3QO2A

Structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
MGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/gene regulation
molecule keywords M-phase phosphoprotein 8
publication title Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 61
sequence length 61
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qo2A00
2D9UA 4O42A 1QNKA 4CJ1B 1ESRA 3N52A 4IUTA 1WTOA 4U68A 3IFDA 1BBXC 1GUWA 3GV6A 3KUPA 5D14A 3F2UA 1DZ1A 1F2LA 1BO0A 4R9WA 3SVMA 2IL8A 1S4ZA 2NZ1D 2Q8TA 4OIKA 2FINB 4LMQD 1B50A 1HRJA 4HSVA 3KBXA 1CA5A 4IUPA 1G2TA 2RA4A 1RODA 3DM1A 5EPKA 1U4PA 2EE1A 1TVXA 1MSHA 3QO2A 2K05A 1Q3LA 5CBEE 1NAPA 4NW2A 1RTOA 4HEDA 3I90A 1EIHA 2B2TA 5AFWA 1EIGA 3FDTA 4X3SA 1X3PA 1M8AA 1PFNA 2B2VA 2FJ2A 1XYIA 1MI2A 2N55A 4IUVA 2K28A 4HCSA 1PFBA 1SSOA 1G2SA 1X32A 1KNAA 5CBAE 2KEEA 3TN2A 1VMPA 1ZXTA 4CJ0B 1AP0A 5EPJA 5COYA 4QUFA 2SDFA 3H91A 2L9HA 4DN4M 3I91A 1A15A 2N88A 3I3CA 2MJ8A 5EQ0A 3R93A 2X6LA 5DNFA 5T1IA 2DY8A 2RVLA 1O7YA 1HUMA 1XX8A 2KECA 2MP1A 1SDFA 2Q8RE 4XT1B 5D65A 4ZLTF 4R8IA 1WTWA 1F9RA 2HDLA 1WTQA 1WTPA 2B2YC 1HA6A 2B2UA 2HDMA 2K03A 2R3ZA 3DEOA 1F9SA 3HP3A 1RHPA 2KEDA 1G6ZA 1CM9A 5E4WC 2H1EA 1C8CA 1U4RA 1QE6A 1DOMA 2NYZD 2K01A 1NR2A 4IUQA 1O80A 4MN3A 5T1GA 1ICWA 4CJ2C 4HAEA 2X69A 1O7ZA 3GV3A 2KOLA 1WVLA 1WTRA 2L1BA 3P7JA 4ZAIA 5EPLA 2HCCA 4UAIA 1DOLA 2FFKB 2L12A 4IUUA 4RA8A 2B2WC 1VMCA 2M2LA 5CORA 4MHEA 3LWEA 5EKIA 1HHVA 4RAUC 2EOTA 2NWGA 1RTNA 1HFNA 1WTXA 2FMMA 2BDNA 1ILQA 1U4LA 2K1BA 1NR4A 2L4NA 1JE4A 2MPMA 4ZKCB 2HUGA 4XT3B 1PFMA 1QG7A 4IURA 2VXWA 4ZK9B 3DEPA 3MTSA 1AZPA 1J9OA 1F9QA 1JICA 1WD1A 1B4OA 1SAPA 3I8ZA 2FHTA 1EQTA 1G91A 3D6WA 2J7ZA 2B2YA 2X6GA 2XIWA 1DONA 4X3KA 2RSNA 2JYOA 2KUMA 1KNEA 2K04A 2KVMA 5E4XA 4QUCA 2MGSA 4X3UA 3IL8A 3TZDA 1BNZA 1B3AA 3UI2A 1X3QA 1WD0A 1E0BA 2B2UC 4X3TA 1ILPA 1ML0D 2B2TC 1B2TA 2B2VC 1IL8A 3ONAB 1HFGA 3G7LA 2HCIA 1U4MA 5EJWA 1CA6A 1EL0A 1WTVA 1NCVA 2RSOA 3FPUB 1HUNA 1AZQA 1BF4A 1RJTA 1PDQA 1PLFA 4OIJA 2B2WA 1MGSA 4ZKBB 1B53A 1DOKA 2CVRA 1MSGA 2JP1A 1J8IA 1LV9A 5CMDA 1IKLA 1EOTA 1F9PA 3MWYW 1IKMA 2L11A 2DY7A 4XDXA 4RWSC 5JJZA 2EPBA 3Q6SA
chains in the Genus database with same CATH superfamily
5IGEA 4HIKA 5LMUL 1KHIA 1MKHA 2A74C 1DM0B 3F2UA 3S15H 1DZ1A 1Q90A 4AH6A 2E2HH 5IOCA 2E2DC 3J80i 4B3TQ 1Q46A 2F03A 2I5MX 2WFWA 4DXGA 4GN3B 2PMZE 1U4PA 1LT4D 1YNNC 3BG3A 3QO2A 3QOJA 4JK1C 3NENA 3GTGB 3BZCA 3RNUA 1K3BC 1M8AA 4K8IA 2A69D 2Z6BA 4OWXB 2UUAL 1HTLD 4ZCKA 4CJ0B 4GNXC 4OO1H 2Y0SG 1IYUA 5C44B 2F0VA 4B3ML 3RMHA 4R4OA 2WACA 1HZBA 2NZHA 4A93G 3NELA 4C2MH 3JAML 3JC66 1C8CA 4LF7L 1DOMA 1VQEA 1V8QA 4KY5A 3SK8A 1HR0L 2ZTCA 4X66L 3T16A 1EQQA 4WFN3 5C3EB 3C3LA 3P7JA 3E9IA 2KBNA 5LMNW 1X6OA 4A3KG 2B2WC 4JI5Q 2HD3A 2F3VA 5EKIA 3K5LA 3PIO3 1KLUD 1STAA 2K1BA 3AQQA 5E1FA 1BBWA 1B70B 2KHSA 4LFBQ 5FLXE 1S5DD 4JI3L 4ZK9B 2F0IA 2OTJA 3S17B 2LSSA 2KENA 2UXBQ 1YZ6A 4H13C 5K36H 4DK6C 1TWFH 3DWPA 1K8GA 3OTOQ 1TWHH 2EY6A 4IOAA 1JB7A 2H4OA 2QEXA 1D5XC 1BNZA 3CU7A 4DR7L 4X3TA 1KDCA 1LTRD 4GOPB 3MFYA 1HZCA 4DV2L 3FPUB 3M7NA 3DLLA 4TKOB 5M3MH 4Y7NB 1FD7D 5KNCA 3WDNA 3ULLA 3GDEA 4QJFA 1O7IA 1SYBA 2ZJQA 2EPBA 3RN5A 4DKAC 2VW9A 4CJ1B 3L9AX 5IIFA 5IGFA 2TMPA 1V1QA 1FNUA 2WAQB 3KUPA 4XQJA 2F0WA 1Z7TA 1C48A 2NZ1D 2DJFC 2CH4W 4HSVA 1NE3A 1E2ZA 2CW0D 3M4PA 1VDZA 4HEDA 1BR9A 1EQVA 2KQ3A 3I55A 3D0FA 3M4YA 3KLSA 4KJOA 4JV5L 4KHPQ 1HH2P 1FL0A 3BYYB 4DK0A 2F0DA 1SROA 3A8IE 4KD3A 1A3VA 3H91A 1EWIA 2VNUD 1R4QB 3GTGH 1X55A 2R61A 3UE1A 1WCMG 4FXKC 3W1BA 4HIDA 1DCZA 4R8IA 2IT1A 1F9RA 3H3VC 1SXTA 2V4DA 5AJ3Q 1W3SA 1TY0A 3SHLA 3KYHC 1F9SA 4M8AA 3GQBA 1U4RA 3MVVA 1PMRA 5IGBA 1NR2A 2K7VA 2NN6I 3EIVA 3MFGA 5ISRA 5C44H 2X69A 4EQPA 5IYBH 4KKSA 5IP9G 2R7DA 1NMGA 2NN6H 5FLMH 3PCOB 3KLSX 1JMCA 4A3EG 3VR6A 4HIOA 3EROA 2FMCA 4BY7G 3TS0A 1BCPC 3KLRA 4LF9L 3ZJYC 3I2ZA 2NVQB 4CHTB 1XJVA 4DUZL 5C3EH 3MTSA 4XQNA 2O5JC 4A3DB 1SAPA 2G9DA 3J81L 3SEBA 2UUCL 1LTAD 1XPRA 4HMJA 3NTHA 3U4VA 4KI0A 3CQZB 1VQ4A 3S17H 3RLFA 5CV8A 4ZKBB 1DOKA 5JVH3 2BOSA 1Q12A 4H02A 4IQZA 5CMDA 1S5FD 2CWPA 1EU4A 1X54A 3VR2A 1IBKQ 1K73C 1EYGA 1I5FA 4LW1A 1Y8OB 4JC0A 3TRZA 1JCKB 1SE3A 1JE5A 1N34Q 1OXSC 2SOBA 2OCEA 1FJGQ 3X3NA 4Y7NH 2EYPA 5J39A 2ZM6Q 4HR7B 1EZ6A 2KCTA 3DUZA 4QF4A 2RA4A 4IO9A 1QJOA 3CP0A 4PZ6A 5IYCG 1Q8KA 2QKIC 4LK1C 2PQAA 4C3JB 4JI0Q 3F2DA 3S1RB 5AFWA 4UP8A 1E1OA 3OPOA 2A6HD 2KHIA 4HCSA 3HOXB 4UP7A 2Z1CA 3CRKC 5CV9A 2Y0SE 4DR2L 1ET6A 1YHBA 1ZXTA 4A3FG 1WI5A 4ME3A 4LF4L 1STHA 3TP6A 2UU9Q 1UEAB 3I91A 3T1HL 1XMOQ 3S2DB 3CC7A 1HZ9A 5IT9c 4A3MG 1S5CD 2PI2A 2MUYA 4KY6A 2LY7A 2XGTA 1LTTD 2A1AA 5M5YB 4G7ZC 1B1ZA 3TBIB 4IUQA 4A4IA 4CJ2C 1C4QA 2AMCB 2SNMA 1VQKA 4IFDG 1LT6D 4PZ7A 4RA8A 1E22A 5C4HA 2IX1A 2M2LA 3K58A 1HHVA 3QIAA 2F0TA 2WP8J 2B8GA 2IX0A 3FMCA 4GNXA 2BDOA 4K5VA 1DYQA 1PH9A 2F4VQ 2IJ0A 3QR8A 4RGNA 1ZYRC 1CQFA 4FO2A 5E3FA 4BXXG 1AZPA 2WIIB 4N8FA 1MIUA 3S9WA 2BE5C 2G5DA 3C1FA 4KD4A 4IFDJ 1IW7D 3A54A 1LO5D 4K6LA 3K0YA 3A5UA 3TMEA 1HJPA 2B2UC 5GAGC 4RGTA 2Q2HA 1Q1BA 1SNDA 1VQLA 4A3DH 4ZUIA 3NEMA 1YEZA 1MJEA 2XWBB 2B2WA 2JP1A 3FVQA 1BVSA 4RKLA 1EY0A 3BS1A 2K4KA 3KF6B 1SE2A 2LS01 3UDGA 3AFPA 3K5MA 3CQZH 1GUGA 3PO3B 4AYBB 3KF6A 1A6XA 4V190 1I3QB 1WJJA 3P20A 5H1SE 4B3TL 1VQ8A 1N9WA 2ZXOA 3T1YQ 4WJ4A 1ASYA 1PTOF 3J7A5 2K5DA 5CBEE 3GTKB 4PG3A 3MA2B 1EFWA 1EEFD 3Q23A 3ULPA 1J6QA 2A68D 1PRTD 3S1MB 4OO1G 3VR3A 1EWHA 3SK4A 5GADC 1QZGA 2NVXB 4A3GB 1F2YA 4QB4A 1XNQQ 2B8FA 4C3JH 4DN4M 3S1RH 3MZ5A 4DGZA 4QMGA 2RVLA 1O7YA 3HOXH 3Q22A 1AFPA 4R4QA 5C4XH 1XPUA 1TS4A 4JBKA 2K01A 3SR1A 1O80A 1B3QA 3S2DH 4P74A 3D6CA 1S40A 2R93B 3GV3A 1CUKA 4FVMA 1VQCA 4HJ5A 2D2CC 3MHBA 2L12A 3I4NB 5C0XI 4NXNQ 4C3IG 1FGUA 2CCZA 1YBYA 4JI5L 1IZ6A 1N32Q 2ICEC 5C0XH 2HUGA 3NE5B 4CDDC 3K8AA 3DEPA 5K36G 4LFBL 2XRQD 4UHVA 5IY0A 2AHOB 1ESFA 2UXBL 5J22A 5F2DA 1YJ9A 4XQQA 5HURA 2E8GA 3I4MB 5E4XA 3OTOL 1SRUA 4ODGA 1WD0A 1SYEA 3FKIG 4YCUA 4IJLA 2HQEA 1BCPB 3QOLA 2HCIA 1U4MA 5C5LA 4AQYL 2F0QA 4RKBA 3PIOA 4FXDA 3C2PA 1TWCH 1HUNA 2K5WA 1BF4A 1VQAA 3Q8DA 4OIJA 4YWLA 1J8IA 4Z9CB 2QW7A 1I4GA 2OXPA 4QL5A 1PH3A 4O42A 3ND9A 1ESRA 3CCEA 4BA2I 5FLXL 4R9WA 4LUZA 1GOZA 3ULJA 3GTPB 1SYCA 2FINB 1MHWC 1NNXA 1PV4A 4IUPA 1UE7A 4DV1Q 1PTOD 1E1TA 5EPKA 2YTYA 2JA7G 1KXLA 3PO3H 3A56A 1W2BA 2Q8IB 1IYJB 4ZUJA 2RCNA 3NQTA 4JBJA 3MXGA 1MI2A 3K59A 1SYDA 3E0JA 3IAYA 4DV0Q 3M9BA 1JWUD 3BVGA 3W1GA 1I3QH 1E3PA 3J7YW 1HA5A 1GUOA 2EIFA 2F4IA 4DU9A 4LF6Q 4KHPL 1KDAA 3HOWB 1GD7A 4OONA 4A3BG 1YNJC 1SDFA 3S1MH 1B9NA 4DR5Q 3A7LA 4GN4B 4XTCS 2NVXH 3BDOA 4A3GH 2Z6KC 3T4AC 2KEDA 2MO1A 4CBVA 4PZ8A 5AJ3L 1AE2A 4R1JA 4I7ZC 3PUWA 1FNWA 2MQHA 4GLXA 4L8JA 4QGUA 4DF7A 3PF4A 4TRDA 1B9MA 4EVOA 4UAIA 3KJPA 3RUZA 1EYDA 2EJMA 3BYTB 1IBMQ 3KDFB 3KFUA 1SMXA 5FO9B 5JEAH 1G8ZD 2QGQA 5IP7H 3SGIA 1Z6HA 2R93H 1JOKA 5FJ8G 1Y1VG 2I0QA 4B9XA 1F9QA 3KDFA 5A2QE 3I4NH 1RD9D 2LFNA 5CC4A 1I50B 1I4RA 4JBMA 3Q24A 2PPBC 3H3VH 5JJKA 2O4XA 4F87A 3M4QA 2WB1G 1B2TA 1G291 2VY3A 4C1NI 3G7LA 4HTHA 1EU3A 1NMFA 1AZQA 4L6TB 2JA8G 5KEEA 1MGSA 1Q86C 3CRLC 1D5ZC 4A3JG 5ELCA 3I4MH 1EZ8A 1F9PA 2EYLA 2ZJRA 1CFMA 1KIXA 2OQKA 1UE1A 3KBGA 4Y52H 5C5MA 1A8VA 3PV0A 1IBKL 2N8NA 3K7AH 2EYFA 1L2FA 1BBXC 3PO2G 1F2LA 2CWAA 3RR5A 4L5RC 4H0LC 4OIKA 4LMQD 1N34L 4ULLA 3C1EA 3D4RA 4GKJQ 1FJGL 3AEVA 1RF2D 2ZM6L 1TVXA 4FNFA 2WAQG 1T9HA 4RG1A 3MEHA 1EIHA 2K5NA 2K6AA 3A0JA 4PNYA 4B9WA 4C1NK 2FJ2A 1F2ZA 4JI0L 4DR3Q 1X9NA 1K83B 3CCRA 4GN5A 3GTPH 1AEXA 5ELBA 3VYRA 2RF4A 2R92B 1S72A 1CKNB 3CCJA 4GKKQ 1SJHD 2K14A 4A75A 1PA6A 3QG1A 2F0LA 4JPBW 3A5ZB 3OHXC 1XMOL 3DHQA 2K75A 2PQEA 2B2YC 4H7BA 4CDCC 1HA6A 2R3ZA 1WFQA 4JI8Q 3I56A 4HJ9A 4X64Q 1YIJA 3HOYB 1LT3D 1VQ7A 3HOWH 4DV4Q 3JAMc 4MTKA 4JG2A 5G3LD 2UXCL 2VUMB 4BBRB 2CQAA 3E5SA 2XNAC 3E0EA 2EOTA 2CFMA 1HFNA 1KAWA 2FMMA 2A69C 1ENCA 4QQBX 3LWUA 3STBC 2V1CC 1D8LA 2CQOA 4JI6Q 2VXWA 2I5LX 2F4VL 1W6KA 3OW2A 1Q82C 1D1KA 4L5QA 2VS1A 1PH7A 4RFBA 4X3KA 3KLWA 1CHQD 3K57A 3IL8A 1ASZA 3LGJA 1CI3M 2C5CA 4JI4Q 2WINB 3ONAB 5KIXA 2DN8A 3MXPA 4WORA 4BWGB 1WTVA 4KTAA 4A76A 2LXJA 5FOBB 3VYTA 1PYBA 1I50H 2KA7A 2M00A 4IALA 3CAMA 1RCVD 2N3SA 2RDHA 3VA7A 2E5LQ 1L1OC 2A5HA 4K6DA 3OSOA 1JOOA 4JI2Q 2J0TD 4A3LH 2RDGA 3RN2A 4S3SA 1QOHA 1RL2A 2IL8A 2RQXA 2N49A 4H44C 3PF5A 1FGBD 1K28A 5J3BA 1XXGA 3HOZB 3GP7A 2K5HA 3EVQA 3T1YL 3AU7A 3AYHB 5KYIA 1GKHA 1FR3A 4DNTB 4X65Q 1IL2A 4GOPA 4K5WA 1KRTA 1SMYD 3MEFA 5DLQE 3BJUA 2F0UA 2MO0A 3C46A 4ZYSA 5HGQA 3MXUA 4KLKA 1K8OA 1XNQL 4R4IA 3I3CA 2F0NA 5EQ0A 1QVFA 4TSSA 5C6AA 2DY8A 5M3FB 1K83H 1STYA 3HOUB 