1I5FA

Bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
MQEGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COLD-SHOCK PROTEIN CSPB
publication title Crystal structures of mutant forms of the Bacillus caldolyticus cold shock protein differing in thermal stability.
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription
total genus 10
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i5fA00
1NBWA 4YWMA 4GLAC 3F2DA 1Q46A 2HHHQ 4BA2I 1HNZQ 2ALYB 2UXCQ 5IYDH 3M4PA 4C3IH 4A3DH 4LUOA 4QY7A 1LM0A 4P71A 5LMNW 5JJKA 2ASBA 1VQPA 4DR7L 4R4IA 2MFIA 2R7ZH 4POGA 2PNHA 5AJ3Q 3CCRA 4JI4L 3RR5A 1VQ8A 2A8VA 1BBWA 1K8GA 3HOYH 1HNXL 1DGSA 1SE8A 1NMFA 2Y0SG 2RCNA 1QUQA 1VQ4A 1Q82C 4LF7Q 2AKWB 1RL2A 3U4ZA 1R9TH 1VS0A 1N33L 3HOZG 5JJIA 4AYBE 3BZCA 4PG3A 3PO2G 2Q2HA 1C9OA 2ID0A 3PUXA 5GAGC 1SLJA 4A3BH 4YHHL 1EQRA 3JAMc 2MNAA 4DAYB 4DR4Q 3J80i 4A3JG 3ULPA 3FKIH 1BBUA 2D62A 5FLMH 2F52A 4K0KL 3L2PA 3UDFA 1E22A 1XMOL 1IL2A 3Q8DA 1Q86C 2Q2UA 3HOUH 1X3FA 1QVGA 2DGYA 2N49A 4OONA 4YCWA 4DUZQ 1VQEA 1N34Q 4DK3C 1AH9A 4A3GH 1OXXK 1TXYA 3F8TA 3PUYA 4JBWA 1WYDA 2K5HA 3OYYA 1LUZA 3HOXG 4A3MG 3K80C 4A3KH 1VQ7A 4A3EG 2Q2TA 2UU9L 4A76A 1X54A 1HNWQ 3SGIA 3J80c 1IZ6A 2PI2E 4DV0L 1VQ9A 3GTOH 3S2HH 2KHJA 3U4VA 4IFDG 3PIPA 1X3GA 1V1QA 2R7DA 5C0XJ 2UUCL 2PQAB 1VQFA 4WJ4A 2ZM6Q 2N3SA 3CC7A 1HR0L 1IYJB 5GADC 4AH6A 1XPOA 1VQOA 3H15A 4DV4Q 4PZ7A 4UP9A 1P8LA 5IT9c 3KJOA 1FGUA 2WAQE 4A3BG 3D31A 1EUJA 5LMNL 1N36L 1CKNA 2K50A 2ZTDA 1KD1C 2R93G 3S16H 3HOZH 4DV1L 3I2ZA 5BR8Q 2VQEL 4KHPQ 5LMUL 4DV2Q 3PUZA 3EBEA 1H95A 3CMEA 3CD6A 2VL6A 1S40A 2OQKA 5GAHC 1OTCA 3ICEA 4OX9L 1J5EQ 2KBNA 1ASZA 4IFDI 2LXJA 3PO3G 1G291 3ER0A 1XNRL 3UDGA 2N78A 2KCTA 1AE3A 2UXDL 2R7FA 4LFCL 3K81C 1PA6A 5E7NA 1EQQA 1X65A 3NENA 1O7IA 4FDBA 3HOXH 4A3MH 1PH3A 1VQHA 4IPGA 4A3EH 5C44G 4X66L 3KF8B 1XMQQ 4JI7Q 4EX5A 3I56A 4YWLA 4HJ9A 3S1RH 2E5LL 2A1AA 5IY0A 4WJ3M 3CW2C 4B3SQ 1GM5A 2K5VA 2YTXA 4B3TQ 2I0QA 2WB1E 4C3HH 4GN3B 4IOAA 3S24A 1CKNB 4XTCS 4DR2Q 2D0OA 4A3CG 5IYDG 3TREA 1EWIA 1J6QA 3PSIA 1L2FA 1RIPA 3CP0A 4PZ8A 4TVAB 5M5XH 2HHHL 3TS2A 2R93H 4OO1G 1HNZL 2UXCL 4DUYQ 2R7ZG 1D7QA 4DNIA 4QGUA 3M9BA 4HIOA 5GAEC 3CCLA 3HOYG 1A0IA 2CWAA 4J15A 5AJ3L 1TWGH 1NY4A 4JCVE 2QA4A 4AQYQ 3T1HQ 3PO3H 3E9IA 3OW2A 1VQ5A 1QVFA 1VQCA 4GLVB 2IX1A 3STBD 1AE2A 2VQFQ 3CF5A 2XGTA 1PH4A 1LYLA 2IX0A 4DR4L 3K7UC 3ERSX 1MKHA 5H1SE 1K0RA 3F1ZA 5C44H 4ALPA 4OO1I 1FL0A 1TWCH 3HKSA 3JC66 1T9HA 3RZDH 3KLWA 1S3OA 3A0JA 2ZJPA 4BA1I 1N34L 5HY6A 1MIUA 4JG2A 1N9WA 2ZTEA 2I5MX 4Y7NH 1M90C 1WI5A 4DV6Q 1HNWL 3E0EA 4HIMA 3W5OA 4A3CH 4L5SA 1IBKQ 4A93G 4NXNQ 2JJQA 4YCVA 3G4SA 1VQIA 3ULLA 5C0XG 4A3IG 1IBLQ 2F4VQ 4KLKA 2A19A 5ELNA 3JAMi 3BZKA 3AFQA 4KHZA 2WP8J 4DK6C 3A74A 4LUVA 1V9PA 2CCZA 3W1GA 5GROA 1PH7A 1N32Q 3TS0A 1I3QH 5JJLA 4BY7G 3L7ZC 1KRSA 2HQLA 2JA7G 3RLFA 4POFA 2IY5B 2I5LX 2YTVA 2BH2A 2HT1A 1PYSB 5BR8L 1EYGA 4KHPL 2GVBA 1MJCA 3T1YL 4DV2L 1PH5A 3FHWA 1PYBA 1K8AC 2PI2A 5FJ8G 2LXKA 5M5WH 4B3MQ 2LSSA 1FJGQ 1JJCB 4JC0A 4OXPA 2YTYA 1L0WA 5C0XI 2JEAI 3GTLH 3W1BA 1UE7A 1PH1A 1PH9A 4LF4Q 3EIVA 2BA1A 1X3EA 1JB7A 4JI3Q 4NB3A 2OTJA 3VDYA 3S1MH 2H5XA 5IYBH 2EXDA 4JBKA 2FXQA 2UUAQ 4A3LH 1XTDA 1X56A 1XNQQ 1KRTA 3MEFA 1D8LA 1YNXA 1SMXA 3PV0A 1UEBA 1L1OA 1JJ2A 1Y1WG 1XMQL 3TEHB 3KFUA 4JI7L 4A93H 1JT8A 5EAYA 4A3FG 4A3IH 4B3SL 4OWXB 2JQOA 4R4CA 2ZTCA 1W2BA 4BXXG 3AYHB 2Z6KA 3S1NH 1QUQB 3OTOQ 3CCJA 4HJ7A 4QQBX 1SR3A 4XIGS 3UDIA 4BY7H 3HOWG 1YEZA 2MO1A 2B29A 2JA5G 1NTGA 3B6YA 3CAMA 2JA7H 4UY8C 1CUKA 1Q1EA 2XTIA 3AFPA 4R4TA 4DUYL 4HJ5A 4HJ8A 4C3JH 3KDFA 4X64Q 2C35B 2AHOB 3K8AA 4DR7Q 5FJ8H 4JI1L 1YJ9A 1PH2A 3NEMA 1VQLA 4X6AH 1FVIA 3RZOH 4AQYL 1OXTA 5J3BA 4IO9A 4DV7Q 3CC4A 1VQNA 4LUZA 4GLXA 4JYAQ 1N33Q 2ZJQA 2NVTH 2HIVA 3CCEA 2L15A 1Z47A 4LFAQ 4EQ5A 2VQFL 3CC2A 3S15H 4BBSG 3G48A 5IP7G 3H3VI 4AYBG 1L1OB 3M85A 1VQ6A 4TQUS 1K83H 1UWVA 1TWFH 2D0PA 2QEXA 4NXMQ 4DR5Q 1PFSA 1Y1WH 1L1OC 4MZ9A 5IYCG 3IRBA 3HKZE 4BY1G 4A3FH 4R4QA 3AEVA 3TRZA 4DR6Q 3F2CA 5C4XH 1HZAA 4BXXH 3RN5A 2GVAA 1U0LA 3UDXA 2YYZA 3DM3A 3AQQA 4LF9Q 2EQSA 2Z6KC 4DV6L 1B8AA 1PHJA 3HOWH 3LGJA 3UE1A 1E7ZA 2K52A 4GNXA 2JA5H 2F3IA 4C2MH 2MQHA 1Q12A 3H3VH 2N8NA 1IBKL 3GTMH 2GN5A 4B3RQ 1HZBA 3KDFB 3GD7A 4NXNL 4DKAC 3I4NH 3K0XA 4RG1A 4X62Q 4JI2Q 1IBLL 2F4VL 1Q7YC 3WWVA 4LF5Q 1E3PA 4JV5Q 3E9HA 3J7A5 3F2BA 2Y0SE 2YV5A 1Q1BA 4DV3Q 1PH6A 4LF6Q 1PVOA 2JA8G 1YJWA 3M3YH 1GO3E 1SROA 1OXUA 2V1CC 1KHIA 4LF7L 1HZCA 2Z0SA 2E8GA 3A5UA 4L5QA 1XJVA 1V43A 1NE3A 1WJJA 1Y1VG 2BH8A 2IHEA 2WAQG 3BU2A 3U50C 4PZ6A 3I4MG 3GO5A 4BBSH 3RNUA 4HIKA 4HIDA 1S72A 2OCEA 5IP7H 1YHAA 3PUWA 1WOCA 4LWCA 2NZOA 4B3ML 3S17H 3NELA 1FJGL 1CSPA 4UPAA 3ULJA 1KL9A 4AIMA 5IYBG 4LF4L 4DUZL 4A3LG 2AWOA 3PCOB 5IYCH 4JI3L 2B63G 1KAWA 4BY1H 5M3FG 2UXDQ 2UUAL 4JI8Q 5IP9G 1EOVA 2VW9A 1XNQL 3EN2A 5C3EH 3KJPA 4GNXB 1K73C 2NN6I 3MXNB 3K7AH 1I94Q 4A4IA 4A75A 1LTLA 4IPHA 4Y52H 2RHSB 4LW1A 2IHFA 5DLQE 2ZM6L 2E5LQ 1P16A 1I5FA 2CFMA 4OWTB 1VQDA 4UP7A 3NBHB 1N8RC 4DV4L 1WFQA 4P73A 4DR1Q 2UXBQ 4JI6Q 5K36G 2JA8H 4R1JA 4LF8Q 4LFBQ 1W3SA 5JEAJ 2AWNA 2K14A 2WB1G 2NZHA 3ZJYC 5IWAQ 3BJUA 3CCQA 1G51A 1OXSC 3M4OH 4GKKQ 4X65Q 5GQOA 3PUVA 4R4OA 2HIXA 1X6OA 1B70B 3GTJH 4DV5Q 2OTLA 1Y1VH 2NVQH 1VQJA 3J81c 2VZAA 3GDEA 4X64L 5M3MH 3CCVA 1J5EL 2JA6H 2R92G 4JI5Q 3I4OA 3I4MH 2PQAA 2RF4A 2WFWA 1I50H 2E2IH 1UE1A 2VS1A 4DV7L 1E1OA 1CKOA 4H02A 1HZ9A 4P75A 4YCUA 1CKMA 2CQOA 2B63H 1GD7A 1NMGA 1C7YA 4JYAL 1Z9FA 4KI0A 5M3FH 2EIFA 3J81j 2UUBQ 2ES2A 5IP9H 4LFAL 4O0AA 1HJPA 1VCIA 4DR3Q 1SFOH 3RN2A 1IBMQ 1WCMG 4GKJQ 4DPGA 4YY3Q 2JK8A 2K4KA 1XPRA 3CCUA 1SN8A 4DR5L 2JE6I 4NXML 5C4XG 3HOVH 1KQSA 4JI0Q 4DR6L 4B3TL 2IT1A 1VQAA 4PMWA 3UE0A 1ASYA 2VUMH 1KC8C 5M5YH 2OWOA 4DR2L 3TQYA 4IPCA 4NPSA 1B7YB 2JA9A 3KOJA 1EIYB 4APVA 4LF9L 3GTGH 3I4NG 1Q81C 4JOIA 1C0AA 3A5ZB 3M4QA 3KYHC 4B3RL 4X62L 1GKHA 3PF5A 4JI2L 3DLLA 1YZ6A 4LF5L 4JV5L 2R92H 4JI4Q 4HJAA 4LF6L 4DV3L 3T1HL 2NVXH 1HNXQ 2ZJRA 3GTPH 3I55A 3S1QH 3KF6A 1KIXA 1GVPA 3S2DH 4GOPA 2ATWA 3L0OA 2KENA 4GS3A 3M7NA 4IPDA 4YHHQ 1K3RA 3T1YQ 1EFWA 1I6HH 4P72A 4BBRG 4JBMA 3PO2H 2KHIA 1WCMH 4K0KQ 3G6EA 2I5HA 4A3JH 1XMOQ 3U58A 3CPWA 2DUDA 3I7FA 1QVCA 4ME3A 5FLXc 2CKZB 1YJNA 1VQGA 1BKBA 1JJGA 2E2HH 5C3EG 3D0FA 2B3GA 2Q2IA 2UU9Q 4JI8L 3GTKH 4GN5A 1M1KC 1HH2P 2R6GA 3J7ZC 4DV0Q 3S14H 1VQBA 1G6PA 1PH8A 5C4JH 1TWAH 4IFDJ 4MNOA 5IE8A 1I94L 2RHQB 2BA0A 1SRUA 2UUCQ 4JOIC 4LNQA 1U5KA 1MJEA 1YHBA 1HR0Q 3HFZB 1YI2A 3H0GG 1QZHA 2NVYH 1EIFA 1X55A 4IOCA 1YITA 2E2JH 2PMZE 1YHQA 4DR1L 2UXBL 3RLNA 4IJHA 4JI6L 5JEAG 4LF8L 3KF6B 4LFBL 1CSQA 3CCMA 1YVCA 2NN6G 3CPFA 5LMNQ 5HGQA 3G71A 4GOPB 1N36Q 4DV1Q 5IWAL 1NJIC 2VQEQ 2MO0A 4A3DG 4GKKL 5LMUQ 4P74A 4X65L 1TWHH 5M3MG 4GN4B 4DV5L 2JA6G 1UE5A 4GOPC 1VQMA 2K5NA 1UE6A 2VY3A 4L5TA 2AMCB 3CQZH 4BBRH 2JEBI 4OX9Q 4QL5A 1A8VA 4JI5L 1QZGA 1K9MC 4JI1Q 3STBC 3CXCA 1N32L 1KXLA 1Q8KA 2OQ0A 3CCSA 1XNRQ 4MTNA 1PV4A 1A63A 2CWPA 3GTQH 2K75A 2KCMA 3PGZA 4IJLA 1JMCA 3FP9A 4O2DA 1YIJA 4LFCQ 1E1TA 1VQKA 1A62A 2VNUD 4JBJA 2UUBL 4QJFA 1YBYA 2QGQA 3CMAA 3FKIG 5FLMG 4X66Q 4GNXC 1OXVA 4DR3L 1IBML 3HOVG 1JE5A 4GKJL 1IXRA 4YY3L 3J81i 4UP8A 3HOUG 1X9NA 2VUMG 4DAMA 1Y14B 3RLOA 4JI0L 4A3GG 4L5RC 3H0GH 3OTOL 3PF4A 3PIOA 4RMFA 4QIWE 2YU9H 1E24A 4A3KG 1XPUA 3HKZG 1HR0W 5ELOA 1BVSA 4YWKA 4OWWB
chains in the Genus database with same CATH superfamily
1JCKB 1W6KA 4FXGC 1HNZQ 4C3IH 5DM63 4LUOA 2DNCA 2E2JB 5LMNW 2SNSA 2MFIA 5AJ3Q 1BBWA 1H9SB 1C4QA 3PIP3 5DM73 1VQ4A 1RL2A 2NYZD 4OL7A 3T4AC 4AYBE 1LV9A 4CJ1B 5KRUA 4PG3A 4RWSC 1SLJA 1EQRA 2VB2X 1HTPA 5E1FA 2D62A 5FLMH 3L2PA 2HCIA 3Q8DA 5CC4A 3DM1A 1F9SA 2DGYA 2N49A 1FNUA 1TXYA 4LK1C 3DEOA 3OYYA 2UU9L 4A3MG 4A3KH 1WTOA 1X54A 2ZXOA 3SGIA 3J80c 1IZ6A 4G7ZC 1YNJC 2PI2E 4DV0L 1QCBD 2F0SA 4CKEA 3U4VA 1VQ9A 4IFDG 3TP5A 2KEDA 4WJ4A 1OO9B 2N3SA 3CC7A 4Y7NB 4TSSA 1VQOA 1FR3A 3GQBA 2FFKB 4UP9A 3VYTA 1PXUA 4G57A 4RH6A 1FGUA 2NWGA 4A3BG 1EUJA 1N36L 2ZTDA 3HOZH 1LTBD 1F9QA 5BR8Q 5LMUL 3CMEA 1E0BA 2PZTA 4M1UB 5GAHC 3ICEA 4QMGA 1J5EQ 4OX9L 3PO3G 1IKLA 2HDMA 1PRTD 3I3CA 1O7IA 4FDBA 4IPGA 3HOUB 2KQ3A 1EYAA 2L9HA 3KF8B 4RFBA 1XMQQ 4EX5A 3S1RH 4A3GB 4WJ3M 1UAPA 1L0XB 2WB1E 4C3HH 4GN3B 4DR2Q 1CKNB 5J1ZA 1IYUA 4A3CG 4RGTA 2KCNA 1SXTA 3BDLA 3PSIA 5M5XH 2R93H 1NAPA 1HNZL 3SHLA 2H1EA 3LWUA 1HTLD 5AJ3L 1TWGH 4GLVB 2J7ZA 1LYLA 3Q0AA 3K7UC 3HZXA 1MKHA 3CKIB 5H1SE 4ALPA 1FL0A 3DWAA 1STBA 4H13C 4UHVA 5D65A 2NVTB 1MIUA 1DOMA 3S15B 1TVXA 2HQEA 1M90C 3NP8A 4HIMA 4DXFA 1WTHA 1Y1WB 1AZQA 1IBKQ 4A93G 4FF2A 3NXWA 2A19A 5ELNA 4KHZA 3AFQA 3KLRA 4X3KA 4LUVA 1FYCA 5T1GA 3W1GA 5GROA 1I4QA 1I3QH 4A3BB 3HOWB 1KRSA 1B4OA 5FOBB 3GTMB 4N9PA 3RLFA 5EQ0A 1CQFA 2I5LX 5DNFA 5BR8L 4C3JG 3CRKC 1K8AC 1KLGD 1JE4A 3PO3B 5C0XI 2YTYA 2PW5A 3EIVA 2F0GA 4DNTB 4JI3Q 4K8JA 5BN3A 2H5XA 1NNXA 3TZUA 2FXQA 5L37A 1X56A 1XNQQ 2F0WA 2ZXPA 1TQOA 1YNXA 3PV0A 1JICA 4I7ZC 4IUVA 1WTQA 1XMQL 4A3FG 4DF7A 1B3AA 3AYHB 1SJED 3S1NH 1VDZA 3FMCA 4JVZA 4WORA 1TR5A 2K32A 4BY7H 2JA5G 4NDXA 3B6YA 2L55A 2LKVA 3CAMA 1LT6D 1CUKA 3MWYW 5KYIA 3H6MA 1IW7C 4RKBA 1EY7A 1UEAB 3TP6A 5IT9E 5EGTA 3BVGA 4X6AH 5C6AA 1VQLA 1SNMA 3RZOH 4MN3A 4NKLA 1VQNA 3M4OB 3NSWA 1E2WA 1PFNA 4LUZA 1N33Q 1ET6A 3BVMA 2ZJQA 3CCEA 1KLUD 1Z47A 4LFAQ 2D2CC 3G48A 4K6LA 3GTLB 1PFMA 2D0PA 2QEXA 2JYOA 1L1OC 2A74C 3UDXA 1PRTF 2B8GA 4A93B 2K52A 3EJIA 2F3IA 4C2MH 2N8NA 1STEA 1IBKL 4B3RQ 