2VQEQ

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqeQ00
4DV1L 4JI6L 5ELOA 4MNOA 2K4KA 3PV0A 1N36Q 4P74A 3OTOQ 3HOVH 2Q2HA 1D8LA 2KHIA 2WP8J 1N34L 2E5LL 3AFPA 5IP9G 4R4OA 1VQ9A 3G71A 1CKOA 2BA0A 3CMAA 1PH3A 4BBRH 3AYHB 1N33Q 4DPGA 5C44H 4IPHA 5M3MH 2UUAQ 1QUQB 1N32L 2BA1A 4X62Q 1J5EQ 5IYDH 5IYBG 4DKAC 4JI4Q 1HNWQ 3CCQA 1G291 4YY3Q 4A3GG 1W2BA 4NXMQ 3PSIA 5LMNQ 3I7FA 1E1OA 1PA6A 3CXCA 2HT1A 4A3DH 1Q86C 1JJCB 3RLNA 4LUVA 5IY0A 3M7NA 2K14A 1XNRL 1L2FA 2WAQG 1N8RC 2JA8H 4XTCS 2VY3A 4JG2A 5IWAQ 3A0JA 1QZGA 1XMQL 4KHPL 1AE2A 1NTGA 4NPSA 4O2DA 3NBHB 3M4QA 2D0OA 4ALPA 2BH2A 1WCMH 4NB3A 4YY3L 3PF5A 2UUBQ 1IZ6A 1TWGH 3PO2H 4X62L 1J5EL 3U4ZA 1BBUA 3HOVG 4OO1I 2FXQA 4GN5A 4QIWE 2ATWA 2NN6I 1TWHH 1JE5A 1E1TA 1SE8A 2Z6KA 3J80i 2VQEQ 3CC7A 1XPUA 1C0AA 4DR2Q 3ERSX 3JAMi 2MO0A 1EQQA 5C4JH 3D0FA 1YHBA 4A3CH 4A3BG 3STBC 1XNQL 2CKZB 5IP7G 4JYAL 3FHWA 3VDYA 2QEXA 1VQOA 5JJKA 3UDIA 3RZOH 1PH1A 4L5RC 1RIPA 3AFQA 1KIXA 4MTNA 4K0KL 1EUJA 4LUZA 4BXXG 2MFIA 2Y0SG 3MEFA 3CCJA 4KHPQ 2ZJQA 5IWAL 4LF5Q 4IFDJ 1UE1A 5IYCH 3RLOA 1E3PA 4GOPB 2AHOB 3GTKH 2EQSA 3OW2A 4A3MG 2N49A 2AMCB 4H02A 4JI8Q 1Y14B 4PZ7A 2JA5G 5JJIA 1I3QH 4LF7Q 3CF5A 4QQBX 4B3RL 4BY1H 4BA1I 2JA9A 1OXVA 1NMGA 3G4SA 3CCRA 1EYGA 3GTQH 4JOIA 1VQAA 1E7ZA 1CSQA 4PG3A 1PYBA 4JI7Q 1YIJA 2JA6G 3PUWA 3S14H 1TWFH 3K8AA 4O0AA 4JBWA 1UEBA 1EIYB 4IJHA 3GTLH 4DR4Q 1X3FA 5HY6A 4PZ8A 2PQAB 2WB1E 3RZDH 2NN6G 1N34Q 2E5LQ 2YYZA 3F2CA 3L2PA 4LF7L 1Q8KA 1VQLA 3W1BA 1BBWA 4BBSH 4DR7Q 3A74A 1A0IA 3TS2A 2IY5B 4GLVB 1Q81C 2R6GA 4DR3Q 2AWNA 1VQIA 4BA2I 3F8TA 1HZCA 4LFBL 2HIXA 4LF5L 4DR1L 3J80c 3KDFA 5ELNA 4DV4Q 1M1KC 1GM5A 4QY7A 2N8NA 4K0KQ 1Q82C 3HOZG 2UXCL 4A3FG 4DV5Q 4LFAQ 1B70B 4IPCA 5LMUQ 3S1MH 4EX5A 1HZBA 4YHHL 4AYBE 2EIFA 1KRTA 2NVQH 4LF6Q 2HHHQ 3J81c 3I55A 1KL9A 3D31A 4JOIC 4C3JH 4DV7L 2F52A 2OCEA 3GD7A 3CC4A 4LFCQ 1PVOA 1G6PA 2VQEL 3KJPA 4GNXC 4IFDI 2NZOA 3HOYH 4DK3C 1TXYA 1X6OA 5M5XH 4A3KG 2JA7H 4HJ9A 5GAEC 3AEVA 2NVTH 1XMOL 3ULLA 1IBML 1Q1BA 4POFA 1CKNB 2MO1A 2E2HH 1YHQA 3FP9A 1EIFA 3S1NH 4A3FH 2WFWA 4JI0Q 3L7ZC 1EQRA 1OXSC 5C4XH 4JBJA 2VS1A 3GTOH 3H3VI 4A3GH 4A75A 2PMZE 1WI5A 4DV7Q 1WOCA 1X55A 3KDFB 4TQUS 1XPRA 2R7ZG 1Y1VH 2KCTA 2A19A 4HIMA 3I4NG 1KHIA 3U58A 4A3JH 2HQLA 1XJVA 2YTVA 2UXBQ 2YTYA 4JI4L 1SN8A 3TS0A 3GTMH 1L1OA 3DLLA 1FL0A 1VCIA 2R93H 4IOAA 3H0GG 1MJCA 3GTGH 2GVAA 2JA6H 1VQGA 1Q46A 3UDGA 1VQCA 3A5ZB 3M4OH 1M90C 3M4PA 4IPDA 4DR7L 1TWCH 5GQOA 2K75A 2N78A 4R4CA 5GROA 3CCEA 4DV6Q 4OWXB 1HR0Q 1PYSB 4RMFA 1CKNA 1BVSA 4XIGS 2A1AA 4BY7H 3HOXH 1HZ9A 4L5QA 1PH4A 2PI2E 1CUKA 4X66Q 4HIKA 3G48A 1FJGQ 4TVAB 1N9WA 2RF4A 3M3YH 1OXTA 1K0RA 1UE6A 4OXPA 2RHQB 3S2DH 2VQFQ 4JI2Q 2KHJA 3EBEA 3CQZH 4JBMA 1VQKA 1S3OA 2JJQA 4DAYB 5C3EH 1PV4A 4DR2L 1VQ6A 1VQEA 3GTPH 2E2IH 3RLFA 3HOZH 4GNXB 4AIMA 4GN4B 4A93G 5GAHC 4UY8C 2KENA 2WAQE 3S15H 4JC0A 1L1OB 4DV3Q 1H95A 2B3GA 2YV5A 3CPFA 1V1QA 1ASZA 1WCMG 1X9NA 3JAMc 2CWAA 4GLXA 3K80C 4GKKL 2R92G 1JB7A 2VUMG 4JI2L 1K83H 3KYHC 3RN5A 3K7AH 5AJ3Q 1QVGA 2JA8G 1VQDA 4ME3A 1D7QA 4IJLA 3T1HL 1KAWA 3LGJA 1LUZA 4X66L 1LYLA 3I4MG 4R1JA 1Z9FA 3W5OA 1NY4A 2MQHA 3STBD 1UWVA 4JYAQ 1HNXL 1NJIC 4AYBG 4GOPA 4BY7G 5LMNL 2I5HA 1JMCA 4C3IH 1HR0L 2R93G 3ULPA 3BU2A 1SMXA 4P71A 1AE3A 1X3GA 4HIOA 3IRBA 5FJ8G 3UDXA 4DUZQ 4HJ8A 2ASBA 1E24A 1VQJA 2ZJRA 4A76A 4DR6L 4Y52H 1BKBA 1Z47A 2ID0A 4OONA 1W3SA 1GKHA 3E9HA 2I5LX 4P73A 4DUZL 4GNXA 4A3MH 3CW2C 1VQ4A 2DUDA 3H0GH 4LUOA 4LFCL 1YHAA 4OWTB 4WJ4A 2A8VA 1X65A 1I50H 3RR5A 1SLJA 4J15A 3S24A 2VZAA 1VQ5A 2Q2TA 1IL2A 3S1QH 1NE3A 3HOWG 1IBKL 5DLQE 1Q1EA 1PH8A 5M3MG 1V43A 2AKWB 4IFDG 1YVCA 1MIUA 1EWIA 2PI2A 3HKZE 1XNRQ 3CCSA 5LMUL 3I2ZA 5M3FG 3HOXG 2R7FA 5AJ3L 3E0EA 3CD6A 2HIVA 3BJUA 3F1ZA 1YJ9A 2D62A 1L0WA 3FKIG 1YBYA 2I0QA 2D0PA 2B29A 4KLKA 1O7IA 3F2BA 1OTCA 3S2HH 3NENA 2UUAL 3PIOA 2B63G 3HOWH 1X3EA 3ZJYC 1YNXA 3EIVA 3U4VA 4AQYQ 1L1OC 3TEHB 2Q2IA 1PH5A 5FLMG 1B8AA 3BZCA 4DV2L 4DR4L 2JEBI 3NEMA 2Q2UA 4JBKA 2VQFL 4A3CG 4LF6L 4UPAA 2VL6A 4YHHQ 4OX9L 2RHSB 3S16H 4OO1G 3PGZA 3TQYA 4B3ML 5JJLA 2LSSA 3TREA 4A3EH 3KF6B 4DV4L 5C0XG 3CCVA 1VQFA 4DV6L 1NBWA 1OXUA 1CSPA 4GKJQ 4JI3L 4P72A 5IYBH 1VQHA 1KRSA 1NMFA 4A3IG 3CCMA 5M5WH 2VUMH 1G51A 4Y7NH 1IBKQ 4YWMA 3W1GA 1B7YB 5C0XJ 4LF8L 1VQBA 2LXJA 5FJ8H 2ZM6Q 2IT1A 1OXXK 3SGIA 1WYDA 1FGUA 4GS3A 4JCVE 3GO5A 3M9BA 5M5YH 3A5UA 4HJAA 3I4MH 3OYYA 3KOJA 2CCZA 1VQNA 2I5MX 4B3SQ 4JI7L 1XNQQ 4QL5A 2GN5A 2EXDA 1U0LA 4DR6Q 4DK6C 5GAGC 1A8VA 2Y0SE 5C3EG 2VW9A 3UE0A 4DV2Q 4RG1A 4YCVA 2K52A 2OTLA 2CQOA 2UXDQ 3PIPA 4IO9A 1V9PA 2UUCQ 4MZ9A 5EAYA 4A3EG 4AQYL 1VQMA 4KHZA 1C9OA 1SR3A 1KXLA 5FLXc 1K73C 4UP7A 3RNUA 3KF6A 1QVCA 3CPWA 2R7ZH 2CFMA 3H15A 4LF9L 5IP9H 4AH6A 3NELA 3PUZA 3I4OA 3H3VH 5LMNW 4A93H 1LM0A 2BH8A 2F3IA 3PUYA 4YCUA 4UP8A 2JK8A 5GADC 2YTXA 3AQQA 1WJJA 4HIDA 4LF9Q 1A63A 1SRUA 4GLAC 4DUYL 4JV5L 4OWWB 3EN2A 1QZHA 4A4IA 5IP7H 2HHHL 1IXRA 2E8GA 2UUCL 3HOYG 2H5XA 3WWVA 1JT8A 3FKIH 4DV0Q 3ULJA 1SFOH 3E9IA 1PH9A 3PCOB 5H1SE 2ES2A 3HKZG 1TWAH 1QUQA 3CP0A 2IX1A 1JJ2A 4NXNQ 2K5NA 1XPOA 1N33L 3HOUG 3BZKA 4DR1Q 1RL2A 3CMEA 1S40A 1EOVA 1LTLA 2KBNA 3CAMA 3PUVA 1KQSA 1P16A 4GN3B 3KFUA 3UE1A 5C0XI 4DR5Q 4LW1A 2VNUD 4QJFA 2LXKA 3S17H 3GDEA 1I6HH 2L15A 4A3JG 4DV1Q 4JI6Q 3K81C 1SROA 1GO3E 1UE5A 3T1HQ 1YEZA 5BR8Q 3HOUH 4GKJL 4BBSG 2K5VA 3F2DA 4BBRG 3TRZA 4QGUA 3I4NH 5J3BA 4P75A 2NVYH 4NXML 1Y1VG 1AH9A 4B3MQ 3JC66 4R4TA 4HJ7A 2Z6KC 1KC8C 4B3RQ 3J7ZC 1PHJA 4C3HH 4EQ5A 2UXBL 1N32Q 2NVXH 5IYDG 4APVA 4YWLA 1HR0W 4FDBA 1K3RA 2WB1G 4DAMA 2R92H 5BR8L 1I5FA 4HJ5A 4BY1G 1U5KA 2NZHA 2JQOA 1MJEA 3KJOA 2JA5H 3J81i 2XTIA 2UU9Q 4IPGA 2V1CC 3M85A 4X64Q 2YU9H 2OTJA 2R7DA 4DR5L 1VQ8A 5IT9c 3KLWA 1T9HA 4GOPC 1IBMQ 1VQ7A 4JI5L 3T1YQ 3CC2A 2N3SA 4NXNL 2K5HA 3ER0A 2IHFA 3GTJH 1X54A 3KF8B 3CCUA 4PMWA 1IBLQ 4L5SA 4A3LH 1UE7A 3MXNB 4DV0L 2OQ0A 4LF4Q 2GVBA 2Z0SA 2C35B 2CWPA 2IX0A 1XTDA 3S1RH 2ZJPA 3HFZB 4B3TL 4A3BH 1Y1WG 4DUYQ 2KCMA 1K8GA 1YITA 4JI1L 1I94Q 4R4QA 4B3SL 2ZTCA 4JV5Q 2F4VQ 3K7UC 5FLMH 1Q7YC 2XGTA 2UUBL 3RN2A 5JEAG 4LFAL 1JJGA 1PFSA 4LWCA 2F4VL 3Q8DA 4JI1Q 2PNHA 3L0OA 4UP9A 4LF8Q 1A62A 4X65Q 1PH6A 4DNIA 4B3TQ 2RCNA 1MKHA 4A3IH 4X6AH 1YI2A 1XMQQ 2PQAA 5JEAJ 1CKMA 1FVIA 4LF4L 3J81j 5IYCG 2QGQA 4POGA 1QVFA 4BXXH 1HZAA 3PO3G 3I56A 4WJ3M 2K50A 1IBLL 1PH7A 2JE6I 2ZTEA 3PF4A 1ASYA 1EFWA 4KI0A 3J7A5 4JI0L 1HNXQ 4C2MH 2DGYA 3G6EA 3T1YL 1K8AC 1HH2P 2UXDL 1E22A 1HNWL 1GVPA 1X56A 5IE8A 3K0XA 1Y1WH 1VQPA 1XMOQ 1S72A 3HKSA 4A3DG 1YJWA 3CCLA 1R9TH 4X65L 2UU9L 3B6YA 3PUXA 2QA4A 4IOCA 4R4IA 4GKKQ 4A3LG 3U50C 1WFQA 1KD1C 1HNZL 5C4XG 2ZM6L 1I94L 1GD7A 2B63H 4DV3L 1K9MC 3OTOL 5C44G 5K36G 4A3KH 1C7YA 1N36L 4JI8L 1PH2A 1HNZQ 2JA7G 3PO2G 5E7NA 4YWKA 3ICEA 2ZTDA 1P8LA 1YZ6A 1VS0A 2ALYB 4DV5L 1Q12A 4JI3Q 2UXCQ 4YCWA 2OWOA 5HGQA 1IYJB 1J6QA 2MNAA 3UDFA 5M3FH 2E2JH 3DM3A 4LNQA 4JI5Q 1HJPA 2JEAI 1YJNA 4LFBQ 4DR3L 2AWOA 4PZ6A 2IHEA 3PO3H 4L5TA 2OQKA 1FJGL 4OX9Q 1DGSA 4X64L
chains in the Genus database with same CATH superfamily
4JI6L 4RFBA 2E5LL 5IP9G 2KCNA 3G71A 1VQ9A 2D9UA 1PH3A 3AYHB 3VA7A 4DPGA 5M3MH 5LL6X 3K57A 4X62Q 1R4PB 4U673 1J5EQ 3FVQA 4DKAC 4JI4Q 1HNWQ 1G291 1W2BA 2EYFA 3SK4A 4NXMQ 4KY6A 1E1OA 2MP1A 3SK6A 2DY8A 1WTQA 2WAQG 1N8RC 1PRTF 3R93A 1QZGA 3A0JA 1XMQL 4KHPL 1NTGA 4O2DA 3M4QA 4NB3A 2QEJC 2LMCB 4LK1C 5M5YB 1SBBB 5I9PA 3Q22A 3NXWA 2OT2A 3NTIA 1JE5A 2B2TA 1PZID 2EJMA 1C0AA 4DF7A 3H91A 2F4IA 1EQQA 1ILPA 5C4JH 3D0FA 1Y8NB 4A3CH 4A3BG 5IP7G 5JPNC 1BQQT 4KKSA 4KKTA 2QEXA 5JJKA 1XX8A 2RA4A 1RIPA 3O13A 4LMQD 1ZYRD 3BDLA 3DEPA 4LUZA 1MGSA 2MFIA 3MEFA 4KHPQ 1UE1A 3FEWX 5NUCA 3U9SA 3RLOA 4GOPB 4NW2A 1F9SA 5CYUA 3OW2A 4JI8Q 1BCPB 1Y14B 4N8X1 1I3QH 5J39A 1R9TB 4DA2A 4XQNA 2FJ2A 1A3UA 4OELB 1LO5D 1O7YA 3OOCA 3G4SA 3GTQH 4JOIA 1LT6D 1E7ZA 3CHBD 3EVQA 1D5MC 3PUWA 1EIYB 1WTXA 3S16B 3D4WA 5HY6A 1D1KA 2WB1E 1K3BC 3L2PA 1FR3A 3EQLC 1VQLA 4C1NI 3A74A 1I4HA 4ID6A 1TQOA 2HIXA 1U4LA 3H09A 3J80c 2NVQB 3KDFA 1M1KC 4QY7A 2EVBA 4C3JG 4CJ2C 4A3FG 3EROA 3HOZG 4IPCA 2F0JA 5LMUQ 4QUFA 4EX5A 2EIFA 2HUGA 1KRTA 2BDNA 4ME5A 3DWQA 1LTID 1TKWB 2CH4W 1RHPA 2RSNA 1ENAA 1SNPA 4JOIC 4C3JH 2OCEA 3KJPA 5KIXA 3A56A 4A3KG 4MIUA 1XMOL 4V190 4POFA 3HOUB 1CKNB 4BY7B 3FP9A 1EIFA 3S1NH 1OXSC 5C4XH 3H3VI 3QIAA 3GV6A 4RGMA 3HRZC 4DK1A 1GUOA 1X55A 3KDFB 4TQUS 1Y1VH 4L63B 2L1BA 4HIMA 3PQIA 4K5XA 2F0WA 4DAPA 3DM1A 4A3JH 2NZ1D 2YTVA 4JI4L 3GTMH 1SN8A 2O4XA 3QJYA 5KYLA 3TS0A 3CKIB 4IURA 5BN5A 4X3TA 1G2TA 1QWYA 1Q46A 1VQCA 2DJFC 2QILA 5CV6A 2IPKD 3TP7A 1M90C 4K2KA 3DMUA 4DR7L 2K75A 2N78A 3CCEA 2Z1CA 4OWXB 1PYSB 1WD0A 4XIGS 2E2JB 1J9OA 3HOXH 1PH4A 4HIKA 2RF4A 1PTOH 3M3YH 1UE6A 4OXPA 3OHXC 3PO2B 3EBEA 2B2VA 4JBMA 1HHVA 1LV9A 5C3EH 4ZYSA 1VQ6A 1SNCA 1M8AA 3RLFA 2F0DA 2SOBA 1IYVA 4UY8C 2E2DC 3R2IA 2YV5A 4R8IA 4GKKL 1L0YB 1I6VC 2A69D 2PW7A 4FF3A 3K7AH 4N9PA 4ME3A 2JA8G 1D7QA 5C4JB 5FO8B 4R1JA 2NVYB 1C4QA 1XTCD 4AYBG 2R93G 1SMXA 1VF5C 3HS0C 1GUNA 1EU4A 3IRBA 4DUZQ 2XSCA 2ASBA 4Q5VA 4DAVA 1Z47A 4OONA 1W3SA 1CA6A 3CW2C 4EVOA 2EDGA 4WJ4A 3RR5A 3S24A 1S5FD 2K6AA 3HOWG 1IBKL 5DLQE 3R2TA 1PH8A 1V43A 1B53A 1F2LA 2TSSA 2PI2A 2O5IC 3I3CA 3I2ZA 4XT3B 3NE5B 2R7FA 4CJ0B 3BG3A 3SEBA 3HOXG 3BJUA 3F1ZA 2HQEA 4K6DA 2D62A 5IGDA 3FKIG 3D6CA 4L6TB 2D0PA 3VR6A 1O7IA 3F2BA 3FRPB 3VR2A 2B63G 2DN8A 2K1BA 1X3EA 3NQTA 2FFKB 2MJ8A 3P7JA 2Q2IA 1PH5A 