3QO2A

Structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
MGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/gene regulation
molecule keywords M-phase phosphoprotein 8
total genus 12
structure length 61
sequence length 61
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qo2A00
1VMPA 1RTNA 3P7JA 2M2LA 4UAIA 4X3KA 1IKMA 3SVMA 1WTRA 2MJ8A 3Q6SA 1WD0A 2DY8A 4X3SA 1SDFA 1F9SA 1JICA 2EE1A 3GV6A 5D65A 2FINB 2FJ2A 2NZ1D 3IFDA 3KBXA 2B2UC 1F9QA 2KECA 4HAEA 4IUPA 2MPMA 4XT1B 2N55A 5E4XA 3TN2A 2RA4A 3I8ZA 2HDMA 1RODA 2BDNA 2Q8TA 2MGSA 1RTOA 2L12A 1HRJA 1KNEA 1S4ZA 3MTSA 1ILPA 5DNFA 1O7ZA 1PLFA 4QUFA 2B2WA 3N52A 1VMCA 4IUVA 1MI2A 1EIHA 4ZK9B 5AFWA 4IURA 3R93A 1EOTA 1F9PA 2R3ZA 1G2TA 5E4WC 1XYIA 1IKLA 1Q3LA 5D14A 4NW2A 1G6ZA 1DOMA 1B4OA 1KNAA 1B53A 4LMQD 1NCVA 4OIKA 1LV9A 4DN4M 1QNKA 2B2YA 1DONA 4RA8A 1J8IA 1QG7A 5EPLA 4IUUA 1O80A 4X3UA 1EL0A 1X32A 1O7YA 2B2UA 1EQTA 4O42A 1WTWA 1ESRA 1WTQA 1TVXA 2KOLA 5T1IA 1BF4A 1GUWA 1BO0A 3H91A 2FFKB 2B2TC 2KUMA 1EIGA 2JYOA 4XT3B 1HUMA 2D9UA 4ZAIA 2EPBA 1HFNA 1WVLA 3DEPA 1CA6A 5CBEE 2Q8RE 2X6GA 1ICWA 3MWYW 3UI2A 1B2TA 2HCIA 1BBXC 1DZ1A 4R9WA 1IL8A 4RWSC 5CBAE 2K01A 2KEDA 1MSGA 4IUTA 4X3TA 5CMDA 2B2VA 1ZXTA 2KEEA 2NYZD 4U68A 2B2YC 3G7LA 1RHPA 3I91A 2X6LA 3TZDA 1C8CA 1E0BA 3FPUB 2K04A 1HA6A 1PDQA 1F2LA 1BNZA 3ONAB 2KVMA 1AP0A 1U4LA 1MGSA 2CVRA 1WD1A 5EQ0A 4ZLTF 5EKIA 2NWGA 2B2TA 1AZQA 1ML0D 1SAPA 3FDTA 4HSVA 5EPKA 2SDFA 1JE4A 1DOKA 2L4NA 4IUQA 4QUCA 1F9RA 5JJZA 2L1BA 4MHEA 4CJ0B 1HHVA 1M8AA 1B50A 2DY7A 2EOTA 2L11A 1RJTA 1PFNA 3HP3A 2K1BA 1NR2A 3D6WA 1X3QA 2B2VC 1CM9A 2HDLA 4HEDA 1ILQA 2K05A 2FMMA 4R8IA 1WTXA 2HCCA 2XIWA 1DOLA 5CORA 1MSHA 1AZPA 1J9OA 3I90A 2L9HA 1U4MA 2IL8A 1NAPA 1PFBA 2X69A 3DM1A 3GV3A 3IL8A 2J7ZA 1U4PA 1G91A 1A15A 1XX8A 3LWEA 2VXWA 1HUNA 4ZKBB 2K28A 1SSOA 2HUGA 3F2UA 5COYA 4HCSA 5T1GA 4CJ1B 3QO2A 1HFGA 2H1EA 2FHTA 3I3CA 3DEOA 4CJ2C 1NR4A 4RAUC 1WTOA 1WTVA 1WTPA 2JP1A 5EPJA 1B3AA 2RSNA 1PFMA 5EJWA 2B2WC 4OIJA 1G2SA 2RSOA 2K03A 2N88A 4XDXA 1U4RA 2MP1A 1X3PA 1CA5A 4ZKCB 4MN3A 3KUPA 2RVLA 1QE6A
chains in the Genus database with same CATH superfamily
1VMPA 2G9DA 3OWFA 1VQ4A 1EYAA 2ZTDA 2CHBD 1C0AA 4A3DB 1S5ED 4LF9L 1D8LA 1VQIA 2N49A 2RCFA 2E5LL 2B3GA 3SHLA 3JAMc 2O5JC 4BY7H 1DJRD 2YTXA 1OTCA 2Z1CA 4C1NK 3GD7A 5IYCG 2A5HA 4JW0A 4KK7A 5I6WA 4RKLA 1Y69U 1XYIA 1IYJB 1Q82C 1R4QB 1L0XB 4NW2A 4CHTB 3KOJA 1KHIA 1TWCB 5AJ3L 1QNKA 2B2YA 4A3EB 1YNND 1XMOQ 4IOCA 1FVIA 2EY5A 3GTOH 1IW7C 4O42A 2NTSA 2F0QA 3K7AH 3MXNA 1NBWA 4RMFA 3IRBA 4RGTA 2R6GA 3Q8DA 2EIFA 2X6GA 3A56A 1NUCA 1VS0A 4AQYL 1E1OA 1HQMC 3NBHB 1YNNC 4NXNQ 1CFMA 2RDHA 4BBSH 1YHQA 4P75A 3HOUG 3HOWH 4K8JA 1F2MA 3ONAB 1MJEA 1LLRD 1MGSA 1Y1WH 3PO2G 2HIXA 3VR6A 4QL5A 5EPKA 2PW7A 2R7ZG 4HJAA 1U9RA 4CJ0B 1QZGA 1PV4A 1GJXA 3T51B 5C3XA 2AQ3B 3F2DA 2PMZB 1BOSA 2AQ2B 1IBLQ 1NSNS 3CMEA 3O13A 4KI0A 4LF4L 2F0EA 2DGYA 4QIWE 3CCQA 1JCKB 1YBYA 1J9OA 1I3QH 4JV5Q 2X69A 4GN3B 1U5KA 4PMBA 4K6DA 1EFID 4GS3A 3TEHB 4R1JA 1B70B 4UHVA 3BVGA 3DXJC 5G3LD 1HR0L 3T1HL 1QCBD 4X65L 4DV3L 4A3IB 4BBRB 1RKNA 2MP1A 3Q23A 3TP7A 4G57A 1QE6A 1HCZA 1SNPA 3LWUA 3UDFA 4IPCA 2EYMA 4CDEC 5M5WB 3GV6A 2EE1A 3T53B 4R4QA 4OWXB 1SEBD 4DK1A 3KBGA 1I4XA 5JAVA 2D0PA 2Q2HA 2CW0C 3SK5A 5IP7G 3N6RA 2LY7A 2L12A 2K5HA 4JI1L 2JXMB 5KYLA 3MTSA 1EY6A 1PLFA 1VF7A 3N52A 2F0OA 5M3FG 3HOYH 1EZ6A 1LT4D 5A35A 3BS1A 1JOOA 5D14A 2F0NA 1MBYA 3R3OA 1K0RA 1GHKA 1PZID 1QWYA 4A3BH 4XYOA 3CCVA 2Z8LA 1OXUA 1EWCA 4HMJA 4DV6Q 2Q2TA 3OYYA 5E3FA 1O7IA 3S1QB 2K75A 1WTHA 2EJFC 2UUBQ 3I4LA 3Q0AA 2PQEA 1DZ1A 4RWSC 5CBAE 3EA6A 2R7ZH 3NTIA 1LT6D 1HR0W 2Y0SB 3PO3H 2A8VA 1TWCH 2X6LA 3S14H 2CQAA 3J80c 5K5PA 4FXKC 4NPSA 4RGNA 4JI8L 4LF7Q 2CWAA 2F4VQ 1AE2A 4A3DH 4GLXA 1STNA 2F0KA 4MZ9A 3I70A 5IT9L 3JAML 1FGUA 3OHXC 1DOKA 2R7DA 1IBKQ 3RLFA 4JI7L 3ULLA 3CD6A 3K5NA 3W5OA 1YZ6A 2K1BA 4UPAA 3HS0C 1HZAA 4A3LG 1ILQA 3HFZB 1EY9A 4OX9L 4ILWA 4HJ7A 3MAQA 2WB1E 1U4MA 2EYLA 1D7QA 1N34L 1N36Q 3HOZH 1XX8A 5A2QE 3GQBA 3EBEA 3RN2A 1VQKA 4P74A 3QO2A 3W1BA 5CV8A 4G7OC 1JWSD 1VQHA 3DEOA 4RAUC 4CKBA 4DXGA 2K33A 4XDXA 4LF8L 3BVZA 3U9SA 1SYEA 1BCPD 4FXDA 1L0WA 4X3KA 2A73B 1CTMA 2OXPA 4BY1G 1E1TA 5D65A 2QKIC 1IYVA 5C5LA 3HKZG 1PRTF 5M3MG 1EUJA 4JI5Q 2BDNA 1PZJD 3S15H 4QB4A 3FVQA 3GTQH 2R93G 3FPPA 1KTKA 1S5BD 3QR8A 2ZJPA 1S4ZA 1JQYD 3CCRA 4ZK9B 3R93A 3D4WA 1EOTA 5LL6X 2L55A 2GVAA 2QDLA 4BXXG 1II3A 1STAA 4YIJA 1S5DD 4CKEA 2ZJQA 2HQLA 2MQHA 2NUCA 2XN9C 1X32A 4M1UB 4LFCQ 2WKDA 4LF9Q 2ID0A 2B2TC 4XT3B 4C2MB 1S72A 4YCUA 3KLRA 5I6YA 2ZT9C 1TU2B 2DNCA 2PYKA 2VL6A 2OEOA 5JVG3 3S17B 4DF7A 2I0QA 2KEDA 2MFIA 2JA5H 2CFMA 2UXCQ 1ZXTA 3KLSA 3HOXB 4XYQA 4LF6L 1S5CD 2EYPA 1BUVT 2RHQB 2J0TD 3MA2B 4B3SQ 3RNUA 4KD3A 1PVOA 1W3SA 4X62Q 5LMNL 4KN4C 1C9OA 3H09A 4YCVA 1ZKOA 1H9RA 3ER0A 1Z47A 2Z0SA 1PH1A 1LTBD 4KHPL 1PH5A 5I4DA 3JAMi 3DM1A 2B63H 1H9JA 4RHRA 3I4NG 1NJIC 2VXWA 4CJ1B 1H95A 3TP6A 1WTOA 1NR4A 3GO5A 4C3IG 3CCMA 1EFWA 5GROA 2B2WC 3CAMA 4LW1A 1B7YB 1AH9A 4RGOS 1P16A 1RCVD 4UAIA 2BA1A 5EKKA 5CV5A 1X55A 5KNDA 5GAEC 1QNUA 2EDGA 5CC4A 4GN5A 2KECA 3I72A 1J6QA 3I4MB 1Y8OB 3GTKB 1VCIA 5JJKA 5IP9H 4G7HC 1RODA 1ENFA 2JA7G 5IYCH 1RTOA 1STBA 2VNUD 1HZCA 3LX0A 4LJZC 2L5TA 1O7ZA 3U4VA 1EY0A 1VQOA 4CDFC 2R3ZA 4JI4Q 4A3FG 1Q1EA 5E4WC 4XQQA 3W3AA 4DNIA 4GKJQ 2AHOB 1NTGA 3RD4A 2NBFA 2JQOA 4JBJA 3PCOB 1D5ZC 2K14A 4TKOB 3CW2C 4KHVA 4DK6C 4DR3Q 1WTWA 2R7ZB 1EQTA 2RBMA 2E2IB 5IYBH 2FMCA 3X3NA 1H9KA 1HUMA 3TBIB 3HRZC 2D5DA 5IYBG 1VQPA 1ICWA 2CW0D 1KABA 4EQ5A 4DV5L 5FOBB 4JBKA 1EEID 3J7AF 3PSIA 2K32A 2F1MA 4ABNA 4MNOA 5IOCA 5IWAL 2HHHQ 4F7XA 1MIUA 3BZCA 2O2LD 1TWHH 4NXML 4DKAC 1Q7YC 1AFPA 1SE8A 5IY0A 4APVA 4DR6Q 2NWGA 2B2TA 4DV6L 5C6AA 4HSVA 1PH7A 3MVVA 1XPRA 4QUCA 2CWPA 4CKCA 1KLUD 1JWMD 4YCWA 1PZKD 3GTKH 2DY7A 3K80C 1MHWC 1CM9A 2HDLA 4R8IA 2XNAC 2NTTA 1HNXQ 3HEJA 3FP9A 5JJLA 4E6IA 4LFAL 3PF5A 4A3CG 2BDOA 1U4PA 1G91A 1GVPA 1TWFH 5C44G 5COYA 3T1YL 3IAYA 3HOWB 3I3CA 3A7AB 1IL2A 1PMRA 1PFMA 2ICIA 4X65Q 3ICEA 5JEAH 1I4RA 4Z9CB 3EFXD 3KUPA 5FLXc 2MUYA 1MD2D 3PF4A 1NY4A 1R9TH 4A93H 5EGTA 3FKIG 3M7GA 4P73A 3S1MB 4DAMA 4YHHQ 1QZHA 1CZWA 4PMWA 3NE5B 1S40A 1QVCA 4DV4L 4BS9A 2B2WA 2ICEC 4MTKA 1LO5D 1F9PA 2XTIA 4C2MH 1SN8A 3CRLC 1TT2A 1M1KC 4LMQD 4OELB 3NK9A 2K5NA 4DR7L 4IUUA 3UE0A 3B6YA 4BA2I 2ZM6Q 4OEMB 1CI3M 4DK0A 2DNEA 4POGA 4FP5D 3ULJA 1EIGA 1EU4A 3ND8A 3S2HB 1V9PA 2E8GA 3BYTB 3H3VI 4PNYA 4Y7NB 1TKWB 2DJGC 2E74C 1YJ9A 2UUBL 1TY2A 2JA8H 2WV6D 1EY4A 3TS2A 1YIJA 1LTID 5IGDA 2F03A 2Y0SG 1GOZA 3F2BA 4IN3A 4KD4A 3VYSA 4IZ8A 2XWJB 1U4LA 1BDOA 2DN8A 1L0YB 2IW3A 1EQRA 2WAQE 4ZLTF 1RD9D 2K5WA 1VDZA 1NE3A 5GADC 1DCZA 2SDFA 2PO4A 1EWIA 3ZJYC 3T1HQ 5IP7H 4EX5A 4A76A 2N3SA 2IJ0A 2Q2IA 3K5MA 3PIPA 3BDOA 3GTPB 3KDFA 3J81c 1TY0A 4PV1C 1TWFB 1JE5A 1LTAD 4NKLA 5M3FB 2AQ1B 5HGQA 1KD1C 2ZTEA 1PH8A 4K5XA 1XJVA 3AMUA 1I50B 4OWWB 1EOVA 4H0LC 3S2DB 1PH3A 1SRUA 2N78A 4J6HA 1QILA 4A3GG 5BR8Q 1I4PA 5CYUA 3D8GA 1HPCA 4EQPA 2JE6I 5DAUA 3X3MA 1E2WA 2K50A 5TSSA 1PTOH 3PIP3 3K7UC 4O2DA 1DYQA 1U0LA 3NBIA 1B9MA 3SR1A 1V1PB 5ELFA 3H6MA 3RZDH 2E76C 1EY8A 1V43A 4DK3C 1LTTD 3OOCA 4NMZA 2GN5A 4JI7Q 1VMCA 3M4PA 4A3EG 2B8GA 3PIO3 2QA4A 1C7YA 3A7LA 1XXGA 4KKSA 1NCVA 2DUDA 4LFBQ 4DAVA 4TQUS 4OX9Q 1H9SA 1XMOL 1PH9A 2KJXA 2IX3A 3EROA 1ASZA 1TS2A 4BY7B 2WAQB 2FFKB 1W6JA 3PO2B 5M3MB 1B44D 1VQAA 1VF5C 1HR0Q 4HMIA 4JI0L 4AQYQ 4V0BA 2ZXOA 3S15B 2BH2A 1W2BA 3TZUA 4R8NA 3CQZH 1DD2A 3CC7A 2SOBA 1FR3A 3LNNA 5ELNA 4L8JA 1AN8A 4B3SL 1ONLA 3G6JB 4ALPA 1DXMA 4P71A 1K83B 3M3YB 2OTJA 1X65A 1D1IA 3QOJA 3RMHA 5HY6A 5JPNC 1FNVA 3VYRA 3KJOA 2KCNA 1IBLL 1WOCA 4A3BG 4C3JB 1Q12A 4HEDA 2IT1A 1WTXA 2K4KA 4FO2A 4JV5L 4ZQ3A 3CP0A 3I90A 5LHY1 4LFCL 4S3SA 4JBMA 1A15A 2PMZE 4HIOA 2E5LQ 2QEJC 1R9TB 1QJOA 1TS3A 3WOFA 1PH4A 1KDCA 5J22A 1GD7A 2RQXA 1IBKL 3GTMB 4IFDG 5C44B 1KLGD 4BY7G 4JI3Q 3J81E 3CCEA 3VR3A 1RL2A 2M2LA 1L1OB 4CDCC 4A3CH 4ZUJA 2IHEA 3SXHA 2E2JH 4M8AA 2XVSA 4FF4A 4UDUC 4IALA 5ELCA 4BA1I 3I8ZA 2HDMA 3D4RA 2WAQG 1EQVA 2OQKA 1BCPC 4BWGB 5DNFA 1VQ9A 3S16H 3I56A 4IUVA 3NWSA 4AH6A 4A3LH 2A69D 4DR4L 4DUZQ 5CV6A 1B4OA 5NUCA 1FGBD 4IPDA 4DNRB 1Q1BA 2MO0A 5EPLA 2ALYB 2EZVA 4JI2L 2IX1A 1IXRA 1HXYD 1X3GA 3PV0A 1JMCA 2NVXB 4F87A 1ESRA 1IHZA 4B3MQ 5LMNQ 2PPBC 2A69C 1JB3A 4K8IA 1CA6A 3G6EA 2VY3A 3FRPB 2MNAA 2VQFQ 4G7ZC 1B2TA 1GUTA 4F88A 1SJHD 3H0GB 2F0UA 3U4ZA 1K0SA 4LF8Q 1L2FA 2K01A 3GTOB 1QOHA 2B63G 2EYJA 5K36H 1XMQL 3I91A 2QILA 3FMCA 1P8LA 1EZ8A 1LACA 1SNDA 1WD1A 3Q22A 5EQ0A 2VUMH 