2WKDA

Crystal structure of a double ile-to-met mutant of protein orf34 from lactococcus phage p2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
79
Chain Sequence
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEVKVAYGSAFMPDFIQMGDTVTVSGRVQAKNYNFVFPTVEKVFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF34P2
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Dna binding protein
total genus 10
structure length 79
sequence length 89
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkdA00
2WKDA 2WKCA
chains in the Genus database with same CATH superfamily
4JI1Q 1QE6A 5GAHC 3CCUA 4NW2A 1JB3A 4DXFA 3H3VI 1JWSD 3FRPB 4BY1G 1JWMD 4NP5A 1JORA 2SEBD 2L55A 4DV1L 4GN4B 1O7IA 1EYCA 1TWHB 2EOTA 3T1YL 3R3OA 3Q22A 5DAUA 4OELB 3ND8A 3PUVA 1S5FD 4U68A 3MAQA 3R93A 2IT1A 3NHHA 3NTKA 1Z7TA 5KNBA 2E5LQ 5LMNL 4IOAA 4YWKA 1QVGA 2A73B 1F9PA 3DMUA 3NSWA 1RF2D 3A74A 1KLUD 5IP9G 3CCRA 3S17B 1M4VA 1OO9B 1AZPA 2M9VA 4J1MA 4KHPL 4KJOA 1C0AA 4YCUA 1RTOA 1EZ8A 1JOKA 1X54A 2GVAA 5C3EH 2DY8A 4LF7Q 3BDOA 4A3FB 3Q24A 4A3JH 3TQYA 2ES2A 4DV7Q 4P74A 2K52A 2PMZE 4X62Q 2R7FA 1EWIA 4AYBB 2A5HA 1NJIC 3MC0B 2VB3X 5K36H 2JN4A 1MI2A 2NN6I 2LXJA 1D2BA 4JBWA 4K5WA 4A3FG 4HCSA 2Y0SB 2EPBA 2JA5G 3TBIB 2EYMA 5DM73 3BU2A 4AYBG 2IJ0A 4O2DA 1XNQQ 2F0TA 4CJ0B 2UXDQ 5I2XA 2L4NA 1OXUA 4F7XA 5LMUQ 5IWAL 3CPWA 3TS2A 3J81E 2YU9H 3HZXA 4RH6A 4A3IB 3HKZE 4S3SA 3A8KE 2IY5B 1MIUA 2MO0A 5JVG3 3VA7A 3S1QB 3K81C 1P16A 3FMCA 4KTAA 1R4QB 1E1OA 1YNXA 3CW2C 2K50A 4X66Q 2CFMA 4Y7NB 4A3IG 4KHZA 2R92G 3H15A 4N9PA 2NB0A 2NZ1D 3NBIA 3NXWA 5CV9A 1E3PA 2EXDA 4RGOS 2IX1A 3WDNA 3A56A 4LK1C 2LKVA 4DR2Q 3I8ZA 1LTBD 2PO4A 3RZOB 1HHVA 1O7LA 5M3MB 5COYA 1Q90A 4IN3A 1I3QB 1Q46A 2C35B 2JXMB 1VQCA 5ELBA 1Q86C 2PCFB 3RN2A 1YJWA 1X3EA 3QOLA 3FP9A 4HEDA 4FYDA 2JA8H 2N55A 1YVCA 5M3MG 4BWGB 4A3EH 4IPGA 2N78A 3HS0C 2EJGC 2RA4A 4DKAC 1HUNA 3C3LA 3K6OA 2AMCB 2HIXA 1E0BA 1TS4A 4ZUIA 1MJCA 1ILPA 2QEXA 5I9OA 1UE1A 3PMFA 1VQAA 2K32A 3DWPA 2MHVA 1XMOQ 1ENAA 3HKSA 1EEFD 5FLXL 1LUZA 5T1IA 4KJNA 1JB7A 1O7YA 5ELEA 1N32L 1STEA 1D5ZC 1O7ZA 2EDGA 2F0UA 2K1BA 4IJHA 4IJLA 3HOUH 4LF8L 1SNQA 2VQFQ 3F1ZA 1T5XD 1GUOA 1Q3LA 1N36Q 2VUMH 4JYAQ 1B44D 5M5XH 2N3SA 3W2DA 1EQVA 4MN3A 4C3HH 4XQJA 4O0AA 2K5HA 1AH9A 5C0XJ 2SNMA 4TQUS 4CDDC 4ZQ3A 5ELOA 3GTOH 3OIQA 2BDOA 3RMHA 1S40A 3SK8A 5JAVA 2A19A 4B3RQ 3MEFA 2JP1A 5CV4A 5KRUA 3UDXA 2CHBD 2J0TD 3QIAA 4BBSB 1MD2D 1SNPA 3BDCA 4TKOB 3JAML 3GTMB 2AKWB 3CAMA 3D4WA 4LWCA 3BVMA 1CZWA 1DOMA 4A3GB 4CKEA 4ZKCB 5IGGA 2RQXA 1FGUA 2MO1A 3MXNB 2V4DA 5IT9L 3CC7A 3KLSA 1AZQA 2KHIA 5M3FH 1OXTA 1QJOA 4QY7A 2IX0A 1STNA 4BBSG 3A54A 1EY6A 5CR3A 4NXNQ 1NBWA 4LFAQ 1XTDA 5A35A 3CC4A 5CBEE 2ZJRA 3DXJC 1M1KC 4A3BB 1KL9A 2BOSA 4YWLA 4FVMA 3NP8A 2R93B 5BN5A 3J7A5 3NEMA 1B50A 4DR1Q 5JVH3 1PH7A 4B3SQ 4QB4A 1CZGA 5FJ8G 3L3OC 3TS0A 3HFZB 1EFID 4IFDJ 4A3BG 3PCOB 1PH6A 4QMGA 2EYJA 3NBHA 3PQIA 5JOBA 3K5OA 3H94A 4DV6Q 1AEXA 3K5NA 1K8AC 1WCMG 4IPHA 1ML0D 3J80L 3J7ZC 1TT2A 4IUTA 2I0QA 4DUYQ 2Z8LA 2O5JC 4JI8L 2XN9C 1CQVA 3K7UC 4DAYB 3X3MA 1N34L 4X3TA 4CBVA 3I4NH 1B9MA 1CM9A 1TS3A 1IZ6A 4LFCL 1SRUA 4RWSC 3TP6A 2A1AA 3B6YA 4Q0FA 5I6WA 3BVZA 5IYBG 3A5UA 3IAYA 4OWXB 1SYDA 5CBAE 1YHQA 3BVGA 3D4RA 3UE1A 2AQ1B 3UI2A 2HD3A 3H0GB 1DJRD 2KVMA 5IY0A 4JC0A 3RD4A 3PO2B 3VR3A 1KRTA 1GXDC 1I6HH 2ICEC 3MXUA 1IXRA 2CWAA 2N49A 3EJIA 1U9RA 1VQHA 5C3XA 1D5MC 3GTQB 1K83B 4R4CA 4DV0L 1MHWC 5CV6A 1F2LA 1LTTD 2PYKA 3AB9A 4QF4A 5C4HA 1STBA 1ZKOA 2H1EA 1G2SA 1H9JA 3PO2G 1H95A 2RF4A 3ULLA 4BY1H 1P8LA 2NTSA 1TY0A 4QIWE 4L5SA 4LF5Q 4A3JG 4MNOA 2OF1A 3F8TA 5GAGC 2XRSD 2D5DA 4FF1A 5J22A 2B8GA 3S15B 2JEBI 1LTID 5K36G 3IFTA 2ALYB 2Q2HA 1TWHH 4IPCA 3LNNA 5IP9H 2XSCA 3E9IA 4YCWA 3OOCA 3SXHA 1W6KA 4J6HA 2R7ZB 3J81c 3HOVB 5DM63 3MFGA 1L0WA 5IGEA 4XT1B 4HJAA 3Q8DA 3GV3A 1LT6D 2AHOB 2RDHA 3S17H 2VXWA 3PUZA 1EIHA 4DF7A 1LTSD 3HOVG 2HDLA 5HGQA 1EZ6A 2F0NA 3PF4A 2C9OA 5C44B 1J5EL 1NMGA 1BBXC 4CKBA 4A3FH 5IE8A 4XT3B 1SE2A 1VQPA 1Y8PB 3TP7A 2UU9Q 2VZAA 3PIOA 1CT1D 5JEAJ 3CCQA 1VQKA 4JI2L 1BVSA 1EUJA 4QIWB 1EOVA 2EY5A 1R4PB 1Y1VB 4HTHA 4ZK9B 1BKBA 3L9AX 3VA5A 1Q81C 1QG7A 2B8FA 3JAMi 3VR2A 5IGDA 1HFGA 4DUZQ 1PMRA 4KY7A 2NUCA 1PFNA 1OXSC 1WOCA 3DHQA 3A7LA 2H5XA 4A3IH 1D1IA 4H13C 2PZWA 1K28A 2WB1B 4OHJA 3VYTA 4A3EG 3S1QH 3I72A 2QDBA 2NTTA 3ITPA 2VQEQ 2F0IA 1FYCA 4AQYQ 1HR0L 4DR5L 3OW2A 1B4OA 3EFXD 1TY2A 4Y7NH 4KN4C 2KEEA 4KY6A 4O1NA 3J7AV 1SMYD 1BF4A 4DAPA 4H7BA 4CDCC 3AFPA 3FKIB 1XNRQ 1T5EA 1GOZA 2MUYA 2EYFA 2KHSA 4IUQA 2ZM6Q 2B63B 2Q8IB 1S5ED 3HOUG 3IFDA 5IGFA 3RZOH 1SXTA 1HTPA 3E9HA 3GTOB 5J1ZA 4HIDA 2QDLA 5M3MH 2Z6KA 2VUMG 4C1NK 2WIIB 3FKIG 1I3QH 2JYOA 5A2QL 3DWAA 5KYIA 2RHQB 4I7AA 1L2FA 3J80i 4EQNA 1WTRA 1J8IA 2B63G 5BR8L 1HFNA 1RTNA 5LMNW 5ELDA 3PO3B 1WTHA 1A15A 2X6GA 3I7FA 5KNCA 2R6GA 4GKKL 1SJED 3E3XA 3K8AA 3QB3A 4JBMA 1XX8A 3WOFA 1PTOD 4MTNA 3SK4A 3CXCA 1S72A 1HNZQ 1Q8KA 1YNND 3BZCA 4R4IA 1VMCA 1JJCB 4DV5Q 1PRTD 2EY2A 3AYHB 4YY3Q 1TIID 1VQ8A 4X6AH 4BA2I 1YNNC 4FDBA 1C9OA 5AJ3Q 1ET6A 2E2HB 4RCOA 3GTLB 5C6AA 3AFQA 4POGA 3KFUA 5E4XA 3BS1A 4HIMA 1DONA 4JI6Q 3C2PA 5D65A 1IYVA 3HP3A 2CW0D 3CCLA 1N9WA 2UUBQ 2VNUD 1NY4A 3IRBA 4FXKC 5CORA 3SK6A 4LF9L 3AU7A 1STYA 1F2ZA 3MXNA 3D8GA 3TMEA 2JEAI 4XTCS 1N33L 3CF5A 4JI3Q 3A7AB 3TEHB 3HOWB 4BBSH 3GTMH 3VYSA 4TRDA 4AH6A 4A3GH 4F88A 3PIP3 2B3GA 4A3DB 2F3VA 4UPAA 1I94L 2ZXOA 4JI7L 4JI0Q 1ILQA 1YJNA 3I4NG 4A93B 4JVZA 1F9SA 4APVA 3HOWG 1BQQT 2ASBA 2NYZD 1HXYD 2QCPX 4JV5L 1F2YA 4DV3Q 2EJFC 2KUMA 1HTLD 4HSPA 3K5LA 1UAPA 2K75A 4A3BH 3OSOA 4X64Q 2KEDA 1EU3A 3U58A 5KNDA 4K2KA 4DV4Q 4KI0A 1IBKQ 2R93H 1UNSA 5C5MA 1H9MA 2O2LD 3PGZA 4BS9A 1FL0A 3RLOA 1AW7A 1BXTA 4LNQA 4B3ML 5CMDA 1U5KA 4AYBE 4DK0A 4DAYA 3G6EA 1SMXA 2UXBQ 1B70B 1SJHD 3E0EA 3W1GA 1EQQA 2KJXA 1QVCA 4OWTB 4XQQA 3OMGA 1SYGA 2Y0SE 3W5OA 3L2PA 2AWOA 1TWFH 5IYBH 3K7AB 2EYLA 2OCEA 1DOKA 1NCVA 1PZJD 3C1FA 2Z6BA 1HH2P 1DD2A 4FO2A 2UUCQ 2OTJA 2K5DA 1CKMA 1QNKA 3E0JA 5EBCA 5JJZA 5FLXE 3OTOL 3CPFA 1X65A 1KRSA 1SR3A 3JC66 3NENA 2EZVA 4DGZA 4FP5D 2X6LA 1QWYA 5EPJA 2TSSA 4JG2A 3NQTA 2F0KA 1ASZA 2MNAA 1HNWL 1VQFA 3K57A 1Y1WB 1PH8A 3IL8A 4V0BA 4DNTB 3J81j 2F0DA 3S9WA 2E2JB 3H0GH 4DV2L 1SNDA 2CWPA 4JI1L 3R2IA 2DJGC 1I50B 2I5MX 2L12A 1IYUA 1G6ZA 5BN4A 5M5YB 3PO2H 1C48A 4POFA 1Q7YC 4OX9Q 4JI5L 5I6YA 4DN4M 2JK8A 4R4TA 1Y1WG 4KLKA 4C2MB 1NE3A 3GTQH 3JAME 1K83H 1LTGD 4OL7A 3VR5A 4G7ZC 3K5MA 4K0KL 5IT9E 2E5LL 4H02A 3DM3A 2B2UC 3OWEB 1VQ4A 4GLXA 5IWAQ 3PSIA 1JT8A 3EQLC 3NK9A 4K8JA 3S15H 4LUZA 4C3IB 2VB2X 1XWEA 1CHPD 2I46A 1B3QA 2YV5A 2QKIC 2B29A 3SGIA 2QF7A 4L6TB 3WWVA 1JR0D 4K8IA 1L1OB 4R8IA 3WOEA 4TSSA 4LF7L 2Y0SG 1HNXL 2MJ8A 3F2DA 1HA5A 4A3KB 4RAUC 2MP1A 1S5CD 4DV7L 2R7ZH 4X62L 4BXXG 1NAPA 2XTIA 2QGQA 4KKSA 3HOVH 2WAQB 1A2TA 1PFMA 1RJTA 1STGA 1TS5A 3EROA 2I5HA 4GLVB 1X56A 1VS0A 3AQQA 4EVOA 3J80E 1OXVA 1PZID 4HMIA 1CSQA 1XNQL 3KLSX 1ENFA 2KCCA 4QUFA 1RKNA 2UXDL 2X69A 4DR3Q 1EOTA 5C44H 5LMUL 4HAEA 4PNYA 4C3JB 2J4XA 1XPOA 2RCFA 3FVQA 2UXCL 2K04A 2RDFA 1BNZA 1XYIA 3RZDB 4FXGC 1CUKA 3VYRA 3S24A 5GROA 2Q8RE 5G3LD 4NPSA 4RKBA 2HT1A 2NVTB 4X66L 2UUAQ 2F1MA 3CRLC 5CGKA 2EXZA 1SE8A 1ZXTA 1Y1VH 1LYLA 3QO2A 1TWAB 3G48A 1E2WA 5D14A 2NVQB 5HURA 1I4HA 1I4XA 1N32Q 1U4LA 1I4RA 1WTXA 2V1CC 4IUVA 2HHHL 5I9PA 4EQOA 1GKHA 3M3YB 2FFKB 1B9NA 5C0XG 2MFIA 3BJUA 3DLLA 1PHJA 4DR6Q 4I7ZC 1GJXA 2BCOA 2RCNA 2SOBA 4HR7B 1CQFA 4DAMA 1VQOA 3F2UA 1C4QA 1NMFA 4CDEC 4X65Q 3D31A 4ME3A 4EX5A 2RKSA 3O13A 5C3WA 3FKIH 1Y8NB 3I4MB 4LF6Q 1Q12A 2AWNA 3Q23A 2B63H 1EIFA 1KC8C 1EIGA 1X9NA 4HIOA 1XMQL 5DNFA 2MPMA 2F0WA 2E75C 1S5BD 3H09A 3CP0A 4K2LA 1I6VC 5IIFA 1UE6A 5GAEC 3P7JA 4EQ5A 5I4DA 4DXGA 3LX0A 3W1BA 3PO3H 4LMQD 4LUVA 2VQFL 3GO5A 1ZYRD 4DNIA 1N36L 1II3A 5EJWA 4JYAL 2A6HD 4IALA 1M90C 1JE4A 4GKJL 1ZYRC 5HY6A 1NTGA 4K6DA 4UDUC 2A6HC 3AMUA 4A3GG 3T53B 1H9SB 4IFDG 1GUGA 3GTGB 1GD7A 2IW3A 2N8NA 1GM5A 3CD6A 4X3KA 1E2VA 3NWSA 3TREA 2F4VL 1QOHA 1B53A 1AN8A 1MGSA 2F0MA 2E2HH 3S2DB 