1HZAA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hzaA00
3AFPA 1VQGA 4JI3L 3JC66 3K7UC 3CP0A 1IBKQ 5IP9G 4JV5Q 4DV6L 4LF9Q 4OWWB 3SGIA 3F1ZA 4DK6C 2JJQA 4DR7Q 1SN8A 1BKBA 2DGYA 3AFQA 1XMQQ 3PO2H 2B63H 2YTXA 4HIMA 4R4CA 3AEVA 2PI2E 1W2BA 3PO3H 1K9MC 3KF6A 3ULJA 1IBMQ 4KHPQ 4QJFA 1WJJA 4NXNL 4BA1I 1JB7A 4DPGA 4APVA 5IWAQ 1A63A 3D0FA 4Y52H 3HFZB 3W1GA 2QGQA 1EQRA 4YCWA 3TS0A 3ER0A 2R93H 3ULLA 5C4XG 1J5EL 1YBYA 4A3MG 4DR1Q 4BY1G 4JG2A 1PV4A 1L1OA 4POGA 1K3RA 4P72A 4GS3A 1BBWA 2JA8G 3TS2A 2K52A 4DR6L 4GKJL 4HJ7A 4LFAQ 1HNWQ 3MXNB 4K0KQ 1EIYB 2OTJA 4JI7Q 2EQSA 4DNIA 1GM5A 3KJOA 4DUYL 1LYLA 4GNXC 1JT8A 5HY6A 4A3CH 1SR3A 3HKZE 4X6AH 4GOPA 2RHQB 1K8GA 2NVTH 1WCMG 3HOUH 5LMUL 1VQOA 1V43A 2YTVA 4DV7L 3K7AH 4AYBG 4R4OA 1RIPA 3ZJYC 5AJ3Q 4B3TQ 1UE6A 4LUZA 4A3KH 4DV4L 1AE2A 5C0XI 4JI1Q 1N8RC 1KXLA 1Q1EA 1JJGA 2BA0A 1XNQL 1X3FA 4XTCS 2WB1G 2NVXH 2OQ0A 4LF6Q 5EAYA 3S1RH 1AH9A 1JE5A 1GD7A 1UWVA 3H3VH 4PZ6A 1OXUA 2PNHA 1OXSC 5BR8Q 3HOXG 3I4MH 1IYJB 2VQEL 4DV2Q 2WAQG 1X56A 3KYHC 1UE5A 4BBRG 1YI2A 1Y1WG 3S1MH 1NY4A 4YWKA 3NENA 2K5NA 2VS1A 4QY7A 2ZM6Q 3T1HQ 1C7YA 4OONA 3UE1A 5JJIA 5GAEC 4A3DG 3NELA 4JI5L 4IO9A 1VQPA 1FJGQ 1N33L 4X62L 1YZ6A 3A74A 3PV0A 2AHOB 3EIVA 5IYCG 3W1BA 3TREA 1N36L 4LF5L 4R4TA 2CWAA 4IFDI 1Q46A 5GAGC 1K0RA 5FLMH 4LF8L 4GN5A 1Q82C 2VQFL 2UUBL 1VQAA 1TWCH 2KCMA 2B3GA 4JBWA 3G4SA 1PH4A 2ZJQA 1KHIA 3D31A 4JI4L 4GNXA 3ICEA 1PYBA 2F4VL 3RLNA 3S2DH 2JQOA 2MQHA 1NBWA 2JA6G 1KAWA 3RNUA 2BH2A 2ATWA 3M85A 2JE6I 2Q2IA 4DV1Q 1KL9A 1SROA 4OXPA 1YHAA 1X9NA 2Q2UA 3S16H 4DV3L 1XNRL 3M4PA 4DV0Q 1Q86C 2R92H 2IX0A 3M3YH 1PH1A 2E2HH 1B7YB 4DR5Q 1N34L 4UP7A 1GVPA 1HZAA 1UE1A 4IJHA 5FLXc 3FKIH 4NXMQ 3W5OA 4A93G 1DGSA 4IPDA 4GN4B 5IYDG 3HOYH 1VQIA 2I5HA 3RLOA 3I56A 3K81C 4TVAB 5C3EH 1QUQA 4HJ9A 3ULPA 2UXCL 2UXDQ 1O7IA 3ERSX 3IRBA 4NB3A 4X64Q 4KHZA 1GKHA 4LF7L 4JOIC 3OTOL 5LMNL 4B3SQ 4LW1A 4BXXG 2JA7H 2IY5B 2XGTA 4GKKQ 3UE0A 1R9TH 2LXJA 4YY3Q 2UXBQ 4P75A 2I5LX 3M9BA 3JAMc 4YWLA 4LWCA 2E5LL 3S17H 2I5MX 3F2DA 3RR5A 3GTQH 1D8LA 3A0JA 4QL5A 4BBSH 3J7A5 1MIUA 1EFWA 4X66L 1ASZA 4X65Q 1MJEA 2A8VA 4JI8L 5HGQA 4JYAQ 1VQ4A 1CUKA 3HOWG 1VQ8A 3S1NH 1HR0Q 1BVSA 1SRUA 1Q81C 2KHIA 1A62A 2ES2A 2Y0SE 3KLWA 2PQAA 4R1JA 5K36G 2HIXA 4HIOA 2UUAL 3H15A 4YHHQ 1X3GA 3I4OA 1ASYA 1S72A 3OYYA 4IPHA 1PH7A 5JEAJ 4DR2Q 1VQ5A 1MJCA 2PI2A 3GTOH 4JI2L 2FXQA 2AMCB 5IYBH 1K8AC 1FGUA 1N32Q 4C2MH 3J81c 4YCUA 2HHHL 4JI6Q 1NMGA 3T1YL 3CC7A 3PO2G 4QGUA 4A3LH 4R4IA 3I4NH 3RZOH 1PYSB 1N9WA 1QVFA 5C44H 2R7FA 1EQQA 2HT1A 4DUZQ 2K4KA 5IP9H 1JMCA 2JA9A 4GLAC 4C3HH 2OWOA 3HOZG 1OXTA 4DR4L 4DK3C 3CQZH 1E24A 4L5TA 4RMFA 4JOIA 1QZGA 2ZJRA 3OW2A 3UDIA 1HZBA 3RN2A 2BA1A 4J15A 3EBEA 3KDFA 5ELNA 4JI0L 2JEAI 1A8VA 1M1KC 3CMAA 1GO3E 2YYZA 3I7FA 1VQKA 2K75A 1YITA 5M3MG 3RLFA 1I94Q 4LFBQ 2VZAA 1TWAH 5C4XH 3U4ZA 1XMOQ 1KQSA 1KRTA 4B3RL 4A3MH 5FJ8G 2BH8A 3J80i 1P16A 1CKNB 2HQLA 4DV5L 1KC8C 3PIPA 1PH9A 3CCLA 1Z47A 3CCSA 1HNXQ 3HOVG 2JA8H 4L5RC 4AQYQ 3S1QH 3PF5A 1LTLA 1V1QA 2N8NA 4LF4L 5GQOA 3K80C 1PFSA 1UE7A 1Y1VG 2UU9L 3CF5A 1E1TA 3UDXA 4A3BG 1WCMH 2HIVA 2Q2TA 1IBLQ 1OXVA 2JK8A 4B3MQ 1QUQB 1OTCA 1IZ6A 4LFCL 2NZOA 2QEXA 2OQKA 2UUCQ 4UY8C 2KENA 1JJCB 1B8AA 4DAYB 4A3IG 5H1SE 2WFWA 3L2PA 1YHQA 1CKMA 4OX9L 2VY3A 5IP7G 4EQ5A 1HZ9A 1EOVA 4QQBX 4A3EG 2EIFA 1BBUA 2Z6KC 4UP9A 1HNZQ 2AKWB 3H0GG 3F8TA 3BZKA 1J5EQ 3G71A 4L5QA 1SMXA 1WI5A 2E8GA 3CCVA 4JI3Q 1XTDA 3K8AA 2CWPA 3HOXH 5C0XG 4DV6Q 2K50A 1KD1C 3KOJA 1EUJA 2E2IH 2Q2HA 1I5FA 4BBRH 4DR3L 1YJWA 3CXCA 1Y1WH 1YEZA 1XPOA 1QVGA 1FVIA 4GN3B 4A3DH 4PZ8A 4IOCA 1SLJA 1IBKL 2PQAB 4A76A 2ZTEA 5GROA 4A3JG 4LF9L 4JV5L 1VS0A 5IT9c 4RG1A 3PUXA 3STBD 4DR7L 4NXNQ 3GTMH 5GAHC 2VUMG 1XMQL 5IYCH 3S14H 2Y0SG 3NEMA 3Q8DA 3S2HH 2R7DA 2ZJPA 3GD7A 3A5UA 3CMEA 4A3GH 1PHJA 1VQEA 2VL6A 3CCRA 4P71A 1IBML 4KHPL 3PUWA 5M5WH 2CQOA 5M3FH 5IWAL 4UPAA 4GKJQ 4DR6Q 3KF6B 4BY1H 2JA6H 4OWXB 1V9PA 4DUYQ 3CPFA 4DR1L 3UDGA 1IL2A 4HIDA 1PH2A 4IFDG 1I3QH 1WOCA 3U50C 3TQYA 1VCIA 1VQ9A 1L1OB 3GO5A 5LMUQ 3F2BA 4LFAL 4JI7L 4DV7Q 4K0KL 4JBMA 2AWOA 1CKOA 4XIGS 4DV4Q 1VQCA 2JA7G 5DLQE 1LM0A 2F52A 1XNQQ 3LGJA 4BY7G 2YTYA 5IYDH 4A3FG 3TEHB 1M90C 4B3TL 3BU2A 1YVCA 3AYHB 2C35B 4HJ5A 1X3EA 5AJ3L 3GTJH 4GOPB 1B70B 2MFIA 3PIOA 1XPUA 4JI1L 3L0OA 1VQMA 4O2DA 3CCQA 2R7ZG 4BXXH 3HKZG 1Q8KA 2NVQH 2JA5G 2K5VA 2L15A 2I0QA 1S3OA 4FDBA 2H5XA 1XPRA 1KRSA 4L5SA 2VQEQ 4LF6L 2YV5A 4P73A 3NBHB 4HIKA 3GTLH 1J6QA 3CCUA 3B6YA 2EXDA 1LUZA 2XTIA 1XJVA 5IY0A 4WJ4A 1AE3A 5BR8L 4AH6A 3G48A 1T9HA 4DV2L 3CC4A 1YIJA 5E7NA 1N33Q 4X62Q 4ALPA 1EIFA 1X6OA 2CCZA 3HOWH 3M4QA 2ZM6L 1PH6A 2DUDA 1N36Q 3T1HL 4LF5Q 1VQNA 2B63G 2VW9A 1C9OA 1TWFH 3CD6A 4TQUS 3MEFA 4C3IH 4LF8Q 1CSPA 2VQFQ 2UUBQ 3PO3G 1FJGL 1SFOH 2LXKA 1X65A 5C0XJ 4JI4Q 2JEBI 5ELOA 1YJ9A 2F4VQ 2GVAA 2R93G 1KIXA 3H3VI 1P8LA 3I2ZA 2ALYB 3BJUA 1MKHA 1NMFA 5J3BA 4AIMA 2E2JH 1WFQA 2ID0A 1VQBA 1HR0W 1U0LA 2KBNA 4HJ8A 1L2FA 4DV3Q 1XNRQ 1Z9FA 4GNXB 4A4IA 3VDYA 1N34Q 2AWNA 3GTGH 4A3CG 4QIWE 4A75A 4DV1L 3HOZH 2NZHA 4DV0L 1H95A 3HOUG 4IOAA 4JC0A 3PCOB 4PMWA 5JJKA 1IXRA 4DR5L 2UXCQ 1G6PA 4JCVE 4A3KG 1QVCA 4NXML 4HJAA 3J81j 4R4QA 1K83H 3KF8B 4LF7Q 5LMNQ 3OTOQ 2N78A 1VQFA 3GTPH 4IFDJ 2IHFA 5M3MH 2ASBA 2CFMA 3K0XA 3E9HA 3L7ZC 2UXDL 2MNAA 5FJ8H 1E22A 4X64L 1YHBA 4H02A 4GLVB 1I50H 3G6EA 4POFA 2E5LQ 5GADC 1PH3A 4B3SL 3HOVH 1EYGA 4WJ3M 1HZCA 4MZ9A 4DKAC 4GKKL 1Q7YC 3I4MG 4X66Q 4YY3L 2UXBL 2IT1A 1NE3A 3EN2A 4JI8Q 1QZHA 2R6GA 3F2CA 2KCTA 4PG3A 4PZ7A 3DM3A 2RF4A 3RZDH 2NN6I 2YU9H 1X55A 1Y1VH 3UDFA 1CSQA 4IPGA 4UP8A 4P74A 1I6HH 4GLXA 4A3BH 2UUAQ 4X65L 2OTLA 4JYAL 2PMZE 4O0AA 1VQ7A 4BA2I 1C0AA 2IHEA 1HR0L 5C4JH 2A1AA 3M7NA 1E1OA 1EWIA 4JI2Q 4YWMA 1HJPA 4LNQA 3GDEA 5JEAG 5FLMG 4KI0A 1WYDA 4A3IH 2HHHQ 2MO0A 4NPSA 4YHHL 3T1YQ 1TWGH 3DLLA 2K5HA 5IP7H 5LMNW 4A3EH 3JAMi 3KJPA 4DR2L 3CC2A 2IX1A 3H0GH 1D7QA 1E7ZA 4C3JH 1N32L 3WWVA 2F3IA 4JBJA 3CCJA 3J80c 4JI6L 1VQLA 1X54A 3PUYA 5JJLA 4DR4Q 2R92G 3STBC 3CCMA 1Q12A 2CKZB 2VNUD 3HKSA 4A3GG 2NN6G 2ZTDA 4OO1I 2V1CC 4AYBE 4DUZL 4LUVA 1FL0A 1W3SA 1Y14B 2D62A 5M3FG 2D0OA 3FKIG 1U5KA 4A3JH 4JI0Q 3AQQA 5M5XH 1PVOA 1E3PA 1G291 1SE8A 1RL2A 1L0WA 1G51A 1VQHA 1JJ2A 2VUMH 3HOYG 5IE8A 1CKNA 1PH5A 2WB1E 1OXXK 3CAMA 4YCVA 5C3EG 2N49A 4JBKA 2KHJA 3S15H 1UEBA 2N3SA 1YNXA 4B3RQ 3J81i 3I55A 4DV5Q 1PH8A 3PGZA 3CCEA 4OWTB 2LSSA 3KDFB 3RN5A 4A93H 3PSIA 3CPWA 1HH2P 1I94L 4LFBL 4LUOA 2Z6KA 1XMOL 3E9IA 2WAQE 4LF4Q 3U58A 2Z0SA 3FHWA 4IPCA 4MNOA 1Q1BA 2UU9Q 2GN5A 4IJLA 1HNXL 2GVBA 3KFUA 4BBSG 1A0IA 4AQYL 4EX5A 2ZTCA 1NJIC 1L1OC 2B29A 3TRZA 1NTGA 2A19A 4OO1G 3J7ZC 3S24A 5M5YH 3FP9A 4KLKA 3U4VA 1S40A 3PUVA 4LFCQ 2MO1A 4ME3A 2QA4A 3CW2C 1YJNA 4BY7H 1VQDA 4A3FH 3BZCA 1IBLL 1TWHH 4OX9Q 4Y7NH 1HNWL 2OCEA 4GOPC 4B3ML 4JI5Q 3GTKH 1TXYA 1VQJA 2WP8J 2R7ZH 5IYBG 2UUCL 2RCNA 3PF4A 2D0PA 2JA5H 1VQ6A 2K14A 3A5ZB 4MTNA 2NVYH 4DAMA 3E0EA 4DR3Q 3PUZA 3M4OH 4A3LG 1K73C 1HNZL 3I4NG 1PA6A 2RHSB 5C44G
chains in the Genus database with same CATH superfamily
1VQGA 4JI3L 4MN3A 5IP9G 3E5SA 5F2DA 1JCKB 1J8IA 2HD3A 1F77A 1OO9B 2B63H 3K7AB 1G2TA 2PI2E 1MSGA 3OWFA 4FF3A 1IBMQ 4QJFA 4BA1I 4DPGA 1A63A 2OXPA 3ER0A 3TS0A 1I6HB 3N52A 1WTPA 1PV4A 2LY7A 4F87A 4GS3A 2JA8G 4GKJL 2K52A 4DR6L 2JP1A 1HPCA 4HJ7A 2SDFA 2CVRA 1EIYB 3BYYB 1LYLA 4A3CH 1SR3A 4I65A 5JPNC 4K6LA 1WCMG 1V43A 4B3TQ 3M4YA 3QO2A 3ZJYC 4LUZA 4A3KH 2FHTA 1SEBD 1DOMA 5C0XI 1N8RC 1KXLA 1Q1EA 1GXDC 3V2TA 3ZYYX 2NVXH 1TWCB 3S1RH 1AH9A 2AQ1B 1U4RA 4PZ6A 3QJYA 1EQVA 1IYJB 4DAPA 2VQEL 1BCPC 1X56A 4BBRG 1RODA 2M9VA 2F0KA 2VS1A 3Q24A 2L9HA 4X62L 1YZ6A 4KD3A 3KLSA 2F0UA 1IYUA 3TREA 3DXJC 3VYTA 5C3EB 4HN7A 5JEAH 4GN5A 1Q82C 3G4SA 2B3GA 2AQ2B 1PH4A 2ZJQA 1QJOA 1I4HA 3X3MA 4GNXA 1LTSD 3JAME 2MQHA 1GOZA 2Q8IB 1ESRA 2BH2A 2JE6I 3A8JE 1SROA 1VF7A 3H09A 1X9NA 2Q2UA 3GV6A 4DV0Q 4KY6A 2IX0A 4FVMA 3HP3A 2E2HH 1MI2A 1TT2A 1B7YB 4IJHA 4QIWB 3FKIH 4NXMQ 3M4OB 3KK7A 5IYDG 3HOYH 2I5HA 3I56A 1RDPD 1HXYD 2UXCL 1QUQA 4HJ9A 5T1IA 4CDFC 1O7IA 3RD4A 4C2MB 1STEA 4GKKQ 1KLGD 3WOFA 2I5LX 1ZEQX 3RZOB 2E5LL 3RR5A 4PMBA 1D8LA 3J7A5 4X66L 1Z6HA 4OO1H 1BVSA 1HA5A 1UAPA 3M7GA 2L4NA 2OEOA 1SYGA 1X3GA 5ELDA 4IPHA 1PH7A 1MJCA 1NNXA 4JI2L 1Y8PB 4QUFA 3T4AC 1N32Q 4C1NI 3J81c 4CDDC 2HHHL 3TDQA 1NMGA 3T1YL 1B1ZA 4JI6Q 4ID6A 1XX8A 1BQQT 4DXFA 5C44H 4K6DA 2MPMA 4DUZQ 2K4KA 5IGFA 1MBYA 2MP1A 3I8ZA 4QMGA 3CQZH 1E24A 4KV6A 4L5TA 1ILQA 4AYBB 1UUPA 1QILA 3PIO3 5ELFA 3QOLA 2JEAI 2L0CA 1A8VA 3ND9A 1M1KC 2YYZA 1VQKA 3D3RA 5M3MG 2K32A 3U9OA 1TWAH 1JC7A 5C4XH 4B3RL 1ZXTA 4BY1H 3J80i 1PH9A 2B2WC 1HNXQ 3HOVG 3MVVA 4JPBW 1V1QA 3K5OA 2G5DA 2M00A 4RWSC 1O7YA 4DF7A 2XN9C 5I2XA 2UU9L 1WTOA 2J0TD 4A3DB 1E1TA 5FOBB 2J7ZA 1AFPA 1IZ6A 4RFBA 2NZOA 3LWEA 2QEXA 1STBA 2KENA 1SYDA 5CR3A 4A3IG 3L2PA 2CQAA 2DN8A 1Q8IA 3I70A 3H0GG 3OSOA 4L5QA 1WI5A 3CCVA 4JI3Q 5NUCA 3HOXH 2E2IH 1LV9A 2Q2HA 1ML0D 1WTVA 1YJWA 1SNQA 4FNFA 2IWHA 1YEZA 1QVGA 1B44D 3LX0A 4PZ8A 1Z7TA 4JV5L 4LF9L 2ZTEA 3W3AA 5IT9c 2VUMG 1EL0A 2ICIA 3S14H 5IGGA 4FO2A 3Q22A 5G3LD 3A5UA 5C6AA 4A3GH 1G6ZA 3KF8A 3MXNA 2CQOA 5M3FH 3OPOA 3QWNA 2ICEC 4DR6Q 4GKJQ 1K0SA 1CM9A 2X6GA 3P7JA 3PMFA 3VR5A 2KUMA 4IFDG 1I3QH 3LNNA 1WOCA 4OIKA 3U50C 1VCIA 4LFAL 4QF4A 4JI7L 5EKIA 1PTOH 3HOWB 1VQCA 5EPLA 5DLQE 1LM0A 4P2CB 1TWFB 5E4WC 4E6IA 4C3IB 5AJ3L 2F03A 2MFIA 1XPUA 4JI1L 3L0OA 2NVQH 2JA5G 