1EWIA

Human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REPLICATION PROTEIN A
publication title Human replication protein A: global fold of the N-terminal RPA-70 domain reveals a basic cleft and flexible C-terminal linker.
pubmed doi rcsb
molecule tags Replication
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ewiA00
1K0RA 1HNXL 1HNZL 1EIYB 1PV4A 1PH8A 4JI6L 2AHOB 1WCMG 4DK3C 4DPGA 5AJ3L 4A3MG 2NVYH 1A8VA 1UE1A 4IPGA 3A5UA 2F4VL 1C0AA 1V1QA 3KF6B 5FJ8G 3L7ZC 1S40A 3HOZG 4QIWE 3U50C 1W2BA 1VQFA 2UUCL 1UEBA 3FHWA 3CXCA 2YTVA 4GN5A 1OXTA 1N8RC 2OQKA 1J5EL 3RZOH 4HJAA 3TS2A 1Q8KA 1K73C 1PH6A 1QVCA 3J81c 4JG2A 4PG3A 1KL9A 3HOXG 4R4OA 4JI8L 1YZ6A 5IYBG 1I94Q 5ELOA 1YEZA 2IX0A 3I4MG 4JV5Q 1YBYA 4A3CH 2K52A 4DKAC 4R4QA 4NXNQ 2MQHA 4ALPA 1IBLL 4JYAQ 3UDIA 4OWTB 2YTXA 4A3GH 4GLXA 4AYBE 4BBSG 4IOCA 4GNXB 1I5FA 1K83H 4YWLA 3CW2C 4QL5A 2UUBL 2MO1A 4P73A 1TWCH 2GN5A 4JI1L 1PHJA 1S3OA 2RHQB 2BA0A 5C3EG 3PIOA 2ZJRA 3MXNB 2E2IH 3J80c 2ATWA 2ID0A 4BY7G 1HNWQ 1U5KA 1TWFH 3CCRA 1GM5A 1ASZA 4A3BG 3CMEA 1OXVA 3M85A 2I0QA 3RLOA 4A3EG 4C3IH 1LYLA 4HJ7A 1VS0A 2ZM6L 4DV1Q 1XPRA 5M3FG 4YWKA 3BZCA 5LMNW 1E22A 3T1YQ 5IYDG 5IP9H 1PH1A 2PMZE 2IY5B 2VQFL 4JBWA 3EIVA 3IRBA 4UP7A 2UXDQ 1Y1VH 1PH9A 4DR3Q 1EQQA 3GTKH 4A3KG 3CCLA 1CKNA 2N3SA 2JEBI 2E5LL 3S1QH 5IT9c 3STBC 1L2FA 2HT1A 2ALYB 2VQEL 3CCEA 3I4OA 4BBRG 1N36L 3S16H 1HZBA 4AH6A 1I94L 2PI2E 4JI2Q 4LFCQ 1E3PA 1WCMH 4JI4Q 1AH9A 4DR4Q 2WB1G 1QZHA 3ER0A 2UXCL 3HOYG 2B63G 3J7A5 3KOJA 3BU2A 5C0XI 2Z6KC 4NXNL 1YVCA 4YHHL 3GDEA 1GVPA 1SMXA 5FJ8H 3G4SA 1GKHA 1EYGA 5GADC 4LF6Q 3HOZH 4IFDG 4L5QA 4X65Q 4DV4Q 4DUZQ 5M3MH 5LMNL 3S14H 1AE3A 4X66Q 3E9IA 4POGA 4JI7Q 1PH7A 3KDFB 3CCUA 2RF4A 3J7ZC 1VQMA 1XPOA 2K50A 3J80i 2AKWB 4XTCS 3HOXH 1NMGA 4DR7L 5IYBH 1VQCA 3RN2A 5IP7G 1Q82C 1HNZQ 4JI6Q 1G291 3KF6A 2ES2A 1TWHH 2LXKA 2LXJA 5AJ3Q 1VQLA 3I4MH 1E1OA 1KRTA 3TS0A 3J81j 2F4VQ 5IE8A 1C9OA 1N34L 1B70B 1KAWA 4RG1A 4LF7L 1P8LA 2UU9L 2KENA 3GD7A 1N32L 5FLMG 4A3GG 2ZTDA 3CQZH 4BBSH 3DM3A 1YHBA 2UUCQ 1I6HH 1VQ8A 3KJPA 2NN6G 4GN4B 4UP8A 3NENA 1J5EQ 3CC2A 3PO3H 3AYHB 4R4TA 1VQOA 4BY7H 4NB3A 2WB1E 2K5VA 5M5WH 1AE2A 1WYDA 3HKZG 4WJ4A 2K75A 4APVA 4A3EH 3KFUA 3JAMc 2EQSA 4DR1L 3RNUA 5HGQA 5M3FH 2D62A 4DUYL 2DGYA 2UUAQ 2EIFA 2Q2HA 3K0XA 3CCJA 3CPWA 4GNXA 1IBLQ 5K36G 1BVSA 1LM0A 3GTMH 1VQIA 2B29A 3I4NG 1IBKL 4A3KH 5EAYA 1E7ZA 2NZHA 4OWXB 4EQ5A 1XMOL 1QZGA 2UUBQ 3K81C 1CUKA 4JI1Q 2KCMA 1MJEA 4BXXH 1EIFA 1SROA 4IFDJ 1BKBA 3GTJH 1NY4A 1UWVA 1WOCA 1EWIA 3G48A 4UPAA 4GOPB 3PF4A 1QUQB 2R7ZH 2K4KA 1L0WA 2ZM6Q 3PUYA 4GLAC 4B3SL 4LUZA 2B63H 3HOYH 2K14A 1Q1EA 2AWOA 4XIGS 1OXSC 3SGIA 4C3JH 2VQFQ 4DV2L 4LFBL 2R93H 3CPFA 4LWCA 1K8GA 1VQPA 3H3VH 5M3MG 2IHEA 3PCOB 2E5LQ 4GKJL 5GAEC 4QQBX 1D8LA 2VQEQ 1NE3A 4R4CA 3HKZE 4HIKA 3HOWG 5IWAL 4X64L 1DGSA 1N36Q 5IP7H 3A74A 2JJQA 2PI2A 5GAGC 3A0JA 1CKMA 4GN3B 3JAMi 4YY3L 3UDXA 2NVTH 1VQDA 3RR5A 2UXCQ 2UUAL 2OTJA 2JA5G 2F52A 2IT1A 4YHHQ 3W5OA 2MNAA 3K7UC 1L1OC 5FLMH 4LW1A 3CC7A 3KDFA 2CKZB 3STBD 1GD7A 3ZJYC 5LMNQ 3K8AA 2A1AA 4X62L 3ICEA 3M7NA 3HOVH 3PO3G 4IPDA 3Q8DA 2JA9A 2KHIA 2D0PA 2D0OA 4DR7Q 3D31A 5JJKA 3H0GH 3EN2A 4A3JG 1X56A 2CWAA 5C0XG 1CKOA 4A76A 5JEAG 1JE5A 3ULPA 3OYYA 4L5SA 4DR5L 1SN8A 1YJNA 1N34Q 3M4PA 3BJUA 1LTLA 4ME3A 4LF7Q 1YHQA 2UU9Q 1N32Q 1UE6A 4DR6L 3AFPA 1XMQL 1X3GA 3S17H 1OXXK 1YHAA 4PMWA 1D7QA 3I4NH 1S72A 3TQYA 1VQJA 5HY6A 1HR0L 3T1HQ 3WWVA 4A3BH 3TREA 3J81i 3F2DA 4BA2I 4BXXG 1HZAA 2GVBA 4GLVB 4YCUA 4GS3A 5BR8L 4LF5L 3KLWA 4LNQA 2R7ZG 4UP9A 4DR1Q 3GTPH 1IYJB 4JI0L 3FKIG 4AQYL 1MIUA 2GVAA 3TEHB 4DUYQ 1SLJA 4A3DG 4POFA 3UDGA 3RLNA 3CCVA 1T9HA 3AFQA 2R93G 1H95A 1SE8A 1KD1C 3K7AH 1Y1WG 3F1ZA 3PV0A 4HJ8A 1IBKQ 1NBWA 3DLLA 1C7YA 3NBHB 2N8NA 4O0AA 4A4IA 4IJLA 4H02A 1MKHA 1XMOQ 1OXUA 1IL2A 1VQKA 1Q1BA 2R7DA 4GOPA 3HOWH 1QUQA 4YWMA 4HIMA 2OTLA 4IOAA 4C3HH 4HJ5A 4NPSA 1VQAA 2IHFA 1W3SA 1G51A 2ZTCA 4TQUS 4DV6Q 1IBML 1Y14B 3S15H 4B3SQ 4KHZA 4B3MQ 4JCVE 2F3IA 4DK6C 1X54A 2JA5H 4DV2Q 3F8TA 2HIXA 1SFOH 2IX1A 4LFBQ 5E7NA 2E2HH 1XNQL 5FLXc 4A93G 4Y7NH 4GKJQ 3FP9A 3HOVG 4R1JA 4IO9A 3EBEA 1KHIA 4BA1I 3T1HL 1MJCA 5GQOA 1RIPA 1PYBA 5IWAQ 4X64Q 3H0GG 2PQAB 4B3RQ 4A3JH 3G71A 1X6OA 1EFWA 1FGUA 3CCQA 3UE0A 1U0LA 4YY3Q 1NMFA 4DV7Q 1IZ6A 1B7YB 3B6YA 3M4QA 1Q7YC 1K9MC 2ZJQA 2MFIA 4OX9Q 3TRZA 3PO2G 4DV3L 1Q46A 2XGTA 2JA8G 1RL2A 3W1GA 5M5XH 3S2DH 3NELA 3I7FA 3MEFA 4IFDI 5IYCG 4X62Q 2VS1A 4IPCA 1YI2A 1Q12A 1PVOA 1CSQA 1A0IA 2QGQA 3L0OA 1UE5A 2RCNA 2H5XA 3PUVA 5DLQE 2OWOA 4O2DA 3PIPA 1FJGL 4L5RC 1VQNA 1SRUA 1TWGH 1R9TH 3KYHC 4QGUA 3UE1A 1VQGA 4DV5L 4GOPC 4A3FG 3GO5A 4RMFA 1KXLA 1V9PA 4DV6L 3M3YH 2C35B 2ASBA 5M5YH 1NTGA 3RZDH 3FKIH 2VW9A 4DR5Q 1VQEA 3E9HA 4B3ML 2NZOA 4A3DH 4WJ3M 3H15A 1YJ9A 1VQ5A 4DR6Q 1XMQQ 1HZ9A 4JC0A 1Y1WH 1EOVA 5H1SE 1KRSA 4A3IH 3OW2A 2I5MX 2V1CC 4JBJA 1HR0Q 4L5TA 4YCVA 2R92H 2NN6I 4OXPA 3I56A 3VDYA 4C2MH 2ZTEA 4DV0L 1K3RA 2BH2A 5C44G 5BR8Q 4PZ8A 4LF5Q 4B3RL 3KF8B 2KBNA 1YITA 3M9BA 4HIOA 1WI5A 1XNRQ 3GTGH 1WFQA 3A5ZB 2N78A 4JOIA 4DV7L 1JJ2A 3CAMA 3PSIA 4OX9L 4OO1I 2UXBL 4JI0Q 1VQBA 4EX5A 4AQYQ 2A8VA 2E8GA 1A62A 2Z0SA 4R4IA 2Q2IA 2CCZA 1XPUA 5LMUL 1G6PA 4AIMA 4GKKQ 1HR0W 4BBRH 2R6GA 3CMAA 2Y0SG 4GNXC 2LSSA 4A75A 4UY8C 3AEVA 4A93H 1VQ9A 2CWPA 1YNXA 4BY1H 4DNIA 1PFSA 3L2PA 1UE7A 1ASYA 2PNHA 4B3TL 3GTLH 3CCMA 3GTQH 4PZ6A 2KHJA 4JI5L 2XTIA 1KQSA 1LUZA 1VCIA 3KJOA 1P16A 2QA4A 2Z6KA 2AMCB 1X3EA 3U4ZA 1VQHA 1O7IA 2BH8A 4Y52H 1SR3A 1IBMQ 4X6AH 3PO2H 1A63A 1N33L 1X3FA 2VY3A 1JMCA 2A19A 2OQ0A 4LFAL 2I5HA 4TVAB 1L1OB 2JA8H 1X65A 4KHPQ 1QVGA 1KC8C 2WFWA 1XNQQ 3S1RH 5IYCH 1YIJA 4LF9Q 1I50H 4OONA 4DR2Q 2HHHQ 2VUMH 1NJIC 1TWAH 2PQAA 2Q2TA 5C4XG 1FL0A 3AQQA 4K0KQ 2YV5A 4JBKA 2DUDA 2R7FA 4A3FH 1XNRL 3CP0A 1Q81C 2JA6H 3JC66 3E0EA 3ERSX 3HKSA 3U4VA 2B3GA 3HOUH 2VNUD 3M4OH 3CD6A 4LF4Q 3PUZA 2Y0SE 4DV3Q 3PUXA 2L15A 4JOIC 3OTOQ 1TXYA 4IJHA 4GKKL 2FXQA 3F2BA 3S24A 1PH5A 4A3LG 2WP8J 2CFMA 1M1KC 1FVIA 3ULLA 1J6QA 4J15A 1PA6A 1PH3A 1VQ6A 3G6EA 2YYZA 2MO0A 1HH2P 4A3IG 1Z47A 4JI3Q 2R92G 3PUWA 3S1NH 4NXMQ 4LF8Q 2KCTA 1FJGQ 2WAQG 2JA7G 3S1MH 1N9WA 1Z9FA 2OCEA 1JT8A 5C44H 2I5LX 4DV5Q 4A3MH 4JV5L 2JK8A 3F2CA 1KIXA 1V43A 3CC4A 4JYAL 1X55A 4P71A 4PZ7A 3PF5A 3I2ZA 2JEAI 4KHPL 4LUOA 5C0XJ 2BA1A 4IPHA 1HZCA 5J3BA 5JEAJ 4DR2L 1M90C 2JQOA 3BZKA 4BY1G 2HHHL 4LF9L 3CF5A 3RLFA 4K0KL 2N49A 2CQOA 2E2JH 1HNWL 1HJPA 3W1BA 2RHSB 4DV0Q 1JB7A 1HNXQ 2VL6A 5IY0A 3I55A 2HIVA 4DAYB 2JE6I 2K5NA 3PGZA 1BBUA 5GROA 5GAHC 4DV1L 4A3CG 4KI0A 2UXBQ 2NVQH 1WJJA 4DAMA 2QEXA 1I3QH 1PYSB 3T1YL 4YCWA 1K8AC 4LF4L 4OWWB 3OTOL 5LMUQ 2EXDA 4JBMA 1PH2A 3S2HH 2UXDL 2AWNA 4DR3L 1IXRA 2K5HA 3NEMA 4KLKA 3UDFA 4HJ9A 2WAQE 1VQ7A 3H3VI 2VUMG 4JI3L 4NXML 4B3TQ 5JJLA 1CKNB 1BBWA 5C4XH 5C3EH 3U58A 2Q2UA 5JJIA 4JI8Q 1OTCA 3LGJA 1Q86C 4JI2L 4JI5Q 2HQLA 4LFCL 4OO1G 1E24A 3D0FA 4JI4L 4DR4L 2JA6G 1PH4A 3K80C 4QY7A 2YU9H 1XTDA 4P72A 4HIDA 1L1OA 1VQ4A 1YJWA 3HOUG 1CSPA 3ULJA 1N33Q 1EUJA 5IP9G 3GTOH 1JJCB 4MZ9A 5IYDH 4LF6L 2VZAA 4LFAQ 3RN5A 4QJFA 1Y1VG 1B8AA 4P74A 4X65L 4P75A 1GO3E 4DUZL 4DV4L 1QVFA 4A3LH 4X66L 4MNOA 1X9NA 4FDBA 4JI7L 1E1TA 2YTYA 4LUVA 4LF8L 2JA7H 1JJGA 5C4JH 4MTNA 4AYBG 5ELNA 2NVXH 3CCSA 2ZJPA 1XJVA 3HFZB 1EQRA
chains in the Genus database with same CATH superfamily
1H9KA 1HNXL 2XRSD 1EIYB 1K3BC 3TP5A 5JAVA 1WCMG 2SNSA 2G9DA 3GQBA 1EY4A 1I4RA 3L7ZC 1SMYC 1ILPA 4IFDH 4KMUC 4A3GB 1HA5A 1STYA 3CXCA 1UUPA 4K2LA 3RZOH 4HJAA 1Q8KA 1TWCB 4L63B 1K73C 1PH6A 1QVCA 1MBYA 1W6JA 1YEZA 3V2TA 3I4MG 4DFAA 3J7YW 4RHSA 1WTHA 4NXNQ 2MQHA 4FO2A 4ALPA 1IBLL 4FYDA 1GUWA 4A3GH 4AYBE 4BBSG 2A69D 4M1UB 1K83H 5FO7B 3I4NB 2PW7A 2UUBL 4P73A 1TWCH 2GN5A 1HPCA 1PHJA 4DNTB 2RHQB 3PIOA 3P75A 2ZJRA 3J80c 1JWSD 1ML0D 3OOCA 4RGNA 3DXJC 1OXVA 2KEDA 1WCMB 3RLOA 1AZPA 1LYLA 1PH1A 2VQFL 4UP7A 1Y1VH 2EY6A 4ZRZA 4DR3Q 5M3MB 2E5LL 1CT1D 2PNRC 1NNXA 2ALYB 3D8GA 1V1PA 4BBRG 1ZKOA 1Q90A 4CKCA 1EIHA 2AQ1B 4JI2Q 3K5MA 1WCMH 1ZXTA 1TWHB 3I4MB 3EFXD 5C0XI 2Z6KC 3GDEA 1VDZA 2RVLA 4L5QA 5M3MH 3CQZB 2DN8A 5LMNL 2E2HB 3W2DA 4JI7Q 3IFDA 4EQNA 4XXEA 3KDFB 2RF4A 1XPOA 1TS2A 2B8FA 1F9PA 1BCPF 4DK1A 4IALA 3J80i 1ESFA 2Z4IA 1V8QA 5C3WA 1LV9A 5IP7G 1HNZQ 1TWHH 4A3JB 1VQLA 5AJ3Q 3I4MH 3OMGA 1H9JA 1E1OA 2AQ3B 1RTOA 4KK7A 1C9OA 5IE8A 3SVMA 2UU9L 1OO9B 3CQZH 4HMIA 3GTMB 4BBSH 2UUCQ 4G7OC 2NN6G 1ICFB 3EROA 4UP8A 1J5EQ 1GUGA 4FF3A 4R4TA 1QNKA 2LS01 4MHEA 3J80E 1BF4A 4ZQ3A 1U4PA 4NMZA 3HKZG 4H0LC 4WJ4A 5IGBA 2B39A 1NR4A 3RNUA 1TS4A 2J0TD 5K36G 1LACA 3GTMH 5CORA 3CU7A 3QOLA 5IGFA 2NZHA 4OWXB 3MXNA 5J39A 1XMOL 1QZGA 1HFNA 1GUNA 2KCMA 1MJEA 4BXXH 2XWBB 2FFKB 5CV5A 1UWVA 4DN4M 3DWQA 2BOSA 1QUQB 3PUYA 4QB4A 4DV2L 3CPFA 2OXPA 2M00A 3LX0A 3RUZA 3E6ZX 4KD3A 4OIKA 4QQBX 4O42A 2EYPA 2VQEQ 4R4CA 1GUSA 1N36Q 3T13A 5IP7H 4C3HG 4XQJA 3HKZB 4YY3L 3OHXC 1B9NA 3E0JA 2IT1A 1H9SB 4RKBA 4KY5A 2EYJA 3CRLC 5ISRA 3QO2A 4LW1A 3STBD 1GD7A 5C3XA 4UHVA 2A1AA 1F9SA 2DNCA 5FLXL 3PO3G 4K2KA 4H44C 2EYLA 5G3LD 1WTXA 2D0PA 5JJKA 2XNAC 1SXTA 1KDBA 3UI2A 4TKOB 1CKOA 4A76A 1JE5A 3NTIA 3OYYA 4L5SA 3GTPB 1N34Q 3M4PA 4ME3A 4KY7A 1N32Q 5K36H 4DR6L 1X3GA 1D7QA 4ME5A 3K7AB 2FJ2A 1S72A 3MC0B 4HR7B 4N9TA 1PTOF 1HR0L 3T1HQ 2F0QA 3TREA 2C5CA 4GLVB 4TSSA 4YCUA 2Q8TA 4C3HB 3KLWA 4LNQA 2R7ZG 4DR1Q 3GTPH 1DCZA 2F0MA 2F3VA 5BN4A 4AQYL 1MIUA 1PYWD 3NBIA 4A3DG 5EPLA 1T9HA 1W6KA 2R93G 1DJRD 4K6LA 3FDTA 