4IZ8A 1K0SA 1QZGA 1J9OA 1X32A 1PTOB 1VQNA 3GTLH 3TZDA 1Y8OB 1JC7A 1VDZA 4JI8Q 4RHRA 1PRTB 2R93G 2M2LA 4L63B 3U9SA 1IL8A 2SDFA 3GD7A 3ERQA 1TWFB 3OW7A 4LFAL 4LFCQ 4LFBQ 1DOLA 4H0LC 4P71A 3BZDB 4DNRB 3CC2A 5C5LA 4DR4Q 1XPRA 2HDMA 3HOWH 1HCZA 3T16A 1KDCA 5IP7H 2CVRA 4UP7A 1SYEA 1HR0W 4DR1L 4A3DH 3FPPA 4N9TA 4PV1C 4B3SL 1I4PA 2LSSA 3L7ZC 1UUPA 3NWTA 3T56B 2E2IH 4WFN3 2ZXPA 1XJVA 2IL8A 4A93H 4GZYC 1Q1EA 4LUOA 5EAYA 5ELNA 3VR6A 2EE1A 4DV6L 4C56C 5BN3A 1GUNA 2RBMA 4PMWA 2I07B 2XWJB 5E7NA 4DV0Q 1S4ZA 3GTKB 4DUYL 1VQDA 1UE5A 2D0PA 1SNOA 5I2YA 5A2QE 4HCEA 4JBJA 4JCVE 3KDFB 1U0LA 4GN3B 3H0GG 2HUGA 4HSVA 2C5CA 3D0FA 3PIPA 3HOZB 3T1HQ 1KNEA 2K14A 3CMAA 4V190 5EKKA 4OIKA 2O4XA 3S2HB 3GP7A 1SBBB 1I5FA 2F0FA 2CCZA 1L1OC 3K7AH 1E22A 1CSPA 5IT9c 3S1NB 1YNJD 3HOZG 2F03A 2EIFA 1PV4A 2Z1CA 2K5QA 3BDLA 2Q2TA 1RIPA 2WB1E 4BA1I 4A76A 1E1TA 4JW0A 1MJEA 3I2ZA 3SDZA 3LWUA 2KECA 4CDFC 4QUCA 3D6CA 3FHWA 1TQOA 5CV5A 1NUCA 4LF4L 5LL6X 3I90A 1Y1WH 2A68D 1KQSA 4LF5L 2E2JH 2D0OA 1J5EQ 1FJGQ 2KCTA 1V43A 2NZHA 4G7HC 1CK1A 1I50H 4QJFA 1N8RC 2IHFA 2R7ZG 5TSSA 1PFBA 5M5YH 1IBLQ 1HJPA 1X6OA 1CHQD 2QILA 1BBWA 1G8ZD 2E76C 4C2MH 2K5VA 1B3AA 1FGBD 1LTLA 2BA1A 2F0QA 3OWFA 4IURA 2JA6B 2J7ZA 4JI2Q 1SE4A 4PQXA 1U4PA 4ILWA 1MSHA 3ZJYC 1EIYB 1DCZA 2F0PA 2IWHA 1G291 1WTPA 3BYTB 4OWWB 4ZUJA 3RUZA 3U4VA 1BO0A 5C44G 4Q5VA 1L1OA 1YITA 4FF4A 2ZTDA 3G71A 1ESRA 1JQYD 2F3IA 3M9BA 2XRQD 1VQ5A 1PTOF 4KMUC 4BXXH 4C3IH 4A3LH 1DYQA 4UP9A 5IGBA 4B3TQ 1PRTF 4JI4Q 3CU7A 1Y1VG 4XDXA 1WYDA 3UDGA 4A3KH 4A3MB 2PZUA 4MZ9A 1TU2B 4GLAC 1WD0A 4U673 2UU9L 1SNCA 4OO1G 3CHBD 2B2VC 1VQEA 4WORA 4DK6C 4YIJA 1CA6A 4ALPA 3HEJA 4QL5A 5EPLA 1YZ6A 2YTXA 3PUWA 5CC4A 1EU4A 2WB1G 1SE3A 4ZRZA 4PZ8A 1KD1C 1SMYC 2D9UA 1G51A 2JQOA 2KHJA 3MFYA 2CH4W 2WFWA 4C3JH 4PZ7A 3GQBA 1V1OA 4RGNA 2FJ2A 1PA6A 2PNRC 3RZDH 1E7ZA 1SN8A 3ICEA 3A55A 2VQEL 3ERSX 4GKKQ 4AQYL 1W2BA 3KF6B 1EY9A 5KEEA 2EY1A 2NVTH 4L5TA 5JJIA 4ID6A 1HRJA 2OEOA 2OTLA 3S1MB 4I65A 1OTCA 4OGQC 1TWAH 1XNRL 2N88A 4YHHL 4WJWA 1PH1A 5C0XH 2NVQH 3TSSA 1X3FA 2NBFA 2ZM6L 1V8QA 1Y14B 4LW1A 3PO3G 5EBDA 4HJ8A 1T9HA 1PTOC 3TN2A 1G91A 3M3YH 4M8AA 2FINB 1BCPB 4R1JA 3SK5A 3KOJA 3OMCA 3RR5A 2H4OA 1PYBA 3T4AC 1PRTC 1ESFA 1YEZA 2K28A 4K5VA 4HIKA 2HIVA 2RVLA 4K5XA 3I4MH 4WJ3M 5C0XI 2OXPA 4B9XA 2P5ZX 5LL6S 4DU9A 4P73A 3QOJA 5EKLA 2ID0A 4MHEA 1D8LA 1VQIA 3HOXB 2CW0C 3N6RA 1JJGA 1HNZL 3CQZB 1SFOB 1EY8A 1PDQA 2DGYA 1PYSB 3UDFA 1BOSA 4DK1A 1KXLA 2A6ED 1LT5D 4JI7Q 3UE0A 4EGVA 2KENA 1IBMQ 1PLFA 3FDTA 4NXML 4ZAIA 3CKIB 3HOXG 4IFDH 2A6EC 1H9SA 3E6ZX 4R9WA 4G7OC 2LFNA 4KV6A 5ISRA 1WFQA 2E2IB 3K0XA 3EBEA 2NVYB 2YTYA 4K14A 1BDOA 1WTQA 4JI6L 3HOYB 4GOPB 1CFMA 1VCIA 1PH5A 5IP7G 1Z6HA 2UUBL 3R8BA 4IO9A 1VQBA 2MGSA 2ZTEA 1A3VA 4A3DG 3GTGH 3F2BA 3P75A 5M9OA 5C4JB 3A8JE 3TP5A 2HQEA 2JE6I 1X3PA 2HCCA 4RGMA 1IL2A 1RD9D 4A93G 2O5IC 1V9PA 3A0JA 4JI3L 1Z47A 2D2CC 2XNAC 4IFDI 3S2DH 3RLFA 1S5DD 2OWOA 1YHBA 1FVIA 2GVBA 1F9QA 4RKLA 1PTOH 3VDYA 4DR7Q 5JJKA 4FF3A 1CKNB 3K59A 4UY8C 1HUMA 2RSOA 2Q8TA 4IOCA 4JI0L 2E2DC 5FOBB 5C4XB 1MKHA 1NR4A 4FF2A 4FXDA 4ODGA 4FNFA 3URYA 1LT3D 4GNXB 2FMCA 2PI2A 4DV1Q 5JPMC 3T1YQ 4R4QA 1XXGA 4DV3L 2FXQA 2R7DA 1IW7D 1EYAA 1LLRD 1BBUA 4HMJA 1I4QA 4QGUA 4B08A 3TRZA 5ELCA 5C4XG 1QB5D 4DV4L 5CV8A 1IW7C 3H6MA 1EL0A 5LMNQ 1IBKL 2ZXRA 4A3CH 2A8VA 4DPGA 2B2YC 1X3GA 1B1ZA 1ICWA 5GADC 3I56A 1IKMA 2GA4B 2FHTA 5L37A 1YBYA 4RG1A 4HJ5A 1KLGD 2L15A 2WAQE 5E1FA 3KBXA 3M85A 2SNSA 2UXBL 2WP8J 2HCIA 4KHPQ 5IYDG 2CQOA 4TVAB 1C7YA 3KDFA 1SYCA 4JI5Q 4ZKBB 2VW9A 3N52A 1HZAA 1STAA 5FO7B 3PF5A 1FD7D 1TWGB 3GTKH 1CA5A 3LWEA 2G9DA 3I4LA 4BBRB 4BY7B 2UUCL 4XQNA 2WKDA 3PIO3 2QEJC 4K0KQ 2LMCB 1CTMA 1PYWD 1EYGA 2WKCA 5EPKA 5G3LF 4YWMA 2NN6H 1DM0B 1TWCB 1D7QA 3HOZH 4BBRG 5KGUA 4BY7G 4JOIC 1TS2A 1VF7A 2QW7A 1BCPF 3S2HH 3FEWX 4ZLTF 1FNVA 2AUKA 2LS01 1LM0A 2DUDA 3P20A 2F0LA 5FO8B 3S1NH 3I73A 2Z9HA 1VQGA 1VQMA 1HNXQ 3MTSA 2NVXB 4QCLA 3VYUA 5GQOA 2JA5B 2ZTCA 1PFSA 1JCKB 5CYUA 1AE2A 4OX9L 3LGJA 1KAAA 1QNUA 1TR5A 2JA9A 2B2YA 2DNCA 3QR8A 3C1EA 3V96A 1ZEQX 2PQEA 3SEBA 1K9MC 5KYLA 3S16B 5HGTA 1ONLA 2K5NA 3KLWA 4C3IG 2B39A 5JEAH 4A3LG 1YI2A 1U4RA 1GUTA 3DM1A 3M4YA 1K3RA 3AEVA 1Q8IA 2OT2A 3A5ZB 3K80C 3KJPA 4A3KG 3KF8B 5FLMG 1GUWA 1EQTA 1LTAD 3G7LA 2F0VA 1LT4D 3M4PA 4WJ4A 2UXCQ 1M8AA 2R92B 2XVSA 2WAQG 2BDNA 4XIGS 2LY7A 2EYOA 2L11A 1VQJA 2XIWA 1SSOA 2JA6H 1RL2A 1O78A 2EYPA 2PQAB 2IX3A 1R9TB 2ZJQA 4PG3A 4JOIA 1A2UA 2JA7B 1VMPA 2BA0A 4KK7A 1UEAB 2B2UA 4Z9CB 1IYJB 5FO9B 4KY5A 4C3JG 5IGCA 2PW7A 1XPUA 3V2TA 4IUPA 3KYHC 1ET9A 2Q2UA 3SVMA 1BCPD 3E5SA 2R61A 1X55A 2EVBA 4F87A 1W3SA 2JA7G 3W3AA 4OO1H 2HHHQ 1GHJA 1Q82C 4E6IA 1BCPC 1GVPA 1X3QA 1K3BC 3RNUA 3OYYA 2PMZB 4DR2L 4DR3L 3GTJB 2L5TA 4LF8Q 3NELA 4A3MH 3D4DA 4XYOA 3GDEA 1KNAA 1ICFB 1PH2A 1F77A 1PH3A 4ZYSA 3ND9A 3DEPA 2K4KA 1L0XB 5D3DA 2UUAL 3M7NA 3MVVA 2EJMA 2DY7A 5IYCG 4OO1I 1WD1A 2YTVA 4CGYB 5E4WC 1XMQQ 4JBKA 3MXGA 3HKZB 1RDPD 3GTPB 3STBD 3KF6A 1H9RA 1ASYA 3M4OB 4DAVA 4OXPA 2BH8A 3Q6SA 1U4MA 3S14B 1NR2A 4X3SA 1STHA 3STBC 3I4MG 5M5WB 1Y69U 1XMOL 2E8GA 3HKZG 4OEMB 3EN2A 3QG1A 4GKJQ 3BYYB 1UE7A 2PI2E 4GOPC 4DR6L 2K33A 3VR4A 1FR3A 2KOLA 4JPBW 3S1MH 1KDAA 1RCVD 1Q1BA 4X65L 1DGSA 2FMMA 3T51B 2ICIA 4LF6L 3FPUB 3BG3A 2JJQA 4RA8A 4IUNA 1JOQA 4KKTA 3ULPA 2E74C 3V05A 4JK1C 2F4VQ 1B2TA 3ULJA 1QVFA 4LAAA 1PH9A 1KTKA 2F0HA 2LXKA 4OONA 1VQ7A 1JOOA 1VQ9A 2RDGA 4B3RL 2DJFC 2RSNA 3PV0A 1L0YB 2K05A 1SNMA 3ER0A 2K01A 3PUXA 5ELFA 1A6XA 2CH4A 4GNXC 4R4OA 3S1RB 1HZ9A 1I4GA 3I55A 2K03A 3MXPA 5K5PA 5IODA 1JJ2A 1N34Q 4AIMA 1V1PA 2EYHA 4NXNL 4MTKA 1E24A 3CCVA 3J81L 3HOXH 5C4ZA 1LABA 3CQZH 1WCMB 4LJZC 1SFOH 2ATWA 3EVQA 2F52A 1HPCA 4GOPA 3MWYW 1PVOA 3P1HA 1QILA 1YIJA 3EIVA 1KAWA 1CKOA 2KBNA 3DEOA 5DEHA 1JE5A 3L0OA 1SROA 4KHVA 2AQ2B 4HJ7A 2DN8A 5D3IB 2NVYH 1HZCA 4IQZA 5FLXc 1K8MA 1GO3E 3Q0AA 3HOYH 1TVXA 4A3CG 1H9KA 3I4OA 1O80A 5EGTA 3U4ZA 2PNHA 5C4JH 1PXUA 3H91A 1C8CA 4LFBL 1CKNA 2XGTA 1SYFA 2F0SA 4DR4L 4IUUA 3MZ5A 4ULLA 3KBGA 2AQ3B 1AP0A 2YYZA 1Z9FA 4GNXA 4CHTB 1D6EC 1K8GA 2XWBB 1LTRD 1QUQA 3NE5B 1MBYA 2R3ZA 1XTCD 3K58A 5C4XH 1MSGA 5EQ0A 3JAMc 4GS3A 4A4IA 5CV7A 1PH4A 2PZTA 2A69D 1BUVT 4P2CB 3G4SA 3KJOA 5C3EB 3UDIA 2F4IA 5J3BA 1HZBA 2A74C 3KUPA 4A3JB 2A69C 2NN6G 3RN5A 1VQLA 4RMFA 2KCMA 4G57A 4L8JA 3OHXC 2K6AA 4NMZA 5IYDH 1YNJC 3OPOA 4NKLA 1F9RA 4LF4Q 3SE0A 1AFPA 3RLNA 3F2CA 5C3EG 5LHY1 2WINB 1K0RA 2ENBA 3T1HL 2ZJPA 1EEID 2PW5A 2CKZB 2Z4IA 1WJJA 1A0IA 2EY6A 2G5DA 3PUYA 2KQ3A 3T13A 2AUJD 1TWGH 2YU9B 1KIXA 1V1QA 3NQIA 1EY0A 4J15A 2A68C 2VY3A 4C1NI 2B2TC 5JEAG 4BBRH 2QA4A 4BY7H 5JJLA 4UHVA 1B7YB 4R8NA 4RCNA 2L1BA 1TKWB 3QWNA 1NNXA 3BZKA 3J80c 3M7GA 2B2WC 3CCSA 1TWCH 4XYQA 2WV6D 1HA6A 1GUSA 3CCEA 5T1GA 2BH2A 1UWVA 2F0EA 4EQPA 1WI5A 3X3NA 3QJYA 2JA6G 1BR9A 2G9HD 1FJGL 3DWQA 1VF5C 2NVXH 1G2TA 2PPBC 2OQKA 2JA5H 1SEBD 2Z6KC 1IBLL 1B8AA 2WACA 1WTWA 1KABA 4PZ6A 1HR0Q 4DR5Q 1EQRA 4ZCKA 1A62A 3G6JB 3R2TA 5FLMH 3KF8A 2NZOA 3S16H 2JA8B 1LACA 4A75A 3IKJA 1QZHA 4QQBX 1SLJA 3NTIA 1S3OA 1QCBD 1FNWA 4A3EB 4N8FA 4K6LA 4P75A 2VS1A 3OIPA 2L0CA 4A3MG 2JA8G 4CKCA 2PQAA 1DZ1A 2B2TA 2D62A 1J6QA 3ONAB 2R92H 2I5LX 4DUZL 4XXEA 3MHBA 1SAPA 4UP8A 3EA6A 3CCJA 1LV9A 4GN5A 1JICA 1EY7A 5BR8Q 4B3TL 2IPKD 1HQMC 4JI4L 2B2WA 3HOUB 1ENCA 1A3UA 1KHIA 3MEHA 5EKIA 3CMEA 1LO5D 1R9TH 3J7AF 1G6PA 1DXMA 3J81i 5IOCA 2JA7H 2VUMB 5M5XB 2K7VA 3GV6A 4YHHQ 2F3WA 3SHLA 4C3HB 3SR1A 4NDXA 2F0JA 5DLQE 1A8VA 3A8IE 4DK3C 3TP8A 5JPNC 1YJ9A 3HG9A 5AFWA 1VQ6A 4X3UA 1YHAA 1JWUD 3CRKC 4KKUA 2IHEA 2F0OA 1A3TA 4O42A 4HJ9A 5FK9C 1E2ZA 4C3HG 1NSNS 3GTJH 3C46A 3KLRA 1WVLA 5E3FA 4F8MA 5IYCH 4L5RC 4ABNA 2EQSA 2B2VA 1JMCA 2NWGA 1CI3M 3CCMA 1K73C 5M3FB 3D3RA 1EWCA 2L9HA 4RGTA 1A63A 4ME5A 1WTOA 3H3VC 4LF9Q 2GN5A 2KCNA 1D5XC 4N8X1 2DNEA 5M3FG 3GTPH 1N33Q 3ZYYX 4J8QA 5F2DA 4MIUA 3M4OH 1TXYA 3K0YA 1W6JA 3M4QA 4CJ2C 4NXMQ 2M00A 4L5QA 3S14H 2F0GA 1I94Q 5M5WH 4DV5L 3DUZA 3TZUA 1EY4A 4YY3L 3J7YW 4RFBA 1EYDA 1V1PB 2VL6A 2ZT9C 4B9WA 5AJ3L 4H44C 3U50C 4DA2A 1SYBA 1SDFA 4JV5Q 1RHPA 4OIJA 1EY5A 1AE3A 5KIXA 3NBHB 3KK7A 4NB3A 3I4NB 2CQAA 3I91A 4IPDA 4KD4A 2K5WA 3TDQA 1KDBA 3NTHA 1FNUA 3U9OA 2OQ0A 4B3MQ 2Z4HA 3HOYG 1UEBA 1IBML 4P72A 1EWHA 5J39A 4PMCA 2KA7A 1WTVA 3HRZC 3S1RH 3NPPA 4M1UB 4DFAA 5FJ8H 1IHZA 1PZKD 3D6WA 1I6HB 1OXXK 3I3CA 3H3VH 3OTOQ 1GHKA 3HGBA 5H1SE 1QUQB 1WCMH 3I70A 4X64L 5NUCA 2Q2IA 4RHSA 2TMPA 1RODA 2RHSB 1D1KA 4KD3A 4WRDA 1K8OA 3NUCA 2BE5D 2MQHA 2HQLA 3MA2B 4Y52H 1HQRD 2Z0SA 1F2MA 4G4KA 5FKAC 1EFWA 4CJ1B 4BY1B 2JSOA 1HNWQ 4YCVA 4PMBA 4KN7C 4HN7A 4UAIA 4DR7L 2BE5C 4DV2Q 1IKLA
