4MIUA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4miuA00
1EYCA 4DF7A 1F2MA 3TP8A 1EZ6A 4KY6A 1KAAA 5CGKA 1A2TA 2OEOA 4K6DA 5C5LA 2SNMA 5J1ZA 3OSOA 5F2DA 3ERQA 4K2KA 3EJIA 3U9OA 2HQEA 3T16A 1F2ZA 3NHHA 2EY6A 1EYDA 3SK4A 4KD4A 4E6IA 3MXPA 5C6AA 5JOBA 3MVVA 3TMEA 5IGFA 2F0JA 1NSNS 1SYCA 1EYAA 1II3A 4K14A 1KDCA 4RKLA 5HGTA 1EQVA 1SYGA 2F0TA 2F0LA 1EZ8A 2WACA 4S3SA 5CV7A 5JAVA 2LKVA 5CR3A 2F0IA 4ID6A 4EQOA 4B9XA 2F0NA 1IHZA 1ENCA 3MEHA 4N9TA 5DAUA 4EQPA 4K2LA 1A2UA 1SNOA 2F0KA 4H7BA 5NUCA 3TP6A 2SNSA 2F3VA 4I65A 5E3FA 3TP5A 5KYIA 2PYKA 2EYMA 2EYJA 1JOOA 1RKNA 3DHQA 3HEJA 1EY0A 3SR1A 1ENAA 1STBA 5CC4A 3NP8A 2EYPA 2NUCA 2F0EA 2EY1A 2OXPA 3D6CA 4K5XA 1KABA 4QB4A 1EY6A 3OWFA 1STHA 5EGTA 5I9OA 4K5WA 2PZWA 4HTHA 4NMZA 2F0QA 3BDCA 1A3UA 3SK6A 4EQNA 4QMGA 5CV4A 3H6MA 4HMIA 2RKSA 4KTAA 5CV8A 1SNCA 4R8NA 2EY5A 3D4WA 1EY7A 4KV6A 1STYA 3EVQA 4YIJA 5C4ZA 5I9PA 1TQOA 4ODGA 5IOCA 5CV5A 5KRUA 3S9WA 2F0FA 4N9PA 4QF4A 5CV6A 3V2TA 4ZQ3A 4F7XA 3BDLA 3OMCA 3VA5A 3D4DA 2M00A 1F2YA 5M9OA 4MIUA 1SYDA 2EYLA 2PW7A 1JOKA 2EYFA 3D8GA 3TP7A 1SNDA 1EY8A 2F3WA 2EYHA 1NUCA 2KQ3A 3P75A 3SK5A 5C3WA 5EKKA 5I6WA 1TT2A 5KYLA 5J22A 1A3TA 3RUZA 4ME5A 4NDXA 4TRDA 2F0OA 1STAA 2EY2A 3HZXA 3C1EA 3MZ5A 5IIFA 5K5PA 2EYOA 4KJNA 1U9RA 3R3OA 4K8JA 4IZ8A 5DEHA 5C4HA 5I6YA 3EROA 4F8MA 3P1HA 1EY9A 2F0UA 4RKBA 3DMUA 2F0DA 3QOJA 3NK9A 3QOLA 4DGZA 1SNMA 3T13A 1SNQA 5IGCA 2F0GA 1A3VA 3MHBA 4B9WA 1SYBA 2OF1A 3C1FA 4K8IA 2F0MA 4PMBA 4NP5A 2PQEA 2F0WA 1SYEA 4PNYA 5IGBA 2QDBA 3NXWA 1SNPA 4OL7A 1STGA 3PMFA 1EY5A 2F0SA 4KJOA 4LAAA 1SYFA 1EY4A 1KDAA 2KHSA 5IGEA 5KGUA 5J39A 4J1MA 3SK8A 4K5VA 2RBMA 5EKLA 5KEEA 5IGGA 2PZTA 4G57A 5IGDA 5HURA 4DU9A 2F0HA 5C5MA 4NKLA 2RDFA 3LX0A 4KY7A 5KIXA 4KHVA 2EXZA 4KY5A 1JOQA 3NUCA 4EVOA 5IODA 1TR5A 4ZUIA 4DFAA 2F0PA 1AEXA 4PMCA 4ZUJA 3SXHA 5C3XA 1STNA 2ENBA 3NQTA 2PZUA 1KDBA 4IALA 4J6HA 4KD3A 4WORA 5ISRA 3QB3A 2O4XA 5E1FA 2SOBA 5CV9A 4WRDA 3E5SA 2PW5A 3ITPA 2F0VA 3OMGA 4IUNA 3SHLA 4HMJA 1JORA
chains in the Genus database with same CATH superfamily
4V0BA 1D2BA 2A5HA 4P72A 2OTLA 2PPBC 1LO5D 3URYA 1SBBB 3U9OA 5IOCA 4R4TA 3SK4A 4E6IA 1I94Q 3S1QB 3MVVA 2WACA 2I5HA 4JI2Q 4JI3L 4K2LA 2F03A 1AW7A 1YNNC 4X66L 4F88A 2CVRA 2K5VA 1SR3A 2PI2E 4GOPA 1I6HH 3TZUA 1PZKD 4O0AA 2JA5H 4JI0L 1J6QA 1RJTA 1PH3A 3CPFA 1AE2A 2JXMB 3VYTA 1K28A 1EIGA 1Z9FA 2B8GA 3EVQA 4IPDA 4IPHA 5I9PA 2JA9A 3J7AV 3GTGB 4BY1B 4N9PA 4B3RQ 2N55A 3RLOA 1QJOA 5CBAE 1EUJA 1F2YA 1Q8IA 1CHQD 4K6LA 1SYDA 2EYLA 3NWTA 5C0XH 1EY8A 3OTOQ 2XIWA 1PFBA 4KLKA 5IIFA 4DXFA 4KJNA 3GTJB 1SAPA 5M3MH 1EY9A 2Z6KA 3DMUA 4O42A 1XPRA 4C3JH 2L9HA 4A3MB 1G291 1PH7A 4LAAA 1I5FA 4YY3Q 2MUYA 1PYBA 5HURA 3TRZA 4DU9A 1LUZA 4UPAA 4JI3Q 3I2ZA 4UP8A 4GN3B 3N52A 5DNFA 4ZAIA 1Y1VH 2SOBA 1K0RA 3HOZB 4JI0Q 4OGQC 4IUNA 3IFTA 1RTOA 2JA6H 2I5LX 2NZ1D 2K75A 1BCPB 1LTID 1BCPC 1R9TH 3CCEA 4EVOA 2HQEA 3CCLA 3TMEA 5ELCA 4JOIC 1MI2A 4IFDH 3J80E 2PCFB 2A69D 3T51B 1LV9A 1OXXK 3AYHB 1CTMA 4IOAA 3FPPA 3K5LA 2F0NA 2YU9B 1ENCA 2E2HB 1T5XD 3ND8A 3VA7A 1N32L 3K7AH 3SDZA 1B50A 3M7NA 5T1GA 1BOSA 3R2IA 3K6OA 1VQ6A 1XNQL 4OWTB 4Q5VA 1EY6A 1CZGA 1IXRA 4RH6A 2PZWA 2A68C 2K5NA 4X3TA 3CPWA 4AYBE 4QMGA 3A5ZB 3C46A 4R8NA 5IT9c 5C4ZA 1TQOA 4B3TL 4A3BH 1HZCA 2F0FA 3CMEA 1HNZL 3A7AB 1EU3A 2AQ3B 4DR6Q 3MAQA 1DJRD 1FVIA 1VQAA 2IX0A 2EJMA 1I4XA 3FRPB 2PMZB 1QG7A 2C35B 2OCEA 1STAA 4TVAB 2AQ2B 1DM0B 2V1CC 4CKCA 4XQNA 4P74A 1ZXTA 4DGZA 1HZAA 3BZKA 2R92H 5IWAL 3PV0A 1JQYD 3O13A 2OF1A 3TZDA 5FO7B 1QUQA 3AB9A 4XIGS 2N78A 3FDTA 5C44G 3TQYA 4IUUA 4UY8C 3MXNB 1VQCA 2UXDQ 4HJ9A 1CSPA 5KGUA 2EJGC 4AYBG 1E3PA 3OIQA 2FINB 1BKBA 4CHTB 3LX0A 3U4ZA 1A0IA 1NJIC 1BCPF 1YIJA 1HTLD 2F0PA 4TQUS 3D4RA 4LFBL 4AIMA 3CU7A 4BA1I 1TS3A 4C3HG 2F3IA 4LF9L 4KN4C 4POFA 5M5XB 4A3KH 4A3GB 3UDIA 4JI8L 4B3TQ 1HNZQ 3L9AX 2B2TA 1JWSD 4DR4L 3LWEA 5C3EB 2XNAC 4MTKA 4EGVA 3GTLH 2F0TA 1D5MC 1Q86C 2ATWA 4RWSC 5JEAG 2CHBD 3F2CA 1WTWA 1MJEA 1S40A 3MC0B 3R2TA 1C9OA 2SNSA 2YTVA 2HUGA 1KTKA 5KYIA 2JEBI 5LMNL 4P75A 2L0CA 1Q82C 1HUMA 5IWAQ 3PO2B 1A15A 1F2LA 1X32A 2BDNA 5IP7G 1MHWC 3QG1A 2EIFA 4X6AH 4YIJA 5C4XB 4NB3A 1EWHA 5CV6A 3UDXA 3JAME 2R93B 1V1OA 3BU2A 1X3FA 4DK0A 2R7ZH 3D4DA 2WAQB 3R93A 5C0XJ 1VQMA 4BBSG 1XWEA 3J81j 4LFCL 3X3NA 2E2DC 3P75A 4FF3A 1WFQA 5J3BA 4HSPA 3CC2A 3GO5A 4KK7A 1U9RA 4X65Q 1W2BA 3T4AC 4P2CB 1IW7D 1G2TA 1H9KA 1VS0A 1ZYRC 4LF9Q 1JE5A 1X56A 4YCWA 1I50H 5JJLA 2BA0A 2FMMA 4B9WA 4HJAA 3C1FA 4A3JG 4JI8Q 4DUYL 3I4MH 1TWHH 1QILA 3MXGA 2JSOA 1SNPA 4IN3A 3QO2A 1EY4A 1HNXL 4DR4Q 3I4NG 3HG9A 1QWYA 4Y7NH 3AU7A 2EDGA 4WJ3M 4KN7C 1G6PA 2RQXA 1YNXA 5C5MA 3NTIA 5KIXA 1Z6HA 4BY7B 5LMNQ 3RZDH 1TXYA 3SXHA 1H9RA 1UE1A 3QJYA 1HQMC 2QILA 1HQRD 3SHLA 4IPGA 2VZAA 4IQZA 2EE1A 3C2PA 1YHBA 1HA6A 4DF7A 2X6LA 3H3VH 2ZJPA 2QKIC 1LTLA 4DNRB 5C5LA 2AKWB 2HIXA 1MSGA 1PZJD 5F2DA 4QJFA 1HR0W 3CCVA 1IYUA 2EY6A 3MXPA 3HRZC 4CKEA 1LTRD 4IFDJ 1O7YA 1YZ6A 2QA4A 4LFCQ 5CR3A 1WCMG 2K5DA 2LSSA 4H44C 4QL5A 4GNXB 1DGSA 1GVPA 3ERSX 2Q2IA 3PF5A 1XX8A 2EYMA 1IBKL 1LTSD 2IHFA 4RGMA 1YJ9A 2F0EA 3PF4A 1VQ9A 1L0XB 5I9OA 3MTSA 3F2UA 4HTHA 2A6EC 2F0QA 1SJED 3G48A 5CV4A 1E7ZA 1GHKA 5CYUA 1QZHA 2RKSA 4KTAA 2Z4IA 5JJIA 1SNCA 1DONA 2J0TD 4PQXA 4IURA 4H13C 1Q3LA 1ZEQX 5GQOA 3ND9A 1EIHA 1MD2D 3I7FA 5LL6S 3GTOH 4DV5Q 2JJQA 3MFGA 4LF7L 4MIUA 3T56B 3HOXB 1KLGD 2WINB 2ZJRA 4B3MQ 1TT2A 2R61A 2F0OA 2EY2A 2WKCA 3A54A 4GOPB 1TWFH 3PIPA 4A76A 2K52A 2VQEL 3HOUG 1ENFA 1TWGH 1SDFA 4CDFC 5GAHC 1X3GA 1PTOB 2K5HA 2JA7B 5FKAC 1PTOC 1SNMA 1RDPD 1YI2A 3OPOA 1WOCA 4ZLTF 4NP5A 1LT6D 3S2HH 4OX9L 4BY1G 3M4YA 4JI1L 2DY7A 2ZXRA 4G7ZC 2Q8RE 1LT3D 3HOWB 1IBLL 1GUOA 3D6WA 1FL0A 3J80i 3DWPA 1PMRA 3K59A 1Y14B 1CKNB 2JA8B 2Z6KC 3S24A 1EU4A 3UDFA 3D3RA 3BJUA 1NCVA 2OQ0A 2Q8IB 1XYIA 3HOVB 4GKKL 4ZRZA 1KAAA 5M3FB 2OEOA 1PFMA 4JBJA 5J1ZA 4DV3L 3T16A 1DOKA 2FMCA 3M4PA 5IGFA 1NSNS 2WB1E 1LYLA 5T1IA 2B63B 1S3OA 1HA5A 2E8GA 3WWVA 2A19A 1YNJD 3FHWA 5IY0A 2CH4W 1R4PB 5H1SE 3MWYW 3DXJC 3W3AA 4O1NA 4HIKA 1K73C 1DZ1A 2VQEQ 2QEJC 3W5OA 1HNWQ 2EZVA 1LTGD 2VQFL 1SRUA 4L6TB 2EYPA 2KCMA 5KNCA 3HOZG 4GZYC 3S16H 3S9WA 4ODGA 1BUVT 1JJGA 1CSQA 1WTHA 1L0WA 3TSSA 2ZJQA 1A63A 1QB5D 1YJNA 1PTOF 3J81c 2KJXA 1K83B 1JOKA 3PUVA 3HFZB 2D9UA 2F3WA 3BYYB 1IBLQ 4RA8A 5GAEC 4TRDA 5TSSA 4QQBX 4A3EG 2WB1G 2TSSA 1PH8A 1JC7A 1SFOH 1QVFA 3MA2B 4LUOA 2VB3X 3L3OC 1GM5A 1PRTF 2F0DA 2YTXA 1FR3A 3VR4A 1UE7A 1JCKB 3CCUA 1XPOA 1I94L 2JEAI 4ZCKA 5D14A 1LM0A 2PNHA 1VF7A 4IUQA 3L0OA 1ONLA 1EY5A 4KJOA 3ZJYC 1KDAA 3NEMA 2PI2A 3U4VA 4OHJA 4JI2L 4C3HH 4B3SL 4IPCA 1XMOQ 5DM73 3K8AA 1I6HB 3J7YW 1I4PA 2EPBA 2Y0SB 2EXZA 4KY5A 2JA5B 4DN4M 5I2YA 5IP9G 2G9HD 3W1GA 3CHBD 3E3XA 4NXMQ 1HUNA 4OO1I 4XYQA 4DPGA 1S5CD 2VQFQ 1KAWA 3NPPA 3ULLA 5JEAH 2KEEA 1IBMQ 1QUQB 3TS0A 1VQ7A 1TWAH 3HOYG 3TP8A 3IFDA 5CGKA 2UXBL 3AEVA 4BWGB 2MO0A 4DR2Q 4R4IA 1DD2A 1EIFA 3BVGA 3EJIA 4KI0A 3OHXC 2K32A 1MSHA 4HIDA 5M5YB 3RD4A 1B8AA 4B9XA 4OIJA 5IP7H 1LTTD 5M3MB 3JAMi 3F2DA 1Q12A 4PZ6A 2F0KA 3GTQH 1TS4A 4APVA 4IUPA 1ENAA 1EQQA 1KNAA 1RHPA 3PUWA 4BBSH 1IZ6A 3CMAA 1H9MA 3G6JB 3SK6A 2E2JH 3I90A 4JBKA 3OOCA 5M5WB 1HXYD 3J7AF 1QVCA 3D4WA 3S1RH 2YTYA 4KV6A 4YY3L 2A6HC 1I4QA 2B2TC 1RTNA 4B3SQ 2VXWA 5IYCG 2JYOA 2HT1A 2Z8LA 3BZCA 5BN3A 4A3JH 4A93G 1VQJA 5C3WA 1O7ZA 1Z47A 2KENA 3H0GG 2VUMB 1FGUA 2XGTA 2F4IA 3I56A 2UUBL 2JA6B 3I4NH 3K81C 1CZWA 3VR6A 2CWAA 1VQIA 1T9HA 1EIYB 3VDYA 4YHHL 3P1HA 2F4VL 1G2SA 1R9TB 4BS9A 2I46A 3KLSX 1QVGA 3S2DH 2UXCL 3QOJA 4A3IG 4R4CA 1RF2D 1E2WA 5G3LF 4DR3Q 1CA5A 3DLLA 3PO2G 1PH5A 1IKMA 2UXBQ 3KLSA 2KOLA 3HKZB 1SYEA 1JMCA 1O78A 2IW3A 2RCNA 3FP9A 2MPMA 5C4XG 4JI7Q 3G6EA 3K7AB 4A75A 4RHRA 2K03A 2Z9HA 2XRQD 5A2QE 2R93G 3I91A 4RMFA 5IGDA 4DR7L 1PLFA 4OELB 2WAQG 1N9WA 4UHVA 3GP7A 4LF6L 3G4SA 1CKNA 3SVMA 4JCVE 4WJWA 3RLNA 4PMCA 1EEFD 1STNA 1K0SA 1B3QA 4PV1C 2Q8TA 3RN5A 2DGYA 4GN5A 3T1HL 5E1FA 4M1UB 5DM63 3TDQA 4A3BB 2L55A 1WCMH 2PW5A 3GTPB 3M3YH 1O7IA 1QOHA 3J81E 4MTNA 1U4RA 3BZDB 4KY6A 4C1NK 1VMCA 4A3FG 1I6VC 3KF8B 3LNNA 4DR6L 2N49A 2DY8A 3DWQA 1BBWA 2NVTB 2ZTDA 1VQOA 4K14A 3BS1A 4BA2I 1SYGA 1XXGA 3CC7A 4S3SA 4QIWB 1V1QA 4OEMB 2KA7A 4QUCA 2HHHQ 4H7BA 2RF4A 5NUCA 2R92B 3IAYA 2UUBQ 4KKTA 4Q0FA 1VQFA 3DHQA 2K14A 2B2YA 4JW0A 1HFGA 4YHHQ 2F4VQ 2RDHA 2UXCQ 5CC4A 1VQKA 4HCEA 3D6CA 3OWFA 4EQNA 2UXDL 4AQYL 2B2WA 3NTHA 1GD7A 4ZKCB 3VYUA 1HH2P 3W2DA 5FK9C 3H09A 3HOUH 4QF4A 4JVZA 4H0LC 2HQLA 4ZQ3A 3KBGA 4QCLA 1W6KA 2K4KA 1BF4A 4DR7Q 4CGYB 3D8GA 3TP7A 1HPCA 1FD7D 4LF6Q 5EKKA 1PDQA 3WDNA 1A3TA 3RUZA 1E0BA 2B39A 