2WKDA

Crystal structure of a double ile-to-met mutant of protein orf34 from lactococcus phage p2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
79
Chain Sequence
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEVKVAYGSAFMPDFIQMGDTVTVSGRVQAKNYNFVFPTVEKVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Dna binding protein
molecule keywords ORF34P2
total genus 10
structure length 79
sequence length 89
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkdA00
2WKCA 2WKDA
chains in the Genus database with same CATH superfamily
3QB3A 3N6RA 3UDGA 3VYSA 1W6JA 2PO4A 3A74A 2B2WC 3CMEA 5C6AA 3MC0B 1NUCA 4JI6Q 3M4OH 5JJIA 4BY7H 5GAGC 2BH8A 1JQYD 2HIXA 3V2TA 1OXSC 2ATWA 2B63B 1D1KA 4HIDA 5KYLA 1A6XA 1V9PA 3FVQA 2RCFA 1TY0A 1EWHA 3M4QA 2EXZA 4IOAA 3IAYA 1Q82C 1VQBA 3KDFA 4A3IG 2BOSA 3LGJA 1H9JA 2MUYA 4R1JA 3G71A 5T1GA 4JI1L 5H1SE 2NZOA 2LY7A 4ZCKA 2JQOA 4ME3A 1FGUA 5CV8A 3UDIA 4DNRB 3VYUA 5KNDA 4LFCL 4J15A 2P5ZX 3OOCA 4GN3B 1AZPA 1ONLA 4F88A 3NQTA 4NP5A 2F0FA 4OHJA 3QIAA 3S2HH 2ZTDA 3Q0AA 1Z6HA 1PRTD 1EQQA 1CQFA 2L0CA 5NUCA 2DJGC 3CXCA 1CK1A 2KCCA 5BN5A 1UWVA 1HNXL 4CJ1B 4XT3B 3JAML 1X3FA 2FJ2A 1IBKL 1SAPA 1VF5C 4OX9Q 2K4KA 2EDGA 2N49A 1SFOB 3KF8A 5HURA 3L3OC 1Y69U 5FO8B 3HOVG 2K14A 1G2TA 5C4HA 1KHIA 4B9XA 2HT1A 1RCVD 1A3VA 1I94Q 3E9HA 2QILA 4RKBA 2E2HH 3L7ZC 3T13A 1J5EQ 5CORA 1GUNA 2RQXA 4HIOA 1JWSD 2R7DA 1ZYRD 2D0OA 1F9QA 1KD1C 2B2TA 3IFTA 1B4OA 4GNXB 4JI7Q 4DV0Q 2LSSA 2KHIA 1IW7D 3FEWX 3OIPA 3T16A 4C3IG 4JC0A 2R3ZA 3CF5A 3PF5A 5IP9G 2UUBQ 2F0VA 1EWIA 1VQJA 1I6HH 3C46A 3S9WA 1M1KC 4RA8A 4A3DH 4DV4L 4KN4C 5C3EH 4DV2L 5GAEC 3CCUA 1MJEA 4BY1B 2B2YA 3A7AB 4QMGA 3CPWA 3VR4A 1JE5A 4YY3Q 5C5LA 3E6ZX 3A54A 5M5XB 1FR3A 1STEA 2K5NA 3GTKB 3DMUA 2AUKA 1EZ8A 3NBHA 3RZDH 1I4HA 4KY6A 1HUMA 2B2TC 4K14A 2WAQE 1OTCA 1RTNA 4HAEA 2PQEA 5JPNC 4JI6L 5CR3A 2E76C 4NXMQ 2M2LA 1PZID 1PH2A 3VYTA 1VF7A 4YHHQ 3MTSA 4A3IB 1EIHA 2OTLA 1JB7A 2UUCQ 2KBNA 4QGUA 1PH9A 3SVMA 1WTXA 4IN3A 1ZKOA 4BXXH 3HOVB 1GUGA 1FNUA 3I4LA 3BS1A 1I4XA 3HOXH 2CWAA 4DR6L 2D5DA 4K8JA 1QCBD 1WTOA 4X3TA 1TIID 4IALA 2Y0SE 1NR4A 5C3XA 3M85A 2A5HA 2ENBA 4CDCC 1WCMH 4EQNA 3WOEA 1IBMQ 2YYZA 3KJOA 1A2UA 3TN2A 3Q6SA 4DR7L 1F9RA 2K5WA 1I4GA 2MHVA 3NHHA 3TP5A 4ZLTF 2D2CC 4GOPB 1UEAB 4WORA 4O2DA 4H02A 4O0AA 4KK7A 5G3LD 3PUZA 5IODA 2OT2A 4MIUA 1MGSA 3D6WA 1H9SA 3F2BA 4HCEA 5DM63 5JJKA 1J5EL 5C4JB 4A75A 4LF4L 2E2IB 1U5KA 1EEFD 1FGBD 5J1ZA 4PMBA 5M5WH 2L15A 1A3TA 4FXGC 3TZDA 1PYWD 3Q23A 4HJ5A 3R2IA 3TS0A 3ZYYX 2XN9C 1KAAA 3S1QB 4GN4B 1I50B 1HZBA 1NMFA 3DWQA 4QY7A 3PUWA 4JOIA 1HUNA 4KY7A 4M8AA 2MJ8A 2EY6A 3K8AA 1W3SA 4IFDG 1D7QA 1B70B 2K5DA 5D3IB 4CKEA 2R93G 4DV4Q 2DN8A 2ZTCA 4DXGA 5FJ8G 2B39A 2JA9A 4DAPA 2E8GA 1HZCA 2RCNA 2RSNA 1ENCA 4JBJA 1Y14B 4V0BA 2GA4B 1U9RA 2DGYA 4LFBQ 4JI3Q 1LT6D 1HNZL 4EX5A 3M3YB 3MXNA 1STHA 1QVFA 1PH4A 2B2YC 2K5QA 2K01A 1XYIA 1W2BA 1VQCA 3M4OB 4ZK9B 1NTGA 2Y0SG 3HKZB 1BCPF 2OWOA 2JA7H 4A3FG 4DK6C 1VS0A 4L6TB 2Z4IA 1ZYRC 3SK4A 4DV6L 1B9MA 1IHZA 2I5MX 4C3HH 3RZOH 1SNPA 3KK7A 4OWWB 5C5MA 4ABNA 4KKTA 1DGSA 4IFDH 4BBRH 1FNWA 4HSVA 1ZXTA 1WTWA 3I4MH 4TKOB 1MSHA 3CW2C 2NTSA 4X62Q 2CWPA 3KJPA 3H3VI 1LV9A 5JVG3 1DZ1A 3HOUB 3PCOB 2F3IA 1O7IA 4XQJA 4KJNA 1B2TA 2UUCL 5LMNL 3GTJB 3VR2A 4CJ0B 4B9WA 5C4XH 2A68D 2XVSA 1E24A 2IW3A 1STNA 1S5CD 1N34Q 3I4OA 4C3JB 1SYFA 4JG2A 1ML0D 5FO7B 4LUOA 3BJUA 1Q46A 1VQFA 1B3AA 1IXRA 1NNXA 4HCSA 2UU9L 3AB9A 3U4VA 2UXBL 1QE6A 1YNXA 3B6YA 1QNUA 4FP5D 4V190 4OO1G 5JJZA 3MWYW 4OIJA 3CMAA 1IBKQ 4L5RC 2R92G 1SE3A 1D8LA 4GKKL 1XPOA 1GUOA 2PCFB 3T1HL 4LF7Q 1KIXA 2E2HB 3S1NH 3TDQA 2L1BA 1KTKA 4ODGA 3E0JA 2OF1A 1N9WA 4JI8Q 3UI2A 1LUZA 1J9OA 4RFBA 2AHOB 5JOBA 1T5EA 3BZKA 1D2BA 1DYQA 3OHXC 2UXCQ 1ILQA 1YNJD 4HR7B 1CZGA 5IGEA 1AW7A 2NVXB 1TWHB 4JI3L 2CCZA 1Z47A 5I4DA 3K81C 1TT2A 1YZ6A 5L37A 2F03A 2UUBL 2QDBA 3KOJA 2IL8A 1Y8OB 3QR8A 1VQIA 1PDQA 2F0IA 1EYDA 2AQ3B 4H0LC 5E1FA 4KHPQ 1A15A 1GUSA 4DUYQ 4FF1A 4C3JG 2EJMA 1G6ZA 1U4MA 4HJ8A 1CKMA 2AWNA 1N32L 1F9SA 1S5DD 1HXYD 1BOSA 3RZDB 2CH4W 2MNAA 1E1TA 2V1CC 2F0JA 4A3GB 2O5JC 1GUWA 1TVXA 3KF6B 4R9WA 1ASZA 1KQSA 2AWOA 3J80c 3JAMi 4O1NA 2VB2X 4A3IH 1AN8A 5FLXc 2PQAB 3GTGB 1DXMA 4YWMA 4FYDA 2Q2HA 4JBMA 3STBC 4GLXA 4A3FH 1SYEA 1G8ZD 4K5WA 1D5XC 1EEID 1Q90A 1BQQT 1L0XB 2O4XA 3SEBA 1JJCB 1XX8A 4GLVB 4MZ9A 1HZ9A 2O2LD 3BYYB 2WIIB 3I4NB 4OO1I 4KKUA 3DEOA 5CC4A 3A55A 4U673 4DR4Q 2QDLA 4DK3C 4XQQA 1GUTA 1Z7TA 4AYBE 1M4VA 3IRBA 4LMQD 3I91A 4DAYA 2WP8J 3DLLA 4P74A 2JA8B 2HDMA 2XSCA 3KDFB 4BWGB 3GTQB 2ZXOA 4A3CG 5C44B 1J8IA 5HGQA 2IHFA 2WB1G 1SNOA 2NVYH 1BKBA 2UXDQ 2SNSA 4IOCA 1PRTB 1BCPB 1N33L 4FDBA 1SROA 1K8AC 3HOZB 1B53A 4OXPA 1BBXC 1TKWB 2EE1A 4DK1A 2E2DC 2RF4A 4A93H 3K6OA 4HMIA 2E74C 1AH9A 2M9VA 5KIXA 1C8CA 3GDEA 1BXTA 5KNBA 3S1QH 4QIWE 1HNWL 2KQ3A 3NPPA 4CJ2C 1W6KA 1R9TB 1LM0A 4A3BH 5G3LF 1EU3A 2H1EA 4POFA 4PQXA 4GKKQ 2A8VA 3IFDA 1MSGA 1B8AA 4K0KL 4JBWA 2VL6A 3KBGA 1JC7A 2MGSA 2MPMA 3A5UA 1RTOA 1S5BD 2F0KA 4GN5A 1EWCA 5BR8L 4JI4L 3HOXG 2F0WA 4IJLA 4HEDA 3W5OA 3PO3G 4LFAQ 4UP9A 4RG1A 3GTMB 4KHPL 4QIWB 3GTOB 3EROA 1VQHA 1EOVA 4B3MQ 1HCZA 4F87A 3M7GA 1HRJA 5JAVA 5IT9c 3L0OA 1HA5A 5LL6S 4UAIA 1DOMA 4ZKCB 1YJ9A 5DM73 5KYIA 1HTPA 1SN8A 5IGGA 3QOLA 4CDDC 2H4OA 2TMPA 3PO2G 4DR3L 4NDXA 4A3KB 5KEEA 1E0BA 4L5TA 1GHKA 1F2MA 2H5XA 3PUXA 1X65A 3HOYB 3T1YQ 4X66Q 2F4IA 1HR0W 1CA5A 1VQLA 3SDZA 3RZOB 4L5QA 1DOKA 1TS3A 4RAUC 2DY7A 4P72A 2VQEQ 1HQMC 3CCVA 2FMCA 3HG9A 1WD1A 4KV6A 5EPJA 3H15A 3K58A 1E22A 4X3UA 4DV6Q 3I4MB 2PZWA 3CCRA 4N8FA 1WYDA 1C9OA 1IYJB 4FF2A 3HOUH 4A3KG 5D3DA 2KVMA 1XNRL 2KOLA 4R4CA 4A4IA 4JI1Q 4DV3L 3NUCA 5AFWA 3Q24A 3AU7A 4DV1L 4JBKA 3FP9A 1WTPA 5C4XB 2DY8A 2XIWA 2XRQD 3A56A 1LTSD 3F8TA 3H0GG 2HD3A 1SDFA 2CQOA 1RIPA 5EAYA 1VQ9A 4RGNA 4KHVA 5C0XG 1G6PA 2N88A 3ULPA 3P75A 2LFNA 5C4ZA 1DONA 5IE8A 1WTRA 4DR4L 4YCWA 4DR6Q 2MO0A 2F52A 3H09A 1VQ6A 1Y8PB 1UNSA 1PTOH 2EY2A 5LMUQ 5I6WA 2B2UA 4FF4A 1EQVA 2ID0A 2OQ0A 2EJFC 1F2LA 1TWFB 2EYMA 1IBML 4L5SA 1R4PB 4XDXA 2JA6G 1I3QB 3S1NB 4JPBW 1KLUD 3PO3H 3TP8A 3K7UC 2RHQB 1N33Q 3GP7A 4EQPA 5IYCH 3K57A 3EBEA 5I9PA 4JK1C 1L2FA 1V43A 3OSOA 3I7FA 4JI8L 1I6VC 1KRSA 4R4IA 1SYGA 1I4RA 1X3QA 1HNWQ 3RR5A 2A68C 3EVQA 3GV3A 4TRDA 5ELOA 1X9NA 1F2ZA 2UXCL 4DGZA 1A3UA 3CCMA 1Y1WH 3CQZB 4IPDA 3PIOA 3BVMA 1H95A 2EIFA 2RHSB 5FO9B 2E2JB 5IWAQ 4X65L 4K6DA 4WJ4A 1UUPA 4A3JB 1JR0D 4JI4Q 1EIYB 3DHQA 1E7ZA 3LNNA 2JA5G 4FNFA 1UAPA 3HKSA 4XYOA 2A6ED 2OTJA 2JSOA 2Z6BA 4GKJQ 1WCMG 3I73A 5DLQE 3T53B 4ZRZA 1KNEA 1PH5A 3T56B 2JYOA 1YI2A 3QO2A 4UDUC 5DEHA 4YY3L 2QEXA 1MBYA 3RLNA 2ICEC 1A62A 3C2PA 1K0RA 4DR2L 2ZM6L 4A3FB 2HUGA 5C0XI 3RLFA 2JA6H 1EU4A 3U9SA 1AFPA 3FPPA 3MXUA 4QF4A 1SLJA 3L2PA 3MHBA 2CKZB 2DJFC 3R2TA 1L1OA 3FMCA 4DV1Q 4BY7G 3EA6A 1YIJA 3I4NH 1KL9A 1MKHA 1WTVA 1PFMA 4R8IA 1CA6A 3SE0A 5JJLA 1XMOL 1O7ZA 2BE5D 2ZJRA 2OCEA 1HHVA 4MHEA 2JA8H 1XJVA 3OIQA 3GTQH 3MXGA 3R93A 4S3SA 2E5LL 5C44H 4DR1L 1WFQA 4PNYA 3DWAA 2F0HA 4Q5VA 1X56A 3I90A 3K5LA 4WJWA 1YJWA 1IW7C 2WINB 4X64Q 3GTPB 1S5FD 1QWYA 4TVAB 1S3OA 4O42A 1HZAA 4KJOA 1Q8IA 3CP0A 1VMCA 1QJOA 2F0QA 3GO5A 4A93B 1K8OA 3MEFA 3U50C 5GQOA 3TZUA 3K7AH 1NCVA 2NN6G 1SYCA 5K5PA 4EQOA 4AQYQ 3S15H 4XIGS 4X3KA 1T5XD 1E2WA 4IUVA 1DOLA 1PYBA 3RD4A 2R92B 4JVZA 4IQZA 1CSPA 4MN3A 1X3PA 3K80C 2RVLA 1HH2P 1V1PB 2VS1A 2C9OA 2A69C 1IBLL 3D4DA 3NQIA 2I5HA 5GROA 4I7ZC 1TY2A 2FXQA 3LWEA 1N36Q 4KHZA 2R7ZH 3HKZE 5EPKA 4OL7A 3WOFA 5FKAC 1LLRD 3K5OA 1GD7A 5IIFA 5BN3A 1GVPA 3GTLB 1K3RA 1L1OB 2F4VQ 1L0WA 4BBSH 4DUZQ 1O7YA 1V8QA 1EQRA 5IYDG 1N8RC 4DV5L 3DM1A 3A8IE 2WAQB 3PQIA 1K0SA 3GD7A 5KRUA 1X54A 1IKLA 1TR5A 1TS2A 4N8X1 2K03A 1PZJD 4OGQC 4MTKA 5IWAL 5HGTA 3J7AV 4UPAA 4JW0A 1QZGA 4BY1G 4A76A 1RODA 3NBHB 4QJFA 2ES2A 3M7NA 4DUYL 1STGA 2WKCA 2ZM6Q 2NVTH 1DM0B 4NXNQ 1FJGQ 4GLAC 5BN4A 1CZWA 1C48A 2B2VC 1SSOA 1VQNA 4JCVE 1BO0A 2NYZD 1MJCA 1E2VA 3NELA 1CKOA 3AYHB 1K3BC 1LTLA 2K05A 2K7VA 1NY4A 2N3SA 3J81c 2JA8G 5ELCA 2LXKA 4LF6L 5IGFA 