2NTTA 2G5DA 3I4NH 4IUNA 3F2BA 3GV3A 1PVOA 4DV3Q 1GO3E 2RKSA 2WB1B 1KHIA 2Z1CA 1HZCA 2Z0SA 3A5UA 4C3JB 2WKCA 1NE3A 1WJJA 1Y1VG 5CV5A 1LT5D 3RNUA 4HIKA 4HIDA 1S72A 5IP7H 1XTCD 1WOCA 4LWCA 2NZOA 2F4IA 1F2MA 3H94A 4QCLA 4DUZL 1SMYC 4JI3L 1Z7TA 2BDOA 4BY1H 5M3FG 4RA8A 2UXDQ 1AN8A 4JI8Q 1TWFB 1XNQL 2R61A 3EN2A 3J7YW 3KJPA 3MFYA 3MA2B 2A69D 4A3FB 3K7AH 4RGMA 1I94Q 1EFID 5T1IA 4DAYA 1YNNC 1LABA 1LTLA 3WOFA 5DLQE 1AZPA 2E5LQ 1SNDA 4Y52H 1P16A 4OIKA 4UP7A 3NBHB 4DV4L 3VR6A 4P73A 3K6OA 4LF8Q 5JOBA 1W3SA 2IX3A 5IWAQ 3V05A 3BJUA 3RMHA 4PMCA 1OXSC 5FO8B 4GKKQ 1GUWA 3PUVA 4R4OA 2HIXA 1X6OA 4DV5Q 4HSPA 2NVQH 2FHTA 4V190 2VZAA 3GDEA 5M3MH 1GUTA 4RKLA 4Q0FA 4X3TA 2PYKA 4KK7A 3OIQA 1WD1A 1UE1A 3E5SA 1CKOA 3V96A 1XX8A 1HZ9A 4P75A 4K5WA 1BQQT 1CKMA 2CQOA 5IODA 5LL6X 2F3WA 1GD7A 1C7YA 4KI0A 2SNMA 4YIJA 4LFAL 3R3OA 2X69A 3IKJA 4DR3Q 3BVZA 1H9RA 3BG3A 4IUPA 4DPGA 1K8OA 3QB3A 1SN8A 3OSOA 3HOVH 1KQSA 3MC0B 3SK5A 4B3TL 2IT1A 2RA4A 4PMWA 5A2QE 2VUMH 4X3SA 2OWOA 2F0OA 4IPCA 3H91A 2JP1A 2WACA 3I4NG 1Q81C 2AQ1B 4B3RL 2EZVA 1CM9A 1EY5A 2CH4W 3DLLA 2EJFC 4LAAA 4JI4Q 4HJAA 4DV3L 5A35A 4GZYC 3URYA 1MGSA 1Y1VB 1KIXA 1SNQA 3S2DH 1CZGA 3M7NA 3OOCA 1F9RA 1K3RA 4P72A 3PO2H 3CRLC 1DM0B 3FPPA 1JQYD 2KHIA 1XMOQ 2QDBA 3CPWA 4ME3A 2CKZB 2XWBB 1YJNA 2E2HH 1I6VC 4F87A 5I4DA 2Q2IA 1SFOB 4JI8L 3GTKH 2RSNA 5CV4A 2R6GA 1EL0A 5C4JH 1TWAH 2KJXA 5IE8A 1I94L 2UUCQ 2BA0A 4JOIC 5M5YB 2A6HD 2BE5C 1YHBA 3HFZB 2J4XA 3K5NA 3QWNA 1QZHA 2NVYH 1EIFA 3GTGB 2B2YC 1X55A 3M4YA 2E2JH 2PMZE 3NBIA 1YHQA 2B2VC 4IJHA 4Q5VA 1O78A 4LF8L 3KF6B 2CW0C 3CCMA 2NN6G 5HGQA 4XXEA 4DV1Q 5IWAL 1NJIC 1EIGA 5ELCA 2VQEQ 4GKKL 4IUUA 1JC7A 1MSHA 1H9JA 1KABA 5M3MG 4DV5L 4GOPC 2NVXB 1UE6A 4L5TA 2Q8IB 3CQZH 2JEBI 1K9MC 1QZGA 4JI1Q 3STBC 1O7ZA 3CXCA 3S1QB 4MTNA 2CH4A 1PV4A 1A63A 2CWPA 1TS3A 2KCMA 1I6HB 1H9SA 4IJLA 1CFMA 1CT1D 4JBJA 1CA6A 4A3JB 4JW0A 4QJFA 1YBYA 3JAML 3FKIG 3CMAA 4DR3L 1ENFA 1OXVA 3AU7A 4CGYB 3HOVG 1CHQD 3ITPA 4TRDA 2J0TD 2VUMG 1SAPA 4DAMA 4HN7A 3G7LA 3VR3A 4L5RC 3LX0A 4IN3A 2O5IC 3HOXB 4QIWE 5IGFA 5JVG3 1EIYB 5JEAH 3SDZA 5LL6S 3MTSA 2HHHQ 2D5DA 3M4PA 4A3DH 1R4QB 2FJ2A 4IQZA 1WD0A 2CQAA 4QY7A 1LM0A 4P71A 5JJKA 1VQPA 2LS01 2PNHA 3CCRA 4JI4L 2A8VA 1K8GA 1SE8A 5IT9L 1NMFA 1WTRA 2Y0SG 4LF7Q 1Q82C 5JJIA 2AKWB 2CVRA 3LWEA 1B44D 4ZLTF 1R9TH 1D2BA 3PO2G 1MHWC 3DXJC 4DR4Q 4DAYB 4ZUIA 4KTAA 2EYPA 3J80i 4F88A 1S4ZA 1BBUA 1E22A 1XMOL 1IL2A 3HOUH 3K5OA 4YCWA 3I90A 1AH9A 4ABNA 4A3GH 1OXXK 1VF5C 3IL8A 1F2YA 1VQ7A 2Q2TA 2DY8A 1QE6A 1X3QA 5EBCA 1F2ZA 5C3WA 1X3GA 2UUCL 3KF8A 1RD9D 2ZM6Q 3K5LA 1EEFD 3H15A 2PZUA 5ELBA 4C1NI 5JJZA 1P8LA 4KKSA 3KJOA 3A8KE 1CKNA 4DV1L 3ND8A 4IUTA 1SYGA 2VQEL 4KHPQ 1H95A 3OW7A 2B8FA 2L5TA 2VL6A 1S40A 1JB3A 1ASZA 4CKBA 1SSOA 1IL8A 1G291 1PZJD 3P1HA 5E4XA 3UDGA 4N9TA 1SJHD 2K6AA 2N78A 4KN7C 1S5DD 3FKIB 5E7NA 1EQQA 5KGUA 2EYMA 5M5WB 1PH3A 4A3MH 3OWEB 5EBDA 4ZUJA 2NZ1D 1K8MA 5FLXE 4NP5A 1STAA 1XYIA 4JI7Q 4IFDH 2IL8A 1BXTA 3QJYA 4B3SQ 2LY7A 2YTXA 2N88A 2NB0A 3MZ5A 3K57A 2I0QA 3GTOB 1CA5A 4IOAA 4B9XA 1IKMA 3S24A 4XTCS 5ELDA 4K5XA 4FF1A 3TREA 1GUNA 1EWIA 4A3BH 1L2FA 3CP0A 2KECA 5CBAE 2HHHL 1NSNS 3MXNA 1SYBA 2K5QA 1CK1A 1A0IA 4HMJA 4CKCA 2CWAA 1PTOC 1NY4A 3S16B 3T1HQ 3PO3H 3QOLA 2PMZB 1VQ5A 3DEPA 3P7JA 5KNDA 2QKIC 2F0MA 2MP1A 2E76C 2QILA 1GJXA 3CF5A 2PCFB 2XGTA 2IX0A 4DR4L 1UNSA 3ERSX 3F1ZA 4OO1I 1SE4A 2E2DC 2A5HA 1S3OA 4KMUC 5HY6A 2Q8TA 1N9WA 3ZYYX 2RDHA 1U9RA 3SK8A 4BS9A 2L4NA 3E0EA 5A2QL 5E3FA 1EY4A 3KBXA 4A3CH 4ME5A 1DZ1A 1NCVA 1VQIA 1BBXC 5FO7B 2R3ZA 5C0XG 2F0FA 3JAMi 2WP8J 1RJTA 3TS0A 1I4XA 3L7ZC 1K28A 2GA4B 4QIWB 4I7AA 2JA7G 2IY5B 2L1BA 2YTVA 2BH2A 4KHPL 1HCZA 1MJCA 2F0UA 3T1YL 1PYBA 1SE2A 1ZEQX 3MVVA 2PI2A 4G7OC 4PMBA 1VMCA 3M3YB 1K0SA 4N8FA 1N32Q 3GTLH 1UE7A 5D14A 1PH1A 4LF4Q 4DNRB 4NB3A 2OTJA 1B2TA 2EXDA 4RGNA 2RCFA 3BYTB 5FO9B 3TDQA 3MEFA 1TWCB 2RVLA 3K5MA 1SMXA 1Y1WG 3KFUA 1TS5A 4JI7L 4A93H 5I9OA 4CDEC 1SYDA 1ZXTA 4B3SL 4OWXB 1YNJD 2JQOA 4BXXG 2ZTCA 2MGSA 1W2BA 2HD3A 2Z6KA 5AFWA 3OTOQ 2Z6BA 5LHY1 1SR3A 3HOWG 1YEZA 4PQXA 2MO1A 2B29A 1NTGA 2H4OA 3IAYA 4UY8C 2XTIA 4G7HC 4R4TA 2F0EA 5CYUA 4C3JH 4X64Q 1GUSA 1ET9A 2E74C 5ELEA 4ZKBB 4DR7Q 2B2YA 1PH2A 2F0QA 1O7LA 1FVIA 2B2VA 4K6DA 1WTWA 2B2TC 4DV7Q 1RCVD 3P75A 3K59A 4BWGB 2HIVA 4DK0A 3I4MB 1HFNA 4AYBG 1SNPA 1L1OB 1HQMC 4O1NA 4RHSA 1TWFH 2HUGA 4NXMQ 3EFXD 4DR5Q 2KCCA 3Q22A 4MZ9A 2B63B 3IRBA 3HKZE 4A3FH 1HFGA 3AEVA 1V1OA 2F0KA 1HZAA 1U0LA 5DAUA 2JSOA 1EY8A 1PHJA 1E7ZA 2JA5H 3I8ZA 3H3VH 2MQHA 3KDFB 1HPCA 1JR0D 2KUMA 4DFAA 2PO4A 4JI2Q 4U68A 3WWVA 1E3PA 2L11A 3J7A5 4JV5Q 5EPLA 3VR5A 2G9HD 2KOLA 2YV5A 4DK1A 3NBHA 1PH6A 2JA7B 4R9WA 1SROA 1OXUA 2K33A 1V43A 1EQVA 1LTID 2EOTA 1KDAA 2IPKD 1CTMA 3U50C 3GO5A 3TMEA 3J81L 4XQNA 2OCEA 3GTPB 3NELA 3H09A 4CHTB 2EY6A 1SBBB 1SDFA 4UPAA 1KL9A 4F7XA 4LF4L 2WV6D 1BUVT 1KAWA 1RHPA 3VYSA 1K83B 1EOVA 1ZYRC 2NTSA 4QB4A 2VW9A 2N55A 1WCMB 3MXNB 4KKUA 4A4IA 4A75A 2CFMA 4OWTB 1VQDA 4RAUC 4O42A 3KLSA 1N8RC 1HUNA 3D4RA 3NK9A 5BN4A 4DR1Q 3BDOA 4ZK9B 2B2UA 4R1JA 2P5ZX 4LFBQ 5JEAJ 2WB1G 3ZJYC 3CCQA 1G51A 4X65Q 5EKKA 5GQOA 1Y1VH 2MJ8A 3L9AX 1G6ZA 1SYEA 4X64L 1J5EL 2R92G 2EJGC 4JI5Q 3I4OA 1FNVA 2RF4A 3A7AB 4DGZA 1XXGA 2E2IH 1I4RA 4DV7L 4PV1C 4H02A 1PFBA 3JAME 2D9UA 1TY2A 1NMGA 4AYBB 5M3FH 2EIFA 4BBRB 3S17B 1EQTA 3DUZA 3K58A 1SFOH 1SYCA 1IBMQ 1TU2B 3VYUA 1I4HA 4YY3Q 2DNEA 1LTRD 2KA7A 2JK8A 3Q6SA 4NXML 4DR5L 4JI0Q 5FLXL 3T53B 5M5YH 4XT1B 4DR2L 3TQYA 4NPSA 2JA9A 5ELFA 3GTGH 2O2LD 4HCEA 3A5ZB 3M4QA 1LTSD 2XRSD 1BDOA 1GKHA 3H0GB 3PF5A 4JI2L 1YZ6A 2YU9B 4JV5L 1G2SA 3R2TA 2NVXH 1I4PA 3D3RA 2OEOA 1IW7D 4M8AA 1QNUA 1SE3A 2FMMA 3S1QH 3KF6A 1ENAA 2ATWA 2JA6B 1CI3M 1Z6HA 3E0JA 4F8MA 4CJ0B 4IPDA 1I50B 4YHHQ 1I6HH 1EFWA 1J8IA 1Q90A 1QJOA 4K0KQ 4A3JH 2F03A 3RUZA 1QILA 3I7FA 2PW7A 3SEBA 5EJWA 1BKBA 3RD4A 1JJGA 1V8QA 2B3GA 1HHVA 2A68C 3DWPA 1HUMA 1STGA 1HH2P 3KK7A 3J7ZC 1G6PA 1VQBA 5IIFA 4IFDJ 1EIHA 2RHQB 3SXHA 1SRUA 4N8X1 4TKOB 2RDFA 1MJEA 1HR0Q 1YI2A 2Z4IA 4ILWA 1YITA 3HKZB 4DR1L 4XYOA 4LFBL 1HA6A 1CSQA 5LMNQ 2Q2UA 4KJNA 4GOPB 2QEJC 3TBIB 4X65L 3TP7A 1TWHH 3N52A 3J7AV 2R92B 5IGCA 2EPBA 5FKAC 4S3SA 2AMCB 4B08A 2BDNA 4QL5A 5JPMC 4JI5L 3PIO3 4KHVA 5I6WA 1Q8KA 2OQ0A 1BOSA 2XVSA 1BF4A 4FP5D 3GTQH 3D6CA 3I72A 5ISRA 3FP9A 1E1TA 2VNUD 1SMYD 5I2YA 1IBML 4KKTA 1JE5A 1IXRA 1A3TA 4YY3L 2M2LA 3J81i 1STYA 1Y14B 4JI0L 3A54A 3S9WA 3QIAA 3PF4A 1YNND 1XPUA 4RMFA 3MEHA 5C4ZA 3OIPA 5ELOA 3JC66 3FEWX 4HAEA 3J80L 2NN6H 3F2DA 4IUQA 3X3NA 1MBYA 2ALYB 4BA2I 2UXCQ 5IGBA 3VA5A 4C3HB 2ASBA 2ENBA 4R4IA 4POGA 1VQ8A 2EXZA 1N33L 2Q2HA 1C9OA 3PUXA 1HRJA 5D3DA 4YHHL 5IGDA 4A3JG 5IOCA 3FKIH 2B2TA 1QOHA 2QCPX 4K0KL 3UDFA 2AQ2B 3EROA 1QVGA 1GXDC 1VQEA 4DK3C 1DJRD 3OWFA 3PUYA 1LUZA 3HOXG 1II3A 1HNWQ 4A3EG 4A76A 3GTOH 1F77A 4DXGA 2KHJA 1JOKA 1ILPA 1S5FD 5I2XA 3PIPA 2R7DA 3EVQA 1VQFA 4HR7B 1HR0L 1IYJB 2OXPA 3MXGA 4AH6A 1J9OA 3BYYB 1TS4A 3N6RA 1SNCA 4X3UA 2RDGA 2WAQE 3D31A 1VMPA 5LMNL 4CJ2C 1LT3D 3S16H 2XWJB 2R7ZB 4DV2Q 3PUZA 5KEEA 4CDFC 3CD6A 1A3UA 3HOYB 3M7GA 2KVMA 2OQKA 1HXYD 1OTCA 2KBNA 2LXJA 2EY5A 3D6WA 2RQXA 3ER0A 1EYDA 1BCPC 4XQQA 5J39A 1E2ZA 1AE3A 2UXDL 2R7FA 1ICFB 3K81C 1X65A 5G3LF 3NENA 1RODA 1VQHA 3CU7A 2ICIA 5C44G 1NR2A 3FDTA 4J6HA 3I56A 2E5LL 2A1AA 3MFGA 3CW2C 1GM5A 3X3MA 2K28A 2F3VA 2Z4HA 1HA5A 3S2HB 3NTIA 2D0OA 2M9VA 1J6QA 4UDUC 2AQ3B 4OO1G 5EPKA 2UXCL 2CW0D 1PTOB 3EA6A 3S1NB 3M9BA 4HIOA 5GAEC 3CCLA 3FRPB 4MTKA 4BY7B 5CV8A 4AQYQ 4JCVE 3E9IA 3TP8A 3KUPA 2IX1A 3STBD 3C46A 3MHBA 1AE2A 3TN2A 1RKNA 1PH4A 1B53A 3RZOB 1HQRD 1TWCH 1UUPA 3HG9A 3HKSA 1T9HA 4WRDA 4E6IA 4BA1I 2ZTEA 1EWCA 4A3EB 4Y7NH 2IJ0A 2WKDA 3C1EA 2C9OA 3KBGA 3QO2A 1HNWL 3W5OA 3D4DA 4C1NK 4L5SA 2NUCA 4U673 4NXNQ 4YCVA 3G4SA 3ULLA 4A3IG 1IBLQ 1S5CD 5I9PA 1LT4D 1GHKA 1ML0D 1PH7A 5JJLA 3NPPA 5IGGA 3J81E 1B9NA 2XIWA 1DCZA 4ID6A 3HS0C 2HT1A 1EYGA 2GVBA 2EYOA 4DV2L 3FHWA 1U4RA 1JWUD 5FJ8G 2LXKA 4B3MQ 2LSSA 1FJGQ 4QUFA 1L0WA 4RCNA 3W1BA 2BA1A 1JB7A 3QR8A 3VDYA 4C56C 1B9MA 4JBKA 2UUAQ 1LTTD 1XTDA 1KRTA 5C44B 1D8LA 1V1PB 3UI2A 3RZDB 4WJWA 4FF3A 1UEBA 1RTOA 1L1OA 2C5CA 3P20A 3TEHB 1JT8A 3HGBA 4ZQ3A 4BY1B 5C0XH 4JPBW 4HJ7A 4QQBX 4XIGS 3UDIA 2F0PA 2JA7H 3DHQA 5CGKA 2JXMB 3KDFA 2AHOB 4JI1L 1YJ9A 4H7BA 1GUGA 3WDNA 4AQYL 1OXTA 4KY7A 1BO0A 4IO9A 1WTVA 1NR4A 4I65A 4GLXA 2NVQB 4JYAQ 4OELB 2NVTH 3SK6A 3VR4A 2L15A 2QW7A 4EQ5A 3S15H 4BBSG 1Q3LA 1G91A 2X6LA 3M85A 1LTAD 1EU3A 4DA2A 1K83H 3OHXC 3S1MB 5JPNC 1K3BC 1PFSA 1Y1WH 5IYCG 4DR6Q 4R4QA 3TRZA 3E6ZX 4BXXH 3RN5A 2GVAA 3AQQA 1TKWB 2EQSA 3C3LA 1B8AA 1EY9A 3HOWH 3LGJA 4A3IB 1Q12A 3GTMH 1GOZA 2K04A 4NXNL 4DKAC 3K0XA 4X62Q 1IBLL 1Q7YC 1A2UA 1L0YB 1QG7A 3IFTA 1WTXA 2JA8G 1YJWA 2V1CC 4OHJA 4LF7L 5I6YA 1EYCA 4L5QA 1PTOD 2OT2A 2BH8A 2IHEA 2DJGC 4PZ6A 3I4MG 4KN4C 1LTGD 4XQJA 1IHZA 4B3ML 3S17H 1PLFA 1FJGL 4AIMA 5COYA 1S5ED 2AWOA 2F0VA 3PCOB 2B63G 2A6EC 5E4WC 5CV6A 2UUAL 5IP9G 3MXPA 2V4DA 4GNXB 1LLRD 3G6JB 2NN6I 3VR2A 3W2DA 4L8JA 5C4XB 4IPHA 2RHSB 2ZM6L 2Q8RE 1I5FA 2E2HB 3T56B 1Y8PB 1WFQA 3BS1A 3IFDA 2OF1A 2UXBQ 5K36G 2FMCA 2AUKA 2AWNA 1TWAB 3M4OH 3Q24A 1H9MA 2OTLA 2FINB 1B70B 1SEBD 2NVYB 3AMUA 3GP7A 2JA6H 3AB9A 2PQAA 3BDCA 4ZKCB 2WFWA 1RF2D 1I50H 2VS1A 1SYFA 2PQEA 1E1OA 1EOTA 4K8IA 5C5LA 3TZDA 3A7LA 4BBSB 1EY6A 4JYAL 1Z9FA 3J81j 3CQZB 2ES2A 4O0AA 1HJPA 1VCIA 2Z8LA 4L6TB 1WCMG 3A8JE 3FVQA 3I4LA 4GKJQ 5CMDA 1NUCA 2CHBD 2K03A 