3QO2A

Structural insights for mpp8 chromodomain interaction with histone h3 lysine 9
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
MGEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-phase phosphoprotein 8
publication title Structural insights for MPP8 chromodomain interaction with histone H3 lysine 9: potential effect of phosphorylation on methyl-lysine binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/gene regulation
total genus 12
structure length 61
sequence length 61
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qo2A00
5EKIA 2HUGA 3DEOA 1J9OA 1U4LA 2JP1A 4XT3B 5D14A 2Q8TA 3TZDA 1U4MA 3R93A 1EL0A 3P7JA 3I3CA 4O42A 1BBXC 1DONA 2RSOA 4RA8A 5AFWA 1G2TA 1LV9A 1VMCA 4HAEA 1PFNA 1BO0A 5EJWA 1BNZA 2HDMA 1WTQA 4NW2A 2NWGA 2KEEA 1ICWA 2B2YC 2FJ2A 2H1EA 2R3ZA 2RA4A 3IL8A 2EE1A 5E4WC 1WD0A 1AZPA 1B50A 1ML0D 2K1BA 3FDTA 2EOTA 1F9RA 3GV3A 3UI2A 4QUFA 2FINB 3DEPA 5DNFA 1MGSA 1AZQA 2EPBA 2K04A 1ILPA 1SAPA 4IURA 4RAUC 3F2UA 1F9PA 2B2UA 1ESRA 4CJ2C 3D6WA 4RWSC 2L11A 1B3AA 1TVXA 3FPUB 4ZAIA 2B2TA 5CBAE 1B4OA 2Q8RE 3IFDA 1IKLA 1NAPA 1KNAA 2FHTA 3TN2A 1PDQA 1DOLA 4U68A 2NZ1D 1MSHA 3I8ZA 2X6GA 1NR4A 1QG7A 1WTVA 1C8CA 4MN3A 1HUMA 1NR2A 1HUNA 2DY7A 2J7ZA 3G7LA 3MTSA 3SVMA 3N52A 1G2SA 1HHVA 1MSGA 2MGSA 1WTRA 1BF4A 1CM9A 2MPMA 1WTPA 2NYZD 1CA6A 2L12A 2KUMA 3ONAB 1XYIA 1PFMA 1SSOA 2JYOA 2VXWA 4HCSA 4MHEA 5EQ0A 1ZXTA 1DOMA 2FMMA 5EPLA 1U4RA 4ZLTF 1WVLA 1AP0A 2B2VC 1HFNA 2X69A 5T1GA 2B2YA 2FFKB 1F9QA 1XX8A 1X3QA 2N55A 1M8AA 2KEDA 1G91A 2CVRA 2HCIA 4IUTA 1O7YA 1F2LA 2RSNA 2SDFA 3GV6A 1RTNA 3HP3A 1DOKA 2B2WC 3I91A 1EOTA 5COYA 2K03A 4UAIA 2HDLA 2RVLA 2DY8A 5JJZA 4IUVA 1IL8A 4ZKBB 4IUUA 1WTWA 1DZ1A 1VMPA 1PLFA 4R8IA 1QNKA 3H91A 3Q6SA 1RJTA 4DN4M 1IKMA 1O80A 1F9SA 1QE6A 4OIKA 2K01A 2IL8A 2KOLA 2BDNA 4OIJA 4R9WA 5D65A 1HRJA 1NCVA 2D9UA 2L1BA 2X6LA 2B2VA 4LMQD 4QUCA 1WTOA 4ZK9B 3DM1A 4HSVA 1O7ZA 1SDFA 2MJ8A 1ILQA 1U4PA 5CBEE 1G6ZA 1X32A 2K05A 4X3UA 4XT1B 4HEDA 4CJ1B 1E0BA 1B2TA 3I90A 3MWYW 1RHPA 5E4XA 1WTXA 1RTOA 2HCCA 4X3TA 1HFGA 1PFBA 1X3PA 1S4ZA 2B2WA 1WD1A 1CA5A 1HA6A 1Q3LA 3KUPA 3QO2A 2L9HA 4X3SA 1EQTA 3LWEA 1A15A 4CJ0B 2N88A 2L4NA 1J8IA 1GUWA 1B53A 1MI2A 2KVMA 5EPKA 2KECA 2MP1A 4IUQA 1JE4A 1JICA 1KNEA 3KBXA 2M2LA 2B2UC 1EIGA 4XDXA 5CORA 5CMDA 2K28A 4IUPA 1RODA 4X3KA 2XIWA 1EIHA 5EPJA 5T1IA 2B2TC 4ZKCB
chains in the Genus database with same CATH superfamily
2NVTH 2O5IC 2JP1A 1V1PA 1EL0A 2NVXB 1D7QA 3P7JA 1SXTA 1EWCA 1S5FD 4BY1G 3EA6A 3S15B 4A3CG 1Q1BA 2R7ZG 3GTPH 1BNZA 1VQBA 1AE3A 1UUPA 4NDXA 4OXPA 1WD0A 3CD6A 4X66Q 3RZDB 3SXHA 2UU9Q 3WDNA 2A8VA 1VQLA 5IT9E 4RAUC 1A2TA 4LFCL 3D6CA 4B3ML 2CQOA 4CGYB 3Q24A 2XVSA 1SN8A 4K8IA 1L0WA 1LTTD 4ZUJA 4NXNL 4DK0A 1DOLA 2ZJPA 2MFIA 1VQ5A 1NR2A 4OEMB 2J7ZA 2QW7A 1DXMA 1G2SA 3U4VA 4CDFC 1HHVA 1GUOA 1K0SA 2A6ED 2WB1B 2KQ3A 1SSOA 1O7LA 1ZXTA 2BH2A 1HFNA 2OT2A 2PQAA 4HJAA 3S1RB 3TSSA 3TMEA 1Z7TA 4P75A 1W3SA 3G6JB 4B3TQ 3H15A 1ICFB 2RSNA 1ENAA 3S1QH 3CW2C 1A62A 3NSWA 3T4AC 1SJED 1FNUA 1SNQA 1TY2A 4LNQA 2F0FA 5C44B 4E6IA 1LM0A 3IFTA 4LF4L 4EQNA 1O80A 2G9HD 3UE1A 3RN5A 4H7BA 2JA8B 4OX9L 4A75A 4IOAA 1Q81C 1I6VC 1PXUA 2JXMB 2IHEA 3BU2A 3GTJH 4LUOA 5L37A 4JI5L 4OO1G 1VQIA 5M5YB 1SDFA 2DUDA 3O13A 4LAAA 4B3SL 2UXBL 3S2DH 5CV9A 2CW0D 2YU9H 2PO4A 4JI0L 1NTGA 5FJ8G 2KBNA 4X3SA 4DV3L 4A3FH 4JI4Q 2D0PA 3PQIA 3UDXA 2KVMA 1KNEA 2R7ZB 5F2DA 3RLOA 2PW5A 3NQIA 2K6AA 4DV4Q 2LXJA 3PO3B 2CH4A 1QVFA 1QVGA 1BBXC 3CCMA 1B3QA 1CHPD 1DM0B 1C9OA 4K14A 1JOQA 3OW7A 4N8FA 2SNMA 5KEEA 3QWNA 5KIXA 4OWWB 3I4NB 2NUCA 5JPMC 1XMOL 2B2YC 3L0OA 1TWGB 4UHVA 2IWHA 1J6QA 1L0YB 3MA2B 4CDDC 3H3VH 5DNFA 2EPBA 1QILA 4RCOA 1JWUD 2K75A 3CC7A 1N8RC 1L1OA 4RWSC 1TVXA 3OHXC 1HA5A 2JN4A 2Q8RE 1NAPA 1I5FA 4WJWA 4ZCKA 1VF7A 5J22A 1II3A 3A7AB 1JQYD 2JA5B 3BDLA 1FNVA 1VQHA 4JG2A 2E2HB 1EZ6A 4JCVE 4U673 2VUMH 1PTOF 3J80E 2B63H 1TT2A 2OCEA 1TWHB 3E3XA 3MEFA 3OMGA 3KDFA 4FF3A 5M5XH 1B8AA 2A6HD 4IUTA 4JOIA 5LMUL 1OO9B 2XNAC 5E1FA 2B2WC 2ASBA 4DA2A 4DUYQ 2Z0SA 5JJIA 1H9MA 4J6HA 2KCTA 4BBSG 1CKNA 4IUVA 1VQDA 4BS9A 1QNKA 2AHOB 3L7ZC 1E3PA 1EQVA 5IP7H 4R8NA 1EU4A 1HR0Q 2KOLA 3A74A 4JW0A 3F8TA 5KNCA 2HHHL 5HURA 4ILWA 4LF5Q 3V96A 4HSVA 2F0GA 3M4OH 1G6ZA 1YJNA 5LL6S 4JI8Q 1I4PA 1M4VA 1HA6A 3H3VI 1QVCA 1EQTA 2K32A 2OEOA 1PVOA 1CKOA 3HOXG 1PFSA 4AQYL 4K5XA 4NKLA 5J1ZA 4QB4A 1EY4A 3AFQA 1UE1A 1F2YA 1SYEA 3EVQA 4Z9CB 1VQFA 2F0JA 2QILA 2EJMA 1V1OA 2Q2UA 3BVZA 4RG1A 1QB5D 4EGVA 5I2XA 4DR2L 4JBKA 1YHBA 1EYGA 1EY7A 1DONA 4MTKA 1LT3D 2VL6A 1EY9A 3J7ZC 4JV5Q 2K52A 3BVGA 5ELEA 2E5LL 5EBDA 4NW2A 2XGTA 5J39A 3T1HQ 5HY6A 3K7AH 3A0JA 3QG1A 2K1BA 2KENA 4ZRZA 4QUFA 4IURA 2MUYA 4KY7A 2EZVA 5IYCH 5GADC 2JA7G 4RGMA 4P2CB 2JEAI 3CPWA 2PCFB 4BXXH 4A3IH 1YVCA 2V1CC 3OTOQ 4DR3L 3FHWA 2LSSA 4DGZA 1NR4A 3L2PA 1YJ9A 2NN6H 1HUNA 1PZJD 3PUXA 4QIWE 2ICEC 3DM3A 1KL9A 3SDZA 2F0PA 2B29A 2VB2X 2IY5B 2JYOA 5C4JH 3NEMA 3J7A5 1CQFA 5BN5A 2OXPA 2LS01 4ZQ3A 4YY3L 2EY6A 4A3LH 1QOHA 5IP9G 4B9XA 2SEBD 3BG3A 5COYA 1PH1A 4HMIA 5JEAG 1LYLA 1SMYD 2HT1A 5C0XJ 1I94L 2R93G 1ZEQX 1CUKA 3RLNA 1V1PB 2EXZA 4DAMA 1TWCH 2XWBB 2R6GA 2E8GA 4A93H 1RL2A 4B08A 1S72A 2JA6G 5LMNL 3CU7A 4R9WA 1Y8NB 1Y1WG 3B6YA 2X6LA 4FP5D 1LTID 4APVA 4BY7G 3QJYA 5I6WA 4LFCQ 4B3MQ 4Q0FA 3SK6A 4XT1B 1QZHA 2NVQB 1DGSA 2Z1CA 2K14A 4GNXC 4AIMA 3NBIA 2LXKA 4NXNQ 4JYAQ 4ULLA 3I56A 1SRUA 4I7AA 4KK7A 4HIDA 4JI3L 3URYA 4AYBE 4XDXA 1TR5A 3OIPA 3V05A 3G71A 2PMZE 1EIHA 2F0KA 5M3MH 4H0LC 4LW1A 1CK1A 5ELNA 5E3FA 3PSIA 1N32L 3MXUA 2JJQA 1Y1VB 4LFAL 2PQAB 2NTTA 3ERSX 3SK4A 3TP5A 1PH6A 5KYIA 5IYDG 2KEEA 4LF4Q 3HOWH 1VQ8A 1B50A 4QL5A 2A1AA 3GV3A 4OX9Q 3GTLB 1HJPA 2DGYA 3G48A 1ESRA 2AQ2B 2ZTCA 1PZKD 2SNSA 1EIYB 3D6WA 1P8LA 1CKMA 3FPUB 1PRTD 2QEJC 4JI5Q 3UE0A 2UXBQ 3BDCA 3TDQA 1WTVA 4JI0Q 5LL6X 5JVG3 4P73A 5JJLA 1MSGA 3R2TA 1BF4A 4FVMA 4DV3Q 1E22A 3QOLA 3S24A 4K2KA 1D8LA 4AYBG 4EQPA 3U4ZA 3CP0A 3H3VC 3X3NA 4BY1H 1KDCA 1MHWC 2L15A 4A3CH 5M3FG 1XWEA 3NTKA 2KHIA 2R7ZH 1B70B 2SDFA 1KRTA 2ZTEA 3H0GB 4JC0A 1Y1WB 3U9OA 4JI7L 1YZ6A 3VYSA 4LF7L 4R8IA 3J80i 1IL2A 3S1MH 2NVYB 1SE8A 4V190 1VQNA 2E75C 2K01A 3GTGB 2F0QA 1SE3A 2F4IA 3HKSA 2F0TA 2VY3A 1XPUA 4QIWB 1QNUA 1TWGH 2VZAA 4A4IA 1HNWL 1KRSA 1ILQA 1U4PA 3A8IE 3BYYB 3TP6A 1C0AA 1E0BA 3QOJA 3I90A 4ALPA 1FNWA 1ESFA 1K8AC 2LY7A 1PFBA 1CA5A 5K36G 4C3HG 1Y69U 1L1OB 2R7DA 2GVBA 5I4DA 2N88A 3ULLA 3R2IA 5JOBA 3NENA 1GUWA 2AQ3B 1O78A 2F0EA 2IX3A 3CMEA 3CCSA 5C3EB 3DWQA 1SYGA 4K6DA 1RIPA 2VQEL 4A3MB 4KHVA 4A3EG 2L0CA 3AYHB 3V2TA 3OYYA 1X3FA 5I9OA 5LMUQ 2UUBL 3Q0AA 2BA0A 5EBCA 1YNXA 2AWNA 1S5DD 3ITPA 1LV9A 2F3WA 3HOUG 5IE8A 3FKIB 2O5JC 1NMGA 3BVMA 4IFDI 4OO1H 3EBEA 1XTCD 3I73A 3UI2A 2HHHQ 2DNCA 2LMCB 3S17B 4K0KL 5FJ8H 1C7YA 3DWAA 2ZM6L 3GTOH 2EY5A 2FHTA 2WB1E 4HJ5A 3I7FA 4A3BB 1C8CA 3LNNA 3W2DA 1A3UA 4HJ9A 1QUQA 3P75A 1PFMA 3S1NH 5EQ0A 4AQYQ 3VA7A 1IBLL 2WIIB 4A3DB 5T1GA 2B2YA 1DCZA 1HZCA 2ZJRA 1V43A 5FLXc 4C3JB 3S2HH 1IHZA 4P72A 4DR2Q 1VQCA 3HRZC 3PO2B 2O4XA 1N36L 1HNXL 3H91A 1RJTA 1Q8IA 1FJGL 4A3KG 2E5LQ 2EYLA 3P20A 5D65A 3STBD 4TQUS 1MD2D 2L1BA 3CCVA 1GUGA 3DXJC 2UUCL 5C4ZA 4X3UA 4CJ1B 1GOZA 4OO1I 5E4XA 2WB1G 2B2WA 4CKCA 3K5OA 2E74C 4DR3Q 5IT9c 3IKJA 1XPOA 5M5WB 1Z47A 1A3TA 1J8IA 1IYJB 5IGEA 1B53A 3NP8A 4LF8L 3PCOB 2B2UC 4DU9A 3CRKC 2B2TC 4ZKCB 4BBSH 5D14A 5C44G 4YY3Q 2B3GA 3EROA 1ZYRC 4K5WA 5EKKA 5CC4A 2WKCA 2JA8G 3MFGA 2D5DA 2VQFL 2GN5A 1HQRD 3UDFA 5CMDA 1PYBA 2ZXPA 1H9JA 3DLLA 1RCVD 2Y0SE 2JQOA 3FDTA 1AZQA 2Z4HA 3DEPA 1EY8A 1SE2A 5LMNQ 1OXVA 4R4TA 3KLSX 1YNJC 1STBA 1PRTC 1VQ7A 1KABA 4DAYB 1PH9A 1K73C 1VQKA 1GHKA 3HOXH 1FGBD 2HQLA 1FR3A 1PRTF 4R4IA 5GAHC 4B3RL 4OONA 2XN9C 4X65Q 5CV5A 3H09A 4IN3A 5CV4A 2QGQA 2VW9A 3TP8A 4L5TA 3W5OA 3K59A 1E1TA 2MPMA 1WTPA 4DV7L 1M90C 3KLSA 1UE7A 4ZAIA 5IYBG 1TU2B 2D2CC 2ZJQA 1JWMD 4JI3Q 4R4OA 1X65A 3MXGA 1SEBD 3PO3G 1YITA 4POFA 2BE5C 4A3KB 1XJVA 2EJFC 1BBWA 2F0MA 1N32Q 1PYWD 5FK9C 2RDGA 3I4NG 4IFDJ 3HOZB 4LFAQ 3AEVA 3H94A 4IUNA 1I4HA 5DAUA 1SJHD 4DUZL 1JOKA 3JAML 2F0IA 1K9MC 1BCPB 1F9SA 4HSPA 2YYZA 5CR3A 1G51A 4I7ZC 1I4XA 1SYFA 2JA7H 2Q2HA 1WI5A 2Y0SG 4DR6L 3IRBA 1HRJA 3TRZA 5GQOA 1RDPD 1K0RA 2IT1A 3ND8A 2MJ8A 2UXCL 2J0TD 3AFPA 2JA5G 4YWLA 4HEDA 1VS0A 2KCMA 4V0BA 2WINB 3W1BA 2RCFA 4DR4Q 1A2UA 5C3XA 2EDGA 4O2DA 4OGQC 2E2IB 1HH2P 4CJ0B 1SBBB 2PPBC 1AH9A 2NB0A 4DK3C 4UY8C 1JICA 5IP9H 4ODGA 1L0XB 3C1FA 5EPJA 1F2MA 5JEAH 3KF8B 1LTLA 1X56A 1K83B 4J1MA 3E5SA 2R93H 4C3IB 1U5KA 1DJRD 1MIUA 2OTJA 4ME5A 4C56C 3JAMi 3A8KE 1I4QA 3PUWA 3J80c 4X64L 2JK8A 2JA6H 