4MIUA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4miuA00
3SK5A 3MZ5A 3EVQA 5J1ZA 1STAA 3LX0A 5M9OA 4ODGA 3QOLA 1ENAA 5IGDA 1STNA 5EKLA 3NK9A 4HMIA 4B9XA 2EYHA 1SYGA 1A3UA 1EQVA 3R3OA 1F2YA 1A3TA 2SNSA 4H7BA 5CV7A 2F0NA 5EGTA 5ISRA 1EY8A 2HQEA 3BDLA 1A3VA 3D6CA 2O4XA 4KJNA 4DGZA 5C3WA 5KYLA 2EY5A 1EYCA 2PZTA 4PMBA 2F3VA 2F0GA 4OL7A 3D4DA 1JOKA 2EYJA 2F0HA 5DEHA 2RDFA 3DMUA 3C1FA 3T16A 3MHBA 4RKBA 5JAVA 3OMCA 2F0SA 3MXPA 1SNQA 2RBMA 2PW7A 3T13A 4HTHA 4K5VA 4DF7A 4EVOA 1SYFA 4ID6A 2OXPA 5HGTA 1F2MA 4DU9A 4F7XA 5C5MA 2EYPA 3V2TA 5C4ZA 4KHVA 3SHLA 1SYDA 4F8MA 1STHA 1EY9A 1TR5A 1ENCA 1NUCA 1EY4A 3EROA 3TMEA 4EQPA 1SNOA 1SNPA 1KAAA 1TT2A 1KDCA 4J6HA 5CV5A 5C6AA 3SR1A 2F0EA 5CR3A 5IIFA 3QB3A 2F0MA 3HEJA 4IUNA 5CV9A 4IZ8A 4QB4A 4K6DA 2NUCA 4KD4A 1TQOA 2OEOA 1JORA 4DFAA 1F2ZA 2PQEA 3PMFA 1STGA 3ERQA 4NDXA 1SYEA 4LAAA 4K8JA 3MEHA 1EZ8A 5DAUA 3RUZA 2QDBA 2ENBA 5J39A 2F3WA 3TP7A 4B9WA 2KHSA 3ITPA 4WRDA 5CV6A 2SOBA 3C1EA 1JOQA 3DHQA 1A2TA 2F0LA 5CC4A 5KIXA 4KTAA 4K14A 2EY6A 4IALA 5CGKA 4K5XA 1EY0A 1U9RA 2PYKA 5E1FA 2F0FA 3U9OA 1II3A 2LKVA 3OSOA 4K2LA 3NXWA 2KQ3A 4N9TA 2PZWA 4KY5A 4QF4A 2SNMA 4PNYA 3NUCA 5C4HA 4K5WA 4ZQ3A 1SYBA 4R8NA 2F0QA 4MIUA 1EY5A 3E5SA 5NUCA 2EXZA 4NMZA 4ZUJA 1EY7A 5IGGA 1STYA 3D4WA 5EKKA 4S3SA 5K5PA 2F0JA 1SYCA 5IGCA 3BDCA 4J1MA 4TRDA 3SK8A 1KABA 2F0VA 4EQNA 3VA5A 2F0DA 2EYLA 3H6MA 4E6IA 1JOOA 1RKNA 4KV6A 5E3FA 3QOJA 4K2KA 2F0IA 5KYIA 4PMCA 1KDAA 5F2DA 2PW5A 5I9OA 2F0UA 5J22A 4EQOA 5KGUA 2EYOA 3SK4A 5C3XA 2F0WA 2RKSA 5HURA 4HMJA 2OF1A 1SNDA 5IOCA 5JOBA 4NKLA 3TP6A 2F0TA 3OWFA 2F0KA 2EYMA 5IGEA 1EZ6A 4G57A 5IGFA 2EYFA 5KRUA 4N9PA 3MVVA 5IODA 2PZUA 4WORA 5KEEA 4I65A 1NSNS 3HZXA 3P75A 4KJOA 3SXHA 2M00A 2WACA 3EJIA 4KD3A 3P1HA 4NP5A 3TP5A 5C5LA 1SNCA 5IGBA 5CV4A 1A2UA 1EYAA 1IHZA 3D8GA 4KY7A 3OMGA 5I9PA 3NHHA 4ME5A 2F0OA 5I6YA 1EY6A 5I6WA 1EYDA 1SNMA 5CV8A 4K8IA 4ZUIA 2F0PA 4QMGA 2EY1A 3NQTA 4RKLA 1AEXA 4KY6A 3NP8A 3S9WA 1KDBA 3SK6A 1STBA 3TP8A 2EY2A 4YIJA
chains in the Genus database with same CATH superfamily
4JPBW 3BZKA 4LUOA 3LX0A 3ND9A 1Q8KA 1BO0A 2NZOA 1STNA 1D5XC 1TS2A 1AP0A 2MJ8A 3AU7A 4OWTB 3PGZA 1M4VA 4UP7A 3D6CA 1N32L 3J7A5 4JI2L 2JA5B 1PHJA 2RDFA 4BY1B 2MHVA 3I4LA 4JBJA 2KBNA 3D0FA 3RZOB 1YZ6A 2K5QA 4HTHA 4K5VA 3TS0A 3UI2A 4OIJA 5JVG3 2OXPA 4DAYB 4HN7A 1TWHH 2EYPA 4XYOA 5JEAH 3MWYW 4IUVA 3TMEA 2KCNA 1X55A 3S1RH 2KA7A 1HFNA 2WKDA 1SE3A 5GAHC 3HOZB 1X9NA 3QIAA 4HIOA 1PYBA 2J0TD 2K05A 4MZ9A 3RMHA 4ZAIA 1VQMA 1J5EQ 1O7IA 1QJOA 1KTKA 1EOTA 3J7AF 1XNRQ 3JAMi 1TIID 5ELEA 2K04A 2DJFC 1K8MA 3SVMA 2F3WA 1WTQA 4R4CA 3S1QH 4M1UB 3S14H 5DNFA 1ICFB 4JI8Q 4C3HG 5EPLA 3JAMc 4CDCC 1N34Q 3CD6A 4DR6L 4H13C 3WWVA 5AJ3L 2KCCA 3CCEA 4K5WA 1VQIA 1SE8A 1WCMH 2K03A 1S5DD 5ELDA 1DM0B 4HIMA 3I4MG 1L1OC 2F3IA 1EIHA 3AB9A 5IP7G 2CHBD 1JQYD 4C3JB 1KDAA 1FD7D 4FVMA 3AFPA 3TZUA 3PO3G 3H3VC 5C3XA 4A3FG 4R4OA 4A3EB 5IOCA 1SFOB 4A3MH 3CRLC 3A7LA 3RR5A 2ICIA 3R93A 4Y52H 1C0AA 1S5FD 4B3SL 3TRZA 4WORA 2BA0A 1CHQD 1KNEA 3EQLC 1K8OA 1HNZQ 2L15A 1A2UA 1TS5A 2QA4A 3URYA 1NJIC 1EY6A 1SEBD 1PRTB 1PZKD 1KL9A 1ZYRC 1T5EA 4KY6A 4R8IA 3HOUH 5LL6S 4JG2A 1PH1A 1ET9A 1PTOC 2H1EA 2Z4IA 3DM1A 5IP9H 1VQPA 4CKCA 4OO1H 3GO5A 4R1JA 3ULLA 1EQVA 2E8GA 1KXLA 2A6ED 2RHSB 5EGTA 4JI4Q 2LFNA 5C3WA 4DUZL 3E9IA 5I2XA 1NMFA 4KLKA 1XPOA 1VQDA 3NBIA 3S15H 4UP9A 3MXPA 4OWWB 4KKTA 4DAMA 1YNXA 2YTVA 4DUYQ 1QE6A 4G4KA 1TY2A 3R2TA 3U4ZA 3NSWA 2WIIB 1EY4A 2Y0SB 1J9OA 4J6HA 1H9JA 4LF7Q 4KMUC 4A93G 5ELBA 3ERSX 3SR1A 4LF6Q 1I6VC 3HEJA 2O5JC 1ILQA 4XQNA 2E2JB 1D5ZC 3RLNA 4C1NI 3I4OA 5LL6X 4A3BG 1WD1A 3CCQA 1EZ8A 5CBAE 2ENBA 4DXGA 1CKOA 1ICWA 4B9WA 5CV6A 1MBYA 4DR7Q 2ID0A 2A69C 5M3FH 5HY6A 2FJ2A 2J7ZA 2NTTA 2I07B 1I4HA 1LTSD 1PFNA 1HTLD 2YV5A 3FEWX 5EKKA 4ZKBB 2MFIA 2NN6G 4U673 3FDTA 2AUJD 4QIWE 4J8QA 2XWJB 4K2KA 1NE3A 2WP8J 1XYIA 2AKWB 4L5SA 2L11A 1GUWA 2WB1G 3CKIB 1TWFH 1MD2D 2Z9HA 4TKOB 1SE2A 4DV5Q 1VCIA 3H94A 2E5LQ 4A3GG 2K01A 1NNXA 4GOPB 3NWTA 2B63H 1NSNS 3MXGA 3P75A 4H44C 2VQEQ 5C5LA 1RHPA 1G291 5ELCA 1H95A 2C35B 4C3HB 4A3LH 1DCZA 1M1KC 4RHSA 4CJ1B 2B2VA 1E1OA 3SK6A 1RDPD 1CTMA 3J81i 4ZRZA 1EQTA 1BXTA 2B2VC 5JEAG 4HSPA 5IT9E 3K57A 1IL2A 2JYOA 4JV5Q 1RTOA 4DV4L 4OIKA 3R3OA 3I4MB 4XT1B 1TKWB 3J81c 1TVXA 4M8AA 4DPGA 3EN2A 5GROA 2RCFA 4F87A 1WOCA 2VB3X 1VQAA 2I5HA 5JAVA 2JA5H 4A3FB 1XNQL 2CQOA 1PZJD 2JA8B 3A55A 3DWAA 4BY1H 1L2FA 4HCSA 1FNUA 3RZOH 5J3BA 5C4ZA 4DV2L 4HCEA 2PMZE 1NUCA 1BCPC 1SNPA 5C0XI 4DK1A 2EOTA 1H9RA 2ZXPA 2L1BA 5CV9A 1G91A 2K5WA 1WCMG 4QB4A 3HOZH 2EQSA 2M9VA 4YY3L 3KF8B 2N49A 1CM9A 3PUWA 3UE1A 1K3BC 4A3DB 1OXTA 2AWOA 1I3QB 1IBKL 3UDFA 5CYUA 4WRDA 1A2TA 2F0LA 4KTAA 1X6OA 2F52A 1PYSB 3S16B 1FYCA 5ELNA 3NXWA 2KQ3A 2EJMA 1HNWL 1RJTA 3Q8DA 4DV3Q 3J7AV 2CH4A 1SN8A 1TWGB 4LF8Q 3KDFB 1R4PB 1EIYB 3VYTA 2QCPX 4XIGS 4LF4Q 3L2PA 1QOHA 1VQ6A 2RHQB 1JOOA 5K36H 5E3FA 1SJED 2LXJA 2NB0A 2PQAA 2Z1CA 4PMCA 5C0XJ 4DNIA 2D0OA 1F9QA 4KHPL 4C3JH 1JR0D 2OF1A 2DN8A 2G9DA 1CSPA 5JOBA 3HOUG 1VQ9A 1BQQT 1EIGA 2F0TA 2QF7A 4A3EH 1SFOH 5M5WB 2HHHL 1JWSD 1ZXTA 1XMOQ 2D0PA 1DXMA 4L5QA 3NEMA 5IODA 1HPCA 1HZCA 3E6ZX 2OQ0A 4FXGC 3M4YA 2MNAA 3F1ZA 3TP5A 2F4VL 4AH6A 4AIMA 1U4PA 2HT1A 1H9KA 1Q12A 4Z9CB 4EQ5A 1YJNA 5IY0A 1MSHA 3K5MA 3G4SA 1STAA 2IHEA 3DLLA 1AFPA 3KBGA 1SAPA 4JI0L 3EVQA 2IW3A 4HJ5A 5A2QL 1OXXK 3NK9A 1LT3D 4QIWB 1QUQB 4BA2I 3N52A 1F2YA 1STEA 3OIQA 2LSSA 5CV7A 3HOYG 4LFCQ 4QQBX 2JXMB 1J5EL 5C44B 3LGJA 2B2UA 4I7AA 1X3GA 1N36Q 1SNQA 1LT4D 2WB1B 3S2DB 4RGOS 3CCMA 1YHQA 2B2UC 1IXRA 1Q90A 3VDYA 1IYUA 4A3GB 4UPAA 3TDQA 1N33L 4JI8L 1EY9A 4JOIA 3T1YQ 1S5BD 3IRBA 2F0EA 3M3YB 2CKZB 3K0XA 1JICA 1LTLA 2Q8RE 3GV6A 2NYZD 4JOIC 3CCUA 1EWIA 2OEOA 1Q8IA 1C4QA 4B3RQ 3M85A 2E2JH 4IO9A 3M7NA 2L4NA 1QVGA 4C2MB 2YTYA 2GVBA 5CC4A 4GNXB 3E3XA 3W1GA 4RAUC 2PYKA 2JN4A 4JI3L 2N3SA 5FO9B 2KJXA 5D3IB 2HDMA 2B8GA 4LW1A 4PNYA 3KK7A 3HOXG 1JC7A 2XRQD 1WTWA 3E5SA 2OTJA 3N6RA 1CKNA 1ASZA 4HJ8A 3K7AB 1V1QA 1F9PA 1X54A 3BDCA 3STBD 1D7QA 4ALPA 1LACA 2KEDA 1RODA 2Z8LA 2PMZB 3JAME 2JA7B 1KQSA 4DNTB 1JWMD 2EYOA 1EUJA 5EPKA 2HCCA 2IX1A 3U4VA 2SDFA 3Q24A 3WOEA 3PSIA 3PIOA 1GUSA 2NZ1D 4A3CG 1WCMB 1NY4A 5LMUL 1VF5C 1WTOA 1XTDA 4NXML 1ZKOA 1K28A 2K14A 2KVMA 4NP5A 4OO1I 4CKEA 2IT1A 2NTSA 4CBVA 1EYAA 4IPGA 3VR3A 4JI4L 5I9PA 3MC0B 4OGQC 4CDFC 1Z7TA 3V05A 3J80c 2JA5G 2EY1A 1OXSC 4C3HH 1EFWA 1JJ2A 2N55A 4JI7L 1B9NA 3PQIA 2C5CA 4YWLA 5NUCA 4DUYL 4CGYB 1ILPA 5L37A 4RMFA 4GLAC 2WKCA 5EKLA 1Z47A 2MUYA 2FMMA 1I6HB 2MP1A 2RCNA 4IPHA 1VQBA 3HOZG 3I4MH 2YTXA 3A8KE 3WOFA 1PFBA 5H1SE 3E0EA 2AUKA 1SMXA 3FPUB 3T13A 3M9BA 2PW7A 1QZHA 1BNZA 4A3FH 5HGTA 2JA8H 3BU2A 4EQPA 2UXCQ 2ZTCA 3J7YW 2BDNA 4LF9Q 2K1BA 3DEOA 1WI5A 4RWSC 2ZJQA 4KKUA 5JVH3 3I70A 3VR5A 1FVIA 1SDFA 3RUZA 3HKZE 4A3DH 5K36G 1I3QH 4DV0L 2KCMA 1LO5D 1WTRA 4DR5Q 4C3JG 2QEXA 3NE5B 4QF4A 3O13A 3S16H 1S5ED 3G71A 4A3EG 2ASBA 1VMPA 3A7AB 4R8NA 3NTIA 4OX9Q 4DV5L 2K75A 3HOYB 3I8ZA 5IGGA 1DGSA 1TWGH 5K5PA 2EE1A 1SYCA 1JCKB 4L8JA 3SK8A 4YCUA 2OT2A 2VQEL 3KLSX 4LJZC 4A3KB 1WTXA 4IFDI 1PYWD 2KECA 3OWFA 1RTNA 3MTSA 2DNCA 2PZUA 5M5WH 3HS0C 4JV5L 2WACA 4K0KL 1Y1WG 1K0SA 5IWAQ 1SRUA 1LM0A 3FPPA 4ME5A 4X3SA 3MFGA 1HTPA 1YBYA 4QL5A 5EJWA 1X32A 3TBIB 1DZ1A 1X3EA 4FXKC 4IUQA 3HOXB 4FDBA 3HOWB 1IBMQ 2CFMA 2H5XA 2Y0SG 4JI1Q 4QUFA 1B70B 2NN6H 1CKMA 1VQCA 3I7FA 1EYCA 2F0GA 1JOKA 2EYJA 4O42A 4DR4Q 2ZXOA 3BJUA 3C1FA 3MA2B 4C3IB 4DR3Q 5C44H 3TN2A 3KUPA 1AN8A 2E74C 1TU2B 3VA7A 5JPNC 1F2MA 5BN3A 2CQAA 3S2DH 1I4XA 2L0CA 1DOMA 4HSVA 3ND8A 3PIO3 5KIXA 2LS01 1LABA 1D5MC 3OPOA 4A3GH 5C6AA 1HFGA 3RLFA 3J81E 2GN5A 1IW7C 1W2BA 4RCOA 3GTPB 1QNUA 1XX8A 3M3YH 4NB3A 4LUVA 4DR1Q 2PQEA 1JORA 3A0JA 4LF8L 3OTOQ 2UUAQ 3EBEA 5D3DA 1QNKA 4LF4L 4G7HC 5AFWA 3BG3A 5E1FA 2F0FA 4RA8A 2O2LD 4C2MH 4A3JG 2RA4A 4NW2A 4K2LA 2BH8A 4J15A 2KHJA 3KF6B 5C4HA 1XMQQ 1CSQA 1RD9D 3KFUA 1GD7A 2QGQA 2UXDQ 2VW9A 3VR6A 3K7AH 3I90A 1PRTF 1RKNA 4KV6A 2UU9L 1FGBD 2ALYB 5FLXL 3GTGB 5M3MG 1AW7A 2BE5D 5EQ0A 4YHHL 3M4OB 4EQOA 1I4QA 2K5DA 2JA7H 2R93H 2DY7A 2PI2E 2FHTA 3T53B 4GKJQ 5KRUA 1SBBB 3HKZB 1K83B 3I72A 4N8X1 4KJOA 1L1OA 2AQ3B 1E2WA 1M90C 1LUZA 1U4RA 4LFCL 3ICEA 1EYDA 1B8AA 2PPBC 3J81j 4LFBQ 4RKLA 4DV6Q 1C8CA 2ATWA 3A8JE 2JA8G 4DGZA 3CCLA 1Z9FA 1LTGD 1FJGQ 1A63A 2X6GA 4N8FA 4RFBA 1SR3A 2K4KA 2ZM6L 3T1YL 2ZTDA 4YCVA 1A3UA 3BVGA 1I6HH 5KYLA 2UUBQ 3J80L 3D4DA 4JI6Q 4A3DG 4LFAQ 3T16A 3MHBA 1VQFA 4QJFA 1PH2A 1SYFA 3NWSA 3SHLA 2ZTEA 1GUGA 4RCNA 3GTJB 5KNCA 3GTOB 2Q2UA 4OXPA 1Y1WB 2VUMB 5EPJA 1STGA 2ES2A 4LWCA 