2JE6I 1ESFA 4DR6L 3J80E 1ESRA 1VQAA 1EU4A 4H0LC 2BCOA 3ND9A 3UE0A 5C3EB 1ASYA 1KC8C 2QF7A 1X3PA 1QWYA 3KOJA 1B7YB 1M8AA 1EZ6A 4CDCC 4R8IA 1T5XD 1RDPD 4JOIA 4HSVA 4X62L 1MI2A 2JA8B 5JVH3 2R92H 3T1HL 4QF4A 1HNXQ 2ZT9C 2L12A 3GTJB 2XN9C 4A3DB 3I55A 1GVPA 4GOPA 1B1ZA 3KLSX 4GS3A 1D1KA 1PRTC 3CHBD 5EKLA 4BBRG 4JBMA 1LO5D 3G6EA 1C8CA 3U58A 1R9TB 2DUDA 1QVCA 5CBEE 1D1IA 3D0FA 2K5WA 5C3XA 2B39A 4GN5A 1A15A 4MNOA 3A56A 3QOJA 1KNEA 3H0GG 2TMPA 3NQIA 4H44C 1T5EA 1AFPA 2EY1A 2UXBL 3RLNA 5CORA 3CPFA 3G71A 1JORA 4C3IG 2ZXRA 4K2LA 4GN4B 5HGTA 2JA6G 3HEJA 2QDLA 1VQMA 4EGVA 1A8VA 5CR3A 1N32L 1KXLA 2SEBD 3CCSA 1XNRQ 4DU9A 2F0NA 3PGZA 4ODGA 4LFCQ 1YIJA 2O4XA 3EQLC 1VQKA 1AW7A 5FLMG 4X66Q 1PTOF 4GNXC 4GKJL 1ZYRD 2EYHA 1PMRA 1X9NA 1DD2A 3RLOA 1I4GA 4FYDA 3OTOL 3O13A 3S14B 3PIOA 4A3MB 4A3KG 3HKZG 4YWKA 1PDQA 4OWWB 3D8GA 1NBWA 1O80A 4GLAC 4YWMA 1Q46A 5IYDH 1STNA 2G9DA 2K01A 4DR7L 1ICWA 2R7ZH 4K14A 1EEID 3RR5A 3HOYH 1HNXL 1DGSA 4RGOS 2M00A 2RCNA 1QUQA 3HOZG 3U4ZA 1VS0A 2K7VA 3BZCA 4DAVA 5GAGC 2ID0A 3PQIA 2MNAA 3JAMc 2O5JC 2EYFA 5C4HA 3ULPA 3I91A 4EQNA 2F52A 1RTNA 3MXUA 1Q86C 4KY6A 1X3FA 4OONA 1N34Q 5D3IB 4DUZQ 3F8TA 4JBWA 1WYDA 2K5HA 3K80C 1DOKA 4CDDC 4MIUA 3S2HH 1KDBA 2B2WC 1V1QA 5C0XJ 2PQAB 3D4WA 2A73B 5GADC 1CZWA 1XPOA 4C3HG 4DAPA 4DV4Q 4PNYA 3BZDB 4PZ7A 1PTOH 5G3LD 1C48A 2K1BA 5IT9c 4C3IB 4FXDA 3NWSA 2K50A 1KD1C 2R93G 4Z9CB 3I2ZA 1DXMA 1TIID 2EYLA 3EBEA 3WOEA 3U9OA 1BCPB 4IFDI 2KEEA 1XNRL 1IYVA 1EZ8A 1U4PA 5CV9A 3E3XA 2KCTA 1PYWD 4LFCL 3FPUB 1PA6A 3U9SA 3ONAB 3HOXH 4A3EH 3NTKA 4RCOA 4X66L 2A68D 3T13A 3Q23A 4HJ9A 4YWLA 5IY0A 2K5VA 4A3KB 3T16A 4B3TQ 2MHVA 1GHJA 2Z9HA 1D6EC 5IYDG 4XYQA 1RIPA 4TVAB 4PZ8A 3K0YA 3TS2A 1EWHA 4HMIA 4DUYQ 1CHPD 2R7ZG 1D7QA 4DNIA 4QGUA 1U4MA 1BNZA 3HOYG 3I73A 3OPOA 2DJFC 4J15A 2QA4A 3HOZB 3OW2A 3VA7A 1QVFA 2XRQD 1VQCA 1F9PA 2VQFQ 2JN4A 4QUCA 1MSGA 4OIJA 3OMGA 4EQOA 2WIIB 3ERQA 1K0RA 5C44H 4LMQD 2F0DA 5J22A 2DY7A 1QNKA 3RZDH 3KLWA 3A0JA 3L3OC 3NQTA 2ZJPA 4K5VA 4JG2A 1N34L 2I5MX 2A69C 2F1MA 1WI5A 4B9WA 4DV6Q 4EVOA 3S1RB 1V1PA 5NUCA 4DN4M 1DOLA 2ICEC 2JJQA 5DEHA 4P2CB 4V0BA 4OO1H 3SR1A 2F4VQ 4KLKA 3C2PA 1E2VA 3BZKA 4DK6C 3A74A 2SDFA 1V9PA 2L0CA 2CCZA 2F0TA 2EJMA 1TS2A 2EY2A 2XNAC 5M5XB 4BY7G 2R93B 1XWEA 2JA5B 2WINB 4IALA 2HQLA 4POFA 4HTHA 1O7YA 1PYSB 2TSSA 2VB3X 3LNNA 4JK1C 1PH5A 4KY5A 1TWGB 1ENCA 1JOOA 5M5WH 1AP0A 3NTHA 1JJCB 4JC0A 4OXPA 2JEAI 1PH9A 1X3EA 3I70A 4HEDA 4LJZC 3S1MH 5IYBH 4A3LH 4J1MA 3C1FA 1R4PB 4FNFA 1JJ2A 5EAYA 4OGQC 4A3IH 3NUCA 2F0HA 4R4CA 4XT3B 1QUQB 3CCJA 5IGEA 4FO2A 1VF7A 1Q1EA 3AFPA 4HJ5A 4DUYL 4HJ8A 1I3QB 3TSSA 2C35B 3K8AA 3NHHA 5FJ8H 3NEMA 1FGBD 3HRZC 5J3BA 3CC4A 1D5XC 3R8BA 5KNBA 4FVMA 3CC2A 2VQFL 1BCPD 2MPMA 1BR9A 1G8ZD 5IP7G 3H3VI 2IW3A 5F2DA 2PPBC 2E2IB 1VQ6A 4TQUS 1UWVA 2EDGA 1X32A 2XSCA 1A3VA 4BY1G 2X6GA 5M3FB 1F2LA 4KV6A 2DN8A 3A55A 5FK9C 5C4XH 3F2CA 2BE5D 5CV7A 2YYZA 3DM3A 4LF9Q 2Z6KC 4DV6L 2A6HC 1U4LA 3UE1A 4GNXA 3QG1A 2GN5A 1HZBA 3GD7A 4RG1A 4ULLA 3DWQA 2F4VL 1QB5D 3V2TA 4LF5Q 4KD4A 3E9HA 2Y0SE 4LF6Q 1Q1BA 2F0JA 4RHRA 3M3YH 4G4KA 2E8GA 5TSSA 1PZKD 1XJVA 1WVLA 4KJOA 3A8IE 2WAQG 1CQVA 2SOBA 3BU2A 3T51B 4BBSH 2PZWA 1YHAA 3PUWA 2LMCB 1JWMD 2MUYA 4NMZA 1CSPA 4ZCKA 3ULJA 1JOQA 5IYBG 4A3LG 5IYCH 1B50A 4HCSA 3HP3A 5EPJA 5C3EH 1K73C 3VYRA 1MD2D 4LW1A 1M4VA 2IHFA 4ZRZA 1D5ZC 1DYQA 4JI6Q 4C2MB 2JA8H 3I4NB 2K14A 1Y69U 2NZHA 3H3VC 2AUJD 2B2WA 3F2UA 3GTJH 1VQJA 4R8NA 3J81c 2RSOA 2VXWA 3CCVA 3I4MH 1PZID 1ZKOA 2F0LA 2K5DA 2I07B 1TWHB 4YCUA 2B63H 2UUBQ 5IP9H 1SNOA 5C5MA 1B3QA 3RN2A 1FD7D 2HDLA 3GTQB 5K5PA 2K4KA 4XDXA 1XPRA 3CCUA 2K05A 5C4XG 2I46A 2IWHA 4EQPA 1STHA 1ILQA 3PMFA 5KYLA 3K7AB 1Q8IA 4LF9L 1D5MC 5K36H 4APVA 2EE1A 2B2UC 1JWSD 2LFNA 4KD3A 2EYJA 1C0AA 3KYHC 4NW2A 1ONLA 4LF5L 4L63B 2NBFA 3OMCA 4LF6L 3NE5B 2RBMA 2ZJRA 3GTPH 2WAQB 1PRTB 4IURA 5BN5A 5M3MB 4IZ8A 3L0OA 2KENA 3T1YQ 5JAVA 5KIXA 1GUOA 2HCCA 1WCMH 2I5HA 4OEMB 3SVMA 5FLXc 1VQGA 2BOSA 5C3EG 1S5BD 2UU9Q 2PNRC 1M1KC 4DV0Q 1A2TA 3S14H 3HOVB 1PH8A 4UAIA 4J8QA 3NWTA 4LNQA 2F0IA 2VUMB 1U5KA 1BCPF 4ZAIA 1TT2A 3W3AA 4IOCA 4FXKC 1W6JA 4JI6L 5KNCA 5JEAG 1N36Q 2KHSA 1YVCA 3MAQA 4CBVA 4A3DG 2MO0A 5LMUQ 4P74A 5M9OA 1H9KA 1UE5A 2K5NA 2VY3A 5EKIA 4BBRH 4OX9Q 1G2TA 3S2DB 2Y0SB 4WFN3 2E75C 2K75A 1JMCA 3R2IA 3PO2B 4O2DA 1A6XA 4MHEA 1TY0A 3SE0A 1DONA 1A62A 2UUBL 2A6ED 2QGQA 1KAAA 1EY0A 1Y8OB 1KNAA 5HURA 4UP8A 3HOUG 3J7AF 1KDCA 3GV6A 3DMUA 3GTKB 4A3GG 4K2KA 3H0GH 1FNWA 4ZYSA 2YU9H 1E24A 2EVBA 3R93A 5C4JB 1Y8NB 1AEXA 1LACA 3SK4A 1HR0W 1WTPA 1BVSA 1KTKA 4FF4A
chains in the Genus database with same CATH topology
1NBWA 4YWMA 4GLAC 3F2DA 1Q46A 2HHHQ 4BA2I 1HNZQ 2ALYB 2UXCQ 5IYDH 3M4PA 4C3IH 4A3DH 4LUOA 4QY7A 1LM0A 4P71A 5LMNW 5JJKA 2ASBA 1VQPA 4DR7L 4R4IA 2MFIA 2R7ZH 4POGA 2PNHA 5AJ3Q 3CCRA 4JI4L 3RR5A 1VQ8A 2A8VA 1BBWA 1K8GA 3HOYH 1HNXL 1DGSA 1SE8A 1NMFA 2Y0SG 2RCNA 1QUQA 1VQ4A 1Q82C 4LF7Q 2AKWB 1RL2A 3U4ZA 1R9TH 1VS0A 1N33L 3HOZG 5JJIA 4AYBE 3BZCA 4PG3A 3PO2G 2Q2HA 1C9OA 2ID0A 3PUXA 5GAGC 1SLJA 4A3BH 4YHHL 1EQRA 3JAMc 2MNAA 4DAYB 4DR4Q 3J80i 4A3JG 3ULPA 3FKIH 1BBUA 2D62A 5FLMH 2F52A 4K0KL 3L2PA 3UDFA 1E22A 1XMOL 1IL2A 3Q8DA 1Q86C 2Q2UA 3HOUH 1X3FA 1QVGA 2DGYA 2N49A 4OONA 4YCWA 4DUZQ 1VQEA 1N34Q 4DK3C 1AH9A 4A3GH 1OXXK 1TXYA 3F8TA 3PUYA 4JBWA 1WYDA 2K5HA 3OYYA 1LUZA 3HOXG 4A3MG 3K80C 4A3KH 1VQ7A 4A3EG 2Q2TA 2UU9L 4A76A 1X54A 1HNWQ 3SGIA 3J80c 1IZ6A 2PI2E 4DV0L 1VQ9A 3GTOH 3S2HH 2KHJA 3U4VA 4IFDG 3PIPA 1X3GA 1V1QA 2R7DA 5C0XJ 2UUCL 2PQAB 1VQFA 4WJ4A 2ZM6Q 2N3SA 3CC7A 1HR0L 1IYJB 5GADC 4AH6A 1XPOA 1VQOA 3H15A 4DV4Q 4PZ7A 4UP9A 1P8LA 5IT9c 3KJOA 1FGUA 2WAQE 4A3BG 3D31A 1EUJA 5LMNL 1N36L 1CKNA 2K50A 2ZTDA 1KD1C 2R93G 3S16H 3HOZH 4DV1L 3I2ZA 5BR8Q 2VQEL 4KHPQ 5LMUL 4DV2Q 3PUZA 3EBEA 1H95A 3CMEA 3CD6A 2VL6A 1S40A 2OQKA 5GAHC 1OTCA 3ICEA 4OX9L 1J5EQ 2KBNA 1ASZA 4IFDI 2LXJA 3PO3G 1G291 3ER0A 1XNRL 3UDGA 2N78A 2KCTA 1AE3A 2UXDL 2R7FA 4LFCL 3K81C 1PA6A 5E7NA 1EQQA 1X65A 3NENA 1O7IA 4FDBA 3HOXH 4A3MH 1PH3A 1VQHA 4IPGA 4A3EH 5C44G 4X66L 3KF8B 1XMQQ 4JI7Q 4EX5A 3I56A 4YWLA 4HJ9A 3S1RH 2E5LL 2A1AA 5IY0A 4WJ3M 3CW2C 4B3SQ 1GM5A 2K5VA 2YTXA 4B3TQ 2I0QA 2WB1E 4C3HH 4GN3B 4IOAA 3S24A 1CKNB 4XTCS 4DR2Q 2D0OA 4A3CG 5IYDG 3TREA 1EWIA 1J6QA 3PSIA 1L2FA 1RIPA 3CP0A 4PZ8A 4TVAB 5M5XH 2HHHL 3TS2A 2R93H 4OO1G 1HNZL 2UXCL 4DUYQ 2R7ZG 1D7QA 4DNIA 4QGUA 3M9BA 4HIOA 5GAEC 3CCLA 3HOYG 1A0IA 2CWAA 4J15A 5AJ3L 1TWGH 1NY4A 4JCVE 2QA4A 4AQYQ 3T1HQ 3PO3H 3E9IA 3OW2A 1VQ5A 1QVFA 1VQCA 4GLVB 2IX1A 3STBD 1AE2A 2VQFQ 3CF5A 2XGTA 1PH4A 1LYLA 2IX0A 4DR4L 3K7UC 3ERSX 1MKHA 5H1SE 1K0RA 3F1ZA 5C44H 4ALPA 4OO1I 1FL0A 1TWCH 3HKSA 3JC66 1T9HA 3RZDH 3KLWA 1S3OA 3A0JA 2ZJPA 4BA1I 1N34L 5HY6A 1MIUA 4JG2A 1N9WA 2ZTEA 2I5MX 4Y7NH 1M90C 1WI5A 4DV6Q 1HNWL 3E0EA 4HIMA 3W5OA 4A3CH 4L5SA 1IBKQ 4A93G 4NXNQ 2JJQA 4YCVA 3G4SA 1VQIA 3ULLA 5C0XG 4A3IG 1IBLQ 2F4VQ 4KLKA 2A19A 5ELNA 3JAMi 3BZKA 3AFQA 4KHZA 2WP8J 4DK6C 3A74A 4LUVA 1V9PA 2CCZA 3W1GA 5GROA 1PH7A 1N32Q 3TS0A 1I3QH 5JJLA 4BY7G 3L7ZC 1KRSA 2HQLA 2JA7G 3RLFA 4POFA 2IY5B 2I5LX 2YTVA 2BH2A 2HT1A 1PYSB 5BR8L 1EYGA 4KHPL 2GVBA 1MJCA 3T1YL 4DV2L 1PH5A 3FHWA 1PYBA 1K8AC 2PI2A 5FJ8G 2LXKA 5M5WH 4B3MQ 2LSSA 1FJGQ 1JJCB 4JC0A 4OXPA 2YTYA 1L0WA 5C0XI 2JEAI 3GTLH 3W1BA 1UE7A 1PH1A 1PH9A 4LF4Q 3EIVA 2BA1A 1X3EA 1JB7A 4JI3Q 4NB3A 2OTJA 3VDYA 3S1MH 2H5XA 5IYBH 2EXDA 4JBKA 2FXQA 2UUAQ 4A3LH 1XTDA 1X56A 1XNQQ 1KRTA 3MEFA 1D8LA 1YNXA 1SMXA 3PV0A 1UEBA 1L1OA 1JJ2A 1Y1WG 1XMQL 3TEHB 3KFUA 4JI7L 4A93H 1JT8A 5EAYA 4A3FG 4A3IH 4B3SL 4OWXB 2JQOA 4R4CA 2ZTCA 1W2BA 4BXXG 3AYHB 2Z6KA 3S1NH 1QUQB 3OTOQ 3CCJA 4HJ7A 4QQBX 1SR3A 4XIGS 3UDIA 4BY7H 3HOWG 1YEZA 2MO1A 2B29A 2JA5G 1NTGA 3B6YA 3CAMA 2JA7H 4UY8C 1CUKA 1Q1EA 2XTIA 3AFPA 4R4TA 4DUYL 4HJ5A 4HJ8A 4C3JH 3KDFA 4X64Q 2C35B 2AHOB 3K8AA 4DR7Q 5FJ8H 4JI1L 1YJ9A 1PH2A 3NEMA 1VQLA 4X6AH 1FVIA 3RZOH 4AQYL 1OXTA 5J3BA 4IO9A 4DV7Q 3CC4A 1VQNA 4LUZA 4GLXA 4JYAQ 1N33Q 2ZJQA 2NVTH 2HIVA 3CCEA 2L15A 1Z47A 4LFAQ 4EQ5A 2VQFL 3CC2A 3S15H 4BBSG 3G48A 5IP7G 3H3VI 4AYBG 1L1OB 3M85A 1VQ6A 4TQUS 1K83H 1UWVA 1TWFH 2D0PA 2QEXA 4NXMQ 4DR5Q 1PFSA 1Y1WH 1L1OC 4MZ9A 5IYCG 3IRBA 3HKZE 4BY1G 4A3FH 4R4QA 3AEVA 3TRZA 4DR6Q 3F2CA 5C4XH 1HZAA 4BXXH 3RN5A 2GVAA 1U0LA 3UDXA 2YYZA 3DM3A 3AQQA 4LF9Q 2EQSA 2Z6KC 4DV6L 1B8AA 1PHJA 3HOWH 3LGJA 3UE1A 1E7ZA 2K52A 4GNXA 2JA5H 2F3IA 4C2MH 2MQHA 1Q12A 3H3VH 2N8NA 1IBKL 3GTMH 2GN5A 4B3RQ 1HZBA 3KDFB 3GD7A 4NXNL 4DKAC 3I4NH 3K0XA 4RG1A 4X62Q 4JI2Q 1IBLL 2F4VL 1Q7YC 3WWVA 4LF5Q 1E3PA 4JV5Q 3E9HA 3J7A5 3F2BA 2Y0SE 2YV5A 1Q1BA 4DV3Q 1PH6A 4LF6Q 1PVOA 2JA8G 1YJWA 3M3YH 1GO3E 1SROA 1OXUA 2V1CC 1KHIA 4LF7L 1HZCA 2Z0SA 2E8GA 3A5UA 4L5QA 1XJVA 1V43A 1NE3A 1WJJA 1Y1VG 2BH8A 2IHEA 2WAQG 3BU2A 3U50C 4PZ6A 3I4MG 3GO5A 4BBSH 3RNUA 4HIKA 4HIDA 1S72A 2OCEA 5IP7H 1YHAA 3PUWA 1WOCA 4LWCA 2NZOA 4B3ML 3S17H 3NELA 1FJGL 1CSPA 4UPAA 3ULJA 1KL9A 4AIMA 5IYBG 4LF4L 4DUZL 4A3LG 2AWOA 3PCOB 5IYCH 4JI3L 2B63G 1KAWA 4BY1H 5M3FG 2UXDQ 2UUAL 4JI8Q 5IP9G 1EOVA 2VW9A 1XNQL 3EN2A 5C3EH 3KJPA 4GNXB 1K73C 2NN6I 3MXNB 3K7AH 1I94Q 4A4IA 4A75A 1LTLA 4IPHA 4Y52H 2RHSB 4LW1A 2IHFA 5DLQE 2ZM6L 2E5LQ 1P16A 1I5FA 2CFMA 4OWTB 1VQDA 4UP7A 3NBHB 1N8RC 4DV4L 1WFQA 4P73A 4DR1Q 2UXBQ 4JI6Q 5K36G 2JA8H 4R1JA 4LF8Q 4LFBQ 1W3SA 5JEAJ 2AWNA 2K14A 2WB1G 2NZHA 3ZJYC 5IWAQ 3BJUA 3CCQA 1G51A 1OXSC 3M4OH 4GKKQ 4X65Q 5GQOA 3PUVA 4R4OA 