1D6EC 3NK9A 3DEOA 2EJGC 2K03A 1GM5A 4OXPA 2R92H 3HRZC 3URYA 3J7AV 3DWAA 4V0BA 5IWAQ 4BY1G 1A3UA 1U9RA 2C35B 4Q0FA 2PZUA 4LUOA 4DFAA 4RCOA 1HR0W 1G6PA 1JORA 2EY2A 4JI1L 2CW0C 1STGA 5BR8Q 1T5EA 3M85A 5ELOA 3NQIA 3CCQA 3LX0A 4DV3Q 4NPSA 1WTXA 3GTOB 2B39A 3HOVB 1NR4A 3HOYH 4BA1I 4LFAQ 3WWVA 1U5KA 4CKBA 3R8BA 1J9OA 2B63G 2VUMH 1PFSA 2QILA 4BBRH 1G91A 4AIMA 1DGSA 2R7ZB 4BBSB 4OHJA 1EFID 2WB1E 2Z6KA 3NUCA 4IZ8A 3U50C 1VQBA 3CD6A 4HJAA 2MGSA 3J81c 1X3QA 3HG9A 1JWMD 2B2TC 3IKJA 4JVZA 5EJWA 5M9OA 1V1PB 3OWEB 3CPFA 1PLFA 2K5VA 4PMCA 2HQLA 2L0CA 3NTKA 2ICIA 3MWYW 5GAEC 1V1PA 2D9UA 4FXGC 1T5XD 1V1OA 4U68A 2VQEQ 3GV6A 1SN8A 5D14A 2CH4A 4A3IB 4A93B 4F7XA 2K50A 1S4ZA 3BU2A 2WAQE 4BS9A 1R9TB 1SYFA 1EYAA 3M3YB 3PO3G 1MJCA 4C3HB 5CV6A 4K14A 3RLOA 4DAYB 4DV1L 5KGUA 1CZGA 1VQIA 4A3KB 1Q7YC 4QIWB 3ITPA 3I72A 2EXDA 1A2TA 1SSOA 5JVG3 1X32A 4DV0L 1Z47A 3FPPA 4LNQA 3HOZH 1C7YA 2ZT9C 3NWTA 5EPJA 2G9HD 3CMEA 4B08A 2GN5A 3EN2A 4LF6L 1A15A 4NXML 4LF8Q 1KD1C 5T1IA 2AKWB 3G6EA 3UDXA 2D0PA 3NTIA 4KN4C 5ELEA 1J5EQ 2J4XA 4YWKA 3H6MA 4DR5L 2YU9B 2H1EA 1CT1D 2NYZD 5LMNQ 2NVTB 1PRTF 2YYZA 3N6RA 4KHVA 1II3A 5M3FH 1RIPA 5C4XB 4B3SQ 3HOUH 4DR1Q 2M9VA 4KKTA 3LWEA 4IUNA 2R6GA 3O13A 5IP7G 1EWCA 4XYOA 2XSCA 1IBML 2A6HC 2QDLA 1HNWQ 4ZKCB 2P5ZX 3GTQB 1VQGA 3HKSA 3OWFA 3OIPA 3L2PA 3U58A 4KJNA 3GO5A 1JICA 1LT5D 2Z4HA 2B3GA 2FHTA 4UPAA 2K5QA 3NBHB 3EJIA 3HKZB 2B2YA 2Z8LA 1Y8NB 5FO8B 2H5XA 2JA6G 1N36L 3GTOH 3HOVH 2IWHA 2JA5G 1CZWA 4ILWA 5IE8A 2B2VC 3I4LA 1TWAB 2R7FA 2R7ZH 4BBSH 1MSGA 5EKLA 5M5WB 1PXUA 1SR3A 4A3CG 2DY7A 1ZYRD 4YCWA 3W3AA 1TWCB 4FP5D 5I9PA 4YIJA 2BE5D 1GUWA 5IT9L 3T56B 3SVMA 4HJ8A 5A2QL 1VQ5A 3J80c 1HRJA 5IYDG 4APVA 3VDYA 2EE1A 2IHFA 4GKJL 2ZXRA 4DR6Q 1HQRD 2VB2X 2VQFQ 3F2CA 4DV6Q 3FDTA 1X3PA 1IW7C 4DAPA 4A3IH 4A93H 3IFTA 4KMUC 1A62A 1PH5A 2HHHQ 1L1OB 4HN7A 1R9TH 3D8GA 4DR3L 4BY7B 4HSPA 1AW7A 3M3YH 2UUBL 1OTCA 2E2JB 1E7ZA 4C3HH 2A19A 5COYA 4QUFA 3FEWX 1L1OA 4GKKL 2PI2E 3SXHA 5FK9C 2N88A 1OXUA 5C4ZA 5I2YA 3H15A 4A3KH 5KNBA 2PZTA 2UXDQ 1HUMA 1B8AA 2KECA 2DUDA 3R3OA 1WTPA 2KJXA 1CTMA 3MAQA 1Q1EA 1VS0A 1CM9A 3K5OA 4RH6A 3P1HA 1E2WA 4JI8L 3VR4A 5IODA 1H9SB 1QB5D 1WVLA 4DV4L 2XVSA 4PMBA 4PV1C 4DNRB 1WYDA 4Q5VA 1CHPD 2YU9H 4ALPA 2NWGA 1H9SA 1RTNA 2NTSA 2A68C 2KCNA 5IGCA 2PCFB 2NVTH 1M90C 1PFMA 5LHY1 5I6YA 4FF2A 3EQLC 4LWCA 4QCLA 1GVPA 4N9PA 3HS0C 2LKVA 1CSQA 5IGDA 4RGMA 4JI6L 1YI2A 4JI7Q 2L15A 2F0GA 1QNUA 2ZXPA 2JYOA 4P71A 3LNNA 1NY4A 1LTLA 4O0AA 4POFA 2F0HA 5C3WA 5D3DA 1JJGA 1VF7A 3GTQH 4RGOS 1BOSA 1IL8A 1EY7A 2F3IA 1QILA 1P8LA 2O5IC 4JI4L 2F0JA 4L63B 1TWGB 2L11A 3L0OA 1PH6A 3B6YA 1NTGA 4DNIA 4WRDA 3TDQA 2DNCA 3ND8A 4A3MB 2E5LL 1TWAH 1UUPA 4PMWA 4JI2L 3WOEA 1QZHA 3D4DA 4CDEC 5M5WH 3BDCA 2AWNA 3R2IA 3KBXA 4AYBE 1CA5A 3DMUA 1H95A 1RODA 3HEJA 3DM1A 5M3MG 3K7AB 1MD2D 2K05A 3HZXA 4UP9A 1WCMH 2I5HA 4NW2A 1RTOA 4J15A 2B2TA 1EIGA 1O78A 4X3SA 2F1MA 3TSSA 1DD2A 3CF5A 3KK7A 4X65L 3PGZA 1VQDA 4IPCA 1OXXK 2EY1A 4P73A 2QCPX 4E6IA 2NTTA 1W6JA 1HNXQ 3J81j 5IP9H 5BN5A 2QEJC 5EGTA 4LF9Q 3E3XA 2EQSA 3OW7A 3NPPA 1ET9A 5K5PA 2K32A 4NB3A 4OEMB 4A3EH 3I70A 3AB9A 5JOBA 3MXNB 2QDBA 4BY7H 5BN3A 3K5NA 2E2JH 1G6ZA 1JJ2A 4DXFA 4N8X1 5DM63 3BZDB 3ER0A 5IWAL 5GQOA 3MXNA 1PH2A 1EIYB 2DGYA 4DV7Q 4ZAIA 1PTOC 4P72A 2F0MA 4HMIA 1D2BA 3T53B 3X3MA 4EGVA 4R4TA 2E76C 2MFIA 3HOYG 3QWNA 4RAUC 1N8RC 5BR8L 2JK8A 4K2KA 4DV3L 5E7NA 5FKAC 1LACA 2F52A 5NUCA 3P75A 1PVOA 3PUZA 4LFAL 5C44G 1PYSB 2F0SA 1Y8PB 1VQOA 5IYBG 1B44D 2J7ZA 2NN6G 5FLMG 1N33Q 1AN8A 3I7FA 1EY5A 1PH4A 1TIID 3HFZB 3TZDA 2K52A 1B3AA 1ILPA 1D7QA 3D31A 2EYOA 5G3LF 5LL6X 3RZOB 1VCIA 3UE0A 4FF4A 1YNXA 2Z0SA 3OOCA 4OELB 3TP5A 2MNAA 5C3EG 1H9RA 2YV5A 4EQOA 5IYCH 1IKLA 4YY3Q 1RKNA 3DWQA 4EQ5A 5IT9E 3PIPA 1CSPA 1CKMA 5JJIA 4L5SA 1GUNA 3N52A 1WTOA 2RHQB 4R4CA 3CCVA 4LFCQ 4IPHA 3M4OB 4ME5A 2VQEL 1GHKA 4JBWA 3T13A 5C3XA 2PMZB 3QB3A 1TWGH 1UE6A 5CV4A 1ZKOA 1GUTA 1MSHA 1Q3LA 1NAPA 4QY7A 3I90A 1JWSD 4A3MH 2B2VA 4F88A 3PQIA 3BVMA 4UDUC 4UY8C 1LM0A 1X56A 3UDFA 4NDXA 4ABNA 4C3IB 4JOIC 2GA4B 3H0GB 3H09A 4NMZA 5IGGA 4IFDI 1L0YB 3A7AB 1VMPA 4M1UB 1AP0A 4LJZC 1BUVT 4XXEA 3CCUA 3QJYA 4IFDH 2F0EA 2D62A 3VA5A 4IPDA 5DNFA 1BBUA 1A0IA 3FHWA 2TSSA 4LF8L 3SDZA 1STBA 2KCCA 1X3GA 1GXDC 2B2UA 2HDMA 2NZOA 2OEOA 1RHPA 4EX5A 2SNSA 1J5EL 4JCVE 3FKIB 4BXXH 1EOVA 5EKKA 1IXRA 1HQMC 1GUSA 1KABA 4DV5Q 5LMNL 1DJRD 1JT8A 5EAYA 1U0LA 2A73B 5ELNA 1I4QA 3D4WA 5CORA 4B3SL 1PZKD 4DR1L 3KOJA 2CHBD 2WKCA 2UU9L 3CKIB 1YJNA 1U4LA 2A6EC 2L4NA 4B3RQ 4JYAQ 1CKNA 5EBCA 4CKCA 2Z9HA 4OGQC 3CC4A 4FF3A 1HNWL 1I94Q 1YNND 4TQUS 2NB0A 2JJQA 1H9KA 3A74A 2IY5B 4DUYQ 3D6WA 3HOVG 2IPKD 2F3WA 4MZ9A 5D3IB 2JA7B 2K04A 3H94A 2JSOA 5CV5A 1KRSA 4GS3A 3GTJB 4K0KQ 5DM73 1HFGA 2R7ZG 1B7YB 4BBSG 4K5XA 2E75C 2RSOA 3PUYA 1PRTB 1V9PA 4J8QA 2Q2TA 1KTKA 1LV9A 1VQJA 1EOTA 1SNPA 4OO1I 3STBD 1BQQT 3L7ZC 2KCMA 5A35A 1QNKA 4A3BB 1VQFA 2AUJD 1VQ6A 3RZOH 1UNSA 3KF8B 3I73A 4XYQA 1SFOH 1NBWA 2Q8TA 1TU2B 2AQ2B 4A3DG 1TXYA 4N9TA 4EQNA 3S1QB 2L5TA 3KF8A 4LAAA 4A3IG 1Y1WB 5JAVA 5JPMC 4K8JA 4DR6L 1XYIA 2VQFL 2BCOA 2MHVA 1CK1A 1BCPF 4DV6L 3M4OH 2EXZA 4C3HG 3CHBD 2HHHL 4LUVA 1BKBA 1A2UA 1ICFB 2KEEA 3TQYA 1JJCB 1D5MC 2NVYB 1Y1VB 1D1IA 1UAPA 1I4XA 3K7UC 4C3IH 2PW7A 4ZQ3A 3W5OA 3H0GH 2UXDL 3E6ZX 4KK7A 2EYMA 1OXTA 2E2IB 1IYVA 3S1NB 1HNZQ 2WB1B 1EY4A 1NJIC 1VQ9A 3CXCA 1TY2A 2JA8B 4C3JG 4RHSA 1AH9A 4A3JB 1XTDA 4AQYQ 3EFXD 1SE4A 3HOXG 2AQ1B 1E2VA 3FKIH 5CYUA 1ILQA 2BA1A 1XWEA 5C4XG 3PO2B 2FXQA 4OX9Q 4CDFC 1UWVA 1SMYC 2EZVA 3PMFA 3ICEA 3CC2A 2PO4A 1FYCA 2F0PA 3TP7A 2XTIA 3S2HH 4JI7L 3CPWA 3F2BA 2KVMA 2OF1A 1PTOB 3NBIA 5M5XH 4QUCA 3U9SA 3K0XA 3BZKA 5JJLA 2GVBA 5C0XG 3HKZG 1H9JA 2D0OA 1RDPD 3MC0B 1A3TA 1EYCA 4NXNL 3GTMB 2ZJPA 1N32L 2JA7H 3ZYYX 4DA2A 1STNA 2ALYB 3TS2A 2RDFA 5JJZA 3PIP3 3GTJH 4KKUA 2ASBA 2JE6I 4LF5Q 1IHZA 2EY5A 2O2LD 5C0XJ 1QVGA 1PH8A 1L0WA 1H9MA 2BH8A 4KV6A 4ID6A 2RCFA 4A3BH 2AQ3B 1JB3A 5TSSA 1SEBD 2VB3X 2D5DA 1BCPD 4YCVA 2PNRC 4DAVA 1KC8C 2Y0SB 3Q0AA 1TQOA 5KRUA 2EYHA 2HIVA 3NXWA 5CBAE 3S1QH 1M4VA 2NUCA 3TN2A 4DK1A 2ZTDA 1XNRQ 5EBDA 1Y1WH 1PZID 2L9HA 3RD4A 3CCMA 4GLVB 1HNXL 1BDOA 3M7GA 5D65A 3U4ZA 2Q8RE 1WTWA 2JN4A 2HDLA 1S3OA 3UDIA 4OWWB 3J7AF 4AYBG 4NP5A 2K33A 1YJWA 1QE6A 4ZRZA 5LL6S 5FJ8H 3FP9A 2NVYH 5T1GA 1KDBA 1Y1VH 3CCSA 1IBLQ 2XN9C 1ENFA 1JOQA 4DAYA 2F0FA 1FVIA 4DPGA 1M1KC 2HCCA 1SJED 1XMQQ 1K8AC 4DV7L 4JOIA 4RHRA 1VMCA 3G48A 1K0SA 2PZWA 4RCNA 2E2IH 3PUXA 3S1NH 1EEID 3EBEA 4A3GG 1BXTA 1LLRD 4FYDA 2C9OA 2JA8H 1SNMA 4A3JH 4X62Q 3AMUA 1EQTA 1CQVA 2X6GA 1DONA 3NP8A 1HZAA 3PSIA 1N33L 2PQAB 4FF1A 2YTVA 3UI2A 3PO2H 3SK6A 5JEAG 4YHHQ 4K2LA 5DEHA 2IHEA 2JA9A 2R93G 1UEBA 3NWSA 3G71A 4DR4Q 1GHJA 4IPGA 5CGKA 2QF7A 1PTOH 3K6OA 1Q81C 3I4NG 5LMUQ 3S14B 4X3UA 2RKSA 1ENAA 2CKZB 1XTCD 2Z4IA 4YY3L 1TS2A 1STEA 3IFDA 1NSNS 1TT2A 2OWOA 3V05A 1O7LA 1I4HA 3GTMH 1TR5A 2XWJB 5JEAJ 4LFCL 1QCBD 2PNHA 3OIQA 4MIUA 1TS5A 1NUCA 5CR3A 4BY1B 1G2TA 3NBHA 1HTPA 3JAME 5HGTA 3VR5A 4HJ7A 3I4MG 1HCZA 2YTXA 3CCLA 5DAUA 3G6JB 2N55A 4IOCA 1Q8IA 2UUAQ 1A63A 1SBBB 1Y14B 3S24A 4GNXB 1WCMB 2UXCQ 1KNAA 4QIWE 1WTHA 3RZDB 3OYYA 1G51A 4B3MQ 1V43A 2B63B 1LABA 3BDLA 3R93A 5BN4A 2X6LA 1TKWB 2PW5A 2IX3A 4ZLTF 4MNOA 2DJGC 3DM3A 3ERSX 4LF7Q 1L0XB 1JQYD 3HP3A 1TS3A 2EYJA 2I46A 1I4PA 4J6HA 1HR0Q 4GZYC 2WV6D 4X66Q 2ZTEA 4A3EB 4WJWA 4HAEA 3JAMi 1CKOA 1LYLA 3V96A 4G4KA 1K3RA 1QVCA 1PHJA 1QUQB 5EPLA 2NVQH 4DV5L 2HT1A 3BVZA 1LTID 1QUQA 4JI3Q 4XT3B 2OQ0A 1F77A 1FNVA 5I6WA 1X65A 4B3RL 4JYAL 3TEHB 4CGYB 3HOWG 1I94L 3J80L 3GTLB 2ENBA 1AE3A 2KUMA 4X64L 1KNEA 4DUYL 4DR7Q 3HKZE 2HIXA 1GO3E 4G57A 4L5TA 1EY9A 2E74C 3CW2C 1E0BA 1E24A 1ML0D 4DV2Q 2AWOA 1EY6A 4YWMA 4CKEA 4XIGS 4JW0A 4G7HC 1CA6A 4K0KL 3R2TA 3S16B 1PDQA 2CVRA 1PRTC 3EA6A 1SYGA 2BA0A 2L55A 1DXMA 3K81C 1K9MC 1IKMA 1LTSD 4OWTB 4RWSC 2LXKA 4U673 4IUTA 4KY7A 1GJXA 2EJFC 1SLJA 2F0KA 3VYUA 2RHSB 2VZAA 1B50A 2Q2IA 4OL7A 3OMGA 2OTLA 1SNQA 3S14H 1C9OA 1I6HB 4A3FB 2JXMB 4JV5Q 5I4DA 3U9OA 4J1MA 4IUVA 1ZEQX 2K28A 3RLNA 4JI1Q 1EUJA 2SEBD 4BY1H 4A3LG 4KN7C 3SE0A 2JEAI 1X3EA 4G7OC 1SNCA 5HY6A 2SDFA 4F8MA 1KLGD 5M5YH 3IRBA 1K0RA 2MJ8A 3H0GG 5FLXc 1UE5A 4KHZA 1XX8A 2MP1A 3A8JE 3J81E 2JA6B 4WJ3M 2ATWA 2JA5B 2AUKA 1YITA 2A8VA 1PH1A 3RZDH 2KHJA 5L37A 4MN3A 4DK3C 2B63H 2RBMA 5C4JB 1HNZL 3GD7A 3AFQA 3I4OA 5ELFA 2KOLA 4P75A 3DXJC 1Z9FA 2ES2A 1DOLA 1OXVA 4O2DA 1LTGD 4GOPC 2BDNA 3D3RA 5KYLA 4DUZQ 3TZUA 2R92G 3ERQA 1QG7A 3V2TA 4IURA 1MBYA 4P2CB 2UUCQ 1C0AA 4OX9L 1B4OA 2ID0A 1HXYD 3A55A 1KAAA 4MTNA 3J81i 3TREA 1I6VC 3NSWA 2F0OA 3A8KE 4FDBA 3S15B 2E2HB 1HPCA 1RJTA 1P16A 3GTLH 2VUMG 3F1ZA 1YNJD 1K8MA 4BBRG 3SK5A 1WOCA 1KL9A 1WTQA 4I7AA 3T51B 2B29A 2PYKA 3GTKH 5KNDA 3CMAA 4NXMQ 3S16H 1JR0D 1BO0A 4LF5L 2WKDA 4O1NA 4DAMA 3OMCA 1KQSA 1PYWD 1XPOA 4POGA 2GVAA 2IW3A 4R8NA 1LUZA 1SE8A 1YHQA 1SFOB 1YVCA 1PZJD 1R4PB 1PFNA 3FRPB 5J1ZA 1SNOA 2EDGA 1VF5C 4I65A 4DR2Q 1PFBA 1G2SA 2DNEA 1F2MA 1Y1WG 5FO7B 4LF4Q 4C2MB 1VQMA 1Y69U 4X6AH 1EIFA 3L3OC 1OO9B 3T1HQ 1YHAA 4HIMA 1I6HH 1XNRL 4A3FH 4GLAC 2JQOA 4NKLA 2JEBI 4C56C 2OT2A 4IN3A 4XT1B 2QA4A 3NHHA 5E4WC 2EVBA 3HGBA 3VYSA 1VQHA 1VQPA 3H3VI 3J7ZC 1EY8A 1N36Q 4HCEA 4RMFA 1ICWA 3HOZG 1LTBD 3TP8A 1O7ZA 3K80C 2NBFA 5I2XA 2LMCB 5JPNC 3KJOA 1IBLL 1WTRA 2L1BA 5CV7A 5ELDA 2FFKB 4IUUA 2BH2A 2JA6H 4MHEA 2JA5H 1XMQL 1TWFB 1TWHB 1VQNA 3G4SA 2Q2UA 1JE4A 2MPMA 4PQXA 5I9OA 1ONLA 5C4JH 4IJHA 3J80E 2I07B 1WD1A 3I8ZA 1S5BD 3F8TA 5GROA 5M3FG 5M3MB 2XIWA 4A3CH 3HOUG 4X62L 2RSNA 3W2DA 1QWYA 1S5ED 1JC7A 3S2HB 1EL0A 1NCVA 4YHHL 4TVAB 1X3FA 5GAHC 5IYDH 5M5XB 1B53A 2VL6A 1EQRA 3PUVA 2N78A 2XRSD 2A6ED 3E9HA 3WOFA 4DR4L 2UUBQ 4XDXA 3Q6SA
