4KY7A

Crystal structure of staphylococcal nuclease variant delta+phs v74d at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEDEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V74D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky7A00
3C1FA 2OXPA 3TP5A 5KEEA 2PW7A 3EVQA 5CV8A 3T13A 2F0SA 4EQPA 4J6HA 1NUCA 1SYFA 5F2DA 4KY6A 5C6AA 5IGGA 2F0TA 2PYKA 5IODA 5EKLA 2F3VA 2F0WA 3OWFA 2F0JA 3SK8A 5CV6A 3MXPA 2EYPA 5E1FA 1TT2A 3ERQA 4ID6A 2PZUA 1TR5A 4K8IA 1II3A 4WORA 3D8GA 2F0GA 4DFAA 1STBA 4KV6A 2EXZA 3SK6A 2SOBA 5KYIA 4H7BA 4N9PA 3VA5A 4G57A 5J1ZA 1A3TA 4K14A 4QMGA 1STYA 1KDBA 5I9PA 3MHBA 3DHQA 2F0UA 4NKLA 1EY5A 1SNQA 1SNMA 2EYMA 3OMGA 4DF7A 1A2TA 3HEJA 5IGEA 2F0HA 2F0MA 3H6MA 4NDXA 3TP6A 4HMJA 3TP8A 4K8JA 3ITPA 1EZ8A 4HTHA 4K2KA 5DEHA 3MZ5A 4IUNA 5IGCA 5JAVA 1JOKA 3TP7A 2F3WA 1A3UA 1NSNS 2F0PA 3MVVA 1JOOA 3PMFA 4KTAA 4KY7A 5E3FA 5CC4A 5KGUA 1EYCA 4NP5A 5C5LA 4IALA 2F0QA 3OSOA 1SYEA 1EYDA 2SNSA 4KHVA 4PMBA 5CV4A 1JORA 1EY0A 5I6YA 2F0EA 4ODGA 5EKKA 3NHHA 2PQEA 4E6IA 1F2ZA 2PZWA 3SR1A 4ZUJA 1EY6A 4EQNA 2HQEA 2EY6A 5KIXA 2ENBA 4OL7A 4QF4A 3D4WA 3QB3A 1SNOA 3U9OA 1KDAA 5CV5A 4K6DA 5I6WA 4DGZA 5C4HA 5KRUA 4HMIA 2QDBA 5KYLA 3RUZA 1RKNA 2EY5A 3NP8A 4DU9A 5IOCA 5J22A 1AEXA 5IGBA 4KD3A 4NMZA 1IHZA 5I9OA 2PW5A 4K5VA 3EJIA 1U9RA 1A2UA 2F0DA 3HZXA 4IZ8A 4K5XA 1SYBA 3BDCA 3NUCA 2RBMA 3EROA 3T16A 4J1MA 2F0NA 3BDLA 4K5WA 3C1EA 3NQTA 3D6CA 3SK5A 1STNA 1F2YA 1EY7A 5C5MA 3SHLA 5HURA 3DMUA 3NXWA 4RKBA 2M00A 1A3VA 2EYOA 2RKSA 4KJOA 1JOQA 1EY9A 4PNYA 4KJNA 3SK4A 4ZQ3A 3NK9A 4ZUIA 4I65A 3LX0A 5DAUA 3E5SA 4R8NA 5IGFA 2F0VA 3OMCA 3S9WA 2OF1A 3V2TA 2LKVA 2OEOA 5CR3A 5CV7A 4RKLA 4S3SA 1STHA 4TRDA 3SXHA 2KHSA 3TMEA 3QOJA 2O4XA 3QOLA 5K5PA 5EGTA 2F0FA 1KDCA 5CGKA 2F0LA 4B9WA 1SNPA 4N9TA 2F0OA 1SYGA 4KD4A 4PMCA 5J39A 5IIFA 2EYFA 1ENAA 2F0IA 1SNCA 2KQ3A 1EY8A 2EY1A 4F7XA 2WACA 2RDFA 5C3WA 1EYAA 2F0KA 3P75A 5HGTA 4YIJA 2PZTA 5C3XA 1SYCA 2EYJA 1EZ6A 2EY2A 2EYLA 1EQVA 1F2MA 3D4DA 1SYDA 3R3OA 1STGA 1SNDA 3MEHA 4K2LA 4ME5A 4QB4A 5JOBA 4EQOA 1EY4A 2EYHA 4EVOA 5C4ZA 2NUCA 4F8MA 5CV9A 5IGDA 1STAA 1TQOA 5ISRA 1KABA 5NUCA 1KAAA 1ENCA 4B9XA 3P1HA 4WRDA 4LAAA 2SNMA 5M9OA 4KY5A 4MIUA
chains in the Genus database with same CATH superfamily
4A3JH 4JYAQ 2ZXOA 1SYFA 1I3QH 2F3VA 2QA4A 1YHBA 3D3RA 3J7A5 1K8AC 3S16B 1PFNA 3D8GA 1VQJA 2QDLA 1JB3A 1YVCA 1VQHA 3HRZC 4H7BA 3VA5A 4DV4L 5J1ZA 1Q1EA 3AYHB 1I4RA 4AQYQ 1Q1BA 2C35B 3FKIH 4GZYC 2OTJA 2DY7A 3HOUG 4NKLA 3GTMH 2QEJC 2J7ZA 4A4IA 3HEJA 4NB3A 3OWEB 3I4MB 2R93B 4JI7Q 1X56A 3HOZB 4K2KA 2MFIA 1JWMD 3S1MH 2K5WA 2YU9B 3NBIA 4B3TL 4UY8C 1S5ED 3A54A 2H1EA 4CBVA 2ES2A 4G7ZC 4NXML 4QY7A 4KHVA 2I46A 4ME3A 3Q8DA 4DXFA 1EL0A 4KMUC 1ASYA 2K14A 2NVTH 2C9OA 5CV5A 4JI1L 3CMEA 2KA7A 1HA5A 1A0IA 1H9MA 5IOCA 1HR0L 4GN3B 2PMZE 3G71A 1RD9D 4K5XA 5FJ8H 5C0XI 4HJ5A 1SR3A 4DV0L 4IO9A 1MKHA 3DWQA 4QJFA 4ZKBB 1GVPA 2R7ZH 4KJOA 1JOQA 4GNXC 3E3XA 1VQNA 2L5TA 1P8LA 2RSNA 3M9BA 5CR3A 5GAGC 4A93G 2V4DA 3LGJA 4A3CH 3S16H 3HS0C 2B63B 3MWYW 3STBD 4HSPA 3IAYA 1CK1A 2Q8RE 1D1KA 1F2MA 1BUVT 4JBJA 4OONA 1IBLQ 4K0KQ 1B8AA 3I4MH 2R93H 4L6TB 1TWFB 4NW2A 4EVOA 3HOZH 4F8MA 3MXGA 2YU9H 1XNRQ 3P1HA 3PO2B 1CUKA 1FGBD 5GQOA 1VQGA 3HFZB 2MP1A 1NTGA 1VQ7A 1L0YB 1N9WA 5C4XB 1VQMA 4CDEC 3K57A 1JE4A 1QB5D 1I6HB 4YY3Q 2EXDA 4DNRB 2AMCB 4KV6A 3KUPA 5KYIA 3K81C 1KDBA 2K6AA 4DV4Q 1PRTB 4KKUA 5EAYA 2PCFB 2A73B 4DAVA 4R4CA 2HCIA 3MZ5A 3TREA 1RF2D 3TP7A 3VYSA 5KNBA 5E3FA 1C0AA 3C46A 2KOLA 5M5WH 2AUKA 4BY7G 3NE5B 1EY0A 4DV2Q 1D5ZC 2JA9A 5LL6X 1A63A 3PUXA 1TWGB 1EU4A 5K36G 1G6PA 1D5MC 2SDFA 4IUVA 2CW0C 5A2QL 1OO9B 1TS3A 2B63H 1PH5A 3T4AC 3G48A 1TWCB 4JI1Q 2CQAA 5C44B 3FVQA 3PIPA 2Y0SG 4OWTB 3I4NG 1A2UA 3UDGA 1JCKB 4J1MA 2F0NA 1GHKA 1A6XA 3C1EA 1TWFH 3RLOA 1G2TA 3DMUA 1XXGA 1ICFB 3UI2A 1KLGD 1PHJA 1NNXA 1W6JA 2KHJA 3KDFB 4I65A 1I5FA 5LHY1 3PO2H 3A8IE 3OMCA 1C9OA 4DV1L 2B2WA 2XIWA 4TRDA 5C4XH 1O7LA 4KLKA 5IWAL 1KDCA 1KD1C 1I6HH 3PO3G 4A3JG 1ENAA 2F0IA 2RSOA 1F9SA 3SVMA 1YNJD 3GTQB 2R7FA 1SYCA 2EYJA 4DR6Q 2G9DA 2F3IA 1FR3A 4JOIC 3HOXB 1VS0A 4B3RQ 3L0OA 5CBEE 4HJ8A 1B3QA 5BR8L 2D2CC 4DR1L 1B1ZA 2WAQB 4APVA 3ICEA 3OPOA 1XNQL 1CSPA 4X64L 1VCIA 1GUGA 1X54A 3OWFA 3CCVA 2F0JA 2B2YA 2QGQA 2ZM6L 2NVXB 1QNKA 2NB0A 2OT2A 2IX3A 3K5MA 3P20A 1GJXA 1TWCH 1U4PA 1BOSA 5I9PA 5C44H 4LUZA 1SNMA 1F9QA 5HGQA 3ULPA 1N34L 1SMYD 3J80E 3Q24A 2NN6G 3E6ZX 2IWHA 5JAVA 4IJHA 1NSNS 5CBAE 1CQVA 3S1NB 4ILWA 4NP5A 2JJQA 5FJ8G 5ELEA 3CRLC 5IP7H 4LF7L 2F0EA 4ODGA 4HIOA 2KCCA 5IT9E 1E2WA 3I3CA 1D1IA 1RL2A 1U5KA 2QILA 1F9RA 4HMIA 1K0RA 1HNZL 1XYIA 3GTQH 1PYBA 4L5SA 4LF9L 1CTMA 3BDLA 4A3CG 2UUCL 3R8BA 3HOXH 4MN3A 4CKBA 3O13A 3A56A 1BF4A 4JI4L 4DXGA 3I4MG 2R93G 3V05A 3SXHA 1STHA 3HOZG 3EA6A 4DV1Q 3PUVA 1SE2A 4B3SL 3PCOB 2NVXH 5IWAQ 3D6WA 3JAMc 1B7YB 1SJHD 4N9TA 3PF4A 2CKZB 2F0OA 4QIWE 2A6HD 5C0XH 3OTOQ 1XTCD 1SE4A 3STBC 3NENA 3TQYA 1WTXA 2RDFA 1DGSA 3G7LA 2EY2A 3H94A 3TRZA 1HTPA 1EY4A 4WJ3M 3CC4A 4PZ6A 1AE2A 2WKDA 2HT1A 2K05A 1HQRD 2ID0A 3S1NH 1BCPB 1ZEQX 4H0LC 4IN3A 4QUFA 4XTCS 4X62Q 5EPJA 3GTGB 1E2ZA 1PH2A 2JSOA 5EKLA 1XNQQ 1VQ8A 1Q8IA 2CQOA 2XGTA 4LW1A 3RN2A 4YCUA 4HJAA 2NYZD 4DAYB 1XMOL 4JBWA 2GVBA 1W6KA 2KVMA 3W1GA 5FKAC 4POGA 4PG3A 1B2TA 3TEHB 1STYA 4BA1I 2ICIA 4J8QA 4DR7L 3PGZA 1H9SB 1BXTA 2B8GA 1VF5C 2B63G 2DJFC 4J15A 1JOOA 4DV6Q 4DR5Q 3E9IA 1Q8KA 1NBWA 1O7IA 1YZ6A 3OSOA 1HUNA 5IYBH 2CFMA 4GKJL 1L1OA 4LF7Q 2I0QA 3HOYB 4L5TA 4BWGB 1PA6A 1B53A 3UE1A 1KIXA 3PO2G 3F2BA 4JV5Q 5KRUA 4RH6A 1UUPA 4RGTA 4QL5A 1KC8C 3CAMA 2NN6I 4RCOA 2HUGA 5KYLA 2IY5B 1H9JA 1HNZQ 4O0AA 5C4XG 1KQSA 4GOPC 2AWOA 2L9HA 3EN2A 2F03A 4IOAA 3BDCA 3TZUA 4X6AH 4FDBA 4LF9Q 2B8FA 1V1PB 1CT1D 1X3PA 3PUWA 5GAHC 3OW2A 4ABNA 3KK7A 3E5SA 4OO1I 3TN2A 2B2TC 2HQLA 1X9NA 2SEBD 4DV3L 4JI4Q 2QF7A 1EQRA 1PH9A 3QOJA 1FD7D 4TQUS 1Z6HA 4B3SQ 1T9HA 1PLFA 2EJFC 1AE3A 5IIFA 4U673 3P75A 1HH2P 2CCZA 1VQCA 1SJED 2M2LA 4DUYQ 1VQDA 4P72A 5CV9A 3A0JA 3KF8B 2Z4IA 1IZ6A 2SNMA 4KI0A 1PRTF 4IUPA 2Q8IB 4BBRB 2MO1A 5C44G 4EQPA 4YWMA 2YYZA 1TY2A 2V1CC 2K50A 4RFBA 4O42A 1Y8OB 1FVIA 3HOYH 1Z9FA 1CHPD 1TU2B 1LTBD 1RDPD 1Q90A 2Z6KA 2PZUA 4K8IA 2VQEQ 1XMOQ 1EFWA 1EIGA 2EDGA 4LUVA 3DUZA 5IP7G 4N9PA 3DEOA 3KLSA 4X65Q 1PH3A 3CC2A 3E0EA 3E9HA 3MEFA 4DF7A 1KRSA 4DV7L 4JYAL 4DR7Q 1SMYC 3NBHB 4Z9CB 4FNFA 1Q82C 1VQPA 2CWAA 1S72A 1HTLD 3PMFA 2Q2IA 4C1NK 1EYCA 3J81L 2K5NA 3ULLA 1E3PA 1EQTA 3M4YA 3BVMA 2MHVA 1EY6A 5KIXA 1ZXTA 2EY6A 2HQEA 4GLVB 4QF4A 2AUJD 2NVQB 2B2VA 2WAQG 3T1HQ 1GXDC 1E24A 4DR4Q 2PI2A 2JA6B 2R92B 3M7NA 3KF8A 3KYHC 3EJIA 1PFBA 2JEBI 2I5MX 1X65A 4FF2A 3NQTA 3WDNA 1F2YA 1BBXC 3ERSX 5FLMH 3CRKC 1OXXK 1TWAB 3EIVA 1DONA 2CHBD 4BBRH 2RQXA 3TS2A 4X3KA 1QZHA 2Z6BA 4U68A 2K52A 1VQ4A 1LTLA 1NJIC 4GKKL 4DV3Q 5EBDA 2LMCB 1B50A 3BYTB 4C56C 5EJWA 3X3NA 3NBHA 2A6HC 2TMPA 2PZTA 3UDIA 1STGA 1K3BC 5C4ZA 4TVAB 1SE8A 2N78A 1PH8A 2XRQD 3K59A 1K73C 3JAMi 4YWLA 4KN7C 3J7YW 4RMFA 4CDCC 1UE7A 2F0SA 2MJ8A 4J6HA 3HOWB 2DUDA 2F0TA 1SAPA 1X3QA 2F0WA 1XWEA 2RVLA 1VMCA 2Q2UA 3I73A 1AFPA 1Q3LA 2VY3A 5EPKA 2NVQH 4A3GG 4K0KL 3SK6A 1Z47A 2WINB 5IYBG 2HD3A 4QUCA 4JI0Q 1KNAA 2JA6H 2R92H 3NEMA 3CD6A 2A1AA 4DV7Q 1JE5A 4GNXA 3ITPA 4RG1A 4HTHA 3F2DA 2CVRA 1R9TB 1CA6A 3LWEA 5CC4A 3DM1A 5AFWA 1TWAH 4G7OC 2YTYA 1LT6D 3MFYA 1UE6A 4GS3A 1PFMA 4YY3L 5CYUA 1PH1A 2JA5B 5CV4A 3NELA 2B29A 5FLXc 1IXRA 1JQYD 4A3BG 4V0BA 5IP9H 2B2UC 4AYBE 1CKMA 3NP8A 1JWUD 4CHTB 4IPHA 4GN5A 2WB1B 3KF6A 3CCQA 5IGBA 5E4WC 2M9VA 3I56A 3S15B 4K5VA 3U9OA 3C2PA 1IL8A 2DNCA 2EVBA 1VQ5A 3FHWA 2CH4A 1H9RA 2X6LA 1EY7A 1I4HA 4DV2L 1MI2A 1BR9A 3QIAA 1H9KA 1CI3M 2IJ0A 3BYYB 3MFGA 4XQQA 1KTKA 2IL8A 3BVZA 3S9WA 3HOWH 1WTHA 2KHSA 1E2VA 2NN6H 4GKKQ 1HXYD 3AB9A 1BCPF 5JJIA 1R4PB 1LABA 1FJGL 1NE3A 1A8VA 1PFSA 4UAIA 1EQQA 4F7XA 1F77A 5C3WA 3HOYG 2LXKA 1VQEA 3ZJYC 4LF4Q 1SYDA 1PRTD 3GP7A 4K2LA 4ME5A 3CPFA 4OO1H 3NQIA 1S40A 1R9TH 1V9PA 1JB7A 3IFTA 5KEEA 1I94L 1LTRD 2E75C 3T13A 5GAEC 1XPRA 1LTAD 4H13C 4IPDA 2JA5H 4LFAQ 2EQSA 4M8AA 2BH8A 2WIIB 5FK9C 1X3FA 4A3IB 2WKCA 1LYLA 1O7ZA 4Y7NB 5E1FA 2EE1A 4WORA 4CDDC 4GN4B 4DR6L 1LTTD 3Q6SA 2QCPX 1GD7A 1A3TA 3GV6A 1KLUD 4V190 4B3RL 2DJGC 3S15H 4A3LH 1WOCA 2CH4W 2AQ1B 3PIO3 3TBIB 1B44D 4HCSA 2N55A 3M4QA 4X3UA 5FOBB 1V1OA 1WCMB 3L9AX 4X3SA 1A62A 1CZWA 5I6YA 2K4KA 3A5ZB 1C7YA 1AW7A 4EQNA 5A2QE 5FLMG 4JC0A 3GO5A 3VR6A 3I55A 1SNOA 1UE1A 4BBRG 4Q5VA 1S5DD 1TY0A 2E2DC 3RUZA 1RKNA 3FDTA 4JOIA 1AN8A 1GOZA 1CKNA 4NMZA 1SYBA 1ESRA 2R7DA 4IQZA 2K03A 2OCEA 3D6CA 4MNOA 3SK5A 1VDZA 4OX9Q 4HIMA 3W5OA 4RKBA 2YV5A 