5T1IA

Cbx3 chromo shadow domain in complex with histone h3 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
GAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Chromobox protein homolog 3
publication title Peptide recognition by heterochromatin protein 1 (HP1) chromoshadow domains revisited: Plasticity in the pseudosymmetric histone binding site of human HP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5t1iA00
5CBEE 1G6ZA 1SDFA 2J7ZA 2RSNA 1QNKA 3ONAB 4OIKA 1ILPA 2KECA 2D9UA 3DEOA 4IUPA 1WVLA 2H1EA 1VMCA 1CA6A 1IKMA 4IUVA 2DY7A 3IL8A 1X3QA 1JICA 1VMPA 1O7YA 3F2UA 4XT1B 1WTQA 1WTPA 2EOTA 1AZPA 5T1IA 2MGSA 5DNFA 2EPBA 1Q3LA 1F9SA 1PFBA 2MJ8A 4ZAIA 1GUWA 2B2YA 1F9RA 1WD1A 1RTOA 1IL8A 2SDFA 2X6GA 3DEPA 1M8AA 3Q6SA 1EL0A 1RTNA 4IUUA 4ZLTF 3D6WA 5CBAE 1F9QA 1X3PA 3MWYW 1O7ZA 3I90A 5EKIA 2HUGA 2FFKB 1DONA 2M2LA 3R93A 2FHTA 2NYZD 4X3SA 2Q8TA 4MN3A 1WTXA 2MPMA 4RAUC 1QE6A 1RODA 1IKLA 1A15A 1J9OA 1DOMA 2KEEA 1RJTA 1CM9A 3I3CA 3DM1A 3KUPA 1CA5A 2B2YC 1AP0A 2HCCA 1BBXC 4CJ0B 4R9WA 2CVRA 2VXWA 1DZ1A 2HDLA 1NR4A 1G2TA 1F2LA 3N52A 5E4WC 2KUMA 2K05A 4MHEA 5EPJA 5T1GA 3GV6A 5D14A 1BO0A 5E4XA 1KNAA 1PDQA 2L12A 3FPUB 1WTVA 4UAIA 1XYIA 2FINB 2IL8A 2BDNA 2MP1A 4DN4M 4ZK9B 1AZQA 1KNEA 1ICWA 2B2WC 1SSOA 4HAEA 4X3KA 4ZKCB 4OIJA 1MSHA 2HCIA 1QG7A 1EIHA 4XT3B 1PFNA 2RSOA 2KVMA 1E0BA 4X3UA 2Q8RE 3MTSA 1HFGA 3TZDA 1B50A 2DY8A 4XDXA 1WTRA 2RVLA 1G91A 1B3AA 2B2VA 4O42A 1O80A 1SAPA 1G2SA 1RHPA 2B2UA 2L4NA 1PFMA 2L1BA 5COYA 4RA8A 4U68A 1S4ZA 2HDMA 4IURA 1WD0A 2B2WA 2K03A 1BF4A 3I8ZA 2FMMA 2NZ1D 5D65A 1LV9A 3I91A 4R8IA 4QUFA 3H91A 5AFWA 2EE1A 2NWGA 3UI2A 1NAPA 1EQTA 1JE4A 1HUMA 1DOKA 1MSGA 2R3ZA 3P7JA 1WTWA 2B2VC 4X3TA 3GV3A 1DOLA 1U4RA 2X6LA 2N55A 3G7LA 2B2UC 2X69A 3KBXA 4IUTA 1B2TA 5JJZA 1U4MA 2RA4A 3TN2A 1NR2A 4HSVA 4NW2A 1B4OA 1X32A 1B53A 1XX8A 5EPLA 1TVXA 2K01A 2K28A 3LWEA 4ZKBB 1C8CA 1BNZA 1HRJA 3HP3A 1EIGA 2N88A 5EJWA 4LMQD 1ML0D 4HEDA 1HHVA 1J8IA 1F9PA 4RWSC 1WTOA 1HA6A 2K1BA 1HUNA 5EPKA 4CJ1B 2B2TA 1HFNA 2FJ2A 4QUCA 1PLFA 2K04A 3QO2A 2KOLA 1MGSA 2L11A 1EOTA 1MI2A 5CMDA 2KEDA 1NCVA 1U4PA 2XIWA 4IUQA 1ILQA 2JYOA 4HCSA 1ZXTA 2JP1A 3FDTA 4CJ2C 2L9HA 2B2TC 3IFDA 1ESRA 3SVMA 5EQ0A 5CORA 1U4LA
chains in the Genus database with same CATH superfamily
2L15A 2HQEA 2KHJA 2JA7B 2QILA 4A3IB 2C5CA 4A3BB 1CFMA 5IE8A 3IRBA 2UUAL 4BWGB 3IL8A 3MHBA 3NBHA 4MTKA 1BCPF 4JOIA 4A3FG 2P5ZX 3ULLA 5DNFA 2NVQH 4GNXA 5EBDA 3B6YA 3MVVA 3CPWA 3GTQB 2IY5B 3ULJA 3SXHA 4CDFC 3TQYA 4R4TA 3K6OA 1Q8IA 3MXNB 1EQQA 3I90A 1OXXK 3S16B 1SR3A 4JI4L 1TWAB 1JR0D 4NXNQ 1SNQA 1J9OA 3TEHB 3CD6A 4U673 4ZCKA 5FKAC 4B3SQ 1GHJA 4IFDH 2EDGA 4P75A 1DZ1A 1RF2D 2K5NA 3N52A 4C1NK 2QEJC 1PYWD 3KLSA 3HEJA 4C3HB 4KTAA 4AIMA 2D5DA 3DWAA 1WTVA 2EYPA 2UU9Q 1Y8NB 2IL8A 1Z47A 1YI2A 1CQFA 3HOVB 3JAME 2Q8RE 3AMUA 1HFGA 1ENCA 1EYAA 5FLMG 3KDFA 1SNPA 3EA6A 3BVMA 4DFAA 1WD0A 4N9PA 1LYLA 5IT9E 4EQNA 1HH2P 4G7HC 3A8JE 5I6WA 4QCLA 3I91A 3D31A 2JA8H 1VS0A 4K0KQ 4FYDA 3CCQA 3BZKA 1PH7A 4JI2L 1PTOF 1WCMG 2ZTEA 3RNUA 4QIWE 2F0IA 1DGSA 3TZUA 2H4OA 4HSVA 1E7ZA 1LTSD 5CV9A 4DNTB 4DV4L 2K01A 1HNWL 4EQ5A 1HZ9A 1D5XC 1O7LA 1TIID 2UXDL 2NB0A 1D1IA 5FK9C 1HA6A 1SYDA 2PYKA 4P72A 3DXJC 4K6DA 4AH6A 3CQZB 3GTOB 4GN3B 4CJ1B 1UEBA 2K5QA 4K2KA 3S15B 3ITPA 2YV5A 1VQOA 2IT1A 5KEEA 5CMDA 3NBHB 1JOQA 1DM0B 2KJXA 3J7ZC 4GNXB 1MKHA 4HR7B 2L9HA 5I9OA 1WTHA 1AW7A 4JI5Q 1SDFA 1DJRD 2A6EC 4OIKA 1X3FA 3DWQA 5I2YA 2N78A 4DR3Q 4OX9Q 2DNCA 2D0OA 2A6ED 5C44G 4DV2L 1TS5A 1EY7A 1GUNA 2OQ0A 5FO9B 4GLAC 1FYCA 1E1TA 2D2CC 1JICA 3S2HB 1PRTF 4XT1B 1CK1A 2OT2A 4H13C 1TKWB 1GUWA 4ALPA 2NTSA 5EKLA 3X3MA 5CBAE 2I5MX 3AFQA 2M2LA 1NTGA 1FNUA 5C4JB 5C3WA 3F2CA 4JI3Q 2K5WA 3KDFB 3HOWH 4B3ML 4TVAB 3HOYG 1UWVA 2JA7G 4LFCQ 1EWHA 2R92G 2YU9H 1PDQA 1ZEQX 4OONA 4A3IG 2F0GA 3BS1A 3W1GA 4A3BG 1R4PB 5GAEC 1SJED 1YNJC 4CHTB 1EWCA 3PIP3 3TMEA 4C3IB 4ZYSA 2RSOA 4X3UA 1E0BA 1M1KC 3HOZB 2IX0A 4POFA 1WTRA 3CU7A 2F0WA 2B2WA 2V1CC 1KDBA 1BDOA 2F0PA 2NZ1D 3I8ZA 5J22A 1Z9FA 1BCPB 2A19A 2CKZB 1MSGA 3U9SA 3JAMi 2F0KA 4KLKA 2N55A 1IYUA 1Q81C 3ND8A 4FVMA 5J3BA 1DD2A 3TN2A 3F2BA 1S5ED 4FF2A 4NW2A 4ZKBB 1B53A 5IYCG 4YIJA 4C3HG 4DA2A 3U4ZA 5C6AA 1XMOL 3HZXA 4G7ZC 1Q1BA 1PMRA 2LXJA 2PO4A 1LO5D 2JEBI 1TWHB 1R4QB 3C1EA 3HOVG 5FLMH 3VR4A 2CH4A 3T51B 3J80c 1EU3A 2VUMG 1H95A 2F1MA 4RCNA 2KOLA 4BA1I 3PCOB 2XWJB 5M5WB 5ELOA 1FD7D 2M00A 1ASZA 4BY7B 4LUOA 1P16A 2DJFC 1EY6A 5C4HA 1WCMH 1GM5A 3HKSA 1A62A 2ZM6L 2J7ZA 1ILPA 1YBYA 2KECA 3A8IE 4P73A 5ELEA 4DR4Q 1B70B 4X65Q 2QF7A 3GTGB 4ID6A 1VQLA 1PTOB 1K0RA 4A3KB 4JI7Q 1AZPA 2MGSA 4OHJA 4B3RL 4IZ8A 4JI6L 3KLRA 3A7LA 3HS0C 2L55A 2E74C 3MWYW 1SE3A 5EKIA 3DHQA 1H9KA 3I70A 4HIMA 3S1NH 1PHJA 2NVTH 1NE3A 3L0OA 5CV6A 1JB3A 4UPAA 4DUYQ 5KYIA 3N6RA 2MO0A 2N49A 4X64Q 3KJOA 3K58A 4A3JB 2E75C 3T53B 2N8NA 4L5SA 1BBXC 1AP0A 4RFBA 1NR4A 2F4VL 4GKKL 1F2LA 1SLJA 4KJNA 4MHEA 4X6AH 2E5LL 5D14A 2RF4A 3TSSA 5C44H 1STBA 1I4XA 2E2IB 5LL6S 1K8GA 5A35A 3OYYA 4DR7Q 1O80A 4LF8L 2B2UA 2SNMA 3K80C 5IYDG 4V190 1W6KA 3PUXA 4G4KA 1HJPA 3KBGA 3M9BA 1D2BA 4QUFA 1XNQL 1C0AA 1PRTB 1HXYD 4WJWA 3I56A 1XNRL 2F0MA 3WOFA 5FLXc 1JE4A 2R3ZA 5FLXE 2UXCQ 2QDBA 1GO3E 2X69A 2A6HD 2VW9A 4EGVA 4LF6L 1F77A 4FF1A 1AN8A 4QF4A 1LTLA 1Z6HA 2JA7H 1B2TA 4NP5A 4A3IH 4J1MA 1HRJA 1LT3D 4A3BH 1SNMA 3D4WA 4PZ6A 1QZGA 4C3IG 5EGTA 1STEA 4JBMA 2G5DA 5BN5A 4IFDJ 1W3SA 3GTQH 2L11A 3DUZA 3K5LA 2KEDA 2XWBB 1XPUA 5JAVA 1SRUA 2O2LD 1ILQA 4FF4A 3S1QB 2JP1A 3NUCA 3EJIA 3S16H 1GKHA 3IFDA 1V8QA 1TWAH 3QJYA 3PIOA 4DV0L 1JJ2A 2OQKA 5E1FA 2MNAA 2D9UA 1CT1D 2KA7A 4JI0L 5IYCH 3SE0A 2PZWA 4C3HH 3BDCA 1SFOB 1LTGD 3D4DA 1ZYRD 1AE2A 1RCVD 3HOVH 1F9SA 2MJ8A 5C3EB 2KHSA 3DWPA 3E9IA 2SDFA 5I6YA 4LUZA 1U5KA 3D6WA 3Q22A 1F9QA 5JEAJ 4FDBA 3BZDB 5FOBB 1XTDA 4MN3A 2V4DA 3STBC 1NUCA 3PO3B 1YIJA 2R93B 2L0CA 3M3YB 1CI3M 2VQEL 4BY7G 3FMCA 2HHHL 2CVRA 1TY2A 5M3MB 2EXDA 1KRTA 3P20A 1LT6D 5EPJA 5GAGC 1KNAA 1IBML 1N32Q 2K75A 4CKBA 2R7ZG 1B9MA 1XMQQ 1VQMA 1F2ZA 4BY1B 4IFDI 2ATWA 5F2DA 1B50A 4L5QA 4A3KG 2XRQD 4DXGA 5EKKA 3UE1A 4J6HA 1IBLL 5IY0A 3CQZH 4EX5A 3GTOH 4DNRB 2F4IA 5COYA 1N34Q 1HNXL 3P1HA 1VQFA 3S15H 4S3SA 4DV7Q 4RH6A 4X66L 5J39A 1TXYA 4LF9L 1U4RA 1JJGA 2E2HB 4R4OA 1P8LA 1UUPA 2KCTA 3H0GB 5HURA 2I07B 1C8CA 4LFBQ 4G57A 2LFNA 5CC4A 2RHQB 1OXSC 2BE5C 4UDUC 3S2HH 2XVSA 2PMZE 4JI1Q 5IYDH 3S2DB 4MTNA 1WOCA 1KXLA 3SDZA 4CDCC 2Z6BA 2AUKA 5C4JH 5JVG3 3RLOA 2K33A 1V43A 1KIXA 1Y14B 2EYHA 3K5MA 1TR5A 3ONAB 4A3FB 4GKJL 2J0TD 5D3DA 5IYBG 2JA5B 2EYOA 1D5MC 1GUGA 3SHLA 3ERQA 3I2ZA 1L0WA 2RKSA 1IYJB 5T1IA 1BVSA 1QB5D 1MIUA 3PQIA 4C3IH 1CKMA 3T1YQ 3CCVA 4K6LA 2ZJPA 1XJVA 2K50A 4EQOA 3J7A5 1M8AA 4FP5D 3G48A 3E9HA 2A73B 1O7ZA 2OWOA 3J81L 4OWTB 1VQIA 3K0XA 2OF1A 5KNDA 5M3FG 4OGQC 1JJCB 2K52A 3BVGA 1E1OA 3TP7A 4NMZA 1N36Q 1V1OA 3CCEA 4DKAC 4LF4Q 1EY8A 1X65A 3FPUB 2L5TA 4Q5VA 1SNOA 1WJJA 2WIIB 1KNEA 1ICWA 4K5WA 1SSOA 2EJFC 2CQOA 1VQJA 4AYBB 5BN4A 5G3LF 1J5EL 3BU2A 1JB7A 4ILWA 4HJAA 2H5XA 1TWHH 2B8FA 4KHVA 2D62A 5C3EG 4KN4C 1W2BA 4A3GG 3CKIB 1G6PA 3TREA 1NJIC 2CH4W 4LFAQ 2UUBQ 1CHQD 2NWGA 3UDGA 3VR6A 5M5WH 1JORA 1HZBA 3PUZA 4BY7H 1LTRD 3PO3G 2R93G 3WDNA 1PH4A 1QVGA 1A63A 3MXNA 5M3MG 4C56C 3CCRA 3FPPA 1JWMD 2F0FA 2HQLA 2LMCB 5NUCA 3GTGH 4EVOA 3S1NB 2CCZA 3BYTB 4BY1G 3W5OA 1YJNA 4B3TQ 2PCFB 4TRDA 4A3KH 3PIPA 3EQLC 1DXMA 3OIQA 3H15A 2KCMA 4GOPC 1UEAB 3W3AA 2GN5A 3LNNA 4RGNA 5TSSA 4JI5L 1C9OA 1NCVA 1CHPD 4OX9L 2JYOA 2OEOA 1ZXTA 2EY5A 3C1FA 3I7FA 4DAPA 2G9HD 3SVMA 4R8IA 4DUZQ 5IGBA 1JT8A 5E3FA 4NB3A 4IOCA 3NE5B 4GLVB 1WVLA 1Q86C 1EFID 1YHBA 1TWFB 1JMCA 1E2ZA 3T56B 1GUTA 5DM73 3H0GG 3BDOA 1WTQA 1U0LA 4L8JA 1F2YA 2XN9C 2E2IH 3PO2B 2ZT9C 4JI3L 5IGEA 2IPKD 1K28A 1X3PA 4BBSB 3GD7A 3HOYB 4LUVA 2AHOB 2R92B 1XPOA 4LFCL 3H3VC 4H02A 3A5UA 5M5XB 2PQAA 1JE5A 2B2YC 2O5JC 5EAYA 4R1JA 3CC2A 3L9AX 4DV5Q 4K8JA 4A3MB 3ER0A 2F3VA 5T1GA 3H94A 5K36G 1I4QA 1SNCA 2WAQB 5IYBH 2L12A 2OCEA 1K8AC 5CR3A 2JA5G 1HA5A 4X3KA 2ICEC 3OWFA 3RN2A 1PH6A 4F7XA 2EQSA 3NELA 2F0QA 2BCOA 1G91A 1LUZA 1B3AA 3PV0A 1I50B 4XYQA 2BH2A 2K14A 3J7YW 2FMMA 4FNFA 5IWAQ 1FL0A 5C3XA 1NAPA 3T1HL 1HUMA 3HOXB 1WTWA 3URYA 1EUJA 2PW5A 5ISRA 4L5RC 3S1QH 4DPGA 5A2QE 4KN7C 2QCPX 3LWUA 3HG9A 2F0LA 2NTTA 3M4QA 2VUMB 1I4RA 1QVCA 5GAHC 1Q12A 1TT2A 1EU4A 1TWGB 1HR0W 2AQ1B 1SFOH 5JOBA 1JOKA 1VQ4A 2EYFA 1I3QB 2NVYB 1U9RA 4AYBG 2XGTA 4NXML 3I4NG 3CW2C 3OMGA 1QCBD 3BDLA 2LS01 4QY7A 3WOEA 1YHAA 5C3EH 4KHPQ 2EZVA 2IX1A 1J6QA 4A3DB 3OW2A 2JN4A 4H0LC 2RDHA 1PH9A 3EBEA 5JEAH 5JPMC 