1I5FA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
b'MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD-SHOCK PROTEIN CSPB
molecule tags Transcription
source organism Bacillus caldolyticus
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i5fA00
4IFDJ 4DAYB 3RLNA 4P74A 1PH1A 3NBHB 4JBKA 3PUWA 1AE3A 1XTDA 3T1HL 1IZ6A 3JAMc 5EAYA 2R7ZG 4JI7Q 5JJKA 1VQAA 4LF9Q 3AQQA 1JJ2A 1LYLA 1IXRA 3S17H 5FJ8G 4IJHA 4A76A 4PMWA 3RNUA 4MZ9A 2JEAI 2I0QA 1I94L 3GTGH 4IO9A 1VQLA 2VUMH 1YHBA 4KHPQ 2LSSA 2IT1A 3AEVA 1V43A 1XMQL 3A0JA 4QGUA 1X65A 1Q12A 2R7FA 4LW1A 2MNAA 3ICEA 4DR4Q 4C3HH 3GDEA 1TWFH 2UU9Q 4KHZA 2KCMA 3M4QA 2LXKA 1TWHH 2MO0A 3PUZA 1K9MC 4JI3Q 4DKAC 3CCEA 2JA5G 4LF5Q 5JJIA 4Y52H 4AQYQ 1IBLL 5C4JH 2OCEA 4HJ9A 3B6YA 3GTJH 1U5KA 4JI4Q 1N34L 4A3FH 1S72A 1VQ9A 2F3IA 3KYHC 2I5LX 1GM5A 2VY3A 1VQ6A 1KXLA 4A3CG 2BH8A 1SROA 4PZ7A 3G71A 1TXYA 3U4ZA 1R9TH 1OXVA 2CCZA 2RHQB 3AYHB 2ZM6Q 1A63A 4LFBQ 4FDBA 1Q8KA 2HIVA 2PQAB 3PF5A 1PH8A 4P73A 4OXPA 5IYCG 1WYDA 4JI1Q 4TVAB 5IP7H 1K0RA 4POGA 3PIPA 3GTOH 4A3GG 1D7QA 3KF6B 4JI5L 3I4OA 3HOZH 3WWVA 3GD7A 4YHHL 3RLFA 2JK8A 4BY1G 3RR5A 3PUVA 1EQRA 4DUYQ 1I3QH 4PZ8A 3L2PA 1SLJA 2A1AA 4YCVA 3KF8B 4IPDA 4JI1L 3CPWA 2PI2A 1HZ9A 2UUCQ 4A3KH 2JQOA 4KLKA 1EQQA 1H95A 1K83H 1QUQA 3J81j 2EIFA 1VQKA 1HR0L 4BA1I 1JJGA 3F2BA 2CFMA 4RMFA 5IWAL 2Q2UA 3KLWA 5JEAJ 1OXXK 1MIUA 1EWIA 4B3TQ 2NVXH 1K73C 2JA5H 4QY7A 1B7YB 4ALPA 2JEBI 1M90C 3TS2A 2WB1E 3FHWA 3CQZH 3CXCA 1WJJA 4DV7Q 1XMQQ 1UE5A 2B63G 4K0KL 1JT8A 3ULJA 3E9HA 1RIPA 2AWOA 2B63H 4KI0A 2ATWA 1J6QA 4QIWE 3Q8DA 3G6EA 3PSIA 4JCVE 1A0IA 1HH2P 1JB7A 4YCUA 1JJCB 2VUMG 1D8LA 1L2FA 2QEXA 3CCRA 3F2CA 5E7NA 2D0PA 2D62A 1RL2A 4OO1I 1VQCA 1YHAA 4BBSH 4X66L 1XNQL 1BBUA 1SFOH 1VQ8A 2OTLA 4NXNQ 2JE6I 4EX5A 3EN2A 2Y0SE 2Q2TA 4B3ML 4HIMA 1Q46A 1HNXL 2BH2A 4DR6L 3OW2A 1Q81C 1MKHA 1Y1WH 1KHIA 3PGZA 3A5ZB 5IYCH 1Y1VH 1IBKQ 1WCMG 3S2DH 2XGTA 4GN4B 4DAMA 1KD1C 3K8AA 2E2JH 1B70B 1LUZA 4QJFA 4GKKQ 4IOAA 4JI8L 4GN5A 1VQJA 5IYBG 2YTXA 1XPOA 1EIFA 1SR3A 1Q1EA 1WOCA 3GTPH 5GAGC 4XTCS 4WJ4A 2NVQH 1Q1BA 4UP9A 3M7NA 1QZHA 4A3JH 3D0FA 3S24A 2EQSA 4JI6L 1YZ6A 4OO1G 3CW2C 2R93H 3HOUG 1YJ9A 2R93G 4JV5L 5IP9H 3RN2A 1HNXQ 2JA6G 3PUXA 4IJLA 2ASBA 4B3MQ 3GTKH 3KFUA 2QA4A 3CCUA 1E1OA 2K75A 3KOJA 4DR5Q 4IPCA 5ELOA 4UY8C 3W5OA 4DV4Q 1PVOA 2FXQA 2JA6H 2DUDA 1AH9A 5IE8A 4JG2A 3OYYA 3CP0A 2OQ0A 3U4VA 2AMCB 3LGJA 1VQNA 4LF7L 1YI2A 1B8AA 2C35B 3KDFB 1VCIA 2VNUD 4L5SA 2YU9H 4JI8Q 3U50C 3CC4A 1NE3A 3PO2H 4GKKL 1XMOQ 2E5LQ 2QGQA 4R4CA 5GQOA 5C4XG 2UU9L 3HOXH 4Y7NH 1XNRQ 4DV6Q 1UWVA 5IYBH 3F8TA 1IBML 4JYAQ 1V9PA 4A3LG 4BBRH 2E8GA 3F1ZA 3TQYA 3RN5A 1G51A 1VQHA 2CKZB 3GTLH 4BA2I 4A93H 4X62Q 2VL6A 1KIXA 1S3OA 1SRUA 1N33Q 4DV3Q 1XNRL 3BJUA 2R92G 5FLMH 4X66Q 3CCSA 3GTMH 1BBWA 2WFWA 4LF5L 2WAQG 3S1MH 3PO3G 4BY7H 1N33L 3J7ZC 2VQFL 1K8GA 1HNWQ 1VQEA 4HIKA 2ZJQA 4NXMQ 3CD6A 1GO3E 1UEBA 2HQLA 4DUZQ 4HIOA 4X65Q 1YJNA 1C7YA 1ASZA 1VQ5A 2IY5B 2I5HA 1Z9FA 1CKOA 5LMNL 2KCTA 1QZGA 5BR8Q 1XMOL 2V1CC 4L5TA 1JE5A 1VQ7A 2E5LL 4P71A 3GO5A 2PI2E 2PMZE 1GD7A 4JI7L 4HJAA 2F4VQ 2YTYA 4UPAA 3J81i 3OTOQ 4A3KG 3K80C 1JMCA 3L7ZC 3HOUH 1OTCA 3UDXA 3UE0A 4EQ5A 4DR5L 1VQPA 1VQFA 3KDFA 3ER0A 3JC66 5C0XG 2NVYH 5M3MG 4DUYL 1HZCA 3FKIG 4AQYL 1GKHA 3J7A5 2K50A 3CC7A 1Y1VG 4R4OA 1PYBA 2WB1G 1FJGL 4DR7Q 5C44G 2ES2A 1N32Q 2N49A 4IOCA 1IBKL 2R7ZH 1X3EA 2YYZA 4XIGS 4GOPA 1E22A 2CWAA 5LMUQ 3PV0A 4BY7G 3J80i 3S1NH 3E9IA 4DPGA 3TRZA 2NZHA 1L0WA 3AFQA 3I2ZA 4YWMA 5BR8L 3J81c 1QVCA 4A3MG 1YBYA 1VQMA 4H02A 5LMNQ 1TWCH 1X3FA 5AJ3Q 2OQKA 1HNZL 4LF7Q 3I4NH 4JC0A 1CUKA 2F52A 1I50H 4LF6Q 4DV1L 4DNIA 1SN8A 3VDYA 2E2IH 2IHFA 1X54A 3S14H 4A3LH 5GAEC 1J5EQ 4OWXB 2RF4A 1TWGH 3BZKA 3UDFA 1VS0A 4A75A 2KENA 5GROA 1U0LA 1NTGA 4A3GH 4LNQA 3M85A 2IHEA 3UE1A 4A4IA 4A3DH 1C0AA 2HIXA 1N36Q 5C0XI 1BVSA 2ZTCA 4DV5L 3FKIH 2MQHA 2Q2IA 5M5WH 3HKZE 3MXNB 4DV2L 2UXBQ 2JA8H 4LUOA 2K5VA 4NB3A 1VQOA 1KAWA 4DV7L 1SE8A 3I4MH 4BBSG 4JI0Q 1HNWL 3BU2A 4B3TL 1Z47A 4YWLA 4UP7A 4KHPL 4PZ6A 2K5NA 5GAHC 4P75A 4DR2L 3CMEA 1NBWA 3H0GG 4POFA 5M3FG 3D31A 4YWKA 1QVGA 1I94Q 4AYBG 1I6HH 1PFSA 3HOWH 3A74A 4R4QA 2UUBL 2UXCL 2GN5A 4A3IH 1Q86C 4OX9Q 1CSPA 1KC8C 1W3SA 3T1HQ 3H0GH 4LUZA 1VQBA 4GS3A 1VQIA 2B29A 4DR3Q 1LTLA 3GTQH 3S15H 4C2MH 5JEAG 3MEFA 1I5FA 2R7DA 3PIOA 3A5UA 3UDGA 3DM3A 1KQSA 3H3VI 4ME3A 3I4MG 4HJ5A 2UXBL 1KRSA 3TS0A 2YV5A 1X55A 1WFQA 3AFPA 2F4VL 2NZOA 1KL9A 2ZJRA 1PV4A 1ASYA 2JA7H 3H15A 4GLXA 1UE6A 3M3YH 5DLQE 2UUCL 3TREA 3TEHB 1C9OA 1HZAA 3ULLA 2I5MX 3ULPA 3CCLA 3ZJYC 2R6GA 1CKNA 2DGYA 5C3EG 1W2BA 3ERSX 4YCWA 1DGSA 3SGIA 3STBC 1S40A 1PH3A 2Z6KA 5M3MH 4DR7L 4X65L 2GVAA 4LF8Q 4DV1Q 1P16A 1CKMA 1E24A 2MFIA 5IT9c 4L5RC 4K0KQ 1QUQB 5C44H 2UUBQ 2UXCQ 5C3EH 1UE1A 3M9BA 2KHIA 5LMUL 3EIVA 1HZBA 4C3IH 2YTVA 3CAMA 2AHOB 1M1KC 2EXDA 2E2HH 2A19A 1Q82C 4IFDI 4A3IG 4JI6Q 5FLXc 2VQEL 3CF5A 2UUAL 4LF4Q 3HOWG 3NENA 1HR0W 1LM0A 2XTIA 3RZDH 3HKSA 1X56A 1PYSB 4NPSA 1PH7A 4A3CH 2VW9A 1G291 4A3EH 4AIMA 2IX1A 5FJ8H 1IBLQ 4NXNL 2HHHL 3H3VH 2ALYB 1XNQQ 4DV5Q 4A3DG 4WJ3M 4X64Q 3S1QH 4JI5Q 3I56A 1KRTA 5IP9G 3G4SA 1N36L 3K7UC 1YVCA 2K5HA 2VZAA 2K52A 3T1YQ 1XPRA 1OXSC 4DR1Q 1YIJA 4GOPB 4GKJL 3HOYH 1CKNB 3KJPA 3S2HH 4YY3L 4DV0L 3CC2A 4DR6Q 2WP8J 1P8LA 3I4NG 5IY0A 4LFBL 5K36G 2IX0A 2ZTDA 3RLOA 4A3MH 1CSQA 1XPUA 5AJ3L 4R4TA 4APVA 1EOVA 4JYAL 2OTJA 4LFAQ 4HJ8A 1N8RC 2N3SA 4JV5Q 4JOIC 2ZTEA 1NMFA 1PA6A 2UUAQ 5C4XH 1Q7YC 2VQEQ 1K8AC 1IBMQ 4O0AA 2VS1A 1FVIA 4LF4L 2B3GA 4OX9L 1FL0A 4LFCQ 4IFDG 1G6PA 2KBNA 1YEZA 1EUJA 3W1GA 1PH4A 2CQOA 1FJGQ 1Y1WG 1PH6A 4X64L 3CCVA 2L15A 1L1OC 1V1QA 3I7FA 4JBWA 4GOPC 1MJEA 1X3GA 3CCQA 1PH9A 3PO3H 3JAMi 3G48A 4JI0L 2R92H 3HOVH 4OWTB 1OXUA 5M5YH 3M4PA 3S1RH 3U58A 1MJCA 2JJQA 3CMAA 1UE7A 1E1TA 3W1BA 1OXTA 4O2DA 3NEMA 5ELNA 4GNXB 1FGUA 4LWCA 3PF4A 1AE2A 4IPGA 1N32L 1EFWA 2UXDQ 1X6OA 3EBEA 3RZOH 1EYGA 1HJPA 4JBJA 3S16H 4P72A 3NELA 3PCOB 5M3FH 1A62A 1GVPA 4LF9L 2H5XA 1YNXA 1VQGA 1K3RA 4PG3A 3CCJA 4YHHQ 3F2DA 5J3BA 1BKBA 4DR3L 1SMXA 2NN6G 3OTOL 2A8VA 1HNZQ 4B3SL 4LUVA 3M4OH 4DR1L 2ID0A 2RHSB 5FLMG 2JA9A 3K7AH 2Q2HA 2K4KA 4JI3L 4QL5A 3E0EA 4MNOA 5HGQA 4DR2Q 2HHHQ 1NY4A 4DV3L 4R4IA 3IRBA 3BZCA 1N9WA 2NVTH 4AYBE 1N34Q 3HOXG 4NXML 4GNXC 1WI5A 1EIYB 2Y0SG 4DK3C 4GLAC 4LFAL 2VQFQ 4A3BG 4GNXA 3FP9A 3UDIA 2N78A 1HR0Q 3K0XA 5IYDG 5C0XJ 4JBMA 2HT1A 1PH2A 2K14A 4BBRG 3HOYG 1XJVA 2JA7G 1NMGA 4JOIA 4YY3Q 2RCNA 5LMNW 5GADC 1T9HA 4DV0Q 4OWWB 1TWAH 4DK6C 3HFZB 3KJOA 4X62L 3HKZG 5IYDH 3CPFA 1J5EL 4B3RQ 4A3BH 2BA1A 2NN6I 1YJWA 2D0OA 2Z0SA 3I55A 4RG1A 2KHJA 1VQDA 2MO1A 4LF6L 4DV2Q 1YHQA 1X9NA 4BXXH 2AWNA 2PNHA 4QQBX 4DUZL 1QVFA 1Y14B 5H1SE 4B3RL 4MTNA 1IL2A 4GN3B 2OWOA 2ZM6L 5JJLA 2LXJA 4HJ7A 1NJIC 3PO2G 4GKJQ 5IWAQ 3L0OA 2N8NA 3T1YL 1E7ZA 2AKWB 4J15A 4A3EG 3HOVG 4TQUS 4DV4L 3J80c 4AH6A 2CWPA 4JI4L 1L1OB 3CCMA 5M5XH 3HOZG 3PUYA 4HIDA 2JA8G 4X6AH 3K81C 1WCMH 4A3JG 4JI2Q 5IP7G 3DLLA 1PHJA 4L5QA 2UXDL 3KF6A 4A93G 4DV6L 1VQ4A 1PH5A 1O7IA 4LFCL 2WAQE 1L1OA 4GLVB 4R1JA 4UP8A 3STBD 4DR4L 4BY1H 4BXXG 4JI2L 1YITA 4C3JH 2PQAA 2GVBA 1IYJB 2Z6KC 1A8VA 1E3PA 4B3SQ 4IPHA 4OONA 4A3FG 5HY6A 4LF8L 2ZJPA 2BA0A
chains in the Genus database with same CATH superfamily
1QWYA 4J8QA 4DAYB 4EQNA 5CV6A 3T1HL 2R7ZG 5EAYA 1JJ2A 4RCOA 3S17H 5FJ8G 4A76A 3RNUA 1A2TA 2CVRA 1CA6A 3GTGH 4KHPQ 4X3SA 1CM9A 2NZ1D 5CV9A 4R8IA 1X65A 1QCBD 1X3QA 3ICEA 4IUVA 1TS4A 2B8FA 4DR4Q 4ZUIA 2KCMA 2K01A 1K9MC 4IN3A 5JJIA 1SYFA 2V4DA 2JA7B 4HJ9A 3B6YA 4MIUA 1KDCA 3KYHC 5I4DA 1KDBA 3G71A 2IX3A 2EE1A 2CCZA 2RHQB 4PQXA 1NCVA 1H9RA 4FYDA 4P73A 3S1RB 2WB1B 4XT1B 3EFXD 5IP7H 2MP1A 3PIPA 2C5CA 1WTPA 2BOSA 1PTOC 4FXKC 1F2LA 3GD7A 2IY5B 4BXXH 1E0BA 1KLUD 1I4RA 2A1AA 4IPDA 1HZ9A 1S5ED 3URYA 1CHPD 4QCLA 1EEFD 3J81j 4BA1I 4RMFA 5IGDA 3KLWA 1EWIA 1CQVA 3TMEA 4QY7A 1M90C 2JEBI 2F0WA 3FHWA 1TWGB 1WJJA 1UE5A 4RKBA 3E9HA 3J80E 4KI0A 2PW7A 4KKUA 3IL8A 5C5LA 1WTVA 4YCUA 3PQIA 2XSCA 3X3NA 4EQOA 2CH4W 5E7NA 3I73A 1EU3A 2PMZB 4OO1I 1PZID 1B9MA 1XNQL 1BBUA 4Z9CB 2DY8A 5IGBA 2Q2TA 5D65A 4BBRB 4FO2A 3IFTA 1Y1VH 1IBKQ 4F88A 1WCMG 3S2DH 1NAPA 5I2YA 2E2JH 4QJFA 3Q23A 2QDBA 1VQJA 3P1HA 4KY5A 5CORA 3HRZC 4WJ4A 2X6LA 3MXGA 1KNEA 2F0TA 3D0FA 2PCFB 2AUJD 2LY7A 2EPBA 3CW2C 2R93H 2F3WA 2JSOA 3T16A 1TKWB 1OO9B 1YJ9A 2JN4A 3KFUA 1KLGD 1BCPC 1E1OA 4DR5Q 1JB3A 2B2UA 1PVOA 2FXQA 2JA6H 2DUDA 3AB9A 5IE8A 2OQ0A 3BVMA 1RODA 1TWAB 2AMCB 3V2TA 1YI2A 2C35B 3NK9A 4L5SA 3NBHA 1TQOA 2YU9H 3U50C 1R9TB 1GUSA 1TT2A 1XX8A 5E4WC 1XNRQ 4HAEA 4DV6Q 1H9JA 2EY1A 5T1GA 4BA2I 3GTLH 3P75A 1O78A 2CQAA 1XNRL 4DV3Q 3J81L 4RHSA 1BBWA 4BY7H 3PO3G 2E2HB 4V190 3OWEB 2IPKD 1DYQA 2VQFL 1K8GA 4KK7A 4QB4A 1EY9A 4NXMQ 1PLFA 3DWQA 5D14A 2HQLA 4HIOA 1F77A 2I5HA 4ZAIA 1Y8NB 5LMNL 3S16B 3SHLA 4P71A 2PI2E 2CW0D 2F4VQ 1ENFA 2BE5D 3R2TA 3I8ZA 4C3HG 3OTOQ 3S2DB 4A3KG 3K59A 1A3TA 1JMCA 3VYSA 3KLSX 1VQPA 1I6VC 3KDFA 4C3JB 4TRDA 3SK8A 3T53B 2NVYH 2A5HA 2F0UA 2L5TA 4F87A 1HZCA 5M3MG 3GTKB 3J7A5 1KAAA 4ZYSA 1FJGL 1IBKL 1PMRA 3NQIA 4OEMB 5LMUQ 1UEAB 5C3WA 3TRZA 4IUPA 2NZHA 4YWMA 1RHPA 4A3MG 1QVCA 1K8MA 1CT1D 5AJ3Q 2F0PA 2OQKA 3M7GA 4K8JA 1CUKA 2WACA 1Z6HA 4LF6Q 1SN8A 1RJTA 2NBFA 4DNTB 3S14H 3S1MB 4A3LH 5GAEC 1TWGH 4A75A 3D6CA 5GROA 4DU9A 5M5YB 4A3DH 4K2LA 1TY0A 2K5WA 2ZTCA 4DV2L 3MXNB 3BYTB 4LUOA 3J80L 2NYZD 3NSWA 4XYOA 3VA5A 1A3UA 1SE8A 3EVQA 1Z47A 3NUCA 1EQTA 