2EYOA 1V43A 2L4NA 2NWGA 4B08A 3H3VI 1Y8PB 4O1NA 1Y69U 1JMCA 3TZDA 1JJ2A 3H15A 2A74C 4WJWA 4A3IH 3I8ZA 5EGTA 2F0FA 4Y7NH 4G4KA 4KN4C 4CGYB 3QWNA 4B9WA 3PSIA 3RN5A 1SYGA 1FJGQ 4CJ1B 2NVYB 4KHZA 2E5LQ 4YIJA 4Q0FA 3I4LA 2H5XA 1X32A 1E22A 1SNDA 3BG3A 2IHEA 4QB4A 1WVLA 1IL2A 4LF8L 1MSGA 1KXLA 1DOLA 1QE6A 4C1NI 4LWCA 5M9OA 1OXUA 2JA6G 2R92G 1HFGA 5JJZA 1JWSD 5BN5A 1IBML 1WCMH 1I94Q 5A35A 1C4QA 2KENA 5C6AA 1BVSA 5TSSA 2BH2A 4P2CB 1K3RA 3OTOL 4RGMA 2H4OA 1ZKOA 1Q46A 1CZGA 4R4OA 3OW7A 1XTDA 3Q0AA 4DUZQ 2IHFA 1FNWA 1HNXL 4HR7B 3A8KE 3UDXA 5GROA 2B39A 4A3MB 2Y0SE 2FJ2A 2VXWA 2D0OA 4LFBQ 1QUQA 2TSSA 1XJVA 3OMGA 2EYMA 4IPGA 1A2TA 1PZKD 4ZCKA 2GN5A 5IP9G 2HDMA 1EEFD 3F2UA 5FO9B 4X62L 2F4VQ 5DM63 1EZ8A 5DEHA 2GA4B 3I70A 2NZHA 3GV3A 1PTOB 2IT1A 3J7AF 5T1GA 2J4XA 3URYA 1TWGH 2K04A 3W2DA 1JORA 3JAME 4HAEA 1F2ZA 2AQ3B 1LACA 4R1JA 2JEAI 4H02A 1QZGA 3HOWG 5M5XB 2NVYH 4OWXB 2E76C 4DV6L 4FXGC 4DR5L 1OXSC 1N33L 1ICWA 1SRUA 4A3EB 2XN9C 4DR3L 4UP8A 3NXWA 1K83B 1SFOB 3S17B 1Y1WB 4R8NA 5IGFA 1BCPD 3WWVA 2OF1A 4JV5L 1UAPA 3B6YA 1NY4A 2PNRC 4OO1G 1KHIA 1UWVA 1OXTA 3J81j 3I4OA 5D3DA 3CCRA 2F0LA 3FRPB 3VYRA 4PMCA 5G3LF 3DWPA 2JA5G 5LMUL 1XPOA 4A3MH 2DN8A 4XXEA 2F0KA 5HGTA 1ASZA 3FP9A 3CCSA 1YJ9A 2EYLA 1V1QA 4BS9A 3CW2C 4JBKA 1NR4A 4EQOA 3S1RB 1PRTC 2NUCA 4A3GB 5ISRA 2BA0A 1PYWD 2WP8J 4AH6A 5IE8A 1W2BA 3U58A 4LF8Q 5ELNA 2WB1G 2NBFA 3HOVB 1BO0A 1PTOH 1PH7A 5CV8A 4B3ML 1IYVA 4A3LG 3VR5A 1LO5D 3IFDA 1IBMQ 1B4OA 2LXJA 2PO4A 1CHQD 1L1OB 2A69D 5M5YB 1BDOA 4GOPA 1BBUA 3QO2A 4DUYL 4O2DA 1AZPA 1HNXQ 1WTPA 5M5XH 4G57A 1VQ9A 5IYCH 4TKOB 5IT9L 3M85A 1M1KC 5JVH3 4A3BB 3CKIB 2E74C 4C3JG 1X3GA 2KECA 1EEID 3H91A 2XVSA 4A3EH 2B2TA 2F3WA 4BA2I 2E2IB 1TKWB 4YHHQ 1K83H 2A8VA 3S17H 2RHSB 5DLQE 1SSOA 2F0QA 1R4QB 4OHJA 1Y1WH 3OIPA 2RDGA 2VQEL 4FF3A 3RD4A 1YJNA 4E6IA 5C3EB 4X65L 3VR3A 2PMZB 3RMHA 1QG7A 1B9MA 4LFCQ 4K6DA 2IX0A 1YHAA 4OGQC 3KBGA 3Q23A 2EY5A 5J22A 3PF5A 1G91A 5LMNQ 4A3IG 2KCTA 4IZ8A 1YIJA 2AQ2B 2RBMA 3PV0A 2FHTA 1O80A 1V8QA 3UDFA 3S1RH 1EOVA 3E0JA 5CORA 2E2JB 1N33Q 2JXMB 2ZT9C 3NTIA 4A3GH 4JW0A 2M00A 1QJOA 4DR3Q 1PH6A 1QVGA 3HOVH 1D6EC 4P74A 3MXUA 3V2TA 3T53B 1EUJA 5FO7B 3T1HL 2R6GA 2IW3A 3HKZG 1I50B 4DR4L 1TVXA 5M5YH 5CGKA 1PZID 4DV5L 1MGSA 3A74A 1HUMA 3BVGA 1NR2A 1WCMG 1L0WA 4LMQD 2UU9L 5LMUQ 3RZDB 1TIID 4JI2L 4A3BH 1LTGD 1LTSD 3H3VH 4RA8A 2O5IC 3GTGH 2E2IH 4RHSA 3CCJA 1YJWA 5E4XA 1EOTA 4EQ5A 2PW7A 3EVQA 2MQHA 1KAWA 4C2MB 3PIOA 1PH4A 3U4VA 4B3MQ 1K8GA 1U4LA 4MZ9A 3BJUA 5C3EH 2ZJPA 3I72A 4R8IA 1K0SA 1II3A 2BE5D 1YNJC 3VYUA 1STBA 1IYJB 4KHPQ 5I2YA 4K14A 3CP0A 3MHBA 2J0TD 5IGEA 5ELBA 3KOJA 4K8JA 5M3FB 2E2JH 1EWHA 1ENFA 2F0PA 4KTAA 4ZKCB 1HR0W 5IYDH 1MJEA 3I2ZA 3RLFA 4A3KB 1E0BA 3VR4A 4LJZC 2SNSA 2B3GA 5ELDA 3SDZA 2PQEA 2D0PA 4JI0L 1I50H 2UUBL 5E7NA 4FXKC 3D4WA 4FO2A 3T1YL 5I6WA 1EYGA 1HZAA 4BY1B 1RJTA 1SN8A 3PIP3 2R61A 1VQIA 1U0LA 1Q12A 2YTXA 1ET9A 3GTKB 1KNEA 1H95A 3RZDH 1E1TA 1IKLA 1IHZA 5I9OA 2PW5A 1U9RA 2F0DA 4BXXG 5IY0A 3GTLB 3NUCA 3EROA 3T16A 2L1BA 4K5WA 1ONLA 1WTVA 1HZ9A 1IKMA 4A3MG 4R4QA 4KK7A 3BU2A 4KJNA 1K9MC 1TS4A 5JPNC 1O78A 1VQAA 3H3VC 4C2MH 1BCPC 2LKVA 2K33A 2AKWB 4CJ2C 3C3LA 1WTQA 1LTID 2R3ZA 1CFMA 3KJPA 5J39A 4DV5Q 4DNIA 3GTOB 1LT4D 3A7AB 1KRTA 3M4PA 4POFA 1WTWA 1JICA 2RDHA 3MXNB 5LL6S 4NXNL 1HFNA 2WV6D 2UU9Q 3AFPA 4IUTA 1NAPA 1LT3D 2Z8LA 4JI2Q 1DZ1A 2JN4A 5M3FH 4GNXB 3J81c 3MTSA 3W1BA 1X55A 5FLXE 5IYCG 4IPCA 3C1FA 1HRJA 4A3KH 2JA8B 1RTOA 1DM0B 5IGGA 1VF7A 1G291 3R93A 1EWCA 5AJ3Q 4A3EG 1PTOF 4XYQA 2ZTDA 1HZCA 2A69C 2WAQE 4MHEA 4JG2A 3M3YB 3TS0A 2K5VA 4LF4L 4R4TA 1Y1WG 3J7ZC 4BY1H 2SOBA 1JJGA 3VR2A 4OIJA 2NTSA 3QG1A 4JI6L 3GTKH 2K28A 3KF6B 3R2TA 1CSQA 3GTLH 3AEVA 3IKJA 3RNUA 4LFAL 4KY7A 4QCLA 2Z1CA 1T5XD 4F87A 1E1OA 4FF1A 2N49A 5DNFA 1PZJD 1SYEA 2XWJB 2HDLA 1J5EL 5EKKA 1RTNA 3NHHA 3VA7A 4JVZA 2ATWA 3K80C 1XPUA 2I5LX 1JC7A 3MXNA 2UUBQ 2F52A 3SGIA 1WYDA 2XSCA 3HOVG 3S2DB 2FXQA 3T1YQ 2QDBA 2K5QA 3GTOH 2NZ1D 1LV9A 2RHQB 2JA7G 2CWPA 2XRSD 1AEXA 4IUUA 3FPPA 4KD3A 2F1MA 3KLRA 4QQBX 1LT5D 3I90A 2B2VC 3QR8A 1L0XB 4LK1C 3G4SA 2MPMA 4XIGS 1EY9A 3VDYA 1HCZA 3EQLC 5CMDA 5DAUA 3KLSX 2JA8H 1PDQA 3DXJC 5JEAH 3GQBA 1FNUA 4RGOS 4QIWB 4H44C 4S3SA 2L12A 3DEPA 2ZJQA 1NCVA 3OHXC 4LF5L 5HY6A 1DYQA 3M3YH 4CKEA 4RAUC 4NPSA 4RGNA 1DCZA 5JVG3 3CCLA 3ND9A 4XQNA 1DD2A 3J7AV 3CHBD 4HIDA 1D5XC 5LMNW 4OX9L 2VB3X 5C3EG 2VZAA 4NXNQ 2HCCA 3GTPB 1HJPA 1GM5A 3L3OC 1G51A 1KABA 5NUCA 2A68D 4WRDA 3D31A 3TP5A 2A5HA 1ZYRD 1NUCA 1AZQA 4C3JB 1DOKA 2N8NA 3AMUA 2EYPA 4KKSA 2E5LL 1SROA 1TR5A 3BDOA 4DFAA 4KKTA 5IYDG 4JPBW 2OTLA 4R9WA 3V96A 3F1ZA 2BE5C 3S2DH 2EXZA 3K8AA 1QWYA 4IFDI 1XMQQ 4QMGA 1Q7YC 2OQ0A 2UUAQ 1EY5A 5L37A 4YCWA 3NWTA 4JI6Q 1PYSB 1CKNB 2F0MA 3SEBA 4HMJA 1EIHA 2ZXRA 3IL8A 3ZYYX 4DA2A 1DJRD 4PQXA 1A3UA 3I91A 3BZKA 5KGUA 4JI5Q 3BZDB 4ZLTF 2AHOB 5C5LA 2DGYA 3F8TA 3PUYA 4IALA 1WD0A 5JPMC 4DUZL 3N6RA 3H09A 5M5WB 2K75A 1J5EQ 2VS1A 2EZVA 3CMAA 4HEDA 2ENBA 3KJOA 5EBCA 4LFBL 1S5CD 1CQFA 4DU9A 2F4VL 5DM73 2ASBA 3CXCA 4XYOA 2KCNA 3HKZB 1J9OA 2KBNA 2IPKD 3S1QB 4OIKA 2RCFA 3GTPH 2I07B 4FP5D 5FO8B 4FF4A 5H1SE 2IX1A 1A15A 1G6ZA 1L2FA 2RKSA 2UXCL 2FMCA 3CQZB 1S4ZA 4ZQ3A 4ZUIA 5JEAJ 1SE3A 3HGBA 1RIPA 4I7AA 1BQQT 1E7ZA 4RCNA 4RKLA 4C3JH 5M3FG 2O4XA 4A75A 3ULJA 1EIYB 4XDXA 1B70B 4LF5Q 4A3KG 3K58A 2EYFA 4IUQA 2K7VA 1I4QA 2G5DA 1N36L 1UEBA 1EZ6A 1PXUA 1QUQB 3K5OA 3D4DA 1CM9A 3LWUA 1HNWL 1MBYA 3H0GB 3R3OA 1WTRA 1K8OA 3A8JE 4BY1G 1STAA 1TQOA 5J3BA 1DXMA 4A3FB 4YCVA 3TDQA 1EWIA 1PTOD 4C3HB 1WI5A 1M4VA 3L2PA 1QNUA 2PI2E 4B3TQ 4RHRA 3LNNA 5D3IB 3WOEA 4ID6A 2E2HB 4NXMQ 5BN3A 2ZTEA 2L11A 3J81i 1EU3A 1OXVA 2UXDL 1SMXA 2E8GA 1O7YA 3P7JA 5JJLA 3MA2B 4GLAC 1B3AA 2A6ED 1P16A 4XQJA 4CKCA 3S1QH 4CJ0B 3FPUB 3R2IA 1NMGA 1HR0Q 4OXPA 2RCNA 4IUNA 5IGCA 1JOKA 1RCVD 2LS01 4G7HC 2D62A 4C3IB 3IRBA 3CQZH 4DV0Q 1N32L 4OELB 3RZOB 4L8JA 5EQ0A 2BDNA 4LNQA 4WJ4A 1IW7D 4DK0A 1QVCA 4X3TA 5C4JB 1HHVA 3NTHA 2LSSA 2UXBL 3G6JB 5EKIA 2JA8G 5JEAG 5M3MB 2N88A 2RF4A 3K6OA 3SK4A 4YHHL 1Q81C 3H0GH 4ULLA 1Q86C 2YTVA 4N8X1 3CPWA 4A3FH 2Z4HA 1EFID 2UXCQ 3LX0A 2LY7A 2Z9HA 4C3HH 4LFCL 2MO0A 2HHHL 5CV7A 3ND8A 3FKIG 4JI8L 1TXYA 5K5PA 4Y52H 2E2HH 5LMNL 4KD4A 3GTJB 4GOPB 2VUMB 1I4PA 2EY1A 3WOFA 2WACA 1EYAA 1STEA 5C3XA 1N36Q 1D7QA 2FFKB 1FGUA 1BNZA 2HIVA 2O2LD 3MEHA 2OWOA 2EYHA 1PV4A 2KEEA 1HNWQ 1VQBA 2JYOA 1N8RC 3KDFA 5D65A 1EIFA 2K5DA 1G2SA 2A68C 4KY5A 4C3IH 3U4ZA 2Z0SA 1HQMC 3I7FA 2WFWA 4IJLA 3RZOH 4BXXH 1Y1VB 5F2DA 1ZYRC 2PYKA 2VQFL 4ZYSA 3NSWA 3G6EA 1CA5A 3CU7A 3MXPA 1MSHA 5C4JH 2B2WC 2A19A 2F0GA 3D4RA 4XT1B 5I4DA 1HA6A 3MC0B 4PZ7A 4DN4M 3K5NA 1YI2A 1T5EA 2BA1A 3JAML 5M3MH 2R7ZG 2UXDQ 4WFN3 1YNXA 3DHQA 1K8MA 3DWAA 2N3SA 4MTKA 4NDXA 1HZBA 1TS5A 4FYDA 5T1IA 4A3DB 3J80L 4OWWB 2F4IA 2JA7B 3W3AA 5GADC 2L55A 4ZK9B 1HPCA 2C5CA 1C8CA 4AYBB 1F2LA 1TWHB 4PMBA 1IBKL 4P75A 1N32Q 1TS2A 1SEBD 3HG9A 1GHJA 4KHPL 4P71A 1OTCA 3CCEA 4BBSB 4IFDH 2KCMA 1LM0A 3K7AB 1YHQA 4OL7A 3KBXA 3QB3A 1KDAA 4R4IA 2UXBQ 4N8FA 1M8AA 2B2YC 3GTJH 1MJCA 2VUMH 2FINB 1QILA 1KL9A 2KUMA 2HIXA 2XTIA 4HJ7A 3FEWX 3Q22A 1SDFA 1SFOH 2KJXA 1STNA 3A7LA 1UEAB 2WB1E 5JJKA 4TSSA 2VW9A 1BBWA 3AQQA 3T51B 2OQKA 3J80c 2QEXA 1YNND 1BKBA 1J6QA 1Y1VH 2GVAA 3RLNA 2OEOA 1JR0D 3HOUB 2HHHQ 1AH9A 4JI8Q 2RA4A 2ICEC 3SE0A 1S3OA 5BR8Q 4K6LA 4DR1Q 5KNDA 4X64Q 3K7UC 3KFUA 3CCMA 1F9PA 1SNCA 2K1BA 2KQ3A 5IT9c 3CF5A 1Z7TA 2ZM6Q 4FXDA 4HN7A 3GDEA 4F88A 1YITA 2Q2HA 2P5ZX 2EOTA 4JCVE 1RHPA 3BS1A 2Q2TA 4A3DH 4B9XA 1ENCA 1FL0A 1X3EA 4JBMA 4UP7A 4IOCA 3OIQA 1N34Q 4DNTB 2JA7H 1VQ6A 1QOHA 2OXPA 1PTOC 1DOMA 1TWHH 2G9HD 4KY6A 5ELOA 3F2CA 2ZTCA 5IODA 5EPLA 1GUNA 4UDUC 2VQFQ 1W3SA 4BBSH 4UPAA 4YWKA 4P73A 1TT2A 3ERQA 3K7AH 2JQOA 2AWNA 1MIUA 4DKAC 2BOSA 2JE6I 1NMFA 2K5HA 2X69A 4JK1C 3KLWA 2F0UA 2ZJRA 2D9UA 2A6EC 2F0HA 4LUOA 3TP8A 3K5LA 4HSVA 3S14B 4A93B 3PQIA 1MD2D 1IYUA 3A5UA 4M1UB 1U4MA 5AJ3L 3MVVA 3DM3A 4FVMA 3OOCA 4JI3L 2UUCQ 3RR5A 1JT8A 1EYDA 3HKZE 2K01A 3H0GG 4ZRZA 4IFDJ 1IBKQ 4EGVA 3ONAB 4DAYA 1IW7C 3HOUH 4L5QA 2BDOA 4A3FG 2Q8TA 4MTNA 4DPGA 4C3HG 1PVOA 2PQAB 4UP9A 1I4XA 3HP3A 4QGUA 5C0XJ 4DR2L 3HKSA 3AU7A 3D0FA 2KHIA 2VNUD 1H9SA 1J8IA 3J81E 4DK6C 4I7ZC 3K0XA 1I4GA 4LF6L 2XNAC 2QW7A 3SHLA 4HJ9A 5HURA 1A3VA 5ELFA 1SLJA 1GUSA 1GUWA 2F0VA 2MUYA 1X6OA 1YBYA 1FYCA 1UNSA 1PMRA 3QOLA 4XT3B 1MHWC 2D5DA 3MAQA 1ET6A 1L1OC 2EIFA 4C3IG 4X66L 1SBBB 4DK3C 4PZ8A 3TSSA 1EY8A 1SXTA 3NPPA 3K0YA 2DY8A 4EX5A 2VB2X 3S2HB 4BY7B 2L0CA 1V1PA 5KNCA 3S14H 4A93H 1KAAA 1ILQA 5M3MG 2O5JC 2BCOA 5G3LD 4MIUA 3NTKA 1AP0A 1FNVA 3CCUA 4OEMB 3ER0A 3FMCA 2PQAA 2Y0SB 3SK8A 5CV6A 3I4NB 1VQLA 3X3MA 3VYTA 1ML0D 2ZXPA 2EJGC 1M90C 3N52A 2DNEA 3HOXG 2JK8A 4ZAIA 3UE0A 4GKJQ 4AQYL 3M4OB 4DAMA 1GKHA 1S5BD 2FMMA 5BN4A 1CKOA 1K28A 1SNQA 4IFDG 1C48A 1ESFA 4JI7L 3H6MA 3TP6A 2EPBA 2NZOA 1WD1A 1D8LA 1QCBD 1GUOA 2VL6A 2VUMG 3EBEA 2B2UA 3PO3B 1I6VC 1LLRD 4HIKA 4A3JB 3OYYA 1WTOA 5C0XG 1B9NA 3U9SA 3A55A 4JI3Q 3BZCA 4UHVA 3JC66 1I3QB 3CC7A 2PZWA 3SR1A 4ZUJA 1XMQL 1ILPA 1LUZA 2CW0D 1YEZA 4IURA 2UUAL 2QKIC 4A76A 4DGZA 5C4HA 3DLLA 1JJCB 1VQFA 5COYA 2K32A 2NTTA 1VMPA 1Y1VG 2Z6KC 4AIMA 3FKIB 3QJYA 3NWSA 1WFQA 3GTMB 3M7GA 4PMWA 5I2XA 2XWBB 4DR2Q 4JI5L 3HZXA 3T56B 4BY7H 3S2HH 1VQOA 1D2BA 5D14A 4RWSC 3S1MB 1Y8NB 5C5MA 2JP1A 4DAPA 4LF6Q 3PUZA 4L63B 3GD7A 5K36H 2MGSA 1Y14B 4PNYA 3NK9A 4PV1C 1VQKA 1U4RA 3AFQA 3L7ZC 1YNNC 2PNHA 3S24A 3EFXD 3TMEA 4L5RC 1UE5A 3I4NH 4A3DG 1S5FD 5FLXL 3U50C 2ALYB 4ALPA 2NVTB 1SNPA 1WJJA 4AYBG 4X66Q 2PPBC 3M4OH 3J80i 1G8ZD 4GLXA 2I5HA 4BBSG 2L15A 4CDFC 1IBLL 1EQVA 2MNAA 5ELCA 1RODA 1XX8A 5JOBA 2EJMA 2KEDA 4HCEA 5IGDA 1XNRL 4DK1A 1GUTA 2R7ZB 2LFNA 2X6GA 1QVFA 4LAAA 3PO3H 1GO3E
