1I5FA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
molecule keywords COLD-SHOCK PROTEIN CSPB
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i5fA00
1MJEA 3K80C 4LFCL 2WB1G 4AQYQ 1YJ9A 1MJCA 2GVBA 1A62A 1WCMG 4DUYL 4DV3L 4B3MQ 3S16H 1KHIA 4A3DG 1KXLA 3G6EA 1PH3A 4EX5A 1YIJA 1CKMA 1N33Q 2AMCB 1VQ6A 1VQLA 1Q82C 2ALYB 2K75A 4B3TL 1N34L 3BU2A 4IOCA 2Y0SG 2CFMA 1EWIA 4A3IG 4A3FG 2F3IA 4C2MH 4DR4Q 3S2DH 2AWNA 2HIVA 3ICEA 1AE2A 2JEAI 4JI5Q 2VY3A 2JA7G 2QGQA 5C4XG 1HNXQ 4KHPL 2V1CC 2NVQH 4A3CH 4BXXG 2OTJA 4C3HH 4DV7Q 3HOVG 5GROA 4POFA 2KCTA 5IYCG 1TXYA 4IPGA 4OXPA 2ZM6L 2UU9L 5H1SE 3DM3A 3RLFA 3PF5A 2K50A 1I50H 4LW1A 4NB3A 1FJGL 4JI2Q 1N36Q 3PUXA 4P73A 1K8GA 4LF8Q 3L0OA 4IFDI 3T1YL 4GKJL 4P71A 5IYDH 1FGUA 3CPFA 2UUBL 1K73C 3RLOA 2F52A 1D7QA 4A3GH 1L1OB 3S1MH 3GTMH 2R93G 1SLJA 1VQ8A 4X66L 1X56A 4JC0A 4PZ7A 4JYAQ 1K0RA 3FKIH 3H0GG 3PUYA 1E3PA 3RN5A 3RN2A 4NXNL 4QGUA 1A0IA 4UPAA 5ELNA 3HFZB 3I4OA 4AH6A 2UUAL 4LF4Q 3I7FA 3OYYA 1HR0L 2JA8G 1EUJA 4DV6Q 1TWGH 4A4IA 1BBUA 1X3EA 5IYDG 3A74A 1PHJA 1KQSA 1X65A 5ELOA 4DV5Q 2OWOA 1OXXK 1TWFH 3HOWG 2Z0SA 2JJQA 2OCEA 1HNZQ 3UDGA 3ERSX 4JBJA 5IYBG 4DAMA 1OXTA 3F1ZA 4NXMQ 4NXML 5AJ3Q 1G51A 4BBRG 2A19A 1T9HA 1G6PA 4LF6L 3HKZE 5M5WH 1FJGQ 2UUCQ 3HKSA 4X64L 1WFQA 1PH8A 3CCLA 3J81c 5LMNL 3KDFB 3NELA 1PA6A 1JJGA 1XNRQ 3KLWA 1FL0A 1HH2P 1PYBA 5JEAG 3T1HL 3GTQH 2GVAA 1E1TA 1UE5A 4KLKA 2E2HH 1EIYB 4JI3Q 1YHAA 3I4NH 4XTCS 1VCIA 2VQEQ 3CC7A 2ZJRA 1VQFA 4OWXB 4A3LG 3ER0A 2VNUD 2OQ0A 3E9HA 1LTLA 1Y1VH 3HKZG 4YWMA 1VQOA 4JI4L 2YTYA 1WCMH 5FLMH 1KRSA 3W5OA 1YITA 4DV0L 2VL6A 3AFQA 2VUMH 4DNIA 4JOIA 4LF7L 1WI5A 1SRUA 2ASBA 4J15A 1E24A 4JBWA 4L5TA 4IPDA 1YJWA 4TVAB 3K81C 1V9PA 4GLAC 2I0QA 4H02A 3HOYG 5FLXc 2EXDA 2JA8H 1PH9A 1UWVA 1JE5A 1UE7A 1YBYA 3UDFA 3Q8DA 5IWAQ 4X62Q 5FLMG 3DLLA 1IBLQ 1VQJA 1VQ7A 1O7IA 4DAYB 3GO5A 4RG1A 1YZ6A 3A5ZB 4DV1L 4LF8L 3AQQA 4YHHL 3CCMA 1NTGA 2H5XA 2B3GA 4X62L 4X64Q 2WFWA 4XIGS 2JA6H 2ZTCA 2EQSA 3WWVA 5IE8A 4POGA 4YY3L 2BA1A 1Q86C 3AEVA 1QUQA 1X3FA 2YTXA 2R7ZG 1GVPA 3GTOH 3T1HQ 2RCNA 4K0KQ 1VQNA 1JB7A 1HZ9A 2PI2A 4DR3Q 1VQEA 4A3MH 1XMQQ 1XPUA 3HOUH 3S1QH 4PZ8A 3KJPA 2Q2HA 4A3EH 1N8RC 2MO1A 3M4QA 4UP9A 4A3BG 1GO3E 3H15A 3EIVA 1KC8C 4JI4Q 1VQ5A 3PCOB 3CCEA 4A3LH 3I56A 1IBML 1PH6A 5BR8Q 5M3MG 1Q81C 4R4TA 2R7DA 1K3RA 4JI8Q 1SMXA 5GQOA 1I94Q 2NN6I 1I94L 2JA5H 1FVIA 1YHBA 1TWAH 3EBEA 4DV7L 1S40A 3PV0A 2R92H 1V1QA 4GLVB 4HJ9A 1NMGA 3NEMA 1HR0W 1CKNA 1Q46A 4JG2A 3GTKH 4QQBX 1KD1C 4JCVE 4OO1I 2HT1A 3NENA 3ULPA 1B8AA 3PF4A 4AYBG 2UXCL 4KHZA 3TEHB 4LF9Q 3H3VI 1E7ZA 4L5RC 4GKKL 3CP0A 2CWAA 3BZKA 4X66Q 1EYGA 4JYAL 5IYCH 2KBNA 4KHPQ 5IP9H 3JAMc 3J7A5 2YV5A 2JA6G 4GN5A 2UXBL 4B3RQ 1E1OA 1VQDA 5LMUQ 1YJNA 1HR0Q 3KOJA 5J3BA 4IPCA 1VQPA 2K52A 2F4VQ 3M4OH 3CCQA 4NXNQ 3PO3H 2E5LQ 2I5HA 2Q2IA 2XGTA 2NVTH 1RL2A 2HHHL 2IX0A 2N3SA 4OWTB 4A3KH 3M3YH 2IT1A 2CWPA 3FKIG 4A3IH 3G71A 1NJIC 2IHFA 1VS0A 3E0EA 3RLNA 3CCVA 3S15H 4GNXB 1JJ2A 2E5LL 2HIXA 5IWAL 4IJHA 2B63H 3GTJH 2BH2A 2Z6KA 1XPRA 1OXVA 4BY1H 2K4KA 3K7AH 4DR1Q 1JMCA 4IO9A 2VUMG 3HOVH 3GD7A 4YCWA 1W2BA 4YHHQ 4A3MG 2UUCL 3PUVA 3KDFA 4LF6Q 1SR3A 2PNHA 3JC66 3S14H 4WJ4A 1Q1BA 2VQEL 4L5QA 2K5NA 5HY6A 1KRTA 4LWCA 2D62A 2AWOA 2ZJQA 2JK8A 3L7ZC 4DPGA 4A3FH 1EFWA 4R4OA 4C3JH 1PVOA 1DGSA 4DK6C 1HZBA 2VQFQ 5EAYA 4JI1Q 3I4MG 4DR7Q 4DR5Q 3UE1A 3S24A 3GDEA 3HOUG 4BY7H 4DUZL 1Y1WH 4LFAQ 4DV0Q 1PH5A 1IL2A 2MFIA 1IZ6A 1OXSC 5IP7G 3I2ZA 1KAWA 4B3SQ 3KF6A 1CSQA 1CSPA 4LF9L 1J5EL 1BVSA 2UXDQ 1KL9A 1N9WA 5C3EH 2VW9A 4DV6L 4OO1G 4R4QA 4LFAL 1I6HH 3K8AA 4P72A 1VQHA 2KCMA 2F4VL 3CPWA 4A76A 4LUZA 3UDIA 2UXCQ 4ALPA 2OTLA 4IOAA 1X55A 2MO0A 1PFSA 4UP8A 4A3GG 2K5HA 3UE0A 5M3FG 3U58A 1TWCH 1G291 2LSSA 3RZDH 3H3VH 3U4VA 5C44G 4JBMA 1VQAA 5IY0A 3J81i 4HJAA 1HZCA 4LF5Q 3U4ZA 3LGJA 3TS0A 1M90C 2KHJA 3F8TA 1TWHH 2R7ZH 1XMQL 4DR1L 1X3GA 1V43A 2LXJA 2Q2UA 2UU9Q 1CKOA 2NZHA 1HNWQ 1WYDA 1BBWA 4KI0A 1PH1A 1L1OC 4ME3A 4AIMA 4HIDA 4O2DA 1P8LA 4WJ3M 1NMFA 4LF7Q 4EQ5A 2Y0SE 2LXKA 1HNXL 3CW2C 4IJLA 4TQUS 1VQ4A 4JI1L 3RNUA 2AHOB 2UXDL 3GTPH 1GM5A 1N32L 1A63A 3CXCA 4JI7Q 4A3BH 4JI5L 1WJJA 1MKHA 1GD7A 4MNOA 2D0OA 4R1JA 4R4IA 3KJOA 5JJLA 4MTNA 3UDXA 3HOZG 3OW2A 4A93G 2IY5B 1PH7A 3J7ZC 3K0XA 4C3IH 2N49A 2ZJPA 1BKBA 1CUKA 1UE1A 4GOPA 1U5KA 1UEBA 3RR5A 1U0LA 4X6AH 1A8VA 2E2JH 5DLQE 3U50C 3IRBA 3TREA 4GNXC 3F2CA 4UY8C 4JI6Q 4BBSH 3TRZA 1Y1VG 1WOCA 1SFOH 1L1OA 3CAMA 3MEFA 1Y14B 1S3OA 2PI2E 2YTVA 4OX9Q 2HHHQ 1PH4A 3TS2A 2DUDA 2ES2A 1VQGA 3W1BA 4LF4L 2KHIA 4APVA 4JV5L 1IBMQ 5C0XI 2YU9H 4MZ9A 3CC2A 4DV2Q 1SE8A 4YCUA 3W1GA 5C3EG 4BA2I 2I5MX 1XJVA 1ASZA 1JT8A 1HNZL 4P75A 3GTGH 5E7NA 4GNXA 1Z9FA 1X6OA 3CCSA 4L5SA 4A3JG 4IPHA 1LUZA 5C4JH 5IYBH 4DV2L 4YCVA 4JI3L 1QVGA 4JI7L 1LM0A 4UP7A 4GOPC 3I4MH 2NVYH 3BJUA 1XMOL 5M5YH 2JA7H 2N8NA 1EQRA 2R7FA 5FJ8H 3ZJYC 2MQHA 4NPSA 3CF5A 3CCRA 4DV4Q 2Q2TA 2RHQB 5C0XJ 4DR3L 5IT9c 4HJ7A 4LNQA 5GADC 3S2HH 3KF8B 3JAMi 3FHWA 2WAQE 3PIPA 1QVFA 2ZM6Q 3K7UC 3M4PA 3S17H 3MXNB 3ULJA 3CMEA 2ZTDA 4A3EG 4DR4L 3CCUA 4O0AA 3STBD 5IP9G 5BR8L 3M9BA 1R9TH 1H95A 1B7YB 1ASYA 2JQOA 4A3DH 2VQFL 1IBLL 4QIWE 3SGIA 3M7NA 2UUAQ 4BY1G 1XTDA 1IYJB 1VQCA 3KF6B 4JI2L 3HOXH 3PUZA 4DK3C 5M3FH 4JI6L 1M1KC 4A3KG 5C44H 2HQLA 4X65L 4BY7G 4X65Q 3I4NG 4YY3Q 2A1AA 1HJPA 4BBSG 2C35B 4OWWB 4JV5Q 5JEAJ 3T1YQ 4DR2Q 1VQMA 3PO2H 1VQKA 4A75A 1B70B 4HJ8A 4OX9L 1HZAA 1VQ9A 1KIXA 1HNWL 3VDYA 1NE3A 3CC4A 2VS1A 1PV4A 3PUWA 5AJ3L 4AQYL 4DR6L 1QUQB 1XNQQ 2IHEA 2ZTEA 3GTLH 4JI8L 4B3ML 3F2DA 3BZCA 2VZAA 5GAGC 1E22A 3D0FA 5C4XH 4DR5L 2CKZB 4LF5L 1XNRL 2CQOA 3A5UA 1J6QA 4BXXH 4HJ5A 4P74A 3CQZH 4DKAC 4JOIC 1XNQL 4B3TQ 1JJCB 1OXUA 5FJ8G 1CKNB 1X9NA 2PMZE 1P16A 3PSIA 2JA5G 1AE3A 1N32Q 3PO3G 1Z47A 2NZOA 1Q8KA 4YWKA 5JJKA 4FDBA 1LYLA 4A3JH 3TQYA 1XMOQ 3I55A 2JEBI 4GOPB 1IXRA 3KYHC 4LFBQ 2WB1E 1X54A 2ATWA 1PYSB 1I5FA 2RF4A 3ULLA 1N36L 3HOYH 1YI2A 2ID0A 3HOZH 4LUVA 4A93H 1SROA 4A3CG 1K9MC 3PO2G 2FXQA 4LUOA 5IP7H 1VQIA 1L2FA 3CMAA 4PG3A 4PMWA 1I3QH 5JJIA 1S72A 1GKHA 4DR6Q 3PGZA 4JI0Q 4HIMA 3E9IA 2KENA 1J5EQ 1RIPA 1PH2A 5M5XH 5M3MH 1NBWA 2RHSB 4RMFA 1AH9A 2B29A 2E8GA 3OTOL 4DR2L 3M85A 1Q7YC 4JI0L 3AFPA 4BBRH 3HOXG 1N34Q 1IBKQ 1YEZA 3STBC 1Y1WG 2QEXA 4DV1Q 1N33L 3OTOQ 4LFCQ 4YWLA 4GN3B 1EIFA 2JA9A 2I5LX 5HGQA 5GAEC 3A0JA 4K0KL 4GN4B 4DUYQ 4DV3Q 1IBKL 2A8VA 4QY7A 3HOWH 4Y52H 2K5VA 2K14A 3J80i 4R4CA 4Y7NH 3G48A 1L0WA 1UE6A 2PQAA 2XTIA 4GKKQ 3G4SA 2N78A 4DUZQ 1EOVA 2AKWB 3S1RH 1K8AC 1OTCA 2NVXH 4GKJQ 2PQAB 1QZHA 2EIFA 3D31A 5LMNQ 2WP8J 2D0PA 4JBKA 1VQBA 4DR7L 4IFDG 5C0XG 4B3RL 2L15A 3H0GH 4LFBL 4DV4L 5LMUL 1SN8A 4QL5A 4HIKA 3J80c 2JE6I 1W3SA 2NN6G 4B3SL 1YHQA 3B6YA 2E2IH 4PZ6A 3CD6A 2WAQG 3RZOH 1YVCA 3CCJA 1C9OA 2BH8A 5K36G 5GAHC 3AYHB 2BA0A 3J81j 2B63G 3NBHB 1Q1EA 1C0AA 4DV5L 1Q12A 4GS3A 4QJFA 4AYBE 5LMNW 3S1NH 1QVCA 2R6GA 2GN5A 2UXBQ 4HIOA 2R92G 4IFDJ 3KFUA 4BA1I 1QZGA 2IX1A 4OONA 2DGYA 2OQKA 1XPOA 1D8LA 2YYZA 1C7YA 1MIUA 2CCZA 1EQQA 3PIOA 4GLXA 1YNXA 3L2PA 3F2BA 2UUBQ 2R93H 1K83H 2Z6KC 1NY4A 2QA4A 3FP9A 2MNAA 3EN2A
chains in the Genus database with same CATH superfamily
4Z9CB 1MJEA 3K80C 3Q23A 4LAAA 3V05A 1KXLA 2BDNA 3BVGA 5ELBA 1B3QA 5KNDA 2K75A 4B3TL 3R3OA 4A3JB 3L3OC 4DR4Q 3S2DH 2AWNA 2JA7G 5C4XG 4A3CH 5I9OA 4FO2A 4C3HH 2OTJA 1Q8IA 4EQOA 4POFA 2ZM6L 2RSOA 4OXPA 2UU9L 1FJGL 3DM3A 4B9XA 4NB3A 1HA5A 3PUXA 5C4HA 3D4WA 3L0OA 4IFDI 1ZEQX 1G2TA 1K73C 3S1MH 1SLJA 1JWSD 1SYCA 4QGUA 4UPAA 1TWCB 4LF4Q 1HR0L 3I90A 1BNZA 1X3EA 2F0PA 2I07B 3A74A 1KQSA 3K57A 2OWOA 1EU4A 2WIIB 1QB5D 1PYWD 2JJQA 4UHVA 3UDGA 1D5MC 1SE2A 2NN6H 4OHJA 4JBJA 5IYBG 1OXTA 4NXML 4RH6A 4BBRG 5M5WB 5IGCA 1G6PA 3HKZE 1CQVA 1F9RA 4QUCA 3KLWA 1FL0A 1HH2P 1PZKD 3T1HL 5M3FB 2LMCB 1EY6A 3HOXB 4K6DA 4XTCS 2ZJRA 2VNUD 1CHQD 1SNQA 1Y1VH 1TT2A 5FLMH 1WCMH 4CDCC 2VL6A 3U9SA 4HSVA 5CV9A 4DNIA 3CKIB 1RF2D 4J15A 4KD3A 4IZ8A 4JBWA 4TVAB 4GLAC 2I0QA 4H02A 2EXDA 2KOLA 4OELB 4A3KB 2JA8H 1JE5A 1YBYA 4KJOA 3UDFA 4HR7B 1IBLQ 1O7IA 3NBHA 4KK7A 3GO5A 4OIKA 2ZTCA 3WWVA 5IE8A 2MJ8A 2BA1A 1Q86C 4GZYC 1QUQA 1SMYD 1X3FA 2YTXA 1ENFA 2O2LD 3A55A 1HZ9A 3S1QH 1VQEA 2DNEA 2H4OA 5D14A 4A3EH 2FMCA 1W6JA 4A3BG 2SNMA 1KC8C 3ITPA 5CBEE 3CCEA 2VXWA 2Z4IA 4L6TB 3HZXA 4HMJA 3MFGA 1NR2A 4JI8Q 2K6AA 1SMXA 4Y7NB 1DYQA 4DV7L 5LL6S 3SVMA 5D3IB 3PV0A 1ICWA 1TKWB 2QKIC 1NMGA 3NEMA 1DZ1A 4OO1I 2UXCL 1MGSA 1RTOA 4L5RC 1B9MA 3P1HA 4RKBA 5IIFA 1H9SA 4X66Q 4JYAL 2YV5A 3VR2A 4GN5A 2ZXOA 1E1OA 4FP5D 3SK5A 5LMUQ 1YJNA 3OPOA 4PNYA 2KEEA 2XIWA 3KOJA 5J3BA 3NSWA 5T1IA 5FOBB 2JA7B 3M4OH 2BOSA 3CCQA 4M1UB 1EIHA 2Q2IA 2N3SA 5FO8B 2IHFA 1VS0A 2X6GA 3GTLB 4RGMA 3S15H 4GNXB 2CVRA 1KTKA 4IJHA 1IW7C 1LT4D 2Z6KA 1XPRA 1JMCA 3T4AC 2VUMG 2R93B 3BDCA 4IUVA 1W2BA 2FJ2A 1BUVT 2E2DC 2UUCL 4LF6Q 3JC66 4KV6A 1GUNA 3GTQB 2ZXPA 3G7LA 4LWCA 1WCMB 2D62A 3VYUA 4R4OA 2Z9HA 1PVOA 4RGTA 5LL6X 1HUNA 2K28A 3N6RA 4DUZL 1Y1WH 4KKUA 3NWSA 3IFDA 4DAPA 5IP7G 1HTPA 1KAWA 4FXKC 2M2LA 1LACA 2KCNA 3HS0C 2UXDQ 4C3HG 2VW9A 2E75C 3H91A 3K8AA 4RCOA 2KCMA 4DAYA 1A6XA 4LUZA 3UDIA 5M9OA 2UXCQ 5E4WC 1EQVA 4HEDA 3BZDB 2OF1A 4FXDA 1PMRA 5M3FG 1TWCH 1G291 3VR6A 1XTCD 2M00A 5C44G 1VQAA 5IY0A 4LF5Q 4KKTA 2RVLA 3ERQA 4FXGC 1STNA 2KVMA 2EYFA 2KHJA 1B3AA 1IL8A 2R7ZH 1HNWQ 2F0SA 2RKSA 1WYDA 3HOYB 1IYUA 2K5QA 1TWAB 4EVOA 4HIDA 1NMFA 1C8CA 1YNND 3GV3A 1JB3A 1VQ4A 3I91A 5C4XB 3GTPH 1GM5A 