2KCNA 3K7AH 1Y1WG 3SXHA 4F8MA 3DLLA 3WOFA 1C7YA 1HUNA 4Y7NB 2R7DA 4GOPA 1MD2D 1ENFA 4YWMA 4TRDA 4IOAA 4C3HH 1D5ZC 1G51A 4B3SQ 1LABA 2F3IA 5JPNC 2A68C 5IIFA 4MTKA 2B2YA 5E7NA 3A56A 5J22A 4C56C 1XNQL 1WD1A 4Y7NH 2EXZA 4R1JA 3F2UA 2EJFC 5EPJA 1KHIA 2I07B 1B2TA 4FF1A 2PO4A 3OMCA 4PMCA 1F2YA 1I6VC 1YNJD 4UY8C 1E0BA 1EEFD 1Q7YC 1B7YB 3M4QA 1IZ6A 1EU4A 1JOKA 3E3XA 4K14A 2MFIA 4RCNA 2ZJQA 5M5YB 4L6TB 3K6OA 3QJYA 1Q46A 4A3DB 2JA8G 1RL2A 2PZWA 3W1GA 3NELA 3H3VC 1Y1WB 2PYKA 3MEFA 4FXKC 1XYIA 4DF7A 1A0IA 1UE5A 2RCNA 1FJGL 1VQNA 3WDNA 3I70A 5C5LA 5IGCA 1S5DD 3UE1A 4DV5L 1RCVD 1V9PA 5EJWA 4DV6L 3L3OC 1NTGA 5M5YH 2VW9A 2NZOA 4A3DH 1YJ9A 4RGOS 1ET6A 1XMQQ 1Y1WH 1EOVA 1EOTA 3NWSA 3HRZC 4BY1B 2NN6I 4OXPA 3I56A 1SYEA 4DV0L 2O5IC 2H4OA 1K3RA 4PZ8A 4B3RL 3KF8B 1Y8PB 2KUMA 1ILQA 4DV7L 4OO1I 3CAMA 3PSIA 4OX9L 4NW2A 2A8VA 2Q2IA 5LMUL 4LMQD 2ZXOA 2JA8B 4GNXC 3VYSA 1VQ9A 1YNXA 5EPKA 4BY1H 4DNIA 2B2WC 1UE7A 2PNHA 4K5VA 4IUQA 4JI5L 1LUZA 2D9UA 1P16A 2Z6KA 1D6EC 4RFBA 1IBMQ 1A63A 3HOUB 2A19A 1CQFA 1D5XC 2I5HA 2JA8H 3K5OA 5I6WA 4M8AA 4KHPQ 1KC8C 4DR2Q 1EWHA 2F0EA 5FOBB 2Q2TA 3AQQA 5I2YA 3G7LA 2HDMA 2YV5A 2CW0D 4JBKA 1CZGA 2LY7A 3T4AC 2IWHA 4WFN3 4FF2A 3ERSX 3K5NA 3HOUH 2VNUD 3OTOQ 4JOIC 2I46A 1TXYA 4GKKL 2FXQA 1PH5A 1LO5D 3TSSA 1PA6A 4A3IG 4JI3Q 1B9MA 2NB0A 3PUWA 4NXMQ 1SAPA 2KCTA 2DJFC 5M9OA 2WAQG 2JSOA 3I91A 1RF2D 3T56B 1JT8A 1X3QA 2X6GA 2CW0C 1JB3A 2NZ1D 1WTVA 1TS5A 3TN2A 1X55A 4ID6A 3R8BA 1FNUA 2XWJB 4LUOA 3VA7A 5C0XJ 1X32A 3SDZA 1LTID 5JEAJ 1IW7D 1HNWL 2RCFA 1WTPA 1HJPA 3W1BA 5C3EB 1HNXQ 2CVRA 3I55A 5GROA 3NUCA 5GAHC 4DV1L 4EVOA 3NWTA 1WJJA 2QEXA 3T1YL 1A2TA 1I3QH 2AUJD 1K8AC 1RODA 1SJED 1C4QA 1DZ1A 2AWNA 3NEMA 4KLKA 3UDFA 3Q0AA 3H3VI 2VUMG 1WD0A 5C3EH 3U58A 5JJIA 4DXFA 2WAQB 2HQLA 2KCCA 3J7AV 1IW7C 1V1PB 2JA6G 4QUFA 2NVYB 4P72A 4F7XA 1YJWA 3ULJA 2OF1A 1EUJA 1O7LA 1N33Q 1J8IA 2ICEC 3FPUB 4LFAQ 4DV4L 1GO3E 1BUVT 1X9NA 2KQ3A 3SEBA 4AYBG 5ELNA 1E2ZA 1ICWA 1PZKD 1PMRA 1UNSA 4HAEA 2K04A 2AHOB 4ILWA 4A3MG 4QUCA 2NVYH 3A5UA 4IPGA 2B2TA 2F4VL 2HUGA 1C0AA 2RA4A 1LTRD 2E2DC 2QCPX 1S40A 1QNUA 4QIWE 3U50C 2RSNA 5EBDA 1K8OA 1QOHA 2RBMA 3FHWA 5FLXE 2YTVA 1LT6D 2OQKA 3CKIB 3J81c 1KL9A 2HDLA 3S16B 2E2IB 3I90A 1YZ6A 3C1FA 5IYBG 1XX8A 4ABNA 4JV5Q 3KK7A 3NHHA 2K52A 1TKWB 5ELBA 1IKLA 3CRKC 5E4WC 4OWTB 3SK6A 1FGBD 4CDDC 4IOCA 1I5FA 2IX3A 3S1QB 1EYCA 3LWEA 4AYBB 3S16H 2BA0A 2E2IH 4BY7G 3MXNB 4K5XA 1JR0D 4S3SA 3CMEA 2ICIA 4N8FA 4PV1C 5M3FG 5LMNW 1E22A 5IYDG 1PRTB 4A3KG 3S1QH 2EY2A 3BDOA 2XN9C 2EE1A 5AFWA 1AEXA 3I4OA 2DJGC 2F0GA 4EQOA 3BVGA 1GJXA 4JI4Q 1YNND 3Q6SA 4CDFC 4IUPA 1A2UA 1MSGA 3HOYG 2IPKD 1BBXC 3KOJA 3QIAA 4PQXA 1YVCA 3G4SA 3A8KE 4IFDG 1QG7A 4X66Q 1NAPA 4R8IA 1I6HB 1PH7A 2CH4A 4RGMA 2L12A 2K50A 3EQLC 2AKWB 4XTCS 4BY7B 5IYBH 1VQCA 1Q82C 4JI6Q 1SNDA 3KF6A 2LXJA 1KRTA 1TU2B 1B53A 3V96A 4RH6A 1KAWA 1P8LA 4A3GG 2ZTDA 3DM3A 1J9OA 4C1NI 1YHBA 3K58A 1I6HH 3I73A 4A3KB 3KJPA 1EY9A 1MSHA 1VQOA 1MI2A 4BY7H 3C2PA 3GTJB 2FMCA 3OPOA 5JJZA 5HGQA 5M3FH 3TP6A 3HOYB 3IKJA 2Q2HA 4GNXA 4LAAA 5IGGA 1LM0A 2B29A 2B2WA 3I4NG 5KIXA 1IBKL 4A3KH 1BCPB 5EAYA 3A7LA 1B50A 1C48A 4JI1Q 1EIFA 3ZYYX 3GTJH 1WOCA 4GOPB 3NTHA 2MHVA 4KKTA 2ZM6Q 4KKSA 4GLAC 1B4OA 4LUZA 3HOYH 3QWNA 5COYA 4RAUC 4RWSC 4Q5VA 4XIGS 5KRUA 4LWCA 5EKKA 1WTQA 1K8GA 5M3MG 4MN3A 2NYZD 2IHEA 4IUVA 4GKJL 2XSCA 3QR8A 3C3LA 5D65A 2KHSA 3IFTA 1SYGA 5IWAL 3Q24A 1PDQA 2N55A 3H0GB 3FPPA 4NP5A 3UDXA 3HOZH 1VQDA 2UXCQ 2OTJA 2JA5G 4FF4A 2F52A 4YHHQ 2PPBC 3TDQA 5CBEE 3ZJYC 2Q8RE 1CFMA 1CQVA 3Q8DA 3VYRA 3A7AB 4DR7Q 4KV6A 3H0GH 1JC7A 3EN2A 1HRJA 4A3JG 3MEHA 3I3CA 4K5WA 1PTOD 2BE5C 5CV4A 4LF7Q 1LTLA 4KY6A 1YHQA 4I7AA 5IGEA 1OXXK 4PMWA 3I4NH 5CV8A 4OIJA 4BXXG 3D4DA 3F2DA 1HZAA 2RKSA 3R2TA 2GVBA 5BR8L 3OIQA 4LF5L 3KBGA 4IUNA 1HXYD 1IYJB 4JI0L 3S15B 2GVAA 4DUYQ 4POFA 3UDGA 2L5TA 2JA5B 3CCVA 1LTSD 1KD1C 3H91A 1SFOB 1PTOC 3PV0A 4O0AA 4A4IA 2EY5A 3S9WA 1VQKA 1Q1BA 4ZYSA 1EFID 1H9RA 1CI3M 2IW3A 2IHFA 1W3SA 2LFNA 4TQUS 1XWEA 4DV6Q 3S15H 1BXTA 4KHZA 4X3SA 4JCVE 3SHLA 2JA5H 1X54A 2K01A 4LFBQ 2HIXA 1SFOH 2HCCA 2E2HH 3TP7A 3FP9A 4IO9A 4HSVA 1MJCA 3HS0C 1S5CD 4X64Q 3TZDA 4B3RQ 1TWGB 4A3JH 1EFWA 4MIUA 1FGUA 5LL6S 1U0LA 4DV7Q 1NMFA 3B6YA 1CK1A 1SNPA 4OX9Q 4DV3L 1AP0A 1EY8A 2PW5A 2Z9HA 3ND8A 4IFDI 4X62Q 1Q8IA 2VS1A 1Z6HA 1YI2A 2G9HD 2R92B 2QGQA 3VYTA 3PIPA 4L5RC 4C2MB 1TWGH 1GUTA 4XYQA 4ZKBB 1KXLA 5KEEA 2Z1CA 1AN8A 2C35B 4CDEC 4DR5Q 4B3ML 3A54A 4ZUIA 3KLSA 3MXGA 1BOSA 3SE0A 2R92H 1O80A 3M7GA 5IT9L 2NBFA 3VDYA 3ERQA 4C2MH 3GTQB 2ZTEA 1ZYRD 3I8ZA 1ET9A 3R93A 3M9BA 1WI5A 2KOLA 3WOEA 1WFQA 3A5ZB 2N78A 1JJ2A 2UXBL 1I4PA 1VQBA 1XPUA 2CCZA 3NBHA 4GKKQ 4FXGC 4OHJA 2F0SA 3S1RB 1TY2A 2X69A 1I50B 5CMDA 1PFSA 4B3TL 1SBBB 1JCKB 3GTQH 1KQSA 1VCIA 2QA4A 1X3EA 2AMCB 1KNEA 1VQHA 2BDOA 1ZYRC 2N88A 4X6AH 2NWGA 1X3FA 3H6MA 2VY3A 2A73B 4TVAB 4ZUJA 2WFWA 4RCOA 3S1RH 2WKDA 3MFYA 1I50H 4OONA 3MFGA 1LTTD 1FL0A 3W3AA 1XXGA 2DUDA 5C4HA 1II3A 1A6XA 2A68D 1XNRL 1Q81C 3HKSA 3HP3A 1EY7A 2K5QA 3CD6A 3JAML 2A6ED 3PUXA 2L15A 5A2QL 2WV6D 1EY5A 5EGTA 1STNA 2WP8J 4A3LG 1M1KC 2PMZB 1FVIA 1J6QA 4J15A 1AFPA 5KGUA 2R61A 3ONAB 3FMCA 4LF8Q 3N6RA 1Z9FA 2OCEA 1C8CA 1EY0A 2I5LX 1JOOA 3F2CA 4DA2A 1V43A 2KEEA 4KJOA 1SYFA 3C1EA 2GA4B 1SNMA 2A6HC 4PZ7A 2XIWA 2A6EC 4IPHA 1HZCA 4R9WA 3RD4A 2HHHL 3BZKA 4BY1G 1STAA 4L8JA 1VF7A 2N49A 2CQOA 3BVMA 3R2IA 3EJIA 1QE6A 2RHSB 3J81L 2F0UA 2K5NA 1QWYA 3PIO3 4KI0A 2YU9B 4DAMA 4LF4L 2EXDA 1I4HA 2MPMA 3DEPA 4JBMA 4DR3L 3Q22A 4HJ9A 1B1ZA 1LLRD 3OW7A 1STBA 1GXDC 1LT4D 2XRQD 1FNVA 1DOKA 1EEID 4JI2L 3J7AF 3BG3A 1PH4A 3GV6A 4QY7A 2YU9H 2WB1B 2RQXA 4N8X1 3VR3A 2DY8A 3HOUG 2IL8A 4RA8A 1JJCB 4MZ9A 5IP9G 1QVFA 1TY0A 2FHTA 4A3LH 2K05A 1HTLD 4U68A 4JI7L 2JA7H 1L0XB 1FNWA 4LUVA 3VR6A 1JJGA 1UEAB 2F0OA 3J7A5 1F2ZA 1HTPA 1EQRA 1D5MC 1K0RA 1S5FD 1HNZL 2LKVA 2F0PA 1PV4A 1PH8A 4DK3C 5AJ3L 2MUYA 1UE1A 1V1QA 3KF6B 2MGSA 1BO0A 1G8ZD 1D2BA 2E75C 1VQFA 2UUCL 1UEBA 4GN5A 1OXTA 2KVMA 4QIWB 3TS2A 1J5EL 5ELFA 2RDFA 3HOXG 4PG3A 4R4OA 1JICA 5ELOA 1TWFB 3VR4A 2B2UC 1A3TA 4R4QA 2PZTA 5JVH3 4JYAQ 3UDIA 4IZ8A 3HGBA 4OGQC 4GLXA 3AU7A 4GNXB 2V4DA 3GTKB 4YWLA 3CW2C 4QL5A 4HMJA 5C3EG 4DAYA 3CCRA 1TWFH 1MGSA 3BVZA 1GM5A 4Q0FA 1QCBD 4A3EG 4HJ7A 1VS0A 4G7ZC 3BZCA 5A35A 2F0LA 1EIGA 5IP9H 1BR9A 1VMPA 2PMZE 5FK9C 1B3QA 5FKAC 1EZ6A 4JBWA 3EIVA 2R3ZA 2UXDQ 1PH9A 1EQQA 3GTKH 3CCLA 1CKNA 4O1NA 2JEBI 5IT9c 1GOZA 1BDOA 1B3AA 1L2FA 3HZXA 2VQEL 5KNBA 3HOXB 1N36L 1HZBA 4AH6A 1I94L 5EKLA 4LFCQ 1E3PA 1SNOA 1AH9A 2TSSA 4DR4Q 1QZHA 3RMHA 3ER0A 1G91A 3AB9A 2B63G 3BU2A 4G57A 1GVPA 4LF6Q 1GKHA 5GADC 4X65Q 4DUZQ 1BQQT 1Y8NB 1AE3A 1EZ8A 3E9IA 4POGA 1Y8OB 1KTKA 1RKNA 1VQMA 3HOXH 1NMGA 1GHJA 5ELEA 1ZEQX 2LXKA 4A3EB 3J81j 1FYCA 1ONLA 2WACA 3OWEB 3U9SA 3P20A 4DK0A 1N34L 1D1IA 4RG1A 5ELDA 1STEA 2KENA 3GD7A 3OIPA 1N32L 5FLMG 3TMEA 4XYOA 1VQ8A 3AMUA 2OT2A 4GN4B 3CC2A 1S5BD 2FINB 1U4RA 3AYHB 3D6CA 2CQAA 4I65A 2WB1E 3MTSA 2K5VA 3MVVA 1QILA 2IJ0A 4A3EH 1GUOA 2EQSA 3JAMc 4DR1L 2D62A 3DUZA 2B63B 3V05A 2D2CC 2EIFA 3K0XA 3CCJA 1IBLQ 2F0WA 1BVSA 1NR2A 1VF5C 2QDLA 2UUBQ 1HHVA 3K81C 1CUKA 1SYBA 5IT9E 4X3UA 1SROA 4OELB 4IFDJ 1GHKA 1WVLA 1NY4A 3G48A 4G7HC 1EWIA 2K4KA 1L0WA 1STGA 4B3SL 2B63H 4K8JA 2VQFQ 1OXSC 3SGIA 3ND9A 1M8AA 1SSOA 2F0FA 1F9RA 3PCOB 2AQ2B 1CHPD 1XTCD 2D5DA 2E5LQ 5GAEC 1T5XD 3LWUA 4QCLA 3HOVB 3X3MA 4WRDA 3NPPA 1NE3A 5CR3A 1STHA 4KHVA 5LHY1 2JYOA 3HOWG 5GAGC 3JAMi 4KJNA 3RR5A 2UUAL 3PO2B 3K7UC 1L1OC 5FLMH 3CC7A 2CKZB 3S17B 1UAPA 3K8AA 5LMNQ 1KNAA 3HOVH 4IPDA 3C46A 4A3BB 4J8QA 2EJGC 2D0OA 5DAUA 3D31A 1SYDA 3MZ5A 1X56A 4LK1C 3T16A 5C0XG 5JEAG 3SK8A 3JAME 1YJNA 2F0DA 1DOLA 3BJUA 4HTHA 5A2QE 4HEDA 2NUCA 5E3FA 2UU9Q 1XMQL 3S17H 5KNCA 5HY6A 2KECA 3WWVA 4A3BH 3J81i 4BA2I 4C1NK 5CV9A 1IL8A 3URYA 3HOWB 2AUKA 5T1IA 3DEOA 4PMBA 3TEHB 1SLJA 4KN4C 4JW0A 4BS9A 2B2VC 1Z7TA 3AFQA 3MAQA 1H95A 1SE8A 1T5EA 3F1ZA 1O7YA 1K28A 2Y0SB 3NBHB 1XMOQ 2L9HA 2SDFA 1OXUA 2ZXPA 3HOWH 3MWYW 2HD3A 3J81E 2OTLA 3SK5A 2F4IA 5I2XA 4NPSA 1E2WA 5ELCA 1IBML 1Y14B 1KAAA 4B3MQ 5IODA 4DV2Q 2IX1A 4EQPA 2CHBD 5E4XA 4A93G 4X3TA 1EY6A 3EBEA 2DY7A 1LTAD 1PYBA 3H0GG 5BN3A 1R9TB 1X6OA 5C0XH 4YY3Q 1K9MC 1R4PB 1X3PA 3P1HA 5JEAH 5BN5A 3TRZA 1DONA 2CH4W 2KJXA 1SE2A 2F0IA 3KLRA 1DOMA 2OWOA 3PUVA 2H5XA 1CZWA 2B2UA 1SDFA 3NQIA 1IKMA 1SRUA 2QF7A 5EKIA 4CBVA 1R9TH 4QGUA 1VQGA 4GOPC 4A3FG 2SNMA 1HFGA 3E9HA 2EOTA 3H15A 4DR6Q 1HZ9A 4JC0A 2QILA 4A93B 1KRSA 2V1CC 4JBJA 1HR0Q 1PFNA 4L5TA 4YCVA 2QEJC 5C44G 2BE5D 1YITA 1XNRQ 4JOIA 3VR2A 4EX5A 4AQYQ 4R4IA 2C9OA 2J4XA 1HR0W 4WJWA 3X3NA 3CMAA 1PZJD 5C5MA 2MP1A 4A93H 1K83B 1PRTF 3A55A 1I4QA 3EA6A 3L2PA 1ASYA 1TWAB 2F0JA 3VYUA 2JP1A 1S5ED 3M4YA 5L37A 3NSWA 4A3FB 2K1BA 2Z4HA 2BH8A 5IOCA 4XT3B 1SR3A 1EU3A 1N33L 5CGKA 4CKEA 3M4OB 1JMCA 2OQ0A 4XQQA 4CGYB 4LFAL 3DHQA 1TT2A 2L0CA 1X65A 1Y1VB 1QVGA 3FVQA 4DGZA 1XNQQ 5KYLA 1EYAA 1TS3A 2HHHQ 1NJIC 1TWAH 2PQAA 2L11A 4QMGA 3S1MB 1K8MA 2F0VA 5C44B 4A3FH 3K0YA 3JC66 2B3GA 1L0YB 2K5DA 2Z6BA 1HUMA 3M4OH 4LF4Q 2Y0SE 2HCIA 4IJHA 4ZLTF 3F2BA 3S24A 2CFMA 3ULLA 1PH3A 4N9PA 3VR5A 1Z47A 2R92G 2A69C 1FJGQ 4HCEA 2RDGA 3S1MH 3ITPA 4R8NA 5C44H 1B44D 5HURA 4DV5Q 4JV5L 1PLFA 5I4DA 2JK8A 1KIXA 3CC4A 1JE4A 3PF5A 1PTOB 4RHRA 2RSOA 4BBSB 4LF9L 5J3BA 2JQOA 2M2LA 2EYHA 1ENAA 4XT1B 3RLFA 4K0KL 1RJTA 3CHBD 4DV0Q 1JB7A 1LTGD 2HIVA 4DAYB 2JE6I 3PGZA 4A3CG 5CYUA 1A15A 