chains in the Genus database with same CATH topology
2ZXOA 1SYFA 2F3VA 3D3RA 3S16B 1PFNA 3D8GA 1JB3A 3HRZC 4H7BA 3VA5A 5J1ZA 1Q1EA 4GZYC 1I4RA 1Q1BA 2DY7A 4NKLA 2QEJC 2J7ZA 3HEJA 3OWEB 3I4MB 2R93B 3HOZB 4K2KA 1JWMD 2K5WA 2YU9B 3NBIA 1S5ED 3A54A 2H1EA 4CBVA 4G7ZC 4KHVA 2I46A 4DXFA 1EL0A 4KMUC 2C9OA 5CV5A 2KA7A 1HA5A 1H9MA 5IOCA 1RD9D 4K5XA 5C0XI 3DWQA 4ZKBB 4KJOA 1JOQA 2L5TA 2RSNA 5CR3A 2V4DA 3HS0C 2B63B 3MWYW 4HSPA 3IAYA 1CK1A 2Q8RE 1D1KA 1F2MA 1BUVT 4L6TB 1TWFB 4NW2A 4EVOA 4F8MA 3MXGA 3P1HA 3PO2B 1FGBD 2MP1A 1L0YB 5C4XB 3K57A 1JE4A 1QB5D 1I6HB 4DNRB 4KV6A 3KUPA 5KYIA 1KDBA 2K6AA 1PRTB 4KKUA 2PCFB 2A73B 4DAVA 2HCIA 3MZ5A 1RF2D 3TP7A 3VYSA 5KNBA 5E3FA 3C46A 2KOLA 2AUKA 3NE5B 1EY0A 1D5ZC 5LL6X 3PUXA 1TWGB 1EU4A 5K36G 1D5MC 2SDFA 4IUVA 2CW0C 5A2QL 1OO9B 1TS3A 3T4AC 1TWCB 2CQAA 5C44B 3FVQA 1A2UA 1JCKB 4J1MA 2F0NA 1GHKA 1A6XA 3C1EA 1G2TA 3DMUA 1XXGA 3UI2A 1KLGD 1W6JA 4I65A 5LHY1 3A8IE 3OMCA 2B2WA 2XIWA 4TRDA 1O7LA 1KDCA 1ENAA 2F0IA 2RSOA 1F9SA 3SVMA 1YNJD 3GTQB 1SYCA 2EYJA 2G9DA 1FR3A 3HOXB 5CBEE 2D2CC 1B1ZA 2WAQB 3OPOA 1VCIA 1GUGA 3OWFA 2F0JA 2B2YA 2NVXB 1QNKA 2NB0A 2OT2A 2IX3A 3K5MA 3P20A 1GJXA 1U4PA 1BOSA 5I9PA 1SNMA 1F9QA 1SMYD 3J80E 3Q24A 2NN6G 3E6ZX 2IWHA 5JAVA 1NSNS 5CBAE 1CQVA 3S1NB 4ILWA 4NP5A 5ELEA 3CRLC 2F0EA 4ODGA 2KCCA 5IT9E 1E2WA 3I3CA 1D1IA 2QILA 1F9RA 4HMIA 1XYIA 1CTMA 3BDLA 3R8BA 4MN3A 4CKBA 3O13A 3A56A 1BF4A 4DXGA 3V05A 3SXHA 1STHA 3EA6A 3PUVA 1SE2A 3D6WA 1SJHD 4N9TA 2F0OA 2A6HD 5C0XH 1XTCD 1SE4A 1WTXA 2RDFA 3G7LA 2EY2A 3H94A 1HTPA 1EY4A 2WKDA 2K05A 1HQRD 2ID0A 1BCPB 1ZEQX 4H0LC 4QUFA 4IN3A 4XTCS 5EPJA 3GTGB 1E2ZA 2JSOA 5EKLA 1Q8IA 2NYZD 4JBWA 1W6KA 2KVMA 5FKAC 1B2TA 1STYA 4BA1I 2ICIA 4J8QA 1H9SB 1BXTA 2B8GA 1VF5C 1JOOA 3OSOA 1HUNA 3HOYB 4BWGB 1B53A 5KRUA 4RH6A 1UUPA 4RGTA 4RCOA 2NN6I 5KYLA 2HUGA 1H9JA 2AWOA 2L9HA 2F03A 3BDCA 3TZUA 2B8FA 1V1PB 1CT1D 1X3PA 3PUWA 4ABNA 3KK7A 3E5SA 4OO1I 3TN2A 2B2TC 2SEBD 2QF7A 3QOJA 1FD7D 4TQUS 1Z6HA 1PLFA 2EJFC 5IIFA 4U673 3P75A 1SJED 2M2LA 5CV9A 2Z4IA 4BBRB 4KI0A 2Q8IB 4IUPA 2SNMA 1PRTF 4EQPA 2YYZA 1TY2A 4RFBA 4O42A 1Y8OB 1CHPD 1TU2B 1LTBD 1RDPD 1Q90A 2PZUA 4K8IA 1EIGA 2EDGA 3DUZA 4N9PA 3DEOA 3KLSA 4DF7A 1SMYC 4Z9CB 4FNFA 1HTLD 3PMFA 4C1NK 1EYCA 3J81L 1EQTA 3M4YA 3BVMA 2MHVA 1EY6A 5KIXA 1ZXTA 2EY6A 2HQEA 4QF4A 2AUJD 2NVQB 2B2VA 1GXDC 2JA6B 2R92B 3M7NA 3KF8A 3EJIA 1PFBA 2JEBI 4FF2A 3NQTA 3WDNA 1F2YA 1BBXC 3CRKC 1OXXK 1TWAB 1DONA 2CHBD 2RQXA 4X3KA 4U68A 5EBDA 2LMCB 1B50A 3BYTB 4C56C 5EJWA 3X3NA 3NBHA 2A6HC 2TMPA 2PZTA 1STGA 5C4ZA 2XRQD 3K59A 4KN7C 3J7YW 2MJ8A 2F0SA 4J6HA 3HOWB 2F0TA 1SAPA 1X3QA 2F0WA 1XWEA 2RVLA 1VMCA 3I73A 1AFPA 1Q3LA 5EPKA 3SK6A 1Z47A 2WINB 4QUCA 1KNAA 3ITPA 4HTHA 2CVRA 1R9TB 1CA6A 3LWEA 5CC4A 3DM1A 5AFWA 4G7OC 1LT6D 3MFYA 1PFMA 5CYUA 2JA5B 5CV4A 1JQYD 4V0BA 2B2UC 3NP8A 1JWUD 4CHTB 2WB1B 5IGBA 5E4WC 2M9VA 3S15B 4K5VA 3U9OA 3C2PA 1IL8A 2DNCA 2EVBA 1H9RA 2X6LA 1EY7A 1I4HA 1MI2A 1BR9A 3QIAA 1H9KA 1CI3M 2IJ0A 3BYYB 3MFGA 4XQQA 1KTKA 2IL8A 3BVZA 3S9WA 2KHSA 1E2VA 2NN6H 1HXYD 3AB9A 1BCPF 1R4PB 1LABA 4UAIA 4F7XA 1F77A 5C3WA 1SYDA 1PRTD 3GP7A 4K2LA 4ME5A 4OO1H 3NQIA 3IFTA 5KEEA 1LTRD 2E75C 3T13A 1LTAD 4H13C 4M8AA 2WIIB 5FK9C 4A3IB 2WKCA 1O7ZA 4Y7NB 5E1FA 2EE1A 4WORA 1LTTD 3Q6SA 2QCPX 1A3TA 3GV6A 1KLUD 4V190 2AQ1B 3PIO3 3TBIB 1B44D 4HCSA 2N55A 4X3UA 5FOBB 1V1OA 1WCMB 3L9AX 4X3SA 1CZWA 5I6YA 1AW7A 4EQNA 5A2QE 3GO5A 3VR6A 1SNOA 4Q5VA 1S5DD 1TY0A 2E2DC 3RUZA 1RKNA 3FDTA 1AN8A 1GOZA 4NMZA 1SYBA 1ESRA 4IQZA 2K03A 3D6CA 3SK5A 1VDZA 4RKBA 2EYOA 1V43A 2L4NA 2NWGA 4B08A 1Y8PB 4O1NA 1Y69U 3TZDA 2A74C 4WJWA 3I8ZA 5EGTA 2F0FA 4G4KA 4KN4C 4CGYB 3QWNA 4B9WA 1SYGA 4CJ1B 2NVYB 4KHZA 4YIJA 4Q0FA 3I4LA 1X32A 1SNDA 3BG3A 4QB4A 1WVLA 1MSGA 1DOLA 1QE6A 4C1NI 5M9OA 1OXUA 5JJZA 1HFGA 1JWSD 5BN5A 5A35A 1C4QA 5C6AA 5TSSA 4P2CB 4RGMA 2H4OA 1ZKOA 1CZGA 3OW7A 3Q0AA 1FNWA 4HR7B 3A8KE 2B39A 4A3MB 2FJ2A 2VXWA 2TSSA 3OMGA 2EYMA 1A2TA 1PZKD 2HDMA 1EEFD 3F2UA 5FO9B 5DM63 1EZ8A 5DEHA 2GA4B 3I70A 3GV3A 1PTOB 2IT1A 3J7AF 5T1GA 2J4XA 3URYA 2K04A 3W2DA 1JORA 3JAME 4HAEA 1F2ZA 2AQ3B 1LACA 2JEAI 5M5XB 2E76C 4FXGC 1OXSC 1ICWA 4A3EB 2XN9C 3NXWA 1K83B 1SFOB 3S17B 1Y1WB 4R8NA 5IGFA 1BCPD 2OF1A 1UAPA 2PNRC 4OO1G 1OXTA 5D3DA 2F0LA 3FRPB 3VYRA 4PMCA 5G3LF 3DWPA 2DN8A 4XXEA 2F0KA 5HGTA 4BS9A 2EYLA 1NR4A 4EQOA 3S1RB 1PRTC 2NUCA 4A3GB 5ISRA 2BA0A 1PYWD 2WP8J 2NBFA 3HOVB 1BO0A 1PTOH 5CV8A 1IYVA 3VR5A 1LO5D 3IFDA 1B4OA 2PO4A 1CHQD 2A69D 5M5YB 1BDOA 3QO2A 1AZPA 1WTPA 4G57A 4TKOB 5IT9L 3M85A 5JVH3 4A3BB 3CKIB 2E74C 4C3JG 2KECA 1EEID 3H91A 2XVSA 2B2TA 2F3WA 4BA2I 2E2IB 1TKWB 1SSOA 2F0QA 1R4QB 4OHJA 3OIPA 2RDGA 4FF3A 3RD4A 4E6IA 5C3EB 3VR3A 2PMZB 3RMHA 1QG7A 1B9MA 4K6DA 2IX0A 4OGQC 3KBGA 3Q23A 2EY5A 5J22A 1G91A 4IZ8A 2AQ2B 2RBMA 3PV0A 2FHTA 1O80A 1V8QA 3E0JA 5CORA 2E2JB 2JXMB 2ZT9C 3NTIA 2M00A 1QJOA 1D6EC 3MXUA 3V2TA 3T53B 5FO7B 2R6GA 2IW3A 1I50B 1TVXA 5CGKA 1PZID 1MGSA 1HUMA 3BVGA 1NR2A 4LMQD 3RZDB 1TIID 1LTGD 1LTSD 4RA8A 2O5IC 4RHSA 5E4XA 1EOTA 2PW7A 3EVQA 4C2MB 1U4LA 3I72A 4R8IA 1II3A 2BE5D 1YNJC 3VYUA 1STBA 5I2YA 4K14A 3MHBA 2J0TD 5IGEA 5ELBA 4K8JA 5M3FB 1EWHA 1ENFA 2F0PA 4KTAA 4ZKCB 4A3KB 3RLFA 1E0BA 3VR4A 4LJZC 2SNSA 5ELDA 3SDZA 2PQEA 4FXKC 3D4WA 4FO2A 5I6WA 4BY1B 1RJTA 3PIP3 2R61A 1Q12A 3GTKB 1ET9A 1KNEA 1IKLA 1IHZA 5I9OA 2PW5A 1U9RA 2F0DA 3GTLB 3NUCA 3EROA 3T16A 2L1BA 4K5WA 1ONLA 1WTVA 1IKMA 4KK7A 4KJNA 1TS4A 5JPNC 1O78A 3H3VC 1BCPC 2LKVA 2K33A 4CJ2C 3C3LA 1WTQA 1LTID 2R3ZA 1CFMA 5J39A 3GTOB 1LT4D 3A7AB 1WTWA 1JICA 2RDHA 1HFNA 5LL6S 2WV6D 4IUTA 1NAPA 1LT3D 2Z8LA 1DZ1A 3MTSA 5FLXE 1HRJA 3C1FA 2JA8B 1RTOA 1DM0B 5IGGA 1VF7A 1G291 3R93A 1EWCA 1PTOF 4XYQA 2A69C 4MHEA 3M3YB 2SOBA 3VR2A 4OIJA 2NTSA 3QG1A 2K28A 3R2TA 3IKJA 4KY7A 4QCLA 2Z1CA 1T5XD 4F87A 4FF1A 5DNFA 1PZJD 1SYEA 2XWJB 2HDLA 5EKKA 1RTNA 3NHHA 3VA7A 1JC7A 3MXNA 2XSCA 3S2DB 2QDBA 2K5QA 2NZ1D 1LV9A 2XRSD 1AEXA 4IUUA 3FPPA 4KD3A 2F1MA 3KLRA 1LT5D 3I90A 2B2VC 1L0XB 4LK1C 2MPMA 4XIGS 1EY9A 1HCZA 3EQLC 5CMDA 5DAUA 3KLSX 1PDQA 3DXJC 5JEAH 3GQBA 1FNUA 4RGOS 4QIWB 4H44C 4S3SA 2L12A 3DEPA 1NCVA 3OHXC 1DYQA 4CKEA 4RAUC 4RGNA 5JVG3 1DCZA 3ND9A 4XQNA 1DD2A 3J7AV 3CHBD 1D5XC 2VB3X 2HCCA 3GTPB 3L3OC 1KABA 5NUCA 2A68D 4WRDA 3D31A 3TP5A 2A5HA 1ZYRD 1NUCA 1AZQA 4C3JB 1DOKA 3AMUA 2EYPA 4KKSA 1TR5A 3BDOA 4DFAA 4KKTA 4R9WA 3V96A 2BE5C 2EXZA 1QWYA 4IFDI 4QMGA 1EY5A 3NWTA 2F0MA 3SEBA 4HMJA 1EIHA 2ZXRA 3IL8A 3ZYYX 4DA2A 1DJRD 4PQXA 1A3UA 3I91A 5KGUA 3BZDB 4ZLTF 5C5LA 3PUYA 4IALA 1WD0A 5JPMC 3N6RA 3H09A 5M5WB 2EZVA 4HEDA 2ENBA 5EBCA 1S5CD 1CQFA 4DU9A 5DM73 4XYOA 2KCNA 3HKZB 1J9OA 2IPKD 3S1QB 4OIKA 2I07B 4FP5D 5FO8B 4FF4A 2IX1A 1G6ZA 1A15A 2RKSA 2FMCA 3CQZB 1S4ZA 4ZQ3A 4ZUIA 5JEAJ 1SE3A 3HGBA 1BQQT 4RCNA 4RKLA 2O4XA 4XDXA 3K58A 2EYFA 4IUQA 2K7VA 1I4QA 1EZ6A 1PXUA 3K5OA 3D4DA 1CM9A 3LWUA 1MBYA 3H0GB 3R3OA 1WTRA 1K8OA 3A8JE 1STAA 1TQOA 1DXMA 4A3FB 3TDQA 1PTOD 4C3HB 1M4VA 1QNUA 4RHRA 3LNNA 5D3IB 3WOEA 4ID6A 2E2HB 5BN3A 2L11A 1EU3A 1OXVA 1O7YA 3P7JA 3MA2B 1B3AA 2A6ED 4XQJA 4CKCA 4CJ0B 3FPUB 3R2IA 5IGCA 4IUNA 1JOKA 1RCVD 2LS01 4G7HC 2D62A 4C3IB 3RZOB 4L8JA 5EQ0A 2BDNA 1IW7D 4DK0A 4X3TA 5C4JB 1HHVA 3NTHA 3G6JB 5EKIA 5JEAG 5M3MB 2N88A 3K6OA 3SK4A 4ULLA 2Z4HA 1EFID 3LX0A 2LY7A 5CV7A 3ND8A 5K5PA 4KD4A 3GTJB 2VUMB 1I4PA 2EY1A 3WOFA 2WACA 1EYAA 1STEA 5C3XA 2FFKB 1BNZA 2O2LD 3MEHA 2EYHA 2KEEA 2JYOA 5D65A 2K5DA 1G2SA 2A68C 4KY5A 1HQMC 