4RCOA 3BZDB 1ICWA 3C1EA 3NEMA 4JBKA 2VQFL 4EQOA 2RHSB 1MHWC 3S16H 2LSSA 1STHA 4QUCA 3MXPA 1ML0D 4RAUC 4DV6L 2G9HD 4JI3L 2CW0D 4I65A 2F0EA 4CDFC 1VQHA 3CCMA 2K5DA 3J81L 2VUMH 1F9RA 1BCPC 3W1GA 5C0XJ 4LF8L 1VQBA 2VW9A 1WYDA 5M5YH 5C4XB 1EEFD 2F3WA 1B9MA 3OYYA 1LT5D 2I5MX 4JI7L 1PRTD 3NHHA 1QNUA 2PO4A 5HGTA 2Y0SE 4DV2Q 1EEID 4YCVA 2K52A 3PIO3 2UXDQ 2Z9HA 4A3EG 5EAYA 4QMGA 1SR3A 4B08A 3RNUA 3KF6A 3CPWA 2R7ZH 3H15A 4TKOB 1JICA 5ELDA 1PFBA 5C3EB 3IFDA 4YCUA 5GADC 4LF9Q 3AQQA 1WJJA 2Z6BA 5FKAC 1I4GA 1SNDA 4A4IA 5IP7H 3K5MA 3WWVA 1JT8A 4DV0Q 1E0BA 3ULJA 1ENCA 1BCPD 2IX1A 2PYKA 1XPOA 4NXNQ 1VMCA 1BUVT 1RL2A 3VYSA 1S40A 3PUVA 1SE4A 2L9HA 4KKUA 1DXMA 3UE1A 1FD7D 5C0XI 4LW1A 3J80E 4QJFA 4A3GB 3NWTA 1X3QA 2L15A 4DV1Q 1II3A 1JC7A 4V0BA 1SROA 3T1HQ 1T5XD 5D3IB 5C4HA 2NVYH 1Y1VG 1AH9A 4B3MQ 2EJFC 4R4TA 2B2TC 3J7ZC 4XDXA 1PHJA 4EQ5A 2I07B 2A5HA 4APVA 4YWLA 4FDBA 2R92H 1T5EA 4HR7B 5FO9B 3T53B 3M4OB 1B50A 4K8IA 2NZHA 3KJOA 3J81i 1D5ZC 5A35A 4X64Q 4C3IB 3DWPA 5ELEA 2N3SA 3WOFA 1X3PA 1DD2A 1ET9A 2WB1B 2F0SA 2OEOA 3MAQA 1D1IA 1O7ZA 2K33A 2KCMA 1K8GA 1EY7A 1YITA 3J80L 1H9SB 3RUZA 5JEAG 2RCFA 5D65A 1JJGA 4JI1Q 4IZ8A 3TP8A 1SYFA 3D4DA 4X65Q 4B3TQ 2RCNA 4G7HC 2CQAA 1WTWA 1XMQQ 4XQJA 5IYCG 4FVMA 3ERQA 4WJ3M 4ZQ3A 2RDFA 1DZ1A 1PH7A 4C2MH 3G6EA 1HH2P 3GV3A 3HOVB 4K5VA 1B4OA 4R4IA 2JSOA 1WTHA 3GTMB 1KD1C 1U4PA 1HNZL 1I94L 3BDOA 1B3AA 1CM9A 4F87A 1GUGA 1JQYD 1K9MC 3PO2G 5IGBA 4JI3Q 1Q12A 4YCWA 1S5DD 3UDFA 2E2JH 1B3QA 1JB3A 4JI5Q 2B2WC 1D2BA 2EYOA 4DV1L 2EY2A 4MNOA 1BNZA 3TZUA 2F0KA 3OTOQ 2KHIA 1PLFA 3AFPA 5C3WA 4R4OA 1CKOA 4J6HA 2PNRC 4XXEA 2F0PA 2BA0A 3H6MA 4BBRH 5C44H 1DYQA 1C8CA 2RSOA 1JOQA 1N32L 2BA1A 5IYDH 5IYBG 4A3GG 1AP0A 3PSIA 1CFMA 3I7FA 1UAPA 4NMZA 4HTHA 1H9MA 1JJCB 1GXDC 5IY0A 2JP1A 2JA8H 5IWAQ 1WD1A 3URYA 4NPSA 4ALPA 4YY3L 2UUBQ 1IZ6A 1UNSA 3IKJA 5T1IA 4X62L 1J5EL 5COYA 4DAYA 4OO1I 2MHVA 4C1NK 4GN5A 2ATWA 2Z6KA 3J80i 4A3MB 1XPUA 3K5NA 3ERSX 1GUWA 2L5TA 1YHBA 3MFYA 3STBC 3MFGA 2BOSA 4JYAL 3VDYA 1ZYRC 1HRJA 3AFQA 1KIXA 3WOEA 3DHQA 3UI2A 2EOTA 1U9RA 2Y0SG 1KDAA 2WAQB 2HCIA 5CV5A 5IYCH 1DM0B 3S2DB 1I4XA 2ZT9C 3KBXA 4A3MG 2JXMB 4MHEA 3OSOA 1FNUA 1Y1WB 1SYGA 2JA5G 5JJIA 3HP3A 3CF5A 1STBA 4QQBX 3D8GA 4BY1H 2DY7A 2JA9A 1NMGA 2A68C 2HDMA 1VQAA 1SFOB 1CSQA 2JA6G 1DOMA 1F77A 1TWFH 2X69A 3K8AA 5J22A 1UEBA 5KNCA 3FMCA 4CDEC 2PQAB 2NN6G 1N34Q 3F2CA 3F2UA 1AZQA 2CHBD 4BBSH 2B2UA 4CDCC 4DR7Q 1A0IA 2PZTA 2IY5B 4BA2I 1VQIA 4LFBL 2AUJD 4DR1L 3NSWA 2K03A 3MVVA 2ICEC 1IKLA 4DV5Q 4LFAQ 1HZBA 4YHHL 4AYBE 2JYOA 2F03A 5IODA 3CC4A 3M7GA 5I2XA 4LFCQ 1G6PA 4RGOS 4KD4A 1EFID 1STYA 4HJ9A 5GAEC 2AQ3B 2NVTH 3BVGA 4KHVA 1V8QA 1S5CD 1LACA 1IBML 1ZEQX 2F1MA 3MWYW 2DJGC 4IUQA 2WFWA 1PMRA 1PTOD 5BN3A 2KOLA 2E75C 4A75A 1WI5A 4DV7Q 2R7ZG 1TWGB 3MA2B 3I4NG 1KHIA 2XNAC 3GTPB 4C3HB 3D3RA 2RQXA 1Z7TA 3DLLA 1HPCA 5L37A 4M8AA 3GTGH 2GVAA 2JA6H 1VQGA 3M4OH 1JWMD 3M4PA 1K83B 1R4QB 1TWCH 1U4RA 1SXTA 5ISRA 4HMJA 3W3AA 2EE1A 4L5QA 1CUKA 3C2PA 3G48A 2V4DA 1N9WA 5DAUA 1A2TA 1OXTA 4JI2Q 3CQZH 2PQEA 1S3OA 2EYPA 1VQEA 2E2IH 3HOZH 4AIMA 4GN4B 5GAHC 4A3BB 2WAQE 1JORA 1ASZA 1X9NA 4GLXA 1LT3D 3S14B 2QCPX 1TVXA 2WACA 1JB7A 2VUMG 4A3FB 5AJ3Q 1QVGA 4RGTA 4H7BA 1HA5A 3LGJA 1LUZA 2HDLA 2ICIA 3I4MG 3W5OA 4A3EB 3VR5A 1UWVA 5C5LA 1EYAA 2KUMA 1JMCA 2EY5A 2YU9B 1DOLA 1S4ZA 3T56B 2J4XA 1X3GA 3GP7A 1E24A 1VQJA 2QF7A 2ZJRA 5IT9L 2NN6H 2I5LX 1K8OA 1A15A 1UUPA 4A3MH 3AMUA 5EJWA 3H0GH 4LUOA 4J8QA 1X65A 1TWCB 1SLJA 1VQ5A 1WTPA 1EWCA 3I70A 1I4RA 1L0XB 5C0XH 5M3MG 3HOYB 1EWIA 1GOZA 1XNRQ 3K5LA 3CCSA 1IYUA 3TDQA 5LMUL 1RDPD 2Z4IA 5JPMC 1I6HB 3R3OA 2PW5A 2SDFA 1YJ9A 3HG9A 1L0WA 3CQZB 4JW0A 4ZCKA 3S2HH 3VR3A 3KF8A 3ZJYC 5HURA 1EY0A 3U4VA 1SNQA 3NTKA 5DNFA 1YNJD 3SR1A 5FLMG 2NVXB 3BZCA 4DV2L 4DR4L 2O5JC 4BBRB 3JAML 4LF6L 3DXJC 4UPAA 2VL6A 5CV4A 1KTKA 3VA5A 3H94A 4ZKBB 4B3ML 2NB0A 1TY0A 3QOLA 4FNFA 3TREA 4A3EH 1I4PA 4HMIA 1VQFA 1HQRD 1NBWA 1OXUA 4OHJA 3A8JE 4DK0A 5IYBH 1NMFA 4A3DB 1G51A 2SNMA 4YWMA 4KJNA 5FJ8H 5CV7A 1EL0A 1G91A 2HCCA 3KOJA 2CCZA 4KTAA 1VQNA 2EXDA 1A8VA 3KLRA 2I46A 2L11A 4MZ9A 1VQMA 4FXDA 4KHZA 1U4MA 5FLXc 4UP7A 3G6JB 2AQ1B 2CFMA 4LF9L 5EGTA 4AH6A 3I4OA 1LM0A 4BXXH 1A63A 1LTAD 4JV5L 2ZXPA 2Q8IB 3EN2A 1QZHA 5BN4A 2F0LA 2E8GA 4RKBA 5I9OA 2HHHL 3HOYG 3FKIH 1SFOH 1PZJD 3PCOB 1TWAH 1AN8A 1G8ZD 3CP0A 1JJ2A 2LFNA 1N33L 2RVLA 3BZKA 3MXUA 1EOVA 1LTLA 3CAMA 5CORA 1KQSA 4GN3B 1H9JA 2E76C 1CQVA 1QE6A 2OXPA 2QKIC 5CV8A 2F0VA 4C3HG 4DR5Q 4FF2A 1O80A 2K05A 4K5WA 5DEHA 2F0OA 3HOUH 3I4MB 2K5VA 4BBRG 4IUNA 4HJ7A 3LWUA 2Z6KC 1KC8C 5I4DA 2UXBL 3HZXA 1N32Q 3E6ZX 1I5FA 4DFAA 5FLXL 1HTPA 3RD4A 1MJEA 1HA6A 2OTJA 2XWBB 5JVH3 3TZDA 1VQ8A 3C1FA 1WTVA 4GOPC 4XT1B 1VQ7A 3A7LA 1EQVA 5FOBB 1HCZA 4TRDA 3S1MB 1RODA 2LKVA 1CI3M 1EZ8A 2C35B 1MSGA 1ONLA 4A3BH 3HFZB 4KN4C 4B3SL 4JV5Q 3QR8A 4R4QA 3E3XA 3GTQB 5FLMH 4UDUC 1GHKA 4LFAL 3P75A 4LWCA 2JA6B 3Q8DA 2PNHA 1F9QA 5M5XB 4DNIA 2PQAA 5JEAJ 1HZAA 3PO3G 3I56A 3OIQA 1IBLL 2G9DA 2N55A 4HCSA 3J7A5 1S5ED 3H3VC 1HNXQ 3T1YL 2DGYA 4FF4A 1K8AC 1X56A 5IE8A 1XMOQ 1S72A 4A3DG 3HOWB 2Y0SB 1R9TH 5CC4A 1LLRD 3PUXA 4IOCA 1STAA 5C4XG 1CT1D 4DV3L 1TR5A 3OTOL 2JA7G 1N36L 1HXYD 1WTRA 3RZDB 1B9NA 3ICEA 5ELCA 2UXCQ 4ABNA 1GHJA 3WDNA 4KD3A 1J6QA 2MNAA 5M3FH 3DM3A 2F0QA 3T51B 1TS2A 5G3LF 2AWOA 4PZ6A 2IHEA 2OQKA 3NBHA 4RGNA 2X6LA 1DGSA 2KVMA 1ENFA 4X64L 5ELOA 3CCLA 2K4KA 3PV0A 2PCFB 3HOVH 2Q2HA 2WP8J 4ODGA 1B44D 1KLUD 1ZKOA 5C4ZA 3QB3A 1N33Q 2NTTA 4IPHA 4ILWA 2EYJA 1Y8OB 3CCQA 4YY3Q 4JPBW 4DU9A 1GUSA 3Q23A 1SMYD 2B2UC 4IUVA 4IQZA 1PA6A 3CXCA 3SHLA 1Q86C 4HAEA 3RLNA 5E4WC 2K14A 4P2CB 1XNRL 1L2FA 4HSVA 4XTCS 2VY3A 4YIJA 1CA5A 2PPBC 4ZLTF 3NBHB 2D0OA 2BH2A 2ZXOA 4N9TA 3SVMA 4FO2A 3GTJB 2F3VA 3PO2H 1JCKB 4F8MA 1BBUA 4K6LA 3HOVG 2FXQA 2R92B 2NN6I 1TWHH 1E1TA 4BS9A 4DR2Q 2XWJB 5FO7B 2X6GA 1XNQL 2CKZB 1VQOA 1Q8IA 3RZOH 4DNRB 1A3VA 4MTNA 4K0KL 2A69C 5K36H 3CCJA 1PRTB 2O2LD 5D3DA 2Z8LA 1E3PA 1PTOC 2N49A 2CW0C 4FXKC 1LT4D 1IHZA 4PNYA 4PZ7A 5IT9E 5EBCA 4H0LC 4RHSA 5ELFA 3CCRA 1PYWD 1LTSD 1I4QA 4PG3A 5FLXE 1PYBA 4JI7Q 2EYMA 1YIJA 1Z6HA 4IJHA 5A2QL 3HOZB 4DR4Q 1JWUD 4PZ8A 2E5LQ 4FP5D 1Q8KA 5DM73 1NR2A 3D6WA 2FMCA 4GLVB 1Q81C 2R6GA 4DR3Q 1SE3A 3F8TA 3PO3B 3M4YA 3BS1A 2R7ZB 4MN3A 2NYZD 1BF4A 1GM5A 2F0MA 2N8NA 4K0KQ 1SJED 1Y1VB 2UXCL 2QDBA 3S1MH 2NVQH 3LNNA 3QO2A 3L3OC 1SYCA 3J81c 5CR3A 1KL9A 3D31A 1ET6A 4DV7L 2F52A 3GD7A 4ZRZA 1O78A 1PFMA 2EY1A 2NZOA 1WVLA 1TXYA 1X6OA 5M5XH 2JA7H 4A3IB 1TY2A 1AZPA 5C6AA 3A55A 3ULLA 1PXUA 4DXGA 2E2HH 1YHQA 3J7AF 5J1ZA 4A3FH 2CH4A 2N88A 2WIIB 3L7ZC 4H13C 2VS1A 4JBJA 4J1MA 4KY5A 3E0JA 1F9PA 3TBIB 1HFGA 3S9WA 1LTBD 1WOCA 1XPRA 3CU7A 2VB2X 4RCNA 3U58A 2EYHA 1VDZA 2EY6A 3SDZA 1W6JA 1IL8A 1SE2A 4IOAA 1EQTA 1FNVA 4KV6A 3J7AV 4WRDA 4IPDA 1K0SA 3MEHA 5GQOA 4R4CA 1HR0Q 4DV6Q 3NTHA 3S17B 1CKNA 1MSHA 2A1AA 4BY7H 1HZ9A 1LTTD 2ZXRA 4TVAB 1QOHA 3S2DH 1EIGA 2VQFQ 2K04A 3RMHA 1PTOB 5FK9C 1VQKA 2JJQA 4DAYB 4DR2L 4PMCA 4CKBA 3GTPH 4B9WA 4A93G 1RKNA 2KENA 4DV3Q 1MI2A 1V1QA 3CPFA 1WCMG 3JAMc 2CWAA 2FINB 4F7XA 1KAAA 2BE5C 1LTRD 2RKSA 1K83H 2IWHA 2WV6D 5EPLA 1EYDA 5JAVA 4CKEA 3NBIA 1LYLA 4JYAQ 1Z9FA 1NY4A 1KNEA 2MQHA 4O42A 3STBD 1HNXL 5IGGA 4BY7G 1HR0L 3ULPA 1WCMB 3BU2A 5KEEA 3DUZA 1AE3A 4EQPA 3LX0A 1CHPD 4HIOA 2IL8A 4HJ8A 2B63B 4A93B 1BKBA 3BVMA 1V1PA 1GKHA 2NWGA 3E9HA 4P73A 4DUZL 1VQ4A 4LFCL 4OWTB 2A8VA 2Q2TA 1SYEA 4J15A 2TMPA 2VZAA 1IL2A 1Q90A 1NE3A 1YNND 3FPUB 1Q1EA 4IFDG 2MUYA 1YVCA 1MIUA 1QJOA 3HKZE 3U9OA 2A74C 5DM63 2AUKA 4OL7A 3T13A 4KN7C 4DN4M 2A6ED 1YBYA 1E2WA 2B29A 1OTCA 2UUAL 1ICFB 1XXGA 2A73B 3HOWH 2SNSA 1MD2D 1FYCA 1YNXA 3V2TA 2F0HA 4PV1C 5KNBA 3BVZA 2JEBI 4QF4A 2Q2UA 4MTKA 4A3CG 1SDFA 4OO1G 5JJLA 3KF6B 5IIFA 3G7LA 4CHTB 3CCVA 2IJ0A 5M9OA 4IUPA 1CSPA 1JE4A 1SMYC 3Q6SA 4Z9CB 2F0UA 1KRSA 4A3IG 2KJXA 5M5WH 1IBKQ 2QW7A 1BXTA 2LXJA 2ZM6Q 1HNZQ 2IT1A 1OXXK 3SGIA 4GS3A 1FGUA 1FGBD 3GO5A 3M9BA 4HJAA 3I4MH 4B3SQ 4QL5A 1TWHB 1U0LA 4DK6C 1TIID 1RCVD 5C3EG 4PMBA 3UE0A 4ZAIA 4RG1A 1GJXA 1STEA 1W6KA 1V9PA 2UUCQ 3HGBA 4AQYL 1C9OA 1SYDA 1WTOA 3EFXD 4PQXA 1K73C 5EKIA 4HSPA 2KEEA 3MXGA 3PUZA 4C2MB 3T4AC 4A93H 2BH8A 3PUYA 4UP8A 4HIDA 2YTXA 3C3LA 4IN3A 1F2MA 4DUYL 4OWWB 1NR4A 1CHQD 1M4VA 2H5XA 1KABA 5G3LD 1PH9A 5H1SE 3K6OA 5EBDA 2K5NA 1B2TA 3HOUG 4QIWB 3CMEA 1P16A 3BDCA 2LXKA 2E2HB 3S17H 4OIJA 2PZUA 3K81C 1GO3E 1UE5A 4GKJL 4ZUIA 4B9XA 3F2DA 3TRZA 1PFNA 4QGUA 4QB4A 5IGEA 2CVRA 4UHVA 5C3XA 4C3JB 4LAAA 4WFN3 4NXML 2Q8RE 1GUTA 1RD9D 1SNOA 1VF7A 4FF1A 2B8FA 1ZXTA 1HR0W 1K3RA 2WB1G 2K28A 3NP8A 4IALA 2A68D 3K58A 2EXZA 4HJ5A 1H9RA 3ZYYX 1SAPA 2JQOA 2C9OA 3OPOA 2UU9Q 2V1CC 2YU9H 2R7DA 1Y8PB 3AB9A 3KLWA 3IAYA 4RA8A 3I8ZA 3CC2A 2DNCA 4NXNL 4X3KA 5KYIA 3GTJH 2KQ3A 1X54A 5E1FA 2F0IA 3KF8B 4PMWA 2GA4B 3OW7A 4DV0L 3W2DA 4LF4Q 2Z0SA 3I72A 2QDLA 2CWPA 2IX0A 1XTDA 3QWNA 3S1RH 2ZJPA 4B3TL 4DUYQ 4JI1L 1JR0D 2R93B 1Q7YC 2XGTA 4G7OC 4X3SA 3L0OA 2OF1A 1MKHA 4A3IH 4X6AH 3X3NA 1AFPA 4LJZC 1CKMA 4LF4L 3J81j 2QGQA 1TT2A 1HTLD 3E5SA 2ZTEA 3PF4A 2BE5D 1EFWA 4KI0A 2D5DA 4JI0L 4RKLA 2UXDL 1E22A 1HNWL 1GVPA 4NP5A 2UU9L 2XN9C 2QA4A 4A3KB 1G6ZA 1WFQA 3GQBA 3Q0AA 2ZM6L 3FKIB 5IOCA 1GD7A 5K36G 2EYLA 4KMUC 5JVG3 4JI8L 3J7YW 5D14A 4YWKA 2PMZB 1YZ6A 2ALYB 1VS0A 4DV5L 2K32A 1STNA 2OWOA 1ILQA 1JOOA 1IYJB 3SK8A 1HJPA 1F2ZA 1BO0A 1YJNA 4LFBQ 3RZOB 4L5TA 1FJGL 