chains in the Genus database with same CATH topology
5IGEA 2A74C 1DM0B 3F2UA 1DZ1A 1Q90A 5IOCA 2E2DC 2F03A 4DXGA 1U4PA 1LT4D 1YNNC 3BG3A 3QO2A 3QOJA 4JK1C 3GTGB 1M8AA 4K8IA 2A69D 1HTLD 4CJ0B 4OO1H 1IYUA 5C44B 2F0VA 3RMHA 2WACA 3JAML 1C8CA 1DOMA 1V8QA 4KY5A 3SK8A 3T16A 4WFN3 5C3EB 3C3LA 3P7JA 2B2WC 2F3VA 5EKIA 3K5LA 3PIO3 1KLUD 1STAA 2K1BA 5E1FA 2KHSA 5FLXE 1S5DD 4ZK9B 2F0IA 3S17B 4H13C 5K36H 3DWPA 2EY6A 2H4OA 1BNZA 1D5XC 3CU7A 4X3TA 1KDCA 1LTRD 3MFYA 3FPUB 3M7NA 4TKOB 4Y7NB 1FD7D 5KNCA 3WDNA 1SYBA 2EPBA 4CJ1B 3L9AX 5IIFA 5IGFA 2TMPA 3KUPA 1FNUA 2WAQB 4XQJA 2F0WA 1Z7TA 1C48A 2NZ1D 4HSVA 1E2ZA 2CW0D 1VDZA 4HEDA 1BR9A 1EQVA 2KQ3A 3M4YA 3KLSA 4KJOA 3BYYB 4DK0A 2F0DA 3A8IE 4KD3A 1A3VA 3H91A 2VNUD 1R4QB 2R61A 4FXKC 1DCZA 4R8IA 2IT1A 1F9RA 3H3VC 1SXTA 2V4DA 1TY0A 3SHLA 1F9SA 4M8AA 3GQBA 1U4RA 3MVVA 1PMRA 5IGBA 1NR2A 2K7VA 2NN6I 3MFGA 5ISRA 2X69A 4EQPA 4KKSA 2NN6H 3KLSX 3VR6A 3EROA 2FMCA 1BCPC 3KLRA 2NVQB 4CHTB 3MTSA 4XQNA 2O5JC 4A3DB 1SAPA 2G9DA 3J81L 3SEBA 1LTAD 4HMJA 3NTHA 4KI0A 3CQZB 3RLFA 5CV8A 4ZKBB 1DOKA 5JVH3 2BOSA 1Q12A 4IQZA 5CMDA 1S5FD 1EU4A 3VR2A 1Y8OB 1JCKB 1SE3A 1OXSC 2SOBA 3X3NA 2EYPA 5J39A 4HR7B 1EZ6A 4QF4A 3DUZA 2RA4A 1QJOA 2QKIC 4LK1C 4C3JB 3S1RB 5AFWA 3OPOA 2A6HD 4HCSA 3HOXB 2Z1CA 3CRKC 5CV9A 1ET6A 1ZXTA 1STHA 3TP6A 1UEAB 3I91A 3S2DB 1S5CD 2MUYA 4KY6A 2LY7A 1LTTD 5M5YB 4G7ZC 1B1ZA 3TBIB 4IUQA 4CJ2C 1C4QA 2SNMA 4IFDG 1LT6D 4RA8A 5C4HA 2IX1A 2M2LA 3K58A 1HHVA 3QIAA 2F0TA 2WP8J 2B8GA 2IX0A 3FMCA 2BDOA 4K5VA 1DYQA 2IJ0A 4RGNA 1ZYRC 1CQFA 4FO2A 5E3FA 1AZPA 2WIIB 3S9WA 2BE5C 3C1FA 4KD4A 4IFDJ 1IW7D 3A54A 1LO5D 4K6LA 3K0YA 3TMEA 2B2UC 4RGTA 1Q1BA 1SNDA 4ZUIA 2XWBB 2B2WA 2JP1A 3FVQA 4RKLA 1EY0A 3BS1A 1SE2A 2LS01 3K5MA 1GUGA 3PO3B 4AYBB 1A6XA 4V190 1I3QB 3P20A 2ZXOA 1PTOF 3GTKB 2K5DA 5CBEE 3MA2B 1EEFD 3Q23A 2A68D 1PRTD 3S1MB 4OO1G 3VR3A 1EWHA 3SK4A 2NVXB 4A3GB 1F2YA 4QB4A 2B8FA 4DN4M 3MZ5A 4DGZA 4QMGA 2RVLA 1O7YA 3Q22A 1AFPA 1TS4A 2K01A 3SR1A 1O80A 3D6CA 2R93B 3GV3A 4FVMA 2D2CC 3MHBA 2L12A 3I4NB 5C0XI 4C3IG 2ICEC 5C0XH 2HUGA 3NE5B 3DEPA 5K36G 2XRQD 1ESFA 5J22A 5F2DA 4XQQA 5HURA 3I4MB 5E4XA 4ODGA 1WD0A 1SYEA 2HQEA 1BCPB 3QOLA 2HCIA 1U4MA 5C5LA 2F0QA 4RKBA 4FXDA 3C2PA 1HUNA 2K5WA 1BF4A 4OIJA 1J8IA 4Z9CB 1I4GA 2OXPA 4O42A 3ND9A 1ESRA 4BA2I 5FLXL 4R9WA 1GOZA 3GTPB 1SYCA 2FINB 4IUPA 1PTOD 5EPKA 3A56A 2Q8IB 4ZUJA 3NQTA 3MXGA 1MI2A 3K59A 1SYDA 3E0JA 3IAYA 1JWUD 3BVGA 3J7YW 1HA5A 1GUOA 4DU9A 2F4IA 1KDAA 3HOWB 1YNJC 1SDFA 1B9NA 3A7LA 4XTCS 3BDOA 3T4AC 2KEDA 4CBVA 4I7ZC 3PUWA 1FNWA 4L8JA 4DF7A 4TRDA 1B9MA 4EVOA 4UAIA 3RUZA 1EYDA 2EJMA 3BYTB 5FO9B 5JEAH 1G8ZD 1Z6HA 1JOKA 4B9XA 1F9QA 5A2QE 1RD9D 2LFNA 5CC4A 1I50B 1I4RA 3Q24A 2PPBC 2O4XA 4F87A 1B2TA 1G291 4C1NI 3G7LA 4HTHA 1EU3A 1AZQA 4L6TB 5KEEA 1MGSA 3CRLC 1D5ZC 5ELCA 1EZ8A 1F9PA 2EYLA 1CFMA 3KBGA 5C5MA 3PV0A 1BBXC 2EYFA 1F2LA 4H0LC 4OIKA 4LMQD 4ULLA 3C1EA 3D4RA 1RF2D 1TVXA 4FNFA 3MEHA 1EIHA 2K6AA 4PNYA 4B9WA 4C1NK 2FJ2A 1F2ZA 1K83B 1AEXA 5ELBA 3VYRA 2R92B 1SJHD 3QG1A 2F0LA 3OHXC 3DHQA 2PQEA 2B2YC 4H7BA 1HA6A 2R3ZA 3HOYB 1LT3D 5G3LD 2VUMB 4BBRB 2CQAA 3E5SA 2XNAC 2EOTA 1HFNA 2FMMA 2A69C 1ENCA 3LWUA 2VXWA 1W6KA 1D1KA 4RFBA 4X3KA 1CHQD 3K57A 3IL8A 1CI3M 2C5CA 2WINB 3ONAB 5KIXA 2DN8A 3MXPA 4WORA 4BWGB 1WTVA 4KTAA 5FOBB 3VYTA 4IALA 2KA7A 2M00A 1RCVD 2RDHA 3VA7A 2A5HA 4K6DA 3OSOA 1JOOA 2J0TD 2RDGA 4S3SA 1QOHA 2IL8A 2RQXA 4H44C 1FGBD 1XXGA 3HOZB 3GP7A 3EVQA 3AU7A 5KYIA 1FR3A 4DNTB 4K5WA 1SMYD 2F0UA 3C46A 4ZYSA 3MXUA 1K8OA 3I3CA 2F0NA 5EQ0A 4TSSA 5C6AA 2DY8A 5M3FB 1STYA 3HOUB 1D6EC 3NK9A 3DEOA 2EJGC 2K03A 3HRZC 3URYA 3J7AV 3DWAA 4V0BA 1A3UA 1U9RA 4Q0FA 2PZUA 4DFAA 4RCOA 1JORA 2EY2A 2CW0C 1STGA 1T5EA 3M85A 3NQIA 3LX0A 1WTXA 3GTOB 2B39A 3HOVB 1NR4A 4BA1I 4CKBA 3R8BA 1J9OA 2QILA 1G91A 2R7ZB 4BBSB 4OHJA 1EFID 3NUCA 4IZ8A 2MGSA 1X3QA 3HG9A 1JWMD 2B2TC 3IKJA 5EJWA 5M9OA 1V1PB 3OWEB 1PLFA 4PMCA 2L0CA 3NTKA 2ICIA 3MWYW 1V1PA 2D9UA 4FXGC 1T5XD 1V1OA 4U68A 3GV6A 5D14A 4A3IB 4A93B 4F7XA 1S4ZA 4BS9A 1R9TB 1SYFA 1EYAA 3M3YB 4C3HB 5CV6A 4K14A 5KGUA 1CZGA 4A3KB 4QIWB 3ITPA 3I72A 1A2TA 1SSOA 5JVG3 1X32A 1Z47A 3FPPA 2ZT9C 3NWTA 5EPJA 2G9HD 4B08A 1A15A 5T1IA 3NTIA 4KN4C 5ELEA 2J4XA 3H6MA 2YU9B 2H1EA 1CT1D 2NYZD 2NVTB 1PRTF 2YYZA 3N6RA 4KHVA 1II3A 5C4XB 2M9VA 4KKTA 3LWEA 4IUNA 2R6GA 3O13A 1EWCA 4XYOA 2XSCA 2A6HC 4ZKCB 3GTQB 3OWFA 3OIPA 4KJNA 3GO5A 1JICA 1LT5D 2Z4HA 2FHTA 2K5QA 3EJIA 3HKZB 2B2YA 2Z8LA 1Y8NB 5FO8B 2IWHA 1CZWA 4ILWA 2B2VC 3I4LA 1TWAB 1MSGA 5EKLA 5M5WB 1PXUA 2DY7A 1ZYRD 3W3AA 1TWCB 4FP5D 5I9PA 4YIJA 2BE5D 1GUWA 5IT9L 3T56B 3SVMA 5A2QL 1HRJA 2EE1A 2ZXRA 1HQRD 2VB2X 3FDTA 1X3PA 1IW7C 4DAPA 3IFTA 4KMUC 4HN7A 3D8GA 4BY7B 4HSPA 1AW7A 2E2JB 5COYA 4QUFA 3FEWX 3SXHA 5FK9C 2N88A 1OXUA 5C4ZA 5I2YA 5KNBA 2PZTA 1HUMA 2KECA 3R3OA 1WTPA 2KJXA 1CTMA 3MAQA 1Q1EA 1CM9A 3K5OA 4RH6A 3P1HA 1E2WA 3VR4A 5IODA 1H9SB 1QB5D 1WVLA 2XVSA 4PMBA 4PV1C 4DNRB 4Q5VA 1CHPD 2NWGA 1H9SA 1RTNA 2NTSA 2A68C 2KCNA 5IGCA 2PCFB 1PFMA 5LHY1 5I6YA 4FF2A 3EQLC 4QCLA 4N9PA 3HS0C 2LKVA 5IGDA 4RGMA 2F0GA 1QNUA 2ZXPA 2JYOA 3LNNA 5C3WA 2F0HA 5D3DA 1VF7A 4RGOS 1BOSA 1IL8A 1EY7A 1QILA 2O5IC 2F0JA 4L63B 1TWGB 2L11A 4WRDA 3TDQA 2DNCA 3ND8A 4A3MB 1UUPA 4PMWA 3WOEA 3D4DA 3BDCA 2AWNA 3R2IA 3KBXA 1CA5A 3DMUA 1RODA 3HEJA 3DM1A 3K7AB 1MD2D 2K05A 3HZXA 4NW2A 1RTOA 2B2TA 1EIGA 1O78A 4X3SA 2F1MA 3TSSA 1DD2A 3KK7A 1OXXK 2EY1A 2QCPX 4E6IA 2NTTA 1W6JA 5BN5A 2QEJC 5EGTA 3OW7A 3NPPA 1ET9A 5K5PA 2K32A 3I70A 3AB9A 5JOBA 2QDBA 5BN3A 3K5NA 1G6ZA 4DXFA 5DM63 3BZDB 3MXNA 4ZAIA 1PTOC 2F0MA 4HMIA 1D2BA 3T53B 3X3MA 4EGVA 2E76C 3QWNA 4RAUC 4K2KA 5FKAC 1LACA 5NUCA 3P75A 3PUZA 2F0SA 1Y8PB 1B44D 2J7ZA 2NN6G 1AN8A 1EY5A 1TIID 3TZDA 1B3AA 1ILPA 3D31A 2EYOA 5G3LF 5LL6X 3RZOB 1VCIA 4FF4A 3OOCA 3TP5A 1H9RA 4EQOA 1IKLA 1RKNA 3DWQA 5IT9E 1GUNA 3N52A 1WTOA 3M4OB 4ME5A 1GHKA 4JBWA 3T13A 5C3XA 2PMZB 3QB3A 5CV4A 1ZKOA 1GUTA 1MSHA 1Q3LA 1NAPA 3I90A 1JWSD 2B2VA 4F88A 3BVMA 4UDUC 4NDXA 4ABNA 4C3IB 2GA4B 3H0GB 3H09A 4NMZA 5IGGA 4IFDI 1L0YB 3A7AB 1VMPA 4M1UB 1AP0A 4LJZC 1BUVT 4XXEA 3QJYA 4IFDH 2F0EA 2D62A 3VA5A 5DNFA 2TSSA 3SDZA 1STBA 2KCCA 1GXDC 2B2UA 2HDMA 2OEOA 1RHPA 2SNSA 3FKIB 5EKKA 1HQMC 1GUSA 1KABA 1DJRD 2A73B 1I4QA 3D4WA 5CORA 1PZKD 2CHBD 2WKCA 3CKIB 1U4LA 2A6EC 2L4NA 5EBCA 4CKCA 4OGQC 4FF3A 1YNND 4TQUS 2NB0A 1H9KA 3D6WA 2IPKD 2F3WA 5D3IB 2JA7B 2K04A 3H94A 2JSOA 5CV5A 3GTJB 5DM73 1HFGA 4K5XA 2E75C 2RSOA 3PUYA 1PRTB 4J8QA 1KTKA 1LV9A 1EOTA 1SNPA 4OO1I 1BQQT 3L7ZC 5A35A 1QNKA 4A3BB 2AUJD 1UNSA 3I73A 4XYQA 2Q8TA 1TU2B 2AQ2B 4EQNA 4N9TA 3S1QB 2L5TA 3KF8A 4LAAA 1Y1WB 5JAVA 5JPMC 4K8JA 1XYIA 2BCOA 2MHVA 1CK1A 1BCPF 2EXZA 4C3HG 3CHBD 1A2UA 2KEEA 1D5MC 2NVYB 1Y1VB 1D1IA 1UAPA 1I4XA 2PW7A 4ZQ3A 3E6ZX 4KK7A 2EYMA 1OXTA 2E2IB 1IYVA 3S1NB 2WB1B 1EY4A 1TY2A 2JA8B 4C3JG 4RHSA 4A3JB 3EFXD 1SE4A 2AQ1B 1E2VA 5CYUA 1ILQA 2BA1A 1XWEA 3PO2B 1SMYC 2EZVA 3PMFA 2PO4A 1FYCA 2F0PA 3TP7A 2KVMA 2OF1A 1PTOB 3NBIA 4QUCA 3U9SA 5C0XG 1H9JA 1RDPD 3MC0B 1A3TA 1EYCA 3GTMB 3ZYYX 4DA2A 1STNA 5JJZA 2RDFA 3PIP3 4KKUA 2JE6I 1IHZA 2EY5A 2O2LD 5C0XJ 1H9MA 4KV6A 4ID6A 2AQ3B 1JB3A 5TSSA 1SEBD 2VB3X 2D5DA 1BCPD 2PNRC 4DAVA 2Y0SB 3Q0AA 1TQOA 5KRUA 2EYHA 3NXWA 5CBAE 1M4VA 2NUCA 3TN2A 4DK1A 5EBDA 1PZID 2L9HA 3RD4A 1BDOA 3M7GA 5D65A 1WTWA 2Q8RE 2HDLA 3J7AF 4NP5A 2K33A 1QE6A 4ZRZA 5LL6S 5T1GA 1KDBA 2XN9C 1ENFA 1JOQA 4DAYA 