1I4GA 3MZ5A 4RCOA 3GTGH 3AFQA 4BY1H 5DEHA 1KD1C 3T1HQ 2R7DA 2A69C 5I2XA 1SEBD 2R7FA 4J8QA 1WVLA 1SE2A 3GTLB 2IX3A 2EVBA 1WD0A 1C0AA 1K8GA 2BH2A 2NZHA 3CCRA 4P71A 2ASBA 3GTJH 2KCCA 3EQLC 3NBHA 1NE3A 3BG3A 5IGGA 2GVAA 5FLXL 3LGJA 3PIO3 2F0HA 2K7VA 3DM3A 1X3QA 1LLRD 2MJ8A 4A3DB 4KMUC 4IUTA 4ZUJA 3STBC 1R4QB 2D0PA 1FJGQ 1IYVA 5JEAJ 2D0OA 2IX1A 5CBEE 4DAYB 4R4QA 2F0VA 1XTDA 4PG3A 4AQYQ 1JORA 2R7ZB 3PGZA 1LTBD 1VQGA 2HDLA 1VQLA 1Q1BA 1CK1A 3CKIB 1S5ED 2B2UC 1MKHA 2DNEA 2F0JA 2KECA 1EYAA 4X3KA 4DV4Q 3KOJA 5JAVA 2K28A 1N34L 4KKUA 1UEAB 4ID6A 3IKJA 1X65A 5DAUA 5IYDG 4X65L 1B9MA 1HJPA 3Q8DA 1Q8KA 3RLFA 3F8TA 4FF4A 2BE5C 2K50A 1TWHB 3K0XA 3Q0AA 3P7JA 2OXPA 4FP5D 4BBRB 1F9SA 2NVXB 1D7QA 2RDGA 2SDFA 1JE4A 4OIKA 4L5QA 2E2HH 2DUDA 1E1TA 1YBYA 3BDOA 4Y7NB 4A3EH 1EWIA 1G6ZA 1EY7A 2AHOB 3NQIA 5M3FG 3VR3A 5EPLA 2ZM6Q 1VQEA 1B3AA 3K5OA 3RZDB 5M9OA 1UAPA 2EQSA 1N8RC 3D0FA 4M8AA 2B63G 2EYFA 1KXLA 1SNDA 3Q23A 3DEOA 4G4KA 3CP0A 3TEHB 1EEID 1NMGA 1VQHA 3FKIB 1J9OA 1YEZA 2ALYB 2XN9C 3R3OA 4K8JA 5I6YA 4R1JA 3SGIA 3CF5A 1Z7TA 2K5WA 1UE6A 4XXEA 1SYBA 3JC66 2NVQH 1NNXA 3L7ZC 5IP9H 1HR0Q 2L15A 1PH2A 1QNKA 4L8JA 1CA6A 3MEFA 3DWAA 2E5LQ 1OO9B 4C2MB 1N34Q 1HTPA 2F1MA 2QCPX 4OWWB 3HOYH 3S17B 1Y8NB 4Z9CB 2QDLA 4LF8Q 5JVG3 1M90C 1ZYRD 3NUCA 2NZOA 1AEXA 3A5UA 1D6EC 2P5ZX 4JBWA 3WOEA 3QB3A 3L2PA 4DXGA 1CUKA 1CQVA 4GN4B 1DOMA 3KF8A 3GTOB 3AFPA 1A8VA 5GROA 4G7OC 1HZBA 3NENA 1CQFA 2BOSA 1JICA 2KUMA 4DV5L 1Q1EA 4F87A 2O5JC 2C5CA 3HGBA 1IW7C 1TIID 1EQTA 4AH6A 4B3ML 1MIUA 3H15A 5IYBG 4NW2A 2F0IA 4LUVA 1KC8C 4RCNA 5IT9E 5FO9B 1RODA 3IL8A 1UUPA 3TP5A 3SR1A 4BXXG 2Q2UA 5IYCH 2HIVA 1LT4D 2NUCA 3S2HB 4YCUA 1RD9D 1STHA 3DUZA 4A93H 2D62A 3CW2C 1YHAA 3H0GH 4XQJA 2AQ1B 1MGSA 2JN4A 1VQ4A 5LL6X 2SEBD 1AZQA 4CJ2C 4HEDA 1AZPA 2AUKA 4UAIA 1AP0A 4HN7A 4A3IH 4GNXC 1D1IA 3GD7A 1K8OA 5C0XI 4L5SA 3PO3G 2OWOA 3PO2H 5KYLA 3J80L 2UUCQ 1D5XC 4ME3A 4PZ8A 3CAMA 1I4RA 1NR4A 3C1EA 2WV6D 5C4XH 1ML0D 1QCBD 5C4HA 4RFBA 4XTCS 2R93H 4I7ZC 1P16A 4H02A 2K05A 3KDFB 3KLWA 3ULPA 5IGCA 3CQZH 3MHBA 3WOFA 4K8IA 3ER0A 4A3LG 4JPBW 2ICIA 2E2IH 3U9SA 3RR5A 4J15A 1PH6A 1SYFA 5IGEA 1GKHA 1FNVA 5C4JH 2DNCA 4GOPC 4A3FH 5FLMG 2GN5A 1HNWL 1LACA 5K36G 1YITA 1TR5A 2VUMG 3F1ZA 5C3XA 4IO9A 1GOZA 2RHSB 3A56A 1KDBA 5ELFA 3S16B 4DAYA 5ISRA 1BBXC 4CBVA 3S1MH 4ULLA 4IOCA 1Y1WB 4L5TA 1TY0A 5LMNW 3KFUA 5ELEA 4P73A 2VW9A 3S14H 3HKSA 1XPUA 1PRTD 1U4MA 1VCIA 3PQIA 4LF4Q 1KHIA 2H1EA 1Y8OB 3ONAB 1UWVA 4IFDI 1OXUA 1SYCA 1KDCA 1WTRA 1U5KA 4AYBB 4YCVA 3K5NA 1IHZA 4DNIA 3PUYA 3TP6A 1EYGA 4RG1A 3V96A 4C3IB 1EOTA 5CMDA 2JP1A 2KBNA 4IUVA 4K5XA 2JE6I 5DLQE 5EGTA 1B44D 4K5WA 4CDEC 3E0EA 4A3MG 1BBUA 1OTCA 3I3CA 5FO8B 4FXGC 4C3HB 2H4OA 2V4DA 1VQPA 3CCSA 1STYA 3FPUB 1L1OA 5CV5A 1I4HA 1EOVA 1XMOL 4V190 1I3QH 4MNOA 2OTJA 1ICWA 3GQBA 4NXNL 4O2DA 1XMQL 1IYJB 2LXKA 3A74A 2L12A 4NXML 5A35A 1JR0D 1JWUD 2ID0A 2G9DA 5ELNA 2D5DA 3CRLC 1FGBD 1TWAB 3W1BA 2LS01 5EJWA 3MXUA 4IZ8A 1PFNA 5GAGC 1IBML 3EROA 2PQAA 4DR2L 2J4XA 1YNJC 1KLUD 1V1PB 1K8MA 4XT1B 4PNYA 5IGBA 2B2VA 2PMZE 3DEPA 3VYRA 3I4LA 1MBYA 3S1NH 1VMPA 4UP9A 1TS2A 2I5MX 5C44H 1DXMA 2ZXPA 2PZTA 1PTOH 4DV0Q 3GV3A 3NSWA 3JAML 3RNUA 1K8AC 3UE1A 2CW0D 1WTQA 4RGOS 5HGQA 4NKLA 1B1ZA 1VQBA 3I70A 3NWSA 5D3IB 2MNAA 1JB3A 4ZUIA 2E2JB 3I8ZA 4FF2A 1OXVA 3S1RB 4XQQA 3E5SA 5ELOA 3QR8A 1IL2A 5IYDH 1G51A 4POGA 3S15H 3KF6A 4K6DA 1CM9A 3NBHB 3EN2A 4HCSA 1HCZA 3ERQA 2G5DA 3NHHA 1EYDA 2DN8A 5G3LD 5JOBA 1V8QA 5JJZA 2L1BA 4OO1G 4RKLA 4NXNQ 1STEA 2BH8A 2XVSA 1XMQQ 1EZ8A 3I4NB 1GUNA 1ET9A 3EBEA 1T5EA 2UU9L 3S2DB 4LNQA 4U673 1SMXA 5M3FH 2QGQA 4FF1A 5JJKA 1E24A 1F9RA 2VL6A 5AJ3L 4DV2L 4A3DG 3T1YL 4XDXA 3GTMH 3F2BA 4DR3L 2EY1A 4QB4A 4QY7A 2B63H 4JV5Q 1W3SA 4NMZA 3J80c 1BVSA 2R6GA 2IWHA 4JI7L 1PFSA 4JI5L 5CORA 1JJ2A 1AH9A 4A3CG 1EWCA 2DJGC 1CKMA 3BDLA 3K57A 1KNEA 3OMCA 5EBCA 3KUPA 1C48A 1VDZA 1RL2A 2PW7A 1S5FD 2UUAL 2KCNA 4C3JB 3SK5A 2O2LD 5BR8Q 1EFID 4ME5A 1SMYC 3M3YB 2CH4A 5K5PA 2R3ZA 1HFNA 1WTVA 4DK1A 3A55A 3KDFA 1LTAD 1AE3A 1S4ZA 4A3GG 2WKDA 4BBRG 2FXQA 1B70B 2WAQE 1K83H 4CDCC 1WJJA 2PQEA 1B7YB 1YNND 4GKJL 1IL8A 4KKSA 5C3EG 5EAYA 4DR1Q 3DM1A 3SK8A 1Y1VB 2RBMA 5EKLA 3TREA 4G57A 2HHHL 2WFWA 2F52A 2UU9Q 2LFNA 1DCZA 3K80C 1BNZA 2A1AA 3I72A 3RN2A 4KHVA 2MQHA 4RAUC 2NWGA 1YVCA 5AJ3Q 4DV2Q 4R9WA 3T1YQ 3FKIG 4WORA 4J6HA 3RZOH 2XWBB 5IYBH 5I4DA 3HOUB 2RHQB 3TBIB 4C56C 2DJFC 4JI4Q 2VY3A 2WP8J 3H3VI 1F2MA 1EZ6A 3AQQA 4JI5Q 4MN3A 1PYWD 4JYAQ 3KLRA 1Q90A 1NBWA 1Y69U 4BXXH 3VR2A 1RIPA 3GTKH 1F2ZA 2RSNA 1VF5C 3A0JA 1II3A 3UDGA 1EQRA 1H9JA 1OXSC 3CC4A 2CQOA 2NVYH 4C1NI 2UUAQ 3E6ZX 1TWCH 2MHVA 4YWKA 1ESRA 1NAPA 2F3VA 4JBMA 4X3UA 2B3GA 3B6YA 3HEJA 3NELA 3M4QA 1FNWA 1KABA 2XSCA 5M5YH 3CD6A 1PVOA 3PO3H 1N33L 2K33A 2LXJA 1A3UA 1K3RA 2K1BA 4HMIA 3OW2A 5CV8A 3M4OH 2RVLA 1SE4A 4GKJQ 4GLAC 4EX5A 3GDEA 2ICEC 4JI6L 2E75C 3PUXA 1M1KC 2E74C 4F7XA 3VA5A 2MP1A 2NTSA 1WYDA 4TKOB 2M00A 2JK8A 4NPSA 1NTGA 2EXDA 3E9IA 4A3LH 4BY7G 1NUCA 3S1QH 1CFMA 3OYYA 5M5WH 1FJGL 3PCOB 1BCPD 1PYSB 2EYOA 4DV7L 4HJ5A 4F8MA 4X66Q 2F0UA 3LWUA 1S5DD 3JAMc 3QOLA 4DUZL 3G7LA 4HAEA 2OQKA 1CT1D 1V1PA 2KCTA 4FXKC 4ZKBB 5JPMC 5FLMH 1AFPA 4OONA 5K36H 5FOBB 1F77A 2VUMH 2QDBA 1W6JA 2IL8A 2NN6G 2Z1CA 4X62L 4DV4L 1WD1A 4DK3C 1QNUA 3QWNA 4GLVB 1PXUA 1O80A 2NN6I 4CKBA 1HZ9A 2A68D 4A3KB 5BN4A 2XRSD 3K5MA 3Q6SA 1GUTA 2EOTA 1Q46A 3CXCA 1Q7YC 2L5TA 5IODA 4KHPL 2RCFA 1ESFA 2ENBA 3PIOA 2PZUA 2WB1B 1O7LA 4A3EB 3V05A 1HRJA 5CV9A 1UNSA 5COYA 1N33Q 4XT3B 1B53A 4HMJA 1ASYA 1EYCA 5KNBA 3TN2A 3VYSA 1X9NA 2ES2A 2ZM6L 1SROA 2H5XA 1J8IA 3RMHA 3J7A5 4HIOA 4JI6Q 1EFWA 3FEWX 3N6RA 3SEBA 5C6AA 1TKWB 5HGTA 3HOXG 4A3MH 1EQVA 3STBD 3GTPH 1U4PA 1K9MC 5FJ8G 1VQDA 5E3FA 1FYCA 4DV7Q 2NVQB 1JOOA 1EY0A 2JA7G 1SE3A 2NVTH 3CRKC 4FO2A 1SJHD 4X64L 2AWOA 4DUZQ 4XYOA 1HR0L 4CJ1B 3BDCA 4CJ0B 3EIVA 1Y1WG 2XWJB 1X3EA 2JQOA 4FXDA 3HOYB 2QEXA 4X62Q 3HOZH 2E5LL 1U0LA 4QGUA 2FFKB 3BVMA 1GUWA 2NBFA 2Q2TA 4LF8L 1TS5A 1TVXA 1GUSA 1I50B 1M8AA 2GA4B 3HOWG 2BE5D 1H95A 5L37A 1D1KA 3I4MB 1PH9A 2CQAA 3CCQA 1XTCD 3PUZA 4YWLA 4KHPQ 2JA8G 1WTOA 5HY6A 4C3IG 2IHEA 1IKLA 1N32Q 2YU9H 4IJLA 5LMUL 4HJ7A 3U50C 1OXTA 2N3SA 3T13A 5LHY1 2KHJA 2X6GA 3HOVG 1A3VA 3CCMA 2L4NA 3AMUA 1CKOA 4HJ8A 1XNQQ 1L1OB 4IJHA 1L1OC 4FDBA 2BCOA 3Q22A 4OL7A 2IT1A 4K5VA 1J5EL 1E2ZA 1CI3M 4HR7B 1A6XA 1X3PA 1ICFB 2B8FA 4KY7A 3H3VC 2CFMA 2LMCB 3I55A 2AUJD 1A62A 4A93B 3SE0A 1JWMD 2KHIA 1LT5D 2Z4HA 3H0GB 3NQTA 4OO1H 2Q2HA 4PZ7A 4X64Q 2PQAB 4WRDA 5JPNC 2K04A 3ITPA 3UE0A 3I4OA 2O5IC 4DA2A 3ICEA 5EKIA 4A3IB 2B2VC 2KEDA 4ZYSA 1F9PA 2Y0SE 2SNMA 4A3DH 3OSOA 5KNDA 4KD4A 1DOLA 1H9SB 1E1OA 2F0LA 1EL0A 2UUCL 2LKVA 4EQOA 4N9TA 3MEHA 2IY5B 5A2QL 1GHJA 4EQPA 2VS1A 1JT8A 1SNOA 4U68A 4A3CH 3CQZB 2PYKA 1RKNA 1QZGA 2E2IB 4LW1A 3CCJA 2FJ2A 4DAVA 5LMUQ 1G8ZD 4JG2A 1X6OA 2Z6BA 3HS0C 3KF6B 4LFBQ 4X3SA 1X54A 4LMQD 5C4JB 1TWFB 3J81L 4A3FB 2K6AA 4L5RC 4N8X1 3M85A 1TWGB 1J5EQ 2ZT9C 5M5XH 3R8BA 2N88A 3Q24A 4A3GH 1ILQA 4BBRH 1Q81C 2Y0SG 4KHZA 2NVXH 2J7ZA 4RGTA 2JA5G 1VQ5A 5I6WA 3S1MB 1B2TA 4ILWA 5C3EH 1DYQA 3K0YA 3S14B 3MFYA 4DKAC 1SLJA 2YV5A 3NBIA 1WTPA 1D8LA 3T53B 4RHSA 1JJCB 3NK9A 5EPJA 4DV6L 3G71A 2F0GA 2NYZD 4OWXB 2TMPA 2IJ0A 2N8NA 3KBXA 1GJXA 4LF4L 5C0XG 2F0MA 4PMBA 2E76C 1VQ8A 1M4VA 2F0WA 4R4OA 3NXWA 1CHPD 3FKIH 2BDOA 3PSIA 3KJPA 2PNRC 5KEEA 3EA6A 4MZ9A 5M3MG 3A8IE 4JOIA 2A6ED 1PA6A 4C3JG 3A8KE 2HDMA 3GV6A 3ULJA 5FLXc 3HKZE 3I73A 1BO0A 4WFN3 2K5QA 1PZID 1VQNA 1S5BD 3OMGA 3NTKA 4C2MH 1I3QB 2MFIA 3A8JE 3S17H 1B4OA 1KRSA 3J81i 1E22A 4DNTB 1A2TA 3A7LA 2EJFC 1ASZA 4DUYQ 1C4QA 4B08A 4LUZA 4EQ5A 2IPKD 3ZYYX 1Y1VG 1PTOD 1HNXQ 5EBDA 4UDUC 3OIPA 1P8LA 2JA6G 1A2UA 4I65A 2NTTA 3FVQA 1JB7A 2PO4A 2EYJA 1L2FA 3U58A 1STBA 3C3LA 1KQSA 3NP8A 4DV6Q 1B9NA 1UEBA 3E9HA 3S1NB 4IFDG 4K0KL 4BY7H 3HKZG 5C44B 4QIWE 1V43A 3TS2A 3H6MA 3BYTB 1SXTA 1JOQA 2CWPA 1HHVA 1GO3E 1PH4A 1SFOB 4DV0L 3VR5A 3UI2A 3MXNA 4FYDA 5E7NA 2A73B 1NMFA 3J7ZC 1BXTA 3PIP3 1U4LA 4RGNA 5ELDA 2QF7A 2NB0A 2BA1A 1UE5A 2B2UA 2EYHA 1PRTB 1PRTC 2LY7A 4NDXA 2NN6H 5D65A 3D31A 1TY2A 4A3BG 3S15B 2QW7A 3BVZA 2HCCA 5GADC 1IBKQ 1SSOA 2Z0SA 4ZK9B 4ALPA 2M2LA 2C9OA 4LFAL 1SNQA 2VNUD 2ZXOA 2L11A 1XNRL 4DK6C 1LABA 4DV1L 3M7GA 1STGA 2ZTEA 2F0SA 2MGSA 2KHSA 5J39A 1ZKOA 4J1MA 5D3DA 4HSVA 4MHEA 2B2YC 3GTMB 3KYHC 2R92G 4DR5L 1GUGA 1GXDC 4LF7Q 1V9PA 4DFAA 4HIMA 2B2WC 4JV5L 2X69A 1FNUA 4KD3A 3HOXH 3K58A 2O4XA 4JK1C 1WTXA 2OT2A 1N36L 2A74C 4K0KQ 1E2VA 4JC0A 5FJ8H 3QIAA 1BR9A 3FMCA 3H91A 2RA4A 4I7AA 3GTQB 1NR2A 5ELBA 1S72A 1KL9A 1H9SA 2CCZA 4K2KA 1RCVD 2JA7H 2VB2X 2I07B 5E4XA 1SE8A 3NE5B 4A4IA 4BBSB 5JVH3 1X55A 4LWCA 5IE8A 5BR8L 3M9BA 5CV7A 1PV4A 2I0QA 1Y1WH 4OXPA 4OX9Q 4L63B 4LF5L 3KK7A 4FVMA 4JI1Q 1BDOA 1F9QA 4LJZC 4A3KG 1AN8A 3OWEB 1QE6A 3K7UC 1KIXA 1NY4A 1ET6A 1MJCA 2AMCB 1L0YB 4FNFA 1K3BC 1TU2B 2RSOA 3OW7A 3HOWH 4LFAQ 1KRTA 4A3JB 2CW0C 4R8IA 1XNRQ 4DR1L 2JA8H 4DV1Q 2CKZB 2EY5A 3E0JA 4C3IH 5KRUA 1PH1A 2YYZA 4GKKQ 3V2TA 5FLXE 1C8CA 2MO1A 4PMWA 3HOVH 3H94A 4TSSA 2XTIA 4DV3Q 3RZOB 5BN5A 4DR5Q 5J22A 2FHTA 2KQ3A 2GVBA 1D5ZC 3HZXA 2M9VA 5IT9L 1ILPA 4UP7A 4JI4L 4YWMA 4N8FA 4RKBA 1N36Q 2WIIB 2R7ZG 3GTKB 4JYAL 4GS3A 5E4WC 2ZTCA 5EPKA 2KVMA 1PHJA 4Y52H 4DAPA 1BQQT 3IRBA 4LK1C 4GLXA 2NVYB 3KJOA 3PMFA 1TWCB 2AWNA 4QUFA 4B3RL 4G7HC 3EFXD 4CDDC 2K01A 1C7YA 1SMYD 1WCMB 2HD3A 1XJVA 2B29A 4LF5Q 5AFWA 4ABNA 1G91A 2RDFA 3OTOL 4DAMA 3PO3B 2A8VA 3I4MG 2HCIA 1YHQA 4WJ4A 4GNXA 1WI5A 2A6HD 3X3MA 1Y8PB 4IALA 3M4OB 2D2CC 1SN8A 3HP3A 3P20A 5EQ0A 1YJWA
