5T1IA

Cbx3 chromo shadow domain in complex with histone h3 peptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
GAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Peptide recognition by heterochromatin protein 1 (HP1) chromoshadow domains revisited: Plasticity in the pseudosymmetric histone binding site of human HP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 3
total genus 14
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5t1iA00
3I3CA 5CBAE 2B2YC 1B2TA 3KUPA 1DOMA 2FINB 1SDFA 4X3TA 5EJWA 4R8IA 1NCVA 1MSGA 1IL8A 1JE4A 1F9PA 2M2LA 1M8AA 4X3KA 1HFGA 1AZPA 1U4LA 1HFNA 2KOLA 2L1BA 5CBEE 2X6LA 5T1GA 2MJ8A 3MTSA 2EE1A 2K1BA 4ZKCB 4IUTA 2B2YA 2K03A 1PLFA 1SAPA 1DOKA 1WTWA 2FMMA 1GUWA 3DEPA 1B50A 4OIJA 1F9SA 2L11A 3I90A 1MGSA 1F2LA 3GV6A 2B2WC 4MHEA 4O42A 2N88A 1HA6A 3G7LA 4ZK9B 1QG7A 1WTQA 1NR2A 2K04A 1MSHA 2L4NA 1G91A 3I8ZA 3QO2A 4IUVA 1BF4A 2CVRA 1X3QA 2KECA 3MWYW 4ZLTF 5CMDA 4CJ0B 1O80A 2X6GA 1QNKA 1S4ZA 3IFDA 1ILQA 1TVXA 3FPUB 2HCCA 3GV3A 1PFNA 3KBXA 5T1IA 2B2WA 3Q6SA 1EOTA 1DOLA 2HUGA 2B2VC 2K05A 4NW2A 2X69A 3ONAB 4HEDA 5E4XA 1SSOA 4IUQA 4R9WA 1RJTA 2N55A 2HDLA 5EPKA 1WTVA 1HUNA 2B2UA 1NAPA 1Q3LA 2DY8A 3R93A 1G2TA 5EQ0A 5E4WC 1CM9A 2EOTA 2DY7A 1ICWA 1B4OA 2HDMA 2KUMA 2HCIA 1B53A 1RTOA 4HCSA 1X3PA 5EPLA 1WTRA 1G2SA 4HSVA 2MPMA 4U68A 1XYIA 2RSOA 1CA6A 1WTPA 1DONA 1U4RA 2D9UA 4HAEA 1ESRA 2VXWA 2XIWA 1BNZA 2K01A 4RWSC 1WVLA 1QE6A 2FJ2A 4IURA 4CJ2C 1ZXTA 3N52A 2B2TC 4LMQD 1PDQA 2MGSA 4ZKBB 3DEOA 2Q8TA 4DN4M 1WTOA 1C8CA 2FFKB 3UI2A 2K28A 4RAUC 1U4PA 3DM1A 4IUUA 1LV9A 1PFBA 2BDNA 3I91A 1HHVA 4XDXA 1RODA 1B3AA 1BBXC 1EIHA 1WD1A 1E0BA 2J7ZA 2RSNA 3D6WA 1IKLA 5D14A 1PFMA 3SVMA 4QUCA 5AFWA 5DNFA 2KEDA 3TN2A 2MP1A 1G6ZA 1XX8A 1A15A 2B2VA 3F2UA 3H91A 2FHTA 2L9HA 4IUPA 5EPJA 2IL8A 4UAIA 2NZ1D 3IL8A 3TZDA 5COYA 1AP0A 1RHPA 2B2UC 2RVLA 2NWGA 1MI2A 1U4MA 1BO0A 1X32A 2R3ZA 1EL0A 4OIKA 1CA5A 1VMCA 4ZAIA 1O7YA 5CORA 2H1EA 2NYZD 1VMPA 1ML0D 4QUFA 2EPBA 4XT3B 1HRJA 1KNEA 1HUMA 1KNAA 2KEEA 3FDTA 3LWEA 1WD0A 2RA4A 3P7JA 1EIGA 4RA8A 1DZ1A 4XT1B 1EQTA 1RTNA 1O7ZA 1J9OA 5D65A 2JP1A 4MN3A 1JICA 2L12A 1IKMA 1AZQA 1J8IA 2Q8RE 2B2TA 1ILPA 1F9QA 4CJ1B 1NR4A 1WTXA 2KVMA 2SDFA 2JYOA 4X3UA 3HP3A 5EKIA 5JJZA 4X3SA 1F9RA
chains in the Genus database with same CATH superfamily
1YJ9A 2O5JC 1VQLA 5LMNL 5M9OA 4DV4L 1Q46A 5IYCH 3V05A 1KTKA 4K2KA 5FJ8H 5ELEA 3CCRA 4HJ9A 1HNXQ 3U4VA 3KLSX 4PZ8A 3K6OA 4JI0Q 4DK3C 2ZJQA 4ZKCB 1BCPD 1CZWA 3PIOA 1F9SA 1QUQA 1D6EC 1R4QB 4MHEA 1SN8A 2QDLA 5C44H 3AFPA 1D5MC 3Q0AA 4DAYA 3QO2A 2MQHA 3C3LA 2F0KA 2F3VA 3MWYW 1ZYRC 5L37A 2B29A 4RFBA 3GTQB 1Y1VH 1PFNA 3NPPA 2K05A 2X69A 4B3MQ 1NUCA 4EX5A 4GN5A 2K5NA 3CQZB 5A2QL 1UUPA 1JR0D 3PUXA 2R93B 1CM9A 4HSPA 3HOXG 4OWXB 5C44B 1TWCH 1X3PA 4JG2A 4DK6C 4HSVA 4P75A 1XMOL 3DXJC 1KHIA 2K01A 4A3CH 1JMCA 3L0OA 2IY5B 3A0JA 5M3MG 4L5QA 3M4OH 4A75A 4DN4M 4O1NA 4DR7L 2EQSA 3NUCA 1F2MA 1PH1A 1CSPA 2E5LL 3BJUA 3K8AA 1WCMG 4DKAC 2MP1A 1EU4A 3GP7A 4DR6Q 4DR4Q 3TZDA 3HOYB 1BUVT 3HOXH 2PMZE 5CV8A 2EJMA 1BCPC 3VA7A 5J39A 2WKCA 1I6VC 3Q23A 4ZAIA 4A3FH 2NYZD 1WOCA 3NWTA 1VS0A 4A3JB 5I2YA 2F0WA 2K5QA 4HTHA 1EIGA 4RMFA 4Y7NB 3ZYYX 1STEA 2Q8RE 5M5WH 2NZHA 1TS2A 4G7ZC 4YHHL 3HOWG 5IP7H 2CWAA 1TQOA 3T4AC 1VQIA 4I65A 4V190 5FKAC 3EN2A 5C3EH 4CDDC 1Y1VB 3W5OA 4BA1I 3GTQH 2J4XA 4QF4A 5A2QE 3J81j 4IUTA 1E2ZA 2MHVA 3CAMA 1DOKA 4FNFA 4HJAA 1CKMA 5KEEA 4DAYB 1I5FA 3FHWA 4L5RC 1BCPF 1MSHA 3PUZA 3MXPA 4CKCA 1LTID 4A3MB 3NELA 1Y14B 1O80A 3NBHA 4G7HC 2EIFA 4IPHA 1Y1WG 3I4NG 1HCZA 1STNA 4IJLA 4LFAL 2A1AA 1T9HA 4DGZA 2A68C 3FPPA 3R2IA 4LK1C 4DXGA 4IFDI 1ENFA 1VF7A 4QB4A 2F0JA 1V1OA 1TXYA 3FKIB 4LF7L 4A3GG 1E1TA 1D1KA 5C0XH 1B4OA 4ZUJA 3R3OA 2OF1A 5K5PA 5CV6A 5IWAL 4RWSC 2OWOA 2ZXPA 3BZCA 1B9NA 2JA6G 1I4QA 1Q90A 1PA6A 1SEBD 3MXNB 3UE1A 3S16H 4P74A 4WRDA 2ZTEA 4RH6A 5C5MA 1HQMC 4QMGA 1JC7A 1UE5A 4IFDG 1JWMD 4LF4L 3H3VI 2E2HH 2EVBA 2PZUA 5D14A 4YCVA 2E5LQ 4C1NK 2B2VA 3CMAA 2F0LA 5LL6S 2UUBL 2B63B 2Z1CA 4DR4L 1A2TA 1AP0A 3CCUA 4OX9Q 4RCOA 3CRLC 1IBKQ 5DM63 4JOIC 5E3FA 1RHPA 5KGUA 5FLXL 2K5VA 1L1OA 1VMCA 3GO5A 1Z7TA 4ZRZA 3K7AB 1YVCA 2C35B 3CW2C 3P7JA 2NN6I 1O7ZA 4GN3B 5I6WA 3GQBA 1U9RA 2L12A 3MZ5A 2QKIC 5EKLA 1HTPA 2XRSD 4X3UA 4L5SA 4A93H 4OELB 3PO3H 4POFA 4K2LA 5FLXE 5M3FH 2XGTA 3SEBA 2VQEL 1FD7D 3AFQA 2OEOA 1HZBA 4BXXH 4IJHA 1HR0L 4DV4Q 1HZCA 2BOSA 1SE4A 1Y8NB 1K8AC 1SNOA 3H6MA 1TS4A 3VR6A 1HFNA 3WDNA 2KOLA 3RR5A 2O4XA 2XWBB 4TKOB 1TWFH 1H9MA 1NMGA 2Z8LA 2B2YA 2K03A 3BVZA 2O5IC 2ZTCA 1WTWA 2FMMA 3QR8A 3KF6A 3I72A 1ONLA 4LF8Q 1VQ4A 2OQKA 1MGSA 4J15A 5IP9H 1ET6A 1MBYA 4PMBA 1SMYD 2KCNA 4P72A 1SBBB 1IW7C 3A7AB 1G8ZD 3MAQA 1VQKA 1S4ZA 2K4KA 2P5ZX 3CCQA 3TP5A 4DR5L 4KKTA 2JA7G 2HCCA 3GV3A 5LHY1 5C0XG 5C5LA 1SFOH 3S16B 1SSOA 2F0NA 4DV7L 2JEAI 1GHJA 4APVA 1Y69U 2BA1A 3UDIA 2B2UA 3HOXB 4NMZA 4DV2L 4JV5L 3PCOB 1EY7A 1I4PA 2K33A 2MPMA 3RLOA 3HKZB 2L0CA 4JI5Q 5M3MB 1XNRQ 1TWFB 4TRDA 1IL2A 1KDAA 1O7IA 3KLWA 1PH9A 4OONA 2CKZB 4C3HH 1VQ6A 1KL9A 4R4IA 5BR8Q 3I7FA 1JOKA 1QVGA 4H0LC 1VQFA 2AQ2B 3B6YA 1A0IA 1H9SA 3OSOA 2XN9C 4M8AA 1IYVA 1JCKB 1STGA 1EQRA 2D0OA 1DM0B 5AFWA 2SNMA 2IX3A 3F2UA 2OXPA 3X3MA 1KAWA 3ULJA 4UAIA 4POGA 1I4GA 5COYA 4O0AA 4OEMB 3JAME 1Z9FA 2GVAA 2A6ED 3K5LA 2NVQB 4CBVA 3VYRA 5JPMC 2EY6A 4FF3A 1Y8OB 5ELCA 3VA5A 3RLNA 3PMFA 3D8GA 3M3YB 3H15A 1RTNA 1DXMA 4KHVA 4JI1L 4BA2I 1LTRD 3R2TA 1ILPA 3UDGA 4CJ1B 3VYTA 3E3XA 1YNND 4KJNA 4FDBA 3SK6A 1PTOH 3HS0C 1V1PB 5M5WB 5CBAE 4K8JA 3K5MA 1LT3D 1SE2A 2E75C 1EFID 1N36Q 1Q7YC 1E2WA 2I5HA 4JI4Q 4OL7A 2HHHL 1L0YB 3I4MG 3L2PA 1S5CD 4LF5L 2CCZA 1HPCA 3CF5A 4CKEA 1EEID 2AWNA 3RLFA 2F3WA 1NE3A 1QZHA 1AE3A 3G7LA 4JI8L 1QG7A 2RDFA 1NR2A 5JJKA 4WJ4A 4GOPC 1K8OA 2CVRA 1F2ZA 3K0XA 3G48A 4CJ0B 2JA5G 2X6GA 4QJFA 1ILQA 4A3IH 4GKKQ 3QOJA 3A5ZB 2G9HD 3J80L 3BYTB 1SLJA 2HUGA 2QDBA 1PH6A 3K57A 3H09A 1I50B 3OIQA 3SXHA 1IBML 3CCLA 2UUCL 4IALA 5K36H 3KLSA 4ODGA 1Q3LA 3TSSA 2YU9B 5JEAJ 4HCSA 1RKNA 1PH5A 4CKBA 2G5DA 2TMPA 1B8AA 5JVH3 2GA4B 4YCWA 2KCCA 3S1QH 1K8MA 2H4OA 4YY3Q 4LMQD 4B08A 4HMJA 4DR3Q 3HKSA 3HOUB 3T56B 5EKKA 1JJCB 3T1YL 1RODA 1K0RA 2JA9A 4PNYA 2GVBA 4XXEA 2B63H 4OO1G 4JBJA 3GD7A 2RKSA 4JI6Q 4HIDA 2RBMA 5J22A 1F2YA 2HQEA 1N34L 2DJGC 3NE5B 1E22A 1EWCA 2E2IH 1N9WA 4UPAA 3BDLA 3NBIA 4XT3B 2KEEA 3T16A 4C1NI 4RA8A 2J0TD 2ICIA 2RQXA 3VR4A 4X62Q 1A8VA 1ET9A 5D65A 5JJLA 1JICA 4GNXB 2VL6A 5CYUA 1NR4A 3K5NA 3GTGB 2N8NA 1ICFB 2LFNA 4C3IG 5IGDA 1B44D 2UUAQ 4N8FA 2B63G 2A8VA 2B2YC 3I4MH 2FINB 1SDFA 2JA5B 4R8IA 1HR0Q 5DLQE 4WFN3 3S15B 1U4LA 4EQOA 2A69D 3OOCA 5IY0A 4AYBE 5C4JB 3E9IA 4A3LH 2JA5H 4LF8L 2HT1A 3I4MB 2D62A 4X66L 4IFDJ 1STAA 1FR3A 2LMCB 1TT2A 4L8JA 1SNQA 3I8ZA 1BF4A 3RUZA 1X3QA 3DM3A 3A5UA 2JA7B 5K36G 4DR5Q 2JK8A 1UAPA 1HNXL 3Q8DA 5BN3A 4A4IA 2A6HC 2E2JH 1FJGQ 4FVMA 5CR3A 5E4XA 4A3BH 4FYDA 4RHRA 2F0VA 5M5XH 4R4QA 3STBC 2LS01 1GUNA 2YTVA 1QILA 1EU3A 1OXSC 3S2DH 2PZTA 4JI7Q 4JI5L 2VNUD 4LF9L 4MNOA 1TY2A 2LXJA 4A3DB 4EQ5A 5H1SE 3OW7A 1EEFD 1XTDA 3CRKC 2ICEC 1JWUD 1Y1WH 1EY4A 1B3AA 3RZDB 2YYZA 2WAQG 3ERSX 1E0BA 1HA5A 3RN2A 3T1YQ 4HIKA 1PFMA 2PW5A 3E5SA 1EY5A 2GN5A 3I70A 1HZ9A 3QIAA 5IOCA 4K8IA 2B39A 4A93G 3S9WA 5ELFA 1TS5A 1STBA 3I4NH 5D3DA 3W1BA 2R92G 4J6HA 1N32Q 2R7ZB 3HOZH 1G291 2RVLA 2PYKA 3DWPA 3RZDH 5EAYA 1H9SB 1EFWA 1Q86C 5LMNQ 4LNQA 1UNSA 2H1EA 4C3IH 2VB2X 4P71A 4A3GH 4A76A 1G51A 5FO8B 2PI2A 1KDBA 4BY7H 5IODA 1OO9B 2F4IA 4HIMA 3CCMA 2A74C 2JE6I 1EZ6A 3KYHC 4FF1A 2ZM6Q 1VQCA 1QNUA 1LO5D 3ULPA 2UU9Q 3M4YA 3A8IE 2ZXRA 3LWUA 4YWMA 4C3IB 1X9NA 4GNXA 3GTMH 1K3BC 5T1GA 1M90C 4LF5Q 4GS3A 2AHOB 3W1GA 1XPRA 1PYBA 3GDEA 5FLMH 5GAEC 1EY6A 3F2DA 2Q2UA 3D4DA 3D31A 5CV7A 2ES2A 2D0PA 4K14A 1LACA 4JYAL 1RL2A 3G4SA 1D7QA 3S24A 2NUCA 4X64L 5T1IA 5IYBH 1FJGL 1TWGH 3WOFA 1LTSD 2N49A 4C3HB 2AKWB 3QB3A 2NVQH 4A3MG 4GLVB 5LMUL 4DR7Q 3ERQA 2IPKD 2F4VQ 2IWHA 2I07B 3A56A 5CC4A 3PO2G 1GJXA 4P73A 2R93H 4BXXG 3G6JB 4IUNA 5CV5A 4JI7L 1W3SA 1L0XB 3K5OA 2LSSA 4IURA 4YWLA 3OMCA 3DEOA 1C8CA 2WIIB 2K28A 3FMCA 4UP7A 3CXCA 4BS9A 4DNRB 3D0FA 1U0LA 4RKLA 5C0XJ 2R92H 2KCTA 3HOZG 3D6WA 2MO0A 2Q2IA 3S17B 3H94A 4JI6L 2CW0C 3KLRA 3M7NA 1C9OA 2K5DA 1OXUA 1MJCA 4JI3Q 2WAQB 1QZGA 5GROA 2R92B 1JOOA 3MXUA 4H02A 5JEAH 3I73A 4B3TQ 4DPGA 1O7YA 5ISRA 2F0DA 3ZJYC 3EVQA 2F0GA 5ELBA 2EPBA 3FDTA 3HZXA 4X62L 3LWEA 1VF5C 2RA4A 3S1RH 4CDFC 1A3VA 1L2FA 5M5YB 2R7ZG 2KHJA 3BDOA 1HXYD 1YITA 1UWVA 2PO4A 1MD2D 1KC8C 5AJ3L 1WTXA 4OX9L 1IBKL 3VR5A 1HTLD 1F77A 3QWNA 4YCUA 2A68D 3KFUA 1KIXA 3K58A 2M9VA 