1LO5D 2A5HA 4JI5L 1LTGD 1ESFA 2Q8RE 5JJLA 3A8JE 4A93G 2IY5B 1CHPD 4CJ0B 5LHY1 3QJYA 1PH7A 3K0XA 2N49A 4K8IA 3TMEA 2ZJPA 1BKBA 2WKDA 4X6AH 3RR5A 3M3YB 2E2JH 4J8QA 5DLQE 3TREA 4GNXC 3F2CA 3TRZA 1CFMA 1SFOH 1L1OA 2EJGC 5DM63 1Y14B 2YTVA 4OX9Q 2DUDA 3HGBA 3W1BA 1X32A 4JV5L 2JYOA 3K5LA 5C0XI 4DFAA 4DV2Q 1SE8A 3N52A 2WAQB 2I5MX 5KEEA 3GTGH 4P75A 4XXEA 2Y0SB 1LUZA 1Z7TA 4JI7L 2EY1A 4JI3L 4UP7A 2TMPA 2F0JA 1AFPA 2Z1CA 1ENAA 3CF5A 2Q2TA 3J80L 3S2HH 2MP1A 2OEOA 2FFKB 3NXWA 3R2TA 5A2QL 3CCUA 5IP9G 2ZT9C 1H95A 1B7YB 3I70A 1RHPA 1K83B 2JQOA 3D8GA 2VQFL 2EZVA 1NSNS 3H0GB 2UUAQ 1X3PA 3MFYA 1XTDA 1VQCA 3I4NB 4JI6L 2F0GA 2L12A 3RZOB 1PTOH 4KY5A 4BY7G 4EQPA 3EROA 4QMGA 2A1AA 1HJPA 1G6ZA 3H09A 4JV5Q 5J39A 4G7ZC 3EJIA 5FK9C 3PO2H 1DM0B 4A75A 4K2KA 3A7AB 4OX9L 2DJGC 1SFOB 1NE3A 4DR6L 3GTLH 3S15B 4JI8L 2VZAA 2E76C 4LF5L 1J6QA 1EWHA 1GHKA 1LT5D 1RODA 4OEMB 1FNWA 1DD2A 1P16A 2B2VA 3D6WA 3V96A 1FNVA 3PSIA 1AE3A 1Q8KA 4A3MB 4JW0A 3DUZA 1LYLA 5CV7A 5JPNC 2JEBI 1IXRA 2HCIA 2PZWA 5K5PA 2RF4A 1T5EA 1SE4A 3HOYH 2MGSA 4A3CG 4FF3A 4LUOA 1L2FA 3C3LA 4LK1C 1SDFA 4F8MA 3FVQA 4JI0Q 1EYCA 3E9IA 4XQJA 2KENA 4A3BB 1RIPA 3OOCA 5D65A 1U4MA 5M3MH 1AH9A 4ME5A 2K32A 3M85A 4JI0L 3HOXG 1WTVA 1IBKQ 3VR3A 3MTSA 5M5YB 3STBC 1Y1WG 1N33L 3OTOQ 5GAEC 4C2MB 1O7ZA 3NP8A 4JK1C 1FNUA 3I3CA 1NUCA 2A68C 2EYJA 4R4CA 1UE6A 2XRQD 3HRZC 3G4SA 1SNCA 1EOVA 4DUZQ 4E6IA 2NVXH 5I6YA 3D31A 2D0PA 4B3RL 3AB9A 4IUQA 5LMUL 1SN8A 2B2UC 3AMUA 4HIKA 3RZOH 5JJZA 1C9OA 1I6VC 2BH8A 3DM1A 5GAHC 2B63G 3NBHB 1LT3D 1Q1EA 3S1NH 2VUMB 2R6GA 3I4LA 2L5TA 2R92G 1K8MA 4OONA 1XPOA 1D8LA 2DNCA 3NTHA 1BQQT 1EU3A 3R8BA 1VMPA 2UUBQ 1YNXA 3I73A 5IT9L 1GUWA 1KDBA 2QCPX 1BDOA 3EN2A 2L1BA 2R3ZA 3IL8A 5CMDA 3G6JB 1PRTD 4EGVA 3S16H 2JA6B 4AYBB 1KHIA 5EKIA 1T5XD 3G6EA 1YNJC 4EX5A 1CKMA 1N33Q 3S1QB 2AMCB 4ZUJA 4C3JG 4Q5VA 1VQLA 2DY7A 4C1NK 5EPKA 1I4XA 3BU2A 1EWIA 4A3FG 1QWYA 2F3IA 4V0BA 4JI5Q 1HNXQ 2V1CC 4DV7Q 3HOVG 2KCTA 4K14A 4IPGA 3RLFA 3PF5A 2K50A 4LW1A 2HDLA 3I72A 3PQIA 2M9VA 1N36Q 1SNDA 2A6HC 1ESRA 4P71A 3NWTA 2R93G 3NK9A 4X66L 1X56A 4JC0A 4PZ7A 1VF7A 4JYAQ 1IYVA 1PTOB 1Y1VB 1A0IA 4M8AA 5ELNA 3HFZB 1Y8PB 2HUGA 1ZXTA 1HPCA 1KABA 4AH6A 1STEA 2UUAL 2JA8G 3HOUB 4A4IA 5IYDG 2NVTB 4DV5Q 1ML0D 1OXXK 1TWFH 2WINB 1HNZQ 4BY7B 1G51A 1LV9A 4LF6L 5M5WH 5IGBA 1WFQA 1CA6A 3J81c 5LMNL 1JJGA 2RDHA 5EPLA 1STYA 1PA6A 1XNRQ 4K2LA 5JEAG 1I4HA 2F0MA 1YHAA 3I4NH 2VQEQ 5M3MB 3KLRA 1VQFA 3ER0A 3HKZG 3R2IA 3KF8A 2VB2X 3QB3A 2B2UA 1WI5A 1SJHD 3ND8A 1SRUA 2ASBA 1DXMA 4L5TA 4IPDA 3T16A 1YJWA 3H3VC 4X3KA 5FLXc 4IUNA 4U673 4X62Q 3Q8DA 4NKLA 3BYTB 5FLMG 1HCZA 5FO9B 2PPBC 3P75A 1YZ6A 3PMFA 1O80A 2IPKD 2H5XA 2B3GA 4X62L 4X64Q 2WFWA 2JA6H 2EQSA 4C56C 4ZYSA 3GTGB 4NP5A 3LWEA 3TP8A 4LMQD 3T1HQ 4G4KA 1JB7A 2A6ED 2PO4A 3NQTA 3KJPA 1N8RC 1B9NA 4UP9A 3H15A 4JI4Q 2NWGA 1VQ5A 3PCOB 3I56A 2IW3A 1I94Q 1FVIA 1TWAH 3EBEA 4F88A 5J22A 1S40A 4HJ9A 1HR0W 1W6KA 1UNSA 3S1RB 1F2ZA 3ULPA 3PF4A 4AYBG 1SNMA 4LF9Q 3H3VI 2EYMA 3CQZB 1QILA 2QDLA 1DJRD 4GKKL 2CWAA 1EYGA 1STBA 2KBNA 5IP9H 5G3LD 1CI3M 1SXTA 3C1EA 4A3FB 2UXBL 4B3RQ 1BCPC 2EPBA 5IGGA 4ODGA 3BVZA 3PIO3 4NXNQ 3PO3H 2I5HA 2N88A 1ZKOA 4OWTB 2IT1A 2CWPA 3FKIG 2F0KA 2WACA 2MPMA 2QILA 3MXGA 3RLNA 2HIXA 1OXVA 1C4QA 4DR1Q 4J6HA 3HOVH 3GD7A 2EOTA 2F0WA 4YCWA 2L55A 4A3MG 3PUVA 4WJ4A 5ISRA 4U68A 5CBAE 2AWOA 2ZJQA 4HN7A 4DPGA 1TWGB 1IW7D 5KYIA 1ILPA 4C3JH 4F7XA 2VQFQ 4DR7Q 3ONAB 1LTRD 4ZRZA 2F0IA 4BY7H 1PH5A 1PFNA 4DV0Q 1LTBD 2MFIA 2O5JC 4C3HB 1CSQA 4LF9L 1DOKA 4ZAIA 1RCVD 4X3TA 2Q8TA 1N9WA 5C3EH 4OO1G 1EIGA 4R4QA 4QUFA 4TKOB 4CJ1B 4P72A 1VQHA 3K5MA 3K7AB 3CPWA 4ALPA 4DK1A 3HKZB 1B44D 2F0FA 1ILQA 4UP8A 3T53B 3UE0A 3U58A 5COYA 5EBCA 3RZDH 3H3VH 3J81i 1HZCA 4KD4A 3IAYA 3LNNA 3RMHA 3LGJA 3TS0A 3F8TA 3C46A 3PO2B 4DR1L 2LXJA 1IKMA 3QR8A 1AP0A 1BBWA 4KI0A 1L1OC 3MVVA 4ME3A 4MTKA 4AIMA 4WJ3M 1P8LA 1R9TB 1HNXL 4OL7A 2A69C 2LXKA 3CW2C 4IJLA 3OIPA 4IUPA 5C3XA 2A6EC 3OMGA 1K0SA 1TS3A 3VR4A 3UI2A 1WD0A 3P7JA 2UXDL 2EE1A 2HDMA 1SYFA 4TRDA 1AEXA 1EZ8A 4A3BH 1WJJA 4QIWB 5K36H 3VA5A 3UDXA 4C3IH 2F0DA 1CUKA 1U5KA 1UEBA 5IODA 4DF7A 1Z6HA 1EY4A 1KNEA 2X6LA 4UY8C 4JI6Q 4PMBA 1MI2A 1Y1VG 1WOCA 3S9WA 3CAMA 2PI2E 1PH4A 2ES2A 1VQGA 1H9JA 2EJMA 1JWUD 2KHIA 3HEJA 2YU9H 1PRTF 3CC2A 2F0EA 2EY2A 4BA2I 1ASZA 4GNXA 3K5OA 1Z9FA 2NBFA 5E4XA 4DV2L 1XMOL 2EXZA 1TU2B 2IWHA 4NPSA 2WV6D 1CTMA 2PZTA 1G8ZD 4DR3L 5GADC 3KF8B 4CDEC 3FHWA 3J7AF 1MSHA 2JSOA 2R92B 4WFN3 2ZM6Q 4DR4L 2KJXA 1SYEA 3SHLA 1ASYA 4A3DH 1EZ6A 1IBLL 2YU9B 3M7NA 1IYJB 3KF6B 2MHVA 3HOXH 5M3FH 1IKLA 3KBGA 5C44H 2KEDA 5FKAC 4X65Q 2KECA 4FYDA 1XWEA 2C35B 4OWWB 2O5IC 5JEAJ 5I2YA 1VF5C 4FF2A 3S2HB 4HJ8A 2FMMA 2LS01 4K5WA 3CC4A 2VS1A 3GTJB 1E2WA 1BCPF 2ZTEA 1I6HB 5JAVA 1PFMA 1SAPA 1Y8OB 3E0JA 4BXXH 4P74A 3CQZH 1CZWA 4B3TQ 3TSSA 5FJ8G 1X9NA 2Z4HA 1D2BA 1VDZA 2JA5G 3QWNA 5ELEA 2K05A 3PO3G 2NZOA 4XQNA 3TQYA 1XMOQ 4MHEA 5DEHA 2WB1E 1X54A 4HMIA 1RD9D 5EKLA 1WTXA 1I5FA 2ID0A 2AQ2B 4X3SA 1QOHA 3PO2G 2FXQA 1F2LA 2ICIA 1I50B 4MN3A 3O13A 2EVBA 2QEJC 3RUZA 1S72A 2PCFB 3L9AX 1S5ED 2GA4B 3H6MA 1PH2A 1J5EQ 2F3WA 1NBWA 1LLRD 1LTID 4RMFA 3FRPB 2LY7A 3J80E 2PMZB 2F0OA 4XT3B 4BBRH 4DNRB 1SNPA 3EVQA 1M4VA 4FNFA 2J4XA 3SDZA 4RHRA 2EYLA 2L9HA 1JOOA 1SBBB 5HGQA 5DAUA 4KJNA 2QF7A 5CV8A 4X3UA 1IBKL 3HOWH 4Y52H 1U9RA 2G9HD 2K5VA 1KDAA 1V8QA 3H94A 4Y7NH 1XYIA 4GKKQ 2PZUA 1K8AC 2AKWB 2XSCA 4L63B 5L37A 3FMCA 2PQAB 1MD2D 3DWQA 2WP8J 3TN2A 4JBKA 1VQBA 2B8FA 1EQTA 2SOBA 3H0GH 4QL5A 1S5BD 3J80c 2JE6I 2NN6G 4G57A 3CD6A 1Y8NB 1PRTB 2WAQG 1EEFD 1F9SA 3KLSX 4XYOA 4DXFA 5BN3A 1HQRD 1YVCA 2VB3X 2OXPA 5K36G 1ONLA 2J0TD 1TS5A 1C0AA 1B53A 4QJFA 4AYBE 1QVCA 4HIOA 3KFUA 5A2QE 2OQKA 1DOMA 1C7YA 2RDGA 2RQXA 1MIUA 4CKEA 1F2MA 1EQQA 2CCZA 4N9PA 1E2ZA 3F2BA 1WTPA 4I7AA 1TY0A 4BY1B 2MNAA 1L0XB 4LFCL 2WB1G 1YJ9A 3T56B 5KYLA 3MA2B 4B3MQ 1UEAB 3QO2A 4A3DG 1GJXA 4L8JA 1YIJA 1GUOA 1VQ6A 4ULLA 1PTOD 4IOCA 2Y0SG 4IUUA 1TS2A 4C2MH 2E2JB 2HIVA 2R7ZB 4ZK9B 2EDGA 2NVQH 4R8IA 3KUPA 2B63B 2CH4W 4NW2A 5TSSA 1D1IA 3K5NA 1K8GA 1FR3A 4LF8Q 2H1EA 1ICFB 1H9MA 5IYDH 1FGUA 3S16B 1A3TA 3CPFA 1D7QA 2K7VA 1U4LA 3DMUA 3CRLC 1K0RA 4N8X1 1XXGA 1UUPA 1EY8A 3I4MB 3I4OA 1BBXC 2ZXRA 3OYYA 4KY6A 1TWGH 5I9PA 1PHJA 3QG1A 1X65A 5ELCA 5ELOA 1SSOA 3PO3B 3D6CA 2MUYA 4KKSA 1WTOA 5KIXA 4IN3A 2V4DA 4RA8A 4DAMA 1PTOC 4XT1B 3S17B 5AJ3Q 1STGA 2A19A 1T9HA 3HKSA 1PH8A 3CCLA 1CK1A 4CGYB 3KDFB 3MAQA 3DEOA 3DWPA 3GTQH 1U4PA 1E1TA 1UE5A 4KLKA 3I8ZA 3CC7A 4HSPA 4OWXB 4A3LG 1CT1D 3R93A 2OQ0A 3E9HA 1KRSA 1YITA 4DV0L 2BE5C 3AFQA 2VUMH 4LF7L 4HCSA 1E24A 5KNBA 1V9PA 2RDFA 4CDDC 1O78A 3NBIA 1UWVA 1UE7A 3DLLA 1VQ7A 4RG1A 3EFXD 5E3FA 4LF8L 3AQQA 4YHHL 3CCMA 2RCFA 4POGA 3AEVA 2E2IB 3BYYB 1D5XC 4CHTB 2R7ZG 3DHQA 1GVPA 3C1FA 3NHHA 2NVYB 2PI2A 4DR3Q 3QOLA 2B2TC 5KGUA 1XMQQ 1XPUA 4PZ8A 2Q2HA 3FDTA 5C4JB 3EIVA 4MIUA 1KLUD 1IBML 5M3MG 1HFNA 2QW7A 3BVMA 1K3RA 3NUCA 1Y1WB 2NN6I 4ZKBB 1LTTD 3Q0AA 1F9QA 2WKCA 4GLVB 3GTKB 3GTKH 1CKNA 4JG2A 4QQBX 1KD1C 2HT1A 1B8AA 5ELFA 4A3DB 3TEHB 3VYRA 1JQYD 3CP0A 5CYUA 3BZKA 3OWEB 2JA6G 5A35A 1HR0Q 4IFDH 1HA6A 1VQPA 1TWFB 1GHJA 5J1ZA 1QE6A 2E5LQ 2XGTA 2NVTH 1RL2A 2IX0A 4A3KH 3M3YH 1H9RA 1NJIC 3G71A 4FF1A 3HOZB 1Q3LA 2X69A 1S4ZA 3CCVA 1MBYA 1JJ2A 2B63H 2BH2A 3MZ5A 2F1MA 4BY1H 2K4KA 3K7AH 3OSOA 3J7YW 4IURA 5T1GA 2ICEC 2NYZD 1HTLD 5CV4A 2K5NA 2Z6BA 5HY6A 2CHBD 4ZQ3A 1KRTA 2K5DA 1II3A 2JK8A 1XX8A 1DGSA 4DK6C 5I4DA 4C3JB 4DR5Q 4ID6A 3UE1A 3S24A 1ET6A 3HOUG 4LFAQ 2IJ0A 3U9OA 4EQNA 3I2ZA 3MXNA 2PNRC 3KF6A 4B3SQ 1J5EL 2XNAC 1KL9A 4LFAL 1I6HH 3TP6A 3HOVB 2F4VL 1AW7A 1V1PB 4A76A 1TS4A 3NTKA 2OTLA 1FYCA 3TZDA 1V1PA 2MO0A 1PFSA 2K5HA 2F0QA 2LSSA 3U4VA 4JBMA 1PXUA 3A7LA 2F0UA 3U4ZA 3S1NB 1J8IA 3CHBD 1TVXA 2JA8B 4P2CB 4DU9A 1TWHH 1XMQL 3WOEA 1V43A 2Q2UA 1CKOA 2NZHA 1D1KA 3VR5A 1ENCA 2D2CC 2Y0SE 4TQUS 1E0BA 1EEID 2K1BA 2AHOB 5M5XB 1A63A 5AFWA 1MKHA 1GD7A 2BCOA 4MNOA 4R4IA 3FKIB 3KJOA 3GTOB 4MTNA 5JVG3 3IKJA 1KDCA 1UE1A 4GOPA 1AZQA 1A2TA 3URYA 4XDXA 4CJ2C 4ZKCB 4BBSH 4G7HC 5C5LA 3MEFA 3RD4A 2OT2A 4PMCA 1VMCA 3T13A 3K59A 2ENBA 3OW7A 2NVXB 1EY0A 2I46A 4KHVA 1IBMQ 4YCUA 5FLXL 3W1GA 2XVSA 5C3EG 4OO1H 1JT8A 1XJVA 2SEBD 5CR3A 1X6OA 1L0YB 4A3JG 4IPHA 4WJWA 2SNSA 1B50A 5C4JH 5IYBH 4YCVA 5IOCA 1SYDA 3I4MH 1EOTA 2NVYH 3WDNA 5M5YH 4XQQA 3BG3A 3HP3A 3E6ZX 5EPJA 2MQHA 2D5DA 3A54A 4C1NI 2F03A 5C0XJ 5IT9c 4HJ7A 4LNQA 2AUKA 5IGEA 1H9KA 1BOSA 2WAQE 1S5FD 5I2XA 1GUGA 1QVFA 3M4PA 1UAPA 2ZTDA 1TQOA 3SEBA 3SE0A 2LKVA 3M9BA 1R9TH 4WRDA 3OIQA 2EY6A 5NUCA 4QIWE 5DM73 1GXDC 4BY1G 5IGFA 3PUZA 4CBVA 4DK3C 2F4IA 1M1KC 4B9WA 2EJFC 3DXJC 2HQLA 3I4NG 1TIID 4BBSG 2FINB 5CV5A 3T1YQ 4DR2Q 3KK7A 2D9UA 1HZAA 1VQ9A 1KIXA 4ABNA 4B08A 3E3XA 4LJZC 1PV4A 3VYTA 4DA2A 2IHEA 2F0LA 4B3ML 1RTNA 4CDFC 3J81E 2NZ1D 1S5CD 1TY2A 2G9DA 3D4RA 5C4XH 1XNRL 1MHWC 3D3RA 4HJ5A 4JOIC 2AUJD 3GTMB 1OXUA 2K33A 1CKNB 1JR0D 2CQAA 3SK4A 4YWKA 4FDBA 4IUTA 3I55A 3M4OB 4LFBQ 2ATWA 1F9PA 1NR4A 4UDUC 1WTWA 4A93H 1SROA 3EA6A 3SXHA 1K9MC 2F0NA 5IP7H 1VQIA 1B4OA 1G91A 1F77A 1E2VA 4RCNA 4PMWA 1C48A 4DR6Q 4R9WA 4HIMA 3QOJA 1CZGA 1JCKB 2J7ZA 3D4DA 2RHSB 2E8GA 2PYKA 4DR2L 1GUTA 1Q7YC 5C4ZA 4BS9A 1N34Q 1YEZA 1YNNC 2EYHA 1ZYRD 4DV1Q 4NMZA 5C5MA 4LFCQ 4GN3B 1EIFA 2JA9A 2I5LX 4K6LA 3HG9A 2A8VA 4NDXA 4DUYQ 4DV3Q 2JA5B 3Q22A 3P20A 1LT6D 1SEBD 3G48A 3Q6SA 1L0WA 2XTIA 3TP7A 3S1RH 5C3EB 