2XVSA 4PZ6A 2K5NA 4P75A 1I94Q 4YWKA 1QVGA 3TP6A 4AYBG 1LTRD 4L6TB 5E1FA 5CV4A 1HTLD 4LUZA 4GS3A 4C2MH 4IUTA 3MEFA 1I5FA 1O7LA 3PIOA 3UDGA 3H3VI 4JYAQ 3FMCA 2NZOA 1KL9A 2JA7H 4IZ8A 3NTIA 1C9OA 3CCLA 3ULPA 2I5MX 5C3EG 2DGYA 3ERSX 3GTPB 1DGSA 4BS9A 2CH4A 1S40A 1CKMA 1D1IA 3J7AV 5IT9c 2K7VA 5C44H 2UXCQ 4JW0A 1UE1A 2M2LA 4B9XA 1SEBD 4CKCA 3CAMA 2IW3A 5I6WA 2E2HH 1NUCA 2A19A 4ZUJA 1Q82C 4A3IG 4ZQ3A 4IFDI 1PTOF 5FLXc 3NENA 2NN6H 1LM0A 3RZDH 1PYSB 1PH7A 4A3CH 4A3EH 2G9DA 3GTLB 2RSNA 3BG3A 3H3VH 3S1QH 2D2CC 2K5HA 2RCFA 5DNFA 2VZAA 2K52A 3T1YQ 1XPRA 1OXSC 4GKJL 3LNNA 2NB0A 1CKNB 1STAA 5DAUA 1O80A 4DV0L 4DR6Q 1P8LA 2O5IC 3OIQA 1I4GA 3RLOA 4A3MH 1CSQA 4APVA 5I9OA 2OTJA 3FRPB 1I6HB 1N8RC 1Z7TA 3SXHA 4JOIC 1STYA 1NMFA 1ZYRC 4FXGC 5IGCA 4G7ZC 1Q7YC 2VQEQ 1A2UA 1PA6A 2VS1A 3CQZB 2XIWA 2B3GA 4OX9L 1FL0A 1SDFA 1EUJA 1PH4A 5CV7A 1IW7C 1Y1WG 5C0XH 1PH6A 1DONA 2F0SA 3PO3H 5IIFA 3JAMi 2A6HC 3A8KE 4KN7C 4JI0L 5A2QL 1JWSD 1K3BC 3PF4A 4IPGA 1EFWA 2UXDQ 1X6OA 5J39A 1EL0A 3NELA 3PIP3 2IJ0A 3R93A 4OIKA 4PG3A 2MJ8A 4YHHQ 1ZXTA 1Y1VB 1TWHB 2XNAC 4DFAA 1I4XA 2RHSB 2EZVA 1DD2A 3K7AH 3MA2B 1EEID 5NUCA 2B2WC 3E0EA 4MNOA 3X3MA 2LFNA 1PXUA 1EY7A 3BZCA 3DM1A 1N9WA 3K5LA 2VB3X 1ZYRD 2Y0SG 2N78A 1HR0Q 5C0XJ 2HT1A 4WJWA 4DNRB 1J8IA 2SDFA 4BBRG 1XJVA 2B2YC 4JOIA 4XQQA 4YY3Q 1M8AA 2RCNA 3SVMA 1T9HA 4DK6C 3KJOA 1GHJA 3TN2A 1Y1WB 2BA1A 1ESFA 1YJWA 2Z0SA 2MO1A 4LF6L 4RCNA 1EY8A 2VXWA 4B3RL 1VF5C 1STHA 1LTAD 2L9HA 2ZM6L 1LTTD 4KN4C 3T4AC 4ABNA 3KK7A 5BN4A 4JI4L 2CWPA 3HOZG 1JWMD 1WVLA 3K81C 2JXMB 1WCMH 1JC7A 3Q22A 1FNUA 1HFGA 1E2WA 2A73B 3DLLA 1PHJA 3KF6A 2OXPA 2SOBA 2BDNA 1O7IA 4K6LA 4LFCL 2WAQE 1YNJD 4GLVB 4DR4L 1HRJA 4RGOS 4ZCKA 5JVH3 4BXXG 1NR4A 1PFBA 2IWHA 4C3JH 4OIJA 4RAUC 5K36H 2Z6KC 3EQLC 1ICWA 3R2IA 2BA0A 1UE7A 4IFDJ 2NVYB 3HOZB 4KV6A 4C3IB 3RLNA 4EVOA 1AE3A 5TSSA 2A69C 4JI7Q 5LL6X 1VQAA 4LF9Q 1HA6A 2NTTA 3AQQA 4LAAA 5EPLA 4CKBA 2F0GA 2VUMH 2K5QA 1YHBA 2IT1A 3A0JA 4QGUA 1Q12A 2R7FA 4LW1A 1AZQA 1Q3LA 2DN8A 4ZKCB 1NNXA 3ZYYX 4BBSH 2K05A 2MO0A 3DHQA 4JI3Q 2JA5G 4A3GB 1SFOB 2Z1CA 2RA4A 3D4RA 2SEBD 5C4JH 1ENCA 3PO3B 2QW7A 3NWTA 4LK1C 5KGUA 3SDZA 1VQ9A 2F3IA 1GM5A 1VMPA 2VY3A 2BH8A 1SROA 3U4ZA 1R9TH 1M4VA 1A63A 4LFBQ 2PQAB 4K6DA 4RGMA 3KF8A 3D4WA 3BVGA 4K8IA 1DZ1A 4POGA 4A3GG 2JA5B 1EY4A 4PMCA 1PRTB 3I4OA 3DWPA 3SEBA 3RLFA 2JK8A 3RR5A 4DN4M 1EQRA 3FPUB 4PZ8A 5C4JB 1SLJA 4YCVA 1B2TA 3KF8B 2PI2A 2UUCQ 4A3KH 2JQOA 2M9VA 2XRQD 3VA7A 2F0VA 2XRSD 2CFMA 2Q2UA 1GXDC 3QB3A 1HTPA 3CXCA 4K0KL 4X3KA 1JT8A 1SNQA 1RIPA 2AWOA 2A6HD 2ATWA 1J6QA 1EIGA 4QIWE 3Q8DA 3G6EA 4JCVE 1JJCB 3CCRA 1L2FA 1I4HA 3GTJB 3L3OC 2E74C 3LWUA 4X66L 1VQ8A 4IALA 2F0MA 3OW7A 1WTXA 4HIMA 1HNXL 2BH2A 4DR6L 1Q81C 4GZYC 1MKHA 3M4YA 1X3PA 4PMBA 2XGTA 2EYOA 1C4QA 1KD1C 2FHTA 4JI8L 5IYBG 1XPOA 1EIFA 1SR3A 1Q1EA 5DM63 4U673 3MHBA 2NVQH 2LMCB 2KVMA 1QZHA 4A3JH 3TZDA 1UUPA 4MHEA 2EQSA 5CGKA 3E3XA 2F03A 1GUOA 4HCEA 4BWGB 5KRUA 4JV5L 2R93G 2XWJB 4IJLA 2KUMA 4B3MQ 2QA4A 2E2DC 3KOJA 1HCZA 2K03A 4A3JB 1B3QA 3LX0A 3W3AA 5L37A 4JG2A 3CP0A 2HCIA 4LF7L 1XTCD 3KDFB 4BY1B 2VNUD 2E75C 1CI3M 5FK9C 3C2PA 1NE3A 4GKKL 1JORA 1SNMA 2QGQA 5GQOA 2KHSA 3K58A 4PV1C 3SK4A 5C4XG 3J81E 3HOXH 1UWVA 5IYBH 3F8TA 2FFKB 1IBML 5KNCA 5ELBA 2E8GA 3RN5A 1G51A 2CKZB 1U9RA 1FYCA 1H9MA 1CTMA 1KIXA 1S3OA 1SRUA 1PTOH 1I3QB 3EROA 2EYMA 1XYIA 1N33L 3NQTA 3A8IE 4HIKA 2NTSA 1BXTA 1HA5A 1GO3E 1VQ5A 2KCCA 1DXMA 2A6EC 1Z9FA 1CKOA 2KCTA 1QZGA 3HOXB 5BR8Q 2E5LL 2V1CC 2EJMA 1U4LA 2PMZE 4JI7L 5EKKA 3VYRA 5DM73 3J81i 4RH6A 2G5DA 3L7ZC 1OTCA 1T5EA 3UDXA 4DR5L 2BDOA 1PZJD 1STNA 1XWEA 3FKIG 1JQYD 1PYBA 3MTSA 4DR7Q 5C44G 2ES2A 1N32Q 2N49A 3K57A 2R7ZH 2SNSA 4K5XA 3J80i 3S1NH 3E9IA 1UNSA 1YBYA 4LF7Q 1I4QA 5EKLA 5ELEA 2F52A 4DV1L 5EBDA 2E2IH 1X54A 3A7LA 2EVBA 5C4ZA 4OWXB 1GUGA 3GTMB 3A54A 2NVXB 4A3GH 4LNQA 3M85A 2IHEA 4A4IA 1PDQA 2HIXA 4EGVA 1FNWA 4DV5L 3FKIH 2Q2IA 3HKZE 2UXBQ 3MC0B 2JA8H 2KOLA 1PFMA 4JI0Q 3SE0A 1CQFA 4O42A 4UP7A 4B9WA 2PZWA 4DR2L 3CMEA 3RD4A 3H0GG 3RMHA 4POFA 3I4NB 3QOJA 1PFSA 4HSVA 3A74A 4R4QA 4UAIA 1T5XD 4KKSA 3T1HQ 2J0TD 3PO2B 4EQPA 5EPKA 4DR3Q 3GTQH 5IT9E 1SYGA 1B4OA 1KQSA 2R7DA 3A5UA 1DJRD 1ESRA 1FD7D 4ULLA 5CV5A 3I4MG 1GUTA 2RDGA 2YV5A 3OSOA 1WFQA 3AFPA 4KY6A 1LT3D 3TDQA 3H15A 1UE6A 3VYUA 4A93H 2R6GA 2F0EA 4CJ2C 1W2BA 4C2MB 3SGIA 1SYBA 5M3MH 4DR7L 4J6HA 4DA2A 1SMYC 2MFIA 3C1EA 1PRTD 1D6EC 1QUQB 2UUBQ 5C3EH 2DJFC 5LMUL 3WOFA 1HZBA 4NKLA 3GV6A 2EXDA 1HHVA 1EYDA 2D5DA 4OL7A 4LF4Q 3C46A 1HR0W 1EYCA 1X56A 3HKSA 4NPSA 1G291 4AIMA 3ITPA 4CJ1B 2B8GA 1IBLQ 4NXNL 3A7AB 4KTAA 4DV5Q 3HGBA 3OWFA 5K5PA 1IYUA 4DGZA 5FO8B 2J4XA 4DR1Q 5FLXL 4GOPB 1HUMA 2L1BA 3H0GB 4XT3B 3MXNA 1PZKD 3VYTA 5CC4A 5IY0A 3I4NG 5K36G 2IX0A 2HUGA 2ZTDA 2AQ2B 3IKJA 3P7JA 4A3IB 1CA5A 2B2TC 4R4TA 4JYAL 4LFAQ 4HJ8A 1SNDA 2N3SA 1QE6A 5CYUA 2EYLA 2ZTEA 2UUAQ 5C4XH 1LV9A 3M3YH 1IBMQ 4O0AA 2HDMA 4LFCQ 2KBNA 2RDHA 3W1GA 1VF7A 4CDDC 2CQOA 2Q8RE 3JAME 3BDCA 2L15A 1V1QA 1IYVA 3CCQA 1PH9A 5JVG3 1PRTC 3G48A 2RKSA 4KMUC 2OF1A 4OWTB 3M4PA 4N8FA 2JJQA 1E1TA 4X6AH 2BE5C 3NEMA 4QIWB 1FGUA 1HUNA 1H9KA 2ZXPA 3RZOH 1HJPA 4JBJA 4RKLA 5KYIA 3S16H 4P72A 4MN3A 3PCOB 4LF9L 1WCMB 2F3VA 1YNXA 2B39A 2IL8A 1K3RA 4XQNA 4Q0FA 5J3BA 1BKBA 1EOTA 4ME5A 4DR3L 2NN6G 3OTOL 4B3SL 3CHBD 3M4OH 2ID0A 4C3HB 2Z4HA 5FLMG 4BY7B 1K0SA 3NHHA 2Q2HA 2K4KA 4JI3L 2EY2A 4I65A 1SXTA 4X3TA 3S15B 3VR6A 5I2XA 5A2QE 2NVTH 3A55A 4AYBE 1H9SA 1N34Q 4GNXC 1WI5A 1YNNC 2Z9HA 1EIYB 4DK3C 3GP7A 3FDTA 5M3FB 1STGA 3NE5B 4GNXA 3FP9A 2NWGA 1CZGA 2EY6A 1F9SA 1GUNA 2K14A 2MGSA 3HOYG 3VR3A 1MSHA 2JA7G 3NBIA 3L9AX 2I46A 5GADC 1DOLA 1TWAH 4LJZC 1B44D 2ZXRA 1S5BD 5J1ZA 5IYDH 2I07B 3E6ZX 3CPFA 4RGNA 4M8AA 1F9RA 4A3BH 3CKIB 2AWNA 4DUZL 1GHKA 1QVFA 3ONAB 4N9PA 1Y14B 2OEOA 3DEPA 3V96A 5H1SE 1G2SA 4GN3B 1IL2A 3AMUA 2LXJA 4HJ7A 1NJIC 4GKJQ 3C1FA 2EYHA 2AKWB 2F1MA 4G4KA 1QG7A 4UDUC 2WIIB 4JVZA 5M5XH 2BCOA 3FVQA 4A3JG 4JI2Q 1HFNA 1I50B 5IGEA 4HCSA 4KHVA 3G6JB 1L1OA 1U4MA 4R1JA 3STBD 4JI2L 1YITA 2PQAA 2LKVA 1GUWA 4A3KB 3V05A 5EQ0A 4IPHA 4OONA 5HY6A 1JWUD 2A68C 4LF8L 4C3JG 3TP8A 3H94A 4FF1A 3NBHB 3PUWA 1XTDA 1IZ6A 1LYLA 1IXRA 1KTKA 4IJHA 4MZ9A 1SYEA 3MXUA 2I0QA 2B2VC 1ILQA 4IO9A 2LSSA 5IT9L 1JOKA 5IGFA 3AEVA 1XMQL 2H4OA 2MNAA 3BVZA 4C3HH 1TWFH 2UU9Q 4QMGA 3M4QA 2LXKA 4LF5Q 4S3SA 3CCEA 4Y52H 1IBLL 4RWSC 4K14A 3H3VC 4JI4Q 1N34L 1S72A 3M4OB 2B2VA 2I5LX 4NW2A 1VQ6A 3N6RA 1BO0A 3KBGA 1TXYA 1KNAA 3F2UA 2KEDA 1D5ZC 2ZM6Q 1V1PA 1Q8KA 2KECA 2HIVA 2L12A 2Q8IB 3PF5A 1PH8A 2PNRC 5C44B 1S5CD 4JI1Q 3GTOH 3TBIB 2AUKA 1WTHA 3KF6B 4JI5L 3FEWX 3HOZH 4M1UB 1ENAA 4BY1G 4DUYQ 3TP7A 1I3QH 4JI1L 3DMUA 2QKIC 2A74C 5FKAC 2EIFA 1VQKA 1HR0L 1JJGA 2K5DA 1TR5A 3HEJA 5JEAJ 1OXXK 4X3UA 4B3TQ 4AYBB 1K73C 3GTOB 1B7YB 2SNMA 3TS2A 2WB1E 5C3XA 5JEAH 2B63G 1STBA 3DWAA 2F4IA 2EYFA 3D6WA 3I4LA 1WTQA 2VUMG 2QEXA 3P20A 3F2CA 2WV6D 1RL2A 2EDGA 1VQCA 2OTLA 2JE6I 4EX5A 3EN2A 1KDAA 1X32A 1Q46A 4DAYA 3OW2A 1Y1WH 1KHIA 3PGZA 2EOTA 2WKCA 4N9TA 4A3DB 5IYCH 1RTNA 1S5FD 5KIXA 1MGSA 4DAMA 4IOAA 1B70B 1LUZA 4GKKQ 3I70A 3OMGA 1JE4A 1WOCA 5GAGC 1GOZA 2HDLA 1S5DD 4UP9A 1YNJC 3M7NA 2MHVA 1SJED 2B2WA 4DXGA 1TIID 2QILA 3DXJC 4OO1G 3R8BA 3I4MB 4DK1A 3RN2A 2KCNA 5G3LF 5HURA 3GTKH 3SK6A 1AFPA 5JJZA 3CCUA 3I3CA 2MPMA 5ELOA 4UY8C 4FNFA 4Y7NB 3OYYA 3MFYA 3U4VA 4PNYA 3LGJA 1D2BA 3GTQB 2PO4A 1G2TA 1RKNA 1EZ8A 2RQXA 4I7ZC 2HQEA 4JI8Q 3CC4A 3PO2H 1LTGD 2E5LQ 4R4CA 3SR1A 4Y7NH 4A3FB 2RVLA 2JA8B 1V9PA 4BBRH 3TQYA 3A8JE 1VQHA 4HTHA 1CFMA 4X62Q 2F0DA 2F0FA 1N33Q 2R92G 5FLMH 4X66Q 3BZDB 2K1BA 3CCSA 1HPCA 2A6ED 3D3RA 4LF5L 3GTMH 2O2LD 2WAQG 1F9PA 1Q8IA 1HNWQ 1MD2D 1VQEA 3CD6A 1UEBA 4DUZQ 1ASZA 5LL6S 1BCPD 2MUYA 4F8MA 3J7YW 1XMOL 4L5TA 1AW7A 4OHJA 3QG1A 4HJAA 2YTYA 4UPAA 2Q8TA 4XXEA 1F2MA 3HOUH 1V1PB 2JA6B 3UE0A 4EQ5A 3S1QB 3ER0A 2J7ZA 1E2ZA 1B9NA 4K5VA 3S9WA 2K50A 1HXYD 1Y1VG 4R4OA 4JPBW 5CR3A 4TKOB 2F0JA 1SNPA 3KLRA 3C3LA 1X3EA 2YYZA 4XIGS 4GOPA 3ERQA 2HD3A 1E22A 2CWAA 1DOKA 1LTID 3PV0A 4BY7G 3KLSA 1ET9A 1J9OA 3I2ZA 3J81c 2Z8LA 5LMNQ 3H6MA 1X3FA 4JC0A 3TZUA 4DNIA 3VDYA 3MWYW 1IKLA 2IHFA 5EPJA 1BOSA 5J22A 2RF4A 1VS0A 1PTOB 1ML0D 2KENA 3RZOB 1U0LA 1NTGA 2GA4B 2E76C 2F0NA 4DK0A 3UE1A 1C0AA 1N36Q 1K8OA 2RDFA 2Z6BA 1EIHA 4NB3A 1BF4A 3Q24A 3BS1A 1VQOA 1TS2A 1AP0A 1KAWA 1LLRD 4IUUA 4BBSG 4B3TL 4IUNA 5GAHC 1II3A 5M3FG 2QCPX 3S17B 4ZLTF 2EXZA 2UXCL 2GN5A 4A3IH 1Q86C 1R4PB 1W3SA 1SJHD 1W6KA 3H0GH 1VQBA 1QILA 2QEJC 4NDXA 3VR4A 1VDZA 5JEAG 1TY2A 4FP5D 3A56A 2UXBL 4HJ5A 5JPMC 1KRSA 2F4VL 2N55A 1ASYA 1L0YB 4GLXA 4DAPA 1K28A 5DLQE 2UUCL 3TEHB 1HZAA 3G7LA 2FMMA 1LO5D 1V1OA 2KJXA 3ZJYC 5E4XA 4YCWA 5JOBA 1PH3A 3STBC 1LT4D 1B53A 2GVAA 1STEA 4LF8Q 1CK1A 4DV1Q 2WKDA 3U9SA 1R4QB 2KHIA 1JR0D 3CRLC 3EIVA 1SE4A 4HSPA 1L0XB 4JI6Q 2VQEL 2FJ2A 3CF5A 2DY7A 2Y0SB 2F0IA 2CW0C 1SBBB 2IX1A 5FJ8H 2HHHL 1XNQQ 4WJ3M 4X64Q 4JI5Q 2ICIA 3I56A 1KRTA 3G4SA 1N36L 1YVCA 3KBXA 1O7ZA 1YIJA 3HOYH 3K6OA 3KJPA 1QNKA 1EQVA 4YY3L 1FGBD 3CC2A 1I4PA 4HMIA 1RCVD 5AJ3L 1EOVA 2L4NA 3HOYB 4QUCA 4HN7A 1YNND 2EY5A 1FVIA 1G6PA 2Z4IA 1YEZA 2KEEA 1FJGQ 1G6ZA 1JCKB 3CCVA 1L1OC 3I7FA 4JBWA 3I72A 4GOPC 1MJEA 1HQMC 1X3GA 1AZPA 5ELFA 1PFNA 5CBEE 2K28A 2R92H 3HOVH 4B08A 1OXUA 1MJCA 3W1BA 4GNXB 1OXTA 5ELNA 1AE2A 4TSSA 1N32L 5BN5A 3NP8A 1PRTF 1H9SB 1EYGA 1AN8A 2ZT9C 5M3FH 4V0BA 5FOBB 1VQGA 2B2UC 1SMXA 3Q6SA 1FR3A 2FMCA 1HNZQ 