1HZAA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzaA00
4Y7NH 1R9TH 4LF4Q 4B3RQ 5IWAQ 4A75A 2LXJA 1V1QA 4YWLA 2LXKA 4DR4L 4X62L 4AYBE 4TQUS 4JI5Q 2VQFQ 2PMZE 1EUJA 4LF5Q 4IFDI 4GKJL 4LFBQ 1CKNA 2BA0A 3PF4A 1HNWL 4UP9A 1FGUA 1EWIA 2N3SA 1SE8A 4R4QA 4DV7Q 5GROA 1BBUA 2YTYA 4DAMA 4DNIA 3ULJA 1W2BA 1NJIC 1HR0W 4LF7Q 3H3VI 5M5WH 2UUCL 3KJOA 1XPOA 1PV4A 4JI4L 4JI7L 2UXBQ 3GTOH 5M3FG 2D62A 1XMOL 2H5XA 1X3EA 4LF9Q 5IYCH 4DV0L 2HT1A 4JYAL 1VQGA 3Q8DA 3RLFA 4IFDG 2Q2TA 1B70B 5C44G 4DV5Q 1KRTA 1X56A 3UDIA 5LMUQ 3PUXA 3VDYA 4A3CG 4B3TQ 3M85A 3S16H 2VNUD 2A19A 5JJKA 1OTCA 3NENA 4DKAC 1PH4A 4JV5Q 1EQQA 2YV5A 3HOUH 1Q12A 3PUWA 4YWKA 4X66Q 2OQKA 4DK3C 4GLAC 2VL6A 5FLMG 2KCTA 5FJ8G 3I7FA 1SN8A 2I5HA 4L5SA 1B7YB 1Z47A 4A3BH 4OONA 3RNUA 2DGYA 2XGTA 3CCJA 4WJ4A 4JI6Q 5J3BA 3UDXA 1S40A 4X64L 1V43A 3L0OA 1L2FA 4O0AA 3HOYH 4K0KQ 3CPWA 1I50H 1AE2A 2RCNA 1MKHA 4HJ9A 5IYDH 1N8RC 1XPRA 1K3RA 3GTKH 3HOVH 1YITA 2K4KA 3PO2G 3KOJA 4JBJA 3BZKA 3HOWG 1VCIA 4A3LG 2ATWA 4JI2L 3I56A 2E2IH 4P73A 4DV6Q 4PZ6A 1OXVA 4DUYQ 1UE5A 1X55A 3OW2A 3OTOL 4EX5A 5IP9H 2R93H 2AHOB 1X65A 2BH2A 1YVCA 3HOZH 1KIXA 4AQYQ 1KAWA 2PQAA 3E0EA 3GTQH 2YU9H 4Y52H 3S1NH 3CCSA 1GD7A 2JE6I 4GNXB 4JBMA 1S72A 3G6EA 2HIXA 2ZJQA 3UE0A 1PH8A 2KBNA 1JE5A 2NVXH 2MQHA 4GS3A 4P75A 2NVQH 4DV1Q 2UXCQ 2JA8H 1YJNA 1WCMG 5IY0A 2Y0SG 4A3MG 2HHHQ 1GO3E 1K83H 1N9WA 1YIJA 3K80C 4JCVE 3UDGA 1J5EQ 4JI0L 3CP0A 1KXLA 3H15A 2IX1A 4KLKA 1N34Q 4DV4L 1WOCA 4B3SQ 1LYLA 4IOCA 3DM3A 4UP8A 4BY1G 4LF6L 4JI1Q 5LMNL 3EN2A 4OWXB 1XMQL 3TQYA 1I94Q 1PHJA 4YHHL 1VQLA 2N8NA 4DAYB 2AWNA 3OYYA 4HJ8A 4A93H 2FXQA 4B3ML 4POGA 3CF5A 1LTLA 2L15A 1IBLL 1IL2A 4DR2Q 4YCUA 4X6AH 1EQRA 4RMFA 2WAQE 3TRZA 4A3KG 4LF8L 1MIUA 2JA5H 1IXRA 1E7ZA 4DR3L 4R4TA 2UUBL 2UXDL 1Q86C 4DV3Q 4B3SL 2V1CC 1XNRQ 4LF4L 1QVGA 3S17H 1LUZA 3PO3H 1PYBA 4BBRG 2QEXA 4A76A 2HQLA 4H02A 3HOXH 2MO1A 2VQFL 1TXYA 2OCEA 3ER0A 1ASYA 3I4MH 4P71A 1IBML 3FKIG 4A3EH 3M7NA 2CWPA 5ELNA 3L7ZC 4DR7L 4A3IH 5C4XH 2E2HH 1KL9A 3PUVA 2N78A 5LMNW 4LF7L 1D7QA 4OO1I 1XTDA 4JBWA 1VQCA 2AKWB 3M3YH 1TWFH 3KF8B 4BY7H 4YCVA 2ZM6L 1UE1A 3J80i 2EQSA 4ME3A 4NXNL 2E5LL 2WB1G 2KENA 4LF9L 2MO0A 2ASBA 1KQSA 4NPSA 1FJGQ 4DV5L 2CCZA 4PZ8A 5LMUL 1PH3A 1GVPA 2NN6I 4DR1Q 4JI3Q 2JA7G 1K8GA 1WI5A 1AE3A 3W1BA 4OO1G 3LGJA 5M3MG 2JQOA 2NZHA 3PUYA 1GM5A 4R4OA 4R1JA 1WYDA 2E8GA 2NZOA 5E7NA 1K8AC 4O2DA 4LW1A 4DUZQ 1X54A 2R92H 4DR5Q 1K0RA 2ZTCA 3K8AA 2F4VQ 1D8LA 4POFA 3I4NG 3KF6B 1E24A 3CMEA 1VQNA 3GO5A 2NN6G 1W3SA 2CQOA 4GKKQ 1ASZA 2OTLA 2VS1A 3CPFA 4K0KL 3H0GH 2UUAL 4X65Q 1RL2A 4JI8Q 1BBWA 1JJCB 3BJUA 3S2DH 4XIGS 3G4SA 4GLXA 4IO9A 4BXXG 4QGUA 1C7YA 1HNZL 4DUYL 2VW9A 1CKNB 5AJ3Q 2ES2A 3S1MH 2UU9L 1PVOA 1I3QH 4KI0A 1L1OA 1KHIA 1UWVA 1Z9FA 4FDBA 2Q2IA 1N36Q 3AYHB 3HKZE 4C2MH 4A3FH 3A0JA 2JEAI 3I4OA 2N49A 1HR0Q 4QIWE 3RLOA 2Z6KA 1UEBA 1VQAA 2RHSB 3AFPA 1NE3A 3EBEA 2VQEL 1CSQA 2R6GA 4IJHA 4OWTB 4NXMQ 1YI2A 4A3JH 4DV2Q 4HIOA 4DV1L 4LFCQ 4LUZA 4HJ7A 1NY4A 2K50A 3GDEA 3U4ZA 1Y1WH 3KYHC 1A62A 3PF5A 2HHHL 1PH5A 1PH9A 2R7ZH 2GVBA 3M4OH 1VS0A 2HIVA 3A74A 3CXCA 2PI2A 3G71A 1B8AA 1L1OC 2BA1A 2ZTEA 1NTGA 1VQ8A 1VQ7A 5C0XJ 4QQBX 3T1YQ 5IP7G 4HIMA 2R7FA 1QUQA 2JA9A 1VQKA 4LUOA 1QVFA 5H1SE 1Q46A 2ZJPA 2RF4A 4X62Q 1FL0A 2Z6KC 4JI1L 1K73C 4P72A 2E2JH 2AMCB 4GKJQ 2IHFA 2JA6G 5C0XI 4DR6L 1HNWQ 3CC2A 2B63H 5C3EG 4WJ3M 3JAMi 5IYBG 4AYBG 1OXXK 4R4IA 3F8TA 2Z0SA 1SR3A 4KHZA 4DR2L 1IBKQ 1KC8C 2K52A 4JI4Q 4JI7Q 4IJLA 2OQ0A 3KDFA 4DV3L 2VUMG 4JYAQ 2XTIA 1Y1VG 1VQOA 1VQFA 3KLWA 2K14A 1VQ6A 1VQIA 1U0LA 2K5VA 4OX9Q 3W5OA 5BR8Q 1YHAA 5C0XG 1UE6A 1N33L 1CKOA 2JEBI 4MTNA 3J81i 4LWCA 3T1HL 1PH6A 1HNXQ 3CCUA 3M9BA 1E3PA 1GKHA 4PZ7A 5M3FH 2PQAB 4NB3A 3RN2A 4UY8C 4HIKA 1X9NA 4BBSG 2R7DA 3CCQA 4LFAL 5C44H 1M90C 1YHQA 1KRSA 3CCMA 1OXTA 4A3DG 2CKZB 4OWWB 4A3CH 4A3GG 3GD7A 2A1AA 2C35B 3H3VH 3MEFA 1WJJA 1RIPA 1M1KC 1HZBA 4P74A 1FJGL 2LSSA 4X64Q 2D0OA 2GVAA 5FLMH 4OXPA 4YY3L 5M5XH 5FJ8H 3RZOH 4GOPA 1VQDA 4HIDA 1H95A 3B6YA 2IX0A 3CCLA 3GTLH 2QGQA 4B3RL 5IWAL 3PUZA 3PIPA 4LNQA 3TS2A 5JEAG 1O7IA 2IT1A 3NEMA 4JI2Q 4JI5L 3UDFA 4MNOA 4LFBL 4LF5L 3GTGH 3E9HA 1MJEA 3OTOQ 3CCEA 1I6HH 4DUZL 5IYCG 4DR5L 3GTPH 4DV7L 2F4VL 2DUDA 3PO2H 4GN5A 4QY7A 2B29A 3K0XA 3HOWH 4A3LH 4GKKL 2F3IA 3S1RH 4GOPC 2UXBL 4JI8L 3STBC 3HOUG 2K5HA 3CCVA 1XNQQ 2ALYB 1JJGA 3PGZA 3AEVA 1YJWA 1YEZA 4RG1A 5AJ3L 3A5ZB 3J7ZC 4B3TL 2RHQB 4JI0Q 4A3BG 3F1ZA 4R4CA 4GN3B 3BZCA 4JV5L 4X66L 4C3HH 3EIVA 1VQHA 3TS0A 1U5KA 1HZ9A 3I2ZA 4DV4Q 2OWOA 3HOYG 4EQ5A 5DLQE 1OXUA 1HR0L 1I5FA 1WCMH 5IYDG 5LMNQ 1DGSA 4A3MH 1XMQQ 2I5MX 1EIYB 3HOVG 2EIFA 3ERSX 4HJAA 1MJCA 3UE1A 4B3MQ 4LFCL 2KHIA 4JI6L 1TWCH 1HZCA 4C3IH 1IBLQ 2A8VA 3MXNB 2B3GA 4KHPQ 3D0FA 4BY1H 1WFQA 5IP9G 3NBHB 1CSPA 5GAEC 2R93G 1VQBA 4DR3Q 1TWGH 2UUBQ 1X6OA 2UXDQ 3HOZG 3GTMH 1N32Q 1SROA 3T1YL 1JB7A 3K81C 2WAQG 1T9HA 4DV6L 1IZ6A 3ULLA 4YWMA 1V9PA 3A5UA 4PMWA 2VZAA 1SMXA 1IBMQ 4A3KH 1JMCA 3S24A 1G6PA 1C9OA 4DR7Q 5C4JH 2I5LX 2JA8G 1HJPA 4AQYL 4GN4B 2JK8A 4LUVA 1IBKL 4BBRH 2CFMA 2MFIA 1NBWA 2Y0SE 3NELA 2YTXA 2QA4A 3U4VA 2KCMA 2ZM6Q 2NVYH 3FKIH 4JOIA 4NXNQ 2E5LQ 1SFOH 3CC7A 2UXCL 4OX9L 3TEHB 5BR8L 1VQEA 2CWAA 1Y14B 1J5EL 3K7AH 1YZ6A 3AFQA 3ULPA 1HNXL 2YYZA 1L1OB 4A93G 1CUKA 1VQ5A 1A63A 1N34L 5GADC 3PSIA 3IRBA 3WWVA 3CW2C 1QZHA 4DR4Q 3FP9A 5EAYA 2JA5G 3RN5A 3J81j 1X3GA 2KHJA 1I94L 1IYJB 4DK6C 3S1QH 3CD6A 4JOIC 2GN5A 1E1OA 2K5NA 1EIFA 3W1GA 2MNAA 3PO3G 2JA7H 3HOXG 1Q1EA 3K7UC 3RZDH 1XPUA 1PYSB 3S2HH 5M3MH 4AH6A 2UUCQ 4GNXA 4A3EG 2EXDA 1NMFA 2Q2HA 2UUAQ 4UPAA 4A3IG 3SGIA 5C4XG 3PV0A 1XMOQ 1QUQB 4DV0Q 3HKSA 1PH1A 3JAMc 1XNRL 1VQJA 3KFUA 3S14H 1C0AA 1OXSC 1HNZQ 3I4NH 3KJPA 1Q82C 2IHEA 2WFWA 1EOVA 4BY7G 1YNXA 3G48A 5JEAJ 1FVIA 5HY6A 2UU9Q 3CQZH 4YCWA 1J6QA 2I0QA 3S15H 1A8VA 1JJ2A 2OTJA 3HFZB 2WB1E 3CMAA 1BKBA 4J15A 4IPDA 4GNXC 4HJ5A 1YJ9A 1PA6A 1EYGA 3E9IA 4BXXH 1QZGA 3M4QA 2VY3A 3KDFB 3J81c 2VQEQ 4ALPA 4GLVB 3CC4A 3HKZG 1XNQL 5K36G 4A4IA 1LM0A 1E22A 1YHBA 5M5YH 3PIOA 3DLLA 4IOAA 3U58A 3AQQA 1X3FA 5HGQA 2R92G 2Q2UA 2WP8J 1PFSA 1S3OA 5IE8A 1SRUA 4DR1L 4JI3L 2NVTH 2IY5B 4MZ9A 5GAHC 3ICEA 1KD1C 1TWHH 4IPCA 3H0GG 1VQ4A 3J7A5 4XTCS 1XJVA 1HZAA 3L2PA 1Q7YC 4DR6Q 1NMGA 3D31A 3RLNA 5IP7H 2PNHA 3CCRA 4L5QA 3F2BA 4KHPL 3F2DA 4GOPB 4X65L 4IPGA 2JJQA 1AH9A 1CKMA 3TREA 4PG3A 3JC66 2ZJRA 1PH7A 3CAMA 2JA6H 1Q8KA 1N32L 2PI2E 1P16A 5C3EH 4A3FG 1K9MC 5IYBH 4AIMA 4JBKA 1P8LA 4DPGA 1EFWA 3I4MG 1Q81C 1N33Q 3U50C 1JT8A 1L0WA 3T1HQ 5GQOA 2ID0A 2F52A 1YBYA 4BA1I 4A3JG 1E1TA 4L5TA 3J80c 5JJIA 2ZTDA 1A0IA 1N36L 4L5RC 2VUMH 1Y1WG 2R7ZG 3PCOB 1Y1VH 1UE7A 4JG2A 4TVAB 4LFAQ 4LF6Q 1TWAH 2BH8A 2K75A 3M4PA 1G291 4YHHQ 4QL5A 5FLXc 3BU2A 3F2CA 3STBD 4NXML 1G51A 5GAGC 4DV2L 1BVSA 1QVCA 1SLJA 4UP7A 1PH2A 1VQPA 3GTJH 4BA2I 4JC0A 3FHWA 1VQ9A 5JJLA 4C3JH 3I55A 3KF6A 3ZJYC 4BBSH 1HH2P 4LF8Q 3RR5A 4YY3Q 2B63G 2AWOA 2YTVA 4APVA 4IFDJ 4QJFA 4IPHA 1VQMA 4A3DH 5IT9c 2D0PA 4A3GH 5ELOA 1Q1BA
chains in the Genus database with same CATH superfamily
4Y7NH 2Z1CA 4B3RQ 2MJ8A 1G6ZA 4YWLA 1FD7D 1L0YB 1SNPA 3QJYA 4FF4A 2PMZE 1TT2A 3GV6A 4GKJL 2BA0A 4UP9A 2Z8LA 1EWIA 1JICA 4R4QA 1I4GA 3K0YA 4DNIA 4FYDA 2QKIC 3ULJA 4LF7Q 3KJOA 1LT4D 2O5IC 2DY8A 3Q24A 5M3FG 2H4OA 4KKTA 2H5XA 4LF9Q 2L12A 1F2MA 3D8GA 1B70B 5C44G 2B2UA 1X56A 3M85A 2SNMA 4DKAC 1PH4A 3TP8A 2QDLA 4MN3A 3FPPA 4K6DA 5FJ8G 3MVVA 5D14A 5EPJA 3D4RA 4L5SA 4OONA 5ELBA 3BDCA 1S40A 1SMYC 1U4RA 1L2FA 3HOYH 4K0KQ 1ENFA 3BG3A 1AE2A 2KCCA 4G4KA 3SEBA 3KOJA 3HOWG 1VCIA 4A3LG 3EVQA 4HSVA 1D1KA 4PZ6A 4DUYQ 2ZXPA 3OW2A 5CV7A 5M3FB 1LTAD 3NK9A 2O2LD 2FFKB 1KIXA 3VR6A 2N55A 1EY7A 2JE6I 4GNXB 3MXPA 2ZJQA 1PRTF 4OHJA 3UE0A 3GQBA 4DAYA 2MQHA 4IUVA 1ICFB 3Q23A 2UXCQ 4CHTB 3TMEA 5IY0A 1GO3E 1K83H 2F4IA 4JCVE 2NVTB 5I9OA 1KXLA 1LT6D 4DN4M 1KTKA 1FGBD 5D65A 3VR4A 1VQLA 2N8NA 4DAYB 3IKJA 1ESRA 4B3ML 1TU2B 3HOWB 4A93H 4V0BA 1LTLA 3S1RB 3D6CA 1IL2A 4X6AH 3TRZA 4IZ8A 3SHLA 4R4TA 1H9SA 4H0LC 1Q86C 1ET6A 1UEAB 1WD0A 1AZQA 3S17H 4BBRG 4A76A 2HQLA 3HOXH 1ASYA 5ELFA 1LLRD 3FKIG 4JK1C 4F88A 2DNCA 4A3EH 3M7NA 1BO0A 4GZYC 4K2KA 2VUMB 3L7ZC 4ZYSA 1B50A 2B8GA 3PUVA 2G9HD 5LMNW 1GUSA 4FXGC 1D7QA 1XWEA 2AKWB 3MWYW 5E1FA 4Q0FA 4Q5VA 2CHBD 1V1PA 3KUPA 3Q22A 3J80i 2EQSA 4ME3A 1FNVA 4J1MA 1WTPA 2KENA 3PQIA 4IUTA 3C1FA 3K58A 2ASBA 1KQSA 3TZDA 2EYFA 2CCZA 4F87A 4A3GB 1VMPA 2NN6I 4DR1Q 2NBFA 3W1BA 5M3MG 5FKAC 2JQOA 3PUYA 2E8GA 1V1PB 4X3TA 4QB4A 3ERQA 5JAVA 1K0RA 1GOZA 3K8AA 5KYLA 4BBRB 5E4XA 2KCNA 4POFA 3GO5A 2NN6G 2CQOA 2NVYB 3FKIB 3H0GH 1PTOH 1BBWA 1TS2A 5G3LF 3S2DH 2NYZD 4XIGS 3G4SA 4H44C 4L8JA 4IO9A 3S16B 1KDAA 1WTQA 1B44D 4QCLA 3S1MH 2F0FA 1UWVA 5JVH3 4A3FH 1PXUA 3I4OA 3E0JA 1PRTC 3D4WA 4YIJA 3AFPA 1NE3A 3T51B 4IJHA 2R6GA 3R2TA 2EDGA 4DV1L 4LUZA 2F0NA 4K6LA 3U4ZA 1Y1WH 1A62A 2HHHL 3A7LA 3M4OH 3H91A 3A74A 3CXCA 2D9UA 1L1OC 2ZTEA 1VQ7A 4I65A 3KBGA 3T1YQ 2R61A 4LUOA 1DONA 5H1SE 1Q46A 2ZJPA 1FL0A 3CQZB 1EQTA 4JI1L 5D3DA 2IHFA 2JA6G 4GKJQ 1B3AA 3SK4A 1OXXK 4R4IA 4QUCA 5DEHA 4KHZA 1YNND 1QNKA 3X3NA 3KDFA 4HMIA 1WTRA 2EPBA 5C3WA 1VQOA 3KLWA 1TR5A 1VQIA 1U0LA 2KECA 1N33L 4MTNA 3T1HL 4WJWA 4BWGB 3CRLC 3NPPA 4UY8C 1GKHA 2PQAB 2WIIB 3KLSA 4HIKA 4BBSG 1ILPA 4LK1C 2RA4A 3P7JA 4J8QA 5KEEA 4A3CH 4RAUC 4HTHA 3I73A 3MEFA 4FF1A 2OXPA 1FJGL 2LSSA 2D0OA 2JA6B 3TN2A 5EKKA 1VQDA 2A6EC 3PIPA 1DOKA 4LNQA 3LX0A 