2VQEQ

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vqeQ00
4DR7L 3HKZG 4BBSH 4LUZA 4DKAC 3G4SA 3AFPA 4P71A 3ICEA 2CKZB 4Y52H 4JYAL 4GS3A 3NELA 2EQSA 2ZTEA 4R4IA 2I5LX 3JAMc 3HOUG 4DR6L 1KL9A 5IY0A 2QEXA 1Q1EA 5FLMH 3CC2A 1E1OA 4OO1I 3L0OA 1SLJA 1A62A 1PH2A 5JJKA 2AMCB 2ZM6Q 1TWHH 2E5LL 4HJ8A 3JC66 4X65Q 4DR4L 2K5VA 2WAQE 1S72A 4GKJQ 1AE2A 4JI7Q 1I3QH 1Z9FA 4GNXC 4A3LG 5AJ3L 1A63A 4B3SL 3S1MH 1TXYA 1KRSA 4AYBE 3HOUH 3I55A 2VL6A 4B3RL 1X3GA 3K8AA 5GROA 1N36L 4DV2L 3KF6B 4A3KG 4JI4L 3BZKA 3PO2G 3PIOA 1I6HH 1LM0A 2MFIA 5C0XJ 3M9BA 4DUYL 1C9OA 1GKHA 3E9IA 5M5XH 4A3LH 2R93G 4GLAC 2D62A 3DLLA 3PF5A 3KLWA 4JC0A 4DR2Q 3M3YH 3FKIG 4A3FG 1PH3A 4DV4Q 5LMNL 3Q8DA 1CKNA 2WAQG 5DLQE 2UUAQ 4YCVA 4A3KH 3M4PA 1X3FA 1B70B 1B7YB 1O7IA 1G6PA 3MXNB 3PO2H 2KBNA 1UEBA 4XTCS 1HNZQ 1T9HA 4DR7Q 4AIMA 2Y0SE 4OWTB 3D31A 3K7UC 4HJAA 1GVPA 3PV0A 4JI6L 2R93H 2NZOA 4JYAQ 1Y14B 1Q86C 1YIJA 4JCVE 5EAYA 2Z6KC 1YHQA 4DR6Q 3FKIH 3U58A 1Z47A 5JEAJ 5GADC 4A3FH 3TRZA 1HNXL 3G48A 5LMUL 4AQYL 4TVAB 3CCUA 1VQMA 1E24A 2YTXA 5IP7G 4DUZQ 2OTJA 5M5YH 4IOCA 1NY4A 1YI2A 2E5LQ 2HQLA 4UY8C 4IPDA 3L7ZC 4DR4Q 2ZTDA 2D0OA 2RHSB 2PNHA 2VW9A 4OO1G 5JJIA 2H5XA 3CF5A 3A5UA 1Y1WG 5GQOA 4LF4L 2Q2HA 5AJ3Q 4LF7L 3UE0A 1W2BA 4DK3C 4WJ4A 4B3SQ 1BVSA 1U0LA 3CP0A 4QJFA 1M90C 2VQEL 1WFQA 2LSSA 2MNAA 4B3RQ 1YHAA 2WFWA 1PHJA 3RLNA 3CXCA 4NXNL 1N36Q 5IP7H 4DV2Q 1VQDA 2R7FA 4BBRG 4JI4Q 1OXVA 3CQZH 1VQEA 4PZ7A 1LYLA 4BY1G 4Y7NH 1ASZA 1E3PA 3S1NH 4LFBL 1N32L 5E7NA 2A19A 1MJEA 2R92G 1NBWA 4O2DA 3UE1A 4DUYQ 2R7DA 1X9NA 1LUZA 4A3EG 1Y1WH 2JE6I 3M85A 3CCVA 4MTNA 3W5OA 1MKHA 2ID0A 3GTMH 4BA1I 3M4OH 3S15H 4DR3L 4LF5L 3A74A 1NE3A 1I50H 2WP8J 5LMNQ 1BKBA 3F1ZA 3T1YL 3FHWA 4MZ9A 3J81c 1KIXA 3HOVG 2IT1A 3KF8B 3U50C 2IHEA 4BBRH 4BY1H 5HY6A 2Q2UA 2UXCL 4A3BG 3KF6A 3W1GA 3ULJA 4GLXA 2JA8G 3CMAA 2R92H 1L2FA 2JEBI 1YJNA 4A3EH 2WB1E 2YTVA 1SR3A 4JI6Q 1TWCH 2ASBA 3KYHC 1IYJB 3TS0A 1OXUA 1YEZA 4GOPB 1PH4A 1TWAH 1UE7A 2IY5B 4QGUA 1AE3A 5LMUQ 3RNUA 1HNXQ 4AQYQ 3PUVA 1P16A 4ALPA 3HOVH 1UE1A 3S24A 4WJ3M 4IPCA 5IE8A 4HIMA 1MIUA 3PSIA 4DV7L 3HOXH 3I56A 2AKWB 3WWVA 4A3BH 4A93G 2JA8H 1IBML 2E2HH 1VQGA 3FP9A 3UDXA 3RR5A 4LF4Q 5IP9H 3S16H 2YYZA 4LF7Q 1EFWA 2I0QA 2ZJRA 3HOZG 2UXDL 4PMWA 1UE5A 4YWKA 3GTOH 5IYDG 2VQEQ 3A5ZB 1FGUA 2KCTA 2MQHA 4YCUA 3T1HL 2R6GA 4K0KL 2UXBL 1J5EL 4L5RC 4NXNQ 3H15A 3F2DA 1UE6A 3HOYG 1PH5A 1E1TA 1K3RA 2WB1G 3GD7A 3JAMi 3KDFB 4DR5L 4A93H 1G51A 4LFBQ 1HR0L 1N32Q 3HKSA 1PYSB 3HFZB 1XNRL 4IFDI 2FXQA 2XTIA 4LUOA 1YJWA 1YITA 3KJOA 4X66L 3U4ZA 1GO3E 2DUDA 3HOZH 3BZCA 4BY7G 5C4XG 1NTGA 4DR3Q 1RL2A 2DGYA 2KENA 1ASYA 4LF5Q 4OWWB 5IYDH 2CWPA 1KQSA 3G71A 2B3GA 3T1YQ 1QUQB 3GTGH 4A75A 1XJVA 1X54A 4GN3B 3HOYH 4DV5L 4KHPL 1VQLA 1VQBA 2VS1A 4YCWA 3M4QA 1Q12A 1SE8A 2GVBA 3K80C 2HHHL 2CFMA 4C3IH 4X62L 1VQNA 1K0RA 1VS0A 3LGJA 3G6EA 1PVOA 2AHOB 3RLFA 4A3CG 1Q46A 1PV4A 4OXPA 1LTLA 4IJLA 1XNQL 3CPFA 2A8VA 3J81j 5C4XH 1SRUA 4BY7H 1OXTA 4QY7A 1EIYB 3H0GG 2JA9A 3RN2A 4LFAL 4DV6L 2JA7G 3J80c 1VCIA 3TQYA 3I4MG 2LXKA 2AWOA 4OX9Q 3K81C 5GAEC 1JT8A 4DV7Q 1VQ7A 3I2ZA 2C35B 4X64L 4R1JA 1X56A 2BA0A 1IBMQ 4A3DG 2E2IH 5ELNA 3GTQH 1OXXK 1K73C 1XTDA 2NVQH 4IPGA 3U4VA 2UXDQ 3J7ZC 2K4KA 1C0AA 1E22A 3H0GH 2RCNA 4UP7A 3T1HQ 1QZGA 2UXBQ 4AYBG 1J5EQ 4GOPA 2JA7H 2MO1A 2NVYH 4C2MH 4HIDA 4B3TL 4JI0L 1J6QA 3I4MH 4YY3L 2VQFL 4GN4B 4APVA 3PUWA 1EWIA 2AWNA 4HIOA 1G291 2F3IA 3OTOL 4DR5Q 1HR0Q 2UUBL 1XNRQ 3ULPA 3UDFA 2JQOA 4JI8L 4XIGS 1Q82C 4A3DH 3PCOB 1BBWA 5BR8L 4DV1L 4X66Q 4JI2L 2E8GA 5FJ8G 1HZCA 3NENA 4DNIA 4IFDG 3PUYA 1YZ6A 3W1BA 1CKOA 1QZHA 2B29A 1FJGL 1OTCA 4DV5Q 3CPWA 4KHPQ 2L15A 1CKMA 4IPHA 2XGTA 2E2JH 2JJQA 2VNUD 2OQ0A 4JG2A 4A76A 4JI5L 3GO5A 4X62Q 2HHHQ 3KDFA 5ELOA 2VZAA 1KAWA 5J3BA 2Y0SG 1IBLL 2YTYA 2VY3A 4HJ5A 1QVCA 5FJ8H 1XNQQ 4LFAQ 1B8AA 1H95A 4DV6Q 3TS2A 3S1QH 3CCSA 5C0XI 1QUQA 4P72A 4PZ8A 1W3SA 1WOCA 4A3GG 3J81i 1HZ9A 1Q8KA 4X64Q 1VQIA 2F52A 4NB3A 1XPRA 4C3HH 2YU9H 3RN5A 2A1AA 3UDGA 1L1OB 3L2PA 3CW2C 4DV0L 3B6YA 3RLOA 4KHZA 1Y1VG 1XMOL 3RZDH 2NN6I 4LUVA 1KXLA 1JJCB 4R4CA 3CAMA 4A4IA 1V1QA 2V1CC 2K75A 1X65A 2JEAI 3J7A5 3NEMA 4LW1A 3ZJYC 4B3TQ 1TWGH 2K50A 3SGIA 4JI0Q 4YY3Q 2VQFQ 1VQ8A 2K52A 3GTJH 1GM5A 4IO9A 2UUBQ 1N33L 3OTOQ 1Q7YC 2Q2TA 3K7AH 1EYGA 2I5HA 1C7YA 4A3GH 1X6OA 2MO0A 4JI8Q 4LF9L 1Q1BA 3GTLH 5BR8Q 4GKKL 4DV1Q 2BA1A 1VQCA 2N3SA 2VUMG 4JI2Q 1BBUA 1Y1VH 1A0IA 4DK6C 4DV3L 2GN5A 1PH7A 2QA4A 1WYDA 5M3MG 4GNXB 1XPUA 1SMXA 1TWFH 2UUCL 5K36G 5IYCG 1YJ9A 1FJGQ 1EOVA 1VQAA 2PQAB 1FL0A 4QIWE 4JI3L 1MJCA 4YWLA 3CCQA 1R9TH 1YHBA 4H02A 2K5NA 4P75A 4JI5Q 4O0AA 1SROA 1VQ5A 1XMQL 1IBLQ 3TEHB 2VUMH 1DGSA 2ZTCA 3KJPA 3I4NG 5M3MH 4LWCA 1KRTA 2LXJA 1K83H 3EIVA 3PF4A 5IYCH 1EIFA 3M7NA 4GOPC 4POGA 3F8TA 3TREA 2KHIA 1YVCA 4HIKA 1WCMG 1IZ6A 1I94L 5LMNW 3K0XA 1VQPA 1SN8A 1HZBA 2ALYB 5C0XG 3CCRA 2HIXA 2PMZE 3ERSX 1KD1C 4DV0Q 1X55A 2UXCQ 4YHHL 1XMOQ 4KI0A 2K14A 3I4NH 1K8AC 4LF8L 1NJIC 4C3JH 5C44G 3CC7A 1NMFA 4YWMA 4R4QA 1QVGA 2OQKA 1D8LA 2NN6G 4DAYB 2R7ZG 4P74A 1JB7A 5GAHC 4RG1A 4JBMA 1WCMH 4DUZL 1N33Q 3AEVA 4IOAA 1UWVA 2CCZA 3J80i 5HGQA 2F4VL 4LF9Q 4GKKQ 1VQOA 3HOWG 3F2BA 2KCMA 3AYHB 4GN5A 1QVFA 1HH2P 4DV3Q 3F2CA 3CCEA 1L1OA 1IL2A 5JEAG 5FLXc 4UP9A 2UUCQ 2BH8A 5M3FG 3GTPH 5C44H 1EQRA 1VQ4A 4JI3Q 4L5SA 2I5MX 2ATWA 2JA5G 1VQKA 2R7ZH 4A3CH 4X6AH 1X3EA 3BJUA 4RMFA 1S3OA 4BXXG 4K0KQ 2PI2A 4QQBX 3HOWH 4UP8A 1XMQQ 2IX0A 4IJHA 2NVXH 1PH8A 2N8NA 2IHFA 4JI1L 4B3ML 1HNWL 3OW2A 4HJ7A 1WI5A 5M3FH 1E7ZA 4JOIA 4GNXA 2EXDA 1EQQA 3GTKH 1NMGA 1Q81C 4OWXB 3KFUA 1PH9A 2JA5H 2JK8A 2K5HA 1AH9A 1GD7A 1OXSC 4LF6L 2PQAA 2BH2A 3STBC 1I94Q 1IBKL 4BXXH 1VQHA 2YV5A 2ZJQA 3D0FA 3IRBA 3H3VI 5JJLA 2OCEA 1K8GA 4DPGA 1YBYA 3PGZA 4P73A 2NVTH 1V43A 3ER0A 2HIVA 4YHHQ 5C3EG 1S40A 5IYBG 1XPOA 3BU2A 4LF8Q 2GVAA 4DR1L 4JV5L 1VQ9A 3RZOH 3NBHB 3MEFA 4L5QA 3S2HH 3EN2A 2QGQA 1YNXA 1K9MC 4NXML 1RIPA 4A3MG 1HZAA 1P8LA 4GLVB 5IWAL 1L0WA 3CCJA 4QL5A 4UPAA 1N34L 4A3JG 2F4VQ 1JJ2A 4PG3A 4DAMA 3PO3G 4MNOA 4LFCL 2OWOA 2Z0SA 2JA6G 1FVIA 1U5KA 2N78A 3ULLA 4JBWA 2RF4A 4FDBA 5GAGC 5IYBH 5C3EH 1SFOH 2UU9L 3CD6A 4TQUS 5H1SE 3KOJA 2CWAA 3I4OA 4A3MH 1JJGA 3GDEA 3STBD 4A3JH 3PO3H 1N9WA 1CSQA 5C4JH 4IFDJ 1N8RC 3UDIA 3CMEA 2JA6H 4PZ6A 2D0PA 3VDYA 3S14H 1HJPA 4JI1Q 1HR0W 4B3MQ 1HNWQ 1PA6A 2ZM6L 1PYBA 2NZHA 4X65L 3S17H 1VQFA 2RHQB 2HT1A 4POFA 4GKJL 1JE5A 4R4OA 4LF6Q 3EBEA 4EQ5A 3CC4A 4JI7L 1KC8C 3DM3A 3CCLA 2Q2IA 1CSPA 1IBKQ 1CUKA 2Z6KA 4NPSA 4L5TA 4A3IG 4BA2I 5M5WH 3HOXG 1CKNB 1EUJA 4R4TA 3HKZE 3OYYA 1PH6A 1M1KC 3AQQA 3PUZA 1JMCA 1A8VA 4OONA 5IP9G 1WJJA 2EIFA 3I7FA 4HJ9A 5IT9c 1L1OC 3CCMA 4DR1Q 3S2DH 3E0EA 2B63G 4JV5Q 1KHIA 1VQJA 3PIPA 3S1RH 1V9PA 4ME3A 4NXMQ 4BBSG 2ES2A 1PFSA 1N34Q 5IWAQ 4AH6A 4J15A 2IX1A 2KHJA 3AFQA 4EX5A 2ZJPA 4DR2L 4A3IH 2OTLA 4OX9L 1D7QA 4LFCQ 1VQ6A 3PUXA 4DV4L 4JBKA 5FLMG 2CQOA 2UUAL 4KLKA 2UU9Q 3A0JA 2N49A 3E9HA 4JBJA 3H3VH 2PI2E 2B63H 1PH1A 1I5FA 4LNQA 4JOIC 1IXRA 1HNZL
chains in the Genus database with same CATH superfamily
4L6TB 5EQ0A 4DR7L 1GUNA 1H9KA 1ET9A 4UHVA 3PQIA 3BS1A 1SMYC 3NELA 1WTRA 1PXUA 4DR6L 3HOUG 1KL9A 1PZID 1CA5A 1E1OA 3FMCA 4FXKC 3L0OA 1SLJA 2F4IA 1PH2A 3DM1A 5ELDA 2ZM6Q 3Q24A 4C3HB 4HJ8A 2YU9B 3E0JA 4X65Q 1UNSA 5CYUA 2WAQE 1S72A 1EY7A 3RZDB 4GKJQ 1AE2A 1A3VA 1I3QH 5CV8A 1JCKB 3BDOA 1JB3A 1TWGB 3S1MH 4KJOA 1ESRA 5A35A 3I55A 3GTJB 3K8AA 4LAAA 5GROA 4A3GB 1IKMA 1XXGA 1I6HH 1Y1VB 1S5FD 1GKHA 4V0BA 2R93G 3DLLA 2D62A 2FINB 3KLWA 3M3YH 3I8ZA 4DR2Q 2L4NA 1SMYD 3FKIG 4A3FG 2NB0A 1FD7D 4YCVA 4B08A 4A3KH 1B7YB 3PO2H 2KBNA 4FF1A 1HNZQ 2SEBD 1RJTA 2KOLA 1QG7A 1YIJA 1LT4D 2RA4A 3U58A 1LTGD 1HNXL 4AQYL 3MZ5A 5IP7G 2YTXA 2OTJA 1NY4A 3MFYA 4DR4Q 2D0OA 2VW9A 5JJIA 1II3A 2Q2HA 4B3SQ 3J7AV 1M90C 4QJFA 2EJGC 2VQEL 2LSSA 5FLXL 2MNAA 1YHAA 4NXNL 3BDCA 4DV2Q 2A69C 3EFXD 4QIWB 4O2DA 1Y1WH 2FFKB 2JE6I 3NBIA 1STEA 1HUNA 2ID0A 4ME5A 4J8QA 5IIFA 4IUPA 1QB5D 2PZWA 4LF5L 3A74A 2R7ZB 3NPPA 5LMNQ 1JOQA 1Z6HA 3HS0C 3Q6SA 3HOWB 3DWPA 5D3IB 4A3BG 2KVMA 2HCIA 1BCPB 1L2FA 4HR7B 5KNCA 4A3EH 1ENFA 1I4XA 2K5DA 4ZAIA 3KYHC 3TS0A 1YEZA 3H6MA 4H0LC 1TWAH 2IY5B 4CGYB 1AE3A 1KAAA 3RNUA 3HOVH 3S24A 5IE8A 3PSIA 2A69D 4DV7L 2AKWB 2NVTB 4IZ8A 1IBML 1Q90A 3MXNA 3K5MA 3TDQA 2DJFC 2AQ2B 5IP9H 2I0QA 2ZJRA 3HOZG 4YWKA 3GTOH 2IPKD 3A5ZB 2KCTA 4KN7C 5CORA 3Q23A 3T1HL 4KKUA 4K0KL 4Q5VA 1UE6A 3SDZA 1SYCA 3SK8A 3H94A 2WB1G 2OEOA 3I73A 3JAMi 4I65A 5E1FA 1N32Q 3HKSA 4C3IG 1XNRL 2XTIA 3A56A 2FHTA 3WOFA 1C8CA 1GO3E 1GHKA 1F9SA 3BZCA 3T1YQ 4DV5L 1LTAD 3C3LA 1RODA 3K80C 2CFMA 3OOCA 1PYWD 3G6EA 2QDBA 1EY0A 3URYA 2WKDA 2NZ1D 1EZ8A 1LTLA 2SNMA 3CPFA 4IJLA 1XNQL 3S17B 4WJWA 2JA9A 5IT9L 5JVG3 4LFAL 4DV6L 1ET6A 2JA7G 4PNYA 2LXKA 3KF8A 3MXUA 4G7HC 3TP5A 1VQ7A 3I2ZA 4X64L 4R1JA 1X56A 2E2IH 2F0EA 4BWGB 4C1NI 2NVQH 1D5MC 3ITPA 4AYBG 4GOPA 4B3TL 3I4MH 4YY3L 4GN4B 1G291 2F3IA 5EKLA 4RHRA 4BS9A 5C5MA 2L5TA 3ULPA 2B2YA 2QDLA 4F87A 3NTHA 4X66Q 4GZYC 4JI2L 4KN4C 1CKOA 1SE4A 3BVMA 4KK7A 2B29A 4DGZA 4FYDA 2L15A 4IPHA 2XGTA 2JJQA 4JG2A 3K5LA 2K5WA 3T53B 2HHHQ 4X62Q 3KDFA 5ELOA 5ELCA 1SNDA 1KAWA 2VY3A 5EPKA 2F3WA 4JW0A 1B9NA 2DJGC 2EVBA 3HKZB 1H95A 1I3QB 5C0XI 3KK7A 3S1MB 2V4DA 3WDNA 5M9OA 3J81i 3HEJA 1ILQA 1JOKA 2F52A 1XPRA 4EQNA 3UDGA 4DV0L 1I6HB 1KXLA 3MTSA 4R4CA 1V1QA 1GXDC 1KNEA 2V1CC 2ENBA 1ML0D 2JEAI 2MP1A 3SGIA 4JI0Q 3M3YB 4FVMA 