chains in the Genus database with same CATH topology
4V0BA 1D2BA 2A5HA 2PPBC 1LO5D 3URYA 1SBBB 3U9OA 5IOCA 3SK4A 4E6IA 3S1QB 3MVVA 2WACA 4K2LA 2F03A 1AW7A 1YNNC 4F88A 2CVRA 3TZUA 1PZKD 1RJTA 2JXMB 3VYTA 3J7AV 1EIGA 2B8GA 3EVQA 3GTGB 5I9PA 4BY1B 4N9PA 2N55A 1QJOA 5CBAE 1F2YA 1Q8IA 1CHQD 4K6LA 1SYDA 2EYLA 3NWTA 5C0XH 1EY8A 2XIWA 1PFBA 5IIFA 4DXFA 4KJNA 3GTJB 1SAPA 1EY9A 3DMUA 4O42A 2L9HA 4A3MB 1G291 4LAAA 2MUYA 5HURA 4DU9A 3N52A 5DNFA 4ZAIA 2SOBA 3HOZB 4OGQC 4IUNA 3IFTA 1RTOA 2NZ1D 1BCPB 1LTID 1BCPC 4EVOA 2HQEA 3TMEA 5ELCA 4IFDH 1MI2A 3J80E 2PCFB 2A69D 3T51B 1LV9A 1OXXK 1CTMA 3FPPA 3K5LA 2F0NA 2YU9B 1ENCA 2E2HB 1T5XD 3ND8A 3VA7A 3SDZA 1B50A 3M7NA 5T1GA 1BOSA 3R2IA 3K6OA 4Q5VA 1EY6A 1CZGA 4RH6A 2PZWA 2A68C 4X3TA 4QMGA 3C46A 4R8NA 5C4ZA 1TQOA 2F0FA 3A7AB 1EU3A 2AQ3B 3MAQA 1DJRD 2IX0A 2EJMA 1I4XA 3FRPB 2PMZB 1QG7A 1STAA 2AQ2B 1DM0B 4CKCA 4XQNA 1ZXTA 4DGZA 3PV0A 1JQYD 3O13A 2OF1A 3TZDA 5FO7B 4XIGS 3AB9A 3FDTA 4IUUA 5KGUA 2EJGC 3OIQA 2FINB 4CHTB 3LX0A 1BCPF 1HTLD 2F0PA 4TQUS 3D4RA 3CU7A 4BA1I 1TS3A 4C3HG 4KN4C 5M5XB 4A3GB 3L9AX 2B2TA 1JWSD 3LWEA 5C3EB 2XNAC 4EGVA 2F0TA 1D5MC 4RWSC 5JEAG 2CHBD 1WTWA 3MC0B 3R2TA 2SNSA 2HUGA 1KTKA 5KYIA 2JEBI 2L0CA 1HUMA 3PO2B 1A15A 1F2LA 1X32A 2BDNA 3QG1A 4YIJA 5C4XB 1EWHA 5CV6A 3JAME 2R93B 1V1OA 4DK0A 3D4DA 2WAQB 3R93A 5C0XJ 1XWEA 3X3NA 2E2DC 3P75A 4FF3A 4HSPA 3GO5A 4KK7A 1U9RA 3T4AC 4P2CB 1IW7D 1G2TA 1H9KA 1ZYRC 2BA0A 2FMMA 4B9WA 3C1FA 1QILA 3MXGA 2JSOA 1SNPA 4IN3A 3QO2A 1EY4A 3HG9A 1QWYA 3AU7A 2EDGA 4KN7C 2RQXA 5C5MA 3NTIA 5KIXA 1Z6HA 4BY7B 3SXHA 1H9RA 3QJYA 1HQMC 2QILA 1HQRD 3SHLA 4IQZA 3C2PA 2EE1A 1HA6A 4DF7A 2X6LA 2QKIC 4DNRB 5C5LA 1MSGA 1PZJD 5F2DA 1IYUA 2EY6A 3MXPA 3HRZC 4CKEA 1LTRD 4IFDJ 1O7YA 5CR3A 2K5DA 4H44C 1XX8A 2EYMA 1LTSD 4RGMA 2F0EA 1L0XB 5I9OA 3MTSA 3F2UA 4HTHA 2A6EC 2F0QA 1SJED 5CV4A 1GHKA 5CYUA 2RKSA 4KTAA 2Z4IA 1DONA 1SNCA 2J0TD 4PQXA 4IURA 4H13C 1Q3LA 1ZEQX 3ND9A 1EIHA 1MD2D 5LL6S 3MFGA 4MIUA 3T56B 3HOXB 1KLGD 2WINB 1TT2A 2R61A 2F0OA 2EY2A 2WKCA 3A54A 1ENFA 1SDFA 1PTOB 2JA7B 5FKAC 1PTOC 1SNMA 1RDPD 3OPOA 4ZLTF 4NP5A 1LT6D 3M4YA 2DY7A 2ZXRA 4G7ZC 2Q8RE 1LT3D 3HOWB 1GUOA 3D6WA 3DWPA 1PMRA 3K59A 2JA8B 1EU4A 3D3RA 1NCVA 2Q8IB 1XYIA 3HOVB 4ZRZA 1KAAA 5M3FB 2OEOA 1PFMA 5J1ZA 3T16A 1DOKA 2FMCA 5IGFA 1NSNS 5T1IA 2B63B 1HA5A 1YNJD 1R4PB 3MWYW 3DXJC 3W3AA 4O1NA 1DZ1A 2QEJC 2EZVA 1LTGD 4L6TB 2EYPA 5KNCA 4GZYC 3S9WA 4ODGA 1BUVT 3TSSA 1QB5D 1PTOF 2KJXA 1K83B 1JOKA 3PUVA 2D9UA 2F3WA 3BYYB 4RA8A 4TRDA 5TSSA 2TSSA 1JC7A 3MA2B 2VB3X 3L3OC 1PRTF 2F0DA 1FR3A 3VR4A 1JCKB 2JEAI 5D14A 1VF7A 4IUQA 1ONLA 1EY5A 4KJOA 1KDAA 4OHJA 5DM73 1I6HB 3J7YW 1I4PA 2EPBA 2Y0SB 2EXZA 4KY5A 2JA5B 4DN4M 5I2YA 2G9HD 3CHBD 1HUNA 4OO1I 4XYQA 1S5CD 3NPPA 5JEAH 2KEEA 3TP8A 3IFDA 5CGKA 4BWGB 1DD2A 3BVGA 3EJIA 4KI0A 3OHXC 2K32A 1MSHA 5M5YB 3RD4A 4B9XA 4OIJA 1LTTD 5M3MB 1Q12A 2F0KA 1TS4A 4IUPA 1ENAA 1KNAA 1RHPA 3PUWA 1H9MA 3G6JB 3SK6A 3I90A 3OOCA 5M5WB 1HXYD 3J7AF 3D4WA 4KV6A 2A6HC 1I4QA 2B2TC 1RTNA 2VXWA 2JYOA 2Z8LA 5BN3A 5C3WA 1O7ZA 1Z47A 2VUMB 2F4IA 2JA6B 1CZWA 3VR6A 3P1HA 1G2SA 1R9TB 4BS9A 2I46A 3KLSX 3QOJA 1RF2D 1E2WA 5G3LF 1CA5A 1IKMA 2KOLA 3HKZB 3KLSA 1SYEA 1O78A 2IW3A 2MPMA 3K7AB 4RHRA 2K03A 2XRQD 5A2QE 3I91A 5IGDA 1PLFA 3GP7A 3SVMA 4WJWA 4PMCA 1EEFD 1STNA 4PV1C 2Q8TA 5E1FA 4M1UB 5DM63 3TDQA 4A3BB 2L55A 2PW5A 3GTPB 1QOHA 3J81E 1U4RA 3BZDB 4KY6A 4C1NK 1VMCA 1I6VC 3LNNA 2DY8A 3DWQA 2NVTB 4K14A 3BS1A 4BA2I 1SYGA 1XXGA 4S3SA 4QIWB 2KA7A 4QUCA 4H7BA 5NUCA 2R92B 3IAYA 4KKTA 4Q0FA 3DHQA 2B2YA 1HFGA 2RDHA 5CC4A 4HCEA 3D6CA 3OWFA 4EQNA 2B2WA 3NTHA 4ZKCB 3VYUA 3W2DA 5FK9C 3H09A 4QF4A 4H0LC 4ZQ3A 3KBGA 4QCLA 1W6KA 1BF4A 4CGYB 3D8GA 3TP7A 1HPCA 1FD7D 5EKKA 1PDQA 3WDNA 1A3TA 3RUZA 1E0BA 2B39A 1I4GA 3MZ5A 4RCOA 5DEHA 2A69C 5I2XA 1SEBD 4J8QA 1WVLA 1SE2A 3GTLB 2IX3A 2EVBA 1WD0A 2KCCA 3EQLC 3NBHA 3BG3A 5IGGA 5FLXL 3PIO3 2F0HA 2K7VA 1X3QA 1LLRD 2MJ8A 4A3DB 4KMUC 4IUTA 4ZUJA 1R4QB 1IYVA 5JEAJ 2IX1A 5CBEE 2F0VA 1JORA 2R7ZB 1LTBD 2HDLA 1Q1BA 1CK1A 3CKIB 1S5ED 2B2UC 2DNEA 2F0JA 2KECA 4X3KA 1EYAA 5JAVA 2K28A 4KKUA 1UEAB 4ID6A 3IKJA 5DAUA 1B9MA 3RLFA 4FF4A 2BE5C 1TWHB 3Q0AA 3P7JA 2OXPA 4FP5D 4BBRB 1F9SA 2NVXB 2RDGA 2SDFA 1JE4A 4OIKA 3BDOA 4Y7NB 1G6ZA 1EY7A 3NQIA 3VR3A 5EPLA 1B3AA 3K5OA 3RZDB 5M9OA 1UAPA 4M8AA 2EYFA 1SNDA 3Q23A 3DEOA 4G4KA 1EEID 1J9OA 3FKIB 2XN9C 3R3OA 4K8JA 5I6YA 1Z7TA 2K5WA 4XXEA 1SYBA 3L7ZC 1QNKA 4L8JA 1CA6A 3DWAA 1OO9B 4C2MB 1HTPA 2F1MA 2QCPX 3S17B 1Y8NB 4Z9CB 5JVG3 1ZYRD 3NUCA 1AEXA 1D6EC 4JBWA 3WOEA 3QB3A 4DXGA 1CQVA 1DOMA 3KF8A 3GTOB 4G7OC 1CQFA 2BOSA 1JICA 2KUMA 1Q1EA 4F87A 2O5JC 2C5CA 3HGBA 1IW7C 1TIID 1EQTA 4NW2A 2F0IA 4RCNA 5IT9E 5FO9B 1RODA 3IL8A 1UUPA 3TP5A 3SR1A 1LT4D 2NUCA 3S2HB 1RD9D 1STHA 3DUZA 2D62A 4XQJA 2AQ1B 1MGSA 5LL6X 2SEBD 1AZQA 4CJ2C 4HEDA 1AZPA 2AUKA 4UAIA 1AP0A 4HN7A 1D1IA 3GD7A 1K8OA 5C0XI 5KYLA 3J80L 1D5XC 1I4RA 1NR4A 3C1EA 2WV6D 1ML0D 1QCBD 5C4HA 4RFBA 4XTCS 4I7ZC 2K05A 5IGCA 3MHBA 3WOFA 4K8IA 2ICIA 3U9SA 1SYFA 5IGEA 1FNVA 2DNCA 1LACA 5K36G 1TR5A 5C3XA 1GOZA 5ELFA 3A56A 1KDBA 3S16B 4DAYA 5ISRA 1BBXC 4CBVA 4ULLA 1Y1WB 1TY0A 5ELEA 1PRTD 1U4MA 1VCIA 2H1EA 1Y8OB 3ONAB 4IFDI 1OXUA 1SYCA 1KDCA 1WTRA 4AYBB 3K5NA 1IHZA 3PUYA 3TP6A 4C3IB 3V96A 1EOTA 5CMDA 2JP1A 4IUVA 4K5XA 2JE6I 5EGTA 1B44D 4K5WA 3I3CA 5FO8B 4FXGC 4C3HB 2H4OA 2V4DA 1STYA 3FPUB 5CV5A 1I4HA 4V190 1ICWA 3GQBA 2L12A 5A35A 1JR0D 1JWUD 2ID0A 2G9DA 2D5DA 3CRLC 1FGBD 1TWAB 2LS01 5EJWA 3MXUA 4IZ8A 1PFNA 3EROA 2J4XA 1YNJC 1KLUD 1V1PB 1K8MA 4XT1B 5IGBA 4PNYA 2B2VA 3DEPA 3VYRA 3I4LA 1MBYA 1VMPA 1TS2A 1DXMA 2ZXPA 2PZTA 1PTOH 3GV3A 3NSWA 3JAML 2CW0D 1WTQA 4RGOS 4NKLA 1B1ZA 3I70A 3NWSA 5D3IB 1JB3A 4ZUIA 2E2JB 3I8ZA 4FF2A 1OXVA 3S1RB 4XQQA 3E5SA 4K6DA 1CM9A 4HCSA 1HCZA 3ERQA 3NHHA 1EYDA 2DN8A 5G3LD 5JOBA 1V8QA 5JJZA 2L1BA 4OO1G 4RKLA 1STEA 2XVSA 3I4NB 1EZ8A 1GUNA 1ET9A 3S2DB 1T5EA 4U673 4FF1A 1F9RA 4XDXA 2EY1A 4QB4A 4NMZA 2IWHA 2R6GA 5CORA 1EWCA 3BDLA 3K57A 1KNEA 3OMCA 5EBCA 3KUPA 1C48A 1VDZA 2PW7A 1S5FD 2KCNA 4C3JB 3SK5A 2O2LD 1EFID 4ME5A 1SMYC 3M3YB 5K5PA 2R3ZA 1HFNA 1WTVA 4DK1A 3A55A 1LTAD 1S4ZA 2WKDA 2PQEA 1YNND 1IL8A 4KKSA 3DM1A 3SK8A 1Y1VB 2RBMA 5EKLA 4G57A 2LFNA 1DCZA 1BNZA 3I72A 4KHVA 4RAUC 2NWGA 4R9WA 4WORA 4J6HA 2XWBB 5I4DA 3HOUB 3TBIB 4C56C 2WP8J 1F2MA 1EZ6A 4MN3A 1PYWD 3KLRA 1Q90A 1Y69U 3VR2A 1F2ZA 2RSNA 1VF5C 1II3A 1H9JA 1OXSC 4C1NI 3E6ZX 2MHVA 1ESRA 1NAPA 2F3VA 4X3UA 3HEJA 1FNWA 1KABA 2XSCA 2K33A 1A3UA 2K1BA 4HMIA 5CV8A 2RVLA 1SE4A 2ICEC 2E75C 3PUXA 2E74C 4F7XA 3VA5A 2MP1A 2NTSA 4TKOB 2M00A 1NUCA 1CFMA 1BCPD 2EYOA 4F8MA 2F0UA 3LWUA 1S5DD 3QOLA 3G7LA 4HAEA 1CT1D 1V1PA 4FXKC 4ZKBB 5JPMC 1AFPA 5K36H 5FOBB 1F77A 2QDBA 1W6JA 2IL8A 2NN6G 2Z1CA 1WD1A 1QNUA 3QWNA 1PXUA 1O80A 2NN6I 4CKBA 2A68D 4A3KB 5BN4A 2XRSD 3K5MA 3Q6SA 1GUTA 2EOTA 2L5TA 5IODA 1ESFA 2ENBA 4A3EB 2PZUA 2WB1B 1O7LA 3V05A 1HRJA 5CV9A 1UNSA 5COYA 4XT3B 1B53A 4HMJA 1EYCA 5KNBA 3TN2A 3VYSA 1J8IA 3RMHA 3FEWX 3N6RA 3SEBA 5C6AA 1TKWB 5HGTA 1EQVA 1U4PA 5E3FA 1FYCA 2NVQB 1JOOA 1EY0A 1SE3A 3CRKC 4FO2A 1SJHD 2AWOA 4XYOA 4CJ1B 3BDCA 4CJ0B 2XWJB 4FXDA 3HOYB 2FFKB 3BVMA 1GUWA 2NBFA 1TS5A 1TVXA 1GUSA 1I50B 1M8AA 2GA4B 2BE5D 1D1KA 3I4MB 2CQAA 1XTCD 3PUZA 1WTOA 4C3IG 1IKLA 1OXTA 3T13A 5LHY1 2X6GA 1A3VA 3AMUA 2L4NA 2BCOA 3Q22A 4OL7A 2IT1A 4K5VA 1E2ZA 1CI3M 4HR7B 1A6XA 1X3PA 2B8FA 4KY7A 3H3VC 2LMCB 2AUJD 4A93B 3SE0A 1JWMD 1LT5D 2Z4HA 3H0GB 3NQTA 4OO1H 4WRDA 5JPNC 2K04A 3ITPA 2O5IC 4DA2A 5EKIA 4A3IB 2B2VC 2KEDA 4ZYSA 1F9PA 2SNMA 3OSOA 5KNDA 4KD4A 