2WKDA

Crystal structure of a double ile-to-met mutant of protein orf34 from lactococcus phage p2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
79
Chain Sequence
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEVKVAYGSAFMPDFIQMGDTVTVSGRVQAKNYNFVFPTVEKVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ORF34P2
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
total genus 10
structure length 79
sequence length 89
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkdA00
2WKCA 2WKDA
chains in the Genus database with same CATH superfamily
2FINB 3CQZH 4BY1G 4AIMA 2TSSA 4V0BA 3KLSA 4A76A 3OWEB 1CI3M 3G6JB 1CSPA 1Q8KA 1RD9D 1B3AA 1EEFD 1Q3LA 2ZXRA 1QNUA 1NMGA 1IYUA 4A3MH 4L8JA 2XRQD 3UDGA 4AYBB 1EU4A 1KAWA 4CDFC 1LLRD 1K3BC 5FJ8G 4F8MA 2F0VA 4UPAA 3QJYA 1HA6A 4OIKA 1GM5A 3RR5A 5I6YA 2I46A 1PYSB 4YHHL 4EX5A 4QUCA 5JEAG 4WJ4A 1GUTA 4BBRH 2Z4HA 3CRLC 3E5SA 1CT1D 1MGSA 1RODA 4LJZC 3T1YL 2QGQA 3HOXG 5CBEE 1L1OB 3EA6A 2OTLA 3M7NA 3X3MA 4OO1H 3S2HB 1N33L 1TWGH 1X56A 4UAIA 4JI2L 2EJFC 4A93G 1KIXA 1PDQA 2YYZA 2ENBA 5IOCA 2A1AA 4DF7A 3IRBA 3U4ZA 1DOMA 5FO8B 4QL5A 3QG1A 3PUXA 2LS01 1T5XD 5AJ3Q 3R93A 1TT2A 4KJNA 2L5TA 3HRZC 4K8JA 4F88A 2NVXB 1PTOD 5IYDG 4B08A 2F0HA 1KC8C 1UAPA 3G7LA 1WCMG 3J80L 5M3FG 3CU7A 2AWOA 1D2BA 2DY7A 3HOZH 1YHBA 5C3EB 4KKSA 1K0SA 3KBGA 2PZTA 3TP5A 1IL2A 3C1FA 4O42A 1E7ZA 4ZUIA 3OTOQ 4DR2L 4LW1A 3GDEA 3OMCA 1VQJA 2FXQA 4A3IB 1BNZA 2CWAA 1XMQL 5CV4A 4POFA 2UXCL 2K7VA 3N6RA 4KV6A 4RAUC 2NVTH 1MBYA 1EQVA 1Q1BA 2L11A 4LF4Q 1SLJA 2E2JB 2FJ2A 3U4VA 2ZM6L 4C3IB 3KF6A 3KOJA 1VQGA 2F0SA 4JI5Q 1Z47A 2WAQE 4NXML 1HR0Q 4A3GB 1SE2A 2B2YC 4JI4Q 4LF8Q 4A3JB 3U9OA 4JBJA 4JOIC 1EWCA 2NB0A 3ULLA 1CK1A 2Z8LA 4A3EG 2QW7A 4BBSB 4HIOA 4DR5Q 2Q2UA 4UY8C 2HQLA 4DR4L 3A74A 1IBLL 2A6ED 3TP6A 4IOCA 1BKBA 1CFMA 2K5NA 3I7FA 4BXXH 2EYHA 4A3BB 1SYCA 4HMJA 1TWFH 4DV2L 1JE4A 4DNTB 1R9TH 1H95A 1V1PB 5IODA 2L0CA 4LF7L 3I4LA 4DR1L 1F2LA 2I07B 3H6MA 5KIXA 1X6OA 1PRTF 4P73A 3H91A 1NMFA 5IP7G 1LTRD 3VYRA 2L55A 2Q2TA 1SEBD 1PFSA 3TZDA 1NR2A 1VF5C 2RA4A 3HOYG 4JI3Q 3PO2G 4MHEA 2X6LA 2B2YA 4KD4A 1QILA 1TU2B 2HDMA 2JQOA 5KRUA 4JOIA 5I2YA 3CCVA 4JYAL 2ZJRA 4GNXC 3MTSA 2UU9L 4GLAC 2AUKA 5KEEA 3L9AX 4APVA 3AFPA 1Y1WH 4A3FG 3FKIH 1E2WA 1PYBA 2B8GA 3VDYA 4QJFA 4JV5Q 3D6WA 1WYDA 4KK7A 5D3IB 1M8AA 2KEDA 4EQ5A 4MZ9A 3TREA 1K9MC 4YWMA 3J81j 2NN6H 3M3YH 2YTXA 4BY1H 4DK6C 2K03A 3NELA 3I2ZA 3TN2A 1PFNA 1GVPA 3H0GB 1EWHA 4Y7NB 2NVQH 2EYJA 4RG1A 4ODGA 1L2FA 2NTTA 3VR3A 2R7FA 1X55A 5FJ8H 1LM0A 3CCQA 2XTIA 4NXNL 5D3DA 1BVSA 1CM9A 2EY5A 3NQIA 1I94L 2EZVA 3S1NB 1F9PA 1U4PA 1HNZQ 2NVYB 3BYTB 5JEAH 4GNXA 3TZUA 1SE8A 2EJGC 1XMOQ 3S1MH 1W2BA 2NZ1D 5DM73 2ZJQA 4OXPA 1T9HA 3HOXH 3KLSX 2XWJB 5C44H 2LY7A 1SNQA 3SVMA 4A3DG 5HY6A 1QB5D 5C4JB 4KD3A 5C0XG 3JAMc 4A93H 1H9JA 2UUCQ 1XWEA 2R93B 4R4CA 3A5ZB 2E2HB 1RDPD 3Q8DA 1SYEA 1SYFA 3HGBA 2F0IA 2WFWA 3MHBA 3HOVH 1VQ6A 2K05A 4N8X1 4RKLA 3DWAA 5IYDH 4DV4L 3OPOA 1VQIA 4H13C 1WCMH 3DEOA 1QCBD 1DJRD 5M3FH 4HEDA 2ATWA 5LHY1 1TWAH 3GO5A 4H44C 2LSSA 1KL9A 4FVMA 5LL6X 1STBA 3RUZA 1JORA 1YEZA 5C5MA 5EBCA 1J5EQ 2VW9A 3NENA 5M3MH 4LF6L 1SBBB 3PF4A 4GKKQ 2IY5B 1MSHA 1X32A 4B3RL 1N34L 1AP0A 1GKHA 2MQHA 2FHTA 1UEAB 2CKZB 5H1SE 2F3VA 1B8AA 1EY6A 5J3BA 5M5YH 1PH4A 1BBUA 1X3EA 4P2CB 2CVRA 3TP7A 4DNRB 2EXDA 4X64Q 2VQFL 4H7BA 2RHSB 3BDOA 1DCZA 2KEEA 2ZTEA 4DK3C 4DR3Q 3VYUA 3BZKA 5K36G 1SMXA 1X3FA 1VQMA 1PH2A 1A3VA 3I72A 4MTKA 1TXYA 3STBD 3ERSX 2EE1A 4DUZQ 4IUUA 5FLMH 1VQPA 1MSGA 3CD6A 1K28A 4A3EH 4ME3A 1I4HA 2WB1B 2MUYA 4L5QA 2CH4W 5I9PA 3GTLB 1B1ZA 3KBXA 3QB3A 1SAPA 2PQAA 3BJUA 1OXSC 1EOVA 3CPFA 3MXNA 3ULJA 1X9NA 5CR3A 2JA8B 1H9MA 1G2SA 3WWVA 2GA4B 1O7ZA 2DY8A 4HAEA 1VQOA 2A68C 4C56C 1TY2A 2XN9C 4F7XA 4DV3Q 4RGNA 3HOYH 2UXDQ 1IZ6A 3CCMA 1WI5A 4P72A 4FP5D 2CQAA 3D6CA 1HPCA 3VR4A 4YCUA 1C7YA 1AW7A 3S16H 2WINB 1II3A 4IUVA 2HUGA 5EPLA 3NBHA 2CCZA 1FNVA 1AZQA 3C2PA 3UDXA 4BY7G 1PRTC 4MTNA 3GTPB 3SK4A 4A3FH 1EY5A 2MP1A 1HTPA 1PH8A 1V1OA 4PZ6A 1PZKD 3HZXA 2IW3A 1SDFA 1OXXK 2G9DA 1NNXA 4KN7C 2LXJA 3F2UA 1D5ZC 1XNQQ 1WTWA 3C46A 3D31A 2QEXA 5EGTA 2HIXA 1JJ2A 2RDGA 4WORA 4IO9A 1EYAA 5IY0A 1EFID 4K5XA 4ZKBB 1GOZA 1VS0A 1VQNA 3NK9A 4HJAA 3AMUA 3ICEA 2A8VA 3J81i 3V96A 1S5DD 5FLXE 2HIVA 3GV6A 4ZLTF 1I6HB 3Q24A 4A3MG 2VUMH 4R1JA 5IWAQ 5C3EH 2R92B 1LT5D 1K8AC 3NEMA 3PUZA 3SXHA 3DHQA 4KKUA 5DNFA 2XNAC 2SNMA 2R3ZA 2QA4A 1DZ1A 3BDLA 3C3LA 1PXUA 1YNNC 2K5DA 1WOCA 4X65Q 3SGIA 1KDAA 1HNXQ 1HA5A 1SRUA 2YV5A 1ENFA 4DV6Q 2HQEA 3BZCA 2O4XA 3DXJC 4A3DH 4HSVA 1JE5A 3PIPA 5C0XH 3PUYA 1PZID 1TKWB 4J8QA 1KRSA 5C4XG 2HT1A 4A3KG 1EYGA 2K1BA 2MO0A 1SYBA 4GZYC 4UP9A 3OSOA 3RZOB 4A3CG 1E1TA 4RWSC 1I4XA 4C3IH 1XJVA 1CKNB 4QF4A 2JK8A 1Q86C 4JI6Q 4C3JG 4OX9L 3F8TA 4A3GH 1EUJA 2LFNA 2GVBA 1ET9A 3M4OH 5I6WA 2PQEA 2NZHA 2QKIC 4FF3A 3T53B 1SYGA 4K5WA 3PIOA 3K0YA 3TEHB 4IPGA 3GTJB 3MEFA 2Y0SG 1N8RC 1B2TA 5GROA 4NW2A 3QOJA 1E24A 3MFYA 4A3BH 1XTDA 4B3ML 1UE5A 5IT9E 3T56B 3A8JE 4JC0A 3HOZG 1QVGA 2OQ0A 3LWUA 4LFCL 1STHA 4R4OA 4E6IA 1A15A 1IYVA 1S5ED 1JJCB 1A3TA 4YCWA 2G5DA 3I91A 1F77A 3TBIB 3AB9A 5F2DA 4JI0Q 1SNCA 3TS0A 2PNHA 4IFDJ 1EY9A 4PMCA 3L0OA 2UUAQ 3JC66 1KLGD 3CCLA 3AU7A 5BN3A 3KUPA 3TP8A 3J7ZC 2XGTA 3I90A 4F87A 3KF6B 1LO5D 3NSWA 3BU2A 2F3WA 4FDBA 3VA5A 1VQ5A 3J7AV 1TS4A 4N9TA 2Z0SA 5J39A 2K04A 4IPHA 2F0FA 3H3VH 1K83B 2VS1A 2IT1A 4IZ8A 5EQ0A 2F4VL 4QUFA 1ML0D 2A6HC 2B63B 4CDDC 4BXXG 2R7DA 1G291 1QVCA 2K33A 1W3SA 4DV5L 3FPUB 3J80E 2PNRC 2VY3A 4XT3B 3GTGH 1Y1VB 5IYCH 2K14A 3E9HA 3K6OA 2PI2E 4HSPA 1BBWA 4BS9A 4X66L 4BWGB 1ESFA 2X69A 2MHVA 3PF5A 3S1NH 3HKZE 1L0XB 4DAYA 2NVYH 3S17H 3NP8A 2EJMA 1YITA 1LT6D 3FDTA 2HDLA 3A7LA 3HOWG 2SOBA 3A0JA 4DA2A 3DEPA 4U68A 1KAAA 2WKDA 3CCEA 3T1HQ 4YY3L 4DV1Q 1PA6A 1EYCA 1Y1WG 1B70B 1NR4A 3FKIG 1NBWA 3CP0A 3NQTA 5ELFA 3ZYYX 4OL7A 2KECA 2A69D 1EEID 4IN3A 2NN6G 2ZTCA 1IKLA 2MNAA 1SXTA 4LNQA 4KHPL 1JB7A 2B2TC 1L0YB 1J6QA 3W1GA 2UUBL 4NPSA 2CW0C 2EIFA 4HMIA 4L5RC 4KKTA 2FMCA 3KF8A 3DUZA 3P20A 4LUZA 2XRSD 3VR6A 2F52A 1XX8A 1DD2A 4IALA 3SHLA 1CHPD 1I50B 5JJZA 1GHKA 4GNXB 1O7LA 1IL8A 1L0WA 4K8IA 1HUNA 3K7AB 3NHHA 2VQEQ 4TQUS 3DLLA 3GTQB 1JC7A 2KBNA 2JA7B 1Q8IA 3J7A5 5C44G 4ID6A 3OYYA 3FPPA 1A63A 1XNRL 5C4XH 1SNPA 3W5OA 4A3KH 2QEJC 2E5LL 5G3LF 5COYA 1B7YB 4DR7L 4A3CH 3U50C 2F0DA 1OXUA 1QNKA 4C3JH 1QVFA 4A3LH 2B2TA 2P5ZX 3SDZA 1LTID 1KQSA 4DV7L 1VQ9A 4IFDI 3HOVG 2J7ZA 2G9HD 4EQOA 3TMEA 5LL6S 4RHRA 1SNMA 2YTYA 2KHIA 3H09A 2PZUA 2IX3A 1QZHA 5CORA 2PZWA 3K58A 2KCMA 1PTOH 3T4AC 3GTOB 3I4NB 1BCPB 3PV0A 1X3PA 2NUCA 1N32L 4XIGS 1KDBA 3PSIA 2BDNA 4CJ0B 1U4RA 5M3MG 2M2LA 5I4DA 3I4MB 2Z9HA 4B3TQ 2E2IH 4IPDA 4K0KQ 4X62Q 5JVH3 4K2LA 3F2DA 3MFGA 3GP7A 1S40A 1MJEA 1BDOA 3FRPB 1SNOA 1VF7A 4KI0A 3SEBA 5IP9G 5LMNQ 4Q0FA 2EOTA 2QF7A 3GTPH 5FLMG 1VMPA 2PW7A 2RKSA 5M5XB 4C2MH 5JOBA 3C1EA 3NTIA 2DJFC 2KUMA 5AFWA 5D65A 3D3RA 3Q0AA 1E2ZA 4JI1L 3M9BA 4KY5A 3OMGA 4JI7L 4LK1C 4R8NA 5NUCA 1XPOA 2HCCA 1E3PA 1IBML 2K75A 3GTKH 5ELEA 3MEHA 2JA6B 1P16A 1VQKA 5KNDA 3ITPA 3ULPA 2B2UC 5JPMC 1NTGA 1EZ6A 2RCFA 1I6HH 4P74A 1YNXA 4IJHA 1BQQT 3M4YA 4AYBG 1QOHA 2ICIA 3VYSA 4L63B 3E0JA 1F2MA 4DV0L 1PFMA 4LF5L 1TIID 3R3OA 1I3QB 3IKJA 3I70A 3QR8A 5BR8Q 4XQJA 4ABNA 1SROA 4B9XA 1MHWC 1SMYD 1Q12A 4JI8Q 1QZGA 3HOWH 1NUCA 3OW2A 3E9IA 3KDFA 3NBHB 3RLOA 1HZAA 1TWHH 3K5MA 2AUJD 3M4QA 4C3HB 3CC7A 1Q7YC 4JK1C 2A5HA 5T1IA 5M5WB 2EPBA 3S1RB 3GTMB 4Z9CB 4ZCKA 1U4LA 3SR1A 1K3RA 4DR6L 2NYZD 2L12A 3BDCA 4J15A 3K81C 1FVIA 1WD0A 1V9PA 1FR3A 2B2UA 2Q8IB 3HOUB 4DK1A 1T5EA 2EYPA 4AQYQ 1LTLA 1TS5A 1GUSA 5HGTA 2XVSA 4FYDA 3MAQA 4IUNA 2Q2HA 4LFAQ 3A7AB 1WTXA 3OWFA 4DUYQ 2EYFA 1D7QA 1TWCH 4IUTA 4XT1B 1OXTA 3JAME 2VUMG 2OF1A 1YZ6A 2F0QA 4QB4A 3PO3B 3W1BA 5A2QE 5C3EG 1G6PA 3AYHB 2AMCB 2HHHQ 3S14H 1IBKQ 1JR0D 4KLKA 3NE5B 1DOKA 2OXPA 1SE3A 5T1GA 2SEBD 4A3IG 4PV1C 3CXCA 1X3GA 2JA9A 2ZXOA 3Q23A 1N36L 1SNDA 3RZDH 3D4DA 1PH1A 2O5JC 3A8KE 5JPNC 1GD7A 3OIQA 1UE7A 4B3SQ 2EY6A 1EQRA 