1WTPA 4R4QA 2EJGC 5ELOA 5FJ8G 1VF7A 2A73B 2RF4A 3HOVH 1PH8A 1QZGA 2EY6A 1K3RA 3D3RA 4DR2L 1HRJA 1J6QA 1V1PA 1II3A 2N8NA 3BZDB 2HIVA 1P16A 2SNMA 3CPFA 1LLRD 4JVZA 1PTOB 4P73A 1RF2D 3FHWA 4DKAC 1G2SA 2B2WA 3PIP3 4CHTB 1G6ZA 3HOYH 2F0JA 4IOCA 2B2WC 3A74A 2Z6KC 1U4MA 3H6MA 3CCSA 3X3NA 2F0IA 2HCIA 2JJQA 5F2DA 4B3TL 4DK0A 2F03A 4IPCA 4A3KH 2UXBQ 2A5HA 1I4PA 2F0KA 1VQ5A 2WFWA 4MN3A 2VNUD 3L0OA 2PNHA 3MXNA 4IOAA 2PI2A 5IYDH 2E2IB 4QY7A 3AQQA 1DJRD 2M00A 1B3AA 2EDGA 4DK3C 4XXEA 4DAVA 3D8GA 1VQ4A 5I6WA 2K5NA 3CCVA 1VMCA 4A3JB 2NWGA 5C44G 3NQTA 3CPWA 3S9WA 3L3OC 4LNQA 4YIJA 2QEJC 2R6GA 3HOXH 3QG1A 3AMUA 4C56C 2MPMA 4CDDC 5T1IA 1SYGA 2QDLA 1UNSA 2IHFA 2IL8A 3ULJA 2Q2TA 4LF9L 3HOWH 1LYLA 4G7ZC 4DNRB 3BDLA 1XPUA 3KOJA 4KJNA 5KNDA 2EVBA 4GS3A 5M3MB 3SE0A 3JC66 2WINB 3G7LA 1FNWA 4PMWA 4IURA 1NAPA 4C3IH 1S72A 1D2BA 2IPKD 4DR5L 1TS4A 1TR5A 2WAQE 2HQLA 5LMNQ 1KAAA 4UDUC 4A3CH 5G3LF 2CCZA 4P2CB 1DD2A 3K5LA 2DGYA 1Y1VB 5GAGC 1VQEA 4BBRG 3GTPH 1B2TA 3CAMA 1C9OA 2IX3A 3MEHA 1ESFA 2QDBA 2IY5B 1E3PA 1QB5D 2QKIC 2KHSA 1IZ6A 1YJ9A 4ZLTF 2HD3A 3T1HL 4DXFA 1KLUD 2JA7G 2R93G 4TSSA 3I3CA 4X3TA 4A75A 4KY5A 1Y8OB 2D9UA 3OYYA 1R9TB 3K7UC 4ZQ3A 2F0QA 1BDOA 4LUZA 1WFQA 1KRTA 1S3OA 3GTMB 2G9HD 1HZBA 4A3IB 1YIJA 4B3MQ 3AYHB 4TQUS 1KHIA 1I94Q 2FXQA 1YNND 2ZXRA 4KI0A 4X62L 5IWAL 1YHBA 3GTGH 1V1OA 2K5HA 2OWOA 3G6JB 1E2VA 1ESRA 5C4JB 3M4OH 4PV1C 3S17B 1G8ZD 5JJZA 1AH9A 3RN2A 1BCPB 1HNXL 2O5IC 1PVOA 1H9SA 2JP1A 3IKJA 4ILWA 5KEEA 1YNJD 3HZXA 4O0AA 1Q3LA 2CW0C 1K83H 2R3ZA 1YI2A 1O80A 3P1HA 2TMPA 5M5XB 1IBLQ 1EU4A 2N88A 4JI1L 3PO2B 2K28A 2D2CC 3PUYA 2NN6I 3GDEA 4DR4L 1PFSA 1GHJA 4KHZA 3BS1A 4I7ZC 4V0BA 4AQYL 3KYHC 4JYAL 5IGDA 2Z6BA 3ER0A 2K6AA 1Q81C 2F0NA 2UUCQ 2XVSA 4R4IA 1AZPA 1BF4A 1EWCA 2PZTA 1LTID 4DR1L 5E7NA 1OO9B 3R8BA 2UUAL 3MFYA 3C3LA 4DK6C 3HOVG 2KEEA 1PH6A 2RQXA 2PQAB 4EX5A 5LMNW 4IJHA 3H3VH 3TS2A 1F9RA 4FP5D 5C4XB 5IIFA 1HR0Q 2F0MA 3GTJH 3GTOH 5JJKA 1D1KA 1Y1WH 2VUMH 1CQFA 1B3QA 3H15A 1NR4A 4JW0A 2UXDL 3KBXA 2QILA 1ML0D 4BS9A 1I4GA 1XNRL 5BR8Q 1K9MC 4K5XA 5EBCA 3U9OA 1EWHA 2FINB 1PRTD 4A3KG 1B4OA 1HXYD 1TS3A 3KLSA 3GTQB 3OOCA 1I4RA 2EXZA 1N34L 1PTOH 2CVRA 5IYDG 4FF1A 4HAEA 4FYDA 1F77A 2RDHA 1SMYD 4JK1C 3W5OA 4C1NK 2E2DC 1UE1A 1X56A 3E9HA 3QWNA 4RGNA 5KGUA 4DN4M 1WD0A 2RVLA 4LFBL 5FLXc 5JEAJ 1XJVA 3PF5A 1YITA 4G57A 5IGFA 3MVVA 4BBRB 1FJGL 3VYSA 3HOWG 3SXHA 4O1NA 3SGIA 4KD3A 2E2IH 5IGBA 2BCOA 3B6YA 2DUDA 2E2HB 3RZDB 1HNZL 1JJCB 4GLXA 2R93B 2MQHA 3H0GB 4JI6L 3U9SA 4LFAL 3BYYB 4ME3A 4C3IG 1KDBA 4A3JH 4GZYC 2C9OA 3VR2A 1STBA 1HJPA 1SE4A 5M9OA 3T51B 3GQBA 2FMCA 4POFA 4RHRA 4DUZQ 1U4LA 4AYBE 1G6PA 3RD4A 2MGSA 3J80i 2O4XA 2F3VA 2E75C 1BOSA 1CKNB 2R92B 1EEID 3TQYA 1K73C 5M3MH 1O78A 3CP0A 1SROA 4IUTA 4DF7A 4EVOA 4NPSA 1E22A 4F7XA 1HZAA 3BVMA 3I4NG 1STHA 1ENCA 4EGVA 2A6EC 1TT2A 1UUPA 4R4TA 1KDCA 2N78A 1HR0W 2EPBA 1N9WA 4GN4B 5A2QE 4K6DA 1PH5A 2VS1A 4LF7L 3PMFA 4LF6L 1Y1VH 1A8VA 1T9HA 3AEVA 1JMCA 3VR4A 3PF4A 3F2CA 4X3UA 3K81C 1GUNA 5CGKA 3HG9A 3M4PA 3SDZA 2YYZA 2JK8A 5ELFA 1O7LA 3OHXC 1CI3M 2NVXB 1X3FA 3DWQA 3GV3A 4DR7L 3NUCA 4MIUA 5EKIA 1R9TH 1PH9A 4HJ7A 3IAYA 4CJ0B 5HGQA 1SLJA 3GTMH 3HKZG 4EQNA 2K52A 3H91A 1BKBA 2QW7A 4A3IH 2Q8IB 3OWEB 1XPRA 3HOVB 1ASYA 1H9MA 2AQ2B 1NTGA 4H0LC 5I9OA 1PXUA 3GD7A 1G2TA 1E1TA 1L0YB 4RGMA 1GUOA 3D31A 5C4JH 3S17H 1E2ZA 3FVQA 2E5LL 3MEFA 4ZK9B 1KAWA 4OONA 2Z4HA 2ZT9C 4WJWA 3NBHA 2XNAC 5M5XH 4UY8C 5DM63 5COYA 5FJ8H 1SXTA 5E4WC 3PO2H 1ZEQX 3HKSA 1JT8A 1WVLA 4IPDA 1CHPD 4X66Q 2OQKA 2EY2A 5CBEE 4XQQA 4OEMB 1UWVA 4ODGA 3TSSA 4CKBA 2FFKB 4PZ7A 2Z0SA 4FO2A 1BUVT 1EY8A 1PFMA 1IL8A 2HQEA 4HEDA 1XNQQ 5G3LD 2VUMG 1YEZA 4PMBA 2KENA 1HA5A 3FRPB 2V4DA 1XTCD 5C0XH 1RIPA 5JPMC 1MJEA 4F88A 1SYDA 1EFID 4BWGB 3FKIG 2A68D 2XRSD 2IJ0A 3KLWA 3UDXA 3OW2A 5C4XH 2BA1A 2VL6A 1IBKQ 5GAEC 4K8JA 3S24A 4CJ2C 3K8AA 4IFDJ 1CZWA 3TP7A 3RN5A 1BBXC 4KN7C 1Q1EA 1NBWA 1QILA 4LMQD 1HNWQ 1B44D 1GVPA 1HQMC 4IALA 1EY0A 1U9RA 4JBKA 1VQHA 2JEAI 4AYBB 1VQLA 1GJXA 1B53A 5DLQE 2B2YA 4RH6A 5JJIA 1SYBA 1KNAA 4BY7G 3CRKC 1YNNC 3VYRA 4ZUJA 1T5XD 3GTQH 2B2YC 4DV3L 1MJCA 2LY7A 3S2HB 5IGCA 1CT1D 4TRDA 5GADC 4DAYA 1KC8C 4R9WA 3OW7A 1LV9A 1IBLL 3ONAB 4DA2A 1WTHA 1X3QA 2PW5A 2KHIA 2LXKA 2CWAA 3I4NB 5TSSA 2HHHQ 1UE5A 1YVCA 2B3GA 2OTLA 5IGEA 4FNFA 2F4VQ 3HFZB 1GM5A 4BBRH 5FLMG 1XMOL 2R7ZG 2E76C 2Q2HA 3EA6A 1IHZA 2UUCL 4KY7A 1FGUA 3OMGA 3P20A 3K5NA 2NVYB 4BBSG 1QG7A 3FMCA 2E2HH 1AEXA 3RZDH 4JI0Q 3S1NB 4G7OC 3H0GH 2K32A 3RLOA 2B29A 1BVSA 5D65A 3IFTA 4X64Q 1ENAA 4JBMA 4B9XA 2DJGC 1Q82C 4H7BA 2XWBB 3H3VI 1HR0L 2P5ZX 2JA6G 1Y1VG 2EY5A 4DV1Q 3DXJC 4MNOA 2F1MA 5IYCH 2F0HA 3DMUA 1VQ7A 1MSGA 1EIFA 3OMCA 1N33Q 2RBMA 4XDXA 5CORA 2R92H 4ID6A 1IKMA 5CMDA 5T1GA 1N36L 3CU7A 5EBDA 5BR8L 4KHVA 4IUPA 1VQOA 1PTOF 5BN5A 3I73A 2KCTA 3HP3A 2R61A 4IZ8A 2EJFC 1AZQA 2I46A 4QUCA 5BN4A 4YWMA 2BOSA 4LAAA 1PRTC 1LTAD 4A3IG 4JI3Q 3DUZA 1A0IA 4B3RL 2A19A 1L1OB 2EIFA 2SOBA 2L12A 3E0JA 1B50A 2Q2IA 4DAPA 1Q7YC 1MHWC 1SMYC 4U68A 4GN5A 2NVXH 3C46A 1EY5A 1E0BA 3CQZB 1LT5D 2J4XA 2TSSA 1STYA 1UE6A 3FP9A 3DWPA 4J1MA 1J8IA 1CZGA 3DEPA 2BDOA 5C3EB 2VXWA 1UEBA 2L55A 3PO2G 3P7JA 5HURA 1I5FA 3MAQA 1OTCA 5FO8B 3FKIB 5IT9L 5LMUQ 4NKLA 2ZJPA 4NXMQ 3PUZA 2A74C 3STBC 1MGSA 1VS0A 3F2DA 2VZAA 3J7ZC 1QVCA 1C48A 4I65A 2Z6KA 3L9AX 4HR7B 2NVTB 3EJIA 1Z6HA 1SNCA 5CV4A 4IUUA 3CCRA 2EZVA 1EU3A 1XXGA 5LHY1 4DV7Q 1OXVA 4GKKQ 5M5YB 2RSOA 4JI7Q 1I50B 1UE7A 1LTTD 5FLXE 5C0XG 3NP8A 2K50A 4YWKA 1Q46A 1HUMA 3H09A 3MZ5A 1PH3A 3CW2C 4BY7B 1V1PB 2EYHA 1GO3E 3CMAA 5C4XG 3M7GA 1Y8NB 4WJ3M 1IYVA 5ISRA 4JC0A 1A3VA 1EOVA 3KJPA 3GP7A 5FKAC 1DOLA 2VQFQ 3IL8A 3EFXD 4KK7A 4RG1A 5IYBH 2GA4B 4GOPA 3CHBD 4BXXH 1LT6D 5C5MA 4ABNA 1PV4A 2YU9B 1TXYA 4F8MA 1NMGA 1N8RC 2NZHA 4GOPC 1F2LA 4KN4C 4Q5VA 3QB3A 4CDEC 2UXCL 2R7ZB 3NTHA 4KD4A 1XWEA 4DV0Q 1MI2A 1DONA 4BBSB 2JEBI 3MXNB 4P71A 3J80E 1GKHA 1X65A 4V190 2DY8A 3C1EA 4X6AH 1F9SA 3LWUA 1TWAB 3UDIA 1ENFA 1CUKA 2WAQG 1JWUD 1NR2A 2EXDA 2WB1E 1BCPF 1GXDC 4Q0FA 1VQNA 2I0QA 2D62A 1P8LA 2HDLA 1KLGD 5EAYA 2JA6B 4QCLA 1DOKA 1TWCB 4OX9L 2F0VA 4UHVA 4FF2A 4HJAA 1QWYA 4E6IA 3S2HH 4YCWA 1EQRA 3HGBA 4IFDH 1AE2A 1CFMA 4B08A 4XT3B 4PG3A 3T56B 4JI5Q 5J22A 3W1BA 1CQVA 2XGTA 3SK4A 3NTKA 4Y7NB 1A6XA 4TVAB 3I4NH 3H0GG 3R2IA 2R7DA 3KF8A 1CA5A 4MTKA 3F8TA 3CC2A 3EIVA 4X66L 4K0KQ 4N9PA 2DNEA 4PQXA 2A6HD 3A5ZB 4X3KA 2JE6I 4POGA 1L0XB 1OXUA 2JQOA 2K33A 3PCOB 3S1MB 3PO3B 2F0OA 5IYCG 4MHEA 4L5TA 4O2DA 3KJOA 2F0PA 3CC7A 4LF5Q 3GTLB 2R92G 1BBWA 2NVYH 3KDFA 3S1NH 4DFAA 3W2DA 1ONLA 4JBWA 4P75A 2MO0A 1Y8PB 3QOLA 2HUGA 2XIWA 4NXNQ 1JB3A 1PMRA 1RCVD 1HA6A 2IX0A 1VDZA 1IBML 2AQ1B 1IW7D 5D14A 3LWEA 3GTKB 4OL7A 4X65Q 1HCZA 4RKBA 2A68C 4GN3B 1VQJA 4RGTA 3WDNA 3NQIA 1D1IA 4DR3L 4A3MG 2VY3A 1B1ZA 3Q22A 2NVQB 2I5LX 4KKSA 1YHAA 4IUNA 1N32Q 5E4XA 4JI2Q 1V43A 1E24A 3AFQA 1UAPA 2PNRC 3F2UA 4ZYSA 1SYEA 3PUVA 2L9HA 1IKLA 2BH2A 3I2ZA 5J39A 1H9SB 3TEHB 3JAML 3W3AA 1TY0A 1V9PA 2IWHA 3OIPA 3DHQA 3OTOL 1LTRD 1O7YA 4ZKCB 1QUQA 3OSOA 4A93B 4N9TA 4MTNA 3U58A 3X3MA 4XYQA 5IP9G 1U0LA 4BA1I 2AWNA 4OO1G 1WTVA 1Q86C 4FF3A 4A3BB 1WJJA 3CQZH 4S3SA 5I4DA 1XMQL 4A4IA 2UU9Q 1HHVA 1E7ZA 1KABA 1VQGA 1CK1A 3VA5A 4YHHQ 3QO2A 5KYIA 3CCJA 4OWXB 2NBFA 2SEBD 2ICEC 5C3EH 1PDQA 1V8QA 2F0WA 2RSNA 4DR6Q 4XTCS 5AJ3Q 2M2LA 3KLRA 1M8AA 3FKIH 4L6TB 1FR3A 3QJYA 3SEBA 1JE4A 2KUMA 3K0YA 4X64L 4GKJL 4GNXA 3RNUA 2BE5C 2NVTH 1LTBD 3NHHA 4JCVE 4L63B 4GNXC 3LNNA 4DV1L 4K6LA 4K8IA 5M5YH 3ZJYC 1A15A 2WAQB 2X6LA 4QMGA 5IYBG 4QGUA 1I50H 1VQ8A 5M3FG 2B39A 4BXXG 2PO4A 4B3SQ 1PA6A 4PZ8A 2ZM6Q 2JA9A 2K7VA 1EYGA 3SK5A 1ZYRD 5J1ZA 4DV6L 3CXCA 5JJLA 1WYDA 1QCBD 4IJLA 3K59A 4BY7H 1DYQA 4OELB 2R7FA 3L7ZC 1PTOD 1KIXA 3CC4A 5A35A 5DEHA 1A62A 1W6JA 2A1AA 3I55A 2ZJRA 2F0SA 2UUBL 1TWHB 1W6KA 3Q6SA 3V2TA 3S1RB 2AMCB 3EROA 1G51A 2YU9H 4P72A 4HIKA 3HRZC 2RDGA 2X69A 4AYBG 3I91A 2B63G 2NUCA 4WFN3 4APVA 2H4OA 2XTIA 5FLMH 2R7ZH 5KNBA 1SJHD 5DAUA 3T4AC 3S1QB 4DR2Q 1FL0A 3S14B 4IFDG 3ITPA 4A3LG 4UAIA 1L0WA 3K5OA 4BBSH 4K14A 1S4ZA 5GQOA 2AHOB 2LKVA 1TWAH 1KD1C 2PZWA 5FOBB 3CF5A 3F2BA 4OHJA 2A69D 2MO1A 5FK9C 1EY7A 1JB7A 1PZID 3PV0A 1QVFA 2JA6H 1TWCH 1X3PA 2CH4W 4B3TQ 2F0DA 3G48A 2L5TA 4IN3A 4DV7L 5I2YA 4GKKL 4BY1G 1Q1BA 4A3MB 1GHKA 2RKSA 4HMJA 1FNVA 3BYTB 1VQKA 2V1CC 4H02A 4HJ9A 4Y7NH 1EZ6A 5IE8A 2UXBL 3MXUA 2D5DA 5IT9c 4HIDA 1R4QB 1GUTA 1RL2A 1UEAB 2Q8TA 1Y69U 1W3SA 3K80C 3A5UA 2I5MX 1Y14B 5IP7H 4UP8A 1BBUA 1SNMA 3S1MH 2VQFL 3PO3H 3HOUB 2F4IA 3U50C 1JE5A 1HH2P 3GTLH 3TP8A 1BR9A 3UDGA 3Q23A 3J81L 1EQQA 1ET6A 1S40A 4PZ6A 1PH7A 4HMIA 1K8AC 3VYUA 1A3TA 2SNSA 2LMCB 1K0RA 3CMEA 3M4QA 1HZ9A 3S15B 3D6WA 3BZCA 3A54A 2KOLA 2B2TA 3K6OA 3GTKH 1S5CD 2VB2X 1EEFD 4A76A 2B2TC 3A8IE 3DM3A 1HUNA 1O7ZA 4FF4A 2JSOA 4DU9A 1MKHA 4FXDA 5DM73 4DV4Q 1SNOA 5CV5A 5CR3A 1D6EC 4ULLA 1EL0A 2CWPA 2NVQH 1PLFA 3G6EA 1TQOA 5LMNL 3I56A 1F2ZA 4NDXA 3UE0A 1BCPD 3ERQA 1SSOA 2GVAA 3TREA 3Q0AA 3T1HQ 2G5DA 4P74A 1K8GA 1JJGA 1JOQA 1YJWA 5FO7B 5M3FB 4DV2Q 3NENA 3ZYYX 5C3EG 2OCEA 4JI5L 3NBHB 4A93H 3ULPA 2XN9C 3IFDA 3V96A 2HIXA 4YY3Q 3C2PA 2XSCA 4NMZA 4L5RC 2PCFB 3D4WA 4A3BH 1MIUA 4X62Q 3D4RA 2EYLA 1AE3A 3QOJA 1GOZA 4B3ML 2CW0D 1CA6A 2F0UA 1I94L 4WJ4A 1C7YA 1TWFB 1D8LA 1SNDA 4GLVB 4XQJA 4LF5L 1B9MA 2A6HC 1HNXQ 3TP6A 3K58A 2EYMA 2B63B 3A56A 2EYFA 1U5KA 3PIPA 3BVZA 4IQZA 4ZCKA 1KRSA 2Y0SE 3BDOA 4NXNL 3TZDA 2B8FA 1NCVA 5I6YA 3QR8A 1HQRD 1B7YB 4KHPQ 3KF6A 5CV8A 4ZUIA 3PUXA 2K5VA 1IYJB 2A8VA 4X65L 4AQYQ 3NELA 4JYAQ 2WV6D 3NPPA 4LK1C 1PH4A 1YNJC