4GKJQ 1QZHA 1RKNA 1O7LA 2EIFA 5LMNQ 3GTPB 4IFDG 5C0XG 2L15A 4LFBL 5CV6A 4DV4L 4OGQC 2JXMB 1QNKA 4FF4A 4DGZA 1W3SA 1YHQA 3B6YA 3DWAA 3F2UA 4HTHA 5KRUA 1Q12A 4GS3A 1PTOF 2GN5A 2UXBQ 1AN8A 3K6OA 4BA1I 1QZGA 2IX1A 2DGYA 2RBMA 4RAUC 2YYZA 4GLXA 3L2PA 3M4YA 3MWYW 4K5VA 4I7ZC 1K83H 2B2WC 2Z6KC 1CQFA 3FP9A 4WORA 4AQYQ 3WOFA 3S1MB 1YNJD 1MJCA 2C5CA 2GVBA 1A62A 1WCMG 4DUYL 4DV3L 1FD7D 1PRTC 5G3LF 1PH3A 1Q82C 2ALYB 4BBRB 1N34L 2N55A 3A56A 1HQMC 2CFMA 1QG7A 2E74C 2Z8LA 4A3IG 3ICEA 2L11A 1AE2A 2JEAI 3S2DB 1D5ZC 1HUMA 1IHZA 2VY3A 2QGQA 2NTTA 4KHPL 4BXXG 3FPPA 1EYDA 5GROA 5IYCG 1TXYA 5H1SE 4QF4A 1I50H 4JI2Q 4P73A 3OWFA 2AQ1B 4H44C 3T1YL 4GKJL 2P5ZX 2UUBL 3RLOA 1CA5A 1WTHA 2F52A 4A3GH 1L1OB 4KMUC 1WTRA 3GTMH 1VQ8A 3FKIH 3H0GG 3PUYA 1E3PA 4YIJA 3RN2A 1KAAA 2DN8A 4NXNL 3T51B 3RN5A 2C9OA 4DK0A 3I7FA 2B2TA 1EUJA 1NCVA 2K01A 4DV6Q 1BBUA 4FVMA 1R4QB 1EY9A 3HOWG 2Z0SA 2OCEA 3E5SA 1GUSA 3ERSX 4NXMQ 3F1ZA 4HCEA 4RWSC 4OIJA 3SR1A 2UUCQ 4X64L 2B2YC 2F0VA 1A3UA 3NELA 1PYBA 2GVAA 4A3GB 4JI3Q 1EIYB 2E2HH 1WTQA 2A69D 1VCIA 2XN9C 1FGBD 4CKCA 5IGDA 1LTLA 4YWMA 4JI4L 1VQOA 2YTYA 3NPPA 3W5OA 1JOKA 4JOIA 2NUCA 3K81C 3HOYG 2HD3A 5HURA 3LWUA 1PH9A 4O42A 5IWAQ 4BBSB 1VQJA 4HAEA 4DAYB 2B2WA 2RSNA 2B2YA 4DV1L 3A5ZB 1J9OA 2XWBB 4UAIA 5EGTA 1NTGA 4XIGS 1I4RA 4YY3L 3OMCA 1Q90A 1PDQA 3DEPA 1PZID 2KQ3A 3GTOH 3MXUA 2RCNA 4K0KQ 1VQNA 4A3MH 3RZDB 2IL8A 3HOUH 2A68D 3J7AV 2MO1A 3M4QA 4A3EB 1GO3E 1ET9A 4A3LH 4IQZA 2K04A 1BF4A 4G7OC 1PH6A 5BR8Q 1Q81C 2L0CA 4R4TA 2R7DA 4BWGB 5GQOA 1I94L 4F87A 2JA5H 1PZJD 1YHBA 3TZUA 2R92H 1V1QA 3MHBA 1Q46A 5CGKA 4JCVE 1PFBA 3NENA 2TSSA 4KHZA 1KNAA 1E7ZA 4ZLTF 4JVZA 5IYCH 3X3NA 4KHPQ 4ILWA 4CKBA 1SE3A 1SYGA 3JAMc 3J7A5 2B2VC 1VQDA 1STHA 1K28A 3X3MA 4C3IB 1X3QA 1A3VA 2KHSA 4IPCA 2K52A 2F4VQ 5JEAH 3NQIA 2HHHL 2K5WA 1JORA 4A3IB 1D6EC 1QCBD 4A3IH 4A93B 1TWHB 3EQLC 3E0EA 2SDFA 1STAA 2BDOA 2E5LL 3QIAA 5IWAL 3GTJH 3FPUB 4K8JA 1QJOA 3TDQA 4IO9A 4YHHQ 2L4NA 3KDFA 1SR3A 2PNHA 1I4GA 3S14H 2E2HB 1Q1BA 1SJED 3JAME 2VQEL 4L5QA 2O4XA 3BDOA 5ELDA 2LFNA 1CM9A 3JAML 3L7ZC 4A3FH 4ZUIA 1EFWA 3NTIA 4XYQA 1HZBA 3BDLA 1M8AA 5EAYA 4JI1Q 3I4MG 3SK8A 3GDEA 4N9TA 1IL2A 1OXSC 1IZ6A 1BCPD 3HOWB 1CSPA 1BVSA 2A74C 2AQ3B 2CH4A 4DV6L 5C3WA 4V190 4JPBW 1DOLA 4IOAA 1X55A 1BO0A 3MEHA 5EQ0A 5C6AA 3K58A 2KA7A 4A3GG 4KTAA 3K0YA 5I6WA 1QNUA 4HJAA 1HFGA 1M90C 5IT9E 4KY7A 1JE4A 1X3GA 2EY5A 1PH1A 3GV6A 4O2DA 4LF7Q 4EQ5A 4TSSA 3PIP3 2HCCA 4JI1L 4DAVA 3RNUA 1WVLA 1V1OA 1N32L 1HXYD 5HGTA 3CXCA 4JI7Q 3BS1A 2D0OA 4R1JA 1LTAD 3HOZG 3OW2A 4QCLA 5EBDA 1B2TA 3J7ZC 1B1ZA 1U0LA 1A8VA 1EY5A 3U50C 3IRBA 3MC0B 1JC7A 3NE5B 2RA4A 3V2TA 1RDPD 2NVQB 1DONA 3AU7A 4PV1C 1S3OA 2BE5D 1I4PA 1K3BC 3CRKC 2HHHQ 3TS2A 4LF4L 2NB0A 4APVA 4MZ9A 1BCPB 2XWJB 4RHSA 1RJTA 2A73B 1HNZL 1JOQA 2A6HD 3ND9A 5E7NA 2NTSA 3CCSA 4L5SA 2F3VA 4N8FA 1QVGA 5C0XH 5EJWA 1LM0A 4GOPC 1SNOA 3BJUA 4RKLA 4R8NA 2PW7A 4H0LC 3IFTA 1Y69U 2JA7H 2N8NA 1EQRA 1ZYRC 2R7FA 3ZJYC 5FJ8H 4DV4Q 2UU9Q 2CW0D 3CCRA 1FJGQ 2RHQB 4IALA 3JAMi 1S5DD 2HQEA 3PIPA 3S17H 3K7UC 3OHXC 3MXNB 3ULJA 3W3AA 3CMEA 4A3EG 4H13C 4K5XA 4O0AA 3STBD 5BR8L 1U4RA 1BR9A 3C2PA 3SGIA 3S14B 1TR5A 3W2DA 4JI2L 1SMYC 1EFID 2F0HA 5JPMC 4ZCKA 3KBXA 4A3KG 4X65L 2EYPA 1K8OA 4YY3Q 4RFBA 5F2DA 2B39A 4KN7C 1VQMA 1VQKA 1HRJA 1B70B 1G2SA 3A8IE 4J1MA 1HNWL 3VDYA 3PUWA 5AJ3L 4AQYL 1EL0A 1QUQB 2QDBA 1XNQQ 3GP7A 3BZCA 3F2DA 5GAGC 1E22A 3D0FA 5CC4A 1NAPA 4DR5L 2CKZB 2CQOA 5E1FA 3A5UA 5JVH3 4DKAC 1XNQL 1JJCB 3J81L 1MSGA 5C44B 2PMZE 1EY7A 1WD1A 5DNFA 2DY8A 1N32Q 1Z47A 1JICA 5JJKA 1OO9B 5JOBA 4A3JH 1BXTA 2B8GA 2XRSD 3TP5A 3VYSA 3MXPA 3KYHC 4GOPB 1PYSB 4H7BA 4Q0FA 5EKKA 3ULLA 2DJFC 4RGNA 1N36L 1YI2A 3HOZH 4LUVA 5BN5A 1JWMD 4QB4A 2R61A 4C3IG 1H9SB 4S3SA 3CMAA 1I3QB 2FHTA 4PG3A 1I3QH 5JJIA 1KLGD 1F2YA 1GKHA 5BN4A 1I4QA 3PGZA 3VA7A 5D3DA 1EYAA 2EYOA 3SK6A 3FEWX 5M5XH 2IX3A 2B29A 2JP1A 4O1NA 3OTOL 3Q24A 3AFPA 4RGOS 5KNCA 2KUMA 2PQEA 1SYBA 3M7GA 4KN4C 2QEXA 1A15A 2CW0C 4PQXA 4YWLA 4K0KL 2K03A 3A0JA 4GN4B 3CU7A 2KCCA 4QY7A 2K14A 5CORA 3J80i 4DN4M 3ZYYX 2PW5A 1A2UA 2PQAA 5FLXE 2N78A 1OTCA 4DR7L 1EWCA 5FO7B 4B3SL 2F0TA 4DXGA 1GOZA 2E2IH 4PZ6A 4I65A 2G5DA 3CCJA 1AZPA 4DNTB 3AYHB 2BA0A 3J81j 4DV5L 1LABA 5LMNW 1LTSD 3A8KE 2JN4A 3GQBA 4IFDJ 1DCZA 1HHVA 1PLFA 1R4PB 1O7YA 3PIOA 2Q8IB 3TBIB 2WB1B 2R93H 1NNXA 2QA4A 1NY4A 3LX0A 3KLSA
chains in the Genus database with same CATH topology
1MJEA 3K80C 4LFCL 2WB1G 4AQYQ 1YJ9A 1MJCA 2GVBA 1A62A 1WCMG 4DUYL 4DV3L 4B3MQ 3S16H 1KHIA 4A3DG 1KXLA 3G6EA 1PH3A 4EX5A 1YIJA 1CKMA 1N33Q 2AMCB 1VQ6A 1VQLA 1Q82C 2ALYB 2K75A 4B3TL 1N34L 3BU2A 4IOCA 2Y0SG 2CFMA 1EWIA 4A3IG 4A3FG 2F3IA 4C2MH 4DR4Q 3S2DH 2AWNA 2HIVA 3ICEA 1AE2A 2JEAI 4JI5Q 2VY3A 2JA7G 2QGQA 5C4XG 1HNXQ 4KHPL 2V1CC 2NVQH 4A3CH 4BXXG 2OTJA 4C3HH 4DV7Q 3HOVG 5GROA 4POFA 2KCTA 5IYCG 1TXYA 4IPGA 4OXPA 2ZM6L 2UU9L 5H1SE 3DM3A 3RLFA 3PF5A 2K50A 1I50H 4LW1A 4NB3A 1FJGL 4JI2Q 1N36Q 3PUXA 4P73A 1K8GA 4LF8Q 3L0OA 4IFDI 3T1YL 4GKJL 4P71A 5IYDH 1FGUA 3CPFA 2UUBL 1K73C 3RLOA 2F52A 1D7QA 4A3GH 1L1OB 3S1MH 3GTMH 2R93G 1SLJA 1VQ8A 4X66L 1X56A 4JC0A 4PZ7A 4JYAQ 1K0RA 3FKIH 3H0GG 3PUYA 1E3PA 3RN5A 3RN2A 4NXNL 4QGUA 1A0IA 4UPAA 5ELNA 3HFZB 3I4OA 4AH6A 2UUAL 4LF4Q 3I7FA 3OYYA 1HR0L 2JA8G 1EUJA 4DV6Q 1TWGH 4A4IA 1BBUA 1X3EA 5IYDG 3A74A 1PHJA 1KQSA 1X65A 5ELOA 4DV5Q 2OWOA 1OXXK 1TWFH 3HOWG 2Z0SA 2JJQA 2OCEA 1HNZQ 3UDGA 3ERSX 4JBJA 5IYBG 4DAMA 1OXTA 3F1ZA 4NXMQ 4NXML 5AJ3Q 1G51A 4BBRG 2A19A 1T9HA 1G6PA 4LF6L 3HKZE 5M5WH 1FJGQ 2UUCQ 3HKSA 4X64L 1WFQA 1PH8A 3CCLA 3J81c 5LMNL 3KDFB 3NELA 1PA6A 1JJGA 1XNRQ 3KLWA 1FL0A 1HH2P 1PYBA 5JEAG 3T1HL 3GTQH 2GVAA 1E1TA 1UE5A 4KLKA 2E2HH 1EIYB 4JI3Q 1YHAA 3I4NH 4XTCS 1VCIA 2VQEQ 3CC7A 2ZJRA 1VQFA 4OWXB 4A3LG 3ER0A 2VNUD 2OQ0A 3E9HA 1LTLA 1Y1VH 3HKZG 4YWMA 1VQOA 4JI4L 2YTYA 1WCMH 5FLMH 1KRSA 3W5OA 1YITA 4DV0L 2VL6A 3AFQA 2VUMH 4DNIA 4JOIA 4LF7L 1WI5A 1SRUA 2ASBA 4J15A 1E24A 4JBWA 4L5TA 4IPDA 1YJWA 4TVAB 3K81C 1V9PA 4GLAC 2I0QA 4H02A 3HOYG 5FLXc 2EXDA 2JA8H 1PH9A 1UWVA 1JE5A 1UE7A 1YBYA 3UDFA 3Q8DA 5IWAQ 4X62Q 5FLMG 3DLLA 1IBLQ 1VQJA 1VQ7A 1O7IA 4DAYB 3GO5A 4RG1A 1YZ6A 3A5ZB 4DV1L 4LF8L 3AQQA 4YHHL 3CCMA 1NTGA 2H5XA 2B3GA 4X62L 4X64Q 2WFWA 4XIGS 2JA6H 2ZTCA 2EQSA 3WWVA 5IE8A 4POGA 4YY3L 2BA1A 1Q86C 3AEVA 1QUQA 1X3FA 2YTXA 2R7ZG 1GVPA 3GTOH 3T1HQ 2RCNA 4K0KQ 1VQNA 1JB7A 1HZ9A 2PI2A 4DR3Q 1VQEA 4A3MH 1XMQQ 1XPUA 3HOUH 3S1QH 4PZ8A 3KJPA 2Q2HA 4A3EH 1N8RC 2MO1A 3M4QA 4UP9A 4A3BG 1GO3E 3H15A 3EIVA 1KC8C 4JI4Q 1VQ5A 3PCOB 3CCEA 4A3LH 3I56A 1IBML 1PH6A 5BR8Q 5M3MG 1Q81C 4R4TA 2R7DA 1K3RA 4JI8Q 1SMXA 5GQOA 1I94Q 2NN6I 1I94L 2JA5H 1FVIA 1YHBA 1TWAH 3EBEA 4DV7L 1S40A 3PV0A 2R92H 1V1QA 4GLVB 4HJ9A 1NMGA 3NEMA 1HR0W 1CKNA 1Q46A 4JG2A 3GTKH 4QQBX 1KD1C 4JCVE 4OO1I 2HT1A 3NENA 3ULPA 1B8AA 3PF4A 4AYBG 2UXCL 4KHZA 3TEHB 4LF9Q 3H3VI 1E7ZA 4L5RC 4GKKL 3CP0A 2CWAA 3BZKA 4X66Q 1EYGA 4JYAL 5IYCH 2KBNA 4KHPQ 5IP9H 3JAMc 3J7A5 2YV5A 2JA6G 4GN5A 2UXBL 4B3RQ 1E1OA 1VQDA 5LMUQ 1YJNA 1HR0Q 3KOJA 5J3BA 4IPCA 1VQPA 2K52A 2F4VQ 3M4OH 3CCQA 4NXNQ 3PO3H 2E5LQ 2I5HA 2Q2IA 2XGTA 2NVTH 1RL2A 2HHHL 2IX0A 2N3SA 4OWTB 4A3KH 3M3YH 2IT1A 2CWPA 3FKIG 4A3IH 3G71A 1NJIC 2IHFA 1VS0A 3E0EA 3RLNA 3CCVA 3S15H 4GNXB 1JJ2A 2E5LL 2HIXA 5IWAL 4IJHA 2B63H 3GTJH 2BH2A 2Z6KA 1XPRA 1OXVA 4BY1H 2K4KA 3K7AH 4DR1Q 1JMCA 4IO9A 2VUMG 3HOVH 3GD7A 4YCWA 1W2BA 4YHHQ 4A3MG 2UUCL 3PUVA 3KDFA 4LF6Q 1SR3A 2PNHA 3JC66 3S14H 4WJ4A 1Q1BA 2VQEL 4L5QA 2K5NA 5HY6A 1KRTA 4LWCA 2D62A 2AWOA 2ZJQA 2JK8A 3L7ZC 4DPGA 4A3FH 1EFWA 4R4OA 4C3JH 1PVOA 1DGSA 4DK6C 1HZBA 2VQFQ 5EAYA 4JI1Q 3I4MG 4DR7Q 4DR5Q 3UE1A 3S24A 3GDEA 3HOUG 4BY7H 4DUZL 1Y1WH 4LFAQ 4DV0Q 1PH5A 1IL2A 2MFIA 1IZ6A 1OXSC 5IP7G 3I2ZA 1KAWA 4B3SQ 3KF6A 1CSQA 1CSPA 4LF9L 1J5EL 1BVSA 2UXDQ 1KL9A 1N9WA 5C3EH 2VW9A 4DV6L 4OO1G 4R4QA 4LFAL 1I6HH 3K8AA 4P72A 1VQHA 2KCMA 2F4VL 3CPWA 4A76A 4LUZA 3UDIA 2UXCQ 4ALPA 2OTLA 4IOAA 1X55A 2MO0A 1PFSA 4UP8A 4A3GG 2K5HA 3UE0A 5M3FG 3U58A 1TWCH 1G291 2LSSA 3RZDH 3H3VH 3U4VA 5C44G 4JBMA 1VQAA 5IY0A 3J81i 4HJAA 1HZCA 4LF5Q 3U4ZA 3LGJA 3TS0A 1M90C 2KHJA 3F8TA 1TWHH 2R7ZH 1XMQL 4DR1L 1X3GA 1V43A 2LXJA 2Q2UA 2UU9Q 1CKOA 2NZHA 1HNWQ 1WYDA 1BBWA 4KI0A 1PH1A 1L1OC 4ME3A 4AIMA 4HIDA 4O2DA 1P8LA 4WJ3M 1NMFA 4LF7Q 4EQ5A 2Y0SE 2LXKA 1HNXL 3CW2C 4IJLA 4TQUS 1VQ4A 4JI1L 3RNUA 2AHOB 2UXDL 3GTPH 1GM5A 1N32L 1A63A 3CXCA 4JI7Q 4A3BH 4JI5L 1WJJA 1MKHA 1GD7A 4MNOA 2D0OA 4R1JA 4R4IA 3KJOA 5JJLA 4MTNA 3UDXA 3HOZG 3OW2A 4A93G 2IY5B 1PH7A 3J7ZC 3K0XA 4C3IH 2N49A 2ZJPA 1BKBA 1CUKA 1UE1A 4GOPA 1U5KA 1UEBA 3RR5A 1U0LA 4X6AH 1A8VA 2E2JH 5DLQE 3U50C 3IRBA 3TREA 4GNXC 3F2CA 4UY8C 4JI6Q 4BBSH 3TRZA 1Y1VG 1WOCA 1SFOH 1L1OA 3CAMA 3MEFA 1Y14B 1S3OA 2PI2E 2YTVA 4OX9Q 2HHHQ 1PH4A 3TS2A 2DUDA 2ES2A 1VQGA 3W1BA 4LF4L 2KHIA 4APVA 4JV5L 1IBMQ 5C0XI 2YU9H 4MZ9A 3CC2A 4DV2Q 1SE8A 4YCUA 3W1GA 5C3EG 4BA2I 2I5MX 1XJVA 1ASZA 1JT8A 1HNZL 4P75A 3GTGH 5E7NA 4GNXA 1Z9FA 1X6OA 3CCSA 4L5SA 4A3JG 4IPHA 1LUZA 5C4JH 5IYBH 4DV2L 4YCVA 4JI3L 1QVGA 4JI7L 1LM0A 4UP7A 4GOPC 3I4MH 2NVYH 3BJUA 1XMOL 5M5YH 2JA7H 2N8NA 1EQRA 2R7FA 5FJ8H 3ZJYC 2MQHA 4NPSA 3CF5A 3CCRA 4DV4Q 2Q2TA 2RHQB 5C0XJ 4DR3L 5IT9c 4HJ7A 4LNQA 5GADC 3S2HH 3KF8B 3JAMi 3FHWA 2WAQE 3PIPA 1QVFA 2ZM6Q 3K7UC 3M4PA 3S17H 3MXNB 3ULJA 3CMEA 2ZTDA 4A3EG 4DR4L 3CCUA 4O0AA 3STBD 5IP9G 5BR8L 3M9BA 1R9TH 1H95A 1B7YB 