4S3SA 1N36Q 4BWGB 2K5QA 4P74A 1D8LA 1N34L 3MHBA 1PRTC 3L9AX 3IFTA 3GTKB 3A8IE 2M00A 3CMAA 4AYBB 3TSSA 4IFDH 2EPBA 2UUAQ 1QUQB 3QG1A 2VB3X 4IUUA 1EY9A 5TSSA 1QB5D 4NDXA 3CRKC 5LHY1 5LMNQ 2LS01 1CK1A 1TWAB 3KUPA 2HT1A 4A3DH 1EU3A 1BDOA 4LUVA 3M7NA 3S1NB 5M3FB 1EY8A 1IW7C 4JG2A 1AE2A 1E2VA 1WCMH 4G57A 3PF5A 1TWGH 2L0CA 1TS4A 3U4ZA 4XQQA 3SE0A 4QIWE 1VMPA 3ND9A 1SE8A 2P5ZX 4DXFA 1DJRD 2VQEQ 3CC7A 3K7AB 3JAMi 2MO0A 2NUCA 3A54A 3NK9A 3KBGA 3V96A 5C5MA 5EKKA 3P1HA 1AW7A 4L8JA 3FHWA 4O1NA 1YNJC 3UDIA 1PH1A 4L5RC 1Y69U 4R8NA 1EUJA 3TP6A 1E2ZA 1RJTA 5KRUA 4BXXG 1QCBD 3OWFA 2ZJQA 5IWAL 4LF5Q 4IFDJ 1CZGA 3GTKH 2AHOB 4I7AA 3DWAA 1C48A 2EQSA 1RTOA 2RDHA 1RF2D 2AMCB 4H02A 3MXNA 2L4NA 4LF7Q 1I50B 3S1QB 3R8BA 4B3RL 4BA1I 3ONAB 1OXVA 1EYGA 1NUCA 3S14H 4O0AA 4JBWA 3GTLH 2XVSA 1X3FA 5KGUA 2M2LA 3RZDH 3S15B 1TS3A 2YYZA 4LF7L 4HEDA 4G4KA 5EQ0A 3W1BA 1BBWA 4R9WA 4OEMB 3TS2A 2A6HD 2AWNA 1HZCA 3NPPA 4LF5L 1CZWA 3I91A 5ELNA 4DV4Q 2EJGC 5JOBA 3S2HB 5IGFA 1Q82C 3TN2A 1B70B 3HEJA 2B2YA 1CTMA 5CV9A 2KA7A 3P20A 2HHHQ 4LF6Q 3T16A 3I55A 5I6YA 4ZKCB 5C44B 1KXLA 1PVOA 2VQEL 4GNXC 4IFDI 3HOYH 4XYQA 3OIPA 4DK3C 5CGKA 1IW7D 3AEVA 2E74C 2F0TA 1Q1BA 1DONA 4Y7NB 2MO1A 2R61A 4WJWA 3HKZB 4JI0Q 1EQRA 3GTOH 3I90A 3BYYB 1QG7A 4A3GH 2PMZE 4KK7A 2JN4A 2KCTA 2PZWA 1SJHD 2A19A 2R3ZA 2B2YC 3N6RA 2HQLA 5LL6S 1SEBD 1PTOF 1S5BD 1XJVA 2UXBQ 3ITPA 2YTYA 1L1OA 1FL0A 1VCIA 2R93H 1D6EC 3H0GG 1MJCA 2XIWA 3MC0B 3A5ZB 1SNMA 4RH6A 4WORA 3UDGA 3MTSA 1HQMC 5GROA 1JWSD 2HD3A 4RMFA 2JA8B 1BVSA 2KCCA 2PI2E 3VYTA 4X66Q 1FJGQ 3SXHA 1EY6A 3SK5A 1K0RA 2RHQB 3I4NB 2F0GA 2KHJA 4OGQC 4M1UB 1PV4A 4OO1H 3PMFA 1H9KA 1PDQA 4GNXB 4K2LA 3H0GB 3S15H 4JC0A 1L1OB 2Q8TA 1H95A 2B3GA 3A7AB 3TP5A 4JVZA 3K80C 3K0YA 4EQNA 5KNDA 1SYBA 4DGZA 2R92G 4JI2L 3KYHC 3RN5A 4RHRA 4DNTB 1VQDA 2F0FA 3KLSX 4HCEA 4IJLA 2WINB 4QCLA 5CBAE 3T1HL 3K5OA 1KAWA 1A2UA 4X66L 1RTNA 4BBSB 4I7ZC 2L55A 1K8MA 3VR4A 1NJIC 2JA5B 4GOPA 5T1GA 5LMNL 2I5HA 4C3IH 4A3JB 1JOKA 4P71A 1HUNA 2D2CC 5FJ8G 3UDXA 4DR6L 4A76A 4Y52H 4UAIA 3PIP3 2ID0A 4CJ1B 3Q24A 4X3UA 5JJZA 4GNXA 1STGA 2DUDA 1YHAA 5F2DA 4RWSC 4E6IA 2RBMA 1I50H 3S1QH 1B1ZA 1EIHA 2K01A 1NSNS 2AKWB 1EYCA 2J0TD 1QNKA 4CBVA 2WKDA 5M3FG 4KY7A 5I6WA 1F2YA 5AJ3L 1TU2B 3E0EA 3CD6A 2HIVA 3QOJA 4K8JA 2I0QA 3I4LA 4KLKA 2M9VA 1XWEA 3NENA 3PIOA 1O7LA 3EIVA 4AQYQ 4ULLA 2VXWA 1L1OC 3TEHB 5CMDA 3FDTA 1B8AA 3S1RB 1H9SA 4N8FA 2ENBA 2Z4HA 1CQFA 3AU7A 5EPKA 1HFNA 4YHHQ 2L12A 5AFWA 4OX9L 2K5WA 3PGZA 2J7ZA 3TQYA 1LTGD 4DV4L 5C0XG 1ESRA 3M3YB 3JAME 2VUMB 2G5DA 3NQIA 1EWHA 4GKJQ 3HOXB 4P72A 3EA6A 2FHTA 3OMCA 4Y7NH 2LY7A 4C3IG 1B7YB 2NTSA 1DOKA 1A3TA 4TSSA 1I3QB 4JCVE 1FNWA 3A5UA 3GTOB 3FPPA 2E2IB 1XNQQ 2GN5A 4DR6Q 1KNAA 5GAGC 1YNNC 2MGSA 2OTLA 2CQOA 3PIPA 3BYTB 1J8IA 4IO9A 3OMGA 2B39A 2H1EA 4G7ZC 4H44C 1QVCA 4F88A 5IP9H 4JK1C 2RDGA 3NELA 3H3VH 5LMNW 3CRLC 2F3IA 1UEAB 2JK8A 3N52A 5E3FA 4C56C 1BBXC 2BCOA 1SRUA 5M3MB 4GLAC 2MPMA 1X32A 1TWFB 1IXRA 2UUCL 1EY5A 1IKMA 2KECA 3E9IA 2ES2A 3HKZG 1QUQA 1TS5A 4BY1B 2F0NA 3MZ5A 2B8GA 5CBEE 4DR1Q 3GTLB 2KBNA 3KFUA 1EOTA 4CDDC 1BOSA 3D4RA 2VNUD 1PZKD 1HUMA 4CKCA 3GDEA 1I6HH 4A3JG 3A8KE 4JI6Q 5ELBA 1OO9B 2B2WA 4IUTA 1YEZA 5BR8Q 2SEBD 3NWSA 4BBSG 3I4NH 5J3BA 4P75A 5E4XA 5EKLA 3JC66 3VYRA 1Q3LA 2IX3A 4B3RQ 1KDBA 1V1PB 2NBFA 4C3HH 1NCVA 3VYUA 2NVXH 5IYDG 1A6XA 1DCZA 4DAMA 5BR8L 3KK7A 4ZK9B 3ND8A 2A6EC 4GZYC 4BY1G 1U5KA 3C46A 5I2YA 1NAPA 2C5CA 4U68A 4XYOA 2JA5H 2XTIA 4IPGA 3M85A 3GTGB 4DR5L 2KEDA 5IT9c 1T9HA 3V05A 3I73A 1IBMQ 4JI5L 3T1YQ 4HN7A 2K5HA 2EZVA 3ER0A 2IHFA 3TMEA 3CCUA 1IBLQ 4L5SA 4A3LH 1KLGD 1UE7A 3MXNB 3IL8A 1D5XC 2GVBA 2OQ0A 2B2VC 3EJIA 5K5PA 1Y1WG 1I94Q 4Q0FA 2ZTCA 2F4VQ 3K7UC 2UUBL 3RN2A 4ZUJA 1PFSA 2F4VL 3OWEB 4UP9A 1G2SA 4LF8Q 1A62A 2XRSD 1PH6A 2JA7B 1YI2A 1NNXA 3K59A 1FVIA 1LABA 4POGA 1EY4A 1QVFA 1BR9A 3X3MA 2H4OA 2K50A 2JE6I 1ASYA 2DNEA 5A2QE 1QILA 3NUCA 1ESFA 1SSOA 5EPJA 4K14A 4NKLA 3DEOA 3J81E 3K0XA 1Y1WH 1VQPA 3HKSA 1YJWA 4OIKA 3KLSA 2WKCA 4X65L 3B6YA 2K7VA 1KDCA 2BDOA 4GKKQ 4A3LG 1XYIA 3LWEA 3U50C 4KJOA 5JEAH 2NVTB 4EGVA 2KHSA 2B63H 2AQ2B 1V1OA 5IGCA 5C44G 4A3KH 1AEXA 1C7YA 1PH2A 4FYDA 2A6HC 1EZ6A 4FXGC 5E7NA 2ZTDA 1P8LA 1MBYA 5HGQA 5M5WB 2FMMA 2XRQD 1BCPF 2IW3A 4LNQA 2JEAI 1K28A 4CGYB 4DR3L 3PO3H 4OX9Q
chains in the Genus database with same CATH topology
4DV1L 4JI6L 5ELOA 4MNOA 2K4KA 3PV0A 1N36Q 4P74A 3OTOQ 3HOVH 2Q2HA 1D8LA 2KHIA 2WP8J 1N34L 2E5LL 3AFPA 5IP9G 4R4OA 1VQ9A 3G71A 1CKOA 2BA0A 3CMAA 1PH3A 4BBRH 3AYHB 1N33Q 4DPGA 5C44H 4IPHA 5M3MH 2UUAQ 1QUQB 1N32L 2BA1A 4X62Q 1J5EQ 5IYDH 5IYBG 4DKAC 4JI4Q 1HNWQ 3CCQA 1G291 4YY3Q 4A3GG 1W2BA 4NXMQ 3PSIA 5LMNQ 3I7FA 1E1OA 1PA6A 3CXCA 2HT1A 4A3DH 1Q86C 1JJCB 3RLNA 4LUVA 5IY0A 3M7NA 2K14A 1XNRL 1L2FA 2WAQG 1N8RC 2JA8H 4XTCS 2VY3A 4JG2A 5IWAQ 3A0JA 1QZGA 1XMQL 4KHPL 1AE2A 1NTGA 4NPSA 4O2DA 3NBHB 3M4QA 2D0OA 4ALPA 2BH2A 1WCMH 4NB3A 4YY3L 3PF5A 2UUBQ 1IZ6A 1TWGH 3PO2H 4X62L 1J5EL 3U4ZA 1BBUA 3HOVG 4OO1I 2FXQA 4GN5A 4QIWE 2ATWA 2NN6I 1TWHH 1JE5A 1E1TA 1SE8A 2Z6KA 3J80i 2VQEQ 3CC7A 1XPUA 1C0AA 4DR2Q 3ERSX 3JAMi 2MO0A 1EQQA 5C4JH 3D0FA 1YHBA 4A3CH 4A3BG 3STBC 1XNQL 2CKZB 5IP7G 4JYAL 3FHWA 3VDYA 2QEXA 1VQOA 5JJKA 3UDIA 3RZOH 1PH1A 4L5RC 1RIPA 3AFQA 1KIXA 4MTNA 4K0KL 1EUJA 4LUZA 4BXXG 2MFIA 2Y0SG 3MEFA 3CCJA 4KHPQ 2ZJQA 5IWAL 4LF5Q 4IFDJ 1UE1A 5IYCH 3RLOA 1E3PA 4GOPB 2AHOB 3GTKH 2EQSA 3OW2A 4A3MG 2N49A 2AMCB 4H02A 4JI8Q 1Y14B 4PZ7A 2JA5G 5JJIA 1I3QH 4LF7Q 3CF5A 4QQBX 4B3RL 4BY1H 4BA1I 2JA9A 1OXVA 1NMGA 3G4SA 3CCRA 1EYGA 3GTQH 4JOIA 1VQAA 1E7ZA 1CSQA 4PG3A 1PYBA 4JI7Q 1YIJA 2JA6G 3PUWA 3S14H 1TWFH 3K8AA 4O0AA 4JBWA 1UEBA 1EIYB 4IJHA 3GTLH 4DR4Q 1X3FA 5HY6A 4PZ8A 2PQAB 2WB1E 3RZDH 2NN6G 1N34Q 2E5LQ 2YYZA 3F2CA 3L2PA 4LF7L 1Q8KA 1VQLA 3W1BA 1BBWA 4BBSH 4DR7Q 3A74A 1A0IA 3TS2A 2IY5B 4GLVB 1Q81C 2R6GA 4DR3Q 2AWNA 1VQIA 4BA2I 3F8TA 1HZCA 4LFBL 2HIXA 4LF5L 4DR1L 3J80c 3KDFA 5ELNA 4DV4Q 1M1KC 1GM5A 4QY7A 2N8NA 4K0KQ 1Q82C 3HOZG 2UXCL 4A3FG 4DV5Q 4LFAQ 1B70B 4IPCA 5LMUQ 3S1MH 4EX5A 1HZBA 4YHHL 4AYBE 2EIFA 1KRTA 2NVQH 4LF6Q 2HHHQ 3J81c 3I55A 1KL9A 3D31A 4JOIC 4C3JH 4DV7L 2F52A 2OCEA 3GD7A 3CC4A 4LFCQ 1PVOA 1G6PA 2VQEL 3KJPA 4GNXC 4IFDI 2NZOA 3HOYH 4DK3C 1TXYA 1X6OA 5M5XH 4A3KG 2JA7H 4HJ9A 5GAEC 3AEVA 2NVTH 1XMOL 3ULLA 1IBML 1Q1BA 4POFA 1CKNB 2MO1A 2E2HH 1YHQA 3FP9A 1EIFA 3S1NH 4A3FH 2WFWA 4JI0Q 3L7ZC 1EQRA 1OXSC 5C4XH 4JBJA 2VS1A 3GTOH 3H3VI 4A3GH 4A75A 2PMZE 1WI5A 4DV7Q 1WOCA 1X55A 3KDFB 4TQUS 1XPRA 2R7ZG 1Y1VH 2KCTA 2A19A 4HIMA 3I4NG 1KHIA 3U58A 4A3JH 2HQLA 1XJVA 2YTVA 2UXBQ 2YTYA 4JI4L 1SN8A 3TS0A 3GTMH 1L1OA 3DLLA 1FL0A 1VCIA 2R93H 4IOAA 3H0GG 1MJCA 3GTGH 2GVAA 2JA6H 1VQGA 1Q46A 3UDGA 1VQCA 3A5ZB 3M4OH 1M90C 3M4PA 4IPDA 4DR7L 1TWCH 5GQOA 2K75A 2N78A 4R4CA 5GROA 3CCEA 4DV6Q 4OWXB 1HR0Q 1PYSB 4RMFA 1CKNA 1BVSA 4XIGS 2A1AA 4BY7H 3HOXH 1HZ9A 4L5QA 1PH4A 2PI2E 1CUKA 4X66Q 4HIKA 3G48A 1FJGQ 4TVAB 1N9WA 2RF4A 3M3YH 1OXTA 1K0RA 1UE6A 4OXPA 2RHQB 3S2DH 2VQFQ 4JI2Q 2KHJA 3EBEA 3CQZH 4JBMA 1VQKA 1S3OA 2JJQA 4DAYB 5C3EH 1PV4A 4DR2L 1VQ6A 1VQEA 3GTPH 2E2IH 3RLFA 3HOZH 4GNXB 4AIMA 4GN4B 4A93G 5GAHC 4UY8C 2KENA 2WAQE 3S15H 4JC0A 1L1OB 4DV3Q 1H95A 2B3GA 2YV5A 3CPFA 1V1QA 1ASZA 1WCMG 1X9NA 3JAMc 2CWAA 4GLXA 3K80C 4GKKL 2R92G 1JB7A 2VUMG 4JI2L 1K83H 3KYHC 3RN5A 3K7AH 5AJ3Q 1QVGA 2JA8G 1VQDA 4ME3A 1D7QA 4IJLA 3T1HL 1KAWA 3LGJA 1LUZA 4X66L 1LYLA 3I4MG 4R1JA 1Z9FA 3W5OA 1NY4A 2MQHA 3STBD 1UWVA 4JYAQ 1HNXL 1NJIC 4AYBG 4GOPA 4BY7G 5LMNL 2I5HA 1JMCA 4C3IH 1HR0L 2R93G 3ULPA 3BU2A 1SMXA 4P71A 1AE3A 1X3GA 4HIOA 3IRBA 5FJ8G 3UDXA 4DUZQ 4HJ8A 2ASBA 1E24A 1VQJA 2ZJRA 4A76A 4DR6L 4Y52H 1BKBA 1Z47A 2ID0A 4OONA 1W3SA 1GKHA 3E9HA 2I5LX 4P73A 4DUZL 4GNXA 4A3MH 3CW2C 1VQ4A 2DUDA 3H0GH 4LUOA 4LFCL 1YHAA 4OWTB 4WJ4A 2A8VA 1X65A 1I50H 3RR5A 1SLJA 4J15A 3S24A 2VZAA 1VQ5A 2Q2TA 1IL2A 3S1QH 1NE3A 3HOWG 1IBKL 5DLQE 1Q1EA 1PH8A 5M3MG 1V43A 2AKWB 4IFDG 1YVCA 1MIUA 1EWIA 2PI2A 3HKZE 1XNRQ 3CCSA 5LMUL 3I2ZA 5M3FG 3HOXG 2R7FA 5AJ3L 3E0EA 3CD6A 2HIVA 3BJUA 3F1ZA 1YJ9A 2D62A 1L0WA 3FKIG 1YBYA 2I0QA 2D0PA 2B29A 4KLKA 1O7IA 3F2BA 1OTCA 3S2HH 3NENA 2UUAL 3PIOA 2B63G 3HOWH 1X3EA 3ZJYC 1YNXA 3EIVA 3U4VA 4AQYQ 1L1OC 3TEHB 2Q2IA 1PH5A 5FLMG 1B8AA 3BZCA 4DV2L 4DR4L 2JEBI 3NEMA 2Q2UA 4JBKA 2VQFL 4A3CG 4LF6L 4UPAA 2VL6A 4YHHQ 4OX9L 2RHSB 3S16H 4OO1G 3PGZA 3TQYA 4B3ML 5JJLA 2LSSA 3TREA 4A3EH 3KF6B 4DV4L 5C0XG 3CCVA 1VQFA 4DV6L 1NBWA 1OXUA 1CSPA 4GKJQ 4JI3L 4P72A 5IYBH 1VQHA 1KRSA 1NMFA 4A3IG 3CCMA 5M5WH 2VUMH 1G51A 4Y7NH 1IBKQ 4YWMA 3W1GA 1B7YB 5C0XJ 4LF8L 1VQBA 2LXJA 5FJ8H 2ZM6Q 2IT1A 1OXXK 3SGIA 1WYDA 1FGUA 4GS3A 4JCVE 3GO5A 3M9BA 5M5YH 3A5UA 4HJAA 3I4MH 3OYYA 3KOJA 2CCZA 1VQNA 2I5MX 4B3SQ 4JI7L 1XNQQ 4QL5A 2GN5A 2EXDA 1U0LA 4DR6Q 4DK6C 5GAGC 1A8VA 2Y0SE 5C3EG 2VW9A 3UE0A 4DV2Q 4RG1A 4YCVA 2K52A 2OTLA 2CQOA 2UXDQ 3PIPA 4IO9A 1V9PA 2UUCQ 4MZ9A 5EAYA 4A3EG 4AQYL 1VQMA 4KHZA 1C9OA 1SR3A 1KXLA 5FLXc 1K73C 4UP7A 3RNUA 3KF6A 1QVCA 3CPWA 2R7ZH 2CFMA 3H15A 4LF9L 5IP9H 4AH6A 3NELA 3PUZA 3I4OA 3H3VH 5LMNW 4A93H 1LM0A 2BH8A 2F3IA 3PUYA 4YCUA 4UP8A 2JK8A 5GADC 2YTXA 3AQQA 1WJJA 4HIDA 4LF9Q 1A63A 1SRUA 4GLAC 4DUYL 4JV5L 4OWWB 3EN2A 1QZHA 4A4IA 5IP7H 2HHHL 1IXRA 2E8GA 2UUCL 3HOYG 2H5XA 3WWVA 1JT8A 3FKIH 4DV0Q 3ULJA 1SFOH 3E9IA 1PH9A 3PCOB 5H1SE 2ES2A 3HKZG 1TWAH 1QUQA 3CP0A 2IX1A 1JJ2A 4NXNQ 2K5NA 