chains in the Genus database with same CATH topology
3LX0A 3ND9A 1BO0A 1STNA 1D5XC 1TS2A 1AP0A 2MJ8A 3AU7A 1M4VA 3D6CA 2JA5B 2RDFA 4BY1B 2MHVA 3I4LA 3RZOB 2K5QA 4HTHA 4K5VA 3UI2A 4OIJA 5JVG3 2OXPA 4HN7A 2EYPA 4XYOA 5JEAH 3MWYW 4IUVA 3TMEA 2KCNA 2KA7A 1HFNA 2WKDA 1SE3A 3HOZB 3QIAA 2J0TD 2K05A 3RMHA 4ZAIA 1QJOA 1KTKA 1EOTA 3J7AF 1TIID 5ELEA 2K04A 1K8MA 3SVMA 2F3WA 1WTQA 4M1UB 5DNFA 4C3HG 5EPLA 4H13C 2KCCA 4K5WA 2K03A 1S5DD 5ELDA 1DM0B 1EIHA 3AB9A 2CHBD 1JQYD 4C3JB 1KDAA 1FD7D 4FVMA 3TZUA 3H3VC 5C3XA 4A3EB 5IOCA 1SFOB 3CRLC 3A7LA 2ICIA 3R93A 1S5FD 4WORA 2BA0A 1CHQD 1KNEA 3EQLC 1K8OA 1A2UA 1TS5A 3URYA 1EY6A 1SEBD 1PRTB 1PZKD 1ZYRC 1T5EA 4KY6A 4R8IA 5LL6S 1ET9A 1PTOC 2H1EA 2Z4IA 3DM1A 4CKCA 4OO1H 3GO5A 1EQVA 2A6ED 5EGTA 2LFNA 5C3WA 5I2XA 3NBIA 3MXPA 4KKTA 1QE6A 4G4KA 1TY2A 3R2TA 3NSWA 2WIIB 1EY4A 2Y0SB 1J9OA 4J6HA 1H9JA 4KMUC 5ELBA 3SR1A 1I6VC 3HEJA 2O5JC 1ILQA 4XQNA 2E2JB 1D5ZC 4C1NI 5LL6X 1WD1A 1EZ8A 5CBAE 2ENBA 4DXGA 1ICWA 4B9WA 5CV6A 1MBYA 2ID0A 2A69C 2FJ2A 2J7ZA 2NTTA 2I07B 1I4HA 1LTSD 1PFNA 1HTLD 3FEWX 5EKKA 4ZKBB 2NN6G 4U673 3FDTA 2AUJD 4J8QA 2XWJB 4K2KA 2WP8J 1XYIA 2L11A 1GUWA 3CKIB 1MD2D 4TKOB 1SE2A 1VCIA 3H94A 2K01A 3NWTA 1NSNS 3MXGA 3P75A 4H44C 5C5LA 1RHPA 1G291 5ELCA 4C3HB 1DCZA 4RHSA 4CJ1B 2B2VA 3SK6A 1RDPD 1CTMA 4ZRZA 1EQTA 1BXTA 2B2VC 5JEAG 4HSPA 5IT9E 3K57A 2JYOA 1RTOA 4OIKA 3R3OA 3I4MB 4XT1B 1TKWB 1TVXA 4M8AA 4F87A 2VB3X 5JAVA 4A3FB 2JA8B 1PZJD 3A55A 3DWAA 4HCSA 1FNUA 5C4ZA 4HCEA 1NUCA 1BCPC 1SNPA 5C0XI 4DK1A 2EOTA 1H9RA 2ZXPA 2L1BA 5CV9A 1G91A 2K5WA 4QB4A 2M9VA 1CM9A 3PUWA 4A3DB 1OXTA 2AWOA 1I3QB 5CYUA 4WRDA 1A2TA 2F0LA 4KTAA 3S16B 1FYCA 3NXWA 2KQ3A 2EJMA 1RJTA 3J7AV 1TWGB 1R4PB 3VYTA 2QCPX 4XIGS 1QOHA 1JOOA 5K36H 5E3FA 1SJED 2NB0A 2Z1CA 4PMCA 5C0XJ 1F9QA 1JR0D 2OF1A 2DN8A 2G9DA 5JOBA 1BQQT 1EIGA 2F0TA 2QF7A 5M5WB 1JWSD 1ZXTA 1DXMA 5IODA 1HPCA 3E6ZX 4FXGC 3M4YA 3TP5A 1U4PA 1H9KA 1Q12A 4Z9CB 1MSHA 3K5MA 1STAA 1AFPA 3KBGA 1SAPA 3EVQA 2IW3A 5A2QL 1OXXK 3NK9A 1LT3D 4QIWB 4BA2I 3N52A 1F2YA 1STEA 3OIQA 5CV7A 2JXMB 5C44B 2B2UA 1SNQA 1LT4D 2WB1B 3S2DB 4RGOS 2B2UC 1Q90A 1IYUA 4A3GB 3TDQA 1EY9A 1S5BD 2F0EA 3M3YB 1JICA 3GV6A 2Q8RE 2NYZD 2OEOA 1Q8IA 1C4QA 3M85A 3M7NA 2L4NA 4C2MB 5CC4A 4RAUC 2PYKA 5FO9B 2KJXA 5D3IB 2HDMA 2B8GA 4PNYA 3KK7A 1JC7A 2XRQD 1WTWA 3E5SA 3N6RA 3K7AB 1F9PA 3BDCA 1LACA 2KEDA 1RODA 2Z8LA 2PMZB 3JAME 2JA7B 4DNTB 1JWMD 2EYOA 5EPKA 2HCCA 2IX1A 2SDFA 3Q24A 3WOEA 1GUSA 2NZ1D 1WCMB 1VF5C 1WTOA 1ZKOA 2KVMA 4NP5A 4OO1I 4CKEA 2IT1A 4CBVA 2NTSA 1EYAA 3VR3A 5I9PA 3MC0B 4OGQC 1Z7TA 3V05A 2EY1A 1OXSC 2N55A 5NUCA 1B9NA 2C5CA 4CGYB 1ILPA 2WKCA 5EKLA 1Z47A 2MUYA 2FMMA 1I6HB 2MP1A 3A8KE 3WOFA 1PFBA 2AUKA 3FPUB 3T13A 1BNZA 2PW7A 5HGTA 4EQPA 3J7YW 2BDNA 2K1BA 3DEOA 4RWSC 4KKUA 5JVH3 3I70A 3VR5A 1SDFA 3RUZA 5K36G 1LO5D 1WTRA 4C3JG 3NE5B 4QF4A 3O13A 1S5ED 1VMPA 3A7AB 4R8NA 3NTIA 3HOYB 3I8ZA 5IGGA 5K5PA 2EE1A 1SYCA 1JCKB 4L8JA 3SK8A 2OT2A 3KLSX 4LJZC 4A3KB 1WTXA 4IFDI 1PYWD 2KECA 3OWFA 1RTNA 3MTSA 2DNCA 2PZUA 3HS0C 2WACA 3FPPA 4ME5A 4X3SA 3MFGA 1HTPA 5EJWA 1X32A 3TBIB 1DZ1A 4FXKC 4IUQA 3HOXB 3HOWB 4QUFA 2NN6H 1EYCA 2F0GA 1JOKA 2EYJA 4O42A 2ZXOA 3C1FA 3MA2B 4C3IB 3TN2A 3KUPA 1AN8A 2E74C 1TU2B 3VA7A 5JPNC 1F2MA 5BN3A 2CQAA 1I4XA 2L0CA 1DOMA 4HSVA 3ND8A 3PIO3 5KIXA 2LS01 1LABA 1D5MC 3OPOA 5C6AA 1HFGA 3RLFA 3J81E 1IW7C 4RCOA 3GTPB 1QNUA 1XX8A 1JORA 2PQEA 5D3DA 1QNKA 4G7HC 5AFWA 3BG3A 5E1FA 2F0FA 4RA8A 2O2LD 2RA4A 4NW2A 4K2LA 5C4HA 1RD9D 3VR6A 3I90A 1PRTF 1RKNA 4KV6A 1FGBD 5FLXL 3GTGB 1AW7A 2BE5D 5EQ0A 3M4OB 4EQOA 1I4QA 2K5DA 2DY7A 2FHTA 3T53B 5KRUA 1SBBB 3HKZB 1K83B 3I72A 4KJOA 2AQ3B 1E2WA 1U4RA 1EYDA 2PPBC 4RKLA 1C8CA 3A8JE 4DGZA 1LTGD 2X6GA 4RFBA 1A3UA 3BVGA 5KYLA 3J80L 3D4DA 3T16A 3MHBA 1SYFA 3NWSA 3SHLA 1GUGA 4RCNA 3GTJB 5KNCA 3GTOB 1Y1WB 2VUMB 5EPJA 1STGA 1WTPA 2EJGC 1VF7A 2A73B 2EY6A 3D3RA 1HRJA 1V1PA 1II3A 3BZDB 2SNMA 1LLRD 1PTOB 1RF2D 1G2SA 2B2WA 3PIP3 4CHTB 1G6ZA 2F0JA 2B2WC 1U4MA 3H6MA 3X3NA 2F0IA 2HCIA 5F2DA 4DK0A 2F03A 2A5HA 1I4PA 2F0KA 4MN3A 2VNUD 3MXNA 2E2IB 1DJRD 2M00A 1B3AA 2EDGA 4XXEA 4DAVA 3D8GA 5I6WA 1VMCA 4A3JB 2NWGA 3NQTA 3S9WA 3L3OC 4YIJA 2QEJC 2R6GA 3QG1A 3AMUA 4C56C 2MPMA 5T1IA 1SYGA 1UNSA 2IL8A 4G7ZC 4DNRB 3BDLA 4KJNA 5KNDA 2EVBA 5M3MB 3SE0A 2WINB 3G7LA 1FNWA 4PMWA 4IURA 1NAPA 1D2BA 2IPKD 1TS4A 1TR5A 1KAAA 4UDUC 5G3LF 4P2CB 1DD2A 3K5LA 1Y1VB 1B2TA 2IX3A 3MEHA 1ESFA 2QDBA 1QB5D 2QKIC 2KHSA 4ZLTF 4DXFA 1KLUD 4TSSA 3I3CA 4X3TA 4KY5A 1Y8OB 2D9UA 1R9TB 4ZQ3A 2F0QA 1BDOA 3GTMB 2G9HD 4A3IB 4TQUS 1YNND 2ZXRA 4KI0A 1V1OA 3G6JB 1E2VA 1ESRA 5C4JB 4PV1C 3S17B 1G8ZD 5JJZA 1BCPB 2O5IC 1H9SA 2JP1A 3IKJA 4ILWA 5KEEA 1YNJD 3HZXA 1Q3LA 2CW0C 2R3ZA 1O80A 3P1HA 2TMPA 5M5XB 1EU4A 2N88A 3PO2B 2K28A 2D2CC 3PUYA 2NN6I 1GHJA 4KHZA 3BS1A 4I7ZC 4V0BA 5IGDA 2K6AA 2F0NA 2XVSA 1AZPA 1BF4A 1EWCA 2PZTA 1LTID 1OO9B 3R8BA 3MFYA 3C3LA 2KEEA 2RQXA 1F9RA 4FP5D 5C4XB 5IIFA 2F0MA 1D1KA 1CQFA 1NR4A 3KBXA 2QILA 1ML0D 4BS9A 1I4GA 4K5XA 5EBCA 3U9OA 1EWHA 2FINB 1PRTD 1B4OA 1HXYD 1TS3A 3KLSA 3GTQB 3OOCA 1I4RA 2EXZA 1PTOH 2CVRA 4FF1A 4HAEA 4FYDA 1F77A 2RDHA 1SMYD 4JK1C 4C1NK 2E2DC 3QWNA 4RGNA 5KGUA 4DN4M 1WD0A 2RVLA 5JEAJ 4G57A 5IGFA 3MVVA 4BBRB 3VYSA 3SXHA 4O1NA 4KD3A 5IGBA 2BCOA 2E2HB 3RZDB 2R93B 3H0GB 3U9SA 3BYYB 4C3IG 4GZYC 1KDBA 2C9OA 3VR2A 1STBA 1SE4A 5M9OA 3T51B 3GQBA 2FMCA 4RHRA 1U4LA 3RD4A 2MGSA 2O4XA 2F3VA 2E75C 1BOSA 2R92B 1EEID 1O78A 4IUTA 4DF7A 4EVOA 4F7XA 3BVMA 1STHA 1ENCA 4EGVA 2A6EC 1TT2A 1UUPA 1KDCA 2EPBA 5A2QE 4K6DA 3PMFA 3VR4A 4X3UA 1GUNA 5CGKA 3HG9A 3SDZA 2YYZA 5ELFA 1O7LA 3OHXC 1CI3M 2NVXB 3DWQA 3GV3A 3NUCA 4MIUA 5EKIA 3IAYA 4CJ0B 4EQNA 3H91A 2Q8IB 3OWEB 3HOVB 1H9MA 2AQ2B 5I9OA 4H0LC 1PXUA 3GD7A 1G2TA 1L0YB 4RGMA 1GUOA 3D31A 1E2ZA 3FVQA 4ZK9B 2Z4HA 2ZT9C 4WJWA 3NBHA 2XNAC 5DM63 5COYA 1SXTA 5E4WC 1ZEQX 1WVLA 1CHPD 2EY2A 5CBEE 4XQQA 4ODGA 3TSSA 4CKBA 2FFKB 4FO2A 1BUVT 1EY8A 1PFMA 1IL8A 2HQEA 4HEDA 5G3LD 4PMBA 1HA5A 3FRPB 2V4DA 1XTCD 5C0XH 5JPMC 4F88A 1SYDA 1EFID 4BWGB 2A68D 2XRSD 2IJ0A 2BA1A 4K8JA 4CJ2C 4IFDJ 1CZWA 3TP7A 1BBXC 4KN7C 1Q1EA 1QILA 4LMQD 1B44D 1HQMC 4IALA 1EY0A 1U9RA 2JEAI 4AYBB 1GJXA 1B53A 2B2YA 4RH6A 1SYBA 1KNAA 3CRKC 1YNNC 3VYRA 4ZUJA 1T5XD 2B2YC 2LY7A 3S2HB 5IGCA 1CT1D 4TRDA 4DAYA 4R9WA 3OW7A 1LV9A 3ONAB 4DA2A 1X3QA 2PW5A 3I4NB 5TSSA 5IGEA 4FNFA 2E76C 3EA6A 1IHZA 4KY7A 3OMGA 3P20A 3K5NA 2NVYB 1QG7A 3FMCA 1AEXA 3S1NB 4G7OC 2K32A 5D65A 3IFTA 1ENAA 4B9XA 4H7BA 2XWBB 2EY5A 3DXJC 2F1MA 2F0HA 3DMUA 1MSGA 3OMCA 2RBMA 5CORA 4XDXA 4ID6A 1IKMA 5CMDA 5T1GA 3CU7A 5EBDA 4KHVA 4IUPA 1PTOF 5BN5A 3I73A 3HP3A 2R61A 4IZ8A 2EJFC 1AZQA 2I46A 4QUCA 5BN4A 2BOSA 4LAAA 1PRTC 1LTAD 3DUZA 2SOBA 2L12A 3E0JA 1B50A 4DAPA 1SMYC 4U68A 3C46A 1EY5A 1E0BA 3CQZB 1LT5D 2J4XA 2TSSA 1STYA 3DWPA 4J1MA 1J8IA 1CZGA 3DEPA 2BDOA 5C3EB 2VXWA 2L55A 3P7JA 5HURA 3MAQA 5FO8B 5IT9L 3FKIB 4NKLA 3PUZA 2A74C 1MGSA 1C48A 4I65A 3L9AX 4HR7B 2NVTB 3EJIA 1Z6HA 1SNCA 5CV4A 4IUUA 2EZVA 1EU3A 1XXGA 5LHY1 1OXVA 5M5YB 2RSOA 1I50B 1LTTD 5FLXE 5C0XG 3NP8A 1HUMA 3H09A 3MZ5A 4BY7B 1V1PB 2EYHA 3M7GA 1Y8NB 1IYVA 5ISRA 1A3VA 3GP7A 5FKAC 1DOLA 3IL8A 3EFXD 4KK7A 2GA4B 3CHBD 1LT6D 5C5MA 4ABNA 2YU9B 4F8MA 1F2LA 4KN4C 4Q5VA 3QB3A 2R7ZB 3NTHA 4KD4A 1XWEA 1MI2A 1DONA 4BBSB 2JEBI 3J80E 4V190 2DY8A 3C1EA 1F9SA 3LWUA 1TWAB 1ENFA 1JWUD 1NR2A 1BCPF 1GXDC 4Q0FA 2D62A 2HDLA 1KLGD 2JA6B 4QCLA 1DOKA 1TWCB 2F0VA 4FF2A 1QWYA 4E6IA 4IFDH 3HGBA 1CFMA 4B08A 4XT3B 3T56B 5J22A 1CQVA 3SK4A 3NTKA 4Y7NB 1A6XA 3R2IA 1CA5A 3KF8A 4N9PA 2DNEA 4PQXA 2A6HD 