2HIXA 1X6OA 1B70B 3GTJH 4DV5Q 2OTLA 1Y1VH 2NVQH 1VQJA 3J81c 2VZAA 3GDEA 4X64L 5M3MH 3CCVA 1J5EL 2JA6H 2R92G 4JI5Q 3I4OA 3I4MH 2PQAA 2RF4A 2WFWA 1I50H 2E2IH 1UE1A 2VS1A 4DV7L 1E1OA 1CKOA 4H02A 1HZ9A 4P75A 4YCUA 1CKMA 2CQOA 2B63H 1GD7A 1NMGA 1C7YA 4JYAL 1Z9FA 4KI0A 5M3FH 2EIFA 3J81j 2UUBQ 2ES2A 5IP9H 4LFAL 4O0AA 1HJPA 1VCIA 4DR3Q 1SFOH 3RN2A 1IBMQ 1WCMG 4GKJQ 4DPGA 4YY3Q 2JK8A 2K4KA 1XPRA 3CCUA 1SN8A 4DR5L 2JE6I 4NXML 5C4XG 3HOVH 1KQSA 4JI0Q 4DR6L 4B3TL 2IT1A 1VQAA 4PMWA 3UE0A 1ASYA 2VUMH 1KC8C 5M5YH 2OWOA 4DR2L 3TQYA 4IPCA 4NPSA 1B7YB 2JA9A 3KOJA 1EIYB 4APVA 4LF9L 3GTGH 3I4NG 1Q81C 4JOIA 1C0AA 3A5ZB 3M4QA 3KYHC 4B3RL 4X62L 1GKHA 3PF5A 4JI2L 3DLLA 1YZ6A 4LF5L 4JV5L 2R92H 4JI4Q 4HJAA 4LF6L 4DV3L 3T1HL 2NVXH 1HNXQ 2ZJRA 3GTPH 3I55A 3S1QH 3KF6A 1KIXA 1GVPA 3S2DH 4GOPA 2ATWA 3L0OA 2KENA 4GS3A 3M7NA 4IPDA 4YHHQ 1K3RA 3T1YQ 1EFWA 1I6HH 4P72A 4BBRG 4JBMA 3PO2H 2KHIA 1WCMH 4K0KQ 3G6EA 2I5HA 4A3JH 1XMOQ 3U58A 3CPWA 2DUDA 3I7FA 1QVCA 4ME3A 5FLXc 2CKZB 1YJNA 1VQGA 1BKBA 1JJGA 2E2HH 5C3EG 3D0FA 2B3GA 2Q2IA 2UU9Q 4JI8L 3GTKH 4GN5A 1M1KC 1HH2P 2R6GA 3J7ZC 4DV0Q 3S14H 1VQBA 1G6PA 1PH8A 5C4JH 1TWAH 4IFDJ 4MNOA 5IE8A 1I94L 2RHQB 2BA0A 1SRUA 2UUCQ 4JOIC 4LNQA 1U5KA 1MJEA 1YHBA 1HR0Q 3HFZB 1YI2A 3H0GG 1QZHA 2NVYH 1EIFA 1X55A 4IOCA 1YITA 2E2JH 2PMZE 1YHQA 4DR1L 2UXBL 3RLNA 4IJHA 4JI6L 5JEAG 4LF8L 3KF6B 4LFBL 1CSQA 3CCMA 1YVCA 2NN6G 3CPFA 5LMNQ 5HGQA 3G71A 4GOPB 1N36Q 4DV1Q 5IWAL 1NJIC 2VQEQ 2MO0A 4A3DG 4GKKL 5LMUQ 4P74A 4X65L 1TWHH 5M3MG 4GN4B 4DV5L 2JA6G 1UE5A 4GOPC 1VQMA 2K5NA 1UE6A 2VY3A 4L5TA 2AMCB 3CQZH 4BBRH 2JEBI 4OX9Q 4QL5A 1A8VA 4JI5L 1QZGA 1K9MC 4JI1Q 3STBC 3CXCA 1N32L 1KXLA 1Q8KA 2OQ0A 3CCSA 1XNRQ 4MTNA 1PV4A 1A63A 2CWPA 3GTQH 2K75A 2KCMA 3PGZA 4IJLA 1JMCA 3FP9A 4O2DA 1YIJA 4LFCQ 1E1TA 1VQKA 1A62A 2VNUD 4JBJA 2UUBL 4QJFA 1YBYA 2QGQA 3CMAA 3FKIG 5FLMG 4X66Q 4GNXC 1OXVA 4DR3L 1IBML 3HOVG 1JE5A 4GKJL 1IXRA 4YY3L 3J81i 4UP8A 3HOUG 1X9NA 2VUMG 4DAMA 1Y14B 3RLOA 4JI0L 4A3GG 4L5RC 3H0GH 3OTOL 3PF4A 3PIOA 4RMFA 4QIWE 2YU9H 1E24A 4A3KG 1XPUA 3HKZG 1HR0W 5ELOA 1BVSA 4YWKA 4OWWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBW A;  4YWM A;  4GLA C;  3F2D A;  1Q46 A;  2HHH Q;  4BA2 I;  1HNZ Q;  2ALY B;  2UXC Q;  5IYD H;  3M4P A;  4C3I H;  4A3D H;  4LUO A;  4QY7 A;  1LM0 A;  4P71 A;  5LMN W;  5JJK A;  2ASB A;  1VQP A;  4DR7 L;  4R4I A;  2MFI A;  2R7Z H;  4POG A;  2PNH A;  5AJ3 Q;  3CCR A;  4JI4 L;  3RR5 A;  1VQ8 A;  2A8V A;  1BBW A;  1K8G A;  3HOY H;  1HNX L;  1DGS A;  1SE8 A;  1NMF A;  2Y0S G;  2RCN A;  1QUQ A;  1VQ4 A;  1Q82 C;  4LF7 Q;  2AKW B;  1RL2 A;  3U4Z A;  1R9T H;  1VS0 A;  1N33 L;  3HOZ G;  5JJI A;  4AYB E;  3BZC A;  4PG3 A;  3PO2 G;  2Q2H A;  1C9O A;  2ID0 A;  3PUX A;  5GAG C;  1SLJ A;  4A3B H;  4YHH L;  1EQR A;  3JAM c;  2MNA A;  4DAY B;  4DR4 Q;  3J80 i;  4A3J G;  3ULP A;  3FKI H;  1BBU A;  2D62 A;  5FLM H;  2F52 A;  4K0K L;  3L2P A;  3UDF A;  1E22 A;  1XMO L;  1IL2 A;  3Q8D A;  1Q86 C;  2Q2U A;  3HOU H;  1X3F A;  1QVG A;  2DGY A;  2N49 A;  4OON A;  4YCW A;  4DUZ Q;  1VQE A;  1N34 Q;  4DK3 C;  1AH9 A;  4A3G H;  1OXX K;  1TXY A;  3F8T A;  3PUY A;  4JBW A;  1WYD A;  2K5H A;  3OYY A;  1LUZ A;  3HOX G;  4A3M G;  3K80 C;  4A3K H;  1VQ7 A;  4A3E G;  2Q2T A;  2UU9 L;  4A76 A;  1X54 A;  1HNW Q;  3SGI A;  3J80 c;  1IZ6 A;  2PI2 E;  4DV0 L;  1VQ9 A;  3GTO H;  3S2H H;  2KHJ A;  3U4V A;  4IFD G;  3PIP A;  1X3G A;  1V1Q A;  2R7D A;  5C0X J;  2UUC L;  2PQA B;  1VQF A;  4WJ4 A;  2ZM6 Q;  2N3S A;  3CC7 A;  1HR0 L;  1IYJ B;  5GAD C;  4AH6 A;  1XPO A;  1VQO A;  3H15 A;  4DV4 Q;  4PZ7 A;  4UP9 A;  1P8L A;  5IT9 c;  3KJO A;  1FGU A;  2WAQ E;  4A3B G;  3D31 A;  1EUJ A;  5LMN L;  1N36 L;  1CKN A;  2K50 A;  2ZTD A;  1KD1 C;  2R93 G;  3S16 H;  3HOZ H;  4DV1 L;  3I2Z A;  5BR8 Q;  2VQE L;  4KHP Q;  5LMU L;  4DV2 Q;  3PUZ A;  3EBE A;  1H95 A;  3CME A;  3CD6 A;  2VL6 A;  1S40 A;  2OQK A;  5GAH C;  1OTC A;  3ICE A;  4OX9 L;  1J5E Q;  2KBN A;  1ASZ A;  4IFD I;  2LXJ A;  3PO3 G;  1G29 1;  3ER0 A;  1XNR L;  3UDG A;  2N78 A;  2KCT A;  1AE3 A;  2UXD L;  2R7F A;  4LFC L;  3K81 C;  1PA6 A;  5E7N A;  1EQQ A;  1X65 A;  3NEN A;  1O7I A;  4FDB A;  3HOX H;  4A3M H;  1PH3 A;  1VQH A;  4IPG A;  4A3E H;  5C44 G;  4X66 L;  3KF8 B;  1XMQ Q;  4JI7 Q;  4EX5 A;  3I56 A;  4YWL A;  4HJ9 A;  3S1R H;  2E5L L;  2A1A A;  5IY0 A;  4WJ3 M;  3CW2 C;  4B3S Q;  1GM5 A;  2K5V A;  2YTX A;  4B3T Q;  2I0Q A;  2WB1 E;  4C3H H;  4GN3 B;  4IOA A;  3S24 A;  1CKN B;  4XTC S;  4DR2 Q;  2D0O A;  4A3C G;  5IYD G;  3TRE A;  1EWI A;  1J6Q A;  3PSI A;  1L2F A;  1RIP A;  3CP0 A;  4PZ8 A;  4TVA B;  5M5X H;  2HHH L;  3TS2 A;  2R93 H;  4OO1 G;  1HNZ L;  2UXC L;  4DUY Q;  2R7Z G;  1D7Q A;  4DNI A;  4QGU A;  3M9B A;  4HIO A;  5GAE C;  3CCL A;  3HOY G;  1A0I A;  2CWA A;  4J15 A;  5AJ3 L;  1TWG H;  1NY4 A;  4JCV E;  2QA4 A;  4AQY Q;  3T1H Q;  3PO3 H;  3E9I A;  3OW2 A;  1VQ5 A;  1QVF A;  1VQC A;  4GLV B;  2IX1 A;  3STB D;  1AE2 A;  2VQF Q;  3CF5 A;  2XGT A;  1PH4 A;  1LYL A;  2IX0 A;  4DR4 L;  3K7U C;  3ERS X;  1MKH A;  5H1S E;  1K0R A;  3F1Z A;  5C44 H;  4ALP A;  4OO1 I;  1FL0 A;  1TWC H;  3HKS A;  3JC6 6;  1T9H A;  3RZD H;  3KLW A;  1S3O A;  3A0J A;  2ZJP A;  4BA1 I;  1N34 L;  5HY6 A;  1MIU A;  4JG2 A;  1N9W A;  2ZTE A;  2I5M X;  4Y7N H;  1M90 C;  1WI5 A;  4DV6 Q;  1HNW L;  3E0E A;  4HIM A;  3W5O A;  4A3C H;  4L5S A;  1IBK Q;  4A93 G;  4NXN Q;  2JJQ A;  4YCV A;  3G4S A;  1VQI A;  3ULL A;  5C0X G;  4A3I G;  1IBL Q;  2F4V Q;  4KLK A;  2A19 A;  5ELN A;  3JAM i;  3BZK A;  3AFQ A;  4KHZ A;  2WP8 J;  4DK6 C;  3A74 A;  4LUV A;  1V9P A;  2CCZ A;  3W1G A;  5GRO A;  1PH7 A;  1N32 Q;  3TS0 A;  1I3Q H;  5JJL A;  4BY7 G;  3L7Z C;  1KRS A;  2HQL A;  2JA7 G;  3RLF A;  4POF A;  2IY5 B;  2I5L X;  2YTV A;  2BH2 A;  2HT1 A;  1PYS B;  5BR8 L;  1EYG A;  4KHP L;  2GVB A;  1MJC A;  3T1Y L;  4DV2 L;  1PH5 A;  3FHW A;  1PYB A;  1K8A C;  2PI2 A;  5FJ8 G;  2LXK A;  5M5W H;  4B3M Q;  2LSS A;  1FJG Q;  1JJC B;  4JC0 A;  4OXP A;  2YTY A;  1L0W A;  5C0X I;  2JEA I;  3GTL H;  3W1B A;  1UE7 A;  1PH1 A;  1PH9 A;  4LF4 Q;  3EIV A;  2BA1 A;  1X3E A;  1JB7 A;  4JI3 Q;  4NB3 A;  2OTJ A;  3VDY A;  3S1M H;  2H5X A;  5IYB H;  2EXD A;  4JBK A;  2FXQ A;  2UUA Q;  4A3L H;  1XTD A;  1X56 A;  1XNQ Q;  1KRT A;  3MEF A;  1D8L A;  1YNX A;  1SMX A;  3PV0 A;  1UEB A;  1L1O A;  1JJ2 A;  1Y1W G;  1XMQ L;  3TEH B;  3KFU A;  4JI7 L;  4A93 H;  1JT8 A;  5EAY A;  4A3F G;  4A3I H;  4B3S L;  4OWX B;  2JQO A;  4R4C A;  2ZTC A;  1W2B A;  4BXX G;  3AYH B;  2Z6K A;  3S1N H;  1QUQ B;  3OTO Q;  3CCJ A;  4HJ7 A;  4QQB X;  1SR3 A;  4XIG S;  3UDI A;  4BY7 H;  3HOW G;  1YEZ A;  2MO1 A;  2B29 A;  2JA5 G;  1NTG A;  3B6Y A;  3CAM A;  2JA7 H;  4UY8 C;  1CUK A;  1Q1E A;  2XTI A;  3AFP A;  4R4T A;  4DUY L;  4HJ5 A;  4HJ8 A;  4C3J H;  3KDF A;  4X64 Q;  2C35 B;  2AHO B;  3K8A A;  4DR7 Q;  5FJ8 H;  4JI1 L;  1YJ9 A;  1PH2 A;  3NEM A;  1VQL A;  4X6A H;  1FVI A;  3RZO H;  4AQY L;  1OXT A;  5J3B A;  4IO9 A;  4DV7 Q;  3CC4 A;  1VQN A;  4LUZ A;  4GLX A;  4JYA Q;  1N33 Q;  2ZJQ A;  2NVT H;  2HIV A;  3CCE A;  2L15 A;  1Z47 A;  4LFA Q;  4EQ5 A;  2VQF L;  3CC2 A;  3S15 H;  4BBS G;  3G48 A;  5IP7 G;  3H3V I;  4AYB G;  1L1O B;  3M85 A;  1VQ6 A;  4TQU S;  1K83 H;  1UWV A;  1TWF H;  2D0P A;  2QEX A;  4NXM Q;  4DR5 Q;  1PFS A;  1Y1W H;  1L1O C;  4MZ9 A;  5IYC G;  3IRB A;  3HKZ E;  4BY1 G;  4A3F H;  4R4Q A;  3AEV A;  3TRZ A;  4DR6 Q;  3F2C A;  5C4X H;  1HZA A;  4BXX H;  3RN5 A;  2GVA A;  1U0L A;  3UDX A;  2YYZ A;  3DM3 A;  3AQQ A;  4LF9 Q;  2EQS A;  2Z6K C;  4DV6 L;  1B8A A;  1PHJ A;  3HOW H;  3LGJ A;  3UE1 A;  1E7Z A;  2K52 A;  4GNX A;  2JA5 H;  2F3I A;  4C2M H;  2MQH A;  1Q12 A;  3H3V H;  2N8N A;  1IBK L;  3GTM H;  2GN5 A;  4B3R Q;  1HZB A;  3KDF B;  3GD7 A;  4NXN L;  4DKA C;  3I4N H;  3K0X A;  4RG1 A;  4X62 Q;  4JI2 Q;  1IBL L;  2F4V L;  1Q7Y C;  3WWV A;  4LF5 Q;  1E3P A;  4JV5 Q;  3E9H A;  3J7A 5;  3F2B A;  2Y0S E;  2YV5 A;  1Q1B A;  4DV3 Q;  1PH6 A;  4LF6 Q;  1PVO A;  2JA8 G;  1YJW A;  3M3Y H;  1GO3 E;  1SRO A;  1OXU A;  2V1C C;  1KHI A;  4LF7 L;  1HZC A;  2Z0S A;  2E8G A;  3A5U A;  4L5Q A;  1XJV A;  1V43 A;  1NE3 A;  1WJJ A;  1Y1V G;  2BH8 A;  2IHE A;  2WAQ G;  3BU2 A;  3U50 C;  4PZ6 A;  3I4M G;  3GO5 A;  4BBS H;  3RNU A;  4HIK A;  4HID A;  1S72 A;  2OCE A;  5IP7 H;  1YHA A;  3PUW A;  1WOC A;  4LWC A;  2NZO A;  4B3M L;  3S17 H;  3NEL A;  1FJG L;  1CSP A;  4UPA A;  3ULJ A;  1KL9 A;  4AIM A;  5IYB G;  4LF4 L;  4DUZ L;  4A3L G;  2AWO A;  3PCO B;  5IYC H;  4JI3 L;  2B63 G;  1KAW A;  4BY1 H;  5M3F G;  2UXD Q;  2UUA L;  4JI8 Q;  5IP9 G;  1EOV A;  2VW9 A;  1XNQ L;  3EN2 A;  5C3E H;  3KJP A;  4GNX B;  1K73 C;  2NN6 I;  3MXN B;  3K7A H;  1I94 Q;  4A4I A;  4A75 A;  1LTL A;  4IPH A;  4Y52 H;  2RHS B;  4LW1 A;  2IHF A;  5DLQ E;  2ZM6 L;  2E5L Q;  1P16 A;  1I5F A;  2CFM A;  4OWT B;  1VQD A;  4UP7 A;  3NBH B;  1N8R C;  4DV4 L;  1WFQ A;  4P73 A;  4DR1 Q;  2UXB Q;  4JI6 Q;  5K36 G;  2JA8 H;  4R1J A;  4LF8 Q;  4LFB Q;  1W3S A;  5JEA J;  2AWN A;  2K14 A;  2WB1 G;  2NZH A;  3ZJY C;  5IWA Q;  3BJU A;  3CCQ A;  1G51 A;  1OXS C;  3M4O H;  4GKK Q;  4X65 Q;  5GQO A;  3PUV A;  4R4O A;  2HIX A;  1X6O A;  1B70 B;  3GTJ H;  4DV5 Q;  2OTL A;  1Y1V H;  2NVQ H;  1VQJ A;  3J81 c;  2VZA A;  3GDE A;  4X64 L;  5M3M H;  3CCV A;  1J5E L;  2JA6 H;  2R92 G;  4JI5 Q;  3I4O A;  3I4M H;  2PQA A;  2RF4 A;  2WFW A;  1I50 H;  2E2I H;  1UE1 A;  2VS1 A;  4DV7 L;  1E1O A;  1CKO A;  4H02 A;  1HZ9 A;  4P75 A;  4YCU A;  1CKM A;  2CQO A;  2B63 H;  1GD7 A;  1NMG A;  1C7Y A;  4JYA L;  1Z9F A;  4KI0 A;  5M3F H;  2EIF A;  3J81 j;  2UUB Q;  2ES2 A;  5IP9 H;  4LFA L;  4O0A A;  1HJP A;  1VCI A;  4DR3 Q;  1SFO H;  3RN2 A;  1IBM Q;  1WCM G;  4GKJ Q;  4DPG A;  4YY3 Q;  2JK8 A;  2K4K A;  1XPR A;  3CCU A;  1SN8 A;  4DR5 L;  2JE6 I;  4NXM L;  5C4X G;  3HOV H;  1KQS A;  4JI0 Q;  4DR6 L;  4B3T L;  2IT1 A;  1VQA A;  4PMW A;  3UE0 A;  1ASY A;  2VUM H;  1KC8 C;  5M5Y H;  2OWO A;  4DR2 L;  3TQY A;  4IPC A;  4NPS A;  1B7Y B;  2JA9 A;  3KOJ A;  1EIY B;  4APV A;  4LF9 L;  3GTG H;  3I4N G;  1Q81 C;  4JOI A;  1C0A A;  3A5Z B;  3M4Q A;  3KYH C;  4B3R L;  4X62 L;  1GKH A;  3PF5 A;  4JI2 L;  3DLL A;  1YZ6 A;  4LF5 L;  4JV5 L;  2R92 H;  4JI4 Q;  4HJA A;  4LF6 L;  4DV3 L;  3T1H L;  2NVX H;  1HNX Q;  2ZJR A;  3GTP H;  3I55 A;  3S1Q H;  3KF6 A;  1KIX A;  1GVP A;  3S2D H;  4GOP A;  2ATW A;  3L0O A;  2KEN A;  4GS3 A;  3M7N A;  4IPD A;  4YHH Q;  1K3R A;  3T1Y Q;  1EFW A;  1I6H H;  4P72 A;  4BBR G;  4JBM A;  3PO2 H;  2KHI A;  1WCM H;  4K0K Q;  3G6E A;  2I5H A;  4A3J H;  1XMO Q;  3U58 A;  3CPW A;  2DUD A;  3I7F A;  1QVC A;  4ME3 A;  5FLX c;  2CKZ B;  1YJN A;  1VQG A;  1BKB A;  1JJG A;  2E2H H;  5C3E G;  3D0F A;  2B3G A;  2Q2I A;  2UU9 Q;  4JI8 L;  3GTK H;  4GN5 A;  1M1K C;  1HH2 P;  2R6G A;  3J7Z C;  4DV0 Q;  3S14 H;  1VQB A;  1G6P A;  1PH8 A;  5C4J H;  1TWA H;  4IFD J;  4MNO A;  5IE8 A;  1I94 L;  2RHQ B;  2BA0 A;  1SRU A;  2UUC Q;  4JOI C;  4LNQ A;  1U5K A;  1MJE A;  1YHB A;  1HR0 Q;  3HFZ B;  1YI2 A;  3H0G G;  1QZH A;  2NVY H;  1EIF A;  1X55 A;  4IOC A;  1YIT A;  2E2J H;  2PMZ E;  1YHQ A;  4DR1 L;  2UXB L;  3RLN A;  4IJH A;  4JI6 L;  5JEA G;  4LF8 L;  3KF6 B;  4LFB L;  1CSQ A;  3CCM A;  1YVC A;  2NN6 G;  3CPF A;  5LMN Q;  5HGQ A;  3G71 A;  4GOP B;  1N36 Q;  4DV1 Q;  5IWA L;  1NJI C;  2VQE Q;  2MO0 A;  4A3D G;  4GKK L;  5LMU Q;  4P74 A;  4X65 L;  1TWH H;  5M3M G;  4GN4 B;  4DV5 L;  2JA6 G;  1UE5 A;  4GOP C;  1VQM A;  2K5N A;  1UE6 A;  2VY3 A;  4L5T A;  2AMC B;  3CQZ H;  4BBR H;  2JEB I;  4OX9 Q;  4QL5 A;  1A8V A;  4JI5 L;  1QZG A;  1K9M C;  4JI1 Q;  3STB C;  3CXC A;  1N32 L;  1KXL A;  1Q8K A;  2OQ0 A;  3CCS A;  1XNR Q;  4MTN A;  1PV4 A;  1A63 A;  2CWP A;  3GTQ H;  2K75 A;  2KCM A;  3PGZ A;  4IJL A;  1JMC A;  3FP9 A;  4O2D A;  1YIJ A;  4LFC Q;  1E1T A;  1VQK A;  1A62 A;  2VNU D;  4JBJ A;  2UUB L;  4QJF A;  1YBY A;  2QGQ A;  3CMA A;  3FKI G;  5FLM G;  4X66 Q;  4GNX C;  1OXV A;  4DR3 L;  1IBM L;  3HOV G;  1JE5 A;  4GKJ L;  1IXR A;  4YY3 L;  3J81 i;  4UP8 A;  3HOU G;  1X9N A;  2VUM G;  4DAM A;  1Y14 B;  3RLO A;  4JI0 L;  4A3G G;  4L5R C;  3H0G H;  3OTO L;  3PF4 A;  3PIO A;  4RMF A;  4QIW E;  2YU9 H;  1E24 A;  4A3K G;  1XPU A;  3HKZ G;  1HR0 W;  5ELO A;  1BVS A;  4YWK A;  4OWW B; 
#chains in the Genus database with same CATH topology
 1JCK B;  1W6K A;  4FXG C;  1HNZ Q;  4C3I H;  5DM6 3;  4LUO A;  2DNC A;  2E2J B;  5LMN W;  2SNS A;  2MFI A;  5AJ3 Q;  1BBW A;  1H9S B;  1C4Q A;  3PIP 3;  5DM7 3;  1VQ4 A;  1RL2 A;  2NYZ D;  4OL7 A;  3T4A C;  4AYB E;  1LV9 A;  4CJ1 B;  5KRU A;  4PG3 A;  4RWS C;  1SLJ A;  1EQR A;  2VB2 X;  1HTP A;  5E1F A;  2D62 A;  5FLM H;  3L2P A;  2HCI A;  3Q8D A;  5CC4 A;  3DM1 A;  1F9S A;  2DGY A;  2N49 A;  1FNU A;  1TXY A;  4LK1 C;  3DEO A;  3OYY A;  2UU9 L;  4A3M G;  4A3K H;  1WTO A;  1X54 A;  2ZXO A;  3SGI A;  3J80 c;  1IZ6 A;  4G7Z C;  1YNJ C;  2PI2 E;  4DV0 L;  1QCB D;  2F0S A;  4CKE A;  3U4V A;  1VQ9 A;  4IFD G;  3TP5 A;  2KED A;  4WJ4 A;  1OO9 B;  2N3S A;  3CC7 A;  4Y7N B;  4TSS A;  1VQO A;  1FR3 A;  3GQB A;  2FFK B;  4UP9 A;  3VYT A;  1PXU A;  4G57 A;  4RH6 A;  1FGU A;  2NWG A;  4A3B G;  1EUJ A;  1N36 L;  2ZTD A;  3HOZ H;  1LTB D;  1F9Q A;  5BR8 Q;  5LMU L;  3CME A;  1E0B A;  2PZT A;  4M1U B;  5GAH C;  3ICE A;  4QMG A;  1J5E Q;  4OX9 L;  3PO3 G;  1IKL A;  2HDM A;  1PRT D;  3I3C A;  1O7I A;  4FDB A;  4IPG A;  3HOU B;  2KQ3 A;  1EYA A;  2L9H A;  3KF8 B;  4RFB A;  1XMQ Q;  4EX5 A;  3S1R H;  4A3G B;  4WJ3 M;  1UAP A;  1L0X B;  2WB1 E;  4C3H H;  4GN3 B;  4DR2 Q;  1CKN B;  5J1Z A;  1IYU A;  4A3C G;  4RGT A;  2KCN A;  1SXT A;  3BDL A;  3PSI A;  5M5X H;  2R93 H;  1NAP A;  1HNZ L;  3SHL A;  2H1E A;  3LWU A;  1HTL D;  5AJ3 L;  1TWG H;  4GLV B;  2J7Z A;  1LYL A;  3Q0A A;  3K7U C;  3HZX A;  1MKH A;  3CKI B;  5H1S E;  4ALP A;  1FL0 A;  3DWA A;  1STB A;  4H13 C;  4UHV A;  5D65 A;  2NVT B;  1MIU A;  1DOM A;  3S15 B;  1TVX A;  2HQE A;  1M90 C;  3NP8 A;  4HIM A;  4DXF A;  1WTH A;  1Y1W B;  1AZQ A;  1IBK Q;  4A93 G;  4FF2 A;  3NXW A;  2A19 A;  5ELN A;  4KHZ A;  3AFQ A;  3KLR A;  4X3K A;  4LUV A;  1FYC A;  5T1G A;  3W1G A;  5GRO A;  1I4Q A;  1I3Q H;  4A3B B;  3HOW B;  1KRS A;  1B4O A;  5FOB B;  3GTM B;  4N9P A;  3RLF A;  5EQ0 A;  1CQF A;  2I5L X;  5DNF A;  5BR8 L;  4C3J G;  3CRK C;  1K8A C;  1KLG D;  1JE4 A;  3PO3 B;  5C0X I;  2YTY A;  2PW5 A;  3EIV A;  2F0G A;  4DNT B;  4JI3 Q;  4K8J A;  5BN3 A;  2H5X A;  1NNX A;  3TZU A;  2FXQ A;  5L37 A;  1X56 A;  1XNQ Q;  2F0W A;  2ZXP A;  1TQO A;  1YNX A;  3PV0 A;  1JIC A;  4I7Z C;  4IUV A;  1WTQ A;  1XMQ L;  4A3F G;  4DF7 A;  1B3A A;  3AYH B;  1SJE D;  3S1N H;  1VDZ A;  3FMC A;  4JVZ A;  4WOR A;  1TR5 A;  2K32 A;  4BY7 H;  2JA5 G;  4NDX A;  3B6Y A;  2L55 A;  2LKV A;  3CAM A;  1LT6 D;  1CUK A;  3MWY W;  5KYI A;  3H6M A;  1IW7 C;  4RKB A;  1EY7 A;  1UEA B;  3TP6 A;  5IT9 E;  5EGT A;  3BVG A;  4X6A H;  5C6A A;  1VQL A;  1SNM A;  3RZO H;  4MN3 A;  4NKL A;  1VQN A;  3M4O B;  3NSW A;  1E2W A;  1PFN A;  4LUZ A;  1N33 Q;  1ET6 A;  3BVM A;  2ZJQ A;  3CCE A;  1KLU D;  1Z47 A;  4LFA Q;  2D2C C;  3G48 A;  4K6L A;  3GTL B;  1PFM A;  2D0P A;  2QEX A;  2JYO A;  1L1O C;  2A74 C;  3UDX A;  1PRT F;  2B8G A;  4A93 B;  2K52 A;  3EJI A;  2F3I A;  4C2M H;  2N8N A;  1STE A;  1IBK L;  4B3R Q;  2NTT A;  2G5D A;  3I4N H;  4IUN A;  3F2B A;  3GV3 A;  1PVO A;  4DV3 Q;  1GO3 E;  2RKS A;  2WB1 B;  1KHI A;  2Z1C A;  1HZC A;  2Z0S A;  3A5U A;  4C3J B;  2WKC A;  1NE3 A;  1WJJ A;  1Y1V G;  5CV5 A;  1LT5 D;  3RNU A;  4HIK A;  4HID A;  1S72 A;  5IP7 H;  1XTC D;  1WOC A;  4LWC A;  2NZO A;  2F4I A;  1F2M A;  3H94 A;  4QCL A;  4DUZ L;  1SMY C;  4JI3 L;  1Z7T A;  2BDO A;  4BY1 H;  5M3F G;  4RA8 A;  2UXD Q;  1AN8 A;  4JI8 Q;  1TWF B;  1XNQ L;  2R61 A;  3EN2 A;  3J7Y W;  3KJP A;  3MFY A;  3MA2 B;  2A69 D;  4A3F B;  3K7A H;  4RGM A;  1I94 Q;  1EFI D;  5T1I A;  4DAY A;  1YNN C;  1LAB A;  1LTL A;  3WOF A;  5DLQ E;  1AZP A;  2E5L Q;  1SND A;  4Y52 H;  1P16 A;  4OIK A;  4UP7 A;  3NBH B;  4DV4 L;  3VR6 A;  4P73 A;  3K6O A;  4LF8 Q;  5JOB A;  1W3S A;  2IX3 A;  5IWA Q;  3V05 A;  3BJU A;  3RMH A;  4PMC A;  1OXS C;  5FO8 B;  4GKK Q;  1GUW A;  3PUV A;  4R4O A;  2HIX A;  1X6O A;  4DV5 Q;  4HSP A;  2NVQ H;  2FHT A;  4V19 0;  2VZA A;  3GDE A;  5M3M H;  1GUT A;  4RKL A;  4Q0F A;  4X3T A;  2PYK A;  4KK7 A;  3OIQ A;  1WD1 A;  1UE1 A;  3E5S A;  1CKO A;  3V96 A;  1XX8 A;  1HZ9 A;  4P75 A;  4K5W A;  1BQQ T;  1CKM A;  2CQO A;  5IOD A;  5LL6 X;  2F3W A;  1GD7 A;  1C7Y A;  4KI0 A;  2SNM A;  4YIJ A;  4LFA L;  3R3O A;  2X69 A;  3IKJ A;  4DR3 Q;  3BVZ A;  1H9R A;  3BG3 A;  4IUP A;  4DPG A;  1K8O A;  3QB3 A;  1SN8 A;  3OSO A;  3HOV H;  1KQS A;  3MC0 B;  3SK5 A;  4B3T L;  2IT1 A;  2RA4 A;  4PMW A;  5A2Q E;  2VUM H;  4X3S A;  2OWO A;  2F0O A;  4IPC A;  3H91 A;  2JP1 A;  2WAC A;  3I4N G;  1Q81 C;  2AQ1 B;  4B3R L;  2EZV A;  1CM9 A;  1EY5 A;  2CH4 W;  3DLL A;  2EJF C;  4LAA A;  4JI4 Q;  4HJA A;  4DV3 L;  5A35 A;  4GZY C;  3URY A;  1MGS A;  1Y1V B;  1KIX A;  1SNQ A;  3S2D H;  1CZG A;  3M7N A;  3OOC A;  1F9R A;  1K3R A;  4P72 A;  3PO2 H;  3CRL C;  1DM0 B;  3FPP A;  1JQY D;  2KHI A;  1XMO Q;  2QDB A;  3CPW A;  4ME3 A;  2CKZ B;  2XWB B;  1YJN A;  2E2H H;  1I6V C;  4F87 A;  5I4D A;  2Q2I A;  1SFO B;  4JI8 L;  3GTK H;  2RSN A;  5CV4 A;  2R6G A;  1EL0 A;  5C4J H;  1TWA H;  2KJX A;  5IE8 A;  1I94 L;  2UUC Q;  2BA0 A;  4JOI C;  5M5Y B;  2A6H D;  2BE5 C;  1YHB A;  3HFZ B;  2J4X A;  3K5N A;  3QWN A;  1QZH A;  2NVY H;  1EIF A;  3GTG B;  2B2Y C;  1X55 A;  3M4Y A;  2E2J H;  2PMZ E;  3NBI A;  1YHQ A;  2B2V C;  4IJH A;  4Q5V A;  1O78 A;  4LF8 L;  3KF6 B;  2CW0 C;  3CCM A;  2NN6 G;  5HGQ A;  4XXE A;  4DV1 Q;  5IWA L;  1NJI C;  1EIG A;  5ELC A;  2VQE Q;  4GKK L;  4IUU A;  1JC7 A;  1MSH A;  1H9J A;  1KAB A;  5M3M G;  4DV5 L;  4GOP C;  2NVX B;  1UE6 A;  4L5T A;  2Q8I B;  3CQZ H;  2JEB I;  1K9M C;  1QZG A;  4JI1 Q;  3STB C;  1O7Z A;  3CXC A;  3S1Q B;  4MTN A;  2CH4 A;  1PV4 A;  1A63 A;  2CWP A;  1TS3 A;  2KCM A;  1I6H B;  1H9S A;  4IJL A;  1CFM A;  1CT1 D;  4JBJ A;  1CA6 A;  4A3J B;  4JW0 A;  4QJF A;  1YBY A;  3JAM L;  3FKI G;  3CMA A;  4DR3 L;  1ENF A;  1OXV A;  3AU7 A;  4CGY B;  3HOV G;  1CHQ D;  3ITP A;  4TRD A;  2J0T D;  2VUM G;  1SAP A;  4DAM A;  4HN7 A;  3G7L A;  3VR3 A;  4L5R C;  3LX0 A;  4IN3 A;  2O5I C;  3HOX B;  4QIW E;  5IGF A;  5JVG 3;  1EIY B;  5JEA H;  3SDZ A;  5LL6 S;  3MTS A;  2HHH Q;  2D5D A;  3M4P