1HZAA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzaA00
3M9BA 1XPRA 4LF6L 4IFDJ 2JA5G 2F4VQ 2C35B 1UE6A 1TWAH 4RG1A 1BKBA 3U4ZA 2WP8J 2EIFA 3KDFB 2WAQE 5M3MH 1B7YB 2UUCQ 1PH1A 1SRUA 3S1RH 4ALPA 3GTQH 1VQBA 1EQQA 4GLAC 2QEXA 2E8GA 4GNXC 2H5XA 3J81i 3ER0A 4C3JH 2YTXA 4J15A 3I4MH 1VQEA 4GN4B 4PMWA 4BBSG 3M4PA 4UP9A 4HJ5A 1IZ6A 1Y1WH 4X64Q 3NEMA 5M5YH 2VQFQ 3RLNA 1KD1C 1ASZA 2JK8A 1VQLA 1QUQA 3CPWA 1MIUA 4GN5A 4DAMA 3CMEA 2QGQA 3S1MH 2XGTA 1K73C 2WB1G 3ULLA 2OQ0A 1KC8C 4JI0L 4NXMQ 4A3BH 5LMNL 3J81j 4A4IA 3H0GH 1YJWA 3CF5A 4X62Q 2PI2A 5IYCG 2ZTEA 1VCIA 1HJPA 3K8AA 3HKSA 3W5OA 1GKHA 1NJIC 5C44G 3K81C 2A19A 4C3IH 3D0FA 3KJPA 1K8AC 4BY1G 4OX9L 5JEAJ 4L5SA 1VQDA 1IBML 1BVSA 1EQRA 2JA6H 3BJUA 2R7FA 1XMQQ 5ELOA 5IE8A 4KHZA 3L7ZC 5FLMH 4LW1A 1VQAA 4A3JG 5GAHC 4DV2L 5GAEC 1N32Q 4MZ9A 1I3QH 5M5XH 2UUBQ 1Q1EA 4BBRG 4AH6A 4TQUS 2JA5H 4EQ5A 2JA7H 1PA6A 1NTGA 4DR6L 4NXNL 3UDGA 1E1TA 2I5HA 2E2IH 2UUAQ 3OTOQ 2XTIA 1UE1A 4DV4L 2JEBI 4KI0A 4B3RQ 3STBC 4BBSH 3PF5A 3CCQA 3S17H 3M85A 1IYJB 4YWLA 1GM5A 1PYSB 2B63G 4A3EG 5IYDH 1HNWL 4LFCL 1DGSA 5LMNW 4LUVA 4UPAA 2IX1A 5C4XG 1O7IA 2KENA 3CCJA 2EXDA 3KYHC 1SR3A 1WFQA 5IYCH 1YVCA 4DV3L 1M1KC 1XMOQ 3J81c 2FXQA 3CCVA 1X55A 4GOPB 4X66L 2N8NA 2UXBL 2IX0A 3GTOH 4OO1G 3F2CA 3TRZA 4JBJA 1TWGH 1WCMG 2E5LL 4DV5L 1QVGA 4OWXB 4LF5Q 1C0AA 1HZBA 1SE8A 1GD7A 1YZ6A 1YI2A 1QZGA 4A3LH 1K9MC 4A3MH 1N34Q 3U4VA 1YHQA 1NY4A 4B3ML 4JBMA 1XPUA 3STBD 1SROA 5HY6A 4DUZQ 4WJ4A 4C3HH 1JJGA 4GLVB 1J5EL 5BR8L 3KF6A 3MEFA 5C3EG 4OXPA 3S1QH 1RIPA 3HOZG 1IBKQ 4BXXG 1OXTA 4DV5Q 1RL2A 1JMCA 2MQHA 4HIOA 4A3FG 4GNXB 1Y1VH 2VUMG 2JA8G 3CAMA 4JBWA 4A3KG 1I6HH 3L0OA 3GTLH 2RF4A 2RHSB 1AE2A 3D31A 2I0QA 5C4JH 2I5LX 2BH8A 4PG3A 2PMZE 3KF8B 5IWAL 3M4QA 1K3RA 4FDBA 1BBUA 1LUZA 1VQIA 2GVAA 1VS0A 1J5EQ 1XNQQ 1VQJA 1L1OC 2WFWA 4YCWA 2LXJA 3ULJA 5C0XG 4QQBX 1OXVA 2YYZA 1NE3A 3SGIA 1OXSC 3PUXA 1IBLQ 1WYDA 3AFQA 4BA1I 4P73A 3PUWA 2F4VL 2MNAA 3GTPH 4A3EH 3I4NH 1K83H 3F1ZA 2LSSA 3LGJA 1UEBA 1CSPA 4DR1L 4DR3Q 2B29A 4OWWB 2YTVA 4LFAQ 5IP7G 3CC2A 2IHFA 5ELNA 5C4XH 3CXCA 4GOPC 1YEZA 3I4OA 3A5UA 3HOXH 4A3IG 4JI3Q 2RHQB 3OW2A 3JC66 3FKIH 4DV1Q 1JB7A 2E2HH 1SLJA 3AQQA 4JI7Q 4HIMA 3CD6A 2PQAB 4X64L 4DR1Q 2VQFL 1TXYA 3PIPA 4HJ9A 4A3DG 4DPGA 1WJJA 2OQKA 1UWVA 4BY7G 4R4OA 4A93G 4NXML 3CC7A 2D62A 3HFZB 5AJ3Q 1VQ4A 1V9PA 1EOVA 1YHBA 1VQ5A 4QL5A 3S14H 3EN2A 4X62L 2AHOB 1C9OA 2VW9A 3NENA 2N49A 2ES2A 3HOWG 4IFDG 1E24A 1VQ8A 4BXXH 1I50H 2KCTA 4A3CG 4A3FH 1VQKA 4RMFA 1XNRQ 2EQSA 3GTJH 4A3KH 3PF4A 1AH9A 1B8AA 4Y7NH 3PSIA 1XMQL 2L15A 3HOVH 3PUZA 1UE5A 1KRTA 2JEAI 2JA9A 4POFA 5FLXc 3DLLA 4OO1I 3MXNB 3DM3A 1WOCA 3UE0A 3JAMi 1YIJA 2UUBL 4JI5Q 1N32L 1MKHA 2UXCQ 1G51A 4JOIA 4A76A 1HZAA 2WAQG 1VQPA 3J80i 4P75A 1VQ7A 1X3FA 3CMAA 3E0EA 4XTCS 4DKAC 5IP7H 1CKNB 4QJFA 1GVPA 4IOCA 3TS0A 5FJ8H 1OXXK 4R4CA 2UUAL 3F2DA 4B3TQ 3OTOL 4A3IH 1P16A 3ICEA 3S1NH 4DR2Q 1EWIA 5M3FG 1WI5A 4DV0Q 4LFBL 1NBWA 3HOUG 1NMFA 4B3RL 2CQOA 5JEAG 4XIGS 4NPSA 4JI6Q 4DAYB 4DR4Q 3M4OH 1X3EA 1EYGA 2Z0SA 3U50C 1KAWA 2Z6KC 3K80C 1VQ9A 4L5RC 3CCUA 4GS3A 3E9IA 3T1HQ 3CW2C 5C0XI 2A1AA 4LFBQ 1I5FA 4JG2A 1CUKA 3GTGH 1X6OA 1QVCA 3HOWH 1XMOL 1N33Q 3H15A 5GAGC 4DK3C 1UE7A 1X65A 2AWOA 3CCSA 1L1OB 1Q8KA 4APVA 1MJCA 1JJ2A 4LF5L 2VY3A 2ZTCA 3AYHB 2GN5A 4R4QA 4UY8C 4GN3B 4YWMA 2HT1A 4R1JA 3PO2G 4LUOA 1QUQB 1N34L 3M3YH 4LUZA 4X6AH 2KBNA 1L0WA 3NBHB 1HR0Q 4DUZL 4O2DA 1EIYB 3PO3G 1EUJA 1H95A 5C44H 2R7DA 2UU9L 2ZJPA 2R7ZG 3KFUA 4A3GG 5JJLA 1IBKL 2RCNA 4BY1H 3PCOB 4POGA 1U5KA 1U0LA 1VQHA 1VQFA 2CFMA 2HIXA 1VQCA 3KOJA 2F3IA 4A75A 2BA1A 1Q81C 5GADC 3BU2A 3G48A 2Q2TA 5IP9G 1I94Q 1AE3A 1D7QA 1TWHH 4JV5Q 1ASYA 4DV6Q 2R6GA 4A3JH 1E7ZA 3TREA 1HNZQ 2KHJA 2HHHQ 3PUVA 2D0PA 2OWOA 4LF4L 4IPGA 1C7YA 1XNQL 2UU9Q 3W1BA 4IFDI 4JI2Q 4BBRH 2PQAA 3S15H 4LF8Q 4IPCA 3HOUH 3KDFA 3NELA 2JQOA 3JAMc 2R92G 1IBLL 4DUYQ 1KHIA 4DR7Q 2UXDL 1BBWA 5M5WH 3K0XA 4DR3L 3J80c 4JYAQ 4HJ8A 4LF9Q 2MO1A 2CWPA 4LFAL 2PI2E 4GLXA 1K0RA 1TWFH 3I2ZA 2IY5B 4OONA 3KLWA 1FL0A 4JCVE 4JI3L 4PZ8A 4IJLA 3T1YQ 2YTYA 1PH9A 2IT1A 4TVAB 3I4MG 4LNQA 3S16H 4DV7Q 4DV1L 4JI7L 4IOAA 1Q12A 1KL9A 2VQEQ 2B63H 2UXDQ 4O0AA 4YY3Q 2ZTDA 3HOYG 2Q2HA 3FP9A 3CC4A 1XTDA 4KLKA 3RN5A 1JT8A 2OCEA 1HNXQ 2CCZA 3OYYA 1LYLA 1Q7YC 5AJ3L 4DR5Q 3F8TA 2YV5A 1S40A 3PO3H 2OTLA 5E7NA 4LF7Q 1YHAA 1CKMA 1Y14B 2R7ZH 1CKOA 4JOIC 1SFOH 1WCMH 4HIKA 1PH7A 2K75A 1CKNA 5EAYA 1XNRL 4P74A 4R4IA 1S72A 4AQYQ 1VQGA 1A0IA 2ID0A 2NN6G 5H1SE 1N9WA 1D8LA 1YBYA 2VL6A 2A8VA 1A63A 2WB1E 2AWNA 2K4KA 4JI4Q 4LF4Q 2F52A 2Q2IA 4HJ7A 2NVYH 1PH8A 5C3EH 4UP8A 4H02A 3HOZH 4JI1Q 1P8LA 1KXLA 1FJGL 4AYBE 4JI5L 1K8GA 1JJCB 2VUMH 2UXCL 2MFIA 4LWCA 4PZ7A 2JA8H 2R92H 3H3VI 2OTJA 1IXRA 1EIFA 3KF6B 4P71A 2BA0A 5LMUQ 2JA7G 2DGYA 1XJVA 2I5MX 3I55A 4ME3A 2KHIA 2ZM6Q 3G4SA 5GQOA 2NVTH 4JI8L 3J7A5 4Y52H 4B3TL 4KHPQ 4DK6C 1FJGQ 4GKJQ 2JJQA 4B3SL 2DUDA 4DR2L 3GTMH 4DV0L 1L1OA 4LF6Q 3VDYA 3S2HH 3WWVA 3TEHB 1PH6A 3CPFA 3KJOA 1KQSA 3HOYH 4JI6L 1Z47A 2Y0SE 3PIOA 3E9HA 1Z9FA 4YCUA 4UP7A 4JI8Q 2MO0A 5IYDG 2GVBA 3U58A 2N3SA 3BZCA 2Q2UA 4DR4L 2ZJRA 1SMXA 1Q86C 3ZJYC 2B3GA 1G291 3RZOH 4GOPA 1E3PA 4B3SQ 2ASBA 1R9TH 1NMGA 3T1HL 4BA2I 2VZAA 3RZDH 2CWAA 4AYBG 2NZHA 3GD7A 3UE1A 5HGQA 5IYBG 3G6EA 2QA4A 1N36L 3F2BA 1HZ9A 4NB3A 1N33L 2NZOA 2K52A 4A3DH 1PYBA 3AFPA 4IPHA 3B6YA 1OTCA 2R93G 4BY7H 4JI0Q 2NVQH 3RR5A 4A93H 4OWTB 2ATWA 5LMNQ 4K0KL 4A3LG 2KCMA 1CSQA 1YNXA 4A3MG 1X56A 4PZ6A 3S2DH 1VQ6A 5JJIA 1YJNA 3TS2A 4MTNA 4GNXA 4QGUA 4EX5A 1N36Q 1HR0L 4YCVA 1Q1BA 4IPDA 3M7NA 4A3CH 5JJKA 3J7ZC 1LM0A 2N78A 1A8VA 4OX9Q 1N8RC 2PNHA 1IBMQ 4L5QA 2Y0SG 1Y1VG 3CQZH 4R4TA 1LTLA 4K0KQ 2K5VA 3FHWA 1T9HA 3UDXA 5K36G 3A5ZB 1I94L 4MNOA 4JV5L 3S24A 3BZKA 4DV6L 2CKZB 1V1QA 2IHEA 4DV2Q 1HNZL 2HHHL 3UDFA 1FVIA 2V1CC 1PH2A 3RLOA 4JI2L 1KRSA 4LF8L 2HQLA 5IT9c 4DR6Q 4WJ3M 4L5TA 4P72A 4DUYL 1PHJA 2NN6I 4DR7L 4NXNQ 3ULPA 3I4NG 4GKKL 1X54A 2HIVA 3EIVA 1B70B 1KIXA 1G6PA 1XPOA 4DNIA 4JYAL 1JE5A 3TQYA 4LF9L 4C2MH 3ERSX 1VQOA 4JC0A 4DV4Q 4IO9A 1YITA 1W3SA 3EBEA 1PFSA 2AMCB 2ALYB 3Q8DA 3HOXG 5M3FH 2YU9H 2NVXH 1TWCH 4YWKA 2BH2A 3T1YL 3HKZE 1IL2A 3FKIG 5IYBH 1QVFA 3CCLA 4QIWE 4IJHA 3A0JA 4DV7L 4GKKQ 3CCMA 1HNWQ 2VQEL 4LFCQ 4YY3L 3CP0A 5GROA 3UDIA 2D0OA 5M3MG 2R93H 3L2PA 3I7FA 3A74A 3RNUA 5IY0A 3RN2A 1MJEA 4X65L 1OXUA 2K50A 1S3OA 4YHHL 1HNXL 1HR0W 3W1GA 1J6QA 2Z6KA 4QY7A 2VNUD 4DR5L 4DV3Q 4JBKA 2UXBQ 1SN8A 2K5HA 4X66Q 4LF7L 1V43A 3IRBA 5C0XJ 4HIDA 1Y1WG 3RLFA 3GDEA 3PUYA 3K7AH 2E5LQ 3H3VH 1PVOA 4X65Q 4YHHQ 3PO2H 2JE6I 2ZJQA 2VS1A 4AQYL 4A3BG 1W2BA 1M90C 4B3MQ 3G71A 1QZHA 3HOVG 3H0GG 1Q82C 4JI4L 5BR8Q 1PH3A 1VQNA 2E2JH 3GTKH 4A3GH 3HKZG 1YJ9A 4JI1L 1GO3E 1HZCA 3PV0A 1L2FA 2AKWB 2LXKA 3AEVA 3GO5A 3PGZA 1X9NA 1A62A 3I56A 5J3BA 1E22A 5LMUL 5IP9H 1EFWA 2K14A 1E1OA 3CCRA 2K5NA 2JA6G 5DLQE 1Q46A 5IWAQ 2ZM6L 1PH5A 1X3GA 3K7UC 5FLMG 3CCEA 4HJAA 4AIMA 2UUCL 5FJ8G 1PV4A 1FGUA 4KHPL 1HH2P 1VQMA 4GKJL 1PH4A
chains in the Genus database with same CATH superfamily
1XPRA 1UE6A 1PRTF 1BKBA 2B2VA 2WP8J 5I4DA 3GTKB 1S5BD 2WAQE 2B2TA 1RKNA 4XT1B 1SRUA 1XTCD 2E8GA 2H5XA 3J81i 3QJYA 4C3JH 1VQEA 4BBSG 5D3DA 3DWAA 2EYOA 1IZ6A 1HFGA 3NEMA 5M5YH 1O78A 3RLNA 1BF4A 3I73A 3K5LA 1ASZA 3X3NA 1VQLA 1NAPA 4DAMA 3L3OC 3FKIB 1KC8C 4XDXA 3J81j 2E2HB 1ENAA 2HUGA 3H09A 4CGYB 4X62Q 5T1IA 1LT5D 1NR4A 3T16A 5M3MB 1NJIC 5C44G 2KQ3A 5FO9B 3SK8A 4OX9L 4BY1G 5JAVA 1EQRA 3BJUA 5IE8A 4KHZA 2D9UA 3L7ZC 1Y1WB 1SYFA 5GAHC 3NTHA 2K33A 1N32Q 5M5XH 2A68C 4BBRG 2PW7A 1HCZA 3DUZA 2F0DA 4BS9A 4O42A 3C1EA 2O4XA 4C3IB 3OTOQ 2B2WC 2XTIA 1EY6A 4DV4L 3U9OA 3KLRA 2JEBI 1EIHA 3H91A 4HCSA 3S17H 1D1IA 1IYJB 1GM5A 5EPKA 5LMNW 3KBXA 4LUVA 4ZLTF 3MWYW 5IIFA 2C5CA 2X69A 3KYHC 3FMCA 5IYCH 4I65A 5DAUA 1A2TA 2UXBL 1X55A 5NUCA 4GOPB 3GP7A 3SVMA 1TWGH 2NTSA 3CRKC 4BBSB 4OGQC 4A3MH 1N34Q 4JBMA 2MP1A 4DUZQ 1J5EL 3KF6A 5C3EG 4DNRB 3HOZG 4BXXG 1OXTA 2OXPA 1RL2A 2VUMG 1EWHA 1Y1VH 2XSCA 4A3KG 5KNDA 3P7JA 3NQTA 2BH8A 5C44B 4PG3A 4OHJA 3M4QA 4FDBA 3VA7A 4BY1B 1C48A 3K6OA 1OXVA 4OELB 3SGIA 1NNXA 1OXSC 3PUXA 3D6CA 3R2TA 2PYKA 3F1ZA 2E74C 4OWWB 5I9PA 3P75A 2YTVA 4IN3A 3CC2A 4BBRB 4GOPC 2J4XA 1FYCA 3HOUB 3I4OA 4X3UA 4A3IG 4JI3Q 5CV6A 4Z9CB 2WKCA 3FKIH 2E2HH 3T51B 1JB7A 4OO1H 4HIMA 4KN4C 1YNNC 4DR1Q 3SEBA 4DXFA 3NBIA 5IODA 4DPGA 1F9RA 2SEBD 3S16B 1J8IA 2FINB 1ZXTA 2EYMA 5J1ZA 4X62L 1C9OA 2LMCB 3ONAB 1C4QA 4B08A 3HOWG 1I50H 4ME5A 1AH9A 1XNRQ 2EQSA 3QOJA 5CV8A 4N9PA 1HTPA 1LABA 3PO3B 1K0SA 2L15A 3HP3A 4POFA 3DLLA 1HUNA 1RJTA 3A55A 2F0EA 2NWGA 1N32L 1WOCA 3JAMi 1KABA 1EQVA 5D65A 5DM63 3S14B 1EY8A 2WAQG 5T1GA 5L37A 5A2QE 1X3FA 3E0EA 2NVYB 5C3EB 4XTCS 3HOZB 4IOCA 1GVPA 2O5JC 3R2IA 3UI2A 4B3TQ 2VUMB 2OF1A 3OTOL 3MTSA 4A3KB 3ICEA 1B50A 3A7LA 4DR2Q 1NBWA 5JEAG 4NPSA 1WD1A 2F0OA 4QIWB 2K1BA 1KAWA 2WKDA 1YNJC 4JG2A 4U68A 1QVCA 3BS1A 2OT2A 3SHLA 4U673 1LT6D 4ZCKA 4A3IB 4CDCC 1JJ2A 5HURA 5E1FA 3PO2G 3BVMA 4ZKCB 4MIUA 1LTAD 2A68D 3ERQA 2Q8RE 1N34L 1TT2A 3J7AV 4DUZL 4O2DA 5C44H 2R7ZG 5JJLA 3KFUA 2PMZB 4ODGA 1TR5A 4BY1H 3PCOB 2HIXA 1QE6A 1SJHD 3S2DB 1SNDA 3BU2A 5CORA 1STAA 1AE3A 3HOWB 4DV6Q 4J6HA 1HXYD 3T53B 2QKIC 1EEFD 4BBRH 1XX8A 4LF8Q 3HOUH 1PRTC 3NTKA 2I07B 1KDAA 1E2WA 1KLGD 3J80c 2CWPA 2PI2E 3I2ZA 1Q90A 2EY2A 2WAQB 4B9XA 4CDDC 1FL0A 1OO9B 4JCVE 4JI3L 4IJLA 3I4MG 3S16H 1TWHB 2HCCA 4DV7Q 4IQZA 