3OW7A 2K01A 4JI5L 2RDFA 1D2BA 4CJ0B 2QEJC 4TSSA 5CV4A 2B2VC 3E9HA 1MJEA 4LF5L 2E2HB 1ZEQX 1BR9A 1PYWD 4DV7L 4RH6A 4GN5A 1TWFB 1KNAA 4BY7B 4DK1A 4GKKL 2UXBL 1A2TA 3OIQA 4M8AA 4JI8L 3STBC 2K5HA 3CCVA 2ALYB 1JJGA 4RGOS 1EWCA 1SNQA 3MXNA 3AEVA 1YJWA 3J7ZC 2D5DA 2RHQB 3NBHA 4HAEA 1MSHA 4XYOA 1E2ZA 4X66L 3EIVA 3FVQA 3NSWA 3HOYG 1HR0L 1ZXTA 1WCMH 4ZKBB 3R3OA 2XIWA 2EIFA 1F9SA 4HJAA 4B3MQ 4X3UA 4C3IH 5IGGA 3MXNB 2F3VA 3D0FA 2BE5C 2N88A 3NBHB 1AN8A 1VQBA 3GTMH 1N32Q 2IX3A 3K81C 3A54A 1II3A 2WAQG 3EROA 4DV6L 3R2IA 1U9RA 3A5UA 1D5XC 1X32A 1V1OA 3S24A 4RHRA 1HJPA 4ULLA 1ZKOA 3N6RA 4LUVA 1IBKL 2CFMA 1EQVA 1CQVA 1PTOD 2M2LA 2Y0SE 4HEDA 1LTGD 5IGFA 1SDFA 5I4DA 2R7ZB 1TIID 3HOYB 1STGA 2BDNA 4OX9L 2L4NA 1J5EL 2CWAA 1Y14B 3AFQA 3ULPA 4A93G 1VQ5A 1A63A 5COYA 2AUKA 3RUZA 3OMCA 2O5JC 2F0DA 4O1NA 3WWVA 3IRBA 1QZHA 2E2JB 2TMPA 3RN5A 5IGCA 2KHJA 3NBIA 1C8CA 3CD6A 4KD4A 4JOIC 2GN5A 2WAQB 4OO1H 3HOXG 3K5OA 3ND8A 4FVMA 1PYSB 2QDBA 4KY6A 4IUNA 1WTOA 4A3EG 2UUCQ 2Q2HA 1QB5D 2K03A 1K0SA 1QOHA 3HKSA 4E6IA 1K83B 2ENBA 1PH1A 1QNUA 1OXSC 2WFWA 1EOVA 1D6EC 5AFWA 1A8VA 1JJ2A 1U4PA 3J7AV 3BVZA 1AEXA 1ENCA 3BYTB 4J15A 4HJ5A 1YJ9A 4BXXH 4XQJA 3VYTA 3H3VC 3M4QA 2EYHA 2C5CA 4ALPA 5FO8B 4GLVB 2BDOA 1BCPD 3MFYA 4NP5A 3MAQA 3DLLA 1VDZA 1STYA 4G7HC 3S17B 2NVTH 4JI3L 2IY5B 4MZ9A 4R8NA 4A3EB 3H0GG 3ND9A 1HZAA 2EJFC 3VR5A 4L63B 5EPKA 1EZ8A 1NMGA 3MEHA 4K14A 5IP7H 4KHPL 4GOPB 2PQEA 4K5XA 4IPGA 3MXGA 1PH7A 3CAMA 1Q8KA 5JJZA 2PI2E 1P16A 4A3FG 4JBKA 4JW0A 1EFWA 2KQ3A 4CDCC 1N33Q 2A74C 3T1HQ 1JWSD 5GQOA 4ZLTF 1YBYA 1E1TA 2EYOA 3J80c 2ZTDA 2VUMH 1Y1WG 4S3SA 1Y1VH 2VB3X 1UE7A 4JG2A 1W6JA 4TVAB 3CHBD 3KLRA 4QF4A 3D3RA 4YHHQ 4KJOA 1TWCB 4DV2L 1HTLD 1SLJA 2F3WA 3FHWA 1A3VA 2L1BA 4C3JH 1HFGA 1B3QA 3I55A 3MC0B 3S2DB 4LF8Q 2PZWA 2PW5A 4QJFA 2D0PA 4A3GH 2B39A 5FLXL 3TBIB 3S1MB 2LXKA 4DR4L 4AYBE 4TQUS 1CHPD 4JI5Q 2SEBD 1EUJA 4LF5Q 1GHKA 3I70A 1CKNA 3MHBA 4KJNA 3HS0C 1BUVT 2N3SA 4A3FB 1TY2A 2EE1A 4DV7Q 5IT9L 4DAMA 1NR2A 2KJXA 5JEAH 5KRUA 4FXDA 4JI4L 1NR4A 2UXBQ 1XMOL 4PMCA 1Y1WB 2HT1A 5IYCH 4JYAL 3OOCA 3Q8DA 3M4OB 1IYUA 2Q2TA 3PIO3 4DV5Q 5LMUQ 3UDIA 4A3CG 3PUXA 3S16H 2VNUD 1OTCA 2FMMA 4ILWA 1EQQA 3I8ZA 4X66Q 3PUWA 4YWKA 3QWNA 4DK3C 4GLAC 1SXTA 2KCTA 1V8QA 1Z47A 3M7GA 3RNUA 4KY7A 2DGYA 1EWHA 3ZYYX 3S2HB 4WJ4A 1NSNS 3BZDB 2OT2A 2E74C 3GTKH 1XPRA 1K3RA 4ZUIA 1F2YA 4OL7A 3HOVH 3BVGA 3P20A 3BZKA 2WACA 2ATWA 3I56A 4EQOA 4P73A 4DV6Q 3OTOL 3CKIB 5IP9H 5EBDA 1EZ6A 5NUCA 3HOZH 1O7LA 1TY0A 3E0EA 1MD2D 3GTQH 3EA6A 1CA5A 2HIXA 1PH8A 1SYCA 2F0MA 4KKUA 2NVXH 4P75A 2NVQH 1WCMG 1N9WA 1J5EQ 3K80C 2PO4A 4QMGA 2KUMA 1E2WA 1FNUA 2K5DA 5J1ZA 2IX1A 1STNA 2GA4B 4C3IG 4DV4L 4IOCA 3SK5A 5KNCA 3EN2A 4OWXB 2JSOA 2R3ZA 2DY7A 3OYYA 1PMRA 3MXUA 3U9OA 2F0QA 2RVLA 4YCUA 3FMCA 1MIUA 2A69D 4DR3L 1RKNA 2UUBL 2UXDL 4DV3Q 4B3SL 2V1CC 2MP1A 4LF4L 1QVGA 2OF1A 2QEXA 3IFDA 2B2YC 2VQFL 3ER0A 2OCEA 3NE5B 3ONAB 3OIPA 2E2HH 1TWAB 1WCMB 3TSSA 4OO1I 1XTDA 2EYLA 1TWFH 4BY7H 4YCVA 3GTJB 4NXNL 1ZYRD 4ZRZA 4EQPA 2MO0A 1SNCA 4KTAA 1STBA 4NPSA 2F0TA 4PZ8A 3GTMB 5CMDA 2EY1A 1UNSA 4RKLA 4JI3Q 4OO1G 3C2PA 3LGJA 4RA8A 3R8BA 4C1NI 5E7NA 1Q3LA 4DUZQ 1S5ED 2F4VQ 3SR1A 3QOJA 1E24A 3I90A 1JOOA 5TSSA 2VS1A 3F2UA 3L3OC 1KDBA 4GLXA 4BXXG 1BDOA 1HNZL 4ZK9B 5CV6A 2VW9A 5AJ3Q 2ES2A 3HOUB 1I3QH 4KI0A 1L1OA 3H09A 3WOFA 3HKZE 4C2MH 1PFBA 1PRTB 4A3BB 1HPCA 1UEBA 4ODGA 2VQEL 1CSQA 3A8KE 4OWTB 4DV2Q 3VYSA 4HIOA 4PMBA 2R7ZH 1M4VA 2GVBA 3K59A 1PFMA 3HG9A 3T13A 1B8AA 2BA1A 2K7VA 1KLGD 2E75C 1A6XA 5C6AA 5IP7G 1QUQA 2JA9A 4OELB 1QCBD 3SVMA 2F0OA 2RF4A 2Z6KC 2E2JH 5FOBB 5EKLA 4WJ3M 3A7AB 4ME5A 4DR2L 1Y8OB 1KC8C 4FF2A 4UAIA 1K3BC 1RCVD 4JI4Q 1RF2D 2VUMG 4JYAQ 1Y1VG 3Q0AA 2K14A 1VQ6A 3AMUA 5BR8Q 2G5DA 4LWCA 1HNXQ 4PV1C 3PMFA 1IYVA 1E3PA 4PZ7A 5HGTA 2HD3A 4C3JG 1X9NA 1HRJA 3CCQA 1KRSA 1OXTA 2CKZB 2B2VA 2EY5A 3H6MA 1A15A 4A3GG 3V96A 1U4LA 3CU7A 4WORA 2GVAA 3MTSA 5FLMH 4HIDA 3B6YA 2IX0A 3GTLH 2QGQA 1SYBA 1CA6A 2PMZB 3PUZA 1LACA 5JEAG 1YNJC 2EZVA 2A68D 3NEMA 3OTOQ 4A3IB 1TS3A 1Y1VB 5IYCG 2ICEC 4DR5L 2L11A 5A2QL 3K5NA 1FNWA 3A8JE 2DUDA 3NTIA 1D5ZC 1LTSD 4QY7A 1ENAA 2F3IA 1WVLA 4N9TA 1H9SB 2HQEA 4IURA 4C3JB 1XNQQ 5E4WC 2F0IA 1R4QB 4RG1A 4B3TL 5C4ZA 3F1ZA 3BZCA 1BF4A 4IN3A 1VQHA 3L9AX 4DV4Q 3OMGA 4EQ5A 2EYJA 1I5FA 2KVMA 1DGSA 1SE2A 3HOVG 2Z6BA 1EYAA 3ERSX 4B9WA 3UE1A 2E76C 4LFCL 2KHIA 2WV6D 1TWCH 1HZCA 2A8VA 1DCZA 4IUPA 4DXFA 2B3GA 2K05A 4BY1H 1HQMC 5IP9G 4DR3Q 4XXEA 1TWGH 2UUBQ 1X6OA 2UXDQ 3HOZG 5IODA 1JB7A 4TKOB 3URYA 1GUTA 5BN4A 1IZ6A 1HTPA 3ULLA 3BDOA 1SMXA 1G6PA 2PPBC 4AQYL 1CQFA 4GN4B 3VR3A 4P2CB 5EJWA 3TZUA 4OIJA 3NELA 2QA4A 2KCMA 4JOIA 4NXNQ 3CC7A 3G6JB 3GTKB 3HOVB 2LMCB 4KN4C 5IGDA 3N52A 3VA7A 5GADC 2OEOA 3PSIA 3CW2C 1O7ZA 5EAYA 1Q90A 1IYJB 2E2DC 2QF7A 3HOZB 2Q8TA 3GTQB 1BQQT 5DM73 2DN8A 1E1OA 2K5NA 5EKIA 1WTHA 1Q1EA 4QUFA 3TP5A 3S2HH 2NVXB 2NVQB 3T53B 3PV0A 5L37A 5BN3A 1VQJA 1C0AA 2A6HC 5DNFA 2M00A 1HNZQ 2B2TC 3I4NH 1JCKB 2IHEA 4BY7G 1JE4A 3G48A 4BS9A 1TS4A 4WRDA 4YCWA 2OTJA 3HFZB 2WB1E 1IHZA 3CMAA 4GNXC 3T16A 2VXWA 1EY9A 1B9MA 1Q8IA 4DNRB 1IW7D 3HEJA 2C9OA 3KDFB 3J81c 2VQEQ 1RJTA 4A4IA 1YHBA 3PIOA 2L0CA 2KEEA 4K5WA 4IOAA 3AQQA 2Q2UA 5IE8A 1S3OA 1GUOA 4K8IA 4CJ1B 3GTGB 1SBBB 4OIKA 1VQ4A 2H1EA 1Q7YC 5JPNC 3NUCA 1F2ZA 3J7AF 1B2TA 1SYFA 4CDDC 3E3XA 2MHVA 1CKMA 4PG3A 3JC66 3SDZA 1CI3M 4TRDA 5CV8A 3UI2A 5IYBH 4K2LA 3QR8A 1JT8A 3U50C 2ICIA 3HRZC 1DM0B 4C3HB 2QW7A 2ID0A 2F52A 4BA1I 5JJIA 1N36L 2R7ZG 1JOKA 1TWAH 3M4PA 2K75A 5C0XH 1G291 5KGUA 1TS5A 5FLXE 3F2CA 3VYRA 4ZUJA 4NXML 1VQPA 3GTJH 4R9WA 1SNDA 3KF6A 1VQMA 4IPHA 5ELOA 1Q1BA 4AIMA 1H9RA 1MI2A 2LXJA 1V1QA 1ET9A 4X62L 1I3QB 1TVXA 5DAUA 1HNWL 1FGUA 4C2MB 1BBUA 1W2BA 4PNYA 5M5WH 3C3LA 4HCEA 1STAA 1XPOA 3D4DA 1PV4A 4JI7L 3GTOH 1JORA 2D62A 4X3SA 1X3EA 4LAAA 4DV0L 1VQGA 1I4RA 1EY8A 1XTCD 1EU4A 1QG7A 2J7ZA 2LFNA 3VDYA 4B3TQ 3NENA 1EY6A 1I6VC 2F0JA 1GUGA 4HN7A 3HOUH 2OQKA 4KHVA 2KHSA 2VL6A 4CKCA 5FLMG 1HUNA 2Z4IA 4C1NK 2NZ1D 3P1HA 4A3BH 3DWQA 1EU3A 2KA7A 5J3BA 3L0OA 5IYDH 1I50H 2RCNA 4HJ9A 5JPMC 1N8RC 2WKDA 4JBJA 2KOLA 1HHVA 4FF3A 1NAPA 4JI2L 3DEPA 5FO9B 1UE5A 1X55A 2G9DA 4EX5A 1JB3A 1FYCA 4IALA 1SJHD 1HQRD 1YVCA 4I7AA 1MBYA 4AQYQ 5I6WA 3JAML 3CCSA 3G6EA 2FMCA 4I7ZC 1EIGA 4C56C 1QJOA 3J81E 1Z7TA 4GS3A 5I2YA 1VF7A 2ZT9C 4DV1Q 1K28A 1XX8A 1EOTA 2Y0SG 3TP7A 2HHHQ 2K6AA 1B53A 3GTLB 3CP0A 3ITPA 2Z9HA 3DWPA 2Q8RE 4R8IA 2AQ1B 4KLKA 3EJIA 1WOCA 1LYLA 2MPMA 3DM3A 3EQLC 4UP8A 1CHQD 4BY1G 4F7XA 4JI1Q 4LF6L 2B2YA 1EYCA 1FR3A 3TQYA 2F0EA 1PHJA 2NB0A 2FXQA 2LKVA 1O80A 4H13C 4POGA 1ICWA 3M4YA 2Q8IB 2EOTA 2RKSA 1RHPA 4RMFA 1RTNA 2JA5H 1IXRA 5C3EB 1GUWA 4KKSA 1G91A 2F03A 3PO3H 1PYBA 2MO1A 1Y69U 1TXYA 2FHTA 4P71A 4JPBW 2CWPA 5KYIA 4DR7L 4A3IH 5C4XH 1JQYD 1KL9A 2Y0SB 2PNRC 4LF7L 3NQTA 1VQCA 5CGKA 1KNEA 2ZM6L 1UE1A 4LF9L 2EVBA 4BY1B 1EEFD 1FJGQ 1TWGB 1A3UA 3LWUA 3DUZA 1AP0A 1CTMA 4KMUC 2L5TA 1WI5A 1AE3A 2X6GA 4RWSC 1KAAA 1RD9D 4H7BA 5K36H 4KN7C 3I4LA 3MA2B 4R4OA 1WYDA 1DD2A 1X54A 2R92H 1D8LA 3I4NG 3CMEA 4DK0A 4GKKQ 4G57A 3CPFA 4K0KL 2UUAL 1RL2A 4JI8Q 1JWUD 1JJCB 5T1GA 4DFAA 5ELCA 4DUYL 1CKNB 1I4XA 3K5LA 1PVOA 2J0TD 1J8IA 2DJGC 2RCFA 1N36Q 1Z9FA 4CDEC 2Q2IA 3TP6A 1TQOA 3A0JA 2JEAI 2N49A 1HR0Q 4QIWE 3RLOA 2Z6KA 1UUPA 1QWYA 3EBEA 1I4QA 4NXMQ 4N9PA 4A3JH 1PDQA 1STHA 1HUMA 2K50A 3GDEA 3NTHA 3KYHC 3PF5A 1YNNC 1PH5A 1VS0A 1PTOF 2PI2A 2JP1A 4F8MA 1VQ8A 1NTGA 1NUCA 2EYMA 3I4NB 1VQKA 1SE4A 1QVFA 2F0LA 5IGBA 4X62Q 1DOLA 4KD3A 4P72A 4EQNA 1LABA 1PRTD 4NW2A 5C0XI 1HNWQ 2B63H 5IYBG 2YU9B 2X6LA 4AYBG 2F0VA 3F8TA 2Z0SA 1IBKQ 3G7LA 2FINB 1SYEA 4JI7Q 4IJLA 2JA8B 1VQFA 5HURA 4OX9Q 2K5VA 5C0XG 1CKOA 2JEBI 1EYDA 2CW0D 3J81i 1LT5D 3M9BA 4XDXA 3RN2A 4NB3A 5KNDA 2PYKA 5I6YA 4IFDH 4LFAL 4PQXA 2HCIA 1M90C 1YHQA 1HA6A 3Q6SA 3CCMA 1WTXA 3E5SA 4OWWB 3VA5A 3H3VH 2P5ZX 1WJJA 4XQNA 1RIPA 1M1KC 4P74A 2V4DA 4OXPA 4YY3L 3RZOH 5A2QE 2F0KA 4AYBB 4FNFA 5IWAL 3TS2A 3SK8A 2IT1A 1BCPF 4JI2Q 3UDFA 4LFBL 3GTGH 1S5CD 1XYIA 1STEA 3GTPH 1PFNA 3PO2H 2RDGA 5K5PA 1RTOA 4XT1B 3M3YB 1KABA 2RBMA 5IGEA 3OWFA 4GOPC 4J6HA 3HOUG 2JXMB 3MZ5A 2F0WA 3OPOA 4WFN3 2A6ED 1HA5A 3LNNA 3T56B 4DGZA 3A5ZB 4A3BG 5CV9A 4R4CA 4GN3B 4JV5L 2B2WC 4C3HH 4EGVA 3TS0A 4UDUC 2O4XA 5DLQE 1OXUA 3FRPB 1H9JA 1GJXA 5IYDG 4A3MH 2I5MX 1EIYB 5G3LD 3I72A 1MJCA 4MIUA 2D2CC 5BN5A 5M5WB 4NMZA 4JI6L 1DYQA 1PTOC 3GTOB 4KHPQ 4RGNA 1WFQA 5GAEC 1CSPA 3D6WA 3BVMA 3A8IE 1SROA 3HGBA 3T1YL 5C3XA 2CQAA 4JVZA 1JWMD 1T9HA 2NUCA 4YWMA 1V9PA 4V190 4N8X1 4A3KH 3W3AA 2I07B 1C9OA 4DR7Q 5C4JH 2I5LX 5E3FA 3I4MB 4K8JA 5EBCA 2MFIA 1JOQA 2BE5D 3NHHA 2CH4W 3P75A 3U4VA 2ZM6Q 1LTTD 5EPLA 1HXYD 1SFOH 5J22A 3H94A 2RQXA 2BCOA 4RHSA 1I50B 3V2TA 1VQEA 2DNEA 3K7AH 1YZ6A 2F0SA 1L1OB 1N34L 4CBVA 2JN4A 4DR4Q 4FXKC 3FP9A 2JA5G 1X3GA 2B2TA 1I94L 1CZGA 4DK6C 2K04A 1EIFA 4DF7A 2MNAA 3PO3G 2JA7H 1LO5D 3VR2A 4B08A 3RZDH 5C5MA 1XPUA 4AH6A 4GNXA 2EXDA 2RDHA 1NCVA 2UUAQ 3A56A 4A3IG 2SDFA 5C4XG 1XMOQ 1QUQB 1XNRL 1BCPC 2XNAC 3JAMc 1XXGA 2VB2X 4HR7B 2F0GA 2CH4A 1UAPA 4X3KA 2K32A 1YNXA 1J6QA 1ML0D 3S15H 5C44B 3TDQA 1BKBA 4IPDA 2SOBA 4IUUA 1EYGA 3HKZG 5K36G 1Z6HA 5M5YH 1E22A 4KV6A 2JA5B 5M5XB 1AZPA 2XWJB 4ZKCB 3IL8A 1EFID 3U58A 1X3FA 5HGQA 2R92G 2HCCA 2ZXRA 2WP8J 3PO3B 1SRUA 1I4PA 1X3QA 1EEID 1JC7A 5GAHC 3ICEA 1VF5C 1KD1C 1ONLA 1TWHH 1K8OA 1I6HB 3EFXD 3J7A5 4XTCS 1XJVA 