1EWIA

Human replication protein a: global fold of the n-terminal rpa-70 domain reveals a basic cleft and flexible c-terminal linker
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
114
structure length
114
Chain Sequence
MVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords REPLICATION PROTEIN A
publication title Human replication protein A: global fold of the N-terminal RPA-70 domain reveals a basic cleft and flexible C-terminal linker.
pubmed doi rcsb
total genus 8
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2000-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ewiA00
1VQ6A 3ICEA 1Z9FA 1GVPA 5AJ3L 3HOWH 1X54A 3I4OA 4A3GH 1VQJA 3JAMc 3CCJA 4YWLA 1AH9A 4L5QA 1HNXQ 3S2HH 2OTLA 1YJNA 5M5XH 3CPWA 3PF4A 5IYDH 1X3GA 1EIYB 3G71A 1YIJA 4B3SQ 1NJIC 2D62A 1SRUA 2DGYA 2RF4A 4FDBA 1JJCB 4DR6L 1JJGA 2KCMA 1A8VA 1KAWA 3E0EA 3CD6A 1SMXA 4A3DG 3G6EA 1E24A 5AJ3Q 4GLAC 1HZCA 4GOPA 4HJAA 1IBKL 1N34L 5IWAL 2HIXA 1CUKA 2IHEA 4JI6L 2CCZA 4PMWA 4BXXG 3S2DH 2WB1E 1HNZQ 3RN2A 3RLNA 3HKZE 1Q82C 2N8NA 1YJWA 5LMNW 4DR5L 1VQ9A 1S40A 2ALYB 4LUZA 4DR6Q 2JA6G 5DLQE 4GKJQ 1NY4A 4BA2I 1D7QA 2Q2UA 5JEAG 2PQAB 4JBWA 3H3VI 1IBKQ 1G291 3FKIH 4LFCL 5IWAQ 2ZJRA 2PQAA 1N34Q 4JI6Q 2F4VL 3HOVH 1YHBA 2JJQA 1IYJB 3K8AA 2D0OA 4HJ5A 1NE3A 4JI5L 2PMZE 1PH5A 2XTIA 1TWGH 4DR5Q 4A3JG 2V1CC 4GNXC 4UP7A 1PA6A 3GTGH 4C3IH 2CKZB 1QZGA 2R93G 1KC8C 1YZ6A 2KHIA 1TWAH 4B3MQ 4NXML 1HNWQ 4XTCS 2K14A 4X62L 2OCEA 3KF6B 4IFDJ 4QGUA 2R7ZG 3NENA 4PZ8A 1X9NA 4BBSG 3NBHB 1FL0A 3H0GG 2F4VQ 4LFCQ 4GN4B 3PUWA 2I5LX 2NVTH 4KI0A 4DV3L 4A3DH 5GAHC 2L15A 4JI5Q 2Y0SG 2HQLA 1NTGA 1Q1EA 1X3FA 2H5XA 4GLXA 3PIPA 1VQMA 3Q8DA 1GO3E 1VQ4A 1XNQL 4TVAB 1PYBA 2JA8G 4BXXH 4JI3Q 2JEAI 4NXMQ 3K0XA 1EOVA 3D31A 4X62Q 2LXKA 1ASYA 1K73C 1J6QA 3CQZH 4OXPA 5C0XJ 3HOYG 2JA6H 1TXYA 3OYYA 4HJ9A 4NPSA 3OW2A 4DV3Q 4A3LG 5JJIA 3PUVA 3EIVA 2E2JH 2ZTCA 1KRSA 4PG3A 2MFIA 1B7YB 5C44G 4JI1L 3S17H 4DV0L 2KCTA 1XNQQ 1L2FA 2JA5G 2IX1A 1VQOA 4OONA 2UXBL 4JV5L 3LGJA 2OQKA 2RHQB 4BY1G 1FVIA 1PH6A 1PH3A 3CAMA 4A3CG 2PNHA 1KD1C 1IXRA 3UE1A 4A3JH 1I5FA 1YHAA 2EXDA 1KQSA 3J81j 1MJEA 2R93H 4IO9A 4JI2L 4P72A 2OQ0A 4GN5A 1NMFA 1VQ5A 2R7ZH 4JI1Q 3MXNB 4LF5L 4BBSH 3H3VH 4DV0Q 3H0GH 5FJ8G 4LF4L 2VZAA 2Z0SA 3M4QA 4Y7NH 1QVCA 1BBUA 2F3IA 3FP9A 3JAMi 1VQKA 3PCOB 4L5SA 4HIDA 4JV5Q 2QA4A 2UXBQ 3CCLA 3UDXA 3KOJA 2UXCQ 4KHZA 1XMQL 1VQAA 4BBRG 3GDEA 4QY7A 1YBYA 4KLKA 4PZ7A 4JOIC 1Q7YC 2JA8H 3OTOL 1KHIA 3M4PA 4GKJL 1E7ZA 1K9MC 2WFWA 4JI2Q 3FHWA 1BBWA 3F2DA 3GTMH 2IT1A 4DV1L 1XPRA 4X6AH 1GD7A 4L5RC 4LF4Q 5HGQA 3CF5A 2A8VA 4JI8L 2Q2IA 4DK3C 3HOYH 4YCUA 3SGIA 4A3MG 3GO5A 4RMFA 3M85A 1Q46A 1QUQB 4A3LH 1JJ2A 1OXVA 4YCWA 4WJ3M 5C44H 1J5EL 1L1OB 4JI7L 3J80c 3M9BA 1W3SA 2WAQG 5M3FG 1XMQQ 2GN5A 1UEBA 1L1OA 4C2MH 1RL2A 4LW1A 4EQ5A 4YHHQ 3HFZB 3OTOQ 4HIMA 3CCMA 1SFOH 3KF8B 2JA5H 3I4MG 2FXQA 1M1KC 4BY1H 4A3CH 2JA9A 4JBJA 4DV1Q 1I94L 1WCMG 5M3MG 4AH6A 1G6PA 1B8AA 2ZTEA 3CXCA 2N3SA 5FLXc 3I2ZA 4ALPA 1CKMA 1QVGA 5M5YH 3HKZG 2QGQA 3CCRA 2A19A 4AQYL 4JI0Q 1J5EQ 4DUYL 2VQEL 1E1TA 2LXJA 4P75A 4IPDA 4JI7Q 3ERSX 2VNUD 1VQNA 5FJ8H 3CCQA 4NXNL 4DR3L 1QVFA 3S14H 3U4ZA 4GOPB 4UY8C 1Y1WG 4PZ6A 1X3EA 2JK8A 1I94Q 1V1QA 1WJJA 2R92G 1Q81C 1Q8KA 4BBRH 5LMUL 4DV2Q 4DV6L 1MJCA 3MEFA 4A75A 2VUMG 3K7AH 4R4OA 4JI4L 4H02A 5GAEC 3I56A 1N33L 4DUYQ 1PFSA 2VQEQ 1BVSA 2BH2A 2R7DA 4A4IA 3NEMA 3GTOH 2RHSB 1Q1BA 2ES2A 4NXNQ 4DV5L 4POGA 1I50H 4A3MH 1FGUA 3F2CA 1SROA 4IPHA 5IYCG 1IL2A 1L0WA 3BZKA 3RLFA 4DR4L 2F52A 3T1HL 3B6YA 3U4VA 5M3FH 1A62A 1O7IA 5LMUQ 4OWXB 4DV6Q 2VY3A 3CC2A 4LFAL 3I4MH 1M90C 4JI4Q 4QIWE 1A0IA 1N33Q 3TS2A 3M3YH 3HOUG 3BU2A 5IE8A 1WI5A 1N32L 1WCMH 5M3MH 5IT9c 4DV5Q 4O0AA 4TQUS 4YY3L 2OWOA 2JQOA 1DGSA 5M5WH 2UU9L 1HR0W 1S3OA 3CC4A 4J15A 2YTXA 1IBLL 4UP8A 4DR4Q 3T1HQ 2AWOA 3ZJYC 2A1AA 1LM0A 1JMCA 1GKHA 4LFAQ 1LUZA 4EX5A 1PH8A 4LUOA 1KL9A 2YV5A 4B3TL 4AYBG 3F1ZA 4DK6C 4HJ8A 1Y1WH 4LF9L 3PUXA 1HZAA 1TWFH 2MQHA 2NVYH 4DAYB 2QEXA 3CPFA 3F8TA 2KHJA 5LMNL 2E5LL 2R92H 4ME3A 3G4SA 3WWVA 1VQCA 2UUAL 5E7NA 3AEVA 2VUMH 4YY3Q 3GTLH 3KFUA 3M4OH 5IP7G 2I5MX 3ULPA 2Q2HA 2NN6I 3NELA 3J81c 4QJFA 1VQIA 1X6OA 3S24A 3RZDH 1E3PA 3CCEA 4B3TQ 1CSQA 3L7ZC 1V43A 4NB3A 4UPAA 2K5NA 5IYCH 4LF9Q 4GNXB 3TQYA 3KJOA 4Y52H 5LMNQ 4A3KG 1Y14B 3ER0A 3EBEA 2E5LQ 1KXLA 4GNXA 3PUYA 4X64L 3PIOA 1MIUA 1PH9A 1R9TH 1OXXK 3F2BA 1XPOA 1EQQA 1E1OA 1A63A 2PI2E 1IZ6A 1B70B 3HOUH 2NN6G 3GTJH 3ULJA 3CCVA 1HR0L 3D0FA 1YHQA 1K8GA 4BA1I 1UE5A 1VQHA 3J80i 5GAGC 1VQ7A 2NVXH 4R4IA 4DR1L 1VCIA 3STBC 1V9PA 2GVAA 2Z6KC 2CWAA 3S15H 2MNAA 4OWWB 2AMCB 1K83H 5JEAJ 2ZJPA 1WFQA 1BKBA 4L5TA 3S1RH 2EQSA 4JCVE 3PO2G 3DM3A 2VQFL 3S1NH 1JE5A 4LWCA 3HOXG 1YI2A 2HT1A 1L1OC 2CWPA 2JA7G 1LTLA 5IYBG 2VW9A 4APVA 2JE6I 5GQOA 1JB7A 1NMGA 2AKWB 3L0OA 2BA0A 3S1MH 2DUDA 5H1SE 4GLVB 3CCUA 2GVBA 2PI2A 4OWTB 5IP7H 1CSPA 4DR1Q 2HHHL 4LF5Q 4LF8L 3GTPH 4IFDI 1EUJA 1PH1A 1Y1VG 3W5OA 2ZTDA 3IRBA 4AIMA 3A74A 4HJ7A 3RN5A 3TS0A 4C3JH 3CCSA 4JBMA 4A3BG 2IX0A 2AHOB 2NVQH 4O2DA 4DUZL 4BY7G 4A3KH 2N78A 2K75A 4GN3B 4B3RL 4GOPC 1SN8A 3KLWA 1PH2A 2ZJQA 2OTJA 5IP9G 4A3IG 1QZHA 2HHHQ 4LF8Q 1XPUA 1G51A 1HJPA 4LUVA 1EFWA 4JI8Q 2WB1G 3AFQA 4IFDG 2NZHA 1GM5A 2B29A 2K50A 4DKAC 3H15A 3I55A 5C0XI 1YITA 2NZOA 1Q86C 1P16A 3K80C 1HZ9A 2I5HA 1UE1A 1X65A 2ATWA 1C0AA 3PUZA 4R4QA 1VQLA 1X55A 2CFMA 3BJUA 3GD7A 1XTDA 3HKSA 2XGTA 2MO0A 5JJKA 4B3RQ 5FLMG 1WOCA 3PO2H 1LYLA 3ULLA 2E2IH 4JOIA 3RZOH 1WYDA 2VS1A 3UDFA 3HOXH 2K52A 1C9OA 3W1BA 3GTKH 1PVOA 1H95A 2JA7H 3DLLA 1HZBA 2D0PA 5IYBH 1KRTA 1SR3A 2CQOA 1VQEA 4X66L 1K8AC 3PSIA 4KHPL 1YEZA 5C0XG 1HNZL 2K4KA 2KENA 4AQYQ 3T1YL 4A3FG 1SLJA 4DR7L 1U5KA 1XJVA 1D8LA 1T9HA 5ELOA 3K81C 4DR3Q 1NBWA 1EIFA 3G48A 4OX9L 2WAQE 3HOZG 1Y1VH 4UP9A 1OXSC 1YNXA 3PV0A 2E8GA 4DR2L 4QL5A 4LF7L 1W2BA 1X56A 4P71A 1C7YA 4A3BH 4C3HH 3CW2C 4YWMA 4BY7H 4JG2A 4X66Q 2UUCL 1U0LA 3J81i 2YYZA 4KHPQ 2ZM6L 1VQBA 3T1YQ 5IP9H 1P8LA 4A3IH 2B63G 4DR7Q 2BA1A 1N9WA 1PV4A 1VS0A 2YTVA 4DPGA 5BR8L 4OX9Q 4QQBX 2UXDL 5C4XG 3KYHC 3J7ZC 2KBNA 4MZ9A 1KIXA 3I4NG 5HY6A 1HNWL 4B3ML 2EIFA 4DR2Q 4LF7Q 3PO3G 1YJ9A 2MO1A 4IPGA 1UWVA 2JEBI 3TRZA 1UE7A 3BZCA 1N8RC 2UUCQ 3RR5A 2R7FA 5FLMH 2ZM6Q 5J3BA 4R4TA 3L2PA 2VL6A 1N32Q 2ID0A 1VQFA 5BR8Q 2UXDQ 2HIVA 1VQPA 4HIOA 2UU9Q 4JI3L 2UUBL 3UDIA 3U58A 1IBLQ 4A3FH 1IBML 1AE2A 3UE0A 4HIKA 4LFBL 4X65L 4GKKL 1I3QH 2B3GA 3KF6A 5C3EG 2IHFA 5JJLA 3PGZA 2ASBA 4RG1A 1CKNB 3HOZH 4A93G 1TWCH 3K7UC 4IPCA 2K5VA 1CKNA 3A0JA 3AFPA 3TEHB 1VQ8A 2I0QA 4P74A 1HH2P 3CMEA 2UUAQ 2WP8J 3RLOA 4WJ4A 3J7A5 1K3RA 4DUZQ 3JC66 2C35B 3TREA 1RIPA 2UUBQ 1IBMQ 4POFA 3KJPA 1UE6A 2B63H 4OO1I 4LF6L 1XNRL 4LFBQ 4A3EG 4X65Q 4GKKQ 1XMOL 1FJGL 3UDGA 3HOVG 2E2HH 5K36G 2RCNA 1JT8A 4R1JA 3CP0A 5C4XH 1E22A 5C4JH 3U50C 3I4NH 1PH4A 4YWKA 2Y0SE 3M7NA 4AYBE 3PO3H 1YVCA 1SE8A 4GS3A 4X64Q 4K0KL 4JBKA 4IJLA 2N49A 1EYGA 2K5HA 2Q2TA 3AQQA 4YCVA 2AWNA 3HOWG 2IY5B 4A3GG 4JYAL 4LNQA 1OXTA 4LF6Q 1HR0Q 2BH8A 1XNRQ 5ELNA 4OO1G 2UXCL 1XMOQ 1FJGQ 3GTQH 5IYDG 4P73A 1Z47A 5EAYA 3STBD 1N36L 3VDYA 4DV4L 3KDFB 1VQGA 1OTCA 2LSSA 1VQDA 4XIGS 1Q12A 4K0KQ 5C3EH 3E9IA 1MKHA 5IY0A 3KDFA 2VQFQ 4IJHA 3AYHB 4A76A 1AE3A 1TWHH 4JC0A 3CMAA 3CC7A 1I6HH 4JYAQ 4A93H 3S16H 4IOAA 3A5ZB 4DV2L 4DV7L 1CKOA 3W1GA 2YU9H 4DAMA 1OXUA 3RNUA 4YHHL 5GROA 1N36Q 2R6GA 5GADC 1ASZA 4DV4Q 3EN2A 4A3EH 1HNXL 1S72A 4MTNA 1EQRA 1PHJA 3I7FA 2Z6KA 3E9HA 4IOCA 4B3SL 3PF5A 1PH7A 4DNIA 3A5UA 1PYSB 4MNOA 1K0RA 4JI0L 3FKIG 1EWIA 4DV7Q 1QUQA 3S1QH 2YTYA 4R4CA
chains in the Genus database with same CATH superfamily
4BY1B 1GVPA 2AQ3B 2HUGA 4DAPA 4XYQA 4A3GH 3CRKC 3CCJA 4L5QA 3S2HH 3MXUA 3VA7A 3Q23A 1YJNA 3PF4A 4RCNA 1LT3D 1G6ZA 2WV6D 2FINB 4DR6L 4HN7A 1DXMA 3CD6A 3LX0A 1ESRA 3FVQA 3H91A 1E24A 4IUNA 1A3VA 4GLAC 1HZCA 4GOPA 4HJAA 3OWFA 1U4MA 1N34L 4JI6L 3S2DH 5CV4A 5ELDA 3RN2A 5ELFA 1ET9A 3OSOA 2JA6G 4RGMA 4KTAA 2PQAB 4JBWA 1Z7TA 1UEAB 1BCPD 2KJXA 1FR3A 3HOVH 2JJQA 1IYJB 3P20A 3FRPB 1PH5A 2XTIA 1TWGH 4DR5Q 2V1CC 2EY1A 3GTGH 3TDQA 2CKZB 2F0EA 1F2ZA 4XTCS 2K14A 5E1FA 2OCEA 1AP0A 4QGUA 2EYLA 2R7ZG 3NENA 3NBHB 4RGTA 3S9WA 1T5XD 4LFCQ 3TZDA 3A7AB 4HCSA 1QJOA 1TS4A 4JI5Q 2IPKD 2Y0SG 1Z6HA 1PRTB 2R92B 3PIPA 4KJOA 1XNQL 3PIO3 4JI3Q 2JEAI 3CQZB 4RFBA 3RUZA 4X62Q 2F03A 5EBCA 4QCLA 3HOYG 2JA6H 1TXYA 1O7YA 3OYYA 5IGCA 4NPSA 2XSCA 4DV3Q 3OW2A 5JJIA 4Q0FA 1KNAA 1SYCA 3E6ZX 4DV0L 2KCTA 4DA2A 2K5WA 2IX1A 4JV5L 4A3JB 1PH6A 4A3CG 1KD1C 3UE1A 3VYUA 3P1HA 2R93B 1I5FA 3NQTA 2F0DA 2MP1A 1A3UA 1O78A 2L4NA 2OQ0A 1J8IA 1VQ5A 2R7ZH 3MXNB 3GV6A 4NKLA 4LF4L 1QE6A 1E2WA 3T13A 3DWQA 3JAMi 4AYBB 2UXBQ 4WFN3 3FDTA 2DNEA 3UDXA 2L1BA 4BBRG 1YBYA 2B2UA 3OTOL 1SEBD 1K9MC 2EJMA 3FHWA 4FF1A 4U68A 1EQVA 3HOYH 2DJFC 2F0MA 1CK1A 1STBA 2F0VA 1Q46A 1ILQA 1IW7C 1OXVA 4H0LC 1G91A 3M9BA 2FJ2A 3PMFA 4K5VA 2GN5A 3NTKA 1SNCA 1H9SB 1M1KC 4RKBA 4A3CH 2JA9A 2K05A 4DV1Q 1WCMG 3BDLA 5M5YB 1DOMA 1B8AA 4ALPA 3DWAA 1ICFB 5KIXA 1J5EQ 2LXJA 4HSPA 4C1NI 4X3TA 4NXNL 3S14H 4GOPB 3RZOB 2RDGA 1X3EA 1S4ZA 1Y8OB 2JK8A 5CC4A 1WJJA 2F0IA 3E3XA 1XX8A 1WD0A 4BBRH 3DWPA 4B9WA 3BDOA 4R4OA 5GAEC 2EYJA 4G7HC 1DZ1A 1LTRD 4A3MB 1CTMA 2BH2A 5CGKA 1FNUA 2Z6BA 4LK1C 1SNQA 4POGA 3F2CA 4CKCA 1L0WA 3BZKA 3RLFA 3VR4A 1D1IA 3U4VA 1A62A 4OWXB 4IUTA 4A3IB 4R8NA 5M3MB 4JI4Q 1G2TA 4F8MA 3M3YH 2JN4A 3HOUG 4WJWA 1O7LA 1WCMH 3CHBD 3TMEA 5IT9c 1KDBA 4YY3L 2OWOA 1DGSA 5M5WH 4UP8A 1ZKOA 3T1HQ 2AWOA 