3OTOQ

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3otoQ00
5GAEC 1KL9A 2ZTDA 4QL5A 1GKHA 4DAYB 4B3SL 1I3QH 4DR4L 2Y0SE 3KLWA 4JBWA 5GROA 4YHHQ 1YJWA 4XTCS 1VQEA 4MZ9A 3PUXA 3DM3A 1XTDA 4GN3B 3SGIA 4X62Q 2F4VL 2UUCL 4TVAB 4AYBG 3BZCA 4P71A 4IFDJ 1X3EA 4X65L 3GTOH 3S16H 2OWOA 4DV5L 5C0XI 3CC4A 3AEVA 4R4TA 2VNUD 1HNZL 1I50H 3ERSX 1WFQA 1YBYA 1IBMQ 3K0XA 2L15A 3HKZE 1YNXA 2MQHA 1JB7A 2IX1A 1PVOA 4DR6L 1X55A 3H0GH 5C4JH 1TWAH 4GS3A 1O7IA 3KOJA 1XJVA 4POGA 4PMWA 3I4NG 1Z9FA 1EOVA 4IPHA 1GD7A 4DK3C 4YWMA 4A3KH 4A3MG 3L0OA 3H0GG 1KHIA 3NENA 3FHWA 1KRSA 2HQLA 1CKNA 1VQMA 3GO5A 4JOIA 2ZM6Q 4DV3Q 3ULJA 3PIOA 1K8AC 3HOUH 1JE5A 3U4VA 3K8AA 1LUZA 2NN6G 4JC0A 5M5WH 2E2JH 4A3KG 2I0QA 2AWOA 4X66Q 2OTLA 4JI1Q 5GAHC 2VQFQ 1VQ6A 1HZAA 2CWAA 5AJ3Q 1NTGA 1EIFA 1MJCA 2QEXA 3AYHB 3ZJYC 5IYBH 3M7NA 2QA4A 2CWPA 4OXPA 4HJ5A 2HHHL 1D8LA 3PUYA 5C44G 4A93H 3I4OA 1EYGA 1N32Q 1L0WA 2V1CC 4DR2L 2ID0A 4P74A 5C0XG 1FGUA 3PV0A 5H1SE 2ZJPA 1Q81C 2AKWB 4DV1L 2IX0A 4LF6L 2CFMA 3U4ZA 2IY5B 1I6HH 3OYYA 4P72A 4DK6C 3KDFA 4YWKA 2UXBQ 3K81C 3NEMA 1HJPA 4DV0Q 4BY7H 4LF8L 2UUAL 3H3VH 2IT1A 1SE8A 5J3BA 1C0AA 4APVA 4JI3Q 2AHOB 5JJKA 1UE7A 3VDYA 4YHHL 3RLNA 1E1OA 5IYCG 4JV5Q 4X62L 3S17H 2JE6I 1VQLA 4JI0Q 3M9BA 4JBKA 2WB1G 3I56A 1N8RC 1X65A 3OTOQ 4LNQA 1L1OC 1IBKQ 1VQKA 5E7NA 4PG3A 1L1OA 3GTQH 1IBML 3I55A 2JA8H 4L5RC 1WCMG 1VQJA 2VL6A 4JCVE 4LUVA 1IZ6A 3GTPH 2BA0A 1S72A 2OTJA 4NB3A 1VQAA 1CKNB 1YHQA 2FXQA 4QQBX 1FJGQ 3S15H 4JV5L 1K0RA 3STBD 2Q2UA 1JJ2A 2JA8G 1PH9A 1UE6A 1X54A 5GQOA 3HOZH 2VUMH 1T9HA 3PGZA 1JMCA 3S1MH 3CW2C 2ZM6L 4DV3L 2XTIA 1I5FA 3PCOB 4PZ6A 3J7A5 3M85A 1D7QA 4DUYQ 4JI5Q 1PH2A 4X66L 2VUMG 4JI1L 2VQFL 3S1RH 1CSQA 1EQQA 2ATWA 2B63H 5AJ3L 5M3MH 1TWCH 4C3IH 5IP7H 3GTJH 4LF5Q 2YV5A 1TWFH 3J81j 3JC66 4OWXB 1N34L 4L5TA 1N32L 2JA9A 1DGSA 3KDFB 2LXKA 2B63G 4KHPQ 2EQSA 4GLVB 4IPGA 5IP7G 3W1BA 4ME3A 2UU9Q 4JYAQ 3E9HA 3KJOA 2JEAI 4B3RQ 2KBNA 1AH9A 5JJLA 1GO3E 1OXVA 4A3CH 2UXBL 1GM5A 4BY1H 4XIGS 2KCMA 4DV0L 1UWVA 2OQKA 2E5LQ 4JI7L 1G6PA 1A62A 1VQPA 3M3YH 1OTCA 4FDBA 4JI3L 3FKIG 3E9IA 4LWCA 5FLMH 4KHZA 2R7FA 4EX5A 1UE1A 1NJIC 3TS2A 2YTVA 3TRZA 4NXNQ 3RLFA 2OQ0A 3RLOA 3W1GA 4QGUA 3J81c 4DV6Q 4ALPA 1Y1WH 5FLMG 4UP8A 3RR5A 4R4QA 5GADC 1K3RA 2D0PA 4R4OA 4R1JA 1X6OA 3OTOL 3CD6A 1IBKL 5IWAQ 4X64Q 2BH2A 3CPWA 3AQQA 2RCNA 1IL2A 4JBJA 3KF6B 1NMFA 2PI2A 1Y1WG 4WJ4A 4YY3Q 4KLKA 2JK8A 3KFUA 5IP9H 1YI2A 5M5XH 3AFPA 5IYDH 2PQAA 1MJEA 3HOYH 1VQDA 3PO3H 2A1AA 1P16A 4HIKA 2LSSA 3I4MH 1W3SA 2MNAA 1V1QA 1YZ6A 4X6AH 1V43A 1X9NA 5IP9G 2JQOA 2E2HH 4OX9Q 1M90C 3KF8B 2K75A 4C3JH 3HOYG 3J80c 4A3JH 1L2FA 4DUYL 1QVFA 4JI5L 3CCJA 1M1KC 4QIWE 3S24A 3I4MG 4L5QA 2UXCQ 3PO2H 4JOIC 3CPFA 1PYBA 1CKOA 1WI5A 3LGJA 3EN2A 2K5NA 4OWTB 3UDIA 5HGQA 4LF5L 3M4OH 4A3JG 1NBWA 4OWWB 3H3VI 2D0OA 4QJFA 3PO2G 2K5VA 2RHQB 4KHPL 4AYBE 1CKMA 2CCZA 1PH8A 4JYAL 4DV4Q 2R6GA 3HOUG 1LM0A 1C7YA 2ZJQA 1XMQL 5C4XH 1Z47A 4P73A 3S2DH 1Q46A 4B3RL 2R93H 2YU9H 3CCQA 4DR1Q 1SMXA 4LUZA 5GAGC 1HNWQ 2K50A 1VQ7A 5IYBG 2MO1A 3S1QH 2Q2TA 2E5LL 1XNRQ 3G71A 1Y14B 1OXUA 1K8GA 4A93G 3ER0A 1YIJA 4B3TQ 2NVQH 2ZTCA 3W5OA 3RN5A 4JI2Q 3CCRA 4NXNL 1HH2P 1SLJA 3CC7A 4DV6L 3UE1A 4OONA 3U50C 3JAMc 4IOAA 4DR7Q 3K7AH 3T1YQ 4IFDI 1Q12A 1YVCA 5DLQE 1NY4A 5IWAL 4X64L 2A8VA 4GN4B 3G6EA 4JI8Q 2JA6H 1XPUA 4BY7G 2PQAB 2DGYA 1FVIA 2VQEQ 3F1ZA 2Z6KA 5M5YH 1YITA 1SFOH 4YY3L 4HIOA 2ZTEA 5IT9c 3A5ZB 1GVPA 4IPDA 4DR3Q 4A3EH 1XPRA 4NXMQ 4DAMA 1N9WA 2JA6G 3GDEA 1B7YB 1V9PA 1HZ9A 4YCVA 4QY7A 4A3GH 3TQYA 1LTLA 4HIDA 4Y52H 4A3EG 1Q86C 2GVBA 4DNIA 4UP9A 4HJ8A 4LF9Q 1Q82C 5JEAG 1PH1A 4HIMA 4OX9L 1KAWA 2IHFA 3NELA 4POFA 2I5MX 1PHJA 1UEBA 4A3GG 3ULPA 3KF6A 1SRUA 2VY3A 2ZJRA 3S2HH 3E0EA 5FJ8H 2UXCL 5M3FH 1N33Q 4LFAQ 1OXTA 1XMQQ 1I94Q 3MXNB 4BBSH 4UP7A 3K80C 2WP8J 4B3SQ 2AWNA 3HOZG 1JT8A 1IBLQ 1XNQQ 2LXJA 4BBRH 4LUOA 1C9OA 3OW2A 4GKKQ 4IFDG 4GOPC 1BVSA 2KENA 3HKSA 1VCIA 2WB1E 1FL0A 1IXRA 3L2PA 4GOPA 2PMZE 4DV4L 4DV7Q 1HNXQ 2F3IA 3EIVA 4BBRG 1KQSA 4JI4Q 1HZCA 1BBUA 4B3MQ 1HNWL 5FLXc 4DR1L 4JBMA 1JJGA 3NBHB 4O0AA 2GVAA 1KD1C 2HT1A 1U0LA 2I5HA 3L7ZC 5M3MG 3GTGH 1A8VA 2WAQG 1XNRL 3B6YA 3HOVH 3A74A 3G4SA 4IPCA 1VQBA 5BR8Q 5C0XJ 4B3TL 3ULLA 2JA5H 1LYLA 4JI2L 4A3BH 3EBEA 3CCUA 3HOWH 3BU2A 1YHBA 2K14A 4DR7L 2CKZB 3KYHC 4IO9A 3T1YL 1PH6A 3CAMA 4A3CG 3PSIA 1J5EQ 2VZAA 4IJLA 4A75A 1NMGA 3G48A 2GN5A 3K7UC 4BY1G 4JI8L 2Y0SG 3CP0A 1PA6A 4HJ7A 4DUZQ 2KHIA 2VQEL 1WOCA 4JI0L 4GKJQ 1PH3A 1CUKA 2C35B 4NXML 4DR3L 1EUJA 1RIPA 3GD7A 1VQ8A 2UUBQ 1X3GA 2R92H 4AQYQ 1K83H 4LFBQ 3M4QA 1TWGH 1MIUA 5LMNW 2NVXH 3T1HQ 3HKZG 3TEHB 4KI0A 4LF9L 1IYJB 1R9TH 1E3PA 2R92G 1FJGL 1YJ9A 4LF4Q 4RMFA 3CCMA 1EFWA 4A3LH 3UDGA 5IE8A 2XGTA 1E22A 2NVYH 4EQ5A 1N33L 3PUVA 3Q8DA 4A3IH 4LFAL 4GOPB 2PNHA 1I94L 2VW9A 3F2CA 2EXDA 4YCUA 4A76A 1VQCA 2ALYB 4IJHA 5IYDG 3WWVA 3PO3G 1IBLL 1BKBA 1XNQL 3J7ZC 4A3IG 3CMAA 4GKKL 4OO1I 1Q1BA 3CXCA 5HY6A 3RN2A 4LF7Q 2JA7H 2R7DA 4YWLA 3CCLA 1HR0W 3CC2A 4DV7L 4DV2Q 1HNXL 1YEZA 4JI4L 2I5LX 4B3ML 4P75A 1PV4A 2JA7G 1KIXA 4MNOA 1VQOA 3CMEA 1RL2A 2UU9L 3J80i 3I4NH 2B3GA 3M4PA 3FP9A 1H95A 4A3MH 2E2IH 4GNXB 5BR8L 2Q2IA 1YJNA 1AE2A 2B29A 3RZDH 1PFSA 1VS0A 3U58A 1TXYA 1JJCB 2IHEA 4DR5Q 1QZGA 1XPOA 3RZOH 2UXDQ 2R93G 2K4KA 5C4XG 1Q1EA 3D0FA 1SR3A 2E8GA 2N49A 1J5EL 3F8TA 3S1NH 1OXSC 1P8LA 1K9MC 2N3SA 3PUZA 1QVGA 1G51A 5C44H 5LMNQ 4DUZL 2R7ZH 4GKJL 2RF4A 1VQIA 1W2BA 1QZHA 3CQZH 1ASZA 4LW1A 4C3HH 2NZOA 2YYZA 3UE0A 3RNUA 2N78A 2ASBA 4HJ9A 1KRTA 2K52A 1XMOQ 4K0KQ 1TWHH 3STBC 4AH6A 4LFCQ 2UUBL 2BH8A 4L5SA 1N34Q 4AQYL 2Z0SA 3A0JA 3H15A 2R7ZG 2Z6KC 4LFBL 1KXLA 4A4IA 2KHJA 3AFQA 4HJAA 4TQUS 3PUWA 3T1HL 1E7ZA 1Y1VH 2QGQA 1EQRA 1AE3A 4DKAC 1PH4A 4J15A 4LF4L 2HIXA 3JAMi 1QVCA 3GTKH 3S14H 2JJQA 3BZKA 1K73C 3GTLH 1EIYB 2H5XA 1Y1VG 2NZHA 3HFZB 3ICEA 1HR0Q 4JI7Q 2AMCB 5IYCH 3KJPA 3PF5A 1N36Q 3I7FA 2JEBI 3MEFA 3F2BA 3CCVA 1Q7YC 4JI6Q 1VQFA 2D62A 4H02A 4PZ8A 2Q2HA 4JG2A 5JJIA 5LMUQ 1BBWA 2MO0A 4LF7L 1WCMH 1OXXK 4DPGA 4IOCA 1MKHA 1X3FA 3HOXH 4DV2L 4BA2I 1A63A 4DR4Q 3TS0A 1QUQA 5FJ8G 5C3EH 5M3FG 2F4VQ 4WJ3M 2UUCQ 4R4IA 3HOXG 4BBSG 1SN8A 5ELOA 3PF4A 3A5UA 5C3EG 4X65Q 4DV5Q 4PZ7A 2F52A 3D31A 1KC8C 1HNZQ 3I2ZA 1VQ4A 4DR5L 1NE3A 1WJJA 3IRBA 4UY8C 1G291 2UXDL 5K36G 5IY0A 4DR6Q 4YCWA 1EWIA 4R4CA 2MFIA 5ELNA 1SROA 1PH5A 1VQHA 3CCSA 1WYDA 1YHAA 1UE5A 4OO1G 3CCEA 5LMNL 3HOVG 2A19A 2DUDA 4GNXC 1HZBA 4GNXA 3BJUA 1VQ9A 1VQNA 1XMOL 4BXXH 2JA5G 4LFCL 4GLXA 3DLLA 4K0KL 2KCTA 2HIVA 4A3BG 4A3DH 2ES2A 1CSPA 3F2DA 4NPSA 3HOWG 4A3FH 2OCEA 1E1TA 4Y7NH 1S3OA 4BXXG 1PYSB 3UDXA 4AIMA 4A3DG 1E24A 2HHHQ 3GTMH 4A3FG 3FKIH 4MTNA 2RHSB 5EAYA 3TREA 3UDFA 1J6QA 2YTXA 4DR2Q 2N8NA 2VS1A 2WAQE 1PH7A 1Q8KA 2CQOA 1HR0L 1B8AA 2K5HA 1VQ5A 1U5KA 4UPAA 1S40A 3CF5A 1N36L 1X56A 2YTYA 3J81i 4DV1Q 4GLAC 4C2MH 4JI6L 4LF6Q 4RG1A 1QUQB 2NVTH 4O2DA 1L1OB 2BA1A 1B70B 5JEAJ 1VQGA 2EIFA 5LMUL 4GN5A 2PI2E 2WFWA 1ASYA 2UUAQ 4LF8Q 4BA1I 1A0IA 4A3LG 2NN6I 3PIPA
chains in the Genus database with same CATH superfamily
4RFBA 2ZTDA 5EPKA 4B3SL 4DR4L 5J39A 4YHHQ 3VYRA 1VQEA 3DM3A 1XTDA 1SNPA 3R2IA 4X62Q 2F4VL 4AYBG 5JVG3 1PYWD 4X65L 1UNSA 5C5LA 3GTOH 4DV5L 3CC4A 1RTOA 2LS01 1WFQA 4A3EB 4RH6A 1IBMQ 3FEWX 3K0XA 4ID6A 3HKZE 4QUFA 1JWSD 1X55A 5D3IB 4GS3A 3FRPB 3L9AX 1Z9FA 1A15A 2NN6H 4DK3C 4A3KH 4A3MG 4RKLA 1KHIA 3FHWA 1CA5A 3TSSA 1EY0A 3K5LA 3ULJA 3HP3A 4HSPA 2WIIB 3NTHA 5M5WH 3K5NA 2AWOA 5CR3A 2A69D 4QUCA 1X32A 4FYDA 1SYGA 1VQ6A 4BBRB 1EIFA 1MJCA 3T4AC 2EVBA 2F0JA 3DEOA 4OXPA 2HHHL 1SBBB 3PUYA 4A93H 2QILA 2WAQB 3OMCA 5CV8A 4DR2L 2BE5C 1FGUA 4NP5A 2CFMA 1I6HH 3OYYA 4P72A 5KGUA 4YWKA 4ZCKA 2UXBQ 2DY8A 4DV0Q 2EJGC 4LF8L 2F0HA 5J3BA 2JA5B 2ZXOA 3E6ZX 4RGMA 1UE7A 3SDZA 4ULLA 2WB1G 3D6CA 5KEEA 4LNQA 3C1FA 1VQKA 2E76C 4L5RC 5HGTA 2A73B 2H1EA 3GTPH 1K83B 2B2YC 3QIAA 4QQBX 3STBD 1SXTA 3VYUA 4JK1C 3HOZH 5FO8B 1EY6A 1IHZA 1T9HA 3PGZA 3S1MH 1B9MA 1EY8A 4K2KA 2ZM6L 4A3IB 5IGDA 4DUYQ 2VQFL 1K3BC 5AJ3L 5M3MH 2CH4A 1TWCH 1WTQA 1BF4A 3JC66 4OWXB 2LXKA 2B63G 3UI2A 4KHPQ 1DD2A 5IP7G 4ME3A 3E9HA 2JEAI 4B3RQ 4RAUC 3SK4A 1AH9A 1GJXA 1GM5A 1TR5A 4XIGS 4CKEA 3GV3A 1A62A 4FDBA 3FKIG 4EVOA 1JWUD 2QF7A 1DOMA 1WTPA 3KK7A 1E2VA 1HFGA 3PIO3 4ALPA 5FLMG 3RR5A 2QCPX 1PZID 4R1JA 5DM63 4R4OA 3OTOL 4RWSC 5IWAQ 4X64Q 3AQQA 1IL2A 4JBJA 1TWHB 1QWYA 2M00A 2JK8A 1TQOA 1L0YB 3AFPA 5IYDH 1MGSA 2FMCA 1EOTA 3HOYH 3PO3H 3DWPA 2LSSA 3GTLB 3K57A 3GV6A 1C4QA 4X6AH 1X9NA 4OX9Q 2FMMA 2PCFB 3KF8B 4C3JH 1L2FA 1QVFA 4L5QA 4JOIC 2Z4HA 1PYBA 1CKOA 3UDIA 4LF5L 5J1ZA 1A2UA 1PTOC 4QJFA 4UDUC 4KJNA 5IIFA 4JYAL 2R6GA 3S2DH 1LV9A 4LUZA 5GAGC 1RHPA 2E5LL 2RDGA 1XNRQ 1Y14B 1K8GA 4A93G 2CHBD 4DK0A 4B3TQ 2BDNA 2NVQH 1KAAA 3HOVB 2SNSA 2ZTCA 3W5OA 3UE1A 1GUNA 2HCCA 4OONA 4CJ1B 1W6KA 2A8VA 3V96A 2LFNA 4JI8Q 1EYDA 2PQAB 3MFGA 4A3DB 2QDBA 1SFOH 5KYIA 1GVPA 4IPDA 1G91A 1SMYD 2JA6G 5JEAH 5L37A 4KN4C 1LTLA 3TP8A 3FKIB 2OXPA 2F0UA 1PH1A 2IHFA 3NELA 1U9RA 3KF6A 1MHWC 2ZJRA 2NZ1D 5FJ8H 5CBEE 4NKLA 3DWAA 4BBSH 4UP7A 3K80C 2AWNA 3HOZG 1ZXTA 4IFDG 3OW2A 1C9OA 1BVSA 2KENA 1KTKA 5F2DA 2PMZE 4DV4L 4U68A 2HCIA 2RQXA 3EIVA 4JI4Q 1BBUA 1HNWL 4DR1L 1JJGA 4O0AA 2GVAA 3GTOB 1U0LA 2B8GA 2I5HA 5ELEA 2RSOA 5IGGA 5M3MG 1IW7C 3FVQA 3GTGH 1ET6A 3A74A 4IPCA 2KJXA 4WORA 1Y8OB 5I9PA 3EBEA 3HOWH 3I70A 1AFPA 1YHBA 2K14A 3CKIB 3VR3A 4A3KB 2HUGA 3G48A 2OEOA 2NN6I 4OIKA 