4MIUA

Crystal structure of staphylococcal nuclease variant delta+phs v23t/v99t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTTKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMTNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4miuA00
1A3UA 4PNYA 4KHVA 5J22A 2EXZA 5JAVA 1A2TA 1KAAA 5IOCA 3SK4A 3C1EA 5KGUA 3OWFA 1SYDA 1U9RA 2F3WA 5DAUA 5HGTA 3OSOA 3SK5A 3LX0A 5C3XA 1SYBA 1TT2A 4I65A 4K5WA 4R8NA 4H7BA 4KTAA 2F0DA 4HMIA 1F2YA 5EKLA 4KJNA 2PYKA 1A2UA 2PZTA 5J39A 3T13A 1IHZA 2NUCA 3ITPA 1SNPA 4K6DA 4WRDA 4OL7A 3TP6A 4B9WA 1JOQA 2RBMA 2F0QA 2OF1A 3QOJA 3ERQA 1SYGA 5CV4A 2QDBA 1SNCA 4DGZA 1A3TA 1JOOA 1STHA 2SNSA 4ID6A 1STYA 4RKLA 2EYFA 3EVQA 4DU9A 2PW7A 5CV7A 3QB3A 4J6HA 1NSNS 3HEJA 5CV9A 5IGGA 5EKKA 5IGDA 1KDAA 1STAA 2RDFA 1SNMA 4EQPA 2PQEA 5E1FA 4QMGA 1EYDA 3P1HA 4QB4A 4IZ8A 5C5MA 4B9XA 2F0IA 5CR3A 3U9OA 3S9WA 2F0JA 2M00A 1II3A 4WORA 1AEXA 3E5SA 2F0MA 3HZXA 3TP7A 4EQNA 4F8MA 4NDXA 4QF4A 3MVVA 1EY7A 2EY6A 2O4XA 1TR5A 3NK9A 2F0GA 3QOLA 2EY2A 1EY0A 2F0HA 4K5XA 4DFAA 4KY5A 4K8IA 3MHBA 4K2LA 5IIFA 1STNA 2F0NA 4MIUA 3P75A 5KRUA 2KHSA 3EROA 1KABA 2PW5A 5CV8A 4KV6A 5JOBA 4HMJA 5HURA 2EYPA 5I6YA 1JORA 3NXWA 4EVOA 4N9PA 1SYFA 4IUNA 1STGA 2PZWA 3MXPA 4NKLA 4ZQ3A 3PMFA 5CC4A 5I9PA 1F2MA 2SOBA 3SK8A 1SNDA 2F3VA 3SXHA 2EYLA 3D6CA 3SR1A 3T16A 4F7XA 5ISRA 5IODA 5CGKA 5KYIA 5IGEA 2F0UA 2PZUA 5J1ZA 5F2DA 2EYMA 3H6MA 3D4WA 4KY7A 3TMEA 2F0EA 5C3WA 3NP8A 4DF7A 3DHQA 2EYHA 1KDCA 3VA5A 2RKSA 5C5LA 5IGFA 4N9TA 3OMCA 3BDCA 3SK6A 4EQOA 2F0SA 5K5PA 1A3VA 3V2TA 2EYJA 2EY5A 4ZUIA 4ZUJA 4KD3A 3R3OA 4IALA 5DEHA 5C6AA 5KYLA 2F0FA 2LKVA 3OMGA 4ME5A 4E6IA 1JOKA 4PMBA 4G57A 3NUCA 1ENAA 2F0TA 4S3SA 2ENBA 5C4HA 3NQTA 3SHLA 4K8JA 2F0KA 5IGBA 5C4ZA 3D8GA 4NP5A 5CV5A 4ODGA 4YIJA 3TP5A 3MEHA 4KJOA 1SYEA 5IGCA 3NHHA 5CV6A 4K14A 1SNQA 2EY1A 1EYCA 1EQVA 4LAAA 1F2ZA 4HTHA 3RUZA 5M9OA 4K2KA 1EY4A 2OEOA 1EY8A 1EZ8A 1EZ6A 2F0LA 2SNMA 3BDLA 4RKBA 1KDBA 1NUCA 1SYCA 2OXPA 1STBA 3C1FA 1EY5A 1EYAA 2EYOA 4PMCA 2WACA 1SNOA 2KQ3A 1ENCA 3MZ5A 4K5VA 4KY6A 1TQOA 2F0OA 4NMZA 4J1MA 3DMUA 5I9OA 1EY6A 3D4DA 1RKNA 5NUCA 4KD4A 3TP8A 5EGTA 2F0WA 5I6WA 2F0PA 2HQEA 5KEEA 3EJIA 4TRDA 5KIXA 5E3FA 2F0VA 1EY9A
chains in the Genus database with same CATH superfamily
5M5XH 1H9MA 2UXDL 2B8FA 5T1IA 4FF4A 4RGMA 1Y69U 2OTJA 4K5WA 1PYWD 4H0LC 1YNND 5FK9C 4A3JG 2N55A 3M4QA 2IY5B 4C1NK 1LT4D 2FINB 4RGNA 3TP6A 2AQ2B 3ERSX 3UE1A 3SVMA 3J7A5 1WJJA 2XRSD 3CC7A 2RHSB 4LF8Q 5CV4A 2L1BA 1SNCA 1Q12A 3G4SA 1AZQA 2GA4B 2K5HA 4RCOA 1N8RC 2L15A 4MTNA 3CP0A 5G3LD 1D6EC 4Q5VA 5CV9A 5IP7H 2TSSA 4JBWA 4LFCL 3PUYA 3IFDA 4IURA 4ULLA 4WJ4A 1DM0B 3NQIA 4A3FB 5TSSA 4JI5Q 1LTLA 4IN3A 4AH6A 5C3EB 2XRQD 2XWBB 1JJCB 1HR0L 1QVFA 3KK7A 1VQMA 2CCZA 1MHWC 1YJWA 4QQBX 5IIFA 2VQFL 4QJFA 1VF5C 2UXCQ 2AUJD 5BN3A 1Q86C 1L1OC 5AJ3L 4JC0A 3BZKA 1CFMA 2KOLA 1VQ5A 1PXUA 4DUZQ 4GNXA 1YNNC 3SE0A 4C3JH 2YV5A 4XQJA 2NWGA 2KCTA 1Q90A 3R3OA 2WB1G 4DAYB 1WTVA 1HFNA 2Z1CA 3S1QB 2Q2TA 3NQTA 2F4VQ 4LF5Q 1ET9A 2E2HB 3ZJYC 3J80L 2K14A 3BJUA 2JQOA 