1LYLA 1MKHA 2BH8A 1KAWA 3HOVH 2XRQD 5IIFA 1W6KA 1J5EL 1SROA 1SE2A 2Q8IB 1GM5A 3KYHC 1NR2A 2VB3X 3NQTA 4A3FB 1TS5A 2A6ED 3J80i 2EY1A 3K5OA 5FLXL 1F2ZA 1CQVA 4MIUA 2L9HA 3FHWA 4IO9A 4DR3L 1PFBA 5LL6S 2JA5G 1D5XC 2J7ZA 4K5WA 4JC0A 4RCNA 3NBHA 4AIMA 1K83H 4U673 1HFGA 4JI1Q 2GVBA 2JP1A 1IBML 1TIID 2A6EC 2F0HA 3HGBA 4R4CA 2UUCL 1WCMG 1JJGA 3WDNA 2BE5C 4A3MH 2E2DC 2UXCL 3KK7A 3C3LA 5HURA 3FEWX 4CGYB 4RFBA 4IUPA 4C3IB 2F0FA 4DV1Q 3SE0A 3VYTA 3T16A 4QMGA 2I07B 1XWEA 3TP5A 2MHVA 2NVYB 3I7FA 4OGQC 1VQEA 3BZDB 5C3EH 3FKIB 1G6ZA 1DOMA 1X54A 2PCFB 4ME3A 3AQQA 1J8IA 1Q8KA 3HOXG 1CT1D 5C3EG 4X3UA 4KMUC 3MFGA 2HHHL 4NB3A 4DPGA 1TVXA 3H0GH 3GTQB 1FNUA 4Q0FA 2KUMA 3KF6A 4KJOA 2IWHA 1SFOB 1D6EC 5FJ8G 3CC2A 2UUAL 1C48A 3J81i 4A3DG 2QGQA 3NWTA 4JI4L 3RLOA 1AE3A 2K5VA 2RCNA 1GHJA 2OCEA 3TMEA 2NVTH 2CKZB 2KEEA 2WKCA 3ERSX 3GTJH 4LF6Q 1TQOA 4LFBL 1RHPA 3U50C 1SXTA 1TXYA 1E7ZA 2XGTA 2H5XA 4Q5VA 1BNZA 1E22A 2F0JA 3W2DA 1VQFA 5M5YB 5L37A 3TP8A 5FO9B 2ENBA 4A3FH 3S1RB 5CV9A 2RF4A 4MHEA 1VQDA 4AYBB 3STBC 1N33L 1RJTA 3KF8A 1G6PA 2WIIB 2JA6G 1XNQQ 4KY7A 4B9WA 1V1PA 4DR7Q 3T56B 1PA6A 2RKSA 1NNXA 4FXGC 4A75A 5IT9E 1HZBA 5IE8A 4GLAC 4PZ8A 4EVOA 5M9OA 2LSSA 3OWEB 1CSPA 1SSOA 4HCSA 3OPOA 5C4ZA 3CPWA 1LTLA 2AWOA 1Z6HA 4RGMA 3KF8B 1K8MA 1R4PB 2I46A 3NQIA 5EPJA 4RKBA 3T13A 5BR8L 3HKSA 2RSOA 1K8GA 2N88A 4G4KA 4MN3A 4C3IH 1I94Q 1SNOA 5C4JH 2K6AA 2SEBD 5LMNW 4L5RC 1N32Q 2F0DA 3HKZE 4O0AA 2NZ1D 2FJ2A 1N9WA 3TN2A 4OWTB 2N55A 2NVTB 2J4XA 4TSSA 4GKKQ 1UNSA 2JA8B 3V96A 4UP8A 4BBSB 2LKVA 1SYGA 3OW7A 1I50H 4LUVA 1G2TA 3HZXA 4IJLA 4DR1L 4GKJL 3W1GA 4JCVE 4C3HH 4OIKA 3P75A 4RA8A 2F0IA 5IODA 1O80A 3M4OB 2VS1A 4YWLA 3SDZA 4C3HG 5KIXA 1VQJA 2PZTA 3QG1A 1BF4A 5J3BA 1HTLD 5DM73 2NN6G 1VQNA 3T1YQ 2EPBA 1WVLA 3SK4A 4LF5L 3C2PA 4X6AH 2JSOA 4MTNA 4DV5Q 3I4NB 4DR4Q 2KQ3A 3ITPA 2EVBA 2GA4B 4KY5A 5IWAQ 1Z7TA 3TZDA 3GTGB 1HA6A 2K04A 2WB1G 4WJWA 1ZYRC 2Z4IA 1ET9A 2EQSA 3M9BA 1AP0A 3QJYA 5JOBA 2ZM6L 5EKIA 3MC0B 4QJFA 4B3ML 2ASBA 1FJGL 4I7ZC 3M4YA 4IOAA 2NZHA 3MEFA 3OMCA 4HIKA 1I6VC 1CKOA 4WFN3 1E24A 5JJZA 4C56C 2L1BA 3DWAA 3GTMH 3E9IA 1GO3E 5K36G 1KDAA 3TSSA 2L11A 3CRKC 2WFWA 1S5FD 3D6WA 1KC8C 4QCLA 1LT3D 1PTOB 1XPOA 1KDBA 1PYSB 1K28A 3EJIA 5EBDA 3H15A 2QCPX 2L0CA 4H13C 3E5SA 4IJHA 4FVMA 2XRSD 5KRUA 4ZKBB 1PXUA 2UXBQ 2PNHA 4DR5Q 1PFSA 4WJ3M 4A3KH 2QF7A 1A2UA 2BOSA 4FF3A 2R92G 1SE4A 3D31A 3P20A 2WB1B 4LUOA 2JA7H 2A68C 5FLMG 2KHJA 2RVLA 2OF1A 1RTNA 2BA0A 5F2DA 2F4IA 1VQ6A 3BDCA 3SVMA 1PHJA 1QVGA 2Z6BA 1A2TA 1SDFA 1F9SA 3VR5A 4H02A 4HAEA 4A4IA 5I9PA 2VQEL 1CHPD 4GN4B 2NVXH 5EKLA 3NENA 1M90C 4IFDI 3NSWA 4N8X1 4DV4Q 2A74C 4C3HB 2YTVA 1EYGA 5LMUL 1SYCA 2EJMA 2AUKA 2WACA 3HOZB 3BG3A 4A3GH 2NB0A 4N8FA 3A55A 2Y0SE 4QGUA 5C4JB 3OSOA 4BY1B 1I4GA 2ZTCA 4K14A 3NUCA 3WWVA 1H9SB 2M00A 3VR4A 1VQGA 4BBSG 3QOLA 1O7YA 2Z9HA 1DGSA 2AUJD 3R2IA 3QIAA 2HIVA 2KOLA 4XQJA 3F2CA 4JI6Q 2JEBI 3JC66 4CDDC 2D9UA 5FO7B 5M5WH 2IX0A 4V190 1CUKA 1YHBA 5M3MH 4X66L 1E2ZA 1G8ZD 2ZJRA 2LS01 3HOUB 3K57A 1JJCB 5BN4A 3C1FA 1X9NA 1ZYRD 4A3JG 4DAPA 3H0GG 1C8CA 2O4XA 1PDQA 1YJNA 4A3IH 2Q2UA 1I4HA 5J39A 5KEEA 1OO9B 1SE3A 2KBNA 3E9HA 1LT5D 2WINB 3M3YH 1ML0D 3OIPA 2NVQH 4K2KA 4DNTB 4X64L 3BVMA 4QIWB 2HT1A 2A19A 1HNZL 1D5MC 1A3UA 3EIVA 3HP3A 4JVZA 2PQAB 4ODGA 1A0IA 1Q81C 3I2ZA 2ES2A 1UAPA 5GAHC 3NEMA 4QY7A 1CZGA 4WJ4A 2OTLA 3IFTA 3F2UA 1S3OA 1XTDA 5GAGC 1WTPA 1WCMH 3S9WA 5EJWA 3TREA 3Q24A 1CA5A 1STGA 2Z6KC 4PG3A 3P7JA 5C3EB 2C5CA 5M3FH 3HOYG 3I4NH 4DV2L 3M85A 4DUYL 5C4XH 3VR2A 4DV0L 2UU9L 1H9MA 4C3JG 1X3FA 2FINB 2RDGA 2PZUA 3KBXA 4C1NI 5E4XA 2R93H 4EQNA 5C4XG 1GUOA 1T5XD 1YHAA 5DEHA 5C0XI 1L1OA 1EIFA 3DWPA 1FL0A 5CR3A 4GOPB 4KN7C 1FD7D 4QUFA 4J15A 5AFWA 4IURA 4HJ8A 1I5FA 2EYFA 2F0SA 3AU7A 4KKUA 1Q3LA 5CV4A 4TVAB 2NN6I 4QQBX 1UWVA 3C1EA 1LV9A 1T9HA 4DN4M 1XMQQ 1QG7A 1UUPA 1T5EA 2JK8A 2JN4A 4IPGA 4L6TB 2MO1A 2LFNA 3UDXA 1A8VA 2DJFC 4A3IG 2JYOA 2K5DA 5G3LF 4JI0Q 4ME5A 1SFOH 2HCIA 4HN7A 2F0LA 2L15A 1J5EQ 1KAAA 4RHSA 4JI3L 4POFA 4IUTA 1MSGA 4HR7B 2F3VA 1GUSA 3L0OA 5IYDG 1WCMB 5AJ3Q 4WORA 3M7NA 2UXDQ 5DLQE 1YVCA 3EQLC 4JI2Q 1OXSC 1G291 4UP9A 1HZ9A 3AB9A 1IYUA 4LUZA 1I3QB 1SAPA 1A3TA 1CK1A 2JA6H 1EYDA 1AW7A 2EOTA 1VQ8A 1PFNA 3BYYB 2AKWB 2UUCQ 3L3OC 4HIMA 2VW9A 1XNQL 1VQCA 5CORA 2HD3A 5KNBA 1ESFA 3CXCA 1K3BC 4RH6A 4DV1L 3M4QA 1QB5D 2FHTA 1PTOC 5J1ZA 3ZYYX 2OWOA 3D0FA 1SMYC 2VQFL 3DWQA 3A74A 1AEXA 4JOIC 4ZKCB 4K2LA 1I94L 4B3RL 1X3EA 1VQBA 1JOKA 4PQXA 1IKMA 3Q6SA 4EGVA 1JICA 2F0WA 3D6CA 2CH4W 2TMPA 2KCTA 1CKMA 5I2YA 3V2TA 4HTHA 3H94A 1STHA 2A6HC 3NP8A 1EYCA 4RCOA 2QDBA 1V1OA 1C4QA 4DUZL 1K3RA 2KCMA 1XTCD 2OT2A 1OXXK 3FKIH 1UEBA 2WP8J 2OQ0A 4N9TA 2A1AA 1CKNA 3MEHA 1HNWQ 1STYA 1TWGB 1LTGD 3S24A 4KKTA 5ELDA 1HQRD 3RZDB 2CCZA 2VQEQ 4UP7A 3G71A 3C46A 4ULLA 4ZAIA 3S1RH 4B3TQ 3PUVA 4A93B 5GQOA 2Q8RE 1TWAH 3MWYW 5LMUQ 2EYOA 1CKNB 1UE1A 1BBXC 1BCPB 1XNRQ 3E3XA 2KENA 4NXNL 4X3TA 4HSPA 3EVQA 5FKAC 4U68A 5I9OA 3DM3A 1XPUA 1ICFB 3J7AV 2R61A 2EXDA 2KVMA 2F0VA 3KLSX 4OO1H 1X56A 2M9VA 5JVH3 3K81C 1WI5A 3QWNA 4JI6L 4R4OA 2H4OA 4ZCKA 1Y14B 2JA8G 1E2VA 1UE5A 1KRTA 4DAYA 1UEAB 4ID6A 4IUQA 1F9RA 5IGFA 1JJ2A 1BQQT 3D3RA 3T4AC 4K0KL 1HHVA 2VZAA 2F0TA 4DR2L 2R7FA 4FNFA 1RDPD 3GTLB 1SYBA 2HCCA 3A0JA 2I5LX 4JBWA 3KJPA 4GNXB 4JG2A 4B08A 1HUNA 3OTOQ 5T1GA 1B8AA 3RLNA 3GTGH 1PRTC 4LF5Q 2IY5B 1TWHB 4UY8C 1PRTB 1B3AA 2UUAQ 3PUXA 1G2SA 2B8FA 4JYAL 1EL0A 5T1IA 3WOEA 5FO8B 1HTPA 4DR1Q 1PH6A 2D0OA 5HGTA 5JEAG 4KJNA 1RF2D 4X3SA 4I65A 4PZ6A 3IFDA 4AYBE 1F9QA 4A93G 4PMCA 4AYBG 3S1NB 1A6XA 3G4SA 4YY3Q 5CGKA 2QW7A 2K7VA 4DA2A 2VUMB 1ILPA 4FF1A 1MI2A 2E2JB 4FDBA 3J7ZC 4JOIA 3MXGA 1PRTD 3HOUH 3K59A 2O5IC 1Z9FA 5IGBA 4DFAA 1WYDA 1Y1WG 3L9AX 5CV7A 4DUYQ 3K0YA 4R4IA 2B2UA 3ERQA 3HOXH 1WTQA 1JOQA 1CSQA 4DR5L 1BO0A 2NZOA 1HA5A 2C35B 3CCSA 4KY6A 4CBVA 1SYDA 3S1MH 5CBEE 4DV3Q 1ZEQX 1BBWA 3CU7A 4XQNA 1IL8A 5CMDA 3NPPA 2B2VA 4J1MA 1Y1VH 3CF5A 4WRDA 4I7AA 1B1ZA 5FLMH 3TQYA 1YI2A 3HOVB 5C0XJ 3CC4A 4A3GB 2CVRA 4RG1A 5IGCA 3MFYA 1YITA 2B39A 4A3KB 1SMYD 3MXUA 1AZQA 5KNCA 1Q46A 2C9OA 3FDTA 3GTLH 2JA7B 1YNJD 1IBMQ 1CHQD 3RN5A 1N33Q 4GOPA 3K58A 1NMFA 2Z6KA 5KGUA 1SMXA 3J7A5 2K05A 3MXNB 1EEFD 1MSHA 4DV7Q 3NTKA 1EU3A 3RZOB 5C5MA 2NN6H 1PYBA 2IL8A 1A3VA 1NAPA 3LGJA 3IL8A 1D2BA 2IPKD 3RUZA 1TS4A 2F0GA 1SYFA 4FF2A 1SNQA 4PZ7A 1Q90A 4NP5A 1ENAA 1WTVA 1FYCA 3IKJA 1L1OC 3L7ZC 5I2XA 4ZUIA 2F52A 1VQ7A 1SLJA 1EY5A 3KLWA 2TSSA 3CCLA 1EIYB 1Q86C 4BY1H 2NVQB 2JA5B 3R8BA 3UE1A 5IGGA 4LAAA 4LWCA 1EY7A 2MJ8A 2EYHA 5M5XB 1WD0A 3S2HH 3PO2H 2G5DA 4XT1B 4A3JH 2R92B 3BJUA 1KIXA 3E0EA 5M5YH 1Y8NB 2UXBL 4GKKL 3PUYA 1BVSA 3NHHA 4IFDH 2ZXRA 2PW5A 4KLKA 2MGSA 3BDLA 4R4TA 2R93B 1HRJA 1SNCA 3SGIA 3TS0A 3CQZB 4XXEA 4X66Q 1QUQA 4DXFA 3SK8A 4A3KG 4K5VA 3AFQA 4BXXH 3J80L 2E2HH 3PUZA 5FK9C 1IKLA 3HOVG 1O7LA 2ATWA 1PH2A 1Y8PB 4OHJA 1BKBA 3K8AA 1DONA 3AYHB 3K0XA 5C44H 3K7AB 3MZ5A 1B3QA 2FXQA 1GUWA 4Y52H 3H91A 2F4VL 2RHSB 2B29A 4H7BA 1Q8IA 3AFPA 5C4XB 2A68D 2I5HA 4X64Q 3QB3A 4B9XA 5IYDH 2AMCB 1JORA 1F77A 4FYDA 1LUZA 3GDEA 1HNZQ 4R9WA 2E2IH 3HOYB 3HG9A 1BBUA 1SBBB 3MHBA 2B2YC 1I6HH 3FPUB 1F2LA 1I4QA 1F2YA 2A6HD 1KRSA 1JWUD 3I4MH 3HOWG 2HQEA 1FJGQ 2K52A 4B3TL 1JE4A 5BN5A 1VQ5A 4L5TA 1VQLA 4HJ5A 5EAYA 4KHPQ 5D3IB 1GUNA 1MJCA 3A54A 2PI2A 2JA6B 2B2VC 4LF4Q 3KF6B 1N32L 1O78A 1NMGA 2Z4HA 1DOLA 5EBCA 4HCEA 4LNQA 3H3VH 2E2HB 4JI8Q 2YTYA 3F8TA 4LF7L 2YV5A 3P1HA 2SNSA 2VB2X 2HUGA 1A63A 5ISRA 2H1EA 2BCOA 1QVFA 4F8MA 1GXDC 4IUNA 2RDFA 3L2PA 1JB7A 1OXVA 3HKZB 4K6LA 4QF4A 1ENCA 2K03A 3S1NH 4J8QA 5FLXE 5ELEA 1E3PA 2JJQA 4A3JB 2R92H 1HH2P 1GUGA 1JC7A 2EY6A 4P2CB 3PIOA 4OONA 5IGEA 3J81j 2KA7A 2N8NA 1BCPF 1D1KA 1TR5A 4IPHA 4LFAQ 3RZOH 4YWKA 1JR0D 4IFDJ 4X62L 3I4OA 2LXKA 2RA4A 3BZKA 3NXWA 4DU9A 2Q8TA 3AEVA 3E0JA 1KNEA 1HJPA 3NELA 3CCUA 1EWHA 4A3MG 1TWAB 2V1CC 3DUZA 2EY2A 4ZYSA 1EIHA 1PYWD 2P5ZX 5JJIA 2KHIA 1KNAA 4Y7NH 1B53A 2G9HD 1ET6A 3HOZG 1KL9A 5C0XG 1LABA 1SJED 3F1ZA 1HNWL 5JEAJ 4JI5L 1WFQA 1UE7A 1Y1VB 1KXLA 2PNRC 3PUWA 4NDXA 4XIGS 1YEZA 4YHHL 3DEPA 2E75C 3I4MG 1BXTA 2V4DA 3UI2A 3VA7A 1A62A 5KYIA 5DM63 5H1SE 1XNRL 1DM0B 3M4OH 1YNJC 3S16B 2NYZD 3G7LA 3I55A 1RIPA 2F0PA 3BU2A 1WJJA 4L63B 2LMCB 3KDFB 4GNXA 1KQSA 3J80E 1V8QA 3CKIB 4H44C 4EQOA 3STBD 3VDYA 1EQQA 3CHBD 2BE5D 2YU9H 2K5QA 3A8IE 3K5LA 4OL7A 4XTCS 5FJ8H 4HJ9A 3V05A 2SNMA 3S2DH 3MXPA 3PGZA 1X3QA 4DR2Q 3VA5A 1AZPA 2YYZA 2B63B 3DMUA 2PI2E 2KHSA 2KCCA 4BBRG 2CQOA 3G48A 5IT9c 5ELOA 4CJ2C 4JK1C 3A8KE 4P72A 2XSCA 3GTJB 2RSNA 4GZYC 1U4RA 1X3PA 3CPFA 5JPMC 3NTHA 3SEBA 4HIDA 1WTRA 4DV2Q 2PZWA 2DY8A 4DV0Q 1Y1WB 2UU9Q 1ASYA 2B2UC 3I73A 1K8OA 1PTOD 2MPMA 4KHZA 5C0XH 1I6HB 4DR6L 3TDQA 3GP7A 4OO1G 1BR9A 5C4HA 1FNWA 4OXPA 2AWNA 1M4VA 1LTSD 3JAME 4L5QA 3EN2A 3RR5A 5A2QL 3CCJA 3OMGA 3R2TA 5E1FA 3J7YW 4JPBW 1HNXL 1YNXA 4DGZA 3A5UA 4L5SA 1B9NA 3ND9A 2IHFA 1TWGH 4GLVB 2CH4A 2VUMG 3PO3G 2JEAI 1GKHA 1X6OA 1V1QA 3A8JE 1K8AC 1HFNA 4KTAA 5BN3A 4A3EH 4LK1C 1PTOF 3S17H 5IP9G 1LTRD 2JA9A 1Y1VG 3ULPA 4GOPC 4K0KQ 4N9PA 4TRDA 1K73C 3CMAA 4OO1I 3PMFA 2XWBB 1G51A 1N8RC 4B3RQ 1IZ6A 1OXTA 3GTPH 1JT8A 5E7NA 2UXDL 1E0BA 5C3WA 4ZRZA 4YWMA 3KFUA 5ELBA 4KV6A 2F3WA 3PQIA 1N36L 1N34Q 2F0MA 2D62A 3UDIA 1K9MC 4A3MB 3OTOL 2ZXPA 3DLLA 3VYUA 2L4NA 4O1NA 4BBRH 2D2CC 3H3VC 3S14B 3UDGA 1M8AA 3A5ZB 2I5MX 3OIQA 1B50A 3DHQA 3TRZA 3SK6A 1LM0A 1STEA 4JYAQ 1YJWA 1UE6A 3E6ZX 4A3BB 2LXJA 2FMMA 2XIWA 2EXZA 3J81L 5M5XH 3U9OA 4DV7L 2F3IA 1CQFA 3URYA 4DAYB 3GV3A 4NXMQ 4IQZA 2NVYH 4GNXC 3S1QH 3LWEA 3U58A 2K28A 5D3DA 1VQMA 4C3JH 1IW7D 3K6OA 1SNMA 2EJGC 4YY3L 2QEXA 2PQAA 4OIJA 2YU9B 1QUQB 3OW2A 1SR3A 3PO3B 3D4DA