4G7OC 4BY1H 2F0EA 2Q2TA 1UE7A 4NXML 3K5NA 1E3PA 1Q7YC 4NKLA 3AEVA 5IGBA 2EY5A 2EXDA 4MNOA 1U4RA 4RWSC 4DA2A 3A5ZB 2QGQA 1EYAA 2QW7A 3MFGA 2PI2E 5LMNW 1I4PA 2B8GA 1YJNA 1Z9FA 2K52A 4FVMA 3SK8A 1HTLD 3K5MA 4DR1Q 1FD7D 1PH3A 4RGTA 1UEBA 2SNMA 4WRDA 1B44D 4KMUC 1VQOA 1CUKA 1C7YA 3KLSA 4PZ7A 1M90C 1ICWA 4U68A 4DNTB 5LMNQ 4L8JA 1SRUA 4A3MH 3P7JA 2Z4HA 3C1FA 4CGYB 1RL2A 3U4ZA 1EFID 5IYBG 4R4OA 1TWFH 3CCJA 3AFPA 1F2YA 1FYCA 3NSWA 3IL8A 1H9SB 3HOVH 1DJRD 1LTRD 1O7LA 5E4WC 2N55A 3PUVA 3PO3B 3RNUA 4DV7L 3V96A 3HOXB 3D4WA 4QUCA 2IPKD 3HP3A 4LF9L 1SBBB 2K33A 4OWXB 3HZXA 3K59A 3KYHC 1QVGA 1C4QA 4P71A 4RH6A 3AMUA 4APVA 3J7A5 2IX0A 2QCPX 3D3RA 1KDBA 1HFGA 1SJED 4WFN3 3C3LA 3H94A 3E0EA 1KDCA 4K5VA 3DXJC 4UP7A 1LTBD 4IJHA 3S17B 2DNCA 3CKIB 2WB1E 2Q2IA 4IZ8A 2VQFL 3CQZH 2D62A 4DV5Q 4BA2I 1IBLQ 1CFMA 4IUUA 3D31A 3I8ZA 2KHJA 1CSQA 4B3RQ 5M5WB 2NN6I 5DNFA 1ICFB 2YU9H 2X69A 1YEZA 5DAUA 4JOIC 3CPFA 1J6QA 2OEOA 3AQQA 2RDHA 4ME5A 1EQTA 2Q2UA 2PW5A 1HNZQ 4DF7A 3F2UA 1AE2A 5COYA 2WV6D 4LUVA 2L9HA 3H6MA 2EYLA 2NB0A 3MFYA 3CC7A 1JJ2A 1XMQQ 5IGCA 3NEMA 1XNQL 5I6YA 4X6AH 3FKIG 3PV0A 2R7FA 2IJ0A 3KLRA 3VDYA 2L12A 3E3XA 4GKJL 2BE5C 5IT9L 1X32A 2J0TD 2B3GA 2JJQA 1N32Q 3OW2A 3ERSX 2HCCA 1WOCA 2XRSD 3MXPA 5FLXE 2JA6B 4P73A 1JE4A 2F1MA 2CHBD 1IYUA 5FK9C 1K83B 2NBFA 4F8MA 4L63B 1G51A 4DR2Q 1ET6A 4UP8A 3JAMc 1YVCA 1NAPA 2NVQH 3M4YA 3HRZC 5K36G 2ASBA 1Y1VH 4C1NI 3I56A 1EZ6A 4FO2A 4DAYB 2JA7B 1SR3A 1PZKD 4DNIA 4R8NA 1IKMA 2NTTA 4YIJA 5EBCA 5EPLA 5I2XA 1SMYC 1OXVA 3JAME 1BUVT 4C3HB 2EY1A 1XMOQ 1JB3A 2YTXA 3SXHA 1PFNA 1S4ZA 3GTPH 3TBIB 1RHPA 2F3VA 3T51B 2PZUA 5M9OA 2R61A 3PUYA 5IYDH 5CV9A 2LMCB 1EYGA 2AKWB 3NBIA 4LK1C 3W2DA 4X3SA 3K0XA 4XQNA 2ZTEA 4X64L 2Z6KA 4DN4M 2CH4A 3D4RA 3S15B 1RKNA 5IP9H 3TREA 3W1BA 1KDAA 2EQSA 5CGKA 3D0FA 4OONA 3GTJH 1CKNB 1XPRA 3HOYG 3S14H 1YITA 1H9RA 1KLGD 1VDZA 1B50A 1PH1A 1PTOD 4DAVA 1EFWA 1L0YB 3S2DH 3ULLA 4LF7L 1JOQA 2F0LA 4I7AA 2K5HA 2F0MA 4HJ9A 2HHHQ 3IKJA 2LXJA 4KD3A 4OEMB 2EJGC 4HJ7A 3T1HQ 4CHTB 4CKCA 1ENFA 4BS9A 1VQKA 4DR5Q 4ID6A 3E9IA 4J1MA 2WFWA 1FL0A 2MO1A 3FKIH 4BBSB 2WKDA 4JI5Q 4JI7L 4E6IA 3KBXA 3RUZA 4CDFC 1F77A 3V05A 2ZJPA 3J80i 5M3MB 4YWKA 1WVLA 5K36H 4DFAA 1SNMA 4IUPA 2AMCB 1VQ4A 2BA1A 2DNEA 1MD2D 4G7ZC 1XNQQ 2R93H 4A3LH 4BY7B 2PYKA 1TWAB 4B3ML 2B63H 4MTNA 4JI2L 4I65A 3CC4A 5IY0A 2CQAA 2NWGA 4P75A 3HKZG 2X6GA 4ULLA 3J80E 3C1EA 3PIP3 2L4NA 1PRTC 4GOPA 4OELB 1HA6A 3TQYA 5JEAH 4GOPC 1K8MA 5HY6A 1TS4A 2MFIA 3WDNA 3BDOA 2A69D 2Z6KC 2B2VA 4X66L 4F7XA 4B08A 1JMCA 1IZ6A 4C1NK 4CKBA 1G291 5CV6A 3SK5A 4A3MG 1QB5D 1VQEA 3CAMA 2D9UA 4DKAC 1HJPA 2R7ZG 4J8QA 2PNHA 1KABA 2IY5B 4G4KA 3ERQA 4NMZA 2WACA 2D0PA 4UHVA 1YHQA 4A3GH 1LYLA 4XYQA 2V4DA 4OO1H 2RSOA 4GZYC 2A6EC 2F0PA 2KUMA 5LHY1 3OMGA 2KENA 3P1HA 2ZT9C 2RDFA 4A3MB 2B8FA 3GQBA 3VA7A 2K50A 2XWJB 4IPCA 1STYA 2KCTA 2OQKA 3DWPA 3CCSA 2N8NA 1HR0L 3UE0A 1OXTA 4BXXG 1BDOA 4LW1A 1D5MC 1E1OA 3TEHB 1NMGA 1HPCA 5C3WA 1TXYA 4Y7NH 5J39A 2E5LQ 4KTAA 4DR7Q 3PMFA 2K1BA 3NXWA 4FXKC 3TSSA 2K75A 4IUTA 1WJJA 4A3EG 1PHJA 2WB1B 1ILPA 4K2LA 1SYDA 5ISRA 3KLSX 3ND8A 3HFZB 1BVSA 2QA4A 3O13A 3G7LA 1IYVA 5IYBH 1EY4A 4RHRA 4LF5Q 4JV5Q 2EPBA 1PA6A 1Y1VG 1PMRA 3S1RB 1CHQD 1UE5A 3NE5B 3J7YW 1ENAA 1I6HB 1I94L 1NBWA 4LAAA 5JPMC 3M4PA 4ZQ3A 4A3DB 5C3EB 2YTVA 1EOTA 2YU9B 3J81i 2ZXPA 2KCNA 2EYPA 2PZTA 5FLXL 4DR5L 1LABA 1PLFA 1D1IA 4FXDA 1D6EC 2IT1A 1O80A 4A3BB 2JA5B 4C3IH 2MQHA 5J22A 2BH2A 3FRPB 3RLOA 2VZAA 5AJ3L 3J81j 2UUAL 3GTKH 2PW7A 1HFNA 3QJYA 3VR5A 3VR6A 4R4TA 1STBA 4JYAL 4P2CB 2A1AA 2CW0D 1JT8A 4IUQA 3H3VC 2RDGA 4KN7C 1YHAA 3HOUG 2HQEA 4A3EB 4NW2A 2GN5A 3FDTA 2A6HD 1MI2A 1BF4A 3MA2B 1PRTF 4DR3Q 4PZ8A 3QWNA 1CI3M 1L1OC 3H0GH 4XXEA 2X6LA 2VQEL 1QILA 3U58A 2QEJC 5I2YA 4NXNL 2A19A 3TMEA 2NVQB 3CD6A 4QUFA 3KLWA 3PSIA 1S40A 3W1GA 4JI0L 5T1IA 5EKIA 1Y1VB 2DUDA 1PFBA 5IP7G 4A3KH 3TRZA 3F1ZA 5FLMH 4EQ5A 2PNRC 4LWCA 3BDCA 3ER0A 1WD0A 3EN2A 1KC8C 4YHHL 3EIVA 4LF8L 4X62L 4DV3Q 2C35B 2CW0C 1OXUA 3D8GA 3QOJA 3PO2H 2RBMA 4B3TQ 1GOZA 3A0JA 4IO9A 2F0UA 3EFXD 3DM3A 5ELEA 5EQ0A 4LFCQ 5E7NA 4CBVA 1LTID 2JEAI 2KCMA 5KNCA 1VQMA 1NSNS 2EYJA 5E3FA 3EQLC 3DUZA 4A3GG 3TS2A 1GXDC 3T4AC 4A3BG 2Q8RE 3W3AA 3HEJA 1NR2A 4N9TA 2UXBQ 5FJ8H 3HOWH 2BDNA 1V1OA 2ICIA 1OXXK 3J81L 1SE8A 2Q8TA 1SMXA 3CC2A 3MZ5A 1I50H 1S72A 5F2DA 2A73B 1I5FA 1PXUA 1AP0A 3OTOL 3UDXA 4IUNA 4K8IA 4ILWA 3A7LA 1VQPA 4AIMA 1FNVA 1SEBD 3G6EA 4HTHA 3BYTB 3NWSA 2VB3X 3WWVA 1X6OA 2PQAA 2Z1CA 4G57A 1TWGH 1PTOB 3CU7A 3H3VH 3FKIB 4LF5L 4JV5L 1SNCA 4H44C 4QB4A 2HHHL 1BCPD 3CCLA 5M3MH 1I3QH 5IOCA 4A3LG 3A8KE 2G9DA 3CRLC 4K0KQ 3OMCA 5ELBA 3M3YH 4C2MH 1GM5A 4RCNA 2NZ1D 1TWCH 5IP7H 1H9MA 4DU9A 2IX3A 1Y8NB 2VUMH 1K9MC 2R93B 5AJ3Q 3CHBD 1QOHA 4HMJA 2VQFQ 5EKLA 2EOTA 1PYSB 1H9KA 1EY6A 1TWAH 4AYBG 1YNJC 4B3SQ 2XGTA 1EUJA 3PIPA 4B3RL 5IYCG 1LO5D 3OPOA 1JOOA 5CV5A 3VYRA 4RHSA 1KXLA 2QF7A 1Y1WB 4R4QA 1T9HA 5M3FB 1BCPC 3QG1A 4BBRB 3VA5A 1LTGD 1D5ZC 4ZAIA 1RJTA 4RKLA 1Q81C 4AYBB 4RMFA 1S5ED 3PF4A 3LX0A 1LT3D 2GVBA 1EYCA 3J7ZC 1EIFA 4POGA 1OO9B 4B3TL 2Z8LA 4QL5A 2C5CA 1AZQA 4KD4A 3CCEA 3OW7A 5I9OA 2Q8IB 3FHWA 3F2CA 4JI0Q 3S1MH 4C3JH 1JWUD 2FINB 3HS0C 4KI0A 1G2SA 2PMZB 4NB3A 3S16H 1PFSA 4HSPA 4A3JG 1Q12A 4QCLA 1SXTA 3L9AX 4NPSA 1Q3LA 3SHLA 1HQRD 3P20A 2EYFA 1A2TA 4Y7NB 2F0SA 2F0DA 1GJXA 4IPHA 1EL0A 4PZ6A 2ZXRA 5ELNA 4BA1I 1HR0Q 1QVCA 3RN5A 1U4LA 1N34L 1TU2B 3TP6A 3OTOQ 1X3GA 2UU9Q 4BBSG 2I5LX 5CMDA 4KKSA 5C3EG 2J7ZA 1B3QA 4GNXA 2K6AA 4AQYL 4GNXC 4DK0A 3NTKA 3S1RH 1P8LA 2AUJD 1UE6A 1NE3A 2F0TA 1FVIA 3I3CA 4LF9Q 4OIKA 1QNKA 2NVXH 2EVBA 1TWHH 4IPGA 1PH8A 2EYHA 2VY3A 5D65A 3SR1A 1Y1WG 4PG3A 1Q1BA 2FFKB 3K7AB 5CBAE 1IL2A 2K32A 4EVOA 4Q0FA 2JEBI 1VQAA 1A0IA 1RDPD 1GHJA 2HIVA 5IT9E 2HCIA 2JA5H 4ZKBB 4C3IB 2R92H 5M5YH 4YWLA 3I2ZA 1SNDA 2JE6I 5M3MG 2TSSA 1MHWC 2J4XA 3NWTA 4RCOA 2K28A 1BBUA 4PMWA 4DV2Q 4LFBL 2I46A 2F4VL 1ESRA 4Z9CB 2IWHA 4PMCA 2PMZE 3HGBA 5CV4A 4ZUIA 2R7ZB 1AE3A 4A3EH 3D6CA 1P16A 4LUZA 2HQLA 2Z9HA 1CM9A 1A8VA 1ZEQX 3GTLH 3GTGH 3PIO3 4JYAQ 1B7YB 2QKIC 3KFUA 1KNAA 3H0GB 5JVH3 1CHPD 3T1YL 4KY5A 5C4XG 5EBDA 4BBRG 1WI5A 2JN4A 1Q86C 3K0YA 1ESFA 3UDFA 2A6HC 1QUQB 2XTIA 3JC66 1VQ7A 1VMPA 4LF6Q 1FJGL 3N52A 4OWTB 2B29A 3UE1A 1EY7A 1EY0A 3I4MG 4HIKA 1BBWA 1PH7A 3PO2B 1LT4D 5CYUA 2KHSA 2NVTB 2IHEA 1NJIC 3EJIA 4YCUA 2F0OA 3F2DA 1DD2A 4LF8Q 3J80L 1BR9A 2SDFA 4K2KA 3NENA 5ELDA 5TSSA 1LTAD 2NVYB 2YTYA 5C0XH 3G4SA 5EJWA 2B63G 4HIMA 3M9BA 1VCIA 1LT5D 2KJXA 1M8AA 2I0QA 1ET9A 1U4PA 3OWFA 2AQ1B 3HOZH 3R8BA 4DPGA 2Z0SA 1JORA 3HOWB 5KGUA 4H7BA 1XXGA 2M00A 2E75C 5LL6X 1KRTA 1VQGA 1EY8A 3KUPA 5C44G 3Q8DA 2NN6H 2PPBC 5IGDA 4IFDJ 5LMUL 1GKHA 2CVRA 1R9TH 5GADC 1EIGA 3S2HB 4IFDI 1A63A 1U0LA 4ALPA 3BDLA 3DEPA 5FLMG 1I4QA 2FMMA 4UY8C 2AQ2B 2L55A 2Y0SB 3U9OA 3I4NG 5E4XA 3TP7A 1TWGB 2L11A 4C3HG 4K6LA 5J3BA 3CCQA 1SYBA 1B1ZA 3GV6A 1SFOH 2EYOA 3GTMH 2SEBD 3ONAB 4C2MB 2JK8A 3GTOH 3MXNB 3X3MA 3URYA 2KA7A 1TWCB 1F9PA 3R3OA 4WJ3M 1GO3E 2NUCA 1PV4A 2VUMB 1II3A 3I72A 1PH6A 2G9HD 4DV0L 5CBEE 3OWEB 5CV7A 4QQBX 2IX1A 3Q22A 4JI5L 1CKNA 1E2ZA 3HOZG 1B9NA 2K04A 4G7HC 1Q8KA 2B2WA 3ULJA 5EGTA 4YCVA 4LFAL 2RA4A 3MEHA 1DCZA 1YBYA 1K28A 1KAWA 1XWEA 3HOYH 3FPUB 3RMHA 3S17H 3HOWG 2RKSA 1STAA 3BZDB 1LACA 3X3NA 1JJGA 2F0GA 2XNAC 3G6JB 2VNUD 3SK6A 5M3FH 2A74C 1XMQL 2BCOA 3J81E 1YNND 1VQ8A 1SJHD 2KEDA 1CQVA 3CRKC 3J7AF 1YNNC 2SOBA 1K73C 3NTHA 4J6HA 1VQDA 4N9PA 4HJAA 2L5TA 1JCKB 1C0AA 3RN2A 3BVGA 1ASYA 5M5XH 5JEAJ 2G5DA 4Y52H 1PTOF 3MVVA 2XWBB 4H13C 3MAQA 1IL8A 2EZVA 4ZYSA 1WTQA 1XNRQ 3S1MB 1RF2D 1V1PA 1EY9A 4RGOS 5JEAG 3NK9A 2OXPA 5EKKA 4KLKA 3NTIA 4CDEC 2VUMG 1Q1EA 4ZUJA 4K5XA 4A93G 3S16B 2K5VA 4IURA 2CFMA 2VW9A 1XPUA 4HN7A 3BZCA 3AFQA 1K83H 2ZJQA 2JA7G 2MP1A 4M1UB 3ITPA 2VXWA 1X3EA 3OYYA 1SE2A 3BU2A 3STBD 1SNQA 5FOBB 2JXMB 4EGVA 1SMYD 2BA0A 1AEXA 2I07B 4LNQA 1G91A 2UXDL 1V1QA 3ND9A 1RD9D 2HDLA 4A3DG 1WCMB 1K8GA 4XT1B 5M3FG 4DV7Q 4GS3A 2LKVA 1JWMD 1LTTD 4DXFA 1BNZA 3KF8B 4LF4Q 4AH6A 1PVOA 1YHBA 3A8JE 2KECA 4LJZC 5D14A 5C0XJ 1HNXQ 2B2UC 1CTMA 3H91A 1MIUA 2PI2A 3G48A 3I70A 4TSSA 2KEEA 4OX9L 5A35A 2E2JH 1XTDA 4DAMA 5ELFA 1X55A 4A3JH 1SE4A 2FHTA 4RGMA 5C4JH 2E2IH 4TQUS 1TS5A 1N36L 2F3WA 3S14B 1QUQA 4PV1C 1R4QB 3E5SA 4C56C 5BR8Q 1QG7A 5M5YB 3VR3A 3ICEA 1JOKA 4X65Q 3S2DB 2ALYB 4XTCS 3LWUA 2YV5A 4DUZL 2NZHA 1UE1A 1XTCD 2R6GA 5GAHC 1CT1D 1TQOA 3BG3A 3BVZA 3KF6A 1EY5A 3I55A 1WTHA 1PTOC 2N78A 4A3CH 2F0NA 3ZJYC 3SGIA 2WAQG 2LS01 1VQ5A 4JI2Q 3S24A 3NP8A 5A2QE 2BDOA 2UUAQ 4FF3A 2O5IC 4B3SL 1O78A 2GVAA 5A2QL 2JP1A 1QZHA 3PGZA 1JICA