1ASYA 2JQOA 4A3DH 2VQFL 1IBLL 4QIWE 3SGIA 3M7NA 2UUAQ 4BY1G 1XTDA 1IYJB 1VQCA 3KF6B 4JI2L 3HOXH 3PUZA 4DK3C 5M3FH 4JI6L 1M1KC 4A3KG 5C44H 2HQLA 4X65L 4BY7G 4X65Q 3I4NG 4YY3Q 2A1AA 1HJPA 4BBSG 2C35B 4OWWB 4JV5Q 5JEAJ 3T1YQ 4DR2Q 1VQMA 3PO2H 1VQKA 4A75A 1B70B 4HJ8A 4OX9L 1HZAA 1VQ9A 1KIXA 1HNWL 3VDYA 1NE3A 3CC4A 2VS1A 1PV4A 3PUWA 5AJ3L 4AQYL 4DR6L 1QUQB 1XNQQ 2IHEA 2ZTEA 3GTLH 4JI8L 4B3ML 3F2DA 3BZCA 2VZAA 5GAGC 1E22A 3D0FA 5C4XH 4DR5L 2CKZB 4LF5L 1XNRL 2CQOA 3A5UA 1J6QA 4BXXH 4HJ5A 4P74A 3CQZH 4DKAC 4JOIC 1XNQL 4B3TQ 1JJCB 1OXUA 5FJ8G 1CKNB 1X9NA 2PMZE 1P16A 3PSIA 2JA5G 1AE3A 1N32Q 3PO3G 1Z47A 2NZOA 1Q8KA 4YWKA 5JJKA 4FDBA 1LYLA 4A3JH 3TQYA 1XMOQ 3I55A 2JEBI 4GOPB 1IXRA 3KYHC 4LFBQ 2WB1E 1X54A 2ATWA 1PYSB 1I5FA 2RF4A 3ULLA 1N36L 3HOYH 1YI2A 2ID0A 3HOZH 4LUVA 4A93H 1SROA 4A3CG 1K9MC 3PO2G 2FXQA 4LUOA 5IP7H 1VQIA 1L2FA 3CMAA 4PG3A 4PMWA 1I3QH 5JJIA 1S72A 1GKHA 4DR6Q 3PGZA 4JI0Q 4HIMA 3E9IA 2KENA 1J5EQ 1RIPA 1PH2A 5M5XH 5M3MH 1NBWA 2RHSB 4RMFA 1AH9A 2B29A 2E8GA 3OTOL 4DR2L 3M85A 1Q7YC 4JI0L 3AFPA 4BBRH 3HOXG 1N34Q 1IBKQ 1YEZA 3STBC 1Y1WG 2QEXA 4DV1Q 1N33L 3OTOQ 4LFCQ 4YWLA 4GN3B 1EIFA 2JA9A 2I5LX 5HGQA 5GAEC 3A0JA 4K0KL 4GN4B 4DUYQ 4DV3Q 1IBKL 2A8VA 4QY7A 3HOWH 4Y52H 2K5VA 2K14A 3J80i 4R4CA 4Y7NH 3G48A 1L0WA 1UE6A 2PQAA 2XTIA 4GKKQ 3G4SA 2N78A 4DUZQ 1EOVA 2AKWB 3S1RH 1K8AC 1OTCA 2NVXH 4GKJQ 2PQAB 1QZHA 2EIFA 3D31A 5LMNQ 2WP8J 2D0PA 4JBKA 1VQBA 4DR7L 4IFDG 5C0XG 4B3RL 2L15A 3H0GH 4LFBL 4DV4L 5LMUL 1SN8A 4QL5A 4HIKA 3J80c 2JE6I 1W3SA 2NN6G 4B3SL 1YHQA 3B6YA 2E2IH 4PZ6A 3CD6A 2WAQG 3RZOH 1YVCA 3CCJA 1C9OA 2BH8A 5K36G 5GAHC 3AYHB 2BA0A 3J81j 2B63G 3NBHB 1Q1EA 1C0AA 4DV5L 1Q12A 4GS3A 4QJFA 4AYBE 5LMNW 3S1NH 1QVCA 2R6GA 2GN5A 2UXBQ 4HIOA 2R92G 4IFDJ 3KFUA 4BA1I 1QZGA 2IX1A 4OONA 2DGYA 2OQKA 1XPOA 1D8LA 2YYZA 1C7YA 1MIUA 2CCZA 1EQQA 3PIOA 4GLXA 1YNXA 3L2PA 3F2BA 2UUBQ 2R93H 1K83H 2Z6KC 1NY4A 2QA4A 3FP9A 2MNAA 3EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJE A;  3K80 C;  4LFC L;  2WB1 G;  4AQY Q;  1YJ9 A;  1MJC A;  2GVB A;  1A62 A;  1WCM G;  4DUY L;  4DV3 L;  4B3M Q;  3S16 H;  1KHI A;  4A3D G;  1KXL A;  3G6E A;  1PH3 A;  4EX5 A;  1YIJ A;  1CKM A;  1N33 Q;  2AMC B;  1VQ6 A;  1VQL A;  1Q82 C;  2ALY B;  2K75 A;  4B3T L;  1N34 L;  3BU2 A;  4IOC A;  2Y0S G;  2CFM A;  1EWI A;  4A3I G;  4A3F G;  2F3I A;  4C2M H;  4DR4 Q;  3S2D H;  2AWN A;  2HIV A;  3ICE A;  1AE2 A;  2JEA I;  4JI5 Q;  2VY3 A;  2JA7 G;  2QGQ A;  5C4X G;  1HNX Q;  4KHP L;  2V1C C;  2NVQ H;  4A3C H;  4BXX G;  2OTJ A;  4C3H H;  4DV7 Q;  3HOV G;  5GRO A;  4POF A;  2KCT A;  5IYC G;  1TXY A;  4IPG A;  4OXP A;  2ZM6 L;  2UU9 L;  5H1S E;  3DM3 A;  3RLF A;  3PF5 A;  2K50 A;  1I50 H;  4LW1 A;  4NB3 A;  1FJG L;  4JI2 Q;  1N36 Q;  3PUX A;  4P73 A;  1K8G A;  4LF8 Q;  3L0O A;  4IFD I;  3T1Y L;  4GKJ L;  4P71 A;  5IYD H;  1FGU A;  3CPF A;  2UUB L;  1K73 C;  3RLO A;  2F52 A;  1D7Q A;  4A3G H;  1L1O B;  3S1M H;  3GTM H;  2R93 G;  1SLJ A;  1VQ8 A;  4X66 L;  1X56 A;  4JC0 A;  4PZ7 A;  4JYA Q;  1K0R A;  3FKI H;  3H0G G;  3PUY A;  1E3P A;  3RN5 A;  3RN2 A;  4NXN L;  4QGU A;  1A0I A;  4UPA A;  5ELN A;  3HFZ B;  3I4O A;  4AH6 A;  2UUA L;  4LF4 Q;  3I7F A;  3OYY A;  1HR0 L;  2JA8 G;  1EUJ A;  4DV6 Q;  1TWG H;  4A4I A;  1BBU A;  1X3E A;  5IYD G;  3A74 A;  1PHJ A;  1KQS A;  1X65 A;  5ELO A;  4DV5 Q;  2OWO A;  1OXX K;  1TWF H;  3HOW G;  2Z0S A;  2JJQ A;  2OCE A;  1HNZ Q;  3UDG A;  3ERS X;  4JBJ A;  5IYB G;  4DAM A;  1OXT A;  3F1Z A;  4NXM Q;  4NXM L;  5AJ3 Q;  1G51 A;  4BBR G;  2A19 A;  1T9H A;  1G6P A;  4LF6 L;  3HKZ E;  5M5W H;  1FJG Q;  2UUC Q;  3HKS A;  4X64 L;  1WFQ A;  1PH8 A;  3CCL A;  3J81 c;  5LMN L;  3KDF B;  3NEL A;  1PA6 A;  1JJG A;  1XNR Q;  3KLW A;  1FL0 A;  1HH2 P;  1PYB A;  5JEA G;  3T1H L;  3GTQ H;  2GVA A;  1E1T A;  1UE5 A;  4KLK A;  2E2H H;  1EIY B;  4JI3 Q;  1YHA A;  3I4N H;  4XTC S;  1VCI A;  2VQE Q;  3CC7 A;  2ZJR A;  1VQF A;  4OWX B;  4A3L G;  3ER0 A;  2VNU D;  2OQ0 A;  3E9H A;  1LTL A;  1Y1V H;  3HKZ G;  4YWM A;  1VQO A;  4JI4 L;  2YTY A;  1WCM H;  5FLM H;  1KRS A;  3W5O A;  1YIT A;  4DV0 L;  2VL6 A;  3AFQ A;  2VUM H;  4DNI A;  4JOI A;  4LF7 L;  1WI5 A;  1SRU A;  2ASB A;  4J15 A;  1E24 A;  4JBW A;  4L5T A;  4IPD A;  1YJW A;  4TVA B;  3K81 C;  1V9P A;  4GLA C;  2I0Q A;  4H02 A;  3HOY G;  5FLX c;  2EXD A;  2JA8 H;  1PH9 A;  1UWV A;  1JE5 A;  1UE7 A;  1YBY A;  3UDF A;  3Q8D A;  5IWA Q;  4X62 Q;  5FLM G;  3DLL A;  1IBL Q;  1VQJ A;  1VQ7 A;  1O7I A;  4DAY B;  3GO5 A;  4RG1 A;  1YZ6 A;  3A5Z B;  4DV1 L;  4LF8 L;  3AQQ A;  4YHH L;  3CCM A;  1NTG A;  2H5X A;  2B3G A;  4X62 L;  4X64 Q;  2WFW A;  4XIG S;  2JA6 H;  2ZTC A;  2EQS A;  3WWV A;  5IE8 A;  4POG A;  4YY3 L;  2BA1 A;  1Q86 C;  3AEV A;  1QUQ A;  1X3F A;  2YTX A;  2R7Z G;  1GVP A;  3GTO H;  3T1H Q;  2RCN A;  4K0K Q;  1VQN A;  1JB7 A;  1HZ9 A;  2PI2 A;  4DR3 Q;  1VQE A;  4A3M H;  1XMQ Q;  1XPU A;  3HOU H;  3S1Q H;  4PZ8 A;  3KJP A;  2Q2H A;  4A3E H;  1N8R C;  2MO1 A;  3M4Q A;  4UP9 A;  4A3B G;  1GO3 E;  3H15 A;  3EIV A;  1KC8 C;  4JI4 Q;  1VQ5 A;  3PCO B;  3CCE A;  4A3L H;  3I56 A;  1IBM L;  1PH6 A;  5BR8 Q;  5M3M G;  1Q81 C;  4R4T A;  2R7D A;  1K3R A;  4JI8 Q;  1SMX A;  5GQO A;  1I94 Q;  2NN6 I;  1I94 L;  2JA5 H;  1FVI A;  1YHB A;  1TWA H;  3EBE A;  4DV7 L;  1S40 A;  3PV0 A;  2R92 H;  1V1Q A;  4GLV B;  4HJ9 A;  1NMG A;  3NEM A;  1HR0 W;  1CKN A;  1Q46 A;  4JG2 A;  3GTK H;  4QQB X;  1KD1 C;  4JCV E;  4OO1 I;  2HT1 A;  3NEN A;  3ULP A;  1B8A A;  3PF4 A;  4AYB G;  2UXC L;  4KHZ A;  3TEH B;  4LF9 Q;  3H3V I;  1E7Z A;  4L5R C;  4GKK L;  3CP0 A;  2CWA A;  3BZK A;  4X66 Q;  1EYG A;  4JYA L;  5IYC H;  2KBN A;  4KHP Q;  5IP9 H;  3JAM c;  3J7A 5;  2YV5 A;  2JA6 G;  4GN5 A;  2UXB L;  4B3R Q;  1E1O A;  1VQD A;  5LMU Q;  1YJN A;  1HR0 Q;  3KOJ A;  5J3B A;  4IPC A;  1VQP A;  2K52 A;  2F4V Q;  3M4O H;  3CCQ A;  4NXN Q;  3PO3 H;  2E5L Q;  2I5H A;  2Q2I A;  2XGT A;  2NVT H;  1RL2 A;  2HHH L;  2IX0 A;  2N3S A;  4OWT B;  4A3K H;  3M3Y H;  2IT1 A;  2CWP A;  3FKI G;  4A3I H;  3G71 A;  1NJI C;  2IHF A;  1VS0 A;  3E0E A;  3RLN A;  3CCV A;  3S15 H;  4GNX B;  1JJ2 A;  2E5L L;  2HIX A;  5IWA L;  4IJH A;  2B63 H;  3GTJ H;  2BH2 A;  2Z6K A;  1XPR A;  1OXV A;  4BY1 H;  2K4K A;  3K7A H;  4DR1 Q;  1JMC A;  4IO9 A;  2VUM G;  3HOV H;  3GD7 A;  4YCW A;  1W2B A;  4YHH Q;  4A3M G;  2UUC L;  3PUV A;  3KDF A;  4LF6 Q;  1SR3 A;  2PNH A;  3JC6 6;  3S14 H;  4WJ4 A;  1Q1B A;  2VQE L;  4L5Q A;  2K5N A;  5HY6 A;  1KRT A;  4LWC A;  2D62 A;  2AWO A;  2ZJQ A;  2JK8 A;  3L7Z C;  4DPG A;  4A3F H;  1EFW A;  4R4O A;  4C3J H;  1PVO A;  1DGS A;  4DK6 C;  1HZB A;  2VQF Q;  5EAY A;  4JI1 Q;  3I4M G;  4DR7 Q;  4DR5 Q;  3UE1 A;  3S24 A;  3GDE A;  3HOU G;  4BY7 H;  4DUZ L;  1Y1W H;  4LFA Q;  4DV0 Q;  1PH5 A;  1IL2 A;  2MFI A;  1IZ6 A;  1OXS C;  5IP7 G;  3I2Z A;  1KAW A;  4B3S Q;  3KF6 A;  1CSQ A;  1CSP A;  4LF9 L;  1J5E L;  1BVS A;  2UXD Q;  1KL9 A;  1N9W A;  5C3E H;  2VW9 A;  4DV6 L;  4OO1 G;  4R4Q A;  4LFA L;  1I6H H;  3K8A A;  4P72 A;  1VQH A;  2KCM A;  2F4V L;  3CPW A;  4A76 A;  4LUZ A;  3UDI A;  2UXC Q;  4ALP A;  2OTL A;  4IOA A;  1X55 A;  2MO0 A;  1PFS A;  4UP8 A;  4A3G G;  2K5H A;  3UE0 A;  5M3F G;  3U58 A;  1TWC H;  1G29 1;  2LSS A;  3RZD H;  3H3V H;  3U4V A;  5C44 G;  4JBM A;  1VQA A;  5IY0 A;  3J81 i;  4HJA A;  1HZC A;  4LF5 Q;  3U4Z A;  3LGJ A;  3TS0 A;  1M90 C;  2KHJ A;  3F8T A;  1TWH H;  2R7Z H;  1XMQ L;  4DR1 L;  1X3G A;  1V43 A;  2LXJ A;  2Q2U A;  2UU9 Q;  1CKO A;  2NZH A;  1HNW Q;  1WYD A;  1BBW A;  4KI0 A;  1PH1 A;  1L1O C;  4ME3 A;  4AIM A;  4HID A;  4O2D A;  1P8L A;  4WJ3 M;  1NMF A;  4LF7 Q;  4EQ5 A;  2Y0S E;  2LXK A;  1HNX L;  3CW2 C;  4IJL A;  4TQU S;  1VQ4 A;  4JI1 L;  3RNU A;  2AHO B;  2UXD L;  3GTP H;  1GM5 A;  1N32 L;  1A63 A;  3CXC A;  4JI7 Q;  4A3B H;  4JI5 L;  1WJJ A;  1MKH A;  1GD7 A;  4MNO A;  2D0O A;  4R1J A;  4R4I A;  3KJO A;  5JJL A;  4MTN A;  3UDX A;  3HOZ G;  3OW2 A;  4A93 G;  2IY5 B;  1PH7 A;  3J7Z C;  3K0X A;  4C3I H;  2N49 A;  2ZJP A;  1BKB A;  1CUK A;  1UE1 A;  4GOP A;  1U5K A;  1UEB A;  3RR5 A;  1U0L A;  4X6A H;  1A8V A;  2E2J H;  5DLQ E;  3U50 C;  3IRB A;  3TRE A;  4GNX C;  3F2C A;  4UY8 C;  4JI6 Q;  4BBS H;  3TRZ A;  1Y1V G;  1WOC A;  1SFO H;  1L1O A;  3CAM A;  3MEF A;  1Y14 B;  1S3O A;  2PI2 E;  2YTV A;  4OX9 Q;  2HHH Q;  1PH4 A;  3TS2 A;  2DUD A;  2ES2 A;  1VQG A;  3W1B A;  4LF4 L;  2KHI A;  4APV A;  4JV5 L;  1IBM Q;  5C0X I;  2YU9 H;  4MZ9 A;  3CC2 A;  4DV2 Q;  1SE8 A;  4YCU A;  3W1G A;  5C3E G;  4BA2 I;  2I5M X;  1XJV A;  1ASZ A;  1JT8 A;  1HNZ L;  4P75 A;  3GTG H;  5E7N A;  4GNX A;  1Z9F A;  1X6O A;  3CCS A;  4L5S A;  4A3J G;  4IPH A;  1LUZ A;  5C4J H;  5IYB H;  4DV2 L;  4YCV A;  4JI3 L;  1QVG A;  4JI7 L;  1LM0 A;  4UP7 A;  4GOP C;  3I4M H;  2NVY H;  3BJU A;  1XMO L;  5M5Y H;  2JA7 H;  2N8N A;  1EQR A;  2R7F A;  5FJ8 H;  3ZJY C;  2MQH A;  4NPS A;  3CF5 A;  3CCR A;  4DV4 Q;  2Q2T A;  2RHQ B;  5C0X J;  4DR3 L;  5IT9 c;  4HJ7 A;  4LNQ A;  5GAD C;  3S2H H;  3KF8 B;  3JAM i;  3FHW A;  2WAQ E;  3PIP A;  1QVF A;  2ZM6 Q;  3K7U C;  3M4P A;  3S17 H;  3MXN B;  3ULJ A;  3CME A;  2ZTD A;  4A3E G;  4DR4 L;  3CCU A;  4O0A A;  3STB D;  5IP9 G;  5BR8 