1K8MA 2K52A 4WORA 1GM5A 3G6JB 1N33L 2CQAA 1VF7A 1C7YA 4JI8Q 1Q1BA 1WTQA 4A3KB 4R9WA 3Q0AA 3PO2B 1EWCA 2J0TD 2QA4A 2JYOA 1DD2A 1MI2A 4XXEA 1YJ9A 3A8KE 2A74C 4QIWE 3RUZA 3CCQA 1SNCA 2A6EC 1MBYA 3MWYW 1IBLQ 3TEHB 3QIAA 2ICIA 3DUZA 5M3MH 1KRTA 1STHA 1K83H 4C3JG 5K36H 4DAVA 1PFNA 1AZPA 1MSHA 4FXDA 4IQZA 1VMPA 2A68D 1IZ6A 1I94L 1M8AA 4U68A 3K0XA 1VQPA 2HIXA 1KD1C 3AU7A 2UXCQ 4PMCA 2VXWA 1XMOQ 3X3NA 3I4NH 4J1MA 1NJIC 1Y1WB 2B2TC 1VF5C 4FF3A 2D9UA 1JB7A 4RG1A 4R8NA 1WCMH 3KLSX 2RCFA 4IUUA 2K01A 1YNNC 3T13A 2A6ED 1VQOA 4HAEA 2CVRA 1QNKA 3DWAA 2KCMA 4KTAA 1R4PB 5JVH3 1SJED 4A3EB 5CMDA 5M3FG 5C44H 4L5SA 2I5MX 2JA5G 1X32A 4HSPA 1TWAB 1EY4A 1S3OA 1FGBD 3P75A 4JK1C 3IL8A 5FO7B 4BXXG 2PI2A 2RQXA 4OIKA 3HOVB 4QQBX 1XMQQ 4A3IB 3J80E 1A3UA 2IHFA 1WI5A 5IODA 3MVVA 3GTKH 2BDNA 4Z9CB 3V2TA 5DM73 1GD7A 1OXSC 3GTOB 2PQAA 2F0HA 3OIPA 1F2MA 1Z7TA 4G7ZC 2X6LA 1YNND 5JJLA 1A15A 1HPCA 1EU4A 2OCEA 1CT1D 1YBYA 2HIVA 1S40A 1W6KA 1I6VC 4XYQA 4LF8Q 2GVAA 4DR1L 3NBHB 3EN2A 1A6XA 2QGQA 5J1ZA 4NXML 4P2CB 3GP7A 4MNOA 2JA6G 5BN4A 2N78A 1PZKD 3K5OA 5A2QE 3OW7A 4ZRZA 1WVLA 1SNOA 5H1SE 4A3MH 4DAYA 1RDPD 1N9WA 1CSQA 5CBAE 3K6OA 3UDIA 1RF2D 4KY7A 1HR0W 5C3XA 1PA6A 2E2IB 1BUVT 1I4PA 1EOTA 2DNCA 3S9WA 1B2TA 3QWNA 2NVQB 1JE5A 4LF6Q 5DEHA 2FMMA 4JI7L 3CC4A 1KC8C 3DM3A 3CCLA 1QWYA 1OO9B 2QF7A 5M5WH 3HOXG 3I4MB 1EUJA 3HKZE 2B2WC 4OONA 1NAPA 3T56B 3I7FA 4HJ9A 1L1OC 2EY5A 1YNJC 1BF4A 1QOHA 3PIPA 1DOMA 3S1RH 4ME3A 5CBEE 3G7LA 5IWAQ 4J15A 1S5CD 3AFQA 5KRUA 2ZJPA 2OTLA 4LFCQ 4FXGC 3PUXA 4DV4L 5FO9B 4CJ0B 3ND8A 2UUAL 3A0JA 3H3VH 2KJXA 3LNNA 2B63H 4LNQA 4JOIC 4BBSH 4LUZA 1PRTC 4P71A 3HRZC 3N52A 4Y52H 3ERQA 1B4OA 4GS3A 2HDLA 2O5IC 2I5LX 3JAMc 2QEXA 1Q1EA 5FLMH 2Z4IA 2H4OA 2E75C 2EPBA 4ULLA 1AZQA 2AMCB 1F2LA 1YNJD 2Q8RE 5FKAC 4QMGA 4A3LG 5AJ3L 1PDQA 4AYBE 3HOUH 1X3GA 3NHHA 3C46A 4JI4L 3DHQA 3PIOA 1LM0A 4DUYL 5NUCA 1S5ED 1PRTD 4QF4A 1DOKA 2ZXPA 5IGGA 1CQFA 4OIJA 1J9OA 1STYA 2NYZD 1UUPA 3Q8DA 2RSNA 3PIP3 1G6PA 4JVZA 3MXNB 3NWSA 3MXPA 1UEBA 2IWHA 4AIMA 5M3MB 4OWTB 2R93H 1K83B 3HG9A 2I07B 4KJNA 4LMQD 1Y14B 4JYAQ 4JCVE 2Z6KC 3FKIH 4A3FH 3TRZA 3LWUA 3OSOA 1HFGA 4F8MA 1TS4A 1VQMA 2KHSA 3KBGA 3KLRA 5M5YH 2E5LQ 4UY8C 4IPDA 2N55A 2PNHA 4OO1G 3I4NB 3A5UA 2F0GA 1BNZA 5GQOA 4LF4L 1W2BA 3DXJC 3FPPA 4DK3C 4B3RQ 5E4XA 1L0XB 1WCMB 2LFNA 3CXCA 1N36Q 1IKLA 5IP7H 4HMIA 4ZLTF 4BBRG 1U4MA 4LFBL 5J22A 3UE1A 5JAVA 2K7VA 2R7DA 5HGTA 1B3AA 1M4VA 5KNDA 4MTNA 1MKHA 5C44B 2IW3A 2WIIB 5KEEA 4DR3L 1PZJD 1BKBA 4MZ9A 3J81c 2IT1A 3KF8B 3U50C 2EY6A 1CK1A 3PIO3 1H9SA 3KF6A 3ULJA 1HTLD 1PTOD 5LHY1 1RTNA 4JI6Q 1TU2B 4DNRB 2ASBA 1IHZA 3GTKB 1IYJB 5IGEA 2K03A 4GOPB 3FDTA 1UE7A 2PMZB 2H1EA 5LMUQ 1I4QA 4ZKBB 4ALPA 1UE1A 3H91A 4X3KA 3J81E 4A3BH 3WWVA 2F0IA 2E2HH 1VQGA 4LF7Q 3U9OA 2QW7A 2UXDL 3T16A 1JICA 2EY1A 1SJHD 2MQHA 4YCUA 2UXBL 3NBHA 1O7YA 1J5EL 2PYKA 4L5RC 2B8GA 2WV6D 1E1TA 3KDFB 3HFZB 1PYSB 4ZCKA 3NXWA 4LUOA 1KLUD 3U4ZA 1EQVA 1BOSA 1LLRD 2DUDA 3OMGA 3HOZH 3W3AA 1RL2A 2DGYA 2KENA 4OWWB 4A3MB 5FK9C 3GTGH 2MJ8A 1RHPA 1VQBA 2VS1A 2Z8LA 4HCEA 3M4QA 4C3IH 1K0RA 3SXHA 3RLFA 4ZYSA 1PV4A 3TN2A 2A8VA 1SRUA 4QY7A 1SYEA 2PQEA 3VR2A 4DK0A 1VCIA 4IUNA 5M5WB 1GHJA 4OX9Q 3K81C 5GAEC 1B9MA 2F0TA 2SOBA 2C35B 1E2VA 3TSSA 1DOLA 1XTDA 3NQTA 4XT1B 1FNVA 3S1RB 1E22A 3TMEA 1JORA 2JA7H 2NVYH 4HIDA 1J6QA 4QUCA 5IGFA 4H44C 3S2DH 2L9HA 4HIOA 4DR5Q 2UUBL 3A8IE 1HR0Q 3L3OC 2JQOA 4LK1C 4R8IA 3HP3A 1BBWA 5BR8L 2F0MA 2B63B 2E8GA 4TKOB 1HZCA 4OELB 4IFDG 4C56C 3W1BA 3P20A 4BBSB 1STGA 2B2TA 1EWHA 1FJGL 1OTCA 4KHPQ 4IALA 2VNUD 4JI5L 3HGBA 5BN5A 3VYSA 2PNRC 3X3MA 2Y0SG 2YTYA 1Y69U 3WOEA 4HJ5A 1SXTA 1B8AA 3TS2A 3BG3A 3NUCA 4KY6A 2PO4A 3HOUB 5I6WA 2M00A 1A2TA 1KNAA 4HTHA 4JPBW 1XWEA 1VQIA 1F2YA 1CTMA 3CW2C 4QB4A 1AW7A 3B6YA 5ELBA 3RLOA 1K0SA 1JJCB 2XVSA 2K75A 2QEJC 1GUTA 3CU7A 3SE0A 2VQFQ 2EYOA 3OTOQ 1LABA 2F0PA 3K7AH 1X6OA 2MO0A 4LF9L 3D8GA 1WTXA 4GKKL 1EQTA 4DV1Q 2PPBC 4G57A 1S5BD 2CHBD 2L55A 2VUMG 1Q3LA 4N8FA 2D5DA 4DK6C 3CKIB 1PH7A 1WYDA 2FJ2A 3NP8A 1CI3M 3MAQA 2R93B 1EOVA 2PQAB 1O7ZA 1FL0A 1NR2A 4JI3L 1R9TH 2PW7A 4X3SA 4P75A 3FKIB 4QUFA 4L8JA 4A3FB 4RGNA 3MHBA 1VQ5A 2L11A 4RFBA 5M5YB 1DGSA 4MTKA 4LWCA 2LXJA 3OMCA 3EIVA 3MFGA 4MHEA 2B2UC 3M7NA 3F8TA 1U4LA 1YVCA 4HIKA 5C5LA 3BYYB 1SN8A 2ALYB 5KYLA 1HA6A 2PMZE 2F0VA 4IUTA 4KI0A 3D6CA 1AFPA 2G9DA 2K14A 4C3JH 1NMFA 1QVGA 1EY9A 2OQKA 2NN6G 4DAYB 3K57A 3OPOA 2KEDA 4IOAA 5CV9A 2CCZA 2F4VL 4FP5D 5F2DA 2B2WA 2F03A 3AYHB 1QVFA 4G7OC 4DV3Q 3CCEA 3H09A 1L1OA 5JEAG 5FLXc 4UP9A 2UUCQ 2BH8A 3GTPH 4DF7A 1EQRA 4CKEA 4WRDA 4A3CH 2ATWA 4ID6A 1D1KA 1U9RA 2C5CA 1CFMA 2IJ0A 2IX3A 3QOJA 4CBVA 2NVXH 4A3BB 2QILA 1MSGA 4O1NA 4B3ML 3A8JE 3EJIA 2E2HB 4K14A 5M3FH 1E7ZA 4JOIA 4N8X1 1NMGA 1PH9A 2JA5H 1AH9A 4EGVA 2BH2A 1IBKL 1HQMC 2ZJQA 2YV5A 4BXXH 3H3VI 1XTCD 3FPUB 2G9HD 2XWJB 2ZT9C 3E3XA 2F0KA 4YHHQ 5ELEA 5C3EG 5IYBG 1XPOA 3BU2A 3SHLA 4MN3A 1LV9A 3S2HH 1V1PA 1TVXA 3HOZB 1HZAA 3RD4A 1L0WA 4UPAA 1L0YB 4A3JG 3TZDA 4PG3A 4RH6A 1JJ2A 3GTGB 3PO3G 3OWEB 2X69A 1ICFB 2WB1B 4RGOS 3ULLA 5IGDA 5I9PA 3J80L 2RF4A 2EYHA 4FDBA 4C3IB 5GAGC 1SFOH 2UU9L 4OEMB 4TQUS 4RKBA 4TSSA 3KOJA 3SR1A 2CWAA 1EEFD 4IFDJ 1N8RC 3IAYA 3W2DA 2A68C 2JA6H 3VR4A 3S14H 4JI1Q 1HNWQ 3EQLC 2ZM6L 3C1EA 2NZHA 1XX8A 4X65L 1EIGA 1SSOA 1WTHA 2HT1A 4GKJL 4R4OA 4EQ5A 3QJYA 2JA7B 2Z6KA 4NPSA 2NVYB 4A3IG 1M1KC 3S2DB 5DNFA 4DA2A 5A2QL 1A8VA 5IP9G 1WJJA 5IT9c 3CCMA 2D2CC 1EEID 3E0EA 4JV5Q 1VQJA 1V9PA 1AEXA 3VR5A 1LTTD 1N34Q 2K1BA 4AH6A 5D3DA 4RWSC 4AYBB 1LT3D 4DR2L 4OX9L 4OL7A 1MHWC 5I4DA 4NDXA 2NBFA 5ELFA 1UAPA 1H9JA 1GOZA 2PI2E 4GNXC 3UE0A 1HNZL 4DKAC 3AFPA 5I2YA 1D5ZC 4IURA 2EQSA 2ZTEA 4R4IA 3DMUA 3CC2A 3VA5A 3SK4A 2EZVA 1A62A 2HQEA 4ODGA 5JJKA 1TWHH 3JC66 1U4PA 4DR4L 2K5VA 2X6GA 1A63A 4B3SL 1KRSA 4CDFC 3T51B 1B50A 5JOBA 1F9QA 1X3QA 5JPNC 4I7ZC 3K7AB 4DV2L 1LTSD 1H9SB 3KF6B 1DJRD 3GV3A 2PW5A 5ISRA 1PRTF 2E2DC 2MFIA 2F1MA 3E9IA 4A3LH 4GLAC 3PF5A 3E6ZX 4CJ1B 2MUYA 2RKSA 1R9TB 2I46A 5LMNL 2DNEA 1CKNA 1SEBD 2WAQG 5DLQE 2L1BA 1VDZA 4M8AA 2WACA 1B70B 3GQBA 1O7IA 3TBIB 1SAPA 4XTCS 4DR7Q 2Y0SE 1TS3A 3K7UC 3KBXA 2NZOA 1TS2A 4DR6Q 1YHQA 5JEAJ 5GADC 2TMPA 4DUZQ 2R61A 4IOCA 1YI2A 2HQLA 3L7ZC 1TIID 2ZTDA 4DAPA 2RHSB 4B9WA 2H5XA 3CF5A 4C3JB 2B8FA 1D5XC 3CP0A 5EKKA 3R3OA 1WFQA 1T5EA 3RLNA 3SEBA 1WTWA 2B2VC 3FEWX 2R7FA 4BY1G 1LYLA 4Y7NH 1N32L 3LX0A 4DK1A 1MJEA 2R92G 4OO1H 1G91A 2LKVA 2BCOA 3GTPB 1CHQD 3M4OH 1I4RA 4XYOA 4YIJA 1NE3A 1I50H 2BDOA 3F1ZA 1CZGA 3T1YL 3V96A 4BBRH 1PTOF 2O4XA 5HY6A 3W1GA 1JOOA 2NVXB 2JA8G 2JEBI 1YJNA 2YTVA 2K5QA 2WB1E 1SR3A 3QR8A 5M3FB 1WTVA 2C9OA 2JA5B 1JWMD 2F0QA 2HDMA 1HNXQ 1HRJA 4AQYQ 5CC4A 1WD0A 5CV5A 4WJ3M 4A93G 3I56A 4NP5A 1PTOH 1LTRD 3FP9A 3UDXA 1HTPA 3CHBD 1STNA 3D4WA 2YYZA 3S2HB 1V1OA 4K2KA 5IYDG 2VQEQ 2R6GA 4Q0FA 4NXNQ 3F2DA 3HOYG 1PH5A 1AP0A 1K3RA 3GD7A 4S3SA 3AMUA 2FXQA 1SFOB 3U9SA 1B3QA 1YITA 3KJOA 4X66L 3I4LA 1BO0A 3CRLC 1EL0A 5C4XG 1FR3A 4BY7G 4LF5Q 1KABA 1SNQA 2LMCB 2B3GA 2JSOA 4A75A 1XJVA 1X54A 4GN3B 5K5PA 4H7BA 3J81L 1HA5A 1CQVA 1SE8A 2Q8IB 2JA6B 2HHHL 4X62L 3S14B 1VS0A 4K5XA 1PVOA 5EKIA 2AHOB 4DXFA 5L37A 3JAME 1Q46A 3EROA 1G6ZA 3J81j 1OXTA 3H0GG 1SYFA 2KEEA 4I7AA 1PLFA 3K0YA 4OGQC 3I91A 2AWOA 2M2LA 4DV7Q 4IUVA 2F0SA 1IBMQ 1EY6A 4A3DG 5ELNA 1K73C 2SDFA 1UEAB 4B9XA 2J4XA 3U4VA 4EVOA 2RDGA 2K4KA 1IL8A 4UP7A 2RCNA 3T1HQ 1QZGA 2B2UA 4JI0L 1LACA 4APVA 2G5DA 3F2UA 1XNRQ 3UDFA 1TY0A 4JI8L 4XIGS 1Q82C 2WINB 4V190 2EYMA 5FJ8G 2VB2X 3NENA 4DFAA 3PUYA 1YZ6A 1PTOC 1DXMA 3C1FA 4DV5Q 4CHTB 1S4ZA 1Q8IA 2E2JH 4A76A 1HXYD 3GO5A 1CHPD 4C3HG 2Q8TA 2Z9HA 1IBLL 1TWHB 2E74C 1XNQQ 1DCZA 2EJMA 4FO2A 4IFDH 5IOCA 4LFAQ 1KDCA 4M1UB 4DV6Q 3S1QH 3ZYYX 3NSWA 1QUQA 1SBBB 5IGCA 1WOCA 1JE4A 1HUMA 4A3GG 1HZ9A 1Q8KA 4X64Q 3R2TA 1E0BA 3RN5A 2A1AA 1L1OB 3L2PA 2UXCL 4KHZA 1Y1VG 2MHVA 3MA2B 1XMOL 4LUVA 4PMBA 4A4IA 5JJZA 4LW1A 4B3TQ 2K50A 4YY3Q 1VQ8A 5J39A 1E2ZA 1SE3A 2Q2TA 1HHVA 2VB3X 2I5HA 1EYGA 3GTLH 5D65A 2N3SA 4JI2Q 3GTMH 3R93A 2GN5A 2B39A 1XPUA 1SMXA 1TWFH 4TRDA 5IYCG 1PRTB 3O13A 1MJCA 2HUGA 4H02A 2K5NA 5JPMC 3SVMA 4RKLA 4O0AA 1SROA 3TP6A 1XMQL 1BCPC 2VUMH 1BR9A 1KLGD 2ZTCA 5C4HA 3KJPA 1V1PB 5D14A 1B44D 2F0LA 2KHIA 3VYRA 3GV6A 4ABNA 2KCCA 2OXPA 1ILPA 5C0XG 3CCRA 3ERSX 4DV0Q 1G2TA 4Y7NB 3L9AX 1K8AC 2OF1A 4RHSA 4LF8L 4YWMA 4R4QA 3CRKC 3M4OB 1D8LA 2R7ZG 1WD1A 4JBMA 1N33Q 3AEVA 1I50B 4DUZL 3KUPA 3J80i 5HGQA 2DN8A 3HOWG 4BBRB 4GN5A 4U673 1QCBD 1HH2P 1BCPD 3F2CA 1ESFA 1F77A 4HCSA 2A73B 2QCPX 2NN6H 4F7XA 4PV1C 1VQKA 1HFNA 1X3EA 3BJUA 4KV6A 4RMFA 3R8BA 1BDOA 1STBA 4UP8A 5CV4A 5KIXA 2IX0A 4IJHA 2PCFB 2N8NA 3EVQA 5C3WA 1PTOB 4HJ7A 3D3RA 3VYTA 5JEAH 4GNXA 1EQQA 1EY8A 1Q81C 1BQQT 2JK8A 1NNXA 2K5HA 4LF6L 1JC7A 1I94Q 2XN9C 1K8GA 3PGZA 1IYUA 4P73A 1V43A 3ER0A 4C1NK 4CDDC 1G8ZD 3A7AB 2EYFA 3RZOH 4L5QA 1X3PA 1YNXA 1RIPA 1P8LA 4GLVB 5EBCA 5IWAL 3CCJA 4QL5A 4RA8A 3P7JA 4LFCL 1FVIA 4HN7A 1H9RA 4JBWA 5C3EH 5IYBH 4K8IA 4F88A 2EXZA 1HQRD 3I4OA 3GDEA 2F0JA 4A3JH 1CA6A 3PO3H 5C4JH 1LTID 5TSSA 3PMFA 2EOTA 4PZ6A 1TR5A 2D0PA 5HURA 1HJPA 1D6EC 1IYVA 1B53A 2NUCA 1O7LA 2SNSA 1VQFA 4POFA 4DN4M 4K5VA 2Q2IA 1CUKA 2XNAC 1EYCA 4L5TA 1H9MA 4K8JA 1CKNB 4R4TA 1PH6A 5BN3A 3AQQA 5I6YA 4LJZC 3FVQA 3J7AF 4DR1Q 1EZ6A 2AQ3B 1U4RA 2ZXRA 1SNMA 5EBDA 2K33A 4NXMQ 1C48A 2ES2A 2IX1A 2KHJA 4EX5A 4A3IH 1D7QA 3IFTA 1I4GA 2L12A 