1Y1VB 5F2DA 1ZYRC 2PYKA 4ZYSA 3NSWA 1CA5A 3CU7A 3MXPA 1MSHA 2B2WC 4XT1B 2F0GA 3D4RA 5I4DA 1HA6A 3MC0B 4DN4M 3K5NA 1T5EA 2BA1A 3JAML 4WFN3 3DHQA 1K8MA 3DWAA 4NDXA 1TS5A 4FYDA 5T1IA 4A3DB 3J80L 2F4IA 2JA7B 3W3AA 2L55A 4ZK9B 1HPCA 2C5CA 1C8CA 4AYBB 1F2LA 1TWHB 4PMBA 1TS2A 1SEBD 3HG9A 1GHJA 4BBSB 4IFDH 3K7AB 4OL7A 3KBXA 3QB3A 1KDAA 1M8AA 2B2YC 2FINB 1QILA 2KUMA 3FEWX 3Q22A 1SDFA 2KJXA 1STNA 3A7LA 1UEAB 4TSSA 3T51B 1YNND 2OEOA 1JR0D 3HOUB 2RA4A 2ICEC 3SE0A 4K6LA 5KNDA 1F9PA 1SNCA 2K1BA 2KQ3A 1Z7TA 4FXDA 4HN7A 4F88A 2EOTA 1RHPA 3BS1A 4B9XA 1ENCA 3OIQA 4DNTB 1QOHA 2OXPA 1PTOC 1DOMA 2G9HD 4KY6A 5IODA 5EPLA 1GUNA 4UDUC 1TT2A 3ERQA 2AWNA 2BOSA 2JE6I 2X69A 4JK1C 2F0UA 2D9UA 2A6EC 2F0HA 3TP8A 3K5LA 4HSVA 3S14B 4A93B 1MD2D 1IYUA 4M1UB 1U4MA 3MVVA 4FVMA 3OOCA 1EYDA 2K01A 4ZRZA 4IFDJ 4EGVA 3ONAB 4DAYA 1IW7C 2BDOA 2Q8TA 4C3HG 1I4XA 3HP3A 5C0XJ 3AU7A 1J8IA 2VNUD 1H9SA 3J81E 4I7ZC 1I4GA 2XNAC 3SHLA 5HURA 1A3VA 5ELFA 1GUSA 1GUWA 2F0VA 2MUYA 1FYCA 1UNSA 1PMRA 3QOLA 4XT3B 2D5DA 3MAQA 1ET6A 4C3IG 1SBBB 3TSSA 1EY8A 1SXTA 3NPPA 3K0YA 2DY8A 2VB2X 3S2HB 4BY7B 2L0CA 1V1PA 5KNCA 1KAAA 1ILQA 2O5JC 2BCOA 5G3LD 4MIUA 3NTKA 1AP0A 1FNVA 3FMCA 2Y0SB 3SK8A 5CV6A 3I4NB 3X3MA 3VYTA 1ML0D 2ZXPA 2EJGC 3N52A 2DNEA 4ZAIA 3M4OB 1S5BD 2FMMA 5BN4A 1SNQA 4IFDG 1C48A 1ESFA 3H6MA 3TP6A 2EPBA 1WD1A 1QCBD 1GUOA 2B2UA 3PO3B 1I6VC 1LLRD 4A3JB 1WTOA 5C0XG 1B9NA 3U9SA 3A55A 1I3QB 2PZWA 3SR1A 4ZUJA 1ILPA 2CW0D 4IURA 2QKIC 4DGZA 5C4HA 5COYA 2K32A 2NTTA 1VMPA 3FKIB 3QJYA 3NWSA 3GTMB 3M7GA 4PMWA 5I2XA 2XWBB 3HZXA 3T56B 1D2BA 5D14A 4RWSC 3S1MB 1Y8NB 5C5MA 2JP1A 4DAPA 3PUZA 4L63B 3GD7A 5K36H 2MGSA 4PNYA 3NK9A 4PV1C 1U4RA 3L7ZC 1YNNC 3EFXD 3TMEA 1S5FD 5FLXL 2NVTB 1SNPA 2PPBC 1G8ZD 1EQVA 5ELCA 1RODA 1XX8A 5JOBA 2EJMA 2KEDA 4HCEA 5IGDA 4DK1A 1GUTA 2R7ZB 2LFNA 2X6GA 4LAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1F A;  2OXP A;  3TP5 A;  5KEE A;  2PW7 A;  3EVQ A;  5CV8 A;  3T13 A;  2F0S A;  4EQP A;  4J6H A;  1NUC A;  1SYF A;  5F2D A;  4KY6 A;  5C6A A;  5IGG A;  2F0T A;  2PYK A;  5IOD A;  5EKL A;  2F3V A;  2F0W A;  3OWF A;  2F0J A;  3SK8 A;  5CV6 A;  3MXP A;  2EYP A;  5E1F A;  1TT2 A;  3ERQ A;  4ID6 A;  2PZU A;  1TR5 A;  4K8I A;  1II3 A;  4WOR A;  3D8G A;  2F0G A;  4DFA A;  1STB A;  4KV6 A;  2EXZ A;  3SK6 A;  2SOB A;  5KYI A;  4H7B A;  4N9P A;  3VA5 A;  4G57 A;  5J1Z A;  1A3T A;  4K14 A;  4QMG A;  1STY A;  1KDB A;  5I9P A;  3MHB A;  3DHQ A;  2F0U A;  4NKL A;  1EY5 A;  1SNQ A;  1SNM A;  2EYM A;  3OMG A;  4DF7 A;  1A2T A;  3HEJ A;  5IGE A;  2F0H A;  2F0M A;  3H6M A;  4NDX A;  3TP6 A;  4HMJ A;  3TP8 A;  4K8J A;  3ITP A;  1EZ8 A;  4HTH A;  4K2K A;  5DEH A;  3MZ5 A;  4IUN A;  5IGC A;  5JAV A;  1JOK A;  3TP7 A;  2F3W A;  1A3U A;  1NSN S;  2F0P A;  3MVV A;  1JOO A;  3PMF A;  4KTA A;  4KY7 A;  5E3F A;  5CC4 A;  5KGU A;  1EYC A;  4NP5 A;  5C5L A;  4IAL A;  2F0Q A;  3OSO A;  1SYE A;  1EYD A;  2SNS A;  4KHV A;  4PMB A;  5CV4 A;  1JOR A;  1EY0 A;  5I6Y A;  2F0E A;  4ODG A;  5EKK A;  3NHH A;  2PQE A;  4E6I A;  1F2Z A;  2PZW A;  3SR1 A;  4ZUJ A;  1EY6 A;  4EQN A;  2HQE A;  2EY6 A;  5KIX A;  2ENB A;  4OL7 A;  4QF4 A;  3D4W A;  3QB3 A;  1SNO A;  3U9O A;  1KDA A;  5CV5 A;  4K6D A;  5I6W A;  4DGZ A;  5C4H A;  5KRU A;  4HMI A;  2QDB A;  5KYL A;  3RUZ A;  1RKN A;  2EY5 A;  3NP8 A;  4DU9 A;  5IOC A;  5J22 A;  1AEX A;  5IGB A;  4KD3 A;  4NMZ A;  1IHZ A;  5I9O A;  2PW5 A;  4K5V A;  3EJI A;  1U9R A;  1A2U A;  2F0D A;  3HZX A;  4IZ8 A;  4K5X A;  1SYB A;  3BDC A;  3NUC A;  2RBM A;  3ERO A;  3T16 A;  4J1M A;  2F0N A;  3BDL A;  4K5W A;  3C1E A;  3NQT A;  3D6C A;  3SK5 A;  1STN A;  1F2Y A;  1EY7 A;  5C5M A;  3SHL A;  5HUR A;  3DMU A;  3NXW A;  4RKB A;  2M00 A;  1A3V A;  2EYO A;  2RKS A;  4KJO A;  1JOQ A;  1EY9 A;  4PNY A;  4KJN A;  3SK4 A;  4ZQ3 A;  3NK9 A;  4ZUI A;  4I65 A;  3LX0 A;  5DAU A;  3E5S A;  4R8N A;  5IGF A;  2F0V A;  3OMC A;  3S9W A;  2OF1 A;  3V2T A;  2LKV A;  2OEO A;  5CR3 A;  5CV7 A;  4RKL A;  4S3S A;  1STH A;  4TRD A;  3SXH A;  2KHS A;  3TME A;  3QOJ A;  2O4X A;  3QOL A;  5K5P A;  5EGT A;  2F0F A;  1KDC A;  5CGK A;  2F0L A;  4B9W A;  1SNP A;  4N9T A;  2F0O A;  1SYG A;  4KD4 A;  4PMC A;  5J39 A;  5IIF A;  2EYF A;  1ENA A;  2F0I A;  1SNC A;  2KQ3 A;  1EY8 A;  2EY1 A;  4F7X A;  2WAC A;  2RDF A;  5C3W A;  1EYA A;  2F0K A;  3P75 A;  5HGT A;  4YIJ A;  2PZT A;  5C3X A;  1SYC A;  2EYJ A;  1EZ6 A;  2EY2 A;  2EYL A;  1EQV A;  1F2M A;  3D4D A;  1SYD A;  3R3O A;  1STG A;  1SND A;  3MEH A;  4K2L A;  4ME5 A;  4QB4 A;  5JOB A;  4EQO A;  1EY4 A;  2EYH A;  4EVO A;  5C4Z A;  2NUC A;  4F8M A;  5CV9 A;  5IGD A;  1STA A;  1TQO A;  5ISR A;  1KAB A;  5NUC A;  1KAA A;  1ENC A;  4B9X A;  3P1H A;  4WRD A;  4LAA A;  2SNM A;  5M9O A;  4KY5 A;  4MIU A; 
#chains in the Genus database with same CATH topology
 4A3J H;  4JYA Q;  2ZXO A;  1SYF A;  1I3Q H;  2F3V A;  2QA4 A;  1YHB A;  3D3R A;  3J7A 5;  1K8A C;  3S16 B;  1PFN A;  3D8G A;  1VQJ A;  2QDL A;  1JB3 A;  1YVC A;  1VQH A;  3HRZ C;  4H7B A;  3VA5 A;  4DV4 L;  5J1Z A;  1Q1E A;  3AYH B;  1I4R A;  4AQY Q;  1Q1B A;  2C35 B;  3FKI H;  4GZY C;  2OTJ A;  2DY7 A;  3HOU G;  4NKL A;  3GTM H;  2QEJ C;  2J7Z A;  4A4I A;  3HEJ A;  4NB3 A;  3OWE B;  3I4M B;  2R93 B;  4JI7 Q;  1X56 A;  3HOZ B;  4K2K A;  2MFI A;  1JWM D;  3S1M H;  2K5W A;  2YU9 B;  3NBI A;  4B3T L;  4UY8 C;  1S5E D;  3A54 A;  2H1E A;  4CBV A;  2ES2 A;  4G7Z C;  4NXM L;  4QY7 A;  4KHV A;  2I46 A;  4ME3 A;  3Q8D A;  4DXF A;  1EL0 A;  4KMU C;  1ASY A;  2K14 A;  2NVT H;  2C9O A;  5CV5 A;  4JI1 L;  3CME A;  2KA7 A;  1HA5 A;  1A0I A;  1H9M A;  5IOC A;  1HR0 L;  4GN3 B;  2PMZ E;  3G71 A;  1RD9 D;  4K5X A;  5FJ8 H;  5C0X I;  4HJ5 A;  1SR3 A;  4DV0 L;  4IO9 A;  1MKH A;  3DWQ A;  4QJF A;  4ZKB B;  1GVP A;  2R7Z H;  4KJO A;  1JOQ A;  4GNX C;  3E3X A;  1VQN A;  2L5T A;  1P8L A;  2RSN A;  3M9B A;  5CR3 A;  5GAG C;  4A93 G;  2V4D A;  3LGJ A;  4A3C H;  3S16 H;  3HS0 C;  2B63 B;  3MWY W;  3STB D;  4HSP A;  3IAY A;  1CK1 A;  2Q8R E;  1D1K A;  1F2M A;  1BUV T;  4JBJ A;  4OON A;  1IBL Q;  4K0K Q;  1B8A A;  3I4M H;  2R93 H;  4L6T B;  1TWF B;  4NW2 A;  4EVO A;  3HOZ H;  4F8M A;  3MXG A;  2YU9 H;  1XNR Q;  3P1H A;  3PO2 B;  1CUK A;  1FGB D;  5GQO A;  1VQG A;  3HFZ B;  2MP1 A;  1NTG A;  1VQ7 A;  1L0Y B;  1N9W A;  5C4X B;  1VQM A;  4CDE C;  3K57 A;  1JE4 A;  1QB5 D;  1I6H B;  4YY3 Q;  2EXD A;  4DNR B;  2AMC B;  4KV6 A;  3KUP A;  5KYI A;  3K81 C;  1KDB A;  2K6A A;  4DV4 Q;  1PRT B;  4KKU A;  5EAY A;  2PCF B;  2A73 B;  4DAV A;  4R4C A;  2HCI A;  3MZ5 A;  3TRE A;  1RF2 D;  3TP7 A;  3VYS A;  5KNB A;  5E3F A;  1C0A A;  3C46 A;  2KOL A;  5M5W H;  2AUK A;  4BY7 G;  3NE5 B;  1EY0 A;  4DV2 Q;  1D5Z C;  2JA9 A;  5LL6 X;  1A63 A;  3PUX A;  1TWG B;  1EU4 A;  5K36 G;  1G6P A;  1D5M C;  2SDF A;  4IUV A;  2CW0 C;  5A2Q L;  1OO9 B;  1TS3 A;  2B63 H;  1PH5 A;  3T4A C;  3G48 A;  1TWC B;  4JI1 Q;  2CQA A;  5C44 B;  3FVQ A;  3PIP A;  2Y0S G;  4OWT B;  3I4N G;  1A2U A;  3UDG A;  1JCK B;  4J1M A;  2F0N A;  1GHK A;  1A6X A;  3C1E A;  1TWF H;  3RLO A;  1G2T A;  3DMU A;  1XXG A;  1ICF B;  3UI2 A;  1KLG D;  1PHJ A;  1NNX A;  1W6J A;  2KHJ A;  3KDF B;  4I65 A;  1I5F A;  5LHY 1;  3PO2 H;  3A8I E;  3OMC A;  1C9O A;  4DV1 L;  2B2W A;  2XIW A;  4TRD A;  5C4X H;  1O7L A;  4KLK A;  5IWA L;  1KDC A;  1KD1 C;  1I6H H;  3PO3 G;  4A3J G;  1ENA A;  2F0I A;  2RSO A;  1F9S A;  3SVM A;  1YNJ D;  3GTQ B;  2R7F A;  1SYC A;  2EYJ A;  4DR6 Q;  2G9D A;  2F3I A;  1FR3 A;  4JOI C;  3HOX B;  1VS0 A;  4B3R Q;  3L0O A;  5CBE E;  4HJ8 A;  1B3Q A;  5BR8 L;  2D2C C;  4DR1 L;  1B1Z A;  2WAQ B;  4APV A;  3ICE A;  3OPO A;  1XNQ L;  1CSP A;  4X64 L;  1VCI A;  1GUG A;  1X54 A;  3OWF A;  3CCV A;  2F0J A;  2B2Y A;  2QGQ A;  2ZM6 L;  2NVX B;  1QNK A;  2NB0 A;  2OT2 A;  2IX3 A;  3K5M A;  3P20 A;  1GJX A;  1TWC H;  1U4P A;  1BOS A;  5I9P A;  5C44 H;  4LUZ A;  1SNM A;  1F9Q A;  5HGQ A;  3ULP A;  1N34 L;  1SMY D;  3J80 E;  3Q24 A;  2NN6 G;  3E6Z X;  2IWH A;  5JAV A;  4IJH A;  1NSN S;  5CBA E;  1CQV A;  3S1N B;  4ILW A;  4NP5 A;  2JJQ A;  5FJ8 G;  5ELE A;  3CRL C;  5IP7 H;  4LF7 L;  2F0E A;  4ODG A;  4HIO A;  2KCC A;  5IT9 E;  1E2W A;  3I3C A;  1D1I A;  1RL2 A;  1U5K A;  2QIL A;  1F9R A;  4HMI A;  1K0R A;  1HNZ L;  1XYI A;  3GTQ H;  1PYB A;  4L5S A;  4LF9 L;  1CTM A;  3BDL A;  4A3C G;  2UUC L;  3R8B A;  3HOX H;  4MN3 A;  4CKB A;  3O13 A;  3A56 A;  1BF4 A;  4JI4 L;  4DXG A;  