2F0FA 2HCCA 1SJED 4RHRA 1VMCA 2PZWA 4RCNA 3PUXA 1EEID 1BXTA 1LLRD 4FYDA 2C9OA 1SNMA 3AMUA 1EQTA 1CQVA 2X6GA 1DONA 3NP8A 4FF1A 3UI2A 3SK6A 5JEAG 4K2LA 5DEHA 3NWSA 1GHJA 5CGKA 2QF7A 1PTOH 3K6OA 3S14B 4X3UA 2RKSA 1ENAA 2Z4IA 1XTCD 1TS2A 1STEA 3IFDA 1NSNS 1TT2A 3V05A 1O7LA 1I4HA 1TR5A 2XWJB 5JEAJ 1QCBD 4MIUA 3OIQA 1TS5A 1NUCA 5CR3A 4BY1B 1G2TA 3NBHA 1HTPA 3JAME 5HGTA 3VR5A 1HCZA 5DAUA 3G6JB 2N55A 1Q8IA 1SBBB 1WCMB 1KNAA 3RZDB 1V43A 2B63B 1LABA 3BDLA 3R93A 5BN4A 2X6LA 1TKWB 2PW5A 2IX3A 4ZLTF 1L0XB 1JQYD 3HP3A 1TS3A 2EYJA 2I46A 1I4PA 4J6HA 4GZYC 2WV6D 4A3EB 4WJWA 4HAEA 3V96A 4G4KA 5EPLA 3BVZA 1LTID 4XT3B 1F77A 1FNVA 5I6WA 4CGYB 3J80L 3GTLB 2ENBA 2KUMA 1KNEA 4G57A 1EY9A 2E74C 1E0BA 1ML0D 2AWOA 1EY6A 4CKEA 4XIGS 4G7HC 1CA6A 3R2TA 3S16B 1PDQA 2CVRA 1PRTC 3EA6A 1SYGA 2BA0A 2L55A 1DXMA 1IKMA 1LTSD 4RWSC 4U673 4IUTA 4KY7A 1GJXA 2EJFC 2F0KA 3VYUA 1B50A 4OL7A 3OMGA 1SNQA 1I6HB 4A3FB 2JXMB 5I4DA 3U9OA 4J1MA 4IUVA 1ZEQX 2K28A 2SEBD 4KN7C 3SE0A 2JEAI 4G7OC 1SNCA 2SDFA 4F8MA 1KLGD 2MJ8A 4KHZA 1XX8A 2MP1A 3A8JE 3J81E 2JA6B 2JA5B 2AUKA 4MN3A 2RBMA 5C4JB 3GD7A 5ELFA 2KOLA 3DXJC 1DOLA 1OXVA 1LTGD 2BDNA 3D3RA 5KYLA 3TZUA 3ERQA 1QG7A 3V2TA 4IURA 1MBYA 4P2CB 1B4OA 2ID0A 1HXYD 3A55A 1KAAA 1I6VC 3NSWA 2F0OA 3A8KE 3S15B 2E2HB 1HPCA 1RJTA 1YNJD 1K8MA 3SK5A 1WTQA 3T51B 2PYKA 5KNDA 1JR0D 1BO0A 2WKDA 4O1NA 3OMCA 1PYWD 2IW3A 4R8NA 1SFOB 1PZJD 1R4PB 1PFNA 3FRPB 5J1ZA 1SNOA 2EDGA 1VF5C 4I65A 1PFBA 1G2SA 2DNEA 1F2MA 5FO7B 4C2MB 1Y69U 3L3OC 1OO9B 4NKLA 2JEBI 4C56C 2OT2A 4IN3A 4XT1B 3NHHA 5E4WC 2EVBA 3HGBA 3VYSA 1EY8A 4HCEA 1ICWA 1LTBD 3TP8A 1O7ZA 2NBFA 5I2XA 2LMCB 5JPNC 1WTRA 2L1BA 5CV7A 5ELDA 2FFKB 4IUUA 4MHEA 1TWFB 1TWHB 1JE4A 2MPMA 4PQXA 5I9OA 1ONLA 3J80E 2I07B 1WD1A 3I8ZA 1S5BD 5M3MB 2XIWA 2RSNA 3W2DA 1QWYA 1S5ED 1JC7A 3S2HB 1EL0A 1NCVA 5M5XB 1B53A 3PUVA 2XRSD 2A6ED 3WOFA 4XDXA 3Q6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D9U A;  4O42 A;  1QNK A;  4CJ1 B;  1ESR A;  3N52 A;  4IUT A;  1WTO A;  4U68 A;  3IFD A;  1BBX C;  1GUW A;  3GV6 A;  3KUP A;  5D14 A;  3F2U A;  1DZ1 A;  1F2L A;  1BO0 A;  4R9W A;  3SVM A;  2IL8 A;  1S4Z A;  2NZ1 D;  2Q8T A;  4OIK A;  2FIN B;  4LMQ D;  1B50 A;  1HRJ A;  4HSV A;  3KBX A;  1CA5 A;  4IUP A;  1G2T A;  2RA4 A;  1ROD A;  3DM1 A;  5EPK A;  1U4P A;  2EE1 A;  1TVX A;  1MSH A;  3QO2 A;  2K05 A;  1Q3L A;  5CBE E;  1NAP A;  4NW2 A;  1RTO A;  4HED A;  3I90 A;  1EIH A;  2B2T A;  5AFW A;  1EIG A;  3FDT A;  4X3S A;  1X3P A;  1M8A A;  1PFN A;  2B2V A;  2FJ2 A;  1XYI A;  1MI2 A;  2N55 A;  4IUV A;  2K28 A;  4HCS A;  1PFB A;  1SSO A;  1G2S A;  1X32 A;  1KNA A;  5CBA E;  2KEE A;  3TN2 A;  1VMP A;  1ZXT A;  4CJ0 B;  1AP0 A;  5EPJ A;  5COY A;  4QUF A;  2SDF A;  3H91 A;  2L9H A;  4DN4 M;  3I91 A;  1A15 A;  2N88 A;  3I3C A;  2MJ8 A;  5EQ0 A;  3R93 A;  2X6L A;  5DNF A;  5T1I A;  2DY8 A;  2RVL A;  1O7Y A;  1HUM A;  1XX8 A;  2KEC A;  2MP1 A;  1SDF A;  2Q8R E;  4XT1 B;  5D65 A;  4ZLT F;  4R8I A;  1WTW A;  1F9R A;  2HDL A;  1WTQ A;  1WTP A;  2B2Y C;  1HA6 A;  2B2U A;  2HDM A;  2K03 A;  2R3Z A;  3DEO A;  1F9S A;  3HP3 A;  1RHP A;  2KED A;  1G6Z A;  1CM9 A;  5E4W C;  2H1E A;  1C8C A;  1U4R A;  1QE6 A;  1DOM A;  2NYZ D;  2K01 A;  1NR2 A;  4IUQ A;  1O80 A;  4MN3 A;  5T1G A;  1ICW A;  4CJ2 C;  4HAE A;  2X69 A;  1O7Z A;  3GV3 A;  2KOL A;  1WVL A;  1WTR A;  2L1B A;  3P7J A;  4ZAI A;  5EPL A;  2HCC A;  4UAI A;  1DOL A;  2FFK B;  2L12 A;  4IUU A;  4RA8 A;  2B2W C;  1VMC A;  2M2L A;  5COR A;  4MHE A;  3LWE A;  5EKI A;  1HHV A;  4RAU C;  2EOT A;  2NWG A;  1RTN A;  1HFN A;  1WTX A;  2FMM A;  2BDN A;  1ILQ A;  1U4L A;  2K1B A;  1NR4 A;  2L4N A;  1JE4 A;  2MPM A;  4ZKC B;  2HUG A;  4XT3 B;  1PFM A;  1QG7 A;  4IUR A;  2VXW A;  4ZK9 B;  3DEP A;  3MTS A;  1AZP A;  1J9O A;  1F9Q A;  1JIC A;  1WD1 A;  1B4O A;  1SAP A;  3I8Z A;  2FHT A;  1EQT A;  1G91 A;  3D6W A;  2J7Z A;  2B2Y A;  2X6G A;  2XIW A;  1DON A;  4X3K A;  2RSN A;  2JYO A;  2KUM A;  1KNE A;  2K04 A;  2KVM A;  5E4X A;  4QUC A;  2MGS A;  4X3U A;  3IL8 A;  3TZD A;  1BNZ A;  1B3A A;  3UI2 A;  1X3Q A;  1WD0 A;  1E0B A;  2B2U C;  4X3T A;  1ILP A;  1ML0 D;  2B2T C;  1B2T A;  2B2V C;  1IL8 A;  3ONA B;  1HFG A;  3G7L A;  2HCI A;  1U4M A;  5EJW A;  1CA6 A;  1EL0 A;  1WTV A;  1NCV A;  2RSO A;  3FPU B;  1HUN A;  1AZQ A;  1BF4 A;  1RJT A;  1PDQ A;  1PLF A;  4OIJ A;  2B2W A;  1MGS A;  4ZKB B;  1B53 A;  1DOK A;  2CVR A;  1MSG A;  2JP1 A;  1J8I A;  1LV9 A;  5CMD A;  1IKL A;  1EOT A;  1F9P A;  3MWY W;  1IKM A;  2L11 A;  2DY7 A;  4XDX A;  4RWS C;  5JJZ A;  2EPB A;  3Q6S A; 
#chains in the Genus database with same CATH topology
 5IGE A;  4HIK A;  5LMU L;  1KHI A;  1MKH A;  2A74 C;  1DM0 B;  3F2U A;  3S15 H;  1DZ1 A;  1Q90 A;  4AH6 A;  2E2H H;  5IOC A;  2E2D C;  3J80 i;  4B3T Q;  1Q46 A;  2F03 A;  2I5M X;  2WFW A;  4DXG A;  4GN3 B;  2PMZ E;  1U4P A;  1LT4 D;  1YNN C;  3BG3 A;  3QO2 A;  3QOJ A;  4JK1 C;  3NEN A;  3GTG B;  3BZC A;  3RNU A;  1K3B C;  1M8A A;  4K8I A;  2A69 D;  2Z6B A;  4OWX B;  2UUA L;  1HTL D;  4ZCK A;  4CJ0 B;  4GNX C;  4OO1 H;  2Y0S G;  1IYU A;  5C44 B;  2F0V A;  4B3M L;  3RMH A;  4R4O A;  2WAC A;  1HZB A;  2NZH A;  4A93 G;  3NEL A;  4C2M H;  3JAM L;  3JC6 6;  1C8C A;  4LF7 L;  1DOM A;  1VQE A;  1V8Q A;  4KY5 A;  3SK8 A;  1HR0 L;  2ZTC A;  4X66 L;  3T16 A;  1EQQ A;  4WFN 3;  5C3E B;  3C3L A;  3P7J A;  3E9I A;  2KBN A;  5LMN W;  1X6O A;  4A3K G;  2B2W C;  4JI5 Q;  2HD3 A;  2F3V A;  5EKI A;  3K5L A;  3PIO 3;  1KLU D;  1STA A;  2K1B A;  3AQQ A;  5E1F A;  1BBW A;  1B70 B;  2KHS A;  4LFB Q;  5FLX E;  1S5D D;  4JI3 L;  4ZK9 B;  2F0I A;  2OTJ A;  3S17 B;  2LSS A;  2KEN A;  2UXB Q;  1YZ6 A;  4H13 C;  5K36 H;  4DK6 C;  1TWF H;  3DWP A;  1K8G A;  3OTO Q;  1TWH H;  2EY6 A;  4IOA A;  1JB7 A;  2H4O A;  2QEX A;  1D5X C;  1BNZ A;  3CU7 A;  4DR7 L;  4X3T A;  1KDC A;  1LTR D;  4GOP B;  3MFY A;  1HZC A;  4DV2 L;  3FPU B;  3M7N A;  3DLL A;  4TKO B;  5M3M H;  4Y7N B;  1FD7 D;  5KNC A;  3WDN A;  3ULL A;  3GDE A;  4QJF A;  1O7I A;  1SYB A;  2ZJQ A;  2EPB A;  3RN5 A;  4DKA C;  2VW9 A;  4CJ1 B;  3L9A X;  5IIF A;  5IGF A;  2TMP A;  1V1Q A;  1FNU A;  2WAQ B;  3KUP A;  4XQJ A;  2F0W A;  1Z7T A;  1C48 A;  2NZ1 D;  2DJF C;  2CH4 W;  4HSV A;  1NE3 A;  1E2Z A;  2CW0 D;  3M4P A;  1VDZ A;  4HED A;  1BR9 A;  1EQV A;  2KQ3 A;  3I55 A;  3D0F A;  3M4Y A;  3KLS A;  4KJO A;  4JV5 L;  4KHP Q;  1HH2 P;  1FL0 A;  3BYY B;  4DK0 A;  2F0D A;  1SRO A;  3A8I E;  4KD3 A;  1A3V A;  3H91 A;  1EWI A;  2VNU D;  1R4Q B;  3GTG H;  1X55 A;  2R61 A;  3UE1 A;  1WCM G;  4FXK C;  3W1B A;  4HID A;  1DCZ A;  4R8I A;  2IT1 A;  1F9R A;  3H3V C;  1SXT A;  2V4D A;  5AJ3 Q;  1W3S A;  1TY0 A;  3SHL A;  3KYH C;  1F9S A;  4M8A A;  3GQB A;  1U4R A;  3MVV A;  1PMR A;  5IGB A;  1NR2 A;  2K7V A;  2NN6 I;  3EIV A;  3MFG A;  5ISR A;  5C44 H;  2X69 A;  4EQP A;  5IYB H;  4KKS A;  5IP9 G;  2R7D A;  1NMG A;  2NN6 H;  5FLM H;  3PCO B;  3KLS X;  1JMC A;  4A3E G;  3VR6 A;  4HIO A;  3ERO A;  2FMC A;  4BY7 G;  3TS0 A;  1BCP C;  3KLR A;  4LF9 L;  3ZJY C;  3I2Z A;  2NVQ B;  4CHT B;  1XJV A;  4DUZ L;  5C3E H;  3MTS A;  4XQN A;  2O5J C;  4A3D B;  1SAP A;  2G9D A;  3J81 L;  3SEB A;  2UUC L;  1LTA D;  1XPR A;  4HMJ A;  3NTH A;  3U4V A;  4KI0 A;  3CQZ B;  1VQ4 A;  3S17 H;  3RLF A;  5CV8 A;  4ZKB B;  1DOK A;  5JVH 3;  2BOS A;  1Q12 A;  4H02 A;  4IQZ A;  5CMD A;  1S5F D;  2CWP A;  1EU4 A;  1X54 A;  3VR2 A;  1IBK Q;  1K73 C;  1EYG A;  1I5F A;  4LW1 A;  1Y8O B;  4JC0 A;  3TRZ A;  1JCK B;  1SE3 A;  1JE5 A;  1N34 Q;  1OXS C;  2SOB A;  2OCE A;  1FJG Q;  3X3N A;  4Y7N H;  2EYP A;  5J39 A;  2ZM6 Q;  4HR7 B;  1EZ6 A;  2KCT A;  3DUZ A;  4QF4 A;  2RA4 A;  4IO9 A;  1QJO A;  3CP0 A;  4PZ6 A;  5IYC G;  1Q8K A;  2QKI C;  4LK1 C;  2PQA A;  4C3J B;  4JI0 Q;  3F2D A;  3S1R B;  5AFW A;  4UP8 A;  1E1O A;  3OPO A;  2A6H D;  2KHI A;  4HCS A;  3HOX B;  4UP7 A;  2Z1C A;  3CRK C;  5CV9 A;  2Y0S E;  4DR2 L;  1ET6 A;  1YHB A;  1ZXT A;  4A3F G;  1WI5 A;  4ME3 A;  4LF4 L;  1STH A;  3TP6 A;  2UU9 Q;  1UEA B;  3I91 A;  3T1H L;  1XMO Q;  3S2D B;  3CC7 A;  1HZ9 A;  5IT9 c;  4A3M G;  1S5C D;  2PI2 A;  2MUY A;  4KY6 A;  2LY7 A;  2XGT A;  1LTT D;  2A1A A;  5M5Y B;  4G7Z C;  1B1Z A;  3TBI B;  4IUQ A;  4A4I A;  4CJ2 C;  1C4Q A;  2AMC B;  2SNM A;  1VQK A;  4IFD G;  1LT6 D;  4PZ7 A;  4RA8 A;  1E22 A;  5C4H A;  2IX1 A;  2M2L A;  3K58 A;  1HHV A;  3QIA A;  2F0T A;  