4K14A 2CFMA 1KTKA 1KHIA 1HZ9A 2C35B 5KYIA 1RJTA 1STGA 1Q82C 3A56A 3MA2B 4GKJL 4FXGC 4C3IG 2IJ0A 1VQCA 3MZ5A 5FOBB 4NKLA 4A3GG 4DAVA 1GHJA 1Q81C 3KFUA 5CC4A 3K5NA 4A3JG 5IGBA 3AFQA 3CCSA 3CPWA 1DOLA 4CKEA 1JQYD 1NCVA 4BBSG 1GUOA 1IYJB 3P7JA 4OHJA 2F0MA 4MNOA 2CH4A 1EOTA 1A3UA 1FJGL 3TRZA 2KHJA 3WOFA 4DNIA 3FEWX 2B63H 2BE5C 5E7NA 3EROA 5EKKA 4A3BG 3CQZB 1ASYA 2F1MA 2ZT9C 1W6JA 2PCFB 1PTOF 5LMUL 2JEBI 4LF9Q 2WKCA 5E4WC 2D0OA 3F2CA 4LFBQ 3J7AF 3H15A 1EY4A 1HNWQ 4K6LA 4XYQA 3M85A 2F0EA 4WFN3 2F0GA 1VQFA 1JCKB 2JN4A 1Z7TA 5BN4A 1CZWA 4XQQA 3ND8A 1JWSD 1JT8A 4JBWA 4K6DA 2B2WA 3LNNA 4HN7A 5IP9H 4OONA 2O5IC 2K01A 5JVG3 4BBRB 2MJ8A 1HH2P 1Q90A 1MKHA 1PH3A 4P71A 2Z4IA 2N49A 2AHOB 2AKWB 3JAMi 1TWGB 2EYMA 2JEAI 4KJOA 2NTSA 2PYKA 3NBIA 3L2PA 1IW7C 1QE6A 1B53A 1E2VA 1FNWA 1UE1A 3MXUA 4H0LC 2WACA 2J0TD 3S9WA 1ZKOA 1WJJA 2BDOA 3CRKC 3GV3A 3H94A 4FF1A 2K28A 3RMHA 3H0GG 3OHXC 3CAMA 1Z6HA 3J81c 2KHSA 4YHHQ 5IYCG 2EY2A 4LUOA 2CHBD 2JSOA 3AEVA 1PZJD 3CMAA 1PYWD 2N3SA 5AJ3L 2JJQA 3T1YQ 2KCCA 4S3SA 3H3VC 3G4SA 4O0AA 1A8VA 4EGVA 3S1QB 1VQBA 4DAYB 2NZOA 1N33Q 4JI2Q 1YNJD 3K7AH 5GQOA 4YWLA 3SK8A 1YVCA 4OWWB 4FXKC 2IHFA 4G4KA 1O7IA 1CQVA 4KN4C 4R4QA 3W3AA 2O2LD 4GN3B 3QO2A 5JJKA 3S2HH 3W2DA 1F2ZA 3OTOL 2NVTB 2R93G 4GOPC 3UDIA 3ONAB 1RCVD 2K52A 3HKZB 1X3QA 5CBAE 1RF2D 4R4IA 3SE0A 1FGBD 3OOCA 1CA5A 2RF4A 4HIMA 3CMEA 4IJLA 4LF4L 2NVXH 2RDFA 2EDGA 2V4DA 4MN3A 2V1CC 3T13A 1VMCA 1BCPD 4DR2Q 4CKBA 4A75A 1VQHA 2X6GA 1VQ4A 4X6AH 4JI5L 3KF8B 2Q2IA 1HR0L 4LF8L 1XMQQ 4JI4L 3AQQA 3LWEA 3GTOH 2UXCQ 2EYOA 2AQ3B 1TWFB 4DAPA 1R9TB 4DR5L 3E3XA 2Q8TA 4LMQD 4UP7A 1PLFA 4A3IH 5EPJA 5M9OA 3I4MH 2ZM6Q 4QMGA 4GOPA 4HIDA 1ONLA 3HFZB 1VQ7A 4NXMQ 1IKMA 3IFDA 5GADC 1JOOA 1AE2A 3RN2A 2EQSA 1N9WA 2E2JH 3WOEA 4DPGA 2QCPX 2PMZE 2JA5B 3J81L 2MO1A 2KQ3A 3HS0C 2L1BA 5IYBH 4A3LG 2JP1A 4DR4Q 3BVZA 1CUKA 1JWMD 1IBLQ 1BOSA 1G8ZD 1I4QA 4A3JH 2R7ZB 4I7AA 1ILQA 1HUMA 1YBYA 2E74C 2IHEA 1WTQA 2KENA 4DV2Q 1HFNA 2FFKB 4QY7A 4BBSH 4JCVE 2WB1G 4C1NK 4RHSA 1J9OA 4LF7Q 4DR1Q 3PCOB 3NTHA 1V43A 4CGYB 5DEHA 1LT4D 3M3YB 4BY1B 1SSOA 4B9WA 4JBMA 4CKCA 3KK7A 4ILWA 4O1NA 5ELOA 4GS3A 1V1QA 2K5HA 1Y8PB 1EL0A 1GXDC 1RHPA 2JA8G 4JV5L 3B6YA 3K57A 5C3XA 2CWPA 2OEOA 4RGMA 3DWQA 1UNSA 1S4ZA 1O7YA 1DGSA 4O2DA 2EY1A 4JVZA 4QIWE 2AQ2B 3NXWA 3QIAA 1A0IA 3K8AA 4JYAQ 3G71A 2PPBC 2UU9Q 1SJED 4TKOB 4PQXA 2EYLA 1EY7A 3PUWA 2FMMA 1PTOC 3S1MB 4ZKCB 3HOXB 4QGUA 1S5FD 1EY8A 1RTOA 4OWXB 2Y0SE 3I55A 5M5WH 1QWYA 2KJXA 3GTMH 1HNZL 1RTNA 4A93B 1LABA 1SN8A 2GVAA 1XMOL 1W6KA 2F03A 1YI2A 5EPKA 2EXZA 2D62A 4ULLA 1JOQA 3HOUH 4NXNQ 1WTVA 1CTMA 1AZPA 3H0GH 4YIJA 1I94Q 2UUCL 4UHVA 4Y7NH 1AEXA 5JJIA 5IGFA 4PG3A 4LWCA 3UI2A 1WCMB 4IPCA 5IE8A 2D5DA 4OO1I 5M3FB 4M1UB 3S24A 1EQTA 1B3QA 3UE1A 3PO3H 4BA2I 1E0BA 5KGUA 3CCRA 2R92G 4RGTA 1LTGD 1PFBA 1XYIA 1P8LA 3DWPA 1A62A 3GQBA 4IFDG 4MIUA 5JEAJ 1DYQA 2A6EC 3F1ZA 5DM63 5C4JH 4HCSA 4KHVA 1TR5A 1X65A 2BH8A 4NP5A 2R93H 4TSSA 1J5EL 3R2IA 2E2HH 4X3SA 1KLUD 3O13A 4DV4Q 1D5XC 4GKKL 1SFOB 4RA8A 3IFTA 1JMCA 1Y69U 1ASZA 2MGSA 4RCOA 1GO3E 4X64L 1AN8A 4DR3L 1F9SA 4R9WA 3CC2A 1AE3A 3EVQA 4OEMB 1YNND 4A3EB 4JG2A 4JPBW 4CJ2C 4ME5A 1D1KA 2K4KA 4LF6Q 4DUZL 3PMFA 3SK5A 1FD7D 3U58A 4B3RQ 5EJWA 1N34Q 3TQYA 2IPKD 4DFAA 2E2DC 3HKSA 4CBVA 1WTPA 4FF2A 5CV5A 2VQFQ 1AFPA 4R8IA 1BCPF 4M8AA 5IT9L 5JJLA 3NUCA 1XPUA 2BH2A 2I0QA 1LTTD 1GUWA 5CV9A 5CV8A 4IQZA 1SYDA 3HOYB 2IL8A 1PH9A 4POGA 3KYHC 4PMWA 1STAA 3PO2B 3K7UC 3M7GA 1EQQA 4XTCS 4DK0A 1Z9FA 3FMCA 1XTCD 2F4IA 3J80i 4XDXA 3S16B 1J8IA 1EIFA 3CC4A 1IHZA 5J1ZA 4DU9A 1U4MA 4DV3L 2KCTA 4HCEA 2UXDL 1YHAA 2DNCA 4K2KA 4EVOA 3V2TA 4A3FB 4GLXA 1NSNS 1HQRD 4PMBA 3GTLH 1RL2A 5IIFA 4ZUJA 1A2UA 1UWVA 1CKNA 1D1IA 1LTSD 3CCUA 1U0LA 2H5XA 3OW7A 2F0PA 2N88A 2OTJA 2B63G 1JWUD 2JA8H 3ND9A 3BG3A 3EQLC 2DN8A 4AH6A 2WAQG 1Y1VG 5E4XA 3NWSA 1XNQL 3RLNA 2MFIA 4OGQC 1LYLA 1WD1A 1D6EC 4DXFA 2VUMB 1DXMA 1QUQA 5IGEA 1HZBA 5ELDA 2NN6I 1PV4A 2K5QA 3S1QH 1HTLD 2UXBL 4RGOS 5EKLA 3T51B 1M4VA 2H4OA 2K32A 3FVQA 5L37A 2LKVA 2A6HD 5IWAL 5C3WA 1Q1EA 4A3DB 3TS2A 1EIGA 1HZCA 3S15B 2L9HA 5C4ZA 3URYA 3WDNA 2RVLA 2C5CA 5BN5A 4Q5VA 1EZ8A 1TVXA 3K5OA 2SNSA 4X65L 1HNXL 4YWKA 4DV6L 3Q6SA 1AH9A 2PQAB 4HTHA 3F2BA 3PGZA 4U673 1EYDA 2VXWA 5ELNA 3BS1A 4OIJA 1C9OA 3MXNB 2YU9B 5GAGC 5ELCA 5K5PA 3M4OB 4OWTB 3V05A 4ZRZA 2K5WA 1HHVA 4FNFA 4JI6L 2Z6KC 1LTBD 1ZYRD 1DONA 2I5MX 4XYOA 2M9VA 5GAHC 5A35A 1K8MA 1K8GA 2F0UA 2R92H 3STBC 1BUVT 3E6ZX 4DXGA 1VQDA 1GJXA 1ENAA 2DNEA 1S3OA 3BVMA 4CJ1B 1BBXC 1SR3A 2KA7A 5KYLA 3NWTA 4L5TA 4IFDH 1FGUA 3SK6A 1MJCA 3LGJA 3NPPA 4OX9Q 2JA7G 4EQNA 4RFBA 2M00A 4A4IA 3KLWA 3T16A 4CDCC 4FO2A 2A19A 4FXDA 1JB3A 1ICWA 3RZOH 2CW0D 1ZEQX 5C0XJ 5C6AA 5FK9C 2JA5H 1BR9A 3K0XA 3PIP3 2JXMB 1QG7A 1ICFB 2QDLA 5KNBA 2F0WA 3VYTA 3I4OA 4JI0L 2R7ZH 4K5VA 3U9SA 2D9UA 2Z6KA 4B3MQ 2UUAL 1C4QA 1YJNA 2QDBA 4RKBA 4KHZA 4AYBE 1CA6A 4LFCQ 1LACA 3DM3A 3GTJH 5I9OA 1KXLA 3FHWA 1VQ8A 4KTAA 1H9SA 2LXKA 1L1OC 3VA7A 1YNJC 3OIPA 4KMUC 4XXEA 1BF4A 3D4WA 4HIKA 3PIO3 2N78A 3NTKA 5KNCA 3I4NG 1VQAA 1ILPA 1JICA 2D2CC 3S2DB 1PRTB 2KVMA 2L4NA 4IOAA 1I4GA 3QOLA 1C0AA 3GTGB 1CQFA 5EBDA 2N55A 1TS3A 2B3GA 1EY0A 3I4MG 3E0EA 3VR2A 4GOPB 1EWIA 2JYOA 1SJHD 2RCNA 4HJ9A 4P75A 1IXRA 1PMRA 1XXGA 4TVAB 2YTVA 2N8NA 2SDFA 4WRDA 3R8BA 3QWNA 2ICEC 1NE3A 3S17B 4WJWA 1BCPC 2B29A 2B2VC 3P75A 2F4VQ 4BY7B 2Z1CA 5IYBG 1G6ZA 1B9MA 1MI2A 1E1OA 2NBFA 4KY7A 2B2WC 1CHQD 1OXVA 2F0NA 1L1OA 1EIYB 3GD7A 2DGYA 3ZJYC 1K83H 4ZYSA 3KJOA 3UDFA 4DV5Q 1UE6A 4G7OC 1LT3D 4NMZA 4JBKA 4L5SA 4OELB 2XWBB 4CHTB 3BYYB 4DAMA 5IGCA 1HCZA 2BA0A 3EBEA 1ET6A 4X66Q 4L6TB 2OQKA 2PMZB 3T1HL 1D5MC 1HQMC 4DV1L 5TSSA 3EN2A 2K6AA 3G6EA 2KCNA 1Y1VH 4NB3A 2JA6G 1F9RA 4DKAC 5D14A 4A3MB 1UUPA 4QQBX 4I65A 2ES2A 2R6GA 3TSSA 1H9RA 5FO9B 1GUNA 1YHQA 3PQIA 1B9NA 2RSNA 2B2VA 1K8OA 4YY3Q 3MXPA 3Q22A 1WFQA 3D0FA 3IAYA 1CZGA 1PHJA 1BO0A 1STNA 1I4RA 1XPRA 4X3TA 1HFGA 3HEJA 1EFWA 3LX0A 4X3KA 4WJ3M 1WTOA 4C3HG 1KNEA 1PVOA 2RBMA 4QIWB 4J1MA 4KHPQ 4DGZA 5C4XB 1PH5A 4A3KB 2XSCA 3J81E 2PW5A 2WP8J 4V190 1SFOH 1G2TA 3ER0A 2VQEL 1YIJA 2UUBQ 4GN5A 1ESRA 2H1EA 4C3JB 4G7HC 2LMCB 1KABA 3N52A 2Z6BA 5HURA 1CSQA 1X54A 5EKIA 3HOUG 1B50A 3IL8A 1EIHA 1HJPA 1Q46A 4X3UA 2D0PA 1S5CD 4UDUC 5C0XI 3FP9A 1C48A 1D8LA 1Y8NB 2L15A 2Y0SB 4TRDA 3KJPA 1M90C 1QJOA 3I56A 1WTHA 1VQEA 1PH6A 3DMUA 1ZXTA 1JJGA 1CKMA 2RDHA 2IX0A 3HOZB 3PO3G 1PTOB 2F0LA 1XNRQ 3A54A 3BZDB 4IUPA 1I50H 1Y14B 1V1PA 5GAEC 2E5LQ 1LV9A 3JAML 1O78A 3L3OC 4PZ8A 5CYUA 4DR7Q 1R4QB 5IP7H 5A2QL 2I5HA 1HR0W 5LMNW 3D4RA 3GTQH 4RCNA 3K59A 2JA7H 2B8FA 1I5FA 2ZXPA 2VL6A 2OT2A 2E2IB 2K5VA 1U5KA 4DV7Q 4JW0A 1TS2A 4RMFA 3PO2H 3EJIA 3M4PA 2NWGA 2WV6D 2QILA 2F0TA 1VQLA 2DJGC 3K80C 4LUVA 5DLQE 1U9RA 4B3TL 1FNUA 4IURA 2C9OA 4RH6A 1OTCA 3D8GA 4K0KL 2ID0A 4X62L 1V8QA 1OO9B 2XIWA 1O80A 2JE6I 4C2MB 3A5UA 4J6HA 2ZTDA 1N32Q 4FF4A 2RQXA 4ZQ3A 4IUQA 4G7ZC 3K5LA 4Y52H 1NAPA 3A55A 5LMNL 1I6VC 1I4PA 1LUZA 1R4PB 3I4NH 2PO4A 5C5LA 2Q8RE 2E8GA 3GTKB 3MWYW 2VZAA 2UXBQ 2HD3A 4H02A 5C4HA 2F0OA 2F0KA 2KOLA 2VB3X 3H3VI 2A69C 1PH7A 1E22A 1DM0B 1GUGA 1CKOA 1BXTA 3RD4A 5G3LD 2F3IA 2BE5D 3HOWB 3DM1A 4JI1Q 2BOSA 4BBRG 5FLXc 2A74C 4JI7Q 1EU3A 1MIUA 1TWHB 3S15H 5M5XH 1RIPA 4JI3L 1JOKA 4ZAIA 4HJ7A 1Y1WB 1IBMQ 5ELBA 1UEBA 5CGKA 3FKIB 1SE4A 5BR8L 4OO1G 4JI8L 2OCEA 4CDEC 3P1HA 2E76C 3HG9A 2YU9H 2RSOA 1MD2D 1A6XA 1LTAD 4ALPA 2JA6H 3I3CA 1F2YA 2K50A 4DV0Q 2VB2X 4HJ8A 4LF5Q 4NDXA 4GLVB 1KRTA 2NVQB 2ASBA 5FKAC 4N8FA 1G91A 3EIVA 3MVVA 2BA1A 2A73B 4BA1I 3MC0B 4AQYL 1TWCB 1QUQB 1RKNA 2HCIA 1WTRA 2BCOA 1B4OA 5E3FA 1I3QH 2R61A 3CKIB 3HP3A 2EVBA 3S14B 1IW7D 5EAYA 1YJ9A 4LFAL 4DR6Q 1VCIA 4DUYL 2I5LX 4QCLA 3X3NA 4C3HH 4YCVA 5C44B 1YJWA 2WB1E 3RZDB 5JAVA 1G51A 2E75C 3S1RH 2HHHL 1IBKL 5IT9c 5K36H 3PUVA 5IGDA 3CCJA 3RNUA 2IWHA 3RN5A 4ZK9B 3J7YW 5HGQA 1STEA 4G57A 2A68D 4LAAA 4UP8A 3HKZG 4R4TA 2CQOA 3L7ZC 3R2TA 4N9PA 2ZJPA 2AWNA 4C1NI 3HOVB 4PNYA 4GN4B 1F9QA 1VDZA 1KDCA 4B3SL 1M1KC 5CV6A 5J22A 4KY6A 5DAUA 4XQNA 1ENCA 3CF5A 1K73C 3ERQA 3MXGA 1S72A 1HRJA 1TQOA 3A8IE 2J4XA 1KD1C 2OWOA 1TY0A 1PRTD 4I7ZC 1C8CA 4DN4M 5ISRA 1TWAB 5CMDA 5FO7B 1N36Q 5FLXL 1S5BD 5IGGA 3EFXD 5E1FA 2VNUD 3S2DH 1KNAA 2WAQB 1HXYD 3KLRA 4HR7B 5M3MB 3G48A 1H9KA 1WVLA 4PZ7A 1STYA 1K0RA 3KDFB 4GKJQ 4HJ5A 5M5YB 1A2TA 2TMPA 2DUDA 3VR5A 4LF9L 2WIIB 3BVGA 3CHBD 3I8ZA 3CW2C 2F0JA 3UE0A 4LFBL 1B44D 3J80c 3RLFA 1Y8OB 1HNWL 2B39A 2JA5G 5I2XA 2ALYB 4BY7H 3I73A 1FJGQ 1FYCA 1ZYRC 2R7ZG 2PI2A 2IX1A 5LMUQ 1FL0A 1NY4A 2GN5A 1H9SB 4EQPA 5CV7A 2AQ1B 1NJIC 1SMYC 3TDQA 2MPMA 2RHQB