chains in the Genus database with same CATH topology
1QE6A 4NW2A 1JB3A 4DXFA 1JWSD 3FRPB 1JWMD 4NP5A 1JORA 2SEBD 2L55A 1TWHB 1EYCA 2EOTA 3R3OA 3Q22A 5DAUA 3ND8A 3PUVA 1S5FD 4U68A 3MAQA 3R93A 2IT1A 3NHHA 3NTKA 1Z7TA 5KNBA 2A73B 1F9PA 3DMUA 3NSWA 1RF2D 1KLUD 3S17B 1M4VA 1OO9B 1AZPA 2M9VA 4J1MA 4KJOA 1RTOA 1EZ8A 1JOKA 2DY8A 3BDOA 4A3FB 3Q24A 4AYBB 2A5HA 3MC0B 2VB3X 5K36H 1MI2A 2NN6I 1D2BA 4JBWA 4K5WA 4HCSA 2Y0SB 2EPBA 3TBIB 2EYMA 5DM73 2IJ0A 2F0TA 4CJ0B 5I2XA 2L4NA 1OXUA 4F7XA 3J81E 3HZXA 4RH6A 4A3IB 4S3SA 3A8KE 5JVG3 3VA7A 3S1QB 3FMCA 4KTAA 1R4QB 4Y7NB 4KHZA 4N9PA 2NB0A 2NZ1D 3NBIA 3NXWA 5CV9A 2IX1A 4RGOS 3WDNA 3A56A 4LK1C 2LKVA 3I8ZA 1LTBD 2PO4A 3RZOB 1HHVA 1O7LA 5M3MB 5COYA 1Q90A 4IN3A 1I3QB 2JXMB 5ELBA 2PCFB 3QOLA 4HEDA 4FYDA 2N55A 4BWGB 3HS0C 2EJGC 2RA4A 1HUNA 3C3LA 3K6OA 1E0BA 1TS4A 4ZUIA 1ILPA 5I9OA 3PMFA 3DWPA 2K32A 2MHVA 1ENAA 1EEFD 5FLXL 5T1IA 4KJNA 1O7YA 5ELEA 1STEA 1D5ZC 1O7ZA 2EDGA 2F0UA 2K1BA 1SNQA 1T5XD 1GUOA 1Q3LA 1B44D 3W2DA 1EQVA 4MN3A 4XQJA 5C0XJ 2SNMA 4TQUS 4ZQ3A 3OIQA 2BDOA 3RMHA 3SK8A 5JAVA 2JP1A 5CV4A 5KRUA 2CHBD 2J0TD 3QIAA 4BBSB 1MD2D 1SNPA 3BDCA 4TKOB 3JAML 3GTMB 3D4WA 3BVMA 1CZWA 1DOMA 4A3GB 4CKEA 4ZKCB 5IGGA 2RQXA 2V4DA 5IT9L 3KLSA 1AZQA 1OXTA 1QJOA 2IX0A 1STNA 3A54A 1EY6A 5CR3A 5A35A 5CBEE 3DXJC 4A3BB 2BOSA 4FVMA 3NP8A 2R93B 5BN5A 1B50A 5JVH3 4QB4A 1CZGA 3L3OC 4IFDJ 1EFID 4QMGA 2EYJA 3NBHA 5JOBA 3K5OA 3H94A 1AEXA 3K5NA 1ML0D 3J80L 1TT2A 4IUTA 2Z8LA 2O5JC 2XN9C 1CQVA 3X3MA 4X3TA 4CBVA 1B9MA 1CM9A 1TS3A 4RWSC 3TP6A 5I6WA 4Q0FA 3BVZA 3IAYA 1SYDA 5CBAE 3BVGA 3D4RA 2AQ1B 3UI2A 3H0GB 1DJRD 2KVMA 3RD4A 3PO2B 3VR3A 1GXDC 2ICEC 3MXUA 3EJIA 1U9RA 5C3XA 1D5MC 3GTQB 1K83B 5CV6A 1F2LA 5C4HA 1LTTD 2PYKA 3AB9A 4QF4A 1STBA 1ZKOA 2H1EA 1G2SA 1H9JA 2NTSA 1TY0A 2OF1A 2XRSD 2D5DA 4FF1A 5J22A 2B8GA 3S15B 2JEBI 1LTID 5K36G 3IFTA 3LNNA 2XSCA 3OOCA 3SXHA 1W6KA 4J6HA 2R7ZB 3HOVB 5DM63 3MFGA 5IGEA 4XT1B 3GV3A 1LT6D 2RDHA 2VXWA 3PUZA 1EIHA 4DF7A 1LTSD 2HDLA 1EZ6A 2F0NA 2C9OA 5C44B 1BBXC 4CKBA 4XT3B 1SE2A 1Y8PB 3TP7A 1CT1D 5JEAJ 4QIWB 2EY5A 4HTHA 1R4PB 1Y1VB 4ZK9B 3L9AX 3VA5A 1QG7A 2B8FA 3VR2A 5IGDA 1HFGA 1PMRA 4KY7A 2NUCA 1PFNA 1OXSC 3DHQA 3A7LA 1D1IA 4H13C 2PZWA 2WB1B 4OHJA 3VYTA 3I72A 2QDBA 2NTTA 3ITPA 2F0IA 1FYCA 1B4OA 3EFXD 1TY2A 4KN4C 2KEEA 4KY6A 4O1NA 3J7AV 1SMYD 1BF4A 4DAPA 4H7BA 3FKIB 1T5EA 1GOZA 2MUYA 2EYFA 2KHSA 4IUQA 2B63B 2Q8IB 1S5ED 3IFDA 5IGFA 1SXTA 1HTPA 3GTOB 5J1ZA 4C1NK 2WIIB 2JYOA 5A2QL 3DWAA 5KYIA 4EQNA 1WTRA 1J8IA 1HFNA 1RTNA 5ELDA 3PO3B 1A15A 2X6GA 5KNCA 2R6GA 1SJED 3QB3A 1XX8A 3WOFA 1PTOD 3SK4A 1YNND 1VMCA 1PRTD 2EY2A 1TIID 4BA2I 1YNNC 1ET6A 2E2HB 4RCOA 3GTLB 5C6AA 5E4XA 3BS1A 1DONA 3C2PA 5D65A 1IYVA 3HP3A 2CW0D 2VNUD 4FXKC 5CORA 3SK6A 3AU7A 1STYA 1F2ZA 3MXNA 3D8GA 3TMEA 2JEAI 4XTCS 3A7AB 3HOWB 3VYSA 4TRDA 4F88A 3PIP3 4A3DB 2F3VA 2ZXOA 1ILQA 4A93B 1F9SA 1BQQT 2NYZD 1HXYD 2QCPX 1F2YA 2EJFC 2KUMA 1HTLD 4HSPA 3K5LA 1UAPA 3OSOA 2KEDA 1EU3A 5KNDA 4K2KA 4KI0A 1UNSA 5C5MA 1H9MA 2O2LD 4BS9A 1AW7A 1BXTA 5CMDA 4DK0A 4DAYA 1SJHD 2KJXA 4XQQA 3OMGA 1SYGA 2AWOA 3K7AB 2EYLA 1DOKA 1NCVA 1PZJD 3C1FA 1DD2A 4FO2A 2K5DA 1QNKA 3E0JA 5EBCA 5JJZA 5FLXE 2EZVA 4DGZA 4FP5D 2X6LA 1QWYA 5EPJA 2TSSA 3NQTA 2F0KA 3K57A 1Y1WB 3IL8A 4V0BA 4DNTB 2F0DA 3S9WA 2E2JB 1SNDA 3R2IA 1I50B 2L12A 1IYUA 1G6ZA 5BN4A 5M5YB 1C48A 5I6YA 4DN4M 4C2MB 3JAME 1LTGD 4OL7A 3VR5A 4G7ZC 3K5MA 5IT9E 2B2UC 3OWEB 3EQLC 3NK9A 4K8JA 4C3IB 2VB2X 1XWEA 1CHPD 2I46A 2QKIC 2QF7A 4L6TB 1JR0D 4K8IA 4R8IA 3WOEA 4TSSA 2MJ8A 1HA5A 4A3KB 4RAUC 2MP1A 1S5CD 1NAPA 4KKSA 2WAQB 1A2TA 1PFMA 1RJTA 1STGA 1TS5A 3EROA 4EVOA 3J80E 1OXVA 1PZID 4HMIA 3KLSX 1ENFA 2KCCA 4QUFA 1RKNA 2X69A 1EOTA 4HAEA 4PNYA 4C3JB 2J4XA 3FVQA 2K04A 2RDFA 1BNZA 1XYIA 3RZDB 4FXGC 3VYRA 2Q8RE 5G3LD 4RKBA 2NVTB 2F1MA 3CRLC 5CGKA 2EXZA 1ZXTA 3QO2A 1TWAB 1E2WA 5D14A 2NVQB 5HURA 1I4HA 1I4XA 1U4LA 1I4RA 1WTXA 4IUVA 5I9PA 4EQOA 3M3YB 2FFKB 1B9NA 5C0XG 4I7ZC 1GJXA 2BCOA 2SOBA 4HR7B 1CQFA 3F2UA 1C4QA 3D31A 2RKSA 3O13A 5C3WA 3I4MB 1Y8NB 1Q12A 2AWNA 3Q23A 1EIGA 5DNFA 2MPMA 2F0WA 2E75C 1S5BD 3H09A 4K2LA 1I6VC 5IIFA 3P7JA 5I4DA 4DXGA 3LX0A 4LMQD 3GO5A 1ZYRD 1II3A 5EJWA 2A6HD 4IALA 1JE4A 1ZYRC 4K6DA 4UDUC 2A6HC 3AMUA 3T53B 1H9SB 4IFDG 1GUGA 3GTGB 2IW3A 4X3KA 1E2VA 3NWSA 1QOHA 1B53A 1AN8A 1MGSA 2F0MA 3S2DB 4IZ8A 1J9OA 1X32A 1PTOB 3TZDA 1Y8OB 1JC7A 1VDZA 4RHRA 1PRTB 2M2LA 4L63B 3U9SA 1IL8A 2SDFA 3GD7A 3ERQA 1TWFB 3OW7A 1DOLA 4H0LC 3BZDB 4DNRB 5C5LA 2HDMA 1HCZA 3T16A 1KDCA 2CVRA 1SYEA 3FPPA 4N9TA 4PV1C 1I4PA 3L7ZC 1UUPA 3NWTA 3T56B 4WFN3 2ZXPA 2IL8A 4GZYC 1Q1EA 3VR6A 2EE1A 4C56C 5BN3A 1GUNA 2RBMA 4PMWA 2I07B 2XWJB 3GTKB 1S4ZA 1SNOA 5I2YA 5A2QE 4HCEA 2HUGA 4HSVA 2C5CA 3HOZB 1KNEA 4V190 5EKKA 4OIKA 2O4XA 3S2HB 3GP7A 1SBBB 2F0FA 3S1NB 1YNJD 2F03A 2Z1CA 2K5QA 3BDLA 4BA1I 3SDZA 3LWUA 2KECA 4QUCA 3D6CA 5CV5A 1TQOA 1NUCA 5LL6X 3I90A 2A68D 1V43A 4G7HC 1CK1A 5TSSA 1PFBA 1CHQD 2QILA 1G8ZD 2E76C 1B3AA 1FGBD 2BA1A 2F0QA 3OWFA 2JA6B 4IURA 2J7ZA 1SE4A 4PQXA 1U4PA 4ILWA 1MSHA 1DCZA 2F0PA 2IWHA 1G291 1WTPA 3BYTB 4ZUJA 3RUZA 1BO0A 4Q5VA 4FF4A 1ESRA 1JQYD 2XRQD 1PTOF 4KMUC 1DYQA 5IGBA 1PRTF 3CU7A 4XDXA 4A3MB 2PZUA 1TU2B 1WD0A 4U673 1SNCA 4OO1G 3CHBD 2B2VC 4WORA 4YIJA 1CA6A 3HEJA 5EPLA 3PUWA 5CC4A 1EU4A 1SE3A 4ZRZA 1SMYC 2D9UA 3MFYA 3GQBA 1V1OA 4RGNA 2FJ2A 2PNRC 3A55A 1EY9A 5KEEA 2EY1A 4ID6A 1HRJA 2OEOA 3S1MB 4I65A 4OGQC 2N88A 4WJWA 5C0XH 3TSSA 2NBFA 1V8QA 5EBDA 1PTOC 3TN2A 1G91A 4M8AA 2FINB 1BCPB 3SK5A 3OMCA 2H4OA 3T4AC 1PRTC 1ESFA 2K28A 4K5VA 2RVLA 4K5XA 5C0XI 2OXPA 4B9XA 5LL6S 4DU9A 3QOJA 5EKLA 2ID0A 4MHEA 3HOXB 2CW0C 3N6RA 3CQZB 1SFOB 1EY8A 1PDQA 1BOSA 4DK1A 2A6ED 1LT5D 4EGVA 1PLFA 3FDTA 4ZAIA 3CKIB 4IFDH 2A6EC 1H9SA 3E6ZX 4R9WA 4G7OC 2LFNA 4KV6A 5ISRA 2E2IB 2NVYB 4K14A 1BDOA 1WTQA 3HOYB 1CFMA 1VCIA 1Z6HA 3R8BA 2MGSA 1A3VA 3P75A 5M9OA 5C4JB 3TP5A 3A8JE 2HQEA 2JE6I 1X3PA 2HCCA 4RGMA 1RD9D 2O5IC 1Z47A 2D2CC 2XNAC 4IFDI 3RLFA 1S5DD 1F9QA 4RKLA 1PTOH 4FF3A 3K59A 1HUMA 2RSOA 2Q8TA 2E2DC 5FOBB 5C4XB 1NR4A 4FF2A 4FXDA 4ODGA 4FNFA 3URYA 1LT3D 2FMCA 5JPMC 1XXGA 1IW7D 1EYAA 1LLRD 4HMJA 1I4QA 4B08A 5ELCA 1QB5D 5CV8A 1IW7C 3H6MA 1EL0A 2ZXRA 2B2YC 1B1ZA 1ICWA 1IKMA 2GA4B 2FHTA 1KLGD 5E1FA 3M85A 3KBXA 2SNSA 2WP8J 2HCIA 1SYCA 4ZKBB 3N52A 1STAA 5FO7B 1FD7D 1TWGB 1CA5A 3LWEA 2G9DA 3I4LA 4BBRB 4BY7B 4XQNA 2WKDA 3PIO3 2QEJC 2LMCB 1CTMA 1PYWD 2WKCA 5EPKA 5G3LF 2NN6H 1DM0B 1TWCB 5KGUA 1TS2A 1VF7A 1BCPF 3FEWX 4ZLTF 1FNVA 2AUKA 2LS01 3P20A 2F0LA 5FO8B 3I73A 3MTSA 2NVXB 4QCLA 3VYUA 2JA5B 1JCKB 5CYUA 1KAAA 1QNUA 1TR5A 2B2YA 2DNCA 3C1EA 3V96A 1ZEQX 2PQEA 3SEBA 5KYLA 3S16B 5HGTA 1ONLA 4C3IG 2B39A 5JEAH 1U4RA 1GUTA 3DM1A 3M4YA 1Q8IA 2OT2A 1GUWA 1EQTA 1LTAD 3G7LA 2F0VA 1LT4D 1M8AA 2R92B 2XVSA 2BDNA 4XIGS 2LY7A 2EYOA 2L11A 2XIWA 1SSOA 1O78A 2EYPA 2IX3A 1R9TB 1A2UA 2JA7B 1VMPA 2BA0A 4KK7A 1UEAB 2B2UA 4Z9CB 5FO9B 4KY5A 4C3JG 5IGCA 2PW7A 3V2TA 4IUPA 1ET9A 3SVMA 1BCPD 3E5SA 2R61A 4F87A 2EVBA 3W3AA 4OO1H 1GHJA 4E6IA 1BCPC 1X3QA 2PMZB 3GTJB 2L5TA 3D4DA 4XYOA 1KNAA 1F77A 4ZYSA 3ND9A 3DEPA 5D3DA 1L0XB 3M7NA 3MVVA 2EJMA 2DY7A 4OO1I 1WD1A 4CGYB 5E4WC 3MXGA 3HKZB 1RDPD 3GTPB 1H9RA 3M4OB 4DAVA 3Q6SA 1U4MA 3S14B 1NR2A 4X3SA 1STHA 5M5WB 1Y69U 3QG1A 3BYYB 2K33A 3VR4A 1FR3A 2KOLA 1KDAA 1RCVD 1Q1BA 2FMMA 3T51B 2ICIA 3FPUB 3BG3A 4RA8A 4IUNA 1JOQA 4KKTA 2E74C 3V05A 4JK1C 1B2TA 