3QO2A

Structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
b'MGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-phase phosphoprotein 8
publication title Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/gene regulation
total genus 12
structure length 61
sequence length 61
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qo2A00
1PLFA 2KEDA 2NWGA 2L4NA 1RHPA 5D65A 4HAEA 3N52A 4QUCA 4ZKBB 1PFMA 2RVLA 1CA6A 1KNEA 2B2WA 3IFDA 1DOKA 2R3ZA 4ZK9B 1WD0A 1ILPA 2L12A 1MGSA 1J8IA 1XYIA 1DOMA 4X3SA 2N55A 2X69A 4R8IA 2K01A 2EOTA 3HP3A 4U68A 4QUFA 3KBXA 1MI2A 4IUTA 1NR2A 2K1BA 4IUVA 4O42A 1X3PA 2JYOA 3R93A 1WTRA 1EQTA 1ILQA 1EIHA 1WVLA 1IKLA 4X3UA 3GV6A 3TZDA 1QNKA 2B2YC 1PFBA 2DY8A 2HUGA 1RTOA 3LWEA 4XT3B 1B2TA 2KECA 1ZXTA 1DONA 5CBAE 2VXWA 1G2TA 1IL8A 2H1EA 4CJ1B 3Q6SA 4LMQD 2M2LA 1A15A 1CM9A 2K05A 3I91A 1WTPA 1B3AA 3P7JA 4OIKA 1XX8A 1NCVA 2CVRA 2MPMA 4ZKCB 5DNFA 1SSOA 1AP0A 4MN3A 3FDTA 1ML0D 2NZ1D 2JP1A 3GV3A 3UI2A 1B50A 1HUNA 1GUWA 2J7ZA 3I8ZA 2Q8TA 1C8CA 2X6GA 1VMPA 2B2TA 2B2VA 3DEPA 4IUUA 3QO2A 2EE1A 1U4RA 2B2UC 1JE4A 2L1BA 2MGSA 5E4WC 3MWYW 4HSVA 1AZPA 1CA5A 4HCSA 2B2WC 1LV9A 5EPJA 1BF4A 5T1IA 1B53A 2FINB 3SVMA 1AZQA 2D9UA 1WTWA 1S4ZA 1KNAA 1MSGA 5CMDA 2FJ2A 5AFWA 1HRJA 4ZLTF 1O7ZA 1U4MA 1VMCA 1PDQA 3DM1A 2FFKB 1F9RA 2FHTA 1O7YA 1WTQA 5CBEE 3I90A 1NAPA 3H91A 4IURA 1M8AA 1BNZA 2RSOA 1NR4A 4OIJA 5EPLA 2X6LA 2FMMA 2L11A 4XDXA 4R9WA 4IUPA 1G6ZA 3F2UA 5EKIA 2RSNA 4RWSC 2IL8A 2MP1A 5CORA 3I3CA 1EL0A 1O80A 2KEEA 5T1GA 2DY7A 1WD1A 1RTNA 1SDFA 1EOTA 1HUMA 1PFNA 3KUPA 3MTSA 2N88A 1SAPA 3DEOA 2K03A 4MHEA 2K28A 4RA8A 1U4LA 5EQ0A 1BBXC 5EJWA 3IL8A 1F9QA 2L9HA 4X3TA 5E4XA 2B2TC 2B2UA 2B2VC 1X3QA 2KOLA 3G7LA 5EPKA 1WTOA 1IKMA 2HCCA 1G2SA 2BDNA 3FPUB 1RODA 1U4PA 5JJZA 1HHVA 2MJ8A 1QG7A 1TVXA 4UAIA 2XIWA 4ZAIA 1ICWA 2B2YA 1DOLA 2EPBA 1DZ1A 1HA6A 2NYZD 4X3KA 1F9SA 4HEDA 3D6WA 4NW2A 1F9PA 1HFGA 2Q8RE 5D14A 4CJ0B 2K04A 1MSHA 4IUQA 1EIGA 3ONAB 2RA4A 1ESRA 2HDLA 4RAUC 5COYA 1F2LA 4DN4M 1B4OA 1HFNA 2HDMA 1Q3LA 1QE6A 1WTVA 1E0BA 1X32A 4XT1B 4CJ2C 1WTXA 1J9OA 2SDFA 3TN2A 1BO0A 1RJTA 2KVMA 1JICA 2KUMA 2HCIA 1G91A
chains in the Genus database with same CATH superfamily
2AKWB 3KYHC 4DUYQ 3OOCA 3K6OA 1E1TA 4KJOA 1CA6A 4TVAB 2R3ZA 1WD0A 1OTCA 4L63B 2JA5B 1Q90A 1ASYA 2BH2A 1VCIA 4A3FG 1L2FA 2Y0SB 4A3EG 2UXBQ 3PO2H 1TWCB 2OQ0A 2XSCA 4A3MH 4DR2L 1TWGH 3VDYA 1O78A 1XWEA 3Q6SA 4B3TQ 1Z9FA 2JA8H 4C3HG 4NXMQ 1V43A 4ME3A 2EYLA 4BWGB 1PMRA 4FDBA 2H5XA 2I5LX 1EYDA 1H95A 2B8FA 3RD4A 4C3HH 5C3WA 3NTIA 4JV5Q 4DV3L 2B2WC 1B53A 5ISRA 2EQSA 4APVA 1N36Q 1MSGA 3L3OC 5AFWA 4JI8Q 3PO2B 3HZXA 4A3MB 1LTRD 1TWGB 3VR4A 1YHQA 3ULJA 1IBML 5IT9c 1EFID 1UNSA 3TP5A 4OIJA 2EVBA 1CKOA 2JA8B 5L37A 2O4XA 1JOQA 1Y1VG 4DR3L 2OQKA 2OEOA 4NP5A 4WORA 1TXYA 3IFTA 3OWFA 2CFMA 3F2DA 2F0KA 1FNUA 1T5XD 4DR7Q 5JAVA 2EYFA 1Y1VH 2IX1A 1G6PA 1K0SA 2DUDA 4YCWA 5CV5A 4X3TA 2MFIA 3EIVA 4DV5Q 3LGJA 1WTOA 2AQ3B 2E5LL 1TS3A 1EWCA 3HOWG 5NUCA 4L8JA 3VYRA 1LTTD 3L7ZC 4HEDA 1PTOC 1PH1A 2I5MX 1Y8PB 5ELNA 3STBC 2FMCA 4OX9Q 2K04A 1SNQA 3T4AC 4A3JH 2O5IC 3HOZG 1LTBD 3RZDH 2QF7A 3JAML 4JOIC 1E0BA 3TN2A 1LT6D 1SNDA 1Q81C 1MD2D 1YJWA 2KEDA 4YCUA 4DFAA 1Q1BA 3OW2A 2SNSA 1DOMA 3F2CA 2I46A 1A62A 3S1NH 1RCVD 2UXCL 4X66L 1B1ZA 1MI2A 4JVZA 1AE3A 4BA1I 1XPOA 4O42A 5C4XG 1SE2A 4PMBA 4KY6A 5C5MA 3U4VA 1BCPD 1M4VA 1D8LA 4A3JB 1QOHA 5BR8L 3RZDB 4DV2Q 1B2TA 4OGQC 2JXMB 1PYBA 2BA1A 2WKCA 2M2LA 5KYLA 4L5TA 3EN2A 4R4TA 4K6LA 1ASZA 1GUSA 5IGDA 3AEVA 1ML0D 1YNND 5IYDG 1W6JA 2J7ZA 2F0SA 4NXNQ 2KHJA 5J1ZA 4HIOA 1CA5A 2F0MA 2SNMA 3URYA 1ENAA 5T1IA 2PO4A 3U58A 2LXKA 1XNRQ 1VQFA 3UE1A 1HRJA 1A3UA 3DM1A 2Q2UA 1SMYD 5EAYA 1O7YA 4HJ8A 5IY0A 5CBEE 3IKJA 3L9AX 3GP7A 4QIWB 3S1QH 2RSNA 4GOPB 3OWEB 2WV6D 3BDCA 2F0OA 1L0WA 5IYCG 1CQFA 1A0IA 1PFNA 3VR5A 2OXPA 2KCMA 3TMEA 2DN8A 2M9VA 3GTQH 4IALA 1NTGA 2EYJA 3TREA 1H9SA 3Q24A 1GD7A 1SBBB 3MC0B 3W1BA 3KF6B 1D5ZC 2MJ8A 3H0GH 4UAIA 1TS5A 1L1OC 4LFAQ 1F9SA 1JWUD 4U673 4JBWA 1TKWB 5FLXc 2Q8RE 2ZJPA 4TSSA 1UEAB 3S1QB 3I4OA 2WB1E 4DV1Q 1F2LA 1U9RA 4GS3A 1Q3LA 5IT9L 4RGNA 2D0PA 4C1NI 2KUMA 2VB2X 4C3JH 1G91A 4OELB 1P8LA 4DR1Q 1Y69U 3K58A 3GTQB 1ONLA 2NTSA 3NWTA 2EXZA 2Z8LA 2PW5A 3CMEA 4M8AA 4YWKA 4UY8C 3H0GB 4JI6Q 4XTCS 2F0LA 3I56A 1NR2A 1X3PA 3RN5A 1X56A 3KF8A 4K5VA 2CQAA 3T1HQ 4XQNA 5BN3A 3BS1A 3DHQA 3U9SA 3I7FA 2O5JC 1IYUA 5GAHC 2VXWA 2RDGA 1VQ8A 1PH2A 4CKBA 3SE0A 1HNZL 1A15A 2MO1A 3KLWA 4K2LA 4C3JB 1GHJA 1YITA 4N9TA 1RF2D 4GLXA 1IBLQ 5M5YH 2A68C 1Z6HA 4FF3A 3EQLC 2KJXA 1FR3A 5LL6S 2IX3A 2GA4B 2UU9L 3I8ZA 1C8CA 3IRBA 1EEFD 1WJJA 1PYSB 5E4WC 1JE4A 1ICFB 3T53B 4RH6A 2KENA 3RLFA 4BBRH 3S24A 2ICIA 1FGUA 2ALYB 1PTOD 2WAQE 1PFSA 3STBD 1YHAA 1C7YA 2FFKB 1N33Q 2R93H 1EY4A 1UE6A 4GZYC 3K7AH 2I07B 4XDXA 1SJED 1WTHA 1XMOQ 1X3GA 5IYBH 1WD1A 1VQ5A 2NZHA 2N88A 3L0OA 4BXXG 1T9HA 5K36H 4BBRB 2PMZB 4DV0L 4OWTB 5M5WB 4YHHL 3CCEA 2WP8J 5M3FB 1LTID 4LW1A 5C4ZA 1DOLA 2R93B 1Q7YC 4POFA 1EQVA 5F2DA 3K7AB 3ERQA 4HSPA 2CKZB 4IUQA 1LT4D 1QJOA 3ULPA 1BDOA 1Y1WH 1WTVA 4X62Q 4LF6Q 1JB7A 2SEBD 3K0XA 2ZTEA 4DV4Q 3NQTA 4H44C 5JPMC 2UUBL 2BH8A 3I4MH 1B3QA 2L4NA 1G51A 3P1HA 4ZUJA 3CC2A 2QILA 4A3CG 4K8IA 3JAMi 1CTMA 3UDXA 2YTXA 2M00A 5KIXA 5LMNQ 2F0JA 4E6IA 2WB1B 1AN8A 1HZCA 4HR7B 3J81c 2LFNA 4DK3C 2JYOA 4ABNA 1DYQA 3U50C 1KTKA 1SYFA 2PPBC 4X3UA 2NVYH 3Q22A 3H94A 2HUGA 1Y1WB 1I4HA 1VQDA 5FLXL 2MHVA 4KY7A 4QF4A 4OEMB 1S40A 4N9PA 1SFOH 4LF8Q 1BR9A 5G3LD 3A55A 3J80L 2E2JH 2K5VA 3I73A 3P7JA 1XMQQ 2HQLA 1E22A 1C9OA 2F0NA 1D2BA 1ZKOA 3TZUA 1HQMC 4ALPA 3DEPA 1K9MC 4JI2Q 1EY7A 1AZPA 1YI2A 4DK0A 4B3RL 3A54A 4ID6A 1SMXA 4AYBE 4J15A 4DAPA 3Q23A 1S4ZA 2GVAA 5CMDA 1K3RA 2NVYB 5C4HA 1YNJC 1UUPA 3S17B 4QGUA 3UE0A 3H91A 1SFOB 3C2PA 3MHBA 2WINB 2E2JB 2CW0C 1NE3A 4FF4A 5EKIA 4HIDA 1SN8A 4FF1A 2ES2A 4C2MH 3HRZC 2WAQB 1D5XC 5M9OA 4GKKQ 4YY3Q 4MTNA 2Z9HA 4CGYB 3G7LA 4JYAQ 1KLGD 1G2SA 3FPUB 4PZ6A 4BY1B 3C3LA 4ZAIA 4JBMA 1ICWA 3CRLC 4FNFA 1DZ1A 3E0JA 1QVFA 3I4NH 4HN7A 4NW2A 3K7UC 1YHBA 2NVXH 1HFGA 2GN5A 3NE5B 4DXGA 2PW7A 4JI4Q 1EIGA 2EJMA 2HDLA 5A2QL 2A8VA 4A93G 3FKIH 2BOSA 2HDMA 1VQAA 3DLLA 4JI0Q 4C2MB 3K5OA 1II3A 4HCEA 5FOBB 4DNIA 3H3VI 1BUVT 3GTMB 4BS9A 2B2WA 4ZK9B 4JW0A 3FP9A 1MGSA 3R2IA 1HNWL 1LTSD 4QUFA 4DAYB 1VF5C 3I4NB 4IUVA 4A3GG 2NVXB 1Q82C 3T56B 5IP9G 2RBMA 1HR0L 3HGBA 2DY8A 3HOVG 4X65L 3FKIB 3HKSA 1MIUA 1J5EL 4FO2A 3ERSX 5IWAQ 4JI7Q 3KBGA 4RGTA 4B9XA 3TP6A 1NCVA 1STAA 1O7LA 2MPMA 3VR6A 1SSOA 4DV6L 1JJ2A 1JB3A 3J7YW 5BN4A 4JI3L 3PMFA 3GTPH 4N8FA 2JA6H 1U4RA 2L1BA 4HSVA 1IL2A 4HCSA 1KLUD 3PIOA 5C44B 4CDDC 1WTWA 4R4QA 1A63A 2PI2E 1SYEA 3NBHA 2NBFA 5AJ3Q 3J81L 2R7ZB 1WTQA 3DMUA 3PQIA 4JOIA 1KAAA 1L0YB 5BN5A 5IGGA 1VQBA 1X6OA 1BVSA 4BY7H 1S5DD 1O80A 3BYYB 3GTPB 2F0TA 2VQEQ 4P75A 2QDBA 2UXDL 3G6JB 4B3MQ 2V4DA 3I55A 1WOCA 2R92H 4LJZC 5KNBA 1PH9A 4NMZA 1HHVA 2P5ZX 4JPBW 1LTAD 4XQQA 4GN3B 4GOPC 3J81j 1HCZA 1FJGL 1JQYD 1V8QA 1I4RA 5I4DA 2G9DA 3S9WA 4ME5A 3MEFA 2LKVA 1S5FD 5HGTA 5JVG3 1CKNA 2F4IA 4DR4Q 1PZID 1QE6A 2R7DA 4CJ2C 5M3MH 1HZBA 2JA5G 3OIPA 3LNNA 1W2BA 4H02A 2XVSA 4B3SQ 2Y0SG 3FMCA 2R92B 1XTDA 4C56C 2CHBD 2H4OA 4X3SA 4YWMA 4A3BH 3S2DH 5C6AA 3EBEA 1LYLA 1YNJD 2Q2TA 4O0AA 4DR6Q 1ILQA 1PYWD 4KHVA 3JAME 4HJ5A 1KRSA 3GV6A 4A76A 4RGMA 1PFBA 3A5ZB 4F88A 5CBAE 2CW0D 3KJPA 5M3MB 2IPKD 2AWNA 1YIJA 2XGTA 3OHXC 3KLSX 1WTPA 4WFN3 5ELOA 1EY9A 5TSSA 3CMAA 2F1MA 2C35B 1GUWA 3PO2G 4A3MG 1D1IA 4A3BB 3S2DB 3F2BA 1HH2P 4LFCQ 3I2ZA 2UXBL 4IJHA 2G5DA 1E2ZA 4LF9Q 1L1OA 2FINB 2JA8G 1G291 3A0JA 2F03A 2QEJC 1LABA 3ND8A 4B3TL 5IP7H 3K81C 1MJEA 5EKLA 1EYGA 5C3XA 3SK8A 1KIXA 4FXKC 3BYTB 3M9BA 3T16A 3PF5A 4KLKA 2FMMA 1X55A 4JK1C 4X64Q 4ULLA 3RNUA 1EQQA 1Y14B 5CORA 4QIWE 1PA6A 4JV5L 2DY7A 3TRZA 1PH3A 3MTSA 5CV4A 1TQOA 1TR5A 4DR2Q 3R2TA 5EJWA 2ZXPA 3M4PA 5EGTA 1RD9D 3ITPA 4A75A 2VUMH 1FNWA 4UPAA 2WIIB 1QVCA 5CV9A 4K5WA 2F4VQ 1GJXA 3K0YA 2A6EC 3J7ZC 1DCZA 2IHEA 2K4KA 1NUCA 2F3IA 3CHBD 3HG9A 3TS0A 5D3IB 2RA4A 2ZTDA 1VQ4A 4DV3Q 4H0LC 4XT1B 4DR7L 2OCEA 1WTXA 1BO0A 5CV8A 2PZUA 4A3DH 5CR3A 4XIGS 4A3FB 1CSQA 4DV5L 3M4OH 4MIUA 1QUQB 1Q8KA 2VQFL 4A3JG 2TSSA 3GTKH 2VUMB 1JORA 1FD7D 3KDFA 5EBDA 2MUYA 2N55A 4R8IA 2B29A 2SOBA 2IWHA 4DR3Q 5CGKA 4OX9L 3HOYH 3AYHB 1UAPA 2A6HC 1EIHA 2A73B 1KRTA 2CCZA 5IT9E 4OO1I 3FPPA 3CXCA 3LWEA 1PZKD 4EX5A 4JC0A 4A3DB 1EOVA 2QA4A 3D3RA 1HR0W 3K8AA 4K2KA 1HTLD 1HTPA 3M4OB 4KD4A 2O2LD 4IPHA 2NZ1D 2EIFA 3NPPA 3GTKB 3RMHA 4Q0FA 5I2YA 1TY2A 1QZGA 1F77A 4A4IA 3HOYB 3EA6A 4UP7A 3SVMA 4DV2L 4IJLA 