4X3KA 2JE6I 1L0XB 1OXUA 2K33A 3S1MB 3PO3B 2F0OA 4MHEA 2F0PA 3GTLB 4DFAA 3W2DA 1ONLA 4JBWA 1Y8PB 3QOLA 2HUGA 2XIWA 1JB3A 1PMRA 1RCVD 1HA6A 2IX0A 1VDZA 2AQ1B 1IW7D 5D14A 3LWEA 3GTKB 4OL7A 1HCZA 4RKBA 2A68C 4RGTA 3WDNA 3NQIA 1D1IA 1B1ZA 3Q22A 2NVQB 4KKSA 4IUNA 5E4XA 1V43A 1UAPA 2PNRC 3F2UA 4ZYSA 1SYEA 3PUVA 2L9HA 1IKLA 5J39A 3JAML 1H9SB 3W3AA 1TY0A 2IWHA 3OIPA 3DHQA 1LTRD 1O7YA 4ZKCB 3OSOA 4A93B 4N9TA 3X3MA 4XYQA 4BA1I 2AWNA 4OO1G 1WTVA 4FF3A 4A3BB 4S3SA 5I4DA 1HHVA 1KABA 1CK1A 3VA5A 3QO2A 5KYIA 2NBFA 2SEBD 2ICEC 1PDQA 1V8QA 2F0WA 2RSNA 4XTCS 2M2LA 3KLRA 1M8AA 4L6TB 1FR3A 3QJYA 3SEBA 1JE4A 2KUMA 3K0YA 2BE5C 1LTBD 3NHHA 4L63B 3LNNA 4K6LA 4K8IA 1A15A 2WAQB 2X6LA 4QMGA 2B39A 2PO4A 2K7VA 3SK5A 1ZYRD 5J1ZA 1QCBD 3K59A 1DYQA 3L7ZC 1PTOD 5A35A 5DEHA 1W6JA 2F0SA 1TWHB 1W6KA 3Q6SA 3V2TA 3S1RB 3EROA 3HRZC 2RDGA 2X69A 3I91A 2NUCA 4WFN3 2H4OA 5KNBA 1SJHD 5DAUA 3T4AC 3S1QB 3S14B 4IFDG 3ITPA 4UAIA 3K5OA 4K14A 1S4ZA 2LKVA 2PZWA 5FOBB 4OHJA 2A69D 5FK9C 1EY7A 1PZID 3PV0A 1X3PA 2F0DA 2L5TA 4IN3A 5I2YA 1Q1BA 4A3MB 1GHKA 2RKSA 4HMJA 1FNVA 3BYTB 1EZ6A 3MXUA 2D5DA 1R4QB 1GUTA 1UEAB 2Q8TA 1Y69U 1SNMA 3HOUB 2F4IA 3TP8A 1BR9A 3Q23A 3J81L 1ET6A 4HMIA 3VYUA 1A3TA 2SNSA 2LMCB 3S15B 3D6WA 3A54A 2KOLA 2B2TA 3K6OA 1S5CD 2VB2X 1EEFD 2B2TC 3A8IE 1HUNA 1O7ZA 4FF4A 2JSOA 4DU9A 4FXDA 5DM73 1SNOA 5CV5A 5CR3A 1D6EC 4ULLA 1EL0A 1PLFA 1TQOA 1F2ZA 4NDXA 1BCPD 3ERQA 1SSOA 3Q0AA 1JOQA 5FO7B 5M3FB 3ZYYX 2XN9C 3IFDA 3V96A 3C2PA 2XSCA 4NMZA 2PCFB 3D4WA 3D4RA 2EYLA 3QOJA 1GOZA 2CW0D 1CA6A 2F0UA 1TWFB 1SNDA 4XQJA 1B9MA 2A6HC 3TP6A 3K58A 2EYMA 2B63B 3A56A 2EYFA 3BVZA 4IQZA 3BDOA 3TZDA 2B8FA 1NCVA 5I6YA 1HQRD 5CV8A 4ZUIA 3PUXA 2WV6D 3NPPA 4LK1C 1YNJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK5 A;  3MZ5 A;  3EVQ A;  5J1Z A;  1STA A;  3LX0 A;  5M9O A;  4ODG A;  3QOL A;  1ENA A;  5IGD A;  1STN A;  5EKL A;  3NK9 A;  4HMI A;  4B9X A;  2EYH A;  1SYG A;  1A3U A;  1EQV A;  3R3O A;  1F2Y A;  1A3T A;  2SNS A;  4H7B A;  5CV7 A;  2F0N A;  5EGT A;  5ISR A;  1EY8 A;  2HQE A;  3BDL A;  1A3V A;  3D6C A;  2O4X A;  4KJN A;  4DGZ A;  5C3W A;  5KYL A;  2EY5 A;  1EYC A;  2PZT A;  4PMB A;  2F3V A;  2F0G A;  4OL7 A;  3D4D A;  1JOK A;  2EYJ A;  2F0H A;  5DEH A;  2RDF A;  3DMU A;  3C1F A;  3T16 A;  3MHB A;  4RKB A;  5JAV A;  3OMC A;  2F0S A;  3MXP A;  1SNQ A;  2RBM A;  2PW7 A;  3T13 A;  4HTH A;  4K5V A;  4DF7 A;  4EVO A;  1SYF A;  4ID6 A;  2OXP A;  5HGT A;  1F2M A;  4DU9 A;  4F7X A;  5C5M A;  2EYP A;  3V2T A;  5C4Z A;  4KHV A;  3SHL A;  1SYD A;  4F8M A;  1STH A;  1EY9 A;  1TR5 A;  1ENC A;  1NUC A;  1EY4 A;  3ERO A;  3TME A;  4EQP A;  1SNO A;  1SNP A;  1KAA A;  1TT2 A;  1KDC A;  4J6H A;  5CV5 A;  5C6A A;  3SR1 A;  2F0E A;  5CR3 A;  5IIF A;  3QB3 A;  2F0M A;  3HEJ A;  4IUN A;  5CV9 A;  4IZ8 A;  4QB4 A;  4K6D A;  2NUC A;  4KD4 A;  1TQO A;  2OEO A;  1JOR A;  4DFA A;  1F2Z A;  2PQE A;  3PMF A;  1STG A;  3ERQ A;  4NDX A;  1SYE A;  4LAA A;  4K8J A;  3MEH A;  1EZ8 A;  5DAU A;  3RUZ A;  2QDB A;  2ENB A;  5J39 A;  2F3W A;  3TP7 A;  4B9W A;  2KHS A;  3ITP A;  4WRD A;  5CV6 A;  2SOB A;  3C1E A;  1JOQ A;  3DHQ A;  1A2T A;  2F0L A;  5CC4 A;  5KIX A;  4KTA A;  4K14 A;  2EY6 A;  4IAL A;  5CGK A;  4K5X A;  1EY0 A;  1U9R A;  2PYK A;  5E1F A;  2F0F A;  3U9O A;  1II3 A;  2LKV A;  3OSO A;  4K2L A;  3NXW A;  2KQ3 A;  4N9T A;  2PZW A;  4KY5 A;  4QF4 A;  2SNM A;  4PNY A;  3NUC A;  5C4H A;  4K5W A;  4ZQ3 A;  1SYB A;  4R8N A;  2F0Q A;  4MIU A;  1EY5 A;  3E5S A;  5NUC A;  2EXZ A;  4NMZ A;  4ZUJ A;  1EY7 A;  5IGG A;  1STY A;  3D4W A;  5EKK A;  4S3S A;  5K5P A;  2F0J A;  1SYC A;  5IGC A;  3BDC A;  4J1M A;  4TRD A;  3SK8 A;  1KAB A;  2F0V A;  4EQN A;  3VA5 A;  2F0D A;  2EYL A;  3H6M A;  4E6I A;  1JOO A;  1RKN A;  4KV6 A;  5E3F A;  3QOJ A;  4K2K A;  2F0I A;  5KYI A;  4PMC A;  1KDA A;  5F2D A;  2PW5 A;  5I9O A;  2F0U A;  5J22 A;  4EQO A;  5KGU A;  2EYO A;  3SK4 A;  5C3X A;  2F0W A;  2RKS A;  5HUR A;  4HMJ A;  2OF1 A;  1SND A;  5IOC A;  5JOB A;  4NKL A;  3TP6 A;  2F0T A;  3OWF A;  2F0K A;  2EYM A;  5IGE A;  1EZ6 A;  4G57 A;  5IGF A;  2EYF A;  5KRU A;  4N9P A;  3MVV A;  5IOD A;  2PZU A;  4WOR A;  5KEE A;  4I65 A;  1NSN S;  3HZX A;  3P75 A;  4KJO A;  3SXH A;  2M00 A;  2WAC A;  3EJI A;  4KD3 A;  3P1H A;  4NP5 A;  3TP5 A;  5C5L A;  1SNC A;  5IGB A;  5CV4 A;  1A2U A;  1EYA A;  1IHZ A;  3D8G A;  4KY7 A;  3OMG A;  5I9P A;  3NHH A;  4ME5 A;  2F0O A;  5I6Y A;  1EY6 A;  5I6W A;  1EYD A;  1SNM A;  5CV8 A;  4K8I A;  4ZUI A;  2F0P A;  4QMG A;  2EY1 A;  3NQT A;  4RKL A;  1AEX A;  4KY6 A;  3NP8 A;  3S9W A;  1KDB A;  3SK6 A;  1STB A;  3TP8 A;  2EY2 A;  4YIJ A; 
#chains in the Genus database with same CATH topology
 4JPB W;  3BZK A;  4LUO A;  3LX0 A;  3ND9 A;  1Q8K A;  1BO0 A;  2NZO A;  1STN A;  1D5X C;  1TS2 A;  1AP0 A;  2MJ8 A;  3AU7 A;  4OWT B;  3PGZ A;  1M4V A;  4UP7 A;  3D6C A;  1N32 L;  3J7A 5;  4JI2 L;  2JA5 B;  1PHJ A;  2RDF A;  4BY1 B;  2MHV A;  3I4L A;  4JBJ A;  2KBN A;  3D0F A;  3RZO B;  1YZ6 A;  2K5Q A;  4HTH A;  4K5V A;  3TS0 A;  3UI2 A;  4OIJ A;  5JVG 3;  2OXP A;  4DAY B;  4HN7 A;  1TWH H;  2EYP A;  4XYO A;  5JEA H;  3MWY W;  4IUV A;  3TME A;  2KCN A;  1X55 A;  3S1R H;  2KA7 A;  1HFN A;  2WKD A;  1SE3 A;  5GAH C;  3HOZ B;  1X9N A;  3QIA A;  4HIO A;  1PYB A;  2J0T D;  2K05 A;  4MZ9 A;  3RMH A;  4ZAI A;  1VQM A;  1J5E Q;  1O7I A;  1QJO A;  1KTK A;  1EOT A;  3J7A F;  1XNR Q;  3JAM i;  1TII D;  5ELE A;  2K04 A;  2DJF C;  1K8M A;  3SVM A;  2F3W A;  1WTQ A;  4R4C A;  3S1Q H;  4M1U B;  3S14 H;  5DNF A;  1ICF B;  4JI8 Q;  4C3H G;  5EPL A;  3JAM c;  4CDC C;  1N34 Q;  3CD6 A;  4DR6 L;  4H13 C;  3WWV A;  5AJ3 L;  2KCC A;  3CCE A;  4K5W A;  1VQI A;  1SE8 A;  1WCM H;  2K03 A;  1S5D D;  5ELD A;  1DM0 B;  4HIM A;  3I4M G;  1L1O C;  2F3I A;  1EIH A;  3AB9 A;  5IP7 G;  2CHB D;  1JQY D;  4C3J B;  1KDA A;  1FD7 D;  4FVM A;  3AFP A;  3TZU A;  3PO3 G;  3H3V C;  5C3X A;  4A3F G;  4R4O A;  4A3E B;  5IOC A;  1SFO B;  4A3M H;  3CRL C;  3A7L A;  3RR5 A;  2ICI A;  3R93 A;  4Y52 H;  1C0A A;  1S5F D;  4B3S L;  3TRZ A;  4WOR A;  2BA0 A;  1CHQ D;  1KNE A;  3EQL C;  1K8O A;  1HNZ Q;  2L15 A;  1A2U A;  1TS5 A;  2QA4 A;  3URY A;  1NJI C;  1EY6 A;  1SEB D;  1PRT B;  1PZK D;  1KL9 A;  1ZYR C;  1T5E A;  4KY6 A;  4R8I A;  3HOU H;  5LL6 S;  4JG2 A;  1PH1 A;  1ET9 A;  1PTO C;  2H1E A;  2Z4I A;  3DM1 A;  5IP9 H;  1VQP A;  4CKC A;  4OO1 H;  3GO5 A;  4R1J A;  3ULL A;  1EQV A;  2E8G A;  1KXL A;  2A6E D;  2RHS B;  5EGT A;  4JI4 Q;  2LFN A;  5C3W A;  4DUZ L;  3E9I A;  5I2X A;  1NMF A;  4KLK A;  1XPO A;  1VQD A;  3NBI A;  3S15 H;  4UP9 A;  3MXP A;  4OWW B;  4KKT A;  4DAM A;  1YNX A;  2YTV A;  4DUY Q;  1QE6 A;  4G4K A;  1TY2 A;  3R2T A;  3U4Z A;  3NSW A;  2WII B;  1EY4 A;  2Y0S B;  1J9O A;  4J6H A;  1H9J A;  4LF7 Q;  4KMU C;  4A93 G;  5ELB A;  3ERS X;  3SR1 A;  4LF6 Q;  1I6V C;  3HEJ A;  2O5J C;  1ILQ A;  4XQN A;  2E2J B;  1D5Z C;  3RLN A;  4C1N I;  3I4O A;  5LL6 X;  4A3B G;  1WD1 A;  3CCQ A;  1EZ8 A;  5CBA E;  2ENB A;  4DXG A;  1CKO A;  1ICW A;  4B9W A;  5CV6 A;  1MBY A;  4DR7 Q;  2ID0 A;  2A69 C;  5M3F H;  5HY6 A;  2FJ2 A;  2J7Z A;  2NTT A;  2I07 B;  1I4H A;  1LTS D;  1PFN A;  1HTL D;  2YV5 A;  3FEW X;  5EKK A;  4ZKB B;  2MFI A;  2NN6 G;  4U67 3;  3FDT A;  2AUJ D;  4QIW E;  4J8Q A;  2XWJ B;  4K2K A;  1NE3 A;  2WP8 J;  1XYI A;  2AKW B;  4L5S A;  2L11 A;  1GUW A;  2WB1 G;  3CKI B;  1TWF H;  1MD2 D;  2Z9H A;  4TKO B;  1SE2 A;  4DV5 Q;  1VCI A;  3H94 A;  2E5L Q;  4A3G G;  2K01 A;  1NNX A;  4GOP B;  3NWT A;  2B63 H;  1NSN S;  3MXG A;  3P75 A;  4H44 C;  2VQE Q;  5C5L A;  1RHP A;  1G29 1;  5ELC A;  1H95 A;  2C35 B;  4C3H B;  4A3L H;  1DCZ A;  1M1K C;  4RHS A;  4CJ1 B;  2B2V A;  1E1O A;  3SK6 A;  1RDP D;  1CTM A;  3J81 i;  4ZRZ A;  1EQT A;  1BXT A;  2B2V C;  5JEA G;  4HSP A;  5IT9 E;  3K57 A;  1IL2 A;  2JYO A;  4JV5 Q;  1RTO A;  4DV4 L;  4OIK A;  3R3O A;  3I4M B;  4XT1 B;  1TKW B;  3J81 c;  1TVX A;  4M8A A;  4DPG A;  3EN2 A;  5GRO A;  2RCF A;  4F87 A;  1WOC A;  2VB3 X;  1VQA A;  2I5H A;  5JAV A;  2JA5 H;  4A3F B;  1XNQ L;  2CQO A;  1PZJ D;  2JA8 B;  3A55 A;  3DWA A;  4BY1 H;  1L2F A;  4HCS A;  1FNU A;  3RZO H;  5J3B A;  5C4Z A;  4DV2 L;  4HCE A;  2PMZ E;  1NUC A;  1BCP C;  1SNP A;  5C0X I;  4DK1 A;  2EOT A;  1H9R A;  2ZXP A;  2L1B A;  5CV9 A;  1G91 A;  2K5W A;  1WCM G;  4QB4 A;  3HOZ H;  2EQS A;  2M9V A;  4YY3 L;  3KF8 B;  