4LAAA 1KTKA 2F0HA 1JOOA 2RDGA 2RSNA 3PV0A 1L0YB 2K05A 1SNMA 2K01A 3PUXA 5ELFA 1A6XA 3S1RB 1I4GA 2K03A 3MXPA 5K5PA 5IODA 1V1PA 2EYHA 3J81L 5C4ZA 1LABA 4LJZC 1WCMB 3EVQA 1HPCA 3MWYW 3P1HA 1QILA 3DEOA 5DEHA 4KHVA 2AQ2B 2DN8A 5D3IB 4IQZA 1K8MA 3Q0AA 1TVXA 1H9KA 5EGTA 1O80A 1PXUA 3H91A 1C8CA 1SYFA 2F0SA 4IUUA 3MZ5A 4ULLA 3KBGA 2AQ3B 1AP0A 2YYZA 4CHTB 1D6EC 2XWBB 1LTRD 3NE5B 1MBYA 2R3ZA 1XTCD 3K58A 1MSGA 5EQ0A 5CV7A 2PZTA 2A69D 1BUVT 4P2CB 5C3EB 2F4IA 2A74C 3KUPA 4A3JB 2A69C 2NN6G 4G57A 4L8JA 3OHXC 2K6AA 4NMZA 1YNJC 3OPOA 4NKLA 1F9RA 3SE0A 1AFPA 5LHY1 2WINB 2ENBA 1EEID 2PW5A 2Z4IA 2EY6A 3PUYA 2KQ3A 3T13A 2AUJD 2YU9B 3NQIA 1EY0A 2A68C 4C1NI 5JEAG 2B2TC 4R8NA 4RCNA 2L1BA 1TKWB 3QWNA 3M7GA 2B2WC 4XYQA 2WV6D 1HA6A 1GUSA 5T1GA 2F0EA 4EQPA 3X3NA 3QJYA 1BR9A 2G9HD 3DWQA 1VF5C 1G2TA 2PPBC 1SEBD 2WACA 1WTWA 1KABA 3G6JB 3R2TA 3KF8A 2JA8B 1LACA 3IKJA 3NTIA 1QCBD 1FNWA 4A3EB 4K6LA 3OIPA 2L0CA 4CKCA 1DZ1A 2B2TA 2D62A 3ONAB 4XXEA 3MHBA 1SAPA 3EA6A 1LV9A 1JICA 1EY7A 2IPKD 1HQMC 2B2WA 3HOUB 1ENCA 1A3UA 3MEHA 5EKIA 1LO5D 3J7AF 1DXMA 2VUMB 5IOCA 5M5XB 2K7VA 3GV6A 2F3WA 3SHLA 4C3HB 3SR1A 4NDXA 2F0JA 3A8IE 3TP8A 5JPNC 3HG9A 5AFWA 4X3UA 1JWUD 3CRKC 4KKUA 2F0OA 1A3TA 4O42A 5FK9C 1E2ZA 4C3HG 1NSNS 3C46A 3KLRA 1WVLA 5E3FA 4F8MA 4ABNA 2B2VA 2NWGA 1CI3M 5M3FB 3D3RA 1EWCA 2L9HA 4RGTA 4ME5A 1WTOA 3H3VC 2KCNA 1D5XC 2DNEA 3ZYYX 4J8QA 5F2DA 4MIUA 3K0YA 1W6JA 4CJ2C 2M00A 2F0GA 3DUZA 3TZUA 1EY4A 3J7YW 4RFBA 1EYDA 1V1PB 2ZT9C 4B9WA 4H44C 4DA2A 1SYBA 1SDFA 1RHPA 4OIJA 1EY5A 5KIXA 3KK7A 3I4NB 2CQAA 3I91A 4KD4A 2K5WA 3TDQA 1KDBA 3NTHA 1FNUA 3U9OA 2Z4HA 1EWHA 5J39A 4PMCA 2KA7A 1WTVA 3HRZC 3NPPA 4M1UB 4DFAA 1IHZA 1PZKD 3D6WA 1I6HB 1OXXK 3I3CA 1GHKA 3HGBA 3I70A 5NUCA 4RHSA 2TMPA 1RODA 1D1KA 4KD3A 4WRDA 1K8OA 3NUCA 2BE5D 3MA2B 1HQRD 1F2MA 4G4KA 5FKAC 4BY1B 4CJ1B 2JSOA 4PMBA 4KN7C 4HN7A 4UAIA 2BE5C 1IKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKD A;  2WKC A; 
#chains in the Genus database with same CATH topology
 4JI1 Q;  1QE6 A;  5GAH C;  3CCU A;  4NW2 A;  1JB3 A;  4DXF A;  3H3V I;  1JWS D;  3FRP B;  4BY1 G;  1JWM D;  4NP5 A;  1JOR A;  2SEB D;  2L55 A;  4DV1 L;  4GN4 B;  1O7I A;  1EYC A;  1TWH B;  2EOT A;  3T1Y L;  3R3O A;  3Q22 A;  5DAU A;  4OEL B;  3ND8 A;  3PUV A;  1S5F D;  4U68 A;  3MAQ A;  3R93 A;  2IT1 A;  3NHH A;  3NTK A;  1Z7T A;  5KNB A;  2E5L Q;  5LMN L;  4IOA A;  4YWK A;  1QVG A;  2A73 B;  1F9P A;  3DMU A;  3NSW A;  1RF2 D;  3A74 A;  1KLU D;  5IP9 G;  3CCR A;  3S17 B;  1M4V A;  1OO9 B;  1AZP A;  2M9V A;  4J1M A;  4KHP L;  4KJO A;  1C0A A;  4YCU A;  1RTO A;  1EZ8 A;  1JOK A;  1X54 A;  2GVA A;  5C3E H;  2DY8 A;  4LF7 Q;  3BDO A;  4A3F B;  3Q24 A;  4A3J H;  3TQY A;  2ES2 A;  4DV7 Q;  4P74 A;  2K52 A;  2PMZ E;  4X62 Q;  2R7F A;  1EWI A;  4AYB B;  2A5H A;  1NJI C;  3MC0 B;  2VB3 X;  5K36 H;  2JN4 A;  1MI2 A;  2NN6 I;  2LXJ A;  1D2B A;  4JBW A;  4K5W A;  4A3F G;  4HCS A;  2Y0S B;  2EPB A;  2JA5 G;  3TBI B;  2EYM A;  5DM7 3;  3BU2 A;  4AYB G;  2IJ0 A;  4O2D A;  1XNQ Q;  2F0T A;  4CJ0 B;  2UXD Q;  5I2X A;  2L4N A;  1OXU A;  4F7X A;  5LMU Q;  5IWA L;  3CPW A;  3TS2 A;  3J81 E;  2YU9 H;  3HZX A;  4RH6 A;  4A3I B;  3HKZ E;  4S3S A;  3A8K E;  2IY5 B;  1MIU A;  2MO0 A;  5JVG 3;  3VA7 A;  3S1Q B;  3K81 C;  1P16 A;  3FMC A;  4KTA A;  1R4Q B;  1E1O A;  1YNX A;  3CW2 C;  2K50 A;  4X66 Q;  2CFM A;  4Y7N B;  4A3I G;  4KHZ A;  2R92 G;  3H15 A;  4N9P A;  2NB0 A;  2NZ1 D;  3NBI A;  3NXW A;  5CV9 A;  1E3P A;  2EXD A;  4RGO S;  2IX1 A;  3WDN A;  3A56 A;  4LK1 C;  2LKV A;  4DR2 Q;  3I8Z A;  1LTB D;  2PO4 A;  3RZO B;  1HHV A;  1O7L A;  5M3M B;  5COY A;  1Q90 A;  4IN3 A;  1I3Q B;  1Q46 A;  2C35 B;  2JXM B;  1VQC A;  5ELB A;  1Q86 C;  2PCF B;  3RN2 A;  1YJW A;  1X3E A;  3QOL A;  3FP9 A;  4HED A;  4FYD A;  2JA8 H;  2N55 A;  1YVC A;  5M3M G;  4BWG B;  4A3E H;  4IPG A;  2N78 A;  3HS0 C;  2EJG C;  2RA4 A;  4DKA C;  1HUN A;  3C3L A;  3K6O A;  2AMC B;  2HIX A;  1E0B A;  1TS4 A;  4ZUI A;  1MJC A;  1ILP A;  2QEX A;  5I9O A;  1UE1 A;  3PMF A;  1VQA A;  2K32 A;  3DWP A;  2MHV A;  1XMO Q;  1ENA A;  3HKS A;  1EEF D;  5FLX L;  1LUZ A;  5T1I A;  4KJN A;  1JB7 A;  1O7Y A;  5ELE A;  1N32 L;  1STE A;  1D5Z C;  1O7Z A;  2EDG A;  2F0U A;  2K1B A;  4IJH A;  4IJL A;  3HOU H;  4LF8 L;  1SNQ A;  2VQF Q;  3F1Z A;  1T5X D;  1GUO A;  1Q3L A;  1N36 Q;  2VUM H;  4JYA Q;  1B44 D;  5M5X H;  2N3S A;  3W2D A;  1EQV A;  4MN3 A;  4C3H H;  4XQJ A;  4O0A A;  2K5H A;  1AH9 A;  5C0X J;  2SNM A;  4TQU S;  4CDD C;  4ZQ3 A;  5ELO A;  3GTO H;  3OIQ A;  2BDO A;  3RMH A;  1S40 A;  3SK8 A;  5JAV A;  2A19 A;  4B3R Q;  3MEF A;  2JP1 A;  5CV4 A;  5KRU A;  3UDX A;  2CHB D;  2J0T D;  3QIA A;  4BBS B;  1MD2 D;  1SNP A;  3BDC A;  4TKO B;  3JAM L;  3GTM B;  2AKW B;  3CAM A;  3D4W A;  4LWC A;  3BVM A;  1CZW A;  1DOM A;  4A3G B;  4CKE A;  4ZKC B;  5IGG A;  2RQX A;  1FGU A;  2MO1 A;  3MXN B;  2V4D A;  5IT9 L;  3CC7 A;  3KLS A;  1AZQ A;  2KHI A;  5M3F H;  1OXT A;  1QJO A;  4QY7 A;  2IX0 A;  1STN A;  4BBS G;  3A54 A;  1EY6 A;  5CR3 A;  4NXN Q;  1NBW A;  4LFA Q;  1XTD A;  5A35 A;  3CC4 A;  5CBE E;  2ZJR A;  3DXJ C;  1M1K C;  4A3B B;  1KL9 A;  2BOS A;  4YWL A;  4FVM A;  3NP8 A;  2R93 B;  5BN5 A;  3J7A 5;  3NEM A;  1B50 A;  4DR1 Q;  5JVH 3;  1PH7 A;  4B3S Q;  4QB4 A;  1CZG A;  5FJ8 G;  3L3O C;  3TS0 A;  3HFZ B;  1EFI D;  4IFD J;  4A3B G;  3PCO B;  1PH6 A;  4QMG A;  2EYJ A;  3NBH A;  3PQI A;  5JOB A;  3K5O A;  3H94 A;  4DV6 Q;  1AEX A;  3K5N A;  1K8A C;  1WCM G;  4IPH A;  1ML0 D;  3J80 L;  3J7Z C;  1TT2 A;  4IUT A;  2I0Q A;  4DUY Q;  2Z8L A;  2O5J C;  4JI8 L;  2XN9 C;  1CQV A;  3K7U C;  4DAY B;  3X3M A;  1N34 L;  4X3T A;  4CBV A;  3I4N H;  1B9M A;  1CM9 A;  1TS3 A;  1IZ6 A;  4LFC L;  1SRU A;  4RWS C;  3TP6 A;  2A1A A;  3B6Y A;  4Q0F A;  5I6W A;  3BVZ A;  5IYB G;  3A5U A;  3IAY A;  4OWX B;  1SYD A;  5CBA E;  1YHQ A;  3BVG A;  3D4R A;  3UE1 A;  2AQ1 B;  3UI2 A;  2HD3 A;  3H0G B;  1DJR D;  2KVM A;  5IY0 A;  4JC0 A;  3RD4 A;  3PO2 B;  3VR3 A;  1KRT A;  1GXD C;  1I6H H;  2ICE C;  3MXU A;  1IXR A;  2CWA A;  2N49 A;  3EJI A;  1U9R A;  1VQH A;  5C3X A;  1D5M C;  3GTQ B;  1K83 B;  4R4C A;  4DV0 L;  1MHW C;  5CV6 A;  1F2L A;  1LTT D;  2PYK A;  3AB9 A;  4QF4 A;  5C4H A;  1STB A;  1ZKO A;  2H1E A;  1G2S A;  1H9J A;  3PO2 G;  1H95 A;  2RF4 A;  3ULL A;  4BY1 H;  1P8L A;  2NTS A;  1TY0 A;  4QIW E;  4L5S A;  4LF5 Q;  4A3J G;  4MNO A;  2OF1 A;  3F8T A;  5GAG C;  2XRS D;  2D5D A;  4FF1 A;  5J22 A;  2B8G A;  3S15 B;  2JEB I;  1LTI D;  5K36 G;  3IFT A;  2ALY B;  2Q2H A;  1TWH H;  4IPC A;  3LNN A;  5IP9 H;  2XSC A;  3E9I A;  4YCW A;  3OOC A;  3SXH A;  1W6K A;  4J6H A;  2R7Z B;  3J81 c;  3HOV B;  5DM6 3;  3MFG A;  1L0W A;  5IGE A;  4XT1 B;  4HJA A;  3Q8D A;  3GV3 A;  1LT6 D;  2AHO B;  2RDH A;  3S17 H;  2VXW A;  3PUZ A;  1EIH A;  4DF7 A;  1LTS D;  3HOV G;  2HDL A;  5HGQ A;  1EZ6 A;  2F0N A;  3PF4 A;  2C9O A;  5C44 B;  1J5E L;  1NMG A;  1BBX C;  4CKB A;  4A3F H;  5IE8 A;  4XT3 B;  1SE2 A;  1VQP A;  1Y8P B;  3TP7 A;  2UU9 Q;  2VZA A;  3PIO A;  1CT1 D;  5JEA J;  3CCQ A;  1VQK A;  4JI2 L;  1BVS A;  1EUJ A;  4QIW B;  1EOV A;  2EY5 A;  1R4P B;  1Y1V B;  4HTH A;  4ZK9 B;  1BKB A;  3L9A X;  3VA5 A;  1Q81 C;  1QG7 A;  2B8F A;  3JAM i;  3VR2 A;  5IGD A;  1HFG A;  4DUZ Q;  1PMR A;  4KY7 A;  2NUC A;  1PFN A;  1OXS C;  1WOC A;  3DHQ A;  3A7L A;  2H5X A;  4A3I H;  1D1I A;  4H13 C;  2PZW A;  1K28 A;  2WB1 B;  4OHJ A;  3VYT A;  4A3E G;  3S1Q H;  3I72 A;  2QDB A;  2NTT A;  3ITP A;  2VQE Q;  2F0I A;  1FYC A;  4AQY Q;  1HR0 L;  4DR5 L;  3OW2 A;  1B4O A;  3EFX D;  1TY2 A;  4Y7N H;  4KN4 C;  2KEE A;  4KY6 A;  4O1N A;  3J7A V;  1SMY D;  1BF4 A;  4DAP A;  4H7B A;  4CDC C;  3AFP A;  3FKI B;  1XNR Q;  1T5E A;  1GOZ A;  2MUY A;  2EYF A;  2KHS A;  4IUQ A;  2ZM6 Q;  2B63 B;  2Q8I B;  1S5E D;  3HOU G;  3IFD A;  5IGF A;  3RZO H;  