4JBKA 2E2JB 2B2VA 4KLKA 3E9HA 4RCOA 1PH1A 3R2IA 1IXRA 4L63B 3HKZG 2AUJD 3G4SA 3ICEA 2LY7A 2RDFA 2CKZB 4JYAL 2LS01 3S1QB 3T4AC 5IY0A 2CH4W 3VYUA 4OO1I 4O42A 2E5LL 2Y0SB 4K6LA 2EY2A 3P1HA 4JI7Q 1Z9FA 4XT3B 2XSCA 1PFMA 4WFN3 1TXYA 1TY2A 2VL6A 4B3RL 2AUKA 1N36L 1I4HA 5CV7A 5FO8B 3GTLB 4A3KG 3BZKA 1DM0B 3PO2G 3RMHA 4IN3A 2O2LD 1IW7C 3GTMB 5C0XJ 3M9BA 1C9OA 5M5XH 5DM63 3OHXC 1TWFB 5I2XA 4JC0A 1QE6A 4X3TA 2ZXOA 1FNWA 2K28A 1PH3A 1Y8OB 4DV4Q 1GJXA 5FLXE 2QKIC 2UUAQ 3SK6A 3M4PA 1X3FA 4EQOA 2VUMB 4CJ2C 1T9HA 3QG1A 2EJFC 4HJAA 3D31A 4HMJA 4JI6L 3PV0A 1GVPA 1Q86C 5EAYA 2CH4A 1ENCA 5T1IA 1Z47A 4FF4A 3G48A 5LMUL 4TVAB 3CCUA 1E24A 2K05A 2XRSD 4N9PA 1IW7D 1F9RA 1Y1WG 1B1ZA 1LT5D 5AJ3Q 4LF7L 1C4QA 5C4ZA 4WJ4A 1BVSA 1MD2D 1U0LA 5G3LF 1PHJA 2WFWA 2K6AA 4KHVA 5FOBB 1VQDA 2EYLA 4JI4Q 1OXVA 3CQZH 1VQEA 2F0NA 2HCCA 4PZ7A 1ASZA 2HD3A 1E3PA 3S1NH 5E7NA 2A19A 1NBWA 4DUYQ 1X9NA 1LUZA 4A3EG 3VR3A 3M85A 3CCVA 3W5OA 1NUCA 4CKCA 2OT2A 4BA1I 3S15H 2NTSA 3FRPB 2J7ZA 1R4QB 2WP8J 4XDXA 3FHWA 1KIXA 3HOVG 1EU3A 2F0OA 2IHEA 1SDFA 4BY1H 2Q2UA 4GLXA 3CMAA 2R92H 3OIQA 2F0DA 3DEOA 1TWCH 2JP1A 4KD4A 4KD3A 1OXUA 3BZDB 2EDGA 1PH4A 1RTOA 4UDUC 1EIHA 1ZXTA 4QGUA 5E4WC 2KECA 3PUVA 1P16A 4IPCA 1FNUA 4HIMA 1MIUA 3HOXH 1S5DD 3D6WA 2JA8H 3RR5A 3QOLA 4LF4Q 3S16H 4RCNA 3RZOB 1EFWA 4PMWA 1UE5A 3ND9A 1PMRA 1FGUA 3N6RA 5IT9E 1FYCA 3H15A 4IUQA 2XRQD 3NQIA 4K5WA 4DR5L 4A93H 1G51A 4LFBQ 1HR0L 1A3TA 4IFDI 5C3EB 2CW0C 1YJWA 1RD9D 3D4DA 3EA6A 1JWSD 1NTGA 4DR3Q 2F3VA 1ASYA 5IYDH 3I90A 2CWPA 1KQSA 3G71A 4HEDA 4DXGA 1QUQB 5KNBA 3NTIA 3UI2A 4A3JB 3HOYH 3PO3B 4KHPL 5C4JB 1VQLA 2N88A 4YCWA 1Q12A 2GVBA 3I72A 1VQNA 4XQNA 3LGJA 4NW2A 5EGTA 4A3CG 3NE5B 1EFID 1RCVD 2JN4A 4NKLA 4OXPA 2RBMA 1WTPA 5C4XH 4BY7H 1EIYB 3NWTA 3RN2A 4EQPA 2XWBB 3J80c 3TQYA 3I4MG 1A2UA 2L0CA 3C2PA 1JT8A 2KQ3A 1Y8NB 2A6HC 3ONAB 4X3UA 4XQJA 1PFBA 2BA0A 3BVGA 5C6AA 3GTQH 1OXXK 2CW0D 4IPGA 2UXDQ 3J7ZC 1C0AA 3H0GH 1O78A 1NR4A 1SNPA 2GA4B 2Z6BA 4RAUC 4ZQ3A 1J5EQ 2UXBQ 1D2BA 2MO1A 4C2MH 1K8OA 1VMCA 2VQFL 2KA7A 3PUWA 1EWIA 2AWNA 4KMUC 3VA7A 3OTOL 1QJOA 2EYJA 1E2WA 4A3DH 3PCOB 3JAML 4DV1L 4DNIA 4N9TA 2F0UA 1EYAA 1QZHA 3I3CA 3CPWA 1CKMA 2OQ0A 2A6HD 3Q22A 2VZAA 5J3BA 1CM9A 5G3LD 5CR3A 1QVCA 5FJ8H 1NCVA 1TQOA 1KDBA 4ZKCB 4CDCC 3CCSA 4P72A 4PZ8A 5T1GA 2RSOA 2O5JC 2FMCA 1W3SA 2XIWA 4NB3A 3E5SA 1GUGA 1JWUD 4C3HH 2AQ1B 2YU9H 1TKWB 3RZDH 2NN6I 1NSNS 3CAMA 1X65A 5M5XB 2Z4HA 3NEMA 3ZJYC 3J7A5 1TWGH 1XYIA 3BDLA 3M4YA 1J8IA 2ICEC 5AFWA 3GTJH 4IO9A 2UUBQ 2E76C 1Q7YC 4A3GH 5BR8Q 2BA1A 4KKTA 1VQCA 4H13C 1BBUA 1Y1VH 1A0IA 4DV3L 2A5HA 4GNXB 5M3MG 5IGBA 2NTTA 3MC0B 2UUCL 5EJWA 5K36G 1FJGQ 1VQAA 4MIUA 4YWLA 3MXGA 3TP7A 1YHBA 3V05A 2Z1CA 4JI5Q 4G4KA 2WAQB 4KKSA 3A7LA 4ZUIA 4DU9A 4UAIA 4E6IA 3LWEA 4RGTA 3MEHA 1SYBA 3I4NG 1WTOA 3PF4A 1K3BC 5IYCH 1EIFA 4GOPC 3DEPA 5KGUA 4POGA 1RKNA 1SYDA 4PQXA 3TREA 1DONA 1F9PA 1WCMG 5I9OA 5LMNW 3NTKA 1HZBA 2B2YC 2R3ZA 4ZUJA 3CQZB 1X55A 3IKJA 4YHHL 1Y8PB 3S1NB 4K6DA 2K32A 2TSSA 4KY5A 5C44G 1K28A 2M9VA 2MGSA 3CC7A 3TZUA 3S15B 1STAA 4P74A 5GAHC 4DNTB 1UWVA 4LF9Q 4GKKQ 5DAUA 1BCPF 5C0XH 3F2BA 4FNFA 4HSVA 4BY1B 2BOSA 4ZK9B 3QO2A 2R92B 1IL2A 3D4RA 3K5NA 1VQ4A 1TWCB 5CGKA 4JI3Q 2BE5C 4X6AH 2R7ZH 5COYA 1G2SA 3M7GA 2NWGA 4ILWA 5LL6S 2F0FA 1T5XD 4K0KQ 2F0WA 3HOWH 3AB9A 1LTBD 1LT6D 2DY8A 1ICWA 1PH8A 3HZXA 3HOXB 2RDHA 4JI1L 2JA8B 1HNWL 3OW2A 4XQQA 1CZWA 3S16B 1ZEQX 2EXDA 3DWQA 3BVZA 1GUOA 4OWXB 3KFUA 3A54A 4QCLA 4J6HA 5EPJA 3J7YW 3STBC 1ZKOA 3VR6A 1BBXC 1VQHA 1ZYRC 3D0FA 3IRBA 4K2LA 1O80A 2K04A 5E3FA 4DPGA 4CDEC 2NVTH 4A93B 1BXTA 4JV5L 1VQ9A 3MEFA 4OHJA 2MPMA 1K9MC 2BE5D 4A3MG 2KUMA 4FF2A 2P5ZX 1N34L 1V8QA 2F4VQ 1DZ1A 3A55A 4DAMA 3HOYB 2JXMB 2PZUA 2OWOA 1TS5A 2Z0SA 1U5KA 5LL6X 1EYDA 1QNUA 3CD6A 5CV6A 3H3VC 4RGMA 2EE1A 2PZTA 2RVLA 3KLSA 1EY5A 5C4XB 4BY7B 1JJGA 1DYQA 3I70A 5EPLA 1W6JA 3TP8A 1JQYD 3STBD 1KTKA 3CMEA 1ZYRD 3K59A 3VDYA 4B3MQ 2DY7A 1TT2A 3K58A 3GTQB 1PYBA 1D1IA 3S17H 1GUWA 2RHQB 1SE2A 4NMZA 3EBEA 2EYPA 3H0GB 1CSPA 1IBKQ 4C2MB 4BA2I 1MGSA 3IFDA 3OWFA 3QB3A 2WKCA 3OYYA 4CKBA 1ENAA 1GUSA 3PUZA 1JMCA 2EIFA 4A3DB 2B63G 1KHIA 1KDAA 1HCZA 4BBSG 1AN8A 1PFSA 3SK5A 1ONLA 5KYIA 3BYTB 1VQ6A 1QILA 1JR0D 1SYGA 1F2ZA 2IL8A 2KCNA 3NK9A 5FLMG 2CQOA 2UU9Q 2N49A 4JBJA 1I5FA 1LO5D
chains in the Genus database with same CATH topology
4DR7L 3HKZG 4BBSH 4LUZA 4DKAC 3G4SA 3AFPA 4P71A 3ICEA 2CKZB 4Y52H 4JYAL 4GS3A 3NELA 2EQSA 2ZTEA 4R4IA 2I5LX 3JAMc 3HOUG 4DR6L 1KL9A 5IY0A 2QEXA 1Q1EA 5FLMH 3CC2A 1E1OA 4OO1I 3L0OA 1SLJA 1A62A 1PH2A 5JJKA 2AMCB 2ZM6Q 1TWHH 2E5LL 4HJ8A 3JC66 4X65Q 4DR4L 2K5VA 2WAQE 1S72A 4GKJQ 1AE2A 4JI7Q 1I3QH 1Z9FA 4GNXC 4A3LG 5AJ3L 1A63A 4B3SL 3S1MH 1TXYA 1KRSA 4AYBE 3HOUH 3I55A 2VL6A 4B3RL 1X3GA 3K8AA 5GROA 1N36L 4DV2L 3KF6B 4A3KG 4JI4L 3BZKA 3PO2G 3PIOA 1I6HH 1LM0A 2MFIA 5C0XJ 3M9BA 4DUYL 1C9OA 1GKHA 3E9IA 5M5XH 4A3LH 2R93G 4GLAC 2D62A 3DLLA 3PF5A 3KLWA 4JC0A 4DR2Q 3M3YH 3FKIG 4A3FG 1PH3A 4DV4Q 5LMNL 3Q8DA 1CKNA 2WAQG 5DLQE 2UUAQ 4YCVA 4A3KH 3M4PA 1X3FA 1B70B 1B7YB 1O7IA 1G6PA 3MXNB 3PO2H 2KBNA 1UEBA 4XTCS 1HNZQ 1T9HA 4DR7Q 4AIMA 2Y0SE 4OWTB 3D31A 3K7UC 4HJAA 1GVPA 3PV0A 4JI6L 2R93H 2NZOA 4JYAQ 1Y14B 1Q86C 1YIJA 4JCVE 5EAYA 2Z6KC 1YHQA 4DR6Q 3FKIH 3U58A 1Z47A 5JEAJ 5GADC 4A3FH 3TRZA 1HNXL 3G48A 5LMUL 4AQYL 4TVAB 3CCUA 1VQMA 1E24A 2YTXA 5IP7G 4DUZQ 2OTJA 5M5YH 4IOCA 1NY4A 1YI2A 2E5LQ 2HQLA 4UY8C 4IPDA 3L7ZC 4DR4Q 2ZTDA 2D0OA 2RHSB 2PNHA 2VW9A 4OO1G 5JJIA 2H5XA 3CF5A 3A5UA 1Y1WG 5GQOA 4LF4L 2Q2HA 5AJ3Q 4LF7L 3UE0A 1W2BA 4DK3C 4WJ4A 4B3SQ 1BVSA 1U0LA 3CP0A 4QJFA 1M90C 2VQEL 1WFQA 2LSSA 2MNAA 4B3RQ 1YHAA 2WFWA 1PHJA 3RLNA 3CXCA 4NXNL 1N36Q 5IP7H 4DV2Q 1VQDA 2R7FA 4BBRG 4JI4Q 1OXVA 3CQZH 1VQEA 4PZ7A 1LYLA 4BY1G 4Y7NH 1ASZA 1E3PA 3S1NH 4LFBL 1N32L 5E7NA 2A19A 1MJEA 2R92G 1NBWA 4O2DA 3UE1A 4DUYQ 2R7DA 1X9NA 1LUZA 4A3EG 1Y1WH 2JE6I 3M85A 3CCVA 4MTNA 3W5OA 1MKHA 2ID0A 3GTMH 4BA1I 3M4OH 3S15H 4DR3L 4LF5L 3A74A 1NE3A 1I50H 2WP8J 5LMNQ 1BKBA 3F1ZA 3T1YL 3FHWA 4MZ9A 3J81c 1KIXA 3HOVG 2IT1A 3KF8B 3U50C 2IHEA 4BBRH 4BY1H 5HY6A 2Q2UA 2UXCL 4A3BG 3KF6A 3W1GA 3ULJA 4GLXA 2JA8G 3CMAA 2R92H 1L2FA 2JEBI 1YJNA 4A3EH 2WB1E 2YTVA 1SR3A 4JI6Q 1TWCH 2ASBA 3KYHC 1IYJB 3TS0A 1OXUA 1YEZA 4GOPB 1PH4A 1TWAH 1UE7A 2IY5B 4QGUA 1AE3A 5LMUQ 3RNUA 1HNXQ 4AQYQ 3PUVA 1P16A 4ALPA 3HOVH 1UE1A 3S24A 4WJ3M 4IPCA 5IE8A 4HIMA 1MIUA 3PSIA 4DV7L 3HOXH 3I56A 2AKWB 3WWVA 4A3BH 4A93G 2JA8H 1IBML 2E2HH 1VQGA 3FP9A 3UDXA 3RR5A 4LF4Q 5IP9H 3S16H 2YYZA 4LF7Q 1EFWA 2I0QA 2ZJRA 3HOZG 2UXDL 4PMWA 1UE5A 4YWKA 3GTOH 5IYDG 2VQEQ 3A5ZB 1FGUA 2KCTA 2MQHA 4YCUA 3T1HL 2R6GA 4K0KL 2UXBL 1J5EL 4L5RC 4NXNQ 3H15A 3F2DA 1UE6A 3HOYG 1PH5A 1E1TA 1K3RA 2WB1G 3GD7A 3JAMi 3KDFB 4DR5L 4A93H 1G51A 4LFBQ 1HR0L 1N32Q 3HKSA 1PYSB 3HFZB 1XNRL 4IFDI 2FXQA 2XTIA 4LUOA 1YJWA 1YITA 3KJOA 4X66L 3U4ZA 1GO3E 2DUDA 3HOZH 3BZCA 4BY7G 5C4XG 1NTGA 4DR3Q 1RL2A 2DGYA 2KENA 1ASYA 4LF5Q 4OWWB 5IYDH 2CWPA 1KQSA 3G71A 2B3GA 3T1YQ 1QUQB 3GTGH 4A75A 1XJVA 1X54A 4GN3B 3HOYH 4DV5L 4KHPL 1VQLA 1VQBA 2VS1A 4YCWA 3M4QA 1Q12A 1SE8A 2GVBA 3K80C 2HHHL 2CFMA 4C3IH 4X62L 1VQNA 1K0RA 1VS0A 3LGJA 3G6EA 1PVOA 2AHOB 3RLFA 4A3CG 1Q46A 1PV4A 4OXPA 1LTLA 4IJLA 1XNQL 3CPFA 2A8VA 3J81j 5C4XH 1SRUA 4BY7H 1OXTA 4QY7A 1EIYB 3H0GG 2JA9A 3RN2A 4LFAL 4DV6L 2JA7G 3J80c 1VCIA 3TQYA 3I4MG 2LXKA 2AWOA 4OX9Q 3K81C 5GAEC 1JT8A 4DV7Q 1VQ7A 3I2ZA 2C35B 4X64L 4R1JA 1X56A 2BA0A 1IBMQ 4A3DG 2E2IH 5ELNA 3GTQH 1OXXK 1K73C 1XTDA 2NVQH 4IPGA 3U4VA 2UXDQ 3J7ZC 2K4KA 1C0AA 1E22A 3H0GH 2RCNA 4UP7A 3T1HQ 1QZGA 2UXBQ 4AYBG 1J5EQ 4GOPA 2JA7H 2MO1A 2NVYH 4C2MH 4HIDA 4B3TL 4JI0L 1J6QA 3I4MH 4YY3L 2VQFL 4GN4B 4APVA 3PUWA 1EWIA 2AWNA 4HIOA 1G291 2F3IA 3OTOL 4DR5Q 1HR0Q 2UUBL 1XNRQ 3ULPA 3UDFA 2JQOA 4JI8L 4XIGS 1Q82C 4A3DH 3PCOB 1BBWA 5BR8L 4DV1L 4X66Q 4JI2L 2E8GA 5FJ8G 1HZCA 3NENA 4DNIA 4IFDG 3PUYA 1YZ6A 3W1BA 1CKOA 1QZHA 2B29A 1FJGL 1OTCA 4DV5Q 3CPWA 4KHPQ 2L15A 1CKMA 4IPHA 2XGTA 2E2JH 2JJQA 2VNUD 2OQ0A 4JG2A 4A76A 4JI5L 3GO5A 4X62Q 2HHHQ 3KDFA 5ELOA 2VZAA 1KAWA 5J3BA 2Y0SG 1IBLL 2YTYA 2VY3A 4HJ5A 1QVCA 5FJ8H 1XNQQ 4LFAQ 1B8AA 1H95A 4DV6Q 3TS2A 3S1QH 3CCSA 5C0XI 1QUQA 4P72A 4PZ8A 1W3SA 1WOCA 4A3GG 3J81i 1HZ9A 1Q8KA 4X64Q 1VQIA 2F52A 4NB3A 1XPRA 4C3HH 2YU9H 3RN5A 2A1AA 3UDGA 1L1OB 3L2PA 3CW2C 4DV0L 3B6YA 3RLOA 4KHZA 1Y1VG 1XMOL 3RZDH 2NN6I 4LUVA 1KXLA 1JJCB 4R4CA 3CAMA 4A4IA 1V1QA 2V1CC 2K75A 1X65A 2JEAI 3J7A5 3NEMA 4LW1A 3ZJYC 4B3TQ 1TWGH 2K50A 3SGIA 4JI0Q 4YY3Q 2VQFQ 1VQ8A 2K52A 3GTJH 1GM5A 4IO9A 2UUBQ 1N33L 3OTOQ 1Q7YC 2Q2TA 3K7AH 1EYGA 2I5HA 1C7YA 4A3GH 1X6OA 2MO0A 4JI8Q 4LF9L 1Q1BA 3GTLH 5BR8Q 4GKKL 4DV1Q 2BA1A 1VQCA 2N3SA 2VUMG 4JI2Q 1BBUA 1Y1VH 1A0IA 4DK6C 4DV3L 2GN5A 1PH7A 2QA4A 1WYDA 5M3MG 4GNXB 1XPUA 1SMXA 1TWFH 2UUCL 5K36G 5IYCG 1YJ9A 1FJGQ 1EOVA 1VQAA 2PQAB 1FL0A 4QIWE 4JI3L 1MJCA 4YWLA 3CCQA 1R9TH 1YHBA 4H02A 2K5NA 4P75A 4JI5Q 4O0AA 1SROA 1VQ5A 1XMQL 1IBLQ 3TEHB 2VUMH 1DGSA 2ZTCA 3KJPA 3I4NG 5M3MH 4LWCA 1KRTA 2LXJA 1K83H 3EIVA 3PF4A 5IYCH 1EIFA 3M7NA 4GOPC 4POGA 3F8TA 3TREA 2KHIA 1YVCA 4HIKA 1WCMG 1IZ6A 1I94L 5LMNW 3K0XA 1VQPA 1SN8A 1HZBA 2ALYB 5C0XG 3CCRA 2HIXA 2PMZE 3ERSX 1KD1C 4DV0Q 1X55A 2UXCQ 4YHHL 1XMOQ 4KI0A 2K14A 3I4NH 1K8AC 4LF8L 1NJIC 4C3JH 5C44G 3CC7A 1NMFA 4YWMA 4R4QA 1QVGA 2OQKA 1D8LA 2NN6G 4DAYB 2R7ZG 4P74A 1JB7A 5GAHC 4RG1A 4JBMA 1WCMH 