1JMCA 2YV5A 4DGZA 5A2QL 4DAYB 3GTLB 3F8TA 2PMZB 5KYIA 4ME3A 3G4SA 3AEVA 3KFUA 4RA8A 4RH6A 1F9QA 1V1OA 1VQIA 3J81E 4B3TQ 4NB3A 4GNXB 3TQYA 4Y52H 3BYYB 1KXLA 4X64L 3PIOA 1PH9A 1R9TH 2PO4A 1E1OA 1K8MA 2PI2E 2L12A 1IZ6A 2E2HB 3IFDA 3HOUH 2NN6G 4JVZA 3QOJA 3D0FA 1YHQA 3BYTB 4BA1I 3J80i 2E75C 2NVXH 3J7AF 4DR1L 1VCIA 1V9PA 3S1RB 3OOCA 2BOSA 1LV9A 1B53A 2MNAA 1K83H 2EYMA 1PZJD 2EQSA 3W2DA 3LWEA 4LWCA 1NR2A 5IT9L 1L1OC 2CWPA 2JA7G 2VW9A 1I4QA 4FXGC 1EWHA 4GLVB 3CCUA 2GVBA 4N8FA 3SK6A 5EPJA 5C5MA 5LHY1 3MAQA 2DY8A 2CQAA 1TWHB 3A7LA 1ZXTA 1PH1A 4O42A 4AIMA 1D5XC 2EYFA 4A3BG 2NVQH 4DUZL 2N78A 4TSSA 4B3RL 1PH2A 2ZJQA 2M00A 5IP9G 1QZHA 3GQBA 1XPUA 3AU7A 1G51A 1HUNA 1EFWA 2NN6H 5CV9A 3HP3A 2B29A 2K50A 3MFGA 4IZ8A 4DKAC 3I55A 1YITA 2NZOA 1IW7D 4DNRB 1CQFA 2ATWA 1GHJA 2EYOA 1YNJC 2CFMA 3GD7A 3PO2B 4C56C 1XTDA 1H9MA 3HOWB 3H94A 2RVLA 2Z4IA 1LYLA 4KY5A 3ULLA 1JWUD 3BG3A 1C8CA 4IUUA 1WYDA 3UDFA 1C9OA 5M9OA 5M5XB 2JA7H 3DLLA 2CQOA 5IGDA 1K8AC 4KHPL 1MSGA 1SLJA 1KAAA 4ZQ3A 1BF4A 4DR3Q 2I07B 5D3DA 3EQLC 1CFMA 4MHEA 2E8GA 4LF7L 4A3BH 5T1GA 5C3XA 4FF2A 4YWMA 4JG2A 4CDDC 3CU7A 2YYZA 1DYQA 1PRTC 5IP9H 2A6HC 1VS0A 4QQBX 4OX9Q 5C4XG 3KYHC 2EJFC 2EIFA 4DR2Q 1S5CD 2MO1A 1CM9A 2J4XA 2ZXOA 4OEMB 2B8GA 3TRZA 2G9DA 1N8RC 3IKJA 4KN7C 5KNBA 4FF4A 2P5ZX 4C3IB 1HPCA 1N32Q 1VQFA 3ND8A 2B39A 1EFID 1LTID 1AFPA 4JI3L 3UDIA 2XRSD 3U58A 1IBML 3DHQA 3OMGA 3DM1A 2B3GA 5JVH3 5C3EG 4A3DB 1CKNB 5IODA 4PNYA 1TWCH 1STGA 1TY2A 2K5VA 1JC7A 2I0QA 1R4QB 1L0YB 1PMRA 1PXUA 2WP8J 4WJ4A 2RSOA 5BN3A 4DXGA 2C35B 4J1MA 1RIPA 4ZLTF 4IUQA 5J1ZA 5JOBA 4OO1I 3I4NB 4A3EG 3WOEA 1SMYC 3VR2A 2RCNA 5C4XH 1JB3A 1JR0D 5C4ZA 4U673 5C4JH 4JK1C 1V1PA 1TS2A 4G7OC 4ZYSA 1NCVA 1YVCA 2HDLA 4GS3A 2N49A 2KA7A 2KECA 4RGNA 2Q2TA 2IY5B 1FNWA 4HSVA 1KLUD 4LF6Q 1XNRQ 2BH8A 3GTQH 5IYDG 1NNXA 5EAYA 1ICWA 1SE3A 2C5CA 1KDAA 4DV4L 1GUGA 1G8ZD 4XQJA 4XIGS 5I4DA 4J6HA 1Q12A 2Z4HA 5C3EH 1MKHA 5IY0A 4JC0A 1JOKA 1EL0A 4JYAQ 4IOAA 1ESFA 2DN8A 2LS01 3W1GA 3N52A 5EKLA 5GROA 1N36Q 5L37A 4A3EH 3SE0A 1VF7A 3I7FA 1B3AA 3MXGA 5C44B 3E9HA 2X6LA 4IOCA 4B3SL 1LTAD 4DNIA 3FKIG 3Q6SA 4DV2Q 4DV7Q 1QUQA 3S1QH 2L0CA 4G7ZC 1VQ6A 1B50A 2MPMA 1XTCD 3K5OA 3V05A 4UAIA 2OF1A 3I90A 1WTWA 4YWLA 4BS9A 1HNXQ 3JAME 4HEDA 5LL6S 5IYDH 1X3GA 3G71A 1YNJD 2D62A 2IW3A 1SRUA 2K32A 2DGYA 1JJCB 1JJGA 2KCMA 3VA5A 1HFGA 1KAWA 3E0EA 1WTOA 1I4GA 3G6EA 1GUTA 5AJ3Q 4GZYC 2GA4B 3A56A 1HTLD 1GUWA 5IWAL 1CUKA 3K7AB 3HKZE 2ALYB 1GUSA 1NY4A 1EY9A 4BA2I 2WINB 1D7QA 5JEAG 5IOCA 2WAQB 2F1MA 4IALA 1IBKQ 1G291 3FKIH 2F4VL 2PQAA 3I73A 1EWCA 2F0SA 2SNMA 1PRTD 3NWTA 4DK1A 1M8AA 5CORA 4A3JG 1PA6A 4GNXC 4UP7A 1TWAB 2A6HD 1AZQA 2WKCA 1EY8A 4DXFA 2R93G 2PPBC 1DONA 4IFDJ 2EY5A 4ZRZA 2N88A 1LO5D 1FL0A 3A8KE 3NBHA 4QMGA 4FXDA 1TWFB 1JWSD 2L15A 2OXPA 2BE5D 1X3FA 2H5XA 2K28A 1VQ4A 2QILA 2JA8G 4NXMQ 3CQZH 4OXPA 5C0XJ 3KBGA 1AZPA 3S17B 3MTSA 2F4IA 2J7ZA 2E2JH 2QW7A 4PG3A 5JEAH 5E4XA 3EA6A 1QB5D 4X3SA 4OONA 2O2LD 2OQKA 3CAMA 3GTJB 4K6LA 1SMYD 4A3JH 2EXDA 1KQSA 1MJEA 1SE2A 2R93H 4IO9A 4JI2L 3H0GB 4Y7NB 1NMFA 3S15B 4JI1Q 1PTOC 2VB3X 3H3VH 3M4QA 3MXNA 1QVCA 1BBUA 3FP9A 3SR1A 1VQKA 1U4RA 4HMIA 5JJZA 3S1NB 1SBBB 3TP6A 2UXCQ 1A2TA 1VQAA 1D5ZC 3NE5B 3NPPA 4JOIC 2JA8H 4GKJL 2A69D 1I6VC 2NWGA 1LTBD 1BBWA 2ZXRA 4OELB 1DD2A 2QDLA 1SDFA 3GO5A 1A2UA 4C3JB 4A3MG 1QUQB 4C2MB 4WJ3M 4JI7L 1L1OB 2CH4A 2Q8TA 5M3FG 2ENBA 1XMQQ 1STYA 3J80E 4LW1A 4YHHQ 1CA5A 3HFZB 3I4MG 1SFOH 3CCMA 1EYDA 2FXQA 1RHPA 5M3MG 1H9SA 4AH6A 1ZEQX 1G6PA 2ZTEA 1PFNA 5FLXc 1QVGA 5M5YH 3QIAA 2VQEL 4P75A 1K0SA 4DR3L 2F0PA 1IYUA 4UY8C 3EVQA 1Y1WG 4MN3A 1EIGA 4ZKBB 1I94Q 1Q81C 1ENAA 1MJCA 3MEFA 4DV6L 2NUCA 5FOBB 3GTOB 4H02A 2B2TC 1N33L 3D4WA 4ODGA 4DUYQ 1OO9B 1BDOA 1NAPA 2ES2A 4DV5L 1I50H 4A3MH 5E3FA 3VR3A 4IPHA 1IL2A 2EY2A 3RMHA 5HGTA 3P75A 4DR4L 3B6YA 2FFKB 1O7IA 3U9SA 5LMUQ 5M3FH 2VY3A 3I4MH 2AUKA 4X3UA 1M90C 1A0IA 4O1NA 1WI5A 1N32L 5M3MH 4H13C 4O0AA 1SNMA 4V0BA 3CC4A 2Q8IB 1LM0A 2QKIC 5FKAC 4DNTB 2E2DC 1LUZA 2NVYB 4LFAQ 1FYCA 1Y1WH 5I2XA 5IGEA 1E2ZA 3MHBA 5I9PA 2MQHA 5ELCA 1TS3A 4M8AA 5LMNL 2R3ZA 1K8OA 2E5LL 4DAYA 3GTLH 2Q2HA 4QB4A 3S24A 3RZDH 1D6EC 1WTVA 3R2IA 1DM0B 1B1ZA 4UPAA 1DOKA 4LF9Q 2QCPX 4A3KG 5EKKA 5JVG3 1STAA 3TP7A 4GNXA 1U9RA 3SK4A 1MGSA 1SYFA 3F2BA 1XPOA 1Q90A 1B70B 3ULJA 4IURA 1K8GA 1GJXA 1UE5A 4HAEA 5GAGC 1VQ7A 3K5MA 3X3MA 4KY7A 2MUYA 2AMCB 3S1RH 3PO2G 1Q3LA 4CJ2C 1YI2A 2HT1A 1LTLA 1D1KA 5IYBG 4APVA 1BCPF 3GTPB 1GXDC 2AKWB 3MEHA 3S1MH 1RF2D 2DUDA 2ICIA 1PTOD 2MHVA 2PI2A 4OWTB 4LF8L 2XWJB 4IFDI 1EUJA 4EVOA 2HD3A 3W5OA 1UAPA 1SSOA 3IRBA 1A15A 1DCZA 1SNDA 3RN5A 1A6XA 3R2TA 2IX0A 4C3HG 4V190 2FMCA 3BVMA 4K2LA 3I3CA 4BY7G 4A3KH 1RCVD 2K75A 2OTJA 2HHHQ 1B4OA 3QG1A 2WB1G 1GM5A 4FNFA 3H15A 5C0XI 2NYZD 1KDCA 1X65A 1C0AA 3PUZA 4Q5VA 2B2YC 1X55A 3BJUA 2K01A 2E2IB 2OEOA 3HKSA 2MO0A 3HOXB 5JJKA 4A3GB 3PO2H 4JOIA 2KEDA 2VS1A 2L5TA 3S2HB 2K52A 3GTKH 1PVOA 1H95A 5IYBH 1VQEA 4X66L 1TT2A 3PSIA 1YEZA 1U5KA 1D8LA 1Y1VB 1NBWA 2A73B 1SXTA 1WTQA 1CI3M 1JOOA 1OXSC 5FO7B 2NB0A 1W2BA 1X56A 4P71A 1C7YA 4XDXA 4C3HH 4BY7H 1PFMA 2UUCL 2KUMA 2ZM6L 1VQBA 3T1YQ 4KD4A 4DR7Q 3DXJC 1N9WA 2F0LA 2KBNA 4MZ9A 5C4HA 3I4NG 5DEHA 1W6KA 3HOVB 1JE4A 1YJ9A 1TWGB 1E2VA 3KLSA 2JP1A 5BN4A 3GTGB 4R4TA 3L2PA 3CRLC 3W3AA 3QO2A 2B2TA 1SNPA 5BR8Q 2UXDQ 3D6CA 4HIOA 3FEWX 4Z9CB 5FO9B 1BXTA 3UE0A 1EIHA 1JWMD 4HIKA 4LFBL 1F2YA 4X65L 3HOZB 1I3QH 3K5LA 5JJLA 3OIQA 4G57A 3SDZA 2Z9HA 1KNEA 3K7UC 5CV5A 1CKNA 3AFPA 3TEHB 1HH2P 1R4PB 3NTIA 2B63B 3J7A5 1S5BD 2UUBQ 4OIKA 2QF7A 4POFA 3KJPA 1L0XB 1H9JA 3WOFA 1QNUA 1U4PA 3C2PA 4GKKQ 1XMOL 1E22A 1H9KA 1F9PA 3I4NH 1PH4A 4YWKA 2Y0SE 2IWHA 3N6RA 2F0FA 4K0KL 4M1UB 5EBDA 4CKBA 1EYGA 5KNCA 4LNQA 3IAYA 1OXTA 2UXCL 1FJGQ 1UUPA 3NWSA 1AN8A 3BVGA 3CKIB 1Z47A 3SHLA 3R3OA 4ME5A 3KDFB 1WTPA 4A93B 3E9IA 4A76A 3AYHB 1AE3A 2K5QA 1I6HH 2YU9B 5HURA 1LT4D 2Q8RE 2O5JC 3C1EA 4QUFA 3A5ZB 1CA6A 1CKOA 4DAMA 1O7ZA 1F2MA 3RNUA 4YHHL 1GUOA 1PTOB 3NTHA 4XQQA 1EQRA 1PHJA 5I6WA 3I4LA 3A5UA 1EEFD 5KYLA 5G3LD 2KCNA 4RWSC 5D65A 3D8GA 1AH9A 2C9OA 3QR8A 1ENCA 1YIJA 1NJIC 4NW2A 2F0KA 1SMXA 3OHXC 1BBXC 2IHEA 4WRDA 4BXXG 4PMWA 2WB1E 1HNZQ 3X3NA 4ZUJA 1Q82C 2N8NA 1VQ9A 4DR5L 1S40A 4LUZA 4DR6Q 1EZ6A 2DJGC 1SJED 3VYRA 1ONLA 2Q2UA 1TQOA 1GOZA 4EQPA 4LFCL 2ZJRA 1N34Q 4JI6Q 2D0OA 4HJ5A 1NE3A 2N55A 4JI5L 2BE5C 4KY6A 5A35A 2SNSA 3A8IE 2HQEA 3SK5A 5M5WB 1IYVA 1YZ6A 1TWAH 4B3MQ 1HNWQ 4X62L 2B2WC 2I46A 1X9NA 2K6AA 4PZ8A 1EU3A 5CR3A 3Q0AA 3H0GG 4BBSG 2NVTH 1EYAA 4NMZA 4DV3L 4LMQD 5GAHC 2HQLA 1Q1EA 4GLXA 1VQMA 3PQIA 3NBIA 4TVAB 3NXWA 4LJZC 4BXXH 3VYSA 2NBFA 2LY7A 3K0XA 3BDCA 1EOVA 3D31A 1RODA 1A3TA 3SEBA 1VMCA 4CGYB 1BOSA 4A3LG 2EVBA 3PUVA 3OIPA 3EIVA 2ZTCA 2MFIA 2OT2A 2F3WA 3S17H 1XNQQ 1R9TB 3VR6A 2UXBL 2NTSA 3LGJA 2RHQB 1PH3A 4BY1G 4KN4C 2F0UA 4CDFC 4N8X1 5EGTA 3E5SA 3I70A 3J81j 2L11A 2XRQD 2A69C 4P72A 3NHHA 4DFAA 5CV8A 1UNSA 2D2CC 4F87A 4BBSH 4B08A 4DV0Q 3H0GH 5FJ8G 1S5FD 4Y7NH 2F3IA 3D6WA 4JV5Q 4L5SA 4HIDA 2QA4A 5TSSA 3K59A 4F88A 3CCLA 1H9RA 4IQZA 1S5DD 4RHSA 4JPBW 4KLKA 3GTMB 3G7LA 2DY7A 2B8FA 4DN4M 5I6YA 1QILA 4DV1L 1GD7A 5CBAE 4K2KA 5HGQA 4LF4Q 1JCKB 2G9HD 4DK3C 3E0JA 5KEEA 4RMFA 1CZWA 3EFXD 5D14A 4A3LH 3T16A 2NVQB 1NSNS 1JJ2A 1PYWD 2Z1CA 1J5EL 2JA5B 1W3SA 1UEBA 1L1OA 3TSSA 4C2MH 4HIMA 3OTOQ 1W6JA 3KF8B 1LLRD 4NP5A 4BY1H 1SAPA 1B3QA 5CV7A 3DEPA 4JBJA 4TKOB 4DAVA 1WTXA 3KLRA 1CKMA 2QGQA 5A2QE 4JI0Q 1F77A 2D9UA 2IL8A 5FJ8H 3CCQA 1QVFA 3U4ZA 2F0NA 3C3LA 1MBYA 2RDHA 4OIJA 5DNFA 3LWUA 2R92G 1IKLA 1WD1A 1Q8KA 4G4KA 4A75A 1Y8PB 1ILPA 4JI4L 1PFSA 1BVSA 1D5MC 2R7DA 4A4IA 3NEMA 3GTOH 1JORA 4NXNQ 1TIID 2HCIA 2XVSA 1Y8NB 2F0HA 2A68C 1EY7A 3T1HL 4X3KA 3AB9A 3CC2A 2LKVA 2MGSA 4QIWE 3TS2A 3V2TA 3BU2A 5IE8A 1LT5D 3HKZB 1C48A 2KQ3A 3IL8A 1S3OA 3RD4A 5IT9E 2YTXA 2IX3A 1HR0W 4KV6A 2HDMA 2M9VA 1B2TA 3UI2A 4EX5A 5IGBA 4LUOA 1PH8A 4B3TL 4AYBG 4DK6C 5D3IB 4HJ8A 3M4OB 2NVYH 2VUMB 4WORA 1X32A 3CPFA 4XT1B 5FK9C 2QEXA 2R92H 2G5DA 3WWVA 4XQNA 3TN2A 4YY3Q 1K3BC 2I5MX 3ULPA 2NN6I 2ZXPA 3NELA 5KNDA 3J81c 4QJFA 5CYUA 1RD9D 1X6OA 3ND9A 1TWCB 2EZVA 2CHBD 2PYKA 4H7BA 1CSQA 3L7ZC 1V43A 2K5NA 4ILWA 4KD3A 2KCCA 3T53B 1Y14B 3EBEA 3PUYA 3BZDB 4DF7A 1A63A 3OPOA 1KTKA 1AEXA 5C4XB 5C4JB 3CCVA 2B2WA 3Q24A 4KKSA 4I7AA 1EY6A 1BNZA 2Z6KC 2CWAA 5C5LA 5JEAJ 4N9PA 2ZJPA 1GUNA 4JCVE 3DM3A 1JE5A 5JPMC 3HOXG 3GTQB 4C1NK 1MHWC 4BWGB 3H09A 4RAUC 1JB7A 3L0OA 4RKLA 2BA0A 5F2DA 5H1SE 1PRTF 4DR1Q 4LF5Q 1CSPA 1JICA 3GTPH 2JXMB 1SE4A 3TZUA 2K33A 1DJRD 1KABA 1Y1VG 3C1FA 3OWEB 2RA4A 3MXPA 2A74C 1TR5A 1SN8A 3HG9A 3KLWA 3J81L 4UHVA 4A3IG 2MJ8A 4ZAIA 4JI8Q 1CT1D 5BN5A 2RBMA 2I5HA 1UE1A 3S1QB 5FO8B 1M4VA 4B3RQ 5FLMG 2FHTA 3K6OA 2E2IH 3RZOH 3HOXH 3W1BA 2EY6A 4N9TA 4PQXA 3QB3A 2D0PA 4HTHA 1KRTA 1SR3A 1HNZL 2K4KA 1FGBD 2TMPA 4AQYQ 1XJVA 1RTNA 1T9HA 3J7AV 3K81C 1EIFA 3A54A 4OX9L 3HOZG 1I4RA 1Y1VH 4IN3A 4UP9A 1YNXA 5JAVA 4DR2L 4QL5A 1X3QA 3L3OC 4FXKC 1SJHD 1K28A 3G6JB 3FMCA 2EXZA 1SYEA 2BCOA 5KRUA 4KHPQ 4A3IH 1P8LA 2B63G 4F7XA 2BA1A 1J9OA 1SYBA 2PCFB 4DPGA 1LT6D 3WDNA 5HY6A 2F3VA 3IFTA 1HNWL 4B3ML 3FKIB 2A68D 4LF7Q 4B9XA 4IPGA 1UWVA 4JW0A 2JEBI 2HCCA 2L55A 1BQQT 3RR5A 5FLMH 5FLXL 2O5IC 1CHQD 2VL6A 3QWNA 1EOTA 2RSNA 4A3FB 2XIWA 4OL7A 2HIVA 1VQPA 2UU9Q 1IBLQ 1C4QA 4DK0A 1AE2A 5EPKA 5DM73 3R8BA 3KF6A 2IHFA 5J22A 4R8IA 2SDFA 2ASBA 4QF4A 3MA2B 4RG1A 3HOZH 1F2LA 5J39A 4A93G 4IPCA 1AW7A 3A0JA 4P74A 2UUAQ 3SK8A 