4HAEA 1BBXC 2NZ1D 2UXDQ 4YY3Q 1IKLA 2Q2HA 3C3LA 2C9OA 2XNAC 4KLKA 3RN5A 3S15B 5CBAE 1STBA 2AUKA 2SNSA 4OIKA 1HNXQ 3PMFA 3MXNA 3PO3H 1EYDA 3VR3A 4LF7Q 1CKMA 2KHSA 1CKOA 4F8MA 4JOIC 4I7ZC 1QJOA 1PH7A 1FNUA 1XNRL 1ZEQX 1VQGA 4CBVA 5EGTA 2B2YC 1D8LA 2VL6A 2A8VA 2WB1E 2AWNA 2K4KA 2Q8IB 2LKVA 2Q2IA 2NVYH 3DMUA 3K7AB 1WTHA 5C3EH 5IT9L 3HOZH 1P8LA 2AQ2B 1KXLA 1FJGL 4AYBE 1I4XA 3PO2B 4ZAIA 2VUMH 2MFIA 4LWCA 2R92H 3H3VI 1IXRA 1EIFA 2BA0A 2NB0A 3K59A 2PNRC 2DGYA 4JPBW 2I5MX 1X32A 2R7ZB 3RD4A 4K5WA 4TRDA 1HQMC 4B3TL 4KHPQ 1YNND 2DUDA 4J1MA 4DR2L 1ICWA 4LF6Q 4ZUIA 1PH6A 3PIOA 3E9HA 2MO0A 3U58A 5C6AA 1SMXA 3NBHA 3IFDA 4GOPA 2PO4A 4CKBA 2ASBA 2F0JA 5JPMC 1TWAB 3RMHA 1Y8PB 3UE1A 1QILA 1PZKD 4YIJA 3OHXC 1SYDA 1JR0D 3NXWA 3CHBD 4NP5A 3GTQB 3B6YA 4OWTB 2ATWA 3I4MB 4K0KL 2A6ED 2EY5A 4PZ6A 3S2DH 5JJIA 4PMCA 1N36Q 5C3XA 1U4RA 3D6WA 3J7ZC 4KJNA 1QOHA 2PNHA 2D5DA 4L63B 3MFGA 1T9HA 5K36G 1AP0A 4IURA 4MNOA 4DV6L 3BZKA 1TVXA 2IHEA 3G6JB 2HD3A 1GJXA 2V1CC 3AB9A 3RLOA 4LF8L 1SXTA 2EJMA 4G57A 4O1NA 3I4NG 4G7ZC 3EIVA 1G6PA 1SYBA 1CZGA 1I3QB 3MAQA 1EL0A 1CQFA 4C2MH 1VQOA 1W3SA 1PFSA 2BH2A 1LTBD 2JXMB 3LWEA 1FD7D 2F03A 1QVFA 3PIP3 4DV7L 3V05A 4GKKQ 1HNWQ 2Z1CA 4YY3L 2RBMA 3MHBA 3BG3A 4LFCQ 2R93H 3TP8A 3I7FA 3A74A 1K8MA 5I2XA 3J80E 5IY0A 3RN2A 5JJZA 4YHHL 1HNXL 1HR0W 4PNYA 1GHKA 1CZWA 4LF7L 1GHJA 1SE3A 1V43A 3RLFA 1JORA 3K7AH 2E5LQ 2JN4A 4FYDA 3Q6SA 2YU9B 3NE5B 1TS5A 2JE6I 4C1NI 2VS1A 3PO2H 1PTOD 3HOVG 3GTOB 1PRTD 1BO0A 3A8JE 2Z6BA 5BR8Q 1VQNA 4N8FA 1Z7TA 2RDHA 1YJ9A 1HZCA 2AKWB 2LXKA 3AEVA 1NSNS 3PGZA 2RVLA 5C3WA 1A62A 3EVQA 5J3BA 1E22A 4K6LA 2F0SA 3S1QB 3K7UC 4WRDA 3TN2A 4HMJA 4KHPL 1VQMA 1IKMA 5I6YA 3M9BA 4LF6L 5C4JB 2C35B 1TWAH 4RG1A 1SYCA 1M4VA 1LACA 4OIJA 3GTQH 1VQBA 2IL8A 1EQQA 3CKIB 4GNXC 1Z6HA 3I4NB 2YTXA 4A3EB 3I4MH 1U9RA 3M4PA 5ELFA 4HJ5A 3BYTB 2AUJD 4X64Q 1KD1C 2L11A 3CPWA 2XGTA 2IJ0A 2WB1G 4LAAA 5KRUA 1K73C 1KDCA 4IALA 2PW5A 3QG1A 3CF5A 1BDOA 5IYCG 2ZTEA 3K8AA 4K8JA 1IL8A 2A19A 4X3TA 1K8AC 5JEAJ 5KGUA 1VQDA 1GUTA 3FPPA 5CC4A 4R8NA 4EQNA 1XMQQ 4NW2A 4ZKBB 1D1KA 1VQAA 2B2YA 4WJWA 4A3JG 3CRLC 2EXZA 4A3FB 1EU3A 3OSOA 2G9DA 1I3QH 1STHA 2UUBQ 3K58A 4AH6A 4TQUS 1EYCA 2JA5H 3HOVB 3MEHA 5HGTA 2I5HA 4QUFA 2EY1A 2XWJB 1UE1A 3I91A 2B8GA 4B3RQ 3D3RA 1EZ6A 1PYSB 2K28A 1U4MA 2M9VA 2B63G 1HNWL 4LFCL 2F0TA 3FRPB 5CGKA 2F0GA 1H9MA 2IX1A 1O7IA 1HRJA 1SR3A 1WFQA 1YVCA 2E76C 1CI3M 3BDOA 5JVH3 3CCVA 3E3XA 2N8NA 2IX0A 3GTOH 4OO1G 1TS3A 3F2CA 1F9PA 4ZK9B 4G7OC 1WCMG 2E5LL 2EE1A 4DV5L 4LF5Q 1SSOA 1GD7A 4KN7C 1YI2A 1QZGA 4DA2A 5FLXL 3U4VA 3STBD 1SROA 4WJ4A 5BR8L 3S1QH 2M00A 1IBKQ 4DFAA 1JMCA 4KMUC 2MQHA 3EROA 3M3YB 3M4YA 1I6HH 3AU7A 3QO2A 2RF4A 2RHSB 5K36H 1AE2A 5C4JH 2I5LX 2PMZE 3KF8B 1K3RA 1Y8NB 2GVAA 1J5EQ 1XNQQ 1VS0A 4KK7A 4QQBX 2LXJA 2DY7A 1IBLQ 3AFQA 3I4LA 4A3JB 3I4NH 4A3EH 3LGJA 4DR3Q 2F0FA 5C4XH 3CXCA 2A5HA 3A5UA 4PMBA 3Q23A 2RHQB 3OW2A 2QDBA 3JC66 1PTOF 1PMRA 2VB3X 4DV1Q 5CV4A 2JP1A 4X64L 1EZ8A 5IOCA 2OQKA 2WINB 1UWVA 2J0TD 4BY7G 3J7AF 2F4IA 3CC7A 2D62A 3HFZB 4QL5A 2B63B 3NENA 5DNFA 2ES2A 2V4DA 4A3FH 4RMFA 1B8AA 1G2SA 3PSIA 1XMQL 3H6MA 3EJIA 3HOVH 4H7BA 1KRTA 5ISRA 2KJXA 2JA9A 1WCMB 3JAML 3MXNB 3DM3A 3UE0A 5C0XH 2UUBL 1EWCA 2NYZD 1JOOA 4A76A 1H9SB 1HZAA 2MHVA 1WTXA 1VQPA 3J80i 4P75A 1VQ7A 1LTRD 3NTIA 2L55A 3CMAA 5IP7H 3LX0A 4QJFA 4LMQD 1I50B 3TS0A 4UAIA 4R4CA 1VF5C 3F2DA 3S1NH 1EWIA 2KUMA 1GUNA 4B3RL 3HOUG 4LFBL 5M9OA 4XIGS 5I9OA 4EQOA 3DWQA 3VYSA 2Z0SA 3U50C 1R4PB 1VQ9A 3GTMB 4GS3A 4KV6A 5FOBB 4X3KA 1EY0A 1I5FA 4Q0FA 3IL8A 5IGCA 1CQVA 1RF2D 3IFTA 3H15A 1I4RA 4UDUC 1G2TA 1X65A 1Q8KA 2MUYA 1MJCA 1SNQA 1PFNA 4LF5L 2PCFB 2VY3A 3AYHB 4LUOA 2RSNA 3M3YH 4X6AH 2KBNA 5KNBA 3NBHB 3I8ZA 3TP5A 3PO3G 1PZJD 4A3GG 4BY7B 2NVQB 1IBKL 3HEJA 2CVRA 4POGA 1S4ZA 1VQCA 3KOJA 5IGEA 1W6JA 2KCNA 4A75A 1Q81C 2AQ1B 3G48A 1I94Q 2R6GA 4A3JH 3QB3A 2OWOA 1C7YA 1XNQL 2HQEA 3W1BA 3LNNA 4QUCA 4JI2Q 4XT3B 5CV7A 1JWUD 2R92G 1IBLL 4DUYQ 2D2CC 3E5SA 2IWHA 1VF7A 4DR7Q 3Q24A 4K5VA 4DF7A 4JYAQ 3K0XA 3D4DA 2BOSA 3NWTA 4DR3L 5EJWA 4XYQA 5ELBA 1DOMA 1JQYD 2EDGA 1ET6A 3T1YQ 1EEID 2YTYA 4DV1L 2MPMA 2B63H 5C5LA 5COYA 1IW7D 1O7ZA 4K6DA 1JT8A 4KY6A 4WORA 2CCZA 1STNA 1MD2D 4DU9A 1S40A 5IGBA 1YHAA 2PQEA 2B39A 1WCMH 1CKNA 5EAYA 2EVBA 3A54A 3OOCA 4R4IA 1S72A 2E2DC 2F0HA 3OWEB 2ID0A 1MSHA 3U9SA 5I2YA 2FMCA 4ZQ3A 2F52A 5ELCA 4HJ7A 2K04A 4UP8A 2K5QA 5EBCA 1K8GA 2K7VA 4PZ7A 2B8FA 4P71A 4FF3A 3I55A 1FGBD 4A3GB 5CR3A 3J7A5 5BN3A 1FJGQ 4GKJQ 2A6EC 5E3FA 2JJQA 3GTMH 3EFXD 1BNZA 1CHPD 3LWUA 3TEHB 5KYIA 1LO5D 2K05A 1SNCA 4UP7A 2EZVA 2CW0D 2GVBA 3BZCA 5CMDA 2DJGC 1LLRD 1ILPA 2B3GA 2R92B 1G291 4I7AA 1B2TA 1TQOA 2XRQD 4EQPA 5HGQA 4H13C 3A8KE 3F2BA 4NB3A 2OEOA 4HEDA 1PYBA 2EJFC 3AFPA 1OTCA 2R93G 4BY7H 3A7AB 4JI0Q 2NVQH 1PRTB 2NN6H 4FVMA 5LMNQ 3SE0A 4DAPA 1JB3A 1X56A 3TS2A 2FJ2A 1SYGA 3IAYA 4IPDA 5IGGA 1RHPA 1UEAB 1A8VA 1N8RC 3OPOA 5KNCA 1CFMA 2Y0SG 3KF8A 3H0GB 4K0KQ 3FHWA 1I94L 3S24A 1V1QA 4DV2Q 1II3A 3O13A 2ZXRA 4ABNA 4JI2L 2JA6B 1WTPA 4DR6Q 4L5TA 5LL6X 4DUYL 1B3AA 4DR7L 4NXNQ 1ENCA 1B70B 1PXUA 4JYAL 4ULLA 4UHVA 1PTOC 2ALYB 3TZDA 3HOXG 2PZTA 2DN8A 3T1YL 4KTAA 5IYBH 1PFBA 1UUPA 4IJHA 3A0JA 1GUGA 2E2IB 1ESRA 1EIGA 3K5NA 1SEBD 3CP0A 2D0OA 3RNUA 1BXTA 1MJEA 4X65L 2K50A 1J6QA 3EQLC 1IYVA 1HFNA 2B2WA 2LFNA 1LT4D 4DV3Q 4JBKA 1WTOA 3TP7A 1SN8A 4K5XA 5A2QL 4HCEA 4C2MB 4RCOA 4HSVA 1CK1A 4B9WA 4YHHQ 1SE2A 1SE4A 4RFBA 4B3MQ 1BCPC 2E75C 3SDZA 2FMMA 1NR2A 4JW0A 1PH3A 1H9SA 2F0VA 2R93B 2RA4A 4A3GH 1GO3E 3PV0A 1L2FA 1D2BA 1GOZA 1RTOA 2F0LA 3I56A 3Q22A 1PYWD 3CCRA 1E1OA 5DLQE 5IWAQ 1PH5A 1X3GA 3FDTA 4RAUC 2UUCL 3MC0B 4FNFA 1X3QA 2Y0SB 1HH2P 1ML0D 1U4PA 2ZXPA 4GKJL 2ICEC 1PH4A 1STEA 4C1NK 2JA5G 2F4VQ 4OL7A 4K2LA 3QOLA 4R9WA 2EIFA 1B7YB 2EYPA 1F9SA 1PTOH 1XYIA 3ER0A 2VQFQ 1GUSA 2JK8A 4N8X1 1Q8IA 1MIUA 3HOXB 4GN5A 3S1MH 4A3BH 4JI0L 3ULLA 2OQ0A 4NXMQ 2I46A 3ND8A 5LMNL 4A4IA 3H0GH 4C56C 4DGZA 5DEHA 1EOTA 1F2MA 4FXDA 1R4QB 1D5MC 1RD9D 3K0YA 3D0FA 1BVSA 2EYJA 3TBIB 3R3OA 2JA6H 5ELOA 4IUVA 5FLMH 5LL6S 4DV2L 3V96A 1HQRD 4MZ9A 1Q1EA 2PZUA 2K32A 4EQ5A 1EQTA 1PA6A 1NTGA 4DR6L 4ILWA 2F0IA 1S5FD 4NXNL 3UDGA 1E1TA 2E2IH 1J9OA 2UUAQ 1AZQA 1DD2A 4KI0A 2KCCA 3STBC 1TKWB 3CCQA 3M85A 4YWLA 2NTTA 4A3EG 1DGSA 4KD3A 4IUUA 4EVOA 3K57A 1QWYA 5C4XG 3DEPA 2JA5B 2EXDA 2P5ZX 1MHWC 2R3ZA 4DV3L 1XMOQ 2FXQA 1AEXA 3V2TA 5E4WC 3J81E 4JBJA 2L5TA 3VYRA 5J39A 1PDQA 3NK9A 4OWXB 1SE8A 2MGSA 4K14A 4H44C 4TSSA 1AFPA 2EPBA 2NBFA 1NY4A 4B3ML 1XPUA 4C3HH 1JJGA 4GLVB 1DZ1A 4ZUJA 1KLUD 2LS01 3GV3A 4DV5Q 4HIOA 4A3FG 4GNXB 2B2UC 2JA8G 3HGBA 3L0OA 3GTLH 4XQJA 3BDLA 2O2LD 1H9KA 5IWAL 3G6EA 1LUZA 1B9MA 1VQIA 3MZ5A 2KA7A 5EBDA 1CTMA 2PZWA 2VB2X 1QCBD 2EY6A 1L1OC 4YCWA 5C0XG 2M2LA 2YYZA 5KEEA 2G5DA 5CV5A 5C4HA 3NSWA 4BA1I 4G4KA 2F4VL 2QEJC 1CSPA 5IP7G 2DJFC 5ELNA 1YEZA 1HA6A 3HOXH 1I6HB 3E0JA 2PPBC 4DXGA 2VQFL 1BCPD 1TXYA 4QCLA 3PIPA 4HJ9A 4DK1A 4A3DG 1WJJA 1G8ZD 4RGTA 5LHY1 4A93G 4NXML 4CJ1B 1VQ4A 1V9PA 1EOVA 3EN2A 1M8AA 2SOBA 3I70A 4L6TB 2EYFA 2N49A 4IFDG 1O7YA 1VQ8A 5CV9A 3TDQA 5C4XB 3PF4A 4J8QA 1TU2B 1QB5D 4PQXA 4FF4A 3PUZA 1EYAA 5D3IB 3T56B 2JEAI 4KD4A 4IUTA 1WTRA 4OO1I 4JI5Q 1ONLA 3D8GA 4X3SA 2BE5D 4JOIA 1TY2A 3J80L 1H9JA 3C46A 2A6HD 4R8IA 3NPPA 1CM9A 1T5XD 4DKAC 4QB4A 1CKNB 2UUAL 2DNCA 1DONA 2JA8B 1P16A 3URYA 5M3FG 1WI5A 2ICIA 1NMFA 4KKUA 2CQOA 4MN3A 1ZYRD 4JI6Q 4GZYC 4DR4Q 3M4OH 1G6ZA 1EYGA 3K80C 5JVG3 4L5RC 3E9IA 3T1HQ 3S2HB 2A1AA 4LFBQ 4CJ0B 1CUKA 3HOYB 3GTGH 1X6OA 2BDNA 1XMOL 3VR5A 5GAGC 4DK3C 1UE7A 2AWOA 3CCSA 2NUCA 4EGVA 2MJ8A 3S1NB 1E2ZA 4R4QA 1CT1D 4UY8C 4GN3B 3EA6A 5EKLA 4YWMA 2HT1A 1F2ZA 1QUQB 2QDLA 1HR0Q 1EIYB 4A3DB 1EUJA 3OW7A 4L8JA 1H95A 2UU9L 2HCIA 1O7LA 3HS0C 4A93B 2RCNA 1STYA 1U5KA 5GADC 1D7QA 4JV5Q 2K01A 1IW7C 3TREA 4IUPA 3DWPA 2HHHQ 3QWNA 1L0XB 4KY7A 2A69D 4IPGA 1K8OA 4V0BA 2PQAA 3CQZB 3RUZA 3NELA 3D4RA 4HTHA 1KHIA 3E6ZX 4HJ8A 1U4LA 2MO1A 2K03A 2EJGC 4KJOA 4GLXA 2ZXOA 4HMIA 3A8IE 1D5ZC 4OONA 1EY7A 3IKJA 4PZ8A 1W6KA 1SMYD 1HTLD 1ZKOA 2DY8A 4IOAA 4IUQA 1KL9A 4IZ8A 2VQEQ 2X6LA 3BVGA 2ZTDA 4O0AA 1K28A 3CC4A 1XTDA 2VXWA 2XWBB 5M3FB 1JC7A 1F77A 2NVXB 1SNPA 4K2KA 1Y14B 2AQ3B 1SFOH 4P74A 2NN6G 3VYUA 1AN8A 2JSOA 5CYUA 1SAPA 1A63A 2CW0C 2F0WA 4JI4Q 4H02A 3WDNA 3J7YW 4DAVA 4F88A 4JI5L 1JJCB 1FNWA 2JA8H 4NDXA 2BCOA 5LMUQ 2JA7G 2X6GA 2B2UA 2E2JB 2ZM6Q 4RKBA 3G4SA 5EPLA 4JI8L 1BCPF 1WTVA 4JK1C 3OIPA 3OMCA 3BZDB 3SR1A 4DK6C 4B3SL 2GA4B 1L1OA 4FXGC 3S2HH 1A15A 1GUWA 2JYOA 3CPFA 1F2LA 1KDBA 2F1MA 3FVQA 3KJOA 1KTKA 3FPUB 1Z47A 3S9WA 2Y0SE 1KQSA 4JI6L 5IYDG 1D5XC 2J7ZA 4DR4L 2N3SA 2Q2UA 2ZJRA 3ZJYC 1HHVA 1I4PA 4NKLA 3RZOH 1FR3A 1PLFA 3T1HL 2KEEA 4BA2I 2CWAA 5I6WA 3GD7A 5IYBG 1HZ9A 3S1RB 4A3DH 1A3UA 2Z4HA 4IPHA 2ZT9C 4A93H 4A3LG 2KCMA 1CSQA 1YNXA 5K5PA 2RDFA 3ZYYX 1VQ6A 1H9RA 3CU7A 5BN4A 4EX5A 4GNXA 1HR0L 4IFDH 4YCVA 1Q1BA 5FO7B 3M7NA 3OMGA 2A74C 2N78A 2K5DA 3I90A 1IBMQ 4L5QA 3CQZH 3NHHA 1LTLA 2K5VA 5KYLA 4JV5L 3OWFA 2A73B 4HR7B 1E0BA 2H4OA 2HHHL 3UDFA 4RA8A 3WOEA 4TKOB 3KLSA 2EYHA 2HQLA 4FXKC 3HZXA 3SK6A 5IT9c 4WJ3M 4KKTA 1PHJA 1XXGA 1X54A 2HIVA 1KIXA 1BR9A 1XPOA 1STGA 3TQYA 3ERSX 1B1ZA 4JC0A 1YITA 5G3LD 3Q8DA 5M3FH 2JA7B 5AFWA 2HDMA 4XQQA 4YWKA 3TSSA 3GV6A 2NVXH 3CCLA 3F2UA 3CCMA 4CJ2C 2VQEL 1L0YB 1I6VC 5GROA 5F2DA 3QIAA 1S3OA 3W1GA 1IHZA 1TS4A 3T13A 2LY7A 2F0QA 2DNEA 4HN7A 