2N49 A;  1CM9 A;  3PUW A;  3UE1 A;  1K3B C;  4A3D B;  1OXT A;  2AWO A;  1I3Q B;  1IBK L;  3UDF A;  5CYU A;  4WRD A;  1A2T A;  2F0L A;  4KTA A;  1X6O A;  2F52 A;  1PYS B;  3S16 B;  1FYC A;  5ELN A;  3NXW A;  2KQ3 A;  2EJM A;  1HNW L;  1RJT A;  3Q8D A;  4DV3 Q;  3J7A V;  2CH4 A;  1SN8 A;  1TWG B;  4LF8 Q;  3KDF B;  1R4P B;  1EIY B;  3VYT A;  2QCP X;  4XIG S;  4LF4 Q;  3L2P A;  1QOH A;  1VQ6 A;  2RHQ B;  1JOO A;  5K36 H;  5E3F A;  1SJE D;  2LXJ A;  2NB0 A;  2PQA A;  2Z1C A;  4PMC A;  5C0X J;  4DNI A;  2D0O A;  1F9Q A;  4KHP L;  4C3J H;  1JR0 D;  2OF1 A;  2DN8 A;  2G9D A;  1CSP A;  5JOB A;  3HOU G;  1VQ9 A;  1BQQ T;  1EIG A;  2F0T A;  2QF7 A;  4A3E H;  1SFO H;  5M5W B;  2HHH L;  1JWS D;  1ZXT A;  1XMO Q;  2D0P A;  1DXM A;  4L5Q A;  3NEM A;  5IOD A;  1HPC A;  1HZC A;  3E6Z X;  2OQ0 A;  4FXG C;  3M4Y A;  2MNA A;  3F1Z A;  3TP5 A;  2F4V L;  4AH6 A;  4AIM A;  1U4P A;  2HT1 A;  1H9K A;  1Q12 A;  4Z9C B;  4EQ5 A;  1YJN A;  5IY0 A;  1MSH A;  3K5M A;  3G4S A;  1STA A;  2IHE A;  3DLL A;  1AFP A;  3KBG A;  1SAP A;  4JI0 L;  3EVQ A;  2IW3 A;  4HJ5 A;  5A2Q L;  1OXX K;  3NK9 A;  1LT3 D;  4QIW B;  1QUQ B;  4BA2 I;  3N52 A;  1F2Y A;  1STE A;  3OIQ A;  2LSS A;  5CV7 A;  3HOY G;  4LFC Q;  4QQB X;  2JXM B;  1J5E L;  5C44 B;  3LGJ A;  2B2U A;  4I7A A;  1X3G A;  1N36 Q;  1SNQ A;  1LT4 D;  2WB1 B;  3S2D B;  4RGO S;  3CCM A;  1YHQ A;  2B2U C;  1IXR A;  1Q90 A;  3VDY A;  1IYU A;  4A3G B;  4UPA A;  3TDQ A;  1N33 L;  4JI8 L;  1EY9 A;  4JOI A;  3T1Y Q;  1S5B D;  3IRB A;  2F0E A;  3M3Y B;  2CKZ B;  3K0X A;  1JIC A;  1LTL A;  2Q8R E;  3GV6 A;  2NYZ D;  4JOI C;  3CCU A;  1EWI A;  2OEO A;  1Q8I A;  1C4Q A;  4B3R Q;  3M85 A;  2E2J H;  4IO9 A;  3M7N A;  2L4N A;  1QVG A;  4C2M B;  2YTY A;  2GVB A;  5CC4 A;  4GNX B;  3E3X A;  3W1G A;  4RAU C;  2PYK A;  2JN4 A;  4JI3 L;  2N3S A;  5FO9 B;  2KJX A;  5D3I B;  2HDM A;  2B8G A;  4LW1 A;  4PNY A;  3KK7 A;  3HOX G;  1JC7 A;  2XRQ D;  1WTW A;  3E5S A;  2OTJ A;  3N6R A;  1CKN A;  1ASZ A;  4HJ8 A;  3K7A B;  1V1Q A;  1F9P A;  1X54 A;  3BDC A;  3STB D;  1D7Q A;  4ALP A;  1LAC A;  2KED A;  1ROD A;  2Z8L A;  2PMZ B;  3JAM E;  2JA7 B;  1KQS A;  4DNT B;  1JWM D;  2EYO A;  1EUJ A;  5EPK A;  2HCC A;  2IX1 A;  3U4V A;  2SDF A;  3Q24 A;  3WOE A;  3PSI A;  3PIO A;  1GUS A;  2NZ1 D;  4A3C G;  1WCM B;  1NY4 A;  5LMU L;  1VF5 C;  1WTO A;  1XTD A;  4NXM L;  1ZKO A;  1K28 A;  2K14 A;  2KVM A;  4NP5 A;  4OO1 I;  4CKE A;  2IT1 A;  2NTS A;  4CBV A;  1EYA A;  4IPG A;  3VR3 A;  4JI4 L;  5I9P A;  3MC0 B;  4OGQ C;  4CDF C;  1Z7T A;  3V05 A;  3J80 c;  2JA5 G;  2EY1 A;  1OXS C;  4C3H H;  1EFW A;  1JJ2 A;  2N55 A;  4JI7 L;  1B9N A;  3PQI A;  2C5C A;  4YWL A;  5NUC A;  4DUY L;  4CGY B;  1ILP A;  5L37 A;  4RMF A;  4GLA C;  2WKC A;  5EKL A;  1Z47 A;  2MUY A;  2FMM A;  1I6H B;  2MP1 A;  2RCN A;  4IPH A;  1VQB A;  3HOZ G;  3I4M H;  2YTX A;  3A8K E;  3WOF A;  1PFB A;  5H1S E;  3E0E A;  2AUK A;  1SMX A;  3FPU B;  3T13 A;  3M9B A;  2PW7 A;  1QZH A;  1BNZ A;  4A3F H;  5HGT A;  2JA8 H;  3BU2 A;  4EQP A;  2UXC Q;  2ZTC A;  3J7Y W;  2BDN A;  4LF9 Q;  2K1B A;  3DEO A;  1WI5 A;  4RWS C;  2ZJQ A;  4KKU A;  5JVH 3;  3I70 A;  3VR5 A;  1FVI A;  1SDF A;  3RUZ A;  3HKZ E;  4A3D H;  5K36 G;  1I3Q H;  4DV0 L;  2KCM A;  1LO5 D;  1WTR A;  4DR5 Q;  4C3J G;  2QEX A;  3NE5 B;  4QF4 A;  3O13 A;  3S16 H;  1S5E D;  3G71 A;  4A3E G;  2ASB A;  1VMP A;  3A7A B;  4R8N A;  3NTI A;  4OX9 Q;  4DV5 L;  2K75 A;  3HOY B;  3I8Z A;  5IGG A;  1DGS A;  1TWG H;  5K5P A;  2EE1 A;  1SYC A;  1JCK B;  4L8J A;  3SK8 A;  4YCU A;  2OT2 A;  2VQE L;  3KLS X;  4LJZ C;  4A3K B;  1WTX A;  4IFD I;  1PYW D;  2KEC A;  3OWF A;  1RTN A;  3MTS A;  2DNC A;  2PZU A;  5M5W H;  3HS0 C;  4JV5 L;  2WAC A;  4K0K L;  1Y1W G;  1K0S A;  5IWA Q;  1SRU A;  1LM0 A;  3FPP A;  4ME5 A;  4X3S A;  3MFG A;  1HTP A;  1YBY A;  4QL5 A;  5EJW A;  1X32 A;  3TBI B;  1DZ1 A;  1X3E A;  4FXK C;  4IUQ A;  3HOX B;  4FDB A;  3HOW B;  1IBM Q;  2CFM A;  2H5X A;  2Y0S G;  4JI1 Q;  4QUF A;  1B70 B;  2NN6 H;  1CKM A;  1VQC A;  3I7F A;  1EYC A;  2F0G A;  1JOK A;  2EYJ A;  4O42 A;  4DR4 Q;  2ZXO A;  3BJU A;  3C1F A;  3MA2 B;  4C3I B;  4DR3 Q;  5C44 H;  3TN2 A;  3KUP A;  1AN8 A;  2E74 C;  1TU2 B;  3VA7 A;  5JPN C;  1F2M A;  5BN3 A;  2CQA A;  3S2D H;  1I4X A;  2L0C A;  1DOM A;  4HSV A;  3ND8 A;  3PIO 3;  5KIX A;  2LS0 1;  1LAB A;  1D5M C;  3OPO A;  4A3G H;  5C6A A;  1HFG A;  3RLF A;  3J81 E;  2GN5 A;  1IW7 C;  1W2B A;  4RCO A;  3GTP B;  1QNU A;  1XX8 A;  3M3Y H;  4NB3 A;  4LUV A;  4DR1 Q;  2PQE A;  1JOR A;  3A0J A;  4LF8 L;  3OTO Q;  2UUA Q;  3EBE A;  5D3D A;  1QNK A;  4LF4 L;  4G7H C;  5AFW A;  3BG3 A;  5E1F A;  2F0F A;  4RA8 A;  2O2L D;  4C2M H;  4A3J G;  2RA4 A;  4NW2 A;  4K2L A;  2BH8 A;  4J15 A;  2KHJ A;  3KF6 B;  5C4H A;  1XMQ Q;  1CSQ A;  1RD9 D;  3KFU A;  1GD7 A;  2QGQ A;  2UXD Q;  2VW9 A;  3VR6 A;  3K7A H;  3I90 A;  1PRT F;  1RKN A;  4KV6 A;  2UU9 L;  1FGB D;  2ALY B;  5FLX L;  3GTG B;  5M3M G;  1AW7 A;  2BE5 D;  5EQ0 A;  4YHH L;  3M4O B;  4EQO A;  1I4Q A;  2K5D A;  2JA7 H;  2R93 H;  2DY7 A;  2PI2 E;  2FHT A;  3T53 B;  4GKJ Q;  5KRU A;  1SBB B;  3HKZ B;  1K83 B;  3I72 A;  4N8X 1;  4KJO A;  1L1O A;  2AQ3 B;  1E2W A;  1M90 C;  1LUZ A;  1U4R A;  4LFC L;  3ICE A;  1EYD A;  1B8A A;  2PPB C;  3J81 j;  4LFB Q;  4RKL A;  4DV6 Q;  1C8C A;  2ATW A;  3A8J E;  2JA8 G;  4DGZ A;  3CCL A;  1Z9F A;  1LTG D;  1FJG Q;  1A63 A;  2X6G A;  4N8F A;  4RFB A;  1SR3 A;  2K4K A;  2ZM6 L;  3T1Y L;  2ZTD A;  4YCV A;  1A3U A;  3BVG A;  1I6H H;  5KYL A;  2UUB Q;  3J80 L;  3D4D A;  4JI6 Q;  4A3D G;  4LFA Q;  3T16 A;  3MHB A;  1VQF A;  4QJF A;  1PH2 A;  1SYF A;  3NWS A;  3SHL A;  2ZTE A;  1GUG A;  4RCN A;  3GTJ B;  5KNC A;  3GTO B;  2Q2U A;  4OXP A;  1Y1W B;  2VUM B;  5EPJ A;  1STG A;  2ES2 A;  4LWC A;  1WTP A;  4R4Q A;  2EJG C;  5ELO A;  5FJ8 G;  1VF7 A;  2A73 B;  2RF4 A;  3HOV H;  1PH8 A;  1QZG A;  2EY6 A;  1K3R A;  3D3R A;  4DR2 L;  1HRJ A;  1J6Q A;  1V1P A;  1II3 A;  2N8N A;  3BZD B;  2HIV A;  1P16 A;  2SNM A;  3CPF A;  1LLR D;  4JVZ A;  1PTO B;  4P73 A;  1RF2 D;  3FHW A;  4DKA C;  1G2S A;  2B2W A;  3PIP 3;  4CHT B;  1G6Z A;  3HOY H;  2F0J A;  4IOC A;  2B2W C;  3A74 A;  2Z6K C;  1U4M A;  3H6M A;  3CCS A;  3X3N A;  2F0I A;  2HCI A;  2JJQ A;  5F2D A;  4B3T L;  4DK0 A;  2F03 A;  4IPC A;  4A3K H;  2UXB Q;  2A5H A;  1I4P A;  2F0K A;  1VQ5 A;  2WFW A;  4MN3 A;  2VNU D;  3L0O A;  2PNH A;  3MXN A;  4IOA A;  2PI2 A;  5IYD H;  2E2I B;  4QY7 A;  3AQQ A;  1DJR D;  2M00 A;  1B3A A;  2EDG A;  4DK3 C;  4XXE A;  4DAV A;  3D8G A;  1VQ4 A;  5I6W A;  2K5N A;  3CCV A;  1VMC A;  4A3J B;  2NWG A;  5C44 G;  3NQT A;  3CPW A;  3S9W A;  3L3O C;  4LNQ A;  4YIJ A;  2QEJ C;  2R6G A;  3HOX H;  3QG1 A;  3AMU A;  4C56 C;  2MPM A;  4CDD C;  5T1I A;  1SYG A;  2QDL A;  1UNS A;  2IHF A;  2IL8 A;  3ULJ A;  2Q2T A;  4LF9 L;  3HOW H;  1LYL A;  4G7Z C;  4DNR B;  3BDL A;  1XPU A;  3KOJ A;  4KJN A;  5KND A;  2EVB A;  4GS3 A;  5M3M B;  3SE0 A;  3JC6 6;  2WIN B;  3G7L A;  1FNW A;  4PMW A;  4IUR A;  1NAP A;  4C3I H;  1S72 A;  1D2B A;  2IPK D;  4DR5 L;  1TS4 A;  1TR5 A;  2WAQ E;  2HQL A;  5LMN Q;  1KAA A;  4UDU C;  4A3C H;  5G3L F;  2CCZ A;  4P2C B;  1DD2 A;  3K5L A;  2DGY A;  1Y1V B;  5GAG C;  1VQE A;  4BBR G;  3GTP H;  1B2T A;  3CAM A;  1C9O A;  2IX3 A;  3MEH A;  1ESF A;  2QDB A;  2IY5 B;  1E3P A;  1QB5 D;  2QKI C;  2KHS A;  1IZ6 A;  1YJ9 A;  4ZLT F;  2HD3 A;  3T1H L;  4DXF A;  1KLU D;  2JA7 G;  2R93 G;  4TSS A;  3I3C A;  4X3T A;  4A75 A;  4KY5 A;  1Y8O B;  2D9U A;  3OYY A;  1R9T B;  3K7U C;  4ZQ3 A;  2F0Q A;  1BDO A;  4LUZ A;  1WFQ A;  1KRT A;  1S3O A;  3GTM B;  2G9H D;  1HZB A;  4A3I B;  1YIJ A;  4B3M Q;  3AYH B;  4TQU S;  1KHI A;  1I94 Q;  2FXQ A;  1YNN D;  2ZXR A;  4KI0 A;  4X62 L;  5IWA L;  1YHB A;  3GTG H;  1V1O A;  2K5H A;  2OWO A;  3G6J B;  1E2V A;  1ESR A;  5C4J B;  3M4O H;  4PV1 C;  3S17 B;  1G8Z D;  5JJZ A;  1AH9 A;  3RN2 A;  1BCP B;  1HNX L;  2O5I C;  1PVO A;  1H9S A;  2JP1 A;  3IKJ A;  4ILW A;  5KEE A;  1YNJ D;  3HZX A;  4O0A A;  1Q3L A;  2CW0 C;  1K83 H;  2R3Z A;  1YI2 A;  1O80 A;  3P1H A;  2TMP A;  5M5X B;  1IBL Q;  1EU4 A;  2N88 A;  4JI1 L;  3PO2 B;  2K28 A;  2D2C C;  3PUY A;  2NN6 I;  3GDE A;  4DR4 L;  1PFS A;  1GHJ A;  4KHZ A;  3BS1 A;  4I7Z C;  4V0B A;  4AQY L;  3KYH C;  4JYA L;  5IGD A;  2Z6B A;  3ER0 A;  2K6A A;  1Q81 C;  2F0N A;  2UUC