4LF7Q 4GNXA 1Y1WH 4OWTB 3IL8A 4BY7H 3PIOA 1JJGA 3I4LA 1IW7C 3RD4A 4A76A 1MGSA 3E9HA 4KD3A 3GTGH 1HNWQ 1UEAB 1B4OA 3IFDA 3K8AA 4A3GB 1QG7A 2F1MA 4PMWA 1BKBA 4WRDA 1Q46A 3N52A 3EQLC 2ID0A 2CCZA 4X62L 1CA6A 2MO0A 3ONAB 1EQRA 1RKNA 1DOMA 5EPLA 2I46A 1I3QB 2RHSB 1LACA 3N6RA 2N55A 4NPSA 1X3QA 1NMFA 2KEDA 3H6MA 1NUCA 3GTQH 3BDOA 3J81j 1FGUA 2VQEQ 1OXTA 2Y0SB 4N9TA 1FVIA 4DK6C 2E2DC 3T1YL 5IYDH 2UUBQ 1JJCB 3TBIB 3KF6A 3HOVB 4KD4A 4ZKBB 5HGQA 1P16A 2BA1A 1DZ1A 4KV6A 1SFOB 1PTOC 4PV1C 1XTDA 3A5UA 4JPBW 4K5VA 4A3JG 4C1NI 2A69D 1ENCA 4CDCC 1M1KC 1LT4D 3D4WA 1WTOA 4BBRB 2NZOA 1H95A 3PF5A 4TVAB 3K5NA 4K0KQ 2EVBA 2K5NA 1KHIA 1H9SB 3F1ZA 1LTGD 4EVOA 2ZM6Q 1FYCA 3R3OA 3GTMB 1O7IA 1Q86C 3NBHA 3M3YH 1G8ZD 1NBWA 1JC7A 2C35B 4IPGA 1PH4A 3NPPA 1TS3A 5M3FH 4RCNA 1W6JA 4YWKA 4YCWA 2MNAA 2PI2A 1SE4A 2M2LA 4DR1L 3J81L 1IBLQ 4GKKL 3S14B 2AMCB 4DN4M 1KC8C 1TWFH 4DV5L 1QUQB 4DV1L 3LWUA 1BQQT 3R93A 2P5ZX 5AJ3Q 2WP8J 2MO1A 2PZUA 1C4QA 4KLKA 1VQ4A 2R92B 2N78A 1EIFA 1XXGA 1EZ8A 4DV6L 1N36Q 1HNXQ 1C48A 2VS1A 3BZCA 5ELCA 1F9RA 1J5EQ 5FO7B 1VF5C 4RGNA 2F4VL 5K36H 4DR5L 1Y14B 1ET6A 3HZXA 1PTOB 4C3HH 5D3IB 1X55A 2UUCQ 1JT8A 4N9PA 1IKLA 1SNPA 4GOPC 1TWAB 1DD2A 3TP7A 3CXCA 1FD7D 3BYTB 5CV7A 4Y7NB 4LF9L 3A7LA 3J81i 3AB9A 3TEHB 4JI2L 2KUMA 5HGTA 1Q12A 1XYIA 4HCSA 4A3EH 1KIXA 3ERQA 3CC4A 4PQXA 4LF8Q 4JBMA 5CYUA 3JC66 3VR5A 1A6XA 1XX8A 2IHFA 2KHSA 1Y1VG 3HKZB 1I4GA 1ASYA 4JI6L 4DV0L 4A3JB 1LT5D 4BA2I 1XNRL 1F2ZA 1MJEA 3HOUH 3BZKA 2K03A 2H5XA 1X3GA 3K7UC 1D2BA 4DFAA 3E9IA 4LUVA 5LHY1 4KKSA 4HIMA 5EKLA 3I4MB 1IKMA 2A6EC 2VQFQ 1B9MA 3SR1A 2I5LX 1Q90A 2BDNA 2EYJA 1JJ2A 2Z8LA 3VR4A 4LMQD 1PMRA 4YCVA 3I55A 4IQZA 4WORA 2WV6D 5C5MA 1S5CD 1EOVA 4C2MB 1WOCA 4QJFA 1B2TA 1G291 2KCCA 1RHPA 1VDZA 1X3PA 2EY1A 5FLMG 4B3RQ 1WYDA 3ZYYX 3CCUA 2NVXH 3AQQA 1KQSA 3RZOB 2KJXA 4FF2A 5C0XG 1D1IA 3FEWX 3S15H 2N3SA 4DAYA 1CSPA 2V4DA 4DV7Q 3F2CA 3S16B 3SEBA 1EIGA 1TS5A 3H0GG 5FO9B 4IPCA 4POGA 3RZDH 1U4LA 2DN8A 1STGA 2CW0C 4LWCA 3WWVA 4PMBA 1Q1EA 1K8GA 4O42A 4R1JA 3NHHA 5IWAL 4A3KH 1R4QB 2RSOA 1TKWB 1R4PB 1UWVA 4GLAC 1MKHA 4DUZQ 2CHBD 1WTQA 2FJ2A 4MZ9A 2NVTB 1E2ZA 4FF4A 4ZUIA 1VQ9A 5GROA 4DR6Q 1NY4A 2B2UA 4DNTB 2NN6I 3CAMA 3LGJA 4CDEC 2RDFA 1EFWA 2B2TA 5FKAC 5CBAE 3CCQA 3S1RH 2K5QA 3GTPB 2UXCQ 4GLXA 4PMCA 1TQOA 1HR0W 2WAQB 3MTSA 5KNDA 5C3EG 4QY7A 1WTRA 2JE6I 5IY0A 1GVPA 2K7VA 4A3MG 3D8GA 1SR3A 1U4RA 5C44H 2B2VC 4O0AA 1YBYA 3PIP3 5C5LA 1YNND 1GHJA 2ICIA 2AUJD 3CCJA 2JA8H 2K33A 4ID6A 2PZWA 1KTKA 1DOKA 4P74A 3MXNB 3SK8A 3ULPA 4B3SQ 3M4YA 1LLRD 3FKIG 3RNUA 3HOYG 3VA5A 5M5YH 1AW7A 5BN4A 4X64Q 4Y52H 3KF8A 3M4QA 3TQYA 1QE6A 3WOFA 5C3WA 1K8OA 4F7XA 3T53B 2DJFC 3DHQA 4S3SA 1I4RA 3C46A 3OW2A 3C1EA 4GNXB 2A6HC 4NMZA 4QUCA 4PZ7A 4A3BG 1CHQD 2K05A 3ZJYC 2VNUD 3CCLA 2I07B 2B8GA 2HCCA 2MHVA 1A0IA 1B9NA 5IYBH 3U58A 3AMUA 2KHJA 2E2JB 1D1KA 3A5ZB 4A3DG 3PO3H 4FF1A 1HXYD 3GTJB 4KHZA 2OF1A 4X62Q 3PMFA 1XMQL 2MP1A 2R61A 4C3JG 1XMOQ 2RHQB 2XIWA 2YU9B 3I4NH 5T1IA 4NXML 5JAVA 3NWSA 4TKOB 3MEHA 3TS2A 1I3QH 1J9OA 3PO2G 1GUTA 4UP8A 4GKJL 3A55A 3T1YQ 5ELOA 5AFWA 3RLFA 3PUVA 1CFMA 2HDMA 3JAME 2CWAA 2QDLA 5G3LD 3TS0A 3GD7A 5D3DA 1AZPA 1UAPA 3KF6B 2JA5H 3T56B 1JB3A 1H9RA 4FDBA 2QDBA 4WJ3M 1ILPA 2E2HH 2UXDL 4CKEA 2F52A 1SNMA 1B3AA 1XNQL 4L8JA 5KRUA 1TWHH 3GDEA 1MJCA 3CQZB 4B9WA 3TN2A 1B44D 1Q82C 1EU3A 3K5LA 1GXDC 3K80C 4FYDA 1E1OA 2YV5A 1VQPA 3CPFA 3J7AF 1SYBA 3D3RA 3HOYB 1U0LA 2C9OA 4LF6L 4UPAA 5GAEC 3K6OA 1H9SA 3L3OC 1M8AA 1CZWA 3NBHB 4KKUA 4GKKQ 1X3EA 3DWPA 1O7YA 4DV5Q 4DV1Q 4KTAA 3QB3A 3S14H 4HIOA 2HDLA 4KY6A 1VCIA 2DY8A 4L63B 3CF5A 1CTMA 3VR6A 1YHAA 1WTWA 1VMPA 2EYPA 5CV6A 2F0VA 4KMUC 4XQJA 2QCPX 5DM73 2IL8A 1BDOA 1PV4A 1AEXA 4RFBA 1IBML 2M00A 2IX0A 1G6PA 3DM1A 2F4VQ 4DV2L 2DJGC 2WKDA 1Z6HA 4KKTA 4DR5Q 4IALA 1CSQA 3PGZA 1SMYC 1RTOA 2IX1A 2L9HA 2NZHA 2NTSA 4LF9Q 4GZYC 1MI2A 4JI2Q 3M4OB 4Y7NH 5DM63 1HNZL 2EYFA 2XRSD 3T13A 3HGBA 2AUKA 2HUGA 3HOZG 5IODA 4JI6Q 1GUSA 1T9HA 1JE5A 4DV0Q 1XNRQ 4H13C 3NK9A 4A3JH 4FXGC 1PFNA 2NWGA 2H1EA 2K5WA 3MFYA 4TSSA 4F88A 2G5DA 2UUAL 3D4RA 3F2UA 4YWMA 5TSSA 3VR2A 2EIFA 3K57A 5EAYA 1HZBA 1PDQA 2RDHA 2NZ1D 4GN5A 3CCEA 1NSNS 3K7AB 2G9DA 1BR9A 3G7LA 1T5XD 1D5XC 1I94Q 1AN8A 2L12A 3KJPA 3GTKB 1LTAD 3K0YA 1WVLA 4L5SA 3RZOH 4CHTB 4C3IG 3J81E 4A3IB 4XYQA 4NB3A 3GV6A 2CQAA 1TIID 5A2QL 2RVLA 1WCMG 5JJZA 3D4DA 5IWAQ 5C4XG 3VR3A 5C4JB 1K3RA 2BOSA 3SGIA 2A68D 4GOPA 2NVQH 2XWJB 1LT6D 1S5ED 4LJZC 2Z6KC 3T51B 4G7OC 3NXWA 3D0FA 1PZID 3RUZA 3ICEA 1KXLA 3QIAA 4DKAC 2F0SA 4A3GG 2ES2A 2BDOA 1K8MA 4GLVB 4WJ4A 1TWCB 4TRDA 4A93B 4X3TA 1S5BD 1WD1A 3FRPB 3NWTA 5NUCA 4IFDG 1BBUA 1IYVA 3TREA 4KJOA 1Y1VH 4UP9A 3OOCA 3IAYA 2HQEA 2E76C 2LFNA 4IUQA 5CORA 2ZXOA 1OXUA 4X3KA 3GQBA 3KJOA 1NJIC 1WTHA 4DXGA 1R9TB 2M9VA 3C3LA 4QQBX 1E2WA 3HOVG 3R8BA 4CBVA 2PZTA 3GTLH 5CGKA 1WJJA 4JYAL 2DNEA 2EJGC 4KN4C 1BOSA 1VQEA 3RN2A 3LX0A 5M3MB 1ICWA 1PRTB 4BBRG 2EE1A 3J7AV 2LKVA 3MXNA 5G3LF 2EOTA 4JI1L 3KLWA 5IGGA 1PA6A 4PZ8A 4OHJA 1F9PA 2BH8A 2QKIC 3A54A 5FLMH 1N34L 1D6EC 1HQMC 4OWXB 5C0XH 4IOCA 2PW7A 3HOWB 3I70A 3OWFA 1KAAA 2Q2IA 3SVMA 4JI7Q 3HKZE 1S40A 3H0GH 1STHA 1ONLA 1IBKL 2K5VA 1WCMB 2VXWA 4OELB 2E2JH 4OL7A 5C4XB 1XMQQ 1GD7A 2NVYH 3MHBA 4YCUA 1Q7YC 3L9AX 4NXMQ 2K5HA 2KA7A 2EYHA 3G6EA 2R92G 1RTNA 5IGDA 3VDYA 1VQOA 4GKJQ 1LABA 2GA4B 5M9OA 1YI2A 4RHSA 4LK1C 1SLJA 4BY1B 1N33L 4QGUA 4F87A 2A74C 4RKBA 1PH7A 3OPOA 4IPDA 1GKHA 2B2VA 2WACA 2QA4A 2UXDQ 2RKSA 4DNRB 5C3EH 3FVQA 1SYCA 3S1MB 1XNQQ 1GUNA 1QCBD 3MWYW 1VQAA 5LMNW 4A3MH 1PH3A 3PF4A 1I50B 3CQZH 1VQ6A 2C5CA 1SMXA 1PYSB 3HKZG 2R7FA 2JA9A 5I9PA 2Q2TA 4QMGA 5C0XI 3STBC 1QZGA 5DEHA 1RODA 4LF6Q 3UDIA 3FKIH 3HOYH 2D0OA 4XT3B 5I6YA 2Q8TA 5FO8B 1OXSC 1JB7A 3I3CA 3I4MG 3CKIB 3E0EA 1PHJA 4DF7A 3M7NA 3S17H 1OXXK 4DR7L 1Y8OB 4HAEA 5K5PA 3K5MA 1BO0A 1DYQA 4YIJA 1SYDA 1AFPA 2RA4A 1EEFD 4UDUC 4A3BH 1EY0A 3I72A 1IYUA 1EYDA 1D5ZC 2F0DA 2WAQE 1IBMQ 3CRLC 4A3DH 3Q22A 4DV2Q 3BS1A 1TXYA 4J15A 3NTHA 4DPGA 4M8AA 1MSHA 1EWHA 2X6GA 2F3VA 5FLXL 1CQVA 2XRQD 4RMFA 4C3JH 4F8MA 2EY2A 1KDBA 4IPHA 1STNA 3CC2A 3U9SA 2FMMA 3X3MA 1FJGQ 3PO2H 4FNFA 3PUYA 5IGCA 2FFKB 1F9QA 3GTOB 3G4SA 1HNZQ 2PYKA 5CV8A 1H9KA 4L5RC 4YHHL 1U9RA 4RKLA 1GO3E 3MVVA 2HIVA 2CWPA 4R4CA 3CMAA 3S1NB 1IL8A 4PG3A 2A68C 1CT1D 2EXDA 4XYOA 1D5MC 5EGTA 5JJKA 2N8NA 4NP5A 1GJXA 3S2HB 1EYAA 3QR8A 5IT9L 1UE6A 2TMPA 4FXDA 5M5WH 1ENFA 4OIJA 3GO5A 1NCVA 2PNRC 2CKZB 2WAQG 1EYCA 1EWIA 4H44C 2UUAQ 1X32A 1X9NA 2PNHA 3VYUA 1E7ZA 4GS3A 2L5TA 1EY6A 1WTXA 1EFID 1YEZA 3UDGA 1SNDA 1KAWA 1Q3LA 3BJUA 1PH5A 2PQEA 4HN7A 1A15A 3EFXD 2F0HA 4JBJA 1I6HB 1KD1C 2F0OA 3D31A 2MQHA 4LUZA 5EPKA 4ABNA 1JE4A 5BN3A 1KLUD 5GAGC 2CFMA 2EYMA 3SK5A 4MTNA 2RF4A 3I4OA 3HEJA 1YHQA 3GTKH 1ZKOA 5EKIA 3KLRA 1B7YB 1STAA 1U4MA 5ELFA 4M1UB 2ZTDA 2RQXA 4X6AH 3ND9A 2HIXA 4G57A 4JVZA 1BXTA 1LO5D 1G2TA 1SNCA 1VMCA 5EJWA 3FMCA 1JWSD 4EQOA 4BBSB 2Z4IA 4RGOS 4UP7A 2RBMA 1TS2A 3TZUA 1EUJA 2CH4W 1VQGA 4PNYA 1T5EA 2K04A 5KGUA 1EQQA 2A73B 1SAPA 2EYOA 3F2DA 4GOPB 5C6AA 2BCOA 1NNXA 3K58A 2L11A 5JEAJ 4KHPL 3M9BA 5KNBA 2B8FA 4MIUA 2B39A 2IW3A 4FO2A 5BR8L 2ZT9C 3SHLA 1HUMA 3OMCA 4LFBL 2DY7A 1K28A 2J4XA 2NYZD 4K8JA 4HCEA 3HOZH 1QJOA 1AP0A 2PI2E 2X69A 4HIKA 1W2BA 2I0QA 4GN4B 3HOXB 4A3FG 3K0XA 1JOOA 3A8JE 1RF2D 3J7YW 1OTCA 4XIGS 1LUZA 1YJWA 4K2LA 1Z9FA 1UEBA 3HP3A 3I91A 1B1ZA 5IOCA 4X65L 1R9TH 1FL0A 1JR0D 3DUZA 2OWOA 5I2YA 1V9PA 3Q6SA 3U50C 2Z6BA 4X66L 3SE0A 2OQ0A 1WFQA 4DAVA 2EQSA 2UU9L 1W6KA 5JVH3 1SNOA 3EIVA 2E2IH 3VYTA 3E0JA 4N8X1 4JI1Q 4IZ8A 3I2ZA 3GP7A 1BCPD 4HJ7A 4C1NK 2TSSA 4KI0A 3JAMc 1N34Q 5ELDA 1ZYRD 1K83H 1X6OA 4DAPA 2JA7B 4QF4A 4K6LA 3KBGA 2I5HA 1BUVT 2GVAA 3HG9A 2A19A 1A8VA 4C3IH 3LWEA 2AKWB 5IGFA 4G7ZC 4G7HC 1L2FA 4L6TB 2L4NA 1KDAA 3J80L 2A69C 1IBKQ 3KBXA 3MXPA 1L1OC 3S1QB 4B3TL 5ELBA 1WCMH 2Z6KA 1ET9A 2N49A 1HTPA 1YNJD 1STYA 5JPNC 5C4XH 2VUMG 2B63G 2XTIA 4DR4L 3E6ZX 4JBWA 4BWGB 3BZDB 4KY5A 5A2QE 1EY5A 4ZYSA 4RA8A 5C4HA 4WFN3 4MNOA 3W1GA 1IZ6A 4HR7B 4A3GH 1PH8A 3A56A 3OIQA 1N33Q 2R93B 4Q5VA 1ML0D 5A35A 4JOIC 5J3BA 3S2DB 4JK1C 1AE2A 4HJ8A 1QWYA 2BE5D 4CJ2C 3DMUA 2JA6B 5IP7G 2F0UA 4IFDH 4HTHA 3S9WA 1K3BC 3NTIA 4ME3A 5ISRA 4A3FB 4U68A 4BY7B 1EEID 2JEBI 4DK1A 4RGTA 3PUZA 1HZAA 4JI4L 3Q23A 2MGSA 1CM9A 2F0NA 1HCZA 2ALYB 1TS4A 2OTLA 2YTXA 4ZLTF 3HS0C 3HOVH 3OWEB 1I50H 1SFOH 4IJLA 2IPKD 3NELA 4FXKC 2XSCA 1G91A 2CVRA 2K4KA 3KOJA 4DV4L 1YIJA 3WOEA 4RH6A 2Z9HA 4XTCS 2F03A 3NE5B 2NBFA 2I5MX 3T16A 3KYHC 1V1QA 1JMCA 1EOTA 2RCNA 4UAIA 3FPPA 4BBRH 2AWOA 2YTYA 4IUUA 1ASZA 4J8QA 4DR7Q 4G4KA 2O2LD 3GTQB 2OQKA 1RD9D 3GTMH 3F2BA 3RMHA 1IXRA 3EN2A 2SOBA 4DR1Q 1KLGD 3AU7A 1N9WA 4ZK9B 1TY0A 2ATWA 1O7ZA 4O1NA 2K5DA 3RR5A 4R4QA 4BA1I 3ER0A 3CCRA 3PIPA 1XPRA 3KDFB 3MC0B 5IIFA 1HFGA 5IYCG 1S4ZA 3K81C 4DXFA 3KUPA 2FXQA 2VUMB 2B63B 5KYLA 1HPCA 4XQNA 4BXXG 4HMJA 5H1SE 4A3IG 4H02A 4XXEA 4DV6Q 5M5XB 2L55A 2KECA 1CKNB 2R92H 2D62A 2NN6G 4XQQA 1CZGA 1IW7D 1Y8PB 2K28A 4IUPA 1CI3M 1HTLD 3DEOA 1UNSA 3TZDA 4AYBB 4DUYL 3NUCA 3M3YB 4GN3B 4YHHQ 2PMZB 1S3OA 5M3FB 1PTOH 4I65A 4AH6A 4A3LG 3J81c 1UE5A 2F3IA 3FP9A 3P1HA 2HD3A 2R3ZA 1TWFB 3NQTA 5E4WC 1HR0L 1SROA 1TWAH 2K50A 1E24A 3CHBD 2FINB 4LF5L 1HZ9A 3OSOA 1STEA 3PV0A 3M85A 4IJHA 4A93G 1Q8KA 5AJ3L 3MAQA 2F0WA 3VYRA 4JI8L 4EX5A 4CKBA 2H4OA 4QCLA 1KNAA 1LTSD 3EJIA 1A63A 3I8ZA 4MN3A 1NE3A 1PTOD 1PH2A 1MBYA 4MHEA 3Q8DA 2ENBA 1J5EL 4C3HB 3W3AA 2QEXA 3I4MH 1I6HH 5IGBA 2QF7A 2HCIA 3KK7A 4KJNA 4IO9A 1F2LA 4P71A 2ZXRA 1BVSA 3HFZB 5M3MG 4A3EB 4JV5L 1JORA 1VQJA 1LTBD 3M4PA 5DLQE 3ULJA 1PLFA 4C2MH 3T1HL 1V8QA 4EQ5A 1E2VA 1GM5A 3M7GA 4OIKA 2F0LA 1YNNC 3KFUA 1VQMA 3HOUB 2AQ1B 5E7NA 2D9UA 1BCPC 1X54A 2FMCA 3HOWG 1LTRD 4RHRA 3S16H 5CBEE 5FOBB 3OTOL 4KHPQ 1A3VA 2IJ0A 4DNIA 1BCPF 3PIO3 1F77A 5BR8Q 2KCNA 3QO2A 4PZ6A 5FLXE 1JCKB 2WFWA 4LFBQ 3MZ5A 2YTVA 4KN7C 3C2PA 2VB3X 2A5HA 2Q8IB 2JSOA 4L5QA
chains in the Genus database with same CATH topology
2O5IC 2JP1A 1V1PA 1EL0A 2NVXB 3P7JA 1SXTA 1EWCA 1S5FD 3EA6A 3S15B 1Q1BA 1BNZA 1UUPA 4NDXA 1WD0A 3RZDB 3SXHA 3WDNA 5IT9E 4RAUC 1A2TA 3D6CA 4CGYB 3Q24A 2XVSA 4K8IA 1LTTD 4ZUJA 4DK0A 1DOLA 1NR2A 2J7ZA 1DXMA 1G2SA 1HHVA 1GUOA 2A6ED 2WB1B 2KQ3A 1SSOA 1O7LA 1ZXTA 1HFNA 2OT2A 3S1RB 3TSSA 3TMEA 1Z7TA 3G6JB 2RSNA 1ENAA 3NSWA 3T4AC 1SJED 1FNUA 1SNQA 1TY2A 2F0FA 5C44B 4E6IA 3IFTA 4EQNA 1O80A 2G9HD 4H7BA 2JA8B 1I6VC 1PXUA 2JXMB 5M5YB 4OO1G 1SDFA 3O13A 4LAAA 5CV9A 2CW0D 2PO4A 4X3SA 2KVMA 1KNEA 2R7ZB 5F2DA 2PW5A 3NQIA 2K6AA 3PO3B 1BBXC 1CHPD 1DM0B 4K14A 1JOQA 3OW7A 2SNMA 5KEEA 3QWNA 5KIXA 3I4NB 2NUCA 5JPMC 2B2YC 1TWGB 2IWHA 1L0YB 3MA2B 5DNFA 2EPBA 1QILA 4RCOA 1JWUD 4RWSC 1TVXA 3OHXC 1HA5A 2Q8RE 1NAPA 4WJWA 1VF7A 5J22A 1II3A 3A7AB 1JQYD 2JA5B 3BDLA 1FNVA 2E2HB 1EZ6A 4U673 1PTOF 3J80E 1TT2A 1TWHB 3OMGA 4FF3A 2A6HD 4IUTA 1OO9B 2XNAC 5E1FA 2B2WC 4DA2A 1H9MA 4J6HA 4IUVA 4BS9A 1QNKA 3L7ZC 1EQVA 4R8NA 1EU4A 2KOLA 5KNCA 5HURA 4ILWA 3V96A 4HSVA 2F0GA 1G6ZA 5LL6S 1I4PA 1M4VA 1HA6A 1EQTA 2K32A 2OEOA 4K5XA 4NKLA 5J1ZA 4QB4A 1EY4A 1F2YA 1SYEA 3EVQA 4Z9CB 2F0JA 2QILA 2EJMA 1V1OA 3BVZA 1QB5D 4EGVA 5I2XA 1EY7A 1DONA 1LT3D 1EY9A 3BVGA 5ELEA 5EBDA 4NW2A 5J39A 3QG1A 2K1BA 4ZRZA 4QUFA 4IURA 2MUYA 4KY7A 2EZVA 4RGMA 4P2CB 2JEAI 2PCFB 4DGZA 1NR4A 2NN6H 1HUNA 1PZJD 3PUXA 2ICEC 3SDZA 2F0PA 2VB2X 2JYOA 1CQFA 5BN5A 2OXPA 2LS01 4ZQ3A 2EY6A 1QOHA 4B9XA 2SEBD 3BG3A 5COYA 4HMIA 5JEAG 1SMYD 5C0XJ 1ZEQX 1V1PB 2EXZA 2XWBB 2R6GA 4B08A 3CU7A 4R9WA 1Y8NB 2X6LA 4FP5D 1LTID 3QJYA 5I6WA 4Q0FA 3SK6A 4XT1B 2NVQB 2Z1CA 3NBIA 4ULLA 4KK7A 3URYA 4XDXA 1TR5A 3OIPA 3V05A 1EIHA 2F0KA 4H0LC 1CK1A 5E3FA 3MXUA 1Y1VB 2NTTA 3SK4A 3TP5A 5KYIA 2KEEA 1B50A 3GV3A 3GTLB 1ESRA 2AQ2B 1PZKD 2SNSA 3D6WA 3FPUB 1PRTD 2QEJC 3BDCA 3TDQA 1WTVA 5LL6X 5JVG3 1MSGA 3R2TA 1BF4A 4FVMA 3QOLA 4K2KA 4EQPA 3H3VC 3X3NA 1KDCA 1XWEA 3NTKA 2SDFA 3H0GB 1Y1WB 3U9OA 3VYSA 4R8IA 2NVYB 4V190 2E75C 2K01A 3GTGB 2F0QA 1SE3A 2F4IA 2F0TA 4QIWB 1QNUA 1ILQA 1U4PA 3A8IE 3BYYB 3TP6A 1E0BA 3QOJA 3I90A 1FNWA 1ESFA 5K36G 2LY7A 1PFBA 1CA5A 4C3HG 1Y69U 5I4DA 2N88A 3R2IA 5JOBA 1GUWA 2AQ3B 1O78A 2F0EA 2IX3A 5C3EB 3DWQA 1SYGA 4K6DA 4A3MB 4KHVA 2L0CA 3V2TA 5I9OA 3Q0AA 2BA0A 5EBCA 2AWNA 1S5DD 3ITPA 1LV9A 2F3WA 3FKIB 2O5JC 4IFDI 3BVMA 4OO1H 1XTCD 3I73A 3UI2A 2DNCA 2LMCB 3S17B 3DWAA 2EY5A 2FHTA 4A3BB 1C8CA 3LNNA 3W2DA 1A3UA 3P75A 1PFMA 5EQ0A 3VA7A 2WIIB 4A3DB 5T1GA 2B2YA 1DCZA 1V43A 4C3JB 1IHZA 3HRZC 3PO2B 2O4XA 3H91A 1RJTA 1Q8IA 2EYLA 3P20A 5D65A 4TQUS 1MD2D 2L1BA 1GUGA 3DXJC 5C4ZA 4X3UA 4CJ1B 1GOZA 4OO1I 5E4XA 2B2WA 4CKCA 3K5OA 2E74C 3IKJA 5M5WB 1Z47A 1A3TA 1J8IA 5IGEA 1B53A 3NP8A 2B2UC 4DU9A 3CRKC 2B2TC 4ZKCB 5D14A 3EROA 1ZYRC 4K5WA 5EKKA 5CC4A 2WKCA 3MFGA 2D5DA 1HQRD 5CMDA 2ZXPA 1H9JA 1RCVD 3FDTA 1AZQA 2Z4HA 3DEPA 1EY8A 1SE2A 1OXVA 3KLSX 1YNJC 1STBA 1PRTC 1KABA 1GHKA 1FGBD 1FR3A 1PRTF 2XN9C 5CV5A 3H09A 4IN3A 5CV4A 3TP8A 3K59A 1WTPA 2MPMA 3KLSA 4ZAIA 1TU2B 2D2CC 1JWMD 3MXGA 1SEBD 2BE5C 4A3KB 2EJFC 2F0MA 1PYWD 5FK9C 2RDGA 4IFDJ 3HOZB 3H94A 4IUNA 1I4HA 5DAUA 1SJHD 1JOKA 3JAML 2F0IA 1BCPB 1F9SA 4HSPA 2YYZA 5CR3A 4I7ZC 1I4XA 1SYFA 1HRJA 1RDPD 2IT1A 3ND8A 2MJ8A 2J0TD 4HEDA 4V0BA 2WINB 1A2UA 5C3XA 2EDGA 4OGQC 2E2IB 4CJ0B 1SBBB 2PPBC 2NB0A 1JICA 4ODGA 1L0XB 3C1FA 5EPJA 1F2MA 5JEAH 1K83B 4J1MA 3E5SA 4C3IB 1DJRD 4ME5A 4C56C 3A8KE 1I4QA 3PUWA 3IL8A 3I4LA 1IW7C 3RD4A 1MGSA 4KD3A 1UEAB 1B4OA 3IFDA 4A3GB 1QG7A 2F1MA 4PMWA 4WRDA 3N52A 3EQLC 2ID0A 1CA6A 3ONAB 1RKNA 1DOMA 5EPLA 2I46A 1I3QB 1LACA 3N6RA 2N55A 1X3QA 2KEDA 3H6MA 1NUCA 3BDOA 1OXTA 2Y0SB 4N9TA 2E2DC 3TBIB 3HOVB 4KD4A 4ZKBB 2BA1A 1DZ1A 4KV6A 1SFOB 1PTOC 4PV1C 4K5VA 4C1NI 2A69D 1ENCA 1LT4D 3D4WA 1WTOA 4BBRB 3K5NA 2EVBA 1H9SB 4EVOA 1LTGD 1FYCA 3R3OA 3GTMB 3NBHA 1G8ZD 1JC7A 3NPPA 1TS3A 4RCNA 1W6JA 1SE4A 2M2LA 3J81L 3S14B 4DN4M 3LWUA 1BQQT 3R93A 2WP8J 2PZUA 1C4QA 2R92B 1XXGA 1EZ8A 1C48A 5ELCA 1F9RA 5FO7B 1VF5C 4RGNA 5K36H 1ET6A 3HZXA 1PTOB 5D3IB 4N9PA 1IKLA 1SNPA 1TWAB 1DD2A 3TP7A 1FD7D 3BYTB 5CV7A 4Y7NB 3A7LA 3AB9A 2KUMA 5HGTA 1Q12A 1XYIA 4HCSA 3ERQA 4PQXA 5CYUA 3VR5A 1A6XA 1XX8A 2KHSA 3HKZB 1I4GA 4A3JB 1LT5D 4BA2I 1F2ZA 2K03A 1D2BA 4DFAA 5LHY1 4KKSA 5EKLA 3I4MB 1IKMA 2A6EC 1B9MA 3SR1A 1Q90A 2BDNA 2EYJA 2Z8LA 3VR4A 4LMQD 1PMRA 4IQZA 4WORA 2WV6D 5C5MA 1S5CD 4C2MB 1B2TA 1G291 2KCCA 1RHPA 1VDZA 1X3PA 2EY1A 3ZYYX 3RZOB 2KJXA 4FF2A 5C0XG 1D1IA 3FEWX 4DAYA 2V4DA 3S16B 3SEBA 1EIGA 1TS5A 5FO9B 1U4LA 2DN8A 1STGA 2CW0C 4PMBA 1Q1EA 4O42A 3NHHA 1R4QB 2RSOA 1TKWB 1R4PB 2CHBD 1WTQA 2FJ2A 2NVTB 1E2ZA 4FF4A 4ZUIA 2B2UA 4DNTB 2NN6I 2RDFA 2B2TA 5FKAC 5CBAE 3GTPB 2K5QA 4PMCA 1TQOA 2WAQB 3MTSA 5KNDA 1WTRA 2JE6I 2K7VA 3D8GA 1U4RA 2B2VC 3PIP3 5C5LA 1YNND 1GHJA 2ICIA 2AUJD 2K33A 4ID6A 2PZWA 1KTKA 1DOKA 3SK8A 3M4YA 1LLRD 3VA5A 1AW7A 5BN4A 3KF8A 1QE6A 3WOFA 5C3WA 1K8OA 4F7XA 3T53B 3DHQA 3C46A 4S3SA 1I4RA 3C1EA 2A6HC 4NMZA 4QUCA 1CHQD 2K05A 2VNUD 2I07B 2B8GA 2HCCA 2MHVA 1B9NA 3AMUA 2E2JB 1D1KA 4FF1A 1HXYD 3GTJB 4KHZA 2OF1A 3PMFA 2MP1A 2R61A 4C3JG 2XIWA 2YU9B 5T1IA 5JAVA 3NWSA 4TKOB 3MEHA 1J9OA 1GUTA 3A55A 5AFWA 3RLFA 3PUVA 1CFMA 2HDMA 3JAME 5G3LD 3GD7A 5D3DA 1AZPA 1UAPA 3T56B 1JB3A 1H9RA 2QDBA 1ILPA 4CKEA 1SNMA 1B3AA 4L8JA 5KRUA 3CQZB 4B9WA 3TN2A 1B44D 1EU3A 3K5LA 1GXDC 4FYDA 3J7AF 1SYBA 3D3RA 3HOYB 2C9OA 3K6OA 1H9SA 3L3OC 1M8AA 1CZWA 4KKUA 3DWPA 1O7YA 4KTAA 3QB3A 2HDLA 4KY6A 1VCIA 2DY8A 4L63B 1CTMA 3VR6A 1WTWA 1VMPA 2EYPA 5CV6A 2F0VA 4KMUC 4XQJA 2QCPX 5DM73 2IL8A 1BDOA 1AEXA 4RFBA 2M00A 2IX0A 3DM1A 2WKDA 1Z6HA 4KKTA 4IALA 1SMYC 1RTOA 2IX1A 2L9HA 2NTSA 4GZYC 1MI2A 3M4OB 5DM63 2EYFA 2XRSD 3T13A 3HGBA 2AUKA 2HUGA 5IODA 1GUSA 4H13C 3NK9A 4FXGC 1PFNA 2NWGA 2H1EA 2K5WA 3MFYA 4TSSA 4F88A 3D4RA 3F2UA 5TSSA 3VR2A 3K57A 1PDQA 2RDHA 2NZ1D 1NSNS 3K7AB 2G9DA 1BR9A 3G7LA 1T5XD 1D5XC 1AN8A 2L12A 3GTKB 1LTAD 3K0YA 1WVLA 4CHTB 4C3IG 3J81E 4A3IB 4XYQA 3GV6A 2CQAA 1TIID 5A2QL 2RVLA 5JJZA 3D4DA 3VR3A 5C4JB 2BOSA 2A68D 2XWJB 1LT6D 1S5ED 4LJZC 3T51B 4G7OC 3NXWA 1PZID 3RUZA 3QIAA 2F0SA 2BDOA 1K8MA 1TWCB 4TRDA 4A93B 4X3TA 1S5BD 1WD1A 3FRPB 3NWTA 5NUCA 4IFDG 1IYVA 4KJOA 3OOCA 3IAYA 2HQEA 2E76C 2LFNA 4IUQA 5CORA 2ZXOA 1OXUA 4X3KA 3GQBA 4DXGA 1R9TB 2M9VA 3C3LA 1E2WA 3R8BA 4CBVA 2PZTA 5CGKA 2DNEA 2EJGC 4KN4C 1BOSA 3LX0A 5M3MB 1ICWA 1PRTB 2EE1A 3J7AV 2LKVA 3MXNA 5G3LF 2EOTA 5IGGA 4OHJA 1F9PA 2QKIC 3A54A 1D6EC 1HQMC 5C0XH 2PW7A 3HOWB 3I70A 3OWFA 1KAAA 3SVMA 1STHA 1ONLA 2VXWA 1WCMB 4OL7A 5C4XB 3MHBA 3L9AX 2KA7A 2EYHA 1RTNA 5IGDA 1LABA 2GA4B 5M9OA 4RHSA 4LK1C 4BY1B 4F87A 2A74C 4RKBA 3OPOA 2B2VA 2WACA 2RKSA 4DNRB 3FVQA 1SYCA 3S1MB 1GUNA 1QCBD 3MWYW 1I50B 2C5CA 5I9PA 4QMGA 5C0XI 5DEHA 1RODA 4XT3B 5I6YA 2Q8TA 5FO8B 1OXSC 3I3CA 3CKIB 4DF7A 3M7NA 1OXXK 1Y8OB 4HAEA 5K5PA 3K5MA 1BO0A 1DYQA 4YIJA 1SYDA 1AFPA 2RA4A 1EEFD 4UDUC 1EY0A 3I72A 1IYUA 1EYDA 1D5ZC 2F0DA 3CRLC 3Q22A 3BS1A 3NTHA 4M8AA 1MSHA 1EWHA 2X6GA 2F3VA 5FLXL 1CQVA 2XRQD 4F8MA 2EY2A 1KDBA 1STNA 3U9SA 2FMMA 3X3MA 4FNFA 3PUYA 5IGCA 2FFKB 1F9QA 3GTOB 2PYKA 5CV8A 1H9KA 1U9RA 4RKLA 3MVVA 3S1NB 1IL8A 2A68C 1CT1D 4XYOA 1D5MC 5EGTA 4NP5A 1GJXA 3S2HB 1EYAA 5IT9L 2TMPA 4FXDA 1ENFA 4OIJA 3GO5A 1NCVA 2PNRC 4H44C 