1XPOA 1N33L 3HOUG 3BZKA 4DR1Q 1RL2A 3CMEA 1S40A 1EOVA 1LTLA 2KBNA 3CAMA 3PUVA 1KQSA 1P16A 4GN3B 3KFUA 3UE1A 5C0XI 4DR5Q 4LW1A 2VNUD 4QJFA 2LXKA 3S17H 3GDEA 1I6HH 2L15A 4A3JG 4DV1Q 4JI6Q 3K81C 1SROA 1GO3E 1UE5A 3T1HQ 1YEZA 5BR8Q 3HOUH 4GKJL 4BBSG 2K5VA 3F2DA 4BBRG 3TRZA 4QGUA 3I4NH 5J3BA 4P75A 2NVYH 4NXML 1Y1VG 1AH9A 4B3MQ 3JC66 4R4TA 4HJ7A 2Z6KC 1KC8C 4B3RQ 3J7ZC 1PHJA 4C3HH 4EQ5A 2UXBL 1N32Q 2NVXH 5IYDG 4APVA 4YWLA 1HR0W 4FDBA 1K3RA 2WB1G 4DAMA 2R92H 5BR8L 1I5FA 4HJ5A 4BY1G 1U5KA 2NZHA 2JQOA 1MJEA 3KJOA 2JA5H 3J81i 2XTIA 2UU9Q 4IPGA 2V1CC 3M85A 4X64Q 2YU9H 2OTJA 2R7DA 4DR5L 1VQ8A 5IT9c 3KLWA 1T9HA 4GOPC 1IBMQ 1VQ7A 4JI5L 3T1YQ 3CC2A 2N3SA 4NXNL 2K5HA 3ER0A 2IHFA 3GTJH 1X54A 3KF8B 3CCUA 4PMWA 1IBLQ 4L5SA 4A3LH 1UE7A 3MXNB 4DV0L 2OQ0A 4LF4Q 2GVBA 2Z0SA 2C35B 2CWPA 2IX0A 1XTDA 3S1RH 2ZJPA 3HFZB 4B3TL 4A3BH 1Y1WG 4DUYQ 2KCMA 1K8GA 1YITA 4JI1L 1I94Q 4R4QA 4B3SL 2ZTCA 4JV5Q 2F4VQ 3K7UC 5FLMH 1Q7YC 2XGTA 2UUBL 3RN2A 5JEAG 4LFAL 1JJGA 1PFSA 4LWCA 2F4VL 3Q8DA 4JI1Q 2PNHA 3L0OA 4UP9A 4LF8Q 1A62A 4X65Q 1PH6A 4DNIA 4B3TQ 2RCNA 1MKHA 4A3IH 4X6AH 1YI2A 1XMQQ 2PQAA 5JEAJ 1CKMA 1FVIA 4LF4L 3J81j 5IYCG 2QGQA 4POGA 1QVFA 4BXXH 1HZAA 3PO3G 3I56A 4WJ3M 2K50A 1IBLL 1PH7A 2JE6I 2ZTEA 3PF4A 1ASYA 1EFWA 4KI0A 3J7A5 4JI0L 1HNXQ 4C2MH 2DGYA 3G6EA 3T1YL 1K8AC 1HH2P 2UXDL 1E22A 1HNWL 1GVPA 1X56A 5IE8A 3K0XA 1Y1WH 1VQPA 1XMOQ 1S72A 3HKSA 4A3DG 1YJWA 3CCLA 1R9TH 4X65L 2UU9L 3B6YA 3PUXA 2QA4A 4IOCA 4R4IA 4GKKQ 4A3LG 3U50C 1WFQA 1KD1C 1HNZL 5C4XG 2ZM6L 1I94L 1GD7A 2B63H 4DV3L 1K9MC 3OTOL 5C44G 5K36G 4A3KH 1C7YA 1N36L 4JI8L 1PH2A 1HNZQ 2JA7G 3PO2G 5E7NA 4YWKA 3ICEA 2ZTDA 1P8LA 1YZ6A 1VS0A 2ALYB 4DV5L 1Q12A 4JI3Q 2UXCQ 4YCWA 2OWOA 5HGQA 1IYJB 1J6QA 2MNAA 3UDFA 5M3FH 2E2JH 3DM3A 4LNQA 4JI5Q 1HJPA 2JEAI 1YJNA 4LFBQ 4DR3L 2AWOA 4PZ6A 2IHEA 3PO3H 4L5TA 2OQKA 1FJGL 4OX9Q 1DGSA 4X64L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 L;  4JI6 L;  5ELO A;  4MNO A;  2K4K A;  3PV0 A;  1N36 Q;  4P74 A;  3OTO Q;  3HOV H;  2Q2H A;  1D8L A;  2KHI A;  2WP8 J;  1N34 L;  2E5L L;  3AFP A;  5IP9 G;  4R4O A;  1VQ9 A;  3G71 A;  1CKO A;  2BA0 A;  3CMA A;  1PH3 A;  4BBR H;  3AYH B;  1N33 Q;  4DPG A;  5C44 H;  4IPH A;  5M3M H;  2UUA Q;  1QUQ B;  1N32 L;  2BA1 A;  4X62 Q;  1J5E Q;  5IYD H;  5IYB G;  4DKA C;  4JI4 Q;  1HNW Q;  3CCQ A;  1G29 1;  4YY3 Q;  4A3G G;  1W2B A;  4NXM Q;  3PSI A;  5LMN Q;  3I7F A;  1E1O A;  1PA6 A;  3CXC A;  2HT1 A;  4A3D H;  1Q86 C;  1JJC B;  3RLN A;  4LUV A;  5IY0 A;  3M7N A;  2K14 A;  1XNR L;  1L2F A;  2WAQ G;  1N8R C;  2JA8 H;  4XTC S;  2VY3 A;  4JG2 A;  5IWA Q;  3A0J A;  1QZG A;  1XMQ L;  4KHP L;  1AE2 A;  1NTG A;  4NPS A;  4O2D A;  3NBH B;  3M4Q A;  2D0O A;  4ALP A;  2BH2 A;  1WCM H;  4NB3 A;  4YY3 L;  3PF5 A;  2UUB Q;  1IZ6 A;  1TWG H;  3PO2 H;  4X62 L;  1J5E L;  3U4Z A;  1BBU A;  3HOV G;  4OO1 I;  2FXQ A;  4GN5 A;  4QIW E;  2ATW A;  2NN6 I;  1TWH H;  1JE5 A;  1E1T A;  1SE8 A;  2Z6K A;  3J80 i;  2VQE Q;  3CC7 A;  1XPU A;  1C0A A;  4DR2 Q;  3ERS X;  3JAM i;  2MO0 A;  1EQQ A;  5C4J H;  3D0F A;  1YHB A;  4A3C H;  4A3B G;  3STB C;  1XNQ L;  2CKZ B;  5IP7 G;  4JYA L;  3FHW A;  3VDY A;  2QEX A;  1VQO A;  5JJK A;  3UDI A;  3RZO H;  1PH1 A;  4L5R C;  1RIP A;  3AFQ A;  1KIX A;  4MTN A;  4K0K L;  1EUJ A;  4LUZ A;  4BXX G;  2MFI A;  2Y0S G;  3MEF A;  3CCJ A;  4KHP Q;  2ZJQ A;  5IWA L;  4LF5 Q;  4IFD J;  1UE1 A;  5IYC H;  3RLO A;  1E3P A;  4GOP B;  2AHO B;  3GTK H;  2EQS A;  3OW2 A;  4A3M G;  2N49 A;  2AMC B;  4H02 A;  4JI8 Q;  1Y14 B;  4PZ7 A;  2JA5 G;  5JJI A;  1I3Q H;  4LF7 Q;  3CF5 A;  4QQB X;  4B3R L;  4BY1 H;  4BA1 I;  2JA9 A;  1OXV A;  1NMG A;  3G4S A;  3CCR A;  1EYG A;  3GTQ H;  4JOI A;  1VQA A;  1E7Z A;  1CSQ A;  4PG3 A;  1PYB A;  4JI7 Q;  1YIJ A;  2JA6 G;  3PUW A;  3S14 H;  1TWF H;  3K8A A;  4O0A A;  4JBW A;  1UEB A;  1EIY B;  4IJH A;  3GTL H;  4DR4 Q;  1X3F A;  5HY6 A;  4PZ8 A;  2PQA B;  2WB1 E;  3RZD H;  2NN6 G;  1N34 Q;  2E5L Q;  2YYZ A;  3F2C A;  3L2P A;  4LF7 L;  1Q8K A;  1VQL A;  3W1B A;  1BBW A;  4BBS H;  4DR7 Q;  3A74 A;  1A0I A;  3TS2 A;  2IY5 B;  4GLV B;  1Q81 C;  2R6G A;  4DR3 Q;  2AWN A;  1VQI A;  4BA2 I;  3F8T A;  1HZC A;  4LFB L;  2HIX A;  4LF5 L;  4DR1 L;  3J80 c;  3KDF A;  5ELN A;  4DV4 Q;  1M1K C;  1GM5 A;  4QY7 A;  2N8N A;  4K0K Q;  1Q82 C;  3HOZ G;  2UXC L;  4A3F G;  4DV5 Q;  4LFA Q;  1B70 B;  4IPC A;  5LMU Q;  3S1M H;  4EX5 A;  1HZB A;  4YHH L;  4AYB E;  2EIF A;  1KRT A;  2NVQ H;  4LF6 Q;  2HHH Q;  3J81 c;  3I55 A;  1KL9 A;  3D31 A;  4JOI C;  4C3J H;  4DV7 L;  2F52 A;  2OCE A;  3GD7 A;  3CC4 A;  4LFC Q;  1PVO A;  1G6P A;  2VQE L;  3KJP A;  4GNX C;  4IFD I;  2NZO A;  3HOY H;  4DK3 C;  1TXY A;  1X6O A;  5M5X H;  4A3K G;  2JA7 H;  4HJ9 A;  5GAE C;  3AEV A;  2NVT H;  1XMO L;  3ULL A;  1IBM L;  1Q1B A;  4POF A;  1CKN B;  2MO1 A;  2E2H H;  1YHQ A;  3FP9 A;  1EIF A;  3S1N H;  4A3F H;  2WFW A;  4JI0 Q;  3L7Z C;  1EQR A;  1OXS C;  5C4X H;  4JBJ A;  2VS1 A;  3GTO H;  3H3V I;  4A3G H;  4A75 A;  2PMZ E;  1WI5 A;  4DV7 Q;  1WOC A;  1X55 A;  3KDF B;  4TQU S;  1XPR A;  2R7Z G;  1Y1V H;  2KCT A;  2A19 A;  4HIM A;  3I4N G;  1KHI A;  3U58 A;  4A3J H;  2HQL A;  1XJV A;  2YTV A;  2UXB Q;  2YTY A;  4JI4 L;  1SN8 A;  3TS0 A;  3GTM H;  1L1O A;  3DLL A;  1FL0 A;  1VCI A;  2R93 H;  4IOA A;  3H0G G;  1MJC A;  3GTG H;  2GVA A;  2JA6 H;  1VQG A;  1Q46 A;  3UDG A;  1VQC A;  3A5Z B;  3M4O H;  1M90 C;  3M4P A;  4IPD A;  4DR7 L;  1TWC H;  5GQO A;  2K75 A;  2N78 A;  4R4C A;  5GRO A;  3CCE A;  4DV6 Q;  4OWX B;  1HR0 Q;  1PYS B;  4RMF A;  1CKN A;  1BVS A;  4XIG S;  2A1A A;  4BY7 H;  3HOX H;  1HZ9 A;  4L5Q A;  1PH4 A;  2PI2 E;  1CUK A;  4X66 Q;  4HIK A;  3G48 A;  1FJG Q;  4TVA B;  1N9W A;  2RF4 A;  3M3Y H;  1OXT A;  1K0R A;  1UE6 A;  4OXP A;  2RHQ B;  3S2D H;  2VQF Q;  4JI2 Q;  2KHJ A;  3EBE A;  3CQZ H;  4JBM A;  1VQK A;  1S3O A;  2JJQ A;  4DAY B;  5C3E H;  1PV4 A;  4DR2 L;  1VQ6 A;  1VQE A;  3GTP H;  2E2I H;  3RLF A;  3HOZ H;  4GNX B;  4AIM A;  4GN4 B;  4A93 G;  5GAH C;  4UY8 C;  2KEN A;  2WAQ E;  3S15 H;  4JC0 A;  1L1O B;  4DV3 Q;  1H95 A;  2B3G A;  2YV5 A;  3CPF A;  1V1Q A;  1ASZ A;  1WCM G;  1X9N A;  3JAM c;  2CWA A;  4GLX A;  3K80 C;  4GKK L;  2R92 G;  1JB7 A;  2VUM G;  4JI2 L;  1K83 H;  3KYH C;  3RN5 A;  3K7A H;  5AJ3 Q;  1QVG A;  2JA8 G;  1VQD A;  4ME3 A;  1D7Q A;  4IJL A;  3T1H L;  1KAW A;  3LGJ A;  1LUZ A;  4X66 L;  1LYL A;  3I4M G;  4R1J A;  1Z9F A;  3W5O A;  1NY4 A;  2MQH A;  3STB D;  1UWV A;  4JYA Q;  1HNX L;  1NJI C;  4AYB G;  4GOP A;  4BY7 G;  5LMN L;  2I5H A;  1JMC A;  4C3I H;  1HR0 L;  2R93 G;  3ULP A;  3BU2 A;  1SMX A;  4P71 A;  1AE3 A;  1X3G A;  4HIO A;  3IRB A;  5FJ8 G;  3UDX A;  4DUZ Q;  4HJ8 A;  2ASB A;  1E24 A;  1VQJ A;  2ZJR A;  4A76 A;  4DR6 L;  4Y52 H;  1BKB A;  1Z47 A;  2ID0 A;  4OON A;  1W3S A;  1GKH A;  3E9H A;  2I5L X;  4P73 A;  4DUZ L;  4GNX A;  4A3M H;  3CW2 C;  1VQ4 A;  2DUD A;  3H0G H;  4LUO A;  4LFC L;  1YHA A;  4OWT B;  4WJ4 A;  2A8V A;  1X65 A;  1I50 H;  3RR5 A;  1SLJ A;  4J15 A;  3S24 A;  2VZA A;  1VQ5 A;  2Q2T A;  1IL2 A;  3S1Q H;  1NE3 A;  3HOW G;  1IBK L;  5DLQ E;  1Q1E A;  1PH8 A;  5M3M G;  1V43 A;  2AKW B;  4IFD G;  1YVC A;  1MIU A;  1EWI A;  2PI2 A;  3HKZ E;  1XNR Q;  3CCS A;  5LMU L;  3I2Z A;  5M3F G;  3HOX G;  2R7F A;  5AJ3 L;  3E0E A;  3CD6 A;  2HIV A;  3BJU A;  3F1Z A;  1YJ9 A;  2D62 A;  1L0W A;  3FKI G;  1YBY A;  2I0Q A;  2D0P A;  2B29 A;  4KLK A;  1O7I A;  3F2B A;  1OTC A;  3S2H H;  3NEN A;  2UUA L;  3PIO A;  2B63 G;  3HOW H;  1X3E A;  3ZJY C;  1YNX A;  3EIV A;  3U4V A;  4AQY Q;  1L1O C;  3TEH B;  2Q2I A;  1PH5 A;  5FLM G;  1B8A A;  3BZC A;  4DV2 L;  4DR4 L;  2JEB I;  3NEM A;  2Q2U A;  4JBK A;  2VQF L;  4A3C G;  4LF6 L;  4UPA A;  2VL6 A;  4YHH Q;  4OX9 L;  2RHS B;  3S16 H;  4OO1 G;  3PGZ A;  3TQY A;  4B3M L;  5JJL A;  2LSS A;  3TRE A;  4A3E H;  3KF6 B;  4DV4 L;  5C0X G;  3CCV A;  1VQF A;  4DV6 L;  1NBW A;  1OXU A;  1CSP A;  4GKJ Q;  4JI3 L;  4P72 A;  5IYB H;  1VQH A;  1KRS A;  1NMF A;  4A3I G;  3CCM A;  5M5W H;  2VUM H;  1G51 A;  4Y7N H;  1IBK Q;  4YWM A;  3W1G A;  1B7Y B;  5C0X J;  4LF8 L;  1VQB A;  2LXJ A;  5FJ8 H;  2ZM6 Q;  2IT1 A;  1OXX K;  3SGI A;  1WYD A;  1FGU A;  4GS3 A;  4JCV E;  3GO5 A;  3M9B A;  5M5Y H;  3A5U A;  4HJA A;  3I4M H;  3OYY A;  3KOJ A;  2CCZ A;  1VQN A;  2I5M X;  4B3S Q;  4JI7 L;  1XNQ Q;  4QL5 A;  2GN5 A;  2EXD A;  1U0L A;  4DR6 Q;  4DK6 C;  5GAG C;  1A8V A;  2Y0S E;  5C3E G;  2VW9 A;  3UE0 A;  4DV2 Q;  4RG1 A;  4YCV A;  2K52 A;  2OTL A;  2CQO A;  2UXD Q;  3PIP A;  4IO9 A;  1V9P A;  2UUC Q;  4MZ9 A;  5EAY A;  4A3E G;  4AQY L;  1VQM A;  4KHZ A;  1C9O A;  1SR3 A;  1KXL A;  5FLX c;  1K73 C;  4UP7 A;  3RNU A;  3KF6 A;  1QVC A;  3CPW A;  2R7Z H;  2CFM A;  3H15 A;  4LF9 L;  5IP9 H;  4AH6 A;  3NEL A;  3PUZ A;  3I4O A;  3H3V H;  5LMN W;  4A93 H;  1LM0 A;  2BH8 A;  2F3I A;  3PUY A;  4YCU A;  4UP8 A;  2JK8 A;  5GAD C;  2YTX A;  3AQQ A;  1WJJ A;  4HID A;  4LF9 Q;  1A63 A;  1SRU A;  4GLA C;  4DUY L;  4JV5 L;  4OWW B;  3EN2 A;  1QZH A;  4A4I A;  5IP7 H;  2HHH L;  1IXR A;  2E8G A;  2UUC L;  3HOY G;  2H5X A;  3WWV A;  1JT8 A;  3FKI H;  4DV0 Q;  3ULJ A;  1SFO H;  3E9I A;  1PH9 A;  3PCO B;  5H1S