2WP8 J;  2B8G A;  2IX0 A;  3FMC A;  4GNX A;  2BDO A;  4K5V A;  1DYQ A;  1PH9 A;  2F4V Q;  2IJ0 A;  3QR8 A;  4RGN A;  1ZYR C;  1CQF A;  4FO2 A;  5E3F A;  4BXX G;  1AZP A;  2WII B;  4N8F A;  1MIU A;  3S9W A;  2BE5 C;  2G5D A;  3C1F A;  4KD4 A;  4IFD J;  1IW7 D;  3A54 A;  1LO5 D;  4K6L A;  3K0Y A;  3A5U A;  3TME A;  1HJP A;  2B2U C;  5GAG C;  4RGT A;  2Q2H A;  1Q1B A;  1SND A;  1VQL A;  4A3D H;  4ZUI A;  3NEM A;  1YEZ A;  1MJE A;  2XWB B;  2B2W A;  2JP1 A;  3FVQ A;  1BVS A;  4RKL A;  1EY0 A;  3BS1 A;  2K4K A;  3KF6 B;  1SE2 A;  2LS0 1;  3UDG A;  3AFP A;  3K5M A;  3CQZ H;  1GUG A;  3PO3 B;  4AYB B;  3KF6 A;  1A6X A;  4V19 0;  1I3Q B;  1WJJ A;  3P20 A;  5H1S E;  4B3T L;  1VQ8 A;  1N9W A;  2ZXO A;  3T1Y Q;  4WJ4 A;  1ASY A;  1PTO F;  3J7A 5;  2K5D A;  5CBE E;  3GTK B;  4PG3 A;  3MA2 B;  1EFW A;  1EEF D;  3Q23 A;  3ULP A;  1J6Q A;  2A68 D;  1PRT D;  3S1M B;  4OO1 G;  3VR3 A;  1EWH A;  3SK4 A;  5GAD C;  1QZG A;  2NVX B;  4A3G B;  1F2Y A;  4QB4 A;  1XNQ Q;  2B8F A;  4C3J H;  4DN4 M;  3S1R H;  3MZ5 A;  4DGZ A;  4QMG A;  2RVL A;  1O7Y A;  3HOX H;  3Q22 A;  1AFP A;  4R4Q A;  5C4X H;  1XPU A;  1TS4 A;  4JBK A;  2K01 A;  3SR1 A;  1O80 A;  1B3Q A;  3S2D H;  4P74 A;  3D6C A;  1S40 A;  2R93 B;  3GV3 A;  1CUK A;  4FVM A;  1VQC A;  4HJ5 A;  2D2C C;  3MHB A;  2L12 A;  3I4N B;  5C0X I;  4NXN Q;  4C3I G;  1FGU A;  2CCZ A;  1YBY A;  4JI5 L;  1IZ6 A;  1N32 Q;  2ICE C;  5C0X H;  2HUG A;  3NE5 B;  4CDD C;  3K8A A;  3DEP A;  5K36 G;  4LFB L;  2XRQ D;  4UHV A;  5IY0 A;  2AHO B;  1ESF A;  2UXB L;  5J22 A;  5F2D A;  1YJ9 A;  4XQQ A;  5HUR A;  2E8G A;  3I4M B;  5E4X A;  3OTO L;  1SRU A;  4ODG A;  1WD0 A;  1SYE A;  3FKI G;  4YCU A;  4IJL A;  2HQE A;  1BCP B;  3QOL A;  2HCI A;  1U4M A;  5C5L A;  4AQY L;  2F0Q A;  4RKB A;  3PIO A;  4FXD A;  3C2P A;  1TWC H;  1HUN A;  2K5W A;  1BF4 A;  1VQA A;  3Q8D A;  4OIJ A;  4YWL A;  1J8I A;  4Z9C B;  2QW7 A;  1I4G A;  2OXP A;  4QL5 A;  1PH3 A;  4O42 A;  3ND9 A;  1ESR A;  3CCE A;  4BA2 I;  5FLX L;  4R9W A;  4LUZ A;  1GOZ A;  3ULJ A;  3GTP B;  1SYC A;  2FIN B;  1MHW C;  1NNX A;  1PV4 A;  4IUP A;  1UE7 A;  4DV1 Q;  1PTO D;  1E1T A;  5EPK A;  2YTY A;  2JA7 G;  1KXL A;  3PO3 H;  3A56 A;  1W2B A;  2Q8I B;  1IYJ B;  4ZUJ A;  2RCN A;  3NQT A;  4JBJ A;  3MXG A;  1MI2 A;  3K59 A;  1SYD A;  3E0J A;  3IAY A;  4DV0 Q;  3M9B A;  1JWU D;  3BVG A;  3W1G A;  1I3Q H;  1E3P A;  3J7Y W;  1HA5 A;  1GUO A;  2EIF A;  2F4I A;  4DU9 A;  4LF6 Q;  4KHP L;  1KDA A;  3HOW B;  1GD7 A;  4OON A;  4A3B G;  1YNJ C;  1SDF A;  3S1M H;  1B9N A;  4DR5 Q;  3A7L A;  4GN4 B;  4XTC S;  2NVX H;  3BDO A;  4A3G H;  2Z6K C;  3T4A C;  2KED A;  2MO1 A;  4CBV A;  4PZ8 A;  5AJ3 L;  1AE2 A;  4R1J A;  4I7Z C;  3PUW A;  1FNW A;  2MQH A;  4GLX A;  4L8J A;  4QGU A;  4DF7 A;  3PF4 A;  4TRD A;  1B9M A;  4EVO A;  4UAI A;  3KJP A;  3RUZ A;  1EYD A;  2EJM A;  3BYT B;  1IBM Q;  3KDF B;  3KFU A;  1SMX A;  5FO9 B;  5JEA H;  1G8Z D;  2QGQ A;  5IP7 H;  3SGI A;  1Z6H A;  2R93 H;  1JOK A;  5FJ8 G;  1Y1V G;  2I0Q A;  4B9X A;  1F9Q A;  3KDF A;  5A2Q E;  3I4N H;  1RD9 D;  2LFN A;  5CC4 A;  1I50 B;  1I4R A;  4JBM A;  3Q24 A;  2PPB C;  3H3V H;  5JJK A;  2O4X A;  4F87 A;  3M4Q A;  2WB1 G;  1B2T A;  1G29 1;  2VY3 A;  4C1N I;  3G7L A;  4HTH A;  1EU3 A;  1NMF A;  1AZQ A;  4L6T B;  2JA8 G;  5KEE A;  1MGS A;  1Q86 C;  3CRL C;  1D5Z C;  4A3J G;  5ELC A;  3I4M H;  1EZ8 A;  1F9P A;  2EYL A;  2ZJR A;  1CFM A;  1KIX A;  2OQK A;  1UE1 A;  3KBG A;  4Y52 H;  5C5M A;  1A8V A;  3PV0 A;  1IBK L;  2N8N A;  3K7A H;  2EYF A;  1L2F A;  1BBX C;  3PO2 G;  1F2L A;  2CWA A;  3RR5 A;  4L5R C;  4H0L C;  4OIK A;  4LMQ D;  1N34 L;  4ULL A;  3C1E A;  3D4R A;  4GKJ Q;  1FJG L;  3AEV A;  1RF2 D;  2ZM6 L;  1TVX A;  4FNF A;  2WAQ G;  1T9H A;  4RG1 A;  3MEH A;  1EIH A;  2K5N A;  2K6A A;  3A0J A;  4PNY A;  4B9W A;  4C1N K;  2FJ2 A;  1F2Z A;  4JI0 L;  4DR3 Q;  1X9N A;  1K83 B;  3CCR A;  4GN5 A;  3GTP H;  1AEX A;  5ELB A;  3VYR A;  2RF4 A;  2R92 B;  1S72 A;  1CKN B;  3CCJ A;  4GKK Q;  1SJH D;  2K14 A;  4A75 A;  1PA6 A;  3QG1 A;  2F0L A;  4JPB W;  3A5Z B;  3OHX C;  1XMO L;  3DHQ A;  2K75 A;  2PQE A;  2B2Y C;  4H7B A;  4CDC C;  1HA6 A;  2R3Z A;  1WFQ A;  4JI8 Q;  3I56 A;  4HJ9 A;  4X64 Q;  1YIJ A;  3HOY B;  1LT3 D;  1VQ7 A;  3HOW H;  4DV4 Q;  3JAM c;  4MTK A;  4JG2 A;  5G3L D;  2UXC L;  2VUM B;  4BBR B;  2CQA A;  3E5S A;  2XNA C;  3E0E A;  2EOT A;  2CFM A;  1HFN A;  1KAW A;  2FMM A;  2A69 C;  1ENC A;  4QQB X;  3LWU A;  3STB C;  2V1C C;  1D8L A;  2CQO A;  4JI6 Q;  2VXW A;  2I5L X;  2F4V L;  1W6K A;  3OW2 A;  1Q82 C;  1D1K A;  4L5Q A;  2VS1 A;  1PH7 A;  4RFB A;  4X3K A;  3KLW A;  1CHQ D;  3K57 A;  3IL8 A;  1ASZ A;  3LGJ A;  1CI3 M;  2C5C A;  4JI4 Q;  2WIN B;  3ONA B;  5KIX A;  2DN8 A;  3MXP A;  4WOR A;  4BWG B;  1WTV A;  4KTA A;  4A76 A;  2LXJ A;  5FOB B;  3VYT A;  1PYB A;  1I50 H;  2KA7 A;  2M00 A;  4IAL A;  3CAM A;  1RCV D;  2N3S A;  2RDH A;  3VA7 A;  2E5L Q;  1L1O C;  2A5H A;  4K6D A;  3OSO A;  1JOO A;  4JI2 Q;  2J0T D;  4A3L H;  2RDG A;  3RN2 A;  4S3S A;  1QOH A;  1RL2 A;  2IL8 A;  2RQX A;  2N49 A;  4H44 C;  3PF5 A;  1FGB D;  1K28 A;  5J3B A;  1XXG A;  3HOZ B;  3GP7 A;  2K5H A;  3EVQ A;  3T1Y L;  3AU7 A;  3AYH B;  5KYI A;  1GKH A;  1FR3 A;  4DNT B;  4X65 Q;  1IL2 A;  4GOP A;  4K5W A;  1KRT A;  1SMY D;  3MEF A;  5DLQ E;  3BJU A;  2F0U A;  2MO0 A;  3C46 A;  4ZYS A;  5HGQ A;  3MXU A;  4KLK A;  1K8O A;  1XNQ L;  4R4I A;  3I3C A;  2F0N A;  5EQ0 A;  1QVF A;  4TSS A;  5C6A A;  2DY8 A;  5M3F B;  1K83 H;  1STY A;  3HOU B;  1D6E C;  3NK9 A;  3DEO A;  2EJG C;  2K03 A;  1GM5 A;  4OXP A;  2R92 H;  3HRZ C;  3URY A;  3J7A V;  3DWA A;  4V0B A;  5IWA Q;  4BY1 G;  1A3U A;  1U9R A;  2C35 B;  4Q0F A;  2PZU A;  4LUO A;  4DFA A;  4RCO A;  1HR0 W;  1G6P A;  1JOR A;  2EY2 A;  4JI1 L;  2CW0 C;  1STG A;  5BR8 Q;  1T5E A;  3M85 A;  5ELO A;  3NQI A;  3CCQ A;  3LX0 A;  4DV3 Q;  4NPS A;  1WTX A;  3GTO B;  2B39 A;  3HOV B;  1NR4 A;  3HOY H;  4BA1 I;  4LFA Q;  3WWV A;  1U5K A;  4CKB A;  3R8B A;  1J9O A;  2B63 G;  2VUM H;  1PFS A;  2QIL A;  4BBR H;  1G91 A;  4AIM A;  1DGS A;  2R7Z B;  4BBS B;  4OHJ A;  1EFI D;  2WB1 E;  2Z6K A;  3NUC A;  4IZ8 A;  3U50 C;  1VQB A;  3CD6 A;  4HJA A;  2MGS A;  3J81 c;  1X3Q A;  3HG9 A;  1JWM D;  2B2T C;  3IKJ A;  4JVZ A;  5EJW A;  5M9O A;  1V1P B;  3OWE B;  3CPF A;  1PLF A;  2K5V A;  4PMC A;  2HQL A;  2L0C A;  3NTK A;  2ICI A;  3MWY W;  5GAE C;  1V1P A;  2D9U A;  4FXG C;  1T5X D;  1V1O A;  4U68 A;  2VQE Q;  3GV6 A;  1SN8 A;  5D14 A;  2CH4 A;  4A3I B;  4A93 B;  4F7X A;  2K50 A;  1S4Z A;  3BU2 A;  2WAQ E;  4BS9 A;  1R9T B;  1SYF A;  1EYA A;  3M3Y B;  3PO3 G;  1MJC A;  4C3H B;  5CV6 A;  4K14 A;  3RLO A;  4DAY B;  4DV1 L;  5KGU A;  1CZG A;  1VQI A;  4A3K B;  1Q7Y C;  4QIW B;  3ITP A;  3I72 A;  2EXD A;  1A2T A;  1SSO A;  5JVG 3;  1X32 A;  4DV0 L;  1Z47 A;  3FPP A;  4LNQ A;  3HOZ H;  1C7Y A;  2ZT9 C;  3NWT A;  5EPJ A;  2G9H D;  3CME A;  4B08 A;  2GN5 A;  3EN2 A;  4LF6 L;  1A15 A;  4NXM L;  4LF8 Q;  1KD1 C;  5T1I A;  2AKW B;  3G6E A;  3UDX A;  2D0P A;  3NTI A;  4KN4 C;  5ELE A;  1J5E Q;  2J4X A;  4YWK A;  3H6M A;  4DR5 L;  2YU9 B;  2H1E A;  1CT1 D;  2NYZ D;  5LMN Q;  2NVT B;  1PRT F;  2YYZ A;  3N6R A;  4KHV A;  1II3 A;  5M3F H;  1RIP A;  5C4X B;  4B3S Q;  3HOU H;  4DR1 Q;  2M9V A;  4KKT A;  3LWE A;  4IUN A;  2R6G A;  3O13 A;  5IP7 G;  1EWC A;  4XYO A;  2XSC A;  1IBM L;  2A6H C;  2QDL A;  1HNW Q;  4ZKC B;  2P5Z X;  3GTQ B;  1VQG A;  3HKS A;  3OWF A;  3OIP A;  3L2P A;  3U58 A;  4KJN A;  3GO5 A;  1JIC A;  1LT5 D;  2Z4H A;  2B3G A;  2FHT A;  4UPA A;  2K5Q A;  3NBH B;  3EJI A;  3HKZ B;  2B2Y A;  2Z8L A;  1Y8N B;  5FO8 B;  2H5X A;  2JA6 G;  1N36 L;  3GTO H;  3HOV H;  2IWH A;  2JA5 G;  1CZW A;  4ILW A;  5IE8 A;  2B2V C;  3I4L A;  1TWA B;  2R7F A;  2R7Z H;  4BBS H;  1MSG A;  5EKL A;  5M5W B;  1PXU A;  1SR3 A;  4A3C G;  2DY7 A;  1ZYR D;  4YCW A;  3W3A A;  1TWC B;  4FP5 D;  5I9P A;  4YIJ A;  2BE5 D;  1GUW A;  5IT9 L;  3T56 B;  3SVM A;  4HJ8 A;  5A2Q L;  1VQ5 A;  3J80 c;  1HRJ A;  5IYD G;  4APV A;  3VDY A;  2EE1 A;  2IHF A;  4GKJ L;  2ZXR A;  4DR6 Q;  1HQR D;  2VB2 X;  2VQF Q;  3F2C A;  4DV6 Q;  3FDT A;  1X3P A;  1IW7 C;  4DAP A;  4A3I H;  4A93 H;  3IFT A;  4KMU C;  1A62 A;  1PH5 A;  2HHH Q;  1L1O B;  4HN7 A;  1R9T H;  3D8G A;  4DR3 L;  4BY7 B;  4HSP A;  1AW7 A;  3M3Y H;  2UUB L;  