2DN8A 4TSSA 3UI2A 4BXXG 1EZ6A 5CBEE 4RCNA 2R7ZB 4P71A 3CQZB 1CKNA 1BBXC 1G91A 4A3DG 4XTCS 4BXXH 1D7QA 2Q8TA 3DMUA 4YHHL 2HDLA 2JA8G 2MQHA 1IYUA 2Y0SG 3DM1A 4FNFA 5NUCA 2R93G 1FR3A 3KBGA 2CVRA 1IW7C 2QEJC 3K7UC 2J7ZA 2NYZD 2E2JB 1IZ6A 1BCPD 3OYYA 4BBRG 1JE4A 4RA8A 3RZOH 1TS4A 3S1NH 4A3CG 1FJGQ 4PZ6A 5J39A 4YY3L 4LUZA 4OIKA 4JV5L 3S1MB 4DV0Q 4KI0A 3T1YL 3FKIH 2EJGC 4LJZC 2E75C 4XT1B 4KKUA 1PRTF 1H9JA 1IYVA 4V190 4QL5A 3QB3A 2BA1A 5EKKA 2RDFA 2D9UA 3WWVA 4IJHA 2PQEA 4QY7A 2E2HH 2WKDA 3S1QH 1K8AC 2Y0SB 4K0KL 1CKMA 2KCMA 4DAMA 4X66Q 3PV0A 4DR3L 1B44D 4B3MQ 5M3MH 4JOIA 4B3TL 3G6JB 3UE0A 1EFID 4J8QA 1Y14B 1O78A 4KV6A 1NTGA 4O1NA 5JOBA 3R8BA 2KA7A 4LW1A 1PLFA 3A55A 5IWAL 1STGA 3MXPA 4NKLA 1QB5D 1F9SA 1OXXK 2MP1A 5K36G 3PF5A 4QUFA 1BCPC 3QG1A 4DR1Q 1PH3A 4C3HG 2F0UA 4BY7H 3D4WA 2F0EA 4DR5L 1BF4A 3TZUA 3PGZA 2JA5G 5IGFA 1A62A 2IX0A 5FLXc 3PQIA 4IUUA 1V9PA 5IYCG 4G7HC 2FJ2A 1PRTC 1B4OA 1X56A 1VQDA 4GOPA 1PZJD 2RF4A 3NWTA 1RTNA 4X3KA 2NVQB 3LWUA 4UAIA 5BR8L 2F1MA 3QWNA 4GNXB 3K57A 4O2DA 4K2KA 1CQVA 3D4RA 4IPDA 3GV3A 3CMEA 3HOZG 1SYCA 1NAPA 1SEBD 2OXPA 3NTKA 1EWCA 2EYOA 2K5WA 2VXWA 3N6RA 1ENCA 2ZXRA 4A93B 5JJKA 1XWEA 2F0OA 2N88A 4I7AA 4J1MA 5LHY1 1BQQT 1RKNA 1YI2A 1VQAA 3IL8A 5EGTA 3NWSA 1QWYA 2HHHL 4DV1Q 3SK4A 3MXGA 4L63B 2UUCQ 4LF9L 3C1EA 3BYYB 3H3VI 3HOUH 2C9OA 2MGSA 1HR0W 2OQ0A 3CCVA 5FLXL 5K36H 4ILWA 1LO5D 3Q23A 4DR7Q 3KBXA 1JQYD 3Q22A 1MD2D 5IT9c 1PH8A 5CMDA 3K0XA 4LF7L 2K05A 2K03A 4LFBQ 1X3QA 1PV4A 1Y1WH 2BH2A 5CV7A 3HEJA 1I94L 1E2VA 2E2IB 2DUDA 2P5ZX 1Y1WB 4WJ3M 1WOCA 2XIWA 1NCVA 4IUTA 2ZM6Q 3A56A 4QB4A 1KAWA 1UE5A 4JCVE 1QJOA 1EEID 2QCPX 1PFSA 4DV5Q 4ZAIA 1ICWA 4M8AA 3NSWA 4DKAC 2O4XA 4K5XA 2F0GA 1P8LA 1SLJA 4J15A 4A3BB 5C4XB 3AEVA 1C7YA 2PW5A 1WYDA 5ELCA 1LTRD 2JA7B 5LMUQ 4PQXA 3GQBA 2QKIC 2NVYB 2QGQA 3KFUA 1YJNA 4I7ZC 1TKWB 3T53B 3CU7A 4DNIA 2L55A 4JI1Q 3D6CA 4F7XA 4A3CH 1JC7A 3BYTB 3CCLA 1B1ZA 3NP8A 4Z9CB 4DF7A 1C4QA 2ZXPA 3GD7A 1CSQA 1D5XC 2B2VA 3VA5A 5FO8B 3SK6A 1GUTA 2EYJA 3W5OA 1HUMA 1SXTA 2PI2E 1GJXA 2Q2HA 3OMGA 2CQOA 2VNUD 2PQAA 3DM3A 5C0XI 4UHVA 1PH9A 3L2PA 1I50H 1RHPA 3OTOL 3EIVA 1PH6A 3S16H 2A73B 2PQAB 2UXBL 4A76A 4U673 1UEAB 1GUOA 1RODA 1Q46A 4CJ2C 3K59A 1B50A 1CI3M 3I70A 3CHBD 5I9OA 1PTOD 1RDPD 5G3LF 3J80E 5M3FG 3MXNB 3S14H 3LNNA 4KD4A 5DLQE 2ICIA 4DN4M 3PIOA 1SJHD 1ZEQX 4GKJQ 2JA6G 2VW9A 1A2TA 1F77A 3FP9A 3P7JA 4B08A 1HQRD 5HGTA 1TWCH 1LM0A 1S5FD 1PH5A 4R8NA 1XPUA 4LF7Q 1GD7A 4JI6L 5KNBA 2R61A 2MJ8A 1G2SA 4C3IB 2E2DC 5IY0A 3HOVG 4FF3A 1TWAB 1EEFD 5EAYA 2VY3A 4MZ9A 1DOMA 1GOZA 5JVG3 1VQIA 3GV6A 1UWVA 1V1PB 3H3VC 1JWMD 3GTKB 2VQEL 4LF9Q 2KVMA 1QCBD 1SROA 1MGSA 3WDNA 5I4DA 1LTSD 4TKOB 4HCSA 4IQZA 4P72A 5IP7G 4XYQA 2J0TD 3E5SA 4QF4A 1TR5A 4IJLA 3GP7A 3MFYA 1EY0A 2F0HA 3JAME 1XNRL 1KABA 5I6YA 3NXWA 1Q1EA 1LTBD 1ENFA 5BN5A 5D3DA 2NVTB 2TMPA 2A69C 5JJIA 5KNCA 4BY7G 2Q8RE 4HEDA 4A93G 3KOJA 3DXJC 2IHEA 2QILA 3EN2A 3CRKC 4OXPA 2ASBA 5C5LA 1HNXQ 3GTPB 1GUSA 2EOTA 4A3LH 3MA2B 3I4OA 3GTMB 2EY5A 3VYSA 1NR4A 1UE7A 3TN2A 1SDFA 4R4QA 