5M9OA 4C1NK 3T56B 4LUVA 5C5MA 4DR1L 5T1IA 3MAQA 2RBMA 2JA9A 4A3EB 3BYYB 1IKMA 5HGQA 4DV3L 4ODGA 3QIAA 4R4IA 5IODA 2R93B 4CDCC 4FF2A 1RD9D 1U4PA 4A3BG 1MBYA 5C4HA 1XXGA 3K0XA 5IYDG 5KNDA 1NMGA 4DV0Q 4OWWB 4G57A 3Q0AA 3NTKA 1MI2A 1SSOA 2A68D 2NN6I 2F0KA 2D0OA 5I6YA 2KHJA 1VQDA 3TSSA 3UI2A 1YHQA 1DCZA 5FO7B 2PNHA 4ILWA 2KQ3A 4MTNA 5FLXE 5JJLA 1SNOA 2N8NA 1E7ZA 1UAPA 4A3EG 3MVVA 2C9OA 4IUQA 4TQUS 4H7BA 4DV4L 1GJXA 1SE3A 3OPOA 3CCMA 3PUYA 4HIDA 2D9UA 2EYJA 5IP7G 1NSNS 2UXDL 2K6AA 1RF2D 3KUPA 4BY1H 1A15A 5EBCA 3OMCA 1IYJB 1A8VA 1E3PA 4B3SQ 1EZ6A 4A3FG 2ZJPA 1KXLA 1PTOD 2AQ3B 1EWCA 1ONLA 2B2TA 4P74A 4L63B 1PH1A 4FF4A 4JBKA 3JAMc 5JJKA 3TP5A 3HOWB 4PMWA 3QR8A 2B63B 2JEAI 1I94L 1VQLA 4FF3A 1V43A 2PZUA 1U4RA 1EYAA 2L0CA 2O5JC 3VR5A 3GDEA 1ICFB 4KHZA 1TWHH 3PUZA 4FXDA 1G91A 4DKAC 4A93B 4AQYQ 2OCEA 3HG9A 4CGYB 1CHQD 3K7AB 3GTJH 1RTOA 1U5KA 4A3FH 4O1NA 3D4DA 3D8GA 1LT5D 2PW5A 4A3CG 4PZ7A 2EJFC 1OXVA 3AYHB 3MEHA 3MXPA 4FDBA 5M5XB 3FPPA 1FNVA 4OXPA 5IYCG 1WYDA 5KEEA 4TVAB 1K0RA 1PYWD 1SYDA 4H44C 1D7QA 3LWEA 3WWVA 4YHHL 3PUVA 3L2PA 4E6IA 3CPWA 4KLKA 4XYQA 1B3AA 4CHTB 1EQQA 1H95A 1QJOA 1K83H 1QUQA 3FKIB 1D5XC 3K0YA 1BUVT 3RUZA 3F2BA 5IWAL 1MIUA 2NVXH 2JA5H 4ALPA 1BR9A 3CQZH 4DV7Q 1XMQQ 1KABA 1EU4A 1JOQA 1TS5A 3ULJA 1EFID 4XDXA 4G7HC 2B63H 5CBAE 1WTOA 5EJWA 3PSIA 1F2ZA 1A0IA 1HH2P 2ENBA 1JB7A 4IQZA 2QF7A 1D8LA 5ISRA 2D0PA 2D62A 2R7ZB 1YHAA 1MHWC 3RZDB 1SFOH 4K5WA 4NXNQ 2Y0SE 2K32A 3ND8A 2K33A 4B3ML 1QNUA 3OIPA 5G3LD 1SNCA 4N8X1 4RA8A 3A5ZB 1JICA 3U9OA 3EJIA 2R61A 4GN4B 4KY7A 3K8AA 4KJNA 1F2YA 2VUMB 1EY6A 4GN5A 2YTXA 5D3IB 3GTPH 4HEDA 4XTCS 1Q1BA 3E5SA 3S24A 2PPBC 4JI6L 4K2KA 1YZ6A 4U68A 3HOUG 5IP9H 1HNXQ 2JA6G 3PUXA 2ASBA 3M3YB 1BCPB 2K75A 3ND9A 4R8NA 2VB2X 4IPCA 3W5OA 4DV4Q 4G7OC 1WD0A 1AH9A 1Y8PB 1VQNA 1B8AA 3O13A 1VCIA 1AEXA 4Q5VA 2G9HD 2TSSA 3WOEA 1XMOQ 5CV8A 2UU9L 3I90A 4C1NI 4A3LG 3BDLA 3F1ZA 3VR2A 1DOMA 1ILPA 2VL6A 3DUZA 3BJUA 4KJOA 1LT6D 1SYCA 2WFWA 1TVXA 4R9WA 5HGTA 3S1MH 3S14B 1D5MC 4L8JA 5ELCA 3CRKC 3J7ZC 4KD3A 3BDOA 2ZJQA 4LMQD 3HOUB 2NVQB 1LACA 1W6JA 3SK5A 1C7YA 1YJNA 1TWFB 4X65Q 4CDFC 1TU2B 1LABA 3OHXC 1BNZA 4RHRA 3CU7A 1JE5A 1VQ7A 3GO5A 1GD7A 1SMYD 4WFN3 1IL8A 2LS01 4QUFA 1WTRA 3S2HB 2WAQB 3K80C 4CKEA 1VQFA 1LTBD 4H0LC 4OO1H 1MSGA 3JC66 1QB5D 5C0XG 1EY0A 4DUYL 1C48A 4AQYL 1GKHA 3CC7A 3HZXA 1SE2A 1LTSD 2WB1G 4IOCA 5CMDA 5LHY1 3H09A 3GTGB 3HP3A 3W2DA 4DPGA 1L0WA 3AFQA 5BR8L 1VQMA 4H02A 1TWCH 3I4NH 1S4ZA 1HNZL 4RFBA 3K5NA 1I50H 4OELB 2WINB 5I9PA 4NP5A 3NXWA 1J5EQ 3UDFA 3BZKA 1RDPD 5DEHA 1VMCA 2AQ1B 4H13C 5COYA 4IFDH 2PQEA 5C0XI 3K5MA 1BVSA 2MQHA 5M5WH 1ZEQX 2K5VA 5C6AA 2K04A 4HR7B 4DV7L 1B1ZA 3I4MH 3E0JA 3IFDA 1HNWL 3BU2A 4IURA 4YWLA 4KHPL 1NBWA 2CHBD 2H1EA 3GV3A 3D31A 3J7AF 4A3BB 3EA6A 1I6HH 4DF7A 3HOWH 1D1KA 2F0OA 2UUBL 3QO2A 4CDEC 4OX9Q 1CSPA 2TMPA 1KC8C 1WD1A 3DEOA 3R3OA 1A6XA 1VQIA 2A69D 2B29A 2JYOA 1LTLA 3S15H 4A3MB 2HCCA 4YIJA 3DM3A 1JOOA 4ME3A 1BBXC 3TS0A 1X55A 2ZJRA 1PV4A 1K83B 4C3IG 1G8ZD 3K5OA 3TREA 3ULLA 1WTWA 1CKNA 1EY5A 4HMJA 1Y69U 1V8QA 1NR2A 2Z6KA 1TS3A 4X65L 1BQQT 2E2JB 1P16A 1E24A 3WDNA 3PIO3 4L5RC 4K0KQ 1TWCB 2ICEC 3QJYA 3M9BA 1IW7D 2L11A 2DJGC 4C3IH 2YTVA 2AHOB 1M1KC 2PYKA 2UUAL 3HOWG 2QDLA 2XTIA 4CJ0B 2F0LA 2VW9A 2ALYB 4MTKA 4A3DG 5IP9G 5JAVA 3K7UC 5C4XB 2X69A 1ZKOA 5D3DA 3S2HH 2ZXOA 2WP8J 4JK1C 2JP1A 4LFBL 2DNCA 1XPUA 1Y8OB 3OOCA 4ID6A 1O7YA 4JV5Q 2B2YA 4LF4L 5EKIA 1K8AC 4IFDG 5KYLA 4C56C 1A3VA 1BDOA 1QOHA 4X64L 2FINB 1IHZA 1Q90A 4DAVA 4ZK9B 5M5YH 3S1RH 5F2DA 3U58A 2N88A 3CMAA 3H91A 4QF4A 4O2DA 4LWCA 2X6GA 3EBEA 2NUCA 5FO9B 3IAYA 1A62A 1GVPA 5ELDA 2H5XA 4OGQC 5JPNC 5M3MB 4WRDA 4I7AA 3CCJA 5C3EB 3F2DA 3AU7A 4WORA 2R92B 2A8VA 5IGGA 3N52A 2F0HA 2EJGC 4QL5A 2HHHQ 5E3FA 4DR2Q 1NY4A 2L55A 3IRBA 2KA7A 3MZ5A 2DNEA 3HOXG 4NXML 4GLAC 4LFAL 2VQFQ 3QOLA 3UDIA 1BCPF 2OT2A 4KD4A 4KKTA 4JBMA 1PH2A 1B50A 1ET6A 5LMNW 4RGTA 3HFZB 4X62L 3HKZG 1J5EL 1E2VA 4B3RQ 3NPPA 3NWSA 5EGTA 3I55A 3GQBA 4RG1A 1DM0B 5BN3A 4DV2Q 1X9NA 4DXFA 3MFGA 4QQBX 4UHVA 4J1MA 2XWBB 1SAPA 2OWOA 3NTHA 3PO2G 5IWAQ 3L0OA 3T1YL 3QWNA 4F7XA 5KNBA 4J15A 3HOVG 2EYPA 5AFWA 2F0QA 1F9QA 4AH6A 3J80c 1L1OB 2XN9C 3S1NB 2JA8G 5A35A 2YU9B 3T13A 4ZRZA 2E2IB 3PMFA 2RSOA 2O4XA 3HS0C 1C8CA 4L5QA 1CZWA 2PZTA 3JAML 4DV6L 1VQ4A 4ZKBB 4A93G 3T51B 1PH5A 4CBVA 4UP8A 4NMZA 1EWHA 2P5ZX 4FVMA 1HQRD 4XQJA 5M5WB 2NVTB 2GVBA 4P2CB 2R3ZA 2M00A 3HKZB 3HOVB 5IOCA 4BBSB 3I91A
chains in the Genus database with same CATH topology
4IFDJ 4DAYB 3RLNA 4P74A 1PH1A 3NBHB 4JBKA 3PUWA 1AE3A 1XTDA 3T1HL 1IZ6A 3JAMc 5EAYA 2R7ZG 4JI7Q 5JJKA 1VQAA 4LF9Q 3AQQA 1JJ2A 1LYLA 1IXRA 3S17H 5FJ8G 4IJHA 4A76A 4PMWA 3RNUA 4MZ9A 2JEAI 2I0QA 1I94L 3GTGH 4IO9A 1VQLA 2VUMH 1YHBA 4KHPQ 2LSSA 2IT1A 3AEVA 1V43A 1XMQL 3A0JA 4QGUA 1X65A 1Q12A 2R7FA 4LW1A 2MNAA 3ICEA 4DR4Q 4C3HH 3GDEA 1TWFH 2UU9Q 4KHZA 2KCMA 3M4QA 2LXKA 1TWHH 2MO0A 3PUZA 1K9MC 4JI3Q 4DKAC 3CCEA 2JA5G 4LF5Q 5JJIA 4Y52H 4AQYQ 1IBLL 5C4JH 2OCEA 4HJ9A 3B6YA 3GTJH 1U5KA 4JI4Q 1N34L 4A3FH 1S72A 1VQ9A 2F3IA 3KYHC 2I5LX 1GM5A 2VY3A 1VQ6A 1KXLA 4A3CG 2BH8A 1SROA 4PZ7A 3G71A 1TXYA 3U4ZA 1R9TH 1OXVA 2CCZA 2RHQB 3AYHB 2ZM6Q 1A63A 4LFBQ 4FDBA 1Q8KA 2HIVA 2PQAB 3PF5A 1PH8A 4P73A 4OXPA 5IYCG 1WYDA 4JI1Q 4TVAB 5IP7H 1K0RA 4POGA 3PIPA 3GTOH 4A3GG 1D7QA 3KF6B 4JI5L 3I4OA 3HOZH 3WWVA 3GD7A 4YHHL 3RLFA 2JK8A 4BY1G 3RR5A 3PUVA 1EQRA 4DUYQ 1I3QH 4PZ8A 3L2PA 1SLJA 2A1AA 4YCVA 3KF8B 4IPDA 4JI1L 3CPWA 2PI2A 1HZ9A 2UUCQ 4A3KH 2JQOA 4KLKA 1EQQA 1H95A 1K83H 1QUQA 3J81j 2EIFA 1VQKA 1HR0L 4BA1I 1JJGA 3F2BA 2CFMA 4RMFA 5IWAL 2Q2UA 3KLWA 5JEAJ 1OXXK 1MIUA 1EWIA 4B3TQ 2NVXH 1K73C 2JA5H 4QY7A 1B7YB 4ALPA 2JEBI 1M90C 3TS2A 2WB1E 3FHWA 3CQZH 3CXCA 1WJJA 4DV7Q 1XMQQ 1UE5A 2B63G 4K0KL 1JT8A 3ULJA 3E9HA 1RIPA 2AWOA 2B63H 4KI0A 2ATWA 1J6QA 4QIWE 3Q8DA 3G6EA 3PSIA 4JCVE 1A0IA 1HH2P 1JB7A 4YCUA 1JJCB 2VUMG 1D8LA 1L2FA 2QEXA 3CCRA 3F2CA 5E7NA 2D0PA 2D62A 1RL2A 4OO1I 1VQCA 1YHAA 4BBSH 4X66L 1XNQL 1BBUA 1SFOH 1VQ8A 2OTLA 4NXNQ 2JE6I 4EX5A 3EN2A 2Y0SE 2Q2TA 4B3ML 4HIMA 1Q46A 1HNXL 2BH2A 4DR6L 3OW2A 1Q81C 1MKHA 1Y1WH 1KHIA 3PGZA 3A5ZB 5IYCH 1Y1VH 1IBKQ 1WCMG 3S2DH 2XGTA 4GN4B 4DAMA 1KD1C 3K8AA 2E2JH 1B70B 1LUZA 4QJFA 4GKKQ 4IOAA 4JI8L 4GN5A 1VQJA 5IYBG 2YTXA 1XPOA 1EIFA 1SR3A 1Q1EA 1WOCA 3GTPH 5GAGC 4XTCS 4WJ4A 2NVQH 1Q1BA 4UP9A 3M7NA 1QZHA 4A3JH 3D0FA 3S24A 2EQSA 4JI6L 1YZ6A 4OO1G 3CW2C 2R93H 3HOUG 1YJ9A 2R93G 4JV5L 5IP9H 3RN2A 1HNXQ 2JA6G 3PUXA 4IJLA 2ASBA 4B3MQ 3GTKH 3KFUA 2QA4A 3CCUA 1E1OA 2K75A 3KOJA 4DR5Q 4IPCA 5ELOA 4UY8C 3W5OA 4DV4Q 1PVOA 2FXQA 2JA6H 2DUDA 1AH9A 5IE8A 4JG2A 3OYYA 3CP0A 2OQ0A 3U4VA 2AMCB 3LGJA 1VQNA 4LF7L 1YI2A 1B8AA 2C35B 3KDFB 1VCIA 2VNUD 4L5SA 2YU9H 4JI8Q 3U50C 3CC4A 1NE3A 3PO2H 4GKKL 1XMOQ 2E5LQ 2QGQA 4R4CA 5GQOA 5C4XG 2UU9L 3HOXH 4Y7NH 1XNRQ 4DV6Q 1UWVA 5IYBH 3F8TA 1IBML 4JYAQ 1V9PA 4A3LG 4BBRH 2E8GA 3F1ZA 3TQYA 3RN5A 1G51A 1VQHA 2CKZB 3GTLH 4BA2I 4A93H 4X62Q 2VL6A 1KIXA 1S3OA 1SRUA 1N33Q 4DV3Q 1XNRL 3BJUA 2R92G 5FLMH 4X66Q 3CCSA 3GTMH 1BBWA 2WFWA 4LF5L 2WAQG 3S1MH 3PO3G 4BY7H 1N33L 3J7ZC 2VQFL 1K8GA 1HNWQ 1VQEA 4HIKA 2ZJQA 4NXMQ 3CD6A 1GO3E 1UEBA 2HQLA 4DUZQ 4HIOA 4X65Q 1YJNA 1C7YA 1ASZA 1VQ5A 2IY5B 2I5HA 1Z9FA 1CKOA 5LMNL 2KCTA 1QZGA 5BR8Q 1XMOL 2V1CC 4L5TA 1JE5A 1VQ7A 2E5LL 4P71A 3GO5A 2PI2E 2PMZE 1GD7A 4JI7L 4HJAA 2F4VQ 2YTYA 4UPAA 3J81i 3OTOQ 4A3KG 3K80C 1JMCA 3L7ZC 3HOUH 1OTCA 3UDXA 3UE0A 4EQ5A 4DR5L 1VQPA 1VQFA 3KDFA 3ER0A 3JC66 5C0XG 2NVYH 5M3MG 4DUYL 1HZCA 3FKIG 4AQYL 1GKHA 3J7A5 2K50A 3CC7A 1Y1VG 4R4OA 1PYBA 2WB1G 1FJGL 4DR7Q 5C44G 2ES2A 1N32Q 2N49A 4IOCA 1IBKL 2R7ZH 1X3EA 2YYZA 4XIGS 4GOPA 1E22A 2CWAA 5LMUQ 3PV0A 4BY7G 3J80i 3S1NH 3E9IA 4DPGA 3TRZA 2NZHA 1L0WA 3AFQA 3I2ZA 4YWMA 5BR8L 3J81c 1QVCA 4A3MG 1YBYA 1VQMA 4H02A 5LMNQ 1TWCH 1X3FA 5AJ3Q 2OQKA 1HNZL 4LF7Q 3I4NH 4JC0A 1CUKA 2F52A 1I50H 4LF6Q 4DV1L 4DNIA 1SN8A 3VDYA 2E2IH 2IHFA 1X54A 3S14H 4A3LH 5GAEC 1J5EQ 4OWXB 2RF4A 1TWGH 3BZKA 3UDFA 1VS0A 4A75A 2KENA 5GROA 1U0LA 1NTGA 4A3GH 4LNQA 3M85A 2IHEA 3UE1A 4A4IA 4A3DH 1C0AA 2HIXA 1N36Q 5C0XI 1BVSA 2ZTCA 4DV5L 3FKIH 2MQHA 2Q2IA 5M5WH 3HKZE 3MXNB 4DV2L 2UXBQ 2JA8H 4LUOA 2K5VA 4NB3A 1VQOA 1KAWA 4DV7L 1SE8A 3I4MH 4BBSG 4JI0Q 1HNWL 3BU2A 4B3TL 1Z47A 4YWLA 4UP7A 4KHPL 4PZ6A 2K5NA 5GAHC 4P75A 4DR2L 3CMEA 1NBWA 3H0GG 4POFA 5M3FG 3D31A 4YWKA 1QVGA 1I94Q 4AYBG 1I6HH 1PFSA 3HOWH 3A74A 4R4QA 2UUBL 2UXCL 2GN5A 4A3IH 1Q86C 4OX9Q 1CSPA 1KC8C 1W3SA 3T1HQ 3H0GH 4LUZA 1VQBA 4GS3A 1VQIA 2B29A 4DR3Q 1LTLA 3GTQH 3S15H 4C2MH 5JEAG 3MEFA 1I5FA 2R7DA 3PIOA 3A5UA 3UDGA 3DM3A 1KQSA 3H3VI 4ME3A 3I4MG 4HJ5A 2UXBL 1KRSA 3TS0A 2YV5A 1X55A 1WFQA 3AFPA 2F4VL 2NZOA 1KL9A 2ZJRA 1PV4A 1ASYA 2JA7H 3H15A 4GLXA 1UE6A 3M3YH 5DLQE 2UUCL 3TREA 3TEHB 1C9OA 1HZAA 3ULLA 2I5MX 3ULPA 3CCLA 3ZJYC 2R6GA 1CKNA 2DGYA 5C3EG 1W2BA 3ERSX 4YCWA 1DGSA 3SGIA 3STBC 1S40A 1PH3A 2Z6KA 5M3MH 4DR7L 4X65L 2GVAA 4LF8Q 4DV1Q 1P16A 1CKMA 1E24A 2MFIA 5IT9c 4L5RC 4K0KQ 1QUQB 5C44H 2UUBQ 2UXCQ 5C3EH 1UE1A 3M9BA 2KHIA 5LMUL 3EIVA 1HZBA 4C3IH 2YTVA 3CAMA 2AHOB 1M1KC 2EXDA 2E2HH 2A19A 1Q82C 4IFDI 4A3IG 4JI6Q 5FLXc 2VQEL 3CF5A 2UUAL 4LF4Q 3HOWG 3NENA 1HR0W 1LM0A 2XTIA 3RZDH 3HKSA 1X56A 1PYSB 4NPSA 1PH7A 4A3CH 2VW9A 1G291 4A3EH 4AIMA 2IX1A 5FJ8H 1IBLQ 4NXNL 2HHHL 3H3VH 2ALYB 1XNQQ 4DV5Q 4A3DG 4WJ3M 4X64Q 3S1QH 4JI5Q 3I56A 1KRTA 5IP9G 3G4SA 1N36L 3K7UC 