1F9PA 1STHA 2WINB 1E3PA 1VQDA 1KD1C 3S14B 1DGSA 2X6LA 3PF5A 3O13A 2K1BA 1IBLL 1XMQQ 1A63A 4IOAA 3C46A 4PZ6A 3NTIA 2EY1A 2MFIA 4DUYQ 1EYAA 4DAPA 3RD4A 1G91A 2KHSA 4LFCL 5BN4A 2CHBD 1PXUA 2Y0SG 1AN8A 2ZJRA 4DV5Q 3U4ZA 1CK1A 4DV3L 3PUWA 1PZID 3FPUB 1O78A 1CHQD 3GTPB 1YNJD 4IPDA 2B2WA 5CV4A 1DOLA 3NBHB 3J81c 4NXML 4R9WA 1K83B 4AH6A 2QCPX 1E7ZA 1WTVA 1X3GA 4JBWA 5ELNA 2F1MA 4HIOA 3BDCA 4JBMA 1CI3M 3HOYH 4A3CG 4G4KA 2PZWA 2LXKA 4GOPB 4OO1H 2NVYH 4GLXA 1BCPB 5JJZA 1SYEA 1CA6A 1S40A 4K0KQ 1OXXK 4KMUC 3ICEA 2EY2A 5I2XA 2AWOA 3VR3A 1LT4D 1XPOA 4KKUA 2IHFA 3K59A 3EFXD 2FXQA 1V43A 4F87A 2B2TC 3HFZB 1MHWC 3BS1A 2PNHA 1I4HA 1LV9A 1N8RC 1BQQT 1Q81C 1WD1A 4JBKA 3SDZA 4A3KG 4OO1I 4YIJA 2KEDA 2Z6KC 1OXTA 4IUPA 5EPJA 1XNRL 1Z6HA 2VUMB 4MIUA 1TWAH 2UUBQ 2Y0SE 1HNWL 4TVAB 1X32A 2PQAB 1V8QA 1A3UA 3VDYA 4FO2A 1SROA 4KY5A 1E24A 1XWEA 2EYOA 3T1HQ 1C0AA 1EQTA 1J9OA 3AB9A 1I6HH 1Y8PB 1TS3A 4OWWB 4O2DA 4PV1C 3TREA 4KHPQ 2VW9A 1D2BA 3D6CA 5GAHC 5LL6X 1CZGA 3M3YH 4UDUC 2EXDA 2M2LA 3ND9A 4EQNA 4QGUA 2F0SA 4LJZC 4M1UB 1SNPA 1SFOB 1LLRD 1A62A 4A3EH 1IBLQ 4BY1H 4KHZA 1I4RA 2L15A 2F0TA 2NZOA 2JJQA 5KIXA 1BVSA 3S1MB 1SYDA 4ZK9B 1WTQA 4B9XA 4K6DA 3E6ZX 1Q12A 1I3QH 3W2DA 1VQJA 2BA0A 4AQYL 1K0SA 4JI4L 2WAQE 3L3OC 4X64Q 2DGYA 2OQ0A 3CP0A 4NW2A 1R9TB 3J7AF 5BR8L 3A8JE 3BG3A 3L7ZC 3BVGA 3VR2A 3J81i 1I3QB 1NAPA 2A19A 2K6AA 3NP8A 4DV2Q 4JV5Q 2EJGC 1RTOA 3V96A 4DR1L 2NVYB 2XVSA 1EIFA 4A3LG 1JJGA 1U4RA 1SMYC 4PMWA 4IFDH 1IW7D 3IKJA 3I55A 1CKNA 1KAAA 2MNAA 1GHKA 1T5XD 3N52A 1VQ8A 2K14A 1IBMQ 1ASZA 3DM1A 5CV9A 2VQFQ 1CKOA 4B3SQ 2XSCA 3TP8A 1LT6D 3MFGA 3OHXC 4ID6A 1BBXC 4BY7G 2J7ZA 1EIHA 1SE3A 3E0JA 4A3BG 2K5WA 4RHSA 1SYFA 1Q1BA 3EA6A 2K7VA 5I9OA 1Q1EA 1PHJA 2AQ1B 4DF7A 3ITPA 4RGNA 1HZAA 5KNBA 4HMIA 2RDGA 2F0IA 3UDXA 4HJ5A 1PH7A 4DR3L 1UE1A 3U58A 5KYIA 3HOUH 3CD6A 1ML0D 3T51B 2E76C 3J7ZC 5M3FG 3P75A 3PO3B 4KV6A 2F0HA 4WORA 1ZKOA 2R61A 4DV0L 2NTTA 4WJWA 4IPGA 2V1CC 4PQXA 3TMEA 3J80E 1JE4A 1H9JA 1IYJB 1E2VA 3PUVA 1N36L 1YJNA 1FNVA 3U9SA 1X6OA 5CBEE 1D5XC 2DNCA 4J8QA 2KENA 3DHQA 3M4QA 1IHZA 5IIFA 4B3ML 1FNUA 1VQNA 1GUWA 2ALYB 2B2WC 1JB3A 4LFCQ 3S1MH 4X65L 4JI8Q 3D3RA 1KRSA 4ZQ3A 4R4OA 3PV0A 4FF2A 4BY1B 3IFDA 4DK1A 1D5ZC 1TVXA 1MKHA 3DLLA 3HOVH 2FMCA 4GKKL 4UY8C 4NP5A 3ONAB 4HEDA 4RGMA 4X6AH 4X66Q 1VQPA 2QW7A 1FYCA 2WV6D 1W2BA 3TQYA 3NTKA 5NUCA 4OWTB 1KDCA 4PG3A 2QA4A 4TQUS 1EYDA 2NVTH 4HAEA 1LTTD 1EWHA 4R4CA 2VY3A 3KJPA 1MIUA 4XQNA 1QB5D 1TWGB 4BWGB 1Q8IA 3EIVA 2TSSA 4ZKBB 1PH3A 3NQTA 1M4VA 5JOBA 1PFBA 4L63B 2ASBA 3K81C 1QJOA 1LABA 5IGGA 2G9DA 4OXPA 4U673 3H91A 4IOCA 2WB1E 3GTGH 5C6AA 2NZ1D 5TSSA 1T5EA 2UUAL 1I4XA 1TKWB 4L6TB 1CA5A 1O7LA 4EVOA 1VMPA 1X3FA 4QUFA 3I56A 2PNRC 4ULLA 2I0QA 4IPCA 5FO7B 1JORA 3ER0A 4MN3A 4AYBG 5JAVA 1IKMA 1F9QA 2B8FA 3P1HA 1ENCA 2QILA 4MTNA 1LTAD 1F9RA 2ENBA 5IYCG 2SEBD 3SE0A 3KUPA 5IT9L 3PO3G 1HFGA 4QQBX 1KQSA 3ND8A 3STBD 2QEJC 3NWSA 4GZYC 1W6JA 3MTSA 1X55A 1TWAB 2E2DC 4KLKA 1PH4A 3DEPA 3SK5A 3I90A 1UE6A 2RCNA 4LF7Q 2OT2A 2L4NA 3F2CA 4C3JG 1S5ED 2H5XA 5CMDA 1C4QA 5FK9C 1TWHH 3A8KE 1I50H 3KF8A 2F0OA 4I7AA 3M4OB 1W6KA 3DUZA 5DEHA 2RDHA 2N55A 3TP6A 1SRUA 3H0GH 4S3SA 3A55A 3MHBA 5EQ0A 1PFSA 5C3WA 2HDMA 3DWQA 4DR1Q 5JVG3 4GKJL 2F0MA 2PW7A 3RZOB 1NY4A 2F52A 1AEXA 4LFAQ 4JPBW 4DK0A 5M5XB 1SYBA 1ENAA 3G71A 2VQFL 1XPUA 2FFKB 5IGBA 5FJ8G 2E2JB 2EYFA 4XDXA 4KI0A 2YV5A 4LF6Q 2F4VL 2LKVA 2ZT9C 3CC7A 4OHJA 4QUCA 5DNFA 3J7A5 4N9TA 3PIPA 3HOWB 1U5KA 1B7YB 2L9HA 2NB0A 1KABA 3CHBD 5IE8A 4RKBA 1II3A 1YHBA 3TZUA 2Z0SA 2B2UC 1U4MA 3M9BA 1CSQA 3PIP3 1N32L 1FNWA 3TDQA 4KN4C 5C4JH 2CWPA 4NKLA 1Y1VG 5CORA 3MA2B 3TBIB 3HOYG 3MEFA 1DZ1A 4JK1C 4A3EG 3SGIA 2VZAA 1AZQA 2B2TA 4N8X1 3CU7A 4AYBB 2RCFA 2SDFA 2VB3X 4FXDA 3H3VC 1FVIA 1H9RA 4ME3A 1QVFA 1B70B 1PH2A 1S72A 4C3JB 3I3CA 1GXDC 2WFWA 4R4TA 4P2CB 4UHVA 4B3TL 5C4XH 4FF4A 4PMCA 2R6GA 3GTLH 1R9TH 3S2HB 1IXRA 4ZCKA 2KA7A 3T13A 3GTOB 2EYLA 4K5XA 1OXVA 2EYHA 4NXNQ 2MJ8A 1GOZA 4G57A 2Y0SB 4TSSA 4MZ9A 1PYSB 2AUKA 2L11A 1F2LA 2N88A 2BE5D 2OTJA 3FP9A 1NNXA 1VQEA 4ZLTF 2B3GA 5IWAQ 1EY8A 2PMZB 1JOQA 1KXLA 1YHQA 3NK9A 3NHHA 2KBNA 4DNTB 4RCNA 4LUVA 2HDLA 4DUYL 5HURA 1QVCA 1B53A 1WTRA 4E6IA 2RSOA 5HY6A 3JAMc 1ESRA 2UXDQ 2N3SA 1SXTA 3EBEA 1GUSA 2PQAA 2CFMA 3EROA 3NTHA 4KK7A 4NPSA 2I5MX 2E74C 4NXMQ 3HOUG 3PIO3 2NVXB 1WTOA 1BDOA 4DV7Q 4A3FB 2EYPA 3S14H 2YTYA 5EBCA 2IX0A 4A3IB 2YTXA 1YIJA 1HHVA 5M3MH 3KF6B 4DV1Q 3KK7A 2C5CA 1SJED 5G3LF 3QJYA 4FP5D 1HNZQ 2F0QA 5AJ3Q 2ATWA 1AH9A 1QCBD 4C56C 1JT8A 1YZ6A 1EUJA 2R3ZA 3OMGA 4JI2L 1V1PA 2JEBI 1SJHD 5KNDA 2AQ3B 2PQEA 4DAMA 5IGEA 1B3QA 1KNEA 1KNAA 4HCEA 4FXGC 2NN6G 1SR3A 5FLXc 3K0YA 3K7UC 3CKIB 5I6YA 3HEJA 4V0BA 1J8IA 2KCMA 1IZ6A 4R1JA 2O2LD 4R8NA 4XQJA 5IT9E 2CW0D 2Z4IA 5EBDA 1CUKA 1ZYRD 5F2DA 2UXCL 4HJ8A 1M8AA 3OIPA 3OYYA 4A3JH 4DV5L 4HN7A 5FLMG 3T1HL 1LUZA 2L1BA 1BBUA 2EE1A 2HQLA 1YNXA 4K6LA 5DAUA 4DR2Q 5CGKA 1SNDA 2A69C 3GV6A 4O42A 1PRTC 1NMFA 4Q5VA 2DNEA 1KLUD 2VS1A 1PTOC 1ESFA 3S1NB 4OGQC 1M1KC 4H13C 1DYQA 3S1RB 2JA8G 2N78A 3BYYB 1UEBA 4QY7A 1FL0A 5C3XA 4UP9A 3OTOQ 3GTLB 4DUZQ 3S2HH 2JXMB 4MTKA 4NB3A 1MJEA 1HUNA 1XTCD 3R93A 1G2TA 2RHQB 5C4HA 3JC66 5KNCA 1DD2A 3PQIA 2KUMA 2HCIA 2I46A 4J1MA 3TEHB 4ZYSA 1DONA 4GKJQ 2RHSB 3EQLC 2VXWA 3JAMi 2MO1A 1PZKD 4JC0A 3SHLA 1VQGA 2Q2TA 3U50C 1GM5A 4A3BB 2MGSA 2K75A 2L5TA 3MEHA 4F88A 2Z4HA 1SYCA 4KTAA 5IT9c 4DV6L 5C3EB 3OWFA 1SE8A 2CQOA 4RGTA 1I94L 1BXTA 2BH8A 1STYA 4LUOA 4BBSG 3EJIA 4DV1L 3LGJA 5JJIA 1A15A 3KJOA 1GKHA 2XTIA 2IL8A 3FKIH 1YBYA 4DA2A 4KHPL 1VQHA 5A35A 3PGZA 2NWGA 2Z9HA 1XJVA 2JA6B 1DCZA 5IYBG 4I7ZC 1R4PB 2KJXA 3VYUA 1HRJA 1PRTD 1VQ9A 1YHAA 4A3MH 2EYMA 3Q24A 5JPNC 1BKBA 1SNMA 3M4PA 1PZJD 2KVMA 2WB1G 1N34Q 1RF2D 3TP7A 3CC4A 1L1OB 2SOBA 1DOMA 2JA8B 1MSGA 4RGOS 3GTMB 3MXNA 3HG9A 3FRPB 4Y52H 1YJWA 1QUQB 1TWHB 3DMUA 4A3DH 2EY5A 3H0GG 1JWSD 4IN3A 3GTKH 2Q2HA 2JA8H 1RIPA 1ZEQX 2R7DA 3AYHB 4OIJA 3TS2A 3IRBA 4EQPA 5IGFA 1HA6A 2F0EA 5J1ZA 4XIGS 3M85A 4LW1A 2ZM6L 1I6HB 2CH4W 2XWJB 2K04A 3QG1A 1NBWA 2KHIA 4B3RQ 1XMOQ 2E2HB 2ID0A 4PZ7A 4RG1A 1QNKA 1K83H 3CCJA 4JVZA 2HIXA 3AEVA 3KBXA 3PO2B 1NJIC 5KRUA 3OTOL 1X65A 2R7ZH 1RJTA 5EPKA 4BBSB 2VUMH 4QIWE 1AFPA 2DY7A 4KD4A 4QIWB 1S5FD 4QCLA 2YU9H 2UXBQ 4CGYB 2F0UA 4ZUIA 3H3VH 2PI2E 2D9UA 1EYGA 4ABNA 1BNZA 1WVLA 3RMHA 3D4RA 1LM0A 5FOBB 5I9PA 2R93G 1CHPD 1AW7A 1ZXTA 1TU2B 2Z6KA 1Q82C 1EQVA 1PDQA 4JCVE 2Q8TA 3FEWX 1JE5A 2BDNA 3HOZB 1CT1D 4C3HG 2LY7A 2RSNA 3CCVA 2NBFA 3S1NH 1I94Q 1TWCB 4C3JH 1G6ZA 2WB1B 3S2DB 3J81L 4LF9Q 3IL8A 3KBGA 4EGVA 5HGQA 1JQYD 4FXKC 4YHHQ 5M5YH 1PRTF 5C4XG 2QF7A 1AE2A 1EY9A 3K7AH 1H95A 2F0PA 2V4DA 1N33Q 5FO9B 3E9HA 3KF8B 4DAVA 3F8TA 2UU9L 4LF4Q 1YEZA 1QWYA 1GVPA 1HQRD 3BVMA 1A3TA 2NTSA 3W3AA 3HP3A 1WJJA 5EKIA 1K9MC 1TR5A 3M7GA 1B2TA 4X3TA 3WWVA 3RNUA 3CC2A 1IL8A 2AUJD 4X65Q 2UXCQ 4X3KA 1G6PA 4C2MH 1BOSA 2B8GA 1AZPA 1K28A 3MVVA 1VQAA 5GQOA 4H7BA 2L55A 2CH4A 1CQFA 1RDPD 1EIYB 1B50A 2AMCB 4KN7C 5IGCA 4DR2L 3L9AX 5D3IB 3I4OA 2Q8IB 2VQEQ 3QOLA 1EY0A 3FVQA 1OTCA 3J7AV 1B9MA 4IUVA 3BZDB 2BDOA 2KECA 4K5WA 3D4WA 3H0GB 3GTKB 3MXGA 2D2CC 4BY7B 1LTLA 3C1EA 1EZ8A 1LT5D 1XNQQ 3GTOH 1XMQL 4Q0FA 1JJ2A 1EOTA 1H9KA 3SK8A 3SK4A 4GOPA 3A74A 1QOHA 3NQIA 1S5DD 2DY8A 4LFBQ 5E4WC 3I4NB 3K80C 3V2TA 2IX1A 3S17H 4A93B 3UDFA 5EPLA 3ULLA 4U68A 3OW2A 2UXBL 3NSWA 5DM73 1K73C 2XIWA 1SMXA 3CPWA 1S3OA 5I4DA 3C1FA 4CDEC 4CJ2C 3TRZA 4A3KB 2DUDA 5IP7G 2K52A 3HKZE 1J6QA 3N6RA 4CHTB 2E2IB 1J5EL 4RAUC 5C3EG 3UE0A 2IW3A 2IHEA 4BY1G 4H44C 4LAAA 3GTJH 4K0KL 2QEXA 1YI2A 4QL5A 3J7YW 3AQQA 1XXGA 2R7FA 3TN2A 4DFAA 3KDFB 1A6XA 1CQVA 2FHTA 2E8GA 4XYOA 4GNXC 1C48A 2WACA 3LNNA 1P8LA 3AU7A 4XQQA 1EYCA 1WI5A 4Y7NH 3A54A 3GTJB 2PPBC 4DU9A 2PCFB 3CQZH 4OIKA 1VCIA 5J3BA 3OPOA 4F7XA 1VQMA 4LF6L 4JI1Q 1BBWA 1UEAB 5C4XB 2JP1A 4XTCS 3SR1A 2Z6BA 3P20A 2XRQD 1WCMH 4N9PA 4KY7A 1VDZA 2F3IA 1GD7A 5ELOA 5EJWA 4GN4B 1S5BD 1VQOA 1NCVA 1RD9D 1YNJC 1A2UA 2NVXH 2JSOA 4JYAQ 4DV3Q 4F8MA 2JA6H 4BBRG 3AMUA 1PLFA 2BCOA 4G7OC 2IJ0A 4LUZA 2NVTB 1TIID 5LMUQ 4KY6A 1LYLA 3HOWH 2DJFC 1PH8A 4B3RL 2XNAC 2EXZA 3PF4A 2EZVA 1YNNC 2NN6H 2HHHQ 2QGQA 3Q6SA 1FGBD 2B2VC 5ELDA 3HKZG 2UUCQ 5G3LD 4IZ8A 3T53B 3IFTA 1KLGD 4B9WA 2EOTA 1PTOF 1GUTA 1X54A 1L1OC 1ICWA 2SNSA 1G2SA 3BZKA 1XYIA 1WTPA 3U9OA 4A3JG 2A6EC 2RF4A 1C7YA 3X3NA 1HJPA 1QE6A 5BN5A 3Q22A 3A7LA 1HNWQ 4JI3L 3CCSA 1X56A 3E0EA 3JAML 1CKNB 2EDGA 3UI2A 2M00A 1J5EQ 1RCVD 3I91A 5IYDH 3J81E 2BH2A 3LX0A 1IKLA 2OTLA 3SVMA 4HR7B 2K32A 1XX8A 4DR6L 2ZXOA 1CTMA 2UXDL 1D1IA 1WCMB 5JEAG 1EQQA 1V1QA 1EL0A 1MI2A 1N33L 4L5TA 3URYA 4UP8A 2ZTDA 1ASYA 3HOVG 2D5DA 1GO3E 2HD3A 1Q8KA 4C2MB 3I4LA 1SNCA 1HUMA 4HJ7A 4IO9A 2JA7H 3WOEA 3PSIA 4A3DG 4DNIA 5E7NA 1B1ZA 5IYDG 4K5VA 1HNZL 1X3EA 2C9OA 4WJ3M 4IQZA 5LMNW 1LTBD 4KD3A 1K3RA 4X3SA 1LTGD 4BBSH 4BBRH 1FGUA 2K5HA 2IT1A 1BR9A 1WFQA 1PRTB 4ILWA 3HRZC 3FKIG 4AQYQ 3CMEA 4A3GB 2OCEA 3OWEB 2JQOA 1TY0A 4JI0L 3GTPH 3DWAA 1KRTA 2DN8A 4NXNL 5HGTA 3S1QB 3J80c 1JB7A 2A73B 1SAPA 3C2PA 5M3FB 2JN4A 4BBRB 3RZOH 1VQ7A 2F03A 1PTOB 4DV0Q 1IYUA 1VQBA 1Z47A 1NSNS 2WP8J 4YWKA 5EGTA 3HGBA 3IAYA 3J80i 5GADC 1SYGA 1XNQL 1PYWD 3G6EA 2KQ3A 1Y1WB 5C4ZA 5C44G 2I5LX 3F1ZA 3CPFA 4YY3L 1V9PA 4IUQA 1PV4A 3KOJA 1HH2P 4LWCA 1PVOA 1UE7A 2EJFC 4GLAC 1EOVA 1K8GA 4LFBL 4ALPA 3BU2A 3PUYA 1D8LA 5IP9G 5GAGC 1PMRA 5KYLA 2BE5C 4CDCC 3I2ZA 4Z9CB 1VQ5A 3VYSA 1CFMA 2FJ2A 1PTOD 4A3EB 1L0WA 1DJRD 1P16A 5E1FA 2K50A 3PO2H 1NTGA 2WKDA 4DUZL 2F0FA 3NEMA 1U4PA 4IUUA 4A3KH 3F2BA 2A6HD 1EWIA 1GUGA 4ME5A 4DXFA 2ZJPA 2HIVA 2MUYA 1HR0W 3RN5A 2VUMG 3TS0A 3MFYA 2CQAA 1BO0A 1GUOA 1WYDA 4JI2Q 4B3SL 3CCEA 4DV6Q 3HOVB 4KJOA 3S15H 3MC0B 3NXWA 1WD0A 4JW0A 4XT1B 1E1OA 1WTHA 4JOIA 4AIMA 3NENA 5C0XI 2EYJA 4NDXA 4A3FG 3R8BA 2JYOA 2A5HA 4A3IG 4KKSA 4XYQA 3KDFA