4DUZL 1N33Q 3AEVA 4IOAA 1UWVA 2CCZA 3J80i 5HGQA 2F4VL 4LF9Q 4GKKQ 1VQOA 3HOWG 3F2BA 2KCMA 3AYHB 4GN5A 1QVFA 1HH2P 4DV3Q 3F2CA 3CCEA 1L1OA 1IL2A 5JEAG 5FLXc 4UP9A 2UUCQ 2BH8A 5M3FG 3GTPH 5C44H 1EQRA 1VQ4A 4JI3Q 4L5SA 2I5MX 2ATWA 2JA5G 1VQKA 2R7ZH 4A3CH 4X6AH 1X3EA 3BJUA 4RMFA 1S3OA 4BXXG 4K0KQ 2PI2A 4QQBX 3HOWH 4UP8A 1XMQQ 2IX0A 4IJHA 2NVXH 1PH8A 2N8NA 2IHFA 4JI1L 4B3ML 1HNWL 3OW2A 4HJ7A 1WI5A 5M3FH 1E7ZA 4JOIA 4GNXA 2EXDA 1EQQA 3GTKH 1NMGA 1Q81C 4OWXB 3KFUA 1PH9A 2JA5H 2JK8A 2K5HA 1AH9A 1GD7A 1OXSC 4LF6L 2PQAA 2BH2A 3STBC 1I94Q 1IBKL 4BXXH 1VQHA 2YV5A 2ZJQA 3D0FA 3IRBA 3H3VI 5JJLA 2OCEA 1K8GA 4DPGA 1YBYA 3PGZA 4P73A 2NVTH 1V43A 3ER0A 2HIVA 4YHHQ 5C3EG 1S40A 5IYBG 1XPOA 3BU2A 4LF8Q 2GVAA 4DR1L 4JV5L 1VQ9A 3RZOH 3NBHB 3MEFA 4L5QA 3S2HH 3EN2A 2QGQA 1YNXA 1K9MC 4NXML 1RIPA 4A3MG 1HZAA 1P8LA 4GLVB 5IWAL 1L0WA 3CCJA 4QL5A 4UPAA 1N34L 4A3JG 2F4VQ 1JJ2A 4PG3A 4DAMA 3PO3G 4MNOA 4LFCL 2OWOA 2Z0SA 2JA6G 1FVIA 1U5KA 2N78A 3ULLA 4JBWA 2RF4A 4FDBA 5GAGC 5IYBH 5C3EH 1SFOH 2UU9L 3CD6A 4TQUS 5H1SE 3KOJA 2CWAA 3I4OA 4A3MH 1JJGA 3GDEA 3STBD 4A3JH 3PO3H 1N9WA 1CSQA 5C4JH 4IFDJ 1N8RC 3UDIA 3CMEA 2JA6H 4PZ6A 2D0PA 3VDYA 3S14H 1HJPA 4JI1Q 1HR0W 4B3MQ 1HNWQ 1PA6A 2ZM6L 1PYBA 2NZHA 4X65L 3S17H 1VQFA 2RHQB 2HT1A 4POFA 4GKJL 1JE5A 4R4OA 4LF6Q 3EBEA 4EQ5A 3CC4A 4JI7L 1KC8C 3DM3A 3CCLA 2Q2IA 1CSPA 1IBKQ 1CUKA 2Z6KA 4NPSA 4L5TA 4A3IG 4BA2I 5M5WH 3HOXG 1CKNB 1EUJA 4R4TA 3HKZE 3OYYA 1PH6A 1M1KC 3AQQA 3PUZA 1JMCA 1A8VA 4OONA 5IP9G 1WJJA 2EIFA 3I7FA 4HJ9A 5IT9c 1L1OC 3CCMA 4DR1Q 3S2DH 3E0EA 2B63G 4JV5Q 1KHIA 1VQJA 3PIPA 3S1RH 1V9PA 4ME3A 4NXMQ 4BBSG 2ES2A 1PFSA 1N34Q 5IWAQ 4AH6A 4J15A 2IX1A 2KHJA 3AFQA 4EX5A 2ZJPA 4DR2L 4A3IH 2OTLA 4OX9L 1D7QA 4LFCQ 1VQ6A 3PUXA 4DV4L 4JBKA 5FLMG 2CQOA 2UUAL 4KLKA 2UU9Q 3A0JA 2N49A 3E9HA 4JBJA 3H3VH 2PI2E 2B63H 1PH1A 1I5FA 4LNQA 4JOIC 1IXRA 1HNZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 L;  3HKZ G;  4BBS H;  4LUZ A;  4DKA C;  3G4S A;  3AFP A;  4P71 A;  3ICE A;  2CKZ B;  4Y52 H;  4JYA L;  4GS3 A;  3NEL A;  2EQS A;  2ZTE A;  4R4I A;  2I5L X;  3JAM c;  3HOU G;  4DR6 L;  1KL9 A;  5IY0 A;  2QEX A;  1Q1E A;  5FLM H;  3CC2 A;  1E1O A;  4OO1 I;  3L0O A;  1SLJ A;  1A62 A;  1PH2 A;  5JJK A;  2AMC B;  2ZM6 Q;  1TWH H;  2E5L L;  4HJ8 A;  3JC6 6;  4X65 Q;  4DR4 L;  2K5V A;  2WAQ E;  1S72 A;  4GKJ Q;  1AE2 A;  4JI7 Q;  1I3Q H;  1Z9F A;  4GNX C;  4A3L G;  5AJ3 L;  1A63 A;  4B3S L;  3S1M H;  1TXY A;  1KRS A;  4AYB E;  3HOU H;  3I55 A;  2VL6 A;  4B3R L;  1X3G A;  3K8A A;  5GRO A;  1N36 L;  4DV2 L;  3KF6 B;  4A3K G;  4JI4 L;  3BZK A;  3PO2 G;  3PIO A;  1I6H H;  1LM0 A;  2MFI A;  5C0X J;  3M9B A;  4DUY L;  1C9O A;  1GKH A;  3E9I A;  5M5X H;  4A3L H;  2R93 G;  4GLA C;  2D62 A;  3DLL A;  3PF5 A;  3KLW A;  4JC0 A;  4DR2 Q;  3M3Y H;  3FKI G;  4A3F G;  1PH3 A;  4DV4 Q;  5LMN L;  3Q8D A;  1CKN A;  2WAQ G;  5DLQ E;  2UUA Q;  4YCV A;  4A3K H;  3M4P A;  1X3F A;  1B70 B;  1B7Y B;  1O7I A;  1G6P A;  3MXN B;  3PO2 H;  2KBN A;  1UEB A;  4XTC S;  1HNZ Q;  1T9H A;  4DR7 Q;  4AIM A;  2Y0S E;  4OWT B;  3D31 A;  3K7U C;  4HJA A;  1GVP A;  3PV0 A;  4JI6 L;  2R93 H;  2NZO A;  4JYA Q;  1Y14 B;  1Q86 C;  1YIJ A;  4JCV E;  5EAY A;  2Z6K C;  1YHQ A;  4DR6 Q;  3FKI H;  3U58 A;  1Z47 A;  5JEA J;  5GAD C;  4A3F H;  3TRZ A;  1HNX L;  3G48 A;  5LMU L;  4AQY L;  4TVA B;  3CCU A;  1VQM A;  1E24 A;  2YTX A;  5IP7 G;  4DUZ Q;  2OTJ A;  5M5Y H;  4IOC A;  1NY4 A;  1YI2 A;  2E5L Q;  2HQL A;  4UY8 C;  4IPD A;  3L7Z C;  4DR4 Q;  2ZTD A;  2D0O A;  2RHS B;  2PNH A;  2VW9 A;  4OO1 G;  5JJI A;  2H5X A;  3CF5 A;  3A5U A;  1Y1W G;  5GQO A;  4LF4 L;  2Q2H A;  5AJ3 Q;  4LF7 L;  3UE0 A;  1W2B A;  4DK3 C;  4WJ4 A;  4B3S Q;  1BVS A;  1U0L A;  3CP0 A;  4QJF A;  1M90 C;  2VQE L;  1WFQ A;  2LSS A;  2MNA A;  4B3R Q;  1YHA A;  2WFW A;  1PHJ A;  3RLN A;  3CXC A;  4NXN L;  1N36 Q;  5IP7 H;  4DV2 Q;  1VQD A;  2R7F A;  4BBR G;  4JI4 Q;  1OXV A;  3CQZ H;  1VQE A;  4PZ7 A;  1LYL A;  4BY1 G;  4Y7N H;  1ASZ A;  1E3P A;  3S1N H;  4LFB L;  1N32 L;  5E7N A;  2A19 A;  1MJE A;  2R92 G;  1NBW A;  4O2D A;  3UE1 A;  4DUY Q;  2R7D A;  1X9N A;  1LUZ A;  4A3E G;  1Y1W H;  2JE6 I;  3M85 A;  3CCV A;  4MTN A;  3W5O A;  1MKH A;  2ID0 A;  3GTM H;  4BA1 I;  3M4O H;  3S15 H;  4DR3 L;  4LF5 L;  3A74 A;  1NE3 A;  1I50 H;  2WP8 J;  5LMN Q;  1BKB A;  3F1Z A;  3T1Y L;  3FHW A;  4MZ9 A;  3J81 c;  1KIX A;  3HOV G;  2IT1 A;  3KF8 B;  3U50 C;  2IHE A;  4BBR H;  4BY1 H;  5HY6 A;  2Q2U A;  2UXC L;  4A3B G;  3KF6 A;  3W1G A;  3ULJ A;  4GLX A;  2JA8 G;  3CMA A;  2R92 H;  1L2F A;  2JEB I;  1YJN A;  4A3E H;  2WB1 E;  2YTV A;  1SR3 A;  4JI6 Q;  1TWC H;  2ASB A;  3KYH C;  1IYJ B;  3TS0 A;  1OXU A;  1YEZ A;  4GOP B;  1PH4 A;  1TWA H;  1UE7 A;  2IY5 B;  4QGU A;  1AE3 A;  5LMU Q;  3RNU A;  1HNX Q;  4AQY Q;  3PUV A;  1P16 A;  4ALP A;  3HOV H;  1UE1 A;  3S24 A;  4WJ3 M;  4IPC A;  5IE8 A;  4HIM A;  1MIU A;  3PSI A;  4DV7 L;  3HOX H;  3I56 A;  2AKW B;  3WWV A;  4A3B H;  4A93 G;  2JA8 H;  1IBM L;  2E2H H;  1VQG A;  3FP9 A;  3UDX A;  3RR5 A;  4LF4 Q;  5IP9 H;  3S16 H;  2YYZ A;  4LF7 Q;  1EFW A;  2I0Q A;  2ZJR A;  3HOZ G;  2UXD L;  4PMW A;  1UE5 A;  4YWK A;  3GTO H;  5IYD G;  2VQE Q;  3A5Z B;  1FGU A;  2KCT A;  2MQH A;  4YCU A;  3T1H L;  2R6G A;  4K0K L;  2UXB L;  1J5E L;  4L5R C;  4NXN Q;  3H15 A;  3F2D A;  1UE6 A;  3HOY G;  1PH5 A;  1E1T A;  1K3R A;  2WB1 G;  3GD7 A;  3JAM i;  3KDF B;  4DR5 L;  4A93 H;  1G51 A;  4LFB Q;  1HR0 L;  1N32 Q;  3HKS A;  1PYS B;  3HFZ B;  1XNR L;  4IFD I;  2FXQ A;  2XTI A;  4LUO A;  1YJW A;  1YIT A;  3KJO A;  4X66 L;  3U4Z A;  1GO3 E;  2DUD A;  3HOZ H;  3BZC A;  4BY7 G;  5C4X G;  1NTG A;  4DR3 Q;  1RL2 A;  2DGY A;  2KEN A;  1ASY A;  4LF5 Q;  4OWW B;  5IYD H;  2CWP A;  1KQS A;  3G71 A;  2B3G A;  3T1Y Q;  1QUQ B;  3GTG H;  4A75 A;  1XJV A;  1X54 A;  4GN3 B;  3HOY H;  4DV5 L;  4KHP L;  1VQL A;  1VQB A;  2VS1 A;  4YCW A;  3M4Q A;  1Q12 A;  1SE8 A;  2GVB A;  3K80 C;  2HHH L;  2CFM A;  4C3I H;  4X62 L;  1VQN A;  1K0R A;  1VS0 A;  3LGJ A;  3G6E A;  1PVO A;  2AHO B;  3RLF A;  4A3C G;  1Q46 A;  1PV4 A;  4OXP A;  1LTL A;  4IJL A;  1XNQ L;  3CPF A;  2A8V A;  3J81 j;  5C4X H;  1SRU A;  4BY7 H;  1OXT A;  4QY7 A;  1EIY B;  3H0G G;  2JA9 A;  3RN2 A;  4LFA L;  4DV6 L;  2JA7 G;  3J80 c;  1VCI A;  3TQY A;  3I4M G;  2LXK A;  2AWO A;  4OX9 Q;  3K81 C;  5GAE C;  1JT8 A;  4DV7 Q;  1VQ7 A;  3I2Z A;  2C35 B;  4X64 L;  4R1J A;  1X56 A;  2BA0 A;  1IBM Q;  4A3D G;  2E2I H;  5ELN A;  3GTQ H;  1OXX K;  1K73 C;  1XTD A;  2NVQ H;  4IPG A;  3U4V A;  2UXD Q;  3J7Z C;  2K4K A;  1C0A A;  1E22 A;  3H0G H;  2RCN A;  4UP7 A;  3T1H Q;  1QZG A;  2UXB Q;  4AYB G;  1J5E Q;  4GOP A;  2JA7 H;  2MO1 A;  2NVY H;  4C2M H;  4HID A;  4B3T L;  4JI0 L;  1J6Q A;  3I4M H;  4YY3 L;  2VQF L;  4GN4 B;  4APV A;  3PUW A;  1EWI A;  2AWN A;  4HIO A;  1G29 1;  2F3I A;  3OTO L;  4DR5 Q;  1HR0 Q;  2UUB L;  1XNR Q;  3ULP A;  3UDF A;  2JQO A;  4JI8 L;  4XIG S;  1Q82 C;  4A3D H;  3PCO B;  1BBW A;  5BR8 L;  4DV1 L;  4X66 Q;  4JI2 L;  2E8G A;  5FJ8 G;  1HZC A;  3NEN A;  4DNI A;  4IFD G;  3PUY A;  1YZ6 A;  3W1B A;  1CKO A;  1QZH A;  2B29 A;  1FJG L;  1OTC A;  4DV5 Q;  3CPW A;  4KHP Q;  2L15 A;  1CKM A;  4IPH A;  2XGT A;  2E2J H;  2JJQ A;  2VNU D;  2OQ0 A;  4JG2 A;  4A76 A;  4JI5 L;  3GO5 A;  4X62 Q;  2HHH Q;  3KDF A;  5ELO A;  2VZA A;  1KAW A;  5J3B A;  2Y0S G;  1IBL L;  2YTY A;  2VY3 A;  4HJ5 A;  1QVC A;  5FJ8 H;  1XNQ Q;  4LFA Q;  1B8A A;  1H95 A;  4DV6 Q;  3TS2 A;  3S1Q H;  3CCS A;  5C0X I;  1QUQ A;  4P72 A;  4PZ8 A;  1W3S A;  1WOC A;  4A3G G;  3J81 i;  1HZ9 A;  1Q8K A;  4X64 Q;  1VQI A;  2F52 A;  4NB3 A;  1XPR A;  4C3H H;  2YU9 H;  3RN5 A;  2A1A A;  3UDG A;  1L1O B;  3L2P A;  3CW2 C;  4DV0 L;  3B6Y A;  3RLO A;  4KHZ A;  1Y1V G;  1XMO L;  3RZD H;  2NN6 I;  4LUV A;  1KXL A;  1JJC B;  4R4C A;  3CAM A;  4A4I A;  1V1Q A;  2V1C C;  2K75 A;  1X65 A;  2JEA I;  3J7A 5;  3NEM A;  4LW1 A;  3ZJY C;  4B3T Q;  1TWG H;  2K50 A;  3SGI A;  4JI0 Q;  4YY3 Q;  2VQF Q;  1VQ8 A;  2K52 A;  3GTJ H;  1GM5 A;  4IO9 A;  2UUB Q;  1N33 L;  3OTO Q;  1Q7Y C;  2Q2T A;  3K7A H;  1EYG A;  2I5H A;  1C7Y A;  4A3G H;  1X6O A;  2MO0 A;  4JI8 Q;  4LF9 L;  1Q1B A;  3GTL H;  5BR8 Q;  4GKK L;  4DV1 Q;  2BA1 A;  1VQC A;  2N3S A;  2VUM G;  4JI2 Q;  1BBU A;  1Y1V H;  1A0I A;  4DK6 C;  4DV3 L;  2GN5 A;  1PH7 A;  2QA4 A;  1WYD A;  5M3M G;  4GNX B;  1XPU A;  1SMX A;  1TWF H;  2UUC L;  5K36 G;  5IYC G;  1YJ9 A;  1FJG Q;  1EOV A;  1VQA A;  2PQA B;  1FL0 A;  4QIW E;  4JI3 L;  1MJC A;  4YWL A;  3CCQ A;  1R9T H;  1YHB A;  4H02 A;  2K5N A;  4P75 A;  4JI5 Q;  4O0A A;  1SRO A;  1VQ5 A;  1XMQ L;  1IBL Q;  3TEH B;  2VUM H;  1DGS A;  2ZTC A;  3KJP A;  3I4N G;  5M3M H;  4LWC A;  1KRT A;  2LXJ A;  1K83 H;  3EIV A;  3PF4 A;  5IYC H;  1EIF A;  3M7N A;  4GOP C;  4POG A;  3F8T A;  3TRE A;  2KHI A;  1YVC A;  4HIK A;  1WCM G;  1IZ6 A;  1I94 L;  5LMN W;  3K0X A;  1VQP A;  1SN8 A;  1HZB A;  2ALY B;  5C0X G;  3CCR A;  2HIX A;  2PMZ E;  3ERS X;  1KD1 C;  4DV0 Q;  1X55 A;  2UXC Q;  4YHH L;  1XMO Q;  4KI0 A;  2K14 A;  3I4N H;  1K8A C;  4LF8 L;  1NJI C;  4C3J H;  5C44 G;  3CC7 A;  1NMF A;  4YWM A;  4R4Q A;  1QVG A;  2OQK A;  1D8L