4E6IA 4OWWB 4G57A 4JPBW 4S3SA 1I6VC 5IP9G 1N33Q 1H9RA 4KLKA 3QIAA 4XYOA 3D8GA 4ODGA 1SRUA 2KEDA 3G7LA 1QNUA 3NHHA 2H1EA 3FEWX 2SNMA 3OHXC 2CH4W 2K33A 2I46A 4B3TQ 1OO9B 3J81i 3GTPH 1E22A 5BN4A 1TQOA 1Z47A 2R7ZH 4RHSA 4P2CB 3CF5A 2HQEA 4A3KG 4NPSA 5IYBH 2F52A 4MN3A 1D2BA 2HIVA 3EBEA 4IFDJ 1HXYD 3E3XA 1BBUA 3AU7A 1HZBA 4P73A 4JI7L 4JVZA 1ZYRC 2D2CC 2X69A 4DPGA 4WRDA 1PH4A 4GN4B 4EQ5A 2F0QA 4OONA 4O42A 4YY3Q 4DV4L 1QZGA 1FJGL 3E0EA 4GLAC 5COYA 1DOLA 3FMCA 1JOOA 5EQ0A 1X32A 3NE5B 4XIGS 3EVQA 4APVA 2JEAI 4FXDA 4JI0L 5M3FB 1GO3E 2NN6H 2IPKD 1TU2B 3IRBA 1BCPF 1HJPA 4JBKA 2AHOB 4YHHQ 3R2IA 2LSSA 3I4MH 5A2QL 4JBJA 3HGBA 4NDXA 1CA5A 1EY7A 4CKEA 3BG3A 5CBAE 4ABNA 2JEBI 1N32L 2WP8J 3CMAA 1CTMA 3D0FA 5GAGC 4GKKQ 2KHSA 4EX5A 1VQ7A 3NTIA 1Y8OB 5D3IB 3H94A 4PZ7A 4JK1C 4C3JG 1X54A 1EQQA 2N3SA 5M5YH 1LUZA 4IUVA 5IP9H 1PZID 1HA6A 2CWPA 1HCZA 3HOXB 1MSGA 4DAPA 1JCKB 4Y7NB 4R4IA 4GNXC 1VQOA 3PF4A 1YZ6A 2XNAC 4PV1C 4N9TA 2K5NA 3MTSA 3OWEB 3S17H 3STBD 3EA6A 2NTSA 1ICFB 4ME5A 4QIWE 1E3PA 1G2TA 1XMOL 1I3QH 4GN3B 5C4HA 4DV6Q 2K75A 3I3CA 4QIWB 1V1OA 4IPHA 2XSCA 5JPMC 4BY1H 1F2ZA 2JXMB 2UXCL 4EGVA 2FHTA 2QW7A 2XVSA 5JJZA 2ZT9C 1E1OA 4IUPA 1HR0Q 1PFNA 1Y8NB 4KY6A 1J5EQ 3PO3B 3FDTA 1RF2D 4JBMA 4BY1G 2A1AA 4UY8C 4R4CA 4KHVA 2IJ0A 3K7AB 2VS1A 4R8IA 3SK5A 1D1KA 2AKWB 4L8JA 3RLOA 4A75A 1LTAD 3ZYYX 4HMIA 3SGIA 3KUPA 4K6DA 1JOQA 4R1JA 1ILPA 4BA1I 2AQ3B 3CCUA 3CQZH 2B2TC 4DV6L 3TS0A 1EFWA 1U4MA 1W6JA 1V43A 1SSOA 3F2UA 5IYDH 1WTPA 1N36Q 1S5ED 1F9RA 1MJEA 4JYAQ 4DU9A 1YNXA 2JA6H 3TRZA 1EUJA 1NSNS 2UXDQ 3IKJA 3DEOA 3VYTA 5CORA 3CCRA 1HZCA 1H9SA 3GO5A 3CAMA 2H5XA 1IL2A 1N34Q 4CJ0B 2HD3A 4HCEA 1K3BC 2EY6A 4RGTA 1XMQL 4CJ1B 2AWNA 5A2QE 4MIUA 5KRUA 4DV2L 4OHJA 2IWHA 3MWYW 1NY4A 1K73C 1S5BD 4XDXA 1OXTA 3TBIB 3HP3A 4DR6Q 3KLSX 1U4RA 3SK8A 1E1TA 4ME3A 3PUXA 3A8JE 5KYIA 1Q8KA 2PZUA 1LTTD 2EYMA 3TMEA 1K83B 3IAYA 5C3WA 3S17B 4JI0Q 1PTOC 4B3SQ 5FLMH 3VR4A 2RCFA 3VDYA 2A6ED 2LKVA 3KLWA 3BU2A 2WAQG 3HOXH 3CKIB 2K50A 4X65Q 4LUOA 1WTHA 4B3SL 3I2ZA 4HTHA 2JA7G 3MAQA 1C0AA 3Q0AA 4JI7Q 3NELA 3ND8A 1FL0A 1KDBA 2A69D 4IO9A 2WACA 3H09A 4Y52H 2I5MX 4AQYL 1YNJD 4A3GB 3I55A 3U50C 3H0GH 4DR6L 3EJIA 2LY7A 3A7AB 2F0VA 1VQKA 1HUNA 1WFQA 2K32A 4PNYA 4LNQA 1F9QA 2EXZA 2ZJPA 3PO2H 1BDOA 1XXGA 3VR6A 5DAUA 3T1HL 5GAEC 1Q82C 3DWAA 3H15A 1EIYB 5FJ8H 1BBWA 2NUCA 4A3IH 1CZGA 2AMCB 4JI3Q 1B9MA 4A93H 3Q6SA 4JI8L 2E76C 2DGYA 3KYHC 5EPJA 1W6KA 3R2TA 3RLNA 5C0XH 2EXDA 4JYAL 2DY7A 4ZK9B 4IOAA 1IKMA 1XPOA 1VMPA 5C0XJ 1N36L 4BY1B 2CWAA 3PO2B 4OGQC 2L9HA 1B7YB 1K8MA 3N52A 3MC0B 3CC2A 2YTXA 3MVVA 3HS0C 5K5PA 4JI2Q 1UE1A 5JPNC 3MHBA 3RZDB 1GM5A 1CA6A 1HHVA 2MO0A 1PFMA 5HURA 3I4MB 1JORA 1PH2A 4N9PA 4DXGA 1TIID 1S40A 1NMGA 3A54A 2UUAQ 4A3DB 2E2JH 1GKHA 3KDFB 4HIMA 2QDLA 2RQXA 2MNAA 2IX3A 1MKHA 1J5EL 4NXNQ 5EBCA 5IGEA 1EYGA 3CXCA 2DY8A 2Q2UA 3VR5A 2JA5H 2BDNA 2RKSA 1JWSD 1WCMG 3X3NA 4EQOA 2JA5B 4YCWA 2R6GA 2NB0A 3OW2A 1K0RA 3MXNA 1SFOB 1JOKA 1UUPA 1B3QA 3W2DA 1I6HH 2Z6KC 1ASYA 1UNSA 4C1NI 5IGBA 1XMOQ 1G6ZA 1RIPA 5CV5A 