1SXT A;  1HTP A;  3E9H A;  3GTO B;  5J1Z A;  4HID A;  2QDL A;  5M3M H;  2Z6K A;  2VUM G;  4C1N K;  2WII B;  3FKI G;  1I3Q H;  2JYO A;  5A2Q L;  3DWA A;  5KYI A;  2RHQ B;  4I7A A;  1L2F A;  3J80 i;  4EQN A;  1WTR A;  1J8I A;  2B63 G;  5BR8 L;  1HFN A;  1RTN A;  5LMN W;  5ELD A;  3PO3 B;  1WTH A;  1A15 A;  2X6G A;  3I7F A;  5KNC A;  2R6G A;  4GKK L;  1SJE D;  3E3X A;  3K8A A;  3QB3 A;  4JBM A;  1XX8 A;  3WOF A;  1PTO D;  4MTN A;  3SK4 A;  3CXC A;  1S72 A;  1HNZ Q;  1Q8K A;  1YNN D;  3BZC A;  4R4I A;  1VMC A;  1JJC B;  4DV5 Q;  1PRT D;  2EY2 A;  3AYH B;  4YY3 Q;  1TII D;  1VQ8 A;  4X6A H;  4BA2 I;  1YNN C;  4FDB A;  1C9O A;  5AJ3 Q;  1ET6 A;  2E2H B;  4RCO A;  3GTL B;  5C6A A;  3AFQ A;  4POG A;  3KFU A;  5E4X A;  3BS1 A;  4HIM A;  1DON A;  4JI6 Q;  3C2P A;  5D65 A;  1IYV A;  3HP3 A;  2CW0 D;  3CCL A;  1N9W A;  2UUB Q;  2VNU D;  1NY4 A;  3IRB A;  4FXK C;  5COR A;  3SK6 A;  4LF9 L;  3AU7 A;  1STY A;  1F2Z A;  3MXN A;  3D8G A;  3TME A;  2JEA I;  4XTC S;  1N33 L;  3CF5 A;  4JI3 Q;  3A7A B;  3TEH B;  3HOW B;  4BBS H;  3GTM H;  3VYS A;  4TRD A;  4AH6 A;  4A3G H;  4F88 A;  3PIP 3;  2B3G A;  4A3D B;  2F3V A;  4UPA A;  1I94 L;  2ZXO A;  4JI7 L;  4JI0 Q;  1ILQ A;  1YJN A;  3I4N G;  4A93 B;  4JVZ A;  1F9S A;  4APV A;  3HOW G;  1BQQ T;  2ASB A;  2NYZ D;  1HXY D;  2QCP X;  4JV5 L;  1F2Y A;  4DV3 Q;  2EJF C;  2KUM A;  1HTL D;  4HSP A;  3K5L A;  1UAP A;  2K75 A;  4A3B H;  3OSO A;  4X64 Q;  2KED A;  1EU3 A;  3U58 A;  5KND A;  4K2K A;  4DV4 Q;  4KI0 A;  1IBK Q;  2R93 H;  1UNS A;  5C5M A;  1H9M A;  2O2L D;  3PGZ A;  4BS9 A;  1FL0 A;  3RLO A;  1AW7 A;  1BXT A;  4LNQ A;  4B3M L;  5CMD A;  1U5K A;  4AYB E;  4DK0 A;  4DAY A;  3G6E A;  1SMX A;  2UXB Q;  1B70 B;  1SJH D;  3E0E A;  3W1G A;  1EQQ A;  2KJX A;  1QVC A;  4OWT B;  4XQQ A;  3OMG A;  1SYG A;  2Y0S E;  3W5O A;  3L2P A;  2AWO A;  1TWF H;  5IYB H;  3K7A B;  2EYL A;  2OCE A;  1DOK A;  1NCV A;  1PZJ D;  3C1F A;  2Z6B A;  1HH2 P;  1DD2 A;  4FO2 A;  2UUC Q;  2OTJ A;  2K5D A;  1CKM A;  1QNK A;  3E0J A;  5EBC A;  5JJZ A;  5FLX E;  3OTO L;  3CPF A;  1X65 A;  1KRS A;  1SR3 A;  3JC6 6;  3NEN A;  2EZV A;  4DGZ A;  4FP5 D;  2X6L A;  1QWY A;  5EPJ A;  2TSS A;  4JG2 A;  3NQT A;  2F0K A;  1ASZ A;  2MNA A;  1HNW L;  1VQF A;  3K57 A;  1Y1W B;  1PH8 A;  3IL8 A;  4V0B A;  4DNT B;  3J81 j;  2F0D A;  3S9W A;  2E2J B;  3H0G H;  4DV2 L;  1SND A;  2CWP A;  4JI1 L;  3R2I A;  2DJG C;  1I50 B;  2I5M X;  2L12 A;  1IYU A;  1G6Z A;  5BN4 A;  5M5Y B;  3PO2 H;  1C48 A;  4POF A;  1Q7Y C;  4OX9 Q;  4JI5 L;  5I6Y A;  4DN4 M;  2JK8 A;  4R4T A;  1Y1W G;  4KLK A;  4C2M B;  1NE3 A;  3GTQ H;  3JAM E;  1K83 H;  1LTG D;  4OL7 A;  3VR5 A;  4G7Z C;  3K5M A;  4K0K L;  5IT9 E;  2E5L L;  4H02 A;  3DM3 A;  2B2U C;  3OWE B;  1VQ4 A;  4GLX A;  5IWA Q;  3PSI A;  1JT8 A;  3EQL C;  3NK9 A;  4K8J A;  3S15 H;  4LUZ A;  4C3I B;  2VB2 X;  1XWE A;  1CHP D;  2I46 A;  1B3Q A;  2YV5 A;  2QKI C;  2B29 A;  3SGI A;  2QF7 A;  4L6T B;  3WWV A;  1JR0 D;  4K8I A;  1L1O B;  4R8I A;  3WOE A;  4TSS A;  4LF7 L;  2Y0S G;  1HNX L;  2MJ8 A;  3F2D A;  1HA5 A;  4A3K B;  4RAU C;  2MP1 A;  1S5C D;  4DV7 L;  2R7Z H;  4X62 L;  4BXX G;  1NAP A;  2XTI A;  2QGQ A;  4KKS A;  3HOV H;  2WAQ B;  1A2T A;  1PFM A;  1RJT A;  1STG A;  1TS5 A;  3ERO A;  2I5H A;  4GLV B;  1X56 A;  1VS0 A;  3AQQ A;  4EVO A;  3J80 E;  1OXV A;  1PZI D;  4HMI A;  1CSQ A;  1XNQ L;  3KLS X;  1ENF A;  2KCC A;  4QUF A;  1RKN A;  2UXD L;  2X69 A;  4DR3 Q;  1EOT A;  5C44 H;  5LMU L;  4HAE A;  4PNY A;  4C3J B;  2J4X A;  1XPO A;  2RCF A;  3FVQ A;  2UXC L;  2K04 A;  2RDF A;  1BNZ A;  1XYI A;  3RZD B;  4FXG C;  1CUK A;  3VYR A;  3S24 A;  5GRO A;  2Q8R E;  5G3L D;  4NPS A;  4RKB A;  2HT1 A;  2NVT B;  4X66 L;  2UUA Q;  2F1M A;  3CRL C;  5CGK A;  2EXZ A;  1SE8 A;  1ZXT A;  1Y1V H;  1LYL A;  3QO2 A;  1TWA B;  3G48 A;  1E2W A;  5D14 A;  2NVQ B;  5HUR A;  1I4H A;  1I4X A;  1N32 Q;  1U4L A;  1I4R A;  1WTX A;  2V1C C;  4IUV A;  2HHH L;  5I9P A;  4EQO A;  1GKH A;  3M3Y B;  2FFK B;  1B9N A;  5C0X G;  2MFI A;  3BJU A;  3DLL A;  1PHJ A;  4DR6 Q;  4I7Z C;  1GJX A;  2BCO A;  2RCN A;  2SOB A;  4HR7 B;  1CQF A;  4DAM A;  1VQO A;  3F2U A;  1C4Q A;  1NMF A;  4CDE C;  4X65 Q;  3D31 A;  4ME3 A;  4EX5 A;  2RKS A;  3O13 A;  5C3W A;  3FKI H;  1Y8N B;  3I4M B;  4LF6 Q;  1Q12 A;  2AWN A;  3Q23 A;  2B63 H;  1EIF A;  1KC8 C;  1EIG A;  1X9N A;  4HIO A;  1XMQ L;  5DNF A;  2MPM A;  2F0W A;  2E75 C;  1S5B D;  3H09 A;  3CP0 A;  4K2L A;  1I6V C;  5IIF A;  1UE6 A;  5GAE C;  3P7J A;  4EQ5 A;  5I4D A;  4DXG A;  3LX0 A;  3W1B A;  3PO3 H;  4LMQ D;  4LUV A;  2VQF L;  3GO5 A;  1ZYR D;  4DNI A;  1N36 L;  1II3 A;  5EJW A;  4JYA L;  2A6H D;  4IAL A;  1M90 C;  1JE4 A;  4GKJ L;  1ZYR C;  5HY6 A;  1NTG A;  4K6D A;  4UDU C;  2A6H C;  3AMU A;  4A3G G;  3T53 B;  1H9S B;  4IFD G;  1GUG A;  3GTG B;  1GD7 A;  2IW3 A;  2N8N A;  1GM5 A;  3CD6 A;  4X3K A;  1E2V A;  3NWS A;  3TRE A;  2F4V L;  1QOH A;  1B53 A;  1AN8 A;  1MGS A;  2F0M A;  2E2H H;  3S2D B;  4IZ8 A;  1K0S A;  1QZG A;  1J9O A;  1X32 A;  1PTO B;  1VQN A;  3GTL H;  3TZD A;  1Y8O B;  1JC7 A;  1VDZ A;  4JI8 Q;  4RHR A;  1PRT B;  2R93 G;  2M2L A;  4L63 B;  3U9S A;  1IL8 A;  2SDF A;  3GD7 A;  3ERQ A;  1TWF B;  3OW7 A;  4LFA L;  4LFC Q;  4LFB Q;  1DOL A;  4H0L C;  4P71 A;  3BZD B;  4DNR B;  3CC2 A;  5C5L A;  4DR4 Q;  1XPR A;  2HDM A;  3HOW H;  1HCZ A;  3T16 A;  1KDC A;  5IP7 H;  2CVR A;  4UP7 A;  1SYE A;  1HR0 W;  4DR1 L;  4A3D H;  3FPP A;  4N9T A;  4PV1 C;  4B3S L;  1I4P A;  2LSS A;  3L7Z C;  1UUP A;  3NWT A;  3T56 B;  2E2I H;  4WFN 3;  2ZXP A;  1XJV A;  2IL8 A;  4A93 H;  4GZY C;  1Q1E A;  4LUO A;  5EAY A;  5ELN A;  3VR6 A;  2EE1 A;  4DV6 L;  4C56 C;  5BN3 A;  1GUN A;  2RBM A;  4PMW A;  2I07 B;  2XWJ B;  5E7N A;  4DV0 Q;  1S4Z A;  3GTK B;  4DUY L;  1VQD A;  1UE5 A;  2D0P A;  1SNO A;  5I2Y A;  5A2Q E;  4HCE A;  4JBJ A;  4JCV E;  3KDF B;  1U0L A;  4GN3 B;  3H0G G;  2HUG A;  4HSV A;  2C5C A;  3D0F A;  3PIP A;  3HOZ B;  3T1H Q;  1KNE A;  2K14 A;  3CMA A;  4V19 0;  5EKK A;  4OIK A;  2O4X A;  3S2H B;  3GP7 A;  1SBB B;  1I5F A;  2F0F A;  2CCZ A;  1L1O C;  3K7A H;  1E22 A;  1CSP A;  5IT9 c;  3S1N B;  1YNJ D;  3HOZ G;  2F03 A;  2EIF A;  1PV4 A;  2Z1C A;  2K5Q A;  3BDL A;  2Q2T A;  1RIP A;  2WB1 E;  4BA1 I;  4A76 A;  1E1T A;  4JW0 A;  1MJE A;  3I2Z A;  3SDZ A;  3LWU A;  2KEC A;  4CDF C;  4QUC A;  3D6C A;  3FHW A;  1TQO A;  5CV5 A;  1NUC A;  4LF4 L;  5LL6 X;  3I90 A;  1Y1W H;  2A68 D;  1KQS A;  4LF5 L;  2E2J H;  2D0O A;  1J5E Q;  1FJG Q;  2KCT A;  1V43 A;  2NZH A;  4G7H C;  1CK1 A;  1I50 H;  4QJF A;  1N8R C;  2IHF A;  2R7Z G;  5TSS A;  1PFB A;  5M5Y H;  1IBL Q;  1HJP A;  1X6O A;  1CHQ D;  2QIL A;  1BBW A;  1G8Z D;  2E76 C;  4C2M H;  2K5V A;  1B3A A;  1FGB D;  1LTL A;  2BA1 A;  2F0Q A;  3OWF A;  4IUR A;  2JA6 B;  2J7Z A;  4JI2 Q;  1SE4 A;  4PQX A;  1U4P A;  4ILW A;  1MSH A;  3ZJY C;  1EIY B;  1DCZ A;  2F0P A;  2IWH A;  1G29 1;  1WTP A;  3BYT B;  4OWW B;  4ZUJ A;  3RUZ A;  3U4V A;  1BO0 A;  5C44 G;  4Q5V A;  1L1O A;  1YIT A;  4FF4 A;  2ZTD A;  3G71 A;  1ESR A;  1JQY D;  2F3I A;  3M9B A;  2XRQ D;  1VQ5 A;  1PTO F;  4KMU C;  4BXX H;  4C3I H;  4A3L H;  1DYQ A;  4UP9 A;  5IGB A;  4B3T Q;  1PRT F;  4JI4 Q;  3CU7 A;  1Y1V G;  4XDX A;  1WYD A;  3UDG A;  4A3K H;  4A3M B;  2PZU A;  4MZ9 A;  1TU2 B;  4GLA C;  1WD0 A;  4U67 3;  2UU9 L;  1SNC A;  4OO1 G;  3CHB D;  2B2V C;  1VQE A;  4WOR A;  4DK6 C;  4YIJ A;  1CA6 A;  4ALP A;  3HEJ A;  4QL5 A;  5EPL A;  1YZ6 A;  2YTX A;  3PUW A;  5CC4 A;  1EU4 A;  2WB1 G;  1SE3 A;  4ZRZ A;  4PZ8 A;  1KD1 C;  1SMY C;  2D9U A;  1G51 A;  2JQO A;  2KHJ A;  3MFY A;  2CH4 W;  2WFW A;  4C3J H;  4PZ7 A;  3GQB A;  1V1O A;  4RGN A;  2FJ2 A;  1PA6 A;  2PNR C;  3RZD H;  1E7Z A;  1SN8 A;  3ICE A;  3A55 A;  2VQE L;  3ERS X;  4GKK Q;  4AQY L;  1W2B A;  3KF6 B;  