chains in the Genus database with same CATH topology
2O5JC 5M9OA 3V05A 1KTKA 4K2KA 5ELEA 3KLSX 3K6OA 4ZKCB 1BCPD 1CZWA 1F9SA 1D6EC 1R4QB 4MHEA 1D5MC 3Q0AA 4DAYA 3QO2A 3C3LA 2F0KA 2F3VA 3MWYW 1ZYRC 4RFBA 3GTQB 1PFNA 3NPPA 2K05A 2X69A 1NUCA 3CQZB 5A2QL 1UUPA 1JR0D 3PUXA 2R93B 1CM9A 4HSPA 5C44B 1X3PA 4HSVA 3DXJC 2K01A 4DN4M 4O1NA 3NUCA 1F2MA 2MP1A 1EU4A 3GP7A 3TZDA 3HOYB 1BUVT 5CV8A 2EJMA 1BCPC 3VA7A 5J39A 2WKCA 1I6VC 3Q23A 4ZAIA 2NYZD 3NWTA 4A3JB 5I2YA 2F0WA 2K5QA 4HTHA 1EIGA 4Y7NB 3ZYYX 1STEA 2Q8RE 1TS2A 4G7ZC 1TQOA 3T4AC 4I65A 4V190 5FKAC 1Y1VB 4BA1I 2J4XA 4QF4A 5A2QE 4IUTA 1E2ZA 2MHVA 1DOKA 4FNFA 5KEEA 1BCPF 1MSHA 3PUZA 4CKCA 3MXPA 1LTID 4A3MB 1O80A 3NBHA 4G7HC 1HCZA 1STNA 4DGZA 2A68C 3FPPA 3R2IA 4LK1C 4DXGA 4IFDI 1ENFA 1VF7A 4QB4A 2F0JA 1V1OA 3FKIB 1D1KA 5C0XH 1B4OA 4ZUJA 3R3OA 2OF1A 5K5PA 5CV6A 4RWSC 2ZXPA 1B9NA 1I4QA 1Q90A 1SEBD 4WRDA 4RH6A 5C5MA 1HQMC 4QMGA 1JC7A 4IFDG 1JWMD 2EVBA 2PZUA 5D14A 4C1NK 2B2VA 2F0LA 5LL6S 2B63B 2Z1CA 1A2TA 1AP0A 4RCOA 3CRLC 5DM63 5E3FA 1RHPA 5KGUA 5FLXL 1VMCA 3GO5A 1Z7TA 4ZRZA 3K7AB 3P7JA 2NN6I 1O7ZA 5I6WA 3GQBA 1U9RA 2L12A 3MZ5A 2QKIC 5EKLA 1HTPA 2XRSD 4X3UA 4K2LA 5FLXE 3SEBA 1FD7D 2OEOA 2BOSA 1SE4A 1Y8NB 1SNOA 3H6MA 1TS4A 3VR6A 1HFNA 3WDNA 2KOLA 2O4XA 2XWBB 4TKOB 1H9MA 2Z8LA 2B2YA 2K03A 3BVZA 2O5IC 1WTWA 2FMMA 3I72A 1ONLA 1MGSA 1ET6A 1MBYA 4PMBA 1SMYD 2KCNA 1SBBB 1IW7C 3A7AB 1G8ZD 3MAQA 1S4ZA 3TP5A 4KKTA 2HCCA 3GV3A 5LHY1 5C0XG 5C5LA 3S16B 1SSOA 2F0NA 2JEAI 1GHJA 1Y69U 2BA1A 3HOXB 2B2UA 4NMZA 1EY7A 1I4PA 2K33A 2MPMA 3HKZB 2L0CA 5M3MB 1TWFB 4TRDA 1KDAA 1JOKA 4H0LC 2AQ2B 1H9SA 3OSOA 2XN9C 4M8AA 1IYVA 1JCKB 1STGA 1DM0B 5AFWA 2SNMA 2IX3A 3F2UA 2OXPA 3X3MA 4UAIA 1I4GA 5COYA 3JAME 2A6ED 3K5LA 2NVQB 4CBVA 3VYRA 5JPMC 2EY6A 4FF3A 1Y8OB 5ELCA 3VA5A 3PMFA 3D8GA 3M3YB 1RTNA 1DXMA 4KHVA 4BA2I 1LTRD 3R2TA 1ILPA 4CJ1B 3VYTA 4KJNA 1YNND 3SK6A 1PTOH 3HS0C 1V1PB 5M5WB 5CBAE 4K8JA 3K5MA 1LT3D 1SE2A 2E75C 1EFID 1E2WA 4OL7A 1L0YB 1S5CD 1HPCA 4CKEA 1EEID 2AWNA 3RLFA 2F3WA 3G7LA 1QG7A 2RDFA 1NR2A 1K8OA 2CVRA 1F2ZA 4CJ0B 2X6GA 1ILQA 3QOJA 3J80L 2G9HD 3BYTB 2HUGA 2QDBA 3K57A 3H09A 1I50B 3OIQA 3SXHA 4IALA 5K36H 3KLSA 4ODGA 1Q3LA 3TSSA 2YU9B 5JEAJ 4HCSA 1RKNA 4CKBA 2TMPA 5JVH3 2GA4B 2KCCA 1K8MA 2H4OA 4LMQD 4B08A 4HMJA 3HOUB 3T56B 5EKKA 1RODA 4PNYA 4XXEA 4OO1G 3GD7A 2RKSA 2RBMA 5J22A 1F2YA 2HQEA 3NE5B 1EWCA 3BDLA 3NBIA 4XT3B 2KEEA 3T16A 4C1NI 4RA8A 2J0TD 2ICIA 2RQXA 3VR4A 1ET9A 5D65A 1JICA 5CYUA 1NR4A 3K5NA 3GTGB 2LFNA 4C3IG 5IGDA 1B44D 2B2YC 2FINB 1SDFA 2JA5B 4R8IA 4WFN3 3S15B 1U4LA 4EQOA 2A69D 3OOCA 5C4JB 3I4MB 2D62A 4IFDJ 1STAA 1FR3A 2LMCB 1TT2A 4L8JA 1SNQA 3I8ZA 1BF4A 3RUZA 1X3QA 2JA7B 5K36G 1UAPA 5BN3A 2A6HC 4FVMA 5CR3A 5E4XA 4FYDA 4RHRA 2F0VA 2LS01 1GUNA 1QILA 1EU3A 1OXSC 2PZTA 2VNUD 1TY2A 4A3DB 3OW7A 1EEFD 3CRKC 2ICEC 1JWUD 1EY4A 1B3AA 3RZDB 2YYZA 1E0BA 1HA5A 1PFMA 2PW5A 3E5SA 1EY5A 3I70A 3QIAA 5IOCA 4K8IA 2B39A 3S9WA 5ELFA 1TS5A 1STBA 5D3DA 4J6HA 2R7ZB 1G291 2RVLA 2PYKA 3DWPA 1H9SB 1UNSA 2H1EA 2VB2X 5FO8B 1KDBA 5IODA 1OO9B 2F4IA 2A74C 2JE6I 1EZ6A 4FF1A 1QNUA 1LO5D 3M4YA 3A8IE 2ZXRA 3LWUA 4C3IB 5T1GA 1EY6A 3D4DA 3D31A 5CV7A 4K14A 1LACA 2NUCA 5T1IA 3WOFA 1LTSD 4C3HB 3QB3A 3ERQA 2IPKD 2IWHA 5CC4A 2I07B 3A56A 1GJXA 3G6JB 4IUNA 5CV5A 1L0XB 3K5OA 4IURA 3OMCA 3DEOA 1C8CA 2WIIB 2K28A 3FMCA 4BS9A 4DNRB 4RKLA 5C0XJ 3D6WA 3S17B 3H94A 2CW0C 3KLRA 3M7NA 2K5DA 1OXUA 2WAQB 2R92B 1JOOA 3MXUA 5JEAH 3I73A 1O7YA 5ISRA 2F0DA 3EVQA 2F0GA 5ELBA 2EPBA 3FDTA 3HZXA 3LWEA 1VF5C 2RA4A 1A3VA 5M5YB 3BDOA 1HXYD 2PO4A 1MD2D 1WTXA 3VR5A 1HTLD 1F77A 3QWNA 2A68D 3K58A 2M9VA 1F9PA 1STHA 2WINB 3S14B 2X6LA 3O13A 2K1BA 3C46A 3NTIA 2EY1A 1EYAA 4DAPA 3RD4A 1G91A 2KHSA 5BN4A 2CHBD 1PXUA 1AN8A 1CK1A 3PUWA 1PZID 3FPUB 1O78A 1CHQD 3GTPB 1YNJD 2B2WA 5CV4A 1DOLA 4R9WA 1K83B 2QCPX 1WTVA 4JBWA 2F1MA 3BDCA 1CI3M 2PZWA 4G4KA 4OO1H 1BCPB 5JJZA 1SYEA 1CA6A 1OXXK 4KMUC 2EY2A 5I2XA 2AWOA 3VR3A 1LT4D 4KKUA 3K59A 3EFXD 1V43A 4F87A 2B2TC 3BS1A 1I4HA 1LV9A 1BQQT 1WD1A 3SDZA 4OO1I 4YIJA 2KEDA 1OXTA 4IUPA 5EPJA 1Z6HA 2VUMB 4MIUA 1X32A 1V8QA 1A3UA 4FO2A 4KY5A 1XWEA 2EYOA 1EQTA 1J9OA 3AB9A 1Y8PB 1TS3A 4PV1C 1D2BA 3D6CA 5LL6X 1CZGA 4UDUC 2M2LA 3ND9A 4EQNA 2F0SA 4LJZC 4M1UB 1SNPA 1SFOB 1LLRD 4KHZA 1I4RA 2F0TA 5KIXA 3S1MB 1SYDA 4ZK9B 1WTQA 4B9XA 4K6DA 3E6ZX 1Q12A 3W2DA 2BA0A 3L3OC 4NW2A 1R9TB 3J7AF 3A8JE 3BG3A 3L7ZC 3BVGA 3VR2A 1I3QB 1NAPA 2K6AA 3NP8A 2EJGC 1RTOA 3V96A 2NVYB 2XVSA 1U4RA 1SMYC 4PMWA 4IFDH 1IW7D 3IKJA 1GHKA 1KAAA 1T5XD 3N52A 3DM1A 5CV9A 2XSCA 3TP8A 1LT6D 3MFGA 3OHXC 4ID6A 1BBXC 1EIHA 2J7ZA 1SE3A 3E0JA 2K5WA 4RHSA 1SYFA 1Q1BA 3EA6A 2K7VA 5I9OA 1Q1EA 2AQ1B 4DF7A 3ITPA 4RGNA 5KNBA 4HMIA 2RDGA 2F0IA 5KYIA 1ML0D 3T51B 2E76C 3P75A 3PO3B 4KV6A 2F0HA 4WORA 1ZKOA 2R61A 2NTTA 4WJWA 4PQXA 3TMEA 3J80E 1JE4A 1H9JA 1E2VA 3PUVA 1FNVA 3U9SA 5CBEE 1D5XC 2DNCA 4J8QA 3DHQA 1IHZA 5IIFA 1FNUA 1GUWA 2B2WC 1JB3A 3D3RA 4ZQ3A 3PV0A 4FF2A 4BY1B 3IFDA 4DK1A 1D5ZC 1TVXA 2FMCA 4NP5A 3ONAB 4HEDA 4RGMA 1FYCA 2WV6D 3NTKA 5NUCA 1KDCA 4TQUS 1EYDA 4HAEA 1LTTD 1EWHA 4XQNA 1QB5D 1TWGB 4BWGB 1Q8IA 4ZKBB 2TSSA 3NQTA 1M4VA 5JOBA 1PFBA 4L63B 1QJOA 1LABA 5IGGA 2G9DA 4U673 3H91A 5C6AA 2NZ1D 5TSSA 1T5EA 1I4XA 1TKWB 4L6TB 1CA5A 1O7LA 4EVOA 1VMPA 4QUFA 2PNRC 4ULLA 5FO7B 1JORA 4MN3A 5JAVA 1IKMA 1F9QA 2B8FA 3P1HA 1ENCA 2QILA 1LTAD 1F9RA 2ENBA 2SEBD 3SE0A 3KUPA 5IT9L 1HFGA 3ND8A 2QEJC 3NWSA 4GZYC 1W6JA 3MTSA 1TWAB 2E2DC 3DEPA 3SK5A 3I90A 2OT2A 2L4NA 4C3JG 1S5ED 5CMDA 1C4QA 5FK9C 3A8KE 3KF8A 2F0OA 3M4OB 1W6KA 3DUZA 5DEHA 2RDHA 2N55A 3TP6A 4S3SA 3A55A 3MHBA 5EQ0A 5C3WA 2HDMA 3DWQA 5JVG3 2F0MA 2PW7A 3RZOB 1AEXA 4DK0A 5M5XB 1SYBA 1ENAA 2FFKB 5IGBA 2E2JB 2EYFA 4XDXA 4KI0A 2LKVA 2ZT9C 4OHJA 4QUCA 5DNFA 4N9TA 3HOWB 2L9HA 2NB0A 1KABA 3CHBD 4RKBA 1II3A 3TZUA 2B2UC 1U4MA 3PIP3 1FNWA 3TDQA 4KN4C 5CORA 4NKLA 3MA2B 3TBIB 1DZ1A 4JK1C 1AZQA 2B2TA 3CU7A 4AYBB 2SDFA 4FXDA 2VB3X 3H3VC 1H9RA 4C3JB 3I3CA 1GXDC 4P2CB 4FF4A 4PMCA 2R6GA 3S2HB 2KA7A 3T13A 3GTOB 2EYLA 4K5XA 1OXVA 2EYHA 2MJ8A 1GOZA 4G57A 2Y0SB 4TSSA 2AUKA 2L11A 1F2LA 2N88A 2BE5D 4ZLTF 1EY8A 2PMZB 1JOQA 3NK9A 3NHHA 4DNTB 4RCNA 2HDLA 5HURA 1B53A 1WTRA 4E6IA 2RSOA 1ESRA 1SXTA 1GUSA 3EROA 3NTHA 4KK7A 2E74C 3PIO3 2NVXB 1WTOA 1BDOA 4A3FB 2EYPA 5EBCA 2IX0A 4A3IB 1HHVA 3KK7A 2C5CA 1SJED 5G3LF 3QJYA 4FP5D 2F0QA 1QCBD 4C56C 2R3ZA 3OMGA 1V1PA 2JEBI 1SJHD 5KNDA 2AQ3B 2PQEA 5IGEA 1KNEA 1KNAA 4HCEA 4FXGC 2NN6G 3K0YA 3CKIB 5I6YA 3HEJA 4V0BA 1J8IA 2O2LD 4R8NA 4XQJA 5IT9E 2CW0D 2Z4IA 5EBDA 1ZYRD 5F2DA 1M8AA 3OIPA 4HN7A 2L1BA 2EE1A 4K6LA 5DAUA 5CGKA 1SNDA 2A69C 3GV6A 4O42A 1PRTC 4Q5VA 2DNEA 1KLUD 1PTOC 1ESFA 3S1NB 4OGQC 4H13C 1DYQA 3S1RB 3BYYB 5C3XA 3GTLB 2JXMB 1HUNA 1XTCD 3R93A 1G2TA 5C4HA 5KNCA 1DD2A 2KUMA 2HCIA 2I46A 4J1MA 4ZYSA 1DONA 3EQLC 2VXWA 1PZKD 3SHLA 4A3BB 2MGSA 2L5TA 3MEHA 4F88A 2Z4HA 1SYCA 4KTAA 5C3EB 3OWFA 4RGTA 1BXTA 1STYA 3EJIA 1A15A 2IL8A 4DA2A 5A35A 2NWGA 2JA6B 1DCZA 4I7ZC 1R4PB 2KJXA 3VYUA 1HRJA 1PRTD 2EYMA 3Q24A 5JPNC 1SNMA 1PZJD 2KVMA 1RF2D 3TP7A 2SOBA 1DOMA 2JA8B 1MSGA 4RGOS 3GTMB 3MXNA 3HG9A 3FRPB 1TWHB 3DMUA 2EY5A 1JWSD 4IN3A 1ZEQX 4OIJA 5IGFA 4EQPA 1HA6A 2F0EA 5J1ZA 4XIGS 3M85A 1I6HB 2XWJB 2K04A 3QG1A 2E2HB 2ID0A 1QNKA 3KBXA 3PO2B 5KRUA 1RJTA 5EPKA 4BBSB 1AFPA 2DY7A 4KD4A 