chains in the Genus database with same CATH topology
1VMPA 2G9DA 3OWFA 1EYAA 2CHBD 4A3DB 1S5ED 3SHLA 2O5JC 1DJRD 2Z1CA 4C1NK 3GD7A 2A5HA 4KK7A 5I6WA 4RKLA 1Y69U 1XYIA 1R4QB 1L0XB 4NW2A 4CHTB 1TWCB 1QNKA 2B2YA 4A3EB 1YNND 2EY5A 1IW7C 4O42A 2NTSA 2F0QA 3MXNA 4RGTA 2R6GA 2X6GA 3A56A 1NUCA 1HQMC 1YNNC 1CFMA 2RDHA 4K8JA 1F2MA 3ONAB 1LLRD 1MGSA 3VR6A 5EPKA 2PW7A 1U9RA 4CJ0B 1GJXA 3T51B 5C3XA 2AQ3B 2PMZB 1BOSA 2AQ2B 1NSNS 3O13A 4KI0A 2F0EA 1JCKB 1J9OA 2X69A 4PMBA 4K6DA 1EFID 3BVGA 3DXJC 5G3LD 1QCBD 4A3IB 4BBRB 1RKNA 2MP1A 3Q23A 3TP7A 4G57A 1QE6A 1HCZA 1SNPA 3LWUA 2EYMA 5M5WB 3GV6A 2EE1A 3T53B 1SEBD 4DK1A 3KBGA 1I4XA 5JAVA 2CW0C 3SK5A 3N6RA 2LY7A 2L12A 2JXMB 5KYLA 3MTSA 1EY6A 1PLFA 1VF7A 3N52A 2F0OA 1EZ6A 1LT4D 5A35A 3BS1A 1JOOA 5D14A 2F0NA 1MBYA 3R3OA 1GHKA 1PZID 1QWYA 4XYOA 2Z8LA 1OXUA 1EWCA 4HMJA 5E3FA 3S1QB 2EJFC 3I4LA 3Q0AA 2PQEA 1DZ1A 4RWSC 5CBAE 3EA6A 3NTIA 1LT6D 2Y0SB 2X6LA 2CQAA 5K5PA 4FXKC 4RGNA 1STNA 2F0KA 3I70A 5IT9L 3JAML 3OHXC 1DOKA 3RLFA 3K5NA 2K1BA 3HS0C 1ILQA 1EY9A 4ILWA 3MAQA 1U4MA 2EYLA 1XX8A 5A2QE 3GQBA 3QO2A 5CV8A 4G7OC 1JWSD 3DEOA 4RAUC 4CKBA 4DXGA 2K33A 4XDXA 3BVZA 3U9SA 1SYEA 1BCPD 4FXDA 4X3KA 2A73B 1CTMA 2OXPA 5D65A 2QKIC 1IYVA 5C5LA 1PRTF 2BDNA 1PZJD 4QB4A 3FVQA 3FPPA 1KTKA 1S5BD 1S4ZA 1JQYD 4ZK9B 3R93A 3D4WA 1EOTA 5LL6X 2L55A 1II3A 1STAA 4YIJA 1S5DD 4CKEA 2NUCA 2XN9C 1X32A 4M1UB 2WKDA 2ID0A 2B2TC 4XT3B 4C2MB 3KLRA 5I6YA 2ZT9C 1TU2B 2DNCA 2PYKA 2OEOA 5JVG3 3S17B 4DF7A 2KEDA 1ZXTA 3KLSA 3HOXB 4XYQA 1S5CD 2EYPA 1BUVT 2J0TD 3MA2B 4KD3A 4KN4C 3H09A 1ZKOA 1H9RA 1Z47A 1LTBD 5I4DA 3DM1A 1H9JA 4RHRA 2VXWA 4CJ1B 3TP6A 1WTOA 1NR4A 3GO5A 4C3IG 2B2WC 4RGOS 1RCVD 4UAIA 2BA1A 5EKKA 5CV5A 5KNDA 1QNUA 2EDGA 5CC4A 2KECA 3I72A 3I4MB 1Y8OB 3GTKB 1VCIA 4G7HC 1RODA 1ENFA 1RTOA 1STBA 2VNUD 3LX0A 4LJZC 2L5TA 1O7ZA 1EY0A 2R3ZA 1Q1EA 5E4WC 4XQQA 3W3AA 3RD4A 2NBFA 1D5ZC 4TKOB 4KHVA 1WTWA 2R7ZB 1EQTA 2RBMA 2E2IB 2FMCA 3X3NA 1H9KA 1HUMA 3TBIB 3HRZC 2D5DA 1ICWA 2CW0D 1KABA 5FOBB 1EEID 3J7AF 2K32A 2F1MA 4ABNA 5IOCA 4F7XA 2O2LD 1AFPA 2NWGA 2B2TA 5C6AA 4HSVA 3MVVA 4QUCA 4CKCA 1KLUD 1JWMD 1PZKD 2DY7A 1CM9A 2HDLA 4R8IA 2XNAC 2NTTA 3HEJA 4E6IA 2BDOA 1U4PA 1G91A 5COYA 3IAYA 3HOWB 3I3CA 3A7AB 1PMRA 1PFMA 2ICIA 5JEAH 4Z9CB 1I4RA 3EFXD 3KUPA 2MUYA 1MD2D 5EGTA 3M7GA 3S1MB 1CZWA 4PMWA 3NE5B 4BS9A 2B2WA 2ICEC 1LO5D 1F9PA 3CRLC 1TT2A 4LMQD 3NK9A 4IUUA 4BA2I 1CI3M 4DK0A 2DNEA 4FP5D 1EIGA 1EU4A 3ND8A 3S2HB 3BYTB 4PNYA 4Y7NB 1TKWB 2E74C 1TY2A 2WV6D 1EY4A 1LTID 5IGDA 2F03A 1GOZA 4IN3A 4KD4A 3VYSA 4IZ8A 2XWJB 1U4LA 1BDOA 2DN8A 1L0YB 2IW3A 4ZLTF 1RD9D 2K5WA 1VDZA 1DCZA 2SDFA 2PO4A 2IJ0A 3K5MA 3BDOA 3GTPB 1TY0A 4PV1C 1TWFB 1LTAD 4NKLA 5M3FB 2AQ1B 4K5XA 3AMUA 1I50B 4H0LC 3S2DB 4J6HA 1QILA 1I4PA 5CYUA 3D8GA 1HPCA 4EQPA 2JE6I 5DAUA 3X3MA 1E2WA 5TSSA 1PTOH 3PIP3 1DYQA 3NBIA 1B9MA 3SR1A 1V1PB 5ELFA 3H6MA 2E76C 1EY8A 1V43A 1LTTD 3OOCA 4NMZA 1VMCA 2B8GA 3PIO3 3A7LA 1XXGA 1NCVA 4KKSA 4DAVA 4TQUS 1H9SA 2KJXA 2IX3A 3EROA 1TS2A 4BY7B 2WAQB 2FFKB 1W6JA 3PO2B 5M3MB 1B44D 1VF5C 4HMIA 4V0BA 2ZXOA 3S15B 3TZUA 4R8NA 1DD2A 2SOBA 1FR3A 3LNNA 4L8JA 1AN8A 1ONLA 3G6JB 1DXMA 1K83B 3M3YB 1D1IA 3QOJA 3RMHA 5JPNC 1FNVA 3VYRA 2KCNA 4C3JB 1Q12A 4HEDA 2IT1A 1WTXA 4FO2A 4ZQ3A 3I90A 5LHY1 4S3SA 1A15A 2QEJC 1R9TB 1QJOA 1TS3A 3WOFA 1KDCA 5J22A 2RQXA 3GTMB 4IFDG 5C44B 1KLGD 3J81E 3VR3A 2M2LA 4ZUJA 3SXHA 4M8AA 2XVSA 4FF4A 4UDUC 4IALA 5ELCA 4BA1I 3I8ZA 2HDMA 3D4RA 1EQVA 1BCPC 4BWGB 5DNFA 4IUVA 3NWSA 2A69D 5CV6A 1B4OA 5NUCA 1FGBD 4DNRB 1Q1BA 5EPLA 2EZVA 2IX1A 1HXYD 3PV0A 2NVXB 4F87A 1ESRA 1IHZA 2PPBC 2A69C 1JB3A 4K8IA 1CA6A 3FRPB 4G7ZC 1B2TA 1GUTA 4F88A 1SJHD 3H0GB 2F0UA 2K01A 3GTOB 1QOHA 2EYJA 5K36H 3I91A 2QILA 3FMCA 1EZ8A 1LACA 1SNDA 1WD1A 3Q22A 5EQ0A 2XRQD 5IIFA 1W6KA 1SE2A 2Q8IB 1NR2A 2VB3X 3NQTA 4A3FB 1TS5A 2A6ED 2EY1A 3K5OA 5FLXL 1F2ZA 1CQVA 4MIUA 2L9HA 1PFBA 5LL6S 1D5XC 2J7ZA 4K5WA 4RCNA 3NBHA 4U673 1HFGA 2JP1A 1TIID 2A6EC 2F0HA 3HGBA 3WDNA 2BE5C 2E2DC 3KK7A 3C3LA 5HURA 3FEWX 4CGYB 4RFBA 4IUPA 4C3IB 2F0FA 3SE0A 3VYTA 3T16A 4QMGA 2I07B 1XWEA 3TP5A 2MHVA 2NVYB 4OGQC 3BZDB 1G6ZA 3FKIB 1DOMA 2PCFB 1J8IA 1CT1D 4X3UA 4KMUC 3MFGA 1TVXA 3GTQB 1FNUA 4Q0FA 2KUMA 4KJOA 2IWHA 1SFOB 1D6EC 1C48A 3NWTA 1GHJA 3TMEA 2KEEA 2WKCA 1TQOA 1RHPA 1SXTA 4Q5VA 1BNZA 2F0JA 3W2DA 5M5YB 3TP8A 5FO9B 2ENBA 3S1RB 5CV9A 4MHEA 4AYBB 1RJTA 3KF8A 2WIIB 4KY7A 4B9WA 1V1PA 3T56B 2RKSA 4FXGC 5IT9E 4EVOA 5M9OA 3OWEB 1SSOA 4HCSA 3OPOA 5C4ZA 4RGMA 2AWOA 1Z6HA 1K8MA 1R4PB 2I46A 3NQIA 5EPJA 4RKBA 3T13A 2RSOA 2N88A 4G4KA 4MN3A 1SNOA 2K6AA 2SEBD 2F0DA 2NZ1D 2FJ2A 3TN2A 2N55A 2NVTB 2J4XA 4TSSA 1UNSA 2JA8B 3V96A 4BBSB 2LKVA 1SYGA 3OW7A 1G2TA 3HZXA 4OIKA 3P75A 4RA8A 2F0IA 5IODA 1O80A 3M4OB 3SDZA 4C3HG 5KIXA 2PZTA 3QG1A 1BF4A 1HTLD 5DM73 2NN6G 2EPBA 1WVLA 3SK4A 3C2PA 2JSOA 3I4NB 2KQ3A 3ITPA 2EVBA 2GA4B 4KY5A 1Z7TA 3TZDA 3GTGB 1HA6A 2K04A 4WJWA 1ZYRC 2Z4IA 1ET9A 1AP0A 3QJYA 5JOBA 5EKIA 3MC0B 4I7ZC 3M4YA 3OMCA 1I6VC 4WFN3 5JJZA 4C56C 2L1BA 3DWAA 5K36G 1KDAA 3TSSA 2L11A 3CRKC 1S5FD 3D6WA 4QCLA 1LT3D 1PTOB 1KDBA 3EJIA 5EBDA 2QCPX 2L0CA 4H13C 3E5SA 4FVMA 2XRSD 5KRUA 4ZKBB 1PXUA 2QF7A 1A2UA 2BOSA 4FF3A 1SE4A 3D31A 3P20A 2WB1B 2A68C 2RVLA 2OF1A 1RTNA 2BA0A 5F2DA 2F4IA 3BDCA 3SVMA 1A2TA 1SDFA 1F9SA 3VR5A 4HAEA 5I9PA 1CHPD 5EKLA 4IFDI 3NSWA 2A74C 4C3HB 1SYCA 2EJMA 2AUKA 2WACA 3HOZB 3BG3A 2NB0A 3A55A 5C4JB 3OSOA 4BY1B 1I4GA 4K14A 3NUCA 1H9SB 2M00A 3VR4A 3QOLA 1O7YA 2AUJD 3R2IA 3QIAA 4XQJA 2KOLA 2JEBI 2D9UA 5FO7B 2IX0A 4V190 1E2ZA 1G8ZD 2LS01 3HOUB 3K57A 5BN4A 3C1FA 1ZYRD 4DAPA 1C8CA 2O4XA 1PDQA 1I4HA 5J39A 5KEEA 1OO9B 1SE3A 1LT5D 2WINB 1ML0D 3OIPA 4K2KA 4DNTB 3BVMA 4QIWB 1D5MC 1A3UA 3HP3A 4ODGA 1UAPA 1CZGA 3IFTA 3F2UA 1WTPA 3S9WA 5EJWA 3Q24A 1CA5A 1STGA 3P7JA 5C3EB 2C5CA 3M85A 3VR2A 1H9MA 4C3JG 2FINB 2RDGA 2PZUA 3KBXA 4C1NI 5E4XA 4EQNA 1GUOA 1T5XD 5DEHA 5C0XI 3DWPA 5CR3A 4KN7C 1FD7D 4QUFA 5AFWA 4IURA 2EYFA 2F0SA 3AU7A 4KKUA 1Q3LA 5CV4A 2NN6I 3C1EA 1LV9A 4DN4M 1QG7A 1UUPA 1T5EA 4L6TB 2LFNA 2JYOA 2K5DA 5G3LF 4ME5A 2HCIA 4HN7A 2F0LA 1KAAA 4RHSA 1MSGA 4IUTA 4HR7B 2F3VA 1GUSA 1WCMB 4WORA 3M7NA 3EQLC 1OXSC 1G291 3AB9A 1IYUA 1I3QB 1SAPA 1A3TA 1CK1A 1EYDA 1AW7A 2EOTA 1PFNA 3BYYB 3L3OC 5CORA 5KNBA 1ESFA 4RH6A 1QB5D 2FHTA 1PTOC 5J1ZA 3ZYYX 1SMYC 3DWQA 1AEXA 4ZKCB 4K2LA 4PQXA 1JOKA 1IKMA 3Q6SA 4EGVA 1JICA 2F0WA 3D6CA 2TMPA 5I2YA 3V2TA 4HTHA 3H94A 1STHA 2A6HC 3NP8A 1EYCA 4RCOA 2QDBA 1V1OA 1C4QA 1XTCD 2OT2A 1OXXK 2WP8J 4N9TA 3MEHA 1STYA 1TWGB 1LTGD 4KKTA 5ELDA 1HQRD 3RZDB 3C46A 4ULLA 4ZAIA 3PUVA 4A93B 2Q8RE 3MWYW 2EYOA 1BBXC 1BCPB 4X3TA 4HSPA 3EVQA 5FKAC 4U68A 5I9OA 3J7AV 2R61A 2KVMA 2F0VA 3KLSX 4OO1H 2M9VA 5JVH3 3QWNA 2H4OA 1E2VA 4DAYA 1UEAB 4ID6A 4IUQA 1F9RA 5IGFA 1BQQT 3D3RA 3T4AC 1HHVA 2F0TA 4FNFA 1RDPD 3GTLB 1SYBA 2HCCA 4JBWA 4B08A 1HUNA 5T1GA 1PRTC 1TWHB 1PRTB 1B3AA 3PUXA 1G2SA 2B8FA 1EL0A 3WOEA 5FO8B 5T1IA 1HTPA 5HGTA 5JEAG 4KJNA 1RF2D 4X3SA 4I65A 3IFDA 1F9QA 4PMCA 3S1NB 1A6XA 5CGKA 2K7VA 4DA2A 2VUMB 1ILPA 4FF1A 1MI2A 2E2JB 3MXGA 1PRTD 3K59A 2O5IC 5IGBA 4DFAA 3L9AX 5CV7A 3K0YA 2B2UA 3ERQA 1WTQA 1JOQA 1BO0A 1HA5A 4KY6A 4CBVA 1SYDA 5CBEE 1ZEQX 3CU7A 4XQNA 1IL8A 5CMDA 3NPPA 2B2VA 4J1MA 4WRDA 1B1ZA 3HOVB 5C0XJ 4A3GB 2CVRA 5IGCA 3MFYA 2B39A 4A3KB 1SMYD 3MXUA 1AZQA 5KNCA 2C9OA 3FDTA 2JA7B 1YNJD 1CHQD 3K58A 5KGUA 2K05A 1EEFD 1MSHA 3NTKA 1EU3A 3RZOB 5C5MA 2NN6H 2IL8A 1A3VA 