4KY7A

Crystal structure of staphylococcal nuclease variant delta+phs v74d at cryogenic temperature
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
132
structure length
132
Chain Sequence
KKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEDEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V74D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 132
sequence length 132
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky7A00
2OXPA 1EYDA 2LKVA 2EYOA 3VA5A 1STBA 4N9PA 3H6MA 3C1FA 5F2DA 2SNSA 3S9WA 2SOBA 4F8MA 3SXHA 1EY6A 1SNCA 4F7XA 1SNQA 2SNMA 1KDAA 2PW5A 3OSOA 5CV5A 1EY5A 4QF4A 2OEOA 3QOJA 2F0MA 1EY8A 2EYLA 4HTHA 4IALA 4EQPA 2EXZA 5E1FA 2EYPA 5C5LA 1A2TA 3TP6A 4OL7A 1A3VA 5KEEA 5K5PA 3R3OA 1F2MA 2PZTA 4ODGA 3BDLA 4HMIA 2RKSA 2F0SA 5JOBA 3V2TA 4EQOA 2F0OA 4NDXA 3QB3A 4DFAA 3U9OA 5EKKA 3E5SA 4KJOA 4QB4A 4K8IA 5IIFA 1EZ8A 5KYLA 5ISRA 4K5VA 2O4XA 5C5MA 5CV6A 2M00A 5HGTA 1KAAA 1EY9A 2F0UA 1EZ6A 4YIJA 3SK4A 1TT2A 1NUCA 4K2KA 4KY6A 3BDCA 4EQNA 2F0JA 2F0TA 3NQTA 2PQEA 3TP7A 5C3XA 5C6AA 1JOQA 2EYHA 2F0PA 5I9PA 2F0VA 3SK6A 1JOKA 4N9TA 1SYCA 4B9XA 5I6YA 3MVVA 5IODA 3T13A 3ITPA 5EKLA 2EY1A 4RKLA 3ERQA 2F0QA 4NMZA 4S3SA 2RDFA 4B9WA 5CV8A 2EYJA 1JORA 4KV6A 1A3TA 1AEXA 3NUCA 2ENBA 4KD4A 3QOLA 3SHLA 5J39A 5C4HA 4WRDA 5EGTA 2F0HA 5DAUA 4ID6A 5I6WA 4ME5A 1NSNS 2NUCA 1ENAA 4G57A 1ENCA 4J1MA 5HURA 5IGGA 3NK9A 3SK8A 5CV4A 3TP8A 1KDBA 5C3WA 3EVQA 1EY0A 3P1HA 4PMCA 5CR3A 5CGKA 2EY2A 1SYEA 1SYBA 5C4ZA 5IOCA 1SYFA 1STYA 3MEHA 4K5XA 3TMEA 1A3UA 3LX0A 2EYMA 3MZ5A 4KD3A 4KY5A 2KHSA 2WACA 3NP8A 3D8GA 5J1ZA 2OF1A 4R8NA 5KIXA 1EY7A 2F3WA 1TQOA 3C1EA 4PMBA 4IUNA 2F0FA 2F3VA 4KJNA 2PYKA 4KY7A 4NP5A 2HQEA 2F0WA 3HZXA 5DEHA 2F0GA 4J6HA 3NHHA 1SNMA 2F0EA 4MIUA 4ZQ3A 1II3A 3DHQA 4RKBA 1F2ZA 1KDCA 5CV7A 4H7BA 3D6CA 1A2UA 3D4DA 4DU9A 4EVOA 5M9OA 4K14A 1JOOA 4ZUIA 3TP5A 1U9RA 5I9OA 1STGA 3SK5A 1SYGA 1SYDA 3OMGA 4K5WA 4HMJA 3MXPA 3P75A 4K2LA 5IGDA 5JAVA 1RKNA 1STNA 3EJIA 4DGZA 3NXWA 1STAA 4ZUJA 4LAAA 4KTAA 4TRDA 2QDBA 3DMUA 1STHA 5J22A 5NUCA 1EQVA 2EY6A 2F0KA 3EROA 3OWFA 3RUZA 4QMGA 2F0IA 2PZWA 3D4WA 5IGFA 3T16A 1TR5A 2F0NA 4KHVA 4NKLA 5IGBA 5KRUA 1SNPA 2RBMA 2PZUA 4K6DA 5CC4A 4IZ8A 1F2YA 1IHZA 1EY4A 1SNDA 5KYIA 1SNOA 3PMFA 3SR1A 4DF7A 2PW7A 1EYCA 3MHBA 4I65A 1EYAA 4WORA 2EYFA 2KQ3A 5CV9A 5E3FA 4PNYA 4E6IA 5IGCA 2F0DA 3OMCA 5IGEA 2EY5A 1KABA 2F0LA 4K8JA 5KGUA 3HEJA
chains in the Genus database with same CATH superfamily
4GN5A 1STBA 1C7YA 1JE5A 2PPBC 4JCVE 1XYIA 1WTQA 4XDXA 4GKJQ 2PW5A 4JBJA 4R4CA 4DAYA 2F0MA 2EYLA 3A8IE 2Q2TA 2NVYB 3J80c 2E2IH 4DR1L 5I2XA 5T1IA 4CHTB 3M7GA 3DUZA 3R3OA 4ILWA 3S2HB 3KLSA 2F4VQ 2QGQA 4A3JB 4NW2A 1YITA 2F0OA 3FRPB 4DFAA 3RZOB 1EIYB 4JI3Q 3K80C 1HPCA 2WV6D 1TT2A 5CORA 5IWAQ 4JBMA 1D2BA 1U0LA 2YTVA 4JI1Q 4EQNA 3QJYA 5C3XA 2VQEQ 2KENA 1TU2B 3GTMH 3HS0C 1VQ6A 2HUGA 2R7ZB 2F0VA 4QQBX 1WD0A 2LXKA 4XT1B 5IODA 3BDOA 3M4OB 1MKHA 5FK9C 4GZYC 3DWQA 3KK7A 3GP7A 2K01A 1QUQA 3SHLA 3ONAB 3V05A 1Y8NB 1Y1VH 5EGTA 4OIKA 4LFCQ 2D2CC 3H0GG 1CKOA 5IGGA 1M1KC 1A6XA 1EFWA 4IPGA 4OIJA 1SMXA 3TZDA 4R1JA 2EZVA 4FXGC 1GUGA 3HOYB 1M4VA 5G3LD 2ID0A 5M5XH 5C4JH 1LTSD 2R7DA 1TQOA 1X32A 2K5VA 2F0FA 1Q81C 3I72A 1VQKA 2JN4A 2MJ8A 1H9JA 2XNAC 1PLFA 1K9MC 2ZJRA 1NAPA 3M4PA 5FO7B 4UAIA 1W6KA 3DWAA 5E4XA 2NZHA 1CZWA 4X65Q 5I2YA 4X3SA 3WWVA 5IGDA 3HKZG 4QUCA 1RKNA 1ET9A 3EJIA 3D3RA 3NXWA 5TSSA 1BQQT 3HOWH 1QCBD 3H09A 3PO2G 4QCLA 3KYHC 4HJ7A 1AE2A 4GOPB 4X3TA 2UXBQ 3IFDA 1SBBB 1MD2D 1U4PA 1X3PA 3I90A 2IHEA 1ASZA 1IHZA 1VQDA 3ND9A 1Q82C 3SR1A 4HJAA 1JQYD 4HIDA 4PNYA 3G6EA 3UDIA 5IGEA 5M5YH 2Q8RE 1GOZA 5C44H 1KQSA 1F9PA 4IUVA 3DWPA 1KLGD 1HA5A 2OEOA 3A8KE 4C2MH 1EL0A 1HCZA 2X6GA 2I46A 1DOKA 2E8GA 3RD4A 1DM0B 3NTHA 1TWCB 1ZXTA 5IYDH 1LT5D 1BCPC 2Z4HA 1DZ1A 1KLUD 1HRJA 1VQIA 1H9RA 1Q90A 2HDLA 2ICIA 2IJ0A 4A76A 2VB3X 2RKSA 2NN6H 1AP0A 5GAEC 1ILQA 1EZ8A 1WI5A 4KKUA 1HNXQ 3FKIB 1KRSA 1NUCA 2KCCA 1LTBD 4HSVA 2VUMH 3VA7A 3F2UA 1QZGA 2RQXA 1WTRA 1OTCA 2DJGC 3A8JE 2EYJA 1JORA 2Z4IA 1X6OA 2JK8A 2MPMA 2UU9Q 1GUNA 1PH4A 4R8IA 2C5CA 3BJUA 2XWJB 3NENA 1CQFA 3MXNB 1I6HB 2JA7H 5CR3A 1VQ4A 3I2ZA 1EOTA 1QILA 4KD3A 2KHSA 5J1ZA 2JA6B 3PIO3 3E9IA 4LFBL 4KY7A 2K28A 4J6HA 1PTOD 2NB0A 3A5ZB 4A93B 2Z1CA 4GNXA 5CV7A 1F2ZA 1F9RA 3D6CA 4JOIA 3CC7A 2KBNA 1SMYC 1Y1VG 4K6LA 3CF5A 3SK5A 4K5WA 3UDGA 4K2LA 2A6EC 2WAQG 1UNSA 3NBIA 2J0TD 1I4HA 4ZYSA 4KN4C 4LUZA 2MNAA 1ICFB 2IX1A 3A7AB 4IPCA 1XWEA 5EAYA 4XIGS 4LMQD 1V1PA 1Y14B 2DY7A 4DUZQ 3H3VC 2A68C 4C1NK 4DR5L 2XRQD 1Z7TA 1VMPA 5BN5A 2ASBA 1HTLD 2EY5A 1KABA 2R61A 4RH6A 1Q7YC 2EOTA 1E0BA 4DV6Q 3ER0A 1WJJA 3HOWG 4OWWB 2SNMA 4UP7A 1KRTA 1V43A 2QEXA 1EYGA 3H91A 3KF8A 4LF5Q 4TKOB 5FLXE 1SXTA 3NWSA 1F2LA 4JYAL 1RF2D 5C5LA 4AQYL 4ZLTF 1XMQL 3KBGA 1E1TA 2Z6BA 1F2MA 2PZTA 4ODGA 2JQOA 2F0SA 3OTOQ 2B2YC 4IOAA 4POFA 1KAWA 1OXTA 2B39A 1TY0A 3BVGA 3T1HL 5C44G 3S14B 4DNTB 1YHQA 5I9PA 1I3QB 1SYCA 1VQPA 1UE1A 1PZID 1SE4A 3AQQA 5EKLA 4B3RL 1IYJB 4CDFC 3OW2A 5IYDG 3NUCA 3W3AA 5C3EB 3LNNA 1X56A 3IAYA 5CMDA 1VQ5A 2NN6G 1ENAA 4J1MA 5LMNW 4U673 4YWMA 1QNKA 4BY1H 3P1HA 1ESFA 3C2PA 1STYA 3TMEA 3LX0A 5FLXc 4KY5A 1YJ9A 2VUMG 2IY5B 3RMHA 1IXRA 2PYKA 2F1MA 4NP5A 2RA4A 2F0GA 3NHHA 4ZQ3A 1LTTD 5FLMH 1CA6A 2YU9H 4DU9A 5CBAE 2B2WA 1DGSA 3F2DA 1SYGA 3JAMi 4G7HC 4XYOA 1STAA 4CKCA 4JV5Q 4NXNQ 2QDBA 4JBWA 2Z6KC 5EPLA 2FINB 2E74C 2MO0A 1M8AA 3OWFA 3KBXA 4R9WA 3H94A 2HHHQ 1QB5D 5G3LF 5DLQE 2TMPA 1F2YA 1EUJA 4A4IA 1I5FA 1IKLA 4C3IH 3T56B 1XX8A 4CGYB 2F0DA 5A2QE 3HGBA 1FR3A 1TWFH 4IN3A 4X66Q 5D65A 2A8VA 1XNRQ 2A74C 4CKEA 4GKKL 3R2IA 4HTHA 1HR0W 2NN6I 4AYBE 2R7FA 3Q8DA 5K5PA 3DEOA 5I4DA 1YNND 1G291 4HMIA 3UDFA 5IIFA 2O4XA 1YHBA 4CJ2C 2M00A 1L0YB 1Y8OB 2CW0C 1V1QA 3BDCA 1N36L 2PCFB 1C4QA 4LF6L 1JOKA 1SSOA 1BCPB 2NTSA 5IYBH 3T1HQ 3ERQA 5COYA 2CQAA 2RDFA 4JI7Q 2MGSA 5GAHC 5C4HA 4G4KA 2OTLA 2CWPA 1PH6A 2IHFA 1SMYD 1MHWC 3NK9A 2GVAA 3CCLA 2L15A 3I7FA 2WINB 4B3SL 4GS3A 2EY2A 4V0BA 4XQJA 1LTGD 1JWSD 3JC66 2VNUD 1TS2A 1XTDA 4RHRA 1VQJA 4M1UB 2EVBA 2Z9HA 3GTOB 1TY2A 4P72A 5KRUA 3S1NB 4K14A 1Y1WH 1Q1BA 1JJ2A 3M3YB 1N32L 2N88A 3NE5B 2N49A 4MHEA 3EA6A 4ZK9B 3P75A 2N55A 3N52A 1VQ8A 1U5KA 4ZUJA 5IY0A 4BY1G 3TS2A 2E76C 4HIOA 1FD7D 3Q22A 1SFOB 4Y7NB 3D4WA 4NXMQ 5M3MB 4KN7C 5FLMG 2A69C 4JI4L 2Y0SE 3CHBD 1CA5A 3CCUA 1PTOF 5CBEE 2PW7A 2KQ3A 1BBWA 2KJXA 2F0LA 4K8JA 1DOLA 1HJPA 1UEBA 1F9SA 5ELDA 2BDNA 4F7XA 1SNQA 2Q8TA 2L5TA 3VR3A 2NVXB 1B1ZA 3DEPA 4QF4A 3G48A 4C1NI 1PYSB 3CRKC 4DV4L 1CFMA 1AFPA 4DR4Q 1B53A 5JEAJ 3S1RB 1E2ZA 2QA4A 1NBWA 2CHBD 4QL5A 1ESRA 4HEDA 1WCMB 4GKJL 4DKAC 4HAEA 4C3IG 3BS1A 3GQBA 3U9OA 4HJ8A 4DV2Q 3I4OA 4DR7Q 1Z9FA 4DK1A 3J81j 1KAAA 3GV3A 1EU3A 3PUVA 5ELOA 3C3LA 1I6HH 4PG3A 1LTRD 3ERSX 2I0QA 4OWTB 3FEWX 2AWNA 2F4VL 3MA2B 2JA6H 1TWGB 3J7YW 4JI3L 2RCFA 2ENBA 1I4XA 1X65A 5IWAL 3CC2A 2WFWA 2F0HA 4JI1L 2VQEL 5LMUQ 1VQOA 1VQLA 1TWHB 3GTPB 1L1OA 3IKJA 1EY0A 2M9VA 4UP8A 3VYSA 1R4QB 1SYEA 2H5XA 1SYFA 4K5XA 2L9HA 1LT6D 2QKIC 1LUZA 1HHVA 4LFCL 2J7ZA 1GUWA 5KEEA 4JPBW 3G7LA 3KF6A 5A2QL 1SE3A 1S40A 3KDFA 1A2UA 1JOOA 1I4QA 3MC0B 3WOFA 2NVQH 1YNXA 1JT8A 3I70A 2RF4A 3KJPA 3MXPA 3I8ZA 4HR7B 2RDHA 5D3IB 4GNXC 3I4NB 1PH2A 5JPNC 4JOIC 2JEBI 4LAAA 3QIAA 1U4MA 3DMUA 3PUYA 1STHA 1LTID 2NVTB 5AJ3Q 3OPOA 1TS3A 4O1NA 1D5MC 3CCSA 1GM5A 1RDPD 2A6HC 1FL0A 2BCOA 4X65L 2ZM6L 4HIKA 2RVLA 1VDZA 4HJ9A 3RN5A 2WB1G 1SNPA 1E1OA 1MSGA 4DV0Q 2ICEC 4A3EB 4I7ZC 1Y1WG 5EBCA 4L5SA 3Q24A 3GTQH 2UXBL 3NBHB 5KNDA 2TSSA 2RSNA 3NTKA 1IBKQ 4BBSB 2A1AA 1GUSA 2UUBL 1FNUA 1X3QA 2HT1A 3ZJYC 3W1GA 2CW0D 3JAML 3CQZH 4OXPA 3S14H 1VQBA 1EY5A 1SJED 3EBEA 4BBRB 2RDGA 1PTOC 2GA4B 1E24A 3GDEA 3TP6A 3TZUA 2ZJPA 2D5DA 1IBML 4JVZA 1I94Q 4LW1A 4DXGA 5JEAH 2DUDA 3OWEB 1LACA 1BCPF 1EU4A 4C3HB 2NZ1D 1B2TA 1D5ZC 1NE3A 5IYCG 4GLVB 3OIPA 1JOQA 3NQTA 4LFAQ 3U9SA 4OEMB 4ZKCB 4B9XA 4JI0L 4RFBA 4FF1A 3K7UC 4S3SA 4DAYB 4DXFA 2L0CA 1HNXL 2BE5C 4F88A 5JVH3 3I4MH 1PRTC 3J81L 1WTWA 3P7JA 3K5NA 5HURA 3G6JB 2KCMA 3HKSA 3ULPA 1BXTA 1A63A 2AMCB 3PQIA 2IWHA 1CTMA 4YWLA 1JWUD 3HRZC 2VQFQ 1J5EQ 5M3FG 3S2DB 2UU9L 4PMBA 1PH8A 3GTLB 2JA6G 1G6PA 4RA8A 5M9OA 2A69D 1ICWA 4FP5D 1AZQA 1QUQB 4BY7H 4A3CG 1X3GA 2E2JH 1TS5A 1C9OA 2YYZA 3CPWA 2B2WC 2B2VA 2LXJA 1UUPA 4OO1H 4EQ5A 2IW3A 4JK1C 2O2LD 2PO4A 3S15B 5IGFA 1LYLA 2PZWA 1AH9A 4KMUC 1CHQD 2CH4W 3T1YQ 3HOUB 2UXDQ 3PMFA 3UE1A 1A0IA 4P74A 1OXXK 5LL6S 5IGCA 3WDNA 2ZM6Q 4FF2A 3LWUA 1RTNA 2SNSA 1HZ9A 2E2DC 2KEEA 1QZHA 1ET6A 3A5UA 4DUZL 1BBXC 2PI2A 4FO2A 4A3KH 1WTOA 5AFWA 1LTLA 2IPKD 1VMCA 1WTXA 3W5OA 2UUBQ 2XIWA 4DV6L 1CKNA 