A;  4A3D H;  1R4Q B;  2FJ2 A;  4IQZ A;  1WD0 A;  2CQA A;  4QY7 A;  1LM0 A;  4P71 A;  5JJK A;  1VQP A;  2LS0 1;  2PNH A;  3CCR A;  4JI4 L;  2A8V A;  1K8G A;  1SE8 A;  5IT9 L;  1NMF A;  1WTR A;  2Y0S G;  4LF7 Q;  1Q82 C;  5JJI A;  2AKW B;  2CVR A;  3LWE A;  1B44 D;  4ZLT F;  1R9T H;  1D2B A;  3PO2 G;  1MHW C;  3DXJ C;  4DR4 Q;  4DAY B;  4ZUI A;  4KTA A;  2EYP A;  3J80 i;  4F88 A;  1S4Z A;  1BBU A;  1E22 A;  1XMO L;  1IL2 A;  3HOU H;  3K5O A;  4YCW A;  3I90 A;  1AH9 A;  4ABN A;  4A3G H;  1OXX K;  1VF5 C;  3IL8 A;  1F2Y A;  1VQ7 A;  2Q2T A;  2DY8 A;  1QE6 A;  1X3Q A;  5EBC A;  1F2Z A;  5C3W A;  1X3G A;  2UUC L;  3KF8 A;  1RD9 D;  2ZM6 Q;  3K5L A;  1EEF D;  3H15 A;  2PZU A;  5ELB A;  4C1N I;  5JJZ A;  1P8L A;  4KKS A;  3KJO A;  3A8K E;  1CKN A;  4DV1 L;  3ND8 A;  4IUT A;  1SYG A;  2VQE L;  4KHP Q;  1H95 A;  3OW7 A;  2B8F A;  2L5T A;  2VL6 A;  1S40 A;  1JB3 A;  1ASZ A;  4CKB A;  1SSO A;  1IL8 A;  1G29 1;  1PZJ D;  3P1H A;  5E4X A;  3UDG A;  4N9T A;  1SJH D;  2K6A A;  2N78 A;  4KN7 C;  1S5D D;  3FKI B;  5E7N A;  1EQQ A;  5KGU A;  2EYM A;  5M5W B;  1PH3 A;  4A3M H;  3OWE B;  5EBD A;  4ZUJ A;  2NZ1 D;  1K8M A;  5FLX E;  4NP5 A;  1STA A;  1XYI A;  4JI7 Q;  4IFD H;  2IL8 A;  1BXT A;  3QJY A;  4B3S Q;  2LY7 A;  2YTX A;  2N88 A;  2NB0 A;  3MZ5 A;  3K57 A;  2I0Q A;  3GTO B;  1CA5 A;  4IOA A;  4B9X A;  1IKM A;  3S24 A;  4XTC S;  5ELD A;  4K5X A;  4FF1 A;  3TRE A;  1GUN A;  1EWI A;  4A3B H;  1L2F A;  3CP0 A;  2KEC A;  5CBA E;  2HHH L;  1NSN S;  3MXN A;  1SYB A;  2K5Q A;  1CK1 A;  1A0I A;  4HMJ A;  4CKC A;  2CWA A;  1PTO C;  1NY4 A;  3S16 B;  3T1H Q;  3PO3 H;  3QOL A;  2PMZ B;  1VQ5 A;  3DEP A;  3P7J A;  5KND A;  2QKI C;  2F0M A;  2MP1 A;  2E76 C;  2QIL A;  1GJX A;  3CF5 A;  2PCF B;  2XGT A;  2IX0 A;  4DR4 L;  1UNS A;  3ERS X;  3F1Z A;  4OO1 I;  1SE4 A;  2E2D C;  2A5H A;  1S3O A;  4KMU C;  5HY6 A;  2Q8T A;  1N9W A;  3ZYY X;  2RDH A;  1U9R A;  3SK8 A;  4BS9 A;  2L4N A;  3E0E A;  5A2Q L;  5E3F A;  1EY4 A;  3KBX A;  4A3C H;  4ME5 A;  1DZ1 A;  1NCV A;  1VQI A;  1BBX C;  5FO7 B;  2R3Z A;  5C0X G;  2F0F A;  3JAM i;  2WP8 J;  1RJT A;  3TS0 A;  1I4X A;  3L7Z C;  1K28 A;  2GA4 B;  4QIW B;  4I7A A;  2JA7 G;  2IY5 B;  2L1B A;  2YTV A;  2BH2 A;  4KHP L;  1HCZ A;  1MJC A;  2F0U A;  3T1Y L;  1PYB A;  1SE2 A;  1ZEQ X;  3MVV A;  2PI2 A;  4G7O C;  4PMB A;  1VMC A;  3M3Y B;  1K0S A;  4N8F A;  1N32 Q;  3GTL H;  1UE7 A;  5D14 A;  1PH1 A;  4LF4 Q;  4DNR B;  4NB3 A;  2OTJ A;  1B2T A;  2EXD A;  4RGN A;  2RCF A;  3BYT B;  5FO9 B;  3TDQ A;  3MEF A;  1TWC B;  2RVL A;  3K5M A;  1SMX A;  1Y1W G;  3KFU A;  1TS5 A;  4JI7 L;  4A93 H;  5I9O A;  4CDE C;  1SYD A;  1ZXT A;  4B3S L;  4OWX B;  1YNJ D;  2JQO A;  4BXX G;  2ZTC A;  2MGS A;  1W2B A;  2HD3 A;  2Z6K A;  5AFW A;  3OTO Q;  2Z6B A;  5LHY 1;  1SR3 A;  3HOW G;  1YEZ A;  4PQX A;  2MO1 A;  2B29 A;  1NTG A;  2H4O A;  3IAY A;  4UY8 C;  2XTI A;  4G7H C;  4R4T A;  2F0E A;  5CYU A;  4C3J H;  4X64 Q;  1GUS A;  1ET9 A;  2E74 C;  5ELE A;  4ZKB B;  4DR7 Q;  2B2Y A;  1PH2 A;  2F0Q A;  1O7L A;  1FVI A;  2B2V A;  4K6D A;  1WTW A;  2B2T C;  4DV7 Q;  1RCV D;  3P75 A;  3K59 A;  4BWG B;  2HIV A;  4DK0 A;  3I4M B;  1HFN A;  4AYB G;  1SNP A;  1L1O B;  1HQM C;  4O1N A;  4RHS A;  1TWF H;  2HUG A;  4NXM Q;  3EFX D;  4DR5 Q;  2KCC A;  3Q22 A;  4MZ9 A;  2B63 B;  3IRB A;  3HKZ E;  4A3F H;  1HFG A;  3AEV A;  1V1O A;  2F0K A;  1HZA A;  1U0L A;  5DAU A;  2JSO A;  1EY8 A;  1PHJ A;  1E7Z A;  2JA5 H;  3I8Z A;  3H3V H;  2MQH A;  3KDF B;  1HPC A;  1JR0 D;  2KUM A;  4DFA A;  2PO4 A;  4JI2 Q;  4U68 A;  3WWV A;  1E3P A;  2L11 A;  3J7A 5;  4JV5 Q;  5EPL A;  3VR5 A;  2G9H D;  2KOL A;  2YV5 A;  4DK1 A;  3NBH A;  1PH6 A;  2JA7 B;  4R9W A;  1SRO A;  1OXU A;  2K33 A;  1V43 A;  1EQV A;  1LTI D;  2EOT A;  1KDA A;  2IPK D;  1CTM A;  3U50 C;  3GO5 A;  3TME A;  3J81 L;  4XQN A;  2OCE A;  3GTP B;  3NEL A;  3H09 A;  4CHT B;  2EY6 A;  1SBB B;  1SDF A;  4UPA A;  1KL9 A;  4F7X A;  4LF4 L;  2WV6 D;  1BUV T;  1KAW A;  1RHP A;  3VYS A;  1K83 B;  1EOV A;  1ZYR C;  2NTS A;  4QB4 A;  2VW9 A;  2N55 A;  1WCM B;  3MXN B;  4KKU A;  4A4I A;  4A75 A;  2CFM A;  4OWT B;  1VQD A;  4RAU C;  4O42 A;  3KLS A;  1N8R C;  1HUN A;  3D4R A;  3NK9 A;  5BN4 A;  4DR1 Q;  3BDO A;  4ZK9 B;  2B2U A;  4R1J A;  2P5Z X;  4LFB Q;  5JEA J;  2WB1 G;  3ZJY C;  3CCQ A;  1G51 A;  4X65 Q;  5EKK A;  5GQO A;  1Y1V H;  2MJ8 A;  3L9A X;  1G6Z A;  1SYE A;  4X64 L;  1J5E L;  2R92 G;  2EJG C;  4JI5 Q;  3I4O A;  1FNV A;  2RF4 A;  3A7A B;  4DGZ A;  1XXG A;  2E2I H;  1I4R A;  4DV7 L;  4PV1 C;  4H02 A;  1PFB A;  3JAM E;  2D9U A;  1TY2 A;  1NMG A;  4AYB B;  5M3F H;  2EIF A;  4BBR B;  3S17 B;  1EQT A;  3DUZ A;  3K58 A;  1SFO H;  1SYC A;  1IBM Q;  1TU2 B;  3VYU A;  1I4H A;  4YY3 Q;  2DNE A;  1LTR D;  2KA7 A;  2JK8 A;  3Q6S A;  4NXM L;  4DR5 L;  4JI0 Q;  5FLX L;  3T53 B;  5M5Y H;  4XT1 B;  4DR2 L;  3TQY A;  4NPS A;  2JA9 A;  5ELF A;  3GTG H;  2O2L D;  4HCE A;  3A5Z B;  3M4Q A;  1LTS D;  2XRS D;  1BDO A;  1GKH A;  3H0G B;  3PF5 A;  4JI2 L;  1YZ6 A;  2YU9 B;  4JV5 L;  1G2S A;  3R2T A;  2NVX H;  1I4P A;  3D3R A;  2OEO A;  1IW7 D;  4M8A A;  1QNU A;  1SE3 A;  2FMM A;  3S1Q H;  3KF6 A;  1ENA A;  2ATW A;  2JA6 B;  1CI3 M;  1Z6H A;  3E0J A;  4F8M A;  4CJ0 B;  4IPD A;  1I50 B;  4YHH Q;  1I6H H;  1EFW A;  1J8I A;  1Q90 A;  1QJO A;  4K0K Q;  4A3J H;  2F03 A;  3RUZ A;  1QIL A;  3I7F A;  2PW7 A;  3SEB A;  5EJW A;  1BKB A;  3RD4 A;  1JJG A;  1V8Q A;  2B3G A;  1HHV A;  2A68 C;  3DWP A;  1HUM A;  1STG A;  1HH2 P;  3KK7 A;  3J7Z C;  1G6P A;  1VQB A;  5IIF A;  4IFD J;  1EIH A;  2RHQ B;  3SXH A;  1SRU A;  4N8X 1;  4TKO B;  2RDF A;  1MJE A;  1HR0 Q;  1YI2 A;  2Z4I A;  4ILW A;  1YIT A;  3HKZ B;  4DR1 L;  4XYO A;  4LFB L;  1HA6 A;  1CSQ A;  5LMN Q;  2Q2U A;  4KJN A;  4GOP B;  2QEJ C;  3TBI B;  4X65 L;  3TP7 A;  1TWH H;  3N52 A;  3J7A V;  2R92 B;  5IGC A;  2EPB A;  5FKA C;  4S3S A;  2AMC B;  4B08 A;  2BDN A;  4QL5 A;  5JPM C;  4JI5 L;  3PIO 3;  4KHV A;  5I6W A;  1Q8K A;  2OQ0 A;  1BOS A;  2XVS A;  1BF4 A;  4FP5 D;  3GTQ H;  3D6C A;  3I72 A;  5ISR A;  3FP9 A;  1E1T A;  2VNU D;  1SMY D;  5I2Y A;  1IBM L;  4KKT A;  1JE5 A;  1IXR A;  1A3T A;  4YY3 L;  2M2L A;  3J81 i;  1STY A;  1Y14 B;  4JI0 L;  3A54 A;  3S9W A;  3QIA A;  3PF4 A;  1YNN D;  1XPU A;  4RMF A;  3MEH A;  5C4Z A;  3OIP A;  5ELO A;  3JC6 6;  3FEW X;  4HAE A;  3J80 L;  2NN6 H;  3F2D A;  4IUQ A;  3X3N A;  1MBY A;  2ALY B;  4BA2 I;  2UXC Q;  5IGB A;  3VA5 A;  4C3H B;  2ASB A;  2ENB A;  4R4I A;  4POG A;  1VQ8 A;  2EXZ A;  1N33 L;  2Q2H A;  1C9O A;  3PUX A;  1HRJ A;  5D3D A;  4YHH L;  5IGD A;  4A3J G;  5IOC A;  3FKI H;  2B2T A;  1QOH A;  2QCP X;  4K0K L;  3UDF A;  2AQ2 B;  3ERO A;  1QVG A;  1GXD C;  1VQE A;  4DK3 C;  1DJR D;  3OWF A;  3PUY A;  1LUZ A;  3HOX G;  1II3 A;  1HNW Q;  4A3E G;  4A76 A;  3GTO H;  1F77 A;  4DXG A;  2KHJ A;  1JOK A;  1ILP A;  1S5F D;  5I2X A;  3PIP A;  2R7D A;  3EVQ A;  1VQF A;  4HR7 B;  1HR0 L;  1IYJ B;  2OXP A;  3MXG A;  4AH6 A;  1J9O A;  3BYY B;  1TS4 A;  3N6R A;  1SNC A;  4X3U A;  2RDG A;  2WAQ E;  3D31 A;  1VMP A;  5LMN L;  4CJ2 C;  1LT3 D;  3S16 H;  2XWJ B;  2R7Z B;  4DV2 Q;  3PUZ A;  5KEE A;  4CDF C;  3CD6 A;  1A3U A;  3HOY B;  3M7G A;  2KVM A;  2OQK A;  1HXY D;  1OTC A;  2KBN A;  2LXJ A;  2EY5 A;  3D6W A;  2RQX A;  3ER0 A;  1EYD A;  1BCP C;  4XQQ A;  5J39 A;  1E2Z A;  1AE3 A;  2UXD L;  2R7F A;  1ICF B;  3K81 C;  1X65 A;  5G3L F;  3NEN A;  1ROD A;  1VQH A;  3CU7 A;  2ICI A;  5C44 G;  1NR2 A;  3FDT A;  4J6H A;  3I56 A;  2E5L L;  2A1A A;  3MFG A;  3CW2 C;  1GM5 A;  3X3M A;  2K28 A;  2F3V A;  2Z4H A;  1HA5 A;  3S2H B;  3NTI A;  2D0O A;  2M9V A;  1J6Q A;  4UDU C;  2AQ3 B;  4OO1 G;  5EPK A;  2UXC L;  2CW0 D;  1PTO B;  3EA6 A;  3S1N B;  3M9B A;  4HIO A;  5GAE C;  3CCL A;  3FRP B;  4MTK A;  4BY7 B;  5CV8 A;  4AQY Q;  4JCV E;  3E9I A;  3TP8 A;  3KUP A;  2IX1 A;  3STB D;  3C46 A;  3MHB A;  1AE2 A;  3TN2 A;  1RKN A;  1PH4 A;  1B53 A;  3RZO B;  1HQR D;  1TWC H;  1UUP A;  3HG9 A;  3HKS A;  1T9H A;  4WRD A;  4E6I A;  4BA1 I;  2ZTE A;  1EWC A;  4A3E B;  4Y7N H;  2IJ0 A;  2WKD A;  3C1E A;  2C9O A;  3KBG A;  3QO2 A;  1HNW L;  3W5O A;  3D4D A;  4C1N K;  4L5S A;  2NUC A;  4U67 3;  4NXN Q;  4YCV A;  3G4S A;  3ULL A;  4A3I G;  1IBL Q;  1S5C D;  5I9P A;  1LT4 D;  1GHK A;  1ML0 D;  1PH7 A;  5JJL A;  3NPP A;  5IGG A;  3J81 E;  1B9N A;  2XIW A;  1DCZ A;  4ID6 A;  3HS0 C;  2HT1 A;  1EYG A;  2GVB A;  2EYO A;  4DV2 L;  3FHW A;  1U4R A;  1JWU D;  5FJ8 G;  2LXK A;  4B3M Q;  2LSS A;  1FJG Q;  4QUF A;  1L0W A;  4RCN A;  3W1B A;  2BA1 A;  1JB7 A;  3QR8 A;  3VDY A;  4C56 C;  1B9M A;  4JBK A;  2UUA Q;  1LTT D;  1XTD A;  1KRT A;  5C44 B;  1D8L A;  1V1P B;  3UI2 A;  3RZD B;  4WJW A;  4FF3 A;  1UEB A;  1RTO A;  1L1O A;  2C5C A;  3P20 A;  3TEH B;  1JT8 A;  3HGB A;  4ZQ3 A;  4BY1 B;  5C0X H;  4JPB W;  4HJ7 A;  4QQB X;  4XIG S;  3UDI A;  2F0P A;  2JA7 H;  3DHQ A;  5CGK A;  2JXM B;  3KDF A;  2AHO B;  4JI1 L;  1YJ9 A;  4H7B A;  1GUG A;  3WDN A;  4AQY L;  1OXT A;  4KY7 A;  1BO0 A;  4IO9 A;  1WTV A;  1NR4 A;  4I65 A;  4GLX A;  2NVQ B;  4JYA Q;  4OEL B;  2NVT H;  3SK6 A;  3VR4 A;  2L15 A;  2QW7 A;  4EQ5 A;  3S15 H;  4BBS G;  1Q3L A;  1G91 A;  