1XPRA 4L5SA 2VQEQ 1A15A 4LF6L 2YV5A 1HCZA 4HIKA 1J6QA 3O13A 2V4DA 3CCUA 1QWYA 2FFKB 2XTIA 4RGTA 3MXGA 3C46A 4WJ4A 5BR8L 2F0VA 4ODGA 1EWCA 2EPBA 1T9HA 5KYLA 3P75A 5CBEE 1YIJA 3CC4A 4X62Q 1DOKA 2A6ED 4ALPA 2CCZA 1X6OA 2ZM6L 1PH6A 2DUDA 2PCFB 3VR4A 3G7LA 1C9OA 1BO0A 4OGQC 3CD6A 1LABA 1EOTA 1J9OA 1ENCA 2NWGA 2ZT9C 1X65A 4PV1C 5C0XJ 3GTPB 1SDFA 2JEBI 1MD2D 2R93G 3I2ZA 1LLRD 1SNCA 2B39A 1I50B 5EKLA 3DWQA 1EYCA 1L2FA 4FYDA 4GNXB 4A4IA 2OT2A 1SAPA 2A5HA 2AWNA 4ME5A 2YU9B 3HOZH 4MTKA 4U68A 2NZHA 3QOJA 4A3BB 1DZ1A 4JC0A 2MGSA 5JJKA 1KLUD 2UXCQ 1I6VC 2PW7A 2NBFA 1HHVA 4HJAA 1BF4A 1VQFA 3NK9A 4K2LA 4XQJA 2E5LQ 4POFA 1EYGA 3SHLA 5C4HA 1Q7YC 4X66Q 4YY3L 2UXBL 3EN2A 2R6GA 1S5DD 2KCTA 4PG3A 2NN6I 1RF2D 1Y1VH 3TP6A 3UDFA 4IPGA 4UP8A 4GLXA 1STAA 4IUNA 4X65L 4IUUA 4BA2I 1TS5A 2L5TA 2KHSA 4M1UB 1E1OA 4JI2Q 4YWMA 3K6OA 4PNYA 2HHHQ 3T1YQ 4BS9A 1CQFA 5LMNW 4A3EH 3CC2A 4CDEC 4C3JH 2F3IA 2G9HD 1HTPA 1I4QA 4K2KA 2RDGA 4TSSA 3PUYA 2R92G 3CCMA 4A3GG 2NN6G 2V1CC 1TS2A 2Z4IA 4B9WA 2D62A 4A3JH 5M3FG 4EQOA 5C5MA 2E74C 1G51A 2KVMA 4KMUC 4BY7B 1TWHB 4LK1C 4Y7NB 4JBKA 4B3RQ 3S15H 3VR2A 2N3SA 1YNXA 5IGCA 3J81i 3I55A 3KBGA 5EQ0A 3HKZB 4OWTB 4A93H 1HH2P 3V05A 2NVYB 3E9IA 2Z0SA 3FHWA 1Q1BA 2UU9Q 1CK1A 2GN5A 4IJLA 2Z1CA 1SSOA 4BBSG 4OL7A 3R93A 4EX5A 3CHBD 1H9RA 1WTXA 4YIJA 4HCEA 4K8IA 5IGBA 5M5YH 3FP9A 4KLKA 1PDQA 1BBXC 1S40A 2B2VA 2MO1A 3GQBA 4A3FH 3PO3B 2IL8A 4ZUJA 1IBLL 2EOTA 1SNDA 4GOPC 3GTKH 1TXYA 2B8GA 3E0JA 5C3XA 2R7ZH 5IYBG 3MFGA 2RCNA 1G8ZD 2K14A 1VQ6A 2RQXA 5ELCA 1A3UA 1UNSA 2WV6D 4DAMA 1KTKA 1K73C 1HNZL 1SYBA 1EU4A 2A6EC 1PA6A 3K7UC 1CQVA 4CBVA 1VF5C 4LF9Q 4JV5Q 2AUJD 2B2YA 4XDXA 3SGIA 1EEFD 3F1ZA 4DK6C 1B53A 4KN4C 3AFQA 4CKEA 3HOUB 4XXEA 3PO2H 3AEVA 2Z4HA 1K9MC 1WJJA 1Y1VB 3NBIA 3D0FA 3HFZB 1EYAA 1EQRA 3Q6SA 2EYOA 3K58A 1YBYA 4A3MG 3QIAA 4JG2A 1L1OA 2RA4A 4POGA 1K3RA 1QCBD 3TS2A 4LFAQ 4F7XA 3MXNB 3I4MB 3VA5A 4JI7Q 1GM5A 3S1MB 1TY0A 5JVG3 4DUYL 1JT8A 5HY6A 4HSVA 1MGSA 1SE4A 2HQEA 5KGUA 1M4VA 4MHEA 1IL8A 4EQPA 2YTVA 4DAVA 3K7AH 1ENFA 5AJ3Q 1B2TA 2NYZD 1XYIA 4JI1Q 5I9OA 1XNQL 1X3FA 3NBHA 4DNRB 2WB1G 1BCPD 4IUTA 5KIXA 4LF6Q 3A7LA 1G91A 1GD7A 5IGEA 1VMPA 1HUNA 1OXSC 1EY6A 5BR8Q 4QB4A 1A2TA 1B9MA 3KYHC 1Y1WG 3S17B 1U9RA 2ZM6Q 3M3YB 4WFN3 1C7YA 4OONA 3NELA 1BXTA 1JR0D 1VDZA 5KEEA 4JI5L 2B2TA 4CJ0B 4IURA 2AHOB 5IYCG 4R4TA 2CWAA 1KNAA 1Q46A 1K0RA 2F0GA 1VQAA 1TWCH 4JBWA 1QOHA 1KHIA 3D31A 5M5YB 1MSHA 1LT3D 2JA7B 3C2PA 1R9TB 3RLNA 3R8BA 3FVQA 4A3FB 2JA6G 2F1MA 2ATWA 3M85A 1FYCA 3M4PA 2R7ZB 3HS0C 3OW7A 2SOBA 1JWUD 1UE1A 1MHWC 5FLXc 1GHJA 4KY7A 4A93G 1A2UA 2DJFC 5C3EH 4B9XA 4OELB 3IRBA 4NB3A 3T53B 4FP5D 3BVZA 2ZXRA 1PFMA 4JOIC 5E3FA 2LXJA 4YY3Q 2UXBQ 1EY4A 3FPUB 5AFWA 5D65A 2IW3A 3M9BA 1IYVA 3I4NB 4LWCA 4ZQ3A 4ZAIA 5CV9A 4X65Q 1MJEA 4JI8L 3J81L 1CUKA 2HDMA 2RDHA 1HQRD 1LT6D 2ES2A 2Z8LA 5EBCA 1CT1D 2K5WA 2TMPA 3KLWA 2XSCA 5K36G 2HIXA 3H15A 1E2WA 3D6CA 1S72A 3MWYW 5FO8B 2PI2A 2AMCB 4C2MH 4CGYB 2AQ3B 2K5QA 2NZ1D 3L9AX 3PO2G 2JA8B 3RZOH 1PYSB 1N9WA 2R7FA 3P20A 3MAQA 4C3HH 1LO5D 1GUOA 5C3WA 1OXTA 4DK3C 1ICFB 1WCMB 4K14A 4RMFA 2LFNA 1DD2A 3I91A 2F0TA 2PW5A 3EBEA 4J15A 5ELNA 1SMYD 4JI0L 1GO3E 1YITA 2MHVA 2F0IA 3U4ZA 1GUNA 1P16A 2HQLA 1CA6A 3CCLA 5CBAE 4KHVA 4L5RC 1WTQA 1LTLA 4L8JA 1ESFA 4BBRB 2KCCA 3E6ZX 5LHY1 3CRLC 2HIVA 1I4RA 1IBLQ 2Q2TA 1QNUA 1JOQA 3GTMB 1OTCA 2HUGA 3S2HB 4LFCL 2F0WA 3BDCA 4DK0A 1R4PB 4CKCA 2L12A 3MHBA 5H1SE 2JYOA 3AU7A 4EQ5A 3R2IA 1EOVA 5IT9L 3I73A 1BBUA 1HNZQ 4CKBA 4B08A 3F8TA 1FNVA 5C0XG 3KOJA 3RUZA 1I5FA 4LAAA 4DR3L 3CXCA 2F0QA 4A3DH 1SLJA 4QCLA 2PQAB 5E1FA 1VS0A 4RG1A 2F3WA 4XQQA 1SJED 1JQYD 2EDGA 2B2WA 4G7HC 1PTOD 4XYOA 4I7ZC 3GD7A 3CMEA 1NCVA 1VQEA 3CCRA 2C5CA 3CKIB 5DNFA 2O2LD 3BDOA 4DUYQ 4DR1L 3UDGA 1IL2A 2L55A 3RMHA 3VA7A 4HIDA 1PH2A 1L1OB 2HCIA 1KAAA 3GP7A 2R3ZA 1D6EC 4JBMA 3EQLC 2AWOA 3HG9A 1TIID 3KLRA 3OIPA 1JICA 2F52A 1XNQQ 3LGJA 3TEHB 1GJXA 1ONLA 1YVCA 2C35B 2KQ3A 1SFOB 3GTJH 4C3HB 4J8QA 3CCQA 2SEBD 4BXXH 1Q8KA 2L15A 1S3OA 4FDBA 2KJXA 1ZKOA 3NBHB 2EY1A 1LUZA 4EQNA 3DEOA 3MTSA 3OIQA 1KDCA 1XJVA 1D5ZC 1DCZA 4K5XA 3GTGB 4DV2L 1K8OA 3HOWH 4IUQA 2A69D 2RVLA 5DM73 2FMMA 1VQNA 2B63G 2VW9A 1TWFH 3IFTA 3MEFA 4C3IH 4JVZA 4RCOA 1FJGL 1K83B 1D1IA 2LXKA 3D8GA 5M3MB 3W2DA 4H13C 1KIXA 1I4GA 1P8LA 3T16A 3R2TA 3K5MA 2E2DC 1MKHA 1NMFA 5I6WA 3C1FA 1U4PA 3HOVB 3L3OC 1PZID 4WRDA 2ID0A 1VQBA 2XRSD 2KBNA 3DEPA 4HJ8A 4JW0A 3KBXA 2A73B 2I07B 2A68D 4A3CG 4A75A 1EWHA 3D4RA 4DV1L 5CV5A 1IHZA 3NTIA 1SMYC 1PFNA 4IOAA 5A35A 3BS1A 3NSWA 4DR5L 4HMJA 4A3KG 3J7AV 2WAQB 1FGBD 2PNRC 3T56B 5C4JB 1WD1A 3J81j 2EJGC 4R4QA 4N8X1 5ELBA 3GTPH 1NR4A 1AW7A 3G6JB 3BG3A 4A3IB 3ERQA 2PPBC 4FXDA 5EJWA 2UXDL 1F9RA 1E22A 5FJ8H 4X64L 1SJHD 4H02A 1I50H 3G6EA 3H0GB 4NP5A 5GADC 3J80E 1HZCA 3K5LA 1BCPB 3K0YA 2IT1A 4JI8Q 1B3QA 2E75C 4K5WA 5KNBA 4PZ7A 2RF4A 2YU9H 5KRUA 4HEDA 2LKVA 3F2UA 2C9OA 4ZYSA 4Z9CB 1TS4A 4A3BH 2KA7A 2OTLA 5M5XB 2PMZE 2IHEA 2VUMB 1F2YA 4C1NK 4HMIA 2QCPX 4LNQA 5JEAG 4KI0A 4NPSA 4YHHL 3NE5B 4RH6A 3DLLA 4RHRA 5IP7H 4DR2L 3FEWX 5JOBA 2IX1A 3CCJA 5FK9C 2X69A 1W6JA 1VQLA 3GTJB 3A8KE 3IAYA 1XWEA 5D3IB 4OO1I 4LUVA 5FO7B 1FL0A 1W3SA 1Y14B 1PTOC 3FKIG 4JI0Q 1EIHA 3AQQA 4DN4M 1PVOA 1E3PA 1G291 4KKUA 3HOYG 4RKBA 1GHKA 5T1GA 1STNA 1BR9A 2WB1E 1OXXK 2K7VA 2DJGC 1UEBA 5JPMC 1RHPA 5CV8A 3PGZA 5DM63 1GUWA 4ABNA 3CCEA 2DY8A 2RSOA 3RN5A 2JA5B 3X3NA 4H7BA 1QG7A 2Z6KA 1H9MA 4MNOA 4L6TB 3D6WA 3EJIA 4X3UA 1EZ8A 4N9PA 4F8MA 3J7ZC 4OO1G 1ET6A 4GZYC 2F0FA 4DAYA 4LFCQ 1CI3M 4ME3A 2QA4A 4XQNA 1YNJC 1TVXA 4BY7H 4Q5VA 2MJ8A 1TWHH 4Y7NH 2OCEA 5J22A 3T13A 1LTID 2Q8TA 2R93B 2K01A 2D0PA 4FF4A 2QW7A 3NQTA 5CMDA 2NVYH 3C3LA 4DR3Q 3E0EA 4FF2A 2RHSB 4HSPA 5C44G 1J5EL 2A69C 4KJNA 4CDCC 2WACA 4DV6L 4UDUC 4OWWB 2JJQA 3VYSA 5A2QL 2NVTB 2B2UC 3GV3A 3IL8A 4HIMA 1SE2A 4N9TA 1W2BA 3PO3H 3ULJA 1C48A 2PZUA 1JB7A 4BWGB 4Y52H 2QGQA 2F0PA 4YCWA 3TSSA 2EYLA 1S5BD 5C4XG 4L63B 4G7ZC 4DR1Q 4BY1G 1D2BA 2A68C 1KDAA 1K28A 1HFGA 4NKLA 4P72A 5FKAC 1BBWA 2P5ZX 1PRTD 2F3VA 2OTJA 2K6AA 2G9DA 2EQSA 2N88A 5G3LF 1DONA 4GOPA 2WKCA 1EYDA 1EZ6A 2RHQB 1K8GA 1JORA 4RCNA 3HOUH 1X3PA 4R4OA 1UE6A 1O80A 1RCVD 4DV4L 1AE2A 2K05A 1PYWD 2BA0A 1KDBA 2OQ0A 5EAYA 1IW7D 1T5EA 1JE5A 2EJFC 3H3VH 3VR6A 3BVMA 1OXUA 3S2DB 3EA6A 2PNHA 3HOXG 3I4MH 2PZWA 1A3VA 4DV2Q 1YI2A 3S1MH 1NY4A 2R92B 4YWKA 2F0DA 4H44C 3NENA 4QY7A 5HGTA 4ZK9B 5GAEC 3OMGA 3D4WA 1VQPA 1FJGQ 1W6KA 3SEBA 5JAVA 1L0XB 4R9WA 1HFNA 3EIVA 3SVMA 3W1BA 1N36L 2R61A 5FLMH 4LF8L 1SYFA 2VQFL 2UUBL 1V1OA 5FLXL 3FPPA 3ICEA 2RBMA 2JQOA 3FMCA 3RNUA 3A55A 2RDFA 2Q2IA 4DV1Q 1KL9A 1QNKA 4H0LC 3SR1A 3GTQB 3S17H 4BBSB 2HCCA 1Q86C 2O5JC 3M3YH 4OEMB 1F9PA 4DR5Q 4UP7A 1GVPA 1HZAA 3S1NB 4ILWA 1NSNS 4DK1A 3DMUA 1Y8OB 3K81C 2UXDQ 4X64Q 4KHZA 1GKHA 3GTOB 4LF7L 3J81E 5LMNL 5IIFA 4LW1A 2JA7H 2IY5B 1F2ZA 2XGTA 4C56C 3SXHA 1R9TH 4P75A 3MC0B 1NR2A 3BVGA 3JAMc 2F0EA 5BN3A 3TMEA 4RGNA 2I5MX 3F2DA 4QL5A 1MIUA 1NAPA 1ASZA 3J7AF 5HGQA 2XIWA 1RTOA 5EPJA 1Q81C 2L1BA 2KHIA 4FXGC 2PQAA 4HIOA 2UUAL 5HURA 2PMZB 2QKIC 2A6HC 4YHHQ 3NWTA 1F9QA 3I4LA 3OYYA 5JEAJ 4DR2Q 1VQ5A 1ENAA 2FXQA 1K8AC 3EROA 4A3MB 1QE6A 4YCUA 1JE4A 3CC7A 2BCOA 3HEJA 1S5ED 4A3LH 3I4NH 3H6MA 3S1QB 1EQQA 3A54A 2LS01 5IP9H 1JMCA 2OWOA 3HOZG 5J39A 4DR4L 4JOIA 2KEEA 1QZGA 3MZ5A 2GA4B 2ZJRA 3KUPA 3OW2A 3RN2A 5I9PA 3QG1A 5JVH3 3CMAA 3I7FA 2NB0A 2WB1B 4KKSA 2RSNA 3RLFA 2VZAA 4DXGA 1KRTA 1PRTC 1KC8C 1C8CA 2PYKA 3CCSA 2AUKA 4KKTA 4U673 2JA8H 2N8NA 4LF4L 5GQOA 1Y1WB 2K33A 1U4LA 1UE7A 2WIIB 1Y1VG 1TKWB 5IT9E 3UDXA 1WCMH 3D4DA 1SNMA 2BE5D 3NTKA 2JSOA 3NXWA 4I7AA 2JK8A 1TS3A 5DEHA 5I4DA 3MA2B 1IW7C 3H91A 4IALA 3LWUA 4UY8C 1B8AA 4DAYB 4XYQA 3U9SA 1BDOA 1YHQA 1CKMA 4EVOA 5M5WB 2O5IC 2KEDA 4ZCKA 4A3EG 2AKWB 2ZXOA 1J5EQ 1PXUA 3G71A 4C3JG 2JA6B 2PO4A 1KD1C 4DV6Q 3ITPA 3QR8A 4BBRH 4IUVA 5BN4A 1XPOA 1FVIA 4GN3B 2F0NA 4IOCA 1IBKL 2EVBA 4V0BA 4A3JG 5GROA 3STBD 3NQIA 3PUXA 4DR7L 3GTMH 5GAHC 1XMQL 2Y0SG 3S2HH 1WTHA 4PMCA 1PMRA 2ZJPA 3AB9A 3HRZC 2VL6A 4P71A 4KHPL 1BNZA 3PUWA 3ND8A 5CGKA 5IWAL 1STHA 4UPAA 4ZLTF 1S5CD 2QDBA 4K8JA 2D9UA 5EKKA 1SXTA 3FDTA 3CPFA 1SYCA 1RTNA 4HR7B 1ILPA 2RCFA 2B2YC 3TQYA 1VQ9A 1HNWL 3GO5A 4FXKC 4K0KL 3F2BA 1GUGA 4O1NA 4XT1B 3Q0AA 1CKOA 4RKLA 4DV4Q 2JA7G 1Q90A 2YTYA 5IYDH 4A3FG 3Q23A 3AYHB 4GOPB 2PZTA 4DGZA 4O2DA 3V96A 2R7ZG 1BOSA 2IJ0A 3MEHA 4IQZA 2H5XA 2KOLA 4P73A 2E2JB 2N55A 3GTLH 3B6YA 2EXDA 1D5MC 5M9OA 4DA2A 5E7NA 3MFYA 1BCPF 4KN7C 3M4QA 1LTTD 1N36Q 3T1HL 1C4QA 2O4XA 4LF8Q 3A8IE 2VQFQ 2UUBQ 3BYTB 1SFOH 1EIGA 4ZRZA 1YJ9A 5ELOA 5L37A 1LTRD 2GVAA 5EBDA 1WVLA 5J3BA 1HR0W 1NUCA 3C1EA 3E3XA 1B3AA 5CYUA 3K57A 3GTGH 4RHSA 2HDLA 1SNPA 1PRTB 2B2TC 1H95A 4F88A 1PLFA 3URYA 1G6PA 3NPPA 4IZ8A 4WJWA 4KD4A 1K83H 4LF7Q 5LMNQ 2LMCB 3NP8A 3SK8A 2IHFA 2SNSA 5M3MH 2F0JA 2ASBA 2CFMA 3E9HA 1TWGB 2MNAA 1EY5A 1CTMA 3HOVH 1CFMA 5LL6S 4B3SL 4DKAC 1FNUA 4ZKCB 1NE3A 1STGA 3RZDH 2BE5C 1VMCA 1X55A 4CJ2C 2VXWA 3CU7A 5IODA 4P74A 2UUAQ 3TBIB 4JYAL 1VQ7A 1YNND 1HR0L 1WD0A 5C4JH 2M2LA 3M7NA 1ICWA 1HJPA 2F4IA 1WYDA 5D3DA 4K5VA 4A3IH 1UEAB 3VR3A 3JAMi 3H0GH 1E7ZA 3WWVA 4JBJA 4RAUC 5LL6X 1X54A 5JJLA 4DR4Q 3STBC 2RKSA 1Q12A 2CKZB 3HKSA 3PIP3 2ZTDA 3I72A 2QEJC 1S5FD 2D0OA 5M5XH 3GTLB 4DNTB 1RL2A 2XWJB 1VQHA 1L0YB 2VUMH 1CKNA 3HGBA 4YCVA 3CAMA 2WKDA 5C3EG 3K59A 1JOOA 1X32A 2N49A 1TQOA 1STYA 1H9SA 