5LL6X 2VL6A 1A8VA 1P16A 4K8IA 2OQ0A 1E2WA 5KYLA 2R92B 4LF5L 3PO3H 3SK4A 1JB3A 3NSWA 1KIXA 3HOXB 1CQVA 3D4RA 1IBMQ 4CJ1B 2FMMA 3SK6A 3K7AB 3UI2A 4OELB 1NNXA 3OTOL 2JA5B 4YWKA 1B9NA 4DV5Q 4A3IB 3HKZE 2R93H 5DM73 3S1NH 1TVXA 2PMZE 1JE4A 4MNOA 5JEAG 3MFYA 1S5DD 4JC0A 4JI0Q 1ENCA 3M3YH 4TQUS 3FP9A 2ZTEA 5C4XH 1MGSA 5JJZA 2B63H 2KEDA 2Q2UA 1C48A 3MZ5A 2CH4A 2IL8A 1LO5D 1VQ7A 1RIPA 4IUNA 3CP0A 4KJNA 4R4OA 3TN2A 4DAMA 3J80L 3K5OA 2A6HD 3KLRA 2D0OA 5M3MH 1YNNC 4QJFA 4R4QA 3I4MG 1STGA 2QDLA 1H9SA 1XPOA 4RCNA 1QVFA 1B50A 1T5EA 3EQLC 4N8X1 2XN9C 4QY7A 1O80A 4IUUA 3MWYW 4RGOS 3S1MB 1FNWA 1XPRA 3F1ZA 2Z8LA 3EROA 1HFGA 2JP1A 1EQQA 3GTKB 1PH7A 2I5LX 1E3PA 2NVXH 3T16A 2F0NA 1I4RA 1QE6A 3H3VH 2KUMA 5CC4A 5D14A 1N33Q 4JV5L 4NXNL 1XPUA 4LUVA 4GNXB 4DF7A 1BOSA 1EYAA 2M2LA 5E3FA 1EIFA 3GTGB 4BY7G 4A3LH 4DR6Q 4EX5A 5KNCA 1UE6A 2HHHL 1Q3LA 3KUPA 2K4KA 1K8MA 4JW0A 2JE6I 1K28A 3T51B 5K36H 2JYOA 3QOJA 1EY8A 2R6GA 1HQMC 4IFDJ 4A75A 1D5XC 5E1FA 2XRSD 1KTKA 3A56A 4OL7A 1A3VA 3FVQA 1V1PB 4X66L 5ELNA 2BE5D 4DR3Q 1XNRL 1PRTD 5IP9H 4RMFA 3AFQA 3FDTA 1TWHH 1NMFA 3GTPH 5C0XJ 4DK0A 2F0JA 4X6AH 1I50H 1OXSC 1B70B 1PTOB 2EYHA 3UDXA 1T5XD 1CUKA 1HZAA 1R9TB 1AN8A 4A3KG 5I6YA 1TWAB 3A55A 3ITPA 4RKLA 1A15A 2KA7A 3CXCA 4Z9CB 3KF8B 2JJQA 4WFN3 1MIUA 2UUCQ 3K5LA 3HKZB 3IFTA 2K52A 3J7A5 1TKWB 1CI3M 2PMZB 4FYDA 3GTJB 2E2HB 4X3KA 5I6WA 3PO2B 4FVMA 3RLFA 3T53B 1B8AA 4KK7A 4J15A 5C3WA 3URYA 3PO3G 1IZ6A 3AEVA 3I4NH 4JI7L 1A3UA 1OXVA 1BDOA 3L3OC 2CVRA 1NMGA 5KIXA 1L1OC 2NVTH 3S16B 1SNMA 4ALPA 4JI8L 1PRTB 3NEMA 2K14A 1KDCA 5FOBB 1YJWA 4OO1I 2R93G 4MZ9A 3S17H 5M5WB 3M85A 1SEBD 4A3EH 1EIHA 5EKIA 3G71A 4PZ6A 5C4XG 1J8IA 1TXYA 3KJOA 2B63G 1AZPA 3E0EA 4L63B 2VW9A 4A3FH 4BBSH 4DV3L 5IT9c 5JVG3 1RODA 3KOJA 2WKCA 4MTKA 4LUOA 4ABNA 4IZ8A 1SNDA 1EY4A 2EPBA 4KKTA 4O2DA 1L0XB 4HIMA 1SAPA 1K83H 1FVIA 4FDBA 3L0OA 2BA1A 3H6MA 4C3HH 4NXML 4HN7A 2JA7G 3CAMA 2L55A 1SNCA 1CK1A 3OSOA 2RHQB 4CBVA 1BNZA 4A3GB 3PIP3 3H15A 5EQ0A 2DNEA 1C8CA 2NVYH 4HSPA 4AYBG 4OX9Q 4IFDH 4OHJA 3CCMA 1VQHA 1U4RA 3X3MA 1MBYA 3S2HH 1GKHA 1F9QA 1CSQA 4A3JH 4A3LG 5CV6A 2B8GA 4DPGA 5HGTA 1EY9A 3RZOH 1QWYA 3HOVB 4DR4L 3BU2A 1BR9A 4KY6A 5EPJA 5D3DA 1LTAD 4H44C 2Q8IB 4FF4A 2F0PA 5K36G 1LT4D 2O5JC 3J81i 3Q0AA 2VY3A 2R7ZH 4DV2L 4B3TQ 4DR7L 2AUJD 1ML0D 4KV6A 5JJIA 2OT2A 1SE2A 1WTHA 2EJGC 3M4OH 4LK1C 5FO8B 4KHPL 2G5DA 2WAQB 3ICEA 1QNUA 1V1OA 4NB3A 2JSOA 3SK8A 5IP9G 2KHJA 2KCTA 1IBLQ 5M5XB 1SYBA 2EYMA 3PUXA 2WACA 2D0PA 1BF4A 3PIOA 4YCUA 5LMUL 3HOYH 2NWGA 4ZCKA 5C4ZA 4L6TB 2YTXA 2QW7A 3TQYA 2I07B 2K75A 4YHHQ 2H4OA 1KXLA 1U9RA 2N8NA 4L8JA 3OMGA 3LGJA 3IL8A 3HOWB 5JJKA 4CDCC 1VF7A 4JI8Q 3BG3A 2BH2A 4WJ3M 4V190 4J8QA 2E5LQ 3I4NG 1WYDA 3A74A 3H3VI 5J22A 2EY6A 4RGTA 2B2VC 4BA1I 5FO9B 2MQHA 3QR8A 4DNRB 2RBMA 3MEFA 4FF3A 3BZKA 4DV3Q 1EYCA 4LF4Q 2Y0SG 4WORA 2HIXA 5CV9A 5AJ3L 5C44B 5GROA 4OONA 4X62L 4A3EG 2NBFA 4JI6Q 2LKVA 2K03A 5FLXL 4C2MB 3SXHA 1S4ZA 4X3UA 5CV5A 4DUYQ 4A3FG 4YY3Q 4BBSG 5BN4A 4DV0L 1NY4A 3E3XA 3ULJA 4EQPA 2I5MX 4LNQA 2NYZD 2JA5H 2EQSA 1TWCH 1IBKL 4N8FA 1C0AA 1PH1A 1DYQA 4RHSA 5EKKA 2RCNA 4KJOA 2EJMA 4A3DB 2VUMB 4YIJA 1LT3D 4QIWB 4K2KA 4C3HG 2UUAQ 2AQ2B 3FKIH 5HY6A 3PCOB 3MVVA 3HG9A 3VYTA 1I94L 4P71A 2K5DA 2B2TA 3DM1A 4B9WA 1HTPA 5CV8A 1JC7A 3K8AA 1UE5A 4IFDG 1Q46A 1U4LA 4A3MB 1YIJA 4DAPA 4LFAL 1EEID 3M7NA 4ID6A 4GLXA 5BN3A 2F52A 4RG1A 4A3JG 3J80i 3K57A 2OCEA 3I55A 1PRTF 1PFMA 4KHPQ 2ALYB 4R8NA 2QCPX 1EY7A 3TSSA 2JEAI 3KLWA 1K73C 3RNUA 2F0WA 2R7ZG 3F2BA 2WP8J 1I4GA 4H7BA 1SROA 4GN4B 2QILA 2ZTDA 4A93H 4UY8C 2VQFL 1J5EL 1D1IA 1V9PA 1YVCA 2EJFC 2VB2X 2HIVA 1N34Q 3A54A 1YZ6A 3RLNA 3VYRA 3MXGA 2MUYA 3U58A 1L1OB 4Q0FA 5FKAC 1Q86C 3K6OA 1Q8IA 3A7LA 2F0KA 1W3SA 1EWHA 3CU7A 3K0XA 3K81C 4LF9Q 3HOYG 5IYBG 3CPFA 4K6DA 2LS01 3KF6B 4QUFA 1KNEA 3KDFB 4FXKC 4I65A 3W2DA 2DNCA 2VS1A 1EYDA 3OIQA 2K7VA 4N9PA 5F2DA 4CJ0B 3K5MA 1B3AA 4F8MA 3N6RA 1VQAA 3T1YL 2ZTCA 4IFDI 2UXDL 2CCZA 4IALA 1B4OA 4X62Q 5FJ8H 2D62A 3BVZA 3NPPA 3SGIA 1R9TH 2GN5A 1A2TA 3AB9A 4KKSA 4BA2I 2X6LA 3R2TA 2FJ2A 2KCNA 3ZYYX 2E2HH 1OO9B 5LMNQ 1XMOQ 4QB4A 3GTJH 2K50A 4R4IA 1L2FA 4Y52H 4K0KQ 4P73A 2FFKB 1SJHD 4B3MQ 5C6AA 2PQEA 2B2UA 3M4YA 4YCWA 4KI0A 3D6WA 4XYQA 4TVAB 3VR5A 1G8ZD 1I3QH 3G4SA 5J3BA 2JA5G 3QOLA 3SEBA 1GUOA 3WOEA 2H1EA 3PUZA 4BY1B 5C3EH 3S1QB 1LV9A 4LF7Q 2QEJC 1X3FA 4RCOA 3TP8A 3J7ZC 4BWGB 4LF8Q 1T9HA 2F3IA 2PNHA 4X64Q 5IOCA 2VZAA 1GHJA 3SE0A 3I3CA 1ZYRD 2F4IA 1PMRA 4JI5Q 2PQAA 3BVMA 4G7ZC 1O7IA 1QOHA 4DV5L 1MJCA 3FKIG 4ZAIA 1XNQQ 2YU9B 1II3A 2HD3A 3DHQA 3TREA 1Y8PB 1WVLA 1W2BA 2G9HD 2I5HA 2K1BA 3Q23A 1HUMA 1N9WA 4A3BB 2KOLA 1PXUA 1KC8C 5DNFA 4I7AA 1STEA 3K59A 1W6JA 2L4NA 3VR2A 4QGUA 3UE0A 2MHVA 2JA8B 2AQ3B 4DAVA 2XWBB 4IOCA 1HR0Q 4QMGA 4O42A 4A3GH 2KECA 1MI2A 4C3IB 1VQNA 1PFBA 4KHZA 3GV6A 4A93G 1BKBA 4CKBA 1TWFB 1AE3A 2LMCB 3OMCA 3B6YA 3HEJA 1E7ZA 2OXPA 2IT1A 4Q5VA 3C1FA 1IL8A 1JJCB 1J6QA 1N33L 3HOVH 1VQEA 3HOZB 3TDQA 1YHAA 2IX0A 1HXYD 3D31A 1PYWD 2EYPA 3FPUB 3CCRA 4DR6L 3GO5A 1YJNA 2SDFA 2VXWA 2CFMA 2FMCA 2FHTA 3BYYB 2QF7A 1D1KA 2A73B 1HNWQ 1GD7A 5C5MA 4U68A 4DA2A 4KLKA 1DCZA 1GO3E 1E2VA 1EIGA 2OQKA 2F0TA 3MTSA 2ZXRA 1SE8A 2K5HA 3VR6A 4N9TA 1GHKA 1JICA 2YV5A 5FJ8G 4DR3L 2ES2A 2KVMA 2OTJA 1TS4A 3NTIA 1X55A 1AEXA 1EOVA 1FGUA 4KD4A 3GD7A 2JXMB 5EBDA 4XXEA 2AUKA 2N78A 4G57A 1CKNB 4DV1Q 2K05A 3CRLC 1ENFA 3STBC 5CGKA 4GOPA 2L12A 4DR2Q 4C3JB 2UUCL 2EE1A 4RGNA 2OF1A 2WB1B 2UXCQ 3DM3A 4PZ8A 2ZJQA 1PFNA 4GLAC 1Y1WB 2X69A 4RKBA 4EVOA 1LABA 5BR8L 1YEZA 4IUPA 4ZUIA 3TP5A 3GTOH 3VR4A 4R4TA 1XJVA 4HMJA 2NZOA 4IJHA 5C3EG 3I56A 1D6EC 1VF5C 3L7ZC 2C9OA 3TEHB 1GXDC 1S72A 1NJIC 4B08A 1HNZQ 3D0FA 3PSIA 2ZXOA 1MJEA 4KHVA 1SFOH 4O0AA 1YBYA 5A35A 1I6VC 1RL2A 4Y7NH 1B9MA 1KD1C 1SNOA 2LSSA 2K5QA 2OWOA 4E6IA 2WKDA 3I4LA 4DR1Q 3TRZA 1B3QA 1H9SB 2EYOA 3CKIB 4A3DH 1JWMD 1KDAA 4H0LC 3OYYA 3U50C 3R8BA 3RZDB 1S5FD 1UAPA 3O13A 1CT1D 4AH6A 2XSCA 4NPSA 4A3GG 2B8FA 1NTGA 4DK6C 4UHVA 1EWIA 4UDUC 3M4QA 3BDLA 1G6ZA 3MXNA 5JOBA 1PA6A 3J7AV 3S1RH 3QB3A 1F77A 3E5SA 4A3MH 1BVSA 1WFQA 2XTIA 3TBIB 5M3FB 1WCMH 1FJGL 3CCQA 2AQ1B 1SRUA 1RTOA 3OHXC 2B3GA 2DY8A 4OO1G 4OX9L 3HOVG 4BXXH 1V8QA 3HP3A 1O78A 1HZCA 3T13A 1S5BD 2EY1A 2F0QA 4NMZA 3E0JA 3H0GB 4FXDA 1Q1EA 1TWGH 3CW2C 5J39A 4OWXB 4G7OC 3MAQA 2Q2HA 1Q8KA 2CQOA 2B2TC 1KHIA 4AIMA 1WTVA 4IQZA 1KDBA 1ZEQX 2HDMA 1IYUA 1OXUA 4B3TL 3FMCA 1Z47A 1RCVD 3C1EA 4F87A 4IURA 1GUTA 3HZXA 2RHSB 2NVQB 5IE8A 4CDEC 1IBLL 5IT9E 1B44D 1EWCA 2ZT9C 3FHWA 2L11A 2WAQE 3R93A 5JAVA 1K0SA 1KL9A 3ND8A 1FNVA 2K32A 4TRDA 3C46A 1UE7A 1FGBD 5BR8Q 1ASYA 2R3ZA 1G51A 4JI2L 4YHHL 4GN3B 5IP7H 3IRBA 2N3SA 2G9DA 1TR5A 4MTNA 2Z0SA 3KFUA 1VQ9A 2C35B 2MFIA 4BS9A 3GTQB 3BYTB 3VDYA 2E5LL 4H02A 3V96A 2EYFA 4DN4M 3HFZB 3A0JA 5KGUA 3CMEA 1VQCA 1QVGA 4IJLA 1CZGA 1JB7A 3CQZB 1Q12A 2SOBA 1VQFA 1PZJD 2D9UA 3SDZA 5H1SE 4JG2A 3E9HA 1GVPA 4PV1C 4LF4L 4WJ4A 1HUNA 2EXZA 1NR2A 4BBRH 5GADC 4JI6L 4XQQA 3DXJC 5M3MG 3V2TA 2BH8A 4DUYL 2AHOB 4YY3L 4UPAA 2RSOA 4K5VA 1DJRD 2KHIA 1VS0A 2MO1A 4ZRZA 1D7QA 3S1QH 3QWNA 4A3DG 3STBD 1HA6A 3TP7A 1I4PA 2YTYA 1TIID 1BBUA 3W1BA 4IPDA 2E2IB 4L5TA 1FJGQ 3I4MB 1YNJC 1HQRD 2B2UC 1GJXA 3CCEA 4YCVA 3TS0A 5L37A 3I73A 3PF5A 5DAUA 2BDOA 4LFBQ 1X3EA 4L5RC 2UUAL 5T1GA 4ME5A 3CCVA 2A5HA 5CV4A 4A3MG 4PQXA 5ELFA 4A3BH 4PMCA 3GTMB 1WCMG 3MXUA 1PYBA 1H95A 3CC4A 2K33A 4QIWE 3X3NA 3KLSX 3NP8A 3D8GA 1P8LA 1UWVA 2JA8H 4BXXG 2F3WA 3S24A 2HQEA 5C0XH 3S2DH 1QG7A 1PFSA 1PDQA 2F0EA 3U4ZA 1QJOA 1Y1VB 1SLJA 1VQGA 1BCPD 1SN8A 4ZKBB 3F2CA 3D4DA 3I91A 3GTLH 2E2JB 4BY7B 5I9OA 4DV7L 1CHPD 1ONLA 2L1BA 3CD6A 4P75A 1JJGA 3MFGA 4DR5Q 1CKMA 3BZCA 4PZ7A 3CMAA 5C4JB 1LM0A 5GQOA 1XXGA 1HH2P 2JA9A 3AYHB 5NUCA 1JMCA 3RUZA 3OW7A 2P5ZX 1JR0D 1K8AC 2F0IA 4PMWA 3HOZH 4NKLA 1HFNA 3S15H 1WOCA 4XT3B 1VQMA 2PZUA 4RAUC 1N34L 5ELBA 4JI2Q 4M8AA 3HOUH 1IW7C 4XTCS 1KNAA 4JYAQ 1SR3A 3NELA 4AQYQ 1DXMA 1XMQQ 1K3BC 1K8OA 3OOCA 1ZYRC 1HZBA 3P20A 4A3KB 4LF9L 1A62A 1EY6A 3EIVA 3L9AX 2MP1A 1PV4A 4IUTA 5IP7G 3AFPA 3JAME 1WTPA 1X54A 2LY7A 1CM9A 3FPPA 3M9BA 3PO3B 4EQOA 5M5YB 4B3RQ 3AU7A 2J4XA 3ULLA 2HQLA 1EZ6A 5JPMC 3E6ZX 2A6ED 4IUQA 2R92H 2XVSA 1NR4A 2WIIB 3HOXH 5IT9L 5DM63 4C3JH 3PUWA 1PH5A 1PH9A 4IPHA 5LMNL 1XMOL 3K7AH 4FNFA 1BUVT 4ULLA 2R93B 2K04A 3K0YA 1A3TA 1Y69U 4K0KL 4BBRG 4WJWA 2CWAA 2A68D 2AWOA 4B3ML 5C4XB 1S5CD 3CCJA 1NSNS 4A3IH 2B63B 1G91A 5KNBA 1K8GA 2ATWA 3J7AF 1ILPA 3EVQA 2EDGA 3J81E 1DONA 1EQRA 3MEHA 2K6AA 1R4PB 4HCEA 3JAMc 2F3VA 1DD2A 4GOPC 1FYCA 2E75C 2BA0A 4LF7L 3Q6SA 2EXDA 3BZDB 4LF8L 3PV0A 1RD9D 5HGQA 4X64L 4JI5L 5CYUA 3L2PA 2JA7B 4APVA 2A19A 5IYCH 1WD1A 1XNQL 1H9KA 2O5IC 4A3BG 2SEBD 4EGVA 5ELCA 3F8TA 4H13C 4DV7Q 4LJZC 1G2SA 5E7NA 4RGMA 1D8LA 2JA8G 4AYBB 3S1MH 3RZDH 4CDDC 5C0XG 3GTKH 3RR5A 1NCVA 2NTTA 3DLLA 4GKKQ 3SVMA 3RN2A 1S3OA 4IO9A 3J81c 1EQTA 1IL2A 1DOMA 3VA5A 1HR0L 3GTGH 3S9WA 3AMUA 1JCKB 4MN3A 5M3FH 4XQNA 3PF4A 5JJLA 1PVOA 2K5WA 4TSSA 4RWSC 2LFNA 5E4WC 4P2CB 1L0WA 1O7LA 2B2YA 3QO2A 4ME3A 3PIPA 3HOZG 2HCCA 1EFID 1UEAB 4HCSA 1N36Q 1YNJD 4LF6Q 2DGYA 3H0GH 4A3CH 4NDXA 1Z6HA 3HOUG 1XTCD 5ISRA 1G2TA 2Q2IA 1BO0A 1K3RA 1I50B 1RHPA 2F0UA 1AW7A 2PNRC 3K58A 2BOSA 1SDFA 1LLRD 3T4AC 4B3SQ 1PTOH 2IX3A 3EN2A 1O7YA 3EFXD 4DK3C 1HNWL 1TWAH 2XGTA 1IYVA 1YI2A 4WRDA 2K5NA 2EIFA 2NUCA 3NQIA 1PHJA 1N8RC 1J9OA 1PH3A 5C0XI 1H9MA 5ELEA 3PO2H 1ZKOA 1O7ZA 1N32Q 2R92G 2F03A 4HJ5A 2DJFC 4C56C 1MSHA 1M90C 3HOXG 3LWEA 5DEHA 1IKMA 4C3JG 4MIUA 4DV1L 1RJTA 2Y0SB 5LHY1 1K0RA 3S16H 2PI2E 4DNIA 3S17B 3J80E 4JBKA 4DR2L 3NBHA 4POGA 2Z6KA 1SYDA 4UP9A 2FXQA 5EJWA 2B29A 2UXCL 3U4VA 4A3IG 1QVCA 4LWCA 1IW7D 1STNA 4A3FB 3PGZA 4DGZA 4JI4Q 4KTAA 1VCIA 1S5ED 3VYUA 5M5WH 1CSPA 1E22A 3QG1A 3NWTA 2DN8A 1EQVA 2ZXPA 1EEFD 2PQAB 2WB1E 4L5QA 5IGBA 4OGQC 3RLOA 5GAGC 1X9NA 5EPKA 1K83B 2V1CC 2AKWB 1B7YB 5KYIA 2HCIA 2V4DA 4DV4Q 3MHBA 2GVBA 1PZKD 2CKZB 1HNZL