1NAPA 3IL8A 1D2BA 2IPKD 3RUZA 1TS4A 2F0GA 1SYFA 4FF2A 1SNQA 1Q90A 4NP5A 1ENAA 1WTVA 1FYCA 3IKJA 3L7ZC 5I2XA 4ZUIA 1EY5A 2TSSA 2NVQB 2JA5B 3R8BA 5IGGA 4LAAA 1EY7A 2MJ8A 2EYHA 5M5XB 1WD0A 4XT1B 2R92B 1Y8NB 3PUYA 3NHHA 4IFDH 2ZXRA 2PW5A 2MGSA 3BDLA 2R93B 1HRJA 1SNCA 3CQZB 4XXEA 4DXFA 3SK8A 4K5VA 3J80L 3PUZA 5FK9C 1IKLA 1O7LA 1Y8PB 4OHJA 1DONA 3K7AB 3MZ5A 1GUWA 3H91A 4H7BA 1Q8IA 5C4XB 2A68D 3QB3A 4B9XA 1JORA 1F77A 4FYDA 4R9WA 3HOYB 3HG9A 1SBBB 3MHBA 2B2YC 3FPUB 1F2LA 1I4QA 1F2YA 2A6HD 1JWUD 2HQEA 1JE4A 5BN5A 5D3IB 1GUNA 3A54A 2JA6B 2B2VC 1O78A 2Z4HA 1DOLA 5EBCA 4HCEA 2E2HB 3P1HA 2SNSA 2VB2X 2HUGA 5ISRA 2H1EA 2BCOA 4F8MA 1GXDC 4IUNA 2RDFA 1OXVA 3HKZB 4K6LA 4QF4A 1ENCA 2K03A 4J8QA 5FLXE 5ELEA 4A3JB 1GUGA 1JC7A 2EY6A 4P2CB 5IGEA 2KA7A 1BCPF 1D1KA 1TR5A 4IFDJ 1JR0D 2RA4A 3NXWA 4DU9A 2Q8TA 3E0JA 1KNEA 1EWHA 1TWAB 3DUZA 2EY2A 4ZYSA 1EIHA 1PYWD 1KNAA 1B53A 2G9HD 1ET6A 5C0XG 1LABA 1SJED 5JEAJ 1Y1VB 2PNRC 3PUWA 4NDXA 4XIGS 3DEPA 2E75C 1BXTA 2V4DA 3UI2A 3VA7A 5KYIA 5DM63 1DM0B 1YNJC 3S16B 2NYZD 3G7LA 2F0PA 4L63B 2LMCB 3J80E 1V8QA 3CKIB 4H44C 4EQOA 3CHBD 2BE5D 2K5QA 3A8IE 3K5LA 4OL7A 4XTCS 3V05A 2SNMA 3MXPA 1X3QA 3VA5A 1AZPA 2YYZA 2B63B 3DMUA 2KHSA 2KCCA 4CJ2C 4JK1C 3A8KE 3GTJB 2XSCA 2RSNA 4GZYC 1U4RA 1X3PA 5JPMC 3NTHA 3SEBA 1WTRA 2PZWA 2DY8A 1Y1WB 2B2UC 3I73A 1K8OA 1PTOD 2MPMA 4KHZA 5C0XH 1I6HB 3TDQA 3GP7A 4OO1G 1BR9A 5C4HA 1FNWA 2AWNA 1M4VA 1LTSD 3JAME 5A2QL 3OMGA 3R2TA 5E1FA 3J7YW 4DGZA 1B9NA 3ND9A 2JEAI 3A8JE 1HFNA 4KTAA 5BN3A 4LK1C 1PTOF 1LTRD 4N9PA 4TRDA 4OO1I 3PMFA 2XWBB 1OXTA 1E0BA 5C3WA 4ZRZA 5ELBA 4KV6A 2F3WA 2F0MA 2D62A 4A3MB 2ZXPA 3VYUA 2L4NA 4O1NA 2D2CC 3H3VC 3S14B 1M8AA 1B50A 3OIQA 3DHQA 3SK6A 1STEA 3E6ZX 4A3BB 2FMMA 2XIWA 2EXZA 3J81L 3U9OA 1CQFA 3URYA 3GV3A 4IQZA 3LWEA 2K28A 5D3DA 1IW7D 3K6OA 1SNMA 2EJGC 4OIJA 2YU9B 3PO3B 3D4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VMP A;  1RTN A;  3P7J A;  2M2L A;  4UAI A;  4X3K A;  1IKM A;  3SVM A;  1WTR A;  2MJ8 A;  3Q6S A;  1WD0 A;  2DY8 A;  4X3S A;  1SDF A;  1F9S A;  1JIC A;  2EE1 A;  3GV6 A;  5D65 A;  2FIN B;  2FJ2 A;  2NZ1 D;  3IFD A;  3KBX A;  2B2U C;  1F9Q A;  2KEC A;  4HAE A;  4IUP A;  2MPM A;  4XT1 B;  2N55 A;  5E4X A;  3TN2 A;  2RA4 A;  3I8Z A;  2HDM A;  1ROD A;  2BDN A;  2Q8T A;  2MGS A;  1RTO A;  2L12 A;  1HRJ A;  1KNE A;  1S4Z A;  3MTS A;  1ILP A;  5DNF A;  1O7Z A;  1PLF A;  4QUF A;  2B2W A;  3N52 A;  1VMC A;  4IUV A;  1MI2 A;  1EIH A;  4ZK9 B;  5AFW A;  4IUR A;  3R93 A;  1EOT A;  1F9P A;  2R3Z A;  1G2T A;  5E4W C;  1XYI A;  1IKL A;  1Q3L A;  5D14 A;  4NW2 A;  1G6Z A;  1DOM A;  1B4O A;  1KNA A;  1B53 A;  4LMQ D;  1NCV A;  4OIK A;  1LV9 A;  4DN4 M;  1QNK A;  2B2Y A;  1DON A;  4RA8 A;  1J8I A;  1QG7 A;  5EPL A;  4IUU A;  1O80 A;  4X3U A;  1EL0 A;  1X32 A;  1O7Y A;  2B2U A;  1EQT A;  4O42 A;  1WTW A;  1ESR A;  1WTQ A;  1TVX A;  2KOL A;  5T1I A;  1BF4 A;  1GUW A;  1BO0 A;  3H91 A;  2FFK B;  2B2T C;  2KUM A;  1EIG A;  2JYO A;  4XT3 B;  1HUM A;  2D9U A;  4ZAI A;  2EPB A;  1HFN A;  1WVL A;  3DEP A;  1CA6 A;  5CBE E;  2Q8R E;  2X6G A;  1ICW A;  3MWY W;  3UI2 A;  1B2T A;  2HCI A;  1BBX C;  1DZ1 A;  4R9W A;  1IL8 A;  4RWS C;  5CBA E;  2K01 A;  2KED A;  1MSG A;  4IUT A;  4X3T A;  5CMD A;  2B2V A;  1ZXT A;  2KEE A;  2NYZ D;  4U68 A;  2B2Y C;  3G7L A;  1RHP A;  3I91 A;  2X6L A;  3TZD A;  1C8C A;  1E0B A;  3FPU B;  2K04 A;  1HA6 A;  1PDQ A;  1F2L A;  1BNZ A;  3ONA B;  2KVM A;  1AP0 A;  1U4L A;  1MGS A;  2CVR A;  1WD1 A;  5EQ0 A;  4ZLT F;  5EKI A;  2NWG A;  2B2T A;  1AZQ A;  1ML0 D;  1SAP A;  3FDT A;  4HSV A;  5EPK A;  2SDF A;  1JE4 A;  1DOK A;  2L4N A;  4IUQ A;  4QUC A;  1F9R A;  5JJZ A;  2L1B A;  4MHE A;  4CJ0 B;  1HHV A;  1M8A A;  1B50 A;  2DY7 A;  2EOT A;  2L11 A;  1RJT A;  1PFN A;  3HP3 A;  2K1B A;  1NR2 A;  3D6W A;  1X3Q A;  2B2V C;  1CM9 A;  2HDL A;  4HED A;  1ILQ A;  2K05 A;  2FMM A;  4R8I A;  1WTX A;  2HCC A;  2XIW A;  1DOL A;  5COR A;  1MSH A;  1AZP A;  1J9O A;  3I90 A;  2L9H A;  1U4M A;  2IL8 A;  1NAP A;  1PFB A;  2X69 A;  3DM1 A;  3GV3 A;  3IL8 A;  2J7Z A;  1U4P A;  1G91 A;  1A15 A;  1XX8 A;  3LWE A;  2VXW A;  1HUN A;  4ZKB B;  2K28 A;  1SSO A;  2HUG A;  3F2U A;  5COY A;  4HCS A;  5T1G A;  4CJ1 B;  3QO2 A;  1HFG A;  2H1E A;  2FHT A;  3I3C A;  3DEO A;  4CJ2 C;  1NR4 A;  4RAU C;  1WTO A;  1WTV A;  1WTP A;  2JP1 A;  5EPJ A;  1B3A A;  2RSN A;  1PFM A;  5EJW A;  2B2W C;  4OIJ A;  1G2S A;  2RSO A;  2K03 A;  2N88 A;  4XDX A;  1U4R A;  2MP1 A;  1X3P A;  1CA5 A;  4ZKC B;  4MN3 A;  3KUP A;  2RVL A;  1QE6 A; 
#chains in the Genus database with same CATH topology
 1VMP A;  2G9D A;  3OWF A;  1VQ4 A;  1EYA A;  2ZTD A;  2CHB D;  1C0A A;  4A3D B;  1S5E D;  4LF9 L;  1D8L A;  1VQI A;  2N49 A;  2RCF A;  2E5L L;  2B3G A;  3SHL A;  3JAM c;  2O5J C;  4BY7 H;  1DJR D;  2YTX A;  1OTC A;  2Z1C A;  4C1N K;  3GD7 A;  5IYC G;  2A5H A;  4JW0 A;  4KK7 A;  5I6W A;  4RKL A;  1Y69 U;  1XYI A;  1IYJ B;  1Q82 C;  1R4Q B;  1L0X B;  4NW2 A;  4CHT B;  3KOJ A;  1KHI A;  1TWC B;  5AJ3 L;  1QNK A;  2B2Y A;  4A3E B;  1YNN D;  1XMO Q;  4IOC A;  1FVI A;  2EY5 A;  3GTO H;  1IW7 C;  4O42 A;  2NTS A;  2F0Q A;  3K7A H;  3MXN A;  1NBW A;  4RMF A;  3IRB A;  4RGT A;  2R6G A;  3Q8D A;  2EIF A;  2X6G A;  3A56 A;  1NUC A;  1VS0 A;  4AQY L;  1E1O A;  1HQM C;  3NBH B;  1YNN C;  4NXN Q;  1CFM A;  2RDH A;  4BBS H;  1YHQ A;  4P75 A;  3HOU G;  3HOW H;  4K8J A;  1F2M A;  3ONA B;  1MJE A;  1LLR D;  1MGS A;  1Y1W H;  3PO2 G;  2HIX A;  3VR6 A;  4QL5 A;  5EPK A;  2PW7 A;  2R7Z G;  4HJA A;  1U9R A;  4CJ0 B;  1QZG A;  1PV4 A;  1GJX A;  3T51 B;  5C3X A;  2AQ3 B;  3F2D A;  2PMZ B;  1BOS A;  2AQ2 B;  1IBL Q;  1NSN S;  3CME A;  3O13 A;  4KI0 A;  4LF4 L;  2F0E A;  2DGY A;  4QIW E;  3CCQ A;  1JCK B;  1YBY A;  1J9O A;  1I3Q H;  4JV5 Q;  2X69 A;  4GN3 B;  1U5K A;  4PMB A;  4K6D A;  1EFI D;  4GS3 A;  3TEH B;  4R1J A;  1B70 B;  4UHV A;  3BVG A;  3DXJ C;  5G3L D;  1HR0 L;  3T1H L;  1QCB D;  4X65 L;  4DV3 L;  4A3I B;  4BBR B;  1RKN A;  2MP1 A;  3Q23 A;  3TP7 A;  4G57 A;  1QE6 A;  1HCZ A;  1SNP A;  3LWU A;  3UDF A;  4IPC A;  2EYM A;  4CDE C;  5M5W B;  3GV6 A;  2EE1 A;  3T53 B;  4R4Q A;  4OWX B;  1SEB D;  4DK1 A;  3KBG A;  1I4X A;  5JAV A;  2D0P A;  2Q2H A;  2CW0 C;  3SK5 A;  5IP7 G;  3N6R A;  2LY7 A;  2L12 A;  2K5H A;  4JI1 L;  2JXM B;  5KYL A;  3MTS A;  1EY6 A;  1PLF A;  1VF7 A;  3N52 A;  2F0O A;  5M3F G;  3HOY H;  1EZ6 A;  1LT4 D;  5A35 A;  3BS1 A;  1JOO A;  5D14 A;  2F0N A;  1MBY A;  3R3O A;  1K0R A;  1GHK A;  1PZI D;  1QWY A;  4A3B H;  4XYO A;  3CCV A;  2Z8L A;  1OXU A;  1EWC A;  4HMJ A;  4DV6 Q;  2Q2T A;  3OYY A;  5E3F A;  1O7I A;  3S1Q B;  2K75 A;  1WTH A;  2EJF C;  2UUB Q;  3I4L A;  3Q0A A;  2PQE A;  1DZ1 A;  4RWS C;  5CBA E;  3EA6 A;  2R7Z H;  3NTI A;  1LT6 D;  1HR0 W;  2Y0S B;  3PO3 H;  2A8V A;  1TWC H;  2X6L A;  3S14 H;  2CQA A;  3J80 c;  5K5P A;  4FXK C;  4NPS A;  4RGN A;  4JI8 L;  4LF7 Q;  2CWA A;  2F4V Q;  1AE2 A;  4A3D H;  4GLX A;  1STN A;  2F0K A;  4MZ9 A;  3I70 A;  5IT9 L;  3JAM L;  1FGU A;  3OHX C;  1DOK A;  2R7D A;  1IBK Q;  3RLF A;  4JI7 L;  3ULL A;  3CD6 A;  3K5N A;  3W5O A;  1YZ6 A;  2K1B A;  4UPA A;  3HS0 C;  1HZA A;  4A3L G;  1ILQ A;  3HFZ B;  1EY9 A;  4OX9 L;  4ILW A;  4HJ7 A;  3MAQ A;  2WB1 E;  1U4M A;  2EYL A;  1D7Q A;  1N34 L;  1N36 Q;  3HOZ H;  1XX8 A;  5A2Q E;  3GQB A;  3EBE A;  3RN2 A;  1VQK A;  4P74 A;  3QO2 A;  3W1B A;  5CV8 A;  4G7O C;  1JWS D;  1VQH A;  3DEO A;  4RAU C;  4CKB A;  4DXG A;  2K33 A;  4XDX A;  4LF8 L;  3BVZ A;  3U9S A;  1SYE A;  1BCP D;  4FXD A;  1L0W A;  4X3K A;  2A73 B;  1CTM A;  2OXP A;  4BY1 G;  1E1T A;  5D65 A;  2QKI C;  1IYV A;  5C5L A;  3HKZ G;  1PRT F;  5M3M G;  1EUJ A;  4JI5 Q;  2BDN A;  1PZJ D;  3S15 H;  4QB4 A;  3FVQ A;  3GTQ H;  2R93 G;  3FPP A;  1KTK A;  1S5B D;  3QR8 A;  2ZJP A;  1S4Z A;  1JQY D;  3CCR A;  4ZK9 B;  3R93 A;  3D4W A;  1EOT A;  5LL6 X;  2L55 A;  2GVA A;  2QDL A;  4BXX G;  1II3 A;  1STA A;  4YIJ A;  1S5D D;  4CKE A;  2ZJQ A;  2HQL A;  2MQH A;  2NUC A;  2XN9 C;  1X32 A;  4M1U B;  4LFC Q;  2WKD A;  4LF9 Q;  2ID0 A;  2B2T C;  4XT3 B;  4C2M B;  1S72 A;  4YCU A;  3KLR A;  5I6Y A;  2ZT9 C;  1TU2 B;  2DNC A;  2PYK A;  2VL6 A;  2OEO A;  5JVG 3;  3S17 B;  4DF7 A;  2I0Q A;  2KED A;  2MFI A;  2JA5 H;  2CFM A;  2UXC Q;  1ZXT A;  3KLS A;  3HOX B;  4XYQ A;  4LF6 L;  1S5C D;  2EYP A;  1BUV T;  2RHQ B;  2J0T D;  