E;  2ES2 A;  3HKZ G;  1TWA H;  1QUQ A;  3CP0 A;  2IX1 A;  1JJ2 A;  4NXN Q;  2K5N A;  1XPO A;  1N33 L;  3HOU G;  3BZK A;  4DR1 Q;  1RL2 A;  3CME A;  1S40 A;  1EOV A;  1LTL A;  2KBN A;  3CAM A;  3PUV A;  1KQS A;  1P16 A;  4GN3 B;  3KFU A;  3UE1 A;  5C0X I;  4DR5 Q;  4LW1 A;  2VNU D;  4QJF A;  2LXK A;  3S17 H;  3GDE A;  1I6H H;  2L15 A;  4A3J G;  4DV1 Q;  4JI6 Q;  3K81 C;  1SRO A;  1GO3 E;  1UE5 A;  3T1H Q;  1YEZ A;  5BR8 Q;  3HOU H;  4GKJ L;  4BBS G;  2K5V A;  3F2D A;  4BBR G;  3TRZ A;  4QGU A;  3I4N H;  5J3B A;  4P75 A;  2NVY H;  4NXM L;  1Y1V G;  1AH9 A;  4B3M Q;  3JC6 6;  4R4T A;  4HJ7 A;  2Z6K C;  1KC8 C;  4B3R Q;  3J7Z C;  1PHJ A;  4C3H H;  4EQ5 A;  2UXB L;  1N32 Q;  2NVX H;  5IYD G;  4APV A;  4YWL A;  1HR0 W;  4FDB A;  1K3R A;  2WB1 G;  4DAM A;  2R92 H;  5BR8 L;  1I5F A;  4HJ5 A;  4BY1 G;  1U5K A;  2NZH A;  2JQO A;  1MJE A;  3KJO A;  2JA5 H;  3J81 i;  2XTI A;  2UU9 Q;  4IPG A;  2V1C C;  3M85 A;  4X64 Q;  2YU9 H;  2OTJ A;  2R7D A;  4DR5 L;  1VQ8 A;  5IT9 c;  3KLW A;  1T9H A;  4GOP C;  1IBM Q;  1VQ7 A;  4JI5 L;  3T1Y Q;  3CC2 A;  2N3S A;  4NXN L;  2K5H A;  3ER0 A;  2IHF A;  3GTJ H;  1X54 A;  3KF8 B;  3CCU A;  4PMW A;  1IBL Q;  4L5S A;  4A3L H;  1UE7 A;  3MXN B;  4DV0 L;  2OQ0 A;  4LF4 Q;  2GVB A;  2Z0S A;  2C35 B;  2CWP A;  2IX0 A;  1XTD A;  3S1R H;  2ZJP A;  3HFZ B;  4B3T L;  4A3B H;  1Y1W G;  4DUY Q;  2KCM A;  1K8G A;  1YIT A;  4JI1 L;  1I94 Q;  4R4Q A;  4B3S L;  2ZTC A;  4JV5 Q;  2F4V Q;  3K7U C;  5FLM H;  1Q7Y C;  2XGT A;  2UUB L;  3RN2 A;  5JEA G;  4LFA L;  1JJG A;  1PFS A;  4LWC A;  2F4V L;  3Q8D A;  4JI1 Q;  2PNH A;  3L0O A;  4UP9 A;  4LF8 Q;  1A62 A;  4X65 Q;  1PH6 A;  4DNI A;  4B3T Q;  2RCN A;  1MKH A;  4A3I H;  4X6A H;  1YI2 A;  1XMQ Q;  2PQA A;  5JEA J;  1CKM A;  1FVI A;  4LF4 L;  3J81 j;  5IYC G;  2QGQ A;  4POG A;  1QVF A;  4BXX H;  1HZA A;  3PO3 G;  3I56 A;  4WJ3 M;  2K50 A;  1IBL L;  1PH7 A;  2JE6 I;  2ZTE A;  3PF4 A;  1ASY A;  1EFW A;  4KI0 A;  3J7A 5;  4JI0 L;  1HNX Q;  4C2M H;  2DGY A;  3G6E A;  3T1Y L;  1K8A C;  1HH2 P;  2UXD L;  1E22 A;  1HNW L;  1GVP A;  1X56 A;  5IE8 A;  3K0X A;  1Y1W H;  1VQP A;  1XMO Q;  1S72 A;  3HKS A;  4A3D G;  1YJW A;  3CCL A;  1R9T H;  4X65 L;  2UU9 L;  3B6Y A;  3PUX A;  2QA4 A;  4IOC A;  4R4I A;  4GKK Q;  4A3L G;  3U50 C;  1WFQ A;  1KD1 C;  1HNZ L;  5C4X G;  2ZM6 L;  1I94 L;  1GD7 A;  2B63 H;  4DV3 L;  1K9M C;  3OTO L;  5C44 G;  5K36 G;  4A3K H;  1C7Y A;  1N36 L;  4JI8 L;  1PH2 A;  1HNZ Q;  2JA7 G;  3PO2 G;  5E7N A;  4YWK A;  3ICE A;  2ZTD A;  1P8L A;  1YZ6 A;  1VS0 A;  2ALY B;  4DV5 L;  1Q12 A;  4JI3 Q;  2UXC Q;  4YCW A;  2OWO A;  5HGQ A;  1IYJ B;  1J6Q A;  2MNA A;  3UDF A;  5M3F H;  2E2J H;  3DM3 A;  4LNQ A;  4JI5 Q;  1HJP A;  2JEA I;  1YJN A;  4LFB Q;  4DR3 L;  2AWO A;  4PZ6 A;  2IHE A;  3PO3 H;  4L5T A;  2OQK A;  1FJG L;  4OX9 Q;  1DGS A;  4X64 L; 
#chains in the Genus database with same CATH topology
 4JI6 L;  4RFB A;  2E5L L;  5IP9 G;  2KCN A;  3G71 A;  1VQ9 A;  2D9U A;  1PH3 A;  3AYH B;  3VA7 A;  4DPG A;  5M3M H;  5LL6 X;  3K57 A;  4X62 Q;  1R4P B;  4U67 3;  1J5E Q;  3FVQ A;  4DKA C;  4JI4 Q;  1HNW Q;  1G29 1;  1W2B A;  2EYF A;  3SK4 A;  4NXM Q;  4KY6 A;  1E1O A;  2MP1 A;  3SK6 A;  2DY8 A;  1WTQ A;  2WAQ G;  1N8R C;  1PRT F;  3R93 A;  1QZG A;  3A0J A;  1XMQ L;  4KHP L;  1NTG A;  4O2D A;  3M4Q A;  4NB3 A;  2QEJ C;  2LMC B;  4LK1 C;  5M5Y B;  1SBB B;  5I9P A;  3Q22 A;  3NXW A;  2OT2 A;  3NTI A;  1JE5 A;  2B2T A;  1PZI D;  2EJM A;  1C0A A;  4DF7 A;  3H91 A;  2F4I A;  1EQQ A;  1ILP A;  5C4J H;  3D0F A;  1Y8N B;  4A3C H;  4A3B G;  5IP7 G;  5JPN C;  1BQQ T;  4KKS A;  4KKT A;  2QEX A;  5JJK A;  1XX8 A;  2RA4 A;  1RIP A;  3O13 A;  4LMQ D;  1ZYR D;  3BDL A;  3DEP A;  4LUZ A;  1MGS A;  2MFI A;  3MEF A;  4KHP Q;  1UE1 A;  3FEW X;  5NUC A;  3U9S A;  3RLO A;  4GOP B;  4NW2 A;  1F9S A;  5CYU A;  3OW2 A;  4JI8 Q;  1BCP B;  1Y14 B;  4N8X 1;  1I3Q H;  5J39 A;  1R9T B;  4DA2 A;  4XQN A;  2FJ2 A;  1A3U A;  4OEL B;  1LO5 D;  1O7Y A;  3OOC A;  3G4S A;  3GTQ H;  4JOI A;  1LT6 D;  1E7Z A;  3CHB D;  3EVQ A;  1D5M C;  3PUW A;  1EIY B;  1WTX A;  3S16 B;  3D4W A;  5HY6 A;  1D1K A;  2WB1 E;  1K3B C;  3L2P A;  1FR3 A;  3EQL C;  1VQL A;  4C1N I;  3A74 A;  1I4H A;  4ID6 A;  1TQO A;  2HIX A;  1U4L A;  3H09 A;  3J80 c;  2NVQ B;  3KDF A;  1M1K C;  4QY7 A;  2EVB A;  4C3J G;  4CJ2 C;  4A3F G;  3ERO A;  3HOZ G;  4IPC A;  2F0J A;  5LMU Q;  4QUF A;  4EX5 A;  2EIF A;  2HUG A;  1KRT A;  2BDN A;  4ME5 A;  3DWQ A;  1LTI D;  1TKW B;  2CH4 W;  1RHP A;  2RSN A;  1ENA A;  1SNP A;  4JOI C;  4C3J H;  2OCE A;  3KJP A;  5KIX A;  3A56 A;  4A3K G;  4MIU A;  1XMO L;  4V19 0;  4POF A;  3HOU B;  1CKN B;  4BY7 B;  3FP9 A;  1EIF A;  3S1N H;  1OXS C;  5C4X H;  3H3V I;  3QIA A;  3GV6 A;  4RGM A;  3HRZ C;  4DK1 A;  1GUO A;  1X55 A;  3KDF B;  4TQU S;  1Y1V H;  4L63 B;  2L1B A;  4HIM A;  3PQI A;  4K5X A;  2F0W A;  4DAP A;  3DM1 A;  4A3J H;  2NZ1 D;  2YTV A;  4JI4 L;  3GTM H;  1SN8 A;  2O4X A;  3QJY A;  5KYL A;  3TS0 A;  3CKI B;  4IUR A;  5BN5 A;  4X3T A;  1G2T A;  1QWY A;  1Q46 A;  1VQC A;  2DJF C;  2QIL A;  5CV6 A;  2IPK D;  3TP7 A;  1M90 C;  4K2K A;  3DMU A;  4DR7 L;  2K75 A;  2N78 A;  3CCE A;  2Z1C A;  4OWX B;  1PYS B;  1WD0 A;  4XIG S;  2E2J B;  1J9O A;  3HOX H;  1PH4 A;  4HIK A;  2RF4 A;  1PTO H;  3M3Y H;  1UE6 A;  4OXP A;  3OHX C;  3PO2 B;  3EBE A;  2B2V A;  4JBM A;  1HHV A;  1LV9 A;  5C3E H;  4ZYS A;  1VQ6 A;  1SNC A;  1M8A A;  3RLF A;  2F0D A;  2SOB A;  1IYV A;  4UY8 C;  2E2D C;  3R2I A;  2YV5 A;  4R8I A;  4GKK L;  1L0Y B;  1I6V C;  2A69 D;  2PW7 A;  4FF3 A;  3K7A H;  4N9P A;  4ME3 A;  2JA8 G;  1D7Q A;  5C4J B;  5FO8 B;  4R1J A;  2NVY B;  1C4Q A;  1XTC D;  4AYB G;  2R93 G;  1SMX A;  1VF5 C;  3HS0 C;  1GUN A;  1EU4 A;  3IRB A;  4DUZ Q;  2XSC A;  2ASB A;  4Q5V A;  4DAV A;  1Z47 A;  4OON A;  1W3S A;  1CA6 A;  3CW2 C;  4EVO A;  2EDG A;  4WJ4 A;  3RR5 A;  3S24 A;  1S5F D;  2K6A A;  3HOW G;  1IBK L;  5DLQ E;  3R2T A;  1PH8 A;  1V43 A;  1B53 A;  1F2L A;  2TSS A;  2PI2 A;  2O5I C;  3I3C A;  3I2Z A;  4XT3 B;  3NE5 B;  2R7F A;  4CJ0 B;  3BG3 A;  3SEB A;  3HOX G;  3BJU A;  3F1Z A;  2HQE A;  4K6D A;  2D62 A;  5IGD A;  3FKI G;  3D6C A;  4L6T B;  2D0P A;  3VR6 A;  1O7I A;  3F2B A;  3FRP B;  3VR2 A;  2B63 G;  2DN8 A;  2K1B A;  1X3E A;  3NQT A;  2FFK B;  2MJ8 A;  3P7J A;  2Q2I A;  1PH5 A;  4RCO A;  3BZD B;  1ICW A;  3C1E A;  3NEM A;  4JBK A;  2VQF L;  4EQO A;  2RHS B;  1MHW C;  3S16 H;  2LSS A;  1STH A;  4QUC A;  3MXP A;  1ML0 D;  4RAU C;  4DV6 L;  2G9H D;  4JI3 L;  2CW0 D;  4I65 A;  2F0E A;  4CDF C;  1VQH A;  3CCM A;  2K5D A;  3J81 L;  2VUM H;  1F9R A;  1BCP C;  3W1G A;  5C0X J;  4LF8 L;  1VQB A;  2VW9 A;  1WYD A;  5M5Y H;  5C4X B;  1EEF D;  2F3W A;  1B9M A;  3OYY A;  1LT5 D;  2I5M X;  4JI7 L;  1PRT D;  3NHH A;  1QNU A;  2PO4 A;  5HGT A;  2Y0S E;  4DV2 Q;  1EEI D;  4YCV A;  2K52 A;  3PIO 3;  2UXD Q;  2Z9H A;  4A3E G;  5EAY A;  4QMG A;  1SR3 A;  4B08 A;  3RNU A;  3KF6 A;  3CPW A;  2R7Z H;  3H15 A;  4TKO B;  1JIC A;  5ELD A;  1PFB A;  5C3E B;  3IFD A;  4YCU A;  5GAD C;  4LF9 Q;  3AQQ A;  1WJJ A;  2Z6B A;  5FKA C;  1I4G A;  1SND A;  4A4I A;  5IP7 H;  3K5M A;  3WWV A;  1JT8 A;  4DV0 Q;  1E0B A;  3ULJ A;  1ENC A;  1BCP D;  2IX1 A;  2PYK A;  1XPO A;  4NXN Q;  1VMC A;  1BUV T;  1RL2 A;  3VYS A;  1S40 A;  3PUV A;  1SE4 A;  2L9H A;  4KKU A;  1DXM A;  3UE1 A;  1FD7 D;  5C0X I;  4LW1 A;  3J80 E;  4QJF A;  4A3G B;  3NWT A;  1X3Q A;  2L15 A;  4DV1 Q;  1II3 A;  1JC7 A;  4V0B A;  1SRO A;  3T1H Q;  1T5X D;  5D3I B;  5C4H A;  2NVY H;  1Y1V G;  1AH9 A;  4B3M Q;  2EJF C;  4R4T A;  2B2T C;  3J7Z C;  4XDX A;  1PHJ A;  4EQ5 A;  2I07 B;  2A5H A;  4APV A;  4YWL A;  4FDB A;  2R92 H;  1T5E A;  4HR7 B;  5FO9 B;  3T53 B;  3M4O B;  1B50 A;  4K8I A;  2NZH A;  3KJO A;  3J81 i;  1D5Z C;  5A35 A;  4X64 Q;  4C3I B;  3DWP A;  5ELE A;  2N3S A;  3WOF A;  1X3P A;  1DD2 A;  1ET9 A;  2WB1 B;  2F0S A;  2OEO A;  3MAQ A;  1D1I A;  1O7Z A;  2K33 A;  2KCM A;  1K8G A;  1EY7 A;  1YIT A;  3J80 L;  1H9S B;  3RUZ A;  5JEA G;  2RCF A;  5D65 A;  1JJG A;  4JI1 Q;  4IZ8 A;  3TP8 A;  1SYF A;  3D4D A;  4X65 Q;  4B3T Q;  2RCN A;  4G7H C;  2CQA A;  1WTW A;  1XMQ Q;  4XQJ A;  5IYC G;  4FVM A;  3ERQ A;  4WJ3 M;  4ZQ3 A;  2RDF A;  1DZ1 A;  1PH7 A;  4C2M H;  3G6E A;  1HH2 P;  3GV3 A;  3HOV B;  4K5V A;  1B4O A;  4R4I A;  2JSO A;  1WTH A;  3GTM B;  1KD1 C;  1U4P A;  1HNZ L;  1I94 L;  3BDO A;  1B3A A;  1CM9 A;  4F87 A;  1GUG A;  1JQY D;  1K9M C;  3PO2 G;  5IGB A;  4JI3 Q;  1Q12 A;  4YCW A;  1S5D D;  3UDF A;  2E2J H;  1B3Q A;  1JB3 A;  4JI5 Q;  2B2W C;  1D2B A;  2EYO A;  4DV1 L;  2EY2 A;  4MNO A;  1BNZ A;  3TZU A;  2F0K A;  3OTO Q;  2KHI A;  1PLF A;  3AFP A;  5C3W A;  4R4O A;  1CKO A;  4J6H A;  2PNR C;  4XXE A;  2F0P A;  2BA0 A;  3H6M A;  4BBR H;  5C44 H;  1DYQ A;  1C8C A;  2RSO A;  1JOQ A;  1N32 L;  2BA1 A;  5IYD H;  5IYB G;  4A3G G;  1AP0 A;  3PSI A;  1CFM A;  3I7F A;  1UAP A;  4NMZ A;  4HTH A;  1H9M A;  1JJC B;  1GXD C;  5IY0 A;  2JP1 A;  2JA8 H;  5IWA Q;  1WD1 A;  3URY A;  4NPS A;  4ALP A;  4YY3 L;  2UUB Q;  1IZ6 A;  1UNS A;  3IKJ A;  5T1I A;  4X62 L;  1J5E L;  5COY A;  4DAY A;  4OO1 I;  