chains in the Genus database with same CATH topology
1STBA 2PPBC 1XYIA 1WTQA 4XDXA 2PW5A 4DAYA 2F0MA 2EYLA 3A8IE 2NVYB 5I2XA 5T1IA 4CHTB 3M7GA 3DUZA 3R3OA 4ILWA 3S2HB 3KLSA 4A3JB 4NW2A 2F0OA 3FRPB 4DFAA 3RZOB 1HPCA 2WV6D 1TT2A 5CORA 1D2BA 4EQNA 3QJYA 5C3XA 1TU2B 3HS0C 2R7ZB 2HUGA 2F0VA 1WD0A 4XT1B 5IODA 3BDOA 3M4OB 5FK9C 4GZYC 3DWQA 3KK7A 3GP7A 2K01A 3SHLA 3ONAB 3V05A 1Y8NB 5EGTA 4OIKA 2D2CC 5IGGA 1A6XA 4OIJA 3TZDA 2EZVA 4FXGC 1GUGA 3HOYB 1M4VA 5G3LD 2ID0A 1LTSD 1TQOA 1X32A 2F0FA 3I72A 2MJ8A 1H9JA 2XNAC 1PLFA 1NAPA 5FO7B 4UAIA 1W6KA 3DWAA 5E4XA 1CZWA 5I2YA 4X3SA 5IGDA 4QUCA 1RKNA 1ET9A 3EJIA 3D3RA 3NXWA 5TSSA 1BQQT 1QCBD 3H09A 4QCLA 4X3TA 3IFDA 1SBBB 1MD2D 1U4PA 1X3PA 3I90A 1IHZA 3ND9A 3SR1A 1JQYD 4PNYA 5IGEA 2Q8RE 1GOZA 1F9PA 4IUVA 3DWPA 1KLGD 1HA5A 2OEOA 3A8KE 1EL0A 1HCZA 2X6GA 2I46A 1DOKA 3RD4A 1DM0B 3NTHA 1TWCB 1ZXTA 1LT5D 1BCPC 2Z4HA 1DZ1A 1KLUD 1HRJA 2ICIA 1H9RA 1Q90A 2HDLA 2IJ0A 2VB3X 2RKSA 2NN6H 1AP0A 1ILQA 1EZ8A 4KKUA 3FKIB 1NUCA 2KCCA 1LTBD 4HSVA 3VA7A 3F2UA 2RQXA 1WTRA 3A8JE 2EYJA 1JORA 2Z4IA 2MPMA 1GUNA 4R8IA 2C5CA 2XWJB 1CQFA 1I6HB 5CR3A 1EOTA 1QILA 4KD3A 2KHSA 5J1ZA 2JA6B 3PIO3 4KY7A 2K28A 4J6HA 1PTOD 2NB0A 4A93B 2Z1CA 5CV7A 1F2ZA 1F9RA 3D6CA 1SMYC 4K6LA 3SK5A 4K5WA 4K2LA 2A6EC 1UNSA 3NBIA 2J0TD 1I4HA 4ZYSA 4KN4C 2IX1A 3A7AB 1XWEA 4XIGS 4LMQD 1V1PA 2DY7A 3H3VC 2A68C 4C1NK 2XRQD 1Z7TA 1VMPA 5BN5A 1HTLD 2EY5A 1KABA 2R61A 4RH6A 2EOTA 1E0BA 2SNMA 1V43A 3H91A 3KF8A 4TKOB 5FLXE 1SXTA 3NWSA 1F2LA 1RF2D 5C5LA 4ZLTF 3KBGA 1F2MA 2PZTA 4ODGA 2F0SA 2B2YC 1OXTA 2B39A 1TY0A 3BVGA 3S14B 4DNTB 5I9PA 1I3QB 1SYCA 1PZID 1SE4A 5EKLA 3NUCA 3W3AA 5C3EB 3LNNA 3IAYA 5CMDA 2NN6G 1ENAA 4J1MA 4U673 1QNKA 3P1HA 1ESFA 3C2PA 1STYA 3TMEA 3LX0A 4KY5A 3RMHA 2PYKA 2F1MA 4NP5A 2RA4A 2F0GA 3NHHA 4ZQ3A 1LTTD 1CA6A 4DU9A 5CBAE 2B2WA 1SYGA 4G7HC 4XYOA 1STAA 4CKCA 2QDBA 4JBWA 5EPLA 2FINB 2E74C 1M8AA 3OWFA 3KBXA 4R9WA 3H94A 1QB5D 5G3LF 2TMPA 1F2YA 1IKLA 3T56B 1XX8A 4CGYB 2F0DA 5A2QE 3HGBA 1FR3A 4IN3A 5D65A 2A74C 4CKEA 3R2IA 4HTHA 2NN6I 5K5PA 3DEOA 5I4DA 1YNND 1G291 4HMIA 5IIFA 2O4XA 4CJ2C 2M00A 1L0YB 1Y8OB 2CW0C 3BDCA 2PCFB 1C4QA 1JOKA 1SSOA 1BCPB 2NTSA 3ERQA 5COYA 2CQAA 2RDFA 2MGSA 5C4HA 4G4KA 1SMYD 3NK9A 2WINB 2EY2A 4V0BA 4XQJA 1LTGD 1JWSD 2VNUD 1TS2A 4RHRA 4M1UB 2EVBA 3GTOB 1TY2A 5KRUA 3S1NB 4K14A 1Q1BA 3M3YB 2N88A 3NE5B 4MHEA 3EA6A 4ZK9B 3P75A 2N55A 3N52A 4ZUJA 2E76C 1FD7D 3Q22A 1SFOB 4Y7NB 3D4WA 5M3MB 4KN7C 2A69C 3CHBD 1CA5A 1PTOF 5CBEE 2PW7A 2KQ3A 2KJXA 2F0LA 4K8JA 1DOLA 1F9SA 5ELDA 2BDNA 4F7XA 1SNQA 2Q8TA 2L5TA 3VR3A 2NVXB 1B1ZA 3DEPA 4QF4A 4C1NI 3CRKC 1CFMA 1AFPA 1B53A 5JEAJ 3S1RB 1E2ZA 2CHBD 1ESRA 4HEDA 1WCMB 4HAEA 4C3IG 3BS1A 3GQBA 3U9OA 4DK1A 1KAAA 3GV3A 1EU3A 3PUVA 3C3LA 1LTRD 3FEWX 2AWNA 3MA2B 1TWGB 3J7YW 2ENBA 1I4XA 2F0HA 1TWHB 3GTPB 3IKJA 1EY0A 2M9VA 3VYSA 1R4QB 1SYEA 1SYFA 4K5XA 2L9HA 1LT6D 2QKIC 1HHVA 2J7ZA 1GUWA 5KEEA 3G7LA 5A2QL 1SE3A 1A2UA 1JOOA 1I4QA 3MC0B 3WOFA 3I70A 3MXPA 3I8ZA 4HR7B 2RDHA 5D3IB 3I4NB 5JPNC 2JEBI 4LAAA 3QIAA 1U4MA 3DMUA 3PUYA 1STHA 1LTID 2NVTB 3OPOA 1TS3A 4O1NA 1D5MC 1RDPD 2A6HC 2BCOA 2RVLA 1VDZA 1SNPA 1MSGA 2ICEC 4A3EB 4I7ZC 5EBCA 3Q24A 5KNDA 2TSSA 2RSNA 3NTKA 4BBSB 1GUSA 1FNUA 1X3QA 2CW0D 3JAML 1EY5A 1SJED 4BBRB 2RDGA 1PTOC 2GA4B 3TP6A 3TZUA 2D5DA 5JEAH 4DXGA 3OWEB 1LACA 1BCPF 1EU4A 4C3HB 2NZ1D 1B2TA 1D5ZC 3OIPA 1JOQA 3NQTA 3U9SA 4ZKCB 4B9XA 4RFBA 4FF1A 4S3SA 4DXFA 2L0CA 2BE5C 4F88A 5JVH3 1PRTC 3J81L 1WTWA 3P7JA 3K5NA 5HURA 3G6JB 1BXTA 2IWHA 1CTMA 1JWUD 3HRZC 3S2DB 4PMBA 3GTLB 4RA8A 5M9OA 2A69D 1ICWA 4FP5D 1AZQA 1TS5A 2YYZA 2B2WC 2B2VA 1UUPA 4OO1H 2IW3A 4JK1C 2O2LD 2PO4A 3S15B 5IGFA 2PZWA 4KMUC 1CHQD 3HOUB 3PMFA 1OXXK 5LL6S 5IGCA 3WDNA 4FF2A 3LWUA 1RTNA 2SNSA 2E2DC 2KEEA 1ET6A 1BBXC 4FO2A 1WTOA 5AFWA 2IPKD 1VMCA 1WTXA 2XIWA 5LL6X 4K8IA 1E2WA 5KYLA 2R92B 3SK4A 1JB3A 3NSWA 3HOXB 1CQVA 3D4RA 4CJ1B 2FMMA 3SK6A 3K7AB 3UI2A 2JA5B 1B9NA 4A3IB 5DM73 1TVXA 1JE4A 5JEAG 3MFYA 1S5DD 1ENCA 4TQUS 1MGSA 5JJZA 2KEDA 1C48A 3MZ5A 2IL8A 1LO5D 4IUNA 3J80L 4KJNA 3TN2A 3K5OA 2A6HD 3KLRA 1YNNC 1STGA 1H9SA 4RCNA 1B50A 1T5EA 3EQLC 2XN9C 1O80A 4IUUA 3MWYW 4RGOS 3S1MB 1FNWA 2Z8LA 3EROA 1HFGA 2JP1A 3GTKB 3T16A 2F0NA 1I4RA 1QE6A 2KUMA 5CC4A 5D14A 4DF7A 1BOSA 1EYAA 2M2LA 5E3FA 3GTGB 5KNCA 1Q3LA 3KUPA 1K8MA 2JE6I 3T51B 5K36H 2JYOA 3QOJA 1EY8A 2R6GA 1HQMC 4IFDJ 1D5XC 5E1FA 2XRSD 1KTKA 3A56A 4OL7A 1A3VA 3FVQA 1V1PB 2BE5D 1PRTD 3FDTA 5C0XJ 4DK0A 2F0JA 1OXSC 1PTOB 2EYHA 1T5XD 1R9TB 1AN8A 5I6YA 1TWAB 3A55A 3ITPA 4RKLA 1A15A 2KA7A 4Z9CB 4WFN3 3K5LA 3HKZB 3IFTA 2E2HB 1TKWB 1CI3M 2PMZB 4FYDA 3GTJB 4X3KA 5I6WA 3PO2B 4FVMA 3RLFA 3T53B 4KK7A 5C3WA 3URYA 1A3UA 1OXVA 1BDOA 3L3OC 2CVRA 5KIXA 3S16B 1SNMA 1PRTB 1KDCA 5FOBB 4OO1I 5M5WB 3M85A 1SEBD 1EIHA 5EKIA 1J8IA 1AZPA 4L63B 5JVG3 1RODA 2WKCA 4ABNA 4IZ8A 1SNDA 1EY4A 2EPBA 4KKTA 1L0XB 1SAPA 2BA1A 3H6MA 4HN7A 2L55A 1SNCA 1CK1A 3OSOA 4CBVA 1BNZA 4A3GB 3PIP3 5EQ0A 2DNEA 1C8CA 4HSPA 4IFDH 4OHJA 1U4RA 3X3MA 1MBYA 1F9QA 5CV6A 2B8GA 5HGTA 1EY9A 1QWYA 3HOVB 4KY6A 1BR9A 5EPJA 5D3DA 1LTAD 4H44C 2Q8IB 4FF4A 2F0PA 5K36G 1LT4D 2O5JC 3Q0AA 2AUJD 1ML0D 4KV6A 2OT2A 1SE2A 2EJGC 4LK1C 5FO8B 2WAQB 1QNUA 1V1OA 2JSOA 3SK8A 5M5XB 1SYBA 2EYMA 3PUXA 2WACA 1BF4A 2NWGA 5C4ZA 4L6TB 2I07B 2H4OA 1U9RA 4L8JA 3OMGA 3IL8A 3HOWB 1VF7A 3BG3A 4V190 4J8QA 5J22A 2EY6A 4RGTA 2B2VC 4BA1I 5FO9B 4DNRB 2RBMA 4FF3A 1EYCA 4WORA 5CV9A 5C44B 2NBFA 2LKVA 2K03A 5FLXL 4C2MB 3SXHA 1S4ZA 4X3UA 5CV5A 5BN4A 4EQPA 2NYZD 1DYQA 4RHSA 5EKKA 4KJOA 2EJMA 4A3DB 2VUMB 4YIJA 1LT3D 4QIWB 4K2KA 4C3HG 2AQ2B 3VYTA 3MVVA 3HG9A 2K5DA 2B2TA 3DM1A 4B9WA 1HTPA 5CV8A 1JC7A 4IFDG 1U4LA 4A3MB 4DAPA 1EEID 3M7NA 4ID6A 5BN3A 3K57A 1PRTF 1PFMA 4R8NA 2QCPX 1EY7A 3TSSA 2JEAI 2F0WA 2WP8J 1I4GA 4H7BA 2QILA 1D1IA 2EJFC 2VB2X 3A54A 3VYRA 3MXGA 2MUYA 4Q0FA 5FKAC 3K6OA 1Q8IA 3A7LA 2F0KA 1EWHA 3CU7A 4K6DA 2LS01 4QUFA 1KNEA 4FXKC 3W2DA 4I65A 2DNCA 1EYDA 3OIQA 2K7VA 4N9PA 5F2DA 4CJ0B 3K5MA 1B3AA 4F8MA 3N6RA 4IFDI 4IALA 1B4OA 2D62A 3BVZA 3NPPA 1A2TA 3AB9A 4KKSA 4BA2I 2X6LA 3R2TA 2FJ2A 2KCNA 3ZYYX 1OO9B 4QB4A 2FFKB 1SJHD 5C6AA 2PQEA 2B2UA 3M4YA 4KI0A 3D6WA 4XYQA 3VR5A 1G8ZD 3QOLA 3SEBA 1GUOA 3WOEA 2H1EA 3PUZA 4BY1B 3S1QB 1LV9A 2QEJC 3TP8A 4RCOA 4BWGB 5IOCA 3SE0A 1GHJA 3I3CA 1ZYRD 2F4IA 1PMRA 3BVMA 4G7ZC 1QOHA 4ZAIA 2YU9B 1II3A 3DHQA 1Y8PB 1WVLA 2G9HD 2K1BA 3Q23A 1HUMA 4A3BB 2KOLA 1PXUA 5DNFA 1STEA 3K59A 1W6JA 2L4NA 3VR2A 2JA8B 2MHVA 2AQ3B 4DAVA 2XWBB 4QMGA 4O42A 2KECA 1MI2A 4C3IB 1PFBA 4KHZA 3GV6A 4CKBA 1TWFB 2LMCB 3OMCA 3HEJA 2OXPA 2IT1A 4Q5VA 3C1FA 1IL8A 3HOZB 3TDQA 2IX0A 1HXYD 3D31A 1PYWD 2EYPA 3FPUB 3GO5A 2SDFA 2VXWA 2FMCA 2FHTA 3BYYB 2QF7A 1D1KA 2A73B 5C5MA 4DA2A 4U68A 1DCZA 1E2VA 1EIGA 2F0TA 3MTSA 2ZXRA 3VR6A 4N9TA 1GHKA 1JICA 2KVMA 1TS4A 3NTIA 1AEXA 4KD4A 3GD7A 2JXMB 5EBDA 4XXEA 2AUKA 4G57A 2K05A 3CRLC 1ENFA 5CGKA 2L12A 4C3JB 2EE1A 4RGNA 2OF1A 2WB1B 1PFNA 1Y1WB 2X69A 4RKBA 4EVOA 1LABA 4IUPA 4ZUIA 3TP5A 3VR4A 4HMJA 1D6EC 1VF5C 3L7ZC 2C9OA 1GXDC 4B08A 2ZXOA 4KHVA 5A35A 1I6VC 1B9MA 1SNOA 2K5QA 4E6IA 2WKDA 3I4LA 1H9SB 2EYOA 3CKIB 1JWMD 1KDAA 4H0LC 3R8BA 3RZDB 1S5FD 1UAPA 3O13A 1CT1D 2XSCA 2B8FA 4UDUC 3BDLA 1G6ZA 3MXNA 5JOBA 3J7AV 3QB3A 1F77A 3E5SA 3TBIB 5M3FB 2AQ1B 1RTOA 3OHXC 2DY8A 4OO1G 1V8QA 3HP3A 