3MA2 B;  4B3S Q;  3RNU A;  4KD3 A;  1PVO A;  1W3S A;  4X62 Q;  5LMN L;  4KN4 C;  1C9O A;  3H09 A;  4YCV A;  1ZKO A;  1H9R A;  3ER0 A;  1Z47 A;  2Z0S A;  1PH1 A;  1LTB D;  4KHP L;  1PH5 A;  5I4D A;  3JAM i;  3DM1 A;  2B63 H;  1H9J A;  4RHR A;  3I4N G;  1NJI C;  2VXW A;  4CJ1 B;  1H95 A;  3TP6 A;  1WTO A;  1NR4 A;  3GO5 A;  4C3I G;  3CCM A;  1EFW A;  5GRO A;  2B2W C;  3CAM A;  4LW1 A;  1B7Y B;  1AH9 A;  4RGO S;  1P16 A;  1RCV D;  4UAI A;  2BA1 A;  5EKK A;  5CV5 A;  1X55 A;  5KND A;  5GAE C;  1QNU A;  2EDG A;  5CC4 A;  4GN5 A;  2KEC A;  3I72 A;  1J6Q A;  3I4M B;  1Y8O B;  3GTK B;  1VCI A;  5JJK A;  5IP9 H;  4G7H C;  1ROD A;  1ENF A;  2JA7 G;  5IYC H;  1RTO A;  1STB A;  2VNU D;  1HZC A;  3LX0 A;  4LJZ C;  2L5T A;  1O7Z A;  3U4V A;  1EY0 A;  1VQO A;  4CDF C;  2R3Z A;  4JI4 Q;  4A3F G;  1Q1E A;  5E4W C;  4XQQ A;  3W3A A;  4DNI A;  4GKJ Q;  2AHO B;  1NTG A;  3RD4 A;  2NBF A;  2JQO A;  4JBJ A;  3PCO B;  1D5Z C;  2K14 A;  4TKO B;  3CW2 C;  4KHV A;  4DK6 C;  4DR3 Q;  1WTW A;  2R7Z B;  1EQT A;  2RBM A;  2E2I B;  5IYB H;  2FMC A;  3X3N A;  1H9K A;  1HUM A;  3TBI B;  3HRZ C;  2D5D A;  5IYB G;  1VQP A;  1ICW A;  2CW0 D;  1KAB A;  4EQ5 A;  4DV5 L;  5FOB B;  4JBK A;  1EEI D;  3J7A F;  3PSI A;  2K32 A;  2F1M A;  4ABN A;  4MNO A;  5IOC A;  5IWA L;  2HHH Q;  4F7X A;  1MIU A;  3BZC A;  2O2L D;  1TWH H;  4NXM L;  4DKA C;  1Q7Y C;  1AFP A;  1SE8 A;  5IY0 A;  4APV A;  4DR6 Q;  2NWG A;  2B2T A;  4DV6 L;  5C6A A;  4HSV A;  1PH7 A;  3MVV A;  1XPR A;  4QUC A;  2CWP A;  4CKC A;  1KLU D;  1JWM D;  4YCW A;  1PZK D;  3GTK H;  2DY7 A;  3K80 C;  1MHW C;  1CM9 A;  2HDL A;  4R8I A;  2XNA C;  2NTT A;  1HNX Q;  3HEJ A;  3FP9 A;  5JJL A;  4E6I A;  4LFA L;  3PF5 A;  4A3C G;  2BDO A;  1U4P A;  1G91 A;  1GVP A;  1TWF H;  5C44 G;  5COY A;  3T1Y L;  3IAY A;  3HOW B;  3I3C A;  3A7A B;  1IL2 A;  1PMR A;  1PFM A;  2ICI A;  4X65 Q;  3ICE A;  5JEA H;  1I4R A;  4Z9C B;  3EFX D;  3KUP A;  5FLX c;  2MUY A;  1MD2 D;  3PF4 A;  1NY4 A;  1R9T H;  4A93 H;  5EGT A;  3FKI G;  3M7G A;  4P73 A;  3S1M B;  4DAM A;  4YHH Q;  1QZH A;  1CZW A;  4PMW A;  3NE5 B;  1S40 A;  1QVC A;  4DV4 L;  4BS9 A;  2B2W A;  2ICE C;  4MTK A;  1LO5 D;  1F9P A;  2XTI A;  4C2M H;  1SN8 A;  3CRL C;  1TT2 A;  1M1K C;  4LMQ D;  4OEL B;  3NK9 A;  2K5N A;  4DR7 L;  4IUU A;  3UE0 A;  3B6Y A;  4BA2 I;  2ZM6 Q;  4OEM B;  1CI3 M;  4DK0 A;  2DNE A;  4POG A;  4FP5 D;  3ULJ A;  1EIG A;  1EU4 A;  3ND8 A;  3S2H B;  1V9P A;  2E8G A;  3BYT B;  3H3V I;  4PNY A;  4Y7N B;  1TKW B;  2DJG C;  2E74 C;  1YJ9 A;  2UUB L;  1TY2 A;  2JA8 H;  2WV6 D;  1EY4 A;  3TS2 A;  1YIJ A;  1LTI D;  5IGD A;  2F03 A;  2Y0S G;  1GOZ A;  3F2B A;  4IN3 A;  4KD4 A;  3VYS A;  4IZ8 A;  2XWJ B;  1U4L A;  1BDO A;  2DN8 A;  1L0Y B;  2IW3 A;  1EQR A;  2WAQ E;  4ZLT F;  1RD9 D;  2K5W A;  1VDZ A;  1NE3 A;  5GAD C;  1DCZ A;  2SDF A;  2PO4 A;  1EWI A;  3ZJY C;  3T1H Q;  5IP7 H;  4EX5 A;  4A76 A;  2N3S A;  2IJ0 A;  2Q2I A;  3K5M A;  3PIP A;  3BDO A;  3GTP B;  3KDF A;  3J81 c;  1TY0 A;  4PV1 C;  1TWF B;  1JE5 A;  1LTA D;  4NKL A;  5M3F B;  2AQ1 B;  5HGQ A;  1KD1 C;  2ZTE A;  1PH8 A;  4K5X A;  1XJV A;  3AMU A;  1I50 B;  4OWW B;  1EOV A;  4H0L C;  3S2D B;  1PH3 A;  1SRU A;  2N78 A;  4J6H A;  1QIL A;  4A3G G;  5BR8 Q;  1I4P A;  5CYU A;  3D8G A;  1HPC A;  4EQP A;  2JE6 I;  5DAU A;  3X3M A;  1E2W A;  2K50 A;  5TSS A;  1PTO H;  3PIP 3;  3K7U C;  4O2D A;  1DYQ A;  1U0L A;  3NBI A;  1B9M A;  3SR1 A;  1V1P B;  5ELF A;  3H6M A;  3RZD H;  2E76 C;  1EY8 A;  1V43 A;  4DK3 C;  1LTT D;  3OOC A;  4NMZ A;  2GN5 A;  4JI7 Q;  1VMC A;  3M4P A;  4A3E G;  2B8G A;  3PIO 3;  2QA4 A;  1C7Y A;  3A7L A;  1XXG A;  4KKS A;  1NCV A;  2DUD A;  4LFB Q;  4DAV A;  4TQU S;  4OX9 Q;  1H9S A;  1XMO L;  1PH9 A;  2KJX A;  2IX3 A;  3ERO A;  1ASZ A;  1TS2 A;  4BY7 B;  2WAQ B;  2FFK B;  1W6J A;  3PO2 B;  5M3M B;  1B44 D;  1VQA A;  1VF5 C;  1HR0 Q;  4HMI A;  4JI0 L;  4AQY Q;  4V0B A;  2ZXO A;  3S15 B;  2BH2 A;  1W2B A;  3TZU A;  4R8N A;  3CQZ H;  1DD2 A;  3CC7 A;  2SOB A;  1FR3 A;  3LNN A;  5ELN A;  4L8J A;  1AN8 A;  4B3S L;  1ONL A;  3G6J B;  4ALP A;  1DXM A;  4P71 A;  1K83 B;  3M3Y B;  2OTJ A;  1X65 A;  1D1I A;  3QOJ A;  3RMH A;  5HY6 A;  5JPN C;  1FNV A;  3VYR A;  3KJO A;  2KCN A;  1IBL L;  1WOC A;  4A3B G;  4C3J B;  1Q12 A;  4HED A;  2IT1 A;  1WTX A;  2K4K A;  4FO2 A;  4JV5 L;  4ZQ3 A;  3CP0 A;  3I90 A;  5LHY 1;  4LFC L;  4S3S A;  4JBM A;  1A15 A;  2PMZ E;  4HIO A;  2E5L Q;  2QEJ C;  1R9T B;  1QJO A;  1TS3 A;  3WOF A;  1PH4 A;  1KDC A;  5J22 A;  1GD7 A;  2RQX A;  1IBK L;  3GTM B;  4IFD G;  5C44 B;  1KLG D;  4BY7 G;  4JI3 Q;  3J81 E;  3CCE A;  3VR3 A;  1RL2 A;  2M2L A;  1L1O B;  4CDC C;  4A3C H;  4ZUJ A;  2IHE A;  3SXH A;  2E2J H;  4M8A A;  2XVS A;  4FF4 A;  4UDU C;  4IAL A;  5ELC A;  4BA1 I;  3I8Z A;  2HDM A;  3D4R A;  2WAQ G;  1EQV A;  2OQK A;  1BCP C;  4BWG B;  5DNF A;  1VQ9 A;  3S16 H;  3I56 A;  4IUV A;  3NWS A;  4AH6 A;  4A3L H;  2A69 D;  4DR4 L;  4DUZ Q;  5CV6 A;  1B4O A;  5NUC A;  1FGB D;  4IPD A;  4DNR B;  1Q1B A;  2MO0 A;  5EPL A;  2ALY B;  2EZV A;  4JI2 L;  2IX1 A;  1IXR A;  1HXY D;  1X3G A;  3PV0 A;  1JMC A;  2NVX B;  4F87 A;  1ESR A;  1IHZ A;  4B3M Q;  5LMN Q;  2PPB C;  2A69 C;  1JB3 A;  4K8I A;  1CA6 A;  3G6E A;  2VY3 A;  3FRP B;  2MNA A;  2VQF Q;  4G7Z C;  1B2T A;  1GUT A;  4F88 A;  1SJH D;  3H0G B;  2F0U A;  3U4Z A;  1K0S A;  4LF8 Q;  1L2F A;  2K01 A;  3GTO B;  1QOH A;  2B63 G;  2EYJ A;  5K36 H;  1XMQ L;  3I91 A;  2QIL A;  3FMC A;  1P8L A;  1EZ8 A;  1LAC A;  1SND A;  1WD1 A;  3Q22 A;  5EQ0 A;  2VUM H;  1LYL A;  1MKH A;  2BH8 A;  1KAW A;  3HOV H;  2XRQ D;  5IIF A;  1W6K A;  1J5E L;  1SRO A;  1SE2 A;  2Q8I B;  1GM5 A;  3KYH C;  1NR2 A;  2VB3 X;  3NQT A;  4A3F B;  1TS5 A;  2A6E D;  3J80 i;  2EY1 A;  3K5O A;  5FLX L;  1F2Z A;  1CQV A;  4MIU A;  2L9H A;  3FHW A;  4IO9 A;  4DR3 L;  1PFB A;  5LL6 S;  2JA5 G;  1D5X C;  2J7Z A;  4K5W A;  4JC0 A;  4RCN A;  3NBH A;  4AIM A;  1K83 H;  4U67 3;  1HFG A;  4JI1 Q;  2GVB A;  2JP1 A;  1IBM L;  1TII D;  2A6E C;  2F0H A;  3HGB A;  4R4C A;  2UUC L;  1WCM G;  1JJG A;  3WDN A;  2BE5 C;  4A3M H;  2E2D C;  2UXC L;  3KK7 A;  3C3L A;  5HUR A;  3FEW X;  4CGY B;  4RFB A;  4IUP A;  4C3I B;  2F0F A;  4DV1 Q;  3SE0 A;  3VYT A;  3T16 A;  4QMG A;  2I07 B;  1XWE A;  3TP5 A;  2MHV A;  2NVY B;  3I7F A;  4OGQ C;  1VQE A;  3BZD B;  5C3E H;  3FKI B;  1G6Z A;  1DOM A;  1X54 A;  2PCF B;  4ME3 A;  3AQQ A;  1J8I A;  1Q8K A;  3HOX G;  1CT1 D;  5C3E G;  4X3U A;  4KMU C;  3MFG A;  2HHH L;  4NB3 A;  4DPG A;  1TVX A;  3H0G H;  3GTQ B;  1FNU A;  4Q0F A;  2KUM A;  3KF6 A;  4KJO A;  2IWH A;  1SFO B;  1D6E C;  5FJ8 G;  3CC2 A;  2UUA L;  1C48 A;  3J81 i;  4A3D G;  2QGQ A;  3NWT A;  4JI4 L;  3RLO A;  1AE3 A;  2K5V A;  2RCN A;  1GHJ A;  2OCE A;  3TME A;  2NVT H;  2CKZ B;  2KEE A;  2WKC A;  3ERS X;  3GTJ H;  4LF6 Q;  1TQO A;  4LFB L;  1RHP A;  3U50 C;  1SXT A;  1TXY A;  1E7Z A;  2XGT A;  2H5X A;  4Q5V A;  1BNZ A;  1E22 A;  2F0J A;  3W2D A;  1VQF A;  5M5Y B;  5L37 A;  3TP8 A;  5FO9 B;  2ENB A;  4A3F H;  3S1R B;  5CV9 A;  2RF4 A;  4MHE A;  1VQD A;  4AYB B;  3STB C;  1N33 L;  1RJT A;  3KF8 A;  1G6P A;  2WII B;  2JA6 G;  1XNQ Q;  4KY7 A;  4B9W A;  1V1P A;  4DR7 Q;  3T56 B;  1PA6 A;  2RKS A;  1NNX A;  4FXG C;  4A75 A;  5IT9 E;  1HZB A;  5IE8 A;  4GLA C;  4PZ8 A;  4EVO A;  5M9O A;  2LSS A;  3OWE B;  1CSP A;  1SSO A;  4HCS A;  3OPO A;  5C4Z A;  3CPW A;  1LTL A;  2AWO A;  1Z6H A;  4RGM A;  3KF8 B;  1K8M A;  1R4P B;  2I46 A;  3NQI A;  5EPJ A;  4RKB A;  3T13 A;  5BR8 L;  3HKS A;  2RSO A;  1K8G A;  2N88 A;  4G4K A;  4MN3 A;  4C3I H;  1I94 Q;  1SNO A;  5C4J H;  2K6A A;  2SEB D;  5LMN W;  4L5R C;  1N32 Q;  2F0D A;  3HKZ E;  4O0A A;  2NZ1 D;  2FJ2 A;  1N9W A;  3TN2 A;  4OWT B;  2N55 A;  2NVT B;  2J4X A;  4TSS A;  4GKK Q;  1UNS A;  2JA8 B;  3V96 A;  4UP8 A;  4BBS B;  2LKV A;  1SYG A;  3OW7 A;  1I50 H;  4LUV A;  1G2T A;  3HZX A;  4IJL A;  4DR1 L;  4GKJ L;  3W1G A;  4JCV E;  4C3H H;  4OIK A;  3P75 A;  4RA8 A;  2F0I A;  5IOD A;  1O80 A;  3M4O B;  2VS1 A;  4YWL A;  3SDZ A;  4C3H G;  5KIX A;  1VQJ A;  2PZT A;  3QG1 A;  1BF4 A;  5J3B A;  1HTL D;  5DM7 3;  2NN6 G;  1VQN A;  3T1Y Q;  2EPB A;  1WVL A;  3SK4 A;  4LF5 L;  3C2P A;  4X6A H;  2JSO A;  4MTN A;  4DV5 Q;  3I4N B;  4DR4 Q;  2KQ3 A;  3ITP A;  2EVB A;  2GA4 B;  4KY5 A;  5IWA Q;  1Z7T A;  3TZD