3T4AC 2R61A 1Q7YC 4LF7Q 1BUVT 1VCIA 4CJ2C 4DR4L 3C46A 4X65L 3SK5A 1FJGQ 4IPGA 3J7AV 3VYTA 3PO3H 1H9MA 2R93H 3M3YH 4YWLA 3OPOA 4JI8Q 3R2IA 2Q8IB 5M3MH 1CSPA 4PMWA 1SMYD 4QL5A 3RUZA 5KGUA 3ZYYX 1C4QA 5HGQA 4DV3L 2IX3A 2PQAB 4QQBX 2RCFA 2GVBA 2NZOA 2EJMA 3K7AB 4AYBE 4BY1H 1S3OA 4DUYL 1I4PA 5GQOA 4X64L 4IUUA 4FXKC 1CQVA 4OL7A 3G71A 4A75A 3A74A 1PA6A 2AQ2B 1CTMA 4RHSA 4XTCS 4YWKA 1IKLA 3KYHC 3A7AB 3JAML 2KEEA 4FF3A 4NPSA 5JJKA 3DM1A 4X62Q 4R9WA 4M1UB 4UP9A 5IP7G 2OXPA 2MQHA 5IT9L 3GP7A 1BO0A 2SOBA 3NSWA 2E2HH 3ICEA 5M9OA 1XYIA 1MBYA 2R6GA 4DR7L 2BA0A 3H0GH 4PQXA 4P74A 1Y69U 1SE8A 3E3XA 1VQ5A 2HCIA 3VR2A 1K8OA 4XT3B 3RZDB 2DJGC 4WFN3 3PGZA 3PO2G 1S4ZA 2VZAA 4LK1C 5GROA 1I94Q 4ME3A 3H91A 2JJQA 4BBSG 3OOCA 3S2DH 4DV1Q 1GVPA 4KKUA 3KF8A 3R8BA 4UY8C 4YCVA 1M90C 3G4SA 4A76A 1U4MA 1PH2A 4A3MG 1X32A 5EPLA 4A3FH 1E24A 4JG2A 1II3A 1BNZA 3CCUA 2WAQG 1SE2A 2N88A 2JA5H 4HEDA 4M8AA 1LTTD 1PLFA 3U4VA 5JPNC 3G6EA 1KABA 4YCWA 3TP8A 5FO8B 2PI2E 1UE6A 1CUKA 1HCZA 1I6HB 1IZ6A 1ASYA 2RDGA 1A2UA 5EQ0A 5IGFA 1U4LA 3HOXG 1V1PA 1PYBA 3OHXC 2IJ0A 2H1EA 1VMCA 1PH5A 2WAQE 2F52A 3J80E 1LLRD 1K83B 2SNSA 2EPBA 2ZTDA 4DF7A 2PPBC 3I4NH 2BDOA 1H9RA 2WKCA 3L3OC 2HUGA 3H09A 4JBJA 3QG1A 4X3SA 4LWCA 4A3DG 4MIUA 2MPMA 1QE6A 1RODA 2UUCQ 3RLNA 1CM9A 5ELNA 4C2MB 2R7ZB 1G8ZD 4ABNA 1PYSB 1XMQL 2CHBD 2F0JA 3GV6A 2PMZB 3AQQA 1X55A 1VQBA 1I4GA 3KF8B 5IODA 4LJZC 4PV1C 1N34L 1HR0Q 4KD4A 3NPPA 3VR5A 3TZDA 4DV7L 1D1KA 3OIPA 1SNDA 4Z9CB 4O42A 2Z6KC 3I4MB 4IURA 2EVBA 4YCUA 4A3CG 1HNWQ 2F0NA 4QGUA 2R7DA 1CZGA 3SK6A 4HJ8A 2UXDQ 2AMCB 1IHZA 4PZ8A 1LT4D 1O78A 4LFBL 2X6LA 4HJ5A 2XRSD 5IP7H 2PNHA 4PMCA 3V05A 3CHBD 1VQCA 1A0IA 3VA7A 1XX8A 4JI1L 2EIFA 4DR6L 1HZAA 1QUQA 1IYVA 1KDAA 1WFQA 1TWFH 2NZHA 1BXTA 4TQUS 3U9OA 1V1PB 3BYYB 2Q2UA 3AU7A 3PO2H 1STNA 4K14A 4PG3A 1VQDA 3QIAA 1NBWA 2A6HC 4A3EB 1EYDA 1IBKQ 4J15A 4LF5L 4BBSH 3V2TA 3HOYH 2EJGC 1NSNS 3E0JA 1ESRA 1D5ZC 2R92H 4XQJA 4OWXB 1G6ZA 4L6TB 5BR8Q 5M5XH 5I2XA 4HCEA 2YYZA 4A3MH 5IOCA 1EFWA 1TS4A 2RCNA 1G51A 3D0FA 2EOTA 2F0UA 1HNZL 4B3MQ 4ZAIA 2B2YA 1B3QA 5M3FB 3LGJA 2JK8A 3S17B 2ASBA 1I50H 2FFKB 2GVAA 1ESFA 3M4YA 1HQMC 4LF4L 3J80i 5LMNW 1A15A 3NQTA 1KD1C 3F8TA 1CA5A 1ZYRC 3HOXH 2UXBQ 1HTPA 1G2TA 2N3SA 4IO9A 2F0DA 3ERSX 4DU9A 4E6IA 2EY6A 1EY9A 3F1ZA 2K5VA 4IUNA 2ZXRA 4HAEA 1PFSA 4GN5A 4DK1A 1MSHA 2O5IC 1QG7A 4A3GB 5FLXL 1VQ8A 2VUMH 1TWGH 2RBMA 1Q1EA 3WWVA 1I3QH 4GOPB 2NVYH 4LAAA 2PW7A 1QUQB 2WACA 5D65A 3MFYA 4C3JB 5AFWA 5LL6X 4A3DH 2Q2TA 1LTBD 4V0BA 4B9XA 2F0OA 1NMFA 1QJOA 4KKTA 3DM3A 5J1ZA 1I5FA 2A1AA 3D4RA 5FJ8G 3Q24A 1BCPD 2AWOA 3NP8A 4CKCA 3GTPB 4HIKA 1UE1A 3MAQA 3CC7A 3EVQA 2C9OA 4PNYA 4JYAL 1TS3A 1J8IA 1WTOA 3NENA 4RGMA 3FP9A 3DLLA 1STAA 2ZM6Q 4P71A 3RZOB 3K7AH 2C35B 4POGA 3AFPA 4BBRB 1S72A 1EOTA 4DR1L 3I4MG 3NQIA 2XIWA 1EIYB 2DN8A 1LTAD 1YZ6A 5JJLA 4XXEA 3TS0A 4B3RQ 1QWYA 4FO2A 3GDEA 2EY2A 3QWNA 3V96A 1STHA 1VQAA 5HGTA 1A2TA 3CPFA 1JCKB 1CA6A 4I7AA 4DR5L 1O7YA 1C7YA 3QOJA 5I9PA 2CWAA 3CCJA 4JW0A 1VQPA 1B9NA 1LABA 3RZDH 3NTIA 4JBKA 3MEFA 1SXTA 3M4OB 1PTOD 2ICIA 1QOHA 2Q2IA 4WJ4A 2ZTCA 4DV5L 3TDQA 4A3EG 5KIXA 4DR2Q 3SK8A 1RJTA 1W6JA 1C48A 4ZUJA 4LF8Q 1VQ9A 2RQXA 3KK7A 4AQYQ 2KBNA 2BDNA 2B2WC 1EZ8A 4NXNL 1YJWA 1AH9A 5IWAL 2CWPA 4KHZA 4B3SL 3NTHA 1NNXA 4N9TA 1I4HA 2I5LX 4QB4A 4BA2I 3H3VI 3C2PA 1SYCA 3DMUA 3D6CA 4Y52H 3CF5A 2K03A 4ODGA 4OELB 5DLQE 2UU9L 2J4XA 2NN6I 1SBBB 1L0YB 2TMPA 3U58A 2VQFQ 4XQQA 1EYCA 2ZJRA 1I6HH 2PI2A 1I6VC 2XSCA 3HKZG 3RMHA 3C3LA 1PRTD 5GADC 3I4NB 4ZQ3A 3GO5A 4HMJA 4K8IA 1KQSA 4K0KL 4LMQD 1B8AA 4KHPL 1HUNA 1K9MC 1D6EC 5C0XJ 2K5DA 4GN4B 3H6MA 3E6ZX 3P75A 1K83H 1SN8A 4KKSA 5CGKA 2KENA 4K2LA 4LF7L 3K5NA 3A5ZB 4JI0Q 4IQZA 1FJGL 2JSOA 1MD2D 4JVZA 1U4PA 3UE0A 4KY7A 2QEXA 4JI8L 3NHHA 3FDTA 3VA5A 4C3JG 5LMNQ 1STGA 2B2TC 2NVXB 2JA8G 2Z4IA 1MHWC 2I46A 5CBEE 4YHHQ 1E2WA 4BS9A 5FJ8H 3CAMA 4C2MH 3HKZE 4KY5A 1DCZA 2R7ZH 1KC8C 1K3RA 4FXGC 2K32A 3ULPA 1VDZA 3QOLA 2XNAC 3TP5A 4F87A 2A69C 4QJFA 2K7VA 4RMFA 3NTKA 1FR3A 4RHRA 2A69D 3NWTA 3M7GA 4IPCA 2HHHQ 2JQOA 1F9RA 1IL8A 4DR3L 3SEBA 4JCVE 1RTNA 4ZLTF 1IBMQ 4X62L 3K57A 4BBRG 4FXDA 1VQHA 3I4MH 2FHTA 2MFIA 3RD4A 4DNIA 3KF6A 5ELBA 2HCCA 2VL6A 3PIO3 1IBLQ 1PH1A 3O13A 4N8FA 5I4DA 1KAWA 2EYLA 3NK9A 4GLXA 2NN6G 1A3VA 2JA9A 5BN3A 3CCMA 1Y1VB 4DK6C 1LACA 1SYGA 3S1RB 4A4IA 5C5LA 1L2FA 4DAYA 1VF5C 1EOVA 2IHEA 2RVLA 4DV1L 3CMAA 4IJLA 4RA8A 2HDMA 1JQYD 1AEXA 3L7ZC 1OXUA 3PSIA 1OXVA 1S5DD 3Q0AA 5DAUA 4A3EH 2RDFA 4EQPA 1AFPA 5ELDA 4YY3Q 4X3TA 1DOLA 3EFXD 1EY4A 5KNCA 2AKWB 4IUTA 4ZRZA 4DGZA 3EIVA 1NR2A 1VQNA 3M4PA 3PUWA 5IGGA 1EIGA 1ML0D 1PH3A 1HHVA 1YHQA 1KAAA 2EY1A 2PZTA 2DGYA 3I4LA 2E8GA 3BJUA 5JVH3 4A3LG 1G291 4GKJQ 4QUCA 4GZYC 1EIFA 1ICFB 2K04A 5E7NA 1X9NA 2ZJQA 3VDYA 1MGSA 5M3FH 5HY6A 1STYA 3S17H 3M85A 1GXDC 1TWCB 2LY7A 3I73A 3A8KE 2DNEA 4OO1G 2HD3A 1R9TB 3GTJB 2RSNA 1YNNC 4DAVA 3Q23A 3DEOA 3CRLC 4QMGA 1Y8OB 1YNND 3VYUA 3BVZA 2YTYA 5C4ZA 4DK3C 1TY0A 1VMPA 4DV6Q 3KF6B 3AB9A 4A3GH 3M7NA 5C0XG 1GUOA 1RTOA 1YITA 2WP8J 3JAMc 1ONLA 3Q6SA 2UUCL 1EL0A 5L37A 4R4CA 1L1OC 1SROA 3IFTA 4DAYB 5IT9c 1FNWA 4C3JH 1SMYC 1J5EQ 4JI7L 1PXUA 4CJ0B 2K4KA 1X3GA 1SJHD 5E4WC 2KUMA 2IWHA 3W2DA 1HR0L 4I7ZC 5LMUQ 1K73C 3LX0A 1RL2A 2I0QA 2MP1A 3D3RA 1GUSA 4IN3A 2F03A 3GTPH 1EIHA 1HPCA 1EEID 2VS1A 3EN2A 3GTKB 2A68C 4DXFA 4XDXA 5A2QL 2G9DA 2A68D 3NXWA 1PFMA 4A93B 1CZWA 3RZOH 1EY5A 1A3UA 3TBIB 4BBRH 3MXPA 1XXGA 3G6JB 1EQTA 2D0PA 5ELFA 3QR8A 3H3VH 2PZUA 3KBXA 5AJ3Q 1TU2B 5JJZA 3OTOQ 1EQRA 2NN6H 5KRUA 4JV5Q 1ENAA 3HP3A 5IIFA 1UNSA 1Y1VG 2JE6I 4RWSC 3UDIA 2KQ3A 1Y1WB 2K1BA 2Y0SG 1AE3A 2UXCL 4KJOA 2MHVA 1IBKL 1HFNA 1S5CD 5C4XB 2B29A 2B63G 3EROA 5BR8L 3M4OH 1PH8A 3GTLB 1QVFA 5CV4A 3FEWX 4YWMA 5FO7B 1Q90A 5K36H 2E2JB 3L2PA 3FKIB 3K59A 5CORA 3SK4A 2KCCA 1NY4A 1N33Q 3HOUB 4IPDA 2AQ3B 2JA6B 4RCOA 4C1NI 5M5YB 3E5SA 2LXKA 2ENBA 1GD7A 3MC0B 2Y0SE 3CMEA 2UUAQ 2I5HA 4A3LH 4PMBA 2X6GA 1YNJD 3J81j 4JK1C 1H9SA 2HIXA 1KLGD 3KOJA 2UXBL 2NYZD 2Z4HA 2Q8TA 4Y7NB 4RGOS 4RAUC 2LSSA 1DOMA 1K0SA 4OO1H 1BR9A 1VQKA 1IXRA 4JI4Q 2K05A 5E4XA 1L0XB 1XWEA 3PMFA 1LT5D 3QB3A 1GHKA 3GTMB 1SE4A 1AZQA 1QZHA 5C5MA 1UAPA 2Z8LA 1VQGA 3T1HQ 2K5HA 4KMUC 3MXUA 3TP6A 3KLWA 3OMCA 4NDXA 2DY8A 5C0XH 4KI0A 2E2DC 4HTHA 1YNXA 2JEAI 1ET9A 4U68A 1Z7TA 3CC4A 1S5FD 1T5EA 1N32L 3PUVA 1XTCD 3I4OA 1BBWA 4UHVA 3RLFA 4WRDA 3UI2A 2VB2X 2ZXOA 4IALA 4IPHA 2B2VC 5JJIA 5D3IB 3FRPB 4UP8A 3S1MB 4NXMQ 2NVXH 2HIVA 1NMGA 2A5HA 4JI2Q 1B4OA 3CXCA 3NWSA 3LWEA 5DM63 4K5VA 3KLSX 1FGBD 2ALYB 2CW0C 4N8X1 4DV4Q 3UDXA 2BA1A 2CW0D 2B2TA 5IP9G 2NUCA 2QA4A 2FJ2A 5H1SE 1UE5A 3S14B 3AEVA 3VR3A 1MI2A 4A93G 5CV5A 1CKNA 1YVCA 4DV3Q 1B1ZA 1BKBA 4HN7A 3J80L 2WFWA 4CGYB 4GOPA 1H9SB 2VB3X 3A56A 1DYQA 5G3LD 1IKMA 3VYRA 1HZCA 1Y1VH 2HT1A 1FVIA 4DV2Q 3TS2A 3S1RH 2BOSA 4DK0A 1PV4A 1SMXA 1Y1WG 2KHIA 4CDDC 4IOAA 1JOOA 4DR2L 1BBUA 1V1QA 5EBCA 3MZ5A 1Q46A 2B63H 1DONA 4NKLA 4KD3A 5C4XG 3MFGA 2ES2A 4JOIC 3RR5A 1WTXA 4GNXC 4AQYL 4F88A 3I3CA 3KUPA 1MJCA 2OTJA 4K5XA 3T1YL 2HDLA 1GJXA 1N8RC 3FKIG 1WYDA 5KNBA 3HOUG 3I72A 2JA6G 4ZKCB 2NVQB 4XIGS 4TKOB 2O4XA 2KVMA 1A6XA 3NEMA 1A8VA 2M9VA 3F2DA 1N36L 1BQQT 4OEMB 1RHPA 2L4NA 2VQFL 4KV6A 1EEFD 3OWEB 4ZUIA 1BF4A 1KDCA 3HOZG 1LV9A 3HKZB 4H44C 2EYMA 1B44D 1HTLD 1X6OA 2Z1CA 1UE7A 3IAYA 4UP7A 3GV3A 3CP0A 1TWCH 3A54A 2WB1B 3PF4A 2OTLA 2F3IA 3GTJH 1R9TH 5K5PA 1CKNB 1TVXA 2YTVA 3HGBA 3FVQA 3I55A 5EJWA 4LFAL 2IHFA 2UUBL 4RKLA 1F9PA 1M4VA 4GS3A 1RIPA 2CFMA 1KTKA 1XMOQ 2CQAA 3E0EA 5LMNL 2Z9HA 2JA8B 1D7QA 4L5TA 2EYJA 1A3TA 3OSOA 2KCNA 4HSPA 4YHHL 1YEZA 3K0YA 4O1NA 4IUQA 3FHWA 1BCPC 1X56A 1PZKD 1K8MA 3D8GA 3ZJYC 1QILA 2A8VA 3K8AA 4B3TL 4HMIA 1QNKA 1X54A 4KY6A 1ENFA 4IJHA 1FNVA 3HFZB 4IUPA 4OXPA 3STBD 2R7FA 1KLUD 4HJ7A 2ZXPA 3U50C 4IUVA 4F8MA 2DY7A 1X3QA 1L1OA 4CBVA 1LM0A 1WTPA 2ID0A 4DAMA 4CKEA 1Q3LA 3AYHB 1EYGA 1F2MA 1PFBA 4DUZL 4A3CH 1SYBA 5IP9H 3IKJA 2Q2HA 1WD1A 3GTKH 3ND9A 1CKOA 1OXTA 4R4QA 1KHIA 2GA4B 3CCSA 3BZCA 4A93H 1E22A 1CSQA 4LW1A 2FXQA 2AWNA 3Q8DA 2MUYA 3S9WA 4JI6Q 2FMCA 1KRSA 1EY0A 5IGDA 2VXWA 1RDPD 4R8NA 1H9JA 1HQRD 2FINB 4A3JG 3J81c 4H7BA 2YTXA 2A74C 4DN4M 4ULLA 3J81E 2F4VQ 4GKKQ 4OIJA 1PTOC 4JC0A 2PNRC 2E5LQ 3MTSA 1OO9B 1JWSD 1S5BD 3MA2B 3OW7A 1Y1WH 1VQEA 4YY3L 2L1BA 1ZKOA 4DR6Q 2BE5D 4RG1A 5C4XH 3HOWB 2PQEA 2EE1A 2SEBD 4BXXG 3JC66 1DOKA 3T13A 1T9HA 1SYEA 3GTLH 1TQOA 3PF5A 3G7LA 2YU9B 1XNQQ 1S40A 3R2TA 2E2JH 3FKIH 1XNRQ 3X3NA 4P2CB 2K28A 1T5XD 3T16A 3HOUH 5LHY1 4LF5Q 2JA6H 1RD9D 4LF6Q 1EWIA 2RHSB 5M5YH 1X3EA 2TSSA 1N9WA 1OTCA 3QO2A 4RGTA 4ME5A 1ET6A 1L1OB 1VQ7A 3HOZH 1PZID 4MZ9A 3PUYA 1EZ6A 1PRTC 1FGUA 4HCSA 5IGCA 4OWWB 2DUDA 2JXMB 1HNZQ 4QIWB 4Y7NH 4IFDG 4ZK9B 1V9PA 1EQVA 4L63B 2QKIC 4I65A 4HIDA 3CRKC 4MNOA 2K6AA 4DV6L 2WB1G 2E76C 2F0TA 1VQ6A 1E3PA 1RKNA 1PZJD 4DV0Q 4R4IA 3F2UA 3GTMH 2Z0SA 1K3BC 2WV6D 3K7UC 3A0JA 1SEBD 1BOSA 2F3WA 3DEPA 2B39A 4J8QA 1GOZA 2QDLA 4JBWA 2VNUD 3TRZA 1XPRA 5ELCA 2NBFA 1LTID 3R93A 2MO1A 3HRZC 3R3OA 1WCMB 3GQBA 2WKDA 4JPBW 1JC7A 3K5OA 5LMUL 2F0HA 4B08A 2EXZA 3J7AF 1Y8PB 2F0SA 1Q8KA 5DEHA 5JEAG 1O7IA 5CV7A 4WJ3M 1YJ9A 3S1MH 2WB1E 1MJEA 1E2VA 4CDEC 4UAIA 2VQEQ 1WI5A 1VF7A 3KJPA 2B3GA 2F0EA 5KYLA 2WINB 4OO1I 1PFNA 3A55A 3NBIA 1SYFA 1TS2A 2B2VA 3CCLA 1SAPA 3UDFA 1G2SA 1B7YB 2NVTB 1PTOH 4XYOA 1PVOA 4TSSA 3MXGA 5AJ3L 3S14H 3J81i 4O0AA 3OTOL 1IL2A 2XTIA 4JYAQ 2QW7A 4PZ7A 3P7JA 4WORA 3SR1A 1HNXQ 4XQNA 5C0XI 4JV5L 2B8GA 2B2UC 2Z6KA 5C44B 2VY3A 1D8LA 2RA4A 4RKBA 5CV8A 4KK7A 4X66Q 4HIOA 2Y0SB 4G7OC 3S24A 3BG3A 4B9WA 4DR1Q 4LF9Q 4A3JH 1I94L 4LNQA 3KFUA 2IW3A 3K81C 4APVA 2B63B 2BH8A 4O2DA 1JWUD 3MEHA 5EPKA 4Q0FA 1Q82C 5CYUA 3W1BA 1QNUA 4DR5Q 2QGQA 2F0VA 3SGIA 1N33L 4BXXH 2LKVA 2AUJD 1KL9A 3VYSA 1IW7C 4HJ9A 3RN5A 3HOWG 1IW7D