2VNUD 1A2UA 4DNTB 2Q8TA 4X66Q 3IRBA 3OIQA 2QW7A 2KVMA 5EQ0A 5C0XJ 5JOBA 1PVOA 1E2VA 4X65Q 1VDZA 4A3BG 1W2BA 1M90C 2WACA 1LTSD 3G71A 1QZHA 3DXJC 3H0GG 4MHEA 4JI4L 3GTKH 1V1PB 2E2JH 3HKZG 5JPNC 1SNOA 3R93A 4RHRA 2KOLA 1X9NA 5LMUL 1TS2A 1EFWA 2JA6G 5EKKA 1B53A 2ZM6L 3P1HA 5FLMG 5FKAC 1TIID 4AIMA 5FJ8G 1Y69U 4RWSC 2XN9C 4CDEC 4IFDJ 2RKSA 3U4ZA 1B44D 3KDFB 5M3MH 1DOLA 3A56A 2UUCQ 1PH1A 5FO8B 3Q0AA 3S1RH 4ALPA 1DCZA 2XRSD 4GLAC 2QEXA 3GTPB 4J15A 4CKEA 1K83B 1SDFA 4GN4B 4PMWA 1JWSD 4UP9A 3AMUA 1Y1WH 1QUQA 1X3PA 3CMEA 2QGQA 2EOTA 2ENBA 1YJWA 2PI2A 4RHSA 1VCIA 1HJPA 3W5OA 3HKSA 4DK0A 1GKHA 1S5CD 4LK1C 3K81C 5A35A 3TZUA 4C3IH 1PTOB 3KJPA 4L5SA 1IBML 4S3SA 1RCVD 2R7FA 1LTGD 4HSPA 2QF7A 4LW1A 1S5DD 4C3HG 5GAEC 3GTJB 3S1MB 2XIWA 3MXPA 4A3BB 4Y7NB 1AW7A 1B3QA 5ELEA 2JA7H 4RGOS 3HKZB 4RCNA 1JWMD 1EY4A 4BBSH 1BCPB 3PF5A 1CA5A 3MVVA 2L0CA 5IT9E 3I3CA 1C8CA 5IYDH 4M8AA 4UPAA 5DM73 3TMEA 2L9HA 2KENA 3CCJA 1DOKA 1DYQA 1XWEA 3BDCA 1GXDC 2Z8LA 1M1KC 4CKCA 3J81c 3FEWX 4X66L 5EKIA 1A3TA 4WFN3 3TRZA 1S5ED 1QVGA 1C0AA 1HZBA 1YZ6A 2F3WA 1PFMA 4A3LH 3C2PA 1K9MC 2O5IC 3HG9A 1YHQA 5HY6A 1CHQD 5C4ZA 3M7GA 2HDLA 3MEFA 4OXPA 1RIPA 3G7LA 4XYOA 5G3LF 3CAMA 3NQIA 4JBWA 4RGNA 1Y8OB 3SK4A 3D31A 2I0QA 3MXGA 4LF4Q 1BBUA 1VQJA 2F0UA 2WFWA 3ULJA 2F0NA 1NE3A 3D4WA 2CQAA 1WYDA 3PIO3 4P73A 3KUPA 3PUWA 3GTPH 2MNAA 1K83H 2FFKB 2LSSA 3VR4A 1UEBA 4C3HB 4DR1L 2B29A 4LFAQ 2IHFA 4KKSA 2RDGA 1MGSA 4FO2A 3NP8A 5D14A 3W3AA 3GTLB 1SJED 3VR2A 3K5OA 5M5WB 3PQIA 1SLJA 3AQQA 2EYLA 4JI7Q 3CD6A 2PQAB 2QILA 1TWFB 5E4XA 2BE5C 3QR8A 1WVLA 2A6HC 4R4OA 5AJ3Q 5KIXA 1SNMA 3S14H 1YHBA 1VQ5A 1ET9A 1VMCA 2VW9A 2AHOB 3GQBA 4DN4M 1E24A 4A3CG 4BXXH 2KCTA 1VQKA 2IX3A 3GTJH 4A3KH 1QNKA 2XVSA 1KNAA 4Y7NH 1ZYRC 4G7HC 1DJRD 1O80A 5J22A 1UE5A 5FLXc 3KBGA 1I4HA 4ZRZA 2UXCQ 1YIJA 4E6IA 1MKHA 1G51A 3BVZA 1JICA 3VYTA 4F87A 5FJ8H 1I4QA 1OXXK 4CDFC 4A3IH 1NCVA 4DV0Q 1ILQA 1JOKA 4H0LC 1I4GA 2NVTB 3BYYB 2N88A 4DAYB 2L12A 4FP5D 1X3EA 4RKLA 2Z6KC 1WD0A 2WIIB 3CCUA 1BUVT 3CW2C 5C0XI 4P2CB 3HOWH 2A69C 1N33Q 3W2DA 1L1OB 4APVA 4RGMA 1R9TB 2ZTCA 2GN5A 3RZDB 1V1PA 4R1JA 1SBBB 2RSOA 1NUCA 1T5EA 4LUZA 1L0WA 1RDPD 3M4OB 3ITPA 1HA5A 2R7DA 2ZJPA 1B9NA 4JVZA 1KNEA 2CFMA 1DXMA 1U0LA 1VQFA 1VQHA 1SMYC 2QCPX 1QG7A 2F3IA 2BA1A 2R61A 1LTID 3X3MA 3NWSA 3VA5A 5IP9G 2Q2TA 1TWHH 3GTGB 1ASYA 1E7ZA 1JE4A 1YNJD 1HNZQ 2KHJA 4LF4L 1V8QA 2D0PA 3PUVA 3MXUA 4Q5VA 2UU9Q 4IFDI 3S15H 4IPCA 3KDFA 2JQOA 5JEAH 3JAMc 2B2VC 1QNUA 2B2TC 2UXDL 1PZID 1BBWA 5M5WH 3DEOA 4LF9Q 2K6AA 4LFAL 1K0RA 1TWFH 2IY5B 3KLWA 1CA6A 4F7XA 3T4AC 1PH9A 4C3JG 2IT1A 4TVAB 3KK7A 4LNQA 3HOYH 2WV6D 4JI7L 1Q12A 3SXHA 3HOYG 3FP9A 4N9TA 2OCEA 5ELDA 1TWCB 2H1EA 1JCKB 3P20A 3OYYA 1LYLA 3SK5A 1Q7YC 5AJ3L 4DR5Q 3F8TA 2YV5A 2OTLA 5E7NA 5C5MA 2R7ZH 2F0MA 1EY5A 4HIKA 4KY5A 2F0KA 2K75A 4OEMB 3DM1A 3H94A 4LJZC 4AQYQ 1A0IA 5EPJA 4V190 5H1SE 1N9WA 1WTQA 1YBYA 2Z4IA 1G91A 5IGFA 3NUCA 1PH8A 4JI1Q 3DHQA 2G9HD 2UXCL 2OTJA 2Z9HA 3KF6B 1XJVA 4M1UB 4ME3A 2KHIA 2NVTH 5GQOA 3I72A 1SFOB 1JOQA 4Y52H 1ENFA 1MI2A 5FLXE 3J81L 2RCFA 4DV0L 1B4OA 3VDYA 2K5WA 3WWVA 4YCUA 1Z9FA 1HUMA 4JI8Q 1Q3LA 1EU4A 1Q86C 1RODA 3MA2B 1VMPA 4K8IA 1LV9A 3HRZC 1E3PA 4CHTB 1R9TH 1NMGA 4B3SQ 1A3VA 1D6EC 2VZAA 5BN5A 3RZDH 4AYBG 2NZHA 2IW3A 2QA4A 1N36L 1HPCA 2KECA 1N33L 1KAAA 2NZOA 2K52A 1AZPA 2TMPA 3L9AX 3H3VC 2N55A 2SNMA 1UAPA 2L4NA 3RR5A 4C3JB 4PV1C 4A3MG 2TSSA 5M5YB 1YJNA 4MTNA 3TP6A 4QGUA 4A3CH 5JJKA 2CH4W 1LM0A 3KLSX 4OX9Q 1GUOA 1BQQT 3RZOB 4XQNA 4R4TA 1Y1VG 3UDXA 3A5ZB 1WTWA 2CKZB 1HNZL 4ZYSA 1FVIA 1LTTD 3ND9A 1PH2A 3VR6A 1KRSA 1F9QA 3N52A 4FF1A 4NMZA 4P72A 2NN6I 3ULPA 1F2YA 3WOFA 4GKKL 5FK9C 1ESFA 2FHTA 4DNIA 1JE5A 5M5XB 4LF9L 1UNSA 4IO9A 4DV4Q 3EBEA 1BOSA 2AMCB 2RQXA 4RH6A 3K5MA 2YU9H 4KHVA 1TWCH 3HKZE 1IL2A 2IPKD 3FKIG 1V1OA 4QIWE 1FNVA 3JAME 2CHBD 4IUNA 3C1FA 4ID6A 1A6XA 3UDIA 5M3MG 3L2PA 1OXUA 5TSSA 2Z6KA 3S17B 4XXEA 4FF2A 4QY7A 4DR5L 1EY9A 2UXBQ 2K5HA 1MSGA 4MTKA 4HIDA 1Y1WG 2WB1B 1K3BC 1DM0B 3GDEA 3PUYA 3H3VH 1RTNA 2SDFA 2F3VA 2ZJQA 4AYBB 4AQYL 5IGDA 1Q82C 4QMGA 1TWGB 4JI1L 3GO5A 4C3IG 1TY0A 4A3MB 2BDOA 3R8BA 5CBEE 5IP9H 2K14A 2K5NA 1IYUA 1Q46A 1LT3D 1EFID 1SYEA 3CCEA 2CH4A 4HJAA 4BWGB 4QF4A 3MFYA 1FGUA 1PV4A 1Y1VB 1MBYA 2L1BA 3N6RA 4DAYA 2KEDA 2F0PA 1ICFB
chains in the Genus database with same CATH topology
3M9BA 1XPRA 4LF6L 4IFDJ 2JA5G 2F4VQ 2C35B 1UE6A 1TWAH 4RG1A 1BKBA 3U4ZA 2WP8J 2EIFA 3KDFB 2WAQE 5M3MH 1B7YB 2UUCQ 1PH1A 1SRUA 3S1RH 4ALPA 3GTQH 1VQBA 1EQQA 4GLAC 2QEXA 2E8GA 4GNXC 2H5XA 3J81i 3ER0A 4C3JH 2YTXA 4J15A 3I4MH 1VQEA 4GN4B 4PMWA 4BBSG 3M4PA 4UP9A 4HJ5A 1IZ6A 1Y1WH 4X64Q 3NEMA 5M5YH 2VQFQ 3RLNA 1KD1C 1ASZA 2JK8A 1VQLA 1QUQA 3CPWA 1MIUA 4GN5A 4DAMA 3CMEA 2QGQA 3S1MH 2XGTA 1K73C 2WB1G 3ULLA 2OQ0A 1KC8C 4JI0L 4NXMQ 4A3BH 5LMNL 3J81j 4A4IA 3H0GH 1YJWA 3CF5A 4X62Q 2PI2A 5IYCG 2ZTEA 1VCIA 1HJPA 3K8AA 3HKSA 3W5OA 1GKHA 1NJIC 5C44G 3K81C 2A19A 4C3IH 3D0FA 3KJPA 1K8AC 4BY1G 4OX9L 5JEAJ 4L5SA 1VQDA 1IBML 1BVSA 1EQRA 2JA6H 3BJUA 2R7FA 1XMQQ 5ELOA 5IE8A 4KHZA 3L7ZC 5FLMH 4LW1A 1VQAA 4A3JG 5GAHC 4DV2L 5GAEC 1N32Q 4MZ9A 1I3QH 5M5XH 2UUBQ 1Q1EA 4BBRG 4AH6A 4TQUS 2JA5H 4EQ5A 2JA7H 1PA6A 1NTGA 4DR6L 4NXNL 3UDGA 1E1TA 2I5HA 2E2IH 2UUAQ 3OTOQ 2XTIA 1UE1A 4DV4L 2JEBI 4KI0A 4B3RQ 3STBC 4BBSH 3PF5A 3CCQA 3S17H 3M85A 1IYJB 4YWLA 1GM5A 1PYSB 2B63G 4A3EG 5IYDH 1HNWL 4LFCL 1DGSA 5LMNW 4LUVA 4UPAA 2IX1A 5C4XG 1O7IA 2KENA 3CCJA 2EXDA 3KYHC 1SR3A 1WFQA 5IYCH 1YVCA 4DV3L 1M1KC 1XMOQ 3J81c 2FXQA 3CCVA 1X55A 4GOPB 4X66L 2N8NA 2UXBL 2IX0A 3GTOH 4OO1G 3F2CA 3TRZA 4JBJA 1TWGH 1WCMG 2E5LL 4DV5L 1QVGA 4OWXB 4LF5Q 1C0AA 1HZBA 1SE8A 1GD7A 1YZ6A 1YI2A 1QZGA 4A3LH 1K9MC 4A3MH 1N34Q 3U4VA 1YHQA 1NY4A 4B3ML 4JBMA 1XPUA 3STBD 1SROA 5HY6A 4DUZQ 4WJ4A 4C3HH 1JJGA 4GLVB 1J5EL 5BR8L 3KF6A 3MEFA 5C3EG 4OXPA 3S1QH 1RIPA 3HOZG 1IBKQ 4BXXG 1OXTA 4DV5Q 1RL2A 1JMCA 2MQHA 4HIOA 4A3FG 4GNXB 1Y1VH 2VUMG 2JA8G 3CAMA 4JBWA 4A3KG 1I6HH 3L0OA 3GTLH 2RF4A 2RHSB 1AE2A 3D31A 2I0QA 5C4JH 2I5LX 2BH8A 4PG3A 2PMZE 3KF8B 5IWAL 3M4QA 1K3RA 4FDBA 1BBUA 1LUZA 1VQIA 2GVAA 1VS0A 1J5EQ 1XNQQ 1VQJA 1L1OC 2WFWA 4YCWA 2LXJA 3ULJA 5C0XG 4QQBX 1OXVA 2YYZA 1NE3A 3SGIA 1OXSC 3PUXA 1IBLQ 1WYDA 3AFQA 4BA1I 4P73A 3PUWA 2F4VL 2MNAA 3GTPH 4A3EH 3I4NH 1K83H 3F1ZA 2LSSA 3LGJA 1UEBA 1CSPA 4DR1L 4DR3Q 2B29A 4OWWB 2YTVA 4LFAQ 5IP7G 3CC2A 2IHFA 5ELNA 5C4XH 3CXCA 4GOPC 1YEZA 3I4OA 3A5UA 3HOXH 4A3IG 4JI3Q 2RHQB 3OW2A 3JC66 3FKIH 4DV1Q 1JB7A 2E2HH 1SLJA 3AQQA 4JI7Q 4HIMA 3CD6A 2PQAB 4X64L 4DR1Q 2VQFL 1TXYA 3PIPA 4HJ9A 4A3DG 4DPGA 1WJJA 2OQKA 1UWVA 4BY7G 4R4OA 4A93G 4NXML 3CC7A 2D62A 3HFZB 5AJ3Q 1VQ4A 1V9PA 1EOVA 1YHBA 1VQ5A 4QL5A 3S14H 3EN2A 4X62L 2AHOB 1C9OA 2VW9A 3NENA 2N49A 2ES2A 3HOWG 4IFDG 1E24A 1VQ8A 4BXXH 1I50H 2KCTA 4A3CG 4A3FH 1VQKA 4RMFA 1XNRQ 2EQSA 3GTJH 4A3KH 3PF4A 1AH9A 1B8AA 4Y7NH 3PSIA 1XMQL 2L15A 3HOVH 3PUZA 1UE5A 1KRTA 2JEAI 2JA9A 4POFA 5FLXc 3DLLA 4OO1I 3MXNB 3DM3A 1WOCA 3UE0A 3JAMi 1YIJA 2UUBL 4JI5Q 1N32L 1MKHA 2UXCQ 1G51A 4JOIA 4A76A 1HZAA 2WAQG 1VQPA 3J80i 4P75A 1VQ7A 1X3FA 3CMAA 3E0EA 4XTCS 4DKAC 5IP7H 1CKNB 4QJFA 1GVPA 4IOCA 3TS0A 5FJ8H 1OXXK 4R4CA 2UUAL 3F2DA 4B3TQ 3OTOL 4A3IH 1P16A 3ICEA 3S1NH 4DR2Q 1EWIA 5M3FG 1WI5A 4DV0Q 4LFBL 1NBWA 3HOUG 1NMFA 4B3RL 2CQOA 5JEAG 4XIGS 4NPSA 4JI6Q 4DAYB 4DR4Q 3M4OH 1X3EA 1EYGA 2Z0SA 3U50C 1KAWA 2Z6KC 3K80C 1VQ9A 4L5RC 3CCUA 4GS3A 3E9IA 3T1HQ 3CW2C 5C0XI 2A1AA 4LFBQ 1I5FA 4JG2A 1CUKA 3GTGH 1X6OA 1QVCA 3HOWH 1XMOL 1N33Q 3H15A 5GAGC 4DK3C 1UE7A 1X65A 2AWOA 3CCSA 1L1OB 1Q8KA 4APVA 1MJCA 1JJ2A 4LF5L 2VY3A 2ZTCA 3AYHB 2GN5A 4R4QA 4UY8C 4GN3B 4YWMA 2HT1A 4R1JA 3PO2G 4LUOA 1QUQB 1N34L 3M3YH 4LUZA 4X6AH 2KBNA 1L0WA 3NBHB 1HR0Q 4DUZL 4O2DA 1EIYB 3PO3G 1EUJA 1H95A 5C44H 2R7DA 2UU9L 2ZJPA 2R7ZG 3KFUA 4A3GG 5JJLA 1IBKL 2RCNA 4BY1H 3PCOB 4POGA 1U5KA 1U0LA 1VQHA 1VQFA 2CFMA 2HIXA 1VQCA 3KOJA 2F3IA 4A75A 2BA1A 1Q81C 5GADC 3BU2A 3G48A 2Q2TA 5IP9G 1I94Q 1AE3A 1D7QA 1TWHH 4JV5Q 1ASYA 4DV6Q 2R6GA 4A3JH 1E7ZA 3TREA 1HNZQ 2KHJA 2HHHQ 3PUVA 2D0PA 2OWOA 4LF4L 4IPGA 1C7YA 1XNQL 2UU9Q 3W1BA 4IFDI 4JI2Q 4BBRH 2PQAA 3S15H 4LF8Q 4IPCA 3HOUH 3KDFA 3NELA 2JQOA 3JAMc 2R92G 1IBLL 4DUYQ 1KHIA 4DR7Q 2UXDL 1BBWA 5M5WH 3K0XA 4DR3L 3J80c 4JYAQ 4HJ8A 4LF9Q 2MO1A 2CWPA 4LFAL 2PI2E 4GLXA 1K0RA 1TWFH 3I2ZA 2IY5B 4OONA 3KLWA 1FL0A 4JCVE 4JI3L 4PZ8A 4IJLA 3T1YQ 2YTYA 1PH9A 2IT1A 4TVAB 3I4MG 4LNQA 3S16H 4DV7Q 4DV1L 4JI7L 4IOAA 1Q12A 1KL9A 2VQEQ 2B63H 2UXDQ 4O0AA 4YY3Q 2ZTDA 3HOYG 2Q2HA 3FP9A 3CC4A 1XTDA 4KLKA 3RN5A 1JT8A 2OCEA 1HNXQ 2CCZA 3OYYA 1LYLA 1Q7YC 5AJ3L 4DR5Q 3F8TA 2YV5A 1S40A 3PO3H 2OTLA 5E7NA 4LF7Q 1YHAA 1CKMA 1Y14B 2R7ZH 1CKOA 4JOIC 1SFOH 1WCMH 4HIKA 1PH7A 2K75A 1CKNA 5EAYA 1XNRL 4P74A 4R4IA 1S72A 4AQYQ 1VQGA 1A0IA 2ID0A 2NN6G 5H1SE 1N9WA 1D8LA 1YBYA 2VL6A 2A8VA 1A63A 2WB1E 2AWNA 2K4KA 4JI4Q 4LF4Q 2F52A 2Q2IA 4HJ7A 2NVYH 1PH8A 5C3EH 4UP8A 4H02A 3HOZH 4JI1Q 1P8LA 1KXLA 1FJGL 4AYBE 4JI5L 1K8GA 1JJCB 2VUMH 2UXCL 2MFIA 4LWCA 4PZ7A 2JA8H 2R92H 3H3VI 2OTJA 1IXRA 1EIFA 3KF6B 4P71A 2BA0A 5LMUQ 2JA7G 2DGYA 1XJVA 2I5MX 3I55A 4ME3A 2KHIA 2ZM6Q 3G4SA 5GQOA 2NVTH 4JI8L 3J7A5 4Y52H 4B3TL 4KHPQ 4DK6C 1FJGQ 4GKJQ 2JJQA 4B3SL 2DUDA 4DR2L 3GTMH 4DV0L 1L1OA 4LF6Q 3VDYA 3S2HH 3WWVA 3TEHB 1PH6A 3CPFA 3KJOA 1KQSA 3HOYH 4JI6L 1Z47A 2Y0SE 3PIOA 3E9HA 1Z9FA 4YCUA 4UP7A 4JI8Q 2MO0A 5IYDG 