1EYCA 1X32A 3VYUA 2L5TA 1EY6A 1WTXA 1EFID 1SNDA 1Q3LA 2PQEA 4HN7A 1A15A 3EFXD 2F0HA 1I6HB 2F0OA 3D31A 5EPKA 4ABNA 1JE4A 5BN3A 1KLUD 2EYMA 3SK5A 3HEJA 1ZKOA 5EKIA 3KLRA 1STAA 1U4MA 5ELFA 4M1UB 2RQXA 3ND9A 4G57A 1BXTA 1LO5D 1G2TA 1SNCA 1VMCA 5EJWA 3FMCA 1JWSD 4EQOA 4BBSB 2Z4IA 4RGOS 2RBMA 1TS2A 3TZUA 4PNYA 1T5EA 2K04A 5KGUA 2A73B 1SAPA 2EYOA 5C6AA 2BCOA 3K58A 2L11A 5JEAJ 5KNBA 2B8FA 4MIUA 2B39A 2IW3A 4FO2A 2ZT9C 3SHLA 1HUMA 3OMCA 2DY7A 2J4XA 2NYZD 4K8JA 4HCEA 1QJOA 1AP0A 2X69A 3HOXB 1JOOA 3A8JE 1RF2D 3J7YW 4XIGS 4K2LA 3HP3A 3I91A 1B1ZA 5IOCA 1JR0D 3DUZA 5I2YA 3Q6SA 3SE0A 4DAVA 1W6KA 5JVH3 1SNOA 3VYTA 3E0JA 4IZ8A 3GP7A 1BCPD 4C1NK 2TSSA 4KI0A 5ELDA 1ZYRD 4DAPA 2JA7B 4QF4A 4K6LA 3HG9A 3KBGA 1BUVT 3LWEA 5IGFA 4G7ZC 4G7HC 4L6TB 2L4NA 1KDAA 3J80L 2A69C 3KBXA 3MXPA 3S1QB 5ELBA 1ET9A 1HTPA 1YNJD 1STYA 5JPNC 3E6ZX 4JBWA 4BWGB 3BZDB 4KY5A 5A2QE 1EY5A 4ZYSA 4RA8A 5C4HA 4WFN3 4HR7B 3A56A 3OIQA 2R93B 4Q5VA 1ML0D 5A35A 3S2DB 4JK1C 1QWYA 2BE5D 4CJ2C 3DMUA 2JA6B 2F0UA 4IFDH 4HTHA 3S9WA 3NTIA 5ISRA 4A3FB 4U68A 4BY7B 1EEID 4DK1A 2JEBI 4RGTA 3PUZA 3Q23A 2MGSA 1CM9A 2F0NA 1HCZA 1TS4A 4ZLTF 3HS0C 3OWEB 2IPKD 4FXKC 2XSCA 1G91A 2CVRA 3WOEA 4RH6A 2F03A 4XTCS 3NE5B 2NBFA 3T16A 1EOTA 4UAIA 3FPPA 2AWOA 4IUUA 4J8QA 4G4KA 2O2LD 3GTQB 1RD9D 3RMHA 2SOBA 1KLGD 3AU7A 4ZK9B 1TY0A 1O7ZA 4O1NA 2K5DA 4BA1I 3MC0B 5IIFA 1HFGA 1S4ZA 4DXFA 3KUPA 2VUMB 2B63B 5KYLA 1HPCA 4XQNA 4HMJA 4XXEA 5M5XB 2L55A 2KECA 2D62A 2NN6G 4XQQA 1CZGA 1IW7D 1Y8PB 2K28A 4IUPA 1CI3M 1HTLD 3DEOA 1UNSA 3TZDA 4AYBB 3NUCA 3M3YB 2PMZB 5M3FB 1PTOH 4I65A 3P1HA 2R3ZA 1TWFB 3NQTA 5E4WC 3CHBD 2FINB 3OSOA 1STEA 3PV0A 3M85A 3MAQA 2F0WA 3VYRA 4CKBA 2H4OA 4QCLA 1KNAA 1LTSD 3EJIA 3I8ZA 4MN3A 1PTOD 1MBYA 4MHEA 2ENBA 4C3HB 3W3AA 5IGBA 2QF7A 2HCIA 3KK7A 4KJNA 1F2LA 2ZXRA 4A3EB 1JORA 1LTBD 1PLFA 1V8QA 1E2VA 3M7GA 4OIKA 2F0LA 1YNNC 3HOUB 2AQ1B 2D9UA 1BCPC 2FMCA 1LTRD 4RHRA 5FOBB 5CBEE 1A3VA 2IJ0A 1BCPF 3PIO3 1F77A 2KCNA 3QO2A 5FLXE 1JCKB 3MZ5A 4KN7C 3C2PA 2VB3X 2A5HA 2Q8IB 2JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKI A;  2HUG A;  3DEO A;  1J9O A;  1U4L A;  2JP1 A;  4XT3 B;  5D14 A;  2Q8T A;  3TZD A;  1U4M A;  3R93 A;  1EL0 A;  3P7J A;  3I3C A;  4O42 A;  1BBX C;  1DON A;  2RSO A;  4RA8 A;  5AFW A;  1G2T A;  1LV9 A;  1VMC A;  4HAE A;  1PFN A;  1BO0 A;  5EJW A;  1BNZ A;  2HDM A;  1WTQ A;  4NW2 A;  2NWG A;  2KEE A;  1ICW A;  2B2Y C;  2FJ2 A;  2H1E A;  2R3Z A;  2RA4 A;  3IL8 A;  2EE1 A;  5E4W C;  1WD0 A;  1AZP A;  1B50 A;  1ML0 D;  2K1B A;  3FDT A;  2EOT A;  1F9R A;  3GV3 A;  3UI2 A;  4QUF A;  2FIN B;  3DEP A;  5DNF A;  1MGS A;  1AZQ A;  2EPB A;  2K04 A;  1ILP A;  1SAP A;  4IUR A;  4RAU C;  3F2U A;  1F9P A;  2B2U A;  1ESR A;  4CJ2 C;  3D6W A;  4RWS C;  2L11 A;  1B3A A;  1TVX A;  3FPU B;  4ZAI A;  2B2T A;  5CBA E;  1B4O A;  2Q8R E;  3IFD A;  1IKL A;  1NAP A;  1KNA A;  2FHT A;  3TN2 A;  1PDQ A;  1DOL A;  4U68 A;  2NZ1 D;  1MSH A;  3I8Z A;  2X6G A;  1NR4 A;  1QG7 A;  1WTV A;  1C8C A;  4MN3 A;  1HUM A;  1NR2 A;  1HUN A;  2DY7 A;  2J7Z A;  3G7L A;  3MTS A;  3SVM A;  3N52 A;  1G2S A;  1HHV A;  1MSG A;  2MGS A;  1WTR A;  1BF4 A;  1CM9 A;  2MPM A;  1WTP A;  2NYZ D;  1CA6 A;  2L12 A;  2KUM A;  3ONA B;  1XYI A;  1PFM A;  1SSO A;  2JYO A;  2VXW A;  4HCS A;  4MHE A;  5EQ0 A;  1ZXT A;  1DOM A;  2FMM A;  5EPL A;  1U4R A;  4ZLT F;  1WVL A;  1AP0 A;  2B2V C;  1HFN A;  2X69 A;  5T1G A;  2B2Y A;  2FFK B;  1F9Q A;  1XX8 A;  1X3Q A;  2N55 A;  1M8A A;  2KED A;  1G91 A;  2CVR A;  2HCI A;  4IUT A;  1O7Y A;  1F2L A;  2RSN A;  2SDF A;  3GV6 A;  1RTN A;  3HP3 A;  1DOK A;  2B2W C;  3I91 A;  1EOT A;  5COY A;  2K03 A;  4UAI A;  2HDL A;  2RVL A;  2DY8 A;  5JJZ A;  4IUV A;  1IL8 A;  4ZKB B;  4IUU A;  1WTW A;  1DZ1 A;  1VMP A;  1PLF A;  4R8I A;  1QNK A;  3H91 A;  3Q6S A;  1RJT A;  4DN4 M;  1IKM A;  1O80 A;  1F9S A;  1QE6 A;  4OIK A;  2K01 A;  2IL8 A;  2KOL A;  2BDN A;  4OIJ A;  4R9W A;  5D65 A;  1HRJ A;  1NCV A;  2D9U A;  2L1B A;  2X6L A;  2B2V A;  4LMQ D;  4QUC A;  1WTO A;  4ZK9 B;  3DM1 A;  4HSV A;  1O7Z A;  1SDF A;  2MJ8 A;  1ILQ A;  1U4P A;  5CBE E;  1G6Z A;  1X32 A;  2K05 A;  4X3U A;  4XT1 B;  4HED A;  4CJ1 B;  1E0B A;  1B2T A;  3I90 A;  3MWY W;  1RHP A;  5E4X A;  1WTX A;  1RTO A;  2HCC A;  4X3T A;  1HFG A;  1PFB A;  1X3P A;  1S4Z A;  2B2W A;  1WD1 A;  1CA5 A;  1HA6 A;  1Q3L A;  3KUP A;  3QO2 A;  2L9H A;  4X3S A;  1EQT A;  3LWE A;  1A15 A;  4CJ0 B;  2N88 A;  2L4N A;  1J8I A;  1GUW A;  1B53 A;  1MI2 A;  2KVM A;  5EPK A;  2KEC A;  2MP1 A;  4IUQ A;  1JE4 A;  1JIC A;  1KNE A;  3KBX A;  2M2L A;  2B2U C;  1EIG A;  4XDX A;  5COR A;  5CMD A;  2K28 A;  4IUP A;  1ROD A;  4X3K A;  2XIW A;  1EIH A;  5EPJ A;  5T1I A;  2B2T C;  4ZKC B; 
#chains in the Genus database with same CATH topology
 2NVT H;  2O5I C;  2JP1 A;  1V1P A;  1EL0 A;  2NVX B;  1D7Q A;  3P7J A;  1SXT A;  1EWC A;  1S5F D;  4BY1 G;  3EA6 A;  3S15 B;  4A3C G;  1Q1B A;  2R7Z G;  3GTP H;  1BNZ A;  1VQB A;  1AE3 A;  1UUP A;  4NDX A;  4OXP A;  1WD0 A;  3CD6 A;  4X66 Q;  3RZD B;  3SXH A;  2UU9 Q;  3WDN A;  2A8V A;  1VQL A;  5IT9 E;  4RAU C;  1A2T A;  4LFC L;  3D6C A;  4B3M L;  2CQO A;  4CGY B;  3Q24 A;  2XVS A;  1SN8 A;  4K8I A;  1L0W A;  1LTT D;  4ZUJ A;  4NXN L;  4DK0 A;  1DOL A;  2ZJP A;  2MFI A;  1VQ5 A;  1NR2 A;  4OEM B;  2J7Z A;  2QW7 A;  1DXM A;  1G2S A;  3U4V A;  4CDF C;  1HHV A;  1GUO A;  1K0S A;  2A6E D;  2WB1 B;  2KQ3 A;  1SSO A;  1O7L A;  1ZXT A;  2BH2 A;  1HFN A;  2OT2 A;  2PQA A;  4HJA A;  3S1R B;  3TSS A;  3TME A;  1Z7T A;  4P75 A;  1W3S A;  3G6J B;  4B3T Q;  3H15 A;  1ICF B;  2RSN A;  1ENA A;  3S1Q H;  3CW2 C;  1A62 A;  3NSW A;  3T4A C;  1SJE D;  1FNU A;  1SNQ A;  1TY2 A;  4LNQ A;  2F0F A;  5C44 B;  4E6I A;  1LM0 A;  3IFT A;  4LF4 L;  4EQN A;  1O80 A;  2G9H D;  3UE1 A;  3RN5 A;  4H7B A;  2JA8 B;  4OX9 L;  4A75 A;  4IOA A;  1Q81 C;  1I6V C;  1PXU A;  2JXM B;  2IHE A;  3BU2 A;  3GTJ H;  4LUO A;  5L37 A;  4JI5 L;  4OO1 G;  1VQI A;  5M5Y B;  1SDF A;  2DUD A;  3O13 A;  4LAA A;  4B3S L;  2UXB L;  3S2D H;  5CV9 A;  2CW0 D;  2YU9 H;  2PO4 A;  4JI0 L;  1NTG A;  5FJ8 G;  2KBN A;  4X3S A;  4DV3 L;  4A3F H;  4JI4 Q;  2D0P A;  3PQI A;  3UDX A;  2KVM A;  1KNE A;  2R7Z B;  5F2D A;  3RLO A;  2PW5 A;  3NQI A;  2K6A A;  4DV4 Q;  2LXJ A;  3PO3 B;  2CH4 A;  1QVF A;  1QVG A;  1BBX C;  3CCM A;  1B3Q A;  1CHP D;  1DM0 B;  1C9O A;  4K14 A;  1JOQ A;  3OW7 A;  4N8F A;  2SNM A;  5KEE A;  3QWN A;  5KIX A;  4OWW B;  3I4N B;  2NUC A;  5JPM C;  1XMO L;  2B2Y C;  3L0O A;  1TWG B;  4UHV A;  2IWH A;  1J6Q A;  1L0Y B;  3MA2 B;  4CDD C;  3H3V H;  5DNF A;  2EPB A;  1QIL A;  4RCO A;  1JWU D;  2K75 A;  3CC7 A;  1N8R C;  1L1O A;  4RWS C;  1TVX A;  3OHX C;  1HA5 A;  2JN4 A;  2Q8R E;  1NAP A;  1I5F A;  4WJW A;  4ZCK A;  1VF7 A;  5J22 A;  1II3 A;  3A7A B;  1JQY D;  2JA5 B;  3BDL A;  1FNV A;  1VQH A;  4JG2 A;  2E2H B;  1EZ6 A;  4JCV E;  4U67 3;  2VUM H;  1PTO F;  3J80 E;  2B63 H;  1TT2 A;  2OCE A;  1TWH B;  3E3X A;  3MEF A;  3OMG A;  3KDF A;  4FF3 A;  5M5X H;  1B8A A;  2A6H D;  4IUT A;  4JOI A;  5LMU L;  1OO9 B;  2XNA C;  5E1F A;  2B2W C;  2ASB A;  4DA2 A;  4DUY Q;  2Z0S A;  5JJI A;  1H9M A;  4J6H A;  2KCT A;  4BBS G;  1CKN A;  4IUV A;  1VQD A;  4BS9 A;  1QNK A;  2AHO B;  3L7Z C;  1E3P A;  1EQV A;  5IP7 H;  4R8N A;  1EU4 A;  1HR0 Q;  2KOL A;  3A74 A;  4JW0 A;  3F8T A;  5KNC A;  2HHH L;  5HUR A;  4ILW A;  4LF5 Q;  3V96 A;  4HSV A;  2F0G A;  3M4O H;  1G6Z A;  1YJN A;  5LL6 S;  4JI8 Q;  1I4P A;  1M4V A;  1HA6 A;  3H3V I;  1QVC A;  1EQT A;  2K32 A;  2OEO A;  1PVO A;  1CKO A;  3HOX G;  1PFS A;  4AQY L;  4K5X A;  4NKL A;  5J1Z A;  4QB4 A;  1EY4 A;  3AFQ A;  1UE1 A;  1F2Y A;  1SYE A;  3EVQ A;  4Z9C B;  1VQF A;  2F0J A;  2QIL A;  2EJM A;  1V1O A;  2Q2U A;  3BVZ A;  4RG1 A;  1QB5 D;  4EGV A;  5I2X A;  4DR2 L;  4JBK A;  1YHB A;  1EYG A;  1EY7 A;  1DON A;  4MTK A;  1LT3 D;  2VL6 A;  1EY9 A;  3J7Z C;  4JV5 Q;  2K52 A;  3BVG A;  5ELE A;  2E5L L;  5EBD A;  4NW2 A;  2XGT A;  5J39 A;  3T1H Q;  5HY6 A;  3K7A H;  3A0J A;  3QG1 A;  2K1B A;  2KEN A;  4ZRZ A;  4QUF A;  4IUR A;  2MUY A;  4KY7 A;  2EZV A;  5IYC H;  5GAD C;  2JA7 G;  4RGM A;  4P2C B;  2JEA I;  3CPW A;  2PCF B;  4BXX H;  4A3I H;  1YVC A;  2V1C C;  3OTO Q;  4DR3 L;  3FHW A;  2LSS A;  4DGZ A;  1NR4 A;  3L2P A;  1YJ9 A;  2NN6 H;  1HUN A;  1PZJ D;  3PUX A;  4QIW E;  2ICE C;  3DM3 A;  1KL9 A;  3SDZ A;  2F0P A;  2B29 A;  2VB2 X;  2IY5 