2Y0SG 1PA6A 5JOBA 1WOCA 4GKJQ 5M5WB 2R61A 3NWSA 2C35B 4RGTA 4NXML 2EXZA 3GD7A 2SOBA 1X3GA 1EY4A 3OMGA 2R92H 1TWGH 1MIUA 4A93B 3W3AA 2NVXH 3P20A 4KI0A 4LF9L 3K59A 1PTOH 1YJ9A 2Z1CA 2VXWA 5IE8A 3R2TA 3SHLA 4EQ5A 1JOQA 2EJFC 1N33L 2JYOA 1I6HB 3I3CA 4YCUA 1VQCA 3I72A 2B8FA 4IJHA 5IYDG 3WWVA 3PO3G 4KHVA 4KMUC 4GKKL 1A2TA 5HY6A 3RN2A 1H9RA 3G6JB 4C3JG 2I5LX 3VA7A 1HA6A 1B4OA 1ML0D 1J8IA 2JA7G 3M4YA 1H9KA 1JICA 2C9OA 3MXNA 1H95A 1ET9A 1TT2A 3GTPB 2Q2IA 1YJNA 3RZDH 1SYDA 1TXYA 1JJCB 2IHEA 1E2ZA 3P75A 3CU7A 3RZOH 2K4KA 1SR3A 1D1IA 3F8TA 1Q3LA 1HTPA 3TDQA 2DY7A 3PUZA 3K58A 1K9MC 5LMNQ 2KCCA 2R7ZH 4V190 1W2BA 4RHRA 5C0XH 2A68C 4OO1G 3UE0A 1G2SA 4AH6A 4LFCQ 2BH8A 1TWCB 2Z0SA 4LFBL 3L3OC 4HJAA 4TQUS 1SE4A 1VF7A 1DOKA 1PZJD 1Y1VH 4CHTB 3P7JA 4DKAC 4YIJA 1QVCA 3GTKH 1F9RA 5EKKA 3BZKA 2IWHA 1LTAD 3HFZB 1HR0Q 3KJPA 3OIQA 1RD9D 2O5IC 1VQFA 1KDCA 3KBGA 4LF7L 1WCMH 1OXXK 3N52A 4X3KA 4DV2L 1UUPA 5E1FA 1CM9A 4DR4Q 5FJ8G 5C3EH 4KTAA 1I3QB 2F4VQ 1U4LA 4BBSG 1SN8A 3MEHA 2KECA 4KD4A 3D4DA 5K36H 4X65Q 4JPBW 4DV5Q 1STGA 4PZ7A 4EQPA 2XRQD 1VQ4A 4DR5L 2DNCA 4K5WA 1G291 1JQYD 3HOYB 5ELNA 2E2DC 4CJ0B 3DMUA 1WYDA 2PW5A 1UE5A 3R3OA 1B3AA 2A19A 2F03A 2A74C 1ESRA 1EQTA 4K0KL 5FKAC 3LWEA 1CSPA 3F2DA 3HOWG 2RCFA 2XN9C 2OCEA 4N8X1 5EKIA 1GUOA 1KLUD 2HHHQ 3GTMH 5CORA 3BDCA 4ZLTF 1ZYRD 2YTXA 2IX3A 4DR2Q 2WAQE 1Q8KA 1B8AA 2K5HA 3CF5A 1N36L 4DK1A 1W6JA 4RG1A 1AP0A 1QUQB 4O2DA 2BA1A 2WKDA 1B70B 2FINB 2NVQB 1VQGA 4LF8Q 2KVMA 2PI2E 2WFWA 3ERQA 5FO9B 2D2CC 3KBXA 3PIPA 1KL9A 4QL5A 4BY7B 3OPOA 4JBWA 3KLWA 4RHSA 4FF4A 4H44C 4F8MA 3J7YW 2EY1A 1BUVT 4G57A 1ESFA 1TY2A 2OWOA 4CDFC 1SFOB 2VNUD 2L55A 1SAPA 2L15A 5IGEA 4FF2A 2MQHA 2VB3X 1NSNS 2EYPA 4K6DA 4YWMA 3H0GG 3NENA 4OELB 2HQLA 1BOSA 3GO5A 4DNTB 2ZM6Q 2F0QA 3E3XA 3PIOA 3HOUH 1JE5A 5KYLA 2CH4W 2OTLA 1HTLD 2LMCB 4MTKA 2VQFQ 1EWCA 1HZAA 2CWAA 5AJ3Q 1NTGA 3AYHB 4XQJA 2IL8A 2FJ2A 1ENAA 5KNBA 1EYGA 4RCOA 1TY0A 5C0XG 3BYTB 4IUUA 3EFXD 2ZJPA 1Q81C 4ZRZA 1D5XC 3KDFA 3K81C 3NEMA 2I07B 1Y8PB 3NHHA 4BY1B 2O5JC 2Z9HA 1BBXC 1E1OA 1KABA 3S17H 1SYEA 1PLFA 2K03A 1VQLA 1GUTA 2K5DA 3IFTA 1STEA 1X65A 3OTOQ 1L1OC 3NTKA 1B2TA 2RBMA 1L1OA 1WCMG 1O7LA 1VQJA 2VL6A 3MXGA 1IZ6A 3K6OA 1S72A 2R92B 3PMFA 4NB3A 2PQEA 1CKNB 1TWGB 1HRJA 1BO0A 1FJGQ 4DA2A 3S15H 2Q2UA 2B2VC 1JJ2A 2JA8G 1PH9A 2NVXB 3TP6A 1X54A 5GQOA 1NNXA 1PTOB 2B2VA 1RODA 4E6IA 2B2UA 1FNUA 1V1OA 5CV9A 3BYYB 3M85A 1KDAA 1D7QA 3BZDB 2VUMG 4JI1L 1CSQA 2B63H 5IP7H 3GTJH 4LF5Q 5COYA 3J81j 5I2YA 4L5TA 1B1ZA 2KHSA 1E0BA 4L6TB 2EQSA 4JYAQ 1QOHA 2E74C 3NTIA 2KBNA 1D2BA 5JJLA 1GO3E 1OXVA 5CYUA 5I2XA 2J7ZA 5IODA 1G6PA 2OQKA 3RZDB 2E5LQ 1VQPA 2F0EA 3H09A 4DFAA 4JI3L 1OTCA 3E9IA 5FLMH 3RZOB 2R7FA 1DJRD 5CV4A 3TRZA 1TKWB 3AB9A 1XWEA 2OQ0A 3W1GA 1PRTF 3J81c 4JV5L 3D6WA 1LTID 4U673 1CT1D 3CD6A 2R7ZB 5ELDA 1Y69U 1CHQD 2EYMA 1HFNA 1AEXA 2RCNA 1S4ZA 1Y1WG 3KF6B 4WJ4A 1RKNA 4ZYSA 3C1EA 4KLKA 3FPPA 4FVMA 4MIUA 3KFUA 3ITPA 5FK9C 5T1GA 4B9XA 1Y1VB 4N9PA 1HQRD 1VQDA 1V1QA 1DONA 2QDLA 1M90C 2G9HD 1O78A 3I4MG 2EPBA 1H9MA 4X3SA 4XT3B 1UEAB 1HQMC 2F0OA 5HGQA 3OWEB 4N8FA 1F2ZA 3PO2G 1PFBA 5C3EB 2D5DA 2CCZA 1PH8A 3DHQA 4DV4Q 5KNDA 3HOUG 3T51B 3D8GA 2ZJQA 4P73A 5BN4A 2KCNA 1HNWQ 1I4RA 4DR1Q 1T5XD 1QJOA 3S1QH 2Q2TA 4H13C 3G71A 4J8QA 1IYVA 3W2DA 5CC4A 1BCPF 4J6HA 5KIXA 2AQ3B 4DV6L 3U50C 3S9WA 3K7AH 3VYTA 5CGKA 4IFDI 2HQEA 1B9NA 4KKTA 3G6EA 3U9SA 2JA6H 1DYQA 1JB3A 3F1ZA 3O13A 3I73A 4YY3L 1I6VC 2BCOA 4NXMQ 4I65A 1N9WA 3TBIB 1MSGA 1R4QB 2EOTA 4KKSA 4DF7A 4O42A 3GTMB 2JSOA 2GVBA 1Q86C 1WTHA 3NK9A 4LF9Q 4KV6A 1B50A 1Q82C 2K33A 2DN8A 2RDHA 3ZYYX 1Y8NB 1KAWA 2RSNA 2A6ED 4A3GG 1Q90A 1UEBA 1O7YA 1SE2A 4QIWB 3ULPA 1GUGA 1SRUA 2VY3A 3S2HH 3E0EA 2UXCL 1FNVA 5M3FH 1N33Q 4IFDH 1UAPA 1OXTA 2MUYA 1XMQQ 3MXNB 4HR7B 1SSOA 1JT8A 4AYBB 3PIP3 4GKKQ 3AU7A 5CV7A 2Z4IA 2Z8LA 2O2LD 3J80E 1SYBA 1JOOA 1F77A 1NUCA 2F0FA 1KD1C 3MXPA 2HT1A 3L7ZC 2PZUA 4H7BA 3RD4A 3NUCA 1CQFA 4A3MB 4KKUA 2IJ0A 1LYLA 4A3BH 1TS5A 1EIHA 1RJTA 1YNND 4DR7L 4IO9A 1D1KA 1LT4D 3CAMA 4EGVA 3EVQA 2VZAA 1NMGA 4ILWA 3CP0A 2NWGA 3S1NB 3HOUB 4NW2A 1PH3A 1X3QA 5E4WC 1QE6A 4ZUJA 4BWGB 4LFBQ 3HS0C 5LMNW 3JAME 3HKZG 3TEHB 3M7GA 1KDBA 1R9TH 4ZKBB 2EYOA 1FJGL 1STNA 3CCMA 1LT3D 1ILPA 2XGTA 1E22A 2A69C 3URYA 4LFAL 5DAUA 4GOPB 1H9SB 1I94L 5IT9E 4A76A 2M9VA 4HEDA 3MXUA 3NWTA 3VYSA 1IBLL 1BKBA 1XNQL 3QR8A 3J80L 2WB1B 4OO1I 1Q1BA 4UAIA 4LF7Q 3E5SA 2R7DA 2XWJB 5C4HA 2JA7H 1HR0W 4DV7L 4DV2Q 1HNXL 2RDFA 3SK5A 4NDXA 1EIGA 4FF3A 1PV4A 3CRKC 4MNOA 3CMEA 4PMBA 4G7HC 1EYAA 4RGNA 1LABA 3SEBA 4B08A 2E2IH 1VS0A 3ONAB 4DR5Q 3S15B 1XPOA 4IUNA 3D0FA 1VF5C 2E8GA 1STAA 2N49A 4OL7A 1J5EL 4OO1H 1OXSC 5FLXE 2XIWA 4IQZA 2N3SA 4DGZA 3I90A 5C44H 4DUZL 3QJYA 2KEDA 1VQIA 1QZHA 3CQZH 3I4LA 2NZOA 3JAML 2N78A 4HJ9A 1KRTA 2K52A 4K0KQ 3STBC 2B63B 2D9UA 1N34Q 4AQYL 3GTJB 3AFQA 4C3HG 4HTHA 3MA2B 3T1HL 2QGQA 1AE3A 5CV5A 4IN3A 1PH4A 4LF4L 2L9HA 5IT9L 3S14H 2JJQA 5A2QE 5BN5A 3ICEA 4DXFA 2AMCB 5IYCH 2EYJA 1N36Q 3CCVA 4LMQD 1PTOF 4KJOA 1QG7A 5CMDA 1OO9B 1EQVA 5JJIA 2F0KA 4DPGA 1EWHA 4BA2I 2P5ZX 3SR1A 3TS0A 5M3FG 3P1HA 4K6LA 4WJ3M 1T5EA 1NR2A 3HOXG 3H3VC 2F0VA 2L0CA 2F52A 4EQNA 1I4HA 5FLXL 1F9QA 4IUVA 1YNJD 4YCWA 1EWIA 2ZXRA 4R4CA 1EU4A 3LWUA 1SROA 1EY7A 3CCSA 3CCEA 2RA4A 2DUDA 2B2WA 3BJUA 1XMOL 2X6GA 2KCTA 4A3BG 5I4DA 5A2QL 2TSSA 4Y7NH 5I6WA 2K5QA 1PYSB 1QNKA 4A3FG 1RDPD 2C5CA 4MTNA 3TREA 3UDFA 1J6QA 3T13A 2N8NA 2VS1A 2CQOA 4UPAA 2YTYA 3J81i 3S1QB 2AUKA 2HDLA 4UHVA 1L1OB 4PNYA 3QOJA 1LTGD 5JEAJ 2EIFA 5LMUL 1CZWA 1GXDC 3K5MA 1D5ZC 1XMQL 1O80A 3R8BA 4DAYB 1SE3A 2K32A 5GROA 3K7AB 4XTCS 2TMPA 1CTMA 4MZ9A 3G7LA 3PUXA 4GN3B 1ENFA 4TVAB 5JPMC 2Q8TA 5FOBB 2JA6B 3BZCA 2XNAC 4DNRB 3S16H 5C0XI 3OIPA 2WACA 1HNZL 1I50H 3ERSX 1EY9A 1YBYA 2IX1A 4JW0A 4HAEA 3H0GH 5C4JH 1TWAH 1O7IA 4POGA 1U4PA 2MP1A 3Q6SA 3KLSA 3X3NA 4IPHA 3RUZA 1GD7A 1JORA 3L0OA 1KRSA 1D6EC 3HOZB 5M3FB 1U4MA 1SMYC 4K14A 3S1MB 3U4VA 3K8AA 1LUZA 2E2JH 2KA7A 4JI1Q 3FDTA 4CKCA 2KEEA 3ZJYC 5IYBH 3M7NA 1JOKA 2KOLA 4PMCA 3ND9A 2L1BA 1D8LA 3CHBD 5M3MB 5EPLA 5C44G 3BG3A 4IUTA 2V1CC 5IOCA 2ID0A 5LL6X 1A3UA 3PV0A 2K5WA 5H1SE 1SJED 4ZUIA 1BXTA 3U4ZA 4DK6C 5HURA 2QW7A 3H3VH 2IT1A 1SE8A 4APVA 4JI3Q 4A3BB 2F1MA 1AN8A 2Y0SB 2EZVA 1CA6A 2I46A 1LTSD 3AMUA 1DM0B 1VMCA 5IYCG 4JV5Q 1FR3A 4JBKA 3BS1A 3I56A 1YNJC 1N8RC 1XXGA 2J4XA 3MWYW 1X3PA 3QO2A 5E7NA 4PG3A 3BDOA 5G3LF 5BN3A 2JA8H 4LUVA 3A8JE 1K0RA 3DEPA 1R9TB 2A6HD 2VUMH 2JN4A 1JMCA 3MC0B 5C4ZA 3PO3B 1S5DD 4DV3L 2XTIA 1I5FA 2ZT9C 1J9OA 1ILQA 3PCOB 3J7A5 4FP5D 3J7AF 1PH2A 4X66L 3K5OA 3HZXA 4C3JB 1EQQA 1CQVA 1HHVA 4L8JA 2XRSD 5EBCA 1KLGD 4C3IH 3I91A 5D14A 2JA7B 1TWFH 1N34L 1N32L 2JA9A 4K2LA 4WFN3 1PFMA 2PO4A 3KJOA 5LL6S 3BVZA 2ICEC 3S2DB 4HCEA 1PRTD 3V05A 2OT2A 3M3YH 1SNMA 1EYCA 4XYOA 2FHTA 4EQOA 2SDFA 4DV6Q 1Y1WH 4HCSA 3NPPA 5GADC 1X6OA 1IBKL 2K04A 3CQZB 3CPWA 2F0PA 1NMFA 3T56B 2PYKA 4YY3Q 4FO2A 5D3DA 1YI2A 5M5XH 3BVGA 2KQ3A 2PQAA 1MJEA 3S14B 4HIKA 3I4MH 1YZ6A 4HMJA 5IP9G 2JQOA 2E2HH 2K75A 1B44D 2HD3A 1TU2B 4JI5L 3MTSA 4QIWE 3S24A 3CCJA 1M1KC 2UXCQ 3PO2H 3CPFA 3KLRA 4OWTB 3EN2A 2K5NA 1EU3A 4A3JG 4OWWB 2D0OA 1MBYA 1I4XA 2K5VA 4BBSB 2RHQB 4AYBE 1CKMA 2F4IA 4R9WA 1C7YA 2R93H 3FMCA 4MHEA 4DXGA 3Q22A 3IL8A 4R8IA 2YU9H 3CCQA 1SMXA 1BCPD 2QKIC 1U4RA 1RF2D 2MO1A 5IYBG 4G7OC 4TKOB 1OXUA 4XXEA 1I4QA 3GTGB 1VDZA 1YIJA 4LK1C 3NP8A 4NXNL 1SLJA 4LJZC 4RGOS 4DR7Q 3VR4A 4OHJA 3HOWB 2DNEA 1YVCA 3NQIA 1NY4A 1TS2A 1XPUA 2WV6D 4WJWA 2DGYA 2A6HC 1JE4A 2F0DA 1YITA 2Z6KA 3OWFA 5M5YH 3LNNA 4QMGA 2ZTEA 3WDNA 3A5ZB 3GDEA 3C2PA 1V9PA 4YCVA 4A3GH 3TQYA 3MFYA 1IYUA 5ELCA 4A3EG 4DNIA 1V1PA 5E3FA 4HJ8A 4X3TA 4HIMA 1WVLA 2I5MX 1IKMA 2B2UC 4LFAQ 1C8CA 1F9PA 2QEJC 4MN3A 2O4XA 2JXMB 4Q0FA 1I94Q 4OIJA 4QF4A 2WP8J 1IBLQ 1XNQQ 2LXJA 1ZYRC 4LUOA 4KN7C 3HKSA 2WB1E 1PRTC 4GZYC 2EYHA 3DXJC 2F0GA 4ODGA 4DV7Q 1HNXQ 1A3TA 3KUPA 4BBRG 1HZCA 2F0NA 2V4DA 4C3IG 4XYQA 1A8VA 2WAQG 1I50B 3B6YA 3HOVH 2ICIA 3U9OA 3G4SA 1VQBA 3ULLA 2K1BA 4X3UA 1EZ6A 3H0GB 2DJFC 1TWAB 5C4JB 4C1NK 4JI2L 4F7XA 3CCUA 2G9DA 5AFWA 2CKZB 1GUSA 2F0MA 3KYHC 3H6MA 4IURA 3T1YL 1J5EQ 5EGTA 4IJLA 4A75A 2GN5A 3K7UC 5NUCA 1SJHD 1ZKOA 4DUZQ 2KHIA 2VQEL 1SNOA 2E2JB 3WOEA 1C48A 4DR3L 1RIPA 2AUJD 1VQ8A 2K05A 4AQYQ 4FXDA 3EROA 3VR6A 3T1HQ 4XQNA 2EY5A 2KUMA 1EZ8A 3MVVA 5A35A 4LF4Q 4RMFA 1EFWA 4A3LH 1DXMA 2NVYH 3IFDA 3IKJA 3GTKB 3PUVA 3Q8DA 1MD2D 1IL8A 2VW9A 2EXDA 2L11A 2ALYB 2K01A 3MHBA 1BCPC 4A3IG 2F0IA 2RKSA 2SEBD 4CBVA 5JJZA 4YWLA 2PZWA 3CCLA 1G2TA 1WCMB 4B3ML 1QCBD 5C5MA 4P75A 1LT5D 3EA6A 1JC7A 3BVMA 4PQXA 1RL2A 3J80i 2EYLA 3I4NH 1K0SA 2G5DA 3M4PA 2JA8B 1G6ZA 5BR8L 4R8NA 1AE2A 2B29A 1PFSA 3U58A 2NUCA 2R93G 5EJWA 2VUMB 2F3VA 2RVLA 3NBHA 1P8LA 2L5TA 5I6YA 1PXUA 1ASZA 4LW1A 4C3HH 2YYZA 2CW0D 4WRDA 2L4NA 1XMOQ 3NQTA 2UUBL 4C3IB 4IUQA 1XYIA 3A0JA 3H15A 1F2LA 1KXLA 1TWFB 4A4IA 1EQRA 2EY6A 3HG9A 2HIXA 3JAMi 4QB4A 1PTOD 5IGBA 1K73C 2R3ZA 1HCZA 2NZHA 4LAAA 4JI7Q 3SXHA 3RMHA 2N55A 1LTBD 2OF1A 3MEFA 3M3YB 5LMUQ 2MO0A 4P2CB 3TP5A 1MKHA 1X3FA 3HOXH 3C46A 1A63A 4FXGC 1Y1WB 1QUQA 4JVZA 1B53A 1ICWA 2EY2A 5ELOA 3A5UA 3SK6A 2B2YA 3D31A 1KC8C 1HNZQ 3I2ZA 1NE3A 1ICFB 1WJJA 3IRBA 2UXDL 3Q0AA 1BQQT 5M5XB 1WTVA 4Z9CB 2MFIA 1I4GA 3I4MB 1H9JA 1YHAA 1Z6HA 3Q24A 4KY6A 3HOVG 2E2HB 2GA4B 4GNXC 5K5PA 4GNXA 1VQ9A 1VQNA 3PO2B 4GLXA 3DLLA 2HIVA 3A55A 2ES2A 