2SOBA 3O13A 4GZYC 5LMUQ 1PH2A 1PTOH 2EJMA 1VQ7A 4FP5D 5C4JB 5JJLA 1CKNB 1DXMA 2Q2UA 2NVXB 2PZUA 1OTCA 3LGJA 4BBRB 3D6WA 4JI5Q 4H13C 4OO1G 4JI4L 4C3IG 4J1MA 2L55A 1H9MA 1L1OA 1CSPA 1LTBD 4P2CB 1F2MA 4QJFA 4P74A 4P75A 4X66L 4MNOA 4FDBA 1E1TA 2YTYA 3P7JA 2DNEA 5C4JH 1EQVA 5CC4A 1QB5D 1TIID 2NVXH 3CCSA 4BBRH 4JI6L 4DPGA 1A8VA 1NSNS 3DWPA 4FVMA 1M4VA 4QF4A 5FJ8G 3HOZG 3U9OA 1W2BA 1EL0A 5FO9B 3Q23A 3MXUA 1N8RC 2K6AA 2F0KA 1PFMA 1SE3A 4JG2A 1NUCA 4JI8L 3DWAA 1I94Q 2IX0A 3SK4A 5K5PA 1YBYA 4A3CH 2B2VA 4C3IB 2ENBA 4DKAC 1PFBA 4Z9CB 1JQYD 2BDNA 2YTXA 4ZK9B 2NN6H 2MO1A 1Y69U 2P5ZX 4JI1L 1S3OA 4CJ2C 4JPBW 4V190 1HNWQ 2ATWA 2ID0A 1U5KA 3BDLA 1ASZA 5F2DA 5DM73 4OO1H 3M85A 2I0QA 2A6HD 1XPRA 1SJHD 4C3IH 2ZM6L 4DV1Q 4HSPA 3I4LA 4YWKA 2NTTA 3T1YQ 2IY5B 2B2TC 1DYQA 1MHWC 3IRBA 3MXPA 1EWCA 3HOZB 3S14B 5DEHA 2N3SA 2K33A 3STBC 5C4ZA 2HT1A 4UDUC 4OL7A 3CCEA 2PI2E 5DM63 3HG9A 2WB1G 3TP8A 2UXCL 1IHZA 4YHHL 4NXNL 4XDXA 1SMXA 5TSSA 5FJ8H 4C3JG 3E5SA 4IQZA 5FO8B 3K5LA 3BS1A 1EYGA 4DV4Q 3S14H 4PNYA 4K8IA 2KA7A 1I4XA 3CCUA 3J7ZC 2VB3X 3PO3B 1HQRD 4DR7L 3RN2A 2MJ8A 1G291 2ES2A 5M5WB 3KBXA 2E74C 3TS0A 2NTSA 2F4VQ 1TR5A 1B70B 4LF7L 2XVSA 1G2SA 5JPMC 4B9WA 2PCFB 1RHPA 4KN7C 3NENA 4DXGA 3PO3H 4FNFA 2BCOA 4NB3A 4CJ0B 5M5WH 1AE2A 1WYDA 1QJOA 2K75A 4APVA 2O2LD 3KFUA 2R7ZB 2K7VA 1CTMA 4DUYL 2DGYA 2EPBA 4DAVA 2UUAQ 2EDGA 2WIIB 3K59A 1TQOA 3CPWA 4C3JB 2R93B 1VQIA 1U4LA 1O7ZA 3SR1A 2EYOA 1E7ZA 4JK1C 2A74C 4EQ5A 3T53B 1CA6A 1BKBA 3OWFA 4UPAA 3BZDB 3PQIA 2EY1A 4CHTB 4EGVA 2R7ZH 2VB2X 3PF4A 4BWGB 1FD7D 3A8JE 2NVTB 1JORA 2K14A 2L1BA 1S4ZA 1Q1EA 2AWOA 1YNJC 4C3JH 4LFBL 2L4NA 2R93H 1VQPA 4YIJA 3H3VH 1Q3LA 4X3KA 1PVOA 5LL6X 2ZT9C 1D8LA 2JN4A 3NK9A 5D3DA 3HKZE 4HIKA 3G6JB 4X64L 1DGSA 4E6IA 5J1ZA 3A74A 2JJQA 3IL8A 2PI2A 3A0JA 4KD4A 1CKMA 4GN3B 2B8GA 2NVTH 3H94A 3W5OA 1SNQA 2MNAA 2RDHA 3KDFA 4F87A 1DM0B 4XQNA 4HCSA 2Q8IB 1BNZA 2F0HA 4X62L 3TZUA 3ICEA 1F9QA 5EQ0A 3M7NA 1DD2A 4DAPA 2JA9A 2KHIA 1LT5D 2WINB 2CWAA 3ULPA 3PIP3 4FXDA 5G3LF 4DR5L 1SN8A 3OSOA 5D3IB 1UE6A 5I6YA 3AFPA 1YHAA 1FR3A 3TQYA 1VQJA 5I9PA 1K0SA 1A3UA 4GS3A 3A8IE 2FMMA 4UP9A 3N52A 2X6LA 3KUPA 3FKIG 2EVBA 3RLNA 2F1MA 5JVG3 4ZAIA 5CBAE 4HJ8A 1IBKQ 1NBWA 3D4WA 2HQEA 2N8NA 2K32A 4IJLA 4H02A 1MKHA 1IL2A 1G6ZA 3GP7A 1QUQA 4HIMA 1EQTA 4HJ5A 5IGDA 1VQAA 3BYTB 3DMUA 2ZTCA 1HCZA 4CKBA 4DK6C 3NXWA 1I3QB 1A3VA 3F8TA 2QKIC 5M5XB 5FLXc 1WTOA 3S2DB 1IYVA 4GKJQ 4B08A 3HOVG 1JOQA 3T1HL 4BA1I 1RD9D 2PQEA 5GQOA 1RIPA 5IWAQ 2PQAB 1ESRA 5CV7A 3DM1A 3G71A 4DNRB 1H9SA 3CCQA 3UE0A 2M9VA 5I9OA 3M3YB 1HA6A 3PO2G 3RZDB 3FKIB 2Z8LA 3D4RA 5HGTA 2XGTA 1NCVA 5M5XH 3S2DH 3I7FA 5E1FA 1JWMD 5IYCG 2EZVA 4IPCA 4A3IB 4KKUA 3L9AX 1Q12A 3IAYA 1KDCA 1CSQA 1O78A 1SNCA 3L0OA 5DLQE 4LF8L 4A3BG 4IN3A 3BYYB 4O2DA 3EVQA 4ULLA 3KYHC 3J80L 5EBCA 1I4GA 3QG1A 3GO5A 4RMFA 1KLUD 3GTGB 3M3YH 2ASBA 3RZDH 1PZID 3FKIH 4F88A 1VQEA 4WJ3M 3NTKA 1KLGD 2ZXRA 5KNDA 1VQ5A 4IUTA 2F03A 1D1KA 5H1SE 2EYMA 3OW2A 2I5MX 4A3IH 4LJZC 4ODGA 3GTLB 2F3WA 2K5WA 2BH2A 5BR8Q 4LF5Q 2KBNA 2VXWA 3QB3A 4HIOA 3GTGH 5D14A 1G2TA 2J7ZA 4G4KA 4IURA 4JI0Q 1PRTD 3LNNA 2E8GA 1A62A 2Z0SA 3PMFA 1G6PA 4I7ZC 4AIMA 2OEOA 2R6GA 2Y0SG 5NUCA 2LSSA 4A75A 3AEVA 3GV3A 2CWPA 1SE4A 3FEWX 5DNFA 4OEMB 2VUMB 4ZCKA 1IYUA 3GTLH 1SEBD 2K28A 4PZ6A 2KHJA 2XTIA 1CHQD 4V0BA 3KJOA 1E2VA 2A5HA 2EYFA 3U4ZA 1JWUD 1O7IA 1U4MA 4B9XA 2JA6B 4Y52H 3PO2H 4RGTA 1WTRA 1AW7A 1CM9A 3MA2B 1L1OB 1PRTC 4NKLA 5IYCH 1HQMC 1YIJA 4LF9Q 4WORA 2VUMH 1TVXA 3S1NB 5C4XG 2G5DA 4K0KQ 1VMCA 1F2LA 2LMCB 5KYIA 2R7FA 3CP0A 4JVZA 4A3MB 2JA6H 2F0TA 3QOJA 2H1EA 3E0EA 3U4VA 5T1GA 4UAIA 3PUZA 4CDCC 4DV3Q 2QDBA 3TBIB 1EYDA 4IUUA 1PXUA 1VQ6A 3G6EA 2YYZA 2MO0A 1HH2P 4J6HA 1F77A 3S1NH 3BDCA 2JA7G 1N9WA 5CV6A 2E2JB 2QW7A 4CJ1B 4A3MH 3NP8A 1U9RA 3MHBA 2NVQB 1KABA 1BCPD 4JYAL 4P71A 2SEBD 3I2ZA 2JEAI 4KHPL 3S2HB 2O5JC 1KDAA 2BA1A 4DR2L 1M90C 3I72A 3CF5A 1R4QB 3KF8A 2E2JH 5C4XB 4NDXA 1CA5A 2VL6A 5IY0A 1BBUA 3KLSX 2UXBQ 4DU9A 5M3FB 2NVQH 1PYSB 4YCWA 4OWWB 3GTOB 3OTOL 1YNNC 4U673 3K57A 3S2HH 2UXDL 2JXMB 3NE5B 1IXRA 2K5HA 3D3RA 1BCPC 4KTAA 2WAQE 1V1OA 4JI3L 4RKLA 4NXML 3T51B 4B3TQ 4H7BA 1BBWA 5C4XH 4JI8Q 2JA7B 1ENCA 3R3OA 1Q86C 4LFCL 1E24A 3D0FA 3NQTA 5JOBA 4HN7A 1SYCA 1RTNA 1AZQA 4DR4L 1SMYD 3K80C 1XTDA 4HIDA 1VQ4A 3GTOH 5IYDH 2K03A 4LF6L 2O4XA 2F0NA 2E76C 1LT3D 2VZAA 1RDPD 1Y1VG 1B8AA 3VA5A 5C6AA 4X65L 4DUZL 3RN5A 2WKCA 4K6DA 1WTWA 3FRPB 2TMPA 2B2YC 4ZKCB 3HEJA 4MTNA 3RZOB 3CCMA 2ZJPA 1XJVA 3H09A 3HFZB
chains in the Genus database with same CATH topology
1K0RA 1HNXL 1HNZL 1EIYB 1PV4A 1PH8A 4JI6L 2AHOB 1WCMG 4DK3C 4DPGA 5AJ3L 4A3MG 2NVYH 1A8VA 1UE1A 4IPGA 3A5UA 2F4VL 1C0AA 1V1QA 3KF6B 5FJ8G 3L7ZC 1S40A 3HOZG 4QIWE 3U50C 1W2BA 1VQFA 2UUCL 1UEBA 3FHWA 3CXCA 2YTVA 4GN5A 1OXTA 1N8RC 2OQKA 1J5EL 3RZOH 4HJAA 3TS2A 1Q8KA 1K73C 1PH6A 1QVCA 3J81c 4JG2A 4PG3A 1KL9A 3HOXG 4R4OA 4JI8L 1YZ6A 5IYBG 1I94Q 5ELOA 1YEZA 2IX0A 3I4MG 4JV5Q 1YBYA 4A3CH 2K52A 4DKAC 4R4QA 4NXNQ 2MQHA 4ALPA 1IBLL 4JYAQ 3UDIA 4OWTB 2YTXA 4A3GH 4GLXA 4AYBE 4BBSG 4IOCA 4GNXB 1I5FA 1K83H 4YWLA 3CW2C 4QL5A 2UUBL 2MO1A 4P73A 1TWCH 2GN5A 4JI1L 1PHJA 1S3OA 2RHQB 2BA0A 5C3EG 3PIOA 2ZJRA 3MXNB 2E2IH 3J80c 2ATWA 2ID0A 4BY7G 1HNWQ 1U5KA 1TWFH 3CCRA 1GM5A 1ASZA 4A3BG 3CMEA 1OXVA 3M85A 2I0QA 3RLOA 4A3EG 4C3IH 1LYLA 4HJ7A 1VS0A 2ZM6L 4DV1Q 1XPRA 5M3FG 4YWKA 3BZCA 5LMNW 1E22A 3T1YQ 5IYDG 5IP9H 1PH1A 2PMZE 2IY5B 2VQFL 4JBWA 3EIVA 3IRBA 4UP7A 2UXDQ 1Y1VH 1PH9A 4DR3Q 1EQQA 3GTKH 4A3KG 3CCLA 1CKNA 2N3SA 2JEBI 2E5LL 3S1QH 5IT9c 3STBC 1L2FA 2HT1A 2ALYB 2VQEL 3CCEA 3I4OA 4BBRG 1N36L 3S16H 1HZBA 4AH6A 1I94L 2PI2E 4JI2Q 4LFCQ 1E3PA 1WCMH 4JI4Q 1AH9A 4DR4Q 2WB1G 1QZHA 3ER0A 2UXCL 3HOYG 2B63G 3J7A5 3KOJA 3BU2A 5C0XI 2Z6KC 4NXNL 1YVCA 4YHHL 3GDEA 1GVPA 1SMXA 5FJ8H 3G4SA 1GKHA 1EYGA 5GADC 4LF6Q 3HOZH 4IFDG 4L5QA 4X65Q 4DV4Q 4DUZQ 5M3MH 5LMNL 3S14H 1AE3A 4X66Q 3E9IA 4POGA 4JI7Q 1PH7A 3KDFB 3CCUA 2RF4A 3J7ZC 1VQMA 1XPOA 2K50A 3J80i 2AKWB 4XTCS 3HOXH 1NMGA 4DR7L 5IYBH 1VQCA 3RN2A 5IP7G 1Q82C 1HNZQ 4JI6Q 1G291 3KF6A 2ES2A 1TWHH 2LXKA 2LXJA 5AJ3Q 1VQLA 3I4MH 1E1OA 1KRTA 3TS0A 3J81j 2F4VQ 5IE8A 1C9OA 1N34L 1B70B 1KAWA 4RG1A 4LF7L 1P8LA 2UU9L 2KENA 3GD7A 1N32L 5FLMG 4A3GG 2ZTDA 3CQZH 4BBSH 3DM3A 1YHBA 2UUCQ 1I6HH 1VQ8A 3KJPA 2NN6G 4GN4B 4UP8A 3NENA 1J5EQ 3CC2A 3PO3H 3AYHB 4R4TA 1VQOA 4BY7H 4NB3A 2WB1E 2K5VA 5M5WH 1AE2A 1WYDA 3HKZG 4WJ4A 2K75A 4APVA 4A3EH 3KFUA 3JAMc 2EQSA 4DR1L 3RNUA 5HGQA 5M3FH 2D62A 4DUYL 2DGYA 2UUAQ 2EIFA 2Q2HA 3K0XA 3CCJA 3CPWA 4GNXA 1IBLQ 5K36G 1BVSA 1LM0A 3GTMH 1VQIA 2B29A 3I4NG 1IBKL 4A3KH 5EAYA 1E7ZA 2NZHA 4OWXB 4EQ5A 1XMOL 1QZGA 2UUBQ 3K81C 1CUKA 4JI1Q 2KCMA 1MJEA 4BXXH 1EIFA 1SROA 4IFDJ 1BKBA 3GTJH 1NY4A 1UWVA 1WOCA 1EWIA 3G48A 4UPAA 4GOPB 3PF4A 1QUQB 2R7ZH 2K4KA 1L0WA 2ZM6Q 3PUYA 4GLAC 4B3SL 4LUZA 2B63H 3HOYH 2K14A 1Q1EA 2AWOA 4XIGS 1OXSC 3SGIA 4C3JH 2VQFQ 4DV2L 4LFBL 2R93H 3CPFA 4LWCA 1K8GA 1VQPA 3H3VH 5M3MG 2IHEA 3PCOB 2E5LQ 4GKJL 5GAEC 4QQBX 1D8LA 2VQEQ 1NE3A 4R4CA 3HKZE 4HIKA 3HOWG 5IWAL 4X64L 1DGSA 1N36Q 5IP7H 3A74A 2JJQA 2PI2A 5GAGC 3A0JA 1CKMA 4GN3B 3JAMi 4YY3L 3UDXA 2NVTH 1VQDA 3RR5A 2UXCQ 2UUAL 2OTJA 2JA5G 2F52A 2IT1A 4YHHQ 3W5OA 2MNAA 3K7UC 1L1OC 5FLMH 4LW1A 3CC7A 3KDFA 2CKZB 3STBD 1GD7A 3ZJYC 5LMNQ 3K8AA 2A1AA 4X62L 3ICEA 3M7NA 3HOVH 3PO3G 4IPDA 3Q8DA 2JA9A 2KHIA 2D0PA 2D0OA 4DR7Q 3D31A 5JJKA 3H0GH 3EN2A 4A3JG 1X56A 2CWAA 5C0XG 1CKOA 4A76A 5JEAG 1JE5A 3ULPA 3OYYA 4L5SA 4DR5L 1SN8A 1YJNA 1N34Q 3M4PA 3BJUA 1LTLA 4ME3A 4LF7Q 1YHQA 2UU9Q 1N32Q 1UE6A 4DR6L 3AFPA 1XMQL 1X3GA 3S17H 1OXXK 1YHAA 4PMWA 1D7QA 3I4NH 1S72A 3TQYA 1VQJA 5HY6A 1HR0L 3T1HQ 3WWVA 4A3BH 3TREA 3J81i 3F2DA 4BA2I 4BXXG 1HZAA 2GVBA 4GLVB 4YCUA 4GS3A 5BR8L 4LF5L 3KLWA 4LNQA 2R7ZG 4UP9A 4DR1Q 3GTPH 1IYJB 4JI0L 3FKIG 4AQYL 1MIUA 2GVAA 3TEHB 4DUYQ 1SLJA 4A3DG 4POFA 3UDGA 3RLNA 3CCVA 1T9HA 3AFQA 2R93G 1H95A 1SE8A 1KD1C 3K7AH 1Y1WG 3F1ZA 3PV0A 4HJ8A 1IBKQ 1NBWA 3DLLA 1C7YA 3NBHB 2N8NA 4O0AA 4A4IA 4IJLA 4H02A 1MKHA 1XMOQ 1OXUA 1IL2A 1VQKA 1Q1BA 2R7DA 4GOPA 3HOWH 1QUQA 4YWMA 4HIMA 2OTLA 4IOAA 4C3HH 4HJ5A 4NPSA 1VQAA 2IHFA 1W3SA 1G51A 2ZTCA 4TQUS 4DV6Q 1IBML 1Y14B 3S15H 4B3SQ 4KHZA 4B3MQ 4JCVE 2F3IA 4DK6C 1X54A 2JA5H 4DV2Q 3F8TA 2HIXA 1SFOH 2IX1A 4LFBQ 5E7NA 2E2HH 1XNQL 5FLXc 4A93G 4Y7NH 4GKJQ 3FP9A 3HOVG 4R1JA 4IO9A 3EBEA 1KHIA 4BA1I 3T1HL 1MJCA 5GQOA 1RIPA 1PYBA 5IWAQ 4X64Q 3H0GG 2PQAB 4B3RQ 4A3JH 3G71A 1X6OA 1EFWA 1FGUA 3CCQA 3UE0A 1U0LA 4YY3Q 1NMFA 4DV7Q 1IZ6A 1B7YB 3B6YA 3M4QA 1Q7YC 1K9MC 2ZJQA 2MFIA 4OX9Q 3TRZA 3PO2G 4DV3L 1Q46A 2XGTA 2JA8G 1RL2A 3W1GA 5M5XH 3S2DH 3NELA 3I7FA 3MEFA 4IFDI 5IYCG 4X62Q 2VS1A 4IPCA 1YI2A 1Q12A 1PVOA 1CSQA 1A0IA 2QGQA 3L0OA 1UE5A 2RCNA 2H5XA 3PUVA 5DLQE 2OWOA 4O2DA 3PIPA 1FJGL 4L5RC 1VQNA 1SRUA 1TWGH 1R9TH 3KYHC 4QGUA 3UE1A 1VQGA 4DV5L 4GOPC 4A3FG 3GO5A 4RMFA 1KXLA 1V9PA 4DV6L 3M3YH 2C35B 2ASBA 5M5YH 1NTGA 3RZDH 3FKIH 2VW9A 4DR5Q 1VQEA 3E9HA 4B3ML 2NZOA 4A3DH 4WJ3M 3H15A 1YJ9A 1VQ5A 4DR6Q 1XMQQ 1HZ9A 4JC0A 1Y1WH 1EOVA 5H1SE 1KRSA 4A3IH 3OW2A 2I5MX 2V1CC 4JBJA 1HR0Q 4L5TA 4YCVA 2R92H 2NN6I 4OXPA 3I56A 3VDYA 4C2MH 2ZTEA 4DV0L 1K3RA 2BH2A 5C44G 5BR8Q 4PZ8A 4LF5Q 4B3RL 3KF8B 2KBNA 1YITA 3M9BA 4HIOA 1WI5A 1XNRQ 3GTGH 1WFQA 3A5ZB 2N78A 4JOIA 4DV7L 1JJ2A 3CAMA 3PSIA 4OX9L 4OO1I 2UXBL 4JI0Q 1VQBA 4EX5A 4AQYQ 2A8VA 2E8GA 1A62A 2Z0SA 4R4IA 2Q2IA 2CCZA 