1V1PB 3EVQA 5EPKA 2LSSA 3PSIA 3CPWA 1I94L 3H94A 1R4QB 1EY9A 4LFBL 1XMOL 3SK5A 4LF4Q 3K5NA 4IPCA 4IFDH 1RJTA 1YNJD 3KFUA 2NTSA 3N6RA 1A0IA 2K1BA 4AQYL 2ZTCA 2IX3A 2B29A 1NJIC 1NTGA 1IKMA 2B63B 3PUVA 2D2CC 2Q8RE 3CW2C 1YJNA 1VQDA 3BZCA 5IGDA 3OOCA 5KNDA 4B3ML 4JI5Q 4LJZC 1VQJA 2WP8J 3IKJA 2UUCL 3HZXA 2F0SA 5A2QE 2JA5H 3PF4A 3A5ZB 4MTNA 4G7OC 1CA5A 2TSSA 1JB3A 1O78A 3DWPA 1V8QA 3AFPA 2XWBB 3JC66 3CP0A 1IBKQ 1CHQD 1AP0A 4C3HG 1M8AA 4DR7Q 1SN8A 1BKBA 2DGYA 1XMQQ 2YTXA 4R4CA 3NTHA 4A3KB 3QB3A 4NDXA 3KF6A 4KHPQ 4NXNL 4N8FA 3RZDB 4APVA 5IWAQ 2ENBA 3W1GA 2NVXB 2R93H 3ULLA 5J1ZA 1AN8A 3S1RB 1LTAD 2EY6A 4ZUIA 1HNWQ 4K0KQ 4DNIA 4IUPA 3KJOA 1PTOF 4GNXC 3HKZE 4X6AH 2NVTH 4G4KA 5LMUL 1VQOA 5ISRA 4DV7L 4AYBG 1RIPA 2NUCA 4LMQD 4UHVA 1JJGA 2EYPA 4XTCS 1S4ZA 1PZKD 1LT5D 4TRDA 1UWVA 2QILA 2WINB 1U4MA 2B2UA 2WAQG 1ET9A 1UE5A 2K5NA 3T1HQ 3UE1A 1YNNC 2EY2A 5FLXE 3SE0A 4A3DG 2E2HB 5JJIA 3T51B 1EY8A 3SK6A 3FKIB 4IO9A 1N33L 3A74A 2KCNA 3PV0A 3HOYB 4LF5L 1EU3A 4IFDI 5GAGC 2FJ2A 1DYQA 2KCMA 1AEXA 4JI4L 1EY7A 1PYBA 2F4VL 3S2DH 1NBWA 1EFID 1KAWA 4OXPA 1YHAA 3S16H 4DV3L 1XNRL 5CORA 5KYIA 2R92H 1GUTA 2NN6H 5CV6A 1PH1A 5C5LA 4X3KA 3TP7A 1N34L 3W5OA 1DGSA 2CHBD 4IPDA 3JAML 4GN4B 2EE1A 2BDOA 1VQIA 4QUCA 4JK1C 3RLOA 1F9SA 5FO9B 4TVAB 3ULPA 2BDNA 3ERSX 2VB2X 4NW2A 4DU9A 3OTOL 4B3SQ 4BXXG 1LTGD 4J6HA 3UE0A 1EY0A 4NMZA 4YWLA 1B4OA 2EXZA 4RGMA 5C44B 1I4PA 3A0JA 3GTQH 4RGOS 4BBSH 1EFWA 2A6HD 2K03A 2A8VA 4JYAQ 1VQ4A 3HOWG 1VQ8A 3S1NH 1HR0Q 3CQZB 1SRUA 1A62A 2Y0SE 4R1JA 4C3IG 1HRJA 1CHPD 3I4OA 1ASYA 3GTOH 2CH4A 3EFXD 1TWAB 5IYBH 3NHHA 1FGUA 5C4XB 4BY1B 4CHTB 4QGUA 1X3QA 4MIUA 4R4IA 1QVFA 2HT1A 1T5XD 2JA9A 2L11A 4GLAC 3FRPB 1ZYRD 4WORA 1Q3LA 5CV4A 1JWMD 2FINB 2F0HA 1G2SA 1HZBA 3UDIA 2BA1A 3KDFA 1CZGA 3A7AB 2K75A 2F0MA 1I94Q 4LFBQ 1KQSA 1XMOQ 2K04A 4A3MH 5FJ8G 2BH8A 4DV5L 2F0LA 1CKNB 2QDLA 3PIPA 3H3VC 1LT4D 4RA8A 1TY2A 1Z47A 1EQTA 3HOXB 4AQYQ 3S1QH 2DY7A 1HUMA 2E2IB 3PF5A 1H9SB 3K80C 1PFSA 3SK4A 3CF5A 1TU2B 4A3BG 3DM1A 2EYMA 2EYJA 1OXVA 3I3CA 4B3MQ 1QUQB 3S14B 2DNCA 2H4OA 1O7ZA 3S16B 2OQKA 3WDNA 2UUCQ 1LTBD 4A3GB 1JJCB 2WFWA 4OX9L 1DJRD 1SNOA 2VY3A 5M3FB 5IP7G 1HQMC 1HZ9A 4QQBX 1AZPA 1E2ZA 2EIFA 2Z6KC 4UP9A 2Z9HA 3BZKA 1SE3A 2EYHA 1SMXA 2E8GA 4R8NA 1XTDA 2OF1A 2B8FA 2CWPA 2CW0D 3K8AA 2K50A 3J80L 1EUJA 3J7YW 1HTLD 1I3QB 3I90A 1Y1WH 5C4ZA 2JN4A 2XRQD 2MUYA 5DAUA 2K5DA 5D14A 1PTOB 4A76A 1E2VA 4NXNQ 5CV7A 3R3OA 3AMUA 2ZXPA 4KJOA 5IYCH 3NEMA 3Q8DA 5KNCA 5JJZA 2R7DA 1PHJA 1IBML 5M5WH 2NVQB 3KF6B 2A74C 4ULLA 4XT3B 4FF1A 2JA6H 4OWXB 1V9PA 4TKOB 4OIJA 2EYFA 3OWEB 1FR3A 5LMUQ 4DV7Q 2Z6BA 3OHXC 4XIGS 1DOLA 3BDLA 1F2LA 3VYRA 4BY7G 1PZJD 1M90C 1JWSD 4B3TL 3BU2A 1A3TA 4HJ5A 2PQEA 1X3EA 1PRTF 2D5DA 4V190 1B70B 3PIOA 3WOEA 1VQMA 3HKZG 2K5VA 2I0QA 1SYEA 1KRSA 2SNMA 5K5PA 2VB3X 1IKLA 1H9JA 2CH4W 5IY0A 4OHJA 1AE3A 1D1KA 4AH6A 3G48A 3UI2A 1N33Q 3HOZB 4O42A 1B50A 1EIFA 5I2YA 4KK7A 4LF5Q 4UAIA 5TSSA 4TQUS 5K36H 1CSPA 3PO3G 3TP8A 4JI4Q 1HA6A 1WTRA 2F4VQ 2EZVA 3H3VI 2ALYB 3BJUA 1RD9D 1V1PA 4AIMA 3TN2A 3TP5A 2FMCA 2E2JH 1WFQA 1U0LA 4HCSA 1H9KA 4X3SA 4EGVA 4DV3Q 1Z9FA 4S3SA 1WTWA 1XNRQ 3SDZA 1ZYRC 3OMCA 2E76C 3VYUA 1GUSA 3VDYA 1N34Q 1F2MA 4QIWE 5CC4A 2XNAC 4DV0L 3HOUG 1FD7D 2EJMA 3PCOB 2H1EA 4PMWA 1IXRA 3PQIA 4JCVE 3NUCA 1QVCA 4NXML 1RKNA 3CRKC 3KF8B 4Q0FA 1DM0B 2N78A 3OTOQ 2BOSA 3DHQA 4IFDJ 4R8IA 3K0XA 3L7ZC 4A3EB 1YHBA 4GLVB 1PH3A 5ELEA 4C3JB 3DWAA 4WJ3M 4MZ9A 1II3A 4GKKL 3BZDB 3I4MG 1QZHA 1XXGA 4HAEA 4M8AA 3F2CA 3DM3A 3A56A 3IFDA 1CSQA 1KNEA 4DFAA 1E0BA 1FNWA 4ZKBB 1I6HH 1TR5A 4A3JB 1AZQA 2DNEA 1EEID 3MXUA 3S9WA 5E4XA 4O0AA 1C0AA 1LACA 2XVSA 2A1AA 2Y0SB 2QF7A 1EWIA 4HTHA 3KLSX 2K28A 3GDEA 4KTAA 5FLMG 3S15B 1BUVT 2MO0A 1TWGH 2B2VC 2J4XA 2K5HA 2CW0C 2X6LA 3KJPA 4A93B 2I46A 3TZDA 2JXMB 1D7QA 1N32L 3TZUA 3J80c 5C0XH 1K3BC 4JI6L 5EGTA 3P1HA 4J1MA 4DUZL 4AYBE 1A6XA 2IPKD 1U5KA 1I4XA 1SE8A 1QB5D 1JJ2A 1L0WA 4IN3A 5IE8A 1PH5A 3DUZA 2KHJA 4DV5Q 3GTKB 1PH8A 1D5XC 1Y69U 1Y8NB 3KDFB 1PFBA 1O7LA 4LUOA 5COYA 2WAQE 3U58A 4KY5A 1XTCD 4CJ1B 5I6YA 2GVBA 1HNXL 1L1OC 3TRZA 2A19A 5IOCA 3S24A 3ONAB 1B9NA 3U4VA 3PO2B 1JOKA 5BN5A 4OX9Q 1SBBB 4X3TA 2KECA 2F0OA 1DXMA 2EY5A 4G57A 4PQXA 2NTTA 3PUZA 3M4OH 4A3LG 1CZWA 3I4NG 3NWSA 3MXPA 2VNUD 1K8MA 1KABA
chains in the Genus database with same CATH topology
3AFPA 1VQGA 4JI3L 3JC66 3K7UC 3CP0A 1IBKQ 5IP9G 4JV5Q 4DV6L 4LF9Q 4OWWB 3SGIA 3F1ZA 4DK6C 2JJQA 4DR7Q 1SN8A 1BKBA 2DGYA 3AFQA 1XMQQ 3PO2H 2B63H 2YTXA 4HIMA 4R4CA 3AEVA 2PI2E 1W2BA 3PO3H 1K9MC 3KF6A 3ULJA 1IBMQ 4KHPQ 4QJFA 1WJJA 4NXNL 4BA1I 1JB7A 4DPGA 4APVA 5IWAQ 1A63A 3D0FA 4Y52H 3HFZB 3W1GA 2QGQA 1EQRA 4YCWA 3TS0A 3ER0A 2R93H 3ULLA 5C4XG 1J5EL 1YBYA 4A3MG 4DR1Q 4BY1G 4JG2A 1PV4A 1L1OA 4POGA 1K3RA 4P72A 4GS3A 1BBWA 2JA8G 3TS2A 2K52A 4DR6L 4GKJL 4HJ7A 4LFAQ 1HNWQ 3MXNB 4K0KQ 1EIYB 2OTJA 4JI7Q 2EQSA 4DNIA 1GM5A 3KJOA 4DUYL 1LYLA 4GNXC 1JT8A 5HY6A 4A3CH 1SR3A 3HKZE 4X6AH 4GOPA 2RHQB 1K8GA 2NVTH 1WCMG 3HOUH 5LMUL 1VQOA 1V43A 2YTVA 4DV7L 3K7AH 4AYBG 4R4OA 1RIPA 3ZJYC 5AJ3Q 4B3TQ 1UE6A 4LUZA 4A3KH 4DV4L 1AE2A 5C0XI 4JI1Q 1N8RC 1KXLA 1Q1EA 1JJGA 2BA0A 1XNQL 1X3FA 4XTCS 2WB1G 2NVXH 2OQ0A 4LF6Q 5EAYA 3S1RH 1AH9A 1JE5A 1GD7A 1UWVA 3H3VH 4PZ6A 1OXUA 2PNHA 1OXSC 5BR8Q 3HOXG 3I4MH 1IYJB 2VQEL 4DV2Q 2WAQG 1X56A 3KYHC 1UE5A 4BBRG 1YI2A 1Y1WG 3S1MH 1NY4A 4YWKA 3NENA 2K5NA 2VS1A 4QY7A 2ZM6Q 3T1HQ 1C7YA 4OONA 3UE1A 5JJIA 5GAEC 4A3DG 3NELA 4JI5L 4IO9A 1VQPA 1FJGQ 1N33L 4X62L 1YZ6A 3A74A 3PV0A 2AHOB 3EIVA 5IYCG 3W1BA 3TREA 1N36L 4LF5L 4R4TA 2CWAA 4IFDI 1Q46A 5GAGC 1K0RA 5FLMH 4LF8L 4GN5A 1Q82C 2VQFL 2UUBL 1VQAA 1TWCH 2KCMA 2B3GA 4JBWA 3G4SA 1PH4A 2ZJQA 1KHIA 3D31A 4JI4L 4GNXA 3ICEA 1PYBA 2F4VL 3RLNA 3S2DH 2JQOA 2MQHA 1NBWA 2JA6G 1KAWA 3RNUA 2BH2A 2ATWA 3M85A 2JE6I 2Q2IA 4DV1Q 1KL9A 1SROA 4OXPA 1YHAA 1X9NA 2Q2UA 3S16H 4DV3L 1XNRL 3M4PA 4DV0Q 1Q86C 2R92H 2IX0A 3M3YH 1PH1A 2E2HH 1B7YB 4DR5Q 1N34L 4UP7A 1GVPA 1HZAA 1UE1A 4IJHA 5FLXc 3FKIH 4NXMQ 3W5OA 4A93G 1DGSA 4IPDA 4GN4B 5IYDG 3HOYH 1VQIA 2I5HA 3RLOA 3I56A 3K81C 4TVAB 5C3EH 1QUQA 4HJ9A 3ULPA 2UXCL 2UXDQ 1O7IA 3ERSX 3IRBA 4NB3A 4X64Q 4KHZA 1GKHA 4LF7L 4JOIC 3OTOL 5LMNL 4B3SQ 4LW1A 4BXXG 2JA7H 2IY5B 2XGTA 4GKKQ 3UE0A 1R9TH 2LXJA 4YY3Q 2UXBQ 4P75A 2I5LX 3M9BA 3JAMc 4YWLA 4LWCA 2E5LL 3S17H 2I5MX 3F2DA 3RR5A 3GTQH 1D8LA 3A0JA 4QL5A 4BBSH 3J7A5 1MIUA 1EFWA 4X66L 1ASZA 4X65Q 1MJEA 2A8VA 4JI8L 5HGQA 4JYAQ 1VQ4A 1CUKA 3HOWG 1VQ8A 3S1NH 1HR0Q 1BVSA 1SRUA 1Q81C 2KHIA 1A62A 2ES2A 2Y0SE 3KLWA 2PQAA 4R1JA 5K36G 2HIXA 4HIOA 2UUAL 3H15A 4YHHQ 1X3GA 3I4OA 1ASYA 1S72A 3OYYA 4IPHA 1PH7A 5JEAJ 4DR2Q 1VQ5A 1MJCA 2PI2A 3GTOH 4JI2L 2FXQA 2AMCB 5IYBH 1K8AC 1FGUA 1N32Q 4C2MH 3J81c 4YCUA 2HHHL 4JI6Q 1NMGA 3T1YL 3CC7A 3PO2G 4QGUA 4A3LH 4R4IA 3I4NH 3RZOH 1PYSB 1N9WA 1QVFA 5C44H 2R7FA 1EQQA 2HT1A 4DUZQ 2K4KA 5IP9H 1JMCA 2JA9A 4GLAC 4C3HH 2OWOA 3HOZG 1OXTA 4DR4L 4DK3C 3CQZH 1E24A 4L5TA 4RMFA 4JOIA 1QZGA 2ZJRA 3OW2A 3UDIA 1HZBA 3RN2A 2BA1A 4J15A 3EBEA 3KDFA 5ELNA 4JI0L 2JEAI 1A8VA 1M1KC 3CMAA 1GO3E 2YYZA 3I7FA 1VQKA 2K75A 1YITA 5M3MG 3RLFA 1I94Q 4LFBQ 2VZAA 1TWAH 5C4XH 3U4ZA 1XMOQ 1KQSA 1KRTA 4B3RL 4A3MH 5FJ8G 2BH8A 3J80i 1P16A 1CKNB 2HQLA 4DV5L 1KC8C 3PIPA 1PH9A 3CCLA 1Z47A 3CCSA 1HNXQ 3HOVG 2JA8H 4L5RC 4AQYQ 3S1QH 3PF5A 1LTLA 1V1QA 2N8NA 4LF4L 5GQOA 3K80C 1PFSA 1UE7A 1Y1VG 2UU9L 3CF5A 1E1TA 3UDXA 4A3BG 1WCMH 2HIVA 2Q2TA 1IBLQ 1OXVA 2JK8A 4B3MQ 1QUQB 1OTCA 1IZ6A 4LFCL 2NZOA 2QEXA 2OQKA 2UUCQ 4UY8C 2KENA 1JJCB 1B8AA 4DAYB 4A3IG 5H1SE 2WFWA 3L2PA 1YHQA 1CKMA 4OX9L 2VY3A 5IP7G 4EQ5A 1HZ9A 1EOVA 4QQBX 4A3EG 2EIFA 1BBUA 2Z6KC 4UP9A 1HNZQ 2AKWB 3H0GG 3F8TA 3BZKA 1J5EQ 3G71A 4L5QA 1SMXA 1WI5A 2E8GA 3CCVA 4JI3Q 1XTDA 3K8AA 2CWPA 3HOXH 5C0XG 4DV6Q 2K50A 1KD1C 3KOJA 1EUJA 2E2IH 2Q2HA 1I5FA 4BBRH 4DR3L 1YJWA 3CXCA 1Y1WH 1YEZA 1XPOA 1QVGA 1FVIA 4GN3B 4A3DH 4PZ8A 4IOCA 1SLJA 1IBKL 2PQAB 4A76A 2ZTEA 5GROA 4A3JG 4LF9L 4JV5L 1VS0A 5IT9c 4RG1A 3PUXA 3STBD 4DR7L 4NXNQ 3GTMH 5GAHC 2VUMG 1XMQL 5IYCH 3S14H 2Y0SG 3NEMA 3Q8DA 3S2HH 2R7DA 2ZJPA 3GD7A 3A5UA 3CMEA 4A3GH 1PHJA 1VQEA 2VL6A 3CCRA 4P71A 1IBML 4KHPL 3PUWA 5M5WH 2CQOA 5M3FH 5IWAL 4UPAA 4GKJQ 4DR6Q 3KF6B 4BY1H 2JA6H 4OWXB 1V9PA 4DUYQ 3CPFA 4DR1L 3UDGA 1IL2A 4HIDA 1PH2A 4IFDG 1I3QH 1WOCA 3U50C 3TQYA 1VCIA 1VQ9A 1L1OB 3GO5A 5LMUQ 3F2BA 4LFAL 4JI7L 4DV7Q 4K0KL 4JBMA 2AWOA 1CKOA 4XIGS 4DV4Q 1VQCA 2JA7G 5DLQE 1LM0A 2F52A 1XNQQ 3LGJA 4BY7G 2YTYA 5IYDH 4A3FG 3TEHB 1M90C 4B3TL 3BU2A 1YVCA 3AYHB 2C35B 4HJ5A 1X3EA 5AJ3L 3GTJH 4GOPB 1B70B 2MFIA 3PIOA 1XPUA 4JI1L 3L0OA 1VQMA 4O2DA 3CCQA 2R7ZG 4BXXH 3HKZG 1Q8KA 2NVQH 2JA5G 2K5VA 2L15A 2I0QA 1S3OA 4FDBA 2H5XA 1XPRA 1KRSA 4L5SA 2VQEQ 4LF6L 2YV5A 4P73A 3NBHB 4HIKA 3GTLH 1J6QA 3CCUA 3B6YA 2EXDA 1LUZA 2XTIA 1XJVA 5IY0A 4WJ4A 1AE3A 5BR8L 4AH6A 3G48A 1T9HA 4DV2L 3CC4A 1YIJA 5E7NA 1N33Q 4X62Q 4ALPA 1EIFA 1X6OA 2CCZA 3HOWH 3M4QA 2ZM6L 1PH6A 2DUDA 1N36Q 3T1HL 4LF5Q 1VQNA 2B63G 2VW9A 1C9OA 1TWFH 3CD6A 4TQUS 3MEFA 4C3IH 4LF8Q 1CSPA 2VQFQ 2UUBQ 3PO3G 1FJGL 1SFOH 2LXKA 1X65A 5C0XJ 4JI4Q 2JEBI 5ELOA 1YJ9A 2F4VQ 2GVAA 2R93G 1KIXA 3H3VI 1P8LA 3I2ZA 2ALYB 3BJUA 1MKHA 1NMFA 5J3BA 4AIMA 2E2JH 1WFQA 2ID0A 1VQBA 1HR0W 1U0LA 2KBNA 4HJ8A 1L2FA 4DV3Q 1XNRQ 1Z9FA 4GNXB 4A4IA 3VDYA 1N34Q 2AWNA 3GTGH 4A3CG 4QIWE 4A75A 4DV1L 3HOZH 2NZHA 4DV0L 1H95A 3HOUG 4IOAA 