1YVCA 2K5HA 2VZAA 2K52A 3T1YQ 1XPRA 1OXSC 4DR1Q 1YIJA 4GOPB 4GKJL 3HOYH 1CKNB 3KJPA 3S2HH 4YY3L 4DV0L 3CC2A 4DR6Q 2WP8J 1P8LA 3I4NG 5IY0A 4LFBL 5K36G 2IX0A 2ZTDA 3RLOA 4A3MH 1CSQA 1XPUA 5AJ3L 4R4TA 4APVA 1EOVA 4JYAL 2OTJA 4LFAQ 4HJ8A 1N8RC 2N3SA 4JV5Q 4JOIC 2ZTEA 1NMFA 1PA6A 2UUAQ 5C4XH 1Q7YC 2VQEQ 1K8AC 1IBMQ 4O0AA 2VS1A 1FVIA 4LF4L 2B3GA 4OX9L 1FL0A 4LFCQ 4IFDG 1G6PA 2KBNA 1YEZA 1EUJA 3W1GA 1PH4A 2CQOA 1FJGQ 1Y1WG 1PH6A 4X64L 3CCVA 2L15A 1L1OC 1V1QA 3I7FA 4JBWA 4GOPC 1MJEA 1X3GA 3CCQA 1PH9A 3PO3H 3JAMi 3G48A 4JI0L 2R92H 3HOVH 4OWTB 1OXUA 5M5YH 3M4PA 3S1RH 3U58A 1MJCA 2JJQA 3CMAA 1UE7A 1E1TA 3W1BA 1OXTA 4O2DA 3NEMA 5ELNA 4GNXB 1FGUA 4LWCA 3PF4A 1AE2A 4IPGA 1N32L 1EFWA 2UXDQ 1X6OA 3EBEA 3RZOH 1EYGA 1HJPA 4JBJA 3S16H 4P72A 3NELA 3PCOB 5M3FH 1A62A 1GVPA 4LF9L 2H5XA 1YNXA 1VQGA 1K3RA 4PG3A 3CCJA 4YHHQ 3F2DA 5J3BA 1BKBA 4DR3L 1SMXA 2NN6G 3OTOL 2A8VA 1HNZQ 4B3SL 4LUVA 3M4OH 4DR1L 2ID0A 2RHSB 5FLMG 2JA9A 3K7AH 2Q2HA 2K4KA 4JI3L 4QL5A 3E0EA 4MNOA 5HGQA 4DR2Q 2HHHQ 1NY4A 4DV3L 4R4IA 3IRBA 3BZCA 1N9WA 2NVTH 4AYBE 1N34Q 3HOXG 4NXML 4GNXC 1WI5A 1EIYB 2Y0SG 4DK3C 4GLAC 4LFAL 2VQFQ 4A3BG 4GNXA 3FP9A 3UDIA 2N78A 1HR0Q 3K0XA 5IYDG 5C0XJ 4JBMA 2HT1A 1PH2A 2K14A 4BBRG 3HOYG 1XJVA 2JA7G 1NMGA 4JOIA 4YY3Q 2RCNA 5LMNW 5GADC 1T9HA 4DV0Q 4OWWB 1TWAH 4DK6C 3HFZB 3KJOA 4X62L 3HKZG 5IYDH 3CPFA 1J5EL 4B3RQ 4A3BH 2BA1A 2NN6I 1YJWA 2D0OA 2Z0SA 3I55A 4RG1A 2KHJA 1VQDA 2MO1A 4LF6L 4DV2Q 1YHQA 1X9NA 4BXXH 2AWNA 2PNHA 4QQBX 4DUZL 1QVFA 1Y14B 5H1SE 4B3RL 4MTNA 1IL2A 4GN3B 2OWOA 2ZM6L 5JJLA 2LXJA 4HJ7A 1NJIC 3PO2G 4GKJQ 5IWAQ 3L0OA 2N8NA 3T1YL 1E7ZA 2AKWB 4J15A 4A3EG 3HOVG 4TQUS 4DV4L 3J80c 4AH6A 2CWPA 4JI4L 1L1OB 3CCMA 5M5XH 3HOZG 3PUYA 4HIDA 2JA8G 4X6AH 3K81C 1WCMH 4A3JG 4JI2Q 5IP7G 3DLLA 1PHJA 4L5QA 2UXDL 3KF6A 4A93G 4DV6L 1VQ4A 1PH5A 1O7IA 4LFCL 2WAQE 1L1OA 4GLVB 4R1JA 4UP8A 3STBD 4DR4L 4BY1H 4BXXG 4JI2L 1YITA 4C3JH 2PQAA 2GVBA 1IYJB 2Z6KC 1A8VA 1E3PA 4B3SQ 4IPHA 4OONA 4A3FG 5HY6A 4LF8L 2ZJPA 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD J;  4DAY B;  3RLN A;  4P74 A;  1PH1 A;  3NBH B;  4JBK A;  3PUW A;  1AE3 A;  1XTD A;  3T1H L;  1IZ6 A;  3JAM c;  5EAY A;  2R7Z G;  4JI7 Q;  5JJK A;  1VQA A;  4LF9 Q;  3AQQ A;  1JJ2 A;  1LYL A;  1IXR A;  3S17 H;  5FJ8 G;  4IJH A;  4A76 A;  4PMW A;  3RNU A;  4MZ9 A;  2JEA I;  2I0Q A;  1I94 L;  3GTG H;  4IO9 A;  1VQL A;  2VUM H;  1YHB A;  4KHP Q;  2LSS A;  2IT1 A;  3AEV A;  1V43 A;  1XMQ L;  3A0J A;  4QGU A;  1X65 A;  1Q12 A;  2R7F A;  4LW1 A;  2MNA A;  3ICE A;  4DR4 Q;  4C3H H;  3GDE A;  1TWF H;  2UU9 Q;  4KHZ A;  2KCM A;  3M4Q A;  2LXK A;  1TWH H;  2MO0 A;  3PUZ A;  1K9M C;  4JI3 Q;  4DKA C;  3CCE A;  2JA5 G;  4LF5 Q;  5JJI A;  4Y52 H;  4AQY Q;  1IBL L;  5C4J H;  2OCE A;  4HJ9 A;  3B6Y A;  3GTJ H;  1U5K A;  4JI4 Q;  1N34 L;  4A3F H;  1S72 A;  1VQ9 A;  2F3I A;  3KYH C;  2I5L X;  1GM5 A;  2VY3 A;  1VQ6 A;  1KXL A;  4A3C G;  2BH8 A;  1SRO A;  4PZ7 A;  3G71 A;  1TXY A;  3U4Z A;  1R9T H;  1OXV A;  2CCZ A;  2RHQ B;  3AYH B;  2ZM6 Q;  1A63 A;  4LFB Q;  4FDB A;  1Q8K A;  2HIV A;  2PQA B;  3PF5 A;  1PH8 A;  4P73 A;  4OXP A;  5IYC G;  1WYD A;  4JI1 Q;  4TVA B;  5IP7 H;  1K0R A;  4POG A;  3PIP A;  3GTO H;  4A3G G;  1D7Q A;  3KF6 B;  4JI5 L;  3I4O A;  3HOZ H;  3WWV A;  3GD7 A;  4YHH L;  3RLF A;  2JK8 A;  4BY1 G;  3RR5 A;  3PUV A;  1EQR A;  4DUY Q;  1I3Q H;  4PZ8 A;  3L2P A;  1SLJ A;  2A1A A;  4YCV A;  3KF8 B;  4IPD A;  4JI1 L;  3CPW A;  2PI2 A;  1HZ9 A;  2UUC Q;  4A3K H;  2JQO A;  4KLK A;  1EQQ A;  1H95 A;  1K83 H;  1QUQ A;  3J81 j;  2EIF A;  1VQK A;  1HR0 L;  4BA1 I;  1JJG A;  3F2B A;  2CFM A;  4RMF A;  5IWA L;  2Q2U A;  3KLW A;  5JEA J;  1OXX K;  1MIU A;  1EWI A;  4B3T Q;  2NVX H;  1K73 C;  2JA5 H;  4QY7 A;  1B7Y B;  4ALP A;  2JEB I;  1M90 C;  3TS2 A;  2WB1 E;  3FHW A;  3CQZ H;  3CXC A;  1WJJ A;  4DV7 Q;  1XMQ Q;  1UE5 A;  2B63 G;  4K0K L;  1JT8 A;  3ULJ A;  3E9H A;  1RIP A;  2AWO A;  2B63 H;  4KI0 A;  2ATW A;  1J6Q A;  4QIW E;  3Q8D A;  3G6E A;  3PSI A;  4JCV E;  1A0I A;  1HH2 P;  1JB7 A;  4YCU A;  1JJC B;  2VUM G;  1D8L A;  1L2F A;  2QEX A;  3CCR A;  3F2C A;  5E7N A;  2D0P A;  2D62 A;  1RL2 A;  4OO1 I;  1VQC A;  1YHA A;  4BBS H;  4X66 L;  1XNQ L;  1BBU A;  1SFO H;  1VQ8 A;  2OTL A;  4NXN Q;  2JE6 I;  4EX5 A;  3EN2 A;  2Y0S E;  2Q2T A;  4B3M L;  4HIM A;  1Q46 A;  1HNX L;  2BH2 A;  4DR6 L;  3OW2 A;  1Q81 C;  1MKH A;  1Y1W H;  1KHI A;  3PGZ A;  3A5Z B;  5IYC H;  1Y1V H;  1IBK Q;  1WCM G;  3S2D H;  2XGT A;  4GN4 B;  4DAM A;  1KD1 C;  3K8A A;  2E2J H;  1B70 B;  1LUZ A;  4QJF A;  4GKK Q;  4IOA A;  4JI8 L;  4GN5 A;  1VQJ A;  5IYB G;  2YTX A;  1XPO A;  1EIF A;  1SR3 A;  1Q1E A;  1WOC A;  3GTP H;  5GAG C;  4XTC S;  4WJ4 A;  2NVQ H;  1Q1B A;  4UP9 A;  3M7N A;  1QZH A;  4A3J H;  3D0F A;  3S24 A;  2EQS A;  4JI6 L;  1YZ6 A;  4OO1 G;  3CW2 C;  2R93 H;  3HOU G;  1YJ9 A;  2R93 G;  4JV5 L;  5IP9 H;  3RN2 A;  1HNX Q;  2JA6 G;  3PUX A;  4IJL A;  2ASB A;  4B3M Q;  3GTK H;  3KFU A;  2QA4 A;  3CCU A;  1E1O A;  2K75 A;  3KOJ A;  4DR5 Q;  4IPC A;  5ELO A;  4UY8 C;  3W5O A;  4DV4 Q;  1PVO A;  2FXQ A;  2JA6 H;  2DUD A;  1AH9 A;  5IE8 A;  4JG2 A;  3OYY A;  3CP0 A;  2OQ0 A;  3U4V A;  2AMC B;  3LGJ A;  1VQN A;  4LF7 L;  1YI2 A;  1B8A A;  2C35 B;  3KDF B;  1VCI A;  2VNU D;  4L5S A;  2YU9 H;  4JI8 Q;  3U50 C;  3CC4 A;  1NE3 A;  3PO2 H;  4GKK L;  1XMO Q;  2E5L Q;  2QGQ A;  4R4C A;  5GQO A;  5C4X G;  2UU9 L;  3HOX H;  4Y7N H;  1XNR Q;  4DV6 Q;  1UWV A;  5IYB H;  3F8T A;  1IBM L;  4JYA Q;  1V9P A;  4A3L G;  4BBR H;  2E8G A;  3F1Z A;  3TQY A;  3RN5 A;  1G51 A;  1VQH A;  2CKZ B;  3GTL H;  4BA2 I;  4A93 H;  4X62 Q;  2VL6 A;  1KIX A;  1S3O A;  1SRU A;  1N33 Q;  4DV3 Q;  1XNR L;  3BJU A;  2R92 G;  5FLM H;  4X66 Q;  3CCS A;  3GTM H;  1BBW A;  2WFW A;  4LF5 L;  2WAQ G;  3S1M H;  3PO3 G;  4BY7 H;  1N33 L;  3J7Z C;  2VQF L;  1K8G A;  1HNW Q;  1VQE A;  4HIK A;  2ZJQ A;  4NXM Q;  3CD6 A;  1GO3 E;  1UEB A;  2HQL A;  4DUZ Q;  4HIO A;  4X65 Q;  1YJN A;  1C7Y A;  1ASZ A;  1VQ5 A;  2IY5 B;  2I5H A;  1Z9F A;  1CKO A;  5LMN L;  2KCT A;  1QZG A;  5BR8 Q;  1XMO L;  2V1C C;  4L5T A;  1JE5 A;  1VQ7 A;  2E5L L;  4P71 A;  3GO5 A;  2PI2 E;  2PMZ E;  1GD7 A;  4JI7 L;  4HJA A;  2F4V Q;  2YTY A;  4UPA A;  3J81 i;  3OTO Q;  4A3K G;  3K80 C;  1JMC A;  3L7Z C;  3HOU H;  1OTC A;  3UDX A;  3UE0 A;  4EQ5 A;  4DR5 L;  1VQP A;  1VQF A;  3KDF A;  3ER0 A;  3JC6 6;  5C0X G;  2NVY H;  5M3M G;  4DUY L;  1HZC A;  3FKI G;  4AQY L;  1GKH A;  3J7A 5;  2K50 A;  3CC7 A;  1Y1V G;  4R4O A;  1PYB A;  2WB1 G;  1FJG L;  4DR7 Q;  5C44 G;  2ES2 A;  1N32 Q;  2N49 A;  4IOC A;  1IBK L;  2R7Z H;  1X3E A;  2YYZ A;  4XIG S;  4GOP A;  1E22 A;  2CWA A;  5LMU Q;  3PV0 A;  4BY7 G;  3J80 i;  3S1N H;  3E9I A;  4DPG A;  3TRZ A;  2NZH A;  1L0W A;  3AFQ A;  3I2Z A;  4YWM A;  5BR8 L;  3J81 c;  1QVC A;  4A3M G;  1YBY A;  1VQM A;  4H02 A;  5LMN Q;  1TWC H;  1X3F A;  5AJ3 Q;  2OQK A;  1HNZ L;  4LF7 Q;  3I4N H;  4JC0 A;  1CUK A;  2F52 A;  1I50 H;  4LF6 Q;  4DV1 L;  4DNI A;  1SN8 A;  3VDY A;  2E2I H;  2IHF A;  1X54 A;  3S14 H;  4A3L H;  5GAE C;  1J5E Q;  4OWX B;  2RF4 A;  1TWG H;  3BZK A;  3UDF A;  1VS0 A;  4A75 A;  2KEN A;  5GRO A;  1U0L A;  1NTG A;  4A3G H;  4LNQ A;  3M85 A;  2IHE A;  3UE1 A;  4A4I A;  4A3D H;  1C0A A;  2HIX A;  1N36 Q;  5C0X I;  1BVS A;  2ZTC A;  4DV5 L;  3FKI H;  2MQH A;  2Q2I A;  5M5W H;  3HKZ E;  3MXN B;  4DV2 L;  2UXB Q;  2JA8 H;  4LUO A;  2K5V A;  4NB3 A;  1VQO A;  1KAW A;  4DV7 L;  1SE8 A;  3I4M H;  4BBS G;  4JI0 Q;  1HNW L;  3BU2 A;  4B3T L;  1Z47 A;  4YWL A;  4UP7 A;  4KHP L;  4PZ6 A;  2K5N A;  5GAH C;  4P75 A;  4DR2 L;  3CME A;  1NBW A;  3H0G G;  4POF A;  5M3F G;  3D31 A;  4YWK A;  1QVG A;  1I94 Q;  4AYB G;  1I6H H;  1PFS A;  3HOW H;  3A74 A;  4R4Q A;  2UUB L;  2UXC L;  2GN5 A;  4A3I H;  1Q86 C;  4OX9 Q;  1CSP A;  1KC8 C;  1W3S A;  3T1H Q;  3H0G H;  4LUZ A;  1VQB A;  4GS3 A;  1VQI A;  2B29 A;  4DR3 Q;  1LTL A;  3GTQ H;  3S15 H;  4C2M H;  5JEA G;  3MEF A;  1I5F A;  2R7D A;  3PIO A;  3A5U A;  3UDG A;  3DM3 A;  1KQS A;  3H3V I;  4ME3 A;  3I4M G;  4HJ5 A;  2UXB L;  1KRS A;  3TS0 A;  2YV5 A;  1X55 A;  1WFQ A;  3AFP A;  2F4V L;  2NZO A;  1KL9 A;  2ZJR A;  1PV4 A;  1ASY A;  2JA7 H;  3H15 A;  4GLX A;  1UE6 A;  3M3Y H;  5DLQ E;  2UUC L;  3TRE A;  3TEH B;  1C9O A;  1HZA A;  3ULL A;  2I5M X;  3ULP A;  3CCL A;  3ZJY C;  2R6G A;  1CKN A;  2DGY A;  5C3E G;  1W2B A;  3ERS X;  4YCW A;  1DGS A;  3SGI A;  3STB C;  1S40 A;  1PH3 A;  2Z6K A;  5M3M H;  4DR7 L;  4X65 L;  2GVA A;  4LF8 Q;  4DV1 Q;  1P16 A;  1CKM A;  1E24 A;  2MFI A;  5IT9 c;  4L5R C;  4K0K Q;  1QUQ B;  5C44 H;  2UUB Q;  2UXC Q;  5C3E H;  1UE1 A;  3M9B A;  2KHI A;  5LMU L;  3EIV A;  1HZB A;  4C3I H;  2YTV A;  3CAM A;  2AHO B;  1M1K C;  2EXD A;  2E2H H;  2A19 A;  1Q82 C;  4IFD I;  4A3I G;  4JI6 Q;  5FLX c;  2VQE L;  3CF5 A;  2UUA L;  4LF4 Q;  3HOW G;  3NEN A;  1HR0 W;  1LM0 A;  2XTI A;  3RZD H;  3HKS A;  1X56 A;  1PYS B;  4NPS A;  1PH7 A;  4A3C H;  2VW9 A;  1G29 1;  4A3E H;  4AIM A;  2IX1 A;  5FJ8 H;  1IBL Q;  4NXN L;  2HHH L;  3H3V H;  2ALY B;  1XNQ Q;  4DV5 Q;  4A3D G;  4WJ3 M;  4X64 Q;  3S1Q H;  4JI5 Q;  3I56 A;  1KRT A;  5IP9 G;  3G4S A;  1N36 L;  3K7U C;  1YVC