1XPUA 5LMUL 1G6PA 4AIMA 4GKKQ 1HR0W 4BBRH 2R6GA 3CMAA 2Y0SG 4GNXC 2LSSA 4A75A 4UY8C 3AEVA 4A93H 1VQ9A 2CWPA 1YNXA 4BY1H 4DNIA 1PFSA 3L2PA 1UE7A 1ASYA 2PNHA 4B3TL 3GTLH 3CCMA 3GTQH 4PZ6A 2KHJA 4JI5L 2XTIA 1KQSA 1LUZA 1VCIA 3KJOA 1P16A 2QA4A 2Z6KA 2AMCB 1X3EA 3U4ZA 1VQHA 1O7IA 2BH8A 4Y52H 1SR3A 1IBMQ 4X6AH 3PO2H 1A63A 1N33L 1X3FA 2VY3A 1JMCA 2A19A 2OQ0A 4LFAL 2I5HA 4TVAB 1L1OB 2JA8H 1X65A 4KHPQ 1QVGA 1KC8C 2WFWA 1XNQQ 3S1RH 5IYCH 1YIJA 4LF9Q 1I50H 4OONA 4DR2Q 2HHHQ 2VUMH 1NJIC 1TWAH 2PQAA 2Q2TA 5C4XG 1FL0A 3AQQA 4K0KQ 2YV5A 4JBKA 2DUDA 2R7FA 4A3FH 1XNRL 3CP0A 1Q81C 2JA6H 3JC66 3E0EA 3ERSX 3HKSA 3U4VA 2B3GA 3HOUH 2VNUD 3M4OH 3CD6A 4LF4Q 3PUZA 2Y0SE 4DV3Q 3PUXA 2L15A 4JOIC 3OTOQ 1TXYA 4IJHA 4GKKL 2FXQA 3F2BA 3S24A 1PH5A 4A3LG 2WP8J 2CFMA 1M1KC 1FVIA 3ULLA 1J6QA 4J15A 1PA6A 1PH3A 1VQ6A 3G6EA 2YYZA 2MO0A 1HH2P 4A3IG 1Z47A 4JI3Q 2R92G 3PUWA 3S1NH 4NXMQ 4LF8Q 2KCTA 1FJGQ 2WAQG 2JA7G 3S1MH 1N9WA 1Z9FA 2OCEA 1JT8A 5C44H 2I5LX 4DV5Q 4A3MH 4JV5L 2JK8A 3F2CA 1KIXA 1V43A 3CC4A 4JYAL 1X55A 4P71A 4PZ7A 3PF5A 3I2ZA 2JEAI 4KHPL 4LUOA 5C0XJ 2BA1A 4IPHA 1HZCA 5J3BA 5JEAJ 4DR2L 1M90C 2JQOA 3BZKA 4BY1G 2HHHL 4LF9L 3CF5A 3RLFA 4K0KL 2N49A 2CQOA 2E2JH 1HNWL 1HJPA 3W1BA 2RHSB 4DV0Q 1JB7A 1HNXQ 2VL6A 5IY0A 3I55A 2HIVA 4DAYB 2JE6I 2K5NA 3PGZA 1BBUA 5GROA 5GAHC 4DV1L 4A3CG 4KI0A 2UXBQ 2NVQH 1WJJA 4DAMA 2QEXA 1I3QH 1PYSB 3T1YL 4YCWA 1K8AC 4LF4L 4OWWB 3OTOL 5LMUQ 2EXDA 4JBMA 1PH2A 3S2HH 2UXDL 2AWNA 4DR3L 1IXRA 2K5HA 3NEMA 4KLKA 3UDFA 4HJ9A 2WAQE 1VQ7A 3H3VI 2VUMG 4JI3L 4NXML 4B3TQ 5JJLA 1CKNB 1BBWA 5C4XH 5C3EH 3U58A 2Q2UA 5JJIA 4JI8Q 1OTCA 3LGJA 1Q86C 4JI2L 4JI5Q 2HQLA 4LFCL 4OO1G 1E24A 3D0FA 4JI4L 4DR4L 2JA6G 1PH4A 3K80C 4QY7A 2YU9H 1XTDA 4P72A 4HIDA 1L1OA 1VQ4A 1YJWA 3HOUG 1CSPA 3ULJA 1N33Q 1EUJA 5IP9G 3GTOH 1JJCB 4MZ9A 5IYDH 4LF6L 2VZAA 4LFAQ 3RN5A 4QJFA 1Y1VG 1B8AA 4P74A 4X65L 4P75A 1GO3E 4DUZL 4DV4L 1QVFA 4A3LH 4X66L 4MNOA 1X9NA 4FDBA 4JI7L 1E1TA 2YTYA 4LUVA 4LF8L 2JA7H 1JJGA 5C4JH 4MTNA 4AYBG 5ELNA 2NVXH 3CCSA 2ZJPA 1XJVA 3HFZB 1EQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0R A;  1HNX L;  1HNZ L;  1EIY B;  1PV4 A;  1PH8 A;  4JI6 L;  2AHO B;  1WCM G;  4DK3 C;  4DPG A;  5AJ3 L;  4A3M G;  2NVY H;  1A8V A;  1UE1 A;  4IPG A;  3A5U A;  2F4V L;  1C0A A;  1V1Q A;  3KF6 B;  5FJ8 G;  3L7Z C;  1S40 A;  3HOZ G;  4QIW E;  3U50 C;  1W2B A;  1VQF A;  2UUC L;  1UEB A;  3FHW A;  3CXC A;  2YTV A;  4GN5 A;  1OXT A;  1N8R C;  2OQK A;  1J5E L;  3RZO H;  4HJA A;  3TS2 A;  1Q8K A;  1K73 C;  1PH6 A;  1QVC A;  3J81 c;  4JG2 A;  4PG3 A;  1KL9 A;  3HOX G;  4R4O A;  4JI8 L;  1YZ6 A;  5IYB G;  1I94 Q;  5ELO A;  1YEZ A;  2IX0 A;  3I4M G;  4JV5 Q;  1YBY A;  4A3C H;  2K52 A;  4DKA C;  4R4Q A;  4NXN Q;  2MQH A;  4ALP A;  1IBL L;  4JYA Q;  3UDI A;  4OWT B;  2YTX A;  4A3G H;  4GLX A;  4AYB E;  4BBS G;  4IOC A;  4GNX B;  1I5F A;  1K83 H;  4YWL A;  3CW2 C;  4QL5 A;  2UUB L;  2MO1 A;  4P73 A;  1TWC H;  2GN5 A;  4JI1 L;  1PHJ A;  1S3O A;  2RHQ B;  2BA0 A;  5C3E G;  3PIO A;  2ZJR A;  3MXN B;  2E2I H;  3J80 c;  2ATW A;  2ID0 A;  4BY7 G;  1HNW Q;  1U5K A;  1TWF H;  3CCR A;  1GM5 A;  1ASZ A;  4A3B G;  3CME A;  1OXV A;  3M85 A;  2I0Q A;  3RLO A;  4A3E G;  4C3I H;  1LYL A;  4HJ7 A;  1VS0 A;  2ZM6 L;  4DV1 Q;  1XPR A;  5M3F G;  4YWK A;  3BZC A;  5LMN W;  1E22 A;  3T1Y Q;  5IYD G;  5IP9 H;  1PH1 A;  2PMZ E;  2IY5 B;  2VQF L;  4JBW A;  3EIV A;  3IRB A;  4UP7 A;  2UXD Q;  1Y1V H;  1PH9 A;  4DR3 Q;  1EQQ A;  3GTK H;  4A3K G;  3CCL A;  1CKN A;  2N3S A;  2JEB I;  2E5L L;  3S1Q H;  5IT9 c;  3STB C;  1L2F A;  2HT1 A;  2ALY B;  2VQE L;  3CCE A;  3I4O A;  4BBR G;  1N36 L;  3S16 H;  1HZB A;  4AH6 A;  1I94 L;  2PI2 E;  4JI2 Q;  4LFC Q;  1E3P A;  1WCM H;  4JI4 Q;  1AH9 A;  4DR4 Q;  2WB1 G;  1QZH A;  3ER0 A;  2UXC L;  3HOY G;  2B63 G;  3J7A 5;  3KOJ A;  3BU2 A;  5C0X I;  2Z6K C;  4NXN L;  1YVC A;  4YHH L;  3GDE A;  1GVP A;  1SMX A;  5FJ8 H;  3G4S A;  1GKH A;  1EYG A;  5GAD C;  4LF6 Q;  3HOZ H;  4IFD G;  4L5Q A;  4X65 Q;  4DV4 Q;  4DUZ Q;  5M3M H;  5LMN L;  3S14 H;  1AE3 A;  4X66 Q;  3E9I A;  4POG A;  4JI7 Q;  1PH7 A;  3KDF B;  3CCU A;  2RF4 A;  3J7Z C;  1VQM A;  1XPO A;  2K50 A;  3J80 i;  2AKW B;  4XTC S;  3HOX H;  1NMG A;  4DR7 L;  5IYB H;  1VQC A;  3RN2 A;  5IP7 G;  1Q82 C;  1HNZ Q;  4JI6 Q;  1G29 1;  3KF6 A;  2ES2 A;  1TWH H;  2LXK A;  2LXJ A;  5AJ3 Q;  1VQL A;  3I4M H;  1E1O A;  1KRT A;  3TS0 A;  3J81 j;  2F4V Q;  5IE8 A;  1C9O A;  1N34 L;  1B70 B;  1KAW A;  4RG1 A;  4LF7 L;  1P8L A;  2UU9 L;  2KEN A;  3GD7 A;  1N32 L;  5FLM G;  4A3G G;  2ZTD A;  3CQZ H;  4BBS H;  3DM3 A;  1YHB A;  2UUC Q;  1I6H H;  1VQ8 A;  3KJP A;  2NN6 G;  4GN4 B;  4UP8 A;  3NEN A;  1J5E Q;  3CC2 A;  3PO3 H;  3AYH B;  4R4T A;  1VQO A;  4BY7 H;  4NB3 A;  2WB1 E;  2K5V A;  5M5W H;  1AE2 A;  1WYD A;  3HKZ G;  4WJ4 A;  2K75 A;  4APV A;  4A3E H;  3KFU A;  3JAM c;  2EQS A;  4DR1 L;  3RNU A;  5HGQ A;  5M3F H;  2D62 A;  4DUY L;  2DGY A;  2UUA Q;  2EIF A;  2Q2H A;  3K0X A;  3CCJ A;  3CPW A;  4GNX A;  1IBL Q;  5K36 G;  1BVS A;  1LM0 A;  3GTM H;  1VQI A;  2B29 A;  3I4N G;  1IBK L;  4A3K H;  5EAY A;  1E7Z A;  2NZH A;  4OWX B;  4EQ5 A;  1XMO L;  1QZG A;  2UUB Q;  3K81 C;  1CUK A;  4JI1 Q;  2KCM A;  1MJE A;  4BXX H;  1EIF A;  1SRO A;  4IFD J;  1BKB A;  3GTJ H;  1NY4 A;  1UWV A;  1WOC A;  1EWI A;  3G48 A;  4UPA A;  4GOP B;  3PF4 A;  1QUQ B;  2R7Z H;  2K4K A;  1L0W A;  2ZM6 Q;  3PUY A;  4GLA C;  4B3S L;  4LUZ A;  2B63 H;  3HOY H;  2K14 A;  1Q1E A;  2AWO A;  4XIG S;  1OXS C;  3SGI A;  4C3J H;  2VQF Q;  4DV2 L;  4LFB L;  2R93 H;  3CPF A;  4LWC A;  1K8G A;  1VQP A;  3H3V H;  5M3M G;  2IHE A;  3PCO B;  2E5L Q;  4GKJ L;  5GAE C;  4QQB X;  1D8L A;  2VQE Q;  1NE3 A;  4R4C A;  3HKZ E;  4HIK A;  3HOW G;  5IWA L;  4X64 L;  1DGS A;  1N36 Q;  5IP7 H;  3A74 A;  2JJQ A;  2PI2 A;  5GAG C;  3A0J A;  1CKM A;  4GN3 B;  3JAM i;  4YY3 L;  3UDX A;  2NVT H;  1VQD A;  3RR5 A;  2UXC Q;  2UUA L;  2OTJ A;  2JA5 G;  2F52 A;  2IT1 A;  4YHH Q;  3W5O A;  2MNA A;  3K7U C;  1L1O C;  5FLM H;  4LW1 A;  3CC7 A;  3KDF A;  2CKZ B;  3STB D;  1GD7 A;  3ZJY C;  5LMN Q;  3K8A A;  2A1A A;  4X62 L;  3ICE A;  3M7N A;  3HOV H;  3PO3 G;  4IPD A;  3Q8D A;  2JA9 A;  2KHI A;  2D0P A;  2D0O A;  4DR7 Q;  3D31 A;  5JJK A;  3H0G H;  3EN2 A;  4A3J G;  1X56 A;  2CWA A;  5C0X G;  1CKO A;  4A76 A;  5JEA G;  1JE5 A;  3ULP A;  3OYY A;  4L5S A;  4DR5 L;  1SN8 A;  1YJN A;  1N34 Q;  3M4P A;  3BJU A;  1LTL A;  4ME3 A;  4LF7 Q;  1YHQ A;  2UU9 Q;  1N32 Q;  1UE6 A;  4DR6 L;  3AFP A;  1XMQ L;  1X3G A;  3S17 H;  1OXX K;  1YHA A;  4PMW A;  1D7Q A;  3I4N H;  1S72 A;  3TQY A;  1VQJ A;  5HY6 A;  1HR0 L;  3T1H Q;  3WWV A;  4A3B H;  3TRE A;  3J81 i;  3F2D A;  4BA2 I;  4BXX G;  1HZA A;  2GVB A;  4GLV B;  4YCU A;  4GS3 A;  5BR8 L;  4LF5 L;  3KLW A;  4LNQ A;  2R7Z G;  4UP9 A;  4DR1 Q;  3GTP H;  1IYJ B;  4JI0 L;  3FKI G;  4AQY L;  1MIU A;  2GVA A;  3TEH B;  4DUY Q;  1SLJ A;  4A3D G;  4POF A;  3UDG A;  3RLN A;  3CCV A;  1T9H A;  3AFQ A;  2R93 G;  1H95 A;  1SE8 A;  1KD1 C;  3K7A H;  1Y1W G;  3F1Z A;  3PV0 A;  4HJ8 A;  1IBK Q;  1NBW A;  3DLL A;  1C7Y A;  3NBH B;  2N8N A;  4O0A A;  4A4I A;  4IJL A;  4H02 A;  1MKH A;  1XMO Q;  1OXU A;  1IL2 A;  1VQK A;  1Q1B A;  2R7D A;  4GOP A;  3HOW H;  1QUQ A;  4YWM A;  4HIM A;  2OTL A;  4IOA A;  4C3H H;  4HJ5 A;  4NPS A;  1VQA A;  2IHF A;  1W3S A;  1G51 A;  2ZTC A;  4TQU S;  4DV6 Q;  1IBM L;  1Y14 B;  3S15 H;  4B3S Q;  4KHZ A;  4B3M Q;  4JCV E;  2F3I A;  4DK6 C;  1X54 A;  2JA5 H;  4DV2 Q;  3F8T A;  2HIX A;  1SFO H;  2IX1 A;  4LFB Q;  5E7N A;  2E2H H;  1XNQ L;  5FLX c;  4A93 G;  4Y7N H;  4GKJ Q;  3FP9 A;  3HOV G;  4R1J A;  4IO9 A;  3EBE A;  1KHI A;  4BA1 I;  3T1H L;  1MJC A;  5GQO A;  1RIP A;  1PYB A;  5IWA Q;  4X64 Q;  3H0G G;  2PQA B;  4B3R Q;  4A3J H;  3G71 A;  1X6O A;  1EFW A;  1FGU A;  3CCQ A;  3UE0 A;  1U0L A;  4YY3 Q;  1NMF A;  4DV7 Q;  1IZ6 A;  1B7Y B;  3B6Y A;  3M4Q A;  1Q7Y C;  1K9M C;  2ZJQ A;  2MFI A;  4OX9 Q;  3TRZ A;  3PO2 G;  4DV3 L;  1Q46 A;  2XGT A;  2JA8 G;  1RL2 A;  3W1G A;  5M5X H;  3S2D H;  3NEL A;  3I7F A;  3MEF A;  4IFD I;  5IYC G;  4X62 Q;  2VS1 A;  4IPC A;  1YI2 A;  1Q12 A;  1PVO A;  1CSQ A;  1A0I A;  2QGQ A;  3L0O A;  1UE5 A;  2RCN A;  2H5X A;  3PUV A;  5DLQ E;  2OWO A;  4O2D A;  3PIP A;  1FJG L;  4L5R C;  1VQN A;  1SRU A;  1TWG H;  1R9T H;  3KYH C;  4QGU A;  3UE1 A;  1VQG A;  4DV5 L;  4GOP C;  4A3F G;  3GO5 A;  4RMF A;  1KXL A;  1V9P A;  4DV6 L;  3M3Y H;  2C35 B;  2ASB A;  5M5Y H;  1NTG A;  3RZD H;  3FKI H;  2VW9 A;  4DR5 Q;  1VQE A;  3E9H A;  4B3M L;  2NZO A;  4A3D H;  4WJ3 M;  3H15 A;  1YJ9 A;  1VQ5 A;  4DR6 Q;  1XMQ Q;  1HZ9 A;  4JC0 A;  1Y1W H;  1EOV A;  5H1S E;  1KRS A;  4A3I H;  3OW2 A;  2I5M X;  2V1C C;  4JBJ A;  1HR0 Q;  4L5T A;  4YCV A;  2R92 H;  2NN6 I;  4OXP A;  3I56 A;  3VDY A;  4C2M H;  2ZTE A;  4DV0 L;  1K3R A;  2BH2 A;  5C44 G;  5BR8 Q;  4PZ8 A;  4LF5 Q;  4B3R L;  3KF8 B;  2KBN A;  1YIT A;  3M9B A;  4HIO A;  1WI5 A;  1XNR Q;  3GTG H;  1WFQ A;  3A5Z B;  2N78 A;  4JOI A;  4DV7 L;  1JJ2 A;  3CAM A;  3PSI A;  4OX9 L;  4OO1 I;  2UXB L;  4JI0 Q;  1VQB A;  4EX5 A;  4AQY Q;  2A8V A;  2E8G A;  1A62 A;  2Z0S A;  4R4I A;  2Q2I A;  2CCZ A;  1XPU A;  5LMU L;  1G6P A;  4AIM