1O78A 3T13A 1S5BD 2EY1A 2F0QA 4NMZA 3E0JA 3H0GB 4FXDA 1Q1EA 5J39A 4G7OC 3MAQA 2B2TC 1WTVA 4IQZA 1KDBA 1ZEQX 2HDMA 1IYUA 1OXUA 3FMCA 1Z47A 1RCVD 3C1EA 4F87A 4IURA 1GUTA 3HZXA 2NVQB 5IT9E 1B44D 1EWCA 2ZT9C 2L11A 3R93A 5JAVA 3ND8A 1FNVA 2K32A 4TRDA 3C46A 1FGBD 2R3ZA 2G9DA 1TR5A 4BS9A 3GTQB 3BYTB 3V96A 2EYFA 4DN4M 5KGUA 1CZGA 3CQZB 1Q12A 2SOBA 1PZJD 2D9UA 3SDZA 4PV1C 1HUNA 2EXZA 1NR2A 4XQQA 3DXJC 3V2TA 2RSOA 4K5VA 1DJRD 4ZRZA 3QWNA 1HA6A 3TP7A 1I4PA 1TIID 2E2IB 3I4MB 1YNJC 1HQRD 2B2UC 1GJXA 3I73A 5DAUA 2BDOA 5T1GA 4ME5A 2A5HA 5CV4A 4PQXA 5ELFA 4PMCA 3GTMB 3MXUA 2K33A 3X3NA 3KLSX 3NP8A 3D8GA 2F3WA 2HQEA 5C0XH 1QG7A 2F0EA 1PDQA 1QJOA 1Y1VB 1BCPD 4ZKBB 4BY7B 3D4DA 3I91A 2E2JB 5I9OA 1CHPD 1ONLA 2L1BA 3MFGA 5C4JB 1XXGA 5NUCA 3RUZA 3OW7A 1JR0D 2F0IA 4PMWA 4NKLA 1HFNA 4XT3B 2PZUA 4RAUC 5ELBA 4M8AA 1IW7C 4XTCS 1KNAA 1DXMA 1K8OA 3OOCA 1ZYRC 3P20A 4A3KB 1EY6A 3L9AX 2MP1A 4IUTA 3JAME 1WTPA 2LY7A 1CM9A 3FPPA 3PO3B 4EQOA 5M5YB 3AU7A 2J4XA 1EZ6A 5JPMC 3E6ZX 2A6ED 4IUQA 2XVSA 1NR4A 2WIIB 5IT9L 5DM63 3PUWA 4ULLA 4FNFA 1BUVT 2R93B 2K04A 3K0YA 1A3TA 1Y69U 4WJWA 2A68D 2AWOA 5C4XB 1S5CD 2B63B 1NSNS 1G91A 5KNBA 3J7AF 1ILPA 3EVQA 2EDGA 3J81E 1DONA 3MEHA 2K6AA 1R4PB 4HCEA 2F3VA 1DD2A 1FYCA 2E75C 2BA0A 3Q6SA 3BZDB 3PV0A 1RD9D 5CYUA 2JA7B 1WD1A 1H9KA 2O5IC 2SEBD 4EGVA 5ELCA 4H13C 4LJZC 1G2SA 4RGMA 4AYBB 5C0XG 1NCVA 2NTTA 3SVMA 1EQTA 1DOMA 3VA5A 3S9WA 3AMUA 1JCKB 4MN3A 4XQNA 2K5WA 4TSSA 5E4WC 2LFNA 4RWSC 4P2CB 1O7LA 2B2YA 3QO2A 2HCCA 1EFID 1UEAB 4HCSA 1YNJD 4NDXA 1Z6HA 1XTCD 5ISRA 1G2TA 1BO0A 1I50B 1RHPA 2F0UA 1AW7A 2PNRC 3K58A 2BOSA 1SDFA 1LLRD 3T4AC 1PTOH 2IX3A 1O7YA 3EFXD 1IYVA 4WRDA 2NUCA 3NQIA 1J9OA 5C0XI 1H9MA 5ELEA 1ZKOA 1O7ZA 2F03A 4C56C 1MSHA 3LWEA 5DEHA 1IKMA 4C3JG 4MIUA 1RJTA 2Y0SB 5LHY1 3S17B 3J80E 3NBHA 1SYDA 5EJWA 1IW7D 1STNA 4A3FB 4DGZA 4KTAA 1VCIA 1S5ED 3VYUA 3QG1A 3NWTA 2DN8A 1EQVA 2ZXPA 1EEFD 5IGBA 4OGQC 5EPKA 1K83B 5KYIA 2HCIA 2V4DA 3MHBA 1PZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OXP A;  1EYD A;  2LKV A;  2EYO A;  3VA5 A;  1STB A;  4N9P A;  3H6M A;  3C1F A;  5F2D A;  2SNS A;  3S9W A;  2SOB A;  4F8M A;  3SXH A;  1EY6 A;  1SNC A;  4F7X A;  1SNQ A;  2SNM A;  1KDA A;  2PW5 A;  3OSO A;  5CV5 A;  1EY5 A;  4QF4 A;  2OEO A;  3QOJ A;  2F0M A;  1EY8 A;  2EYL A;  4HTH A;  4IAL A;  4EQP A;  2EXZ A;  5E1F A;  2EYP A;  5C5L A;  1A2T A;  3TP6 A;  4OL7 A;  1A3V A;  5KEE A;  5K5P A;  3R3O A;  1F2M A;  2PZT A;  4ODG A;  3BDL A;  4HMI A;  2RKS A;  2F0S A;  5JOB A;  3V2T A;  4EQO A;  2F0O A;  4NDX A;  3QB3 A;  4DFA A;  3U9O A;  5EKK A;  3E5S A;  4KJO A;  4QB4 A;  4K8I A;  5IIF A;  1EZ8 A;  5KYL A;  5ISR A;  4K5V A;  2O4X A;  5C5M A;  5CV6 A;  2M00 A;  5HGT A;  1KAA A;  1EY9 A;  2F0U A;  1EZ6 A;  4YIJ A;  3SK4 A;  1TT2 A;  1NUC A;  4K2K A;  4KY6 A;  3BDC A;  4EQN A;  2F0J A;  2F0T A;  3NQT A;  2PQE A;  3TP7 A;  5C3X A;  5C6A A;  1JOQ A;  2EYH A;  2F0P A;  5I9P A;  2F0V A;  3SK6 A;  1JOK A;  4N9T A;  1SYC A;  4B9X A;  5I6Y A;  3MVV A;  5IOD A;  3T13 A;  3ITP A;  5EKL A;  2EY1 A;  4RKL A;  3ERQ A;  2F0Q A;  4NMZ A;  4S3S A;  2RDF A;  4B9W A;  5CV8 A;  2EYJ A;  1JOR A;  4KV6 A;  1A3T A;  1AEX A;  3NUC A;  2ENB A;  4KD4 A;  3QOL A;  3SHL A;  5J39 A;  5C4H A;  4WRD A;  5EGT A;  2F0H A;  5DAU A;  4ID6 A;  5I6W A;  4ME5 A;  1NSN S;  2NUC A;  1ENA A;  4G57 A;  1ENC A;  4J1M A;  5HUR A;  5IGG A;  3NK9 A;  3SK8 A;  5CV4 A;  3TP8 A;  1KDB A;  5C3W A;  3EVQ A;  1EY0 A;  3P1H A;  4PMC A;  5CR3 A;  5CGK A;  2EY2 A;  1SYE A;  1SYB A;  5C4Z A;  5IOC A;  1SYF A;  1STY A;  3MEH A;  4K5X A;  3TME A;  1A3U A;  3LX0 A;  2EYM A;  3MZ5 A;  4KD3 A;  4KY5 A;  2KHS A;  2WAC A;  3NP8 A;  3D8G A;  5J1Z A;  2OF1 A;  4R8N A;  5KIX A;  1EY7 A;  2F3W A;  1TQO A;  3C1E A;  4PMB A;  4IUN A;  2F0F A;  2F3V A;  4KJN A;  2PYK A;  4KY7 A;  4NP5 A;  2HQE A;  2F0W A;  3HZX A;  5DEH A;  2F0G A;  4J6H A;  3NHH A;  1SNM A;  2F0E A;  4MIU A;  4ZQ3 A;  1II3 A;  3DHQ A;  4RKB A;  1F2Z A;  1KDC A;  5CV7 A;  4H7B A;  3D6C A;  1A2U A;  3D4D A;  4DU9 A;  4EVO A;  5M9O A;  4K14 A;  1JOO A;  4ZUI A;  3TP5 A;  1U9R A;  5I9O A;  1STG A;  3SK5 A;  1SYG A;  1SYD A;  3OMG A;  4K5W A;  4HMJ A;  3MXP A;  3P75 A;  4K2L A;  5IGD A;  5JAV A;  1RKN A;  1STN A;  3EJI A;  4DGZ A;  3NXW A;  1STA A;  4ZUJ A;  4LAA A;  4KTA A;  4TRD A;  2QDB A;  3DMU A;  1STH A;  5J22 A;  5NUC A;  1EQV A;  2EY6 A;  2F0K A;  3ERO A;  3OWF A;  3RUZ A;  4QMG A;  2F0I A;  2PZW A;  3D4W A;  5IGF A;  3T16 A;  1TR5 A;  2F0N A;  4KHV A;  4NKL A;  5IGB A;  5KRU A;  1SNP A;  2RBM A;  2PZU A;  4K6D A;  5CC4 A;  4IZ8 A;  1F2Y A;  1IHZ A;  1EY4 A;  1SND A;  5KYI A;  1SNO A;  3PMF A;  3SR1 A;  4DF7 A;  2PW7 A;  1EYC A;  3MHB A;  4I65 A;  1EYA A;  4WOR A;  2EYF A;  2KQ3 A;  5CV9 A;  5E3F A;  4PNY A;  4E6I A;  5IGC A;  2F0D A;  3OMC A;  5IGE A;  2EY5 A;  1KAB A;  2F0L A;  4K8J A;  5KGU A;  3HEJ A; 
#chains in the Genus database with same CATH topology
 4GN5 A;  1STB A;  1C7Y A;  1JE5 A;  2PPB C;  4JCV E;  1XYI A;  1WTQ A;  4XDX A;  4GKJ Q;  2PW5 A;  4JBJ A;  4R4C A;  4DAY A;  2F0M A;  2EYL A;  3A8I E;  2Q2T A;  2NVY B;  3J80 c;  2E2I H;  4DR1 L;  5I2X A;  5T1I A;  4CHT B;  3M7G A;  3DUZ A;  3R3O A;  4ILW A;  3S2H B;  3KLS A;  2F4V Q;  2QGQ A;  4A3J B;  4NW2 A;  1YIT A;  2F0O A;  3FRP B;  4DFA A;  3RZO B;  1EIY B;  4JI3 Q;  3K80 C;  1HPC A;  2WV6 D;  1TT2 A;  5COR A;  5IWA Q;  4JBM A;  1D2B A;  1U0L A;  2YTV A;  4JI1 Q;  4EQN A;  3QJY A;  5C3X A;  2VQE Q;  2KEN A;  1TU2 B;  3GTM H;  3HS0 C;  1VQ6 A;  2HUG A;  2R7Z B;  2F0V A;  4QQB X;  1WD0 A;  2LXK A;  4XT1 B;  5IOD A;  3BDO A;  3M4O B;  1MKH A;  5FK9 C;  4GZY C;  3DWQ A;  3KK7 A;  3GP7 A;  2K01 A;  1QUQ A;  3SHL A;  3ONA B;  3V05 A;  1Y8N B;  1Y1V H;  5EGT A;  4OIK A;  4LFC Q;  2D2C C;  3H0G G;  1CKO A;  5IGG A;  1M1K C;  1A6X A;  1EFW A;  4IPG A;  4OIJ A;  1SMX A;  3TZD A;  4R1J A;  2EZV A;  4FXG C;  1GUG A;  3HOY B;  1M4V A;  5G3L D;  2ID0 A;  5M5X H;  5C4J H;  1LTS D;  2R7D A;  1TQO A;  1X32 A;  2K5V A;  2F0F A;  1Q81 C;  3I72 A;  1VQK A;  2JN4 A;  2MJ8 A;  1H9J A;  2XNA C;  1PLF A;  1K9M C;  2ZJR A;  1NAP A;  3M4P A;  5FO7 B;  4UAI A;  1W6K A;  3DWA A;  5E4X A;  2NZH A;  1CZW A;  4X65 Q;  5I2Y A;  4X3S A;  3WWV A;  5IGD A;  3HKZ G;  4QUC A;  1RKN A;  1ET9 A;  3EJI A;  3D3R A;  3NXW A;  5TSS A;  1BQQ T;  3HOW H;  1QCB D;  3H09 A;  3PO2 G;  4QCL A;  3KYH C;  4HJ7 A;  1AE2 A;  4GOP B;  4X3T A;  2UXB Q;  3IFD A;  1SBB B;  1MD2 D;  1U4P A;  1X3P A;  3I90 A;  2IHE A;  1ASZ A;  1IHZ A;  1VQD A;  3ND9 A;  1Q82 C;  3SR1 A;  4HJA A;  1JQY D;  4HID A;  4PNY A;  3G6E A;  3UDI A;  5IGE A;  5M5Y H;  2Q8R E;  1GOZ A;  5C44 H;  1KQS A;  1F9P A;  4IUV A;  3DWP A;  1KLG D;  1HA5 A;  2OEO A;  3A8K E;  4C2M H;  1EL0 A;  1HCZ A;  2X6G A;  2I46 A;  1DOK A;  2E8G A;  3RD4 A;  1DM0 B;  3NTH A;  1TWC B;  1ZXT A;  5IYD H;  1LT5 D;  1BCP C;  2Z4H A;  1DZ1 A;  1KLU D;  1HRJ A;  1VQI A;  1H9R A;  1Q90 A;  2HDL A;  2ICI A;  2IJ0 A;  4A76 A;  2VB3 X;  2RKS A;  2NN6 H;  1AP0 A;  5GAE C;  1ILQ A;  1EZ8 A;  1WI5 A;  4KKU A;  1HNX Q;  3FKI B;  1KRS A;  1NUC A;  2KCC A;  1LTB D;  4HSV A;  2VUM H;  3VA7 A;  3F2U A;  1QZG A;  2RQX A;  1WTR A;  1OTC A;  2DJG C;  3A8J E;  2EYJ A;  1JOR A;  2Z4I A;  1X6O A;  2JK8 A;  2MPM A;  2UU9 Q;  1GUN A;  1PH4 A;  4R8I A;  2C5C A;  3BJU A;  2XWJ B;  3NEN A;  1CQF A;  3MXN B;  1I6H B;  2JA7 H;  5CR3 A;  1VQ4 A;  3I2Z A;  1EOT A;  1QIL A;  4KD3 A;  2KHS A;  5J1Z A;  2JA6 B;  3PIO 3;  3E9I A;  4LFB L;  4KY7 A;  2K28 A;  4J6H A;  1PTO D;  2NB0 A;  3A5Z B;  4A93 B;  2Z1C A;  4GNX A;  5CV7 A;  1F2Z A;  1F9R A;  3D6C A;  4JOI A;  3CC7 A;  2KBN A;  1SMY C;  1Y1V G;  4K6L A;  3CF5 A;  3SK5 A;  4K5W A;  3UDG A;  4K2L A;  2A6E C;  2WAQ G;  1UNS A;  3NBI A;  2J0T D;  1I4H A;  4ZYS A;  4KN4 C;  4LUZ A;  2MNA A;  1ICF B;  2IX1 A;  3A7A B;  4IPC A;  1XWE A;  5EAY A;  4XIG S;  4LMQ D;  1V1P A;  1Y14 B;  2DY7 A;  4DUZ Q;  3H3V C;  2A68 C;  4C1N K;  4DR5 L;  2XRQ D;  1Z7T A;  1VMP A;  5BN5 A;  2ASB A;  1HTL D;  2EY5 A;  1KAB A;  2R61 A;  4RH6 A;  1Q7Y C;  2EOT A;  1E0B A;  4DV6 Q;  3ER0 A;  1WJJ A;  3HOW G;  4OWW B;  2SNM A;  4UP7 A;  1KRT A;  1V43 A;  2QEX A;  1EYG A;  3H91 A;  3KF8 A;  4LF5 Q;  4TKO B;  5FLX E;  1SXT A;  3NWS A;  1F2L A;  4JYA L;  1RF2 D;  5C5L A;  4AQY L;  4ZLT F;  1XMQ L;  3KBG A;  1E1T A;  2Z6B A;  1F2M A;  2PZT A;  4ODG A;  2JQO A;  2F0S A;  3OTO Q;  2B2Y C;  4IOA A;  4POF A;  