4JC0A 3PCOB 4PMWA 5JJKA 1IXRA 4DR5L 2UXCQ 1G6PA 4JCVE 4A3KG 1QVCA 4NXML 4HJAA 3J81j 4R4QA 1K83H 3KF8B 4LF7Q 5LMNQ 3OTOQ 2N78A 1VQFA 3GTPH 4IFDJ 2IHFA 5M3MH 2ASBA 2CFMA 3K0XA 3E9HA 3L7ZC 2UXDL 2MNAA 5FJ8H 1E22A 4X64L 1YHBA 4H02A 4GLVB 1I50H 3G6EA 4POFA 2E5LQ 5GADC 1PH3A 4B3SL 3HOVH 1EYGA 4WJ3M 1HZCA 4MZ9A 4DKAC 4GKKL 1Q7YC 3I4MG 4X66Q 4YY3L 2UXBL 2IT1A 1NE3A 3EN2A 4JI8Q 1QZHA 2R6GA 3F2CA 2KCTA 4PG3A 4PZ7A 3DM3A 2RF4A 3RZDH 2NN6I 2YU9H 1X55A 1Y1VH 3UDFA 1CSQA 4IPGA 4UP8A 4P74A 1I6HH 4GLXA 4A3BH 2UUAQ 4X65L 2OTLA 4JYAL 2PMZE 4O0AA 1VQ7A 4BA2I 1C0AA 2IHEA 1HR0L 5C4JH 2A1AA 3M7NA 1E1OA 1EWIA 4JI2Q 4YWMA 1HJPA 4LNQA 3GDEA 5JEAG 5FLMG 4KI0A 1WYDA 4A3IH 2HHHQ 2MO0A 4NPSA 4YHHL 3T1YQ 1TWGH 3DLLA 2K5HA 5IP7H 5LMNW 4A3EH 3JAMi 3KJPA 4DR2L 3CC2A 2IX1A 3H0GH 1D7QA 1E7ZA 4C3JH 1N32L 3WWVA 2F3IA 4JBJA 3CCJA 3J80c 4JI6L 1VQLA 1X54A 3PUYA 5JJLA 4DR4Q 2R92G 3STBC 3CCMA 1Q12A 2CKZB 2VNUD 3HKSA 4A3GG 2NN6G 2ZTDA 4OO1I 2V1CC 4AYBE 4DUZL 4LUVA 1FL0A 1W3SA 1Y14B 2D62A 5M3FG 2D0OA 3FKIG 1U5KA 4A3JH 4JI0Q 3AQQA 5M5XH 1PVOA 1E3PA 1G291 1SE8A 1RL2A 1L0WA 1G51A 1VQHA 1JJ2A 2VUMH 3HOYG 5IE8A 1CKNA 1PH5A 2WB1E 1OXXK 3CAMA 4YCVA 5C3EG 2N49A 4JBKA 2KHJA 3S15H 1UEBA 2N3SA 1YNXA 4B3RQ 3J81i 3I55A 4DV5Q 1PH8A 3PGZA 3CCEA 4OWTB 2LSSA 3KDFB 3RN5A 4A93H 3PSIA 3CPWA 1HH2P 1I94L 4LFBL 4LUOA 2Z6KA 1XMOL 3E9IA 2WAQE 4LF4Q 3U58A 2Z0SA 3FHWA 4IPCA 4MNOA 1Q1BA 2UU9Q 2GN5A 4IJLA 1HNXL 2GVBA 3KFUA 4BBSG 1A0IA 4AQYL 4EX5A 2ZTCA 1NJIC 1L1OC 2B29A 3TRZA 1NTGA 2A19A 4OO1G 3J7ZC 3S24A 5M5YH 3FP9A 4KLKA 3U4VA 1S40A 3PUVA 4LFCQ 2MO1A 4ME3A 2QA4A 3CW2C 1YJNA 4BY7H 1VQDA 4A3FH 3BZCA 1IBLL 1TWHH 4OX9Q 4Y7NH 1HNWL 2OCEA 4GOPC 4B3ML 4JI5Q 3GTKH 1TXYA 1VQJA 2WP8J 2R7ZH 5IYBG 2UUCL 2RCNA 3PF4A 2D0PA 2JA5H 1VQ6A 2K14A 3A5ZB 4MTNA 2NVYH 4DAMA 3E0EA 4DR3Q 3PUZA 3M4OH 4A3LG 1K73C 1HNZL 3I4NG 1PA6A 2RHSB 5C44G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFP A;  1VQG A;  4JI3 L;  3JC6 6;  3K7U C;  3CP0 A;  1IBK Q;  5IP9 G;  4JV5 Q;  4DV6 L;  4LF9 Q;  4OWW B;  3SGI A;  3F1Z A;  4DK6 C;  2JJQ A;  4DR7 Q;  1SN8 A;  1BKB A;  2DGY A;  3AFQ A;  1XMQ Q;  3PO2 H;  2B63 H;  2YTX A;  4HIM A;  4R4C A;  3AEV A;  2PI2 E;  1W2B A;  3PO3 H;  1K9M C;  3KF6 A;  3ULJ A;  1IBM Q;  4KHP Q;  4QJF A;  1WJJ A;  4NXN L;  4BA1 I;  1JB7 A;  4DPG A;  4APV A;  5IWA Q;  1A63 A;  3D0F A;  4Y52 H;  3HFZ B;  3W1G A;  2QGQ A;  1EQR A;  4YCW A;  3TS0 A;  3ER0 A;  2R93 H;  3ULL A;  5C4X G;  1J5E L;  1YBY A;  4A3M G;  4DR1 Q;  4BY1 G;  4JG2 A;  1PV4 A;  1L1O A;  4POG A;  1K3R A;  4P72 A;  4GS3 A;  1BBW A;  2JA8 G;  3TS2 A;  2K52 A;  4DR6 L;  4GKJ L;  4HJ7 A;  4LFA Q;  1HNW Q;  3MXN B;  4K0K Q;  1EIY B;  2OTJ A;  4JI7 Q;  2EQS A;  4DNI A;  1GM5 A;  3KJO A;  4DUY L;  1LYL A;  4GNX C;  1JT8 A;  5HY6 A;  4A3C H;  1SR3 A;  3HKZ E;  4X6A H;  4GOP A;  2RHQ B;  1K8G A;  2NVT H;  1WCM G;  3HOU H;  5LMU L;  1VQO A;  1V43 A;  2YTV A;  4DV7 L;  3K7A H;  4AYB G;  4R4O A;  1RIP A;  3ZJY C;  5AJ3 Q;  4B3T Q;  1UE6 A;  4LUZ A;  4A3K H;  4DV4 L;  1AE2 A;  5C0X I;  4JI1 Q;  1N8R C;  1KXL A;  1Q1E A;  1JJG A;  2BA0 A;  1XNQ L;  1X3F A;  4XTC S;  2WB1 G;  2NVX H;  2OQ0 A;  4LF6 Q;  5EAY A;  3S1R H;  1AH9 A;  1JE5 A;  1GD7 A;  1UWV A;  3H3V H;  4PZ6 A;  1OXU A;  2PNH A;  1OXS C;  5BR8 Q;  3HOX G;  3I4M H;  1IYJ B;  2VQE L;  4DV2 Q;  2WAQ G;  1X56 A;  3KYH C;  1UE5 A;  4BBR G;  1YI2 A;  1Y1W G;  3S1M H;  1NY4 A;  4YWK A;  3NEN A;  2K5N A;  2VS1 A;  4QY7 A;  2ZM6 Q;  3T1H Q;  1C7Y A;  4OON A;  3UE1 A;  5JJI A;  5GAE C;  4A3D G;  3NEL A;  4JI5 L;  4IO9 A;  1VQP A;  1FJG Q;  1N33 L;  4X62 L;  1YZ6 A;  3A74 A;  3PV0 A;  2AHO B;  3EIV A;  5IYC G;  3W1B A;  3TRE A;  1N36 L;  4LF5 L;  4R4T A;  2CWA A;  4IFD I;  1Q46 A;  5GAG C;  1K0R A;  5FLM H;  4LF8 L;  4GN5 A;  1Q82 C;  2VQF L;  2UUB L;  1VQA A;  1TWC H;  2KCM A;  2B3G A;  4JBW A;  3G4S A;  1PH4 A;  2ZJQ A;  1KHI A;  3D31 A;  4JI4 L;  4GNX A;  3ICE A;  1PYB A;  2F4V L;  3RLN A;  3S2D H;  2JQO A;  2MQH A;  1NBW A;  2JA6 G;  1KAW A;  3RNU A;  2BH2 A;  2ATW A;  3M85 A;  2JE6 I;  2Q2I A;  4DV1 Q;  1KL9 A;  1SRO A;  4OXP A;  1YHA A;  1X9N A;  2Q2U A;  3S16 H;  4DV3 L;  1XNR L;  3M4P A;  4DV0 Q;  1Q86 C;  2R92 H;  2IX0 A;  3M3Y H;  1PH1 A;  2E2H H;  1B7Y B;  4DR5 Q;  1N34 L;  4UP7 A;  1GVP A;  1HZA A;  1UE1 A;  4IJH A;  5FLX c;  3FKI H;  4NXM Q;  3W5O A;  4A93 G;  1DGS A;  4IPD A;  4GN4 B;  5IYD G;  3HOY H;  1VQI A;  2I5H A;  3RLO A;  3I56 A;  3K81 C;  4TVA B;  5C3E H;  1QUQ A;  4HJ9 A;  3ULP A;  2UXC L;  2UXD Q;  1O7I A;  3ERS X;  3IRB A;  4NB3 A;  4X64 Q;  4KHZ A;  1GKH A;  4LF7 L;  4JOI C;  3OTO L;  5LMN L;  4B3S Q;  4LW1 A;  4BXX G;  2JA7 H;  2IY5 B;  2XGT A;  4GKK Q;  3UE0 A;  1R9T H;  2LXJ A;  4YY3 Q;  2UXB Q;  4P75 A;  2I5L X;  3M9B A;  3JAM c;  4YWL A;  4LWC A;  2E5L L;  3S17 H;  2I5M X;  3F2D A;  3RR5 A;  3GTQ H;  1D8L A;  3A0J A;  4QL5 A;  4BBS H;  3J7A 5;  1MIU A;  1EFW A;  4X66 L;  1ASZ A;  4X65 Q;  1MJE A;  2A8V A;  4JI8 L;  5HGQ A;  4JYA Q;  1VQ4 A;  1CUK A;  3HOW G;  1VQ8 A;  3S1N H;  1HR0 Q;  1BVS A;  1SRU A;  1Q81 C;  2KHI A;  1A62 A;  2ES2 A;  2Y0S E;  3KLW A;  2PQA A;  4R1J A;  5K36 G;  2HIX A;  4HIO A;  2UUA L;  3H15 A;  4YHH Q;  1X3G A;  3I4O A;  1ASY A;  1S72 A;  3OYY A;  4IPH A;  1PH7 A;  5JEA J;  4DR2 Q;  1VQ5 A;  1MJC A;  2PI2 A;  3GTO H;  4JI2 L;  2FXQ A;  2AMC B;  5IYB H;  1K8A C;  1FGU A;  1N32 Q;  4C2M H;  3J81 c;  4YCU A;  2HHH L;  4JI6 Q;  1NMG A;  3T1Y L;  3CC7 A;  3PO2 G;  4QGU A;  4A3L H;  4R4I A;  3I4N H;  3RZO H;  1PYS B;  1N9W A;  1QVF A;  5C44 H;  2R7F A;  1EQQ A;  2HT1 A;  4DUZ Q;  2K4K A;  5IP9 H;  1JMC A;  2JA9 A;  4GLA C;  4C3H H;  2OWO A;  3HOZ G;  1OXT A;  4DR4 L;  4DK3 C;  3CQZ H;  1E24 A;  4L5T A;  4RMF A;  4JOI A;  1QZG A;  2ZJR A;  3OW2 A;  3UDI A;  1HZB A;  3RN2 A;  2BA1 A;  4J15 A;  3EBE A;  3KDF A;  5ELN A;  4JI0 L;  2JEA I;  1A8V A;  1M1K C;  3CMA A;  1GO3 E;  2YYZ A;  3I7F A;  1VQK A;  2K75 A;  1YIT A;  5M3M G;  3RLF A;  1I94 Q;  4LFB Q;  2VZA A;  1TWA H;  5C4X H;  3U4Z A;  1XMO Q;  1KQS A;  1KRT A;  4B3R L;  4A3M H;  5FJ8 G;  2BH8 A;  3J80 i;  1P16 A;  1CKN B;  2HQL A;  4DV5 L;  1KC8 C;  3PIP A;  1PH9 A;  3CCL A;  1Z47 A;  3CCS A;  1HNX Q;  3HOV G;  2JA8 H;  4L5R C;  4AQY Q;  3S1Q H;  3PF5 A;  1LTL A;  1V1Q A;  2N8N A;  4LF4 L;  5GQO A;  3K80 C;  1PFS A;  1UE7 A;  1Y1V G;  2UU9 L;  3CF5 A;  1E1T A;  3UDX A;  4A3B G;  1WCM H;  2HIV A;  2Q2T A;  1IBL Q;  1OXV A;  2JK8 A;  4B3M Q;  1QUQ B;  1OTC A;  1IZ6 A;  4LFC L;  2NZO A;  2QEX A;  2OQK A;  2UUC Q;  4UY8 C;  2KEN A;  1JJC B;  1B8A A;  4DAY B;  4A3I G;  5H1S E;  2WFW A;  3L2P A;  1YHQ A;  1CKM A;  4OX9 L;  2VY3 A;  5IP7 G;  4EQ5 A;  1HZ9 A;  1EOV A;  4QQB X;  4A3E G;  2EIF A;  1BBU A;  2Z6K C;  4UP9 A;  1HNZ Q;  2AKW B;  3H0G G;  3F8T A;  3BZK A;  1J5E Q;  3G71 A;  4L5Q A;  1SMX A;  1WI5 A;  2E8G A;  3CCV A;  4JI3 Q;  1XTD A;  3K8A A;  2CWP A;  3HOX H;  5C0X G;  4DV6 Q;  2K50 A;  1KD1 C;  3KOJ A;  1EUJ A;  2E2I H;  2Q2H A;  1I5F A;  4BBR H;  4DR3 L;  1YJW A;  3CXC A;  1Y1W H;  1YEZ A;  1XPO A;  1QVG A;  1FVI A;  4GN3 B;  4A3D H;  4PZ8 A;  4IOC A;  1SLJ A;  1IBK L;  2PQA B;  4A76 A;  2ZTE A;  5GRO A;  4A3J G;  4LF9 L;  4JV5 L;  1VS0 A;  5IT9 c;  4RG1 A;  3PUX A;  3STB D;  4DR7 L;  4NXN Q;  3GTM H;  5GAH C;  2VUM G;  1XMQ L;  5IYC H;  3S14 H;  2Y0S G;  3NEM A;  3Q8D A;  3S2H H;  2R7D A;  2ZJP A;  3GD7 A;  3A5U A;  3CME A;  4A3G H;  1PHJ A;  1VQE A;  2VL6 A;  3CCR A;  4P71 A;  1IBM L;  4KHP L;  3PUW A;  5M5W H;  2CQO A;  5M3F H;  5IWA L;  4UPA A;  4GKJ Q;  4DR6 Q;  3KF6 B;  4BY1 H;  2JA6 H;  4OWX B;  1V9P A;  4DUY Q;  3CPF A;  4DR1 L;  3UDG A;  1IL2 A;  4HID A;  1PH2 A;  4IFD G;  1I3Q H;  1WOC A;  3U50 C;  3TQY A;  1VCI A;  1VQ9 A;  1L1O B;  3GO5 A;  5LMU Q;  3F2B A;  4LFA L;  4JI7 L;  4DV7 Q;  4K0K L;  4JBM A;  2AWO A;  1CKO A;  4XIG S;  4DV4 Q;  1VQC A;  2JA7 G;  5DLQ E;  1LM0 A;  2F52 A;  1XNQ Q;  3LGJ A;  4BY7 G;  2YTY A;  5IYD H;  4A3F G;  3TEH B;  1M90 C;  4B3T L;  3BU2 A;  1YVC A;  3AYH B;  2C35 B;  4HJ5 A;  1X3E A;  5AJ3 L;  3GTJ H;  4GOP B;  1B70 B;  2MFI A;  3PIO A;  1XPU A;  4JI1 L;  3L0O A;  1VQM A;  4O2D A;  3CCQ A;  2R7Z G;  4BXX H;  3HKZ G;  1Q8K A;  2NVQ H;  2JA5 G;  2K5V A;  2L15 A;  2I0Q A;  1S3O A;  4FDB A;  2H5X A;  1XPR A;  1KRS A;  4L5S A;  2VQE Q;  4LF6 L;  2YV5 A;  4P73 A;  3NBH B;  4HIK A;  3GTL H;  1J6Q A;  3CCU A;  3B6Y A;  2EXD A;  1LUZ A;  2XTI A;  1XJV A;  5IY0 A;  4WJ4 A;  1AE3 A;  5BR8 L;  4AH6 A;  3G48 A;  1T9H A;  4DV2 L;  3CC4 A;  1YIJ A;  5E7N A;  1N33 Q;  4X62 Q;  4ALP A;  1EIF A;  1X6O A;  2CCZ A;  3HOW H;  3M4Q A;  2ZM6 L;  1PH6 A;  2DUD A;  1N36 Q;  3T1H L;  4LF5 Q;  1VQN A;  2B63 G;  2VW9 A;  1C9O A;  1TWF H;  3CD6 A;  4TQU S;  3MEF A;  4C3I H;  4LF8 Q;  1CSP A;  2VQF Q;  2UUB Q;  3PO3 G;  1FJG L;  1SFO H;  2LXK A;  1X65 A;  5C0X J;  4JI4 Q;  2JEB I;  5ELO A;  1YJ9 A;  2F4V Q;  2GVA A;  2R93 G;  1KIX A;  3H3V I;  1P8L A;  3I2Z A;  2ALY B;  3BJU A;  1MKH A;  1NMF A;  5J3B A;  4AIM A;  2E2J H;  1WFQ A;  2ID0 A;  1VQB A;  1HR0 W;  1U0L A;  2KBN A;  4HJ8 A;  1L2F A;  4DV3 Q;  1XNR Q;  1Z9F A;  4GNX B;  4A4I A;  3VDY A;  1N34 Q;  2AWN A;  3GTG H;  4A3C