1UWV A;  1AE3 A;  3HOZ G;  2JA7 G;  3D31 A;  4L5S A;  2F4V L;  1JJ2 A;  3CMA A;  2ZJR A;  4A3C G;  4OXP A;  4JI8 L;  1PH7 A;  3RZD H;  5JJI A;  4IPC A;  1E1O A;  4LFA Q;  4B3R Q;  3T1H Q;  4PMW A;  2VS1 A;  4A3D G;  1I6H H;  3BU2 A;  4KHP L;  3SGI A;  2JA6 G;  4GLA C;  3HKZ E;  2RHS B;  2PI2 E;  3AFQ A;  4GKJ Q;  3M4O H;  1WI5 A;  1FL0 A;  3I4N H;  2JK8 A;  2KHI A;  4B3R L;  3PV0 A;  3T1H L;  1MKH A;  3FHW A;  4GKJ L;  4JI3 Q;  3HOY H;  3F2B A;  1QUQ B;  1VCI A;  2A8V A;  1G6P A;  2PQA A;  4IPD A;  5IP9 G;  1YHQ A;  2N8N A;  5C4J H;  4A3J H;  1PA6 A;  2ES2 A;  1L2F A;  1IBM Q;  1IZ6 A;  4LUZ A;  3HKS A;  4KHZ A;  1K9M C;  1YVC A;  3H3V H;  4QQB X;  4A93 H;  3CCL A;  4A3E H;  2NVQ H;  2BH2 A;  4JV5 Q;  4UPA A;  3LGJ A;  2K4K A;  3S17 H;  2Y0S E;  4LFB Q;  5IYB G;  1I94 Q;  5ELO A;  2YTY A;  3NEM A;  3ULP A;  4POG A;  1HZB A;  4JV5 L;  1TXY A;  4X62 Q;  4P71 A;  2CWA A;  4WJ3 M;  4A3I H;  1G29 1;  5E7N A;  2Q2H A;  1OXS C;  1E24 A;  2ATW A;  1KRS A;  1NY4 A;  2K52 A;  1WCM G;  3I4M H;  1RIP A;  1SR3 A;  4R1J A;  4AH6 A;  3KJP A;  4DR2 Q;  1LYL A;  1N8R C;  2VQE L;  5M3F H;  2JA8 H;  1L1O B;  1Y14 B;  2JA8 G;  3L2P A;  5C3E G;  5LMN W;  4DR2 L;  1PHJ A;  4DR1 Q;  4B3M Q;  5HGQ A;  1PH6 A;  1UE5 A;  4MNO A;  4DR1 L;  1KRT A;  4B3M L;  5GAD C;  1SN8 A;  3U58 A;  3K8A A;  4X6A H;  1IBK Q;  1SFO H;  2D0P A;  2YTX A;  3T1Y L;  1J6Q A;  2NZH A;  1PVO A;  3RLF A;  3TQY A;  3K80 C;  4X66 Q;  1QZH A;  1Q86 C;  2ASB A;  3K81 C;  4APV A;  3GTJ H;  4JI2 Q;  3CAM A;  3GTP H;  4LF5 Q;  2HIV A;  1UE1 A;  3I4N G;  4A3F H;  4LF7 Q;  2JEA I;  4DR3 L;  5EAY A;  5LMN L;  3ULL A;  3F2D A;  1VQL A;  5C44 H;  3TS0 A;  4JI2 L;  1PH4 A;  2ZTD A;  3CCV A;  3S24 A;  3GD7 A;  1SE8 A;  3HOY G;  4R4C A;  4LF7 L;  4DV6 Q;  1GD7 A;  4DV0 Q;  1YJ9 A;  5JEA J;  1JB7 A;  4A3J G;  4IOC A;  1PH5 A;  3FP9 A;  2JA5 H;  4DV6 L;  3GTK H;  4A93 G;  1Q8K A;  4A3E G;  1JT8 A;  1PH9 A;  3UDI A;  1HZ9 A;  4DV4 L;  4H02 A;  3L7Z C;  4RMF A;  3U4Z A;  1VQE A;  2R92 H;  4LF6 L;  3FKI H;  4JBJ A;  5FLM H;  4HJA A;  3S1R H;  5JJK A;  3PIO A;  4OO1 I;  2QGQ A;  1TWG H;  2GVA A;  2BH8 A;  1HR0 L;  1CKN A;  4JI1 L;  3PUW A;  3CXC A;  4P74 A;  4A3I G;  5M5Y H;  3PCO B;  4A75 A;  3I4M G;  4HJ5 A;  2K5V A;  1FGU A;  1PH8 A;  4UP7 A;  1YI2 A;  4BXX G;  5M3F G;  1MIU A;  1XTD A;  3DM3 