1C0AA 1LM0A 4F87A 1U4MA 3Q8DA 3LWUA 2JK8A 3MVVA 1JWSD 2KCTA 1NAPA 1H9RA 4DXFA 3BG3A 5J3BA 4FXDA 2RSOA 3TSSA 2UXCQ 2K6AA 4NXNL 3MAQA 5EBCA 5T1GA 1N9WA 1CHQD 4ZQ3A 2ASBA 1HUMA 1LLRD 1UE5A 2K28A 1XNRL 1GVPA 1F9QA 4J6HA 1VQPA 3OSOA 3TEHB 1I4QA 4MNOA 3CCJA 2PMZE 2YYZA 3PIO3 4ZCKA 1WI5A 4R4CA 4GN5A 3CD6A 4X3KA 4LUVA 5JEAH 4V190 2WFWA 1CUKA 4JCVE 1MSHA 3EVQA 3A56A 3GTOB 1IYJB 1TWAH 1SEBD 1J9OA 1OXVA 2SDFA 3RR5A 4Y7NH 3H3VH 4IFDI 3H0GG 2HCIA 1F2ZA 2AHOB 3NTHA 1RHPA 2A5HA 2IHFA 2PNRC 3N52A 4HAEA 5GAEC 5C4XB 4IPDA 2KHSA 2D0OA 2XRSD 4QJFA 4LFAL 3K80C 4KI0A 4HJAA 2YTYA 4PZ7A 1BCPB 1S5BD 4IUTA 1PRTB 4C3JG 1K8AC 2JN4A 4DV1L 4GLAC 3J80c 3B6YA 5IGEA 4LF7L 4L5QA 3T51B 1TWAB 1VS0A 4YIJA 2KBNA 4WJWA 4YWLA 4RMFA 1GM5A 4Y7NB 3DWPA 4DR1L 3K5LA 1Q86C 3NELA 3CC4A 3T1YQ 3OW7A 4IFDJ 5C3EH 2IY5B 2K7VA 1DJRD 3G6EA 3OYYA 4JI6L 3E3XA 3D4WA 2HIVA 3CCQA 1Q46A 3QO2A 4MTKA 4A3KH 1GUGA 4PQXA 3T1HL 1E7ZA 4PG3A 4IQZA 2EY5A 1TU2B 2A6ED 4FVMA 3K5MA 4DUZQ 4DR5Q 1BBWA 2HIXA 5J39A 1DGSA 2RDHA 4G4KA 3IAYA 2F0WA 1BBUA 4K14A 1IBLL 1M8AA 2RHSB 1NR4A 4BBRG 2X6LA 1VQIA 3JC66 5C3EB 4LUZA 1I4XA 1EY5A 3OIQA 5JPNC 3KUPA 4A3KB 1U4LA 3PSIA 2R93G 3CAMA 1LT3D 1HXYD 5M5WH 2B2VC 1V1PB 3PUWA 5M3FH 4DV7Q 1N33L 4KHPQ 3QIAA 4KN4C 4Z9CB 1K73C 2A6HD 3SHLA 3GQBA 1JOKA 1TVXA 1X3EA 3L2PA 4HTHA 1SNMA 5IYBG 1EU4A 2L55A 2I5HA 1LTLA 2NTTA 1OXSC 3MXNB 4CJ0B 5K36G 1XMOL 1IBKQ 1FL0A 3HKZB 2PQAB 5DM63 4DK1A 3BZCA 3W1GA 3PUYA 4GLVB 3GTJH 1K8GA 2WB1G 5I6WA 2FXQA 2WACA 2QCPX 1TY0A 3SXHA 2ID0A 1NBWA 2IX0A 2MO0A 4K8JA 1T5EA 1STHA 3KFUA 1ILPA 1SE3A 3MXUA 3K5NA 1Y1WG 4C3IH 1OXXK 1XJVA 2LMCB 2E74C 4DNRB 3AMUA 1K8MA 2CWPA 4IPGA 1RL2A 1ZEQX 3I4MG 3S2HH 3A7AB 4IOAA 5A2QE 1AE2A 3ULLA 3QOJA 5EKKA 3PUXA 1A2TA 4LF6L 2AQ1B 3MXPA 4XYOA 4XT3B 3OMGA 4DV4L 2YU9H 3G48A 4DV0Q 2JA7H 1QCBD 2B3GA 2K05A 2NN6H 3GTJB 1ENCA 2R7FA 4FF2A 1STYA 2Z6KC 1VQ9A 2L15A 3GV3A 3DWQA 1FGBD 1A6XA 4QQBX 1UE7A 4AQYQ 2ZM6Q 1RIPA 4C3IB 2MGSA 3PO3H 4GOPA 5D3DA 1LV9A 3S2HB 3HEJA 3R8BA 1DXMA 4G57A 5C4JH 4BBSH 3S17H 2OTJA 3GTGB 1VMCA 5C0XH 5KNDA 3HOXH 2YU9B 1X54A 4AIMA 4KD3A 4DU9A 1I3QH 1EFWA 1XMQL 4LF5Q 1EWIA 2WAQG 3I90A 2JA7B 2DJGC 3KF6A 2OF1A 5DAUA 5ELEA 2C9OA 4P71A 3D4RA 2MP1A 4JI2L 3I3CA 1EL0A 1E2WA 1WYDA 2HHHQ 4IZ8A 5A35A 4RA8A 1SAPA 3DEOA 4MHEA 3PO3B 5I9PA 4BY1H 1X3QA 2K5HA 5C4JB 4BBSB 3HOXB 3X3NA 2XIWA 1I3QB 3RUZA 4LFBQ 2QW7A 3RLNA 1KQSA 4DAVA 4MZ9A 3CQZB 3SGIA 1N34Q 3VYSA 4ILWA 4GKJQ 4H7BA 3TP7A 2E2IH 4A3IH 3VR3A 4J1MA 2K5WA 2AWOA 4HMJA 3WOFA 1ZYRC 3GTMH 4P72A 4GKKL 4YY3L 2E76C 3A74A 2F0FA 4JBKA 4JYAL 3I4NG 3CW2C 1J6QA 3CCVA 4OXPA 4PMWA 3IFDA 1MJCA 4KJNA 4GNXB 4BA2I 1I6VC 1N32Q 3FKIG 4KHZA 1HNXQ 3QWNA 4LNQA 2ENBA 2X69A 1BCPF 5HGQA 2XWBB 4JI4L 1PRTF 2ZJRA 1HPCA 1AFPA 3GDEA 1PH8A 4F8MA 4RCOA 2L5TA 3ZJYC 4OO1H 2A68D 4JI0L 3AQQA 1I94L 2ZJQA 4XQJA 4V0BA 4A3IB 3SDZA 4JI5Q 2E2IB 1ZXTA 2K75A 4IPCA 1G2TA 5CV6A 4ZUIA 1A3VA 1G8ZD 1W3SA 2XNAC 5M5XB 4G7ZC 1XNQL 5HURA 1OXTA 2B63H 5HY6A 2CQOA 1IW7C 2F0IA 4QCLA 1CZGA 1KXLA 3PF4A 1DM0B 2R7ZG 1SNOA 5C44H 5LMUQ 1PH5A 4IO9A 3RZOH 1B9MA 3KJOA 5EPJA 5KNCA 1SYDA 3M85A 5JEAJ 4IUNA 3F8TA 4WRDA 2UUCQ 1VQHA 5IWAL 3OTOQ 4JI7L 1JJGA 2R7ZH 1GHKA 1X65A 1F9RA 5ELCA 4AYBG 3DUZA 3Q0AA 1QWYA 2RF4A 4LF4Q 2JA6G 2JEAI 5IE8A 1EZ6A 2DGYA 2B63B 3BVZA 4L5SA 5FLMH 2KEEA 4R4OA 5FO7B 4QY7A 2Q2IA 3CCSA 4NB3A 1EOTA 4LAAA 4X65Q 4KKUA 1KDCA 3RZOB 1JJCB 3IL8A 3WOEA 1ET9A 3C1EA 1XPRA 4RKLA 4UP9A 5EPKA 1K83H 2UUAL 5GROA 1TIID 3C46A 4OL7A 2ICEC 5I6YA 1SNCA 3CCRA 4BY7G 1I5FA 5FJ8H 5IGFA 2PQEA 3CCLA 4IFDG 3UDFA 1F9PA 4OHJA 3NWSA 3NK9A 2LS01 2R92G 2VQEL 1XTCD 2EXDA 3S15H 1HFNA 1QNUA 1B44D 2AUJD 4I7ZC 1D1KA 4CHTB 4IFDH 2XRQD 4JI1Q 1I6HH 4X6AH 4G7OC 2NWGA 3HOUH 4A3LH 3H6MA 2PYKA 3M7GA 1NMGA 1X9NA 4K0KL 1K83B 2L12A 1HZAA 1XYIA 1AW7A 2WKDA 5IGCA 4KTAA 5M3MG 5DM73 1QB5D 1SNPA 1WTRA 1B70B 5KGUA 4JG2A 3TZDA 1PZJD 3KOJA 4IN3A 2B2YC 3MA2B 1VQKA 2UXDQ 3VR2A 3NP8A 4DA2A 3S15B 2KHIA 4B3SL 3TDQA 1I6HB 4DAMA 1CM9A 3AFPA 4A3BG 1S72A 3CF5A 2EY6A 3PUZA 1SROA 3HOUB 1PRTC 3PCOB 4B9WA 2YV5A 1KABA 1B50A 1HUNA 1PVOA 1GKHA 2EE1A 1UEBA 4DR6L 2N78A 1XXGA 1H9KA 2MNAA 3H3VC 4XYQA 1JT8A 5LMNW 1AZQA 1KNAA 2FJ2A 3K57A 2N8NA 1EY6A 1PDQA 5GAGC 4DUYL 1B8AA 1CHPD 3AU7A 1PH4A 2NN6I 3KLSA 1K8OA 3A7LA 2GVBA 1K28A 3MFGA 1BQQT 1ZYRD 3U9OA 1CSPA 1G6ZA 3F2UA 1EQRA 2IJ0A 4M1UB 2IL8A 2NVQB 4TQUS 4ZRZA 3J80i 3EJIA 4LFCL 5IP7G 1SDFA 1IKMA 4LF9L 1CQVA 1FYCA 4IOCA 2VY3A 4H13C 4ZYSA 2B2TC 1WCMB 3SR1A 5C0XI 1JOOA 5I9OA 4NXML 4C1NK 4RCNA 2K33A 1RDPD 3MXGA 4I65A 1CFMA 2DNEA 4X64L 2DNCA 1PH7A 3QB3A 4DAYA 1KDBA 3CCMA 2EYOA 4NDXA 2VUMG 2F3VA 1Q12A 3I4LA 1I4GA 4A3FH 1H9SB 2XWJB 1IW7D 3NBIA 1EIYB 5KRUA 4A3EH 1N36L 4JI8L 5D65A 2EYMA 2N49A 1Z47A 2RVLA 4I7AA 2BCOA 1KNEA 2F4VL 1DOKA 3E0EA 3TBIB 1CKMA 2RQXA 5C0XJ 1H9MA 4A3DG 2K1BA 3G71A 2NZOA 1TT2A 5G3LF 2NB0A 3VA7A 2CH4A 1DONA 1GOZA 5FKAC 4A3EB 2F52A 1B3AA 3HOYG 1IBMQ 4ZKCB 2QDLA 1UWVA 1SRUA 3X3MA 2F3WA 2Q8TA 3PV0A 1WFQA 3KF8B 2B2VA 1DD2A 3M4YA 3FHWA 4C3HB 2TMPA 1E1OA 5GADC 1BKBA 2XN9C 4UHVA 4HMIA 4R4IA 3CP0A 1B7YB 1ET6A 2PCFB 1YNXA 1A2UA 2VQFQ 2E5LQ 2EZVA 2PZWA 1IZ6A 4TRDA 3TP8A 5CC4A 1A3TA 3BVMA 2ZT9C 3MFYA 3HOWH 5JOBA 1D7QA 3VYUA 1SJHD 1V1OA 4O2DA 3CCUA 3HOZH 1Y1VB 4FYDA 1Q8IA 2F0EA 2ZXOA 1RODA 2CH4W 1Z7TA 1EY0A 3MEHA 1RKNA 2N3SA 1KDAA 1B9NA 3GTOH 4X66Q 4CKCA 4FP5D 3VA5A 4L5RC 3J81i 1ESRA 1M1KC 2Z6KA 4YCVA 1PV4A 1PRTD 3HOWB 5BR8Q 4HIMA 1JICA 3HKZE 2V1CC 2AMCB 5C4XH 4O1NA 2EJGC 1HA5A 3CU7A 4CDEC 3NTKA 1A8VA 5JEAG 1SYBA 2JEBI 4ZKBB 3HOZB 1AEXA 2JA9A 2VS1A 1IHZA 1LTGD 1HJPA 2K01A 2EOTA 3HP3A 2J0TD 3S1NB 1KHIA 3BU2A 4KY5A 1YJ9A 1M90C 5IYDH 1K0RA 2QKIC 3J7A5 2R61A 4GNXC 4CJ1B 3W2DA 3I91A 1TWFH 1MBYA 4OIKA 2CVRA 3BVGA 2JE6I 3FDTA 5IOCA 1NJIC 2K5NA 3HFZB 2Z0SA 2X6GA 2BE5C 2HD3A 4PMCA 3A8IE 1C4QA 1GUNA 2BA0A 2Q8IB 3PGZA 2D9UA 1U5KA 1VQMA 4NKLA 5C3EG 3V96A 2PI2A 3T13A 4ZLTF 1O7ZA 5IYCH 5KEEA 2EDGA 3T1YL 1VF7A 4A3KG 1GXDC 3E9HA 1VQGA 3GD7A 1BNZA 1TWFB 5EPLA 3NSWA 4GN4B 1MKHA 1CZWA 4RWSC 4XXEA 5GQOA 1EIFA 1HZ9A 2CWAA 2OT2A 1LUZA 4EQPA 4J8QA 4LF7Q 3UDGA 3S1MH 2K03A 2RHQB 5EQ0A 1LT5D 4DUZL 4LK1C 4DR5L 2NVTH 3DWAA 3ND9A 1VQLA 2RCNA 3PIPA 4KN7C 4ODGA 5FLXE 1UE1A 2EYPA 1QILA 3HKZG 1STGA 2VL6A 5FO9B 3J80E 1D5MC 1QUQA 3CRKC 3E9IA 4KKTA 4K5XA 2EPBA 1FVIA 3H09A 2NYZD 1PHJA 5FO8B 5D14A 3D8GA 4CKEA 3ONAB 3TQYA 2F0HA 3GTLH 1S5CD 1QVGA 1B4OA 5M3FG 3QOLA 2A69C 4DK6C 3S1MB 2HT1A 1KD1C 2AQ2B 4PV1C 4DV7L 4DNTB 2VNUD 1HNZQ 4KHPL 2NVTB 5IGBA 4QUCA 1PFMA 4B08A 3QR8A 3I72A 1QZHA 3MZ5A 2Z4IA 2F0PA 1SXTA 3A5UA 4QMGA 1IXRA 2UU9Q 4Q5VA 1IBKL 1EQTA 1EY8A 3EFXD 3AFQA 1IKLA 1QNKA 3GTLB 1LO5D 4L6TB 2IT1A 5E7NA 2E2DC 2L0CA 1IL8A 2H1EA 2RCFA 2EY2A 4C3IG 1JMCA 4RFBA 3S16H 4PNYA 2OWOA 1SE8A 1SLJA 3S1RH 4MN3A 2R6GA 1EYAA 5M5YB 2Z1CA 4EQNA 3J7AF 1X3FA 1PTOH 1JWMD 4IUUA 1YBYA 2J4XA 2JA7G 1R9TH 2NN6G 1Y8NB 4X62L 3GTGH 4DPGA 3OMCA 4KK7A 1SR3A 3BDLA 3RLOA 1KC8C 2FHTA 1HQRD 1STEA 4YHHQ 4OONA 1JC7A 2EY1A 4BXXH 2KCNA 3M3YH 2KCCA 3S16B 4CDFC 1CI3M 4JBJA 4DF7A 4EVOA 2A1AA 3PO3G 1VQJA 1AH9A 2L11A 3CKIB 4R9WA 5LMNL 3S1RB 4AQYL 2ZM6L 4BBSG 3QJYA 3HOXG 5C0XG 1PTOB 5C5LA 1NSNS 2D2CC 2Q2HA 5COYA 1I4PA 3NBHB 4F7XA 1BBXC 1KAWA 1R9TB 1JE5A 1GUTA 2UUBQ 1OXUA 1V1QA 2B2UA 2KOLA 4LF8L 4UP8A 5JJZA 2BDNA 4LF5L 1U4PA 1W6KA 4RG1A 2D62A 2B2YA 2QEXA 1VQOA 5KYIA 3CQZH 3M3YB 3GO5A 4A3CH 3N6RA 4R1JA 2HHHL 3K59A 4BY1G 2K5QA 3KK7A 4LUOA 5JJKA 1E24A 1RJTA 1VQ6A 4P2CB 1PLFA 2BE5D 3J7AV 3FVQA 2E2HH 3ICEA 3I70A 3I4MB 1VQ7A 2ATWA 3J81E 1GO3E 4S3SA 1NY4A 3D31A 3E5SA 4LFBL 4WJ3M 4A3IG 1STNA 1CKNB 1N34L 1YEZA 4GKJL 3U4ZA 1E3PA 1D6EC 2K14A 4K6DA 2C5CA 2KA7A 3BZDB 1EUJA 1GUOA 1O7IA 2A74C 1KL9A 1PH6A 4B3RQ 4P74A 2JSOA 1OO9B 1RTOA 5JJIA 4FXGC 2ZTCA 5M5XH 3WWVA 4EGVA 1FNVA 2AUKA 3NHHA 5K5PA 2OTLA 2PZTA 3D0FA 1VQCA 4EQOA 2LXJA 5DNFA 1F2YA 4QB4A 1N32L 2E2HB 2EJFC 5J22A 1HNXL 1CK1A 4OO1G 1NMFA 4CBVA 5H1SE 1VMPA 2B2TA 2BDOA 4RHSA 1TS4A 2F0DA 1K3BC 4UDUC 4HJ9A 4RGOS 3W5OA 3MWYW 2VB3X 2YTVA 3OPOA 1BF4A 3H15A 3KLRA 2RKSA 3CPFA 4JI5L 5JVH3 4G7HC 2B63G 3P75A 5CYUA 3AB9A 1V1PA 4N8X1 5C44G 3O13A 2I0QA 3VYTA 2A69D 3NUCA 1CT1D 2B8GA 1VQEA 1BXTA 2LY7A 4HJ7A 1R4PB 5LMUL 1L1OB 3MXNA 4WJ4A 3SEBA 1I94Q 2Z4HA 2VW9A 1ESFA 2PQAA 5LL6X 2UUCL 3S14H 3OTOL 1E2VA 2A19A 1TS2A 2MQHA 5E4XA 4A93H 1SYGA 4HIKA 3QG1A 5E3FA 1XNQQ 4LF4L 3G4SA 1S3OA 3R3OA 1QG7A 5FLMG 2F0VA 1YJNA 4QL5A 1I50H 1HNWQ 3D6WA 3V05A 1EYCA 1PXUA 1V9PA 1C48A 4P73A 3M7NA 3A8JE 5IIFA 3ER0A 4RAUC 1YZ6A 4DN4M 1EZ8A 2Y0SE 2F0UA 1HR0Q 2KVMA 5FJ8G 1J5EQ 4KV6A 4A3GH 2NUCA 1N8RC 5IP9H 2HQEA 5LHY1 3S14B 3BDOA 5AJ3L 5DEHA 3HOVH 4A93B 3WDNA 1EU3A 4PZ8A 2E8GA 4DV6Q 1J8IA 2E75C 4JI3Q 3PIP3 4U68A 2LSSA 3EROA 1TWHH 3BJUA 3KBXA 3NEMA 1I50B 4Y52H 2EYHA 3R93A 3HOUG 1VQNA 4A3LG 1WVLA 3FEWX 4TKOB 4JI1L 4OWXB 5ELFA 3UDIA 3A8KE 2KECA 3LX0A 3V2TA 4B3ML 3NXWA 3F1ZA 4LMQD 2UUAQ 3RN2A 5I2XA 4A3GB 1NNXA 3KDFB 1VDZA 1XX8A 2F0GA 3CPWA 4RHRA 1AP0A 3UI2A 2JP1A 3HOVB 1JCKB 2PNHA 4CDCC 2K5DA 5DLQE 3D6CA 4NPSA 1SYCA 2K52A 4OWWB 1S5ED 2B2UC 4AYBB 1YVCA 1TWHB 1U0LA 2JA6B 4DR4L 1MHWC 3CC7A 5JJLA 3NENA 2K50A 4EQ5A 5E1FA 2B39A 3NQIA 1SE4A 2VZAA 3HS0C 3DM3A 1JR0D 2F0QA 3SK4A 4R8NA 3JAMc 2JJQA 4K0KQ 1BCPC 4RKBA 3PUVA 4IURA 1BOSA 1EEID 1ENFA 4LWCA 1FJGQ 1F2MA 2KQ3A 1IYVA 2NVQH 4IUPA 1WCMG 5ELBA 1H9JA 2RDFA 3SK5A 5IODA 1PTOF 4BY7B 3W3AA 3TS2A 1R4QB 1RTNA 3DXJC 3BZKA 3ZYYX 1YNNC 2IW3A 3SK6A 1L0XB 3D4DA 4DGZA 1WCMH 2L9HA 3P20A 1STBA 3FRPB 5ELDA 2G9HD 4KMUC 1Q1EA 3E6ZX 1LACA 2QGQA 2HCCA 2JA5H 2JQOA 5CV7A 4POGA 1HA6A 4AH6A 2ZXRA 5FK9C 1P16A 4GNXA 2D5DA 1SMYC 3C1FA 3M4QA 1TWCH 1EWHA 2Z6BA 2XTIA 2DJFC 1X32A 1XPUA 4DKAC 1Y8OB 4KKSA 2K32A