3RLOA 4HMJA 3TREA 1IBMQ 1UE6A 2B63H 4LF6L 1XNRL 5JPNC 5EKIA 5IGGA 3OW7A 1JT8A 4KK7A 2E2HH 2E2JB 4R1JA 3PO3B 1QOHA 4I65A 4AYBE 1YNND 3M7GA 4JBKA 2K04A 3HOWG 3AQQA 4YCVA 4JYAL 1PLFA 4CKEA 3MFYA 2F0OA 1HR0Q 1B44D 4OO1G 1DOLA 4LAAA 4KKUA 3NSWA 1EY4A 3GV3A 3Q22A 1N36L 3VDYA 2LSSA 1VQDA 3S16B 3KDFA 2VQFQ 4IJHA 3CC7A 1TWHH 3CMAA 1LTGD 4A93H 2JA8B 4EQOA 4DV2L 4DV7L 2YU9H 2F0GA 3A55A 3D4DA 1OXUA 1STHA 2A5HA 4LFBQ 4FP5D 1CZGA 2R6GA 4DV4Q 1HNXL 1S72A 1PTOH 2E74C 2Z6KA 3J7YW 4MNOA 4JI0L 3RLNA 1SFOB 2YTYA 4KHVA 4R4CA 5EJWA 2PZTA 2B2VC 3ICEA 1Z9FA 5AJ3L 3HOWH 1X54A 3I4OA 1EQTA 4P2CB 1EEID 1VQJA 3I72A 3JAMc 4C3IG 3FPPA 1B9NA 4OO1H 2OTLA 5M5XH 3CPWA 1EIYB 2PZUA 1RJTA 2LMCB 4B3SQ 1B9MA 4CDEC 3TBIB 2RF4A 4FDBA 4ZK9B 3ONAB 4FO2A 1I4PA 3D4RA 4YIJA 1A8VA 4A3DG 3HZXA 4KKTA 3S2DB 1IBKL 2BDOA 2HIXA 2CCZA 3KK7A 1YJWA 5LMNW 3C46A 5DLQE 1I50B 1VF5C 3KLSX 1QCBD 5M3FB 3H3VI 1PTOF 1HHVA 5IWAQ 3I4MB 2K7VA 5ISRA 1XWEA 1YHBA 3SVMA 3K8AA 1V8QA 2PMZE 4ID6A 4QUCA 4C3IH 1HFNA 1QZGA 1KC8C 2KHIA 4NXML 3BVZA 3KF6B 2F4VQ 2EJGC 1O80A 1JQYD 4PMCA 4GN4B 4PMBA 5CV6A 4CJ0B 1E0BA 3PUWA 2I5LX 1BCPB 1Y1WB 3NP8A 4KI0A 3JAML 4A3DH 4K5XA 1NTGA 3KUPA 3Q8DA 1GO3E 4ZKCB 1PYBA 3T51B 1PFBA 1HA5A 2PQEA 2LXKA 2JA6B 1ASYA 1K73C 2EYPA 2WACA 1J6QA 2RDFA 4R9WA 3RZDB 4HJ9A 3ITPA 2QDBA 2NTTA 2SEBD 1KRSA 5C44G 1B7YB 4OGQC 4PV1C 4JI1L 4IUPA 4K8IA 1L2FA 2JA5G 1HQRD 1VQOA 1FVIA 2PNHA 1IXRA 1HRJA 1YHAA 2X69A 2R7ZB 2JYOA 4LF5L 1I4HA 3QOLA 2VZAA 1BO0A 2Z0SA 2Y0SB 5T1IA 2D5DA 4L6TB 3OMCA 3PCOB 4DU9A 5CMDA 3KOJA 3VR5A 4KHZA 5EPLA 1XMQL 3GDEA 4QY7A 3S1MB 4KMUC 4PZ7A 3EROA 1Q7YC 3QJYA 3M4PA 1KHIA 1E7ZA 5EQ0A 2WFWA 4JI2Q 3GP7A 3F2DA 3HOYB 3GTMH 3MWYW 2IT1A 1XPRA 2EOTA 4X6AH 4L5RC 1SNOA 5I9OA 3BS1A 3CF5A 2A8VA 4JI8L 2Q2IA 4YCUA 3SGIA 3M85A 4XT3B 5IIFA 4YCWA 5KGUA 1ZYRC 5C44H 4A3KB 4CDCC 5DAUA 3J80c 3K58A 2WAQG 2KEEA 1Y69U 4EQ5A 1RL2A 4GKJQ 2JA5H 4L8JA 4IUVA 4OHJA 3KF8A 4K8JA 1I94L 3CXCA 2N3SA 4ABNA 1I4XA 3I2ZA 4CJ1B 5FLXE 3HKZG 3CCRA 2A19A 4AQYL 3S14B 3TP5A 3P7JA 1E1TA 4DUYL 4JI7Q 4IPDA 2VNUD 3ERSX 1VQNA 2ICEC 4E6IA 1TS5A 1STEA 2X6GA 3DUZA 1IKMA 3GTKB 4BBRB 4PZ6A 1V1QA 2K1BA 4ZUIA 5LMUL 2VUMG 3A8JE 1HUMA 3K7AH 4MTKA 3I56A 1T5EA 2VQEQ 5AFWA 1NUCA 2RHSB 1Q1BA 1CHPD 1LABA 2B2YA 2SOBA 4I7ZC 1IHZA 1FGUA 4C3HB 1SROA 5IYCG 2B2VA 4BY7B 2F52A 2O4XA 4DV6Q 3M3YB 2F0WA 4LFAL 4RCOA 1WCMB 1N33Q 1F9RA 2LFNA 2WB1B 3MC0B 1PZKD 4DV5Q 4TQUS 4EQNA 3J80L 2JQOA 2UU9L 4FVMA 4J15A 1IBLL 2R61A 3O13A 1STNA 4DR4Q 3ZJYC 2A1AA 1GKHA 2F0QA 4HR7B 1KL9A 2AQ1B 4TRDA 3F1ZA 4LF9L 5K5PA 3PUXA 1HZAA 1TWFH 2KHJA 1HXYD 2UUAL 1VQCA 5G3LF 4NDXA 5E7NA 2VUMH 3DMUA 3M4OH 5IP7G 2KOLA 1I3QB 2XN9C 3KBXA 4ZCKA 1HQMC 4EGVA 3LNNA 4K14A 1E3PA 3CCEA 3H3VC 4C3JG 3ZYYX 3H6MA 2A6EC 2NZ1D 5IYCH 3KJOA 3FPUB 5LMNQ 2EE1A 2E5LQ 3ER0A 1ENFA 3HEJA 2EYHA 1MIUA 3HOUB 1EQQA 1OXXK 3GTJH 2NVXB 4FF3A 1HR0L 1LTSD 1VQHA 4R4IA 1K83B 3STBC 3SXHA 2GVAA 4L63B 3T56B 3L9AX 3S15H 4OWWB 1HA6A 1WFQA 1BKBA 4L5TA 2AQ2B 2VQFL 3S1NH 5IGFA 3K0YA 2WIIB 4K5WA 3F2UA 1EYCA 1SYDA 2AUJD 2JE6I 5GQOA 1NMGA 2HHHL 5IP7H 1TKWB 1X3PA 1RTOA 2CW0C 4HCEA 3MVVA 1FNVA 1I6HB 2ZTDA 1RDPD 2FMMA 3A74A 4HJ7A 3TS0A 1HCZA 4C3JH 3CCSA 1U4LA 4JBMA 2AHOB 4O2DA 1SYGA 3HGBA 1IL8A 2Z8LA 4S3SA 1LACA 4GN3B 4GOPC 1II3A 2L9HA 4LF8Q 5ELBA 5I2YA 1HJPA 4LUVA 3AFQA 2PNRC 2NZHA 4IFDG 1Q86C 1ML0D 1F9SA 1HTPA 1BUVT 1P16A 1ZYRD 3K80C 1HZ9A 5E4WC 4XXEA 1JOQA 1QG7A 3HS0C 4R4QA 1VQLA 3URYA 3R93A 5C3WA 4H44C 2XGTA 1QWYA 1WOCA 2V4DA 2JA7B 4CHTB 3K5NA 1VDZA 1HZBA 1MI2A 1LTTD 2RCFA 1EZ8A 5C0XG 1MSHA 2CVRA 2KENA 3MZ5A 4A3FG 3T1YL 4DR7L 2TSSA 5ELOA 4ULLA 3G48A 1WTRA 1GHKA 2WAQE 4A3BB 1TY0A 3PV0A 2PW7A 2RKSA 2VXWA 2K03A 3CW2C 2VB2X 1MD2D 5DM63 1BCPC 4X66Q 1U0LA 3J81i 2BDNA 1PDQA 4RGOS 1PV4A 2YTVA 3NQIA 5BR8L 4IFDH 2UXDL 2WKDA 1BR9A 2PZWA 3J7ZC 1KIXA 1EU4A 1D2BA 3NK9A 1PZID 3PO3G 2F0JA 1UE7A 3BZCA 2K5DA 2UUCQ 2R7FA 3PIP3 4XYOA 5J3BA 2ZM6Q 2H1EA 4K6DA 2ID0A 1EY0A 3K57A 4QIWB 2JSOA 3TP8A 2UUBL 5C0XH 4A3FH 2E76C 2XWBB 2NVTB 2KHSA 3AMUA 1WTHA 3V96A 4GKKL 4KJNA 5ELEA 3EJIA 3PGZA 2M2LA 1WVLA 3T4AC 3M4YA 3DEOA 2RQXA 1NR4A 3U9OA 2H4OA 1YNNC 1VQ8A 5COYA 3CMEA 3NUCA 3HRZC 1K3RA 3JC66 4UDUC 2B2UC 1Q8IA 1XXGA 1S5ED 1VMPA 4X65Q 5C6AA 1V1PB 1FJGL 1ET6A 2ZT9C 3D3RA 1FD7D 3UDGA 5K36G 3CP0A 3U50C 2A6ED 3M7NA 1G2SA 3PO3H 4FYDA 1SE8A 4X64Q 4IJLA 3I91A 2K5HA 2AWNA 4A3GG 3I8ZA 5ELNA 1XMOQ 4CBVA 1XYIA 4MIUA 4P73A 2J0TD 3STBD 2EPBA 4RHRA 2EDGA 4J8QA 4BBSB 2IJ0A 5C3EB 1EY5A 1OTCA 1VQGA 5LL6X 2XNAC 4K0KQ 5CBEE 2KVMA 2PW5A 3S16H 2F0TA 1RKNA 1TU2B 1KLGD 4A3EB 2CW0D 2CH4W 3ERQA 5NUCA 2QEJC 5GADC 1ASZA 1CQVA 3EN2A 5K36H 1QNKA 4MTNA 2DNCA 3PF5A 1PH7A 1PYSB 3VYTA 1K0RA 1EWIA 4DUZQ 1TVXA 4GN5A 3HOVG
chains in the Genus database with same CATH topology
1VQ6A 3ICEA 1Z9FA 1GVPA 5AJ3L 3HOWH 1X54A 3I4OA 4A3GH 1VQJA 3JAMc 3CCJA 4YWLA 1AH9A 4L5QA 1HNXQ 3S2HH 2OTLA 1YJNA 5M5XH 3CPWA 3PF4A 5IYDH 1X3GA 1EIYB 3G71A 1YIJA 4B3SQ 1NJIC 2D62A 1SRUA 2DGYA 2RF4A 4FDBA 1JJCB 4DR6L 1JJGA 2KCMA 1A8VA 1KAWA 3E0EA 3CD6A 1SMXA 4A3DG 3G6EA 1E24A 5AJ3Q 4GLAC 1HZCA 4GOPA 4HJAA 1IBKL 1N34L 5IWAL 2HIXA 1CUKA 2IHEA 4JI6L 2CCZA 4PMWA 4BXXG 3S2DH 2WB1E 1HNZQ 3RN2A 3RLNA 3HKZE 1Q82C 2N8NA 1YJWA 5LMNW 4DR5L 1VQ9A 1S40A 2ALYB 4LUZA 4DR6Q 2JA6G 5DLQE 4GKJQ 1NY4A 4BA2I 1D7QA 2Q2UA 5JEAG 2PQAB 4JBWA 3H3VI 1IBKQ 1G291 3FKIH 4LFCL 5IWAQ 2ZJRA 2PQAA 1N34Q 4JI6Q 2F4VL 3HOVH 1YHBA 2JJQA 1IYJB 3K8AA 2D0OA 4HJ5A 1NE3A 4JI5L 2PMZE 1PH5A 2XTIA 1TWGH 4DR5Q 4A3JG 2V1CC 4GNXC 4UP7A 1PA6A 3GTGH 4C3IH 2CKZB 1QZGA 2R93G 1KC8C 1YZ6A 2KHIA 1TWAH 4B3MQ 4NXML 1HNWQ 4XTCS 2K14A 4X62L 2OCEA 3KF6B 4IFDJ 4QGUA 2R7ZG 3NENA 4PZ8A 1X9NA 4BBSG 3NBHB 1FL0A 3H0GG 2F4VQ 4LFCQ 4GN4B 3PUWA 2I5LX 2NVTH 4KI0A 4DV3L 4A3DH 5GAHC 2L15A 4JI5Q 2Y0SG 2HQLA 1NTGA 1Q1EA 1X3FA 2H5XA 4GLXA 3PIPA 1VQMA 3Q8DA 1GO3E 1VQ4A 1XNQL 4TVAB 1PYBA 2JA8G 4BXXH 4JI3Q 2JEAI 4NXMQ 3K0XA 1EOVA 3D31A 4X62Q 2LXKA 1ASYA 1K73C 1J6QA 3CQZH 4OXPA 5C0XJ 3HOYG 2JA6H 1TXYA 3OYYA 4HJ9A 4NPSA 3OW2A 4DV3Q 4A3LG 5JJIA 3PUVA 3EIVA 2E2JH 2ZTCA 1KRSA 4PG3A 2MFIA 1B7YB 5C44G 4JI1L 3S17H 4DV0L 2KCTA 1XNQQ 1L2FA 2JA5G 2IX1A 1VQOA 4OONA 2UXBL 4JV5L 3LGJA 2OQKA 2RHQB 4BY1G 1FVIA 1PH6A 1PH3A 3CAMA 4A3CG 2PNHA 1KD1C 1IXRA 3UE1A 4A3JH 1I5FA 1YHAA 2EXDA 1KQSA 3J81j 1MJEA 2R93H 4IO9A 4JI2L 4P72A 2OQ0A 4GN5A 1NMFA 1VQ5A 2R7ZH 4JI1Q 3MXNB 4LF5L 4BBSH 3H3VH 4DV0Q 3H0GH 5FJ8G 4LF4L 2VZAA 2Z0SA 3M4QA 4Y7NH 1QVCA 1BBUA 2F3IA 3FP9A 3JAMi 1VQKA 3PCOB 4L5SA 4HIDA 4JV5Q 2QA4A 2UXBQ 3CCLA 3UDXA 3KOJA 2UXCQ 4KHZA 1XMQL 1VQAA 4BBRG 3GDEA 4QY7A 1YBYA 4KLKA 4PZ7A 4JOIC 1Q7YC 2JA8H 3OTOL 1KHIA 3M4PA 4GKJL 1E7ZA 1K9MC 2WFWA 4JI2Q 3FHWA 1BBWA 3F2DA 3GTMH 2IT1A 4DV1L 1XPRA 4X6AH 1GD7A 4L5RC 4LF4Q 5HGQA 3CF5A 2A8VA 4JI8L 2Q2IA 4DK3C 3HOYH 4YCUA 3SGIA 4A3MG 3GO5A 4RMFA 3M85A 1Q46A 1QUQB 4A3LH 1JJ2A 1OXVA 4YCWA 4WJ3M 5C44H 1J5EL 1L1OB 4JI7L 3J80c 3M9BA 1W3SA 2WAQG 5M3FG 1XMQQ 2GN5A 1UEBA 1L1OA 4C2MH 1RL2A 4LW1A 4EQ5A 4YHHQ 3HFZB 3OTOQ 4HIMA 3CCMA 1SFOH 3KF8B 2JA5H 3I4MG 2FXQA 1M1KC 4BY1H 4A3CH 2JA9A 4JBJA 4DV1Q 1I94L 1WCMG 5M3MG 4AH6A 1G6PA 1B8AA 2ZTEA 3CXCA 2N3SA 5FLXc 3I2ZA 4ALPA 1CKMA 1QVGA 5M5YH 3HKZG 2QGQA 3CCRA 2A19A 4AQYL 4JI0Q 1J5EQ 4DUYL 2VQEL 1E1TA 2LXJA 4P75A 4IPDA 4JI7Q 3ERSX 2VNUD 1VQNA 5FJ8H 3CCQA 4NXNL 4DR3L 1QVFA 3S14H 3U4ZA 4GOPB 4UY8C 1Y1WG 4PZ6A 1X3EA 2JK8A 1I94Q 1V1QA 1WJJA 2R92G 1Q81C 1Q8KA 4BBRH 5LMUL 4DV2Q 4DV6L 1MJCA 3MEFA 4A75A 2VUMG 3K7AH 4R4OA 4JI4L 4H02A 5GAEC 3I56A 1N33L 4DUYQ 1PFSA 2VQEQ 1BVSA 2BH2A 2R7DA 4A4IA 3NEMA 3GTOH 2RHSB 1Q1BA 2ES2A 4NXNQ 4DV5L 4POGA 1I50H 4A3MH 1FGUA 3F2CA 1SROA 4IPHA 5IYCG 1IL2A 1L0WA 3BZKA 3RLFA 4DR4L 2F52A 3T1HL 3B6YA 3U4VA 5M3FH 1A62A 1O7IA 5LMUQ 4OWXB 4DV6Q 2VY3A 3CC2A 4LFAL 3I4MH 1M90C 4JI4Q 4QIWE 1A0IA 1N33Q 3TS2A 3M3YH 3HOUG 3BU2A 5IE8A 1WI5A 1N32L 1WCMH 5M3MH 5IT9c 4DV5Q 4O0AA 4TQUS 4YY3L 2OWOA 2JQOA 1DGSA 5M5WH 2UU9L 1HR0W 1S3OA 3CC4A 4J15A 2YTXA 1IBLL 4UP8A 4DR4Q 3T1HQ 2AWOA 3ZJYC 2A1AA 1LM0A 1JMCA 1GKHA 4LFAQ 1LUZA 4EX5A 1PH8A 4LUOA 1KL9A 2YV5A 4B3TL 4AYBG 3F1ZA 4DK6C 4HJ8A 1Y1WH 4LF9L 3PUXA 1HZAA 1TWFH 2MQHA 2NVYH 4DAYB 2QEXA 3CPFA 3F8TA 2KHJA 5LMNL 2E5LL 2R92H 4ME3A 3G4SA 3WWVA 1VQCA 2UUAL 5E7NA 3AEVA 2VUMH 4YY3Q 3GTLH 3KFUA 3M4OH 5IP7G 2I5MX 3ULPA 2Q2HA 2NN6I 3NELA 3J81c 4QJFA 1VQIA 1X6OA 3S24A 3RZDH 1E3PA 3CCEA 4B3TQ 1CSQA 3L7ZC 1V43A 4NB3A 4UPAA 2K5NA 5IYCH 4LF9Q 4GNXB 3TQYA 3KJOA 4Y52H 5LMNQ 4A3KG 1Y14B 3ER0A 3EBEA 2E5LQ 1KXLA 4GNXA 3PUYA 4X64L 3PIOA 1MIUA 1PH9A 1R9TH 1OXXK 3F2BA 1XPOA 1EQQA 1E1OA 1A63A 2PI2E 1IZ6A 1B70B 3HOUH 2NN6G 3GTJH 3ULJA 3CCVA 1HR0L 3D0FA 1YHQA 1K8GA 4BA1I 1UE5A 1VQHA 3J80i 5GAGC 1VQ7A 2NVXH 4R4IA 4DR1L 1VCIA 3STBC 1V9PA 2GVAA 2Z6KC 2CWAA 3S15H 2MNAA 4OWWB 2AMCB 1K83H 5JEAJ 2ZJPA 1WFQA 1BKBA 4L5TA 3S1RH 2EQSA 4JCVE 3PO2G 3DM3A 2VQFL 3S1NH 1JE5A 4LWCA 3HOXG 1YI2A 2HT1A 1L1OC 2CWPA 2JA7G 1LTLA 5IYBG 2VW9A 4APVA 2JE6I 5GQOA 1JB7A 1NMGA 2AKWB 3L0OA 2BA0A 3S1MH 2DUDA 5H1SE 4GLVB 3CCUA 2GVBA 2PI2A 4OWTB 5IP7H 1CSPA 4DR1Q 2HHHL 4LF5Q 4LF8L 3GTPH 4IFDI 1EUJA 1PH1A 1Y1VG 3W5OA 2ZTDA 3IRBA 4AIMA 3A74A 4HJ7A 3RN5A 3TS0A 4C3JH 3CCSA 4JBMA 4A3BG 2IX0A 2AHOB 2NVQH 4O2DA 4DUZL 4BY7G 4A3KH 2N78A 2K75A 4GN3B 4B3RL 4GOPC 1SN8A 3KLWA 1PH2A 2ZJQA 2OTJA 5IP9G 4A3IG 1QZHA 2HHHQ 4LF8Q 1XPUA 1G51A 1HJPA 4LUVA 1EFWA 4JI8Q 2WB1G 3AFQA 4IFDG 2NZHA 1GM5A 2B29A 2K50A 4DKAC 3H15A 3I55A 5C0XI 1YITA 