4KY7A

Crystal structure of staphylococcal nuclease variant delta+phs v74d at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEDEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V74D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky7A00
3OMGA 3NQTA 4IZ8A 4K2LA 2EYHA 1EY6A 5EKKA 3EVQA 5CV4A 2F0QA 2EXZA 4ME5A 4WRDA 3PMFA 5F2DA 5M9OA 1TR5A 3D6CA 5KEEA 1JOQA 3QOJA 5C5LA 1AEXA 1F2MA 2OXPA 1A2TA 4EQNA 5KGUA 1TT2A 4TRDA 1F2ZA 3ERQA 3HZXA 4PNYA 4DGZA 1KDCA 4EQOA 2PZUA 5JOBA 3P1HA 2EYOA 2EYLA 1KAAA 5I9PA 1ENAA 2LKVA 2SNMA 3BDLA 2PYKA 3H6MA 3T16A 3T13A 1EY5A 3MVVA 2EYPA 4NKLA 3NHHA 2ENBA 1EY4A 2F3VA 1A3UA 4NDXA 5CV6A 3SK8A 3C1FA 2F0KA 5JAVA 5CV7A 3QB3A 4KY7A 1A2UA 1KABA 1SYBA 3EJIA 4K5WA 2F0PA 4KTAA 4DU9A 4KJNA 1EYDA 4K5VA 5C5MA 1F2YA 1II3A 4N9TA 1SNOA 1EZ6A 2F0OA 5CC4A 3MZ5A 5KRUA 4ZUIA 1TQOA 2EY5A 2HQEA 4QF4A 5NUCA 1SYEA 2WACA 4H7BA 4S3SA 5IGFA 1SNQA 2KQ3A 2RKSA 1SNMA 2QDBA 3C1EA 4K6DA 3P75A 3SK5A 1JOKA 3S9WA 1EYCA 3SXHA 2PW7A 2PZTA 2SOBA 3D4WA 3OWFA 5KYIA 4HMIA 4OL7A 4K8IA 1SNPA 5ISRA 5IGCA 1EY9A 5CGKA 3TP6A 1SYCA 1JOOA 2F0UA 2F0FA 3E5SA 5CV8A 5I6WA 5CR3A 5IGDA 3TP7A 2PQEA 4DF7A 5E1FA 2F0JA 5DAUA 1KDAA 5CV5A 4RKBA 5KYLA 5C3XA 1STYA 4F7XA 2F0DA 2SNSA 3MEHA 3NK9A 3OMCA 3OSOA 5KIXA 1SYFA 4G57A 1IHZA 5EKLA 1STNA 3DMUA 1EYAA 2PW5A 3NP8A 3U9OA 5C6AA 4EVOA 2F0IA 4MIUA 2F0GA 3QOLA 5EGTA 4KJOA 1NUCA 2EYFA 2F0EA 2KHSA 5C4ZA 2PZWA 5I9OA 2F3WA 4IALA 4R8NA 5IGGA 2F0TA 2O4XA 4RKLA 2F0WA 3HEJA 3R3OA 4KHVA 3DHQA 4QB4A 5E3FA 1STBA 2F0LA 3V2TA 1RKNA 1A3TA 4E6IA 4ZUJA 4EQPA 3SHLA 5J22A 4DFAA 2EYMA 3ITPA 3NUCA 4KV6A 2OEOA 5IIFA 3NXWA 4HTHA 4J1MA 4I65A 3TP8A 5HURA 5CV9A 5K5PA 2F0VA 3BDCA 4KD4A 1SYDA 3MXPA 3EROA 3VA5A 2F0MA 4B9XA 4QMGA 4ZQ3A 4PMBA 1JORA 1KDBA 3SK6A 1A3VA 2EY2A 5C4HA 3MHBA 2F0HA 5IGEA 5IOCA 1EZ8A 4N9PA 4PMCA 5J39A 1EY0A 1EY7A 5I6YA 2EY6A 4NP5A 3RUZA 2RDFA 1NSNS 3D8GA 1SYGA 4K2KA 5DEHA 1EQVA 4J6HA 5IODA 4NMZA 4HMJA 4KD3A 4F8MA 3LX0A 4IUNA 4ODGA 4WORA 3TP5A 5HGTA 4K5XA 2OF1A 4LAAA 4KY5A 1STHA 2RBMA 3D4DA 2EYJA 1EY8A 1SNCA 2F0NA 5C3WA 4YIJA 4B9WA 2M00A 5J1ZA 1STAA 4K8JA 2F0SA 5IGBA 2NUCA 3TMEA 3SK4A 2EY1A 1ENCA 3SR1A 4ID6A 4K14A 1U9RA 4KY6A 1SNDA 1STGA
chains in the Genus database with same CATH superfamily
4K2LA 3A74A 4AIMA 2DGYA 3PO3B 4XT1B 4FXGC 2IHFA 2VNUD 1E2ZA 4JI1L 2A6HC 2ZJRA 1E2VA 2UXDL 4IOCA 2WIIB 5G3LD 1NE3A 1NR2A 2MFIA 3ERQA 4LJZC 4QY7A 3SVMA 1VQ5A 1Y69U 4DR3L 3GO5A 4BY7H 1J9OA 3W1GA 3HP3A 1K3RA 2Q2IA 1TWFB 4A3MB 3H91A 2RHSB 2AHOB 3OW7A 2KCMA 2YTVA 2Z6KA 4O42A 1KAWA 3PUZA 4DU9A 1U4LA 3JAMi 2CH4A 4DV1Q 3EFXD 4CKCA 2MPMA 4C3JG 2EY5A 4A4IA 1N34Q 3S14B 3TDQA 4Z9CB 1LTLA 4S3SA 4RGOS 2RA4A 1VQ4A 1A0IA 1SNMA 3RN2A 2BDOA 5FLMH 2DJFC 2Q2TA 1X32A 3A8IE 2F52A 4GLVB 3ULLA 4A3DG 1SFOH 2ZXOA 3BYYB 4RKBA 2Z9HA 4V190 1QB5D 2SNSA 2ALYB 4G7ZC 1SYFA 5EKLA 4OXPA 2JEBI 4DV0Q 5LMUQ 5JPMC 1ZKOA 5M5YB 2BE5D 3R2IA 5C4ZA 2VW9A 4A3KH 1V43A 1Q46A 1CQVA 3GTQH 3L2PA 1NCVA 4KHVA 3DHQA 4EQPA 4WJ4A 2K32A 4IPDA 3SHLA 1PFNA 2XGTA 5IP9G 3ITPA 2RCFA 1K8GA 4PV1C 1PRTB 3VR6A 1I3QH 3EQLC 2R92G 1J6QA 5C4HA 3HOVH 3GTPB 3DEPA 1H9JA 1E1OA 3PV0A 3E6ZX 1EQVA 4OX9L 2G9DA 4DXGA 1TVXA 3MC0B 4K5XA 1PRTD 1LT5D 2Z6KC 3D4DA 2I07B 3OOCA 5JVH3 2EVBA 2NUCA 5EPJA 2VB3X 3K0YA 1STGA 3I3CA 1EWIA 1KLUD 1WFQA 4WRDA 2ZM6L 5IYBG 4GLAC 2MQHA 4L5TA 1WTXA 1OTCA 1D1KA 4BBSB 1KRSA 3A55A 5C0XH 2M2LA 2B2TA 4C3IH 4EQNA 5J3BA 1C4QA 4O1NA 5LMNL 4IPHA 3HOWG 4DAYB 2K6AA 1NAPA 2KJXA 1KTKA 2WB1B 4A3FB 2CWAA 5IYDG 2EYLA 3PO2B 1JQYD 4IN3A 3M4OB 3FDTA 3WOEA 1XPUA 3AFQA 2I0QA 1H9SA 2ENBA 1B9NA 5D14A 3SK8A 2UUCL 2HHHQ 4R4QA 1JE4A 3EJIA 1IW7C 1EYDA 2YU9B 1DJRD 1WTQA 2O2LD 3JAML 4IQZA 3GTMH 1Z7TA 4DN4M 3S1RH 4XTCS 2IW3A 3C1EA 1MI2A 1PLFA 4LF5Q 3SK5A 3S9WA 1KLGD 5FOBB 3TREA 1VQNA 4IFDJ 3I73A 2CH4W 3DUZA 1C48A 3D31A 3NENA 1R9TH 1VQDA 1B2TA 1LTGD 3A7AB 2EPBA 4KN7C 2VUMB 1QJOA 4J8QA 4IPGA 4LFBQ 1EYAA 4BXXG 1HNWQ 3ND8A 1W3SA 2F0GA 3QOLA 4GKJL 1Y1WH 2KHSA 5EPLA 4CDDC 4HIDA 2ID0A 1IBML 1EOTA 3K0XA 3NWTA 5GQOA 4FO2A 4ZCKA 3FRPB 1XMQL 4QJFA 1SJHD 3LNNA 5TSSA 3NXWA 3CC7A 1HNXQ 4A3BG 2B2TC 2A1AA 1KDBA 1EQTA 1LT6D 3SK6A 2VQEL 4FF3A 2QF7A 4CDFC 3KJOA 4JYAL 2B29A 2CHBD 1E22A 4LF9Q 3RLFA 4LUZA 4I7AA 1E1TA 1AP0A 5HGQA 4BBRG 3SGIA 1N33Q 1W6JA 2HUGA 4XXEA 5C3WA 2XVSA 5EKIA 4TSSA 1YNNC 2PMZB 4IUQA 3CCQA 2K01A 1EYGA 1DM0B 1LTAD 3NPPA 2F03A 4BY1B 3BZCA 2KCNA 4LFCQ 2LSSA 3S17H 3EVQA 4OHJA 2JA6G 1TWAH 2R93B 2JA8H 1HUNA 1Y1VH 3EN2A 2BA0A 5IT9L 3KJPA 1I6HH 2N88A 2EJMA 3HZXA 2K14A 1X3GA 3KOJA 4GN5A 4A93G 5C4XG 4IURA 1VQEA 2K50A 4JI3L 3T13A 1HNZQ 1ICFB 3CCSA 2OCEA 2A68C 5CV7A 4A76A 1D7QA 1EIGA 3L0OA 4H44C 3J7ZC 2NN6H 4OO1H 1SYBA 2XSCA 1T5EA 5BR8Q 4JVZA 3VDYA 2IX0A 3NTHA 4JI7L 2CCZA 1WCMG 1H9RA 2KQ3A 3I72A 2TMPA 3RMHA 4A3LG 3HOZH 3DWQA 3PSIA 2ATWA 4AH6A 4DR4L 1PYSB 1HR0L 3S16B 3AYHB 5FLXE 2K33A 4MTNA 2R7DA 1B8AA 1A6XA 1NR4A 3BVMA 3TRZA 1AFPA 5D3DA 3J81E 4DV2L 4MZ9A 3FEWX 2F0IA 3T51B 3OHXC 2UUBQ 2F0TA 3VYSA 2B63B 1CZGA 3NWSA 1KNEA 1HA6A 1DD2A 1SMXA 2AKWB 1M8AA 4A3IG 1UEAB 1I94Q 5EJWA 2F0MA 3CCUA 2LXKA 3L9AX 1JORA 3HOUG 2JA7B 4PMCA 3CP0A 1EY0A 1D5MC 2ZTDA 2RDFA 1JJGA 1WVLA 1G2SA 2HIXA 3MAQA 2K28A 1FNUA 1J5EQ 1EL0A 5HGTA 1DYQA 3PGZA 2XIWA 4XT3B 3DM1A 1X3QA 5IY0A 4DV1L 2FINB 4ABNA 2K05A 1AE3A 1L0WA 1N34L 2L5TA 3J7A5 5E7NA 1IBKQ 4ME5A 3PMFA 1WD1A 5BN5A 1VQAA 5COYA 1KNAA 4JW0A 4DPGA 4CGYB 3AMUA 4H02A 1YITA 3S2HB 1TT2A 5A2QE 4YWKA 1TKWB 1BR9A 2JA9A 2B2UA 2YTXA 2MJ8A 3P1HA 4DV0L 4AQYQ 1JJ2A 1UE6A 3H94A 4B3TQ 4C3HB 1Q81C 4F87A 2Q2HA 3BDLA 1I4QA 3MVVA 2UU9Q 4QUCA 1BDOA 1ENFA 4YY3Q 2HQLA 2V1CC 3CAMA 3TQYA 3I4MB 1VQ9A 2R7FA 1A63A 2A5HA 1AZPA 2F0OA 3S15B 3KYHC 4ZUIA 2E2IB 1SYEA 1B44D 1G91A 1PH5A 2L55A 2PW7A 1TWGB 3MFYA 4OL7A 1OXUA 1SNPA 3GQBA 5CMDA 3HOXB 1VF7A 1JWUD 5C3EG 1VQHA 4HJ5A 4A3EG 5A35A 2LS01 1PFMA 3MXNA 2NZ1D 1B53A 2NVQB 3MEHA 4PMWA 4FF2A 1SAPA 4QGUA 1OXVA 4KJOA 3WDNA 5K36G 1RJTA 2PZWA 4IALA 5AFWA 1YNJC 1TWCB 3K7UC 2O5JC 4DV4L 3RZDB 1EEFD 1MGSA 2Y0SE 3JC66 5E3FA 5DM63 3LWUA 4DAMA 5EPKA 4DA2A 1B1ZA 1YEZA 4DFAA 1GOZA 4J1MA 3BDCA 4KD4A 1CSQA 1GXDC 1VS0A 1CI3M 4KMUC 1YIJA 2Y0SG 2D0OA 1RIPA 4NMZA 1YNXA 2JK8A 4WORA 4C3JB 1A62A 4P74A 2HHHL 2MUYA 3RLNA 1O78A 5IGBA 2Z6BA 3OTOQ 1Q82C 1BBXC 4RGTA 2KEEA 3OMGA 3PF5A 5M5XH 4A3DB 4LF5L 2EXZA 1FGUA 4OIJA 1TXYA 3H0GH 2WKCA 4IJLA 3U4VA 4N8FA 2A6HD 1PH6A 2DJGC 4LFBL 4RMFA 4CKEA 4HEDA 1HNWL 4RCOA 4A3CG 1IYUA 5C44H 3CU7A 5CV6A 2D9UA 2R92B 3VR2A 3A7LA 2HD3A 3JAMc 1HNXL 2ICEC 4LMQD 4DUZQ 3GDEA 4JOIC 1ICWA 3NBHB 5IP7G 1PH8A 4RFBA 3I8ZA 2JA5H 2EZVA 4DR7L 1WD0A 1UE5A 4GKKQ 1DGSA 4IJHA 3SDZA 1PH3A 3B6YA 3H3VC 3E5SA 1Q86C 1O7LA 5E1FA 1J8IA 2N8NA 1N33L 2B3GA 2E8GA 3OMCA 3G6EA 1FVIA 2R3ZA 2PW5A 2R7ZH 2F0EA 3I56A 2KHIA 1OXTA 2WAQE 3E0JA 3F2BA 3HOYG 3HEJA 3NEMA 4KKTA 4LFCL 4DR6Q 2LMCB 3K58A 1L1OA 1NY4A 2H1EA 3HOWB 2OEOA 1B70B 2IX3A 2B8GA 2WAQG 3D4RA 2QEXA 3QJYA 1QCBD 3Q24A 1PH9A 3BG3A 1DOKA 2E2JH 1LTBD 2Z1CA 2EY6A 4LNQA 5IODA 1HNZL 4QQBX 4PZ8A 1RODA 2B2VC 3M7NA 1W6KA 1SE3A 4X64Q 2IJ0A 4UDUC 2MNAA 1STHA 3KFUA 4PG3A 4C3HG 5BR8L 4YIJA 3EBEA 1SSOA 3TMEA 1ZEQX 3G7LA 3BZKA 2QA4A 4ZAIA 2O5IC 4UY8C 4PZ7A 1Q1EA 5CV4A 1UE7A 5M9OA 3Q0AA 3S2DB 3KUPA 1C0AA 1EOVA 1GM5A 3I90A 5FO7B 1I4RA 2K04A 1XPRA 1UAPA 4CJ0B 5M3FG 3VYRA 1FJGQ 1HCZA 1XXGA 1ENAA 3H6MA 2UUBL 4WJ3M 4LF7Q 2F3VA 1XMOQ 4A3BB 2RSNA 4FXDA 5EBCA 1JWSD 2E2HB 4IUVA 4KHZA 4L8JA 1PTOF 4HJAA 2NVTB 2Z4HA 1PTOB 2WINB 3PO3H 4X62L 3MZ5A 1H9MA 4O0AA 1Q1BA 1DCZA 2E5LQ 3I4NG 1ONLA 1IW7D 1SNQA 4BBRB 5CORA 3CCJA 2SOBA 5FLXc 3OWFA 5FJ8H 4QL5A 4DUYQ 1V9PA 1HPCA 4RCNA 1J5EL 3W3AA 5JJZA 1X55A 2VXWA 1CZWA 4RWSC 5JPNC 1LTSD 1TWFH 2B8FA 4A3MH 5C6AA 3U9OA 1O7ZA 2JA6B 1QOHA 2KUMA 1XNQL 2NB0A 2E2DC 4RKLA 1D8LA 1TU2B 3H3VI 4QB4A 1IBKL 4O2DA 4V0BA 4ME3A 4UHVA 3S14H 2EYMA 2J0TD 4IOAA 3NE5B 4A93B 4XYOA 4B08A 2MP1A 1HZ9A 5C4XB 2F3IA 1JB7A 3CPWA 1N8RC 1B4OA 2IL8A 4ZYSA 1H9SB 2VZAA 3BYTB 3OPOA 4AQYL 1SRUA 4B3TL 1WTWA 3T1YQ 2UU9L 3CRKC 1TY0A 2WKDA 5JEAG 5M5YH 4X65Q 4YY3L 5JJKA 1WCMB 2EYJA 4MNOA 5ELOA 4B9WA 3SEBA 4A3GG 4IFDH 4MN3A 3SR1A 4GOPA 3G71A 1U9RA 2D5DA 2B2WA 3NQTA 4K0KQ 1R4PB 2G5DA 1YNND 3WWVA 2JJQA 5D3IB 3D6CA 2YTYA 2JQOA 4F88A 4CJ2C 1F2MA 3HRZC 3TS2A 3GTPH 5HY6A 3J80E 1ET9A 3MWYW 4NB3A 1VQBA 1VQIA 2XRQD 1VQ7A 1RTNA 2EDGA 2ZT9C 3FKIG 4OGQC 1X3PA 4DK3C 3GTGH 2EYPA 3NHHA 4A3IB 1EIFA 5IYCG 3QB3A 4R9WA 4KHPQ 4A3JG 1VQCA 3J7AV 1S5ED 4K5WA 3TEHB 3HOUB 1VQFA 4DNTB 1EZ6A 1ASZA 2A68D 5KRUA 5CBAE 4J15A 4BBSH 2NTSA 1GUWA 2QDBA 2UXCQ 5ELFA 1PXUA 4JI8Q 1EY9A 2N55A 5M3MG 