chains in the Genus database with same CATH topology
3OOCA 3K6OA 4KJOA 1CA6A 2R3ZA 1WD0A 4L63B 2JA5B 1Q90A 1VCIA 2Y0SB 1TWCB 2XSCA 1O78A 1XWEA 3Q6SA 4C3HG 1V43A 2EYLA 4BWGB 1PMRA 1EYDA 2B8FA 3RD4A 5C3WA 3NTIA 2B2WC 1B53A 5ISRA 1MSGA 3L3OC 5AFWA 3PO2B 3HZXA 4A3MB 1LTRD 1TWGB 3VR4A 1EFID 1UNSA 3TP5A 4OIJA 2EVBA 2JA8B 2O4XA 1JOQA 2OEOA 4NP5A 4WORA 3IFTA 3OWFA 2F0KA 1FNUA 1T5XD 5JAVA 2EYFA 2IX1A 5CV5A 4X3TA 1WTOA 2AQ3B 1TS3A 1EWCA 5NUCA 3VYRA 4L8JA 1LTTD 3L7ZC 4HEDA 1PTOC 1Y8PB 2FMCA 2K04A 1SNQA 3T4AC 2O5IC 1LTBD 2QF7A 3JAML 1E0BA 3TN2A 1LT6D 1SNDA 1MD2D 2KEDA 4DFAA 1Q1BA 2SNSA 1DOMA 2I46A 1RCVD 1B1ZA 1MI2A 4BA1I 4O42A 1SE2A 4PMBA 4KY6A 5C5MA 1BCPD 1M4VA 4A3JB 1QOHA 3RZDB 1B2TA 4OGQC 2JXMB 2BA1A 2WKCA 2M2LA 5KYLA 4K6LA 1GUSA 5IGDA 1ML0D 1YNND 1W6JA 2J7ZA 2F0SA 5J1ZA 1CA5A 2F0MA 2SNMA 3URYA 1ENAA 5T1IA 2PO4A 1HRJA 1A3UA 3DM1A 1SMYD 1O7YA 5CBEE 3IKJA 3L9AX 3GP7A 4QIWB 2RSNA 3OWEB 2WV6D 3BDCA 2F0OA 1CQFA 1PFNA 3VR5A 2OXPA 3TMEA 2DN8A 2M9VA 4IALA 2EYJA 1H9SA 3Q24A 1SBBB 3MC0B 1D5ZC 2MJ8A 4UAIA 1TS5A 1F9SA 1JWUD 4U673 4JBWA 1TKWB 2Q8RE 4TSSA 1UEAB 3S1QB 1F2LA 1U9RA 1Q3LA 5IT9L 4RGNA 4C1NI 2KUMA 2VB2X 1G91A 1Y69U 3K58A 3GTQB 1ONLA 2NTSA 3NWTA 2EXZA 2Z8LA 2PW5A 4M8AA 3H0GB 4XTCS 2F0LA 1NR2A 1X3PA 3KF8A 4K5VA 2CQAA 4XQNA 5BN3A 3BS1A 3DHQA 3U9SA 2O5JC 1IYUA 2VXWA 2RDGA 4CKBA 3SE0A 1A15A 4K2LA 4C3JB 1GHJA 4N9TA 1RF2D 2A68C 1Z6HA 4FF3A 3EQLC 2KJXA 1FR3A 5LL6S 2IX3A 2GA4B 3I8ZA 1C8CA 1EEFD 5E4WC 1JE4A 3T53B 4RH6A 3RLFA 2ICIA 1PTOD 2FFKB 1EY4A 4GZYC 2I07B 4XDXA 1SJED 1WD1A 2N88A 5K36H 4BBRB 2PMZB 5M5WB 2WP8J 5M3FB 1LTID 5C4ZA 1DOLA 2R93B 1EQVA 5F2DA 3K7AB 3ERQA 4HSPA 4IUQA 1LT4D 1QJOA 1BDOA 1WTVA 2SEBD 3NQTA 4H44C 5JPMC 2L4NA 4ZUJA 3P1HA 2QILA 4K8IA 1CTMA 2M00A 5KIXA 2F0JA 4E6IA 2WB1B 1AN8A 4HR7B 2LFNA 2JYOA 4ABNA 1DYQA 1KTKA 1SYFA 2PPBC 4X3UA 3Q22A 3H94A 2HUGA 1Y1WB 1I4HA 5FLXL 2MHVA 4KY7A 4QF4A 4N9PA 1BR9A 5G3LD 3A55A 3J80L 3I73A 3P7JA 2F0NA 1D2BA 1ZKOA 3TZUA 1HQMC 3DEPA 1EY7A 1AZPA 4DK0A 3A54A 4ID6A 4DAPA 3Q23A 1S4ZA 5CMDA 2NVYB 5C4HA 1YNJC 1UUPA 3S17B 3H91A 1SFOB 3C2PA 3MHBA 2WINB 2E2JB 2CW0C 4FF4A 5EKIA 4FF1A 3HRZC 2WAQB 1D5XC 5M9OA 4CGYB 3G7LA 1KLGD 1G2SA 3FPUB 4BY1B 3C3LA 4ZAIA 1ICWA 3CRLC 4FNFA 1DZ1A 3E0JA 4HN7A 4NW2A 1HFGA 3NE5B 4DXGA 2PW7A 1EIGA 2EJMA 2HDLA 5A2QL 2BOSA 2HDMA 4C2MB 3K5OA 1II3A 4HCEA 5FOBB 1BUVT 3GTMB 4BS9A 2B2WA 4ZK9B 1MGSA 3R2IA 1LTSD 4QUFA 1VF5C 3I4NB 4IUVA 2NVXB 3T56B 2RBMA 3HGBA 2DY8A 3FKIB 4FO2A 3KBGA 4RGTA 4B9XA 3TP6A 1NCVA 1STAA 1O7LA 2MPMA 3VR6A 1SSOA 1JB3A 3J7YW 5BN4A 3PMFA 1U4RA 2L1BA 4HSVA 4HCSA 1KLUD 5C44B 1WTWA 1SYEA 3NBHA 2NBFA 3J81L 2R7ZB 1WTQA 3DMUA 1KAAA 1L0YB 5BN5A 5IGGA 1S5DD 1O80A 3BYYB 3GTPB 2F0TA 2QDBA 3G6JB 2V4DA 4LJZC 5KNBA 4NMZA 1HHVA 1LTAD 4XQQA 1HCZA 1JQYD 1V8QA 1I4RA 5I4DA 2G9DA 3S9WA 4ME5A 2LKVA 1S5FD 5HGTA 5JVG3 2F4IA 1PZID 1QE6A 4CJ2C 3OIPA 3LNNA 2XVSA 3FMCA 2R92B 4C56C 2CHBD 2H4OA 4X3SA 5C6AA 1YNJD 1ILQA 1PYWD 4KHVA 3JAME 3GV6A 4RGMA 1PFBA 4F88A 5CBAE 2CW0D 5M3MB 2IPKD 2AWNA 3OHXC 3KLSX 1WTPA 4WFN3 1EY9A 5TSSA 2F1MA 1GUWA 1D1IA 4A3BB 3S2DB 1E2ZA 2FINB 1G291 2F03A 2QEJC 1LABA 3ND8A 5EKLA 5C3XA 3SK8A 4FXKC 3BYTB 3T16A 2FMMA 4JK1C 4ULLA 5CORA 2DY7A 3MTSA 5CV4A 1TQOA 1TR5A 3R2TA 5EJWA 2ZXPA 5EGTA 1RD9D 3ITPA 1FNWA 2WIIB 5CV9A 4K5WA 1GJXA 3K0YA 2A6EC 1DCZA 1NUCA 3CHBD 3HG9A 5D3IB 2RA4A 4H0LC 4XT1B 1WTXA 1BO0A 5CV8A 2PZUA 5CR3A 4XIGS 4A3FB 4MIUA 2TSSA 2VUMB 1JORA 1FD7D 5EBDA 2MUYA 2N55A 4R8IA 2IWHA 2SOBA 5CGKA 1UAPA 2A6HC 1EIHA 2A73B 5IT9E 4OO1I 3FPPA 3LWEA 1PZKD 4A3DB 3D3RA 4K2KA 1HTLD 1HTPA 3M4OB 4KD4A 2O2LD 2NZ1D 3NPPA 3GTKB 3RMHA 4Q0FA 5I2YA 1TY2A 1F77A 3HOYB 3EA6A 3SVMA 4F87A 1U4MA 3LWUA 3MVVA 1JWSD 1NAPA 1H9RA 4DXFA 3BG3A 4FXDA 2RSOA 3TSSA 2K6AA 3MAQA 5EBCA 5T1GA 1CHQD 4ZQ3A 1HUMA 1LLRD 2K28A 1F9QA 4J6HA 3OSOA 1I4QA 2YYZA 3PIO3 4X3KA 5JEAH 4V190 1MSHA 3EVQA 3A56A 3GTOB 1SEBD 1J9OA 1OXVA 2SDFA 4IFDI 2HCIA 1F2ZA 3NTHA 1RHPA 2A5HA 2PNRC 3N52A 4HAEA 5C4XB 2KHSA 2XRSD 4KI0A 1BCPB 1S5BD 4IUTA 1PRTB 4C3JG 5IGEA 3T51B 1TWAB 4YIJA 4WJWA 4Y7NB 3DWPA 3K5LA 3OW7A 4IFDJ 2K7VA 1DJRD 3D4WA 3QO2A 1GUGA 4PQXA 4IQZA 2EY5A 1TU2B 2A6ED 4FVMA 3K5MA 5J39A 2RDHA 4G4KA 3IAYA 2F0WA 4K14A 1M8AA 1NR4A 2X6LA 5C3EB 1I4XA 1EY5A 3OIQA 5JPNC 3KUPA 4A3KB 1U4LA 1LT3D 1HXYD 2B2VC 1V1PB 3PUWA 4Z9CB 3QIAA 4KN4C 2A6HD 3SHLA 3GQBA 1JOKA 1TVXA 4HTHA 1SNMA 1EU4A 2L55A 2NTTA 1OXSC 4CJ0B 5K36G 3HKZB 5DM63 4DK1A 3PUYA 5I6WA 2WACA 2QCPX 1TY0A 3SXHA 2ID0A 2IX0A 4K8JA 1T5EA 1STHA 1ILPA 1SE3A 3MXUA 3K5NA 1OXXK 2LMCB 2E74C 4DNRB 3AMUA 1K8MA 1ZEQX 3A7AB 5A2QE 3QOJA 5EKKA 3PUXA 1A2TA 2AQ1B 3MXPA 4XYOA 4XT3B 3OMGA 1QCBD 3GTJB 2K05A 2NN6H 1ENCA 4FF2A 1STYA 3GV3A 3DWQA 1FGBD 1A6XA 4C3IB 2MGSA 5D3DA 1LV9A 3S2HB 3HEJA 3R8BA 1DXMA 4G57A 3GTGB 1VMCA 5C0XH 5KNDA 2YU9B 4KD3A 4DU9A 3I90A 2JA7B 2OF1A 5DAUA 5ELEA 2C9OA 3D4RA 2MP1A 3I3CA 1EL0A 1E2WA 4IZ8A 5A35A 4RA8A 1SAPA 3DEOA 4MHEA 3PO3B 5I9PA 1X3QA 5C4JB 4BBSB 3HOXB 3X3NA 2XIWA 3RUZA 1I3QB 4DAVA 3CQZB 3VYSA 4ILWA 4H7BA 3TP7A 3VR3A 4J1MA 2K5WA 2AWOA 4HMJA 3WOFA 1ZYRC 2E76C 2F0FA 4PMWA 3IFDA 4KJNA 4BA2I 1I6VC 4KHZA 3QWNA 2ENBA 2X69A 1BCPF 2XWBB 1PRTF 1AFPA 1HPCA 4F8MA 4RCOA 2L5TA 4OO1H 2A68D 4XQJA 4V0BA 4A3IB 3SDZA 2E2IB 1ZXTA 1G2TA 5CV6A 4ZUIA 1A3VA 1G8ZD 2XNAC 5M5XB 4G7ZC 5HURA 1OXTA 1IW7C 2F0IA 4QCLA 1CZGA 1DM0B 1SNOA 1B9MA 5EPJA 5KNCA 1SYDA 3M85A 5JEAJ 4IUNA 4WRDA 1GHKA 1F9RA 5ELCA 3DUZA 3Q0AA 1QWYA 2JEAI 1EZ6A 2B63B 3BVZA 2KEEA 5FO7B 1EOTA 4LAAA 4KKUA 1KDCA 3RZOB 3IL8A 3WOEA 1ET9A 3C1EA 4RKLA 5EPKA 1TIID 3C46A 4OL7A 2ICEC 5I6YA 1SNCA 5IGFA 2PQEA 4IFDG 1F9PA 4OHJA 3NWSA 3NK9A 2LS01 1HFNA 1XTCD 1QNUA 1B44D 2AUJD 4I7ZC 1D1KA 4CHTB 4IFDH 2XRQD 4G7OC 2NWGA 3H6MA 2PYKA 3M7GA 1K83B 2L12A 1XYIA 1AW7A 2WKDA 5IGCA 4KTAA 5DM73 1QB5D 1SNPA 1WTRA 5KGUA 3TZDA 1PZJD 4IN3A 2B2YC 3MA2B 3VR2A 3NP8A 4DA2A 3S15B 3TDQA 1I6HB 1CM9A 2EY6A 3PUZA 3HOUB 1PRTC 4B9WA 1KABA 1B50A 1HUNA 2EE1A 1XXGA 1H9KA 3H3VC 4XYQA 1AZQA 1KNAA 2FJ2A 3K57A 1EY6A 1PDQA 1CHPD 3AU7A 2NN6I 3KLSA 1K8OA 3A7LA 3MFGA 1BQQT 1ZYRD 3U9OA 1G6ZA 3F2UA 2IJ0A 4M1UB 2IL8A 2NVQB 4TQUS 4ZRZA 3EJIA 1SDFA 1IKMA 1CQVA 1FYCA 4H13C 4ZYSA 2B2TC 1WCMB 3SR1A 5C0XI 1JOOA 5I9OA 4C1NK 4RCNA 2K33A 1RDPD 3MXGA 4I65A 1CFMA 2DNEA 2DNCA 3QB3A 4DAYA 1KDBA 2EYOA 4NDXA 2F3VA 1Q12A 3I4LA 1I4GA 1H9SB 2XWJB 1IW7D 3NBIA 5KRUA 5D65A 2EYMA 1Z47A 2RVLA 2BCOA 1KNEA 1DOKA 3TBIB 2RQXA 5C0XJ 1H9MA 2K1BA 1TT2A 5G3LF 2NB0A 3VA7A 1DONA 1GOZA 5FKAC 4A3EB 1B3AA 4ZKCB 3X3MA 2F3WA 2Q8TA 3PV0A 2B2VA 1DD2A 3M4YA 4C3HB 2TMPA 2XN9C 4HMIA 1ET6A 2PCFB 1A2UA 2EZVA 2PZWA 4TRDA 3TP8A 5CC4A 1A3TA 3BVMA 2ZT9C 3MFYA 5JOBA 3VYUA 1SJHD 1V1OA 1Y1VB 4FYDA 1Q8IA 2F0EA 2ZXOA 1RODA 1Z7TA 1EY0A 3MEHA 1RKNA 1KDAA 1B9NA 4CKCA 4FP5D 3VA5A 1ESRA 1PRTD 3HOWB 1JICA 4O1NA 2EJGC 1HA5A 3CU7A 3NTKA 5JEAG 1SYBA 2JEBI 4ZKBB 3HOZB 1AEXA 1IHZA 1LTGD 2K01A 2EOTA 3HP3A 2J0TD 3S1NB 4KY5A 2QKIC 2R61A 4CJ1B 3W2DA 3I91A 1MBYA 4OIKA 2CVRA 3BVGA 2JE6I 3FDTA 5IOCA 2X6GA 2BE5C 4PMCA 3A8IE 1C4QA 1GUNA 2BA0A 2Q8IB 2D9UA 4NKLA 3V96A 3T13A 4ZLTF 1O7ZA 5KEEA 2EDGA 1VF7A 1GXDC 3GD7A 1BNZA 1TWFB 5EPLA 3NSWA 1CZWA 4RWSC 4XXEA 2OT2A 4EQPA 4J8QA 2K03A 5EQ0A 1LT5D 4LK1C 3DWAA 3ND9A 4KN7C 4ODGA 5FLXE 2EYPA 1QILA 1STGA 5FO9B 3J80E 1D5MC 3CRKC 4KKTA 4K5XA 2EPBA 3H09A 2NYZD 5FO8B 5D14A 3D8GA 4CKEA 3ONAB 2F0HA 1S5CD 1B4OA 3QOLA 