A;  4YCW A;  5BR8 L;  3OW2 A;  2IHF A;  1BVS A;  1PFS A;  4R4T A;  1PH1 A;  2E5L L;  2ZJQ A;  4JI6 Q;  4POF A;  1Q1E A;  4IJH A;  1VQD A;  1K73 C;  2R93 H;  4UP9 A;  3BJU A;  5IT9 c;  3CPF A;  4DV3 Q;  4JI6 L;  3Q8D A;  3HOV H;  1NE3 A;  1C7Y A;  3BZC A;  4IFD J;  2QEX A;  3E9H A;  3L0O A;  2A1A A;  3NEL A;  5GAE C;  4YHH Q;  3B6Y A;  2AMC B;  1W2B A;  4JOI C;  4AYB E;  4QY7 A;  2IX0 A;  3CCJ A;  3J81 j;  1VQ9 A;  3CD6 A;  4DUY Q;  4A4I A;  4B3S Q;  2MFI A;  1KD1 C;  1C9O A;  4YHH L;  3RLO A;  2Z6K C;  4JYA L;  1JJG A;  1OXU A;  3CF5 A;  4B3T L;  4DR7 Q;  1E3P A;  1NMF A;  4LNQ A;  4JI5 L;  2EXD A;  1YJN A;  5FJ8 H;  2RHQ B;  4BY1 H;  4B3S L;  2ZM6 Q;  1O7I A;  3HKZ G;  3RN2 A;  2N49 A;  3RR5 A;  2MNA A;  4R4I A;  4DV1 Q;  4IFD I;  2OQK A;  3PF5 A;  4DV2 L;  4LUV A;  3F1Z A;  4DAM A;  2DUD A;  1K8G A;  2XGT A;  3F8T A;  4LUO A;  4LFA L;  2UU9 Q;  4JBK A;  2JA5 G;  2WB1 E;  1VQ8 A;  4DAY B;  3TRE A;  2QA4 A;  1VQF A;  1Y1V H;  4HIK A;  1X9N A;  2CQO A;  2BA1 A;  4HID A;  4DR5 Q;  1YJW A;  1QVC A;  1VQM A;  2R92 G;  3HOU H;  3FKI G;  1UE7 A;  3W1B A;  4YCV A;  1A8V A;  1W3S A;  5FLM G;  2UU9 L;  4BA2 I;  4JI0 Q;  1CKN B;  4PZ7 A;  2RCN A;  4JI3 L;  2Y0S G;  1KHI A;  2IHE A;  4DV5 Q;  1E1T A;  4DR5 L;  3GTO H;  2D0O A;  4UY8 C;  5M3M H;  2V1C C;  1L0W A;  1YEZ A;  3KF6 A;  3PUV A;  2B29 A;  2CFM A;  3GTG H;  3OTO Q;  4BBS G;  2F3I A;  4WJ4 A;  1Q46 A;  1Z47 A;  1IBM L;  4GNX A;  3ZJY C;  2EIF A;  3DLL A;  2HHH Q;  4A3B G;  3HOX H;  1WYD A;  1YZ6 A;  1T9H A;  4ME3 A;  1TWH H;  4GKK Q;  3CP0 A;  3J81 i;  1YHA A;  4LFB L;  1E7Z A;  2R93 G;  4OX9 Q;  1P8L A;  3CME A;  5JEA G;  1I94 L;  1XNQ Q;  3HOV G;  1VQH A;  1Y1W G;  3PO3 H;  2JA9 A;  4X62 L;  3ER0 A;  5LMU Q;  3JAM i;  3CCR A;  3UDX A;  1ASZ A;  3KF8 B;  5C0X I;  3PF4 A;  4OX9 L;  5K36 G;  4LF9 Q;  4GOP B;  1VQ7 A;  1N36 Q;  1EOV A;  3PUX A;  3STB D;  1N33 Q;  4BBR H;  4DK6 C;  5LMU L;  2IY5 B;  1CUK A;  2NN6 I;  1WOC A;  1PH2 A;  5AJ3 Q;  1Q12 A;  3A74 A;  3VDY A;  3S2H H;  1K8A C;  4BY1 G;  1JE5 A;  3W5O A;  1XMO Q;  1SRU A;  3GDE A;  5IY0 A;  2MQH A;  4JCV E;  2VQF Q;  3PUZ A;  3J7A 5;  1TWA H;  5AJ3 L;  4HIO A;  1S72 A;  3PO2 H;  1AE2 A;  2D62 A;  2KCM A;  4AIM A;  1JMC A;  2VUM H;  1XMO L;  1IBK L;  1QVF A;  3J81 c;  1VQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...