2GVBA 3U58A 2N3SA 3BZCA 2Q2UA 4DR4L 2ZJRA 1SMXA 1Q86C 3ZJYC 2B3GA 1G291 3RZOH 4GOPA 1E3PA 4B3SQ 2ASBA 1R9TH 1NMGA 3T1HL 4BA2I 2VZAA 3RZDH 2CWAA 4AYBG 2NZHA 3GD7A 3UE1A 5HGQA 5IYBG 3G6EA 2QA4A 1N36L 3F2BA 1HZ9A 4NB3A 1N33L 2NZOA 2K52A 4A3DH 1PYBA 3AFPA 4IPHA 3B6YA 1OTCA 2R93G 4BY7H 4JI0Q 2NVQH 3RR5A 4A93H 4OWTB 2ATWA 5LMNQ 4K0KL 4A3LG 2KCMA 1CSQA 1YNXA 4A3MG 1X56A 4PZ6A 3S2DH 1VQ6A 5JJIA 1YJNA 3TS2A 4MTNA 4GNXA 4QGUA 4EX5A 1N36Q 1HR0L 4YCVA 1Q1BA 4IPDA 3M7NA 4A3CH 5JJKA 3J7ZC 1LM0A 2N78A 1A8VA 4OX9Q 1N8RC 2PNHA 1IBMQ 4L5QA 2Y0SG 1Y1VG 3CQZH 4R4TA 1LTLA 4K0KQ 2K5VA 3FHWA 1T9HA 3UDXA 5K36G 3A5ZB 1I94L 4MNOA 4JV5L 3S24A 3BZKA 4DV6L 2CKZB 1V1QA 2IHEA 4DV2Q 1HNZL 2HHHL 3UDFA 1FVIA 2V1CC 1PH2A 3RLOA 4JI2L 1KRSA 4LF8L 2HQLA 5IT9c 4DR6Q 4WJ3M 4L5TA 4P72A 4DUYL 1PHJA 2NN6I 4DR7L 4NXNQ 3ULPA 3I4NG 4GKKL 1X54A 2HIVA 3EIVA 1B70B 1KIXA 1G6PA 1XPOA 4DNIA 4JYAL 1JE5A 3TQYA 4LF9L 4C2MH 3ERSX 1VQOA 4JC0A 4DV4Q 4IO9A 1YITA 1W3SA 3EBEA 1PFSA 2AMCB 2ALYB 3Q8DA 3HOXG 5M3FH 2YU9H 2NVXH 1TWCH 4YWKA 2BH2A 3T1YL 3HKZE 1IL2A 3FKIG 5IYBH 1QVFA 3CCLA 4QIWE 4IJHA 3A0JA 4DV7L 4GKKQ 3CCMA 1HNWQ 2VQEL 4LFCQ 4YY3L 3CP0A 5GROA 3UDIA 2D0OA 5M3MG 2R93H 3L2PA 3I7FA 3A74A 3RNUA 5IY0A 3RN2A 1MJEA 4X65L 1OXUA 2K50A 1S3OA 4YHHL 1HNXL 1HR0W 3W1GA 1J6QA 2Z6KA 4QY7A 2VNUD 4DR5L 4DV3Q 4JBKA 2UXBQ 1SN8A 2K5HA 4X66Q 4LF7L 1V43A 3IRBA 5C0XJ 4HIDA 1Y1WG 3RLFA 3GDEA 3PUYA 3K7AH 2E5LQ 3H3VH 1PVOA 4X65Q 4YHHQ 3PO2H 2JE6I 2ZJQA 2VS1A 4AQYL 4A3BG 1W2BA 1M90C 4B3MQ 3G71A 1QZHA 3HOVG 3H0GG 1Q82C 4JI4L 5BR8Q 1PH3A 1VQNA 2E2JH 3GTKH 4A3GH 3HKZG 1YJ9A 4JI1L 1GO3E 1HZCA 3PV0A 1L2FA 2AKWB 2LXKA 3AEVA 3GO5A 3PGZA 1X9NA 1A62A 3I56A 5J3BA 1E22A 5LMUL 5IP9H 1EFWA 2K14A 1E1OA 3CCRA 2K5NA 2JA6G 5DLQE 1Q46A 5IWAQ 2ZM6L 1PH5A 1X3GA 3K7UC 5FLMG 3CCEA 4HJAA 4AIMA 2UUCL 5FJ8G 1PV4A 1FGUA 4KHPL 1HH2P 1VQMA 4GKJL 1PH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  1XPR A;  4LF6 L;  4IFD J;  2JA5 G;  2F4V Q;  2C35 B;  1UE6 A;  1TWA H;  4RG1 A;  1BKB A;  3U4Z A;  2WP8 J;  2EIF A;  3KDF B;  2WAQ E;  5M3M H;  1B7Y B;  2UUC Q;  1PH1 A;  1SRU A;  3S1R H;  4ALP A;  3GTQ H;  1VQB A;  1EQQ A;  4GLA C;  2QEX A;  2E8G A;  4GNX C;  2H5X A;  3J81 i;  3ER0 A;  4C3J H;  2YTX A;  4J15 A;  3I4M H;  1VQE A;  4GN4 B;  4PMW A;  4BBS G;  3M4P A;  4UP9 A;  4HJ5 A;  1IZ6 A;  1Y1W H;  4X64 Q;  3NEM A;  5M5Y H;  2VQF Q;  3RLN A;  1KD1 C;  1ASZ A;  2JK8 A;  1VQL A;  1QUQ A;  3CPW A;  1MIU A;  4GN5 A;  4DAM A;  3CME A;  2QGQ A;  3S1M H;  2XGT A;  1K73 C;  2WB1 G;  3ULL A;  2OQ0 A;  1KC8 C;  4JI0 L;  4NXM Q;  4A3B H;  5LMN L;  3J81 j;  4A4I A;  3H0G H;  1YJW A;  3CF5 A;  4X62 Q;  2PI2 A;  5IYC G;  2ZTE A;  1VCI A;  1HJP A;  3K8A A;  3HKS A;  3W5O A;  1GKH A;  1NJI C;  5C44 G;  3K81 C;  2A19 A;  4C3I H;  3D0F A;  3KJP A;  1K8A C;  4BY1 G;  4OX9 L;  5JEA J;  4L5S A;  1VQD A;  1IBM L;  1BVS A;  1EQR A;  2JA6 H;  3BJU A;  2R7F A;  1XMQ Q;  5ELO A;  5IE8 A;  4KHZ A;  3L7Z C;  5FLM H;  4LW1 A;  1VQA A;  4A3J G;  5GAH C;  4DV2 L;  5GAE C;  1N32 Q;  4MZ9 A;  1I3Q H;  5M5X H;  2UUB Q;  1Q1E A;  4BBR G;  4AH6 A;  4TQU S;  2JA5 H;  4EQ5 A;  2JA7 H;  1PA6 A;  1NTG A;  4DR6 L;  4NXN L;  3UDG A;  1E1T A;  2I5H A;  2E2I H;  2UUA Q;  3OTO Q;  2XTI A;  1UE1 A;  4DV4 L;  2JEB I;  4KI0 A;  4B3R Q;  3STB C;  4BBS H;  3PF5 A;  3CCQ A;  3S17 H;  3M85 A;  1IYJ B;  4YWL A;  1GM5 A;  1PYS B;  2B63 G;  4A3E G;  5IYD H;  1HNW L;  4LFC L;  1DGS A;  5LMN W;  4LUV A;  4UPA A;  2IX1 A;  5C4X G;  1O7I A;  2KEN A;  3CCJ A;  2EXD A;  3KYH C;  1SR3 A;  1WFQ A;  5IYC H;  1YVC A;  4DV3 L;  1M1K C;  1XMO Q;  3J81 c;  2FXQ A;  3CCV A;  1X55 A;  4GOP B;  4X66 L;  2N8N A;  2UXB L;  2IX0 A;  3GTO H;  4OO1 G;  3F2C A;  3TRZ A;  4JBJ A;  1TWG H;  1WCM G;  2E5L L;  4DV5 L;  1QVG A;  4OWX B;  4LF5 Q;  1C0A A;  1HZB A;  1SE8 A;  1GD7 A;  1YZ6 A;  1YI2 A;  1QZG A;  4A3L H;  1K9M C;  4A3M H;  1N34 Q;  3U4V A;  1YHQ A;  1NY4 A;  4B3M L;  4JBM A;  1XPU A;  3STB D;  1SRO A;  5HY6 A;  4DUZ Q;  4WJ4 A;  4C3H H;  1JJG A;  4GLV B;  1J5E L;  5BR8 L;  3KF6 A;  3MEF A;  5C3E G;  4OXP A;  3S1Q H;  1RIP A;  3HOZ G;  1IBK Q;  4BXX G;  1OXT A;  4DV5 Q;  1RL2 A;  1JMC A;  2MQH A;  4HIO A;  4A3F G;  4GNX B;  1Y1V H;  2VUM G;  2JA8 G;  3CAM A;  4JBW A;  4A3K G;  1I6H H;  3L0O A;  3GTL H;  2RF4 A;  2RHS B;  1AE2 A;  3D31 A;  2I0Q A;  5C4J H;  2I5L X;  2BH8 A;  4PG3 A;  2PMZ E;  3KF8 B;  5IWA L;  3M4Q A;  1K3R A;  4FDB A;  1BBU A;  1LUZ A;  1VQI A;  2GVA A;  1VS0 A;  1J5E Q;  1XNQ Q;  1VQJ A;  1L1O C;  2WFW A;  4YCW A;  2LXJ A;  3ULJ A;  5C0X G;  4QQB X;  1OXV A;  2YYZ A;  1NE3 A;  3SGI A;  1OXS C;  3PUX A;  1IBL Q;  1WYD A;  3AFQ A;  4BA1 I;  4P73 A;  3PUW A;  2F4V L;  2MNA A;  3GTP H;  4A3E H;  3I4N H;  1K83 H;  3F1Z A;  2LSS A;  3LGJ A;  1UEB A;  1CSP A;  4DR1 L;  4DR3 Q;  2B29 A;  4OWW B;  2YTV A;  4LFA Q;  5IP7 G;  3CC2 A;  2IHF A;  5ELN A;  5C4X H;  3CXC A;  4GOP C;  1YEZ A;  3I4O A;  3A5U A;  3HOX H;  4A3I G;  4JI3 Q;  2RHQ B;  3OW2 A;  3JC6 6;  3FKI H;  4DV1 Q;  1JB7 A;  2E2H H;  1SLJ A;  3AQQ A;  4JI7 Q;  4HIM A;  3CD6 A;  2PQA B;  4X64 L;  4DR1 Q;  2VQF L;  1TXY A;  3PIP A;  4HJ9 A;  4A3D G;  4DPG A;  1WJJ A;  2OQK A;  1UWV A;  4BY7 G;  4R4O A;  4A93 G;  4NXM L;  3CC7 A;  2D62 A;  3HFZ B;  5AJ3 Q;  1VQ4 A;  1V9P A;  1EOV A;  1YHB A;  1VQ5 A;  4QL5 A;  3S14 H;  3EN2 A;  4X62 L;  2AHO B;  1C9O A;  2VW9 A;  3NEN A;  2N49 A;  2ES2 A;  3HOW G;  4IFD G;  1E24 A;  1VQ8 A;  4BXX H;  1I50 H;  2KCT A;  4A3C G;  4A3F H;  1VQK A;  4RMF A;  1XNR Q;  2EQS A;  3GTJ H;  4A3K H;  3PF4 A;  1AH9 A;  1B8A A;  4Y7N H;  3PSI A;  1XMQ L;  2L15 A;  3HOV H;  3PUZ A;  1UE5 A;  1KRT A;  2JEA I;  2JA9 A;  4POF A;  5FLX c;  3DLL A;  4OO1 I;  3MXN B;  3DM3 A;  1WOC A;  3UE0 A;  3JAM i;  1YIJ A;  2UUB L;  4JI5 Q;  1N32 L;  1MKH A;  2UXC Q;  1G51 A;  4JOI A;  4A76 A;  1HZA A;  2WAQ G;  1VQP A;  3J80 i;  4P75 A;  1VQ7 A;  1X3F A;  3CMA A;  3E0E A;  4XTC S;  4DKA C;  5IP7 H;  1CKN B;  4QJF A;  1GVP A;  4IOC A;  3TS0 A;  5FJ8 H;  1OXX K;  4R4C A;  2UUA L;  3F2D A;  4B3T Q;  3OTO L;  4A3I H;  1P16 A;  3ICE A;  3S1N H;  4DR2 Q;  1EWI A;  5M3F G;  1WI5 A;  4DV0 Q;  4LFB L;  1NBW A;  3HOU G;  1NMF A;  4B3R L;  2CQO A;  5JEA G;  4XIG S;  4NPS A;  4JI6 Q;  4DAY B;  4DR4 Q;  3M4O H;  1X3E A;  1EYG A;  2Z0S A;  3U50 C;  1KAW A;  2Z6K C;  3K80 C;  1VQ9 A;  4L5R C;  3CCU A;  4GS3 A;  3E9I A;  3T1H Q;  3CW2 C;  5C0X I;  2A1A A;  4LFB Q;  1I5F A;  4JG2 A;  1CUK A;  3GTG H;  1X6O A;  1QVC A;  3HOW H;  1XMO L;  1N33 Q;  3H15 A;  5GAG C;  4DK3 C;  1UE7 A;  1X65 A;  2AWO A;  3CCS A;  1L1O B;  1Q8K A;  4APV A;  1MJC A;  1JJ2 A;  4LF5 L;  2VY3 A;  2ZTC A;  3AYH B;  2GN5 A;  4R4Q A;  4UY8 C;  4GN3 B;  4YWM A;  2HT1 A;  4R1J A;  3PO2 G;  4LUO A;  1QUQ B;  1N34 L;  3M3Y H;  4LUZ A;  4X6A H;  2KBN A;  1L0W A;  3NBH B;  1HR0 Q;  4DUZ L;  4O2D A;  1EIY B;  3PO3 G;  1EUJ A;  1H95 A;  5C44 H;  2R7D A;  2UU9 L;  2ZJP A;  2R7Z G;  3KFU A;  4A3G G;  5JJL A;  1IBK L;  2RCN A;  4BY1 H;  3PCO B;  4POG A;  1U5K A;  1U0L A;  1VQH A;  1VQF A;  2CFM A;  2HIX A;  1VQC A;  3KOJ A;  2F3I A;  4A75 A;  2BA1 A;  1Q81 C;  5GAD C;  3BU2 A;  3G48 A;  2Q2T A;  5IP9 G;  1I94 Q;  1AE3 A;  1D7Q A;  1TWH H;  4JV5 Q;  1ASY A;  4DV6 Q;  2R6G A;  4A3J H;  1E7Z A;  3TRE A;  1HNZ Q;  2KHJ A;  2HHH Q;  3PUV A;  2D0P A;  2OWO A;  4LF4 L;  4IPG A;  1C7Y A;  1XNQ L;  2UU9 Q;  3W1B A;  4IFD I;  4JI2 Q;  4BBR H;  2PQA A;  3S15 H;  4LF8 Q;  4IPC A;  3HOU H;  3KDF A;  3NEL A;  2JQO A;  3JAM c;  2R92 G;  1IBL L;  4DUY Q;  1KHI A;  4DR7 Q;  2UXD L;  1BBW A;  5M5W H;  3K0X A;  4DR3 L;  3J80 c;  4JYA Q;  4HJ8 A;  4LF9 Q;  2MO1 A;  2CWP A;  4LFA L;  2PI2 E;  4GLX A;  1K0R A;  1TWF H;  3I2Z A;  2IY5 B;  4OON A;  3KLW A;  1FL0 A;  4JCV E;  4JI3 L;  4PZ8 A;  4IJL A;  3T1Y Q;  2YTY A;  1PH9 A;  2IT1 A;  4TVA B;  3I4M G;  4LNQ A;  3S16 H;  4DV7 Q;  4DV1 L;  4JI7 L;  4IOA A;  1Q12 A;  1KL9 A;  2VQE Q;  2B63 H;  2UXD Q;  4O0A A;  4YY3 Q;  2ZTD A;  3HOY G;  2Q2H A;  3FP9 A;  3CC4 A;  1XTD A;  4KLK A;  3RN5 A;  1JT8 A;  2OCE A;  1HNX Q;  2CCZ A;  3OYY A;  1LYL A;  1Q7Y C;  5AJ3 L;  4DR5 Q;  3F8T A;  2YV5 A;  1S40 A;  3PO3 H;  2OTL A;  5E7N A;  4LF7 Q;  1YHA A;  1CKM A;  1Y14 B;  2R7Z H;  1CKO A;  4JOI C;  1SFO H;  1WCM H;  4HIK A;  1PH7 A;  2K75 A;  1CKN A;  5EAY A;  1XNR L;  4P74 A;  4R4I A;  1S72 A;  4AQY Q;  1VQG A;  1A0I A;  2ID0 A;  2NN6 G;  5H1S E;  1N9W A;  1D8L A;  1YBY A;  2VL6 A;  2A8V A;  1A63 A;  2WB1 E;  2AWN A;  2K4K A;  4JI4 Q;  4LF4 Q;  2F52 A;  2Q2I A;  4HJ7 A;  2NVY H;  1PH8 A;  5C3E H;  4UP8 A;  4H02 A;  3HOZ H;  4JI1 Q;  1P8L A;  1KXL A;  1FJG L;  4AYB E;  4JI5 L;  1K8G A;  1JJC B;  2VUM H;  2UXC L;  2MFI A;  4LWC A;  4PZ7 A;  2JA8 H;  2R92 H;  3H3V I;  2OTJ A;  1IXR A;  1EIF A;  3KF6 B;  4P71 A;  2BA0 A;  5LMU Q;  2JA7 G;  2DGY A;  1XJV A;  2I5M X;  3I55 A;  4ME3 A;  2KHI A;  2ZM6 Q;  3G4S A;  5GQO A;  2NVT H;  4JI8 L;  3J7A 5;  4Y52 H;  4B3T L;  4KHP Q;  4DK6 C;  1FJG Q;  4GKJ Q;  2JJQ A;  4B3S L;  2DUD A;  4DR2 L;  3GTM H;  4DV0 L;  1L1O A;  4LF6 Q;  3VDY A;  3S2H H;  3WWV A;  3TEH B;  1PH6 A;  3CPF A;  3KJO A;  1KQS A;  3HOY H;  4JI6 L;  1Z47 A;  