2A69C 3S1MB 2AQ2B 4PV1C 4DNTB 2VNUD 2NVTB 5IGBA 4QUCA 1PFMA 4B08A 3I72A 3MZ5A 2Z4IA 2F0PA 1SXTA 4QMGA 4Q5VA 1EQTA 1EY8A 3EFXD 1IKLA 1QNKA 3GTLB 1LO5D 4L6TB 2IT1A 2E2DC 2L0CA 1IL8A 2H1EA 2EY2A 4C3IG 4RFBA 4PNYA 4MN3A 2R6GA 1EYAA 5M5YB 2Z1CA 4EQNA 3J7AF 1PTOH 1JWMD 4IUUA 2J4XA 2NN6G 1Y8NB 3OMCA 4KK7A 3BDLA 2FHTA 1HQRD 1STEA 1JC7A 2EY1A 2KCNA 2KCCA 3S16B 4DF7A 1CI3M 4EVOA 2L11A 3CKIB 4R9WA 3S1RB 3QJYA 5C0XG 1PTOB 5C5LA 1NSNS 2D2CC 5COYA 1I4PA 4F7XA 1BBXC 1R9TB 1GUTA 1OXUA 2B2UA 2KOLA 5JJZA 2BDNA 1U4PA 1W6KA 2D62A 2B2YA 5KYIA 3M3YB 3GO5A 3N6RA 3K59A 2K5QA 3KK7A 1RJTA 4P2CB 1PLFA 2BE5D 3J7AV 3FVQA 3I4MB 3I70A 3J81E 4S3SA 3D31A 3E5SA 1STNA 1D6EC 4K6DA 2C5CA 2KA7A 3BZDB 1GUOA 2A74C 2JSOA 1OO9B 1RTOA 4FXGC 4EGVA 1FNVA 2AUKA 3NHHA 5K5PA 2PZTA 4EQOA 5DNFA 1F2YA 4QB4A 2E2HB 2EJFC 5J22A 1CK1A 4OO1G 4CBVA 1VMPA 2B2TA 2BDOA 4RHSA 1TS4A 2F0DA 4UDUC 4RGOS 3MWYW 2VB3X 3OPOA 1BF4A 3KLRA 2RKSA 5JVH3 4G7HC 3P75A 5CYUA 3AB9A 1V1PA 3O13A 3VYTA 2A69D 3NUCA 1CT1D 2B8GA 1BXTA 2LY7A 1R4PB 3MXNA 3SEBA 2Z4HA 1ESFA 5LL6X 1E2VA 1TS2A 5E4XA 1SYGA 3QG1A 5E3FA 3R3OA 1QG7A 2F0VA 3D6WA 3V05A 1EYCA 1PXUA 1C48A 3M7NA 3A8JE 5IIFA 4RAUC 4DN4M 1EZ8A 2F0UA 2KVMA 4KV6A 2NUCA 2HQEA 5LHY1 3S14B 3BDOA 5DEHA 4A93B 3WDNA 1EU3A 1J8IA 2E75C 3PIP3 4U68A 3EROA 3KBXA 1I50B 2EYHA 3R93A 1WVLA 3FEWX 4TKOB 5ELFA 3A8KE 2KECA 3LX0A 3V2TA 3NXWA 4LMQD 5I2XA 4A3GB 1VDZA 1XX8A 2F0GA 4RHRA 1AP0A 3UI2A 2JP1A 3HOVB 1JCKB 2K5DA 3D6CA 1SYCA 1S5ED 2B2UC 4AYBB 1TWHB 2JA6B 5E1FA 2B39A 3NQIA 1SE4A 3HS0C 1JR0D 2F0QA 3SK4A 4R8NA 1BCPC 4RKBA 3PUVA 4IURA 1BOSA 1EEID 1ENFA 1F2MA 2KQ3A 1IYVA 4IUPA 5ELBA 1H9JA 2RDFA 3SK5A 5IODA 1PTOF 4BY7B 3W3AA 1R4QB 1RTNA 3DXJC 3ZYYX 1YNNC 2IW3A 3SK6A 1L0XB 3D4DA 4DGZA 2L9HA 3P20A 1STBA 3FRPB 5ELDA 2G9HD 4KMUC 1Q1EA 3E6ZX 1LACA 2HCCA 5CV7A 1HA6A 2ZXRA 5FK9C 2D5DA 1SMYC 3C1FA 1EWHA 1X32A 1Y8OB 4KKSA 2K32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLF A;  2KED A;  2NWG A;  2L4N A;  1RHP A;  5D65 A;  4HAE A;  3N52 A;  4QUC A;  4ZKB B;  1PFM A;  2RVL A;  1CA6 A;  1KNE A;  2B2W A;  3IFD A;  1DOK A;  2R3Z A;  4ZK9 B;  1WD0 A;  1ILP A;  2L12 A;  1MGS A;  1J8I A;  1XYI A;  1DOM A;  4X3S A;  2N55 A;  2X69 A;  4R8I A;  2K01 A;  2EOT A;  3HP3 A;  4U68 A;  4QUF A;  3KBX A;  1MI2 A;  4IUT A;  1NR2 A;  2K1B A;  4IUV A;  4O42 A;  1X3P A;  2JYO A;  3R93 A;  1WTR A;  1EQT A;  1ILQ A;  1EIH A;  1WVL A;  1IKL A;  4X3U A;  3GV6 A;  3TZD A;  1QNK A;  2B2Y C;  1PFB A;  2DY8 A;  2HUG A;  1RTO A;  3LWE A;  4XT3 B;  1B2T A;  2KEC A;  1ZXT A;  1DON A;  5CBA E;  2VXW A;  1G2T A;  1IL8 A;  2H1E A;  4CJ1 B;  3Q6S A;  4LMQ D;  2M2L A;  1A15 A;  1CM9 A;  2K05 A;  3I91 A;  1WTP A;  1B3A A;  3P7J A;  4OIK A;  1XX8 A;  1NCV A;  2CVR A;  2MPM A;  4ZKC B;  5DNF A;  1SSO A;  1AP0 A;  4MN3 A;  3FDT A;  1ML0 D;  2NZ1 D;  2JP1 A;  3GV3 A;  3UI2 A;  1B50 A;  1HUN A;  1GUW A;  2J7Z A;  3I8Z A;  2Q8T A;  1C8C A;  2X6G A;  1VMP A;  2B2T A;  2B2V A;  3DEP A;  4IUU A;  3QO2 A;  2EE1 A;  1U4R A;  2B2U C;  1JE4 A;  2L1B A;  2MGS A;  5E4W C;  3MWY W;  4HSV A;  1AZP A;  1CA5 A;  4HCS A;  2B2W C;  1LV9 A;  5EPJ A;  1BF4 A;  5T1I A;  1B53 A;  2FIN B;  3SVM A;  1AZQ A;  2D9U A;  1WTW A;  1S4Z A;  1KNA A;  1MSG A;  5CMD A;  2FJ2 A;  5AFW A;  1HRJ A;  4ZLT F;  1O7Z A;  1U4M A;  1VMC A;  1PDQ A;  3DM1 A;  2FFK B;  1F9R A;  2FHT A;  1O7Y A;  1WTQ A;  5CBE E;  3I90 A;  1NAP A;  3H91 A;  4IUR A;  1M8A A;  1BNZ A;  2RSO A;  1NR4 A;  4OIJ A;  5EPL A;  2X6L A;  2FMM A;  2L11 A;  4XDX A;  4R9W A;  4IUP A;  1G6Z A;  3F2U A;  5EKI A;  2RSN A;  4RWS C;  2IL8 A;  2MP1 A;  5COR A;  3I3C A;  1EL0 A;  1O80 A;  2KEE A;  5T1G A;  2DY7 A;  1WD1 A;  1RTN A;  1SDF A;  1EOT A;  1HUM A;  1PFN A;  3KUP A;  3MTS A;  2N88 A;  1SAP A;  3DEO A;  2K03 A;  4MHE A;  2K28 A;  4RA8 A;  1U4L A;  5EQ0 A;  1BBX C;  5EJW A;  3IL8 A;  1F9Q A;  2L9H A;  4X3T A;  5E4X A;  2B2T C;  2B2U A;  2B2V C;  1X3Q A;  2KOL A;  3G7L A;  5EPK A;  1WTO A;  1IKM A;  2HCC A;  1G2S A;  2BDN A;  3FPU B;  1ROD A;  1U4P A;  5JJZ A;  1HHV A;  2MJ8 A;  1QG7 A;  1TVX A;  4UAI A;  2XIW A;  4ZAI A;  1ICW A;  2B2Y A;  1DOL A;  2EPB A;  1DZ1 A;  1HA6 A;  2NYZ D;  4X3K A;  1F9S A;  4HED A;  3D6W A;  4NW2 A;  1F9P A;  1HFG A;  2Q8R E;  5D14 A;  4CJ0 B;  2K04 A;  1MSH A;  4IUQ A;  1EIG A;  3ONA B;  2RA4 A;  1ESR A;  2HDL A;  4RAU C;  5COY A;  1F2L A;  4DN4 M;  1B4O A;  1HFN A;  2HDM A;  1Q3L A;  1QE6 A;  1WTV A;  1E0B A;  1X32 A;  4XT1 B;  4CJ2 C;  1WTX A;  1J9O A;  2SDF A;  3TN2 A;  1BO0 A;  1RJT A;  2KVM A;  1JIC A;  2KUM A;  2HCI A;  1G91 A; 
#chains in the Genus database with same CATH topology
 2AKW B;  3KYH C;  4DUY Q;  3OOC A;  3K6O A;  1E1T A;  4KJO A;  1CA6 A;  4TVA B;  2R3Z A;  1WD0 A;  1OTC A;  4L63 B;  2JA5 B;  1Q90 A;  1ASY A;  2BH2 A;  1VCI A;  4A3F G;  1L2F A;  2Y0S B;  4A3E G;  2UXB Q;  3PO2 H;  1TWC B;  2OQ0 A;  2XSC A;  4A3M H;  4DR2 L;  1TWG H;  3VDY A;  1O78 A;  1XWE A;  3Q6S A;  4B3T Q;  1Z9F A;  2JA8 H;  4C3H G;  4NXM Q;  1V43 A;  4ME3 A;  2EYL A;  4BWG B;  1PMR A;  4FDB A;  2H5X A;  2I5L X;  1EYD A;  1H95 A;  2B8F A;  3RD4 A;  4C3H H;  5C3W A;  3NTI A;  4JV5 Q;  4DV3 L;  2B2W C;  1B53 A;  5ISR A;  2EQS A;  4APV A;  1N36 Q;  1MSG A;  3L3O C;  5AFW A;  4JI8 Q;  3PO2 B;  3HZX A;  4A3M B;  1LTR D;  1TWG B;  3VR4 A;  1YHQ A;  3ULJ A;  1IBM L;  5IT9 c;  1EFI D;  1UNS A;  3TP5 A;  4OIJ A;  2EVB A;  1CKO A;  2JA8 B;  5L37 A;  2O4X A;  1JOQ A;  1Y1V G;  4DR3 L;  2OQK A;  2OEO A;  4NP5 A;  4WOR A;  1TXY A;  3IFT A;  3OWF A;  2CFM A;  3F2D A;  2F0K A;  1FNU A;  1T5X D;  4DR7 Q;  5JAV A;  2EYF A;  1Y1V H;  2IX1 A;  1G6P A;  1K0S A;  2DUD A;  4YCW A;  5CV5 A;  4X3T A;  2MFI A;  3EIV A;  4DV5 Q;  3LGJ A;  1WTO A;  2AQ3 B;  2E5L L;  1TS3 A;  1EWC A;  3HOW G;  5NUC A;  4L8J A;  3VYR A;  1LTT D;  3L7Z C;  4HED A;  1PTO C;  1PH1 A;  2I5M X;  1Y8P B;  5ELN A;  3STB C;  2FMC A;  4OX9 Q;  2K04 A;  1SNQ A;  3T4A C;  4A3J H;  2O5I C;  3HOZ G;  1LTB D;  3RZD H;  2QF7 A;  3JAM L;  4JOI C;  1E0B A;  3TN2 A;  1LT6 D;  1SND A;  1Q81 C;  1MD2 D;  1YJW A;  2KED A;  4YCU A;  4DFA A;  1Q1B A;  3OW2 A;  2SNS A;  1DOM A;  3F2C A;  2I46 A;  1A62 A;  3S1N H;  1RCV D;  2UXC L;  4X66 L;  1B1Z A;  1MI2 A;  4JVZ A;  1AE3 A;  4BA1 I;  1XPO A;  4O42 A;  5C4X G;  1SE2 A;  4PMB A;  4KY6 A;  5C5M A;  3U4V A;  1BCP D;  1M4V A;  1D8L A;  4A3J B;  1QOH A;  5BR8 L;  3RZD B;  4DV2 Q;  1B2T A;  4OGQ C;  2JXM B;  1PYB A;  2BA1 A;  2WKC A;  2M2L A;  5KYL A;  4L5T A;  3EN2 A;  4R4T A;  4K6L A;  1ASZ A;  1GUS A;  5IGD A;  3AEV A;  1ML0 D;  1YNN D;  5IYD G;  1W6J A;  2J7Z A;  2F0S A;  4NXN Q;  2KHJ A;  5J1Z A;  4HIO A;  1CA5 A;  2F0M A;  2SNM A;  3URY A;  1ENA A;  5T1I A;  2PO4 A;  3U58 A;  2LXK A;  1XNR Q;  1VQF A;  3UE1 A;  1HRJ A;  1A3U A;  3DM1 A;  2Q2U A;  1SMY D;  5EAY A;  1O7Y A;  4HJ8 A;  5IY0 A;  5CBE E;  3IKJ A;  3L9A X;  3GP7 A;  4QIW B;  3S1Q H;  2RSN A;  4GOP B;  3OWE B;  2WV6 D;  3BDC A;  2F0O A;  1L0W A;  5IYC G;  1CQF A;  1A0I A;  1PFN A;  3VR5 A;  2OXP A;  2KCM A;  3TME A;  2DN8 A;  2M9V A;  3GTQ H;  4IAL A;  1NTG A;  2EYJ A;  3TRE A;  1H9S A;  3Q24 A;  1GD7 A;  1SBB B;  3MC0 B;  3W1B A;  3KF6 B;  1D5Z C;  2MJ8 A;  3H0G H;  4UAI A;  1TS5 A;  1L1O C;  4LFA Q;  1F9S A;  1JWU D;  4U67 3;  4JBW A;  1TKW B;  5FLX c;  2Q8R E;  2ZJP A;  4TSS A;  1UEA B;  3S1Q B;  3I4O A;  2WB1 E;  4DV1 Q;  1F2L A;  1U9R A;  4GS3 A;  1Q3L A;  5IT9 L;  4RGN A;  2D0P A;  4C1N I;  2KUM A;  2VB2 X;  4C3J H;  1G91 A;  4OEL B;  1P8L A;  4DR1 Q;  1Y69 U;  3K58 A;  3GTQ B;  1ONL A;  2NTS A;  3NWT A;  2EXZ A;  2Z8L A;  2PW5 A;  3CME A;  4M8A A;  4YWK A;  4UY8 C;  3H0G B;  4JI6 Q;  4XTC S;  2F0L A;  3I56 A;  1NR2 A;  1X3P A;  3RN5 A;  1X56 A;  3KF8 A;  4K5V A;  2CQA A;  3T1H Q;  4XQN A;  5BN3 A;  3BS1 A;  3DHQ A;  3U9S A;  3I7F A;  2O5J C;  1IYU A;  5GAH C;  2VXW A;  2RDG A;  1VQ8 A;  1PH2 A;  4CKB A;  3SE0 A;  1HNZ L;  1A15 A;  2MO1 A;  3KLW A;  4K2L A;  4C3J B;  1GHJ A;  1YIT A;  4N9T A;  1RF2 D;  4GLX A;  1IBL Q;  5M5Y H;  2A68 C;  1Z6H A;  4FF3 A;  3EQL C;  2KJX A;  1FR3 A;  5LL6 S;  2IX3 A;  2GA4 B;  2UU9 L;  3I8Z A;  1C8C A;  3IRB A;  1EEF D;  1WJJ A;  1PYS B;  5E4W C;  1JE4 A;  1ICF B;  3T53 B;  4RH6 A;  2KEN A;  3RLF A;  4BBR H;  3S24 A;  2ICI A;  1FGU A;  2ALY B;  1PTO D;  2WAQ E;  1PFS A;  3STB D;  1YHA A;  1C7Y A;  2FFK B;  1N33 Q;  2R93 H;  1EY4 A;  1UE6 