1KAW A;  1OXT A;  2B39 A;  1TY0 A;  3BVG A;  3T1H L;  5C44 G;  3S14 B;  4DNT B;  1YHQ A;  5I9P A;  1I3Q B;  1SYC A;  1VQP A;  1UE1 A;  1PZI D;  1SE4 A;  3AQQ A;  5EKL A;  4B3R L;  1IYJ B;  4CDF C;  3OW2 A;  5IYD G;  3NUC A;  3W3A A;  5C3E B;  3LNN A;  1X56 A;  3IAY A;  5CMD A;  1VQ5 A;  2NN6 G;  1ENA A;  4J1M A;  5LMN W;  4U67 3;  4YWM A;  1QNK A;  4BY1 H;  3P1H A;  1ESF A;  3C2P A;  1STY A;  3TME A;  3LX0 A;  5FLX c;  4KY5 A;  1YJ9 A;  2VUM G;  2IY5 B;  3RMH A;  1IXR A;  2PYK A;  2F1M A;  4NP5 A;  2RA4 A;  2F0G A;  3NHH A;  4ZQ3 A;  1LTT D;  5FLM H;  1CA6 A;  2YU9 H;  4DU9 A;  5CBA E;  2B2W A;  1DGS A;  3F2D A;  1SYG A;  3JAM i;  4G7H C;  4XYO A;  1STA A;  4CKC A;  4JV5 Q;  4NXN Q;  2QDB A;  4JBW A;  2Z6K C;  5EPL A;  2FIN B;  2E74 C;  2MO0 A;  1M8A A;  3OWF A;  3KBX A;  4R9W A;  3H94 A;  2HHH Q;  1QB5 D;  5G3L F;  5DLQ E;  2TMP A;  1F2Y A;  1EUJ A;  4A4I A;  1I5F A;  1IKL A;  4C3I H;  3T56 B;  1XX8 A;  4CGY B;  2F0D A;  5A2Q E;  3HGB A;  1FR3 A;  1TWF H;  4IN3 A;  4X66 Q;  5D65 A;  2A8V A;  1XNR Q;  2A74 C;  4CKE A;  4GKK L;  3R2I A;  4HTH A;  1HR0 W;  2NN6 I;  4AYB E;  2R7F A;  3Q8D A;  5K5P A;  3DEO A;  5I4D A;  1YNN D;  1G29 1;  4HMI A;  3UDF A;  5IIF A;  2O4X A;  1YHB A;  4CJ2 C;  2M00 A;  1L0Y B;  1Y8O B;  2CW0 C;  1V1Q A;  3BDC A;  1N36 L;  2PCF B;  1C4Q A;  4LF6 L;  1JOK A;  1SSO A;  1BCP B;  2NTS A;  5IYB H;  3T1H Q;  3ERQ A;  5COY A;  2CQA A;  2RDF A;  4JI7 Q;  2MGS A;  5GAH C;  5C4H A;  4G4K A;  2OTL A;  2CWP A;  1PH6 A;  2IHF A;  1SMY D;  1MHW C;  3NK9 A;  2GVA A;  3CCL A;  2L15 A;  3I7F A;  2WIN B;  4B3S L;  4GS3 A;  2EY2 A;  4V0B A;  4XQJ A;  1LTG D;  1JWS D;  3JC6 6;  2VNU D;  1TS2 A;  1XTD A;  4RHR A;  1VQJ A;  4M1U B;  2EVB A;  2Z9H A;  3GTO B;  1TY2 A;  4P72 A;  5KRU A;  3S1N B;  4K14 A;  1Y1W H;  1Q1B A;  1JJ2 A;  3M3Y B;  1N32 L;  2N88 A;  3NE5 B;  2N49 A;  4MHE A;  3EA6 A;  4ZK9 B;  3P75 A;  2N55 A;  3N52 A;  1VQ8 A;  1U5K A;  4ZUJ A;  5IY0 A;  4BY1 G;  3TS2 A;  2E76 C;  4HIO A;  1FD7 D;  3Q22 A;  1SFO B;  4Y7N B;  3D4W A;  4NXM Q;  5M3M B;  4KN7 C;  5FLM G;  2A69 C;  4JI4 L;  2Y0S E;  3CHB D;  1CA5 A;  3CCU A;  1PTO F;  5CBE E;  2PW7 A;  2KQ3 A;  1BBW A;  2KJX A;  2F0L A;  4K8J A;  1DOL A;  1HJP A;  1UEB A;  1F9S A;  5ELD A;  2BDN A;  4F7X A;  1SNQ A;  2Q8T A;  2L5T A;  3VR3 A;  2NVX B;  1B1Z A;  3DEP A;  4QF4 A;  3G48 A;  4C1N I;  1PYS B;  3CRK C;  4DV4 L;  1CFM A;  1AFP A;  4DR4 Q;  1B53 A;  5JEA J;  3S1R B;  1E2Z A;  2QA4 A;  1NBW A;  2CHB D;  4QL5 A;  1ESR A;  4HED A;  1WCM B;  4GKJ L;  4DKA C;  4HAE A;  4C3I G;  3BS1 A;  3GQB A;  3U9O A;  4HJ8 A;  4DV2 Q;  3I4O A;  4DR7 Q;  1Z9F A;  4DK1 A;  3J81 j;  1KAA A;  3GV3 A;  1EU3 A;  3PUV A;  5ELO A;  3C3L A;  1I6H H;  4PG3 A;  1LTR D;  3ERS X;  2I0Q A;  4OWT B;  3FEW X;  2AWN A;  2F4V L;  3MA2 B;  2JA6 H;  1TWG B;  3J7Y W;  4JI3 L;  2RCF A;  2ENB A;  1I4X A;  1X65 A;  5IWA L;  3CC2 A;  2WFW A;  2F0H A;  4JI1 L;  2VQE L;  5LMU Q;  1VQO A;  1VQL A;  1TWH B;  3GTP B;  1L1O A;  3IKJ A;  1EY0 A;  2M9V A;  4UP8 A;  3VYS A;  1R4Q B;  1SYE A;  2H5X A;  1SYF A;  4K5X A;  2L9H A;  1LT6 D;  2QKI C;  1LUZ A;  1HHV A;  4LFC L;  2J7Z A;  1GUW A;  5KEE A;  4JPB W;  3G7L A;  3KF6 A;  5A2Q L;  1SE3 A;  1S40 A;  3KDF A;  1A2U A;  1JOO A;  1I4Q A;  3MC0 B;  3WOF A;  2NVQ H;  1YNX A;  1JT8 A;  3I70 A;  2RF4 A;  3KJP A;  3MXP A;  3I8Z A;  4HR7 B;  2RDH A;  5D3I B;  4GNX C;  3I4N B;  1PH2 A;  5JPN C;  4JOI C;  2JEB I;  4LAA A;  3QIA A;  1U4M A;  3DMU A;  3PUY A;  1STH A;  1LTI D;  2NVT B;  5AJ3 Q;  3OPO A;  1TS3 A;  4O1N A;  1D5M C;  3CCS A;  1GM5 A;  1RDP D;  2A6H C;  1FL0 A;  2BCO A;  4X65 L;  2ZM6 L;  4HIK A;  2RVL A;  1VDZ A;  4HJ9 A;  3RN5 A;  2WB1 G;  1SNP A;  1E1O A;  1MSG A;  4DV0 Q;  2ICE C;  4A3E B;  4I7Z C;  1Y1W G;  5EBC A;  4L5S A;  3Q24 A;  3GTQ H;  2UXB L;  3NBH B;  5KND A;  2TSS A;  2RSN A;  3NTK A;  1IBK Q;  4BBS B;  2A1A A;  1GUS A;  2UUB L;  1FNU A;  1X3Q A;  2HT1 A;  3ZJY C;  3W1G A;  2CW0 D;  3JAM L;  3CQZ H;  4OXP A;  3S14 H;  1VQB A;  1EY5 A;  1SJE D;  3EBE A;  4BBR B;  2RDG A;  1PTO C;  2GA4 B;  1E24 A;  3GDE A;  3TP6 A;  3TZU A;  2ZJP A;  2D5D A;  1IBM L;  4JVZ A;  1I94 Q;  4LW1 A;  4DXG A;  5JEA H;  2DUD A;  3OWE B;  1LAC A;  1BCP F;  1EU4 A;  4C3H B;  2NZ1 D;  1B2T A;  1D5Z C;  1NE3 A;  5IYC G;  4GLV B;  3OIP A;  1JOQ A;  3NQT A;  4LFA Q;  3U9S A;  4OEM B;  4ZKC B;  4B9X A;  4JI0 L;  4RFB A;  4FF1 A;  3K7U C;  4S3S A;  4DAY B;  4DXF A;  2L0C A;  1HNX L;  2BE5 C;  4F88 A;  5JVH 3;  3I4M H;  1PRT C;  3J81 L;  1WTW A;  3P7J A;  3K5N A;  5HUR A;  3G6J B;  2KCM A;  3HKS A;  3ULP A;  1BXT A;  1A63 A;  2AMC B;  3PQI A;  2IWH A;  1CTM A;  4YWL A;  1JWU D;  3HRZ C;  2VQF Q;  1J5E Q;  5M3F G;  3S2D B;  2UU9 L;  4PMB A;  1PH8 A;  3GTL B;  2JA6 G;  1G6P A;  4RA8 A;  5M9O A;  2A69 D;  1ICW A;  4FP5 D;  1AZQ A;  1QUQ B;  4BY7 H;  4A3C G;  1X3G A;  2E2J H;  1TS5 A;  1C9O A;  2YYZ A;  3CPW A;  2B2W C;  2B2V A;  2LXJ A;  1UUP A;  4OO1 H;  4EQ5 A;  2IW3 A;  4JK1 C;  2O2L D;  2PO4 A;  3S15 B;  5IGF A;  1LYL A;  2PZW A;  1AH9 A;  4KMU C;  1CHQ D;  2CH4 W;  3T1Y Q;  3HOU B;  2UXD Q;  3PMF A;  3UE1 A;  1A0I A;  4P74 A;  1OXX K;  5LL6 S;  5IGC A;  3WDN A;  2ZM6 Q;  4FF2 A;  3LWU A;  1RTN A;  2SNS A;  1HZ9 A;  2E2D C;  2KEE A;  1QZH A;  1ET6 A;  3A5U A;  4DUZ L;  1BBX C;  2PI2 A;  4FO2 A;  4A3K H;  1WTO A;  5AFW A;  1LTL A;  2IPK D;  1VMC A;  1WTX A;  3W5O A;  2UUB Q;  2XIW A;  4DV6 L;  1CKN A;  5LL6 X;  2VL6 A;  1A8V A;  1P16 A;  4K8I A;  2OQ0 A;  1E2W A;  5KYL A;  2R92 B;  4LF5 L;  3PO3 H;  3SK4 A;  1JB3 A;  3NSW A;  1KIX A;  3HOX B;  1CQV A;  3D4R A;  1IBM Q;  4CJ1 B;  2FMM A;  3SK6 A;  3K7A B;  3UI2 A;  4OEL B;  1NNX A;  3OTO L;  2JA5 B;  4YWK A;  1B9N A;  4DV5 Q;  4A3I B;  3HKZ E;  2R93 H;  5DM7 3;  3S1N H;  1TVX A;  2PMZ E;  1JE4 A;  4MNO A;  5JEA G;  3MFY A;  1S5D D;  4JC0 A;  4JI0 Q;  1ENC A;  3M3Y H;  4TQU S;  3FP9 A;  2ZTE A;  5C4X H;  1MGS A;  5JJZ A;  2B63 H;  2KED A;  2Q2U A;  1C48 A;  3MZ5 A;  2CH4 A;  2IL8 A;  1LO5 D;  1VQ7 A;  1RIP A;  4IUN A;  3CP0 A;  4KJN A;  4R4O A;  3TN2 A;  4DAM A;  3J80 L;  3K5O A;  2A6H D;  3KLR A;  2D0O A;  5M3M H;  1YNN C;  4QJF A;  4R4Q A;  3I4M G;  1STG A;  2QDL A;  1H9S A;  1XPO A;  4RCN A;  1QVF A;  1B50 A;  1T5E A;  3EQL C;  4N8X 1;  2XN9 C;  4QY7 A;  1O80 A;  4IUU A;  3MWY W;  4RGO S;  3S1M B;  1FNW A;  1XPR A;  3F1Z A;  2Z8L A;  3ERO A;  1HFG A;  2JP1 A;  1EQQ A;  3GTK B;  1PH7 A;  2I5L X;  1E3P A;  2NVX H;  3T16 A;  2F0N A;  1I4R A;  1QE6 A;  3H3V H;  2KUM A;  5CC4 A;  5D14 A;  1N33 Q;  4JV5 L;  4NXN L;  1XPU A;  4LUV A;  4GNX B;  4DF7 A;  1BOS A;  1EYA A;  2M2L A;  5E3F A;  1EIF A;  3GTG B;  4BY7 G;  4A3L H;  4DR6 Q;  4EX5 A;  5KNC A;  1UE6 A;  2HHH L;  1Q3L A;  3KUP A;  2K4K A;  1K8M A;  4JW0 A;  2JE6 I;  1K28 A;  3T51 B;  5K36 H;  2JYO A;  3QOJ A;  1EY8 A;  2R6G A;  1HQM C;  4IFD J;  4A75 A;  1D5X C;  5E1F A;  2XRS D;  1KTK A;  3A56 A;  4OL7 A;  1A3V A;  3FVQ A;  1V1P B;  4X66 L;  5ELN A;  2BE5 D;  4DR3 Q;  1XNR L;  1PRT D;  5IP9 H;  4RMF A;  3AFQ A;  3FDT A;  1TWH H;  1NMF A;  3GTP H;  5C0X J;  4DK0 A;  2F0J A;  4X6A H;  1I50 H;  1OXS C;  1B70 B;  1PTO B;  2EYH A;  3UDX A;  1T5X D;  1CUK A;  1HZA A;  1R9T B;  1AN8 A;  4A3K G;  5I6Y A;  1TWA B;  3A55 A;  3ITP A;  4RKL A;  1A15 A;  2KA7 A;  3CXC A;  4Z9C B;  3KF8 B;  2JJQ A;  4WFN 3;  1MIU A;  2UUC Q;  3K5L A;  3HKZ B;  3IFT A;  2K52 A;  3J7A 5;  1TKW B;  1CI3 M;  2PMZ B;  4FYD A;  3GTJ B;  2E2H B;  4X3K A;  5I6W A;  3PO2 B;  4FVM A;  3RLF A;  3T53 B;  1B8A A;  4KK7 A;  4J15 A;  5C3W A;  3URY A;  3PO3 G;  1IZ6 A;  3AEV A;  3I4N H;  4JI7 L;  1A3U A;  1OXV A;  1BDO A;  3L3O C;  2CVR A;  1NMG A;  5KIX A;  1L1O C;  2NVT H;  3S16 B;  1SNM A;  4ALP A;  4JI8 L;  1PRT B;  3NEM A;  2K14 A;  1KDC A;  5FOB B;  1YJW A;  4OO1 I;  2R93 G;  4MZ9 A;  3S17 H;  5M5W B;  3M85 A;  1SEB D;  4A3E H;  1EIH A;  5EKI A;  3G71 A;  4PZ6 A;  5C4X G;  1J8I A;  1TXY A;  3KJO A;  2B63 G;  1AZP A;  3E0E A;  4L63 B;  2VW9 A;  4A3F H;  4BBS H;  4DV3 L;  5IT9 c;  5JVG 3;  1ROD A;  3KOJ A;  2WKC A;  4MTK A;  4LUO A;  4ABN A;  4IZ8 A;  1SND A;  1EY4 A;  2EPB A;  4KKT A;  4O2D A;  1L0X B;  4HIM A;  1SAP A;  1K83 H;  1FVI A;  4FDB A;  3L0O A;  2BA1 A;  3H6M A;  4C3H H;  4NXM L;  4HN7 A;  2JA7 G;  3CAM A;  2L55 A;  1SNC A;  1CK1 A;  3OSO A;  2RHQ B;  4CBV A;  1BNZ A;  4A3G B;  3PIP 3;  3H15 A;  5EQ0 