2NZOA 1Q86C 1P16A 3K80C 1HZ9A 2I5HA 1UE1A 1X65A 2ATWA 1C0AA 3PUZA 4R4QA 1VQLA 1X55A 2CFMA 3BJUA 3GD7A 1XTDA 3HKSA 2XGTA 2MO0A 5JJKA 4B3RQ 5FLMG 1WOCA 3PO2H 1LYLA 3ULLA 2E2IH 4JOIA 3RZOH 1WYDA 2VS1A 3UDFA 3HOXH 2K52A 1C9OA 3W1BA 3GTKH 1PVOA 1H95A 2JA7H 3DLLA 1HZBA 2D0PA 5IYBH 1KRTA 1SR3A 2CQOA 1VQEA 4X66L 1K8AC 3PSIA 4KHPL 1YEZA 5C0XG 1HNZL 2K4KA 2KENA 4AQYQ 3T1YL 4A3FG 1SLJA 4DR7L 1U5KA 1XJVA 1D8LA 1T9HA 5ELOA 3K81C 4DR3Q 1NBWA 1EIFA 3G48A 4OX9L 2WAQE 3HOZG 1Y1VH 4UP9A 1OXSC 1YNXA 3PV0A 2E8GA 4DR2L 4QL5A 4LF7L 1W2BA 1X56A 4P71A 1C7YA 4A3BH 4C3HH 3CW2C 4YWMA 4BY7H 4JG2A 4X66Q 2UUCL 1U0LA 3J81i 2YYZA 4KHPQ 2ZM6L 1VQBA 3T1YQ 5IP9H 1P8LA 4A3IH 2B63G 4DR7Q 2BA1A 1N9WA 1PV4A 1VS0A 2YTVA 4DPGA 5BR8L 4OX9Q 4QQBX 2UXDL 5C4XG 3KYHC 3J7ZC 2KBNA 4MZ9A 1KIXA 3I4NG 5HY6A 1HNWL 4B3ML 2EIFA 4DR2Q 4LF7Q 3PO3G 1YJ9A 2MO1A 4IPGA 1UWVA 2JEBI 3TRZA 1UE7A 3BZCA 1N8RC 2UUCQ 3RR5A 2R7FA 5FLMH 2ZM6Q 5J3BA 4R4TA 3L2PA 2VL6A 1N32Q 2ID0A 1VQFA 5BR8Q 2UXDQ 2HIVA 1VQPA 4HIOA 2UU9Q 4JI3L 2UUBL 3UDIA 3U58A 1IBLQ 4A3FH 1IBML 1AE2A 3UE0A 4HIKA 4LFBL 4X65L 4GKKL 1I3QH 2B3GA 3KF6A 5C3EG 2IHFA 5JJLA 3PGZA 2ASBA 4RG1A 1CKNB 3HOZH 4A93G 1TWCH 3K7UC 4IPCA 2K5VA 1CKNA 3A0JA 3AFPA 3TEHB 1VQ8A 2I0QA 4P74A 1HH2P 3CMEA 2UUAQ 2WP8J 3RLOA 4WJ4A 3J7A5 1K3RA 4DUZQ 3JC66 2C35B 3TREA 1RIPA 2UUBQ 1IBMQ 4POFA 3KJPA 1UE6A 2B63H 4OO1I 4LF6L 1XNRL 4LFBQ 4A3EG 4X65Q 4GKKQ 1XMOL 1FJGL 3UDGA 3HOVG 2E2HH 5K36G 2RCNA 1JT8A 4R1JA 3CP0A 5C4XH 1E22A 5C4JH 3U50C 3I4NH 1PH4A 4YWKA 2Y0SE 3M7NA 4AYBE 3PO3H 1YVCA 1SE8A 4GS3A 4X64Q 4K0KL 4JBKA 4IJLA 2N49A 1EYGA 2K5HA 2Q2TA 3AQQA 4YCVA 2AWNA 3HOWG 2IY5B 4A3GG 4JYAL 4LNQA 1OXTA 4LF6Q 1HR0Q 2BH8A 1XNRQ 5ELNA 4OO1G 2UXCL 1XMOQ 1FJGQ 3GTQH 5IYDG 4P73A 1Z47A 5EAYA 3STBD 1N36L 3VDYA 4DV4L 3KDFB 1VQGA 1OTCA 2LSSA 1VQDA 4XIGS 1Q12A 4K0KQ 5C3EH 3E9IA 1MKHA 5IY0A 3KDFA 2VQFQ 4IJHA 3AYHB 4A76A 1AE3A 1TWHH 4JC0A 3CMAA 3CC7A 1I6HH 4JYAQ 4A93H 3S16H 4IOAA 3A5ZB 4DV2L 4DV7L 1CKOA 3W1GA 2YU9H 4DAMA 1OXUA 3RNUA 4YHHL 5GROA 1N36Q 2R6GA 5GADC 1ASZA 4DV4Q 3EN2A 4A3EH 1HNXL 1S72A 4MTNA 1EQRA 1PHJA 3I7FA 2Z6KA 3E9HA 4IOCA 4B3SL 3PF5A 1PH7A 4DNIA 3A5UA 1PYSB 4MNOA 1K0RA 4JI0L 3FKIG 1EWIA 4DV7Q 1QUQA 3S1QH 2YTYA 4R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 A;  3ICE A;  1Z9F A;  1GVP A;  5AJ3 L;  3HOW H;  1X54 A;  3I4O A;  4A3G H;  1VQJ A;  3JAM c;  3CCJ A;  4YWL A;  1AH9 A;  4L5Q A;  1HNX Q;  3S2H H;  2OTL A;  1YJN A;  5M5X H;  3CPW A;  3PF4 A;  5IYD H;  1X3G A;  1EIY B;  3G71 A;  1YIJ A;  4B3S Q;  1NJI C;  2D62 A;  1SRU A;  2DGY A;  2RF4 A;  4FDB A;  1JJC B;  4DR6 L;  1JJG A;  2KCM A;  1A8V A;  1KAW A;  3E0E A;  3CD6 A;  1SMX A;  4A3D G;  3G6E A;  1E24 A;  5AJ3 Q;  4GLA C;  1HZC A;  4GOP A;  4HJA A;  1IBK L;  1N34 L;  5IWA L;  2HIX A;  1CUK A;  2IHE A;  4JI6 L;  2CCZ A;  4PMW A;  4BXX G;  3S2D H;  2WB1 E;  1HNZ Q;  3RN2 A;  3RLN A;  3HKZ E;  1Q82 C;  2N8N A;  1YJW A;  5LMN W;  4DR5 L;  1VQ9 A;  1S40 A;  2ALY B;  4LUZ A;  4DR6 Q;  2JA6 G;  5DLQ E;  4GKJ Q;  1NY4 A;  4BA2 I;  1D7Q A;  2Q2U A;  5JEA G;  2PQA B;  4JBW A;  3H3V I;  1IBK Q;  1G29 1;  3FKI H;  4LFC L;  5IWA Q;  2ZJR A;  2PQA A;  1N34 Q;  4JI6 Q;  2F4V L;  3HOV H;  1YHB A;  2JJQ A;  1IYJ B;  3K8A A;  2D0O A;  4HJ5 A;  1NE3 A;  4JI5 L;  2PMZ E;  1PH5 A;  2XTI A;  1TWG H;  4DR5 Q;  4A3J G;  2V1C C;  4GNX C;  4UP7 A;  1PA6 A;  3GTG H;  4C3I H;  2CKZ B;  1QZG A;  2R93 G;  1KC8 C;  1YZ6 A;  2KHI A;  1TWA H;  4B3M Q;  4NXM L;  1HNW Q;  4XTC S;  2K14 A;  4X62 L;  2OCE A;  3KF6 B;  4IFD J;  4QGU A;  2R7Z G;  3NEN A;  4PZ8 A;  1X9N A;  4BBS G;  3NBH B;  1FL0 A;  3H0G G;  2F4V Q;  4LFC Q;  4GN4 B;  3PUW A;  2I5L X;  2NVT H;  4KI0 A;  4DV3 L;  4A3D H;  5GAH C;  2L15 A;  4JI5 Q;  2Y0S G;  2HQL A;  1NTG A;  1Q1E A;  1X3F A;  2H5X A;  4GLX A;  3PIP A;  1VQM A;  3Q8D A;  1GO3 E;  1VQ4 A;  1XNQ L;  4TVA B;  1PYB A;  2JA8 G;  4BXX H;  4JI3 Q;  2JEA I;  4NXM Q;  3K0X A;  1EOV A;  3D31 A;  4X62 Q;  2LXK A;  1ASY A;  1K73 C;  1J6Q A;  3CQZ H;  4OXP A;  5C0X J;  3HOY G;  2JA6 H;  1TXY A;  3OYY A;  4HJ9 A;  4NPS A;  3OW2 A;  4DV3 Q;  4A3L G;  5JJI A;  3PUV A;  3EIV A;  2E2J H;  2ZTC A;  1KRS A;  4PG3 A;  2MFI A;  1B7Y B;  5C44 G;  4JI1 L;  3S17 H;  4DV0 L;  2KCT A;  1XNQ Q;  1L2F A;  2JA5 G;  2IX1 A;  1VQO A;  4OON A;  2UXB L;  4JV5 L;  3LGJ A;  2OQK A;  2RHQ B;  4BY1 G;  1FVI A;  1PH6 A;  1PH3 A;  3CAM A;  4A3C G;  2PNH A;  1KD1 C;  1IXR A;  3UE1 A;  4A3J H;  1I5F A;  1YHA A;  2EXD A;  1KQS A;  3J81 j;  1MJE A;  2R93 H;  4IO9 A;  4JI2 L;  4P72 A;  2OQ0 A;  4GN5 A;  1NMF A;  1VQ5 A;  2R7Z H;  4JI1 Q;  3MXN B;  4LF5 L;  4BBS H;  3H3V H;  4DV0 Q;  3H0G H;  5FJ8 G;  4LF4 L;  2VZA A;  2Z0S A;  3M4Q A;  4Y7N H;  1QVC A;  1BBU A;  2F3I A;  3FP9 A;  3JAM i;  1VQK A;  3PCO B;  4L5S A;  4HID A;  4JV5 Q;  2QA4 A;  2UXB Q;  3CCL A;  3UDX A;  3KOJ A;  2UXC Q;  4KHZ A;  1XMQ L;  1VQA A;  4BBR G;  3GDE A;  4QY7 A;  1YBY A;  4KLK A;  4PZ7 A;  4JOI C;  1Q7Y C;  2JA8 H;  3OTO L;  1KHI A;  3M4P A;  4GKJ L;  1E7Z A;  1K9M C;  2WFW A;  4JI2 Q;  3FHW A;  1BBW A;  3F2D A;  3GTM H;  2IT1 A;  4DV1 L;  1XPR A;  4X6A H;  1GD7 A;  4L5R C;  4LF4 Q;  5HGQ A;  3CF5 A;  2A8V A;  4JI8 L;  2Q2I A;  4DK3 C;  3HOY H;  4YCU A;  3SGI A;  4A3M G;  3GO5 A;  4RMF A;  3M85 A;  1Q46 A;  1QUQ B;  4A3L H;  1JJ2 A;  1OXV A;  4YCW A;  4WJ3 M;  5C44 H;  1J5E L;  1L1O B;  4JI7 L;  3J80 c;  3M9B A;  1W3S A;  2WAQ G;  5M3F G;  1XMQ Q;  2GN5 A;  1UEB A;  1L1O A;  4C2M H;  1RL2 A;  4LW1 A;  4EQ5 A;  4YHH Q;  3HFZ B;  3OTO Q;  4HIM A;  3CCM A;  1SFO H;  3KF8 B;  2JA5 H;  3I4M G;  2FXQ A;  1M1K C;  4BY1 H;  4A3C H;  2JA9 A;  4JBJ A;  4DV1 Q;  1I94 L;  1WCM G;  5M3M G;  4AH6 A;  1G6P A;  1B8A A;  2ZTE A;  3CXC A;  2N3S A;  5FLX c;  3I2Z A;  4ALP A;  1CKM A;  1QVG A;  5M5Y H;  3HKZ G;  2QGQ A;  3CCR A;  2A19 A;  4AQY L;  4JI0 Q;  1J5E Q;  4DUY L;  2VQE L;  1E1T A;  2LXJ A;  4P75 A;  4IPD A;  4JI7 Q;  3ERS X;  2VNU D;  1VQN A;  5FJ8 H;  3CCQ A;  4NXN L;  4DR3 L;  1QVF A;  3S14 H;  3U4Z A;  4GOP B;  4UY8 C;  1Y1W G;  4PZ6 A;  1X3E A;  2JK8 A;  1I94 Q;  1V1Q A;  1WJJ A;  2R92 G;  1Q81 C;  1Q8K A;  4BBR H;  5LMU L;  4DV2 Q;  4DV6 L;  1MJC A;  3MEF A;  4A75 A;  2VUM G;  3K7A H;  4R4O A;  4JI4 L;  4H02 A;  5GAE C;  3I56 A;  1N33 L;  4DUY Q;  1PFS A;  2VQE Q;  1BVS A;  2BH2 A;  2R7D A;  4A4I A;  3NEM A;  3GTO H;  2RHS B;  1Q1B A;  2ES2 A;  4NXN Q;  4DV5 L;  4POG A;  1I50 H;  4A3M H;  1FGU A;  3F2C A;  1SRO A;  4IPH A;  5IYC G;  1IL2 A;  1L0W A;  3BZK A;  3RLF A;  4DR4 L;  2F52 A;  3T1H L;  3B6Y A;  3U4V A;  5M3F H;  1A62 A;  1O7I A;  5LMU Q;  4OWX B;  4DV6 Q;  2VY3 A;  3CC2 A;  4LFA L;  3I4M H;  1M90 C;  4JI4 Q;  4QIW E;  1A0I A;  1N33 Q;  3TS2 A;  3M3Y H;  3HOU G;  3BU2 A;  5IE8 A;  1WI5 A;  1N32 L;  1WCM H;  5M3M H;  5IT9 c;  4DV5 Q;  4O0A A;  4TQU S;  4YY3 L;  2OWO A;  2JQO A;  1DGS A;  5M5W H;  2UU9 L;  1HR0 W;  1S3O A;  3CC4 A;  4J15 A;  2YTX A;  1IBL L;  4UP8 A;  4DR4 Q;  3T1H Q;  2AWO A;  3ZJY C;  2A1A A;  1LM0 A;  1JMC A;  1GKH A;  4LFA Q;  1LUZ A;  4EX5 A;  1PH8 A;  4LUO A;  1KL9 A;  2YV5 A;  4B3T L;  4AYB G;  3F1Z A;  4DK6 C;  4HJ8 A;  1Y1W H;  4LF9 L;  3PUX A;  1HZA A;  1TWF H;  2MQH A;  2NVY H;  4DAY B;  2QEX A;  3CPF A;  3F8T A;  2KHJ A;  5LMN L;  2E5L L;  2R92 H;  4ME3 A;  3G4S A;  3WWV A;  1VQC A;  2UUA L;  5E7N A;  3AEV A;  2VUM H;  4YY3 Q;  3GTL H;  3KFU A;  3M4O H;  5IP7 G;  2I5M X;  3ULP A;  2Q2H A;  2NN6 I;  3NEL A;  3J81 c;  4QJF A;  1VQI A;  1X6O A;  3S24 A;  3RZD H;  1E3P A;  3CCE A;  4B3T Q;  1CSQ A;  3L7Z C;  1V43 A;  4NB3 A;  4UPA A;  2K5N A;  5IYC H;  4LF9 Q;  4GNX B;  3TQY A;  3KJO A;  4Y52 H;  5LMN Q;  4A3K G;  1Y14 B;  3ER0 A;  3EBE A;  2E5L Q;  1KXL A;  4GNX A;  3PUY A;  4X64 L;  3PIO A;  1MIU A;  1PH9 A;  1R9T H;  1OXX K;  3F2B A;  1XPO A;  1EQQ A;  1E1O A;  1A63 A;  2PI2 E;  1IZ6 A;  1B70 B;  3HOU H;  2NN6 G;  3GTJ H;  3ULJ A;  3CCV A;  1HR0 L;  3D0F A;  1YHQ A;  1K8G A;  4BA1 I;  1UE5 A;  1VQH A;  3J80 i;  5GAG C;  1VQ7 A;  2NVX H;  4R4I A;  4DR1 L;  1VCI A;  3STB C;  1V9P A;  2GVA A;  2Z6K C;  2CWA A;  3S15 H;  2MNA A;  4OWW B;  2AMC B;  1K83 H;  5JEA J;  2ZJP A;  1WFQ A;  1BKB A;  4L5T A;  3S1R H;  2EQS A;  4JCV E;  3PO2 G;  3DM3 A;  2VQF L;  3S1N H;  1JE5 A;  4LWC A;  3HOX G;  1YI2 A;  2HT1 A;  1L1O C;  2CWP A;  2JA7 G;  1LTL A;  5IYB G;  2VW9 A;  4APV A;  2JE6 I;  5GQO A;  1JB7 A;  1NMG A;  2AKW B;  3L0O A;  2BA0 A;  3S1M H;  2DUD A;  5H1S E;  4GLV B;  3CCU A;  2GVB A;  2PI2 A;  4OWT B;  5IP7 H;  1CSP A;  4DR1 Q;  2HHH L;  4LF5 Q;  4LF8 L;  3GTP H;  4IFD I;  1EUJ A;  1PH1 A;  1Y1V G;  3W5O A;  2ZTD A;  3IRB A;  4AIM A;  3A74 A;  4HJ7 A;  3RN5 A;  3TS0 A;  4C3J H;  3CCS A;  4JBM A;  4A3B G;  2IX0 A;  2AHO B;  2NVQ H;  4O2D A;  4DUZ L;  4BY7 G;  4A3K H;  2N78 A;  2K75 A;  4GN3 B;  4B3R L;  4GOP C;  1SN8 A;  3KLW A;  1PH2 A;  2ZJQ A;  2OTJ A;  5IP9 G;  4A3I G;  1QZH A;  2HHH Q;  4LF8 Q;  1XPU A;  1G51 A;  1HJP A;  4LUV A;  1EFW A;  4JI8 Q;  2WB1 G;  3AFQ A;  4IFD G;  2NZH A;  1GM5 A;  2B29 A;  2K50 A;  4DKA C;  3H15 A;  3I55 A;  5C0X I;  1YIT A;  2NZO A;  1Q86 C;  1P16 A;  3K80 C;  1HZ9 A;  2I5H A;  1UE1 A;  1X65 A;  2ATW A;  1C0A A;  3PUZ A;  4R4Q A;  1VQL A;  1X55 A;  2CFM A;  3BJU A;  3GD7 A;  