2Y0S E;  3PIO A;  3E9H A;  1Z9F A;  4YCU A;  4UP7 A;  4JI8 Q;  2MO0 A;  5IYD G;  2GVB A;  3U58 A;  2N3S A;  3BZC A;  2Q2U A;  4DR4 L;  2ZJR A;  1SMX A;  1Q86 C;  3ZJY C;  2B3G A;  1G29 1;  3RZO H;  4GOP A;  1E3P A;  4B3S Q;  2ASB A;  1R9T H;  1NMG A;  3T1H L;  4BA2 I;  2VZA A;  3RZD H;  2CWA A;  4AYB G;  2NZH A;  3GD7 A;  3UE1 A;  5HGQ A;  5IYB G;  3G6E A;  2QA4 A;  1N36 L;  3F2B A;  1HZ9 A;  4NB3 A;  1N33 L;  2NZO A;  2K52 A;  4A3D H;  1PYB A;  3AFP A;  4IPH A;  3B6Y A;  1OTC A;  2R93 G;  4BY7 H;  4JI0 Q;  2NVQ H;  3RR5 A;  4A93 H;  4OWT B;  2ATW A;  5LMN Q;  4K0K L;  4A3L G;  2KCM A;  1CSQ A;  1YNX A;  4A3M G;  1X56 A;  4PZ6 A;  3S2D H;  1VQ6 A;  5JJI A;  1YJN A;  3TS2 A;  4MTN A;  4GNX A;  4QGU A;  4EX5 A;  1N36 Q;  1HR0 L;  4YCV A;  1Q1B A;  4IPD A;  3M7N A;  4A3C H;  5JJK A;  3J7Z C;  1LM0 A;  2N78 A;  1A8V A;  4OX9 Q;  1N8R C;  2PNH A;  1IBM Q;  4L5Q A;  2Y0S G;  1Y1V G;  3CQZ H;  4R4T A;  1LTL A;  4K0K Q;  2K5V A;  3FHW A;  1T9H A;  3UDX A;  5K36 G;  3A5Z B;  1I94 L;  4MNO A;  4JV5 L;  3S24 A;  3BZK A;  4DV6 L;  2CKZ B;  1V1Q A;  2IHE A;  4DV2 Q;  1HNZ L;  2HHH L;  3UDF A;  1FVI A;  2V1C C;  1PH2 A;  3RLO A;  4JI2 L;  1KRS A;  4LF8 L;  2HQL A;  5IT9 c;  4DR6 Q;  4WJ3 M;  4L5T A;  4P72 A;  4DUY L;  1PHJ A;  2NN6 I;  4DR7 L;  4NXN Q;  3ULP A;  3I4N G;  4GKK L;  1X54 A;  2HIV A;  3EIV A;  1B70 B;  1KIX A;  1G6P A;  1XPO A;  4DNI A;  4JYA L;  1JE5 A;  3TQY A;  4LF9 L;  4C2M H;  3ERS X;  1VQO A;  4JC0 A;  4DV4 Q;  4IO9 A;  1YIT A;  1W3S A;  3EBE A;  1PFS A;  2AMC B;  2ALY B;  3Q8D A;  3HOX G;  5M3F H;  2YU9 H;  2NVX H;  1TWC H;  4YWK A;  2BH2 A;  3T1Y L;  3HKZ E;  1IL2 A;  3FKI G;  5IYB H;  1QVF A;  3CCL A;  4QIW E;  4IJH A;  3A0J A;  4DV7 L;  4GKK Q;  3CCM A;  1HNW Q;  2VQE L;  4LFC Q;  4YY3 L;  3CP0 A;  5GRO A;  3UDI A;  2D0O A;  5M3M G;  2R93 H;  3L2P A;  3I7F A;  3A74 A;  3RNU A;  5IY0 A;  3RN2 A;  1MJE A;  4X65 L;  1OXU A;  2K50 A;  1S3O A;  4YHH L;  1HNX L;  1HR0 W;  3W1G A;  1J6Q A;  2Z6K A;  4QY7 A;  2VNU D;  4DR5 L;  4DV3 Q;  4JBK A;  2UXB Q;  1SN8 A;  2K5H A;  4X66 Q;  4LF7 L;  1V43 A;  3IRB A;  5C0X J;  4HID A;  1Y1W G;  3RLF A;  3GDE A;  3PUY A;  3K7A H;  2E5L Q;  3H3V H;  1PVO A;  4X65 Q;  4YHH Q;  3PO2 H;  2JE6 I;  2ZJQ A;  2VS1 A;  4AQY L;  4A3B G;  1W2B A;  1M90 C;  4B3M Q;  3G71 A;  1QZH A;  3HOV G;  3H0G G;  1Q82 C;  4JI4 L;  5BR8 Q;  1PH3 A;  1VQN A;  2E2J H;  3GTK H;  4A3G H;  3HKZ G;  1YJ9 A;  4JI1 L;  1GO3 E;  1HZC A;  3PV0 A;  1L2F A;  2AKW B;  2LXK A;  3AEV A;  3GO5 A;  3PGZ A;  1X9N A;  1A62 A;  3I56 A;  5J3B A;  1E22 A;  5LMU L;  5IP9 H;  1EFW A;  2K14 A;  1E1O A;  3CCR A;  2K5N A;  2JA6 G;  5DLQ E;  1Q46 A;  5IWA Q;  2ZM6 L;  1PH5 A;  1X3G A;  3K7U C;  5FLM G;  3CCE A;  4HJA A;  4AIM A;  2UUC L;  5FJ8 G;  1PV4 A;  1FGU A;  4KHP L;  1HH2 P;  1VQM A;  4GKJ L;  1PH4 A; 
#chains in the Genus database with same CATH topology
 1XPR A;  1UE6 A;  1PRT F;  1BKB A;  2B2V A;  2WP8 J;  5I4D A;  3GTK B;  1S5B D;  2WAQ E;  2B2T A;  1RKN A;  4XT1 B;  1SRU A;  1XTC D;  2E8G A;  2H5X A;  3J81 i;  3QJY A;  4C3J H;  1VQE A;  4BBS G;  5D3D A;  3DWA A;  2EYO A;  1IZ6 A;  1HFG A;  3NEM A;  5M5Y H;  1O78 A;  3RLN A;  1BF4 A;  3I73 A;  3K5L A;  1ASZ A;  3X3N A;  1VQL A;  1NAP A;  4DAM A;  3L3O C;  3FKI B;  1KC8 C;  4XDX A;  3J81 j;  2E2H B;  1ENA A;  2HUG A;  3H09 A;  4CGY B;  4X62 Q;  5T1I A;  1LT5 D;  1NR4 A;  3T16 A;  5M3M B;  1NJI C;  5C44 G;  2KQ3 A;  5FO9 B;  3SK8 A;  4OX9 L;  4BY1 G;  5JAV A;  1EQR A;  3BJU A;  5IE8 A;  4KHZ A;  2D9U A;  3L7Z C;  1Y1W B;  1SYF A;  5GAH C;  3NTH A;  2K33 A;  1N32 Q;  5M5X H;  2A68 C;  4BBR G;  2PW7 A;  1HCZ A;  3DUZ A;  2F0D A;  4BS9 A;  4O42 A;  3C1E A;  2O4X A;  4C3I B;  3OTO Q;  2B2W C;  2XTI A;  1EY6 A;  4DV4 L;  3U9O A;  3KLR A;  2JEB I;  1EIH A;  3H91 A;  4HCS A;  3S17 H;  1D1I A;  1IYJ B;  1GM5 A;  5EPK A;  5LMN W;  3KBX A;  4LUV A;  4ZLT F;  3MWY W;  5IIF A;  2C5C A;  2X69 A;  3KYH C;  3FMC A;  5IYC H;  4I65 A;  5DAU A;  1A2T A;  2UXB L;  1X55 A;  5NUC A;  4GOP B;  3GP7 A;  3SVM A;  1TWG H;  2NTS A;  3CRK C;  4BBS B;  4OGQ C;  4A3M H;  1N34 Q;  4JBM A;  2MP1 A;  4DUZ Q;  1J5E L;  3KF6 A;  5C3E G;  4DNR B;  3HOZ G;  4BXX G;  1OXT A;  2OXP A;  1RL2 A;  2VUM G;  1EWH A;  1Y1V H;  2XSC A;  4A3K G;  5KND A;  3P7J A;  3NQT A;  2BH8 A;  5C44 B;  4PG3 A;  4OHJ A;  3M4Q A;  4FDB A;  3VA7 A;  4BY1 B;  1C48 A;  3K6O A;  1OXV A;  4OEL B;  3SGI A;  1NNX A;  1OXS C;  3PUX A;  3D6C A;  3R2T A;  2PYK A;  3F1Z A;  2E74 C;  4OWW B;  5I9P A;  3P75 A;  2YTV A;  4IN3 A;  3CC2 A;  4BBR B;  4GOP C;  2J4X A;  1FYC A;  3HOU B;  3I4O A;  4X3U A;  4A3I G;  4JI3 Q;  5CV6 A;  4Z9C B;  2WKC A;  3FKI H;  2E2H H;  3T51 B;  1JB7 A;  4OO1 H;  4HIM A;  4KN4 C;  1YNN C;  4DR1 Q;  3SEB A;  4DXF A;  3NBI A;  5IOD A;  4DPG A;  1F9R A;  2SEB D;  3S16 B;  1J8I A;  2FIN B;  1ZXT A;  2EYM A;  5J1Z A;  4X62 L;  1C9O A;  2LMC B;  3ONA B;  1C4Q A;  4B08 A;  3HOW G;  1I50 H;  4ME5 A;  1AH9 A;  1XNR Q;  2EQS A;  3QOJ A;  5CV8 A;  4N9P A;  1HTP A;  1LAB A;  3PO3 B;  1K0S A;  2L15 A;  3HP3 A;  4POF A;  3DLL A;  1HUN A;  1RJT A;  3A55 A;  2F0E A;  2NWG A;  1N32 L;  1WOC A;  3JAM i;  1KAB A;  1EQV A;  5D65 A;  5DM6 3;  3S14 B;  1EY8 A;  2WAQ G;  5T1G A;  5L37 A;  5A2Q E;  1X3F A;  3E0E A;  2NVY B;  5C3E B;  4XTC S;  3HOZ B;  4IOC A;  1GVP A;  2O5J C;  3R2I A;  3UI2 A;  4B3T Q;  2VUM B;  2OF1 A;  3OTO L;  3MTS A;  4A3K B;  3ICE A;  1B50 A;  3A7L A;  4DR2 Q;  1NBW A;  5JEA G;  4NPS A;  1WD1 A;  2F0O A;  4QIW B;  2K1B A;  1KAW A;  2WKD A;  1YNJ C;  4JG2 A;  4U68 A;  1QVC A;  3BS1 A;  2OT2 A;  3SHL A;  4U67 3;  1LT6 D;  4ZCK A;  4A3I B;  4CDC C;  1JJ2 A;  5HUR A;  5E1F A;  3PO2 G;  3BVM A;  4ZKC B;  4MIU A;  1LTA D;  2A68 D;  3ERQ A;  2Q8R E;  1N34 L;  1TT2 A;  3J7A V;  4DUZ L;  4O2D A;  5C44 H;  2R7Z G;  5JJL A;  3KFU A;  2PMZ B;  4ODG A;  1TR5 A;  4BY1 H;  3PCO B;  2HIX A;  1QE6 A;  1SJH D;  3S2D B;  1SND A;  3BU2 A;  5COR A;  1STA A;  1AE3 A;  3HOW B;  4DV6 Q;  4J6H A;  1HXY D;  3T53 B;  2QKI C;  1EEF D;  4BBR H;  1XX8 A;  4LF8 Q;  3HOU H;  1PRT C;  3NTK A;  2I07 B;  1KDA A;  1E2W A;  1KLG D;  3J80 c;  2CWP A;  2PI2 E;  3I2Z A;  1Q90 A;  2EY2 A;  2WAQ B;  4B9X A;  4CDD C;  1FL0 A;  1OO9 B;  4JCV E;  4JI3 L;  4IJL A;  3I4M G;  3S16 H;  1TWH B;  2HCC A;  4DV7 Q;  4IQZ A;  4HAE A;  1BBX C;  2NZ1 D;  2UXD Q;  4YY3 Q;  1IKL A;  2Q2H A;  3C3L A;  2C9O A;  2XNA C;  4KLK A;  3RN5 A;  3S15 B;  5CBA E;  1STB A;  2AUK A;  2SNS A;  4OIK A;  1HNX Q;  3PMF A;  3MXN A;  3PO3 H;  1EYD A;  3VR3 A;  4LF7 Q;  1CKM A;  2KHS A;  1CKO A;  4F8M A;  4JOI C;  4I7Z C;  1QJO A;  1PH7 A;  1FNU A;  1XNR L;  1ZEQ X;  1VQG A;  4CBV A;  5EGT A;  2B2Y C;  1D8L A;  2VL6 A;  2A8V A;  2WB1 E;  2AWN A;  2K4K A;  2Q8I B;  2LKV A;  2Q2I A;  2NVY H;  3DMU A;  3K7A B;  1WTH A;  5C3E H;  5IT9 L;  3HOZ H;  1P8L A;  2AQ2 B;  1KXL A;  1FJG L;  4AYB E;  1I4X A;  3PO2 B;  4ZAI A;  2VUM H;  2MFI A;  4LWC A;  2R92 H;  3H3V I;  1IXR A;  1EIF A;  2BA0 A;  2NB0 A;  3K59 A;  2PNR C;  2DGY A;  4JPB W;  2I5M X;  1X32 A;  2R7Z B;  3RD4 A;  4K5W A;  4TRD A;  1HQM C;  4B3T L;  4KHP Q;  1YNN D;  2DUD A;  4J1M A;  4DR2 L;  1ICW A;  4LF6 Q;  4ZUI A;  1PH6 A;  3PIO A;  3E9H A;  2MO0 A;  3U58 A;  5C6A A;  1SMX A;  3NBH A;  3IFD A;  4GOP A;  2PO4 A;  4CKB A;  2ASB A;  2F0J A;  5JPM C;  1TWA B;  3RMH A;  1Y8P B;  3UE1 A;  1QIL A;  1PZK D;  4YIJ A;  3OHX C;  1SYD A;  1JR0 D;  3NXW A;  3CHB D;  4NP5 A;  3GTQ B;  3B6Y A;  4OWT B;  2ATW A;  3I4M B;  4K0K L;  2A6E D;  2EY5 A;  4PZ6 A;  3S2D H;  5JJI A;  4PMC A;  1N36 Q;  5C3X A;  1U4R A;  3D6W A;  3J7Z C;  4KJN A;  1QOH A;  2PNH A;  2D5D A;  4L63 B;  3MFG A;  1T9H A;  5K36 G;  1AP0 A;  4IUR A;  4MNO A;  4DV6 L;  3BZK A;  1TVX A;  2IHE A;  3G6J B;  2HD3 A;  1GJX A;  2V1C C;  3AB9 A;  3RLO A;  4LF8 L;  1SXT A;  2EJM A;  4G57 A;  4O1N A;  3I4N G;  4G7Z C;  3EIV A;  1G6P A;  1SYB A;  1CZG A;  1I3Q B;  3MAQ A;  1EL0 A;  1CQF A;  4C2M H;  1VQO A;  1W3S A;  1PFS A;  2BH2 A;  1LTB D;  2JXM B;  3LWE A;  1FD7 D;  2F03 A;  1QVF A;  3PIP 3;  4DV7 L;  3V05 A;  4GKK Q;  1HNW Q;  2Z1C A;  4YY3 L;  2RBM A;  3MHB A;  3BG3 A;  4LFC Q;  2R93 H;  3TP8 A;  3I7F A;  3A74 A;  1K8M A;  5I2X A;  3J80 E;  5IY0 A;  3RN2 A;  5JJZ A;  4YHH L;  1HNX L;  1HR0 W;  4PNY A;  1GHK A;  1CZW A;  4LF7 L;  1GHJ A;  1SE3 A;  1V43 A;  3RLF A;  1JOR A;  3K7A H;  2E5L Q;  2JN4 A;  4FYD A;  3Q6S A;  2YU9 B;  3NE5 B;  1TS5 A;  2JE6 I;  4C1N I;  2VS1 A;  3PO2 H;  1PTO D;  3HOV G;  3GTO B;  1PRT D;  1BO0 A;  3A8J E;  2Z6B A;  5BR8 Q;  1VQN A;  4N8F A;  1Z7T A;  2RDH A;  1YJ9 A;  1HZC A;  2AKW B;  2LXK A;  3AEV A;  1NSN S;  3PGZ A;  2RVL A;  5C3W A;  1A62 A;  3EVQ A;  5J3B A;  1E22 A;  4K6L A;  2F0S A;  3S1Q B;  3K7U C;  4WRD A;  3TN2 A;  4HMJ A;  4KHP L;  1VQM A;  1IKM A;  5I6Y A;  3M9B A;  4LF6 L;  5C4J B;  2C35 B;  1TWA H;  4RG1 A;  1SYC A;  1M4V A;  1LAC A;  4OIJ A;  3GTQ H;  1VQB A;  2IL8 A;  1EQQ A;  3CKI B;  4GNX C;  1Z6H A;  3I4N B;  2YTX A;  4A3E B;  3I4M H;  1U9R A;  3M4P A;  5ELF A;  4HJ5 A;  3BYT B;  2AUJ D;  4X64 Q;  1KD1 C;  2L11 A;  3CPW A;  2XGT A;  2IJ0 A;  2WB1 