chains in the Genus database with same CATH topology
2FINB 2TSSA 4V0BA 3KLSA 3OWEB 1CI3M 3G6JB 1RD9D 1B3AA 1EEFD 1Q3LA 2ZXRA 1QNUA 1IYUA 4L8JA 2XRQD 4AYBB 1EU4A 1LLRD 4F8MA 2F0VA 3QJYA 1HA6A 4OIKA 5I6YA 2I46A 4QUCA 5JEAG 1GUTA 2Z4HA 3CRLC 3E5SA 1CT1D 1MGSA 1RODA 4LJZC 5CBEE 3EA6A 3M7NA 3X3MA 4OO1H 3S2HB 4UAIA 2EJFC 1PDQA 2YYZA 2ENBA 5IOCA 4DF7A 1DOMA 5FO8B 3QG1A 3PUXA 2LS01 1T5XD 3R93A 1TT2A 4KJNA 2L5TA 3HRZC 4K8JA 4F88A 2NVXB 1PTOD 4B08A 2F0HA 1UAPA 3G7LA 3J80L 3CU7A 2AWOA 1D2BA 2DY7A 5C3EB 4KKSA 3KBGA 2PZTA 3TP5A 3C1FA 4O42A 4ZUIA 3OMCA 4A3IB 1BNZA 5CV4A 2K7VA 3N6RA 4KV6A 4RAUC 1MBYA 1EQVA 1Q1BA 2L11A 2E2JB 2FJ2A 4C3IB 2F0SA 1Z47A 4A3GB 1SE2A 2B2YC 4A3JB 3U9OA 1EWCA 2NB0A 1CK1A 2Z8LA 4BBSB 2A6ED 3TP6A 1CFMA 2EYHA 4A3BB 1SYCA 4HMJA 1JE4A 4DNTB 1V1PB 5IODA 2L0CA 3I4LA 1F2LA 2I07B 3H6MA 5KIXA 1PRTF 3H91A 1LTRD 3VYRA 2L55A 1SEBD 3TZDA 1NR2A 1VF5C 2RA4A 4MHEA 2X6LA 2B2YA 4KD4A 1QILA 1TU2B 2HDMA 5KRUA 5I2YA 3MTSA 2AUKA 5KEEA 3L9AX 1E2WA 2B8GA 3D6WA 4KK7A 5D3IB 1M8AA 2KEDA 2NN6H 2K03A 3TN2A 1PFNA 3H0GB 1EWHA 4Y7NB 2EYJA 4ODGA 2NTTA 3VR3A 5D3DA 1CM9A 2EY5A 3NQIA 2EZVA 3S1NB 1F9PA 1U4PA 2NVYB 3BYTB 5JEAH 3TZUA 2EJGC 2NZ1D 5DM73 3KLSX 2XWJB 2LY7A 1SNQA 3SVMA 1QB5D 5C4JB 4KD3A 5C0XG 1H9JA 2R93B 1XWEA 2E2HB 1RDPD 1SYEA 1SYFA 3HGBA 2F0IA 3MHBA 2K05A 4RKLA 3DWAA 3OPOA 4H13C 3DEOA 1QCBD 1DJRD 4HEDA 5LHY1 3GO5A 4H44C 4FVMA 5LL6X 1STBA 3RUZA 1JORA 5C5MA 5EBCA 1SBBB 1MSHA 1X32A 1AP0A 2FHTA 1UEAB 2F3VA 1EY6A 3TP7A 4P2CB 2CVRA 4DNRB 4H7BA 3BDOA 1DCZA 2KEEA 3VYUA 5K36G 1A3VA 3I72A 2EE1A 4IUUA 1MSGA 1I4HA 2WB1B 2MUYA 5I9PA 3GTLB 1B1ZA 3KBXA 3QB3A 1SAPA 1OXSC 3MXNA 5CR3A 2JA8B 1H9MA 1G2SA 2GA4B 1O7ZA 2DY8A 4HAEA 2A68C 4C56C 1TY2A 2XN9C 4F7XA 4RGNA 2CQAA 4FP5D 3D6CA 1HPCA 3VR4A 1AW7A 2WINB 1II3A 4IUVA 5EPLA 2HUGA 3NBHA 1FNVA 1AZQA 3C2PA 1PRTC 3GTPB 3SK4A 1EY5A 2MP1A 1HTPA 1V1OA 1PZKD 3HZXA 2IW3A 1SDFA 1OXXK 2G9DA 4KN7C 3F2UA 1D5ZC 1WTWA 3C46A 3D31A 5EGTA 2RDGA 4WORA 1EYAA 1EFID 4K5XA 4ZKBB 1GOZA 3NK9A 3AMUA 3V96A 1S5DD 5FLXE 3GV6A 4ZLTF 1I6HB 3Q24A 2R92B 1LT5D 3PUZA 3SXHA 3DHQA 4KKUA 5DNFA 2XNAC 2SNMA 2R3ZA 1DZ1A 3BDLA 3C3LA 1PXUA 1YNNC 2K5DA 1KDAA 1HA5A 1ENFA 2HQEA 3DXJC 2O4XA 4HSVA 5C0XH 3PUYA 1PZID 1TKWB 4J8QA 2K1BA 1SYBA 4GZYC 3OSOA 3RZOB 4RWSC 1I4XA 4QF4A 4C3JG 2LFNA 1ET9A 5I6WA 2PQEA 2QKIC 4FF3A 3T53B 1SYGA 4K5WA 3K0YA 3GTJB 1B2TA 4NW2A 3QOJA 3MFYA 5IT9E 3T56B 3A8JE 3LWUA 1STHA 4E6IA 1A15A 1IYVA 1S5ED 1A3TA 3I91A 1F77A 3TBIB 3AB9A 5F2DA 1SNCA 4IFDJ 1EY9A 4PMCA 1KLGD 3AU7A 5BN3A 3KUPA 3TP8A 3I90A 4F87A 1LO5D 3NSWA 3J7AV 2F3WA 3VA5A 1TS4A 4N9TA 5J39A 2K04A 2F0FA 1K83B 2IT1A 4IZ8A 5EQ0A 4QUFA 1ML0D 2A6HC 2B63B 1G291 2K33A 3FPUB 3J80E 2PNRC 4XT3B 1Y1VB 3K6OA 4HSPA 4BS9A 4BWGB 1ESFA 2X69A 2MHVA 1L0XB 4DAYA 3NP8A 2EJMA 1LT6D 3FDTA 2HDLA 3A7LA 2SOBA 4DA2A 3DEPA 4U68A 1KAAA 2WKDA 1EYCA 1NR4A 3NQTA 5ELFA 3ZYYX 4OL7A 2KECA 2A69D 1EEID 4IN3A 2NN6G 1IKLA 1SXTA 2B2TC 1L0YB 2CW0C 4HMIA 4KKTA 2FMCA 3KF8A 3DUZA 3P20A 2XRSD 3VR6A 1XX8A 1DD2A 4IALA 3SHLA 1CHPD 1I50B 5JJZA 1GHKA 1O7LA 1IL8A 1HUNA 4K8IA 3K7AB 3NHHA 4TQUS 3GTQB 1JC7A 2JA7B 1Q8IA 4ID6A 3FPPA 1SNPA 2QEJC 5G3LF 5COYA 2F0DA 1OXUA 1QNKA 2B2TA 3SDZA 1LTID 4IFDI 2J7ZA 2G9HD 4EQOA 3TMEA 5LL6S 4RHRA 1SNMA 3H09A 2PZUA 2IX3A 5CORA 2PZWA 3K58A 1PTOH 3T4AC 3GTOB 3I4NB 1BCPB 3PV0A 1X3PA 2NUCA 4XIGS 1KDBA 2BDNA 4CJ0B 1U4RA 2M2LA 5I4DA 3I4MB 5JVH3 4K2LA 3MFGA 3GP7A 1BDOA 3FRPB 1SNOA 1VF7A 4KI0A 3SEBA 4Q0FA 2EOTA 2QF7A 1VMPA 2PW7A 2RKSA 5M5XB 5JOBA 3C1EA 3NTIA 2KUMA 5AFWA 5D65A 3D3RA 3Q0AA 1E2ZA 4KY5A 3OMGA 4LK1C 4R8NA 5NUCA 2HCCA 5ELEA 3MEHA 2JA6B 5KNDA 3ITPA 2B2UC 5JPMC 1EZ6A 1BQQT 3M4YA 1QOHA 2ICIA 3VYSA 4L63B 3E0JA 1F2MA 1PFMA 1TIID 3R3OA 1I3QB 3IKJA 3I70A 4XQJA 4ABNA 4B9XA 1SMYD 1Q12A 1NUCA 3K5MA 2AUJD 4C3HB 4JK1C 2A5HA 5T1IA 5M5WB 2EPBA 3S1RB 3GTMB 4Z9CB 1U4LA 3SR1A 2NYZD 2L12A 3BDCA 1WD0A 2B2UA 1FR3A 2Q8IB 3HOUB 4DK1A 1T5EA 2EYPA 1TS5A 1GUSA 5HGTA 2XVSA 4FYDA 3MAQA 4IUNA 3A7AB 1WTXA 3OWFA 2EYFA 4IUTA 4XT1B 1OXTA 3JAME 3PO3B 2OF1A 2F0QA 4QB4A 5A2QE 1JR0D 3NE5B 1DOKA 2OXPA 1SE3A 5T1GA 2SEBD 4PV1C 2ZXOA 3Q23A 1SNDA 3D4DA 2O5JC 5JPNC 3A8KE 3OIQA 2EY6A 4K14A 1KTKA 5KYIA 1RJTA 1STGA 3A56A 3MA2B 4FXGC 4C3IG 2IJ0A 3MZ5A 5FOBB 4NKLA 4DAVA 1GHJA 5CC4A 3K5NA 5IGBA 1DOLA 4CKEA 1JQYD 1NCVA 1GUOA 3P7JA 4OHJA 2F0MA 1EOTA 1A3UA 3WOFA 3FEWX 2BE5C 3EROA 5EKKA 3CQZB 2F1MA 2ZT9C 1W6JA 2PCFB 1PTOF 2JEBI 2WKCA 5E4WC 3J7AF 1EY4A 4K6LA 4XYQA 3M85A 2F0EA 4WFN3 2F0GA 1JCKB 1Z7TA 5BN4A 1CZWA 4XQQA 3ND8A 1JWSD 4JBWA 4K6DA 2B2WA 3LNNA 4HN7A 2O5IC 2K01A 5JVG3 4BBRB 2MJ8A 1Q90A 2Z4IA 1TWGB 2EYMA 2JEAI 4KJOA 2NTSA 2PYKA 3NBIA 1IW7C 1QE6A 1B53A 1E2VA 1FNWA 3MXUA 4H0LC 2WACA 2J0TD 3S9WA 1ZKOA 2BDOA 3CRKC 3GV3A 3H94A 4FF1A 2K28A 3RMHA 3OHXC 1Z6HA 2KHSA 2EY2A 2CHBD 2JSOA 1PZJD 1PYWD 2KCCA 4S3SA 3H3VC 4EGVA 3S1QB 1YNJD 3SK8A 4FXKC 4G4KA 1CQVA 4KN4C 3W3AA 2O2LD 3QO2A 3W2DA 1F2ZA 2NVTB 3ONAB 1RCVD 3HKZB 1X3QA 5CBAE 1RF2D 3SE0A 1FGBD 3OOCA 1CA5A 2RDFA 2EDGA 2V4DA 4MN3A 3T13A 1VMCA 1BCPD 4CKBA 2X6GA 3LWEA 2EYOA 2AQ3B 1TWFB 4DAPA 1R9TB 2Q8TA 4LMQD 1PLFA 5EPJA 5M9OA 4QMGA 1ONLA 1IKMA 3IFDA 1JOOA 3WOEA 2QCPX 2JA5B 3J81L 2KQ3A 3HS0C 2L1BA 2JP1A 3BVZA 1JWMD 1BOSA 1G8ZD 1I4QA 2R7ZB 1ILQA 1HUMA 2E74C 1WTQA 1HFNA 2FFKB 4C1NK 4RHSA 1J9OA 3NTHA 1V43A 4CGYB 5DEHA 1LT4D 3M3YB 4BY1B 1SSOA 4B9WA 4CKCA 3KK7A 4ILWA 4O1NA 1Y8PB 1EL0A 1GXDC 1RHPA 3K57A 5C3XA 2OEOA 4RGMA 3DWQA 1UNSA 1S4ZA 1O7YA 2EY1A 2AQ2B 3NXWA 3QIAA 2PPBC 1SJED 4TKOB 4PQXA 2EYLA 1EY7A 3PUWA 2FMMA 1PTOC 3S1MB 4ZKCB 3HOXB 1S5FD 1EY8A 1RTOA 1QWYA 2KJXA 1RTNA 4A93B 1LABA 1W6KA 2F03A 5EPKA 2EXZA 2D62A 4ULLA 1JOQA 1WTVA 1CTMA 1AZPA 4YIJA 1AEXA 5IGFA 3UI2A 1WCMB 2D5DA 4OO1I 5M3FB 4M1UB 1EQTA 4BA2I 1E0BA 5KGUA 4RGTA 1LTGD 1PFBA 1XYIA 3DWPA 3GQBA 4IFDG 4MIUA 5JEAJ 1DYQA 2A6EC 5DM63 4HCSA 4KHVA 1TR5A 4NP5A 4TSSA 3R2IA 4X3SA 1KLUD 3O13A 1D5XC 1SFOB 4RA8A 3IFTA 1Y69U 2MGSA 4RCOA 1AN8A 1F9SA 4R9WA 3EVQA 4A3EB 1YNND 4CJ2C 4ME5A 1D1KA 3PMFA 3SK5A 1FD7D 5EJWA 2IPKD 4DFAA 2E2DC 4CBVA 1WTPA 4FF2A 5CV5A 1AFPA 4R8IA 1BCPF 4M8AA 5IT9L 3NUCA 1LTTD 1GUWA 5CV9A 5CV8A 4IQZA 1SYDA 3HOYB 2IL8A 4PMWA 1STAA 3PO2B 3M7GA 4XTCS 4DK0A 3FMCA 1XTCD 2F4IA 3S16B 4XDXA 1J8IA 1IHZA 5J1ZA 4DU9A 1U4MA 4HCEA 2DNCA 4K2KA 4EVOA 3V2TA 4A3FB 1NSNS 1HQRD 4PMBA 5IIFA 4ZUJA 1A2UA 1D1IA 1LTSD 3OW7A 2F0PA 2N88A 1JWUD 3ND9A 3BG3A 3EQLC 2DN8A 5E4XA 3NWSA 4OGQC 1WD1A 1D6EC 4DXFA 2VUMB 1DXMA 5IGEA 5ELDA 2NN6I 2K5QA 1HTLD 4RGOS 5EKLA 3T51B 1M4VA 2H4OA 2K32A 3FVQA 2LKVA 2A6HD 5C3WA 1Q1EA 4A3DB 1EIGA 3S15B 2L9HA 5C4ZA 3URYA 3WDNA 2RVLA 2C5CA 5BN5A 4Q5VA 1EZ8A 1TVXA 3K5OA 2SNSA 3Q6SA 4HTHA 4U673 1EYDA 2VXWA 3BS1A 4OIJA 2YU9B 5ELCA 5K5PA 3M4OB 3V05A 4ZRZA 2K5WA 1HHVA 4FNFA 1LTBD 1ZYRD 1DONA 4XYOA 2M9VA 5A35A 1K8MA 2F0UA 1BUVT 3E6ZX 4DXGA 1GJXA 1ENAA 2DNEA 3BVMA 4CJ1B 1BBXC 2KA7A 5KYLA 3NWTA 4IFDH 3SK6A 3NPPA 4EQNA 4RFBA 2M00A 3T16A 4FO2A 4FXDA 1JB3A 1ICWA 2CW0D 1ZEQX 5C0XJ 5C6AA 5FK9C 1BR9A 3PIP3 2JXMB 1QG7A 5KNBA 2F0WA 3VYTA 4K5VA 3U9SA 2D9UA 1C4QA 2QDBA 4RKBA 4KHZA 1CA6A 1LACA 5I9OA 4KTAA 1H9SA 3VA7A 1YNJC 3OIPA 4KMUC 4XXEA 1BF4A 3D4WA 3PIO3 3NTKA 5KNCA 1ILPA 1JICA 2D2CC 3S2DB 1PRTB 2KVMA 2L4NA 1I4GA 3QOLA 3GTGB 1CQFA 5EBDA 2N55A 1TS3A 1EY0A 3VR2A 2JYOA 1SJHD 1PMRA 1XXGA 2SDFA 4WRDA 3R8BA 3QWNA 2ICEC 3S17B 4WJWA 1BCPC 2B2VC 3P75A 4BY7B 2Z1CA 1G6ZA 