1P8LA 1JOOA 1SYCA 3S1MB 4A3FH 2I5HA 2R6GA 5GAHC 3PO2H 1X54A 3IFTA 5C3XA 1HZAA 1STYA 3M4OH 3QO2A 4G57A 3TZDA 3DMUA 1VQKA 4X66L 1Q8IA 3UE1A 4JI0Q 1QVFA 2L1BA 4NPSA 3OTOL 3AB9A 5IGGA 4R8NA 4XDXA 1WTPA 2ICIA 1CKOA 1OXXK 1LV9A 4IO9A 3QR8A 5J22A 2YU9H 3GTOB 1L0XB 1PTOC 3J81i 2F0VA 4EGVA 4FP5D 2ZXRA 3HKSA 4QMGA 4ZQ3A 1X9NA 2XWJB 2ZXPA 3PUVA 4RH6A 4I7ZC 3GTJB 2KBNA 4P72A 4GNXA 1HZCA 1K8OA 3M4QA 3S1RB 4ALPA 4EX5A 4NXNQ 2VUMH 2ZJQA 1JB3A 4B3SQ 1TS5A 3CF5A 1V1OA 4GLXA 5LMNW 3I4LA 1S5BD 4B3RQ 1I4PA 4FDBA 4DR1Q 1TWHB 2SDFA 1F9QA 4DUZL 1ILQA 3C46A 3LWEA 3MXGA 1B9MA 4KY6A 1BO0A 4IZ8A 4LF6Q 5C3EB 4YCWA 5LL6S 4A3EB 4DV6Q 2F0QA 1XWEA 2GVBA 3K7AB 1TR5A 4JBKA 1FNWA 2D0PA 1JOQA 4GKKL 1FGBD 3F1ZA 3QOJA 1C8CA 1N36Q 2J4XA 2RDGA 2DNCA 5ELBA 3HFZB 1WYDA 5ELEA 2NVXH 1TS2A 1CQFA 2Z4IA 1SE4A 2RQXA 1VQPA 3WOFA 1K83B 3KK7A 2PQAA 1Z6HA 2FFKB 3CCRA 5I2YA 1I50B 4X3TA 4DR6L 3R2TA 5JAVA 3K8AA 2HDMA 3Q23A 4BY1H 1PH4A 2Y0SB 3CW2C 3L7ZC 1I6VC 4BY7G 3CC4A 4LK1C 2R93H 1KXLA 2A8VA 4HAEA 1YZ6A 2CQAA 4HMIA 4DK6C 3S17B 5IGCA 5DM73 3K5OA 1QNUA 4H0LC 2F0JA 5DAUA 4AYBE 4JI5L 4X64L 4JV5Q 4QUFA 5FLMG 1WTVA 1NUCA 4QIWE 2F3WA 5EAYA 2DY8A 2BH2A 3R3OA 2QCPX 2GN5A 4AYBG 3W1BA 4E6IA 1CA5A 4ZUJA 4B3MQ 3W2DA 1VQJA 3V05A 1YNJD 1E2WA 4KI0A 2KEDA 2AQ2B 5AJ3Q 5JJLA 1X3EA 5FLXL 1S5FD 4A3KG 1AZQA 1S72A 2KCCA 1XTCD 1W2BA 3M3YB 3J81L 2QW7A 5I6YA 1FJGL 3S16H 3K5MA 1GHKA 3GTKB 4J6HA 4U673 4LF7L 1D2BA 2I46A 1V1PA 4FYDA 3TP5A 1CKMA 3O13A 1E0BA 4XYQA 3CCVA 3FHWA 2VY3A 1ZYRC 2F0NA 3HOVG 1YHAA 1Y14B 2B63H 2GA4B 4TVAB 3R93A 3K6OA 2E5LL 2F4IA 5M5WH 3KDFA 1HRJA 4BA2I 3STBC 3MXNB 3W5OA 2B2YA 1G51A 2AQ3B 3DWAA 2JA7H 1A2TA 4DUYL 4HSVA 3UI2A 1DXMA 4JI4Q 2JSOA 4L63B 4CBVA 4FF1A 2GVAA 5JOBA 3U4ZA 3HOYB 2EYOA 4DAPA 2D62A 5C0XG 4RG1A 4M8AA 3X3MA 1QUQB 4C3IG 1XTDA 4NXMQ 1HR0W 4CDCC 4C2MH 1E7ZA 2WAQB 1A2UA 4G4KA 1PH7A 2K7VA 3CRLC 1MSHA 1PH1A 2ZTCA 2XNAC 1WTOA 5A2QL 4DKAC 5LHY1 3I91A 2XN9C 3ZJYC 3H3VH 5ELNA 3S2HH 5LMUL 2X69A 2N78A 4YWLA 4QCLA 4UAIA 4X65L 5GADC 3NK9A 2B39A 2RF4A 3BDOA 4RHRA 2EJFC 3U58A 4IUTA 3A56A 4ZKBB 2ZJPA 1JJCB 2QDLA 1JT8A 3VR3A 2C5CA 2MHVA 3BU2A 3NQIA 3I4MH 4K0KL 4LF8Q 5KEEA 3S15H 2OT2A 2NVYB 2KECA 2E2IH 1DOLA 3VA7A 5M3FB 5T1IA 4DK1A 1PDQA 2B2YC 3K59A 2P5ZX 2OQKA 3MXPA 1Y1WG 1TS4A 1KC8C 1TWGH 5JJIA 5IGEA 3HOXH 2FHTA 4N9PA 5J39A 3KF6A 4L5SA 1X56A 1YJWA 1NNXA 3D8GA 4N8X1 1K9MC 3FP9A 2NVQH 5FKAC 3FVQA 4DNIA 1KD1C 3D3RA 4L5QA 3I4NB 4KHPL 1LTRD 4IPCA 1U4PA 2BA1A 1TWCH 2F0SA 1BVSA 3RZDH 2UXBQ 3SK4A 4DAVA 2TSSA 1KL9A 2UXCL 3AQQA 2DN8A 3J7YW 2B2UC 1YJNA 1HA5A 3J80c 1SEBD 4G7OC 4LFAQ 4X3UA 4JI8L 3M4YA 2OXPA 3SE0A 4ZKCB 4HCSA 3MXUA 1CUKA 5ELCA 1K28A 4EQ5A 3PIOA 3S1NB 1PZJD 4PZ6A 2YYZA 1L1OB 1KAAA 2JA8G 3DXJC 4C3JH 1Y1VG 4JI0L 2LKVA 2SNMA 4DK0A 1H95A 3AU7A 3KF8A 1KQSA 2XTIA 1IZ6A 1CFMA 2L15A 1DZ1A 4NDXA 2KVMA 2IWHA 3CMAA 3IL8A 2HCCA 1CK1A 4A3DH 1IKMA 3H09A 2HQEA 5NUCA 2CKZB 3KLWA 5CBEE 2K1BA 4PQXA 1FL0A 3PIPA 4X6AH 3C2PA 1UNSA 1VF5C 2NN6G 4OO1G 5M5XB 1JC7A 2KCTA 1T5XD 1G6PA 5KNCA 4A3GB 4B3SL 3ULPA 4HJ8A 1VQGA 4B3RL 1X3FA 2VB2X 1IHZA 5IP9H 1HFGA 1STNA 1GO3E 4DR1L 3CKIB 3NP8A 1G291 2L0CA 3HOZG 1Y8PB 2JN4A 1IBLQ 1PA6A 2R92H 4Y52H 2IHEA 2CW0C 1IYJB 3T53B 4LF6L 4DV6L 3H15A 2NYZD 2IT1A 5E4WC 3NTIA 1GUOA 2C35B 3CPFA 1N36L 3UDIA 3IAYA 4LF9L 3J7AF 4KKSA 5L37A 2A6ED 4LUOA 3FKIB 3G48A 1RD9D 4LF4Q 1LT4D 4RA8A 3OIPA 4FVMA 3RZOB 1PVOA 2A73B 1NMFA 1PMRA 4A3JB 2KOLA 1CKNA 2PO4A 5I2XA 1EQRA 3BVGA 1LLRD 1BXTA 3HGBA 1S5CD 2AUJD 4IUNA 4ODGA 1S40A 5IYBH 4LAAA 4KY5A 4DXFA 1EY8A 2RSOA 1NTGA 1D6EC 2BOSA 1G6ZA 1B7YB 3CCEA 3I2ZA 5H1SE 1K73C 3HOWH 3RN5A 3K5LA 5M3MB 2JE6I 1PZID 2QEJC 3PCOB 5IYDH 1B3AA 2I5LX 5C4JB 1SXTA 3G6JB 4YCUA 3CQZB 1VQLA 4DV7Q 3OYYA 1QZGA 2FXQA 1K0RA 3S1QB 4ZLTF 1QNKA 4TRDA 4GZYC 3CC2A 1CM9A 1BCPF 3BZDB 3PF4A 4JV5L 4TKOB 5IWAQ 4RHSA 1H9KA 4YCVA 5I9PA 5JEAJ 4BA1I 1EWHA 3EA6A 1AN8A 4OO1I 2F0KA 1IKLA 2EQSA 4B3ML 1ML0D 3J80i 1SE2A 5C5MA 1TIID 2QGQA 2DNEA 1Z47A 3GP7A 3P20A 5AJ3L 3RR5A 3S2DH 4R4OA 1K8AC 2SEBD 3KBGA 3P75A 4BXXH 1RDPD 4K8IA 1VQ8A 1HFNA 2BDNA 1U4RA 3LGJA 3NBIA 1GVPA 2E76C 3A54A 5I6WA 4Y7NB 1K8MA 5CR3A 4OONA 1EIYB 4GOPB 1HHVA 1U0LA 1SR3A 3GTLB 3J81j 1I5FA 2K52A 3NBHA 1L1OC 4A3BH 5IE8A 2XRSD 4U68A 3K57A 1I94L 2O4XA 2E2HH 1D5ZC 2NVTH 1PTOH 5G3LF 1BBWA 1PH2A 3TP8A 2K5NA 2Z8LA 3E3XA 4I65A 4BBRH 5K5PA 3J81c 3CCLA 4JI4L 1JR0D 1VQOA 1A3VA 1XPOA 1LTID 1PTOD 3RLOA 2MO0A 4NP5A 3NELA 1BQQT 3DEOA 2F4VQ 1ZXTA 2NTTA 3TZUA 4KD3A 4NXML 1N32Q 4BY7B 4P73A 2JA6H 1KRTA 4IUUA 2RBMA 1SNCA 2A6EC 4LWCA 5EQ0A 4UP8A 3X3NA 2OTJA 1JWMD 4HIKA 4A93H 1C7YA 5F2DA 5C4XH 1F77A 3KLSX 1AEXA 3VYUA 1RF2D 4ULLA 1E24A 1O7YA 5KNBA 4Q0FA 4H13C 1GUNA 3Q6SA 4EQOA 1SFOB 4XQQA 1RL2A 4AYBB 1UE1A 3P7JA 5GROA 1WCMH 3H0GG 3VR5A 4OWWB 4QIWB 4LF8L 2JXMB 4A3LH 4MHEA 3NTKA 4A3KB 4KTAA 2F0PA 3GTQB 1BUVT 4GNXB 2H5XA 1MKHA 3GV6A 4QF4A 4DV5Q 1HXYD 4MTKA 3J80L 5C44G 1I3QB 3AFPA 3ND9A 3U50C 1EU3A 3MA2B 2CWPA 1PRTF 5D65A 3MFGA 1LYLA 1WTRA 3AEVA 5CGKA 3HOVB 3PQIA 1MHWC 2NZOA 2PQEA 4DF7A 5KYLA 1YHQA 5CV5A 2JA5G 2L9HA 1C9OA 2PCFB 1BCPC 3F2DA 2AMCB 2N3SA 5GAEC 2VQFQ 3F8TA 4DV3Q 4ZRZA 1LO5D 1HTLD 4A3IH 2UXBL 1SE8A 2PNHA 3A8JE 2PI2A 3HOUH 4LUVA 3HKZE 2UUAQ 4X3SA 3V2TA 1S5DD 2F0LA 3GTGB 2KHJA 3IFDA 2FJ2A 4A75A 4LFAL 1YI2A 4KN4C 2R7ZG 2PQAB 1D5XC 1SBBB 4DV4Q 3MTSA 1PZKD 3A8KE 3HKZG 3MHBA 2F0HA 4C3IB 5IOCA 4HCEA 3S1MH 3CCMA 3BS1A 2AWOA 3RUZA 1YBYA 1SYGA 1LTTD 2Z0SA 2FMCA 4YHHQ 2NBFA 4GOPC 2ASBA 1NBWA 2B2WC 2IY5B 1Q3LA 2ZTEA 1PFSA 3PIO3 1BOSA 4R4IA 1Q8KA 1EUJA 4FXKC 4JI6Q 3GTOH 3OWEB 2VL6A 3E0EA 1ZYRD 1M4VA 1EY6A 5EKKA 1M90C 1HTPA 3GV3A 4XQJA 2RHQB 3GTMB 1F9PA 1KIXA 2PPBC 3GTJH 3STBD 1PFBA 4HJ9A 2K5VA 1F2ZA 3JAME 2A69D 4XIGS 1R9TB 2FMMA 3PIP3 4HIMA 1BF4A 2EXDA 1IBLL 2BH8A 3T16A 2PYKA 2NZHA 2HCIA 3ULJA 1TWHH 1EY4A 1B50A 1Y1WB 1RTOA 4KY7A 4P71A 3I4OA 1KABA 5ELDA 5C3EH 2RVLA 3G4SA 4A3EH 4N9TA 1TQOA 3K7AH 3ONAB 2HT1A 1K0SA 1VQMA 4LF4L 1ILPA 1V1PB 3QG1A 2D2CC 1EYCA 5K36H 2Q2UA 3K81C 2PI2E 1MSGA 1QG7A 2F0UA 2F0FA 5CV8A 3PO3G 4DR7Q 3TP7A 2Q8TA 2BE5C 1K83H 2EOTA 1V1QA 4CDEC 3KDFB 1PHJA 2DY7A 4P2CB 4DR5Q 3PUYA 3D6WA 1QE6A 5C0XJ 1CHPD 4C1NI 1I50H 2NVXB 5FJ8G 1AH9A 2K5QA 4OWXB 3FPPA 2EYFA 3K80C 3URYA 4Q5VA 2EJGC 3N6RA 4DAYA 1OO9B 4JI2Q 2K5HA 4BWGB 1STBA 2E75C 1A3TA 1SMYD 1JICA 1X6OA 1X65A 1HH2P 1TS3A 4GNXC 4A3MG 5HURA 1S4ZA 1OXSC 4HTHA 4DV7L 1TWAB 1SYDA 4DR2Q 2JA8B 3CXCA 1Y1VB 4OELB 3HS0C 3C3LA 1SROA 4JBJA 5IWAL 1I6HB 2Q8IB 2AQ1B 2RDHA 2K03A 1PRTC 3KBXA 1YVCA 5IT9E 4HMJA 4NW2A 1YHBA 4C56C 2OF1A 1NMGA 5LL6X 3I55A 1XNRQ 2H4OA 5J1ZA 4KK7A 1SDFA 3E9IA 1XYIA 4ID6A 1SJED 2L11A 2E74C 1U4MA 2EYHA 4YWMA 4HJ7A 1GHJA 1CSPA 3T1HQ 5C5LA 4A3CH 1CTMA 3F2CA 3M3YH 4IFDG 1VMPA 3HOZB 2DUDA 4XQNA 1XMOL 4RGMA 1KDCA 3GTKH 1QWYA 2PZUA 3A0JA 1HUMA 1XX8A 5IP7H 1O80A 4R4TA 2G9HD 3D0FA 3C1FA 1MJEA 3R8BA 4K5VA 1WOCA 3KF6B 1Y8NB 4JC0A 2A69C 2HDLA 1G2TA 4CJ1B 5IGFA 2RKSA 1QVGA 1B3QA 1WJJA 1JOKA 2C9OA 3SXHA 5M5WB 1IL2A 3D4WA 2F4VL 4JI1Q 4X62Q 1QILA 1F9RA 1I4HA 1GUGA 4WFN3 3HOYH 2WB1E 3M9BA 5T1GA 3A5UA 1N32L 2UXDQ 2JP1A 2L12A 1HJPA 1CT1D 2F0DA 3U9SA 5KIXA 1VCIA 4BBSG 2XWBB 3TS0A 4DR3Q 1P16A 4EVOA 1PYBA 1DOMA 3ERSX 5I9OA 2K75A 3UDXA 1IXRA 2Q8RE 2WB1G 4G7HC 4A3FG 2F0WA 3PO2G 2A74C 2WP8J 1RKNA 2CW0D 4JBWA 4C2MB 5IIFA 4HIOA 1BNZA 5E4XA 2OWOA 3PUXA 1XNQQ 2J7ZA 2K5WA 3VA5A 3T1YL 3KLSA 1ET6A 3TSSA 1ASYA 3KF8B 1Q90A 1U5KA 2EY2A 4C3HH 1LABA 1EZ8A 1F9SA 1UWVA 1HQMC 1Q12A 1NSNS 2LY7A 4FNFA 4K2KA 5DEHA 2OTLA 1SMYC 2X6GA 3Q22A 1MIUA 1N9WA 2ES2A 3T4AC 1Q7YC 4IFDI 3TBIB 5FO8B 1STAA 3L3OC 5FK9C 2NVYH 4DV5L 5FO9B 1EQQA 4ZK9B 2VUMG 5M3FH 3N52A 1LUZA 2NWGA 2CFMA 1I4XA 1LM0A 1SLJA 4C1NK 2MGSA 4CKBA 2EIFA 1RCVD 1CHQD 4PNYA 4DGZA 1V8QA 2VQFL 4POGA 4DV3L 4ILWA 4GN3B 3IRBA 2LFNA 4DNRB 3GD7A 1E3PA 2LXJA 4UP7A 3I4NH 2MO1A 4OX9Q 1MBYA 2UUAL 2PMZE 1WTHA 4RGNA 1G8ZD 5C0XI 4KJNA 2V4DA 1GUSA 2WFWA 3Q8DA 1F2YA 1II3A 3M7GA 1SNOA 1EFID 4OWTB 2M9VA 2R61A 4JG2A 1CKNB 1D1IA 4HSPA 1NJIC 2ZM6Q 3FMCA 2PZTA 4JOIA 5KYIA 4BY1G 1QUQA 1XJVA 1KHIA 1O7IA 2AUKA 3TP6A 2F1MA 3S1NH 2KENA 3A5ZB 5IGDA 4YHHL 5LMNQ 2R93G 1MD2D 4IUPA 4F7XA 3I7FA 3OSOA 5DLQE 4UP9A 4HN7A 3PUWA 1A8VA 4POFA 3I70A 4MIUA 2WV6D 4GS3A 3T56B 4JI6L 2AWNA 4R4CA 4HR7B 2QKIC 1EEID 2A19A 1CA6A 1GUTA 2K4KA 2UUCQ 3ER0A 5DNFA 3VYTA 3CMEA 4L5RC 4X66Q 1M1KC 1Y8OB 4M1UB 3IKJA 5CYUA 3BVZA 4FF4A 4NXNL 5JEAH 2RCNA 4X3KA 1IL8A 4WJWA 1FD7D 4PMBA 3H0GB 3QIAA 1LACA 4R8IA 2CQOA 1T9HA 3RD4A 1EFWA 4A3GH 1STEA 3NSWA 1DONA 4KLKA 4F8MA 3RNUA 4GN4B 1VQ6A 1R4QB 5C44B 2M00A 3VR4A 5I4DA 2IPKD 3HG9A 4GKJQ 1GJXA 1ENCA 4CHTB 2B2VA 4K14A 2K5DA 1IBMQ 4RAUC 1FR3A 4K8JA 3M4PA 1PV4A 1PYWD 2HIVA 2JA5B 1FNVA 1XMQQ 3F2UA 3FKIH 2B63G 5JVG3 2YV5A 5KGUA 3RZOH 5BN3A 5IYCH 4UPAA 2BCOA 1FYCA 5GAGC 4A3JH 2VQEQ 2I5MX 4DR5L 1EWCA 1K3BC 4JYAQ 3TN2A 4K6LA 2JA7G 1EY5A 1IYVA 1AW7A 4JI2L 1QVCA 4NKLA 1A3UA 2X6LA 2R7ZB 4JK1C 1HQRD 1AE2A 4OEMB 3HKZB 3UDFA 5BN4A 1WI5A 5M3MH 1JMCA 1VMCA 1F2LA 5CC4A 4DR2L 3M85A 3DLLA 5C4JH 1RHPA 2WACA 4H7BA 1GKHA 3CQZH 4K6DA 2IX1A 1EU4A 3V96A 1BCPB 3KLRA 2QILA 3OIQA 3S1QH 3OW2A 5EBDA 4APVA 5ISRA 1HZBA 2OQ0A 2EE1A 1UUPA 2E2JB 1JE5A 4JCVE 1YJ9A 3BJUA 1UEBA 1KDAA 1LT3D 2NN6I 1XNRL 3FPUB 4JBMA 4TQUS 1MJCA 1Z9FA 2L4NA 2JEAI 1TY2A 5EGTA 4JI3Q 3QWNA 3ZYYX 3CD6A 1BCPD 1SN8A 4LW1A 3EIVA 3ICEA 4L6TB 1QZHA 3DM3A 4OIKA 4JI5Q 3K5NA 1A15A 1I4GA 3T1HL 2KA7A 1ESRA 3NUCA 4KV6A 1JCKB 5CV9A 4JI7Q 3EROA 2VS1A 4B9XA 2N49A 4JPBW 5IT9c 5KNDA 3I4MG 4BS9A 3E9HA 3CHBD 4KKUA 4Y7NH 1EY7A 3UDGA 1BBUA 3UE0A 3GTLH 2PNRC 4DR4Q 4R1JA 1S3OA 3DWPA 1BKBA 2JYOA 1HR0Q 3LX0A 1EIHA 2CVRA 4P75A 3HOXG 1GD7A 4DV2Q 1VDZA 1L0YB 1ESFA 3MEFA 1L2FA 2EY1A 3S24A 1SNDA