A;  4GZY C;  3K7A H;  2I07 B;  4XDX A;  1SJE D;  1WTH A;  1XMO Q;  1X3G A;  5IYB H;  1WD1 A;  1VQ5 A;  2NZH A;  2N88 A;  3L0O A;  4BXX G;  1T9H A;  5K36 H;  4BBR B;  2PMZ B;  4DV0 L;  4OWT B;  5M5W B;  4YHH L;  3CCE A;  2WP8 J;  5M3F B;  1LTI D;  4LW1 A;  5C4Z A;  1DOL A;  2R93 B;  1Q7Y C;  4POF A;  1EQV A;  5F2D A;  3K7A B;  3ERQ A;  4HSP A;  2CKZ B;  4IUQ A;  1LT4 D;  1QJO A;  3ULP A;  1BDO A;  1Y1W H;  1WTV A;  4X62 Q;  4LF6 Q;  1JB7 A;  2SEB D;  3K0X A;  2ZTE A;  4DV4 Q;  3NQT A;  4H44 C;  5JPM C;  2UUB L;  2BH8 A;  3I4M H;  1B3Q A;  2L4N A;  1G51 A;  3P1H A;  4ZUJ A;  3CC2 A;  2QIL A;  4A3C G;  4K8I A;  3JAM i;  1CTM A;  3UDX A;  2YTX A;  2M00 A;  5KIX A;  5LMN Q;  2F0J A;  4E6I A;  2WB1 B;  1AN8 A;  1HZC A;  4HR7 B;  3J81 c;  2LFN A;  4DK3 C;  2JYO A;  4ABN A;  1DYQ A;  3U50 C;  1KTK A;  1SYF A;  2PPB C;  4X3U A;  2NVY H;  3Q22 A;  3H94 A;  2HUG A;  1Y1W B;  1I4H A;  1VQD A;  5FLX L;  2MHV A;  4KY7 A;  4QF4 A;  4OEM B;  1S40 A;  4N9P A;  1SFO H;  4LF8 Q;  1BR9 A;  5G3L D;  3A55 A;  3J80 L;  2E2J H;  2K5V A;  3I73 A;  3P7J A;  1XMQ Q;  2HQL A;  1E22 A;  1C9O A;  2F0N A;  1D2B A;  1ZKO A;  3TZU A;  1HQM C;  4ALP A;  3DEP A;  1K9M C;  4JI2 Q;  1EY7 A;  1AZP A;  1YI2 A;  4DK0 A;  4B3R L;  3A54 A;  4ID6 A;  1SMX A;  4AYB E;  4J15 A;  4DAP A;  3Q23 A;  1S4Z A;  2GVA A;  5CMD A;  1K3R A;  2NVY B;  5C4H A;  1YNJ C;  1UUP A;  3S17 B;  4QGU A;  3UE0 A;  3H91 A;  1SFO B;  3C2P A;  3MHB A;  2WIN B;  2E2J B;  2CW0 C;  1NE3 A;  4FF4 A;  5EKI A;  4HID A;  1SN8 A;  4FF1 A;  2ES2 A;  4C2M H;  3HRZ C;  2WAQ B;  1D5X C;  5M9O A;  4GKK Q;  4YY3 Q;  4MTN A;  2Z9H A;  4CGY B;  3G7L A;  4JYA Q;  1KLG D;  1G2S A;  3FPU B;  4PZ6 A;  4BY1 B;  3C3L A;  4ZAI A;  4JBM A;  1ICW A;  3CRL C;  4FNF A;  1DZ1 A;  3E0J A;  1QVF A;  3I4N H;  4HN7 A;  4NW2 A;  3K7U C;  1YHB A;  2NVX H;  1HFG A;  2GN5 A;  3NE5 B;  4DXG A;  2PW7 A;  4JI4 Q;  1EIG A;  2EJM A;  2HDL A;  5A2Q L;  2A8V A;  4A93 G;  3FKI H;  2BOS A;  2HDM A;  1VQA A;  3DLL A;  4JI0 Q;  4C2M B;  3K5O A;  1II3 A;  4HCE A;  5FOB B;  4DNI A;  3H3V I;  1BUV T;  3GTM B;  4BS9 A;  2B2W A;  4ZK9 B;  4JW0 A;  3FP9 A;  1MGS A;  3R2I A;  1HNW L;  1LTS D;  4QUF A;  4DAY B;  1VF5 C;  3I4N B;  4IUV A;  4A3G G;  2NVX B;  1Q82 C;  3T56 B;  5IP9 G;  2RBM A;  1HR0 L;  3HGB A;  2DY8 A;  3HOV G;  4X65 L;  3FKI B;  3HKS A;  1MIU A;  1J5E L;  4FO2 A;  3ERS X;  5IWA Q;  4JI7 Q;  3KBG A;  4RGT A;  4B9X A;  3TP6 A;  1NCV A;  1STA A;  1O7L A;  2MPM A;  3VR6 A;  1SSO A;  4DV6 L;  1JJ2 A;  1JB3 A;  3J7Y W;  5BN4 A;  4JI3 L;  3PMF A;  3GTP H;  4N8F A;  2JA6 H;  1U4R A;  2L1B A;  4HSV A;  1IL2 A;  4HCS A;  1KLU D;  3PIO A;  5C44 B;  4CDD C;  1WTW A;  4R4Q A;  1A63 A;  2PI2 E;  1SYE A;  3NBH A;  2NBF A;  5AJ3 Q;  3J81 L;  2R7Z B;  1WTQ A;  3DMU A;  3PQI A;  4JOI A;  1KAA A;  1L0Y B;  5BN5 A;  5IGG A;  1VQB A;  1X6O A;  1BVS A;  4BY7 H;  1S5D D;  1O80 A;  3BYY B;  3GTP B;  2F0T A;  2VQE Q;  4P75 A;  2QDB A;  2UXD L;  3G6J B;  4B3M Q;  2V4D A;  3I55 A;  1WOC A;  2R92 H;  4LJZ C;  5KNB A;  1PH9 A;  4NMZ A;  1HHV A;  2P5Z X;  4JPB W;  1LTA D;  4XQQ A;  4GN3 B;  4GOP C;  3J81 j;  1HCZ A;  1FJG L;  1JQY D;  1V8Q A;  1I4R A;  5I4D A;  2G9D A;  3S9W A;  4ME5 A;  3MEF A;  2LKV A;  1S5F D;  5HGT A;  5JVG 3;  1CKN A;  2F4I A;  4DR4 Q;  1PZI D;  1QE6 A;  2R7D A;  4CJ2 C;  5M3M H;  1HZB A;  2JA5 G;  3OIP A;  3LNN A;  1W2B A;  4H02 A;  2XVS A;  4B3S Q;  2Y0S G;  3FMC A;  2R92 B;  1XTD A;  4C56 C;  2CHB D;  2H4O A;  4X3S A;  4YWM A;  4A3B H;  3S2D H;  5C6A A;  3EBE A;  1LYL A;  1YNJ D;  2Q2T A;  4O0A A;  4DR6 Q;  1ILQ A;  1PYW D;  4KHV A;  3JAM E;  4HJ5 A;  1KRS A;  3GV6 A;  4A76 A;  4RGM A;  1PFB A;  3A5Z B;  4F88 A;  5CBA E;  2CW0 D;  3KJP A;  5M3M B;  2IPK D;  2AWN A;  1YIJ A;  2XGT A;  3OHX C;  3KLS X;  1WTP A;  4WFN 3;  5ELO A;  1EY9 A;  5TSS A;  3CMA A;  2F1M A;  2C35 B;  1GUW A;  3PO2 G;  4A3M G;  1D1I A;  4A3B B;  3S2D B;  3F2B A;  1HH2 P;  4LFC Q;  3I2Z A;  2UXB L;  4IJH A;  2G5D A;  1E2Z A;  4LF9 Q;  1L1O A;  2FIN B;  2JA8 G;  1G29 1;  3A0J A;  2F03 A;  2QEJ C;  1LAB A;  3ND8 A;  4B3T L;  5IP7 H;  3K81 C;  1MJE A;  5EKL A;  1EYG A;  5C3X A;  3SK8 A;  1KIX A;  4FXK C;  3BYT B;  3M9B A;  3T16 A;  3PF5 A;  4KLK A;  2FMM A;  1X55 A;  4JK1 C;  4X64 Q;  4ULL A;  3RNU A;  1EQQ A;  1Y14 B;  5COR A;  4QIW E;  1PA6 A;  4JV5 L;  2DY7 A;  3TRZ A;  1PH3 A;  3MTS A;  5CV4 A;  1TQO A;  1TR5 A;  4DR2 Q;  3R2T A;  5EJW A;  2ZXP A;  3M4P A;  5EGT A;  1RD9 D;  3ITP A;  4A75 A;  2VUM H;  1FNW A;  4UPA A;  2WII B;  1QVC A;  5CV9 A;  4K5W A;  2F4V Q;  1GJX A;  3K0Y A;  2A6E C;  3J7Z C;  1DCZ A;  2IHE A;  2K4K A;  1NUC A;  2F3I A;  3CHB D;  3HG9 A;  3TS0 A;  5D3I B;  2RA4 A;  2ZTD A;  1VQ4 A;  4DV3 Q;  4H0L C;  4XT1 B;  4DR7 L;  2OCE A;  1WTX A;  1BO0 A;  5CV8 A;  2PZU A;  4A3D H;  5CR3 A;  4XIG S;  4A3F B;  1CSQ A;  4DV5 L;  3M4O H;  4MIU A;  1QUQ B;  1Q8K A;  2VQF L;  4A3J G;  2TSS A;  3GTK H;  2VUM B;  1JOR A;  1FD7 D;  3KDF A;  5EBD A;  2MUY A;  2N55 A;  4R8I A;  2B29 A;  2SOB A;  2IWH A;  4DR3 Q;  5CGK A;  4OX9 L;  3HOY H;  3AYH B;  1UAP A;  2A6H C;  1EIH A;  2A73 B;  1KRT A;  2CCZ A;  5IT9 E;  4OO1 I;  3FPP A;  3CXC A;  3LWE A;  1PZK D;  4EX5 A;  4JC0 A;  4A3D B;  1EOV A;  2QA4 A;  3D3R A;  1HR0 W;  3K8A A;  4K2K A;  1HTL D;  1HTP A;  3M4O B;  4KD4 A;  2O2L D;  4IPH A;  2NZ1 D;  2EIF A;  3NPP A;  3GTK B;  3RMH A;  4Q0F A;  5I2Y A;  1TY2 A;  1QZG A;  1F77 A;  4A4I A;  3HOY B;  3EA6 A;  4UP7 A;  3SVM A;  4DV2 L;  4IJL A;  1C0A A;  1LM0 A;  4F87 A;  1U4M A;  3Q8D A;  3LWU A;  2JK8 A;  3MVV A;  1JWS D;  2KCT A;  1NAP A;  1H9R A;  4DXF A;  3BG3 A;  5J3B A;  4FXD A;  2RSO A;  3TSS A;  2UXC Q;  2K6A A;  4NXN L;  3MAQ A;  5EBC A;  5T1G A;  1N9W A;  1CHQ D;  4ZQ3 A;  2ASB A;  1HUM A;  1LLR D;  1UE5 A;  2K28 A;  1XNR L;  1GVP A;  1F9Q A;  4J6H A;  1VQP A;  3OSO A;  3TEH B;  1I4Q A;  4MNO A;  3CCJ A;  2PMZ E;  2YYZ A;  3PIO 3;  4ZCK A;  1WI5 A;  4R4C A;  4GN5 A;  3CD6 A;  4X3K A;  4LUV A;  5JEA H;  4V19 0;  2WFW A;  1CUK A;  4JCV E;  1MSH A;  3EVQ A;  3A56 A;  3GTO B;  1IYJ B;  1TWA H;  1SEB D;  1J9O A;  1OXV A;  2SDF A;  3RR5 A;  4Y7N H;  3H3V H;  4IFD I;  3H0G G;  2HCI A;  1F2Z A;  2AHO B;  3NTH A;  1RHP A;  2A5H A;  2IHF A;  2PNR C;  3N52 A;  4HAE A;  5GAE C;  5C4X B;  4IPD A;  2KHS A;  2D0O A;  2XRS D;  4QJF A;  4LFA L;  3K80 C;  4KI0 A;  4HJA A;  2YTY A;  4PZ7 A;  1BCP B;  1S5B D;  4IUT A;  1PRT B;  4C3J G;  1K8A C;  2JN4 A;  4DV1 L;  4GLA C;  3J80 c;  3B6Y A;  5IGE A;  4LF7 L;  4L5Q A;  3T51 B;  1TWA B;  1VS0 A;  4YIJ A;  2KBN A;  4WJW A;  4YWL A;  4RMF A;  1GM5 A;  4Y7N B;  3DWP A;  4DR1 L;  3K5L A;  1Q86 C;  3NEL A;  3CC4 A;  3T1Y Q;  3OW7 A;  4IFD J;  5C3E H;  2IY5 B;  2K7V A;  1DJR D;  3G6E A;  3OYY A;  4JI6 L;  3E3X A;  3D4W A;  2HIV A;  3CCQ A;  1Q46 A;  3QO2 A;  4MTK A;  4A3K H;  1GUG A;  4PQX A;  3T1H L;  1E7Z A;  4PG3 A;  4IQZ A;  2EY5 A;  1TU2 B;  2A6E D;  4FVM A;  3K5M A;  4DUZ Q;  4DR5 Q;  1BBW A;  2HIX A;  5J39 A;  1DGS A;  2RDH A;  4G4K A;  3IAY A;  2F0W A;  1BBU A;  4K14 A;  1IBL L;  1M8A A;  2RHS B;  1NR4 A;  4BBR G;  2X6L A;  1VQI A;  3JC6 6;  5C3E B;  4LUZ A;  1I4X A;  1EY5 A;  3OIQ A;  5JPN C;  3KUP A;  4A3K B;  1U4L A;  3PSI A;  2R93 G;  3CAM A;  1LT3 D;  1HXY D;  5M5W H;  2B2V C;  1V1P B;  3PUW A;  5M3F H;  4DV7 Q;  1N33 L;  4KHP Q;  3QIA A;  4KN4 C;  4Z9C B;  1K73 C;  2A6H D;  3SHL A;  3GQB A;  1JOK A;  1TVX A;  1X3E A;  3L2P A;  4HTH A;  1SNM A;  5IYB G;  1EU4 A;  2L55 A;  2I5H A;  1LTL A;  2NTT A;  1OXS C;  3MXN B;  4CJ0 B;  5K36 G;  1XMO L;  1IBK Q;  1FL0 A;  3HKZ B;  2PQA B;  5DM6 3;  4DK1 A;  3BZC A;  3W1G A;  3PUY A;  4GLV B;  3GTJ H;  1K8G A;  2WB1 G;  5I6W A;  2FXQ A;  2WAC A;  2QCP X;  1TY0 A;  3SXH A;  2ID0 A;  1NBW A;  2IX0 A;  2MO0 A;  4K8J A;  1T5E A;  1STH A;  3KFU A;  1ILP A;  1SE3 A;  3MXU A;  3K5N A;  1Y1W G;  4C3I H;  1OXX K;  1XJV A;  2LMC B;  2E74 C;  4DNR B;  3AMU A;  1K8M A;  2CWP A;  4IPG A;  1RL2 A;  1ZEQ X;  3I4M G;  3S2H H;  3A7A B;  4IOA A;  5A2Q E;  1AE2 A;  3ULL A;  3QOJ A;  5EKK A;  3PUX A;  1A2T A;  4LF6 L;  2AQ1 B;  3MXP A;  4XYO A;  4XT3 B;  3OMG A;  4DV4 L;  2YU9 H;  3G48 A;  4DV0 Q;  2JA7 H;  1QCB D;  2B3G A;  2K05 A;  2NN6 H;  3GTJ B;  1ENC A;  2R7F A;  4FF2 A;  1STY A;  2Z6K C;  1VQ9 A;  2L15 A;  3GV3 A;  3DWQ A;  1FGB D;  1A6X