1DOLA 1H9SB 2F0LA 1EL0A 2LKVA 4EQOA 4N9TA 3MEHA 5A2QL 1GHJA 4EQPA 1SNOA 4U68A 3CQZB 2PYKA 1RKNA 2E2IB 2FJ2A 4DAVA 1G8ZD 3HS0C 4X3SA 4LMQD 5C4JB 1TWFB 3J81L 4A3FB 2K6AA 3M85A 1TWGB 2ZT9C 3R8BA 2N88A 3Q24A 1ILQA 4KHZA 2J7ZA 4RGTA 5I6WA 3S1MB 1B2TA 4ILWA 1DYQA 3K0YA 3S14B 3MFYA 3NBIA 1WTPA 3T53B 4RHSA 3NK9A 5EPJA 2F0GA 2NYZD 2TMPA 2IJ0A 3KBXA 1GJXA 5C0XG 2F0MA 4PMBA 2E76C 1M4VA 2F0WA 3NXWA 1CHPD 2BDOA 2PNRC 5KEEA 3EA6A 3A8IE 2A6ED 4C3JG 3A8KE 2HDMA 3GV6A 3I73A 1BO0A 4WFN3 2K5QA 1PZID 1S5BD 3OMGA 3NTKA 1I3QB 3A8JE 1B4OA 4DNTB 1A2TA 3A7LA 2EJFC 1C4QA 4B08A 2IPKD 3ZYYX 1PTOD 5EBDA 4UDUC 3OIPA 1A2UA 4I65A 2NTTA 3FVQA 2PO4A 2EYJA 1STBA 3C3LA 3NP8A 1B9NA 4IFDG 3S1NB 5C44B 1V43A 3H6MA 3BYTB 1SXTA 1JOQA 1HHVA 1SFOB 3VR5A 3UI2A 3MXNA 4FYDA 2A73B 1BXTA 3PIP3 1U4LA 4RGNA 5ELDA 2QF7A 2NB0A 2BA1A 2B2UA 2EYHA 1PRTB 1PRTC 2LY7A 4NDXA 2NN6H 5D65A 3D31A 1TY2A 3S15B 3BVZA 2HCCA 1SSOA 4ZK9B 2M2LA 2C9OA 2VNUD 1SNQA 2ZXOA 2L11A 1LABA 3M7GA 1STGA 2F0SA 2MGSA 2KHSA 5J39A 1ZKOA 4J1MA 5D3DA 4HSVA 4MHEA 2B2YC 3GTMB 1GUGA 1GXDC 4DFAA 2B2WC 2X69A 1FNUA 4KD3A 3K58A 2O4XA 4JK1C 1WTXA 2OT2A 2A74C 1E2VA 3QIAA 1BR9A 3FMCA 3H91A 2RA4A 3GTQB 1NR2A 5ELBA 1H9SA 4K2KA 1RCVD 2VB2X 2I07B 5E4XA 3NE5B 4BBSB 5JVH3 5CV7A 4L63B 3KK7A 4FVMA 1BDOA 1F9QA 4LJZC 1AN8A 3OWEB 1QE6A 1ET6A 1L0YB 4FNFA 1TU2B 2RSOA 3OW7A 4A3JB 2CW0C 4R8IA 2EY5A 3E0JA 5KRUA 2YYZA 3V2TA 5FLXE 1C8CA 4PMWA 3H94A 4TSSA 3RZOB 5BN5A 5J22A 2FHTA 2KQ3A 1D5ZC 3HZXA 2M9VA 5IT9L 1ILPA 4RKBA 2WIIB 3GTKB 5E4WC 5EPKA 2KVMA 4DAPA 1BQQT 4LK1C 2NVYB 3PMFA 1TWCB 2AWNA 4QUFA 4G7HC 3EFXD 2K01A 1SMYD 1WCMB 5AFWA 4ABNA 1G91A 2RDFA 3PO3B 2HCIA 2A6HD 3X3MA 1Y8PB 4IALA 3M4OB 2D2CC 3HP3A 3P20A 5EQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYC A;  4DF7 A;  1F2M A;  3TP8 A;  1EZ6 A;  4KY6 A;  1KAA A;  5CGK A;  1A2T A;  2OEO A;  4K6D A;  5C5L A;  2SNM A;  5J1Z A;  3OSO A;  5F2D A;  3ERQ A;  4K2K A;  3EJI A;  3U9O A;  2HQE A;  3T16 A;  1F2Z A;  3NHH A;  2EY6 A;  1EYD A;  3SK4 A;  4KD4 A;  4E6I A;  3MXP A;  5C6A A;  5JOB A;  3MVV A;  3TME A;  5IGF A;  2F0J A;  1NSN S;  1SYC A;  1EYA A;  1II3 A;  4K14 A;  1KDC A;  4RKL A;  5HGT A;  1EQV A;  1SYG A;  2F0T A;  2F0L A;  1EZ8 A;  2WAC A;  4S3S A;  5CV7 A;  5JAV A;  2LKV A;  5CR3 A;  2F0I A;  4ID6 A;  4EQO A;  4B9X A;  2F0N A;  1IHZ A;  1ENC A;  3MEH A;  4N9T A;  5DAU A;  4EQP A;  4K2L A;  1A2U A;  1SNO A;  2F0K A;  4H7B A;  5NUC A;  3TP6 A;  2SNS A;  2F3V A;  4I65 A;  5E3F A;  3TP5 A;  5KYI A;  2PYK A;  2EYM A;  2EYJ A;  1JOO A;  1RKN A;  3DHQ A;  3HEJ A;  1EY0 A;  3SR1 A;  1ENA A;  1STB A;  5CC4 A;  3NP8 A;  2EYP A;  2NUC A;  2F0E A;  2EY1 A;  2OXP A;  3D6C A;  4K5X A;  1KAB A;  4QB4 A;  1EY6 A;  3OWF A;  1STH A;  5EGT A;  5I9O A;  4K5W A;  2PZW A;  4HTH A;  4NMZ A;  2F0Q A;  3BDC A;  1A3U A;  3SK6 A;  4EQN A;  4QMG A;  5CV4 A;  3H6M A;  4HMI A;  2RKS A;  4KTA A;  5CV8 A;  1SNC A;  4R8N A;  2EY5 A;  3D4W A;  1EY7 A;  4KV6 A;  1STY A;  3EVQ A;  4YIJ A;  5C4Z A;  5I9P A;  1TQO A;  4ODG A;  5IOC A;  5CV5 A;  5KRU A;  3S9W A;  2F0F A;  4N9P A;  4QF4 A;  5CV6 A;  3V2T A;  4ZQ3 A;  4F7X A;  3BDL A;  3OMC A;  3VA5 A;  3D4D A;  2M00 A;  1F2Y A;  5M9O A;  4MIU A;  1SYD A;  2EYL A;  2PW7 A;  1JOK A;  2EYF A;  3D8G A;  3TP7 A;  1SND A;  1EY8 A;  2F3W A;  2EYH A;  1NUC A;  2KQ3 A;  3P75 A;  3SK5 A;  5C3W A;  5EKK A;  5I6W A;  1TT2 A;  5KYL A;  5J22 A;  1A3T A;  3RUZ A;  4ME5 A;  4NDX A;  4TRD A;  2F0O A;  1STA A;  2EY2 A;  3HZX A;  3C1E A;  3MZ5 A;  5IIF A;  5K5P A;  2EYO A;  4KJN A;  1U9R A;  3R3O A;  4K8J A;  4IZ8 A;  5DEH A;  5C4H A;  5I6Y A;  3ERO A;  4F8M A;  3P1H A;  1EY9 A;  2F0U A;  4RKB A;  3DMU A;  2F0D A;  3QOJ A;  3NK9 A;  3QOL A;  4DGZ A;  1SNM A;  3T13 A;  1SNQ A;  5IGC A;  2F0G A;  1A3V A;  3MHB A;  4B9W A;  1SYB A;  2OF1 A;  3C1F A;  4K8I A;  2F0M A;  4PMB A;  4NP5 A;  2PQE A;  2F0W A;  1SYE A;  4PNY A;  5IGB A;  2QDB A;  3NXW A;  1SNP A;  4OL7 A;  1STG A;  3PMF A;  1EY5 A;  2F0S A;  4KJO A;  4LAA A;  1SYF A;  1EY4 A;  1KDA A;  2KHS A;  5IGE A;  5KGU A;  5J39 A;  4J1M A;  3SK8 A;  4K5V A;  2RBM A;  5EKL A;  5KEE A;  5IGG A;  2PZT A;  4G57 A;  5IGD A;  5HUR A;  4DU9 A;  2F0H A;  5C5M A;  4NKL A;  2RDF A;  3LX0 A;  4KY7 A;  5KIX A;  4KHV A;  2EXZ A;  4KY5 A;  1JOQ A;  3NUC A;  4EVO A;  5IOD A;  1TR5 A;  4ZUI A;  4DFA A;  2F0P A;  1AEX A;  4PMC A;  4ZUJ A;  3SXH A;  5C3X A;  1STN A;  2ENB A;  3NQT A;  2PZU A;  1KDB A;  4IAL A;  4J6H A;  4KD3 A;  4WOR A;  5ISR A;  3QB3 A;  2O4X A;  5E1F A;  2SOB A;  5CV9 A;  4WRD A;  3E5S A;  2PW5 A;  3ITP A;  2F0V A;  3OMG A;  4IUN A;  3SHL A;  4HMJ A;  1JOR A; 
#chains in the Genus database with same CATH topology
 4V0B A;  1D2B A;  2A5H A;  4P72 A;  2OTL A;  2PPB C;  1LO5 D;  3URY A;  1SBB B;  3U9O A;  5IOC A;  4R4T A;  3SK4 A;  4E6I A;  1I94 Q;  3S1Q B;  3MVV A;  2WAC A;  2I5H A;  4JI2 Q;  4JI3 L;  4K2L A;  2F03 A;  1AW7 A;  1YNN C;  4X66 L;  4F88 A;  2CVR A;  2K5V A;  1SR3 A;  2PI2 E;  4GOP A;  1I6H H;  3TZU A;  1PZK D;  4O0A A;  2JA5 H;  4JI0 L;  1J6Q A;  1RJT A;  1PH3 A;  3CPF A;  1AE2 A;  2JXM B;  3VYT A;  1K28 A;  1EIG A;  1Z9F A;  2B8G A;  3EVQ A;  4IPD A;  4IPH A;  5I9P A;  2JA9 A;  3J7A V;  3GTG B;  4BY1 B;  4N9P A;  4B3R Q;  2N55 A;  3RLO A;  1QJO A;  5CBA E;  1EUJ A;  1F2Y A;  1Q8I A;  1CHQ D;  4K6L A;  1SYD A;  2EYL A;  3NWT A;  5C0X H;  1EY8 A;  3OTO Q;  2XIW A;  1PFB A;  4KLK A;  5IIF A;  4DXF A;  4KJN A;  3GTJ B;  1SAP A;  5M3M H;  1EY9 A;  2Z6K A;  3DMU A;  4O42 A;  1XPR A;  4C3J H;  2L9H A;  4A3M B;  1G29 1;  1PH7 A;  4LAA A;  1I5F A;  4YY3 Q;  2MUY A;  1PYB A;  5HUR A;  3TRZ A;  4DU9 A;  1LUZ A;  4UPA A;  4JI3 Q;  3I2Z A;  4UP8 A;  4GN3 B;  3N52 A;  5DNF A;  4ZAI A;  1Y1V H;  2SOB A;  1K0R A;  3HOZ B;  4JI0 Q;  4OGQ C;  4IUN A;  3IFT A;  1RTO A;  2JA6 H;  2I5L X;  2NZ1 D;  2K75 A;  1BCP B;  1LTI D;  1BCP C;  1R9T H;  3CCE A;  4EVO A;  2HQE A;  3CCL A;  3TME A;  5ELC A;  4JOI C;  1MI2 A;  4IFD H;  3J80 E;  2PCF B;  2A69 D;  3T51 B;  1LV9 A;  1OXX K;  3AYH B;  1CTM A;  4IOA A;  3FPP A;  3K5L A;  2F0N A;  2YU9 B;  1ENC A;  2E2H B;  1T5X D;  3ND8 A;  3VA7 A;  1N32 L;  3K7A H;  3SDZ A;  1B50 A;  3M7N A;  5T1G A;  1BOS A;  3R2I A;  3K6O A;  1VQ6 A;  1XNQ L;  4OWT B;  4Q5V A;  1EY6 A;  1CZG A;  1IXR A;  4RH6 A;  2PZW A;  2A68 C;  2K5N A;  4X3T A;  3CPW A;  4AYB E;  4QMG A;  3A5Z B;  3C46 A;  4R8N A;  5IT9 c;  5C4Z A;  1TQO A;  4B3T L;  4A3B H;  1HZC A;  2F0F A;  3CME A;  1HNZ L;  3A7A B;  1EU3 A;  2AQ3 B;  4DR6 Q;  3MAQ A;  1DJR D;  1FVI A;  1VQA A;  2IX0 A;  2EJM A;  1I4X A;  3FRP B;  2PMZ B;  1QG7 A;  2C35 B;  2OCE A;  1STA A;  4TVA B;  2AQ2 B;  1DM0 B;  2V1C C;  4CKC A;  4XQN A;  4P74 A;  1ZXT A;  4DGZ A;  1HZA A;  3BZK A;  2R92 H;  5IWA L;  3PV0 A;  1JQY D;  3O13 A;  2OF1 A;  3TZD A;  5FO7 B;  1QUQ A;  3AB9 A;  4XIG S;  2N78 A;  3FDT A;  5C44 G;  3TQY A;  4IUU A;  4UY8 C;  3MXN B;  1VQC A;  2UXD Q;  4HJ9 A;  1CSP A;  5KGU A;  2EJG C;  4AYB G;  1E3P A;  3OIQ A;  2FIN B;  1BKB A;  4CHT B;  3LX0 A;  3U4Z A;  1A0I A;  1NJI C;  1BCP F;  1YIJ A;  1HTL D;  2F0P A;  4TQU S;  3D4R A;  4LFB L;  4AIM A;  3CU7 A;  4BA1 I;  1TS3 A;  4C3H G;  2F3I A;  4LF9 L;  4KN4 C;  4POF A;  5M5X B;  4A3K H;  4A3G B;  3UDI A;  4JI8 L;  4B3T Q;  1HNZ Q;  3L9A X;  2B2T A;  1JWS D;  4DR4 L;  3LWE A;  5C3E B;  2XNA C;  4MTK A;  4EGV A;  3GTL H;  2F0T A;  1D5M C;  1Q86 C;  2ATW A;  4RWS C;  5JEA G;  2CHB D;  3F2C A;  1WTW A;  1MJE A;  1S40 A;  3MC0 B;  3R2T A;  1C9O A;  2SNS A;  2YTV A;  2HUG A;  1KTK A;  5KYI A;  2JEB I;  5LMN L;  4P75 A;  2L0C A;  1Q82 C;  1HUM A;  5IWA Q;  3PO2 B;  1A15 A;  1F2L A;  1X32 A;  2BDN A;  5IP7 G;  1MHW C;  3QG1 A;  2EIF A;  4X6A H;  4YIJ A;  5C4X B;  4NB3 A;  1EWH A;  5CV6 A;  3UDX A;  3JAM E;  2R93 B;  1V1O A;  3BU2 A;  1X3F A;  4DK0 A;  2R7Z H;  3D4D A;  2WAQ B;  3R93 A;  5C0X J;  1VQM A;  4BBS G;  1XWE A;  3J81 j;  4LFC L;  3X3N A;  2E2D C;  3P75 A;  4FF3 A;  1WFQ A;  5J3B A;  4HSP A;  3CC2 A;  3GO5 A;  4KK7 A;  1U9R A;  4X65 Q;  1W2B A;  3T4A C;  4P2C B;  1IW7 D;  1G2T A;  1H9K A;  1VS0 A;  1ZYR C;  4LF9 Q;  1JE5 A;  1X56 A;  4YCW A;  1I50 H;  5JJL A;  2BA0 A;  2FMM A;  4B9W A;  4HJA A;  3C1F A;  4A3J G;  4JI8 Q;  4DUY L;  3I4M H;  1TWH H;  1QIL A;  3MXG A;  2JSO A;  1SNP A;  4IN3 A;  3QO2 A;  1EY4 A;  1HNX L;  4DR4 Q;  3I4N G;  3HG9 A;  1QWY A;  4Y7N H;  3AU7 A;  