1B9MA 1MI2A 2NBFA 4KY7A 2B2WC 1CHQD 1OXVA 2F0NA 3GD7A 4ZYSA 4G7OC 1LT3D 4NMZA 2XWBB 4CHTB 3BYYB 5IGCA 1HCZA 2BA0A 1ET6A 4L6TB 2PMZB 1D5MC 1HQMC 5TSSA 2K6AA 2KCNA 1F9RA 5D14A 4A3MB 1UUPA 4I65A 2R6GA 3TSSA 1H9RA 5FO9B 1GUNA 1B9NA 2RSNA 2B2VA 1K8OA 3MXPA 3Q22A 3IAYA 1CZGA 1BO0A 1STNA 1I4RA 4X3TA 1HFGA 3HEJA 3LX0A 4X3KA 1WTOA 4C3HG 1KNEA 2RBMA 4QIWB 4J1MA 4DGZA 5C4XB 4A3KB 2XSCA 3J81E 2PW5A 2WP8J 4V190 1G2TA 1ESRA 2H1EA 4C3JB 4G7HC 2LMCB 1KABA 3N52A 5HURA 5EKIA 1B50A 3IL8A 1EIHA 4X3UA 1S5CD 4UDUC 5C0XI 1C48A 1Y8NB 4TRDA 2Y0SB 1QJOA 3DMUA 1ZXTA 2RDHA 2IX0A 3HOZB 1PTOB 2F0LA 3A54A 3BZDB 4IUPA 1V1PA 1LV9A 3JAML 1O78A 3L3OC 5CYUA 1R4QB 5A2QL 3D4RA 4RCNA 3K59A 2B8FA 2ZXPA 2OT2A 2E2IB 1TS2A 3EJIA 2NWGA 2WV6D 2QILA 2F0TA 1U9RA 1FNUA 4IURA 2C9OA 4RH6A 3D8GA 2ID0A 1V8QA 1OO9B 2XIWA 1O80A 2JE6I 4C2MB 4J6HA 4FF4A 2RQXA 4ZQ3A 4IUQA 4G7ZC 3K5LA 1NAPA 3A55A 1I6VC 1I4PA 1R4PB 2PO4A 5C5LA 2Q8RE 3GTKB 3MWYW 5C4HA 2F0OA 2F0KA 2KOLA 2VB3X 2A69C 1DM0B 1GUGA 1BXTA 3RD4A 5G3LD 2BE5D 3HOWB 3DM1A 2BOSA 2A74C 1EU3A 1TWHB 1JOKA 4ZAIA 1Y1WB 5ELBA 5CGKA 3FKIB 1SE4A 4OO1G 3P1HA 2E76C 3HG9A 2RSOA 1MD2D 1A6XA 1LTAD 3I3CA 1F2YA 2VB2X 4NDXA 2NVQB 5FKAC 1G91A 3MVVA 2BA1A 2A73B 4BA1I 3MC0B 1TWCB 1RKNA 2HCIA 1WTRA 2BCOA 1B4OA 5E3FA 2R61A 3CKIB 3HP3A 2EVBA 3S14B 1IW7D 1VCIA 4QCLA 3X3NA 5C44B 3RZDB 5JAVA 2E75C 5K36H 3PUVA 5IGDA 2IWHA 4ZK9B 3J7YW 1STEA 4G57A 2A68D 4LAAA 3L7ZC 3R2TA 4N9PA 4C1NI 2AWNA 3HOVB 4PNYA 1F9QA 1VDZA 1KDCA 5CV6A 5J22A 4KY6A 5DAUA 4XQNA 1ENCA 3ERQA 3MXGA 1HRJA 1TQOA 3A8IE 2J4XA 1TY0A 1PRTD 4I7ZC 1C8CA 4DN4M 5ISRA 1TWAB 5CMDA 5FO7B 5FLXL 1S5BD 5IGGA 3EFXD 5E1FA 2VNUD 1KNAA 2WAQB 1HXYD 3KLRA 4HR7B 5M3MB 1H9KA 1WVLA 1STYA 5M5YB 1A2TA 2TMPA 3VR5A 2WIIB 3BVGA 3CHBD 3I8ZA 2F0JA 1B44D 3RLFA 1Y8OB 2B39A 5I2XA 3I73A 1FYCA 1ZYRC 2IX1A 4EQPA 1H9SB 5CV7A 2AQ1B 1SMYC 3TDQA 2MPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKC A;  2WKD A; 
#chains in the Genus database with same CATH topology
 2FIN B;  3CQZ H;  4BY1 G;  4AIM A;  2TSS A;  4V0B A;  3KLS A;  4A76 A;  3OWE B;  1CI3 M;  3G6J B;  1CSP A;  1Q8K A;  1RD9 D;  1B3A A;  1EEF D;  1Q3L A;  2ZXR A;  1QNU A;  1NMG A;  1IYU A;  4A3M H;  4L8J A;  2XRQ D;  3UDG A;  4AYB B;  1EU4 A;  1KAW A;  4CDF C;  1LLR D;  1K3B C;  5FJ8 G;  4F8M A;  2F0V A;  4UPA A;  3QJY A;  1HA6 A;  4OIK A;  1GM5 A;  3RR5 A;  5I6Y A;  2I46 A;  1PYS B;  4YHH L;  4EX5 A;  4QUC A;  5JEA G;  4WJ4 A;  1GUT A;  4BBR H;  2Z4H A;  3CRL C;  3E5S A;  1CT1 D;  1MGS A;  1ROD A;  4LJZ C;  3T1Y L;  2QGQ A;  3HOX G;  5CBE E;  1L1O B;  3EA6 A;  2OTL A;  3M7N A;  3X3M A;  4OO1 H;  3S2H B;  1N33 L;  1TWG H;  1X56 A;  4UAI A;  4JI2 L;  2EJF C;  4A93 G;  1KIX A;  1PDQ A;  2YYZ A;  2ENB A;  5IOC A;  2A1A A;  4DF7 A;  3IRB A;  3U4Z A;  1DOM A;  5FO8 B;  4QL5 A;  3QG1 A;  3PUX A;  2LS0 1;  1T5X D;  5AJ3 Q;  3R93 A;  1TT2 A;  4KJN A;  2L5T A;  3HRZ C;  4K8J A;  4F88 A;  2NVX B;  1PTO D;  5IYD G;  4B08 A;  2F0H A;  1KC8 C;  1UAP A;  3G7L A;  1WCM G;  3J80 L;  5M3F G;  3CU7 A;  2AWO A;  1D2B A;  2DY7 A;  3HOZ H;  1YHB A;  5C3E B;  4KKS A;  1K0S A;  3KBG A;  2PZT A;  3TP5 A;  1IL2 A;  3C1F A;  4O42 A;  1E7Z A;  4ZUI A;  3OTO Q;  4DR2 L;  4LW1 A;  3GDE A;  3OMC A;  1VQJ A;  2FXQ A;  4A3I B;  1BNZ A;  2CWA A;  1XMQ L;  5CV4 A;  4POF A;  2UXC L;  2K7V A;  3N6R A;  4KV6 A;  4RAU C;  2NVT H;  1MBY A;  1EQV A;  1Q1B A;  2L11 A;  4LF4 Q;  1SLJ A;  2E2J B;  2FJ2 A;  3U4V A;  2ZM6 L;  4C3I B;  3KF6 A;  3KOJ A;  1VQG A;  2F0S A;  4JI5 Q;  1Z47 A;  2WAQ E;  4NXM L;  1HR0 Q;  4A3G B;  1SE2 A;  2B2Y C;  4JI4 Q;  4LF8 Q;  4A3J B;  3U9O A;  4JBJ A;  4JOI C;  1EWC A;  2NB0 A;  3ULL A;  1CK1 A;  2Z8L A;  4A3E G;  2QW7 A;  4BBS B;  4HIO A;  4DR5 Q;  2Q2U A;  4UY8 C;  2HQL A;  4DR4 L;  3A74 A;  1IBL L;  2A6E D;  3TP6 A;  4IOC A;  1BKB A;  1CFM A;  2K5N A;  3I7F A;  4BXX H;  2EYH A;  4A3B B;  1SYC A;  4HMJ A;  1TWF H;  4DV2 L;  1JE4 A;  4DNT B;  1R9T H;  1H95 A;  1V1P B;  5IOD A;  2L0C A;  4LF7 L;  3I4L A;  4DR1 L;  1F2L A;  2I07 B;  3H6M A;  5KIX A;  1X6O A;  1PRT F;  4P73 A;  3H91 A;  1NMF A;  5IP7 G;  1LTR D;  3VYR A;  2L55 A;  2Q2T A;  1SEB D;  1PFS A;  3TZD A;  1NR2 A;  1VF5 C;  2RA4 A;  3HOY G;  4JI3 Q;  3PO2 G;  4MHE A;  2X6L A;  2B2Y A;  4KD4 A;  1QIL A;  1TU2 B;  2HDM A;  2JQO A;  5KRU A;  4JOI A;  5I2Y A;  3CCV A;  4JYA L;  2ZJR A;  4GNX C;  3MTS A;  2UU9 L;  4GLA C;  2AUK A;  5KEE A;  3L9A X;  4APV A;  3AFP A;  1Y1W H;  4A3F G;  3FKI H;  1E2W A;  1PYB A;  2B8G A;  3VDY A;  4QJF A;  4JV5 Q;  3D6W A;  1WYD A;  4KK7 A;  5D3I B;  1M8A A;  2KED A;  4EQ5 A;  4MZ9 A;  3TRE A;  1K9M C;  4YWM A;  3J81 j;  2NN6 H;  3M3Y H;  2YTX A;  4BY1 H;  4DK6 C;  2K03 A;  3NEL A;  3I2Z A;  3TN2 A;  1PFN A;  1GVP A;  3H0G B;  1EWH A;  4Y7N B;  2NVQ H;  2EYJ A;  4RG1 A;  4ODG A;  1L2F A;  2NTT A;  3VR3 A;  2R7F A;  1X55 A;  5FJ8 H;  1LM0 A;  3CCQ A;  2XTI A;  4NXN L;  5D3D A;  1BVS A;  1CM9 A;  2EY5 A;  3NQI A;  1I94 L;  2EZV A;  3S1N B;  1F9P A;  1U4P A;  1HNZ Q;  2NVY B;  3BYT B;  5JEA H;  4GNX A;  3TZU A;  1SE8 A;  2EJG C;  1XMO Q;  3S1M H;  1W2B A;  2NZ1 D;  5DM7 3;  2ZJQ A;  4OXP A;  1T9H A;  3HOX H;  3KLS X;  2XWJ B;  5C44 H;  2LY7 A;  1SNQ A;  3SVM A;  4A3D G;  5HY6 A;  1QB5 D;  5C4J B;  4KD3 A;  5C0X G;  3JAM c;  4A93 H;  1H9J A;  2UUC Q;  1XWE A;  2R93 B;  4R4C A;  3A5Z B;  2E2H B;  1RDP D;  3Q8D A;  1SYE A;  1SYF A;  3HGB A;  2F0I A;  2WFW A;  3MHB A;  3HOV H;  1VQ6 A;  2K05 A;  4N8X 1;  4RKL A;  3DWA A;  5IYD H;  4DV4 L;  3OPO A;  1VQI A;  4H13 C;  1WCM H;  3DEO A;  1QCB D;  1DJR D;  5M3F H;  4HED A;  2ATW A;  5LHY 1;  1TWA H;  3GO5 A;  4H44 C;  2LSS A;  1KL9 A;  4FVM A;  5LL6 X;  1STB A;  3RUZ A;  1JOR A;  1YEZ A;  5C5M A;  5EBC A;  1J5E Q;  2VW9 A;  3NEN A;  5M3M H;  4LF6 L;  1SBB B;  3PF4 A;  4GKK Q;  2IY5 B;  1MSH A;  1X32 A;  4B3R L;  1N34 L;  1AP0 A;  1GKH A;  2MQH A;  2FHT A;  1UEA B;  2CKZ B;  5H1S E;  2F3V A;  1B8A A;  1EY6 A;  5J3B A;  5M5Y H;  1PH4 A;  1BBU A;  1X3E A;  4P2C B;  2CVR A;  3TP7 A;  4DNR B;  2EXD A;  4X64 Q;  2VQF L;  4H7B A;  2RHS B;  3BDO A;  1DCZ A;  2KEE A;  2ZTE A;  4DK3 C;  4DR3 Q;  3VYU A;  3BZK A;  5K36 G;  1SMX A;  1X3F A;  1VQM A;  1PH2 A;  1A3V A;  3I72 A;  4MTK A;  1TXY A;  3STB D;  3ERS X;  2EE1 A;  4DUZ Q;  4IUU A;  5FLM H;  1VQP A;  1MSG A;  3CD6 A;  1K28 A;  4A3E H;  4ME3 A;  1I4H A;  2WB1 B;  2MUY A;  4L5Q A;  2CH4 W;  5I9P A;  3GTL B;  1B1Z A;  3KBX A;  3QB3 A;  1SAP A;  2PQA A;  3BJU A;  1OXS C;  1EOV A;  3CPF A;  3MXN A;  3ULJ A;  1X9N A;  5CR3 A;  2JA8 B;  1H9M A;  1G2S A;  3WWV A;  2GA4 B;  1O7Z A;  2DY8 A;  4HAE A;  1VQO A;  2A68 C;  4C56 C;  1TY2 A;  2XN9 C;  4F7X A;  4DV3 Q;  4RGN A;  3HOY H;  2UXD Q;  1IZ6 A;  3CCM A;  1WI5 A;  4P72 A;  4FP5 D;  2CQA A;  3D6C A;  1HPC A;  3VR4 A;  4YCU A;  1C7Y A;  1AW7 A;  3S16 H;  2WIN B;  1II3 A;  4IUV A;  2HUG A;  5EPL A;  3NBH A;  2CCZ A;  1FNV A;  1AZQ A;  3C2P A;  3UDX A;  4BY7 G;  1PRT C;  4MTN A;  3GTP B;  3SK4 A;  4A3F H;  1EY5 A;  2MP1 A;  1HTP A;  1PH8 A;  1V1O A;  4PZ6 A;  1PZK D;  3HZX A;  2IW3 A;  1SDF A;  1OXX K;  2G9D A;  1NNX A;  4KN7 C;  2LXJ A;  3F2U A;  1D5Z C;  1XNQ Q;  1WTW A;  3C46 A;  3D31 A;  2QEX A;  5EGT A;  2HIX A;  1JJ2 A;  2RDG A;  4WOR A;  4IO9 A;  1EYA A;  5IY0 A;  1EFI D;  4K5X A;  4ZKB B;  1GOZ A;  1VS0 A;  1VQN A;  3NK9 A;  4HJA A;  3AMU A;  3ICE A;  2A8V A;  3J81 i;  3V96 A;  1S5D D;  5FLX E;  2HIV A;  3GV6 A;  4ZLT F;  1I6H B;  3Q24 A;  4A3M G;  2VUM H;  4R1J A;  5IWA Q;  5C3E H;  2R92 B;  1LT5 D;  1K8A C;  3NEM A;  3PUZ A;  3SXH A;  3DHQ A;  4KKU A;  5DNF A;  2XNA C;  2SNM A;  2R3Z A;  2QA4 A;  1DZ1 A;  3BDL A;  3C3L A;  1PXU A;  1YNN C;  2K5D A;  1WOC A;  4X65 Q;  3SGI A;  1KDA A;  1HNX Q;  1HA5 A;  1SRU A;  2YV5 A;  1ENF A;  4DV6 Q;  2HQE A;  3BZC A;  2O4X A;  3DXJ C;  4A3D H;  4HSV A;  1JE5 A;  