G;  4QIW E;  4A75 A;  4DV1 L;  3HOZ H;  2NZH A;  4DV0 L;  1H95 A;  3HOU G;  4IOA A;  4JC0 A;  3PCO B;  4PMW A;  5JJK A;  1IXR A;  4DR5 L;  2UXC Q;  1G6P A;  4JCV E;  4A3K G;  1QVC A;  4NXM L;  4HJA A;  3J81 j;  4R4Q A;  1K83 H;  3KF8 B;  4LF7 Q;  5LMN Q;  3OTO Q;  2N78 A;  1VQF A;  3GTP H;  4IFD J;  2IHF A;  5M3M H;  2ASB A;  2CFM A;  3K0X A;  3E9H A;  3L7Z C;  2UXD L;  2MNA A;  5FJ8 H;  1E22 A;  4X64 L;  1YHB A;  4H02 A;  4GLV B;  1I50 H;  3G6E A;  4POF A;  2E5L Q;  5GAD C;  1PH3 A;  4B3S L;  3HOV H;  1EYG A;  4WJ3 M;  1HZC A;  4MZ9 A;  4DKA C;  4GKK L;  1Q7Y C;  3I4M G;  4X66 Q;  4YY3 L;  2UXB L;  2IT1 A;  1NE3 A;  3EN2 A;  4JI8 Q;  1QZH A;  2R6G A;  3F2C A;  2KCT A;  4PG3 A;  4PZ7 A;  3DM3 A;  2RF4 A;  3RZD H;  2NN6 I;  2YU9 H;  1X55 A;  1Y1V H;  3UDF A;  1CSQ A;  4IPG A;  4UP8 A;  4P74 A;  1I6H H;  4GLX A;  4A3B H;  2UUA Q;  4X65 L;  2OTL A;  4JYA L;  2PMZ E;  4O0A A;  1VQ7 A;  4BA2 I;  1C0A A;  2IHE A;  1HR0 L;  5C4J H;  2A1A A;  3M7N A;  1E1O A;  1EWI A;  4JI2 Q;  4YWM A;  1HJP A;  4LNQ A;  3GDE A;  5JEA G;  5FLM G;  4KI0 A;  1WYD A;  4A3I H;  2HHH Q;  2MO0 A;  4NPS A;  4YHH L;  3T1Y Q;  1TWG H;  3DLL A;  2K5H A;  5IP7 H;  5LMN W;  4A3E H;  3JAM i;  3KJP A;  4DR2 L;  3CC2 A;  2IX1 A;  3H0G H;  1D7Q A;  1E7Z A;  4C3J H;  1N32 L;  3WWV A;  2F3I A;  4JBJ A;  3CCJ A;  3J80 c;  4JI6 L;  1VQL A;  1X54 A;  3PUY A;  5JJL A;  4DR4 Q;  2R92 G;  3STB C;  3CCM A;  1Q12 A;  2CKZ B;  2VNU D;  3HKS A;  4A3G G;  2NN6 G;  2ZTD A;  4OO1 I;  2V1C C;  4AYB E;  4DUZ L;  4LUV A;  1FL0 A;  1W3S A;  1Y14 B;  2D62 A;  5M3F G;  2D0O A;  3FKI G;  1U5K A;  4A3J H;  4JI0 Q;  3AQQ A;  5M5X H;  1PVO A;  1E3P A;  1G29 1;  1SE8 A;  1RL2 A;  1L0W A;  1G51 A;  1VQH A;  1JJ2 A;  2VUM H;  3HOY G;  5IE8 A;  1CKN A;  1PH5 A;  2WB1 E;  1OXX K;  3CAM A;  4YCV A;  5C3E G;  2N49 A;  4JBK A;  2KHJ A;  3S15 H;  1UEB A;  2N3S A;  1YNX A;  4B3R Q;  3J81 i;  3I55 A;  4DV5 Q;  1PH8 A;  3PGZ A;  3CCE A;  4OWT B;  2LSS A;  3KDF B;  3RN5 A;  4A93 H;  3PSI A;  3CPW A;  1HH2 P;  1I94 L;  4LFB L;  4LUO A;  2Z6K A;  1XMO L;  3E9I A;  2WAQ E;  4LF4 Q;  3U58 A;  2Z0S A;  3FHW A;  4IPC A;  4MNO A;  1Q1B A;  2UU9 Q;  2GN5 A;  4IJL A;  1HNX L;  2GVB A;  3KFU A;  4BBS G;  1A0I A;  4AQY L;  4EX5 A;  2ZTC A;  1NJI C;  1L1O C;  2B29 A;  3TRZ A;  1NTG A;  2A19 A;  4OO1 G;  3J7Z C;  3S24 A;  5M5Y H;  3FP9 A;  4KLK A;  3U4V A;  1S40 A;  3PUV A;  4LFC Q;  2MO1 A;  4ME3 A;  2QA4 A;  3CW2 C;  1YJN A;  4BY7 H;  1VQD A;  4A3F H;  3BZC A;  1IBL L;  1TWH H;  4OX9 Q;  4Y7N H;  1HNW L;  2OCE A;  4GOP C;  4B3M L;  4JI5 Q;  3GTK H;  1TXY A;  1VQJ A;  2WP8 J;  2R7Z H;  5IYB G;  2UUC L;  2RCN A;  3PF4 A;  2D0P A;  2JA5 H;  1VQ6 A;  2K14 A;  3A5Z B;  4MTN A;  2NVY H;  4DAM A;  3E0E A;  4DR3 Q;  3PUZ A;  3M4O H;  4A3L G;  1K73 C;  1HNZ L;  3I4N G;  1PA6 A;  2RHS B;  5C44 G; 
#chains in the Genus database with same CATH topology
 1VQG A;  4JI3 L;  4MN3 A;  5IP9 G;  3E5S A;  5F2D A;  1JCK B;  1J8I A;  2HD3 A;  1F77 A;  1OO9 B;  2B63 H;  3K7A B;  1G2T A;  2PI2 E;  1MSG A;  3OWF A;  4FF3 A;  1IBM Q;  4QJF A;  4BA1 I;  4DPG A;  1A63 A;  2OXP A;  3ER0 A;  3TS0 A;  1I6H B;  3N52 A;  1WTP A;  1PV4 A;  2LY7 A;  4F87 A;  4GS3 A;  2JA8 G;  4GKJ L;  2K52 A;  4DR6 L;  2JP1 A;  1HPC A;  4HJ7 A;  2SDF A;  2CVR A;  1EIY B;  3BYY B;  1LYL A;  4A3C H;  1SR3 A;  4I65 A;  5JPN C;  4K6L A;  1WCM G;  1V43 A;  4B3T Q;  3M4Y A;  3QO2 A;  3ZJY C;  4LUZ A;  4A3K H;  2FHT A;  1SEB D;  1DOM A;  5C0X I;  1N8R C;  1KXL A;  1Q1E A;  1GXD C;  3V2T A;  3ZYY X;  2NVX H;  1TWC B;  3S1R H;  1AH9 A;  2AQ1 B;  1U4R A;  4PZ6 A;  3QJY A;  1EQV A;  1IYJ B;  4DAP A;  2VQE L;  1BCP C;  1X56 A;  4BBR G;  1ROD A;  2M9V A;  2F0K A;  2VS1 A;  3Q24 A;  2L9H A;  4X62 L;  1YZ6 A;  4KD3 A;  3KLS A;  2F0U A;  1IYU A;  3TRE A;  3DXJ C;  3VYT A;  5C3E B;  4HN7 A;  5JEA H;  4GN5 A;  1Q82 C;  3G4S A;  2B3G A;  2AQ2 B;  1PH4 A;  2ZJQ A;  1QJO A;  1I4H A;  3X3M A;  4GNX A;  1LTS D;  3JAM E;  2MQH A;  1GOZ A;  2Q8I B;  1ESR A;  2BH2 A;  2JE6 I;  3A8J E;  1SRO A;  1VF7 A;  3H09 A;  1X9N A;  2Q2U A;  3GV6 A;  4DV0 Q;  4KY6 A;  2IX0 A;  4FVM A;  3HP3 A;  2E2H H;  1MI2 A;  1TT2 A;  1B7Y B;  4IJH A;  4QIW B;  3FKI H;  4NXM Q;  3M4O B;  3KK7 A;  5IYD G;  3HOY H;  2I5H A;  3I56 A;  1RDP D;  1HXY D;  2UXC L;  1QUQ A;  4HJ9 A;  5T1I A;  4CDF C;  1O7I A;  3RD4 A;  4C2M B;  1STE A;  4GKK Q;  1KLG D;  3WOF A;  2I5L X;  1ZEQ X;  3RZO B;  2E5L L;  3RR5 A;  4PMB A;  1D8L A;  3J7A 5;  4X66 L;  1Z6H A;  4OO1 H;  1BVS A;  1HA5 A;  1UAP A;  3M7G A;  2L4N A;  2OEO A;  1SYG A;  1X3G A;  5ELD A;  4IPH A;  1PH7 A;  1MJC A;  1NNX A;  4JI2 L;  1Y8P B;  4QUF A;  3T4A C;  1N32 Q;  4C1N I;  3J81 c;  4CDD C;  2HHH L;  3TDQ A;  1NMG A;  3T1Y L;  1B1Z A;  4JI6 Q;  4ID6 A;  1XX8 A;  1BQQ T;  4DXF A;  5C44 H;  4K6D A;  2MPM A;  4DUZ Q;  2K4K A;  5IGF A;  1MBY A;  2MP1 A;  3I8Z A;  4QMG A;  3CQZ H;  1E24 A;  4KV6 A;  4L5T A;  1ILQ A;  4AYB B;  1UUP A;  1QIL A;  3PIO 3;  5ELF A;  3QOL A;  2JEA I;  2L0C A;  1A8V A;  3ND9 A;  1M1K C;  2YYZ A;  1VQK A;  3D3R A;  5M3M G;  2K32 A;  3U9O A;  1TWA H;  1JC7 A;  5C4X H;  4B3R L;  1ZXT A;  4BY1 H;  3J80 i;  1PH9 A;  2B2W C;  1HNX Q;  3HOV G;  3MVV A;  4JPB W;  1V1Q A;  3K5O A;  2G5D A;  2M00 A;  4RWS C;  1O7Y A;  4DF7 A;  2XN9 C;  5I2X A;  2UU9 L;  1WTO A;  2J0T D;  4A3D B;  1E1T A;  5FOB B;  2J7Z A;  1AFP A;  1IZ6 A;  4RFB A;  2NZO A;  3LWE A;  2QEX A;  1STB A;  2KEN A;  1SYD A;  5CR3 A;  4A3I G;  3L2P A;  2CQA A;  2DN8 A;  1Q8I A;  3I70 A;  3H0G G;  3OSO A;  4L5Q A;  1WI5 A;  3CCV A;  4JI3 Q;  5NUC A;  3HOX H;  2E2I H;  1LV9 A;  2Q2H A;  1ML0 D;  1WTV A;  1YJW A;  1SNQ A;  4FNF A;  2IWH A;  1YEZ A;  1QVG A;  1B44 D;  3LX0 A;  4PZ8 A;  1Z7T A;  4JV5 L;  4LF9 L;  2ZTE A;  3W3A A;  5IT9 c;  2VUM G;  1EL0 A;  2ICI A;  3S14 H;  5IGG A;  4FO2 A;  3Q22 A;  5G3L D;  3A5U A;  5C6A A;  4A3G H;  1G6Z A;  3KF8 A;  3MXN A;  2CQO A;  5M3F H;  3OPO A;  3QWN A;  2ICE C;  4DR6 Q;  4GKJ Q;  1K0S A;  1CM9 A;  2X6G A;  3P7J A;  3PMF A;  3VR5 A;  2KUM A;  4IFD G;  1I3Q H;  3LNN A;  1WOC A;  4OIK A;  3U50 C;  1VCI A;  4LFA L;  4QF4 A;  4JI7 L;  5EKI A;  1PTO H;  3HOW B;  1VQC A;  5EPL A;  5DLQ E;  1LM0 A;  4P2C B;  1TWF B;  5E4W C;  4E6I A;  4C3I B;  5AJ3 L;  2F03 A;  2MFI A;  1XPU A;  4JI1 L;  3L0O A;  2NVQ H;  2JA5 G;  1XPR A;  4L5S A;  2VQE Q;  1A15 A;  4LF6 L;  2YV5 A;  1HCZ A;  4HIK A;  1J6Q A;  3O13 A;  2V4D A;  3CCU A;  1QWY A;  2FFK B;  2XTI A;  4RGT A;  3MXG A;  3C46 A;  4WJ4 A;  5BR8 L;  2F0V A;  4ODG A;  1EWC A;  2EPB A;  1T9H A;  5KYL A;  3P75 A;  5CBE E;  1YIJ A;  3CC4 A;  4X62 Q;  1DOK A;  2A6E D;  4ALP A;  2CCZ A;  1X6O A;  2ZM6 L;  1PH6 A;  2DUD A;  2PCF B;  3VR4 A;  3G7L A;  1C9O A;  1BO0 A;  4OGQ C;  3CD6 A;  1LAB A;  1EOT A;  1J9O A;  1ENC A;  2NWG A;  2ZT9 C;  1X65 A;  4PV1 C;  5C0X J;  3GTP B;  1SDF A;  2JEB I;  1MD2 D;  2R93 G;  3I2Z A;  1LLR D;  1SNC A;  2B39 A;  1I50 B;  5EKL A;  3DWQ A;  1EYC A;  1L2F A;  4FYD A;  4GNX B;  4A4I A;  2OT2 A;  1SAP A;  2A5H A;  2AWN A;  4ME5 A;  2YU9 B;  3HOZ H;  4MTK A;  4U68 A;  2NZH A;  3QOJ A;  4A3B B;  1DZ1 A;  4JC0 A;  2MGS A;  5JJK A;  1KLU D;  2UXC Q;  1I6V C;  2PW7 A;  2NBF A;  1HHV A;  4HJA A;  1BF4 A;  1VQF A;  3NK9 A;  4K2L A;  4XQJ A;  2E5L Q;  4POF A;  1EYG A;  3SHL A;  5C4H A;  1Q7Y C;  4X66 Q;  4YY3 L;  2UXB L;  3EN2 A;  2R6G A;  1S5D D;  2KCT A;  4PG3 A;  2NN6 I;  1RF2 D;  1Y1V H;  3TP6 A;  3UDF A;  4IPG A;  4UP8 A;  4GLX A;  1STA A;  4IUN A;  4X65 L;  4IUU A;  4BA2 I;  1TS5 A;  2L5T A;  2KHS A;  4M1U B;  1E1O A;  4JI2 Q;  4YWM A;  3K6O A;  4PNY A;  2HHH Q;  3T1Y Q;  4BS9 A;  1CQF A;  5LMN W;  4A3E H;  3CC2 A;  4CDE C;  4C3J H;  2F3I A;  2G9H D;  1HTP A;  1I4Q A;  4K2K A;  2RDG A;  4TSS A;  3PUY A;  2R92 G;  3CCM A;  4A3G G;  2NN6 G;  2V1C C;  1TS2 A;  2Z4I A;  4B9W A;  2D62 A;  4A3J H;  5M3F G;  4EQO A;  5C5M A;  2E74 C;  1G51 A;  2KVM A;  4KMU C;  4BY7 B;  1TWH B;  4LK1 C;  4Y7N B;  4JBK A;  4B3R Q;  3S15 H;  3VR2 A;  2N3S A;  1YNX A;  5IGC A;  3J81 i;  3I55 A;  3KBG A;  5EQ0 A;  3HKZ B;  4OWT B;  4A93 H;  1HH2 P;  3V05 A;  2NVY B;  3E9I A;  2Z0S A;  3FHW A;  1Q1B A;  2UU9 Q;  1CK1 A;  2GN5 A;  4IJL A;  2Z1C A;  1SSO A;  4BBS G;  4OL7 A;  3R93 A;  4EX5 A;  3CHB D;  1H9R A;  1WTX A;  4YIJ A;  4HCE A;  4K8I A;  5IGB A;  5M5Y H;  3FP9 A;  4KLK A;  1PDQ A;  1BBX C;  1S40 A;  2B2V A;  2MO1 A;  3GQB A;  4A3F H;  3PO3 B;  2IL8 A;  4ZUJ A;  1IBL L;  2EOT A;  1SND A;  4GOP C;  3GTK H;  1TXY A;  2B8G A;  3E0J A;  5C3X A;  2R7Z H;  5IYB G;  3MFG A;  2RCN A;  1G8Z D;  2K14 A;  1VQ6 A;  2RQX A;  5ELC A;  1A3U A;  1UNS A;  2WV6 D;  4DAM A;  1KTK A;  1K73 C;  1HNZ L;  1SYB A;  1EU4 A;  2A6E C;  1PA6 A;  3K7U C;  1CQV A;  4CBV A;  1VF5 C;  4LF9 Q;  4JV5 Q;  2AUJ D;  2B2Y A;  4XDX A;  3SGI A;  1EEF D;  3F1Z A;  4DK6 C;  1B53 A;  4KN4 C;  3AFQ A;  4CKE A;  3HOU B;  4XXE A;  3PO2 H;  3AEV A;  2Z4H A;  1K9M C;  1WJJ A;  1Y1V B;  3NBI A;  3D0F A;  3HFZ B;  1EYA A;  1EQR A;  3Q6S A;  2EYO A;  3K58 A;  1YBY A;  4A3M G;  3QIA A;  4JG2 A;  1L1O A;  2RA4 A;  4POG A;  1K3R A;  1QCB D;  3TS2 A;  4LFA Q;  4F7X A;  