chains in the Genus database with same CATH topology
2JA7B 2HQEA 2QILA 4A3IB 2C5CA 4A3BB 1CFMA 4BWGB 3IL8A 3MHBA 3NBHA 1BCPF 5DNFA 5EBDA 3MVVA 3GTQB 3SXHA 3K6OA 1Q8IA 3I90A 1OXXK 3S16B 1TWAB 1JR0D 1SNQA 1J9OA 4U673 5FKAC 1DZ1A 1GHJA 4IFDH 2EDGA 1RF2D 3N52A 4C1NK 2QEJC 1PYWD 3KLSA 3HEJA 4C3HB 4KTAA 2D5DA 3DWAA 1WTVA 2EYPA 1Y8NB 2IL8A 1Z47A 1CQFA 3HOVB 3JAME 2Q8RE 3AMUA 1HFGA 1ENCA 1EYAA 1SNPA 3EA6A 3BVMA 4DFAA 1WD0A 4N9PA 5IT9E 4EQNA 4G7HC 3A8JE 5I6WA 4QCLA 3I91A 3D31A 4FYDA 1PTOF 2F0IA 3TZUA 2H4OA 4HSVA 1LTSD 5CV9A 4DNTB 2K01A 1D5XC 1O7LA 1TIID 2NB0A 1D1IA 5FK9C 1HA6A 1SYDA 2PYKA 3DXJC 4K6DA 3CQZB 3GTOB 4CJ1B 2K5QA 4K2KA 3S15B 3ITPA 2IT1A 5KEEA 5CMDA 1JOQA 1DM0B 2KJXA 4HR7B 2L9HA 5I9OA 1AW7A 1SDFA 1DJRD 2A6EC 4OIKA 5I2YA 3DWQA 2DNCA 2A6ED 1TS5A 1EY7A 1GUNA 5FO9B 1FYCA 2D2CC 1JICA 3S2HB 1PRTF 4XT1B 1CK1A 2OT2A 4H13C 1TKWB 1GUWA 2NTSA 5EKLA 3X3MA 5CBAE 2M2LA 5C4JB 1FNUA 5C3WA 2K5WA 1EWHA 1PDQA 1ZEQX 2F0GA 3BS1A 1R4PB 1SJED 1YNJC 4CHTB 1EWCA 3PIP3 3TMEA 4C3IB 4ZYSA 2RSOA 4X3UA 1E0BA 3HOZB 2IX0A 1WTRA 3CU7A 2F0WA 2B2WA 1KDBA 1BDOA 2F0PA 2NZ1D 3I8ZA 5J22A 1BCPB 1MSGA 3U9SA 2F0KA 2N55A 1IYUA 3ND8A 4FVMA 1DD2A 3TN2A 1S5ED 4FF2A 4NW2A 4ZKBB 1B53A 4YIJA 4C3HG 4DA2A 5C6AA 3HZXA 4G7ZC 1Q1BA 1PMRA 2PO4A 1LO5D 2JEBI 1TWHB 1R4QB 3C1EA 3VR4A 3T51B 1EU3A 2F1MA 4RCNA 2KOLA 4BA1I 2XWJB 5M5WB 1FD7D 2M00A 4BY7B 1EY6A 5C4HA 2J7ZA 1ILPA 2KECA 3A8IE 5ELEA 2QF7A 3GTGB 4ID6A 1PTOB 4A3KB 1AZPA 2MGSA 4OHJA 4IZ8A 3KLRA 3A7LA 3HS0C 2L55A 2E74C 3MWYW 1SE3A 5EKIA 3DHQA 1H9KA 3I70A 5CV6A 1JB3A 5KYIA 3N6RA 3K58A 4A3JB 2E75C 3T53B 1AP0A 1BBXC 4RFBA 1NR4A 1F2LA 4KJNA 4MHEA 5D14A 3TSSA 1STBA 1I4XA 2E2IB 5LL6S 5A35A 1O80A 2B2UA 2SNMA 4V190 1W6KA 3PUXA 4G4KA 3KBGA 1D2BA 4QUFA 1PRTB 1HXYD 4WJWA 2F0MA 3WOFA 1JE4A 2R3ZA 5FLXE 2QDBA 2X69A 2A6HD 4EGVA 1F77A 4FF1A 1AN8A 4QF4A 1B2TA 1Z6HA 4NP5A 4J1MA 1HRJA 1LT3D 1SNMA 3D4WA 4C3IG 5EGTA 1STEA 5BN5A 4IFDJ 2L11A 3DUZA 3K5LA 2KEDA 2XWBB 5JAVA 2O2LD 1ILQA 4FF4A 3S1QB 2JP1A 3NUCA 3EJIA 3IFDA 1V8QA 3QJYA 5E1FA 2D9UA 1CT1D 2KA7A 3SE0A 2PZWA 3BDCA 1SFOB 1LTGD 3D4DA 1ZYRD 1RCVD 1F9SA 2MJ8A 5C3EB 2KHSA 3DWPA 2SDFA 5I6YA 3D6WA 3Q22A 1F9QA 5JEAJ 3BZDB 5FOBB 4MN3A 2V4DA 3PO3B 1NUCA 2R93B 2L0CA 3M3YB 1CI3M 3FMCA 2CVRA 1TY2A 5M3MB 3P20A 1LT6D 5EPJA 1KNAA 4CKBA 1B9MA 1F2ZA 4BY1B 4IFDI 5F2DA 1B50A 2XRQD 4DXGA 5EKKA 4J6HA 4DNRB 2F4IA 5COYA 3P1HA 4S3SA 4RH6A 5J39A 1U4RA 2E2HB 1UUPA 3H0GB 5HURA 2I07B 1C8CA 4G57A 2LFNA 5CC4A 1OXSC 2BE5C 4UDUC 2XVSA 3S2DB 3SDZA 2AUKA 5JVG3 2K33A 1V43A 2EYHA 3K5MA 1TR5A 3ONAB 4A3FB 2J0TD 5D3DA 2JA5B 2EYOA 1D5MC 1GUGA 3SHLA 3ERQA 2RKSA 5T1IA 1QB5D 4K6LA 4EQOA 1M8AA 4FP5D 2A73B 1O7ZA 3J81L 2OF1A 5KNDA 4OGQC 3BVGA 3TP7A 4NMZA 1V1OA 1EY8A 3FPUB 2L5TA 4Q5VA 1SNOA 2WIIB 1KNEA 1ICWA 4K5WA 1SSOA 2EJFC 4AYBB 5BN4A 5G3LF 4ILWA 2B8FA 4KHVA 2D62A 4KN4C 3CKIB 1CHQD 2NWGA 3VR6A 1JORA 3PUZA 1LTRD 3WDNA 3MXNA 4C56C 3FPPA 1JWMD 2F0FA 2LMCB 5NUCA 4EVOA 3S1NB 3BYTB 2PCFB 4TRDA 3EQLC 1DXMA 3OIQA 1UEAB 3W3AA 3LNNA 4RGNA 5TSSA 1NCVA 1CHPD 2JYOA 2OEOA 1ZXTA 2EY5A 3C1FA 4DAPA 2G9HD 3SVMA 4R8IA 5IGBA 5E3FA 3NE5B 1WVLA 1EFID 1TWFB 1E2ZA 3T56B 1GUTA 5DM73 3BDOA 1WTQA 4L8JA 1F2YA 2XN9C 3PO2B 2ZT9C 5IGEA 2IPKD 1X3PA 4BBSB 3GD7A 3HOYB 2R92B 3H3VC 5M5XB 2B2YC 2O5JC 3L9AX 4K8JA 4A3MB 2F3VA 5T1GA 3H94A 5K36G 1I4QA 1SNCA 2WAQB 2L12A 5CR3A 1HA5A 4X3KA 2ICEC 3OWFA 4F7XA 2F0QA 2BCOA 1G91A 1B3AA 3PV0A 1I50B 4XYQA 3J7YW 2FMMA 4FNFA 5C3XA 1NAPA 1HUMA 3HOXB 1WTWA 3URYA 2PW5A 5ISRA 5A2QE 4KN7C 2QCPX 3LWUA 3HG9A 2F0LA 2NTTA 2VUMB 1I4RA 1Q12A 1TT2A 1EU4A 1TWGB 2AQ1B 5JOBA 1JOKA 2EYFA 1I3QB 2NVYB 1U9RA 3OMGA 1QCBD 3BDLA 2LS01 3WOEA 2EZVA 2IX1A 4A3DB 4H0LC 2RDHA 5JEAH 5JPMC 3T4AC 2R61A 1BUVT 1VCIA 4CJ2C 3C46A 3SK5A 3J7AV 3VYTA 1H9MA 3OPOA 3R2IA 2Q8IB 4PMWA 1SMYD 5KGUA 3RUZA 3ZYYX 1C4QA 2IX3A 2EJMA 3K7AB 1I4PA 4IUUA 4FXKC 1CQVA 4OL7A 2AQ2B 1CTMA 4RHSA 4XTCS 1IKLA 3JAML 3A7AB 2KEEA 4FF3A 3DM1A 4R9WA 4M1UB 2OXPA 5IT9L 3GP7A 1BO0A 2SOBA 3NSWA 5M9OA 1XYIA 1MBYA 2R6GA 2BA0A 4PQXA 1Y69U 2HCIA 3VR2A 1K8OA 4XT3B 3RZDB 4WFN3 1S4ZA 4LK1C 3H91A 3OOCA 3R8BA 4KKUA 3KF8A 1U4MA 1X32A 5EPLA 1II3A 1BNZA 1SE2A 2N88A 4HEDA 4M8AA 1LTTD 1PLFA 5JPNC 1KABA 3TP8A 5FO8B 1HCZA 1I6HB 2RDGA 1A2UA 5EQ0A 5IGFA 1U4LA 1V1PA 3OHXC 2IJ0A 2H1EA 1VMCA 3J80E 1LLRD 1K83B 2SNSA 2EPBA 4DF7A 2PPBC 2BDOA 1H9RA 2WKCA 3L3OC 2HUGA 3H09A 3QG1A 4X3SA 4MIUA 2MPMA 1QE6A 1RODA 1CM9A 4C2MB 2R7ZB 1G8ZD 4ABNA 2CHBD 2F0JA 3GV6A 2PMZB 1I4GA 5IODA 4LJZC 4PV1C 4KD4A 3NPPA 3VR5A 3TZDA 1D1KA 3OIPA 1SNDA 4Z9CB 4O42A 3I4MB 4IURA 2EVBA 2F0NA 1CZGA 3SK6A 1IHZA 1LT4D 1O78A 2X6LA 2XRSD 4PMCA 3V05A 3CHBD 3VA7A 1XX8A 1IYVA 1KDAA 1BXTA 4TQUS 3U9OA 1V1PB 3BYYB 3AU7A 1STNA 4K14A 3QIAA 2A6HC 4A3EB 1EYDA 3V2TA 2EJGC 1NSNS 3E0JA 1ESRA 1D5ZC 4XQJA 1G6ZA 4L6TB 5I2XA 4HCEA 2YYZA 5IOCA 1TS4A 2EOTA 2F0UA 4ZAIA 2B2YA 5M3FB 3S17B 2FFKB 1ESFA 3M4YA 1HQMC 1A15A 3NQTA 1CA5A 1ZYRC 1HTPA 1G2TA 2F0DA 4DU9A 4E6IA 2EY6A 1EY9A 4IUNA 2ZXRA 4HAEA 2O5IC 4DK1A 1MSHA 4A3GB 1QG7A 5FLXL 2RBMA 1Q1EA 4LAAA 2PW7A 2WACA 5D65A 3MFYA 4C3JB 5AFWA 5LL6X 1LTBD 4V0BA 4B9XA 2F0OA 1QJOA 4KKTA 5J1ZA 3D4RA 3Q24A 1BCPD 2AWOA 3NP8A 4CKCA 3GTPB 3MAQA 3EVQA 2C9OA 4PNYA 1TS3A 1J8IA 1WTOA 4RGMA 1STAA 3RZOB 4BBRB 1EOTA 3NQIA 2XIWA 2DN8A 1LTAD 4XXEA 1QWYA 4FO2A 2EY2A 3QWNA 3V96A 1STHA 5HGTA 1A2TA 1JCKB 1CA6A 1O7YA 3QOJA 5I9PA 1B9NA 1LABA 3NTIA 1SXTA 3M4OB 1PTOD 2ICIA 1QOHA 3TDQA 5KIXA 3SK8A 1RJTA 1W6JA 1C48A 4ZUJA 2RQXA 3KK7A 2BDNA 2B2WC 1EZ8A 4KHZA 3NTHA 4N9TA 1I4HA 4QB4A 4BA2I 3C2PA 1SYCA 3DMUA 3D6CA 2K03A 4ODGA 2J4XA 2NN6I 1SBBB 1L0YB 2TMPA 4XQQA 1EYCA 1I6VC 2XSCA 3RMHA 3C3LA 1PRTD 3I4NB 4ZQ3A 3GO5A 4HMJA 4K8IA 4LMQD 1HUNA 1D6EC 5C0XJ 2K5DA 3H6MA 3E6ZX 3P75A 5CGKA 4KKSA 4K2LA 3K5NA 4IQZA 2JSOA 1MD2D 1U4PA 4KY7A 3NHHA 3FDTA 3VA5A 4C3JG 1STGA 2B2TC 2NVXB 2Z4IA 2I46A 5CBEE 1E2WA 4BS9A 4KY5A 1DCZA 4FXGC 2K32A 1VDZA 3QOLA 2XNAC 3TP5A 4F87A 2A69C 2K7VA 3NTKA 1FR3A 4RHRA 2A69D 3NWTA 3M7GA 1F9RA 1IL8A 3SEBA 1RTNA 4ZLTF 3K57A 4FXDA 2FHTA 3RD4A 5ELBA 2HCCA 3PIO3 3O13A 5I4DA 2EYLA 3NK9A 2NN6G 1A3VA 5BN3A 1Y1VB 1LACA 1SYGA 3S1RB 5C5LA 4DAYA 1VF5C 2RVLA 4RA8A 2HDMA 1JQYD 1AEXA 3L7ZC 1OXUA 1OXVA 1S5DD 3Q0AA 5DAUA 2RDFA 4EQPA 1AFPA 5ELDA 4X3TA 1DOLA 3EFXD 1EY4A 5KNCA 4IUTA 4ZRZA 4DGZA 1NR2A 3PUWA 5IGGA 1EIGA 1ML0D 1HHVA 1KAAA 2EY1A 2PZTA 3I4LA 5JVH3 1G291 4QUCA 4GZYC 2K04A 1MGSA 1STYA 3M85A 1GXDC 1TWCB 2LY7A 3I73A 3A8KE 2DNEA 4OO1G 1R9TB 3GTJB 2RSNA 1YNNC 4DAVA 3Q23A 3CRLC 3DEOA 4QMGA 1Y8OB 1YNND 3VYUA 3BVZA 5C4ZA 1TY0A 1VMPA 3AB9A 3M7NA 5C0XG 1GUOA 1RTOA 2WP8J 1ONLA 3Q6SA 1EL0A 3IFTA 1FNWA 1SMYC 1PXUA 4CJ0B 1SJHD 5E4WC 2KUMA 2IWHA 3W2DA 4I7ZC 3LX0A 2MP1A 3D3RA 1GUSA 4IN3A 2F03A 1EIHA 1HPCA 1EEID 3GTKB 2A68C 4DXFA 4XDXA 5A2QL 2G9DA 2A68D 3NXWA 1PFMA 4A93B 1CZWA 1EY5A 1A3UA 3TBIB 3MXPA 1XXGA 3G6JB 1EQTA 5ELFA 2PZUA 3KBXA 1TU2B 5JJZA 2NN6H 5KRUA 1ENAA 3HP3A 5IIFA 1UNSA 2JE6I 4RWSC 1Y1WB 2KQ3A 2K1BA 4KJOA 2MHVA 1HFNA 1S5CD 5C4XB 3EROA 3GTLB 5CV4A 3FEWX 5FO7B 1Q90A 5K36H 2E2JB 3FKIB 3K59A 5CORA 3SK4A 2KCCA 3HOUB 2AQ3B 2JA6B 4RCOA 4C1NI 5M5YB 3E5SA 2ENBA 3MC0B 4PMBA 2X6GA 1YNJD 4JK1C 1H9SA 1KLGD 2NYZD 2Z4HA 2Q8TA 4Y7NB 4RGOS 4RAUC 1DOMA 4OO1H 1BR9A 2K05A 5E4XA 1L0XB 1XWEA 3PMFA 1LT5D 3QB3A 1GHKA 3GTMB 1SE4A 1AZQA 5C5MA 