2KCCA 3J7ZC 1KLUD 1KTKA 2EY1A 1EQVA 5M3FH 4X64Q 2LMCB 5M3MG 1YNJC 4LUVA 2EVBA 3RNUA 3S2HH 4DAVA 1SAPA 1IW7D 1SNOA 4KN7C 2FMMA 2Z6BA 1Z7TA 1AP0A 1PH1A 2NVXB 5FO9B 4OWTB 2F4IA 4L5TA 3G71A 4FYDA 3CC4A 5GROA 3CPFA 4AIMA 2B2UC 4RWSC 5IOCA 4HJ9A 2EZVA 3A0JA 3I56A 1FGBD 1KRSA 4NW2A 1EU3A 3C46A 4I65A 2DJGC 2UXBQ 4DR4Q 3QR8A 3PO2G 2X6GA 4C2MB 4A3MH 1GUGA 2RCNA 4BBRH 5LMNW 3HKSA 3E6ZX 4QGUA 1PHJA 4X62L 5T1GA 2C35B 1SNMA 2JA9A 4LK1C 5E1FA 1I4HA 1E2WA 4LMQD 5C4JB 4A3DH 2B2YC 1AEXA 3GTLH 3AQQA 2RSNA 5I2XA 3QOLA 3J7AV 1O7ZA 1QVCA 5LMUL 1STNA 1S5DD 1VQFA 4MTKA 1RD9D 1Y1WG 1T9HA 4DA2A 3HOUB 2SDFA 1G6PA 5C3EG 5D14A 5F2DA 3GTKH 2RA4A 3W1GA 2JSOA 3W3AA 1I94Q 5IYBG 4BBSG 3K5LA 1Q7YC 2ZJRA 2KHIA 4C2MH 4A3MB 1K83H 4LFBL 2EPBA 1FNVA 1JJGA 1HRJA 1C48A 3NUCA 3CCSA 1MBYA 3HOYB 4DR7L 1LLRD 3CCQA 2A6EC 1LT3D 5M9OA 2ZTCA 5FO7B 3KDFA 1EY8A 4HSPA 2F0LA 1HNXL 3EFXD 1R4QB 1NUCA 2WKCA 1EL0A 2UUCL 3GTGB 3S14B 4UP9A 1YIJA 2KQ3A 3MZ5A 1M90C 1KNEA 1TWGB 4NMZA 3FVQA 1Q8IA 2G9DA 3L7ZC 3PO3G 2O2LD 1DONA 5ELBA 2M2LA 4TRDA 4MNOA 4FDBA 3V96A 1HZ9A 3L3OC 3K81C 2HUGA 2KBNA 4IFDI 2F3WA 1IXRA 4RGOS 3HOWH 1SYBA 1VQEA 2F0DA 1MI2A 2Y0SE 2PYKA 2CFMA 1CUKA 4OL7A 1L0WA 1ESFA 5JEAJ 1F2LA 3J81j 3HOWG 2K5DA 3J7AF 3HG9A 1O7IA 4N8X1 2QDBA 4AYBB 4BA2I 3DEPA 4JOIC 3AYHB 3GTOH 3S24A 3M4OB 1X3FA 3LGJA 2NZ1D 1KDAA 1OXSC 1KQSA 4A3EG 2EE1A 3KLRA 2BH8A 2OT2A 1CM9A 3BS1A 4DR1L 5JEAG 5CR3A 1EWIA 1DYQA 1II3A 3TP7A 4JI6Q 3URYA 1JWUD 3K6OA 2O5JC 1B9NA 2WIIB 4RHRA 1DD2A 4OO1H 2EYPA 2JE6I 1IL8A 1SYFA 4B3ML 4L5QA 4CDCC 5CC4A 3PMFA 3CCMA 1D5MC 4X66L 3SXHA 4TQUS 4C3IG 2HCIA 1O7YA 3V05A 5CYUA 3GTOB 2NVYH 2JA6B 3H6MA 2BDOA 1H9SB 4AYBG 3DHQA 1B70B 2E5LL 1EQTA 1X3GA 3TREA 1PA6A 5C3EH 1X65A 1QUQB 4G7OC 2F0FA 4HIDA 2WFWA 4HIKA 2ENBA 4OELB 3TZDA 4DV0L 2G9HD 2RDGA 4KJOA 3L0OA 5IGCA 2UU9Q 5M5YB 4RH6A 2ICEC 2NN6I 4CDEC 1K28A 4X62Q 2E2IH 2NVQH 2VUMH 1GUWA 4K6LA 4P75A 4BS9A 1WTRA 2XN9C 3I4NG 2NBFA 1EY5A 3AB9A 5DM63 3HKZG 4OX9L 2XGTA 1KIXA 4POGA 1E24A 1ZXTA 1ET6A 4Y7NH 4OWXB 1VDZA 4BY7B 2F0PA 1VQCA 4DR4L 1A3UA 5ELDA 4CKBA 1VQHA 3FRPB 5KGUA 3KF6A 3OWFA 1B3AA 1R9TB 4KTAA 4BBRB 4CDDC 4KJNA 4DV5L 1WTOA 4CDFC 5ELEA 4B9WA 4LF5L 5IT9E 2ZM6L 3Q8DA 3ERQA 4NB3A 3JC66 4C3IH 3W1BA 1GHJA 2FXQA 1A6XA 4RKLA 1HTPA 1QVGA 1STYA 1VQNA 2EYFA 3S16B 2C5CA 4FXKC 4OEMB 4YCUA 3MFGA 3U4ZA 4DUZL 1TS3A 1YITA 4H02A 3P20A 1WTWA 2Z8LA 4EQPA 4RMFA 1D8LA 1ONLA 2L12A 4KHZA 4DXFA 3HRZC 2NVXH 2K01A 1SE3A 5JVH3 1BR9A 4DFAA 1CT1D 3S1MH 3HOYG 1AH9A 2K52A 1KLGD 2VB3X 3GTJH 4A3EH 1DCZA 5EJWA 2B2VC 4DK0A 2VQFQ 4HMJA 3GTLB 1Y1VH 4A3LG 2YU9B 2HHHQ 5C4JH 4L5RC 5I9PA 1LTID 1F2MA 4NXNL 1AW7A 1LV9A 3SR1A 4JI5L 3U4VA 5I2YA 3QJYA 4GLVB 3K5NA 2PNHA 2CW0D 1NR2A 4DAYA 4DK3C 4IPGA 4ZKBB 2UUAL 2X6LA 1JR0D 4GOPB 4FF1A 1DOKA 3PIP3 3OMCA 4A3JH 4CHTB 4KD3A 4IALA 5AFWA 1FNUA 1KC8C 2JJQA 2Z6KA 1XJVA 2F0KA 1C8CA 1GVPA 1JB3A 2OWOA 4YIJA 4LWCA 3VYRA 4POFA 3F2CA 3HOZH 2MUYA 1B2TA 1VQ6A 5M5WB 5JJLA 1S4ZA 4LAAA 3ND9A 4L6TB 3UDXA 2OEOA 4LF4Q 4C56C 1WVLA 1JMCA 2B63G 3PCOB 4JI8Q 3I7FA 