A;  3GTG B;  1HA6 A;  2K04 A;  2WB1 G;  4WJW A;  1ZYR C;  2Z4I A;  1ET9 A;  2EQS A;  3M9B A;  1AP0 A;  3QJY A;  5JOB A;  2ZM6 L;  5EKI A;  3MC0 B;  4QJF A;  4B3M L;  2ASB A;  1FJG L;  4I7Z C;  3M4Y A;  4IOA A;  2NZH A;  3MEF A;  3OMC A;  4HIK A;  1I6V C;  1CKO A;  4WFN 3;  1E24 A;  5JJZ A;  4C56 C;  2L1B A;  3DWA A;  3GTM H;  3E9I A;  1GO3 E;  5K36 G;  1KDA A;  3TSS A;  2L11 A;  3CRK C;  2WFW A;  1S5F D;  3D6W A;  1KC8 C;  4QCL A;  1LT3 D;  1PTO B;  1XPO A;  1KDB A;  1PYS B;  1K28 A;  3EJI A;  5EBD A;  3H15 A;  2QCP X;  2L0C A;  4H13 C;  3E5S A;  4IJH A;  4FVM A;  2XRS D;  5KRU A;  4ZKB B;  1PXU A;  2UXB Q;  2PNH A;  4DR5 Q;  1PFS A;  4WJ3 M;  4A3K H;  2QF7 A;  1A2U A;  2BOS A;  4FF3 A;  2R92 G;  1SE4 A;  3D31 A;  3P20 A;  2WB1 B;  4LUO A;  2JA7 H;  2A68 C;  5FLM G;  2KHJ A;  2RVL A;  2OF1 A;  1RTN A;  2BA0 A;  5F2D A;  2F4I A;  1VQ6 A;  3BDC A;  3SVM A;  1PHJ A;  1QVG A;  2Z6B A;  1A2T A;  1SDF A;  1F9S A;  3VR5 A;  4H02 A;  4HAE A;  4A4I A;  5I9P A;  2VQE L;  1CHP D;  4GN4 B;  2NVX H;  5EKL A;  3NEN A;  1M90 C;  4IFD I;  3NSW A;  4N8X 1;  4DV4 Q;  2A74 C;  4C3H B;  2YTV A;  1EYG A;  5LMU L;  1SYC A;  2EJM A;  2AUK A;  2WAC A;  3HOZ B;  3BG3 A;  4A3G H;  2NB0 A;  4N8F A;  3A55 A;  2Y0S E;  4QGU A;  5C4J B;  3OSO A;  4BY1 B;  1I4G A;  2ZTC A;  4K14 A;  3NUC A;  3WWV A;  1H9S B;  2M00 A;  3VR4 A;  1VQG A;  4BBS G;  3QOL A;  1O7Y A;  2Z9H A;  1DGS A;  2AUJ D;  3R2I A;  3QIA A;  2HIV A;  2KOL A;  4XQJ A;  3F2C A;  4JI6 Q;  2JEB I;  3JC6 6;  4CDD C;  2D9U A;  5FO7 B;  5M5W H;  2IX0 A;  4V19 0;  1CUK A;  1YHB A;  5M3M H;  4X66 L;  1E2Z A;  1G8Z D;  2ZJR A;  2LS0 1;  3HOU B;  3K57 A;  1JJC B;  5BN4 A;  3C1F A;  1X9N A;  1ZYR D;  4A3J G;  4DAP A;  3H0G G;  1C8C A;  2O4X A;  1PDQ A;  1YJN A;  4A3I H;  2Q2U A;  1I4H A;  5J39 A;  5KEE A;  1OO9 B;  1SE3 A;  2KBN A;  3E9H A;  1LT5 D;  2WIN B;  3M3Y H;  1ML0 D;  3OIP A;  2NVQ H;  4K2K A;  4DNT B;  4X64 L;  3BVM A;  4QIW B;  2HT1 A;  2A19 A;  1HNZ L;  1D5M C;  1A3U A;  3EIV A;  3HP3 A;  4JVZ A;  2PQA B;  4ODG A;  1A0I A;  1Q81 C;  3I2Z A;  2ES2 A;  1UAP A;  5GAH C;  3NEM A;  4QY7 A;  1CZG A;  4WJ4 A;  2OTL A;  3IFT A;  3F2U A;  1S3O A;  1XTD A;  5GAG C;  1WTP A;  1WCM H;  3S9W A;  5EJW A;  3TRE A;  3Q24 A;  1CA5 A;  1STG A;  2Z6K C;  4PG3 A;  3P7J A;  5C3E B;  2C5C A;  5M3F H;  3HOY G;  3I4N H;  4DV2 L;  3M85 A;  4DUY L;  5C4X H;  3VR2 A;  4DV0 L;  2UU9 L;  1H9M A;  4C3J G;  1X3F A;  2FIN B;  2RDG A;  2PZU A;  3KBX A;  4C1N I;  5E4X A;  2R93 H;  4EQN A;  5C4X G;  1GUO A;  1T5X D;  1YHA A;  5DEH A;  5C0X I;  1L1O A;  1EIF A;  3DWP A;  1FL0 A;  5CR3 A;  4GOP B;  4KN7 C;  1FD7 D;  4QUF A;  4J15 A;  5AFW A;  4IUR A;  4HJ8 A;  1I5F A;  2EYF A;  2F0S A;  3AU7 A;  4KKU A;  1Q3L A;  5CV4 A;  4TVA B;  2NN6 I;  4QQB X;  1UWV A;  3C1E A;  1LV9 A;  1T9H A;  4DN4 M;  1XMQ Q;  1QG7 A;  1UUP A;  1T5E A;  2JK8 A;  2JN4 A;  4IPG A;  4L6T B;  2MO1 A;  2LFN A;  3UDX A;  1A8V A;  2DJF C;  4A3I G;  2JYO A;  2K5D A;  5G3L F;  4JI0 Q;  4ME5 A;  1SFO H;  2HCI A;  4HN7 A;  2F0L A;  2L15 A;  1J5E Q;  1KAA A;  4RHS A;  4JI3 L;  4POF A;  4IUT A;  1MSG A;  4HR7 B;  2F3V A;  1GUS A;  3L0O A;  5IYD G;  1WCM B;  5AJ3 Q;  4WOR A;  3M7N A;  2UXD Q;  5DLQ E;  1YVC A;  3EQL C;  4JI2 Q;  1OXS C;  1G29 1;  4UP9 A;  1HZ9 A;  3AB9 A;  1IYU A;  4LUZ A;  1I3Q B;  1SAP A;  1A3T A;  1CK1 A;  2JA6 H;  1EYD A;  1AW7 A;  2EOT A;  1VQ8 A;  1PFN A;  3BYY B;  2AKW B;  2UUC Q;  3L3O C;  4HIM A;  2VW9 A;  1XNQ L;  1VQC A;  5COR A;  2HD3 A;  5KNB A;  1ESF A;  3CXC A;  1K3B C;  4RH6 A;  4DV1 L;  3M4Q A;  1QB5 D;  2FHT A;  1PTO C;  5J1Z A;  3ZYY X;  2OWO A;  3D0F A;  1SMY C;  2VQF L;  3DWQ A;  3A74 A;  1AEX A;  4JOI C;  4ZKC B;  4K2L A;  1I94 L;  4B3R L;  1X3E A;  1VQB A;  1JOK A;  4PQX A;  1IKM A;  3Q6S A;  4EGV A;  1JIC A;  2F0W A;  3D6C A;  2CH4 W;  2TMP A;  2KCT A;  1CKM A;  5I2Y A;  3V2T A;  4HTH A;  3H94 A;  1STH A;  2A6H C;  3NP8 A;  1EYC A;  4RCO A;  2QDB A;  1V1O A;  1C4Q A;  4DUZ L;  1K3R A;  2KCM A;  1XTC D;  2OT2 A;  1OXX K;  3FKI H;  1UEB A;  2WP8 J;  2OQ0 A;  4N9T A;  2A1A A;  1CKN A;  3MEH A;  1HNW Q;  1STY A;  1TWG B;  1LTG D;  3S24 A;  4KKT A;  5ELD A;  1HQR D;  3RZD B;  2CCZ A;  2VQE Q;  4UP7 A;  3G71 A;  3C46 A;  4ULL A;  4ZAI A;  3S1R H;  4B3T Q;  3PUV A;  4A93 B;  5GQO A;  2Q8R E;  1TWA H;  3MWY W;  5LMU Q;  2EYO A;  1CKN B;  1UE1 A;  1BBX C;  1BCP B;  1XNR Q;  3E3X A;  2KEN A;  4NXN L;  4X3T A;  4HSP A;  3EVQ A;  5FKA C;  4U68 A;  5I9O A;  3DM3 A;  1XPU A;  1ICF B;  3J7A V;  2R61 A;  2EXD A;  2KVM A;  2F0V A;  3KLS X;  4OO1 H;  1X56 A;  2M9V A;  5JVH 3;  3K81 C;  1WI5 A;  3QWN A;  4JI6 L;  4R4O A;  2H4O A;  4ZCK A;  1Y14 B;  2JA8 G;  1E2V A;  1UE5 A;  1KRT A;  4DAY A;  1UEA B;  4ID6 A;  4IUQ A;  1F9R A;  5IGF A;  1JJ2 A;  1BQQ T;  3D3R A;  3T4A C;  4K0K L;  1HHV A;  2VZA A;  2F0T A;  4DR2 L;  2R7F A;  4FNF A;  1RDP D;  3GTL B;  1SYB A;  2HCC A;  3A0J A;  2I5L X;  4JBW A;  3KJP A;  4GNX B;  4JG2 A;  4B08 A;  1HUN A;  3OTO Q;  5T1G A;  1B8A A;  3RLN A;  3GTG H;  1PRT C;  4LF5 Q;  2IY5 B;  1TWH B;  4UY8 C;  1PRT B;  1B3A A;  2UUA Q;  3PUX A;  1G2S A;  2B8F A;  4JYA L;  1EL0 A;  5T1I A;  3WOE A;  5FO8 B;  1HTP A;  4DR1 Q;  1PH6 A;  2D0O A;  5HGT A;  5JEA G;  4KJN A;  1RF2 D;  4X3S A;  4I65 A;  4PZ6 A;  3IFD A;  4AYB E;  1F9Q A;  4A93 G;  4PMC A;  4AYB G;  3S1N B;  1A6X A;  3G4S A;  4YY3 Q;  5CGK A;  2QW7 A;  2K7V A;  4DA2 A;  2VUM B;  1ILP A;  4FF1 A;  1MI2 A;  2E2J B;  4FDB A;  3J7Z C;  4JOI A;  3MXG A;  1PRT D;  3HOU H;  3K59 A;  2O5I C;  1Z9F A;  5IGB A;  4DFA A;  1WYD A;  1Y1W G;  3L9A X;  5CV7 A;  4DUY Q;  3K0Y A;  4R4I A;  2B2U A;  3ERQ A;  3HOX H;  1WTQ A;  1JOQ A;  1CSQ A;  4DR5 L;  1BO0 A;  2NZO A;  1HA5 A;  2C35 B;  3CCS A;  4KY6 A;  4CBV A;  1SYD A;  3S1M H;  5CBE E;  4DV3 Q;  1ZEQ X;  1BBW A;  3CU7 A;  4XQN A;  1IL8 A;  5CMD A;  3NPP A;  2B2V A;  4J1M A;  1Y1V H;  3CF5 A;  4WRD A;  4I7A A;  1B1Z A;  5FLM H;  3TQY A;  1YI2 A;  3HOV B;  5C0X J;  3CC4 A;  4A3G B;  2CVR A;  4RG1 A;  5IGC A;  3MFY A;  1YIT A;  2B39 A;  4A3K B;  1SMY D;  3MXU A;  1AZQ A;  5KNC A;  1Q46 A;  2C9O A;  3FDT A;  3GTL H;  2JA7 B;  1YNJ D;  1IBM Q;  1CHQ D;  3RN5 A;  1N33 Q;  4GOP A;  3K58 A;  1NMF A;  2Z6K A;  5KGU A;  1SMX A;  3J7A 5;  2K05 A;  3MXN B;  1EEF D;  1MSH A;  4DV7 Q;  3NTK A;  1EU3 A;  3RZO B;  5C5M A;  2NN6 H;  1PYB A;  2IL8 A;  1A3V A;  1NAP A;  3LGJ A;  3IL8 A;  1D2B A;  2IPK D;  3RUZ A;  1TS4 A;  2F0G A;  1SYF A;  4FF2 A;  1SNQ A;  4PZ7 A;  1Q90 A;  4NP5 A;  1ENA A;  1WTV A;  1FYC A;  3IKJ A;  1L1O C;  3L7Z C;  5I2X A;  4ZUI A;  2F52 A;  1VQ7 A;  1SLJ A;  1EY5 A;  3KLW A;  2TSS A;  3CCL A;  1EIY B;  1Q86 C;  4BY1 H;  2NVQ B;  2JA5 B;  3R8B A;  3UE1 A;  5IGG A;  4LAA A;  4LWC A;  1EY7 A;  2MJ8 A;  2EYH A;  5M5X B;  1WD0 A;  3S2H H;  3PO2 H;  2G5D A;  4XT1 B;  4A3J H;  2R92 B;  3BJU A;  1KIX A;  3E0E A;  5M5Y H;  1Y8N B;  2UXB L;  4GKK L;  3PUY A;  1BVS A;  3NHH A;  4IFD H;  2ZXR A;  2PW5 A;  4KLK A;  2MGS A;  3BDL A;  4R4T A;  2R93 B;  1HRJ A;  1SNC A;  3SGI A;  3TS0 A;  3CQZ B;  4XXE A;  4X66 Q;  1QUQ A;  4DXF A;  3SK8 A;  4A3K G;  4K5V A;  3AFQ A;  4BXX H;  3J80 L;  2E2H H;  3PUZ A;  5FK9 C;  1IKL A;  3HOV G;  1O7L A;  2ATW A;  1PH2 A;  1Y8P B;  4OHJ A;  1BKB A;  3K8A A;  1DON A;  3AYH B;  3K0X A;  5C44 H;  3K7A B;  3MZ5 A;  1B3Q A;  2FXQ A;  1GUW A;  4Y52 H;  3H91 A;  2F4V L;  2RHS B;  2B29 A;  4H7B A;  1Q8I A;  3AFP A;  5C4X B;  2A68 D;  2I5H A;  4X64 Q;  3QB3 A;  4B9X A;  5IYD H;  2AMC B;  1JOR A;  1F77 A;  4FYD A;  1LUZ A;  3GDE A;  1HNZ Q;  4R9W A;  2E2I H;  3HOY B;  3HG9 A;  1BBU A;  1SBB B;  3MHB A;  2B2Y C;  1I6H H;  3FPU B;  1F2L A;  1I4Q A;  1F2Y A;  2A6H D;  1KRS A;  1JWU D;  3I4M H;  3HOW G;  2HQE A;  1FJG Q;  2K52 A;  4B3T L;  1JE4 A;  5BN5 A;  1VQ5 A;  4L5T A;  1VQL A;  4HJ5 A;  5EAY A;  4KHP Q;  5D3I B;  1GUN A;  1MJC A;  3A54 A;  2PI2 A;  2JA6 B;  2B2V C;  4LF4 Q;  3KF6 B;  1N32 L;  1O78 A;  1NMG A;  2Z4H A;  1DOL A;  5EBC A;  4HCE A;  4LNQ A;  3H3V H;  2E2H B;  4JI8 Q;  2YTY A;  3F8T A;  4LF7 L;  2YV5 A;  3P1H A;  2SNS A;  2VB2 X;  2HUG A;  1A63 A;  5ISR A;  2H1E A;  2BCO A;  1QVF A;  4F8M A;  1GXD C;  4IUN A;  2RDF A;  3L2P A;  1JB7 A;  1OXV A;  3HKZ B;  4K6L A;  4QF4 A;  1ENC A;  2K03 A;  3S1N H;  4J8Q A;  5FLX E;  5ELE A;  1E3P A;  