1UAPA 2Z8LA 4KMUC 3MXUA 3TP6A 3OMCA 4NDXA 2DY8A 5C0XH 4KI0A 2E2DC 4HTHA 2JEAI 1ET9A 4U68A 1Z7TA 1S5FD 1T5EA 3PUVA 1XTCD 3RLFA 4WRDA 3UI2A 2VB2X 2ZXOA 4IALA 2B2VC 5D3IB 3FRPB 3S1MB 2A5HA 1B4OA 3NWSA 3LWEA 5DM63 4K5VA 3KLSX 1FGBD 2CW0C 2BA1A 2CW0D 2B2TA 2NUCA 2FJ2A 3S14B 3VR3A 1MI2A 5CV5A 1B1ZA 3J80L 4HN7A 4CGYB 1H9SB 2VB3X 3A56A 1DYQA 5G3LD 1IKMA 3VYRA 2BOSA 4DK0A 1JOOA 5EBCA 3MZ5A 1DONA 4NKLA 4KD3A 3MFGA 1WTXA 4F88A 3I3CA 3KUPA 4K5XA 2HDLA 1GJXA 5KNBA 3I72A 4ZKCB 2NVQB 4XIGS 4TKOB 2O4XA 2KVMA 1A6XA 2M9VA 1BQQT 1RHPA 2L4NA 4KV6A 1EEFD 3OWEB 4ZUIA 1BF4A 1KDCA 1LV9A 3HKZB 4H44C 2EYMA 1B44D 1HTLD 3IAYA 2Z1CA 3GV3A 3A54A 2WB1B 5K5PA 1TVXA 3HGBA 3FVQA 5EJWA 4RKLA 1F9PA 1M4VA 1KTKA 2CQAA 2JA8B 2EYJA 1A3TA 3OSOA 2KCNA 4HSPA 3K0YA 4O1NA 4IUQA 1BCPC 1PZKD 1K8MA 3D8GA 1QILA 4HMIA 1QNKA 4KY6A 1ENFA 1FNVA 4IUPA 1KLUD 2ZXPA 4IUVA 4F8MA 2DY7A 1X3QA 4CBVA 1WTPA 2ID0A 4CKEA 1Q3LA 1F2MA 1PFBA 1SYBA 3IKJA 1WD1A 3ND9A 1OXTA 2GA4B 2AWNA 3S9WA 2MUYA 2FMCA 1EY0A 5IGDA 2VXWA 1RDPD 4R8NA 1H9JA 1HQRD 2FINB 4H7BA 4DN4M 2A74C 3J81E 4ULLA 4OIJA 1PTOC 2PNRC 3MTSA 1OO9B 1JWSD 1S5BD 3MA2B 3OW7A 2L1BA 1ZKOA 2BE5D 3HOWB 2PQEA 2EE1A 2SEBD 1DOKA 3T13A 1SYEA 1TQOA 3G7LA 2YU9B 3R2TA 3X3NA 4P2CB 2K28A 1T5XD 3T16A 5LHY1 1RD9D 2TSSA 3QO2A 4RGTA 4ME5A 1ET6A 1PZID 3PUYA 1EZ6A 1PRTC 4HCSA 5IGCA 2JXMB 4QIWB 4IFDG 4ZK9B 1EQVA 4L63B 2QKIC 4I65A 3CRKC 2K6AA 2E76C 2F0TA 1RKNA 1PZJD 3F2UA 2WV6D 1SEBD 1BOSA 2F3WA 3DEPA 2B39A 4J8QA 1GOZA 4JBWA 2VNUD 5ELCA 2NBFA 1LTID 3R93A 3HRZC 3R3OA 1WCMB 3GQBA 2WKDA 1JC7A 3K5OA 4B08A 2F0HA 2EXZA 3J7AF 1Y8PB 2F0SA 5DEHA 5JEAG 5CV7A 1E2VA 4UAIA 1VF7A 2F0EA 5KYLA 2WINB 4OO1I 1PFNA 3A55A 3NBIA 1SYFA 1TS2A 2B2VA 1SAPA 1G2SA 2NVTB 1PTOH 4XYOA 4TSSA 3MXGA 3P7JA 4WORA 3SR1A 4XQNA 5C0XI 2B8GA 2B2UC 5C44B 2RA4A 4RKBA 5CV8A 4KK7A 4G7OC 2Y0SB 3BG3A 4B9WA 2IW3A 2B63B 1JWUD 3MEHA 5EPKA 4Q0FA 5CYUA 1QNUA 2F0VA 2LKVA 2AUJD 3VYSA 1IW7C 1IW7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBE E;  1G6Z A;  1SDF A;  2J7Z A;  2RSN A;  1QNK A;  3ONA B;  4OIK A;  1ILP A;  2KEC A;  2D9U A;  3DEO A;  4IUP A;  1WVL A;  2H1E A;  1VMC A;  1CA6 A;  1IKM A;  4IUV A;  2DY7 A;  3IL8 A;  1X3Q A;  1JIC A;  1VMP A;  1O7Y A;  3F2U A;  4XT1 B;  1WTQ A;  1WTP A;  2EOT A;  1AZP A;  5T1I A;  2MGS A;  5DNF A;  2EPB A;  1Q3L A;  1F9S A;  1PFB A;  2MJ8 A;  4ZAI A;  1GUW A;  2B2Y A;  1F9R A;  1WD1 A;  1RTO A;  1IL8 A;  2SDF A;  2X6G A;  3DEP A;  1M8A A;  3Q6S A;  1EL0 A;  1RTN A;  4IUU A;  4ZLT F;  3D6W A;  5CBA E;  1F9Q A;  1X3P A;  3MWY W;  1O7Z A;  3I90 A;  5EKI A;  2HUG A;  2FFK B;  1DON A;  2M2L A;  3R93 A;  2FHT A;  2NYZ D;  4X3S A;  2Q8T A;  4MN3 A;  1WTX A;  2MPM A;  4RAU C;  1QE6 A;  1ROD A;  1IKL A;  1A15 A;  1J9O A;  1DOM A;  2KEE A;  1RJT A;  1CM9 A;  3I3C A;  3DM1 A;  3KUP A;  1CA5 A;  2B2Y C;  1AP0 A;  2HCC A;  1BBX C;  4CJ0 B;  4R9W A;  2CVR A;  2VXW A;  1DZ1 A;  2HDL A;  1NR4 A;  1G2T A;  1F2L A;  3N52 A;  5E4W C;  2KUM A;  2K05 A;  4MHE A;  5EPJ A;  5T1G A;  3GV6 A;  5D14 A;  1BO0 A;  5E4X A;  1KNA A;  1PDQ A;  2L12 A;  3FPU B;  1WTV A;  4UAI A;  1XYI A;  2FIN B;  2IL8 A;  2BDN A;  2MP1 A;  4DN4 M;  4ZK9 B;  1AZQ A;  1KNE A;  1ICW A;  2B2W C;  1SSO A;  4HAE A;  4X3K A;  4ZKC B;  4OIJ A;  1MSH A;  2HCI A;  1QG7 A;  1EIH A;  4XT3 B;  1PFN A;  2RSO A;  2KVM A;  1E0B A;  4X3U A;  2Q8R E;  3MTS A;  1HFG A;  3TZD A;  1B50 A;  2DY8 A;  4XDX A;  1WTR A;  2RVL A;  1G91 A;  1B3A A;  2B2V A;  4O42 A;  1O80 A;  1SAP A;  1G2S A;  1RHP A;  2B2U A;  2L4N A;  1PFM A;  2L1B A;  5COY A;  4RA8 A;  4U68 A;  1S4Z A;  2HDM A;  4IUR A;  1WD0 A;  2B2W A;  2K03 A;  1BF4 A;  3I8Z A;  2FMM A;  2NZ1 D;  5D65 A;  1LV9 A;  3I91 A;  4R8I A;  4QUF A;  3H91 A;  5AFW A;  2EE1 A;  2NWG A;  3UI2 A;  1NAP A;  1EQT A;  1JE4 A;  1HUM A;  1DOK A;  1MSG A;  2R3Z A;  3P7J A;  1WTW A;  2B2V C;  4X3T A;  3GV3 A;  1DOL A;  1U4R A;  2X6L A;  2N55 A;  3G7L A;  2B2U C;  2X69 A;  3KBX A;  4IUT A;  1B2T A;  5JJZ A;  1U4M A;  2RA4 A;  3TN2 A;  1NR2 A;  4HSV A;  4NW2 A;  1B4O A;  1X32 A;  1B53 A;  1XX8 A;  5EPL A;  1TVX A;  2K01 A;  2K28 A;  3LWE A;  4ZKB B;  1C8C A;  1BNZ A;  1HRJ A;  3HP3 A;  1EIG A;  2N88 A;  5EJW A;  4LMQ D;  1ML0 D;  4HED A;  1HHV A;  1J8I A;  1F9P A;  4RWS C;  1WTO A;  1HA6 A;  2K1B A;  1HUN A;  5EPK A;  4CJ1 B;  2B2T A;  1HFN A;  2FJ2 A;  4QUC A;  1PLF A;  2K04 A;  3QO2 A;  2KOL A;  1MGS A;  2L11 A;  1EOT A;  1MI2 A;  5CMD A;  2KED A;  1NCV A;  1U4P A;  2XIW A;  4IUQ A;  1ILQ A;  2JYO A;  4HCS A;  1ZXT A;  2JP1 A;  3FDT A;  4CJ2 C;  2L9H A;  2B2T C;  3IFD A;  1ESR A;  3SVM A;  5EQ0 A;  5COR A;  1U4L A; 
#chains in the Genus database with same CATH topology
 2L15 A;  2HQE A;  2KHJ A;  2JA7 B;  2QIL A;  4A3I B;  2C5C A;  4A3B B;  1CFM A;  5IE8 A;  3IRB A;  2UUA L;  4BWG B;  3IL8 A;  3MHB A;  3NBH A;  4MTK A;  1BCP F;  4JOI A;  4A3F G;  2P5Z X;  3ULL A;  5DNF A;  2NVQ H;  4GNX A;  5EBD A;  3B6Y A;  3MVV A;  3CPW A;  3GTQ B;  2IY5 B;  3ULJ A;  3SXH A;  4CDF C;  3TQY A;  4R4T A;  3K6O A;  1Q8I A;  3MXN B;  1EQQ A;  3I90 A;  1OXX K;  3S16 B;  1SR3 A;  4JI4 L;  1TWA B;  1JR0 D;  4NXN Q;  1SNQ A;  1J9O A;  3TEH B;  3CD6 A;  4U67 3;  4ZCK A;  5FKA C;  4B3S Q;  1GHJ A;  4IFD H;  2EDG A;  4P75 A;  1DZ1 A;  1RF2 D;  2K5N A;  3N52 A;  4C1N K;  2QEJ C;  1PYW D;  3KLS A;  3HEJ A;  4C3H B;  4KTA A;  4AIM A;  2D5D A;  3DWA A;  1WTV A;  2EYP A;  2UU9 Q;  1Y8N B;  2IL8 A;  1Z47 A;  1YI2 A;  1CQF A;  3HOV B;  3JAM E;  2Q8R E;  3AMU A;  1HFG A;  1ENC A;  1EYA A;  5FLM G;  3KDF A;  1SNP A;  3EA6 A;  3BVM A;  4DFA A;  1WD0 A;  4N9P A;  1LYL A;  5IT9 E;  4EQN A;  1HH2 P;  4G7H C;  3A8J E;  5I6W A;  4QCL A;  3I91 A;  3D31 A;  2JA8 H;  1VS0 A;  4K0K Q;  4FYD A;  3CCQ A;  3BZK A;  1PH7 A;  4JI2 L;  1PTO F;  1WCM G;  2ZTE A;  3RNU A;  4QIW E;  2F0I A;  1DGS A;  3TZU A;  2H4O A;  4HSV A;  1E7Z A;  1LTS D;  5CV9 A;  4DNT B;  4DV4 L;  2K01 A;  1HNW L;  4EQ5 A;  1HZ9 A;  1D5X C;  1O7L A;  1TII D;  2UXD L;  2NB0 A;  1D1I A;  5FK9 C;  1HA6 A;  1SYD A;  2PYK A;  4P72 A;  3DXJ C;  4K6D A;  4AH6 A;  3CQZ B;  3GTO B;  4GN3 B;  4CJ1 B;  1UEB A;  2K5Q A;  4K2K A;  3S15 B;  3ITP A;  2YV5 A;  1VQO A;  2IT1 A;  5KEE A;  5CMD A;  3NBH B;  1JOQ A;  1DM0 B;  2KJX A;  3J7Z C;  4GNX B;  1MKH A;  4HR7 B;  2L9H A;  5I9O A;  1WTH A;  1AW7 A;  4JI5 Q;  1SDF A;  1DJR D;  2A6E C;  4OIK A;  1X3F A;  3DWQ A;  5I2Y A;  2N78 A;  4DR3 Q;  4OX9 Q;  2DNC A;  2D0O A;  2A6E D;  5C44 G;  4DV2 L;  1TS5 A;  1EY7 A;  1GUN A;  2OQ0 A;  5FO9 B;  4GLA C;  1FYC A;  1E1T A;  2D2C C;  1JIC A;  3S2H B;  1PRT F;  4XT1 B;  1CK1 A;  2OT2 A;  4H13 C;  1TKW B;  1GUW A;  4ALP A;  2NTS A;  5EKL A;  3X3M A;  5CBA E;  2I5M X;  3AFQ A;  2M2L A;  1NTG A;  1FNU A;  5C4J B;  5C3W A;  3F2C A;  4JI3 Q;  2K5W A;  3KDF B;  3HOW H;  4B3M L;  4TVA B;  3HOY G;  1UWV A;  2JA7 G;  4LFC Q;  1EWH A;  2R92 G;  2YU9 H;  1PDQ A;  1ZEQ X;  4OON A;  4A3I G;  2F0G A;  3BS1 A;  3W1G A;  4A3B G;  1R4P B;  5GAE C;  1SJE D;  1YNJ C;  4CHT B;  1EWC A;  3PIP 3;  3TME A;  4C3I B;  4ZYS A;  2RSO A;  4X3U A;  1E0B A;  1M1K C;  3HOZ B;  2IX0 A;  4POF A;  1WTR A;  3CU7 A;  2F0W A;  2B2W A;  2V1C C;  1KDB A;  1BDO A;  2F0P A;  2NZ1 D;  3I8Z A;  5J22 A;  1Z9F A;  1BCP B;  2A19 A;  2CKZ B;  1MSG A;  3U9S A;  3JAM i;  2F0K A;  4KLK A;  2N55 A;  1IYU A;  1Q81 C;  3ND8 A;  4FVM A;  5J3B A;  1DD2 A;  3TN2 A;  3F2B A;  1S5E D;  4FF2 A;  4NW2 A;  4ZKB B;  1B53 A;  5IYC G;  4YIJ A;  4C3H G;  4DA2 A;  3U4Z A;  5C6A A;  1XMO L;  3HZX A;  4G7Z C;  1Q1B A;  1PMR A;  2LXJ A;  2PO4 A;  1LO5 D;  2JEB I;  1TWH B;  1R4Q B;  3C1E A;  3HOV G;  5FLM H;  3VR4 A;  2CH4 A;  3T51 B;  3J80 c;  1EU3 A;  2VUM G;  1H95 A;  2F1M A;  4RCN A;  2KOL A;  4BA1 I;  3PCO B;  2XWJ B;  5M5W B;  5ELO A;  1FD7 D;  2M00 A;  1ASZ A;  4BY7 B;  4LUO A;  1P16 A;  2DJF C;  1EY6 A;  5C4H A;  1WCM H;  1GM5 A;  3HKS A;  1A62 A;  2ZM6 L;  2J7Z A;  1ILP A;  1YBY A;  2KEC A;  3A8I E;  4P73 A;  5ELE A;  4DR4 Q;  1B70 B;  4X65 Q;  2QF7 A;  3GTG B;  4ID6 A;  1VQL A;  1PTO B;  1K0R A;  4A3K B;  4JI7 Q;  1AZP A;  2MGS A;  4OHJ A;  4B3R L;  4IZ8 A;  4JI6 L;  3KLR A;  3A7L A;  3HS0 C;  2L55 A;  2E74 C;  3MWY W;  1SE3 A;  5EKI A;  3DHQ A;  1H9K A;  3I70 A;  4HIM A;  3S1N H;  1PHJ A;  2NVT H;  1NE3 A;  3L0O A;  5CV6 A;  1JB3 A;  4UPA A;  4DUY Q;  5KYI A;  3N6R A;  2MO0 A;  2N49 A;  4X64 Q;  3KJO A;  3K58 A;  