1OTC A;  2E2J B;  1E7Z A;  4C3H H;  2A19 A;  5COY A;  4QUF A;  3FEW X;  1L1O A;  4GKK L;  2PI2 E;  3SXH A;  5FK9 C;  2N88 A;  1OXU A;  5C4Z A;  5I2Y A;  3H15 A;  4A3K H;  5KNB A;  2PZT A;  2UXD Q;  1HUM A;  1B8A A;  2KEC A;  2DUD A;  3R3O A;  1WTP A;  2KJX A;  1CTM A;  3MAQ A;  1Q1E A;  1VS0 A;  1CM9 A;  3K5O A;  4RH6 A;  3P1H A;  1E2W A;  4JI8 L;  3VR4 A;  5IOD A;  1H9S B;  1QB5 D;  1WVL A;  4DV4 L;  2XVS A;  4PMB A;  4PV1 C;  4DNR B;  1WYD A;  4Q5V A;  1CHP D;  2YU9 H;  4ALP A;  2NWG A;  1H9S A;  1RTN A;  2NTS A;  2A68 C;  2KCN A;  5IGC A;  2PCF B;  2NVT H;  1M90 C;  1PFM A;  5LHY 1;  5I6Y A;  4FF2 A;  3EQL C;  4LWC A;  4QCL A;  1GVP A;  4N9P A;  3HS0 C;  2LKV A;  1CSQ A;  5IGD A;  4RGM A;  4JI6 L;  1YI2 A;  4JI7 Q;  2L15 A;  2F0G A;  1QNU A;  2ZXP A;  2JYO A;  4P71 A;  3LNN A;  1NY4 A;  1LTL A;  4O0A A;  4POF A;  2F0H A;  5C3W A;  5D3D A;  1JJG A;  1VF7 A;  3GTQ H;  4RGO S;  1BOS A;  1IL8 A;  1EY7 A;  2F3I A;  1QIL A;  1P8L A;  2O5I C;  4JI4 L;  2F0J A;  4L63 B;  1TWG B;  2L11 A;  3L0O A;  1PH6 A;  3B6Y A;  1NTG A;  4DNI A;  4WRD A;  3TDQ A;  2DNC A;  3ND8 A;  4A3M B;  2E5L L;  1TWA H;  1UUP A;  4PMW A;  4JI2 L;  3WOE A;  1QZH A;  3D4D A;  4CDE C;  5M5W H;  3BDC A;  2AWN A;  3R2I A;  3KBX A;  4AYB E;  1CA5 A;  3DMU A;  1H95 A;  1ROD A;  3HEJ A;  3DM1 A;  5M3M G;  3K7A B;  1MD2 D;  2K05 A;  3HZX A;  4UP9 A;  1WCM H;  2I5H A;  4NW2 A;  1RTO A;  4J15 A;  2B2T A;  1EIG A;  1O78 A;  4X3S A;  2F1M A;  3TSS A;  1DD2 A;  3CF5 A;  3KK7 A;  4X65 L;  3PGZ A;  1VQD A;  4IPC A;  1OXX K;  2EY1 A;  4P73 A;  2QCP X;  4E6I A;  2NTT A;  1W6J A;  1HNX Q;  3J81 j;  5IP9 H;  5BN5 A;  2QEJ C;  5EGT A;  4LF9 Q;  3E3X A;  2EQS A;  3OW7 A;  3NPP A;  1ET9 A;  5K5P A;  2K32 A;  4NB3 A;  4OEM B;  4A3E H;  3I70 A;  3AB9 A;  5JOB A;  3MXN B;  2QDB A;  4BY7 H;  5BN3 A;  3K5N A;  2E2J H;  1G6Z A;  1JJ2 A;  4DXF A;  4N8X 1;  5DM6 3;  3BZD B;  3ER0 A;  5IWA L;  5GQO A;  3MXN A;  1PH2 A;  1EIY B;  2DGY A;  4DV7 Q;  4ZAI A;  1PTO C;  4P72 A;  2F0M A;  4HMI A;  1D2B A;  3T53 B;  3X3M A;  4EGV A;  4R4T A;  2E76 C;  2MFI A;  3HOY G;  3QWN A;  4RAU C;  1N8R C;  5BR8 L;  2JK8 A;  4K2K A;  4DV3 L;  5E7N A;  5FKA C;  1LAC A;  2F52 A;  5NUC A;  3P75 A;  1PVO A;  3PUZ A;  4LFA L;  5C44 G;  1PYS B;  2F0S A;  1Y8P B;  1VQO A;  5IYB G;  1B44 D;  2J7Z A;  2NN6 G;  5FLM G;  1N33 Q;  1AN8 A;  3I7F A;  1EY5 A;  1PH4 A;  1TII D;  3HFZ B;  3TZD A;  2K52 A;  1B3A A;  1ILP A;  1D7Q A;  3D31 A;  2EYO A;  5G3L F;  5LL6 X;  3RZO B;  1VCI A;  3UE0 A;  4FF4 A;  1YNX A;  2Z0S A;  3OOC A;  4OEL B;  3TP5 A;  2MNA A;  5C3E G;  1H9R A;  2YV5 A;  4EQO A;  5IYC H;  1IKL A;  4YY3 Q;  1RKN A;  3DWQ A;  4EQ5 A;  5IT9 E;  3PIP A;  1CSP A;  1CKM A;  5JJI A;  4L5S A;  1GUN A;  3N52 A;  1WTO A;  2RHQ B;  4R4C A;  3CCV A;  4LFC Q;  4IPH A;  3M4O B;  4ME5 A;  2VQE L;  1GHK A;  4JBW A;  3T13 A;  5C3X A;  2PMZ B;  3QB3 A;  1TWG H;  1UE6 A;  5CV4 A;  1ZKO A;  1GUT A;  1MSH A;  1Q3L A;  1NAP A;  4QY7 A;  3I90 A;  1JWS D;  4A3M H;  2B2V A;  4F88 A;  3PQI A;  3BVM A;  4UDU C;  4UY8 C;  1LM0 A;  1X56 A;  3UDF A;  4NDX A;  4ABN A;  4C3I B;  4JOI C;  2GA4 B;  3H0G B;  3H09 A;  4NMZ A;  5IGG A;  4IFD I;  1L0Y B;  3A7A B;  1VMP A;  4M1U B;  1AP0 A;  4LJZ C;  1BUV T;  4XXE A;  3CCU A;  3QJY A;  4IFD H;  2F0E A;  2D62 A;  3VA5 A;  4IPD A;  5DNF A;  1BBU A;  1A0I A;  3FHW A;  2TSS A;  4LF8 L;  3SDZ A;  1STB A;  2KCC A;  1X3G A;  1GXD C;  2B2U A;  2HDM A;  2NZO A;  2OEO A;  1RHP A;  4EX5 A;  2SNS A;  1J5E L;  4JCV E;  3FKI B;  4BXX H;  1EOV A;  5EKK A;  1IXR A;  1HQM C;  1GUS A;  1KAB A;  4DV5 Q;  5LMN L;  1DJR D;  1JT8 A;  5EAY A;  1U0L A;  2A73 B;  5ELN A;  1I4Q A;  3D4W A;  5COR A;  4B3S L;  1PZK D;  4DR1 L;  3KOJ A;  2CHB D;  2WKC A;  2UU9 L;  3CKI B;  1YJN A;  1U4L A;  2A6E C;  2L4N A;  4B3R Q;  4JYA Q;  1CKN A;  5EBC A;  4CKC A;  2Z9H A;  4OGQ C;  3CC4 A;  4FF3 A;  1HNW L;  1I94 Q;  1YNN D;  4TQU S;  2NB0 A;  2JJQ A;  1H9K A;  3A74 A;  2IY5 B;  4DUY Q;  3D6W A;  3HOV G;  2IPK D;  2F3W A;  4MZ9 A;  5D3I B;  2JA7 B;  2K04 A;  3H94 A;  2JSO A;  5CV5 A;  1KRS A;  4GS3 A;  3GTJ B;  4K0K Q;  5DM7 3;  1HFG A;  2R7Z G;  1B7Y B;  4BBS G;  4K5X A;  2E75 C;  2RSO A;  3PUY A;  1PRT B;  1V9P A;  4J8Q A;  2Q2T A;  1KTK A;  1LV9 A;  1VQJ A;  1EOT A;  1SNP A;  4OO1 I;  3STB D;  1BQQ T;  3L7Z C;  2KCM A;  5A35 A;  1QNK A;  4A3B B;  1VQF A;  2AUJ D;  1VQ6 A;  3RZO H;  1UNS A;  3KF8 B;  3I73 A;  4XYQ A;  1SFO H;  1NBW A;  2Q8T A;  1TU2 B;  2AQ2 B;  4A3D G;  1TXY A;  4N9T A;  4EQN A;  3S1Q B;  2L5T A;  3KF8 A;  4LAA A;  4A3I G;  1Y1W B;  5JAV A;  5JPM C;  4K8J A;  4DR6 L;  1XYI A;  2VQF L;  2BCO A;  2MHV A;  1CK1 A;  1BCP F;  4DV6 L;  3M4O H;  2EXZ A;  4C3H G;  3CHB D;  2HHH L;  4LUV A;  1BKB A;  1A2U A;  1ICF B;  2KEE A;  3TQY A;  1JJC B;  1D5M C;  2NVY B;  1Y1V B;  1D1I A;  1UAP A;  1I4X A;  3K7U C;  4C3I H;  2PW7 A;  4ZQ3 A;  3W5O A;  3H0G H;  2UXD L;  3E6Z X;  4KK7 A;  2EYM A;  1OXT A;  2E2I B;  1IYV A;  3S1N B;  1HNZ Q;  2WB1 B;  1EY4 A;  1NJI C;  1VQ9 A;  3CXC A;  1TY2 A;  2JA8 B;  4C3J G;  4RHS A;  1AH9 A;  4A3J B;  1XTD A;  4AQY Q;  3EFX D;  1SE4 A;  3HOX G;  2AQ1 B;  1E2V A;  3FKI H;  5CYU A;  1ILQ A;  2BA1 A;  1XWE A;  5C4X G;  3PO2 B;  2FXQ A;  4OX9 Q;  4CDF C;  1UWV A;  1SMY C;  2EZV A;  3PMF A;  3ICE A;  3CC2 A;  2PO4 A;  1FYC A;  2F0P A;  3TP7 A;  2XTI A;  3S2H H;  4JI7 L;  3CPW A;  3F2B A;  2KVM A;  2OF1 A;  1PTO B;  3NBI A;  5M5X H;  4QUC A;  3U9S A;  3K0X A;  3BZK A;  5JJL A;  2GVB A;  5C0X G;  3HKZ G;  1H9J A;  2D0O A;  1RDP D;  3MC0 B;  1A3T A;  1EYC A;  4NXN L;  3GTM B;  2ZJP A;  1N32 L;  2JA7 H;  3ZYY X;  4DA2 A;  1STN A;  2ALY B;  3TS2 A;  2RDF A;  5JJZ A;  3PIP 3;  3GTJ H;  4KKU A;  2ASB A;  2JE6 I;  4LF5 Q;  1IHZ A;  2EY5 A;  2O2L D;  5C0X J;  1QVG A;  1PH8 A;  1L0W A;  1H9M A;  2BH8 A;  4KV6 A;  4ID6 A;  2RCF A;  4A3B H;  2AQ3 B;  1JB3 A;  5TSS A;  1SEB D;  2VB3 X;  2D5D A;  1BCP D;  4YCV A;  2PNR C;  4DAV A;  1KC8 C;  2Y0S B;  3Q0A A;  1TQO A;  5KRU A;  2EYH A;  2HIV A;  3NXW A;  5CBA E;  3S1Q H;  1M4V A;  2NUC A;  3TN2 A;  4DK1 A;  2ZTD A;  1XNR Q;  5EBD A;  1Y1W H;  1PZI D;  2L9H A;  3RD4 A;  3CCM A;  4GLV B;  1HNX L;  1BDO A;  3M7G A;  5D65 A;  3U4Z A;  2Q8R E;  1WTW A;  2JN4 A;  2HDL A;  1S3O A;  3UDI A;  4OWW B;  3J7A F;  4AYB G;  4NP5 A;  2K33 A;  1YJW A;  1QE6 A;  4ZRZ A;  5LL6 S;  5FJ8 H;  3FP9 A;  2NVY H;  5T1G A;  1KDB A;  1Y1V H;  3CCS A;  1IBL Q;  2XN9 C;  1ENF A;  1JOQ A;  4DAY A;  2F0F A;  1FVI A;  4DPG A;  1M1K C;  2HCC A;  1SJE D;  1XMQ Q;  1K8A C;  4DV7 L;  4JOI A;  4RHR A;  1VMC A;  3G48 A;  1K0S A;  2PZW A;  4RCN A;  2E2I H;  3PUX A;  3S1N H;  1EEI D;  3EBE A;  4A3G G;  1BXT A;  1LLR D;  4FYD A;  2C9O A;  2JA8 H;  1SNM A;  4A3J H;  4X62 Q;  3AMU A;  1EQT A;  1CQV A;  2X6G A;  1DON A;  3NP8 A;  1HZA A;  3PSI A;  1N33 L;  2PQA B;  4FF1 A;  2YTV A;  3UI2 A;  3PO2 H;  3SK6 A;  5JEA G;  4YHH Q;  4K2L A;  5DEH A;  2IHE A;  2JA9 A;  2R93 G;  1UEB A;  3NWS A;  3G71 A;  4DR4 Q;  1GHJ A;  4IPG A;  5CGK A;  2QF7 A;  1PTO H;  3K6O A;  1Q81 C;  3I4N G;  5LMU Q;  3S14 B;  4X3U A;  2RKS A;  1ENA A;  2CKZ B;  1XTC D;  2Z4I A;  4YY3 L;  1TS2 A;  1STE A;  3IFD A;  1NSN S;  1TT2 A;  2OWO A;  3V05 A;  1O7L A;  1I4H A;  3GTM H;  1TR5 A;  2XWJ B;  5JEA J;  4LFC L;  1QCB D;  2PNH A;  3OIQ A;  4MIU A;  1TS5 A;  1NUC A;  5CR3 A;  4BY1 B;  1G2T A;  3NBH A;  1HTP A;  3JAM E;  5HGT A;  3VR5 A;  4HJ7 A;  3I4M G;  1HCZ A;  2YTX A;  3CCL A;  5DAU A;  3G6J B;  2N55 A;  4IOC A;  1Q8I A;  2UUA Q;  1A63 A;  1SBB B;  1Y14 B;  3S24 A;  4GNX B;  1WCM B;  2UXC Q;  1KNA A;  4QIW E;  1WTH A;  3RZD B;  3OYY A;  1G51 A;  4B3M Q;  1V43 A;  2B63 B;  1LAB A;  3BDL A;  3R93 A;  5BN4 A;  2X6L A;  1TKW B;  2PW5 A;  2IX3 A;  4ZLT F;  4MNO A;  2DJG C;  3DM3 A;  3ERS X;  4LF7 Q;  1L0X B;  1JQY D;  3HP3 A;  1TS3 A;  2EYJ A;  2I46 A;  1I4P A;  4J6H A;  1HR0 Q;  4GZY C;  2WV6 D;  4X66 Q;  2ZTE A;  4A3E B;  4WJW A;  4HAE A;  3JAM i;  1CKO A;  1LYL A;  3V96 A;  4G4K A;  1K3R A;  1QVC A;  1PHJ A;  1QUQ B;  5EPL A;  2NVQ H;  4DV5 L;  2HT1 A;  3BVZ A;  1LTI D;  1QUQ A;  4JI3 Q;  4XT3 B;  2OQ0 A;  1F77 A;  1FNV A;  5I6W A;  1X65 A;  4B3R L;  4JYA L;  3TEH B;  4CGY B;  3HOW G;  1I94 L;  3J80 L;  3GTL B;  2ENB A;  1AE3 A;  2KUM A;  4X64 L;  1KNE A;  4DUY L;  4DR7 Q;  3HKZ E;  