2MHV A;  4C1N K;  4GN5 A;  2ATW A;  2Z6K A;  3J80 i;  4A3M B;  1XPU A;  3K5N A;  3ERS X;  1GUW A;  2L5T A;  1YHB A;  3MFY A;  3STB C;  3MFG A;  2BOS A;  4JYA L;  3VDY A;  1ZYR C;  1HRJ A;  3AFQ A;  1KIX A;  3WOE A;  3DHQ A;  3UI2 A;  2EOT A;  1U9R A;  2Y0S G;  1KDA A;  2WAQ B;  2HCI A;  5CV5 A;  5IYC H;  1DM0 B;  3S2D B;  1I4X A;  2ZT9 C;  3KBX A;  4A3M G;  2JXM B;  4MHE A;  3OSO A;  1FNU A;  1Y1W B;  1SYG A;  2JA5 G;  5JJI A;  3HP3 A;  3CF5 A;  1STB A;  4QQB X;  3D8G A;  4BY1 H;  2DY7 A;  2JA9 A;  1NMG A;  2A68 C;  2HDM A;  1VQA A;  1SFO B;  1CSQ A;  2JA6 G;  1DOM A;  1F77 A;  1TWF H;  2X69 A;  3K8A A;  5J22 A;  1UEB A;  5KNC A;  3FMC A;  4CDE C;  2PQA B;  2NN6 G;  1N34 Q;  3F2C A;  3F2U A;  1AZQ A;  2CHB D;  4BBS H;  2B2U A;  4CDC C;  4DR7 Q;  1A0I A;  2PZT A;  2IY5 B;  4BA2 I;  1VQI A;  4LFB L;  2AUJ D;  4DR1 L;  3NSW A;  2K03 A;  3MVV A;  2ICE C;  1IKL A;  4DV5 Q;  4LFA Q;  1HZB A;  4YHH L;  4AYB E;  2JYO A;  2F03 A;  5IOD A;  3CC4 A;  3M7G A;  5I2X A;  4LFC Q;  1G6P A;  4RGO S;  4KD4 A;  1EFI D;  1STY A;  4HJ9 A;  5GAE C;  2AQ3 B;  2NVT H;  3BVG A;  4KHV A;  1V8Q A;  1S5C D;  1LAC A;  1IBM L;  1ZEQ X;  2F1M A;  3MWY W;  2DJG C;  4IUQ A;  2WFW A;  1PMR A;  1PTO D;  5BN3 A;  2KOL A;  2E75 C;  4A75 A;  1WI5 A;  4DV7 Q;  2R7Z G;  1TWG B;  3MA2 B;  3I4N G;  1KHI A;  2XNA C;  3GTP B;  4C3H B;  3D3R A;  2RQX A;  1Z7T A;  3DLL A;  1HPC A;  5L37 A;  4M8A A;  3GTG H;  2GVA A;  2JA6 H;  1VQG A;  3M4O H;  1JWM D;  3M4P A;  1K83 B;  1R4Q B;  1TWC H;  1U4R A;  1SXT A;  5ISR A;  4HMJ A;  3W3A A;  2EE1 A;  4L5Q A;  1CUK A;  3C2P A;  3G48 A;  2V4D A;  1N9W A;  5DAU A;  1A2T A;  1OXT A;  4JI2 Q;  3CQZ H;  2PQE A;  1S3O A;  2EYP A;  1VQE A;  2E2I H;  3HOZ H;  4AIM A;  4GN4 B;  5GAH C;  4A3B B;  2WAQ E;  1JOR A;  1ASZ A;  1X9N A;  4GLX A;  1LT3 D;  3S14 B;  2QCP X;  1TVX A;  2WAC A;  1JB7 A;  2VUM G;  4A3F B;  5AJ3 Q;  1QVG A;  4RGT A;  4H7B A;  1HA5 A;  3LGJ A;  1LUZ A;  2HDL A;  2ICI A;  3I4M G;  3W5O A;  4A3E B;  3VR5 A;  1UWV A;  5C5L A;  1EYA A;  2KUM A;  1JMC A;  2EY5 A;  2YU9 B;  1DOL A;  1S4Z A;  3T56 B;  2J4X A;  1X3G A;  3GP7 A;  1E24 A;  1VQJ A;  2QF7 A;  2ZJR A;  5IT9 L;  2NN6 H;  2I5L X;  1K8O A;  1A15 A;  1UUP A;  4A3M H;  3AMU A;  5EJW A;  3H0G H;  4LUO A;  4J8Q A;  1X65 A;  1TWC B;  1SLJ A;  1VQ5 A;  1WTP A;  1EWC A;  3I70 A;  1I4R A;  1L0X B;  5C0X H;  5M3M G;  3HOY B;  1EWI A;  1GOZ A;  1XNR Q;  3K5L A;  3CCS A;  1IYU A;  3TDQ A;  5LMU L;  1RDP D;  2Z4I A;  5JPM C;  1I6H B;  3R3O A;  2PW5 A;  2SDF A;  1YJ9 A;  3HG9 A;  1L0W A;  3CQZ B;  4JW0 A;  4ZCK A;  3S2H H;  3VR3 A;  3KF8 A;  3ZJY C;  5HUR A;  1EY0 A;  3U4V A;  1SNQ A;  3NTK A;  5DNF A;  1YNJ D;  3SR1 A;  5FLM G;  2NVX B;  3BZC A;  4DV2 L;  4DR4 L;  2O5J C;  4BBR B;  3JAM L;  4LF6 L;  3DXJ C;  4UPA A;  2VL6 A;  5CV4 A;  1KTK A;  3VA5 A;  3H94 A;  4ZKB B;  4B3M L;  2NB0 A;  1TY0 A;  3QOL A;  4FNF A;  3TRE A;  4A3E H;  1I4P A;  4HMI A;  1VQF A;  1HQR D;  1NBW A;  1OXU A;  4OHJ A;  3A8J E;  4DK0 A;  5IYB H;  1NMF A;  4A3D B;  1G51 A;  2SNM A;  4YWM A;  4KJN A;  5FJ8 H;  5CV7 A;  1EL0 A;  1G91 A;  2HCC A;  3KOJ A;  2CCZ A;  4KTA A;  1VQN A;  2EXD A;  1A8V A;  3KLR A;  2I46 A;  2L11 A;  4MZ9 A;  1VQM A;  4FXD A;  4KHZ A;  1U4M A;  5FLX c;  4UP7 A;  3G6J B;  2AQ1 B;  2CFM A;  4LF9 L;  5EGT A;  4AH6 A;  3I4O A;  1LM0 A;  4BXX H;  1A63 A;  1LTA D;  4JV5 L;  2ZXP A;  2Q8I B;  3EN2 A;  1QZH A;  5BN4 A;  2F0L A;  2E8G A;  4RKB A;  5I9O A;  2HHH L;  3HOY G;  3FKI H;  1SFO H;  1PZJ D;  3PCO B;  1TWA H;  1AN8 A;  1G8Z D;  3CP0 A;  1JJ2 A;  2LFN A;  1N33 L;  2RVL A;  3BZK A;  3MXU A;  1EOV A;  1LTL A;  3CAM A;  5COR A;  1KQS A;  4GN3 B;  1H9J A;  2E76 C;  1CQV A;  1QE6 A;  2OXP A;  2QKI C;  5CV8 A;  2F0V A;  4C3H G;  4DR5 Q;  4FF2 A;  1O80 A;  2K05 A;  4K5W A;  5DEH A;  2F0O A;  3HOU H;  3I4M B;  2K5V A;  4BBR G;  4IUN A;  4HJ7 A;  3LWU A;  2Z6K C;  1KC8 C;  5I4D A;  2UXB L;  3HZX A;  1N32 Q;  3E6Z X;  1I5F A;  4DFA A;  5FLX L;  1HTP A;  3RD4 A;  1MJE A;  1HA6 A;  2OTJ A;  2XWB B;  5JVH 3;  3TZD A;  1VQ8 A;  3C1F A;  1WTV A;  4GOP C;  4XT1 B;  1VQ7 A;  3A7L A;  1EQV A;  5FOB B;  1HCZ A;  4TRD A;  3S1M B;  1ROD A;  2LKV A;  1CI3 M;  1EZ8 A;  2C35 B;  1MSG A;  1ONL A;  4A3B H;  3HFZ B;  4KN4 C;  4B3S L;  4JV5 Q;  3QR8 A;  4R4Q A;  3E3X A;  3GTQ B;  5FLM H;  4UDU C;  1GHK A;  4LFA L;  3P75 A;  4LWC A;  2JA6 B;  3Q8D A;  2PNH A;  1F9Q A;  5M5X B;  4DNI A;  2PQA A;  5JEA J;  1HZA A;  3PO3 G;  3I56 A;  3OIQ A;  1IBL L;  2G9D A;  2N55 A;  4HCS A;  3J7A 5;  1S5E D;  3H3V C;  1HNX Q;  3T1Y L;  2DGY A;  4FF4 A;  1K8A C;  1X56 A;  5IE8 A;  1XMO Q;  1S72 A;  4A3D G;  3HOW B;  2Y0S B;  1R9T H;  5CC4 A;  1LLR D;  3PUX A;  4IOC A;  1STA A;  5C4X G;  1CT1 D;  4DV3 L;  1TR5 A;  3OTO L;  2JA7 G;  1N36 L;  1HXY D;  1WTR A;  3RZD B;  1B9N A;  3ICE A;  5ELC A;  2UXC Q;  4ABN A;  1GHJ A;  3WDN A;  4KD3 A;  1J6Q A;  2MNA A;  5M3F H;  3DM3 A;  2F0Q A;  3T51 B;  1TS2 A;  5G3L F;  2AWO A;  4PZ6 A;  2IHE A;  2OQK A;  3NBH A;  4RGN A;  2X6L A;  1DGS A;  2KVM A;  1ENF A;  4X64 L;  5ELO A;  3CCL A;  2K4K A;  3PV0 A;  2PCF B;  3HOV H;  2Q2H A;  2WP8 J;  4ODG A;  1B44 D;  1KLU D;  1ZKO A;  5C4Z A;  3QB3 A;  1N33 Q;  2NTT A;  4IPH A;  4ILW A;  2EYJ A;  1Y8O B;  3CCQ A;  4YY3 Q;  4JPB W;  4DU9 A;  1GUS A;  3Q23 A;  1SMY D;  2B2U C;  4IUV A;  4IQZ A;  1PA6 A;  3CXC A;  3SHL A;  1Q86 C;  4HAE A;  3RLN A;  5E4W C;  2K14 A;  4P2C B;  1XNR L;  1L2F A;  4HSV A;  4XTC S;  2VY3 A;  4YIJ A;  1CA5 A;  2PPB C;  4ZLT F;  3NBH B;  2D0O A;  2BH2 A;  2ZXO A;  4N9T A;  3SVM A;  4FO2 A;  3GTJ B;  2F3V A;  3PO2 H;  1JCK B;  4F8M A;  1BBU A;  4K6L A;  3HOV G;  2FXQ A;  2R92 B;  2NN6 I;  1TWH H;  1E1T A;  4BS9 A;  4DR2 Q;  2XWJ B;  5FO7 B;  2X6G A;  1XNQ L;  2CKZ B;  1VQO A;  1Q8I A;  3RZO H;  4DNR B;  1A3V A;  4MTN A;  4K0K L;  2A69 C;  5K36 H;  3CCJ A;  1PRT B;  2O2L D;  5D3D A;  2Z8L A;  1E3P A;  1PTO C;  2N49 A;  2CW0 C;  4FXK C;  1LT4 D;  1IHZ A;  4PNY A;  4PZ7 A;  5IT9 E;  5EBC A;  4H0L C;  4RHS A;  5ELF A;  3CCR A;  1PYW D;  1LTS D;  1I4Q A;  4PG3 A;  5FLX E;  1PYB A;  4JI7 Q;  2EYM A;  1YIJ A;  1Z6H A;  4IJH A;  5A2Q L;  3HOZ B;  4DR4 Q;  1JWU D;  4PZ8 A;  2E5L Q;  4FP5 D;  1Q8K A;  5DM7 3;  1NR2 A;  3D6W A;  2FMC A;  4GLV B;  1Q81 C;  2R6G A;  4DR3 Q;  1SE3 A;  3F8T A;  3PO3 B;  3M4Y A;  3BS1 A;  2R7Z B;  4MN3 A;  2NYZ D;  1BF4 A;  1GM5 A;  2F0M A;  2N8N A;  4K0K Q;  1SJE D;  1Y1V B;  2UXC L;  2QDB A;  3S1M H;  2NVQ H;  3LNN A;  3QO2 A;  3L3O C;  1SYC A;  3J81 c;  5CR3 A;  1KL9 A;  3D31 A;  1ET6 A;  4DV7 L;  2F52 A;  3GD7 A;  4ZRZ A;  1O78 A;  1PFM A;  2EY1 A;  2NZO A;  1WVL A;  1TXY A;  1X6O A;  5M5X H;  2JA7 H;  4A3I B;  1TY2 A;  1AZP A;  5C6A A;  3A55 A;  3ULL A;  1PXU A;  4DXG A;  2E2H H;  1YHQ A;  3J7A F;  5J1Z A;  4A3F H;  2CH4 A;  2N88 A;  2WII B;  3L7Z C;  4H13 C;  2VS1 A;  4JBJ A;  4J1M A;  4KY5 A;  3E0J A;  1F9P A;  3TBI B;  1HFG A;  3S9W A;  1LTB D;  1WOC A;  1XPR A;  3CU7 A;  2VB2 X;  4RCN A;  3U58 A;  2EYH A;  1VDZ A;  2EY6 A;  3SDZ A;  1W6J A;  1IL8 A;  1SE2 A;  4IOA A;  1EQT A;  1FNV A;  4KV6 A;  3J7A V;  4WRD A;  4IPD A;  1K0S A;  3MEH A;  5GQO A;  4R4C A;  1HR0 Q;  4DV6 Q;  3NTH A;  3S17 B;  1CKN A;  1MSH A;  2A1A A;  4BY7 H;  1HZ9 A;  1LTT D;  2ZXR A;  4TVA B;  1QOH A;  3S2D H;  1EIG A;  2VQF Q;  2K04 A;  3RMH A;  1PTO B;  5FK9 C;  1VQK A;  2JJQ A;  4DAY B;  4DR2 L;  4PMC A;  4CKB A;  3GTP H;  4B9W A;  4A93 G;  1RKN A;  2KEN A;  4DV3 Q;  1MI2 A;  1V1Q A;  3CPF A;  1WCM G;  3JAM c;  2CWA A;  2FIN B;  4F7X A;  1KAA A;  2BE5 C;  1LTR D;  2RKS A;  1K83 H;  2IWH A;  2WV6 D;  5EPL A;  1EYD A;  5JAV A;  4CKE A;  3NBI A;  1LYL A;  4JYA Q;  1Z9F A;  1NY4 A;  1KNE A;  2MQH A;  4O42 A;  3STB D;  1HNX L;  5IGG A;  4BY7 G;  1HR0 L;  3ULP A;  1WCM B;  3BU2 A;  5KEE A;  3DUZ A;  1AE3 A;  4EQP A;  3LX0 A;  1CHP D;  4HIO A;  2IL8 A;  4HJ8 A;  2B63 B;  4A93 B;  1BKB A;  3BVM A;  1V1P A;  1GKH A;  2NWG A;  3E9H A;  4P73 A;  4DUZ L;  1VQ4 A;  4LFC L;  4OWT B;  2A8V A;  2Q2T A;  1SYE A;  4J15 A;  2TMP A;  2VZA A;  1IL2 A;  1Q90 A;  1NE3 A;  1YNN D;  3FPU B;  1Q1E A;  4IFD G;  2MUY A;  1YVC A;  1MIU A;  1QJO A;  3HKZ E;  3U9O A;  2A74 C;  5DM6 3;  2AUK A;  4OL7 A;  3T13 A;  4KN7 C;  4DN4 M;  2A6E D;  1YBY A;  1E2W A;  2B29 A;  1OTC A;  2UUA L;  1ICF B;  1XXG A;  2A73 B;  3HOW H;  2SNS A;  1MD2 D;  1FYC A;  1YNX A;  3V2T A;  2F0H A;  4PV1 C;  5KNB A;  3BVZ A;  2JEB I;  4QF4 A;  2Q2U A;  4MTK A;  4A3C G;  1SDF A;  4OO1 G;  5JJL A;  3KF6 B;  5IIF A;  3G7L A;  4CHT B;  3CCV A;  2IJ0 A;  5M9O A;  4IUP A;  1CSP A;  1JE4 A;  1SMY C;  3Q6S A;  4Z9C B;  2F0U A;  1KRS A;  4A3I G;  2KJX A;  5M5W H;  1IBK Q;  2QW7 A;  1BXT A;  2LXJ A;  2ZM6 Q;  1HNZ Q;  2IT1 A;  1OXX K;  3SGI A;  4GS3 A;  1FGU A;  1FGB D;  3GO5 A;  3M9B A;  4HJA A;  3I4M H;  4B3S Q;  4QL5 A;  1TWH B;  1U0L A;  4DK6 C;  1TII D;  1RCV D;  5C3E G;  4PMB A;  3UE0 A;  4ZAI A;  4RG1 A;  1GJX A;  1STE A;  1W6K A;  1V9P A;  2UUC Q;  3HGB A;  4AQY L;  1C9O A;  1SYD A;  1WTO A;  3EFX D;  4PQX A;  1K73 C;  5EKI A;  4HSP A;  2KEE A;  3MXG A;  3PUZ A;  4C2M B;  3T4A C;  4A93 