A;  4QQB X;  1UE7 A;  4AQY Q;  2ZM6 Q;  1RIP A;  4C3I B;  2MGS A;  3PO3 H;  4GOP A;  5D3D A;  1LV9 A;  3S2H B;  3HEJ A;  3R8B A;  1DXM A;  4G57 A;  5C4J H;  4BBS H;  3S17 H;  2OTJ A;  3GTG B;  1VMC A;  5C0X H;  5KND A;  3HOX H;  2YU9 B;  1X54 A;  4AIM A;  4KD3 A;  4DU9 A;  1I3Q H;  1EFW A;  1XMQ L;  4LF5 Q;  1EWI A;  2WAQ G;  3I90 A;  2JA7 B;  2DJG C;  3KF6 A;  2OF1 A;  5DAU A;  5ELE A;  2C9O A;  4P71 A;  3D4R A;  2MP1 A;  4JI2 L;  3I3C A;  1EL0 A;  1E2W A;  1WYD A;  2HHH Q;  4IZ8 A;  5A35 A;  4RA8 A;  1SAP A;  3DEO A;  4MHE A;  3PO3 B;  5I9P A;  4BY1 H;  1X3Q A;  2K5H A;  5C4J B;  4BBS B;  3HOX B;  3X3N A;  2XIW A;  1I3Q B;  3RUZ A;  4LFB Q;  2QW7 A;  3RLN A;  1KQS A;  4DAV A;  4MZ9 A;  3CQZ B;  3SGI A;  1N34 Q;  3VYS A;  4ILW A;  4GKJ Q;  4H7B A;  3TP7 A;  2E2I H;  4A3I H;  3VR3 A;  4J1M A;  2K5W A;  2AWO A;  4HMJ A;  3WOF A;  1ZYR C;  3GTM H;  4P72 A;  4GKK L;  4YY3 L;  2E76 C;  3A74 A;  2F0F A;  4JBK A;  4JYA L;  3I4N G;  3CW2 C;  1J6Q A;  3CCV A;  4OXP A;  4PMW A;  3IFD A;  1MJC A;  4KJN A;  4GNX B;  4BA2 I;  1I6V C;  1N32 Q;  3FKI G;  4KHZ A;  1HNX Q;  3QWN A;  4LNQ A;  2ENB A;  2X69 A;  1BCP F;  5HGQ A;  2XWB B;  4JI4 L;  1PRT F;  2ZJR A;  1HPC A;  1AFP A;  3GDE A;  1PH8 A;  4F8M A;  4RCO A;  2L5T A;  3ZJY C;  4OO1 H;  2A68 D;  4JI0 L;  3AQQ A;  1I94 L;  2ZJQ A;  4XQJ A;  4V0B A;  4A3I B;  3SDZ A;  4JI5 Q;  2E2I B;  1ZXT A;  2K75 A;  4IPC A;  1G2T A;  5CV6 A;  4ZUI A;  1A3V A;  1G8Z D;  1W3S A;  2XNA C;  5M5X B;  4G7Z C;  1XNQ L;  5HUR A;  1OXT A;  2B63 H;  5HY6 A;  2CQO A;  1IW7 C;  2F0I A;  4QCL A;  1CZG A;  1KXL A;  3PF4 A;  1DM0 B;  2R7Z G;  1SNO A;  5C44 H;  5LMU Q;  1PH5 A;  4IO9 A;  3RZO H;  1B9M A;  3KJO A;  5EPJ A;  5KNC A;  1SYD A;  3M85 A;  5JEA J;  4IUN A;  3F8T A;  4WRD A;  2UUC Q;  1VQH A;  5IWA L;  3OTO Q;  4JI7 L;  1JJG A;  2R7Z H;  1GHK A;  1X65 A;  1F9R A;  5ELC A;  4AYB G;  3DUZ A;  3Q0A A;  1QWY A;  2RF4 A;  4LF4 Q;  2JA6 G;  2JEA I;  5IE8 A;  1EZ6 A;  2DGY A;  2B63 B;  3BVZ A;  4L5S A;  5FLM H;  2KEE A;  4R4O A;  5FO7 B;  4QY7 A;  2Q2I A;  3CCS A;  4NB3 A;  1EOT A;  4LAA A;  4X65 Q;  4KKU A;  1KDC A;  3RZO B;  1JJC B;  3IL8 A;  3WOE A;  1ET9 A;  3C1E A;  1XPR A;  4RKL A;  4UP9 A;  5EPK A;  1K83 H;  2UUA L;  5GRO A;  1TII D;  3C46 A;  4OL7 A;  2ICE C;  5I6Y A;  1SNC A;  3CCR A;  4BY7 G;  1I5F A;  5FJ8 H;  5IGF A;  2PQE A;  3CCL A;  4IFD G;  3UDF A;  1F9P A;  4OHJ A;  3NWS A;  3NK9 A;  2LS0 1;  2R92 G;  2VQE L;  1XTC D;  2EXD A;  3S15 H;  1HFN A;  1QNU A;  1B44 D;  2AUJ D;  4I7Z C;  1D1K A;  4CHT B;  4IFD H;  2XRQ D;  4JI1 Q;  1I6H H;  4X6A H;  4G7O C;  2NWG A;  3HOU H;  4A3L H;  3H6M A;  2PYK A;  3M7G A;  1NMG A;  1X9N A;  4K0K L;  1K83 B;  2L12 A;  1HZA A;  1XYI A;  1AW7 A;  2WKD A;  5IGC A;  4KTA A;  5M3M G;  5DM7 3;  1QB5 D;  1SNP A;  1WTR A;  1B70 B;  5KGU A;  4JG2 A;  3TZD A;  1PZJ D;  3KOJ A;  4IN3 A;  2B2Y C;  3MA2 B;  1VQK A;  2UXD Q;  3VR2 A;  3NP8 A;  4DA2 A;  3S15 B;  2KHI A;  4B3S L;  3TDQ A;  1I6H B;  4DAM A;  1CM9 A;  3AFP A;  4A3B G;  1S72 A;  3CF5 A;  2EY6 A;  3PUZ A;  1SRO A;  3HOU B;  1PRT C;  3PCO B;  4B9W A;  2YV5 A;  1KAB A;  1B50 A;  1HUN A;  1PVO A;  1GKH A;  2EE1 A;  1UEB A;  4DR6 L;  2N78 A;  1XXG A;  1H9K A;  2MNA A;  3H3V C;  4XYQ A;  1JT8 A;  5LMN W;  1AZQ A;  1KNA A;  2FJ2 A;  3K57 A;  2N8N A;  1EY6 A;  1PDQ A;  5GAG C;  4DUY L;  1B8A A;  1CHP D;  3AU7 A;  1PH4 A;  2NN6 I;  3KLS A;  1K8O A;  3A7L A;  2GVB A;  1K28 A;  3MFG A;  1BQQ T;  1ZYR D;  3U9O A;  1CSP A;  1G6Z A;  3F2U A;  1EQR A;  2IJ0 A;  4M1U B;  2IL8 A;  2NVQ B;  4TQU S;  4ZRZ A;  3J80 i;  3EJI A;  4LFC L;  5IP7 G;  1SDF A;  1IKM A;  4LF9 L;  1CQV A;  1FYC A;  4IOC A;  2VY3 A;  4H13 C;  4ZYS A;  2B2T C;  1WCM B;  3SR1 A;  5C0X I;  1JOO A;  5I9O A;  4NXM L;  4C1N K;  4RCN A;  2K33 A;  1RDP D;  3MXG A;  4I65 A;  1CFM A;  2DNE A;  4X64 L;  2DNC A;  1PH7 A;  3QB3 A;  4DAY A;  1KDB A;  3CCM A;  2EYO A;  4NDX A;  2VUM G;  2F3V A;  1Q12 A;  3I4L A;  1I4G A;  4A3F H;  1H9S B;  2XWJ B;  1IW7 D;  3NBI A;  1EIY B;  5KRU A;  4A3E H;  1N36 L;  4JI8 L;  5D65 A;  2EYM A;  2N49 A;  1Z47 A;  2RVL A;  4I7A A;  2BCO A;  1KNE A;  2F4V L;  1DOK A;  3E0E A;  3TBI B;  1CKM A;  2RQX A;  5C0X J;  1H9M A;  4A3D G;  2K1B A;  3G71 A;  2NZO A;  1TT2 A;  5G3L F;  2NB0 A;  3VA7 A;  2CH4 A;  1DON A;  1GOZ A;  5FKA C;  4A3E B;  2F52 A;  1B3A A;  3HOY G;  1IBM Q;  4ZKC B;  2QDL A;  1UWV A;  1SRU A;  3X3M A;  2F3W A;  2Q8T A;  3PV0 A;  1WFQ A;  3KF8 B;  2B2V A;  1DD2 A;  3M4Y A;  3FHW A;  4C3H B;  2TMP A;  1E1O A;  5GAD C;  1BKB A;  2XN9 C;  4UHV A;  4HMI A;  4R4I A;  3CP0 A;  1B7Y B;  1ET6 A;  2PCF B;  1YNX A;  1A2U A;  2VQF Q;  2E5L Q;  2EZV A;  2PZW A;  1IZ6 A;  4TRD A;  3TP8 A;  5CC4 A;  1A3T A;  3BVM A;  2ZT9 C;  3MFY A;  3HOW H;  5JOB A;  1D7Q A;  3VYU A;  1SJH D;  1V1O A;  4O2D A;  3CCU A;  3HOZ H;  1Y1V B;  4FYD A;  1Q8I A;  2F0E A;  2ZXO A;  1ROD A;  2CH4 W;  1Z7T A;  1EY0 A;  3MEH A;  1RKN A;  2N3S A;  1KDA A;  1B9N A;  3GTO H;  4X66 Q;  4CKC A;  4FP5 D;  3VA5 A;  4L5R C;  3J81 i;  1ESR A;  1M1K C;  2Z6K A;  4YCV A;  1PV4 A;  1PRT D;  3HOW B;  5BR8 Q;  4HIM A;  1JIC A;  3HKZ E;  2V1C C;  2AMC B;  5C4X H;  4O1N A;  2EJG C;  1HA5 A;  3CU7 A;  4CDE C;  3NTK A;  1A8V A;  5JEA G;  1SYB A;  2JEB I;  4ZKB B;  3HOZ B;  1AEX A;  2JA9 A;  2VS1 A;  1IHZ A;  1LTG D;  1HJP A;  2K01 A;  2EOT A;  3HP3 A;  2J0T D;  3S1N B;  1KHI A;  3BU2 A;  4KY5 A;  1YJ9 A;  1M90 C;  5IYD H;  1K0R A;  2QKI C;  3J7A 5;  2R61 A;  4GNX C;  4CJ1 B;  3W2D A;  3I91 A;  1TWF H;  1MBY A;  4OIK A;  2CVR A;  3BVG A;  2JE6 I;  3FDT A;  5IOC A;  1NJI C;  2K5N A;  3HFZ B;  2Z0S A;  2X6G A;  2BE5 C;  2HD3 A;  4PMC A;  3A8I E;  1C4Q A;  1GUN A;  2BA0 A;  2Q8I B;  3PGZ A;  2D9U A;  1U5K A;  1VQM A;  4NKL A;  5C3E G;  3V96 A;  2PI2 A;  3T13 A;  4ZLT F;  1O7Z A;  5IYC H;  5KEE A;  2EDG A;  3T1Y L;  1VF7 A;  4A3K G;  1GXD C;  3E9H A;  1VQG A;  3GD7 A;  1BNZ A;  1TWF B;  5EPL A;  3NSW A;  4GN4 B;  1MKH A;  1CZW A;  4RWS C;  4XXE A;  5GQO A;  1EIF A;  1HZ9 A;  2CWA A;  2OT2 A;  1LUZ A;  4EQP A;  4J8Q A;  4LF7 Q;  3UDG A;  3S1M H;  2K03 A;  2RHQ B;  5EQ0 A;  1LT5 D;  4DUZ L;  4LK1 C;  4DR5 L;  2NVT H;  3DWA A;  3ND9 A;  1VQL A;  2RCN A;  3PIP A;  4KN7 C;  4ODG A;  5FLX E;  1UE1 A;  2EYP A;  1QIL A;  3HKZ G;  1STG A;  2VL6 A;  5FO9 B;  3J80 E;  1D5M C;  1QUQ A;  3CRK C;  3E9I A;  4KKT A;  4K5X A;  2EPB A;  1FVI A;  3H09 A;  2NYZ D;  1PHJ A;  5FO8 B;  5D14 A;  3D8G A;  4CKE A;  3ONA B;  3TQY A;  2F0H A;  3GTL H;  1S5C D;  1QVG A;  1B4O A;  5M3F G;  3QOL A;  2A69 C;  4DK6 C;  3S1M B;  2HT1 A;  1KD1 C;  2AQ2 B;  4PV1 C;  4DV7 L;  4DNT B;  2VNU D;  1HNZ Q;  4KHP L;  2NVT B;  5IGB A;  4QUC A;  1PFM A;  4B08 A;  3QR8 A;  3I72 A;  1QZH A;  3MZ5 A;  2Z4I A;  2F0P A;  1SXT A;  3A5U A;  4QMG A;  1IXR A;  2UU9 Q;  4Q5V A;  1IBK L;  1EQT A;  1EY8 A;  3EFX D;  3AFQ A;  1IKL A;  1QNK A;  3GTL B;  1LO5 D;  4L6T B;  2IT1 A;  5E7N A;  2E2D C;  2L0C A;  1IL8 A;  2H1E A;  2RCF A;  2EY2 A;  4C3I G;  1JMC A;  4RFB A;  3S16 H;  4PNY A;  2OWO A;  1SE8 A;  1SLJ A;  3S1R H;  4MN3 A;  2R6G A;  1EYA A;  5M5Y B;  2Z1C A;  4EQN A;  3J7A F;  1X3F A;  1PTO H;  1JWM D;  4IUU A;  1YBY A;  2J4X A;  2JA7 G;  1R9T H;  2NN6 G;  1Y8N B;  4X62 L;  3GTG H;  4DPG A;  3OMC A;  4KK7 A;  1SR3 A;  3BDL A;  3RLO A;  1KC8 C;  2FHT A;  1HQR D;  1STE A;  4YHH Q;  4OON A;  1JC7 A;  2EY1 A;  4BXX H;  2KCN A;  3M3Y H;  2KCC A;  3S16 B;  4CDF C;  1CI3 M;  4JBJ A;  4DF7 A;  4EVO A;  2A1A A;  3PO3 G;  1VQJ A;  1AH9 A;  2L11 A;  3CKI B;  4R9W A;  5LMN L;  3S1R B;  4AQY L;  2ZM6 L;  4BBS G;  3QJY A;  3HOX G;  5C0X G;  1PTO B;  5C5L A;  1NSN S;  2D2C C;  2Q2H A;  5COY A;  1I4P A;  3NBH B;  4F7X A;  1BBX C;  1KAW A;  1R9T B;  1JE5 A;  1GUT A;  2UUB Q;  1OXU A;  1V1Q A;  2B2U A;  2KOL A;  4LF8 L;  4UP8 A;  5JJZ A;  2BDN A;  4LF5 L;  1U4P A;  1W6K A;  4RG1 A;  2D62 A;  2B2Y A;  2QEX A;  1VQO A;  5KYI A;  3CQZ H;  3M3Y B;  3GO5 A;  4A3C H;  3N6R A;  4R1J A;  2HHH L;  3K59 A;  4BY1 G;  2K5Q A;  3KK7 A;  4LUO A;  5JJK A;  1E24 A;  1RJT A;  1VQ6 A;  4P2C B;  1PLF A;  2BE5 D;  3J7A V;  3FVQ A;  2E2H H;  3ICE A;  3I70 A;  3I4M B;  1VQ7 A;  2ATW A;  3J81 E;  1GO3 E;  4S3S A;  1NY4 A;  3D31 A;  3E5S A;  4LFB L;  4WJ3 M;  4A3I G;  1STN A;  1CKN B;  1N34 L;  1YEZ A;  4GKJ L;  3U4Z A;  1E3P