G;  4LAA A;  5KRU A;  1K73 C;  1KDC A;  4IAL A;  2PW5 A;  3QG1 A;  3CF5 A;  1BDO A;  5IYC G;  2ZTE A;  3K8A A;  4K8J A;  1IL8 A;  2A19 A;  4X3T A;  1K8A C;  5JEA J;  5KGU A;  1VQD A;  1GUT A;  3FPP A;  5CC4 A;  4R8N A;  4EQN A;  1XMQ Q;  4NW2 A;  4ZKB B;  1D1K A;  1VQA A;  2B2Y A;  4WJW A;  4A3J G;  3CRL C;  2EXZ A;  4A3F B;  1EU3 A;  3OSO A;  2G9D A;  1I3Q H;  1STH A;  2UUB Q;  3K58 A;  4AH6 A;  4TQU S;  1EYC A;  2JA5 H;  3HOV B;  3MEH A;  5HGT A;  2I5H A;  4QUF A;  2EY1 A;  2XWJ B;  1UE1 A;  3I91 A;  2B8G A;  4B3R Q;  3D3R A;  1EZ6 A;  1PYS B;  2K28 A;  1U4M A;  2M9V A;  2B63 G;  1HNW L;  4LFC L;  2F0T A;  3FRP B;  5CGK A;  2F0G A;  1H9M A;  2IX1 A;  1O7I A;  1HRJ A;  1SR3 A;  1WFQ A;  1YVC A;  2E76 C;  1CI3 M;  3BDO A;  5JVH 3;  3CCV A;  3E3X A;  2N8N A;  2IX0 A;  3GTO H;  4OO1 G;  1TS3 A;  3F2C A;  1F9P A;  4ZK9 B;  4G7O C;  1WCM G;  2E5L L;  2EE1 A;  4DV5 L;  4LF5 Q;  1SSO A;  1GD7 A;  4KN7 C;  1YI2 A;  1QZG A;  4DA2 A;  5FLX L;  3U4V A;  3STB D;  1SRO A;  4WJ4 A;  5BR8 L;  3S1Q H;  2M00 A;  1IBK Q;  4DFA A;  1JMC A;  4KMU C;  2MQH A;  3ERO A;  3M3Y B;  3M4Y A;  1I6H H;  3AU7 A;  3QO2 A;  2RF4 A;  2RHS B;  5K36 H;  1AE2 A;  5C4J H;  2I5L X;  2PMZ E;  3KF8 B;  1K3R A;  1Y8N B;  2GVA A;  1J5E Q;  1XNQ Q;  1VS0 A;  4KK7 A;  4QQB X;  2LXJ A;  2DY7 A;  1IBL Q;  3AFQ A;  3I4L A;  4A3J B;  3I4N H;  4A3E H;  3LGJ A;  4DR3 Q;  2F0F A;  5C4X H;  3CXC A;  2A5H A;  3A5U A;  4PMB A;  3Q23 A;  2RHQ B;  3OW2 A;  2QDB A;  3JC6 6;  1PTO F;  1PMR A;  2VB3 X;  4DV1 Q;  5CV4 A;  2JP1 A;  4X64 L;  1EZ8 A;  5IOC A;  2OQK A;  2WIN B;  1UWV A;  2J0T D;  4BY7 G;  3J7A F;  2F4I A;  3CC7 A;  2D62 A;  3HFZ B;  4QL5 A;  2B63 B;  3NEN A;  5DNF A;  2ES2 A;  2V4D A;  4A3F H;  4RMF A;  1B8A A;  1G2S A;  3PSI A;  1XMQ L;  3H6M A;  3EJI A;  3HOV H;  4H7B A;  1KRT A;  5ISR A;  2KJX A;  2JA9 A;  1WCM B;  3JAM L;  3MXN B;  3DM3 A;  3UE0 A;  5C0X H;  2UUB L;  1EWC A;  2NYZ D;  1JOO A;  4A76 A;  1H9S B;  1HZA A;  2MHV A;  1WTX A;  1VQP A;  3J80 i;  4P75 A;  1VQ7 A;  1LTR D;  3NTI A;  2L55 A;  3CMA A;  5IP7 H;  3LX0 A;  4QJF A;  4LMQ D;  1I50 B;  3TS0 A;  4UAI A;  4R4C A;  1VF5 C;  3F2D A;  3S1N H;  1EWI A;  2KUM A;  1GUN A;  4B3R L;  3HOU G;  4LFB L;  5M9O A;  4XIG S;  5I9O A;  4EQO A;  3DWQ A;  3VYS A;  2Z0S A;  3U50 C;  1R4P B;  1VQ9 A;  3GTM B;  4GS3 A;  4KV6 A;  5FOB B;  4X3K A;  1EY0 A;  1I5F A;  4Q0F A;  3IL8 A;  5IGC A;  1CQV A;  1RF2 D;  3IFT A;  3H15 A;  1I4R A;  4UDU C;  1G2T A;  1X65 A;  1Q8K A;  2MUY A;  1MJC A;  1SNQ A;  1PFN A;  4LF5 L;  2PCF B;  2VY3 A;  3AYH B;  4LUO A;  2RSN A;  3M3Y H;  4X6A H;  2KBN A;  5KNB A;  3NBH B;  3I8Z A;  3TP5 A;  3PO3 G;  1PZJ D;  4A3G G;  4BY7 B;  2NVQ B;  1IBK L;  3HEJ A;  2CVR A;  4POG A;  1S4Z A;  1VQC A;  3KOJ A;  5IGE A;  1W6J A;  2KCN A;  4A75 A;  1Q81 C;  2AQ1 B;  3G48 A;  1I94 Q;  2R6G A;  4A3J H;  3QB3 A;  2OWO A;  1C7Y A;  1XNQ L;  2HQE A;  3W1B A;  3LNN A;  4QUC A;  4JI2 Q;  4XT3 B;  5CV7 A;  1JWU D;  2R92 G;  1IBL L;  4DUY Q;  2D2C C;  3E5S A;  2IWH A;  1VF7 A;  4DR7 Q;  3Q24 A;  4K5V A;  4DF7 A;  4JYA Q;  3K0X A;  3D4D A;  2BOS A;  3NWT A;  4DR3 L;  5EJW A;  4XYQ A;  5ELB A;  1DOM A;  1JQY D;  2EDG A;  1ET6 A;  3T1Y Q;  1EEI D;  2YTY A;  4DV1 L;  2MPM A;  2B63 H;  5C5L A;  5COY A;  1IW7 D;  1O7Z A;  4K6D A;  1JT8 A;  4KY6 A;  4WOR A;  2CCZ A;  1STN A;  1MD2 D;  4DU9 A;  1S40 A;  5IGB A;  1YHA A;  2PQE A;  2B39 A;  1WCM H;  1CKN A;  5EAY A;  2EVB A;  3A54 A;  3OOC A;  4R4I A;  1S72 A;  2E2D C;  2F0H A;  3OWE B;  2ID0 A;  1MSH A;  3U9S A;  5I2Y A;  2FMC A;  4ZQ3 A;  2F52 A;  5ELC A;  4HJ7 A;  2K04 A;  4UP8 A;  2K5Q A;  5EBC A;  1K8G A;  2K7V A;  4PZ7 A;  2B8F A;  4P71 A;  4FF3 A;  3I55 A;  1FGB D;  4A3G B;  5CR3 A;  3J7A 5;  5BN3 A;  1FJG Q;  4GKJ Q;  2A6E C;  5E3F A;  2JJQ A;  3GTM H;  3EFX D;  1BNZ A;  1CHP D;  3LWU A;  3TEH B;  5KYI A;  1LO5 D;  2K05 A;  1SNC A;  4UP7 A;  2EZV A;  2CW0 D;  2GVB A;  3BZC A;  5CMD A;  2DJG C;  1LLR D;  1ILP A;  2B3G A;  2R92 B;  1G29 1;  4I7A A;  1B2T A;  1TQO A;  2XRQ D;  4EQP A;  5HGQ A;  4H13 C;  3A8K E;  3F2B A;  4NB3 A;  2OEO A;  4HED A;  1PYB A;  2EJF C;  3AFP A;  1OTC A;  2R93 G;  4BY7 H;  3A7A B;  4JI0 Q;  2NVQ H;  1PRT B;  2NN6 H;  4FVM A;  5LMN Q;  3SE0 A;  4DAP A;  1JB3 A;  1X56 A;  3TS2 A;  2FJ2 A;  1SYG A;  3IAY A;  4IPD A;  5IGG A;  1RHP A;  1UEA B;  1A8V A;  1N8R C;  3OPO A;  5KNC A;  1CFM A;  2Y0S G;  3KF8 A;  3H0G B;  4K0K Q;  3FHW A;  1I94 L;  3S24 A;  1V1Q A;  4DV2 Q;  1II3 A;  3O13 A;  2ZXR A;  4ABN A;  4JI2 L;  2JA6 B;  1WTP A;  4DR6 Q;  4L5T A;  5LL6 X;  4DUY L;  1B3A A;  4DR7 L;  4NXN Q;  1ENC A;  1B70 B;  1PXU A;  4JYA L;  4ULL A;  4UHV A;  1PTO C;  2ALY B;  3TZD A;  3HOX G;  2PZT A;  2DN8 A;  3T1Y L;  4KTA A;  5IYB H;  1PFB A;  1UUP A;  4IJH A;  3A0J A;  1GUG A;  2E2I B;  1ESR A;  1EIG A;  3K5N A;  1SEB D;  3CP0 A;  2D0O A;  3RNU A;  1BXT A;  1MJE A;  4X65 L;  2K50 A;  1J6Q A;  3EQL C;  1IYV A;  1HFN A;  2B2W A;  2LFN A;  1LT4 D;  4DV3 Q;  4JBK A;  1WTO A;  3TP7 A;  1SN8 A;  4K5X A;  5A2Q L;  4HCE A;  4C2M B;  4RCO A;  4HSV A;  1CK1 A;  4B9W A;  4YHH Q;  1SE2 A;  1SE4 A;  4RFB A;  4B3M Q;  1BCP C;  2E75 C;  3SDZ A;  2FMM A;  1NR2 A;  4JW0 A;  1PH3 A;  1H9S A;  2F0V A;  2R93 B;  2RA4 A;  4A3G H;  1GO3 E;  3PV0 A;  1L2F A;  1D2B A;  1GOZ A;  1RTO A;  2F0L A;  3I56 A;  3Q22 A;  1PYW D;  3CCR A;  1E1O A;  5DLQ E;  5IWA Q;  1PH5 A;  1X3G A;  3FDT A;  4RAU C;  2UUC L;  3MC0 B;  4FNF A;  1X3Q A;  2Y0S B;  1HH2 P;  1ML0 D;  1U4P A;  2ZXP A;  4GKJ L;  2ICE C;  1PH4 A;  1STE A;  4C1N K;  2JA5 G;  2F4V Q;  4OL7 A;  4K2L A;  3QOL A;  4R9W A;  2EIF A;  1B7Y B;  2EYP A;  1F9S A;  1PTO H;  1XYI A;  3ER0 A;  2VQF Q;  1GUS A;  2JK8 A;  4N8X 1;  1Q8I A;  1MIU A;  3HOX B;  4GN5 A;  3S1M H;  4A3B H;  4JI0 L;  3ULL A;  2OQ0 A;  4NXM Q;  2I46 A;  3ND8 A;  5LMN L;  4A4I A;  3H0G H;  4C56 C;  4DGZ A;  5DEH A;  1EOT A;  1F2M A;  4FXD A;  1R4Q B;  1D5M C;  1RD9 D;  3K0Y A;  3D0F A;  1BVS A;  2EYJ A;  3TBI B;  3R3O A;  2JA6 H;  5ELO A;  4IUV A;  5FLM H;  5LL6 S;  4DV2 L;  3V96 A;  1HQR D;  4MZ9 A;  1Q1E A;  2PZU A;  2K32 A;  4EQ5 A;  1EQT A;  1PA6 A;  1NTG A;  4DR6 L;  4ILW A;  2F0I A;  1S5F D;  4NXN L;  3UDG A;  1E1T A;  2E2I H;  1J9O A;  2UUA Q;  1AZQ A;  1DD2 A;  4KI0 A;  2KCC A;  3STB C;  1TKW B;  3CCQ A;  3M85 A;  4YWL A;  2NTT A;  4A3E G;  1DGS A;  4KD3 A;  4IUU A;  4EVO A;  3K57 A;  1QWY A;  5C4X G;  3DEP A;  2JA5 B;  2EXD A;  2P5Z X;  1MHW C;  2R3Z A;  4DV3 L;  1XMO Q;  2FXQ A;  1AEX A;  3V2T A;  5E4W C;  3J81 E;  4JBJ A;  2L5T A;  3VYR A;  5J39 A;  1PDQ A;  3NK9 A;  4OWX B;  1SE8 A;  2MGS A;  4K14 A;  4H44 C;  4TSS A;  1AFP A;  2EPB A;  2NBF A;  1NY4 A;  4B3M L;  1XPU A;  4C3H H;  1JJG A;  4GLV B;  1DZ1 A;  4ZUJ A;  1KLU D;  2LS0 1;  3GV3 A;  4DV5 Q;  4HIO A;  4A3F G;  4GNX B;  2B2U C;  2JA8 G;  3HGB A;  3L0O A;  3GTL H;  4XQJ A;  3BDL A;  2O2L D;  1H9K A;  5IWA L;  3G6E A;  1LUZ A;  1B9M A;  1VQI A;  3MZ5 A;  2KA7 A;  5EBD A;  1CTM A;  2PZW A;  2VB2 X;  1QCB D;  2EY6 A;  1L1O C;  4YCW A;  5C0X G;  2M2L A;  2YYZ A;  5KEE A;  2G5D A;  5CV5 A;  5C4H A;  3NSW A;  4BA1 I;  4G4K A;  2F4V L;  2QEJ C;  1CSP A;  5IP7 G;  2DJF C;  5ELN A;  1YEZ A;  1HA6 A;  3HOX H;  1I6H B;  3E0J A;  2PPB C;  4DXG A;  2VQF L;  1BCP D;  1TXY A;  4QCL A;  3PIP A;  4HJ9 A;  4DK1 A;  4A3D G;  1WJJ A;  1G8Z D;  4RGT A;  5LHY 1;  4A93 G;  4NXM L;  4CJ1 B;  1VQ4 A;  1V9P A;  1EOV A;  3EN2 A;  1M8A A;  2SOB A;  3I70 A;  4L6T B;  2EYF A;  2N49 A;  4IFD G;  1O7Y A;  1VQ8 A;  5CV9 A;  3TDQ A;  5C4X B;  3PF4 A;  4J8Q A;  1TU2 B;  1QB5 D;  4PQX A;  4FF4 A;  3PUZ A;  1EYA A;  5D3I B;  3T56 B;  2JEA I;  4KD4 A;  4IUT A;  1WTR A;  4OO1 I;  4JI5 Q;  1ONL A;  3D8G A;  4X3S A;  2BE5 D;  4JOI A;  1TY2 A;  3J80 L;  1H9J A;  3C46 A;  2A6H D;  4R8I A;  3NPP A;  1CM9 A;  1T5X D;  4DKA C;  4QB4 A;  1CKN B;  2UUA L;  2DNC A;  1DON A;  2JA8 B;  1P16 A;  3URY A;  5M3F G;  1WI5 A;  2ICI A;  1NMF A;  4KKU A;  2CQO A;  4MN3 A;  1ZYR D;  4JI6 Q;  4GZY C;  4DR4 Q;  3M4O H;  1G6Z A;  1EYG A;  3K80 C;  5JVG 3;  4L5R C;  3E9I A;  3T1H Q;  3S2H B;  2A1A A;  4LFB Q;  4CJ0 B;  1CUK A;  3HOY B;  3GTG H;  1X6O A;  2BDN A;  1XMO L;  3VR5 A;  5GAG C;  4DK3 C;  1UE7 A;  2AWO A;  3CCS A;  2NUC A;  4EGV A;  2MJ8 A;  3S1N B;  1E2Z A;  4R4Q A;  1CT1 D;  4UY8 C;  4GN3 B;  3EA6 A;  5EKL A;  4YWM A;  2HT1 A;  1F2Z A;  1QUQ B;  2QDL A;  1HR0 Q;  1EIY B;  4A3D B;  1EUJ A;  3OW7 A;  4L8J A;  1H95 A;  2UU9 L;  2HCI A;  1O7L A;  3HS0 C;  4A93 B;  2RCN A;  1STY A;  1U5K A;  5GAD C;  1D7Q A;  4JV5 Q;  2K01 A;  1IW7 C;  3TRE A;  4IUP A;  3DWP A;  2HHH Q;  3QWN A;  1L0X B;  4KY7 A;  2A69 D;  4IPG A;  1K8O A;  4V0B A;  2PQA A;  3CQZ B;  3RUZ A;  3NEL A;  3D4R A;  4HTH A;  1KHI A;  3E6Z X;  4HJ8 A;  1U4L A;  2MO1 A;  2K03 A;  2EJG C;  4KJO A;  4GLX A;  2ZXO A;  4HMI A;  3A8I E;  1D5Z C;  4OON A;  1EY7 A;  3IKJ A;  4PZ8 A;  1W6K A;  1SMY D;  1HTL D;  1ZKO A;  2DY8 A;  4IOA A;  4IUQ A;  1KL9 A;  4IZ8 A;  2VQE Q;  2X6L A;  3BVG A;  2ZTD A;  4O0A A;  1K28 A;  3CC4 A;  1XTD A;  2VXW A;  2XWB B;  5M3F B;  1JC7 A;  1F77 A;  2NVX B;  1SNP A;  