2EDG A;  4WJ3 M;  4KN7 C;  1G6P A;  2RQX A;  1YNX A;  5C5M A;  3NTI A;  5KIX A;  1Z6H A;  4BY7 B;  5LMN Q;  3RZD H;  1TXY A;  3SXH A;  1H9R A;  1UE1 A;  3QJY A;  1HQM C;  2QIL A;  1HQR D;  3SHL A;  4IPG A;  2VZA A;  4IQZ A;  2EE1 A;  3C2P A;  1YHB A;  1HA6 A;  4DF7 A;  2X6L A;  3H3V H;  2ZJP A;  2QKI C;  1LTL A;  4DNR B;  5C5L A;  2AKW B;  2HIX A;  1MSG A;  1PZJ D;  5F2D A;  4QJF A;  1HR0 W;  3CCV A;  1IYU A;  2EY6 A;  3MXP A;  3HRZ C;  4CKE A;  1LTR D;  4IFD J;  1O7Y A;  1YZ6 A;  2QA4 A;  4LFC Q;  5CR3 A;  1WCM G;  2K5D A;  2LSS A;  4H44 C;  4QL5 A;  4GNX B;  1DGS A;  1GVP A;  3ERS X;  2Q2I A;  3PF5 A;  1XX8 A;  2EYM A;  1IBK L;  1LTS D;  2IHF A;  4RGM A;  1YJ9 A;  2F0E A;  3PF4 A;  1VQ9 A;  1L0X B;  5I9O A;  3MTS A;  3F2U A;  4HTH A;  2A6E C;  2F0Q A;  1SJE D;  3G48 A;  5CV4 A;  1E7Z A;  1GHK A;  5CYU A;  1QZH A;  2RKS A;  4KTA A;  2Z4I A;  5JJI A;  1SNC A;  1DON A;  2J0T D;  4PQX A;  4IUR A;  4H13 C;  1Q3L A;  1ZEQ X;  5GQO A;  3ND9 A;  1EIH A;  1MD2 D;  3I7F A;  5LL6 S;  3GTO H;  4DV5 Q;  2JJQ A;  3MFG A;  4LF7 L;  4MIU A;  3T56 B;  3HOX B;  1KLG D;  2WIN B;  2ZJR A;  4B3M Q;  1TT2 A;  2R61 A;  2F0O A;  2EY2 A;  2WKC A;  3A54 A;  4GOP B;  1TWF H;  3PIP A;  4A76 A;  2K52 A;  2VQE L;  3HOU G;  1ENF A;  1TWG H;  1SDF A;  4CDF C;  5GAH C;  1X3G A;  1PTO B;  2K5H A;  2JA7 B;  5FKA C;  1PTO C;  1SNM A;  1RDP D;  1YI2 A;  3OPO A;  1WOC A;  4ZLT F;  4NP5 A;  1LT6 D;  3S2H H;  4OX9 L;  4BY1 G;  3M4Y A;  4JI1 L;  2DY7 A;  2ZXR A;  4G7Z C;  2Q8R E;  1LT3 D;  3HOW B;  1IBL L;  1GUO A;  3D6W A;  1FL0 A;  3J80 i;  3DWP A;  1PMR A;  3K59 A;  1Y14 B;  1CKN B;  2JA8 B;  2Z6K C;  3S24 A;  1EU4 A;  3UDF A;  3D3R A;  3BJU A;  1NCV A;  2OQ0 A;  2Q8I B;  1XYI A;  3HOV B;  4GKK L;  4ZRZ A;  1KAA A;  5M3F B;  2OEO A;  1PFM A;  4JBJ A;  5J1Z A;  4DV3 L;  3T16 A;  1DOK A;  2FMC A;  3M4P A;  5IGF A;  1NSN S;  2WB1 E;  1LYL A;  5T1I A;  2B63 B;  1S3O A;  1HA5 A;  2E8G A;  3WWV A;  2A19 A;  1YNJ D;  3FHW A;  5IY0 A;  2CH4 W;  1R4P B;  5H1S E;  3MWY W;  3DXJ C;  3W3A A;  4O1N A;  4HIK A;  1K73 C;  1DZ1 A;  2VQE Q;  2QEJ C;  3W5O A;  1HNW Q;  2EZV A;  1LTG D;  2VQF L;  1SRU A;  4L6T B;  2EYP A;  2KCM A;  5KNC A;  3HOZ G;  4GZY C;  3S16 H;  3S9W A;  4ODG A;  1BUV T;  1JJG A;  1CSQ A;  1WTH A;  1L0W A;  3TSS A;  2ZJQ A;  1A63 A;  1QB5 D;  1YJN A;  1PTO F;  3J81 c;  2KJX A;  1K83 B;  1JOK A;  3PUV A;  3HFZ B;  2D9U A;  2F3W A;  3BYY B;  1IBL Q;  4RA8 A;  5GAE C;  4TRD A;  5TSS A;  4QQB X;  4A3E G;  2WB1 G;  2TSS A;  1PH8 A;  1JC7 A;  1SFO H;  1QVF A;  3MA2 B;  4LUO A;  2VB3 X;  3L3O C;  1GM5 A;  1PRT F;  2F0D A;  2YTX A;  1FR3 A;  3VR4 A;  1UE7 A;  1JCK B;  3CCU A;  1XPO A;  1I94 L;  2JEA I;  4ZCK A;  5D14 A;  1LM0 A;  2PNH A;  1VF7 A;  4IUQ A;  3L0O A;  1ONL A;  1EY5 A;  4KJO A;  3ZJY C;  1KDA A;  3NEM A;  2PI2 A;  3U4V A;  4OHJ A;  4JI2 L;  4C3H H;  4B3S L;  4IPC A;  1XMO Q;  5DM7 3;  3K8A A;  1I6H B;  3J7Y W;  1I4P A;  2EPB A;  2Y0S B;  2EXZ A;  4KY5 A;  2JA5 B;  4DN4 M;  5I2Y A;  5IP9 G;  2G9H D;  3W1G A;  3CHB D;  3E3X A;  4NXM Q;  1HUN A;  4OO1 I;  4XYQ A;  4DPG A;  1S5C D;  2VQF Q;  1KAW A;  3NPP A;  3ULL A;  5JEA H;  2KEE A;  1IBM Q;  1QUQ B;  3TS0 A;  1VQ7 A;  1TWA H;  3HOY G;  3TP8 A;  3IFD A;  5CGK A;  2UXB L;  3AEV A;  4BWG B;  2MO0 A;  4DR2 Q;  4R4I A;  1DD2 A;  1EIF A;  3BVG A;  3EJI A;  4KI0 A;  3OHX C;  2K32 A;  1MSH A;  4HID A;  5M5Y B;  3RD4 A;  1B8A A;  4B9X A;  4OIJ A;  5IP7 H;  1LTT D;  5M3M B;  3JAM i;  3F2D A;  1Q12 A;  4PZ6 A;  2F0K A;  3GTQ H;  1TS4 A;  4APV A;  4IUP A;  1ENA A;  1EQQ A;  1KNA A;  1RHP A;  3PUW A;  4BBS H;  1IZ6 A;  3CMA A;  1H9M A;  3G6J B;  3SK6 A;  2E2J H;  3I90 A;  4JBK A;  3OOC A;  5M5W B;  1HXY D;  3J7A F;  1QVC A;  3D4W A;  3S1R H;  2YTY A;  4KV6 A;  4YY3 L;  2A6H C;  1I4Q A;  2B2T C;  1RTN A;  4B3S Q;  2VXW A;  5IYC G;  2JYO A;  2HT1 A;  2Z8L A;  3BZC A;  5BN3 A;  4A3J H;  4A93 G;  1VQJ A;  5C3W A;  1O7Z A;  1Z47 A;  2KEN A;  3H0G G;  2VUM B;  1FGU A;  2XGT A;  2F4I A;  3I56 A;  2UUB L;  2JA6 B;  3I4N H;  3K81 C;  1CZW A;  3VR6 A;  2CWA A;  1VQI A;  1T9H A;  1EIY B;  3VDY A;  4YHH L;  3P1H A;  2F4V L;  1G2S A;  1R9T B;  4BS9 A;  2I46 A;  3KLS X;  1QVG A;  3S2D H;  2UXC L;  3QOJ A;  4A3I G;  4R4C A;  1RF2 D;  1E2W A;  5G3L F;  4DR3 Q;  1CA5 A;  3DLL A;  3PO2 G;  1PH5 A;  1IKM A;  2UXB Q;  3KLS A;  2KOL A;  3HKZ B;  1SYE A;  1JMC A;  1O78 A;  2IW3 A;  2RCN A;  3FP9 A;  2MPM A;  5C4X G;  4JI7 Q;  3G6E A;  3K7A B;  4A75 A;  4RHR A;  2K03 A;  2Z9H A;  2XRQ D;  5A2Q E;  2R93 G;  3I91 A;  4RMF A;  5IGD A;  4DR7 L;  1PLF A;  4OEL B;  2WAQ G;  1N9W A;  4UHV A;  3GP7 A;  4LF6 L;  3G4S A;  1CKN A;  3SVM A;  4JCV E;  4WJW A;  3RLN A;  4PMC A;  1EEF D;  1STN A;  1K0S A;  1B3Q A;  4PV1 C;  2Q8T A;  3RN5 A;  2DGY A;  4GN5 A;  3T1H L;  5E1F A;  4M1U B;  5DM6 3;  3TDQ A;  4A3B B;  2L55 A;  1WCM H;  2PW5 A;  3GTP B;  3M3Y H;  1O7I A;  1QOH A;  3J81 E;  4MTN A;  1U4R A;  3BZD B;  4KY6 A;  4C1N K;  1VMC A;  4A3F G;  1I6V C;  3KF8 B;  3LNN A;  4DR6 L;  2N49 A;  2DY8 A;  3DWQ A;  1BBW A;  2NVT B;  2ZTD A;  1VQO A;  4K14 A;  3BS1 A;  4BA2 I;  1SYG A;  1XXG A;  3CC7 A;  4S3S A;  4QIW B;  1V1Q A;  4OEM B;  2KA7 A;  4QUC A;  2HHH Q;  4H7B A;  2RF4 A;  5NUC A;  2R92 B;  3IAY A;  2UUB Q;  4KKT A;  4Q0F A;  1VQF A;  3DHQ A;  2K14 A;  2B2Y A;  4JW0 A;  1HFG A;  4YHH Q;  2F4V Q;  2RDH A;  2UXC Q;  5CC4 A;  1VQK A;  4HCE A;  3D6C A;  3OWF A;  4EQN A;  2UXD L;  4AQY L;  2B2W A;  3NTH A;  1GD7 A;  4ZKC B;  3VYU A;  1HH2 P;  3W2D A;  5FK9 C;  3H09 A;  3HOU H;  4QF4 A;  4JVZ A;  4H0L C;  2HQL A;  4ZQ3 A;  3KBG A;  4QCL A;  1W6K A;  2K4K A;  1BF4 A;  4DR7 Q;  4CGY B;  3D8G A;  3TP7 A;  1HPC A;  1FD7 D;  4LF6 Q;  5EKK A;  1PDQ A;  3WDN A;  1A3T A;  3RUZ A;  1E0B A;  2B39 A;  1I4G A;  3MZ5 A;  4RCO A;  3GTG H;  3AFQ A;  4BY1 H;  5DEH A;  1KD1 C;  3T1H Q;  2R7D A;  2A69 C;  5I2X A;  1SEB D;  2R7F A;  4J8Q A;  1WVL A;  1SE2 A;  3GTL B;  2IX3 A;  2EVB A;  1WD0 A;  1C0A A;  1K8G A;  2BH2 A;  2NZH A;  3CCR A;  4P71 A;  2ASB A;  3GTJ H;  2KCC A;  3EQL C;  3NBH A;  1NE3 A;  3BG3 A;  5IGG A;  2GVA A;  5FLX L;  3LGJ A;  3PIO 3;  2F0H A;  2K7V A;  3DM3 A;  1X3Q A;  1LLR D;  2MJ8 A;  4A3D B;  4KMU C;  4IUT A;  4ZUJ A;  3STB C;  1R4Q B;  2D0P A;  1FJG Q;  1IYV A;  5JEA J;  2D0O A;  2IX1 A;  5CBE E;  4DAY B;  4R4Q A;  2F0V A;  1XTD A;  4PG3 A;  4AQY Q;  1JOR A;  2R7Z B;  3PGZ A;  1LTB D;  1VQG A;  2HDL A;  1VQL A;  1Q1B A;  1CK1 A;  3CKI B;  1S5E D;  2B2U C;  1MKH A;  2DNE A;  2F0J A;  2KEC A;  1EYA A;  4X3K A;  4DV4 Q;  3KOJ A;  5JAV A;  2K28 A;  1N34 L;  4KKU A;  1UEA B;  4ID6 A;  3IKJ A;  1X65 A;  5DAU A;  5IYD G;  4X65 L;  1B9M A;  1HJP A;  3Q8D A;  1Q8K A;  3RLF A;  3F8T A;  4FF4 A;  2BE5 C;  2K50 A;  1TWH B;  3K0X A;  3Q0A A;  3P7J A;  2OXP A;  4FP5 D;  4BBR B;  1F9S A;  2NVX B;  1D7Q A;  2RDG A;  2SDF A;  1JE4 A;  4OIK A;  4L5Q A;  2E2H H;  2DUD A;  1E1T A;  1YBY A;  3BDO A;  4Y7N B;  4A3E H;  1EWI A;  1G6Z A;  1EY7 A;  2AHO B;  3NQI A;  5M3F G;  3VR3 A;  5EPL A;  2ZM6 Q;  1VQE A;  1B3A A;  3K5O A;  3RZD B;  5M9O A;  1UAP A;  2EQS A;  1N8R C;  3D0F A;  4M8A A;  2B63 G;  2EYF A;  1KXL A;  1SND A;  3Q23 A;  3DEO A;  4G4K A;  3CP0 A;  3TEH B;  1EEI D;  1NMG A;  1VQH A;  3FKI B;  1J9O A;  1YEZ A;  2ALY B;  2XN9 C;  3R3O A;  4K8J A;  5I6Y A;  4R1J A;  3SGI A;  3CF5 A;  1Z7T A;  2K5W A;  1UE6 A;  4XXE A;  1SYB A;  3JC6 6;  2NVQ H;  1NNX A;  3L7Z C;  5IP9 H;  1HR0 Q;  2L15 A;  1PH2 A;  1QNK A;  4L8J A;  1CA6 A;  3MEF A;  3DWA A;  2E5L Q;  1OO9 B;  4C2M B;  1N34 Q;  1HTP A;  2F1M A;  2QCP X;  4OWW B;  3HOY H;  3S17 B;  1Y8N B;  4Z9C B;  2QDL A;  4LF8 Q;  5JVG 3;  1M90 C;  1ZYR D;  3NUC A;  2NZO A;  1AEX A;  3A5U A;  1D6E C;  2P5Z X;  4JBW A;  3WOE A;  3QB3 A;  3L2P A;  4DXG A;  1CUK A;  1CQV A;  4GN4 B;  1DOM A;  3KF8 A;  3GTO B;  3AFP A;  1A8V A;  5GRO A;  4G7O C;  1HZB A;  3NEN A;  1CQF A;  2BOS A;  1JIC A;  2KUM A;  4DV5 L;  1Q1E A;  4F87 A;  2O5J C;  2C5C A;  3HGB A;  1IW7 C;  1TII D;  1EQT A;  4AH6 A;  4B3M L;  1MIU A;  3H15 A;  5IYB G;  4NW2 A;  2F0I A;  4LUV A;  1KC8 C;  4RCN A;  5IT9 E;  5FO9 B;  1ROD A;  3IL8 A;  1UUP A;  3TP5 A;  3SR1 A;  4BXX G;  2Q2U A;  5IYC H;  2HIV A;  1LT4 D;  2NUC A;  3S2H B;  4YCU A;  1RD9 D;  1STH A;  3DUZ A;  4A93 H;  2D62 A;  3CW2 C;  1YHA A;  3H0G H;  4XQJ A;  2AQ1 