2X6L A;  3M85 A;  1LTA D;  1EU3 A;  4DA2 A;  1K83 H;  3OHX C;  3S1M B;  5JPN C;  1K3B C;  1PFS A;  1Y1W H;  5IYC G;  4DR6 Q;  4R4Q A;  3TRZ A;  3E6Z X;  4BXX H;  3RN5 A;  2GVA A;  3AQQ A;  1TKW B;  2EQS A;  3C3L A;  1B8A A;  1EY9 A;  3HOW H;  3LGJ A;  4A3I B;  1Q12 A;  3GTM H;  1GOZ A;  2K04 A;  4NXN L;  4DKA C;  3K0X A;  4X62 Q;  1IBL L;  1Q7Y C;  1A2U A;  1L0Y B;  1QG7 A;  3IFT A;  1WTX A;  2JA8 G;  1YJW A;  2V1C C;  4OHJ A;  4LF7 L;  5I6Y A;  1EYC A;  4L5Q A;  1PTO D;  2OT2 A;  2BH8 A;  2IHE A;  2DJG C;  4PZ6 A;  3I4M G;  4KN4 C;  1LTG D;  4XQJ A;  1IHZ A;  4B3M L;  3S17 H;  1PLF A;  1FJG L;  4AIM A;  5COY A;  1S5E D;  2AWO A;  2F0V A;  3PCO B;  2B63 G;  2A6E C;  5E4W C;  5CV6 A;  2UUA L;  5IP9 G;  3MXP A;  2V4D A;  4GNX B;  1LLR D;  3G6J B;  2NN6 I;  3VR2 A;  3W2D A;  4L8J A;  5C4X B;  4IPH A;  2RHS B;  2ZM6 L;  2Q8R E;  1I5F A;  2E2H B;  3T56 B;  1Y8P B;  1WFQ A;  3BS1 A;  3IFD A;  2OF1 A;  2UXB Q;  5K36 G;  2FMC A;  2AUK A;  2AWN A;  1TWA B;  3M4O H;  3Q24 A;  1H9M A;  2OTL A;  2FIN B;  1B70 B;  1SEB D;  2NVY B;  3AMU A;  3GP7 A;  2JA6 H;  3AB9 A;  2PQA A;  3BDC A;  4ZKC B;  2WFW A;  1RF2 D;  1I50 H;  2VS1 A;  1SYF A;  2PQE A;  1E1O A;  1EOT A;  4K8I A;  5C5L A;  3TZD A;  3A7L A;  4BBS B;  1EY6 A;  4JYA L;  1Z9F A;  3J81 j;  3CQZ B;  2ES2 A;  4O0A A;  1HJP A;  1VCI A;  2Z8L A;  4L6T B;  1WCM G;  3A8J E;  3FVQ A;  3I4L A;  4GKJ Q;  5CMD A;  1NUC A;  2CHB D;  2K03 A;  2JE6 I;  1ESF A;  4DR6 L;  3J80 E;  1ESR A;  1VQA A;  1EU4 A;  4H0L C;  2BCO A;  3ND9 A;  3UE0 A;  5C3E B;  1ASY A;  1KC8 C;  2QF7 A;  1X3P A;  1QWY A;  3KOJ A;  1B7Y B;  1M8A A;  1EZ6 A;  4CDC C;  4R8I A;  1T5X D;  1RDP D;  4JOI A;  4HSV A;  4X62 L;  1MI2 A;  2JA8 B;  5JVH 3;  2R92 H;  3T1H L;  4QF4 A;  1HNX Q;  2ZT9 C;  2L12 A;  3GTJ B;  2XN9 C;  4A3D B;  3I55 A;  1GVP A;  4GOP A;  1B1Z A;  3KLS X;  4GS3 A;  1D1K A;  1PRT C;  3CHB D;  5EKL A;  4BBR G;  4JBM A;  1LO5 D;  3G6E A;  1C8C A;  3U58 A;  1R9T B;  2DUD A;  1QVC A;  5CBE E;  1D1I A;  3D0F A;  2K5W A;  5C3X A;  2B39 A;  4GN5 A;  1A15 A;  4MNO A;  3A56 A;  3QOJ A;  1KNE A;  3H0G G;  2TMP A;  3NQI A;  4H44 C;  1T5E A;  1AFP A;  2EY1 A;  2UXB L;  3RLN A;  5COR A;  3CPF A;  3G71 A;  1JOR A;  4C3I G;  2ZXR A;  4K2L A;  4GN4 B;  5HGT A;  2JA6 G;  3HEJ A;  2QDL A;  1VQM A;  4EGV A;  1A8V A;  5CR3 A;  1N32 L;  1KXL A;  2SEB D;  3CCS A;  1XNR Q;  4DU9 A;  2F0N A;  3PGZ A;  4ODG A;  4LFC Q;  1YIJ A;  2O4X A;  3EQL C;  1VQK A;  1AW7 A;  5FLM G;  4X66 Q;  1PTO F;  4GNX C;  4GKJ L;  1ZYR D;  2EYH A;  1PMR A;  1X9N A;  1DD2 A;  3RLO A;  1I4G A;  4FYD A;  3OTO L;  3O13 A;  3S14 B;  3PIO A;  4A3M B;  4A3K G;  3HKZ G;  4YWK A;  1PDQ A;  4OWW B;  3D8G A;  1NBW A;  1O80 A;  4GLA C;  4YWM A;  1Q46 A;  5IYD H;  1STN A;  2G9D A;  2K01 A;  4DR7 L;  1ICW A;  2R7Z H;  4K14 A;  1EEI D;  3RR5 A;  3HOY H;  1HNX L;  1DGS A;  4RGO S;  2M00 A;  2RCN A;  1QUQ A;  3HOZ G;  3U4Z A;  1VS0 A;  2K7V A;  3BZC A;  4DAV A;  5GAG C;  2ID0 A;  3PQI A;  2MNA A;  3JAM c;  2O5J C;  2EYF A;  5C4H A;  3ULP A;  3I91 A;  4EQN A;  2F52 A;  1RTN A;  3MXU A;  1Q86 C;  4KY6 A;  1X3F A;  4OON A;  1N34 Q;  5D3I B;  4DUZ Q;  3F8T A;  4JBW A;  1WYD A;  2K5H A;  3K80 C;  1DOK A;  4CDD C;  4MIU A;  3S2H H;  1KDB A;  2B2W C;  1V1Q A;  5C0X J;  2PQA B;  3D4W A;  2A73 B;  5GAD C;  1CZW A;  1XPO A;  4C3H G;  4DAP A;  4DV4 Q;  4PNY A;  3BZD B;  4PZ7 A;  1PTO H;  5G3L D;  1C48 A;  2K1B A;  5IT9 c;  4C3I B;  4FXD A;  3NWS A;  2K50 A;  1KD1 C;  2R93 G;  4Z9C B;  3I2Z A;  1DXM A;  1TII D;  2EYL A;  3EBE A;  3WOE A;  3U9O A;  1BCP B;  4IFD I;  2KEE A;  1XNR L;  1IYV A;  1EZ8 A;  1U4P A;  5CV9 A;  3E3X A;  2KCT A;  1PYW D;  4LFC L;  3FPU B;  1PA6 A;  3U9S A;  3ONA B;  3HOX H;  4A3E H;  3NTK A;  4RCO A;  4X66 L;  2A68 D;  3T13 A;  3Q23 A;  4HJ9 A;  4YWL A;  5IY0 A;  2K5V A;  4A3K B;  3T16 A;  4B3T Q;  2MHV A;  1GHJ A;  2Z9H A;  1D6E C;  5IYD G;  4XYQ A;  1RIP A;  4TVA B;  4PZ8 A;  3K0Y A;  3TS2 A;  1EWH A;  4HMI A;  4DUY Q;  1CHP D;  2R7Z G;  1D7Q A;  4DNI A;  4QGU A;  1U4M A;  1BNZ A;  3HOY G;  3I73 A;  3OPO A;  2DJF C;  4J15 A;  2QA4 A;  3HOZ B;  3OW2 A;  3VA7 A;  1QVF A;  2XRQ D;  1VQC A;  1F9P A;  2VQF Q;  2JN4 A;  4QUC A;  1MSG A;  4OIJ A;  3OMG A;  4EQO A;  2WII B;  3ERQ A;  1K0R A;  5C44 H;  4LMQ D;  2F0D A;  5J22 A;  2DY7 A;  1QNK A;  3RZD H;  3KLW A;  3A0J A;  3L3O C;  3NQT A;  2ZJP A;  4K5V A;  4JG2 A;  1N34 L;  2I5M X;  2A69 C;  2F1M A;  1WI5 A;  4B9W A;  4DV6 Q;  4EVO A;  3S1R B;  1V1P A;  5NUC A;  4DN4 M;  1DOL A;  2ICE C;  2JJQ A;  5DEH A;  4P2C B;  4V0B A;  4OO1 H;  3SR1 A;  2F4V Q;  4KLK A;  3C2P A;  1E2V A;  3BZK A;  4DK6 C;  3A74 A;  2SDF A;  1V9P A;  2L0C A;  2CCZ A;  2F0T A;  2EJM A;  1TS2 A;  2EY2 A;  2XNA C;  5M5X B;  4BY7 G;  2R93 B;  1XWE A;  2JA5 B;  2WIN B;  4IAL A;  2HQL A;  4POF A;  4HTH A;  1O7Y A;  1PYS B;  2TSS A;  2VB3 X;  3LNN A;  4JK1 C;  1PH5 A;  4KY5 A;  1TWG B;  1ENC A;  1JOO A;  5M5W H;  1AP0 A;  3NTH A;  1JJC B;  4JC0 A;  4OXP A;  2JEA I;  1PH9 A;  1X3E A;  3I70 A;  4HED A;  4LJZ C;  3S1M H;  5IYB H;  4A3L H;  4J1M A;  3C1F A;  1R4P B;  4FNF A;  1JJ2 A;  5EAY A;  4OGQ C;  4A3I H;  3NUC A;  2F0H A;  4R4C A;  4XT3 B;  1QUQ B;  3CCJ A;  5IGE A;  4FO2 A;  1VF7 A;  1Q1E A;  3AFP A;  4HJ5 A;  4DUY L;  4HJ8 A;  1I3Q B;  3TSS A;  2C35 B;  3K8A A;  3NHH A;  5FJ8 H;  3NEM A;  1FGB D;  3HRZ C;  5J3B A;  3CC4 A;  1D5X C;  3R8B A;  5KNB A;  4FVM A;  3CC2 A;  2VQF L;  1BCP D;  2MPM A;  1BR9 A;  1G8Z D;  5IP7 G;  3H3V I;  2IW3 A;  5F2D A;  2PPB C;  2E2I B;  1VQ6 A;  4TQU S;  1UWV A;  2EDG A;  1X32 A;  2XSC A;  1A3V A;  4BY1 G;  2X6G A;  5M3F B;  1F2L A;  4KV6 A;  2DN8 A;  3A55 A;  5FK9 C;  5C4X H;  3F2C A;  2BE5 D;  5CV7 A;  2YYZ A;  3DM3 A;  4LF9 Q;  2Z6K C;  4DV6 L;  2A6H C;  1U4L A;  3UE1 A;  4GNX A;  3QG1 A;  2GN5 A;  1HZB A;  3GD7 A;  4RG1 A;  4ULL A;  3DWQ A;  2F4V L;  1QB5 D;  3V2T A;  4LF5 Q;  4KD4 A;  3E9H A;  2Y0S E;  4LF6 Q;  1Q1B A;  2F0J A;  4RHR A;  3M3Y H;  4G4K A;  2E8G A;  5TSS A;  1PZK D;  1XJV A;  1WVL A;  4KJO A;  3A8I E;  2WAQ G;  1CQV A;  2SOB A;  3BU2 A;  3T51 B;  4BBS H;  2PZW A;  1YHA A;  3PUW A;  2LMC B;  1JWM D;  2MUY A;  4NMZ A;  1CSP A;  4ZCK A;  3ULJ A;  1JOQ A;  5IYB G;  4A3L G;  5IYC H;  1B50 A;  4HCS A;  3HP3 A;  5EPJ A;  5C3E H;  1K73 C;  3VYR A;  1MD2 D;  4LW1 A;  1M4V A;  2IHF A;  4ZRZ A;  1D5Z C;  1DYQ A;  4JI6 Q;  4C2M B;  2JA8 H;  3I4N B;  2K14 A;  1Y69 U;  2NZH A;  3H3V C;  2AUJ D;  2B2W A;  3F2U A;  3GTJ H;  1VQJ A;  4R8N A;  3J81 c;  2RSO A;  2VXW A;  3CCV A;  3I4M H;  1PZI D;  1ZKO A;  2F0L A;  2K5D A;  2I07 B;  1TWH B;  4YCU A;  2B63 H;  2UUB Q;  5IP9 H;  1SNO A;  5C5M A;  1B3Q A;  3RN2 A;  1FD7 D;  2HDL A;  3GTQ B;  5K5P A;  2K4K A;  4XDX A;  1XPR A;  3CCU A;  2K05 A;  5C4X G;  2I46 A;  2IWH A;  4EQP A;  1STH A;  1ILQ A;  3PMF A;  5KYL A;  3K7A B;  1Q8I A;  4LF9 L;  1D5M C;  5K36 H;  4APV A;  2EE1 A;  2B2U C;  1JWS D;  2LFN A;  4KD3 A;  2EYJ A;  1C0A A;  3KYH C;  4NW2 A;  1ONL A;  4LF5 L;  4L63 B;  2NBF A;  3OMC A;  4LF6 L;  3NE5 B;  2RBM A;  2ZJR A;  3GTP H;  2WAQ B;  1PRT B;  4IUR A;  5BN5 A;  5M3M B;  4IZ8 A;  3L0O A;  2KEN A;  3T1Y Q;  5JAV A;  5KIX A;  1GUO A;  2HCC A;  1WCM H;  2I5H A;  4OEM B;  3SVM A;  5FLX c;  1VQG A;  2BOS A;  5C3E G;  1S5B D;  2UU9 Q;  2PNR C;  1M1K C;  4DV0 Q;  1A2T A;  3S14 H;  3HOV B;  1PH8 A;  4UAI A;  4J8Q A;  3NWT A;  4LNQ A;  2F0I A;  2VUM B;  1U5K A;  1BCP F;  4ZAI A;  1TT2 A;  3W3A A;  4IOC A;  4FXK C;  1W6J A;  4JI6 L;  5KNC A;  5JEA G;  1N36 Q;  2KHS A;  1YVC A;  3MAQ A;  4CBV A;  4A3D G;  2MO0 A;  5LMU Q;  4P74 A;  5M9O A;  1H9K A;  1UE5 A;  2K5N A;  2VY3 A;  5EKI A;  4BBR H;  4OX9 Q;  1G2T A;  3S2D B;  2Y0S B;  4WFN 3;  2E75 C;  2K75 A;  1JMC A;  3R2I A;  3PO2 B;  4O2D A;  1A6X A;  4MHE A;  1TY0 A;  3SE0 A;  1DON A;  1A62 A;  2UUB L;  2A6E D;  2QGQ A;  1KAA A;  1EY0 A;  1Y8O B;  1KNA A;  5HUR A;  4UP8 A;  3HOU G;  3J7A F;  1KDC A;  3GV6 A;  3DMU A;  3GTK B;  4A3G G;  4K2K A;  3H0G H;  1FNW A;  4ZYS A;  2YU9 H;  1E24 A;  2EVB A;  3R93 A;  5C4J B;  1Y8N B;  1AEX A;  1LAC A;  3SK4 A;  1HR0 W;  1WTP A;  1BVS A;  1KTK A;  4FF4 A; 
#chains in the Genus database with same CATH homology