4QIWB 1S5FD 4QCLA 4CGYB 2F0UA 4ZUIA 2D9UA 4ABNA 1BNZA 1WVLA 3RMHA 3D4RA 5I9PA 5FOBB 1CHPD 1AW7A 1ZXTA 1TU2B 1EQVA 1PDQA 2Q8TA 3FEWX 2BDNA 3HOZB 1CT1D 4C3HG 2LY7A 2RSNA 2NBFA 1TWCB 1G6ZA 2WB1B 3S2DB 3J81L 3IL8A 3KBGA 4EGVA 1JQYD 4FXKC 1PRTF 2QF7A 1EY9A 2F0PA 2V4DA 5FO9B 4DAVA 1QWYA 1HQRD 3BVMA 1A3TA 2NTSA 3W3AA 3HP3A 5EKIA 1TR5A 3M7GA 1B2TA 4X3TA 1IL8A 2AUJD 4X3KA 1BOSA 2B8GA 1AZPA 3MVVA 4H7BA 2L55A 1CQFA 1RDPD 1B50A 4KN7C 5IGCA 3L9AX 5D3IB 2Q8IB 3QOLA 1EY0A 3FVQA 3J7AV 1B9MA 4IUVA 3BZDB 2BDOA 2KECA 4K5WA 3D4WA 3H0GB 3GTKB 3MXGA 2D2CC 4BY7B 3C1EA 1EZ8A 1LT5D 4Q0FA 1EOTA 1H9KA 3SK8A 3SK4A 1QOHA 3NQIA 1S5DD 2DY8A 5E4WC 3I4NB 3V2TA 2IX1A 4A93B 5EPLA 4U68A 3NSWA 5DM73 2XIWA 5I4DA 3C1FA 4CJ2C 4A3KB 3N6RA 4CHTB 2E2IB 4RAUC 2IW3A 4H44C 4LAAA 3J7YW 1XXGA 3TN2A 4DFAA 1A6XA 1CQVA 2FHTA 4XYOA 1C48A 2WACA 3LNNA 3AU7A 4XQQA 1EYCA 3A54A 3GTJB 2PPBC 4DU9A 2PCFB 4OIKA 1VCIA 3OPOA 4F7XA 1UEAB 5C4XB 2JP1A 4XTCS 3SR1A 3P20A 2XRQD 4N9PA 4KY7A 1VDZA 5EJWA 1S5BD 1NCVA 1RD9D 1YNJC 1A2UA 2JSOA 4F8MA 3AMUA 1PLFA 2BCOA 4G7OC 2IJ0A 2NVTB 1TIID 4KY6A 2XNAC 2EXZA 2EZVA 1YNNC 2NN6H 3Q6SA 1FGBD 2B2VC 5ELDA 5G3LD 4IZ8A 3T53B 3IFTA 1KLGD 4B9WA 2EOTA 1PTOF 1GUTA 1ICWA 2SNSA 1G2SA 1XYIA 1WTPA 3U9OA 2A6EC 3X3NA 1QE6A 5BN5A 3Q22A 3A7LA 3JAML 2EDGA 3UI2A 2M00A 1RCVD 3I91A 3J81E 3LX0A 1IKLA 3SVMA 4HR7B 2K32A 1XX8A 2ZXOA 1CTMA 1D1IA 1WCMB 5JEAG 1EL0A 1MI2A 3URYA 2D5DA 4C2MB 3I4LA 1SNCA 1HUMA 3WOEA 1B1ZA 4K5VA 2C9OA 4IQZA 1LTBD 4KD3A 4X3SA 1LTGD 2IT1A 1BR9A 1PRTB 4ILWA 3HRZC 4A3GB 3OWEB 1TY0A 3DWAA 5HGTA 2DN8A 3S1QB 2A73B 1SAPA 3C2PA 5M3FB 4BBRB 2F03A 1PTOB 1IYUA 1Z47A 1NSNS 2WP8J 5EGTA 3HGBA 3IAYA 1SYGA 1PYWD 2KQ3A 1Y1WB 5C4ZA 4IUQA 2EJFC 3PUYA 1PMRA 5KYLA 2BE5C 4Z9CB 3VYSA 1CFMA 2FJ2A 1PTOD 4A3EB 1DJRD 5E1FA 2WKDA 2F0FA 1U4PA 4IUUA 2A6HD 1GUGA 4ME5A 4DXFA 2MUYA 3MFYA 2CQAA 1BO0A 1GUOA 3HOVB 4KJOA 3MC0B 3NXWA 1WD0A 4XT1B 5C0XI 2EYJA 4NDXA 3R8BA 2JYOA 2A5HA 4KKSA 4XYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3C A;  5CBA E;  2B2Y C;  1B2T A;  3KUP A;  1DOM A;  2FIN B;  1SDF A;  4X3T A;  5EJW A;  4R8I A;  1NCV A;  1MSG A;  1IL8 A;  1JE4 A;  1F9P A;  2M2L A;  1M8A A;  4X3K A;  1HFG A;  1AZP A;  1U4L A;  1HFN A;  2KOL A;  2L1B A;  5CBE E;  2X6L A;  5T1G A;  2MJ8 A;  3MTS A;  2EE1 A;  2K1B A;  4ZKC B;  4IUT A;  2B2Y A;  2K03 A;  1PLF A;  1SAP A;  1DOK A;  1WTW A;  2FMM A;  1GUW A;  3DEP A;  1B50 A;  4OIJ A;  1F9S A;  2L11 A;  3I90 A;  1MGS A;  1F2L A;  3GV6 A;  2B2W C;  4MHE A;  4O42 A;  2N88 A;  1HA6 A;  3G7L A;  4ZK9 B;  1QG7 A;  1WTQ A;  1NR2 A;  2K04 A;  1MSH A;  2L4N A;  1G91 A;  3I8Z A;  3QO2 A;  4IUV A;  1BF4 A;  2CVR A;  1X3Q A;  2KEC A;  3MWY W;  4ZLT F;  5CMD A;  4CJ0 B;  1O80 A;  2X6G A;  1QNK A;  1S4Z A;  3IFD A;  1ILQ A;  1TVX A;  3FPU B;  2HCC A;  3GV3 A;  1PFN A;  3KBX A;  5T1I A;  2B2W A;  3Q6S A;  1EOT A;  1DOL A;  2HUG A;  2B2V C;  2K05 A;  4NW2 A;  2X69 A;  3ONA B;  4HED A;  5E4X A;  1SSO A;  4IUQ A;  4R9W A;  1RJT A;  2N55 A;  2HDL A;  5EPK A;  1WTV A;  1HUN A;  2B2U A;  1NAP A;  1Q3L A;  2DY8 A;  3R93 A;  1G2T A;  5EQ0 A;  5E4W C;  1CM9 A;  2EOT A;  2DY7 A;  1ICW A;  1B4O A;  2HDM A;  2KUM A;  2HCI A;  1B53 A;  1RTO A;  4HCS A;  1X3P A;  5EPL A;  1WTR A;  1G2S A;  4HSV A;  2MPM A;  4U68 A;  1XYI A;  2RSO A;  1CA6 A;  1WTP A;  1DON A;  1U4R A;  2D9U A;  4HAE A;  1ESR A;  2VXW A;  2XIW A;  1BNZ A;  2K01 A;  4RWS C;  1WVL A;  1QE6 A;  2FJ2 A;  4IUR A;  4CJ2 C;  1ZXT A;  3N52 A;  2B2T C;  4LMQ D;  1PDQ A;  2MGS A;  4ZKB B;  3DEO A;  2Q8T A;  4DN4 M;  1WTO A;  1C8C A;  2FFK B;  3UI2 A;  2K28 A;  4RAU C;  1U4P A;  3DM1 A;  4IUU A;  1LV9 A;  1PFB A;  2BDN A;  3I91 A;  1HHV A;  4XDX A;  1ROD A;  1B3A A;  1BBX C;  1EIH A;  1WD1 A;  1E0B A;  2J7Z A;  2RSN A;  3D6W A;  1IKL A;  5D14 A;  1PFM A;  3SVM A;  4QUC A;  5AFW A;  5DNF A;  2KED A;  3TN2 A;  2MP1 A;  1G6Z A;  1XX8 A;  1A15 A;  2B2V A;  3F2U A;  3H91 A;  2FHT A;  2L9H A;  4IUP A;  5EPJ A;  2IL8 A;  4UAI A;  2NZ1 D;  3IL8 A;  3TZD A;  5COY A;  1AP0 A;  1RHP A;  2B2U C;  2RVL A;  2NWG A;  1MI2 A;  1U4M A;  1BO0 A;  1X32 A;  2R3Z A;  1EL0 A;  4OIK A;  1CA5 A;  1VMC A;  4ZAI A;  1O7Y A;  5COR A;  2H1E A;  2NYZ D;  1VMP A;  1ML0 D;  4QUF A;  2EPB A;  4XT3 B;  1HRJ A;  1KNE A;  1HUM A;  1KNA A;  2KEE A;  3FDT A;  3LWE A;  1WD0 A;  2RA4 A;  3P7J A;  1EIG A;  4RA8 A;  1DZ1 A;  4XT1 B;  1EQT A;  1RTN A;  1O7Z A;  1J9O A;  5D65 A;  2JP1 A;  4MN3 A;  1JIC A;  2L12 A;  1IKM A;  1AZQ A;  1J8I A;  2Q8R E;  2B2T A;  1ILP A;  1F9Q A;  4CJ1 B;  1NR4 A;  1WTX A;  2KVM A;  2SDF A;  2JYO A;  4X3U A;  3HP3 A;  5EKI A;  5JJZ A;  4X3S A;  1F9R A; 
#chains in the Genus database with same CATH topology
 1YJ9 A;  2O5J C;  1VQL A;  5LMN L;  5M9O A;  4DV4 L;  1Q46 A;  5IYC H;  3V05 A;  1KTK A;  4K2K A;  5FJ8 H;  5ELE A;  3CCR A;  4HJ9 A;  1HNX Q;  3U4V A;  3KLS X;  4PZ8 A;  3K6O A;  4JI0 Q;  4DK3 C;  2ZJQ A;  4ZKC B;  1BCP D;  1CZW A;  3PIO A;  1F9S A;  1QUQ A;  1D6E C;  1R4Q B;  4MHE A;  1SN8 A;  2QDL A;  5C44 H;  3AFP A;  1D5M C;  3Q0A A;  4DAY A;  3QO2 A;  2MQH A;  3C3L A;  2F0K A;  2F3V A;  3MWY W;  1ZYR C;  5L37 A;  2B29 A;  4RFB A;  3GTQ B;  1Y1V H;  1PFN A;  3NPP A;  2K05 A;  2X69 A;  4B3M Q;  1NUC A;  4EX5 A;  4GN5 A;  2K5N A;  3CQZ B;  5A2Q L;  1UUP A;  1JR0 D;  3PUX A;  2R93 B;  1CM9 A;  4HSP A;  3HOX G;  4OWX B;  5C44 B;  1TWC H;  1X3P A;  4JG2 A;  4DK6 C;  4HSV A;  4P75 A;  1XMO L;  3DXJ C;  1KHI A;  2K01 A;  4A3C H;  1JMC A;  3L0O A;  2IY5 B;  3A0J A;  5M3M G;  4L5Q A;  3M4O H;  4A75 A;  4DN4 M;  4O1N A;  4DR7 L;  2EQS A;  3NUC A;  1F2M A;  1PH1 A;  1CSP A;  2E5L L;  3BJU A;  3K8A A;  1WCM G;  4DKA C;  2MP1 A;  1EU4 A;  3GP7 A;  4DR6 Q;  4DR4 Q;  3TZD A;  3HOY B;  1BUV T;  3HOX H;  2PMZ E;  5CV8 A;  2EJM A;  1BCP C;  3VA7 A;  5J39 A;  2WKC A;  1I6V C;  3Q23 A;  4ZAI A;  4A3F H;  2NYZ D;  1WOC A;  3NWT A;  1VS0 A;  4A3J B;  5I2Y A;  2F0W A;  2K5Q A;  4HTH A;  1EIG A;  4RMF A;  4Y7N B;  3ZYY X;  1STE A;  2Q8R E;  5M5W H;  2NZH A;  1TS2 A;  4G7Z C;  4YHH L;  3HOW G;  5IP7 H;  2CWA A;  1TQO A;  3T4A C;  1VQI A;  4I65 A;  4V19 0;  5FKA C;  3EN2 A;  5C3E H;  4CDD C;  1Y1V B;  3W5O A;  4BA1 I;  3GTQ H;  2J4X A;  4QF4 A;  5A2Q E;  3J81 j;  4IUT A;  1E2Z A;  2MHV A;  3CAM A;  1DOK A;  4FNF A;  4HJA A;  1CKM A;  5KEE A;  4DAY B;  1I5F A;  3FHW A;  4L5R C;  1BCP F;  1MSH A;  3PUZ A;  3MXP A;  4CKC A;  1LTI D;  4A3M B;  3NEL A;  1Y14 B;  1O80 A;  3NBH A;  4G7H C;  2EIF A;  4IPH A;  1Y1W G;  3I4N G;  1HCZ A;  1STN A;  4IJL A;  4LFA L;  2A1A A;  1T9H A;  4DGZ A;  2A68 C;  3FPP A;  3R2I A;  4LK1 C;  4DXG A;  4IFD I;  1ENF A;  1VF7 A;  4QB4 A;  2F0J A;  1V1O A;  1TXY A;  3FKI B;  4LF7 L;  4A3G G;  1E1T A;  1D1K A;  5C0X H;  1B4O A;  4ZUJ A;  3R3O A;  2OF1 A;  5K5P A;  5CV6 A;  5IWA L;  4RWS C;  2OWO A;  2ZXP A;  3BZC A;  1B9N A;  2JA6 G;  1I4Q A;  1Q90 A;  1PA6 A;  1SEB D;  3MXN B;  3UE1 A;  3S16 H;  4P74 A;  4WRD A;  2ZTE A;  4RH6 A;  5C5M A;  1HQM C;  4QMG A;  1JC7 A;  1UE5 A;  4IFD G;  1JWM D;  4LF4 L;  3H3V I;  2E2H H;  2EVB A;  2PZU A;  5D14 A;  4YCV A;  2E5L Q;  4C1N K;  2B2V A;  3CMA A;  2F0L A;  5LL6 S;  2UUB L;  2B63 B;  2Z1C A;  4DR4 L;  1A2T A;  1AP0 A;  3CCU A;  4OX9 Q;  4RCO A;  3CRL C;  1IBK Q;  5DM6 3;  4JOI C;  5E3F A;  1RHP A;  5KGU A;  5FLX L;  2K5V A;  1L1O A;  1VMC A;  3GO5 A;  1Z7T A;  4ZRZ A;  3K7A B;  1YVC A;  2C35 B;  3CW2 C;  3P7J A;  2NN6 I;  1O7Z A;  4GN3 B;  5I6W A;  3GQB A;  1U9R A;  2L12 A;  3MZ5 A;  2QKI C;  5EKL A;  1HTP A;  2XRS D;  4X3U A;  4L5S A;  4A93 H;  4OEL B;  3PO3 H;  4POF A;  4K2L A;  5FLX E;  5M3F H;  2XGT A;  3SEB A;  2VQE L;  1FD7 D;  3AFQ A;  2OEO A;  1HZB A;  4BXX H;  4IJH A;  1HR0 L;  4DV4 Q;  1HZC A;  2BOS A;  1SE4 A;  1Y8N B;  1K8A C;  1SNO A;  3H6M A;  1TS4 A;  3VR6 A;  1HFN A;  3WDN A;  2KOL A;  3RR5 A;  2O4X A;  2XWB B;  4TKO B;  1TWF H;  1H9M A;  1NMG A;  2Z8L A;  2B2Y A;  2K03 A;  3BVZ A;  2O5I C;  2ZTC A;  1WTW A;  2FMM A;  3QR8 A;  3KF6 A;  3I72 A;  1ONL A;  4LF8 Q;  1VQ4 A;  2OQK A;  1MGS A;  4J15 A;  5IP9 H;  1ET6 A;  1MBY A;  4PMB A;  1SMY D;  2KCN A;  4P72 A;  1SBB B;  1IW7 C;  3A7A B;  1G8Z D;  3MAQ A;  1VQK A;  1S4Z A;  2K4K A;  2P5Z X;  3CCQ A;  3TP5 A;  4DR5 L;  4KKT A;  2JA7 G;  2HCC A;  3GV3 A;  5LHY 1;  5C0X G;  5C5L A;  1SFO H;  3S16 B;  1SSO A;  2F0N A;  4DV7 L;  2JEA I;  1GHJ A;  4APV A;  1Y69 U;  