A;  2DNE A;  1C8C A;  2NVY H;  4HSP A;  4AYB G;  4OX9 Q;  4IFD H;  4OHJ A;  3CCM A;  1VQH A;  1U4R A;  3X3M A;  1MBY A;  3S2H H;  1GKH A;  1F9Q A;  1CSQ A;  4A3J H;  4A3L G;  5CV6 A;  2B8G A;  4DPG A;  5HGT A;  1EY9 A;  3RZO H;  1QWY A;  3HOV B;  4DR4 L;  3BU2 A;  1BR9 A;  4KY6 A;  5EPJ A;  5D3D A;  1LTA D;  4H44 C;  2Q8I B;  4FF4 A;  2F0P A;  5K36 G;  1LT4 D;  2O5J C;  3J81 i;  3Q0A A;  2VY3 A;  2R7Z H;  4DV2 L;  4B3T Q;  4DR7 L;  2AUJ D;  1ML0 D;  4KV6 A;  5JJI A;  2OT2 A;  1SE2 A;  1WTH A;  2EJG C;  3M4O H;  4LK1 C;  5FO8 B;  4KHP L;  2G5D A;  2WAQ B;  3ICE A;  1QNU A;  1V1O A;  4NB3 A;  2JSO A;  3SK8 A;  5IP9 G;  2KHJ A;  2KCT A;  1IBL Q;  5M5X B;  1SYB A;  2EYM A;  3PUX A;  2WAC A;  2D0P A;  1BF4 A;  3PIO A;  4YCU A;  5LMU L;  3HOY H;  2NWG A;  4ZCK A;  5C4Z A;  4L6T B;  2YTX A;  2QW7 A;  3TQY A;  2I07 B;  2K75 A;  4YHH Q;  2H4O A;  1KXL A;  1U9R A;  2N8N A;  4L8J A;  3OMG A;  3LGJ A;  3IL8 A;  3HOW B;  5JJK A;  4CDC C;  1VF7 A;  4JI8 Q;  3BG3 A;  2BH2 A;  4WJ3 M;  4V19 0;  4J8Q A;  2E5L Q;  3I4N G;  1WYD A;  3A74 A;  3H3V I;  5J22 A;  2EY6 A;  4RGT A;  2B2V C;  4BA1 I;  5FO9 B;  2MQH A;  3QR8 A;  4DNR B;  2RBM A;  3MEF A;  4FF3 A;  3BZK A;  4DV3 Q;  1EYC A;  4LF4 Q;  2Y0S G;  4WOR A;  2HIX A;  5CV9 A;  5AJ3 L;  5C44 B;  5GRO A;  4OON A;  4X62 L;  4A3E G;  2NBF A;  4JI6 Q;  2LKV A;  2K03 A;  5FLX L;  4C2M B;  3SXH A;  1S4Z A;  4X3U A;  5CV5 A;  4DUY Q;  4A3F G;  4YY3 Q;  4BBS G;  5BN4 A;  4DV0 L;  1NY4 A;  3E3X A;  3ULJ A;  4EQP A;  2I5M X;  4LNQ A;  2NYZ D;  2JA5 H;  2EQS A;  1TWC H;  1IBK L;  4N8F A;  1C0A A;  1PH1 A;  1DYQ A;  4RHS A;  5EKK A;  2RCN A;  4KJO A;  2EJM A;  4A3D B;  2VUM B;  4YIJ A;  1LT3 D;  4QIW B;  4K2K A;  4C3H G;  2UUA Q;  2AQ2 B;  3FKI H;  5HY6 A;  3PCO B;  3MVV A;  3HG9 A;  3VYT A;  1I94 L;  4P71 A;  2K5D A;  2B2T A;  3DM1 A;  4B9W A;  1HTP A;  5CV8 A;  1JC7 A;  3K8A A;  1UE5 A;  4IFD G;  1Q46 A;  1U4L A;  4A3M B;  1YIJ A;  4DAP A;  4LFA L;  1EEI D;  3M7N A;  4ID6 A;  4GLX A;  5BN3 A;  2F52 A;  4RG1 A;  4A3J G;  3J80 i;  3K57 A;  2OCE A;  3I55 A;  1PRT F;  1PFM A;  4KHP Q;  2ALY B;  4R8N A;  2QCP X;  1EY7 A;  3TSS A;  2JEA I;  3KLW A;  1K73 C;  3RNU A;  2F0W A;  2R7Z G;  3F2B A;  2WP8 J;  1I4G A;  4H7B A;  1SRO A;  4GN4 B;  2QIL A;  2ZTD A;  4A93 H;  4UY8 C;  2VQF L;  1J5E L;  1D1I A;  1V9P A;  1YVC A;  2EJF C;  2VB2 X;  2HIV A;  1N34 Q;  3A54 A;  1YZ6 A;  3RLN A;  3VYR A;  3MXG A;  2MUY A;  3U58 A;  1L1O B;  4Q0F A;  5FKA C;  1Q86 C;  3K6O A;  1Q8I A;  3A7L A;  2F0K A;  1W3S A;  1EWH A;  3CU7 A;  3K0X A;  3K81 C;  4LF9 Q;  3HOY G;  5IYB G;  3CPF A;  4K6D A;  2LS0 1;  3KF6 B;  4QUF A;  1KNE A;  3KDF B;  4FXK C;  4I65 A;  3W2D A;  2DNC A;  2VS1 A;  1EYD A;  3OIQ A;  2K7V A;  4N9P A;  5F2D A;  4CJ0 B;  3K5M A;  1B3A A;  4F8M A;  3N6R A;  1VQA A;  3T1Y L;  2ZTC A;  4IFD I;  2UXD L;  2CCZ A;  4IAL A;  1B4O A;  4X62 Q;  5FJ8 H;  2D62 A;  3BVZ A;  3NPP A;  3SGI A;  1R9T H;  2GN5 A;  1A2T A;  3AB9 A;  4KKS A;  4BA2 I;  2X6L A;  3R2T A;  2FJ2 A;  2KCN A;  3ZYY X;  2E2H H;  1OO9 B;  5LMN Q;  1XMO Q;  4QB4 A;  3GTJ H;  2K50 A;  4R4I A;  1L2F A;  4Y52 H;  4K0K Q;  4P73 A;  2FFK B;  1SJH D;  4B3M Q;  5C6A A;  2PQE A;  2B2U A;  3M4Y A;  4YCW A;  4KI0 A;  3D6W A;  4XYQ A;  4TVA B;  3VR5 A;  1G8Z D;  1I3Q H;  3G4S A;  5J3B A;  2JA5 G;  3QOL A;  3SEB A;  1GUO A;  3WOE A;  2H1E A;  3PUZ A;  4BY1 B;  5C3E H;  3S1Q B;  1LV9 A;  4LF7 Q;  2QEJ C;  1X3F A;  4RCO A;  3TP8 A;  3J7Z C;  4BWG B;  4LF8 Q;  1T9H A;  2F3I A;  2PNH A;  4X64 Q;  5IOC A;  2VZA A;  1GHJ A;  3SE0 A;  3I3C A;  1ZYR D;  2F4I A;  1PMR A;  4JI5 Q;  2PQA A;  3BVM A;  4G7Z C;  1O7I A;  1QOH A;  4DV5 L;  1MJC A;  3FKI G;  4ZAI A;  1XNQ Q;  2YU9 B;  1II3 A;  2HD3 A;  3DHQ A;  3TRE A;  1Y8P B;  1WVL A;  1W2B A;  2G9H D;  2I5H A;  2K1B A;  3Q23 A;  1HUM A;  1N9W A;  4A3B B;  2KOL A;  1PXU A;  1KC8 C;  5DNF A;  4I7A A;  1STE A;  3K59 A;  1W6J A;  2L4N A;  3VR2 A;  4QGU A;  3UE0 A;  2MHV A;  2JA8 B;  2AQ3 B;  4DAV A;  2XWB B;  4IOC A;  1HR0 Q;  4QMG A;  4O42 A;  4A3G H;  2KEC A;  1MI2 A;  4C3I B;  1VQN A;  1PFB A;  4KHZ A;  3GV6 A;  4A93 G;  1BKB A;  4CKB A;  1TWF B;  1AE3 A;  2LMC B;  3OMC A;  3B6Y A;  3HEJ A;  1E7Z A;  2OXP A;  2IT1 A;  4Q5V A;  3C1F A;  1IL8 A;  1JJC B;  1J6Q A;  1N33 L;  3HOV H;  1VQE A;  3HOZ B;  3TDQ A;  1YHA A;  2IX0 A;  1HXY D;  3D31 A;  1PYW D;  2EYP A;  3FPU B;  3CCR A;  4DR6 L;  3GO5 A;  1YJN A;  2SDF A;  2VXW A;  2CFM A;  2FMC A;  2FHT A;  3BYY B;  2QF7 A;  1D1K A;  2A73 B;  1HNW Q;  1GD7 A;  5C5M A;  4U68 A;  4DA2 A;  4KLK A;  1DCZ A;  1GO3 E;  1E2V A;  1EIG A;  2OQK A;  2F0T A;  3MTS A;  2ZXR A;  1SE8 A;  2K5H A;  3VR6 A;  4N9T A;  1GHK A;  1JIC A;  2YV5 A;  5FJ8 G;  4DR3 L;  2ES2 A;  2KVM A;  2OTJ A;  1TS4 A;  3NTI A;  1X55 A;  1AEX A;  1EOV A;  1FGU A;  4KD4 A;  3GD7 A;  2JXM B;  5EBD A;  4XXE A;  2AUK A;  2N78 A;  4G57 A;  1CKN B;  4DV1 Q;  2K05 A;  3CRL C;  1ENF A;  3STB C;  5CGK A;  4GOP A;  2L12 A;  4DR2 Q;  4C3J B;  2UUC L;  2EE1 A;  4RGN A;  2OF1 A;  2WB1 B;  2UXC Q;  3DM3 A;  4PZ8 A;  2ZJQ A;  1PFN A;  4GLA C;  1Y1W B;  2X69 A;  4RKB A;  4EVO A;  1LAB A;  5BR8 L;  1YEZ A;  4IUP A;  4ZUI A;  3TP5 A;  3GTO H;  3VR4 A;  4R4T A;  1XJV A;  4HMJ A;  2NZO A;  4IJH A;  5C3E G;  3I56 A;  1D6E C;  1VF5 C;  3L7Z C;  2C9O A;  3TEH B;  1GXD C;  1S72 A;  1NJI C;  4B08 A;  1HNZ Q;  3D0F A;  3PSI A;  2ZXO A;  1MJE A;  4KHV A;  1SFO H;  4O0A A;  1YBY A;  5A35 A;  1I6V C;  1RL2 A;  4Y7N H;  1B9M A;  1KD1 C;  1SNO A;  2LSS A;  2K5Q A;  2OWO A;  4E6I A;  2WKD A;  3I4L A;  4DR1 Q;  3TRZ A;  1B3Q A;  1H9S B;  2EYO A;  3CKI B;  4A3D H;  1JWM D;  1KDA A;  4H0L C;  3OYY A;  3U50 C;  3R8B A;  3RZD B;  1S5F D;  1UAP A;  3O13 A;  1CT1 D;  4AH6 A;  2XSC A;  4NPS A;  4A3G G;  2B8F A;  1NTG A;  4DK6 C;  4UHV A;  1EWI A;  4UDU C;  3M4Q A;  3BDL A;  1G6Z A;  3MXN A;  5JOB A;  1PA6 A;  3J7A V;  3S1R H;  3QB3 A;  1F77 A;  3E5S A;  4A3M H;  1BVS A;  1WFQ A;  2XTI A;  3TBI B;  5M3F B;  1WCM H;  1FJG L;  3CCQ A;  2AQ1 B;  1SRU A;  1RTO A;  3OHX C;  2B3G A;  2DY8 A;  4OO1 G;  4OX9 L;  3HOV G;  4BXX H;  1V8Q A;  3HP3 A;  1O78 A;  1HZC A;  3T13 A;  1S5B D;  2EY1 A;  2F0Q A;  4NMZ A;  3E0J A;  3H0G B;  4FXD A;  1Q1E A;  1TWG H;  3CW2 C;  5J39 A;  4OWX B;  4G7O C;  3MAQ A;  2Q2H A;  1Q8K A;  2CQO A;  2B2T C;  1KHI A;  4AIM A;  1WTV A;  4IQZ A;  1KDB A;  1ZEQ X;  2HDM A;  1IYU A;  1OXU A;  4B3T L;  3FMC A;  1Z47 A;  1RCV D;  3C1E A;  4F87 A;  4IUR A;  1GUT A;  3HZX A;  2RHS B;  2NVQ B;  5IE8 A;  4CDE C;  1IBL L;  5IT9 E;  1B44 D;  1EWC A;  2ZT9 C;  3FHW A;  2L11 A;  2WAQ E;  3R93 A;  5JAV A;  1K0S A;  1KL9 A;  3ND8 A;  1FNV A;  2K32 A;  4TRD A;  3C46 A;  1UE7 A;  1FGB D;  5BR8 Q;  1ASY A;  2R3Z A;  1G51 A;  4JI2 L;  4YHH L;  4GN3 B;  5IP7 H;  3IRB A;  2N3S A;  2G9D A;  1TR5 A;  4MTN A;  2Z0S A;  3KFU A;  1VQ9 A;  2C35 B;  2MFI A;  4BS9 A;  3GTQ B;  3BYT B;  3VDY A;  2E5L L;  4H02 A;  3V96 A;  2EYF A;  4DN4 M;  3HFZ B;  3A0J A;  5KGU A;  3CME A;  1VQC A;  1QVG A;  4IJL A;  1CZG A;  1JB7 A;  3CQZ B;  1Q12 A;  2SOB A;  1VQF A;  1PZJ D;  2D9U A;  3SDZ A;  5H1S E;  4JG2 A;  3E9H A;  1GVP A;  4PV1 C;  4LF4 L;  4WJ4 A;  1HUN A;  2EXZ A;  1NR2 A;  4BBR H;  5GAD C;  4JI6 L;  4XQQ A;  3DXJ C;  5M3M G;  3V2T A;  2BH8 A;  4DUY L;  2AHO B;  4YY3 L;  4UPA A;  2RSO A;  4K5V A;  1DJR D;  2KHI A;  1VS0 A;  2MO1 A;  4ZRZ A;  1D7Q A;  3S1Q H;  3QWN A;  4A3D G;  3STB D;  1HA6 A;  3TP7 A;  1I4P A;  2YTY A;  1TII D;  1BBU A;  3W1B A;  4IPD A;  2E2I B;  4L5T A;  1FJG Q;  3I4M B;  1YNJ C;  1HQR D;  2B2U C;  1GJX A;  3CCE A;  4YCV A;  3TS0 A;  5L37 A;  3I73 A;  3PF5 A;  5DAU A;  2BDO A;  4LFB Q;  1X3E A;  4L5R C;  2UUA L;  5T1G A;  4ME5 A;  3CCV A;  2A5H A;  5CV4 A;  4A3M G;  4PQX A;  5ELF A;  4A3B H;  4PMC A;  3GTM B;  1WCM G;  3MXU A;  1PYB A;  1H95 A;  3CC4 A;  2K33 A;  4QIW E;  3X3N A;  3KLS X;  3NP8 A;  3D8G A;  1P8L A;  1UWV A;  2JA8 H;  4BXX G;  2F3W A;  3S24 A;  2HQE A;  5C0X H;  3S2D H;  1QG7 A;  1PFS A;  1PDQ A;  2F0E A;  3U4Z A;  1QJO A;  1Y1V B;  1SLJ A;  1VQG A;  1BCP D;  1SN8 A;  4ZKB B;  3F2C A;  3D4D A;  3I91 A;  3GTL H;  2E2J B;  4BY7 B;  5I9O A;  4DV7 L;  1CHP D;  1ONL A;  2L1B A;  3CD6 A;  4P75 A;  1JJG A;  3MFG A;  4DR5 Q;  1CKM A;  3BZC A;  4PZ7 A;  3CMA A;  5C4J B;  1LM0 A;  5GQO A;  1XXG A;  1HH2 P;  2JA9 A;  3AYH B;  5NUC A;  1JMC A;  3RUZ A;  3OW7 A;  2P5Z