1IKLA 5CBAE 3L2PA 5C4XB 2IPKD 1PZKD 4DAVA 1WTVA 3RLNA 2PNHA 1EL0A 3CCRA 4L5QA 5IIFA 3F2DA 1H9KA 3SK6A 4U68A 2EJGC 4X65L 2JJQA 1BNZA 3TREA 1DZ1A 2ZJRA 2TSSA 5I2XA 1N32L 5C3EH 5IOCA 1K9MC 1P8LA 4DPGA 1K8MA 1Q81C 2IW3A 1DOMA 5EGTA 1NNXA 1A2UA 5A35A 3HKZB 4A3JG 4FP5D 1A0IA 4L5RC 1ESFA 4ZQ3A 3PCOB 3R93A 4LFAQ 2BH8A 3C1EA 2R92B 1QILA 4QL5A 5FLXc 3BU2A 5M9OA 1G51A 5GAGC 1BVSA 2DJFC 4UP7A 5DM63 1EIHA 1B1ZA 4ZAIA 3J80L 5JJLA 3ZJYC 1HH2P 4YY3Q 1G8ZD 2B63G 4APVA 4A3DH 3NWTA 5IT9c 2HDLA 3KK7A 4B3SQ 1R9TH 4LF4Q 3FEWX 5IWAQ 4A75A 3NQIA 1PLFA 2VQFQ 2RSNA 4LFBQ 4IFDI 3PF4A 1AW7A 1SE8A 1R4PB 5GROA 2YTYA 1HR0W 3H3VI 2M9VA 1NJIC 2UUCL 1LTBD 4A3JB 3RLFA 4IFDG 1KRTA 2A19A 5JJKA 4JV5Q 2YV5A 1Q12A 2F1MA 1SE3A 1F77A 3QG1A 2B63B 3S1QB 1MSGA 3I7FA 1SN8A 2I5HA 1B7YB 2XGTA 5M3MB 1SSOA 3CCJA 4JI6Q 2B2UC 3UDXA 4X64L 1V43A 2XN9C 4O0AA 5C5LA 4DU9A 3CPWA 5FK9C 1MKHA 3S14B 1YITA 2K4KA 2F0UA 3PO2G 3QIAA 2K5QA 3JAME 5KIXA 1EY0A 2PCFB 2IJ0A 2E2IH 3BS1A 1OXVA 2MUYA 2CW0C 3QOLA 3QB3A 2R93H 2AHOB 1X65A 2X69A 2BH2A 1Y8PB 1CFMA 1U4MA 5CV5A 1KAWA 2PQAA 2YU9H 4Y52H 3S1NH 4JBMA 1GD7A 5ISRA 1S72A 4C3HG 2KBNA 1F9RA 1JE5A 3J7YW 5LL6S 3NWSA 3RZOB 2JA8H 1BOSA 1YJNA 1L0XB 4A3MG 2A69C 1YIJA 3UDGA 4JI0L 3W2DA 5CORA 4RGMA 3H15A 1BBXC 3U9SA 1T5XD 4FO2A 1N34Q 4RKBA 4MTKA 4DNTB 5LMNL 2BOSA 1XMQL 1MHWC 3GTPB 1I94Q 5EQ0A 4YHHL 1GUNA 1GXDC 3OSOA 3PO2B 5D3IB 2AWNA 1CK1A 4HJ8A 3CF5A 3HP3A 5J39A 2L15A 1IBLL 1SEBD 4DR2Q 1EQRA 2KEDA 2WAQE 4A3KG 4LF8L 3NXWA 1E7ZA 3KF8A 1ZYRC 4LJZC 1XNRQ 3E6ZX 1LUZA 4NDXA 4H02A 3IFTA 1IBML 2SNSA 2B8FA 5ELNA 2N78A 4A3MB 5CYUA 4JBWA 2IWHA 2Z4HA 4ABNA 3KF8B 3M3YH 1B9NA 4XQQA 3RMHA 2E5LL 2WB1G 4BBSB 4DV5L 1KDCA 1VMCA 1GHJA 4M1UB 5LMUL 4EVOA 2A5HA 1PH3A 4Y7NB 1GVPA 5IT9E 2JA7G 3IAYA 1RDPD 1K8GA 1SNMA 5I9PA 2HUGA 3GP7A 4A3KB 2I46A 2NZHA 4OGQC 1GM5A 4R1JA 2NZOA 1DXMA 5C4JB 1K8AC 4O2DA 4LW1A 4DR5Q 2ZTCA 3OWEB 1TKWB 1F9PA 2EXZA 2HDMA 1G2TA 2L9HA 2J4XA 2K5WA 3KF6B 5JVG3 1VQNA 1W3SA 1ASZA 1CM9A 2OTLA 1SFOB 1S5BD 4X65Q 1LTRD 3BJUA 1ILQA 3K7AB 4XYQA 4G7ZC 4QGUA 1C7YA 1RODA 2UU9L 2WB1B 3A55A 2EY2A 1KHIA 4FDBA 3DXJC 4RCOA 3AB9A 3AYHB 3NTKA 1VQAA 1QE6A 3I4MH 2RHSB 2JA7B 3DMUA 3RZDB 4KK7A 1EY5A 1YI2A 1JR0D 4LFCQ 4HJ7A 1NY4A 1PH9A 2HIVA 3G71A 3DHQA 2NTSA 3LWEA 5C0XJ 4QQBX 2L55A 2R7FA 4HIMA 2AQ3B 1K73C 5FO7B 3S15B 2AMCB 3CRKC 4DR6L 3CC2A 1D5MC 5C3EG 3JAMi 1KLUD 5ELDA 1SR3A 4XT3B 1SMYD 2K52A 4K5VA 1PZJD 4RGTA 5M5YB 2OQ0A 4DV3L 4CDFC 2XTIA 2XRSD 1YHAA 1UE6A 1E0BA 1PH6A 1TWHB 3CCUA 5M3FH 1DJRD 2CVRA 5KNBA 1SYGA 2RSOA 2A68C 2R7DA 3S9WA 1C4QA 5C44H 4CKEA 4A3DG 2PZTA 4A93B 4IUQA 3GD7A 2A1AA 2C35B 1O78A 1O7YA 1HZBA 4X64Q 3FDTA 2EYPA 1IL8A 1SJED 3WOEA 5FJ8H 5M5XH 4GOPA 1F2LA 1H95A 3CCLA 3HOXB 4B3RL 1O7IA 2NTTA 3BDLA 4IQZA 4MNOA 1PZID 1J9OA 3CCEA 1I6HH 1BXTA 4DUZL 1A3TA 1S5FD 4ZCKA 2B2WA 2XVSA 2EY6A 3SE0A 2F4VL 3HOWH 2B29A 3K0XA 4A3LH 1AFPA 2EJMA 2AQ2B 3S1RH 1E2VA 1HFNA 1X3PA 3MFGA 3GV3A 3PGZA 1YNJD 2LY7A 4A3DB 1YEZA 2WINB 5AJ3L 4JI0Q 1W6KA 1R9TB 5F2DA 3BYYB 4Z9CB 3V05A 1U5KA 1HZ9A 3I2ZA 2OWOA 2PW7A 5LMNQ 1XMQQ 1I4HA 4NKLA 1IBLQ 3H0GB 1PTOB 4CJ2C 2R93G 3O13A 3I91A 3KBXA 2ZXOA 1CT1D 1LTID 4HMJA 4RCNA 4PMWA 2VZAA 1IBMQ 1JMCA 4MHEA 2XRQD 2JA8G 1B4OA 2JK8A 2LS01 4BBRH 1S5DD 1H9MA 1NBWA 4B9XA 5LL6X 2YTXA 2NVYH 3FKIH 2E5LQ 3FPUB 1IKMA 2UXCL 1CZWA 3TEHB 5BR8L 3OHXC 1T5EA 1WTWA 1HCZA 1HNXL 2YYZA 1CUKA 4O42A 4DAPA 2E2IB 4CGYB 3PIP3 2R93B 4LMQD 3J81j 3S1QH 2IL8A 1SNOA 3W1GA 4DA2A 3S1NB 3K7UC 4HSPA 5M3MH 1IW7C 1NMFA 4UPAA 3I3CA 3SGIA 4DV0Q 3KFUA 1BCPB 3S14H 2WKCA 3KLSX 4HCSA 3KJPA 1Q82C 2NN6H 4N8FA 4RFBA 5JEAJ 1FVIA 5HY6A 2UU9Q 3CQZH 2I0QA 4ID6A 3DEOA 2K1BA 1PA6A 1WD1A 4KY5A 3E9IA 1QZGA 4CKBA 2VY3A 3T4AC 3CC4A 5T1IA 3QO2A 4U673 1XNQL 3X3MA 1LM0A 4G7OC 3NP8A 2A6HD 2QCPX 3SXHA 1PFSA 4DR1L 3WDNA 3J81L 4IPCA 3DM1A 2K33A 5CBEE 1C48A 2AUJD 1SYDA 2F0PA 2FJ2A 1LV9A 4DR6Q 2XWBB 2JYOA 3D31A 2QILA 3K6OA 4OEMB 3AU7A 4L6TB 3F2BA 3HZXA 5JOBA 3K5MA 1AH9A 5CR3A 5ELEA 5CC4A 4UHVA 2JA6H 1D1IA 3RD4A 1MGSA 5C4HA 4DXGA 1F9QA 3I4MG 2K28A 2PZUA 2XSCA 1L0WA 1EY4A 4L5TA 1S4ZA 3J80E 1M8AA 4QIWB 3DWAA 4LF6Q 2MGSA 2F0HA 3STBD 4C3IB 1LT3D 1Y8NB 1QVCA 1G2SA 3K57A 1SAPA 1PH2A 1OO9B 4BA2I 4JC0A 1VQ9A 3VYUA 3C46A 2A73B 4BBSH 3RR5A 2AWOA 2YTVA 4IFDJ 5LHY1 2NWGA 3W5OA
chains in the Genus database with same CATH topology
4Y7NH 1R9TH 4LF4Q 4B3RQ 5IWAQ 4A75A 2LXJA 1V1QA 4YWLA 2LXKA 4DR4L 4X62L 4AYBE 4TQUS 4JI5Q 2VQFQ 2PMZE 1EUJA 4LF5Q 4IFDI 4GKJL 4LFBQ 1CKNA 2BA0A 3PF4A 1HNWL 4UP9A 1FGUA 1EWIA 2N3SA 1SE8A 4R4QA 4DV7Q 5GROA 1BBUA 2YTYA 4DAMA 4DNIA 3ULJA 1W2BA 1NJIC 1HR0W 4LF7Q 3H3VI 5M5WH 2UUCL 3KJOA 1XPOA 1PV4A 4JI4L 4JI7L 2UXBQ 3GTOH 5M3FG 2D62A 1XMOL 2H5XA 1X3EA 4LF9Q 5IYCH 4DV0L 2HT1A 4JYAL 1VQGA 3Q8DA 3RLFA 4IFDG 2Q2TA 1B70B 5C44G 4DV5Q 1KRTA 1X56A 3UDIA 5LMUQ 3PUXA 3VDYA 4A3CG 4B3TQ 3M85A 3S16H 2VNUD 2A19A 5JJKA 1OTCA 3NENA 4DKAC 1PH4A 4JV5Q 1EQQA 2YV5A 3HOUH 1Q12A 3PUWA 4YWKA 4X66Q 2OQKA 4DK3C 4GLAC 2VL6A 5FLMG 2KCTA 5FJ8G 3I7FA 1SN8A 2I5HA 4L5SA 1B7YB 1Z47A 4A3BH 4OONA 3RNUA 2DGYA 2XGTA 3CCJA 4WJ4A 4JI6Q 5J3BA 3UDXA 1S40A 4X64L 1V43A 3L0OA 1L2FA 4O0AA 3HOYH 4K0KQ 3CPWA 1I50H 1AE2A 2RCNA 1MKHA 4HJ9A 5IYDH 1N8RC 1XPRA 1K3RA 3GTKH 3HOVH 1YITA 2K4KA 3PO2G 3KOJA 4JBJA 3BZKA 3HOWG 1VCIA 4A3LG 2ATWA 4JI2L 3I56A 2E2IH 4P73A 4DV6Q 4PZ6A 1OXVA 4DUYQ 1UE5A 1X55A 3OW2A 3OTOL 4EX5A 5IP9H 2R93H 2AHOB 1X65A 2BH2A 1YVCA 3HOZH 1KIXA 4AQYQ 1KAWA 2PQAA 3E0EA 3GTQH 2YU9H 4Y52H 3S1NH 3CCSA 1GD7A 2JE6I 4GNXB 4JBMA 1S72A 3G6EA 2HIXA 2ZJQA 3UE0A 1PH8A 2KBNA 1JE5A 2NVXH 2MQHA 4GS3A 4P75A 2NVQH 4DV1Q 2UXCQ 2JA8H 1YJNA 1WCMG 5IY0A 2Y0SG 4A3MG 2HHHQ 1GO3E 1K83H 1N9WA 1YIJA 3K80C 4JCVE 3UDGA 1J5EQ 4JI0L 3CP0A 1KXLA 3H15A 2IX1A 4KLKA 1N34Q 4DV4L 1WOCA 4B3SQ 1LYLA 4IOCA 3DM3A 4UP8A 4BY1G 4LF6L 4JI1Q 5LMNL 3EN2A 4OWXB 1XMQL 3TQYA 1I94Q 1PHJA 4YHHL 1VQLA 2N8NA 4DAYB 2AWNA 3OYYA 4HJ8A 4A93H 2FXQA 4B3ML 4POGA 3CF5A 1LTLA 2L15A 1IBLL 1IL2A 4DR2Q 4YCUA 4X6AH 1EQRA 4RMFA 2WAQE 3TRZA 4A3KG 4LF8L 1MIUA 2JA5H 1IXRA 1E7ZA 4DR3L 4R4TA 2UUBL 2UXDL 1Q86C 4DV3Q 4B3SL 2V1CC 1XNRQ 4LF4L 1QVGA 3S17H 1LUZA 3PO3H 1PYBA 4BBRG 2QEXA 4A76A 2HQLA 4H02A 3HOXH 2MO1A 2VQFL 1TXYA 2OCEA 3ER0A 1ASYA 3I4MH 4P71A 1IBML 3FKIG 4A3EH 3M7NA 2CWPA 5ELNA 3L7ZC 4DR7L 4A3IH 5C4XH 2E2HH 1KL9A 3PUVA 2N78A 5LMNW 4LF7L 1D7QA 4OO1I 1XTDA 4JBWA 1VQCA 2AKWB 3M3YH 1TWFH 3KF8B 4BY7H 4YCVA 2ZM6L 1UE1A 3J80i 2EQSA 4ME3A 4NXNL 2E5LL 2WB1G 2KENA 4LF9L 2MO0A 2ASBA 1KQSA 4NPSA 1FJGQ 4DV5L 2CCZA 4PZ8A 5LMUL 1PH3A 1GVPA 2NN6I 4DR1Q 4JI3Q 2JA7G 1K8GA 1WI5A 1AE3A 3W1BA 4OO1G 3LGJA 5M3MG 2JQOA 2NZHA 3PUYA 1GM5A 4R4OA 4R1JA 1WYDA 2E8GA 2NZOA 5E7NA 1K8AC 4O2DA 4LW1A 4DUZQ 1X54A 2R92H 4DR5Q 1K0RA 2ZTCA 3K8AA 2F4VQ 1D8LA 4POFA 3I4NG 3KF6B 1E24A 3CMEA 1VQNA 3GO5A 2NN6G 1W3SA 2CQOA 4GKKQ 1ASZA 2OTLA 2VS1A 3CPFA 4K0KL 3H0GH 2UUAL 4X65Q 1RL2A 4JI8Q 1BBWA 1JJCB 3BJUA 3S2DH 4XIGS 3G4SA 4GLXA 4IO9A 4BXXG 4QGUA 1C7YA 1HNZL 4DUYL 2VW9A 1CKNB 5AJ3Q 2ES2A 3S1MH 2UU9L 1PVOA 1I3QH 4KI0A 1L1OA 1KHIA 1UWVA 1Z9FA 4FDBA 2Q2IA 1N36Q 3AYHB 3HKZE 4C2MH 4A3FH 3A0JA 2JEAI 3I4OA 2N49A 1HR0Q 4QIWE 3RLOA 2Z6KA 1UEBA 1VQAA 2RHSB 3AFPA 1NE3A 3EBEA 2VQEL 1CSQA 2R6GA 4IJHA 4OWTB 4NXMQ 1YI2A 4A3JH 4DV2Q 4HIOA 4DV1L 4LFCQ 4LUZA 4HJ7A 1NY4A 2K50A 3GDEA 3U4ZA 1Y1WH 3KYHC 1A62A 3PF5A 2HHHL 1PH5A 1PH9A 2R7ZH 2GVBA 3M4OH 1VS0A 2HIVA 3A74A 3CXCA 2PI2A 3G71A 1B8AA 1L1OC 2BA1A 2ZTEA 1NTGA 1VQ8A 1VQ7A 5C0XJ 4QQBX 3T1YQ 5IP7G 4HIMA 2R7FA 1QUQA 2JA9A 1VQKA 4LUOA 1QVFA 5H1SE 1Q46A 2ZJPA 2RF4A 4X62Q 1FL0A 2Z6KC 4JI1L 1K73C 4P72A 2E2JH 2AMCB 4GKJQ 2IHFA 2JA6G 5C0XI 4DR6L 1HNWQ 3CC2A 2B63H 5C3EG 4WJ3M 3JAMi 5IYBG 4AYBG 1OXXK 4R4IA 3F8TA 2Z0SA 1SR3A 4KHZA 4DR2L 1IBKQ 1KC8C 2K52A 4JI4Q 4JI7Q 4IJLA 2OQ0A 3KDFA 4DV3L 2VUMG 4JYAQ 2XTIA 1Y1VG 1VQOA 1VQFA 3KLWA 2K14A 1VQ6A 1VQIA 1U0LA 2K5VA 4OX9Q 3W5OA 5BR8Q 1YHAA 5C0XG 1UE6A 1N33L 1CKOA 2JEBI 4MTNA 3J81i 4LWCA 3T1HL 1PH6A 1HNXQ 3CCUA 3M9BA 1E3PA 1GKHA 4PZ7A 5M3FH 2PQAB 4NB3A 3RN2A 4UY8C 4HIKA 1X9NA 4BBSG 2R7DA 3CCQA 4LFAL 5C44H 1M90C 1YHQA 1KRSA 3CCMA 1OXTA 4A3DG 2CKZB 4OWWB 4A3CH 4A3GG 3GD7A 2A1AA 2C35B 3H3VH 3MEFA 1WJJA 1RIPA 1M1KC 1HZBA 4P74A 1FJGL 2LSSA 4X64Q 2D0OA 2GVAA 5FLMH 4OXPA 4YY3L 5M5XH 5FJ8H 3RZOH 4GOPA 1VQDA 4HIDA 1H95A 3B6YA 2IX0A 3CCLA 3GTLH 2QGQA 4B3RL 5IWAL 3PUZA 3PIPA 4LNQA 3TS2A 5JEAG 1O7IA 2IT1A 3NEMA 4JI2Q 4JI5L 3UDFA 4MNOA 4LFBL 4LF5L 3GTGH 3E9HA 1MJEA 3OTOQ 3CCEA 1I6HH 4DUZL 5IYCG 4DR5L 3GTPH 4DV7L 2F4VL 2DUDA 3PO2H 4GN5A 4QY7A 2B29A 3K0XA 3HOWH 4A3LH 4GKKL 2F3IA 3S1RH 4GOPC 2UXBL 4JI8L 3STBC 3HOUG 2K5HA 3CCVA 1XNQQ 2ALYB 1JJGA 3PGZA 3AEVA 1YJWA 1YEZA 4RG1A 5AJ3L 3A5ZB 3J7ZC 4B3TL 2RHQB 4JI0Q 4A3BG 3F1ZA 4R4CA 4GN3B 3BZCA 4JV5L 4X66L 4C3HH 3EIVA 1VQHA 3TS0A 1U5KA 1HZ9A 3I2ZA 4DV4Q 2OWOA 3HOYG 4EQ5A 5DLQE 1OXUA 1HR0L 1I5FA 1WCMH 5IYDG 5LMNQ 1DGSA 4A3MH 1XMQQ 2I5MX 1EIYB 3HOVG 2EIFA 3ERSX 4HJAA 1MJCA 3UE1A 4B3MQ 4LFCL 2KHIA 4JI6L 1TWCH 1HZCA 4C3IH 1IBLQ 2A8VA 3MXNB 2B3GA 4KHPQ 3D0FA 4BY1H 1WFQA 5IP9G 3NBHB 1CSPA 5GAEC 2R93G 1VQBA 4DR3Q 1TWGH 2UUBQ 1X6OA 2UXDQ 3HOZG 3GTMH 1N32Q 1SROA 3T1YL 1JB7A 3K81C 2WAQG 1T9HA 4DV6L 1IZ6A 3ULLA 4YWMA 1V9PA 3A5UA 4PMWA 2VZAA 1SMXA 1IBMQ 4A3KH 1JMCA 3S24A 1G6PA 1C9OA 4DR7Q 5C4JH 2I5LX 2JA8G 1HJPA 4AQYL 4GN4B 2JK8A 4LUVA 1IBKL 4BBRH 2CFMA 2MFIA 1NBWA 2Y0SE 