4K2K A;  1Y14 B;  2AQ3 B;  1SFO H;  4P74 A;  2NN6 G;  3VYU A;  1AN8 A;  2JSO A;  5CYU A;  1SAP A;  1A63 A;  2CW0 C;  2F0W A;  4JI4 Q;  4H02 A;  3WDN A;  3J7Y W;  4DAV A;  4F88 A;  4JI5 L;  1JJC B;  1FNW A;  2JA8 H;  4NDX A;  2BCO A;  5LMU Q;  2JA7 G;  2X6G A;  2B2U A;  2E2J B;  2ZM6 Q;  4RKB A;  3G4S A;  5EPL A;  4JI8 L;  1BCP F;  1WTV A;  4JK1 C;  3OIP A;  3OMC A;  3BZD B;  3SR1 A;  4DK6 C;  4B3S L;  2GA4 B;  1L1O A;  4FXG C;  3S2H H;  1A15 A;  1GUW A;  2JYO A;  3CPF A;  1F2L A;  1KDB A;  2F1M A;  3FVQ A;  3KJO A;  1KTK A;  3FPU B;  1Z47 A;  3S9W A;  2Y0S E;  1KQS A;  4JI6 L;  5IYD G;  1D5X C;  2J7Z A;  4DR4 L;  2N3S A;  2Q2U A;  2ZJR A;  3ZJY C;  1HHV A;  1I4P A;  4NKL A;  3RZO H;  1FR3 A;  1PLF A;  3T1H L;  2KEE A;  4BA2 I;  2CWA A;  5I6W A;  3GD7 A;  5IYB G;  1HZ9 A;  3S1R B;  4A3D H;  1A3U A;  2Z4H A;  4IPH A;  2ZT9 C;  4A93 H;  4A3L G;  2KCM A;  1CSQ A;  1YNX A;  5K5P A;  2RDF A;  3ZYY X;  1VQ6 A;  1H9R A;  3CU7 A;  5BN4 A;  4EX5 A;  4GNX A;  1HR0 L;  4IFD H;  4YCV A;  1Q1B A;  5FO7 B;  3M7N A;  3OMG A;  2A74 C;  2N78 A;  2K5D A;  3I90 A;  1IBM Q;  4L5Q A;  3CQZ H;  3NHH A;  1LTL A;  2K5V A;  5KYL A;  4JV5 L;  3OWF A;  2A73 B;  4HR7 B;  1E0B A;  2H4O A;  2HHH L;  3UDF A;  4RA8 A;  3WOE A;  4TKO B;  3KLS A;  2EYH A;  2HQL A;  4FXK C;  3HZX A;  3SK6 A;  5IT9 c;  4WJ3 M;  4KKT A;  1PHJ A;  1XXG A;  1X54 A;  2HIV A;  1KIX A;  1BR9 A;  1XPO A;  1STG A;  3TQY A;  3ERS X;  1B1Z A;  4JC0 A;  1YIT A;  5G3L D;  3Q8D A;  5M3F H;  2JA7 B;  5AFW A;  2HDM A;  4XQQ A;  4YWK A;  3TSS A;  3GV6 A;  2NVX H;  3CCL A;  3F2U A;  3CCM A;  4CJ2 C;  2VQE L;  1L0Y B;  1I6V C;  5GRO A;  5F2D A;  3QIA A;  1S3O A;  3W1G A;  1IHZ A;  1TS4 A;  3T13 A;  2LY7 A;  2F0Q A;  2DNE A;  4HN7 A;  2VNU D;  1A2U A;  4DNT B;  2Q8T A;  4X66 Q;  3IRB A;  3OIQ A;  2QW7 A;  2KVM A;  5EQ0 A;  5C0X J;  5JOB A;  1PVO A;  1E2V A;  4X65 Q;  1VDZ A;  4A3B G;  1W2B A;  1M90 C;  2WAC A;  1LTS D;  3G71 A;  1QZH A;  3DXJ C;  3H0G G;  4MHE A;  4JI4 L;  3GTK H;  1V1P B;  2E2J H;  3HKZ G;  5JPN C;  1SNO A;  3R93 A;  4RHR A;  2KOL A;  1X9N A;  5LMU L;  1TS2 A;  1EFW A;  2JA6 G;  5EKK A;  1B53 A;  2ZM6 L;  3P1H A;  5FLM G;  5FKA C;  1TII D;  4AIM A;  5FJ8 G;  1Y69 U;  4RWS C;  2XN9 C;  4CDE C;  4IFD J;  2RKS A;  3U4Z A;  1B44 D;  3KDF B;  5M3M H;  1DOL A;  3A56 A;  2UUC Q;  1PH1 A;  5FO8 B;  3Q0A A;  3S1R H;  4ALP A;  1DCZ A;  2XRS D;  4GLA C;  2QEX A;  3GTP B;  4J15 A;  4CKE A;  1K83 B;  1SDF A;  4GN4 B;  4PMW A;  1JWS D;  4UP9 A;  3AMU A;  1Y1W H;  1QUQ A;  1X3P A;  3CME A;  2QGQ A;  2EOT A;  2ENB A;  1YJW A;  2PI2 A;  4RHS A;  1VCI A;  1HJP A;  3W5O A;  3HKS A;  4DK0 A;  1GKH A;  1S5C D;  4LK1 C;  3K81 C;  5A35 A;  3TZU A;  4C3I H;  1PTO B;  3KJP A;  4L5S A;  1IBM L;  4S3S A;  1RCV D;  2R7F A;  1LTG D;  4HSP A;  2QF7 A;  4LW1 A;  1S5D D;  4C3H G;  5GAE C;  3GTJ B;  3S1M B;  2XIW A;  3MXP A;  4A3B B;  4Y7N B;  1AW7 A;  1B3Q A;  5ELE A;  2JA7 H;  4RGO S;  3HKZ B;  4RCN A;  1JWM D;  1EY4 A;  4BBS H;  1BCP B;  3PF5 A;  1CA5 A;  3MVV A;  2L0C A;  5IT9 E;  3I3C A;  1C8C A;  5IYD H;  4M8A A;  4UPA A;  5DM7 3;  3TME A;  2L9H A;  2KEN A;  3CCJ A;  1DOK A;  1DYQ A;  1XWE A;  3BDC A;  1GXD C;  2Z8L A;  1M1K C;  4CKC A;  3J81 c;  3FEW X;  4X66 L;  5EKI A;  1A3T A;  4WFN 3;  3TRZ A;  1S5E D;  1QVG A;  1C0A A;  1HZB A;  1YZ6 A;  2F3W A;  1PFM A;  4A3L H;  3C2P A;  1K9M C;  2O5I C;  3HG9 A;  1YHQ A;  5HY6 A;  1CHQ D;  5C4Z A;  3M7G A;  2HDL A;  3MEF A;  4OXP A;  1RIP A;  3G7L A;  4XYO A;  5G3L F;  3CAM A;  3NQI A;  4JBW A;  4RGN A;  1Y8O B;  3SK4 A;  3D31 A;  2I0Q A;  3MXG A;  4LF4 Q;  1BBU A;  1VQJ A;  2F0U A;  2WFW A;  3ULJ A;  2F0N A;  1NE3 A;  3D4W A;  2CQA A;  1WYD A;  3PIO 3;  4P73 A;  3KUP A;  3PUW A;  3GTP H;  2MNA A;  1K83 H;  2FFK B;  2LSS A;  3VR4 A;  1UEB A;  4C3H B;  4DR1 L;  2B29 A;  4LFA Q;  2IHF A;  4KKS A;  2RDG A;  1MGS A;  4FO2 A;  3NP8 A;  5D14 A;  3W3A A;  3GTL B;  1SJE D;  3VR2 A;  3K5O A;  5M5W B;  3PQI A;  1SLJ A;  3AQQ A;  2EYL A;  4JI7 Q;  3CD6 A;  2PQA B;  2QIL A;  1TWF B;  5E4X A;  2BE5 C;  3QR8 A;  1WVL A;  2A6H C;  4R4O A;  5AJ3 Q;  5KIX A;  1SNM A;  3S14 H;  1YHB A;  1VQ5 A;  1ET9 A;  1VMC A;  2VW9 A;  2AHO B;  3GQB A;  4DN4 M;  1E24 A;  4A3C G;  4BXX H;  2KCT A;  1VQK A;  2IX3 A;  3GTJ H;  4A3K H;  1QNK A;  2XVS A;  1KNA A;  4Y7N H;  1ZYR C;  4G7H C;  1DJR D;  1O80 A;  5J22 A;  1UE5 A;  5FLX c;  3KBG A;  1I4H A;  4ZRZ A;  2UXC Q;  1YIJ A;  4E6I A;  1MKH A;  1G51 A;  3BVZ A;  1JIC A;  3VYT A;  4F87 A;  5FJ8 H;  1I4Q A;  1OXX K;  4CDF C;  4A3I H;  1NCV A;  4DV0 Q;  1ILQ A;  1JOK A;  4H0L C;  1I4G A;  2NVT B;  3BYY B;  2N88 A;  4DAY B;  2L12 A;  4FP5 D;  1X3E A;  4RKL A;  2Z6K C;  1WD0 A;  2WII B;  3CCU A;  1BUV T;  3CW2 C;  5C0X I;  4P2C B;  3HOW H;  2A69 C;  1N33 Q;  3W2D A;  1L1O B;  4APV A;  4RGM A;  1R9T B;  2ZTC A;  2GN5 A;  3RZD B;  1V1P A;  4R1J A;  1SBB B;  2RSO A;  1NUC A;  1T5E A;  4LUZ A;  1L0W A;  1RDP D;  3M4O B;  3ITP A;  1HA5 A;  2R7D A;  2ZJP A;  1B9N A;  4JVZ A;  1KNE A;  2CFM A;  1DXM A;  1U0L A;  1VQF A;  1VQH A;  1SMY C;  2QCP X;  1QG7 A;  2F3I A;  2BA1 A;  2R61 A;  1LTI D;  3X3M A;  3NWS A;  3VA5 A;  5IP9 G;  2Q2T A;  1TWH H;  3GTG B;  1ASY A;  1E7Z A;  1JE4 A;  1YNJ D;  1HNZ Q;  2KHJ A;  4LF4 L;  1V8Q A;  2D0P A;  3PUV A;  3MXU A;  4Q5V A;  2UU9 Q;  4IFD I;  3S15 H;  4IPC A;  3KDF A;  2JQO A;  5JEA H;  3JAM c;  2B2V C;  1QNU A;  2B2T C;  2UXD L;  1PZI D;  1BBW A;  5M5W H;  3DEO A;  4LF9 Q;  2K6A A;  4LFA L;  1K0R A;  1TWF H;  2IY5 B;  3KLW A;  1CA6 A;  4F7X A;  3T4A C;  1PH9 A;  4C3J G;  2IT1 A;  4TVA B;  3KK7 A;  4LNQ A;  3HOY H;  2WV6 D;  4JI7 L;  1Q12 A;  3SXH A;  3HOY G;  3FP9 A;  4N9T A;  2OCE A;  5ELD A;  1TWC B;  2H1E A;  1JCK B;  3P20 A;  3OYY A;  1LYL A;  3SK5 A;  1Q7Y C;  5AJ3 L;  4DR5 Q;  3F8T A;  2YV5 A;  2OTL A;  5E7N A;  5C5M A;  2R7Z H;  2F0M A;  1EY5 A;  4HIK A;  4KY5 A;  2F0K A;  2K75 A;  4OEM B;  3DM1 A;  3H94 A;  4LJZ C;  4AQY Q;  1A0I A;  5EPJ A;  4V19 0;  5H1S E;  1N9W A;  1WTQ A;  1YBY A;  2Z4I A;  1G91 A;  5IGF A;  3NUC A;  1PH8 A;  4JI1 Q;  3DHQ A;  2G9H D;  2UXC L;  2OTJ A;  2Z9H A;  3KF6 B;  1XJV A;  4M1U B;  4ME3 A;  2KHI A;  2NVT H;  5GQO A;  3I72 A;  1SFO B;  1JOQ A;  4Y52 H;  1ENF A;  1MI2 A;  5FLX E;  3J81 L;  2RCF A;  4DV0 L;  1B4O A;  3VDY A;  2K5W A;  3WWV A;  4YCU A;  1Z9F A;  1HUM A;  4JI8 Q;  1Q3L A;  1EU4 A;  1Q86 C;  1ROD A;  3MA2 B;  1VMP A;  4K8I A;  1LV9 A;  3HRZ C;  1E3P A;  4CHT B;  1R9T H;  1NMG A;  4B3S Q;  1A3V A;  1D6E C;  2VZA A;  5BN5 A;  3RZD H;  4AYB G;  2NZH A;  2IW3 A;  2QA4 A;  1N36 L;  1HPC A;  2KEC A;  1N33 L;  1KAA A;  2NZO A;  2K52 A;  1AZP A;  2TMP A;  3L9A X;  3H3V C;  2N55 A;  2SNM A;  1UAP A;  2L4N A;  3RR5 A;  4C3J B;  4PV1 C;  4A3M G;  2TSS A;  5M5Y B;  1YJN A;  4MTN A;  3TP6 A;  4QGU A;  4A3C H;  5JJK A;  2CH4 W;  1LM0 A;  3KLS X;  4OX9 Q;  1GUO A;  1BQQ T;  3RZO B;  4XQN A;  4R4T A;  1Y1V G;  3UDX A;  3A5Z B;  1WTW A;  2CKZ B;  1HNZ L;  4ZYS A;  1FVI A;  1LTT D;  3ND9 A;  1PH2 A;  3VR6 A;  1KRS A;  1F9Q A;  3N52 A;  4FF1 A;  4NMZ A;  4P72 A;  2NN6 I;  3ULP A;  1F2Y A;  3WOF A;  4GKK L;  5FK9 C;  1ESF A;  2FHT A;  4DNI A;  1JE5 A;  5M5X B;  4LF9 L;  1UNS A;  4IO9 A;  4DV4 Q;  3EBE A;  1BOS A;  2AMC B;  2RQX A;  4RH6 A;  3K5M A;  2YU9 H;  4KHV A;  1TWC H;  3HKZ E;  1IL2 A;  2IPK D;  3FKI G;  1V1O A;  4QIW E;  1FNV A;  3JAM E;  2CHB D;  4IUN A;  3C1F A;  4ID6 A;  1A6X A;  3UDI A;  5M3M G;  3L2P A;  1OXU A;  5TSS A;  2Z6K A;  3S17 B;  4XXE A;  4FF2 A;  4QY7 A;  4DR5 L;  1EY9 A;  2UXB Q;  2K5H A;  1MSG A;  4MTK A;  4HID A;  1Y1W G;  2WB1 B;  1K3B C;  1DM0 B;  3GDE A;  3PUY A;  3H3V H;  1RTN A;  2SDF A;  2F3V A;  2ZJQ A;  4AYB B;  4AQY L;  5IGD A;  1Q82 C;  4QMG A;  1TWG B;  4JI1 L;  3GO5 A;  4C3I G;  1TY0 A;  4A3M B;  2BDO A;  3R8B A;  5CBE E;  5IP9 H;  2K14 A;  2K5N A;  1IYU A;  1Q46 A;  1LT3 D;  1EFI D;  1SYE A;  3CCE A;  2CH4 A;  4HJA A;  4BWG B;  4QF4 A;  3MFY A;  1FGU A;  1PV4 A;  1Y1V B;  1MBY A;  2L1B A;  3N6R A;  4DAY A;  2KED A;  2F0P A;  1ICF B; 
#chains in the Genus database with same CATH homology