2ZTDA 2I5HA 3JAMc 4RAUC 1K8GA 4DR2L 5EPKA 2D0OA 1R9TH 2ES2A 1KL9A 3STBC 5I6WA 1LACA 5IWAQ 3D31A 3T1HQ 1D1IA 1LT6D 2HCCA 1HNZL 1ML0D 2I0QA 1L1OA 3GTQB 3Q24A 1TT2A 4A3BG 5C4XG 4DR3Q 3PUVA 1EOTA 3JAML 4BBSH 4A3IG 5HGQA 3NEMA 1TVXA 3ULPA 1SNPA 1SMYD 1KNAA 2L0CA 3X3MA 3RZDH 1Y1VG 2GN5A 4AQYQ 1FYCA 1Z6HA 1IBML 4KHPQ 1SYGA 3D3RA 4G7ZC 3I4NB 3UDFA 2VZAA 1SJED 1CHPD 2K7VA 1RTOA 2B2UA 2B8GA 1YVCA 1PTOH 4KKTA 4J6HA 3CPWA 2D62A 3J81L 3H0GB 5ELFA 4ZKCB 1H95A 5ELNA 3S9WA 3J80i 3KF6B 2F0JA 4WORA 3HZXA 1KD1C 1I5FA 2LXKA 4K8IA 4R9WA 2DNEA 3RN5A 3KLSA 4NXMQ 5CV8A 2AWOA 3ULJA 3FKIG 4FF2A 4A4IA 4ZQ3A 2CQAA 3HOXG 1LABA 1SNDA 4CGYB 3JAMi 1GHKA 3U58A 1QOHA 1DXMA 1P16A 1SN8A 3M7GA 4FO2A 2OTLA 4KY7A 2ALYB 4R4OA 1KDCA 3EQLC 4DNTB 4A3MG 1IKLA 4P74A 1VQ8A 2F0SA 2OCEA 4DV2Q 2A8VA 4ZCKA 3S2DB 4BBSB 1CKOA 3SDZA 1TWHB 4A3IB 2V4DA 1CQFA 1NJIC 2F4VL 4F87A 1N34L 1HNWL 3UDIA 2MFIA 5C4ZA 3A5UA 3I72A 1SNQA 1PH7A 2JK8A 1TXYA 3PIPA 1EY4A 5M5XB 1PTOB 2CKZB 1MJCA 1RJTA 1STBA 3OW7A 1EYAA 1XTCD 2LXJA 2BE5C 3DWPA 4F88A 1MIUA 3S2HB 4C3HB 4X3TA 1U0LA 2WAQE 3UDGA 4DV3Q 2Q2IA 3TP8A 2F0WA 5KEEA 1TS2A 5ELOA 3J81E 5KIXA 5E3FA 1IBKQ 1SR3A 1YHBA 1HPCA 3M4OH 5JAVA 4KN4C 2I07B 5IYDG 1Q3LA 1U9RA 1J9OA 3OSOA 1YHQA 2ZXOA 1PYSB 3I90A 1IBMQ 2PZTA 1IHZA 2MO1A 2YYZA 1EIHA 4C3JB 4XQNA 2OF1A 4OO1G 2A74C 4LFCQ 4CBVA 1BVSA 2K4KA 3HOWB 4DGZA 4GOPC 1JICA 4V0BA 5LL6S 4OIJA 2M9VA 3NBHB 5JEAH 1E0BA 2R92B 1JB7A 3I8ZA 4A3FG 4TVAB 4OO1I 1EIFA 2NZHA 2F0IA 2RVLA 3RR5A 3OOCA 4KK7A 3DLLA 1YBYA 3BZDB 2EY2A 1Q1BA 2F0NA 3P75A 3BVMA 4LF4L 4GZYC 1K0SA 4ALPA 4EVOA 5J3BA 1PZKD 2B39A 2DNCA 2HDMA 2UUBQ 1EQRA 5IODA 1N9WA 1JT8A 1EWHA 3MXUA 4RG1A 1E7ZA 2RSOA 4DNRB 1J6QA 4GKKL 1A3VA 4FP5D 2CW0C 1TWGH 3PO3H 1TY2A 1CZWA 4BWGB 1N32Q 5KYLA 2B2TA 5HY6A 2FMCA 2KENA 1SBBB 1TWCB 1K8OA 1KRTA 3A7LA 3U9SA 1WTXA 1LYLA 2A19A 2PMZE 2XTIA 2N8NA 1EYCA 4HN7A 1HFGA 2L11A 3BDLA 2G5DA 1SMYC 3RLFA 3C1FA 1TWHH 5L37A 1CKNB 2VL6A 1BOSA 4DV4Q 3DWQA 3HOVB 3HKZB 1VQPA 2Z4IA 1EY6A 1K9MC 2B29A 2NZOA 3F8TA 1JJ2A 1J8IA 2RHQB 3KF8B 4G4KA 5E4WC 1PFBA 3T4AC 1X55A 2AUKA 4YWLA 1WCMB 1PYBA 1QG7A 2WAQB 4LFAQ 1U4LA 5C3XA 3KF8A 3A8IE 2R92G 3M4PA 4IUQA 4HJ5A 1S72A 3M85A 2RBMA 2YTVA 3VA7A 1BKBA 1BNZA 3OIQA 4RFBA 2JA8H 2GVAA 4N8FA 2R93H 1PDQA 1H9KA 1ZYRD 2SNSA 4ID6A 1GXDC 1I4RA 5M5WH 5C44G 1PTOF 3AFPA 2MPMA 2WV6D 2Z4HA 4FXGC 1D5ZC 1ILQA 1C9OA 2L4NA 3IFTA 2HT1A 5GAHC 4UP8A 1UAPA 4IZ8A 4B3RQ 3U9OA 1VF7A 3T51B 1N33L 2F0MA 1QZHA 2JP1A 4OX9Q 3NK9A 4A3GH 1OTCA 2CHBD 4KY5A 2L5TA 3EROA 2D5DA 2B63B 2OQKA 2ATWA 2N78A 4X6AH 2KECA 5GQOA 2WB1B 4IUNA 3J80c 2UU9L 3GTQH 2SOBA 2F3VA 2EYLA 5FOBB 4IFDH 2CH4A 4PG3A 5J1ZA 3PSIA 1YJ9A 4DUYQ 2Z9HA 1STEA 3OPOA 4ZLTF 2BE5D 2EYHA 2IW3A 1F9PA 3BDCA 4Q0FA 1XNRQ 2GVBA 2E5LQ 5DEHA 2A68D 1SE8A 2PI2A 5LMNQ 3O13A 1DGSA 1XNQL 1QILA 1E2ZA 1FVIA 4PMBA 4DV7Q 2F0TA 3QO2A 2DJFC 2B3GA 1KXLA 3S1NB 2XWJB 4NP5A 3TP5A 3OIPA 1NNXA 5CV6A 3M3YB 1ASZA 2FFKB 2VQEQ 1EZ8A 1L2FA 3K58A 1MSHA 3RMHA 2E8GA 2AQ1B 2R7FA 3E0JA 3K80C 1YHAA 1QUQA 1OXUA 4O0AA 1IBLQ 2WB1E 