4A3FH 1JCKB 4OEMB 1E1TA 1QNUA 2ZXPA 1WTWA 1K28A 4BXXG 4A3DG 1E24A 3VA5A 1PH7A 2R93B 2YU9B 1XTCD 1U5KA 1VQ5A 1S40A 1PMRA 4DAVA 1GUWA 3HEJA 1X56A 4C2MH 1WTXA 4JI6L 3R93A 5J22A 2NVTH 1AZPA 2PPBC 3GP7A 3TMEA 1IW7D 2IPKD 4I7AA 4GN5A 1FD7D 3A56A 5FO7B 1ASYA 1A0IA 1HUMA 4A3LG 5GAEC 1GKHA 1I3QH 2Y0SE 1YJWA 5T1IA 4C1NI 2NBFA 3MZ5A 3SGIA 2UUCL 3LX0A 4P71A 4IFDJ 1X3EA 4N9TA 3S17B 4I7ZC 1AW7A 3AEVA 5M5YB 4R4TA 3QWNA 1E2WA 4G7ZC 1YNXA 1JB7A 1PVOA 4DR6L 1STBA 4A3GB 2CW0C 2AQ1B 3KOJA 1XJVA 4IALA 4RCNA 1PDQA 4PMWA 3I4NG 1TVXA 1EOVA 5DNFA 4DU9A 2F0TA 1VQMA 1CKNA 1JR0D 4JOIA 4DV3Q 3E0JA 1K8AC 1CFMA 4M1UB 1TS3A 4JC0A 2NN6G 4ME5A 2I0QA 4A3KG 4X66Q 5ISRA 3SK8A 5GAHC 4K5VA 4KY5A 2QEXA 2QA4A 1TS4A 5CBAE 2CWPA 4HJ5A 2A6EC 4KK7A 4FNFA 3I4OA 1N32Q 1L0WA 4P74A 3TZUA 1CZGA 2AKWB 5M9OA 2HDMA 2X6LA 4DV1L 2IX0A 2MGSA 4LF6L 1A3VA 2FFKB 2IY5B 1QILA 2EJMA 4RA8A 1HJPA 4BY7H 4K5XA 2UUAL 1C0AA 2Q8IB 4TSSA 2AHOB 5C3XA 5JJKA 5JAVA 3QOLA 2NTSA 4HN7A 3VDYA 4YHHL 5G3LD 3RLNA 4CDEC 2AQ2B 5EBDA 2WINB 1LACA 2JP1A 4X62L 2JE6I 2PW7A 4JI0Q 2XWBB 1NAPA 1SEBD 3M9BA 1WD0A 3A54A 1IBKQ 2BDOA 3GTQH 1IBML 3I55A 2EE1A 3HKZB 4O1NA 2ENBA 4JCVE 4G4KA 2BA0A 1YNNC 2OTJA 2A68D 5CV6A 1VQAA 1STYA 1YHQA 2FXQA 5C6AA 3WOFA 1UE6A 1FGBD 1NCVA 4H0LC 3CW2C 5EPJA 2NVYB 4PZ6A 4JI5Q 2B2WC 3SVMA 3S1RH 1EEID 2N88A 2ATWA 5IGCA 1S5ED 3VR5A 2H4OA 1JWMD 2X69A 2YV5A 2Z6BA 4C56C 1RTNA 3D3RA 3KDFB 1DGSA 1KNAA 2K6AA 4GLVB 4IPGA 3W1BA 1R4PB 5JVH3 2UU9Q 1O7ZA 5D65A 3D4WA 3I4NB 2EYFA 4A3CH 5IGFA 2UXBL 4BY1H 2KCMA 4DV0L 1UWVA 4JI7L 2LKVA 4ABNA 1EFID 2NTTA 5ELFA 3MAQA 4LWCA 5EKLA 4KHZA 4EX5A 1UE1A 5JPNC 1NJIC 3TS2A 2YTVA 4NXNQ 3RLFA 4QGUA 3RLOA 4UP8A 4R4QA 2VB2X 1V1PB 1K3RA 2D0PA 2BOSA 2BH2A 2F0WA 1EY5A 4C3HB 1DOLA 1WTOA 4ZK9B 1LLRD 2PI2A 3EQLC 2CVRA 2MHVA 4QCLA 1D5MC 2DJGC 3D4RA 4IUPA 3T53B 1MI2A 3A7LA 5IP9H 5KNCA 2A1AA 1P16A 1F9SA 3IAYA 1W3SA 2MNAA 1V43A 1PRTB 1K8OA 1BNZA 3HOYG 3J80c 4A3JH 4DUYL 2E75C 4S3SA 3S2HB 1WI5A 2PZTA 3LGJA 3M4OH 1QB5D 1NR4A 5TSSA 1NBWA 3H3VI 3HOXB 4KHPL 2NB0A 5I9OA 4TRDA 1LM0A 5C4XH 1Z47A 4DN4M 4B3RL 1Q46A 4F87A 2K50A 1VQ7A 4M8AA 1HA5A 5C3WA 1TIID 1WD1A 3ER0A 3HGBA 1SNCA 3X3MA 3EJIA 4ZQ3A 3RN5A 4JI2Q 3CCRA 3CC7A 1HH2P 4CDDC 3BDLA 4K8IA 3JAMc 4K8JA 4IOAA 2L12A 4XDXA 3T1YQ 1Q12A 5DLQE 5IWAL 1L0XB 4X64L 4GN4B 4BY7G 2CQAA 1FVIA 2VQEQ 1SDFA 4A3FB 4HIOA 1CI3M 5IT9c 4A3EH 4DR3Q 1XPRA 1SNDA 4DAMA 1B7YB 1HZ9A 1F2MA 5ELBA 4QY7A 2K28A 3OW7A 3QG1A 3J81E 4HIDA 1BCPB 4Y52H 3A8KE 2PNRC 4UP9A 5JEAG 2F0SA 4OX9L 4POFA 1PHJA 1LTTD 1STHA 4C2MB 2NVTB 3K0YA 1G8ZD 1S5FD 1MSHA 1LT6D 3I8ZA 4B3SQ 4ZKCB 3CRLC 4BBRH 3V2TA 3GQBA 1LO5D 4GOPC 1VCIA 4DAPA 1FL0A 1IXRA 3L2PA 4GOPA 1H9SA 1DZ1A 3ND8A 2F3IA 1KQSA 3KF8A 4B3MQ 5FLXc 4JBMA 3NBHB 4RKBA 5LHY1 1XNRL 4CGYB 5BR8Q 5C0XJ 4B3TL 1I4PA 1DCZA 1V8QA 2E2IB 3TP7A 2JA5H 1PFNA 3BU2A 2B39A 4J1MA 1GHKA 1PH6A 4OGQC 2F3WA 4A3CG 3PSIA 4BY1G 1AZQA 2MPMA 4JI8L 3DWQA 4HJ7A 3PQIA 4JI0L 3SE0A 1CUKA 3J81L 5C44B 1SNQA 1EUJA 1SYFA 2UUBQ 2Q8RE 1K83H 3M4QA 3C3LA 3HRZC 1S5CD 1IYJB 1E3PA 2R92G 3J7AV 1EEFD 3UDGA 1B3QA 5E4XA 4ZAIA 4A3IH 4IZ8A 2PNHA 4XT1B 3F2CA 3NSWA 4V0BA 1GOZA 1BDOA 3J7ZC 3CMAA 3CXCA 2PMZB 1HPCA 3CC2A 1KNEA 1YEZA 4JI4L 1PZKD 3H94A 4PV1C 3NBIA 1KIXA 1VQOA 2UU9L 3GTQB 3OSOA 1M4VA 2B3GA 3FP9A 4A3MH 4GNXB 5DM73 2WKCA 1BR9A 1QZGA 4F88A 2UXDQ 1HXYD 5C4XG 2B2TC 1Q1EA 3Q23A 3H91A 2B2TA 3S1NH 1QVGA 1G51A 4GKJL 1ENCA 2RF4A 3VR2A 3RNUA 2ASBA 3S1RB 1TWHH 4L5SA 2F0LA 2R7ZG 2Z6KC 3A8IE 2KHJA 3PUWA 1RCVD 2K7VA 1E7ZA 4Y7NB 1K8MA 1Q8IA 4J15A 3KLSX 3GTLH 2EDGA 1EIYB 4CDCC 2H5XA 1Y1VG 3FPUB 3N6RA 3PF5A 1F2YA 3I7FA 2JEBI 3NE5B 3F2BA 1Q7YC 4L63B 3T16A 4JI6Q 2D62A 4H02A 1IKLA 4PZ8A 2Q2HA 1M8AA 4JG2A 2BE5D 1BBWA 1CK1A 4IOCA 3A7AB 3TZDA 4FF1A 1EL0A 5EQ0A 2UUCQ 4R4IA 2A5HA 3PF4A 5C3EG 1ZEQX 1S5BD 4DAYA 4HSVA 5KRUA 1CHPD 3QB3A 3S16B 2SNMA 4B9WA 1A6XA 3TN2A 4UY8C 5K36G 2IW3A 5IY0A 4DR6Q 4KD3A 4Q5VA 1PH5A 1VQHA 2MJ8A 3F2UA 4CKBA 2LY7A 1WTRA 5LMNL 4XQQA 1FYCA 3OHXC 4NMZA 1HZBA 4A3JB 3DUZA 1HUNA 4BXXH 1FNWA 1GHJA 4LFCL 2JA5G 1ONLA 2M2LA 4BS9A 4A3DH 3M4OB 4NPSA 1S3OA 2XVSA 4CJ2C 2XSCA 2J0TD 4FXKC 4KY7A 3UDXA 4AIMA 4HMIA 3FKIH 5EAYA 2RHSB 1LTRD 5C4XB 1SYCA 1HR0L 2NYZD 1VMPA 5DEHA 4DV1Q 1XX8A 4GLAC 4LF6Q 1Z7TA 3NXWA 3DM1A 1II3A 2UUAQ 4BA1I 3OOCA
chains in the Genus database with same CATH topology
5GAEC 1KL9A 2ZTDA 4QL5A 1GKHA 4DAYB 4B3SL 1I3QH 4DR4L 2Y0SE 3KLWA 4JBWA 5GROA 4YHHQ 1YJWA 4XTCS 1VQEA 4MZ9A 3PUXA 3DM3A 1XTDA 4GN3B 3SGIA 4X62Q 2F4VL 2UUCL 4TVAB 4AYBG 3BZCA 4P71A 4IFDJ 1X3EA 4X65L 3GTOH 3S16H 2OWOA 4DV5L 5C0XI 3CC4A 3AEVA 4R4TA 2VNUD 1HNZL 1I50H 3ERSX 1WFQA 1YBYA 1IBMQ 3K0XA 2L15A 3HKZE 1YNXA 2MQHA 1JB7A 2IX1A 1PVOA 4DR6L 1X55A 3H0GH 5C4JH 1TWAH 4GS3A 1O7IA 3KOJA 1XJVA 4POGA 4PMWA 3I4NG 1Z9FA 1EOVA 4IPHA 1GD7A 4DK3C 4YWMA 4A3KH 4A3MG 3L0OA 3H0GG 1KHIA 3NENA 3FHWA 1KRSA 2HQLA 1CKNA 1VQMA 3GO5A 4JOIA 2ZM6Q 4DV3Q 3ULJA 3PIOA 1K8AC 3HOUH 1JE5A 3U4VA 3K8AA 1LUZA 2NN6G 4JC0A 5M5WH 2E2JH 4A3KG 2I0QA 2AWOA 4X66Q 2OTLA 4JI1Q 5GAHC 2VQFQ 1VQ6A 1HZAA 2CWAA 5AJ3Q 1NTGA 1EIFA 1MJCA 2QEXA 3AYHB 3ZJYC 5IYBH 3M7NA 2QA4A 2CWPA 4OXPA 4HJ5A 2HHHL 1D8LA 3PUYA 5C44G 4A93H 3I4OA 1EYGA 1N32Q 1L0WA 2V1CC 4DR2L 2ID0A 4P74A 5C0XG 1FGUA 3PV0A 5H1SE 2ZJPA 1Q81C 2AKWB 4DV1L 2IX0A 4LF6L 2CFMA 3U4ZA 2IY5B 1I6HH 3OYYA 4P72A 4DK6C 3KDFA 4YWKA 2UXBQ 3K81C 3NEMA 1HJPA 4DV0Q 4BY7H 4LF8L 2UUAL 3H3VH 2IT1A 1SE8A 5J3BA 1C0AA 4APVA 4JI3Q 2AHOB 5JJKA 1UE7A 3VDYA 4YHHL 3RLNA 1E1OA 5IYCG 4JV5Q 4X62L 3S17H 2JE6I 1VQLA 4JI0Q 3M9BA 4JBKA 2WB1G 3I56A 1N8RC 1X65A 3OTOQ 4LNQA 1L1OC 1IBKQ 1VQKA 5E7NA 4PG3A 1L1OA 3GTQH 1IBML 3I55A 2JA8H 4L5RC 1WCMG 1VQJA 2VL6A 4JCVE 4LUVA 1IZ6A 3GTPH 2BA0A 1S72A 2OTJA 4NB3A 1VQAA 1CKNB 1YHQA 2FXQA 4QQBX 1FJGQ 3S15H 4JV5L 1K0RA 3STBD 2Q2UA 1JJ2A 2JA8G 1PH9A 1UE6A 1X54A 5GQOA 3HOZH 2VUMH 1T9HA 3PGZA 1JMCA 3S1MH 3CW2C 2ZM6L 4DV3L 2XTIA 1I5FA 3PCOB 4PZ6A 3J7A5 3M85A 1D7QA 4DUYQ 4JI5Q 1PH2A 4X66L 2VUMG 4JI1L 2VQFL 3S1RH 1CSQA 1EQQA 2ATWA 2B63H 5AJ3L 5M3MH 1TWCH 4C3IH 5IP7H 3GTJH 4LF5Q 2YV5A 1TWFH 3J81j 3JC66 4OWXB 1N34L 4L5TA 1N32L 2JA9A 1DGSA 3KDFB 2LXKA 2B63G 4KHPQ 2EQSA 4GLVB 4IPGA 5IP7G 3W1BA 4ME3A 2UU9Q 4JYAQ 3E9HA 3KJOA 2JEAI 4B3RQ 2KBNA 1AH9A 5JJLA 1GO3E 1OXVA 4A3CH 2UXBL 1GM5A 4BY1H 4XIGS 2KCMA 4DV0L 1UWVA 2OQKA 2E5LQ 4JI7L 1G6PA 1A62A 1VQPA 3M3YH 1OTCA 4FDBA 4JI3L 3FKIG 3E9IA 4LWCA 5FLMH 4KHZA 2R7FA 4EX5A 1UE1A 1NJIC 3TS2A 2YTVA 3TRZA 4NXNQ 3RLFA 2OQ0A 3RLOA 3W1GA 4QGUA 3J81c 4DV6Q 4ALPA 1Y1WH 5FLMG 4UP8A 3RR5A 4R4QA 5GADC 1K3RA 2D0PA 4R4OA 4R1JA 1X6OA 3OTOL 3CD6A 1IBKL 5IWAQ 4X64Q 2BH2A 3CPWA 3AQQA 2RCNA 1IL2A 4JBJA 3KF6B 1NMFA 2PI2A 1Y1WG 4WJ4A 4YY3Q 4KLKA 2JK8A 3KFUA 5IP9H 1YI2A 5M5XH 3AFPA 5IYDH 2PQAA 1MJEA 3HOYH 1VQDA 3PO3H 2A1AA 1P16A 4HIKA 2LSSA 3I4MH 1W3SA 2MNAA 1V1QA 1YZ6A 4X6AH 1V43A 1X9NA 5IP9G 2JQOA 2E2HH 4OX9Q 1M90C 3KF8B 2K75A 4C3JH 3HOYG 3J80c 4A3JH 1L2FA 4DUYL 1QVFA 4JI5L 3CCJA 1M1KC 4QIWE 3S24A 3I4MG 4L5QA 2UXCQ 3PO2H 4JOIC 3CPFA 1PYBA 1CKOA 1WI5A 3LGJA 3EN2A 2K5NA 4OWTB 3UDIA 5HGQA 4LF5L 3M4OH 4A3JG 1NBWA 4OWWB 3H3VI 2D0OA 4QJFA 3PO2G 2K5VA 2RHQB 4KHPL 4AYBE 1CKMA 2CCZA 1PH8A 4JYAL 4DV4Q 2R6GA 3HOUG 1LM0A 1C7YA 2ZJQA 1XMQL 5C4XH 1Z47A 4P73A 3S2DH 1Q46A 4B3RL 2R93H 2YU9H 3CCQA 4DR1Q 1SMXA 4LUZA 5GAGC 1HNWQ 2K50A 1VQ7A 5IYBG 2MO1A 3S1QH 2Q2TA 2E5LL 1XNRQ 3G71A 1Y14B 1OXUA 1K8GA 4A93G 3ER0A 1YIJA 4B3TQ 2NVQH 2ZTCA 3W5OA 3RN5A 4JI2Q 3CCRA 4NXNL 1HH2P 1SLJA 3CC7A 4DV6L 3UE1A 4OONA 3U50C 3JAMc 4IOAA 4DR7Q 3K7AH 3T1YQ 4IFDI 1Q12A 1YVCA 5DLQE 1NY4A 5IWAL 4X64L 2A8VA 4GN4B 3G6EA 4JI8Q 2JA6H 1XPUA 4BY7G 2PQAB 2DGYA 1FVIA 2VQEQ 3F1ZA 2Z6KA 5M5YH 1YITA 1SFOH 4YY3L 4HIOA 2ZTEA 5IT9c 3A5ZB 1GVPA 4IPDA 4DR3Q 4A3EH 1XPRA 4NXMQ 4DAMA 1N9WA 2JA6G 3GDEA 1B7YB 1V9PA 1HZ9A 4YCVA 4QY7A 4A3GH 3TQYA 1LTLA 4HIDA 4Y52H 4A3EG 1Q86C 2GVBA 4DNIA 4UP9A 4HJ8A 4LF9Q 1Q82C 5JEAG 1PH1A 4HIMA 4OX9L 1KAWA 2IHFA 3NELA 4POFA 2I5MX 1PHJA 1UEBA 4A3GG 3ULPA 3KF6A 1SRUA 2VY3A 2ZJRA 3S2HH 3E0EA 5FJ8H 2UXCL 5M3FH 1N33Q 4LFAQ 1OXTA 1XMQQ 1I94Q 3MXNB 4BBSH 4UP7A 3K80C 2WP8J 4B3SQ 2AWNA 3HOZG 1JT8A 1IBLQ 1XNQQ 2LXJA 4BBRH 4LUOA 1C9OA 3OW2A 4GKKQ 4IFDG 4GOPC 1BVSA 2KENA 3HKSA 1VCIA 2WB1E 1FL0A 1IXRA 3L2PA 4GOPA 2PMZE 4DV4L 4DV7Q 1HNXQ 2F3IA 3EIVA 4BBRG 1KQSA 4JI4Q 1HZCA 1BBUA 4B3MQ 1HNWL 5FLXc 4DR1L 4JBMA 1JJGA 3NBHB 4O0AA 2GVAA 1KD1C 2HT1A 1U0LA 2I5HA 3L7ZC 5M3MG 3GTGH 1A8VA 2WAQG 1XNRL 3B6YA 3HOVH 3A74A 3G4SA 4IPCA 1VQBA 5BR8Q 5C0XJ 4B3TL 3ULLA 2JA5H 1LYLA 4JI2L 4A3BH 3EBEA 3CCUA 3HOWH 3BU2A 1YHBA 2K14A 4DR7L 2CKZB 3KYHC 4IO9A 3T1YL 1PH6A 3CAMA 4A3CG 3PSIA 1J5EQ 2VZAA 4IJLA 4A75A 1NMGA 3G48A 2GN5A 3K7UC 4BY1G 4JI8L 2Y0SG 3CP0A 1PA6A 4HJ7A 4DUZQ 2KHIA 2VQEL 1WOCA 4JI0L 4GKJQ 1PH3A 1CUKA 2C35B 4NXML 4DR3L 1EUJA 1RIPA 3GD7A 1VQ8A 2UUBQ 1X3GA 2R92H 4AQYQ 1K83H 4LFBQ 3M4QA 1TWGH 1MIUA 5LMNW 2NVXH 3T1HQ 3HKZG 3TEHB 4KI0A 4LF9L 1IYJB 1R9TH 1E3PA 2R92G 1FJGL 1YJ9A 4LF4Q 4RMFA 3CCMA 1EFWA 4A3LH 3UDGA 5IE8A 2XGTA 1E22A 2NVYH 4EQ5A 1N33L 3PUVA 3Q8DA 4A3IH 4LFAL 4GOPB 2PNHA 1I94L 2VW9A 3F2CA 2EXDA 4YCUA 4A76A 1VQCA 2ALYB 4IJHA 5IYDG 3WWVA 3PO3G 1IBLL 1BKBA 1XNQL 3J7ZC 4A3IG 3CMAA 4GKKL 4OO1I 1Q1BA 3CXCA 5HY6A 3RN2A 4LF7Q 2JA7H 2R7DA 4YWLA 3CCLA 1HR0W 3CC2A 4DV7L 4DV2Q 1HNXL 1YEZA 4JI4L 2I5LX 4B3ML 4P75A 1PV4A 2JA7G 1KIXA 4MNOA 1VQOA 