chains in the Genus database with same CATH topology
3QB3A 3N6RA 3VYSA 1W6JA 2PO4A 2B2WC 5C6AA 3MC0B 1NUCA 1JQYD 3V2TA 1OXSC 2B63B 1D1KA 5KYLA 1A6XA 3FVQA 1TY0A 1EWHA 2EXZA 3IAYA 2BOSA 1H9JA 2MUYA 5T1GA 2LY7A 5CV8A 4DNRB 3VYUA 5KNDA 3OOCA 1AZPA 1ONLA 4F88A 3NQTA 4NP5A 2F0FA 4OHJA 3QIAA 3Q0AA 1Z6HA 1PRTD 1CQFA 2L0CA 5NUCA 1CK1A 2KCCA 5BN5A 4CJ1B 4XT3B 3JAML 2FJ2A 1SAPA 1VF5C 2EDGA 1SFOB 3KF8A 5HURA 3L3OC 1Y69U 5FO8B 1G2TA 5C4HA 4B9XA 1RCVD 1A3VA 2QILA 4RKBA 3L7ZC 3T13A 5CORA 1GUNA 2RQXA 1JWSD 1ZYRD 1F9QA 2B2TA 3IFTA 1B4OA 1IW7D 3FEWX 3OIPA 3T16A 4C3IG 2R3ZA 2F0VA 3C46A 3S9WA 4RA8A 4KN4C 4BY1B 2B2YA 3A7AB 4QMGA 3VR4A 5C5LA 3E6ZX 5M5XB 3A54A 1FR3A 1STEA 3GTKB 3DMUA 2AUKA 1EZ8A 3NBHA 1I4HA 4KY6A 1HUMA 2B2TC 4K14A 1RTNA 4HAEA 2PQEA 5JPNC 5CR3A 2E76C 2M2LA 1PZID 3VYTA 1VF7A 4A3IB 3MTSA 1EIHA 3SVMA 1WTXA 4IN3A 1ZKOA 3HOVB 1GUGA 1FNUA 3I4LA 3BS1A 1I4XA 2D5DA 4K8JA 1QCBD 1WTOA 4X3TA 1TIID 4IALA 1NR4A 5C3XA 3M85A 2A5HA 2ENBA 4EQNA 3WOEA 2YYZA 1A2UA 3TN2A 3Q6SA 1F9RA 2K5WA 1I4GA 2MHVA 4ZLTF 3NHHA 3TP5A 2D2CC 1UEAB 4WORA 5G3LD 4KK7A 3PUZA 5IODA 2OT2A 4MIUA 1MGSA 3D6WA 1H9SA 4HCEA 5DM63 5C4JB 2E2IB 1EEFD 1FGBD 5J1ZA 4PMBA 1A3TA 4FXGC 3TZDA 1PYWD 3Q23A 3R2IA 3ZYYX 2XN9C 1KAAA 3S1QB 1I50B 3DWQA 3PUWA 1HUNA 4KY7A 4M8AA 2MJ8A 2EY6A 4IFDG 2K5DA 5D3IB 4CKEA 2DN8A 4DXGA 2B39A 4DAPA 2RSNA 1ENCA 4V0BA 2GA4B 1U9RA 1LT6D 3M3YB 3MXNA 1STHA 2B2YC 2K5QA 2K01A 1XYIA 3M4OB 4ZK9B 3HKZB 1BCPF 4L6TB 2Z4IA 1ZYRC 3SK4A 1B9MA 1IHZA 1SNPA 3KK7A 5C5MA 4ABNA 4KKTA 4IFDH 1FNWA 4HSVA 1ZXTA 1WTWA 4TKOB 1MSHA 2NTSA 1LV9A 5JVG3 1DZ1A 3HOUB 4XQJA 4KJNA 1B2TA 3GTJB 3VR2A 4CJ0B 4B9WA 2A68D 2XVSA 2IW3A 1STNA 1S5CD 4C3JB 1SYFA 1ML0D 5FO7B 1B3AA 4HCSA 3AB9A 1QE6A 1QNUA 4FP5D 4V190 4OO1G 5JJZA 3MWYW 4OIJA 1SE3A 1GUOA 2PCFB 2E2HB 3TDQA 2L1BA 1KTKA 3E0JA 4ODGA 2OF1A 3UI2A 1J9OA 4RFBA 5JOBA 1T5EA 1D2BA 1DYQA 3OHXC 1ILQA 1YNJD 4HR7B 1CZGA 5IGEA 1AW7A 2NVXB 1TWHB 1Z47A 5I4DA 1TT2A 2F03A 2QDBA 2IL8A 1Y8OB 1PDQA 2F0IA 1EYDA 2AQ3B 4H0LC 5E1FA 1A15A 1GUSA 4FF1A 4C3JG 2EJMA 1G6ZA 1U4MA 2AWNA 1F9SA 1S5DD 1HXYD 1BOSA 3RZDB 2F0JA 4A3GB 2O5JC 1GUWA 1TVXA 4R9WA 2AWOA 4O1NA 2VB2X 1AN8A 3GTGB 1DXMA 4FYDA 1SYEA 1G8ZD 4K5WA 1D5XC 1EEID 1Q90A 1BQQT 1L0XB 2O4XA 3SEBA 1XX8A 2O2LD 3BYYB 2WIIB 3I4NB 4OO1I 4KKUA 3DEOA 5CC4A 3A55A 4U673 4XQQA 1GUTA 1Z7TA 1M4VA 4LMQD 3I91A 4DAYA 2WP8J 2JA8B 2HDMA 2XSCA 4BWGB 3GTQB 2ZXOA 5C44B 1J8IA 1SNOA 2SNSA 1PRTB 1BCPB 3HOZB 1B53A 1BBXC 1TKWB 2EE1A 4DK1A 2E2DC 3K6OA 4HMIA 2E74C 2M9VA 5KIXA 1C8CA 1BXTA 5KNBA 2KQ3A 3NPPA 4CJ2C 1W6KA 1R9TB 5G3LF 1EU3A 2H1EA 4PQXA 3IFDA 1MSGA 4JBWA 3KBGA 1JC7A 2MGSA 2MPMA 1RTOA 1S5BD 2F0KA 1EWCA 2F0WA 4HEDA 3GTMB 4QIWB 3GTOB 3EROA 1HCZA 4F87A 3M7GA 1HRJA 5JAVA 1HA5A 5LL6S 4UAIA 1DOMA 4ZKCB 5DM73 5KYIA 1HTPA 5IGGA 3QOLA 2H4OA 2TMPA 4NDXA 4A3KB 5KEEA 1E0BA 1GHKA 1F2MA 3PUXA 3HOYB 2F4IA 1CA5A 3SDZA 3RZOB 1DOKA 1TS3A 4RAUC 2DY7A 1HQMC 2FMCA 3HG9A 1WD1A 4KV6A 5EPJA 3K58A 4X3UA 3I4MB 2PZWA 4FF2A 5D3DA 2KVMA 2KOLA 3NUCA 5AFWA 3Q24A 3AU7A 1WTPA 5C4XB 2DY8A 2XIWA 2XRQD 3A56A 1LTSD 1SDFA 4RGNA 4KHVA 5C0XG 2N88A 3P75A 2LFNA 5C4ZA 1DONA 1WTRA 3H09A 1Y8PB 1UNSA 1PTOH 2EY2A 4FF4A 5I6WA 2B2UA 1EQVA 2ID0A 2EJFC 1F2LA 1TWFB 2EYMA 1R4PB 4XDXA 1I3QB 3S1NB 1KLUD 3TP8A 3GP7A 4EQPA 3K57A 5I9PA 4JK1C 1V43A 3OSOA 1I6VC 1SYGA 1I4RA 1X3QA 2A68C 3EVQA 3GV3A 4TRDA 1F2ZA 4DGZA 1A3UA 3CQZB 3BVMA 5FO9B 2E2JB 4K6DA 1UUPA 4A3JB 1JR0D 3DHQA 3LNNA 4FNFA 1UAPA 4XYOA 2A6ED 2JSOA 3I73A 3T53B 4ZRZA 1KNEA 3T56B 2JYOA 3QO2A 4UDUC 5DEHA 1MBYA 2ICEC 3C2PA 4A3FB 2HUGA 5C0XI 3RLFA 1EU4A 3U9SA 1AFPA 3FPPA 3MXUA 4QF4A 3MHBA 3R2TA 3FMCA 3EA6A 1WTVA 1PFMA 4R8IA 1CA6A 3SE0A 1O7ZA 2BE5D 1HHVA 4MHEA 3OIQA 3MXGA 3R93A 4S3SA 4PNYA 3DWAA 2F0HA 4Q5VA 3K5LA 3I90A 4WJWA 1IW7C 2WINB 3GTPB 1S5FD 1QWYA 4O42A 4KJOA 1Q8IA 1VMCA 1QJOA 2F0QA 3GO5A 4A93B 1K8OA 3TZUA 1NCVA 2NN6G 1SYCA 5K5PA 4EQOA 4XIGS 4X3KA 1T5XD 1E2WA 4IUVA 1DOLA 3RD4A 2R92B 4IQZA 4MN3A 1X3PA 2RVLA 1V1PB 2C9OA 2A69C 3D4DA 3NQIA 3LWEA 1TY2A 4I7ZC 4KHZA 5EPKA 4OL7A 3WOFA 5FKAC 1LLRD 3K5OA 5IIFA 5BN3A 3GTLB 1O7YA 1V8QA 3DM1A 3A8IE 2WAQB 3GD7A 5KRUA 1IKLA 1TR5A 1TS2A 2K03A 1PZJD 4OGQC 5HGTA 3J7AV 1RODA 3M7NA 1STGA 2WKCA 1DM0B 5BN4A 1CZWA 1C48A 2B2VC 1SSOA 1BO0A 2NYZD 1E2VA 2K05A 2K7VA 5ELCA 5IGFA 4G7OC 2F0EA 3K5NA 4NKLA 5IGBA 2EY5A 1U4RA 4RWSC 4DA2A 1EYAA 3MFGA 1I4PA 2B8GA 4FVMA 3SK8A 1HTLD 3K5MA 1FD7D 4RGTA 2SNMA 4WRDA 1B44D 4KMUC 3KLSA 1ICWA 4U68A 4DNTB 4L8JA 3P7JA 2Z4HA 3C1FA 4CGYB 1EFID 1F2YA 1FYCA 3NSWA 3IL8A 1H9SB 1DJRD 1LTRD 1O7LA 5E4WC 2N55A 3PUVA 3PO3B 3V96A 3HOXB 3D4WA 4QUCA 2IPKD 3HP3A 1SBBB 2K33A 3HZXA 3K59A 1C4QA 4RH6A 3AMUA 2IX0A 2QCPX 3D3RA 1KDBA 1HFGA 1SJED 4WFN3 3C3LA 3H94A 1KDCA 4K5VA 3DXJC 1LTBD 3S17B 2DNCA 3CKIB 4IZ8A 2D62A 4BA2I 1CFMA 4IUUA 3D31A 3I8ZA 5M5WB 2NN6I 5DNFA 2X69A 5DAUA 2OEOA 4ME5A 2RDHA 1EQTA 2PW5A 4DF7A 3F2UA 5COYA 2WV6D 2L9HA 3H6MA 2EYLA 2NB0A 3MFYA 5IGCA 5I6YA 3PV0A 2IJ0A 3KLRA 2L12A 2BE5C 5IT9L 1X32A 2J0TD 2HCCA 2XRSD 3MXPA 5FLXE 2JA6B 1JE4A 2F1MA 2CHBD 1IYUA 5FK9C 1K83B 2NBFA 4F8MA 4L63B 1ET6A 1NAPA 3M4YA 3HRZC 5K36G 4C1NI 1EZ6A 4FO2A 2JA7B 1PZKD 4R8NA 1IKMA 2NTTA 4YIJA 5EBCA 5EPLA 5I2XA 1SMYC 1OXVA 3JAME 1BUVT 4C3HB 2EY1A 1JB3A 3SXHA 1PFNA 1S4ZA 3TBIB 1RHPA 2F3VA 3T51B 2PZUA 5M9OA 2R61A 3PUYA 5CV9A 2LMCB 3NBIA 4LK1C 3W2DA 4X3SA 4XQNA 4DN4M 3D4RA 3S15B 1RKNA 1KDAA 5CGKA 1H9RA 1KLGD 1VDZA 1B50A 1PTOD 4DAVA 1L0YB 1JOQA 2F0LA 2F0MA 3IKJA 4KD3A 2EJGC 4CHTB 4CKCA 1ENFA 4BS9A 4ID6A 4J1MA 4BBSB 2WKDA 4E6IA 3KBXA 3RUZA 1F77A 3V05A 5M3MB 1WVLA 5K36H 4DFAA 1SNMA 4IUPA 2BA1A 2DNEA 1MD2D 4G7ZC 4BY7B 2PYKA 1TWAB 4I65A 2CQAA 2NWGA 2X6GA 4ULLA 3J80E 3PIP3 3C1EA 2L4NA 1PRTC 1HA6A 5JEAH 1K8MA 1TS4A 3WDNA 3BDOA 2A69D 2B2VA 4F7XA 4B08A 4C1NK 4CKBA 1G291 5CV6A 3SK5A 1QB5D 2D9UA 4J8QA 1KABA 4G4KA 3ERQA 4NMZA 2WACA 4XYQA 2V4DA 4OO1H 2RSOA 4GZYC 2A6EC 2F0PA 2KUMA 5LHY1 3OMGA 3P1HA 2ZT9C 2RDFA 4A3MB 2B8FA 3GQBA 3VA7A 2XWJB 1STYA 3DWPA 1OXTA 1BDOA 1D5MC 1HPCA 5C3WA 5J39A 4KTAA 3PMFA 2K1BA 3NXWA 4FXKC 3TSSA 4IUTA 1ILPA 2WB1B 4K2LA 1SYDA 5ISRA 3KLSX 3ND8A 3O13A 3G7LA 1IYVA 1EY4A 4RHRA 2EPBA 1PMRA 3S1RB 1CHQD 3NE5B 3J7YW 1ENAA 1I6HB 4LAAA 5JPMC 4ZQ3A 4A3DB 5C3EB 2YU9B 1EOTA 2ZXPA 2KCNA 2EYPA 2PZTA 5FLXL 1LABA 1PLFA 1D1IA 4FXDA 1D6EC 2IT1A 1O80A 4A3BB 2JA5B 5J22A 3FRPB 2PW7A 1HFNA 3QJYA 3VR5A 3VR6A 1STBA 4P2CB 2CW0D 4IUQA 3H3VC 2RDGA 4KN7C 2HQEA 4A3EB 4NW2A 3FDTA 2A6HD 1MI2A 1BF4A 3MA2B 1PRTF 3QWNA 1CI3M 4XXEA 2X6LA 1QILA 2QEJC 5I2YA 2NVQB 3TMEA 4QUFA 5T1IA 5EKIA 1Y1VB 1PFBA 2PNRC 3BDCA 1WD0A 2CW0C 1OXUA 3D8GA 3QOJA 2RBMA 1GOZA 2F0UA 3EFXD 5ELEA 5EQ0A 4CBVA 1LTID 2JEAI 5KNCA 1NSNS 2EYJA 5E3FA 3EQLC 3DUZA 1GXDC 3T4AC 2Q8RE 3W3AA 3HEJA 1NR2A 4N9TA 2BDNA 1V1OA 2ICIA 1OXXK 3J81L 2Q8TA 3MZ5A 5F2DA 2A73B 1PXUA 1AP0A 4IUNA 4K8IA 4ILWA 3A7LA 1FNVA 1SEBD 4HTHA 3BYTB 3NWSA 2VB3X 4G57A 2Z1CA 1PTOB 3CU7A 3FKIB 1SNCA 4H44C 4QB4A 1BCPD 5IOCA 3A8KE 2G9DA 3CRLC 3OMCA 5ELBA 4RCNA 2NZ1D 1H9MA 4DU9A 2IX3A 1Y8NB 2R93B 3CHBD 1QOHA 4HMJA 5EKLA 2EOTA 1H9KA 1EY6A 1YNJC 1LO5D 3OPOA 1JOOA 5CV5A 3VYRA 4RHSA 2QF7A 1Y1WB 5M3FB 1BCPC 3QG1A 4BBRB 3VA5A 1LTGD 1D5ZC 4ZAIA 1RJTA 4RKLA 4AYBB 1S5ED 3LX0A 1LT3D 1EYCA 1OO9B 2Z8LA 2C5CA 1AZQA 4KD4A 3OW7A 5I9OA 2Q8IB 1JWUD 2FINB 3HS0C 4KI0A 1G2SA 2PMZB 4HSPA 1Q12A 4QCLA 1SXTA 3L9AX 3SHLA 1Q3LA 1HQRD 3P20A 2EYFA 1A2TA 