A;  2NN6 G;  4DAY B;  2R7Z G;  4P74 A;  1JB7 A;  5GAH C;  4RG1 A;  4JBM A;  1WCM H;  4DUZ L;  1N33 Q;  3AEV A;  4IOA A;  1UWV A;  2CCZ A;  3J80 i;  5HGQ A;  2F4V L;  4LF9 Q;  4GKK Q;  1VQO A;  3HOW G;  3F2B A;  2KCM A;  3AYH B;  4GN5 A;  1QVF A;  1HH2 P;  4DV3 Q;  3F2C A;  3CCE A;  1L1O A;  1IL2 A;  5JEA G;  5FLX c;  4UP9 A;  2UUC Q;  2BH8 A;  5M3F G;  3GTP H;  5C44 H;  1EQR A;  1VQ4 A;  4JI3 Q;  4L5S A;  2I5M X;  2ATW A;  2JA5 G;  1VQK A;  2R7Z H;  4A3C H;  4X6A H;  1X3E A;  3BJU A;  4RMF A;  1S3O A;  4BXX G;  4K0K Q;  2PI2 A;  4QQB X;  3HOW H;  4UP8 A;  1XMQ Q;  2IX0 A;  4IJH A;  2NVX H;  1PH8 A;  2N8N A;  2IHF A;  4JI1 L;  4B3M L;  1HNW L;  3OW2 A;  4HJ7 A;  1WI5 A;  5M3F H;  1E7Z A;  4JOI A;  4GNX A;  2EXD A;  1EQQ A;  3GTK H;  1NMG A;  1Q81 C;  4OWX B;  3KFU A;  1PH9 A;  2JA5 H;  2JK8 A;  2K5H A;  1AH9 A;  1GD7 A;  1OXS C;  4LF6 L;  2PQA A;  2BH2 A;  3STB C;  1I94 Q;  1IBK L;  4BXX H;  1VQH A;  2YV5 A;  2ZJQ A;  3D0F A;  3IRB A;  3H3V I;  5JJL A;  2OCE A;  1K8G A;  4DPG A;  1YBY A;  3PGZ A;  4P73 A;  2NVT H;  1V43 A;  3ER0 A;  2HIV A;  4YHH Q;  5C3E G;  1S40 A;  5IYB G;  1XPO A;  3BU2 A;  4LF8 Q;  2GVA A;  4DR1 L;  4JV5 L;  1VQ9 A;  3RZO H;  3NBH B;  3MEF A;  4L5Q A;  3S2H H;  3EN2 A;  2QGQ A;  1YNX A;  1K9M C;  4NXM L;  1RIP A;  4A3M G;  1HZA A;  1P8L A;  4GLV B;  5IWA L;  1L0W A;  3CCJ A;  4QL5 A;  4UPA A;  1N34 L;  4A3J G;  2F4V Q;  1JJ2 A;  4PG3 A;  4DAM A;  3PO3 G;  4MNO A;  4LFC L;  2OWO A;  2Z0S A;  2JA6 G;  1FVI A;  1U5K A;  2N78 A;  3ULL A;  4JBW A;  2RF4 A;  4FDB A;  5GAG C;  5IYB H;  5C3E H;  1SFO H;  2UU9 L;  3CD6 A;  4TQU S;  5H1S E;  3KOJ A;  2CWA A;  3I4O A;  4A3M H;  1JJG A;  3GDE A;  3STB D;  4A3J H;  3PO3 H;  1N9W A;  1CSQ A;  5C4J H;  4IFD J;  1N8R C;  3UDI A;  3CME A;  2JA6 H;  4PZ6 A;  2D0P A;  3VDY A;  3S14 H;  1HJP A;  4JI1 Q;  1HR0 W;  4B3M Q;  1HNW Q;  1PA6 A;  2ZM6 L;  1PYB A;  2NZH A;  4X65 L;  3S17 H;  1VQF A;  2RHQ B;  2HT1 A;  4POF A;  4GKJ L;  1JE5 A;  4R4O A;  4LF6 Q;  3EBE A;  4EQ5 A;  3CC4 A;  4JI7 L;  1KC8 C;  3DM3 A;  3CCL A;  2Q2I A;  1CSP A;  1IBK Q;  1CUK A;  2Z6K A;  4NPS A;  4L5T A;  4A3I G;  4BA2 I;  5M5W H;  3HOX G;  1CKN B;  1EUJ A;  4R4T A;  3HKZ E;  3OYY A;  1PH6 A;  1M1K C;  3AQQ A;  3PUZ A;  1JMC A;  1A8V A;  4OON A;  5IP9 G;  1WJJ A;  2EIF A;  3I7F A;  4HJ9 A;  5IT9 c;  1L1O C;  3CCM A;  4DR1 Q;  3S2D H;  3E0E A;  2B63 G;  4JV5 Q;  1KHI A;  1VQJ A;  3PIP A;  3S1R H;  1V9P A;  4ME3 A;  4NXM Q;  4BBS G;  2ES2 A;  1PFS A;  1N34 Q;  5IWA Q;  4AH6 A;  4J15 A;  2IX1 A;  2KHJ A;  3AFQ A;  4EX5 A;  2ZJP A;  4DR2 L;  4A3I H;  2OTL A;  4OX9 L;  1D7Q A;  4LFC Q;  1VQ6 A;  3PUX A;  4DV4 L;  4JBK A;  5FLM G;  2CQO A;  2UUA L;  4KLK A;  2UU9 Q;  3A0J A;  2N49 A;  3E9H A;  4JBJ A;  3H3V H;  2PI2 E;  2B63 H;  1PH1 A;  1I5F A;  4LNQ A;  4JOI C;  1IXR A;  1HNZ L; 
#chains in the Genus database with same CATH topology
 4L6T B;  5EQ0 A;  4DR7 L;  1GUN A;  1H9K A;  1ET9 A;  4UHV A;  3PQI A;  3BS1 A;  1SMY C;  3NEL A;  1WTR A;  1PXU A;  4DR6 L;  3HOU G;  1KL9 A;  1PZI D;  1CA5 A;  1E1O A;  3FMC A;  4FXK C;  3L0O A;  1SLJ A;  2F4I A;  1PH2 A;  3DM1 A;  5ELD A;  2ZM6 Q;  3Q24 A;  4C3H B;  4HJ8 A;  2YU9 B;  3E0J A;  4X65 Q;  1UNS A;  5CYU A;  2WAQ E;  1S72 A;  1EY7 A;  3RZD B;  4GKJ Q;  1AE2 A;  1A3V A;  1I3Q H;  5CV8 A;  1JCK B;  3BDO A;  1JB3 A;  1TWG B;  3S1M H;  4KJO A;  1ESR A;  5A35 A;  3I55 A;  3GTJ B;  3K8A A;  4LAA A;  5GRO A;  4A3G B;  1IKM A;  1XXG A;  1I6H H;  1Y1V B;  1S5F D;  1GKH A;  4V0B A;  2R93 G;  3DLL A;  2D62 A;  2FIN B;  3KLW A;  3M3Y H;  3I8Z A;  4DR2 Q;  2L4N A;  1SMY D;  3FKI G;  4A3F G;  2NB0 A;  1FD7 D;  4YCV A;  4B08 A;  4A3K H;  1B7Y B;  3PO2 H;  2KBN A;  4FF1 A;  1HNZ Q;  2SEB D;  1RJT A;  2KOL A;  1QG7 A;  1YIJ A;  1LT4 D;  2RA4 A;  3U58 A;  1LTG D;  1HNX L;  4AQY L;  3MZ5 A;  5IP7 G;  2YTX A;  2OTJ A;  1NY4 A;  3MFY A;  4DR4 Q;  2D0O A;  2VW9 A;  5JJI A;  1II3 A;  2Q2H A;  4B3S Q;  3J7A V;  1M90 C;  4QJF A;  2EJG C;  2VQE L;  2LSS A;  5FLX L;  2MNA A;  1YHA A;  4NXN L;  3BDC A;  4DV2 Q;  2A69 C;  3EFX D;  4QIW B;  4O2D A;  1Y1W H;  2FFK B;  2JE6 I;  3NBI A;  1STE A;  1HUN A;  2ID0 A;  4ME5 A;  4J8Q A;  5IIF A;  4IUP A;  1QB5 D;  2PZW A;  4LF5 L;  3A74 A;  2R7Z B;  3NPP A;  5LMN Q;  1JOQ A;  1Z6H A;  3HS0 C;  3Q6S A;  3HOW B;  3DWP A;  5D3I B;  4A3B G;  2KVM A;  2HCI A;  1BCP B;  1L2F A;  4HR7 B;  5KNC A;  4A3E H;  1ENF A;  1I4X A;  2K5D A;  4ZAI A;  3KYH C;  3TS0 A;  1YEZ A;  3H6M A;  4H0L C;  1TWA H;  2IY5 B;  4CGY B;  1AE3 A;  1KAA A;  3RNU A;  3HOV H;  3S24 A;  5IE8 A;  3PSI A;  2A69 D;  4DV7 L;  2AKW B;  2NVT B;  4IZ8 A;  1IBM L;  1Q90 A;  3MXN A;  3K5M A;  3TDQ A;  2DJF C;  2AQ2 B;  5IP9 H;  2I0Q A;  2ZJR A;  3HOZ G;  4YWK A;  3GTO H;  2IPK D;  3A5Z B;  2KCT A;  4KN7 C;  5COR A;  3Q23 A;  3T1H L;  4KKU A;  4K0K L;  4Q5V A;  1UE6 A;  3SDZ A;  1SYC A;  3SK8 A;  3H94 A;  2WB1 G;  2OEO A;  3I73 A;  3JAM i;  4I65 A;  5E1F A;  1N32 Q;  3HKS A;  4C3I G;  1XNR L;  2XTI A;  3A56 A;  2FHT A;  3WOF A;  1C8C A;  1GO3 E;  1GHK A;  1F9S A;  3BZC A;  3T1Y Q;  4DV5 L;  1LTA D;  3C3L A;  1ROD A;  3K80 C;  2CFM A;  3OOC A;  1PYW D;  3G6E A;  2QDB A;  1EY0 A;  3URY A;  2WKD A;  2NZ1 D;  1EZ8 A;  1LTL A;  2SNM A;  3CPF A;  4IJL A;  1XNQ L;  3S17 B;  4WJW A;  2JA9 A;  5IT9 L;  5JVG 3;  4LFA L;  4DV6 L;  1ET6 A;  2JA7 G;  4PNY A;  2LXK A;  3KF8 A;  3MXU A;  4G7H C;  3TP5 A;  1VQ7 A;  3I2Z A;  4X64 L;  4R1J A;  1X56 A;  2E2I H;  2F0E A;  4BWG B;  4C1N I;  2NVQ H;  1D5M C;  3ITP A;  4AYB G;  4GOP A;  4B3T L;  3I4M H;  4YY3 L;  4GN4 B;  1G29 1;  2F3I A;  5EKL A;  4RHR A;  4BS9 A;  5C5M A;  2L5T A;  3ULP A;  2B2Y A;  2QDL A;  4F87 A;  3NTH A;  4X66 Q;  4GZY C;  4JI2 L;  4KN4 C;  1CKO A;  1SE4 A;  3BVM A;  4KK7 A;  2B29 A;  4DGZ A;  4FYD A;  2L15 A;  4IPH A;  2XGT A;  2JJQ A;  4JG2 A;  3K5L A;  2K5W A;  3T53 B;  2HHH Q;  4X62 Q;  3KDF A;  5ELO A;  5ELC A;  1SND A;  1KAW A;  2VY3 A;  5EPK A;  2F3W A;  4JW0 A;  1B9N A;  2DJG C;  2EVB A;  3HKZ B;  1H95 A;  1I3Q B;  5C0X I;  3KK7 A;  3S1M B;  2V4D A;  3WDN A;  5M9O A;  3J81 i;  3HEJ A;  1ILQ A;  1JOK A;  2F52 A;  1XPR A;  4EQN A;  3UDG A;  4DV0 L;  1I6H B;  1KXL A;  3MTS A;  4R4C A;  1V1Q A;  1GXD C;  1KNE A;  2V1C C;  2ENB A;  1ML0 D;  2JEA I;  2MP1 A;  3SGI A;  4JI0 Q;  3M3Y B;  4FVM A;  1K8M A;  2K52 A;  4WOR A;  1GM5 A;  3G6J B;  1N33 L;  2CQA A;  1VF7 A;  1C7Y A;  4JI8 Q;  1Q1B A;  1WTQ A;  4A3K B;  4R9W A;  3Q0A A;  3PO2 B;  1EWC A;  2J0T D;  2QA4 A;  2JYO A;  1DD2 A;  1MI2 A;  4XXE A;  1YJ9 A;  3A8K E;  2A74 C;  4QIW E;  3RUZ A;  3CCQ A;  1SNC A;  2A6E C;  1MBY A;  3MWY W;  1IBL Q;  3TEH B;  3QIA A;  2ICI A;  3DUZ A;  5M3M H;  1KRT A;  1STH A;  1K83 H;  4C3J G;  5K36 H;  4DAV A;  1PFN A;  1AZP A;  1MSH A;  4FXD A;  4IQZ A;  1VMP A;  2A68 D;  1IZ6 A;  1I94 L;  1M8A A;  4U68 A;  3K0X A;  1VQP A;  2HIX A;  1KD1 C;  3AU7 A;  2UXC Q;  4PMC A;  2VXW A;  1XMO Q;  3X3N A;  3I4N H;  4J1M A;  1NJI C;  1Y1W B;  2B2T C;  1VF5 C;  4FF3 A;  2D9U A;  1JB7 A;  4RG1 A;  4R8N A;  1WCM H;  3KLS X;  2RCF A;  4IUU A;  2K01 A;  1YNN C;  3T13 A;  2A6E D;  1VQO A;  4HAE A;  2CVR A;  1QNK A;  3DWA A;  2KCM A;  4KTA A;  1R4P B;  5JVH 3;  1SJE D;  4A3E B;  5CMD A;  5M3F G;  5C44 H;  4L5S A;  2I5M X;  2JA5 G;  1X32 A;  4HSP A;  1TWA B;  1EY4 A;  1S3O A;  1FGB D;  3P75 A;  4JK1 C;  3IL8 A;  5FO7 B;  4BXX G;  2PI2 A;  2RQX A;  4OIK A;  3HOV B;  4QQB X;  1XMQ Q;  4A3I B;  3J80 E;  1A3U A;  2IHF A;  1WI5 A;  5IOD A;  3MVV A;  3GTK H;  2BDN A;  4Z9C B;  3V2T A;  5DM7 3;  1GD7 A;  1OXS C;  3GTO B;  2PQA A;  2F0H A;  3OIP A;  1F2M A;  1Z7T A;  4G7Z C;  2X6L A;  1YNN D;  5JJL A;  1A15 A;  1HPC A;  1EU4 A;  2OCE A;  1CT1 D;  1YBY A;  2HIV A;  1S40 A;  1W6K A;  1I6V C;  4XYQ A;  4LF8 Q;  2GVA A;  4DR1 L;  3NBH B;  3EN2 A;  1A6X A;  2QGQ A;  5J1Z A;  4NXM L;  4P2C B;  3GP7 A;  4MNO A;  2JA6 G;  5BN4 A;  2N78 A;  1PZK D;  3K5O A;  5A2Q E;  3OW7 A;  4ZRZ A;  1WVL A;  1SNO A;  5H1S E;  4A3M H;  4DAY A;  1RDP D;  1N9W A;  1CSQ A;  5CBA E;  3K6O A;  3UDI A;  1RF2 D;  4KY7 A;  1HR0 W;  5C3X A;  1PA6 A;  2E2I B;  1BUV T;  1I4P A;  1EOT A;  2DNC A;  3S9W A;  1B2T A;  3QWN A;  2NVQ B;  1JE5 A;  4LF6 Q;  5DEH A;  2FMM A;  4JI7 L;  3CC4 A;  1KC8 C;  3DM3 A;  3CCL A;  1QWY A;  1OO9 B;  2QF7 A;  5M5W H;  3HOX G;  3I4M B;  1EUJ A;  3HKZ E;  2B2W C;  4OON A;  1NAP A;  3T56 B;  3I7F A;  4HJ9 A;  1L1O C;  2EY5 A;  1YNJ C;  1BF4 A;  1QOH A;  3PIP A;  1DOM A;  3S1R H;  4ME3 A;  5CBE E;  3G7L A;  5IWA Q;  4J15 A;  1S5C D;  3AFQ A;  5KRU A;  2ZJP A;  2OTL A;  4LFC Q;  4FXG C;  3PUX A;  4DV4 L;  5FO9 B;  4CJ0 B;  3ND8 A;  2UUA L;  3A0J A;  3H3V H;  2KJX A;  3LNN A;  2B63 H;  4LNQ A;  4JOI C;  4BBS H;  4LUZ A;  1PRT C;  4P71 A;  3HRZ C;  3N52 A;  4Y52 H;  3ERQ A;  1B4O A;  4GS3 A;  2HDL A;  2O5I C;  2I5L X;  3JAM c;  2QEX A;  1Q1E A;  5FLM H;  2Z4I A;  2H4O A;  2E75 C;  2EPB A;  4ULL A;  1AZQ A;  2AMC B;  1F2L A;  1YNJ D;  2Q8R E;  5FKA C;  4QMG A;  4A3L G;  5AJ3 L;  1PDQ A;  4AYB E;  3HOU H;  1X3G A;  3NHH A;  3C46 A;  4JI4 L;  3DHQ A;  3PIO A;  1LM0 A;  4DUY L;  5NUC A;  1S5E D;  