3PIP A;  5C0X H;  3PUY A;  1PZI D;  1TKW B;  4J8Q A;  1KRS A;  5C4X G;  2HT1 A;  4A3K G;  1EYG A;  2K1B A;  2MO0 A;  1SYB A;  4GZY C;  4UP9 A;  3OSO A;  3RZO B;  4A3C G;  1E1T A;  4RWS C;  1I4X A;  4C3I H;  1XJV A;  1CKN B;  4QF4 A;  2JK8 A;  1Q86 C;  4JI6 Q;  4C3J G;  4OX9 L;  3F8T A;  4A3G H;  1EUJ A;  2LFN A;  2GVB A;  1ET9 A;  3M4O H;  5I6W A;  2PQE A;  2NZH A;  2QKI C;  4FF3 A;  3T53 B;  1SYG A;  4K5W A;  3PIO A;  3K0Y A;  3TEH B;  4IPG A;  3GTJ B;  3MEF A;  2Y0S G;  1N8R C;  1B2T A;  5GRO A;  4NW2 A;  3QOJ A;  1E24 A;  3MFY A;  4A3B H;  1XTD A;  4B3M L;  1UE5 A;  5IT9 E;  3T56 B;  3A8J E;  4JC0 A;  3HOZ G;  1QVG A;  2OQ0 A;  3LWU A;  4LFC L;  1STH A;  4R4O A;  4E6I A;  1A15 A;  1IYV A;  1S5E D;  1JJC B;  1A3T A;  4YCW A;  2G5D A;  3I91 A;  1F77 A;  3TBI B;  3AB9 A;  5F2D A;  4JI0 Q;  1SNC A;  3TS0 A;  2PNH A;  4IFD J;  1EY9 A;  4PMC A;  3L0O A;  2UUA Q;  3JC6 6;  1KLG D;  3CCL A;  3AU7 A;  5BN3 A;  3KUP A;  3TP8 A;  3J7Z C;  2XGT A;  3I90 A;  4F87 A;  3KF6 B;  1LO5 D;  3NSW A;  3BU2 A;  2F3W A;  4FDB A;  3VA5 A;  1VQ5 A;  3J7A V;  1TS4 A;  4N9T A;  2Z0S A;  5J39 A;  2K04 A;  4IPH A;  2F0F A;  3H3V H;  1K83 B;  2VS1 A;  2IT1 A;  4IZ8 A;  5EQ0 A;  2F4V L;  4QUF A;  1ML0 D;  2A6H C;  2B63 B;  4CDD C;  4BXX G;  2R7D A;  1G29 1;  1QVC A;  2K33 A;  1W3S A;  4DV5 L;  3FPU B;  3J80 E;  2PNR C;  2VY3 A;  4XT3 B;  3GTG H;  1Y1V B;  5IYC H;  2K14 A;  3E9H A;  3K6O A;  2PI2 E;  4HSP A;  1BBW A;  4BS9 A;  4X66 L;  4BWG B;  1ESF A;  2X69 A;  2MHV A;  3PF5 A;  3S1N H;  3HKZ E;  1L0X B;  4DAY A;  2NVY H;  3S17 H;  3NP8 A;  2EJM A;  1YIT A;  1LT6 D;  3FDT A;  2HDL A;  3A7L A;  3HOW G;  2SOB A;  3A0J A;  4DA2 A;  3DEP A;  4U68 A;  1KAA A;  2WKD A;  3CCE A;  3T1H Q;  4YY3 L;  4DV1 Q;  1PA6 A;  1EYC A;  1Y1W G;  1B70 B;  1NR4 A;  3FKI G;  1NBW A;  3CP0 A;  3NQT A;  5ELF A;  3ZYY X;  4OL7 A;  2KEC A;  2A69 D;  1EEI D;  4IN3 A;  2NN6 G;  2ZTC A;  1IKL A;  2MNA A;  1SXT A;  4LNQ A;  4KHP L;  1JB7 A;  2B2T C;  1L0Y B;  1J6Q A;  3W1G A;  2UUB L;  4NPS A;  2CW0 C;  2EIF A;  4HMI A;  4L5R C;  4KKT A;  2FMC A;  3KF8 A;  3DUZ A;  3P20 A;  4LUZ A;  2XRS D;  3VR6 A;  2F52 A;  1XX8 A;  1DD2 A;  4IAL A;  3SHL A;  1CHP D;  1I50 B;  5JJZ A;  1GHK A;  4GNX B;  1O7L A;  1IL8 A;  1L0W A;  4K8I A;  1HUN A;  3K7A B;  3NHH A;  2VQE Q;  4TQU S;  3DLL A;  3GTQ B;  1JC7 A;  2KBN A;  2JA7 B;  1Q8I A;  3J7A 5;  5C44 G;  4ID6 A;  3OYY A;  3FPP A;  1A63 A;  1XNR L;  5C4X H;  1SNP A;  3W5O A;  4A3K H;  2QEJ C;  2E5L L;  5G3L F;  5COY A;  1B7Y B;  4DR7 L;  4A3C H;  3U50 C;  2F0D A;  1OXU A;  1QNK A;  4C3J H;  1QVF A;  4A3L H;  2B2T A;  2P5Z X;  3SDZ A;  1LTI D;  1KQS A;  4DV7 L;  1VQ9 A;  4IFD I;  3HOV G;  2J7Z A;  2G9H D;  4EQO A;  3TME A;  5LL6 S;  4RHR A;  1SNM A;  2YTY A;  2KHI A;  3H09 A;  2PZU A;  2IX3 A;  1QZH A;  5COR A;  2PZW A;  3K58 A;  2KCM A;  1PTO H;  3T4A C;  3GTO B;  3I4N B;  1BCP B;  3PV0 A;  1X3P A;  2NUC A;  1N32 L;  4XIG S;  1KDB A;  3PSI A;  2BDN A;  4CJ0 B;  1U4R A;  5M3M G;  2M2L A;  5I4D A;  3I4M B;  2Z9H A;  4B3T Q;  2E2I H;  4IPD A;  4K0K Q;  4X62 Q;  5JVH 3;  4K2L A;  3F2D A;  3MFG A;  3GP7 A;  1S40 A;  1MJE A;  1BDO A;  3FRP B;  1SNO A;  1VF7 A;  4KI0 A;  3SEB A;  5IP9 G;  5LMN Q;  4Q0F A;  2EOT A;  2QF7 A;  3GTP H;  5FLM G;  1VMP A;  2PW7 A;  2RKS A;  5M5X B;  4C2M H;  5JOB A;  3C1E A;  3NTI A;  2DJF C;  2KUM A;  5AFW A;  5D65 A;  3D3R A;  3Q0A A;  1E2Z A;  4JI1 L;  3M9B A;  4KY5 A;  3OMG A;  4JI7 L;  4LK1 C;  4R8N A;  5NUC A;  1XPO A;  2HCC A;  1E3P A;  1IBM L;  2K75 A;  3GTK H;  5ELE A;  3MEH A;  2JA6 B;  1P16 A;  1VQK A;  5KND A;  3ITP A;  3ULP A;  2B2U C;  5JPM C;  1NTG A;  1EZ6 A;  2RCF A;  1I6H H;  4P74 A;  1YNX A;  4IJH A;  1BQQ T;  3M4Y A;  4AYB G;  1QOH A;  2ICI A;  3VYS A;  4L63 B;  3E0J A;  1F2M A;  4DV0 L;  1PFM A;  4LF5 L;  1TII D;  3R3O A;  1I3Q B;  3IKJ A;  3I70 A;  3QR8 A;  5BR8 Q;  4XQJ A;  4ABN A;  1SRO A;  4B9X A;  1MHW C;  1SMY D;  1Q12 A;  4JI8 Q;  1QZG A;  3HOW H;  1NUC A;  3OW2 A;  3E9I A;  3KDF A;  3NBH B;  3RLO A;  1HZA A;  1TWH H;  3K5M A;  2AUJ D;  3M4Q A;  4C3H B;  3CC7 A;  1Q7Y C;  4JK1 C;  2A5H A;  5T1I A;  5M5W B;  2EPB A;  3S1R B;  3GTM B;  4Z9C B;  4ZCK A;  1U4L A;  3SR1 A;  1K3R A;  4DR6 L;  2NYZ D;  2L12 A;  3BDC A;  4J15 A;  3K81 C;  1FVI A;  1WD0 A;  1V9P A;  1FR3 A;  2B2U A;  2Q8I B;  3HOU B;  4DK1 A;  1T5E A;  2EYP A;  4AQY Q;  1LTL A;  1TS5 A;  1GUS A;  5HGT A;  2XVS A;  4FYD A;  3MAQ A;  4IUN A;  2Q2H A;  4LFA Q;  3A7A B;  1WTX A;  3OWF A;  4DUY Q;  2EYF A;  1D7Q A;  1TWC H;  4IUT A;  4XT1 B;  1OXT A;  3JAM E;  2VUM G;  2OF1 A;  1YZ6 A;  2F0Q A;  4QB4 A;  3PO3 B;  3W1B A;  5A2Q E;  5C3E G;  1G6P A;  3AYH B;  2AMC B;  2HHH Q;  3S14 H;  1IBK Q;  1JR0 D;  4KLK A;  3NE5 B;  1DOK A;  2OXP A;  1SE3 A;  5T1G A;  2SEB D;  4A3I G;  4PV1 C;  3CXC A;  1X3G A;  2JA9 A;  2ZXO A;  3Q23 A;  1N36 L;  1SND A;  3RZD H;  3D4D A;  1PH1 A;  2O5J C;  3A8K E;  5JPN C;  1GD7 A;  3OIQ A;  1UE7 A;  4B3S Q;  2EY6 A;  1EQR A;  4K14 A;  2CFM A;  1KTK A;  1KHI A;  1HZ9 A;  2C35 B;  5KYI A;  1RJT A;  1STG A;  1Q82 C;  3A56 A;  3MA2 B;  4GKJ L;  4FXG C;  4C3I G;  2IJ0 A;  1VQC A;  3MZ5 A;  5FOB B;  4NKL A;  4A3G G;  4DAV A;  1GHJ A;  1Q81 C;  3KFU A;  5CC4 A;  3K5N A;  4A3J G;  5IGB A;  3AFQ A;  3CCS A;  3CPW A;  1DOL A;  4CKE A;  1JQY D;  1NCV A;  4BBS G;  1GUO A;  1IYJ B;  3P7J A;  4OHJ A;  2F0M A;  4MNO A;  2CH4 A;  1EOT A;  1A3U A;  1FJG L;  3TRZ A;  2KHJ A;  3WOF A;  4DNI A;  3FEW X;  2B63 H;  2BE5 C;  5E7N A;  3ERO A;  5EKK A;  4A3B G;  3CQZ B;  1ASY A;  2F1M A;  2ZT9 C;  1W6J A;  2PCF B;  1PTO F;  5LMU L;  2JEB I;  4LF9 Q;  2WKC A;  5E4W C;  2D0O A;  3F2C A;  4LFB Q;  3J7A F;  3H15 A;  1EY4 A;  1HNW Q;  4K6L A;  4XYQ A;  3M85 A;  2F0E A;  4WFN 3;  2F0G A;  1VQF A;  1JCK B;  2JN4 A;  1Z7T A;  5BN4 A;  1CZW A;  4XQQ A;  3ND8 A;  1JWS D;  1JT8 A;  4JBW A;  4K6D A;  2B2W A;  3LNN A;  4HN7 A;  5IP9 H;  4OON A;  2O5I C;  2K01 A;  5JVG 3;  4BBR B;  2MJ8 A;  1HH2 P;  1Q90 A;  1MKH A;  1PH3 A;  4P71 A;  2Z4I A;  2N49 A;  2AHO B;  2AKW B;  3JAM i;  1TWG B;  2EYM A;  2JEA I;  4KJO A;  2NTS A;  2PYK A;  3NBI A;  3L2P A;  1IW7 C;  1QE6 A;  1B53 A;  1E2V A;  1FNW A;  1UE1 A;  3MXU A;  4H0L C;  2WAC A;  2J0T D;  3S9W A;  1ZKO A;  1WJJ A;  2BDO A;  3CRK C;  3GV3 A;  3H94 A;  4FF1 A;  2K28 A;  3RMH A;  3H0G G;  3OHX C;  3CAM A;  1Z6H A;  3J81 c;  2KHS A;  4YHH Q;  5IYC G;  2EY2 A;  4LUO A;  2CHB D;  2JSO A;  3AEV A;  1PZJ D;  3CMA A;  1PYW D;  2N3S A;  5AJ3 L;  2JJQ A;  3T1Y Q;  2KCC A;  4S3S A;  3H3V C;  3G4S A;  4O0A A;  1A8V A;  4EGV A;  3S1Q B;  1VQB A;  4DAY B;  2NZO A;  1N33 Q;  4JI2 Q;  1YNJ D;  3K7A H;  5GQO A;  4YWL A;  3SK8 A;  1YVC A;  4OWW B;  4FXK C;  2IHF A;  4G4K A;  1O7I A;  1CQV A;  4KN4 C;  4R4Q A;  3W3A A;  2O2L D;  4GN3 B;  3QO2 A;  5JJK A;  3S2H H;  3W2D A;  1F2Z A;  3OTO L;  2NVT B;  2R93 G;  4GOP C;  3UDI A;  3ONA B;  1RCV D;  2K52 A;  3HKZ B;  1X3Q A;  5CBA E;  1RF2 D;  4R4I A;  3SE0 A;  1FGB D;  3OOC A;  1CA5 A;  2RF4 A;  4HIM A;  3CME A;  4IJL A;  4LF4 L;  2NVX H;  2RDF A;  2EDG A;  2V4D A;  4MN3 A;  2V1C C;  3T13 A;  1VMC A;  1BCP D;  4DR2 Q;  4CKB A;  4A75 A;  1VQH A;  2X6G A;  1VQ4 A;  4X6A H;  4JI5 L;  3KF8 B;  2Q2I A;  1HR0 L;  4LF8 L;  1XMQ Q;  4JI4 L;  3AQQ A;  3LWE A;  3GTO H;  2UXC Q;  2EYO A;  2AQ3 B;  1TWF B;  4DAP A;  1R9T B;  4DR5 L;  3E3X A;  2Q8T A;  4LMQ D;  4UP7 A;  1PLF A;  4A3I H;  5EPJ A;  5M9O A;  3I4M H;  2ZM6 Q;  4QMG A;  4GOP A;  4HID A;  1ONL A;  3HFZ B;  1VQ7 A;  4NXM Q;  1IKM A;  3IFD A;  5GAD C;  1JOO A;  1AE2 A;  3RN2 A;  2EQS A;  1N9W A;  2E2J H;  3WOE A;  4DPG A;  2QCP X;  2PMZ E;  2JA5 B;  3J81 L;  2MO1 A;  2KQ3 A;  3HS0 C;  2L1B A;  5IYB H;  4A3L G;  2JP1 A;  4DR4 Q;  3BVZ A;  1CUK A;  1JWM D;  1IBL Q;  1BOS A;  1G8Z D;  