2JJQ A;  4A3J B;  2R92 H;  1HH2 P;  1GUG A;  1JC7 A;  2EY6 A;  4P2C B;  3PIO A;  4OON A;  5IGE A;  3J81 j;  2KA7 A;  2N8N A;  1BCP F;  1D1K A;  1TR5 A;  4IPH A;  4LFA Q;  3RZO H;  4YWK A;  1JR0 D;  4IFD J;  4X62 L;  3I4O A;  2LXK A;  2RA4 A;  3BZK A;  3NXW A;  4DU9 A;  2Q8T A;  3AEV A;  3E0J A;  1KNE A;  1HJP A;  3NEL A;  3CCU A;  1EWH A;  4A3M G;  1TWA B;  2V1C C;  3DUZ A;  2EY2 A;  4ZYS A;  1EIH A;  1PYW D;  2P5Z X;  5JJI A;  2KHI A;  1KNA A;  4Y7N H;  1B53 A;  2G9H D;  1ET6 A;  3HOZ G;  1KL9 A;  5C0X G;  1LAB A;  1SJE D;  3F1Z A;  1HNW L;  5JEA J;  4JI5 L;  1WFQ A;  1UE7 A;  1Y1V B;  1KXL A;  2PNR C;  3PUW A;  4NDX A;  4XIG S;  1YEZ A;  4YHH L;  3DEP A;  2E75 C;  3I4M G;  1BXT A;  2V4D A;  3UI2 A;  3VA7 A;  1A62 A;  5KYI A;  5DM6 3;  5H1S E;  1XNR L;  1DM0 B;  3M4O H;  1YNJ C;  3S16 B;  2NYZ D;  3G7L A;  3I55 A;  1RIP A;  2F0P A;  3BU2 A;  1WJJ A;  4L63 B;  2LMC B;  3KDF B;  4GNX A;  1KQS A;  3J80 E;  1V8Q A;  3CKI B;  4H44 C;  4EQO A;  3STB D;  3VDY A;  1EQQ A;  3CHB D;  2BE5 D;  2YU9 H;  2K5Q A;  3A8I E;  3K5L A;  4OL7 A;  4XTC S;  5FJ8 H;  4HJ9 A;  3V05 A;  2SNM A;  3S2D H;  3MXP A;  3PGZ A;  1X3Q A;  4DR2 Q;  3VA5 A;  1AZP A;  2YYZ A;  2B63 B;  3DMU A;  2PI2 E;  2KHS A;  2KCC A;  4BBR G;  2CQO A;  3G48 A;  5IT9 c;  5ELO A;  4CJ2 C;  4JK1 C;  3A8K E;  4P72 A;  2XSC A;  3GTJ B;  2RSN A;  4GZY C;  1U4R A;  1X3P A;  3CPF A;  5JPM C;  3NTH A;  3SEB A;  4HID A;  1WTR A;  4DV2 Q;  2PZW A;  2DY8 A;  4DV0 Q;  1Y1W B;  2UU9 Q;  1ASY A;  2B2U C;  3I73 A;  1K8O A;  1PTO D;  2MPM A;  4KHZ A;  5C0X H;  1I6H B;  4DR6 L;  3TDQ A;  3GP7 A;  4OO1 G;  1BR9 A;  5C4H A;  1FNW A;  4OXP A;  2AWN A;  1M4V A;  1LTS D;  3JAM E;  4L5Q A;  3EN2 A;  3RR5 A;  5A2Q L;  3CCJ A;  3OMG A;  3R2T A;  5E1F A;  3J7Y W;  4JPB W;  1HNX L;  1YNX A;  4DGZ A;  3A5U A;  4L5S A;  1B9N A;  3ND9 A;  2IHF A;  1TWG H;  4GLV B;  2CH4 A;  2VUM G;  3PO3 G;  2JEA I;  1GKH A;  1X6O A;  1V1Q A;  3A8J E;  1K8A C;  1HFN A;  4KTA A;  5BN3 A;  4A3E H;  4LK1 C;  1PTO F;  3S17 H;  5IP9 G;  1LTR D;  2JA9 A;  1Y1V G;  3ULP A;  4GOP C;  4K0K Q;  4N9P A;  4TRD A;  1K73 C;  3CMA A;  4OO1 I;  3PMF A;  2XWB B;  1G51 A;  1N8R C;  4B3R Q;  1IZ6 A;  1OXT A;  3GTP H;  1JT8 A;  5E7N A;  2UXD L;  1E0B A;  5C3W A;  4ZRZ A;  4YWM A;  3KFU A;  5ELB A;  4KV6 A;  2F3W A;  3PQI A;  1N36 L;  1N34 Q;  2F0M A;  2D62 A;  3UDI A;  1K9M C;  4A3M B;  3OTO L;  2ZXP A;  3DLL A;  3VYU A;  2L4N A;  4O1N A;  4BBR H;  2D2C C;  3H3V C;  3S14 B;  3UDG A;  1M8A A;  3A5Z B;  2I5M X;  3OIQ A;  1B50 A;  3DHQ A;  3TRZ A;  3SK6 A;  1LM0 A;  1STE A;  4JYA Q;  1YJW A;  1UE6 A;  3E6Z X;  4A3B B;  2LXJ A;  2FMM A;  2XIW A;  2EXZ A;  3J81 L;  5M5X H;  3U9O A;  4DV7 L;  2F3I A;  1CQF A;  3URY A;  4DAY B;  3GV3 A;  4NXM Q;  4IQZ A;  2NVY H;  4GNX C;  3S1Q H;  3LWE A;  3U58 A;  2K28 A;  5D3D A;  1VQM A;  4C3J H;  1IW7 D;  3K6O A;  1SNM A;  2EJG C;  4YY3 L;  2QEX A;  2PQA A;  4OIJ A;  2YU9 B;  1QUQ B;  3OW2 A;  1SR3 A;  3PO3 B;  3D4D A; 
#chains in the Genus database with same CATH homology
 1VMP A;  2G9D A;  3OWF A;  1EYA A;  2CHB D;  4A3D B;  1S5E D;  3SHL A;  2O5J C;  1DJR D;  2Z1C A;  4C1N K;  3GD7 A;  2A5H A;  4KK7 A;  5I6W A;  4RKL A;  1Y69 U;  1XYI A;  1R4Q B;  1L0X B;  4NW2 A;  4CHT B;  1TWC B;  1QNK A;  2B2Y A;  4A3E B;  1YNN D;  2EY5 A;  1IW7 C;  4O42 A;  2NTS A;  2F0Q A;  3MXN A;  4RGT A;  2R6G A;  2X6G A;  3A56 A;  1NUC A;  1HQM C;  1YNN C;  1CFM A;  2RDH A;  4K8J A;  1F2M A;  3ONA B;  1LLR D;  1MGS A;  3VR6 A;  5EPK A;  2PW7 A;  1U9R A;  4CJ0 B;  1GJX A;  3T51 B;  5C3X A;  2AQ3 B;  2PMZ B;  1BOS A;  2AQ2 B;  1NSN S;  3O13 A;  4KI0 A;  2F0E A;  1JCK B;  1J9O A;  2X69 A;  4PMB A;  4K6D A;  1EFI D;  3BVG A;  3DXJ C;  5G3L D;  1QCB D;  4A3I B;  4BBR B;  1RKN A;  2MP1 A;  3Q23 A;  3TP7 A;  4G57 A;  1QE6 A;  1HCZ A;  1SNP A;  3LWU A;  2EYM A;  5M5W B;  3GV6 A;  2EE1 A;  3T53 B;  1SEB D;  4DK1 A;  3KBG A;  1I4X A;  5JAV A;  2CW0 C;  3SK5 A;  3N6R A;  2LY7 A;  2L12 A;  2JXM B;  5KYL A;  3MTS A;  1EY6 A;  1PLF A;  1VF7 A;  3N52 A;  2F0O A;  1EZ6 A;  1LT4 D;  5A35 A;  3BS1 A;  1JOO A;  5D14 A;  2F0N A;  1MBY A;  3R3O A;  1GHK A;  1PZI D;  1QWY A;  4XYO A;  2Z8L A;  1OXU A;  1EWC A;  4HMJ A;  5E3F A;  3S1Q B;  2EJF C;  3I4L A;  3Q0A A;  2PQE A;  1DZ1 A;  4RWS C;  5CBA E;  3EA6 A;  3NTI A;  1LT6 D;  2Y0S B;  2X6L A;  2CQA A;  5K5P A;  4FXK C;  4RGN A;  1STN A;  2F0K A;  3I70 A;  5IT9 L;  3JAM L;  3OHX C;  1DOK A;  3RLF A;  3K5N A;  2K1B A;  3HS0 C;  1ILQ A;  1EY9 A;  4ILW A;  3MAQ A;  1U4M A;  2EYL A;  1XX8 A;  5A2Q E;  3GQB A;  3QO2 A;  5CV8 A;  4G7O C;  1JWS D;  3DEO A;  4RAU C;  4CKB A;  4DXG A;  2K33 A;  4XDX A;  3BVZ A;  3U9S A;  1SYE A;  1BCP D;  4FXD A;  4X3K A;  2A73 B;  1CTM A;  2OXP A;  5D65 A;  2QKI C;  1IYV A;  5C5L A;  1PRT F;  2BDN A;  1PZJ D;  4QB4 A;  3FVQ A;  3FPP A;  1KTK A;  1S5B D;  1S4Z A;  1JQY D;  4ZK9 B;  3R93 A;  3D4W A;  1EOT A;  5LL6 X;  2L55 A;  1II3 A;  1STA A;  4YIJ A;  1S5D D;  4CKE A;  2NUC A;  2XN9 C;  1X32 A;  4M1U B;  2WKD A;  2ID0 A;  2B2T C;  4XT3 B;  4C2M B;  3KLR A;  5I6Y A;  2ZT9 C;  1TU2 B;  2DNC A;  2PYK A;  2OEO A;  5JVG 3;  3S17 B;  4DF7 A;  2KED A;  1ZXT A;  3KLS A;  3HOX B;  4XYQ A;  1S5C D;  2EYP A;  1BUV T;  2J0T D;  3MA2 B;  4KD3 A;  4KN4 C;  3H09 A;  1ZKO A;  1H9R A;  1Z47 A;  1LTB D;  5I4D A;  3DM1 A;  1H9J A;  4RHR A;  2VXW A;  4CJ1 B;  3TP6 A;  1WTO A;  1NR4 A;  3GO5 A;  4C3I G;  2B2W C;  4RGO S;  1RCV D;  4UAI A;  2BA1 A;  5EKK A;  5CV5 A;  5KND A;  1QNU A;  2EDG A;  5CC4 A;  2KEC A;  3I72 A;  3I4M B;  1Y8O B;  3GTK B;  1VCI A;  4G7H C;  1ROD A;  1ENF A;  1RTO A;  1STB A;  2VNU D;  3LX0 A;  4LJZ C;  2L5T A;  1O7Z A;  1EY0 A;  2R3Z A;  1Q1E A;  5E4W C;  4XQQ A;  3W3A A;  3RD4 A;  2NBF A;  1D5Z C;  4TKO B;  4KHV A;  1WTW A;  2R7Z B;  1EQT A;  2RBM A;  2E2I B;  2FMC A;  3X3N A;  1H9K A;  1HUM A;  3TBI B;  3HRZ C;  2D5D A;  1ICW A;  2CW0 D;  1KAB A;  5FOB B;  1EEI D;  3J7A F;  2K32 A;  2F1M A;  4ABN A;  5IOC A;  4F7X A;  2O2L D;  1AFP A;  2NWG A;  2B2T A;  5C6A A;  4HSV A;  3MVV A;  4QUC A;  4CKC A;  1KLU D;  1JWM D;  1PZK D;  2DY7 A;  1CM9 A;  2HDL A;  4R8I A;  2XNA C;  2NTT A;  3HEJ A;  4E6I A;  2BDO A;  1U4P A;  1G91 A;  5COY A;  3IAY A;  3HOW B;  3I3C A;  3A7A B;  1PMR A;  1PFM A;  2ICI A;  5JEA H;  4Z9C B;  1I4R A;  3EFX D;  3KUP A;  2MUY A;  1MD2 D;  5EGT A;  3M7G A;  3S1M B;  1CZW A;  4PMW A;  3NE5 B;  4BS9 A;  2B2W A;  2ICE C;  1LO5 D;  1F9P A;  3CRL C;  1TT2 A;  4LMQ D;  3NK9 A;  4IUU A;  4BA2 I;  1CI3 M;  4DK0 A;  2DNE A;  4FP5 D;  1EIG A;  1EU4 A;  3ND8 A;  3S2H B;  3BYT B;  4PNY A;  4Y7N B;  1TKW B;  2E74 C;  1TY2 A;  2WV6 D;  1EY4 A;  1LTI D;  5IGD A;  2F03 A;  1GOZ A;  4IN3 A;  4KD4 A;  3VYS A;  4IZ8 A;  2XWJ B;  1U4L A;  1BDO A;  2DN8 A;  1L0Y B;  2IW3 A;  4ZLT F;  1RD9 D;  2K5W A;  1VDZ A;  1DCZ A;  2SDF A;  2PO4 A;  2IJ0 A;  3K5M A;  3BDO A;  3GTP B;  1TY0 A;  4PV1 C;  1TWF B;  1LTA D;  4NKL A;  5M3F B;  2AQ1 B;  4K5X A;  3AMU A;  1I50 B;  4H0L C;  3S2D B;  4J6H A;  1QIL A;  1I4P A;  5CYU A;  3D8G A;  1HPC A;  4EQP A;  2JE6 I;  5DAU A;  3X3M A;  1E2W A;  5TSS A;  1PTO H;  3PIP 3;  1DYQ A;  3NBI A;  1B9M A;  3SR1 A;  1V1P B;  5ELF A;  3H6M A;  2E76 C;  1EY8 A;  1V43 A;  1LTT D;  3OOC A;  4NMZ A;  1VMC A;  2B8G A;  3PIO 3;  3A7L A;  1XXG A;  1NCV A;  4KKS A;  4DAV A;  4TQU S;  1H9S A;  2KJX A;  2IX3 A;  3ERO A;  1TS2 A;  4BY7 B;  2WAQ B;  2FFK B;  1W6J A;  3PO2 B;  5M3M B;  1B44 D;  1VF5 C;  4HMI A;  4V0B A;  2ZXO A;  3S15 B;  3TZU A;  4R8N A;  1DD2 A;  2SOB A;  1FR3 A;  3LNN A;  4L8J A;  1AN8 A;  1ONL A;  3G6J B;  1DXM A;  1K83 B;  3M3Y B;  1D1I A;  3QOJ A;  3RMH A;  5JPN C;  1FNV A;  3VYR A;  2KCN A;  4C3J B;  1Q12 A;  4HED A;  2IT1 A;  1WTX A;  4FO2 A;  4ZQ3 A;  3I90 A;  5LHY 1;  4S3S A;  1A15 A;  2QEJ C;  1R9T B;  1QJO A;  1TS3 A;  3WOF A;  1KDC A;  5J22 A;  2RQX A;  3GTM B;  4IFD G;  5C44 B;  1KLG D;  3J81 E;  3VR3 A;  2M2L A;  4ZUJ A;  3SXH A;  4M8A A;  2XVS A;  4FF4 A;  4UDU C;  4IAL A;  5ELC A;  4BA1 I;  3I8Z A;  2HDM A;  3D4R A;  1EQV A;  1BCP C;  4BWG B;  5DNF A;  4IUV A;  3NWS A;  2A69 D;  5CV6 A;  1B4O A;  5NUC A;  1FGB D;  4DNR B;  1Q1B A;  5EPL A;  2EZV A;  2IX1 A;  1HXY D;  3PV0 A;  2NVX B;  4F87 A;  1ESR A;  1IHZ A;  2PPB C;  2A69 C;  1JB3 A;  4K8I A;  1CA6 A;  3FRP B;  