4A3J B;  2E75 C;  3T53 B;  2N8N A;  4L5S A;  1BBX C;  1AP0 A;  4RFB A;  1NR4 A;  2F4V L;  4GKK L;  1F2L A;  1SLJ A;  4KJN A;  4MHE A;  4X6A H;  2E5L L;  5D14 A;  2RF4 A;  3TSS A;  5C44 H;  1STB A;  1I4X A;  2E2I B;  5LL6 S;  1K8G A;  5A35 A;  3OYY A;  4DR7 Q;  1O80 A;  4LF8 L;  2B2U A;  2SNM A;  3K80 C;  5IYD G;  4V19 0;  1W6K A;  3PUX A;  4G4K A;  1HJP A;  3KBG A;  3M9B A;  1D2B A;  4QUF A;  1XNQ L;  1C0A A;  1PRT B;  1HXY D;  4WJW A;  3I56 A;  1XNR L;  2F0M A;  3WOF A;  5FLX c;  1JE4 A;  2R3Z A;  5FLX E;  2UXC Q;  2QDB A;  1GO3 E;  2X69 A;  2A6H D;  2VW9 A;  4EGV A;  4LF6 L;  1F77 A;  4FF1 A;  1AN8 A;  4QF4 A;  1LTL A;  1Z6H A;  2JA7 H;  1B2T A;  4NP5 A;  4A3I H;  4J1M A;  1HRJ A;  1LT3 D;  4A3B H;  1SNM A;  3D4W A;  4PZ6 A;  1QZG A;  4C3I G;  5EGT A;  1STE A;  4JBM A;  2G5D A;  5BN5 A;  4IFD J;  1W3S A;  3GTQ H;  2L11 A;  3DUZ A;  3K5L A;  2KED A;  2XWB B;  1XPU A;  5JAV A;  1SRU A;  2O2L D;  1ILQ A;  4FF4 A;  3S1Q B;  2JP1 A;  3NUC A;  3EJI A;  3S16 H;  1GKH A;  3IFD A;  1V8Q A;  1TWA H;  3QJY A;  3PIO A;  4DV0 L;  1JJ2 A;  2OQK A;  5E1F A;  2MNA A;  2D9U A;  1CT1 D;  2KA7 A;  4JI0 L;  5IYC H;  3SE0 A;  2PZW A;  4C3H H;  3BDC A;  1SFO B;  1LTG D;  3D4D A;  1ZYR D;  1AE2 A;  1RCV D;  3HOV H;  1F9S A;  2MJ8 A;  5C3E B;  2KHS A;  3DWP A;  3E9I A;  2SDF A;  5I6Y A;  4LUZ A;  1U5K A;  3D6W A;  3Q22 A;  1F9Q A;  5JEA J;  4FDB A;  3BZD B;  5FOB B;  1XTD A;  4MN3 A;  2V4D A;  3STB C;  1NUC A;  3PO3 B;  1YIJ A;  2R93 B;  2L0C A;  3M3Y B;  1CI3 M;  2VQE L;  4BY7 G;  3FMC A;  2HHH L;  2CVR A;  1TY2 A;  5M3M B;  2EXD A;  1KRT A;  3P20 A;  1LT6 D;  5EPJ A;  5GAG C;  1KNA A;  1IBM L;  1N32 Q;  2K75 A;  4CKB A;  2R7Z G;  1B9M A;  1XMQ Q;  1VQM A;  1F2Z A;  4BY1 B;  4IFD I;  2ATW A;  5F2D A;  1B50 A;  4L5Q A;  4A3K G;  2XRQ D;  4DXG A;  5EKK A;  3UE1 A;  4J6H A;  1IBL L;  5IY0 A;  3CQZ H;  4EX5 A;  3GTO H;  4DNR B;  2F4I A;  5COY A;  1N34 Q;  1HNX L;  3P1H A;  1VQF A;  3S15 H;  4S3S A;  4DV7 Q;  4RH6 A;  4X66 L;  5J39 A;  1TXY A;  4LF9 L;  1U4R A;  1JJG A;  2E2H B;  4R4O A;  1P8L A;  1UUP A;  2KCT A;  3H0G B;  5HUR A;  2I07 B;  1C8C A;  4LFB Q;  4G57 A;  2LFN A;  5CC4 A;  2RHQ B;  1OXS C;  2BE5 C;  4UDU C;  3S2H H;  2XVS A;  2PMZ E;  4JI1 Q;  5IYD H;  3S2D B;  4MTN A;  1WOC A;  1KXL A;  3SDZ A;  4CDC C;  2Z6B A;  2AUK A;  5C4J H;  5JVG 3;  3RLO A;  2K33 A;  1V43 A;  1KIX A;  1Y14 B;  2EYH A;  3K5M A;  1TR5 A;  3ONA B;  4A3F B;  4GKJ L;  2J0T D;  5D3D A;  5IYB G;  2JA5 B;  2EYO A;  1D5M C;  1GUG A;  3SHL A;  3ERQ A;  3I2Z A;  1L0W A;  2RKS A;  1IYJ B;  5T1I A;  1BVS A;  1QB5 D;  1MIU A;  3PQI A;  4C3I H;  1CKM A;  3T1Y Q;  3CCV A;  4K6L A;  2ZJP A;  1XJV A;  2K50 A;  4EQO A;  3J7A 5;  1M8A A;  4FP5 D;  3G48 A;  3E9H A;  2A73 B;  1O7Z A;  2OWO A;  3J81 L;  4OWT B;  1VQI A;  3K0X A;  2OF1 A;  5KND A;  5M3F G;  4OGQ C;  1JJC B;  2K52 A;  3BVG A;  1E1O A;  3TP7 A;  4NMZ A;  1N36 Q;  1V1O A;  3CCE A;  4DKA C;  4LF4 Q;  1EY8 A;  1X65 A;  3FPU B;  2L5T A;  4Q5V A;  1SNO A;  1WJJ A;  2WII B;  1KNE A;  1ICW A;  4K5W A;  1SSO A;  2EJF C;  2CQO A;  1VQJ A;  4AYB B;  5BN4 A;  5G3L F;  1J5E L;  3BU2 A;  1JB7 A;  4ILW A;  4HJA A;  2H5X A;  1TWH H;  2B8F A;  4KHV A;  2D62 A;  5C3E G;  4KN4 C;  1W2B A;  4A3G G;  3CKI B;  1G6P A;  3TRE A;  1NJI C;  2CH4 W;  4LFA Q;  2UUB Q;  1CHQ D;  2NWG A;  3UDG A;  3VR6 A;  5M5W H;  1JOR A;  1HZB A;  3PUZ A;  4BY7 H;  1LTR D;  3PO3 G;  2R93 G;  3WDN A;  1PH4 A;  1QVG A;  1A63 A;  3MXN A;  5M3M G;  4C56 C;  3CCR A;  3FPP A;  1JWM D;  2F0F A;  2HQL A;  2LMC B;  5NUC A;  3GTG H;  4EVO A;  3S1N B;  2CCZ A;  3BYT B;  4BY1 G;  3W5O A;  1YJN A;  4B3T Q;  2PCF B;  4TRD A;  4A3K H;  3PIP A;  3EQL C;  1DXM A;  3OIQ A;  3H15 A;  2KCM A;  4GOP C;  1UEA B;  3W3A A;  2GN5 A;  3LNN A;  4RGN A;  5TSS A;  4JI5 L;  1C9O A;  1NCV A;  1CHP D;  4OX9 L;  2JYO A;  2OEO A;  1ZXT A;  2EY5 A;  3C1F A;  3I7F A;  4DAP A;  2G9H D;  3SVM A;  4R8I A;  4DUZ Q;  5IGB A;  1JT8 A;  5E3F A;  4NB3 A;  4IOC A;  3NE5 B;  4GLV B;  1WVL A;  1Q86 C;  1EFI D;  1YHB A;  1TWF B;  1JMC A;  1E2Z A;  3T56 B;  1GUT A;  5DM7 3;  3H0G G;  3BDO A;  1WTQ A;  1U0L A;  4L8J A;  1F2Y A;  2XN9 C;  2E2I H;  3PO2 B;  2ZT9 C;  4JI3 L;  5IGE A;  2IPK D;  1K28 A;  1X3P A;  4BBS B;  3GD7 A;  3HOY B;  4LUV A;  2AHO B;  2R92 B;  1XPO A;  4LFC L;  3H3V C;  4H02 A;  3A5U A;  5M5X B;  2PQA A;  1JE5 A;  2B2Y C;  2O5J C;  5EAY A;  4R1J A;  3CC2 A;  3L9A X;  4DV5 Q;  4K8J A;  4A3M B;  3ER0 A;  2F3V A;  5T1G A;  3H94 A;  5K36 G;  1I4Q A;  1SNC A;  2WAQ B;  5IYB H;  2L12 A;  2OCE A;  1K8A C;  5CR3 A;  2JA5 G;  1HA5 A;  4X3K A;  2ICE C;  3OWF A;  3RN2 A;  1PH6 A;  4F7X A;  2EQS A;  3NEL A;  2F0Q A;  2BCO A;  1G91 A;  1LUZ A;  1B3A A;  3PV0 A;  1I50 B;  4XYQ A;  2BH2 A;  2K14 A;  3J7Y W;  2FMM A;  4FNF A;  5IWA Q;  1FL0 A;  5C3X A;  1NAP A;  3T1H L;  1HUM A;  3HOX B;  1WTW A;  3URY A;  1EUJ A;  2PW5 A;  5ISR A;  4L5R C;  3S1Q H;  4DPG A;  5A2Q E;  4KN7 C;  2QCP X;  3LWU A;  3HG9 A;  2F0L A;  2NTT A;  3M4Q A;  2VUM B;  1I4R A;  1QVC A;  5GAH C;  1Q12 A;  1TT2 A;  1EU4 A;  1TWG B;  1HR0 W;  2AQ1 B;  1SFO H;  5JOB A;  1JOK A;  1VQ4 A;  2EYF A;  1I3Q B;  2NVY B;  1U9R A;  4AYB G;  2XGT A;  4NXM L;  3I4N G;  3CW2 C;  3OMG A;  1QCB D;  3BDL A;  2LS0 1;  4QY7 A;  3WOE A;  1YHA A;  5C3E H;  4KHP Q;  2EZV A;  2IX1 A;  1J6Q A;  4A3D B;  3OW2 A;  2JN4 A;  4H0L C;  2RDH A;  1PH9 A;  3EBE A;  5JEA H;  5JPM C;  3T4A C;  2R61 A;  1Q7Y C;  4LF7 Q;  1BUV T;  1VCI A;  4CJ2 C;  4DR4 L;  3C46 A;  4X65 L;  3SK5 A;  1FJG Q;  4IPG A;  3J7A V;  3VYT A;  3PO3 H;  1H9M A;  2R93 H;  3M3Y H;  4YWL A;  3OPO A;  4JI8 Q;  3R2I A;  2Q8I B;  5M3M H;  1CSP A;  4PMW A;  1SMY D;  4QL5 A;  3RUZ A;  5KGU A;  3ZYY X;  1C4Q A;  5HGQ A;  4DV3 L;  2IX3 A;  2PQA B;  4QQB X;  2RCF A;  2GVB A;  2NZO A;  2EJM A;  3K7A B;  4AYB E;  4BY1 H;  1S3O A;  4DUY L;  1I4P A;  5GQO A;  4X64 L;  4IUU A;  4FXK C;  1CQV A;  4OL7 A;  3G71 A;  4A75 A;  3A74 A;  1PA6 A;  2AQ2 B;  1CTM A;  4RHS A;  4XTC S;  4YWK A;  1IKL A;  3KYH C;  3A7A B;  3JAM L;  2KEE A;  4FF3 A;  4NPS A;  5JJK A;  3DM1 A;  4X62 Q;  4R9W A;  4M1U B;  4UP9 A;  5IP7 G;  2OXP A;  2MQH A;  5IT9 L;  3GP7 A;  1BO0 A;  2SOB A;  3NSW A;  2E2H H;  3ICE A;  5M9O A;  1XYI A;  1MBY A;  2R6G A;  4DR7 L;  2BA0 A;  3H0G H;  4PQX A;  4P74 A;  1Y69 U;  1SE8 A;  3E3X A;  1VQ5 A;  2HCI A;  3VR2 A;  1K8O A;  4XT3 B;  3RZD B;  2DJG C;  4WFN 3;  3PGZ A;  3PO2 G;  1S4Z A;  2VZA A;  4LK1 C;  5GRO A;  1I94 Q;  4ME3 A;  3H91 A;  2JJQ A;  4BBS G;  3OOC A;  3S2D H;  4DV1 Q;  1GVP A;  4KKU A;  3KF8 A;  3R8B A;  4UY8 C;  4YCV A;  1M90 C;  3G4S A;  4A76 A;  1U4M A;  1PH2 A;  4A3M G;  1X32 A;  5EPL A;  4A3F H;  1E24 A;  4JG2 A;  1II3 A;  1BNZ A;  3CCU A;  2WAQ G;  1SE2 A;  2N88 A;  2JA5 H;  4HED A;  4M8A A;  1LTT D;  1PLF A;  3U4V A;  5JPN C;  3G6E A;  1KAB A;  4YCW A;  3TP8 A;  5FO8 B;  2PI2 E;  1UE6 A;  1CUK A;  1HCZ A;  1I6H B;  1IZ6 A;  1ASY A;  2RDG A;  1A2U A;  5EQ0 A;  5IGF A;  1U4L A;  3HOX G;  1V1P A;  1PYB A;  3OHX C;  2IJ0 A;  2H1E A;  1VMC A;  1PH5 A;  2WAQ E;  2F52 A;  3J80 E;  1LLR D;  1K83 B;  2SNS A;  2EPB A;  2ZTD A;  4DF7 A;  2PPB C;  3I4N H;  2BDO A;  1H9R A;  2WKC A;  3L3O C;  2HUG A;  3H09 A;  4JBJ A;  3QG1 A;  4X3S A;  4LWC A;  4A3D G;  4MIU A;  2MPM A;  1QE6 A;  1ROD A;  2UUC Q;  3RLN A;  1CM9 A;  5ELN A;  4C2M B;  2R7Z B;  1G8Z D;  4ABN A;  1PYS B;  1XMQ L;  2CHB D;  2F0J A;  3GV6 A;  2PMZ B;  3AQQ A;  1X55 A;  1VQB A;  1I4G A;  3KF8 B;  5IOD A;  4LJZ C;  4PV1 C;  1N34 L;  1HR0 Q;  4KD4 A;  3NPP A;  3VR5 A;  3TZD A;  4DV7 L;  1D1K A;  3OIP A;  1SND A;  4Z9C B;  4O42 A;  2Z6K C;  3I4M B;  4IUR A;  2EVB A;  4YCU A;  4A3C G;  1HNW Q;  2F0N A;  4QGU A;  2R7D A;  1CZG A;  3SK6 A;  4HJ8 A;  2UXD Q;  2AMC B;  1IHZ A;  4PZ8 A;  1LT4 D;  1O78 A;  4LFB L;  2X6L A;  4HJ5 A;  2XRS D;  5IP7 H;  2PNH A;  4PMC A;  3V05 A;  3CHB D;  1VQC A;  1A0I A;  3VA7 A;  1XX8 A;  4JI1 L;  2EIF A;  4DR6 L;  1HZA A;  1QUQ A;  1IYV A;  1KDA A;  1WFQ A;  1TWF H;  2NZH A;  1BXT A;  4TQU S;  3U9O A;  1V1P B;  3BYY B;  2Q2U A;  3AU7 A;  3PO2 H;  1STN A;  4K14 A;  4PG3 A;  1VQD A;  3QIA A;  1NBW A;  2A6H C;  4A3E B;  1EYD A;  1IBK Q;  4J15 A;  4LF5 L;  4BBS H;  3V2T A;  3HOY H;  2EJG C;  1NSN S;  3E0J A;  1ESR A;  1D5Z C;  2R92 H;  4XQJ A;  4OWX B;  1G6Z A;  4L6T B;  