B;  2JYO A;  5C4J H;  3NEM A;  3J7A 5;  1CQF A;  5BN5 A;  2OXP A;  2LS0 1;  4ZQ3 A;  4YY3 L;  2EY6 A;  4A3L H;  1QOH A;  5IP9 G;  4B9X A;  2SEB D;  3BG3 A;  5COY A;  1PH1 A;  4HMI A;  5JEA G;  1LYL A;  1SMY D;  2HT1 A;  5C0X J;  1I94 L;  2R93 G;  1ZEQ X;  1CUK A;  3RLN A;  1V1P B;  2EXZ A;  4DAM A;  1TWC H;  2XWB B;  2R6G A;  2E8G A;  4A93 H;  1RL2 A;  4B08 A;  1S72 A;  2JA6 G;  5LMN L;  3CU7 A;  4R9W A;  1Y8N B;  1Y1W G;  3B6Y A;  2X6L A;  4FP5 D;  1LTI D;  4APV A;  4BY7 G;  3QJY A;  5I6W A;  4LFC Q;  4B3M Q;  4Q0F A;  3SK6 A;  4XT1 B;  1QZH A;  2NVQ B;  1DGS A;  2Z1C A;  2K14 A;  4GNX C;  4AIM A;  3NBI A;  2LXK A;  4NXN Q;  4JYA Q;  4ULL A;  3I56 A;  1SRU A;  4I7A A;  4KK7 A;  4HID A;  4JI3 L;  3URY A;  4AYB E;  4XDX A;  1TR5 A;  3OIP A;  3V05 A;  3G71 A;  2PMZ E;  1EIH A;  2F0K A;  5M3M H;  4H0L C;  4LW1 A;  1CK1 A;  5ELN A;  5E3F A;  3PSI A;  1N32 L;  3MXU A;  2JJQ A;  1Y1V B;  4LFA L;  2PQA B;  2NTT A;  3ERS X;  3SK4 A;  3TP5 A;  1PH6 A;  5KYI A;  5IYD G;  2KEE A;  4LF4 Q;  3HOW H;  1VQ8 A;  1B50 A;  4QL5 A;  2A1A A;  3GV3 A;  4OX9 Q;  3GTL B;  1HJP A;  2DGY A;  3G48 A;  1ESR A;  2AQ2 B;  2ZTC A;  1PZK D;  2SNS A;  1EIY B;  3D6W A;  1P8L A;  1CKM A;  3FPU B;  1PRT D;  2QEJ C;  4JI5 Q;  3UE0 A;  2UXB Q;  3BDC A;  3TDQ A;  1WTV A;  4JI0 Q;  5LL6 X;  5JVG 3;  4P73 A;  5JJL A;  1MSG A;  3R2T A;  1BF4 A;  4FVM A;  4DV3 Q;  1E22 A;  3QOL A;  3S24 A;  4K2K A;  1D8L A;  4AYB G;  4EQP A;  3U4Z A;  3CP0 A;  3H3V C;  3X3N A;  4BY1 H;  1KDC A;  1MHW C;  2L15 A;  4A3C H;  5M3F G;  1XWE A;  3NTK A;  2KHI A;  2R7Z H;  1B70 B;  2SDF A;  1KRT A;  2ZTE A;  3H0G B;  4JC0 A;  1Y1W B;  3U9O A;  4JI7 L;  1YZ6 A;  3VYS A;  4LF7 L;  4R8I A;  3J80 i;  1IL2 A;  3S1M H;  2NVY B;  1SE8 A;  4V19 0;  1VQN A;  2E75 C;  2K01 A;  3GTG B;  2F0Q A;  1SE3 A;  2F4I A;  3HKS A;  2F0T A;  2VY3 A;  1XPU A;  4QIW B;  1QNU A;  1TWG H;  2VZA A;  4A4I A;  1HNW L;  1KRS A;  1ILQ A;  1U4P A;  3A8I E;  3BYY B;  3TP6 A;  1C0A A;  1E0B A;  3QOJ A;  3I90 A;  4ALP A;  1FNW A;  1ESF A;  1K8A C;  2LY7 A;  1PFB A;  1CA5 A;  5K36 G;  4C3H G;  1Y69 U;  1L1O B;  2R7D A;  2GVB A;  5I4D A;  2N88 A;  3ULL A;  3R2I A;  5JOB A;  3NEN A;  1GUW A;  2AQ3 B;  1O78 A;  2F0E A;  2IX3 A;  3CME A;  3CCS A;  5C3E B;  3DWQ A;  1SYG A;  4K6D A;  1RIP A;  2VQE L;  4A3M B;  4KHV A;  4A3E G;  2L0C A;  3AYH B;  3V2T A;  3OYY A;  1X3F A;  5I9O A;  5LMU Q;  2UUB L;  3Q0A A;  2BA0 A;  5EBC A;  1YNX A;  2AWN A;  1S5D D;  3ITP A;  1LV9 A;  2F3W A;  3HOU G;  5IE8 A;  3FKI B;  2O5J C;  1NMG A;  3BVM A;  4IFD I;  4OO1 H;  3EBE A;  1XTC D;  3I73 A;  3UI2 A;  2HHH Q;  2DNC A;  2LMC B;  3S17 B;  4K0K L;  5FJ8 H;  1C7Y A;  3DWA A;  2ZM6 L;  3GTO H;  2EY5 A;  2FHT A;  2WB1 E;  4HJ5 A;  3I7F A;  4A3B B;  1C8C A;  3LNN A;  3W2D A;  1A3U A;  4HJ9 A;  1QUQ A;  3P75 A;  1PFM A;  3S1N H;  5EQ0 A;  4AQY Q;  3VA7 A;  1IBL L;  2WII B;  4A3D B;  5T1G A;  2B2Y A;  1DCZ A;  1HZC A;  2ZJR A;  1V43 A;  5FLX c;  4C3J B;  3S2H H;  1IHZ A;  4P72 A;  4DR2 Q;  1VQC A;  3HRZ C;  3PO2 B;  2O4X A;  1N36 L;  1HNX L;  3H91 A;  1RJT A;  1Q8I A;  1FJG L;  4A3K G;  2E5L Q;  2EYL A;  3P20 A;  5D65 A;  3STB D;  4TQU S;  1MD2 D;  2L1B A;  3CCV A;  1GUG A;  3DXJ C;  2UUC L;  5C4Z A;  4X3U A;  4CJ1 B;  1GOZ A;  4OO1 I;  5E4X A;  2WB1 G;  2B2W A;  4CKC A;  3K5O A;  2E74 C;  4DR3 Q;  5IT9 c;  3IKJ A;  1XPO A;  5M5W B;  1Z47 A;  1A3T A;  1J8I A;  1IYJ B;  5IGE A;  1B53 A;  3NP8 A;  4LF8 L;  3PCO B;  2B2U C;  4DU9 A;  3CRK C;  2B2T C;  4ZKC B;  4BBS H;  5D14 A;  5C44 G;  4YY3 Q;  2B3G A;  3ERO A;  1ZYR C;  4K5W A;  5EKK A;  5CC4 A;  2WKC A;  2JA8 G;  3MFG A;  2D5D A;  2VQF L;  2GN5 A;  1HQR D;  3UDF A;  5CMD A;  1PYB A;  2ZXP A;  1H9J A;  3DLL A;  1RCV D;  2Y0S E;  2JQO A;  3FDT A;  1AZQ A;  2Z4H A;  3DEP A;  1EY8 A;  1SE2 A;  5LMN Q;  1OXV A;  4R4T A;  3KLS X;  1YNJ C;  1STB A;  1PRT C;  1VQ7 A;  1KAB A;  4DAY B;  1PH9 A;  1K73 C;  1VQK A;  1GHK A;  3HOX H;  1FGB D;  2HQL A;  1FR3 A;  1PRT F;  4R4I A;  5GAH C;  4B3R L;  4OON A;  2XN9 C;  4X65 Q;  5CV5 A;  3H09 A;  4IN3 A;  5CV4 A;  2QGQ A;  2VW9 A;  3TP8 A;  4L5T A;  3W5O A;  3K59 A;  1E1T A;  2MPM A;  1WTP A;  4DV7 L;  1M90 C;  3KLS A;  1UE7 A;  4ZAI A;  5IYB G;  1TU2 B;  2D2C C;  2ZJQ A;  1JWM D;  4JI3 Q;  4R4O A;  1X65 A;  3MXG A;  1SEB D;  3PO3 G;  1YIT A;  4POF A;  2BE5 C;  4A3K B;  1XJV A;  2EJF C;  1BBW A;  2F0M A;  1N32 Q;  1PYW D;  5FK9 C;  2RDG A;  3I4N G;  4IFD J;  3HOZ B;  4LFA Q;  3AEV A;  3H94 A;  4IUN A;  1I4H A;  5DAU A;  1SJH D;  4DUZ L;  1JOK A;  3JAM L;  2F0I A;  1K9M C;  1BCP B;  1F9S A;  4HSP A;  2YYZ A;  5CR3 A;  1G51 A;  4I7Z C;  1I4X A;  1SYF A;  2JA7 H;  2Q2H A;  1WI5 A;  2Y0S G;  4DR6 L;  3IRB A;  1HRJ A;  3TRZ A;  5GQO A;  1RDP D;  1K0R A;  2IT1 A;  3ND8 A;  2MJ8 A;  2UXC L;  2J0T D;  3AFP A;  2JA5 G;  4YWL A;  4HED A;  1VS0 A;  2KCM A;  4V0B A;  2WIN B;  3W1B A;  2RCF A;  4DR4 Q;  1A2U A;  5C3X A;  2EDG A;  4O2D A;  4OGQ C;  2E2I B;  1HH2 P;  4CJ0 B;  1SBB B;  2PPB C;  1AH9 A;  2NB0 A;  4DK3 C;  4UY8 C;  1JIC A;  5IP9 H;  4ODG A;  1L0X B;  3C1F A;  5EPJ A;  1F2M A;  5JEA H;  3KF8 B;  1LTL A;  1X56 A;  1K83 B;  4J1M A;  3E5S A;  2R93 H;  4C3I B;  1U5K A;  1DJR D;  1MIU A;  2OTJ A;  4ME5 A;  4C56 C;  3JAM i;  3A8K E;  1I4Q A;  3PUW A;  3J80 c;  4X64 L;  2JK8 A;  2JA6 H;  4LF7 Q;  4GNX A;  1Y1W H;  4OWT B;  3IL8 A;  4BY7 H;  3PIO A;  1JJG A;  3I4L A;  1IW7 C;  3RD4 A;  4A76 A;  1MGS A;  3E9H A;  4KD3 A;  3GTG H;  1HNW Q;  1UEA B;  1B4O A;  3IFD A;  3K8A A;  4A3G B;  1QG7 A;  2F1M A;  4PMW A;  1BKB A;  4WRD A;  1Q46 A;  3N52 A;  3EQL C;  2ID0 A;  2CCZ A;  4X62 L;  1CA6 A;  2MO0 A;  3ONA B;  1EQR A;  1RKN A;  1DOM A;  5EPL A;  2I46 A;  1I3Q B;  2RHS B;  1LAC A;  3N6R A;  2N55 A;  4NPS A;  1X3Q A;  1NMF A;  2KED A;  3H6M A;  1NUC A;  3GTQ H;  3BDO A;  3J81 j;  1FGU A;  2VQE Q;  1OXT A;  2Y0S B;  4N9T A;  1FVI A;  4DK6 C;  2E2D C;  3T1Y L;  5IYD H;  2UUB Q;  1JJC B;  3TBI B;  3KF6 A;  3HOV B;  4KD4 A;  4ZKB B;  5HGQ A;  1P16 A;  2BA1 A;  1DZ1 A;  4KV6 A;  1SFO B;  1PTO C;  4PV1 C;  1XTD A;  3A5U A;  4JPB W;  4K5V A;  4A3J G;  4C1N I;  2A69 D;  1ENC A;  4CDC C;  1M1K C;  1LT4 D;  3D4W A;  1WTO A;  4BBR B;  2NZO A;  1H95 A;  3PF5 A;  4TVA B;  3K5N A;  4K0K Q;  2EVB A;  2K5N A;  1KHI A;  1H9S B;  3F1Z A;  1LTG D;  4EVO A;  2ZM6 Q;  1FYC A;  3R3O A;  3GTM B;  1O7I A;  1Q86 C;  3NBH A;  3M3Y H;  1G8Z D;  1NBW A;  1JC7 A;  2C35 B;  4IPG A;  1PH4 A;  3NPP A;  1TS3 A;  5M3F H;  4RCN A;  1W6J A;  4YWK A;  4YCW A;  2MNA A;  2PI2 A;  1SE4 A;  2M2L A;  4DR1 L;  3J81 L;  1IBL Q;  4GKK L;  3S14 B;  2AMC B;  4DN4 M;  1KC8 C;  1TWF H;  4DV5 L;  1QUQ B;  4DV1 L;  3LWU A;  1BQQ T;  3R93 A;  2P5Z X;  5AJ3 Q;  2WP8 J;  2MO1 A;  2PZU A;  1C4Q A;  4KLK A;  1VQ4 A;  2R92 B;  2N78 A;  1EIF A;  1XXG A;  1EZ8 A;  4DV6 L;  1N36 Q;  1HNX Q;  1C48 A;  2VS1 A;  3BZC A;  5ELC A;  1F9R A;  1J5E Q;  5FO7 B;  1VF5 C;  4RGN A;  2F4V L;  5K36 H;  4DR5 L;  1Y14 B;  1ET6 A;  3HZX A;  1PTO B;  4C3H H;  5D3I B;  1X55 A;  2UUC Q;  1JT8 A;  4N9P A;  1IKL A;  1SNP A;  4GOP C;  1TWA B;  1DD2 A;  3TP7 A;  3CXC A;  1FD7 D;  3BYT B;  5CV7 A;  4Y7N B;  4LF9 L;  3A7L A;  3J81 i;  3AB9 A;  3TEH B;  4JI2 L;  2KUM A;  5HGT A;  1Q12 A;  1XYI A;  4HCS A;  4A3E H;  1KIX A;  3ERQ A;  3CC4 A;  4PQX A;  4LF8 Q;  4JBM A;  5CYU A;  3JC6 6;  3VR5 A;  1A6X A;  1XX8 A;  2IHF A;  2KHS A;  1Y1V G;  3HKZ B;  1I4G A;  1ASY A;  4JI6 L;  4DV0 L;  4A3J B;  1LT5 D;  4BA2 I;  1XNR L;  1F2Z A;  1MJE A;  3HOU H;  3BZK A;  2K03 A;  2H5X A;  1X3G A;  3K7U C;  1D2B A;  4DFA A;  3E9I A;  4LUV A;  5LHY 1;  4KKS A;  4HIM A;  5EKL A;  3I4M B;  1IKM A;  2A6E C;  2VQF Q;  1B9M A;  3SR1 A;  2I5L X;  1Q90 A;  2BDN A;  2EYJ A;  1JJ2 A;  2Z8L A;  3VR4 A;  4LMQ D;  1PMR A;  4YCV A;  3I55 A;  4IQZ A;  4WOR A;  2WV6 D;  5C5M A;  1S5C D;  1EOV A;  4C2M B;  1WOC A;  4QJF A;  1B2T A;  1G29 1;  2KCC A;  1RHP A;  1VDZ A;  1X3P A;  2EY1 A;  5FLM G;  4B3R Q;  1WYD A;  3ZYY X;  3CCU A;  2NVX H;  3AQQ A;  1KQS A;  3RZO B;  2KJX A;  4FF2 A;  5C0X G;  1D1I A;  3FEW X;  3S15 H;  2N3S A;  4DAY A;  1CSP A;  2V4D A;  4DV7 Q;  3F2C A;  3S16 B;  3SEB A;  1EIG A;  1TS5 A;  3H0G G;  5FO9 B;  4IPC A;  4POG A;  3RZD H;  1U4L A;  2DN8 A;  1STG A;  2CW0 C;  4LWC A;  3WWV A;  4PMB A;  1Q1E A;  1K8G A;  4O42 A;  4R1J A;  3NHH A;  5IWA L;  4A3K