3NELA 2YTXA 2QA4A 3U4VA 2KCMA 2ZM6Q 2NVYH 3FKIH 4JOIA 4NXNQ 2E5LQ 1SFOH 3CC7A 2UXCL 4OX9L 3TEHB 5BR8L 1VQEA 2CWAA 1Y14B 1J5EL 3K7AH 1YZ6A 3AFQA 3ULPA 1HNXL 2YYZA 1L1OB 4A93G 1CUKA 1VQ5A 1A63A 1N34L 5GADC 3PSIA 3IRBA 3WWVA 3CW2C 1QZHA 4DR4Q 3FP9A 5EAYA 2JA5G 3RN5A 3J81j 1X3GA 2KHJA 1I94L 1IYJB 4DK6C 3S1QH 3CD6A 4JOIC 2GN5A 1E1OA 2K5NA 1EIFA 3W1GA 2MNAA 3PO3G 2JA7H 3HOXG 1Q1EA 3K7UC 3RZDH 1XPUA 1PYSB 3S2HH 5M3MH 4AH6A 2UUCQ 4GNXA 4A3EG 2EXDA 1NMFA 2Q2HA 2UUAQ 4UPAA 4A3IG 3SGIA 5C4XG 3PV0A 1XMOQ 1QUQB 4DV0Q 3HKSA 1PH1A 3JAMc 1XNRL 1VQJA 3KFUA 3S14H 1C0AA 1OXSC 1HNZQ 3I4NH 3KJPA 1Q82C 2IHEA 2WFWA 1EOVA 4BY7G 1YNXA 3G48A 5JEAJ 1FVIA 5HY6A 2UU9Q 3CQZH 4YCWA 1J6QA 2I0QA 3S15H 1A8VA 1JJ2A 2OTJA 3HFZB 2WB1E 3CMAA 1BKBA 4J15A 4IPDA 4GNXC 4HJ5A 1YJ9A 1PA6A 1EYGA 3E9IA 4BXXH 1QZGA 3M4QA 2VY3A 3KDFB 3J81c 2VQEQ 4ALPA 4GLVB 3CC4A 3HKZG 1XNQL 5K36G 4A4IA 1LM0A 1E22A 1YHBA 5M5YH 3PIOA 3DLLA 4IOAA 3U58A 3AQQA 1X3FA 5HGQA 2R92G 2Q2UA 2WP8J 1PFSA 1S3OA 5IE8A 1SRUA 4DR1L 4JI3L 2NVTH 2IY5B 4MZ9A 5GAHC 3ICEA 1KD1C 1TWHH 4IPCA 3H0GG 1VQ4A 3J7A5 4XTCS 1XJVA 1HZAA 3L2PA 1Q7YC 4DR6Q 1NMGA 3D31A 3RLNA 5IP7H 2PNHA 3CCRA 4L5QA 3F2BA 4KHPL 3F2DA 4GOPB 4X65L 4IPGA 2JJQA 1AH9A 1CKMA 3TREA 4PG3A 3JC66 2ZJRA 1PH7A 3CAMA 2JA6H 1Q8KA 1N32L 2PI2E 1P16A 5C3EH 4A3FG 1K9MC 5IYBH 4AIMA 4JBKA 1P8LA 4DPGA 1EFWA 3I4MG 1Q81C 1N33Q 3U50C 1JT8A 1L0WA 3T1HQ 5GQOA 2ID0A 2F52A 1YBYA 4BA1I 4A3JG 1E1TA 4L5TA 3J80c 5JJIA 2ZTDA 1A0IA 1N36L 4L5RC 2VUMH 1Y1WG 2R7ZG 3PCOB 1Y1VH 1UE7A 4JG2A 4TVAB 4LFAQ 4LF6Q 1TWAH 2BH8A 2K75A 3M4PA 1G291 4YHHQ 4QL5A 5FLXc 3BU2A 3F2CA 3STBD 4NXML 1G51A 5GAGC 4DV2L 1BVSA 1QVCA 1SLJA 4UP7A 1PH2A 1VQPA 3GTJH 4BA2I 4JC0A 3FHWA 1VQ9A 5JJLA 4C3JH 3I55A 3KF6A 3ZJYC 4BBSH 1HH2P 4LF8Q 3RR5A 4YY3Q 2B63G 2AWOA 2YTVA 4APVA 4IFDJ 4QJFA 4IPHA 1VQMA 4A3DH 5IT9c 2D0PA 4A3GH 5ELOA 1Q1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N H;  1R9T H;  4LF4 Q;  4B3R Q;  5IWA Q;  4A75 A;  2LXJ A;  1V1Q A;  4YWL A;  2LXK A;  4DR4 L;  4X62 L;  4AYB E;  4TQU S;  4JI5 Q;  2VQF Q;  2PMZ E;  1EUJ A;  4LF5 Q;  4IFD I;  4GKJ L;  4LFB Q;  1CKN A;  2BA0 A;  3PF4 A;  1HNW L;  4UP9 A;  1FGU A;  1EWI A;  2N3S A;  1SE8 A;  4R4Q A;  4DV7 Q;  5GRO A;  1BBU A;  2YTY A;  4DAM A;  4DNI A;  3ULJ A;  1W2B A;  1NJI C;  1HR0 W;  4LF7 Q;  3H3V I;  5M5W H;  2UUC L;  3KJO A;  1XPO A;  1PV4 A;  4JI4 L;  4JI7 L;  2UXB Q;  3GTO H;  5M3F G;  2D62 A;  1XMO L;  2H5X A;  1X3E A;  4LF9 Q;  5IYC H;  4DV0 L;  2HT1 A;  4JYA L;  1VQG A;  3Q8D A;  3RLF A;  4IFD G;  2Q2T A;  1B70 B;  5C44 G;  4DV5 Q;  1KRT A;  1X56 A;  3UDI A;  5LMU Q;  3PUX A;  3VDY A;  4A3C G;  4B3T Q;  3M85 A;  3S16 H;  2VNU D;  2A19 A;  5JJK A;  1OTC A;  3NEN A;  4DKA C;  1PH4 A;  4JV5 Q;  1EQQ A;  2YV5 A;  3HOU H;  1Q12 A;  3PUW A;  4YWK A;  4X66 Q;  2OQK A;  4DK3 C;  4GLA C;  2VL6 A;  5FLM G;  2KCT A;  5FJ8 G;  3I7F A;  1SN8 A;  2I5H A;  4L5S A;  1B7Y B;  1Z47 A;  4A3B H;  4OON A;  3RNU A;  2DGY A;  2XGT A;  3CCJ A;  4WJ4 A;  4JI6 Q;  5J3B A;  3UDX A;  1S40 A;  4X64 L;  1V43 A;  3L0O A;  1L2F A;  4O0A A;  3HOY H;  4K0K Q;  3CPW A;  1I50 H;  1AE2 A;  2RCN A;  1MKH A;  4HJ9 A;  5IYD H;  1N8R C;  1XPR A;  1K3R A;  3GTK H;  3HOV H;  1YIT A;  2K4K A;  3PO2 G;  3KOJ A;  4JBJ A;  3BZK A;  3HOW G;  1VCI A;  4A3L G;  2ATW A;  4JI2 L;  3I56 A;  2E2I H;  4P73 A;  4DV6 Q;  4PZ6 A;  1OXV A;  4DUY Q;  1UE5 A;  1X55 A;  3OW2 A;  3OTO L;  4EX5 A;  5IP9 H;  2R93 H;  2AHO B;  1X65 A;  2BH2 A;  1YVC A;  3HOZ H;  1KIX A;  4AQY Q;  1KAW A;  2PQA A;  3E0E A;  3GTQ H;  2YU9 H;  4Y52 H;  3S1N H;  3CCS A;  1GD7 A;  2JE6 I;  4GNX B;  4JBM A;  1S72 A;  3G6E A;  2HIX A;  2ZJQ A;  3UE0 A;  1PH8 A;  2KBN A;  1JE5 A;  2NVX H;  2MQH A;  4GS3 A;  4P75 A;  2NVQ H;  4DV1 Q;  2UXC Q;  2JA8 H;  1YJN A;  1WCM G;  5IY0 A;  2Y0S G;  4A3M G;  2HHH Q;  1GO3 E;  1K83 H;  1N9W A;  1YIJ A;  3K80 C;  4JCV E;  3UDG A;  1J5E Q;  4JI0 L;  3CP0 A;  1KXL A;  3H15 A;  2IX1 A;  4KLK A;  1N34 Q;  4DV4 L;  1WOC A;  4B3S Q;  1LYL A;  4IOC A;  3DM3 A;  4UP8 A;  4BY1 G;  4LF6 L;  4JI1 Q;  5LMN L;  3EN2 A;  4OWX B;  1XMQ L;  3TQY A;  1I94 Q;  1PHJ A;  4YHH L;  1VQL A;  2N8N A;  4DAY B;  2AWN A;  3OYY A;  4HJ8 A;  4A93 H;  2FXQ A;  4B3M L;  4POG A;  3CF5 A;  1LTL A;  2L15 A;  1IBL L;  1IL2 A;  4DR2 Q;  4YCU A;  4X6A H;  1EQR A;  4RMF A;  2WAQ E;  3TRZ A;  4A3K G;  4LF8 L;  1MIU A;  2JA5 H;  1IXR A;  1E7Z A;  4DR3 L;  4R4T A;  2UUB L;  2UXD L;  1Q86 C;  4DV3 Q;  4B3S L;  2V1C C;  1XNR Q;  4LF4 L;  1QVG A;  3S17 H;  1LUZ A;  3PO3 H;  1PYB A;  4BBR G;  2QEX A;  4A76 A;  2HQL A;  4H02 A;  3HOX H;  2MO1 A;  2VQF L;  1TXY A;  2OCE A;  3ER0 A;  1ASY A;  3I4M H;  4P71 A;  1IBM L;  3FKI G;  4A3E H;  3M7N A;  2CWP A;  5ELN A;  3L7Z C;  4DR7 L;  4A3I H;  5C4X H;  2E2H H;  1KL9 A;  3PUV A;  2N78 A;  5LMN W;  4LF7 L;  1D7Q A;  4OO1 I;  1XTD A;  4JBW A;  1VQC A;  2AKW B;  3M3Y H;  1TWF H;  3KF8 B;  4BY7 H;  4YCV A;  2ZM6 L;  1UE1 A;  3J80 i;  2EQS A;  4ME3 A;  4NXN L;  2E5L L;  2WB1 G;  2KEN A;  4LF9 L;  2MO0 A;  2ASB A;  1KQS A;  4NPS A;  1FJG Q;  4DV5 L;  2CCZ A;  4PZ8 A;  5LMU L;  1PH3 A;  1GVP A;  2NN6 I;  4DR1 Q;  4JI3 Q;  2JA7 G;  1K8G A;  1WI5 A;  1AE3 A;  3W1B A;  4OO1 G;  3LGJ A;  5M3M G;  2JQO A;  2NZH A;  3PUY A;  1GM5 A;  4R4O A;  4R1J A;  1WYD A;  2E8G A;  2NZO A;  5E7N A;  1K8A C;  4O2D A;  4LW1 A;  4DUZ Q;  1X54 A;  2R92 H;  4DR5 Q;  1K0R A;  2ZTC A;  3K8A A;  2F4V Q;  1D8L A;  4POF A;  3I4N G;  3KF6 B;  1E24 A;  3CME A;  1VQN A;  3GO5 A;  2NN6 G;  1W3S A;  2CQO A;  4GKK Q;  1ASZ A;  2OTL A;  2VS1 A;  3CPF A;  4K0K L;  3H0G H;  2UUA L;  4X65 Q;  1RL2 A;  4JI8 Q;  1BBW A;  1JJC B;  3BJU A;  3S2D H;  4XIG S;  3G4S A;  4GLX A;  4IO9 A;  4BXX G;  4QGU A;  1C7Y A;  1HNZ L;  4DUY L;  2VW9 A;  1CKN B;  5AJ3 Q;  2ES2 A;  3S1M H;  2UU9 L;  1PVO A;  1I3Q H;  4KI0 A;  1L1O A;  1KHI A;  1UWV A;  1Z9F A;  4FDB A;  2Q2I A;  1N36 Q;  3AYH B;  3HKZ E;  4C2M H;  4A3F H;  3A0J A;  2JEA I;  3I4O A;  2N49 A;  1HR0 Q;  4QIW E;  3RLO A;  2Z6K A;  1UEB A;  1VQA A;  2RHS B;  3AFP A;  1NE3 A;  3EBE A;  2VQE L;  1CSQ A;  2R6G A;  4IJH A;  4OWT B;  4NXM Q;  1YI2 A;  4A3J H;  4DV2 Q;  4HIO A;  4DV1 L;  4LFC Q;  4LUZ A;  4HJ7 A;  1NY4 A;  2K50 A;  3GDE A;  3U4Z A;  1Y1W H;  3KYH C;  1A62 A;  3PF5 A;  2HHH L;  1PH5 A;  1PH9 A;  2R7Z H;  2GVB A;  3M4O H;  1VS0 A;  2HIV A;  3A74 A;  3CXC A;  2PI2 A;  3G71 A;  1B8A A;  1L1O C;  2BA1 A;  2ZTE A;  1NTG A;  1VQ8 A;  1VQ7 A;  5C0X J;  4QQB X;  3T1Y Q;  5IP7 G;  4HIM A;  2R7F A;  1QUQ A;  2JA9 A;  1VQK A;  4LUO A;  1QVF A;  5H1S E;  1Q46 A;  2ZJP A;  2RF4 A;  4X62 Q;  1FL0 A;  2Z6K C;  4JI1 L;  1K73 C;  4P72 A;  2E2J H;  2AMC B;  4GKJ Q;  2IHF A;  2JA6 G;  5C0X I;  4DR6 L;  1HNW Q;  3CC2 A;  2B63 H;  5C3E G;  4WJ3 M;  3JAM i;  5IYB G;  4AYB G;  1OXX K;  4R4I A;  3F8T A;  2Z0S A;  1SR3 A;  4KHZ A;  4DR2 L;  1IBK Q;  1KC8 C;  2K52 A;  4JI4 Q;  4JI7 Q;  4IJL A;  2OQ0 A;  3KDF A;  4DV3 L;  2VUM G;  4JYA Q;  2XTI A;  1Y1V G;  1VQO A;  1VQF A;  3KLW A;  2K14 A;  1VQ6 A;  1VQI A;  1U0L A;  2K5V A;  4OX9 Q;  3W5O A;  5BR8 Q;  1YHA A;  5C0X G;  1UE6 A;  1N33 L;  1CKO A;  2JEB I;  4MTN A;  3J81 i;  4LWC A;  3T1H L;  1PH6 A;  1HNX Q;  3CCU A;  3M9B A;  1E3P A;  1GKH A;  4PZ7 A;  5M3F H;  2PQA B;  4NB3 A;  3RN2 A;  4UY8 C;  4HIK A;  1X9N A;  4BBS G;  2R7D A;  3CCQ A;  4LFA L;  5C44 H;  1M90 C;  1YHQ A;  1KRS A;  3CCM A;  1OXT A;  4A3D G;  2CKZ B;  4OWW B;  4A3C H;  4A3G G;  3GD7 A;  2A1A A;  2C35 B;  3H3V H;  3MEF A;  1WJJ A;  1RIP A;  1M1K C;  1HZB A;  4P74 A;  1FJG L;  2LSS A;  4X64 Q;  2D0O A;  2GVA A;  5FLM H;  4OXP A;  4YY3 L;  5M5X H;  5FJ8 H;  3RZO H;  4GOP A;  1VQD A;  4HID A;  1H95 A;  3B6Y A;  2IX0 A;  3CCL A;  3GTL H;  2QGQ A;  4B3R L;  5IWA L;  3PUZ A;  3PIP A;  4LNQ A;  3TS2 A;  5JEA G;  1O7I A;  2IT1 A;  3NEM A;  4JI2 Q;  4JI5 L;  3UDF A;  4MNO A;  4LFB L;  4LF5 L;  3GTG H;  3E9H A;  1MJE A;  3OTO Q;  3CCE A;  1I6H H;  4DUZ L;  5IYC G;  4DR5 L;  3GTP H;  4DV7 L;  2F4V L;  2DUD A;  3PO2 H;  4GN5 A;  4QY7 A;  2B29 A;  3K0X A;  3HOW H;  4A3L H;  4GKK L;  2F3I A;  3S1R H;  4GOP C;  2UXB L;  4JI8 L;  3STB C;  3HOU G;  2K5H A;  3CCV A;  1XNQ Q;  2ALY B;  1JJG A;  3PGZ A;  3AEV A;  1YJW A;  1YEZ A;  4RG1 A;  5AJ3 L;  3A5Z B;  3J7Z C;  4B3T L;  2RHQ B;  4JI0 Q;  4A3B G;  3F1Z A;  4R4C A;  4GN3 B;  3BZC A;  4JV5 L;  4X66 L;  4C3H H;  3EIV A;  1VQH A;  3TS0 A;  1U5K A;  1HZ9 A;  3I2Z A;  4DV4 Q;  2OWO A;  3HOY G;  4EQ5 A;  5DLQ E;  1OXU A;  1HR0 L;  1I5F A;  1WCM H;  5IYD G;  5LMN Q;  1DGS A;  4A3M H;  1XMQ Q;  2I5M X;  1EIY B;  3HOV G;  2EIF A;  3ERS X;  4HJA A;  1MJC A;  3UE1 A;  4B3M Q;  4LFC L;  2KHI A;  4JI6 L;  1TWC H;  1HZC A;  4C3I H;  1IBL Q;  2A8V A;  3MXN B;  2B3G A;  4KHP Q;  3D0F A;  4BY1 H;  1WFQ A;  5IP9 G;  3NBH B;  1CSP A;  5GAE C;  2R93 G;  1VQB A;  4DR3 Q;  1TWG H;  2UUB Q;  1X6O A;  2UXD Q;  3HOZ G;  3GTM H;  1N32 Q;  1SRO A;  3T1Y L;  1JB7 A;  3K81 C;  2WAQ G;  1T9H A;  4DV6 L;  1IZ6 A;  3ULL A;  4YWM A;  1V9P A;  3A5U A;  4PMW A;  2VZA A;  1SMX A;  1IBM Q;  4A3K H;  1JMC A;  3S24 A;  1G6P A;  1C9O A;  4DR7 Q;  5C4J H;  2I5L X;  2JA8 G;  1HJP A;  4AQY L;  