B;  1MGS A;  2JN4 A;  1VQ4 A;  5LL6 X;  2SEB D;  1AZQ A;  4CJ2 C;  4HED A;  1AZP A;  2AUK A;  4UAI A;  1AP0 A;  4HN7 A;  4A3I H;  4GNX C;  1D1I A;  3GD7 A;  1K8O A;  5C0X I;  4L5S A;  3PO3 G;  2OWO A;  3PO2 H;  5KYL A;  3J80 L;  2UUC Q;  1D5X C;  4ME3 A;  4PZ8 A;  3CAM A;  1I4R A;  1NR4 A;  3C1E A;  2WV6 D;  5C4X H;  1ML0 D;  1QCB D;  5C4H A;  4RFB A;  4XTC S;  2R93 H;  4I7Z C;  1P16 A;  4H02 A;  2K05 A;  3KDF B;  3KLW A;  3ULP A;  5IGC A;  3CQZ H;  3MHB A;  3WOF A;  4K8I A;  3ER0 A;  4A3L G;  4JPB W;  2ICI A;  2E2I H;  3U9S A;  3RR5 A;  4J15 A;  1PH6 A;  1SYF A;  5IGE A;  1GKH A;  1FNV A;  5C4J H;  2DNC A;  4GOP C;  4A3F H;  5FLM G;  2GN5 A;  1HNW L;  1LAC A;  5K36 G;  1YIT A;  1TR5 A;  2VUM G;  3F1Z A;  5C3X A;  4IO9 A;  1GOZ A;  2RHS B;  3A56 A;  1KDB A;  5ELF A;  3S16 B;  4DAY A;  5ISR A;  1BBX C;  4CBV A;  3S1M H;  4ULL A;  4IOC A;  1Y1W B;  4L5T A;  1TY0 A;  5LMN W;  3KFU A;  5ELE A;  4P73 A;  2VW9 A;  3S14 H;  3HKS A;  1XPU A;  1PRT D;  1U4M A;  1VCI A;  3PQI A;  4LF4 Q;  1KHI A;  2H1E A;  1Y8O B;  3ONA B;  1UWV A;  4IFD I;  1OXU A;  1SYC A;  1KDC A;  1WTR A;  1U5K A;  4AYB B;  4YCV A;  3K5N A;  1IHZ A;  4DNI A;  3PUY A;  3TP6 A;  1EYG A;  4RG1 A;  3V96 A;  4C3I B;  1EOT A;  5CMD A;  2JP1 A;  2KBN A;  4IUV A;  4K5X A;  2JE6 I;  5DLQ E;  5EGT A;  1B44 D;  4K5W A;  4CDE C;  3E0E A;  4A3M G;  1BBU A;  1OTC A;  3I3C A;  5FO8 B;  4FXG C;  4C3H B;  2H4O A;  2V4D A;  1VQP A;  3CCS A;  1STY A;  3FPU B;  1L1O A;  5CV5 A;  1I4H A;  1EOV A;  1XMO L;  4V19 0;  1I3Q H;  4MNO A;  2OTJ A;  1ICW A;  3GQB A;  4NXN L;  4O2D A;  1XMQ L;  1IYJ B;  2LXK A;  3A74 A;  2L12 A;  4NXM L;  5A35 A;  1JR0 D;  1JWU D;  2ID0 A;  2G9D A;  5ELN A;  2D5D A;  3CRL C;  1FGB D;  1TWA B;  3W1B A;  2LS0 1;  5EJW A;  3MXU A;  4IZ8 A;  1PFN A;  5GAG C;  1IBM L;  3ERO A;  2PQA A;  4DR2 L;  2J4X A;  1YNJ C;  1KLU D;  1V1P B;  1K8M A;  4XT1 B;  4PNY A;  5IGB A;  2B2V A;  2PMZ E;  3DEP A;  3VYR A;  3I4L A;  1MBY A;  3S1N H;  1VMP A;  4UP9 A;  1TS2 A;  2I5M X;  5C44 H;  1DXM A;  2ZXP A;  2PZT A;  1PTO H;  4DV0 Q;  3GV3 A;  3NSW A;  3JAM L;  3RNU A;  1K8A C;  3UE1 A;  2CW0 D;  1WTQ A;  4RGO S;  5HGQ A;  4NKL A;  1B1Z A;  1VQB A;  3I70 A;  3NWS A;  5D3I B;  2MNA A;  1JB3 A;  4ZUI A;  2E2J B;  3I8Z A;  4FF2 A;  1OXV A;  3S1R B;  4XQQ A;  3E5S A;  5ELO A;  3QR8 A;  1IL2 A;  5IYD H;  1G51 A;  4POG A;  3S15 H;  3KF6 A;  4K6D A;  1CM9 A;  3NBH B;  3EN2 A;  4HCS A;  1HCZ A;  3ERQ A;  2G5D A;  3NHH A;  1EYD A;  2DN8 A;  5G3L D;  5JOB A;  1V8Q A;  5JJZ A;  2L1B A;  4OO1 G;  4RKL A;  4NXN Q;  1STE A;  2BH8 A;  2XVS A;  1XMQ Q;  1EZ8 A;  3I4N B;  1GUN A;  1ET9 A;  3EBE A;  1T5E A;  2UU9 L;  3S2D B;  4LNQ A;  4U67 3;  1SMX A;  5M3F H;  2QGQ A;  4FF1 A;  5JJK A;  1E24 A;  1F9R A;  2VL6 A;  5AJ3 L;  4DV2 L;  4A3D G;  3T1Y L;  4XDX A;  3GTM H;  3F2B A;  4DR3 L;  2EY1 A;  4QB4 A;  4QY7 A;  2B63 H;  4JV5 Q;  1W3S A;  4NMZ A;  3J80 c;  1BVS A;  2R6G A;  2IWH A;  4JI7 L;  1PFS A;  4JI5 L;  5COR A;  1JJ2 A;  1AH9 A;  4A3C G;  1EWC A;  2DJG C;  1CKM A;  3BDL A;  3K57 A;  1KNE A;  3OMC A;  5EBC A;  3KUP A;  1C48 A;  1VDZ A;  1RL2 A;  2PW7 A;  1S5F D;  2UUA L;  2KCN A;  4C3J B;  3SK5 A;  2O2L D;  5BR8 Q;  1EFI D;  4ME5 A;  1SMY C;  3M3Y B;  2CH4 A;  5K5P A;  2R3Z A;  1HFN A;  1WTV A;  4DK1 A;  3A55 A;  3KDF A;  1LTA D;  1AE3 A;  1S4Z A;  4A3G G;  2WKD A;  4BBR G;  2FXQ A;  1B70 B;  2WAQ E;  1K83 H;  4CDC C;  1WJJ A;  2PQE A;  1B7Y B;  1YNN D;  4GKJ L;  1IL8 A;  4KKS A;  5C3E G;  5EAY A;  4DR1 Q;  3DM1 A;  3SK8 A;  1Y1V B;  2RBM A;  5EKL A;  3TRE A;  4G57 A;  2HHH L;  2WFW A;  2F52 A;  2UU9 Q;  2LFN A;  1DCZ A;  3K80 C;  1BNZ A;  2A1A A;  3I72 A;  3RN2 A;  4KHV A;  2MQH A;  4RAU C;  2NWG A;  1YVC A;  5AJ3 Q;  4DV2 Q;  4R9W A;  3T1Y Q;  3FKI G;  4WOR A;  4J6H A;  3RZO H;  2XWB B;  5IYB H;  5I4D A;  3HOU B;  2RHQ B;  3TBI B;  4C56 C;  2DJF C;  4JI4 Q;  2VY3 A;  2WP8 J;  3H3V I;  1F2M A;  1EZ6 A;  3AQQ A;  4JI5 Q;  4MN3 A;  1PYW D;  4JYA Q;  3KLR A;  1Q90 A;  1NBW A;  1Y69 U;  4BXX H;  3VR2 A;  1RIP A;  3GTK H;  1F2Z A;  2RSN A;  1VF5 C;  3A0J A;  1II3 A;  3UDG A;  1EQR A;  1H9J A;  1OXS C;  3CC4 A;  2CQO A;  2NVY H;  4C1N I;  2UUA Q;  3E6Z X;  1TWC H;  2MHV A;  4YWK A;  1ESR A;  1NAP A;  2F3V A;  4JBM A;  4X3U A;  2B3G A;  3B6Y A;  3HEJ A;  3NEL A;  3M4Q A;  1FNW A;  1KAB A;  2XSC A;  5M5Y H;  3CD6 A;  1PVO A;  3PO3 H;  1N33 L;  2K33 A;  2LXJ A;  1A3U A;  1K3R A;  2K1B A;  4HMI A;  3OW2 A;  5CV8 A;  3M4O H;  2RVL A;  1SE4 A;  4GKJ Q;  4GLA C;  4EX5 A;  3GDE A;  2ICE C;  4JI6 L;  2E75 C;  3PUX A;  1M1K C;  2E74 C;  4F7X A;  3VA5 A;  2MP1 A;  2NTS A;  1WYD A;  4TKO B;  2M00 A;  2JK8 A;  4NPS A;  1NTG A;  2EXD A;  3E9I A;  4A3L H;  4BY7 G;  1NUC A;  3S1Q H;  1CFM A;  3OYY A;  5M5W H;  1FJG L;  3PCO B;  1BCP D;  1PYS B;  2EYO A;  4DV7 L;  4HJ5 A;  4F8M A;  4X66 Q;  2F0U A;  3LWU A;  1S5D D;  3JAM c;  3QOL A;  4DUZ L;  3G7L A;  4HAE A;  2OQK A;  1CT1 D;  1V1P A;  2KCT A;  4FXK C;  4ZKB B;  5JPM C;  5FLM H;  1AFP A;  4OON A;  5K36 H;  5FOB B;  1F77 A;  2VUM H;  2QDB A;  1W6J A;  2IL8 A;  2NN6 G;  2Z1C A;  4X62 L;  4DV4 L;  1WD1 A;  4DK3 C;  1QNU A;  3QWN A;  4GLV B;  1PXU A;  1O80 A;  2NN6 I;  4CKB A;  1HZ9 A;  2A68 D;  4A3K B;  5BN4 A;  2XRS D;  3K5M A;  3Q6S A;  1GUT A;  2EOT A;  1Q46 A;  3CXC A;  1Q7Y C;  2L5T A;  5IOD A;  4KHP L;  2RCF A;  1ESF A;  2ENB A;  3PIO A;  2PZU A;  2WB1 B;  1O7L A;  4A3E B;  3V05 A;  1HRJ A;  5CV9 A;  1UNS A;  5COY A;  1N33 Q;  4XT3 B;  1B53 A;  4HMJ A;  1ASY A;  1EYC A;  5KNB A;  3TN2 A;  3VYS A;  1X9N A;  2ES2 A;  2ZM6 L;  1SRO A;  2H5X A;  1J8I A;  3RMH A;  3J7A 5;  4HIO A;  4JI6 Q;  1EFW A;  3FEW X;  3N6R A;  3SEB A;  5C6A A;  1TKW B;  5HGT A;  3HOX G;  4A3M H;  1EQV A;  3STB D;  3GTP H;  1U4P A;  1K9M C;  5FJ8 G;  1VQD A;  5E3F A;  1FYC A;  4DV7 Q;  2NVQ B;  1JOO A;  1EY0 A;  2JA7 G;  1SE3 A;  2NVT H;  3CRK C;  4FO2 A;  1SJH D;  4X64 L;  2AWO A;  4DUZ Q;  4XYO A;  1HR0 L;  4CJ1 B;  3BDC A;  4CJ0 B;  3EIV A;  1Y1W G;  2XWJ B;  1X3E A;  2JQO A;  4FXD A;  3HOY B;  2QEX A;  4X62 Q;  3HOZ H;  2E5L L;  1U0L A;  4QGU A;  2FFK B;  3BVM A;  1GUW A;  2NBF A;  2Q2T A;  4LF8 L;  1TS5 A;  1TVX A;  1GUS A;  1I50 B;  1M8A A;  2GA4 B;  3HOW G;  2BE5 D;  1H95 A;  5L37 A;  1D1K A;  3I4M B;  1PH9 A;  2CQA A;  3CCQ A;  1XTC D;  3PUZ A;  4YWL A;  4KHP Q;  2JA8 G;  1WTO A;  5HY6 A;  4C3I G;  2IHE A;  1IKL A;  1N32 Q;  2YU9 H;  4IJL A;  5LMU L;  4HJ7 A;  3U50 C;  1OXT A;  2N3S A;  3T13 A;  5LHY 1;  2KHJ A;  2X6G A;  3HOV G;  1A3V A;  3CCM A;  2L4N A;  3AMU A;  1CKO A;  4HJ8 A;  1XNQ Q;  1L1O B;  4IJH A;  1L1O C;  4FDB A;  2BCO A;  3Q22 A;  4OL7 A;  2IT1 A;  4K5V A;  1J5E L;  1E2Z A;  1CI3 M;  4HR7 B;  1A6X A;  1X3P A;  1ICF B;  2B8F A;  4KY7 A;  3H3V C;  2CFM A;  2LMC B;  3I55 A;  2AUJ D;  1A62 A;  4A93 B;  3SE0 A;  1JWM D;  2KHI A;  1LT5 D;  2Z4H A;  3H0G B;  3NQT A;  4OO1 H;  2Q2H A;  4PZ7 A;  4X64 Q;  2PQA B;  4WRD A;  5JPN C;  2K04 A;  3ITP A;  3UE0 A;  3I4O A;  2O5I C;  4DA2 A;  3ICE A;  5EKI A;  4A3I B;  2B2V C;  2KED A;  4ZYS A;  1F9P A;  2Y0S E;  2SNM A;  4A3D H;  3OSO A;  5KND A;  4KD4 A;  1DOL A;  1H9S B;  1E1O A;  2F0L A;  1EL0 A;  2UUC L;  2LKV A;  4EQO A;  4N9T A;  3MEH A;  2IY5 B;  5A2Q L;  1GHJ A;  4EQP A;  2VS1 A;  1JT8 A;  1SNO A;  4U68 A;  4A3C H;  3CQZ B;  2PYK A;  1RKN A;  1QZG A;  2E2I B;  4LW1 A;  3CCJ A;  2FJ2 A;  4DAV A;  5LMU Q;  1G8Z D;  4JG2 A;  1X6O A;  2Z6B A;  3HS0 C;  3KF6 B;  4LFB Q;  4X3S A;  1X54 A;  4LMQ D;  5C4J B;  1TWF B;  3J81 L;  4A3F B;  2K6A A;  4L5R C;  4N8X 1;  3M85 A;  1TWG B;  1J5E Q;  2ZT9 C;  5M5X H;  3R8B A;  2N88 A;  3Q24 A;  4A3G H;  1ILQ A;  4BBR H;  1Q81 C;  2Y0S G;  4KHZ A;  2NVX H;  2J7Z A;  4RGT A;  2JA5 G;  1VQ5 A;  5I6W A;  3S1M B;  1B2T A;  4ILW A;  5C3E H;  1DYQ A;  3K0Y A;  3S14 B;  3MFY A;  4DKA C;  1SLJ A;  2YV5 A;  3NBI A;  1WTP A;  1D8L A;  3T53 B;  4RHS A;  1JJC B;  3NK9 A;  5EPJ A;  4DV6 L;  3G71 A;  2F0G A;  2NYZ D;  4OWX B;  2TMP A;  2IJ0 A;  2N8N A;  3KBX A;  1GJX A;  4LF4 L;  5C0X G;  2F0M A;  4PMB A;  2E76 C;  1VQ8 A;  1M4V A;  2F0W A;  4R4O A;  3NXW A;  1CHP D;  3FKI H;  2BDO A;  3PSI A;  3KJP A;  2PNR C;  5KEE A;  3EA6 A;  4MZ9 A;  5M3M G;  3A8I E;  4JOI A;  2A6E D;  1PA6 A;  4C3J G;  3A8K E;  2HDM A;  3GV6 A;  3ULJ A;  5FLX c;  3HKZ E;  3I73 A;  1BO0 A;  