L;  3M9B A;  1R9T H;  1H95 A;  1B7Y B;  1ASY A;  2JQO A;  4A3D H;  2VQF L;  1IBL L;  4QIW E;  3SGI A;  3M7N A;  2UUA Q;  4BY1 G;  1XTD A;  1IYJ B;  1VQC A;  3KF6 B;  4JI2 L;  3HOX H;  3PUZ A;  4DK3 C;  5M3F H;  4JI6 L;  1M1K C;  4A3K G;  5C44 H;  2HQL A;  4X65 L;  4BY7 G;  4X65 Q;  3I4N G;  4YY3 Q;  2A1A A;  1HJP A;  4BBS G;  2C35 B;  4OWW B;  4JV5 Q;  5JEA J;  3T1Y Q;  4DR2 Q;  1VQM A;  3PO2 H;  1VQK A;  4A75 A;  1B70 B;  4HJ8 A;  4OX9 L;  1HZA A;  1VQ9 A;  1KIX A;  1HNW L;  3VDY A;  1NE3 A;  3CC4 A;  2VS1 A;  1PV4 A;  3PUW A;  5AJ3 L;  4AQY L;  4DR6 L;  1QUQ B;  1XNQ Q;  2IHE A;  2ZTE A;  3GTL H;  4JI8 L;  4B3M L;  3F2D A;  3BZC A;  2VZA A;  5GAG C;  1E22 A;  3D0F A;  5C4X H;  4DR5 L;  2CKZ B;  4LF5 L;  1XNR L;  2CQO A;  3A5U A;  1J6Q A;  4BXX H;  4HJ5 A;  4P74 A;  3CQZ H;  4DKA C;  4JOI C;  1XNQ L;  4B3T Q;  1JJC B;  1OXU A;  5FJ8 G;  1CKN B;  1X9N A;  2PMZ E;  1P16 A;  3PSI A;  2JA5 G;  1AE3 A;  1N32 Q;  3PO3 G;  1Z47 A;  2NZO A;  1Q8K A;  4YWK A;  5JJK A;  4FDB A;  1LYL A;  4A3J H;  3TQY A;  1XMO Q;  3I55 A;  2JEB I;  4GOP B;  1IXR A;  3KYH C;  4LFB Q;  2WB1 E;  1X54 A;  2ATW A;  1PYS B;  1I5F A;  2RF4 A;  3ULL A;  1N36 L;  3HOY H;  1YI2 A;  2ID0 A;  3HOZ H;  4LUV A;  4A93 H;  1SRO A;  4A3C G;  1K9M C;  3PO2 G;  2FXQ A;  4LUO A;  5IP7 H;  1VQI A;  1L2F A;  3CMA A;  4PG3 A;  4PMW A;  1I3Q H;  5JJI A;  1S72 A;  1GKH A;  4DR6 Q;  3PGZ A;  4JI0 Q;  4HIM A;  3E9I A;  2KEN A;  1J5E Q;  1RIP A;  1PH2 A;  5M5X H;  5M3M H;  1NBW A;  2RHS B;  4RMF A;  1AH9 A;  2B29 A;  2E8G A;  3OTO L;  4DR2 L;  3M85 A;  1Q7Y C;  4JI0 L;  3AFP A;  4BBR H;  3HOX G;  1N34 Q;  1IBK Q;  1YEZ A;  3STB C;  1Y1W G;  2QEX A;  4DV1 Q;  1N33 L;  3OTO Q;  4LFC Q;  4YWL A;  4GN3 B;  1EIF A;  2JA9 A;  2I5L X;  5HGQ A;  5GAE C;  3A0J A;  4K0K L;  4GN4 B;  4DUY Q;  4DV3 Q;  1IBK L;  2A8V A;  4QY7 A;  3HOW H;  4Y52 H;  2K5V A;  2K14 A;  3J80 i;  4R4C A;  4Y7N H;  3G48 A;  1L0W A;  1UE6 A;  2PQA A;  2XTI A;  4GKK Q;  3G4S A;  2N78 A;  4DUZ Q;  1EOV A;  2AKW B;  3S1R H;  1K8A C;  1OTC A;  2NVX H;  4GKJ Q;  2PQA B;  1QZH A;  2EIF A;  3D31 A;  5LMN Q;  2WP8 J;  2D0P A;  4JBK A;  1VQB A;  4DR7 L;  4IFD G;  5C0X G;  4B3R L;  2L15 A;  3H0G H;  4LFB L;  4DV4 L;  5LMU L;  1SN8 A;  4QL5 A;  4HIK A;  3J80 c;  2JE6 I;  1W3S A;  2NN6 G;  4B3S L;  1YHQ A;  3B6Y A;  2E2I H;  4PZ6 A;  3CD6 A;  2WAQ G;  3RZO H;  1YVC A;  3CCJ A;  1C9O A;  2BH8 A;  5K36 G;  5GAH C;  3AYH B;  2BA0 A;  3J81 j;  2B63 G;  3NBH B;  1Q1E A;  1C0A A;  4DV5 L;  1Q12 A;  4GS3 A;  4QJF A;  4AYB E;  5LMN W;  3S1N H;  1QVC A;  2R6G A;  2GN5 A;  2UXB Q;  4HIO A;  2R92 G;  4IFD J;  3KFU A;  4BA1 I;  1QZG A;  2IX1 A;  4OON A;  2DGY A;  2OQK A;  1XPO A;  1D8L A;  2YYZ A;  1C7Y A;  1MIU A;  2CCZ A;  1EQQ A;  3PIO A;  4GLX A;  1YNX A;  3L2P A;  3F2B A;  2UUB Q;  2R93 H;  1K83 H;  2Z6K C;  1NY4 A;  2QA4 A;  3FP9 A;  2MNA A;  3EN2 A; 
#chains in the Genus database with same CATH topology
 4Z9C B;  1MJE A;  3K80 C;  3Q23 A;  4LAA A;  3V05 A;  1KXL A;  2BDN A;  3BVG A;  5ELB A;  1B3Q A;  5KND A;  2K75 A;  4B3T L;  3R3O A;  4A3J B;  3L3O C;  4DR4 Q;  3S2D H;  2AWN A;  2JA7 G;  5C4X G;  4A3C H;  5I9O A;  4FO2 A;  4C3H H;  2OTJ A;  1Q8I A;  4EQO A;  4POF A;  2ZM6 L;  2RSO A;  4OXP A;  2UU9 L;  1FJG L;  3DM3 A;  4B9X A;  4NB3 A;  1HA5 A;  3PUX A;  5C4H A;  3D4W A;  3L0O A;  4IFD I;  1ZEQ X;  1G2T A;  1K73 C;  3S1M H;  1SLJ A;  1JWS D;  1SYC A;  4QGU A;  4UPA A;  1TWC B;  4LF4 Q;  1HR0 L;  3I90 A;  1BNZ A;  1X3E A;  2F0P A;  2I07 B;  3A74 A;  1KQS A;  3K57 A;  2OWO A;  1EU4 A;  2WII B;  1QB5 D;  1PYW D;  2JJQ A;  4UHV A;  3UDG A;  1D5M C;  1SE2 A;  2NN6 H;  4OHJ A;  4JBJ A;  5IYB G;  1OXT A;  4NXM L;  4RH6 A;  4BBR G;  5M5W B;  5IGC A;  1G6P A;  3HKZ E;  1CQV A;  1F9R A;  4QUC A;  3KLW A;  1FL0 A;  1HH2 P;  1PZK D;  3T1H L;  5M3F B;  2LMC B;  1EY6 A;  3HOX B;  4K6D A;  4XTC S;  2ZJR A;  2VNU D;  1CHQ D;  1SNQ A;  1Y1V H;  1TT2 A;  5FLM H;  1WCM H;  4CDC C;  2VL6 A;  3U9S A;  4HSV A;  5CV9 A;  4DNI A;  3CKI B;  1RF2 D;  4J15 A;  4KD3 A;  4IZ8 A;  4JBW A;  4TVA B;  4GLA C;  2I0Q A;  4H02 A;  2EXD A;  2KOL A;  4OEL B;  4A3K B;  2JA8 H;  1JE5 A;  1YBY A;  4KJO A;  3UDF A;  4HR7 B;  1IBL Q;  1O7I A;  3NBH A;  4KK7 A;  3GO5 A;  4OIK A;  2ZTC A;  3WWV A;  5IE8 A;  2MJ8 A;  2BA1 A;  1Q86 C;  4GZY C;  1QUQ A;  1SMY D;  1X3F A;  2YTX A;  1ENF A;  2O2L D;  3A55 A;  1HZ9 A;  3S1Q H;  1VQE A;  2DNE A;  2H4O A;  5D14 A;  4A3E H;  2FMC A;  1W6J A;  4A3B G;  2SNM A;  1KC8 C;  3ITP A;  5CBE E;  3CCE A;  2VXW A;  2Z4I A;  4L6T B;  3HZX A;  4HMJ A;  3MFG A;  1NR2 A;  4JI8 Q;  2K6A A;  1SMX A;  4Y7N B;  1DYQ A;  4DV7 L;  5LL6 S;  3SVM A;  5D3I B;  3PV0 A;  1ICW A;  1TKW B;  2QKI C;  1NMG A;  3NEM A;  1DZ1 A;  4OO1 I;  2UXC L;  1MGS A;  1RTO A;  4L5R C;  1B9M A;  3P1H A;  4RKB A;  5IIF A;  1H9S A;  4X66 Q;  4JYA L;  2YV5 A;  3VR2 A;  4GN5 A;  2ZXO A;  1E1O A;  4FP5 D;  3SK5 A;  5LMU Q;  1YJN A;  3OPO A;  4PNY A;  2KEE A;  2XIW A;  3KOJ A;  5J3B A;  3NSW A;  5T1I A;  5FOB B;  2JA7 B;  3M4O H;  2BOS A;  3CCQ A;  4M1U B;  1EIH A;  2Q2I A;  2N3S A;  5FO8 B;  2IHF A;  1VS0 A;  2X6G A;  3GTL B;  4RGM A;  3S15 H;  4GNX B;  2CVR A;  1KTK A;  4IJH A;  1IW7 C;  1LT4 D;  2Z6K A;  1XPR A;  1JMC A;  3T4A C;  2VUM G;  2R93 B;  3BDC A;  4IUV A;  1W2B A;  2FJ2 A;  1BUV T;  2E2D C;  2UUC L;  4LF6 Q;  3JC6 6;  4KV6 A;  1GUN A;  3GTQ B;  2ZXP A;  3G7L A;  4LWC A;  1WCM B;  2D62 A;  3VYU A;  4R4O A;  2Z9H A;  1PVO A;  4RGT A;  5LL6 X;  1HUN A;  2K28 A;  3N6R A;  4DUZ L;  1Y1W H;  4KKU A;  3NWS A;  3IFD A;  4DAP A;  5IP7 G;  1HTP A;  1KAW A;  4FXK C;  2M2L A;  1LAC A;  2KCN A;  3HS0 C;  2UXD Q;  4C3H G;  2VW9 A;  2E75 C;  3H91 A;  3K8A A;  4RCO A;  2KCM A;  4DAY A;  1A6X A;  4LUZ A;  3UDI A;  5M9O A;  2UXC Q;  5E4W C;  1EQV A;  4HED A;  3BZD B;  2OF1 A;  4FXD A;  1PMR A;  5M3F G;  1TWC H;  1G29 1;  3VR6 A;  1XTC D;  2M00 A;  5C44 G;  1VQA A;  5IY0 A;  4LF5 Q;  4KKT A;  2RVL A;  3ERQ A;  4FXG C;  1STN A;  2KVM A;  2EYF A;  2KHJ A;  1B3A A;  1IL8 A;  2R7Z H;  1HNW Q;  2F0S A;  2RKS A;  1WYD A;  3HOY B;  1IYU A;  2K5Q A;  1TWA B;  4EVO A;  4HID A;  1NMF A;  1C8C A;  1YNN D;  3GV3 A;  1JB3 A;  1VQ4 A;  3I91 A;  5C4X B;  3GTP H;  1GM5 A;  1LO5 D;  2A5H A;  4JI5 L;  1LTG D;  1ESF A;  2Q8R E;  5JJL A;  3A8J E;  4A93 G;  2IY5 B;  1CHP D;  4CJ0 B;  5LHY 1;  3QJY A;  1PH7 A;  3K0X A;  2N49 A;  4K8I A;  3TME A;  2ZJP A;  1BKB A;  2WKD A;  4X6A H;  3RR5 A;  3M3Y B;  2E2J H;  4J8Q A;  5DLQ E;  3TRE A;  4GNX C;  3F2C A;  3TRZ A;  1CFM A;  1SFO H;  1L1O A;  2EJG C;  5DM6 3;  1Y14 B;  2YTV A;  4OX9 Q;  2DUD A;  3HGB A;  3W1B A;  1X32 A;  4JV5 L;  2JYO A;  3K5L A;  5C0X I;  4DFA A;  4DV2 Q;  1SE8 A;  3N52 A;  2WAQ B;  2I5M X;  5KEE A;  3GTG H;  4P75 A;  4XXE A;  2Y0S B;  1LUZ A;  1Z7T A;  4JI7 L;  2EY1 A;  4JI3 L;  4UP7 A;  2TMP A;  2F0J A;  1AFP A;  2Z1C A;  1ENA A;  3CF5 A;  2Q2T A;  3J80 L;  3S2H H;  2MP1 A;  2OEO A;  2FFK B;  3NXW A;  3R2T A;  5A2Q L;  3CCU A;  5IP9 G;  2ZT9 C;  1H95 A;  1B7Y B;  3I70 A;  1RHP A;  1K83 B;  2JQO A;  3D8G A;  2VQF L;  2EZV A;  1NSN S;  3H0G B;  2UUA Q;  1X3P A;  3MFY A;  1XTD A;  1VQC A;  3I4N B;  4JI6 L;  2F0G A;  2L12 A;  3RZO B;  1PTO H;  4KY5 A;  4BY7 G;  4EQP A;  3ERO A;  4QMG A;  2A1A A;  1HJP A;  1G6Z A;  3H09 A;  4JV5 Q;  5J39 A;  4G7Z C;  3EJI A;  5FK9 C;  3PO2 H;  1DM0 B;  4A75 A;  4K2K A;  3A7A B;  4OX9 L;  2DJG C;  1SFO B;  1NE3 A;  4DR6 L;  3GTL H;  3S15 B;  4JI8 L;  2VZA A;  2E76 C;  4LF5 L;  1J6Q A;  1EWH A;  1GHK A;  1LT5 D;  1ROD A;  4OEM B;  1FNW A;  1DD2 A;  1P16 A;  2B2V A;  3D6W A;  3V96 A;  1FNV A;  3PSI A;  1AE3 A;  1Q8K A;  4A3M B;  4JW0 A;  3DUZ A;  1LYL A;  5CV7 A;  5JPN C;  2JEB I;  1IXR A;  2HCI A;  2PZW A;  5K5P A;  2RF4 A;  1T5E A;  1SE4 A;  3HOY H;  2MGS A;  4A3C G;  4FF3 A;  4LUO A;  1L2F A;  3C3L A;  4LK1 C;  1SDF A;  4F8M A;  3FVQ A;  4JI0 Q;  1EYC A;  3E9I A;  4XQJ A;  2KEN A;  4A3B B;  1RIP A;  3OOC A;  5D65 A;  1U4M A;  5M3M H;  1AH9 A;  4ME5 A;  2K32 A;  3M85 A;  4JI0 L;  3HOX G;  1WTV A;  1IBK Q;  3VR3 A;  3MTS A;  5M5Y B;  3STB C;  1Y1W G;  1N33 L;  3OTO Q;  5GAE C;  4C2M B;  1O7Z A;  3NP8 A;  4JK1 C;  1FNU A;  3I3C A;  1NUC A;  2A68 C;  2EYJ A;  4R4C A;  1UE6 A;  2XRQ D;  3HRZ C;  3G4S A;  1SNC A;  1EOV A;  4DUZ Q;  4E6I A;  2NVX H;  5I6Y A;  3D31 A;  2D0P A;  4B3R L;  3AB9 A;  4IUQ A;  5LMU L;  1SN8 A;  2B2U C;  3AMU A;  4HIK A;  3RZO H;  5JJZ A;  1C9O A;  1I6V C;  2BH8 A;  3DM1 A;  5GAH C;  2B63 G;  3NBH B;  1LT3 D;  1Q1E A;  3S1N H;  2VUM B;  2R6G A;  3I4L A;  2L5T A;  2R92 G;  1K8M A;  4OON A;  1XPO A;  1D8L A;  2DNC A;  3NTH A;  1BQQ T;  1EU3 A;  3R8B A;  1VMP A;  2UUB Q;  1YNX A;  3I73 A;  5IT9 L;  1GUW A;  1KDB A;  2QCP X;  1BDO A;  3EN2 A;  2L1B A;  2R3Z A;  3IL8 A;  5CMD A;  3G6J B;  1PRT D;  4EGV A;  3S16 H;  2JA6 B;  4AYB B;  1KHI A;  5EKI A;  1T5X D;  3G6E A;  1YNJ C;  4EX5 A;  1CKM A;  1N33 Q;  3S1Q B;  2AMC B;  4ZUJ A;  4C3J G;  4Q5V A;  1VQL A;  2DY7 A;  4C1N K;  5EPK A;  1I4X A;  3BU2 A;  1EWI A;  4A3F G;  1QWY A;  2F3I A;  4V0B A;  4JI5 Q;  1HNX Q;  2V1C C;  4DV7 Q;  3HOV G;  2KCT A;  