chains in the Genus database with same CATH topology
4K2LA 3PO3B 4XT1B 4FXGC 2VNUD 1E2ZA 2A6HC 1E2VA 2WIIB 5G3LD 1NR2A 3ERQA 4LJZC 3SVMA 1Y69U 3GO5A 1J9OA 3HP3A 1TWFB 4A3MB 3H91A 3OW7A 4O42A 3PUZA 4DU9A 1U4LA 3EFXD 4CKCA 2MPMA 4C3JG 2EY5A 3S14B 3TDQA 4Z9CB 4S3SA 4RGOS 2RA4A 1SNMA 2BDOA 1X32A 3A8IE 2ZXOA 3BYYB 4RKBA 4V190 1QB5D 2SNSA 4G7ZC 1SYFA 5EKLA 2JEBI 5JPMC 1ZKOA 5M5YB 2BE5D 3R2IA 5C4ZA 1V43A 1CQVA 1NCVA 4KHVA 3DHQA 4EQPA 2K32A 3SHLA 1PFNA 3ITPA 4PV1C 1PRTB 3VR6A 3EQLC 5C4HA 3GTPB 3DEPA 1H9JA 3PV0A 3E6ZX 1EQVA 2G9DA 4DXGA 1TVXA 3MC0B 4K5XA 1PRTD 1LT5D 3D4DA 2I07B 3OOCA 5JVH3 2EVBA 2NUCA 5EPJA 2VB3X 3K0YA 1STGA 3I3CA 1KLUD 4WRDA 1WTXA 1D1KA 4BBSB 5C0XH 3A55A 2M2LA 2B2TA 4EQNA 1C4QA 4O1NA 2K6AA 1NAPA 2KJXA 1KTKA 2WB1B 4A3FB 2EYLA 3PO2B 1JQYD 4IN3A 3M4OB 3FDTA 3WOEA 1H9SA 2ENBA 1B9NA 5D14A 3SK8A 1JE4A 3EJIA 1IW7C 1EYDA 2YU9B 1DJRD 1WTQA 2O2LD 3JAML 4IQZA 1Z7TA 4DN4M 4XTCS 2IW3A 3C1EA 1MI2A 1PLFA 3SK5A 3S9WA 1KLGD 5FOBB 4IFDJ 3I73A 3DUZA 1C48A 3D31A 1B2TA 1LTGD 3A7AB 2EPBA 4KN7C 2VUMB 1QJOA 4J8QA 1EYAA 3ND8A 2F0GA 3QOLA 2KHSA 5EPLA 2ID0A 1EOTA 3NWTA 4FO2A 3FRPB 1SJHD 3LNNA 5TSSA 3NXWA 2B2TC 1KDBA 1EQTA 1LT6D 3SK6A 4FF3A 2QF7A 2CHBD 3RLFA 1AP0A 1W6JA 2HUGA 4XXEA 5C3WA 2XVSA 5EKIA 4TSSA 1YNNC 2PMZB 4IUQA 2K01A 1DM0B 1LTAD 3NPPA 2F03A 4BY1B 2KCNA 3EVQA 4OHJA 2R93B 1HUNA 5IT9L 2BA0A 2N88A 2EJMA 3HZXA 4IURA 3T13A 2A68C 5CV7A 1EIGA 4H44C 2NN6H 4OO1H 1SYBA 2XSCA 1T5EA 2IX0A 3NTHA 1H9RA 2KQ3A 3I72A 2TMPA 3RMHA 3DWQA 3S16B 5FLXE 2K33A 1A6XA 1NR4A 3BVMA 1AFPA 5D3DA 3J81E 3FEWX 2F0IA 3T51B 3OHXC 2F0TA 3VYSA 2B63B 1CZGA 3NWSA 1KNEA 1HA6A 1DD2A 1M8AA 1UEAB 5EJWA 2F0MA 3L9AX 1JORA 2JA7B 4PMCA 1EY0A 1D5MC 2RDFA 1WVLA 1G2SA 3MAQA 2K28A 1FNUA 1EL0A 5HGTA 1DYQA 2XIWA 4XT3B 3DM1A 1X3QA 2FINB 4ABNA 2K05A 2L5TA 4ME5A 3PMFA 1WD1A 5BN5A 5COYA 1KNAA 4CGYB 3AMUA 3S2HB 1TT2A 5A2QE 1TKWB 1BR9A 2B2UA 2MJ8A 3P1HA 3H94A 4C3HB 4F87A 3BDLA 1I4QA 3MVVA 4QUCA 1BDOA 1ENFA 3I4MB 2A5HA 1AZPA 2F0OA 3S15B 4ZUIA 2E2IB 1SYEA 1B44D 1G91A 2L55A 2PW7A 1TWGB 3MFYA 4OL7A 1OXUA 1SNPA 3GQBA 5CMDA 3HOXB 1VF7A 1JWUD 5A35A 2LS01 1PFMA 3MXNA 2NZ1D 1B53A 2NVQB 3MEHA 4PMWA 4FF2A 1SAPA 1OXVA 4KJOA 3WDNA 5K36G 1RJTA 2PZWA 4IALA 5AFWA 1YNJC 1TWCB 2O5JC 3RZDB 1EEFD 1MGSA 5E3FA 5DM63 3LWUA 5EPKA 4DA2A 1B1ZA 4DFAA 1GOZA 4J1MA 3BDCA 4KD4A 1GXDC 1CI3M 4KMUC 4NMZA 4WORA 4C3JB 2MUYA 1O78A 5IGBA 1BBXC 4RGTA 2KEEA 3OMGA 4A3DB 2EXZA 4OIJA 2WKCA 2A6HD 4CKEA 4HEDA 4RCOA 1IYUA 3CU7A 5CV6A 2D9UA 2R92B 3VR2A 3A7LA 2ICEC 4LMQD 1ICWA 4RFBA 3I8ZA 2EZVA 1WD0A 3SDZA 3H3VC 3E5SA 1O7LA 5E1FA 1J8IA 3OMCA 2R3ZA 2PW5A 2F0EA 1OXTA 3E0JA 3HEJA 4KKTA 2LMCB 3K58A 2H1EA 3HOWB 2OEOA 2IX3A 2B8GA 3D4RA 3QJYA 1QCBD 3Q24A 3BG3A 1DOKA 1LTBD 2Z1CA 2EY6A 5IODA 3M7NA 1RODA 2B2VC 1W6KA 1SE3A 2IJ0A 4UDUC 1STHA 4C3HG 4YIJA 1SSOA 3TMEA 1ZEQX 3G7LA 4ZAIA 2O5IC 5CV4A 1Q1EA 5M9OA 3Q0AA 3S2DB 3KUPA 3I90A 5FO7B 1I4RA 2K04A 1UAPA 4CJ0B 3VYRA 1HCZA 1XXGA 1ENAA 3H6MA 2F3VA 4A3BB 2RSNA 4FXDA 5EBCA 1JWSD 2E2HB 4IUVA 4KHZA 4L8JA 1PTOF 2NVTB 2Z4HA 1PTOB 2WINB 3MZ5A 1H9MA 1Q1BA 1DCZA 1ONLA 1IW7D 1SNQA 4BBRB 5CORA 2SOBA 3OWFA 1HPCA 4RCNA 3W3AA 5JJZA 4RWSC 2VXWA 1CZWA 5JPNC 1LTSD 2B8FA 5C6AA 3U9OA 1O7ZA 2JA6B 1QOHA 2KUMA 2NB0A 2E2DC 4RKLA 1TU2B 4QB4A 4V0BA 2EYMA 2J0TD 3NE5B 4A93B 4XYOA 4B08A 2MP1A 5C4XB 1B4OA 2IL8A 4ZYSA 1H9SB 3BYTB 3OPOA 1WTWA 3CRKC 1TY0A 2WKDA 5JEAG 1WCMB 2EYJA 4B9WA 3SEBA 4IFDH 4MN3A 3SR1A 1U9RA 2D5DA 2B2WA 3NQTA 1R4PB 1YNND 5D3IB 3D6CA 4F88A 4CJ2C 1F2MA 3HRZC 3J80E 1ET9A 3MWYW 2XRQD 1RTNA 2EDGA 2ZT9C 4OGQC 1X3PA 2EYPA 3NHHA 4A3IB 3QB3A 4R9WA 3J7AV 1S5ED 4K5WA 3HOUB 4DNTB 1EZ6A 2A68D 5KRUA 5CBAE 2NTSA 1GUWA 2QDBA 5ELFA 1PXUA 1EY9A 2N55A 1SYCA 1JOOA 3S1MB 2R6GA 3IFTA 5C3XA 1STYA 3QO2A 4G57A 3TZDA 3DMUA 1Q8IA 2L1BA 3AB9A 5IGGA 4R8NA 4XDXA 1WTPA 2ICIA 1OXXK 1LV9A 5J22A 3GTOB 1L0XB 1PTOC 2F0VA 4EGVA 4FP5D 2ZXRA 4QMGA 4ZQ3A 2XWJB 2ZXPA 3PUVA 4RH6A 4I7ZC 3GTJB 1K8OA 3S1RB 1JB3A 1TS5A 1V1OA 3I4LA 1S5BD 1I4PA 1TWHB 2SDFA 1F9QA 1ILQA 3C46A 3LWEA 3MXGA 1B9MA 4KY6A 1BO0A 4IZ8A 5C3EB 5LL6S 4A3EB 2F0QA 1XWEA 3K7AB 1TR5A 1FNWA 1JOQA 1FGBD 3QOJA 1C8CA 2J4XA 2RDGA 2DNCA 5ELBA 5ELEA 1TS2A 1CQFA 2Z4IA 1SE4A 2RQXA 3WOFA 1K83B 3KK7A 1Z6HA 2FFKB 5I2YA 1I50B 4X3TA 3R2TA 5JAVA 2HDMA 3Q23A 2Y0SB 3L7ZC 1I6VC 4LK1C 4HAEA 2CQAA 4HMIA 3S17B 5IGCA 5DM73 3K5OA 1QNUA 4H0LC 2F0JA 5DAUA 4QUFA 1WTVA 1NUCA 2F3WA 2DY8A 2QCPX 3R3OA 4E6IA 1CA5A 4ZUJA 3W2DA 3V05A 1YNJD 1E2WA 4KI0A 2KEDA 2AQ2B 5FLXL 1S5FD 1AZQA 2KCCA 1XTCD 3M3YB 3J81L 5I6YA 3K5MA 1GHKA 3GTKB 4J6HA 4U673 1D2BA 2I46A 1V1PA 4FYDA 3TP5A 3O13A 1E0BA 4XYQA 1ZYRC 2F0NA 2GA4B 3R93A 3K6OA 2F4IA 1HRJA 4BA2I 2B2YA 2AQ3B 3DWAA 1A2TA 4HSVA 3UI2A 1DXMA 2JSOA 4L63B 4CBVA 4FF1A 5JOBA 3HOYB 2EYOA 4DAPA 2D62A 5C0XG 4M8AA 3X3MA 4C3IG 2WAQB 4G4KA 1A2UA 2K7VA 3CRLC 1MSHA 2XNAC 1WTOA 5A2QL 5LHY1 3I91A 2XN9C 2X69A 4QCLA 4UAIA 3NK9A 2B39A 3BDOA 4RHRA 2EJFC 4IUTA 3A56A 4ZKBB 3VR3A 2C5CA 2MHVA 3NQIA 5KEEA 2OT2A 2NVYB 2KECA 1DOLA 3VA7A 5M3FB 5T1IA 4DK1A 1PDQA 2B2YC 3K59A 3MXPA 1TS4A 5IGEA 2FHTA 4N9PA 5J39A 3D8GA 5FKAC 3FVQA 3D3RA 3I4NB 1LTRD 1U4PA 2BA1A 2F0SA 3SK4A 4DAVA 2TSSA 2DN8A 3J7YW 2B2UC 1HA5A 1SEBD 4G7OC 4X3UA 3M4YA 2OXPA 3SE0A 4ZKCB 4HCSA 3MXUA 5ELCA 3S1NB 1PZJD 2YYZA 1KAAA 3DXJC 2LKVA 4DK0A 2SNMA 3AU7A 3KF8A 1CFMA 1DZ1A 4NDXA 2KVMA 2IWHA 3IL8A 2HCCA 1CK1A 1IKMA 3H09A 2HQEA 5NUCA 5CBEE 2K1BA 4PQXA 3C2PA 1UNSA 1VF5C 2NN6G 4OO1G 5M5XB 1JC7A 1T5XD 5KNCA 4A3GB 2VB2X 1IHZA 1HFGA 1STNA 3CKIB 3NP8A 1G291 2L0CA 1Y8PB 2CW0C 3T53B 2NYZD 2IT1A 5E4WC 3NTIA 1GUOA 3IAYA 3J7AF 4KKSA 2A6ED 3FKIB 1RD9D 1LT4D 4RA8A 3OIPA 4FVMA 3RZOB 2A73B 1PMRA 4A3JB 2KOLA 2PO4A 5I2XA 3BVGA 1LLRD 1BXTA 3HGBA 1S5CD 2AUJD 4IUNA 4ODGA 4LAAA 4KY5A 4DXFA 1EY8A 2RSOA 1D6EC 2BOSA 1G6ZA 3K5LA 5M3MB 2JE6I 1PZID 2QEJC 1B3AA 5C4JB 1SXTA 3G6JB 3CQZB 3S1QB 4ZLTF 1QNKA 4TRDA 4GZYC 1CM9A 1BCPF 3BZDB 4TKOB 4RHSA 1H9KA 5I9PA 5JEAJ 4BA1I 1EWHA 3EA6A 1AN8A 4OO1I 2F0KA 1IKLA 1ML0D 1SE2A 5C5MA 1TIID 2DNEA 1Z47A 3GP7A 3P20A 2SEBD 3KBGA 3P75A 1RDPD 4K8IA 1HFNA 2BDNA 1U4RA 2E76C 3NBIA 3A54A 5I6WA 4Y7NB 1K8MA 5CR3A 1HHVA 3GTLB 3NBHA 2XRSD 4U68A 3K57A 2O4XA 1D5ZC 1PTOH 5G3LF 3TP8A 2Z8LA 4I65A 5K5PA 1JR0D 1A3VA 1LTID 1PTOD 4NP5A 1BQQT 3DEOA 1ZXTA 2NTTA 3TZUA 4KD3A 4BY7B 4IUUA 2RBMA 1SNCA 2A6EC 5EQ0A 3X3NA 1JWMD 5F2DA 1F77A 3KLSX 1AEXA 3VYUA 1RF2D 4ULLA 1O7YA 5KNBA 4Q0FA 4H13C 1GUNA 3Q6SA 4EQOA 1SFOB 4XQQA 4AYBB 3P7JA 3VR5A 4QIWB 2JXMB 4MHEA 3NTKA 4A3KB 4KTAA 2F0PA 3GTQB 1BUVT 3GV6A 4QF4A 1HXYD 3J80L 1I3QB 3ND9A 1EU3A 3MA2B 1PRTF 5D65A 3MFGA 1WTRA 5CGKA 3HOVB 2PQEA 4DF7A 5KYLA 5CV5A 2L9HA 2PCFB 1BCPC 4ZRZA 1LO5D 1HTLD 3A8JE 4X3SA 3V2TA 1S5DD 2F0LA 3GTGB 3IFDA 2FJ2A 4KN4C 1D5XC 1SBBB 3MTSA 1PZKD 3A8KE 3MHBA 2F0HA 4C3IB 5IOCA 4HCEA 3BS1A 2AWOA 3RUZA 1SYGA 1LTTD 2FMCA 2NBFA 2B2WC 1Q3LA 3PIO3 1BOSA 4FXKC 3OWEB 1ZYRD 1M4VA 1EY6A 5EKKA 1HTPA 3GV3A 4XQJA 3GTMB 1F9PA 2PPBC 1PFBA 1F2ZA 3JAME 2A69D 4XIGS 1R9TB 2FMMA 3PIP3 1BF4A 3T16A 2PYKA 2HCIA 1EY4A 1B50A 1Y1WB 1RTOA 4KY7A 1KABA 5ELDA 2RVLA 4N9TA 1TQOA 3ONAB 1ILPA 1V1PB 3QG1A 2D2CC 1EYCA 5K36H 1MSGA 1QG7A 2F0UA 2F0FA 5CV8A 3TP7A 2Q8TA 2BE5C 2EOTA 2DY7A 4P2CB 3PUYA 3D6WA 1QE6A 5C0XJ 1CHPD 4C1NI 2NVXB 2K5QA 3URYA 3FPPA 2EYFA 4Q5VA 2EJGC 3N6RA 4DAYA 1OO9B 4BWGB 1STBA 2E75C 1A3TA 1SMYD 1JICA 1TS3A 5HURA 1S4ZA 1OXSC 4HTHA 1TWAB 1SYDA 2JA8B 1Y1VB 3HS0C 3C3LA 1I6HB 