4Y7NB 2F0SA 2F0DA 1GJXA 1EL0A 4BA1I 2ZXRA 1U4LA 1TU2B 3TP6A 5CMDA 4KKSA 2J7ZA 2K6AA 4DK0A 3NTKA 2AUJD 2F0TA 3I3CA 4OIKA 1QNKA 2EVBA 2EYHA 5D65A 3SR1A 1Q1BA 2FFKB 3K7AB 5CBAE 2K32A 4EVOA 4Q0FA 2JEBI 1RDPD 1GHJA 5IT9E 2HCIA 4ZKBB 4C3IB 1SNDA 2JE6I 2TSSA 2J4XA 3NWTA 4RCOA 2K28A 4PMWA 2I46A 1ESRA 4Z9CB 2IWHA 4PMCA 3HGBA 5CV4A 4ZUIA 2R7ZB 3D6CA 1CM9A 1ZEQX 3PIO3 2QKIC 1KNAA 3H0GB 5JVH3 1CHPD 4KY5A 5EBDA 3K0YA 1ESFA 2A6HC 1VMPA 3N52A 1EY7A 1EY0A 3PO2B 1LT4D 5CYUA 2KHSA 2NVTB 3EJIA 2F0OA 1DD2A 3J80L 1BR9A 2SDFA 4K2KA 5ELDA 5TSSA 1LTAD 2NVYB 5C0XH 5EJWA 1VCIA 1LT5D 2KJXA 1M8AA 1ET9A 1U4PA 3OWFA 2AQ1B 3R8BA 1JORA 3HOWB 5KGUA 4H7BA 1XXGA 2M00A 2E75C 5LL6X 1EY8A 3KUPA 2NN6H 2PPBC 5IGDA 4IFDJ 2CVRA 3S2HB 1EIGA 4IFDI 3BDLA 3DEPA 1I4QA 2FMMA 2AQ2B 2L55A 2Y0SB 3U9OA 5E4XA 3TP7A 1TWGB 2L11A 4C3HG 4K6LA 1SYBA 1B1ZA 3GV6A 2EYOA 2SEBD 3ONAB 4C2MB 3X3MA 3URYA 2KA7A 1TWCB 1F9PA 3R3OA 2NUCA 2VUMB 1II3A 3I72A 2G9HD 5CBEE 3OWEB 5CV7A 2IX1A 3Q22A 1E2ZA 1B9NA 2K04A 4G7HC 2B2WA 5EGTA 2RA4A 3MEHA 1DCZA 1XWEA 3FPUB 3RMHA 2RKSA 1STAA 3BZDB 1LACA 3X3NA 2F0GA 2XNAC 3G6JB 2VNUD 3SK6A 2A74C 2BCOA 3J81E 1YNND 1SJHD 2KEDA 1CQVA 3CRKC 3J7AF 1YNNC 2SOBA 3NTHA 4J6HA 4N9PA 2L5TA 1JCKB 3BVGA 5JEAJ 1PTOF 3MVVA 2XWBB 3MAQA 1WTQA 4H13C 1IL8A 4ZYSA 2EZVA 3S1MB 1RF2D 1V1PA 1EY9A 4RGOS 5JEAG 3NK9A 2OXPA 5EKKA 3NTIA 1Q1EA 4ZUJA 4K5XA 3S16B 4IURA 4HN7A 2MP1A 4M1UB 3ITPA 2VXWA 1SE2A 1SNQA 5FOBB 2JXMB 4EGVA 1SMYD 2BA0A 1AEXA 2I07B 1G91A 3ND9A 1RD9D 2HDLA 1WCMB 4XT1B 2LKVA 1JWMD 1LTTD 4DXFA 1BNZA 5D14A 3A8JE 5C0XJ 2KECA 4LJZC 2B2UC 1CTMA 3H91A 3I70A 4TSSA 2KEEA 5A35A 5ELFA 1SE4A 2FHTA 4RGMA 4TQUS 1TS5A 2F3WA 3S14B 4PV1C 1R4QB 3E5SA 4C56C 1QG7A 5M5YB 3VR3A 1JOKA 3S2DB 4XTCS 3LWUA 1XTCD 2R6GA 1CT1D 1TQOA 3BG3A 3BVZA 1EY5A 1PTOC 2F0NA 2LS01 5A2QE 4FF3A 3NP8A 2BDOA 2O5IC 1O78A 5A2QL 2JP1A 1JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKC A;  2WKD A; 
#chains in the Genus database with same CATH topology
 3QB3 A;  3N6R A;  3UDG A;  3VYS A;  1W6J A;  2PO4 A;  3A74 A;  2B2W C;  3CME A;  5C6A A;  3MC0 B;  1NUC A;  4JI6 Q;  3M4O H;  5JJI A;  4BY7 H;  5GAG C;  2BH8 A;  1JQY D;  2HIX A;  3V2T A;  1OXS C;  2ATW A;  2B63 B;  1D1K A;  4HID A;  5KYL A;  1A6X A;  1V9P A;  3FVQ A;  2RCF A;  1TY0 A;  1EWH A;  3M4Q A;  2EXZ A;  4IOA A;  3IAY A;  1Q82 C;  1VQB A;  3KDF A;  4A3I G;  2BOS A;  3LGJ A;  1H9J A;  2MUY A;  4R1J A;  3G71 A;  5T1G A;  4JI1 L;  5H1S E;  2NZO A;  2LY7 A;  4ZCK A;  2JQO A;  4ME3 A;  1FGU A;  5CV8 A;  3UDI A;  4DNR B;  3VYU A;  5KND A;  4LFC L;  4J15 A;  2P5Z X;  3OOC A;  4GN3 B;  1AZP A;  1ONL A;  4F88 A;  3NQT A;  4NP5 A;  2F0F A;  4OHJ A;  3QIA A;  3S2H H;  2ZTD A;  3Q0A A;  1Z6H A;  1PRT D;  1EQQ A;  1CQF A;  2L0C A;  5NUC A;  2DJG C;  3CXC A;  1CK1 A;  2KCC A;  5BN5 A;  1UWV A;  1HNX L;  4CJ1 B;  4XT3 B;  3JAM L;  1X3F A;  2FJ2 A;  1IBK L;  1SAP A;  1VF5 C;  4OX9 Q;  2K4K A;  2EDG A;  2N49 A;  1SFO B;  3KF8 A;  5HUR A;  3L3O C;  1Y69 U;  5FO8 B;  3HOV G;  2K14 A;  1G2T A;  5C4H A;  1KHI A;  4B9X A;  2HT1 A;  1RCV D;  1A3V A;  1I94 Q;  3E9H A;  2QIL A;  4RKB A;  2E2H H;  3L7Z C;  3T13 A;  1J5E Q;  5COR A;  1GUN A;  2RQX A;  4HIO A;  1JWS D;  2R7D A;  1ZYR D;  2D0O A;  1F9Q A;  1KD1 C;  2B2T A;  3IFT A;  1B4O A;  4GNX B;  4JI7 Q;  4DV0 Q;  2LSS A;  2KHI A;  1IW7 D;  3FEW X;  3OIP A;  3T16 A;  4C3I G;  4JC0 A;  2R3Z A;  3CF5 A;  3PF5 A;  5IP9 G;  2UUB Q;  2F0V A;  1EWI A;  1VQJ A;  1I6H H;  3C46 A;  3S9W A;  1M1K C;  4RA8 A;  4A3D H;  4DV4 L;  4KN4 C;  5C3E H;  4DV2 L;  5GAE C;  3CCU A;  1MJE A;  4BY1 B;  2B2Y A;  3A7A B;  4QMG A;  3CPW A;  3VR4 A;  1JE5 A;  4YY3 Q;  5C5L A;  3E6Z X;  3A54 A;  5M5X B;  1FR3 A;  1STE A;  2K5N A;  3GTK B;  3DMU A;  2AUK A;  1EZ8 A;  3NBH A;  3RZD H;  1I4H A;  4KY6 A;  1HUM A;  2B2T C;  4K14 A;  2WAQ E;  1OTC A;  1RTN A;  4HAE A;  2PQE A;  5JPN C;  4JI6 L;  5CR3 A;  2E76 C;  4NXM Q;  2M2L A;  1PZI D;  1PH2 A;  3VYT A;  1VF7 A;  4YHH Q;  3MTS A;  4A3I B;  1EIH A;  2OTL A;  1JB7 A;  2UUC Q;  2KBN A;  4QGU A;  1PH9 A;  3SVM A;  1WTX A;  4IN3 A;  1ZKO A;  4BXX H;  3HOV B;  1GUG A;  1FNU A;  3I4L A;  3BS1 A;  1I4X A;  3HOX H;  2CWA A;  4DR6 L;  2D5D A;  4K8J A;  1QCB D;  1WTO A;  4X3T A;  1TII D;  4IAL A;  2Y0S E;  1NR4 A;  5C3X A;  3M85 A;  2A5H A;  2ENB A;  4CDC C;  1WCM H;  4EQN A;  3WOE A;  1IBM Q;  2YYZ A;  3KJO A;  1A2U A;  3TN2 A;  3Q6S A;  4DR7 L;  1F9R A;  2K5W A;  1I4G A;  2MHV A;  3NHH A;  3TP5 A;  4ZLT F;  2D2C C;  4GOP B;  1UEA B;  4WOR A;  4O2D A;  4H02 A;  4O0A A;  4KK7 A;  5G3L D;  3PUZ A;  5IOD A;  2OT2 A;  4MIU A;  1MGS A;  3D6W A;  1H9S A;  3F2B A;  4HCE A;  5DM6 3;  5JJK A;  1J5E L;  5C4J B;  4A75 A;  4LF4 L;  2E2I B;  1U5K A;  1EEF D;  1FGB D;  5J1Z A;  4PMB A;  5M5W H;  2L15 A;  1A3T A;  4FXG C;  3TZD A;  1PYW D;  3Q23 A;  4HJ5 A;  3R2I A;  3TS0 A;  3ZYY X;  2XN9 C;  1KAA A;  3S1Q B;  4GN4 B;  1I50 B;  1HZB A;  1NMF A;  3DWQ A;  4QY7 A;  3PUW A;  4JOI A;  1HUN A;  4KY7 A;  4M8A A;  2MJ8 A;  2EY6 A;  3K8A A;  1W3S A;  4IFD G;  1D7Q A;  1B70 B;  2K5D A;  5D3I B;  4CKE A;  2R93 G;  4DV4 Q;  2DN8 A;  2ZTC A;  4DXG A;  5FJ8 G;  2B39 A;  2JA9 A;  4DAP A;  2E8G A;  1HZC A;  2RCN A;  2RSN A;  1ENC A;  4JBJ A;  1Y14 B;  4V0B A;  2GA4 B;  1U9R A;  2DGY A;  4LFB Q;  4JI3 Q;  1LT6 D;  1HNZ L;  4EX5 A;  3M3Y B;  3MXN A;  1STH A;  1QVF A;  1PH4 A;  2B2Y C;  2K5Q A;  2K01 A;  1XYI A;  1W2B A;  1VQC A;  3M4O B;  4ZK9 B;  1NTG A;  2Y0S G;  3HKZ B;  1BCP F;  2OWO A;  2JA7 H;  4A3F G;  4DK6 C;  1VS0 A;  4L6T B;  2Z4I A;  1ZYR C;  3SK4 A;  4DV6 L;  1B9M A;  1IHZ A;  2I5M X;  4C3H H;  3RZO H;  1SNP A;  3KK7 A;  4OWW B;  5C5M A;  4ABN A;  4KKT A;  1DGS A;  4IFD H;  4BBR H;  1FNW A;  4HSV A;  1ZXT A;  1WTW A;  3I4M H;  4TKO B;  1MSH A;  3CW2 C;  2NTS A;  4X62 Q;  2CWP A;  3KJP A;  3H3V I;  1LV9 A;  5JVG 3;  1DZ1 A;  3HOU B;  3PCO B;  2F3I A;  1O7I A;  4XQJ A;  4KJN A;  1B2T A;  2UUC L;  5LMN L;  3GTJ B;  3VR2 A;  4CJ0 B;  4B9W A;  5C4X H;  2A68 D;  2XVS A;  1E24 A;  2IW3 A;  1STN A;  1S5C D;  1N34 Q;  3I4O A;  4C3J B;  1SYF A;  4JG2 A;  1ML0 D;  5FO7 B;  4LUO A;  3BJU A;  1Q46 A;  1VQF A;  1B3A A;  1IXR A;  1NNX A;  4HCS A;  2UU9 L;  3AB9 A;  3U4V A;  2UXB L;  1QE6 A;  1YNX A;  3B6Y A;  1QNU A;  4FP5 D;  4V19 0;  4OO1 G;  5JJZ A;  3MWY W;  4OIJ A;  3CMA A;  1IBK Q;  4L5R C;  2R92 G;  1SE3 A;  1D8L A;  4GKK L;  1XPO A;  1GUO A;  2PCF B;  3T1H L;  4LF7 Q;  1KIX A;  2E2H B;  3S1N H;  3TDQ A;  2L1B A;  1KTK A;  4ODG A;  3E0J A;  2OF1 A;  1N9W A;  4JI8 Q;  3UI2 A;  1LUZ A;  1J9O A;  4RFB A;  2AHO B;  5JOB A;  1T5E A;  3BZK A;  1D2B A;  1DYQ A;  3OHX C;  2UXC Q;  1ILQ A;  1YNJ D;  4HR7 B;  1CZG A;  5IGE A;  1AW7 A;  2NVX B;  1TWH B;  4JI3 L;  2CCZ A;  1Z47 A;  5I4D A;  3K81 C;  1TT2 A;  1YZ6 A;  5L37 A;  2F03 A;  2UUB L;  2QDB A;  3KOJ A;  2IL8 A;  1Y8O B;  3QR8 A;  1VQI A;  1PDQ A;  2F0I A;  1EYD A;  2AQ3 B;  4H0L C;  5E1F A;  4KHP Q;  1A15 A;  1GUS A;  4DUY Q;  4FF1 A;  4C3J G;  2EJM A;  1G6Z A;  1U4M A;  4HJ8 A;  1CKM A;  2AWN A;  1N32 L;  1F9S A;  1S5D D;  1HXY D;  1BOS A;  3RZD B;  2CH4 W;  2MNA A;  1E1T A;  2V1C C;  2F0J A;  4A3G B;  2O5J C;  1GUW A;  1TVX A;  3KF6 B;  4R9W A;  1ASZ A;  1KQS A;  2AWO A;  3J80 c;  3JAM i;  4O1N A;  2VB2 X;  4A3I H;  1AN8 A;  5FLX c;  2PQA B;  3GTG B;  1DXM A;  4YWM A;  4FYD A;  2Q2H A;  4JBM A;  3STB C;  4GLX A;  4A3F H;  1SYE A;  1G8Z D;  4K5W A;  1D5X C;  1EEI D;  1Q90 A;  1BQQ T;  1L0X B;  2O4X A;  3SEB A;  1JJC B;  1XX8 A;  4GLV B;  4MZ9 A;  1HZ9 A;  2O2L D;  3BYY B;  2WII B;  3I4N B;  4OO1 I;  4KKU A;  3DEO A;  5CC4 A;  3A55 A;  4U67 3;  4DR4 Q;  2QDL A;  4DK3 C;  4XQQ A;  1GUT A;  1Z7T A;  4AYB E;  1M4V A;  3IRB A;  4LMQ D;  3I91 A;  4DAY A;  2WP8 J;  3DLL A;  4P74 A;  2JA8 B;  2HDM A;  2XSC A;  3KDF B;  4BWG B;  3GTQ B;  2ZXO A;  4A3C