A;  1D6E C;  2K14 A;  4K6D A;  2C5C A;  2KA7 A;  3BZD B;  1EUJ A;  1GUO A;  1O7I A;  2A74 C;  1KL9 A;  1PH6 A;  4B3R Q;  4P74 A;  2JSO A;  1OO9 B;  1RTO A;  5JJI A;  4FXG C;  2ZTC A;  5M5X H;  3WWV A;  4EGV A;  1FNV A;  2AUK A;  3NHH A;  5K5P A;  2OTL A;  2PZT A;  3D0F A;  1VQC A;  4EQO A;  2LXJ A;  5DNF A;  1F2Y A;  4QB4 A;  1N32 L;  2E2H B;  2EJF C;  5J22 A;  1HNX L;  1CK1 A;  4OO1 G;  1NMF A;  4CBV A;  5H1S E;  1VMP A;  2B2T A;  2BDO A;  4RHS A;  1TS4 A;  2F0D A;  1K3B C;  4UDU C;  4HJ9 A;  4RGO S;  3W5O A;  3MWY W;  2VB3 X;  2YTV A;  3OPO A;  1BF4 A;  3H15 A;  3KLR A;  2RKS A;  3CPF A;  4JI5 L;  5JVH 3;  4G7H C;  2B63 G;  3P75 A;  5CYU A;  3AB9 A;  1V1P A;  4N8X 1;  5C44 G;  3O13 A;  2I0Q A;  3VYT A;  2A69 D;  3NUC A;  1CT1 D;  2B8G A;  1VQE A;  1BXT A;  2LY7 A;  4HJ7 A;  1R4P B;  5LMU L;  1L1O B;  3MXN A;  4WJ4 A;  3SEB A;  1I94 Q;  2Z4H A;  2VW9 A;  1ESF A;  2PQA A;  5LL6 X;  2UUC L;  3S14 H;  3OTO L;  1E2V A;  2A19 A;  1TS2 A;  2MQH A;  5E4X A;  4A93 H;  1SYG A;  4HIK A;  3QG1 A;  5E3F A;  1XNQ Q;  4LF4 L;  3G4S A;  1S3O A;  3R3O A;  1QG7 A;  5FLM G;  2F0V A;  1YJN A;  4QL5 A;  1I50 H;  1HNW Q;  3D6W A;  3V05 A;  1EYC A;  1PXU A;  1V9P A;  1C48 A;  4P73 A;  3M7N A;  3A8J E;  5IIF A;  3ER0 A;  4RAU C;  1YZ6 A;  4DN4 M;  1EZ8 A;  2Y0S E;  2F0U A;  1HR0 Q;  2KVM A;  5FJ8 G;  1J5E Q;  4KV6 A;  4A3G H;  2NUC A;  1N8R C;  5IP9 H;  2HQE A;  5LHY 1;  3S14 B;  3BDO A;  5AJ3 L;  5DEH A;  3HOV H;  4A93 B;  3WDN A;  1EU3 A;  4PZ8 A;  2E8G A;  4DV6 Q;  1J8I A;  2E75 C;  4JI3 Q;  3PIP 3;  4U68 A;  2LSS A;  3ERO A;  1TWH H;  3BJU A;  3KBX A;  3NEM A;  1I50 B;  4Y52 H;  2EYH A;  3R93 A;  3HOU G;  1VQN A;  4A3L G;  1WVL A;  3FEW X;  4TKO B;  4JI1 L;  4OWX B;  5ELF A;  3UDI A;  3A8K E;  2KEC A;  3LX0 A;  3V2T A;  4B3M L;  3NXW A;  3F1Z A;  4LMQ D;  2UUA Q;  3RN2 A;  5I2X A;  4A3G B;  1NNX A;  3KDF B;  1VDZ A;  1XX8 A;  2F0G A;  3CPW A;  4RHR A;  1AP0 A;  3UI2 A;  2JP1 A;  3HOV B;  1JCK B;  2PNH A;  4CDC C;  2K5D A;  5DLQ E;  3D6C A;  4NPS A;  1SYC A;  2K52 A;  4OWW B;  1S5E D;  2B2U C;  4AYB B;  1YVC A;  1TWH B;  1U0L A;  2JA6 B;  4DR4 L;  1MHW C;  3CC7 A;  5JJL A;  3NEN A;  2K50 A;  4EQ5 A;  5E1F A;  2B39 A;  3NQI A;  1SE4 A;  2VZA A;  3HS0 C;  3DM3 A;  1JR0 D;  2F0Q A;  3SK4 A;  4R8N A;  3JAM c;  2JJQ A;  4K0K Q;  1BCP C;  4RKB A;  3PUV A;  4IUR A;  1BOS A;  1EEI D;  1ENF A;  4LWC A;  1FJG Q;  1F2M A;  2KQ3 A;  1IYV A;  2NVQ H;  4IUP A;  1WCM G;  5ELB A;  1H9J A;  2RDF A;  3SK5 A;  5IOD A;  1PTO F;  4BY7 B;  3W3A A;  3TS2 A;  1R4Q B;  1RTN A;  3DXJ C;  3BZK A;  3ZYY X;  1YNN C;  2IW3 A;  3SK6 A;  1L0X B;  3D4D A;  4DGZ A;  1WCM H;  2L9H A;  3P20 A;  1STB A;  3FRP B;  5ELD A;  2G9H D;  4KMU C;  1Q1E A;  3E6Z X;  1LAC A;  2QGQ A;  2HCC A;  2JA5 H;  2JQO A;  5CV7 A;  4POG A;  1HA6 A;  4AH6 A;  2ZXR A;  5FK9 C;  1P16 A;  4GNX A;  2D5D A;  1SMY C;  3C1F A;  3M4Q A;  1TWC H;  1EWH A;  2Z6B A;  2XTI A;  2DJF C;  1X32 A;  1XPU A;  4DKA C;  1Y8O B;  4KKS A;  2K32 A; 
#chains in the Genus database with same CATH homology
 3OOC A;  3K6O A;  4KJO A;  1CA6 A;  2R3Z A;  1WD0 A;  4L63 B;  2JA5 B;  1Q90 A;  1VCI A;  2Y0S B;  1TWC B;  2XSC A;  1O78 A;  1XWE A;  3Q6S A;  4C3H G;  1V43 A;  2EYL A;  4BWG B;  1PMR A;  1EYD A;  2B8F A;  3RD4 A;  5C3W A;  3NTI A;  2B2W C;  1B53 A;  5ISR A;  1MSG A;  3L3O C;  5AFW A;  3PO2 B;  3HZX A;  4A3M B;  1LTR D;  1TWG B;  3VR4 A;  1EFI D;  1UNS A;  3TP5 A;  4OIJ A;  2EVB A;  2JA8 B;  2O4X A;  1JOQ A;  2OEO A;  4NP5 A;  4WOR A;  3IFT A;  3OWF A;  2F0K A;  1FNU A;  1T5X D;  5JAV A;  2EYF A;  2IX1 A;  5CV5 A;  4X3T A;  1WTO A;  2AQ3 B;  1TS3 A;  1EWC A;  5NUC A;  3VYR A;  4L8J A;  1LTT D;  3L7Z C;  4HED A;  1PTO C;  1Y8P B;  2FMC A;  2K04 A;  1SNQ A;  3T4A C;  2O5I C;  1LTB D;  2QF7 A;  3JAM L;  1E0B A;  3TN2 A;  1LT6 D;  1SND A;  1MD2 D;  2KED A;  4DFA A;  1Q1B A;  2SNS A;  1DOM A;  2I46 A;  1RCV D;  1B1Z A;  1MI2 A;  4BA1 I;  4O42 A;  1SE2 A;  4PMB A;  4KY6 A;  5C5M A;  1BCP D;  1M4V A;  4A3J B;  1QOH A;  3RZD B;  1B2T A;  4OGQ C;  2JXM B;  2BA1 A;  2WKC A;  2M2L A;  5KYL A;  4K6L A;  1GUS A;  5IGD A;  1ML0 D;  1YNN D;  1W6J A;  2J7Z A;  2F0S A;  5J1Z A;  1CA5 A;  2F0M A;  2SNM A;  3URY A;  1ENA A;  5T1I A;  2PO4 A;  1HRJ A;  1A3U A;  3DM1 A;  1SMY D;  1O7Y A;  5CBE E;  3IKJ A;  3L9A X;  3GP7 A;  4QIW B;  2RSN A;  3OWE B;  2WV6 D;  3BDC A;  2F0O A;  1CQF A;  1PFN A;  3VR5 A;  2OXP A;  3TME A;  2DN8 A;  2M9V A;  4IAL A;  2EYJ A;  1H9S A;  3Q24 A;  1SBB B;  3MC0 B;  1D5Z C;  2MJ8 A;  4UAI A;  1TS5 A;  1F9S A;  1JWU D;  4U67 3;  4JBW A;  1TKW B;  2Q8R E;  4TSS A;  1UEA B;  3S1Q B;  1F2L A;  1U9R A;  1Q3L A;  5IT9 L;  4RGN A;  4C1N I;  2KUM A;  2VB2 X;  1G91 A;  1Y69 U;  3K58 A;  3GTQ B;  1ONL A;  2NTS A;  3NWT A;  2EXZ A;  2Z8L A;  2PW5 A;  4M8A A;  3H0G B;  4XTC S;  2F0L A;  1NR2 A;  1X3P A;  3KF8 A;  4K5V A;  2CQA A;  4XQN A;  5BN3 A;  3BS1 A;  3DHQ A;  3U9S A;  2O5J C;  1IYU A;  2VXW A;  2RDG A;  4CKB A;  3SE0 A;  1A15 A;  4K2L A;  4C3J B;  1GHJ A;  4N9T A;  1RF2 D;  2A68 C;  1Z6H A;  4FF3 A;  3EQL C;  2KJX A;  1FR3 A;  5LL6 S;  2IX3 A;  2GA4 B;  3I8Z A;  1C8C A;  1EEF D;  5E4W C;  1JE4 A;  3T53 B;  4RH6 A;  3RLF A;  2ICI A;  1PTO D;  2FFK B;  1EY4 A;  4GZY C;  2I07 B;  4XDX A;  1SJE D;  1WD1 A;  2N88 A;  5K36 H;  4BBR B;  2PMZ B;  5M5W B;  2WP8 J;  5M3F B;  1LTI D;  5C4Z A;  1DOL A;  2R93 B;  1EQV A;  5F2D A;  3K7A B;  3ERQ A;  4HSP A;  4IUQ A;  1LT4 D;  1QJO A;  1BDO A;  1WTV A;  2SEB D;  3NQT A;  4H44 C;  5JPM C;  2L4N A;  4ZUJ A;  3P1H A;  2QIL A;  4K8I A;  1CTM A;  2M00 A;  5KIX A;  2F0J A;  4E6I A;  2WB1 B;  1AN8 A;  4HR7 B;  2LFN A;  2JYO A;  4ABN A;  1DYQ A;  1KTK A;  1SYF A;  2PPB C;  4X3U A;  3Q22 A;  3H94 A;  2HUG A;  1Y1W B;  1I4H A;  5FLX L;  2MHV A;  4KY7 A;  4QF4 A;  4N9P A;  1BR9 A;  5G3L D;  3A55 A;  3J80 L;  3I73 A;  3P7J A;  2F0N A;  1D2B A;  1ZKO A;  3TZU A;  1HQM C;  3DEP A;  1EY7 A;  1AZP A;  4DK0 A;  3A54 A;  4ID6 A;  4DAP A;  3Q23 A;  1S4Z A;  5CMD A;  2NVY B;  5C4H A;  1YNJ C;  1UUP A;  3S17 B;  3H91 A;  1SFO B;  3C2P A;  3MHB A;  2WIN B;  2E2J B;  2CW0 C;  4FF4 A;  5EKI A;  4FF1 A;  3HRZ C;  2WAQ B;  1D5X C;  5M9O A;  4CGY B;  3G7L A;  1KLG D;  1G2S A;  3FPU B;  4BY1 B;  3C3L A;  4ZAI A;  1ICW A;  3CRL C;  4FNF A;  1DZ1 A;  3E0J A;  4HN7 A;  4NW2 A;  1HFG A;  3NE5 B;  4DXG A;  2PW7 A;  1EIG A;  2EJM A;  2HDL A;  5A2Q L;  2BOS A;  2HDM A;  4C2M B;  3K5O A;  1II3 A;  4HCE A;  5FOB B;  1BUV T;  3GTM B;  4BS9 A;  2B2W A;  4ZK9 B;  1MGS A;  3R2I A;  1LTS D;  4QUF A;  1VF5 C;  3I4N B;  4IUV A;  2NVX B;  3T56 B;  2RBM A;  3HGB A;  2DY8 A;  3FKI B;  4FO2 A;  3KBG A;  4RGT A;  4B9X A;  3TP6 A;  1NCV A;  1STA A;  1O7L A;  2MPM A;  3VR6 A;  1SSO A;  1JB3 A;  3J7Y W;  5BN4 A;  3PMF A;  1U4R A;  2L1B A;  4HSV A;  4HCS A;  1KLU D;  5C44 B;  1WTW A;  1SYE A;  3NBH A;  2NBF A;  3J81 L;  2R7Z B;  1WTQ A;  3DMU A;  1KAA A;  1L0Y B;  5BN5 A;  5IGG A;  1S5D D;  1O80 A;  3BYY B;  3GTP B;  2F0T A;  2QDB A;  3G6J B;  2V4D A;  4LJZ C;  5KNB A;  4NMZ A;  1HHV A;  1LTA D;  4XQQ A;  1HCZ A;  1JQY D;  1V8Q A;  1I4R A;  5I4D A;  2G9D A;  3S9W A;  4ME5 A;  2LKV A;  1S5F D;  5HGT A;  5JVG 3;  2F4I A;  1PZI D;  1QE6 A;  4CJ2 C;  3OIP A;  3LNN A;  2XVS A;  3FMC A;  2R92 B;  4C56 C;  2CHB D;  2H4O A;  4X3S A;  5C6A A;  1YNJ D;  1ILQ A;  1PYW D;  4KHV A;  3JAM E;  3GV6 A;  4RGM A;  1PFB A;  4F88 A;  5CBA E;  2CW0 D;  5M3M B;  2IPK D;  2AWN A;  3OHX C;  3KLS X;  1WTP A;  4WFN 3;  1EY9 A;  5TSS A;  2F1M A;  1GUW A;  1D1I A;  4A3B B;  3S2D B;  1E2Z A;  2FIN B;  1G29 1;  2F03 A;  2QEJ C;  1LAB A;  3ND8 A;  5EKL A;  5C3X A;  3SK8 A;  4FXK C;  3BYT B;  3T16 A;  2FMM A;  4JK1 C;  4ULL A;  5COR A;  2DY7 A;  3MTS A;  5CV4 A;  1TQO A;  1TR5 A;  3R2T A;  5EJW A;  2ZXP A;  5EGT A;  1RD9 D;  3ITP A;  1FNW A;  2WII B;  5CV9 A;  4K5W A;  1GJX A;  3K0Y A;  2A6E C;  1DCZ A;  1NUC A;  3CHB D;  3HG9 A;  5D3I B;  2RA4 A;  4H0L C;  4XT1 B;  1WTX A;  1BO0 A;  5CV8 A;  2PZU A;  5CR3 A;  4XIG S;  4A3F B;  4MIU A;  2TSS A;  2VUM B;  1JOR A;  1FD7 D;  5EBD A;  2MUY A;  2N55 A;  4R8I A;  2IWH A;  2SOB A;  5CGK A;  1UAP A;  2A6H C;  1EIH A;  2A73 B;  5IT9 E;  4OO1 I;  3FPP A;  3LWE A;  1PZK D;  4A3D B;  3D3R A;  4K2K A;  1HTL D;  1HTP A;  3M4O B;  4KD4 A;  2O2L D;  2NZ1 D;  3NPP A;  3GTK