2BA1 A;  3UDI A;  2B2U A;  3HOX B;  4NMZ A;  4DV2 L;  4JV5 L;  3PCO B;  1EY7 A;  1I4P A;  2K33 A;  2MPM A;  3RLO A;  3HKZ B;  2L0C A;  4JI5 Q;  5M3M B;  1XNR Q;  1TWF B;  4TRD A;  1IL2 A;  1KDA A;  1O7I A;  3KLW A;  1PH9 A;  4OON A;  2CKZ B;  4C3H H;  1VQ6 A;  1KL9 A;  4R4I A;  5BR8 Q;  3I7F A;  1JOK A;  1QVG A;  4H0L C;  1VQF A;  2AQ2 B;  3B6Y A;  1A0I A;  1H9S A;  3OSO A;  2XN9 C;  4M8A A;  1IYV A;  1JCK B;  1STG A;  1EQR A;  2D0O A;  1DM0 B;  5AFW A;  2SNM A;  2IX3 A;  3F2U A;  2OXP A;  3X3M A;  1KAW A;  3ULJ A;  4UAI A;  4POG A;  1I4G A;  5COY A;  4O0A A;  4OEM B;  3JAM E;  1Z9F A;  2GVA A;  2A6E D;  3K5L A;  2NVQ B;  4CBV A;  3VYR A;  5JPM C;  2EY6 A;  4FF3 A;  1Y8O B;  5ELC A;  3VA5 A;  3RLN A;  3PMF A;  3D8G A;  3M3Y B;  3H15 A;  1RTN A;  1DXM A;  4KHV A;  4JI1 L;  4BA2 I;  1LTR D;  3R2T A;  1ILP A;  3UDG A;  4CJ1 B;  3VYT A;  3E3X A;  1YNN D;  4KJN A;  4FDB A;  3SK6 A;  1PTO H;  3HS0 C;  1V1P B;  5M5W B;  5CBA E;  4K8J A;  3K5M A;  1LT3 D;  1SE2 A;  2E75 C;  1EFI D;  1N36 Q;  1Q7Y C;  1E2W A;  2I5H A;  4JI4 Q;  4OL7 A;  2HHH L;  1L0Y B;  3I4M G;  3L2P A;  1S5C D;  4LF5 L;  2CCZ A;  1HPC A;  3CF5 A;  4CKE A;  1EEI D;  2AWN A;  3RLF A;  2F3W A;  1NE3 A;  1QZH A;  1AE3 A;  3G7L A;  4JI8 L;  1QG7 A;  2RDF A;  1NR2 A;  5JJK A;  4WJ4 A;  4GOP C;  1K8O A;  2CVR A;  1F2Z A;  3K0X A;  3G48 A;  4CJ0 B;  2JA5 G;  2X6G A;  4QJF A;  1ILQ A;  4A3I H;  4GKK Q;  3QOJ A;  3A5Z B;  2G9H D;  3J80 L;  3BYT B;  1SLJ A;  2HUG A;  2QDB A;  1PH6 A;  3K57 A;  3H09 A;  1I50 B;  3OIQ A;  3SXH A;  1IBM L;  3CCL A;  2UUC L;  4IAL A;  5K36 H;  3KLS A;  4ODG A;  1Q3L A;  3TSS A;  2YU9 B;  5JEA J;  4HCS A;  1RKN A;  1PH5 A;  4CKB A;  2G5D A;  2TMP A;  1B8A A;  5JVH 3;  2GA4 B;  4YCW A;  2KCC A;  3S1Q H;  1K8M A;  2H4O A;  4YY3 Q;  4LMQ D;  4B08 A;  4HMJ A;  4DR3 Q;  3HKS A;  3HOU B;  3T56 B;  5EKK A;  1JJC B;  3T1Y L;  1ROD A;  1K0R A;  2JA9 A;  4PNY A;  2GVB A;  4XXE A;  2B63 H;  4OO1 G;  4JBJ A;  3GD7 A;  2RKS A;  4JI6 Q;  4HID A;  2RBM A;  5J22 A;  1F2Y A;  2HQE A;  1N34 L;  2DJG C;  3NE5 B;  1E22 A;  1EWC A;  2E2I H;  1N9W A;  4UPA A;  3BDL A;  3NBI A;  4XT3 B;  2KEE A;  3T16 A;  4C1N I;  4RA8 A;  2J0T D;  2ICI A;  2RQX A;  3VR4 A;  4X62 Q;  1A8V A;  1ET9 A;  5D65 A;  5JJL A;  1JIC A;  4GNX B;  2VL6 A;  5CYU A;  1NR4 A;  3K5N A;  3GTG B;  2N8N A;  1ICF B;  2LFN A;  4C3I G;  5IGD A;  1B44 D;  2UUA Q;  4N8F A;  2B63 G;  2A8V A;  2B2Y C;  3I4M H;  2FIN B;  1SDF A;  2JA5 B;  4R8I A;  1HR0 Q;  5DLQ E;  4WFN 3;  3S15 B;  1U4L A;  4EQO A;  2A69 D;  3OOC A;  5IY0 A;  4AYB E;  5C4J B;  3E9I A;  4A3L H;  2JA5 H;  4LF8 L;  2HT1 A;  3I4M B;  2D62 A;  4X66 L;  4IFD J;  1STA A;  1FR3 A;  2LMC B;  1TT2 A;  4L8J A;  1SNQ A;  3I8Z A;  1BF4 A;  3RUZ A;  1X3Q A;  3DM3 A;  3A5U A;  2JA7 B;  5K36 G;  4DR5 Q;  2JK8 A;  1UAP A;  1HNX L;  3Q8D A;  5BN3 A;  4A4I A;  2A6H C;  2E2J H;  1FJG Q;  4FVM A;  5CR3 A;  5E4X A;  4A3B H;  4FYD A;  4RHR A;  2F0V A;  5M5X H;  4R4Q A;  3STB C;  2LS0 1;  1GUN A;  2YTV A;  1QIL A;  1EU3 A;  1OXS C;  3S2D H;  2PZT A;  4JI7 Q;  4JI5 L;  2VNU D;  4LF9 L;  4MNO A;  1TY2 A;  2LXJ A;  4A3D B;  4EQ5 A;  5H1S E;  3OW7 A;  1EEF D;  1XTD A;  3CRK C;  2ICE C;  1JWU D;  1Y1W H;  1EY4 A;  1B3A A;  3RZD B;  2YYZ A;  2WAQ G;  3ERS X;  1E0B A;  1HA5 A;  3RN2 A;  3T1Y Q;  4HIK A;  1PFM A;  2PW5 A;  3E5S A;  1EY5 A;  2GN5 A;  3I70 A;  1HZ9 A;  3QIA A;  5IOC A;  4K8I A;  2B39 A;  4A93 G;  3S9W A;  5ELF A;  1TS5 A;  1STB A;  3I4N H;  5D3D A;  3W1B A;  2R92 G;  4J6H A;  1N32 Q;  2R7Z B;  3HOZ H;  1G29 1;  2RVL A;  2PYK A;  3DWP A;  3RZD H;  5EAY A;  1H9S B;  1EFW A;  1Q86 C;  5LMN Q;  4LNQ A;  1UNS A;  2H1E A;  4C3I H;  2VB2 X;  4P71 A;  4A3G H;  4A76 A;  1G51 A;  5FO8 B;  2PI2 A;  1KDB A;  4BY7 H;  5IOD A;  1OO9 B;  2F4I A;  4HIM A;  3CCM A;  2A74 C;  2JE6 I;  1EZ6 A;  3KYH C;  4FF1 A;  2ZM6 Q;  1VQC A;  1QNU A;  1LO5 D;  3ULP A;  2UU9 Q;  3M4Y A;  3A8I E;  2ZXR A;  3LWU A;  4YWM A;  4C3I B;  1X9N A;  4GNX A;  3GTM H;  1K3B C;  5T1G A;  1M90 C;  4LF5 Q;  4GS3 A;  2AHO B;  3W1G A;  1XPR A;  1PYB A;  3GDE A;  5FLM H;  5GAE C;  1EY6 A;  3F2D A;  2Q2U A;  3D4D A;  3D31 A;  5CV7 A;  2ES2 A;  2D0P A;  4K14 A;  1LAC A;  4JYA L;  1RL2 A;  3G4S A;  1D7Q A;  3S24 A;  2NUC A;  4X64 L;  5T1I A;  5IYB H;  1FJG L;  1TWG H;  3WOF A;  1LTS D;  2N49 A;  4C3H B;  2AKW B;  3QB3 A;  2NVQ H;  4A3M G;  4GLV B;  5LMU L;  4DR7 Q;  3ERQ A;  2IPK D;  2F4V Q;  2IWH A;  2I07 B;  3A56 A;  5CC4 A;  3PO2 G;  1GJX A;  4P73 A;  2R93 H;  4BXX G;  3G6J B;  4IUN A;  5CV5 A;  4JI7 L;  1W3S A;  1L0X B;  3K5O A;  2LSS A;  4IUR A;  4YWL A;  3OMC A;  3DEO A;  1C8C A;  2WII B;  2K28 A;  3FMC A;  4UP7 A;  3CXC A;  4BS9 A;  4DNR B;  3D0F A;  1U0L A;  4RKL A;  5C0X J;  2R92 H;  2KCT A;  3HOZ G;  3D6W A;  2MO0 A;  2Q2I A;  3S17 B;  3H94 A;  4JI6 L;  2CW0 C;  3KLR A;  3M7N A;  1C9O A;  2K5D A;  1OXU A;  1MJC A;  4JI3 Q;  2WAQ B;  1QZG A;  5GRO A;  2R92 B;  1JOO A;  3MXU A;  4H02 A;  5JEA H;  3I73 A;  4B3T Q;  4DPG A;  1O7Y A;  5ISR A;  2F0D A;  3ZJY C;  3EVQ A;  2F0G A;  5ELB A;  2EPB A;  3FDT A;  3HZX A;  4X62 L;  3LWE A;  1VF5 C;  2RA4 A;  3S1R H;  4CDF C;  1A3V A;  1L2F A;  5M5Y B;  2R7Z G;  2KHJ A;  3BDO A;  1HXY D;  1YIT A;  1UWV A;  2PO4 A;  1MD2 D;  1KC8 C;  5AJ3 L;  1WTX A;  4OX9 L;  1IBK L;  3VR5 A;  1HTL D;  1F77 A;  3QWN A;  4YCU A;  2A68 D;  3KFU A;  1KIX A;  3K58 A;  2M9V A;  1F9P A;  1STH A;  2WIN B;  1E3P A;  1VQD A;  1KD1 C;  3S14 B;  1DGS A;  2X6L A;  3PF5 A;  3O13 A;  2K1B A;  1IBL L;  1XMQ Q;  1A63 A;  4IOA A;  3C46 A;  4PZ6 A;  3NTI A;  2EY1 A;  2MFI A;  4DUY Q;  1EYA A;  4DAP A;  3RD4 A;  1G91 A;  2KHS A;  4LFC L;  5BN4 A;  2CHB D;  1PXU A;  2Y0S G;  1AN8 A;  2ZJR A;  4DV5 Q;  3U4Z A;  1CK1 A;  4DV3 L;  3PUW A;  1PZI D;  3FPU B;  1O78 A;  1CHQ D;  3GTP B;  1YNJ D;  4IPD A;  2B2W A;  5CV4 A;  1DOL A;  3NBH B;  3J81 c;  4NXM L;  4R9W A;  1K83 B;  4AH6 A;  2QCP X;  1E7Z A;  1WTV A;  1X3G A;  4JBW A;  5ELN A;  2F1M A;  4HIO A;  3BDC A;  4JBM A;  1CI3 M;  3HOY H;  4A3C G;  4G4K A;  2PZW A;  2LXK A;  4GOP B;  4OO1 H;  2NVY H;  4GLX A;  1BCP B;  5JJZ A;  1SYE A;  1CA6 A;  1S40 A;  4K0K Q;  1OXX K;  4KMU C;  3ICE A;  2EY2 A;  5I2X A;  2AWO A;  3VR3 A;  1LT4 D;  1XPO A;  4KKU A;  2IHF A;  3K59 A;  3EFX D;  2FXQ A;  1V43 A;  4F87 A;  2B2T C;  3HFZ B;  1MHW C;  3BS1 A;  2PNH A;  1I4H A;  1LV9 A;  1N8R C;  1BQQ T;  1Q81 C;  1WD1 A;  4JBK A;  3SDZ A;  4A3K G;  4OO1 I;  4YIJ A;  2KED A;  2Z6K C;  1OXT A;  4IUP A;  5EPJ A;  1XNR L;  1Z6H A;  2VUM B;  4MIU A;  1TWA H;  2UUB Q;  2Y0S E;  1HNW L;  4TVA B;  1X32 A;  2PQA B;  1V8Q A;  1A3U A;  3VDY A;  4FO2 A;  1SRO A;  4KY5 A;  1E24 A;  1XWE A;  2EYO A;  3T1H Q;  1C0A A;  1EQT A;  1J9O A;  3AB9 A;  1I6H H;  1Y8P B;  1TS3 A;  4OWW B;  4O2D A;  4PV1 C;  3TRE A;  4KHP Q;  2VW9 A;  1D2B A;  3D6C A;  5GAH C;  5LL6 X;  1CZG A;  3M3Y H;  4UDU C;  2EXD A;  2M2L A;  3ND9 A;  4EQN A;  4QGU A;  2F0S A;  4LJZ C;  4M1U B;  1SNP A;  1SFO B;  1LLR D;  1A62 A;  4A3E H;  1IBL Q;  4BY1 H;  4KHZ A;  1I4R A;  2L15 A;  2F0T A;  2NZO A;  2JJQ A;  5KIX A;  1BVS A;  3S1M B;  1SYD A;  4ZK9 B;  1WTQ A;  4B9X A;  4K6D A;  3E6Z X;  1Q12 A;  1I3Q H;  3W2D A;  1VQJ A;  2BA0 A;  4AQY L;  1K0S A;  4JI4 L;  2WAQ E;  3L3O C;  4X64 Q;  2DGY A;  2OQ0 A;  3CP0 A;  4NW2 A;  1R9T B;  3J7A F;  5BR8 L;  3A8J E;  3BG3 A;  3L7Z C;  3BVG A;  3VR2 A;  3J81 i;  1I3Q B;  1NAP A;  2A19 A;  2K6A A;  3NP8 A;  4DV2 Q;  4JV5 Q;  2EJG C;  1RTO A;  3V96 A;  4DR1 L;  2NVY B;  2XVS A;  1EIF A;  4A3L G;  1JJG A;  1U4R A;  1SMY C;  4PMW A;  4IFD H;  1IW7 D;  3IKJ A;  3I55 A;  1CKN A;  1KAA A;  2MNA A;  1GHK A;  1T5X D;  3N52 A;  1VQ8 A;  2K14 A;  1IBM Q;  1ASZ A;  3DM1 A;  5CV9 A;  2VQF Q;  1CKO A;  4B3S Q;  2XSC A;  3TP8 A;  1LT6 D;  3MFG A;  3OHX C;  4ID6 A;  1BBX C;  4BY7 G;  2J7Z A;  1EIH A;  1SE3 A;  3E0J A;  4A3B G;  2K5W A;  4RHS A;  1SYF A;  1Q1B A;  3EA6 A;  2K7V A;  5I9O A;  1Q1E A;  1PHJ A;  2AQ1 B;  4DF7 A;  3ITP A;  4RGN A;  1HZA A;  5KNB A;  4HMI A;  2RDG A;  2F0I A;  3UDX A;  4HJ5 A;  1PH7 A;  4DR3 L;  1UE1 A;  3U58 A;  5KYI A;  3HOU H;  3CD6 A;  1ML0 D;  3T51 B;  2E76 C;  3J7Z C;  5M3F G;  3P75 A;  3PO3 B;  4KV6 A;  2F0H A;  4WOR A;  1ZKO A;  2R61 A;  4DV0 L;  2NTT A;  4WJW A;  4IPG A;  2V1C C;  4PQX A;  3TME A;  3J80 E;  1JE4 A;  1H9J A;  