A;  4GKK Q;  1HR0 W;  4BBR H;  2R6G A;  3CMA A;  2Y0S G;  4GNX C;  2LSS A;  4A75 A;  4UY8 C;  3AEV A;  4A93 H;  1VQ9 A;  2CWP A;  1YNX A;  4BY1 H;  4DNI A;  1PFS A;  3L2P A;  1UE7 A;  1ASY A;  2PNH A;  4B3T L;  3GTL H;  3CCM A;  3GTQ H;  4PZ6 A;  2KHJ A;  4JI5 L;  2XTI A;  1KQS A;  1LUZ A;  1VCI A;  3KJO A;  1P16 A;  2QA4 A;  2Z6K A;  2AMC B;  1X3E A;  3U4Z A;  1VQH A;  1O7I A;  2BH8 A;  4Y52 H;  1SR3 A;  1IBM Q;  4X6A H;  3PO2 H;  1A63 A;  1N33 L;  1X3F A;  2VY3 A;  1JMC A;  2A19 A;  2OQ0 A;  4LFA L;  2I5H A;  4TVA B;  1L1O B;  2JA8 H;  1X65 A;  4KHP Q;  1QVG A;  1KC8 C;  2WFW A;  1XNQ Q;  3S1R H;  5IYC H;  1YIJ A;  4LF9 Q;  1I50 H;  4OON A;  4DR2 Q;  2HHH Q;  2VUM H;  1NJI C;  1TWA H;  2PQA A;  2Q2T A;  5C4X G;  1FL0 A;  3AQQ A;  4K0K Q;  2YV5 A;  4JBK A;  2DUD A;  2R7F A;  4A3F H;  1XNR L;  3CP0 A;  1Q81 C;  2JA6 H;  3JC6 6;  3E0E A;  3ERS X;  3HKS A;  3U4V A;  2B3G A;  3HOU H;  2VNU D;  3M4O H;  3CD6 A;  4LF4 Q;  3PUZ A;  2Y0S E;  4DV3 Q;  3PUX A;  2L15 A;  4JOI C;  3OTO Q;  1TXY A;  4IJH A;  4GKK L;  2FXQ A;  3F2B A;  3S24 A;  1PH5 A;  4A3L G;  2WP8 J;  2CFM A;  1M1K C;  1FVI A;  3ULL A;  1J6Q A;  4J15 A;  1PA6 A;  1PH3 A;  1VQ6 A;  3G6E A;  2YYZ A;  2MO0 A;  1HH2 P;  4A3I G;  1Z47 A;  4JI3 Q;  2R92 G;  3PUW A;  3S1N H;  4NXM Q;  4LF8 Q;  2KCT A;  1FJG Q;  2WAQ G;  2JA7 G;  3S1M H;  1N9W A;  1Z9F A;  2OCE A;  1JT8 A;  5C44 H;  2I5L X;  4DV5 Q;  4A3M H;  4JV5 L;  2JK8 A;  3F2C A;  1KIX A;  1V43 A;  3CC4 A;  4JYA L;  1X55 A;  4P71 A;  4PZ7 A;  3PF5 A;  3I2Z A;  2JEA I;  4KHP L;  4LUO A;  5C0X J;  2BA1 A;  4IPH A;  1HZC A;  5J3B A;  5JEA J;  4DR2 L;  1M90 C;  2JQO A;  3BZK A;  4BY1 G;  2HHH L;  4LF9 L;  3CF5 A;  3RLF A;  4K0K L;  2N49 A;  2CQO A;  2E2J H;  1HNW L;  1HJP A;  3W1B A;  2RHS B;  4DV0 Q;  1JB7 A;  1HNX Q;  2VL6 A;  5IY0 A;  3I55 A;  2HIV A;  4DAY B;  2JE6 I;  2K5N A;  3PGZ A;  1BBU A;  5GRO A;  5GAH C;  4DV1 L;  4A3C G;  4KI0 A;  2UXB Q;  2NVQ H;  1WJJ A;  4DAM A;  2QEX A;  1I3Q H;  1PYS B;  3T1Y L;  4YCW A;  1K8A C;  4LF4 L;  4OWW B;  3OTO L;  5LMU Q;  2EXD A;  4JBM A;  1PH2 A;  3S2H H;  2UXD L;  2AWN A;  4DR3 L;  1IXR A;  2K5H A;  3NEM A;  4KLK A;  3UDF A;  4HJ9 A;  2WAQ E;  1VQ7 A;  3H3V I;  2VUM G;  4JI3 L;  4NXM L;  4B3T Q;  5JJL A;  1CKN B;  1BBW A;  5C4X H;  5C3E H;  3U58 A;  2Q2U A;  5JJI A;  4JI8 Q;  1OTC A;  3LGJ A;  1Q86 C;  4JI2 L;  4JI5 Q;  2HQL A;  4LFC L;  4OO1 G;  1E24 A;  3D0F A;  4JI4 L;  4DR4 L;  2JA6 G;  1PH4 A;  3K80 C;  4QY7 A;  2YU9 H;  1XTD A;  4P72 A;  4HID A;  1L1O A;  1VQ4 A;  1YJW A;  3HOU G;  1CSP A;  3ULJ A;  1N33 Q;  1EUJ A;  5IP9 G;  3GTO H;  1JJC B;  4MZ9 A;  5IYD H;  4LF6 L;  2VZA A;  4LFA Q;  3RN5 A;  4QJF A;  1Y1V G;  1B8A A;  4P74 A;  4X65 L;  4P75 A;  1GO3 E;  4DUZ L;  4DV4 L;  1QVF A;  4A3L H;  4X66 L;  4MNO A;  1X9N A;  4FDB A;  4JI7 L;  1E1T A;  2YTY A;  4LUV A;  4LF8 L;  2JA7 H;  1JJG A;  5C4J H;  4MTN A;  4AYB G;  5ELN A;  2NVX H;  3CCS A;  2ZJP A;  1XJV A;  3HFZ B;  1EQR A; 
#chains in the Genus database with same CATH topology
 1H9K A;  1HNX L;  2XRS D;  1EIY B;  1K3B C;  3TP5 A;  5JAV A;  1WCM G;  2SNS A;  2G9D A;  3GQB A;  1EY4 A;  1I4R A;  3L7Z C;  1SMY C;  1ILP A;  4IFD H;  4KMU C;  4A3G B;  1HA5 A;  1STY A;  3CXC A;  1UUP A;  4K2L A;  3RZO H;  4HJA A;  1Q8K A;  1TWC B;  4L63 B;  1K73 C;  1PH6 A;  1QVC A;  1MBY A;  1W6J A;  1YEZ A;  3V2T A;  3I4M G;  4DFA A;  3J7Y W;  4RHS A;  1WTH A;  4NXN Q;  2MQH A;  4FO2 A;  4ALP A;  1IBL L;  4FYD A;  1GUW A;  4A3G H;  4AYB E;  4BBS G;  2A69 D;  4M1U B;  1K83 H;  5FO7 B;  3I4N B;  2PW7 A;  2UUB L;  4P73 A;  1TWC H;  2GN5 A;  1HPC A;  1PHJ A;  4DNT B;  2RHQ B;  3PIO A;  3P75 A;  2ZJR A;  3J80 c;  1JWS D;  1ML0 D;  3OOC A;  4RGN A;  3DXJ C;  1OXV A;  2KED A;  1WCM B;  3RLO A;  1AZP A;  1LYL A;  1PH1 A;  2VQF L;  4UP7 A;  1Y1V H;  2EY6 A;  4ZRZ A;  4DR3 Q;  5M3M B;  2E5L L;  1CT1 D;  2PNR C;  1NNX A;  2ALY B;  3D8G A;  1V1P A;  4BBR G;  1ZKO A;  1Q90 A;  4CKC A;  1EIH A;  2AQ1 B;  4JI2 Q;  3K5M A;  1WCM H;  1ZXT A;  1TWH B;  3I4M B;  3EFX D;  5C0X I;  2Z6K C;  3GDE A;  1VDZ A;  2RVL A;  4L5Q A;  5M3M H;  3CQZ B;  2DN8 A;  5LMN L;  2E2H B;  3W2D A;  4JI7 Q;  3IFD A;  4EQN A;  4XXE A;  3KDF B;  2RF4 A;  1XPO A;  1TS2 A;  2B8F A;  1F9P A;  1BCP F;  4DK1 A;  4IAL A;  3J80 i;  1ESF A;  2Z4I A;  1V8Q A;  5C3W A;  1LV9 A;  5IP7 G;  1HNZ Q;  1TWH H;  4A3J B;  1VQL A;  5AJ3 Q;  3I4M H;  3OMG A;  1H9J A;  1E1O A;  2AQ3 B;  1RTO A;  4KK7 A;  1C9O A;  5IE8 A;  3SVM A;  2UU9 L;  1OO9 B;  3CQZ H;  4HMI A;  3GTM B;  4BBS H;  2UUC Q;  4G7O C;  2NN6 G;  1ICF B;  3ERO A;  4UP8 A;  1J5E Q;  1GUG A;  4FF3 A;  4R4T A;  1QNK A;  2LS0 1;  4MHE A;  3J80 E;  1BF4 A;  4ZQ3 A;  1U4P A;  4NMZ A;  3HKZ G;  4H0L C;  4WJ4 A;  5IGB A;  2B39 A;  1NR4 A;  3RNU A;  1TS4 A;  2J0T D;  5K36 G;  1LAC A;  3GTM H;  5COR A;  3CU7 A;  3QOL A;  5IGF A;  2NZH A;  4OWX B;  3MXN A;  5J39 A;  1XMO L;  1QZG A;  1HFN A;  1GUN A;  2KCM A;  1MJE A;  4BXX H;  2XWB B;  2FFK B;  5CV5 A;  1UWV A;  4DN4 M;  3DWQ A;  2BOS A;  1QUQ B;  3PUY A;  4QB4 A;  4DV2 L;  3CPF A;  2OXP A;  2M00 A;  3LX0 A;  3RUZ A;  3E6Z X;  4KD3 A;  4OIK A;  4QQB X;  4O42 A;  2EYP A;  2VQE Q;  4R4C A;  1GUS A;  1N36 Q;  3T13 A;  5IP7 H;  4C3H G;  4XQJ A;  3HKZ B;  4YY3 L;  3OHX C;  1B9N A;  3E0J A;  2IT1 A;  1H9S B;  4RKB A;  4KY5 A;  2EYJ A;  3CRL C;  5ISR A;  3QO2 A;  4LW1 A;  3STB D;  1GD7 A;  5C3X A;  4UHV A;  2A1A A;  1F9S A;  2DNC A;  5FLX L;  3PO3 G;  4K2K A;  4H44 C;  2EYL A;  5G3L D;  1WTX A;  2D0P A;  5JJK A;  2XNA C;  1SXT A;  1KDB A;  3UI2 A;  4TKO B;  1CKO A;  4A76 A;  1JE5 A;  3NTI A;  3OYY A;  4L5S A;  3GTP B;  1N34 Q;  3M4P A;  4ME3 A;  4KY7 A;  1N32 Q;  5K36 H;  4DR6 L;  1X3G A;  1D7Q A;  4ME5 A;  3K7A B;  2FJ2 A;  1S72 A;  3MC0 B;  4HR7 B;  4N9T A;  1PTO F;  1HR0 L;  3T1H Q;  2F0Q A;  3TRE A;  2C5C A;  4GLV B;  4TSS A;  4YCU A;  2Q8T A;  4C3H B;  3KLW A;  4LNQ A;  2R7Z G;  4DR1 Q;  3GTP H;  1DCZ A;  2F0M A;  2F3V A;  5BN4 A;  4AQY L;  1MIU A;  1PYW D;  3NBI A;  4A3D G;  5EPL A;  1T9H A;  1W6K A;  2R93 G;  1DJR D;  4K6L A;  3FDT A;  2KCN A;  3K7A H;  1Y1W G;  3SXH A;  4F8M A;  3DLL A;  3WOF A;  1C7Y A;  1HUN A;  4Y7N B;  2R7D A;  4GOP A;  1MD2 D;  1ENF A;  4YWM A;  4TRD A;  4IOA A;  4C3H H;  1D5Z C;  1G51 A;  4B3S Q;  1LAB A;  2F3I A;  5JPN C;  2A68 C;  5IIF A;  4MTK A;  2B2Y A;  5E7N A;  3A56 A;  5J22 A;  4C56 C;  1XNQ L;  1WD1 A;  4Y7N H;  2EXZ A;  4R1J A;  3F2U A;  2EJF C;  5EPJ A;  1KHI A;  2I07 B;  1B2T A;  4FF1 A;  2PO4 A;  3OMC A;  4PMC A;  1F2Y A;  1I6V C;  1YNJ D;  4UY8 C;  1E0B A;  1EEF D;  1Q7Y C;  1B7Y B;  3M4Q A;  1IZ6 A;  1EU4 A;  1JOK A;  3E3X A;  4K14 A;  2MFI A;  4RCN A;  2ZJQ A;  5M5Y B;  4L6T B;  3K6O A;  3QJY A;  1Q46 A;  4A3D B;  2JA8 G;  1RL2 A;  2PZW A;  3W1G A;  3NEL A;  3H3V C;  1Y1W B;  2PYK A;  3MEF A;  4FXK C;  1XYI A;  4DF7 A;  1A0I A;  1UE5 A;  2RCN A;  1FJG L;  1VQN A;  3WDN A;  3I70 A;  5C5L A;  5IGC A;  1S5D D;  3UE1 A;  4DV5 L;  1RCV D;  1V9P A;  5EJW A;  4DV6 L;  3L3O C;  1NTG A;  5M5Y H;  2VW9 A;  2NZO A;  4A3D H;  1YJ9 A;  4RGO S;  1ET6 A;  1XMQ Q;  1Y1W H;  1EOV A;  1EOT A;  3NWS A;  3HRZ C;  4BY1 B;  2NN6 I;  4OXP A;  3I56 A;  1SYE A;  4DV0 L;  2O5I C;  2H4O A;  1K3R A;  4PZ8 A;  4B3R L;  3KF8 B;  1Y8P B;  2KUM A;  1ILQ A;  4DV7 L;  4OO1 I;  3CAM A;  3PSI A;  4OX9 L;  4NW2 A;  2A8V A;  2Q2I A;  5LMU L;  4LMQ D;  2ZXO A;  2JA8 B;  4GNX C;  3VYS A;  1VQ9 A;  1YNX A;  5EPK A;  4BY1 H;  4DNI A;  2B2W C;  1UE7 A;  2PNH A;  4K5V A;  4IUQ A;  4JI5 L;  1LUZ A;  2D9U A;  1P16 A;  2Z6K A;  1D6E C;  4RFB A;  1IBM Q;  1A63 A;  3HOU B;  2A19 A;  1CQF A;  1D5X C;  2I5H A;  2JA8 H;  3K5O A;  5I6W A;  4M8A A;  4KHP Q;  1KC8 C;  4DR2 Q;  1EWH A;  2F0E A;  5FOB B;  2Q2T A;  3AQQ A;  5I2Y A;  3G7L A;  2HDM A;  2YV5 A;  2CW0 D;  4JBK A;  1CZG A;  2LY7 A;  3T4A C;  2IWH A;  4WFN 3;  4FF2 A;  3ERS X;  3K5N A;  3HOU H;  2VNU D;  3OTO Q;  4JOI C;  2I46 A;  1TXY A;  4GKK L;  2FXQ A;  1PH5 A;  1LO5 D;  3TSS A;  1PA6 A;  4A3I G;  4JI3 Q;  1B9M A;  2NB0 A;  3PUW A;  4NXM Q;  1SAP A;  2KCT A;  2DJF C;  5M9O A;  2WAQ G;  2JSO A;  3I91 A;  1RF2 D;  3T56 B;  1JT8 A;  1X3Q A;  2X6G A;  2CW0 C;  1JB3 A;  2NZ1 D;  1WTV A;  1TS5 A;  3TN2 A;  1X55 A;  4ID6 A;  3R8B A;  1FNU A;  2XWJ B;  4LUO A;  3VA7 A;  5C0X J;  1X32 A;  3SDZ A;  1LTI D;  5JEA J;  1IW7 D;  1HNW L;  2RCF A;  1WTP A;  1HJP A;  3W1B A;  5C3E B;  1HNX Q;  2CVR A;  3I55 A;  5GRO A;  3NUC A;  5GAH C;  4DV1 L;  4EVO A;  3NWT A;  1WJJ A;  2QEX A;  3T1Y L;  1A2T A;  1I3Q H;  2AUJ D;  1K8A C;  1ROD A;  1SJE D;  1C4Q A;  1DZ1 A;  2AWN A;  3NEM A;  4KLK A;  3UDF A;  3Q0A A;  3H3V I;  2VUM G;  1WD0 A;  5C3E H;  3U58 A;  5JJI A;  4DXF A;  2WAQ B;  2HQL A;  2KCC A;  3J7A V;  1IW7 C;  1V1P B;  2JA6 G;  4QUF A;  2NVY B;  4P72 A;  4F7X A;  1YJW A;  3ULJ A;  2OF1 A;  1EUJ A;  1O7L A;  1N33 Q;  1J8I A;  2ICE C;  3FPU B;  4LFA Q;  4DV4 L;  1GO3 E;  1BUV T;  1X9N A;  2KQ3 A;  3SEB A;  4AYB G;  5ELN A;  1E2Z A;  1ICW A;  1PZK D;  1PMR A;  1UNS A;  4HAE A;  2K04 A;  2AHO B;  4ILW A;  4A3M G;  4QUC A;  2NVY H;  3A5U A;  4IPG A;  2B2T A;  2F4V L;  2HUG A;  1C0A A;  2RA4 A;  