1EY9 A;  5KEE A;  2EY1 A;  2NVT H;  4L5T A;  5JJI A;  4ID6 A;  1HRJ A;  2OEO A;  2OTL A;  3S1M B;  4I65 A;  1OTC A;  4OGQ C;  1TWA H;  1XNR L;  2N88 A;  4YHH L;  4WJW A;  1PH1 A;  5C0X H;  2NVQ H;  3TSS A;  1X3F A;  2NBF A;  2ZM6 L;  1V8Q A;  1Y14 B;  4LW1 A;  3PO3 G;  5EBD A;  4HJ8 A;  1T9H A;  1PTO C;  3TN2 A;  1G91 A;  3M3Y H;  4M8A A;  2FIN B;  1BCP B;  4R1J A;  3SK5 A;  3KOJ A;  3OMC A;  3RR5 A;  2H4O A;  1PYB A;  3T4A C;  1PRT C;  1ESF A;  1YEZ A;  2K28 A;  4K5V A;  4HIK A;  2HIV A;  2RVL A;  4K5X A;  3I4M H;  4WJ3 M;  5C0X I;  2OXP A;  4B9X A;  2P5Z X;  5LL6 S;  4DU9 A;  4P73 A;  3QOJ A;  5EKL A;  2ID0 A;  4MHE A;  1D8L A;  1VQI A;  3HOX B;  2CW0 C;  3N6R A;  1JJG A;  1HNZ L;  3CQZ B;  1SFO B;  1EY8 A;  1PDQ A;  2DGY A;  1PYS B;  3UDF A;  1BOS A;  4DK1 A;  1KXL A;  2A6E D;  1LT5 D;  4JI7 Q;  3UE0 A;  4EGV A;  2KEN A;  1IBM Q;  1PLF A;  3FDT A;  4NXM L;  4ZAI A;  3CKI B;  3HOX G;  4IFD H;  2A6E C;  1H9S A;  3E6Z X;  4R9W A;  4G7O C;  2LFN A;  4KV6 A;  5ISR A;  1WFQ A;  2E2I B;  3K0X A;  3EBE A;  2NVY B;  2YTY A;  4K14 A;  1BDO A;  1WTQ A;  4JI6 L;  3HOY B;  4GOP B;  1CFM A;  1VCI A;  1PH5 A;  5IP7 G;  1Z6H A;  2UUB L;  3R8B A;  4IO9 A;  1VQB A;  2MGS A;  2ZTE A;  1A3V A;  4A3D G;  3GTG H;  3F2B A;  3P75 A;  5M9O A;  5C4J B;  3A8J E;  3TP5 A;  2HQE A;  2JE6 I;  1X3P A;  2HCC A;  4RGM A;  1IL2 A;  1RD9 D;  4A93 G;  2O5I C;  1V9P A;  3A0J A;  4JI3 L;  1Z47 A;  2D2C C;  2XNA C;  4IFD I;  3S2D H;  3RLF A;  1S5D D;  2OWO A;  1YHB A;  1FVI A;  2GVB A;  1F9Q A;  4RKL A;  1PTO H;  3VDY A;  4DR7 Q;  5JJK A;  4FF3 A;  1CKN B;  3K59 A;  4UY8 C;  1HUM A;  2RSO A;  2Q8T A;  4IOC A;  4JI0 L;  2E2D C;  5FOB B;  5C4X B;  1MKH A;  1NR4 A;  4FF2 A;  4FXD A;  4ODG A;  4FNF A;  3URY A;  1LT3 D;  4GNX B;  2FMC A;  2PI2 A;  4DV1 Q;  5JPM C;  3T1Y Q;  4R4Q A;  1XXG A;  4DV3 L;  2FXQ A;  2R7D A;  1IW7 D;  1EYA A;  1LLR D;  1BBU A;  4HMJ A;  1I4Q A;  4QGU A;  4B08 A;  3TRZ A;  5ELC A;  5C4X G;  1QB5 D;  4DV4 L;  5CV8 A;  1IW7 C;  3H6M A;  1EL0 A;  5LMN Q;  1IBK L;  2ZXR A;  4A3C H;  2A8V A;  4DPG A;  2B2Y C;  1X3G A;  1B1Z A;  1ICW A;  5GAD C;  3I56 A;  1IKM A;  2GA4 B;  2FHT A;  5L37 A;  1YBY A;  4RG1 A;  4HJ5 A;  1KLG D;  2L15 A;  2WAQ E;  5E1F A;  3KBX A;  3M85 A;  2SNS A;  2UXB L;  2WP8 J;  2HCI A;  4KHP Q;  5IYD G;  2CQO A;  4TVA B;  1C7Y A;  3KDF A;  1SYC A;  4JI5 Q;  4ZKB B;  2VW9 A;  3N52 A;  1HZA A;  1STA A;  5FO7 B;  3PF5 A;  1FD7 D;  1TWG B;  3GTK H;  1CA5 A;  3LWE A;  2G9D A;  3I4L A;  4BBR B;  4BY7 B;  2UUC L;  4XQN A;  2WKD A;  3PIO 3;  2QEJ C;  4K0K Q;  2LMC B;  1CTM A;  1PYW D;  1EYG A;  2WKC A;  5EPK A;  5G3L F;  4YWM A;  2NN6 H;  1DM0 B;  1TWC B;  1D7Q A;  3HOZ H;  4BBR G;  5KGU A;  4BY7 G;  4JOI C;  1TS2 A;  1VF7 A;  2QW7 A;  1BCP F;  3S2H H;  3FEW X;  4ZLT F;  1FNV A;  2AUK A;  2LS0 1;  1LM0 A;  2DUD A;  3P20 A;  2F0L A;  5FO8 B;  3S1N H;  3I73 A;  2Z9H A;  1VQG A;  1VQM A;  1HNX Q;  3MTS A;  2NVX B;  4QCL A;  3VYU A;  5GQO A;  2JA5 B;  2ZTC A;  1PFS A;  1JCK B;  5CYU A;  1AE2 A;  4OX9 L;  3LGJ A;  1KAA A;  1QNU A;  1TR5 A;  2JA9 A;  2B2Y A;  2DNC A;  3QR8 A;  3C1E A;  3V96 A;  1ZEQ X;  2PQE A;  3SEB A;  1K9M C;  5KYL A;  3S16 B;  5HGT A;  1ONL A;  2K5N A;  3KLW A;  4C3I G;  2B39 A;  5JEA H;  4A3L G;  1YI2 A;  1U4R A;  1GUT A;  3DM1 A;  3M4Y A;  1K3R A;  3AEV A;  1Q8I A;  2OT2 A;  3A5Z B;  3K80 C;  3KJP A;  4A3K G;  3KF8 B;  5FLM G;  1GUW A;  1EQT A;  1LTA D;  3G7L A;  2F0V A;  1LT4 D;  3M4P A;  4WJ4 A;  2UXC Q;  1M8A A;  2R92 B;  2XVS A;  2WAQ G;  2BDN A;  4XIG S;  2LY7 A;  2EYO A;  2L11 A;  1VQJ A;  2XIW A;  1SSO A;  2JA6 H;  1RL2 A;  1O78 A;  2EYP A;  2PQA B;  2IX3 A;  1R9T B;  2ZJQ A;  4PG3 A;  4JOI A;  1A2U A;  2JA7 B;  1VMP A;  2BA0 A;  4KK7 A;  1UEA B;  2B2U A;  4Z9C B;  1IYJ B;  5FO9 B;  4KY5 A;  4C3J G;  5IGC A;  2PW7 A;  1XPU A;  3V2T A;  4IUP A;  3KYH C;  1ET9 A;  2Q2U A;  3SVM A;  1BCP D;  3E5S A;  2R61 A;  1X55 A;  2EVB A;  4F87 A;  1W3S A;  2JA7 G;  3W3A A;  4OO1 H;  2HHH Q;  1GHJ A;  1Q82 C;  4E6I A;  1BCP C;  1GVP A;  1X3Q A;  1K3B C;  3RNU A;  3OYY A;  2PMZ B;  4DR2 L;  4DR3 L;  3GTJ B;  2L5T A;  4LF8 Q;  3NEL A;  4A3M H;  3D4D A;  4XYO A;  3GDE A;  1KNA A;  1ICF B;  1PH2 A;  1F77 A;  1PH3 A;  4ZYS A;  3ND9 A;  3DEP A;  2K4K A;  1L0X B;  5D3D A;  2UUA L;  3M7N A;  3MVV A;  2EJM A;  2DY7 A;  5IYC G;  4OO1 I;  1WD1 A;  2YTV A;  4CGY B;  5E4W C;  1XMQ Q;  4JBK A;  3MXG A;  3HKZ B;  1RDP D;  3GTP B;  3STB D;  3KF6 A;  1H9R A;  1ASY A;  3M4O B;  4DAV A;  4OXP A;  2BH8 A;  3Q6S A;  1U4M A;  3S14 B;  1NR2 A;  4X3S A;  1STH A;  3STB C;  3I4M G;  5M5W B;  1Y69 U;  1XMO L;  2E8G A;  3HKZ G;  4OEM B;  3EN2 A;  3QG1 A;  4GKJ Q;  3BYY B;  1UE7 A;  2PI2 E;  4GOP C;  4DR6 L;  2K33 A;  3VR4 A;  1FR3 A;  2KOL A;  4JPB W;  3S1M H;  1KDA A;  1RCV D;  1Q1B A;  4X65 L;  1DGS A;  2FMM A;  3T51 B;  2ICI A;  4LF6 L;  3FPU B;  3BG3 A;  2JJQ A;  4RA8 A;  4IUN A;  1JOQ A;  4KKT A;  3ULP A;  2E74 C;  3V05 A;  4JK1 C;  2F4V Q;  1B2T A;  3ULJ A;  1QVF A;  4LAA A;  1PH9 A;  1KTK A;  2F0H A;  2LXK A;  4OON A;  1VQ7 A;  1JOO A;  1VQ9 A;  2RDG A;  4B3R L;  2DJF C;  2RSN A;  3PV0 A;  1L0Y B;  2K05 A;  1SNM A;  3ER0 A;  2K01 A;  3PUX A;  5ELF A;  1A6X A;  2CH4 A;  4GNX C;  4R4O A;  3S1R B;  1HZ9 A;  1I4G A;  3I55 A;  2K03 A;  3MXP A;  5K5P A;  5IOD A;  1JJ2 A;  1N34 Q;  4AIM A;  1V1P A;  2EYH A;  4NXN L;  4MTK A;  1E24 A;  3CCV A;  3J81 L;  3HOX H;  5C4Z A;  1LAB A;  3CQZ H;  1WCM B;  4LJZ C;  1SFO H;  2ATW A;  3EVQ A;  2F52 A;  1HPC A;  4GOP A;  3MWY W;  1PVO A;  3P1H A;  1QIL A;  1YIJ A;  3EIV A;  1KAW A;  1CKO A;  2KBN A;  3DEO A;  5DEH A;  1JE5 A;  3L0O A;  1SRO A;  4KHV A;  2AQ2 B;  4HJ7 A;  2DN8 A;  5D3I B;  2NVY H;  1HZC A;  4IQZ A;  5FLX c;  1K8M A;  1GO3 E;  3Q0A A;  3HOY H;  1TVX A;  4A3C G;  1H9K A;  3I4O A;  1O80 A;  5EGT A;  3U4Z A;  2PNH A;  5C4J H;  1PXU A;  3H91 A;  1C8C A;  4LFB L;  1CKN A;  2XGT A;  1SYF A;  2F0S A;  4DR4 L;  4IUU A;  3MZ5 A;  4ULL A;  3KBG A;  2AQ3 B;  1AP0 A;  2YYZ A;  1Z9F A;  4GNX A;  4CHT B;  1D6E C;  1K8G A;  2XWB B;  1LTR D;  1QUQ A;  3NE5 B;  1MBY A;  2R3Z A;  1XTC D;  3K58 A;  5C4X H;  1MSG A;  5EQ0 A;  3JAM c;  4GS3 A;  4A4I A;  5CV7 A;  1PH4 A;  2PZT A;  2A69 D;  1BUV T;  4P2C B;  3G4S A;  3KJO A;  5C3E B;  3UDI A;  2F4I A;  5J3B A;  1HZB A;  2A74 C;  3KUP A;  4A3J B;  2A69 C;  2NN6 G;  3RN5 A;  1VQL A;  4RMF A;  2KCM A;  4G57 A;  4L8J A;  3OHX C;  2K6A A;  4NMZ A;  5IYD H;  1YNJ C;  3OPO A;  4NKL A;  1F9R A;  4LF4 Q;  3SE0 A;  1AFP A;  3RLN A;  3F2C A;  5C3E G;  5LHY 1;  2WIN B;  1K0R A;  2ENB A;  3T1H L;  2ZJP A;  1EEI D;  2PW5 A;  2CKZ B;  2Z4I A;  1WJJ A;  1A0I A;  2EY6 A;  2G5D A;  3PUY A;  2KQ3 A;  3T13 A;  2AUJ D;  1TWG H;  2YU9 B;  1KIX A;  1V1Q A;  3NQI A;  1EY0 A;  4J15 A;  2A68 C;  2VY3 A;  4C1N I;  2B2T C;  5JEA G;  4BBR H;  2QA4 A;  4BY7 H;  5JJL A;  4UHV A;  1B7Y B;  4R8N A;  4RCN A;  2L1B A;  1TKW B;  3QWN A;  1NNX A;  3BZK A;  3J80 c;  3M7G A;  2B2W C;  3CCS A;  1TWC H;  4XYQ A;  2WV6 D;  1HA6 A;  1GUS A;  3CCE A;  5T1G A;  2BH2 A;  1UWV A;  2F0E A;  4EQP A;  1WI5 A;  3X3N A;  3QJY A;  2JA6 G;  1BR9 A;  2G9H D;  1FJG L;  3DWQ A;  1VF5 C;  2NVX H;  1G2T A;  2PPB C;  2OQK A;  2JA5 H;  1SEB D;  2Z6K C;  1IBL L;  1B8A A;  2WAC A;  1WTW A;  1KAB A;  4PZ6 A;  1HR0 Q;  4DR5 Q;  1EQR A;  4ZCK A;  1A62 A;  3G6J B;  3R2T A;  5FLM H;  3KF8 A;  2NZO A;  3S16 H;  2JA8 B;  1LAC A;  4A75 A;  3IKJ A;  1QZH A;  4QQB X;  1SLJ A;  3NTI A;  1S3O A;  1QCB D;  1FNW A;  4A3E B;  4N8F A;  4K6L A;  4P75 A;  2VS1 A;  3OIP A;  2L0C A;  4A3M G;  2JA8 G;  4CKC A;  2PQA A;  1DZ1 A;  2B2T A;  2D62 A;  1J6Q A;  3ONA B;  2R92 H;  2I5L X;  4DUZ L;  4XXE A;  3MHB A;  1SAP A;  4UP8 A;  3EA6 A;  3CCJ A;  1LV9 A;  4GN5 A;  1JIC A;  1EY7 A;  5BR8 Q;  4B3T L;  