1PRT D;  4QF4 A;  1DOK A;  2ZXP A;  5IGG A;  1CQF A;  4OIJ A;  1J9O A;  1STY A;  2NYZ D;  1UUP A;  3Q8D A;  2RSN A;  3PIP 3;  1G6P A;  4JVZ A;  3MXN B;  3NWS A;  3MXP A;  1UEB A;  2IWH A;  4AIM A;  5M3M B;  4OWT B;  2R93 H;  1K83 B;  3HG9 A;  2I07 B;  4KJN A;  4LMQ D;  1Y14 B;  4JYA Q;  4JCV E;  2Z6K C;  3FKI H;  4A3F H;  3TRZ A;  3LWU A;  3OSO A;  1HFG A;  4F8M A;  1TS4 A;  1VQM A;  2KHS A;  3KBG A;  3KLR A;  5M5Y H;  2E5L Q;  4UY8 C;  4IPD A;  2N55 A;  2PNH A;  4OO1 G;  3I4N B;  3A5U A;  2F0G A;  1BNZ A;  5GQO A;  4LF4 L;  1W2B A;  3DXJ C;  3FPP A;  4DK3 C;  4B3R Q;  5E4X A;  1L0X B;  1WCM B;  2LFN A;  3CXC A;  1N36 Q;  1IKL A;  5IP7 H;  4HMI A;  4ZLT F;  4BBR G;  1U4M A;  4LFB L;  5J22 A;  3UE1 A;  5JAV A;  2K7V A;  2R7D A;  5HGT A;  1B3A A;  1M4V A;  5KND A;  4MTN A;  1MKH A;  5C44 B;  2IW3 A;  2WII B;  5KEE A;  4DR3 L;  1PZJ D;  1BKB A;  4MZ9 A;  3J81 c;  2IT1 A;  3KF8 B;  3U50 C;  2EY6 A;  1CK1 A;  3PIO 3;  1H9S A;  3KF6 A;  3ULJ A;  1HTL D;  1PTO D;  5LHY 1;  1RTN A;  4JI6 Q;  1TU2 B;  4DNR B;  2ASB A;  1IHZ A;  3GTK B;  1IYJ B;  5IGE A;  2K03 A;  4GOP B;  3FDT A;  1UE7 A;  2PMZ B;  2H1E A;  5LMU Q;  1I4Q A;  4ZKB B;  4ALP A;  1UE1 A;  3H91 A;  4X3K A;  3J81 E;  4A3B H;  3WWV A;  2F0I A;  2E2H H;  1VQG A;  4LF7 Q;  3U9O A;  2QW7 A;  2UXD L;  3T16 A;  1JIC A;  2EY1 A;  1SJH D;  2MQH A;  4YCU A;  2UXB L;  3NBH A;  1O7Y A;  1J5E L;  2PYK A;  4L5R C;  2B8G A;  2WV6 D;  1E1T A;  3KDF B;  3HFZ B;  1PYS B;  4ZCK A;  3NXW A;  4LUO A;  1KLU D;  3U4Z A;  1EQV A;  1BOS A;  1LLR D;  2DUD A;  3OMG A;  3HOZ H;  3W3A A;  1RL2 A;  2DGY A;  2KEN A;  4OWW B;  4A3M B;  5FK9 C;  3GTG H;  2MJ8 A;  1RHP A;  1VQB A;  2VS1 A;  2Z8L A;  4HCE A;  3M4Q A;  4C3I H;  1K0R A;  3SXH A;  3RLF A;  4ZYS A;  1PV4 A;  3TN2 A;  2A8V A;  1SRU A;  4QY7 A;  1SYE A;  2PQE A;  3VR2 A;  4DK0 A;  1VCI A;  4IUN A;  5M5W B;  1GHJ A;  4OX9 Q;  3K81 C;  5GAE C;  1B9M A;  2F0T A;  2SOB A;  2C35 B;  1E2V A;  3TSS A;  1DOL A;  1XTD A;  3NQT A;  4XT1 B;  1FNV A;  3S1R B;  1E22 A;  3TME A;  1JOR A;  2JA7 H;  2NVY H;  4HID A;  1J6Q A;  4QUC A;  5IGF A;  4H44 C;  3S2D H;  2L9H A;  4HIO A;  4DR5 Q;  2UUB L;  3A8I E;  1HR0 Q;  3L3O C;  2JQO A;  4LK1 C;  4R8I A;  3HP3 A;  1BBW A;  5BR8 L;  2F0M A;  2B63 B;  2E8G A;  4TKO B;  1HZC A;  4OEL B;  4IFD G;  4C56 C;  3W1B A;  3P20 A;  4BBS B;  1STG A;  2B2T A;  1EWH A;  1FJG L;  1OTC A;  4KHP Q;  4IAL A;  2VNU D;  4JI5 L;  3HGB A;  5BN5 A;  3VYS A;  2PNR C;  3X3M A;  2Y0S G;  2YTY A;  1Y69 U;  3WOE A;  4HJ5 A;  1SXT A;  1B8A A;  3TS2 A;  3BG3 A;  3NUC A;  4KY6 A;  2PO4 A;  3HOU B;  5I6W A;  2M00 A;  1A2T A;  1KNA A;  4HTH A;  4JPB W;  1XWE A;  1VQI A;  1F2Y A;  1CTM A;  3CW2 C;  4QB4 A;  1AW7 A;  3B6Y A;  5ELB A;  3RLO A;  1K0S A;  1JJC B;  2XVS A;  2K75 A;  2QEJ C;  1GUT A;  3CU7 A;  3SE0 A;  2VQF Q;  2EYO A;  3OTO Q;  1LAB A;  2F0P A;  3K7A H;  1X6O A;  2MO0 A;  4LF9 L;  3D8G A;  1WTX A;  4GKK L;  1EQT A;  4DV1 Q;  2PPB C;  4G57 A;  1S5B D;  2CHB D;  2L55 A;  2VUM G;  1Q3L A;  4N8F A;  2D5D A;  4DK6 C;  3CKI B;  1PH7 A;  1WYD A;  2FJ2 A;  3NP8 A;  1CI3 M;  3MAQ A;  2R93 B;  1EOV A;  2PQA B;  1O7Z A;  1FL0 A;  1NR2 A;  4JI3 L;  1R9T H;  2PW7 A;  4X3S A;  4P75 A;  3FKI B;  4QUF A;  4L8J A;  4A3F B;  4RGN A;  3MHB A;  1VQ5 A;  2L11 A;  4RFB A;  5M5Y B;  1DGS A;  4MTK A;  4LWC A;  2LXJ A;  3OMC A;  3EIV A;  3MFG A;  4MHE A;  2B2U C;  3M7N A;  3F8T A;  1U4L A;  1YVC A;  4HIK A;  5C5L A;  3BYY B;  1SN8 A;  2ALY B;  5KYL A;  1HA6 A;  2PMZ E;  2F0V A;  4IUT A;  4KI0 A;  3D6C A;  1AFP A;  2G9D A;  2K14 A;  4C3J H;  1NMF A;  1QVG A;  1EY9 A;  2OQK A;  2NN6 G;  4DAY B;  3K57 A;  3OPO A;  2KED A;  4IOA A;  5CV9 A;  2CCZ A;  2F4V L;  4FP5 D;  5F2D A;  2B2W A;  2F03 A;  3AYH B;  1QVF A;  4G7O C;  4DV3 Q;  3CCE A;  3H09 A;  1L1O A;  5JEA G;  5FLX c;  4UP9 A;  2UUC Q;  2BH8 A;  3GTP H;  4DF7 A;  1EQR A;  4CKE A;  4WRD A;  4A3C H;  2ATW A;  4ID6 A;  1D1K A;  1U9R A;  2C5C A;  1CFM A;  2IJ0 A;  2IX3 A;  3QOJ A;  4CBV A;  2NVX H;  4A3B B;  2QIL A;  1MSG A;  4O1N A;  4B3M L;  3A8J E;  3EJI A;  2E2H B;  4K14 A;  5M3F H;  1E7Z A;  4JOI A;  4N8X 1;  1NMG A;  1PH9 A;  2JA5 H;  1AH9 A;  4EGV A;  2BH2 A;  1IBK L;  1HQM C;  2ZJQ A;  2YV5 A;  4BXX H;  3H3V I;  1XTC D;  3FPU B;  2G9H D;  2XWJ B;  2ZT9 C;  3E3X A;  2F0K A;  4YHH Q;  5ELE A;  5C3E G;  5IYB G;  1XPO A;  3BU2 A;  3SHL A;  4MN3 A;  1LV9 A;  3S2H H;  1V1P A;  1TVX A;  3HOZ B;  1HZA A;  3RD4 A;  1L0W A;  4UPA A;  1L0Y B;  4A3J G;  3TZD A;  4PG3 A;  4RH6 A;  1JJ2 A;  3GTG B;  3PO3 G;  3OWE B;  2X69 A;  1ICF B;  2WB1 B;  4RGO S;  3ULL A;  5IGD A;  5I9P A;  3J80 L;  2RF4 A;  2EYH A;  4FDB A;  4C3I B;  5GAG C;  1SFO H;  2UU9 L;  4OEM B;  4TQU S;  4RKB A;  4TSS A;  3KOJ A;  3SR1 A;  2CWA A;  1EEF D;  4IFD J;  1N8R C;  3IAY A;  3W2D A;  2A68 C;  2JA6 H;  3VR4 A;  3S14 H;  4JI1 Q;  1HNW Q;  3EQL C;  2ZM6 L;  3C1E A;  2NZH A;  1XX8 A;  4X65 L;  1EIG A;  1SSO A;  1WTH A;  2HT1 A;  4GKJ L;  4R4O A;  4EQ5 A;  3QJY A;  2JA7 B;  2Z6K A;  4NPS A;  2NVY B;  4A3I G;  1M1K C;  3S2D B;  5DNF A;  4DA2 A;  5A2Q L;  1A8V A;  5IP9 G;  1WJJ A;  5IT9 c;  3CCM A;  2D2C C;  1EEI D;  3E0E A;  4JV5 Q;  1VQJ A;  1V9P A;  1AEX A;  3VR5 A;  1LTT D;  1N34 Q;  2K1B A;  4AH6 A;  5D3D A;  4RWS C;  4AYB B;  1LT3 D;  4DR2 L;  4OX9 L;  4OL7 A;  1MHW C;  5I4D A;  4NDX A;  2NBF A;  5ELF A;  1UAP A;  1H9J A;  1GOZ A;  2PI2 E;  4GNX C;  3UE0 A;  1HNZ L;  4DKA C;  3AFP A;  5I2Y A;  1D5Z C;  4IUR A;  2EQS A;  2ZTE A;  4R4I A;  3DMU A;  3CC2 A;  3VA5 A;  3SK4 A;  2EZV A;  1A62 A;  2HQE A;  4ODG A;  5JJK A;  1TWH H;  3JC6 6;  1U4P A;  4DR4 L;  2K5V A;  2X6G A;  1A63 A;  4B3S L;  1KRS A;  4CDF C;  3T51 B;  1B50 A;  5JOB A;  1F9Q A;  1X3Q A;  5JPN C;  4I7Z C;  3K7A B;  4DV2 L;  1LTS D;  1H9S B;  3KF6 B;  1DJR D;  3GV3 A;  2PW5 A;  5ISR A;  1PRT F;  2E2D C;  2MFI A;  2F1M A;  3E9I A;  4A3L H;  4GLA C;  3PF5 A;  3E6Z X;  4CJ1 B;  2MUY A;  2RKS A;  1R9T B;  2I46 A;  5LMN L;  2DNE A;  1CKN A;  1SEB D;  2WAQ G;  5DLQ E;  2L1B A;  1VDZ A;  4M8A A;  2WAC A;  1B70 B;  3GQB A;  1O7I A;  3TBI B;  1SAP A;  4XTC S;  4DR7 Q;  2Y0S E;  1TS3 A;  3K7U C;  3KBX A;  2NZO A;  1TS2 A;  4DR6 Q;  1YHQ A;  5JEA J;  5GAD C;  2TMP A;  4DUZ Q;  2R61 A;  4IOC A;  1YI2 A;  2HQL A;  3L7Z C;  1TII D;  2ZTD A;  4DAP A;  2RHS B;  4B9W A;  2H5X A;  3CF5 A;  4C3J B;  2B8F A;  1D5X C;  3CP0 A;  5EKK A;  3R3O A;  1WFQ A;  1T5E A;  3RLN A;  3SEB A;  1WTW A;  2B2V C;  3FEW X;  2R7F A;  4BY1 G;  1LYL A;  4Y7N H;  1N32 L;  3LX0 A;  4DK1 A;  1MJE A;  2R92 G;  4OO1 H;  1G91 A;  2LKV A;  2BCO A;  3GTP B;  1CHQ D;  3M4O H;  1I4R A;  4XYO A;  4YIJ A;  1NE3 A;  1I50 H;  2BDO A;  3F1Z A;  1CZG A;  3T1Y L;  3V96 A;  4BBR H;  1PTO F;  2O4X A;  5HY6 A;  3W1G A;  1JOO A;  2NVX B;  2JA8 G;  2JEB I;  1YJN A;  2YTV A;  2K5Q A;  2WB1 E;  1SR3 A;  3QR8 A;  5M3F B;  1WTV A;  2C9O A;  2JA5 B;  1JWM D;  2F0Q A;  2HDM A;  1HNX Q;  1HRJ A;  4AQY Q;  5CC4 A;  1WD0 A;  5CV5 A;  4WJ3 M;  4A93 G;  3I56 A;  4NP5 A;  1PTO H;  1LTR D;  3FP9 A;  3UDX A;  1HTP A;  3CHB D;  1STN A;  3D4W A;  2YYZ A;  3S2H B;  1V1O A;  4K2K A;  5IYD G;  2VQE Q;  2R6G A;  4Q0F A;  4NXN Q;  3F2D A;  3HOY G;  1PH5 A;  1AP0 A;  1K3R A;  3GD7 A;  4S3S A;  3AMU A;  2FXQ A;  1SFO B;  3U9S A;  1B3Q A;  1YIT A;  3KJO A;  4X66 L;  3I4L A;  1BO0 A;  3CRL C;  1EL0 A;  5C4X G;  1FR3 A;  4BY7 G;  4LF5 Q;  1KAB A;  1SNQ A;  2LMC B;  2B3G A;  2JSO A;  4A75 A;  1XJV A;  1X54 A;  4GN3 B;  5K5P A;  4H7B A;  3J81 L;  1HA5 A;  1CQV A;  1SE8 A;  2Q8I B;  2JA6 B;  2HHH L;  4X62 L;  3S14 B;  1VS0 A;  4K5X A;  1PVO A;  5EKI A;  2AHO B;  4DXF A;  5L37 A;  3JAM E;  1Q46 A;  3ERO A;  1G6Z A;  3J81 j;  1OXT A;  3H0G G;  1SYF A;  2KEE A;  4I7A A;  1PLF A;  3K0Y A;  4OGQ C;  3I91 A;  2AWO A;  2M2L A;  4DV7 Q;  4IUV A;  2F0S A;  1IBM Q;  1EY6 A;  4A3D G;  5ELN A;  1K73 C;  2SDF A;  1UEA B;  4B9X A;  2J4X A;  3U4V A;  4EVO A;  2RDG A;  2K4K A;  1IL8 A;  4UP7 A;  2RCN A;  3T1H Q;  1QZG A;  2B2U A;  4JI0 L;  1LAC A;  4APV A;  2G5D A;  3F2U A;  1XNR Q;  3UDF A;  1TY0 A;  4JI8 L;  4XIG S;  1Q82 C;  2WIN B;  4V19 0;  2EYM A;  5FJ8 G;  2VB2 X;  3NEN A;  4DFA A;  3PUY A;  1YZ6 A;  1PTO C;  1DXM A;  3C1F A;  4DV5 Q;  4CHT B;  1S4Z A;  1Q8I A;  2E2J H;  4A76 A;  1HXY D;  3GO5 A;  1CHP D;  4C3H G;  2Q8T A;  2Z9H A;  1IBL L;  1TWH B;  2E74 C;  1XNQ Q;  1DCZ A;  2EJM A;  4FO2 A;  4IFD H;  5IOC A;  4LFA Q;  1KDC A;  4M1U B;  4DV6 Q;  3S1Q H;  3ZYY X;  3NSW A;  1QUQ A;  1SBB B;  5IGC A;  1WOC A;  1JE4 A;  1HUM A;  4A3G G;  1HZ9 A;  1Q8K A;  4X64 Q;  3R2T A;  1E0B A;  3RN5 A;  2A1A A;  1L1O B;  3L2P A;  2UXC L;  4KHZ A;  1Y1V G;  2MHV A;  3MA2 B;  1XMO L;  4LUV A;  4PMB A;  4A4I A;  5JJZ A;  4LW1 A;  4B3T Q;  2K50 A;  4YY3 Q;  1VQ8 A;  5J39 A;  1E2Z A;  1SE3 A;  2Q2T A;  1HHV A;  2VB3 X;  2I5H A;  1EYG A;  3GTL H;  5D65 A;  2N3S A;  4JI2 Q;  3GTM H;  3R93 A;  2GN5 A;  2B39 A;  1XPU A;  1SMX A;  1TWF H;  4TRD A;  5IYC G;  1PRT B;  3O13 A;  1MJC A;  2HUG A;  4H02 A;  2K5N A;  5JPM C;  3SVM A;  4RKL A;  4O0A A;  1SRO A;  3TP6 A;  1XMQ L;  1BCP C;  2VUM H;  1BR9 A;  1KLG