2Q8IB 2AQ1B 2RDHA 2K03A 1PRTC 3KBXA 5IT9E 4HMJA 4NW2A 4C56C 2OF1A 5LL6X 2H4OA 5J1ZA 4KK7A 1SDFA 1XYIA 4ID6A 1SJED 2L11A 2E74C 1U4MA 2EYHA 1GHJA 5C5LA 1CTMA 4IFDG 1VMPA 3HOZB 4XQNA 4RGMA 1KDCA 1QWYA 2PZUA 1HUMA 1XX8A 1O80A 2G9HD 3C1FA 3R8BA 4K5VA 1Y8NB 2A69C 2HDLA 1G2TA 4CJ1B 5IGFA 2RKSA 2C9OA 1JOKA 5M5WB 3SXHA 3D4WA 1QILA 1F9RA 1I4HA 1GUGA 4WFN3 5T1GA 2JP1A 2L12A 2F0DA 1CT1D 3U9SA 5KIXA 1VCIA 2XWBB 4EVOA 1DOMA 5I9OA 2Q8RE 4G7HC 2F0WA 2A74C 2WP8J 1RKNA 2CW0D 4JBWA 4C2MB 5IIFA 1BNZA 5E4XA 3PUXA 2J7ZA 2K5WA 3VA5A 3KLSA 1ET6A 3TSSA 1Q90A 2EY2A 1LABA 1EZ8A 1F9SA 1HQMC 1Q12A 1NSNS 2LY7A 4FNFA 4K2KA 5DEHA 1SMYC 2X6GA 3Q22A 3T4AC 4IFDI 3TBIB 5FO8B 1STAA 3L3OC 5FK9C 5FO9B 4ZK9B 3N52A 2NWGA 1I4XA 4C1NK 2MGSA 4CKBA 1RCVD 1CHQD 4PNYA 4DGZA 1V8QA 4ILWA 2LFNA 4DNRB 3GD7A 1MBYA 4RGNA 1G8ZD 5C0XI 4KJNA 2V4DA 1GUSA 1F2YA 1II3A 3M7GA 1SNOA 1EFID 2M9VA 2R61A 1D1IA 4HSPA 3FMCA 2PZTA 5KYIA 2AUKA 3TP6A 2F1MA 5IGDA 1MD2D 4IUPA 4F7XA 3OSOA 4HN7A 3PUWA 3I70A 4MIUA 2WV6D 3T56B 2AWNA 4HR7B 2QKIC 1EEID 1CA6A 1GUTA 5DNFA 3VYTA 1Y8OB 4M1UB 3IKJA 5CYUA 3BVZA 4FF4A 5JEAH 4X3KA 1IL8A 4WJWA 1FD7D 4PMBA 3H0GB 3QIAA 1LACA 4R8IA 3RD4A 1STEA 3NSWA 1DONA 4F8MA 1R4QB 5C44B 2M00A 3VR4A 5I4DA 2IPKD 3HG9A 1GJXA 1ENCA 4CHTB 2B2VA 4K14A 2K5DA 4RAUC 1FR3A 4K8JA 1PYWD 2JA5B 1FNVA 3F2UA 5JVG3 5KGUA 5BN3A 2BCOA 1FYCA 1EWCA 3TN2A 4K6LA 1IYVA 1EY5A 1AW7A 4NKLA 1A3UA 2X6LA 2R7ZB 4JK1C 1HQRD 3HKZB 5BN4A 1VMCA 1F2LA 5CC4A 3M85A 1RHPA 2WACA 4H7BA 4K6DA 2IX1A 1EU4A 3V96A 1BCPB 3KLRA 2QILA 3OIQA 5EBDA 5ISRA 2EE1A 1UUPA 2E2JB 1KDAA 1LT3D 2NN6I 3FPUB 4TQUS 2L4NA 2JEAI 1TY2A 5EGTA 3QWNA 3ZYYX 1BCPD 4L6TB 4OIKA 3K5NA 1A15A 1I4GA 2KA7A 1ESRA 3NUCA 4KV6A 1JCKB 5CV9A 3EROA 4B9XA 5KNDA 4BS9A 3CHBD 4KKUA 1EY7A 2PNRC 3DWPA 2JYOA 3LX0A 1EIHA 2CVRA 1VDZA 1L0YB 1ESFA 2EY1A 1SNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  3NQT A;  4IZ8 A;  4K2L A;  2EYH A;  1EY6 A;  5EKK A;  3EVQ A;  5CV4 A;  2F0Q A;  2EXZ A;  4ME5 A;  4WRD A;  3PMF A;  5F2D A;  5M9O A;  1TR5 A;  3D6C A;  5KEE A;  1JOQ A;  3QOJ A;  5C5L A;  1AEX A;  1F2M A;  2OXP A;  1A2T A;  4EQN A;  5KGU A;  1TT2 A;  4TRD A;  1F2Z A;  3ERQ A;  3HZX A;  4PNY A;  4DGZ A;  1KDC A;  4EQO A;  2PZU A;  5JOB A;  3P1H A;  2EYO A;  2EYL A;  1KAA A;  5I9P A;  1ENA A;  2LKV A;  2SNM A;  3BDL A;  2PYK A;  3H6M A;  3T16 A;  3T13 A;  1EY5 A;  3MVV A;  2EYP A;  4NKL A;  3NHH A;  2ENB A;  1EY4 A;  2F3V A;  1A3U A;  4NDX A;  5CV6 A;  3SK8 A;  3C1F A;  2F0K A;  5JAV A;  5CV7 A;  3QB3 A;  4KY7 A;  1A2U A;  1KAB A;  1SYB A;  3EJI A;  4K5W A;  2F0P A;  4KTA A;  4DU9 A;  4KJN A;  1EYD A;  4K5V A;  5C5M A;  1F2Y A;  1II3 A;  4N9T A;  1SNO A;  1EZ6 A;  2F0O A;  5CC4 A;  3MZ5 A;  5KRU A;  4ZUI A;  1TQO A;  2EY5 A;  2HQE A;  4QF4 A;  5NUC A;  1SYE A;  2WAC A;  4H7B A;  4S3S A;  5IGF A;  1SNQ A;  2KQ3 A;  2RKS A;  1SNM A;  2QDB A;  3C1E A;  4K6D A;  3P75 A;  3SK5 A;  1JOK A;  3S9W A;  1EYC A;  3SXH A;  2PW7 A;  2PZT A;  2SOB A;  3D4W A;  3OWF A;  5KYI A;  4HMI A;  4OL7 A;  4K8I A;  1SNP A;  5ISR A;  5IGC A;  1EY9 A;  5CGK A;  3TP6 A;  1SYC A;  1JOO A;  2F0U A;  2F0F A;  3E5S A;  5CV8 A;  5I6W A;  5CR3 A;  5IGD A;  3TP7 A;  2PQE A;  4DF7 A;  5E1F A;  2F0J A;  5DAU A;  1KDA A;  5CV5 A;  4RKB A;  5KYL A;  5C3X A;  1STY A;  4F7X A;  2F0D A;  2SNS A;  3MEH A;  3NK9 A;  3OMC A;  3OSO A;  5KIX A;  1SYF A;  4G57 A;  1IHZ A;  5EKL A;  1STN A;  3DMU A;  1EYA A;  2PW5 A;  3NP8 A;  3U9O A;  5C6A A;  4EVO A;  2F0I A;  4MIU A;  2F0G A;  3QOL A;  5EGT A;  4KJO A;  1NUC A;  2EYF A;  2F0E A;  2KHS A;  5C4Z A;  2PZW A;  5I9O A;  2F3W A;  4IAL A;  4R8N A;  5IGG A;  2F0T A;  2O4X A;  4RKL A;  2F0W A;  3HEJ A;  3R3O A;  4KHV A;  3DHQ A;  4QB4 A;  5E3F A;  1STB A;  2F0L A;  3V2T A;  1RKN A;  1A3T A;  4E6I A;  4ZUJ A;  4EQP A;  3SHL A;  5J22 A;  4DFA A;  2EYM A;  3ITP A;  3NUC A;  4KV6 A;  2OEO A;  5IIF A;  3NXW A;  4HTH A;  4J1M A;  4I65 A;  3TP8 A;  5HUR A;  5CV9 A;  5K5P A;  2F0V A;  3BDC A;  4KD4 A;  1SYD A;  3MXP A;  3ERO A;  3VA5 A;  2F0M A;  4B9X A;  4QMG A;  4ZQ3 A;  4PMB A;  1JOR A;  1KDB A;  3SK6 A;  1A3V A;  2EY2 A;  5C4H A;  3MHB A;  2F0H A;  5IGE A;  5IOC A;  1EZ8 A;  4N9P A;  4PMC A;  5J39 A;  1EY0 A;  1EY7 A;  5I6Y A;  2EY6 A;  4NP5 A;  3RUZ A;  2RDF A;  1NSN S;  3D8G A;  1SYG A;  4K2K A;  5DEH A;  1EQV A;  4J6H A;  5IOD A;  4NMZ A;  4HMJ A;  4KD3 A;  4F8M A;  3LX0 A;  4IUN A;  4ODG A;  4WOR A;  3TP5 A;  5HGT A;  4K5X A;  2OF1 A;  4LAA A;  4KY5 A;  1STH A;  2RBM A;  3D4D A;  2EYJ A;  1EY8 A;  1SNC A;  2F0N A;  5C3W A;  4YIJ A;  4B9W A;  2M00 A;  5J1Z A;  1STA A;  4K8J A;  2F0S A;  5IGB A;  2NUC A;  3TME A;  3SK4 A;  2EY1 A;  1ENC A;  3SR1 A;  4ID6 A;  4K14 A;  1U9R A;  4KY6 A;  1SND A;  1STG A; 
#chains in the Genus database with same CATH topology
 4K2L A;  3A74 A;  4AIM A;  2DGY A;  3PO3 B;  4XT1 B;  4FXG C;  2IHF A;  2VNU D;  1E2Z A;  4JI1 L;  2A6H C;  2ZJR A;  1E2V A;  2UXD L;  4IOC A;  2WII B;  5G3L D;  1NE3 A;  1NR2 A;  2MFI A;  3ERQ A;  4LJZ C;  4QY7 A;  3SVM A;  1VQ5 A;  1Y69 U;  4DR3 L;  3GO5 A;  4BY7 H;  1J9O A;  3W1G A;  3HP3 A;  1K3R A;  2Q2I A;  1TWF B;  4A3M B;  3H91 A;  2RHS B;  2AHO B;  3OW7 A;  2KCM A;  2YTV A;  2Z6K A;  4O42 A;  1KAW A;  3PUZ A;  4DU9 A;  1U4L A;  3JAM i;  2CH4 A;  4DV1 Q;  3EFX D;  4CKC A;  2MPM A;  4C3J G;  2EY5 A;  4A4I A;  1N34 Q;  3S14 B;  3TDQ A;  4Z9C B;  1LTL A;  4S3S A;  4RGO S;  2RA4 A;  1VQ4 A;  1A0I A;  1SNM A;  3RN2 A;  2BDO A;  5FLM H;  2DJF C;  2Q2T A;  1X32 A;  3A8I E;  2F52 A;  4GLV B;  3ULL A;  4A3D G;  1SFO H;  2ZXO A;  3BYY B;  4RKB A;  2Z9H A;  4V19 0;  1QB5 D;  2SNS A;  2ALY B;  4G7Z C;  1SYF A;  5EKL A;  4OXP A;  2JEB I;  4DV0 Q;  5LMU Q;  5JPM C;  1ZKO A;  5M5Y B;  2BE5 D;  3R2I A;  5C4Z A;  2VW9 A;  4A3K H;  1V43 A;  1Q46 A;  1CQV A;  3GTQ H;  3L2P A;  1NCV A;  4KHV A;  3DHQ A;  4EQP A;  4WJ4 A;  2K32 A;  4IPD A;  3SHL A;  1PFN A;  2XGT A;  5IP9 G;  3ITP A;  2RCF A;  1K8G A;  4PV1 C;  1PRT B;  3VR6 A;  1I3Q H;  3EQL C;  2R92 G;  1J6Q A;  5C4H A;  3HOV H;  3GTP B;  3DEP A;  1H9J A;  1E1O A;  3PV0 A;  3E6Z X;  1EQV A;  4OX9 L;  2G9D A;  4DXG A;  1TVX A;  3MC0 B;  4K5X A;  1PRT D;  1LT5 D;  2Z6K C;  3D4D A;  2I07 B;  3OOC A;  5JVH 3;  2EVB A;  2NUC A;  5EPJ A;  2VB3 X;  3K0Y A;  1STG A;  3I3C A;  1EWI A;  1KLU D;  1WFQ A;  4WRD A;  2ZM6 L;  5IYB G;  4GLA C;  2MQH A;  4L5T A;  1WTX A;  1OTC A;  1D1K A;  4BBS B;  1KRS A;  3A55 A;  5C0X H;  2M2L A;  2B2T A;  4C3I H;  4EQN A;  5J3B A;  1C4Q A;  4O1N A;  5LMN L;  4IPH A;  3HOW G;  4DAY B;  2K6A A;  1NAP A;  2KJX A;  1KTK A;  2WB1 B;  4A3F B;  2CWA A;  5IYD G;  2EYL A;  3PO2 B;  1JQY D;  4IN3 A;  3M4O B;  3FDT A;  3WOE A;  1XPU A;  3AFQ A;  2I0Q A;  1H9S A;  2ENB A;  1B9N A;  5D14 A;  3SK8 A;  2UUC L;  2HHH Q;  4R4Q A;  1JE4 A;  3EJI A;  1IW7 C;  1EYD A;  2YU9 B;  1DJR D;  1WTQ A;  2O2L D;  3JAM L;  4IQZ A;  3GTM H;  1Z7T A;  4DN4 M;  3S1R H;  4XTC S;  2IW3 A;  3C1E A;  1MI2 A;  1PLF A;  4LF5 Q;  3SK5 A;  3S9W A;  1KLG D;  5FOB B;  3TRE A;  1VQN A;  4IFD J;  3I73 A;  2CH4 W;  3DUZ A;  1C48 A;  3D31 A;  3NEN A;  1R9T H;  1VQD A;  1B2T A;  1LTG D;  3A7A B;  2EPB A;  4KN7 C;  2VUM B;  1QJO A;  4J8Q A;  4IPG A;  4LFB Q;  1EYA A;  4BXX G;  1HNW Q;  3ND8 A;  1W3S A;  2F0G A;  3QOL A;  4GKJ L;  1Y1W H;  2KHS A;  5EPL A;  4CDD C;  4HID A;  2ID0 A;  1IBM L;  1EOT A;  3K0X A;  3NWT A;  5GQO A;  4FO2 A;  4ZCK A;  3FRP B;  1XMQ L;  4QJF A;  1SJH D;  3LNN A;  5TSS A;  3NXW A;  3CC7 A;  1HNX Q;  4A3B G;  2B2T C;  2A1A A;  1KDB A;  1EQT A;  1LT6 D;  3SK6 A;  2VQE L;  4FF3 A;  2QF7 A;  4CDF C;  3KJO A;  4JYA L;  2B29 A;  2CHB D;  1E22 A;  4LF9 Q;  3RLF A;  4LUZ A;  4I7A A;  1E1T A;  1AP0 A;  5HGQ A;  4BBR G;  3SGI A;  1N33 Q;  1W6J A;  2HUG A;  4XXE A;  5C3W A;  2XVS A;  5EKI A;  4TSS A;  1YNN C;  2PMZ B;  4IUQ A;  3CCQ A;  2K01 A;  1EYG A;  1DM0 B;  1LTA D;  3NPP A;  2F03 A;  4BY1 B;  3BZC A;  2KCN A;  4LFC Q;  2LSS A;  3S17 H;  3EVQ A;  4OHJ A;  2JA6 G;  1TWA H;  2R93 B;  2JA8 H;  1HUN A;  1Y1V H;  3EN2 A;  2BA0 A;  5IT9 L;  3KJP A;  1I6H H;  2N88 A;  2EJM A;  3HZX A;  2K14 A;  1X3G A;  3KOJ A;  4GN5 A;  4A93 G;  5C4X G;  4IUR A;  1VQE A;  2K50 A;  4JI3 L;  3T13 A;  1HNZ Q;  1ICF B;  3CCS A;  2OCE A;  2A68 C;  5CV7 A;  4A76 A;  1D7Q A;  1EIG A;  3L0O A;  4H44 C;  3J7Z C;  2NN6 H;  4OO1 H;  1SYB A;  2XSC A;  1T5E A;  5BR8 Q;  4JVZ A;  3VDY A;  2IX0 