Q;  2XVS A;  4R4I A;  1AZP A;  1BF4 A;  1EWC A;  2PZT A;  1LTI D;  4DR1 L;  5E7N A;  1OO9 B;  3R8B A;  2UUA L;  3MFY A;  3C3L A;  4DK6 C;  3HOV G;  2KEE A;  1PH6 A;  2RQX A;  2PQA B;  4EX5 A;  5LMN W;  4IJH A;  3H3V H;  3TS2 A;  1F9R A;  4FP5 D;  5C4X B;  5IIF A;  1HR0 Q;  2F0M A;  3GTJ H;  3GTO H;  5JJK A;  1D1K A;  1Y1W H;  2VUM H;  1CQF A;  1B3Q A;  3H15 A;  1NR4 A;  4JW0 A;  2UXD L;  3KBX A;  2QIL A;  1ML0 D;  4BS9 A;  1I4G A;  1XNR L;  5BR8 Q;  1K9M C;  4K5X A;  5EBC A;  3U9O A;  1EWH A;  2FIN B;  1PRT D;  4A3K G;  1B4O A;  1HXY D;  1TS3 A;  3KLS A;  3GTQ B;  3OOC A;  1I4R A;  2EXZ A;  1N34 L;  1PTO H;  2CVR A;  5IYD G;  4FF1 A;  4HAE A;  4FYD A;  1F77 A;  2RDH A;  1SMY D;  4JK1 C;  3W5O A;  4C1N K;  2E2D C;  1UE1 A;  1X56 A;  3E9H A;  3QWN A;  4RGN A;  5KGU A;  4DN4 M;  1WD0 A;  2RVL A;  4LFB L;  5FLX c;  5JEA J;  1XJV A;  3PF5 A;  1YIT A;  4G57 A;  5IGF A;  3MVV A;  4BBR B;  1FJG L;  3VYS A;  3HOW G;  3SXH A;  4O1N A;  3SGI A;  4KD3 A;  2E2I H;  5IGB A;  2BCO A;  3B6Y A;  2DUD A;  2E2H B;  3RZD B;  1HNZ L;  1JJC B;  4GLX A;  2R93 B;  2MQH A;  3H0G B;  4JI6 L;  3U9S A;  4LFA L;  3BYY B;  4ME3 A;  4C3I G;  1KDB A;  4A3J H;  4GZY C;  2C9O A;  3VR2 A;  1STB A;  1HJP A;  1SE4 A;  5M9O A;  3T51 B;  3GQB A;  2FMC A;  4POF A;  4RHR A;  4DUZ Q;  1U4L A;  4AYB E;  1G6P A;  3RD4 A;  2MGS A;  3J80 i;  2O4X A;  2F3V A;  2E75 C;  1BOS A;  1CKN B;  2R92 B;  1EEI D;  3TQY A;  1K73 C;  5M3M H;  1O78 A;  3CP0 A;  1SRO A;  4IUT A;  4DF7 A;  4EVO A;  4NPS A;  1E22 A;  4F7X A;  1HZA A;  3BVM A;  3I4N G;  1STH A;  1ENC A;  4EGV A;  2A6E C;  1TT2 A;  1UUP A;  4R4T A;  1KDC A;  2N78 A;  1HR0 W;  2EPB A;  1N9W A;  4GN4 B;  5A2Q E;  4K6D A;  1PH5 A;  2VS1 A;  4LF7 L;  3PMF A;  4LF6 L;  1Y1V H;  1A8V A;  1T9H A;  3AEV A;  1JMC A;  3VR4 A;  3PF4 A;  3F2C A;  4X3U A;  3K81 C;  1GUN A;  5CGK A;  3HG9 A;  3M4P A;  3SDZ A;  2YYZ A;  2JK8 A;  5ELF A;  1O7L A;  3OHX C;  1CI3 M;  2NVX B;  1X3F A;  3DWQ A;  3GV3 A;  4DR7 L;  3NUC A;  4MIU A;  5EKI A;  1R9T H;  1PH9 A;  4HJ7 A;  3IAY A;  4CJ0 B;  5HGQ A;  1SLJ A;  3GTM H;  3HKZ G;  4EQN A;  2K52 A;  3H91 A;  1BKB A;  2QW7 A;  4A3I H;  2Q8I B;  3OWE B;  1XPR A;  3HOV B;  1ASY A;  1H9M A;  2AQ2 B;  1NTG A;  4H0L C;  5I9O A;  1PXU A;  3GD7 A;  1G2T A;  1E1T A;  1L0Y B;  4RGM A;  1GUO A;  3D31 A;  5C4J H;  3S17 H;  1E2Z A;  3FVQ A;  2E5L L;  3MEF A;  4ZK9 B;  1KAW A;  4OON A;  2Z4H A;  2ZT9 C;  4WJW A;  3NBH A;  2XNA C;  5M5X H;  4UY8 C;  5DM6 3;  5COY A;  5FJ8 H;  1SXT A;  5E4W C;  3PO2 H;  1ZEQ X;  3HKS A;  1JT8 A;  1WVL A;  4IPD A;  1CHP D;  4X66 Q;  2OQK A;  2EY2 A;  5CBE E;  4XQQ A;  4OEM B;  1UWV A;  4ODG A;  3TSS A;  4CKB A;  2FFK B;  4PZ7 A;  2Z0S A;  4FO2 A;  1BUV T;  1EY8 A;  1PFM A;  1IL8 A;  2HQE A;  4HED A;  1XNQ Q;  5G3L D;  2VUM G;  1YEZ A;  4PMB A;  2KEN A;  1HA5 A;  3FRP B;  2V4D A;  1XTC D;  5C0X H;  1RIP A;  5JPM C;  1MJE A;  4F88 A;  1SYD A;  1EFI D;  4BWG B;  3FKI G;  2A68 D;  2XRS D;  2IJ0 A;  3KLW A;  3UDX A;  3OW2 A;  5C4X H;  2BA1 A;  2VL6 A;  1IBK Q;  5GAE C;  4K8J A;  3S24 A;  4CJ2 C;  3K8A A;  4IFD J;  1CZW A;  3TP7 A;  3RN5 A;  1BBX C;  4KN7 C;  1Q1E A;  1NBW A;  1QIL A;  4LMQ D;  1HNW Q;  1B44 D;  1GVP A;  1HQM C;  4IAL A;  1EY0 A;  1U9R A;  4JBK A;  1VQH A;  2JEA I;  4AYB B;  1VQL A;  1GJX A;  1B53 A;  5DLQ E;  2B2Y A;  4RH6 A;  5JJI A;  1SYB A;  1KNA A;  4BY7 G;  3CRK C;  1YNN C;  3VYR A;  4ZUJ A;  1T5X D;  3GTQ H;  2B2Y C;  4DV3 L;  1MJC A;  2LY7 A;  3S2H B;  5IGC A;  1CT1 D;  4TRD A;  5GAD C;  4DAY A;  1KC8 C;  4R9W A;  3OW7 A;  1LV9 A;  1IBL L;  3ONA B;  4DA2 A;  1WTH A;  1X3Q A;  2PW5 A;  2KHI A;  2LXK A;  2CWA A;  3I4N B;  5TSS A;  2HHH Q;  1UE5 A;  1YVC A;  2B3G A;  2OTL A;  5IGE A;  4FNF A;  2F4V Q;  3HFZ B;  1GM5 A;  4BBR H;  5FLM G;  1XMO L;  2R7Z G;  2E76 C;  2Q2H A;  3EA6 A;  1IHZ A;  2UUC L;  4KY7 A;  1FGU A;  3OMG A;  3P20 A;  3K5N A;  2NVY B;  4BBS G;  1QG7 A;  3FMC A;  2E2H H;  1AEX A;  3RZD H;  4JI0 Q;  3S1N B;  4G7O C;  3H0G H;  2K32 A;  3RLO A;  2B29 A;  1BVS A;  5D65 A;  3IFT A;  4X64 Q;  1ENA A;  4JBM A;  4B9X A;  2DJG C;  1Q82 C;  4H7B A;  2XWB B;  3H3V I;  1HR0 L;  2P5Z X;  2JA6 G;  1Y1V G;  2EY5 A;  4DV1 Q;  3DXJ C;  4MNO A;  2F1M A;  5IYC H;  2F0H A;  3DMU A;  1VQ7 A;  1MSG A;  1EIF A;  3OMC A;  1N33 Q;  2RBM A;  4XDX A;  5COR A;  2R92 H;  4ID6 A;  1IKM A;  5CMD A;  5T1G A;  1N36 L;  3CU7 A;  5EBD A;  5BR8 L;  4KHV A;  4IUP A;  1VQO A;  1PTO F;  5BN5 A;  3I73 A;  2KCT A;  3HP3 A;  2R61 A;  4IZ8 A;  2EJF C;  1AZQ A;  2I46 A;  4QUC A;  5BN4 A;  4YWM A;  2BOS A;  4LAA A;  1PRT C;  1LTA D;  4A3I G;  4JI3 Q;  3DUZ A;  1A0I A;  4B3R L;  2A19 A;  1L1O B;  2EIF A;  2SOB A;  2L12 A;  3E0J A;  1B50 A;  2Q2I A;  4DAP A;  1Q7Y C;  1MHW C;  1SMY C;  4U68 A;  4GN5 A;  2NVX H;  3C46 A;  1EY5 A;  1E0B A;  3CQZ B;  1LT5 D;  2J4X A;  2TSS A;  1STY A;  1UE6 A;  3FP9 A;  3DWP A;  4J1M A;  1J8I A;  1CZG A;  3DEP A;  2BDO A;  5C3E B;  2VXW A;  1UEB A;  2L55 A;  3PO2 G;  3P7J A;  5HUR A;  1I5F A;  3MAQ A;  1OTC A;  5FO8 B;  3FKI B;  5IT9 L;  5LMU Q;  4NKL A;  2ZJP A;  4NXM Q;  3PUZ A;  2A74 C;  3STB C;  1MGS A;  1VS0 A;  3F2D A;  2VZA A;  3J7Z C;  1QVC A;  1C48 A;  4I65 A;  2Z6K A;  3L9A X;  4HR7 B;  2NVT B;  3EJI A;  1Z6H A;  1SNC A;  5CV4 A;  4IUU A;  3CCR A;  2EZV A;  1EU3 A;  1XXG A;  5LHY 1;  4DV7 Q;  1OXV A;  4GKK Q;  5M5Y B;  2RSO A;  4JI7 Q;  1I50 B;  1UE7 A;  1LTT D;  5FLX E;  5C0X G;  3NP8 A;  2K50 A;  4YWK A;  1Q46 A;  1HUM A;  3H09 A;  3MZ5 A;  1PH3 A;  3CW2 C;  4BY7 B;  1V1P B;  2EYH A;  1GO3 E;  3CMA A;  5C4X G;  3M7G A;  1Y8N B;  4WJ3 M;  1IYV A;  5ISR A;  4JC0 A;  1A3V A;  1EOV A;  3KJP A;  3GP7 A;  5FKA C;  1DOL A;  2VQF Q;  3IL8 A;  3EFX D;  4KK7 A;  4RG1 A;  5IYB H;  2GA4 B;  4GOP A;  3CHB D;  4BXX H;  1LT6 D;  5C5M A;  4ABN A;  1PV4 A;  2YU9 B;  1TXY A;  4F8M A;  1NMG A;  1N8R C;  2NZH A;  4GOP C;  1F2L A;  4KN4 C;  4Q5V A;  3QB3 A;  4CDE C;  2UXC L;  2R7Z B;  3NTH A;  4KD4 A;  1XWE A;  4DV0 Q;  1MI2 A;  1DON A;  4BBS B;  2JEB I;  3MXN B;  4P71 A;  3J80 E;  1GKH A;  1X65 A;  4V19 0;  2DY8 A;  3C1E A;  4X6A H;  1F9S A;  3LWU A;  1TWA B;  3UDI A;  1ENF A;  1CUK A;  2WAQ G;  1JWU D;  1NR2 A;  2EXD A;  2WB1 E;  1BCP F;  1GXD C;  4Q0F A;  1VQN A;  2I0Q A;  2D62 A;  1P8L A;  2HDL A;  1KLG D;  5EAY A;  2JA6 B;  4QCL A;  1DOK A;  1TWC B;  4OX9 L;  2F0V A;  4UHV A;  4FF2 A;  4HJA A;  1QWY A;  4E6I A;  3S2H H;  4YCW A;  1EQR A;  3HGB A;  4IFD H;  1AE2 A;  1CFM A;  4B08 A;  4XT3 B;  4PG3 A;  3T56 B;  4JI5 Q;  5J22 A;  3W1B A;  1CQV A;  2XGT A;  3SK4 A;  3NTK A;  4Y7N B;  1A6X A;  4TVA B;  3I4N H;  3H0G G;  3R2I A;  2R7D A;  3KF8 A;  1CA5 A;  4MTK A;  3F8T A;  3CC2 A;  3EIV A;  4X66 L;  4K0K Q;  4N9P A;  2DNE A;  4PQX A;  2A6H D;  3A5Z B;  4X3K A;  2JE6 I;  4POG A;  1L0X B;  1OXU A;  2JQO A;  2K33 A;  3PCO B;  3S1M B;  3PO3 B;  2F0O A;  5IYC G;  4MHE A;  4L5T A;  4O2D A;  3KJO A;  2F0P A;  3CC7 A;  4LF5 Q;  3GTL B;  2R92 G;  1BBW A;  2NVY H;  3KDF A;  3S1N H;  4DFA A;  3W2D A;  1ONL A;  4JBW A;  4P75 A;  2MO0 A;  1Y8P B;  3QOL A;  2HUG A;  2XIW A;  4NXN Q;  1JB3 A;  1PMR A;  1RCV D;  1HA6 A;  2IX0 A;  1VDZ A;  1IBM L;  2AQ1 B;  1IW7 D;  5D14 A;  3LWE A;  3GTK B;  4OL7 A;  4X65 Q;  1HCZ A;  4RKB A;  2A68 C;  4GN3 B;  1VQJ A;  4RGT A;  3WDN A;  3NQI A;  1D1I A;  4DR3 L;  4A3M G;  2VY3 A;  1B1Z A;  3Q22 A;  2NVQ B;  2I5L X;  4KKS A;  1YHA A;  4IUN A;  1N32 Q;  5E4X A;  4JI2 Q;  1V43 A;  1E24 A;  3AFQ A;  1UAP A;  2PNR C;  3F2U A;  4ZYS A;  1SYE A;  3PUV A;  2L9H A;  1IKL A;  2BH2 A;  3I2Z A;  5J39 A;  1H9S B;  3TEH B;  3JAM L;  3W3A A;  1TY0 A;  1V9P A;  2IWH A;  3OIP A;  3DHQ A;  3OTO L;  1LTR D;  1O7Y A;  4ZKC B;  1QUQ A;  3OSO A;  4A93 B;  4N9T A;  4MTN A;  3U58 A;  3X3M A;  4XYQ A;  5IP9 G;  1U0L A;  4BA1 I;  2AWN A;  4OO1 G;  1WTV A;  1Q86 C;  4FF3 A;  4A3B B;  1WJJ A;  3CQZ H;  4S3S A;  5I4D A;  1XMQ L;  4A4I A;  2UU9 Q;  1HHV A;  1E7Z A;  1KAB A;  1VQG A;  1CK1 A;  3VA5 A;  4YHH Q;  3QO2 A;  5KYI A;  3CCJ A;  4OWX B;  2NBF A;  2SEB D;  2ICE C;  5C3E H;  1PDQ A;  1V8Q A;  2F0W A;  2RSN A;  4DR6 Q;  4XTC S;  5AJ3 Q;  2M2L A;  3KLR A;  1M8A A;  3FKI H;  4L6T B;  1FR3 A;  3QJY A;  3SEB A;  1JE4 A;  2KUM A;  3K0Y A;  4X64 L;  4GKJ L;  4GNX A;  3RNU A;  2BE5 C;  2NVT H;  1LTB D;  3NHH A;  4JCV E;  4L63 B;  4GNX C;  