4GN4 B;  2JK8 A;  4LUV A;  1IBK L;  4BBR H;  2CFM A;  2MFI A;  1NBW A;  2Y0S E;  3NEL A;  2YTX A;  2QA4 A;  3U4V A;  2KCM A;  2ZM6 Q;  2NVY H;  3FKI H;  4JOI A;  4NXN Q;  2E5L Q;  1SFO H;  3CC7 A;  2UXC L;  4OX9 L;  3TEH B;  5BR8 L;  1VQE A;  2CWA A;  1Y14 B;  1J5E L;  3K7A H;  1YZ6 A;  3AFQ A;  3ULP A;  1HNX L;  2YYZ A;  1L1O B;  4A93 G;  1CUK A;  1VQ5 A;  1A63 A;  1N34 L;  5GAD C;  3PSI A;  3IRB A;  3WWV A;  3CW2 C;  1QZH A;  4DR4 Q;  3FP9 A;  5EAY A;  2JA5 G;  3RN5 A;  3J81 j;  1X3G A;  2KHJ A;  1I94 L;  1IYJ B;  4DK6 C;  3S1Q H;  3CD6 A;  4JOI C;  2GN5 A;  1E1O A;  2K5N A;  1EIF A;  3W1G A;  2MNA A;  3PO3 G;  2JA7 H;  3HOX G;  1Q1E A;  3K7U C;  3RZD H;  1XPU A;  1PYS B;  3S2H H;  5M3M H;  4AH6 A;  2UUC Q;  4GNX A;  4A3E G;  2EXD A;  1NMF A;  2Q2H A;  2UUA Q;  4UPA A;  4A3I G;  3SGI A;  5C4X G;  3PV0 A;  1XMO Q;  1QUQ B;  4DV0 Q;  3HKS A;  1PH1 A;  3JAM c;  1XNR L;  1VQJ A;  3KFU A;  3S14 H;  1C0A A;  1OXS C;  1HNZ Q;  3I4N H;  3KJP A;  1Q82 C;  2IHE A;  2WFW A;  1EOV A;  4BY7 G;  1YNX A;  3G48 A;  5JEA J;  1FVI A;  5HY6 A;  2UU9 Q;  3CQZ H;  4YCW A;  1J6Q A;  2I0Q A;  3S15 H;  1A8V A;  1JJ2 A;  2OTJ A;  3HFZ B;  2WB1 E;  3CMA A;  1BKB A;  4J15 A;  4IPD A;  4GNX C;  4HJ5 A;  1YJ9 A;  1PA6 A;  1EYG A;  3E9I A;  4BXX H;  1QZG A;  3M4Q A;  2VY3 A;  3KDF B;  3J81 c;  2VQE Q;  4ALP A;  4GLV B;  3CC4 A;  3HKZ G;  1XNQ L;  5K36 G;  4A4I A;  1LM0 A;  1E22 A;  1YHB A;  5M5Y H;  3PIO A;  3DLL A;  4IOA A;  3U58 A;  3AQQ A;  1X3F A;  5HGQ A;  2R92 G;  2Q2U A;  2WP8 J;  1PFS A;  1S3O A;  5IE8 A;  1SRU A;  4DR1 L;  4JI3 L;  2NVT H;  2IY5 B;  4MZ9 A;  5GAH C;  3ICE A;  1KD1 C;  1TWH H;  4IPC A;  3H0G G;  1VQ4 A;  3J7A 5;  4XTC S;  1XJV A;  1HZA A;  3L2P A;  1Q7Y C;  4DR6 Q;  1NMG A;  3D31 A;  3RLN A;  5IP7 H;  2PNH A;  3CCR A;  4L5Q A;  3F2B A;  4KHP L;  3F2D A;  4GOP B;  4X65 L;  4IPG A;  2JJQ A;  1AH9 A;  1CKM A;  3TRE A;  4PG3 A;  3JC6 6;  2ZJR A;  1PH7 A;  3CAM A;  2JA6 H;  1Q8K A;  1N32 L;  2PI2 E;  1P16 A;  5C3E H;  4A3F G;  1K9M C;  5IYB H;  4AIM A;  4JBK A;  1P8L A;  4DPG A;  1EFW A;  3I4M G;  1Q81 C;  1N33 Q;  3U50 C;  1JT8 A;  1L0W A;  3T1H Q;  5GQO A;  2ID0 A;  2F52 A;  1YBY A;  4BA1 I;  4A3J G;  1E1T A;  4L5T A;  3J80 c;  5JJI A;  2ZTD A;  1A0I A;  1N36 L;  4L5R C;  2VUM H;  1Y1W G;  2R7Z G;  3PCO B;  1Y1V H;  1UE7 A;  4JG2 A;  4TVA B;  4LFA Q;  4LF6 Q;  1TWA H;  2BH8 A;  2K75 A;  3M4P A;  1G29 1;  4YHH Q;  4QL5 A;  5FLX c;  3BU2 A;  3F2C A;  3STB D;  4NXM L;  1G51 A;  5GAG C;  4DV2 L;  1BVS A;  1QVC A;  1SLJ A;  4UP7 A;  1PH2 A;  1VQP A;  3GTJ H;  4BA2 I;  4JC0 A;  3FHW A;  1VQ9 A;  5JJL A;  4C3J H;  3I55 A;  3KF6 A;  3ZJY C;  4BBS H;  1HH2 P;  4LF8 Q;  3RR5 A;  4YY3 Q;  2B63 G;  2AWO A;  2YTV A;  4APV A;  4IFD J;  4QJF A;  4IPH A;  1VQM A;  4A3D H;  5IT9 c;  2D0P A;  4A3G H;  5ELO A;  1Q1B A; 
#chains in the Genus database with same CATH topology
 4Y7N H;  2Z1C A;  4B3R Q;  2MJ8 A;  1G6Z A;  4YWL A;  1FD7 D;  1L0Y B;  1SNP A;  3QJY A;  4FF4 A;  2PMZ E;  1TT2 A;  3GV6 A;  4GKJ L;  2BA0 A;  4UP9 A;  2Z8L A;  1EWI A;  1JIC A;  4R4Q A;  1I4G A;  3K0Y A;  4DNI A;  4FYD A;  2QKI C;  3ULJ A;  4LF7 Q;  3KJO A;  1LT4 D;  2O5I C;  2DY8 A;  3Q24 A;  5M3F G;  2H4O A;  4KKT A;  2H5X A;  4LF9 Q;  2L12 A;  1F2M A;  3D8G A;  1B70 B;  5C44 G;  2B2U A;  1X56 A;  3M85 A;  2SNM A;  4DKA C;  1PH4 A;  3TP8 A;  2QDL A;  4MN3 A;  3FPP A;  4K6D A;  5FJ8 G;  3MVV A;  5D14 A;  5EPJ A;  3D4R A;  4L5S A;  4OON A;  5ELB A;  3BDC A;  1S40 A;  1SMY C;  1U4R A;  1L2F A;  3HOY H;  4K0K Q;  1ENF A;  3BG3 A;  1AE2 A;  2KCC A;  4G4K A;  3SEB A;  3KOJ A;  3HOW G;  1VCI A;  4A3L G;  3EVQ A;  4HSV A;  1D1K A;  4PZ6 A;  4DUY Q;  2ZXP A;  3OW2 A;  5CV7 A;  5M3F B;  1LTA D;  3NK9 A;  2O2L D;  2FFK B;  1KIX A;  3VR6 A;  2N55 A;  1EY7 A;  2JE6 I;  4GNX B;  3MXP A;  2ZJQ A;  1PRT F;  4OHJ A;  3UE0 A;  3GQB A;  4DAY A;  2MQH A;  4IUV A;  1ICF B;  3Q23 A;  2UXC Q;  4CHT B;  3TME A;  5IY0 A;  1GO3 E;  1K83 H;  2F4I A;  4JCV E;  2NVT B;  5I9O A;  1KXL A;  1LT6 D;  4DN4 M;  1KTK A;  1FGB D;  5D65 A;  3VR4 A;  1VQL A;  2N8N A;  4DAY B;  3IKJ A;  1ESR A;  4B3M L;  1TU2 B;  3HOW B;  4A93 H;  4V0B A;  1LTL A;  3S1R B;  3D6C A;  1IL2 A;  4X6A H;  3TRZ A;  4IZ8 A;  3SHL A;  4R4T A;  1H9S A;  4H0L C;  1Q86 C;  1ET6 A;  1UEA B;  1WD0 A;  1AZQ A;  3S17 H;  4BBR G;  4A76 A;  2HQL A;  3HOX H;  1ASY A;  5ELF A;  1LLR D;  3FKI G;  4JK1 C;  4F88 A;  2DNC A;  4A3E H;  3M7N A;  1BO0 A;  4GZY C;  4K2K A;  2VUM B;  3L7Z C;  4ZYS A;  1B50 A;  2B8G A;  3PUV A;  2G9H D;  5LMN W;  1GUS A;  4FXG C;  1D7Q A;  1XWE A;  2AKW B;  3MWY W;  5E1F A;  4Q0F A;  4Q5V A;  2CHB D;  1V1P A;  3KUP A;  3Q22 A;  3J80 i;  2EQS A;  4ME3 A;  1FNV A;  4J1M A;  1WTP A;  2KEN A;  3PQI A;  4IUT A;  3C1F A;  3K58 A;  2ASB A;  1KQS A;  3TZD A;  2EYF A;  2CCZ A;  4F87 A;  4A3G B;  1VMP A;  2NN6 I;  4DR1 Q;  2NBF A;  3W1B A;  5M3M G;  5FKA C;  2JQO A;  3PUY A;  2E8G A;  1V1P B;  4X3T A;  4QB4 A;  3ERQ A;  5JAV A;  1K0R A;  1GOZ A;  3K8A A;  5KYL A;  4BBR B;  5E4X A;  2KCN A;  4POF A;  3GO5 A;  2NN6 G;  2CQO A;  2NVY B;  3FKI B;  3H0G H;  1PTO H;  1BBW A;  1TS2 A;  5G3L F;  3S2D H;  2NYZ D;  4XIG S;  3G4S A;  4H44 C;  4L8J A;  4IO9 A;  3S16 B;  1KDA A;  1WTQ A;  1B44 D;  4QCL A;  3S1M H;  2F0F A;  1UWV A;  5JVH 3;  4A3F H;  1PXU A;  3I4O A;  3E0J A;  1PRT C;  3D4W A;  4YIJ A;  3AFP A;  1NE3 A;  3T51 B;  4IJH A;  2R6G A;  3R2T A;  2EDG A;  4DV1 L;  4LUZ A;  2F0N A;  4K6L A;  3U4Z A;  1Y1W H;  1A62 A;  2HHH L;  3A7L A;  3M4O H;  3H91 A;  3A74 A;  3CXC A;  2D9U A;  1L1O C;  2ZTE A;  1VQ7 A;  4I65 A;  3KBG A;  3T1Y Q;  2R61 A;  4LUO A;  1DON A;  5H1S E;  1Q46 A;  2ZJP A;  1FL0 A;  3CQZ B;  1EQT A;  4JI1 L;  5D3D A;  2IHF A;  2JA6 G;  4GKJ Q;  1B3A A;  3SK4 A;  1OXX K;  4R4I A;  4QUC A;  5DEH A;  4KHZ A;  1YNN D;  1QNK A;  3X3N A;  3KDF A;  4HMI A;  1WTR A;  2EPB A;  5C3W A;  1VQO A;  3KLW A;  1TR5 A;  1VQI A;  1U0L A;  2KEC A;  1N33 L;  4MTN A;  3T1H L;  4WJW A;  4BWG B;  3CRL C;  3NPP A;  4UY8 C;  1GKH A;  2PQA B;  2WII B;  3KLS A;  4HIK A;  4BBS G;  1ILP A;  4LK1 C;  2RA4 A;  3P7J A;  4J8Q A;  5KEE A;  4A3C H;  4RAU C;  4HTH A;  3I73 A;  3MEF A;  4FF1 A;  2OXP A;  1FJG L;  2LSS A;  2D0O A;  2JA6 B;  3TN2 A;  5EKK A;  1VQD A;  2A6E C;  3PIP A;  1DOK A;  4LNQ A;  3LX0 A;  3OW7 A;  2K01 A;  4JI5 L;  2RDF A;  1D2B A;  4CJ0 B;  2QEJ C;  4TSS A;  5CV4 A;  2B2V C;  3E9H A;  1MJE A;  4LF5 L;  2E2H B;  1ZEQ X;  1BR9 A;  1PYW D;  4DV7 L;  4RH6 A;  4GN5 A;  1TWF B;  1KNA A;  4BY7 B;  4DK1 A;  4GKK L;  2UXB L;  1A2T A;  3OIQ A;  4M8A A;  4JI8 L;  3STB C;  2K5H A;  3CCV A;  2ALY B;  1JJG A;  4RGO S;  1EWC A;  1SNQ A;  3MXN A;  3AEV A;  1YJW A;  3J7Z C;  2D5D A;  2RHQ B;  3NBH A;  4HAE A;  1MSH A;  4XYO A;  1E2Z A;  4X66 L;  3EIV A;  3FVQ A;  3NSW A;  3HOY G;  1HR0 L;  1ZXT A;  1WCM H;  4ZKB B;  3R3O A;  2XIW A;  2EIF A;  1F9S A;  4HJA A;  4B3M Q;  4X3U A;  4C3I H;  5IGG A;  3MXN B;  2F3V A;  3D0F A;  2BE5 C;  2N88 A;  3NBH B;  1AN8 A;  1VQB A;  3GTM H;  1N32 Q;  2IX3 A;  3K81 C;  3A54 A;  1II3 A;  2WAQ G;  3ERO A;  4DV6 L;  3R2I A;  1U9R A;  3A5U A;  1D5X C;  1X32 A;  1V1O A;  3S24 A;  4RHR A;  1HJP A;  4ULL A;  1ZKO A;  3N6R A;  4LUV A;  1IBK L;  2CFM A;  1EQV A;  1CQV A;  1PTO D;  2M2L A;  2Y0S E;  4HED A;  1LTG D;  5IGF A;  1SDF A;  5I4D A;  2R7Z B;  1TII D;  3HOY B;  1STG A;  2BDN A;  4OX9 L;  2L4N A;  1J5E L;  2CWA A;  1Y14 B;  3AFQ A;  3ULP A;  4A93 G;  1VQ5 A;  1A63 A;  5COY A;  2AUK A;  3RUZ A;  3OMC A;  2O5J C;  2F0D A;  4O1N A;  3WWV A;  3IRB A;  1QZH A;  2E2J B;  2TMP A;  3RN5 A;  5IGC A;  2KHJ A;  3NBI A;  1C8C A;  3CD6 A;  4KD4 A;  4JOI C;  2GN5 A;  2WAQ B;  4OO1 H;  3HOX G;  3K5O A;  3ND8 A;  4FVM A;  1PYS B;  2QDB A;  4KY6 A;  4IUN A;  1WTO A;  4A3E G;  2UUC Q;  2Q2H A;  1QB5 D;  2K03 A;  1K0S A;  1QOH A;  3HKS A;  4E6I A;  1K83 B;  2ENB A;  1PH1 A;  1QNU A;  1OXS C;  2WFW A;  1EOV A;  1D6E C;  5AFW A;  1A8V A;  1JJ2 A;  1U4P A;  3J7A V;  3BVZ A;  1AEX A;  1ENC A;  3BYT B;  4J15 A;  4HJ5 A;  1YJ9 A;  4BXX H;  4XQJ A;  3VYT A;  3H3V C;  3M4Q A;  2EYH A;  2C5C A;  4ALP A;  5FO8 B;  4GLV B;  2BDO A;  1BCP D;  3MFY A;  4NP5 A;  3MAQ A;  3DLL A;  1VDZ A;  1STY A;  4G7H C;  3S17 B;  2NVT H;  4JI3 L;  2IY5 B;  4MZ9 A;  4R8N A;  4A3E B;  3H0G G;  3ND9 A;  1HZA A;  2EJF C;  3VR5 A;  4L63 B;  5EPK A;  1EZ8 A;  1NMG A;  3MEH A;  4K14 A;  5IP7 H;  4KHP L;  4GOP B;  2PQE A;  4K5X A;  4IPG A;  3MXG A;  1PH7 A;  3CAM A;  1Q8K A;  5JJZ A;  2PI2 E;  1P16 A;  4A3F G;  4JBK A;  4JW0 A;  1EFW A;  2KQ3 A;  4CDC C;  1N33 Q;  2A74 C;  3T1H Q;  1JWS D;  5GQO A;  4ZLT F;  1YBY A;  1E1T A;  2EYO A;  3J80 c;  2ZTD A;  2VUM H;  1Y1W G;  4S3S A;  1Y1V H;  2VB3 X;  1UE7 A;  4JG2 A;  1W6J A;  4TVA B;  3CHB D;  3KLR A;  4QF4 A;  3D3R A;  4YHH Q;  4KJO A;  1TWC B;  4DV2 L;  1HTL D;  1SLJ A;  2F3W A;  3FHW A;  1A3V A;  2L1B A;  4C3J H;  1HFG A;  1B3Q A;  3I55 A;  3MC0 B;  3S2D B;  4LF8 Q;  2PZW A;  2PW5 A;  4QJF A;  2D0P A;  4A3G H;  2B39 A;  5FLX L;  3TBI B;  3S1M B;  2LXK A;  4DR4 L;  4AYB E;  4TQU S;  1CHP D;  4JI5 Q;  2SEB D;  1EUJ A;  