G;  5C44 B;  1J8I A;  5HGQ A;  2IHF A;  2WB1 G;  1SNO A;  2NVY H;  1BKB A;  2UXD Q;  2SNS A;  4IOC A;  1PRT B;  1BCP B;  1N33 L;  4FDB A;  1SRO A;  1K8A C;  3HOZ B;  1B53 A;  4OXP A;  1BBX C;  1TKW B;  2EE1 A;  4DK1 A;  2E2D C;  2RF4 A;  4A93 H;  3K6O A;  4HMI A;  2E74 C;  1AH9 A;  2M9V A;  5KIX A;  1C8C A;  3GDE A;  1BXT A;  5KNB A;  3S1Q H;  4QIW E;  1HNW L;  2KQ3 A;  3NPP A;  4CJ2 C;  1W6K A;  1R9T B;  1LM0 A;  4A3B H;  5G3L F;  1EU3 A;  2H1E A;  4POF A;  4PQX A;  4GKK Q;  2A8V A;  3IFD A;  1MSG A;  1B8A A;  4K0K L;  4JBW A;  2VL6 A;  3KBG A;  1JC7 A;  2MGS A;  2MPM A;  3A5U A;  1RTO A;  1S5B D;  2F0K A;  4GN5 A;  1EWC A;  5BR8 L;  4JI4 L;  3HOX G;  2F0W A;  4IJL A;  4HED A;  3W5O A;  3PO3 G;  4LFA Q;  4UP9 A;  4RG1 A;  3GTM B;  4KHP L;  4QIW B;  3GTO B;  3ERO A;  1VQH A;  1EOV A;  4B3M Q;  1HCZ A;  4F87 A;  3M7G A;  1HRJ A;  5JAV A;  5IT9 c;  3L0O A;  1HA5 A;  5LL6 S;  4UAI A;  1DOM A;  4ZKC B;  1YJ9 A;  5DM7 3;  5KYI A;  1HTP A;  1SN8 A;  5IGG A;  3QOL A;  4CDD C;  2H4O A;  2TMP A;  3PO2 G;  4DR3 L;  4NDX A;  4A3K B;  5KEE A;  1E0B A;  4L5T A;  1GHK A;  1F2M A;  2H5X A;  3PUX A;  1X65 A;  3HOY B;  3T1Y Q;  4X66 Q;  2F4I A;  1HR0 W;  1CA5 A;  1VQL A;  3SDZ A;  3RZO B;  4L5Q A;  1DOK A;  1TS3 A;  4RAU C;  2DY7 A;  4P72 A;  2VQE Q;  1HQM C;  3CCV A;  2FMC A;  3HG9 A;  1WD1 A;  4KV6 A;  5EPJ A;  3H15 A;  3K58 A;  1E22 A;  4X3U A;  4DV6 Q;  3I4M B;  2PZW A;  3CCR A;  4N8F A;  1WYD A;  1C9O A;  1IYJ B;  4FF2 A;  3HOU H;  4A3K G;  5D3D A;  2KVM A;  1XNR L;  2KOL A;  4R4C A;  4A4I A;  4JI1 Q;  4DV3 L;  3NUC A;  5AFW A;  3Q24 A;  3AU7 A;  4DV1 L;  4JBK A;  3FP9 A;  1WTP A;  5C4X B;  2DY8 A;  2XIW A;  2XRQ D;  3A56 A;  1LTS D;  3F8T A;  3H0G G;  2HD3 A;  1SDF A;  2CQO A;  1RIP A;  5EAY A;  1VQ9 A;  4RGN A;  4KHV A;  5C0X G;  1G6P A;  2N88 A;  3ULP A;  3P75 A;  2LFN A;  5C4Z A;  1DON A;  5IE8 A;  1WTR A;  4DR4 L;  4YCW A;  4DR6 Q;  2MO0 A;  2F52 A;  3H09 A;  1VQ6 A;  1Y8P B;  1UNS A;  1PTO H;  2EY2 A;  5LMU Q;  5I6W A;  2B2U A;  4FF4 A;  1EQV A;  2ID0 A;  2OQ0 A;  2EJF C;  1F2L A;  1TWF B;  2EYM A;  1IBM L;  4L5S A;  1R4P B;  4XDX A;  2JA6 G;  1I3Q B;  3S1N B;  4JPB W;  1KLU D;  3PO3 H;  3TP8 A;  3K7U C;  2RHQ B;  1N33 Q;  3GP7 A;  4EQP A;  5IYC H;  3K57 A;  3EBE A;  5I9P A;  4JK1 C;  1L2F A;  1V43 A;  3OSO A;  3I7F A;  4JI8 L;  1I6V C;  1KRS A;  4R4I A;  1SYG A;  1I4R A;  1X3Q A;  1HNW Q;  3RR5 A;  2A68 C;  3EVQ A;  3GV3 A;  4TRD A;  5ELO A;  1X9N A;  1F2Z A;  2UXC L;  4DGZ A;  1A3U A;  3CCM A;  1Y1W H;  3CQZ B;  4IPD A;  3PIO A;  3BVM A;  1H95 A;  2EIF A;  2RHS B;  5FO9 B;  2E2J B;  5IWA Q;  4X65 L;  4K6D A;  4WJ4 A;  1UUP A;  4A3J B;  1JR0 D;  4JI4 Q;  1EIY B;  3DHQ A;  1E7Z A;  3LNN A;  2JA5 G;  4FNF A;  1UAP A;  3HKS A;  4XYO A;  2A6E D;  2OTJ A;  2JSO A;  2Z6B A;  4GKJ Q;  1WCM G;  3I73 A;  5DLQ E;  3T53 B;  4ZRZ A;  1KNE A;  1PH5 A;  3T56 B;  2JYO A;  1YI2 A;  3QO2 A;  4UDU C;  5DEH A;  4YY3 L;  2QEX A;  1MBY A;  3RLN A;  2ICE C;  1A62 A;  3C2P A;  1K0R A;  4DR2 L;  2ZM6 L;  4A3F B;  2HUG A;  5C0X I;  3RLF A;  2JA6 H;  1EU4 A;  3U9S A;  1AFP A;  3FPP A;  3MXU A;  4QF4 A;  1SLJ A;  3L2P A;  3MHB A;  2CKZ B;  2DJF C;  3R2T A;  1L1O A;  3FMC A;  4DV1 Q;  4BY7 G;  3EA6 A;  1YIJ A;  3I4N H;  1KL9 A;  1MKH A;  1WTV A;  1PFM A;  4R8I A;  1CA6 A;  3SE0 A;  5JJL A;  1XMO L;  1O7Z A;  2BE5 D;  2ZJR A;  2OCE A;  1HHV A;  4MHE A;  2JA8 H;  1XJV A;  3OIQ A;  3GTQ H;  3MXG A;  3R93 A;  4S3S A;  2E5L L;  5C44 H;  4DR1 L;  1WFQ A;  4PNY A;  3DWA A;  2F0H A;  4Q5V A;  1X56 A;  3I90 A;  3K5L A;  4WJW A;  1YJW A;  1IW7 C;  2WIN B;  4X64 Q;  3GTP B;  1S5F D;  1QWY A;  4TVA B;  1S3O A;  4O42 A;  1HZA A;  4KJO A;  1Q8I A;  3CP0 A;  1VMC A;  1QJO A;  2F0Q A;  3GO5 A;  4A93 B;  1K8O A;  3MEF A;  3U50 C;  5GQO A;  3TZU A;  3K7A H;  1NCV A;  2NN6 G;  1SYC A;  5K5P A;  4EQO A;  4AQY Q;  3S15 H;  4XIG S;  4X3K A;  1T5X D;  1E2W A;  4IUV A;  1DOL A;  1PYB A;  3RD4 A;  2R92 B;  4JVZ A;  4IQZ A;  1CSP A;  4MN3 A;  1X3P A;  3K80 C;  2RVL A;  1HH2 P;  1V1P B;  2VS1 A;  2C9O A;  2A69 C;  1IBL L;  3D4D A;  3NQI A;  2I5H A;  5GRO A;  4I7Z C;  1TY2 A;  2FXQ A;  3LWE A;  1N36 Q;  4KHZ A;  2R7Z H;  3HKZ E;  5EPK A;  4OL7 A;  3WOF A;  5FKA C;  1LLR D;  3K5O A;  1GD7 A;  5IIF A;  5BN3 A;  1GVP A;  3GTL B;  1K3R A;  1L1O B;  2F4V Q;  1L0W A;  4BBS H;  4DUZ Q;  1O7Y A;  1V8Q A;  1EQR A;  5IYD G;  1N8R C;  4DV5 L;  3DM1 A;  3A8I E;  2WAQ B;  3PQI A;  1K0S A;  3GD7 A;  5KRU A;  1X54 A;  1IKL A;  1TR5 A;  1TS2 A;  4N8X 1;  2K03 A;  1PZJ D;  4OGQ C;  4MTK A;  5IWA L;  5HGT A;  3J7A V;  4UPA A;  4JW0 A;  1QZG A;  4BY1 G;  4A76 A;  1ROD A;  3NBH B;  4QJF A;  2ES2 A;  3M7N A;  4DUY L;  1STG A;  2WKC A;  2ZM6 Q;  2NVT H;  1DM0 B;  4NXN Q;  1FJG Q;  4GLA C;  5BN4 A;  1CZW A;  1C48 A;  2B2V C;  1SSO A;  1VQN A;  4JCV E;  1BO0 A;  2NYZ D;  1MJC A;  1E2V A;  3NEL A;  1CKO A;  3AYH B;  1K3B C;  1LTL A;  2K05 A;  2K7V A;  1NY4 A;  2N3S A;  3J81 c;  2JA8 G;  5ELC A;  2LXK A;  4LF6 L;  5IGF A;  4G7O C;  4BY1 H;  2F0E A;  2Q2T A;  1UE7 A;  4NXM L;  3K5N A;  1E3P A;  1Q7Y C;  4NKL A;  3AEV A;  5IGB A;  2EY5 A;  2EXD A;  4MNO A;  1U4R A;  4RWS C;  4DA2 A;  3A5Z B;  2QGQ A;  1EYA A;  2QW7 A;  3MFG A;  2PI2 E;  5LMN W;  1I4P A;  2B8G A;  1YJN A;  1Z9F A;  2K52 A;  4FVM A;  3SK8 A;  1HTL D;  3K5M A;  4DR1 Q;  1FD7 D;  1PH3 A;  4RGT A;  1UEB A;  2SNM A;  4WRD A;  1B44 D;  4KMU C;  1VQO A;  1CUK A;  1C7Y A;  3KLS A;  4PZ7 A;  1M90 C;  1ICW A;  4U68 A;  4DNT B;  5LMN Q;  4L8J A;  1SRU A;  4A3M H;  3P7J A;  2Z4H A;  3C1F A;  4CGY B;  1RL2 A;  3U4Z A;  1EFI D;  5IYB G;  4R4O A;  1TWF H;  3CCJ A;  3AFP A;  1F2Y A;  1FYC A;  3NSW A;  3IL8 A;  1H9S B;  3HOV H;  1DJR D;  1LTR D;  1O7L A;  5E4W C;  2N55 A;  3PUV A;  3PO3 B;  3RNU A;  4DV7 L;  3V96 A;  3HOX B;  3D4W A;  4QUC A;  2IPK D;  3HP3 A;  4LF9 L;  1SBB B;  2K33 A;  4OWX B;  3HZX A;  3K59 A;  3KYH C;  1QVG A;  1C4Q A;  4P71 A;  4RH6 A;  3AMU A;  4APV A;  3J7A 5;  2IX0 A;  2QCP X;  3D3R A;  1KDB A;  1HFG A;  1SJE D;  4WFN 3;  3C3L A;  3H94 A;  3E0E A;  1KDC A;  4K5V A;  3DXJ C;  4UP7 A;  1LTB D;  4IJH A;  3S17 B;  2DNC A;  3CKI B;  2WB1 E;  2Q2I A;  4IZ8 A;  2VQF L;  3CQZ H;  2D62 A;  4DV5 Q;  4BA2 I;  1IBL Q;  1CFM A;  4IUU A;  3D31 A;  3I8Z A;  2KHJ A;  1CSQ A;  4B3R Q;  5M5W B;  2NN6 I;  5DNF A;  1ICF B;  2YU9 H;  2X69 A;  1YEZ A;  5DAU A;  4JOI C;  3CPF A;  1J6Q A;  2OEO A;  3AQQ A;  2RDH A;  4ME5 A;  1EQT A;  2Q2U A;  2PW5 A;  1HNZ Q;  4DF7 A;  3F2U A;  1AE2 A;  5COY A;  2WV6 D;  4LUV A;  2L9H A;  3H6M A;  2EYL A;  2NB0 A;  3MFY A;  3CC7 A;  1JJ2 A;  1XMQ Q;  5IGC A;  3NEM A;  1XNQ L;  5I6Y A;  4X6A H;  3FKI G;  3PV0 A;  2R7F A;  2IJ0 A;  3KLR A;  3VDY A;  2L12 A;  3E3X A;  4GKJ L;  2BE5 C;  5IT9 L;  1X32 A;  2J0T D;  2B3G A;  2JJQ A;  1N32 Q;  3OW2 A;  3ERS X;  2HCC A;  1WOC A;  2XRS D;  3MXP A;  5FLX E;  2JA6 B;  4P73 A;  1JE4 A;  2F1M A;  2CHB D;  1IYU A;  5FK9 C;  1K83 B;  2NBF A;  4F8M A;  4L63 B;  1G51 A;  4DR2 Q;  1ET6 A;  4UP8 A;  3JAM c;  1YVC A;  1NAP A;  2NVQ H;  3M4Y A;  3HRZ C;  5K36 G;  2ASB A;  1Y1V H;  4C1N I;  3I56 A;  1EZ6 A;  4FO2 A;  4DAY B;  2JA7 B;  1SR3 A;  1PZK D;  4DNI A;  4R8N A;  1IKM A;  2NTT A;  4YIJ A;  5EBC A;  5EPL A;  5I2X A;  1SMY C;  1OXV A;  3JAM E;  1BUV T;  4C3H B;  2EY1 A;  1XMO Q;  1JB3 A;  2YTX A;  3SXH A;  1PFN A;  1S4Z A;  3GTP H;  3TBI B;  1RHP A;  2F3V A;  3T51 B;  2PZU A;  5M9O A;  2R61 A;  3PUY A;  5IYD H;  5CV9 A;  2LMC B;  1EYG A;  2AKW B;  3NBI A;  4LK1 C;  3W2D A;  4X3S A;  3K0X A;  4XQN A;  2ZTE A;  4X64 L;  2Z6K A;  4DN4 M;  2CH4 A;  3D4R A;  3S15 B;  1RKN A;  5IP9 H;  3TRE A;  3W1B A;  1KDA A;  2EQS A;  5CGK A;  3D0F A;  4OON A;  3GTJ H;  1CKN B;  1XPR A;  3HOY G;  3S14 H;  1YIT A;  1H9R A;  1KLG D;  1VDZ A;  1B50 A;  1PH1 