H;  1R4Q B;  2RSO A;  1TKW B;  1R4P B;  1UWV A;  4GLA C;  1MKH A;  4DUZ Q;  2CHB D;  1WTQ A;  2FJ2 A;  4MZ9 A;  2NVT B;  1E2Z A;  4FF4 A;  4ZUI A;  1VQ9 A;  5GRO A;  4DR6 Q;  1NY4 A;  2B2U A;  4DNT B;  2NN6 I;  3CAM A;  3LGJ A;  4CDE C;  2RDF A;  1EFW A;  2B2T A;  5FKA C;  5CBA E;  3CCQ A;  3S1R H;  2K5Q A;  3GTP B;  2UXC Q;  4GLX A;  4PMC A;  1TQO A;  1HR0 W;  2WAQ B;  3MTS A;  5KND A;  5C3E G;  4QY7 A;  1WTR A;  2JE6 I;  5IY0 A;  1GVP A;  2K7V A;  4A3M G;  3D8G A;  1SR3 A;  1U4R A;  5C44 H;  2B2V C;  4O0A A;  1YBY A;  3PIP 3;  5C5L A;  1YNN D;  1GHJ A;  2ICI A;  2AUJ D;  3CCJ A;  2JA8 H;  2K33 A;  4ID6 A;  2PZW A;  1KTK A;  1DOK A;  4P74 A;  3MXN B;  3SK8 A;  3ULP A;  4B3S Q;  3M4Y A;  1LLR D;  3FKI G;  3RNU A;  3HOY G;  3VA5 A;  5M5Y H;  1AW7 A;  5BN4 A;  4X64 Q;  4Y52 H;  3KF8 A;  3M4Q A;  3TQY A;  1QE6 A;  3WOF A;  5C3W A;  1K8O A;  4F7X A;  3T53 B;  2DJF C;  3DHQ A;  4S3S A;  1I4R A;  3C46 A;  3OW2 A;  3C1E A;  4GNX B;  2A6H C;  4NMZ A;  4QUC A;  4PZ7 A;  4A3B G;  1CHQ D;  2K05 A;  3ZJY C;  2VNU D;  3CCL A;  2I07 B;  2B8G A;  2HCC A;  2MHV A;  1A0I A;  1B9N A;  5IYB H;  3U58 A;  3AMU A;  2KHJ A;  2E2J B;  1D1K A;  3A5Z B;  4A3D G;  3PO3 H;  4FF1 A;  1HXY D;  3GTJ B;  4KHZ A;  2OF1 A;  4X62 Q;  3PMF A;  1XMQ L;  2MP1 A;  2R61 A;  4C3J G;  1XMO Q;  2RHQ B;  2XIW A;  2YU9 B;  3I4N H;  5T1I A;  4NXM L;  5JAV A;  3NWS A;  4TKO B;  3MEH A;  3TS2 A;  1I3Q H;  1J9O A;  3PO2 G;  1GUT A;  4UP8 A;  4GKJ L;  3A55 A;  3T1Y Q;  5ELO A;  5AFW A;  3RLF A;  3PUV A;  1CFM A;  2HDM A;  3JAM E;  2CWA A;  2QDL A;  5G3L D;  3TS0 A;  3GD7 A;  5D3D A;  1AZP A;  1UAP A;  3KF6 B;  2JA5 H;  3T56 B;  1JB3 A;  1H9R A;  4FDB A;  2QDB A;  4WJ3 M;  1ILP A;  2E2H H;  2UXD L;  4CKE A;  2F52 A;  1SNM A;  1B3A A;  1XNQ L;  4L8J A;  5KRU A;  1TWH H;  3GDE A;  1MJC A;  3CQZ B;  4B9W A;  3TN2 A;  1B44 D;  1Q82 C;  1EU3 A;  3K5L A;  1GXD C;  3K80 C;  4FYD A;  1E1O A;  2YV5 A;  1VQP A;  3CPF A;  3J7A F;  1SYB A;  3D3R A;  3HOY B;  1U0L A;  2C9O A;  4LF6 L;  4UPA A;  5GAE C;  3K6O A;  1H9S A;  3L3O C;  1M8A A;  1CZW A;  3NBH B;  4KKU A;  4GKK Q;  1X3E A;  3DWP A;  1O7Y A;  4DV5 Q;  4DV1 Q;  4KTA A;  3QB3 A;  3S14 H;  4HIO A;  2HDL A;  4KY6 A;  1VCI A;  2DY8 A;  4L63 B;  3CF5 A;  1CTM A;  3VR6 A;  1YHA A;  1WTW A;  1VMP A;  2EYP A;  5CV6 A;  2F0V A;  4KMU C;  4XQJ A;  2QCP X;  5DM7 3;  2IL8 A;  1BDO A;  1PV4 A;  1AEX A;  4RFB A;  1IBM L;  2M00 A;  2IX0 A;  1G6P A;  3DM1 A;  2F4V Q;  4DV2 L;  2DJG C;  2WKD A;  1Z6H A;  4KKT A;  4DR5 Q;  4IAL A;  1CSQ A;  3PGZ A;  1SMY C;  1RTO A;  2IX1 A;  2L9H A;  2NZH A;  2NTS A;  4LF9 Q;  4GZY C;  1MI2 A;  4JI2 Q;  3M4O B;  4Y7N H;  5DM6 3;  1HNZ L;  2EYF A;  2XRS D;  3T13 A;  3HGB A;  2AUK A;  2HUG A;  3HOZ G;  5IOD A;  4JI6 Q;  1GUS A;  1T9H A;  1JE5 A;  4DV0 Q;  1XNR Q;  4H13 C;  3NK9 A;  4A3J H;  4FXG C;  1PFN A;  2NWG A;  2H1E A;  2K5W A;  3MFY A;  4TSS A;  4F88 A;  2G5D A;  2UUA L;  3D4R A;  3F2U A;  4YWM A;  5TSS A;  3VR2 A;  2EIF A;  3K57 A;  5EAY A;  1HZB A;  1PDQ A;  2RDH A;  2NZ1 D;  4GN5 A;  3CCE A;  1NSN S;  3K7A B;  2G9D A;  1BR9 A;  3G7L A;  1T5X D;  1D5X C;  1I94 Q;  1AN8 A;  2L12 A;  3KJP A;  3GTK B;  1LTA D;  3K0Y A;  1WVL A;  4L5S A;  3RZO H;  4CHT B;  4C3I G;  3J81 E;  4A3I B;  4XYQ A;  4NB3 A;  3GV6 A;  2CQA A;  1TII D;  5A2Q L;  2RVL A;  1WCM G;  5JJZ A;  3D4D A;  5IWA Q;  5C4X G;  3VR3 A;  5C4J B;  1K3R A;  2BOS A;  3SGI A;  2A68 D;  4GOP A;  2NVQ H;  2XWJ B;  1LT6 D;  1S5E D;  4LJZ C;  2Z6K C;  3T51 B;  4G7O C;  3NXW A;  3D0F A;  1PZI D;  3RUZ A;  3ICE A;  1KXL A;  3QIA A;  4DKA C;  2F0S A;  4A3G G;  2ES2 A;  2BDO A;  1K8M A;  4GLV B;  4WJ4 A;  1TWC B;  4TRD A;  4A93 B;  4X3T A;  1S5B D;  1WD1 A;  3FRP B;  3NWT A;  5NUC A;  4IFD G;  1BBU A;  1IYV A;  3TRE A;  4KJO A;  1Y1V H;  4UP9 A;  3OOC A;  3IAY A;  2HQE A;  2E76 C;  2LFN A;  4IUQ A;  5COR A;  2ZXO A;  1OXU A;  4X3K A;  3GQB A;  3KJO A;  1NJI C;  1WTH A;  4DXG A;  1R9T B;  2M9V A;  3C3L A;  4QQB X;  1E2W A;  3HOV G;  3R8B A;  4CBV A;  2PZT A;  3GTL H;  5CGK A;  1WJJ A;  4JYA L;  2DNE A;  2EJG C;  4KN4 C;  1BOS A;  1VQE A;  3RN2 A;  3LX0 A;  5M3M B;  1ICW A;  1PRT B;  4BBR G;  2EE1 A;  3J7A V;  2LKV A;  3MXN A;  5G3L F;  2EOT A;  4JI1 L;  3KLW A;  5IGG A;  1PA6 A;  4PZ8 A;  4OHJ A;  1F9P A;  2BH8 A;  2QKI C;  3A54 A;  5FLM H;  1N34 L;  1D6E C;  1HQM C;  4OWX B;  5C0X H;  4IOC A;  2PW7 A;  3HOW B;  3I70 A;  3OWF A;  1KAA A;  2Q2I A;  3SVM A;  4JI7 Q;  3HKZ E;  1S40 A;  3H0G H;  1STH A;  1ONL A;  1IBK L;  2K5V A;  1WCM B;  2VXW A;  4OEL B;  2E2J H;  4OL7 A;  5C4X B;  1XMQ Q;  1GD7 A;  2NVY H;  3MHB A;  4YCU A;  1Q7Y C;  3L9A X;  4NXM Q;  2K5H A;  2KA7 A;  2EYH A;  3G6E A;  2R92 G;  1RTN A;  5IGD A;  3VDY A;  1VQO A;  4GKJ Q;  1LAB A;  2GA4 B;  5M9O A;  1YI2 A;  4RHS A;  4LK1 C;  1SLJ A;  4BY1 B;  1N33 L;  4QGU A;  4F87 A;  2A74 C;  4RKB A;  1PH7 A;  3OPO A;  4IPD A;  1GKH A;  2B2V A;  2WAC A;  2QA4 A;  2UXD Q;  2RKS A;  4DNR B;  5C3E H;  3FVQ A;  1SYC A;  3S1M B;  1XNQ Q;  1GUN A;  1QCB D;  3MWY W;  1VQA A;  5LMN W;  4A3M H;  1PH3 A;  3PF4 A;  1I50 B;  3CQZ H;  1VQ6 A;  2C5C A;  1SMX A;  1PYS B;  3HKZ G;  2R7F A;  2JA9 A;  5I9P A;  2Q2T A;  4QMG A;  5C0X I;  3STB C;  1QZG A;  5DEH A;  1ROD A;  4LF6 Q;  3UDI A;  3FKI H;  3HOY H;  2D0O A;  4XT3 B;  5I6Y A;  2Q8T A;  5FO8 B;  1OXS C;  1JB7 A;  3I3C A;  3I4M G;  3CKI B;  3E0E A;  1PHJ A;  4DF7 A;  3M7N A;  3S17 H;  1OXX K;  4DR7 L;  1Y8O B;  4HAE A;  5K5P A;  3K5M A;  1BO0 A;  1DYQ A;  4YIJ A;  1SYD A;  1AFP A;  2RA4 A;  1EEF D;  4UDU C;  4A3B H;  1EY0 A;  3I72 A;  1IYU A;  1EYD A;  1D5Z C;  2F0D A;  2WAQ E;  1IBM Q;  3CRL C;  4A3D H;  3Q22 A;  4DV2 Q;  3BS1 A;  1TXY A;  4J15 A;  3NTH A;  4DPG A;  4M8A A;  1MSH A;  1EWH A;  2X6G A;  2F3V A;  5FLX L;  1CQV A;  2XRQ D;  4RMF A;  4C3J H;  4F8M A;  2EY2 A;  1KDB A;  4IPH A;  1STN A;  3CC2 A;  3U9S A;  2FMM A;  3X3M A;  1FJG Q;  3PO2 H;  4FNF A;  3PUY A;  5IGC A;  2FFK B;  1F9Q A;  3GTO B;  3G4S A;  1HNZ Q;  2PYK A;  5CV8 A;  1H9K A;  4L5R C;  4YHH L;  1U9R A;  4RKL A;  1GO3 E;  3MVV A;  2HIV A;  2CWP A;  4R4C A;  3CMA A;  3S1N B;  1IL8 A;  4PG3 A;  2A68 C;  1CT1 D;  2EXD A;  4XYO A;  1D5M C;  5EGT A;  5JJK A;  2N8N A;  4NP5 A;  1GJX A;  3S2H B;  1EYA A;  3QR8 A;  5IT9 L;  1UE6 A;  2TMP A;  4FXD A;  5M5W H;  1ENF A;  4OIJ A;  3GO5 A;  1NCV A;  2PNR C;  2CKZ B;  2WAQ G;  1EYC A;  1EWI A;  4H44 C;  2UUA Q;  1X32 A;  1X9N A;  2PNH A;  3VYU A;  1E7Z A;  4GS3 A;  2L5T A;  1EY6 A;  1WTX A;  1EFI D;  1YEZ A;  3UDG A;  1SND A;  1KAW A;  1Q3L A;  3BJU A;  1PH5 A;  2PQE A;  4HN7 A;  1A15 A;  3EFX D;  2F0H A;  4JBJ A;  1I6H B;  1KD1 C;  2F0O A;  3D31 A;  2MQH A;  4LUZ A;  5EPK A;  4ABN A;  1JE4 A;  5BN3 A;  1KLU D;  5GAG C;  2CFM A;  2EYM A;  3SK5 A;  4MTN A;  2RF4 A;  3I4O A;  3HEJ A;  1YHQ A;  3GTK H;  1ZKO A;  5EKI A;  3KLR A;  1B7Y B;  1STA A;  1U4M A;  5ELF A;  4M1U B;  2ZTD A;  2RQX A;  4X6A H;  3ND9 A;  2HIX A;  4G57 A;  4JVZ A;  1BXT A;  1LO5 D;  1G2T A;  1SNC A;  1VMC A;  5EJW A;  3FMC A;  1JWS D;  4EQO A;  4BBS B;  2Z4I A;  4RGO S;  4UP7 A;  2RBM A;  1TS2 A;  3TZU A;  1EUJ A;  2CH4 W;  1VQG A;  4PNY A;  1T5E A;  2K04 A;  5KGU A;  1EQQ A;  2A73 B;  1SAP A;  2EYO A;  3F2D A;  4GOP B;  5C6A A;  2BCO A;  1NNX A;  3K58 A;  2L11 A;  5JEA J;  4KHP L;  3M9B A;  5KNB A;  2B8F A;  4MIU A;  2B39 A;  2IW3 A;  4FO2 A;  5BR8 L;  2ZT9 C;  3SHL A;  1HUM A;  3OMC A;  4LFB L;  2DY7 A;  1K28 A;  2J4X A;  2NYZ D;  4K8J A;  4HCE A;  3HOZ H;  1QJO A;  1AP0 A;  2PI2 E;  2X69 A;  4HIK A;  1W2B A;  2I0Q A;  4GN4 B;  3HOX B;  4A3F G;  3K0X A;  1JOO A;  3A8J E;  1RF2 D;  3J7Y W;  1OTC A;  4XIG S;  1LUZ A;  1YJW A;  4K2L A;  1Z9F A;  1UEB A;  3HP3 A;  3I91 A;  1B1Z A;  5IOC A;  4X65 L;  1R9T H;  1FL0 A;  1JR0 D;  3DUZ A;  2OWO A;  5I2Y A;  1V9P A;  3Q6S A;  3U50 C;  2Z6B A;  4X66 L;  3SE0 A;  2OQ0 A;  1WFQ A;  4DAV A;  2EQS A;  2UU9 L;  1W6K A;  5JVH 3;  1SNO A;  3EIV A;  2E2I H;  3VYT A;  3E0J A;  4N8X 1;  4JI1 Q;  4IZ8 A;  3I2Z A;  3GP7 A;  1BCP D;  4HJ7 A;  4C1N K;  2TSS A;  4KI0 A;  3JAM c;  1N34 Q;  5ELD A;  1ZYR D;  1K83 H;  1X6O A;  4DAP A;  2JA7 B;  4QF4 A;  4K6L A;  3KBG A;  2I5H A;  1BUV T;  2GVA A;  3HG9 A;  2A19 A;  1A8V A;  4C3I H;  3LWE A;  2AKW B;  5IGF A;  4G7Z C;  4G7H C;  1L2F A;  4L6T B;  2L4N A;  1KDA A;  3J80 L;  2A69 C;  1IBK