1IYJ B;  1E2V A;  3PUV A;  1N36 L;  1YJN A;  1FNV A;  3U9S A;  1X6O A;  5CBE E;  1D5X C;  2DNC A;  4J8Q A;  2KEN A;  3DHQ A;  3M4Q A;  1IHZ A;  5IIF A;  4B3M L;  1FNU A;  1VQN A;  1GUW A;  2ALY B;  2B2W C;  1JB3 A;  4LFC Q;  3S1M H;  4X65 L;  4JI8 Q;  3D3R A;  1KRS A;  4ZQ3 A;  4R4O A;  3PV0 A;  4FF2 A;  4BY1 B;  3IFD A;  4DK1 A;  1D5Z C;  1TVX A;  1MKH A;  3DLL A;  3HOV H;  2FMC A;  4GKK L;  4UY8 C;  4NP5 A;  3ONA B;  4HED A;  4RGM A;  4X6A H;  4X66 Q;  1VQP A;  2QW7 A;  1FYC A;  2WV6 D;  1W2B A;  3TQY A;  3NTK A;  5NUC A;  4OWT B;  1KDC A;  4PG3 A;  2QA4 A;  4TQU S;  1EYD A;  2NVT H;  4HAE A;  1LTT D;  1EWH A;  4R4C A;  2VY3 A;  3KJP A;  1MIU A;  4XQN A;  1QB5 D;  1TWG B;  4BWG B;  1Q8I A;  3EIV A;  2TSS A;  4ZKB B;  1PH3 A;  3NQT A;  1M4V A;  5JOB A;  1PFB A;  4L63 B;  2ASB A;  3K81 C;  1QJO A;  1LAB A;  5IGG A;  2G9D A;  4OXP A;  4U67 3;  3H91 A;  4IOC A;  2WB1 E;  3GTG H;  5C6A A;  2NZ1 D;  5TSS A;  1T5E A;  2UUA L;  1I4X A;  1TKW B;  4L6T B;  1CA5 A;  1O7L A;  4EVO A;  1VMP A;  1X3F A;  4QUF A;  3I56 A;  2PNR C;  4ULL A;  2I0Q A;  4IPC A;  5FO7 B;  1JOR A;  3ER0 A;  4MN3 A;  4AYB G;  5JAV A;  1IKM A;  1F9Q A;  2B8F A;  3P1H A;  1ENC A;  2QIL A;  4MTN A;  1LTA D;  1F9R A;  2ENB A;  5IYC G;  2SEB D;  3SE0 A;  3KUP A;  5IT9 L;  3PO3 G;  1HFG A;  4QQB X;  1KQS A;  3ND8 A;  3STB D;  2QEJ C;  3NWS A;  4GZY C;  1W6J A;  3MTS A;  1X55 A;  1TWA B;  2E2D C;  4KLK A;  1PH4 A;  3DEP A;  3SK5 A;  3I90 A;  1UE6 A;  2RCN A;  4LF7 Q;  2OT2 A;  2L4N A;  3F2C A;  4C3J G;  1S5E D;  2H5X A;  5CMD A;  1C4Q A;  5FK9 C;  1TWH H;  3A8K E;  1I50 H;  3KF8 A;  2F0O A;  4I7A A;  3M4O B;  1W6K A;  3DUZ A;  5DEH A;  2RDH A;  2N55 A;  3TP6 A;  1SRU A;  3H0G H;  4S3S A;  3A55 A;  3MHB A;  5EQ0 A;  1PFS A;  5C3W A;  2HDM A;  3DWQ A;  4DR1 Q;  5JVG 3;  4GKJ L;  2F0M A;  2PW7 A;  3RZO B;  1NY4 A;  2F52 A;  1AEX A;  4LFA Q;  4JPB W;  4DK0 A;  5M5X B;  1SYB A;  1ENA A;  3G71 A;  2VQF L;  1XPU A;  2FFK B;  5IGB A;  5FJ8 G;  2E2J B;  2EYF A;  4XDX A;  4KI0 A;  2YV5 A;  4LF6 Q;  2F4V L;  2LKV A;  2ZT9 C;  3CC7 A;  4OHJ A;  4QUC A;  5DNF A;  3J7A 5;  4N9T A;  3PIP A;  3HOW B;  1U5K A;  1B7Y B;  2L9H A;  2NB0 A;  1KAB A;  3CHB D;  5IE8 A;  4RKB A;  1II3 A;  1YHB A;  3TZU A;  2Z0S A;  2B2U C;  1U4M A;  3M9B A;  1CSQ A;  3PIP 3;  1N32 L;  1FNW A;  3TDQ A;  4KN4 C;  5C4J H;  2CWP A;  4NKL A;  1Y1V G;  5COR A;  3MA2 B;  3TBI B;  3HOY G;  3MEF A;  1DZ1 A;  4JK1 C;  4A3E G;  3SGI A;  2VZA A;  1AZQ A;  2B2T A;  4N8X 1;  3CU7 A;  4AYB B;  2RCF A;  2SDF A;  2VB3 X;  4FXD A;  3H3V C;  1FVI A;  1H9R A;  4ME3 A;  1QVF A;  1B70 B;  1PH2 A;  1S72 A;  4C3J B;  3I3C A;  1GXD C;  2WFW A;  4R4T A;  4P2C B;  4UHV A;  4B3T L;  5C4X H;  4FF4 A;  4PMC A;  2R6G A;  3GTL H;  1R9T H;  3S2H B;  1IXR A;  4ZCK A;  2KA7 A;  3T13 A;  3GTO B;  2EYL A;  4K5X A;  1OXV A;  2EYH A;  4NXN Q;  2MJ8 A;  1GOZ A;  4G57 A;  2Y0S B;  4TSS A;  4MZ9 A;  1PYS B;  2AUK A;  2L11 A;  1F2L A;  2N88 A;  2BE5 D;  2OTJ A;  3FP9 A;  1NNX A;  1VQE A;  4ZLT F;  2B3G A;  5IWA Q;  1EY8 A;  2PMZ B;  1JOQ A;  1KXL A;  1YHQ A;  3NK9 A;  3NHH A;  2KBN A;  4DNT B;  4RCN A;  4LUV A;  2HDL A;  4DUY L;  5HUR A;  1QVC A;  1B53 A;  1WTR A;  4E6I A;  2RSO A;  5HY6 A;  3JAM c;  1ESR A;  2UXD Q;  2N3S A;  1SXT A;  3EBE A;  1GUS A;  2PQA A;  2CFM A;  3ERO A;  3NTH A;  4KK7 A;  4NPS A;  2I5M X;  2E74 C;  4NXM Q;  3HOU G;  3PIO 3;  2NVX B;  1WTO A;  1BDO A;  4DV7 Q;  4A3F B;  2EYP A;  3S14 H;  2YTY A;  5EBC A;  2IX0 A;  4A3I B;  2YTX A;  1YIJ A;  1HHV A;  5M3M H;  3KF6 B;  4DV1 Q;  3KK7 A;  2C5C A;  1SJE D;  5G3L F;  3QJY A;  4FP5 D;  1HNZ Q;  2F0Q A;  5AJ3 Q;  2ATW A;  1AH9 A;  1QCB D;  4C56 C;  1JT8 A;  1YZ6 A;  1EUJ A;  2R3Z A;  3OMG A;  4JI2 L;  1V1P A;  2JEB I;  1SJH D;  5KND A;  2AQ3 B;  2PQE A;  4DAM A;  5IGE A;  1B3Q A;  1KNE A;  1KNA A;  4HCE A;  4FXG C;  2NN6 G;  1SR3 A;  5FLX c;  3K0Y A;  3K7U C;  3CKI B;  5I6Y A;  3HEJ A;  4V0B A;  1J8I A;  2KCM A;  1IZ6 A;  4R1J A;  2O2L D;  4R8N A;  4XQJ A;  5IT9 E;  2CW0 D;  2Z4I A;  5EBD A;  1CUK A;  1ZYR D;  5F2D A;  2UXC L;  4HJ8 A;  1M8A A;  3OIP A;  3OYY A;  4A3J H;  4DV5 L;  4HN7 A;  5FLM G;  3T1H L;  1LUZ A;  2L1B A;  1BBU A;  2EE1 A;  2HQL A;  1YNX A;  4K6L A;  5DAU A;  4DR2 Q;  5CGK A;  1SND A;  2A69 C;  3GV6 A;  4O42 A;  1PRT C;  1NMF A;  4Q5V A;  2DNE A;  1KLU D;  2VS1 A;  1PTO C;  1ESF A;  3S1N B;  4OGQ C;  1M1K C;  4H13 C;  1DYQ A;  3S1R B;  2JA8 G;  2N78 A;  3BYY B;  1UEB A;  4QY7 A;  1FL0 A;  5C3X A;  4UP9 A;  3OTO Q;  3GTL B;  4DUZ Q;  3S2H H;  2JXM B;  4MTK A;  4NB3 A;  1MJE A;  1HUN A;  1XTC D;  3R93 A;  1G2T A;  2RHQ B;  5C4H A;  3JC6 6;  5KNC A;  1DD2 A;  3PQI A;  2KUM A;  2HCI A;  2I46 A;  4J1M A;  3TEH B;  4ZYS A;  1DON A;  4GKJ Q;  2RHS B;  3EQL C;  2VXW A;  3JAM i;  2MO1 A;  1PZK D;  4JC0 A;  3SHL A;  1VQG A;  2Q2T A;  3U50 C;  1GM5 A;  4A3B B;  2MGS A;  2K75 A;  2L5T A;  3MEH A;  4F88 A;  2Z4H A;  1SYC A;  4KTA A;  5IT9 c;  4DV6 L;  5C3E B;  3OWF A;  1SE8 A;  2CQO A;  4RGT A;  1I94 L;  1BXT A;  2BH8 A;  1STY A;  4LUO A;  4BBS G;  3EJI A;  4DV1 L;  3LGJ A;  5JJI A;  1A15 A;  3KJO A;  1GKH A;  2XTI A;  2IL8 A;  3FKI H;  1YBY A;  4DA2 A;  4KHP L;  1VQH A;  5A35 A;  3PGZ A;  2NWG A;  2Z9H A;  1XJV A;  2JA6 B;  1DCZ A;  5IYB G;  4I7Z C;  1R4P B;  2KJX A;  3VYU A;  1HRJ A;  1PRT D;  1VQ9 A;  1YHA A;  4A3M H;  2EYM A;  3Q24 A;  5JPN C;  1BKB A;  1SNM A;  3M4P A;  1PZJ D;  2KVM A;  2WB1 G;  1N34 Q;  1RF2 D;  3TP7 A;  3CC4 A;  1L1O B;  2SOB A;  1DOM A;  2JA8 B;  1MSG A;  4RGO S;  3GTM B;  3MXN A;  3HG9 A;  3FRP B;  4Y52 H;  1YJW A;  1QUQ B;  1TWH B;  3DMU A;  4A3D H;  2EY5 A;  3H0G G;  1JWS D;  4IN3 A;  3GTK H;  2Q2H A;  2JA8 H;  1RIP A;  1ZEQ X;  2R7D A;  3AYH B;  4OIJ A;  3TS2 A;  3IRB A;  4EQP A;  5IGF A;  1HA6 A;  2F0E A;  5J1Z A;  4XIG S;  3M85 A;  4LW1 A;  2ZM6 L;  1I6H B;  2CH4 W;  2XWJ B;  2K04 A;  3QG1 A;  1NBW A;  2KHI A;  4B3R Q;  1XMO Q;  2E2H B;  2ID0 A;  4PZ7 A;  4RG1 A;  1QNK A;  1K83 H;  3CCJ A;  4JVZ A;  2HIX A;  3AEV A;  3KBX A;  3PO2 B;  1NJI C;  5KRU A;  3OTO L;  1X65 A;  2R7Z H;  1RJT A;  5EPK A;  4BBS B;  2VUM H;  4QIW E;  1AFP A;  2DY7 A;  4KD4 A;  4QIW B;  1S5F D;  4QCL A;  2YU9 H;  2UXB Q;  4CGY B;  2F0U A;  4ZUI A;  3H3V H;  2PI2 E;  2D9U A;  1EYG A;  4ABN A;  1BNZ A;  1WVL A;  3RMH A;  3D4R A;  1LM0 A;  5FOB B;  5I9P A;  2R93 G;  1CHP D;  1AW7 A;  1ZXT A;  1TU2 B;  2Z6K A;  1Q82 C;  1EQV A;  1PDQ A;  4JCV E;  2Q8T A;  3FEW X;  1JE5 A;  2BDN A;  3HOZ B;  1CT1 D;  4C3H G;  2LY7 A;  2RSN A;  3CCV A;  2NBF A;  3S1N H;  1I94 Q;  1TWC B;  4C3J H;  1G6Z A;  2WB1 B;  3S2D B;  3J81 L;  4LF9 Q;  3IL8 A;  3KBG A;  4EGV A;  5HGQ A;  1JQY D;  4FXK C;  4YHH Q;  5M5Y H;  1PRT F;  5C4X G;  2QF7 A;  1AE2 A;  1EY9 A;  3K7A H;  1H95 A;  2F0P A;  2V4D A;  1N33 Q;  5FO9 B;  3E9H A;  3KF8 B;  4DAV A;  3F8T A;  2UU9 L;  4LF4 Q;  1YEZ A;  1QWY A;  1GVP A;  1HQR D;  3BVM A;  1A3T A;  2NTS A;  3W3A A;  3HP3 A;  1WJJ A;  5EKI A;  1K9M C;  1TR5 A;  3M7G A;  1B2T A;  4X3T A;  3WWV A;  3RNU A;  3CC2 A;  1IL8 A;  2AUJ D;  4X65 Q;  2UXC Q;  4X3K A;  1G6P A;  4C2M H;  1BOS A;  2B8G A;  1AZP A;  1K28 A;  3MVV A;  1VQA A;  5GQO A;  4H7B A;  2L55 A;  2CH4 A;  1CQF A;  1RDP D;  1EIY B;  1B50 A;  2AMC B;  4KN7 C;  5IGC A;  4DR2 L;  3L9A X;  5D3I B;  3I4O A;  2Q8I B;  2VQE Q;  3QOL A;  1EY0 A;  3FVQ A;  1OTC A;  3J7A V;  1B9M A;  4IUV A;  3BZD B;  2BDO A;  2KEC A;  4K5W A;  3D4W A;  3H0G B;  3GTK B;  3MXG A;  2D2C C;  4BY7 B;  1LTL A;  3C1E A;  1EZ8 A;  1LT5 D;  1XNQ Q;  3GTO H;  1XMQ L;  4Q0F A;  1JJ2 A;  1EOT A;  1H9K A;  3SK8 A;  3SK4 A;  4GOP A;  3A74 A;  1QOH A;  3NQI A;  1S5D D;  2DY8 A;  4LFB Q;  5E4W C;  3I4N B;  3K80 C;  3V2T A;  2IX1 A;  3S17 H;  4A93 B;  3UDF A;  5EPL A;  3ULL A;  4U68 A;  3OW2 A;  2UXB L;  3NSW A;  5DM7 3;  1K73 C;  2XIW A;  1SMX A;  3CPW A;  1S3O A;  5I4D A;  3C1F A;  4CDE C;  4CJ2 C;  3TRZ A;  4A3K B;  2DUD A;  5IP7 G;  2K52 A;  3HKZ E;  1J6Q A;  3N6R A;  4CHT B;  2E2I B;  1J5E L;  4RAU C;  5C3E G;  3UE0 A;  2IW3 A;  2IHE A;  4BY1 G;  4H44 C;  4LAA A;  3GTJ H;  4K0K L;  2QEX A;  1YI2 A;  4QL5 A;  3J7Y W;  3AQQ A;  1XXG A;  2R7F A;  3TN2 A;  4DFA A;  3KDF B;  1A6X A;  1CQV A;  2FHT A;  2E8G A;  4XYO A;  4GNX C;  1C48 A;  2WAC A;  3LNN A;  1P8L A;  3AU7 A;  4XQQ A;  1EYC A;  1WI5 A;  4Y7N H;  3A54 