A;  1PTO D;  4DAV A;  1EFW A;  1L0Y B;  3S2D H;  3ULL A;  4LF7 L;  1JOQ A;  2F0L A;  4I7A A;  2K5H A;  2F0M A;  4HJ9 A;  2HHH Q;  3IKJ A;  2LXJ A;  4KD3 A;  4OEM B;  2EJG C;  4HJ7 A;  3T1H Q;  4CHT B;  4CKC A;  1ENF A;  4BS9 A;  1VQK A;  4DR5 Q;  4ID6 A;  3E9I A;  4J1M A;  2WFW A;  1FL0 A;  2MO1 A;  3FKI H;  4BBS B;  2WKD A;  4JI5 Q;  4JI7 L;  4E6I A;  3KBX A;  3RUZ A;  4CDF C;  1F77 A;  3V05 A;  2ZJP A;  3J80 i;  5M3M B;  4YWK A;  1WVL A;  5K36 H;  4DFA A;  1SNM A;  4IUP A;  2AMC B;  1VQ4 A;  2BA1 A;  2DNE A;  1MD2 D;  4G7Z C;  1XNQ Q;  2R93 H;  4A3L H;  4BY7 B;  2PYK A;  1TWA B;  4B3M L;  2B63 H;  4MTN A;  4JI2 L;  4I65 A;  3CC4 A;  5IY0 A;  2CQA A;  2NWG A;  4P75 A;  3HKZ G;  2X6G A;  4ULL A;  3J80 E;  3C1E A;  3PIP 3;  2L4N A;  1PRT C;  4GOP A;  4OEL B;  1HA6 A;  3TQY A;  5JEA H;  4GOP C;  1K8M A;  5HY6 A;  1TS4 A;  2MFI A;  3WDN A;  3BDO A;  2A69 D;  2Z6K C;  2B2V A;  4X66 L;  4F7X A;  4B08 A;  1JMC A;  1IZ6 A;  4C1N K;  4CKB A;  1G29 1;  5CV6 A;  3SK5 A;  4A3M G;  1QB5 D;  1VQE A;  3CAM A;  2D9U A;  4DKA C;  1HJP A;  2R7Z G;  4J8Q A;  2PNH A;  1KAB A;  2IY5 B;  4G4K A;  3ERQ A;  4NMZ A;  2WAC A;  2D0P A;  4UHV A;  1YHQ A;  4A3G H;  1LYL A;  4XYQ A;  2V4D A;  4OO1 H;  2RSO A;  4GZY C;  2A6E C;  2F0P A;  2KUM A;  5LHY 1;  3OMG A;  2KEN A;  3P1H A;  2ZT9 C;  2RDF A;  4A3M B;  2B8F A;  3GQB A;  3VA7 A;  2K50 A;  2XWJ B;  4IPC A;  1STY A;  2KCT A;  2OQK A;  3DWP A;  3CCS A;  2N8N A;  1HR0 L;  3UE0 A;  1OXT A;  4BXX G;  1BDO A;  4LW1 A;  1D5M C;  1E1O A;  3TEH B;  1NMG A;  1HPC A;  5C3W A;  1TXY A;  4Y7N H;  5J39 A;  2E5L Q;  4KTA A;  4DR7 Q;  3PMF A;  2K1B A;  3NXW A;  4FXK C;  3TSS A;  2K75 A;  4IUT A;  1WJJ A;  4A3E G;  1PHJ A;  2WB1 B;  1ILP A;  4K2L A;  1SYD A;  5ISR A;  3KLS X;  3ND8 A;  3HFZ B;  1BVS A;  2QA4 A;  3O13 A;  3G7L A;  1IYV A;  5IYB H;  1EY4 A;  4RHR A;  4LF5 Q;  4JV5 Q;  2EPB A;  1PA6 A;  1Y1V G;  1PMR A;  3S1R B;  1CHQ D;  1UE5 A;  3NE5 B;  3J7Y W;  1ENA A;  1I6H B;  1I94 L;  1NBW A;  4LAA A;  5JPM C;  3M4P A;  4ZQ3 A;  4A3D B;  5C3E B;  2YTV A;  1EOT A;  2YU9 B;  3J81 i;  2ZXP A;  2KCN A;  2EYP A;  2PZT A;  5FLX L;  4DR5 L;  1LAB A;  1PLF A;  1D1I A;  4FXD A;  1D6E C;  2IT1 A;  1O80 A;  4A3B B;  2JA5 B;  4C3I H;  2MQH A;  5J22 A;  2BH2 A;  3FRP B;  3RLO A;  2VZA A;  5AJ3 L;  3J81 j;  2UUA L;  3GTK H;  2PW7 A;  1HFN A;  3QJY A;  3VR5 A;  3VR6 A;  4R4T A;  1STB A;  4JYA L;  4P2C B;  2A1A A;  2CW0 D;  1JT8 A;  4IUQ A;  3H3V C;  2RDG A;  4KN7 C;  1YHA A;  3HOU G;  2HQE A;  4A3E B;  4NW2 A;  2GN5 A;  3FDT A;  2A6H D;  1MI2 A;  1BF4 A;  3MA2 B;  1PRT F;  4DR3 Q;  4PZ8 A;  3QWN A;  1CI3 M;  1L1O C;  3H0G H;  4XXE A;  2X6L A;  2VQE L;  1QIL A;  3U58 A;  2QEJ C;  5I2Y A;  4NXN L;  2A19 A;  3TME A;  2NVQ B;  3CD6 A;  4QUF A;  3KLW A;  3PSI A;  1S40 A;  3W1G A;  4JI0 L;  5T1I A;  5EKI A;  1Y1V B;  2DUD A;  1PFB A;  5IP7 G;  4A3K H;  3TRZ A;  3F1Z A;  5FLM H;  4EQ5 A;  2PNR C;  4LWC A;  3BDC A;  3ER0 A;  1WD0 A;  3EN2 A;  1KC8 C;  4YHH L;  3EIV A;  4LF8 L;  4X62 L;  4DV3 Q;  2C35 B;  2CW0 C;  1OXU A;  3D8G A;  3QOJ A;  3PO2 H;  2RBM A;  4B3T Q;  1GOZ A;  3A0J A;  4IO9 A;  2F0U A;  3EFX D;  3DM3 A;  5ELE A;  5EQ0 A;  4LFC Q;  5E7N A;  4CBV A;  1LTI D;  2JEA I;  2KCM A;  5KNC A;  1VQM A;  1NSN S;  2EYJ A;  5E3F A;  3EQL C;  3DUZ A;  4A3G G;  3TS2 A;  1GXD C;  3T4A C;  4A3B G;  2Q8R E;  3W3A A;  3HEJ A;  1NR2 A;  4N9T A;  2UXB Q;  5FJ8 H;  3HOW H;  2BDN A;  1V1O A;  2ICI A;  1OXX K;  3J81 L;  1SE8 A;  2Q8T A;  1SMX A;  3CC2 A;  3MZ5 A;  1I50 H;  1S72 A;  5F2D A;  2A73 B;  1I5F A;  1PXU A;  1AP0 A;  3OTO L;  3UDX A;  4IUN A;  4K8I A;  4ILW A;  3A7L A;  1VQP A;  4AIM A;  1FNV A;  1SEB D;  3G6E A;  4HTH A;  3BYT B;  3NWS A;  2VB3 X;  3WWV A;  1X6O A;  2PQA A;  2Z1C A;  4G57 A;  1TWG H;  1PTO B;  3CU7 A;  3H3V H;  3FKI B;  4LF5 L;  4JV5 L;  1SNC A;  4H44 C;  4QB4 A;  2HHH L;  1BCP D;  3CCL A;  5M3M H;  1I3Q H;  5IOC A;  4A3L G;  3A8K E;  2G9D A;  3CRL C;  4K0K Q;  3OMC A;  5ELB A;  3M3Y H;  4C2M H;  1GM5 A;  4RCN A;  2NZ1 D;  1TWC H;  5IP7 H;  1H9M A;  4DU9 A;  2IX3 A;  1Y8N B;  2VUM H;  1K9M C;  2R93 B;  5AJ3 Q;  3CHB D;  1QOH A;  4HMJ A;  2VQF Q;  5EKL A;  2EOT A;  1PYS B;  1H9K A;  1EY6 A;  1TWA H;  4AYB G;  1YNJ C;  4B3S Q;  2XGT A;  1EUJ A;  3PIP A;  4B3R L;  5IYC G;  1LO5 D;  3OPO A;  1JOO A;  5CV5 A;  3VYR A;  4RHS A;  1KXL A;  2QF7 A;  1Y1W B;  4R4Q A;  1T9H A;  5M3F B;  1BCP C;  3QG1 A;  4BBR B;  3VA5 A;  1LTG D;  1D5Z C;  4ZAI A;  1RJT A;  4RKL A;  1Q81 C;  4AYB B;  4RMF A;  1S5E D;  3PF4 A;  3LX0 A;  1LT3 D;  2GVB A;  1EYC A;  3J7Z C;  1EIF A;  4POG A;  1OO9 B;  4B3T L;  2Z8L A;  4QL5 A;  2C5C A;  1AZQ A;  4KD4 A;  3CCE A;  3OW7 A;  5I9O A;  2Q8I B;  3FHW A;  3F2C A;  4JI0 Q;  3S1M H;  4C3J H;  1JWU D;  2FIN B;  3HS0 C;  4KI0 A;  1G2S A;  2PMZ B;  4NB3 A;  3S16 H;  1PFS A;  4HSP A;  4A3J G;  1Q12 A;  4QCL A;  1SXT A;  3L9A X;  4NPS A;  1Q3L A;  3SHL A;  1HQR D;  3P20 A;  2EYF A;  1A2T A;  4Y7N B;  2F0S A;  2F0D A;  1GJX A;  4IPH A;  1EL0 A;  4PZ6 A;  2ZXR A;  5ELN A;  4BA1 I;  1HR0 Q;  1QVC A;  3RN5 A;  1U4L A;  1N34 L;  1TU2 B;  3TP6 A;  3OTO Q;  1X3G A;  2UU9 Q;  4BBS G;  2I5L X;  5CMD A;  4KKS A;  5C3E G;  2J7Z A;  1B3Q A;  4GNX A;  2K6A A;  4AQY L;  4GNX C;  4DK0 A;  3NTK A;  3S1R H;  1P8L A;  2AUJ D;  1UE6 A;  1NE3 A;  2F0T A;  1FVI A;  3I3C A;  4LF9 Q;  4OIK A;  1QNK A;  2NVX H;  2EVB A;  1TWH H;  4IPG A;  1PH8 A;  2EYH A;  2VY3 A;  5D65 A;  3SR1 A;  1Y1W G;  4PG3 A;  1Q1B A;  2FFK B;  3K7A B;  5CBA E;  1IL2 A;  2K32 A;  4EVO A;  4Q0F A;  2JEB I;  1VQA A;  1A0I A;  1RDP D;  1GHJ A;  2HIV A;  5IT9 E;  2HCI A;  2JA5 H;  4ZKB B;  4C3I B;  2R92 H;  5M5Y H;  4YWL A;  3I2Z A;  1SND A;  2JE6 I;  5M3M G;  2TSS A;  1MHW C;  2J4X A;  3NWT A;  4RCO A;  2K28 A;  1BBU A;  4PMW A;  4DV2 Q;  4LFB L;  2I46 A;  2F4V L;  1ESR A;  4Z9C B;  2IWH A;  4PMC A;  2PMZ E;  3HGB A;  5CV4 A;  4ZUI A;  2R7Z B;  1AE3 A;  4A3E H;  3D6C A;  1P16 A;  4LUZ A;  2HQL A;  2Z9H A;  1CM9 A;  1A8V A;  1ZEQ X;  3GTL H;  3GTG H;  3PIO 3;  4JYA Q;  1B7Y B;  2QKI C;  3KFU A;  1KNA A;  3H0G B;  5JVH 3;  1CHP D;  3T1Y L;  4KY5 A;  5C4X G;  5EBD A;  4BBR G;  1WI5 A;  2JN4 A;  1Q86 C;  3K0Y A;  1ESF A;  3UDF A;  2A6H C;  1QUQ B;  2XTI A;  3JC6 6;  1VQ7 A;  1VMP A;  4LF6 Q;  1FJG L;  3N52 A;  4OWT B;  2B29 A;  3UE1 A;  1EY7 A;  1EY0 A;  3I4M G;  4HIK A;  1BBW A;  1PH7 A;  3PO2 B;  1LT4 D;  5CYU A;  2KHS A;  2NVT B;  2IHE A;  1NJI C;  3EJI A;  4YCU A;  2F0O A;  3F2D A;  1DD2 A;  4LF8 Q;  3J80 L;  1BR9 A;  2SDF A;  4K2K A;  3NEN A;  5ELD A;  5TSS A;  1LTA D;  2NVY B;  2YTY A;  5C0X H;  3G4S A;  5EJW A;  2B63 G;  4HIM A;  3M9B A;  1VCI A;  1LT5 D;  2KJX A;  1M8A A;  2I0Q A;  1ET9 A;  1U4P A;  3OWF A;  2AQ1 B;  3HOZ H;  3R8B A;  4DPG A;  2Z0S A;  1JOR A;  3HOW B;  5KGU A;  4H7B A;  1XXG A;  2M00 A;  2E75 C;  5LL6 X;  1KRT A;  1VQG A;  1EY8 A;  3KUP A;  5C44 G;  3Q8D A;  2NN6 H;  2PPB C;  5IGD A;  4IFD J;  5LMU L;  1GKH A;  2CVR A;  1R9T H;  5GAD C;  1EIG A;  3S2H B;  4IFD I;  1A63 A;  1U0L A;  4ALP A;  3BDL A;  3DEP A;  5FLM G;  1I4Q A;  2FMM A;  4UY8 C;  2AQ2 B;  2L55 A;  2Y0S B;  3U9O A;  3I4N G;  5E4X A;  3TP7 A;  1TWG B;  2L11 A;  4C3H G;  4K6L A;  5J3B A;  3CCQ A;  1SYB A;  1B1Z A;  3GV6 A;  1SFO H;  2EYO A;  3GTM H;  2SEB D;  3ONA B;  4C2M B;  2JK8 A;  3GTO H;  3MXN B;  3X3M A;  3URY A;  2KA7 A;  1TWC B;  1F9P A;  3R3O A;  4WJ3 M;  1GO3 E;  2NUC A;  1PV4 A;  2VUM B;  1II3 A;  3I72 A;  1PH6 A;  2G9H D;  4DV0 L;  5CBE E;  3OWE B;  5CV7 A;  4QQB X;  2IX1 A;  3Q22 A;  4JI5 L;  1CKN A;  1E2Z A;  3HOZ G;  1B9N A;  2K04 A;  4G7H C;  1Q8K A;  2B2W A;  3ULJ A;  5EGT A;  4YCV A;  4LFA L;  2RA4 A;  3MEH A;  1DCZ A;  1YBY A;  1K28 A;  1KAW A;  1XWE A;  3HOY H;  3FPU B;  3RMH A;  3S17 H;  3HOW G;  