4HSVA 4XT3B 3BDOA 1A15A 1EY9A 4HJAA 4UPAA 1EOVA 3CW2C 1SYDA 1I3QB 3LX0A 1VQ9A 3GDEA 3KJOA 1HQMC 4JG2A 3PUZA 4XXEA 3KJPA 1ESRA 4GKJL 5EKLA 3HOVH 1V1QA 3ITPA 5FKAC 2HIXA 1JE5A 2I5LX 1HTLD 3G48A 2NTTA 2Z0SA 1X9NA 4DV7L 4JI4L 1XNQQ 2PO4A 2RDHA 2EJMA 2EIFA 2H4OA 4IFDG 1A3TA 1HH2P 1CHQD 3L9AX 3OTOQ 4DUYL 4QMGA 1M4VA 2IHFA 2A6HC 4B9XA 4DK6C 4A3GG 1QNKA 4H13C 2R7DA 4LF6L 1I4QA 2EJFC 2EDGA 2NN6G 2F3IA 3BZCA 3K5OA 2KCNA 5D65A 2F03A 3HKZE 3T16A 4JI1L 3WOEA 4B3RL 1AFPA 3G6EA 1NBWA 4UDUC 1HA5A 2ZTEA 3NPPA 3J7YW 3DUZA 3FHWA 4YWKA 1A63A 3H0GG 2V1CC 1TY0A 2N49A 4ZUJA 2PMZB 1W2BA 3AFQA 4GLXA 2BCOA 1Z9FA 5LL6X 3RZOB 3HFZB 1B8AA 1A0IA 3BVGA 3CRLC 4A3KH 2VUMB 4K14A 5DNFA 1VQ4A 1WD1A 3AMUA 3PUWA 2JA7H 2R7ZG 4IPCA 1L0XB 1XX8A 3K8AA 4CKCA 2K04A 4A3JB 1NMFA 1U5KA 2LS01 5C44B 1FD7D 4MHEA 4QUCA 5FLMG 2K6AA 1VS0A 3K0YA 1A8VA 3I73A 2LFNA 2WINB 3S15B 1RCVD 3VR2A 2HQLA 4A3KB 1VMCA 1HZAA 2D0PA 2YU9H 3HOZB 4HAEA 2VB2X 1SFOH 4LF6Q 4H7BA 4DV1L 1ZKOA 1A2UA 3QOJA 3F2BA 2JYOA 3VR3A 1UE6A 1Q81C 3HOUG 3ONAB 4HJ8A 2QA4A 1M8AA 1STHA 1BO0A 1GUNA 5IGGA 5IGDA 3E9IA 5FLXE 2K5QA 4KKSA 3C3LA 3M3YH 4JI4Q 1PRTB 3E9HA 3BVZA 3R93A 2K1BA 2K5VA 5C5MA 5BR8Q 4HIOA 3LWEA 3J81c 1XPRA 2A68C 2M00A 2A5HA 1PVOA 1K3RA 4F8MA 4PZ8A 4EQNA 2Q8IB 1G291 2ZJQA 3GTJB 1VQGA 5DM73 1T5XD 3CCEA 4X3SA 4A3FH 4QCLA 1L1OB 4X64L 5GADC 1KHIA 3I91A 3T56B 5IT9L 4DR5Q 2YTYA 1WCMH 3A8KE 3CCJA 5KNDA 1M1KC 1IBLL 3SEBA 4L5SA 4GN5A 3CD6A 3MEFA 3TS2A 5CGKA 3ICEA 5IYCH 3ER0A 3RN2A 4PMWA 2EQSA 1VCIA 2KEEA 1S3OA 2E74C 1I4PA 3F2DA 4C3HH 5C6AA 3GTGH 1I4XA 1EIGA 4K0KQ 3TDQA 5IE8A 1CSPA 4M1UB 1WD0A 5LMNL 1SYEA 3S1RH 3M7NA 1T5EA 1OXVA 1EU4A 5EBDA 4AYBE 3D6WA 3HOYH 3F1ZA 1O80A 1I4GA 1PMRA 4ZRZA 2PCFB 4WFN3 1L0YB 1BXTA 4HR7B 4JI2L 5M3MB 4PMCA 5C0XG 1IBKL 2KHJA 2MHVA 4K5VA 1R4PB 2B2WA 1QE6A 3T1YQ 1VQJA 4DV3L 2PPBC 4JV5Q 3NTHA 5FJ8G 2IX1A 4IOCA 1G8ZD 5J22A 1XYIA 1KAAA 3H91A 2BOSA 3VYUA 1W3SA 1XTDA 3S1RB 2PNRC 3A5ZB 3C2PA 2J4XA 1F2YA 5EPLA 4YWMA 4KMUC 1LTGD 3T13A 4JI3L 2QF7A 2IL8A 1HNWQ 3M9BA 1SMXA 4ZYSA 5EKIA 3H3VH 1TWAH 4JW0A 3M4YA 1SE4A 2K28A 2ID0A 1TWFB 1U4PA 4H44C 3RD4A 1S5CD 1LT5D 2KUMA 2PW7A 2KJXA 3A74A 3I4MG 1STAA 1SE2A 1O7LA 1I6HB 1DJRD 2O5IC 4WJWA 1EYDA 3P1HA 1I50B 3ULLA 1IYJB 4GS3A 1FNWA 4FVMA 1WI5A 5C44H 3I4NH 1CK1A 2SEBD 1PRTD 1X3PA 5H1SE 4LFAL 1Y8PB 4K2LA 2VUMG 3B6YA 2A6HD 1AZPA 3NBIA 1VQLA 1UEBA 2IT1A 4NXML 1BUVT 2PZWA 3K7AH 4X3UA 1AE2A 3TQYA 4DK1A 4X65L 3S15H 2JN4A 2B2YA 5ISRA 1TS5A 2B2WC 2R92H 5AJ3Q 1TWFH 1Y1VB 5E7NA 4U68A 1FGUA 3TSSA 2JA8B 2R93B 3S2DH 3K5MA 1B53A 2QEXA 3V2TA 5C4XH 4A3BH 4ZUIA 3FKIB 3TEHB 4HJ7A 4UP7A 4KHPL 1ENAA 1RL2A 3SHLA 1VQBA 4K8JA 1V1PA 3PIO3 1WTQA 1X3EA 1AE3A 3MEHA 2NVTH 3RUZA 2R3ZA 3NBHA 4RKBA 1V8QA 3FPUB 1HNZQ 2B63H 1XMQQ 2BA0A 4A3EB 1X6OA 4LF8L 3FPPA 1BCPB 3GTMH 4R4TA 1DZ1A 5A35A 3NENA 2UUBL 3D4DA 5E4XA 1YEZA 1NE3A 4YCVA 4XQQA 3WOFA 1G51A 4DR2Q 1AN8A 3I4LA
chains in the Genus database with same CATH topology