4K14 A;  4IPG A;  3RLF A;  3PF5 A;  2K50 A;  4LW1 A;  2HDL A;  3I72 A;  3PQI A;  2M9V A;  1N36 Q;  1SND A;  2A6H C;  1ESR A;  4P71 A;  3NWT A;  2R93 G;  3NK9 A;  4X66 L;  1X56 A;  4JC0 A;  4PZ7 A;  1VF7 A;  4JYA Q;  1IYV A;  1PTO B;  1Y1V B;  1A0I A;  4M8A A;  5ELN A;  3HFZ B;  1Y8P B;  2HUG A;  1ZXT A;  1HPC A;  1KAB A;  4AH6 A;  1STE A;  2UUA L;  2JA8 G;  3HOU B;  4A4I A;  5IYD G;  2NVT B;  4DV5 Q;  1ML0 D;  1OXX K;  1TWF H;  2WIN B;  1HNZ Q;  4BY7 B;  1G51 A;  1LV9 A;  4LF6 L;  5M5W H;  5IGB A;  1WFQ A;  1CA6 A;  3J81 c;  5LMN L;  1JJG A;  2RDH A;  5EPL A;  1STY A;  1PA6 A;  1XNR Q;  4K2L A;  5JEA G;  1I4H A;  2F0M A;  1YHA A;  3I4N H;  2VQE Q;  5M3M B;  3KLR A;  1VQF A;  3ER0 A;  3HKZ G;  3R2I A;  3KF8 A;  2VB2 X;  3QB3 A;  2B2U A;  1WI5 A;  1SJH D;  3ND8 A;  1SRU A;  2ASB A;  1DXM A;  4L5T A;  4IPD A;  3T16 A;  1YJW A;  3H3V C;  4X3K A;  5FLX c;  4IUN A;  4U67 3;  4X62 Q;  3Q8D A;  4NKL A;  3BYT B;  5FLM G;  1HCZ A;  5FO9 B;  2PPB C;  3P75 A;  1YZ6 A;  3PMF A;  1O80 A;  2IPK D;  2H5X A;  2B3G A;  4X62 L;  4X64 Q;  2WFW A;  2JA6 H;  2EQS A;  4C56 C;  4ZYS A;  3GTG B;  4NP5 A;  3LWE A;  3TP8 A;  4LMQ D;  3T1H Q;  4G4K A;  1JB7 A;  2A6E D;  2PO4 A;  3NQT A;  3KJP A;  1N8R C;  1B9N A;  4UP9 A;  3H15 A;  4JI4 Q;  2NWG A;  1VQ5 A;  3PCO B;  3I56 A;  2IW3 A;  1I94 Q;  1FVI A;  1TWA H;  3EBE A;  4F88 A;  5J22 A;  1S40 A;  4HJ9 A;  1HR0 W;  1W6K A;  1UNS A;  3S1R B;  1F2Z A;  3ULP A;  3PF4 A;  4AYB G;  1SNM A;  4LF9 Q;  3H3V I;  2EYM A;  3CQZ B;  1QIL A;  2QDL A;  1DJR D;  4GKK L;  2CWA A;  1EYG A;  1STB A;  2KBN A;  5IP9 H;  5G3L D;  1CI3 M;  1SXT A;  3C1E A;  4A3F B;  2UXB L;  4B3R Q;  1BCP C;  2EPB A;  5IGG A;  4ODG A;  3BVZ A;  3PIO 3;  4NXN Q;  3PO3 H;  2I5H A;  2N88 A;  1ZKO A;  4OWT B;  2IT1 A;  2CWP A;  3FKI G;  2F0K A;  2WAC A;  2MPM A;  2QIL A;  3MXG A;  3RLN A;  2HIX A;  1OXV A;  1C4Q A;  4DR1 Q;  4J6H A;  3HOV H;  3GD7 A;  2EOT A;  2F0W A;  4YCW A;  2L55 A;  4A3M G;  3PUV A;  4WJ4 A;  5ISR A;  4U68 A;  5CBA E;  2AWO A;  2ZJQ A;  4HN7 A;  4DPG A;  1TWG B;  1IW7 D;  5KYI A;  1ILP A;  4C3J H;  4F7X A;  2VQF Q;  4DR7 Q;  3ONA B;  1LTR D;  4ZRZ A;  2F0I A;  4BY7 H;  1PH5 A;  1PFN A;  4DV0 Q;  1LTB D;  2MFI A;  2O5J C;  4C3H B;  1CSQ A;  4LF9 L;  1DOK A;  4ZAI A;  1RCV D;  4X3T A;  2Q8T A;  1N9W A;  5C3E H;  4OO1 G;  1EIG A;  4R4Q A;  4QUF A;  4TKO B;  4CJ1 B;  4P72 A;  1VQH A;  3K5M A;  3K7A B;  3CPW A;  4ALP A;  4DK1 A;  3HKZ B;  1B44 D;  2F0F A;  1ILQ A;  4UP8 A;  3T53 B;  3UE0 A;  3U58 A;  5COY A;  5EBC A;  3RZD H;  3H3V H;  3J81 i;  1HZC A;  4KD4 A;  3IAY A;  3LNN A;  3RMH A;  3LGJ A;  3TS0 A;  3F8T A;  3C46 A;  3PO2 B;  4DR1 L;  2LXJ A;  1IKM A;  3QR8 A;  1AP0 A;  1BBW A;  4KI0 A;  1L1O C;  3MVV A;  4ME3 A;  4MTK A;  4AIM A;  4WJ3 M;  1P8L A;  1R9T B;  1HNX L;  4OL7 A;  2A69 C;  2LXK A;  3CW2 C;  4IJL A;  3OIP A;  4IUP A;  5C3X A;  2A6E C;  3OMG A;  1K0S A;  1TS3 A;  3VR4 A;  3UI2 A;  1WD0 A;  3P7J A;  2UXD L;  2EE1 A;  2HDM A;  1SYF A;  4TRD A;  1AEX A;  1EZ8 A;  4A3B H;  1WJJ A;  4QIW B;  5K36 H;  3VA5 A;  3UDX A;  4C3I H;  2F0D A;  1CUK A;  1U5K A;  1UEB A;  5IOD A;  4DF7 A;  1Z6H A;  1EY4 A;  1KNE A;  2X6L A;  4UY8 C;  4JI6 Q;  4PMB A;  1MI2 A;  1Y1V G;  1WOC A;  3S9W A;  3CAM A;  2PI2 E;  1PH4 A;  2ES2 A;  1VQG A;  1H9J A;  2EJM A;  1JWU D;  2KHI A;  3HEJ A;  2YU9 H;  1PRT F;  3CC2 A;  2F0E A;  2EY2 A;  4BA2 I;  1ASZ A;  4GNX A;  3K5O A;  1Z9F A;  2NBF A;  5E4X A;  4DV2 L;  1XMO L;  2EXZ A;  1TU2 B;  2IWH A;  4NPS A;  2WV6 D;  1CTM A;  2PZT A;  1G8Z D;  4DR3 L;  5GAD C;  3KF8 B;  4CDE C;  3FHW A;  3J7A F;  1MSH A;  2JSO A;  2R92 B;  4WFN 3;  2ZM6 Q;  4DR4 L;  2KJX A;  1SYE A;  3SHL A;  1ASY A;  4A3D H;  1EZ6 A;  1IBL L;  2YU9 B;  3M7N A;  1IYJ B;  3KF6 B;  2MHV A;  3HOX H;  5M3F H;  1IKL A;  3KBG A;  5C44 H;  2KED A;  5FKA C;  4X65 Q;  2KEC A;  4FYD A;  1XWE A;  2C35 B;  4OWW B;  2O5I C;  5JEA J;  5I2Y A;  1VF5 C;  4FF2 A;  3S2H B;  4HJ8 A;  2FMM A;  2LS0 1;  4K5W A;  3CC4 A;  2VS1 A;  3GTJ B;  1E2W A;  1BCP F;  2ZTE A;  1I6H B;  5JAV A;  1PFM A;  1SAP A;  1Y8O B;  3E0J A;  4BXX H;  4P74 A;  3CQZ H;  1CZW A;  4B3T Q;  3TSS A;  5FJ8 G;  1X9N A;  2Z4H A;  1D2B A;  1VDZ A;  2JA5 G;  3QWN A;  5ELE A;  2K05 A;  3PO3 G;  2NZO A;  4XQN A;  3TQY A;  1XMO Q;  4MHE A;  5DEH A;  2WB1 E;  1X54 A;  4HMI A;  1RD9 D;  5EKL A;  1WTX A;  1I5F A;  2ID0 A;  2AQ2 B;  4X3S A;  1QOH A;  3PO2 G;  2FXQ A;  1F2L A;  2ICI A;  1I50 B;  4MN3 A;  3O13 A;  2EVB A;  2QEJ C;  3RUZ A;  1S72 A;  2PCF B;  3L9A X;  1S5E D;  2GA4 B;  3H6M A;  1PH2 A;  1J5E Q;  2F3W A;  1NBW A;  1LLR D;  1LTI D;  4RMF A;  3FRP B;  2LY7 A;  3J80 E;  2PMZ B;  2F0O A;  4XT3 B;  4BBR H;  4DNR B;  1SNP A;  3EVQ A;  1M4V A;  4FNF A;  2J4X A;  3SDZ A;  4RHR A;  2EYL A;  2L9H A;  1JOO A;  1SBB B;  5HGQ A;  5DAU A;  4KJN A;  2QF7 A;  5CV8 A;  4X3U A;  1IBK L;  3HOW H;  4Y52 H;  1U9R A;  2G9H D;  2K5V A;  1KDA A;  1V8Q A;  3H94 A;  4Y7N H;  1XYI A;  4GKK Q;  2PZU A;  1K8A C;  2AKW B;  2XSC A;  4L63 B;  5L37 A;  3FMC A;  2PQA B;  1MD2 D;  3DWQ A;  2WP8 J;  3TN2 A;  4JBK A;  1VQB A;  2B8F A;  1EQT A;  2SOB A;  3H0G H;  4QL5 A;  1S5B D;  3J80 c;  2JE6 I;  2NN6 G;  4G57 A;  3CD6 A;  1Y8N B;  1PRT B;  2WAQ G;  1EEF D;  1F9S A;  3KLS X;  4XYO A;  4DXF A;  5BN3 A;  1HQR D;  1YVC A;  2VB3 X;  2OXP A;  5K36 G;  1ONL A;  2J0T D;  1TS5 A;  1C0A A;  1B53 A;  4QJF A;  4AYB E;  1QVC A;  4HIO A;  3KFU A;  5A2Q E;  2OQK A;  1DOM A;  1C7Y A;  2RDG A;  2RQX A;  1MIU A;  4CKE A;  1F2M A;  1EQQ A;  2CCZ A;  4N9P A;  1E2Z A;  3F2B A;  1WTP A;  4I7A A;  1TY0 A;  4BY1 B;  2MNA A;  1L0X B;  4LFC L;  2WB1 G;  1YJ9 A;  3T56 B;  5KYL A;  3MA2 B;  4B3M Q;  1UEA B;  3QO2 A;  4A3D G;  1GJX A;  4L8J A;  1YIJ A;  1GUO A;  1VQ6 A;  4ULL A;  1PTO D;  4IOC A;  2Y0S G;  4IUU A;  1TS2 A;  4C2M H;  2E2J B;  2HIV A;  2R7Z B;  4ZK9 B;  2EDG A;  2NVQ H;  4R8I A;  3KUP A;  2B63 B;  2CH4 W;  4NW2 A;  5TSS A;  1D1I A;  3K5N A;  1K8G A;  1FR3 A;  4LF8 Q;  2H1E A;  1ICF B;  1H9M A;  5IYD H;  1FGU A;  3S16 B;  1A3T A;  3CPF A;  1D7Q A;  2K7V A;  1U4L A;  3DMU A;  3CRL C;  1K0R A;  4N8X 1;  1XXG A;  1UUP A;  1EY8 A;  3I4M B;  3I4O A;  1BBX C;  2ZXR A;  3OYY A;  4KY6 A;  1TWG H;  5I9P A;  1PHJ A;  3QG1 A;  1X65 A;  5ELC A;  5ELO A;  1SSO A;  3PO3 B;  3D6C A;  2MUY A;  4KKS A;  1WTO A;  5KIX A;  4IN3 A;  2V4D A;  4RA8 A;  4DAM A;  1PTO C;  4XT1 B;  3S17 B;  5AJ3 Q;  1STG A;  2A19 A;  1T9H A;  3HKS A;  1PH8 A;  3CCL A;  1CK1 A;  4CGY B;  3KDF B;  3MAQ A;  3DEO A;  3DWP A;  3GTQ H;  1U4P A;  1E1T A;  1UE5 A;  4KLK A;  3I8Z A;  3CC7 A;  4HSP A;  4OWX B;  4A3L G;  1CT1 D;  3R93 A;  2OQ0 A;  3E9H A;  1KRS A;  1YIT A;  4DV0 L;  2BE5 C;  3AFQ A;  2VUM H;  4LF7 L;  4HCS A;  1E24 A;  5KNB A;  1V9P A;  2RDF A;  4CDD C;  1O78 A;  3NBI A;  1UWV A;  1UE7 A;  3DLL A;  1VQ7 A;  4RG1 A;  3EFX D;  5E3F A;  4LF8 L;  3AQQ A;  4YHH L;  3CCM A;  2RCF A;  4POG A;  3AEV A;  2E2I B;  3BYY B;  1D5X C;  4CHT B;  2R7Z G;  3DHQ A;  1GVP A;  3C1F A;  3NHH A;  2NVY B;  2PI2 A;  4DR3 Q;  3QOL A;  2B2T C;  5KGU A;  1XMQ Q;  1XPU A;  4PZ8 A;  2Q2H A;  3FDT A;  5C4J B;  3EIV A;  4MIU A;  1KLU D;  1IBM L;  5M3M G;  1HFN A;  2QW7 A;  3BVM A;  1K3R A;  3NUC A;  1Y1W B;  2NN6 I;  4ZKB B;  1LTT D;  3Q0A A;  1F9Q A;  2WKC A;  4GLV B;  3GTK B;  3GTK H;  1CKN A;  4JG2 A;  4QQB X;  1KD1 C;  2HT1 A;  1B8A A;  5ELF A;  4A3D B;  3TEH B;  3VYR A;  1JQY D;  3CP0 A;  5CYU A;  3BZK A;  3OWE B;  2JA6 G;  5A35 A;  1HR0 Q;  4IFD H;  1HA6 A;  1VQP A;  1TWF B;  1GHJ A;  5J1Z A;  1QE6 A;  2E5L Q;  2XGT A;  2NVT H;  1RL2 A;  2IX0 A;  4A3K H;  3M3Y H;  1H9R A;  1NJI C;  3G71 A;  4FF1 A;  3HOZ B;  1Q3L A;  2X69 A;  1S4Z A;  3CCV A;  1MBY A;  1JJ2 A;  2B63 H;  2BH2 A;  3MZ5 A;  2F1M A;  4BY1 H;  2K4K A;  3K7A H;  3OSO A;  3J7Y W;  4IUR A;  5T1G A;  2ICE C;  2NYZ D;  1HTL D;  5CV4 A;  2K5N A;  2Z6B A;  5HY6 A;  2CHB D;  4ZQ3 A;  1KRT A;  2K5D A;  1II3 A;  2JK8 A;  1XX8 A;  1DGS A;  4DK6 C;  5I4D A;  4C3J B;  4DR5 Q;  4ID6 A;  3UE1 A;  3S24 A;  1ET6 A;  3HOU G;  4LFA Q;  2IJ0 A;  3U9O A;  4EQN A;  3I2Z A;  3MXN A;  2PNR C;  3KF6 A;  4B3S Q;  1J5E L;  2XNA C;  1KL9 A;  4LFA L;  1I6H H;  3TP6 A;  3HOV B;  2F4V L;  1AW7 A;  1V1P B;  4A76 A;  1TS4 A;  3NTK A;  2OTL A;  1FYC A;  3TZD A;  1V1P A;  2MO0 A;  1PFS A;  2K5H A;  2F0Q A;  2LSS A;  3U4V A;  4JBM A;  1PXU A;  3A7L A;  2F0U A;  3U4Z A;  3S1N B;  1J8I A;  3CHB D;  1TVX A;  2JA8 B;  4P2C B;  4DU9 A;  1TWH H;  1XMQ L;  3WOE A;  1V43 A;  2Q2U A;  1CKO A;  2NZH A;  1D1K A;  3VR5 A;  1ENC A;  2D2C C;  2Y0S E;  4TQU S;  1E0B A;  1EEI D;  2K1B A;  2AHO B;  5M5X B;  1A63 A;  5AFW A;  1MKH A;  1GD7 A;  2BCO A;  4MNO A;  4R4I A;  3FKI B;  3KJO A;  3GTO B;  4MTN A;  5JVG 3;  3IKJ A;  1KDC A;  1UE1 A;  4GOP A;  1AZQ A;  1A2T A;  3URY A;  4XDX A;  4CJ2 C;  4ZKC B;  4BBS H;  4G7H C;  5C5L A;  3MEF A;  3RD4 A;  2OT2 A;  4PMC A;  1VMC A;  3T13 A;  3K59 A;  2ENB A;  3OW7 A;  2NVX B;  1EY0 A;  2I46 A;  4KHV A;  1IBM Q;  4YCU A;  5FLX L;  3W1G A;  2XVS A;  5C3E G;  4OO1 H;  1JT8 A;  1XJV A;  2SEB D;  5CR3 A;  1X6O A;  1L0Y B;  4A3J G;  4IPH A;  4WJW A;  