2RKS A;  1STA A;  3BZD B;  1LAC A;  3X3N A;  1JJG A;  2F0G A;  2XNA C;  3G6J B;  2VNU D;  3SK6 A;  5M3F H;  2A74 C;  1XMQ L;  2BCO A;  3J81 E;  1YNN D;  1VQ8 A;  1SJH D;  2KED A;  1CQV A;  3CRK C;  3J7A F;  1YNN C;  2SOB A;  1K73 C;  3NTH A;  4J6H A;  1VQD A;  4N9P A;  4HJA A;  2L5T A;  1JCK B;  1C0A A;  3RN2 A;  3BVG A;  1ASY A;  5M5X H;  5JEA J;  2G5D A;  4Y52 H;  1PTO F;  3MVV A;  2XWB B;  4H13 C;  3MAQ A;  1IL8 A;  2EZV A;  4ZYS A;  1WTQ A;  1XNR Q;  3S1M B;  1RF2 D;  1V1P A;  1EY9 A;  4RGO S;  5JEA G;  3NK9 A;  2OXP A;  5EKK A;  4KLK A;  3NTI A;  4CDE C;  2VUM G;  1Q1E A;  4ZUJ A;  4K5X A;  4A93 G;  3S16 B;  2K5V A;  4IUR A;  2CFM A;  2VW9 A;  1XPU A;  4HN7 A;  3BZC A;  3AFQ A;  1K83 H;  2ZJQ A;  2JA7 G;  2MP1 A;  4M1U B;  3ITP A;  2VXW A;  1X3E A;  3OYY A;  1SE2 A;  3BU2 A;  3STB D;  1SNQ A;  5FOB B;  2JXM B;  4EGV A;  1SMY D;  2BA0 A;  1AEX A;  2I07 B;  4LNQ A;  1G91 A;  2UXD L;  1V1Q A;  3ND9 A;  1RD9 D;  2HDL A;  4A3D G;  1WCM B;  1K8G A;  4XT1 B;  5M3F G;  4DV7 Q;  4GS3 A;  2LKV A;  1JWM D;  1LTT D;  4DXF A;  1BNZ A;  3KF8 B;  4LF4 Q;  4AH6 A;  1PVO A;  1YHB A;  3A8J E;  2KEC A;  4LJZ C;  5D14 A;  5C0X J;  1HNX Q;  2B2U C;  1CTM A;  3H91 A;  1MIU A;  2PI2 A;  3G48 A;  3I70 A;  4TSS A;  2KEE A;  4OX9 L;  5A35 A;  2E2J H;  1XTD A;  4DAM A;  5ELF A;  1X55 A;  4A3J H;  1SE4 A;  2FHT A;  4RGM A;  5C4J H;  2E2I H;  4TQU S;  1TS5 A;  1N36 L;  2F3W A;  3S14 B;  1QUQ A;  4PV1 C;  1R4Q B;  3E5S A;  4C56 C;  5BR8 Q;  1QG7 A;  5M5Y B;  3VR3 A;  3ICE A;  1JOK A;  4X65 Q;  3S2D B;  2ALY B;  4XTC S;  3LWU A;  2YV5 A;  4DUZ L;  2NZH A;  1UE1 A;  1XTC D;  2R6G A;  5GAH C;  1CT1 D;  1TQO A;  3BG3 A;  3BVZ A;  3KF6 A;  1EY5 A;  3I55 A;  1WTH A;  1PTO C;  2N78 A;  4A3C H;  2F0N A;  3ZJY C;  3SGI A;  2WAQ G;  2LS0 1;  1VQ5 A;  4JI2 Q;  3S24 A;  3NP8 A;  5A2Q E;  2BDO A;  2UUA Q;  4FF3 A;  2O5I C;  4B3S L;  1O78 A;  2GVA A;  5A2Q L;  2JP1 A;  1QZH A;  3PGZ A;  1JIC A; 
#chains in the Genus database with same CATH homology
 3QB3 A;  3N6R A;  3VYS A;  1W6J A;  2PO4 A;  2B2W C;  5C6A A;  3MC0 B;  1NUC A;  1JQY D;  3V2T A;  1OXS C;  2B63 B;  1D1K A;  5KYL A;  1A6X A;  3FVQ A;  1TY0 A;  1EWH A;  2EXZ A;  3IAY A;  2BOS A;  1H9J A;  2MUY A;  5T1G A;  2LY7 A;  5CV8 A;  4DNR B;  3VYU A;  5KND A;  3OOC A;  1AZP A;  1ONL A;  4F88 A;  3NQT A;  4NP5 A;  2F0F A;  4OHJ A;  3QIA A;  3Q0A A;  1Z6H A;  1PRT D;  1CQF A;  2L0C A;  5NUC A;  1CK1 A;  2KCC A;  5BN5 A;  4CJ1 B;  4XT3 B;  3JAM L;  2FJ2 A;  1SAP A;  1VF5 C;  2EDG A;  1SFO B;  3KF8 A;  5HUR A;  3L3O C;  1Y69 U;  5FO8 B;  1G2T A;  5C4H A;  4B9X A;  1RCV D;  1A3V A;  2QIL A;  4RKB A;  3L7Z C;  3T13 A;  5COR A;  1GUN A;  2RQX A;  1JWS D;  1ZYR D;  1F9Q A;  2B2T A;  3IFT A;  1B4O A;  1IW7 D;  3FEW X;  3OIP A;  3T16 A;  4C3I G;  2R3Z A;  2F0V A;  3C46 A;  3S9W A;  4RA8 A;  4KN4 C;  4BY1 B;  2B2Y A;  3A7A B;  4QMG A;  3VR4 A;  5C5L A;  3E6Z X;  5M5X B;  3A54 A;  1FR3 A;  1STE A;  3GTK B;  3DMU A;  2AUK A;  1EZ8 A;  3NBH A;  1I4H A;  4KY6 A;  1HUM A;  2B2T C;  4K14 A;  1RTN A;  4HAE A;  2PQE A;  5JPN C;  5CR3 A;  2E76 C;  2M2L A;  1PZI D;  3VYT A;  1VF7 A;  4A3I B;  3MTS A;  1EIH A;  3SVM A;  1WTX A;  4IN3 A;  1ZKO A;  3HOV B;  1GUG A;  1FNU A;  3I4L A;  3BS1 A;  1I4X A;  2D5D A;  4K8J A;  1QCB D;  1WTO A;  4X3T A;  1TII D;  4IAL A;  1NR4 A;  5C3X A;  3M85 A;  2A5H A;  2ENB A;  4EQN A;  3WOE A;  2YYZ A;  1A2U A;  3TN2 A;  3Q6S A;  1F9R A;  2K5W A;  1I4G A;  2MHV A;  4ZLT F;  3NHH A;  3TP5 A;  2D2C C;  1UEA B;  4WOR A;  5G3L D;  4KK7 A;  3PUZ A;  5IOD A;  2OT2 A;  4MIU A;  1MGS A;  3D6W A;  1H9S A;  4HCE A;  5DM6 3;  5C4J B;  2E2I B;  1EEF D;  1FGB D;  5J1Z A;  4PMB A;  1A3T A;  4FXG C;  3TZD A;  1PYW D;  3Q23 A;  3R2I A;  3ZYY X;  2XN9 C;  1KAA A;  3S1Q B;  1I50 B;  3DWQ A;  3PUW A;  1HUN A;  4KY7 A;  4M8A A;  2MJ8 A;  2EY6 A;  4IFD G;  2K5D A;  5D3I B;  4CKE A;  2DN8 A;  4DXG A;  2B39 A;  4DAP A;  2RSN A;  1ENC A;  4V0B A;  2GA4 B;  1U9R A;  1LT6 D;  3M3Y B;  3MXN A;  1STH A;  2B2Y C;  2K5Q A;  2K01 A;  1XYI A;  3M4O B;  4ZK9 B;  3HKZ B;  1BCP F;  4L6T B;  2Z4I A;  1ZYR C;  3SK4 A;  1B9M A;  1IHZ A;  1SNP A;  3KK7 A;  5C5M A;  4ABN A;  4KKT A;  4IFD H;  1FNW A;  4HSV A;  1ZXT A;  1WTW A;  4TKO B;  1MSH A;  2NTS A;  1LV9 A;  5JVG 3;  1DZ1 A;  3HOU B;  4XQJ A;  4KJN A;  1B2T A;  3GTJ B;  3VR2 A;  4CJ0 B;  4B9W A;  2A68 D;  2XVS A;  2IW3 A;  1STN A;  1S5C D;  4C3J B;  1SYF A;  1ML0 D;  5FO7 B;  1B3A A;  4HCS A;  3AB9 A;  1QE6 A;  1QNU A;  4FP5 D;  4V19 0;  4OO1 G;  5JJZ A;  3MWY W;  4OIJ A;  1SE3 A;  1GUO A;  2PCF B;  2E2H B;  3TDQ A;  2L1B A;  1KTK A;  3E0J A;  4ODG A;  2OF1 A;  3UI2 A;  1J9O A;  4RFB A;  5JOB A;  1T5E A;  1D2B A;  1DYQ A;  3OHX C;  1ILQ A;  1YNJ D;  4HR7 B;  1CZG A;  5IGE A;  1AW7 A;  2NVX B;  1TWH B;  1Z47 A;  5I4D A;  1TT2 A;  2F03 A;  2QDB A;  2IL8 A;  1Y8O B;  1PDQ A;  2F0I A;  1EYD A;  2AQ3 B;  4H0L C;  5E1F A;  1A15 A;  1GUS A;  4FF1 A;  4C3J G;  2EJM A;  1G6Z A;  1U4M A;  2AWN A;  1F9S A;  1S5D D;  1HXY D;  1BOS A;  3RZD B;  2F0J A;  4A3G B;  2O5J C;  1GUW A;  1TVX A;  4R9W A;  2AWO A;  4O1N A;  2VB2 X;  1AN8 A;  3GTG B;  1DXM A;  4FYD A;  1SYE A;  1G8Z D;  4K5W A;  1D5X C;  1EEI D;  1Q90 A;  1BQQ T;  1L0X B;  2O4X A;  3SEB A;  1XX8 A;  2O2L D;  3BYY B;  2WII B;  3I4N B;  4OO1 I;  4KKU A;  3DEO A;  5CC4 A;  3A55 A;  4U67 3;  4XQQ A;  1GUT A;  1Z7T A;  1M4V A;  4LMQ D;  3I91 A;  4DAY A;  2WP8 J;  2JA8 B;  2HDM A;  2XSC A;  4BWG B;  3GTQ B;  2ZXO A;  5C44 B;  1J8I A;  1SNO A;  2SNS A;  1PRT B;  1BCP B;  3HOZ B;  1B53 A;  1BBX C;  1TKW B;  2EE1 A;  4DK1 A;  2E2D C;  3K6O A;  4HMI A;  2E74 C;  2M9V A;  5KIX A;  1C8C A;  1BXT A;  5KNB A;  2KQ3 A;  3NPP A;  4CJ2 C;  1W6K A;  1R9T B;  5G3L F;  1EU3 A;  2H1E A;  4PQX A;  3IFD A;  1MSG A;  4JBW A;  3KBG A;  1JC7 A;  2MGS A;  2MPM A;  1RTO A;  1S5B D;  2F0K A;  1EWC A;  2F0W A;  4HED A;  3GTM B;  4QIW B;  3GTO B;  3ERO A;  1HCZ A;  4F87 A;  3M7G A;  1HRJ A;  5JAV A;  1HA5 A;  5LL6 S;  4UAI A;  1DOM A;  4ZKC B;  5DM7 3;  5KYI A;  1HTP A;  5IGG A;  3QOL A;  2H4O A;  2TMP A;  4NDX A;  4A3K B;  5KEE A;  1E0B A;  1GHK A;  1F2M A;  3PUX A;  3HOY B;  2F4I A;  1CA5 A;  3SDZ A;  3RZO B;  1DOK A;  1TS3 A;  4RAU C;  2DY7 A;  1HQM C;  2FMC A;  3HG9 A;  1WD1 A;  4KV6 A;  5EPJ A;  3K58 A;  4X3U A;  3I4M B;  2PZW A;  4FF2 A;  5D3D A;  2KVM A;  2KOL A;  3NUC A;  5AFW A;  3Q24 A;  3AU7 A;  1WTP A;  5C4X B;  2DY8 A;  2XIW A;  2XRQ D;  3A56 A;  1LTS D;  1SDF A;  4RGN A;  4KHV A;  5C0X G;  2N88 A;  3P75 A;  2LFN A;  5C4Z A;  1DON A;  1WTR A;  3H09 A;  1Y8P B;  1UNS A;  1PTO H;  2EY2 A;  4FF4 A;  5I6W A;  2B2U A;  1EQV A;  2ID0 A;  2EJF C;  1F2L A;  1TWF B;  2EYM A;  1R4P B;  4XDX A;  1I3Q B;  3S1N B;  1KLU D;  3TP8 A;  3GP7 A;  4EQP A;  3K57 A;  5I9P A;  4JK1 C;  1V43 A;  3OSO A;  1I6V C;  1SYG A;  1I4R A;  1X3Q A;  2A68 C;  3EVQ A;  3GV3 A;  4TRD A;  1F2Z A;  4DGZ A;  1A3U A;  3CQZ B;  3BVM A;  5FO9 B;  2E2J B;  4K6D A;  1UUP A;  4A3J B;  1JR0 D;  3DHQ A;  3LNN A;  4FNF A;  1UAP A;  4XYO A;  2A6E D;  2JSO A;  3I73 A;  3T53 B;  4ZRZ A;  1KNE A;  3T56 B;  2JYO A;  3QO2 A;  4UDU C;  5DEH A;  1MBY A;  2ICE C;  3C2P A;  4A3F B;  2HUG A;  5C0X I;  3RLF A;  1EU4 A;  3U9S A;  1AFP A;  3FPP A;  3MXU A;  4QF4 A;  3MHB A;  3R2T A;  3FMC A;  3EA6 A;  1WTV A;  1PFM A;  4R8I A;  1CA6 A;  3SE0 A;  1O7Z A;  2BE5 D;  1HHV A;  4MHE A;  3OIQ A;  3MXG A;  3R93 A;  4S3S A;  4PNY A;  3DWA A;  2F0H A;  4Q5V A;  3K5L A;  3I90 A;  4WJW A;  1IW7 C;  2WIN B;  3GTP B;  1S5F D;  1QWY A;  4O42 A;  4KJO A;  1Q8I A;  1VMC A;  1QJO A;  2F0Q A;  3GO5 A;  4A93 B;  1K8O A;  3TZU A;  1NCV A;  2NN6 G;  1SYC A;  5K5P A;  4EQO A;  4XIG S;  4X3K A;  1T5X D;  1E2W A;  4IUV A;  1DOL A;  3RD4 A;  2R92 B;  4IQZ A;  4MN3 A;  1X3P A;  2RVL