5BR8 Q;  5M5X H;  5I2X A;  4HCE A;  2YYZ A;  4A3M H;  5IOC A;  1EFW A;  1TS4 A;  2RCN A;  1G51 A;  3D0F A;  2EOT A;  2F0U A;  1HNZ L;  4B3M Q;  4ZAI A;  2B2Y A;  1B3Q A;  5M3F B;  3LGJ A;  2JK8 A;  3S17 B;  2ASB A;  1I50 H;  2FFK B;  2GVA A;  1ESF A;  3M4Y A;  1HQM C;  4LF4 L;  3J80 i;  5LMN W;  1A15 A;  3NQT A;  1KD1 C;  3F8T A;  1CA5 A;  1ZYR C;  3HOX H;  2UXB Q;  1HTP A;  1G2T A;  2N3S A;  4IO9 A;  2F0D A;  3ERS X;  4DU9 A;  4E6I A;  2EY6 A;  1EY9 A;  3F1Z A;  2K5V A;  4IUN A;  2ZXR A;  4HAE A;  1PFS A;  4GN5 A;  4DK1 A;  1MSH A;  2O5I C;  1QG7 A;  4A3G B;  5FLX L;  1VQ8 A;  2VUM H;  1TWG H;  2RBM A;  1Q1E A;  3WWV A;  1I3Q H;  4GOP B;  2NVY H;  4LAA A;  2PW7 A;  1QUQ B;  2WAC A;  5D65 A;  3MFY A;  4C3J B;  5AFW A;  5LL6 X;  4A3D H;  2Q2T A;  1LTB D;  4V0B A;  4B9X A;  2F0O A;  1NMF A;  1QJO A;  4KKT A;  3DM3 A;  5J1Z A;  1I5F A;  2A1A A;  3D4R A;  5FJ8 G;  3Q24 A;  1BCP D;  2AWO A;  3NP8 A;  4CKC A;  3GTP B;  4HIK A;  1UE1 A;  3MAQ A;  3CC7 A;  3EVQ A;  2C9O A;  4PNY A;  4JYA L;  1TS3 A;  1J8I A;  1WTO A;  3NEN A;  4RGM A;  3FP9 A;  3DLL A;  1STA A;  2ZM6 Q;  4P71 A;  3RZO B;  3K7A H;  2C35 B;  4POG A;  3AFP A;  4BBR B;  1S72 A;  1EOT A;  4DR1 L;  3I4M G;  3NQI A;  2XIW A;  1EIY B;  2DN8 A;  1LTA D;  1YZ6 A;  5JJL A;  4XXE A;  3TS0 A;  4B3R Q;  1QWY A;  4FO2 A;  3GDE A;  2EY2 A;  3QWN A;  3V96 A;  1STH A;  1VQA A;  5HGT A;  1A2T A;  3CPF A;  1JCK B;  1CA6 A;  4I7A A;  4DR5 L;  1O7Y A;  1C7Y A;  3QOJ A;  5I9P A;  2CWA A;  3CCJ A;  4JW0 A;  1VQP A;  1B9N A;  1LAB A;  3RZD H;  3NTI A;  4JBK A;  3MEF A;  1SXT A;  3M4O B;  1PTO D;  2ICI A;  1QOH A;  2Q2I A;  4WJ4 A;  2ZTC A;  4DV5 L;  3TDQ A;  4A3E G;  5KIX A;  4DR2 Q;  3SK8 A;  1RJT A;  1W6J A;  1C48 A;  4ZUJ A;  4LF8 Q;  1VQ9 A;  2RQX A;  3KK7 A;  4AQY Q;  2KBN A;  2BDN A;  2B2W C;  1EZ8 A;  4NXN L;  1YJW A;  1AH9 A;  5IWA L;  2CWP A;  4KHZ A;  4B3S L;  3NTH A;  1NNX A;  4N9T A;  1I4H A;  2I5L X;  4QB4 A;  4BA2 I;  3H3V I;  3C2P A;  1SYC A;  3DMU A;  3D6C A;  4Y52 H;  3CF5 A;  2K03 A;  4ODG A;  4OEL B;  5DLQ E;  2UU9 L;  2J4X A;  2NN6 I;  1SBB B;  1L0Y B;  2TMP A;  3U58 A;  2VQF Q;  4XQQ A;  1EYC A;  2ZJR A;  1I6H H;  2PI2 A;  1I6V C;  2XSC A;  3HKZ G;  3RMH A;  3C3L A;  1PRT D;  5GAD C;  3I4N B;  4ZQ3 A;  3GO5 A;  4HMJ A;  4K8I A;  1KQS A;  4K0K L;  4LMQ D;  1B8A A;  4KHP L;  1HUN A;  1K9M C;  1D6E C;  5C0X J;  2K5D A;  4GN4 B;  3H6M A;  3E6Z X;  3P75 A;  1K83 H;  1SN8 A;  4KKS A;  5CGK A;  2KEN A;  4K2L A;  4LF7 L;  3K5N A;  3A5Z B;  4JI0 Q;  4IQZ A;  1FJG L;  2JSO A;  1MD2 D;  4JVZ A;  1U4P A;  3UE0 A;  4KY7 A;  2QEX A;  4JI8 L;  3NHH A;  3FDT A;  3VA5 A;  4C3J G;  5LMN Q;  1STG A;  2B2T C;  2NVX B;  2JA8 G;  2Z4I A;  1MHW C;  2I46 A;  5CBE E;  4YHH Q;  1E2W A;  4BS9 A;  5FJ8 H;  3CAM A;  4C2M H;  3HKZ E;  4KY5 A;  1DCZ A;  2R7Z H;  1KC8 C;  1K3R A;  4FXG C;  2K32 A;  3ULP A;  1VDZ A;  3QOL A;  2XNA C;  3TP5 A;  4F87 A;  2A69 C;  4QJF A;  2K7V A;  4RMF A;  3NTK A;  1FR3 A;  4RHR A;  2A69 D;  3NWT A;  3M7G A;  4IPC A;  2HHH Q;  2JQO A;  1F9R A;  1IL8 A;  4DR3 L;  3SEB A;  4JCV E;  1RTN A;  4ZLT F;  1IBM Q;  4X62 L;  3K57 A;  4BBR G;  4FXD A;  1VQH A;  3I4M H;  2FHT A;  2MFI A;  3RD4 A;  4DNI A;  3KF6 A;  5ELB A;  2HCC A;  2VL6 A;  3PIO 3;  1IBL Q;  1PH1 A;  3O13 A;  4N8F A;  5I4D A;  1KAW A;  2EYL A;  3NK9 A;  4GLX A;  2NN6 G;  1A3V A;  2JA9 A;  5BN3 A;  3CCM A;  1Y1V B;  4DK6 C;  1LAC A;  1SYG A;  3S1R B;  4A4I A;  5C5L A;  1L2F A;  4DAY A;  1VF5 C;  1EOV A;  2IHE A;  2RVL A;  4DV1 L;  3CMA A;  4IJL A;  4RA8 A;  2HDM A;  1JQY D;  1AEX A;  3L7Z C;  1OXU A;  3PSI A;  1OXV A;  1S5D D;  3Q0A A;  5DAU A;  4A3E H;  2RDF A;  4EQP A;  1AFP A;  5ELD A;  4YY3 Q;  4X3T A;  1DOL A;  3EFX D;  1EY4 A;  5KNC A;  2AKW B;  4IUT A;  4ZRZ A;  4DGZ A;  3EIV A;  1NR2 A;  1VQN A;  3M4P A;  3PUW A;  5IGG A;  1EIG A;  1ML0 D;  1PH3 A;  1HHV A;  1YHQ A;  1KAA A;  2EY1 A;  2PZT A;  2DGY A;  3I4L A;  2E8G A;  3BJU A;  5JVH 3;  4A3L G;  1G29 1;  4GKJ Q;  4QUC A;  4GZY C;  1EIF A;  1ICF B;  2K04 A;  5E7N A;  1X9N A;  2ZJQ A;  3VDY A;  1MGS A;  5M3F H;  5HY6 A;  1STY A;  3S17 H;  3M85 A;  1GXD C;  1TWC B;  2LY7 A;  3I73 A;  3A8K E;  2DNE A;  4OO1 G;  2HD3 A;  1R9T B;  3GTJ B;  2RSN A;  1YNN C;  4DAV A;  3Q23 A;  3DEO A;  3CRL C;  4QMG A;  1Y8O B;  1YNN D;  3VYU A;  3BVZ A;  2YTY A;  5C4Z A;  4DK3 C;  1TY0 A;  1VMP A;  4DV6 Q;  3KF6 B;  3AB9 A;  4A3G H;  3M7N A;  5C0X G;  1GUO A;  1RTO A;  1YIT A;  2WP8 J;  3JAM c;  1ONL A;  3Q6S A;  2UUC L;  1EL0 A;  5L37 A;  4R4C A;  1L1O C;  1SRO A;  3IFT A;  4DAY B;  5IT9 c;  1FNW A;  4C3J H;  1SMY C;  1J5E Q;  4JI7 L;  1PXU A;  4CJ0 B;  2K4K A;  1X3G A;  1SJH D;  5E4W C;  2KUM A;  2IWH A;  3W2D A;  1HR0 L;  4I7Z C;  5LMU Q;  1K73 C;  3LX0 A;  1RL2 A;  2I0Q A;  2MP1 A;  3D3R A;  1GUS A;  4IN3 A;  2F03 A;  3GTP H;  1EIH A;  1HPC A;  1EEI D;  2VS1 A;  3EN2 A;  3GTK B;  2A68 C;  4DXF A;  4XDX A;  5A2Q L;  2G9D A;  2A68 D;  3NXW A;  1PFM A;  4A93 B;  1CZW A;  3RZO H;  1EY5 A;  1A3U A;  3TBI B;  4BBR H;  3MXP A;  1XXG A;  3G6J B;  1EQT A;  2D0P A;  5ELF A;  3QR8 A;  3H3V H;  2PZU A;  3KBX A;  5AJ3 Q;  1TU2 B;  5JJZ A;  3OTO Q;  1EQR A;  2NN6 H;  5KRU A;  4JV5 Q;  1ENA A;  3HP3 A;  5IIF A;  1UNS A;  1Y1V G;  2JE6 I;  4RWS C;  3UDI A;  2KQ3 A;  1Y1W B;  2K1B A;  2Y0S G;  1AE3 A;  2UXC L;  4KJO A;  2MHV A;  1IBK L;  1HFN A;  1S5C D;  5C4X B;  2B29 A;  2B63 G;  3ERO A;  5BR8 L;  3M4O H;  1PH8 A;  3GTL B;  1QVF A;  5CV4 A;  3FEW X;  4YWM A;  5FO7 B;  1Q90 A;  5K36 H;  2E2J B;  3L2P A;  3FKI B;  3K59 A;  5COR A;  3SK4 A;  2KCC A;  1NY4 A;  1N33 Q;  3HOU B;  4IPD A;  2AQ3 B;  2JA6 B;  4RCO A;  4C1N I;  5M5Y B;  3E5S A;  2LXK A;  2ENB A;  1GD7 A;  3MC0 B;  2Y0S E;  3CME A;  2UUA Q;  2I5H A;  4A3L H;  4PMB A;  2X6G A;  1YNJ D;  3J81 j;  4JK1 C;  1H9S A;  2HIX A;  1KLG D;  3KOJ A;  2UXB L;  2NYZ D;  2Z4H A;  2Q8T A;  4Y7N B;  4RGO S;  4RAU C;  2LSS A;  1DOM A;  1K0S A;  4OO1 H;  1BR9 A;  1VQK A;  1IXR A;  4JI4 Q;  2K05 A;  5E4X A;  1L0X B;  1XWE A;  3PMF A;  1LT5 D;  3QB3 A;  1GHK A;  3GTM B;  1SE4 A;  1AZQ A;  1QZH A;  5C5M A;  1UAP A;  2Z8L A;  1VQG A;  3T1H Q;  2K5H A;  4KMU C;  3MXU A;  3TP6 A;  3KLW A;  3OMC A;  4NDX A;  2DY8 A;  5C0X H;  4KI0 A;  2E2D C;  4HTH A;  1YNX A;  2JEA I;  1ET9 A;  4U68 A;  1Z7T A;  3CC4 A;  1S5F D;  1T5E A;  1N32 L;  3PUV A;  1XTC D;  3I4O A;  1BBW A;  4UHV A;  3RLF A;  4WRD A;  3UI2 A;  2VB2 X;  2ZXO A;  4IAL A;  4IPH A;  2B2V C;  5JJI A;  5D3I B;  3FRP B;  4UP8 A;  3S1M B;  4NXM Q;  2NVX H;  2HIV A;  1NMG A;  2A5H A;  4JI2 Q;  1B4O A;  3CXC A;  3NWS A;  3LWE A;  5DM6 3;  4K5V A;  3KLS X;  1FGB D;  2ALY B;  2CW0 C;  4N8X 1;  4DV4 Q;  3UDX A;  2BA1 A;  2CW0 D;  2B2T A;  5IP9 G;  2NUC A;  2QA4 A;  2FJ2 A;  5H1S E;  1UE5 A;  3S14 B;  3AEV A;  3VR3 A;  1MI2 A;  4A93 G;  5CV5 A;  1CKN A;  1YVC A;  4DV3 Q;  1B1Z A;  1BKB A;  4HN7 A;  3J80 L;  2WFW A;  4CGY B;  4GOP A;  1H9S B;  2VB3 X;  3A56 A;  1DYQ A;  5G3L D;  1IKM A;  3VYR A;  1HZC A;  1Y1V H;  2HT1 A;  1FVI A;  4DV2 Q;  3TS2 A;  3S1R H;  2BOS A;  4DK0 A;  1PV4 A;  1SMX A;  1Y1W G;  2KHI A;  4CDD C;  4IOA A;  1JOO A;  4DR2 L;  1BBU A;  1V1Q A;  5EBC A;  3MZ5 A;  1Q46 A;  2B63 H;  1DON A;  4NKL A;  4KD3 A;  5C4X G;  3MFG A;  2ES2 A;  4JOI C;  3RR5 A;  1WTX A;  4GNX C;  4AQY L;  4F88 A;  3I3C A;  3KUP A;  1MJC A;  2OTJ A;  4K5X A;  3T1Y L;  2HDL A;  1GJX A;  1N8R C;  3FKI G;  1WYD A;  5KNB A;  3HOU G;  3I72 A;  2JA6 G;  4ZKC B;  2NVQ B;  4XIG S;  4TKO B;  2O4X A;  2KVM A;  1A6X A;  3NEM A;  1A8V A;  2M9V A;  3F2D A;  1N36 L;  1BQQ T;  4OEM B;  1RHP A;  2L4N A;  2VQF L;  4KV6 A;  1EEF D;  3OWE B;  4ZUI A;  1BF4 A;  1KDC A;  3HOZ G;  1LV9 A;  3HKZ B;  4H44 C;  2EYM A;  1B44 D;  1HTL D;  1X6O A;  2Z1C A;  1UE7 A;  3IAY A;  4UP7 A;  3GV3 A;  3CP0 A;  1TWC H;  3A54 A;  2WB1 B;  3PF4 A;  2OTL A;  2F3I A;  3GTJ H;  1R9T H;  5K5P A;  1CKN B;  1TVX A;  2YTV A;  3HGB A;  3FVQ A;  3I55 A;  5EJW A;  4LFA L;  2IHF A;  2UUB L;  4RKL A;  1F9P A;  1M4V A;  4GS3 A;  1RIP A;  2CFM A;  1KTK A;  1XMO Q;  2CQA A;  3E0E A;  5LMN L;  2Z9H A;  2JA8 B;  1D7Q A;  4L5T A;  2EYJ A;  1A3T A;  3OSO A;  2KCN A;  4HSP A;  4YHH L;  1YEZ A;  3K0Y A;  4O1N A;  4IUQ A;  3FHW A;  1BCP C;  1X56 A;  1PZK D;  1K8M A;  3D8G A;  3ZJY C;  1QIL A;  2A8V A;  3K8A A;  4B3T L;  4HMI A;  1QNK