1LTR D;  2E2D C;  2QCP X;  1S40 A;  1QNU A;  4QIW E;  3U50 C;  2RSN A;  5EBD A;  1K8O A;  1QOH A;  2RBM A;  3FHW A;  5FLX E;  2YTV A;  1LT6 D;  2OQK A;  3CKI B;  3J81 c;  1KL9 A;  2HDL A;  3S16 B;  2E2I B;  3I90 A;  1YZ6 A;  3C1F A;  5IYB G;  1XX8 A;  4ABN A;  4JV5 Q;  3KK7 A;  3NHH A;  2K52 A;  1TKW B;  5ELB A;  1IKL A;  3CRK C;  5E4W C;  4OWT B;  3SK6 A;  1FGB D;  4CDD C;  4IOC A;  1I5F A;  2IX3 A;  3S1Q B;  1EYC A;  3LWE A;  4AYB B;  3S16 H;  2BA0 A;  2E2I H;  4BY7 G;  3MXN B;  4K5X A;  1JR0 D;  4S3S A;  3CME A;  2ICI A;  4N8F A;  4PV1 C;  5M3F G;  5LMN W;  1E22 A;  5IYD G;  1PRT B;  4A3K G;  3S1Q H;  2EY2 A;  3BDO A;  2XN9 C;  2EE1 A;  5AFW A;  1AEX A;  3I4O A;  2DJG C;  2F0G A;  4EQO A;  3BVG A;  1GJX A;  4JI4 Q;  1YNN D;  3Q6S A;  4CDF C;  4IUP A;  1A2U A;  1MSG A;  3HOY G;  2IPK D;  1BBX C;  3KOJ A;  3QIA A;  4PQX A;  1YVC A;  3G4S A;  3A8K E;  4IFD G;  1QG7 A;  4X66 Q;  1NAP A;  4R8I A;  1I6H B;  1PH7 A;  2CH4 A;  4RGM A;  2L12 A;  2K50 A;  3EQL C;  2AKW B;  4XTC S;  4BY7 B;  5IYB H;  1VQC A;  1Q82 C;  4JI6 Q;  1SND A;  3KF6 A;  2LXJ A;  1KRT A;  1TU2 B;  1B53 A;  3V96 A;  4RH6 A;  1KAW A;  1P8L A;  4A3G G;  2ZTD A;  3DM3 A;  1J9O A;  4C1N I;  1YHB A;  3K58 A;  1I6H H;  3I73 A;  4A3K B;  3KJP A;  1EY9 A;  1MSH A;  1VQO A;  1MI2 A;  4BY7 H;  3C2P A;  3GTJ B;  2FMC A;  3OPO A;  5JJZ A;  5HGQ A;  5M3F H;  3TP6 A;  3HOY B;  3IKJ A;  2Q2H A;  4GNX A;  4LAA A;  5IGG A;  1LM0 A;  2B29 A;  2B2W A;  3I4N G;  5KIX A;  1IBK L;  4A3K H;  1BCP B;  5EAY A;  3A7L A;  1B50 A;  1C48 A;  4JI1 Q;  1EIF A;  3ZYY X;  3GTJ H;  1WOC A;  4GOP B;  3NTH A;  2MHV A;  4KKT A;  2ZM6 Q;  4KKS A;  4GLA C;  1B4O A;  4LUZ A;  3HOY H;  3QWN A;  5COY A;  4RAU C;  4RWS C;  4Q5V A;  4XIG S;  5KRU A;  4LWC A;  5EKK A;  1WTQ A;  1K8G A;  5M3M G;  4MN3 A;  2NYZ D;  2IHE A;  4IUV A;  4GKJ L;  2XSC A;  3QR8 A;  3C3L A;  5D65 A;  2KHS A;  3IFT A;  1SYG A;  5IWA L;  3Q24 A;  1PDQ A;  2N55 A;  3H0G B;  3FPP A;  4NP5 A;  3UDX A;  3HOZ H;  1VQD A;  2UXC Q;  2OTJ A;  2JA5 G;  4FF4 A;  2F52 A;  4YHH Q;  2PPB C;  3TDQ A;  5CBE E;  3ZJY C;  2Q8R E;  1CFM A;  1CQV A;  3Q8D A;  3VYR A;  3A7A B;  4DR7 Q;  4KV6 A;  3H0G H;  1JC7 A;  3EN2 A;  1HRJ A;  4A3J G;  3MEH A;  3I3C A;  4K5W A;  1PTO D;  2BE5 C;  5CV4 A;  4LF7 Q;  1LTL A;  4KY6 A;  1YHQ A;  4I7A A;  5IGE A;  1OXX K;  4PMW A;  3I4N H;  5CV8 A;  4OIJ A;  4BXX G;  3D4D A;  3F2D A;  1HZA A;  2RKS A;  3R2T A;  2GVB A;  5BR8 L;  3OIQ A;  4LF5 L;  3KBG A;  4IUN A;  1HXY D;  1IYJ B;  4JI0 L;  3S15 B;  2GVA A;  4DUY Q;  4POF A;  3UDG A;  2L5T A;  2JA5 B;  3CCV A;  1LTS D;  1KD1 C;  3H91 A;  1SFO B;  1PTO C;  3PV0 A;  4O0A A;  4A4I A;  2EY5 A;  3S9W A;  1VQK A;  1Q1B A;  4ZYS A;  1EFI D;  1H9R A;  1CI3 M;  2IW3 A;  2IHF A;  1W3S A;  2LFN A;  4TQU S;  1XWE A;  4DV6 Q;  3S15 H;  1BXT A;  4KHZ A;  4X3S A;  4JCV E;  3SHL A;  2JA5 H;  1X54 A;  2K01 A;  4LFB Q;  2HIX A;  1SFO H;  2HCC A;  2E2H H;  3TP7 A;  3FP9 A;  4IO9 A;  4HSV A;  1MJC A;  3HS0 C;  1S5C D;  4X64 Q;  3TZD A;  4B3R Q;  1TWG B;  4A3J H;  1EFW A;  4MIU A;  1FGU A;  5LL6 S;  1U0L A;  4DV7 Q;  1NMF A;  3B6Y A;  1CK1 A;  1SNP A;  4OX9 Q;  4DV3 L;  1AP0 A;  1EY8 A;  2PW5 A;  2Z9H A;  3ND8 A;  4IFD I;  4X62 Q;  1Q8I A;  2VS1 A;  1Z6H A;  1YI2 A;  2G9H D;  2R92 B;  2QGQ A;  3VYT A;  3PIP A;  4L5R C;  4C2M B;  1TWG H;  1GUT A;  4XYQ A;  4ZKB B;  1KXL A;  5KEE A;  2Z1C A;  1AN8 A;  2C35 B;  4CDE C;  4DR5 Q;  4B3M L;  3A54 A;  4ZUI A;  3KLS A;  3MXG A;  1BOS A;  3SE0 A;  2R92 H;  1O80 A;  3M7G A;  5IT9 L;  2NBF A;  3VDY A;  3ERQ A;  4C2M H;  3GTQ B;  2ZTE A;  1ZYR D;  3I8Z A;  1ET9 A;  3R93 A;  3M9B A;  1WI5 A;  2KOL A;  3WOE A;  1WFQ A;  3A5Z B;  2N78 A;  1JJ2 A;  2UXB L;  1I4P A;  1VQB A;  1XPU A;  2CCZ A;  3NBH A;  4GKK Q;  4FXG C;  4OHJ A;  2F0S A;  3S1R B;  1TY2 A;  2X69 A;  1I50 B;  5CMD A;  1PFS A;  4B3T L;  1SBB B;  1JCK B;  3GTQ H;  1KQS A;  1VCI A;  2QA4 A;  1X3E A;  2AMC B;  1KNE A;  1VQH A;  2BDO A;  1ZYR C;  2N88 A;  4X6A H;  2NWG A;  1X3F A;  3H6M A;  2VY3 A;  2A73 B;  4TVA B;  4ZUJ A;  2WFW A;  4RCO A;  3S1R H;  2WKD A;  3MFY A;  1I50 H;  4OON A;  3MFG A;  1LTT D;  1FL0 A;  3W3A A;  1XXG A;  2DUD A;  5C4H A;  1II3 A;  1A6X A;  2A68 D;  1XNR L;  1Q81 C;  3HKS A;  3HP3 A;  1EY7 A;  2K5Q A;  3CD6 A;  3JAM L;  2A6E D;  3PUX A;  2L15 A;  5A2Q L;  2WV6 D;  1EY5 A;  5EGT A;  1STN A;  2WP8 J;  4A3L G;  1M1K C;  2PMZ B;  1FVI A;  1J6Q A;  4J15 A;  1AFP A;  5KGU A;  2R61 A;  3ONA B;  3FMC A;  4LF8 Q;  3N6R A;  1Z9F A;  2OCE A;  1C8C A;  1EY0 A;  2I5L X;  1JOO A;  3F2C A;  4DA2 A;  1V43 A;  2KEE A;  4KJO A;  1SYF A;  3C1E A;  2GA4 B;  1SNM A;  2A6H C;  4PZ7 A;  2XIW A;  2A6E C;  4IPH A;  1HZC A;  4R9W A;  3RD4 A;  2HHH L;  3BZK A;  4BY1 G;  1STA A;  4L8J A;  1VF7 A;  2N49 A;  2CQO A;  3BVM A;  3R2I A;  3EJI A;  1QE6 A;  2RHS B;  3J81 L;  2F0U A;  2K5N A;  1QWY A;  3PIO 3;  4KI0 A;  2YU9 B;  4DAM A;  4LF4 L;  2EXD A;  1I4H A;  2MPM A;  3DEP A;  4JBM A;  4DR3 L;  3Q22 A;  4HJ9 A;  1B1Z A;  1LLR D;  3OW7 A;  1STB A;  1GXD C;  1LT4 D;  2XRQ D;  1FNV A;  1DOK A;  1EEI D;  4JI2 L;  3J7A F;  3BG3 A;  1PH4 A;  3GV6 A;  4QY7 A;  2YU9 H;  2WB1 B;  2RQX A;  4N8X 1;  3VR3 A;  2DY8 A;  3HOU G;  2IL8 A;  4RA8 A;  1JJC B;  4MZ9 A;  5IP9 G;  1QVF A;  1TY0 A;  2FHT A;  4A3L H;  2K05 A;  1HTL D;  4U68 A;  4JI7 L;  2JA7 H;  1L0X B;  1FNW A;  4LUV A;  3VR6 A;  1JJG A;  1UEA B;  2F0O A;  3J7A 5;  1F2Z A;  1HTP A;  1EQR A;  1D5M C;  1K0R A;  1S5F D;  1HNZ L;  2LKV A;  2F0P A;  1PV4 A;  1PH8 A;  4DK3 C;  5AJ3 L;  2MUY A;  1UE1 A;  1V1Q A;  3KF6 B;  2MGS A;  1BO0 A;  1G8Z D;  1D2B A;  2E75 C;  1VQF A;  2UUC L;  1UEB A;  4GN5 A;  1OXT A;  2KVM A;  4QIW B;  3TS2 A;  1J5E L;  5ELF A;  2RDF A;  3HOX G;  4PG3 A;  4R4O A;  1JIC A;  5ELO A;  1TWF B;  3VR4 A;  2B2U C;  1A3T A;  4R4Q A;  2PZT A;  5JVH 3;  4JYA Q;  3UDI A;  4IZ8 A;  3HGB A;  4OGQ C;  4GLX A;  3AU7 A;  4GNX B;  2V4D A;  3GTK B;  4YWL A;  3CW2 C;  4QL5 A;  4HMJ A;  5C3E G;  4DAY A;  3CCR A;  1TWF H;  1MGS A;  3BVZ A;  1GM5 A;  4Q0F A;  1QCB D;  4A3E G;  4HJ7 A;  1VS0 A;  4G7Z C;  3BZC A;  5A35 A;  2F0L A;  1EIG A;  5IP9 H;  1BR9 A;  1VMP A;  2PMZ E;  5FK9 C;  1B3Q A;  5FKA C;  1EZ6 A;  4JBW A;  3EIV A;  2R3Z A;  2UXD Q;  1PH9 A;  1EQQ A;  3GTK H;  3CCL A;  1CKN A;  4O1N A;  2JEB I;  5IT9 c;  1GOZ A;  1BDO A;  1B3A A;  1L2F A;  3HZX A;  2VQE L;  5KNB A;  3HOX B;  1N36 L;  1HZB A;  4AH6 A;  1I94 L;  5EKL A;  4LFC Q;  1E3P A;  1SNO A;  1AH9 A;  2TSS A;  4DR4 Q;  1QZH A;  3RMH A;  3ER0 A;  1G91 A;  3AB9 A;  2B63 G;  3BU2 A;  4G57 A;  1GVP A;  4LF6 Q;  1GKH A;  5GAD C;  4X65 Q;  4DUZ Q;  1BQQ T;  1Y8N B;  1AE3 A;  1EZ8 A;  3E9I A;  4POG A;  1Y8O B;  1KTK A;  1RKN A;  1VQM A;  3HOX H;  1NMG A;  1GHJ A;  5ELE A;  1ZEQ X;  2LXK A;  4A3E B;  3J81 j;  1FYC A;  1ONL A;  2WAC A;  3OWE B;  3U9S A;  3P20 A;  4DK0 A;  1N34 L;  1D1I A;  4RG1 A;  5ELD A;  1STE A;  2KEN A;  3GD7 A;  3OIP A;  1N32 L;  5FLM G;  3TME A;  4XYO A;  1VQ8 A;  3AMU A;  2OT2 A;  4GN4 B;  3CC2 A;  1S5B D;  2FIN B;  1U4R A;  3AYH B;  3D6C A;  2CQA A;  4I65 A;  2WB1 E;  3MTS A;  2K5V A;  3MVV A;  1QIL A;  2IJ0 A;  4A3E H;  1GUO A;  2EQS A;  3JAM c;  4DR1 L;  2D62 A;  3DUZ A;  2B63 B;  3V05 A;  2D2C C;  2EIF A;  3K0X A;  3CCJ A;  1IBL Q;  2F0W A;  1BVS A;  1NR2 A;  1VF5 C;  2QDL A;  2UUB Q;  1HHV A;  3K81 C;  1CUK A;  1SYB A;  5IT9 E;  4X3U A;  1SRO A;  4OEL B;  4IFD J;  1GHK A;  1WVL A;  1NY4 A;  3G48 A;  4G7H C;  1EWI A;  2K4K A;  1L0W A;  1STG A;  4B3S L;  2B63 H;  4K8J A;  2VQF Q;  1OXS C;  3SGI A;  3ND9 A;  1M8A A;  1SSO A;  2F0F A;  1F9R A;  3PCO B;  2AQ2 B;  1CHP D;  1XTC D;  2D5D A;  2E5L Q;  5GAE C;  1T5X D;  3LWU A;  4QCL A;  3HOV B;  3X3M A;  4WRD A;  3NPP A;  1NE3 A;  5CR3 A;  1STH A;  4KHV A;  5LHY 1;  2JYO A;  3HOW G;  5GAG C;  3JAM i;  4KJN A;  3RR5 A;  2UUA L;  3PO2 B;  3K7U C;  1L1O C;  5FLM H;  3CC7 A;  2CKZ B;  3S17 B;  1UAP A;  3K8A A;  5LMN Q;  1KNA A;  3HOV H;  4IPD A;  3C46 A;  4A3B B;  4J8Q A;  2EJG C;  2D0O A;  5DAU A;  3D31 A;  1SYD A;  3MZ5 A;  1X56 A;  4LK1 C;  3T16 A;  5C0X G;  5JEA G;  3SK8 A;  3JAM E;  1YJN A;  2F0D A;  1DOL A;  3BJU A;  4HTH A;  5A2Q E;  4HED A;  2NUC A;  5E3F A;  2UU9 Q;  1XMQ L;  3S17 H;  5KNC A;  5HY6 A;  2KEC A;  3WWV A;  4A3B H;  3J81 i;  4BA2 I;  4C1N K;  5CV9 A;  1IL8 A;  3URY A;  3HOW B;  2AUK A;  5T1I A;  3DEO A;  4PMB A;  3TEH B;  1SLJ A;  4KN4 C;  4JW0 A;  4BS9 A;  2B2V C;  1Z7T A;  3AFQ A;  3MAQ A;  1H95 A;  1SE8 A;  1T5E A;  3F1Z A;  1O7Y A;  1K28 A;  2Y0S B;  3NBH B;  1XMO Q;  2L9H A;  2SDF A;  1OXU A;  2ZXP A;  3HOW H;  3MWY W;  2HD3 A;  3J81 E;  2OTL A;  3SK5 A;  2F4I A;  5I2X A;  4NPS A;  1E2W A;  5ELC A;  1IBM L;  1Y14 B;  1KAA A;  4B3M Q;  5IOD A;  4DV2 Q;  2IX1 A;  4EQP A;  2CHB D;  5E4X A;  4A93 G;  4X3T A;  1EY6 A;  3EBE A;  2DY7 A;  1LTA D;  1PYB A;  3H0G G;  5BN3 A;  1R9T B;  1X6O A;  5C0X H;  4YY3 Q;  1K9M C;  1R4P B;  1X3P A;  3P1H A;  5JEA H;  5BN5 A;  3TRZ A;  1DON A;  2CH4 W;  2KJX A;  1SE2 A;  2F0I A;  3KLR A;  1DOM A;  2OWO A;  3PUV A;  2H5X A;  1CZW A;  2B2U A;  1SDF A;  3NQI A;  1IKM A;  1SRU A;  2QF7 A;  5EKI A;  4CBV A;  