A;  2K5H A;  2VZA A;  2K52 A;  3T1Y Q;  1XPR A;  1OXS C;  4DR1 Q;  1YIJ A;  4GOP B;  4GKJ L;  3HOY H;  1CKN B;  3KJP A;  3S2H H;  4YY3 L;  4DV0 L;  3CC2 A;  4DR6 Q;  2WP8 J;  1P8L A;  3I4N G;  5IY0 A;  4LFB L;  5K36 G;  2IX0 A;  2ZTD A;  3RLO A;  4A3M H;  1CSQ A;  1XPU A;  5AJ3 L;  4R4T A;  4APV A;  1EOV A;  4JYA L;  2OTJ A;  4LFA Q;  4HJ8 A;  1N8R C;  2N3S A;  4JV5 Q;  4JOI C;  2ZTE A;  1NMF A;  1PA6 A;  2UUA Q;  5C4X H;  1Q7Y C;  2VQE Q;  1K8A C;  1IBM Q;  4O0A A;  2VS1 A;  1FVI A;  4LF4 L;  2B3G A;  4OX9 L;  1FL0 A;  4LFC Q;  4IFD G;  1G6P A;  2KBN A;  1YEZ A;  1EUJ A;  3W1G A;  1PH4 A;  2CQO A;  1FJG Q;  1Y1W G;  1PH6 A;  4X64 L;  3CCV A;  2L15 A;  1L1O C;  1V1Q A;  3I7F A;  4JBW A;  4GOP C;  1MJE A;  1X3G A;  3CCQ A;  1PH9 A;  3PO3 H;  3JAM i;  3G48 A;  4JI0 L;  2R92 H;  3HOV H;  4OWT B;  1OXU A;  5M5Y H;  3M4P A;  3S1R H;  3U58 A;  1MJC A;  2JJQ A;  3CMA A;  1UE7 A;  1E1T A;  3W1B A;  1OXT A;  4O2D A;  3NEM A;  5ELN A;  4GNX B;  1FGU A;  4LWC A;  3PF4 A;  1AE2 A;  4IPG A;  1N32 L;  1EFW A;  2UXD Q;  1X6O A;  3EBE A;  3RZO H;  1EYG A;  1HJP A;  4JBJ A;  3S16 H;  4P72 A;  3NEL A;  3PCO B;  5M3F H;  1A62 A;  1GVP A;  4LF9 L;  2H5X A;  1YNX A;  1VQG A;  1K3R A;  4PG3 A;  3CCJ A;  4YHH Q;  3F2D A;  5J3B A;  1BKB A;  4DR3 L;  1SMX A;  2NN6 G;  3OTO L;  2A8V A;  1HNZ Q;  4B3S L;  4LUV A;  3M4O H;  4DR1 L;  2ID0 A;  2RHS B;  5FLM G;  2JA9 A;  3K7A H;  2Q2H A;  2K4K A;  4JI3 L;  4QL5 A;  3E0E A;  4MNO A;  5HGQ A;  4DR2 Q;  2HHH Q;  1NY4 A;  4DV3 L;  4R4I A;  3IRB A;  3BZC A;  1N9W A;  2NVT H;  4AYB E;  1N34 Q;  3HOX G;  4NXM L;  4GNX C;  1WI5 A;  1EIY B;  2Y0S G;  4DK3 C;  4GLA C;  4LFA L;  2VQF Q;  4A3B G;  4GNX A;  3FP9 A;  3UDI A;  2N78 A;  1HR0 Q;  3K0X A;  5IYD G;  5C0X J;  4JBM A;  2HT1 A;  1PH2 A;  2K14 A;  4BBR G;  3HOY G;  1XJV A;  2JA7 G;  1NMG A;  4JOI A;  4YY3 Q;  2RCN A;  5LMN W;  5GAD C;  1T9H A;  4DV0 Q;  4OWW B;  1TWA H;  4DK6 C;  3HFZ B;  3KJO A;  4X62 L;  3HKZ G;  5IYD H;  3CPF A;  1J5E L;  4B3R Q;  4A3B H;  2BA1 A;  2NN6 I;  1YJW A;  2D0O A;  2Z0S A;  3I55 A;  4RG1 A;  2KHJ A;  1VQD A;  2MO1 A;  4LF6 L;  4DV2 Q;  1YHQ A;  1X9N A;  4BXX H;  2AWN A;  2PNH A;  4QQB X;  4DUZ L;  1QVF A;  1Y14 B;  5H1S E;  4B3R L;  4MTN A;  1IL2 A;  4GN3 B;  2OWO A;  2ZM6 L;  5JJL A;  2LXJ A;  4HJ7 A;  1NJI C;  3PO2 G;  4GKJ Q;  5IWA Q;  3L0O A;  2N8N A;  3T1Y L;  1E7Z A;  2AKW B;  4J15 A;  4A3E G;  3HOV G;  4TQU S;  4DV4 L;  3J80 c;  4AH6 A;  2CWP A;  4JI4 L;  1L1O B;  3CCM A;  5M5X H;  3HOZ G;  3PUY A;  4HID A;  2JA8 G;  4X6A H;  3K81 C;  1WCM H;  4A3J G;  4JI2 Q;  5IP7 G;  3DLL A;  1PHJ A;  4L5Q A;  2UXD L;  3KF6 A;  4A93 G;  4DV6 L;  1VQ4 A;  1PH5 A;  1O7I A;  4LFC L;  2WAQ E;  1L1O A;  4GLV B;  4R1J A;  4UP8 A;  3STB D;  4DR4 L;  4BY1 H;  4BXX G;  4JI2 L;  1YIT A;  4C3J H;  2PQA A;  2GVB A;  1IYJ B;  2Z6K C;  1A8V A;  1E3P A;  4B3S Q;  4IPH A;  4OON A;  4A3F G;  5HY6 A;  4LF8 L;  2ZJP A;  2BA0 A; 
#chains in the Genus database with same CATH topology
 1QWY A;  4J8Q A;  4DAY B;  4EQN A;  5CV6 A;  3T1H L;  2R7Z G;  5EAY A;  1JJ2 A;  4RCO A;  3S17 H;  5FJ8 G;  4A76 A;  3RNU A;  1A2T A;  2CVR A;  1CA6 A;  3GTG H;  4KHP Q;  4X3S A;  1CM9 A;  2NZ1 D;  5CV9 A;  4R8I A;  1X65 A;  1QCB D;  1X3Q A;  3ICE A;  4IUV A;  1TS4 A;  2B8F A;  4DR4 Q;  4ZUI A;  2KCM A;  2K01 A;  1K9M C;  4IN3 A;  5JJI A;  1SYF A;  2V4D A;  2JA7 B;  4HJ9 A;  3B6Y A;  4MIU A;  1KDC A;  3KYH C;  5I4D A;  1KDB A;  3G71 A;  2IX3 A;  2EE1 A;  2CCZ A;  2RHQ B;  4PQX A;  1NCV A;  1H9R A;  4FYD A;  4P73 A;  3S1R B;  2WB1 B;  4XT1 B;  3EFX D;  5IP7 H;  2MP1 A;  3PIP A;  2C5C A;  1WTP A;  2BOS A;  1PTO C;  4FXK C;  1F2L A;  3GD7 A;  2IY5 B;  4BXX H;  1E0B A;  1KLU D;  1I4R A;  2A1A A;  4IPD A;  1HZ9 A;  1S5E D;  3URY A;  1CHP D;  4QCL A;  1EEF D;  3J81 j;  4BA1 I;  4RMF A;  5IGD A;  3KLW A;  1EWI A;  1CQV A;  3TME A;  4QY7 A;  1M90 C;  2JEB I;  2F0W A;  3FHW A;  1TWG B;  1WJJ A;  1UE5 A;  4RKB A;  3E9H A;  3J80 E;  4KI0 A;  2PW7 A;  4KKU A;  3IL8 A;  5C5L A;  1WTV A;  4YCU A;  3PQI A;  2XSC A;  3X3N A;  4EQO A;  2CH4 W;  5E7N A;  3I73 A;  1EU3 A;  2PMZ B;  4OO1 I;  1PZI D;  1B9M A;  1XNQ L;  1BBU A;  4Z9C B;  2DY8 A;  5IGB A;  2Q2T A;  5D65 A;  4BBR B;  4FO2 A;  3IFT A;  1Y1V H;  1IBK Q;  4F88 A;  1WCM G;  3S2D H;  1NAP A;  5I2Y A;  2E2J H;  4QJF A;  3Q23 A;  2QDB A;  1VQJ A;  3P1H A;  4KY5 A;  5COR A;  3HRZ C;  4WJ4 A;  2X6L A;  3MXG A;  1KNE A;  2F0T A;  3D0F A;  2PCF B;  2AUJ D;  2LY7 A;  2EPB A;  3CW2 C;  2R93 H;  2F3W A;  2JSO A;  3T16 A;  1TKW B;  1OO9 B;  1YJ9 A;  2JN4 A;  3KFU A;  1KLG D;  1BCP C;  1E1O A;  4DR5 Q;  1JB3 A;  2B2U A;  1PVO A;  2FXQ A;  2JA6 H;  2DUD A;  3AB9 A;  5IE8 A;  2OQ0 A;  3BVM A;  1ROD A;  1TWA B;  2AMC B;  3V2T A;  1YI2 A;  2C35 B;  3NK9 A;  4L5S A;  3NBH A;  1TQO A;  2YU9 H;  3U50 C;  1R9T B;  1GUS A;  1TT2 A;  1XX8 A;  5E4W C;  1XNR Q;  4HAE A;  4DV6 Q;  1H9J A;  2EY1 A;  5T1G A;  4BA2 I;  3GTL H;  3P75 A;  1O78 A;  2CQA A;  1XNR L;  4DV3 Q;  3J81 L;  4RHS A;  1BBW A;  4BY7 H;  3PO3 G;  2E2H B;  4V19 0;  3OWE B;  2IPK D;  1DYQ A;  2VQF L;  1K8G A;  4KK7 A;  4QB4 A;  1EY9 A;  4NXM Q;  1PLF A;  3DWQ A;  5D14 A;  2HQL A;  4HIO A;  1F77 A;  2I5H A;  4ZAI A;  1Y8N B;  5LMN L;  3S16 B;  3SHL A;  4P71 A;  2PI2 E;  2CW0 D;  2F4V Q;  1ENF A;  2BE5 D;  3R2T A;  3I8Z A;  4C3H G;  3OTO Q;  3S2D B;  4A3K G;  3K59 A;  1A3T A;  1JMC A;  3VYS A;  3KLS X;  1VQP A;  1I6V C;  3KDF A;  4C3J B;  4TRD A;  3SK8 A;  3T53 B;  2NVY H;  2A5H A;  2F0U A;  2L5T A;  4F87 A;  1HZC A;  5M3M G;  3GTK B;  3J7A 5;  1KAA A;  4ZYS A;  1FJG L;  1IBK L;  1PMR A;  3NQI A;  4OEM B;  5LMU Q;  1UEA B;  5C3W A;  3TRZ A;  4IUP A;  2NZH A;  4YWM A;  1RHP A;  4A3M G;  1QVC A;  1K8M A;  1CT1 D;  5AJ3 Q;  2F0P A;  2OQK A;  3M7G A;  4K8J A;  1CUK A;  2WAC A;  1Z6H A;  4LF6 Q;  1SN8 A;  1RJT A;  2NBF A;  4DNT B;  3S14 H;  3S1M B;  4A3L H;  5GAE C;  1TWG H;  4A75 A;  3D6C A;  5GRO A;  4DU9 A;  5M5Y B;  4A3D H;  4K2L A;  1TY0 A;  2K5W A;  2ZTC A;  4DV2 L;  3MXN B;  3BYT B;  4LUO A;  3J80 L;  2NYZ D;  3NSW A;  4XYO A;  3VA5 A;  1A3U A;  1SE8 A;  3EVQ A;  1Z47 A;  3NUC A;  1EQT A;  2XVS A;  4PZ6 A;  2K5N A;  4P75 A;  1I94 Q;  4YWK A;  1QVG A;  3TP6 A;  4AYB G;  1LTR D;  4L6T B;  5E1F A;  5CV4 A;  1HTL D;  4LUZ A;  4GS3 A;  4C2M H;  4IUT A;  3MEF A;  1I5F A;  1O7L A;  3PIO A;  3UDG A;  3H3V I;  4JYA Q;  3FMC A;  2NZO A;  1KL9 A;  2JA7 H;  4IZ8 A;  3NTI A;  1C9O A;  3CCL A;  3ULP A;  2I5M X;  5C3E G;  2DGY A;  3ERS X;  3GTP B;  1DGS A;  4BS9 A;  2CH4 A;  1S40 A;  1CKM A;  1D1I A;  3J7A V;  5IT9 c;  2K7V A;  5C44 H;  2UXC Q;  4JW0 A;  1UE1 A;  2M2L A;  4B9X A;  1SEB D;  4CKC A;  3CAM A;  2IW3 A;  5I6W A;  2E2H H;  1NUC A;  2A19 A;  4ZUJ A;  1Q82 C;  4A3I G;  4ZQ3 A;  4IFD I;  1PTO F;  5FLX c;  3NEN A;  2NN6 H;  1LM0 A;  3RZD H;  1PYS B;  1PH7 A;  4A3C H;  4A3E H;  2G9D A;  3GTL B;  2RSN A;  3BG3 A;  3H3V H;  3S1Q H;  2D2C C;  2K5H A;  2RCF A;  5DNF A;  2VZA A;  2K52 A;  3T1Y Q;  1XPR A;  1OXS C;  4GKJ L;  3LNN A;  2NB0 A;  1CKN B;  1STA A;  5DAU A;  1O80 A;  4DV0 L;  4DR6 Q;  1P8L A;  2O5I C;  3OIQ A;  1I4G A;  3RLO A;  4A3M H;  1CSQ A;  4APV A;  5I9O A;  2OTJ A;  3FRP B;  1I6H B;  1N8R C;  1Z7T A;  3SXH A;  4JOI C;  1STY A;  1NMF A;  1ZYR C;  4FXG C;  5IGC A;  4G7Z C;  1Q7Y C;  2VQE Q;  1A2U A;  1PA6 A;  2VS1 A;  3CQZ B;  2XIW A;  2B3G A;  4OX9 L;  1FL0 A;  1SDF A;  1EUJ A;  1PH4 A;  5CV7 A;  1IW7 C;  1Y1W G;  5C0X H;  1PH6 A;  1DON A;  2F0S A;  3PO3 H;  5IIF A;  3JAM i;  2A6H C;  3A8K E;  4KN7 C;  4JI0 L;  5A2Q L;  1JWS D;  1K3B C;  3PF4 A;  4IPG A;  1EFW A;  2UXD Q;  1X6O A;  5J39 A;  1EL0 A;  3NEL A;  3PIP 3;  2IJ0 A;  3R93 A;  4OIK A;  4PG3 A;  2MJ8 A;  4YHH Q;  1ZXT A;  1Y1V B;  1TWH B;  2XNA C;  4DFA A;  1I4X A;  2RHS B;  2EZV A;  1DD2 A;  3K7A H;  3MA2 B;  1EEI D;  5NUC A;  2B2W C;  3E0E A;  4MNO A;  3X3M A;  2LFN A;  1PXU A;  1EY7 A;  3BZC A;  3DM1 A;  1N9W A;  3K5L A;  2VB3 X;  1ZYR D;  2Y0S G;  2N78 A;  1HR0 Q;  5C0X J;  2HT1 A;  4WJW A;  4DNR B;  1J8I A;  2SDF A;  4BBR G;  1XJV A;  2B2Y C;  4JOI A;  4XQQ A;  4YY3 Q;  1M8A A;  2RCN A;  3SVM A;  1T9H A;  4DK6 C;  3KJO A;  1GHJ A;  3TN2 A;  1Y1W B;  2BA1 A;  1ESF A;  1YJW A;  2Z0S A;  2MO1 A;  4LF6 L;  4RCN A;  1EY8 A;  2VXW A;  4B3R L;  1VF5 C;  1STH A;  1LTA D;  2L9H A;  2ZM6 L;  1LTT D;  4KN4 C;  3T4A C;  4ABN A;  3KK7 A;  5BN4 A;  4JI4 L;  2CWP A;  3HOZ G;  1JWM D;  1WVL A;  3K81 C;  2JXM B;  1WCM H;  1JC7 A;  3Q22 A;  1FNU A;  1HFG A;  1E2W A;  2A73 B;  3DLL A;  1PHJ A;  3KF6 A;  2OXP A;  2SOB A;  2BDN A;  1O7I A;  4K6L A;  4LFC L;  2WAQ E;  1YNJ D;  4GLV B;  4DR4 L;  1HRJ A;  4RGO S;  4ZCK A;  5JVH 3;  4BXX G;  1NR4 A;  1PFB A;  2IWH A;  4C3J H;  4OIJ A;  4RAU C;  5K36 H;  2Z6K C;  3EQL C;  1ICW A;  3R2I A;  2BA0 A;  1UE7 A;  4IFD J;  2NVY B;  3HOZ B;  4KV6 A;  4C3I B;  3RLN A;  4EVO A;  1AE3 A;  5TSS A;  2A69 C;  4JI7 Q;  5LL6 X;  1VQA A;  4LF9 Q;  1HA6 A;  2NTT A;  3AQQ A;  4LAA A;  5EPL A;  4CKB A;  2F0G A;  2VUM H;  2K5Q A;  1YHB A;  2IT1 A;  3A0J A;  4QGU A;  1Q12 A;  2R7F A;  4LW1 A;  1AZQ A;  1Q3L A;  2DN8 A;  4ZKC B;  1NNX A;  3ZYY