A;  1V1P B;  2C9O A;  2A69 C;  3D4D A;  3NQI A;  3LWE A;  1TY2 A;  4I7Z C;  4KHZ A;  5EPK A;  4OL7 A;  3WOF A;  5FKA C;  1LLR D;  3K5O A;  5IIF A;  5BN3 A;  3GTL B;  1O7Y A;  1V8Q A;  3DM1 A;  3A8I E;  2WAQ B;  3GD7 A;  5KRU A;  1IKL A;  1TR5 A;  1TS2 A;  2K03 A;  1PZJ D;  4OGQ C;  5HGT A;  3J7A V;  1ROD A;  3M7N A;  1STG A;  2WKC A;  1DM0 B;  5BN4 A;  1CZW A;  1C48 A;  2B2V C;  1SSO A;  1BO0 A;  2NYZ D;  1E2V A;  2K05 A;  2K7V A;  5ELC A;  5IGF A;  4G7O C;  2F0E A;  3K5N A;  4NKL A;  5IGB A;  2EY5 A;  1U4R A;  4RWS C;  4DA2 A;  1EYA A;  3MFG A;  1I4P A;  2B8G A;  4FVM A;  3SK8 A;  1HTL D;  3K5M A;  1FD7 D;  4RGT A;  2SNM A;  4WRD A;  1B44 D;  4KMU C;  3KLS A;  1ICW A;  4U68 A;  4DNT B;  4L8J A;  3P7J A;  2Z4H A;  3C1F A;  4CGY B;  1EFI D;  1F2Y A;  1FYC A;  3NSW A;  3IL8 A;  1H9S B;  1DJR D;  1LTR D;  1O7L A;  5E4W C;  2N55 A;  3PUV A;  3PO3 B;  3V96 A;  3HOX B;  3D4W A;  4QUC A;  2IPK D;  3HP3 A;  1SBB B;  2K33 A;  3HZX A;  3K59 A;  1C4Q A;  4RH6 A;  3AMU A;  2IX0 A;  2QCP X;  3D3R A;  1KDB A;  1HFG A;  1SJE D;  4WFN 3;  3C3L A;  3H94 A;  1KDC A;  4K5V A;  3DXJ C;  1LTB D;  3S17 B;  2DNC A;  3CKI B;  4IZ8 A;  2D62 A;  4BA2 I;  1CFM A;  4IUU A;  3D31 A;  3I8Z A;  5M5W B;  2NN6 I;  5DNF A;  2X69 A;  5DAU A;  2OEO A;  4ME5 A;  2RDH A;  1EQT A;  2PW5 A;  4DF7 A;  3F2U A;  5COY A;  2WV6 D;  2L9H A;  3H6M A;  2EYL A;  2NB0 A;  3MFY A;  5IGC A;  5I6Y A;  3PV0 A;  2IJ0 A;  3KLR A;  2L12 A;  2BE5 C;  5IT9 L;  1X32 A;  2J0T D;  2HCC A;  2XRS D;  3MXP A;  5FLX E;  2JA6 B;  1JE4 A;  2F1M A;  2CHB D;  1IYU A;  5FK9 C;  1K83 B;  2NBF A;  4F8M A;  4L63 B;  1ET6 A;  1NAP A;  3M4Y A;  3HRZ C;  5K36 G;  4C1N I;  1EZ6 A;  4FO2 A;  2JA7 B;  1PZK D;  4R8N A;  1IKM A;  2NTT A;  4YIJ A;  5EBC A;  5EPL A;  5I2X A;  1SMY C;  1OXV A;  3JAM E;  1BUV T;  4C3H B;  2EY1 A;  1JB3 A;  3SXH A;  1PFN A;  1S4Z A;  3TBI B;  1RHP A;  2F3V A;  3T51 B;  2PZU A;  5M9O A;  2R61 A;  3PUY A;  5CV9 A;  2LMC B;  3NBI A;  4LK1 C;  3W2D A;  4X3S A;  4XQN A;  4DN4 M;  3D4R A;  3S15 B;  1RKN A;  1KDA A;  5CGK A;  1H9R A;  1KLG D;  1VDZ A;  1B50 A;  1PTO D;  4DAV A;  1L0Y B;  1JOQ A;  2F0L A;  2F0M A;  3IKJ A;  4KD3 A;  2EJG C;  4CHT B;  4CKC A;  1ENF A;  4BS9 A;  4ID6 A;  4J1M A;  4BBS B;  2WKD A;  4E6I A;  3KBX A;  3RUZ A;  1F77 A;  3V05 A;  5M3M B;  1WVL A;  5K36 H;  4DFA A;  1SNM A;  4IUP A;  2BA1 A;  2DNE A;  1MD2 D;  4G7Z C;  4BY7 B;  2PYK A;  1TWA B;  4I65 A;  2CQA A;  2NWG A;  2X6G A;  4ULL A;  3J80 E;  3PIP 3;  3C1E A;  2L4N A;  1PRT C;  1HA6 A;  5JEA H;  1K8M A;  1TS4 A;  3WDN A;  3BDO A;  2A69 D;  2B2V A;  4F7X A;  4B08 A;  4C1N K;  4CKB A;  1G29 1;  5CV6 A;  3SK5 A;  1QB5 D;  2D9U A;  4J8Q A;  1KAB A;  4G4K A;  3ERQ A;  4NMZ A;  2WAC A;  4XYQ A;  2V4D A;  4OO1 H;  2RSO A;  4GZY C;  2A6E C;  2F0P A;  2KUM A;  5LHY 1;  3OMG A;  3P1H A;  2ZT9 C;  2RDF A;  4A3M B;  2B8F A;  3GQB A;  3VA7 A;  2XWJ B;  1STY A;  3DWP A;  1OXT A;  1BDO A;  1D5M C;  1HPC A;  5C3W A;  5J39 A;  4KTA A;  3PMF A;  2K1B A;  3NXW A;  4FXK C;  3TSS A;  4IUT A;  1ILP A;  2WB1 B;  4K2L A;  1SYD A;  5ISR A;  3KLS X;  3ND8 A;  3O13 A;  3G7L A;  1IYV A;  1EY4 A;  4RHR A;  2EPB A;  1PMR A;  3S1R B;  1CHQ D;  3NE5 B;  3J7Y W;  1ENA A;  1I6H B;  4LAA A;  5JPM C;  4ZQ3 A;  4A3D B;  5C3E B;  2YU9 B;  1EOT A;  2ZXP A;  2KCN A;  2EYP A;  2PZT A;  5FLX L;  1LAB A;  1PLF A;  1D1I A;  4FXD A;  1D6E C;  2IT1 A;  1O80 A;  4A3B B;  2JA5 B;  5J22 A;  3FRP B;  2PW7 A;  1HFN A;  3QJY A;  3VR5 A;  3VR6 A;  1STB A;  4P2C B;  2CW0 D;  4IUQ A;  3H3V C;  2RDG A;  4KN7 C;  2HQE A;  4A3E B;  4NW2 A;  3FDT A;  2A6H D;  1MI2 A;  1BF4 A;  3MA2 B;  1PRT F;  3QWN A;  1CI3 M;  4XXE A;  2X6L A;  1QIL A;  2QEJ C;  5I2Y A;  2NVQ B;  3TME A;  4QUF A;  5T1I A;  5EKI A;  1Y1V B;  1PFB A;  2PNR C;  3BDC A;  1WD0 A;  2CW0 C;  1OXU A;  3D8G A;  3QOJ A;  2RBM A;  1GOZ A;  2F0U A;  3EFX D;  5ELE A;  5EQ0 A;  4CBV A;  1LTI D;  2JEA I;  5KNC A;  1NSN S;  2EYJ A;  5E3F A;  3EQL C;  3DUZ A;  1GXD C;  3T4A C;  2Q8R E;  3W3A A;  3HEJ A;  1NR2 A;  4N9T A;  2BDN A;  1V1O A;  2ICI A;  1OXX K;  3J81 L;  2Q8T A;  3MZ5 A;  5F2D A;  2A73 B;  1PXU A;  1AP0 A;  4IUN A;  4K8I A;  4ILW A;  3A7L A;  1FNV A;  1SEB D;  4HTH A;  3BYT B;  3NWS A;  2VB3 X;  4G57 A;  2Z1C A;  1PTO B;  3CU7 A;  3FKI B;  1SNC A;  4H44 C;  4QB4 A;  1BCP D;  5IOC A;  3A8K E;  2G9D A;  3CRL C;  3OMC A;  5ELB A;  4RCN A;  2NZ1 D;  1H9M A;  4DU9 A;  2IX3 A;  1Y8N B;  2R93 B;  3CHB D;  1QOH A;  4HMJ A;  5EKL A;  2EOT A;  1H9K A;  1EY6 A;  1YNJ C;  1LO5 D;  3OPO A;  1JOO A;  5CV5 A;  3VYR A;  4RHS A;  2QF7 A;  1Y1W B;  5M3F B;  1BCP C;  3QG1 A;  4BBR B;  3VA5 A;  1LTG D;  1D5Z C;  4ZAI A;  1RJT A;  4RKL A;  4AYB B;  1S5E D;  3LX0 A;  1LT3 D;  1EYC A;  1OO9 B;  2Z8L A;  2C5C A;  1AZQ A;  4KD4 A;  3OW7 A;  5I9O A;  2Q8I B;  1JWU D;  2FIN B;  3HS0 C;  4KI0 A;  1G2S A;  2PMZ B;  4HSP A;  1Q12 A;  4QCL A;  1SXT A;  3L9A X;  3SHL A;  1Q3L A;  1HQR D;  3P20 A;  2EYF A;  1A2T A;  4Y7N B;  2F0S A;  2F0D A;  1GJX A;  1EL0 A;  4BA1 I;  2ZXR A;  1U4L A;  1TU2 B;  3TP6 A;  5CMD A;  4KKS A;  2J7Z A;  2K6A A;  4DK0 A;  3NTK A;  2AUJ D;  2F0T A;  3I3C A;  4OIK A;  1QNK A;  2EVB A;  2EYH A;  5D65 A;  3SR1 A;  1Q1B A;  2FFK B;  3K7A B;  5CBA E;  2K32 A;  4EVO A;  4Q0F A;  2JEB I;  1RDP D;  1GHJ A;  5IT9 E;  2HCI A;  4ZKB B;  4C3I B;  1SND A;  2JE6 I;  2TSS A;  2J4X A;  3NWT A;  4RCO A;  2K28 A;  4PMW A;  2I46 A;  1ESR A;  4Z9C B;  2IWH A;  4PMC A;  3HGB A;  5CV4 A;  4ZUI A;  2R7Z B;  3D6C A;  1CM9 A;  1ZEQ X;  3PIO 3;  2QKI C;  1KNA A;  3H0G B;  5JVH 3;  1CHP D;  4KY5 A;  5EBD A;  3K0Y A;  1ESF A;  2A6H C;  1VMP A;  3N52 A;  1EY7 A;  1EY0 A;  3PO2 B;  1LT4 D;  5CYU A;  2KHS A;  2NVT B;  3EJI A;  2F0O A;  1DD2 A;  3J80 L;  1BR9 A;  2SDF A;  4K2K A;  5ELD A;  5TSS A;  1LTA D;  2NVY B;  5C0X H;  5EJW A;  1VCI A;  1LT5 D;  2KJX A;  1M8A A;  1ET9 A;  1U4P A;  3OWF A;  2AQ1 B;  3R8B A;  1JOR A;  3HOW B;  5KGU A;  4H7B A;  1XXG A;  2M00 A;  2E75 C;  5LL6 X;  1EY8 A;  3KUP A;  2NN6 H;  2PPB C;  5IGD A;  4IFD J;  2CVR A;  3S2H B;  1EIG A;  4IFD I;  3BDL A;  3DEP A;  1I4Q A;  2FMM A;  2AQ2 B;  2L55 A;  2Y0S B;  3U9O A;  5E4X A;  3TP7 A;  1TWG B;  2L11 A;  4C3H G;  4K6L A;  1SYB A;  1B1Z A;  3GV6 A;  2EYO A;  2SEB D;  3ONA B;  4C2M B;  3X3M A;  3URY A;  2KA7 A;  1TWC B;  1F9P A;  3R3O A;  2NUC A;  2VUM B;  1II3 A;  3I72 A;  2G9H D;  5CBE E;  3OWE B;  5CV7 A;  2IX1 A;  3Q22 A;  1E2Z A;  1B9N A;  2K04 A;  4G7H C;  2B2W A;  5EGT A;  2RA4 A;  3MEH A;  1DCZ A;  1XWE A;  3FPU B;  3RMH A;  2RKS A;  1STA A;  3BZD B;  1LAC A;  3X3N A;  2F0G A;  2XNA C;  3G6J B;  2VNU D;  3SK6 A;  2A74 C;  2BCO A;  3J81 E;  1YNN D;  1SJH D;  2KED A;  1CQV A;  3CRK C;  3J7A F;  1YNN C;  2SOB A;  3NTH A;  4J6H A;  4N9P A;  2L5T A;  1JCK B;  3BVG A;  5JEA J;  1PTO F;  3MVV A;  2XWB B;  3MAQ A;  1WTQ A;  4H13 C;  1IL8 A;  4ZYS A;  2EZV A;  3S1M B;  1RF2 D;  1V1P A;  1EY9 A;  4RGO S;  5JEA G;  3NK9 A;  2OXP A;  5EKK A;  3NTI A;  1Q1E A;  4ZUJ A;  4K5X A;  3S16 B;  4IUR A;  4HN7 A;  2MP1 A;  4M1U B;  3ITP A;  2VXW A;  1SE2 A;  1SNQ A;  5FOB B;  2JXM B;  4EGV A;  1SMY D;  2BA0 A;  1AEX A;  2I07 B;  1G91 A;  3ND9 A;  1RD9 D;  2HDL A;  1WCM B;  4XT1 B;  2LKV A;  1JWM D;  1LTT D;  4DXF A;  1BNZ A;  5D14 A;  3A8J E;  5C0X J;  2KEC A;  4LJZ C;  2B2U C;  1CTM A;  3H91 A;  3I70 A;  4TSS A;  2KEE A;  5A35 A;  5ELF A;  1SE4 A;  2FHT A;  4RGM A;  4TQU S;  1TS5 A;  2F3W A;  3S14 B;  4PV1 C;  1R4Q B;  3E5S A;  4C56 C;  1QG7 A;  5M5Y B;  3VR3 A;  1JOK A;  3S2D B;  4XTC S;  3LWU A;  1XTC D;  2R6G A;  1CT1 D;  1TQO A;  3BG3 A;  3BVZ A;  1EY5 A;  1PTO C;  2F0N A;  2LS0 1;  5A2Q E;  4FF3 A;  3NP8 A;  2BDO A;  2O5I C;  1O78 A;  5A2Q L;  2JP1 A;  1JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...