2HIX A;  1GO3 E;  4G57 A;  4L5T A;  1EY9 A;  2E74 C;  3CW2 C;  1E0B A;  1E24 A;  1ML0 D;  4DV2 Q;  2AWO A;  1EY6 A;  4YWM A;  4CKE A;  4XIG S;  4JW0 A;  4G7H C;  1CA6 A;  4K0K L;  3R2T A;  3S16 B;  1PDQ A;  2CVR A;  1PRT C;  3EA6 A;  1SYG A;  2BA0 A;  2L55 A;  1DXM A;  3K81 C;  1K9M C;  1IKM A;  1LTS D;  4OWT B;  4RWS C;  2LXK A;  4U67 3;  4IUT A;  4KY7 A;  1GJX A;  2EJF C;  1SLJ A;  2F0K A;  3VYU A;  2RHS B;  2VZA A;  1B50 A;  2Q2I A;  4OL7 A;  3OMG A;  2OTL A;  1SNQ A;  3S14 H;  1C9O A;  1I6H B;  4A3F B;  2JXM B;  4JV5 Q;  5I4D A;  3U9O A;  4J1M A;  4IUV A;  1ZEQ X;  2K28 A;  3RLN A;  4JI1 Q;  1EUJ A;  2SEB D;  4BY1 H;  4A3L G;  4KN7 C;  3SE0 A;  2JEA I;  1X3E A;  4G7O C;  1SNC A;  5HY6 A;  2SDF A;  4F8M A;  1KLG D;  5M5Y H;  3IRB A;  1K0R A;  2MJ8 A;  3H0G G;  5FLX c;  1UE5 A;  4KHZ A;  1XX8 A;  2MP1 A;  3A8J E;  3J81 E;  2JA6 B;  4WJ3 M;  2ATW A;  2JA5 B;  2AUK A;  1YIT A;  2A8V A;  1PH1 A;  3RZD H;  2KHJ A;  5L37 A;  4MN3 A;  4DK3 C;  2B63 H;  2RBM A;  5C4J B;  1HNZ L;  3GD7 A;  3AFQ A;  3I4O A;  5ELF A;  2KOL A;  4P75 A;  3DXJ C;  1Z9F A;  2ES2 A;  1DOL A;  1OXV A;  4O2D A;  1LTG D;  4GOP C;  2BDN A;  3D3R A;  5KYL A;  4DUZ Q;  3TZU A;  2R92 G;  3ERQ A;  1QG7 A;  3V2T A;  4IUR A;  1MBY A;  4P2C B;  2UUC Q;  1C0A A;  4OX9 L;  1B4O A;  2ID0 A;  1HXY D;  3A55 A;  1KAA A;  4MTN A;  3J81 i;  3TRE A;  1I6V C;  3NSW A;  2F0O A;  3A8K E;  4FDB A;  3S15 B;  2E2H B;  1HPC A;  1RJT A;  1P16 A;  3GTL H;  2VUM G;  3F1Z A;  1YNJ D;  1K8M A;  4BBR G;  3SK5 A;  1WOC A;  1KL9 A;  1WTQ A;  4I7A A;  3T51 B;  2B29 A;  2PYK A;  3GTK H;  5KND A;  3CMA A;  4NXM Q;  3S16 H;  1JR0 D;  1BO0 A;  4LF5 L;  2WKD A;  4O1N A;  4DAM A;  3OMC A;  1KQS A;  1PYW D;  1XPO A;  4POG A;  2GVA A;  2IW3 A;  4R8N A;  1LUZ A;  1SE8 A;  1YHQ A;  1SFO B;  1YVC A;  1PZJ D;  1R4P B;  1PFN A;  3FRP B;  5J1Z A;  1SNO A;  2EDG A;  1VF5 C;  4I65 A;  4DR2 Q;  1PFB A;  1G2S A;  2DNE A;  1F2M A;  1Y1W G;  5FO7 B;  4LF4 Q;  4C2M B;  1VQM A;  1Y69 U;  4X6A H;  1EIF A;  3L3O C;  1OO9 B;  3T1H Q;  1YHA A;  4HIM A;  1I6H H;  1XNR L;  4A3F H;  4GLA C;  2JQO A;  4NKL A;  2JEB I;  4C56 C;  2OT2 A;  4IN3 A;  4XT1 B;  2QA4 A;  3NHH A;  5E4W C;  2EVB A;  3HGB A;  3VYS A;  1VQH A;  1VQP A;  3H3V I;  3J7Z C;  1EY8 A;  1N36 Q;  4HCE A;  4RMF A;  1ICW A;  3HOZ G;  1LTB D;  3TP8 A;  1O7Z A;  3K80 C;  2NBF A;  5I2X A;  2LMC B;  5JPN C;  3KJO A;  1IBL L;  1WTR A;  2L1B A;  5CV7 A;  5ELD A;  2FFK B;  4IUU A;  2BH2 A;  2JA6 H;  4MHE A;  2JA5 H;  1XMQ L;  1TWF B;  1TWH B;  1VQN A;  3G4S A;  2Q2U A;  1JE4 A;  2MPM A;  4PQX A;  5I9O A;  1ONL A;  5C4J H;  4IJH A;  3J80 E;  2I07 B;  1WD1 A;  3I8Z A;  1S5B D;  3F8T A;  5GRO A;  5M3F G;  5M3M B;  2XIW A;  4A3C H;  3HOU G;  4X62 L;  2RSN A;  3W2D A;  1QWY A;  1S5E D;  1JC7 A;  3S2H B;  1EL0 A;  1NCV A;  4YHH L;  4TVA B;  1X3F A;  5GAH C;  5IYD H;  5M5X B;  1B53 A;  2VL6 A;  1EQR A;  3PUV A;  2N78 A;  2XRS D;  2A6E D;  3E9H A;  3WOF A;  4DR4 L;  2UUB Q;  4XDX A;  3Q6S A; 
#chains in the Genus database with same CATH homology
 5IGE A;  2A74 C;  1DM0 B;  3F2U A;  1DZ1 A;  1Q90 A;  5IOC A;  2E2D C;  2F03 A;  4DXG A;  1U4P A;  1LT4 D;  1YNN C;  3BG3 A;  3QO2 A;  3QOJ A;  4JK1 C;  3GTG B;  1M8A A;  4K8I A;  2A69 D;  1HTL D;  4CJ0 B;  4OO1 H;  1IYU A;  5C44 B;  2F0V A;  3RMH A;  2WAC A;  3JAM L;  1C8C A;  1DOM A;  1V8Q A;  4KY5 A;  3SK8 A;  3T16 A;  4WFN 3;  5C3E B;  3C3L A;  3P7J A;  2B2W C;  2F3V A;  5EKI A;  3K5L A;  3PIO 3;  1KLU D;  1STA A;  2K1B A;  5E1F A;  2KHS A;  5FLX E;  1S5D D;  4ZK9 B;  2F0I A;  3S17 B;  4H13 C;  5K36 H;  3DWP A;  2EY6 A;  2H4O A;  1BNZ A;  1D5X C;  3CU7 A;  4X3T A;  1KDC A;  1LTR D;  3MFY A;  3FPU B;  3M7N A;  4TKO B;  4Y7N B;  1FD7 D;  5KNC A;  3WDN A;  1SYB A;  2EPB A;  4CJ1 B;  3L9A X;  5IIF A;  5IGF A;  2TMP A;  3KUP A;  1FNU A;  2WAQ B;  4XQJ A;  2F0W A;  1Z7T A;  1C48 A;  2NZ1 D;  4HSV A;  1E2Z A;  2CW0 D;  1VDZ A;  4HED A;  1BR9 A;  1EQV A;  2KQ3 A;  3M4Y A;  3KLS A;  4KJO A;  3BYY B;  4DK0 A;  2F0D A;  3A8I E;  4KD3 A;  1A3V A;  3H91 A;  2VNU D;  1R4Q B;  2R61 A;  4FXK C;  1DCZ A;  4R8I A;  2IT1 A;  1F9R A;  3H3V C;  1SXT A;  2V4D A;  1TY0 A;  3SHL A;  1F9S A;  4M8A A;  3GQB A;  1U4R A;  3MVV A;  1PMR A;  5IGB A;  1NR2 A;  2K7V A;  2NN6 I;  3MFG A;  5ISR A;  2X69 A;  4EQP A;  4KKS A;  2NN6 H;  3KLS X;  3VR6 A;  3ERO A;  2FMC A;  1BCP C;  3KLR A;  2NVQ B;  4CHT B;  3MTS A;  4XQN A;  2O5J C;  4A3D B;  1SAP A;  2G9D A;  3J81 L;  3SEB A;  1LTA D;  4HMJ A;  3NTH A;  4KI0 A;  3CQZ B;  3RLF A;  5CV8 A;  4ZKB B;  1DOK A;  5JVH 3;  2BOS A;  1Q12 A;  4IQZ A;  5CMD A;  1S5F D;  1EU4 A;  3VR2 A;  1Y8O B;  1JCK B;  1SE3 A;  1OXS C;  2SOB A;  3X3N A;  2EYP A;  5J39 A;  4HR7 B;  1EZ6 A;  4QF4 A;  3DUZ A;  2RA4 A;  1QJO A;  2QKI C;  4LK1 C;  4C3J B;  3S1R B;  5AFW A;  3OPO A;  2A6H D;  4HCS A;  3HOX B;  2Z1C A;  3CRK C;  5CV9 A;  1ET6 A;  1ZXT A;  1STH A;  3TP6 A;  1UEA B;  3I91 A;  3S2D B;  1S5C D;  2MUY A;  4KY6 A;  2LY7 A;  1LTT D;  5M5Y B;  4G7Z C;  1B1Z A;  3TBI B;  4IUQ A;  4CJ2 C;  1C4Q A;  2SNM A;  4IFD G;  1LT6 D;  4RA8 A;  5C4H A;  2IX1 A;  2M2L A;  3K58 A;  1HHV A;  3QIA A;  2F0T A;  2WP8 J;  2B8G A;  2IX0 A;  3FMC A;  2BDO A;  4K5V A;  1DYQ A;  2IJ0 A;  4RGN A;  1ZYR C;  1CQF A;  4FO2 A;  5E3F A;  1AZP A;  2WII B;  3S9W A;  2BE5 C;  3C1F A;  4KD4 A;  4IFD J;  1IW7 D;  3A54 A;  1LO5 D;  4K6L A;  3K0Y A;  3TME A;  2B2U C;  4RGT A;  1Q1B A;  1SND A;  4ZUI A;  2XWB B;  2B2W A;  2JP1 A;  3FVQ A;  4RKL A;  1EY0 A;  3BS1 A;  1SE2 A;  2LS0 1;  3K5M A;  1GUG A;  3PO3 B;  4AYB B;  1A6X A;  4V19 0;  1I3Q B;  3P20 A;  2ZXO A;  1PTO F;  3GTK B;  2K5D A;  5CBE E;  3MA2 B;  1EEF D;  3Q23 A;  2A68 D;  1PRT D;  3S1M B;  4OO1 G;  3VR3 A;  1EWH A;  3SK4 A;  2NVX B;  4A3G B;  1F2Y A;  4QB4 A;  2B8F A;  4DN4 M;  3MZ5 A;  4DGZ A;  4QMG A;  2RVL A;  1O7Y A;  3Q22 A;  1AFP A;  1TS4 A;  2K01 A;  3SR1 A;  1O80 A;  3D6C A;  2R93 B;  3GV3 A;  4FVM A;  2D2C C;  3MHB A;  2L12 A;  3I4N B;  5C0X I;  4C3I G;  2ICE C;  5C0X H;  2HUG A;  3NE5 B;  3DEP A;  5K36 G;  2XRQ D;  1ESF A;  5J22 A;  5F2D A;  4XQQ A;  5HUR A;  3I4M B;  5E4X A;  4ODG A;  1WD0 A;  1SYE A;  2HQE A;  1BCP B;  3QOL A;  2HCI A;  1U4M A;  5C5L A;  2F0Q A;  4RKB A;  4FXD A;  3C2P A;  1HUN A;  2K5W A;  1BF4 A;  4OIJ A;  1J8I A;  4Z9C B;  1I4G A;  2OXP A;  4O42 A;  3ND9 A;  1ESR A;  4BA2 I;  5FLX L;  4R9W A;  1GOZ A;  3GTP B;  1SYC A;  2FIN B;  4IUP A;  1PTO D;  5EPK A;  3A56 A;  2Q8I B;  4ZUJ A;  3NQT A;  3MXG A;  1MI2 A;  3K59 A;  1SYD A;  3E0J A;  3IAY A;  1JWU D;  3BVG A;  3J7Y W;  1HA5 A;  1GUO A;  4DU9 A;  2F4I A;  1KDA A;  3HOW B;  1YNJ C;  1SDF A;  1B9N A;  3A7L A;  4XTC S;  3BDO A;  3T4A C;  2KED A;  4CBV A;  4I7Z C;  3PUW A;  1FNW A;  4L8J A;  4DF7 A;  4TRD A;  1B9M A;  4EVO A;  4UAI A;  3RUZ A;  1EYD A;  2EJM A;  3BYT B;  5FO9 B;  5JEA H;  1G8Z D;  1Z6H A;  1JOK A;  4B9X A;  1F9Q A;  5A2Q E;  1RD9 D;  2LFN A;  5CC4 A;  1I50 B;  1I4R A;  3Q24 A;  2PPB C;  2O4X A;  4F87 A;  1B2T A;  1G29 1;  4C1N I;  3G7L A;  4HTH A;  1EU3 A;  1AZQ A;  4L6T B;  5KEE A;  1MGS A;  3CRL C;  1D5Z C;  5ELC A;  1EZ8 A;  1F9P A;  2EYL A;  1CFM A;  3KBG A;  5C5M A;  3PV0 A;  1BBX C;  2EYF A;  1F2L A;  4H0L C;  4OIK A;  4LMQ D;  4ULL A;  3C1E A;  3D4R A;  1RF2 D;  1TVX A;  4FNF A;  3MEH A;  1EIH A;  2K6A A;  4PNY A;  4B9W A;  4C1N K;  2FJ2 A;  1F2Z A;  1K83 B;  1AEX A;  5ELB A;  3VYR A;  2R92 B;  1SJH D;  3QG1 A;  2F0L A;  3OHX C;  3DHQ A;  2PQE A;  2B2Y C;  4H7B A;  1HA6 A;  2R3Z A;  3HOY B;  1LT3 D;  5G3L D;  2VUM B;  4BBR B;  2CQA A;  3E5S A;  2XNA C;  2EOT A;  1HFN A;  2FMM A;  2A69 C;  1ENC A;  3LWU A;  2VXW A;  1W6K A;  1D1K A;  4RFB A;  4X3K A;  1CHQ D;  3K57 A;  3IL8 A;  1CI3 M;  2C5C A;  2WIN B;  3ONA B;  5KIX A;  2DN8 A;  3MXP A;  4WOR A;  4BWG B;  1WTV A;  4KTA A;  5FOB B;  3VYT A;  4IAL A;  2KA7 A;  2M00 A;  1RCV D;  2RDH A;  3VA7 A;  2A5H A;  4K6D A;  3OSO A;  1JOO A;  2J0T D;  2RDG A;  4S3S A;  1QOH A;  2IL8 A;  2RQX A;  4H44 C;  1FGB D;  1XXG A;  3HOZ B;  3GP7 A;  3EVQ A;  3AU7 A;  5KYI A;  1FR3 A;  4DNT B;  4K5W A;  1SMY D;  2F0U A;  3C46 A;  4ZYS A;  3MXU A;  1K8O A;  3I3C A;  2F0N A;  5EQ0 A;  4TSS A;  5C6A A;  2DY8 A;  5M3F B;  1STY A;  3HOU B;  1D6E C;  3NK9 A;  3DEO A;  2EJG C;  2K03 A;  3HRZ C;  3URY A;  3J7A V;  3DWA