B;  3RMH A;  4Q0F A;  5I2Y A;  1TY2 A;  1F77 A;  3HOY B;  3EA6 A;  3SVM A;  4F87 A;  1U4M A;  3LWU A;  3MVV A;  1JWS D;  1NAP A;  1H9R A;  4DXF A;  3BG3 A;  4FXD A;  2RSO A;  3TSS A;  2K6A A;  3MAQ A;  5EBC A;  5T1G A;  1CHQ D;  4ZQ3 A;  1HUM A;  1LLR D;  2K28 A;  1F9Q A;  4J6H A;  3OSO A;  1I4Q A;  2YYZ A;  3PIO 3;  4X3K A;  5JEA H;  4V19 0;  1MSH A;  3EVQ A;  3A56 A;  3GTO B;  1SEB D;  1J9O A;  1OXV A;  2SDF A;  4IFD I;  2HCI A;  1F2Z A;  3NTH A;  1RHP A;  2A5H A;  2PNR C;  3N52 A;  4HAE A;  5C4X B;  2KHS A;  2XRS D;  4KI0 A;  1BCP B;  1S5B D;  4IUT A;  1PRT B;  4C3J G;  5IGE A;  3T51 B;  1TWA B;  4YIJ A;  4WJW A;  4Y7N B;  3DWP A;  3K5L A;  3OW7 A;  4IFD J;  2K7V A;  1DJR D;  3D4W A;  3QO2 A;  1GUG A;  4PQX A;  4IQZ A;  2EY5 A;  1TU2 B;  2A6E D;  4FVM A;  3K5M A;  5J39 A;  2RDH A;  4G4K A;  3IAY A;  2F0W A;  4K14 A;  1M8A A;  1NR4 A;  2X6L A;  5C3E B;  1I4X A;  1EY5 A;  3OIQ A;  5JPN C;  3KUP A;  4A3K B;  1U4L A;  1LT3 D;  1HXY D;  2B2V C;  1V1P B;  3PUW A;  4Z9C B;  3QIA A;  4KN4 C;  2A6H D;  3SHL A;  3GQB A;  1JOK A;  1TVX A;  4HTH A;  1SNM A;  1EU4 A;  2L55 A;  2NTT A;  1OXS C;  4CJ0 B;  5K36 G;  3HKZ B;  5DM6 3;  4DK1 A;  3PUY A;  5I6W A;  2WAC A;  2QCP X;  1TY0 A;  3SXH A;  2ID0 A;  2IX0 A;  4K8J A;  1T5E A;  1STH A;  1ILP A;  1SE3 A;  3MXU A;  3K5N A;  1OXX K;  2LMC B;  2E74 C;  4DNR B;  3AMU A;  1K8M A;  1ZEQ X;  3A7A B;  5A2Q E;  3QOJ A;  5EKK A;  3PUX A;  1A2T A;  2AQ1 B;  3MXP A;  4XYO A;  4XT3 B;  3OMG A;  1QCB D;  3GTJ B;  2K05 A;  2NN6 H;  1ENC A;  4FF2 A;  1STY A;  3GV3 A;  3DWQ A;  1FGB D;  1A6X A;  4C3I B;  2MGS A;  5D3D A;  1LV9 A;  3S2H B;  3HEJ A;  3R8B A;  1DXM A;  4G57 A;  3GTG B;  1VMC A;  5C0X H;  5KND A;  2YU9 B;  4KD3 A;  4DU9 A;  3I90 A;  2JA7 B;  2OF1 A;  5DAU A;  5ELE A;  2C9O A;  3D4R A;  2MP1 A;  3I3C A;  1EL0 A;  1E2W A;  4IZ8 A;  5A35 A;  4RA8 A;  1SAP A;  3DEO A;  4MHE A;  3PO3 B;  5I9P A;  1X3Q A;  5C4J B;  4BBS B;  3HOX B;  3X3N A;  2XIW A;  3RUZ A;  1I3Q B;  4DAV A;  3CQZ B;  3VYS A;  4ILW A;  4H7B A;  3TP7 A;  3VR3 A;  4J1M A;  2K5W A;  2AWO A;  4HMJ A;  3WOF A;  1ZYR C;  2E76 C;  2F0F A;  4PMW A;  3IFD A;  4KJN A;  4BA2 I;  1I6V C;  4KHZ A;  3QWN A;  2ENB A;  2X69 A;  1BCP F;  2XWB B;  1PRT F;  1AFP A;  1HPC A;  4F8M A;  4RCO A;  2L5T A;  4OO1 H;  2A68 D;  4XQJ A;  4V0B A;  4A3I B;  3SDZ A;  2E2I B;  1ZXT A;  1G2T A;  5CV6 A;  4ZUI A;  1A3V A;  1G8Z D;  2XNA C;  5M5X B;  4G7Z C;  5HUR A;  1OXT A;  1IW7 C;  2F0I A;  4QCL A;  1CZG A;  1DM0 B;  1SNO A;  1B9M A;  5EPJ A;  5KNC A;  1SYD A;  3M85 A;  5JEA J;  4IUN A;  4WRD A;  1GHK A;  1F9R A;  5ELC A;  3DUZ A;  3Q0A A;  1QWY A;  2JEA I;  1EZ6 A;  2B63 B;  3BVZ A;  2KEE A;  5FO7 B;  1EOT A;  4LAA A;  4KKU A;  1KDC A;  3RZO B;  3IL8 A;  3WOE A;  1ET9 A;  3C1E A;  4RKL A;  5EPK A;  1TII D;  3C46 A;  4OL7 A;  2ICE C;  5I6Y A;  1SNC A;  5IGF A;  2PQE A;  4IFD G;  1F9P A;  4OHJ A;  3NWS A;  3NK9 A;  2LS0 1;  1HFN A;  1XTC D;  1QNU A;  1B44 D;  2AUJ D;  4I7Z C;  1D1K A;  4CHT B;  4IFD H;  2XRQ D;  4G7O C;  2NWG A;  3H6M A;  2PYK A;  3M7G A;  1K83 B;  2L12 A;  1XYI A;  1AW7 A;  2WKD A;  5IGC A;  4KTA A;  5DM7 3;  1QB5 D;  1SNP A;  1WTR A;  5KGU A;  3TZD A;  1PZJ D;  4IN3 A;  2B2Y C;  3MA2 B;  3VR2 A;  3NP8 A;  4DA2 A;  3S15 B;  3TDQ A;  1I6H B;  1CM9 A;  2EY6 A;  3PUZ A;  3HOU B;  1PRT C;  4B9W A;  1KAB A;  1B50 A;  1HUN A;  2EE1 A;  1XXG A;  1H9K A;  3H3V C;  4XYQ A;  1AZQ A;  1KNA A;  2FJ2 A;  3K57 A;  1EY6 A;  1PDQ A;  1CHP D;  3AU7 A;  2NN6 I;  3KLS A;  1K8O A;  3A7L A;  3MFG A;  1BQQ T;  1ZYR D;  3U9O A;  1G6Z A;  3F2U A;  2IJ0 A;  4M1U B;  2IL8 A;  2NVQ B;  4TQU S;  4ZRZ A;  3EJI A;  1SDF A;  1IKM A;  1CQV A;  1FYC A;  4H13 C;  4ZYS A;  2B2T C;  1WCM B;  3SR1 A;  5C0X I;  1JOO A;  5I9O A;  4C1N K;  4RCN A;  2K33 A;  1RDP D;  3MXG A;  4I65 A;  1CFM A;  2DNE A;  2DNC A;  3QB3 A;  4DAY A;  1KDB A;  2EYO A;  4NDX A;  2F3V A;  1Q12 A;  3I4L A;  1I4G A;  1H9S B;  2XWJ B;  1IW7 D;  3NBI A;  5KRU A;  5D65 A;  2EYM A;  1Z47 A;  2RVL A;  2BCO A;  1KNE A;  1DOK A;  3TBI B;  2RQX A;  5C0X J;  1H9M A;  2K1B A;  1TT2 A;  5G3L F;  2NB0 A;  3VA7 A;  1DON A;  1GOZ A;  5FKA C;  4A3E B;  1B3A A;  4ZKC B;  3X3M A;  2F3W A;  2Q8T A;  3PV0 A;  2B2V A;  1DD2 A;  3M4Y A;  4C3H B;  2TMP A;  2XN9 C;  4HMI A;  1ET6 A;  2PCF B;  1A2U A;  2EZV A;  2PZW A;  4TRD A;  3TP8 A;  5CC4 A;  1A3T A;  3BVM A;  2ZT9 C;  3MFY A;  5JOB A;  3VYU A;  1SJH D;  1V1O A;  1Y1V B;  4FYD A;  1Q8I A;  2F0E A;  2ZXO A;  1ROD A;  1Z7T A;  1EY0 A;  3MEH A;  1RKN A;  1KDA A;  1B9N A;  4CKC A;  4FP5 D;  3VA5 A;  1ESR A;  1PRT D;  3HOW B;  1JIC A;  4O1N A;  2EJG C;  1HA5 A;  3CU7 A;  3NTK A;  5JEA G;  1SYB A;  2JEB I;  4ZKB B;  3HOZ B;  1AEX A;  1IHZ A;  1LTG D;  2K01 A;  2EOT A;  3HP3 A;  2J0T D;  3S1N B;  4KY5 A;  2QKI C;  2R61 A;  4CJ1 B;  3W2D A;  3I91 A;  1MBY A;  4OIK A;  2CVR A;  3BVG A;  2JE6 I;  3FDT A;  5IOC A;  2X6G A;  2BE5 C;  4PMC A;  3A8I E;  1C4Q A;  1GUN A;  2BA0 A;  2Q8I B;  2D9U A;  4NKL A;  3V96 A;  3T13 A;  4ZLT F;  1O7Z A;  5KEE A;  2EDG A;  1VF7 A;  1GXD C;  3GD7 A;  1BNZ A;  1TWF B;  5EPL A;  3NSW A;  1CZW A;  4RWS C;  4XXE A;  2OT2 A;  4EQP A;  4J8Q A;  2K03 A;  5EQ0 A;  1LT5 D;  4LK1 C;  3DWA A;  3ND9 A;  4KN7 C;  4ODG A;  5FLX E;  2EYP A;  1QIL A;  1STG A;  5FO9 B;  3J80 E;  1D5M C;  3CRK C;  4KKT A;  4K5X A;  2EPB A;  3H09 A;  2NYZ D;  5FO8 B;  5D14 A;  3D8G A;  4CKE A;  3ONA B;  2F0H A;  1S5C D;  1B4O A;  3QOL A;  2A69 C;  3S1M B;  2AQ2 B;  4PV1 C;  4DNT B;  2VNU D;  2NVT B;  5IGB A;  4QUC A;  1PFM A;  4B08 A;  3I72 A;  3MZ5 A;  2Z4I A;  2F0P A;  1SXT A;  4QMG A;  4Q5V A;  1EQT A;  1EY8 A;  3EFX D;  1IKL A;  1QNK A;  3GTL B;  1LO5 D;  4L6T B;  2IT1 A;  2E2D C;  2L0C A;  1IL8 A;  2H1E A;  2EY2 A;  4C3I G;  4RFB A;  4PNY A;  4MN3 A;  2R6G A;  1EYA A;  5M5Y B;  2Z1C A;  4EQN A;  3J7A F;  1PTO H;  1JWM D;  4IUU A;  2J4X A;  2NN6 G;  1Y8N B;  3OMC A;  4KK7 A;  3BDL A;  2FHT A;  1HQR D;  1STE A;  1JC7 A;  2EY1 A;  2KCN A;  2KCC A;  3S16 B;  4DF7 A;  1CI3 M;  4EVO A;  2L11 A;  3CKI B;  4R9W A;  3S1R B;  3QJY A;  5C0X G;  1PTO B;  5C5L A;  1NSN S;  2D2C C;  5COY A;  1I4P A;  4F7X A;  1BBX C;  1R9T B;  1GUT A;  1OXU A;  2B2U A;  2KOL A;  5JJZ A;  2BDN A;  1U4P A;  1W6K A;  2D62 A;  2B2Y A;  5KYI A;  3M3Y B;  3GO5 A;  3N6R A;  3K59 A;  2K5Q A;  3KK7 A;  1RJT A;  4P2C B;  1PLF A;  2BE5 D;  3J7A V;  3FVQ A;  3I4M B;  3I70 A;  3J81 E;  4S3S A;  3D31 A;  3E5S A;  1STN A;  1D6E C;  4K6D A;  2C5C A;  2KA7 A;  3BZD B;  1GUO A;  2A74 C;  2JSO A;  1OO9 B;  1RTO A;  4FXG C;  4EGV A;  1FNV A;  2AUK A;  3NHH A;  5K5P A;  2PZT A;  4EQO A;  5DNF A;  1F2Y A;  4QB4 A;  2E2H B;  2EJF C;  5J22 A;  1CK1 A;  4OO1 G;  4CBV A;  1VMP A;  2B2T A;  2BDO A;  4RHS A;  1TS4 A;  2F0D A;  4UDU C;  4RGO S;  3MWY W;  2VB3 X;  3OPO A;  1BF4 A;  3KLR A;  2RKS A;  5JVH 3;  4G7H C;  3P75 A;  5CYU A;  3AB9 A;  1V1P A;  3O13 A;  3VYT A;  2A69 D;  3NUC A;  1CT1 D;  2B8G A;  1BXT A;  2LY7 A;  1R4P B;  3MXN A;  3SEB A;  2Z4H A;  1ESF A;  5LL6 X;  1E2V A;  1TS2 A;  5E4X A;  1SYG A;  3QG1 A;  5E3F A;  3R3O A;  1QG7 A;  2F0V A;  3D6W A;  3V05 A;  1EYC A;  1PXU A;  1C48 A;  3M7N A;  3A8J E;  5IIF A;  4RAU C;  4DN4 M;  1EZ8 A;  2F0U A;  2KVM A;  4KV6 A;  2NUC A;  2HQE A;  5LHY 1;  3S14 B;  3BDO A;  5DEH A;  4A93 B;  3WDN A;  1EU3 A;  1J8I A;  2E75 C;  3PIP 3;  4U68 A;  3ERO A;  3KBX A;  1I50 B;  2EYH A;  3R93 A;  1WVL A;  3FEW X;  4TKO B;  5ELF A;  3A8K E;  2KEC A;  3LX0 A;  3V2T A;  3NXW A;  4LMQ D;  5I2X A;  4A3G B;  1VDZ A;  1XX8 A;  2F0G A;  4RHR A;  1AP0 A;  3UI2 A;  2JP1 A;  3HOV B;  1JCK B;  2K5D A;  3D6C A;  1SYC A;  1S5E D;  2B2U C;  4AYB B;  1TWH B;  2JA6 B;  5E1F A;  2B39 A;  3NQI A;  1SE4 A;  3HS0 C;  1JR0 D;  2F0Q A;  3SK4 A;  4R8N A;  1BCP C;  4RKB A;  3PUV A;  4IUR A;  1BOS A;  1EEI D;  1ENF A;  1F2M A;  2KQ3 A;  1IYV A;  4IUP A;  5ELB A;  1H9J A;  2RDF A;  3SK5 A;  5IOD A;  1PTO F;  4BY7 B;  3W3A A;  1R4Q B;  1RTN A;  3DXJ C;  3ZYY X;  1YNN C;  2IW3 A;  3SK6 A;  1L0X B;  3D4D A;  4DGZ A;  2L9H A;  3P20 A;  1STB A;  3FRP B;  5ELD A;  2G9H D;  4KMU C;  1Q1E A;  3E6Z X;  1LAC A;  2HCC A;  5CV7 A;  1HA6 A;  2ZXR A;  5FK9 C;  2D5D A;  1SMY C;  3C1F A;  1EWH A;  1X32 A;  1Y8O B;  4KKS A;  2K32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...