A;  1X54 A;  4KY6 A;  1ENF A;  4IJH A;  1FNV A;  3HFZ B;  4IUP A;  4OXP A;  3STB D;  2R7F A;  1KLU D;  4HJ7 A;  2ZXP A;  3U50 C;  4IUV A;  4F8M A;  2DY7 A;  1X3Q A;  1L1O A;  4CBV A;  1LM0 A;  1WTP A;  2ID0 A;  4DAM A;  4CKE A;  1Q3L A;  3AYH B;  1EYG A;  1F2M A;  1PFB A;  4DUZ L;  4A3C H;  1SYB A;  5IP9 H;  3IKJ A;  2Q2H A;  1WD1 A;  3GTK H;  3ND9 A;  1CKO A;  1OXT A;  4R4Q A;  1KHI A;  2GA4 B;  3CCS A;  3BZC A;  4A93 H;  1E22 A;  1CSQ A;  4LW1 A;  2FXQ A;  2AWN A;  3Q8D A;  2MUY A;  3S9W A;  4JI6 Q;  2FMC A;  1KRS A;  1EY0 A;  5IGD A;  2VXW A;  1RDP D;  4R8N A;  1H9J A;  1HQR D;  2FIN B;  4A3J G;  3J81 c;  4H7B A;  2YTX A;  2A74 C;  4DN4 M;  4ULL A;  3J81 E;  2F4V Q;  4GKK Q;  4OIJ A;  1PTO C;  4JC0 A;  2PNR C;  2E5L Q;  3MTS A;  1OO9 B;  1JWS D;  1S5B D;  3MA2 B;  3OW7 A;  1Y1W H;  1VQE A;  4YY3 L;  2L1B A;  1ZKO A;  4DR6 Q;  2BE5 D;  4RG1 A;  5C4X H;  3HOW B;  2PQE A;  2EE1 A;  2SEB D;  4BXX G;  3JC6 6;  1DOK A;  3T13 A;  1T9H A;  1SYE A;  3GTL H;  1TQO A;  3PF5 A;  3G7L A;  2YU9 B;  1XNQ Q;  1S40 A;  3R2T A;  2E2J H;  3FKI H;  1XNR Q;  3X3N A;  4P2C B;  2K28 A;  1T5X D;  3T16 A;  3HOU H;  5LHY 1;  4LF5 Q;  2JA6 H;  1RD9 D;  4LF6 Q;  1EWI A;  2RHS B;  5M5Y H;  1X3E A;  2TSS A;  1N9W A;  1OTC A;  3QO2 A;  4RGT A;  4ME5 A;  1ET6 A;  1L1O B;  1VQ7 A;  3HOZ H;  1PZI D;  4MZ9 A;  3PUY A;  1EZ6 A;  1PRT C;  1FGU A;  4HCS A;  5IGC A;  4OWW B;  2DUD A;  2JXM B;  1HNZ Q;  4QIW B;  4Y7N H;  4IFD G;  4ZK9 B;  1V9P A;  1EQV A;  4L63 B;  2QKI C;  4I65 A;  4HID A;  3CRK C;  4MNO A;  2K6A A;  4DV6 L;  2WB1 G;  2E76 C;  2F0T A;  1VQ6 A;  1E3P A;  1RKN A;  1PZJ D;  4DV0 Q;  4R4I A;  3F2U A;  3GTM H;  2Z0S A;  1K3B C;  2WV6 D;  3K7U C;  3A0J A;  1SEB D;  1BOS A;  2F3W A;  3DEP A;  2B39 A;  4J8Q A;  1GOZ A;  2QDL A;  4JBW A;  2VNU D;  3TRZ A;  1XPR A;  5ELC A;  2NBF A;  1LTI D;  3R93 A;  2MO1 A;  3HRZ C;  3R3O A;  1WCM B;  3GQB A;  2WKD A;  4JPB W;  1JC7 A;  3K5O A;  5LMU L;  2F0H A;  4B08 A;  2EXZ A;  3J7A F;  1Y8P B;  2F0S A;  1Q8K A;  5DEH A;  5JEA G;  1O7I A;  5CV7 A;  4WJ3 M;  1YJ9 A;  3S1M H;  2WB1 E;  1MJE A;  1E2V A;  4CDE C;  4UAI A;  2VQE Q;  1WI5 A;  1VF7 A;  3KJP A;  2B3G A;  2F0E A;  5KYL A;  2WIN B;  4OO1 I;  1PFN A;  3A55 A;  3NBI A;  1SYF A;  1TS2 A;  2B2V A;  3CCL A;  1SAP A;  3UDF A;  1G2S A;  1B7Y B;  2NVT B;  1PTO H;  4XYO A;  1PVO A;  4TSS A;  3MXG A;  5AJ3 L;  3S14 H;  3J81 i;  4O0A A;  3OTO L;  1IL2 A;  2XTI A;  4JYA Q;  2QW7 A;  4PZ7 A;  3P7J A;  4WOR A;  3SR1 A;  1HNX Q;  4XQN A;  5C0X I;  4JV5 L;  2B8G A;  2B2U C;  2Z6K A;  5C44 B;  2VY3 A;  1D8L A;  2RA4 A;  4RKB A;  5CV8 A;  4KK7 A;  4X66 Q;  4HIO A;  2Y0S B;  4G7O C;  3S24 A;  3BG3 A;  4B9W A;  4DR1 Q;  4LF9 Q;  4A3J H;  1I94 L;  4LNQ A;  3KFU A;  2IW3 A;  3K81 C;  4APV A;  2B63 B;  2BH8 A;  4O2D A;  1JWU D;  3MEH A;  5EPK A;  4Q0F A;  1Q82 C;  5CYU A;  3W1B A;  1QNU A;  4DR5 Q;  2QGQ A;  2F0V A;  3SGI A;  1N33 L;  4BXX H;  2LKV A;  2AUJ D;  1KL9 A;  3VYS A;  1IW7 C;  4HJ9 A;  3RN5 A;  3HOW G;  1IW7 D; 
#chains in the Genus database with same CATH homology
 2JA7 B;  2HQE A;  2QIL A;  4A3I B;  2C5C A;  4A3B B;  1CFM A;  4BWG B;  3IL8 A;  3MHB A;  3NBH A;  1BCP F;  5DNF A;  5EBD A;  3MVV A;  3GTQ B;  3SXH A;  3K6O A;  1Q8I A;  3I90 A;  1OXX K;  3S16 B;  1TWA B;  1JR0 D;  1SNQ A;  1J9O A;  4U67 3;  5FKA C;  1DZ1 A;  1GHJ A;  4IFD H;  2EDG A;  1RF2 D;  3N52 A;  4C1N K;  2QEJ C;  1PYW D;  3KLS A;  3HEJ A;  4C3H B;  4KTA A;  2D5D A;  3DWA A;  1WTV A;  2EYP A;  1Y8N B;  2IL8 A;  1Z47 A;  1CQF A;  3HOV B;  3JAM E;  2Q8R E;  3AMU A;  1HFG A;  1ENC A;  1EYA A;  1SNP A;  3EA6 A;  3BVM A;  4DFA A;  1WD0 A;  4N9P A;  5IT9 E;  4EQN A;  4G7H C;  3A8J E;  5I6W A;  4QCL A;  3I91 A;  3D31 A;  4FYD A;  1PTO F;  2F0I A;  3TZU A;  2H4O A;  4HSV A;  1LTS D;  5CV9 A;  4DNT B;  2K01 A;  1D5X C;  1O7L A;  1TII D;  2NB0 A;  1D1I A;  5FK9 C;  1HA6 A;  1SYD A;  2PYK A;  3DXJ C;  4K6D A;  3CQZ B;  3GTO B;  4CJ1 B;  2K5Q A;  4K2K A;  3S15 B;  3ITP A;  2IT1 A;  5KEE A;  5CMD A;  1JOQ A;  1DM0 B;  2KJX A;  4HR7 B;  2L9H A;  5I9O A;  1AW7 A;  1SDF A;  1DJR D;  2A6E C;  4OIK A;  5I2Y A;  3DWQ A;  2DNC A;  2A6E D;  1TS5 A;  1EY7 A;  1GUN A;  5FO9 B;  1FYC A;  2D2C C;  1JIC A;  3S2H B;  1PRT F;  4XT1 B;  1CK1 A;  2OT2 A;  4H13 C;  1TKW B;  1GUW A;  2NTS A;  5EKL A;  3X3M A;  5CBA E;  2M2L A;  5C4J B;  1FNU A;  5C3W A;  2K5W A;  1EWH A;  1PDQ A;  1ZEQ X;  2F0G A;  3BS1 A;  1R4P B;  1SJE D;  1YNJ C;  4CHT B;  1EWC A;  3PIP 3;  3TME A;  4C3I B;  4ZYS A;  2RSO A;  4X3U A;  1E0B A;  3HOZ B;  2IX0 A;  1WTR A;  3CU7 A;  2F0W A;  2B2W A;  1KDB A;  1BDO A;  2F0P A;  2NZ1 D;  3I8Z A;  5J22 A;  1BCP B;  1MSG A;  3U9S A;  2F0K A;  2N55 A;  1IYU A;  3ND8 A;  4FVM A;  1DD2 A;  3TN2 A;  1S5E D;  4FF2 A;  4NW2 A;  4ZKB B;  1B53 A;  4YIJ A;  4C3H G;  4DA2 A;  5C6A A;  3HZX A;  4G7Z C;  1Q1B A;  1PMR A;  2PO4 A;  1LO5 D;  2JEB I;  1TWH B;  1R4Q B;  3C1E A;  3VR4 A;  3T51 B;  1EU3 A;  2F1M A;  4RCN A;  2KOL A;  4BA1 I;  2XWJ B;  5M5W B;  1FD7 D;  2M00 A;  4BY7 B;  1EY6 A;  5C4H A;  2J7Z A;  1ILP A;  2KEC A;  3A8I E;  5ELE A;  2QF7 A;  3GTG B;  4ID6 A;  1PTO B;  4A3K B;  1AZP A;  2MGS A;  4OHJ A;  4IZ8 A;  3KLR A;  3A7L A;  3HS0 C;  2L55 A;  2E74 C;  3MWY W;  1SE3 A;  5EKI A;  3DHQ A;  1H9K A;  3I70 A;  5CV6 A;  1JB3 A;  5KYI A;  3N6R A;  3K58 A;  4A3J B;  2E75 C;  3T53 B;  1AP0 A;  1BBX C;  4RFB A;  1NR4 A;  1F2L A;  4KJN A;  4MHE A;  5D14 A;  3TSS A;  1STB A;  1I4X A;  2E2I B;  5LL6 S;  5A35 A;  1O80 A;  2B2U A;  2SNM A;  4V19 0;  1W6K A;  3PUX A;  4G4K A;  3KBG A;  1D2B A;  4QUF A;  1PRT B;  1HXY D;  4WJW A;  2F0M A;  3WOF A;  1JE4 A;  2R3Z A;  5FLX E;  2QDB A;  2X69 A;  2A6H D;  4EGV A;  1F77 A;  4FF1 A;  1AN8 A;  4QF4 A;  1B2T A;  1Z6H A;  4NP5 A;  4J1M A;  1HRJ A;  1LT3 D;  1SNM A;  3D4W A;  4C3I G;  5EGT A;  1STE A;  5BN5 A;  4IFD J;  2L11 A;  3DUZ A;  3K5L A;  2KED A;  2XWB B;  5JAV A;  2O2L D;  1ILQ A;  4FF4 A;  3S1Q B;  2JP1 A;  3NUC A;  3EJI A;  3IFD A;  1V8Q A;  3QJY A;  5E1F A;  2D9U A;  1CT1 D;  2KA7 A;  3SE0 A;  2PZW A;  3BDC A;  1SFO B;  1LTG D;  3D4D A;  1ZYR D;  1RCV D;  1F9S A;  2MJ8 A;  5C3E B;  2KHS A;  3DWP A;  2SDF A;  5I6Y A;  3D6W A;  3Q22 A;  1F9Q A;  5JEA J;  3BZD B;  5FOB B;  4MN3 A;  2V4D A;  3PO3 B;  1NUC A;  2R93 B;  2L0C A;  3M3Y B;  1CI3 M;  3FMC A;  2CVR A;  1TY2 A;  5M3M B;  3P20 A;  1LT6 D;  5EPJ A;  1KNA A;  4CKB A;  1B9M A;  1F2Z A;  4BY1 B;  4IFD I;  5F2D A;  1B50 A;  2XRQ D;  4DXG A;  5EKK A;  4J6H A;  4DNR B;  2F4I A;  5COY A;  3P1H A;  4S3S A;  4RH6 A;  5J39 A;  1U4R A;  2E2H B;  1UUP A;  3H0G B;  5HUR A;  2I07 B;  1C8C A;  4G57 A;  2LFN A;  5CC4 A;  1OXS C;  2BE5 C;  4UDU C;  2XVS A;  3S2D B;  3SDZ A;  2AUK A;  5JVG 3;  2K33 A;  1V43 A;  2EYH A;  3K5M A;  1TR5 A;  3ONA B;  4A3F B;  2J0T D;  5D3D A;  2JA5 B;  2EYO A;  1D5M C;  1GUG A;  3SHL A;  3ERQ A;  2RKS A;  5T1I A;  1QB5 D;  4K6L A;  4EQO A;  1M8A A;  4FP5 D;  2A73 B;  1O7Z A;  3J81 L;  2OF1 A;  5KND A;  4OGQ C;  3BVG A;  3TP7 A;  4NMZ A;  1V1O A;  1EY8 A;  3FPU B;  2L5T A;  4Q5V A;  1SNO A;  2WII B;  1KNE A;  1ICW A;  4K5W A;  1SSO A;  2EJF C;  4AYB B;  5BN4 A;  5G3L F;  4ILW A;  2B8F A;  4KHV A;  2D62 A;  4KN4 C;  3CKI B;  1CHQ D;  2NWG A;  3VR6 A;  1JOR A;  3PUZ A;  1LTR D;  3WDN A;  3MXN A;  4C56 C;  3FPP A;  1JWM D;  2F0F A;  2LMC B;  5NUC A;  4EVO A;  3S1N B;  3BYT B;  2PCF B;  4TRD A;  3EQL C;  1DXM A;  3OIQ A;  1UEA B;  3W3A A;  3LNN A;  4RGN A;  5TSS A;  1NCV A;  1CHP D;  2JYO A;  2OEO A;  1ZXT A;  2EY5 A;  3C1F A;  4DAP A;  2G9H D;  3SVM A;  4R8I A;  5IGB A;  5E3F A;  3NE5 B;  1WVL A;  1EFI D;  1TWF B;  1E2Z A;  3T56 B;  1GUT A;  5DM7 3;  3BDO A;  1WTQ A;  4L8J A;  1F2Y A;  2XN9 C;  3PO2 B;  2ZT9 C;  5IGE A;  2IPK D;  1X3P A;  4BBS B;  3GD7 A;  3HOY B;  2R92 B;  3H3V C;  5M5X B;  2B2Y C;  2O5J C;  3L9A X;  4K8J A;  4A3M B;  2F3V A;  5T1G A;  3H94 A;  5K36 G;  1I4Q A;  1SNC A;  2WAQ B;  2L12 A;  5CR3 A;  1HA5 A;  4X3K A;  2ICE C;  3OWF A;  4F7X A;  2F0Q A;  2BCO A;  1G91 A;  1B3A A;  3PV0 A;  1I50 B;  4XYQ A;  3J7Y W;  2FMM A;  4FNF A;  5C3X A;  1NAP A;  1HUM A;  3HOX B;  1WTW A;  3URY A;  2PW5 A;  5ISR A;  5A2Q E;  4KN7 C;  2QCP X;  3LWU A;  3HG9 A;  2F0L A;  2NTT A;  2VUM B;  1I4R A;  1Q12 A;  1TT2 A;  1EU4 A;  1TWG B;  2AQ1 B;  5JOB A;  1JOK A;  2EYF