4G7Z C;  1B2T A;  1GUT A;  4F88 A;  1SJH D;  3H0G B;  2F0U A;  2K01 A;  3GTO B;  1QOH A;  2EYJ A;  5K36 H;  3I91 A;  2QIL A;  3FMC A;  1EZ8 A;  1LAC A;  1SND A;  1WD1 A;  3Q22 A;  5EQ0 A;  2XRQ D;  5IIF A;  1W6K A;  1SE2 A;  2Q8I B;  1NR2 A;  2VB3 X;  3NQT A;  4A3F B;  1TS5 A;  2A6E D;  2EY1 A;  3K5O A;  5FLX L;  1F2Z A;  1CQV A;  4MIU A;  2L9H A;  1PFB A;  5LL6 S;  1D5X C;  2J7Z A;  4K5W A;  4RCN A;  3NBH A;  4U67 3;  1HFG A;  2JP1 A;  1TII D;  2A6E C;  2F0H A;  3HGB A;  3WDN A;  2BE5 C;  2E2D C;  3KK7 A;  3C3L A;  5HUR A;  3FEW X;  4CGY B;  4RFB A;  4IUP A;  4C3I B;  2F0F A;  3SE0 A;  3VYT A;  3T16 A;  4QMG A;  2I07 B;  1XWE A;  3TP5 A;  2MHV A;  2NVY B;  4OGQ C;  3BZD B;  1G6Z A;  3FKI B;  1DOM A;  2PCF B;  1J8I A;  1CT1 D;  4X3U A;  4KMU C;  3MFG A;  1TVX A;  3GTQ B;  1FNU A;  4Q0F A;  2KUM A;  4KJO A;  2IWH A;  1SFO B;  1D6E C;  1C48 A;  3NWT A;  1GHJ A;  3TME A;  2KEE A;  2WKC A;  1TQO A;  1RHP A;  1SXT A;  4Q5V A;  1BNZ A;  2F0J A;  3W2D A;  5M5Y B;  3TP8 A;  5FO9 B;  2ENB A;  3S1R B;  5CV9 A;  4MHE A;  4AYB B;  1RJT A;  3KF8 A;  2WII B;  4KY7 A;  4B9W A;  1V1P A;  3T56 B;  2RKS A;  4FXG C;  5IT9 E;  4EVO A;  5M9O A;  3OWE B;  1SSO A;  4HCS A;  3OPO A;  5C4Z A;  4RGM A;  2AWO A;  1Z6H A;  1K8M A;  1R4P B;  2I46 A;  3NQI A;  5EPJ A;  4RKB A;  3T13 A;  2RSO A;  2N88 A;  4G4K A;  4MN3 A;  1SNO A;  2K6A A;  2SEB D;  2F0D A;  2NZ1 D;  2FJ2 A;  3TN2 A;  2N55 A;  2NVT B;  2J4X A;  4TSS A;  1UNS A;  2JA8 B;  3V96 A;  4BBS B;  2LKV A;  1SYG A;  3OW7 A;  1G2T A;  3HZX A;  4OIK A;  3P75 A;  4RA8 A;  2F0I A;  5IOD A;  1O80 A;  3M4O B;  3SDZ A;  4C3H G;  5KIX A;  2PZT A;  3QG1 A;  1BF4 A;  1HTL D;  5DM7 3;  2NN6 G;  2EPB A;  1WVL A;  3SK4 A;  3C2P A;  2JSO A;  3I4N B;  2KQ3 A;  3ITP A;  2EVB A;  2GA4 B;  4KY5 A;  1Z7T A;  3TZD A;  3GTG B;  1HA6 A;  2K04 A;  4WJW A;  1ZYR C;  2Z4I A;  1ET9 A;  1AP0 A;  3QJY A;  5JOB A;  5EKI A;  3MC0 B;  4I7Z C;  3M4Y A;  3OMC A;  1I6V C;  4WFN 3;  5JJZ A;  4C56 C;  2L1B A;  3DWA A;  5K36 G;  1KDA A;  3TSS A;  2L11 A;  3CRK C;  1S5F D;  3D6W A;  4QCL A;  1LT3 D;  1PTO B;  1KDB A;  3EJI A;  5EBD A;  2QCP X;  2L0C A;  4H13 C;  3E5S A;  4FVM A;  2XRS D;  5KRU A;  4ZKB B;  1PXU A;  2QF7 A;  1A2U A;  2BOS A;  4FF3 A;  1SE4 A;  3D31 A;  3P20 A;  2WB1 B;  2A68 C;  2RVL A;  2OF1 A;  1RTN A;  2BA0 A;  5F2D A;  2F4I A;  3BDC A;  3SVM A;  1A2T A;  1SDF A;  1F9S A;  3VR5 A;  4HAE A;  5I9P A;  1CHP D;  5EKL A;  4IFD I;  3NSW A;  2A74 C;  4C3H B;  1SYC A;  2EJM A;  2AUK A;  2WAC A;  3HOZ B;  3BG3 A;  2NB0 A;  3A55 A;  5C4J B;  3OSO A;  4BY1 B;  1I4G A;  4K14 A;  3NUC A;  1H9S B;  2M00 A;  3VR4 A;  3QOL A;  1O7Y A;  2AUJ D;  3R2I A;  3QIA A;  4XQJ A;  2KOL A;  2JEB I;  2D9U A;  5FO7 B;  2IX0 A;  4V19 0;  1E2Z A;  1G8Z D;  2LS0 1;  3HOU B;  3K57 A;  5BN4 A;  3C1F A;  1ZYR D;  4DAP A;  1C8C A;  2O4X A;  1PDQ A;  1I4H A;  5J39 A;  5KEE A;  1OO9 B;  1SE3 A;  1LT5 D;  2WIN B;  1ML0 D;  3OIP A;  4K2K A;  4DNT B;  3BVM A;  4QIW B;  1D5M C;  1A3U A;  3HP3 A;  4ODG A;  1UAP A;  1CZG A;  3IFT A;  3F2U A;  1WTP A;  3S9W A;  5EJW A;  3Q24 A;  1CA5 A;  1STG A;  3P7J A;  5C3E B;  2C5C A;  3M85 A;  3VR2 A;  1H9M A;  4C3J G;  2FIN B;  2RDG A;  2PZU A;  3KBX A;  4C1N I;  5E4X A;  4EQN A;  1GUO A;  1T5X D;  5DEH A;  5C0X I;  3DWP A;  5CR3 A;  4KN7 C;  1FD7 D;  4QUF A;  5AFW A;  4IUR A;  2EYF A;  2F0S A;  3AU7 A;  4KKU A;  1Q3L A;  5CV4 A;  2NN6 I;  3C1E A;  1LV9 A;  4DN4 M;  1QG7 A;  1UUP A;  1T5E A;  4L6T B;  2LFN A;  2JYO A;  2K5D A;  5G3L F;  4ME5 A;  2HCI A;  4HN7 A;  2F0L A;  1KAA A;  4RHS A;  1MSG A;  4IUT A;  4HR7 B;  2F3V A;  1GUS A;  1WCM B;  4WOR A;  3M7N A;  3EQL C;  1OXS C;  1G29 1;  3AB9 A;  1IYU A;  1I3Q B;  1SAP A;  1A3T A;  1CK1 A;  1EYD A;  1AW7 A;  2EOT A;  1PFN A;  3BYY B;  3L3O C;  5COR A;  5KNB A;  1ESF A;  4RH6 A;  1QB5 D;  2FHT A;  1PTO C;  5J1Z A;  3ZYY X;  1SMY C;  3DWQ A;  1AEX A;  4ZKC B;  4K2L A;  4PQX A;  1JOK A;  1IKM A;  3Q6S A;  4EGV A;  1JIC A;  2F0W A;  3D6C A;  2TMP A;  5I2Y A;  3V2T A;  4HTH A;  3H94 A;  1STH A;  2A6H C;  3NP8 A;  1EYC A;  4RCO A;  2QDB A;  1V1O A;  1C4Q A;  1XTC D;  2OT2 A;  1OXX K;  2WP8 J;  4N9T A;  3MEH A;  1STY A;  1TWG B;  1LTG D;  4KKT A;  5ELD A;  1HQR D;  3RZD B;  3C46 A;  4ULL A;  4ZAI A;  3PUV A;  4A93 B;  2Q8R E;  3MWY W;  2EYO A;  1BBX C;  1BCP B;  4X3T A;  4HSP A;  3EVQ A;  5FKA C;  4U68 A;  5I9O A;  3J7A V;  2R61 A;  2KVM A;  2F0V A;  3KLS X;  4OO1 H;  2M9V A;  5JVH 3;  3QWN A;  2H4O A;  1E2V A;  4DAY A;  1UEA B;  4ID6 A;  4IUQ A;  1F9R A;  5IGF A;  1BQQ T;  3D3R A;  3T4A C;  1HHV A;  2F0T A;  4FNF A;  1RDP D;  3GTL B;  1SYB A;  2HCC A;  4JBW A;  4B08 A;  1HUN A;  5T1G A;  1PRT C;  1TWH B;  1PRT B;  1B3A A;  3PUX A;  1G2S A;  2B8F A;  1EL0 A;  3WOE A;  5FO8 B;  5T1I A;  1HTP A;  5HGT A;  5JEA G;  4KJN A;  1RF2 D;  4X3S A;  4I65 A;  3IFD A;  1F9Q A;  4PMC A;  3S1N B;  1A6X A;  5CGK A;  2K7V A;  4DA2 A;  2VUM B;  1ILP A;  4FF1 A;  1MI2 A;  2E2J B;  3MXG A;  1PRT D;  3K59 A;  2O5I C;  5IGB A;  4DFA A;  3L9A X;  5CV7 A;  3K0Y A;  2B2U A;  3ERQ A;  1WTQ A;  1JOQ A;  1BO0 A;  1HA5 A;  4KY6 A;  4CBV A;  1SYD A;  5CBE E;  1ZEQ X;  3CU7 A;  4XQN A;  1IL8 A;  5CMD A;  3NPP A;  2B2V A;  4J1M A;  4WRD A;  1B1Z A;  3HOV B;  5C0X J;  4A3G B;  2CVR A;  5IGC A;  3MFY A;  2B39 A;  4A3K B;  1SMY D;  3MXU A;  1AZQ A;  5KNC A;  2C9O A;  3FDT A;  2JA7 B;  1YNJ D;  1CHQ D;  3K58 A;  5KGU A;  2K05 A;  1EEF D;  1MSH A;  3NTK A;  1EU3 A;  3RZO B;  5C5M A;  2NN6 H;  2IL8 A;  1A3V A;  1NAP A;  3IL8 A;  1D2B A;  2IPK D;  3RUZ A;  1TS4 A;  2F0G A;  1SYF A;  4FF2 A;  1SNQ A;  1Q90 A;  4NP5 A;  1ENA A;  1WTV A;  1FYC A;  3IKJ A;  3L7Z C;  5I2X A;  4ZUI A;  1EY5 A;  2TSS A;  2NVQ B;  2JA5 B;  3R8B A;  5IGG A;  4LAA A;  1EY7 A;  2MJ8 A;  2EYH A;  5M5X B;  1WD0 A;  4XT1 B;  2R92 B;  1Y8N B;  3PUY A;  3NHH A;  4IFD H;  2ZXR A;  2PW5 A;  2MGS A;  3BDL A;  2R93 B;  1HRJ A;  1SNC A;  3CQZ B;  4XXE A;  4DXF A;  3SK8 A;  4K5V A;  3J80 L;  3PUZ A;  5FK9 C;  1IKL A;  1O7L A;  1Y8P B;  4OHJ A;  1DON A;  3K7A B;  3MZ5 A;  1GUW A;  3H91 A;  4H7B A;  1Q8I A;  5C4X B;  2A68 D;  3QB3 A;  4B9X A;  1JOR A;  1F77 A;  4FYD A;  4R9W A;  3HOY B;  3HG9 A;  1SBB B;  3MHB A;  2B2Y C;  3FPU B;  1F2L A;  1I4Q A;  1F2Y A;  2A6H D;  1JWU D;  2HQE A;  1JE4 A;  5BN5 A;  5D3I B;  1GUN A;  3A54 A;  2JA6 B;  2B2V C;  1O78 A;  2Z4H A;  1DOL A;  5EBC A;  4HCE A;  2E2H B;  3P1H A;  2SNS A;  2VB2 X;  2HUG A;  5ISR A;  2H1E A;  2BCO A;  4F8M A;  1GXD C;  4IUN A;  2RDF A;  1OXV A;  3HKZ B;  4K6L A;  4QF4 A;  1ENC A;  2K03 A;  4J8Q A;  5FLX E;  5ELE A;  4A3J B;  1GUG A;  1JC7 A;  2EY6 A;  4P2C B;  5IGE A;  2KA7 A;  1BCP F;  1D1K A;  1TR5 A;  4IFD J;  1JR0 D;  2RA4 A;  3NXW A;  4DU9 A;  2Q8T A;  3E0J A;  1KNE A;  1EWH A;  1TWA B;  3DUZ A;  2EY2 A;  4ZYS A;  1EIH A;  1PYW D;  1KNA A;  1B53 A;  2G9H D;  1ET6 A;  5C0X G;  1LAB A;  1SJE D;  5JEA J;  1Y1V B;  2PNR C;  3PUW A;  4NDX A;  4XIG S;  3DEP A;  2E75 C;  1BXT A;  2V4D A;  3UI2 A;  3VA7 A;  5KYI A;  5DM6 3;  1DM0 B;  1YNJ C;  3S16 B;  2NYZ D;  3G7L A;  2F0P A;  4L63 B;  2LMC B;  3J80 E;  1V8Q A;  3CKI B;  4H44 C;  4EQO A;  3CHB D;  2BE5 D;  2K5Q A;  3A8I E;  3K5L A;  4OL7 A;  4XTC S;  3V05 A;  2SNM A;  3MXP A;  1X3Q A;  3VA5 A;  1AZP A;  2YYZ A;  2B63 B;  3DMU A;  2KHS A;  2KCC A;  4CJ2 C;  4JK1 C;  3A8K E;  3GTJ B;  2XSC A;  2RSN A;  4GZY C;  1U4R A;  1X3P A;  5JPM C;  3NTH A;  3SEB A;  1WTR A;  2PZW A;  2DY8 A;  1Y1W B;  2B2U C;  3I73 A;  1K8O A;  1PTO D;  2MPM A;  4KHZ A;  5C0X H;  1I6H B;  3TDQ A;  3GP7 A;  4OO1 G;  1BR9 A;  5C4H A;  1FNW A;  2AWN A;  1M4V A;  1LTS D;  3JAM E;  5A2Q L;  3OMG A;  3R2T A;  5E1F A;  3J7Y W;  4DGZ A;  1B9N A;  3ND9 A;  2JEA I;  3A8J E;  1HFN A;  4KTA A;  5BN3 A;  4LK1 C;  1PTO F;  1LTR D;  4N9P A;  4TRD A;  4OO1 I;  3PMF A;  2XWB B;  1OXT A;  1E0B A;  5C3W A;  4ZRZ A;  5ELB A;  4KV6 A;  2F3W A;  2F0M A;  2D62 A;  4A3M B;  2ZXP A;  3VYU A;  2L4N A;  4O1N A;  2D2C C;  3H3V C;  3S14 B;  1M8A A;  1B50 A;  3OIQ A;  3DHQ A;  3SK6 A;  1STE A;  3E6Z X;  4A3B B;  2FMM A;  2XIW A;  2EXZ A;  3J81 L;  3U9O A;  1CQF A;  3URY A;  3GV3 A;  4IQZ A;  3LWE A;  2K28 A;  5D3D A;  1IW7 D;  3K6O A;  1SNM A;  2EJG C;  4OIJ A;  2YU9 B;  3PO3 B;  3D4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...