4LF5 Q;  1GHK A;  3I70 A;  1CKN A;  3MHB A;  4KJN A;  3HS0 C;  1BUV T;  2N3S A;  4A3F B;  1TY2 A;  2EE1 A;  4DV7 Q;  5IT9 L;  4DAM A;  1NR2 A;  2KJX A;  5JEA H;  5KRU A;  4FXD A;  4JI4 L;  1NR4 A;  2UXB Q;  1XMO L;  4PMC A;  1Y1W B;  2HT1 A;  5IYC H;  4JYA L;  3OOC A;  3Q8D A;  3M4O B;  1IYU A;  2Q2T A;  3PIO 3;  4DV5 Q;  5LMU Q;  3UDI A;  4A3C G;  3PUX A;  3S16 H;  2VNU D;  1OTC A;  2FMM A;  4ILW A;  1EQQ A;  3I8Z A;  4X66 Q;  3PUW A;  4YWK A;  3QWN A;  4DK3 C;  4GLA C;  1SXT A;  2KCT A;  1V8Q A;  1Z47 A;  3M7G A;  3RNU A;  4KY7 A;  2DGY A;  1EWH A;  3ZYY X;  3S2H B;  4WJ4 A;  1NSN S;  3BZD B;  2OT2 A;  2E74 C;  3GTK H;  1XPR A;  1K3R A;  4ZUI A;  1F2Y A;  4OL7 A;  3HOV H;  3BVG A;  3P20 A;  3BZK A;  2WAC A;  2ATW A;  3I56 A;  4EQO A;  4P73 A;  4DV6 Q;  3OTO L;  3CKI B;  5IP9 H;  5EBD A;  1EZ6 A;  5NUC A;  3HOZ H;  1O7L A;  1TY0 A;  3E0E A;  1MD2 D;  3GTQ H;  3EA6 A;  1CA5 A;  2HIX A;  1PH8 A;  1SYC A;  2F0M A;  4KKU A;  2NVX H;  4P75 A;  2NVQ H;  1WCM G;  1N9W A;  1J5E Q;  3K80 C;  2PO4 A;  4QMG A;  2KUM A;  1E2W A;  1FNU A;  2K5D A;  5J1Z A;  2IX1 A;  1STN A;  2GA4 B;  4C3I G;  4DV4 L;  4IOC A;  3SK5 A;  5KNC A;  3EN2 A;  4OWX B;  2JSO A;  2R3Z A;  2DY7 A;  3OYY A;  1PMR A;  3MXU A;  3U9O A;  2F0Q A;  2RVL A;  4YCU A;  3FMC A;  1MIU A;  2A69 D;  4DR3 L;  1RKN A;  2UUB L;  2UXD L;  4DV3 Q;  4B3S L;  2V1C C;  2MP1 A;  4LF4 L;  1QVG A;  2OF1 A;  2QEX A;  3IFD A;  2B2Y C;  2VQF L;  3ER0 A;  2OCE A;  3NE5 B;  3ONA B;  3OIP A;  2E2H H;  1TWA B;  1WCM B;  3TSS A;  4OO1 I;  1XTD A;  2EYL A;  1TWF H;  4BY7 H;  4YCV A;  3GTJ B;  4NXN L;  1ZYR D;  4ZRZ A;  4EQP A;  2MO0 A;  1SNC A;  4KTA A;  1STB A;  4NPS A;  2F0T A;  4PZ8 A;  3GTM B;  5CMD A;  2EY1 A;  1UNS A;  4RKL A;  4JI3 Q;  4OO1 G;  3C2P A;  3LGJ A;  4RA8 A;  3R8B A;  4C1N I;  5E7N A;  1Q3L A;  4DUZ Q;  1S5E D;  2F4V Q;  3SR1 A;  3QOJ A;  1E24 A;  3I90 A;  1JOO A;  5TSS A;  2VS1 A;  3F2U A;  3L3O C;  1KDB A;  4GLX A;  4BXX G;  1BDO A;  1HNZ L;  4ZK9 B;  5CV6 A;  2VW9 A;  5AJ3 Q;  2ES2 A;  3HOU B;  1I3Q H;  4KI0 A;  1L1O A;  3H09 A;  3WOF A;  3HKZ E;  4C2M H;  1PFB A;  1PRT B;  4A3B B;  1HPC A;  1UEB A;  4ODG A;  2VQE L;  1CSQ A;  3A8K E;  4OWT B;  4DV2 Q;  3VYS A;  4HIO A;  4PMB A;  2R7Z H;  1M4V A;  2GVB A;  3K59 A;  1PFM A;  3HG9 A;  3T13 A;  1B8A A;  2BA1 A;  2K7V A;  1KLG D;  2E75 C;  1A6X A;  5C6A A;  5IP7 G;  1QUQ A;  2JA9 A;  4OEL B;  1QCB D;  3SVM A;  2F0O A;  2RF4 A;  2Z6K C;  2E2J H;  5FOB B;  5EKL A;  4WJ3 M;  3A7A B;  4ME5 A;  4DR2 L;  1Y8O B;  1KC8 C;  4FF2 A;  4UAI A;  1K3B C;  1RCV D;  4JI4 Q;  1RF2 D;  2VUM G;  4JYA Q;  1Y1V G;  3Q0A A;  2K14 A;  1VQ6 A;  3AMU A;  5BR8 Q;  2G5D A;  4LWC A;  1HNX Q;  4PV1 C;  3PMF A;  1IYV A;  1E3P A;  4PZ7 A;  5HGT A;  2HD3 A;  4C3J G;  1X9N A;  1HRJ A;  3CCQ A;  1KRS A;  1OXT A;  2CKZ B;  2B2V A;  2EY5 A;  3H6M A;  1A15 A;  4A3G G;  3V96 A;  1U4L A;  3CU7 A;  4WOR A;  2GVA A;  3MTS A;  5FLM H;  4HID A;  3B6Y A;  2IX0 A;  3GTL H;  2QGQ A;  1SYB A;  1CA6 A;  2PMZ B;  3PUZ A;  1LAC A;  5JEA G;  1YNJ C;  2EZV A;  2A68 D;  3NEM A;  3OTO Q;  4A3I B;  1TS3 A;  1Y1V B;  5IYC G;  2ICE C;  4DR5 L;  2L11 A;  5A2Q L;  3K5N A;  1FNW A;  3A8J E;  2DUD A;  3NTI A;  1D5Z C;  1LTS D;  4QY7 A;  1ENA A;  2F3I A;  1WVL A;  4N9T A;  1H9S B;  2HQE A;  4IUR A;  4C3J B;  1XNQ Q;  5E4W C;  2F0I A;  1R4Q B;  4RG1 A;  4B3T L;  5C4Z A;  3F1Z A;  3BZC A;  1BF4 A;  4IN3 A;  1VQH A;  3L9A X;  4DV4 Q;  3OMG A;  4EQ5 A;  2EYJ A;  1I5F A;  2KVM A;  1DGS A;  1SE2 A;  3HOV G;  2Z6B A;  1EYA A;  3ERS X;  4B9W A;  3UE1 A;  2E76 C;  4LFC L;  2KHI A;  2WV6 D;  1TWC H;  1HZC A;  2A8V A;  1DCZ A;  4IUP A;  4DXF A;  2B3G A;  2K05 A;  4BY1 H;  1HQM C;  5IP9 G;  4DR3 Q;  4XXE A;  1TWG H;  2UUB Q;  1X6O A;  2UXD Q;  3HOZ G;  5IOD A;  1JB7 A;  4TKO B;  3URY A;  1GUT A;  5BN4 A;  1IZ6 A;  1HTP A;  3ULL A;  3BDO A;  1SMX A;  1G6P A;  2PPB C;  4AQY L;  1CQF A;  4GN4 B;  3VR3 A;  4P2C B;  5EJW A;  3TZU A;  4OIJ A;  3NEL A;  2QA4 A;  2KCM A;  4JOI A;  4NXN Q;  3CC7 A;  3G6J B;  3GTK B;  3HOV B;  2LMC B;  4KN4 C;  5IGD A;  3N52 A;  3VA7 A;  5GAD C;  2OEO A;  3PSI A;  3CW2 C;  1O7Z A;  5EAY A;  1Q90 A;  1IYJ B;  2E2D C;  2QF7 A;  3HOZ B;  2Q8T A;  3GTQ B;  1BQQ T;  5DM7 3;  2DN8 A;  1E1O A;  2K5N A;  5EKI A;  1WTH A;  1Q1E A;  4QUF A;  3TP5 A;  3S2H H;  2NVX B;  2NVQ B;  3T53 B;  3PV0 A;  5L37 A;  5BN3 A;  1VQJ A;  1C0A A;  2A6H C;  5DNF A;  2M00 A;  1HNZ Q;  2B2T C;  3I4N H;  1JCK B;  2IHE A;  4BY7 G;  1JE4 A;  3G48 A;  4BS9 A;  1TS4 A;  4WRD A;  4YCW A;  2OTJ A;  3HFZ B;  2WB1 E;  1IHZ A;  3CMA A;  4GNX C;  3T16 A;  2VXW A;  1EY9 A;  1B9M A;  1Q8I A;  4DNR B;  1IW7 D;  3HEJ A;  2C9O A;  3KDF B;  3J81 c;  2VQE Q;  1RJT A;  4A4I A;  1YHB A;  3PIO A;  2L0C A;  2KEE A;  4K5W A;  4IOA A;  3AQQ A;  2Q2U A;  5IE8 A;  1S3O A;  1GUO A;  4K8I A;  4CJ1 B;  3GTG B;  1SBB B;  4OIK A;  1VQ4 A;  2H1E A;  1Q7Y C;  5JPN C;  3NUC A;  1F2Z A;  3J7A F;  1B2T A;  1SYF A;  4CDD C;  3E3X A;  2MHV A;  1CKM A;  4PG3 A;  3JC6 6;  3SDZ A;  1CI3 M;  4TRD A;  5CV8 A;  3UI2 A;  5IYB H;  4K2L A;  3QR8 A;  1JT8 A;  3U50 C;  2ICI A;  3HRZ C;  1DM0 B;  4C3H B;  2QW7 A;  2ID0 A;  2F52 A;  4BA1 I;  5JJI A;  1N36 L;  2R7Z G;  1JOK A;  1TWA H;  3M4P A;  2K75 A;  5C0X H;  1G29 1;  5KGU A;  1TS5 A;  5FLX E;  3F2C A;  3VYR A;  4ZUJ A;  4NXM L;  1VQP A;  3GTJ H;  4R9W A;  1SND A;  3KF6 A;  1VQM A;  4IPH A;  5ELO A;  1Q1B A;  4AIM A;  1H9R A;  1MI2 A;  2LXJ A;  1V1Q A;  1ET9 A;  4X62 L;  1I3Q B;  1TVX A;  5DAU A;  1HNW L;  1FGU A;  4C2M B;  1BBU A;  1W2B A;  4PNY A;  5M5W H;  3C3L A;  4HCE A;  1STA A;  1XPO A;  3D4D A;  1PV4 A;  4JI7 L;  3GTO H;  1JOR A;  2D62 A;  4X3S A;  1X3E A;  4LAA A;  4DV0 L;  1VQG A;  1I4R A;  1EY8 A;  1XTC D;  1EU4 A;  1QG7 A;  2J7Z A;  2LFN A;  3VDY A;  4B3T Q;  3NEN A;  1EY6 A;  1I6V C;  2F0J A;  1GUG A;  4HN7 A;  3HOU H;  2OQK A;  4KHV A;  2KHS A;  2VL6 A;  4CKC A;  5FLM G;  1HUN A;  2Z4I A;  4C1N K;  2NZ1 D;  3P1H A;  4A3B H;  3DWQ A;  1EU3 A;  2KA7 A;  5J3B A;  3L0O A;  5IYD H;  1I50 H;  2RCN A;  4HJ9 A;  5JPM C;  1N8R C;  2WKD A;  4JBJ A;  2KOL A;  1HHV A;  4FF3 A;  1NAP A;  4JI2 L;  3DEP A;  5FO9 B;  1UE5 A;  1X55 A;  2G9D A;  4EX5 A;  1JB3 A;  1FYC A;  4IAL A;  1SJH D;  1HQR D;  1YVC A;  4I7A A;  1MBY A;  4AQY Q;  5I6W A;  3JAM L;  3CCS A;  3G6E A;  2FMC A;  4I7Z C;  1EIG A;  4C56 C;  1QJO A;  3J81 E;  1Z7T A;  4GS3 A;  5I2Y A;  1VF7 A;  2ZT9 C;  4DV1 Q;  1K28 A;  1XX8 A;  1EOT A;  2Y0S G;  3TP7 A;  2HHH Q;  2K6A A;  1B53 A;  3GTL B;  3CP0 A;  3ITP A;  2Z9H A;  3DWP A;  2Q8R E;  4R8I A;  2AQ1 B;  4KLK A;  3EJI A;  1WOC A;  1LYL A;  2MPM A;  3DM3 A;  3EQL C;  4UP8 A;  1CHQ D;  4BY1 G;  4F7X A;  4JI1 Q;  4LF6 L;  2B2Y A;  1EYC A;  1FR3 A;  3TQY A;  2F0E A;  1PHJ A;  2NB0 A;  2FXQ A;  2LKV A;  1O80 A;  4H13 C;  4POG A;  1ICW A;  3M4Y A;  2Q8I B;  2EOT A;  2RKS A;  1RHP A;  4RMF A;  1RTN A;  2JA5 H;  1IXR A;  5C3E B;  1GUW A;  4KKS A;  1G91 A;  2F03 A;  3PO3 H;  1PYB A;  2MO1 A;  1Y69 U;  1TXY A;  2FHT A;  4P71 A;  4JPB W;  2CWP A;  5KYI A;  4DR7 L;  4A3I H;  5C4X H;  1JQY D;  1KL9 A;  2Y0S B;  2PNR C;  4LF7 L;  3NQT A;  1VQC A;  5CGK A;  1KNE A;  2ZM6 L;  1UE1 A;  4LF9 L;  2EVB A;  4BY1 B;  1EEF D;  1FJG Q;  1TWG B;  1A3U A;  3LWU A;  3DUZ A;  1AP0 A;  1CTM A;  4KMU C;  2L5T A;  1WI5 A;  1AE3 A;  2X6G A;  4RWS C;  1KAA A;  1RD9 D;  4H7B A;  5K36 H;  4KN7 C;  3I4L A;  3MA2 B;  4R4O A;  1WYD A;  1DD2 A;  1X54 A;  2R92 H;  1D8L A;  3I4N G;  3CME A;  4DK0 A;  4GKK Q;  4G57 A;  3CPF A;  4K0K L;  2UUA L;  1RL2 A;  4JI8 Q;  1JWU D;  1JJC B;  5T1G A;  4DFA A;  5ELC A;  4DUY L;  1CKN B;  1I4X A;  3K5L A;  1PVO A;  2J0T D;  1J8I A;  2DJG C;  2RCF A;  1N36 Q;  1Z9F A;  4CDE C;  2Q2I A;  3TP6 A;  1TQO A;  3A0J A;  2JEA I;  2N49 A;  1HR0 Q;  4QIW E;  3RLO A;  2Z6K A;  1UUP A;  1QWY A;  3EBE A;  1I4Q A;  4NXM Q;  4N9P A;  4A3J H;  1PDQ A;  1STH A;  1HUM A;  2K50 A;  3GDE A;  3NTH A;  3KYH C;  3PF5 A;  1YNN C;  1PH5 A;  1VS0 A;  1PTO F;  2PI2 A;  2JP1 A;  4F8M A;  1VQ8 A;  1NTG A;  1NUC A;  2EYM A;  3I4N B;  1VQK A;  1SE4 A;  1QVF A;  2F0L A;  5IGB A;  4X62 Q;  1DOL A;  4KD3 A;  4P72 A;  4EQN A;  1LAB A;  1PRT D;  4NW2 A;  5C0X I;  1HNW Q;  2B63 H;  5IYB G;  2YU9 B;  2X6L A;  4AYB G;  2F0V A;  3F8T A;  2Z0S A;  1IBK Q;  3G7L A;  2FIN B;  1SYE A;  4JI7 Q;  4IJL A;  2JA8 B;  1VQF A;  5HUR A;  4OX9 Q;  2K5V A;  5C0X G;  1CKO A;  2JEB I;  1EYD A;  2CW0 D;  3J81 i;  1LT5 D;  3M9B A;  4XDX A;  3RN2 A;  4NB3 A;  5KND A;  2PYK A;  5I6Y A;  4IFD H;  4LFA L;  4PQX A;  2HCI A;  1M90 C;  1YHQ A;  1HA6 A;  3Q6S A;  3CCM A;  1WTX A;  3E5S A;  4OWW B;  3VA5 A;  3H3V H;  2P5Z X;  1WJJ A;  4XQN A;  1RIP A;  1M1K C;  4P74 A;  2V4D A;  4OXP A;  4YY3 L;  3RZO H;  5A2Q E;  2F0K A;  4AYB B;  4FNF A;  5IWA L;  3TS2 A;  3SK8 A;  2IT1 A;  1BCP F;  4JI2 Q;  3UDF A;  4LFB L;  3GTG H;  1S5C D;  1XYI A;  1STE A;  3GTP H;  1PFN A;  3PO2 H;  2RDG A;  5K5P A;  1RTO A;  4XT1 B;  3M3Y B;  1KAB A;  2RBM A;  5IGE A;  3OWF A;  4GOP C;  4J6H A;  3HOU G;  2JXM B;  3MZ5 A;  2F0W A;  3OPO A;  4WFN 3;  2A6E D;  1HA5 A;  3LNN A;  3T56 