A;  3NTH A;  4JI7 L;  2CCZ A;  1WCM G;  1H9R A;  2KQ3 A;  3I72 A;  2TMP A;  3RMH A;  4A3L G;  3HOZ H;  3DWQ A;  3PSI A;  2ATW A;  4AH6 A;  4DR4 L;  1PYS B;  1HR0 L;  3S16 B;  3AYH B;  5FLX E;  2K33 A;  4MTN A;  2R7D A;  1B8A A;  1A6X A;  1NR4 A;  3BVM A;  3TRZ A;  1AFP A;  5D3D A;  3J81 E;  4DV2 L;  4MZ9 A;  3FEW X;  2F0I A;  3T51 B;  3OHX C;  2UUB Q;  2F0T A;  3VYS A;  2B63 B;  1CZG A;  3NWS A;  1KNE A;  1HA6 A;  1DD2 A;  1SMX A;  2AKW B;  1M8A A;  4A3I G;  1UEA B;  1I94 Q;  5EJW A;  2F0M A;  3CCU A;  2LXK A;  3L9A X;  1JOR A;  3HOU G;  2JA7 B;  4PMC A;  3CP0 A;  1EY0 A;  1D5M C;  2ZTD A;  2RDF A;  1JJG A;  1WVL A;  1G2S A;  2HIX A;  3MAQ A;  2K28 A;  1FNU A;  1J5E Q;  1EL0 A;  5HGT A;  1DYQ A;  3PGZ A;  2XIW A;  4XT3 B;  3DM1 A;  1X3Q A;  5IY0 A;  4DV1 L;  2FIN B;  4ABN A;  2K05 A;  1AE3 A;  1L0W A;  1N34 L;  2L5T A;  3J7A 5;  5E7N A;  1IBK Q;  4ME5 A;  3PMF A;  1WD1 A;  5BN5 A;  1VQA A;  5COY A;  1KNA A;  4JW0 A;  4DPG A;  4CGY B;  3AMU A;  4H02 A;  1YIT A;  3S2H B;  1TT2 A;  5A2Q E;  4YWK A;  1TKW B;  1BR9 A;  2JA9 A;  2B2U A;  2YTX A;  2MJ8 A;  3P1H A;  4DV0 L;  4AQY Q;  1JJ2 A;  1UE6 A;  3H94 A;  4B3T Q;  4C3H B;  1Q81 C;  4F87 A;  2Q2H A;  3BDL A;  1I4Q A;  3MVV A;  2UU9 Q;  4QUC A;  1BDO A;  1ENF A;  4YY3 Q;  2HQL A;  2V1C C;  3CAM A;  3TQY A;  3I4M B;  1VQ9 A;  2R7F A;  1A63 A;  2A5H A;  1AZP A;  2F0O A;  3S15 B;  3KYH C;  4ZUI A;  2E2I B;  1SYE A;  1B44 D;  1G91 A;  1PH5 A;  2L55 A;  2PW7 A;  1TWG B;  3MFY A;  4OL7 A;  1OXU A;  1SNP A;  3GQB A;  5CMD A;  3HOX B;  1VF7 A;  1JWU D;  5C3E G;  1VQH A;  4HJ5 A;  4A3E G;  5A35 A;  2LS0 1;  1PFM A;  3MXN A;  2NZ1 D;  1B53 A;  2NVQ B;  3MEH A;  4PMW A;  4FF2 A;  1SAP A;  4QGU A;  1OXV A;  4KJO A;  3WDN A;  5K36 G;  1RJT A;  2PZW A;  4IAL A;  5AFW A;  1YNJ C;  1TWC B;  3K7U C;  2O5J C;  4DV4 L;  3RZD B;  1EEF D;  1MGS A;  2Y0S E;  3JC6 6;  5E3F A;  5DM6 3;  3LWU A;  4DAM A;  5EPK A;  4DA2 A;  1B1Z A;  1YEZ A;  4DFA A;  1GOZ A;  4J1M A;  3BDC A;  4KD4 A;  1CSQ A;  1GXD C;  1VS0 A;  1CI3 M;  4KMU C;  1YIJ A;  2Y0S G;  2D0O A;  1RIP A;  4NMZ A;  1YNX A;  2JK8 A;  4WOR A;  4C3J B;  1A62 A;  4P74 A;  2HHH L;  2MUY A;  3RLN A;  1O78 A;  5IGB A;  2Z6B A;  3OTO Q;  1Q82 C;  1BBX C;  4RGT A;  2KEE A;  3OMG A;  3PF5 A;  5M5X H;  4A3D B;  4LF5 L;  2EXZ A;  1FGU A;  4OIJ A;  1TXY A;  3H0G H;  2WKC A;  4IJL A;  3U4V A;  4N8F A;  2A6H D;  1PH6 A;  2DJG C;  4LFB L;  4RMF A;  4CKE A;  4HED A;  1HNW L;  4RCO A;  4A3C G;  1IYU A;  5C44 H;  3CU7 A;  5CV6 A;  2D9U A;  2R92 B;  3VR2 A;  3A7L A;  2HD3 A;  3JAM c;  1HNX L;  2ICE C;  4LMQ D;  4DUZ Q;  3GDE A;  4JOI C;  1ICW A;  3NBH B;  5IP7 G;  1PH8 A;  4RFB A;  3I8Z A;  2JA5 H;  2EZV A;  4DR7 L;  1WD0 A;  1UE5 A;  4GKK Q;  1DGS A;  4IJH A;  3SDZ A;  1PH3 A;  3B6Y A;  3H3V C;  3E5S A;  1Q86 C;  1O7L A;  5E1F A;  1J8I A;  2N8N A;  1N33 L;  2B3G A;  2E8G A;  3OMC A;  3G6E A;  1FVI A;  2R3Z A;  2PW5 A;  2R7Z H;  2F0E A;  3I56 A;  2KHI A;  1OXT A;  2WAQ E;  3E0J A;  3F2B A;  3HOY G;  3HEJ A;  3NEM A;  4KKT A;  4LFC L;  4DR6 Q;  2LMC B;  3K58 A;  1L1O A;  1NY4 A;  2H1E A;  3HOW B;  2OEO A;  1B70 B;  2IX3 A;  2B8G A;  2WAQ G;  3D4R A;  2QEX A;  3QJY A;  1QCB D;  3Q24 A;  1PH9 A;  3BG3 A;  1DOK A;  2E2J H;  1LTB D;  2Z1C A;  2EY6 A;  4LNQ A;  5IOD A;  1HNZ L;  4QQB X;  4PZ8 A;  1ROD A;  2B2V C;  3M7N A;  1W6K A;  1SE3 A;  4X64 Q;  2IJ0 A;  4UDU C;  2MNA A;  1STH A;  3KFU A;  4PG3 A;  4C3H G;  5BR8 L;  4YIJ A;  3EBE A;  1SSO A;  3TME A;  1ZEQ X;  3G7L A;  3BZK A;  2QA4 A;  4ZAI A;  2O5I C;  4UY8 C;  4PZ7 A;  1Q1E A;  5CV4 A;  1UE7 A;  5M9O A;  3Q0A A;  3S2D B;  3KUP A;  1C0A A;  1EOV A;  1GM5 A;  3I90 A;  5FO7 B;  1I4R A;  2K04 A;  1XPR A;  1UAP A;  4CJ0 B;  5M3F G;  3VYR A;  1FJG Q;  1HCZ A;  1XXG A;  1ENA A;  3H6M A;  2UUB L;  4WJ3 M;  4LF7 Q;  2F3V A;  1XMO Q;  4A3B B;  2RSN A;  4FXD A;  5EBC A;  1JWS D;  2E2H B;  4IUV A;  4KHZ A;  4L8J A;  1PTO F;  4HJA A;  2NVT B;  2Z4H A;  1PTO B;  2WIN B;  3PO3 H;  4X62 L;  3MZ5 A;  1H9M A;  4O0A A;  1Q1B A;  1DCZ A;  2E5L Q;  3I4N G;  1ONL A;  1IW7 D;  1SNQ A;  4BBR B;  5COR A;  3CCJ A;  2SOB A;  5FLX c;  3OWF A;  5FJ8 H;  4QL5 A;  4DUY Q;  1V9P A;  1HPC A;  4RCN A;  1J5E L;  3W3A A;  5JJZ A;  1X55 A;  2VXW A;  1CZW A;  4RWS C;  5JPN C;  1LTS D;  1TWF H;  2B8F A;  4A3M H;  5C6A A;  3U9O A;  1O7Z A;  2JA6 B;  1QOH A;  2KUM A;  1XNQ L;  2NB0 A;  2E2D C;  4RKL A;  1D8L A;  1TU2 B;  3H3V I;  4QB4 A;  1IBK L;  4O2D A;  4V0B A;  4ME3 A;  4UHV A;  3S14 H;  2EYM A;  2J0T D;  4IOA A;  3NE5 B;  4A93 B;  4XYO A;  4B08 A;  2MP1 A;  1HZ9 A;  5C4X B;  2F3I A;  1JB7 A;  3CPW A;  1N8R C;  1B4O A;  2IL8 A;  4ZYS A;  1H9S B;  2VZA A;  3BYT B;  3OPO A;  4AQY L;  1SRU A;  4B3T L;  1WTW A;  3T1Y Q;  2UU9 L;  3CRK C;  1TY0 A;  2WKD A;  5JEA G;  5M5Y H;  4X65 Q;  4YY3 L;  5JJK A;  1WCM B;  2EYJ A;  4MNO A;  5ELO A;  4B9W A;  3SEB A;  4A3G G;  4IFD H;  4MN3 A;  3SR1 A;  4GOP A;  3G71 A;  1U9R A;  2D5D A;  2B2W A;  3NQT A;  4K0K Q;  1R4P B;  2G5D A;  1YNN D;  3WWV A;  2JJQ A;  5D3I B;  3D6C A;  2YTY A;  2JQO A;  4F88 A;  4CJ2 C;  1F2M A;  3HRZ C;  3TS2 A;  3GTP H;  5HY6 A;  3J80 E;  1ET9 A;  3MWY W;  4NB3 A;  1VQB A;  1VQI A;  2XRQ D;  1VQ7 A;  1RTN A;  2EDG A;  2ZT9 C;  3FKI G;  4OGQ C;  1X3P A;  4DK3 C;  3GTG H;  2EYP A;  3NHH A;  4A3I B;  1EIF A;  5IYC G;  3QB3 A;  4R9W A;  4KHP Q;  4A3J G;  1VQC A;  3J7A V;  1S5E D;  4K5W A;  3TEH B;  3HOU B;  1VQF A;  4DNT B;  1EZ6 A;  1ASZ A;  2A68 D;  5KRU A;  5CBA E;  4J15 A;  4BBS H;  2NTS A;  1GUW A;  2QDB A;  2UXC Q;  5ELF A;  1PXU A;  4JI8 Q;  1EY9 A;  2N55 A;  5M3M G;  1P8L A;  1JOO A;  1SYC A;  3S1M B;  4A3F H;  2I5H A;  2R6G A;  5GAH C;  3PO2 H;  1X54 A;  3IFT A;  5C3X A;  1HZA A;  1STY A;  3M4O H;  3QO2 A;  4G57 A;  3TZD A;  3DMU A;  1VQK A;  4X66 L;  1Q8I A;  3UE1 A;  4JI0 Q;  1QVF A;  2L1B A;  4NPS A;  3OTO L;  3AB9 A;  5IGG A;  4R8N A;  4XDX A;  1WTP A;  2ICI A;  1CKO A;  1OXX K;  1LV9 A;  4IO9 A;  3QR8 A;  5J22 A;  2YU9 H;  3GTO B;  1L0X B;  1PTO C;  3J81 i;  2F0V A;  4EGV A;  4FP5 D;  2ZXR A;  3HKS A;  4QMG A;  4ZQ3 A;  1X9N A;  2XWJ B;  2ZXP A;  3PUV A;  4RH6 A;  4I7Z C;  3GTJ B;  2KBN A;  4P72 A;  4GNX A;  1HZC A;  1K8O A;  3M4Q A;  3S1R B;  4ALP A;  4EX5 A;  4NXN Q;  2VUM H;  2ZJQ A;  1JB3 A;  4B3S Q;  1TS5 A;  3CF5 A;  1V1O A;  4GLX A;  5LMN W;  3I4L A;  1S5B D;  4B3R Q;  1I4P A;  4FDB A;  4DR1 Q;  1TWH B;  2SDF A;  1F9Q A;  4DUZ L;  1ILQ A;  3C46 A;  3LWE A;  3MXG A;  1B9M A;  4KY6 A;  1BO0 A;  4IZ8 A;  4LF6 Q;  5C3E B;  4YCW A;  5LL6 S;  4A3E B;  4DV6 Q;  2F0Q A;  1XWE A;  2GVB A;  3K7A B;  1TR5 A;  4JBK A;  1FNW A;  2D0P A;  1JOQ A;  4GKK L;  1FGB D;  3F1Z A;  3QOJ A;  1C8C A;  1N36 Q;  2J4X A;  2RDG A;  2DNC A;  5ELB A;  3HFZ B;  1WYD A;  5ELE A;  2NVX H;  1TS2 A;  1CQF A;  2Z4I A;  1SE4 A;  2RQX A;  1VQP A;  3WOF A;  1K83 B;  3KK7 A;  2PQA A;  1Z6H A;  2FFK B;  3CCR A;  5I2Y A;  1I50 B;  4X3T A;  4DR6 L;  3R2T A;  5JAV A;  3K8A A;  2HDM A;  3Q23 A;  4BY1 H;  1PH4 A;  2Y0S B;  3CW2 C;  3L7Z C;  1I6V C;  4BY7 G;  3CC4 A;  4LK1 C;  2R93 H;  1KXL A;  2A8V A;  4HAE A;  1YZ6 A;  2CQA A;  4HMI A;  4DK6 C;  3S17 B;  5IGC A;  5DM7 3;  3K5O A;  1QNU A;  4H0L C;  2F0J A;  5DAU A;  4AYB E;  4JI5 L;  4X64 L;  4JV5 Q;  4QUF A;  5FLM G;  1WTV A;  1NUC A;  4QIW E;  2F3W A;  5EAY A;  2DY8 A;  2BH2 A;  3R3O A;  2QCP X;  2GN5 A;  4AYB G;  3W1B A;  4E6I A;  1CA5 A;  4ZUJ A;  4B3M Q;  3W2D A;  1VQJ A;  3V05 A;  1YNJ D;  1E2W A;  4KI0 A;  2KED A;  2AQ2 B;  5AJ3 Q;  5JJL A;  1X3E A;  5FLX L;  1S5F D;  4A3K G;  1AZQ A;  1S72 A;  2KCC A;  1XTC D;  1W2B A;  3M3Y B;  3J81 L;  2QW7 A;  5I6Y A;  1FJG L;  3S16 H;  3K5M A;  1GHK A;  3GTK B;  4J6H A;  4U67 3;  4LF7 L;  1D2B A;  2I46 A;  1V1P A;  4FYD A;  3TP5 A;  1CKM A;  3O13 A;  1E0B A;  4XYQ A;  3CCV A;  3FHW A;  2VY3 A;  1ZYR C;  2F0N A;  3HOV G;  1YHA A;  1Y14 B;  2B63 H;  2GA4 B;  4TVA B;  3R93 A;  3K6O A;  2E5L L;  2F4I A;  5M5W H;  3KDF A;  1HRJ A;  4BA2 I;  3STB C;  3MXN B;  3W5O A;  2B2Y A;  1G51 A;  2AQ3 B;  3DWA A;  2JA7 H;  1A2T A;  4DUY L;  4HSV A;  3UI2 A;  1DXM A;  4JI4 Q;  2JSO A;  4L63 B;  4CBV A;  4FF1 A;  2GVA A;  5JOB A;  3U4Z A;  3HOY B;  2EYO A;  4DAP A;  2D62 A;  5C0X G;  4RG1 A;  4M8A A;  3X3M A;  1QUQ B;  4C3I G;  1XTD A;  4NXM Q;  1HR0 W;  4CDC C;  4C2M H;  1E7Z A;  2WAQ B;  1A2U A;  4G4K A;  