4WFN 3;  2K5Q A;  1PZI D;  1VQN A;  1S5B D;  3OMG A;  3NTK A;  4C2M H;  1I3Q B;  2MFI A;  3A8J E;  3S17 H;  1B4O A;  1KRS A;  3J81 i;  1E22 A;  4DNT B;  1A2T A;  3A7L A;  2EJF C;  1ASZ A;  4DUY Q;  1C4Q A;  4B08 A;  4LUZ A;  4EQ5 A;  2IPK D;  3ZYY X;  1Y1V G;  1PTO D;  1HNX Q;  5EBD A;  4UDU C;  3OIP A;  1P8L A;  2JA6 G;  1A2U A;  4I65 A;  2NTT A;  3FVQ A;  1JB7 A;  2PO4 A;  2EYJ A;  1L2F A;  3U58 A;  1STB A;  3C3L A;  1KQS A;  3NP8 A;  4DV6 Q;  1B9N A;  1UEB A;  3E9H A;  3S1N B;  4IFD G;  4K0K L;  4BY7 H;  3HKZ G;  5C44 B;  4QIW E;  1V43 A;  3TS2 A;  3H6M A;  3BYT B;  1SXT A;  1JOQ A;  2CWP A;  1HHV A;  1GO3 E;  1PH4 A;  1SFO B;  4DV0 L;  3VR5 A;  3UI2 A;  3MXN A;  4FYD A;  5E7N A;  2A73 B;  1NMF A;  3J7Z C;  1BXT A;  3PIP 3;  1U4L A;  4RGN A;  5ELD A;  2QF7 A;  2NB0 A;  2BA1 A;  1UE5 A;  2B2U A;  2EYH A;  1PRT B;  1PRT C;  2LY7 A;  4NDX A;  2NN6 H;  5D65 A;  3D31 A;  1TY2 A;  4A3B G;  3S15 B;  2QW7 A;  3BVZ A;  2HCC A;  5GAD C;  1IBK Q;  1SSO A;  2Z0S A;  4ZK9 B;  4ALP A;  2M2L A;  2C9O A;  4LFA L;  1SNQ A;  2VNU D;  2ZXO A;  2L11 A;  1XNR L;  4DK6 C;  1LAB A;  4DV1 L;  3M7G A;  1STG A;  2ZTE A;  2F0S A;  2MGS A;  2KHS A;  5J39 A;  1ZKO A;  4J1M A;  5D3D A;  4HSV A;  4MHE A;  2B2Y C;  3GTM B;  3KYH C;  2R92 G;  4DR5 L;  1GUG A;  1GXD C;  4LF7 Q;  1V9P A;  4DFA A;  4HIM A;  2B2W C;  4JV5 L;  2X69 A;  1FNU A;  4KD3 A;  3HOX H;  3K58 A;  2O4X A;  4JK1 C;  1WTX A;  2OT2 A;  1N36 L;  2A74 C;  4K0K Q;  1E2V A;  4JC0 A;  5FJ8 H;  3QIA A;  1BR9 A;  3FMC A;  3H91 A;  2RA4 A;  4I7A A;  3GTQ B;  1NR2 A;  5ELB A;  1S72 A;  1KL9 A;  1H9S A;  2CCZ A;  4K2K A;  1RCV D;  2JA7 H;  2VB2 X;  2I07 B;  5E4X A;  1SE8 A;  3NE5 B;  4A4I A;  4BBS B;  5JVH 3;  1X55 A;  4LWC A;  5IE8 A;  5BR8 L;  3M9B A;  5CV7 A;  1PV4 A;  2I0Q A;  1Y1W H;  4OXP A;  4OX9 Q;  4L63 B;  4LF5 L;  3KK7 A;  4FVM A;  4JI1 Q;  1BDO A;  1F9Q A;  4LJZ C;  4A3K G;  1AN8 A;  3OWE B;  1QE6 A;  3K7U C;  1KIX A;  1NY4 A;  1ET6 A;  1MJC A;  2AMC B;  1L0Y B;  4FNF A;  1K3B C;  1TU2 B;  2RSO A;  3OW7 A;  3HOW H;  4LFA Q;  1KRT A;  4A3J B;  2CW0 C;  4R8I A;  1XNR Q;  4DR1 L;  2JA8 H;  4DV1 Q;  2CKZ B;  2EY5 A;  3E0J A;  4C3I H;  5KRU A;  1PH1 A;  2YYZ A;  4GKK Q;  3V2T A;  5FLX E;  1C8C A;  2MO1 A;  4PMW A;  3HOV H;  3H94 A;  4TSS A;  2XTI A;  4DV3 Q;  3RZO B;  5BN5 A;  4DR5 Q;  5J22 A;  2FHT A;  2KQ3 A;  2GVB A;  1D5Z C;  3HZX A;  2M9V A;  5IT9 L;  1ILP A;  4UP7 A;  4JI4 L;  4YWM A;  4N8F A;  4RKB A;  1N36 Q;  2WII B;  2R7Z G;  3GTK B;  4JYA L;  4GS3 A;  5E4W C;  2ZTC A;  5EPK A;  2KVM A;  1PHJ A;  4Y52 H;  4DAP A;  1BQQ T;  3IRB A;  4LK1 C;  4GLX A;  2NVY B;  3KJO A;  3PMF A;  1TWC B;  2AWN A;  4QUF A;  4B3R L;  4G7H C;  3EFX D;  4CDD C;  2K01 A;  1C7Y A;  1SMY D;  1WCM B;  2HD3 A;  1XJV A;  2B29 A;  4LF5 Q;  5AFW A;  4ABN A;  1G91 A;  2RDF A;  3OTO L;  4DAM A;  3PO3 B;  2A8V A;  3I4M G;  2HCI A;  1YHQ A;  4WJ4 A;  4GNX A;  1WI5 A;  2A6H D;  3X3M A;  1Y8P B;  4IAL A;  3M4O B;  2D2C C;  1SN8 A;  3HP3 A;  3P20 A;  5EQ0 A;  1YJW A; 
#chains in the Genus database with same CATH homology
 4V0B A;  1D2B A;  2A5H A;  2PPB C;  1LO5 D;  3URY A;  1SBB B;  3U9O A;  5IOC A;  3SK4 A;  4E6I A;  3S1Q B;  3MVV A;  2WAC A;  4K2L A;  2F03 A;  1AW7 A;  1YNN C;  4F88 A;  2CVR A;  3TZU A;  1PZK D;  1RJT A;  2JXM B;  3VYT A;  3J7A V;  1EIG A;  2B8G A;  3EVQ A;  3GTG B;  5I9P A;  4BY1 B;  4N9P A;  2N55 A;  1QJO A;  5CBA E;  1F2Y A;  1Q8I A;  1CHQ D;  4K6L A;  1SYD A;  2EYL A;  3NWT A;  5C0X H;  1EY8 A;  2XIW A;  1PFB A;  5IIF A;  4DXF A;  4KJN A;  3GTJ B;  1SAP A;  1EY9 A;  3DMU A;  4O42 A;  2L9H A;  4A3M B;  1G29 1;  4LAA A;  2MUY A;  5HUR A;  4DU9 A;  3N52 A;  5DNF A;  4ZAI A;  2SOB A;  3HOZ B;  4OGQ C;  4IUN A;  3IFT A;  1RTO A;  2NZ1 D;  1BCP B;  1LTI D;  1BCP C;  4EVO A;  2HQE A;  3TME A;  5ELC A;  4IFD H;  1MI2 A;  3J80 E;  2PCF B;  2A69 D;  3T51 B;  1LV9 A;  1OXX K;  1CTM A;  3FPP A;  3K5L A;  2F0N A;  2YU9 B;  1ENC A;  2E2H B;  1T5X D;  3ND8 A;  3VA7 A;  3SDZ A;  1B50 A;  3M7N A;  5T1G A;  1BOS A;  3R2I A;  3K6O A;  4Q5V A;  1EY6 A;  1CZG A;  4RH6 A;  2PZW A;  2A68 C;  4X3T A;  4QMG A;  3C46 A;  4R8N A;  5C4Z A;  1TQO A;  2F0F A;  3A7A B;  1EU3 A;  2AQ3 B;  3MAQ A;  1DJR D;  2IX0 A;  2EJM A;  1I4X A;  3FRP B;  2PMZ B;  1QG7 A;  1STA A;  2AQ2 B;  1DM0 B;  4CKC A;  4XQN A;  1ZXT A;  4DGZ A;  3PV0 A;  1JQY D;  3O13 A;  2OF1 A;  3TZD A;  5FO7 B;  4XIG S;  3AB9 A;  3FDT A;  4IUU A;  5KGU A;  2EJG C;  3OIQ A;  2FIN B;  4CHT B;  3LX0 A;  1BCP F;  1HTL D;  2F0P A;  4TQU S;  3D4R A;  3CU7 A;  4BA1 I;  1TS3 A;  4C3H G;  4KN4 C;  5M5X B;  4A3G B;  3L9A X;  2B2T A;  1JWS D;  3LWE A;  5C3E B;  2XNA C;  4EGV A;  2F0T A;  1D5M C;  4RWS C;  5JEA G;  2CHB D;  1WTW A;  3MC0 B;  3R2T A;  2SNS A;  2HUG A;  1KTK A;  5KYI A;  2JEB I;  2L0C A;  1HUM A;  3PO2 B;  1A15 A;  1F2L A;  1X32 A;  2BDN A;  3QG1 A;  4YIJ A;  5C4X B;  1EWH A;  5CV6 A;  3JAM E;  2R93 B;  1V1O A;  4DK0 A;  3D4D A;  2WAQ B;  3R93 A;  5C0X J;  1XWE A;  3X3N A;  2E2D C;  3P75 A;  4FF3 A;  4HSP A;  3GO5 A;  4KK7 A;  1U9R A;  3T4A C;  4P2C B;  1IW7 D;  1G2T A;  1H9K A;  1ZYR C;  2BA0 A;  2FMM A;  4B9W A;  3C1F A;  1QIL A;  3MXG A;  2JSO A;  1SNP A;  4IN3 A;  3QO2 A;  1EY4 A;  3HG9 A;  1QWY A;  3AU7 A;  2EDG A;  4KN7 C;  2RQX A;  5C5M A;  3NTI A;  5KIX A;  1Z6H A;  4BY7 B;  3SXH A;  1H9R A;  3QJY A;  1HQM C;  2QIL A;  1HQR D;  3SHL A;  4IQZ A;  3C2P A;  2EE1 A;  1HA6 A;  4DF7 A;  2X6L A;  2QKI C;  4DNR B;  5C5L A;  1MSG A;  1PZJ D;  5F2D A;  1IYU A;  2EY6 A;  3MXP A;  3HRZ C;  4CKE A;  1LTR D;  4IFD J;  1O7Y A;  5CR3 A;  2K5D A;  4H44 C;  1XX8 A;  2EYM A;  1LTS D;  4RGM A;  2F0E A;  1L0X B;  5I9O A;  3MTS A;  3F2U A;  4HTH A;  2A6E C;  2F0Q A;  1SJE D;  5CV4 A;  1GHK A;  5CYU A;  2RKS A;  4KTA A;  2Z4I A;  1DON A;  1SNC A;  2J0T D;  4PQX A;  4IUR A;  4H13 C;  1Q3L A;  1ZEQ X;  3ND9 A;  1EIH A;  1MD2 D;  5LL6 S;  3MFG A;  4MIU A;  3T56 B;  3HOX B;  1KLG D;  2WIN B;  1TT2 A;  2R61 A;  2F0O A;  2EY2 A;  2WKC A;  3A54 A;  1ENF A;  1SDF A;  1PTO B;  2JA7 B;  5FKA C;  1PTO C;  1SNM A;  1RDP D;  3OPO A;  4ZLT F;  4NP5 A;  1LT6 D;  3M4Y A;  2DY7 A;  2ZXR A;  4G7Z C;  2Q8R E;  1LT3 D;  3HOW B;  1GUO A;  3D6W A;  3DWP A;  1PMR A;  3K59 A;  2JA8 B;  1EU4 A;  3D3R A;  1NCV A;  2Q8I B;  1XYI A;  3HOV B;  4ZRZ A;  1KAA A;  5M3F B;  2OEO A;  1PFM A;  5J1Z A;  3T16 A;  1DOK A;  2FMC A;  5IGF A;  1NSN S;  5T1I A;  2B63 B;  1HA5 A;  1YNJ D;  1R4P B;  3MWY W;  3DXJ C;  3W3A A;  4O1N A;  1DZ1 A;  2QEJ C;  2EZV A;  1LTG D;  4L6T B;  2EYP A;  5KNC A;  4GZY C;  3S9W A;  4ODG A;  1BUV T;  3TSS A;  1QB5 D;  1PTO F;  2KJX A;  1K83 B;  1JOK A;  3PUV A;  2D9U A;  2F3W A;  3BYY B;  4RA8 A;  4TRD A;  5TSS A;  2TSS A;  1JC7 A;  3MA2 B;  2VB3 X;  3L3O C;  1PRT F;  2F0D A;  1FR3 A;  3VR4 A;  1JCK B;  2JEA I;  5D14 A;  1VF7 A;  4IUQ A;  1ONL A;  1EY5 A;  4KJO A;  1KDA A;  4OHJ A;  5DM7 3;  1I6H B;  3J7Y W;  1I4P A;  2EPB A;  2Y0S B;  2EXZ A;  4KY5 A;  2JA5 B;  4DN4 M;  5I2Y A;  2G9H D;  3CHB D;  1HUN A;  4OO1 I;  4XYQ A;  1S5C D;  3NPP A;  5JEA H;  2KEE A;  3TP8 A;  3IFD A;  5CGK A;  4BWG B;  1DD2 A;  3BVG A;  3EJI A;  4KI0 A;  3OHX C;  2K32 A;  1MSH A;  5M5Y B;  3RD4 A;  4B9X A;  4OIJ A;  1LTT D;  5M3M B;  1Q12 A;  2F0K A;  1TS4 A;  4IUP A;  1ENA A;  1KNA A;  1RHP A;  3PUW A;  1H9M A;  3G6J B;  3SK6 A;  3I90 A;  3OOC A;  5M5W B;  1HXY D;  3J7A F;  3D4W A;  4KV6 A;  2A6H C;  1I4Q A;  2B2T C;  1RTN A;  2VXW A;  2JYO A;  2Z8L A;  5BN3 A;  5C3W A;  1O7Z A;  1Z47 A;  2VUM B;  2F4I A;  2JA6 B;  1CZW A;  3VR6 A;  3P1H A;  1G2S A;  1R9T B;  4BS9 A;  2I46 A;  3KLS X;  3QOJ A;  1RF2 D;  1E2W A;  5G3L F;  1CA5 A;  1IKM A;  2KOL A;  3HKZ B;  3KLS A;  1SYE A;  1O78 A;  2IW3 A;  2MPM A;  3K7A B;  4RHR A;  2K03 A;  2XRQ D;  5A2Q E;  3I91 A;  5IGD A;  1PLF A;  3GP7 A;  3SVM A;  4WJW A;  4PMC A;  1EEF D;  1STN A;  4PV1 C;  2Q8T A;  5E1F A;  4M1U B;  5DM6 3;  3TDQ A;  4A3B B;  2L55 A;  2PW5 A;  3GTP B;  1QOH A;  3J81 E;  1U4R A;  3BZD B;  4KY6 A;  4C1N K;  1VMC A;  1I6V C;  3LNN A;  2DY8 A;  3DWQ A;  2NVT B;  4K14 A;  3BS1 A;  4BA2 I;  1SYG A;  1XXG A;  4S3S A;  4QIW B;  2KA7 A;  4QUC A;  4H7B A;  5NUC A;  2R92 B;  3IAY A;  4KKT A;  4Q0F A;  3DHQ A;  2B2Y A;  1HFG A;  2RDH A;  5CC4 A;  4HCE A;  3D6C A;  3OWF A;  4EQN A;  2B2W A;  3NTH A;  4ZKC B;  