X;  1JR0 D;  1K8A C;  2F0I A;  4PMW A;  3HOZ H;  4NKL A;  1HFN A;  3S15 H;  1WOC A;  4XT3 B;  1VQM A;  2PZU A;  4RAU C;  1N34 L;  5ELB A;  4JI2 Q;  4M8A A;  3HOU H;  1IW7 C;  4XTC S;  1KNA A;  4JYA Q;  1SR3 A;  3NEL A;  4AQY Q;  1DXM A;  1XMQ Q;  1K3B C;  1K8O A;  3OOC A;  1ZYR C;  1HZB A;  3P20 A;  4A3K B;  4LF9 L;  1A62 A;  1EY6 A;  3EIV A;  3L9A X;  2MP1 A;  1PV4 A;  4IUT A;  5IP7 G;  3AFP A;  3JAM E;  1WTP A;  1X54 A;  2LY7 A;  1CM9 A;  3FPP A;  3M9B A;  3PO3 B;  4EQO A;  5M5Y B;  4B3R Q;  3AU7 A;  2J4X A;  3ULL A;  2HQL A;  1EZ6 A;  5JPM C;  3E6Z X;  2A6E D;  4IUQ A;  2R92 H;  2XVS A;  1NR4 A;  2WII B;  3HOX H;  5IT9 L;  5DM6 3;  4C3J H;  3PUW A;  1PH5 A;  1PH9 A;  4IPH A;  5LMN L;  1XMO L;  3K7A H;  4FNF A;  1BUV T;  4ULL A;  2R93 B;  2K04 A;  3K0Y A;  1A3T A;  1Y69 U;  4K0K L;  4BBR G;  4WJW A;  2CWA A;  2A68 D;  2AWO A;  4B3M L;  5C4X B;  1S5C D;  3CCJ A;  1NSN S;  4A3I H;  2B63 B;  1G91 A;  5KNB A;  1K8G A;  2ATW A;  3J7A F;  1ILP A;  3EVQ A;  2EDG A;  3J81 E;  1DON A;  1EQR A;  3MEH A;  2K6A A;  1R4P B;  4HCE A;  3JAM c;  2F3V A;  1DD2 A;  4GOP C;  1FYC A;  2E75 C;  2BA0 A;  4LF7 L;  3Q6S A;  2EXD A;  3BZD B;  4LF8 L;  3PV0 A;  1RD9 D;  5HGQ A;  4X64 L;  4JI5 L;  5CYU A;  3L2P A;  2JA7 B;  4APV A;  2A19 A;  5IYC H;  1WD1 A;  1XNQ L;  1H9K A;  2O5I C;  4A3B G;  2SEB D;  4EGV A;  5ELC A;  3F8T A;  4H13 C;  4DV7 Q;  4LJZ C;  1G2S A;  5E7N A;  4RGM A;  1D8L A;  2JA8 G;  4AYB B;  3S1M H;  3RZD H;  4CDD C;  5C0X G;  3GTK H;  3RR5 A;  1NCV A;  2NTT A;  3DLL A;  4GKK Q;  3SVM A;  3RN2 A;  1S3O A;  4IO9 A;  3J81 c;  1EQT A;  1IL2 A;  1DOM A;  3VA5 A;  1HR0 L;  3GTG H;  3S9W A;  3AMU A;  1JCK B;  4MN3 A;  5M3F H;  4XQN A;  3PF4 A;  5JJL A;  1PVO A;  2K5W A;  4TSS A;  4RWS C;  2LFN A;  5E4W C;  4P2C B;  1L0W A;  1O7L A;  2B2Y A;  3QO2 A;  4ME3 A;  3PIP A;  3HOZ G;  2HCC A;  1EFI D;  1UEA B;  4HCS A;  1N36 Q;  1YNJ D;  4LF6 Q;  2DGY A;  3H0G H;  4A3C H;  4NDX A;  1Z6H A;  3HOU G;  1XTC D;  5ISR A;  1G2T A;  2Q2I A;  1BO0 A;  1K3R A;  1I50 B;  1RHP A;  2F0U A;  1AW7 A;  2PNR C;  3K58 A;  2BOS A;  1SDF A;  1LLR D;  3T4A C;  4B3S Q;  1PTO H;  2IX3 A;  3EN2 A;  1O7Y A;  3EFX D;  4DK3 C;  1HNW L;  1TWA H;  2XGT A;  1IYV A;  1YI2 A;  4WRD A;  2K5N A;  2EIF A;  2NUC A;  3NQI A;  1PHJ A;  1N8R C;  1J9O A;  1PH3 A;  5C0X I;  1H9M A;  5ELE A;  3PO2 H;  1ZKO A;  1O7Z A;  1N32 Q;  2R92 G;  2F03 A;  4HJ5 A;  2DJF C;  4C56 C;  1MSH A;  1M90 C;  3HOX G;  3LWE A;  5DEH A;  1IKM A;  4C3J G;  4MIU A;  4DV1 L;  1RJT A;  2Y0S B;  5LHY 1;  1K0R A;  3S16 H;  2PI2 E;  4DNI A;  3S17 B;  3J80 E;  4JBK A;  4DR2 L;  3NBH A;  4POG A;  2Z6K A;  1SYD A;  4UP9 A;  2FXQ A;  5EJW A;  2B29 A;  2UXC L;  3U4V A;  4A3I G;  1QVC A;  4LWC A;  1IW7 D;  1STN A;  4A3F B;  3PGZ A;  4DGZ A;  4JI4 Q;  4KTA A;  1VCI A;  1S5E D;  3VYU A;  5M5W H;  1CSP A;  1E22 A;  3QG1 A;  3NWT A;  2DN8 A;  1EQV A;  2ZXP A;  1EEF D;  2PQA B;  2WB1 E;  4L5Q A;  5IGB A;  4OGQ C;  3RLO A;  5GAG C;  1X9N A;  5EPK A;  1K83 B;  2V1C C;  2AKW B;  1B7Y B;  5KYI A;  2HCI A;  2V4D A;  4DV4 Q;  3MHB A;  2GVB A;  1PZK D;  2CKZ B;  1HNZ L; 
#chains in the Genus database with same CATH homology
 1STB A;  2PPB C;  1XYI A;  1WTQ A;  4XDX A;  2PW5 A;  4DAY A;  2F0M A;  2EYL A;  3A8I E;  2NVY B;  5I2X A;  5T1I A;  4CHT B;  3M7G A;  3DUZ A;  3R3O A;  4ILW A;  3S2H B;  3KLS A;  4A3J B;  4NW2 A;  2F0O A;  3FRP B;  4DFA A;  3RZO B;  1HPC A;  2WV6 D;  1TT2 A;  5COR A;  1D2B A;  4EQN A;  3QJY A;  5C3X A;  1TU2 B;  3HS0 C;  2R7Z B;  2HUG A;  2F0V A;  1WD0 A;  4XT1 B;  5IOD A;  3BDO A;  3M4O B;  5FK9 C;  4GZY C;  3DWQ A;  3KK7 A;  3GP7 A;  2K01 A;  3SHL A;  3ONA B;  3V05 A;  1Y8N B;  5EGT A;  4OIK A;  2D2C C;  5IGG A;  1A6X A;  4OIJ A;  3TZD A;  2EZV A;  4FXG C;  1GUG A;  3HOY B;  1M4V A;  5G3L D;  2ID0 A;  1LTS D;  1TQO A;  1X32 A;  2F0F A;  3I72 A;  2MJ8 A;  1H9J A;  2XNA C;  1PLF A;  1NAP A;  5FO7 B;  4UAI A;  1W6K A;  3DWA A;  5E4X A;  1CZW A;  5I2Y A;  4X3S A;  5IGD A;  4QUC A;  1RKN A;  1ET9 A;  3EJI A;  3D3R A;  3NXW A;  5TSS A;  1BQQ T;  1QCB D;  3H09 A;  4QCL A;  4X3T A;  3IFD A;  1SBB B;  1MD2 D;  1U4P A;  1X3P A;  3I90 A;  1IHZ A;  3ND9 A;  3SR1 A;  1JQY D;  4PNY A;  5IGE A;  2Q8R E;  1GOZ A;  1F9P A;  4IUV A;  3DWP A;  1KLG D;  1HA5 A;  2OEO A;  3A8K E;  1EL0 A;  1HCZ A;  2X6G A;  2I46 A;  1DOK A;  3RD4 A;  1DM0 B;  3NTH A;  1TWC B;  1ZXT A;  1LT5 D;  1BCP C;  2Z4H A;  1DZ1 A;  1KLU D;  1HRJ A;  2ICI A;  1H9R A;  1Q90 A;  2HDL A;  2IJ0 A;  2VB3 X;  2RKS A;  2NN6 H;  1AP0 A;  1ILQ A;  1EZ8 A;  4KKU A;  3FKI B;  1NUC A;  2KCC A;  1LTB D;  4HSV A;  3VA7 A;  3F2U A;  2RQX A;  1WTR A;  3A8J E;  2EYJ A;  1JOR A;  2Z4I A;  2MPM A;  1GUN A;  4R8I A;  2C5C A;  2XWJ B;  1CQF A;  1I6H B;  5CR3 A;  1EOT A;  1QIL A;  4KD3 A;  2KHS A;  5J1Z A;  2JA6 B;  3PIO 3;  4KY7 A;  2K28 A;  4J6H A;  1PTO D;  2NB0 A;  4A93 B;  2Z1C A;  5CV7 A;  1F2Z A;  1F9R A;  3D6C A;  1SMY C;  4K6L A;  3SK5 A;  4K5W A;  4K2L A;  2A6E C;  1UNS A;  3NBI A;  2J0T D;  1I4H A;  4ZYS A;  4KN4 C;  2IX1 A;  3A7A B;  1XWE A;  4XIG S;  4LMQ D;  1V1P A;  2DY7 A;  3H3V C;  2A68 C;  4C1N K;  2XRQ D;  1Z7T A;  1VMP A;  5BN5 A;  1HTL D;  2EY5 A;  1KAB A;  2R61 A;  4RH6 A;  2EOT A;  1E0B A;  2SNM A;  1V43 A;  3H91 A;  3KF8 A;  4TKO B;  5FLX E;  1SXT A;  3NWS A;  1F2L A;  1RF2 D;  5C5L A;  4ZLT F;  3KBG A;  1F2M A;  2PZT A;  4ODG A;  2F0S A;  2B2Y C;  1OXT A;  2B39 A;  1TY0 A;  3BVG A;  3S14 B;  4DNT B;  5I9P A;  1I3Q B;  1SYC A;  1PZI D;  1SE4 A;  5EKL A;  3NUC A;  3W3A A;  5C3E B;  3LNN A;  3IAY A;  5CMD A;  2NN6 G;  1ENA A;  4J1M A;  4U67 3;  1QNK A;  3P1H A;  1ESF A;  3C2P A;  1STY A;  3TME A;  3LX0 A;  4KY5 A;  3RMH A;  2PYK A;  2F1M A;  4NP5 A;  2RA4 A;  2F0G A;  3NHH A;  4ZQ3 A;  1LTT D;  1CA6 A;  4DU9 A;  5CBA E;  2B2W A;  1SYG A;  4G7H C;  4XYO A;  1STA A;  4CKC A;  2QDB A;  4JBW A;  5EPL A;  2FIN B;  2E74 C;  1M8A A;  3OWF A;  3KBX A;  4R9W A;  3H94 A;  1QB5 D;  5G3L F;  2TMP A;  1F2Y A;  1IKL A;  3T56 B;  1XX8 A;  4CGY B;  2F0D A;  5A2Q E;  3HGB A;  1FR3 A;  4IN3 A;  5D65 A;  2A74 C;  4CKE A;  3R2I A;  4HTH A;  2NN6 I;  5K5P A;  3DEO A;  5I4D A;  1YNN D;  1G29 1;  4HMI A;  5IIF A;  2O4X A;  4CJ2 C;  2M00 A;  1L0Y B;  1Y8O B;  2CW0 C;  3BDC A;  2PCF B;  1C4Q A;  1JOK A;  1SSO A;  1BCP B;  2NTS A;  3ERQ A;  5COY A;  2CQA A;  2RDF A;  2MGS A;  5C4H A;  4G4K A;  1SMY D;  3NK9 A;  2WIN B;  2EY2 A;  4V0B A;  4XQJ A;  1LTG D;  1JWS D;  2VNU D;  1TS2 A;  4RHR A;  4M1U B;  2EVB A;  3GTO B;  1TY2 A;  5KRU A;  3S1N B;  4K14 A;  1Q1B A;  3M3Y B;  2N88 A;  3NE5 B;  4MHE A;  3EA6 A;  4ZK9 B;  3P75 A;  2N55 A;  3N52 A;  4ZUJ A;  2E76 C;  1FD7 D;  3Q22 A;  1SFO B;  4Y7N B;  3D4W A;  5M3M B;  4KN7 C;  2A69 C;  3CHB D;  1CA5 A;  1PTO F;  5CBE E;  2PW7 A;  2KQ3 A;  2KJX A;  2F0L A;  4K8J A;  1DOL A;  1F9S A;  5ELD A;  2BDN A;  4F7X A;  1SNQ A;  2Q8T A;  2L5T A;  3VR3 A;  2NVX B;  1B1Z A;  3DEP A;  4QF4 A;  4C1N I;  3CRK C;  1CFM A;  1AFP A;  1B53 A;  5JEA J;  3S1R B;  1E2Z A;  2CHB D;  1ESR A;  4HED A;  1WCM B;  4HAE A;  4C3I G;  3BS1 A;  3GQB A;  3U9O A;  4DK1 A;  1KAA A;  3GV3 A;  1EU3 A;  3PUV A;  3C3L A;  1LTR D;  3FEW X;  2AWN A;  3MA2 B;  1TWG B;  3J7Y W;  2ENB A;  1I4X A;  2F0H A;  1TWH B;  3GTP B;  3IKJ A;  1EY0 A;  2M9V A;  3VYS A;  1R4Q B;  1SYE A;  1SYF A;  4K5X A;  2L9H A;  1LT6 D;  2QKI C;  1HHV A;  2J7Z A;  1GUW A;  5KEE A;  3G7L A;  5A2Q L;  1SE3 A;  1A2U A;  1JOO A;  1I4Q A;  3MC0 B;  3WOF A;  3I70 A;  3MXP A;  3I8Z A;  4HR7 B;  2RDH A;  5D3I B;  3I4N B;  5JPN C;  2JEB I;  4LAA A;  3QIA A;  1U4M A;  3DMU A;  3PUY A;  1STH A;  1LTI D;  2NVT B;  3OPO A;  1TS3 A;  4O1N A;  1D5M C;  1RDP D;  2A6H C;  2BCO A;  2RVL A;  1VDZ A;  1SNP A;  1MSG A;  2ICE C;  4A3E B;  4I7Z C;  5EBC A;  3Q24 A;  5KND A;  2TSS A;  2RSN A;  3NTK A;  4BBS B;  1GUS A;  1FNU A;  1X3Q A;  2CW0 D;  3JAM L;  1EY5 A;  1SJE D;  4BBR B;  2RDG A;  1PTO C;  2GA4 B;  3TP6 A;  3TZU A;  2D5D A;  5JEA H;  4DXG A;  3OWE B;  1LAC A;  1BCP F;  1EU4 A;  4C3H B;  2NZ1 D;  1B2T A;  1D5Z C;  3OIP A;  1JOQ A;  3NQT A;  3U9S A;  4ZKC B;  4B9X A;  4RFB A;  4FF1 A;  4S3S A;  4DXF A;  2L0C A;  2BE5 C;  4F88 A;  5JVH 3;  1PRT C;  3J81 L;  1WTW A;  3P7J A;  3K5N A;  5HUR A;  3G6J B;  1BXT A;  2IWH A;  1CTM A;  1JWU D;  3HRZ C;  3S2D B;  4PMB A;  3GTL B;  4RA8 A;  5M9O A;  2A69 D;  1ICW A;  4FP5 D;  