1I4Q A;  4A3J H;  2R7Z B;  4I7A A;  1ILQ A;  1HUM A;  1YBY A;  2E74 C;  2IHE A;  1WTQ A;  2KEN A;  4DV2 Q;  1HFN A;  2FFK B;  4QY7 A;  4BBS H;  4JCV E;  2WB1 G;  4C1N K;  4RHS A;  1J9O A;  4LF7 Q;  4DR1 Q;  3PCO B;  3NTH A;  1V43 A;  4CGY B;  5DEH A;  1LT4 D;  3M3Y B;  4BY1 B;  1SSO A;  4B9W A;  4JBM A;  4CKC A;  3KK7 A;  4ILW A;  4O1N A;  5ELO A;  4GS3 A;  1V1Q A;  2K5H A;  1Y8P B;  1EL0 A;  1GXD C;  1RHP A;  2JA8 G;  4JV5 L;  3B6Y A;  3K57 A;  5C3X A;  2CWP A;  2OEO A;  4RGM A;  3DWQ A;  1UNS A;  1S4Z A;  1O7Y A;  1DGS A;  4O2D A;  2EY1 A;  4JVZ A;  4QIW E;  2AQ2 B;  3NXW A;  3QIA A;  1A0I A;  3K8A A;  4JYA Q;  3G71 A;  2PPB C;  2UU9 Q;  1SJE D;  4TKO B;  4PQX A;  2EYL A;  1EY7 A;  3PUW A;  2FMM A;  1PTO C;  3S1M B;  4ZKC B;  3HOX B;  4QGU A;  1S5F D;  1EY8 A;  1RTO A;  4OWX B;  2Y0S E;  3I55 A;  5M5W H;  1QWY A;  2KJX A;  3GTM H;  1HNZ L;  1RTN A;  4A93 B;  1LAB A;  1SN8 A;  2GVA A;  1XMO L;  1W6K A;  2F03 A;  1YI2 A;  5EPK A;  2EXZ A;  2D62 A;  4ULL A;  1JOQ A;  3HOU H;  4NXN Q;  1WTV A;  1CTM A;  1AZP A;  3H0G H;  4YIJ A;  1I94 Q;  2UUC L;  4UHV A;  4Y7N H;  1AEX A;  5JJI A;  5IGF A;  4PG3 A;  4LWC A;  3UI2 A;  1WCM B;  4IPC A;  5IE8 A;  2D5D A;  4OO1 I;  5M3F B;  4M1U B;  3S24 A;  1EQT A;  1B3Q A;  3UE1 A;  3PO3 H;  4BA2 I;  1E0B A;  5KGU A;  3CCR A;  2R92 G;  4RGT A;  1LTG D;  1PFB A;  1XYI A;  1P8L A;  3DWP A;  1A62 A;  3GQB A;  4IFD G;  4MIU A;  5JEA J;  1DYQ A;  2A6E C;  3F1Z A;  5DM6 3;  5C4J H;  4HCS A;  4KHV A;  1TR5 A;  1X65 A;  2BH8 A;  4NP5 A;  2R93 H;  4TSS A;  1J5E L;  3R2I A;  2E2H H;  4X3S A;  1KLU D;  3O13 A;  4DV4 Q;  1D5X C;  4GKK L;  1SFO B;  4RA8 A;  3IFT A;  1JMC A;  1Y69 U;  1ASZ A;  2MGS A;  4RCO A;  1GO3 E;  4X64 L;  1AN8 A;  4DR3 L;  1F9S A;  4R9W A;  3CC2 A;  1AE3 A;  3EVQ A;  4OEM B;  1YNN D;  4A3E B;  4JG2 A;  4JPB W;  4CJ2 C;  4ME5 A;  1D1K A;  2K4K A;  4LF6 Q;  4DUZ L;  3PMF A;  3SK5 A;  1FD7 D;  3U58 A;  4B3R Q;  5EJW A;  1N34 Q;  3TQY A;  2IPK D;  4DFA A;  2E2D C;  3HKS A;  4CBV A;  1WTP A;  4FF2 A;  5CV5 A;  2VQF Q;  1AFP A;  4R8I A;  1BCP F;  4M8A A;  5IT9 L;  5JJL A;  3NUC A;  1XPU A;  2BH2 A;  2I0Q A;  1LTT D;  1GUW A;  5CV9 A;  5CV8 A;  4IQZ A;  1SYD A;  3HOY B;  2IL8 A;  1PH9 A;  4POG A;  3KYH C;  4PMW A;  1STA A;  3PO2 B;  3K7U C;  3M7G A;  1EQQ A;  4XTC S;  4DK0 A;  1Z9F A;  3FMC A;  1XTC D;  2F4I A;  3J80 i;  4XDX A;  3S16 B;  1J8I A;  1EIF A;  3CC4 A;  1IHZ A;  5J1Z A;  4DU9 A;  1U4M A;  4DV3 L;  2KCT A;  4HCE A;  2UXD L;  1YHA A;  2DNC A;  4K2K A;  4EVO A;  3V2T A;  4A3F B;  4GLX A;  1NSN S;  1HQR D;  4PMB A;  3GTL H;  1RL2 A;  5IIF A;  4ZUJ A;  1A2U A;  1UWV A;  1CKN A;  1D1I A;  1LTS D;  3CCU A;  1U0L A;  2H5X A;  3OW7 A;  2F0P A;  2N88 A;  2OTJ A;  2B63 G;  1JWU D;  2JA8 H;  3ND9 A;  3BG3 A;  3EQL C;  2DN8 A;  4AH6 A;  2WAQ G;  1Y1V G;  5E4X A;  3NWS A;  1XNQ L;  3RLN A;  2MFI A;  4OGQ C;  1LYL A;  1WD1 A;  1D6E C;  4DXF A;  2VUM B;  1DXM A;  1QUQ A;  5IGE A;  1HZB A;  5ELD A;  2NN6 I;  1PV4 A;  2K5Q A;  3S1Q H;  1HTL D;  2UXB L;  4RGO S;  5EKL A;  3T51 B;  1M4V A;  2H4O A;  2K32 A;  3FVQ A;  5L37 A;  2LKV A;  2A6H D;  5IWA L;  5C3W A;  1Q1E A;  4A3D B;  3TS2 A;  1EIG A;  1HZC A;  3S15 B;  2L9H A;  5C4Z A;  3URY A;  3WDN A;  2RVL A;  2C5C A;  5BN5 A;  4Q5V A;  1EZ8 A;  1TVX A;  3K5O A;  2SNS A;  4X65 L;  1HNX L;  4YWK A;  4DV6 L;  3Q6S A;  1AH9 A;  2PQA B;  4HTH A;  3F2B A;  3PGZ A;  4U67 3;  1EYD A;  2VXW A;  5ELN A;  3BS1 A;  4OIJ A;  1C9O A;  3MXN B;  2YU9 B;  5GAG C;  5ELC A;  5K5P A;  3M4O B;  4OWT B;  3V05 A;  4ZRZ A;  2K5W A;  1HHV A;  4FNF A;  4JI6 L;  2Z6K C;  1LTB D;  1ZYR D;  1DON A;  2I5M X;  4XYO A;  2M9V A;  5GAH C;  5A35 A;  1K8M A;  1K8G A;  2F0U A;  2R92 H;  3STB C;  1BUV T;  3E6Z X;  4DXG A;  1VQD A;  1GJX A;  1ENA A;  2DNE A;  1S3O A;  3BVM A;  4CJ1 B;  1BBX C;  1SR3 A;  2KA7 A;  5KYL A;  3NWT A;  4L5T A;  4IFD H;  1FGU A;  3SK6 A;  1MJC A;  3LGJ A;  3NPP A;  4OX9 Q;  2JA7 G;  4EQN A;  4RFB A;  2M00 A;  4A4I A;  3KLW A;  3T16 A;  4CDC C;  4FO2 A;  2A19 A;  4FXD A;  1JB3 A;  1ICW A;  3RZO H;  2CW0 D;  1ZEQ X;  5C0X J;  5C6A A;  5FK9 C;  2JA5 H;  1BR9 A;  3K0X A;  3PIP 3;  2JXM B;  1QG7 A;  1ICF B;  2QDL A;  5KNB A;  2F0W A;  3VYT A;  3I4O A;  4JI0 L;  2R7Z H;  4K5V A;  3U9S A;  2D9U A;  2Z6K A;  4B3M Q;  2UUA L;  1C4Q A;  1YJN A;  2QDB A;  4RKB A;  4KHZ A;  4AYB E;  1CA6 A;  4LFC Q;  1LAC A;  3DM3 A;  3GTJ H;  5I9O A;  1KXL A;  3FHW A;  1VQ8 A;  4KTA A;  1H9S A;  2LXK A;  1L1O C;  3VA7 A;  1YNJ C;  3OIP A;  4KMU C;  4XXE A;  1BF4 A;  3D4W A;  4HIK A;  3PIO 3;  2N78 A;  3NTK A;  5KNC A;  3I4N G;  1VQA A;  1ILP A;  1JIC A;  2D2C C;  3S2D B;  1PRT B;  2KVM A;  2L4N A;  4IOA A;  1I4G A;  3QOL A;  1C0A A;  3GTG B;  1CQF A;  5EBD A;  2N55 A;  1TS3 A;  2B3G A;  1EY0 A;  3I4M G;  3E0E A;  3VR2 A;  4GOP B;  1EWI A;  2JYO A;  1SJH D;  2RCN A;  4HJ9 A;  4P75 A;  1IXR A;  1PMR A;  1XXG A;  4TVA B;  2YTV A;  2N8N A;  2SDF A;  4WRD A;  3R8B A;  3QWN A;  2ICE C;  1NE3 A;  3S17 B;  4WJW A;  1BCP C;  2B29 A;  2B2V C;  3P75 A;  2F4V Q;  4BY7 B;  2Z1C A;  5IYB G;  1G6Z A;  1B9M A;  1MI2 A;  1E1O A;  2NBF A;  4KY7 A;  2B2W C;  1CHQ D;  1OXV A;  2F0N A;  1L1O A;  1EIY B;  3GD7 A;  2DGY A;  3ZJY C;  1K83 H;  4ZYS A;  3KJO A;  3UDF A;  4DV5 Q;  1UE6 A;  4G7O C;  1LT3 D;  4NMZ A;  4JBK A;  4L5S A;  4OEL B;  2XWB B;  4CHT B;  3BYY B;  4DAM A;  5IGC A;  1HCZ A;  2BA0 A;  3EBE A;  1ET6 A;  4X66 Q;  4L6T B;  2OQK A;  2PMZ B;  3T1H L;  1D5M C;  1HQM C;  4DV1 L;  5TSS A;  3EN2 A;  2K6A A;  3G6E A;  2KCN A;  1Y1V H;  4NB3 A;  2JA6 G;  1F9R A;  4DKA C;  5D14 A;  4A3M B;  1UUP A;  4QQB X;  4I65 A;  2ES2 A;  2R6G A;  3TSS A;  1H9R A;  5FO9 B;  1GUN A;  1YHQ A;  3PQI A;  1B9N A;  2RSN A;  2B2V A;  1K8O A;  4YY3 Q;  3MXP A;  3Q22 A;  1WFQ A;  3D0F A;  3IAY A;  1CZG A;  1PHJ A;  1BO0 A;  1STN A;  1I4R A;  1XPR A;  4X3T A;  1HFG A;  3HEJ A;  1EFW A;  3LX0 A;  4X3K A;  4WJ3 M;  1WTO A;  4C3H G;  1KNE A;  1PVO A;  2RBM A;  4QIW B;  4J1M A;  4KHP Q;  4DGZ A;  5C4X B;  1PH5 A;  4A3K B;  2XSC A;  3J81 E;  2PW5 A;  2WP8 J;  4V19 0;  1SFO H;  1G2T A;  3ER0 A;  2VQE L;  1YIJ A;  2UUB Q;  4GN5 A;  1ESR A;  2H1E A;  4C3J B;  4G7H C;  2LMC B;  1KAB A;  3N52 A;  2Z6B A;  5HUR A;  1CSQ A;  1X54 A;  5EKI A;  3HOU G;  1B50 A;  3IL8 A;  1EIH A;  1HJP A;  1Q46 A;  4X3U A;  2D0P A;  1S5C D;  4UDU C;  5C0X I;  3FP9 A;  1C48 A;  1D8L A;  1Y8N B;  2L15 A;  2Y0S B;  4TRD A;  3KJP A;  1M90 C;  1QJO A;  3I56 A;  1WTH A;  1VQE A;  1PH6 A;  3DMU A;  1ZXT A;  1JJG A;  1CKM A;  2RDH A;  2IX0 A;  3HOZ B;  3PO3 G;  1PTO B;  2F0L A;  1XNR Q;  3A54 A;  3BZD B;  4IUP A;  1I50 H;  1Y14 B;  1V1P A;  5GAE C;  2E5L Q;  1LV9 A;  3JAM L;  1O78 A;  3L3O C;  4PZ8 A;  5CYU A;  4DR7 Q;  1R4Q B;  5IP7 H;  5A2Q L;  2I5H A;  1HR0 W;  5LMN W;  3D4R A;  3GTQ H;  4RCN A;  3K59 A;  2JA7 H;  2B8F A;  1I5F A;  2ZXP A;  2VL6 A;  2OT2 A;  2E2I B;  2K5V A;  1U5K A;  4DV7 Q;  4JW0 A;  1TS2 A;  4RMF A;  3PO2 H;  3EJI A;  3M4P A;  2NWG A;  2WV6 D;  2QIL A;  2F0T A;  1VQL A;  2DJG C;  3K80 C;  4LUV A;  5DLQ E;  1U9R A;  4B3T L;  1FNU A;  4IUR A;  2C9O A;  4RH6 A;  1OTC A;  3D8G A;  4K0K L;  2ID0 A;  4X62 L;  1V8Q A;  1OO9 B;  2XIW A;  1O80 A;  2JE6 I;  4C2M B;  3A5U A;  4J6H A;  2ZTD A;  1N32 Q;  4FF4 A;  2RQX A;  4ZQ3 A;  4IUQ A;  4G7Z C;  3K5L A;  4Y52 H;  1NAP A;  3A55 A;  5LMN L;  1I6V C;  1I4P A;  1LUZ A;  1R4P B;  3I4N H;  2PO4 A;  5C5L A;  2Q8R E;  2E8G A;  3GTK B;  3MWY W;  2VZA A;  2UXB Q;  2HD3 A;  4H02 A;  5C4H A;  2F0O A;  2F0K A;  2KOL A;  2VB3 X;  3H3V I;  2A69 C;  1PH7 A;  1E22 A;  1DM0 B;  1GUG A;  1CKO A;  1BXT A;  3RD4 A;  5G3L D;  2F3I A;  2BE5 D;  3HOW B;  3DM1 A;  4JI1 Q;  2BOS A;  4BBR G;  5FLX c;  2A74 C;  4JI7 Q;  1EU3 A;  1MIU A;  1TWH B;  3S15 H;  5M5X H;  1RIP