1XTD A;  3HKS A;  2XGT A;  2MO0 A;  5JJK A;  4B3R Q;  5FLM G;  1WOC A;  3PO2 H;  1LYL A;  3ULL A;  2E2I H;  4JOI A;  3RZO H;  1WYD A;  2VS1 A;  3UDF A;  3HOX H;  2K52 A;  1C9O A;  3W1B A;  3GTK H;  1PVO A;  1H95 A;  2JA7 H;  3DLL A;  1HZB A;  2D0P A;  5IYB H;  1KRT A;  1SR3 A;  2CQO A;  1VQE A;  4X66 L;  1K8A C;  3PSI A;  4KHP L;  1YEZ A;  5C0X G;  1HNZ L;  2K4K A;  2KEN A;  4AQY Q;  3T1Y L;  4A3F G;  1SLJ A;  4DR7 L;  1U5K A;  1XJV A;  1D8L A;  1T9H A;  5ELO A;  3K81 C;  4DR3 Q;  1NBW A;  1EIF A;  3G48 A;  4OX9 L;  2WAQ E;  3HOZ G;  1Y1V H;  4UP9 A;  1OXS C;  1YNX A;  3PV0 A;  2E8G A;  4DR2 L;  4QL5 A;  4LF7 L;  1W2B A;  1X56 A;  4P71 A;  1C7Y A;  4A3B H;  4C3H H;  3CW2 C;  4YWM A;  4BY7 H;  4JG2 A;  4X66 Q;  2UUC L;  1U0L A;  3J81 i;  2YYZ A;  4KHP Q;  2ZM6 L;  1VQB A;  3T1Y Q;  5IP9 H;  1P8L A;  4A3I H;  2B63 G;  4DR7 Q;  2BA1 A;  1N9W A;  1PV4 A;  1VS0 A;  2YTV A;  4DPG A;  5BR8 L;  4OX9 Q;  4QQB X;  2UXD L;  5C4X G;  3KYH C;  3J7Z C;  2KBN A;  4MZ9 A;  1KIX A;  3I4N G;  5HY6 A;  1HNW L;  4B3M L;  2EIF A;  4DR2 Q;  4LF7 Q;  3PO3 G;  1YJ9 A;  2MO1 A;  4IPG A;  1UWV A;  2JEB I;  3TRZ A;  1UE7 A;  3BZC A;  1N8R C;  2UUC Q;  3RR5 A;  2R7F A;  5FLM H;  2ZM6 Q;  5J3B A;  4R4T A;  3L2P A;  2VL6 A;  1N32 Q;  2ID0 A;  1VQF A;  5BR8 Q;  2UXD Q;  2HIV A;  1VQP A;  4HIO A;  2UU9 Q;  4JI3 L;  2UUB L;  3UDI A;  3U58 A;  1IBL Q;  4A3F H;  1IBM L;  1AE2 A;  3UE0 A;  4HIK A;  4LFB L;  4X65 L;  4GKK L;  1I3Q H;  2B3G A;  3KF6 A;  5C3E G;  2IHF A;  5JJL A;  3PGZ A;  2ASB A;  4RG1 A;  1CKN B;  3HOZ H;  4A93 G;  1TWC H;  3K7U C;  4IPC A;  2K5V A;  1CKN A;  3A0J A;  3AFP A;  3TEH B;  1VQ8 A;  2I0Q A;  4P74 A;  1HH2 P;  3CME A;  2UUA Q;  2WP8 J;  3RLO A;  4WJ4 A;  3J7A 5;  1K3R A;  4DUZ Q;  3JC6 6;  2C35 B;  3TRE A;  1RIP A;  2UUB Q;  1IBM Q;  4POF A;  3KJP A;  1UE6 A;  2B63 H;  4OO1 I;  4LF6 L;  1XNR L;  4LFB Q;  4A3E G;  4X65 Q;  4GKK Q;  1XMO L;  1FJG L;  3UDG A;  3HOV G;  2E2H H;  5K36 G;  2RCN A;  1JT8 A;  4R1J A;  3CP0 A;  5C4X H;  1E22 A;  5C4J H;  3U50 C;  3I4N H;  1PH4 A;  4YWK A;  2Y0S E;  3M7N A;  4AYB E;  3PO3 H;  1YVC A;  1SE8 A;  4GS3 A;  4X64 Q;  4K0K L;  4JBK A;  4IJL A;  2N49 A;  1EYG A;  2K5H A;  2Q2T A;  3AQQ A;  4YCV A;  2AWN A;  3HOW G;  2IY5 B;  4A3G G;  4JYA L;  4LNQ A;  1OXT A;  4LF6 Q;  1HR0 Q;  2BH8 A;  1XNR Q;  5ELN A;  4OO1 G;  2UXC L;  1XMO Q;  1FJG Q;  3GTQ H;  5IYD G;  4P73 A;  1Z47 A;  5EAY A;  3STB D;  1N36 L;  3VDY A;  4DV4 L;  3KDF B;  1VQG A;  1OTC A;  2LSS A;  1VQD A;  4XIG S;  1Q12 A;  4K0K Q;  5C3E H;  3E9I A;  1MKH A;  5IY0 A;  3KDF A;  2VQF Q;  4IJH A;  3AYH B;  4A76 A;  1AE3 A;  1TWH H;  4JC0 A;  3CMA A;  3CC7 A;  1I6H H;  4JYA Q;  4A93 H;  3S16 H;  4IOA A;  3A5Z B;  4DV2 L;  4DV7 L;  1CKO A;  3W1G A;  2YU9 H;  4DAM A;  1OXU A;  3RNU A;  4YHH L;  5GRO A;  1N36 Q;  2R6G A;  5GAD C;  1ASZ A;  4DV4 Q;  3EN2 A;  4A3E H;  1HNX L;  1S72 A;  4MTN A;  1EQR A;  1PHJ A;  3I7F A;  2Z6K A;  3E9H A;  4IOC A;  4B3S L;  3PF5 A;  1PH7 A;  4DNI A;  3A5U A;  1PYS B;  4MNO A;  1K0R A;  4JI0 L;  3FKI G;  1EWI A;  4DV7 Q;  1QUQ A;  3S1Q H;  2YTY A;  4R4C A; 
#chains in the Genus database with same CATH topology
 4BY1 B;  1GVP A;  2AQ3 B;  2HUG A;  4DAP A;  4XYQ A;  4A3G H;  3CRK C;  3CCJ A;  4L5Q A;  3S2H H;  3MXU A;  3VA7 A;  3Q23 A;  1YJN A;  3PF4 A;  4RCN A;  1LT3 D;  1G6Z A;  2WV6 D;  2FIN B;  4DR6 L;  4HN7 A;  1DXM A;  3CD6 A;  3LX0 A;  1ESR A;  3FVQ A;  3H91 A;  1E24 A;  4IUN A;  1A3V A;  4GLA C;  1HZC A;  4GOP A;  4HJA A;  3OWF A;  1U4M A;  1N34 L;  4JI6 L;  3S2D H;  5CV4 A;  5ELD A;  3RN2 A;  5ELF A;  1ET9 A;  3OSO A;  2JA6 G;  4RGM A;  4KTA A;  2PQA B;  4JBW A;  1Z7T A;  1UEA B;  1BCP D;  2KJX A;  1FR3 A;  3HOV H;  2JJQ A;  1IYJ B;  3P20 A;  3FRP B;  1PH5 A;  2XTI A;  1TWG H;  4DR5 Q;  2V1C C;  2EY1 A;  3GTG H;  3TDQ A;  2CKZ B;  2F0E A;  1F2Z A;  4XTC S;  2K14 A;  5E1F A;  2OCE A;  1AP0 A;  4QGU A;  2EYL A;  2R7Z G;  3NEN A;  3NBH B;  4RGT A;  3S9W A;  1T5X D;  4LFC Q;  3TZD A;  3A7A B;  4HCS A;  1QJO A;  1TS4 A;  4JI5 Q;  2IPK D;  2Y0S G;  1Z6H A;  1PRT B;  2R92 B;  3PIP A;  4KJO A;  1XNQ L;  3PIO 3;  4JI3 Q;  2JEA I;  3CQZ B;  4RFB A;  3RUZ A;  4X62 Q;  2F03 A;  5EBC A;  4QCL A;  3HOY G;  2JA6 H;  1TXY A;  1O7Y A;  3OYY A;  5IGC A;  4NPS A;  2XSC A;  4DV3 Q;  3OW2 A;  5JJI A;  4Q0F A;  1KNA A;  1SYC A;  3E6Z X;  4DV0 L;  2KCT A;  4DA2 A;  2K5W A;  2IX1 A;  4JV5 L;  4A3J B;  1PH6 A;  4A3C G;  1KD1 C;  3UE1 A;  3VYU A;  3P1H A;  2R93 B;  1I5F A;  3NQT A;  2F0D A;  2MP1 A;  1A3U A;  1O78 A;  2L4N A;  2OQ0 A;  1J8I A;  1VQ5 A;  2R7Z H;  3MXN B;  3GV6 A;  4NKL A;  4LF4 L;  1QE6 A;  1E2W A;  3T13 A;  3DWQ A;  3JAM i;  4AYB B;  2UXB Q;  4WFN 3;  3FDT A;  2DNE A;  3UDX A;  2L1B A;  4BBR G;  1YBY A;  2B2U A;  3OTO L;  1SEB D;  1K9M C;  2EJM A;  3FHW A;  4FF1 A;  4U68 A;  1EQV A;  3HOY H;  2DJF C;  2F0M A;  1CK1 A;  1STB A;  2F0V A;  1Q46 A;  1ILQ A;  1IW7 C;  1OXV A;  4H0L C;  1G91 A;  3M9B A;  2FJ2 A;  3PMF A;  4K5V A;  2GN5 A;  3NTK A;  1SNC A;  1H9S B;  1M1K C;  4RKB A;  4A3C H;  2JA9 A;  2K05 A;  4DV1 Q;  1WCM G;  3BDL A;  5M5Y B;  1DOM A;  1B8A A;  4ALP A;  3DWA A;  1ICF B;  5KIX A;  1J5E Q;  2LXJ A;  4HSP A;  4C1N I;  4X3T A;  4NXN L;  3S14 H;  4GOP B;  3RZO B;  2RDG A;  1X3E A;  1S4Z A;  1Y8O B;  2JK8 A;  5CC4 A;  1WJJ A;  2F0I A;  3E3X A;  1XX8 A;  1WD0 A;  4BBR H;  3DWP A;  4B9W A;  3BDO A;  4R4O A;  5GAE C;  2EYJ A;  4G7H C;  1DZ1 A;  1LTR D;  4A3M B;  1CTM A;  2BH2 A;  5CGK A;  1FNU A;  2Z6B A;  4LK1 C;  1SNQ A;  4POG A;  3F2C A;  4CKC A;  1L0W A;  3BZK A;  3RLF A;  3VR4 A;  1D1I A;  3U4V A;  1A62 A;  4OWX B;  4IUT A;  4A3I B;  4R8N A;  5M3M B;  4JI4 Q;  1G2T A;  4F8M A;  3M3Y H;  2JN4 A;  3HOU G;  4WJW A;  1O7L A;  1WCM H;  3CHB D;  3TME A;  5IT9 c;  1KDB A;  4YY3 L;  2OWO A;  1DGS A;  5M5W H;  4UP8 A;  1ZKO A;  3T1H Q;  2AWO A;  1JMC A;  2YV5 A;  4DGZ A;  5A2Q L;  4DAY B;  3GTL B;  3F8T A;  2PMZ B;  5KYI A;  4ME3 A;  3G4S A;  3AEV A;  3KFU A;  4RA8 A;  4RH6 A;  1F9Q A;  1V1O A;  1VQI A;  3J81 E;  4B3T Q;  4NB3 A;  4GNX B;  3TQY A;  4Y52 H;  3BYY B;  1KXL A;  4X64 L;  3PIO A;  1PH9 A;  1R9T H;  2PO4 A;  1E1O A;  1K8M A;  2PI2 E;  2L12 A;  1IZ6 A;  2E2H B;  3IFD A;  3HOU H;  2NN6 G;  4JVZ A;  3QOJ A;  3D0F A;  1YHQ A;  3BYT B;  4BA1 I;  3J80 i;  2E75 C;  2NVX H;  3J7A F;  4DR1 L;  1VCI A;  1V9P A;  3S1R B;  3OOC A;  2BOS A;  1LV9 A;  1B53 A;  2MNA A;  1K83 H;  2EYM A;  1PZJ D;  2EQS A;  3W2D A;  3LWE A;  4LWC A;  1NR2 A;  5IT9 L;  1L1O C;  2CWP A;  2JA7 G;  2VW9 A;  1I4Q A;  4FXG C;  1EWH A;  4GLV B;  3CCU A;  2GVB A;  4N8F A;  3SK6 A;  5EPJ A;  5C5M A;  5LHY 1;  3MAQ A;  2DY8 A;  2CQA A;  1TWH B;  3A7L A;  1ZXT A;  1PH1 A;  4O42 A;  4AIM A;  1D5X C;  2EYF A;  4A3B G;  2NVQ H;  4DUZ L;  2N78 A;  4TSS A;  4B3R L;  1PH2 A;  2ZJQ A;  2M00 A;  5IP9 G;  1QZH A;  3GQB A;  1XPU A;  3AU7 A;  1G51 A;  1HUN A;  1EFW A;  2NN6 H;  5CV9 A;  3HP3 A;  2B29 A;  2K50 A;  3MFG A;  4IZ8 A;  4DKA C;  3I55 A;  1YIT A;  2NZO A;  1IW7 D;  4DNR B;  1CQF A;  2ATW A;  1GHJ A;  2EYO A;  1YNJ C;  2CFM A;  3GD7 A;  3PO2 B;  4C56 C;  1XTD A;  1H9M A;  3HOW B;  3H94 A;  2RVL A;  2Z4I A;  1LYL A;  4KY5 A;  3ULL A;  1JWU D;  3BG3 A;  1C8C A;  4IUU A;  1WYD A;  3UDF A;  1C9O A;  5M9O A;  5M5X B;  2JA7 H;  3DLL A;  2CQO A;  5IGD A;  1K8A C;  4KHP L;  1MSG A;  1SLJ A;  1KAA A;  4ZQ3 A;  1BF4 A;  4DR3 Q;  2I07 B;  5D3D A;  3EQL C;  1CFM A;  4MHE A;  2E8G A;  4LF7 L;  4A3B H;  5T1G A;  5C3X A;  4FF2 A;  4YWM A;  4JG2 A;  4CDD C;  3CU7 A;  2YYZ A;  1DYQ A;  1PRT C;  5IP9 H;  2A6H C;  1VS0 A;  4QQB X;  4OX9 Q;  5C4X G;  3KYH C;  2EJF C;  2EIF A;  4DR2 Q;  1S5C D;  2MO1 A;  1CM9 A;  2J4X A;  2ZXO A;  4OEM B;  2B8G A;  3TRZ A;  2G9D A;  1N8R C;  3IKJ A;  4KN7 C;  5KNB A;  4FF4 A;  2P5Z X;  4C3I B;  1HPC A;  1N32 Q;  1VQF A;  3ND8 A;  2B39 A;  1EFI D;  1LTI D;  1AFP A;  4JI3 L;  3UDI A;  2XRS D;  3U58 A;  1IBM L;  3DHQ A;  3OMG A;  3DM1 A;  2B3G A;  5JVH 3;  5C3E G;  4A3D B;  1CKN B;  5IOD A;  4PNY A;  1TWC H;  1STG A;  1TY2 A;  2K5V A;  1JC7 A;  2I0Q A;  1R4Q B;  1L0Y B;  1PMR A;  1PXU A;  2WP8 J;  4WJ4 A;  2RSO A;  5BN3 A;  4DXG A;  2C35 B;  4J1M A;  1RIP A;  4ZLT F;  4IUQ A;  5J1Z A;  5JOB A;  4OO1 I;  3I4N B;  4A3E G;  3WOE A;  1SMY C;  3VR2 A;  2RCN A;  5C4X H;  1JB3 A;  1JR0 D;  5C4Z A;  4U67 3;  5C4J H;  4JK1 C;  1V1P A;  1TS2 A;  4G7O C;  4ZYS A;  1NCV A;  1YVC A;  2HDL A;  4GS3 A;  2N49 A;  2KA7 A;  2KEC A;  4RGN A;  2Q2T A;  2IY5 B;  1FNW A;  4HSV A;  1KLU D;  4LF6 Q;  1XNR Q;  2BH8 A;  3GTQ H;  5IYD G;  1NNX A;  5EAY A;  1ICW A;  1SE3 A;  2C5C A;  1KDA A;  4DV4 L;  1GUG A;  1G8Z D;  4XQJ A;  4XIG S;  5I4D A;  4J6H A;  1Q12 A;  2Z4H A;  5C3E H;  1MKH A;  5IY0 A;  4JC0 A;  1JOK A;  1EL0 A;  4JYA Q;  4IOA A;  1ESF A;  2DN8 A;  2LS0 1;  3W1G A;  3N52 A;  5EKL A;  5GRO A;  1N36 Q;  5L37 A;  4A3E H;  3SE0 A;  1VF7 A;  3I7F A;  1B3A A;  3MXG A;  5C44 B;  3E9H A;  2X6L A;  4IOC A;  4B3S L;  1LTA D;  4DNI A;  3FKI G;  3Q6S A;  4DV2 Q;  4DV7 Q;  1QUQ A;  3S1Q H;  2L0C A;  4G7Z C;  1VQ6 A;  1B50 A;  2MPM A;  1XTC D;  3K5O A;  3V05 A;  4UAI A;  2OF1 A;  3I90 A;  1WTW A;  4YWL A;  4BS9 A;  1HNX Q;  3JAM E;  