Q;  3KBX A;  3MXP A;  1L1O C;  3S1Q B;  4B3T L;  5ELB A;  1WCM H;  2Z6K A;  1ET9 A;  2N49 A;  1HTP A;  1YNJ D;  1STY A;  5JPN C;  5C4X H;  2VUM G;  2B63 G;  2XTI A;  4DR4 L;  3E6Z X;  4JBW A;  4BWG B;  3BZD B;  4KY5 A;  5A2Q E;  1EY5 A;  4ZYS A;  4RA8 A;  5C4H A;  4WFN 3;  4MNO A;  3W1G A;  1IZ6 A;  4HR7 B;  4A3G H;  1PH8 A;  3A56 A;  3OIQ A;  1N33 Q;  2R93 B;  4Q5V A;  1ML0 D;  5A35 A;  4JOI C;  5J3B A;  3S2D B;  4JK1 C;  1AE2 A;  4HJ8 A;  1QWY A;  2BE5 D;  4CJ2 C;  3DMU A;  2JA6 B;  5IP7 G;  2F0U A;  4IFD H;  4HTH A;  3S9W A;  1K3B C;  3NTI A;  4ME3 A;  5ISR A;  4A3F B;  4U68 A;  4BY7 B;  1EEI D;  2JEB I;  4DK1 A;  4RGT A;  3PUZ A;  1HZA A;  4JI4 L;  3Q23 A;  2MGS A;  1CM9 A;  2F0N A;  1HCZ A;  2ALY B;  1TS4 A;  2OTL A;  2YTX A;  4ZLT F;  3HS0 C;  3HOV H;  3OWE B;  1I50 H;  1SFO H;  4IJL A;  2IPK D;  3NEL A;  4FXK C;  2XSC A;  1G91 A;  2CVR A;  2K4K A;  3KOJ A;  4DV4 L;  1YIJ A;  3WOE A;  4RH6 A;  2Z9H A;  4XTC S;  2F03 A;  3NE5 B;  2NBF A;  2I5M X;  3T16 A;  3KYH C;  1V1Q A;  1JMC A;  1EOT A;  2RCN A;  4UAI A;  3FPP A;  4BBR H;  2AWO A;  2YTY A;  4IUU A;  1ASZ A;  4J8Q A;  4DR7 Q;  4G4K A;  2O2L D;  3GTQ B;  2OQK A;  1RD9 D;  3GTM H;  3F2B A;  3RMH A;  1IXR A;  3EN2 A;  2SOB A;  4DR1 Q;  1KLG D;  3AU7 A;  1N9W A;  4ZK9 B;  1TY0 A;  2ATW A;  1O7Z A;  4O1N A;  2K5D A;  3RR5 A;  4R4Q A;  4BA1 I;  3ER0 A;  3CCR A;  3PIP A;  1XPR A;  3KDF B;  3MC0 B;  5IIF A;  1HFG A;  5IYC G;  1S4Z A;  3K81 C;  4DXF A;  3KUP A;  2FXQ A;  2VUM B;  2B63 B;  5KYL A;  1HPC A;  4XQN A;  4BXX G;  4HMJ A;  5H1S E;  4A3I G;  4H02 A;  4XXE A;  4DV6 Q;  5M5X B;  2L55 A;  2KEC A;  1CKN B;  2R92 H;  2D62 A;  2NN6 G;  4XQQ A;  1CZG A;  1IW7 D;  1Y8P B;  2K28 A;  4IUP A;  1CI3 M;  1HTL D;  3DEO A;  1UNS A;  3TZD A;  4AYB B;  4DUY L;  3NUC A;  3M3Y B;  4GN3 B;  4YHH Q;  2PMZ B;  1S3O A;  5M3F B;  1PTO H;  4I65 A;  4AH6 A;  4A3L G;  3J81 c;  1UE5 A;  2F3I A;  3FP9 A;  3P1H A;  2HD3 A;  2R3Z A;  1TWF B;  3NQT A;  5E4W C;  1HR0 L;  1SRO A;  1TWA H;  2K50 A;  1E24 A;  3CHB D;  2FIN B;  4LF5 L;  1HZ9 A;  3OSO A;  1STE A;  3PV0 A;  3M85 A;  4IJH A;  4A93 G;  1Q8K A;  5AJ3 L;  3MAQ A;  2F0W A;  3VYR A;  4JI8 L;  4EX5 A;  4CKB A;  2H4O A;  4QCL A;  1KNA A;  1LTS D;  3EJI A;  1A63 A;  3I8Z A;  4MN3 A;  1NE3 A;  1PTO D;  1PH2 A;  1MBY A;  4MHE A;  3Q8D A;  2ENB A;  1J5E L;  4C3H B;  3W3A A;  2QEX A;  3I4M H;  1I6H H;  5IGB A;  2QF7 A;  2HCI A;  3KK7 A;  4KJN A;  4IO9 A;  1F2L A;  4P71 A;  2ZXR A;  1BVS A;  3HFZ B;  5M3M G;  4A3E B;  4JV5 L;  1JOR A;  1VQJ A;  1LTB D;  3M4P A;  5DLQ E;  3ULJ A;  1PLF A;  4C2M H;  3T1H L;  1V8Q A;  4EQ5 A;  1E2V A;  1GM5 A;  3M7G A;  4OIK A;  2F0L A;  1YNN C;  3KFU A;  1VQM A;  3HOU B;  2AQ1 B;  5E7N A;  2D9U A;  1BCP C;  1X54 A;  2FMC A;  3HOW G;  1LTR D;  4RHR A;  3S16 H;  5CBE E;  5FOB B;  3OTO L;  4KHP Q;  1A3V A;  2IJ0 A;  4DNI A;  1BCP F;  3PIO 3;  1F77 A;  5BR8 Q;  2KCN A;  3QO2 A;  4PZ6 A;  5FLX E;  1JCK B;  2WFW A;  4LFB Q;  3MZ5 A;  2YTV A;  4KN7 C;  3C2P A;  2VB3 X;  2A5H A;  2Q8I B;  2JSO A;  4L5Q A; 
#chains in the Genus database with same CATH homology
 2O5I C;  2JP1 A;  1V1P A;  1EL0 A;  2NVX B;  3P7J A;  1SXT A;  1EWC A;  1S5F D;  3EA6 A;  3S15 B;  1Q1B A;  1BNZ A;  1UUP A;  4NDX A;  1WD0 A;  3RZD B;  3SXH A;  3WDN A;  5IT9 E;  4RAU C;  1A2T A;  3D6C A;  4CGY B;  3Q24 A;  2XVS A;  4K8I A;  1LTT D;  4ZUJ A;  4DK0 A;  1DOL A;  1NR2 A;  2J7Z A;  1DXM A;  1G2S A;  1HHV A;  1GUO A;  2A6E D;  2WB1 B;  2KQ3 A;  1SSO A;  1O7L A;  1ZXT A;  1HFN A;  2OT2 A;  3S1R B;  3TSS A;  3TME A;  1Z7T A;  3G6J B;  2RSN A;  1ENA A;  3NSW A;  3T4A C;  1SJE D;  1FNU A;  1SNQ A;  1TY2 A;  2F0F A;  5C44 B;  4E6I A;  3IFT A;  4EQN A;  1O80 A;  2G9H D;  4H7B A;  2JA8 B;  1I6V C;  1PXU A;  2JXM B;  5M5Y B;  4OO1 G;  1SDF A;  3O13 A;  4LAA A;  5CV9 A;  2CW0 D;  2PO4 A;  4X3S A;  2KVM A;  1KNE A;  2R7Z B;  5F2D A;  2PW5 A;  3NQI A;  2K6A A;  3PO3 B;  1BBX C;  1CHP D;  1DM0 B;  4K14 A;  1JOQ A;  3OW7 A;  2SNM A;  5KEE A;  3QWN A;  5KIX A;  3I4N B;  2NUC A;  5JPM C;  2B2Y C;  1TWG B;  2IWH A;  1L0Y B;  3MA2 B;  5DNF A;  2EPB A;  1QIL A;  4RCO A;  1JWU D;  4RWS C;  1TVX A;  3OHX C;  1HA5 A;  2Q8R E;  1NAP A;  4WJW A;  1VF7 A;  5J22 A;  1II3 A;  3A7A B;  1JQY D;  2JA5 B;  3BDL A;  1FNV A;  2E2H B;  1EZ6 A;  4U67 3;  1PTO F;  3J80 E;  1TT2 A;  1TWH B;  3OMG A;  4FF3 A;  2A6H D;  4IUT A;  1OO9 B;  2XNA C;  5E1F A;  2B2W C;  4DA2 A;  1H9M A;  4J6H A;  4IUV A;  4BS9 A;  1QNK A;  3L7Z C;  1EQV A;  4R8N A;  1EU4 A;  2KOL A;  5KNC A;  5HUR A;  4ILW A;  3V96 A;  4HSV A;  2F0G A;  1G6Z A;  5LL6 S;  1I4P A;  1M4V A;  1HA6 A;  1EQT A;  2K32 A;  2OEO A;  4K5X A;  4NKL A;  5J1Z A;  4QB4 A;  1EY4 A;  1F2Y A;  1SYE A;  3EVQ A;  4Z9C B;  2F0J A;  2QIL A;  2EJM A;  1V1O A;  3BVZ A;  1QB5 D;  4EGV A;  5I2X A;  1EY7 A;  1DON A;  1LT3 D;  1EY9 A;  3BVG A;  5ELE A;  5EBD A;  4NW2 A;  5J39 A;  3QG1 A;  2K1B A;  4ZRZ A;  4QUF A;  4IUR A;  2MUY A;  4KY7 A;  2EZV A;  4RGM A;  4P2C B;  2JEA I;  2PCF B;  4DGZ A;  1NR4 A;  2NN6 H;  1HUN A;  1PZJ D;  3PUX A;  2ICE C;  3SDZ A;  2F0P A;  2VB2 X;  2JYO A;  1CQF A;  5BN5 A;  2OXP A;  2LS0 1;  4ZQ3 A;  2EY6 A;  1QOH A;  4B9X A;  2SEB D;  3BG3 A;  5COY A;  4HMI A;  5JEA G;  1SMY D;  5C0X J;  1ZEQ X;  1V1P B;  2EXZ A;  2XWB B;  2R6G A;  4B08 A;  3CU7 A;  4R9W A;  1Y8N B;  2X6L A;  4FP5 D;  1LTI D;  3QJY A;  5I6W A;  4Q0F A;  3SK6 A;  4XT1 B;  2NVQ B;  2Z1C A;  3NBI A;  4ULL A;  4KK7 A;  3URY A;  4XDX A;  1TR5 A;  3OIP A;  3V05 A;  1EIH A;  2F0K A;  4H0L C;  1CK1 A;  5E3F A;  3MXU A;  1Y1V B;  2NTT A;  3SK4 A;  3TP5 A;  5KYI A;  2KEE A;  1B50 A;  3GV3 A;  3GTL B;  1ESR A;  2AQ2 B;  1PZK D;  2SNS A;  3D6W A;  3FPU B;  1PRT D;  2QEJ C;  3BDC A;  3TDQ A;  1WTV A;  5LL6 X;  5JVG 3;  1MSG A;  3R2T A;  1BF4 A;  4FVM A;  3QOL A;  4K2K A;  4EQP A;  3H3V C;  3X3N A;  1KDC A;  1XWE A;  3NTK A;  2SDF A;  3H0G B;  1Y1W B;  3U9O A;  3VYS A;  4R8I A;  2NVY B;  4V19 0;  2E75 C;  2K01 A;  3GTG B;  2F0Q A;  1SE3 A;  2F4I A;  2F0T A;  4QIW B;  1QNU A;  1ILQ A;  1U4P A;  3A8I E;  3BYY B;  3TP6 A;  1E0B A;  3QOJ A;  3I90 A;  1FNW A;  1ESF A;  5K36 G;  2LY7 A;  1PFB A;  1CA5 A;  4C3H G;  1Y69 U;  5I4D A;  2N88 A;  3R2I A;  5JOB A;  1GUW A;  2AQ3 B;  1O78 A;  2F0E A;  2IX3 A;  5C3E B;  3DWQ A;  1SYG A;  4K6D A;  4A3M B;  4KHV A;  2L0C A;  3V2T A;  5I9O A;  3Q0A A;  2BA0 A;  5EBC A;  2AWN A;  1S5D D;  3ITP A;  1LV9 A;  2F3W A;  3FKI B;  2O5J C;  4IFD I;  3BVM A;  4OO1 H;  1XTC D;  3I73 A;  3UI2 A;  2DNC A;  2LMC B;  3S17 B;  3DWA A;  2EY5 A;  2FHT A;  4A3B B;  1C8C A;  3LNN A;  3W2D A;  1A3U A;  3P75 A;  1PFM A;  5EQ0 A;  3VA7 A;  2WII B;  4A3D B;  5T1G A;  2B2Y A;  1DCZ A;  1V43 A;  4C3J B;  1IHZ A;  3HRZ C;  3PO2 B;  2O4X A;  3H91 A;  1RJT A;  1Q8I A;  2EYL A;  3P20 A;  5D65 A;  4TQU S;  1MD2 D;  2L1B A;  1GUG A;  3DXJ C;  5C4Z A;  4X3U A;  4CJ1 B;  1GOZ A;  4OO1 I;  5E4X A;  2B2W A;  4CKC A;  3K5O A;  2E74 C;  3IKJ A;  5M5W B;  1Z47 A;  1A3T A;  1J8I A;  5IGE A;  1B53 A;  3NP8 A;  2B2U C;  4DU9 A;  3CRK C;  2B2T C;  4ZKC B;  5D14 A;  3ERO A;  1ZYR C;  4K5W A;  5EKK A;  5CC4 A;  2WKC A;  3MFG A;  2D5D A;  1HQR D;  5CMD A;  2ZXP A;  1H9J A;  1RCV D;  3FDT A;  1AZQ A;  2Z4H A;  3DEP A;  1EY8 A;  1SE2 A;  1OXV A;  3KLS X;  1YNJ C;  1STB A;  1PRT C;  1KAB A;  1GHK A;  1FGB D;  1FR3 A;  1PRT F;  2XN9 C;  5CV5 A;  3H09 A;  4IN3 A;  5CV4 A;  3TP8 A;  3K59 A;  1WTP A;  2MPM A;  3KLS A;  4ZAI A;  1TU2 B;  2D2C C;  1JWM D;  3MXG A;  1SEB D;  2BE5 C;  4A3K B;  2EJF C;  2F0M A;  1PYW D;  5FK9 C;  2RDG A;  4IFD J;  3HOZ B;  3H94 A;  4IUN A;  1I4H A;  5DAU A;  1SJH D;  1JOK A;  3JAM L;  2F0I A;  1BCP B;  1F9S A;  4HSP A;  2YYZ A;  5CR3 A;  4I7Z C;  1I4X A;  1SYF A;  1HRJ A;  1RDP D;  2IT1 A;  3ND8 A;  2MJ8 A;  2J0T D;  4HED A;  4V0B A;  2WIN B;  1A2U A;  5C3X A;  2EDG A;  4OGQ C;  2E2I B;  4CJ0 B;  1SBB B;  2PPB C;  2NB0 A;  1JIC A;  4ODG A;  1L0X B;  3C1F A;  5EPJ A;  1F2M A;  5JEA H;  1K83 B;  4J1M A;  3E5S A;  4C3I B;  1DJR D;  4ME5 A;  4C56 C;  3A8K E;  1I4Q A;  3PUW A;  3IL8 A;  3I4L A;  1IW7 C;  3RD4 A;  1MGS A;  4KD3 A;  1UEA B;  1B4O A;  3IFD A;  4A3G B;  1QG7 A;  2F1M A;  4PMW A;  4WRD A;  3N52 A;  3EQL C;  2ID0 A;  1CA6 A;  3ONA B;  1RKN A;  1DOM A;  5EPL A;  2I46 A;  1I3Q B;  1LAC A;  3N6R A;  2N55 A;  1X3Q A;  2KED A;  3H6M