X;  4BBS H;  2K05 A;  2MO0 A;  3DHQ A;  4JI3 Q;  2JA5 G;  4A3G B;  1SFO B;  2Z1C A;  2RA4 A;  3D4R A;  2SEB D;  5C4J H;  1ENC A;  3PO3 B;  2QW7 A;  3NWT A;  4LK1 C;  5KGU A;  3SDZ A;  1VQ9 A;  2F3I A;  1GM5 A;  1VMP A;  2VY3 A;  2BH8 A;  1SRO A;  3U4Z A;  1R9T H;  1M4V A;  1A63 A;  4LFB Q;  2PQA B;  4K6D A;  4RGM A;  3KF8 A;  3D4W A;  3BVG A;  4K8I A;  1DZ1 A;  4POG A;  4A3G G;  2JA5 B;  1EY4 A;  4PMC A;  1PRT B;  3I4O A;  3DWP A;  3SEB A;  3RLF A;  2JK8 A;  3RR5 A;  4DN4 M;  1EQR A;  3FPU B;  4PZ8 A;  5C4J B;  1SLJ A;  4YCV A;  1B2T A;  3KF8 B;  2PI2 A;  2UUC Q;  4A3K H;  2JQO A;  2M9V A;  2XRQ D;  3VA7 A;  2F0V A;  2XRS D;  2CFM A;  2Q2U A;  1GXD C;  3QB3 A;  1HTP A;  3CXC A;  4K0K L;  4X3K A;  1JT8 A;  1SNQ A;  1RIP A;  2AWO A;  2A6H D;  2ATW A;  1J6Q A;  1EIG A;  4QIW E;  3Q8D A;  3G6E A;  4JCV E;  1JJC B;  3CCR A;  1L2F A;  1I4H A;  3GTJ B;  3L3O C;  2E74 C;  3LWU A;  4X66 L;  1VQ8 A;  4IAL A;  2F0M A;  3OW7 A;  1WTX A;  4HIM A;  1HNX L;  2BH2 A;  4DR6 L;  1Q81 C;  4GZY C;  1MKH A;  3M4Y A;  1X3P A;  4PMB A;  2XGT A;  2EYO A;  1C4Q A;  1KD1 C;  2FHT A;  4JI8 L;  5IYB G;  1XPO A;  1EIF A;  1SR3 A;  1Q1E A;  5DM6 3;  4U67 3;  3MHB A;  2NVQ H;  2LMC B;  2KVM A;  1QZH A;  4A3J H;  3TZD A;  1UUP A;  4MHE A;  2EQS A;  5CGK A;  3E3X A;  2F03 A;  1GUO A;  4HCE A;  4BWG B;  5KRU A;  4JV5 L;  2R93 G;  2XWJ B;  4IJL A;  2KUM A;  4B3M Q;  2QA4 A;  2E2D C;  3KOJ A;  1HCZ A;  2K03 A;  4A3J B;  1B3Q A;  3LX0 A;  3W3A A;  5L37 A;  4JG2 A;  3CP0 A;  2HCI A;  4LF7 L;  1XTC D;  3KDF B;  4BY1 B;  2VNU D;  2E75 C;  1CI3 M;  5FK9 C;  3C2P A;  1NE3 A;  4GKK L;  1JOR A;  1SNM A;  2QGQ A;  5GQO A;  2KHS A;  3K58 A;  4PV1 C;  3SK4 A;  5C4X G;  3J81 E;  3HOX H;  1UWV A;  5IYB H;  3F8T A;  2FFK B;  1IBM L;  5KNC A;  5ELB A;  2E8G A;  3RN5 A;  1G51 A;  2CKZ B;  1U9R A;  1FYC A;  1H9M A;  1CTM A;  1KIX A;  1S3O A;  1SRU A;  1PTO H;  1I3Q B;  3ERO A;  2EYM A;  1XYI A;  1N33 L;  3NQT A;  3A8I E;  4HIK A;  2NTS A;  1BXT A;  1HA5 A;  1GO3 E;  1VQ5 A;  2KCC A;  1DXM A;  2A6E C;  1Z9F A;  1CKO A;  2KCT A;  1QZG A;  3HOX B;  5BR8 Q;  2E5L L;  2V1C C;  2EJM A;  1U4L A;  2PMZ E;  4JI7 L;  5EKK A;  3VYR A;  5DM7 3;  3J81 i;  4RH6 A;  2G5D A;  3L7Z C;  1OTC A;  1T5E A;  3UDX A;  4DR5 L;  2BDO A;  1PZJ D;  1STN A;  1XWE A;  3FKI G;  1JQY D;  1PYB A;  3MTS A;  4DR7 Q;  5C44 G;  2ES2 A;  1N32 Q;  2N49 A;  3K57 A;  2R7Z H;  2SNS A;  4K5X A;  3J80 i;  3S1N H;  3E9I A;  1UNS A;  1YBY A;  4LF7 Q;  1I4Q A;  5EKL A;  5ELE A;  2F52 A;  4DV1 L;  5EBD A;  2E2I H;  1X54 A;  3A7L A;  2EVB A;  5C4Z A;  4OWX B;  1GUG A;  3GTM B;  3A54 A;  2NVX B;  4A3G H;  4LNQ A;  3M85 A;  2IHE A;  4A4I A;  1PDQ A;  2HIX A;  4EGV A;  1FNW A;  4DV5 L;  3FKI H;  2Q2I A;  3HKZ E;  2UXB Q;  3MC0 B;  2JA8 H;  2KOL A;  1PFM A;  4JI0 Q;  3SE0 A;  1CQF A;  4O42 A;  4UP7 A;  4B9W A;  2PZW A;  4DR2 L;  3CME A;  3RD4 A;  3H0G G;  3RMH A;  4POF A;  3I4N B;  3QOJ A;  1PFS A;  4HSV A;  3A74 A;  4R4Q A;  4UAI A;  1T5X D;  4KKS A;  3T1H Q;  2J0T D;  3PO2 B;  4EQP A;  5EPK A;  4DR3 Q;  3GTQ H;  5IT9 E;  1SYG A;  1B4O A;  1KQS A;  2R7D A;  3A5U A;  1DJR D;  1ESR A;  1FD7 D;  4ULL A;  5CV5 A;  3I4M G;  1GUT A;  2RDG A;  2YV5 A;  3OSO A;  1WFQ A;  3AFP A;  4KY6 A;  1LT3 D;  3TDQ A;  3H15 A;  1UE6 A;  3VYU A;  4A93 H;  2R6G A;  2F0E A;  4CJ2 C;  1W2B A;  4C2M B;  3SGI A;  1SYB A;  5M3M H;  4DR7 L;  4J6H A;  4DA2 A;  1SMY C;  2MFI A;  3C1E A;  1PRT D;  1D6E C;  1QUQ B;  2UUB Q;  5C3E H;  2DJF C;  5LMU L;  3WOF A;  1HZB A;  4NKL A;  3GV6 A;  2EXD A;  1HHV A;  1EYD A;  2D5D A;  4OL7 A;  4LF4 Q;  3C46 A;  1HR0 W;  1EYC A;  1X56 A;  3HKS A;  4NPS A;  1G29 1;  4AIM A;  3ITP A;  4CJ1 B;  2B8G A;  1IBL Q;  4NXN L;  3A7A B;  4KTA A;  4DV5 Q;  3HGB A;  3OWF A;  5K5P A;  1IYU A;  4DGZ A;  5FO8 B;  2J4X A;  4DR1 Q;  5FLX L;  4GOP B;  1HUM A;  2L1B A;  3H0G B;  4XT3 B;  3MXN A;  1PZK D;  3VYT A;  5CC4 A;  5IY0 A;  3I4N G;  5K36 G;  2IX0 A;  2HUG A;  2ZTD A;  2AQ2 B;  3IKJ A;  3P7J A;  4A3I B;  1CA5 A;  2B2T C;  4R4T A;  4JYA L;  4LFA Q;  4HJ8 A;  1SND A;  2N3S A;  1QE6 A;  5CYU A;  2EYL A;  2ZTE A;  2UUA Q;  5C4X H;  1LV9 A;  3M3Y H;  1IBM Q;  4O0A A;  2HDM A;  4LFC Q;  2KBN A;  2RDH A;  3W1G A;  1VF7 A;  4CDD C;  2CQO A;  2Q8R E;  3JAM E;  3BDC A;  2L15 A;  1V1Q A;  1IYV A;  3CCQ A;  1PH9 A;  5JVG 3;  1PRT C;  3G48 A;  2RKS A;  4KMU C;  2OF1 A;  4OWT B;  3M4P A;  4N8F A;  2JJQ A;  1E1T A;  4X6A H;  2BE5 C;  3NEM A;  4QIW B;  1FGU A;  1HUN A;  1H9K A;  2ZXP A;  3RZO H;  1HJP A;  4JBJ A;  4RKL A;  5KYI A;  3S16 H;  4P72 A;  4MN3 A;  3PCO B;  4LF9 L;  1WCM B;  2F3V A;  1YNX A;  2B39 A;  2IL8 A;  1K3R A;  4XQN A;  4Q0F A;  5J3B A;  1BKB A;  1EOT A;  4ME5 A;  4DR3 L;  2NN6 G;  3OTO L;  4B3S L;  3CHB D;  3M4O H;  2ID0 A;  4C3H B;  2Z4H A;  5FLM G;  4BY7 B;  1K0S A;  3NHH A;  2Q2H A;  2K4K A;  4JI3 L;  2EY2 A;  4I65 A;  1SXT A;  4X3T A;  3S15 B;  3VR6 A;  5I2X A;  5A2Q E;  2NVT H;  3A55 A;  4AYB E;  1H9S A;  1N34 Q;  4GNX C;  1WI5 A;  1YNN C;  2Z9H A;  1EIY B;  4DK3 C;  3GP7 A;  3FDT A;  5M3F B;  1STG A;  3NE5 B;  4GNX A;  3FP9 A;  2NWG A;  1CZG A;  2EY6 A;  1F9S A;  1GUN A;  2K14 A;  2MGS A;  3HOY G;  3VR3 A;  1MSH A;  2JA7 G;  3NBI A;  3L9A X;  2I46 A;  5GAD C;  1DOL A;  1TWA H;  4LJZ C;  1B44 D;  2ZXR A;  1S5B D;  5J1Z A;  5IYD H;  2I07 B;  3E6Z X;  3CPF A;  4RGN A;  4M8A A;  1F9R A;  4A3B H;  3CKI B;  2AWN A;  4DUZ L;  1GHK A;  1QVF A;  3ONA B;  4N9P A;  1Y14 B;  2OEO A;  3DEP A;  3V96 A;  5H1S E;  1G2S A;  4GN3 B;  1IL2 A;  3AMU A;  2LXJ A;  4HJ7 A;  1NJI C;  4GKJ Q;  3C1F A;  2EYH A;  2AKW B;  2F1M A;  4G4K A;  1QG7 A;  4UDU C;  2WII B;  4JVZ A;  5M5X H;  2BCO A;  3FVQ A;  4A3J G;  4JI2 Q;  1HFN A;  1I50 B;  5IGE A;  4HCS A;  4KHV A;  3G6J B;  1L1O A;  1U4M A;  4R1J A;  3STB D;  4JI2 L;  1YIT A;  2PQA A;  2LKV A;  1GUW A;  4A3K B;  3V05 A;  5EQ0 A;  4IPH A;  4OON A;  5HY6 A;  1JWU D;  2A68 C;  4LF8 L;  4C3J G;  3TP8 A;  3H94 A;  4FF1 A;  3NBH B;  3PUW A;  1XTD A;  1IZ6 A;  1LYL A;  1IXR A;  1KTK A;  4IJH A;  4MZ9 A;  1SYE A;  3MXU A;  2I0Q A;  2B2V C;  1ILQ A;  4IO9 A;  2LSS A;  5IT9 L;  1JOK A;  5IGF A;  3AEV A;  1XMQ L;  2H4O A;  2MNA A;  3BVZ A;  4C3H H;  1TWF H;  2UU9 Q;  4QMG A;  3M4Q A;  2LXK A;  4LF5 Q;  4S3S A;  3CCE A;  4Y52 H;  1IBL L;  4RWS C;  4K14 A;  3H3V C;  4JI4 Q;  1N34 L;  1S72 A;  3M4O B;  2B2V A;  2I5L X;  4NW2 A;  1VQ6 A;  3N6R A;  1BO0 A;  3KBG A;  1TXY A;  1KNA A;  3F2U A;  2KED A;  1D5Z C;  2ZM6 Q;  1V1P A;  1Q8K A;  2KEC A;  2HIV A;  2L12 A;  2Q8I B;  3PF5 A;  1PH8 A;  2PNR C;  5C44 B;  1S5C D;  4JI1 Q;  3GTO H;  3TBI B;  2AUK A;  1WTH A;  3KF6 B;  4JI5 L;  3FEW X;  3HOZ H;  4M1U B;  1ENA A;  4BY1 G;  4DUY Q;  3TP7 A;  1I3Q H;  4JI1 L;  3DMU A;  2QKI C;  2A74 C;  5FKA C;  2EIF A;  1VQK A;  1HR0 L;  1JJG A;  2K5D A;  1TR5 A;  3HEJ A;  5JEA J;  1OXX K;  4X3U A;  4B3T Q;  4AYB B;  1K73 C;  3GTO B;  1B7Y B;  2SNM A;  3TS2 A;  2WB1 E;  5C3X A;  5JEA H;  2B63 G;  1STB A;  3DWA A;  2F4I A;  2EYF A;  3D6W A;  3I4L A;  1WTQ A;  2VUM G;  2QEX A;  3P20 A;  3F2C A;  2WV6 D;  1RL2 A;  2EDG A;  1VQC A;  2OTL A;  2JE6 I;  4EX5 A;  3EN2 A;  1KDA A;  1X32 A;  1Q46 A;  4DAY A;  3OW2 A;  1Y1W H;  1KHI A;  3PGZ A;  2EOT A;  2WKC A;  4N9T A;  4A3D B;  5IYC H;  1RTN A;  1S5F D;  5KIX A;  1MGS A;  4DAM A;  4IOA A;  1B70 B;  1LUZ A;  4GKK Q;  3I70 A;  3OMG A;  1JE4 A;  1WOC A;  5GAG C;  1GOZ A;  2HDL A;  1S5D D;  4UP9 A;  1YNJ C;  3M7N A;  2MHV A;  1SJE D;  2B2W A;  4DXG A;  1TII D;  2QIL A;  3DXJ C;  4OO1 G;  3R8B A;  3I4M B;  4DK1 A;  3RN2 A;  2KCN A;  5G3L F;  5HUR A;  3GTK H;  3SK6 A;  1AFP A;  5JJZ A;  3CCU A;  3I3C A;  2MPM A;  5ELO A;  4UY8 C;  4FNF A;  4Y7N B;  3OYY A;  3MFY A;  3U4V A;  4PNY A;  3LGJ A;  1D2B A;  3GTQ B;  2PO4 A;  1G2T A;  1RKN A;  1EZ8 A;  2RQX A;  4I7Z C;  2HQE A;  4JI8 Q;  3CC4 A;  3PO2 H;  1LTG D;  2E5L Q;  4R4C A;  3SR1 A;  4Y7N H;  4A3F B;  2RVL A;  2JA8 B;  1V9P A;  4BBR H;  3TQY A;  3A8J E;  1VQH A;  4HTH A;  1CFM A;  4X62 Q;  2F0D A;  2F0F A;  1N33 Q;  2R92 G;  5FLM H;  4X66 Q;  3BZD B;  2K1B A;  3CCS A;  1HPC A;  2A6E D;  3D3R A;  4LF5 L;  3GTM H;  2O2L D;  2WAQ G;  1F9P A;  1Q8I A;  1HNW Q;  1MD2 D;  1VQE A;  3CD6 A;  1UEB A;  4DUZ Q;  1ASZ A;  5LL6 S;  1BCP D;  2MUY A;  4F8M A;  3J7Y W;  1XMO L;  4L5T A;  1AW7 A;  4OHJ A;  3QG1 A;  4HJA A;  2YTY A;  4UPA A;  2Q8T A;  4XXE A;  1F2M A;  3HOU H;  1V1P B;  2JA6 B;  3UE0 A;  4EQ5 A;  3S1Q B;  3ER0 A;  2J7Z A;  1E2Z A;  1B9N A;  4K5V A;  3S9W A;  2K50 A;  1HXY D;  1Y1V G;  4R4O A;  4JPB W;  5CR3 A;  4TKO B;  2F0J A;  1SNP A;  3KLR A;  3C3L A;  1X3E A;  2YYZ A;  4XIG S;  4GOP A;  3ERQ A;  2HD3 A;  1E22 A;  2CWA A;  1DOK A;  1LTI D;  3PV0 A;  4BY7 G;  3KLS A;  1ET9 A;  1J9O A;  3I2Z A;  3J81 c;  2Z8L A;  5LMN Q;  3H6M A;  1X3F A;  4JC0 A;  3TZU A;  4DNI A;  3VDY A;  3MWY W;  1IKL A;  2IHF A;  5EPJ A;  1BOS A;  5J22 A;  2RF4 A;  1VS0 A;  1PTO B;  1ML0 D;  2KEN A;  3RZO B;  1U0L A;  1NTG A;  2GA4 B;  2E76 C;  2F0N A;  4DK0 A;  3UE1 A;  1C0A A;  1N36 Q;  1K8O A;  2RDF A;  2Z6B A;  1EIH A;  4NB3 A;  1BF4 A;  3Q24 A;  3BS1 A;  1VQO A;  1TS2 A;  1AP0 A;  1KAW