3CMEA 1RL2A 2UU9L 3J80i 3I4NH 2B3GA 3M4PA 3FP9A 1H95A 4A3MH 2E2IH 4GNXB 5BR8L 2Q2IA 1YJNA 1AE2A 2B29A 3RZDH 1PFSA 1VS0A 3U58A 1TXYA 1JJCB 2IHEA 4DR5Q 1QZGA 1XPOA 3RZOH 2UXDQ 2R93G 2K4KA 5C4XG 1Q1EA 3D0FA 1SR3A 2E8GA 2N49A 1J5EL 3F8TA 3S1NH 1OXSC 1P8LA 1K9MC 2N3SA 3PUZA 1QVGA 1G51A 5C44H 5LMNQ 4DUZL 2R7ZH 4GKJL 2RF4A 1VQIA 1W2BA 1QZHA 3CQZH 1ASZA 4LW1A 4C3HH 2NZOA 2YYZA 3UE0A 3RNUA 2N78A 2ASBA 4HJ9A 1KRTA 2K52A 1XMOQ 4K0KQ 1TWHH 3STBC 4AH6A 4LFCQ 2UUBL 2BH8A 4L5SA 1N34Q 4AQYL 2Z0SA 3A0JA 3H15A 2R7ZG 2Z6KC 4LFBL 1KXLA 4A4IA 2KHJA 3AFQA 4HJAA 4TQUS 3PUWA 3T1HL 1E7ZA 1Y1VH 2QGQA 1EQRA 1AE3A 4DKAC 1PH4A 4J15A 4LF4L 2HIXA 3JAMi 1QVCA 3GTKH 3S14H 2JJQA 3BZKA 1K73C 3GTLH 1EIYB 2H5XA 1Y1VG 2NZHA 3HFZB 3ICEA 1HR0Q 4JI7Q 2AMCB 5IYCH 3KJPA 3PF5A 1N36Q 3I7FA 2JEBI 3MEFA 3F2BA 3CCVA 1Q7YC 4JI6Q 1VQFA 2D62A 4H02A 4PZ8A 2Q2HA 4JG2A 5JJIA 5LMUQ 1BBWA 2MO0A 4LF7L 1WCMH 1OXXK 4DPGA 4IOCA 1MKHA 1X3FA 3HOXH 4DV2L 4BA2I 1A63A 4DR4Q 3TS0A 1QUQA 5FJ8G 5C3EH 5M3FG 2F4VQ 4WJ3M 2UUCQ 4R4IA 3HOXG 4BBSG 1SN8A 5ELOA 3PF4A 3A5UA 5C3EG 4X65Q 4DV5Q 4PZ7A 2F52A 3D31A 1KC8C 1HNZQ 3I2ZA 1VQ4A 4DR5L 1NE3A 1WJJA 3IRBA 4UY8C 1G291 2UXDL 5K36G 5IY0A 4DR6Q 4YCWA 1EWIA 4R4CA 2MFIA 5ELNA 1SROA 1PH5A 1VQHA 3CCSA 1WYDA 1YHAA 1UE5A 4OO1G 3CCEA 5LMNL 3HOVG 2A19A 2DUDA 4GNXC 1HZBA 4GNXA 3BJUA 1VQ9A 1VQNA 1XMOL 4BXXH 2JA5G 4LFCL 4GLXA 3DLLA 4K0KL 2KCTA 2HIVA 4A3BG 4A3DH 2ES2A 1CSPA 3F2DA 4NPSA 3HOWG 4A3FH 2OCEA 1E1TA 4Y7NH 1S3OA 4BXXG 1PYSB 3UDXA 4AIMA 4A3DG 1E24A 2HHHQ 3GTMH 4A3FG 3FKIH 4MTNA 2RHSB 5EAYA 3TREA 3UDFA 1J6QA 2YTXA 4DR2Q 2N8NA 2VS1A 2WAQE 1PH7A 1Q8KA 2CQOA 1HR0L 1B8AA 2K5HA 1VQ5A 1U5KA 4UPAA 1S40A 3CF5A 1N36L 1X56A 2YTYA 3J81i 4DV1Q 4GLAC 4C2MH 4JI6L 4LF6Q 4RG1A 1QUQB 2NVTH 4O2DA 1L1OB 2BA1A 1B70B 5JEAJ 1VQGA 2EIFA 5LMUL 4GN5A 2PI2E 2WFWA 1ASYA 2UUAQ 4LF8Q 4BA1I 1A0IA 4A3LG 2NN6I 3PIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAE C;  1KL9 A;  2ZTD A;  4QL5 A;  1GKH A;  4DAY B;  4B3S L;  1I3Q H;  4DR4 L;  2Y0S E;  3KLW A;  4JBW A;  5GRO A;  4YHH Q;  1YJW A;  4XTC S;  1VQE A;  4MZ9 A;  3PUX A;  3DM3 A;  1XTD A;  4GN3 B;  3SGI A;  4X62 Q;  2F4V L;  2UUC L;  4TVA B;  4AYB G;  3BZC A;  4P71 A;  4IFD J;  1X3E A;  4X65 L;  3GTO H;  3S16 H;  2OWO A;  4DV5 L;  5C0X I;  3CC4 A;  3AEV A;  4R4T A;  2VNU D;  1HNZ L;  1I50 H;  3ERS X;  1WFQ A;  1YBY A;  1IBM Q;  3K0X A;  2L15 A;  3HKZ E;  1YNX A;  2MQH A;  1JB7 A;  2IX1 A;  1PVO A;  4DR6 L;  1X55 A;  3H0G H;  5C4J H;  1TWA H;  4GS3 A;  1O7I A;  3KOJ A;  1XJV A;  4POG A;  4PMW A;  3I4N G;  1Z9F A;  1EOV A;  4IPH A;  1GD7 A;  4DK3 C;  4YWM A;  4A3K H;  4A3M G;  3L0O A;  3H0G G;  1KHI A;  3NEN A;  3FHW A;  1KRS A;  2HQL A;  1CKN A;  1VQM A;  3GO5 A;  4JOI A;  2ZM6 Q;  4DV3 Q;  3ULJ A;  3PIO A;  1K8A C;  3HOU H;  1JE5 A;  3U4V A;  3K8A A;  1LUZ A;  2NN6 G;  4JC0 A;  5M5W H;  2E2J H;  4A3K G;  2I0Q A;  2AWO A;  4X66 Q;  2OTL A;  4JI1 Q;  5GAH C;  2VQF Q;  1VQ6 A;  1HZA A;  2CWA A;  5AJ3 Q;  1NTG A;  1EIF A;  1MJC A;  2QEX A;  3AYH B;  3ZJY C;  5IYB H;  3M7N A;  2QA4 A;  2CWP A;  4OXP A;  4HJ5 A;  2HHH L;  1D8L A;  3PUY A;  5C44 G;  4A93 H;  3I4O A;  1EYG A;  1N32 Q;  1L0W A;  2V1C C;  4DR2 L;  2ID0 A;  4P74 A;  5C0X G;  1FGU A;  3PV0 A;  5H1S E;  2ZJP A;  1Q81 C;  2AKW B;  4DV1 L;  2IX0 A;  4LF6 L;  2CFM A;  3U4Z A;  2IY5 B;  1I6H H;  3OYY A;  4P72 A;  4DK6 C;  3KDF A;  4YWK A;  2UXB Q;  3K81 C;  3NEM A;  1HJP A;  4DV0 Q;  4BY7 H;  4LF8 L;  2UUA L;  3H3V H;  2IT1 A;  1SE8 A;  5J3B A;  1C0A A;  4APV A;  4JI3 Q;  2AHO B;  5JJK A;  1UE7 A;  3VDY A;  4YHH L;  3RLN A;  1E1O A;  5IYC G;  4JV5 Q;  4X62 L;  3S17 H;  2JE6 I;  1VQL A;  4JI0 Q;  3M9B A;  4JBK A;  2WB1 G;  3I56 A;  1N8R C;  1X65 A;  3OTO Q;  4LNQ A;  1L1O C;  1IBK Q;  1VQK A;  5E7N A;  4PG3 A;  1L1O A;  3GTQ H;  1IBM L;  3I55 A;  2JA8 H;  4L5R C;  1WCM G;  1VQJ A;  2VL6 A;  4JCV E;  4LUV A;  1IZ6 A;  3GTP H;  2BA0 A;  1S72 A;  2OTJ A;  4NB3 A;  1VQA A;  1CKN B;  1YHQ A;  2FXQ A;  4QQB X;  1FJG Q;  3S15 H;  4JV5 L;  1K0R A;  3STB D;  2Q2U A;  1JJ2 A;  2JA8 G;  1PH9 A;  1UE6 A;  1X54 A;  5GQO A;  3HOZ H;  2VUM H;  1T9H A;  3PGZ A;  1JMC A;  3S1M H;  3CW2 C;  2ZM6 L;  4DV3 L;  2XTI A;  1I5F A;  3PCO B;  4PZ6 A;  3J7A 5;  3M85 A;  1D7Q A;  4DUY Q;  4JI5 Q;  1PH2 A;  4X66 L;  2VUM G;  4JI1 L;  2VQF L;  3S1R H;  1CSQ A;  1EQQ A;  2ATW A;  2B63 H;  5AJ3 L;  5M3M H;  1TWC H;  4C3I H;  5IP7 H;  3GTJ H;  4LF5 Q;  2YV5 A;  1TWF H;  3J81 j;  3JC6 6;  4OWX B;  1N34 L;  4L5T A;  1N32 L;  2JA9 A;  1DGS A;  3KDF B;  2LXK A;  2B63 G;  4KHP Q;  2EQS A;  4GLV B;  4IPG A;  5IP7 G;  3W1B A;  4ME3 A;  2UU9 Q;  4JYA Q;  3E9H A;  3KJO A;  2JEA I;  4B3R Q;  2KBN A;  1AH9 A;  5JJL A;  1GO3 E;  1OXV A;  4A3C H;  2UXB L;  1GM5 A;  4BY1 H;  4XIG S;  2KCM A;  4DV0 L;  1UWV A;  2OQK A;  2E5L Q;  4JI7 L;  1G6P A;  1A62 A;  1VQP A;  3M3Y H;  1OTC A;  4FDB A;  4JI3 L;  3FKI G;  3E9I A;  4LWC A;  5FLM H;  4KHZ A;  2R7F A;  4EX5 A;  1UE1 A;  1NJI C;  3TS2 A;  2YTV A;  3TRZ A;  4NXN Q;  3RLF A;  2OQ0 A;  3RLO A;  3W1G A;  4QGU A;  3J81 c;  4DV6 Q;  4ALP A;  1Y1W H;  5FLM G;  4UP8 A;  3RR5 A;  4R4Q A;  5GAD C;  1K3R A;  2D0P A;  4R4O A;  4R1J A;  1X6O A;  3OTO L;  3CD6 A;  1IBK L;  5IWA Q;  4X64 Q;  2BH2 A;  3CPW A;  3AQQ A;  2RCN A;  1IL2 A;  4JBJ A;  3KF6 B;  1NMF A;  2PI2 A;  1Y1W G;  4WJ4 A;  4YY3 Q;  4KLK A;  2JK8 A;  3KFU A;  5IP9 H;  1YI2 A;  5M5X H;  3AFP A;  5IYD H;  2PQA A;  1MJE A;  3HOY H;  1VQD A;  3PO3 H;  2A1A A;  1P16 A;  4HIK A;  2LSS A;  3I4M H;  1W3S A;  2MNA A;  1V1Q A;  1YZ6 A;  4X6A H;  1V43 A;  1X9N A;  5IP9 G;  2JQO A;  2E2H H;  4OX9 Q;  1M90 C;  3KF8 B;  2K75 A;  4C3J H;  3HOY G;  3J80 c;  4A3J H;  1L2F A;  4DUY L;  1QVF A;  4JI5 L;  3CCJ A;  1M1K C;  4QIW E;  3S24 A;  3I4M G;  4L5Q A;  2UXC Q;  3PO2 H;  4JOI C;  3CPF A;  1PYB A;  1CKO A;  1WI5 A;  3LGJ A;  3EN2 A;  2K5N A;  4OWT B;  3UDI A;  5HGQ A;  4LF5 L;  3M4O H;  4A3J G;  1NBW A;  4OWW B;  3H3V I;  2D0O A;  4QJF A;  3PO2 G;  2K5V A;  2RHQ B;  4KHP L;  4AYB E;  1CKM A;  2CCZ A;  1PH8 A;  4JYA L;  4DV4 Q;  2R6G A;  3HOU G;  1LM0 A;  1C7Y A;  2ZJQ A;  1XMQ L;  5C4X H;  1Z47 A;  4P73 A;  3S2D H;  1Q46 A;  4B3R L;  2R93 H;  2YU9 H;  3CCQ A;  4DR1 Q;  1SMX A;  4LUZ A;  5GAG C;  1HNW Q;  2K50 A;  1VQ7 A;  5IYB G;  2MO1 A;  3S1Q H;  2Q2T A;  2E5L L;  1XNR Q;  3G71 A;  1Y14 B;  1OXU A;  1K8G A;  4A93 G;  3ER0 A;  1YIJ A;  4B3T Q;  2NVQ H;  2ZTC A;  3W5O A;  3RN5 A;  4JI2 Q;  3CCR A;  4NXN L;  1HH2 P;  1SLJ A;  3CC7 A;  4DV6 L;  3UE1 A;  4OON A;  3U50 C;  3JAM c;  4IOA A;  4DR7 Q;  3K7A H;  3T1Y Q;  4IFD I;  1Q12 A;  1YVC A;  5DLQ E;  1NY4 A;  5IWA L;  4X64 L;  2A8V A;  4GN4 B;  3G6E A;  4JI8 Q;  2JA6 H;  1XPU A;  4BY7 G;  2PQA B;  2DGY A;  1FVI A;  2VQE Q;  3F1Z A;  2Z6K A;  5M5Y H;  1YIT A;  1SFO H;  4YY3 L;  4HIO A;  2ZTE A;  5IT9 c;  3A5Z B;  1GVP A;  4IPD A;  4DR3 Q;  4A3E H;  1XPR A;  4NXM Q;  4DAM A;  1N9W A;  2JA6 G;  3GDE A;  1B7Y B;  1V9P A;  1HZ9 A;  4YCV A;  4QY7 A;  4A3G H;  3TQY A;  1LTL A;  4HID A;  4Y52 H;  4A3E G;  1Q86 C;  2GVB A;  4DNI A;  4UP9 A;  4HJ8 A;  4LF9 Q;  1Q82 C;  5JEA G;  1PH1 A;  4HIM A;  4OX9 L;  1KAW A;  2IHF A;  3NEL A;  4POF A;  2I5M X;  1PHJ A;  1UEB A;  4A3G G;  3ULP A;  3KF6 A;  1SRU A;  2VY3 A;  2ZJR A;  3S2H H;  3E0E A;  5FJ8 H;  2UXC L;  5M3F H;  1N33 Q;  4LFA Q;  1OXT A;  1XMQ Q;  1I94 Q;  3MXN B;  4BBS H;  4UP7 A;  3K80 C;  2WP8 J;  4B3S Q;  2AWN A;  3HOZ G;  1JT8 A;  1IBL Q;  1XNQ Q;  2LXJ A;  4BBR H;  4LUO A;  1C9O A;  3OW2 A;  4GKK Q;  4IFD G;  4GOP C;  1BVS A;  2KEN A;  3HKS A;  1VCI A;  2WB1 E;  1FL0 A;  1IXR A;  3L2P A;  4GOP A;  2PMZ E;  4DV4 L;  4DV7 Q;  1HNX Q;  2F3I A;  3EIV A;  4BBR G;  1KQS A;  4JI4 Q;  1HZC A;  1BBU A;  4B3M Q;  1HNW L;  5FLX c;  4DR1 L;  4JBM A;  1JJG A;  3NBH B;  4O0A A;  2GVA A;  1KD1 C;  2HT1 A;  1U0L A;  2I5H A;  3L7Z C;  5M3M G;  3GTG H;  1A8V A;  2WAQ G;  1XNR L;  3B6Y A;  3HOV H;  3A74 A;  3G4S A;  4IPC A;  1VQB A;  5BR8 Q;  5C0X J;  4B3T L;  3ULL A;  2JA5 H;  1LYL A;  4JI2 L;  4A3B H;  3EBE A;  3CCU A;  3HOW H;  3BU2 A;  1YHB A;  2K14 A;  4DR7 L;  2CKZ B;  3KYH C;  4IO9 A;  3T1Y L;  1PH6 A;  3CAM A;  4A3C G;  3PSI A;  1J5E Q;  2VZA A;  4IJL A;  4A75 A;  1NMG A;  3G48 A;  2GN5 A;  3K7U C;  4BY1 G;  4JI8 L;  2Y0S G;  3CP0 A;  1PA6 A;  4HJ7 A;  4DUZ Q;  2KHI A;  2VQE L;  1WOC A;  4JI0 L;  4GKJ Q;  1PH3 A;  1CUK A;  2C35 B;  4NXM L;  4DR3 L;  1EUJ A;  1RIP A;  3GD7 A;  1VQ8 A;  2UUB Q;  1X3G A;  2R92 H;  4AQY Q;  1K83 H;  4LFB Q;  3M4Q A;  1TWG H;  1MIU A;  5LMN W;  2NVX H;  3T1H Q;  3HKZ G;  3TEH B;  4KI0 A;  4LF9 L;  1IYJ B;  1R9T H;  1E3P A;  2R92 G;  1FJG L;  1YJ9 A;  4LF4 Q;  4RMF A;  3CCM A;  1EFW A;  4A3L H;  3UDG A;  5IE8 A;  2XGT A;  1E22 A;  2NVY H;  4EQ5 A;  1N33 L;  3PUV A;  3Q8D A;  4A3I H;  4LFA L;  4GOP B;  2PNH A;  1I94 L;  2VW9 A;  3F2C A;  2EXD A;  4YCU A;  4A76 A;  1VQC A;  2ALY B;  4IJH A;  5IYD G;  3WWV A;  3PO3 G;  1IBL L;  1BKB A;  1XNQ L;  3J7Z C;  4A3I G;  3CMA A;  4GKK L;  4OO1 I;  1Q1B A;  3CXC A;  5HY6 A;  3RN2 A;  4LF7 Q;  2JA7 H;  2R7D A;  4YWL A;  3CCL A;  1HR0 W;  3CC2 A;  4DV7 L;  4DV2 Q;  1HNX L;  1YEZ A;  4JI4 