1H9MA 2B8FA 5T1IA 4FF4A 4RGMA 1Y69U 4K5WA 1PYWD 4H0LC 1YNND 5FK9C 2N55A 4C1NK 1LT4D 2FINB 4RGNA 3TP6A 2AQ2B 3SVMA 2XRSD 5CV4A 2L1BA 1SNCA 1Q12A 1AZQA 2GA4B 4RCOA 5G3LD 1D6EC 4Q5VA 5CV9A 2TSSA 4JBWA 3PUYA 3IFDA 4IURA 4ULLA 1DM0B 3NQIA 4A3FB 5TSSA 4IN3A 5C3EB 2XRQD 2XWBB 3KK7A 5IIFA 1VF5C 2AUJD 5BN3A 1CFMA 2KOLA 1PXUA 1YNNC 3SE0A 4XQJA 2NWGA 3R3OA 1Q90A 1WTVA 1HFNA 2Z1CA 3S1QB 3NQTA 1ET9A 2E2HB 3J80L 2DN8A 4TSSA 3UI2A 1EZ6A 5CBEE 4RCNA 2R7ZB 3CQZB 1G91A 1BBXC 4XTCS 2Q8TA 3DMUA 2HDLA 4FNFA 1IYUA 3DM1A 5NUCA 1FR3A 3KBGA 2CVRA 1IW7C 2QEJC 2J7ZA 2NYZD 2E2JB 1BCPD 1JE4A 4RA8A 1TS4A 5J39A 4OIKA 3S1MB 4KI0A 2EJGC 4LJZC 2E75C 4XT1B 4KKUA 1PRTF 1H9JA 1IYVA 4V190 3QB3A 2BA1A 5EKKA 2RDFA 2D9UA 2PQEA 2WKDA 2Y0SB 3PV0A 1B44D 3G6JB 1EFID 4J8QA 1O78A 4KV6A 4O1NA 5JOBA 3R8BA 2KA7A 1PLFA 3A55A 1STGA 3MXPA 4NKLA 1QB5D 1F9SA 1OXXK 2MP1A 5K36G 4QUFA 1BCPC 3QG1A 4C3HG 2F0UA 3D4WA 2F0EA 1BF4A 3TZUA 5IGFA 2IX0A 4IUUA 4G7HC 2FJ2A 1PRTC 1B4OA 1PZJD 4X3KA 3NWTA 1RTNA 2NVQB 3LWUA 4UAIA 2F1MA 3QWNA 3K57A 4K2KA 1CQVA 3D4RA 3GV3A 1SYCA 1NAPA 1SEBD 2OXPA 3NTKA 1EWCA 2EYOA 2K5WA 2VXWA 3N6RA 1ENCA 2ZXRA 4A93B 1XWEA 2F0OA 2N88A 4J1MA 5LHY1 1BQQT 1RKNA 3IL8A 5EGTA 3NWSA 1QWYA 3SK4A 3MXGA 4L63B 3C1EA 3BYYB 2C9OA 2MGSA 5FLXL 5K36H 4ILWA 1LO5D 3Q23A 3KBXA 1JQYD 3Q22A 1MD2D 5CMDA 2K05A 2K03A 1X3QA 5CV7A 3HEJA 1E2VA 2E2IB 1Y1WB 2XIWA 1NCVA 4IUTA 3A56A 4QB4A 1QJOA 1EEID 2QCPX 4ZAIA 1ICWA 4M8AA 3NSWA 2O4XA 4K5XA 2F0GA 4A3BB 5C4XB 2PW5A 5ELCA 1LTRD 2JA7B 4PQXA 3GQBA 2QKIC 2NVYB 4I7ZC 1TKWB 3T53B 3CU7A 2L55A 3D6CA 4F7XA 1JC7A 3BYTB 1B1ZA 3NP8A 4Z9CB 4DF7A 1C4QA 2ZXPA 3GD7A 3VA5A 1D5XC 2B2VA 5FO8B 3SK6A 1GUTA 2EYJA 1HUMA 1SXTA 1GJXA 3OMGA 2VNUD 5C0XI 1RHPA 2A73B 4U673 1UEAB 1GUOA 1RODA 4CJ2C 3K59A 1B50A 1CI3M 3I70A 3CHBD 5I9OA 1PTOD 1RDPD 5G3LF 3J80E 3LNNA 4KD4A 2ICIA 4DN4M 1SJHD 1ZEQX 1A2TA 1F77A 3P7JA 4B08A 1HQRD 5HGTA 1S5FD 4R8NA 5KNBA 2R61A 2MJ8A 1G2SA 4C3IB 2E2DC 4FF3A 1TWAB 1EEFD 1DOMA 1GOZA 5JVG3 3GV6A 1V1PB 3H3VC 1JWMD 3GTKB 2KVMA 1QCBD 1MGSA 3WDNA 5I4DA 1LTSD 4TKOB 4HCSA 4IQZA 4XYQA 2J0TD 3E5SA 4QF4A 1TR5A 3GP7A 3MFYA 1EY0A 2F0HA 3JAME 1KABA 5I6YA 3NXWA 1Q1EA 1LTBD 1ENFA 5BN5A 5D3DA 2NVTB 2TMPA 2A69C 5KNCA 2Q8RE 4HEDA 3DXJC 2QILA 3CRKC 5C5LA 3GTPB 1GUSA 2EOTA 3MA2B 3GTMB 2EY5A 3VYSA 1NR4A 3TN2A 1SDFA 4E6IA 4G57A 4S3SA 1I6VC 1H9RA 3QIAA 4XYOA 3D8GA 4ODGA 2KEDA 3G7LA 1QNUA 3NHHA 2H1EA 3FEWX 2SNMA 3OHXC 2K33A 2I46A 1OO9B 5BN4A 1TQOA 1Z47A 4RHSA 4P2CB 2HQEA 4MN3A 1D2BA 4IFDJ 1HXYD 3AU7A 1ZYRC 2D2CC 2X69A 4WRDA 2F0QA 4O42A 5COYA 1DOLA 3FMCA 1JOOA 5EQ0A 1X32A 3NE5B 4XIGS 3EVQA 2JEAI 4FXDA 5M3FB 2NN6H 2IPKD 1TU2B 1BCPF 3R2IA 5A2QL 3HGBA 4NDXA 1CA5A 1EY7A 4CKEA 3BG3A 5CBAE 4ABNA 2JEBI 2WP8J 1CTMA 2KHSA 3NTIA 1Y8OB 5D3IB 3H94A 4JK1C 4C3JG 4IUVA 1PZID 1HA6A 1HCZA 3HOXB 1MSGA 4DAPA 1JCKB 4Y7NB 2XNAC 4PV1C 4N9TA 3OWEB 3MTSA 3EA6A 2NTSA 4ME5A 1G2TA 5C4HA 3I3CA 4QIWB 1V1OA 2XSCA 5JPMC 1F2ZA 2JXMB 4EGVA 2FHTA 2XVSA 5JJZA 2ZT9C 4IUPA 1PFNA 1Y8NB 4KY6A 3PO3B 3FDTA 1RF2D 4KHVA 2IJ0A 3K7AB 4R8IA 3SK5A 1D1KA 4L8JA 1LTAD 3ZYYX 4HMIA 3KUPA 4K6DA 1JOQA 1ILPA 4BA1I 