A;  4V0B A;  1A3U A;  1U9R A;  4Q0F A;  2PZU A;  4DFA A;  4RCO A;  1JOR A;  2EY2 A;  2CW0 C;  1STG A;  1T5E A;  3M85 A;  3NQI A;  3LX0 A;  1WTX A;  3GTO B;  2B39 A;  3HOV B;  1NR4 A;  4BA1 I;  4CKB A;  3R8B A;  1J9O A;  2QIL A;  1G91 A;  2R7Z B;  4BBS B;  4OHJ A;  1EFI D;  3NUC A;  4IZ8 A;  2MGS A;  1X3Q A;  3HG9 A;  1JWM D;  2B2T C;  3IKJ A;  5EJW A;  5M9O A;  1V1P B;  3OWE B;  1PLF A;  4PMC A;  2L0C A;  3NTK A;  2ICI A;  3MWY W;  1V1P A;  2D9U A;  4FXG C;  1T5X D;  1V1O A;  4U68 A;  3GV6 A;  5D14 A;  4A3I B;  4A93 B;  4F7X A;  1S4Z A;  4BS9 A;  1R9T B;  1SYF A;  1EYA A;  3M3Y B;  4C3H B;  5CV6 A;  4K14 A;  5KGU A;  1CZG A;  4A3K B;  4QIW B;  3ITP A;  3I72 A;  1A2T A;  1SSO A;  5JVG 3;  1X32 A;  1Z47 A;  3FPP A;  2ZT9 C;  3NWT A;  5EPJ A;  2G9H D;  4B08 A;  1A15 A;  5T1I A;  3NTI A;  4KN4 C;  5ELE A;  2J4X A;  3H6M A;  2YU9 B;  2H1E A;  1CT1 D;  2NYZ D;  2NVT B;  1PRT F;  2YYZ A;  3N6R A;  4KHV A;  1II3 A;  5C4X B;  2M9V A;  4KKT A;  3LWE A;  4IUN A;  2R6G A;  3O13 A;  1EWC A;  4XYO A;  2XSC A;  2A6H C;  4ZKC B;  3GTQ B;  3OWF A;  3OIP A;  4KJN A;  3GO5 A;  1JIC A;  1LT5 D;  2Z4H A;  2FHT A;  2K5Q A;  3EJI A;  3HKZ B;  2B2Y A;  2Z8L A;  1Y8N B;  5FO8 B;  2IWH A;  1CZW A;  4ILW A;  2B2V C;  3I4L A;  1TWA B;  1MSG A;  5EKL A;  5M5W B;  1PXU A;  2DY7 A;  1ZYR D;  3W3A A;  1TWC B;  4FP5 D;  5I9P A;  4YIJ A;  2BE5 D;  1GUW A;  5IT9 L;  3T56 B;  3SVM A;  5A2Q L;  1HRJ A;  2EE1 A;  2ZXR A;  1HQR D;  2VB2 X;  3FDT A;  1X3P A;  1IW7 C;  4DAP A;  3IFT A;  4KMU C;  4HN7 A;  3D8G A;  4BY7 B;  4HSP A;  1AW7 A;  2E2J B;  5COY A;  4QUF A;  3FEW X;  3SXH A;  5FK9 C;  2N88 A;  1OXU A;  5C4Z A;  5I2Y A;  5KNB A;  2PZT A;  1HUM A;  2KEC A;  3R3O A;  1WTP A;  2KJX A;  1CTM A;  3MAQ A;  1Q1E A;  1CM9 A;  3K5O A;  4RH6 A;  3P1H A;  1E2W A;  3VR4 A;  5IOD A;  1H9S B;  1QB5 D;  1WVL A;  2XVS A;  4PMB A;  4PV1 C;  4DNR B;  4Q5V A;  1CHP D;  2NWG A;  1H9S A;  1RTN A;  2NTS A;  2A68 C;  2KCN A;  5IGC A;  2PCF B;  1PFM A;  5LHY 1;  5I6Y A;  4FF2 A;  3EQL C;  4QCL A;  4N9P A;  3HS0 C;  2LKV A;  5IGD A;  4RGM A;  2F0G A;  1QNU A;  2ZXP A;  2JYO A;  3LNN A;  5C3W A;  2F0H A;  5D3D A;  1VF7 A;  4RGO S;  1BOS A;  1IL8 A;  1EY7 A;  1QIL A;  2O5I C;  2F0J A;  4L63 B;  1TWG B;  2L11 A;  4WRD A;  3TDQ A;  2DNC A;  3ND8 A;  4A3M B;  1UUP A;  4PMW A;  3WOE A;  3D4D A;  3BDC A;  2AWN A;  3R2I A;  3KBX A;  1CA5 A;  3DMU A;  1ROD A;  3HEJ A;  3DM1 A;  3K7A B;  1MD2 D;  2K05 A;  3HZX A;  4NW2 A;  1RTO A;  2B2T A;  1EIG A;  1O78 A;  4X3S A;  2F1M A;  3TSS A;  1DD2 A;  3KK7 A;  1OXX K;  2EY1 A;  2QCP X;  4E6I A;  2NTT A;  1W6J A;  5BN5 A;  2QEJ C;  5EGT A;  3OW7 A;  3NPP A;  1ET9 A;  5K5P A;  2K32 A;  3I70 A;  3AB9 A;  5JOB A;  2QDB A;  5BN3 A;  3K5N A;  1G6Z A;  4DXF A;  5DM6 3;  3BZD B;  3MXN A;  4ZAI A;  1PTO C;  2F0M A;  4HMI A;  1D2B A;  3T53 B;  3X3M A;  4EGV A;  2E76 C;  3QWN A;  4RAU C;  4K2K A;  5FKA C;  1LAC A;  5NUC A;  3P75 A;  3PUZ A;  2F0S A;  1Y8P B;  1B44 D;  2J7Z A;  2NN6 G;  1AN8 A;  1EY5 A;  1TII D;  3TZD A;  1B3A A;  1ILP A;  3D31 A;  2EYO A;  5G3L F;  5LL6 X;  3RZO B;  1VCI A;  4FF4 A;  3OOC A;  3TP5 A;  1H9R A;  4EQO A;  1IKL A;  1RKN A;  3DWQ A;  5IT9 E;  1GUN A;  3N52 A;  1WTO A;  3M4O B;  4ME5 A;  1GHK A;  4JBW A;  3T13 A;  5C3X A;  2PMZ B;  3QB3 A;  5CV4 A;  1ZKO A;  1GUT A;  1MSH A;  1Q3L A;  1NAP A;  3I90 A;  1JWS D;  2B2V A;  4F88 A;  3BVM A;  4UDU C;  4NDX A;  4ABN A;  4C3I B;  2GA4 B;  3H0G B;  3H09 A;  4NMZ A;  5IGG A;  4IFD I;  1L0Y B;  3A7A B;  1VMP A;  4M1U B;  1AP0 A;  4LJZ C;  1BUV T;  4XXE A;  3QJY A;  4IFD H;  2F0E A;  2D62 A;  3VA5 A;  5DNF A;  2TSS A;  3SDZ A;  1STB A;  2KCC A;  1GXD C;  2B2U A;  2HDM A;  2OEO A;  1RHP A;  2SNS A;  3FKI B;  5EKK A;  1HQM C;  1GUS A;  1KAB A;  1DJR D;  2A73 B;  1I4Q A;  3D4W A;  5COR A;  1PZK D;  2CHB D;  2WKC A;  3CKI B;  1U4L A;  2A6E C;  2L4N A;  5EBC A;  4CKC A;  4OGQ C;  4FF3 A;  1YNN D;  4TQU S;  2NB0 A;  1H9K A;  3D6W A;  2IPK D;  2F3W A;  5D3I B;  2JA7 B;  2K04 A;  3H94 A;  2JSO A;  5CV5 A;  3GTJ B;  5DM7 3;  1HFG A;  4K5X A;  2E75 C;  2RSO A;  3PUY A;  1PRT B;  4J8Q A;  1KTK A;  1LV9 A;  1EOT A;  1SNP A;  4OO1 I;  1BQQ T;  3L7Z C;  5A35 A;  1QNK A;  4A3B B;  2AUJ D;  1UNS A;  3I73 A;  4XYQ A;  2Q8T A;  1TU2 B;  2AQ2 B;  4EQN A;  4N9T A;  3S1Q B;  2L5T A;  3KF8 A;  4LAA A;  1Y1W B;  5JAV A;  5JPM C;  4K8J A;  1XYI A;  2BCO A;  2MHV A;  1CK1 A;  1BCP F;  2EXZ A;  4C3H G;  3CHB D;  1A2U A;  2KEE A;  1D5M C;  2NVY B;  1Y1V B;  1D1I A;  1UAP A;  1I4X A;  2PW7 A;  4ZQ3 A;  3E6Z X;  4KK7 A;  2EYM A;  1OXT A;  2E2I B;  1IYV A;  3S1N B;  2WB1 B;  1EY4 A;  1TY2 A;  2JA8 B;  4C3J G;  4RHS A;  4A3J B;  3EFX D;  1SE4 A;  2AQ1 B;  1E2V A;  5CYU A;  1ILQ A;  2BA1 A;  1XWE A;  3PO2 B;  1SMY C;  2EZV A;  3PMF A;  2PO4 A;  1FYC A;  2F0P A;  3TP7 A;  2KVM A;  2OF1 A;  1PTO B;  3NBI A;  4QUC A;  3U9S A;  5C0X G;  1H9J A;  1RDP D;  3MC0 B;  1A3T A;  1EYC A;  3GTM B;  3ZYY X;  4DA2 A;  1STN A;  5JJZ A;  2RDF A;  3PIP 3;  4KKU A;  2JE6 I;  1IHZ A;  2EY5 A;  2O2L D;  5C0X J;  1H9M A;  4KV6 A;  4ID6 A;  2AQ3 B;  1JB3 A;  5TSS A;  1SEB D;  2VB3 X;  2D5D A;  1BCP D;  2PNR C;  4DAV A;  2Y0S B;  3Q0A A;  1TQO A;  5KRU A;  2EYH A;  3NXW A;  5CBA E;  1M4V A;  2NUC A;  3TN2 A;  4DK1 A;  5EBD A;  1PZI D;  2L9H A;  3RD4 A;  1BDO A;  3M7G A;  5D65 A;  1WTW A;  2Q8R E;  2HDL A;  3J7A F;  4NP5 A;  2K33 A;  1QE6 A;  4ZRZ A;  5LL6 S;  5T1G A;  1KDB A;  2XN9 C;  1ENF A;  1JOQ A;  4DAY A;  2F0F A;  2HCC A;  1SJE D;  4RHR A;  1VMC A;  2PZW A;  4RCN A;  3PUX A;  1EEI D;  1BXT A;  1LLR D;  4FYD A;  2C9O A;  1SNM A;  3AMU A;  1EQT A;  1CQV A;  2X6G A;  1DON A;  3NP8 A;  4FF1 A;  3UI2 A;  3SK6 A;  5JEA G;  4K2L A;  5DEH A;  3NWS A;  1GHJ A;  5CGK A;  2QF7 A;  1PTO H;  3K6O A;  3S14 B;  4X3U A;  2RKS A;  1ENA A;  2Z4I A;  1XTC D;  1TS2 A;  1STE A;  3IFD A;  1NSN S;  1TT2 A;  3V05 A;  1O7L A;  1I4H A;  1TR5 A;  2XWJ B;  5JEA J;  1QCB D;  4MIU A;  3OIQ A;  1TS5 A;  1NUC A;  5CR3 A;  4BY1 B;  1G2T A;  3NBH A;  1HTP A;  3JAM E;  5HGT A;  3VR5 A;  1HCZ A;  5DAU A;  3G6J B;  2N55 A;  1Q8I A;  1SBB B;  1WCM B;  1KNA A;  3RZD B;  1V43 A;  2B63 B;  1LAB A;  3BDL A;  3R93 A;  5BN4 A;  2X6L A;  1TKW B;  2PW5 A;  2IX3 A;  4ZLT F;  1L0X B;  1JQY D;  3HP3 A;  1TS3 A;  2EYJ A;  2I46 A;  1I4P A;  4J6H A;  4GZY C;  2WV6 D;  4A3E B;  4WJW A;  4HAE A;  3V96 A;  4G4K A;  5EPL A;  3BVZ A;  1LTI D;  4XT3 B;  1F77 A;  1FNV A;  5I6W A;  4CGY B;  3J80 L;  3GTL B;  2ENB A;  2KUM A;  1KNE A;  4G57 A;  1EY9 A;  2E74 C;  1E0B A;  1ML0 D;  2AWO A;  1EY6 A;  4CKE A;  4XIG S;  4G7H C;  1CA6 A;  3R2T A;  3S16 B;  1PDQ A;  2CVR A;  1PRT C;  3EA6 A;  1SYG A;  2BA0 A;  2L55 A;  1DXM A;  1IKM A;  1LTS D;  4RWS C;  4U67 3;  4IUT A;  4KY7 A;  1GJX A;  2EJF C;  2F0K A;  3VYU A;  1B50 A;  4OL7 A;  3OMG A;  1SNQ A;  1I6H B;  4A3F B;  2JXM B;  5I4D A;  3U9O A;  4J1M A;  4IUV A;  1ZEQ X;  2K28 A;  2SEB D;  4KN7 C;  3SE0 A;  2JEA I;  4G7O C;  1SNC A;  2SDF A;  4F8M A;  1KLG D;  2MJ8 A;  4KHZ A;  1XX8 A;  2MP1 A;  3A8J E;  3J81 E;  2JA6 B;  2JA5 B;  2AUK A;  4MN3 A;  2RBM A;  5C4J B;  3GD7 A;  5ELF A;  2KOL A;  3DXJ C;  1DOL A;  1OXV A;  1LTG D;  2BDN A;  3D3R A;  5KYL A;  3TZU A;  3ERQ A;  1QG7 A;  3V2T A;  4IUR A;  1MBY A;  4P2C B;  1B4O A;  2ID0 A;  1HXY D;  3A55 A;  1KAA A;  1I6V C;  3NSW A;  2F0O A;  3A8K E;  3S15 B;  2E2H B;  1HPC A;  1RJT A;  1YNJ D;  1K8M A;  3SK5 A;  1WTQ A;  3T51 B;  2PYK A;  5KND A;  1JR0 D;  1BO0 A;  2WKD A;  4O1N A;  3OMC A;  1PYW D;  2IW3 A;  4R8N A;  1SFO B;  1PZJ D;  1R4P B;  1PFN A;  3FRP B;  5J1Z A;  1SNO A;  2EDG A;  1VF5 C;  4I65 A;  1PFB A;  1G2S A;  2DNE A;  1F2M A;  5FO7 B;  4C2M B;  1Y69 U;  3L3O C;  1OO9 B;  4NKL A;  2JEB I;  4C56 C;  2OT2 A;  4IN3 A;  4XT1 B;  3NHH A;  5E4W C;  2EVB A;  3HGB A;  3VYS A;  1EY8 A;  4HCE A;  1ICW A;  1LTB D;  3TP8 A;  1O7Z A;  2NBF A;  5I2X A;  2LMC B;  5JPN C;  1WTR A;  2L1B A;  5CV7 A;  5ELD A;  2FFK B;  4IUU A;  4MHE A;  1TWF B;  1TWH B;  1JE4 A;  2MPM A;  4PQX A;  5I9O A;  1ONL A;  3J80 E;  2I07 B;  1WD1 A;  3I8Z A;  1S5B D;  5M3M B;  2XIW A;  2RSN A;  3W2D A;  1QWY A;  1S5E D;  1JC7 A;  3S2H B;  1EL0 A;  1NCV A;  5M5X B;  1B53 A;  3PUV A;  2XRS D;  2A6E D;  3WOF A;  4XDX A;  3Q6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...