3I4M G;  2R93 G;  3V05 A;  3SXH A;  1STH A;  3HOZ G;  3EA6 A;  4DV1 Q;  3PUV A;  1SE2 A;  4B3S L;  3PCO B;  2NVX H;  5IWA Q;  3D6W A;  3JAM c;  1B7Y B;  1SJH D;  4N9T A;  3PF4 A;  2CKZ B;  2F0O A;  4QIW E;  2A6H D;  5C0X H;  3OTO Q;  1XTC D;  1SE4 A;  3STB C;  3NEN A;  3TQY A;  1WTX A;  2RDF A;  1DGS A;  3G7L A;  2EY2 A;  3H94 A;  3TRZ A;  1HTP A;  1EY4 A;  4WJ3 M;  3CC4 A;  4PZ6 A;  1AE2 A;  2WKD A;  2HT1 A;  2K05 A;  1HQR D;  2ID0 A;  3S1N H;  1BCP B;  1ZEQ X;  4H0L C;  4IN3 A;  4QUF A;  4XTC S;  4X62 Q;  5EPJ A;  3GTG B;  1E2Z A;  1PH2 A;  2JSO A;  5EKL A;  1XNQ Q;  1VQ8 A;  1Q8I A;  2CQO A;  2XGT A;  4LW1 A;  3RN2 A;  4YCU A;  4HJA A;  2NYZ D;  4DAY B;  1XMO L;  4JBW A;  2GVB A;  1W6K A;  2KVM A;  3W1G A;  5FKA C;  4POG A;  4PG3 A;  1B2T A;  3TEH B;  1STY A;  4BA1 I;  2ICI A;  4J8Q A;  4DR7 L;  3PGZ A;  1H9S B;  1BXT A;  2B8G A;  1VF5 C;  2B63 G;  2DJF C;  4J15 A;  1JOO A;  4DV6 Q;  4DR5 Q;  3E9I A;  1Q8K A;  1NBW A;  1O7I A;  1YZ6 A;  3OSO A;  1HUN A;  5IYB H;  2CFM A;  4GKJ L;  1L1O A;  4LF7 Q;  2I0Q A;  3HOY B;  4L5T A;  4BWG B;  1PA6 A;  1B53 A;  3UE1 A;  1KIX A;  3PO2 G;  3F2B A;  4JV5 Q;  5KRU A;  4RH6 A;  1UUP A;  4RGT A;  4QL5 A;  1KC8 C;  3CAM A;  2NN6 I;  4RCO A;  2HUG A;  5KYL A;  2IY5 B;  1H9J A;  1HNZ Q;  4O0A A;  5C4X G;  1KQS A;  4GOP C;  2AWO A;  2L9H A;  3EN2 A;  2F03 A;  4IOA A;  3BDC A;  3TZU A;  4X6A H;  4FDB A;  4LF9 Q;  2B8F A;  1V1P B;  1CT1 D;  1X3P A;  3PUW A;  5GAH C;  3OW2 A;  4ABN A;  3KK7 A;  3E5S A;  4OO1 I;  3TN2 A;  2B2T C;  2HQL A;  1X9N A;  2SEB D;  4DV3 L;  4JI4 Q;  2QF7 A;  1EQR A;  1PH9 A;  3QOJ A;  1FD7 D;  4TQU S;  1Z6H A;  4B3S Q;  1T9H A;  1PLF A;  2EJF C;  1AE3 A;  5IIF A;  4U67 3;  3P75 A;  1HH2 P;  2CCZ A;  1VQC A;  1SJE D;  2M2L A;  4DUY Q;  1VQD A;  4P72 A;  5CV9 A;  3A0J A;  3KF8 B;  2Z4I A;  1IZ6 A;  2SNM A;  4KI0 A;  1PRT F;  4IUP A;  2Q8I B;  4BBR B;  2MO1 A;  5C44 G;  4EQP A;  4YWM A;  2YYZ A;  1TY2 A;  2V1C C;  2K50 A;  4RFB A;  4O42 A;  1Y8O B;  1FVI A;  3HOY H;  1Z9F A;  1CHP D;  1TU2 B;  1LTB D;  1RDP D;  1Q90 A;  2Z6K A;  2PZU A;  4K8I A;  2VQE Q;  1XMO Q;  1EFW A;  1EIG A;  2EDG A;  4LUV A;  3DUZ A;  5IP7 G;  4N9P A;  3DEO A;  3KLS A;  4X65 Q;  1PH3 A;  3CC2 A;  3E0E A;  3E9H A;  3MEF A;  4DF7 A;  1KRS A;  4DV7 L;  4JYA L;  4DR7 Q;  1SMY C;  3NBH B;  4Z9C B;  4FNF A;  1Q82 C;  1VQP A;  2CWA A;  1S72 A;  1HTL D;  3PMF A;  2Q2I A;  4C1N K;  1EYC A;  3J81 L;  2K5N A;  3ULL A;  1E3P A;  1EQT A;  3M4Y A;  3BVM A;  2MHV A;  1EY6 A;  5KIX A;  1ZXT A;  2EY6 A;  2HQE A;  4GLV B;  4QF4 A;  2AUJ D;  2NVQ B;  2B2V A;  2WAQ G;  3T1H Q;  1GXD C;  1E24 A;  4DR4 Q;  2PI2 A;  2JA6 B;  2R92 B;  3M7N A;  3KF8 A;  3KYH C;  3EJI A;  1PFB A;  2JEB I;  2I5M X;  1X65 A;  4FF2 A;  3NQT A;  3WDN A;  1F2Y A;  1BBX C;  3ERS X;  5FLM H;  3CRK C;  1OXX K;  1TWA B;  3EIV A;  1DON A;  2CHB D;  4BBR H;  2RQX A;  3TS2 A;  4X3K A;  1QZH A;  2Z6B A;  4U68 A;  2K52 A;  1VQ4 A;  1LTL A;  1NJI C;  4GKK L;  4DV3 Q;  5EBD A;  2LMC B;  1B50 A;  3BYT B;  4C56 C;  5EJW A;  3X3N A;  3NBH A;  2A6H C;  2TMP A;  2PZT A;  3UDI A;  1STG A;  1K3B C;  5C4Z A;  4TVA B;  1SE8 A;  2N78 A;  1PH8 A;  2XRQ D;  3K59 A;  1K73 C;  3JAM i;  4YWL A;  4KN7 C;  3J7Y W;  4RMF A;  4CDC C;  1UE7 A;  2F0S A;  2MJ8 A;  4J6H A;  3HOW B;  2DUD A;  2F0T A;  1SAP A;  1X3Q A;  2F0W A;  1XWE A;  2RVL A;  1VMC A;  2Q2U A;  3I73 A;  1AFP A;  1Q3L A;  2VY3 A;  5EPK A;  2NVQ H;  4A3G G;  4K0K L;  3SK6 A;  1Z47 A;  2WIN B;  5IYB G;  2HD3 A;  4QUC A;  4JI0 Q;  1KNA A;  2JA6 H;  2R92 H;  3NEM A;  3CD6 A;  2A1A A;  4DV7 Q;  1JE5 A;  4GNX A;  3ITP A;  4RG1 A;  4HTH A;  3F2D A;  2CVR A;  1R9T B;  1CA6 A;  3LWE A;  5CC4 A;  3DM1 A;  5AFW A;  1TWA H;  4G7O C;  2YTY A;  1LT6 D;  3MFY A;  1UE6 A;  4GS3 A;  1PFM A;  4YY3 L;  5CYU A;  1PH1 A;  2JA5 B;  5CV4 A;  3NEL A;  2B29 A;  5FLX c;  1IXR A;  1JQY D;  4A3B G;  4V0B A;  5IP9 H;  2B2U C;  4AYB E;  1CKM A;  3NP8 A;  1JWU D;  4CHT B;  4IPH A;  4GN5 A;  2WB1 B;  3KF6 A;  3CCQ A;  5IGB A;  5E4W C;  2M9V A;  3I56 A;  3S15 B;  4K5V A;  3U9O A;  3C2P A;  1IL8 A;  2DNC A;  2EVB A;  1VQ5 A;  3FHW A;  2CH4 A;  1H9R A;  2X6L A;  1EY7 A;  1I4H A;  4DV2 L;  1MI2 A;  1BR9 A;  3QIA A;  1H9K A;  1CI3 M;  2IJ0 A;  3BYY B;  3MFG A;  4XQQ A;  1KTK A;  2IL8 A;  3BVZ A;  3S9W A;  3HOW H;  1WTH A;  2KHS A;  1E2V A;  2NN6 H;  4GKK Q;  1HXY D;  3AB9 A;  1BCP F;  5JJI A;  1R4P B;  1LAB A;  1FJG L;  1NE3 A;  1A8V A;  1PFS A;  4UAI A;  1EQQ A;  4F7X A;  1F77 A;  5C3W A;  3HOY G;  2LXK A;  1VQE A;  3ZJY C;  4LF4 Q;  1SYD A;  1PRT D;  3GP7 A;  4K2L A;  4ME5 A;  3CPF A;  4OO1 H;  3NQI A;  1S40 A;  1R9T H;  1V9P A;  1JB7 A;  3IFT A;  5KEE A;  1I94 L;  1LTR D;  2E75 C;  3T13 A;  5GAE C;  1XPR A;  1LTA D;  4H13 C;  4IPD A;  2JA5 H;  4LFA Q;  2EQS A;  4M8A A;  2BH8 A;  2WII B;  5FK9 C;  1X3F A;  4A3I B;  2WKC A;  1LYL A;  1O7Z A;  4Y7N B;  5E1F A;  2EE1 A;  4WOR A;  4CDD C;  4GN4 B;  4DR6 L;  1LTT D;  3Q6S A;  2QCP X;  1GD7 A;  1A3T A;  3GV6 A;  1KLU D;  4V19 0;  4B3R L;  2DJG C;  3S15 H;  4A3L H;  1WOC A;  2CH4 W;  2AQ1 B;  3PIO 3;  3TBI B;  1B44 D;  4HCS A;  2N55 A;  3M4Q A;  4X3U A;  5FOB B;  1V1O A;  1WCM B;  3L9A X;  4X3S A;  1A62 A;  1CZW A;  5I6Y A;  2K4K A;  3A5Z B;  1C7Y A;  1AW7 A;  4EQN A;  5A2Q E;  5FLM G;  4JC0 A;  3GO5 A;  3VR6 A;  3I55 A;  1SNO A;  1UE1 A;  4BBR G;  4Q5V A;  1S5D D;  1TY0 A;  2E2D C;  3RUZ A;  1RKN A;  3FDT A;  4JOI A;  1AN8 A;  1GOZ A;  1CKN A;  4NMZ A;  1SYB A;  1ESR A;  2R7D A;  4IQZ A;  2K03 A;  2OCE A;  3D6C A;  4MNO A;  3SK5 A;  1VDZ A;  4OX9 Q;  4HIM A;  3W5O A;  4RKB A;  2YV5 A;  2EYO A;  1V43 A;  2L4N A;  2NWG A;  4B08 A;  3H3V I;  1Y8P B;  4O1N A;  1Y69 U;  1JMC A;  3TZD A;  1JJ2 A;  3H15 A;  2A74 C;  4WJW A;  4A3I H;  3I8Z A;  5EGT A;  2F0F A;  4Y7N H;  4G4K A;  4KN4 C;  4CGY B;  3QWN A;  4B9W A;  3PSI A;  3RN5 A;  1SYG A;  1FJG Q;  4CJ1 B;  2NVY B;  4KHZ A;  2E5L Q;  4YIJ A;  4Q0F A;  3I4L A;  2H5X A;  1X32 A;  1E22 A;  1SND A;  3BG3 A;  2IHE A;  4QB4 A;  1WVL A;  1IL2 A;  4LF8 L;  1MSG A;  1KXL A;  1DOL A;  1QE6 A;  4C1N I;  4LWC A;  5M9O A;  1OXU A;  2JA6 G;  2R92 G;  1HFG A;  5JJZ A;  1JWS D;  5BN5 A;  1IBM L;  1WCM H;  1I94 Q;  5A35 A;  1C4Q A;  2KEN A;  5C6A A;  1BVS A;  5TSS A;  2BH2 A;  4P2C B;  1K3R A;  3OTO L;  4RGM A;  2H4O A;  1ZKO A;  1Q46 A;  1CZG A;  4R4O A;  3OW7 A;  1XTD A;  3Q0A A;  4DUZ Q;  2IHF A;  1FNW A;  1HNX L;  4HR7 B;  3A8K E;  3UDX A;  5GRO A;  2B39 A;  4A3M B;  2Y0S E;  2FJ2 A;  2VXW A;  2D0O A;  4LFB Q;  1QUQ A;  2TSS A;  1XJV A;  3OMG A;  2EYM A;  4IPG A;  1A2T A;  1PZK D;  4ZCK A;  2GN5 A;  5IP9 G;  2HDM A;  1EEF D;  3F2U A;  5FO9 B;  4X62 L;  2F4V Q;  5DM6 3;  1EZ8 A;  5DEH A;  2GA4 B;  3I70 A;  2NZH A;  3GV3 A;  1PTO B;  2IT1 A;  3J7A F;  5T1G A;  2J4X A;  3URY A;  1TWG H;  2K04 A;  3W2D A;  1JOR A;  3JAM E;  4HAE A;  1F2Z A;  2AQ3 B;  1LAC A;  4R1J A;  2JEA I;  4H02 A;  1QZG A;  3HOW G;  5M5X B;  2NVY H;  4OWX B;  2E76 C;  4DV6 L;  4FXG C;  4DR5 L;  1OXS C;  1N33 L;  1ICW A;  1SRU A;  4A3E B;  2XN9 C;  4DR3 L;  4UP8 A;  3NXW A;  1K83 B;  1SFO B;  3S17 B;  1Y1W B;  4R8N A;  5IGF A;  1BCP D;  3WWV A;  2OF1 A;  4JV5 L;  1UAP A;  3B6Y A;  1NY4 A;  2PNR C;  4OO1 G;  1KHI A;  1UWV A;  1OXT A;  3J81 j;  3I4O A;  5D3D A;  3CCR A;  2F0L A;  3FRP B;  3VYR A;  4PMC A;  5G3L F;  3DWP A;  2JA5 G;  5LMU L;  1XPO A;  4A3M H;  2DN8 A;  4XXE A;  2F0K A;  5HGT A;  1ASZ A;  3FP9 A;  3CCS A;  1YJ9 A;  2EYL A;  1V1Q A;  4BS9 A;  3CW2 C;  4JBK A;  1NR4 A;  4EQO A;  3S1R B;  1PRT C;  2NUC A;  4A3G B;  5ISR A;  2BA0 A;  1PYW D;  2WP8 J;  4AH6 A;  5IE8 A;  1W2B A;  3U58 A;  4LF8 Q;  5ELN A;  2WB1 G;  2NBF A;  3HOV B;  1BO0 A;  1PTO H;  1PH7 A;  5CV8 A;  4B3M L;  1IYV A;  4A3L G;  3VR5 A;  1LO5 D;  3IFD A;  1IBM Q;  1B4O A;  2LXJ A;  2PO4 A;  1CHQ D;  1L1O B;  2A69 D;  5M5Y B;  1BDO A;  4GOP A;  1BBU A;  3QO2 A;  4DUY L;  4O2D A;  1AZP A;  1HNX Q;  1WTP A;  5M5X H;  4G57 A;  1VQ9 A;  5IYC H;  4TKO B;  5IT9 L;  3M85 A;  1M1K C;  5JVH 3;  4A3B B;  3CKI B;  2E74 C;  4C3J G;  1X3G A;  2KEC A;  1EEI D;  3H91 A;  2XVS A;  4A3E H;  2B2T A;  2F3W A;  4BA2 I;  2E2I B;  1TKW B;  4YHH Q;  1K83 H;  2A8V A;  3S17 H;  2RHS B;  5DLQ E;  1SSO A;  2F0Q A;  1R4Q B;  4OHJ A;  1Y1W H;  3OIP A;  2RDG A;  2VQE L;  4FF3 A;  3RD4 A;  1YJN A;  4E6I A;  5C3E B;  4X65 L;  3VR3 A;  