2SNS A;  1B50 A;  5C4J H;  5IYB H;  4YCV A;  5IOC A;  1SYD A;  3I4M H;  1EOT A;  2NVY H;  3WDN A;  5M5Y H;  4XQQ A;  3BG3 A;  3HP3 A;  3E6Z X;  5EPJ A;  2MQH A;  2D5D A;  3A54 A;  4C1N I;  2F03 A;  5C0X J;  5IT9 c;  4HJ7 A;  4LNQ A;  2AUK A;  5IGE A;  1H9K A;  1BOS A;  2WAQ E;  1S5F D;  5I2X A;  1GUG A;  1QVF A;  3M4P A;  1UAP A;  2ZTD A;  1TQO A;  3SEB A;  3SE0 A;  2LKV A;  3M9B A;  1R9T H;  4WRD A;  3OIQ A;  2EY6 A;  5NUC A;  4QIW E;  5DM7 3;  1GXD C;  4BY1 G;  5IGF A;  3PUZ A;  4CBV A;  4DK3 C;  2F4I A;  1M1K C;  4B9W A;  2EJF C;  3DXJ C;  2HQL A;  3I4N G;  1TII D;  4BBS G;  2FIN B;  5CV5 A;  3T1Y Q;  4DR2 Q;  3KK7 A;  2D9U A;  1HZA A;  1VQ9 A;  1KIX A;  4ABN A;  4B08 A;  3E3X A;  4LJZ C;  1PV4 A;  3VYT A;  4DA2 A;  2IHE A;  2F0L A;  4B3M L;  1RTN A;  4CDF C;  3J81 E;  2NZ1 D;  1S5C D;  1TY2 A;  2G9D A;  3D4R A;  5C4X H;  1XNR L;  1MHW C;  3D3R A;  4HJ5 A;  4JOI C;  2AUJ D;  3GTM B;  1OXU A;  2K33 A;  1CKN B;  1JR0 D;  2CQA A;  3SK4 A;  4YWK A;  4FDB A;  4IUT A;  3I55 A;  3M4O B;  4LFB Q;  2ATW A;  1F9P A;  1NR4 A;  4UDU C;  1WTW A;  4A93 H;  1SRO A;  3EA6 A;  3SXH A;  1K9M C;  2F0N A;  5IP7 H;  1VQI A;  1B4O A;  1G91 A;  1F77 A;  1E2V A;  4RCN A;  4PMW A;  1C48 A;  4DR6 Q;  4R9W A;  4HIM A;  3QOJ A;  1CZG A;  1JCK B;  2J7Z A;  3D4D A;  2RHS B;  2E8G A;  2PYK A;  4DR2 L;  1GUT A;  1Q7Y C;  5C4Z A;  4BS9 A;  1N34 Q;  1YEZ A;  1YNN C;  2EYH A;  1ZYR D;  4DV1 Q;  4NMZ A;  5C5M A;  4LFC Q;  4GN3 B;  1EIF A;  2JA9 A;  2I5L X;  4K6L A;  3HG9 A;  2A8V A;  4NDX A;  4DUY Q;  4DV3 Q;  2JA5 B;  3Q22 A;  3P20 A;  1LT6 D;  1SEB D;  3G48 A;  3Q6S A;  1L0W A;  2XTI A;  3TP7 A;  3S1R H;  5C3E B;  4GKJ Q;  1QZH A;  1RKN A;  1O7L A;  2EIF A;  5LMN Q;  3GTP B;  4IFD G;  5C0X G;  2L15 A;  4LFB L;  5CV6 A;  4DV4 L;  4OGQ C;  2JXM B;  1QNK A;  4FF4 A;  4DGZ A;  1W3S A;  1YHQ A;  3B6Y A;  3DWA A;  3F2U A;  4HTH A;  5KRU A;  1Q12 A;  4GS3 A;  1PTO F;  2GN5 A;  2UXB Q;  1AN8 A;  3K6O A;  4BA1 I;  1QZG A;  2IX1 A;  2DGY A;  2RBM A;  4RAU C;  2YYZ A;  4GLX A;  3L2P A;  3M4Y A;  3MWY W;  4K5V A;  4I7Z C;  1K83 H;  2B2W C;  2Z6K C;  1CQF A;  3FP9 A;  4WOR A;  4AQY Q;  3WOF A;  3S1M B;  1YNJ D;  1MJC A;  2C5C A;  2GVB A;  1A62 A;  1WCM G;  4DUY L;  4DV3 L;  1FD7 D;  1PRT C;  5G3L F;  1PH3 A;  1Q82 C;  2ALY B;  4BBR B;  1N34 L;  2N55 A;  3A56 A;  1HQM C;  2CFM A;  1QG7 A;  2E74 C;  2Z8L A;  4A3I G;  3ICE A;  2L11 A;  1AE2 A;  2JEA I;  3S2D B;  1D5Z C;  1HUM A;  1IHZ A;  2VY3 A;  2QGQ A;  2NTT A;  4KHP L;  4BXX G;  3FPP A;  1EYD A;  5GRO A;  5IYC G;  1TXY A;  5H1S E;  4QF4 A;  1I50 H;  4JI2 Q;  4P73 A;  3OWF A;  2AQ1 B;  4H44 C;  3T1Y L;  4GKJ L;  2P5Z X;  2UUB L;  3RLO A;  1CA5 A;  1WTH A;  2F52 A;  4A3G H;  1L1O B;  4KMU C;  1WTR A;  3GTM H;  1VQ8 A;  3FKI H;  3H0G G;  3PUY A;  1E3P A;  4YIJ A;  3RN2 A;  1KAA A;  2DN8 A;  4NXN L;  3T51 B;  3RN5 A;  2C9O A;  4DK0 A;  3I7F A;  2B2T A;  1EUJ A;  1NCV A;  2K01 A;  4DV6 Q;  1BBU A;  4FVM A;  1R4Q B;  1EY9 A;  3HOW G;  2Z0S A;  2OCE A;  3E5S A;  1GUS A;  3ERS X;  4NXM Q;  3F1Z A;  4HCE A;  4RWS C;  4OIJ A;  3SR1 A;  2UUC Q;  4X64 L;  2B2Y C;  2F0V A;  1A3U A;  3NEL A;  1PYB A;  2GVA A;  4A3G B;  4JI3 Q;  1EIY B;  2E2H H;  1WTQ A;  2A69 D;  1VCI A;  2XN9 C;  1FGB D;  4CKC A;  5IGD A;  1LTL A;  4YWM A;  4JI4 L;  1VQO A;  2YTY A;  3NPP A;  3W5O A;  1JOK A;  4JOI A;  2NUC A;  3K81 C;  3HOY G;  2HD3 A;  5HUR A;  3LWU A;  1PH9 A;  4O42 A;  5IWA Q;  4BBS B;  1VQJ A;  4HAE A;  4DAY B;  2B2W A;  2RSN A;  2B2Y A;  4DV1 L;  3A5Z B;  1J9O A;  2XWB B;  4UAI A;  5EGT A;  1NTG A;  4XIG S;  1I4R A;  4YY3 L;  3OMC A;  1Q90 A;  1PDQ A;  3DEP A;  1PZI D;  2KQ3 A;  3GTO H;  3MXU A;  2RCN A;  4K0K Q;  1VQN A;  4A3M H;  3RZD B;  2IL8 A;  3HOU H;  2A68 D;  3J7A V;  2MO1 A;  3M4Q A;  4A3E B;  1GO3 E;  1ET9 A;  4A3L H;  4IQZ A;  2K04 A;  1BF4 A;  4G7O C;  1PH6 A;  5BR8 Q;  1Q81 C;  2L0C A;  4R4T A;  2R7D A;  4BWG B;  5GQO A;  1I94 L;  4F87 A;  2JA5 H;  1PZJ D;  1YHB A;  3TZU A;  2R92 H;  1V1Q A;  3MHB A;  1Q46 A;  5CGK A;  4JCV E;  1PFB A;  3NEN A;  2TSS A;  4KHZ A;  1KNA A;  1E7Z A;  4ZLT F;  4JVZ A;  5IYC H;  3X3N A;  4KHP Q;  4ILW A;  4CKB A;  1SE3 A;  1SYG A;  3JAM c;  3J7A 5;  2B2V C;  1VQD A;  1STH A;  1K28 A;  3X3M A;  4C3I B;  1X3Q A;  1A3V A;  2KHS A;  4IPC A;  2K52 A;  2F4V Q;  5JEA H;  3NQI A;  2HHH L;  2K5W A;  1JOR A;  4A3I B;  1D6E C;  1QCB D;  4A3I H;  4A93 B;  1TWH B;  3EQL C;  3E0E A;  2SDF A;  1STA A;  2BDO A;  2E5L L;  3QIA A;  5IWA L;  3GTJ H;  3FPU B;  4K8J A;  1QJO A;  3TDQ A;  4IO9 A;  4YHH Q;  2L4N A;  3KDF A;  1SR3 A;  2PNH A;  1I4G A;  3S14 H;  2E2H B;  1Q1B A;  1SJE D;  3JAM E;  2VQE L;  4L5Q A;  2O4X A;  3BDO A;  5ELD A;  2LFN A;  1CM9 A;  3JAM L;  3L7Z C;  4A3F H;  4ZUI A;  1EFW A;  3NTI A;  4XYQ A;  1HZB A;  3BDL A;  1M8A A;  5EAY A;  4JI1 Q;  3I4M G;  3SK8 A;  3GDE A;  4N9T A;  1IL2 A;  1OXS C;  1IZ6 A;  1BCP D;  3HOW B;  1CSP A;  1BVS A;  2A74 C;  2AQ3 B;  2CH4 A;  4DV6 L;  5C3W A;  4V19 0;  4JPB W;  1DOL A;  4IOA A;  1X55 A;  1BO0 A;  3MEH A;  5EQ0 A;  5C6A A;  3K58 A;  2KA7 A;  4A3G G;  4KTA A;  3K0Y A;  5I6W A;  1QNU A;  4HJA A;  1HFG A;  1M90 C;  5IT9 E;  4KY7 A;  1JE4 A;  1X3G A;  2EY5 A;  1PH1 A;  3GV6 A;  4O2D A;  4LF7 Q;  4EQ5 A;  4TSS A;  3PIP 3;  2HCC A;  4JI1 L;  4DAV A;  3RNU A;  1WVL A;  1V1O A;  1N32 L;  1HXY D;  5HGT A;  3CXC A;  4JI7 Q;  3BS1 A;  2D0O A;  4R1J A;  1LTA D;  3HOZ G;  3OW2 A;  4QCL A;  5EBD A;  1B2T A;  3J7Z C;  1B1Z A;  1U0L A;  1A8V A;  1EY5 A;  3U50 C;  3IRB A;  3MC0 B;  1JC7 A;  3NE5 B;  2RA4 A;  3V2T A;  1RDP D;  2NVQ B;  1DON A;  3AU7 A;  4PV1 C;  1S3O A;  2BE5 D;  1I4P A;  1K3B C;  3CRK C;  2HHH Q;  3TS2 A;  4LF4 L;  2NB0 A;  4APV A;  4MZ9 A;  1BCP B;  2XWJ B;  4RHS A;  1RJT A;  2A73 B;  1HNZ L;  1JOQ A;  2A6H D;  3ND9 A;  5E7N A;  2NTS A;  3CCS A;  4L5S A;  2F3V A;  4N8F A;  1QVG A;  5C0X H;  5EJW A;  1LM0 A;  4GOP C;  1SNO A;  3BJU A;  4RKL A;  4R8N A;  2PW7 A;  4H0L C;  3IFT A;  1Y69 U;  2JA7 H;  2N8N A;  1EQR A;  1ZYR C;  2R7F A;  3ZJY C;  5FJ8 H;  4DV4 Q;  2UU9 Q;  2CW0 D;  3CCR A;  1FJG Q;  2RHQ B;  4IAL A;  3JAM i;  1S5D D;  2HQE A;  3PIP A;  3S17 H;  3K7U C;  3OHX C;  3MXN B;  3ULJ A;  3W3A A;  3CME A;  4A3E G;  4H13 C;  4K5X A;  4O0A A;  3STB D;  5BR8 L;  1U4R A;  1BR9 A;  3C2P A;  3SGI A;  3S14 B;  1TR5 A;  3W2D A;  4JI2 L;  1SMY C;  1EFI D;  2F0H A;  5JPM C;  4ZCK A;  3KBX A;  4A3K G;  4X65 L;  2EYP A;  1K8O A;  4YY3 Q;  4RFB A;  5F2D A;  2B39 A;  4KN7 C;  1VQM A;  1VQK A;  1HRJ A;  1B70 B;  1G2S A;  3A8I E;  4J1M A;  1HNW L;  3VDY A;  3PUW A;  5AJ3 L;  4AQY L;  1EL0 A;  1QUQ B;  2QDB A;  1XNQ Q;  3GP7 A;  3BZC A;  3F2D A;  5GAG C;  1E22 A;  3D0F A;  5CC4 A;  1NAP A;  4DR5 L;  2CKZ B;  2CQO A;  5E1F A;  3A5U A;  5JVH 3;  4DKA C;  1XNQ L;  1JJC B;  3J81 L;  1MSG A;  5C44 B;  2PMZ E;  1EY7 A;  1WD1 A;  5DNF A;  2DY8 A;  1N32 Q;  1Z47 A;  1JIC A;  5JJK A;  1OO9 B;  5JOB A;  4A3J H;  1BXT A;  2B8G A;  2XRS D;  3TP5 A;  3VYS A;  3MXP A;  3KYH C;  4GOP B;  1PYS B;  4H7B A;  4Q0F A;  5EKK A;  3ULL A;  2DJF C;  4RGN A;  1N36 L;  1YI2 A;  3HOZ H;  4LUV A;  5BN5 A;  1JWM D;  4QB4 A;  2R61 A;  4C3I G;  1H9S B;  4S3S A;  3CMA A;  1I3Q B;  2FHT A;  4PG3 A;  1I3Q H;  5JJI A;  1KLG D;  1F2Y A;  1GKH A;  5BN4 A;  1I4Q A;  3PGZ A;  3VA7 A;  5D3D A;  1EYA A;  2EYO A;  3SK6 A;  3FEW X;  5M5X H;  2IX3 A;  2B29 A;  2JP1 A;  4O1N A;  3OTO L;  3Q24 A;  3AFP A;  4RGO S;  5KNC A;  2KUM A;  2PQE A;  1SYB A;  3M7G A;  4KN4 C;  2QEX A;  1A15 A;  2CW0 C;  4PQX A;  4YWL A;  4K0K L;  2K03 A;  3A0J A;  4GN4 B;  3CU7 A;  2KCC A;  4QY7 A;  2K14 A;  5COR A;  3J80 i;  4DN4 M;  3ZYY X;  2PW5 A;  1A2U A;  2PQA A;  5FLX E;  2N78 A;  1OTC A;  4DR7 L;  1EWC A;  5FO7 B;  4B3S L;  2F0T A;  4DXG A;  1GOZ A;  2E2I H;  4PZ6 A;  4I65 A;  2G5D A;  3CCJ A;  1AZP A;  4DNT B;  3AYH B;  2BA0 A;  3J81 j;  4DV5 L;  1LAB A;  5LMN W;  1LTS D;  3A8K E;  2JN4 A;  3GQB A;  4IFD J;  1DCZ A;  1HHV A;  1PLF A;  1R4P B;  1O7Y A;  3PIO A;  2Q8I B;  3TBI B;  2WB1 B;  2R93 H;  1NNX A;  2QA4 A;  1NY4 A;  3LX0 A;  3KLS A; 
#chains in the Genus database with same CATH homology