3VYU A;  3W2D A;  5FK9 C;  3H09 A;  4QF4 A;  4H0L C;  4ZQ3 A;  3KBG A;  4QCL A;  1W6K A;  1BF4 A;  4CGY B;  3D8G A;  3TP7 A;  1HPC A;  1FD7 D;  5EKK A;  1PDQ A;  3WDN A;  1A3T A;  3RUZ A;  1E0B A;  2B39 A;  1I4G A;  3MZ5 A;  4RCO A;  5DEH A;  2A69 C;  5I2X A;  1SEB D;  4J8Q A;  1WVL A;  1SE2 A;  3GTL B;  2IX3 A;  2EVB A;  1WD0 A;  2KCC A;  3EQL C;  3NBH A;  3BG3 A;  5IGG A;  5FLX L;  3PIO 3;  2F0H A;  2K7V A;  1X3Q A;  1LLR D;  2MJ8 A;  4A3D B;  4KMU C;  4IUT A;  4ZUJ A;  1R4Q B;  1IYV A;  5JEA J;  2IX1 A;  5CBE E;  2F0V A;  1JOR A;  2R7Z B;  1LTB D;  2HDL A;  1Q1B A;  1CK1 A;  3CKI B;  1S5E D;  2B2U C;  2DNE A;  2F0J A;  2KEC A;  4X3K A;  1EYA A;  5JAV A;  2K28 A;  4KKU A;  1UEA B;  4ID6 A;  3IKJ A;  5DAU A;  1B9M A;  3RLF A;  4FF4 A;  2BE5 C;  1TWH B;  3Q0A A;  3P7J A;  2OXP A;  4FP5 D;  4BBR B;  1F9S A;  2NVX B;  2RDG A;  2SDF A;  1JE4 A;  4OIK A;  3BDO A;  4Y7N B;  1G6Z A;  1EY7 A;  3NQI A;  3VR3 A;  5EPL A;  1B3A A;  3K5O A;  3RZD B;  5M9O A;  1UAP A;  4M8A A;  2EYF A;  1SND A;  3Q23 A;  3DEO A;  4G4K A;  1EEI D;  1J9O A;  3FKI B;  2XN9 C;  3R3O A;  4K8J A;  5I6Y A;  1Z7T A;  2K5W A;  4XXE A;  1SYB A;  3L7Z C;  1QNK A;  4L8J A;  1CA6 A;  3DWA A;  1OO9 B;  4C2M B;  1HTP A;  2F1M A;  2QCP X;  3S17 B;  1Y8N B;  4Z9C B;  5JVG 3;  1ZYR D;  3NUC A;  1AEX A;  1D6E C;  4JBW A;  3WOE A;  3QB3 A;  4DXG A;  1CQV A;  1DOM A;  3KF8 A;  3GTO B;  4G7O C;  1CQF A;  2BOS A;  1JIC A;  2KUM A;  1Q1E A;  4F87 A;  2O5J C;  2C5C A;  3HGB A;  1IW7 C;  1TII D;  1EQT A;  4NW2 A;  2F0I A;  4RCN A;  5IT9 E;  5FO9 B;  1ROD A;  3IL8 A;  1UUP A;  3TP5 A;  3SR1 A;  1LT4 D;  2NUC A;  3S2H B;  1RD9 D;  1STH A;  3DUZ A;  2D62 A;  4XQJ A;  2AQ1 B;  1MGS A;  5LL6 X;  2SEB D;  1AZQ A;  4CJ2 C;  4HED A;  1AZP A;  2AUK A;  4UAI A;  1AP0 A;  4HN7 A;  1D1I A;  3GD7 A;  1K8O A;  5C0X I;  5KYL A;  3J80 L;  1D5X C;  1I4R A;  1NR4 A;  3C1E A;  2WV6 D;  1ML0 D;  1QCB D;  5C4H A;  4RFB A;  4XTC S;  4I7Z C;  2K05 A;  5IGC A;  3MHB A;  3WOF A;  4K8I A;  2ICI A;  3U9S A;  1SYF A;  5IGE A;  1FNV A;  2DNC A;  1LAC A;  5K36 G;  1TR5 A;  5C3X A;  1GOZ A;  5ELF A;  3A56 A;  1KDB A;  3S16 B;  4DAY A;  5ISR A;  1BBX C;  4CBV A;  4ULL A;  1Y1W B;  1TY0 A;  5ELE A;  1PRT D;  1U4M A;  1VCI A;  2H1E A;  1Y8O B;  3ONA B;  4IFD I;  1OXU A;  1SYC A;  1KDC A;  1WTR A;  4AYB B;  3K5N A;  1IHZ A;  3PUY A;  3TP6 A;  4C3I B;  3V96 A;  1EOT A;  5CMD A;  2JP1 A;  4IUV A;  4K5X A;  2JE6 I;  5EGT A;  1B44 D;  4K5W A;  3I3C A;  5FO8 B;  4FXG C;  4C3H B;  2H4O A;  2V4D A;  1STY A;  3FPU B;  5CV5 A;  1I4H A;  4V19 0;  1ICW A;  3GQB A;  2L12 A;  5A35 A;  1JR0 D;  1JWU D;  2ID0 A;  2G9D A;  2D5D A;  3CRL C;  1FGB D;  1TWA B;  2LS0 1;  5EJW A;  3MXU A;  4IZ8 A;  1PFN A;  3ERO A;  2J4X A;  1YNJ C;  1KLU D;  1V1P B;  1K8M A;  4XT1 B;  5IGB A;  4PNY A;  2B2V A;  3DEP A;  3VYR A;  3I4L A;  1MBY A;  1VMP A;  1TS2 A;  1DXM A;  2ZXP A;  2PZT A;  1PTO H;  3GV3 A;  3NSW A;  3JAM L;  2CW0 D;  1WTQ A;  4RGO S;  4NKL A;  1B1Z A;  3I70 A;  3NWS A;  5D3I B;  1JB3 A;  4ZUI A;  2E2J B;  3I8Z A;  4FF2 A;  1OXV A;  3S1R B;  4XQQ A;  3E5S A;  4K6D A;  1CM9 A;  4HCS A;  1HCZ A;  3ERQ A;  3NHH A;  1EYD A;  2DN8 A;  5G3L D;  5JOB A;  1V8Q A;  5JJZ A;  2L1B A;  4OO1 G;  4RKL A;  1STE A;  2XVS A;  3I4N B;  1EZ8 A;  1GUN A;  1ET9 A;  3S2D B;  1T5E A;  4U67 3;  4FF1 A;  1F9R A;  4XDX A;  2EY1 A;  4QB4 A;  4NMZ A;  2IWH A;  2R6G A;  5COR A;  1EWC A;  3BDL A;  3K57 A;  1KNE A;  3OMC A;  5EBC A;  3KUP A;  1C48 A;  1VDZ A;  2PW7 A;  1S5F D;  2KCN A;  4C3J B;  3SK5 A;  2O2L D;  1EFI D;  4ME5 A;  1SMY C;  3M3Y B;  5K5P A;  2R3Z A;  1HFN A;  1WTV A;  4DK1 A;  3A55 A;  1LTA D;  1S4Z A;  2WKD A;  2PQE A;  1YNN D;  1IL8 A;  4KKS A;  3DM1 A;  3SK8 A;  1Y1V B;  2RBM A;  5EKL A;  4G57 A;  2LFN A;  1DCZ A;  1BNZ A;  3I72 A;  4KHV A;  4RAU C;  2NWG A;  4R9W A;  4WOR A;  4J6H A;  2XWB B;  5I4D A;  3HOU B;  3TBI B;  4C56 C;  2WP8 J;  1F2M A;  1EZ6 A;  4MN3 A;  1PYW D;  3KLR A;  1Q90 A;  1Y69 U;  3VR2 A;  1F2Z A;  2RSN A;  1VF5 C;  1II3 A;  1H9J A;  1OXS C;  4C1N I;  3E6Z X;  2MHV A;  1ESR A;  1NAP A;  2F3V A;  4X3U A;  3HEJ A;  1FNW A;  1KAB A;  2XSC A;  2K33 A;  1A3U A;  2K1B A;  4HMI A;  5CV8 A;  2RVL A;  1SE4 A;  2ICE C;  2E75 C;  3PUX A;  2E74 C;  4F7X A;  3VA5 A;  2MP1 A;  2NTS A;  4TKO B;  2M00 A;  1NUC A;  1CFM A;  1BCP D;  2EYO A;  4F8M A;  2F0U A;  3LWU A;  1S5D D;  3QOL A;  3G7L A;  4HAE A;  1CT1 D;  1V1P A;  4FXK C;  4ZKB B;  5JPM C;  1AFP A;  5K36 H;  5FOB B;  1F77 A;  2QDB A;  1W6J A;  2IL8 A;  2NN6 G;  2Z1C A;  1WD1 A;  1QNU A;  3QWN A;  1PXU A;  1O80 A;  2NN6 I;  4CKB A;  2A68 D;  4A3K B;  5BN4 A;  2XRS D;  3K5M A;  3Q6S A;  1GUT A;  2EOT A;  2L5T A;  5IOD A;  1ESF A;  2ENB A;  4A3E B;  2PZU A;  2WB1 B;  1O7L A;  3V05 A;  1HRJ A;  5CV9 A;  1UNS A;  5COY A;  4XT3 B;  1B53 A;  4HMJ A;  1EYC A;  5KNB A;  3TN2 A;  3VYS A;  1J8I A;  3RMH A;  3FEW X;  3N6R A;  3SEB A;  5C6A A;  1TKW B;  5HGT A;  1EQV A;  1U4P A;  5E3F A;  1FYC A;  2NVQ B;  1JOO A;  1EY0 A;  1SE3 A;  3CRK C;  4FO2 A;  1SJH D;  2AWO A;  4XYO A;  4CJ1 B;  3BDC A;  4CJ0 B;  2XWJ B;  4FXD A;  3HOY B;  2FFK B;  3BVM A;  1GUW A;  2NBF A;  1TS5 A;  1TVX A;  1GUS A;  1I50 B;  1M8A A;  2GA4 B;  2BE5 D;  1D1K A;  3I4M B;  2CQA A;  1XTC D;  3PUZ A;  1WTO A;  4C3I G;  1IKL A;  1OXT A;  3T13 A;  5LHY 1;  2X6G A;  1A3V A;  3AMU A;  2L4N A;  2BCO A;  3Q22 A;  4OL7 A;  2IT1 A;  4K5V A;  1E2Z A;  1CI3 M;  4HR7 B;  1A6X A;  1X3P A;  2B8F A;  4KY7 A;  3H3V C;  2LMC B;  2AUJ D;  4A93 B;  3SE0 A;  1JWM D;  1LT5 D;  2Z4H A;  3H0G B;  3NQT A;  4OO1 H;  4WRD A;  5JPN C;  2K04 A;  3ITP A;  2O5I C;  4DA2 A;  5EKI A;  4A3I B;  2B2V C;  2KED A;  4ZYS A;  1F9P A;  2SNM A;  3OSO A;  5KND A;  4KD4 A;  1DOL A;  1H9S B;  2F0L A;  1EL0 A;  2LKV A;  4EQO A;  4N9T A;  3MEH A;  5A2Q L;  1GHJ A;  4EQP A;  1SNO A;  4U68 A;  3CQZ B;  2PYK A;  1RKN A;  2E2I B;  2FJ2 A;  4DAV A;  1G8Z D;  3HS0 C;  4X3S A;  4LMQ D;  5C4J B;  1TWF B;  3J81 L;  4A3F B;  2K6A A;  3M85 A;  1TWG B;  2ZT9 C;  3R8B A;  2N88 A;  3Q24 A;  1ILQ A;  4KHZ A;  2J7Z A;  4RGT A;  5I6W A;  3S1M B;  1B2T A;  4ILW A;  1DYQ A;  3K0Y A;  3S14 B;  3MFY A;  3NBI A;  1WTP A;  3T53 B;  4RHS A;  3NK9 A;  5EPJ A;  2F0G A;  2NYZ D;  2TMP A;  2IJ0 A;  3KBX A;  1GJX A;  5C0X G;  2F0M A;  4PMB A;  2E76 C;  1M4V A;  2F0W A;  3NXW A;  1CHP D;  2BDO A;  2PNR C;  5KEE A;  3EA6 A;  3A8I E;  2A6E D;  4C3J G;  3A8K E;  2HDM A;  3GV6 A;  3I73 A;  1BO0 A;  4WFN 3;  2K5Q A;  1PZI D;  1S5B D;  3OMG A;  3NTK A;  1I3Q B;  3A8J E;  1B4O A;  4DNT B;  1A2T A;  3A7L A;  2EJF C;  1C4Q A;  4B08 A;  2IPK D;  3ZYY X;  1PTO D;  5EBD A;  4UDU C;  3OIP A;  1A2U A;  4I65 A;  2NTT A;  3FVQ A;  2PO4 A;  2EYJ A;  1STB A;  3C3L A;  3NP8 A;  1B9N A;  4IFD G;  3S1N B;  5C44 B;  1V43 A;  3H6M A;  3BYT B;  1SXT A;  1JOQ A;  1HHV A;  1SFO B;  3VR5 A;  3UI2 A;  3MXN A;  4FYD A;  2A73 B;  1BXT A;  3PIP 3;  1U4L A;  4RGN A;  5ELD A;  2QF7 A;  2NB0 A;  2BA1 A;  2B2U A;  2EYH A;  1PRT B;  1PRT C;  2LY7 A;  4NDX A;  2NN6 H;  5D65 A;  3D31 A;  1TY2 A;  3S15 B;  3BVZ A;  2HCC A;  1SSO A;  4ZK9 B;  2M2L A;  2C9O A;  2VNU D;  1SNQ A;  2ZXO A;  2L11 A;  1LAB A;  3M7G A;  1STG A;  2F0S A;  2MGS A;  2KHS A;  5J39 A;  1ZKO A;  4J1M A;  5D3D A;  4HSV A;  4MHE A;  2B2Y C;  3GTM B;  1GUG A;  1GXD C;  4DFA A;  2B2W C;  2X69 A;  1FNU A;  4KD3 A;  3K58 A;  2O4X A;  4JK1 C;  1WTX A;  2OT2 A;  2A74 C;  1E2V A;  3QIA A;  1BR9 A;  3FMC A;  3H91 A;  2RA4 A;  3GTQ B;  1NR2 A;  5ELB A;  1H9S A;  4K2K A;  1RCV D;  2VB2 X;  2I07 B;  5E4X A;  3NE5 B;  4BBS B;  5JVH 3;  5CV7 A;  4L63 B;  3KK7 A;  4FVM A;  1BDO A;  1F9Q A;  4LJZ C;  1AN8 A;  3OWE B;  1QE6 A;  1ET6 A;  1L0Y B;  4FNF A;  1TU2 B;  2RSO A;  3OW7 A;  4A3J B;  2CW0 C;  4R8I A;  2EY5 A;  3E0J A;  5KRU A;  2YYZ A;  3V2T A;  5FLX E;  1C8C A;  4PMW A;  3H94 A;  4TSS A;  3RZO B;  5BN5 A;  5J22 A;  2FHT A;  2KQ3 A;  1D5Z C;  3HZX A;  2M9V A;  5IT9 L;  1ILP A;  4RKB A;  2WII B;  3GTK B;  5E4W C;  5EPK A;  2KVM A;  4DAP A;  1BQQ T;  4LK1 C;  2NVY B;  3PMF A;  1TWC B;  2AWN A;  4QUF A;  4G7H C;  3EFX D;  2K01 A;  1SMY D;  1WCM B;  5AFW A;  4ABN A;  1G91 A;  2RDF A;  3PO3 B;  2HCI A;  2A6H D;  3X3M A;  1Y8P B;  4IAL A;  3M4O B;  2D2C C;  3HP3 A;  3P20 A;  5EQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...