A;  1NUC A;  3BDO A;  1OXT A;  2Y0S B;  4N9T A;  2E2D C;  3TBI B;  3HOV B;  4KD4 A;  4ZKB B;  2BA1 A;  1DZ1 A;  4KV6 A;  1SFO B;  1PTO C;  4PV1 C;  4K5V A;  4C1N I;  2A69 D;  1ENC A;  1LT4 D;  3D4W A;  1WTO A;  4BBR B;  3K5N A;  2EVB A;  1H9S B;  4EVO A;  1LTG D;  1FYC A;  3R3O A;  3GTM B;  3NBH A;  1G8Z D;  1JC7 A;  3NPP A;  1TS3 A;  4RCN A;  1W6J A;  1SE4 A;  2M2L A;  3J81 L;  3S14 B;  4DN4 M;  3LWU A;  1BQQ T;  3R93 A;  2WP8 J;  2PZU A;  1C4Q A;  2R92 B;  1XXG A;  1EZ8 A;  1C48 A;  5ELC A;  1F9R A;  5FO7 B;  1VF5 C;  4RGN A;  5K36 H;  1ET6 A;  3HZX A;  1PTO B;  5D3I B;  4N9P A;  1IKL A;  1SNP A;  1TWA B;  1DD2 A;  3TP7 A;  1FD7 D;  3BYT B;  5CV7 A;  4Y7N B;  3A7L A;  3AB9 A;  2KUM A;  5HGT A;  1Q12 A;  1XYI A;  4HCS A;  3ERQ A;  4PQX A;  5CYU A;  3VR5 A;  1A6X A;  1XX8 A;  2KHS A;  3HKZ B;  1I4G A;  4A3J B;  1LT5 D;  4BA2 I;  1F2Z A;  2K03 A;  1D2B A;  4DFA A;  5LHY 1;  4KKS A;  5EKL A;  3I4M B;  1IKM A;  2A6E C;  1B9M A;  3SR1 A;  1Q90 A;  2BDN A;  2EYJ A;  2Z8L A;  3VR4 A;  4LMQ D;  1PMR A;  4IQZ A;  4WOR A;  2WV6 D;  5C5M A;  1S5C D;  4C2M B;  1B2T A;  1G29 1;  2KCC A;  1RHP A;  1VDZ A;  1X3P A;  2EY1 A;  3ZYY X;  3RZO B;  2KJX A;  4FF2 A;  5C0X G;  1D1I A;  3FEW X;  4DAY A;  2V4D A;  3S16 B;  3SEB A;  1EIG A;  1TS5 A;  5FO9 B;  1U4L A;  2DN8 A;  1STG A;  2CW0 C;  4PMB A;  1Q1E A;  4O42 A;  3NHH A;  1R4Q B;  2RSO A;  1TKW B;  1R4P B;  2CHB D;  1WTQ A;  2FJ2 A;  2NVT B;  1E2Z A;  4FF4 A;  4ZUI A;  2B2U A;  4DNT B;  2NN6 I;  2RDF A;  2B2T A;  5FKA C;  5CBA E;  3GTP B;  2K5Q A;  4PMC A;  1TQO A;  2WAQ B;  3MTS A;  5KND A;  1WTR A;  2JE6 I;  2K7V A;  3D8G A;  1U4R A;  2B2V C;  3PIP 3;  5C5L A;  1YNN D;  1GHJ A;  2ICI A;  2AUJ D;  2K33 A;  4ID6 A;  2PZW A;  1KTK A;  1DOK A;  3SK8 A;  3M4Y A;  1LLR D;  3VA5 A;  1AW7 A;  5BN4 A;  3KF8 A;  1QE6 A;  3WOF A;  5C3W A;  1K8O A;  4F7X A;  3T53 B;  3DHQ A;  3C46 A;  4S3S A;  1I4R A;  3C1E A;  2A6H C;  4NMZ A;  4QUC A;  1CHQ D;  2K05 A;  2VNU D;  2I07 B;  2B8G A;  2HCC A;  2MHV A;  1B9N A;  3AMU A;  2E2J B;  1D1K A;  4FF1 A;  1HXY D;  3GTJ B;  4KHZ A;  2OF1 A;  3PMF A;  2MP1 A;  2R61 A;  4C3J G;  2XIW A;  2YU9 B;  5T1I A;  5JAV A;  3NWS A;  4TKO B;  3MEH A;  1J9O A;  1GUT A;  3A55 A;  5AFW A;  3RLF A;  3PUV A;  1CFM A;  2HDM A;  3JAM E;  5G3L D;  3GD7 A;  5D3D A;  1AZP A;  1UAP A;  3T56 B;  1JB3 A;  1H9R A;  2QDB A;  1ILP A;  4CKE A;  1SNM A;  1B3A A;  4L8J A;  5KRU A;  3CQZ B;  4B9W A;  3TN2 A;  1B44 D;  1EU3 A;  3K5L A;  1GXD C;  4FYD A;  3J7A F;  1SYB A;  3D3R A;  3HOY B;  2C9O A;  3K6O A;  1H9S A;  3L3O C;  1M8A A;  1CZW A;  4KKU A;  3DWP A;  1O7Y A;  4KTA A;  3QB3 A;  2HDL A;  4KY6 A;  1VCI A;  2DY8 A;  4L63 B;  1CTM A;  3VR6 A;  1WTW A;  1VMP A;  2EYP A;  5CV6 A;  2F0V A;  4KMU C;  4XQJ A;  2QCP X;  5DM7 3;  2IL8 A;  1BDO A;  1AEX A;  4RFB A;  2M00 A;  2IX0 A;  3DM1 A;  2WKD A;  1Z6H A;  4KKT A;  4IAL A;  1SMY C;  1RTO A;  2IX1 A;  2L9H A;  2NTS A;  4GZY C;  1MI2 A;  3M4O B;  5DM6 3;  2EYF A;  2XRS D;  3T13 A;  3HGB A;  2AUK A;  2HUG A;  5IOD A;  1GUS A;  4H13 C;  3NK9 A;  4FXG C;  1PFN A;  2NWG A;  2H1E A;  2K5W A;  3MFY A;  4TSS A;  4F88 A;  3D4R A;  3F2U A;  5TSS A;  3VR2 A;  3K57 A;  1PDQ A;  2RDH A;  2NZ1 D;  1NSN S;  3K7A B;  2G9D A;  1BR9 A;  3G7L A;  1T5X D;  1D5X C;  1AN8 A;  2L12 A;  3GTK B;  1LTA D;  3K0Y A;  1WVL A;  4CHT B;  4C3I G;  3J81 E;  4A3I B;  4XYQ A;  3GV6 A;  2CQA A;  1TII D;  5A2Q L;  2RVL A;  5JJZ A;  3D4D A;  3VR3 A;  5C4J B;  2BOS A;  2A68 D;  2XWJ B;  1LT6 D;  1S5E D;  4LJZ C;  3T51 B;  4G7O C;  3NXW A;  1PZI D;  3RUZ A;  3QIA A;  2F0S A;  2BDO A;  1K8M A;  1TWC B;  4TRD A;  4A93 B;  4X3T A;  1S5B D;  1WD1 A;  3FRP B;  3NWT A;  5NUC A;  4IFD G;  1IYV A;  4KJO A;  3OOC A;  3IAY A;  2HQE A;  2E76 C;  2LFN A;  4IUQ A;  5COR A;  2ZXO A;  1OXU A;  4X3K A;  3GQB A;  4DXG A;  1R9T B;  2M9V A;  3C3L A;  1E2W A;  3R8B A;  4CBV A;  2PZT A;  5CGK A;  2DNE A;  2EJG C;  4KN4 C;  1BOS A;  3LX0 A;  5M3M B;  1ICW A;  1PRT B;  2EE1 A;  3J7A V;  2LKV A;  3MXN A;  5G3L F;  2EOT A;  5IGG A;  4OHJ A;  1F9P A;  2QKI C;  3A54 A;  1D6E C;  1HQM C;  5C0X H;  2PW7 A;  3HOW B;  3I70 A;  3OWF A;  1KAA A;  3SVM A;  1STH A;  1ONL A;  2VXW A;  1WCM B;  4OL7 A;  5C4X B;  3MHB A;  3L9A X;  2KA7 A;  2EYH A;  1RTN A;  5IGD A;  1LAB A;  2GA4 B;  5M9O A;  4RHS A;  4LK1 C;  4BY1 B;  4F87 A;  2A74 C;  4RKB A;  3OPO A;  2B2V A;  2WAC A;  2RKS A;  4DNR B;  3FVQ A;  1SYC A;  3S1M B;  1GUN A;  1QCB D;  3MWY W;  1I50 B;  2C5C A;  5I9P A;  4QMG A;  5C0X I;  5DEH A;  1ROD A;  4XT3 B;  5I6Y A;  2Q8T A;  5FO8 B;  1OXS C;  3I3C A;  3CKI B;  4DF7 A;  3M7N A;  1OXX K;  1Y8O B;  4HAE A;  5K5P A;  3K5M A;  1BO0 A;  1DYQ A;  4YIJ A;  1SYD A;  1AFP A;  2RA4 A;  1EEF D;  4UDU C;  1EY0 A;  3I72 A;  1IYU A;  1EYD A;  1D5Z C;  2F0D A;  3CRL C;  3Q22 A;  3BS1 A;  3NTH A;  4M8A A;  1MSH A;  1EWH A;  2X6G A;  2F3V A;  5FLX L;  1CQV A;  2XRQ D;  4F8M A;  2EY2 A;  1KDB A;  1STN A;  3U9S A;  2FMM A;  3X3M A;  4FNF A;  3PUY A;  5IGC A;  2FFK B;  1F9Q A;  3GTO B;  2PYK A;  5CV8 A;  1H9K A;  1U9R A;  4RKL A;  3MVV A;  3S1N B;  1IL8 A;  2A68 C;  1CT1 D;  4XYO A;  1D5M C;  5EGT A;  4NP5 A;  1GJX A;  3S2H B;  1EYA A;  5IT9 L;  2TMP A;  4FXD A;  1ENF A;  4OIJ A;  3GO5 A;  1NCV A;  2PNR C;  4H44 C;  1EYC A;  1X32 A;  3VYU A;  2L5T A;  1EY6 A;  1WTX A;  1EFI D;  1SND A;  1Q3L A;  2PQE A;  4HN7 A;  1A15 A;  3EFX D;  2F0H A;  1I6H B;  2F0O A;  3D31 A;  5EPK A;  4ABN A;  1JE4 A;  5BN3 A;  1KLU D;  2EYM A;  3SK5 A;  3HEJ A;  1ZKO A;  5EKI A;  3KLR A;  1STA A;  1U4M A;  5ELF A;  4M1U B;  2RQX A;  3ND9 A;  4G57 A;  1BXT A;  1LO5 D;  1G2T A;  1SNC A;  1VMC A;  5EJW A;  3FMC A;  1JWS D;  4EQO A;  4BBS B;  2Z4I A;  4RGO S;  2RBM A;  1TS2 A;  3TZU A;  4PNY A;  1T5E A;  2K04 A;  5KGU A;  2A73 B;  1SAP A;  2EYO A;  5C6A A;  2BCO A;  3K58 A;  2L11 A;  5JEA J;  5KNB A;  2B8F A;  4MIU A;  2B39 A;  2IW3 A;  4FO2 A;  2ZT9 C;  3SHL A;  1HUM A;  3OMC A;  2DY7 A;  2J4X A;  2NYZ D;  4K8J A;  4HCE A;  1QJO A;  1AP0 A;  2X69 A;  3HOX B;  1JOO A;  3A8J E;  1RF2 D;  3J7Y W;  4XIG S;  4K2L A;  3HP3 A;  3I91 A;  1B1Z A;  5IOC A;  1JR0 D;  3DUZ A;  5I2Y A;  3Q6S A;  3SE0 A;  4DAV A;  1W6K A;  5JVH 3;  1SNO A;  3VYT A;  3E0J A;  4IZ8 A;  3GP7 A;  1BCP D;  4C1N K;  2TSS A;  4KI0 A;  5ELD A;  1ZYR D;  4DAP A;  2JA7 B;  4QF4 A;  4K6L A;  3HG9 A;  3KBG A;  1BUV T;  3LWE A;  5IGF A;  4G7Z C;  4G7H C;  4L6T B;  2L4N A;  1KDA A;  3J80 L;  2A69 C;  3KBX A;  3MXP A;  3S1Q B;  5ELB A;  1ET9 A;  1HTP A;  1YNJ D;  1STY A;  5JPN C;  3E6Z X;  4JBW A;  4BWG B;  3BZD B;  4KY5 A;  5A2Q E;  1EY5 A;  4ZYS A;  4RA8 A;  5C4H A;  4WFN 3;  4HR7 B;  3A56 A;  3OIQ A;  2R93 B;  4Q5V A;  1ML0 D;  5A35 A;  3S2D B;  4JK1 C;  1QWY A;  2BE5 D;  4CJ2 C;  3DMU A;  2JA6 B;  2F0U A;  4IFD H;  4HTH A;  3S9W A;  3NTI A;  5ISR A;  4A3F B;  4U68 A;  4BY7 B;  1EEI D;  4DK1 A;  2JEB I;  4RGT A;  3PUZ A;  3Q23 A;  2MGS A;  1CM9 A;  2F0N A;  1HCZ A;  1TS4 A;  4ZLT F;  3HS0 C;  3OWE B;  2IPK D;  4FXK C;  2XSC A;  1G91 A;  2CVR A;  3WOE A;  4RH6 A;  2F03 A;  4XTC S;  3NE5 B;  2NBF A;  3T16 A;  1EOT A;  4UAI A;  3FPP A;  2AWO A;  4IUU A;  4J8Q A;  4G4K A;  2O2L D;  3GTQ B;  1RD9 D;  3RMH A;  2SOB A;  1KLG D;  3AU7 A;  4ZK9 B;  1TY0 A;  1O7Z A;  4O1N A;  2K5D A;  4BA1 I;  3MC0 B;  5IIF A;  1HFG A;  1S4Z A;  4DXF A;  3KUP A;  2VUM B;  2B63 B;  5KYL A;  1HPC A;  4XQN A;  4HMJ A;  4XXE A;  5M5X B;  2L55 A;  2KEC A;  2D62 A;  2NN6 G;  4XQQ A;  1CZG A;  1IW7 D;  1Y8P B;  2K28 A;  4IUP A;  1CI3 M;  1HTL D;  3DEO A;  1UNS A;  3TZD A;  4AYB B;  3NUC A;  3M3Y B;  2PMZ B;  5M3F B;  1PTO H;  4I65 A;  3P1H A;  2R3Z A;  1TWF B;  3NQT A;  5E4W C;  3CHB D;  2FIN B;  3OSO A;  1STE A;  3PV0 A;  3M85 A;  3MAQ A;  2F0W A;  3VYR A;  4CKB A;  2H4O A;  4QCL A;  1KNA A;  1LTS D;  3EJI A;  3I8Z A;  4MN3 A;  1PTO D;  1MBY A;  4MHE A;  2ENB A;  4C3H B;  3W3A A;  5IGB A;  2QF7 A;  2HCI A;  3KK7 A;  4KJN A;  1F2L A;  2ZXR A;  4A3E B;  1JOR A;  1LTB D;  1PLF A;  1V8Q A;  1E2V A;  3M7G A;  4OIK A;  2F0L A;  1YNN C;  3HOU B;  2AQ1 B;  2D9U A;  1BCP C;  2FMC A;  1LTR D;  4RHR A;  5FOB B;  5CBE E;  1A3V A;  2IJ0 A;  1BCP F;  3PIO 3;  1F77 A;  2KCN A;  3QO2 A;  5FLX E;  1JCK B;  3MZ5 A;  4KN7 C;  3C2P A;  2VB3 X;  2A5H A;  2Q8I B;  2JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...