A;  3GTJ B;  2PPB C;  4DU9 A;  2PCF B;  3CQZ H;  4OIK A;  1VCI A;  5J3B A;  3OPO A;  4F7X A;  1VQM A;  4LF6 L;  4JI1 Q;  1BBW A;  1UEA B;  5C4X B;  2JP1 A;  4XTC S;  3SR1 A;  2Z6B A;  3P20 A;  2XRQ D;  1WCM H;  4N9P A;  4KY7 A;  1VDZ A;  2F3I A;  1GD7 A;  5ELO A;  5EJW A;  4GN4 B;  1S5B D;  1VQO A;  1NCV A;  1RD9 D;  1YNJ C;  1A2U A;  2NVX H;  2JSO A;  4JYA Q;  4DV3 Q;  4F8M A;  2JA6 H;  4BBR G;  3AMU A;  1PLF A;  2BCO A;  4G7O C;  2IJ0 A;  4LUZ A;  2NVT B;  1TII D;  5LMU Q;  4KY6 A;  1LYL A;  3HOW H;  2DJF C;  1PH8 A;  4B3R L;  2XNA C;  2EXZ A;  3PF4 A;  2EZV A;  1YNN C;  2NN6 H;  2HHH Q;  2QGQ A;  3Q6S A;  1FGB D;  2B2V C;  5ELD A;  3HKZ G;  2UUC Q;  5G3L D;  4IZ8 A;  3T53 B;  3IFT A;  1KLG D;  4B9W A;  2EOT A;  1PTO F;  1GUT A;  1X54 A;  1L1O C;  1ICW A;  2SNS A;  1G2S A;  3BZK A;  1XYI A;  1WTP A;  3U9O A;  4A3J G;  2A6E C;  2RF4 A;  1C7Y A;  3X3N A;  1HJP A;  1QE6 A;  5BN5 A;  3Q22 A;  3A7L A;  1HNW Q;  4JI3 L;  3CCS A;  1X56 A;  3E0E A;  3JAM L;  1CKN B;  2EDG A;  3UI2 A;  2M00 A;  1J5E Q;  1RCV D;  3I91 A;  5IYD H;  3J81 E;  2BH2 A;  3LX0 A;  1IKL A;  2OTL A;  3SVM A;  4HR7 B;  2K32 A;  1XX8 A;  4DR6 L;  2ZXO A;  1CTM A;  2UXD L;  1D1I A;  1WCM B;  5JEA G;  1EQQ A;  1V1Q A;  1EL0 A;  1MI2 A;  1N33 L;  4L5T A;  3URY A;  4UP8 A;  2ZTD A;  1ASY A;  3HOV G;  2D5D A;  1GO3 E;  2HD3 A;  1Q8K A;  4C2M B;  3I4L A;  1SNC A;  1HUM A;  4HJ7 A;  4IO9 A;  2JA7 H;  3WOE A;  3PSI A;  4A3D G;  4DNI A;  5E7N A;  1B1Z A;  5IYD G;  4K5V A;  1HNZ L;  1X3E A;  2C9O A;  4WJ3 M;  4IQZ A;  5LMN W;  1LTB D;  4KD3 A;  1K3R A;  4X3S A;  1LTG D;  4BBS H;  4BBR H;  1FGU A;  2K5H A;  2IT1 A;  1BR9 A;  1WFQ A;  1PRT B;  4ILW A;  3HRZ C;  3FKI G;  4AQY Q;  3CME A;  4A3G B;  2OCE A;  3OWE B;  2JQO A;  1TY0 A;  4JI0 L;  3GTP H;  3DWA A;  1KRT A;  2DN8 A;  4NXN L;  5HGT A;  3S1Q B;  3J80 c;  1JB7 A;  2A73 B;  1SAP A;  3C2P A;  5M3F B;  2JN4 A;  4BBR B;  3RZO H;  1VQ7 A;  2F03 A;  1PTO B;  4DV0 Q;  1IYU A;  1VQB A;  1Z47 A;  1NSN S;  2WP8 J;  4YWK A;  5EGT A;  3HGB A;  3IAY A;  3J80 i;  5GAD C;  1SYG A;  1XNQ L;  1PYW D;  3G6E A;  2KQ3 A;  1Y1W B;  5C4Z A;  5C44 G;  2I5L X;  3F1Z A;  3CPF A;  4YY3 L;  1V9P A;  4IUQ A;  1PV4 A;  3KOJ A;  1HH2 P;  4LWC A;  1PVO A;  1UE7 A;  2EJF C;  4GLA C;  1EOV A;  1K8G A;  4LFB L;  4ALP A;  3BU2 A;  3PUY A;  1D8L A;  5IP9 G;  5GAG C;  1PMR A;  5KYL A;  2BE5 C;  4CDC C;  3I2Z A;  4Z9C B;  1VQ5 A;  3VYS A;  1CFM A;  2FJ2 A;  1PTO D;  4A3E B;  1L0W A;  1DJR D;  1P16 A;  5E1F A;  2K50 A;  3PO2 H;  1NTG A;  2WKD A;  4DUZ L;  2F0F A;  3NEM A;  1U4P A;  4IUU A;  4A3K H;  3F2B A;  2A6H D;  1EWI A;  1GUG A;  4ME5 A;  4DXF A;  2ZJP A;  2HIV A;  2MUY A;  1HR0 W;  3RN5 A;  2VUM G;  3TS0 A;  3MFY A;  2CQA A;  1BO0 A;  1GUO A;  1WYD A;  4JI2 Q;  4B3S L;  3CCE A;  4DV6 Q;  3HOV B;  4KJO A;  3S15 H;  3MC0 B;  3NXW A;  1WD0 A;  4JW0 A;  4XT1 B;  1E1O A;  1WTH A;  4JOI A;  4AIM A;  3NEN A;  5C0X I;  2EYJ A;  4NDX A;  4A3F G;  3R8B A;  2JYO A;  2A5H A;  4A3I G;  4KKS A;  4XYQ A;  3KDF A; 
#chains in the Genus database with same CATH homology
 2O5J C;  5M9O A;  3V05 A;  1KTK A;  4K2K A;  5ELE A;  3KLS X;  3K6O A;  4ZKC B;  1BCP D;  1CZW A;  1F9S A;  1D6E C;  1R4Q B;  4MHE A;  1D5M C;  3Q0A A;  4DAY A;  3QO2 A;  3C3L A;  2F0K A;  2F3V A;  3MWY W;  1ZYR C;  4RFB A;  3GTQ B;  1PFN A;  3NPP A;  2K05 A;  2X69 A;  1NUC A;  3CQZ B;  5A2Q L;  1UUP A;  1JR0 D;  3PUX A;  2R93 B;  1CM9 A;  4HSP A;  5C44 B;  1X3P A;  4HSV A;  3DXJ C;  2K01 A;  4DN4 M;  4O1N A;  3NUC A;  1F2M A;  2MP1 A;  1EU4 A;  3GP7 A;  3TZD A;  3HOY B;  1BUV T;  5CV8 A;  2EJM A;  1BCP C;  3VA7 A;  5J39 A;  2WKC A;  1I6V C;  3Q23 A;  4ZAI A;  2NYZ D;  3NWT A;  4A3J B;  5I2Y A;  2F0W A;  2K5Q A;  4HTH A;  1EIG A;  4Y7N B;  3ZYY X;  1STE A;  2Q8R E;  1TS2 A;  4G7Z C;  1TQO A;  3T4A C;  4I65 A;  4V19 0;  5FKA C;  1Y1V B;  4BA1 I;  2J4X A;  4QF4 A;  5A2Q E;  4IUT A;  1E2Z A;  2MHV A;  1DOK A;  4FNF A;  5KEE A;  1BCP F;  1MSH A;  3PUZ A;  4CKC A;  3MXP A;  1LTI D;  4A3M B;  1O80 A;  3NBH A;  4G7H C;  1HCZ A;  1STN A;  4DGZ A;  2A68 C;  3FPP A;  3R2I A;  4LK1 C;  4DXG A;  4IFD I;  1ENF A;  1VF7 A;  4QB4 A;  2F0J A;  1V1O A;  3FKI B;  1D1K A;  5C0X H;  1B4O A;  4ZUJ A;  3R3O A;  2OF1 A;  5K5P A;  5CV6 A;  4RWS C;  2ZXP A;  1B9N A;  1I4Q A;  1Q90 A;  1SEB D;  4WRD A;  4RH6 A;  5C5M A;  1HQM C;  4QMG A;  1JC7 A;  4IFD G;  1JWM D;  2EVB A;  2PZU A;  5D14 A;  4C1N K;  2B2V A;  2F0L A;  5LL6 S;  2B63 B;  2Z1C A;  1A2T A;  1AP0 A;  4RCO A;  3CRL C;  5DM6 3;  5E3F A;  1RHP A;  5KGU A;  5FLX L;  1VMC A;  3GO5 A;  1Z7T A;  4ZRZ A;  3K7A B;  3P7J A;  2NN6 I;  1O7Z A;  5I6W A;  3GQB A;  1U9R A;  2L12 A;  3MZ5 A;  2QKI C;  5EKL A;  1HTP A;  2XRS D;  4X3U A;  4K2L A;  5FLX E;  3SEB A;  1FD7 D;  2OEO A;  2BOS A;  1SE4 A;  1Y8N B;  1SNO A;  3H6M A;  1TS4 A;  3VR6 A;  1HFN A;  3WDN A;  2KOL A;  2O4X A;  2XWB B;  4TKO B;  1H9M A;  2Z8L A;  2B2Y A;  2K03 A;  3BVZ A;  2O5I C;  1WTW A;  2FMM A;  3I72 A;  1ONL A;  1MGS A;  1ET6 A;  1MBY A;  4PMB A;  1SMY D;  2KCN A;  1SBB B;  1IW7 C;  3A7A B;  1G8Z D;  3MAQ A;  1S4Z A;  3TP5 A;  4KKT A;  2HCC A;  3GV3 A;  5LHY 1;  5C0X G;  5C5L A;  3S16 B;  1SSO A;  2F0N A;  2JEA I;  1GHJ A;  1Y69 U;  2BA1 A;  3HOX B;  2B2U A;  4NMZ A;  1EY7 A;  1I4P A;  2K33 A;  2MPM A;  3HKZ B;  2L0C A;  5M3M B;  1TWF B;  4TRD A;  1KDA A;  1JOK A;  4H0L C;  2AQ2 B;  1H9S A;  3OSO A;  2XN9 C;  4M8A A;  1IYV A;  1JCK B;  1STG A;  1DM0 B;  5AFW A;  2SNM A;  2IX3 A;  3F2U A;  2OXP A;  3X3M A;  4UAI A;  1I4G A;  5COY A;  3JAM E;  2A6E D;  3K5L A;  2NVQ B;  4CBV A;  3VYR A;  5JPM C;  2EY6 A;  4FF3 A;  1Y8O B;  5ELC A;  3VA5 A;  3PMF A;  3D8G A;  3M3Y B;  1RTN A;  1DXM A;  4KHV A;  4BA2 I;  1LTR D;  3R2T A;  1ILP A;  4CJ1 B;  3VYT A;  4KJN A;  1YNN D;  3SK6 A;  1PTO H;  3HS0 C;  1V1P B;  5M5W B;  5CBA E;  4K8J A;  3K5M A;  1LT3 D;  1SE2 A;  2E75 C;  1EFI D;  1E2W A;  4OL7 A;  1L0Y B;  1S5C D;  1HPC A;  4CKE A;  1EEI D;  2AWN A;  3RLF A;  2F3W A;  3G7L A;  1QG7 A;  2RDF A;  1NR2 A;  1K8O A;  2CVR A;  1F2Z A;  4CJ0 B;  2X6G A;  1ILQ A;  3QOJ A;  3J80 L;  2G9H D;  3BYT B;  2HUG A;  2QDB A;  3K57 A;  3H09 A;  1I50 B;  3OIQ A;  3SXH A;  4IAL A;  5K36 H;  3KLS A;  4ODG A;  1Q3L A;  3TSS A;  2YU9 B;  5JEA J;  4HCS A;  1RKN A;  4CKB A;  2TMP A;  5JVH 3;  2GA4 B;  2KCC A;  1K8M A;  2H4O A;  4LMQ D;  4B08 A;  4HMJ A;  3HOU B;  3T56 B;  5EKK A;  1ROD A;  4PNY A;  4XXE A;  4OO1 G;  3GD7 A;  2RKS A;  2RBM A;  5J22 A;  1F2Y A;  2HQE A;  3NE5 B;  1EWC A;  3BDL A;  3NBI A;  4XT3 B;  2KEE A;  3T16 A;  4C1N I;  4RA8 A;  2J0T D;  2ICI A;  2RQX A;  3VR4 A;  1ET9 A;  5D65 A;  1JIC A;  5CYU A;  1NR4 A;  3K5N A;  3GTG B;  2LFN A;  4C3I G;  5IGD A;  1B44 D;  2B2Y C;  2FIN B;  1SDF A;  2JA5 B;  4R8I A;  4WFN 3;  3S15 B;  1U4L A;  4EQO A;  2A69 D;  3OOC A;  5C4J B;  3I4M B;  2D62 A;  4IFD J;  1STA A;  1FR3 A;  2LMC B;  1TT2 A;  4L8J A;  1SNQ A;  3I8Z A;  1BF4 A;  3RUZ A;  1X3Q A;  2JA7 B;  5K36 G;  1UAP A;  5BN3 A;  2A6H C;  4FVM A;  5CR3 A;  5E4X A;  4FYD A;  4RHR A;  2F0V A;  2LS0 1;  1GUN A;  1QIL A;  1EU3 A;  1OXS C;  2PZT A;  2VNU D;  1TY2 A;  4A3D B;  3OW7 A;  1EEF D;  3CRK C;  2ICE C;  1JWU D;  1EY4 A;  1B3A A;  3RZD B;  2YYZ A;  1E0B A;  1HA5 A;  1PFM A;  2PW5 A;  3E5S A;  1EY5 A;  3I70 A;  3QIA A;  5IOC A;  4K8I A;  2B39 A;  3S9W A;  5ELF A;  1TS5 A;  1STB A;  5D3D A;  4J6H A;  2R7Z B;  1G29 1;  2RVL A;  2PYK A;  3DWP A;  1H9S B;  1UNS A;  2H1E A;  2VB2 X;  5FO8 B;  1KDB A;  5IOD A;  1OO9 B;  2F4I A;  2A74 C;  2JE6 I;  1EZ6 A;  4FF1 A;  1QNU A;  1LO5 D;  3M4Y A;  3A8I E;  2ZXR A;  3LWU A;  4C3I B;  5T1G A;  1EY6 A;  3D4D A;  3D31 A;  5CV7 A;  4K14 A;  1LAC A;  2NUC A;  5T1I A;  3WOF A;  1LTS D;  4C3H B;  3QB3 A;  3ERQ A;  2IPK D;  2IWH A;  5CC4 A;  2I07 B;  3A56 A;  1GJX A;  3G6J B;  4IUN A;  5CV5 A;  1L0X B;  3K5O A;  4IUR A;  3OMC A;  3DEO A;  1C8C A;  2WII B;  2K28 A;  3FMC A;  4BS9 A;  4DNR B;  4RKL A;  5C0X J;  3D6W A;  3S17 B;  3H94 A;  2CW0 C;  3KLR A;  3M7N A;  2K5D A;  1OXU A;  2WAQ B;  2R92 B;  1JOO A;  3MXU A;  5JEA H;  3I73 A;  1O7Y A;  5ISR A;  2F0D A;  3EVQ A;  2F0G A;  5ELB A;  2EPB A;  3FDT A;  3HZX A;  3LWE A;  1VF5 C;  2RA4 A;  1A3V A;  5M5Y B;  3BDO A;  1HXY D;  2PO4 A;  1MD2 D;  1WTX A;  3VR5 A;  1HTL D;  1F77 A;  3QWN A;  2A68 D;  3K58 A;  