L;  2I5L X;  4B3M L;  4P75 A;  1PV4 A;  2JA7 G;  1KIX A;  4MNO A;  1VQO A;  3CME A;  1RL2 A;  2UU9 L;  3J80 i;  3I4N H;  2B3G A;  3M4P A;  3FP9 A;  1H95 A;  4A3M H;  2E2I H;  4GNX B;  5BR8 L;  2Q2I A;  1YJN A;  1AE2 A;  2B29 A;  3RZD H;  1PFS A;  1VS0 A;  3U58 A;  1TXY A;  1JJC B;  2IHE A;  4DR5 Q;  1QZG A;  1XPO A;  3RZO H;  2UXD Q;  2R93 G;  2K4K A;  5C4X G;  1Q1E A;  3D0F A;  1SR3 A;  2E8G A;  2N49 A;  1J5E L;  3F8T A;  3S1N H;  1OXS C;  1P8L A;  1K9M C;  2N3S A;  3PUZ A;  1QVG A;  1G51 A;  5C44 H;  5LMN Q;  4DUZ L;  2R7Z H;  4GKJ L;  2RF4 A;  1VQI A;  1W2B A;  1QZH A;  3CQZ H;  1ASZ A;  4LW1 A;  4C3H H;  2NZO A;  2YYZ A;  3UE0 A;  3RNU A;  2N78 A;  2ASB A;  4HJ9 A;  1KRT A;  2K52 A;  1XMO Q;  4K0K Q;  1TWH H;  3STB C;  4AH6 A;  4LFC Q;  2UUB L;  2BH8 A;  4L5S A;  1N34 Q;  4AQY L;  2Z0S A;  3A0J A;  3H15 A;  2R7Z G;  2Z6K C;  4LFB L;  1KXL A;  4A4I A;  2KHJ A;  3AFQ A;  4HJA A;  4TQU S;  3PUW A;  3T1H L;  1E7Z A;  1Y1V H;  2QGQ A;  1EQR A;  1AE3 A;  4DKA C;  1PH4 A;  4J15 A;  4LF4 L;  2HIX A;  3JAM i;  1QVC A;  3GTK H;  3S14 H;  2JJQ A;  3BZK A;  1K73 C;  3GTL H;  1EIY B;  2H5X A;  1Y1V G;  2NZH A;  3HFZ B;  3ICE A;  1HR0 Q;  4JI7 Q;  2AMC B;  5IYC H;  3KJP A;  3PF5 A;  1N36 Q;  3I7F A;  2JEB I;  3MEF A;  3F2B A;  3CCV A;  1Q7Y C;  4JI6 Q;  1VQF A;  2D62 A;  4H02 A;  4PZ8 A;  2Q2H A;  4JG2 A;  5JJI A;  5LMU Q;  1BBW A;  2MO0 A;  4LF7 L;  1WCM H;  1OXX K;  4DPG A;  4IOC A;  1MKH A;  1X3F A;  3HOX H;  4DV2 L;  4BA2 I;  1A63 A;  4DR4 Q;  3TS0 A;  1QUQ A;  5FJ8 G;  5C3E H;  5M3F G;  2F4V Q;  4WJ3 M;  2UUC Q;  4R4I A;  3HOX G;  4BBS G;  1SN8 A;  5ELO A;  3PF4 A;  3A5U A;  5C3E G;  4X65 Q;  4DV5 Q;  4PZ7 A;  2F52 A;  3D31 A;  1KC8 C;  1HNZ Q;  3I2Z A;  1VQ4 A;  4DR5 L;  1NE3 A;  1WJJ A;  3IRB A;  4UY8 C;  1G29 1;  2UXD L;  5K36 G;  5IY0 A;  4DR6 Q;  4YCW A;  1EWI A;  4R4C A;  2MFI A;  5ELN A;  1SRO A;  1PH5 A;  1VQH A;  3CCS A;  1WYD A;  1YHA A;  1UE5 A;  4OO1 G;  3CCE A;  5LMN L;  3HOV G;  2A19 A;  2DUD A;  4GNX C;  1HZB A;  4GNX A;  3BJU A;  1VQ9 A;  1VQN A;  1XMO L;  4BXX H;  2JA5 G;  4LFC L;  4GLX A;  3DLL A;  4K0K L;  2KCT A;  2HIV A;  4A3B G;  4A3D H;  2ES2 A;  1CSP A;  3F2D A;  4NPS A;  3HOW G;  4A3F H;  2OCE A;  1E1T A;  4Y7N H;  1S3O A;  4BXX G;  1PYS B;  3UDX A;  4AIM A;  4A3D G;  1E24 A;  2HHH Q;  3GTM H;  4A3F G;  3FKI H;  4MTN A;  2RHS B;  5EAY A;  3TRE A;  3UDF A;  1J6Q A;  2YTX A;  4DR2 Q;  2N8N A;  2VS1 A;  2WAQ E;  1PH7 A;  1Q8K A;  2CQO A;  1HR0 L;  1B8A A;  2K5H A;  1VQ5 A;  1U5K A;  4UPA A;  1S40 A;  3CF5 A;  1N36 L;  1X56 A;  2YTY A;  3J81 i;  4DV1 Q;  4GLA C;  4C2M H;  4JI6 L;  4LF6 Q;  4RG1 A;  1QUQ B;  2NVT H;  4O2D A;  1L1O B;  2BA1 A;  1B70 B;  5JEA J;  1VQG A;  2EIF A;  5LMU L;  4GN5 A;  2PI2 E;  2WFW A;  1ASY A;  2UUA Q;  4LF8 Q;  4BA1 I;  1A0I A;  4A3L G;  2NN6 I;  3PIP A; 
#chains in the Genus database with same CATH topology
 4RFB A;  2ZTD A;  5EPK A;  4B3S L;  4DR4 L;  5J39 A;  4YHH Q;  3VYR A;  1VQE A;  3DM3 A;  1XTD A;  1SNP A;  3R2I A;  4X62 Q;  2F4V L;  4AYB G;  5JVG 3;  1PYW D;  4X65 L;  1UNS A;  5C5L A;  3GTO H;  4DV5 L;  3CC4 A;  1RTO A;  2LS0 1;  1WFQ A;  4A3E B;  4RH6 A;  1IBM Q;  3FEW X;  3K0X A;  4ID6 A;  3HKZ E;  4QUF A;  1JWS D;  1X55 A;  5D3I B;  4GS3 A;  3FRP B;  3L9A X;  1Z9F A;  1A15 A;  2NN6 H;  4DK3 C;  4A3K H;  4A3M G;  4RKL A;  1KHI A;  3FHW A;  1CA5 A;  3TSS A;  1EY0 A;  3K5L A;  3ULJ A;  3HP3 A;  4HSP A;  2WII B;  3NTH A;  5M5W H;  3K5N A;  2AWO A;  5CR3 A;  2A69 D;  4QUC A;  1X32 A;  4FYD A;  1SYG A;  1VQ6 A;  4BBR B;  1EIF A;  1MJC A;  3T4A C;  2EVB A;  2F0J A;  3DEO A;  4OXP A;  2HHH L;  1SBB B;  3PUY A;  4A93 H;  2QIL A;  2WAQ B;  3OMC A;  5CV8 A;  4DR2 L;  2BE5 C;  1FGU A;  4NP5 A;  2CFM A;  1I6H H;  3OYY A;  4P72 A;  5KGU A;  4YWK A;  4ZCK A;  2UXB Q;  2DY8 A;  4DV0 Q;  2EJG C;  4LF8 L;  2F0H A;  5J3B A;  2JA5 B;  2ZXO A;  3E6Z X;  4RGM A;  1UE7 A;  3SDZ A;  4ULL A;  2WB1 G;  3D6C A;  5KEE A;  4LNQ A;  3C1F A;  1VQK A;  2E76 C;  4L5R C;  5HGT A;  2A73 B;  2H1E A;  3GTP H;  1K83 B;  2B2Y C;  3QIA A;  4QQB X;  3STB D;  1SXT A;  3VYU A;  4JK1 C;  3HOZ H;  5FO8 B;  1EY6 A;  1IHZ A;  1T9H A;  3PGZ A;  3S1M H;  1B9M A;  1EY8 A;  4K2K A;  2ZM6 L;  4A3I B;  5IGD A;  4DUY Q;  2VQF L;  1K3B C;  5AJ3 L;  5M3M H;  2CH4 A;  1TWC H;  1WTQ A;  1BF4 A;  3JC6 6;  4OWX B;  2LXK A;  2B63 G;  3UI2 A;  4KHP Q;  1DD2 A;  5IP7 G;  4ME3 A;  3E9H A;  2JEA I;  4B3R Q;  4RAU C;  3SK4 A;  1AH9 A;  1GJX A;  1GM5 A;  1TR5 A;  4XIG S;  4CKE A;  3GV3 A;  1A62 A;  4FDB A;  3FKI G;  4EVO A;  1JWU D;  2QF7 A;  1DOM A;  1WTP A;  3KK7 A;  1E2V A;  1HFG A;  3PIO 3;  4ALP A;  5FLM G;  3RR5 A;  2QCP X;  1PZI D;  4R1J A;  5DM6 3;  4R4O A;  3OTO L;  4RWS C;  5IWA Q;  4X64 Q;  3AQQ A;  1IL2 A;  4JBJ A;  1TWH B;  1QWY A;  2M00 A;  2JK8 A;  1TQO A;  1L0Y B;  3AFP A;  5IYD H;  1MGS A;  2FMC A;  1EOT A;  3HOY H;  3PO3 H;  3DWP A;  2LSS A;  3GTL B;  3K57 A;  3GV6 A;  1C4Q A;  4X6A H;  1X9N A;  4OX9 Q;  2FMM A;  2PCF B;  3KF8 B;  4C3J H;  1L2F A;  1QVF A;  4L5Q A;  4JOI C;  2Z4H A;  1PYB A;  1CKO A;  3UDI A;  4LF5 L;  5J1Z A;  1A2U A;  1PTO C;  4QJF A;  4UDU C;  4KJN A;  5IIF A;  4JYA L;  2R6G A;  3S2D H;  1LV9 A;  4LUZ A;  5GAG C;  1RHP A;  2E5L L;  2RDG A;  1XNR Q;  1Y14 B;  1K8G A;  4A93 G;  2CHB D;  4DK0 A;  4B3T Q;  2BDN A;  2NVQ H;  1KAA A;  3HOV B;  2SNS A;  2ZTC A;  3W5O A;  3UE1 A;  1GUN A;  2HCC A;  4OON A;  4CJ1 B;  1W6K A;  2A8V A;  3V96 A;  2LFN A;  4JI8 Q;  1EYD A;  2PQA B;  3MFG A;  4A3D B;  2QDB A;  1SFO H;  5KYI A;  1GVP A;  4IPD A;  1G91 A;  1SMY D;  2JA6 G;  5JEA H;  5L37 A;  4KN4 C;  1LTL A;  3TP8 A;  3FKI B;  2OXP A;  2F0U A;  1PH1 A;  2IHF A;  3NEL A;  1U9R A;  3KF6 A;  1MHW C;  2ZJR A;  2NZ1 D;  5FJ8 H;  5CBE E;  4NKL A;  3DWA A;  4BBS H;  4UP7 A;  3K80 C;  2AWN A;  3HOZ G;  1ZXT A;  4IFD G;  3OW2 A;  1C9O A;  1BVS A;  2KEN A;  1KTK A;  5F2D A;  2PMZ E;  4DV4 L;  4U68 A;  2HCI A;  2RQX A;  3EIV A;  4JI4 Q;  1BBU A;  1HNW L;  4DR1 L;  1JJG A;  4O0A A;  2GVA A;  3GTO B;  1U0L A;  2B8G A;  2I5H A;  5ELE A;  2RSO A;  5IGG A;  5M3M G;  1IW7 C;  3FVQ A;  3GTG H;  1ET6 A;  3A74 A;  4IPC A;  2KJX A;  4WOR A;  1Y8O B;  5I9P A;  3EBE A;  3HOW H;  3I70 A;  1AFP A;  1YHB A;  2K14 A;  3CKI B;  3VR3 A;  4A3K B;  2HUG A;  3G48 A;  2OEO A;  2NN6 I;  4OIK A;  2Y0S G;  1PA6 A;  5JOB A;  1WOC A;  4GKJ Q;  5M5W B;  2R61 A;  3NWS A;  2C35 B;  4RGT A;  4NXM L;  2EXZ A;  3GD7 A;  2SOB A;  1X3G A;  1EY4 A;  3OMG A;  2R92 H;  1TWG H;  1MIU A;  4A93 B;  3W3A A;  2NVX H;  3P20 A;  4KI0 A;  4LF9 L;  3K59 A;  1PTO H;  1YJ9 A;  2Z1C A;  2VXW A;  5IE8 A;  3R2T A;  3SHL A;  4EQ5 A;  1JOQ A;  2EJF C;  1N33 L;  2JYO A;  1I6H B;  3I3C A;  4YCU A;  1VQC A;  3I72 A;  2B8F A;  4IJH A;  5IYD G;  3WWV A;  3PO3 G;  4KHV A;  4KMU C;  4GKK L;  1A2T A;  5HY6 A;  3RN2 A;  1H9R A;  3G6J B;  4C3J G;  2I5L X;  3VA7 A;  1HA6 A;  1B4O A;  1ML0 D;  1J8I A;  2JA7 G;  3M4Y A;  1H9K A;  1JIC A;  2C9O A;  3MXN A;  1H95 A;  1ET9 A;  1TT2 A;  3GTP B;  2Q2I A;  1YJN A;  3RZD H;  1SYD A;  1TXY A;  1JJC B;  2IHE A;  1E2Z A;  3P75 A;  3CU7 A;  3RZO H;  2K4K A;  1SR3 A;  1D1I A;  3F8T A;  1Q3L A;  1HTP A;  3TDQ A;  2DY7 A;  3PUZ A;  3K58 A;  1K9M C;  5LMN Q;  2KCC A;  2R7Z H;  4V19 0;  1W2B A;  4RHR A;  5C0X H;  2A68 C;  4OO1 G;  3UE0 A;  1G2S A;  4AH6 A;  4LFC Q;  2BH8 A;  1TWC B;  2Z0S A;  4LFB L;  3L3O C;  4HJA A;  4TQU S;  1SE4 A;  1VF7 A;  1DOK A;  1PZJ D;  1Y1V H;  4CHT B;  3P7J A;  4DKA C;  4YIJ A;  1QVC A;  3GTK H;  1F9R A;  5EKK A;  3BZK A;  2IWH A;  1LTA D;  3HFZ B;  1HR0 Q;  3KJP A;  3OIQ A;  1RD9 D;  2O5I C;  1VQF A;  1KDC A;  3KBG A;  4LF7 L;  1WCM H;  1OXX K;  3N52 A;  4X3K A;  4DV2 L;  1UUP A;  5E1F A;  1CM9 A;  4DR4 Q;  5FJ8 G;  5C3E H;  4KTA A;  1I3Q B;  2F4V Q;  1U4L A;  4BBS G;  1SN8 A;  3MEH A;  2KEC A;  4KD4 A;  3D4D A;  5K36 H;  4X65 Q;  4JPB W;  4DV5 Q;  1STG A;  4PZ7 A;  4EQP A;  2XRQ D;  1VQ4 A;  4DR5 L;  2DNC A;  4K5W A;  1G29 1;  1JQY D;  3HOY B;  5ELN A;  2E2D C;  4CJ0 B;  3DMU A;  1WYD A;  2PW5 A;  1UE5 A;  3R3O A;  1B3A A;  2A19 A;  2F03 A;  2A74 C;  1ESR A;  1EQT A;  4K0K L;  5FKA C;  3LWE A;  1CSP A;  3F2D A;  3HOW G;  2RCF A;  2XN9 C;  2OCE A;  4N8X 1;  5EKI A;  1GUO A;  1KLU D;  2HHH Q;  3GTM H;  5COR A;  3BDC A;  4ZLT F;  1ZYR D;  2YTX A;  2IX3 A;  4DR2 Q;  2WAQ E;  1Q8K A;  1B8A A;  2K5H A;  3CF5 A;  1N36 L;  4DK1 A;  1W6J A;  4RG1 A;  1AP0 A;  1QUQ B;  4O2D A;  2BA1 A;  2WKD A;  1B70 B;  2FIN B;  2NVQ B;  1VQG A;  4LF8 Q;  2KVM A;  2PI2 E;  2WFW A;  3ERQ A;  5FO9 B;  2D2C C;  3KBX A;  3PIP A;  1KL9 A;  4QL5 A;  4BY7 B;  3OPO A;  4JBW A;  3KLW A;  4RHS A;  4FF4 A;  4H44 C;  4F8M A;  3J7Y W;  2EY1 A;  1BUV T;  4G57 A;  1ESF A;  1TY2 A;  2OWO A;  4CDF C;  1SFO B;  2VNU D;  2L55 A;  1SAP A;  2L15 A;  5IGE A;  4FF2 A;  2MQH A;  2VB3 X;  1NSN S;  2EYP A;  4K6D A;  4YWM A;  3H0G G;  3NEN A;  4OEL B;  2HQL A;  1BOS A;  3GO5 A;  4DNT B;  2ZM6 Q;  2F0Q A;  3E3X A;  3PIO A;  3HOU H;  1JE5 A;  5KYL A;  2CH4 W;  2OTL A;  1HTL D;  2LMC B;  4MTK A;  2VQF Q;  1EWC A;  1HZA A;  2CWA A;  5AJ3 Q;  1NTG A;  3AYH B;  4XQJ A;  