1PH7 A;  2K7V A;  3CRL C;  1MSH A;  1PH1 A;  2ZTC A;  2XNA C;  1WTO A;  5A2Q L;  4DKA C;  5LHY 1;  3I91 A;  2XN9 C;  3ZJY C;  3H3V H;  5ELN A;  3S2H H;  5LMU L;  2X69 A;  2N78 A;  4YWL A;  4QCL A;  4UAI A;  4X65 L;  5GAD C;  3NK9 A;  2B39 A;  2RF4 A;  3BDO A;  4RHR A;  2EJF C;  3U58 A;  4IUT A;  3A56 A;  4ZKB B;  2ZJP A;  1JJC B;  2QDL A;  1JT8 A;  3VR3 A;  2C5C A;  2MHV A;  3BU2 A;  3NQI A;  3I4M H;  4K0K L;  4LF8 Q;  5KEE A;  3S15 H;  2OT2 A;  2NVY B;  2KEC A;  2E2I H;  1DOL A;  3VA7 A;  5M3F B;  5T1I A;  4DK1 A;  1PDQ A;  2B2Y C;  3K59 A;  2P5Z X;  2OQK A;  3MXP A;  1Y1W G;  1TS4 A;  1KC8 C;  1TWG H;  5JJI A;  5IGE A;  3HOX H;  2FHT A;  4N9P A;  5J39 A;  3KF6 A;  4L5S A;  1X56 A;  1YJW A;  1NNX A;  3D8G A;  4N8X 1;  1K9M C;  3FP9 A;  2NVQ H;  5FKA C;  3FVQ A;  4DNI A;  1KD1 C;  3D3R A;  4L5Q A;  3I4N B;  4KHP L;  1LTR D;  4IPC A;  1U4P A;  2BA1 A;  1TWC H;  2F0S A;  1BVS A;  3RZD H;  2UXB Q;  3SK4 A;  4DAV A;  2TSS A;  1KL9 A;  2UXC L;  3AQQ A;  2DN8 A;  3J7Y W;  2B2U C;  1YJN A;  1HA5 A;  3J80 c;  1SEB D;  4G7O C;  4LFA Q;  4X3U A;  4JI8 L;  3M4Y A;  2OXP A;  3SE0 A;  4ZKC B;  4HCS A;  3MXU A;  1CUK A;  5ELC A;  1K28 A;  4EQ5 A;  3PIO A;  3S1N B;  1PZJ D;  4PZ6 A;  2YYZ A;  1L1O B;  1KAA A;  2JA8 G;  3DXJ C;  4C3J H;  1Y1V G;  4JI0 L;  2LKV A;  2SNM A;  4DK0 A;  1H95 A;  3AU7 A;  3KF8 A;  1KQS A;  2XTI A;  1IZ6 A;  1CFM A;  2L15 A;  1DZ1 A;  4NDX A;  2KVM A;  2IWH A;  3CMA A;  3IL8 A;  2HCC A;  1CK1 A;  4A3D H;  1IKM A;  3H09 A;  2HQE A;  5NUC A;  2CKZ B;  3KLW A;  5CBE E;  2K1B A;  4PQX A;  1FL0 A;  3PIP A;  4X6A H;  3C2P A;  1UNS A;  1VF5 C;  2NN6 G;  4OO1 G;  5M5X B;  1JC7 A;  2KCT A;  1T5X D;  1G6P A;  5KNC A;  4A3G B;  4B3S L;  3ULP A;  4HJ8 A;  1VQG A;  4B3R L;  1X3F A;  2VB2 X;  1IHZ A;  5IP9 H;  1HFG A;  1STN A;  1GO3 E;  4DR1 L;  3CKI B;  3NP8 A;  1G29 1;  2L0C A;  3HOZ G;  1Y8P B;  2JN4 A;  1IBL Q;  1PA6 A;  2R92 H;  4Y52 H;  2IHE A;  2CW0 C;  1IYJ B;  3T53 B;  4LF6 L;  4DV6 L;  3H15 A;  2NYZ D;  2IT1 A;  5E4W C;  3NTI A;  1GUO A;  2C35 B;  3CPF A;  1N36 L;  3UDI A;  3IAY A;  4LF9 L;  3J7A F;  4KKS A;  5L37 A;  2A6E D;  4LUO A;  3FKI B;  3G48 A;  1RD9 D;  4LF4 Q;  1LT4 D;  4RA8 A;  3OIP A;  4FVM A;  3RZO B;  1PVO A;  2A73 B;  1NMF A;  1PMR A;  4A3J B;  2KOL A;  1CKN A;  2PO4 A;  5I2X A;  1EQR A;  3BVG A;  1LLR D;  1BXT A;  3HGB A;  1S5C D;  2AUJ D;  4IUN A;  4ODG A;  1S40 A;  5IYB H;  4LAA A;  4KY5 A;  4DXF A;  1EY8 A;  2RSO A;  1NTG A;  1D6E C;  2BOS A;  1G6Z A;  1B7Y B;  3CCE A;  3I2Z A;  5H1S E;  1K73 C;  3HOW H;  3RN5 A;  3K5L A;  5M3M B;  2JE6 I;  1PZI D;  2QEJ C;  3PCO B;  5IYD H;  1B3A A;  2I5L X;  5C4J B;  1SXT A;  3G6J B;  4YCU A;  3CQZ B;  1VQL A;  4DV7 Q;  3OYY A;  1QZG A;  2FXQ A;  1K0R A;  3S1Q B;  4ZLT F;  1QNK A;  4TRD A;  4GZY C;  3CC2 A;  1CM9 A;  1BCP F;  3BZD B;  3PF4 A;  4JV5 L;  4TKO B;  5IWA Q;  4RHS A;  1H9K A;  4YCV A;  5I9P A;  5JEA J;  4BA1 I;  1EWH A;  3EA6 A;  1AN8 A;  4OO1 I;  2F0K A;  1IKL A;  2EQS A;  4B3M L;  1ML0 D;  3J80 i;  1SE2 A;  5C5M A;  1TII D;  2QGQ A;  2DNE A;  1Z47 A;  3GP7 A;  3P20 A;  5AJ3 L;  3RR5 A;  3S2D H;  4R4O A;  1K8A C;  2SEB D;  3KBG A;  3P75 A;  4BXX H;  1RDP D;  4K8I A;  1VQ8 A;  1HFN A;  2BDN A;  1U4R A;  3LGJ A;  3NBI A;  1GVP A;  2E76 C;  3A54 A;  5I6W A;  4Y7N B;  1K8M A;  5CR3 A;  4OON A;  1EIY B;  4GOP B;  1HHV A;  1U0L A;  1SR3 A;  3GTL B;  3J81 j;  1I5F A;  2K52 A;  3NBH A;  1L1O C;  4A3B H;  5IE8 A;  2XRS D;  4U68 A;  3K57 A;  1I94 L;  2O4X A;  2E2H H;  1D5Z C;  2NVT H;  1PTO H;  5G3L F;  1BBW A;  1PH2 A;  3TP8 A;  2K5N A;  2Z8L A;  3E3X A;  4I65 A;  4BBR H;  5K5P A;  3J81 c;  3CCL A;  4JI4 L;  1JR0 D;  1VQO A;  1A3V A;  1XPO A;  1LTI D;  1PTO D;  3RLO A;  2MO0 A;  4NP5 A;  3NEL A;  1BQQ T;  3DEO A;  2F4V Q;  1ZXT A;  2NTT A;  3TZU A;  4KD3 A;  4NXM L;  1N32 Q;  4BY7 B;  4P73 A;  2JA6 H;  1KRT A;  4IUU A;  2RBM A;  1SNC A;  2A6E C;  4LWC A;  5EQ0 A;  4UP8 A;  3X3N A;  2OTJ A;  1JWM D;  4HIK A;  4A93 H;  1C7Y A;  5F2D A;  5C4X H;  1F77 A;  3KLS X;  1AEX A;  3VYU A;  1RF2 D;  4ULL A;  1E24 A;  1O7Y A;  5KNB A;  4Q0F A;  4H13 C;  1GUN A;  3Q6S A;  4EQO A;  1SFO B;  4XQQ A;  1RL2 A;  4AYB B;  1UE1 A;  3P7J A;  5GRO A;  1WCM H;  3H0G G;  3VR5 A;  4OWW B;  4QIW B;  4LF8 L;  2JXM B;  4A3L H;  4MHE A;  3NTK A;  4A3K B;  4KTA A;  2F0P A;  3GTQ B;  1BUV T;  4GNX B;  2H5X A;  1MKH A;  3GV6 A;  4QF4 A;  4DV5 Q;  1HXY D;  4MTK A;  3J80 L;  5C44 G;  1I3Q B;  3AFP A;  3ND9 A;  3U50 C;  1EU3 A;  3MA2 B;  2CWP A;  1PRT F;  5D65 A;  3MFG A;  1LYL A;  1WTR A;  3AEV A;  5CGK A;  3HOV B;  3PQI A;  1MHW C;  2NZO A;  2PQE A;  4DF7 A;  5KYL A;  1YHQ A;  5CV5 A;  2JA5 G;  2L9H A;  1C9O A;  2PCF B;  1BCP C;  3F2D A;  2AMC B;  2N3S A;  5GAE C;  2VQF Q;  3F8T A;  4DV3 Q;  4ZRZ A;  1LO5 D;  1HTL D;  4A3I H;  2UXB L;  1SE8 A;  2PNH A;  3A8J E;  2PI2 A;  3HOU H;  4LUV A;  3HKZ E;  2UUA Q;  4X3S A;  3V2T A;  1S5D D;  2F0L A;  3GTG B;  2KHJ A;  3IFD A;  2FJ2 A;  4A75 A;  4LFA L;  1YI2 A;  4KN4 C;  2R7Z G;  2PQA B;  1D5X C;  1SBB B;  4DV4 Q;  3MTS A;  1PZK D;  3A8K E;  3HKZ G;  3MHB A;  2F0H A;  4C3I B;  5IOC A;  4HCE A;  3S1M H;  3CCM A;  3BS1 A;  2AWO A;  3RUZ A;  1YBY A;  1SYG A;  1LTT D;  2Z0S A;  2FMC A;  4YHH Q;  2NBF A;  4GOP C;  2ASB A;  1NBW A;  2B2W C;  2IY5 B;  1Q3L A;  2ZTE A;  1PFS A;  3PIO 3;  1BOS A;  4R4I A;  1Q8K A;  1EUJ A;  4FXK C;  4JI6 Q;  3GTO H;  3OWE B;  2VL6 A;  3E0E A;  1ZYR D;  1M4V A;  1EY6 A;  5EKK A;  1M90 C;  1HTP A;  3GV3 A;  4XQJ A;  2RHQ B;  3GTM B;  1F9P A;  1KIX A;  2PPB C;  3GTJ H;  3STB D;  1PFB A;  4HJ9 A;  2K5V A;  1F2Z A;  3JAM E;  2A69 D;  4XIG S;  1R9T B;  2FMM A;  3PIP 3;  4HIM A;  1BF4 A;  2EXD A;  1IBL L;  2BH8 A;  3T16 A;  2PYK A;  2NZH A;  2HCI A;  3ULJ A;  1TWH H;  1EY4 A;  1B50 A;  1Y1W B;  1RTO A;  4KY7 A;  4P71 A;  3I4O A;  1KAB A;  5ELD A;  5C3E H;  2RVL A;  3G4S A;  4A3E H;  4N9T A;  1TQO A;  3K7A H;  3ONA B;  2HT1 A;  1K0S A;  1VQM A;  4LF4 L;  1ILP A;  1V1P B;  3QG1 A;  2D2C C;  1EYC A;  5K36 H;  2Q2U A;  3K81 C;  2PI2 E;  1MSG A;  1QG7 A;  2F0U A;  2F0F A;  5CV8 A;  3PO3 G;  4DR7 Q;  3TP7 A;  2Q8T A;  2BE5 C;  1K83 H;  2EOT A;  1V1Q A;  4CDE C;  3KDF B;  1PHJ A;  2DY7 A;  4P2C B;  4DR5 Q;  3PUY A;  3D6W A;  1QE6 A;  5C0X J;  1CHP D;  4C1N I;  1I50 H;  2NVX B;  5FJ8 G;  1AH9 A;  2K5Q A;  4OWX B;  3FPP A;  2EYF A;  3K80 C;  3URY A;  4Q5V A;  2EJG C;  3N6R A;  4DAY A;  1OO9 B;  4JI2 Q;  2K5H A;  4BWG B;  1STB A;  2E75 C;  1A3T A;  1SMY D;  1JIC A;  1X6O A;  1X65 A;  1HH2 P;  1TS3 A;  4GNX C;  4A3M G;  5HUR A;  1S4Z A;  1OXS C;  4HTH A;  4DV7 L;  1TWA B;  1SYD A;  4DR2 Q;  2JA8 B;  3CXC A;  1Y1V B;  4OEL B;  3HS0 C;  3C3L A;  1SRO A;  4JBJ A;  5IWA L;  1I6H B;  2Q8I B;  2AQ1 B;  2RDH A;  2K03 A;  1PRT C;  3KBX A;  1YVC A;  5IT9 E;  4HMJ A;  4NW2 A;  1YHB A;  4C56 C;  2OF1 A;  1NMG A;  5LL6 X;  3I55 A;  1XNR Q;  2H4O A;  5J1Z A;  4KK7 A;  1SDF A;  3E9I A;  1XYI A;  4ID6 A;  1SJE D;  2L11 A;  2E74 C;  1U4M A;  2EYH A;  4YWM A;  4HJ7 A;  1GHJ A;  1CSP A;  3T1H Q;  5C5L A;  4A3C H;  1CTM A;  3F2C A;  3M3Y H;  4IFD G;  1VMP A;  3HOZ B;  2DUD A;  4XQN A;  1XMO L;  4RGM A;  1KDC A;  3GTK H;  1QWY A;  2PZU A;  3A0J A;  1HUM A;  1XX8 A;  5IP7 H;  1O80 A;  4R4T A;  2G9H D;  3D0F A;  3C1F A;  1MJE A;  3R8B A;  4K5V A;  1WOC A;  3KF6 B;  1Y8N B;  4JC0 A;  2A69 C;  2HDL A;  1G2T A;  4CJ1 B;  5IGF A;  2RKS A;  1QVG A;  1B3Q A;  1WJJ A;  1JOK A;  2C9O A;  3SXH A;  5M5W B;  1IL2 A;  3D4W A;  2F4V L;  4JI1 Q;  4X62 Q;  1QIL A;  1F9R A;  1I4H A;  1GUG A;  4WFN 3;  3HOY H;  2WB1 E;  3M9B A;  5T1G A;  3A5U A;  1N32 L;  2UXD Q;  2JP1 A;  2L12 A;  1HJP A;  1CT1 D;  2F0D A;  3U9S A;  5KIX A;  1VCI A;  4BBS G;  2XWB B;  3TS0 A;  4DR3 Q;  1P16 A;  4EVO A;  1PYB A;  1DOM A;  3ERS X;  5I9O A;  2K75 A;  3UDX A;  1IXR A;  2Q8R E;  2WB1 G;  4G7H C;  4A3F G;  2F0W A;  3PO2 G;  2A74 C;  2WP8 J;  1RKN A;  2CW0 D;  4JBW A;  4C2M B;  5IIF A;  4HIO A;  1BNZ A;  5E4X A;  2OWO A;  3PUX A;  1XNQ Q;  2J7Z A;  2K5W A;  3VA5 A;  3T1Y L;  3KLS A;  1ET6 A;  3TSS A;  1ASY A;  3KF8 B;  1Q90 A;  1U5K A;  2EY2 A;  4C3H H;  1LAB A;  1EZ8 A;  1F9S A;  1UWV A;  1HQM C;  1Q12 A;  1NSN S;  2LY7 A;  4FNF A;  4K2K A;  5DEH A;  2OTL A;  1SMY C;  2X6G A;  3Q22 A;  1MIU A;  1N9W A;  2ES2 A;  3T4A C;  1Q7Y C;  4IFD I;  3TBI B;  5FO8 B;  1STA A;  3L3O C;  