 3M9B A;  1XPR A;  4LF6 L;  4IFD J;  2JA5 G;  2F4V Q;  2C35 B;  1UE6 A;  1TWA H;  4RG1 A;  1BKB A;  3U4Z A;  2WP8 J;  2EIF A;  3KDF B;  2WAQ E;  5M3M H;  1B7Y B;  2UUC Q;  1PH1 A;  1SRU A;  3S1R H;  4ALP A;  3GTQ H;  1VQB A;  1EQQ A;  4GLA C;  2QEX A;  2E8G A;  4GNX C;  2H5X A;  3J81 i;  3ER0 A;  4C3J H;  2YTX A;  4J15 A;  3I4M H;  1VQE A;  4GN4 B;  4PMW A;  4BBS G;  3M4P A;  4UP9 A;  4HJ5 A;  1IZ6 A;  1Y1W H;  4X64 Q;  3NEM A;  5M5Y H;  2VQF Q;  3RLN A;  1KD1 C;  1ASZ A;  2JK8 A;  1VQL A;  1QUQ A;  3CPW A;  1MIU A;  4GN5 A;  4DAM A;  3CME A;  2QGQ A;  3S1M H;  2XGT A;  1K73 C;  2WB1 G;  3ULL A;  2OQ0 A;  1KC8 C;  4JI0 L;  4NXM Q;  4A3B H;  5LMN L;  3J81 j;  4A4I A;  3H0G H;  1YJW A;  3CF5 A;  4X62 Q;  2PI2 A;  5IYC G;  2ZTE A;  1VCI A;  1HJP A;  3K8A A;  3HKS A;  3W5O A;  1GKH A;  1NJI C;  5C44 G;  3K81 C;  2A19 A;  4C3I H;  3D0F A;  3KJP A;  1K8A C;  4BY1 G;  4OX9 L;  5JEA J;  4L5S A;  1VQD A;  1IBM L;  1BVS A;  1EQR A;  2JA6 H;  3BJU A;  2R7F A;  1XMQ Q;  5ELO A;  5IE8 A;  4KHZ A;  3L7Z C;  5FLM H;  4LW1 A;  1VQA A;  4A3J G;  5GAH C;  4DV2 L;  5GAE C;  1N32 Q;  4MZ9 A;  1I3Q H;  5M5X H;  2UUB Q;  1Q1E A;  4BBR G;  4AH6 A;  4TQU S;  2JA5 H;  4EQ5 A;  2JA7 H;  1PA6 A;  1NTG A;  4DR6 L;  4NXN L;  3UDG A;  1E1T A;  2I5H A;  2E2I H;  2UUA Q;  3OTO Q;  2XTI A;  1UE1 A;  4DV4 L;  2JEB I;  4KI0 A;  4B3R Q;  3STB C;  4BBS H;  3PF5 A;  3CCQ A;  3S17 H;  3M85 A;  1IYJ B;  4YWL A;  1GM5 A;  1PYS B;  2B63 G;  4A3E G;  5IYD H;  1HNW L;  4LFC L;  1DGS A;  5LMN W;  4LUV A;  4UPA A;  2IX1 A;  5C4X G;  1O7I A;  2KEN A;  3CCJ A;  2EXD A;  3KYH C;  1SR3 A;  1WFQ A;  5IYC H;  1YVC A;  4DV3 L;  1M1K C;  1XMO Q;  3J81 c;  2FXQ A;  3CCV A;  1X55 A;  4GOP B;  4X66 L;  2N8N A;  2UXB L;  2IX0 A;  3GTO H;  4OO1 G;  3F2C A;  3TRZ A;  4JBJ A;  1TWG H;  1WCM G;  2E5L L;  4DV5 L;  1QVG A;  4OWX B;  4LF5 Q;  1C0A A;  1HZB A;  1SE8 A;  1GD7 A;  1YZ6 A;  1YI2 A;  1QZG A;  4A3L H;  1K9M C;  4A3M H;  1N34 Q;  3U4V A;  1YHQ A;  1NY4 A;  4B3M L;  4JBM A;  1XPU A;  3STB D;  1SRO A;  5HY6 A;  4DUZ Q;  4WJ4 A;  4C3H H;  1JJG A;  4GLV B;  1J5E L;  5BR8 L;  3KF6 A;  3MEF A;  5C3E G;  4OXP A;  3S1Q H;  1RIP A;  3HOZ G;  1IBK Q;  4BXX G;  1OXT A;  4DV5 Q;  1RL2 A;  1JMC A;  2MQH A;  4HIO A;  4A3F G;  4GNX B;  1Y1V H;  2VUM G;  2JA8 G;  3CAM A;  4JBW A;  4A3K G;  1I6H H;  3L0O A;  3GTL H;  2RF4 A;  2RHS B;  1AE2 A;  3D31 A;  2I0Q A;  5C4J H;  2I5L X;  2BH8 A;  4PG3 A;  2PMZ E;  3KF8 B;  5IWA L;  3M4Q A;  1K3R A;  4FDB A;  1BBU A;  1LUZ A;  1VQI A;  2GVA A;  1VS0 A;  1J5E Q;  1XNQ Q;  1VQJ A;  1L1O C;  2WFW A;  4YCW A;  2LXJ A;  3ULJ A;  5C0X G;  4QQB X;  1OXV A;  2YYZ A;  1NE3 A;  3SGI A;  1OXS C;  3PUX A;  1IBL Q;  1WYD A;  3AFQ A;  4BA1 I;  4P73 A;  3PUW A;  2F4V L;  2MNA A;  3GTP H;  4A3E H;  3I4N H;  1K83 H;  3F1Z A;  2LSS A;  3LGJ A;  1UEB A;  1CSP A;  4DR1 L;  4DR3 Q;  2B29 A;  4OWW B;  2YTV A;  4LFA Q;  5IP7 G;  3CC2 A;  2IHF A;  5ELN A;  5C4X H;  3CXC A;  4GOP C;  1YEZ A;  3I4O A;  3A5U A;  3HOX H;  4A3I G;  4JI3 Q;  2RHQ B;  3OW2 A;  3JC6 6;  3FKI H;  4DV1 Q;  1JB7 A;  2E2H H;  1SLJ A;  3AQQ A;  4JI7 Q;  4HIM A;  3CD6 A;  2PQA B;  4X64 L;  4DR1 Q;  2VQF L;  1TXY A;  3PIP A;  4HJ9 A;  4A3D G;  4DPG A;  1WJJ A;  2OQK A;  1UWV A;  4BY7 G;  4R4O A;  4A93 G;  4NXM L;  3CC7 A;  2D62 A;  3HFZ B;  5AJ3 Q;  1VQ4 A;  1V9P A;  1EOV A;  1YHB A;  1VQ5 A;  4QL5 A;  3S14 H;  3EN2 A;  4X62 L;  2AHO B;  1C9O A;  2VW9 A;  3NEN A;  2N49 A;  2ES2 A;  3HOW G;  4IFD G;  1E24 A;  1VQ8 A;  4BXX H;  1I50 H;  2KCT A;  4A3C G;  4A3F H;  1VQK A;  4RMF A;  1XNR Q;  2EQS A;  3GTJ H;  4A3K H;  3PF4 A;  1AH9 A;  1B8A A;  4Y7N H;  3PSI A;  1XMQ L;  2L15 A;  3HOV H;  3PUZ A;  1UE5 A;  1KRT A;  2JEA I;  2JA9 A;  4POF A;  5FLX c;  3DLL A;  4OO1 I;  3MXN B;  3DM3 A;  1WOC A;  3UE0 A;  3JAM i;  1YIJ A;  2UUB L;  4JI5 Q;  1N32 L;  1MKH A;  2UXC Q;  1G51 A;  4JOI A;  4A76 A;  1HZA A;  2WAQ G;  1VQP A;  3J80 i;  4P75 A;  1VQ7 A;  1X3F A;  3CMA A;  3E0E A;  4XTC S;  4DKA C;  5IP7 H;  1CKN B;  4QJF A;  1GVP A;  4IOC A;  3TS0 A;  5FJ8 H;  1OXX K;  4R4C A;  2UUA L;  3F2D A;  4B3T Q;  3OTO L;  4A3I H;  1P16 A;  3ICE A;  3S1N H;  4DR2 Q;  1EWI A;  5M3F G;  1WI5 A;  4DV0 Q;  4LFB L;  1NBW A;  3HOU G;  1NMF A;  4B3R L;  2CQO A;  5JEA G;  4XIG S;  4NPS A;  4JI6 Q;  4DAY B;  4DR4 Q;  3M4O H;  1X3E A;  1EYG A;  2Z0S A;  3U50 C;  1KAW A;  2Z6K C;  3K80 C;  1VQ9 A;  4L5R C;  3CCU A;  4GS3 A;  3E9I A;  3T1H Q;  3CW2 C;  5C0X I;  2A1A A;  4LFB Q;  1I5F A;  4JG2 A;  1CUK A;  3GTG H;  1X6O A;  1QVC A;  3HOW H;  1XMO L;  1N33 Q;  3H15 A;  5GAG C;  4DK3 C;  1UE7 A;  1X65 A;  2AWO A;  3CCS A;  1L1O B;  1Q8K A;  4APV A;  1MJC A;  1JJ2 A;  4LF5 L;  2VY3 A;  2ZTC A;  3AYH B;  2GN5 A;  4R4Q A;  4UY8 C;  4GN3 B;  4YWM A;  2HT1 A;  4R1J A;  3PO2 G;  4LUO A;  1QUQ B;  1N34 L;  3M3Y H;  4LUZ A;  4X6A H;  2KBN A;  1L0W A;  3NBH B;  1HR0 Q;  4DUZ L;  4O2D A;  1EIY B;  3PO3 G;  1EUJ A;  1H95 A;  5C44 H;  2R7D A;  2UU9 L;  2ZJP A;  2R7Z G;  3KFU A;  4A3G G;  5JJL A;  1IBK L;  2RCN A;  4BY1 H;  3PCO B;  4POG A;  1U5K A;  1U0L A;  1VQH A;  1VQF A;  2CFM A;  2HIX A;  1VQC A;  3KOJ A;  2F3I A;  4A75 A;  2BA1 A;  1Q81 C;  5GAD C;  3BU2 A;  3G48 A;  2Q2T A;  5IP9 G;  1I94 Q;  1AE3 A;  1D7Q A;  1TWH H;  4JV5 Q;  1ASY A;  4DV6 Q;  2R6G A;  4A3J H;  1E7Z A;  3TRE A;  1HNZ Q;  2KHJ A;  2HHH Q;  3PUV A;  2D0P A;  2OWO A;  4LF4 L;  4IPG A;  1C7Y A;  1XNQ L;  2UU9 Q;  3W1B A;  4IFD I;  4JI2 Q;  4BBR H;  2PQA A;  3S15 H;  4LF8 Q;  4IPC A;  3HOU H;  3KDF A;  3NEL A;  2JQO A;  3JAM c;  2R92 G;  1IBL L;  4DUY Q;  1KHI A;  4DR7 Q;  2UXD L;  1BBW A;  5M5W H;  3K0X A;  4DR3 L;  3J80 c;  4JYA Q;  4HJ8 A;  4LF9 Q;  2MO1 A;  2CWP A;  4LFA L;  2PI2 E;  4GLX A;  1K0R A;  1TWF H;  3I2Z A;  2IY5 B;  4OON A;  3KLW A;  1FL0 A;  4JCV E;  4JI3 L;  4PZ8 A;  4IJL A;  3T1Y Q;  2YTY A;  1PH9 A;  2IT1 A;  4TVA B;  3I4M G;  4LNQ A;  3S16 H;  4DV7 Q;  4DV1 L;  4JI7 L;  4IOA A;  1Q12 A;  1KL9 A;  2VQE Q;  2B63 H;  2UXD Q;  4O0A A;  4YY3 Q;  2ZTD A;  3HOY G;  2Q2H A;  3FP9 A;  3CC4 A;  1XTD A;  4KLK A;  3RN5 A;  1JT8 A;  2OCE A;  1HNX Q;  2CCZ A;  3OYY A;  1LYL A;  1Q7Y C;  5AJ3 L;  4DR5 Q;  3F8T A;  2YV5 A;  1S40 A;  3PO3 H;  2OTL A;  5E7N A;  4LF7 Q;  1YHA A;  1CKM A;  1Y14 B;  2R7Z H;  1CKO A;  4JOI C;  1SFO H;  1WCM H;  4HIK A;  1PH7 A;  2K75 A;  1CKN A;  5EAY A;  1XNR L;  4P74 A;  4R4I A;  1S72 A;  4AQY Q;  1VQG A;  1A0I A;  2ID0 A;  2NN6 G;  5H1S E;  1N9W A;  1D8L A;  1YBY A;  2VL6 A;  2A8V A;  1A63 A;  2WB1 E;  2AWN A;  2K4K A;  4JI4 Q;  4LF4 Q;  2F52 A;  2Q2I A;  4HJ7 A;  2NVY H;  1PH8 A;  5C3E H;  4UP8 A;  4H02 A;  3HOZ H;  4JI1 Q;  1P8L A;  1KXL A;  1FJG L;  4AYB E;  4JI5 L;  1K8G A;  1JJC B;  2VUM H;  2UXC L;  2MFI A;  4LWC A;  4PZ7 A;  2JA8 H;  2R92 H;  3H3V I;  2OTJ A;  1IXR A;  1EIF A;  3KF6 B;  4P71 A;  2BA0 A;  5LMU Q;  2JA7 G;  2DGY A;  1XJV A;  2I5M X;  3I55 A;  4ME3 A;  2KHI A;  2ZM6 Q;  3G4S A;  5GQO A;  2NVT H;  4JI8 L;  3J7A 5;  4Y52 H;  4B3T L;  4KHP Q;  4DK6 C;  1FJG Q;  4GKJ Q;  2JJQ A;  4B3S L;  2DUD A;  4DR2 L;  3GTM H;  4DV0 L;  1L1O A;  4LF6 Q;  3VDY A;  3S2H H;  3WWV A;  3TEH B;  1PH6 A;  3CPF A;  3KJO A;  1KQS A;  3HOY H;  4JI6 L;  1Z47 A;  2Y0S E;  3PIO A;  3E9H A;  1Z9F A;  4YCU A;  4UP7 A;  4JI8 Q;  2MO0 A;  5IYD G;  2GVB A;  3U58 A;  2N3S A;  3BZC A;  2Q2U A;  4DR4 L;  2ZJR A;  1SMX A;  1Q86 C;  3ZJY C;  2B3G A;  1G29 1;  3RZO H;  4GOP A;  1E3P A;  4B3S Q;  2ASB A;  1R9T H;  1NMG A;  3T1H L;  4BA2 I;  2VZA A;  3RZD H;  2CWA A;  4AYB G;  2NZH A;  3GD7 A;  3UE1 A;  5HGQ A;  5IYB G;  3G6E A;  2QA4 A;  1N36 L;  3F2B A;  1HZ9 A;  4NB3 A;  1N33 L;  2NZO A;  2K52 A;  4A3D H;  1PYB A;  3AFP A;  4IPH A;  3B6Y A;  1OTC A;  2R93 G;  4BY7 H;  4JI0 Q;  2NVQ H;  3RR5 A;  4A93 H;  4OWT B;  2ATW A;  5LMN Q;  4K0K L;  4A3L G;  2KCM A;  1CSQ A;  1YNX A;  4A3M G;  1X56 A;  4PZ6 A;  3S2D H;  1VQ6 A;  5JJI A;  1YJN A;  3TS2 A;  4MTN A;  4GNX A;  4QGU A;  4EX5 A;  1N36 Q;  1HR0 L;  4YCV A;  1Q1B A;  4IPD A;  3M7N A;  4A3C H;  5JJK A;  3J7Z C;  1LM0 A;  2N78 A;  1A8V A;  4OX9 Q;  1N8R C;  2PNH A;  1IBM Q;  4L5Q A;  2Y0S G;  1Y1V G;  3CQZ H;  4R4T A;  1LTL A;  4K0K Q;  2K5V A;  3FHW A;  1T9H A;  3UDX A;  5K36 G;  3A5Z B;  1I94 L;  4MNO A;  4JV5 L;  3S24 A;  3BZK A;  4DV6 L;  2CKZ B;  1V1Q A;  2IHE A;  4DV2 Q;  1HNZ L;  2HHH L;  3UDF A;  1FVI A;  2V1C C;  1PH2 A;  3RLO A;  4JI2 L;  1KRS A;  4LF8 L;  2HQL A;  5IT9 c;  4DR6 Q;  4WJ3 M;  4L5T A;  4P72 A;  4DUY L;  1PHJ A;  2NN6 I;  4DR7 L;  4NXN Q;  3ULP A;  3I4N G;  4GKK L;  1X54 A;  2HIV A;  3EIV A;  1B70 B;  1KIX A;  1G6P A;  1XPO A;  4DNI A;  4JYA L;  1JE5 A;  3TQY A;  4LF9 L;  4C2M H;  3ERS X;  1VQO A;  4JC0 A;  4DV4 Q;  4IO9 A;  1YIT A;  1W3S A;  3EBE A;  1PFS A;  2AMC B;  2ALY B;  3Q8D A;  3HOX G;  5M3F H;  2YU9 H;  2NVX H;  1TWC H;  4YWK A;  2BH2 A;  3T1Y L;  3HKZ E;  1IL2 A;  3FKI G;  5IYB H;  1QVF A;  3CCL A;  4QIW E;  4IJH A;  3A0J A;  4DV7 L;  4GKK Q;  3CCM A;  1HNW Q;  2VQE L;  4LFC Q;  4YY3 L;  3CP0 A;  5GRO A;  3UDI A;  2D0O A;  5M3M G;  2R93 H;  3L2P A;  3I7F A;  3A74 A;  3RNU A;  5IY0 A;  3RN2 A;  1MJE A;  4X65 L;  1OXU A;  2K50 A;  1S3O A;  4YHH L;  1HNX L;  1HR0 W;  3W1G A;  1J6Q A;  2Z6K A;  4QY7 A;  2VNU D;  4DR5 L;  4DV3 Q;  4JBK A;  2UXB Q;  1SN8 A;  2K5H A;  4X66 Q;  4LF7 L;  1V43 A;  3IRB A;  5C0X J;  4HID A;  1Y1W G;  3RLF A;  3GDE A;  3PUY A;  3K7A H;  2E5L Q;  3H3V H;  1PVO A;  4X65 Q;  4YHH Q;  3PO2 H;  2JE6 I;  2ZJQ A;  2VS1 A;  4AQY L;  4A3B G;  1W2B A;  1M90 C;  4B3M Q;  3G71 A;  1QZH A;  3HOV G;  3H0G G;  1Q82 C;  4JI4 L;  5BR8 Q;  1PH3 A;  1VQN A;  2E2J H;  3GTK H;  4A3G H;  3HKZ G;  1YJ9 A;  4JI1 L;  1GO3 E;  1HZC A;  3PV0 A;  1L2F A;  2AKW B;  2LXK A;  3AEV A;  3GO5 A;  3PGZ A;  1X9N A;  1A62 A;  3I56 A;  5J3B A;  1E22 A;  5LMU L;  5IP9 H;  1EFW A;  2K14 A;  1E1O A;  3CCR A;  2K5N A;  2JA6 G;  5DLQ E;  1Q46 A;  5IWA Q;  2ZM6 L;  1PH5 A;  1X3G A;  3K7U C;  5FLM G;  3CCE A;  4HJA A;  4AIM A;  2UUC L;  5FJ8 G;  1PV4 A;  1FGU A;  4KHP L;  1HH2 P;  1VQM A;  4GKJ L;  1PH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...