2IL8 A;  2FJ2 A;  1ENA A;  5KNB A;  1EYG A;  4RCO A;  1TY0 A;  5C0X G;  3BYT B;  4IUU A;  3EFX D;  2ZJP A;  1Q81 C;  4ZRZ A;  1D5X C;  3KDF A;  3K81 C;  3NEM A;  2I07 B;  1Y8P B;  3NHH A;  4BY1 B;  2O5J C;  2Z9H A;  1BBX C;  1E1O A;  1KAB A;  3S17 H;  1SYE A;  1PLF A;  2K03 A;  1VQL A;  1GUT A;  2K5D A;  3IFT A;  1STE A;  1X65 A;  3OTO Q;  1L1O C;  3NTK A;  1B2T A;  2RBM A;  1L1O A;  1WCM G;  1O7L A;  1VQJ A;  2VL6 A;  3MXG A;  1IZ6 A;  3K6O A;  1S72 A;  2R92 B;  3PMF A;  4NB3 A;  2PQE A;  1CKN B;  1TWG B;  1HRJ A;  1BO0 A;  1FJG Q;  4DA2 A;  3S15 H;  2Q2U A;  2B2V C;  1JJ2 A;  2JA8 G;  1PH9 A;  2NVX B;  3TP6 A;  1X54 A;  5GQO A;  1NNX A;  1PTO B;  2B2V A;  1ROD A;  4E6I A;  2B2U A;  1FNU A;  1V1O A;  5CV9 A;  3BYY B;  3M85 A;  1KDA A;  1D7Q A;  3BZD B;  2VUM G;  4JI1 L;  1CSQ A;  2B63 H;  5IP7 H;  3GTJ H;  4LF5 Q;  5COY A;  3J81 j;  5I2Y A;  4L5T A;  1B1Z A;  2KHS A;  1E0B A;  4L6T B;  2EQS A;  4JYA Q;  1QOH A;  2E74 C;  3NTI A;  2KBN A;  1D2B A;  5JJL A;  1GO3 E;  1OXV A;  5CYU A;  5I2X A;  2J7Z A;  5IOD A;  1G6P A;  2OQK A;  3RZD B;  2E5L Q;  1VQP A;  2F0E A;  3H09 A;  4DFA A;  4JI3 L;  1OTC A;  3E9I A;  5FLM H;  3RZO B;  2R7F A;  1DJR D;  5CV4 A;  3TRZ A;  1TKW B;  3AB9 A;  1XWE A;  2OQ0 A;  3W1G A;  1PRT F;  3J81 c;  4JV5 L;  3D6W A;  1LTI D;  4U67 3;  1CT1 D;  3CD6 A;  2R7Z B;  5ELD A;  1Y69 U;  1CHQ D;  2EYM A;  1HFN A;  1AEX A;  2RCN A;  1S4Z A;  1Y1W G;  3KF6 B;  4WJ4 A;  1RKN A;  4ZYS A;  3C1E A;  4KLK A;  3FPP A;  4FVM A;  4MIU A;  3KFU A;  3ITP A;  5FK9 C;  5T1G A;  4B9X A;  1Y1V B;  4N9P A;  1HQR D;  1VQD A;  1V1Q A;  1DON A;  2QDL A;  1M90 C;  2G9H D;  1O78 A;  3I4M G;  2EPB A;  1H9M A;  4X3S A;  4XT3 B;  1UEA B;  1HQM C;  2F0O A;  5HGQ A;  3OWE B;  4N8F A;  1F2Z A;  3PO2 G;  1PFB A;  5C3E B;  2D5D A;  2CCZ A;  1PH8 A;  3DHQ A;  4DV4 Q;  5KND A;  3HOU G;  3T51 B;  3D8G A;  2ZJQ A;  4P73 A;  5BN4 A;  2KCN A;  1HNW Q;  1I4R A;  4DR1 Q;  1T5X D;  1QJO A;  3S1Q H;  2Q2T A;  4H13 C;  3G71 A;  4J8Q A;  1IYV A;  3W2D A;  5CC4 A;  1BCP F;  4J6H A;  5KIX A;  2AQ3 B;  4DV6 L;  3U50 C;  3S9W A;  3K7A H;  3VYT A;  5CGK A;  4IFD I;  2HQE A;  1B9N A;  4KKT A;  3G6E A;  3U9S A;  2JA6 H;  1DYQ A;  1JB3 A;  3F1Z A;  3O13 A;  3I73 A;  4YY3 L;  1I6V C;  2BCO A;  4NXM Q;  4I65 A;  1N9W A;  3TBI B;  1MSG A;  1R4Q B;  2EOT A;  4KKS A;  4DF7 A;  4O42 A;  3GTM B;  2JSO A;  2GVB A;  1Q86 C;  1WTH A;  3NK9 A;  4LF9 Q;  4KV6 A;  1B50 A;  1Q82 C;  2K33 A;  2DN8 A;  2RDH A;  3ZYY X;  1Y8N B;  1KAW A;  2RSN A;  2A6E D;  4A3G G;  1Q90 A;  1UEB A;  1O7Y A;  1SE2 A;  4QIW B;  3ULP A;  1GUG A;  1SRU A;  2VY3 A;  3S2H H;  3E0E A;  2UXC L;  1FNV A;  5M3F H;  1N33 Q;  4IFD H;  1UAP A;  1OXT A;  2MUY A;  1XMQ Q;  3MXN B;  4HR7 B;  1SSO A;  1JT8 A;  4AYB B;  3PIP 3;  4GKK Q;  3AU7 A;  5CV7 A;  2Z4I A;  2Z8L A;  2O2L D;  3J80 E;  1SYB A;  1JOO A;  1F77 A;  1NUC A;  2F0F A;  1KD1 C;  3MXP A;  2HT1 A;  3L7Z C;  2PZU A;  4H7B A;  3RD4 A;  3NUC A;  1CQF A;  4A3M B;  4KKU A;  2IJ0 A;  1LYL A;  4A3B H;  1TS5 A;  1EIH A;  1RJT A;  1YNN D;  4DR7 L;  4IO9 A;  1D1K A;  1LT4 D;  3CAM A;  4EGV A;  3EVQ A;  2VZA A;  1NMG A;  4ILW A;  3CP0 A;  2NWG A;  3S1N B;  3HOU B;  4NW2 A;  1PH3 A;  1X3Q A;  5E4W C;  1QE6 A;  4ZUJ A;  4BWG B;  4LFB Q;  3HS0 C;  5LMN W;  3JAM E;  3HKZ G;  3TEH B;  3M7G A;  1KDB A;  1R9T H;  4ZKB B;  2EYO A;  1FJG L;  1STN A;  3CCM A;  1LT3 D;  1ILP A;  2XGT A;  1E22 A;  2A69 C;  3URY A;  4LFA L;  5DAU A;  4GOP B;  1H9S B;  1I94 L;  5IT9 E;  4A76 A;  2M9V A;  4HED A;  3MXU A;  3NWT A;  3VYS A;  1IBL L;  1BKB A;  1XNQ L;  3QR8 A;  3J80 L;  2WB1 B;  4OO1 I;  1Q1B A;  4UAI A;  4LF7 Q;  3E5S A;  2R7D A;  2XWJ B;  5C4H A;  2JA7 H;  1HR0 W;  4DV7 L;  4DV2 Q;  1HNX L;  2RDF A;  3SK5 A;  4NDX A;  1EIG A;  4FF3 A;  1PV4 A;  3CRK C;  4MNO A;  3CME A;  4PMB A;  4G7H C;  1EYA A;  4RGN A;  1LAB A;  3SEB A;  4B08 A;  2E2I H;  1VS0 A;  3ONA B;  4DR5 Q;  3S15 B;  1XPO A;  4IUN A;  3D0F A;  1VF5 C;  2E8G A;  1STA A;  2N49 A;  4OL7 A;  1J5E L;  4OO1 H;  1OXS C;  5FLX E;  2XIW A;  4IQZ A;  2N3S A;  4DGZ A;  3I90 A;  5C44 H;  4DUZ L;  3QJY A;  2KED A;  1VQI A;  1QZH A;  3CQZ H;  3I4L A;  2NZO A;  3JAM L;  2N78 A;  4HJ9 A;  1KRT A;  2K52 A;  4K0K Q;  3STB C;  2B63 B;  2D9U A;  1N34 Q;  4AQY L;  3GTJ B;  3AFQ A;  4C3H G;  4HTH A;  3MA2 B;  3T1H L;  2QGQ A;  1AE3 A;  5CV5 A;  4IN3 A;  1PH4 A;  4LF4 L;  2L9H A;  5IT9 L;  3S14 H;  2JJQ A;  5A2Q E;  5BN5 A;  3ICE A;  4DXF A;  2AMC B;  5IYC H;  2EYJ A;  1N36 Q;  3CCV A;  4LMQ D;  1PTO F;  4KJO A;  1QG7 A;  5CMD A;  1OO9 B;  1EQV A;  5JJI A;  2F0K A;  4DPG A;  1EWH A;  4BA2 I;  2P5Z X;  3SR1 A;  3TS0 A;  5M3F G;  3P1H A;  4K6L A;  4WJ3 M;  1T5E A;  1NR2 A;  3HOX G;  3H3V C;  2F0V A;  2L0C A;  2F52 A;  4EQN A;  1I4H A;  5FLX L;  1F9Q A;  4IUV A;  1YNJ D;  4YCW A;  1EWI A;  2ZXR A;  4R4C A;  1EU4 A;  3LWU A;  1SRO A;  1EY7 A;  3CCS A;  3CCE A;  2RA4 A;  2DUD A;  2B2W A;  3BJU A;  1XMO L;  2X6G A;  2KCT A;  4A3B G;  5I4D A;  5A2Q L;  2TSS A;  4Y7N H;  5I6W A;  2K5Q A;  1PYS B;  1QNK A;  4A3F G;  1RDP D;  2C5C A;  4MTN A;  3TRE A;  3UDF A;  1J6Q A;  3T13 A;  2N8N A;  2VS1 A;  2CQO A;  4UPA A;  2YTY A;  3J81 i;  3S1Q B;  2AUK A;  2HDL A;  4UHV A;  1L1O B;  4PNY A;  3QOJ A;  1LTG D;  5JEA J;  2EIF A;  5LMU L;  1CZW A;  1GXD C;  3K5M A;  1D5Z C;  1XMQ L;  1O80 A;  3R8B A;  4DAY B;  1SE3 A;  2K32 A;  5GRO A;  3K7A B;  4XTC S;  2TMP A;  1CTM A;  4MZ9 A;  3G7L A;  3PUX A;  4GN3 B;  1ENF A;  4TVA B;  5JPM C;  2Q8T A;  5FOB B;  2JA6 B;  3BZC A;  2XNA C;  4DNR B;  3S16 H;  5C0X I;  3OIP A;  2WAC A;  1HNZ L;  1I50 H;  3ERS X;  1EY9 A;  1YBY A;  2IX1 A;  4JW0 A;  4HAE A;  3H0G H;  5C4J H;  1TWA H;  1O7I A;  4POG A;  1U4P A;  2MP1 A;  3Q6S A;  3KLS A;  3X3N A;  4IPH A;  3RUZ A;  1GD7 A;  1JOR A;  3L0O A;  1KRS A;  1D6E C;  3HOZ B;  5M3F B;  1U4M A;  1SMY C;  4K14 A;  3S1M B;  3U4V A;  3K8A A;  1LUZ A;  2E2J H;  2KA7 A;  4JI1 Q;  3FDT A;  4CKC A;  2KEE A;  3ZJY C;  5IYB H;  3M7N A;  1JOK A;  2KOL A;  4PMC A;  3ND9 A;  2L1B A;  1D8L A;  3CHB D;  5M3M B;  5EPL A;  5C44 G;  3BG3 A;  4IUT A;  2V1C C;  5IOC A;  2ID0 A;  5LL6 X;  1A3U A;  3PV0 A;  2K5W A;  5H1S E;  1SJE D;  4ZUI A;  1BXT A;  3U4Z A;  4DK6 C;  5HUR A;  2QW7 A;  3H3V H;  2IT1 A;  1SE8 A;  4APV A;  4JI3 Q;  4A3B B;  2F1M A;  1AN8 A;  2Y0S B;  2EZV A;  1CA6 A;  2I46 A;  1LTS D;  3AMU A;  1DM0 B;  1VMC A;  5IYC G;  4JV5 Q;  1FR3 A;  4JBK A;  3BS1 A;  3I56 A;  1YNJ C;  1N8R C;  1XXG A;  2J4X A;  3MWY W;  1X3P A;  3QO2 A;  5E7N A;  4PG3 A;  3BDO A;  5G3L F;  5BN3 A;  2JA8 H;  4LUV A;  3A8J E;  1K0R A;  3DEP A;  1R9T B;  2A6H D;  2VUM H;  2JN4 A;  1JMC A;  3MC0 B;  5C4Z A;  3PO3 B;  1S5D D;  4DV3 L;  2XTI A;  1I5F A;  2ZT9 C;  1J9O A;  1ILQ A;  3PCO B;  3J7A 5;  4FP5 D;  3J7A F;  1PH2 A;  4X66 L;  3K5O A;  3HZX A;  4C3J B;  1EQQ A;  1CQV A;  1HHV A;  4L8J A;  2XRS D;  5EBC A;  1KLG D;  4C3I H;  3I91 A;  5D14 A;  2JA7 B;  1TWF H;  1N34 L;  1N32 L;  2JA9 A;  4K2L A;  4WFN 3;  1PFM A;  2PO4 A;  3KJO A;  5LL6 S;  3BVZ A;  2ICE C;  3S2D B;  4HCE A;  1PRT D;  3V05 A;  2OT2 A;  3M3Y H;  1SNM A;  1EYC A;  4XYO A;  2FHT A;  4EQO A;  2SDF A;  4DV6 Q;  1Y1W H;  4HCS A;  3NPP A;  5GAD C;  1X6O A;  1IBK L;  2K04 A;  3CQZ B;  3CPW A;  2F0P A;  1NMF A;  3T56 B;  2PYK A;  4YY3 Q;  4FO2 A;  5D3D A;  1YI2 A;  5M5X H;  3BVG A;  2KQ3 A;  2PQA A;  1MJE A;  3S14 B;  4HIK A;  3I4M H;  1YZ6 A;  4HMJ A;  5IP9 G;  2JQO A;  2E2H H;  2K75 A;  1B44 D;  2HD3 A;  1TU2 B;  4JI5 L;  3MTS A;  4QIW E;  3S24 A;  3CCJ A;  1M1K C;  2UXC Q;  3PO2 H;  3CPF A;  3KLR A;  4OWT B;  3EN2 A;  2K5N A;  1EU3 A;  4A3J G;  4OWW B;  2D0O A;  1MBY A;  1I4X A;  2K5V A;  4BBS B;  2RHQ B;  4AYB E;  1CKM A;  2F4I A;  4R9W A;  1C7Y A;  2R93 H;  3FMC A;  4MHE A;  4DXG A;  3Q22 A;  3IL8 A;  4R8I A;  2YU9 H;  3CCQ A;  1SMX A;  1BCP D;  2QKI C;  1U4R A;  1RF2 D;  2MO1 A;  5IYB G;  4G7O C;  4TKO B;  1OXU A;  4XXE A;  1I4Q A;  3GTG B;  1VDZ A;  1YIJ A;  4LK1 C;  3NP8 A;  4NXN L;  1SLJ A;  4LJZ C;  4RGO S;  4DR7 Q;  3VR4 A;  4OHJ A;  3HOW B;  2DNE A;  1YVC A;  3NQI A;  1NY4 A;  1TS2 A;  1XPU A;  2WV6 D;  4WJW A;  2DGY A;  2A6H C;  1JE4 A;  2F0D A;  1YIT A;  2Z6K A;  3OWF A;  5M5Y H;  3LNN A;  4QMG A;  2ZTE A;  3WDN A;  3A5Z B;  3GDE A;  3C2P A;  1V9P A;  4YCV A;  4A3G H;  3TQY A;  3MFY A;  1IYU A;  5ELC A;  4A3E G;  4DNI A;  1V1P A;  5E3F A;  4HJ8 A;  4X3T A;  4HIM A;  1WVL A;  2I5M X;  1IKM A;  2B2U C;  4LFA Q;  1C8C A;  1F9P A;  2QEJ C;  4MN3 A;  2O4X A;  2JXM B;  4Q0F A;  1I94 Q;  4OIJ A;  4QF4 A;  2WP8 J;  1IBL Q;  1XNQ Q;  2LXJ A;  1ZYR C;  4LUO A;  4KN7 C;  3HKS A;  2WB1 E;  1PRT C;  4GZY C;  2EYH A;  3DXJ C;  2F0G A;  4ODG A;  4DV7 Q;  1HNX Q;  1A3T A;  3KUP A;  4BBR G;  1HZC A;  2F0N A;  2V4D A;  4C3I G;  4XYQ A;  1A8V A;  2WAQ G;  1I50 B;  3B6Y A;  3HOV H;  2ICI A;  3U9O A;  3G4S A;  1VQB A;  3ULL A;  2K1B A;  4X3U A;  1EZ6 A;  3H0G B;  2DJF C;  1TWA B;  5C4J B;  4C1N K;  4JI2 L;  4F7X A;  3CCU A;  2G9D A;  5AFW A;  2CKZ B;  1GUS A;  2F0M A;  3KYH C;  3H6M A;  4IUR A;  3T1Y L;  1J5E Q;  5EGT A;  4IJL A;  4A75 A;  2GN5 A;  3K7U