B;  4DGZ A;  3A5Z B;  4A3B G;  5CV9 A;  4R4C A;  4GN3 B;  4JV5 L;  2B2W C;  4C3H H;  4EGV A;  3TS0 A;  4UDU C;  2O4X A;  5DLQ E;  1OXU A;  3FRP B;  1H9J A;  1GJX A;  5IYD G;  4A3M H;  2I5M X;  1EIY B;  5G3L D;  3I72 A;  1MJC A;  4MIU A;  2D2C C;  5BN5 A;  5M5W B;  4NMZ A;  4JI6 L;  1DYQ A;  1PTO C;  3GTO B;  4KHP Q;  4RGN A;  1WFQ A;  5GAE C;  1CSP A;  3D6W A;  3BVM A;  3A8I E;  1SRO A;  3HGB A;  3T1Y L;  5C3X A;  2CQA A;  4JVZ A;  1JWM D;  1T9H A;  2NUC A;  4YWM A;  1V9P A;  4V19 0;  4N8X 1;  4A3K H;  3W3A A;  2I07 B;  1C9O A;  4DR7 Q;  5C4J H;  2I5L X;  5E3F A;  3I4M B;  4K8J A;  5EBC A;  2MFI A;  1JOQ A;  2BE5 D;  3NHH A;  2CH4 W;  3P75 A;  3U4V A;  2ZM6 Q;  1LTT D;  5EPL A;  1HXY D;  1SFO H;  5J22 A;  3H94 A;  2RQX A;  2BCO A;  4RHS A;  1I50 B;  3V2T A;  1VQE A;  2DNE A;  3K7A H;  1YZ6 A;  2F0S A;  1L1O B;  1N34 L;  4CBV A;  2JN4 A;  4DR4 Q;  4FXK C;  3FP9 A;  2JA5 G;  1X3G A;  2B2T A;  1I94 L;  1CZG A;  4DK6 C;  2K04 A;  1EIF A;  4DF7 A;  2MNA A;  3PO3 G;  2JA7 H;  1LO5 D;  3VR2 A;  4B08 A;  3RZD H;  5C5M A;  1XPU A;  4AH6 A;  4GNX A;  2EXD A;  2RDH A;  1NCV A;  2UUA Q;  3A56 A;  4A3I G;  2SDF A;  5C4X G;  1XMO Q;  1QUQ B;  1XNR L;  1BCP C;  2XNA C;  3JAM c;  1XXG A;  2VB2 X;  4HR7 B;  2F0G A;  2CH4 A;  1UAP A;  4X3K A;  2K32 A;  1YNX A;  1J6Q A;  1ML0 D;  3S15 H;  5C44 B;  3TDQ A;  1BKB A;  4IPD A;  2SOB A;  4IUU A;  1EYG A;  3HKZ G;  5K36 G;  1Z6H A;  5M5Y H;  1E22 A;  4KV6 A;  2JA5 B;  5M5X B;  1AZP A;  2XWJ B;  4ZKC B;  3IL8 A;  1EFI D;  3U58 A;  1X3F A;  5HGQ A;  2R92 G;  2HCC A;  2ZXR A;  2WP8 J;  3PO3 B;  1SRU A;  1I4P A;  1X3Q A;  1EEI D;  1JC7 A;  5GAH C;  3ICE A;  1VF5 C;  1KD1 C;  1ONL A;  1TWH H;  1K8O A;  1I6H B;  3EFX D;  3J7A 5;  4XTC S;  1XJV A;  1IKL A;  5CBA E;  3L2P A;  5C4X B;  2IPK D;  1PZK D;  4DAV A;  1WTV A;  3RLN A;  2PNH A;  1EL0 A;  3CCR A;  4L5Q A;  5IIF A;  3F2D A;  1H9K A;  3SK6 A;  4U68 A;  2EJG C;  4X65 L;  2JJQ A;  1BNZ A;  3TRE A;  1DZ1 A;  2ZJR A;  2TSS A;  5I2X A;  1N32 L;  5C3E H;  5IOC A;  1K9M C;  1P8L A;  4DPG A;  1K8M A;  1Q81 C;  2IW3 A;  1DOM A;  5EGT A;  1NNX A;  1A2U A;  5A35 A;  3HKZ B;  4A3J G;  4FP5 D;  1A0I A;  4L5R C;  1ESF A;  4ZQ3 A;  3PCO B;  3R93 A;  4LFA Q;  2BH8 A;  3C1E A;  2R92 B;  1QIL A;  4QL5 A;  5FLX c;  3BU2 A;  5M9O A;  1G51 A;  5GAG C;  1BVS A;  2DJF C;  4UP7 A;  5DM6 3;  1EIH A;  1B1Z A;  4ZAI A;  3J80 L;  5JJL A;  3ZJY C;  1HH2 P;  4YY3 Q;  1G8Z D;  2B63 G;  4APV A;  4A3D H;  3NWT A;  5IT9 c;  2HDL A;  3KK7 A;  4B3S Q;  1R9T H;  4LF4 Q;  3FEW X;  5IWA Q;  4A75 A;  3NQI A;  1PLF A;  2VQF Q;  2RSN A;  4LFB Q;  4IFD I;  3PF4 A;  1AW7 A;  1SE8 A;  1R4P B;  5GRO A;  2YTY A;  1HR0 W;  3H3V I;  2M9V A;  1NJI C;  2UUC L;  1LTB D;  4A3J B;  3RLF A;  4IFD G;  1KRT A;  2A19 A;  5JJK A;  4JV5 Q;  2YV5 A;  1Q12 A;  2F1M A;  1SE3 A;  1F77 A;  3QG1 A;  2B63 B;  3S1Q B;  1MSG A;  3I7F A;  1SN8 A;  2I5H A;  1B7Y B;  2XGT A;  5M3M B;  1SSO A;  3CCJ A;  4JI6 Q;  2B2U C;  3UDX A;  4X64 L;  1V43 A;  2XN9 C;  4O0A A;  5C5L A;  4DU9 A;  3CPW A;  5FK9 C;  1MKH A;  3S14 B;  1YIT A;  2K4K A;  2F0U A;  3PO2 G;  3QIA A;  2K5Q A;  3JAM E;  5KIX A;  1EY0 A;  2PCF B;  2IJ0 A;  2E2I H;  3BS1 A;  1OXV A;  2MUY A;  2CW0 C;  3QOL A;  3QB3 A;  2R93 H;  2AHO B;  1X65 A;  2X69 A;  2BH2 A;  1Y8P B;  1CFM A;  1U4M A;  5CV5 A;  1KAW A;  2PQA A;  2YU9 H;  4Y52 H;  3S1N H;  4JBM A;  1GD7 A;  5ISR A;  1S72 A;  4C3H G;  2KBN A;  1F9R A;  1JE5 A;  3J7Y W;  5LL6 S;  3NWS A;  3RZO B;  2JA8 H;  1BOS A;  1YJN A;  1L0X B;  4A3M G;  2A69 C;  1YIJ A;  3UDG A;  4JI0 L;  3W2D A;  5COR A;  4RGM A;  3H15 A;  1BBX C;  3U9S A;  1T5X D;  4FO2 A;  1N34 Q;  4RKB A;  4MTK A;  4DNT B;  5LMN L;  2BOS A;  1XMQ L;  1MHW C;  3GTP B;  1I94 Q;  5EQ0 A;  4YHH L;  1GUN A;  1GXD C;  3OSO A;  3PO2 B;  5D3I B;  2AWN A;  1CK1 A;  4HJ8 A;  3CF5 A;  3HP3 A;  5J39 A;  2L15 A;  1IBL L;  1SEB D;  4DR2 Q;  1EQR A;  2KED A;  2WAQ E;  4A3K G;  4LF8 L;  3NXW A;  1E7Z A;  3KF8 A;  1ZYR C;  4LJZ C;  1XNR Q;  3E6Z X;  1LUZ A;  4NDX A;  4H02 A;  3IFT A;  1IBM L;  2SNS A;  2B8F A;  5ELN A;  2N78 A;  4A3M B;  5CYU A;  4JBW A;  2IWH A;  2Z4H A;  4ABN A;  3KF8 B;  3M3Y H;  1B9N A;  4XQQ A;  3RMH A;  2E5L L;  2WB1 G;  4BBS B;  4DV5 L;  1KDC A;  1VMC A;  1GHJ A;  4M1U B;  5LMU L;  4EVO A;  2A5H A;  1PH3 A;  4Y7N B;  1GVP A;  5IT9 E;  2JA7 G;  3IAY A;  1RDP D;  1K8G A;  1SNM A;  5I9P A;  2HUG A;  3GP7 A;  4A3K B;  2I46 A;  2NZH A;  4OGQ C;  1GM5 A;  4R1J A;  2NZO A;  1DXM A;  5C4J B;  1K8A C;  4O2D A;  4LW1 A;  4DR5 Q;  2ZTC A;  3OWE B;  1TKW B;  1F9P A;  2EXZ A;  2HDM A;  1G2T A;  2L9H A;  2J4X A;  2K5W A;  3KF6 B;  5JVG 3;  1VQN A;  1W3S A;  1ASZ A;  1CM9 A;  2OTL A;  1SFO B;  1S5B D;  4X65 Q;  1LTR D;  3BJU A;  1ILQ A;  3K7A B;  4XYQ A;  4G7Z C;  4QGU A;  1C7Y A;  1ROD A;  2UU9 L;  2WB1 B;  3A55 A;  2EY2 A;  1KHI A;  4FDB A;  3DXJ C;  4RCO A;  3AB9 A;  3AYH B;  3NTK A;  1VQA A;  1QE6 A;  3I4M H;  2RHS B;  2JA7 B;  3DMU A;  3RZD B;  4KK7 A;  1EY5 A;  1YI2 A;  1JR0 D;  4LFC Q;  4HJ7 A;  1NY4 A;  1PH9 A;  2HIV A;  3G71 A;  3DHQ A;  2NTS A;  3LWE A;  5C0X J;  4QQB X;  2L55 A;  2R7F A;  4HIM A;  2AQ3 B;  1K73 C;  5FO7 B;  3S15 B;  2AMC B;  3CRK C;  4DR6 L;  3CC2 A;  1D5M C;  5C3E G;  3JAM i;  1KLU D;  5ELD A;  1SR3 A;  4XT3 B;  1SMY D;  2K52 A;  4K5V A;  1PZJ D;  4RGT A;  5M5Y B;  2OQ0 A;  4DV3 L;  4CDF C;  2XTI A;  2XRS D;  1YHA A;  1UE6 A;  1E0B A;  1PH6 A;  1TWH B;  3CCU A;  5M3F H;  1DJR D;  2CVR A;  5KNB A;  1SYG A;  2RSO A;  2A68 C;  2R7D A;  3S9W A;  1C4Q A;  5C44 H;  4CKE A;  4A3D G;  2PZT A;  4A93 B;  4IUQ A;  3GD7 A;  2A1A A;  2C35 B;  1O78 A;  1O7Y A;  1HZB A;  4X64 Q;  3FDT A;  2EYP A;  1IL8 A;  1SJE D;  3WOE A;  5FJ8 H;  5M5X H;  4GOP A;  1F2L A;  1H95 A;  3CCL A;  3HOX B;  4B3R L;  1O7I A;  2NTT A;  3BDL A;  4IQZ A;  4MNO A;  1PZI D;  1J9O A;  3CCE A;  1I6H H;  1BXT A;  4DUZ L;  1A3T A;  1S5F D;  4ZCK A;  2B2W A;  2XVS A;  2EY6 A;  3SE0 A;  2F4V L;  3HOW H;  2B29 A;  3K0X A;  4A3L H;  1AFP A;  2EJM A;  2AQ2 B;  3S1R H;  1E2V A;  1HFN A;  1X3P A;  3MFG A;  3GV3 A;  3PGZ A;  1YNJ D;  2LY7 A;  4A3D B;  1YEZ A;  2WIN B;  5AJ3 L;  4JI0 Q;  1W6K A;  1R9T B;  5F2D A;  3BYY B;  4Z9C B;  3V05 A;  1U5K A;  1HZ9 A;  3I2Z A;  2OWO A;  2PW7 A;  5LMN Q;  1XMQ Q;  1I4H A;  4NKL A;  1IBL Q;  3H0G B;  1PTO B;  4CJ2 C;  2R93 G;  3O13 A;  3I91 A;  3KBX A;  2ZXO A;  1CT1 D;  1LTI D;  4HMJ A;  4RCN A;  4PMW A;  2VZA A;  1IBM Q;  1JMC A;  4MHE A;  2XRQ D;  2JA8 G;  1B4O A;  2JK8 A;  2LS0 1;  4BBR H;  1S5D D;  1H9M A;  1NBW A;  4B9X A;  5LL6 X;  2YTX A;  2NVY H;  3FKI H;  2E5L Q;  3FPU B;  1IKM A;  2UXC L;  1CZW A;  3TEH B;  5BR8 L;  3OHX C;  1T5E A;  1WTW A;  1HCZ A;  1HNX L;  2YYZ A;  1CUK A;  4O42 A;  4DAP A;  2E2I B;  4CGY B;  3PIP 3;  2R93 B;  4LMQ D;  3J81 j;  3S1Q H;  2IL8 A;  1SNO A;  3W1G A;  4DA2 A;  3S1N B;  3K7U C;  4HSP A;  5M3M H;  1IW7 C;  1NMF A;  4UPA A;  3I3C A;  3SGI A;  4DV0 Q;  3KFU A;  1BCP B;  3S14 H;  2WKC A;  3KLS X;  4HCS A;  3KJP A;  1Q82 C;  2NN6 H;  4N8F A;  4RFB A;  5JEA J;  1FVI A;  5HY6 A;  2UU9 Q;  3CQZ H;  2I0Q A;  4ID6 A;  3DEO A;  2K1B A;  1PA6 A;  1WD1 A;  4KY5 A;  3E9I A;  1QZG A;  4CKB A;  2VY3 A;  3T4A C;  3CC4 A;  5T1I A;  3QO2 A;  4U67 3;  1XNQ L;  3X3M A;  1LM0 A;  4G7O C;  3NP8 A;  2A6H D;  2QCP X;  3SXH A;  1PFS A;  4DR1 L;  3WDN A;  3J81 L;  4IPC A;  3DM1 A;  2K33 A;  5CBE E;  1C48 A;  2AUJ D;  1SYD A;  2F0P A;  2FJ2 A;  1LV9 A;  4DR6 Q;  2XWB B;  2JYO A;  3D31 A;  2QIL A;  3K6O A;  4OEM B;  3AU7 A;  4L6T B;  3F2B A;  3HZX A;  5JOB A;  3K5M A;  1AH9 A;  5CR3 A;  5ELE A;  5CC4 A;  4UHV A;  2JA6 H;  1D1I A;  3RD4 A;  1MGS A;  5C4H A;  4DXG A;  1F9Q A;  3I4M G;  2K28 A;  2PZU A;  2XSC A;  1L0W A;  1EY4 A;  4L5T A;  1S4Z A;  3J80 E;  1M8A A;  4QIW B;  3DWA A;  4LF6 Q;  2MGS A;  2F0H A;  3STB D;  4C3I B;  1LT3 D;  1Y8N B;  1QVC A;  1G2S A;  3K57 A;  1SAP A;  1PH2 A;  1OO9 B;  4BA2 I;  4JC0 A;  1VQ9 A;  3VYU A;  3C46 A;  2A73 B;  4BBS H;  3RR5 A;  2AWO A;  2YTV A;  4IFD J;  5LHY 1;  2NWG A;  3W5O A; 
#chains in the Genus database with same CATH homology