2PMZ B;  3RMH A;  1QG7 A;  1B9M A;  4LFC Q;  4K6D A;  2IX0 A;  1YHA A;  4OGQ C;  3KBG A;  3Q23 A;  2EY5 A;  5J22 A;  3PF5 A;  1G91 A;  5LMN Q;  4A3I G;  2KCT A;  4IZ8 A;  1YIJ A;  2AQ2 B;  2RBM A;  3PV0 A;  2FHT A;  1O80 A;  1V8Q A;  3UDF A;  3S1R H;  1EOV A;  3E0J A;  5COR A;  2E2J B;  1N33 Q;  2JXM B;  2ZT9 C;  3NTI A;  4A3G H;  4JW0 A;  2M00 A;  1QJO A;  4DR3 Q;  1PH6 A;  1QVG A;  3HOV H;  1D6E C;  4P74 A;  3MXU A;  3V2T A;  3T53 B;  1EUJ A;  5FO7 B;  3T1H L;  2R6G A;  2IW3 A;  3HKZ G;  1I50 B;  4DR4 L;  1TVX A;  5M5Y H;  5CGK A;  1PZI D;  4DV5 L;  1MGS A;  3A74 A;  1HUM A;  3BVG A;  1NR2 A;  1WCM G;  1L0W A;  4LMQ D;  2UU9 L;  5LMU Q;  3RZD B;  1TII D;  4JI2 L;  4A3B H;  1LTG D;  1LTS D;  3H3V H;  4RA8 A;  2O5I C;  3GTG H;  2E2I H;  4RHS A;  3CCJ A;  1YJW A;  5E4X A;  1EOT A;  4EQ5 A;  2PW7 A;  3EVQ A;  2MQH A;  1KAW A;  4C2M B;  3PIO A;  1PH4 A;  3U4V A;  4B3M Q;  1K8G A;  1U4L A;  4MZ9 A;  3BJU A;  5C3E H;  2ZJP A;  3I72 A;  4R8I A;  1K0S A;  1II3 A;  2BE5 D;  1YNJ C;  3VYU A;  1STB A;  1IYJ B;  4KHP Q;  5I2Y A;  4K14 A;  3CP0 A;  3MHB A;  2J0T D;  5IGE A;  5ELB A;  3KOJ A;  4K8J A;  5M3F B;  2E2J H;  1EWH A;  1ENF A;  2F0P A;  4KTA A;  4ZKC B;  1HR0 W;  5IYD H;  1MJE A;  3I2Z A;  3RLF A;  4A3K B;  1E0B A;  3VR4 A;  4LJZ C;  2SNS A;  2B3G A;  5ELD A;  3SDZ A;  2PQE A;  2D0P A;  4JI0 L;  1I50 H;  2UUB L;  5E7N A;  4FXK C;  3D4W A;  4FO2 A;  3T1Y L;  5I6W A;  1EYG A;  1HZA A;  4BY1 B;  1RJT A;  1SN8 A;  3PIP 3;  2R61 A;  1VQI A;  1U0L A;  1Q12 A;  2YTX A;  1ET9 A;  3GTK B;  1KNE A;  1H95 A;  3RZD H;  1E1T A;  1IKL A;  1IHZ A;  5I9O A;  2PW5 A;  1U9R A;  2F0D A;  4BXX G;  5IY0 A;  3GTL B;  3NUC A;  3ERO A;  3T16 A;  2L1B A;  4K5W A;  1ONL A;  1WTV A;  1HZ9 A;  1IKM A;  4A3M G;  4R4Q A;  4KK7 A;  3BU2 A;  4KJN A;  1K9M C;  1TS4 A;  5JPN C;  1O78 A;  1VQA A;  3H3V C;  4C2M H;  1BCP C;  2LKV A;  2K33 A;  2AKW B;  4CJ2 C;  3C3L A;  1WTQ A;  1LTI D;  2R3Z A;  1CFM A;  3KJP A;  5J39 A;  4DV5 Q;  4DNI A;  3GTO B;  1LT4 D;  3A7A B;  1KRT A;  3M4P A;  4POF A;  1WTW A;  1JIC A;  2RDH A;  3MXN B;  5LL6 S;  4NXN L;  1HFN A;  2WV6 D;  2UU9 Q;  3AFP A;  4IUT A;  1NAP A;  1LT3 D;  2Z8L A;  4JI2 Q;  1DZ1 A;  2JN4 A;  5M3F H;  4GNX B;  3J81 c;  3MTS A;  3W1B A;  1X55 A;  5FLX E;  5IYC G;  4IPC A;  3C1F A;  1HRJ A;  4A3K H;  2JA8 B;  1RTO A;  1DM0 B;  5IGG A;  1VF7 A;  1G29 1;  3R93 A;  1EWC A;  5AJ3 Q;  4A3E G;  1PTO F;  4XYQ A;  2ZTD A;  1HZC A;  2A69 C;  2WAQ E;  4MHE A;  4JG2 A;  3M3Y B;  3TS0 A;  2K5V A;  4LF4 L;  4R4T A;  1Y1W G;  3J7Z C;  4BY1 H;  2SOB A;  1JJG A;  3VR2 A;  4OIJ A;  2NTS A;  3QG1 A;  4JI6 L;  3GTK H;  2K28 A;  3KF6 B;  3R2T A;  1CSQ A;  3GTL H;  3AEV A;  3IKJ A;  3RNU A;  4LFA L;  4KY7 A;  4QCL A;  2Z1C A;  1T5X D;  4F87 A;  1E1O A;  4FF1 A;  2N49 A;  5DNF A;  1PZJ D;  1SYE A;  2XWJ B;  2HDL A;  1J5E L;  5EKK A;  1RTN A;  3NHH A;  3VA7 A;  4JVZ A;  2ATW A;  3K80 C;  1XPU A;  2I5L X;  1JC7 A;  3MXN A;  2UUB Q;  2F52 A;  3SGI A;  1WYD A;  2XSC A;  3HOV G;  3S2D B;  2FXQ A;  3T1Y Q;  2QDB A;  2K5Q A;  3GTO H;  2NZ1 D;  1LV9 A;  2RHQ B;  2JA7 G;  2CWP A;  2XRS D;  1AEX A;  4IUU A;  3FPP A;  4KD3 A;  2F1M A;  3KLR A;  4QQB X;  1LT5 D;  3I90 A;  2B2V C;  3QR8 A;  1L0X B;  4LK1 C;  3G4S A;  2MPM A;  4XIG S;  1EY9 A;  3VDY A;  1HCZ A;  3EQL C;  5CMD A;  5DAU A;  3KLS X;  2JA8 H;  1PDQ A;  3DXJ C;  5JEA H;  3GQB A;  1FNU A;  4RGO S;  4QIW B;  4H44 C;  4S3S A;  2L12 A;  3DEP A;  2ZJQ A;  1NCV A;  3OHX C;  4LF5 L;  5HY6 A;  1DYQ A;  3M3Y H;  4CKE A;  4RAU C;  4NPS A;  4RGN A;  1DCZ A;  5JVG 3;  3CCL A;  3ND9 A;  4XQN A;  1DD2 A;  3J7A V;  3CHB D;  4HID A;  1D5X C;  5LMN W;  4OX9 L;  2VB3 X;  5C3E G;  2VZA A;  4NXN Q;  2HCC A;  3GTP B;  1HJP A;  1GM5 A;  3L3O C;  1G51 A;  1KAB A;  5NUC A;  2A68 D;  4WRD A;  3D31 A;  3TP5 A;  2A5H A;  1ZYR D;  1NUC A;  1AZQ A;  4C3J B;  1DOK A;  2N8N A;  3AMU A;  2EYP A;  4KKS A;  2E5L L;  1SRO A;  1TR5 A;  3BDO A;  4DFA A;  4KKT A;  5IYD G;  4JPB W;  2OTL A;  4R9W A;  3V96 A;  3F1Z A;  2BE5 C;  3S2D H;  2EXZ A;  3K8A A;  1QWY A;  4IFD I;  1XMQ Q;  4QMG A;  1Q7Y C;  2OQ0 A;  2UUA Q;  1EY5 A;  5L37 A;  4YCW A;  3NWT A;  4JI6 Q;  1PYS B;  1CKN B;  2F0M A;  3SEB A;  4HMJ A;  1EIH A;  2ZXR A;  3IL8 A;  3ZYY X;  4DA2 A;  1DJR D;  4PQX A;  1A3U A;  3I91 A;  3BZK A;  5KGU A;  4JI5 Q;  3BZD B;  4ZLT F;  2AHO B;  5C5L A;  2DGY A;  3F8T A;  3PUY A;  4IAL A;  1WD0 A;  5JPM C;  4DUZ L;  3N6R A;  3H09 A;  5M5W B;  2K75 A;  1J5E Q;  2VS1 A;  2EZV A;  3CMA A;  4HED A;  2ENB A;  3KJO A;  5EBC A;  4LFB L;  1S5C D;  1CQF A;  4DU9 A;  2F4V L;  5DM7 3;  2ASB A;  3CXC A;  4XYO A;  2KCN A;  3HKZ B;  1J9O A;  2KBN A;  2IPK D;  3S1Q B;  4OIK A;  2RCF A;  3GTP H;  2I07 B;  4FP5 D;  5FO8 B;  4FF4 A;  5H1S E;  2IX1 A;  1A15 A;  1G6Z A;  1L2F A;  2RKS A;  2UXC L;  2FMC A;  3CQZ B;  1S4Z A;  4ZQ3 A;  4ZUI A;  5JEA J;  1SE3 A;  3HGB A;  1RIP A;  4I7A A;  1BQQ T;  1E7Z A;  4RCN A;  4RKL A;  4C3J H;  5M3F G;  2O4X A;  4A75 A;  3ULJ A;  1EIY B;  4XDX A;  1B70 B;  4LF5 Q;  4A3K G;  3K58 A;  2EYF A;  4IUQ A;  2K7V A;  1I4Q A;  2G5D A;  1N36 L;  1UEB A;  1EZ6 A;  1PXU A;  1QUQ B;  3K5O A;  3D4D A;  1CM9 A;  3LWU A;  1HNW L;  1MBY A;  3H0G B;  3R3O A;  1WTR A;  1K8O A;  3A8J E;  4BY1 G;  1STA A;  1TQO A;  5J3B A;  1DXM A;  4A3F B;  4YCV A;  3TDQ A;  1EWI A;  1PTO D;  4C3H B;  1WI5 A;  1M4V A;  3L2P A;  1QNU A;  2PI2 E;  4B3T Q;  4RHR A;  3LNN A;  5D3I B;  3WOE A;  4ID6 A;  2E2H B;  4NXM Q;  5BN3 A;  2ZTE A;  2L11 A;  3J81 i;  1EU3 A;  1OXV A;  2UXD L;  1SMX A;  2E8G A;  1O7Y A;  3P7J A;  5JJL A;  3MA2 B;  4GLA C;  1B3A A;  2A6E D;  1P16 A;  4XQJ A;  4CKC A;  3S1Q H;  4CJ0 B;  3FPU B;  3R2I A;  1NMG A;  1HR0 Q;  4OXP A;  2RCN A;  4IUN A;  5IGC A;  1JOK A;  1RCV D;  2LS0 1;  4G7H C;  2D62 A;  4C3I B;  3IRB A;  3CQZ H;  4DV0 Q;  1N32 L;  4OEL B;  3RZO B;  4L8J A;  5EQ0 A;  2BDN A;  4LNQ A;  4WJ4 A;  1IW7 D;  4DK0 A;  1QVC A;  4X3T A;  5C4J B;  1HHV A;  3NTH A;  2LSS A;  2UXB L;  3G6J B;  5EKI A;  2JA8 G;  5JEA G;  5M3M B;  2N88 A;  2RF4 A;  3K6O A;  3SK4 A;  4YHH L;  1Q81 C;  3H0G H;  4ULL A;  1Q86 C;  2YTV A;  4N8X 1;  3CPW A;  4A3F H;  2Z4H A;  1EFI D;  2UXC Q;  3LX0 A;  2LY7 A;  2Z9H A;  4C3H H;  4LFC L;  2MO0 A;  2HHH L;  5CV7 A;  3ND8 A;  3FKI G;  4JI8 L;  1TXY A;  5K5P A;  4Y52 H;  2E2H H;  5LMN L;  4KD4 A;  3GTJ B;  4GOP B;  2VUM B;  1I4P A;  2EY1 A;  3WOF A;  2WAC A;  1EYA A;  1STE A;  5C3X A;  1N36 Q;  1D7Q A;  2FFK B;  1FGU A;  1BNZ A;  2HIV A;  2O2L D;  3MEH A;  2OWO A;  2EYH A;  1PV4 A;  2KEE A;  1HNW Q;  1VQB A;  2JYO A;  1N8R C;  3KDF A;  5D65 A;  1EIF A;  2K5D A;  1G2S A;  2A68 C;  4KY5 A;  4C3I H;  3U4Z A;  2Z0S A;  1HQM C;  3I7F A;  2WFW A;  4IJL A;  3RZO H;  4BXX H;  1Y1V B;  5F2D A;  1ZYR C;  2PYK A;  2VQF L;  4ZYS A;  3NSW A;  3G6E A;  1CA5 A;  3CU7 A;  3MXP A;  1MSH A;  5C4J H;  2B2W C;  2A19 A;  2F0G A;  3D4R A;  4XT1 B;  5I4D A;  1HA6 A;  3MC0 B;  4PZ7 A;  4DN4 M;  3K5N A;  1YI2 A;  1T5E A;  2BA1 A;  3JAM L;  5M3M H;  2R7Z G;  2UXD Q;  4WFN 3;  1YNX A;  3DHQ A;  1K8M A;  3DWA A;  2N3S A;  4MTK A;  4NDX A;  1HZB A;  1TS5 A;  4FYD A;  5T1I A;  4A3D B;  3J80 L;  4OWW B;  2F4I A;  2JA7 B;  3W3A A;  5GAD C;  2L55 A;  4ZK9 B;  1HPC A;  2C5C A;  1C8C A;  4AYB B;  1F2L A;  1TWH B;  4PMB A;  1IBK L;  4P75 A;  1N32 Q;  1TS2 A;  1SEB D;  3HG9 A;  1GHJ A;  4KHP L;  4P71 A;  1OTC A;  3CCE A;  4BBS B;  4IFD H;  2KCM A;  1LM0 A;  3K7A B;  1YHQ A;  4OL7 A;  3KBX A;  3QB3 A;  1KDA A;  4R4I A;  2UXB Q;  4N8F A;  1M8A A;  2B2Y C;  3GTJ H;  1MJC A;  2VUM H;  2FIN B;  1QIL A;  1KL9 A;  2KUM A;  2HIX A;  2XTI A;  4HJ7 A;  3FEW X;  3Q22 A;  1SDF A;  1SFO H;  2KJX A;  1STN A;  3A7L A;  1UEA B;  2WB1 E;  5JJK A;  4TSS A;  2VW9 A;  1BBW A;  3AQQ A;  3T51 B;  2OQK A;  3J80 c;  2QEX A;  1YNN D;  1BKB A;  1J6Q A;  1Y1V H;  2GVA A;  3RLN A;  2OEO A;  1JR0 D;  3HOU B;  2HHH Q;  1AH9 A;  4JI8 Q;  2RA4 A;  2ICE C;  3SE0 A;  1S3O A;  5BR8 Q;  4K6L A;  4DR1 Q;  5KND A;  4X64 Q;  3K7U C;  3KFU A;  3CCM A;  1F9P A;  1SNC A;  2K1B A;  2KQ3 A;  5IT9 c;  3CF5 A;  1Z7T A;  2ZM6 Q;  4FXD A;  4HN7 A;  3GDE A;  4F88 A;  1YIT A;  2Q2H A;  2P5Z X;  2EOT A;  4JCV E;  1RHP A;  3BS1 A;  2Q2T A;  4A3D H;  4B9X A;  1ENC A;  1FL0 A;  1X3E A;  4JBM A;  4UP7 A;  4IOC A;  3OIQ A;  1N34 Q;  4DNT B;  2JA7 H;  1VQ6 A;  1QOH A;  2OXP A;  