 1MJE A;  3K80 C;  4LFC L;  2WB1 G;  4AQY Q;  1YJ9 A;  1MJC A;  2GVB A;  1A62 A;  1WCM G;  4DUY L;  4DV3 L;  4B3M Q;  3S16 H;  1KHI A;  4A3D G;  1KXL A;  3G6E A;  1PH3 A;  4EX5 A;  1YIJ A;  1CKM A;  1N33 Q;  2AMC B;  1VQ6 A;  1VQL A;  1Q82 C;  2ALY B;  2K75 A;  4B3T L;  1N34 L;  3BU2 A;  4IOC A;  2Y0S G;  2CFM A;  1EWI A;  4A3I G;  4A3F G;  2F3I A;  4C2M H;  4DR4 Q;  3S2D H;  2AWN A;  2HIV A;  3ICE A;  1AE2 A;  2JEA I;  4JI5 Q;  2VY3 A;  2JA7 G;  2QGQ A;  5C4X G;  1HNX Q;  4KHP L;  2V1C C;  2NVQ H;  4A3C H;  4BXX G;  2OTJ A;  4C3H H;  4DV7 Q;  3HOV G;  5GRO A;  4POF A;  2KCT A;  5IYC G;  1TXY A;  4IPG A;  4OXP A;  2ZM6 L;  2UU9 L;  5H1S E;  3DM3 A;  3RLF A;  3PF5 A;  2K50 A;  1I50 H;  4LW1 A;  4NB3 A;  1FJG L;  4JI2 Q;  1N36 Q;  3PUX A;  4P73 A;  1K8G A;  4LF8 Q;  3L0O A;  4IFD I;  3T1Y L;  4GKJ L;  4P71 A;  5IYD H;  1FGU A;  3CPF A;  2UUB L;  1K73 C;  3RLO A;  2F52 A;  1D7Q A;  4A3G H;  1L1O B;  3S1M H;  3GTM H;  2R93 G;  1SLJ A;  1VQ8 A;  4X66 L;  1X56 A;  4JC0 A;  4PZ7 A;  4JYA Q;  1K0R A;  3FKI H;  3H0G G;  3PUY A;  1E3P A;  3RN5 A;  3RN2 A;  4NXN L;  4QGU A;  1A0I A;  4UPA A;  5ELN A;  3HFZ B;  3I4O A;  4AH6 A;  2UUA L;  4LF4 Q;  3I7F A;  3OYY A;  1HR0 L;  2JA8 G;  1EUJ A;  4DV6 Q;  1TWG H;  4A4I A;  1BBU A;  1X3E A;  5IYD G;  3A74 A;  1PHJ A;  1KQS A;  1X65 A;  5ELO A;  4DV5 Q;  2OWO A;  1OXX K;  1TWF H;  3HOW G;  2Z0S A;  2JJQ A;  2OCE A;  1HNZ Q;  3UDG A;  3ERS X;  4JBJ A;  5IYB G;  4DAM A;  1OXT A;  3F1Z A;  4NXM Q;  4NXM L;  5AJ3 Q;  1G51 A;  4BBR G;  2A19 A;  1T9H A;  1G6P A;  4LF6 L;  3HKZ E;  5M5W H;  1FJG Q;  2UUC Q;  3HKS A;  4X64 L;  1WFQ A;  1PH8 A;  3CCL A;  3J81 c;  5LMN L;  3KDF B;  3NEL A;  1PA6 A;  1JJG A;  1XNR Q;  3KLW A;  1FL0 A;  1HH2 P;  1PYB A;  5JEA G;  3T1H L;  3GTQ H;  2GVA A;  1E1T A;  1UE5 A;  4KLK A;  2E2H H;  1EIY B;  4JI3 Q;  1YHA A;  3I4N H;  4XTC S;  1VCI A;  2VQE Q;  3CC7 A;  2ZJR A;  1VQF A;  4OWX B;  4A3L G;  3ER0 A;  2VNU D;  2OQ0 A;  3E9H A;  1LTL A;  1Y1V H;  3HKZ G;  4YWM A;  1VQO A;  4JI4 L;  2YTY A;  1WCM H;  5FLM H;  1KRS A;  3W5O A;  1YIT A;  4DV0 L;  2VL6 A;  3AFQ A;  2VUM H;  4DNI A;  4JOI A;  4LF7 L;  1WI5 A;  1SRU A;  2ASB A;  4J15 A;  1E24 A;  4JBW A;  4L5T A;  4IPD A;  1YJW A;  4TVA B;  3K81 C;  1V9P A;  4GLA C;  2I0Q A;  4H02 A;  3HOY G;  5FLX c;  2EXD A;  2JA8 H;  1PH9 A;  1UWV A;  1JE5 A;  1UE7 A;  1YBY A;  3UDF A;  3Q8D A;  5IWA Q;  4X62 Q;  5FLM G;  3DLL A;  1IBL Q;  1VQJ A;  1VQ7 A;  1O7I A;  4DAY B;  3GO5 A;  4RG1 A;  1YZ6 A;  3A5Z B;  4DV1 L;  4LF8 L;  3AQQ A;  4YHH L;  3CCM A;  1NTG A;  2H5X A;  2B3G A;  4X62 L;  4X64 Q;  2WFW A;  4XIG S;  2JA6 H;  2ZTC A;  2EQS A;  3WWV A;  5IE8 A;  4POG A;  4YY3 L;  2BA1 A;  1Q86 C;  3AEV A;  1QUQ A;  1X3F A;  2YTX A;  2R7Z G;  1GVP A;  3GTO H;  3T1H Q;  2RCN A;  4K0K Q;  1VQN A;  1JB7 A;  1HZ9 A;  2PI2 A;  4DR3 Q;  1VQE A;  4A3M H;  1XMQ Q;  1XPU A;  3HOU H;  3S1Q H;  4PZ8 A;  3KJP A;  2Q2H A;  4A3E H;  1N8R C;  2MO1 A;  3M4Q A;  4UP9 A;  4A3B G;  1GO3 E;  3H15 A;  3EIV A;  1KC8 C;  4JI4 Q;  1VQ5 A;  3PCO B;  3CCE A;  4A3L H;  3I56 A;  1IBM L;  1PH6 A;  5BR8 Q;  5M3M G;  1Q81 C;  4R4T A;  2R7D A;  1K3R A;  4JI8 Q;  1SMX A;  5GQO A;  1I94 Q;  2NN6 I;  1I94 L;  2JA5 H;  1FVI A;  1YHB A;  1TWA H;  3EBE A;  4DV7 L;  1S40 A;  3PV0 A;  2R92 H;  1V1Q A;  4GLV B;  4HJ9 A;  1NMG A;  3NEM A;  1HR0 W;  1CKN A;  1Q46 A;  4JG2 A;  3GTK H;  4QQB X;  1KD1 C;  4JCV E;  4OO1 I;  2HT1 A;  3NEN A;  3ULP A;  1B8A A;  3PF4 A;  4AYB G;  2UXC L;  4KHZ A;  3TEH B;  4LF9 Q;  3H3V I;  1E7Z A;  4L5R C;  4GKK L;  3CP0 A;  2CWA A;  3BZK A;  4X66 Q;  1EYG A;  4JYA L;  5IYC H;  2KBN A;  4KHP Q;  5IP9 H;  3JAM c;  3J7A 5;  2YV5 A;  2JA6 G;  4GN5 A;  2UXB L;  4B3R Q;  1E1O A;  1VQD A;  5LMU Q;  1YJN A;  1HR0 Q;  3KOJ A;  5J3B A;  4IPC A;  1VQP A;  2K52 A;  2F4V Q;  3M4O H;  3CCQ A;  4NXN Q;  3PO3 H;  2E5L Q;  2I5H A;  2Q2I A;  2XGT A;  2NVT H;  1RL2 A;  2HHH L;  2IX0 A;  2N3S A;  4OWT B;  4A3K H;  3M3Y H;  2IT1 A;  2CWP A;  3FKI G;  4A3I H;  3G71 A;  1NJI C;  2IHF A;  1VS0 A;  3E0E A;  3RLN A;  3CCV A;  3S15 H;  4GNX B;  1JJ2 A;  2E5L L;  2HIX A;  5IWA L;  4IJH A;  2B63 H;  3GTJ H;  2BH2 A;  2Z6K A;  1XPR A;  1OXV A;  4BY1 H;  2K4K A;  3K7A H;  4DR1 Q;  1JMC A;  4IO9 A;  2VUM G;  3HOV H;  3GD7 A;  4YCW A;  1W2B A;  4YHH Q;  4A3M G;  2UUC L;  3PUV A;  3KDF A;  4LF6 Q;  1SR3 A;  2PNH A;  3JC6 6;  3S14 H;  4WJ4 A;  1Q1B A;  2VQE L;  4L5Q A;  2K5N A;  5HY6 A;  1KRT A;  4LWC A;  2D62 A;  2AWO A;  2ZJQ A;  2JK8 A;  3L7Z C;  4DPG A;  4A3F H;  1EFW A;  4R4O A;  4C3J H;  1PVO A;  1DGS A;  4DK6 C;  1HZB A;  2VQF Q;  5EAY A;  4JI1 Q;  3I4M G;  4DR7 Q;  4DR5 Q;  3UE1 A;  3S24 A;  3GDE A;  3HOU G;  4BY7 H;  4DUZ L;  1Y1W H;  4LFA Q;  4DV0 Q;  1PH5 A;  1IL2 A;  2MFI A;  1IZ6 A;  1OXS C;  5IP7 G;  3I2Z A;  1KAW A;  4B3S Q;  3KF6 A;  1CSQ A;  1CSP A;  4LF9 L;  1J5E L;  1BVS A;  2UXD Q;  1KL9 A;  1N9W A;  5C3E H;  2VW9 A;  4DV6 L;  4OO1 G;  4R4Q A;  4LFA L;  1I6H H;  3K8A A;  4P72 A;  1VQH A;  2KCM A;  2F4V L;  3CPW A;  4A76 A;  4LUZ A;  3UDI A;  2UXC Q;  4ALP A;  2OTL A;  4IOA A;  1X55 A;  2MO0 A;  1PFS A;  4UP8 A;  4A3G G;  2K5H A;  3UE0 A;  5M3F G;  3U58 A;  1TWC H;  1G29 1;  2LSS A;  3RZD H;  3H3V H;  3U4V A;  5C44 G;  4JBM A;  1VQA A;  5IY0 A;  3J81 i;  4HJA A;  1HZC A;  4LF5 Q;  3U4Z A;  3LGJ A;  3TS0 A;  1M90 C;  2KHJ A;  3F8T A;  1TWH H;  2R7Z H;  1XMQ L;  4DR1 L;  1X3G A;  1V43 A;  2LXJ A;  2Q2U A;  2UU9 Q;  1CKO A;  2NZH A;  1HNW Q;  1WYD A;  1BBW A;  4KI0 A;  1PH1 A;  1L1O C;  4ME3 A;  4AIM A;  4HID A;  4O2D A;  1P8L A;  4WJ3 M;  1NMF A;  4LF7 Q;  4EQ5 A;  2Y0S E;  2LXK A;  1HNX L;  3CW2 C;  4IJL A;  4TQU S;  1VQ4 A;  4JI1 L;  3RNU A;  2AHO B;  2UXD L;  3GTP H;  1GM5 A;  1N32 L;  1A63 A;  3CXC A;  4JI7 Q;  4A3B H;  4JI5 L;  1WJJ A;  1MKH A;  1GD7 A;  4MNO A;  2D0O A;  4R1J A;  4R4I A;  3KJO A;  5JJL A;  4MTN A;  3UDX A;  3HOZ G;  3OW2 A;  4A93 G;  2IY5 B;  1PH7 A;  3J7Z C;  3K0X A;  4C3I H;  2N49 A;  2ZJP A;  1BKB A;  1CUK A;  1UE1 A;  4GOP A;  1U5K A;  1UEB A;  3RR5 A;  1U0L A;  4X6A H;  1A8V A;  2E2J H;  5DLQ E;  3U50 C;  3IRB A;  3TRE A;  4GNX C;  3F2C A;  4UY8 C;  4JI6 Q;  4BBS H;  3TRZ A;  1Y1V G;  1WOC A;  1SFO H;  1L1O A;  3CAM A;  3MEF A;  1Y14 B;  1S3O A;  2PI2 E;  2YTV A;  4OX9 Q;  2HHH Q;  1PH4 A;  3TS2 A;  2DUD A;  2ES2 A;  1VQG A;  3W1B A;  4LF4 L;  2KHI A;  4APV A;  4JV5 L;  1IBM Q;  5C0X I;  2YU9 H;  4MZ9 A;  3CC2 A;  4DV2 Q;  1SE8 A;  4YCU A;  3W1G A;  5C3E G;  4BA2 I;  2I5M X;  1XJV A;  1ASZ A;  1JT8 A;  1HNZ L;  4P75 A;  3GTG H;  5E7N A;  4GNX A;  1Z9F A;  1X6O A;  3CCS A;  4L5S A;  4A3J G;  4IPH A;  1LUZ A;  5C4J H;  5IYB H;  4DV2 L;  4YCV A;  4JI3 L;  1QVG A;  4JI7 L;  1LM0 A;  4UP7 A;  4GOP C;  3I4M H;  2NVY H;  3BJU A;  1XMO L;  5M5Y H;  2JA7 H;  2N8N A;  1EQR A;  2R7F A;  5FJ8 H;  3ZJY C;  2MQH A;  4NPS A;  3CF5 A;  3CCR A;  4DV4 Q;  2Q2T A;  2RHQ B;  5C0X J;  4DR3 L;  5IT9 c;  4HJ7 A;  4LNQ A;  5GAD C;  3S2H H;  3KF8 B;  3JAM i;  3FHW A;  2WAQ E;  3PIP A;  1QVF A;  2ZM6 Q;  3K7U C;  3M4P A;  3S17 H;  3MXN B;  3ULJ A;  3CME A;  2ZTD A;  4A3E G;  4DR4 L;  3CCU A;  4O0A A;  3STB D;  5IP9 G;  5BR8 L;  3M9B A;  1R9T H;  1H95 A;  1B7Y B;  1ASY A;  2JQO A;  4A3D H;  2VQF L;  1IBL L;  4QIW E;  3SGI A;  3M7N A;  2UUA Q;  4BY1 G;  1XTD A;  1IYJ B;  1VQC A;  3KF6 B;  4JI2 L;  3HOX H;  3PUZ A;  4DK3 C;  5M3F H;  4JI6 L;  1M1K C;  4A3K G;  5C44 H;  2HQL A;  4X65 L;  4BY7 G;  4X65 Q;  3I4N G;  4YY3 Q;  2A1A A;  1HJP A;  4BBS G;  2C35 B;  4OWW B;  4JV5 Q;  5JEA J;  3T1Y Q;  4DR2 Q;  1VQM A;  3PO2 H;  1VQK A;  4A75 A;  1B70 B;  4HJ8 A;  4OX9 L;  1HZA A;  1VQ9 A;  1KIX A;  1HNW L;  3VDY A;  1NE3 A;  3CC4 A;  2VS1 A;  1PV4 A;  3PUW A;  5AJ3 L;  4AQY L;  4DR6 L;  1QUQ B;  1XNQ Q;  2IHE A;  2ZTE A;  3GTL H;  4JI8 L;  4B3M L;  3F2D A;  3BZC A;  2VZA A;  5GAG C;  1E22 A;  3D0F A;  5C4X H;  4DR5 L;  2CKZ B;  4LF5 L;  1XNR L;  2CQO A;  3A5U A;  1J6Q A;  4BXX H;  4HJ5 A;  4P74 A;  3CQZ H;  4DKA C;  4JOI C;  1XNQ L;  4B3T Q;  1JJC B;  1OXU A;  5FJ8 G;  1CKN B;  1X9N A;  2PMZ E;  1P16 A;  3PSI A;  2JA5 G;  1AE3 A;  1N32 Q;  3PO3 G;  1Z47 A;  2NZO A;  1Q8K A;  4YWK A;  5JJK A;  4FDB A;  1LYL A;  4A3J H;  3TQY A;  1XMO Q;  3I55 A;  2JEB I;  4GOP B;  1IXR A;  3KYH C;  4LFB Q;  2WB1 E;  1X54 A;  2ATW A;  1PYS B;  1I5F A;  2RF4 A;  3ULL A;  1N36 L;  3HOY H;  1YI2 A;  2ID0 A;  3HOZ H;  4LUV A;  4A93 H;  1SRO A;  4A3C G;  1K9M C;  3PO2 G;  2FXQ A;  4LUO A;  5IP7 H;  1VQI A;  1L2F A;  3CMA A;  4PG3 A;  4PMW A;  1I3Q H;  5JJI A;  1S72 A;  1GKH A;  4DR6 Q;  3PGZ A;  4JI0 Q;  4HIM A;  3E9I A;  2KEN A;  1J5E Q;  1RIP A;  1PH2 A;  5M5X H;  5M3M H;  1NBW A;  2RHS B;  4RMF A;  1AH9 A;  2B29 A;  2E8G A;  3OTO L;  4DR2 L;  3M85 A;  1Q7Y C;  4JI0 L;  3AFP A;  4BBR H;  3HOX G;  1N34 Q;  1IBK Q;  1YEZ A;  3STB C;  1Y1W G;  2QEX A;  4DV1 Q;  1N33 L;  3OTO Q;  4LFC Q;  4YWL A;  4GN3 B;  1EIF A;  2JA9 A;  2I5L X;  5HGQ A;  5GAE C;  3A0J A;  4K0K L;  4GN4 B;  4DUY Q;  4DV3 Q;  1IBK L;  2A8V A;  4QY7 A;  3HOW H;  4Y52 H;  2K5V A;  2K14 A;  3J80 i;  4R4C A;  4Y7N H;  3G48 A;  1L0W A;  1UE6 A;  2PQA A;  2XTI A;  4GKK Q;  3G4S A;  2N78 A;  4DUZ Q;  1EOV A;  2AKW B;  3S1R H;  1K8A C;  1OTC A;  2NVX H;  4GKJ Q;  2PQA B;  1QZH A;  2EIF A;  3D31 A;  5LMN Q;  2WP8 J;  2D0P A;  4JBK A;  1VQB A;  4DR7 L;  4IFD G;  5C0X G;  4B3R L;  2L15 A;  3H0G H;  4LFB L;  4DV4 L;  5LMU L;  1SN8 A;  4QL5 A;  4HIK A;  3J80 c;  2JE6 I;  1W3S A;  2NN6 G;  4B3S L;  1YHQ A;  3B6Y A;  2E2I H;  4PZ6 A;  3CD6 A;  2WAQ G;  3RZO H;  1YVC A;  3CCJ A;  1C9O A;  2BH8 A;  5K36 G;  5GAH C;  3AYH B;  2BA0 A;  3J81 j;  2B63 G;  3NBH B;  1Q1E A;  1C0A A;  4DV5 L;  1Q12 A;  4GS3 A;  4QJF A;  4AYB E;  5LMN W;  3S1N H;  1QVC A;  2R6G A;  2GN5 A;  2UXB Q;  4HIO A;  2R92 G;  4IFD J;  3KFU A;  4BA1 I;  1QZG A;  2IX1 A;  4OON A;  2DGY A;  2OQK A;  1XPO A;  1D8L A;  2YYZ A;  1C7Y A;  1MIU A;  2CCZ A;  1EQQ A;  3PIO A;  4GLX A;  1YNX A;  3L2P A;  3F2B A;  2UUB Q;  2R93 H;  1K83 H;  2Z6K C;  1NY4 A;  2QA4 A;  3FP9 A;  2MNA A;  3EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...