H;  2BH8 A;  3PUY A;  4UP8 A;  4HID A;  2YTX A;  3C3L A;  4IN3 A;  1F2M A;  4DUY L;  4OWW B;  1NR4 A;  1CHQ D;  1M4V A;  2H5X A;  1KAB A;  5G3L D;  1PH9 A;  5H1S E;  3K6O A;  5EBD A;  2K5N A;  1B2T A;  3HOU G;  4QIW B;  3CME A;  1P16 A;  3BDC A;  2LXK A;  2E2H B;  3S17 H;  4OIJ A;  2PZU A;  3K81 C;  1GO3 E;  1UE5 A;  4GKJ L;  4ZUI A;  4B9X A;  3F2D A;  3TRZ A;  1PFN A;  4QGU A;  4QB4 A;  5IGE A;  2CVR A;  4UHV A;  5C3X A;  4C3J B;  4LAA A;  4WFN 3;  4NXM L;  2Q8R E;  1GUT A;  1RD9 D;  1SNO A;  1VF7 A;  4FF1 A;  2B8F A;  1ZXT A;  1HR0 W;  1K3R A;  2WB1 G;  2K28 A;  3NP8 A;  4IAL A;  2A68 D;  3K58 A;  2EXZ A;  4HJ5 A;  1H9R A;  3ZYY X;  1SAP A;  2JQO A;  2C9O A;  3OPO A;  2UU9 Q;  2V1C C;  2YU9 H;  2R7D A;  1Y8P B;  3AB9 A;  3KLW A;  3IAY A;  4RA8 A;  3I8Z A;  3CC2 A;  2DNC A;  4NXN L;  4X3K A;  5KYI A;  3GTJ H;  2KQ3 A;  1X54 A;  5E1F A;  2F0I A;  3KF8 B;  4PMW A;  2GA4 B;  3OW7 A;  4DV0 L;  3W2D A;  4LF4 Q;  2Z0S A;  3I72 A;  2QDL A;  2CWP A;  2IX0 A;  1XTD A;  3QWN A;  3S1R H;  2ZJP A;  4B3T L;  4DUY Q;  4JI1 L;  1JR0 D;  2R93 B;  1Q7Y C;  2XGT A;  4G7O C;  4X3S A;  3L0O A;  2OF1 A;  1MKH A;  4A3I H;  4X6A H;  3X3N A;  1AFP A;  4LJZ C;  1CKM A;  4LF4 L;  3J81 j;  2QGQ A;  1TT2 A;  1HTL D;  3E5S A;  2ZTE A;  3PF4 A;  2BE5 D;  1EFW A;  4KI0 A;  2D5D A;  4JI0 L;  4RKL A;  2UXD L;  1E22 A;  1HNW L;  1GVP A;  4NP5 A;  2UU9 L;  2XN9 C;  2QA4 A;  4A3K B;  1G6Z A;  1WFQ A;  3GQB A;  3Q0A A;  2ZM6 L;  3FKI B;  5IOC A;  1GD7 A;  5K36 G;  2EYL A;  4KMU C;  5JVG 3;  4JI8 L;  3J7Y W;  5D14 A;  4YWK A;  2PMZ B;  1YZ6 A;  2ALY B;  1VS0 A;  4DV5 L;  2K32 A;  1STN A;  2OWO A;  1ILQ A;  1JOO A;  1IYJ B;  3SK8 A;  1HJP A;  1F2Z A;  1BO0 A;  1YJN A;  4LFB Q;  3RZO B;  4L5T A;  1FJG L;  4S3S A;  1N36 Q;  4BWG B;  2K5Q A;  4P74 A;  1D8L A;  1N34 L;  3MHB A;  1PRT C;  3L9A X;  3IFT A;  3GTK B;  3A8I E;  2M00 A;  3CMA A;  4AYB B;  3TSS A;  4IFD H;  2EPB A;  2UUA Q;  1QUQ B;  3QG1 A;  2VB3 X;  4IUU A;  1EY9 A;  5TSS A;  1QB5 D;  4NDX A;  3CRK C;  5LHY 1;  5LMN Q;  2LS0 1;  1CK1 A;  1TWA B;  3KUP A;  2HT1 A;  4A3D H;  1EU3 A;  1BDO A;  4LUV A;  3M7N A;  3S1N B;  5M3F B;  1EY8 A;  1IW7 C;  4JG2 A;  1AE2 A;  1E2V A;  1WCM H;  4G57 A;  3PF5 A;  1TWG H;  2L0C A;  1TS4 A;  3U4Z A;  4XQQ A;  3SE0 A;  4QIW E;  1VMP A;  3ND9 A;  1SE8 A;  2P5Z X;  4DXF A;  1DJR D;  2VQE Q;  3CC7 A;  3K7A B;  3JAM i;  2MO0 A;  2NUC A;  3A54 A;  3NK9 A;  3KBG A;  3V96 A;  5C5M A;  5EKK A;  3P1H A;  1AW7 A;  4L8J A;  3FHW A;  4O1N A;  1YNJ C;  3UDI A;  1PH1 A;  4L5R C;  1Y69 U;  4R8N A;  1EUJ A;  3TP6 A;  1E2Z A;  1RJT A;  5KRU A;  4BXX G;  1QCB D;  3OWF A;  2ZJQ A;  5IWA L;  4LF5 Q;  4IFD J;  1CZG A;  3GTK H;  2AHO B;  4I7A A;  3DWA A;  1C48 A;  2EQS A;  1RTO A;  2RDH A;  1RF2 D;  2AMC B;  4H02 A;  3MXN A;  2L4N A;  4LF7 Q;  1I50 B;  3S1Q B;  3R8B A;  4B3R L;  4BA1 I;  3ONA B;  1OXV A;  1EYG A;  1NUC A;  3S14 H;  4O0A A;  4JBW A;  3GTL H;  2XVS A;  1X3F A;  5KGU A;  2M2L A;  3RZD H;  3S15 B;  1TS3 A;  2YYZ A;  4LF7 L;  4HED A;  4G4K A;  5EQ0 A;  3W1B A;  1BBW A;  4R9W A;  4OEM B;  3TS2 A;  2A6H D;  2AWN A;  1HZC A;  3NPP A;  4LF5 L;  1CZW A;  3I91 A;  5ELN A;  4DV4 Q;  2EJG C;  5JOB A;  3S2H B;  5IGF A;  1Q82 C;  3TN2 A;  1B70 B;  3HEJ A;  2B2Y A;  1CTM A;  5CV9 A;  2KA7 A;  3P20 A;  2HHH Q;  4LF6 Q;  3T16 A;  3I55 A;  5I6Y A;  4ZKC B;  5C44 B;  1KXL A;  1PVO A;  2VQE L;  4GNX C;  4IFD I;  3HOY H;  4XYQ A;  3OIP A;  4DK3 C;  5CGK A;  1IW7 D;  3AEV A;  2E74 C;  2F0T A;  1Q1B A;  1DON A;  4Y7N B;  2MO1 A;  2R61 A;  4WJW A;  3HKZ B;  4JI0 Q;  1EQR A;  3GTO H;  3I90 A;  3BYY B;  1QG7 A;  4A3G H;  2PMZ E;  4KK7 A;  2JN4 A;  2KCT A;  2PZW A;  1SJH D;  2A19 A;  2R3Z A;  2B2Y C;  3N6R A;  2HQL A;  5LL6 S;  1SEB D;  1PTO F;  1S5B D;  1XJV A;  2UXB Q;  3ITP A;  2YTY A;  1L1O A;  1FL0 A;  1VCI A;  2R93 H;  1D6E C;  3H0G G;  1MJC A;  2XIW A;  3MC0 B;  3A5Z B;  1SNM A;  4RH6 A;  4WOR A;  3UDG A;  3MTS A;  1HQM C;  5GRO A;  1JWS D;  2HD3 A;  4RMF A;  2JA8 B;  1BVS A;  2KCC A;  2PI2 E;  3VYT A;  4X66 Q;  1FJG Q;  3SXH A;  1EY6 A;  3SK5 A;  1K0R A;  2RHQ B;  3I4N B;  2F0G A;  2KHJ A;  4OGQ C;  4M1U B;  1PV4 A;  4OO1 H;  3PMF A;  1H9K A;  1PDQ A;  4GNX B;  4K2L A;  3H0G B;  3S15 H;  4JC0 A;  1L1O B;  2Q8T A;  1H95 A;  2B3G A;  3A7A B;  3TP5 A;  4JVZ A;  3K80 C;  3K0Y A;  4EQN A;  5KND A;  1SYB A;  4DGZ A;  2R92 G;  4JI2 L;  3KYH C;  3RN5 A;  4RHR A;  4DNT B;  1VQD A;  2F0F A;  3KLS X;  4HCE A;  4IJL A;  2WIN B;  4QCL A;  5CBA E;  3T1H L;  3K5O A;  1KAW A;  1A2U A;  4X66 L;  1RTN A;  4BBS B;  4I7Z C;  2L55 A;  1K8M A;  3VR4 A;  1NJI C;  2JA5 B;  4GOP A;  5T1G A;  5LMN L;  2I5H A;  4C3I H;  4A3J B;  1JOK A;  4P71 A;  1HUN A;  2D2C C;  5FJ8 G;  3UDX A;  4DR6 L;  4A76 A;  4Y52 H;  4UAI A;  3PIP 3;  2ID0 A;  4CJ1 B;  3Q24 A;  4X3U A;  5JJZ A;  4GNX A;  1STG A;  2DUD A;  1YHA A;  5F2D A;  4RWS C;  4E6I A;  2RBM A;  1I50 H;  3S1Q H;  1B1Z A;  1EIH A;  2K01 A;  1NSN S;  2AKW B;  1EYC A;  2J0T D;  1QNK A;  4CBV A;  2WKD A;  5M3F G;  4KY7 A;  5I6W A;  1F2Y A;  5AJ3 L;  1TU2 B;  3E0E A;  3CD6 A;  2HIV A;  3QOJ A;  4K8J A;  2I0Q A;  3I4L A;  4KLK A;  2M9V A;  1XWE A;  3NEN A;  3PIO A;  1O7L A;  3EIV A;  4AQY Q;  4ULL A;  2VXW A;  1L1O C;  3TEH B;  5CMD A;  3FDT A;  1B8A A;  3S1R B;  1H9S A;  4N8F A;  2ENB A;  2Z4H A;  1CQF A;  3AU7 A;  5EPK A;  1HFN A;  4YHH Q;  2L12 A;  5AFW A;  4OX9 L;  2K5W A;  3PGZ A;  2J7Z A;  3TQY A;  1LTG D;  4DV4 L;  5C0X G;  1ESR A;  3M3Y B;  3JAM E;  2VUM B;  2G5D A;  3NQI A;  1EWH A;  4GKJ Q;  3HOX B;  4P72 A;  3EA6 A;  2FHT A;  3OMC A;  4Y7N H;  2LY7 A;  4C3I G;  1B7Y B;  2NTS A;  1DOK A;  1A3T A;  4TSS A;  1I3Q B;  4JCV E;  1FNW A;  3A5U A;  3GTO B;  3FPP A;  2E2I B;  1XNQ Q;  2GN5 A;  4DR6 Q;  1KNA A;  5GAG C;  1YNN C;  2MGS A;  2OTL A;  2CQO A;  3PIP A;  3BYT B;  1J8I A;  4IO9 A;  3OMG A;  2B39 A;  2H1E A;  4G7Z C;  4H44 C;  1QVC A;  4F88 A;  5IP9 H;  4JK1 C;  2RDG A;  3NEL A;  3H3V H;  5LMN W;  3CRL C;  2F3I A;  1UEA B;  2JK8 A;  3N52 A;  5E3F A;  4C56 C;  1BBX C;  2BCO A;  1SRU A;  5M3M B;  4GLA C;  2MPM A;  1X32 A;  1TWF B;  1IXR A;  2UUC L;  1EY5 A;  1IKM A;  2KEC A;  3E9I A;  2ES2 A;  3HKZ G;  1QUQ A;  1TS5 A;  4BY1 B;  2F0N A;  3MZ5 A;  2B8G A;  5CBE E;  4DR1 Q;  3GTL B;  2KBN A;  3KFU A;  1EOT A;  4CDD C;  1BOS A;  3D4R A;  2VNU D;  1PZK D;  1HUM A;  4CKC A;  3GDE A;  1I6H H;  4A3J G;  3A8K E;  4JI6 Q;  5ELB A;  1OO9 B;  2B2W A;  4IUT A;  1YEZ A;  5BR8 Q;  2SEB D;  3NWS A;  4BBS G;  3I4N H;  5J3B A;  4P75 A;  5E4X A;  5EKL A;  3JC6 6;  3VYR A;  1Q3L A;  2IX3 A;  4B3R Q;  1KDB A;  1V1P B;  2NBF A;  4C3H H;  1NCV A;  3VYU A;  2NVX H;  5IYD G;  1A6X A;  1DCZ A;  4DAM A;  5BR8 L;  3KK7 A;  4ZK9 B;  3ND8 A;  2A6E C;  4GZY C;  4BY1 G;  1U5K A;  3C46 A;  5I2Y A;  1NAP A;  2C5C A;  4U68 A;  4XYO A;  2JA5 H;  2XTI A;  4IPG A;  3M85 A;  3GTG B;  4DR5 L;  2KED A;  5IT9 c;  1T9H A;  3V05 A;  3I73 A;  1IBM Q;  4JI5 L;  3T1Y Q;  4HN7 A;  2K5H A;  2EZV A;  3ER0 A;  2IHF A;  3TME A;  3CCU A;  1IBL Q;  4L5S A;  4A3L H;  1KLG D;  1UE7 A;  3MXN B;  3IL8 A;  1D5X C;  2GVB A;  2OQ0 A;  2B2V C;  3EJI A;  5K5P A;  1Y1W G;  1I94 Q;  4Q0F A;  2ZTC A;  2F4V Q;  3K7U C;  2UUB L;  3RN2 A;  4ZUJ A;  1PFS A;  2F4V L;  3OWE B;  4UP9 A;  1G2S A;  4LF8 Q;  1A62 A;  2XRS D;  1PH6 A;  2JA7 B;  1YI2 A;  1NNX A;  3K59 A;  1FVI A;  1LAB A;  4POG A;  1EY4 A;  1QVF A;  1BR9 A;  3X3M A;  2H4O A;  2K50 A;  2JE6 I;  1ASY A;  2DNE A;  5A2Q E;  1QIL A;  3NUC A;  1ESF A;  1SSO A;  5EPJ A;  4K14 A;  4NKL A;  3DEO A;  3J81 E;  3K0X A;  1Y1W H;  1VQP A;  3HKS A;  1YJW A;  4OIK A;  3KLS A;  2WKC A;  4X65 L;  3B6Y A;  2K7V A;  1KDC A;  2BDO A;  4GKK Q;  4A3L G;  1XYI A;  3LWE A;  3U50 C;  4KJO A;  5JEA H;  2NVT B;  4EGV A;  2KHS A;  2B63 H;  2AQ2 B;  1V1O A;  5IGC A;  5C44 G;  4A3K H;  1AEX A;  1C7Y A;  1PH2 A;  4FYD A;  2A6H C;  1EZ6 A;  4FXG C;  5E7N A;  2ZTD A;  1P8L A;  1MBY A;  5HGQ A;  5M5W B;  2FMM A;  2XRQ D;  1BCP F;  2IW3 A;  4LNQ A;  2JEA I;  1K28 A;  4CGY B;  4DR3 L;  3PO3 H;  4OX9 Q; 
#chains in the Genus database with same CATH homology