5FK9 C;  2NVY H;  4DV5 L;  5FO9 B;  1EQQ A;  4ZK9 B;  2VUM G;  5M3F H;  3N52 A;  1LUZ A;  2NWG A;  2CFM A;  1I4X A;  1LM0 A;  1SLJ A;  4C1N K;  2MGS A;  4CKB A;  2EIF A;  1RCV D;  1CHQ D;  4PNY A;  4DGZ A;  1V8Q A;  2VQF L;  4POG A;  4DV3 L;  4ILW A;  4GN3 B;  3IRB A;  2LFN A;  4DNR B;  3GD7 A;  1E3P A;  2LXJ A;  4UP7 A;  3I4N H;  2MO1 A;  4OX9 Q;  1MBY A;  2UUA L;  2PMZ E;  1WTH A;  4RGN A;  1G8Z D;  5C0X I;  4KJN A;  2V4D A;  1GUS A;  2WFW A;  3Q8D A;  1F2Y A;  1II3 A;  3M7G A;  1SNO A;  1EFI D;  4OWT B;  2M9V A;  2R61 A;  4JG2 A;  1CKN B;  1D1I A;  4HSP A;  1NJI C;  2ZM6 Q;  3FMC A;  2PZT A;  4JOI A;  5KYI A;  4BY1 G;  1QUQ A;  1XJV A;  1KHI A;  1O7I A;  2AUK A;  3TP6 A;  2F1M A;  3S1N H;  2KEN A;  3A5Z B;  5IGD A;  4YHH L;  5LMN Q;  2R93 G;  1MD2 D;  4IUP A;  4F7X A;  3I7F A;  3OSO A;  5DLQ E;  4UP9 A;  4HN7 A;  3PUW A;  1A8V A;  4POF A;  3I70 A;  4MIU A;  2WV6 D;  4GS3 A;  3T56 B;  4JI6 L;  2AWN A;  4R4C A;  4HR7 B;  2QKI C;  1EEI D;  2A19 A;  1CA6 A;  1GUT A;  2K4K A;  2UUC Q;  3ER0 A;  5DNF A;  3VYT A;  3CME A;  4L5R C;  4X66 Q;  1M1K C;  1Y8O B;  4M1U B;  3IKJ A;  5CYU A;  3BVZ A;  4FF4 A;  4NXN L;  5JEA H;  2RCN A;  4X3K A;  1IL8 A;  4WJW A;  1FD7 D;  4PMB A;  3H0G B;  3QIA A;  1LAC A;  4R8I A;  2CQO A;  1T9H A;  3RD4 A;  1EFW A;  4A3G H;  1STE A;  3NSW A;  1DON A;  4KLK A;  4F8M A;  3RNU A;  4GN4 B;  1VQ6 A;  1R4Q B;  5C44 B;  2M00 A;  3VR4 A;  5I4D A;  2IPK D;  3HG9 A;  4GKJ Q;  1GJX A;  1ENC A;  4CHT B;  2B2V A;  4K14 A;  2K5D A;  1IBM Q;  4RAU C;  1FR3 A;  4K8J A;  3M4P A;  1PV4 A;  1PYW D;  2HIV A;  2JA5 B;  1FNV A;  1XMQ Q;  3F2U A;  3FKI H;  2B63 G;  5JVG 3;  2YV5 A;  5KGU A;  3RZO H;  5BN3 A;  5IYC H;  4UPA A;  2BCO A;  1FYC A;  5GAG C;  4A3J H;  2VQE Q;  2I5M X;  4DR5 L;  1EWC A;  1K3B C;  4JYA Q;  3TN2 A;  4K6L A;  2JA7 G;  1EY5 A;  1IYV A;  1AW7 A;  4JI2 L;  1QVC A;  4NKL A;  1A3U A;  2X6L A;  2R7Z B;  4JK1 C;  1HQR D;  1AE2 A;  4OEM B;  3HKZ B;  3UDF A;  5BN4 A;  1WI5 A;  5M3M H;  1JMC A;  1VMC A;  1F2L A;  5CC4 A;  4DR2 L;  3M85 A;  3DLL A;  5C4J H;  1RHP A;  2WAC A;  4H7B A;  1GKH A;  3CQZ H;  4K6D A;  2IX1 A;  1EU4 A;  3V96 A;  1BCP B;  3KLR A;  2QIL A;  3OIQ A;  3S1Q H;  3OW2 A;  5EBD A;  4APV A;  5ISR A;  1HZB A;  2OQ0 A;  2EE1 A;  1UUP A;  2E2J B;  1JE5 A;  4JCV E;  1YJ9 A;  3BJU A;  1UEB A;  1KDA A;  1LT3 D;  2NN6 I;  1XNR L;  3FPU B;  4JBM A;  4TQU S;  1MJC A;  1Z9F A;  2L4N A;  2JEA I;  1TY2 A;  5EGT A;  4JI3 Q;  3QWN A;  3ZYY X;  3CD6 A;  1BCP D;  1SN8 A;  4LW1 A;  3EIV A;  3ICE A;  4L6T B;  1QZH A;  3DM3 A;  4OIK A;  4JI5 Q;  3K5N A;  1A15 A;  1I4G A;  3T1H L;  2KA7 A;  1ESR A;  3NUC A;  4KV6 A;  1JCK B;  5CV9 A;  4JI7 Q;  3ERO A;  2VS1 A;  4B9X A;  2N49 A;  4JPB W;  5IT9 c;  5KND A;  3I4M G;  4BS9 A;  3E9H A;  3CHB D;  4KKU A;  4Y7N H;  1EY7 A;  3UDG A;  1BBU A;  3UE0 A;  3GTL H;  2PNR C;  4DR4 Q;  4R1J A;  1S3O A;  3DWP A;  1BKB A;  2JYO A;  1HR0 Q;  3LX0 A;  1EIH A;  2CVR A;  4P75 A;  3HOX G;  1GD7 A;  4DV2 Q;  1VDZ A;  1L0Y B;  1ESF A;  3MEF A;  1L2F A;  2EY1 A;  3S24 A;  1SND A; 
#chains in the Genus database with same CATH homology
 4K2L A;  3PO3 B;  4XT1 B;  4FXG C;  2VNU D;  1E2Z A;  2A6H C;  1E2V A;  2WII B;  5G3L D;  1NR2 A;  3ERQ A;  4LJZ C;  3SVM A;  1Y69 U;  3GO5 A;  1J9O A;  3HP3 A;  1TWF B;  4A3M B;  3H91 A;  3OW7 A;  4O42 A;  3PUZ A;  4DU9 A;  1U4L A;  3EFX D;  4CKC A;  2MPM A;  4C3J G;  2EY5 A;  3S14 B;  3TDQ A;  4Z9C B;  4S3S A;  4RGO S;  2RA4 A;  1SNM A;  2BDO A;  1X32 A;  3A8I E;  2ZXO A;  3BYY B;  4RKB A;  4V19 0;  1QB5 D;  2SNS A;  4G7Z C;  1SYF A;  5EKL A;  2JEB I;  5JPM C;  1ZKO A;  5M5Y B;  2BE5 D;  3R2I A;  5C4Z A;  1V43 A;  1CQV A;  1NCV A;  4KHV A;  3DHQ A;  4EQP A;  2K32 A;  3SHL A;  1PFN A;  3ITP A;  4PV1 C;  1PRT B;  3VR6 A;  3EQL C;  5C4H A;  3GTP B;  3DEP A;  1H9J A;  3PV0 A;  3E6Z X;  1EQV A;  2G9D A;  4DXG A;  1TVX A;  3MC0 B;  4K5X A;  1PRT D;  1LT5 D;  3D4D A;  2I07 B;  3OOC A;  5JVH 3;  2EVB A;  2NUC A;  5EPJ A;  2VB3 X;  3K0Y A;  1STG A;  3I3C A;  1KLU D;  4WRD A;  1WTX A;  1D1K A;  4BBS B;  5C0X H;  3A55 A;  2M2L A;  2B2T A;  4EQN A;  1C4Q A;  4O1N A;  2K6A A;  1NAP A;  2KJX A;  1KTK A;  2WB1 B;  4A3F B;  2EYL A;  3PO2 B;  1JQY D;  4IN3 A;  3M4O B;  3FDT A;  3WOE A;  1H9S A;  2ENB A;  1B9N A;  5D14 A;  3SK8 A;  1JE4 A;  3EJI A;  1IW7 C;  1EYD A;  2YU9 B;  1DJR D;  1WTQ A;  2O2L D;  3JAM L;  4IQZ A;  1Z7T A;  4DN4 M;  4XTC S;  2IW3 A;  3C1E A;  1MI2 A;  1PLF A;  3SK5 A;  3S9W A;  1KLG D;  5FOB B;  4IFD J;  3I73 A;  3DUZ A;  1C48 A;  3D31 A;  1B2T A;  1LTG D;  3A7A B;  2EPB A;  4KN7 C;  2VUM B;  1QJO A;  4J8Q A;  1EYA A;  3ND8 A;  2F0G A;  3QOL A;  2KHS A;  5EPL A;  2ID0 A;  1EOT A;  3NWT A;  4FO2 A;  3FRP B;  1SJH D;  3LNN A;  5TSS A;  3NXW A;  2B2T C;  1KDB A;  1EQT A;  1LT6 D;  3SK6 A;  4FF3 A;  2QF7 A;  2CHB D;  3RLF A;  1AP0 A;  1W6J A;  2HUG A;  4XXE A;  5C3W A;  2XVS A;  5EKI A;  4TSS A;  1YNN C;  2PMZ B;  4IUQ A;  2K01 A;  1DM0 B;  1LTA D;  3NPP A;  2F03 A;  4BY1 B;  2KCN A;  3EVQ A;  4OHJ A;  2R93 B;  1HUN A;  5IT9 L;  2BA0 A;  2N88 A;  2EJM A;  3HZX A;  4IUR A;  3T13 A;  2A68 C;  5CV7 A;  1EIG A;  4H44 C;  2NN6 H;  4OO1 H;  1SYB A;  2XSC A;  1T5E A;  2IX0 A;  3NTH A;  1H9R A;  2KQ3 A;  3I72 A;  2TMP A;  3RMH A;  3DWQ A;  3S16 B;  5FLX E;  2K33 A;  1A6X A;  1NR4 A;  3BVM A;  1AFP A;  5D3D A;  3J81 E;  3FEW X;  2F0I A;  3T51 B;  3OHX C;  2F0T A;  3VYS A;  2B63 B;  1CZG A;  3NWS A;  1KNE A;  1HA6 A;  1DD2 A;  1M8A A;  1UEA B;  5EJW A;  2F0M A;  3L9A X;  1JOR A;  2JA7 B;  4PMC A;  1EY0 A;  1D5M C;  2RDF A;  1WVL A;  1G2S A;  3MAQ A;  2K28 A;  1FNU A;  1EL0 A;  5HGT A;  1DYQ A;  2XIW A;  4XT3 B;  3DM1 A;  1X3Q A;  2FIN B;  4ABN A;  2K05 A;  2L5T A;  4ME5 A;  3PMF A;  1WD1 A;  5BN5 A;  5COY A;  1KNA A;  4CGY B;  3AMU A;  3S2H B;  1TT2 A;  5A2Q E;  1TKW B;  1BR9 A;  2B2U A;  2MJ8 A;  3P1H A;  3H94 A;  4C3H B;  4F87 A;  3BDL A;  1I4Q A;  3MVV A;  4QUC A;  1BDO A;  1ENF A;  3I4M B;  2A5H A;  1AZP A;  2F0O A;  3S15 B;  4ZUI A;  2E2I B;  1SYE A;  1B44 D;  1G91 A;  2L55 A;  2PW7 A;  1TWG B;  3MFY A;  4OL7 A;  1OXU A;  1SNP A;  3GQB A;  5CMD A;  3HOX B;  1VF7 A;  1JWU D;  5A35 A;  2LS0 1;  1PFM A;  3MXN A;  2NZ1 D;  1B53 A;  2NVQ B;  3MEH A;  4PMW A;  4FF2 A;  1SAP A;  1OXV A;  4KJO A;  3WDN A;  5K36 G;  1RJT A;  2PZW A;  4IAL A;  5AFW A;  1YNJ C;  1TWC B;  2O5J C;  3RZD B;  1EEF D;  1MGS A;  5E3F A;  5DM6 3;  3LWU A;  5EPK A;  4DA2 A;  1B1Z A;  4DFA A;  1GOZ A;  4J1M A;  3BDC A;  4KD4 A;  1GXD C;  1CI3 M;  4KMU C;  4NMZ A;  4WOR A;  4C3J B;  2MUY A;  1O78 A;  5IGB A;  1BBX C;  4RGT A;  2KEE A;  3OMG A;  4A3D B;  2EXZ A;  4OIJ A;  2WKC A;  2A6H D;  4CKE A;  4HED A;  4RCO A;  1IYU A;  3CU7 A;  5CV6 A;  2D9U A;  2R92 B;  3VR2 A;  3A7L A;  2ICE C;  4LMQ D;  1ICW A;  4RFB A;  3I8Z A;  2EZV A;  1WD0 A;  3SDZ A;  3H3V C;  3E5S A;  1O7L A;  5E1F A;  1J8I A;  3OMC A;  2R3Z A;  2PW5 A;  2F0E A;  1OXT A;  3E0J A;  3HEJ A;  4KKT A;  2LMC B;  3K58 A;  2H1E A;  3HOW B;  2OEO A;  2IX3 A;  2B8G A;  3D4R A;  3QJY A;  1QCB D;  3Q24 A;  3BG3 A;  1DOK A;  1LTB D;  2Z1C A;  2EY6 A;  5IOD A;  3M7N A;  1ROD A;  2B2V C;  1W6K A;  1SE3 A;  2IJ0 A;  4UDU C;  1STH A;  4C3H G;  4YIJ A;  1SSO A;  3TME A;  1ZEQ X;  3G7L A;  4ZAI A;  2O5I C;  5CV4 A;  1Q1E A;  5M9O A;  3Q0A A;  3S2D B;  3KUP A;  3I90 A;  5FO7 B;  1I4R A;  2K04 A;  1UAP A;  4CJ0 B;  3VYR A;  1HCZ A;  1XXG A;  1ENA A;  3H6M A;  2F3V A;  4A3B B;  2RSN A;  4FXD A;  5EBC A;  1JWS D;  2E2H B;  4IUV A;  4KHZ A;  4L8J A;  1PTO F;  2NVT B;  2Z4H A;  1PTO B;  2WIN B;  3MZ5 A;  1H9M A;  1Q1B A;  1DCZ A;  1ONL A;  1IW7 D;  1SNQ A;  4BBR B;  5COR A;  2SOB A;  3OWF A;  1HPC A;  4RCN A;  3W3A A;  5JJZ A;  4RWS C;  2VXW A;  1CZW A;  5JPN C;  1LTS D;  2B8F A;  5C6A A;  3U9O A;  1O7Z A;  2JA6 B;  1QOH A;  2KUM A;  2NB0 A;  2E2D C;  4RKL A;  1TU2 B;  4QB4 A;  4V0B A;  2EYM A;  2J0T D;  3NE5 B;  4A93 B;  4XYO A;  4B08 A;  2MP1 A;  5C4X B;  1B4O A;  2IL8 A;  4ZYS A;  1H9S B;  3BYT B;  3OPO A;  1WTW A;  3CRK C;  1TY0 A;  2WKD A;  5JEA G;  1WCM B;  2EYJ A;  4B9W A;  3SEB A;  4IFD H;  4MN3 A;  3SR1 A;  1U9R A;  2D5D A;  2B2W A;  3NQT A;  1R4P B;  1YNN D;  5D3I B;  3D6C A;  4F88 A;  4CJ2 C;  1F2M A;  3HRZ C;  3J80 E;  1ET9 A;  3MWY W;  2XRQ D;  1RTN A;  2EDG A;  2ZT9 C;  4OGQ C;  1X3P A;  2EYP A;  3NHH A;  4A3I B;  