C;  5NUC A;  1SJH D;  1ZKO A;  4DUZ Q;  2KHI A;  2VQE L;  1SNO A;  2E2J B;  3WOE A;  1C48 A;  4DR3 L;  1RIP A;  2AUJ D;  1VQ8 A;  2K05 A;  4AQY Q;  4FXD A;  3ERO A;  3VR6 A;  3T1H Q;  4XQN A;  2EY5 A;  2KUM A;  1EZ8 A;  3MVV A;  5A35 A;  4LF4 Q;  4RMF A;  1EFW A;  4A3L H;  1DXM A;  2NVY H;  3IFD A;  3IKJ A;  3GTK B;  3PUV A;  3Q8D A;  1MD2 D;  1IL8 A;  2VW9 A;  2EXD A;  2L11 A;  2ALY B;  2K01 A;  3MHB A;  1BCP C;  4A3I G;  2F0I A;  2RKS A;  2SEB D;  4CBV A;  5JJZ A;  4YWL A;  2PZW A;  3CCL A;  1G2T A;  1WCM B;  4B3M L;  1QCB D;  5C5M A;  4P75 A;  1LT5 D;  3EA6 A;  1JC7 A;  3BVM A;  4PQX A;  1RL2 A;  3J80 i;  2EYL A;  3I4N H;  1K0S A;  2G5D A;  3M4P A;  2JA8 B;  1G6Z A;  5BR8 L;  4R8N A;  1AE2 A;  2B29 A;  1PFS A;  3U58 A;  2NUC A;  2R93 G;  5EJW A;  2VUM B;  2F3V A;  2RVL A;  3NBH A;  1P8L A;  2L5T A;  5I6Y A;  1PXU A;  1ASZ A;  4LW1 A;  4C3H H;  2YYZ A;  2CW0 D;  4WRD A;  2L4N A;  1XMO Q;  3NQT A;  2UUB L;  4C3I B;  4IUQ A;  1XYI A;  3A0J A;  3H15 A;  1F2L A;  1KXL A;  1TWF B;  4A4I A;  1EQR A;  2EY6 A;  3HG9 A;  2HIX A;  3JAM i;  4QB4 A;  1PTO D;  5IGB A;  1K73 C;  2R3Z A;  1HCZ A;  2NZH A;  4LAA A;  4JI7 Q;  3SXH A;  3RMH A;  2N55 A;  1LTB D;  2OF1 A;  3MEF A;  3M3Y B;  5LMU Q;  2MO0 A;  4P2C B;  3TP5 A;  1MKH A;  1X3F A;  3HOX H;  3C46 A;  1A63 A;  4FXG C;  1Y1W B;  1QUQ A;  4JVZ A;  1B53 A;  1ICW A;  2EY2 A;  5ELO A;  3A5U A;  3SK6 A;  2B2Y A;  3D31 A;  1KC8 C;  1HNZ Q;  3I2Z A;  1NE3 A;  1ICF B;  1WJJ A;  3IRB A;  2UXD L;  3Q0A A;  1BQQ T;  5M5X B;  1WTV A;  4Z9C B;  2MFI A;  1I4G A;  3I4M B;  1H9J A;  1YHA A;  1Z6H A;  3Q24 A;  4KY6 A;  3HOV G;  2E2H B;  2GA4 B;  4GNX C;  5K5P A;  4GNX A;  1VQ9 A;  1VQN A;  3PO2 B;  4GLX A;  3DLL A;  2HIV A;  3A55 A;  2ES2 A;  4A3F H;  1JCK B;  4OEM B;  1E1T A;  1QNU A;  2ZXP A;  1WTW A;  1K28 A;  4BXX G;  4A3D G;  1E24 A;  3VA5 A;  1PH7 A;  2R93 B;  2YU9 B;  1XTC D;  1U5K A;  1VQ5 A;  1S40 A;  1PMR A;  4DAV A;  1GUW A;  3HEJ A;  1X56 A;  4C2M H;  1WTX A;  4JI6 L;  3R93 A;  5J22 A;  2NVT H;  1AZP A;  2PPB C;  3GP7 A;  3TME A;  1IW7 D;  2IPK D;  4I7A A;  4GN5 A;  1FD7 D;  3A56 A;  5FO7 B;  1ASY A;  1A0I A;  1HUM A;  4A3L G;  5GAE C;  1GKH A;  1I3Q H;  2Y0S E;  1YJW A;  5T1I A;  4C1N I;  2NBF A;  3MZ5 A;  3SGI A;  2UUC L;  3LX0 A;  4P71 A;  4IFD J;  1X3E A;  4N9T A;  3S17 B;  4I7Z C;  1AW7 A;  3AEV A;  5M5Y B;  4R4T A;  3QWN A;  1E2W A;  4G7Z C;  1YNX A;  1JB7 A;  1PVO A;  4DR6 L;  1STB A;  4A3G B;  2CW0 C;  2AQ1 B;  3KOJ A;  1XJV A;  4IAL A;  4RCN A;  1PDQ A;  4PMW A;  3I4N G;  1TVX A;  1EOV A;  5DNF A;  4DU9 A;  2F0T A;  1VQM A;  1CKN A;  1JR0 D;  4JOI A;  4DV3 Q;  3E0J A;  1K8A C;  1CFM A;  4M1U B;  1TS3 A;  4JC0 A;  2NN6 G;  4ME5 A;  2I0Q A;  4A3K G;  4X66 Q;  5ISR A;  3SK8 A;  5GAH C;  4K5V A;  4KY5 A;  2QEX A;  2QA4 A;  1TS4 A;  5CBA E;  2CWP A;  4HJ5 A;  2A6E C;  4KK7 A;  4FNF A;  3I4O A;  1N32 Q;  1L0W A;  4P74 A;  3TZU A;  1CZG A;  2AKW B;  5M9O A;  2HDM A;  2X6L A;  4DV1 L;  2IX0 A;  2MGS A;  4LF6 L;  1A3V A;  2FFK B;  2IY5 B;  1QIL A;  2EJM A;  4RA8 A;  1HJP A;  4BY7 H;  4K5X A;  2UUA L;  1C0A A;  2Q8I B;  4TSS A;  2AHO B;  5C3X A;  5JJK A;  5JAV A;  3QOL A;  2NTS A;  4HN7 A;  3VDY A;  4YHH L;  5G3L D;  3RLN A;  4CDE C;  2AQ2 B;  5EBD A;  2WIN B;  1LAC A;  2JP1 A;  4X62 L;  2JE6 I;  2PW7 A;  4JI0 Q;  2XWB B;  1NAP A;  1SEB D;  3M9B A;  1WD0 A;  3A54 A;  1IBK Q;  2BDO A;  3GTQ H;  1IBM L;  3I55 A;  2EE1 A;  3HKZ B;  4O1N A;  2ENB A;  4JCV E;  4G4K A;  2BA0 A;  1YNN C;  2OTJ A;  2A68 D;  5CV6 A;  1VQA A;  1STY A;  1YHQ A;  2FXQ A;  5C6A A;  3WOF A;  1UE6 A;  1FGB D;  1NCV A;  4H0L C;  3CW2 C;  5EPJ A;  2NVY B;  4PZ6 A;  4JI5 Q;  2B2W C;  3SVM A;  3S1R H;  1EEI D;  2N88 A;  2ATW A;  5IGC A;  1S5E D;  3VR5 A;  2H4O A;  1JWM D;  2X69 A;  2YV5 A;  2Z6B A;  4C56 C;  1RTN A;  3D3R A;  3KDF B;  1DGS A;  1KNA A;  2K6A A;  4GLV B;  4IPG A;  3W1B A;  1R4P B;  5JVH 3;  2UU9 Q;  1O7Z A;  5D65 A;  3D4W A;  3I4N B;  2EYF A;  4A3C H;  5IGF A;  2UXB L;  4BY1 H;  2KCM A;  4DV0 L;  1UWV A;  4JI7 L;  2LKV A;  4ABN A;  1EFI D;  2NTT A;  5ELF A;  3MAQ A;  4LWC A;  5EKL A;  4KHZ A;  4EX5 A;  1UE1 A;  5JPN C;  1NJI C;  3TS2 A;  2YTV A;  4NXN Q;  3RLF A;  4QGU A;  3RLO A;  4UP8 A;  4R4Q A;  2VB2 X;  1V1P B;  1K3R A;  2D0P A;  2BOS A;  2BH2 A;  2F0W A;  1EY5 A;  4C3H B;  1DOL A;  1WTO A;  4ZK9 B;  1LLR D;  2PI2 A;  3EQL C;  2CVR A;  2MHV A;  4QCL A;  1D5M C;  2DJG C;  3D4R A;  4IUP A;  3T53 B;  1MI2 A;  3A7L A;  5IP9 H;  5KNC A;  2A1A A;  1P16 A;  1F9S A;  3IAY A;  1W3S A;  2MNA A;  1V43 A;  1PRT B;  1K8O A;  1BNZ A;  3HOY G;  3J80 c;  4A3J H;  4DUY L;  2E75 C;  4S3S A;  3S2H B;  1WI5 A;  2PZT A;  3LGJ A;  3M4O H;  1QB5 D;  1NR4 A;  5TSS A;  1NBW A;  3H3V I;  3HOX B;  4KHP L;  2NB0 A;  5I9O A;  4TRD A;  1LM0 A;  5C4X H;  1Z47 A;  4DN4 M;  4B3R L;  1Q46 A;  4F87 A;  2K50 A;  1VQ7 A;  4M8A A;  1HA5 A;  5C3W A;  1TII D;  1WD1 A;  3ER0 A;  3HGB A;  1SNC A;  3X3M A;  3EJI A;  4ZQ3 A;  3RN5 A;  4JI2 Q;  3CCR A;  3CC7 A;  1HH2 P;  4CDD C;  3BDL A;  4K8I A;  3JAM c;  4K8J A;  4IOA A;  2L12 A;  4XDX A;  3T1Y Q;  1Q12 A;  5DLQ E;  5IWA L;  1L0X B;  4X64 L;  4GN4 B;  4BY7 G;  2CQA A;  1FVI A;  2VQE Q;  1SDF A;  4A3F B;  4HIO A;  1CI3 M;  5IT9 c;  4A3E H;  4DR3 Q;  1XPR A;  1SND A;  4DAM A;  1B7Y B;  1HZ9 A;  1F2M A;  5ELB A;  4QY7 A;  2K28 A;  3OW7 A;  3QG1 A;  3J81 E;  4HID A;  1BCP B;  4Y52 H;  3A8K E;  2PNR C;  4UP9 A;  5JEA G;  2F0S A;  4OX9 L;  4POF A;  1PHJ A;  1LTT D;  1STH A;  4C2M B;  2NVT B;  3K0Y A;  1G8Z D;  1S5F D;  1MSH A;  1LT6 D;  3I8Z A;  4B3S Q;  4ZKC B;  3CRL C;  4BBR H;  3V2T A;  3GQB A;  1LO5 D;  4GOP C;  1VCI A;  4DAP A;  1FL0 A;  1IXR A;  3L2P A;  4GOP A;  1H9S A;  1DZ1 A;  3ND8 A;  2F3I A;  1KQS A;  3KF8 A;  4B3M Q;  5FLX c;  4JBM A;  3NBH B;  4RKB A;  5LHY 1;  1XNR L;  4CGY B;  5BR8 Q;  5C0X J;  4B3T L;  1I4P A;  1DCZ A;  1V8Q A;  2E2I B;  3TP7 A;  2JA5 H;  1PFN A;  3BU2 A;  2B39 A;  4J1M A;  1GHK A;  1PH6 A;  4OGQ C;  2F3W A;  4A3C G;  3PSI A;  4BY1 G;  1AZQ A;  2MPM A;  4JI8 L;  3DWQ A;  4HJ7 A;  3PQI A;  4JI0 L;  3SE0 A;  1CUK A;  3J81 L;  5C44 B;  1SNQ A;  1EUJ A;  1SYF A;  2UUB Q;  2Q8R E;  1K83 H;  3M4Q A;  3C3L A;  3HRZ C;  1S5C D;  1IYJ B;  1E3P A;  2R92 G;  3J7A V;  1EEF D;  3UDG A;  1B3Q A;  5E4X A;  4ZAI A;  4A3I H;  4IZ8 A;  2PNH A;  4XT1 B;  3F2C A;  3NSW A;  4V0B A;  1GOZ A;  1BDO A;  3J7Z C;  3CMA A;  3CXC A;  2PMZ B;  1HPC A;  3CC2 A;  1KNE A;  1YEZ A;  4JI4 L;  1PZK D;  3H94 A;  4PV1 C;  3NBI A;  1KIX A;  1VQO A;  2UU9 L;  3GTQ B;  3OSO A;  1M4V A;  2B3G A;  3FP9 A;  4A3M H;  4GNX B;  5DM7 3;  2WKC A;  1BR9 A;  1QZG A;  4F88 A;  2UXD Q;  1HXY D;  5C4X G;  2B2T C;  1Q1E A;  3Q23 A;  3H91 A;  2B2T A;  3S1N H;  1QVG A;  1G51 A;  4GKJ L;  1ENC A;  2RF4 A;  3VR2 A;  3RNU A;  2ASB A;  3S1R B;  1TWH H;  4L5S A;  2F0L A;  2R7Z G;  2Z6K C;  3A8I E;  2KHJ A;  3PUW A;  1RCV D;  2K7V A;  1E7Z A;  4Y7N B;  1K8M A;  1Q8I A;  4J15 A;  3KLS X;  3GTL H;  2EDG A;  1EIY B;  4CDC C;  2H5X A;  1Y1V G;  3FPU B;  3N6R A;  3PF5 A;  1F2Y A;  3I7F A;  2JEB I;  3NE5 B;  3F2B A;  1Q7Y C;  4L63 B;  3T16 A;  4JI6 Q;  2D62 A;  4H02 A;  1IKL A;  4PZ8 A;  2Q2H A;  1M8A A;  4JG2 A;  2BE5 D;  1BBW A;  1CK1 A;  4IOC A;  3A7A B;  3TZD A;  4FF1 A;  1EL0 A;  5EQ0 A;  2UUC Q;  4R4I A;  2A5H A;  3PF4 A;  5C3E G;  1ZEQ X;  1S5B D;  4DAY A;  4HSV A;  5KRU A;  1CHP D;  3QB3 A;  3S16 B;  2SNM A;  4B9W A;  1A6X A;  3TN2 A;  4UY8 C;  5K36 G;  2IW3 A;  5IY0 A;  4DR6 Q;  4KD3 A;  4Q5V A;  1PH5 A;  1VQH A;  2MJ8 A;  3F2U A;  4CKB A;  2LY7 A;  1WTR A;  5LMN L;  4XQQ A;  1FYC A;  3OHX C;  4NMZ A;  1HZB A;  4A3J B;  3DUZ A;  1HUN A;  4BXX H;  1FNW A;  1GHJ A;  4LFC L;  2JA5 G;  1ONL A;  2M2L A;  4BS9 A;  4A3D H;  3M4O B;  4NPS A;  1S3O A;  2XVS A;  4CJ2 C;  2XSC A;  2J0T D;  4FXK C;  4KY7 A;  3UDX A;  4AIM A;  4HMI A;  3FKI H;  5EAY A;  2RHS B;  1LTR D;  5C4X B;  1SYC A;  1HR0 L;  2NYZ D;  1VMP A;  5DEH A;  4DV1 Q;  1XX8 A;  4GLA C;  4LF6 Q;  1Z7T A;  3NXW A;  3DM1 A;  1II3 A;  2UUA Q;  4BA1 I;  3OOC A; 
#chains in the Genus database with same CATH homology