 4DV1 L;  4JI6 L;  5ELO A;  4MNO A;  2K4K A;  3PV0 A;  1N36 Q;  4P74 A;  3OTO Q;  3HOV H;  2Q2H A;  1D8L A;  2KHI A;  2WP8 J;  1N34 L;  2E5L L;  3AFP A;  5IP9 G;  4R4O A;  1VQ9 A;  3G71 A;  1CKO A;  2BA0 A;  3CMA A;  1PH3 A;  4BBR H;  3AYH B;  1N33 Q;  4DPG A;  5C44 H;  4IPH A;  5M3M H;  2UUA Q;  1QUQ B;  1N32 L;  2BA1 A;  4X62 Q;  1J5E Q;  5IYD H;  5IYB G;  4DKA C;  4JI4 Q;  1HNW Q;  3CCQ A;  1G29 1;  4YY3 Q;  4A3G G;  1W2B A;  4NXM Q;  3PSI A;  5LMN Q;  3I7F A;  1E1O A;  1PA6 A;  3CXC A;  2HT1 A;  4A3D H;  1Q86 C;  1JJC B;  3RLN A;  4LUV A;  5IY0 A;  3M7N A;  2K14 A;  1XNR L;  1L2F A;  2WAQ G;  1N8R C;  2JA8 H;  4XTC S;  2VY3 A;  4JG2 A;  5IWA Q;  3A0J A;  1QZG A;  1XMQ L;  4KHP L;  1AE2 A;  1NTG A;  4NPS A;  4O2D A;  3NBH B;  3M4Q A;  2D0O A;  4ALP A;  2BH2 A;  1WCM H;  4NB3 A;  4YY3 L;  3PF5 A;  2UUB Q;  1IZ6 A;  1TWG H;  3PO2 H;  4X62 L;  1J5E L;  3U4Z A;  1BBU A;  3HOV G;  4OO1 I;  2FXQ A;  4GN5 A;  4QIW E;  2ATW A;  2NN6 I;  1TWH H;  1JE5 A;  1E1T A;  1SE8 A;  2Z6K A;  3J80 i;  2VQE Q;  3CC7 A;  1XPU A;  1C0A A;  4DR2 Q;  3ERS X;  3JAM i;  2MO0 A;  1EQQ A;  5C4J H;  3D0F A;  1YHB A;  4A3C H;  4A3B G;  3STB C;  1XNQ L;  2CKZ B;  5IP7 G;  4JYA L;  3FHW A;  3VDY A;  2QEX A;  1VQO A;  5JJK A;  3UDI A;  3RZO H;  1PH1 A;  4L5R C;  1RIP A;  3AFQ A;  1KIX A;  4MTN A;  4K0K L;  1EUJ A;  4LUZ A;  4BXX G;  2MFI A;  2Y0S G;  3MEF A;  3CCJ A;  4KHP Q;  2ZJQ A;  5IWA L;  4LF5 Q;  4IFD J;  1UE1 A;  5IYC H;  3RLO A;  1E3P A;  4GOP B;  2AHO B;  3GTK H;  2EQS A;  3OW2 A;  4A3M G;  2N49 A;  2AMC B;  4H02 A;  4JI8 Q;  1Y14 B;  4PZ7 A;  2JA5 G;  5JJI A;  1I3Q H;  4LF7 Q;  3CF5 A;  4QQB X;  4B3R L;  4BY1 H;  4BA1 I;  2JA9 A;  1OXV A;  1NMG A;  3G4S A;  3CCR A;  1EYG A;  3GTQ H;  4JOI A;  1VQA A;  1E7Z A;  1CSQ A;  4PG3 A;  1PYB A;  4JI7 Q;  1YIJ A;  2JA6 G;  3PUW A;  3S14 H;  1TWF H;  3K8A A;  4O0A A;  4JBW A;  1UEB A;  1EIY B;  4IJH A;  3GTL H;  4DR4 Q;  1X3F A;  5HY6 A;  4PZ8 A;  2PQA B;  2WB1 E;  3RZD H;  2NN6 G;  1N34 Q;  2E5L Q;  2YYZ A;  3F2C A;  3L2P A;  4LF7 L;  1Q8K A;  1VQL A;  3W1B A;  1BBW A;  4BBS H;  4DR7 Q;  3A74 A;  1A0I A;  3TS2 A;  2IY5 B;  4GLV B;  1Q81 C;  2R6G A;  4DR3 Q;  2AWN A;  1VQI A;  4BA2 I;  3F8T A;  1HZC A;  4LFB L;  2HIX A;  4LF5 L;  4DR1 L;  3J80 c;  3KDF A;  5ELN A;  4DV4 Q;  1M1K C;  1GM5 A;  4QY7 A;  2N8N A;  4K0K Q;  1Q82 C;  3HOZ G;  2UXC L;  4A3F G;  4DV5 Q;  4LFA Q;  1B70 B;  4IPC A;  5LMU Q;  3S1M H;  4EX5 A;  1HZB A;  4YHH L;  4AYB E;  2EIF A;  1KRT A;  2NVQ H;  4LF6 Q;  2HHH Q;  3J81 c;  3I55 A;  1KL9 A;  3D31 A;  4JOI C;  4C3J H;  4DV7 L;  2F52 A;  2OCE A;  3GD7 A;  3CC4 A;  4LFC Q;  1PVO A;  1G6P A;  2VQE L;  3KJP A;  4GNX C;  4IFD I;  2NZO A;  3HOY H;  4DK3 C;  1TXY A;  1X6O A;  5M5X H;  4A3K G;  2JA7 H;  4HJ9 A;  5GAE C;  3AEV A;  2NVT H;  1XMO L;  3ULL A;  1IBM L;  1Q1B A;  4POF A;  1CKN B;  2MO1 A;  2E2H H;  1YHQ A;  3FP9 A;  1EIF A;  3S1N H;  4A3F H;  2WFW A;  4JI0 Q;  3L7Z C;  1EQR A;  1OXS C;  5C4X H;  4JBJ A;  2VS1 A;  3GTO H;  3H3V I;  4A3G H;  4A75 A;  2PMZ E;  1WI5 A;  4DV7 Q;  1WOC A;  1X55 A;  3KDF B;  4TQU S;  1XPR A;  2R7Z G;  1Y1V H;  2KCT A;  2A19 A;  4HIM A;  3I4N G;  1KHI A;  3U58 A;  4A3J H;  2HQL A;  1XJV A;  2YTV A;  2UXB Q;  2YTY A;  4JI4 L;  1SN8 A;  3TS0 A;  3GTM H;  1L1O A;  3DLL A;  1FL0 A;  1VCI A;  2R93 H;  4IOA A;  3H0G G;  1MJC A;  3GTG H;  2GVA A;  2JA6 H;  1VQG A;  1Q46 A;  3UDG A;  1VQC A;  3A5Z B;  3M4O H;  1M90 C;  3M4P A;  4IPD A;  4DR7 L;  1TWC H;  5GQO A;  2K75 A;  2N78 A;  4R4C A;  5GRO A;  3CCE A;  4DV6 Q;  4OWX B;  1HR0 Q;  1PYS B;  4RMF A;  1CKN A;  1BVS A;  4XIG S;  2A1A A;  4BY7 H;  3HOX H;  1HZ9 A;  4L5Q A;  1PH4 A;  2PI2 E;  1CUK A;  4X66 Q;  4HIK A;  3G48 A;  1FJG Q;  4TVA B;  1N9W A;  2RF4 A;  3M3Y H;  1OXT A;  1K0R A;  1UE6 A;  4OXP A;  2RHQ B;  3S2D H;  2VQF Q;  4JI2 Q;  2KHJ A;  3EBE A;  3CQZ H;  4JBM A;  1VQK A;  1S3O A;  2JJQ A;  4DAY B;  5C3E H;  1PV4 A;  4DR2 L;  1VQ6 A;  1VQE A;  3GTP H;  2E2I H;  3RLF A;  3HOZ H;  4GNX B;  4AIM A;  4GN4 B;  4A93 G;  5GAH C;  4UY8 C;  2KEN A;  2WAQ E;  3S15 H;  4JC0 A;  1L1O B;  4DV3 Q;  1H95 A;  2B3G A;  2YV5 A;  3CPF A;  1V1Q A;  1ASZ A;  1WCM G;  1X9N A;  3JAM c;  2CWA A;  4GLX A;  3K80 C;  4GKK L;  2R92 G;  1JB7 A;  2VUM G;  4JI2 L;  1K83 H;  3KYH C;  3RN5 A;  3K7A H;  5AJ3 Q;  1QVG A;  2JA8 G;  1VQD A;  4ME3 A;  1D7Q A;  4IJL A;  3T1H L;  1KAW A;  3LGJ A;  1LUZ A;  4X66 L;  1LYL A;  3I4M G;  4R1J A;  1Z9F A;  3W5O A;  1NY4 A;  2MQH A;  3STB D;  1UWV A;  4JYA Q;  1HNX L;  1NJI C;  4AYB G;  4GOP A;  4BY7 G;  5LMN L;  2I5H A;  1JMC A;  4C3I H;  1HR0 L;  2R93 G;  3ULP A;  3BU2 A;  1SMX A;  4P71 A;  1AE3 A;  1X3G A;  4HIO A;  3IRB A;  5FJ8 G;  3UDX A;  4DUZ Q;  4HJ8 A;  2ASB A;  1E24 A;  1VQJ A;  2ZJR A;  4A76 A;  4DR6 L;  4Y52 H;  1BKB A;  1Z47 A;  2ID0 A;  4OON A;  1W3S A;  1GKH A;  3E9H A;  2I5L X;  4P73 A;  4DUZ L;  4GNX A;  4A3M H;  3CW2 C;  1VQ4 A;  2DUD A;  3H0G H;  4LUO A;  4LFC L;  1YHA A;  4OWT B;  4WJ4 A;  2A8V A;  1X65 A;  1I50 H;  3RR5 A;  1SLJ A;  4J15 A;  3S24 A;  2VZA A;  1VQ5 A;  2Q2T A;  1IL2 A;  3S1Q H;  1NE3 A;  3HOW G;  1IBK L;  5DLQ E;  1Q1E A;  1PH8 A;  5M3M G;  1V43 A;  2AKW B;  4IFD G;  1YVC A;  1MIU A;  1EWI A;  2PI2 A;  3HKZ E;  1XNR Q;  3CCS A;  5LMU L;  3I2Z A;  5M3F G;  3HOX G;  2R7F A;  5AJ3 L;  3E0E A;  3CD6 A;  2HIV A;  3BJU A;  3F1Z A;  1YJ9 A;  2D62 A;  1L0W A;  3FKI G;  1YBY A;  2I0Q A;  2D0P A;  2B29 A;  4KLK A;  1O7I A;  3F2B A;  1OTC A;  3S2H H;  3NEN A;  2UUA L;  3PIO A;  2B63 G;  3HOW H;  1X3E A;  3ZJY C;  1YNX A;  3EIV A;  3U4V A;  4AQY Q;  1L1O C;  3TEH B;  2Q2I A;  1PH5 A;  5FLM G;  1B8A A;  3BZC A;  4DV2 L;  4DR4 L;  2JEB I;  3NEM A;  2Q2U A;  4JBK A;  2VQF L;  4A3C G;  4LF6 L;  4UPA A;  2VL6 A;  4YHH Q;  4OX9 L;  2RHS B;  3S16 H;  4OO1 G;  3PGZ A;  3TQY A;  4B3M L;  5JJL A;  2LSS A;  3TRE A;  4A3E H;  3KF6 B;  4DV4 L;  5C0X G;  3CCV A;  1VQF A;  4DV6 L;  1NBW A;  1OXU A;  1CSP A;  4GKJ Q;  4JI3 L;  4P72 A;  5IYB H;  1VQH A;  1KRS A;  1NMF A;  4A3I G;  3CCM A;  5M5W H;  2VUM H;  1G51 A;  4Y7N H;  1IBK Q;  4YWM A;  3W1G A;  1B7Y B;  5C0X J;  4LF8 L;  1VQB A;  2LXJ A;  5FJ8 H;  2ZM6 Q;  2IT1 A;  1OXX K;  3SGI A;  1WYD A;  1FGU A;  4GS3 A;  4JCV E;  3GO5 A;  3M9B A;  5M5Y H;  3A5U A;  4HJA A;  3I4M H;  3OYY A;  3KOJ A;  2CCZ A;  1VQN A;  2I5M X;  4B3S Q;  4JI7 L;  1XNQ Q;  4QL5 A;  2GN5 A;  2EXD A;  1U0L A;  4DR6 Q;  4DK6 C;  5GAG C;  1A8V A;  2Y0S E;  5C3E G;  2VW9 A;  3UE0 A;  4DV2 Q;  4RG1 A;  4YCV A;  2K52 A;  2OTL A;  2CQO A;  2UXD Q;  3PIP A;  4IO9 A;  1V9P A;  2UUC Q;  4MZ9 A;  5EAY A;  4A3E G;  4AQY L;  1VQM A;  4KHZ A;  1C9O A;  1SR3 A;  1KXL A;  5FLX c;  1K73 C;  4UP7 A;  3RNU A;  3KF6 A;  1QVC A;  3CPW A;  2R7Z H;  2CFM A;  3H15 A;  4LF9 L;  5IP9 H;  4AH6 A;  3NEL A;  3PUZ A;  3I4O A;  3H3V H;  5LMN W;  4A93 H;  1LM0 A;  2BH8 A;  2F3I A;  3PUY A;  4YCU A;  4UP8 A;  2JK8 A;  5GAD C;  2YTX A;  3AQQ A;  1WJJ A;  4HID A;  4LF9 Q;  1A63 A;  1SRU A;  4GLA C;  4DUY L;  4JV5 L;  4OWW B;  3EN2 A;  1QZH A;  4A4I A;  5IP7 H;  2HHH L;  1IXR A;  2E8G A;  2UUC L;  3HOY G;  2H5X A;  3WWV A;  1JT8 A;  3FKI H;  4DV0 Q;  3ULJ A;  1SFO H;  3E9I A;  1PH9 A;  3PCO B;  5H1S E;  2ES2 A;  3HKZ G;  1TWA H;  1QUQ A;  3CP0 A;  2IX1 A;  1JJ2 A;  4NXN Q;  2K5N A;  1XPO A;  1N33 L;  3HOU G;  3BZK A;  4DR1 Q;  1RL2 A;  3CME A;  1S40 A;  1EOV A;  1LTL A;  2KBN A;  3CAM A;  3PUV A;  1KQS A;  1P16 A;  4GN3 B;  3KFU A;  3UE1 A;  5C0X I;  4DR5 Q;  4LW1 A;  2VNU D;  4QJF A;  2LXK A;  3S17 H;  3GDE A;  1I6H H;  2L15 A;  4A3J G;  4DV1 Q;  4JI6 Q;  3K81 C;  1SRO A;  1GO3 E;  1UE5 A;  3T1H Q;  1YEZ A;  5BR8 Q;  3HOU H;  4GKJ L;  4BBS G;  2K5V A;  3F2D A;  4BBR G;  3TRZ A;  4QGU A;  3I4N H;  5J3B A;  4P75 A;  2NVY H;  4NXM L;  1Y1V G;  1AH9 A;  4B3M Q;  3JC6 6;  4R4T A;  4HJ7 A;  2Z6K C;  1KC8 C;  4B3R Q;  3J7Z C;  1PHJ A;  4C3H H;  4EQ5 A;  2UXB L;  1N32 Q;  2NVX H;  5IYD G;  4APV A;  4YWL A;  1HR0 W;  4FDB A;  1K3R A;  2WB1 G;  4DAM A;  2R92 H;  5BR8 L;  1I5F A;  4HJ5 A;  4BY1 G;  1U5K A;  2NZH A;  2JQO A;  1MJE A;  3KJO A;  2JA5 H;  3J81 i;  2XTI A;  2UU9 Q;  4IPG A;  2V1C C;  3M85 A;  4X64 Q;  2YU9 H;  2OTJ A;  2R7D A;  4DR5 L;  1VQ8 A;  5IT9 c;  3KLW A;  1T9H A;  4GOP C;  1IBM Q;  1VQ7 A;  4JI5 L;  3T1Y Q;  3CC2 A;  2N3S A;  4NXN L;  2K5H A;  3ER0 A;  2IHF A;  3GTJ H;  1X54 A;  3KF8 B;  3CCU A;  4PMW A;  1IBL Q;  4L5S A;  4A3L H;  1UE7 A;  3MXN B;  4DV0 L;  2OQ0 A;  4LF4 Q;  2GVB A;  2Z0S A;  2C35 B;  2CWP A;  2IX0 A;  1XTD A;  3S1R H;  2ZJP A;  3HFZ B;  4B3T L;  4A3B H;  1Y1W G;  4DUY Q;  2KCM A;  1K8G A;  1YIT A;  4JI1 L;  1I94 Q;  4R4Q A;  4B3S L;  2ZTC A;  4JV5 Q;  2F4V Q;  3K7U C;  5FLM H;  1Q7Y C;  2XGT A;  2UUB L;  3RN2 A;  5JEA G;  4LFA L;  1JJG A;  1PFS A;  4LWC A;  2F4V L;  3Q8D A;  4JI1 Q;  2PNH A;  3L0O A;  4UP9 A;  4LF8 Q;  1A62 A;  4X65 Q;  1PH6 A;  4DNI A;  4B3T Q;  2RCN A;  1MKH A;  4A3I H;  4X6A H;  1YI2 A;  1XMQ Q;  2PQA A;  5JEA J;  1CKM A;  1FVI A;  4LF4 L;  3J81 j;  5IYC G;  2QGQ A;  4POG A;  1QVF A;  4BXX H;  1HZA A;  3PO3 G;  3I56 A;  4WJ3 M;  2K50 A;  1IBL L;  1PH7 A;  2JE6 I;  2ZTE A;  3PF4 A;  1ASY A;  1EFW A;  4KI0 A;  3J7A 5;  4JI0 L;  1HNX Q;  4C2M H;  2DGY A;  3G6E A;  3T1Y L;  1K8A C;  1HH2 P;  2UXD L;  1E22 A;  1HNW L;  1GVP A;  1X56 A;  5IE8 A;  3K0X A;  1Y1W H;  1VQP A;  1XMO Q;  1S72 A;  3HKS A;  4A3D G;  1YJW A;  3CCL A;  1R9T H;  4X65 L;  2UU9 L;  3B6Y A;  3PUX A;  2QA4 A;  4IOC A;  4R4I A;  4GKK Q;  4A3L G;  3U50 C;  1WFQ A;  1KD1 C;  1HNZ L;  5C4X G;  2ZM6 L;  1I94 L;  1GD7 A;  2B63 H;  4DV3 L;  1K9M C;  3OTO L;  5C44 G;  5K36 G;  4A3K H;  1C7Y A;  1N36 L;  4JI8 L;  1PH2 A;  1HNZ Q;  2JA7 G;  3PO2 G;  5E7N A;  4YWK A;  3ICE A;  2ZTD A;  1P8L A;  1YZ6 A;  1VS0 A;  2ALY B;  4DV5 L;  1Q12 A;  4JI3 Q;  2UXC Q;  4YCW A;  2OWO A;  5HGQ A;  1IYJ B;  1J6Q A;  2MNA A;  3UDF A;  5M3F H;  2E2J H;  3DM3 A;  4LNQ A;  4JI5 Q;  1HJP A;  2JEA I;  1YJN A;  4LFB Q;  4DR3 L;  2AWO A;  4PZ6 A;  2IHE A;  3PO3 H;  4L5T A;  2OQK A;  1FJG L;  4OX9 Q;  1DGS A;  4X64 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...