 1NBW A;  4YWM A;  4GLA C;  3F2D A;  1Q46 A;  2HHH Q;  4BA2 I;  1HNZ Q;  2ALY B;  2UXC Q;  5IYD H;  3M4P A;  4C3I H;  4A3D H;  4LUO A;  4QY7 A;  1LM0 A;  4P71 A;  5LMN W;  5JJK A;  2ASB A;  1VQP A;  4DR7 L;  4R4I A;  2MFI A;  2R7Z H;  4POG A;  2PNH A;  5AJ3 Q;  3CCR A;  4JI4 L;  3RR5 A;  1VQ8 A;  2A8V A;  1BBW A;  1K8G A;  3HOY H;  1HNX L;  1DGS A;  1SE8 A;  1NMF A;  2Y0S G;  2RCN A;  1QUQ A;  1VQ4 A;  1Q82 C;  4LF7 Q;  2AKW B;  1RL2 A;  3U4Z A;  1R9T H;  1VS0 A;  1N33 L;  3HOZ G;  5JJI A;  4AYB E;  3BZC A;  4PG3 A;  3PO2 G;  2Q2H A;  1C9O A;  2ID0 A;  3PUX A;  5GAG C;  1SLJ A;  4A3B H;  4YHH L;  1EQR A;  3JAM c;  2MNA A;  4DAY B;  4DR4 Q;  3J80 i;  4A3J G;  3ULP A;  3FKI H;  1BBU A;  2D62 A;  5FLM H;  2F52 A;  4K0K L;  3L2P A;  3UDF A;  1E22 A;  1XMO L;  1IL2 A;  3Q8D A;  1Q86 C;  2Q2U A;  3HOU H;  1X3F A;  1QVG A;  2DGY A;  2N49 A;  4OON A;  4YCW A;  4DUZ Q;  1VQE A;  1N34 Q;  4DK3 C;  1AH9 A;  4A3G H;  1OXX K;  1TXY A;  3F8T A;  3PUY A;  4JBW A;  1WYD A;  2K5H A;  3OYY A;  1LUZ A;  3HOX G;  4A3M G;  3K80 C;  4A3K H;  1VQ7 A;  4A3E G;  2Q2T A;  2UU9 L;  4A76 A;  1X54 A;  1HNW Q;  3SGI A;  3J80 c;  1IZ6 A;  2PI2 E;  4DV0 L;  1VQ9 A;  3GTO H;  3S2H H;  2KHJ A;  3U4V A;  4IFD G;  3PIP A;  1X3G A;  1V1Q A;  2R7D A;  5C0X J;  2UUC L;  2PQA B;  1VQF A;  4WJ4 A;  2ZM6 Q;  2N3S A;  3CC7 A;  1HR0 L;  1IYJ B;  5GAD C;  4AH6 A;  1XPO A;  1VQO A;  3H15 A;  4DV4 Q;  4PZ7 A;  4UP9 A;  1P8L A;  5IT9 c;  3KJO A;  1FGU A;  2WAQ E;  4A3B G;  3D31 A;  1EUJ A;  5LMN L;  1N36 L;  1CKN A;  2K50 A;  2ZTD A;  1KD1 C;  2R93 G;  3S16 H;  3HOZ H;  4DV1 L;  3I2Z A;  5BR8 Q;  2VQE L;  4KHP Q;  5LMU L;  4DV2 Q;  3PUZ A;  3EBE A;  1H95 A;  3CME A;  3CD6 A;  2VL6 A;  1S40 A;  2OQK A;  5GAH C;  1OTC A;  3ICE A;  4OX9 L;  1J5E Q;  2KBN A;  1ASZ A;  4IFD I;  2LXJ A;  3PO3 G;  1G29 1;  3ER0 A;  1XNR L;  3UDG A;  2N78 A;  2KCT A;  1AE3 A;  2UXD L;  2R7F A;  4LFC L;  3K81 C;  1PA6 A;  5E7N A;  1EQQ A;  1X65 A;  3NEN A;  1O7I A;  4FDB A;  3HOX H;  4A3M H;  1PH3 A;  1VQH A;  4IPG A;  4A3E H;  5C44 G;  4X66 L;  3KF8 B;  1XMQ Q;  4JI7 Q;  4EX5 A;  3I56 A;  4YWL A;  4HJ9 A;  3S1R H;  2E5L L;  2A1A A;  5IY0 A;  4WJ3 M;  3CW2 C;  4B3S Q;  1GM5 A;  2K5V A;  2YTX A;  4B3T Q;  2I0Q A;  2WB1 E;  4C3H H;  4GN3 B;  4IOA A;  3S24 A;  1CKN B;  4XTC S;  4DR2 Q;  2D0O A;  4A3C G;  5IYD G;  3TRE A;  1EWI A;  1J6Q A;  3PSI A;  1L2F A;  1RIP A;  3CP0 A;  4PZ8 A;  4TVA B;  5M5X H;  2HHH L;  3TS2 A;  2R93 H;  4OO1 G;  1HNZ L;  2UXC L;  4DUY Q;  2R7Z G;  1D7Q A;  4DNI A;  4QGU A;  3M9B A;  4HIO A;  5GAE C;  3CCL A;  3HOY G;  1A0I A;  2CWA A;  4J15 A;  5AJ3 L;  1TWG H;  1NY4 A;  4JCV E;  2QA4 A;  4AQY Q;  3T1H Q;  3PO3 H;  3E9I A;  3OW2 A;  1VQ5 A;  1QVF A;  1VQC A;  4GLV B;  2IX1 A;  3STB D;  1AE2 A;  2VQF Q;  3CF5 A;  2XGT A;  1PH4 A;  1LYL A;  2IX0 A;  4DR4 L;  3K7U C;  3ERS X;  1MKH A;  5H1S E;  1K0R A;  3F1Z A;  5C44 H;  4ALP A;  4OO1 I;  1FL0 A;  1TWC H;  3HKS A;  3JC6 6;  1T9H A;  3RZD H;  3KLW A;  1S3O A;  3A0J A;  2ZJP A;  4BA1 I;  1N34 L;  5HY6 A;  1MIU A;  4JG2 A;  1N9W A;  2ZTE A;  2I5M X;  4Y7N H;  1M90 C;  1WI5 A;  4DV6 Q;  1HNW L;  3E0E A;  4HIM A;  3W5O A;  4A3C H;  4L5S A;  1IBK Q;  4A93 G;  4NXN Q;  2JJQ A;  4YCV A;  3G4S A;  1VQI A;  3ULL A;  5C0X G;  4A3I G;  1IBL Q;  2F4V Q;  4KLK A;  2A19 A;  5ELN A;  3JAM i;  3BZK A;  3AFQ A;  4KHZ A;  2WP8 J;  4DK6 C;  3A74 A;  4LUV A;  1V9P A;  2CCZ A;  3W1G A;  5GRO A;  1PH7 A;  1N32 Q;  3TS0 A;  1I3Q H;  5JJL A;  4BY7 G;  3L7Z C;  1KRS A;  2HQL A;  2JA7 G;  3RLF A;  4POF A;  2IY5 B;  2I5L X;  2YTV A;  2BH2 A;  2HT1 A;  1PYS B;  5BR8 L;  1EYG A;  4KHP L;  2GVB A;  1MJC A;  3T1Y L;  4DV2 L;  1PH5 A;  3FHW A;  1PYB A;  1K8A C;  2PI2 A;  5FJ8 G;  2LXK A;  5M5W H;  4B3M Q;  2LSS A;  1FJG Q;  1JJC B;  4JC0 A;  4OXP A;  2YTY A;  1L0W A;  5C0X I;  2JEA I;  3GTL H;  3W1B A;  1UE7 A;  1PH1 A;  1PH9 A;  4LF4 Q;  3EIV A;  2BA1 A;  1X3E A;  1JB7 A;  4JI3 Q;  4NB3 A;  2OTJ A;  3VDY A;  3S1M H;  2H5X A;  5IYB H;  2EXD A;  4JBK A;  2FXQ A;  2UUA Q;  4A3L H;  1XTD A;  1X56 A;  1XNQ Q;  1KRT A;  3MEF A;  1D8L A;  1YNX A;  1SMX A;  3PV0 A;  1UEB A;  1L1O A;  1JJ2 A;  1Y1W G;  1XMQ L;  3TEH B;  3KFU A;  4JI7 L;  4A93 H;  1JT8 A;  5EAY A;  4A3F G;  4A3I H;  4B3S L;  4OWX B;  2JQO A;  4R4C A;  2ZTC A;  1W2B A;  4BXX G;  3AYH B;  2Z6K A;  3S1N H;  1QUQ B;  3OTO Q;  3CCJ A;  4HJ7 A;  4QQB X;  1SR3 A;  4XIG S;  3UDI A;  4BY7 H;  3HOW G;  1YEZ A;  2MO1 A;  2B29 A;  2JA5 G;  1NTG A;  3B6Y A;  3CAM A;  2JA7 H;  4UY8 C;  1CUK A;  1Q1E A;  2XTI A;  3AFP A;  4R4T A;  4DUY L;  4HJ5 A;  4HJ8 A;  4C3J H;  3KDF A;  4X64 Q;  2C35 B;  2AHO B;  3K8A A;  4DR7 Q;  5FJ8 H;  4JI1 L;  1YJ9 A;  1PH2 A;  3NEM A;  1VQL A;  4X6A H;  1FVI A;  3RZO H;  4AQY L;  1OXT A;  5J3B A;  4IO9 A;  4DV7 Q;  3CC4 A;  1VQN A;  4LUZ A;  4GLX A;  4JYA Q;  1N33 Q;  2ZJQ A;  2NVT H;  2HIV A;  3CCE A;  2L15 A;  1Z47 A;  4LFA Q;  4EQ5 A;  2VQF L;  3CC2 A;  3S15 H;  4BBS G;  3G48 A;  5IP7 G;  3H3V I;  4AYB G;  1L1O B;  3M85 A;  1VQ6 A;  4TQU S;  1K83 H;  1UWV A;  1TWF H;  2D0P A;  2QEX A;  4NXM Q;  4DR5 Q;  1PFS A;  1Y1W H;  1L1O C;  4MZ9 A;  5IYC G;  3IRB A;  3HKZ E;  4BY1 G;  4A3F H;  4R4Q A;  3AEV A;  3TRZ A;  4DR6 Q;  3F2C A;  5C4X H;  1HZA A;  4BXX H;  3RN5 A;  2GVA A;  1U0L A;  3UDX A;  2YYZ A;  3DM3 A;  3AQQ A;  4LF9 Q;  2EQS A;  2Z6K C;  4DV6 L;  1B8A A;  1PHJ A;  3HOW H;  3LGJ A;  3UE1 A;  1E7Z A;  2K52 A;  4GNX A;  2JA5 H;  2F3I A;  4C2M H;  2MQH A;  1Q12 A;  3H3V H;  2N8N A;  1IBK L;  3GTM H;  2GN5 A;  4B3R Q;  1HZB A;  3KDF B;  3GD7 A;  4NXN L;  4DKA C;  3I4N H;  3K0X A;  4RG1 A;  4X62 Q;  4JI2 Q;  1IBL L;  2F4V L;  1Q7Y C;  3WWV A;  4LF5 Q;  1E3P A;  4JV5 Q;  3E9H A;  3J7A 5;  3F2B A;  2Y0S E;  2YV5 A;  1Q1B A;  4DV3 Q;  1PH6 A;  4LF6 Q;  1PVO A;  2JA8 G;  1YJW A;  3M3Y H;  1GO3 E;  1SRO A;  1OXU A;  2V1C C;  1KHI A;  4LF7 L;  1HZC A;  2Z0S A;  2E8G A;  3A5U A;  4L5Q A;  1XJV A;  1V43 A;  1NE3 A;  1WJJ A;  1Y1V G;  2BH8 A;  2IHE A;  2WAQ G;  3BU2 A;  3U50 C;  4PZ6 A;  3I4M G;  3GO5 A;  4BBS H;  3RNU A;  4HIK A;  4HID A;  1S72 A;  2OCE A;  5IP7 H;  1YHA A;  3PUW A;  1WOC A;  4LWC A;  2NZO A;  4B3M L;  3S17 H;  3NEL A;  1FJG L;  1CSP A;  4UPA A;  3ULJ A;  1KL9 A;  4AIM A;  5IYB G;  4LF4 L;  4DUZ L;  4A3L G;  2AWO A;  3PCO B;  5IYC H;  4JI3 L;  2B63 G;  1KAW A;  4BY1 H;  5M3F G;  2UXD Q;  2UUA L;  4JI8 Q;  5IP9 G;  1EOV A;  2VW9 A;  1XNQ L;  3EN2 A;  5C3E H;  3KJP A;  4GNX B;  1K73 C;  2NN6 I;  3MXN B;  3K7A H;  1I94 Q;  4A4I A;  4A75 A;  1LTL A;  4IPH A;  4Y52 H;  2RHS B;  4LW1 A;  2IHF A;  5DLQ E;  2ZM6 L;  2E5L Q;  1P16 A;  1I5F A;  2CFM A;  4OWT B;  1VQD A;  4UP7 A;  3NBH B;  1N8R C;  4DV4 L;  1WFQ A;  4P73 A;  4DR1 Q;  2UXB Q;  4JI6 Q;  5K36 G;  2JA8 H;  4R1J A;  4LF8 Q;  4LFB Q;  1W3S A;  5JEA J;  2AWN A;  2K14 A;  2WB1 G;  2NZH A;  3ZJY C;  5IWA Q;  3BJU A;  3CCQ A;  1G51 A;  1OXS C;  3M4O H;  4GKK Q;  4X65 Q;  5GQO A;  3PUV A;  4R4O A;  2HIX A;  1X6O A;  1B70 B;  3GTJ H;  4DV5 Q;  2OTL A;  1Y1V H;  2NVQ H;  1VQJ A;  3J81 c;  2VZA A;  3GDE A;  4X64 L;  5M3M H;  3CCV A;  1J5E L;  2JA6 H;  2R92 G;  4JI5 Q;  3I4O A;  3I4M H;  2PQA A;  2RF4 A;  2WFW A;  1I50 H;  2E2I H;  1UE1 A;  2VS1 A;  4DV7 L;  1E1O A;  1CKO A;  4H02 A;  1HZ9 A;  4P75 A;  4YCU A;  1CKM A;  2CQO A;  2B63 H;  1GD7 A;  1NMG A;  1C7Y A;  4JYA L;  1Z9F A;  4KI0 A;  5M3F H;  2EIF A;  3J81 j;  2UUB Q;  2ES2 A;  5IP9 H;  4LFA L;  4O0A A;  1HJP A;  1VCI A;  4DR3 Q;  1SFO H;  3RN2 A;  1IBM Q;  1WCM G;  4GKJ Q;  4DPG A;  4YY3 Q;  2JK8 A;  2K4K A;  1XPR A;  3CCU A;  1SN8 A;  4DR5 L;  2JE6 I;  4NXM L;  5C4X G;  3HOV H;  1KQS A;  4JI0 Q;  4DR6 L;  4B3T L;  2IT1 A;  1VQA A;  4PMW A;  3UE0 A;  1ASY A;  2VUM H;  1KC8 C;  5M5Y H;  2OWO A;  4DR2 L;  3TQY A;  4IPC A;  4NPS A;  1B7Y B;  2JA9 A;  3KOJ A;  1EIY B;  4APV A;  4LF9 L;  3GTG H;  3I4N G;  1Q81 C;  4JOI A;  1C0A A;  3A5Z B;  3M4Q A;  3KYH C;  4B3R L;  4X62 L;  1GKH A;  3PF5 A;  4JI2 L;  3DLL A;  1YZ6 A;  4LF5 L;  4JV5 L;  2R92 H;  4JI4 Q;  4HJA A;  4LF6 L;  4DV3 L;  3T1H L;  2NVX H;  1HNX Q;  2ZJR A;  3GTP H;  3I55 A;  3S1Q H;  3KF6 A;  1KIX A;  1GVP A;  3S2D H;  4GOP A;  2ATW A;  3L0O A;  2KEN A;  4GS3 A;  3M7N A;  4IPD A;  4YHH Q;  1K3R A;  3T1Y Q;  1EFW A;  1I6H H;  4P72 A;  4BBR G;  4JBM A;  3PO2 H;  2KHI A;  1WCM H;  4K0K Q;  3G6E A;  2I5H A;  4A3J H;  1XMO Q;  3U58 A;  3CPW A;  2DUD A;  3I7F A;  1QVC A;  4ME3 A;  5FLX c;  2CKZ B;  1YJN A;  1VQG A;  1BKB A;  1JJG A;  2E2H H;  5C3E G;  3D0F A;  2B3G A;  2Q2I A;  2UU9 Q;  4JI8 L;  3GTK H;  4GN5 A;  1M1K C;  1HH2 P;  2R6G A;  3J7Z C;  4DV0 Q;  3S14 H;  1VQB A;  1G6P A;  1PH8 A;  5C4J H;  1TWA H;  4IFD J;  4MNO A;  5IE8 A;  1I94 L;  2RHQ B;  2BA0 A;  1SRU A;  2UUC Q;  4JOI C;  4LNQ A;  1U5K A;  1MJE A;  1YHB A;  1HR0 Q;  3HFZ B;  1YI2 A;  3H0G G;  1QZH A;  2NVY H;  1EIF A;  1X55 A;  4IOC A;  1YIT A;  2E2J H;  2PMZ E;  1YHQ A;  4DR1 L;  2UXB L;  3RLN A;  4IJH A;  4JI6 L;  5JEA G;  4LF8 L;  3KF6 B;  4LFB L;  1CSQ A;  3CCM A;  1YVC A;  2NN6 G;  3CPF A;  5LMN Q;  5HGQ A;  3G71 A;  4GOP B;  1N36 Q;  4DV1 Q;  5IWA L;  1NJI C;  2VQE Q;  2MO0 A;  4A3D G;  4GKK L;  5LMU Q;  4P74 A;  4X65 L;  1TWH H;  5M3M G;  4GN4 B;  4DV5 L;  2JA6 G;  1UE5 A;  4GOP C;  1VQM A;  2K5N A;  1UE6 A;  2VY3 A;  4L5T A;  2AMC B;  3CQZ H;  4BBR H;  2JEB I;  4OX9 Q;  4QL5 A;  1A8V A;  4JI5 L;  1QZG A;  1K9M C;  4JI1 Q;  3STB C;  3CXC A;  1N32 L;  1KXL A;  1Q8K A;  2OQ0 A;  3CCS A;  1XNR Q;  4MTN A;  1PV4 A;  1A63 A;  2CWP A;  3GTQ H;  2K75 A;  2KCM A;  3PGZ A;  4IJL A;  1JMC A;  3FP9 A;  4O2D A;  1YIJ A;  4LFC Q;  1E1T A;  1VQK A;  1A62 A;  2VNU D;  4JBJ A;  2UUB L;  4QJF A;  1YBY A;  2QGQ A;  3CMA A;  3FKI G;  5FLM G;  4X66 Q;  4GNX C;  1OXV A;  4DR3 L;  1IBM L;  3HOV G;  1JE5 A;  4GKJ L;  1IXR A;  4YY3 L;  3J81 i;  4UP8 A;  3HOU G;  1X9N A;  2VUM G;  4DAM A;  1Y14 B;  3RLO A;  4JI0 L;  4A3G G;  4L5R C;  3H0G H;  3OTO L;  3PF4 A;  3PIO A;  4RMF A;  4QIW E;  2YU9 H;  1E24 A;  4A3K G;  1XPU A;  3HKZ G;  1HR0 W;  5ELO A;  1BVS A;  4YWK A;  4OWW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...