3MXN B;  3I4M B;  3VA5 A;  4JI7 Q;  1GM5 A;  3S1M B;  1TY0 A;  5JVG 3;  4DUY L;  1JT8 A;  5HY6 A;  4HSV A;  1MGS A;  1SE4 A;  2HQE A;  5KGU A;  1M4V A;  4MHE A;  1IL8 A;  4EQP A;  2YTV A;  4DAV A;  3K7A H;  1ENF A;  5AJ3 Q;  1B2T A;  2NYZ D;  1XYI A;  4JI1 Q;  5I9O A;  1XNQ L;  1X3F A;  3NBH A;  4DNR B;  2WB1 G;  1BCP D;  4IUT A;  5KIX A;  4LF6 Q;  3A7L A;  1G91 A;  1GD7 A;  5IGE A;  1VMP A;  1HUN A;  1OXS C;  1EY6 A;  5BR8 Q;  4QB4 A;  1A2T A;  1B9M A;  3KYH C;  1Y1W G;  3S17 B;  1U9R A;  2ZM6 Q;  3M3Y B;  4WFN 3;  1C7Y A;  4OON A;  3NEL A;  1BXT A;  1JR0 D;  1VDZ A;  5KEE A;  4JI5 L;  2B2T A;  4CJ0 B;  4IUR A;  2AHO B;  5IYC G;  4R4T A;  2CWA A;  1KNA A;  1Q46 A;  1K0R A;  2F0G A;  1VQA A;  1TWC H;  4JBW A;  1QOH A;  1KHI A;  3D31 A;  5M5Y B;  1MSH A;  1LT3 D;  2JA7 B;  3C2P A;  1R9T B;  3RLN A;  3R8B A;  3FVQ A;  4A3F B;  2JA6 G;  2F1M A;  2ATW A;  3M85 A;  1FYC A;  3M4P A;  2R7Z B;  3HS0 C;  3OW7 A;  2SOB A;  1JWU D;  1UE1 A;  1MHW C;  5FLX c;  1GHJ A;  4KY7 A;  4A93 G;  1A2U A;  2DJF C;  5C3E H;  4B9X A;  4OEL B;  3IRB A;  4NB3 A;  3T53 B;  4FP5 D;  3BVZ A;  2ZXR A;  1PFM A;  4JOI C;  5E3F A;  2LXJ A;  4YY3 Q;  2UXB Q;  1EY4 A;  3FPU B;  5AFW A;  5D65 A;  2IW3 A;  3M9B A;  1IYV A;  3I4N B;  4LWC A;  4ZQ3 A;  4ZAI A;  5CV9 A;  4X65 Q;  1MJE A;  4JI8 L;  3J81 L;  1CUK A;  2HDM A;  2RDH A;  1HQR D;  1LT6 D;  2ES2 A;  2Z8L A;  5EBC A;  1CT1 D;  2K5W A;  2TMP A;  3KLW A;  2XSC A;  5K36 G;  2HIX A;  3H15 A;  1E2W A;  3D6C A;  1S72 A;  3MWY W;  5FO8 B;  2PI2 A;  2AMC B;  4C2M H;  4CGY B;  2AQ3 B;  2K5Q A;  2NZ1 D;  3L9A X;  3PO2 G;  2JA8 B;  3RZO H;  1PYS B;  1N9W A;  2R7F A;  3P20 A;  3MAQ A;  4C3H H;  1LO5 D;  1GUO A;  5C3W A;  1OXT A;  4DK3 C;  1ICF B;  1WCM B;  4K14 A;  4RMF A;  2LFN A;  1DD2 A;  3I91 A;  2F0T A;  2PW5 A;  3EBE A;  4J15 A;  5ELN A;  1SMY D;  4JI0 L;  1GO3 E;  1YIT A;  2MHV A;  2F0I A;  3U4Z A;  1GUN A;  1P16 A;  2HQL A;  1CA6 A;  3CCL A;  5CBA E;  4KHV A;  4L5R C;  1WTQ A;  1LTL A;  4L8J A;  1ESF A;  4BBR B;  2KCC A;  3E6Z X;  5LHY 1;  3CRL C;  2HIV A;  1I4R A;  1IBL Q;  2Q2T A;  1QNU A;  1JOQ A;  3GTM B;  1OTC A;  2HUG A;  3S2H B;  4LFC L;  2F0W A;  3BDC A;  4DK0 A;  1R4P B;  4CKC A;  2L12 A;  3MHB A;  5H1S E;  2JYO A;  3AU7 A;  4EQ5 A;  3R2I A;  1EOV A;  5IT9 L;  3I73 A;  1BBU A;  1HNZ Q;  4CKB A;  4B08 A;  3F8T A;  1FNV A;  5C0X G;  3KOJ A;  3RUZ A;  1I5F A;  4LAA A;  4DR3 L;  3CXC A;  2F0Q A;  4A3D H;  1SLJ A;  4QCL A;  2PQA B;  5E1F A;  1VS0 A;  4RG1 A;  2F3W A;  4XQQ A;  1SJE D;  1JQY D;  2EDG A;  2B2W A;  4G7H C;  1PTO D;  4XYO A;  4I7Z C;  3GD7 A;  3CME A;  1NCV A;  1VQE A;  3CCR A;  2C5C A;  3CKI B;  5DNF A;  2O2L D;  3BDO A;  4DUY Q;  4DR1 L;  3UDG A;  1IL2 A;  2L55 A;  3RMH A;  3VA7 A;  4HID A;  1PH2 A;  1L1O B;  2HCI A;  1KAA A;  3GP7 A;  2R3Z A;  1D6E C;  4JBM A;  3EQL C;  2AWO A;  3HG9 A;  1TII D;  3KLR A;  3OIP A;  1JIC A;  2F52 A;  1XNQ Q;  3LGJ A;  3TEH B;  1GJX A;  1ONL A;  1YVC A;  2C35 B;  2KQ3 A;  1SFO B;  3GTJ H;  4C3H B;  4J8Q A;  3CCQ A;  2SEB D;  4BXX H;  1Q8K A;  2L15 A;  1S3O A;  4FDB A;  2KJX A;  1ZKO A;  3NBH B;  2EY1 A;  1LUZ A;  4EQN A;  3DEO A;  3MTS A;  3OIQ A;  1KDC A;  1XJV A;  1D5Z C;  1DCZ A;  4K5X A;  3GTG B;  4DV2 L;  1K8O A;  3HOW H;  4IUQ A;  2A69 D;  2RVL A;  5DM7 3;  2FMM A;  1VQN A;  2B63 G;  2VW9 A;  1TWF H;  3IFT A;  3MEF A;  4C3I H;  4JVZ A;  4RCO A;  1FJG L;  1K83 B;  1D1I A;  2LXK A;  3D8G A;  5M3M B;  3W2D A;  4H13 C;  1KIX A;  1I4G A;  1P8L A;  3T16 A;  3R2T A;  3K5M A;  2E2D C;  1MKH A;  1NMF A;  5I6W A;  3C1F A;  1U4P A;  3HOV B;  3L3O C;  1PZI D;  4WRD A;  2ID0 A;  1VQB A;  2XRS D;  2KBN A;  3DEP A;  4HJ8 A;  4JW0 A;  3KBX A;  2A73 B;  2I07 B;  2A68 D;  4A3C G;  4A75 A;  1EWH A;  3D4R A;  4DV1 L;  5CV5 A;  1IHZ A;  3NTI A;  1SMY C;  1PFN A;  4IOA A;  5A35 A;  3BS1 A;  3NSW A;  4DR5 L;  4HMJ A;  4A3K G;  3J7A V;  2WAQ B;  1FGB D;  2PNR C;  3T56 B;  5C4J B;  1WD1 A;  3J81 j;  2EJG C;  4R4Q A;  4N8X 1;  5ELB A;  3GTP H;  1NR4 A;  1AW7 A;  3G6J B;  3BG3 A;  4A3I B;  3ERQ A;  2PPB C;  4FXD A;  5EJW A;  2UXD L;  1F9R A;  1E22 A;  5FJ8 H;  4X64 L;  1SJH D;  4H02 A;  1I50 H;  3G6E A;  3H0G B;  4NP5 A;  5GAD C;  3J80 E;  1HZC A;  3K5L A;  1BCP B;  3K0Y A;  2IT1 A;  4JI8 Q;  1B3Q A;  2E75 C;  4K5W A;  5KNB A;  4PZ7 A;  2RF4 A;  2YU9 H;  5KRU A;  4HED A;  2LKV A;  3F2U A;  2C9O A;  4ZYS A;  4Z9C B;  1TS4 A;  4A3B H;  2KA7 A;  2OTL A;  5M5X B;  2PMZ E;  2IHE A;  2VUM B;  1F2Y A;  4C1N K;  4HMI A;  2QCP X;  4LNQ A;  5JEA G;  4KI0 A;  4NPS A;  4YHH L;  3NE5 B;  4RH6 A;  3DLL A;  4RHR A;  5IP7 H;  4DR2 L;  3FEW X;  5JOB A;  2IX1 A;  3CCJ A;  5FK9 C;  2X69 A;  1W6J A;  1VQL A;  3GTJ B;  3A8K E;  3IAY A;  1XWE A;  5D3I B;  4OO1 I;  4LUV A;  5FO7 B;  1FL0 A;  1W3S A;  1Y14 B;  1PTO C;  3FKI G;  4JI0 Q;  1EIH A;  3AQQ A;  4DN4 M;  1PVO A;  1E3P A;  1G29 1;  4KKU A;  3HOY G;  4RKB A;  1GHK A;  5T1G A;  1STN A;  1BR9 A;  2WB1 E;  1OXX K;  2K7V A;  2DJG C;  1UEB A;  5JPM C;  1RHP A;  5CV8 A;  3PGZ A;  5DM6 3;  1GUW A;  4ABN A;  3CCE A;  2DY8 A;  2RSO A;  3RN5 A;  2JA5 B;  3X3N A;  4H7B A;  1QG7 A;  2Z6K A;  1H9M A;  4MNO A;  4L6T B;  3D6W A;  3EJI A;  4X3U A;  1EZ8 A;  4N9P A;  4F8M A;  3J7Z C;  4OO1 G;  1ET6 A;  4GZY C;  2F0F A;  4DAY A;  4LFC Q;  1CI3 M;  4ME3 A;  2QA4 A;  4XQN A;  1YNJ C;  1TVX A;  4BY7 H;  4Q5V A;  2MJ8 A;  1TWH H;  4Y7N H;  2OCE A;  5J22 A;  3T13 A;  1LTI D;  2Q8T A;  2R93 B;  2K01 A;  2D0P A;  4FF4 A;  2QW7 A;  3NQT A;  5CMD A;  2NVY H;  3C3L A;  4DR3 Q;  3E0E A;  4FF2 A;  2RHS B;  4HSP A;  5C44 G;  1J5E L;  2A69 C;  4KJN A;  4CDC C;  2WAC A;  4DV6 L;  4UDU C;  4OWW B;  2JJQ A;  3VYS A;  5A2Q L;  2NVT B;  2B2U C;  3GV3 A;  3IL8 A;  4HIM A;  1SE2 A;  4N9T A;  1W2B A;  3PO3 H;  3ULJ A;  1C48 A;  2PZU A;  1JB7 A;  4BWG B;  4Y52 H;  2QGQ A;  2F0P A;  4YCW A;  3TSS A;  2EYL A;  1S5B D;  5C4X G;  4L63 B;  4G7Z C;  4DR1 Q;  4BY1 G;  1D2B A;  2A68 C;  1KDA A;  1K28 A;  1HFG A;  4NKL A;  4P72 A;  5FKA C;  1BBW A;  2P5Z X;  1PRT D;  2F3V A;  2OTJ A;  2K6A A;  2G9D A;  2EQS A;  2N88 A;  5G3L F;  1DON A;  4GOP A;  2WKC A;  1EYD A;  1EZ6 A;  2RHQ B;  1K8G A;  1JOR A;  4RCN A;  3HOU H;  1X3P A;  4R4O A;  1UE6 A;  1O80 A;  1RCV D;  4DV4 L;  1AE2 A;  2K05 A;  1PYW D;  2BA0 A;  1KDB A;  2OQ0 A;  5EAY A;  1IW7 D;  1T5E A;  1JE5 A;  2EJF C;  3H3V H;  3VR6 A;  3BVM A;  1OXU A;  3S2D B;  3EA6 A;  2PNH A;  3HOX G;  3I4M H;  2PZW A;  1A3V A;  4DV2 Q;  1YI2 A;  3S1M H;  1NY4 A;  2R92 B;  4YWK A;  2F0D A;  4H44 C;  3NEN A;  4QY7 A;  5HGT A;  4ZK9 B;  5GAE C;  3OMG A;  3D4W A;  1VQP A;  1FJG Q;  1W6K A;  3SEB A;  5JAV A;  1L0X B;  4R9W A;  1HFN A;  3EIV A;  3SVM A;  3W1B A;  1N36 L;  2R61 A;  5FLM H;  4LF8 L;  1SYF A;  2VQF L;  2UUB L;  1V1O A;  5FLX L;  3FPP A;  3ICE A;  2RBM A;  2JQO A;  3FMC A;  3RNU A;  3A55 A;  2RDF A;  2Q2I A;  4DV1 Q;  1KL9 A;  1QNK A;  4H0L C;  3SR1 A;  3GTQ B;  3S17 H;  4BBS B;  2HCC A;  1Q86 C;  2O5J C;  3M3Y H;  4OEM B;  1F9P A;  4DR5 Q;  4UP7 A;  1GVP A;  1HZA A;  3S1N B;  4ILW A;  1NSN S;  4DK1 A;  3DMU A;  1Y8O B;  3K81 C;  2UXD Q;  4X64 Q;  4KHZ A;  1GKH A;  3GTO B;  4LF7 L;  3J81 E;  5LMN L;  5IIF A;  4LW1 A;  2JA7 H;  2IY5 B;  1F2Z A;  2XGT A;  4C56 C;  3SXH A;  1R9T H;  4P75 A;  3MC0 B;  1NR2 A;  3BVG A;  3JAM c;  2F0E A;  5BN3 A;  3TME A;  4RGN A;  2I5M X;  3F2D A;  4QL5 A;  1MIU A;  1NAP A;  1ASZ A;  3J7A F;  5HGQ A;  2XIW A;  1RTO A;  5EPJ A;  1Q81 C;  2L1B A;  2KHI A;  4FXG C;  2PQA A;  4HIO A;  2UUA L;  5HUR A;  2PMZ B;  2QKI C;  2A6H C;  4YHH Q;  3NWT A;  1F9Q A;  3I4L A;  3OYY A;  5JEA J;  4DR2 Q;  1VQ5 A;  1ENA A;  2FXQ A;  1K8A C;  3ERO A;  4A3M B;  1QE6 A;  4YCU A;  1JE4 A;  3CC7 A;  2BCO A;  3HEJ A;  1S5E D;  4A3L H;  3I4N H;  3H6M A;  3S1Q B;  1EQQ A;  3A54 A;  2LS0 1;  5IP9 H;  1JMC A;  2OWO A;  3HOZ G;  5J39 A;  4DR4 L;  4JOI A;  2KEE A;  1QZG A;  3MZ5 A;  2GA4 B;  2ZJR A;  3KUP A;  3OW2 A;  3RN2 A;  5I9P A;  3QG1 A;  5JVH 3;  3CMA A;  3I7F A;  2NB0 A;  2WB1 B;  4KKS A;  2RSN A;  3RLF A;  2VZA A;  4DXG A;  1KRT A;  1PRT C;  1KC8 C;  1C8C A;  2PYK A;  3CCS A;  2AUK A;  4KKT A;  4U67 3;  2JA8 H;  2N8N A;  4LF4 L;  5GQO A;  1Y1W B;  2K33 A;  1U4L A;  1UE7 A;  2WII B;  1Y1V G;  1TKW B;  5IT9 E;  3UDX A;  1WCM H;  3D4D A;  1SNM A;  2BE5 D;  3NTK A;  2JSO A;  3NXW A;  4I7A A;  2JK8 A;  1TS3 A;  5DEH A;  5I4D A;  3MA2 B;  1IW7 C;  3H91 A;  4IAL A;  3LWU A;  4UY8 C;  1B8A A;  4DAY B;  4XYQ A;  3U9S A;  1BDO A;  1YHQ A;  1CKM A;  4EVO A;  5M5W B;  2O5I C;  2KED A;  4ZCK A;  4A3E G;  2AKW B;  2ZXO A;  1J5E Q;  1PXU A;  3G71 A;  4C3J G;  2JA6 B;  2PO4 A;  1KD1 C;  4DV6 Q;  3ITP A;  3QR8 A;  4BBR H;  4IUV A;  5BN4 A;  1XPO A;  1FVI A;  4GN3 B;  2F0N A;  4IOC A;  1IBK L;  2EVB A;  4V0B A;  4A3J G;  5GRO A;  3STB D;  3NQI A;  3PUX A;  4DR7 L;  3GTM H;  5GAH C;  1XMQ L;  2Y0S G;  3S2H H;  1WTH A;  4PMC A;  1PMR A;  2ZJP A;  3AB9 A;  3HRZ C;  2VL6 A;  4P71 A;  4KHP L;  1BNZ A;  3PUW A;  3ND8 A;  5CGK A;  5IWA L;  1STH A;  4UPA A;  4ZLT F;  1S5C D;  2QDB A;  4K8J A;  2D9U A;  5EKK A;  1SXT A;  3FDT A;  3CPF A;  1SYC A;  1RTN A;  4HR7 