1AZQ A;  1TS5 A;  2YYZ A;  2B2W C;  2B2V A;  1UUP A;  4OO1 H;  2IW3 A;  4JK1 C;  2O2L D;  2PO4 A;  3S15 B;  5IGF A;  2PZW A;  4KMU C;  1CHQ D;  3HOU B;  3PMF A;  1OXX K;  5LL6 S;  5IGC A;  3WDN A;  4FF2 A;  3LWU A;  1RTN A;  2SNS A;  2E2D C;  2KEE A;  1ET6 A;  1BBX C;  4FO2 A;  1WTO A;  5AFW A;  2IPK D;  1VMC A;  1WTX A;  2XIW A;  5LL6 X;  4K8I A;  1E2W A;  5KYL A;  2R92 B;  3SK4 A;  1JB3 A;  3NSW A;  3HOX B;  1CQV A;  3D4R A;  4CJ1 B;  2FMM A;  3SK6 A;  3K7A B;  3UI2 A;  2JA5 B;  1B9N A;  4A3I B;  5DM7 3;  1TVX A;  1JE4 A;  5JEA G;  3MFY A;  1S5D D;  1ENC A;  4TQU S;  1MGS A;  5JJZ A;  2KED A;  1C48 A;  3MZ5 A;  2IL8 A;  1LO5 D;  4IUN A;  3J80 L;  4KJN A;  3TN2 A;  3K5O A;  2A6H D;  3KLR A;  1YNN C;  1STG A;  1H9S A;  4RCN A;  1B50 A;  1T5E A;  3EQL C;  2XN9 C;  1O80 A;  4IUU A;  3MWY W;  4RGO S;  3S1M B;  1FNW A;  2Z8L A;  3ERO A;  1HFG A;  2JP1 A;  3GTK B;  3T16 A;  2F0N A;  1I4R A;  1QE6 A;  2KUM A;  5CC4 A;  5D14 A;  4DF7 A;  1BOS A;  1EYA A;  2M2L A;  5E3F A;  3GTG B;  5KNC A;  1Q3L A;  3KUP A;  1K8M A;  2JE6 I;  3T51 B;  5K36 H;  2JYO A;  3QOJ A;  1EY8 A;  2R6G A;  1HQM C;  4IFD J;  1D5X C;  5E1F A;  2XRS D;  1KTK A;  3A56 A;  4OL7 A;  1A3V A;  3FVQ A;  1V1P B;  2BE5 D;  1PRT D;  3FDT A;  5C0X J;  4DK0 A;  2F0J A;  1OXS C;  1PTO B;  2EYH A;  1T5X D;  1R9T B;  1AN8 A;  5I6Y A;  1TWA B;  3A55 A;  3ITP A;  4RKL A;  1A15 A;  2KA7 A;  4Z9C B;  4WFN 3;  3K5L A;  3HKZ B;  3IFT A;  2E2H B;  1TKW B;  1CI3 M;  2PMZ B;  4FYD A;  3GTJ B;  4X3K A;  5I6W A;  3PO2 B;  4FVM A;  3RLF A;  3T53 B;  4KK7 A;  5C3W A;  3URY A;  1A3U A;  1OXV A;  1BDO A;  3L3O C;  2CVR A;  5KIX A;  3S16 B;  1SNM A;  1PRT B;  1KDC A;  5FOB B;  4OO1 I;  5M5W B;  3M85 A;  1SEB D;  1EIH A;  5EKI A;  1J8I A;  1AZP A;  4L63 B;  5JVG 3;  1ROD A;  2WKC A;  4ABN A;  4IZ8 A;  1SND A;  1EY4 A;  2EPB A;  4KKT A;  1L0X B;  1SAP A;  2BA1 A;  3H6M A;  4HN7 A;  2L55 A;  1SNC A;  1CK1 A;  3OSO A;  4CBV A;  1BNZ A;  4A3G B;  3PIP 3;  5EQ0 A;  2DNE A;  1C8C A;  4HSP A;  4IFD H;  4OHJ A;  1U4R A;  3X3M A;  1MBY A;  1F9Q A;  5CV6 A;  2B8G A;  5HGT A;  1EY9 A;  1QWY A;  3HOV B;  4KY6 A;  1BR9 A;  5EPJ A;  5D3D A;  1LTA D;  4H44 C;  2Q8I B;  4FF4 A;  2F0P A;  5K36 G;  1LT4 D;  2O5J C;  3Q0A A;  2AUJ D;  1ML0 D;  4KV6 A;  2OT2 A;  1SE2 A;  2EJG C;  4LK1 C;  5FO8 B;  2WAQ B;  1QNU A;  1V1O A;  2JSO A;  3SK8 A;  5M5X B;  1SYB A;  2EYM A;  3PUX A;  2WAC A;  1BF4 A;  2NWG A;  5C4Z A;  4L6T B;  2I07 B;  2H4O A;  1U9R A;  4L8J A;  3OMG A;  3IL8 A;  3HOW B;  1VF7 A;  3BG3 A;  4V19 0;  4J8Q A;  5J22 A;  2EY6 A;  4RGT A;  2B2V C;  4BA1 I;  5FO9 B;  4DNR B;  2RBM A;  4FF3 A;  1EYC A;  4WOR A;  5CV9 A;  5C44 B;  2NBF A;  2LKV A;  2K03 A;  5FLX L;  4C2M B;  3SXH A;  1S4Z A;  4X3U A;  5CV5 A;  5BN4 A;  4EQP A;  2NYZ D;  1DYQ A;  4RHS A;  5EKK A;  4KJO A;  2EJM A;  4A3D B;  2VUM B;  4YIJ A;  1LT3 D;  4QIW B;  4K2K A;  4C3H G;  2AQ2 B;  3VYT A;  3MVV A;  3HG9 A;  2K5D A;  2B2T A;  3DM1 A;  4B9W A;  1HTP A;  5CV8 A;  1JC7 A;  4IFD G;  1U4L A;  4A3M B;  4DAP A;  1EEI D;  3M7N A;  4ID6 A;  5BN3 A;  3K57 A;  1PRT F;  1PFM A;  4R8N A;  2QCP X;  1EY7 A;  3TSS A;  2JEA I;  2F0W A;  2WP8 J;  1I4G A;  4H7B A;  2QIL A;  1D1I A;  2EJF C;  2VB2 X;  3A54 A;  3VYR A;  3MXG A;  2MUY A;  4Q0F A;  5FKA C;  3K6O A;  1Q8I A;  3A7L A;  2F0K A;  1EWH A;  3CU7 A;  4K6D A;  2LS0 1;  4QUF A;  1KNE A;  4FXK C;  3W2D A;  4I65 A;  2DNC A;  1EYD A;  3OIQ A;  2K7V A;  4N9P A;  5F2D A;  4CJ0 B;  3K5M A;  1B3A A;  4F8M A;  3N6R A;  4IFD I;  4IAL A;  1B4O A;  2D62 A;  3BVZ A;  3NPP A;  1A2T A;  3AB9 A;  4KKS A;  4BA2 I;  2X6L A;  3R2T A;  2FJ2 A;  2KCN A;  3ZYY X;  1OO9 B;  4QB4 A;  2FFK B;  1SJH D;  5C6A A;  2PQE A;  2B2U A;  3M4Y A;  4KI0 A;  3D6W A;  4XYQ A;  3VR5 A;  1G8Z D;  3QOL A;  3SEB A;  1GUO A;  3WOE A;  2H1E A;  3PUZ A;  4BY1 B;  3S1Q B;  1LV9 A;  2QEJ C;  3TP8 A;  4RCO A;  4BWG B;  5IOC A;  3SE0 A;  1GHJ A;  3I3C A;  1ZYR D;  2F4I A;  1PMR A;  3BVM A;  4G7Z C;  1QOH A;  4ZAI A;  2YU9 B;  1II3 A;  3DHQ A;  1Y8P B;  1WVL A;  2G9H D;  2K1B A;  3Q23 A;  1HUM A;  4A3B B;  2KOL A;  1PXU A;  5DNF A;  1STE A;  3K59 A;  1W6J A;  2L4N A;  3VR2 A;  2JA8 B;  2MHV A;  2AQ3 B;  4DAV A;  2XWB B;  4QMG A;  4O42 A;  2KEC A;  1MI2 A;  4C3I B;  1PFB A;  4KHZ A;  3GV6 A;  4CKB A;  1TWF B;  2LMC B;  3OMC A;  3HEJ A;  2OXP A;  2IT1 A;  4Q5V A;  3C1F A;  1IL8 A;  3HOZ B;  3TDQ A;  2IX0 A;  1HXY D;  3D31 A;  1PYW D;  2EYP A;  3FPU B;  3GO5 A;  2SDF A;  2VXW A;  2FMC A;  2FHT A;  3BYY B;  2QF7 A;  1D1K A;  2A73 B;  5C5M A;  4DA2 A;  4U68 A;  1DCZ A;  1E2V A;  1EIG A;  2F0T A;  3MTS A;  2ZXR A;  3VR6 A;  4N9T A;  1GHK A;  1JIC A;  2KVM A;  1TS4 A;  3NTI A;  1AEX A;  4KD4 A;  3GD7 A;  2JXM B;  5EBD A;  4XXE A;  2AUK A;  4G57 A;  2K05 A;  3CRL C;  1ENF A;  5CGK A;  2L12 A;  4C3J B;  2EE1 A;  4RGN A;  2OF1 A;  2WB1 B;  1PFN A;  1Y1W B;  2X69 A;  4RKB A;  4EVO A;  1LAB A;  4IUP A;  4ZUI A;  3TP5 A;  3VR4 A;  4HMJ A;  1D6E C;  1VF5 C;  3L7Z C;  2C9O A;  1GXD C;  4B08 A;  2ZXO A;  4KHV A;  5A35 A;  1I6V C;  1B9M A;  1SNO A;  2K5Q A;  4E6I A;  2WKD A;  3I4L A;  1H9S B;  2EYO A;  3CKI B;  1JWM D;  1KDA A;  4H0L C;  3R8B A;  3RZD B;  1S5F D;  1UAP A;  3O13 A;  1CT1 D;  2XSC A;  2B8F A;  4UDU C;  3BDL A;  1G6Z A;  3MXN A;  5JOB A;  3J7A V;  3QB3 A;  1F77 A;  3E5S A;  3TBI B;  5M3F B;  2AQ1 B;  1RTO A;  3OHX C;  2DY8 A;  4OO1 G;  1V8Q A;  3HP3 A;  1O78 A;  3T13 A;  1S5B D;  2EY1 A;  2F0Q A;  4NMZ A;  3E0J A;  3H0G B;  4FXD A;  1Q1E A;  5J39 A;  4G7O C;  3MAQ A;  2B2T C;  1WTV A;  4IQZ A;  1KDB A;  1ZEQ X;  2HDM A;  1IYU A;  1OXU A;  3FMC A;  1Z47 A;  1RCV D;  3C1E A;  4F87 A;  4IUR A;  1GUT A;  3HZX A;  2NVQ B;  5IT9 E;  1B44 D;  1EWC A;  2ZT9 C;  2L11 A;  3R93 A;  5JAV A;  3ND8 A;  1FNV A;  2K32 A;  4TRD A;  3C46 A;  1FGB D;  2R3Z A;  2G9D A;  1TR5 A;  4BS9 A;  3GTQ B;  3BYT B;  3V96 A;  2EYF A;  4DN4 M;  5KGU A;  1CZG A;  3CQZ B;  1Q12 A;  2SOB A;  1PZJ D;  2D9U A;  3SDZ A;  4PV1 C;  1HUN A;  2EXZ A;  1NR2 A;  4XQQ A;  3DXJ C;  3V2T A;  2RSO A;  4K5V A;  1DJR D;  4ZRZ A;  3QWN A;  1HA6 A;  3TP7 A;  1I4P A;  1TII D;  2E2I B;  3I4M B;  1YNJ C;  1HQR D;  2B2U C;  1GJX A;  3I73 A;  5DAU A;  2BDO A;  5T1G A;  4ME5 A;  2A5H A;  5CV4 A;  4PQX A;  5ELF A;  4PMC A;  3GTM B;  3MXU A;  2K33 A;  3X3N A;  3KLS X;  3NP8 A;  3D8G A;  2F3W A;  2HQE A;  5C0X H;  1QG7 A;  2F0E A;  1PDQ A;  1QJO A;  1Y1V B;  1BCP D;  4ZKB B;  4BY7 B;  3D4D A;  3I91 A;  2E2J B;  5I9O A;  1CHP D;  1ONL A;  2L1B A;  3MFG A;  5C4J B;  1XXG A;  5NUC A;  3RUZ A;  3OW7 A;  1JR0 D;  2F0I A;  4PMW A;  4NKL A;  1HFN A;  4XT3 B;  2PZU A;  4RAU C;  5ELB A;  4M8A A;  1IW7 C;  4XTC S;  1KNA A;  1DXM A;  1K8O A;  3OOC A;  1ZYR C;  3P20 A;  4A3K B;  1EY6 A;  3L9A X;  2MP1 A;  4IUT A;  3JAM E;  1WTP A;  2LY7 A;  1CM9 A;  3FPP A;  3PO3 B;  4EQO A;  5M5Y B;  3AU7 A;  2J4X A;  1EZ6 A;  5JPM C;  3E6Z X;  2A6E D;  4IUQ A;  2XVS A;  1NR4 A;  2WII B;  5IT9 L;  5DM6 3;  3PUW A;  4ULL A;  4FNF A;  1BUV T;  2R93 B;  2K04 A;  3K0Y A;  1A3T A;  1Y69 U;  4WJW A;  2A68 D;  2AWO A;  5C4X B;  1S5C D;  2B63 B;  1NSN S;  1G91 A;  5KNB A;  3J7A F;  1ILP A;  3EVQ A;  2EDG A;  3J81 E;  1DON A;  3MEH A;  2K6A A;  1R4P B;  4HCE A;  2F3V A;  1DD2 A;  1FYC A;  2E75 C;  2BA0 A;  3Q6S A;  3BZD B;  3PV0 A;  1RD9 D;  5CYU A;  2JA7 B;  1WD1 A;  1H9K A;  2O5I C;  2SEB D;  4EGV A;  5ELC A;  4H13 C;  4LJZ C;  1G2S A;  4RGM A;  4AYB B;  5C0X G;  1NCV A;  2NTT A;  3SVM A;  1EQT A;  1DOM A;  3VA5 A;  3S9W A;  3AMU A;  1JCK B;  4MN3 A;  4XQN A;  2K5W A;  4TSS A;  5E4W C;  2LFN A;  4RWS C;  4P2C B;  1O7L A;  2B2Y A;  3QO2 A;  2HCC A;  1EFI D;  1UEA B;  4HCS A;  1YNJ D;  4NDX A;  1Z6H A;  1XTC D;  5ISR A;  1G2T A;  1BO0 A;  1I50 B;  1RHP A;  2F0U A;  1AW7 A;  2PNR C;  3K58 A;  2BOS A;  1SDF A;  1LLR D;  3T4A C;  1PTO H;  2IX3 A;  1O7Y A;  3EFX D;  1IYV A;  4WRD A;  2NUC A;  3NQI A;  1J9O A;  5C0X I;  1H9M A;  5ELE A;  1ZKO A;  1O7Z A;  2F03 A;  4C56 C;  1MSH A;  3LWE A;  5DEH A;  1IKM A;  4C3J G;  4MIU A;  1RJT A;  2Y0S B;  5LHY 1;  3S17 B;  3J80 E;  3NBH A;  1SYD A;  5EJW A;  1IW7 D;  1STN A;  4A3F B;  4DGZ A;  4KTA A;  1VCI A;  1S5E D;  3VYU A;  3QG1 A;  3NWT A;  2DN8 A;  1EQV A;  2ZXP A;  1EEF D;  5IGB A;  4OGQ C;  5EPK A;  1K83 B;  5KYI A;  2HCI A;  2V4D A;  3MHB A;  1PZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...