A;  4JI3 L;  1JOK A;  4ZAI A;  4HJ7 A;  1Y1W B;  1IBM Q;  5ELB A;  1UEB A;  5CGK A;  3FKI B;  1SE4 A;  5BR8 L;  4OO1 G;  4JI8 L;  2OCE A;  4CDE C;  3P1H A;  2E76 C;  3HG9 A;  2YU9 H;  2RSO A;  1MD2 D;  1A6X A;  1LTA D;  4ALP A;  2JA6 H;  3I3C A;  1F2Y A;  2K50 A;  4DV0 Q;  2VB2 X;  4HJ8 A;  4LF5 Q;  4NDX A;  4GLV B;  1KRT A;  2NVQ B;  2ASB A;  5FKA C;  4N8F A;  1G91 A;  3EIV A;  3MVV A;  2BA1 A;  2A73 B;  4BA1 I;  3MC0 B;  4AQY L;  1TWC B;  1QUQ B;  1RKN A;  2HCI A;  1WTR A;  2BCO A;  1B4O A;  5E3F A;  1I3Q H;  2R61 A;  3CKI B;  3HP3 A;  2EVB A;  3S14 B;  1IW7 D;  5EAY A;  1YJ9 A;  4LFA L;  4DR6 Q;  1VCI A;  4DUY L;  2I5L X;  4QCL A;  3X3N A;  4C3H H;  4YCV A;  5C44 B;  1YJW A;  2WB1 E;  3RZD B;  5JAV A;  1G51 A;  2E75 C;  3S1R H;  2HHH L;  1IBK L;  5IT9 c;  5K36 H;  3PUV A;  5IGD A;  3CCJ A;  3RNU A;  2IWH A;  3RN5 A;  4ZK9 B;  3J7Y W;  5HGQ A;  1STE A;  4G57 A;  2A68 D;  4LAA A;  4UP8 A;  3HKZ G;  4R4T A;  2CQO A;  3L7Z C;  3R2T A;  4N9P A;  2ZJP A;  2AWN A;  4C1N I;  3HOV B;  4PNY A;  4GN4 B;  1F9Q A;  1VDZ A;  1KDC A;  4B3S L;  1M1K C;  5CV6 A;  5J22 A;  4KY6 A;  5DAU A;  4XQN A;  1ENC A;  3CF5 A;  1K73 C;  3ERQ A;  3MXG A;  1S72 A;  1HRJ A;  1TQO A;  3A8I E;  2J4X A;  1KD1 C;  2OWO A;  1TY0 A;  1PRT D;  4I7Z C;  1C8C A;  4DN4 M;  5ISR A;  1TWA B;  5CMD A;  5FO7 B;  1N36 Q;  5FLX L;  1S5B D;  5IGG A;  3EFX D;  5E1F A;  2VNU D;  3S2D H;  1KNA A;  2WAQ B;  1HXY D;  3KLR A;  4HR7 B;  5M3M B;  3G48 A;  1H9K A;  1WVL A;  4PZ7 A;  1STY A;  1K0R A;  3KDF B;  4GKJ Q;  4HJ5 A;  5M5Y B;  1A2T A;  2TMP A;  2DUD A;  3VR5 A;  4LF9 L;  2WII B;  3BVG A;  3CHB D;  3I8Z A;  3CW2 C;  2F0J A;  3UE0 A;  4LFB L;  1B44 D;  3J80 c;  3RLF A;  1Y8O B;  1HNW L;  2B39 A;  2JA5 G;  5I2X A;  2ALY B;  4BY7 H;  3I73 A;  1FJG Q;  1FYC A;  1ZYR C;  2R7Z G;  2PI2 A;  2IX1 A;  5LMU Q;  1FL0 A;  1NY4 A;  2GN5 A;  1H9S B;  4EQP A;  5CV7 A;  2AQ1 B;  1NJI C;  1SMY C;  3TDQ A;  2MPM A;  2RHQ B; 
#chains in the Genus database with same CATH homology
 2FIN B;  2TSS A;  4V0B A;  3KLS A;  3OWE B;  1CI3 M;  3G6J B;  1RD9 D;  1B3A A;  1EEF D;  1Q3L A;  2ZXR A;  1QNU A;  1IYU A;  4L8J A;  2XRQ D;  4AYB B;  1EU4 A;  1LLR D;  4F8M A;  2F0V A;  3QJY A;  1HA6 A;  4OIK A;  5I6Y A;  2I46 A;  4QUC A;  5JEA G;  1GUT A;  2Z4H A;  3CRL C;  3E5S A;  1CT1 D;  1MGS A;  1ROD A;  4LJZ C;  5CBE E;  3EA6 A;  3M7N A;  3X3M A;  4OO1 H;  3S2H B;  4UAI A;  2EJF C;  1PDQ A;  2YYZ A;  2ENB A;  5IOC A;  4DF7 A;  1DOM A;  5FO8 B;  3QG1 A;  3PUX A;  2LS0 1;  1T5X D;  3R93 A;  1TT2 A;  4KJN A;  2L5T A;  3HRZ C;  4K8J A;  4F88 A;  2NVX B;  1PTO D;  4B08 A;  2F0H A;  1UAP A;  3G7L A;  3J80 L;  3CU7 A;  2AWO A;  1D2B A;  2DY7 A;  5C3E B;  4KKS A;  3KBG A;  2PZT A;  3TP5 A;  3C1F A;  4O42 A;  4ZUI A;  3OMC A;  4A3I B;  1BNZ A;  5CV4 A;  2K7V A;  3N6R A;  4KV6 A;  4RAU C;  1MBY A;  1EQV A;  1Q1B A;  2L11 A;  2E2J B;  2FJ2 A;  4C3I B;  2F0S A;  1Z47 A;  4A3G B;  1SE2 A;  2B2Y C;  4A3J B;  3U9O A;  1EWC A;  2NB0 A;  1CK1 A;  2Z8L A;  4BBS B;  2A6E D;  3TP6 A;  1CFM A;  2EYH A;  4A3B B;  1SYC A;  4HMJ A;  1JE4 A;  4DNT B;  1V1P B;  5IOD A;  2L0C A;  3I4L A;  1F2L A;  2I07 B;  3H6M A;  5KIX A;  1PRT F;  3H91 A;  1LTR D;  3VYR A;  2L55 A;  1SEB D;  3TZD A;  1NR2 A;  1VF5 C;  2RA4 A;  4MHE A;  2X6L A;  2B2Y A;  4KD4 A;  1QIL A;  1TU2 B;  2HDM A;  5KRU A;  5I2Y A;  3MTS A;  2AUK A;  5KEE A;  3L9A X;  1E2W A;  2B8G A;  3D6W A;  4KK7 A;  5D3I B;  1M8A A;  2KED A;  2NN6 H;  2K03 A;  3TN2 A;  1PFN A;  3H0G B;  1EWH A;  4Y7N B;  2EYJ A;  4ODG A;  2NTT A;  3VR3 A;  5D3D A;  1CM9 A;  2EY5 A;  3NQI A;  2EZV A;  3S1N B;  1F9P A;  1U4P A;  2NVY B;  3BYT B;  5JEA H;  3TZU A;  2EJG C;  2NZ1 D;  5DM7 3;  3KLS X;  2XWJ B;  2LY7 A;  1SNQ A;  3SVM A;  1QB5 D;  5C4J B;  4KD3 A;  5C0X G;  1H9J A;  2R93 B;  1XWE A;  2E2H B;  1RDP D;  1SYE A;  1SYF A;  3HGB A;  2F0I A;  3MHB A;  2K05 A;  4RKL A;  3DWA A;  3OPO A;  4H13 C;  3DEO A;  1QCB D;  1DJR D;  4HED A;  5LHY 1;  3GO5 A;  4H44 C;  4FVM A;  5LL6 X;  1STB A;  3RUZ A;  1JOR A;  5C5M A;  5EBC A;  1SBB B;  1MSH A;  1X32 A;  1AP0 A;  2FHT A;  1UEA B;  2F3V A;  1EY6 A;  3TP7 A;  4P2C B;  2CVR A;  4DNR B;  4H7B A;  3BDO A;  1DCZ A;  2KEE A;  3VYU A;  5K36 G;  1A3V A;  3I72 A;  2EE1 A;  4IUU A;  1MSG A;  1I4H A;  2WB1 B;  2MUY A;  5I9P A;  3GTL B;  1B1Z A;  3KBX A;  3QB3 A;  1SAP A;  1OXS C;  3MXN A;  5CR3 A;  2JA8 B;  1H9M A;  1G2S A;  2GA4 B;  1O7Z A;  2DY8 A;  4HAE A;  2A68 C;  4C56 C;  1TY2 A;  2XN9 C;  4F7X A;  4RGN A;  2CQA A;  4FP5 D;  3D6C A;  1HPC A;  3VR4 A;  1AW7 A;  2WIN B;  1II3 A;  4IUV A;  5EPL A;  2HUG A;  3NBH A;  1FNV A;  1AZQ A;  3C2P A;  1PRT C;  3GTP B;  3SK4 A;  1EY5 A;  2MP1 A;  1HTP A;  1V1O A;  1PZK D;  3HZX A;  2IW3 A;  1SDF A;  1OXX K;  2G9D A;  4KN7 C;  3F2U A;  1D5Z C;  1WTW A;  3C46 A;  3D31 A;  5EGT A;  2RDG A;  4WOR A;  1EYA A;  1EFI D;  4K5X A;  4ZKB B;  1GOZ A;  3NK9 A;  3AMU A;  3V96 A;  1S5D D;  5FLX E;  3GV6 A;  4ZLT F;  1I6H B;  3Q24 A;  2R92 B;  1LT5 D;  3PUZ A;  3SXH A;  3DHQ A;  4KKU A;  5DNF A;  2XNA C;  2SNM A;  2R3Z A;  1DZ1 A;  3BDL A;  3C3L A;  1PXU A;  1YNN C;  2K5D A;  1KDA A;  1HA5 A;  1ENF A;  2HQE A;  3DXJ C;  2O4X A;  4HSV A;  5C0X H;  3PUY A;  1PZI D;  1TKW B;  4J8Q A;  2K1B A;  1SYB A;  4GZY C;  3OSO A;  3RZO B;  4RWS C;  1I4X A;  4QF4 A;  4C3J G;  2LFN A;  1ET9 A;  5I6W A;  2PQE A;  2QKI C;  4FF3 A;  3T53 B;  1SYG A;  4K5W A;  3K0Y A;  3GTJ B;  1B2T A;  4NW2 A;  3QOJ A;  3MFY A;  5IT9 E;  3T56 B;  3A8J E;  3LWU A;  1STH A;  4E6I A;  1A15 A;  1IYV A;  1S5E D;  1A3T A;  3I91 A;  1F77 A;  3TBI B;  3AB9 A;  5F2D A;  1SNC A;  4IFD J;  1EY9 A;  4PMC A;  1KLG D;  3AU7 A;  5BN3 A;  3KUP A;  3TP8 A;  3I90 A;  4F87 A;  1LO5 D;  3NSW A;  3J7A V;  2F3W A;  3VA5 A;  1TS4 A;  4N9T A;  5J39 A;  2K04 A;  2F0F A;  1K83 B;  2IT1 A;  4IZ8 A;  5EQ0 A;  4QUF A;  1ML0 D;  2A6H C;  2B63 B;  1G29 1;  2K33 A;  3FPU B;  3J80 E;  2PNR C;  4XT3 B;  1Y1V B;  3K6O A;  4HSP A;  4BS9 A;  4BWG B;  1ESF A;  2X69 A;  2MHV A;  1L0X B;  4DAY A;  3NP8 A;  2EJM A;  1LT6 D;  3FDT A;  2HDL A;  3A7L A;  2SOB A;  4DA2 A;  3DEP A;  4U68 A;  1KAA A;  2WKD A;  1EYC A;  1NR4 A;  3NQT A;  5ELF A;  3ZYY X;  4OL7 A;  2KEC A;  2A69 D;  1EEI D;  4IN3 A;  2NN6 G;  1IKL A;  1SXT A;  2B2T C;  1L0Y B;  2CW0 C;  4HMI A;  4KKT A;  2FMC A;  3KF8 A;  3DUZ A;  3P20 A;  2XRS D;  3VR6 A;  1XX8 A;  1DD2 A;  4IAL A;  3SHL A;  1CHP D;  1I50 B;  5JJZ A;  1GHK A;  1O7L A;  1IL8 A;  1HUN A;  4K8I A;  3K7A B;  3NHH A;  4TQU S;  3GTQ B;  1JC7 A;  2JA7 B;  1Q8I A;  4ID6 A;  3FPP A;  1SNP A;  2QEJ C;  5G3L F;  5COY A;  2F0D A;  1OXU A;  1QNK A;  2B2T A;  3SDZ A;  1LTI D;  4IFD I;  2J7Z A;  2G9H D;  4EQO A;  3TME A;  5LL6 S;  4RHR A;  1SNM A;  3H09 A;  2PZU A;  2IX3 A;  5COR A;  2PZW A;  3K58 A;  1PTO H;  3T4A C;  3GTO B;  3I4N B;  1BCP B;  3PV0 A;  1X3P A;  2NUC A;  4XIG S;  1KDB A;  2BDN A;  4CJ0 B;  1U4R A;  2M2L A;  5I4D A;  3I4M B;  5JVH 3;  4K2L A;  3MFG A;  3GP7 A;  1BDO A;  3FRP B;  1SNO A;  1VF7 A;  4KI0 A;  3SEB A;  4Q0F A;  2EOT A;  2QF7 A;  1VMP A;  2PW7 A;  2RKS A;  5M5X B;  5JOB A;  3C1E A;  3NTI A;  2KUM A;  5AFW A;  5D65 A;  3D3R A;  3Q0A A;  1E2Z A;  4KY5 A;  3OMG A;  4LK1 C;  4R8N A;  5NUC A;  2HCC A;  5ELE A;  3MEH A;  2JA6 B;  5KND A;  3ITP A;  2B2U C;  5JPM C;  1EZ6 A;  1BQQ T;  3M4Y A;  1QOH A;  2ICI A;  3VYS A;  4L63 B;  3E0J A;  1F2M A;  1PFM A;  1TII D;  3R3O A;  1I3Q B;  3IKJ A;  3I70 A;  4XQJ A;  4ABN A;  4B9X A;  1SMY D;  1Q12 A;  1NUC A;  3K5M A;  2AUJ D;  4C3H B;  4JK1 C;  2A5H A;  5T1I A;  5M5W B;  2EPB A;  3S1R B;  3GTM B;  4Z9C B;  1U4L A;  3SR1 A;  2NYZ D;  2L12 A;  3BDC A;  1WD0 A;  2B2U A;  1FR3 A;  2Q8I B;  3HOU B;  4DK1 A;  1T5E A;  2EYP A;  1TS5 A;  1GUS A;  5HGT A;  2XVS A;  4FYD A;  3MAQ A;  4IUN