3LNN A;  4DV1 L;  4K6L A;  4K8I A;  5M5Y H;  3ZJY C;  1A15 A;  2WAQ B;  2X6L A;  4QMG A;  5IYB G;  4QGU A;  1I50 H;  1VQ8 A;  5M3F G;  2B39 A;  4BXX G;  2PO4 A;  4B3S Q;  1PA6 A;  4PZ8 A;  2ZM6 Q;  2JA9 A;  2K7V A;  1EYG A;  3SK5 A;  1ZYR D;  5J1Z A;  4DV6 L;  3CXC A;  5JJL A;  1WYD A;  1QCB D;  4IJL A;  3K59 A;  4BY7 H;  1DYQ A;  4OEL B;  2R7F A;  3L7Z C;  1PTO D;  1KIX A;  3CC4 A;  5A35 A;  5DEH A;  1A62 A;  1W6J A;  2A1A A;  3I55 A;  2ZJR A;  2F0S A;  2UUB L;  1TWH B;  1W6K A;  3Q6S A;  3V2T A;  3S1R B;  2AMC B;  3ERO A;  1G51 A;  2YU9 H;  4P72 A;  4HIK A;  3HRZ C;  2RDG A;  2X69 A;  4AYB G;  3I91 A;  2B63 G;  2NUC A;  4WFN 3;  4APV A;  2H4O A;  2XTI A;  5FLM H;  2R7Z H;  5KNB A;  1SJH D;  5DAU A;  3T4A C;  3S1Q B;  4DR2 Q;  1FL0 A;  3S14 B;  4IFD G;  3ITP A;  4A3L G;  4UAI A;  1L0W A;  3K5O A;  4BBS H;  4K14 A;  1S4Z A;  5GQO A;  2AHO B;  2LKV A;  1TWA H;  1KD1 C;  2PZW A;  5FOB B;  3CF5 A;  3F2B A;  4OHJ A;  2A69 D;  2MO1 A;  5FK9 C;  1EY7 A;  1JB7 A;  1PZI D;  3PV0 A;  1QVF A;  2JA6 H;  1TWC H;  1X3P A;  2CH4 W;  4B3T Q;  2F0D A;  3G48 A;  2L5T A;  4IN3 A;  4DV7 L;  5I2Y A;  4GKK L;  4BY1 G;  1Q1B A;  4A3M B;  1GHK A;  2RKS A;  4HMJ A;  1FNV A;  3BYT B;  1VQK A;  2V1C C;  4H02 A;  4HJ9 A;  4Y7N H;  1EZ6 A;  5IE8 A;  2UXB L;  3MXU A;  2D5D A;  5IT9 c;  4HID A;  1R4Q B;  1GUT A;  1RL2 A;  1UEA B;  2Q8T A;  1Y69 U;  1W3S A;  3K80 C;  3A5U A;  2I5M X;  1Y14 B;  5IP7 H;  4UP8 A;  1BBU A;  1SNM A;  3S1M H;  2VQF L;  3PO3 H;  3HOU B;  2F4I A;  3U50 C;  1JE5 A;  1HH2 P;  3GTL H;  3TP8 A;  1BR9 A;  3UDG A;  3Q23 A;  3J81 L;  1EQQ A;  1ET6 A;  1S40 A;  4PZ6 A;  1PH7 A;  4HMI A;  1K8A C;  3VYU A;  1A3T A;  2SNS A;  2LMC B;  1K0R A;  3CME A;  3M4Q A;  1HZ9 A;  3S15 B;  3D6W A;  3BZC A;  3A54 A;  2KOL A;  2B2T A;  3K6O A;  3GTK H;  1S5C D;  2VB2 X;  1EEF D;  4A76 A;  2B2T C;  3A8I E;  3DM3 A;  1HUN A;  1O7Z A;  4FF4 A;  2JSO A;  4DU9 A;  1MKH A;  4FXD A;  5DM7 3;  4DV4 Q;  1SNO A;  5CV5 A;  5CR3 A;  1D6E C;  4ULL A;  1EL0 A;  2CWP A;  2NVQ H;  1PLF A;  3G6E A;  1TQO A;  5LMN L;  3I56 A;  1F2Z A;  4NDX A;  3UE0 A;  1BCP D;  3ERQ A;  1SSO A;  2GVA A;  3TRE A;  3Q0A A;  3T1H Q;  2G5D A;  4P74 A;  1K8G A;  1JJG A;  1JOQ A;  1YJW A;  5FO7 B;  5M3F B;  4DV2 Q;  3NEN A;  3ZYY X;  5C3E G;  2OCE A;  4JI5 L;  3NBH B;  4A93 H;  3ULP A;  2XN9 C;  3IFD A;  3V96 A;  2HIX A;  4YY3 Q;  3C2P A;  2XSC A;  4NMZ A;  4L5R C;  2PCF B;  3D4W A;  4A3B H;  1MIU A;  4X62 Q;  3D4R A;  2EYL A;  1AE3 A;  3QOJ A;  1GOZ A;  4B3M L;  2CW0 D;  1CA6 A;  2F0U A;  1I94 L;  4WJ4 A;  1C7Y A;  1TWF B;  1D8L A;  1SND A;  4GLV B;  4XQJ A;  4LF5 L;  1B9M A;  2A6H C;  1HNX Q;  3TP6 A;  3K58 A;  2EYM A;  2B63 B;  3A56 A;  2EYF A;  1U5K A;  3PIP A;  3BVZ A;  4IQZ A;  4ZCK A;  1KRS A;  2Y0S E;  3BDO A;  4NXN L;  3TZD A;  2B8F A;  1NCV A;  5I6Y A;  3QR8 A;  1HQR D;  1B7Y B;  4KHP Q;  3KF6 A;  5CV8 A;  4ZUI A;  3PUX A;  2K5V A;  1IYJ B;  2A8V A;  4X65 L;  4AQY Q;  3NEL A;  4JYA Q;  2WV6 D;  3NPP A;  4LK1 C;  1PH4 A;  1YNJ C; 
#chains in the Genus database with same CATH homology
 3LX0 A;  3ND9 A;  1BO0 A;  1STN A;  1D5X C;  1TS2 A;  1AP0 A;  2MJ8 A;  3AU7 A;  1M4V A;  3D6C A;  2JA5 B;  2RDF A;  4BY1 B;  2MHV A;  3I4L A;  3RZO B;  2K5Q A;  4HTH A;  4K5V A;  3UI2 A;  4OIJ A;  5JVG 3;  2OXP A;  4HN7 A;  2EYP A;  4XYO A;  5JEA H;  3MWY W;  4IUV A;  3TME A;  2KCN A;  2KA7 A;  1HFN A;  2WKD A;  1SE3 A;  3HOZ B;  3QIA A;  2J0T D;  2K05 A;  3RMH A;  4ZAI A;  1QJO A;  1KTK A;  1EOT A;  3J7A F;  1TII D;  5ELE A;  2K04 A;  1K8M A;  3SVM A;  2F3W A;  1WTQ A;  4M1U B;  5DNF A;  4C3H G;  5EPL A;  4H13 C;  2KCC A;  4K5W A;  2K03 A;  1S5D D;  5ELD A;  1DM0 B;  1EIH A;  3AB9 A;  2CHB D;  1JQY D;  4C3J B;  1KDA A;  1FD7 D;  4FVM A;  3TZU A;  3H3V C;  5C3X A;  4A3E B;  5IOC A;  1SFO B;  3CRL C;  3A7L A;  2ICI A;  3R93 A;  1S5F D;  4WOR A;  2BA0 A;  1CHQ D;  1KNE A;  3EQL C;  1K8O A;  1A2U A;  1TS5 A;  3URY A;  1EY6 A;  1SEB D;  1PRT B;  1PZK D;  1ZYR C;  1T5E A;  4KY6 A;  4R8I A;  5LL6 S;  1ET9 A;  1PTO C;  2H1E A;  2Z4I A;  3DM1 A;  4CKC A;  4OO1 H;  3GO5 A;  1EQV A;  2A6E D;  5EGT A;  2LFN A;  5C3W A;  5I2X A;  3NBI A;  3MXP A;  4KKT A;  1QE6 A;  4G4K A;  1TY2 A;  3R2T A;  3NSW A;  2WII B;  1EY4 A;  2Y0S B;  1J9O A;  4J6H A;  1H9J A;  4KMU C;  5ELB A;  3SR1 A;  1I6V C;  3HEJ A;  2O5J C;  1ILQ A;  4XQN A;  2E2J B;  1D5Z C;  4C1N I;  5LL6 X;  1WD1 A;  1EZ8 A;  5CBA E;  2ENB A;  4DXG A;  1ICW A;  4B9W A;  5CV6 A;  1MBY A;  2ID0 A;  2A69 C;  2FJ2 A;  2J7Z A;  2NTT A;  2I07 B;  1I4H A;  1LTS D;  1PFN A;  1HTL D;  3FEW X;  5EKK A;  4ZKB B;  2NN6 G;  4U67 3;  3FDT A;  2AUJ D;  4J8Q A;  2XWJ B;  4K2K A;  2WP8 J;  1XYI A;  2L11 A;  1GUW A;  3CKI B;  1MD2 D;  4TKO B;  1SE2 A;  1VCI A;  3H94 A;  2K01 A;  3NWT A;  1NSN S;  3MXG A;  3P75 A;  4H44 C;  5C5L A;  1RHP A;  1G29 1;  5ELC A;  4C3H B;  1DCZ A;  4RHS A;  4CJ1 B;  2B2V A;  3SK6 A;  1RDP D;  1CTM A;  4ZRZ A;  1EQT A;  1BXT A;  2B2V C;  5JEA G;  4HSP A;  5IT9 E;  3K57 A;  2JYO A;  1RTO A;  4OIK A;  3R3O A;  3I4M B;  4XT1 B;  1TKW B;  1TVX A;  4M8A A;  4F87 A;  2VB3 X;  5JAV A;  4A3F B;  2JA8 B;  1PZJ D;  3A55 A;  3DWA A;  4HCS A;  1FNU A;  5C4Z A;  4HCE A;  1NUC A;  1BCP C;  1SNP A;  5C0X I;  4DK1 A;  2EOT A;  1H9R A;  2ZXP A;  2L1B A;  5CV9 A;  1G91 A;  2K5W A;  4QB4 A;  2M9V A;  1CM9 A;  3PUW A;  4A3D B;  1OXT A;  2AWO A;  1I3Q B;  5CYU A;  4WRD A;  1A2T A;  2F0L A;  4KTA A;  3S16 B;  1FYC A;  3NXW A;  2KQ3 A;  2EJM A;  1RJT A;  3J7A V;  1TWG B;  1R4P B;  3VYT A;  2QCP X;  4XIG S;  1QOH A;  1JOO A;  5K36 H;  5E3F A;  1SJE D;  2NB0 A;  2Z1C A;  4PMC A;  5C0X J;  1F9Q A;  1JR0 D;  2OF1 A;  2DN8 A;  2G9D A;  5JOB A;  1BQQ T;  1EIG A;  2F0T A;  2QF7 A;  5M5W B;  1JWS D;  1ZXT A;  1DXM A;  5IOD A;  1HPC A;  3E6Z X;  4FXG C;  3M4Y A;  3TP5 A;  1U4P A;  1H9K A;  1Q12 A;  4Z9C B;  1MSH A;  3K5M A;  1STA A;  1AFP A;  3KBG A;  1SAP A;  3EVQ A;  2IW3 A;  5A2Q L;  1OXX K;  3NK9 A;  1LT3 D;  4QIW B;  4BA2 I;  3N52 A;  1F2Y A;  1STE A;  3OIQ A;  5CV7 A;  2JXM B;  5C44 B;  2B2U A;  1SNQ A;  1LT4 D;  2WB1 B;  3S2D B;  4RGO S;  2B2U C;  1Q90 A;  1IYU A;  4A3G B;  3TDQ A;  1EY9 A;  1S5B D;  2F0E A;  3M3Y B;  1JIC A;  3GV6 A;  2Q8R E;  2NYZ D;  2OEO A;  1Q8I A;  1C4Q A;  3M85 A;  3M7N A;  2L4N A;  4C2M B;  5CC4 A;  4RAU C;  2PYK A;  5FO9 B;  2KJX A;  5D3I B;  2HDM A;  2B8G A;  4PNY A;  3KK7 A;  1JC7 A;  2XRQ D;  1WTW A;  3E5S A;  3N6R A;  3K7A B;  1F9P A;  3BDC A;  1LAC A;  2KED A;  1ROD A;  2Z8L A;  2PMZ B;  3JAM E;  2JA7 B;  4DNT B;  1JWM D;  2EYO A;  5EPK A;  2HCC A;  2IX1 A;  2SDF A;  3Q24 A;  3WOE A;  1GUS A;  2NZ1 D;  1WCM B;  1VF5 C;  1WTO A;  1ZKO A;  2KVM A;  4NP5 A;  4OO1 I;  4CKE A;  2IT1 A;  4CBV A;  2NTS A;  1EYA A;  3VR3 A;  5I9P A;  3MC0 B;  4OGQ C;  1Z7T A;  3V05 A;  2EY1 A;  1OXS C;  2N55 A;  5NUC A;  1B9N A;  2C5C A;  4CGY B;  1ILP A;  2WKC A;  5EKL A;  1Z47 A;  2MUY A;  2FMM A;  1I6H B;  2MP1 A;  3A8K E;  3WOF A;  1PFB A;  2AUK A;  3FPU B;  3T13 A;  1BNZ A;  2PW7 A;  5HGT A;  4EQP A;  3J7Y W;  2BDN A;  2K1B A;  3DEO A;  4RWS C;  4KKU A;  5JVH 3;  3I70 A;  3VR5 A;  1SDF A;  3RUZ A;  5K36 G;  1LO5 D;  1WTR A;  4C3J G;  3NE5 B;  4QF4 A;  3O13 A;  1S5E D;  1VMP A;  3A7A B;  4R8N A;  3NTI A;  3HOY B;  3I8Z A;  5IGG A;  5K5P A;  2EE1 A;  1SYC A;  1JCK B;  4L8J A;  3SK8 A;  2OT2 A;  3KLS X;  4LJZ C;  4A3K B;  1WTX A;  4IFD I;  1PYW D;  2KEC A;  3OWF A;  1RTN A;  3MTS A;  2DNC A;  2PZU A;  3HS0 C;  2WAC A;  3FPP A;  4ME5 A;  4X3S A;  3MFG A;  1HTP A;  5EJW A;  1X32 A;  3TBI B;  1DZ1 A;  4FXK C;  4IUQ A;  3HOX B;  3HOW B;  4QUF A;  2NN6 H;  1EYC A;  2F0G A;  1JOK A;  2EYJ A;  4O42 A;  2ZXO A;  3C1F A;  3MA2 B;  4C3I B;  3TN2 A;  3KUP A;  1AN8 A;  2E74 C;  1TU2 B;  3VA7 A;  5JPN C;  1F2M A;  5BN3 A;  2CQA A;  1I4X A;  2L0C A;  1DOM A;  4HSV A;  3ND8 A;  3PIO 3;  5KIX A;  2LS0 1;  1LAB A;  1D5M C;  3OPO A;  5C6A A;  1HFG A;  3RLF A;  3J81 E;  1IW7 C;  4RCO A;  3GTP B;  1QNU A;  1XX8 A;  1JOR A;  2PQE A;  5D3D A;  1QNK A;  4G7H C;  5AFW A;  3BG3 A;  5E1F A;  2F0F A;  4RA8 A;  2O2L D;  2RA4 A;  4NW2 A;  4K2L A;  5C4H A;  1RD9 D;  3VR6 A;  3I90 A;  1PRT F;  1RKN A;  4KV6 A;  1FGB D;  5FLX L;  3GTG B;  1AW7 A;  2BE5 D;  5EQ0 A;  3M4O B;  4EQO A;  1I4Q A;  2K5D A;  2DY7 A;  2FHT A;  3T53 B;  5KRU A;  1SBB B;  