1PTO C;  1DOM A;  1TWH H;  2G9H D;  4KY6 A;  5ELO A;  3F2C A;  2ZTC A;  5IOD A;  5EPL A;  1GUN A;  4UDU C;  2VQF Q;  1W3S A;  4BBS H;  4UPA A;  4YWK A;  4P73 A;  1TT2 A;  3ERQ A;  3K7A H;  2JQO A;  2AWN A;  1MIU A;  4DKA C;  2BOS A;  2JE6 I;  1NMF A;  2K5H A;  2X69 A;  4JK1 C;  3KLW A;  2F0U A;  2ZJR A;  2D9U A;  2A6E C;  2F0H A;  4LUO A;  3TP8 A;  3K5L A;  4HSV A;  3S14 B;  4A93 B;  3PQI A;  1MD2 D;  1IYU A;  3A5U A;  4M1U B;  1U4M A;  5AJ3 L;  3MVV A;  3DM3 A;  4FVM A;  3OOC A;  4JI3 L;  2UUC Q;  3RR5 A;  1JT8 A;  1EYD A;  3HKZ E;  2K01 A;  3H0G G;  4ZRZ A;  4IFD J;  1IBK Q;  4EGV A;  3ONA B;  4DAY A;  1IW7 C;  3HOU H;  4L5Q A;  2BDO A;  4A3F G;  2Q8T A;  4MTN A;  4DPG A;  4C3H G;  1PVO A;  2PQA B;  4UP9 A;  1I4X A;  3HP3 A;  4QGU A;  5C0X J;  4DR2 L;  3HKS A;  3AU7 A;  3D0F A;  2KHI A;  2VNU D;  1H9S A;  1J8I A;  3J81 E;  4DK6 C;  4I7Z C;  3K0X A;  1I4G A;  4LF6 L;  2XNA C;  2QW7 A;  3SHL A;  4HJ9 A;  5HUR A;  1A3V A;  5ELF A;  1SLJ A;  1GUS A;  1GUW A;  2F0V A;  2MUY A;  1X6O A;  1YBY A;  1FYC A;  1UNS A;  1PMR A;  3QOL A;  4XT3 B;  1MHW C;  2D5D A;  3MAQ A;  1ET6 A;  1L1O C;  2EIF A;  4C3I G;  4X66 L;  1SBB B;  4DK3 C;  4PZ8 A;  3TSS A;  1EY8 A;  1SXT A;  3NPP A;  3K0Y A;  2DY8 A;  4EX5 A;  2VB2 X;  3S2H B;  4BY7 B;  2L0C A;  1V1P A;  5KNC A;  3S14 H;  4A93 H;  1KAA A;  1ILQ A;  5M3M G;  2O5J C;  2BCO A;  5G3L D;  4MIU A;  3NTK A;  1AP0 A;  1FNV A;  3CCU A;  4OEM B;  3ER0 A;  3FMC A;  2PQA A;  2Y0S B;  3SK8 A;  5CV6 A;  3I4N B;  1VQL A;  3X3M A;  3VYT A;  1ML0 D;  2ZXP A;  2EJG C;  1M90 C;  3N52 A;  2DNE A;  3HOX G;  2JK8 A;  4ZAI A;  3UE0 A;  4GKJ Q;  4AQY L;  3M4O B;  4DAM A;  1GKH A;  1S5B D;  2FMM A;  5BN4 A;  1CKO A;  1K28 A;  1SNQ A;  4IFD G;  1C48 A;  1ESF A;  4JI7 L;  3H6M A;  3TP6 A;  2EPB A;  2NZO A;  1WD1 A;  1D8L A;  1QCB D;  1GUO A;  2VL6 A;  2VUM G;  3EBE A;  2B2U A;  3PO3 B;  1I6V C;  1LLR D;  4HIK A;  4A3J B;  3OYY A;  1WTO A;  5C0X G;  1B9N A;  3U9S A;  3A55 A;  4JI3 Q;  3BZC A;  4UHV A;  3JC6 6;  1I3Q B;  3CC7 A;  2PZW A;  3SR1 A;  4ZUJ A;  1XMQ L;  1ILP A;  1LUZ A;  2CW0 D;  1YEZ A;  4IUR A;  2UUA L;  2QKI C;  4A76 A;  4DGZ A;  5C4H A;  3DLL A;  1JJC B;  1VQF A;  5COY A;  2K32 A;  2NTT A;  1VMP A;  1Y1V G;  2Z6K C;  4AIM A;  3FKI B;  3QJY A;  3NWS A;  1WFQ A;  3GTM B;  3M7G A;  4PMW A;  5I2X A;  2XWB B;  4DR2 Q;  4JI5 L;  3HZX A;  3T56 B;  4BY7 H;  3S2H H;  1VQO A;  1D2B A;  5D14 A;  4RWS C;  3S1M B;  1Y8N B;  5C5M A;  2JP1 A;  4DAP A;  4LF6 Q;  3PUZ A;  4L63 B;  3GD7 A;  5K36 H;  2MGS A;  1Y14 B;  4PNY A;  3NK9 A;  4PV1 C;  1VQK A;  1U4R A;  3AFQ A;  3L7Z C;  1YNN C;  2PNH A;  3S24 A;  3EFX D;  3TME A;  4L5R C;  1UE5 A;  3I4N H;  4A3D G;  1S5F D;  5FLX L;  3U50 C;  2ALY B;  4ALP A;  2NVT B;  1SNP A;  1WJJ A;  4AYB G;  4X66 Q;  2PPB C;  3M4O H;  3J80 i;  1G8Z D;  4GLX A;  2I5H A;  4BBS G;  2L15 A;  4CDF C;  1IBL L;  1EQV A;  2MNA A;  5ELC A;  1ROD A;  1XX8 A;  5JOB A;  2EJM A;  2KED A;  4HCE A;  5IGD A;  1XNR L;  4DK1 A;  1GUT A;  2R7Z B;  2LFN A;  2X6G A;  1QVF A;  4LAA A;  3PO3 H;  1GO3 E; 
#chains in the Genus database with same CATH homology
 2ZXO A;  1SYF A;  2F3V A;  3D3R A;  3S16 B;  1PFN A;  3D8G A;  1JB3 A;  3HRZ C;  4H7B A;  3VA5 A;  5J1Z A;  1Q1E A;  4GZY C;  1I4R A;  1Q1B A;  2DY7 A;  4NKL A;  2QEJ C;  2J7Z A;  3HEJ A;  3OWE B;  3I4M B;  2R93 B;  3HOZ B;  4K2K A;  1JWM D;  2K5W A;  2YU9 B;  3NBI A;  1S5E D;  3A54 A;  2H1E A;  4CBV A;  4G7Z C;  4KHV A;  2I46 A;  4DXF A;  1EL0 A;  4KMU C;  2C9O A;  5CV5 A;  2KA7 A;  1HA5 A;  1H9M A;  5IOC A;  1RD9 D;  4K5X A;  5C0X I;  3DWQ A;  4ZKB B;  4KJO A;  1JOQ A;  2L5T A;  2RSN A;  5CR3 A;  2V4D A;  3HS0 C;  2B63 B;  3MWY W;  4HSP A;  3IAY A;  1CK1 A;  2Q8R E;  1D1K A;  1F2M A;  1BUV T;  4L6T B;  1TWF B;  4NW2 A;  4EVO A;  4F8M A;  3MXG A;  3P1H A;  3PO2 B;  1FGB D;  2MP1 A;  1L0Y B;  5C4X B;  3K57 A;  1JE4 A;  1QB5 D;  1I6H B;  4DNR B;  4KV6 A;  3KUP A;  5KYI A;  1KDB A;  2K6A A;  1PRT B;  4KKU A;  2PCF B;  2A73 B;  4DAV A;  2HCI A;  3MZ5 A;  1RF2 D;  3TP7 A;  3VYS A;  5KNB A;  5E3F A;  3C46 A;  2KOL A;  2AUK A;  3NE5 B;  1EY0 A;  1D5Z C;  5LL6 X;  3PUX A;  1TWG B;  1EU4 A;  5K36 G;  1D5M C;  2SDF A;  4IUV A;  2CW0 C;  5A2Q L;  1OO9 B;  1TS3 A;  3T4A C;  1TWC B;  2CQA A;  5C44 B;  3FVQ A;  1A2U A;  1JCK B;  4J1M A;  2F0N A;  1GHK A;  1A6X A;  3C1E A;  1G2T A;  3DMU A;  1XXG A;  3UI2 A;  1KLG D;  1W6J A;  4I65 A;  5LHY 1;  3A8I E;  3OMC A;  2B2W A;  2XIW A;  4TRD A;  1O7L A;  1KDC A;  1ENA A;  2F0I A;  2RSO A;  1F9S A;  3SVM A;  1YNJ D;  3GTQ B;  1SYC A;  2EYJ A;  2G9D A;  1FR3 A;  3HOX B;  5CBE E;  2D2C C;  1B1Z A;  2WAQ B;  3OPO A;  1VCI A;  1GUG A;  3OWF A;  2F0J A;  2B2Y A;  2NVX B;  1QNK A;  2NB0 A;  2OT2 A;  2IX3 A;  3K5M A;  3P20 A;  1GJX A;  1U4P A;  1BOS A;  5I9P A;  1SNM A;  1F9Q A;  1SMY D;  3J80 E;  3Q24 A;  2NN6 G;  3E6Z X;  2IWH A;  5JAV A;  1NSN S;  5CBA E;  1CQV A;  3S1N B;  4ILW A;  4NP5 A;  5ELE A;  3CRL C;  2F0E A;  4ODG A;  2KCC A;  5IT9 E;  1E2W A;  3I3C A;  1D1I A;  2QIL A;  1F9R A;  4HMI A;  1XYI A;  1CTM A;  3BDL A;  3R8B A;  4MN3 A;  4CKB A;  3O13 A;  3A56 A;  1BF4 A;  4DXG A;  3V05 A;  3SXH A;  1STH A;  3EA6 A;  3PUV A;  1SE2 A;  3D6W A;  1SJH D;  4N9T A;  2F0O A;  2A6H D;  5C0X H;  1XTC D;  1SE4 A;  1WTX A;  2RDF A;  3G7L A;  2EY2 A;  3H94 A;  1HTP A;  1EY4 A;  2WKD A;  2K05 A;  1HQR D;  2ID0 A;  1BCP B;  1ZEQ X;  4H0L C;  4QUF A;  4IN3 A;  4XTC S;  5EPJ A;  3GTG B;  1E2Z A;  2JSO A;  5EKL A;  1Q8I A;  2NYZ D;  4JBW A;  1W6K A;  2KVM A;  5FKA C;  1B2T A;  1STY A;  4BA1 I;  2ICI A;  4J8Q A;  1H9S B;  1BXT A;  2B8G A;  1VF5 C;  1JOO A;  3OSO A;  1HUN A;  3HOY B;  4BWG B;  1B53 A;  5KRU A;  4RH6 A;  1UUP A;  4RGT A;  4RCO A;  2NN6 I;  5KYL A;  2HUG A;  1H9J A;  2AWO A;  2L9H A;  2F03 A;  3BDC A;  3TZU A;  2B8F A;  1V1P B;  1CT1 D;  1X3P A;  3PUW A;  4ABN A;  3KK7 A;  3E5S A;  4OO1 I;  3TN2 A;  2B2T C;  2SEB D;  2QF7 A;  3QOJ A;  1FD7 D;  4TQU S;  1Z6H A;  1PLF A;  2EJF C;  5IIF A;  4U67 3;  3P75 A;  1SJE D;  2M2L A;  5CV9 A;  2Z4I A;  4BBR B;  4KI0 A;  2Q8I B;  4IUP A;  2SNM A;  1PRT F;  4EQP A;  2YYZ A;  1TY2 A;  4RFB A;  4O42 A;  1Y8O B;  1CHP D;  1TU2 B;  1LTB D;  1RDP D;  1Q90 A;  2PZU A;  4K8I A;  1EIG A;  2EDG A;  3DUZ A;  4N9P A;  3DEO A;  3KLS A;  4DF7 A;  1SMY C;  4Z9C B;  4FNF A;  1HTL D;  3PMF A;  4C1N K;  1EYC A;  3J81 L;  1EQT A;  3M4Y A;  3BVM A;  2MHV A;  1EY6 A;  5KIX A;  1ZXT A;  2EY6 A;  2HQE A;  4QF4 A;  2AUJ D;  2NVQ B;  2B2V A;  1GXD C;  2JA6 B;  2R92 B;  3M7N A;  3KF8 A;  3EJI A;  1PFB A;  2JEB I;  4FF2 A;  3NQT A;  3WDN A;  1F2Y A;  1BBX C;  3CRK C;  1OXX K;  1TWA B;  1DON A;  2CHB D;  2RQX A;  4X3K A;  4U68 A;  5EBD A;  2LMC B;  1B50 A;  3BYT B;  4C56 C;  5EJW A;  3X3N A;  3NBH A;  2A6H C;  2TMP A;  2PZT A;  1STG A;  5C4Z A;  2XRQ D;  3K59 A;  4KN7 C;  3J7Y W;  2MJ8 A;  2F0S A;  4J6H A;  3HOW B;  2F0T A;  1SAP A;  1X3Q A;  2F0W A;  1XWE A;  2RVL A;  1VMC A;  3I73 A;  1AFP A;  1Q3L A;  5EPK A;  3SK6 A;  1Z47 A;  2WIN B;  4QUC A;  1KNA A;  3ITP A;  4HTH A;  2CVR A;  1R9T B;  1CA6 A;  3LWE A;  5CC4 A;  3DM1 A;  5AFW A;  4G7O C;  1LT6 D;  3MFY A;  1PFM A;  5CYU A;  2JA5 B;  5CV4 A;  1JQY D;  4V0B A;  2B2U C;  3NP8 A;  1JWU D;  4CHT B;  2WB1 B;  5IGB A;  5E4W C;  2M9V A;  3S15 B;  4K5V A;  3U9O A;  3C2P A;  1IL8 A;  2DNC A;  2EVB A;  1H9R A;  2X6L A;  1EY7 A;  1I4H A;  1MI2 A;  1BR9 A;  3QIA A;  1H9K A;  1CI3 M;  2IJ0 A;  3BYY B;  3MFG A;  4XQQ A;  1KTK A;  2IL8 A;  3BVZ A;  3S9W A;  2KHS A;  1E2V A;  2NN6 H;  1HXY D;  3AB9 A;  1BCP F;  1R4P B;  1LAB A;  4UAI A;  4F7X A;  1F77 A;  5C3W A;  1SYD A;  1PRT D;  3GP7 A;  4K2L A;  4ME5 A;  4OO1 H;  3NQI A;  3IFT A;  5KEE A;  1LTR D;  2E75 C;  3T13 A;  1LTA D;  4H13 C;  4M8A A;  2WII B;  5FK9 C;  4A3I B;  2WKC A;  1O7Z A;  4Y7N B;  5E1F A;  2EE1 A;  4WOR A;  1LTT D;  3Q6S A;  2QCP X;  1A3T A;  3GV6 A;  1KLU D;  4V19 0;  2AQ1 B;  3PIO 3;  3TBI B;  1B44 D;  4HCS A;  2N55 A;  4X3U A;  5FOB B;  1V1O A;  1WCM B;  3L9A X;  4X3S A;  1CZW A;  5I6Y A;  1AW7 A;  4EQN A;  5A2Q E;  3GO5 A;  3VR6 A;  1SNO A;  4Q5V A;  1S5D D;  1TY0 A;  2E2D C;  3RUZ A;  1RKN A;  3FDT A;  1AN8 A;  1GOZ A;  4NMZ A;  1SYB A;  1ESR A;  4IQZ A;  2K03 A;  3D6C A;  3SK5 A;  1VDZ A;  4RKB A;  2EYO A;  1V43 A;  2L4N A;  2NWG A;  4B08 A;  1Y8P B;  4O1N A;  1Y69 U;  3TZD