 5GAE C;  1KL9 A;  2ZTD A;  4QL5 A;  1GKH A;  4DAY B;  4B3S L;  1I3Q H;  4DR4 L;  2Y0S E;  3KLW A;  4JBW A;  5GRO A;  4YHH Q;  1YJW A;  4XTC S;  1VQE A;  4MZ9 A;  3PUX A;  3DM3 A;  1XTD A;  4GN3 B;  3SGI A;  4X62 Q;  2F4V L;  2UUC L;  4TVA B;  4AYB G;  3BZC A;  4P71 A;  4IFD J;  1X3E A;  4X65 L;  3GTO H;  3S16 H;  2OWO A;  4DV5 L;  5C0X I;  3CC4 A;  3AEV A;  4R4T A;  2VNU D;  1HNZ L;  1I50 H;  3ERS X;  1WFQ A;  1YBY A;  1IBM Q;  3K0X A;  2L15 A;  3HKZ E;  1YNX A;  2MQH A;  1JB7 A;  2IX1 A;  1PVO A;  4DR6 L;  1X55 A;  3H0G H;  5C4J H;  1TWA H;  4GS3 A;  1O7I A;  3KOJ A;  1XJV A;  4POG A;  4PMW A;  3I4N G;  1Z9F A;  1EOV A;  4IPH A;  1GD7 A;  4DK3 C;  4YWM A;  4A3K H;  4A3M G;  3L0O A;  3H0G G;  1KHI A;  3NEN A;  3FHW A;  1KRS A;  2HQL A;  1CKN A;  1VQM A;  3GO5 A;  4JOI A;  2ZM6 Q;  4DV3 Q;  3ULJ A;  3PIO A;  1K8A C;  3HOU H;  1JE5 A;  3U4V A;  3K8A A;  1LUZ A;  2NN6 G;  4JC0 A;  5M5W H;  2E2J H;  4A3K G;  2I0Q A;  2AWO A;  4X66 Q;  2OTL A;  4JI1 Q;  5GAH C;  2VQF Q;  1VQ6 A;  1HZA A;  2CWA A;  5AJ3 Q;  1NTG A;  1EIF A;  1MJC A;  2QEX A;  3AYH B;  3ZJY C;  5IYB H;  3M7N A;  2QA4 A;  2CWP A;  4OXP A;  4HJ5 A;  2HHH L;  1D8L A;  3PUY A;  5C44 G;  4A93 H;  3I4O A;  1EYG A;  1N32 Q;  1L0W A;  2V1C C;  4DR2 L;  2ID0 A;  4P74 A;  5C0X G;  1FGU A;  3PV0 A;  5H1S E;  2ZJP A;  1Q81 C;  2AKW B;  4DV1 L;  2IX0 A;  4LF6 L;  2CFM A;  3U4Z A;  2IY5 B;  1I6H H;  3OYY A;  4P72 A;  4DK6 C;  3KDF A;  4YWK A;  2UXB Q;  3K81 C;  3NEM A;  1HJP A;  4DV0 Q;  4BY7 H;  4LF8 L;  2UUA L;  3H3V H;  2IT1 A;  1SE8 A;  5J3B A;  1C0A A;  4APV A;  4JI3 Q;  2AHO B;  5JJK A;  1UE7 A;  3VDY A;  4YHH L;  3RLN A;  1E1O A;  5IYC G;  4JV5 Q;  4X62 L;  3S17 H;  2JE6 I;  1VQL A;  4JI0 Q;  3M9B A;  4JBK A;  2WB1 G;  3I56 A;  1N8R C;  1X65 A;  3OTO Q;  4LNQ A;  1L1O C;  1IBK Q;  1VQK A;  5E7N A;  4PG3 A;  1L1O A;  3GTQ H;  1IBM L;  3I55 A;  2JA8 H;  4L5R C;  1WCM G;  1VQJ A;  2VL6 A;  4JCV E;  4LUV A;  1IZ6 A;  3GTP H;  2BA0 A;  1S72 A;  2OTJ A;  4NB3 A;  1VQA A;  1CKN B;  1YHQ A;  2FXQ A;  4QQB X;  1FJG Q;  3S15 H;  4JV5 L;  1K0R A;  3STB D;  2Q2U A;  1JJ2 A;  2JA8 G;  1PH9 A;  1UE6 A;  1X54 A;  5GQO A;  3HOZ H;  2VUM H;  1T9H A;  3PGZ A;  1JMC A;  3S1M H;  3CW2 C;  2ZM6 L;  4DV3 L;  2XTI A;  1I5F A;  3PCO B;  4PZ6 A;  3J7A 5;  3M85 A;  1D7Q A;  4DUY Q;  4JI5 Q;  1PH2 A;  4X66 L;  2VUM G;  4JI1 L;  2VQF L;  3S1R H;  1CSQ A;  1EQQ A;  2ATW A;  2B63 H;  5AJ3 L;  5M3M H;  1TWC H;  4C3I H;  5IP7 H;  3GTJ H;  4LF5 Q;  2YV5 A;  1TWF H;  3J81 j;  3JC6 6;  4OWX B;  1N34 L;  4L5T A;  1N32 L;  2JA9 A;  1DGS A;  3KDF B;  2LXK A;  2B63 G;  4KHP Q;  2EQS A;  4GLV B;  4IPG A;  5IP7 G;  3W1B A;  4ME3 A;  2UU9 Q;  4JYA Q;  3E9H A;  3KJO A;  2JEA I;  4B3R Q;  2KBN A;  1AH9 A;  5JJL A;  1GO3 E;  1OXV A;  4A3C H;  2UXB L;  1GM5 A;  4BY1 H;  4XIG S;  2KCM A;  4DV0 L;  1UWV A;  2OQK A;  2E5L Q;  4JI7 L;  1G6P A;  1A62 A;  1VQP A;  3M3Y H;  1OTC A;  4FDB A;  4JI3 L;  3FKI G;  3E9I A;  4LWC A;  5FLM H;  4KHZ A;  2R7F A;  4EX5 A;  1UE1 A;  1NJI C;  3TS2 A;  2YTV A;  3TRZ A;  4NXN Q;  3RLF A;  2OQ0 A;  3RLO A;  3W1G A;  4QGU A;  3J81 c;  4DV6 Q;  4ALP A;  1Y1W H;  5FLM G;  4UP8 A;  3RR5 A;  4R4Q A;  5GAD C;  1K3R A;  2D0P A;  4R4O A;  4R1J A;  1X6O A;  3OTO L;  3CD6 A;  1IBK L;  5IWA Q;  4X64 Q;  2BH2 A;  3CPW A;  3AQQ A;  2RCN A;  1IL2 A;  4JBJ A;  3KF6 B;  1NMF A;  2PI2 A;  1Y1W G;  4WJ4 A;  4YY3 Q;  4KLK A;  2JK8 A;  3KFU A;  5IP9 H;  1YI2 A;  5M5X H;  3AFP A;  5IYD H;  2PQA A;  1MJE A;  3HOY H;  1VQD A;  3PO3 H;  2A1A A;  1P16 A;  4HIK A;  2LSS A;  3I4M H;  1W3S A;  2MNA A;  1V1Q A;  1YZ6 A;  4X6A H;  1V43 A;  1X9N A;  5IP9 G;  2JQO A;  2E2H H;  4OX9 Q;  1M90 C;  3KF8 B;  2K75 A;  4C3J H;  3HOY G;  3J80 c;  4A3J H;  1L2F A;  4DUY L;  1QVF A;  4JI5 L;  3CCJ A;  1M1K C;  4QIW E;  3S24 A;  3I4M G;  4L5Q A;  2UXC Q;  3PO2 H;  4JOI C;  3CPF A;  1PYB A;  1CKO A;  1WI5 A;  3LGJ A;  3EN2 A;  2K5N A;  4OWT B;  3UDI A;  5HGQ A;  4LF5 L;  3M4O H;  4A3J G;  1NBW A;  4OWW B;  3H3V I;  2D0O A;  4QJF A;  3PO2 G;  2K5V A;  2RHQ B;  4KHP L;  4AYB E;  1CKM A;  2CCZ A;  1PH8 A;  4JYA L;  4DV4 Q;  2R6G A;  3HOU G;  1LM0 A;  1C7Y A;  2ZJQ A;  1XMQ L;  5C4X H;  1Z47 A;  4P73 A;  3S2D H;  1Q46 A;  4B3R L;  2R93 H;  2YU9 H;  3CCQ A;  4DR1 Q;  1SMX A;  4LUZ A;  5GAG C;  1HNW Q;  2K50 A;  1VQ7 A;  5IYB G;  2MO1 A;  3S1Q H;  2Q2T A;  2E5L L;  1XNR Q;  3G71 A;  1Y14 B;  1OXU A;  1K8G A;  4A93 G;  3ER0 A;  1YIJ A;  4B3T Q;  2NVQ H;  2ZTC A;  3W5O A;  3RN5 A;  4JI2 Q;  3CCR A;  4NXN L;  1HH2 P;  1SLJ A;  3CC7 A;  4DV6 L;  3UE1 A;  4OON A;  3U50 C;  3JAM c;  4IOA A;  4DR7 Q;  3K7A H;  3T1Y Q;  4IFD I;  1Q12 A;  1YVC A;  5DLQ E;  1NY4 A;  5IWA L;  4X64 L;  2A8V A;  4GN4 B;  3G6E A;  4JI8 Q;  2JA6 H;  1XPU A;  4BY7 G;  2PQA B;  2DGY A;  1FVI A;  2VQE Q;  3F1Z A;  2Z6K A;  5M5Y H;  1YIT A;  1SFO H;  4YY3 L;  4HIO A;  2ZTE A;  5IT9 c;  3A5Z B;  1GVP A;  4IPD A;  4DR3 Q;  4A3E H;  1XPR A;  4NXM Q;  4DAM A;  1N9W A;  2JA6 G;  3GDE A;  1B7Y B;  1V9P A;  1HZ9 A;  4YCV A;  4QY7 A;  4A3G H;  3TQY A;  1LTL A;  4HID A;  4Y52 H;  4A3E G;  1Q86 C;  2GVB A;  4DNI A;  4UP9 A;  4HJ8 A;  4LF9 Q;  1Q82 C;  5JEA G;  1PH1 A;  4HIM A;  4OX9 L;  1KAW A;  2IHF A;  3NEL A;  4POF A;  2I5M X;  1PHJ A;  1UEB A;  4A3G G;  3ULP A;  3KF6 A;  1SRU A;  2VY3 A;  2ZJR A;  3S2H H;  3E0E A;  5FJ8 H;  2UXC L;  5M3F H;  1N33 Q;  4LFA Q;  1OXT A;  1XMQ Q;  1I94 Q;  3MXN B;  4BBS H;  4UP7 A;  3K80 C;  2WP8 J;  4B3S Q;  2AWN A;  3HOZ G;  1JT8 A;  1IBL Q;  1XNQ Q;  2LXJ A;  4BBR H;  4LUO A;  1C9O A;  3OW2 A;  4GKK Q;  4IFD G;  4GOP C;  1BVS A;  2KEN A;  3HKS A;  1VCI A;  2WB1 E;  1FL0 A;  1IXR A;  3L2P A;  4GOP A;  2PMZ E;  4DV4 L;  4DV7 Q;  1HNX Q;  2F3I A;  3EIV A;  4BBR G;  1KQS A;  4JI4 Q;  1HZC A;  1BBU A;  4B3M Q;  1HNW L;  5FLX c;  4DR1 L;  4JBM A;  1JJG A;  3NBH B;  4O0A A;  2GVA A;  1KD1 C;  2HT1 A;  1U0L A;  2I5H A;  3L7Z C;  5M3M G;  3GTG H;  1A8V A;  2WAQ G;  1XNR L;  3B6Y A;  3HOV H;  3A74 A;  3G4S A;  4IPC A;  1VQB A;  5BR8 Q;  5C0X J;  4B3T L;  3ULL A;  2JA5 H;  1LYL A;  4JI2 L;  4A3B H;  3EBE A;  3CCU A;  3HOW H;  3BU2 A;  1YHB A;  2K14 A;  4DR7 L;  2CKZ B;  3KYH C;  4IO9 A;  3T1Y L;  1PH6 A;  3CAM A;  4A3C G;  3PSI A;  1J5E Q;  2VZA A;  4IJL A;  4A75 A;  1NMG A;  3G48 A;  2GN5 A;  3K7U C;  4BY1 G;  4JI8 L;  2Y0S G;  3CP0 A;  1PA6 A;  4HJ7 A;  4DUZ Q;  2KHI A;  2VQE L;  1WOC A;  4JI0 L;  4GKJ Q;  1PH3 A;  1CUK A;  2C35 B;  4NXM L;  4DR3 L;  1EUJ A;  1RIP A;  3GD7 A;  1VQ8 A;  2UUB Q;  1X3G A;  2R92 H;  4AQY Q;  1K83 H;  4LFB Q;  3M4Q A;  1TWG H;  1MIU A;  5LMN W;  2NVX H;  3T1H Q;  3HKZ G;  3TEH B;  4KI0 A;  4LF9 L;  1IYJ B;  1R9T H;  1E3P A;  2R92 G;  1FJG L;  1YJ9 A;  4LF4 Q;  4RMF A;  3CCM A;  1EFW A;  4A3L H;  3UDG A;  5IE8 A;  2XGT A;  1E22 A;  2NVY H;  4EQ5 A;  1N33 L;  3PUV A;  3Q8D A;  4A3I H;  4LFA L;  4GOP B;  2PNH A;  1I94 L;  2VW9 A;  3F2C A;  2EXD A;  4YCU A;  4A76 A;  1VQC A;  2ALY B;  4IJH A;  5IYD G;  3WWV A;  3PO3 G;  1IBL L;  1BKB A;  1XNQ L;  3J7Z C;  4A3I G;  3CMA A;  4GKK L;  4OO1 I;  1Q1B A;  3CXC A;  5HY6 A;  3RN2 A;  4LF7 Q;  2JA7 H;  2R7D A;  4YWL A;  3CCL A;  1HR0 W;  3CC2 A;  4DV7 L;  4DV2 Q;  1HNX L;  1YEZ A;  4JI4 L;  2I5L X;  4B3M L;  4P75 A;  1PV4 A;  2JA7 G;  1KIX A;  4MNO A;  1VQO A;  3CME A;  1RL2 A;  2UU9 L;  3J80 i;  3I4N H;  2B3G A;  3M4P A;  3FP9 A;  1H95 A;  4A3M H;  2E2I H;  4GNX B;  5BR8 L;  2Q2I A;  1YJN A;  1AE2 A;  2B29 A;  3RZD H;  1PFS A;  1VS0 A;  3U58 A;  1TXY A;  1JJC B;  2IHE A;  4DR5 Q;  1QZG A;  1XPO A;  3RZO H;  2UXD Q;  2R93 G;  2K4K A;  5C4X G;  1Q1E A;  3D0F A;  1SR3 A;  2E8G A;  2N49 A;  1J5E L;  3F8T A;  3S1N H;  1OXS C;  1P8L A;  1K9M C;  2N3S A;  3PUZ A;  1QVG A;  1G51 A;  5C44 H;  5LMN Q;  4DUZ L;  2R7Z H;  4GKJ L;  2RF4 A;  1VQI A;  1W2B A;  1QZH A;  3CQZ H;  1ASZ A;  4LW1 A;  4C3H H;  2NZO A;  2YYZ A;  3UE0 A;  3RNU A;  2N78 A;  2ASB A;  4HJ9 A;  1KRT A;  2K52 A;  1XMO Q;  4K0K Q;  1TWH H;  3STB C;  4AH6 A;  4LFC Q;  2UUB L;  2BH8 A;  4L5S A;  1N34 Q;  4AQY L;  2Z0S A;  3A0J A;  3H15 A;  2R7Z G;  2Z6K C;  4LFB L;  1KXL A;  4A4I A;  2KHJ A;  3AFQ A;  4HJA A;  4TQU S;  3PUW A;  3T1H L;  1E7Z A;  1Y1V H;  2QGQ A;  1EQR A;  1AE3 A;  4DKA C;  1PH4 A;  4J15 A;  4LF4 L;  2HIX A;  3JAM i;  1QVC A;  3GTK H;  3S14 H;  2JJQ A;  3BZK A;  1K73 C;  3GTL H;  1EIY B;  2H5X A;  1Y1V G;  2NZH A;  3HFZ B;  3ICE A;  1HR0 Q;  4JI7 Q;  2AMC B;  5IYC H;  3KJP A;  3PF5 A;  1N36 Q;  3I7F A;  2JEB I;  3MEF A;  3F2B A;  3CCV A;  1Q7Y C;  4JI6 Q;  1VQF A;  2D62 A;  4H02 A;  4PZ8 A;  2Q2H A;  4JG2 A;  5JJI A;  5LMU Q;  1BBW A;  2MO0 A;  4LF7 L;  1WCM H;  1OXX K;  4DPG A;  4IOC A;  1MKH A;  1X3F A;  3HOX H;  4DV2 L;  4BA2 I;  1A63 A;  4DR4 Q;  3TS0 A;  1QUQ A;  5FJ8 G;  5C3E H;  5M3F G;  2F4V Q;  4WJ3 M;  2UUC Q;  4R4I A;  3HOX G;  4BBS G;  1SN8 A;  5ELO A;  3PF4 A;  3A5U A;  5C3E G;  4X65 Q;  4DV5 Q;  4PZ7 A;  2F52 A;  3D31 A;  1KC8 C;  1HNZ Q;  3I2Z A;  1VQ4 A;  4DR5 L;  1NE3 A;  1WJJ A;  3IRB A;  4UY8 C;  1G29 1;  2UXD L;  5K36 G;  5IY0 A;  4DR6 Q;  4YCW A;  1EWI A;  4R4C A;  2MFI A;  5ELN A;  1SRO A;  1PH5 A;  1VQH A;  3CCS A;  1WYD A;  1YHA A;  1UE5 A;  4OO1 G;  3CCE A;  5LMN L;  3HOV G;  2A19 A;  2DUD A;  4GNX C;  1HZB A;  4GNX A;  3BJU A;  1VQ9 A;  1VQN A;  1XMO L;  4BXX H;  2JA5 G;  4LFC L;  4GLX A;  3DLL A;  4K0K L;  2KCT A;  2HIV A;  4A3B G;  4A3D H;  2ES2 A;  1CSP A;  3F2D A;  4NPS A;  3HOW G;  4A3F H;  2OCE A;  1E1T A;  4Y7N H;  1S3O A;  4BXX G;  1PYS B;  3UDX A;  4AIM A;  4A3D G;  1E24 A;  2HHH Q;  3GTM H;  4A3F G;  3FKI H;  4MTN A;  2RHS B;  5EAY A;  3TRE A;  3UDF A;  1J6Q A;  2YTX A;  4DR2 Q;  2N8N A;  2VS1 A;  2WAQ E;  1PH7 A;  1Q8K A;  2CQO A;  1HR0 L;  1B8A A;  2K5H A;  1VQ5 A;  1U5K A;  4UPA A;  1S40 A;  3CF5 A;  1N36 L;  1X56 A;  2YTY A;  3J81 i;  4DV1 Q;  4GLA C;  4C2M H;  4JI6 L;  4LF6 Q;  4RG1 A;  1QUQ B;  2NVT H;  4O2D A;  1L1O B;  2BA1 A;  1B70 B;  5JEA J;  1VQG A;  2EIF A;  5LMU L;  4GN5 A;  2PI2 E;  2WFW A;  1ASY A;  2UUA Q;  4LF8 Q;  4BA1 I;  1A0I A;  4A3L G;  2NN6 I;  3PIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...