4HED A;  5LL6 S;  5IYD H;  1X3G A;  3G71 A;  1YNJ D;  2D62 A;  2IW3 A;  1SRU A;  2K32 A;  2DGY A;  1JJC B;  1JJG A;  2KCM A;  3VA5 A;  1HFG A;  1KAW A;  3E0E A;  1WTO A;  1I4G A;  3G6E A;  1GUT A;  5AJ3 Q;  4GZY C;  2GA4 B;  3A56 A;  1HTL D;  1GUW A;  5IWA L;  1CUK A;  3K7A B;  3HKZ E;  2ALY B;  1GUS A;  1NY4 A;  1EY9 A;  4BA2 I;  2WIN B;  1D7Q A;  5JEA G;  5IOC A;  2WAQ B;  2F1M A;  4IAL A;  1IBK Q;  1G29 1;  3FKI H;  2F4V L;  2PQA A;  3I73 A;  1EWC A;  2F0S A;  2SNM A;  1PRT D;  3NWT A;  4DK1 A;  1M8A A;  5COR A;  4A3J G;  1PA6 A;  4GNX C;  4UP7 A;  1TWA B;  2A6H D;  1AZQ A;  2WKC A;  1EY8 A;  4DXF A;  2R93 G;  2PPB C;  1DON A;  4IFD J;  2EY5 A;  4ZRZ A;  2N88 A;  1LO5 D;  1FL0 A;  3A8K E;  3NBH A;  4QMG A;  4FXD A;  1TWF B;  1JWS D;  2L15 A;  2OXP A;  2BE5 D;  1X3F A;  2H5X A;  2K28 A;  1VQ4 A;  2QIL A;  2JA8 G;  4NXM Q;  3CQZ H;  4OXP A;  5C0X J;  3KBG A;  1AZP A;  3S17 B;  3MTS A;  2F4I A;  2J7Z A;  2E2J H;  2QW7 A;  4PG3 A;  5JEA H;  5E4X A;  3EA6 A;  1QB5 D;  4X3S A;  4OON A;  2O2L D;  2OQK A;  3CAM A;  3GTJ B;  4K6L A;  1SMY D;  4A3J H;  2EXD A;  1KQS A;  1MJE A;  1SE2 A;  2R93 H;  4IO9 A;  4JI2 L;  3H0G B;  4Y7N B;  1NMF A;  3S15 B;  4JI1 Q;  1PTO C;  2VB3 X;  3H3V H;  3M4Q A;  3MXN A;  1QVC A;  1BBU A;  3FP9 A;  3SR1 A;  1VQK A;  1U4R A;  4HMI A;  5JJZ A;  3S1N B;  1SBB B;  3TP6 A;  2UXC Q;  1A2T A;  1VQA A;  1D5Z C;  3NE5 B;  3NPP A;  4JOI C;  2JA8 H;  4GKJ L;  2A69 D;  1I6V C;  2NWG A;  1LTB D;  1BBW A;  2ZXR A;  4OEL B;  1DD2 A;  2QDL A;  1SDF A;  3GO5 A;  1A2U A;  4C3J B;  4A3M G;  1QUQ B;  4C2M B;  4WJ3 M;  4JI7 L;  1L1O B;  2CH4 A;  2Q8T A;  5M3F G;  2ENB A;  1XMQ Q;  1STY A;  3J80 E;  4LW1 A;  4YHH Q;  1CA5 A;  3HFZ B;  3I4M G;  1SFO H;  3CCM A;  1EYD A;  2FXQ A;  1RHP A;  5M3M G;  1H9S A;  4AH6 A;  1ZEQ X;  1G6P A;  2ZTE A;  1PFN A;  5FLX c;  1QVG A;  5M5Y H;  3QIA A;  2VQE L;  4P75 A;  1K0S A;  4DR3 L;  2F0P A;  1IYU A;  4UY8 C;  3EVQ A;  1Y1W G;  4MN3 A;  1EIG A;  4ZKB B;  1I94 Q;  1Q81 C;  1ENA A;  1MJC A;  3MEF A;  4DV6 L;  2NUC A;  5FOB B;  3GTO B;  4H02 A;  2B2T C;  1N33 L;  3D4W A;  4ODG A;  4DUY Q;  1OO9 B;  1BDO A;  1NAP A;  2ES2 A;  4DV5 L;  1I50 H;  4A3M H;  5E3F A;  3VR3 A;  4IPH A;  1IL2 A;  2EY2 A;  3RMH A;  5HGT A;  3P75 A;  4DR4 L;  3B6Y A;  2FFK B;  1O7I A;  3U9S A;  5LMU Q;  5M3F H;  2VY3 A;  3I4M H;  2AUK A;  4X3U A;  1M90 C;  1A0I A;  4O1N A;  1WI5 A;  1N32 L;  5M3M H;  4H13 C;  4O0A A;  1SNM A;  4V0B A;  3CC4 A;  2Q8I B;  1LM0 A;  2QKI C;  5FKA C;  4DNT B;  2E2D C;  1LUZ A;  2NVY B;  4LFA Q;  1FYC A;  1Y1W H;  5I2X A;  5IGE A;  1E2Z A;  3MHB A;  5I9P A;  2MQH A;  5ELC A;  1TS3 A;  4M8A A;  5LMN L;  2R3Z A;  1K8O A;  2E5L L;  4DAY A;  3GTL H;  2Q2H A;  4QB4 A;  3S24 A;  3RZD H;  1D6E C;  1WTV A;  3R2I A;  1DM0 B;  1B1Z A;  4UPA A;  1DOK A;  4LF9 Q;  2QCP X;  4A3K G;  5EKK A;  5JVG 3;  1STA A;  3TP7 A;  4GNX A;  1U9R A;  3SK4 A;  1MGS A;  1SYF A;  3F2B A;  1XPO A;  1Q90 A;  1B70 B;  3ULJ A;  4IUR A;  1K8G A;  1GJX A;  1UE5 A;  4HAE A;  5GAG C;  1VQ7 A;  3K5M A;  3X3M A;  4KY7 A;  2MUY A;  2AMC B;  3S1R H;  3PO2 G;  1Q3L A;  4CJ2 C;  1YI2 A;  2HT1 A;  1LTL A;  1D1K A;  5IYB G;  4APV A;  1BCP F;  3GTP B;  1GXD C;  2AKW B;  3MEH A;  3S1M H;  1RF2 D;  2DUD A;  2ICI A;  1PTO D;  2MHV A;  2PI2 A;  4OWT B;  4LF8 L;  2XWJ B;  4IFD I;  1EUJ A;  4EVO A;  2HD3 A;  3W5O A;  1UAP A;  1SSO A;  3IRB A;  1A15 A;  1DCZ A;  1SND A;  3RN5 A;  1A6X A;  3R2T A;  2IX0 A;  4C3H G;  4V19 0;  2FMC A;  3BVM A;  4K2L A;  3I3C A;  4BY7 G;  4A3K H;  1RCV D;  2K75 A;  2OTJ A;  2HHH Q;  1B4O A;  3QG1 A;  2WB1 G;  1GM5 A;  4FNF A;  3H15 A;  5C0X I;  2NYZ D;  1KDC A;  1X65 A;  1C0A A;  3PUZ A;  4Q5V A;  2B2Y C;  1X55 A;  3BJU A;  2K01 A;  2E2I B;  2OEO A;  3HKS A;  2MO0 A;  3HOX B;  5JJK A;  4A3G B;  3PO2 H;  4JOI A;  2KED A;  2VS1 A;  2L5T A;  3S2H B;  2K52 A;  3GTK H;  1PVO A;  1H95 A;  5IYB H;  1VQE A;  4X66 L;  1TT2 A;  3PSI A;  1YEZ A;  1U5K A;  1D8L A;  1Y1V B;  1NBW A;  2A73 B;  1SXT A;  1WTQ A;  1CI3 M;  1JOO A;  1OXS C;  5FO7 B;  2NB0 A;  1W2B A;  1X56 A;  4P71 A;  1C7Y A;  4XDX A;  4C3H H;  4BY7 H;  1PFM A;  2UUC L;  2KUM A;  2ZM6 L;  1VQB A;  3T1Y Q;  4KD4 A;  4DR7 Q;  3DXJ C;  1N9W A;  2F0L A;  2KBN A;  4MZ9 A;  5C4H A;  3I4N G;  5DEH A;  1W6K A;  3HOV B;  1JE4 A;  1YJ9 A;  1TWG B;  1E2V A;  3KLS A;  2JP1 A;  5BN4 A;  3GTG B;  4R4T A;  3L2P A;  3CRL C;  3W3A A;  3QO2 A;  2B2T A;  1SNP A;  5BR8 Q;  2UXD Q;  3D6C A;  4HIO A;  3FEW X;  4Z9C B;  5FO9 B;  1BXT A;  3UE0 A;  1EIH A;  1JWM D;  4HIK A;  4LFB L;  1F2Y A;  4X65 L;  3HOZ B;  1I3Q H;  3K5L A;  5JJL A;  3OIQ A;  4G57 A;  3SDZ A;  2Z9H A;  1KNE A;  3K7U C;  5CV5 A;  1CKN A;  3AFP A;  3TEH B;  1HH2 P;  1R4P B;  3NTI A;  2B63 B;  3J7A 5;  1S5B D;  2UUB Q;  4OIK A;  2QF7 A;  4POF A;  3KJP A;  1L0X B;  1H9J A;  3WOF A;  1QNU A;  1U4P A;  3C2P A;  4GKK Q;  1XMO L;  1E22 A;  1H9K A;  1F9P A;  3I4N H;  1PH4 A;  4YWK A;  2Y0S E;  2IWH A;  3N6R A;  2F0F A;  4K0K L;  4M1U B;  5EBD A;  4CKB A;  1EYG A;  5KNC A;  4LNQ A;  3IAY A;  1OXT A;  2UXC L;  1FJG Q;  1UUP A;  3NWS A;  1AN8 A;  3BVG A;  3CKI B;  1Z47 A;  3SHL A;  3R3O A;  4ME5 A;  3KDF B;  1WTP A;  4A93 B;  3E9I A;  4A76 A;  3AYH B;  1AE3 A;  2K5Q A;  1I6H H;  2YU9 B;  5HUR A;  1LT4 D;  2Q8R E;  2O5J C;  3C1E A;  4QUF A;  3A5Z B;  1CA6 A;  1CKO A;  4DAM A;  1O7Z A;  1F2M A;  3RNU A;  4YHH L;  1GUO A;  1PTO B;  3NTH A;  4XQQ A;  1EQR A;  1PHJ A;  5I6W A;  3I4L A;  3A5U A;  1EEF D;  5KYL A;  5G3L D;  2KCN A;  4RWS C;  5D65 A;  3D8G A;  1AH9 A;  2C9O A;  3QR8 A;  1ENC A;  1YIJ A;  1NJI C;  4NW2 A;  2F0K A;  1SMX A;  3OHX C;  1BBX C;  2IHE A;  4WRD A;  4BXX G;  4PMW A;  2WB1 E;  1HNZ Q;  3X3N A;  4ZUJ A;  1Q82 C;  2N8N A;  1VQ9 A;  4DR5 L;  1S40 A;  4LUZ A;  4DR6 Q;  1EZ6 A;  2DJG C;  1SJE D;  3VYR A;  1ONL A;  2Q2U A;  1TQO A;  1GOZ A;  4EQP A;  4LFC L;  2ZJR A;  1N34 Q;  4JI6 Q;  2D0O A;  4HJ5 A;  1NE3 A;  2N55 A;  4JI5 L;  2BE5 C;  4KY6 A;  5A35 A;  2SNS A;  3A8I E;  2HQE A;  3SK5 A;  5M5W B;  1IYV A;  1YZ6 A;  1TWA H;  4B3M Q;  1HNW Q;  4X62 L;  2B2W C;  2I46 A;  1X9N A;  2K6A A;  4PZ8 A;  1EU3 A;  5CR3 A;  3Q0A A;  3H0G G;  4BBS G;  2NVT H;  1EYA A;  4NMZ A;  4DV3 L;  4LMQ D;  5GAH C;  2HQL A;  1Q1E A;  4GLX A;  1VQM A;  3PQI A;  3NBI A;  4TVA B;  3NXW A;  4LJZ C;  4BXX H;  3VYS A;  2NBF A;  2LY7 A;  3K0X A;  3BDC A;  1EOV A;  3D31 A;  1ROD A;  1A3T A;  3SEB A;  1VMC A;  4CGY B;  1BOS A;  4A3L G;  2EVB A;  3PUV A;  3OIP A;  3EIV A;  2ZTC A;  2MFI A;  2OT2 A;  2F3W A;  3S17 H;  1XNQ Q;  1R9T B;  3VR6 A;  2UXB L;  2NTS A;  3LGJ A;  2RHQ B;  1PH3 A;  4BY1 G;  4KN4 C;  2F0U A;  4CDF C;  4N8X 1;  5EGT A;  3E5S A;  3I70 A;  3J81 j;  2L11 A;  2XRQ D;  2A69 C;  4P72 A;  3NHH A;  4DFA A;  5CV8 A;  1UNS A;  2D2C C;  4F87 A;  4BBS H;  4B08 A;  4DV0 Q;  3H0G H;  5FJ8 G;  1S5F D;  4Y7N H;  2F3I A;  3D6W A;  4JV5 Q;  4L5S A;  4HID A;  2QA4 A;  5TSS A;  3K59 A;  4F88 A;  3CCL A;  1H9R A;  4IQZ A;  1S5D D;  4RHS A;  4JPB W;  4KLK A;  3GTM B;  3G7L A;  2DY7 A;  2B8F A;  4DN4 M;  5I6Y A;  1QIL A;  4DV1 L;  1GD7 A;  5CBA E;  4K2K A;  5HGQ A;  4LF4 Q;  1JCK B;  2G9H D;  4DK3 C;  3E0J A;  5KEE A;  4RMF A;  1CZW A;  3EFX D;  5D14 A;  4A3L H;  3T16 A;  2NVQ B;  1NSN S;  1JJ2 A;  1PYW D;  2Z1C A;  1J5E L;  2JA5 B;  1W3S A;  1UEB A;  1L1O A;  3TSS A;  4C2M H;  4HIM A;  3OTO Q;  1W6J A;  3KF8 B;  1LLR D;  4NP5 A;  4BY1 H;  1SAP A;  1B3Q A;  5CV7 A;  3DEP A;  4JBJ A;  4TKO B;  4DAV A;  1WTX A;  3KLR A;  1CKM A;  2QGQ A;  5A2Q E;  4JI0 Q;  1F77 A;  2D9U A;  2IL8 A;  5FJ8 H;  3CCQ A;  1QVF A;  3U4Z A;  2F0N A;  3C3L A;  1MBY A;  2RDH A;  4OIJ A;  5DNF A;  3LWU A;  2R92 G;  1IKL A;  1WD1 A;  1Q8K A;  4G4K A;  4A75 A;  1Y8P B;  1ILP A;  4JI4 L;  1PFS A;  1BVS A;  1D5M C;  2R7D A;  4A4I A;  3NEM A;  3GTO H;  1JOR A;  4NXN Q;  1TII D;  2HCI A;  2XVS A;  1Y8N B;  2F0H A;  2A68 C;  1EY7 A;  3T1H L;  4X3K A;  3AB9 A;  3CC2 A;  2LKV A;  2MGS A;  4QIW E;  3TS2 A;  3V2T A;  3BU2 A;  5IE8 A;  1LT5 D;  3HKZ B;  1C48 A;  2KQ3 A;  3IL8 A;  1S3O A;  3RD4 A;  5IT9 E;  2YTX A;  2IX3 A;  1HR0 W;  4KV6 A;  2HDM A;  2M9V A;  1B2T A;  3UI2 A;  4EX5 A;  5IGB A;  4LUO A;  1PH8 A;  4B3T L;  4AYB G;  4DK6 C;  5D3I B;  4HJ8 A;  3M4O B;  2NVY H;  2VUM B;  4WOR A;  1X32 A;  3CPF A;  4XT1 B;  5FK9 C;  2QEX A;  2R92 H;  2G5D A;  3WWV A;  4XQN A;  3TN2 A;  4YY3 Q;  1K3B C;  2I5M X;  3ULP A;  2NN6 I;  2ZXP A;  3NEL A;  5KND A;  3J81 c;  4QJF A;  5CYU A;  1RD9 D;  1X6O A;  3ND9 A;  1TWC B;  2EZV A;  2CHB D;  2PYK A;  4H7B A;  1CSQ A;  3L7Z C;  1V43 A;  2K5N A;  4ILW A;  4KD3 A;  2KCC A;  3T53 B;  1Y14 B;  3EBE A;  3PUY A;  3BZD B;  4DF7 A;  1A63 A;  3OPO A;  1KTK A;  1AEX A;  5C4X B;  5C4J B;  3CCV A;  2B2W A;  3Q24 A;  4KKS A;  4I7A A;  1EY6 A;  1BNZ A;  2Z6K C;  2CWA A;  5C5L A;  5JEA J;  4N9P A;  2ZJP A;  1GUN A;  4JCV E;  3DM3 A;  1JE5 A;  5JPM C;  3HOX G;  3GTQ B;  4C1N K;  1MHW C;  4BWG B;  3H09 A;  4RAU C;  1JB7 A;  3L0O A;  4RKL A;  2BA0 A;  5F2D A;  5H1S E;  1PRT F;  4DR1 Q;  4LF5 Q;  1CSP A;  1JIC A;  3GTP H;  2JXM B;  1SE4 A;  3TZU A;  2K33 A;  1DJR D;  1KAB A;  1Y1V G;  3C1F A;  3OWE B;  2RA4 A;  3MXP A;  2A74 