A;  1LLR D;  4IUU A;  4BBS G;  4B3T L;  4IUN A;  5GAH C;  1II3 A;  5M3F G;  2QCP X;  3S17 B;  4ZLT F;  2EXZ A;  2UXC L;  2GN5 A;  4A3I H;  1Q86 C;  1R4P B;  1W3S A;  1SJH D;  1W6K A;  3H0G H;  1VQB A;  1QIL A;  2QEJ C;  4NDX A;  3VR4 A;  1VDZ A;  5JEA G;  1TY2 A;  4FP5 D;  3A56 A;  2UXB L;  4HJ5 A;  5JPM C;  1KRS A;  2F4V L;  2N55 A;  1ASY A;  1L0Y B;  4GLX A;  4DAP A;  1K28 A;  5DLQ E;  2UUC L;  3TEH B;  1HZA A;  3G7L A;  2FMM A;  1LO5 D;  1V1O A;  2KJX A;  3ZJY C;  5E4X A;  4YCW A;  5JOB A;  1PH3 A;  3STB C;  1LT4 D;  1B53 A;  2GVA A;  1STE A;  4LF8 Q;  1CK1 A;  4DV1 Q;  2WKD A;  3U9S A;  1R4Q B;  2KHI A;  1JR0 D;  3CRL C;  3EIV A;  1SE4 A;  4HSP A;  1L0X B;  4JI6 Q;  2VQE L;  2FJ2 A;  3CF5 A;  2DY7 A;  2Y0S B;  2F0I A;  2CW0 C;  1SBB B;  2IX1 A;  5FJ8 H;  2HHH L;  1XNQ Q;  4WJ3 M;  4X64 Q;  4JI5 Q;  2ICI A;  3I56 A;  1KRT A;  3G4S A;  1N36 L;  1YVC A;  3KBX A;  1O7Z A;  1YIJ A;  3HOY H;  3K6O A;  3KJP A;  1QNK A;  1EQV A;  4YY3 L;  1FGB D;  3CC2 A;  1I4P A;  4HMI A;  1RCV D;  5AJ3 L;  1EOV A;  2L4N A;  3HOY B;  4QUC A;  4HN7 A;  1YNN D;  2EY5 A;  1FVI A;  1G6P A;  2Z4I A;  1YEZ A;  2KEE A;  1FJG Q;  1G6Z A;  1JCK B;  3CCV A;  1L1O C;  3I7F A;  4JBW A;  3I72 A;  4GOP C;  1MJE A;  1HQM C;  1X3G A;  1AZP A;  5ELF A;  1PFN A;  5CBE E;  2K28 A;  2R92 H;  3HOV H;  4B08 A;  1OXU A;  1MJC A;  3W1B A;  4GNX B;  1OXT A;  5ELN A;  1AE2 A;  4TSS A;  1N32 L;  5BN5 A;  3NP8 A;  1PRT F;  1H9S B;  1EYG A;  1AN8 A;  2ZT9 C;  5M3F H;  4V0B A;  5FOB B;  1VQG A;  2B2U C;  1SMX A;  3Q6S A;  1FR3 A;  2FMC A;  1HNZ Q;  5M9O A;  4C1N K;  3T56 B;  4LUV A;  5C5M A;  4DR1 L;  5T1I A;  3MAQ A;  2RBM A;  2JA9 A;  4A3E B;  3BYY B;  1IKM A;  5HGQ A;  4DV3 L;  4ODG A;  3QIA A;  4R4I A;  5IOD A;  2R93 B;  4CDC C;  4FF2 A;  1RD9 D;  1U4P A;  4A3B G;  1MBY A;  5C4H A;  1XXG A;  3K0X A;  5IYD G;  5KND A;  1NMG A;  4DV0 Q;  4OWW B;  4G57 A;  3Q0A A;  3NTK A;  1MI2 A;  1SSO A;  2A68 D;  2NN6 I;  2F0K A;  2D0O A;  5I6Y A;  2KHJ A;  1VQD A;  3TSS A;  3UI2 A;  1YHQ A;  1DCZ A;  5FO7 B;  2PNH A;  4ILW A;  2KQ3 A;  4MTN A;  5FLX E;  5JJL A;  1SNO A;  2N8N A;  1E7Z A;  1UAP A;  4A3E G;  3MVV A;  2C9O A;  4IUQ A;  4TQU S;  4H7B A;  4DV4 L;  1GJX A;  1SE3 A;  3OPO A;  3CCM A;  3PUY A;  4HID A;  2D9U A;  2EYJ A;  5IP7 G;  1NSN S;  2UXD L;  2K6A A;  1RF2 D;  3KUP A;  4BY1 H;  1A15 A;  5EBC A;  3OMC A;  1IYJ B;  1A8V A;  1E3P A;  4B3S Q;  1EZ6 A;  4A3F G;  2ZJP A;  1KXL A;  1PTO D;  2AQ3 B;  1EWC A;  1ONL A;  2B2T A;  4P74 A;  4L63 B;  1PH1 A;  4FF4 A;  4JBK A;  3JAM c;  5JJK A;  3TP5 A;  3HOW B;  4PMW A;  3QR8 A;  2B63 B;  2JEA I;  1I94 L;  1VQL A;  4FF3 A;  1V43 A;  2PZU A;  1U4R A;  1EYA A;  2L0C A;  2O5J C;  3VR5 A;  3GDE A;  1ICF B;  4KHZ A;  1TWH H;  3PUZ A;  4FXD A;  1G91 A;  4DKA C;  4A93 B;  4AQY Q;  2OCE A;  3HG9 A;  4CGY B;  1CHQ D;  3K7A B;  3GTJ H;  1RTO A;  1U5K A;  4A3F H;  4O1N A;  3D4D A;  3D8G A;  1LT5 D;  2PW5 A;  4A3C G;  4PZ7 A;  2EJF C;  1OXV A;  3AYH B;  3MEH A;  3MXP A;  4FDB A;  5M5X B;  3FPP A;  1FNV A;  4OXP A;  5IYC G;  1WYD A;  5KEE A;  4TVA B;  1K0R A;  1PYW D;  1SYD A;  4H44 C;  1D7Q A;  3LWE A;  3WWV A;  4YHH L;  3PUV A;  3L2P A;  4E6I A;  3CPW A;  4KLK A;  4XYQ A;  1B3A A;  4CHT B;  1EQQ A;  1H95 A;  1QJO A;  1K83 H;  1QUQ A;  3FKI B;  1D5X C;  3K0Y A;  1BUV T;  3RUZ A;  3F2B A;  5IWA L;  1MIU A;  2NVX H;  2JA5 H;  4ALP A;  1BR9 A;  3CQZ H;  4DV7 Q;  1XMQ Q;  1KAB A;  1EU4 A;  1JOQ A;  1TS5 A;  3ULJ A;  1EFI D;  4XDX A;  4G7H C;  2B63 H;  5CBA E;  1WTO A;  5EJW A;  3PSI A;  1F2Z A;  1A0I A;  1HH2 P;  2ENB A;  1JB7 A;  4IQZ A;  2QF7 A;  1D8L A;  5ISR A;  2D0P A;  2D62 A;  2R7Z B;  1YHA A;  1MHW C;  3RZD B;  1SFO H;  4K5W A;  4NXN Q;  2Y0S E;  2K32 A;  3ND8 A;  2K33 A;  4B3M L;  1QNU A;  3OIP A;  5G3L D;  1SNC A;  4N8X 1;  4RA8 A;  3A5Z B;  1JIC A;  3U9O A;  3EJI A;  2R61 A;  4GN4 B;  4KY7 A;  3K8A A;  4KJN A;  1F2Y A;  2VUM B;  1EY6 A;  4GN5 A;  2YTX A;  5D3I B;  3GTP H;  4HED A;  4XTC S;  1Q1B A;  3E5S A;  3S24 A;  2PPB C;  4JI6 L;  4K2K A;  1YZ6 A;  4U68 A;  3HOU G;  5IP9 H;  1HNX Q;  2JA6 G;  3PUX A;  2ASB A;  3M3Y B;  1BCP B;  2K75 A;  3ND9 A;  4R8N A;  2VB2 X;  4IPC A;  3W5O A;  4DV4 Q;  4G7O C;  1WD0 A;  1AH9 A;  1Y8P B;  1VQN A;  1B8A A;  3O13 A;  1VCI A;  1AEX A;  4Q5V A;  2G9H D;  2TSS A;  3WOE A;  1XMO Q;  5CV8 A;  2UU9 L;  3I90 A;  4C1N I;  4A3L G;  3BDL A;  3F1Z A;  3VR2 A;  1DOM A;  1ILP A;  2VL6 A;  3DUZ A;  3BJU A;  4KJO A;  1LT6 D;  1SYC A;  2WFW A;  1TVX A;  4R9W A;  5HGT A;  3S1M H;  3S14 B;  1D5M C;  4L8J A;  5ELC A;  3CRK C;  3J7Z C;  4KD3 A;  3BDO A;  2ZJQ A;  4LMQ D;  3HOU B;  2NVQ B;  1LAC A;  1W6J A;  3SK5 A;  1C7Y A;  1YJN A;  1TWF B;  4X65 Q;  4CDF C;  1TU2 B;  1LAB A;  3OHX C;  1BNZ A;  4RHR A;  3CU7 A;  1JE5 A;  1VQ7 A;  3GO5 A;  1GD7 A;  1SMY D;  4WFN 3;  1IL8 A;  2LS0 1;  4QUF A;  1WTR A;  3S2H B;  2WAQ B;  3K80 C;  4CKE A;  1VQF A;  1LTB D;  4H0L C;  4OO1 H;  1MSG A;  3JC6 6;  1QB5 D;  5C0X G;  1EY0 A;  4DUY L;  1C48 A;  4AQY L;  1GKH A;  3CC7 A;  3HZX A;  1SE2 A;  1LTS D;  2WB1 G;  4IOC A;  5CMD A;  5LHY 1;  3H09 A;  3GTG B;  3HP3 A;  3W2D A;  4DPG A;  1L0W A;  3AFQ A;  5BR8 L;  1VQM A;  4H02 A;  1TWC H;  3I4N H;  1S4Z A;  1HNZ L;  4RFB A;  3K5N A;  1I50 H;  4OEL B;  2WIN B;  5I9P A;  4NP5 A;  3NXW A;  1J5E Q;  3UDF A;  3BZK A;  1RDP D;  5DEH A;  1VMC A;  2AQ1 B;  4H13 C;  5COY A;  4IFD H;  2PQE A;  5C0X I;  3K5M A;  1BVS A;  2MQH A;  5M5W H;  1ZEQ X;  2K5V A;  5C6A A;  2K04 A;  4HR7 B;  4DV7 L;  1B1Z A;  3I4M H;  3E0J A;  3IFD A;  1HNW L;  3BU2 A;  4IUR A;  4YWL A;  4KHP L;  1NBW A;  2CHB D;  2H1E A;  3GV3 A;  3D31 A;  3J7A F;  4A3B B;  3EA6 A;  1I6H H;  4DF7 A;  3HOW H;  1D1K A;  2F0O A;  2UUB L;  3QO2 A;  4CDE C;  4OX9 Q;  1CSP A;  2TMP A;  1KC8 C;  1WD1 A;  3DEO A;  3R3O A;  1A6X A;  1VQI A;  2A69 D;  2B29 A;  2JYO A;  1LTL A;  3S15 H;  4A3M B;  2HCC A;  4YIJ A;  3DM3 A;  1JOO A;  4ME3 A;  1BBX C;  3TS0 A;  1X55 A;  2ZJR A;  1PV4 A;  1K83 B;  4C3I G;  1G8Z D;  3K5O A;  3TRE A;  3ULL A;  1WTW A;  1CKN A;  1EY5 A;  4HMJ A;  1Y69 U;  1V8Q A;  1NR2 A;  2Z6K A;  1TS3 A;  4X65 L;  1BQQ T;  2E2J B;  1P16 A;  1E24 A;  3WDN A;  3PIO 3;  4L5R C;  4K0K Q;  1TWC B;  2ICE C;  3QJY A;  3M9B A;  1IW7 D;  2L11 A;  2DJG C;  4C3I H;  2YTV A;  2AHO B;  1M1K C;  2PYK A;  2UUA L;  3HOW G;  2QDL A;  2XTI A;  4CJ0 B;  2F0L A;  2VW9 A;  2ALY B;  4MTK A;  4A3D G;  5IP9 G;  5JAV A;  3K7U C;  5C4X B;  2X69 A;  1ZKO A;  5D3D A;  3S2H H;  2ZXO A;  2WP8 J;  4JK1 C;  2JP1 A;  4LFB L;  2DNC A;  1XPU A;  1Y8O B;  3OOC A;  4ID6 A;  1O7Y A;  4JV5 Q;  2B2Y A;  4LF4 L;  5EKI A;  1K8A C;  4IFD G;  5KYL A;  4C56 C;  1A3V A;  1BDO A;  1QOH A;  4X64 L;  2FIN B;  1IHZ A;  1Q90 A;  4DAV A;  4ZK9 B;  5M5Y H;  3S1R H;  5F2D A;  3U58 A;  2N88 A;  3CMA A;  3H91 A;  4QF4 A;  4O2D A;  4LWC A;  2X6G A;  3EBE A;  2NUC A;  5FO9 B;  3IAY A;  1A62 A;  1GVP A;  5ELD A;  2H5X A;  4OGQ C;  5JPN C;  5M3M B;  4WRD A;  4I7A A;  3CCJ A;  5C3E B;  3F2D A;  3AU7 A;  4WOR A;  2R92 B;  2A8V A;  5IGG A;  3N52 A;  2F0H A;  2EJG C;  4QL5 A;  2HHH Q;  5E3F A;  4DR2 Q;  1NY4 A;  2L55 A;  3IRB A;  2KA7 A;  3MZ5 A;  2DNE A;  3HOX G;  4NXM L;  4GLA C;  4LFA L;  2VQF Q;  3QOL A;  3UDI A;  1BCP F;  2OT2 A;  4KD4 A;  4KKT A;  4JBM A;  1PH2 A;  1B50 A;  1ET6 A;  5LMN W;  4RGT A;  3HFZ B;  4X62 L;  3HKZ G;  1J5E L;  1E2V A;  4B3R Q;  3NPP A;  3NWS A;  5EGT A;  3I55 A;  3GQB A;  4RG1 A;  1DM0 B;  5BN3 A;  4DV2 Q;  1X9N A;  4DXF A;  3MFG A;  4QQB X;  4UHV A;  4J1M A;  2XWB B;  1SAP A;  2OWO A;  3NTH A;  3PO2 G;  5IWA Q;  3L0O A;  3T1Y L;  3QWN A;  4F7X A;  5KNB A;  4J15 A;  3HOV G;  2EYP A;  5AFW A;  2F0Q A;  1F9Q A;  4AH6 A;  3J80 c;  1L1O B;  2XN9 C;  3S1N B;  2JA8 G;  5A35 A;  2YU9 B;  3T13 A;  4ZRZ A;  2E2I B;  3PMF A;  2RSO A;  2O4X A;  3HS0 C;  1C8C A;  4L5Q A;  1CZW A;  2PZT A;  3JAM L;  4DV6 L;  1VQ4 A;  4ZKB B;  4A93 G;  3T51 B;  1PH5 A;  4CBV A;  4UP8 A;  4NMZ A;  1EWH A;  2P5Z X;  4FVM A;  1HQR D;  4XQJ A;  5M5W B;  2NVT B;  2GVB A;  4P2C B;  2R3Z A;  2M00 A;  3HKZ B;  3HOV B;  5IOC A;  4BBS B;  3I91 A; 
#chains in the Genus database with same CATH homology