 4Y7N H;  1R9T H;  4LF4 Q;  4B3R Q;  5IWA Q;  4A75 A;  2LXJ A;  1V1Q A;  4YWL A;  2LXK A;  4DR4 L;  4X62 L;  4AYB E;  4TQU S;  4JI5 Q;  2VQF Q;  2PMZ E;  1EUJ A;  4LF5 Q;  4IFD I;  4GKJ L;  4LFB Q;  1CKN A;  2BA0 A;  3PF4 A;  1HNW L;  4UP9 A;  1FGU A;  1EWI A;  2N3S A;  1SE8 A;  4R4Q A;  4DV7 Q;  5GRO A;  1BBU A;  2YTY A;  4DAM A;  4DNI A;  3ULJ A;  1W2B A;  1NJI C;  1HR0 W;  4LF7 Q;  3H3V I;  5M5W H;  2UUC L;  3KJO A;  1XPO A;  1PV4 A;  4JI4 L;  4JI7 L;  2UXB Q;  3GTO H;  5M3F G;  2D62 A;  1XMO L;  2H5X A;  1X3E A;  4LF9 Q;  5IYC H;  4DV0 L;  2HT1 A;  4JYA L;  1VQG A;  3Q8D A;  3RLF A;  4IFD G;  2Q2T A;  1B70 B;  5C44 G;  4DV5 Q;  1KRT A;  1X56 A;  3UDI A;  5LMU Q;  3PUX A;  3VDY A;  4A3C G;  4B3T Q;  3M85 A;  3S16 H;  2VNU D;  2A19 A;  5JJK A;  1OTC A;  3NEN A;  4DKA C;  1PH4 A;  4JV5 Q;  1EQQ A;  2YV5 A;  3HOU H;  1Q12 A;  3PUW A;  4YWK A;  4X66 Q;  2OQK A;  4DK3 C;  4GLA C;  2VL6 A;  5FLM G;  2KCT A;  5FJ8 G;  3I7F A;  1SN8 A;  2I5H A;  4L5S A;  1B7Y B;  1Z47 A;  4A3B H;  4OON A;  3RNU A;  2DGY A;  2XGT A;  3CCJ A;  4WJ4 A;  4JI6 Q;  5J3B A;  3UDX A;  1S40 A;  4X64 L;  1V43 A;  3L0O A;  1L2F A;  4O0A A;  3HOY H;  4K0K Q;  3CPW A;  1I50 H;  1AE2 A;  2RCN A;  1MKH A;  4HJ9 A;  5IYD H;  1N8R C;  1XPR A;  1K3R A;  3GTK H;  3HOV H;  1YIT A;  2K4K A;  3PO2 G;  3KOJ A;  4JBJ A;  3BZK A;  3HOW G;  1VCI A;  4A3L G;  2ATW A;  4JI2 L;  3I56 A;  2E2I H;  4P73 A;  4DV6 Q;  4PZ6 A;  1OXV A;  4DUY Q;  1UE5 A;  1X55 A;  3OW2 A;  3OTO L;  4EX5 A;  5IP9 H;  2R93 H;  2AHO B;  1X65 A;  2BH2 A;  1YVC A;  3HOZ H;  1KIX A;  4AQY Q;  1KAW A;  2PQA A;  3E0E A;  3GTQ H;  2YU9 H;  4Y52 H;  3S1N H;  3CCS A;  1GD7 A;  2JE6 I;  4GNX B;  4JBM A;  1S72 A;  3G6E A;  2HIX A;  2ZJQ A;  3UE0 A;  1PH8 A;  2KBN A;  1JE5 A;  2NVX H;  2MQH A;  4GS3 A;  4P75 A;  2NVQ H;  4DV1 Q;  2UXC Q;  2JA8 H;  1YJN A;  1WCM G;  5IY0 A;  2Y0S G;  4A3M G;  2HHH Q;  1GO3 E;  1K83 H;  1N9W A;  1YIJ A;  3K80 C;  4JCV E;  3UDG A;  1J5E Q;  4JI0 L;  3CP0 A;  1KXL A;  3H15 A;  2IX1 A;  4KLK A;  1N34 Q;  4DV4 L;  1WOC A;  4B3S Q;  1LYL A;  4IOC A;  3DM3 A;  4UP8 A;  4BY1 G;  4LF6 L;  4JI1 Q;  5LMN L;  3EN2 A;  4OWX B;  1XMQ L;  3TQY A;  1I94 Q;  1PHJ A;  4YHH L;  1VQL A;  2N8N A;  4DAY B;  2AWN A;  3OYY A;  4HJ8 A;  4A93 H;  2FXQ A;  4B3M L;  4POG A;  3CF5 A;  1LTL A;  2L15 A;  1IBL L;  1IL2 A;  4DR2 Q;  4YCU A;  4X6A H;  1EQR A;  4RMF A;  2WAQ E;  3TRZ A;  4A3K G;  4LF8 L;  1MIU A;  2JA5 H;  1IXR A;  1E7Z A;  4DR3 L;  4R4T A;  2UUB L;  2UXD L;  1Q86 C;  4DV3 Q;  4B3S L;  2V1C C;  1XNR Q;  4LF4 L;  1QVG A;  3S17 H;  1LUZ A;  3PO3 H;  1PYB A;  4BBR G;  2QEX A;  4A76 A;  2HQL A;  4H02 A;  3HOX H;  2MO1 A;  2VQF L;  1TXY A;  2OCE A;  3ER0 A;  1ASY A;  3I4M H;  4P71 A;  1IBM L;  3FKI G;  4A3E H;  3M7N A;  2CWP A;  5ELN A;  3L7Z C;  4DR7 L;  4A3I H;  5C4X H;  2E2H H;  1KL9 A;  3PUV A;  2N78 A;  5LMN W;  4LF7 L;  1D7Q A;  4OO1 I;  1XTD A;  4JBW A;  1VQC A;  2AKW B;  3M3Y H;  1TWF H;  3KF8 B;  4BY7 H;  4YCV A;  2ZM6 L;  1UE1 A;  3J80 i;  2EQS A;  4ME3 A;  4NXN L;  2E5L L;  2WB1 G;  2KEN A;  4LF9 L;  2MO0 A;  2ASB A;  1KQS A;  4NPS A;  1FJG Q;  4DV5 L;  2CCZ A;  4PZ8 A;  5LMU L;  1PH3 A;  1GVP A;  2NN6 I;  4DR1 Q;  4JI3 Q;  2JA7 G;  1K8G A;  1WI5 A;  1AE3 A;  3W1B A;  4OO1 G;  3LGJ A;  5M3M G;  2JQO A;  2NZH A;  3PUY A;  1GM5 A;  4R4O A;  4R1J A;  1WYD A;  2E8G A;  2NZO A;  5E7N A;  1K8A C;  4O2D A;  4LW1 A;  4DUZ Q;  1X54 A;  2R92 H;  4DR5 Q;  1K0R A;  2ZTC A;  3K8A A;  2F4V Q;  1D8L A;  4POF A;  3I4N G;  3KF6 B;  1E24 A;  3CME A;  1VQN A;  3GO5 A;  2NN6 G;  1W3S A;  2CQO A;  4GKK Q;  1ASZ A;  2OTL A;  2VS1 A;  3CPF A;  4K0K L;  3H0G H;  2UUA L;  4X65 Q;  1RL2 A;  4JI8 Q;  1BBW A;  1JJC B;  3BJU A;  3S2D H;  4XIG S;  3G4S A;  4GLX A;  4IO9 A;  4BXX G;  4QGU A;  1C7Y A;  1HNZ L;  4DUY L;  2VW9 A;  1CKN B;  5AJ3 Q;  2ES2 A;  3S1M H;  2UU9 L;  1PVO A;  1I3Q H;  4KI0 A;  1L1O A;  1KHI A;  1UWV A;  1Z9F A;  4FDB A;  2Q2I A;  1N36 Q;  3AYH B;  3HKZ E;  4C2M H;  4A3F H;  3A0J A;  2JEA I;  3I4O A;  2N49 A;  1HR0 Q;  4QIW E;  3RLO A;  2Z6K A;  1UEB A;  1VQA A;  2RHS B;  3AFP A;  1NE3 A;  3EBE A;  2VQE L;  1CSQ A;  2R6G A;  4IJH A;  4OWT B;  4NXM Q;  1YI2 A;  4A3J H;  4DV2 Q;  4HIO A;  4DV1 L;  4LFC Q;  4LUZ A;  4HJ7 A;  1NY4 A;  2K50 A;  3GDE A;  3U4Z A;  1Y1W H;  3KYH C;  1A62 A;  3PF5 A;  2HHH L;  1PH5 A;  1PH9 A;  2R7Z H;  2GVB A;  3M4O H;  1VS0 A;  2HIV A;  3A74 A;  3CXC A;  2PI2 A;  3G71 A;  1B8A A;  1L1O C;  2BA1 A;  2ZTE A;  1NTG A;  1VQ8 A;  1VQ7 A;  5C0X J;  4QQB X;  3T1Y Q;  5IP7 G;  4HIM A;  2R7F A;  1QUQ A;  2JA9 A;  1VQK A;  4LUO A;  1QVF A;  5H1S E;  1Q46 A;  2ZJP A;  2RF4 A;  4X62 Q;  1FL0 A;  2Z6K C;  4JI1 L;  1K73 C;  4P72 A;  2E2J H;  2AMC B;  4GKJ Q;  2IHF A;  2JA6 G;  5C0X I;  4DR6 L;  1HNW Q;  3CC2 A;  2B63 H;  5C3E G;  4WJ3 M;  3JAM i;  5IYB G;  4AYB G;  1OXX K;  4R4I A;  3F8T A;  2Z0S A;  1SR3 A;  4KHZ A;  4DR2 L;  1IBK Q;  1KC8 C;  2K52 A;  4JI4 Q;  4JI7 Q;  4IJL A;  2OQ0 A;  3KDF A;  4DV3 L;  2VUM G;  4JYA Q;  2XTI A;  1Y1V G;  1VQO A;  1VQF A;  3KLW A;  2K14 A;  1VQ6 A;  1VQI A;  1U0L A;  2K5V A;  4OX9 Q;  3W5O A;  5BR8 Q;  1YHA A;  5C0X G;  1UE6 A;  1N33 L;  1CKO A;  2JEB I;  4MTN A;  3J81 i;  4LWC A;  3T1H L;  1PH6 A;  1HNX Q;  3CCU A;  3M9B A;  1E3P A;  1GKH A;  4PZ7 A;  5M3F H;  2PQA B;  4NB3 A;  3RN2 A;  4UY8 C;  4HIK A;  1X9N A;  4BBS G;  2R7D A;  3CCQ A;  4LFA L;  5C44 H;  1M90 C;  1YHQ A;  1KRS A;  3CCM A;  1OXT A;  4A3D G;  2CKZ B;  4OWW B;  4A3C H;  4A3G G;  3GD7 A;  2A1A A;  2C35 B;  3H3V H;  3MEF A;  1WJJ A;  1RIP A;  1M1K C;  1HZB A;  4P74 A;  1FJG L;  2LSS A;  4X64 Q;  2D0O A;  2GVA A;  5FLM H;  4OXP A;  4YY3 L;  5M5X H;  5FJ8 H;  3RZO H;  4GOP A;  1VQD A;  4HID A;  1H95 A;  3B6Y A;  2IX0 A;  3CCL A;  3GTL H;  2QGQ A;  4B3R L;  5IWA L;  3PUZ A;  3PIP A;  4LNQ A;  3TS2 A;  5JEA G;  1O7I A;  2IT1 A;  3NEM A;  4JI2 Q;  4JI5 L;  3UDF A;  4MNO A;  4LFB L;  4LF5 L;  3GTG H;  3E9H A;  1MJE A;  3OTO Q;  3CCE A;  1I6H H;  4DUZ L;  5IYC G;  4DR5 L;  3GTP H;  4DV7 L;  2F4V L;  2DUD A;  3PO2 H;  4GN5 A;  4QY7 A;  2B29 A;  3K0X A;  3HOW H;  4A3L H;  4GKK L;  2F3I A;  3S1R H;  4GOP C;  2UXB L;  4JI8 L;  3STB C;  3HOU G;  2K5H A;  3CCV A;  1XNQ Q;  2ALY B;  1JJG A;  3PGZ A;  3AEV A;  1YJW A;  1YEZ A;  4RG1 A;  5AJ3 L;  3A5Z B;  3J7Z C;  4B3T L;  2RHQ B;  4JI0 Q;  4A3B G;  3F1Z A;  4R4C A;  4GN3 B;  3BZC A;  4JV5 L;  4X66 L;  4C3H H;  3EIV A;  1VQH A;  3TS0 A;  1U5K A;  1HZ9 A;  3I2Z A;  4DV4 Q;  2OWO A;  3HOY G;  4EQ5 A;  5DLQ E;  1OXU A;  1HR0 L;  1I5F A;  1WCM H;  5IYD G;  5LMN Q;  1DGS A;  4A3M H;  1XMQ Q;  2I5M X;  1EIY B;  3HOV G;  2EIF A;  3ERS X;  4HJA A;  1MJC A;  3UE1 A;  4B3M Q;  4LFC L;  2KHI A;  4JI6 L;  1TWC H;  1HZC A;  4C3I H;  1IBL Q;  2A8V A;  3MXN B;  2B3G A;  4KHP Q;  3D0F A;  4BY1 H;  1WFQ A;  5IP9 G;  3NBH B;  1CSP A;  5GAE C;  2R93 G;  1VQB A;  4DR3 Q;  1TWG H;  2UUB Q;  1X6O A;  2UXD Q;  3HOZ G;  3GTM H;  1N32 Q;  1SRO A;  3T1Y L;  1JB7 A;  3K81 C;  2WAQ G;  1T9H A;  4DV6 L;  1IZ6 A;  3ULL A;  4YWM A;  1V9P A;  3A5U A;  4PMW A;  2VZA A;  1SMX A;  1IBM Q;  4A3K H;  1JMC A;  3S24 A;  1G6P A;  1C9O A;  4DR7 Q;  5C4J H;  2I5L X;  2JA8 G;  1HJP A;  4AQY L;  4GN4 B;  2JK8 A;  4LUV A;  1IBK L;  4BBR H;  2CFM A;  2MFI A;  1NBW A;  2Y0S E;  3NEL A;  2YTX A;  2QA4 A;  3U4V A;  2KCM A;  2ZM6 Q;  2NVY H;  3FKI H;  4JOI A;  4NXN Q;  2E5L Q;  1SFO H;  3CC7 A;  2UXC L;  4OX9 L;  3TEH B;  5BR8 L;  1VQE A;  2CWA A;  1Y14 B;  1J5E L;  3K7A H;  1YZ6 A;  3AFQ A;  3ULP A;  1HNX L;  2YYZ A;  1L1O B;  4A93 G;  1CUK A;  1VQ5 A;  1A63 A;  1N34 L;  5GAD C;  3PSI A;  3IRB A;  3WWV A;  3CW2 C;  1QZH A;  4DR4 Q;  3FP9 A;  5EAY A;  2JA5 G;  3RN5 A;  3J81 j;  1X3G A;  2KHJ A;  1I94 L;  1IYJ B;  4DK6 C;  3S1Q H;  3CD6 A;  4JOI C;  2GN5 A;  1E1O A;  2K5N A;  1EIF A;  3W1G A;  2MNA A;  3PO3 G;  2JA7 H;  3HOX G;  1Q1E A;  3K7U C;  3RZD H;  1XPU A;  1PYS B;  3S2H H;  5M3M H;  4AH6 A;  2UUC Q;  4GNX A;  4A3E G;  2EXD A;  1NMF A;  2Q2H A;  2UUA Q;  4UPA A;  4A3I G;  3SGI A;  5C4X G;  3PV0 A;  1XMO Q;  1QUQ B;  4DV0 Q;  3HKS A;  1PH1 A;  3JAM c;  1XNR L;  1VQJ A;  3KFU A;  3S14 H;  1C0A A;  1OXS C;  1HNZ Q;  3I4N H;  3KJP A;  1Q82 C;  2IHE A;  2WFW A;  1EOV A;  4BY7 G;  1YNX A;  3G48 A;  5JEA J;  1FVI A;  5HY6 A;  2UU9 Q;  3CQZ H;  4YCW A;  1J6Q A;  2I0Q A;  3S15 H;  1A8V A;  1JJ2 A;  2OTJ A;  3HFZ B;  2WB1 E;  3CMA A;  1BKB A;  4J15 A;  4IPD A;  4GNX C;  4HJ5 A;  1YJ9 A;  1PA6 A;  1EYG A;  3E9I A;  4BXX H;  1QZG A;  3M4Q A;  2VY3 A;  3KDF B;  3J81 c;  2VQE Q;  4ALP A;  4GLV B;  3CC4 A;  3HKZ G;  1XNQ L;  5K36 G;  4A4I A;  1LM0 A;  1E22 A;  1YHB A;  5M5Y H;  3PIO A;  3DLL A;  4IOA A;  3U58 A;  3AQQ A;  1X3F A;  5HGQ A;  2R92 G;  2Q2U A;  2WP8 J;  1PFS A;  1S3O A;  5IE8 A;  1SRU A;  4DR1 L;  4JI3 L;  2NVT H;  2IY5 B;  4MZ9 A;  5GAH C;  3ICE A;  1KD1 C;  1TWH H;  4IPC A;  3H0G G;  1VQ4 A;  3J7A 5;  4XTC S;  1XJV A;  1HZA A;  3L2P A;  1Q7Y C;  4DR6 Q;  1NMG A;  3D31 A;  3RLN A;  5IP7 H;  2PNH A;  3CCR A;  4L5Q A;  3F2B A;  4KHP L;  3F2D A;  4GOP B;  4X65 L;  4IPG A;  2JJQ A;  1AH9 A;  1CKM A;  3TRE A;  4PG3 A;  3JC6 6;  2ZJR A;  1PH7 A;  3CAM A;  2JA6 H;  1Q8K A;  1N32 L;  2PI2 E;  1P16 A;  5C3E H;  4A3F G;  1K9M C;  5IYB H;  4AIM A;  4JBK A;  1P8L A;  4DPG A;  1EFW A;  3I4M G;  1Q81 C;  1N33 Q;  3U50 C;  1JT8 A;  1L0W A;  3T1H Q;  5GQO A;  2ID0 A;  2F52 A;  1YBY A;  4BA1 I;  4A3J G;  1E1T A;  4L5T A;  3J80 c;  5JJI A;  2ZTD A;  1A0I A;  1N36 L;  4L5R C;  2VUM H;  1Y1W G;  2R7Z G;  3PCO B;  1Y1V H;  1UE7 A;  4JG2 A;  4TVA B;  4LFA Q;  4LF6 Q;  1TWA H;  2BH8 A;  2K75 A;  3M4P A;  1G29 1;  4YHH Q;  4QL5 A;  5FLX c;  3BU2 A;  3F2C A;  3STB D;  4NXM L;  1G51 A;  5GAG C;  4DV2 L;  1BVS A;  1QVC A;  1SLJ A;  4UP7 A;  1PH2 A;  1VQP A;  3GTJ H;  4BA2 I;  4JC0 A;  3FHW A;  1VQ9 A;  5JJL A;  4C3J H;  3I55 A;  3KF6 A;  3ZJY C;  4BBS H;  1HH2 P;  4LF8 Q;  3RR5 A;  4YY3 Q;  2B63 G;  2AWO A;  2YTV A;  4APV A;  4IFD J;  4QJF A;  4IPH A;  1VQM A;  4A3D H;  5IT9 c;  2D0P A;  4A3G H;  5ELO A;  1Q1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...