1R9T H;  4QGU A;  1VQG A;  4GOP C;  4A3F G;  2SNM A;  1HFG A;  3E9H A;  2EOT A;  3H15 A;  4DR6 Q;  1HZ9 A;  4JC0 A;  2QIL A;  4A93 B;  1KRS A;  2V1C C;  4JBJ A;  1HR0 Q;  1PFN A;  4L5T A;  4YCV A;  2QEJ C;  5C44 G;  2BE5 D;  1YIT A;  1XNR Q;  4JOI A;  3VR2 A;  4EX5 A;  4AQY Q;  4R4I A;  2C9O A;  2J4X A;  1HR0 W;  4WJW A;  3X3N A;  3CMA A;  1PZJ D;  5C5M A;  2MP1 A;  4A93 H;  1K83 B;  1PRT F;  3A55 A;  1I4Q A;  3EA6 A;  3L2P A;  1ASY A;  1TWA B;  2F0J A;  3VYU A;  2JP1 A;  1S5E D;  3M4Y A;  5L37 A;  3NSW A;  4A3F B;  2K1B A;  2Z4H A;  2BH8 A;  5IOC A;  4XT3 B;  1SR3 A;  1EU3 A;  1N33 L;  5CGK A;  4CKE A;  3M4O B;  1JMC A;  2OQ0 A;  4XQQ A;  4CGY B;  4LFA L;  3DHQ A;  1TT2 A;  2L0C A;  1X65 A;  1Y1V B;  1QVG A;  3FVQ A;  4DGZ A;  1XNQ Q;  5KYL A;  1EYA A;  1TS3 A;  2HHH Q;  1NJI C;  1TWA H;  2PQA A;  2L11 A;  4QMG A;  3S1M B;  1K8M A;  2F0V A;  5C44 B;  4A3F H;  3K0Y A;  3JC6 6;  2B3G A;  1L0Y B;  2K5D A;  2Z6B A;  1HUM A;  3M4O H;  4LF4 Q;  2Y0S E;  2HCI A;  4IJH A;  4ZLT F;  3F2B A;  3S24 A;  2CFM A;  3ULL A;  1PH3 A;  4N9P A;  3VR5 A;  1Z47 A;  2R92 G;  2A69 C;  1FJG Q;  4HCE A;  2RDG A;  3S1M H;  3ITP A;  4R8N A;  5C44 H;  1B44 D;  5HUR A;  4DV5 Q;  4JV5 L;  1PLF A;  5I4D A;  2JK8 A;  1KIX A;  3CC4 A;  1JE4 A;  3PF5 A;  1PTO B;  4RHR A;  2RSO A;  4BBS B;  4LF9 L;  5J3B A;  2JQO A;  2M2L A;  2EYH A;  1ENA A;  4XT1 B;  3RLF A;  4K0K L;  1RJT A;  3CHB D;  4DV0 Q;  1JB7 A;  1LTG D;  2HIV A;  4DAY B;  2JE6 I;  3PGZ A;  4A3C G;  5CYU A;  1A15 A;  2SOB A;  3O13 A;  4GZY C;  5LMU Q;  1PH2 A;  1PTO H;  2EJM A;  1VQ7 A;  4FP5 D;  5C4J B;  5JJL A;  1CKN B;  1DXM A;  2Q2U A;  2NVX B;  2PZU A;  1OTC A;  3LGJ A;  4BBR B;  3D6W A;  4JI5 Q;  4H13 C;  4OO1 G;  4JI4 L;  4C3I G;  4J1M A;  2L55 A;  1H9M A;  1L1O A;  1CSP A;  1LTB D;  4P2C B;  1F2M A;  4QJF A;  4P74 A;  4P75 A;  4X66 L;  4MNO A;  4FDB A;  1E1T A;  2YTY A;  3P7J A;  2DNE A;  5C4J H;  1EQV A;  5CC4 A;  1QB5 D;  1TII D;  2NVX H;  3CCS A;  4BBR H;  4JI6 L;  4DPG A;  1A8V A;  1NSN S;  3DWP A;  4FVM A;  1M4V A;  4QF4 A;  5FJ8 G;  3HOZ G;  3U9O A;  1W2B A;  1EL0 A;  5FO9 B;  3Q23 A;  3MXU A;  1N8R C;  2K6A A;  2F0K A;  1PFM A;  1SE3 A;  4JG2 A;  1NUC A;  4JI8 L;  3DWA A;  1I94 Q;  2IX0 A;  3SK4 A;  5K5P A;  1YBY A;  4A3C H;  2B2V A;  4C3I B;  2ENB A;  4DKA C;  1PFB A;  4Z9C B;  1JQY D;  2BDN A;  2YTX A;  4ZK9 B;  2NN6 H;  2MO1 A;  1Y69 U;  2P5Z X;  4JI1 L;  1S3O A;  4CJ2 C;  4JPB W;  4V19 0;  1HNW Q;  2ATW A;  2ID0 A;  1U5K A;  3BDL A;  1ASZ A;  5F2D A;  5DM7 3;  4OO1 H;  3M85 A;  2I0Q A;  2A6H D;  1XPR A;  1SJH D;  4C3I H;  2ZM6 L;  4DV1 Q;  4HSP A;  3I4L A;  4YWK A;  2NTT A;  3T1Y Q;  2IY5 B;  2B2T C;  1DYQ A;  1MHW C;  3IRB A;  3MXP A;  1EWC A;  3HOZ B;  3S14 B;  5DEH A;  2N3S A;  2K33 A;  3STB C;  5C4Z A;  2HT1 A;  4UDU C;  4OL7 A;  3CCE A;  2PI2 E;  5DM6 3;  3HG9 A;  2WB1 G;  3TP8 A;  2UXC L;  1IHZ A;  4YHH L;  4NXN L;  4XDX A;  1SMX A;  5TSS A;  5FJ8 H;  4C3J G;  3E5S A;  4IQZ A;  5FO8 B;  3K5L A;  3BS1 A;  1EYG A;  4DV4 Q;  3S14 H;  4PNY A;  4K8I A;  2KA7 A;  1I4X A;  3CCU A;  3J7Z C;  2VB3 X;  3PO3 B;  1HQR D;  4DR7 L;  3RN2 A;  2MJ8 A;  1G29 1;  2ES2 A;  5M5W B;  3KBX A;  2E74 C;  3TS0 A;  2NTS A;  2F4V Q;  1TR5 A;  1B70 B;  4LF7 L;  2XVS A;  1G2S A;  5JPM C;  4B9W A;  2PCF B;  1RHP A;  4KN7 C;  3NEN A;  4DXG A;  3PO3 H;  4FNF A;  2BCO A;  4NB3 A;  4CJ0 B;  5M5W H;  1AE2 A;  1WYD A;  1QJO A;  2K75 A;  4APV A;  2O2L D;  3KFU A;  2R7Z B;  2K7V A;  1CTM A;  4DUY L;  2DGY A;  2EPB A;  4DAV A;  2UUA Q;  2EDG A;  2WII B;  3K59 A;  1TQO A;  3CPW A;  4C3J B;  2R93 B;  1VQI A;  1U4L A;  1O7Z A;  3SR1 A;  2EYO A;  1E7Z A;  4JK1 C;  2A74 C;  4EQ5 A;  3T53 B;  1CA6 A;  1BKB A;  3OWF A;  4UPA A;  3BZD B;  3PQI A;  2EY1 A;  4CHT B;  4EGV A;  2R7Z H;  2VB2 X;  3PF4 A;  4BWG B;  1FD7 D;  3A8J E;  2NVT B;  1JOR A;  2K14 A;  2L1B A;  1S4Z A;  1Q1E A;  2AWO A;  1YNJ C;  4C3J H;  4LFB L;  2L4N A;  2R93 H;  1VQP A;  4YIJ A;  3H3V H;  1Q3L A;  4X3K A;  1PVO A;  5LL6 X;  2ZT9 C;  1D8L A;  2JN4 A;  3NK9 A;  5D3D A;  3HKZ E;  4HIK A;  3G6J B;  4X64 L;  1DGS A;  4E6I A;  5J1Z A;  3A74 A;  2JJQ A;  3IL8 A;  2PI2 A;  3A0J A;  4KD4 A;  1CKM A;  4GN3 B;  2B8G A;  2NVT H;  3H94 A;  3W5O A;  1SNQ A;  2MNA A;  2RDH A;  3KDF A;  4F87 A;  1DM0 B;  4XQN A;  4HCS A;  2Q8I B;  1BNZ A;  2F0H A;  4X62 L;  3TZU A;  3ICE A;  1F9Q A;  5EQ0 A;  3M7N A;  1DD2 A;  4DAP A;  2JA9 A;  2KHI A;  1LT5 D;  2WIN B;  2CWA A;  3ULP A;  3PIP 3;  4FXD A;  5G3L F;  4DR5 L;  1SN8 A;  3OSO A;  5D3I B;  1UE6 A;  5I6Y A;  3AFP A;  1YHA A;  1FR3 A;  3TQY A;  1VQJ A;  5I9P A;  1K0S A;  1A3U A;  4GS3 A;  3A8I E;  2FMM A;  4UP9 A;  3N52 A;  2X6L A;  3KUP A;  3FKI G;  2EVB A;  3RLN A;  2F1M A;  5JVG 3;  4ZAI A;  5CBA E;  4HJ8 A;  1IBK Q;  1NBW A;  3D4W A;  2HQE A;  2N8N A;  2K32 A;  4IJL A;  4H02 A;  1MKH A;  1IL2 A;  1G6Z A;  3GP7 A;  1QUQ A;  4HIM A;  1EQT A;  4HJ5 A;  5IGD A;  1VQA A;  3BYT B;  3DMU A;  2ZTC A;  1HCZ A;  4CKB A;  4DK6 C;  3NXW A;  1I3Q B;  1A3V A;  3F8T A;  2QKI C;  5M5X B;  5FLX c;  1WTO A;  3S2D B;  1IYV A;  4GKJ Q;  4B08 A;  3HOV G;  1JOQ A;  3T1H L;  4BA1 I;  1RD9 D;  2PQE A;  5GQO A;  1RIP A;  5IWA Q;  2PQA B;  1ESR A;  5CV7 A;  3DM1 A;  3G71 A;  4DNR B;  1H9S A;  3CCQ A;  3UE0 A;  2M9V A;  5I9O A;  3M3Y B;  1HA6 A;  3PO2 G;  3RZD B;  3FKI B;  2Z8L A;  3D4R A;  5HGT A;  2XGT A;  1NCV A;  5M5X H;  3S2D H;  3I7F A;  5E1F A;  1JWM D;  5IYC G;  2EZV A;  4IPC A;  4A3I B;  4KKU A;  3L9A X;  1Q12 A;  3IAY A;  1KDC A;  1CSQ A;  1O78 A;  1SNC A;  3L0O A;  5DLQ E;  4LF8 L;  4A3B G;  4IN3 A;  3BYY B;  4O2D A;  3EVQ A;  4ULL A;  3KYH C;  3J80 L;  5EBC A;  1I4G A;  3QG1 A;  3GO5 A;  4RMF A;  1KLU D;  3GTG B;  3M3Y H;  2ASB A;  3RZD H;  1PZI D;  3FKI H;  4F88 A;  1VQE A;  4WJ3 M;  3NTK A;  1KLG D;  2ZXR A;  5KND A;  1VQ5 A;  4IUT A;  2F03 A;  1D1K A;  5H1S E;  2EYM A;  3OW2 A;  2I5M X;  4A3I H;  4LJZ C;  4ODG A;  3GTL B;  2F3W A;  2K5W A;  2BH2 A;  5BR8 Q;  4LF5 Q;  2KBN A;  2VXW A;  3QB3 A;  4HIO A;  3GTG H;  5D14 A;  1G2T A;  2J7Z A;  4G4K A;  4IUR A;  4JI0 Q;  1PRT D;  3LNN A;  2E8G A;  1A62 A;  2Z0S A;  3PMF A;  1G6P A;  4I7Z C;  4AIM A;  2OEO A;  2R6G A;  2Y0S G;  5NUC A;  2LSS A;  4A75 A;  3AEV A;  3GV3 A;  2CWP A;  1SE4 A;  3FEW X;  5DNF A;  4OEM B;  2VUM B;  4ZCK A;  1IYU A;  3GTL H;  1SEB D;  2K28 A;  4PZ6 A;  2KHJ A;  2XTI A;  1CHQ D;  4V0B A;  3KJO A;  1E2V A;  2A5H A;  2EYF A;  3U4Z A;  1JWU D;  1O7I A;  1U4M A;  4B9X A;  2JA6 B;  4Y52 H;  3PO2 H;  4RGT A;  1WTR A;  1AW7 A;  1CM9 A;  3MA2 B;  1L1O B;  1PRT C;  4NKL A;  5IYC H;  1HQM C;  1YIJ A;  4LF9 Q;  4WOR A;  2VUM H;  1TVX A;  3S1N B;  5C4X G;  2G5D A;  4K0K Q;  1VMC A;  1F2L A;  2LMC B;  5KYI A;  2R7F A;  3CP0 A;  4JVZ A;  4A3M B;  2JA6 H;  2F0T A;  3QOJ A;  2H1E A;  3E0E A;  3U4V A;  5T1G A;  4UAI A;  3PUZ A;  4CDC C;  4DV3 Q;  2QDB A;  3TBI B;  1EYD A;  4IUU A;  1PXU A;  1VQ6 A;  3G6E A;  2YYZ A;  2MO0 A;  1HH2 P;  4J6H A;  1F77 A;  3S1N H;  3BDC A;  2JA7 G;  1N9W A;  5CV6 A;  2E2J B;  2QW7 A;  4CJ1 B;  4A3M H;  3NP8 A;  1U9R A;  3MHB A;  2NVQ B;  1KAB A;  1BCP D;  4JYA L;  4P71 A;  2SEB D;  3I2Z A;  2JEA I;  4KHP L;  3S2H B;  2O5J C;  1KDA A;  2BA1 A;  4DR2 L;  1M90 C;  3I72 A;  3CF5 A;  1R4Q B;  3KF8 A;  2E2J H;  5C4X B;  4NDX A;  1CA5 A;  2VL6 A;  5IY0 A;  1BBU A;  3KLS X;  2UXB Q;  4DU9 A;  5M3F B;  2NVQ H;  1PYS B;  4YCW A;  4OWW B;  3GTO B;  3OTO L;  1YNN C;  4U67 3;  3K57 A;  3S2H H;  2UXD L;  2JXM B;  3NE5 B;  1IXR A;  2K5H A;  3D3R A;  1BCP C;  4KTA A;  2WAQ E;  1V1O A;  4JI3 L;  4RKL A;  4NXM L;  3T51 B;  4B3T Q;  4H7B A;  1BBW A;  5C4X H;  4JI8 Q;  2JA7 B;  1ENC A;  3R3O A;  1Q86 C;  4LFC L;  1E24 A;  3D0F A;  3NQT A;  5JOB A;  4HN7 A;  1SYC A;  1RTN A;  1AZQ A;  4DR4 L;  1SMY D;  3K80 C;  1XTD A;  4HID A;  1VQ4 A;  3GTO H;  5IYD H;  2K03 A;  4LF6 L;  2O4X A;  2F0N A;  2E76 C;  1LT3 D;  2VZA A;  1RDP D;  1Y1V G;  1B8A A;  3VA5 A;  5C6A A;  4X65 L;  4DUZ L;  3RN5 A;  2WKC A;  4K6D A;  1WTW A;  3FRP B;  2TMP A;  2B2Y C;  4ZKC B;  3HEJ A;  4MTN A;  3RZO B;  3CCM A;  2ZJP A;  1XJV A;  3H09 A;  3HFZ B; 
#chains in the Genus database with same CATH homology