3HKZ B;  1K83 B;  3I72 A;  4KJO A;  2AQ3 B;  1E2W A;  1U4R A;  1EYD A;  2PPB C;  4RKL A;  1C8C A;  3A8J E;  4DGZ A;  1LTG D;  2X6G A;  4RFB A;  1A3U A;  3BVG A;  5KYL A;  3J80 L;  3D4D A;  3T16 A;  3MHB A;  1SYF A;  3NWS A;  3SHL A;  1GUG A;  4RCN A;  3GTJ B;  5KNC A;  3GTO B;  1Y1W B;  2VUM B;  5EPJ A;  1STG A;  1WTP A;  2EJG C;  1VF7 A;  2A73 B;  2EY6 A;  3D3R A;  1HRJ A;  1V1P A;  1II3 A;  3BZD B;  2SNM A;  1LLR D;  1PTO B;  1RF2 D;  1G2S A;  2B2W A;  3PIP 3;  4CHT B;  1G6Z A;  2F0J A;  2B2W C;  1U4M A;  3H6M A;  3X3N A;  2F0I A;  2HCI A;  5F2D A;  4DK0 A;  2F03 A;  2A5H A;  1I4P A;  2F0K A;  4MN3 A;  2VNU D;  3MXN A;  2E2I B;  1DJR D;  2M00 A;  1B3A A;  2EDG A;  4XXE A;  4DAV A;  3D8G A;  5I6W A;  1VMC A;  4A3J B;  2NWG A;  3NQT A;  3S9W A;  3L3O C;  4YIJ A;  2QEJ C;  2R6G A;  3QG1 A;  3AMU A;  4C56 C;  2MPM A;  5T1I A;  1SYG A;  1UNS A;  2IL8 A;  4G7Z C;  4DNR B;  3BDL A;  4KJN A;  5KND A;  2EVB A;  5M3M B;  3SE0 A;  2WIN B;  3G7L A;  1FNW A;  4PMW A;  4IUR A;  1NAP A;  1D2B A;  2IPK D;  1TS4 A;  1TR5 A;  1KAA A;  4UDU C;  5G3L F;  4P2C B;  1DD2 A;  3K5L A;  1Y1V B;  1B2T A;  2IX3 A;  3MEH A;  1ESF A;  2QDB A;  1QB5 D;  2QKI C;  2KHS A;  4ZLT F;  4DXF A;  1KLU D;  4TSS A;  3I3C A;  4X3T A;  4KY5 A;  1Y8O B;  2D9U A;  1R9T B;  4ZQ3 A;  2F0Q A;  1BDO A;  3GTM B;  2G9H D;  4A3I B;  4TQU S;  1YNN D;  2ZXR A;  4KI0 A;  1V1O A;  3G6J B;  1E2V A;  1ESR A;  5C4J B;  4PV1 C;  3S17 B;  1G8Z D;  5JJZ A;  1BCP B;  2O5I C;  1H9S A;  2JP1 A;  3IKJ A;  4ILW A;  5KEE A;  1YNJ D;  3HZX A;  1Q3L A;  2CW0 C;  2R3Z A;  1O80 A;  3P1H A;  2TMP A;  5M5X B;  1EU4 A;  2N88 A;  3PO2 B;  2K28 A;  2D2C C;  3PUY A;  2NN6 I;  1GHJ A;  4KHZ A;  3BS1 A;  4I7Z C;  4V0B A;  5IGD A;  2K6A A;  2F0N A;  2XVS A;  1AZP A;  1BF4 A;  1EWC A;  2PZT A;  1LTI D;  1OO9 B;  3R8B A;  3MFY A;  3C3L A;  2KEE A;  2RQX A;  1F9R A;  4FP5 D;  5C4X B;  5IIF A;  2F0M A;  1D1K A;  1CQF A;  1NR4 A;  3KBX A;  2QIL A;  1ML0 D;  4BS9 A;  1I4G A;  4K5X A;  5EBC A;  3U9O A;  1EWH A;  2FIN B;  1PRT D;  1B4O A;  1HXY D;  1TS3 A;  3KLS A;  3GTQ B;  3OOC A;  1I4R A;  2EXZ A;  1PTO H;  2CVR A;  4FF1 A;  4HAE A;  4FYD A;  1F77 A;  2RDH A;  1SMY D;  4JK1 C;  4C1N K;  2E2D C;  3QWN A;  4RGN A;  5KGU A;  4DN4 M;  1WD0 A;  2RVL A;  5JEA J;  4G57 A;  5IGF A;  3MVV A;  4BBR B;  3VYS A;  3SXH A;  4O1N A;  4KD3 A;  5IGB A;  2BCO A;  2E2H B;  3RZD B;  2R93 B;  3H0G B;  3U9S A;  3BYY B;  4C3I G;  4GZY C;  1KDB A;  2C9O A;  3VR2 A;  1STB A;  1SE4 A;  5M9O A;  3T51 B;  3GQB A;  2FMC A;  4RHR A;  1U4L A;  3RD4 A;  2MGS A;  2O4X A;  2F3V A;  2E75 C;  1BOS A;  2R92 B;  1EEI D;  1O78 A;  4IUT A;  4DF7 A;  4EVO A;  4F7X A;  3BVM A;  1STH A;  1ENC A;  4EGV A;  2A6E C;  1TT2 A;  1UUP A;  1KDC A;  2EPB A;  5A2Q E;  4K6D A;  3PMF A;  3VR4 A;  4X3U A;  1GUN A;  5CGK A;  3HG9 A;  3SDZ A;  2YYZ A;  5ELF A;  1O7L A;  3OHX C;  1CI3 M;  2NVX B;  3DWQ A;  3GV3 A;  3NUC A;  4MIU A;  5EKI A;  3IAY A;  4CJ0 B;  4EQN A;  3H91 A;  2Q8I B;  3OWE B;  3HOV B;  1H9M A;  2AQ2 B;  5I9O A;  4H0L C;  1PXU A;  3GD7 A;  1G2T A;  1L0Y B;  4RGM A;  1GUO A;  3D31 A;  1E2Z A;  3FVQ A;  4ZK9 B;  2Z4H A;  2ZT9 C;  4WJW A;  3NBH A;  2XNA C;  5DM6 3;  5COY A;  1SXT A;  5E4W C;  1ZEQ X;  1WVL A;  1CHP D;  2EY2 A;  5CBE E;  4XQQ A;  4ODG A;  3TSS A;  4CKB A;  2FFK B;  4FO2 A;  1BUV T;  1EY8 A;  1PFM A;  1IL8 A;  2HQE A;  4HED A;  5G3L D;  4PMB A;  1HA5 A;  3FRP B;  2V4D A;  1XTC D;  5C0X H;  5JPM C;  4F88 A;  1SYD A;  1EFI D;  4BWG B;  2A68 D;  2XRS D;  2IJ0 A;  2BA1 A;  4K8J A;  4CJ2 C;  4IFD J;  1CZW A;  3TP7 A;  1BBX C;  4KN7 C;  1Q1E A;  1QIL A;  4LMQ D;  1B44 D;  1HQM C;  4IAL A;  1EY0 A;  1U9R A;  2JEA I;  4AYB B;  1GJX A;  1B53 A;  2B2Y A;  4RH6 A;  1SYB A;  1KNA A;  3CRK C;  1YNN C;  3VYR A;  4ZUJ A;  1T5X D;  2B2Y C;  2LY7 A;  3S2H B;  5IGC A;  1CT1 D;  4TRD A;  4DAY A;  4R9W A;  3OW7 A;  1LV9 A;  3ONA B;  4DA2 A;  1X3Q A;  2PW5 A;  3I4N B;  5TSS A;  5IGE A;  4FNF A;  2E76 C;  3EA6 A;  1IHZ A;  4KY7 A;  3OMG A;  3P20 A;  3K5N A;  2NVY B;  1QG7 A;  3FMC A;  1AEX A;  3S1N B;  4G7O C;  2K32 A;  5D65 A;  3IFT A;  1ENA A;  4B9X A;  4H7B A;  2XWB B;  2EY5 A;  3DXJ C;  2F1M A;  2F0H A;  3DMU A;  1MSG A;  3OMC A;  2RBM A;  5COR A;  4XDX A;  4ID6 A;  1IKM A;  5CMD A;  5T1G A;  3CU7 A;  5EBD A;  4KHV A;  4IUP A;  1PTO F;  5BN5 A;  3I73 A;  3HP3 A;  2R61 A;  4IZ8 A;  2EJF C;  1AZQ A;  2I46 A;  4QUC A;  5BN4 A;  2BOS A;  4LAA A;  1PRT C;  1LTA D;  3DUZ A;  2SOB A;  2L12 A;  3E0J A;  1B50 A;  4DAP A;  1SMY C;  4U68 A;  3C46 A;  1EY5 A;  1E0B A;  3CQZ B;  1LT5 D;  2J4X A;  2TSS A;  1STY A;  3DWP A;  4J1M A;  1J8I A;  1CZG A;  3DEP A;  2BDO A;  5C3E B;  2VXW A;  2L55 A;  3P7J A;  5HUR A;  3MAQ A;  5FO8 B;  5IT9 L;  3FKI B;  4NKL A;  3PUZ A;  2A74 C;  1MGS A;  1C48 A;  4I65 A;  3L9A X;  4HR7 B;  2NVT B;  3EJI A;  1Z6H A;  1SNC A;  5CV4 A;  4IUU A;  2EZV A;  1EU3 A;  1XXG A;  5LHY 1;  1OXV A;  5M5Y B;  2RSO A;  1I50 B;  1LTT D;  5FLX E;  5C0X G;  3NP8 A;  1HUM A;  3H09 A;  3MZ5 A;  4BY7 B;  1V1P B;  2EYH A;  3M7G A;  1Y8N B;  1IYV A;  5ISR A;  1A3V A;  3GP7 A;  5FKA C;  1DOL A;  3IL8 A;  3EFX D;  4KK7 A;  2GA4 B;  3CHB D;  1LT6 D;  5C5M A;  4ABN A;  2YU9 B;  4F8M A;  1F2L A;  4KN4 C;  4Q5V A;  3QB3 A;  2R7Z B;  3NTH A;  4KD4 A;  1XWE A;  1MI2 A;  1DON A;  4BBS B;  2JEB I;  3J80 E;  4V19 0;  2DY8 A;  3C1E A;  1F9S A;  3LWU A;  1TWA B;  1ENF A;  1JWU D;  1NR2 A;  1BCP F;  1GXD C;  4Q0F A;  2D62 A;  2HDL A;  1KLG D;  2JA6 B;  4QCL A;  1DOK A;  1TWC B;  2F0V A;  4FF2 A;  1QWY A;  4E6I A;  4IFD H;  3HGB A;  1CFM A;  4B08 A;  4XT3 B;  3T56 B;  5J22 A;  1CQV A;  3SK4 A;  3NTK A;  4Y7N B;  1A6X A;  3R2I A;  1CA5 A;  3KF8 A;  4N9P A;  2DNE A;  4PQX A;  2A6H D;  4X3K A;  2JE6 I;  1L0X B;  1OXU A;  2K33 A;  3S1M B;  3PO3 B;  2F0O A;  4MHE A;  2F0P A;  3GTL B;  4DFA A;  3W2D A;  1ONL A;  4JBW A;  1Y8P B;  3QOL A;  2HUG A;  2XIW A;  1JB3 A;  1PMR A;  1RCV D;  1HA6 A;  2IX0 A;  1VDZ A;  2AQ1 B;  1IW7 D;  5D14 A;  3LWE A;  3GTK B;  4OL7 A;  1HCZ A;  4RKB A;  2A68 C;  4RGT A;  3WDN A;  3NQI A;  1D1I A;  1B1Z A;  3Q22 A;  2NVQ B;  4KKS A;  4IUN A;  5E4X A;  1V43 A;  1UAP A;  2PNR C;  3F2U A;  4ZYS A;  1SYE A;  3PUV A;  2L9H A;  1IKL A;  5J39 A;  3JAM L;  1H9S B;  3W3A A;  1TY0 A;  2IWH A;  3OIP A;  3DHQ A;  1LTR D;  1O7Y A;  4ZKC B;  3OSO A;  4A93 B;  4N9T A;  3X3M A;  4XYQ A;  4BA1 I;  2AWN A;  4OO1 G;  1WTV A;  4FF3 A;  4A3B B;  4S3S A;  5I4D A;  1HHV A;  1KAB A;  1CK1 A;  3VA5 A;  3QO2 A;  5KYI A;  2NBF A;  2SEB D;  2ICE C;  1PDQ A;  1V8Q A;  2F0W A;  2RSN A;  4XTC S;  2M2L A;  3KLR A;  1M8A A;  4L6T B;  1FR3 A;  3QJY A;  3SEB A;  1JE4 A;  2KUM A;  3K0Y A;  2BE5 C;  1LTB D;  3NHH A;  4L63 B;  3LNN A;  4K6L A;  4K8I A;  1A15 A;  2WAQ B;  2X6L A;  4QMG A;  2B39 A;  2PO4 A;  2K7V A;  3SK5 A;  1ZYR D;  5J1Z A;  1QCB D;  3K59 A;  1DYQ A;  3L7Z C;  1PTO D;  5A35 A;  5DEH A;  1W6J A;  2F0S A;  1TWH B;  1W6K A;  3Q6S A;  3V2T A;  3S1R B;  3ERO A;  3HRZ C;  2RDG A;  2X69 A;  3I91 A;  2NUC A;  4WFN 3;  2H4O A;  5KNB A;  1SJH D;  5DAU A;  3T4A C;  3S1Q B;  3S14 B;  4IFD G;  3ITP A;  4UAI A;  3K5O A;  4K14 A;  1S4Z A;  2LKV A;  2PZW A;  5FOB B;  4OHJ A;  2A69 D;  5FK9 C;  1EY7 A;  1PZI D;  3PV0 A;  1X3P A;  2F0D A;  2L5T A;  4IN3 A;  5I2Y A;  1Q1B A;  4A3M B;  1GHK A;  2RKS A;  4HMJ A;  1FNV A;  3BYT B;  1EZ6 A;  3MXU A;  2D5D A;  1R4Q B;  1GUT A;  1UEA B;  2Q8T A;  1Y69 U;  1SNM A;  3HOU B;  2F4I A;  3TP8 A;  1BR9 A;  3Q23 A;  3J81 L;  1ET6 A;  4HMI A;  3VYU A;  1A3T A;  2SNS A;  2LMC B;  3S15 B;  3D6W A;  3A54 A;  2KOL A;  2B2T A;  3K6O A;  1S5C D;  2VB2 X;  1EEF D;  2B2T C;  3A8I E;  1HUN A;  1O7Z A;  4FF4 A;  2JSO A;  4DU9 A;  4FXD A;  5DM7 3;  1SNO A;  5CV5 A;  5CR3 A;  1D6E C;  4ULL A;  1EL0 A;  1PLF A;  1TQO A;  1F2Z A;  4NDX A;  1BCP D;  3ERQ A;  1SSO A;  3Q0A A;  1JOQ A;  5FO7 B;  5M3F B;  3ZYY X;  2XN9 C;  3IFD A;  3V96 A;  3C2P A;  2XSC A;  4NMZ A;  2PCF B;  3D4W A;  3D4R A;  2EYL A;  3QOJ A;  1GOZ A;  2CW0 D;  1CA6 A;  2F0U A;  1TWF B;  1SND A;  4XQJ A;  1B9M A;  2A6H C;  3TP6 A;  3K58 A;  2EYM A;  2B63 B;  3A56 A;  2EYF A;  3BVZ A;  4IQZ A;  3BDO A;  3TZD A;  2B8F A;  1NCV A;  5I6Y A;  1HQR D;  5CV8 A;  4ZUI A;  3PUX A;  2WV6 D;  3NPP A;  4LK1 C;  1YNJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...