C;  1TR5 A;  1SN8 A;  3HG9 A;  3KLW A;  3J81 L;  4UHV A;  4A3I G;  2MJ8 A;  4ZAI A;  4JI8 Q;  1CT1 D;  5BN5 A;  2RBM A;  2I5H A;  1UE1 A;  3S1Q B;  5FO8 B;  1M4V A;  4B3R Q;  5FLM G;  2FHT A;  3K6O A;  2E2I H;  3RZO H;  3HOX H;  3W1B A;  2EY6 A;  4N9T A;  4PQX A;  3QB3 A;  2D0P A;  4HTH A;  1KRT A;  1SR3 A;  1HNZ L;  2K4K A;  1FGB D;  2TMP A;  4AQY Q;  1XJV A;  1RTN A;  1T9H A;  3J7A V;  3K81 C;  1EIF A;  3A54 A;  4OX9 L;  3HOZ G;  1I4R A;  1Y1V H;  4IN3 A;  4UP9 A;  1YNX A;  5JAV A;  4DR2 L;  4QL5 A;  1X3Q A;  3L3O C;  4FXK C;  1SJH D;  1K28 A;  3G6J B;  3FMC A;  2EXZ A;  1SYE A;  2BCO A;  5KRU A;  4KHP Q;  4A3I H;  1P8L A;  2B63 G;  4F7X A;  2BA1 A;  1J9O A;  1SYB A;  2PCF B;  4DPG A;  1LT6 D;  3WDN A;  5HY6 A;  2F3V A;  3IFT A;  1HNW L;  4B3M L;  3FKI B;  2A68 D;  4LF7 Q;  4B9X A;  4IPG A;  1UWV A;  4JW0 A;  2JEB I;  2HCC A;  2L55 A;  1BQQ T;  3RR5 A;  5FLM H;  5FLX L;  2O5I C;  1CHQ D;  2VL6 A;  3QWN A;  1EOT A;  2RSN A;  4A3F B;  2XIW A;  4OL7 A;  2HIV A;  1VQP A;  2UU9 Q;  1IBL Q;  1C4Q A;  4DK0 A;  1AE2 A;  5EPK A;  5DM7 3;  3R8B A;  3KF6 A;  2IHF A;  5J22 A;  4R8I A;  2SDF A;  2ASB A;  4QF4 A;  3MA2 B;  4RG1 A;  3HOZ H;  1F2L A;  5J39 A;  4A93 G;  4IPC A;  1AW7 A;  3A0J A;  4P74 A;  2UUA Q;  3SK8 A;  3RLO A;  4HMJ A;  3TRE A;  1IBM Q;  1UE6 A;  2B63 H;  4LF6 L;  1XNR L;  5JPN C;  5EKI A;  5IGG A;  3OW7 A;  1JT8 A;  4KK7 A;  2E2H H;  2E2J B;  4R1J A;  3PO3 B;  1QOH A;  4I65 A;  4AYB E;  1YNN D;  3M7G A;  4JBK A;  2K04 A;  3HOW G;  3AQQ A;  4YCV A;  4JYA L;  1PLF A;  4CKE A;  3MFY A;  2F0O A;  1HR0 Q;  1B44 D;  4OO1 G;  1DOL A;  4LAA A;  4KKU A;  3NSW A;  1EY4 A;  3GV3 A;  3Q22 A;  1N36 L;  3VDY A;  2LSS A;  1VQD A;  3S16 B;  3KDF A;  2VQF Q;  4IJH A;  3CC7 A;  1TWH H;  3CMA A;  1LTG D;  4A93 H;  2JA8 B;  4EQO A;  4DV2 L;  4DV7 L;  2YU9 H;  2F0G A;  3A55 A;  3D4D A;  1OXU A;  1STH A;  2A5H A;  4LFB Q;  4FP5 D;  1CZG A;  2R6G A;  4DV4 Q;  1HNX L;  1S72 A;  1PTO H;  2E74 C;  2Z6K A;  3J7Y W;  4MNO A;  4JI0 L;  3RLN A;  1SFO B;  2YTY A;  4KHV A;  4R4C A;  5EJW A;  2PZT A;  2B2V C;  3ICE A;  1Z9F A;  5AJ3 L;  3HOW H;  1X54 A;  3I4O A;  1EQT A;  4P2C B;  1EEI D;  1VQJ A;  3I72 A;  3JAM c;  4C3I G;  3FPP A;  1B9N A;  4OO1 H;  2OTL A;  5M5X H;  3CPW A;  1EIY B;  2PZU A;  1RJT A;  2LMC B;  4B3S Q;  1B9M A;  4CDE C;  3TBI B;  2RF4 A;  4FDB A;  4ZK9 B;  3ONA B;  4FO2 A;  1I4P A;  3D4R A;  4YIJ A;  1A8V A;  4A3D G;  3HZX A;  4KKT A;  3S2D B;  1IBK L;  2BDO A;  2HIX A;  2CCZ A;  3KK7 A;  1YJW A;  5LMN W;  3C46 A;  5DLQ E;  1I50 B;  1VF5 C;  3KLS X;  1QCB D;  5M3F B;  3H3V I;  1PTO F;  1HHV A;  5IWA Q;  3I4M B;  2K7V A;  5ISR A;  1XWE A;  1YHB A;  3SVM A;  3K8A A;  1V8Q A;  2PMZ E;  4ID6 A;  4QUC A;  4C3I H;  1HFN A;  1QZG A;  1KC8 C;  2KHI A;  4NXM L;  3BVZ A;  3KF6 B;  2F4V Q;  2EJG C;  1O80 A;  1JQY D;  4PMC A;  4GN4 B;  4PMB A;  5CV6 A;  4CJ0 B;  1E0B A;  3PUW A;  2I5L X;  1BCP B;  1Y1W B;  3NP8 A;  4KI0 A;  3JAM L;  4A3D H;  4K5X A;  1NTG A;  3KUP A;  3Q8D A;  1GO3 E;  4ZKC B;  1PYB A;  3T51 B;  1PFB A;  1HA5 A;  2PQE A;  2LXK A;  2JA6 B;  1ASY A;  1K73 C;  2EYP A;  2WAC A;  1J6Q A;  2RDF A;  4R9W A;  3RZD B;  4HJ9 A;  3ITP A;  2QDB A;  2NTT A;  2SEB D;  1KRS A;  5C44 G;  1B7Y B;  4OGQ C;  4PV1 C;  4JI1 L;  4IUP A;  4K8I A;  1L2F A;  2JA5 G;  1HQR D;  1VQO A;  1FVI A;  2PNH A;  1IXR A;  1HRJ A;  1YHA A;  2X69 A;  2R7Z B;  2JYO A;  4LF5 L;  1I4H A;  3QOL A;  2VZA A;  1BO0 A;  2Z0S A;  2Y0S B;  5T1I A;  2D5D A;  4L6T B;  3OMC A;  3PCO B;  4DU9 A;  5CMD A;  3KOJ A;  3VR5 A;  4KHZ A;  5EPL A;  1XMQ L;  3GDE A;  4QY7 A;  3S1M B;  4KMU C;  4PZ7 A;  3ERO A;  1Q7Y C;  3QJY A;  3M4P A;  1KHI A;  1E7Z A;  5EQ0 A;  2WFW A;  4JI2 Q;  3GP7 A;  3F2D A;  3HOY B;  3GTM H;  3MWY W;  2IT1 A;  1XPR A;  2EOT A;  4X6A H;  4L5R C;  1SNO A;  5I9O A;  3BS1 A;  3CF5 A;  2A8V A;  4JI8 L;  2Q2I A;  4YCU A;  3SGI A;  3M85 A;  4XT3 B;  5IIF A;  4YCW A;  5KGU A;  1ZYR C;  5C44 H;  4A3K B;  4CDC C;  5DAU A;  3J80 c;  3K58 A;  2WAQ G;  2KEE A;  1Y69 U;  4EQ5 A;  1RL2 A;  4GKJ Q;  2JA5 H;  4L8J A;  4IUV A;  4OHJ A;  3KF8 A;  4K8J A;  1I94 L;  3CXC A;  2N3S A;  4ABN A;  1I4X A;  3I2Z A;  4CJ1 B;  5FLX E;  3HKZ G;  3CCR A;  2A19 A;  4AQY L;  3S14 B;  3TP5 A;  3P7J A;  1E1T A;  4DUY L;  4JI7 Q;  4IPD A;  2VNU D;  3ERS X;  1VQN A;  2ICE C;  4E6I A;  1TS5 A;  1STE A;  2X6G A;  3DUZ A;  1IKM A;  3GTK B;  4BBR B;  4PZ6 A;  1V1Q A;  2K1B A;  4ZUI A;  5LMU L;  2VUM G;  3A8J E;  1HUM A;  3K7A H;  4MTK A;  3I56 A;  1T5E A;  2VQE Q;  5AFW A;  1NUC A;  2RHS B;  1Q1B A;  1CHP D;  1LAB A;  2B2Y A;  2SOB A;  4I7Z C;  1IHZ A;  1FGU A;  4C3H B;  1SRO A;  5IYC G;  2B2V A;  4BY7 B;  2F52 A;  2O4X A;  4DV6 Q;  3M3Y B;  2F0W A;  4LFA L;  4RCO A;  1WCM B;  1N33 Q;  1F9R A;  2LFN A;  2WB1 B;  3MC0 B;  1PZK D;  4DV5 Q;  4TQU S;  4EQN A;  3J80 L;  2JQO A;  2UU9 L;  4FVM A;  4J15 A;  1IBL L;  2R61 A;  3O13 A;  1STN A;  4DR4 Q;  3ZJY C;  2A1A A;  1GKH A;  2F0Q A;  4HR7 B;  1KL9 A;  2AQ1 B;  4TRD A;  3F1Z A;  4LF9 L;  5K5P A;  3PUX A;  1HZA A;  1TWF H;  2KHJ A;  1HXY D;  2UUA L;  1VQC A;  5G3L F;  4NDX A;  5E7N A;  2VUM H;  3DMU A;  3M4O H;  5IP7 G;  2KOL A;  1I3Q B;  2XN9 C;  3KBX A;  4ZCK A;  1HQM C;  4EGV A;  3LNN A;  4K14 A;  1E3P A;  3CCE A;  3H3V C;  4C3J G;  3ZYY X;  3H6M A;  2A6E C;  2NZ1 D;  5IYC H;  3KJO A;  3FPU B;  5LMN Q;  2EE1 A;  2E5L Q;  3ER0 A;  1ENF A;  3HEJ A;  2EYH A;  1MIU A;  3HOU B;  1EQQ A;  1OXX K;  3GTJ H;  2NVX B;  4FF3 A;  1HR0 L;  1LTS D;  1VQH A;  4R4I A;  1K83 B;  3STB C;  3SXH A;  2GVA A;  4L63 B;  3T56 B;  3L9A X;  3S15 H;  4OWW B;  1HA6 A;  1WFQ A;  1BKB A;  4L5T A;  2AQ2 B;  2VQF L;  3S1N H;  5IGF A;  3K0Y A;  2WII B;  4K5W A;  3F2U A;  1EYC A;  1SYD A;  2AUJ D;  2JE6 I;  5GQO A;  1NMG A;  2HHH L;  5IP7 H;  1TKW B;  1X3P A;  1RTO A;  2CW0 C;  4HCE A;  3MVV A;  1FNV A;  1I6H B;  2ZTD A;  1RDP D;  2FMM A;  3A74 A;  4HJ7 A;  3TS0 A;  1HCZ A;  4C3J H;  3CCS A;  1U4L A;  4JBM A;  2AHO B;  4O2D A;  1SYG A;  3HGB A;  1IL8 A;  2Z8L A;  4S3S A;  1LAC A;  4GN3 B;  4GOP C;  1II3 A;  2L9H A;  4LF8 Q;  5ELB A;  5I2Y A;  1HJP A;  4LUV A;  3AFQ A;  2PNR C;  2NZH A;  4IFD G;  1Q86 C;  1ML0 D;  1F9S A;  1HTP A;  1BUV T;  1P16 A;  1ZYR D;  3K80 C;  1HZ9 A;  5E4W C;  4XXE A;  1JOQ A;  1QG7 A;  3HS0 C;  4R4Q A;  1VQL A;  3URY A;  3R93 A;  5C3W A;  4H44 C;  2XGT A;  1QWY A;  1WOC A;  2V4D A;  2JA7 B;  4CHT B;  3K5N A;  1VDZ A;  1HZB A;  1MI2 A;  1LTT D;  2RCF A;  1EZ8 A;  5C0X G;  1MSH A;  2CVR A;  2KEN A;  3MZ5 A;  4A3F G;  3T1Y L;  4DR7 L;  2TSS A;  5ELO A;  4ULL A;  3G48 A;  1WTR A;  1GHK A;  2WAQ E;  4A3B B;  1TY0 A;  3PV0 A;  2PW7 A;  2RKS A;  2VXW A;  2K03 A;  3CW2 C;  2VB2 X;  1MD2 D;  5DM6 3;  1BCP C;  4X66 Q;  1U0L A;  3J81 i;  2BDN A;  1PDQ A;  4RGO S;  1PV4 A;  2YTV A;  3NQI A;  5BR8 L;  4IFD H;  2UXD L;  2WKD A;  1BR9 A;  2PZW A;  3J7Z C;  1KIX A;  1EU4 A;  1D2B A;  3NK9 A;  1PZI D;  3PO3 G;  2F0J A;  1UE7 A;  3BZC A;  2K5D A;  2UUC Q;  2R7F A;  3PIP 3;  4XYO A;  5J3B A;  2ZM6 Q;  2H1E A;  4K6D A;  2ID0 A;  1EY0 A;  3K57 A;  4QIW B;  2JSO A;  3TP8 A;  2UUB L;  5C0X H;  4A3F H;  2E76 C;  2XWB B;  2NVT B;  2KHS A;  3AMU A;  1WTH A;  3V96 A;  4GKK L;  4KJN A;  5ELE A;  3EJI A;  3PGZ A;  2M2L A;  1WVL A;  3T4A C;  3M4Y A;  3DEO A;  2RQX A;  1NR4 A;  3U9O A;  2H4O A;  1YNN C;  1VQ8 A;  5COY A;  3CME A;  3NUC A;  3HRZ C;  1K3R A;  3JC6 6;  4UDU C;  2B2U C;  1Q8I A;  1XXG A;  1S5E D;  1VMP A;  4X65 Q;  5C6A A;  1V1P B;  1FJG L;  1ET6 A;  2ZT9 C;  3D3R A;  1FD7 D;  3UDG A;  5K36 G;  3CP0 A;  3U50 C;  2A6E D;  3M7N A;  1G2S A;  3PO3 H;  4FYD A;  1SE8 A;  4X64 Q;  4IJL A;  3I91 A;  2K5H A;  2AWN A;  4A3G G;  3I8Z A;  5ELN A;  1XMO Q;  4CBV A;  1XYI A;  4MIU A;  4P73 A;  2J0T D;  3STB D;  2EPB A;  4RHR A;  2EDG A;  4J8Q A;  4BBS B;  2IJ0 A;  5C3E B;  1EY5 A;  1OTC A;  1VQG A;  5LL6 X;  2XNA C;  4K0K Q;  5CBE E;  2KVM A;  2PW5 A;  3S16 H;  2F0T A;  1RKN A;  1TU2 B;  1KLG D;  4A3E B;  2CW0 D;  2CH4 W;  3ERQ A;  5NUC A;  2QEJ C;  5GAD C;  1ASZ A;  1CQV A;  3EN2 A;  5K36 H;  1QNK A;  4MTN A;  2DNC A;  3PF5 A;  1PH7 A;  1PYS B;  3VYT A;  1K0R A;  1EWI A;  4DUZ Q;  1TVX A;  4GN5 A;  3HOV G; 
#chains in the Genus database with same CATH homology