2IPK D;  1HQM C;  4JI4 L;  2B2W A;  3HOU B;  1ENC A;  1A3U A;  1KHI A;  3MEH A;  5EKI A;  3CME A;  1LO5 D;  1R9T H;  3J7A F;  1G6P A;  1DXM A;  3J81 i;  5IOC A;  2JA7 H;  2VUM B;  5M5X B;  2K7V A;  3GV6 A;  4YHH Q;  2F3W A;  3SHL A;  4C3H B;  3SR1 A;  4NDX A;  2F0J A;  5DLQ E;  1A8V A;  3A8I E;  4DK3 C;  3TP8 A;  5JPN C;  1YJ9 A;  3HG9 A;  5AFW A;  1VQ6 A;  4X3U A;  1YHA A;  1JWU D;  3CRK C;  4KKU A;  2IHE A;  2F0O A;  1A3T A;  4O42 A;  4HJ9 A;  5FK9 C;  1E2Z A;  4C3H G;  1NSN S;  3GTJ H;  3C46 A;  3KLR A;  1WVL A;  5E3F A;  4F8M A;  5IYC H;  4L5R C;  4ABN A;  2EQS A;  2B2V A;  1JMC A;  2NWG A;  1CI3 M;  3CCM A;  1K73 C;  5M3F B;  3D3R A;  1EWC A;  2L9H A;  4RGT A;  1A63 A;  4ME5 A;  1WTO A;  3H3V C;  4LF9 Q;  2GN5 A;  2KCN A;  1D5X C;  4N8X 1;  2DNE A;  5M3F G;  3GTP H;  1N33 Q;  3ZYY X;  4J8Q A;  5F2D A;  4MIU A;  3M4O H;  1TXY A;  3K0Y A;  1W6J A;  3M4Q A;  4CJ2 C;  4NXM Q;  2M00 A;  4L5Q A;  3S14 H;  2F0G A;  1I94 Q;  5M5W H;  4DV5 L;  3DUZ A;  3TZU A;  1EY4 A;  4YY3 L;  3J7Y W;  4RFB A;  1EYD A;  1V1P B;  2VL6 A;  2ZT9 C;  4B9W A;  5AJ3 L;  4H44 C;  3U50 C;  4DA2 A;  1SYB A;  1SDF A;  4JV5 Q;  1RHP A;  4OIJ A;  1EY5 A;  1AE3 A;  5KIX A;  3NBH B;  3KK7 A;  4NB3 A;  3I4N B;  2CQA A;  3I91 A;  4IPD A;  4KD4 A;  2K5W A;  3TDQ A;  1KDB A;  3NTH A;  1FNU A;  3U9O A;  2OQ0 A;  4B3M Q;  2Z4H A;  3HOY G;  1UEB A;  1IBM L;  4P72 A;  1EWH A;  5J39 A;  4PMC A;  2KA7 A;  1WTV A;  3HRZ C;  3S1R H;  3NPP A;  4M1U B;  4DFA A;  5FJ8 H;  1IHZ A;  1PZK D;  3D6W A;  1I6H B;  1OXX K;  3I3C A;  3H3V H;  3OTO Q;  1GHK A;  3HGB A;  5H1S E;  1QUQ B;  1WCM H;  3I70 A;  4X64 L;  5NUC A;  2Q2I A;  4RHS A;  2TMP A;  1ROD A;  2RHS B;  1D1K A;  4KD3 A;  4WRD A;  1K8O A;  3NUC A;  2BE5 D;  2MQH A;  2HQL A;  3MA2 B;  4Y52 H;  1HQR D;  2Z0S A;  1F2M A;  4G4K A;  5FKA C;  1EFW A;  4CJ1 B;  4BY1 B;  2JSO A;  1HNW Q;  4YCV A;  4PMB A;  4KN7 C;  4HN7 A;  4UAI A;  4DR7 L;  2BE5 C;  4DV2 Q;  1IKL A; 
#chains in the Genus database with same CATH homology
 1QE6 A;  4NW2 A;  1JB3 A;  4DXF A;  1JWS D;  3FRP B;  1JWM D;  4NP5 A;  1JOR A;  2SEB D;  2L55 A;  1TWH B;  1EYC A;  2EOT A;  3R3O A;  3Q22 A;  5DAU A;  3ND8 A;  3PUV A;  1S5F D;  4U68 A;  3MAQ A;  3R93 A;  2IT1 A;  3NHH A;  3NTK A;  1Z7T A;  5KNB A;  2A73 B;  1F9P A;  3DMU A;  3NSW A;  1RF2 D;  1KLU D;  3S17 B;  1M4V A;  1OO9 B;  1AZP A;  2M9V A;  4J1M A;  4KJO A;  1RTO A;  1EZ8 A;  1JOK A;  2DY8 A;  3BDO A;  4A3F B;  3Q24 A;  4AYB B;  2A5H A;  3MC0 B;  2VB3 X;  5K36 H;  1MI2 A;  2NN6 I;  1D2B A;  4JBW A;  4K5W A;  4HCS A;  2Y0S B;  2EPB A;  3TBI B;  2EYM A;  5DM7 3;  2IJ0 A;  2F0T A;  4CJ0 B;  5I2X A;  2L4N A;  1OXU A;  4F7X A;  3J81 E;  3HZX A;  4RH6 A;  4A3I B;  4S3S A;  3A8K E;  5JVG 3;  3VA7 A;  3S1Q B;  3FMC A;  4KTA A;  1R4Q B;  4Y7N B;  4KHZ A;  4N9P A;  2NB0 A;  2NZ1 D;  3NBI A;  3NXW A;  5CV9 A;  2IX1 A;  4RGO S;  3WDN A;  3A56 A;  4LK1 C;  2LKV A;  3I8Z A;  1LTB D;  2PO4 A;  3RZO B;  1HHV A;  1O7L A;  5M3M B;  5COY A;  1Q90 A;  4IN3 A;  1I3Q B;  2JXM B;  5ELB A;  2PCF B;  3QOL A;  4HED A;  4FYD A;  2N55 A;  4BWG B;  3HS0 C;  2EJG C;  2RA4 A;  1HUN A;  3C3L A;  3K6O A;  1E0B A;  1TS4 A;  4ZUI A;  1ILP A;  5I9O A;  3PMF A;  3DWP A;  2K32 A;  2MHV A;  1ENA A;  1EEF D;  5FLX L;  5T1I A;  4KJN A;  1O7Y A;  5ELE A;  1STE A;  1D5Z C;  1O7Z A;  2EDG A;  2F0U A;  2K1B A;  1SNQ A;  1T5X D;  1GUO A;  1Q3L A;  1B44 D;  3W2D A;  1EQV A;  4MN3 A;  4XQJ A;  5C0X J;  2SNM A;  4TQU S;  4ZQ3 A;  3OIQ A;  2BDO A;  3RMH A;  3SK8 A;  5JAV A;  2JP1 A;  5CV4 A;  5KRU A;  2CHB D;  2J0T D;  3QIA A;  4BBS B;  1MD2 D;  1SNP A;  3BDC A;  4TKO B;  3JAM L;  3GTM B;  3D4W A;  3BVM A;  1CZW A;  1DOM A;  4A3G B;  4CKE A;  4ZKC B;  5IGG A;  2RQX A;  2V4D A;  5IT9 L;  3KLS A;  1AZQ A;  1OXT A;  1QJO A;  2IX0 A;  1STN A;  3A54 A;  1EY6 A;  5CR3 A;  5A35 A;  5CBE E;  3DXJ C;  4A3B B;  2BOS A;  4FVM A;  3NP8 A;  2R93 B;  5BN5 A;  1B50 A;  5JVH 3;  4QB4 A;  1CZG A;  3L3O C;  4IFD J;  1EFI D;  4QMG A;  2EYJ A;  3NBH A;  5JOB A;  3K5O A;  3H94 A;  1AEX A;  3K5N A;  1ML0 D;  3J80 L;  1TT2 A;  4IUT A;  2Z8L A;  2O5J C;  2XN9 C;  1CQV A;  3X3M A;  4X3T A;  4CBV A;  1B9M A;  1CM9 A;  1TS3 A;  4RWS C;  3TP6 A;  5I6W A;  4Q0F A;  3BVZ A;  3IAY A;  1SYD A;  5CBA E;  3BVG A;  3D4R A;  2AQ1 B;  3UI2 A;  3H0G B;  1DJR D;  2KVM A;  3RD4 A;  3PO2 B;  3VR3 A;  1GXD C;  2ICE C;  3MXU A;  3EJI A;  1U9R A;  5C3X A;  1D5M C;  3GTQ B;  1K83 B;  5CV6 A;  1F2L A;  5C4H A;  1LTT D;  2PYK A;  3AB9 A;  4QF4 A;  1STB A;  1ZKO A;  2H1E A;  1G2S A;  1H9J A;  2NTS A;  1TY0 A;  2OF1 A;  2XRS D;  2D5D A;  4FF1 A;  5J22 A;  2B8G A;  3S15 B;  2JEB I;  1LTI D;  5K36 G;  3IFT A;  3LNN A;  2XSC A;  3OOC A;  3SXH A;  1W6K A;  4J6H A;  2R7Z B;  3HOV B;  5DM6 3;  3MFG A;  5IGE A;  4XT1 B;  3GV3 A;  1LT6 D;  2RDH A;  2VXW A;  3PUZ A;  1EIH A;  4DF7 A;  1LTS D;  2HDL A;  1EZ6 A;  2F0N A;  2C9O A;  5C44 B;  1BBX C;  4CKB A;  4XT3 B;  1SE2 A;  1Y8P B;  3TP7 A;  1CT1 D;  5JEA J;  4QIW B;  2EY5 A;  4HTH A;  1R4P B;  1Y1V B;  4ZK9 B;  3L9A X;  3VA5 A;  1QG7 A;  2B8F A;  3VR2 A;  5IGD A;  1HFG A;  1PMR A;  4KY7 A;  2NUC A;  1PFN A;  1OXS C;  3DHQ A;  3A7L A;  1D1I A;  4H13 C;  2PZW A;  2WB1 B;  4OHJ A;  3VYT A;  3I72 A;  2QDB A;  2NTT A;  3ITP A;  2F0I A;  1FYC A;  1B4O A;  3EFX D;  1TY2 A;  4KN4 C;  2KEE A;  4KY6 A;  4O1N A;  3J7A V;  1SMY D;  1BF4 A;  4DAP A;  4H7B A;  3FKI B;  1T5E A;  1GOZ A;  2MUY A;  2EYF A;  2KHS A;  4IUQ A;  2B63 B;  2Q8I B;  1S5E D;  3IFD A;  5IGF A;  1SXT A;  1HTP A;  3GTO B;  5J1Z A;  4C1N K;  2WII B;  2JYO A;  5A2Q L;  3DWA A;  5KYI A;  4EQN A;  1WTR A;  1J8I A;  1HFN A;  1RTN A;  5ELD A;  3PO3 B;  1A15 A;  2X6G A;  5KNC A;  2R6G A;  1SJE D;  3QB3 A;  1XX8 A;  3WOF A;  1PTO D;  3SK4 A;  1YNN D;  1VMC A;  1PRT D;  2EY2 A;  1TII D;  4BA2 I;  1YNN C;  1ET6 A;  2E2H B;  4RCO A;  3GTL B;  5C6A A;  5E4X A;  3BS1 A;  1DON A;  3C2P A;  5D65 A;  1IYV A;  3HP3 A;  2CW0 D;  2VNU D;  4FXK C;  5COR A;  3SK6 A;  3AU7 A;  1STY A;  1F2Z A;  3MXN A;  3D8G A;  3TME A;  2JEA I;  4XTC S;  3A7A B;  3HOW B;  3VYS A;  4TRD A;  4F88 A;  3PIP 3;  4A3D B;  2F3V A;  2ZXO A;  1ILQ A;  4A93 B;  1F9S A;  1BQQ T;  2NYZ D;  1HXY D;  2QCP X;  1F2Y A;  2EJF C;  2KUM A;  1HTL D;  4HSP A;  3K5L A;  1UAP A;  3OSO A;  2KED A;  1EU3 A;  5KND A;  4K2K A;  4KI0 A;  1UNS A;  5C5M A;  1H9M A;  2O2L D;  4BS9 A;  1AW7 A;  1BXT A;  5CMD A;  4DK0 A;  4DAY A;  1SJH D;  2KJX A;  4XQQ A;  3OMG A;  1SYG A;  2AWO A;  3K7A B;  2EYL A;  1DOK A;  1NCV A;  1PZJ D;  3C1F A;  1DD2 A;  4FO2 A;  2K5D A;  1QNK A;  3E0J A;  5EBC A;  5JJZ A;  5FLX E;  2EZV A;  4DGZ A;  4FP5 D;  2X6L A;  1QWY A;  5EPJ A;  2TSS A;  3NQT A;  2F0K A;  3K57 A;  1Y1W B;  3IL8 A;  4V0B A;  4DNT B;  2F0D A;  3S9W A;  2E2J B;  1SND A;  3R2I A;  1I50 B;  2L12 A;  1IYU A;  1G6Z A;  5BN4 A;  5M5Y B;  1C48 A;  5I6Y A;  4DN4 M;  4C2M B;  3JAM E;  1LTG D;  4OL7 A;  3VR5 A;  4G7Z C;  3K5M A;  5IT9 E;  2B2U C;  3OWE B;  3EQL C;  3NK9 A;  4K8J A;  4C3I B;  2VB2 X;  1XWE A;  1CHP D;  2I46 A;  2QKI C;  2QF7 A;  4L6T B;  1JR0 D;  4K8I A;  4R8I A;  3WOE A;  4TSS A;  2MJ8 A;  1HA5 A;  4A3K B;  4RAU C;  2MP1 A;  1S5C D;  1NAP A;  4KKS A;  2WAQ B;  1A2T A;  1PFM A;  1RJT A;  1STG A;  1TS5 A;  3ERO A;  4EVO A;  3J80 E;  1OXV A;  1PZI D;  4HMI A;  3KLS X;  1ENF A;  2KCC A;  4QUF A;  1RKN A;  2X69 A;  1EOT A;  4HAE A;  4PNY A;  4C3J B;  2J4X A;  3FVQ A;  2K04 A;  2RDF A;  1BNZ A;  1XYI A;  3RZD B;  4FXG C;  3VYR A;  2Q8R E;  5G3L D;  4RKB A;  2NVT B;  2F1M A;  3CRL C;  5CGK A;  2EXZ A;  1ZXT A;  3QO2 A;  1TWA B;  1E2W A;  5D14 A;  2NVQ B;  5HUR A;  1I4H A;  1I4X A;  1U4L A;  1I4R A;  1WTX A;  4IUV A;  5I9P A;  4EQO A;  3M3Y B;  2FFK B;  1B9N A;  5C0X G;  4I7Z C;  1GJX A;  2BCO A;  2SOB A;  4HR7 B;  1CQF