B;  1ILP A;  2RCF A;  2B2Y C;  3TQY A;  1VQ9 A;  1HNW L;  3GO5 A;  4FXK C;  4K0K L;  3F2B A;  1GUG A;  4O1N A;  4XT1 B;  3Q0A A;  1CKO A;  4RKL A;  4DV4 Q;  2JA7 G;  1Q90 A;  2YTY A;  5IYD H;  4A3F G;  3Q23 A;  3AYH B;  4GOP B;  2PZT A;  4DGZ A;  4O2D A;  3V96 A;  2R7Z G;  1BOS A;  2IJ0 A;  3MEH A;  4IQZ A;  2H5X A;  2KOL A;  4P73 A;  2E2J B;  2N55 A;  3GTL H;  3B6Y A;  2EXD A;  1D5M C;  5M9O A;  4DA2 A;  5E7N A;  3MFY A;  1BCP F;  4KN7 C;  3M4Q A;  1LTT D;  1N36 Q;  3T1H L;  1C4Q A;  2O4X A;  4LF8 Q;  3A8I E;  2VQF Q;  2UUB Q;  3BYT B;  1SFO H;  1EIG A;  4ZRZ A;  1YJ9 A;  5ELO A;  5L37 A;  1LTR D;  2GVA A;  5EBD A;  1WVL A;  5J3B A;  1HR0 W;  1NUC A;  3C1E A;  3E3X A;  1B3A A;  5CYU A;  3K57 A;  3GTG H;  4RHS A;  2HDL A;  1SNP A;  1PRT B;  2B2T C;  1H95 A;  4F88 A;  1PLF A;  3URY A;  1G6P A;  3NPP A;  4IZ8 A;  4WJW A;  4KD4 A;  1K83 H;  4LF7 Q;  5LMN Q;  2LMC B;  3NP8 A;  3SK8 A;  2IHF A;  2SNS A;  5M3M H;  2F0J A;  2ASB A;  2CFM A;  3E9H A;  1TWG B;  2MNA A;  1EY5 A;  1CTM A;  3HOV H;  1CFM A;  5LL6 S;  4B3S L;  4DKA C;  1FNU A;  4ZKC B;  1NE3 A;  1STG A;  3RZD H;  2BE5 C;  1VMC A;  1X55 A;  4CJ2 C;  2VXW A;  3CU7 A;  5IOD A;  4P74 A;  2UUA Q;  3TBI B;  4JYA L;  1VQ7 A;  1YNN D;  1HR0 L;  1WD0 A;  5C4J H;  2M2L A;  3M7N A;  1ICW A;  1HJP A;  2F4I A;  1WYD A;  5D3D A;  4K5V A;  4A3I H;  1UEA B;  3VR3 A;  3JAM i;  3H0G H;  1E7Z A;  3WWV A;  4JBJ A;  4RAU C;  5LL6 X;  1X54 A;  5JJL A;  4DR4 Q;  3STB C;  2RKS A;  1Q12 A;  2CKZ B;  3HKS A;  3PIP 3;  2ZTD A;  3I72 A;  2QEJ C;  1S5F D;  2D0O A;  5M5X H;  3GTL B;  4DNT B;  1RL2 A;  2XWJ B;  1VQH A;  1L0Y B;  2VUM H;  1CKN A;  3HGB A;  4YCV A;  3CAM A;  2WKD A;  5C3E G;  3K59 A;  1JOO A;  1X32 A;  2N49 A;  1TQO A;  1STY A;  1H9S A;  1V1P B;  3EVQ A;  5EPK A;  2LSS A;  3PSI A;  3CPW A;  1I94 L;  3H94 A;  1R4Q B;  1EY9 A;  4LFB L;  1XMO L;  3SK5 A;  4LF4 Q;  3K5N A;  4IPC A;  4IFD H;  1RJT A;  1YNJ D;  3KFU A;  2NTS A;  3N6R A;  1A0I A;  2K1B A;  4AQY L;  2ZTC A;  2IX3 A;  2B29 A;  1NJI C;  1NTG A;  1IKM A;  2B63 B;  3PUV A;  2D2C C;  2Q8R E;  3CW2 C;  1YJN A;  1VQD A;  3BZC A;  5IGD A;  3OOC A;  5KND A;  4B3M L;  4JI5 Q;  4LJZ C;  1VQJ A;  2WP8 J;  3IKJ A;  2UUC L;  3HZX A;  2F0S A;  5A2Q E;  2JA5 H;  3PF4 A;  3A5Z B;  4MTN A;  4G7O C;  1CA5 A;  2TSS A;  1JB3 A;  1O78 A;  3DWP A;  1V8Q A;  3AFP A;  2XWB B;  3JC6 6;  3CP0 A;  1IBK Q;  1CHQ D;  1AP0 A;  4C3H G;  1M8A A;  4DR7 Q;  1SN8 A;  1BKB A;  2DGY A;  1XMQ Q;  2YTX A;  4R4C A;  3NTH A;  4A3K B;  3QB3 A;  4NDX A;  3KF6 A;  4KHP Q;  4NXN L;  4N8F A;  3RZD B;  4APV A;  5IWA Q;  2ENB A;  3W1G A;  2NVX B;  2R93 H;  3ULL A;  5J1Z A;  1AN8 A;  3S1R B;  1LTA D;  2EY6 A;  4ZUI A;  1HNW Q;  4K0K Q;  4DNI A;  4IUP A;  3KJO A;  1PTO F;  4GNX C;  3HKZ E;  4X6A H;  2NVT H;  4G4K A;  5LMU L;  1VQO A;  5ISR A;  4DV7 L;  4AYB G;  1RIP A;  2NUC A;  4LMQ D;  4UHV A;  1JJG A;  2EYP A;  4XTC S;  1S4Z A;  1PZK D;  1LT5 D;  4TRD A;  1UWV A;  2QIL A;  2WIN B;  1U4M A;  2B2U A;  2WAQ G;  1ET9 A;  1UE5 A;  2K5N A;  3T1H Q;  3UE1 A;  1YNN C;  2EY2 A;  5FLX E;  3SE0 A;  4A3D G;  2E2H B;  5JJI A;  3T51 B;  1EY8 A;  3SK6 A;  3FKI B;  4IO9 A;  1N33 L;  3A74 A;  2KCN A;  3PV0 A;  3HOY B;  4LF5 L;  1EU3 A;  4IFD I;  5GAG C;  2FJ2 A;  1DYQ A;  2KCM A;  1AEX A;  4JI4 L;  1EY7 A;  1PYB A;  2F4V L;  3S2D H;  1NBW A;  1EFI D;  1KAW A;  4OXP A;  1YHA A;  3S16 H;  4DV3 L;  1XNR L;  5COR A;  5KYI A;  2R92 H;  1GUT A;  2NN6 H;  5CV6 A;  1PH1 A;  5C5L A;  4X3K A;  3TP7 A;  1N34 L;  3W5O A;  1DGS A;  2CHB D;  4IPD A;  3JAM L;  4GN4 B;  2EE1 A;  2BDO A;  1VQI A;  4QUC A;  4JK1 C;  3RLO A;  1F9S A;  5FO9 B;  4TVA B;  3ULP A;  2BDN A;  3ERS X;  2VB2 X;  4NW2 A;  4DU9 A;  3OTO L;  4B3S Q;  4BXX G;  1LTG D;  4J6H A;  3UE0 A;  1EY0 A;  4NMZ A;  4YWL A;  1B4O A;  2EXZ A;  4RGM A;  5C44 B;  1I4P A;  3A0J A;  3GTQ H;  4RGO S;  4BBS H;  1EFW A;  2A6H D;  2K03 A;  2A8V A;  4JYA Q;  1VQ4 A;  3HOW G;  1VQ8 A;  3S1N H;  1HR0 Q;  3CQZ B;  1SRU A;  1A62 A;  2Y0S E;  4R1J A;  4C3I G;  1HRJ A;  1CHP D;  3I4O A;  1ASY A;  3GTO H;  2CH4 A;  3EFX D;  1TWA B;  5IYB H;  3NHH A;  1FGU A;  5C4X B;  4BY1 B;  4CHT B;  4QGU A;  1X3Q A;  4MIU A;  4R4I A;  1QVF A;  2HT1 A;  1T5X D;  2JA9 A;  2L11 A;  4GLA C;  3FRP B;  1ZYR D;  4WOR A;  1Q3L A;  5CV4 A;  1JWM D;  2FIN B;  2F0H A;  1G2S A;  1HZB A;  3UDI A;  2BA1 A;  3KDF A;  1CZG A;  3A7A B;  2K75 A;  2F0M A;  1I94 Q;  4LFB Q;  1KQS A;  1XMO Q;  2K04 A;  4A3M H;  5FJ8 G;  2BH8 A;  4DV5 L;  2F0L A;  1CKN B;  2QDL A;  3PIP A;  3H3V C;  1LT4 D;  4RA8 A;  1TY2 A;  1Z47 A;  1EQT A;  3HOX B;  4AQY Q;  3S1Q H;  2DY7 A;  1HUM A;  2E2I B;  3PF5 A;  1H9S B;  3K80 C;  1PFS A;  3SK4 A;  3CF5 A;  1TU2 B;  4A3B G;  3DM1 A;  2EYM A;  2EYJ A;  1OXV A;  3I3C A;  4B3M Q;  1QUQ B;  3S14 B;  2DNC A;  2H4O A;  1O7Z A;  3S16 B;  2OQK A;  3WDN A;  2UUC Q;  1LTB D;  4A3G B;  1JJC B;  2WFW A;  4OX9 L;  1DJR D;  1SNO A;  2VY3 A;  5M3F B;  5IP7 G;  1HQM C;  1HZ9 A;  4QQB X;  1AZP A;  1E2Z A;  2EIF A;  2Z6K C;  4UP9 A;  2Z9H A;  3BZK A;  1SE3 A;  2EYH A;  1SMX A;  2E8G A;  4R8N A;  1XTD A;  2OF1 A;  2B8F A;  2CWP A;  2CW0 D;  3K8A A;  2K50 A;  3J80 L;  1EUJ A;  3J7Y W;  1HTL D;  1I3Q B;  3I90 A;  1Y1W H;  5C4Z A;  2JN4 A;  2XRQ D;  2MUY A;  5DAU A;  2K5D A;  5D14 A;  1PTO B;  4A76 A;  1E2V A;  4NXN Q;  5CV7 A;  3R3O A;  3AMU A;  2ZXP A;  4KJO A;  5IYC H;  3NEM A;  3Q8D A;  5KNC A;  5JJZ A;  2R7D A;  1PHJ A;  1IBM L;  5M5W H;  2NVQ B;  3KF6 B;  2A74 C;  4ULL A;  4XT3 B;  4FF1 A;  2JA6 H;  4OWX B;  1V9P A;  4TKO B;  4OIJ A;  2EYF A;  3OWE B;  1FR3 A;  5LMU Q;  4DV7 Q;  2Z6B A;  3OHX C;  4XIG S;  1DOL A;  3BDL A;  1F2L A;  3VYR A;  4BY7 G;  1PZJ D;  1M90 C;  1JWS D;  4B3T L;  3BU2 A;  1A3T A;  4HJ5 A;  2PQE A;  1X3E A;  1PRT F;  2D5D A;  4V19 0;  1B70 B;  3PIO A;  3WOE A;  1VQM A;  3HKZ G;  2K5V A;  2I0Q A;  1SYE A;  1KRS A;  2SNM A;  5K5P A;  2VB3 X;  1IKL A;  1H9J A;  2CH4 W;  5IY0 A;  4OHJ A;  1AE3 A;  1D1K A;  4AH6 A;  3G48 A;  3UI2 A;  1N33 Q;  3HOZ B;  4O42 A;  1B50 A;  1EIF A;  5I2Y A;  4KK7 A;  4LF5 Q;  4UAI A;  5TSS A;  4TQU S;  5K36 H;  1CSP A;  3PO3 G;  3TP8 A;  4JI4 Q;  1HA6 A;  1WTR A;  2F4V Q;  2EZV A;  3H3V I;  2ALY B;  3BJU A;  1RD9 D;  1V1P A;  4AIM A;  3TN2 A;  3TP5 A;  2FMC A;  2E2J H;  1WFQ A;  1U0L A;  4HCS A;  1H9K A;  4X3S A;  4EGV A;  4DV3 Q;  1Z9F A;  4S3S A;  1WTW A;  1XNR Q;  3SDZ A;  1ZYR C;  3OMC A;  2E76 C;  3VYU A;  1GUS A;  3VDY A;  1N34 Q;  1F2M A;  4QIW E;  5CC4 A;  2XNA C;  4DV0 L;  3HOU G;  1FD7 D;  2EJM A;  3PCO B;  2H1E A;  4PMW A;  1IXR A;  3PQI A;  4JCV E;  3NUC A;  1QVC A;  4NXM L;  1RKN A;  3CRK C;  3KF8 B;  4Q0F A;  1DM0 B;  2N78 A;  3OTO Q;  2BOS A;  3DHQ A;  4IFD J;  4R8I A;  3K0X A;  3L7Z C;  4A3E B;  1YHB A;  4GLV B;  1PH3 A;  5ELE A;  4C3J B;  3DWA A;  4WJ3 M;  4MZ9 A;  1II3 A;  4GKK L;  3BZD B;  3I4M G;  1QZH A;  1XXG A;  4HAE A;  4M8A A;  3F2C A;  3DM3 A;  3A56 A;  3IFD A;  1CSQ A;  1KNE A;  4DFA A;  1E0B A;  1FNW A;  4ZKB B;  1I6H H;  1TR5 A;  4A3J B;  1AZQ A;  2DNE A;  1EEI D;  3MXU A;  3S9W A;  5E4X A;  4O0A A;  1C0A A;  1LAC A;  2XVS A;  2A1A A;  2Y0S B;  2QF7 A;  1EWI A;  4HTH A;  3KLS X;  2K28 A;  3GDE A;  4KTA A;  5FLM G;  3S15 B;  1BUV T;  2MO0 A;  1TWG H;  2B2V C;  2J4X A;  2K5H A;  2CW0 C;  2X6L A;  3KJP A;  4A93 B;  2I46 A;  3TZD A;  2JXM B;  1D7Q A;  1N32 L;  3TZU A;  3J80 c;  5C0X H;  1K3B C;  4JI6 L;  5EGT A;  3P1H A;  4J1M A;  4DUZ L;  4AYB E;  1A6X A;  2IPK D;  1U5K A;  1I4X A;  1SE8 A;  1QB5 D;  1JJ2 A;  1L0W A;  4IN3 A;  5IE8 A;  1PH5 A;  3DUZ A;  2KHJ A;  4DV5 Q;  3GTK B;  1PH8 A;  1D5X C;  1Y69 U;  1Y8N B;  3KDF B;  1PFB A;  1O7L A;  4LUO A;  5COY A;  2WAQ E;  3U58 A;  4KY5 A;  1XTC D;  4CJ1 B;  5I6Y A;  2GVB A;  1HNX L;  1L1O C;  3TRZ A;  2A19 A;  5IOC A;  3S24 A;  3ONA B;  1B9N A;  3U4V A;  3PO2 B;  1JOK A;  5BN5 A;  4OX9 Q;  1SBB B;  4X3T A;  2KEC A;  2F0O A;  1DXM A;  2EY5 A;  4G57 A;  4PQX A;  2NTT A;  3PUZ A;  3M4O H;  4A3L G;  1CZW A;  3I4N G;  3NWS A;  3MXP A;  2VNU D;  1K8M A;  1KAB A; 
#chains in the Genus database with same CATH homology