 1VQ6 A;  3ICE A;  1Z9F A;  1GVP A;  5AJ3 L;  3HOW H;  1X54 A;  3I4O A;  4A3G H;  1VQJ A;  3JAM c;  3CCJ A;  4YWL A;  1AH9 A;  4L5Q A;  1HNX Q;  3S2H H;  2OTL A;  1YJN A;  5M5X H;  3CPW A;  3PF4 A;  5IYD H;  1X3G A;  1EIY B;  3G71 A;  1YIJ A;  4B3S Q;  1NJI C;  2D62 A;  1SRU A;  2DGY A;  2RF4 A;  4FDB A;  1JJC B;  4DR6 L;  1JJG A;  2KCM A;  1A8V A;  1KAW A;  3E0E A;  3CD6 A;  1SMX A;  4A3D G;  3G6E A;  1E24 A;  5AJ3 Q;  4GLA C;  1HZC A;  4GOP A;  4HJA A;  1IBK L;  1N34 L;  5IWA L;  2HIX A;  1CUK A;  2IHE A;  4JI6 L;  2CCZ A;  4PMW A;  4BXX G;  3S2D H;  2WB1 E;  1HNZ Q;  3RN2 A;  3RLN A;  3HKZ E;  1Q82 C;  2N8N A;  1YJW A;  5LMN W;  4DR5 L;  1VQ9 A;  1S40 A;  2ALY B;  4LUZ A;  4DR6 Q;  2JA6 G;  5DLQ E;  4GKJ Q;  1NY4 A;  4BA2 I;  1D7Q A;  2Q2U A;  5JEA G;  2PQA B;  4JBW A;  3H3V I;  1IBK Q;  1G29 1;  3FKI H;  4LFC L;  5IWA Q;  2ZJR A;  2PQA A;  1N34 Q;  4JI6 Q;  2F4V L;  3HOV H;  1YHB A;  2JJQ A;  1IYJ B;  3K8A A;  2D0O A;  4HJ5 A;  1NE3 A;  4JI5 L;  2PMZ E;  1PH5 A;  2XTI A;  1TWG H;  4DR5 Q;  4A3J G;  2V1C C;  4GNX C;  4UP7 A;  1PA6 A;  3GTG H;  4C3I H;  2CKZ B;  1QZG A;  2R93 G;  1KC8 C;  1YZ6 A;  2KHI A;  1TWA H;  4B3M Q;  4NXM L;  1HNW Q;  4XTC S;  2K14 A;  4X62 L;  2OCE A;  3KF6 B;  4IFD J;  4QGU A;  2R7Z G;  3NEN A;  4PZ8 A;  1X9N A;  4BBS G;  3NBH B;  1FL0 A;  3H0G G;  2F4V Q;  4LFC Q;  4GN4 B;  3PUW A;  2I5L X;  2NVT H;  4KI0 A;  4DV3 L;  4A3D H;  5GAH C;  2L15 A;  4JI5 Q;  2Y0S G;  2HQL A;  1NTG A;  1Q1E A;  1X3F A;  2H5X A;  4GLX A;  3PIP A;  1VQM A;  3Q8D A;  1GO3 E;  1VQ4 A;  1XNQ L;  4TVA B;  1PYB A;  2JA8 G;  4BXX H;  4JI3 Q;  2JEA I;  4NXM Q;  3K0X A;  1EOV A;  3D31 A;  4X62 Q;  2LXK A;  1ASY A;  1K73 C;  1J6Q A;  3CQZ H;  4OXP A;  5C0X J;  3HOY G;  2JA6 H;  1TXY A;  3OYY A;  4HJ9 A;  4NPS A;  3OW2 A;  4DV3 Q;  4A3L G;  5JJI A;  3PUV A;  3EIV A;  2E2J H;  2ZTC A;  1KRS A;  4PG3 A;  2MFI A;  1B7Y B;  5C44 G;  4JI1 L;  3S17 H;  4DV0 L;  2KCT A;  1XNQ Q;  1L2F A;  2JA5 G;  2IX1 A;  1VQO A;  4OON A;  2UXB L;  4JV5 L;  3LGJ A;  2OQK A;  2RHQ B;  4BY1 G;  1FVI A;  1PH6 A;  1PH3 A;  3CAM A;  4A3C G;  2PNH A;  1KD1 C;  1IXR A;  3UE1 A;  4A3J H;  1I5F A;  1YHA A;  2EXD A;  1KQS A;  3J81 j;  1MJE A;  2R93 H;  4IO9 A;  4JI2 L;  4P72 A;  2OQ0 A;  4GN5 A;  1NMF A;  1VQ5 A;  2R7Z H;  4JI1 Q;  3MXN B;  4LF5 L;  4BBS H;  3H3V H;  4DV0 Q;  3H0G H;  5FJ8 G;  4LF4 L;  2VZA A;  2Z0S A;  3M4Q A;  4Y7N H;  1QVC A;  1BBU A;  2F3I A;  3FP9 A;  3JAM i;  1VQK A;  3PCO B;  4L5S A;  4HID A;  4JV5 Q;  2QA4 A;  2UXB Q;  3CCL A;  3UDX A;  3KOJ A;  2UXC Q;  4KHZ A;  1XMQ L;  1VQA A;  4BBR G;  3GDE A;  4QY7 A;  1YBY A;  4KLK A;  4PZ7 A;  4JOI C;  1Q7Y C;  2JA8 H;  3OTO L;  1KHI A;  3M4P A;  4GKJ L;  1E7Z A;  1K9M C;  2WFW A;  4JI2 Q;  3FHW A;  1BBW A;  3F2D A;  3GTM H;  2IT1 A;  4DV1 L;  1XPR A;  4X6A H;  1GD7 A;  4L5R C;  4LF4 Q;  5HGQ A;  3CF5 A;  2A8V A;  4JI8 L;  2Q2I A;  4DK3 C;  3HOY H;  4YCU A;  3SGI A;  4A3M G;  3GO5 A;  4RMF A;  3M85 A;  1Q46 A;  1QUQ B;  4A3L H;  1JJ2 A;  1OXV A;  4YCW A;  4WJ3 M;  5C44 H;  1J5E L;  1L1O B;  4JI7 L;  3J80 c;  3M9B A;  1W3S A;  2WAQ G;  5M3F G;  1XMQ Q;  2GN5 A;  1UEB A;  1L1O A;  4C2M H;  1RL2 A;  4LW1 A;  4EQ5 A;  4YHH Q;  3HFZ B;  3OTO Q;  4HIM A;  3CCM A;  1SFO H;  3KF8 B;  2JA5 H;  3I4M G;  2FXQ A;  1M1K C;  4BY1 H;  4A3C H;  2JA9 A;  4JBJ A;  4DV1 Q;  1I94 L;  1WCM G;  5M3M G;  4AH6 A;  1G6P A;  1B8A A;  2ZTE A;  3CXC A;  2N3S A;  5FLX c;  3I2Z A;  4ALP A;  1CKM A;  1QVG A;  5M5Y H;  3HKZ G;  2QGQ A;  3CCR A;  2A19 A;  4AQY L;  4JI0 Q;  1J5E Q;  4DUY L;  2VQE L;  1E1T A;  2LXJ A;  4P75 A;  4IPD A;  4JI7 Q;  3ERS X;  2VNU D;  1VQN A;  5FJ8 H;  3CCQ A;  4NXN L;  4DR3 L;  1QVF A;  3S14 H;  3U4Z A;  4GOP B;  4UY8 C;  1Y1W G;  4PZ6 A;  1X3E A;  2JK8 A;  1I94 Q;  1V1Q A;  1WJJ A;  2R92 G;  1Q81 C;  1Q8K A;  4BBR H;  5LMU L;  4DV2 Q;  4DV6 L;  1MJC A;  3MEF A;  4A75 A;  2VUM G;  3K7A H;  4R4O A;  4JI4 L;  4H02 A;  5GAE C;  3I56 A;  1N33 L;  4DUY Q;  1PFS A;  2VQE Q;  1BVS A;  2BH2 A;  2R7D A;  4A4I A;  3NEM A;  3GTO H;  2RHS B;  1Q1B A;  2ES2 A;  4NXN Q;  4DV5 L;  4POG A;  1I50 H;  4A3M H;  1FGU A;  3F2C A;  1SRO A;  4IPH A;  5IYC G;  1IL2 A;  1L0W A;  3BZK A;  3RLF A;  4DR4 L;  2F52 A;  3T1H L;  3B6Y A;  3U4V A;  5M3F H;  1A62 A;  1O7I A;  5LMU Q;  4OWX B;  4DV6 Q;  2VY3 A;  3CC2 A;  4LFA L;  3I4M H;  1M90 C;  4JI4 Q;  4QIW E;  1A0I A;  1N33 Q;  3TS2 A;  3M3Y H;  3HOU G;  3BU2 A;  5IE8 A;  1WI5 A;  1N32 L;  1WCM H;  5M3M H;  5IT9 c;  4DV5 Q;  4O0A A;  4TQU S;  4YY3 L;  2OWO A;  2JQO A;  1DGS A;  5M5W H;  2UU9 L;  1HR0 W;  1S3O A;  3CC4 A;  4J15 A;  2YTX A;  1IBL L;  4UP8 A;  4DR4 Q;  3T1H Q;  2AWO A;  3ZJY C;  2A1A A;  1LM0 A;  1JMC A;  1GKH A;  4LFA Q;  1LUZ A;  4EX5 A;  1PH8 A;  4LUO A;  1KL9 A;  2YV5 A;  4B3T L;  4AYB G;  3F1Z A;  4DK6 C;  4HJ8 A;  1Y1W H;  4LF9 L;  3PUX A;  1HZA A;  1TWF H;  2MQH A;  2NVY H;  4DAY B;  2QEX A;  3CPF A;  3F8T A;  2KHJ A;  5LMN L;  2E5L L;  2R92 H;  4ME3 A;  3G4S A;  3WWV A;  1VQC A;  2UUA L;  5E7N A;  3AEV A;  2VUM H;  4YY3 Q;  3GTL H;  3KFU A;  3M4O H;  5IP7 G;  2I5M X;  3ULP A;  2Q2H A;  2NN6 I;  3NEL A;  3J81 c;  4QJF A;  1VQI A;  1X6O A;  3S24 A;  3RZD H;  1E3P A;  3CCE A;  4B3T Q;  1CSQ A;  3L7Z C;  1V43 A;  4NB3 A;  4UPA A;  2K5N A;  5IYC H;  4LF9 Q;  4GNX B;  3TQY A;  3KJO A;  4Y52 H;  5LMN Q;  4A3K G;  1Y14 B;  3ER0 A;  3EBE A;  2E5L Q;  1KXL A;  4GNX A;  3PUY A;  4X64 L;  3PIO A;  1MIU A;  1PH9 A;  1R9T H;  1OXX K;  3F2B A;  1XPO A;  1EQQ A;  1E1O A;  1A63 A;  2PI2 E;  1IZ6 A;  1B70 B;  3HOU H;  2NN6 G;  3GTJ H;  3ULJ A;  3CCV A;  1HR0 L;  3D0F A;  1YHQ A;  1K8G A;  4BA1 I;  1UE5 A;  1VQH A;  3J80 i;  5GAG C;  1VQ7 A;  2NVX H;  4R4I A;  4DR1 L;  1VCI A;  3STB C;  1V9P A;  2GVA A;  2Z6K C;  2CWA A;  3S15 H;  2MNA A;  4OWW B;  2AMC B;  1K83 H;  5JEA J;  2ZJP A;  1WFQ A;  1BKB A;  4L5T A;  3S1R H;  2EQS A;  4JCV E;  3PO2 G;  3DM3 A;  2VQF L;  3S1N H;  1JE5 A;  4LWC A;  3HOX G;  1YI2 A;  2HT1 A;  1L1O C;  2CWP A;  2JA7 G;  1LTL A;  5IYB G;  2VW9 A;  4APV A;  2JE6 I;  5GQO A;  1JB7 A;  1NMG A;  2AKW B;  3L0O A;  2BA0 A;  3S1M H;  2DUD A;  5H1S E;  4GLV B;  3CCU A;  2GVB A;  2PI2 A;  4OWT B;  5IP7 H;  1CSP A;  4DR1 Q;  2HHH L;  4LF5 Q;  4LF8 L;  3GTP H;  4IFD I;  1EUJ A;  1PH1 A;  1Y1V G;  3W5O A;  2ZTD A;  3IRB A;  4AIM A;  3A74 A;  4HJ7 A;  3RN5 A;  3TS0 A;  4C3J H;  3CCS A;  4JBM A;  4A3B G;  2IX0 A;  2AHO B;  2NVQ H;  4O2D A;  4DUZ L;  4BY7 G;  4A3K H;  2N78 A;  2K75 A;  4GN3 B;  4B3R L;  4GOP C;  1SN8 A;  3KLW A;  1PH2 A;  2ZJQ A;  2OTJ A;  5IP9 G;  4A3I G;  1QZH A;  2HHH Q;  4LF8 Q;  1XPU A;  1G51 A;  1HJP A;  4LUV A;  1EFW A;  4JI8 Q;  2WB1 G;  3AFQ A;  4IFD G;  2NZH A;  1GM5 A;  2B29 A;  2K50 A;  4DKA C;  3H15 A;  3I55 A;  5C0X I;  1YIT A;  2NZO A;  1Q86 C;  1P16 A;  3K80 C;  1HZ9 A;  2I5H A;  1UE1 A;  1X65 A;  2ATW A;  1C0A A;  3PUZ A;  4R4Q A;  1VQL A;  1X55 A;  2CFM A;  3BJU A;  3GD7 A;  1XTD A;  3HKS A;  2XGT A;  2MO0 A;  5JJK A;  4B3R Q;  5FLM G;  1WOC A;  3PO2 H;  1LYL A;  3ULL A;  2E2I H;  4JOI A;  3RZO H;  1WYD A;  2VS1 A;  3UDF A;  3HOX H;  2K52 A;  1C9O A;  3W1B A;  3GTK H;  1PVO A;  1H95 A;  2JA7 H;  3DLL A;  1HZB A;  2D0P A;  5IYB H;  1KRT A;  1SR3 A;  2CQO A;  1VQE A;  4X66 L;  1K8A C;  3PSI A;  4KHP L;  1YEZ A;  5C0X G;  1HNZ L;  2K4K A;  2KEN A;  4AQY Q;  3T1Y L;  4A3F G;  1SLJ A;  4DR7 L;  1U5K A;  1XJV A;  1D8L A;  1T9H A;  5ELO A;  3K81 C;  4DR3 Q;  1NBW A;  1EIF A;  3G48 A;  4OX9 L;  2WAQ E;  3HOZ G;  1Y1V H;  4UP9 A;  1OXS C;  1YNX A;  3PV0 A;  2E8G A;  4DR2 L;  4QL5 A;  4LF7 L;  1W2B A;  1X56 A;  4P71 A;  1C7Y A;  4A3B H;  4C3H H;  3CW2 C;  4YWM A;  4BY7 H;  4JG2 A;  4X66 Q;  2UUC L;  1U0L A;  3J81 i;  2YYZ A;  4KHP Q;  2ZM6 L;  1VQB A;  3T1Y Q;  5IP9 H;  1P8L A;  4A3I H;  2B63 G;  4DR7 Q;  2BA1 A;  1N9W A;  1PV4 A;  1VS0 A;  2YTV A;  4DPG A;  5BR8 L;  4OX9 Q;  4QQB X;  2UXD L;  5C4X G;  3KYH C;  3J7Z C;  2KBN A;  4MZ9 A;  1KIX A;  3I4N G;  5HY6 A;  1HNW L;  4B3M L;  2EIF A;  4DR2 Q;  4LF7 Q;  3PO3 G;  1YJ9 A;  2MO1 A;  4IPG A;  1UWV A;  2JEB I;  3TRZ A;  1UE7 A;  3BZC A;  1N8R C;  2UUC Q;  3RR5 A;  2R7F A;  5FLM H;  2ZM6 Q;  5J3B A;  4R4T A;  3L2P A;  2VL6 A;  1N32 Q;  2ID0 A;  1VQF A;  5BR8 Q;  2UXD Q;  2HIV A;  1VQP A;  4HIO A;  2UU9 Q;  4JI3 L;  2UUB L;  3UDI A;  3U58 A;  1IBL Q;  4A3F H;  1IBM L;  1AE2 A;  3UE0 A;  4HIK A;  4LFB L;  4X65 L;  4GKK L;  1I3Q H;  2B3G A;  3KF6 A;  5C3E G;  2IHF A;  5JJL A;  3PGZ A;  2ASB A;  4RG1 A;  1CKN B;  3HOZ H;  4A93 G;  1TWC H;  3K7U C;  4IPC A;  2K5V A;  1CKN A;  3A0J A;  3AFP A;  3TEH B;  1VQ8 A;  2I0Q A;  4P74 A;  1HH2 P;  3CME A;  2UUA Q;  2WP8 J;  3RLO A;  4WJ4 A;  3J7A 5;  1K3R A;  4DUZ Q;  3JC6 6;  2C35 B;  3TRE A;  1RIP A;  2UUB Q;  1IBM Q;  4POF A;  3KJP A;  1UE6 A;  2B63 H;  4OO1 I;  4LF6 L;  1XNR L;  4LFB Q;  4A3E G;  4X65 Q;  4GKK Q;  1XMO L;  1FJG L;  3UDG A;  3HOV G;  2E2H H;  5K36 G;  2RCN A;  1JT8 A;  4R1J A;  3CP0 A;  5C4X H;  1E22 A;  5C4J H;  3U50 C;  3I4N H;  1PH4 A;  4YWK A;  2Y0S E;  3M7N A;  4AYB E;  3PO3 H;  1YVC A;  1SE8 A;  4GS3 A;  4X64 Q;  4K0K L;  4JBK A;  4IJL A;  2N49 A;  1EYG A;  2K5H A;  2Q2T A;  3AQQ A;  4YCV A;  2AWN A;  3HOW G;  2IY5 B;  4A3G G;  4JYA L;  4LNQ A;  1OXT A;  4LF6 Q;  1HR0 Q;  2BH8 A;  1XNR Q;  5ELN A;  4OO1 G;  2UXC L;  1XMO Q;  1FJG Q;  3GTQ H;  5IYD G;  4P73 A;  1Z47 A;  5EAY A;  3STB D;  1N36 L;  3VDY A;  4DV4 L;  3KDF B;  1VQG A;  1OTC A;  2LSS A;  1VQD A;  4XIG S;  1Q12 A;  4K0K Q;  5C3E H;  3E9I A;  1MKH A;  5IY0 A;  3KDF A;  2VQF Q;  4IJH A;  3AYH B;  4A76 A;  1AE3 A;  1TWH H;  4JC0 A;  3CMA A;  3CC7 A;  1I6H H;  4JYA Q;  4A93 H;  3S16 H;  4IOA A;  3A5Z B;  4DV2 L;  4DV7 L;  1CKO A;  3W1G A;  2YU9 H;  4DAM A;  1OXU A;  3RNU A;  4YHH L;  5GRO A;  1N36 Q;  2R6G A;  5GAD C;  1ASZ A;  4DV4 Q;  3EN2 A;  4A3E H;  1HNX L;  1S72 A;  4MTN A;  1EQR A;  1PHJ A;  3I7F A;  2Z6K A;  3E9H A;  4IOC A;  4B3S L;  3PF5 A;  1PH7 A;  4DNI A;  3A5U A;  1PYS B;  4MNO A;  1K0R A;  4JI0 L;  3FKI G;  1EWI A;  4DV7 Q;  1QUQ A;  3S1Q H;  2YTY A;  4R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...