A;  3A7A B;  1WTX A;  3OWF A;  2EYF A;  4IUT A;  4XT1 B;  1OXT A;  3JAM E;  3PO3 B;  2OF1 A;  2F0Q A;  4QB4 A;  5A2Q E;  1JR0 D;  3NE5 B;  1DOK A;  2OXP A;  1SE3 A;  5T1G A;  2SEB D;  4PV1 C;  2ZXO A;  3Q23 A;  1SND A;  3D4D A;  2O5J C;  5JPN C;  3A8K E;  3OIQ A;  2EY6 A;  4K14 A;  1KTK A;  5KYI A;  1RJT A;  1STG A;  3A56 A;  3MA2 B;  4FXG C;  4C3I G;  2IJ0 A;  3MZ5 A;  5FOB B;  4NKL A;  4DAV A;  1GHJ A;  5CC4 A;  3K5N A;  5IGB A;  1DOL A;  4CKE A;  1JQY D;  1NCV A;  1GUO A;  3P7J A;  4OHJ A;  2F0M A;  1EOT A;  1A3U A;  3WOF A;  3FEW X;  2BE5 C;  3ERO A;  5EKK A;  3CQZ B;  2F1M A;  2ZT9 C;  1W6J A;  2PCF B;  1PTO F;  2JEB I;  2WKC A;  5E4W C;  3J7A F;  1EY4 A;  4K6L A;  4XYQ A;  3M85 A;  2F0E A;  4WFN 3;  2F0G A;  1JCK B;  1Z7T A;  5BN4 A;  1CZW A;  4XQQ A;  3ND8 A;  1JWS D;  4JBW A;  4K6D A;  2B2W A;  3LNN A;  4HN7 A;  2O5I C;  2K01 A;  5JVG 3;  4BBR B;  2MJ8 A;  1Q90 A;  2Z4I A;  1TWG B;  2EYM A;  2JEA I;  4KJO A;  2NTS A;  2PYK A;  3NBI A;  1IW7 C;  1QE6 A;  1B53 A;  1E2V A;  1FNW A;  3MXU A;  4H0L C;  2WAC A;  2J0T D;  3S9W A;  1ZKO A;  2BDO A;  3CRK C;  3GV3 A;  3H94 A;  4FF1 A;  2K28 A;  3RMH A;  3OHX C;  1Z6H A;  2KHS A;  2EY2 A;  2CHB D;  2JSO A;  1PZJ D;  1PYW D;  2KCC A;  4S3S A;  3H3V C;  4EGV A;  3S1Q B;  1YNJ D;  3SK8 A;  4FXK C;  4G4K A;  1CQV A;  4KN4 C;  3W3A A;  2O2L D;  3QO2 A;  3W2D A;  1F2Z A;  2NVT B;  3ONA B;  1RCV D;  3HKZ B;  1X3Q A;  5CBA E;  1RF2 D;  3SE0 A;  1FGB D;  3OOC A;  1CA5 A;  2RDF A;  2EDG A;  2V4D A;  4MN3 A;  3T13 A;  1VMC A;  1BCP D;  4CKB A;  2X6G A;  3LWE A;  2EYO A;  2AQ3 B;  1TWF B;  4DAP A;  1R9T B;  2Q8T A;  4LMQ D;  1PLF A;  5EPJ A;  5M9O A;  4QMG A;  1ONL A;  1IKM A;  3IFD A;  1JOO A;  3WOE A;  2QCP X;  2JA5 B;  3J81 L;  2KQ3 A;  3HS0 C;  2L1B A;  2JP1 A;  3BVZ A;  1JWM D;  1BOS A;  1G8Z D;  1I4Q A;  2R7Z B;  1ILQ A;  1HUM A;  2E74 C;  1WTQ A;  1HFN A;  2FFK B;  4C1N K;  4RHS A;  1J9O A;  3NTH A;  1V43 A;  4CGY B;  5DEH A;  1LT4 D;  3M3Y B;  4BY1 B;  1SSO A;  4B9W A;  4CKC A;  3KK7 A;  4ILW A;  4O1N A;  1Y8P B;  1EL0 A;  1GXD C;  1RHP A;  3K57 A;  5C3X A;  2OEO A;  4RGM A;  3DWQ A;  1UNS A;  1S4Z A;  1O7Y A;  2EY1 A;  2AQ2 B;  3NXW A;  3QIA A;  2PPB C;  1SJE D;  4TKO B;  4PQX A;  2EYL A;  1EY7 A;  3PUW A;  2FMM A;  1PTO C;  3S1M B;  4ZKC B;  3HOX B;  1S5F D;  1EY8 A;  1RTO A;  1QWY A;  2KJX A;  1RTN A;  4A93 B;  1LAB A;  1W6K A;  2F03 A;  5EPK A;  2EXZ A;  2D62 A;  4ULL A;  1JOQ A;  1WTV A;  1CTM A;  1AZP A;  4YIJ A;  1AEX A;  5IGF A;  3UI2 A;  1WCM B;  2D5D A;  4OO1 I;  5M3F B;  4M1U B;  1EQT A;  4BA2 I;  1E0B A;  5KGU A;  4RGT A;  1LTG D;  1PFB A;  1XYI A;  3DWP A;  3GQB A;  4IFD G;  4MIU A;  5JEA J;  1DYQ A;  2A6E C;  5DM6 3;  4HCS A;  4KHV A;  1TR5 A;  4NP5 A;  4TSS A;  3R2I A;  4X3S A;  1KLU D;  3O13 A;  1D5X C;  1SFO B;  4RA8 A;  3IFT A;  1Y69 U;  2MGS A;  4RCO A;  1AN8 A;  1F9S A;  4R9W A;  3EVQ A;  4A3E B;  1YNN D;  4CJ2 C;  4ME5 A;  1D1K A;  3PMF A;  3SK5 A;  1FD7 D;  5EJW A;  2IPK D;  4DFA A;  2E2D C;  4CBV A;  1WTP A;  4FF2 A;  5CV5 A;  1AFP A;  4R8I A;  1BCP F;  4M8A A;  5IT9 L;  3NUC A;  1LTT D;  1GUW A;  5CV9 A;  5CV8 A;  4IQZ A;  1SYD A;  3HOY B;  2IL8 A;  4PMW A;  1STA A;  3PO2 B;  3M7G A;  4XTC S;  4DK0 A;  3FMC A;  1XTC D;  2F4I A;  3S16 B;  4XDX A;  1J8I A;  1IHZ A;  5J1Z A;  4DU9 A;  1U4M A;  4HCE A;  2DNC A;  4K2K A;  4EVO A;  3V2T A;  4A3F B;  1NSN S;  1HQR D;  4PMB A;  5IIF A;  4ZUJ A;  1A2U A;  1D1I A;  1LTS D;  3OW7 A;  2F0P A;  2N88 A;  1JWU D;  3ND9 A;  3BG3 A;  3EQL C;  2DN8 A;  5E4X A;  3NWS A;  4OGQ C;  1WD1 A;  1D6E C;  4DXF A;  2VUM B;  1DXM A;  5IGE A;  5ELD A;  2NN6 I;  2K5Q A;  1HTL D;  4RGO S;  5EKL A;  3T51 B;  1M4V A;  2H4O A;  2K32 A;  3FVQ A;  2LKV A;  2A6H D;  5C3W A;  1Q1E A;  4A3D B;  1EIG A;  3S15 B;  2L9H A;  5C4Z A;  3URY A;  3WDN A;  2RVL A;  2C5C A;  5BN5 A;  4Q5V A;  1EZ8 A;  1TVX A;  3K5O A;  2SNS A;  3Q6S A;  4HTH A;  4U67 3;  1EYD A;  2VXW A;  3BS1 A;  4OIJ A;  2YU9 B;  5ELC A;  5K5P A;  3M4O B;  3V05 A;  4ZRZ A;  2K5W A;  1HHV A;  4FNF A;  1LTB D;  1ZYR D;  1DON A;  4XYO A;  2M9V A;  5A35 A;  1K8M A;  2F0U A;  1BUV T;  3E6Z X;  4DXG A;  1GJX A;  1ENA A;  2DNE A;  3BVM A;  4CJ1 B;  1BBX C;  2KA7 A;  5KYL A;  3NWT A;  4IFD H;  3SK6 A;  3NPP A;  4EQN A;  4RFB A;  2M00 A;  3T16 A;  4FO2 A;  4FXD A;  1JB3 A;  1ICW A;  2CW0 D;  1ZEQ X;  5C0X J;  5C6A A;  5FK9 C;  1BR9 A;  3PIP 3;  2JXM B;  1QG7 A;  5KNB A;  2F0W A;  3VYT A;  4K5V A;  3U9S A;  2D9U A;  1C4Q A;  2QDB A;  4RKB A;  4KHZ A;  1CA6 A;  1LAC A;  5I9O A;  4KTA A;  1H9S A;  3VA7 A;  1YNJ C;  3OIP A;  4KMU C;  4XXE A;  1BF4 A;  3D4W A;  3PIO 3;  3NTK A;  5KNC A;  1ILP A;  1JIC A;  2D2C C;  3S2D B;  1PRT B;  2KVM A;  2L4N A;  1I4G A;  3QOL A;  3GTG B;  1CQF A;  5EBD A;  2N55 A;  1TS3 A;  1EY0 A;  3VR2 A;  2JYO A;  1SJH D;  1PMR A;  1XXG A;  2SDF A;  4WRD A;  3R8B A;  3QWN A;  2ICE C;  3S17 B;  4WJW A;  1BCP C;  2B2V C;  3P75 A;  4BY7 B;  2Z1C A;  1G6Z A;  1B9M A;  1MI2 A;  2NBF A;  4KY7 A;  2B2W C;  1CHQ D;  1OXV A;  2F0N A;  3GD7 A;  4ZYS A;  4G7O C;  1LT3 D;  4NMZ A;  2XWB B;  4CHT B;  3BYY B;  5IGC A;  1HCZ A;  2BA0 A;  1ET6 A;  4L6T B;  2PMZ B;  1D5M C;  1HQM C;  5TSS A;  2K6A A;  2KCN A;  1F9R A;  5D14 A;  4A3M B;  1UUP A;  4I65 A;  2R6G A;  3TSS A;  1H9R A;  5FO9 B;  1GUN A;  1B9N A;  2RSN A;  2B2V A;  1K8O A;  3MXP A;  3Q22 A;  3IAY A;  1CZG A;  1BO0 A;  1STN A;  1I4R A;  4X3T A;  1HFG A;  3HEJ A;  3LX0 A;  4X3K A;  1WTO A;  4C3H G;  1KNE A;  2RBM A;  4QIW B;  4J1M A;  4DGZ A;  5C4X B;  4A3K B;  2XSC A;  3J81 E;  2PW5 A;  2WP8 J;  4V19 0;  1G2T A;  1ESR A;  2H1E A;  4C3J B;  4G7H C;  2LMC B;  1KAB A;  3N52 A;  5HUR A;  5EKI A;  1B50 A;  3IL8 A;  1EIH A;  4X3U A;  1S5C D;  4UDU C;  5C0X I;  1C48 A;  1Y8N B;  4TRD A;  2Y0S B;  1QJO A;  3DMU A;  1ZXT A;  2RDH A;  2IX0 A;  3HOZ B;  1PTO B;  2F0L A;  3A54 A;  3BZD B;  4IUP A;  1V1P A;  1LV9 A;  3JAM L;  1O78 A;  3L3O C;  5CYU A;  1R4Q B;  5A2Q L;  3D4R A;  4RCN A;  3K59 A;  2B8F A;  2ZXP A;  2OT2 A;  2E2I B;  1TS2 A;  3EJI A;  2NWG A;  2WV6 D;  2QIL A;  2F0T A;  1U9R A;  1FNU A;  4IUR A;  2C9O A;  4RH6 A;  3D8G A;  2ID0 A;  1V8Q A;  1OO9 B;  2XIW A;  1O80 A;  2JE6 I;  4C2M B;  4J6H A;  4FF4 A;  2RQX A;  4ZQ3 A;  4IUQ A;  4G7Z C;  3K5L A;  1NAP A;  3A55 A;  1I6V C;  1I4P A;  1R4P B;  2PO4 A;  5C5L A;  2Q8R E;  3GTK B;  3MWY W;  5C4H A;  2F0O A;  2F0K A;  2KOL A;  2VB3 X;  2A69 C;  1DM0 B;  1GUG A;  1BXT A;  3RD4 A;  5G3L D;  2BE5 D;  3HOW B;  3DM1 A;  2BOS A;  2A74 C;  1EU3 A;  1TWH B;  1JOK A;  4ZAI A;  1Y1W B;  5ELB A;  5CGK A;  3FKI B;  1SE4 A;  4OO1 G;  3P1H A;  2E76 C;  3HG9 A;  2RSO A;  1MD2 D;  1A6X A;  1LTA D;  3I3C A;  1F2Y A;  2VB2 X;  4NDX A;  2NVQ B;  5FKA C;  1G91 A;  3MVV A;  2BA1 A;  2A73 B;  4BA1 I;  3MC0 B;  1TWC B;  1RKN A;  2HCI A;  1WTR A;  2BCO A;  1B4O A;  5E3F A;  2R61 A;  3CKI B;  3HP3 A;  2EVB A;  3S14 B;  1IW7 D;  1VCI A;  4QCL A;  3X3N A;  5C44 B;  3RZD B;  5JAV A;  2E75 C;  5K36 H;  3PUV A;  5IGD A;  2IWH A;  4ZK9 B;  3J7Y W;  1STE A;  4G57 A;  2A68 D;  4LAA A;  3L7Z C;  3R2T A;  4N9P A;  4C1N I;  2AWN A;  3HOV B;  4PNY A;  1F9Q A;  1VDZ A;  1KDC A;  5CV6 A;  5J22 A;  4KY6 A;  5DAU A;  4XQN A;  1ENC A;  3ERQ A;  3MXG A;  1HRJ A;  1TQO A;  3A8I E;  2J4X A;  1TY0 A;  1PRT D;  4I7Z C;  1C8C A;  4DN4 M;  5ISR A;  1TWA B;  5CMD A;  5FO7 B;  5FLX L;  1S5B D;  5IGG A;  3EFX D;  5E1F A;  2VNU D;  1KNA A;  2WAQ B;  1HXY D;  3KLR A;  4HR7 B;  5M3M B;  1H9K A;  1WVL A;  1STY A;  5M5Y B;  1A2T A;  2TMP A;  3VR5 A;  2WII B;  3BVG A;  3CHB D;  3I8Z A;  2F0J A;  1B44 D;  3RLF A;  1Y8O B;  2B39 A;  5I2X A;  3I73 A;  1FYC A;  1ZYR C;  2IX1 A;  4EQP A;  1H9S B;  5CV7 A;  2AQ1 B;  1SMY C;  3TDQ A;  2MPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...