 4IFD J;  4DAY B;  3RLN A;  4P74 A;  1PH1 A;  3NBH B;  4JBK A;  3PUW A;  1AE3 A;  1XTD A;  3T1H L;  1IZ6 A;  3JAM c;  5EAY A;  2R7Z G;  4JI7 Q;  5JJK A;  1VQA A;  4LF9 Q;  3AQQ A;  1JJ2 A;  1LYL A;  1IXR A;  3S17 H;  5FJ8 G;  4IJH A;  4A76 A;  4PMW A;  3RNU A;  4MZ9 A;  2JEA I;  2I0Q A;  1I94 L;  3GTG H;  4IO9 A;  1VQL A;  2VUM H;  1YHB A;  4KHP Q;  2LSS A;  2IT1 A;  3AEV A;  1V43 A;  1XMQ L;  3A0J A;  4QGU A;  1X65 A;  1Q12 A;  2R7F A;  4LW1 A;  2MNA A;  3ICE A;  4DR4 Q;  4C3H H;  3GDE A;  1TWF H;  2UU9 Q;  4KHZ A;  2KCM A;  3M4Q A;  2LXK A;  1TWH H;  2MO0 A;  3PUZ A;  1K9M C;  4JI3 Q;  4DKA C;  3CCE A;  2JA5 G;  4LF5 Q;  5JJI A;  4Y52 H;  4AQY Q;  1IBL L;  5C4J H;  2OCE A;  4HJ9 A;  3B6Y A;  3GTJ H;  1U5K A;  4JI4 Q;  1N34 L;  4A3F H;  1S72 A;  1VQ9 A;  2F3I A;  3KYH C;  2I5L X;  1GM5 A;  2VY3 A;  1VQ6 A;  1KXL A;  4A3C G;  2BH8 A;  1SRO A;  4PZ7 A;  3G71 A;  1TXY A;  3U4Z A;  1R9T H;  1OXV A;  2CCZ A;  2RHQ B;  3AYH B;  2ZM6 Q;  1A63 A;  4LFB Q;  4FDB A;  1Q8K A;  2HIV A;  2PQA B;  3PF5 A;  1PH8 A;  4P73 A;  4OXP A;  5IYC G;  1WYD A;  4JI1 Q;  4TVA B;  5IP7 H;  1K0R A;  4POG A;  3PIP A;  3GTO H;  4A3G G;  1D7Q A;  3KF6 B;  4JI5 L;  3I4O A;  3HOZ H;  3WWV A;  3GD7 A;  4YHH L;  3RLF A;  2JK8 A;  4BY1 G;  3RR5 A;  3PUV A;  1EQR A;  4DUY Q;  1I3Q H;  4PZ8 A;  3L2P A;  1SLJ A;  2A1A A;  4YCV A;  3KF8 B;  4IPD A;  4JI1 L;  3CPW A;  2PI2 A;  1HZ9 A;  2UUC Q;  4A3K H;  2JQO A;  4KLK A;  1EQQ A;  1H95 A;  1K83 H;  1QUQ A;  3J81 j;  2EIF A;  1VQK A;  1HR0 L;  4BA1 I;  1JJG A;  3F2B A;  2CFM A;  4RMF A;  5IWA L;  2Q2U A;  3KLW A;  5JEA J;  1OXX K;  1MIU A;  1EWI A;  4B3T Q;  2NVX H;  1K73 C;  2JA5 H;  4QY7 A;  1B7Y B;  4ALP A;  2JEB I;  1M90 C;  3TS2 A;  2WB1 E;  3FHW A;  3CQZ H;  3CXC A;  1WJJ A;  4DV7 Q;  1XMQ Q;  1UE5 A;  2B63 G;  4K0K L;  1JT8 A;  3ULJ A;  3E9H A;  1RIP A;  2AWO A;  2B63 H;  4KI0 A;  2ATW A;  1J6Q A;  4QIW E;  3Q8D A;  3G6E A;  3PSI A;  4JCV E;  1A0I A;  1HH2 P;  1JB7 A;  4YCU A;  1JJC B;  2VUM G;  1D8L A;  1L2F A;  2QEX A;  3CCR A;  3F2C A;  5E7N A;  2D0P A;  2D62 A;  1RL2 A;  4OO1 I;  1VQC A;  1YHA A;  4BBS H;  4X66 L;  1XNQ L;  1BBU A;  1SFO H;  1VQ8 A;  2OTL A;  4NXN Q;  2JE6 I;  4EX5 A;  3EN2 A;  2Y0S E;  2Q2T A;  4B3M L;  4HIM A;  1Q46 A;  1HNX L;  2BH2 A;  4DR6 L;  3OW2 A;  1Q81 C;  1MKH A;  1Y1W H;  1KHI A;  3PGZ A;  3A5Z B;  5IYC H;  1Y1V H;  1IBK Q;  1WCM G;  3S2D H;  2XGT A;  4GN4 B;  4DAM A;  1KD1 C;  3K8A A;  2E2J H;  1B70 B;  1LUZ A;  4QJF A;  4GKK Q;  4IOA A;  4JI8 L;  4GN5 A;  1VQJ A;  5IYB G;  2YTX A;  1XPO A;  1EIF A;  1SR3 A;  1Q1E A;  1WOC A;  3GTP H;  5GAG C;  4XTC S;  4WJ4 A;  2NVQ H;  1Q1B A;  4UP9 A;  3M7N A;  1QZH A;  4A3J H;  3D0F A;  3S24 A;  2EQS A;  4JI6 L;  1YZ6 A;  4OO1 G;  3CW2 C;  2R93 H;  3HOU G;  1YJ9 A;  2R93 G;  4JV5 L;  5IP9 H;  3RN2 A;  1HNX Q;  2JA6 G;  3PUX A;  4IJL A;  2ASB A;  4B3M Q;  3GTK H;  3KFU A;  2QA4 A;  3CCU A;  1E1O A;  2K75 A;  3KOJ A;  4DR5 Q;  4IPC A;  5ELO A;  4UY8 C;  3W5O A;  4DV4 Q;  1PVO A;  2FXQ A;  2JA6 H;  2DUD A;  1AH9 A;  5IE8 A;  4JG2 A;  3OYY A;  3CP0 A;  2OQ0 A;  3U4V A;  2AMC B;  3LGJ A;  1VQN A;  4LF7 L;  1YI2 A;  1B8A A;  2C35 B;  3KDF B;  1VCI A;  2VNU D;  4L5S A;  2YU9 H;  4JI8 Q;  3U50 C;  3CC4 A;  1NE3 A;  3PO2 H;  4GKK L;  1XMO Q;  2E5L Q;  2QGQ A;  4R4C A;  5GQO A;  5C4X G;  2UU9 L;  3HOX H;  4Y7N H;  1XNR Q;  4DV6 Q;  1UWV A;  5IYB H;  3F8T A;  1IBM L;  4JYA Q;  1V9P A;  4A3L G;  4BBR H;  2E8G A;  3F1Z A;  3TQY A;  3RN5 A;  1G51 A;  1VQH A;  2CKZ B;  3GTL H;  4BA2 I;  4A93 H;  4X62 Q;  2VL6 A;  1KIX A;  1S3O A;  1SRU A;  1N33 Q;  4DV3 Q;  1XNR L;  3BJU A;  2R92 G;  5FLM H;  4X66 Q;  3CCS A;  3GTM H;  1BBW A;  2WFW A;  4LF5 L;  2WAQ G;  3S1M H;  3PO3 G;  4BY7 H;  1N33 L;  3J7Z C;  2VQF L;  1K8G A;  1HNW Q;  1VQE A;  4HIK A;  2ZJQ A;  4NXM Q;  3CD6 A;  1GO3 E;  1UEB A;  2HQL A;  4DUZ Q;  4HIO A;  4X65 Q;  1YJN A;  1C7Y A;  1ASZ A;  1VQ5 A;  2IY5 B;  2I5H A;  1Z9F A;  1CKO A;  5LMN L;  2KCT A;  1QZG A;  5BR8 Q;  1XMO L;  2V1C C;  4L5T A;  1JE5 A;  1VQ7 A;  2E5L L;  4P71 A;  3GO5 A;  2PI2 E;  2PMZ E;  1GD7 A;  4JI7 L;  4HJA A;  2F4V Q;  2YTY A;  4UPA A;  3J81 i;  3OTO Q;  4A3K G;  3K80 C;  1JMC A;  3L7Z C;  3HOU H;  1OTC A;  3UDX A;  3UE0 A;  4EQ5 A;  4DR5 L;  1VQP A;  1VQF A;  3KDF A;  3ER0 A;  3JC6 6;  5C0X G;  2NVY H;  5M3M G;  4DUY L;  1HZC A;  3FKI G;  4AQY L;  1GKH A;  3J7A 5;  2K50 A;  3CC7 A;  1Y1V G;  4R4O A;  1PYB A;  2WB1 G;  1FJG L;  4DR7 Q;  5C44 G;  2ES2 A;  1N32 Q;  2N49 A;  4IOC A;  1IBK L;  2R7Z H;  1X3E A;  2YYZ A;  4XIG S;  4GOP A;  1E22 A;  2CWA A;  5LMU Q;  3PV0 A;  4BY7 G;  3J80 i;  3S1N H;  3E9I A;  4DPG A;  3TRZ A;  2NZH A;  1L0W A;  3AFQ A;  3I2Z A;  4YWM A;  5BR8 L;  3J81 c;  1QVC A;  4A3M G;  1YBY A;  1VQM A;  4H02 A;  5LMN Q;  1TWC H;  1X3F A;  5AJ3 Q;  2OQK A;  1HNZ L;  4LF7 Q;  3I4N H;  4JC0 A;  1CUK A;  2F52 A;  1I50 H;  4LF6 Q;  4DV1 L;  4DNI A;  1SN8 A;  3VDY A;  2E2I H;  2IHF A;  1X54 A;  3S14 H;  4A3L H;  5GAE C;  1J5E Q;  4OWX B;  2RF4 A;  1TWG H;  3BZK A;  3UDF A;  1VS0 A;  4A75 A;  2KEN A;  5GRO A;  1U0L A;  1NTG A;  4A3G H;  4LNQ A;  3M85 A;  2IHE A;  3UE1 A;  4A4I A;  4A3D H;  1C0A A;  2HIX A;  1N36 Q;  5C0X I;  1BVS A;  2ZTC A;  4DV5 L;  3FKI H;  2MQH A;  2Q2I A;  5M5W H;  3HKZ E;  3MXN B;  4DV2 L;  2UXB Q;  2JA8 H;  4LUO A;  2K5V A;  4NB3 A;  1VQO A;  1KAW A;  4DV7 L;  1SE8 A;  3I4M H;  4BBS G;  4JI0 Q;  1HNW L;  3BU2 A;  4B3T L;  1Z47 A;  4YWL A;  4UP7 A;  4KHP L;  4PZ6 A;  2K5N A;  5GAH C;  4P75 A;  4DR2 L;  3CME A;  1NBW A;  3H0G G;  4POF A;  5M3F G;  3D31 A;  4YWK A;  1QVG A;  1I94 Q;  4AYB G;  1I6H H;  1PFS A;  3HOW H;  3A74 A;  4R4Q A;  2UUB L;  2UXC L;  2GN5 A;  4A3I H;  1Q86 C;  4OX9 Q;  1CSP A;  1KC8 C;  1W3S A;  3T1H Q;  3H0G H;  4LUZ A;  1VQB A;  4GS3 A;  1VQI A;  2B29 A;  4DR3 Q;  1LTL A;  3GTQ H;  3S15 H;  4C2M H;  5JEA G;  3MEF A;  1I5F A;  2R7D A;  3PIO A;  3A5U A;  3UDG A;  3DM3 A;  1KQS A;  3H3V I;  4ME3 A;  3I4M G;  4HJ5 A;  2UXB L;  1KRS A;  3TS0 A;  2YV5 A;  1X55 A;  1WFQ A;  3AFP A;  2F4V L;  2NZO A;  1KL9 A;  2ZJR A;  1PV4 A;  1ASY A;  2JA7 H;  3H15 A;  4GLX A;  1UE6 A;  3M3Y H;  5DLQ E;  2UUC L;  3TRE A;  3TEH B;  1C9O A;  1HZA A;  3ULL A;  2I5M X;  3ULP A;  3CCL A;  3ZJY C;  2R6G A;  1CKN A;  2DGY A;  5C3E G;  1W2B A;  3ERS X;  4YCW A;  1DGS A;  3SGI A;  3STB C;  1S40 A;  1PH3 A;  2Z6K A;  5M3M H;  4DR7 L;  4X65 L;  2GVA A;  4LF8 Q;  4DV1 Q;  1P16 A;  1CKM A;  1E24 A;  2MFI A;  5IT9 c;  4L5R C;  4K0K Q;  1QUQ B;  5C44 H;  2UUB Q;  2UXC Q;  5C3E H;  1UE1 A;  3M9B A;  2KHI A;  5LMU L;  3EIV A;  1HZB A;  4C3I H;  2YTV A;  3CAM A;  2AHO B;  1M1K C;  2EXD A;  2E2H H;  2A19 A;  1Q82 C;  4IFD I;  4A3I G;  4JI6 Q;  5FLX c;  2VQE L;  3CF5 A;  2UUA L;  4LF4 Q;  3HOW G;  3NEN A;  1HR0 W;  1LM0 A;  2XTI A;  3RZD H;  3HKS A;  1X56 A;  1PYS B;  4NPS A;  1PH7 A;  4A3C H;  2VW9 A;  1G29 1;  4A3E H;  4AIM A;  2IX1 A;  5FJ8 H;  1IBL Q;  4NXN L;  2HHH L;  3H3V H;  2ALY B;  1XNQ Q;  4DV5 Q;  4A3D G;  4WJ3 M;  4X64 Q;  3S1Q H;  4JI5 Q;  3I56 A;  1KRT A;  5IP9 G;  3G4S A;  1N36 L;  3K7U C;  1YVC A;  2K5H A;  2VZA A;  2K52 A;  3T1Y Q;  1XPR A;  1OXS C;  4DR1 Q;  1YIJ A;  4GOP B;  4GKJ L;  3HOY H;  1CKN B;  3KJP A;  3S2H H;  4YY3 L;  4DV0 L;  3CC2 A;  4DR6 Q;  2WP8 J;  1P8L A;  3I4N G;  5IY0 A;  4LFB L;  5K36 G;  2IX0 A;  2ZTD A;  3RLO A;  4A3M H;  1CSQ A;  1XPU A;  5AJ3 L;  4R4T A;  4APV A;  1EOV A;  4JYA L;  2OTJ A;  4LFA Q;  4HJ8 A;  1N8R C;  2N3S A;  4JV5 Q;  4JOI C;  2ZTE A;  1NMF A;  1PA6 A;  2UUA Q;  5C4X H;  1Q7Y C;  2VQE Q;  1K8A C;  1IBM Q;  4O0A A;  2VS1 A;  1FVI A;  4LF4 L;  2B3G A;  4OX9 L;  1FL0 A;  4LFC Q;  4IFD G;  1G6P A;  2KBN A;  1YEZ A;  1EUJ A;  3W1G A;  1PH4 A;  2CQO A;  1FJG Q;  1Y1W G;  1PH6 A;  4X64 L;  3CCV A;  2L15 A;  1L1O C;  1V1Q A;  3I7F A;  4JBW A;  4GOP C;  1MJE A;  1X3G A;  3CCQ A;  1PH9 A;  3PO3 H;  3JAM i;  3G48 A;  4JI0 L;  2R92 H;  3HOV H;  4OWT B;  1OXU A;  5M5Y H;  3M4P A;  3S1R H;  3U58 A;  1MJC A;  2JJQ A;  3CMA A;  1UE7 A;  1E1T A;  3W1B A;  1OXT A;  4O2D A;  3NEM A;  5ELN A;  4GNX B;  1FGU A;  4LWC A;  3PF4 A;  1AE2 A;  4IPG A;  1N32 L;  1EFW A;  2UXD Q;  1X6O A;  3EBE A;  3RZO H;  1EYG A;  1HJP A;  4JBJ A;  3S16 H;  4P72 A;  3NEL A;  3PCO B;  5M3F H;  1A62 A;  1GVP A;  4LF9 L;  2H5X A;  1YNX A;  1VQG A;  1K3R A;  4PG3 A;  3CCJ A;  4YHH Q;  3F2D A;  5J3B A;  1BKB A;  4DR3 L;  1SMX A;  2NN6 G;  3OTO L;  2A8V A;  1HNZ Q;  4B3S L;  4LUV A;  3M4O H;  4DR1 L;  2ID0 A;  2RHS B;  5FLM G;  2JA9 A;  3K7A H;  2Q2H A;  2K4K A;  4JI3 L;  4QL5 A;  3E0E A;  4MNO A;  5HGQ A;  4DR2 Q;  2HHH Q;  1NY4 A;  4DV3 L;  4R4I A;  3IRB A;  3BZC A;  1N9W A;  2NVT H;  4AYB E;  1N34 Q;  3HOX G;  4NXM L;  4GNX C;  1WI5 A;  1EIY B;  2Y0S G;  4DK3 C;  4GLA C;  4LFA L;  2VQF Q;  4A3B G;  4GNX A;  3FP9 A;  3UDI A;  2N78 A;  1HR0 Q;  3K0X A;  5IYD G;  5C0X J;  4JBM A;  2HT1 A;  1PH2 A;  2K14 A;  4BBR G;  3HOY G;  1XJV A;  2JA7 G;  1NMG A;  4JOI A;  4YY3 Q;  2RCN A;  5LMN W;  5GAD C;  1T9H A;  4DV0 Q;  4OWW B;  1TWA H;  4DK6 C;  3HFZ B;  3KJO A;  4X62 L;  3HKZ G;  5IYD H;  3CPF A;  1J5E L;  4B3R Q;  4A3B H;  2BA1 A;  2NN6 I;  1YJW A;  2D0O A;  2Z0S A;  3I55 A;  4RG1 A;  2KHJ A;  1VQD A;  2MO1 A;  4LF6 L;  4DV2 Q;  1YHQ A;  1X9N A;  4BXX H;  2AWN A;  2PNH A;  4QQB X;  4DUZ L;  1QVF A;  1Y14 B;  5H1S E;  4B3R L;  4MTN A;  1IL2 A;  4GN3 B;  2OWO A;  2ZM6 L;  5JJL A;  2LXJ A;  4HJ7 A;  1NJI C;  3PO2 G;  4GKJ Q;  5IWA Q;  3L0O A;  2N8N A;  3T1Y L;  1E7Z A;  2AKW B;  4J15 A;  4A3E G;  3HOV G;  4TQU S;  4DV4 L;  3J80 c;  4AH6 A;  2CWP A;  4JI4 L;  1L1O B;  3CCM A;  5M5X H;  3HOZ G;  3PUY A;  4HID A;  2JA8 G;  4X6A H;  3K81 C;  1WCM H;  4A3J G;  4JI2 Q;  5IP7 G;  3DLL A;  1PHJ A;  4L5Q A;  2UXD L;  3KF6 A;  4A93 G;  4DV6 L;  1VQ4 A;  1PH5 A;  1O7I A;  4LFC L;  2WAQ E;  1L1O A;  4GLV B;  4R1J A;  4UP8 A;  3STB D;  4DR4 L;  4BY1 H;  4BXX G;  4JI2 L;  1YIT A;  4C3J H;  2PQA A;  2GVB A;  1IYJ B;  2Z6K C;  1A8V A;  1E3P A;  4B3S Q;  4IPH A;  4OON A;  4A3F G;  5HY6 A;  4LF8 L;  2ZJP A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...