D;  2ZTC A;  5C4H A;  3KJP A;  1V1P B;  5D14 A;  1B44 D;  2F0L A;  2KHI A;  3VYR A;  3GV6 A;  4ABN A;  2KCC A;  2OXP A;  1ILP A;  5C0X G;  3CCR A;  3ERS X;  4DV0 Q;  1G2T A;  4Y7N B;  3L9A X;  1K8A C;  2OF1 A;  4RHS A;  4LF8 L;  4YWM A;  4R4Q A;  3CRK C;  3M4O B;  1D8L A;  2R7Z G;  1WD1 A;  4JBM A;  1N33 Q;  3AEV A;  1I50 B;  4DUZ L;  3KUP A;  3J80 i;  5HGQ A;  2DN8 A;  3HOW G;  4BBR B;  4GN5 A;  4U67 3;  1QCB D;  1HH2 P;  1BCP D;  3F2C A;  1ESF A;  1F77 A;  4HCS A;  2A73 B;  2QCP X;  2NN6 H;  4F7X A;  4PV1 C;  1VQK A;  1HFN A;  1X3E A;  3BJU A;  4KV6 A;  4RMF A;  3R8B A;  1BDO A;  1STB A;  4UP8 A;  5CV4 A;  5KIX A;  2IX0 A;  4IJH A;  2PCF B;  2N8N A;  3EVQ A;  5C3W A;  1PTO B;  4HJ7 A;  3D3R A;  3VYT A;  5JEA H;  4GNX A;  1EQQ A;  1EY8 A;  1Q81 C;  1BQQ T;  2JK8 A;  1NNX A;  2K5H A;  4LF6 L;  1JC7 A;  1I94 Q;  2XN9 C;  1K8G A;  3PGZ A;  1IYU A;  4P73 A;  1V43 A;  3ER0 A;  4C1N K;  4CDD C;  1G8Z D;  3A7A B;  2EYF A;  3RZO H;  4L5Q A;  1X3P A;  1YNX A;  1RIP A;  1P8L A;  4GLV B;  5EBC A;  5IWA L;  3CCJ A;  4QL5 A;  4RA8 A;  3P7J A;  4LFC L;  1FVI A;  4HN7 A;  1H9R A;  4JBW A;  5C3E H;  5IYB H;  4K8I A;  4F88 A;  2EXZ A;  1HQR D;  3I4O A;  3GDE A;  2F0J A;  4A3J H;  1CA6 A;  3PO3 H;  5C4J H;  1LTI D;  5TSS A;  3PMF A;  2EOT A;  4PZ6 A;  1TR5 A;  2D0P A;  5HUR A;  1HJP A;  1D6E C;  1IYV A;  1B53 A;  2NUC A;  1O7L A;  2SNS A;  1VQF A;  4POF A;  4DN4 M;  4K5V A;  2Q2I A;  1CUK A;  2XNA C;  1EYC A;  4L5T A;  1H9M A;  4K8J A;  1CKN B;  4R4T A;  1PH6 A;  5BN3 A;  3AQQ A;  5I6Y A;  4LJZ C;  3FVQ A;  3J7A F;  4DR1 Q;  1EZ6 A;  2AQ3 B;  1U4R A;  2ZXR A;  1SNM A;  5EBD A;  2K33 A;  4NXM Q;  1C48 A;  2ES2 A;  2IX1 A;  2KHJ A;  4EX5 A;  4A3I H;  1D7Q A;  3IFT A;  1I4G A;  2L12 A;  4JBK A;  2E2J B;  2B2V A;  4KLK A;  3E9H A;  4RCO A;  1PH1 A;  3R2I A;  1IXR A;  4L63 B;  3HKZ G;  2AUJ D;  3G4S A;  3ICE A;  2LY7 A;  2RDF A;  2CKZ B;  4JYA L;  2LS0 1;  3S1Q B;  3T4A C;  5IY0 A;  2CH4 W;  3VYU A;  4OO1 I;  4O42 A;  2E5L L;  2Y0S B;  4K6L A;  2EY2 A;  3P1H A;  4JI7 Q;  1Z9F A;  4XT3 B;  2XSC A;  1PFM A;  4WFN 3;  1TXY A;  1TY2 A;  2VL6 A;  4B3R L;  2AUK A;  1N36 L;  1I4H A;  5CV7 A;  5FO8 B;  3GTL B;  4A3K G;  3BZK A;  1DM0 B;  3PO2 G;  3RMH A;  4IN3 A;  2O2L D;  1IW7 C;  3GTM B;  5C0X J;  3M9B A;  1C9O A;  5M5X H;  5DM6 3;  3OHX C;  1TWF B;  5I2X A;  4JC0 A;  1QE6 A;  4X3T A;  2ZXO A;  1FNW A;  2K28 A;  1PH3 A;  1Y8O B;  4DV4 Q;  1GJX A;  5FLX E;  2QKI C;  2UUA Q;  3SK6 A;  3M4P A;  1X3F A;  4EQO A;  2VUM B;  4CJ2 C;  1T9H A;  3QG1 A;  2EJF C;  4HJA A;  3D31 A;  4HMJ A;  4JI6 L;  3PV0 A;  1GVP A;  1Q86 C;  5EAY A;  2CH4 A;  1ENC A;  5T1I A;  1Z47 A;  4FF4 A;  3G48 A;  5LMU L;  4TVA B;  3CCU A;  1E24 A;  2K05 A;  2XRS D;  4N9P A;  1IW7 D;  1F9R A;  1Y1W G;  1B1Z A;  1LT5 D;  5AJ3 Q;  4LF7 L;  1C4Q A;  5C4Z A;  4WJ4 A;  1BVS A;  1MD2 D;  1U0L A;  5G3L F;  1PHJ A;  2WFW A;  2K6A A;  4KHV A;  5FOB B;  1VQD A;  2EYL A;  4JI4 Q;  1OXV A;  3CQZ H;  1VQE A;  2F0N A;  2HCC A;  4PZ7 A;  1ASZ A;  2HD3 A;  1E3P A;  3S1N H;  5E7N A;  2A19 A;  1NBW A;  4DUY Q;  1X9N A;  1LUZ A;  4A3E G;  3VR3 A;  3M85 A;  3CCV A;  3W5O A;  1NUC A;  4CKC A;  2OT2 A;  4BA1 I;  3S15 H;  2NTS A;  3FRP B;  2J7Z A;  1R4Q B;  2WP8 J;  4XDX A;  3FHW A;  1KIX A;  3HOV G;  1EU3 A;  2F0O A;  2IHE A;  1SDF A;  4BY1 H;  2Q2U A;  4GLX A;  3CMA A;  2R92 H;  3OIQ A;  2F0D A;  3DEO A;  1TWC H;  2JP1 A;  4KD4 A;  4KD3 A;  1OXU A;  3BZD B;  2EDG A;  1PH4 A;  1RTO A;  4UDU C;  1EIH A;  1ZXT A;  4QGU A;  5E4W C;  2KEC A;  3PUV A;  1P16 A;  4IPC A;  1FNU A;  4HIM A;  1MIU A;  3HOX H;  1S5D D;  3D6W A;  2JA8 H;  3RR5 A;  3QOL A;  4LF4 Q;  3S16 H;  4RCN A;  3RZO B;  1EFW A;  4PMW A;  1UE5 A;  3ND9 A;  1PMR A;  1FGU A;  3N6R A;  5IT9 E;  1FYC A;  3H15 A;  4IUQ A;  2XRQ D;  3NQI A;  4K5W A;  4DR5 L;  4A93 H;  1G51 A;  4LFB Q;  1HR0 L;  1A3T A;  4IFD I;  5C3E B;  2CW0 C;  1YJW A;  1RD9 D;  3D4D A;  3EA6 A;  1JWS D;  1NTG A;  4DR3 Q;  2F3V A;  1ASY A;  5IYD H;  3I90 A;  2CWP A;  1KQS A;  3G71 A;  4HED A;  4DXG A;  1QUQ B;  5KNB A;  3NTI A;  3UI2 A;  4A3J B;  3HOY H;  3PO3 B;  4KHP L;  5C4J B;  1VQL A;  2N88 A;  4YCW A;  1Q12 A;  2GVB A;  3I72 A;  1VQN A;  4XQN A;  3LGJ A;  4NW2 A;  5EGT A;  4A3C G;  3NE5 B;  1EFI D;  1RCV D;  2JN4 A;  4NKL A;  4OXP A;  2RBM A;  1WTP A;  5C4X H;  4BY7 H;  1EIY B;  3NWT A;  3RN2 A;  4EQP A;  2XWB B;  3J80 c;  3TQY A;  3I4M G;  1A2U A;  2L0C A;  3C2P A;  1JT8 A;  2KQ3 A;  1Y8N B;  2A6H C;  3ONA B;  4X3U A;  4XQJ A;  1PFB A;  2BA0 A;  3BVG A;  5C6A A;  3GTQ H;  1OXX K;  2CW0 D;  4IPG A;  2UXD Q;  3J7Z C;  1C0A A;  3H0G H;  1O78 A;  1NR4 A;  1SNP A;  2GA4 B;  2Z6B A;  4RAU C;  4ZQ3 A;  1J5E Q;  2UXB Q;  1D2B A;  2MO1 A;  4C2M H;  1K8O A;  1VMC A;  2VQF L;  2KA7 A;  3PUW A;  1EWI A;  2AWN A;  4KMU C;  3VA7 A;  3OTO L;  1QJO A;  2EYJ A;  1E2W A;  4A3D H;  3PCO B;  3JAM L;  4DV1 L;  4DNI A;  4N9T A;  2F0U A;  1EYA A;  1QZH A;  3I3C A;  3CPW A;  1CKM A;  2OQ0 A;  2A6H D;  3Q22 A;  2VZA A;  5J3B A;  1CM9 A;  5G3L D;  5CR3 A;  1QVC A;  5FJ8 H;  1NCV A;  1TQO A;  1KDB A;  4ZKC B;  4CDC C;  3CCS A;  4P72 A;  4PZ8 A;  5T1G A;  2RSO A;  2O5J C;  2FMC A;  1W3S A;  2XIW A;  4NB3 A;  3E5S A;  1GUG A;  1JWU D;  4C3H H;  2AQ1 B;  2YU9 H;  1TKW B;  3RZD H;  2NN6 I;  1NSN S;  3CAM A;  1X65 A;  5M5X B;  2Z4H A;  3NEM A;  3ZJY C;  3J7A 5;  1TWG H;  1XYI A;  3BDL A;  3M4Y A;  1J8I A;  2ICE C;  5AFW A;  3GTJ H;  4IO9 A;  2UUB Q;  2E76 C;  1Q7Y C;  4A3G H;  5BR8 Q;  2BA1 A;  4KKT A;  1VQC A;  4H13 C;  1BBU A;  1Y1V H;  1A0I A;  4DV3 L;  2A5H A;  4GNX B;  5M3M G;  5IGB A;  2NTT A;  3MC0 B;  2UUC L;  5EJW A;  5K36 G;  1FJG Q;  1VQA A;  4MIU A;  4YWL A;  3MXG A;  3TP7 A;  1YHB A;  3V05 A;  2Z1C A;  4JI5 Q;  4G4K A;  2WAQ B;  4KKS A;  3A7L A;  4ZUI A;  4DU9 A;  4UAI A;  4E6I A;  3LWE A;  4RGT A;  3MEH A;  1SYB A;  3I4N G;  1WTO A;  3PF4 A;  1K3B C;  5IYC H;  1EIF A;  4GOP C;  3DEP A;  5KGU A;  4POG A;  1RKN A;  1SYD A;  4PQX A;  3TRE A;  1DON A;  1F9P A;  1WCM G;  5I9O A;  5LMN W;  3NTK A;  1HZB A;  2B2Y C;  2R3Z A;  4ZUJ A;  3CQZ B;  1X55 A;  3IKJ A;  4YHH L;  1Y8P B;  3S1N B;  4K6D A;  2K32 A;  2TSS A;  4KY5 A;  5C44 G;  1K28 A;  2M9V A;  2MGS A;  3CC7 A;  3TZU A;  3S15 B;  1STA A;  4P74 A;  5GAH C;  4DNT B;  1UWV A;  4LF9 Q;  4GKK Q;  5DAU A;  1BCP F;  5C0X H;  3F2B A;  4FNF A;  4HSV A;  4BY1 B;  2BOS A;  4ZK9 B;  3QO2 A;  2R92 B;  1IL2 A;  3D4R A;  3K5N A;  1VQ4 A;  1TWC B;  5CGK A;  4JI3 Q;  2BE5 C;  4X6A H;  2R7Z H;  5COY A;  1G2S A;  3M7G A;  2NWG A;  4ILW A;  5LL6 S;  2F0F A;  1T5X D;  4K0K Q;  2F0W A;  3HOW H;  3AB9 A;  1LTB D;  1LT6 D;  2DY8 A;  1ICW A;  1PH8 A;  3HZX A;  3HOX B;  2RDH A;  4JI1 L;  2JA8 B;  1HNW L;  3OW2 A;  4XQQ A;  1CZW A;  3S16 B;  1ZEQ X;  2EXD A;  3DWQ A;  3BVZ A;  1GUO A;  4OWX B;  3KFU A;  3A54 A;  4QCL A;  4J6H A;  5EPJ A;  3J7Y W;  3STB C;  1ZKO A;  3VR6 A;  1BBX C;  1VQH A;  1ZYR C;  3D0F A;  3IRB A;  4K2L A;  1O80 A;  2K04 A;  5E3F A;  4DPG A;  4CDE C;  2NVT H;  4A93 B;  1BXT A;  4JV5 L;  1VQ9 A;  3MEF A;  4OHJ A;  2MPM A;  1K9M C;  2BE5 D;  4A3M G;  2KUM A;  4FF2 A;  2P5Z X;  1N34 L;  1V8Q A;  2F4V Q;  1DZ1 A;  3A55 A;  4DAM A;  3HOY B;  2JXM B;  2PZU A;  2OWO A;  1TS5 A;  2Z0S A;  1U5K A;  5LL6 X;  1EYD A;  1QNU A;  3CD6 A;  5CV6 A;  3H3V C;  4RGM A;  2EE1 A;  2PZT A;  2RVL A;  3KLS A;  1EY5 A;  5C4X B;  4BY7 B;  1JJG A;  1DYQ A;  3I70 A;  5EPL A;  1W6J A;  3TP8 A;  1JQY D;  3STB D;  1KTK A;  3CME A;  1ZYR D;  3K59 A;  3VDY A;  4B3M Q;  2DY7 A;  1TT2 A;  3K58 A;  3GTQ B;  1PYB A;  1D1I A;  3S17 H;  1GUW A;  2RHQ B;  1SE2 A;  4NMZ A;  3EBE A;  2EYP A;  3H0G B;  1CSP A;  1IBK Q;  4C2M B;  4BA2 I;  1MGS A;  3IFD A;  3OWF A;  3QB3 A;  2WKC A;  3OYY A;  4CKB A;  1ENA A;  1GUS A;  3PUZ A;  1JMC A;  2EIF A;  4A3D B;  2B63 G;  1KHI A;  1KDA A;  1HCZ A;  4BBS G;  1AN8 A;  1PFS A;  3SK5 A;  1ONL A;  5KYI A;  3BYT B;  1VQ6 A;  1QIL A;  1JR0 D;  1SYG A;  1F2Z A;  2IL8 A;  2KCN A;  3NK9 A;  5FLM G;  2CQO A;  2UU9 Q;  2N49 A;  4JBJ A;  1I5F A;  1LO5 D; 
#chains in the Genus database with same CATH homology