 3AFP A;  1VQG A;  4JI3 L;  3JC6 6;  3K7U C;  3CP0 A;  1IBK Q;  5IP9 G;  4JV5 Q;  4DV6 L;  4LF9 Q;  4OWW B;  3SGI A;  3F1Z A;  4DK6 C;  2JJQ A;  4DR7 Q;  1SN8 A;  1BKB A;  2DGY A;  3AFQ A;  1XMQ Q;  3PO2 H;  2B63 H;  2YTX A;  4HIM A;  4R4C A;  3AEV A;  2PI2 E;  1W2B A;  3PO3 H;  1K9M C;  3KF6 A;  3ULJ A;  1IBM Q;  4KHP Q;  4QJF A;  1WJJ A;  4NXN L;  4BA1 I;  1JB7 A;  4DPG A;  4APV A;  5IWA Q;  1A63 A;  3D0F A;  4Y52 H;  3HFZ B;  3W1G A;  2QGQ A;  1EQR A;  4YCW A;  3TS0 A;  3ER0 A;  2R93 H;  3ULL A;  5C4X G;  1J5E L;  1YBY A;  4A3M G;  4DR1 Q;  4BY1 G;  4JG2 A;  1PV4 A;  1L1O A;  4POG A;  1K3R A;  4P72 A;  4GS3 A;  1BBW A;  2JA8 G;  3TS2 A;  2K52 A;  4DR6 L;  4GKJ L;  4HJ7 A;  4LFA Q;  1HNW Q;  3MXN B;  4K0K Q;  1EIY B;  2OTJ A;  4JI7 Q;  2EQS A;  4DNI A;  1GM5 A;  3KJO A;  4DUY L;  1LYL A;  4GNX C;  1JT8 A;  5HY6 A;  4A3C H;  1SR3 A;  3HKZ E;  4X6A H;  4GOP A;  2RHQ B;  1K8G A;  2NVT H;  1WCM G;  3HOU H;  5LMU L;  1VQO A;  1V43 A;  2YTV A;  4DV7 L;  3K7A H;  4AYB G;  4R4O A;  1RIP A;  3ZJY C;  5AJ3 Q;  4B3T Q;  1UE6 A;  4LUZ A;  4A3K H;  4DV4 L;  1AE2 A;  5C0X I;  4JI1 Q;  1N8R C;  1KXL A;  1Q1E A;  1JJG A;  2BA0 A;  1XNQ L;  1X3F A;  4XTC S;  2WB1 G;  2NVX H;  2OQ0 A;  4LF6 Q;  5EAY A;  3S1R H;  1AH9 A;  1JE5 A;  1GD7 A;  1UWV A;  3H3V H;  4PZ6 A;  1OXU A;  2PNH A;  1OXS C;  5BR8 Q;  3HOX G;  3I4M H;  1IYJ B;  2VQE L;  4DV2 Q;  2WAQ G;  1X56 A;  3KYH C;  1UE5 A;  4BBR G;  1YI2 A;  1Y1W G;  3S1M H;  1NY4 A;  4YWK A;  3NEN A;  2K5N A;  2VS1 A;  4QY7 A;  2ZM6 Q;  3T1H Q;  1C7Y A;  4OON A;  3UE1 A;  5JJI A;  5GAE C;  4A3D G;  3NEL A;  4JI5 L;  4IO9 A;  1VQP A;  1FJG Q;  1N33 L;  4X62 L;  1YZ6 A;  3A74 A;  3PV0 A;  2AHO B;  3EIV A;  5IYC G;  3W1B A;  3TRE A;  1N36 L;  4LF5 L;  4R4T A;  2CWA A;  4IFD I;  1Q46 A;  5GAG C;  1K0R A;  5FLM H;  4LF8 L;  4GN5 A;  1Q82 C;  2VQF L;  2UUB L;  1VQA A;  1TWC H;  2KCM A;  2B3G A;  4JBW A;  3G4S A;  1PH4 A;  2ZJQ A;  1KHI A;  3D31 A;  4JI4 L;  4GNX A;  3ICE A;  1PYB A;  2F4V L;  3RLN A;  3S2D H;  2JQO A;  2MQH A;  1NBW A;  2JA6 G;  1KAW A;  3RNU A;  2BH2 A;  2ATW A;  3M85 A;  2JE6 I;  2Q2I A;  4DV1 Q;  1KL9 A;  1SRO A;  4OXP A;  1YHA A;  1X9N A;  2Q2U A;  3S16 H;  4DV3 L;  1XNR L;  3M4P A;  4DV0 Q;  1Q86 C;  2R92 H;  2IX0 A;  3M3Y H;  1PH1 A;  2E2H H;  1B7Y B;  4DR5 Q;  1N34 L;  4UP7 A;  1GVP A;  1HZA A;  1UE1 A;  4IJH A;  5FLX c;  3FKI H;  4NXM Q;  3W5O A;  4A93 G;  1DGS A;  4IPD A;  4GN4 B;  5IYD G;  3HOY H;  1VQI A;  2I5H A;  3RLO A;  3I56 A;  3K81 C;  4TVA B;  5C3E H;  1QUQ A;  4HJ9 A;  3ULP A;  2UXC L;  2UXD Q;  1O7I A;  3ERS X;  3IRB A;  4NB3 A;  4X64 Q;  4KHZ A;  1GKH A;  4LF7 L;  4JOI C;  3OTO L;  5LMN L;  4B3S Q;  4LW1 A;  4BXX G;  2JA7 H;  2IY5 B;  2XGT A;  4GKK Q;  3UE0 A;  1R9T H;  2LXJ A;  4YY3 Q;  2UXB Q;  4P75 A;  2I5L X;  3M9B A;  3JAM c;  4YWL A;  4LWC A;  2E5L L;  3S17 H;  2I5M X;  3F2D A;  3RR5 A;  3GTQ H;  1D8L A;  3A0J A;  4QL5 A;  4BBS H;  3J7A 5;  1MIU A;  1EFW A;  4X66 L;  1ASZ A;  4X65 Q;  1MJE A;  2A8V A;  4JI8 L;  5HGQ A;  4JYA Q;  1VQ4 A;  1CUK A;  3HOW G;  1VQ8 A;  3S1N H;  1HR0 Q;  1BVS A;  1SRU A;  1Q81 C;  2KHI A;  1A62 A;  2ES2 A;  2Y0S E;  3KLW A;  2PQA A;  4R1J A;  5K36 G;  2HIX A;  4HIO A;  2UUA L;  3H15 A;  4YHH Q;  1X3G A;  3I4O A;  1ASY A;  1S72 A;  3OYY A;  4IPH A;  1PH7 A;  5JEA J;  4DR2 Q;  1VQ5 A;  1MJC A;  2PI2 A;  3GTO H;  4JI2 L;  2FXQ A;  2AMC B;  5IYB H;  1K8A C;  1FGU A;  1N32 Q;  4C2M H;  3J81 c;  4YCU A;  2HHH L;  4JI6 Q;  1NMG A;  3T1Y L;  3CC7 A;  3PO2 G;  4QGU A;  4A3L H;  4R4I A;  3I4N H;  3RZO H;  1PYS B;  1N9W A;  1QVF A;  5C44 H;  2R7F A;  1EQQ A;  2HT1 A;  4DUZ Q;  2K4K A;  5IP9 H;  1JMC A;  2JA9 A;  4GLA C;  4C3H H;  2OWO A;  3HOZ G;  1OXT A;  4DR4 L;  4DK3 C;  3CQZ H;  1E24 A;  4L5T A;  4RMF A;  4JOI A;  1QZG A;  2ZJR A;  3OW2 A;  3UDI A;  1HZB A;  3RN2 A;  2BA1 A;  4J15 A;  3EBE A;  3KDF A;  5ELN A;  4JI0 L;  2JEA I;  1A8V A;  1M1K C;  3CMA A;  1GO3 E;  2YYZ A;  3I7F A;  1VQK A;  2K75 A;  1YIT A;  5M3M G;  3RLF A;  1I94 Q;  4LFB Q;  2VZA A;  1TWA H;  5C4X H;  3U4Z A;  1XMO Q;  1KQS A;  1KRT A;  4B3R L;  4A3M H;  5FJ8 G;  2BH8 A;  3J80 i;  1P16 A;  1CKN B;  2HQL A;  4DV5 L;  1KC8 C;  3PIP A;  1PH9 A;  3CCL A;  1Z47 A;  3CCS A;  1HNX Q;  3HOV G;  2JA8 H;  4L5R C;  4AQY Q;  3S1Q H;  3PF5 A;  1LTL A;  1V1Q A;  2N8N A;  4LF4 L;  5GQO A;  3K80 C;  1PFS A;  1UE7 A;  1Y1V G;  2UU9 L;  3CF5 A;  1E1T A;  3UDX A;  4A3B G;  1WCM H;  2HIV A;  2Q2T A;  1IBL Q;  1OXV A;  2JK8 A;  4B3M Q;  1QUQ B;  1OTC A;  1IZ6 A;  4LFC L;  2NZO A;  2QEX A;  2OQK A;  2UUC Q;  4UY8 C;  2KEN A;  1JJC B;  1B8A A;  4DAY B;  4A3I G;  5H1S E;  2WFW A;  3L2P A;  1YHQ A;  1CKM A;  4OX9 L;  2VY3 A;  5IP7 G;  4EQ5 A;  1HZ9 A;  1EOV A;  4QQB X;  4A3E G;  2EIF A;  1BBU A;  2Z6K C;  4UP9 A;  1HNZ Q;  2AKW B;  3H0G G;  3F8T A;  3BZK A;  1J5E Q;  3G71 A;  4L5Q A;  1SMX A;  1WI5 A;  2E8G A;  3CCV A;  4JI3 Q;  1XTD A;  3K8A A;  2CWP A;  3HOX H;  5C0X G;  4DV6 Q;  2K50 A;  1KD1 C;  3KOJ A;  1EUJ A;  2E2I H;  2Q2H A;  1I5F A;  4BBR H;  4DR3 L;  1YJW A;  3CXC A;  1Y1W H;  1YEZ A;  1XPO A;  1QVG A;  1FVI A;  4GN3 B;  4A3D H;  4PZ8 A;  4IOC A;  1SLJ A;  1IBK L;  2PQA B;  4A76 A;  2ZTE A;  5GRO A;  4A3J G;  4LF9 L;  4JV5 L;  1VS0 A;  5IT9 c;  4RG1 A;  3PUX A;  3STB D;  4DR7 L;  4NXN Q;  3GTM H;  5GAH C;  2VUM G;  1XMQ L;  5IYC H;  3S14 H;  2Y0S G;  3NEM A;  3Q8D A;  3S2H H;  2R7D A;  2ZJP A;  3GD7 A;  3A5U A;  3CME A;  4A3G H;  1PHJ A;  1VQE A;  2VL6 A;  3CCR A;  4P71 A;  1IBM L;  4KHP L;  3PUW A;  5M5W H;  2CQO A;  5M3F H;  5IWA L;  4UPA A;  4GKJ Q;  4DR6 Q;  3KF6 B;  4BY1 H;  2JA6 H;  4OWX B;  1V9P A;  4DUY Q;  3CPF A;  4DR1 L;  3UDG A;  1IL2 A;  4HID A;  1PH2 A;  4IFD G;  1I3Q H;  1WOC A;  3U50 C;  3TQY A;  1VCI A;  1VQ9 A;  1L1O B;  3GO5 A;  5LMU Q;  3F2B A;  4LFA L;  4JI7 L;  4DV7 Q;  4K0K L;  4JBM A;  2AWO A;  1CKO A;  4XIG S;  4DV4 Q;  1VQC A;  2JA7 G;  5DLQ E;  1LM0 A;  2F52 A;  1XNQ Q;  3LGJ A;  4BY7 G;  2YTY A;  5IYD H;  4A3F G;  3TEH B;  1M90 C;  4B3T L;  3BU2 A;  1YVC A;  3AYH B;  2C35 B;  4HJ5 A;  1X3E A;  5AJ3 L;  3GTJ H;  4GOP B;  1B70 B;  2MFI A;  3PIO A;  1XPU A;  4JI1 L;  3L0O A;  1VQM A;  4O2D A;  3CCQ A;  2R7Z G;  4BXX H;  3HKZ G;  1Q8K A;  2NVQ H;  2JA5 G;  2K5V A;  2L15 A;  2I0Q A;  1S3O A;  4FDB A;  2H5X A;  1XPR A;  1KRS A;  4L5S A;  2VQE Q;  4LF6 L;  2YV5 A;  4P73 A;  3NBH B;  4HIK A;  3GTL H;  1J6Q A;  3CCU A;  3B6Y A;  2EXD A;  1LUZ A;  2XTI A;  1XJV A;  5IY0 A;  4WJ4 A;  1AE3 A;  5BR8 L;  4AH6 A;  3G48 A;  1T9H A;  4DV2 L;  3CC4 A;  1YIJ A;  5E7N A;  1N33 Q;  4X62 Q;  4ALP A;  1EIF A;  1X6O A;  2CCZ A;  3HOW H;  3M4Q A;  2ZM6 L;  1PH6 A;  2DUD A;  1N36 Q;  3T1H L;  4LF5 Q;  1VQN A;  2B63 G;  2VW9 A;  1C9O A;  1TWF H;  3CD6 A;  4TQU S;  3MEF A;  4C3I H;  4LF8 Q;  1CSP A;  2VQF Q;  2UUB Q;  3PO3 G;  1FJG L;  1SFO H;  2LXK A;  1X65 A;  5C0X J;  4JI4 Q;  2JEB I;  5ELO A;  1YJ9 A;  2F4V Q;  2GVA A;  2R93 G;  1KIX A;  3H3V I;  1P8L A;  3I2Z A;  2ALY B;  3BJU A;  1MKH A;  1NMF A;  5J3B A;  4AIM A;  2E2J H;  1WFQ A;  2ID0 A;  1VQB A;  1HR0 W;  1U0L A;  2KBN A;  4HJ8 A;  1L2F A;  4DV3 Q;  1XNR Q;  1Z9F A;  4GNX B;  4A4I A;  3VDY A;  1N34 Q;  2AWN A;  3GTG H;  4A3C G;  4QIW E;  4A75 A;  4DV1 L;  3HOZ H;  2NZH A;  4DV0 L;  1H95 A;  3HOU G;  4IOA A;  4JC0 A;  3PCO B;  4PMW A;  5JJK A;  1IXR A;  4DR5 L;  2UXC Q;  1G6P A;  4JCV E;  4A3K G;  1QVC A;  4NXM L;  4HJA A;  3J81 j;  4R4Q A;  1K83 H;  3KF8 B;  4LF7 Q;  5LMN Q;  3OTO Q;  2N78 A;  1VQF A;  3GTP H;  4IFD J;  2IHF A;  5M3M H;  2ASB A;  2CFM A;  3K0X A;  3E9H A;  3L7Z C;  2UXD L;  2MNA A;  5FJ8 H;  1E22 A;  4X64 L;  1YHB A;  4H02 A;  4GLV B;  1I50 H;  3G6E A;  4POF A;  2E5L Q;  5GAD C;  1PH3 A;  4B3S L;  3HOV H;  1EYG A;  4WJ3 M;  1HZC A;  4MZ9 A;  4DKA C;  4GKK L;  1Q7Y C;  3I4M G;  4X66 Q;  4YY3 L;  2UXB L;  2IT1 A;  1NE3 A;  3EN2 A;  4JI8 Q;  1QZH A;  2R6G A;  3F2C A;  2KCT A;  4PG3 A;  4PZ7 A;  3DM3 A;  2RF4 A;  3RZD H;  2NN6 I;  2YU9 H;  1X55 A;  1Y1V H;  3UDF A;  1CSQ A;  4IPG A;  4UP8 A;  4P74 A;  1I6H H;  4GLX A;  4A3B H;  2UUA Q;  4X65 L;  2OTL A;  4JYA L;  2PMZ E;  4O0A A;  1VQ7 A;  4BA2 I;  1C0A A;  2IHE A;  1HR0 L;  5C4J H;  2A1A A;  3M7N A;  1E1O A;  1EWI A;  4JI2 Q;  4YWM A;  1HJP A;  4LNQ A;  3GDE A;  5JEA G;  5FLM G;  4KI0 A;  1WYD A;  4A3I H;  2HHH Q;  2MO0 A;  4NPS A;  4YHH L;  3T1Y Q;  1TWG H;  3DLL A;  2K5H A;  5IP7 H;  5LMN W;  4A3E H;  3JAM i;  3KJP A;  4DR2 L;  3CC2 A;  2IX1 A;  3H0G H;  1D7Q A;  1E7Z A;  4C3J H;  1N32 L;  3WWV A;  2F3I A;  4JBJ A;  3CCJ A;  3J80 c;  4JI6 L;  1VQL A;  1X54 A;  3PUY A;  5JJL A;  4DR4 Q;  2R92 G;  3STB C;  3CCM A;  1Q12 A;  2CKZ B;  2VNU D;  3HKS A;  4A3G G;  2NN6 G;  2ZTD A;  4OO1 I;  2V1C C;  4AYB E;  4DUZ L;  4LUV A;  1FL0 A;  1W3S A;  1Y14 B;  2D62 A;  5M3F G;  2D0O A;  3FKI G;  1U5K A;  4A3J H;  4JI0 Q;  3AQQ A;  5M5X H;  1PVO A;  1E3P A;  1G29 1;  1SE8 A;  1RL2 A;  1L0W A;  1G51 A;  1VQH A;  1JJ2 A;  2VUM H;  3HOY G;  5IE8 A;  1CKN A;  1PH5 A;  2WB1 E;  1OXX K;  3CAM A;  4YCV A;  5C3E G;  2N49 A;  4JBK A;  2KHJ A;  3S15 H;  1UEB A;  2N3S A;  1YNX A;  4B3R Q;  3J81 i;  3I55 A;  4DV5 Q;  1PH8 A;  3PGZ A;  3CCE A;  4OWT B;  2LSS A;  3KDF B;  3RN5 A;  4A93 H;  3PSI A;  3CPW A;  1HH2 P;  1I94 L;  4LFB L;  4LUO A;  2Z6K A;  1XMO L;  3E9I A;  2WAQ E;  4LF4 Q;  3U58 A;  2Z0S A;  3FHW A;  4IPC A;  4MNO A;  1Q1B A;  2UU9 Q;  2GN5 A;  4IJL A;  1HNX L;  2GVB A;  3KFU A;  4BBS G;  1A0I A;  4AQY L;  4EX5 A;  2ZTC A;  1NJI C;  1L1O C;  2B29 A;  3TRZ A;  1NTG A;  2A19 A;  4OO1 G;  3J7Z C;  3S24 A;  5M5Y H;  3FP9 A;  4KLK A;  3U4V A;  1S40 A;  3PUV A;  4LFC Q;  2MO1 A;  4ME3 A;  2QA4 A;  3CW2 C;  1YJN A;  4BY7 H;  1VQD A;  4A3F H;  3BZC A;  1IBL L;  1TWH H;  4OX9 Q;  4Y7N H;  1HNW L;  2OCE A;  4GOP C;  4B3M L;  4JI5 Q;  3GTK H;  1TXY A;  1VQJ A;  2WP8 J;  2R7Z H;  5IYB G;  2UUC L;  2RCN A;  3PF4 A;  2D0P A;  2JA5 H;  1VQ6 A;  2K14 A;  3A5Z B;  4MTN A;  2NVY H;  4DAM A;  3E0E A;  4DR3 Q;  3PUZ A;  3M4O H;  4A3L G;  1K73 C;  1HNZ L;  3I4N G;  1PA6 A;  2RHS B;  5C44 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...