3QB3 A;  4R9W A;  3J7A V;  1S5E D;  4K5W A;  3HOU B;  4DNT B;  1EZ6 A;  2A68 D;  5KRU A;  5CBA E;  2NTS A;  1GUW A;  2QDB A;  5ELF A;  1PXU A;  1EY9 A;  2N55 A;  1SYC A;  1JOO A;  3S1M B;  2R6G A;  3IFT A;  5C3X A;  1STY A;  3QO2 A;  4G57 A;  3TZD A;  3DMU A;  1Q8I A;  2L1B A;  3AB9 A;  5IGG A;  4R8N A;  4XDX A;  1WTP A;  2ICI A;  1OXX K;  1LV9 A;  5J22 A;  3GTO B;  1L0X B;  1PTO C;  2F0V A;  4EGV A;  4FP5 D;  2ZXR A;  4QMG A;  4ZQ3 A;  2XWJ B;  2ZXP A;  3PUV A;  4RH6 A;  4I7Z C;  3GTJ B;  1K8O A;  3S1R B;  1JB3 A;  1TS5 A;  1V1O A;  3I4L A;  1S5B D;  1I4P A;  1TWH B;  2SDF A;  1F9Q A;  1ILQ A;  3C46 A;  3LWE A;  3MXG A;  1B9M A;  4KY6 A;  1BO0 A;  4IZ8 A;  5C3E B;  5LL6 S;  4A3E B;  2F0Q A;  1XWE A;  3K7A B;  1TR5 A;  1FNW A;  1JOQ A;  1FGB D;  3QOJ A;  1C8C A;  2J4X A;  2RDG A;  2DNC A;  5ELB A;  5ELE A;  1TS2 A;  1CQF A;  2Z4I A;  1SE4 A;  2RQX A;  3WOF A;  1K83 B;  3KK7 A;  1Z6H A;  2FFK B;  5I2Y A;  1I50 B;  4X3T A;  3R2T A;  5JAV A;  2HDM A;  3Q23 A;  2Y0S B;  3L7Z C;  1I6V C;  4LK1 C;  4HAE A;  2CQA A;  4HMI A;  3S17 B;  5IGC A;  5DM7 3;  3K5O A;  1QNU A;  4H0L C;  2F0J A;  5DAU A;  4QUF A;  1WTV A;  1NUC A;  2F3W A;  2DY8 A;  2QCP X;  3R3O A;  4E6I A;  1CA5 A;  4ZUJ A;  3W2D A;  3V05 A;  1YNJ D;  1E2W A;  4KI0 A;  2KED A;  2AQ2 B;  5FLX L;  1S5F D;  1AZQ A;  2KCC A;  1XTC D;  3M3Y B;  3J81 L;  5I6Y A;  3K5M A;  1GHK A;  3GTK B;  4J6H A;  4U67 3;  1D2B A;  2I46 A;  1V1P A;  4FYD A;  3TP5 A;  3O13 A;  1E0B A;  4XYQ A;  1ZYR C;  2F0N A;  2GA4 B;  3R93 A;  3K6O A;  2F4I A;  1HRJ A;  4BA2 I;  2B2Y A;  2AQ3 B;  3DWA A;  1A2T A;  4HSV A;  3UI2 A;  1DXM A;  2JSO A;  4L63 B;  4CBV A;  4FF1 A;  5JOB A;  3HOY B;  2EYO A;  4DAP A;  2D62 A;  5C0X G;  4M8A A;  3X3M A;  4C3I G;  2WAQ B;  4G4K A;  1A2U A;  2K7V A;  3CRL C;  1MSH A;  2XNA C;  1WTO A;  5A2Q L;  5LHY 1;  3I91 A;  2XN9 C;  2X69 A;  4QCL A;  4UAI A;  3NK9 A;  2B39 A;  3BDO A;  4RHR A;  2EJF C;  4IUT A;  3A56 A;  4ZKB B;  3VR3 A;  2C5C A;  2MHV A;  3NQI A;  5KEE A;  2OT2 A;  2NVY B;  2KEC A;  1DOL A;  3VA7 A;  5M3F B;  5T1I A;  4DK1 A;  1PDQ A;  2B2Y C;  3K59 A;  3MXP A;  1TS4 A;  5IGE A;  2FHT A;  4N9P A;  5J39 A;  3D8G A;  5FKA C;  3FVQ A;  3D3R A;  3I4N B;  1LTR D;  1U4P A;  2BA1 A;  2F0S A;  3SK4 A;  4DAV A;  2TSS A;  2DN8 A;  3J7Y W;  2B2U C;  1HA5 A;  1SEB D;  4G7O C;  4X3U A;  3M4Y A;  2OXP A;  3SE0 A;  4ZKC B;  4HCS A;  3MXU A;  5ELC A;  3S1N B;  1PZJ D;  2YYZ A;  1KAA A;  3DXJ C;  2LKV A;  4DK0 A;  2SNM A;  3AU7 A;  3KF8 A;  1CFM A;  1DZ1 A;  4NDX A;  2KVM A;  2IWH A;  3IL8 A;  2HCC A;  1CK1 A;  1IKM A;  3H09 A;  2HQE A;  5NUC A;  5CBE E;  2K1B A;  4PQX A;  3C2P A;  1UNS A;  1VF5 C;  2NN6 G;  4OO1 G;  5M5X B;  1JC7 A;  1T5X D;  5KNC A;  4A3G B;  2VB2 X;  1IHZ A;  1HFG A;  1STN A;  3CKI B;  3NP8 A;  1G29 1;  2L0C A;  1Y8P B;  2CW0 C;  3T53 B;  2NYZ D;  2IT1 A;  5E4W C;  3NTI A;  1GUO A;  3IAY A;  3J7A F;  4KKS A;  2A6E D;  3FKI B;  1RD9 D;  1LT4 D;  4RA8 A;  3OIP A;  4FVM A;  3RZO B;  2A73 B;  1PMR A;  4A3J B;  2KOL A;  2PO4 A;  5I2X A;  3BVG A;  1LLR D;  1BXT A;  3HGB A;  1S5C D;  2AUJ D;  4IUN A;  4ODG A;  4LAA A;  4KY5 A;  4DXF A;  1EY8 A;  2RSO A;  1D6E C;  2BOS A;  1G6Z A;  3K5L A;  5M3M B;  2JE6 I;  1PZI D;  2QEJ C;  1B3A A;  5C4J B;  1SXT A;  3G6J B;  3CQZ B;  3S1Q B;  4ZLT F;  1QNK A;  4TRD A;  4GZY C;  1CM9 A;  1BCP F;  3BZD B;  4TKO B;  4RHS A;  1H9K A;  5I9P A;  5JEA J;  4BA1 I;  1EWH A;  3EA6 A;  1AN8 A;  4OO1 I;  2F0K A;  1IKL A;  1ML0 D;  1SE2 A;  5C5M A;  1TII D;  2DNE A;  1Z47 A;  3GP7 A;  3P20 A;  2SEB D;  3KBG A;  3P75 A;  1RDP D;  4K8I A;  1HFN A;  2BDN A;  1U4R A;  2E76 C;  3NBI A;  3A54 A;  5I6W A;  4Y7N B;  1K8M A;  5CR3 A;  1HHV A;  3GTL B;  3NBH A;  2XRS D;  4U68 A;  3K57 A;  2O4X A;  1D5Z C;  1PTO H;  5G3L F;  3TP8 A;  2Z8L A;  4I65 A;  5K5P A;  1JR0 D;  1A3V A;  1LTI D;  1PTO D;  4NP5 A;  1BQQ T;  3DEO A;  1ZXT A;  2NTT A;  3TZU A;  4KD3 A;  4BY7 B;  4IUU A;  2RBM A;  1SNC A;  2A6E C;  5EQ0 A;  3X3N A;  1JWM D;  5F2D A;  1F77 A;  3KLS X;  1AEX A;  3VYU A;  1RF2 D;  4ULL A;  1O7Y A;  5KNB A;  4Q0F A;  4H13 C;  1GUN A;  3Q6S A;  4EQO A;  1SFO B;  4XQQ A;  4AYB B;  3P7J A;  3VR5 A;  4QIW B;  2JXM B;  4MHE A;  3NTK A;  4A3K B;  4KTA A;  2F0P A;  3GTQ B;  1BUV T;  3GV6 A;  4QF4 A;  1HXY D;  3J80 L;  1I3Q B;  3ND9 A;  1EU3 A;  3MA2 B;  1PRT F;  5D65 A;  3MFG A;  1WTR A;  5CGK A;  3HOV B;  2PQE A;  4DF7 A;  5KYL A;  5CV5 A;  2L9H A;  2PCF B;  1BCP C;  4ZRZ A;  1LO5 D;  1HTL D;  3A8J E;  4X3S A;  3V2T A;  1S5D D;  2F0L A;  3GTG B;  3IFD A;  2FJ2 A;  4KN4 C;  1D5X C;  1SBB B;  3MTS A;  1PZK D;  3A8K E;  3MHB A;  2F0H A;  4C3I B;  5IOC A;  4HCE A;  3BS1 A;  2AWO A;  3RUZ A;  1SYG A;  1LTT D;  2FMC A;  2NBF A;  2B2W C;  1Q3L A;  3PIO 3;  1BOS A;  4FXK C;  3OWE B;  1ZYR D;  1M4V A;  1EY6 A;  5EKK A;  1HTP A;  3GV3 A;  4XQJ A;  3GTM B;  1F9P A;  2PPB C;  1PFB A;  1F2Z A;  3JAM E;  2A69 D;  4XIG S;  1R9T B;  2FMM A;  3PIP 3;  1BF4 A;  3T16 A;  2PYK A;  2HCI A;  1EY4 A;  1B50 A;  1Y1W B;  1RTO A;  4KY7 A;  1KAB A;  5ELD A;  2RVL A;  4N9T A;  1TQO A;  3ONA B;  1ILP A;  1V1P B;  3QG1 A;  2D2C C;  1EYC A;  5K36 H;  1MSG A;  1QG7 A;  2F0U A;  2F0F A;  5CV8 A;  3TP7 A;  2Q8T A;  2BE5 C;  2EOT A;  2DY7 A;  4P2C B;  3PUY A;  3D6W A;  1QE6 A;  5C0X J;  1CHP D;  4C1N I;  2NVX B;  2K5Q A;  3URY A;  3FPP A;  2EYF A;  4Q5V A;  2EJG C;  3N6R A;  4DAY A;  1OO9 B;  4BWG B;  1STB A;  2E75 C;  1A3T A;  1SMY D;  1JIC A;  1TS3 A;  5HUR A;  1S4Z A;  1OXS C;  4HTH A;  1TWA B;  1SYD A;  2JA8 B;  1Y1V B;  3HS0 C;  3C3L A;  1I6H B;  2Q8I B;  2AQ1 B;  2RDH A;  2K03 A;  1PRT C;  3KBX A;  5IT9 E;  4HMJ A;  4NW2 A;  4C56 C;  2OF1 A;  5LL6 X;  2H4O A;  5J1Z A;  4KK7 A;  1SDF A;  1XYI A;  4ID6 A;  1SJE D;  2L11 A;  2E74 C;  1U4M A;  2EYH A;  1GHJ A;  5C5L A;  1CTM A;  4IFD G;  1VMP A;  3HOZ B;  4XQN A;  4RGM A;  1KDC A;  1QWY A;  2PZU A;  1HUM A;  1XX8 A;  1O80 A;  2G9H D;  3C1F A;  3R8B A;  4K5V A;  1Y8N B;  2A69 C;  2HDL A;  1G2T A;  4CJ1 B;  5IGF A;  2RKS A;  2C9O A;  1JOK A;  5M5W B;  3SXH A;  3D4W A;  1QIL A;  1F9R A;  1I4H A;  1GUG A;  4WFN 3;  5T1G A;  2JP1 A;  2L12 A;  2F0D A;  1CT1 D;  3U9S A;  5KIX A;  1VCI A;  2XWB B;  4EVO A;  1DOM A;  5I9O A;  2Q8R E;  4G7H C;  2F0W A;  2A74 C;  2WP8 J;  1RKN A;  2CW0 D;  4JBW A;  4C2M B;  5IIF A;  1BNZ A;  5E4X A;  3PUX A;  2J7Z A;  2K5W A;  3VA5 A;  3KLS A;  1ET6 A;  3TSS A;  1Q90 A;  2EY2 A;  1LAB A;  1EZ8 A;  1F9S A;  1HQM C;  1Q12 A;  1NSN S;  2LY7 A;  4FNF A;  4K2K A;  5DEH A;  1SMY C;  2X6G A;  3Q22 A;  3T4A C;  4IFD I;  3TBI B;  5FO8 B;  1STA A;  3L3O C;  5FK9 C;  5FO9 B;  4ZK9 B;  3N52 A;  2NWG A;  1I4X A;  4C1N K;  2MGS A;  4CKB A;  1RCV D;  1CHQ D;  4PNY A;  4DGZ A;  1V8Q A;  4ILW A;  2LFN A;  4DNR B;  3GD7 A;  1MBY A;  4RGN A;  1G8Z D;  5C0X I;  4KJN A;  2V4D A;  1GUS A;  1F2Y A;  1II3 A;  3M7G A;  1SNO A;  1EFI D;  2M9V A;  2R61 A;  1D1I A;  4HSP A;  3FMC A;  2PZT A;  5KYI A;  2AUK A;  3TP6 A;  2F1M A;  5IGD A;  1MD2 D;  4IUP A;  4F7X A;  3OSO A;  4HN7 A;  3PUW A;  3I70 A;  4MIU A;  2WV6 D;  3T56 B;  2AWN A;  4HR7 B;  2QKI C;  1EEI D;  1CA6 A;  1GUT A;  5DNF A;  3VYT A;  1Y8O B;  4M1U B;  3IKJ A;  5CYU A;  3BVZ A;  4FF4 A;  5JEA H;  4X3K A;  1IL8 A;  4WJW A;  1FD7 D;  4PMB A;  3H0G B;  3QIA A;  1LAC A;  4R8I A;  3RD4 A;  1STE A;  3NSW A;  1DON A;  4F8M A;  1R4Q B;  5C44 B;  2M00 A;  3VR4 A;  5I4D A;  2IPK D;  3HG9 A;  1GJX A;  1ENC A;  4CHT B;  2B2V A;  4K14 A;  2K5D A;  4RAU C;  1FR3 A;  4K8J A;  1PYW D;  2JA5 B;  1FNV A;  3F2U A;  5JVG 3;  5KGU A;  5BN3 A;  2BCO A;  1FYC A;  1EWC A;  3TN2 A;  4K6L A;  1IYV A;  1EY5 A;  1AW7 A;  4NKL A;  1A3U A;  2X6L A;  2R7Z B;  4JK1 C;  1HQR D;  3HKZ B;  5BN4 A;  1VMC A;  1F2L A;  5CC4 A;  3M85 A;  1RHP A;  2WAC A;  4H7B A;  4K6D A;  2IX1 A;  1EU4 A;  3V96 A;  1BCP B;  3KLR A;  2QIL A;  3OIQ A;  5EBD A;  5ISR A;  2EE1 A;  1UUP A;  2E2J B;  1KDA A;  1LT3 D;  2NN6 I;  3FPU B;  4TQU S;  2L4N A;  2JEA I;  1TY2 A;  5EGT A;  3QWN A;  3ZYY X;  1BCP D;  4L6T B;  4OIK A;  3K5N A;  1A15 A;  1I4G A;  2KA7 A;  1ESR A;  3NUC A;  4KV6 A;  1JCK B;  5CV9 A;  3ERO A;  4B9X A;  5KND A;  4BS9 A;  3CHB D;  4KKU A;  1EY7 A;  2PNR C;  3DWP A;  2JYO A;  3LX0 A;  1EIH A;  2CVR A;  1VDZ A;  1L0Y B;  1ESF A;  2EY1 A;  1SND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...