 4DR7 L;  3HKZ G;  4BBS H;  4LUZ A;  4DKA C;  3G4S A;  3AFP A;  4P71 A;  3ICE A;  2CKZ B;  4Y52 H;  4JYA L;  4GS3 A;  3NEL A;  2EQS A;  2ZTE A;  4R4I A;  2I5L X;  3JAM c;  3HOU G;  4DR6 L;  1KL9 A;  5IY0 A;  2QEX A;  1Q1E A;  5FLM H;  3CC2 A;  1E1O A;  4OO1 I;  3L0O A;  1SLJ A;  1A62 A;  1PH2 A;  5JJK A;  2AMC B;  2ZM6 Q;  1TWH H;  2E5L L;  4HJ8 A;  3JC6 6;  4X65 Q;  4DR4 L;  2K5V A;  2WAQ E;  1S72 A;  4GKJ Q;  1AE2 A;  4JI7 Q;  1I3Q H;  1Z9F A;  4GNX C;  4A3L G;  5AJ3 L;  1A63 A;  4B3S L;  3S1M H;  1TXY A;  1KRS A;  4AYB E;  3HOU H;  3I55 A;  2VL6 A;  4B3R L;  1X3G A;  3K8A A;  5GRO A;  1N36 L;  4DV2 L;  3KF6 B;  4A3K G;  4JI4 L;  3BZK A;  3PO2 G;  3PIO A;  1I6H H;  1LM0 A;  2MFI A;  5C0X J;  3M9B A;  4DUY L;  1C9O A;  1GKH A;  3E9I A;  5M5X H;  4A3L H;  2R93 G;  4GLA C;  2D62 A;  3DLL A;  3PF5 A;  3KLW A;  4JC0 A;  4DR2 Q;  3M3Y H;  3FKI G;  4A3F G;  1PH3 A;  4DV4 Q;  5LMN L;  3Q8D A;  1CKN A;  2WAQ G;  5DLQ E;  2UUA Q;  4YCV A;  4A3K H;  3M4P A;  1X3F A;  1B70 B;  1B7Y B;  1O7I A;  1G6P A;  3MXN B;  3PO2 H;  2KBN A;  1UEB A;  4XTC S;  1HNZ Q;  1T9H A;  4DR7 Q;  4AIM A;  2Y0S E;  4OWT B;  3D31 A;  3K7U C;  4HJA A;  1GVP A;  3PV0 A;  4JI6 L;  2R93 H;  2NZO A;  4JYA Q;  1Y14 B;  1Q86 C;  1YIJ A;  4JCV E;  5EAY A;  2Z6K C;  1YHQ A;  4DR6 Q;  3FKI H;  3U58 A;  1Z47 A;  5JEA J;  5GAD C;  4A3F H;  3TRZ A;  1HNX L;  3G48 A;  5LMU L;  4AQY L;  4TVA B;  3CCU A;  1VQM A;  1E24 A;  2YTX A;  5IP7 G;  4DUZ Q;  2OTJ A;  5M5Y H;  4IOC A;  1NY4 A;  1YI2 A;  2E5L Q;  2HQL A;  4UY8 C;  4IPD A;  3L7Z C;  4DR4 Q;  2ZTD A;  2D0O A;  2RHS B;  2PNH A;  2VW9 A;  4OO1 G;  5JJI A;  2H5X A;  3CF5 A;  3A5U A;  1Y1W G;  5GQO A;  4LF4 L;  2Q2H A;  5AJ3 Q;  4LF7 L;  3UE0 A;  1W2B A;  4DK3 C;  4WJ4 A;  4B3S Q;  1BVS A;  1U0L A;  3CP0 A;  4QJF A;  1M90 C;  2VQE L;  1WFQ A;  2LSS A;  2MNA A;  4B3R Q;  1YHA A;  2WFW A;  1PHJ A;  3RLN A;  3CXC A;  4NXN L;  1N36 Q;  5IP7 H;  4DV2 Q;  1VQD A;  2R7F A;  4BBR G;  4JI4 Q;  1OXV A;  3CQZ H;  1VQE A;  4PZ7 A;  1LYL A;  4BY1 G;  4Y7N H;  1ASZ A;  1E3P A;  3S1N H;  4LFB L;  1N32 L;  5E7N A;  2A19 A;  1MJE A;  2R92 G;  1NBW A;  4O2D A;  3UE1 A;  4DUY Q;  2R7D A;  1X9N A;  1LUZ A;  4A3E G;  1Y1W H;  2JE6 I;  3M85 A;  3CCV A;  4MTN A;  3W5O A;  1MKH A;  2ID0 A;  3GTM H;  4BA1 I;  3M4O H;  3S15 H;  4DR3 L;  4LF5 L;  3A74 A;  1NE3 A;  1I50 H;  2WP8 J;  5LMN Q;  1BKB A;  3F1Z A;  3T1Y L;  3FHW A;  4MZ9 A;  3J81 c;  1KIX A;  3HOV G;  2IT1 A;  3KF8 B;  3U50 C;  2IHE A;  4BBR H;  4BY1 H;  5HY6 A;  2Q2U A;  2UXC L;  4A3B G;  3KF6 A;  3W1G A;  3ULJ A;  4GLX A;  2JA8 G;  3CMA A;  2R92 H;  1L2F A;  2JEB I;  1YJN A;  4A3E H;  2WB1 E;  2YTV A;  1SR3 A;  4JI6 Q;  1TWC H;  2ASB A;  3KYH C;  1IYJ B;  3TS0 A;  1OXU A;  1YEZ A;  4GOP B;  1PH4 A;  1TWA H;  1UE7 A;  2IY5 B;  4QGU A;  1AE3 A;  5LMU Q;  3RNU A;  1HNX Q;  4AQY Q;  3PUV A;  1P16 A;  4ALP A;  3HOV H;  1UE1 A;  3S24 A;  4WJ3 M;  4IPC A;  5IE8 A;  4HIM A;  1MIU A;  3PSI A;  4DV7 L;  3HOX H;  3I56 A;  2AKW B;  3WWV A;  4A3B H;  4A93 G;  2JA8 H;  1IBM L;  2E2H H;  1VQG A;  3FP9 A;  3UDX A;  3RR5 A;  4LF4 Q;  5IP9 H;  3S16 H;  2YYZ A;  4LF7 Q;  1EFW A;  2I0Q A;  2ZJR A;  3HOZ G;  2UXD L;  4PMW A;  1UE5 A;  4YWK A;  3GTO H;  5IYD G;  2VQE Q;  3A5Z B;  1FGU A;  2KCT A;  2MQH A;  4YCU A;  3T1H L;  2R6G A;  4K0K L;  2UXB L;  1J5E L;  4L5R C;  4NXN Q;  3H15 A;  3F2D A;  1UE6 A;  3HOY G;  1PH5 A;  1E1T A;  1K3R A;  2WB1 G;  3GD7 A;  3JAM i;  3KDF B;  4DR5 L;  4A93 H;  1G51 A;  4LFB Q;  1HR0 L;  1N32 Q;  3HKS A;  1PYS B;  3HFZ B;  1XNR L;  4IFD I;  2FXQ A;  2XTI A;  4LUO A;  1YJW A;  1YIT A;  3KJO A;  4X66 L;  3U4Z A;  1GO3 E;  2DUD A;  3HOZ H;  3BZC A;  4BY7 G;  5C4X G;  1NTG A;  4DR3 Q;  1RL2 A;  2DGY A;  2KEN A;  1ASY A;  4LF5 Q;  4OWW B;  5IYD H;  2CWP A;  1KQS A;  3G71 A;  2B3G A;  3T1Y Q;  1QUQ B;  3GTG H;  4A75 A;  1XJV A;  1X54 A;  4GN3 B;  3HOY H;  4DV5 L;  4KHP L;  1VQL A;  1VQB A;  2VS1 A;  4YCW A;  3M4Q A;  1Q12 A;  1SE8 A;  2GVB A;  3K80 C;  2HHH L;  2CFM A;  4C3I H;  4X62 L;  1VQN A;  1K0R A;  1VS0 A;  3LGJ A;  3G6E A;  1PVO A;  2AHO B;  3RLF A;  4A3C G;  1Q46 A;  1PV4 A;  4OXP A;  1LTL A;  4IJL A;  1XNQ L;  3CPF A;  2A8V A;  3J81 j;  5C4X H;  1SRU A;  4BY7 H;  1OXT A;  4QY7 A;  1EIY B;  3H0G G;  2JA9 A;  3RN2 A;  4LFA L;  4DV6 L;  2JA7 G;  3J80 c;  1VCI A;  3TQY A;  3I4M G;  2LXK A;  2AWO A;  4OX9 Q;  3K81 C;  5GAE C;  1JT8 A;  4DV7 Q;  1VQ7 A;  3I2Z A;  2C35 B;  4X64 L;  4R1J A;  1X56 A;  2BA0 A;  1IBM Q;  4A3D G;  2E2I H;  5ELN A;  3GTQ H;  1OXX K;  1K73 C;  1XTD A;  2NVQ H;  4IPG A;  3U4V A;  2UXD Q;  3J7Z C;  2K4K A;  1C0A A;  1E22 A;  3H0G H;  2RCN A;  4UP7 A;  3T1H Q;  1QZG A;  2UXB Q;  4AYB G;  1J5E Q;  4GOP A;  2JA7 H;  2MO1 A;  2NVY H;  4C2M H;  4HID A;  4B3T L;  4JI0 L;  1J6Q A;  3I4M H;  4YY3 L;  2VQF L;  4GN4 B;  4APV A;  3PUW A;  1EWI A;  2AWN A;  4HIO A;  1G29 1;  2F3I A;  3OTO L;  4DR5 Q;  1HR0 Q;  2UUB L;  1XNR Q;  3ULP A;  3UDF A;  2JQO A;  4JI8 L;  4XIG S;  1Q82 C;  4A3D H;  3PCO B;  1BBW A;  5BR8 L;  4DV1 L;  4X66 Q;  4JI2 L;  2E8G A;  5FJ8 G;  1HZC A;  3NEN A;  4DNI A;  4IFD G;  3PUY A;  1YZ6 A;  3W1B A;  1CKO A;  1QZH A;  2B29 A;  1FJG L;  1OTC A;  4DV5 Q;  3CPW A;  4KHP Q;  2L15 A;  1CKM A;  4IPH A;  2XGT A;  2E2J H;  2JJQ A;  2VNU D;  2OQ0 A;  4JG2 A;  4A76 A;  4JI5 L;  3GO5 A;  4X62 Q;  2HHH Q;  3KDF A;  5ELO A;  2VZA A;  1KAW A;  5J3B A;  2Y0S G;  1IBL L;  2YTY A;  2VY3 A;  4HJ5 A;  1QVC A;  5FJ8 H;  1XNQ Q;  4LFA Q;  1B8A A;  1H95 A;  4DV6 Q;  3TS2 A;  3S1Q H;  3CCS A;  5C0X I;  1QUQ A;  4P72 A;  4PZ8 A;  1W3S A;  1WOC A;  4A3G G;  3J81 i;  1HZ9 A;  1Q8K A;  4X64 Q;  1VQI A;  2F52 A;  4NB3 A;  1XPR A;  4C3H H;  2YU9 H;  3RN5 A;  2A1A A;  3UDG A;  1L1O B;  3L2P A;  3CW2 C;  4DV0 L;  3B6Y A;  3RLO A;  4KHZ A;  1Y1V G;  1XMO L;  3RZD H;  2NN6 I;  4LUV A;  1KXL A;  1JJC B;  4R4C A;  3CAM A;  4A4I A;  1V1Q A;  2V1C C;  2K75 A;  1X65 A;  2JEA I;  3J7A 5;  3NEM A;  4LW1 A;  3ZJY C;  4B3T Q;  1TWG H;  2K50 A;  3SGI A;  4JI0 Q;  4YY3 Q;  2VQF Q;  1VQ8 A;  2K52 A;  3GTJ H;  1GM5 A;  4IO9 A;  2UUB Q;  1N33 L;  3OTO Q;  1Q7Y C;  2Q2T A;  3K7A H;  1EYG A;  2I5H A;  1C7Y A;  4A3G H;  1X6O A;  2MO0 A;  4JI8 Q;  4LF9 L;  1Q1B A;  3GTL H;  5BR8 Q;  4GKK L;  4DV1 Q;  2BA1 A;  1VQC A;  2N3S A;  2VUM G;  4JI2 Q;  1BBU A;  1Y1V H;  1A0I A;  4DK6 C;  4DV3 L;  2GN5 A;  1PH7 A;  2QA4 A;  1WYD A;  5M3M G;  4GNX B;  1XPU A;  1SMX A;  1TWF H;  2UUC L;  5K36 G;  5IYC G;  1YJ9 A;  1FJG Q;  1EOV A;  1VQA A;  2PQA B;  1FL0 A;  4QIW E;  4JI3 L;  1MJC A;  4YWL A;  3CCQ A;  1R9T H;  1YHB A;  4H02 A;  2K5N A;  4P75 A;  4JI5 Q;  4O0A A;  1SRO A;  1VQ5 A;  1XMQ L;  1IBL Q;  3TEH B;  2VUM H;  1DGS A;  2ZTC A;  3KJP A;  3I4N G;  5M3M H;  4LWC A;  1KRT A;  2LXJ A;  1K83 H;  3EIV A;  3PF4 A;  5IYC H;  1EIF A;  3M7N A;  4GOP C;  4POG A;  3F8T A;  3TRE A;  2KHI A;  1YVC A;  4HIK A;  1WCM G;  1IZ6 A;  1I94 L;  5LMN W;  3K0X A;  1VQP A;  1SN8 A;  1HZB A;  2ALY B;  5C0X G;  3CCR A;  2HIX A;  2PMZ E;  3ERS X;  1KD1 C;  4DV0 Q;  1X55 A;  2UXC Q;  4YHH L;  1XMO Q;  4KI0 A;  2K14 A;  3I4N H;  1K8A C;  4LF8 L;  1NJI C;  4C3J H;  5C44 G;  3CC7 A;  1NMF A;  4YWM A;  4R4Q A;  1QVG A;  2OQK A;  1D8L A;  2NN6 G;  4DAY B;  2R7Z G;  4P74 A;  1JB7 A;  5GAH C;  4RG1 A;  4JBM A;  1WCM H;  4DUZ L;  1N33 Q;  3AEV A;  4IOA A;  1UWV A;  2CCZ A;  3J80 i;  5HGQ A;  2F4V L;  4LF9 Q;  4GKK Q;  1VQO A;  3HOW G;  3F2B A;  2KCM A;  3AYH B;  4GN5 A;  1QVF A;  1HH2 P;  4DV3 Q;  3F2C A;  3CCE A;  1L1O A;  1IL2 A;  5JEA G;  5FLX c;  4UP9 A;  2UUC Q;  2BH8 A;  5M3F G;  3GTP H;  5C44 H;  1EQR A;  1VQ4 A;  4JI3 Q;  4L5S A;  2I5M X;  2ATW A;  2JA5 G;  1VQK A;  2R7Z H;  4A3C H;  4X6A H;  1X3E A;  3BJU A;  4RMF A;  1S3O A;  4BXX G;  4K0K Q;  2PI2 A;  4QQB X;  3HOW H;  4UP8 A;  1XMQ Q;  2IX0 A;  4IJH A;  2NVX H;  1PH8 A;  2N8N A;  2IHF A;  4JI1 L;  4B3M L;  1HNW L;  3OW2 A;  4HJ7 A;  1WI5 A;  5M3F H;  1E7Z A;  4JOI A;  4GNX A;  2EXD A;  1EQQ A;  3GTK H;  1NMG A;  1Q81 C;  4OWX B;  3KFU A;  1PH9 A;  2JA5 H;  2JK8 A;  2K5H A;  1AH9 A;  1GD7 A;  1OXS C;  4LF6 L;  2PQA A;  2BH2 A;  3STB C;  1I94 Q;  1IBK L;  4BXX H;  1VQH A;  2YV5 A;  2ZJQ A;  3D0F A;  3IRB A;  3H3V I;  5JJL A;  2OCE A;  1K8G A;  4DPG A;  1YBY A;  3PGZ A;  4P73 A;  2NVT H;  1V43 A;  3ER0 A;  2HIV A;  4YHH Q;  5C3E G;  1S40 A;  5IYB G;  1XPO A;  3BU2 A;  4LF8 Q;  2GVA A;  4DR1 L;  4JV5 L;  1VQ9 A;  3RZO H;  3NBH B;  3MEF A;  4L5Q A;  3S2H H;  3EN2 A;  2QGQ A;  1YNX A;  1K9M C;  4NXM L;  1RIP A;  4A3M G;  1HZA A;  1P8L A;  4GLV B;  5IWA L;  1L0W A;  3CCJ A;  4QL5 A;  4UPA A;  1N34 L;  4A3J G;  2F4V Q;  1JJ2 A;  4PG3 A;  4DAM A;  3PO3 G;  4MNO A;  4LFC L;  2OWO A;  2Z0S A;  2JA6 G;  1FVI A;  1U5K A;  2N78 A;  3ULL A;  4JBW A;  2RF4 A;  4FDB A;  5GAG C;  5IYB H;  5C3E H;  1SFO H;  2UU9 L;  3CD6 A;  4TQU S;  5H1S E;  3KOJ A;  2CWA A;  3I4O A;  4A3M H;  1JJG A;  3GDE A;  3STB D;  4A3J H;  3PO3 H;  1N9W A;  1CSQ A;  5C4J H;  4IFD J;  1N8R C;  3UDI A;  3CME A;  2JA6 H;  4PZ6 A;  2D0P A;  3VDY A;  3S14 H;  1HJP A;  4JI1 Q;  1HR0 W;  4B3M Q;  1HNW Q;  1PA6 A;  2ZM6 L;  1PYB A;  2NZH A;  4X65 L;  3S17 H;  1VQF A;  2RHQ B;  2HT1 A;  4POF A;  4GKJ L;  1JE5 A;  4R4O A;  4LF6 Q;  3EBE A;  4EQ5 A;  3CC4 A;  4JI7 L;  1KC8 C;  3DM3 A;  3CCL A;  2Q2I A;  1CSP A;  1IBK Q;  1CUK A;  2Z6K A;  4NPS A;  4L5T A;  4A3I G;  4BA2 I;  5M5W H;  3HOX G;  1CKN B;  1EUJ A;  4R4T A;  3HKZ E;  3OYY A;  1PH6 A;  1M1K C;  3AQQ A;  3PUZ A;  1JMC A;  1A8V A;  4OON A;  5IP9 G;  1WJJ A;  2EIF A;  3I7F A;  4HJ9 A;  5IT9 c;  1L1O C;  3CCM A;  4DR1 Q;  3S2D H;  3E0E A;  2B63 G;  4JV5 Q;  1KHI A;  1VQJ A;  3PIP A;  3S1R H;  1V9P A;  4ME3 A;  4NXM Q;  4BBS G;  2ES2 A;  1PFS A;  1N34 Q;  5IWA Q;  4AH6 A;  4J15 A;  2IX1 A;  2KHJ A;  3AFQ A;  4EX5 A;  2ZJP A;  4DR2 L;  4A3I H;  2OTL A;  4OX9 L;  1D7Q A;  4LFC Q;  1VQ6 A;  3PUX A;  4DV4 L;  4JBK A;  5FLM G;  2CQO A;  2UUA L;  4KLK A;  2UU9 Q;  3A0J A;  2N49 A;  3E9H A;  4JBJ A;  3H3V H;  2PI2 E;  2B63 H;  1PH1 A;  1I5F A;  4LNQ A;  4JOI C;  1IXR A;  1HNZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...