A;  2A74 C;  4WJW A;  3I8Z A;  5EGT A;  2F0F A;  4G4K A;  4KN4 C;  4CGY B;  3QWN A;  4B9W A;  1SYG A;  4CJ1 B;  2NVY B;  4KHZ A;  4YIJ A;  4Q0F A;  3I4L A;  1X32 A;  1SND A;  3BG3 A;  4QB4 A;  1WVL A;  1MSG A;  1DOL A;  1QE6 A;  4C1N I;  5M9O A;  1OXU A;  5JJZ A;  1HFG A;  1JWS D;  5BN5 A;  5A35 A;  1C4Q A;  5C6A A;  5TSS A;  4P2C B;  4RGM A;  2H4O A;  1ZKO A;  1CZG A;  3OW7 A;  3Q0A A;  1FNW A;  4HR7 B;  3A8K E;  2B39 A;  4A3M B;  2FJ2 A;  2VXW A;  2TSS A;  3OMG A;  2EYM A;  1A2T A;  1PZK D;  2HDM A;  1EEF D;  3F2U A;  5FO9 B;  5DM6 3;  1EZ8 A;  5DEH A;  2GA4 B;  3I70 A;  3GV3 A;  1PTO B;  2IT1 A;  3J7A F;  5T1G A;  2J4X A;  3URY A;  2K04 A;  3W2D A;  1JOR A;  3JAM E;  4HAE A;  1F2Z A;  2AQ3 B;  1LAC A;  2JEA I;  5M5X B;  2E76 C;  4FXG C;  1OXS C;  1ICW A;  4A3E B;  2XN9 C;  3NXW A;  1K83 B;  1SFO B;  3S17 B;  1Y1W B;  4R8N A;  5IGF A;  1BCP D;  2OF1 A;  1UAP A;  2PNR C;  4OO1 G;  1OXT A;  5D3D A;  2F0L A;  3FRP B;  3VYR A;  4PMC A;  5G3L F;  3DWP A;  2DN8 A;  4XXE A;  2F0K A;  5HGT A;  4BS9 A;  2EYL A;  1NR4 A;  4EQO A;  3S1R B;  1PRT C;  2NUC A;  4A3G B;  5ISR A;  2BA0 A;  1PYW D;  2WP8 J;  2NBF A;  3HOV B;  1BO0 A;  1PTO H;  5CV8 A;  1IYV A;  3VR5 A;  1LO5 D;  3IFD A;  1B4O A;  2PO4 A;  1CHQ D;  2A69 D;  5M5Y B;  1BDO A;  3QO2 A;  1AZP A;  1WTP A;  4G57 A;  4TKO B;  5IT9 L;  3M85 A;  5JVH 3;  4A3B B;  3CKI B;  2E74 C;  4C3J G;  2KEC A;  1EEI D;  3H91 A;  2XVS A;  2B2T A;  2F3W A;  4BA2 I;  2E2I B;  1TKW B;  1SSO A;  2F0Q A;  1R4Q B;  4OHJ A;  3OIP A;  2RDG A;  4FF3 A;  3RD4 A;  4E6I A;  5C3E B;  3VR3 A;  2PMZ B;  3RMH A;  1QG7 A;  1B9M A;  4K6D A;  2IX0 A;  4OGQ C;  3KBG A;  3Q23 A;  2EY5 A;  5J22 A;  1G91 A;  4IZ8 A;  2AQ2 B;  2RBM A;  3PV0 A;  2FHT A;  1O80 A;  1V8Q A;  3E0J A;  5COR A;  2E2J B;  2JXM B;  2ZT9 C;  3NTI A;  2M00 A;  1QJO A;  1D6E C;  3MXU A;  3V2T A;  3T53 B;  5FO7 B;  2R6G A;  2IW3 A;  1I50 B;  1TVX A;  5CGK A;  1PZI D;  1MGS A;  1HUM A;  3BVG A;  1NR2 A;  4LMQ D;  3RZD B;  1TII D;  1LTG D;  1LTS D;  4RA8 A;  2O5I C;  4RHS A;  5E4X A;  1EOT A;  2PW7 A;  3EVQ A;  4C2M B;  1U4L A;  3I72 A;  4R8I A;  1II3 A;  2BE5 D;  1YNJ C;  3VYU A;  1STB A;  5I2Y A;  4K14 A;  3MHB A;  2J0T D;  5IGE A;  5ELB A;  4K8J A;  5M3F B;  1EWH A;  1ENF A;  2F0P A;  4KTA A;  4ZKC B;  4A3K B;  3RLF A;  1E0B A;  3VR4 A;  4LJZ C;  2SNS A;  5ELD A;  3SDZ A;  2PQE A;  4FXK C;  3D4W A;  4FO2 A;  5I6W A;  4BY1 B;  1RJT A;  3PIP 3;  2R61 A;  1Q12 A;  3GTK B;  1ET9 A;  1KNE A;  1IKL A;  1IHZ A;  5I9O A;  2PW5 A;  1U9R A;  2F0D A;  3GTL B;  3NUC A;  3ERO A;  3T16 A;  2L1B A;  4K5W A;  1ONL A;  1WTV A;  1IKM A;  4KK7 A;  4KJN A;  1TS4 A;  5JPN C;  1O78 A;  3H3V C;  1BCP C;  2LKV A;  2K33 A;  4CJ2 C;  3C3L A;  1WTQ A;  1LTI D;  2R3Z A;  1CFM A;  5J39 A;  3GTO B;  1LT4 D;  3A7A B;  1WTW A;  1JIC A;  2RDH A;  1HFN A;  5LL6 S;  2WV6 D;  4IUT A;  1NAP A;  1LT3 D;  2Z8L A;  1DZ1 A;  3MTS A;  5FLX E;  1HRJ A;  3C1F A;  2JA8 B;  1RTO A;  1DM0 B;  5IGG A;  1VF7 A;  1G29 1;  3R93 A;  1EWC A;  1PTO F;  4XYQ A;  2A69 C;  4MHE A;  3M3Y B;  2SOB A;  3VR2 A;  4OIJ A;  2NTS A;  3QG1 A;  2K28 A;  3R2T A;  3IKJ A;  4KY7 A;  4QCL A;  2Z1C A;  1T5X D;  4F87 A;  4FF1 A;  5DNF A;  1PZJ D;  1SYE A;  2XWJ B;  2HDL A;  5EKK A;  1RTN A;  3NHH A;  3VA7 A;  1JC7 A;  3MXN A;  2XSC A;  3S2D B;  2QDB A;  2K5Q A;  2NZ1 D;  1LV9 A;  2XRS D;  1AEX A;  4IUU A;  3FPP A;  4KD3 A;  2F1M A;  3KLR A;  1LT5 D;  3I90 A;  2B2V C;  1L0X B;  4LK1 C;  2MPM A;  4XIG S;  1EY9 A;  1HCZ A;  3EQL C;  5CMD A;  5DAU A;  3KLS X;  1PDQ A;  3DXJ C;  5JEA H;  3GQB A;  1FNU A;  4RGO S;  4QIW B;  4H44 C;  4S3S A;  2L12 A;  3DEP A;  1NCV A;  3OHX C;  1DYQ A;  4CKE A;  4RAU C;  4RGN A;  5JVG 3;  1DCZ A;  3ND9 A;  4XQN A;  1DD2 A;  3J7A V;  3CHB D;  1D5X C;  2VB3 X;  2HCC A;  3GTP B;  3L3O C;  1KAB A;  5NUC A;  2A68 D;  4WRD A;  3D31 A;  3TP5 A;  2A5H A;  1ZYR D;  1NUC A;  1AZQ A;  4C3J B;  1DOK A;  3AMU A;  2EYP A;  4KKS A;  1TR5 A;  3BDO A;  4DFA A;  4KKT A;  4R9W A;  3V96 A;  2BE5 C;  2EXZ A;  1QWY A;  4IFD I;  4QMG A;  1EY5 A;  3NWT A;  2F0M A;  3SEB A;  4HMJ A;  1EIH A;  2ZXR A;  3IL8 A;  3ZYY X;  4DA2 A;  1DJR D;  4PQX A;  1A3U A;  3I91 A;  5KGU A;  3BZD B;  4ZLT F;  5C5L A;  3PUY A;  4IAL A;  1WD0 A;  5JPM C;  3N6R A;  3H09 A;  5M5W B;  2EZV A;  4HED A;  2ENB A;  5EBC A;  1S5C D;  1CQF A;  4DU9 A;  5DM7 3;  4XYO A;  2KCN A;  3HKZ B;  1J9O A;  2IPK D;  3S1Q B;  4OIK A;  2I07 B;  4FP5 D;  5FO8 B;  4FF4 A;  2IX1 A;  1G6Z A;  1A15 A;  2RKS A;  2FMC A;  3CQZ B;  1S4Z A;  4ZQ3 A;  4ZUI A;  5JEA J;  1SE3 A;  3HGB A;  1BQQ T;  4RCN A;  4RKL A;  2O4X A;  4XDX A;  3K58 A;  2EYF A;  4IUQ A;  2K7V A;  1I4Q A;  1EZ6 A;  1PXU A;  3K5O A;  3D4D A;  1CM9 A;  3LWU A;  1MBY A;  3H0G B;  3R3O A;  1WTR A;  1K8O A;  3A8J E;  1STA A;  1TQO A;  1DXM A;  4A3F B;  3TDQ A;  1PTO D;  4C3H B;  1M4V A;  1QNU A;  4RHR A;  3LNN A;  5D3I B;  3WOE A;  4ID6 A;  2E2H B;  5BN3 A;  2L11 A;  1EU3 A;  1OXV A;  1O7Y A;  3P7J A;  3MA2 B;  1B3A A;  2A6E D;  4XQJ A;  4CKC A;  4CJ0 B;  3FPU B;  3R2I A;  5IGC A;  4IUN A;  1JOK A;  1RCV D;  2LS0 1;  4G7H C;  2D62 A;  4C3I B;  3RZO B;  4L8J A;  5EQ0 A;  2BDN A;  1IW7 D;  4DK0 A;  4X3T A;  5C4J B;  1HHV A;  3NTH A;  3G6J B;  5EKI A;  5JEA G;  5M3M B;  2N88 A;  3K6O A;  3SK4 A;  4ULL A;  2Z4H A;  1EFI D;  3LX0 A;  2LY7 A;  5CV7 A;  3ND8 A;  5K5P A;  4KD4 A;  3GTJ B;  2VUM B;  1I4P A;  2EY1 A;  3WOF A;  2WAC A;  1EYA A;  1STE A;  5C3X A;  2FFK B;  1BNZ A;  2O2L D;  3MEH A;  2EYH A;  2KEE A;  2JYO A;  5D65 A;  2K5D A;  1G2S A;  2A68 C;  4KY5 A;  1HQM C;  1Y1V B;  5F2D A;  1ZYR C;  2PYK A;  4ZYS A;  3NSW A;  1CA5 A;  3CU7 A;  3MXP A;  1MSH A;  2B2W C;  4XT1 B;  2F0G A;  3D4R A;  5I4D A;  1HA6 A;  3MC0 B;  4DN4 M;  3K5N A;  1T5E A;  2BA1 A;  3JAM L;  4WFN 3;  3DHQ A;  1K8M A;  3DWA A;  4NDX A;  1TS5 A;  4FYD A;  5T1I A;  4A3D B;  3J80 L;  2F4I A;  2JA7 B;  3W3A A;  2L55 A;  4ZK9 B;  1HPC A;  2C5C A;  1C8C A;  4AYB B;  1F2L A;  1TWH B;  4PMB A;  1TS2 A;  1SEB D;  3HG9 A;  1GHJ A;  4BBS B;  4IFD H;  3K7A B;  4OL7 A;  3KBX A;  3QB3 A;  1KDA A;  1M8A A;  2B2Y C;  2FIN B;  1QIL A;  2KUM A;  3FEW X;  3Q22 A;  1SDF A;  2KJX A;  1STN A;  3A7L A;  1UEA B;  4TSS A;  3T51 B;  1YNN D;  2OEO A;  1JR0 D;  3HOU B;  2RA4 A;  2ICE C;  3SE0 A;  4K6L A;  5KND A;  1F9P A;  1SNC A;  2K1B A;  2KQ3 A;  1Z7T A;  4FXD A;  4HN7 A;  4F88 A;  2EOT A;  1RHP A;  3BS1 A;  4B9X A;  1ENC A;  3OIQ A;  4DNT B;  1QOH A;  2OXP A;  1PTO C;  1DOM A;  2G9H D;  4KY6 A;  5IOD A;  5EPL A;  1GUN A;  4UDU C;  1TT2 A;  3ERQ A;  2AWN A;  2BOS A;  2JE6 I;  2X69 A;  4JK1 C;  2F0U A;  2D9U A;  2A6E C;  2F0H A;  3TP8 A;  3K5L A;  4HSV A;  3S14 B;  4A93 B;  1MD2 D;  1IYU A;  4M1U B;  1U4M A;  3MVV A;  4FVM A;  3OOC A;  1EYD A;  2K01 A;  4ZRZ A;  4IFD J;  4EGV A;  3ONA B;  4DAY A;  1IW7 C;  2BDO A;  2Q8T A;  4C3H G;  1I4X A;  3HP3 A;  5C0X J;  3AU7 A;  1J8I A;  2VNU D;  1H9S A;  3J81 E;  4I7Z C;  1I4G A;  2XNA C;  3SHL A;  5HUR A;  1A3V A;  5ELF A;  1GUS A;  1GUW A;  2F0V A;  2MUY A;  1FYC A;  1UNS A;  1PMR A;  3QOL A;  4XT3 B;  2D5D A;  3MAQ A;  1ET6 A;  4C3I G;  1SBB B;  3TSS A;  1EY8 A;  1SXT A;  3NPP A;  3K0Y A;  2DY8 A;  2VB2 X;  3S2H B;  4BY7 B;  2L0C A;  1V1P A;  5KNC A;  1KAA A;  1ILQ A;  2O5J C;  2BCO A;  5G3L D;  4MIU A;  3NTK A;  1AP0 A;  1FNV A;  3FMC A;  2Y0S B;  3SK8 A;  5CV6 A;  3I4N B;  3X3M A;  3VYT A;  1ML0 D;  2ZXP A;  2EJG C;  3N52 A;  2DNE A;  4ZAI A;  3M4O B;  1S5B D;  2FMM A;  5BN4 A;  1SNQ A;  4IFD G;  1C48 A;  1ESF A;  3H6M A;  3TP6 A;  2EPB A;  1WD1 A;  1QCB D;  1GUO A;  2B2U A;  3PO3 B;  1I6V C;  1LLR D;  4A3J B;  1WTO A;  5C0X G;  1B9N A;  3U9S A;  3A55 A;  1I3Q B;  2PZW A;  3SR1 A;  4ZUJ A;  1ILP A;  2CW0 D;  4IUR A;  2QKI C;  4DGZ A;  5C4H A;  5COY A;  2K32 A;  2NTT A;  1VMP A;  3FKI B;  3QJY A;  3NWS A;  3GTM B;  3M7G A;  4PMW A;  5I2X A;  2XWB B;  3HZX A;  3T56 B;  1D2B A;  5D14 A;  4RWS C;  3S1M B;  1Y8N B;  5C5M A;  2JP1 A;  4DAP A;  3PUZ A;  4L63 B;  3GD7 A;  5K36 H;  2MGS A;  4PNY A;  3NK9 A;  4PV1 C;  1U4R A;  3L7Z C;  1YNN C;  3EFX D;  3TME A;  1S5F D;  5FLX L;  2NVT B;  1SNP A;  2PPB C;  1G8Z D;  1EQV A;  5ELC A;  1ROD A;  1XX8 A;  5JOB A;  2EJM A;  2KED A;  4HCE A;  5IGD A;  4DK1 A;  1GUT A;  2R7Z B;  2LFN A;  2X6G A;  4LAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...