 1K0R A;  1HNX L;  1HNZ L;  1EIY B;  1PV4 A;  1PH8 A;  4JI6 L;  2AHO B;  1WCM G;  4DK3 C;  4DPG A;  5AJ3 L;  4A3M G;  2NVY H;  1A8V A;  1UE1 A;  4IPG A;  3A5U A;  2F4V L;  1C0A A;  1V1Q A;  3KF6 B;  5FJ8 G;  3L7Z C;  1S40 A;  3HOZ G;  4QIW E;  3U50 C;  1W2B A;  1VQF A;  2UUC L;  1UEB A;  3FHW A;  3CXC A;  2YTV A;  4GN5 A;  1OXT A;  1N8R C;  2OQK A;  1J5E L;  3RZO H;  4HJA A;  3TS2 A;  1Q8K A;  1K73 C;  1PH6 A;  1QVC A;  3J81 c;  4JG2 A;  4PG3 A;  1KL9 A;  3HOX G;  4R4O A;  4JI8 L;  1YZ6 A;  5IYB G;  1I94 Q;  5ELO A;  1YEZ A;  2IX0 A;  3I4M G;  4JV5 Q;  1YBY A;  4A3C H;  2K52 A;  4DKA C;  4R4Q A;  4NXN Q;  2MQH A;  4ALP A;  1IBL L;  4JYA Q;  3UDI A;  4OWT B;  2YTX A;  4A3G H;  4GLX A;  4AYB E;  4BBS G;  4IOC A;  4GNX B;  1I5F A;  1K83 H;  4YWL A;  3CW2 C;  4QL5 A;  2UUB L;  2MO1 A;  4P73 A;  1TWC H;  2GN5 A;  4JI1 L;  1PHJ A;  1S3O A;  2RHQ B;  2BA0 A;  5C3E G;  3PIO A;  2ZJR A;  3MXN B;  2E2I H;  3J80 c;  2ATW A;  2ID0 A;  4BY7 G;  1HNW Q;  1U5K A;  1TWF H;  3CCR A;  1GM5 A;  1ASZ A;  4A3B G;  3CME A;  1OXV A;  3M85 A;  2I0Q A;  3RLO A;  4A3E G;  4C3I H;  1LYL A;  4HJ7 A;  1VS0 A;  2ZM6 L;  4DV1 Q;  1XPR A;  5M3F G;  4YWK A;  3BZC A;  5LMN W;  1E22 A;  3T1Y Q;  5IYD G;  5IP9 H;  1PH1 A;  2PMZ E;  2IY5 B;  2VQF L;  4JBW A;  3EIV A;  3IRB A;  4UP7 A;  2UXD Q;  1Y1V H;  1PH9 A;  4DR3 Q;  1EQQ A;  3GTK H;  4A3K G;  3CCL A;  1CKN A;  2N3S A;  2JEB I;  2E5L L;  3S1Q H;  5IT9 c;  3STB C;  1L2F A;  2HT1 A;  2ALY B;  2VQE L;  3CCE A;  3I4O A;  4BBR G;  1N36 L;  3S16 H;  1HZB A;  4AH6 A;  1I94 L;  2PI2 E;  4JI2 Q;  4LFC Q;  1E3P A;  1WCM H;  4JI4 Q;  1AH9 A;  4DR4 Q;  2WB1 G;  1QZH A;  3ER0 A;  2UXC L;  3HOY G;  2B63 G;  3J7A 5;  3KOJ A;  3BU2 A;  5C0X I;  2Z6K C;  4NXN L;  1YVC A;  4YHH L;  3GDE A;  1GVP A;  1SMX A;  5FJ8 H;  3G4S A;  1GKH A;  1EYG A;  5GAD C;  4LF6 Q;  3HOZ H;  4IFD G;  4L5Q A;  4X65 Q;  4DV4 Q;  4DUZ Q;  5M3M H;  5LMN L;  3S14 H;  1AE3 A;  4X66 Q;  3E9I A;  4POG A;  4JI7 Q;  1PH7 A;  3KDF B;  3CCU A;  2RF4 A;  3J7Z C;  1VQM A;  1XPO A;  2K50 A;  3J80 i;  2AKW B;  4XTC S;  3HOX H;  1NMG A;  4DR7 L;  5IYB H;  1VQC A;  3RN2 A;  5IP7 G;  1Q82 C;  1HNZ Q;  4JI6 Q;  1G29 1;  3KF6 A;  2ES2 A;  1TWH H;  2LXK A;  2LXJ A;  5AJ3 Q;  1VQL A;  3I4M H;  1E1O A;  1KRT A;  3TS0 A;  3J81 j;  2F4V Q;  5IE8 A;  1C9O A;  1N34 L;  1B70 B;  1KAW A;  4RG1 A;  4LF7 L;  1P8L A;  2UU9 L;  2KEN A;  3GD7 A;  1N32 L;  5FLM G;  4A3G G;  2ZTD A;  3CQZ H;  4BBS H;  3DM3 A;  1YHB A;  2UUC Q;  1I6H H;  1VQ8 A;  3KJP A;  2NN6 G;  4GN4 B;  4UP8 A;  3NEN A;  1J5E Q;  3CC2 A;  3PO3 H;  3AYH B;  4R4T A;  1VQO A;  4BY7 H;  4NB3 A;  2WB1 E;  2K5V A;  5M5W H;  1AE2 A;  1WYD A;  3HKZ G;  4WJ4 A;  2K75 A;  4APV A;  4A3E H;  3KFU A;  3JAM c;  2EQS A;  4DR1 L;  3RNU A;  5HGQ A;  5M3F H;  2D62 A;  4DUY L;  2DGY A;  2UUA Q;  2EIF A;  2Q2H A;  3K0X A;  3CCJ A;  3CPW A;  4GNX A;  1IBL Q;  5K36 G;  1BVS A;  1LM0 A;  3GTM H;  1VQI A;  2B29 A;  3I4N G;  1IBK L;  4A3K H;  5EAY A;  1E7Z A;  2NZH A;  4OWX B;  4EQ5 A;  1XMO L;  1QZG A;  2UUB Q;  3K81 C;  1CUK A;  4JI1 Q;  2KCM A;  1MJE A;  4BXX H;  1EIF A;  1SRO A;  4IFD J;  1BKB A;  3GTJ H;  1NY4 A;  1UWV A;  1WOC A;  1EWI A;  3G48 A;  4UPA A;  4GOP B;  3PF4 A;  1QUQ B;  2R7Z H;  2K4K A;  1L0W A;  2ZM6 Q;  3PUY A;  4GLA C;  4B3S L;  4LUZ A;  2B63 H;  3HOY H;  2K14 A;  1Q1E A;  2AWO A;  4XIG S;  1OXS C;  3SGI A;  4C3J H;  2VQF Q;  4DV2 L;  4LFB L;  2R93 H;  3CPF A;  4LWC A;  1K8G A;  1VQP A;  3H3V H;  5M3M G;  2IHE A;  3PCO B;  2E5L Q;  4GKJ L;  5GAE C;  4QQB X;  1D8L A;  2VQE Q;  1NE3 A;  4R4C A;  3HKZ E;  4HIK A;  3HOW G;  5IWA L;  4X64 L;  1DGS A;  1N36 Q;  5IP7 H;  3A74 A;  2JJQ A;  2PI2 A;  5GAG C;  3A0J A;  1CKM A;  4GN3 B;  3JAM i;  4YY3 L;  3UDX A;  2NVT H;  1VQD A;  3RR5 A;  2UXC Q;  2UUA L;  2OTJ A;  2JA5 G;  2F52 A;  2IT1 A;  4YHH Q;  3W5O A;  2MNA A;  3K7U C;  1L1O C;  5FLM H;  4LW1 A;  3CC7 A;  3KDF A;  2CKZ B;  3STB D;  1GD7 A;  3ZJY C;  5LMN Q;  3K8A A;  2A1A A;  4X62 L;  3ICE A;  3M7N A;  3HOV H;  3PO3 G;  4IPD A;  3Q8D A;  2JA9 A;  2KHI A;  2D0P A;  2D0O A;  4DR7 Q;  3D31 A;  5JJK A;  3H0G H;  3EN2 A;  4A3J G;  1X56 A;  2CWA A;  5C0X G;  1CKO A;  4A76 A;  5JEA G;  1JE5 A;  3ULP A;  3OYY A;  4L5S A;  4DR5 L;  1SN8 A;  1YJN A;  1N34 Q;  3M4P A;  3BJU A;  1LTL A;  4ME3 A;  4LF7 Q;  1YHQ A;  2UU9 Q;  1N32 Q;  1UE6 A;  4DR6 L;  3AFP A;  1XMQ L;  1X3G A;  3S17 H;  1OXX K;  1YHA A;  4PMW A;  1D7Q A;  3I4N H;  1S72 A;  3TQY A;  1VQJ A;  5HY6 A;  1HR0 L;  3T1H Q;  3WWV A;  4A3B H;  3TRE A;  3J81 i;  3F2D A;  4BA2 I;  4BXX G;  1HZA A;  2GVB A;  4GLV B;  4YCU A;  4GS3 A;  5BR8 L;  4LF5 L;  3KLW A;  4LNQ A;  2R7Z G;  4UP9 A;  4DR1 Q;  3GTP H;  1IYJ B;  4JI0 L;  3FKI G;  4AQY L;  1MIU A;  2GVA A;  3TEH B;  4DUY Q;  1SLJ A;  4A3D G;  4POF A;  3UDG A;  3RLN A;  3CCV A;  1T9H A;  3AFQ A;  2R93 G;  1H95 A;  1SE8 A;  1KD1 C;  3K7A H;  1Y1W G;  3F1Z A;  3PV0 A;  4HJ8 A;  1IBK Q;  1NBW A;  3DLL A;  1C7Y A;  3NBH B;  2N8N A;  4O0A A;  4A4I A;  4IJL A;  4H02 A;  1MKH A;  1XMO Q;  1OXU A;  1IL2 A;  1VQK A;  1Q1B A;  2R7D A;  4GOP A;  3HOW H;  1QUQ A;  4YWM A;  4HIM A;  2OTL A;  4IOA A;  4C3H H;  4HJ5 A;  4NPS A;  1VQA A;  2IHF A;  1W3S A;  1G51 A;  2ZTC A;  4TQU S;  4DV6 Q;  1IBM L;  1Y14 B;  3S15 H;  4B3S Q;  4KHZ A;  4B3M Q;  4JCV E;  2F3I A;  4DK6 C;  1X54 A;  2JA5 H;  4DV2 Q;  3F8T A;  2HIX A;  1SFO H;  2IX1 A;  4LFB Q;  5E7N A;  2E2H H;  1XNQ L;  5FLX c;  4A93 G;  4Y7N H;  4GKJ Q;  3FP9 A;  3HOV G;  4R1J A;  4IO9 A;  3EBE A;  1KHI A;  4BA1 I;  3T1H L;  1MJC A;  5GQO A;  1RIP A;  1PYB A;  5IWA Q;  4X64 Q;  3H0G G;  2PQA B;  4B3R Q;  4A3J H;  3G71 A;  1X6O A;  1EFW A;  1FGU A;  3CCQ A;  3UE0 A;  1U0L A;  4YY3 Q;  1NMF A;  4DV7 Q;  1IZ6 A;  1B7Y B;  3B6Y A;  3M4Q A;  1Q7Y C;  1K9M C;  2ZJQ A;  2MFI A;  4OX9 Q;  3TRZ A;  3PO2 G;  4DV3 L;  1Q46 A;  2XGT A;  2JA8 G;  1RL2 A;  3W1G A;  5M5X H;  3S2D H;  3NEL A;  3I7F A;  3MEF A;  4IFD I;  5IYC G;  4X62 Q;  2VS1 A;  4IPC A;  1YI2 A;  1Q12 A;  1PVO A;  1CSQ A;  1A0I A;  2QGQ A;  3L0O A;  1UE5 A;  2RCN A;  2H5X A;  3PUV A;  5DLQ E;  2OWO A;  4O2D A;  3PIP A;  1FJG L;  4L5R C;  1VQN A;  1SRU A;  1TWG H;  1R9T H;  3KYH C;  4QGU A;  3UE1 A;  1VQG A;  4DV5 L;  4GOP C;  4A3F G;  3GO5 A;  4RMF A;  1KXL A;  1V9P A;  4DV6 L;  3M3Y H;  2C35 B;  2ASB A;  5M5Y H;  1NTG A;  3RZD H;  3FKI H;  2VW9 A;  4DR5 Q;  1VQE A;  3E9H A;  4B3M L;  2NZO A;  4A3D H;  4WJ3 M;  3H15 A;  1YJ9 A;  1VQ5 A;  4DR6 Q;  1XMQ Q;  1HZ9 A;  4JC0 A;  1Y1W H;  1EOV A;  5H1S E;  1KRS A;  4A3I H;  3OW2 A;  2I5M X;  2V1C C;  4JBJ A;  1HR0 Q;  4L5T A;  4YCV A;  2R92 H;  2NN6 I;  4OXP A;  3I56 A;  3VDY A;  4C2M H;  2ZTE A;  4DV0 L;  1K3R A;  2BH2 A;  5C44 G;  5BR8 Q;  4PZ8 A;  4LF5 Q;  4B3R L;  3KF8 B;  2KBN A;  1YIT A;  3M9B A;  4HIO A;  1WI5 A;  1XNR Q;  3GTG H;  1WFQ A;  3A5Z B;  2N78 A;  4JOI A;  4DV7 L;  1JJ2 A;  3CAM A;  3PSI A;  4OX9 L;  4OO1 I;  2UXB L;  4JI0 Q;  1VQB A;  4EX5 A;  4AQY Q;  2A8V A;  2E8G A;  1A62 A;  2Z0S A;  4R4I A;  2Q2I A;  2CCZ A;  1XPU A;  5LMU L;  1G6P A;  4AIM A;  4GKK Q;  1HR0 W;  4BBR H;  2R6G A;  3CMA A;  2Y0S G;  4GNX C;  2LSS A;  4A75 A;  4UY8 C;  3AEV A;  4A93 H;  1VQ9 A;  2CWP A;  1YNX A;  4BY1 H;  4DNI A;  1PFS A;  3L2P A;  1UE7 A;  1ASY A;  2PNH A;  4B3T L;  3GTL H;  3CCM A;  3GTQ H;  4PZ6 A;  2KHJ A;  4JI5 L;  2XTI A;  1KQS A;  1LUZ A;  1VCI A;  3KJO A;  1P16 A;  2QA4 A;  2Z6K A;  2AMC B;  1X3E A;  3U4Z A;  1VQH A;  1O7I A;  2BH8 A;  4Y52 H;  1SR3 A;  1IBM Q;  4X6A H;  3PO2 H;  1A63 A;  1N33 L;  1X3F A;  2VY3 A;  1JMC A;  2A19 A;  2OQ0 A;  4LFA L;  2I5H A;  4TVA B;  1L1O B;  2JA8 H;  1X65 A;  4KHP Q;  1QVG A;  1KC8 C;  2WFW A;  1XNQ Q;  3S1R H;  5IYC H;  1YIJ A;  4LF9 Q;  1I50 H;  4OON A;  4DR2 Q;  2HHH Q;  2VUM H;  1NJI C;  1TWA H;  2PQA A;  2Q2T A;  5C4X G;  1FL0 A;  3AQQ A;  4K0K Q;  2YV5 A;  4JBK A;  2DUD A;  2R7F A;  4A3F H;  1XNR L;  3CP0 A;  1Q81 C;  2JA6 H;  3JC6 6;  3E0E A;  3ERS X;  3HKS A;  3U4V A;  2B3G A;  3HOU H;  2VNU D;  3M4O H;  3CD6 A;  4LF4 Q;  3PUZ A;  2Y0S E;  4DV3 Q;  3PUX A;  2L15 A;  4JOI C;  3OTO Q;  1TXY A;  4IJH A;  4GKK L;  2FXQ A;  3F2B A;  3S24 A;  1PH5 A;  4A3L G;  2WP8 J;  2CFM A;  1M1K C;  1FVI A;  3ULL A;  1J6Q A;  4J15 A;  1PA6 A;  1PH3 A;  1VQ6 A;  3G6E A;  2YYZ A;  2MO0 A;  1HH2 P;  4A3I G;  1Z47 A;  4JI3 Q;  2R92 G;  3PUW A;  3S1N H;  4NXM Q;  4LF8 Q;  2KCT A;  1FJG Q;  2WAQ G;  2JA7 G;  3S1M H;  1N9W A;  1Z9F A;  2OCE A;  1JT8 A;  5C44 H;  2I5L X;  4DV5 Q;  4A3M H;  4JV5 L;  2JK8 A;  3F2C A;  1KIX A;  1V43 A;  3CC4 A;  4JYA L;  1X55 A;  4P71 A;  4PZ7 A;  3PF5 A;  3I2Z A;  2JEA I;  4KHP L;  4LUO A;  5C0X J;  2BA1 A;  4IPH A;  1HZC A;  5J3B A;  5JEA J;  4DR2 L;  1M90 C;  2JQO A;  3BZK A;  4BY1 G;  2HHH L;  4LF9 L;  3CF5 A;  3RLF A;  4K0K L;  2N49 A;  2CQO A;  2E2J H;  1HNW L;  1HJP A;  3W1B A;  2RHS B;  4DV0 Q;  1JB7 A;  1HNX Q;  2VL6 A;  5IY0 A;  3I55 A;  2HIV A;  4DAY B;  2JE6 I;  2K5N A;  3PGZ A;  1BBU A;  5GRO A;  5GAH C;  4DV1 L;  4A3C G;  4KI0 A;  2UXB Q;  2NVQ H;  1WJJ A;  4DAM A;  2QEX A;  1I3Q H;  1PYS B;  3T1Y L;  4YCW A;  1K8A C;  4LF4 L;  4OWW B;  3OTO L;  5LMU Q;  2EXD A;  4JBM A;  1PH2 A;  3S2H H;  2UXD L;  2AWN A;  4DR3 L;  1IXR A;  2K5H A;  3NEM A;  4KLK A;  3UDF A;  4HJ9 A;  2WAQ E;  1VQ7 A;  3H3V I;  2VUM G;  4JI3 L;  4NXM L;  4B3T Q;  5JJL A;  1CKN B;  1BBW A;  5C4X H;  5C3E H;  3U58 A;  2Q2U A;  5JJI A;  4JI8 Q;  1OTC A;  3LGJ A;  1Q86 C;  4JI2 L;  4JI5 Q;  2HQL A;  4LFC L;  4OO1 G;  1E24 A;  3D0F A;  4JI4 L;  4DR4 L;  2JA6 G;  1PH4 A;  3K80 C;  4QY7 A;  2YU9 H;  1XTD A;  4P72 A;  4HID A;  1L1O A;  1VQ4 A;  1YJW A;  3HOU G;  1CSP A;  3ULJ A;  1N33 Q;  1EUJ A;  5IP9 G;  3GTO H;  1JJC B;  4MZ9 A;  5IYD H;  4LF6 L;  2VZA A;  4LFA Q;  3RN5 A;  4QJF A;  1Y1V G;  1B8A A;  4P74 A;  4X65 L;  4P75 A;  1GO3 E;  4DUZ L;  4DV4 L;  1QVF A;  4A3L H;  4X66 L;  4MNO A;  1X9N A;  4FDB A;  4JI7 L;  1E1T A;  2YTY A;  4LUV A;  4LF8 L;  2JA7 H;  1JJG A;  5C4J H;  4MTN A;  4AYB G;  5ELN A;  2NVX H;  3CCS A;  2ZJP A;  1XJV A;  3HFZ B;  1EQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...