A;  3F2U A;  1C4Q A;  3D31 A;  2RKS A;  3O13 A;  5C3W A;  3I4M B;  1Y8N B;  1Q12 A;  2AWN A;  3Q23 A;  1EIG A;  5DNF A;  2MPM A;  2F0W A;  2E75 C;  1S5B D;  3H09 A;  4K2L A;  1I6V C;  5IIF A;  3P7J A;  5I4D A;  4DXG A;  3LX0 A;  4LMQ D;  3GO5 A;  1ZYR D;  1II3 A;  5EJW A;  2A6H D;  4IAL A;  1JE4 A;  1ZYR C;  4K6D A;  4UDU C;  2A6H C;  3AMU A;  3T53 B;  1H9S B;  4IFD G;  1GUG A;  3GTG B;  2IW3 A;  4X3K A;  1E2V A;  3NWS A;  1QOH A;  1B53 A;  1AN8 A;  1MGS A;  2F0M A;  3S2D B;  4IZ8 A;  1J9O A;  1X32 A;  1PTO B;  3TZD A;  1Y8O B;  1JC7 A;  1VDZ A;  4RHR A;  1PRT B;  2M2L A;  4L63 B;  3U9S A;  1IL8 A;  2SDF A;  3GD7 A;  3ERQ A;  1TWF B;  3OW7 A;  1DOL A;  4H0L C;  3BZD B;  4DNR B;  5C5L A;  2HDM A;  1HCZ A;  3T16 A;  1KDC A;  2CVR A;  1SYE A;  3FPP A;  4N9T A;  4PV1 C;  1I4P A;  3L7Z C;  1UUP A;  3NWT A;  3T56 B;  4WFN 3;  2ZXP A;  2IL8 A;  4GZY C;  1Q1E A;  3VR6 A;  2EE1 A;  4C56 C;  5BN3 A;  1GUN A;  2RBM A;  4PMW A;  2I07 B;  2XWJ B;  3GTK B;  1S4Z A;  1SNO A;  5I2Y A;  5A2Q E;  4HCE A;  2HUG A;  4HSV A;  2C5C A;  3HOZ B;  1KNE A;  4V19 0;  5EKK A;  4OIK A;  2O4X A;  3S2H B;  3GP7 A;  1SBB B;  2F0F A;  3S1N B;  1YNJ D;  2F03 A;  2Z1C A;  2K5Q A;  3BDL A;  4BA1 I;  3SDZ A;  3LWU A;  2KEC A;  4QUC A;  3D6C A;  5CV5 A;  1TQO A;  1NUC A;  5LL6 X;  3I90 A;  2A68 D;  1V43 A;  4G7H C;  1CK1 A;  5TSS A;  1PFB A;  1CHQ D;  2QIL A;  1G8Z D;  2E76 C;  1B3A A;  1FGB D;  2BA1 A;  2F0Q A;  3OWF A;  2JA6 B;  4IUR A;  2J7Z A;  1SE4 A;  4PQX A;  1U4P A;  4ILW A;  1MSH A;  1DCZ A;  2F0P A;  2IWH A;  1G29 1;  1WTP A;  3BYT B;  4ZUJ A;  3RUZ A;  1BO0 A;  4Q5V A;  4FF4 A;  1ESR A;  1JQY D;  2XRQ D;  1PTO F;  4KMU C;  1DYQ A;  5IGB A;  1PRT F;  3CU7 A;  4XDX A;  4A3M B;  2PZU A;  1TU2 B;  1WD0 A;  4U67 3;  1SNC A;  4OO1 G;  3CHB D;  2B2V C;  4WOR A;  4YIJ A;  1CA6 A;  3HEJ A;  5EPL A;  3PUW A;  5CC4 A;  1EU4 A;  1SE3 A;  4ZRZ A;  1SMY C;  2D9U A;  3MFY A;  3GQB A;  1V1O A;  4RGN A;  2FJ2 A;  2PNR C;  3A55 A;  1EY9 A;  5KEE A;  2EY1 A;  4ID6 A;  1HRJ A;  2OEO A;  3S1M B;  4I65 A;  4OGQ C;  2N88 A;  4WJW A;  5C0X H;  3TSS A;  2NBF A;  1V8Q A;  5EBD A;  1PTO C;  3TN2 A;  1G91 A;  4M8A A;  2FIN B;  1BCP B;  3SK5 A;  3OMC A;  2H4O A;  3T4A C;  1PRT C;  1ESF A;  2K28 A;  4K5V A;  2RVL A;  4K5X A;  5C0X I;  2OXP A;  4B9X A;  5LL6 S;  4DU9 A;  3QOJ A;  5EKL A;  2ID0 A;  4MHE A;  3HOX B;  2CW0 C;  3N6R A;  3CQZ B;  1SFO B;  1EY8 A;  1PDQ A;  1BOS A;  4DK1 A;  2A6E D;  1LT5 D;  4EGV A;  1PLF A;  3FDT A;  4ZAI A;  3CKI B;  4IFD H;  2A6E C;  1H9S A;  3E6Z X;  4R9W A;  4G7O C;  2LFN A;  4KV6 A;  5ISR A;  2E2I B;  2NVY B;  4K14 A;  1BDO A;  1WTQ A;  3HOY B;  1CFM A;  1VCI A;  1Z6H A;  3R8B A;  2MGS A;  1A3V A;  3P75 A;  5M9O A;  5C4J B;  3TP5 A;  3A8J E;  2HQE A;  2JE6 I;  1X3P A;  2HCC A;  4RGM A;  1RD9 D;  2O5I C;  1Z47 A;  2D2C C;  2XNA C;  4IFD I;  3RLF A;  1S5D D;  1F9Q A;  4RKL A;  1PTO H;  4FF3 A;  3K59 A;  1HUM A;  2RSO A;  2Q8T A;  2E2D C;  5FOB B;  5C4X B;  1NR4 A;  4FF2 A;  4FXD A;  4ODG A;  4FNF A;  3URY A;  1LT3 D;  2FMC A;  5JPM C;  1XXG A;  1IW7 D;  1EYA A;  1LLR D;  4HMJ A;  1I4Q A;  4B08 A;  5ELC A;  1QB5 D;  5CV8 A;  1IW7 C;  3H6M A;  1EL0 A;  2ZXR A;  2B2Y C;  1B1Z A;  1ICW A;  1IKM A;  2GA4 B;  2FHT A;  1KLG D;  5E1F A;  3M85 A;  3KBX A;  2SNS A;  2WP8 J;  2HCI A;  1SYC A;  4ZKB B;  3N52 A;  1STA A;  5FO7 B;  1FD7 D;  1TWG B;  1CA5 A;  3LWE A;  2G9D A;  3I4L A;  4BBR B;  4BY7 B;  4XQN A;  2WKD A;  3PIO 3;  2QEJ C;  2LMC B;  1CTM A;  1PYW D;  2WKC A;  5EPK A;  5G3L F;  2NN6 H;  1DM0 B;  1TWC B;  5KGU A;  1TS2 A;  1VF7 A;  1BCP F;  3FEW X;  4ZLT F;  1FNV A;  2AUK A;  2LS0 1;  3P20 A;  2F0L A;  5FO8 B;  3I73 A;  3MTS A;  2NVX B;  4QCL A;  3VYU A;  2JA5 B;  1JCK B;  5CYU A;  1KAA A;  1QNU A;  1TR5 A;  2B2Y A;  2DNC A;  3C1E A;  3V96 A;  1ZEQ X;  2PQE A;  3SEB A;  5KYL A;  3S16 B;  5HGT A;  1ONL A;  4C3I G;  2B39 A;  5JEA H;  1U4R A;  1GUT A;  3DM1 A;  3M4Y A;  1Q8I A;  2OT2 A;  1GUW A;  1EQT A;  1LTA D;  3G7L A;  2F0V A;  1LT4 D;  1M8A A;  2R92 B;  2XVS A;  2BDN A;  4XIG S;  2LY7 A;  2EYO A;  2L11 A;  2XIW A;  1SSO A;  1O78 A;  2EYP A;  2IX3 A;  1R9T B;  1A2U A;  2JA7 B;  1VMP A;  2BA0 A;  4KK7 A;  1UEA B;  2B2U A;  4Z9C B;  5FO9 B;  4KY5 A;  4C3J G;  5IGC A;  2PW7 A;  3V2T A;  4IUP A;  1ET9 A;  3SVM A;  1BCP D;  3E5S A;  2R61 A;  4F87 A;  2EVB A;  3W3A A;  4OO1 H;  1GHJ A;  4E6I A;  1BCP C;  1X3Q A;  2PMZ B;  3GTJ B;  2L5T A;  3D4D A;  4XYO A;  1KNA A;  1F77 A;  4ZYS A;  3ND9 A;  3DEP A;  5D3D A;  1L0X B;  3M7N A;  3MVV A;  2EJM A;  2DY7 A;  4OO1 I;  1WD1 A;  4CGY B;  5E4W C;  3MXG A;  3HKZ B;  1RDP D;  3GTP B;  1H9R A;  3M4O B;  4DAV A;  3Q6S A;  1U4M A;  3S14 B;  1NR2 A;  4X3S A;  1STH A;  5M5W B;  1Y69 U;  3QG1 A;  3BYY B;  2K33 A;  3VR4 A;  1FR3 A;  2KOL A;  1KDA A;  1RCV D;  1Q1B A;  2FMM A;  3T51 B;  2ICI A;  3FPU B;  3BG3 A;  4RA8 A;  4IUN A;  1JOQ A;  4KKT A;  2E74 C;  3V05 A;  4JK1 C;  1B2T A;  4LAA A;  1KTK A;  2F0H A;  1JOO A;  2RDG A;  2RSN A;  3PV0 A;  1L0Y B;  2K05 A;  1SNM A;  2K01 A;  3PUX A;  5ELF A;  1A6X A;  3S1R B;  1I4G A;  2K03 A;  3MXP A;  5K5P A;  5IOD A;  1V1P A;  2EYH A;  3J81 L;  5C4Z A;  1LAB A;  4LJZ C;  1WCM B;  3EVQ A;  1HPC A;  3MWY W;  3P1H A;  1QIL A;  3DEO A;  5DEH A;  4KHV A;  2AQ2 B;  2DN8 A;  5D3I B;  4IQZ A;  1K8M A;  3Q0A A;  1TVX A;  1H9K A;  5EGT A;  1O80 A;  1PXU A;  3H91 A;  1C8C A;  1SYF A;  2F0S A;  4IUU A;  3MZ5 A;  4ULL A;  3KBG A;  2AQ3 B;  1AP0 A;  2YYZ A;  4CHT B;  1D6E C;  2XWB B;  1LTR D;  3NE5 B;  1MBY A;  2R3Z A;  1XTC D;  3K58 A;  1MSG A;  5EQ0 A;  5CV7 A;  2PZT A;  2A69 D;  1BUV T;  4P2C B;  5C3E B;  2F4I A;  2A74 C;  3KUP A;  4A3J B;  2A69 C;  2NN6 G;  4G57 A;  4L8J A;  3OHX C;  2K6A A;  4NMZ A;  1YNJ C;  3OPO A;  4NKL A;  1F9R A;  3SE0 A;  1AFP A;  5LHY 1;  2WIN B;  2ENB A;  1EEI D;  2PW5 A;  2Z4I A;  2EY6 A;  3PUY A;  2KQ3 A;  3T13 A;  2AUJ D;  2YU9 B;  3NQI A;  1EY0 A;  2A68 C;  4C1N I;  5JEA G;  2B2T C;  4R8N A;  4RCN A;  2L1B A;  1TKW B;  3QWN A;  3M7G A;  2B2W C;  4XYQ A;  2WV6 D;  1HA6 A;  1GUS A;  5T1G A;  2F0E A;  4EQP A;  3X3N A;  3QJY A;  1BR9 A;  2G9H D;  3DWQ A;  1VF5 C;  1G2T A;  2PPB C;  1SEB D;  2WAC A;  1WTW A;  1KAB A;  3G6J B;  3R2T A;  3KF8 A;  2JA8 B;  1LAC A;  3IKJ A;  3NTI A;  1QCB D;  1FNW A;  4A3E B;  4K6L A;  3OIP A;  2L0C A;  4CKC A;  1DZ1 A;  2B2T A;  2D62 A;  3ONA B;  4XXE A;  3MHB A;  1SAP A;  3EA6 A;  1LV9 A;  1JIC A;  1EY7 A;  2IPK D;  1HQM C;  2B2W A;  3HOU B;  1ENC A;  1A3U A;  3MEH A;  5EKI A;  1LO5 D;  3J7A F;  1DXM A;  2VUM B;  5IOC A;  5M5X B;  2K7V A;  3GV6 A;  2F3W A;  3SHL A;  4C3H B;  3SR1 A;  4NDX A;  2F0J A;  3A8I E;  3TP8 A;  5JPN C;  3HG9 A;  5AFW A;  4X3U A;  1JWU D;  3CRK C;  4KKU A;  2F0O A;  1A3T A;  4O42 A;  5FK9 C;  1E2Z A;  4C3H G;  1NSN S;  3C46 A;  3KLR A;  1WVL A;  5E3F A;  4F8M A;  4ABN A;  2B2V A;  2NWG A;  1CI3 M;  5M3F B;  3D3R A;  1EWC A;  2L9H A;  4RGT A;  4ME5 A;  1WTO A;  3H3V C;  2KCN A;  1D5X C;  2DNE A;  3ZYY X;  4J8Q A;  5F2D A;  4MIU A;  3K0Y A;  1W6J A;  4CJ2 C;  2M00 A;  2F0G A;  3DUZ A;  3TZU A;  1EY4 A;  3J7Y W;  4RFB A;  1EYD A;  1V1P B;  2ZT9 C;  4B9W A;  4H44 C;  4DA2 A;  1SYB A;  1SDF A;  1RHP A;  4OIJ A;  1EY5 A;  5KIX A;  3KK7 A;  3I4N B;  2CQA A;  3I91 A;  4KD4 A;  2K5W A;  3TDQ A;  1KDB A;  3NTH A;  1FNU A;  3U9O A;  2Z4H A;  1EWH A;  5J39 A;  4PMC A;  2KA7 A;  1WTV A;  3HRZ C;  3NPP A;  4M1U B;  4DFA A;  1IHZ A;  1PZK D;  3D6W A;  1I6H B;  1OXX K;  3I3C A;  1GHK A;  3HGB A;  3I70 A;  5NUC A;  4RHS A;  2TMP A;  1ROD A;  1D1K A;  4KD3 A;  4WRD A;  1K8O A;  3NUC A;  2BE5 D;  3MA2 B;  1HQR D;  1F2M A;  4G4K A;  5FKA C;  4BY1 B;  4CJ1 B;  2JSO A;  4PMB A;  4KN7 C;  4HN7 A;  4UAI A;  2BE5 C;  1IKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...