A;  1I3Q B;  2NVY B;  1U9R A;  3OMG A;  1QCB D;  3BDL A;  2LS0 1;  3WOE A;  2EZV A;  2IX1 A;  4A3D B;  4H0L C;  2RDH A;  5JEA H;  5JPM C;  3T4A C;  2R61 A;  1BUV T;  1VCI A;  4CJ2 C;  3C46 A;  3SK5 A;  3J7A V;  3VYT A;  1H9M A;  3OPO A;  3R2I A;  2Q8I B;  4PMW A;  1SMY D;  5KGU A;  3RUZ A;  3ZYY X;  1C4Q A;  2IX3 A;  2EJM A;  3K7A B;  1I4P A;  4IUU A;  4FXK C;  1CQV A;  4OL7 A;  2AQ2 B;  1CTM A;  4RHS A;  4XTC S;  1IKL A;  3JAM L;  3A7A B;  2KEE A;  4FF3 A;  3DM1 A;  4R9W A;  4M1U B;  2OXP A;  5IT9 L;  3GP7 A;  1BO0 A;  2SOB A;  3NSW A;  5M9O A;  1XYI A;  1MBY A;  2R6G A;  2BA0 A;  4PQX A;  1Y69 U;  2HCI A;  3VR2 A;  1K8O A;  4XT3 B;  3RZD B;  4WFN 3;  1S4Z A;  4LK1 C;  3H91 A;  3OOC A;  3R8B A;  4KKU A;  3KF8 A;  1U4M A;  1X32 A;  5EPL A;  1II3 A;  1BNZ A;  1SE2 A;  2N88 A;  4HED A;  4M8A A;  1LTT D;  1PLF A;  5JPN C;  1KAB A;  3TP8 A;  5FO8 B;  1HCZ A;  1I6H B;  2RDG A;  1A2U A;  5EQ0 A;  5IGF A;  1U4L A;  1V1P A;  3OHX C;  2IJ0 A;  2H1E A;  1VMC A;  3J80 E;  1LLR D;  1K83 B;  2SNS A;  2EPB A;  4DF7 A;  2PPB C;  2BDO A;  1H9R A;  2WKC A;  3L3O C;  2HUG A;  3H09 A;  3QG1 A;  4X3S A;  4MIU A;  2MPM A;  1QE6 A;  1ROD A;  1CM9 A;  4C2M B;  2R7Z B;  1G8Z D;  4ABN A;  2CHB D;  2F0J A;  3GV6 A;  2PMZ B;  1I4G A;  5IOD A;  4LJZ C;  4PV1 C;  4KD4 A;  3NPP A;  3VR5 A;  3TZD A;  1D1K A;  3OIP A;  1SND A;  4Z9C B;  4O42 A;  3I4M B;  4IUR A;  2EVB A;  2F0N A;  1CZG A;  3SK6 A;  1IHZ A;  1LT4 D;  1O78 A;  2X6L A;  2XRS D;  4PMC A;  3V05 A;  3CHB D;  3VA7 A;  1XX8 A;  1IYV A;  1KDA A;  1BXT A;  4TQU S;  3U9O A;  1V1P B;  3BYY B;  3AU7 A;  1STN A;  4K14 A;  3QIA A;  2A6H C;  4A3E B;  1EYD A;  3V2T A;  2EJG C;  1NSN S;  3E0J A;  1ESR A;  1D5Z C;  4XQJ A;  1G6Z A;  4L6T B;  5I2X A;  4HCE A;  2YYZ A;  5IOC A;  1TS4 A;  2EOT A;  2F0U A;  4ZAI A;  2B2Y A;  5M3F B;  3S17 B;  2FFK B;  1ESF A;  3M4Y A;  1HQM C;  1A15 A;  3NQT A;  1CA5 A;  1ZYR C;  1HTP A;  1G2T A;  2F0D A;  4DU9 A;  4E6I A;  2EY6 A;  1EY9 A;  4IUN A;  2ZXR A;  4HAE A;  2O5I C;  4DK1 A;  1MSH A;  4A3G B;  1QG7 A;  5FLX L;  2RBM A;  1Q1E A;  4LAA A;  2PW7 A;  2WAC A;  5D65 A;  3MFY A;  4C3J B;  5AFW A;  5LL6 X;  1LTB D;  4V0B A;  4B9X A;  2F0O A;  1QJO A;  4KKT A;  5J1Z A;  3D4R A;  3Q24 A;  1BCP D;  2AWO A;  3NP8 A;  4CKC A;  3GTP B;  3MAQ A;  3EVQ A;  2C9O A;  4PNY A;  1TS3 A;  1J8I A;  1WTO A;  4RGM A;  1STA A;  3RZO B;  4BBR B;  1EOT A;  3NQI A;  2XIW A;  2DN8 A;  1LTA D;  4XXE A;  1QWY A;  4FO2 A;  2EY2 A;  3QWN A;  3V96 A;  1STH A;  5HGT A;  1A2T A;  1JCK B;  1CA6 A;  1O7Y A;  3QOJ A;  5I9P A;  1B9N A;  1LAB A;  3NTI A;  1SXT A;  3M4O B;  1PTO D;  2ICI A;  1QOH A;  3TDQ A;  5KIX A;  3SK8 A;  1RJT A;  1W6J A;  1C48 A;  4ZUJ A;  2RQX A;  3KK7 A;  2BDN A;  2B2W C;  1EZ8 A;  4KHZ A;  3NTH A;  4N9T A;  1I4H A;  4QB4 A;  4BA2 I;  3C2P A;  1SYC A;  3DMU A;  3D6C A;  2K03 A;  4ODG A;  2J4X A;  2NN6 I;  1SBB B;  1L0Y B;  2TMP A;  4XQQ A;  1EYC A;  1I6V C;  2XSC A;  3RMH A;  3C3L A;  1PRT D;  3I4N B;  4ZQ3 A;  3GO5 A;  4HMJ A;  4K8I A;  4LMQ D;  1HUN A;  1D6E C;  5C0X J;  2K5D A;  3H6M A;  3E6Z X;  3P75 A;  5CGK A;  4KKS A;  4K2L A;  3K5N A;  4IQZ A;  2JSO A;  1MD2 D;  1U4P A;  4KY7 A;  3NHH A;  3FDT A;  3VA5 A;  4C3J G;  1STG A;  2B2T C;  2NVX B;  2Z4I A;  2I46 A;  5CBE E;  1E2W A;  4BS9 A;  4KY5 A;  1DCZ A;  4FXG C;  2K32 A;  1VDZ A;  3QOL A;  2XNA C;  3TP5 A;  4F87 A;  2A69 C;  2K7V A;  3NTK A;  1FR3 A;  4RHR A;  2A69 D;  3NWT A;  3M7G A;  1F9R A;  1IL8 A;  3SEB A;  1RTN A;  4ZLT F;  3K57 A;  4FXD A;  2FHT A;  3RD4 A;  5ELB A;  2HCC A;  3PIO 3;  3O13 A;  5I4D A;  2EYL A;  3NK9 A;  2NN6 G;  1A3V A;  5BN3 A;  1Y1V B;  1LAC A;  1SYG A;  3S1R B;  5C5L A;  4DAY A;  1VF5 C;  2RVL A;  4RA8 A;  2HDM A;  1JQY D;  1AEX A;  3L7Z C;  1OXU A;  1OXV A;  1S5D D;  3Q0A A;  5DAU A;  2RDF A;  4EQP A;  1AFP A;  5ELD A;  4X3T A;  1DOL A;  3EFX D;  1EY4 A;  5KNC A;  4IUT A;  4ZRZ A;  4DGZ A;  1NR2 A;  3PUW A;  5IGG A;  1EIG A;  1ML0 D;  1HHV A;  1KAA A;  2EY1 A;  2PZT A;  3I4L A;  5JVH 3;  1G29 1;  4QUC A;  4GZY C;  2K04 A;  1MGS A;  1STY A;  3M85 A;  1GXD C;  1TWC B;  2LY7 A;  3I73 A;  3A8K E;  2DNE A;  4OO1 G;  1R9T B;  3GTJ B;  2RSN A;  1YNN C;  4DAV A;  3Q23 A;  3CRL C;  3DEO A;  4QMG A;  1Y8O B;  1YNN D;  3VYU A;  3BVZ A;  5C4Z A;  1TY0 A;  1VMP A;  3AB9 A;  3M7N A;  5C0X G;  1GUO A;  1RTO A;  2WP8 J;  1ONL A;  3Q6S A;  1EL0 A;  3IFT A;  1FNW A;  1SMY C;  1PXU A;  4CJ0 B;  1SJH D;  5E4W C;  2KUM A;  2IWH A;  3W2D A;  4I7Z C;  3LX0 A;  2MP1 A;  3D3R A;  1GUS A;  4IN3 A;  2F03 A;  1EIH A;  1HPC A;  1EEI D;  3GTK B;  2A68 C;  4DXF A;  4XDX A;  5A2Q L;  2G9D A;  2A68 D;  3NXW A;  1PFM A;  4A93 B;  1CZW A;  1EY5 A;  1A3U A;  3TBI B;  3MXP A;  1XXG A;  3G6J B;  1EQT A;  5ELF A;  2PZU A;  3KBX A;  1TU2 B;  5JJZ A;  2NN6 H;  5KRU A;  1ENA A;  3HP3 A;  5IIF A;  1UNS A;  2JE6 I;  4RWS C;  1Y1W B;  2KQ3 A;  2K1B A;  4KJO A;  2MHV A;  1HFN A;  1S5C D;  5C4X B;  3ERO A;  3GTL B;  5CV4 A;  3FEW X;  5FO7 B;  1Q90 A;  5K36 H;  2E2J B;  3FKI B;  3K59 A;  5COR A;  3SK4 A;  2KCC A;  3HOU B;  2AQ3 B;  2JA6 B;  4RCO A;  4C1N I;  5M5Y B;  3E5S A;  2ENB A;  3MC0 B;  4PMB A;  2X6G A;  1YNJ D;  4JK1 C;  1H9S A;  1KLG D;  2NYZ D;  2Z4H A;  2Q8T A;  4Y7N B;  4RGO S;  4RAU C;  1DOM A;  4OO1 H;  1BR9 A;  2K05 A;  5E4X A;  1L0X B;  1XWE A;  3PMF A;  1LT5 D;  3QB3 A;  1GHK A;  3GTM B;  1SE4 A;  1AZQ A;  5C5M A;  1UAP A;  2Z8L A;  4KMU C;  3MXU A;  3TP6 A;  3OMC A;  4NDX A;  2DY8 A;  5C0X H;  4KI0 A;  2E2D C;  4HTH A;  2JEA I;  1ET9 A;  4U68 A;  1Z7T A;  1S5F D;  1T5E A;  3PUV A;  1XTC D;  3RLF A;  4WRD A;  3UI2 A;  2VB2 X;  2ZXO A;  4IAL A;  2B2V C;  5D3I B;  3FRP B;  3S1M B;  2A5H A;  1B4O A;  3NWS A;  3LWE A;  5DM6 3;  4K5V A;  3KLS X;  1FGB D;  2CW0 C;  2BA1 A;  2CW0 D;  2B2T A;  2NUC A;  2FJ2 A;  3S14 B;  3VR3 A;  1MI2 A;  5CV5 A;  1B1Z A;  3J80 L;  4HN7 A;  4CGY B;  1H9S B;  2VB3 X;  3A56 A;  1DYQ A;  5G3L D;  1IKM A;  3VYR A;  2BOS A;  4DK0 A;  1JOO A;  5EBC A;  3MZ5 A;  1DON A;  4NKL A;  4KD3 A;  3MFG A;  1WTX A;  4F88 A;  3I3C A;  3KUP A;  4K5X A;  2HDL A;  1GJX A;  5KNB A;  3I72 A;  4ZKC B;  2NVQ B;  4XIG S;  4TKO B;  2O4X A;  2KVM A;  1A6X A;  2M9V A;  1BQQ T;  1RHP A;  2L4N A;  4KV6 A;  1EEF D;  3OWE B;  4ZUI A;  1BF4 A;  1KDC A;  1LV9 A;  3HKZ B;  4H44 C;  2EYM A;  1B44 D;  1HTL D;  3IAY A;  2Z1C A;  3GV3 A;  3A54 A;  2WB1 B;  5K5P A;  1TVX A;  3HGB A;  3FVQ A;  5EJW A;  4RKL A;  1F9P A;  1M4V A;  1KTK A;  2CQA A;  2JA8 B;  2EYJ A;  1A3T A;  3OSO A;  2KCN A;  4HSP A;  3K0Y A;  4O1N A;  4IUQ A;  1BCP C;  1PZK D;  1K8M A;  3D8G A;  1QIL A;  4HMI A;  1QNK A;  4KY6 A;  1ENF A;  1FNV A;  4IUP A;  1KLU D;  2ZXP A;  4IUV A;  4F8M A;  2DY7 A;  1X3Q A;  4CBV A;  1WTP A;  2ID0 A;  4CKE A;  1Q3L A;  1F2M A;  1PFB A;  1SYB A;  3IKJ A;  1WD1 A;  3ND9 A;  1OXT A;  2GA4 B;  2AWN A;  3S9W A;  2MUY A;  2FMC A;  1EY0 A;  5IGD A;  2VXW A;  1RDP D;  4R8N A;  1H9J A;  1HQR D;  2FIN B;  4H7B A;  4DN4 M;  2A74 C;  3J81 E;  4ULL A;  4OIJ A;  1PTO C;  2PNR C;  3MTS A;  1OO9 B;  1JWS D;  1S5B D;  3MA2 B;  3OW7 A;  2L1B A;  1ZKO A;  2BE5 D;  3HOW B;  2PQE A;  2EE1 A;  2SEB D;  1DOK A;  3T13 A;  1SYE A;  1TQO A;  3G7L A;  2YU9 B;  3R2T A;  3X3N A;  4P2C B;  2K28 A;  1T5X D;  3T16 A;  5LHY 1;  1RD9 D;  2TSS A;  3QO2 A;  4RGT A;  4ME5 A;  1ET6 A;  1PZI D;  3PUY A;  1EZ6 A;  1PRT C;  4HCS A;  5IGC A;  2JXM B;  4QIW B;  4IFD G;  4ZK9 B;  1EQV A;  4L63 B;  2QKI C;  4I65 A;  3CRK C;  2K6A A;  2E76 C;  2F0T A;  1RKN A;  1PZJ D;  3F2U A;  2WV6 D;  1SEB D;  1BOS A;  2F3W A;  3DEP A;  2B39 A;  4J8Q A;  1GOZ A;  4JBW A;  2VNU D;  5ELC A;  2NBF A;  1LTI D;  3R93 A;  3HRZ C;  3R3O A;  1WCM B;  3GQB A;  2WKD A;  1JC7 A;  3K5O A;  4B08 A;  2F0H A;  2EXZ A;  3J7A F;  1Y8P B;  2F0S A;  5DEH A;  5JEA G;  5CV7 A;  1E2V A;  4UAI A;  1VF7 A;  2F0E A;  5KYL A;  2WIN B;  4OO1 I;  1PFN A;  3A55 A;  3NBI A;  1SYF A;  1TS2 A;  2B2V A;  1SAP A;  1G2S A;  2NVT B;  1PTO H;  4XYO A;  4TSS A;  3MXG A;  3P7J A;  4WOR A;  3SR1 A;  4XQN A;  5C0X I;  2B8G A;  2B2U C;  5C44 B;  2RA4 A;  4RKB A;  5CV8 A;  4KK7 A;  4G7O C;  2Y0S B;  3BG3 A;  4B9W A;  2IW3 A;  2B63 B;  1JWU D;  3MEH A;  5EPK A;  4Q0F A;  5CYU A;  1QNU A;  2F0V A;  2LKV A;  2AUJ D;  3VYS A;  1IW7 C;  1IW7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...