2M9V A;  1F9P A;  1STH A;  2WIN B;  3S14 B;  2X6L A;  3O13 A;  2K1B A;  3C46 A;  3NTI A;  2EY1 A;  1EYA A;  4DAP A;  3RD4 A;  1G91 A;  2KHS A;  5BN4 A;  2CHB D;  1PXU A;  1AN8 A;  1CK1 A;  3PUW A;  1PZI D;  3FPU B;  1O78 A;  1CHQ D;  3GTP B;  1YNJ D;  2B2W A;  5CV4 A;  1DOL A;  4R9W A;  1K83 B;  2QCP X;  1WTV A;  4JBW A;  2F1M A;  3BDC A;  1CI3 M;  2PZW A;  4G4K A;  4OO1 H;  1BCP B;  5JJZ A;  1SYE A;  1CA6 A;  1OXX K;  4KMU C;  2EY2 A;  5I2X A;  2AWO A;  3VR3 A;  1LT4 D;  4KKU A;  3K59 A;  3EFX D;  1V43 A;  4F87 A;  2B2T C;  3BS1 A;  1I4H A;  1LV9 A;  1BQQ T;  1WD1 A;  3SDZ A;  4OO1 I;  4YIJ A;  2KED A;  1OXT A;  4IUP A;  5EPJ A;  1Z6H A;  2VUM B;  4MIU A;  1X32 A;  1V8Q A;  1A3U A;  4FO2 A;  4KY5 A;  1XWE A;  2EYO A;  1EQT A;  1J9O A;  3AB9 A;  1Y8P B;  1TS3 A;  4PV1 C;  1D2B A;  3D6C A;  5LL6 X;  1CZG A;  4UDU C;  2M2L A;  3ND9 A;  4EQN A;  2F0S A;  4LJZ C;  4M1U B;  1SNP A;  1SFO B;  1LLR D;  4KHZ A;  1I4R A;  2F0T A;  5KIX A;  3S1M B;  1SYD A;  4ZK9 B;  1WTQ A;  4B9X A;  4K6D A;  3E6Z X;  1Q12 A;  3W2D A;  2BA0 A;  3L3O C;  4NW2 A;  1R9T B;  3J7A F;  3A8J E;  3BG3 A;  3L7Z C;  3BVG A;  3VR2 A;  1I3Q B;  1NAP A;  2K6A A;  3NP8 A;  2EJG C;  1RTO A;  3V96 A;  2NVY B;  2XVS A;  1U4R A;  1SMY C;  4PMW A;  4IFD H;  1IW7 D;  3IKJ A;  1GHK A;  1KAA A;  1T5X D;  3N52 A;  3DM1 A;  5CV9 A;  2XSC A;  3TP8 A;  1LT6 D;  3MFG A;  3OHX C;  4ID6 A;  1BBX C;  1EIH A;  2J7Z A;  1SE3 A;  3E0J A;  2K5W A;  4RHS A;  1SYF A;  1Q1B A;  3EA6 A;  2K7V A;  5I9O A;  1Q1E A;  2AQ1 B;  4DF7 A;  3ITP A;  4RGN A;  5KNB A;  4HMI A;  2RDG A;  2F0I A;  5KYI A;  1ML0 D;  3T51 B;  2E76 C;  3P75 A;  3PO3 B;  4KV6 A;  2F0H A;  4WOR A;  1ZKO A;  2R61 A;  2NTT A;  4WJW A;  4PQX A;  3TME A;  3J80 E;  1JE4 A;  1H9J A;  1E2V A;  3PUV A;  1FNV A;  3U9S A;  5CBE E;  1D5X C;  2DNC A;  4J8Q A;  3DHQ A;  1IHZ A;  5IIF A;  1FNU A;  1GUW A;  2B2W C;  1JB3 A;  3D3R A;  4ZQ3 A;  3PV0 A;  4FF2 A;  4BY1 B;  3IFD A;  4DK1 A;  1D5Z C;  1TVX A;  2FMC A;  4NP5 A;  3ONA B;  4HED A;  4RGM A;  1FYC A;  2WV6 D;  3NTK A;  5NUC A;  1KDC A;  4TQU S;  1EYD A;  4HAE A;  1LTT D;  1EWH A;  4XQN A;  1QB5 D;  1TWG B;  4BWG B;  1Q8I A;  4ZKB B;  2TSS A;  3NQT A;  1M4V A;  5JOB A;  1PFB A;  4L63 B;  1QJO A;  1LAB A;  5IGG A;  2G9D A;  4U67 3;  3H91 A;  5C6A A;  2NZ1 D;  5TSS A;  1T5E A;  1I4X A;  1TKW B;  4L6T B;  1CA5 A;  1O7L A;  4EVO A;  1VMP A;  4QUF A;  2PNR C;  4ULL A;  5FO7 B;  1JOR A;  4MN3 A;  5JAV A;  1IKM A;  1F9Q A;  2B8F A;  3P1H A;  1ENC A;  2QIL A;  1LTA D;  1F9R A;  2ENB A;  2SEB D;  3SE0 A;  3KUP A;  5IT9 L;  1HFG A;  3ND8 A;  2QEJ C;  3NWS A;  4GZY C;  1W6J A;  3MTS A;  1TWA B;  2E2D C;  3DEP A;  3SK5 A;  3I90 A;  2OT2 A;  2L4N A;  4C3J G;  1S5E D;  5CMD A;  1C4Q A;  5FK9 C;  3A8K E;  3KF8 A;  2F0O A;  3M4O B;  1W6K A;  3DUZ A;  5DEH A;  2RDH A;  2N55 A;  3TP6 A;  4S3S A;  3A55 A;  3MHB A;  5EQ0 A;  5C3W A;  2HDM A;  3DWQ A;  5JVG 3;  2F0M A;  2PW7 A;  3RZO B;  1AEX A;  4DK0 A;  5M5X B;  1SYB A;  1ENA A;  2FFK B;  5IGB A;  2E2J B;  2EYF A;  4XDX A;  4KI0 A;  2LKV A;  2ZT9 C;  4OHJ A;  4QUC A;  5DNF A;  4N9T A;  3HOW B;  2L9H A;  2NB0 A;  1KAB A;  3CHB D;  4RKB A;  1II3 A;  3TZU A;  2B2U C;  1U4M A;  3PIP 3;  1FNW A;  3TDQ A;  4KN4 C;  5COR A;  4NKL A;  3MA2 B;  3TBI B;  1DZ1 A;  4JK1 C;  1AZQ A;  2B2T A;  3CU7 A;  4AYB B;  2SDF A;  4FXD A;  2VB3 X;  3H3V C;  1H9R A;  4C3J B;  3I3C A;  1GXD C;  4P2C B;  4FF4 A;  4PMC A;  2R6G A;  3S2H B;  2KA7 A;  3T13 A;  3GTO B;  2EYL A;  4K5X A;  1OXV A;  2EYH A;  2MJ8 A;  1GOZ A;  4G57 A;  2Y0S B;  4TSS A;  2AUK A;  2L11 A;  1F2L A;  2N88 A;  2BE5 D;  4ZLT F;  1EY8 A;  2PMZ B;  1JOQ A;  3NK9 A;  3NHH A;  4DNT B;  4RCN A;  2HDL A;  5HUR A;  1B53 A;  1WTR A;  4E6I A;  2RSO A;  1ESR A;  1SXT A;  1GUS A;  3ERO A;  3NTH A;  4KK7 A;  2E74 C;  3PIO 3;  2NVX B;  1WTO A;  1BDO A;  4A3F B;  2EYP A;  5EBC A;  2IX0 A;  4A3I B;  1HHV A;  3KK7 A;  2C5C A;  1SJE D;  5G3L F;  3QJY A;  4FP5 D;  2F0Q A;  1QCB D;  4C56 C;  2R3Z A;  3OMG A;  1V1P A;  2JEB I;  1SJH D;  5KND A;  2AQ3 B;  2PQE A;  5IGE A;  1KNE A;  1KNA A;  4HCE A;  4FXG C;  2NN6 G;  3K0Y A;  3CKI B;  5I6Y A;  3HEJ A;  4V0B A;  1J8I A;  2O2L D;  4R8N A;  4XQJ A;  5IT9 E;  2CW0 D;  2Z4I A;  5EBD A;  1ZYR D;  5F2D A;  1M8A A;  3OIP A;  4HN7 A;  2L1B A;  2EE1 A;  4K6L A;  5DAU A;  5CGK A;  1SND A;  2A69 C;  3GV6 A;  4O42 A;  1PRT C;  4Q5V A;  2DNE A;  1KLU D;  1PTO C;  1ESF A;  3S1N B;  4OGQ C;  4H13 C;  1DYQ A;  3S1R B;  3BYY B;  5C3X A;  3GTL B;  2JXM B;  1HUN A;  1XTC D;  3R93 A;  1G2T A;  5C4H A;  5KNC A;  1DD2 A;  2KUM A;  2HCI A;  2I46 A;  4J1M A;  4ZYS A;  1DON A;  3EQL C;  2VXW A;  1PZK D;  3SHL A;  4A3B B;  2MGS A;  2L5T A;  3MEH A;  4F88 A;  2Z4H A;  1SYC A;  4KTA A;  5C3E B;  3OWF A;  4RGT A;  1BXT A;  1STY A;  3EJI A;  1A15 A;  2IL8 A;  4DA2 A;  5A35 A;  2NWG A;  2JA6 B;  1DCZ A;  4I7Z C;  1R4P B;  2KJX A;  3VYU A;  1HRJ A;  1PRT D;  2EYM A;  3Q24 A;  5JPN C;  1SNM A;  1PZJ D;  2KVM A;  1RF2 D;  3TP7 A;  2SOB A;  1DOM A;  2JA8 B;  1MSG A;  4RGO S;  3GTM B;  3MXN A;  3HG9 A;  3FRP B;  1TWH B;  3DMU A;  2EY5 A;  1JWS D;  4IN3 A;  1ZEQ X;  4OIJ A;  5IGF A;  4EQP A;  1HA6 A;  2F0E A;  5J1Z A;  4XIG S;  3M85 A;  1I6H B;  2XWJ B;  2K04 A;  3QG1 A;  2E2H B;  2ID0 A;  1QNK A;  3KBX A;  3PO2 B;  5KRU A;  1RJT A;  5EPK A;  4BBS B;  1AFP A;  2DY7 A;  4KD4 A;  4QIW B;  1S5F D;  4QCL A;  4CGY B;  2F0U A;  4ZUI A;  2D9U A;  4ABN A;  1BNZ A;  1WVL A;  3RMH A;  3D4R A;  5I9P A;  5FOB B;  1CHP D;  1AW7 A;  1ZXT A;  1TU2 B;  1EQV A;  1PDQ A;  2Q8T A;  3FEW X;  2BDN A;  3HOZ B;  1CT1 D;  4C3H G;  2LY7 A;  2RSN A;  2NBF A;  1TWC B;  1G6Z A;  2WB1 B;  3S2D B;  3J81 L;  3IL8 A;  3KBG A;  4EGV A;  1JQY D;  4FXK C;  1PRT F;  2QF7 A;  1EY9 A;  2F0P A;  2V4D A;  5FO9 B;  4DAV A;  1QWY A;  1HQR D;  3BVM A;  1A3T A;  2NTS A;  3W3A A;  3HP3 A;  5EKI A;  1TR5 A;  3M7G A;  1B2T A;  4X3T A;  1IL8 A;  2AUJ D;  4X3K A;  1BOS A;  2B8G A;  1AZP A;  3MVV A;  4H7B A;  2L55 A;  1CQF A;  1RDP D;  1B50 A;  4KN7 C;  5IGC A;  3L9A X;  5D3I B;  2Q8I B;  3QOL A;  1EY0 A;  3FVQ A;  3J7A V;  1B9M A;  4IUV A;  3BZD B;  2BDO A;  2KEC A;  4K5W A;  3D4W A;  3H0G B;  3GTK B;  3MXG A;  2D2C C;  4BY7 B;  3C1E A;  1EZ8 A;  1LT5 D;  4Q0F A;  1EOT A;  1H9K A;  3SK8 A;  3SK4 A;  1QOH A;  3NQI A;  1S5D D;  2DY8 A;  5E4W C;  3I4N B;  3V2T A;  2IX1 A;  4A93 B;  5EPL A;  4U68 A;  3NSW A;  5DM7 3;  2XIW A;  5I4D A;  3C1F A;  4CJ2 C;  4A3K B;  3N6R A;  4CHT B;  2E2I B;  4RAU C;  2IW3 A;  4H44 C;  4LAA A;  3J7Y W;  1XXG A;  3TN2 A;  4DFA A;  1A6X A;  1CQV A;  2FHT A;  4XYO A;  1C48 A;  2WAC A;  3LNN A;  3AU7 A;  4XQQ A;  1EYC A;  3A54 A;  3GTJ B;  2PPB C;  4DU9 A;  2PCF B;  4OIK A;  1VCI A;  3OPO A;  4F7X A;  1UEA B;  5C4X B;  2JP1 A;  4XTC S;  3SR1 A;  3P20 A;  2XRQ D;  4N9P A;  4KY7 A;  1VDZ A;  5EJW A;  1S5B D;  1NCV A;  1RD9 D;  1YNJ C;  1A2U A;  2JSO A;  4F8M A;  3AMU A;  1PLF A;  2BCO A;  4G7O C;  2IJ0 A;  2NVT B;  1TII D;  4KY6 A;  2XNA C;  2EXZ A;  2EZV A;  1YNN C;  2NN6 H;  3Q6S A;  1FGB D;  2B2V C;  5ELD A;  5G3L D;  4IZ8 A;  3T53 B;  3IFT A;  1KLG D;  4B9W A;  2EOT A;  1PTO F;  1GUT A;  1ICW A;  2SNS A;  1G2S A;  1XYI A;  1WTP A;  3U9O A;  2A6E C;  3X3N A;  1QE6 A;  5BN5 A;  3Q22 A;  3A7L A;  3JAM L;  2EDG A;  3UI2 A;  2M00 A;  1RCV D;  3I91 A;  3J81 E;  3LX0 A;  1IKL A;  3SVM A;  4HR7 B;  2K32 A;  1XX8 A;  2ZXO A;  1CTM A;  1D1I A;  1WCM B;  5JEA G;  1EL0 A;  1MI2 A;  3URY A;  2D5D A;  4C2M B;  3I4L A;  1SNC A;  1HUM A;  3WOE A;  1B1Z A;  4K5V A;  2C9O A;  4IQZ A;  1LTB D;  4KD3 A;  4X3S A;  1LTG D;  2IT1 A;  1BR9 A;  1PRT B;  4ILW A;  3HRZ C;  4A3G B;  3OWE B;  1TY0 A;  3DWA A;  5HGT A;  2DN8 A;  3S1Q B;  2A73 B;  1SAP A;  3C2P A;  5M3F B;  4BBR B;  2F03 A;  1PTO B;  1IYU A;  1Z47 A;  1NSN S;  2WP8 J;  5EGT A;  3HGB A;  3IAY A;  1SYG A;  1PYW D;  2KQ3 A;  1Y1W B;  5C4Z A;  4IUQ A;  2EJF C;  3PUY A;  1PMR A;  5KYL A;  2BE5 C;  4Z9C B;  3VYS A;  1CFM A;  2FJ2 A;  1PTO D;  4A3E B;  1DJR D;  5E1F A;  2WKD A;  2F0F A;  1U4P A;  4IUU A;  2A6H D;  1GUG A;  4ME5 A;  4DXF A;  2MUY A;  3MFY A;  2CQA A;  1BO0 A;  1GUO A;  3HOV B;  4KJO A;  3MC0 B;  3NXW A;  1WD0 A;  4XT1 B;  5C0X I;  2EYJ A;  4NDX A;  3R8B A;  2JYO A;  2A5H A;  4KKS A;  4XYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...