2AQ3B 2B2TC 1U4MA 1W6JA 1V43A 1SSOA 3F2UA 1WTPA 1S5ED 1F9RA 4DU9A 1NSNS 3IKJA 3DEOA 3VYTA 5CORA 1H9SA 3GO5A 4CJ0B 4HCEA 2EY6A 4RGTA 4CJ1B 2AWNA 5A2QE 4MIUA 5KRUA 4OHJA 2IWHA 3MWYW 1S5BD 4XDXA 1OXTA 3TBIB 3HP3A 3KLSX 1U4RA 3SK8A 3PUXA 3A8JE 5KYIA 2PZUA 1LTTD 2EYMA 3TMEA 1K83B 3IAYA 5C3WA 3S17B 1PTOC 3VR4A 2A6ED 2LKVA 3CKIB 4HTHA 3MAQA 3Q0AA 3ND8A 2A69D 1KDBA 2WACA 3H09A 1YNJD 4A3GB 3EJIA 2LY7A 3A7AB 2F0VA 1HUNA 2K32A 4PNYA 1F9QA 2EXZA 1BDOA 1XXGA 3VR6A 5DAUA 3DWAA 2NUCA 1CZGA 1B9MA 3Q6SA 2E76C 5EPJA 1W6KA 3R2TA 5C0XH 2DY7A 4ZK9B 1IKMA 1VMPA 5C0XJ 4BY1B 3PO2B 4OGQC 2L9HA 1K8MA 3N52A 3MC0B 3MVVA 3HS0C 5K5PA 5JPNC 3MHBA 3RZDB 1CA6A 1HHVA 1PFMA 5HURA 3I4MB 1JORA 4A3DB 4N9PA 4DXGA 1TIID 3A54A 2RQXA 2IX3A 5EBCA 5IGEA 2DY8A 3VR5A 2BDNA 2RKSA 1JWSD 3X3NA 4EQOA 2JA5B 2R6GA 2NB0A 3MXNA 1SFOB 1JOKA 1UUPA 3W2DA 1UNSA 4C1NI 5IGBA 1G6ZA 5CV5A 2KCCA 1KLUD 1KTKA 2EY1A 1EQVA 2LMCB 1YNJC 2EVBA 4DAVA 1SAPA 1IW7D 1SNOA 4KN7C 2FMMA 1Z7TA 1AP0A 2NVXB 5FO9B 2F4IA 4FYDA 2B2UC 4RWSC 5IOCA 2EZVA 1FGBD 1EU3A 4NW2A 3C46A 4I65A 2X6GA 4C2MB 1GUGA 3E6ZX 5T1GA 1SNMA 4LK1C 5E1FA 1I4HA 1E2WA 4LMQD 5C4JB 2B2YC 1AEXA 2RSNA 5I2XA 3QOLA 3J7AV 1O7ZA 1STNA 1S5DD 1RD9D 4DA2A 3HOUB 2SDFA 5D14A 5F2DA 2RA4A 2JSOA 3W3AA 3K5LA 4A3MB 2EPBA 1FNVA 1HRJA 1C48A 3NUCA 1MBYA 3HOYB 1LLRD 2A6EC 1LT3D 5M9OA 5FO7B 1EY8A 4HSPA 2F0LA 3EFXD 1R4QB 1NUCA 2WKCA 1EL0A 3GTGB 3S14B 2KQ3A 3MZ5A 1KNEA 1TWGB 4NMZA 3FVQA 1Q8IA 2G9DA 3L7ZC 2O2LD 1DONA 5ELBA 2M2LA 4TRDA 3V96A 3L3OC 2HUGA 4IFDI 2F3WA 4RGOS 1SYBA 2F0DA 1MI2A 2PYKA 4OL7A 1ESFA 5JEAJ 1F2LA 2K5DA 3J7AF 3HG9A 2QDBA 4AYBB 4BA2I 3DEPA 3M4OB 2NZ1D 1KDAA 1OXSC 2EE1A 3KLRA 2OT2A 1CM9A 3BS1A 5JEAG 5CR3A 1DYQA 1II3A 3TP7A 3URYA 1JWUD 3K6OA 2O5JC 1B9NA 2WIIB 4RHRA 1DD2A 4OO1H 2EYPA 2JE6I 1IL8A 1SYFA 5CC4A 3PMFA 1D5MC 3SXHA 4TQUS 4C3IG 2HCIA 1O7YA 3V05A 5CYUA 3GTOB 2JA6B 3H6MA 2BDOA 1H9SB 3DHQA 1EQTA 4G7OC 2F0FA 2ENBA 3TZDA 2G9HD 2RDGA 4KJOA 5IGCA 5M5YB 4RH6A 2ICEC 2NN6I 1GUWA 4K6LA 4BS9A 1WTRA 2XN9C 2NBFA 1EY5A 3AB9A 5DM63 1ZXTA 1ET6A 1VDZA 4BY7B 2F0PA 1A3UA 5ELDA 4CKBA 3FRPB 5KGUA 3OWFA 1B3AA 1R9TB 4KTAA 4BBRB 4KJNA 1WTOA 5ELEA 4B9WA 5IT9E 3ERQA 1GHJA 1A6XA 4RKLA 1HTPA 3S16B 1STYA 2EYFA 2C5CA 4FXKC 3MFGA 1TS3A 3P20A 1WTWA 2Z8LA 4EQPA 1ONLA 2L12A 4KHZA 4DXFA 3HRZC 2K01A 1SE3A 5JVH3 1BR9A 4DFAA 1CT1D 1KLGD 2VB3X 1DCZA 5EJWA 2B2VC 4DK0A 4HMJA 3GTLB 2YU9B 5I9PA 1LTID 1F2MA 1AW7A 1LV9A 3SR1A 5I2YA 3QJYA 3K5NA 2CW0D 1NR2A 4DAYA 4ZKBB 2X6LA 1JR0D 4FF1A 1DOKA 3PIP3 3OMCA 4CHTB 4KD3A 4IALA 5AFWA 1FNUA 2F0KA 1C8CA 1JB3A 4YIJA 3VYRA 2MUYA 1B2TA 5M5WB 1S4ZA 4LAAA 3ND9A 4L6TB 2OEOA 4C56C 1WVLA 4RAUC 5EPKA 5I6WA 1LACA 3D31A 1D1IA 1LT6D 2HCCA 1ML0D 3GTQB 3Q24A 1TT2A 3PUVA 1EOTA 3JAML 1TVXA 1SNPA 1SMYD 1KNAA 2L0CA 3X3MA 1FYCA 1Z6HA 1SYGA 3D3RA 4G7ZC 3I4NB 1SJED 1CHPD 2K7VA 1RTOA 2B2UA 2B8GA 4KKTA 1PTOH 4J6HA 2D62A 3J81L 3H0GB 5ELFA 4ZKCB 3S9WA 2F0JA 4WORA 3HZXA 4K8IA 4R9WA 2DNEA 3KLSA 5CV8A 2AWOA 4FF2A 4ZQ3A 2CQAA 1LABA 1SNDA 4CGYB 1GHKA 1QOHA 1DXMA 3M7GA 4FO2A 4KY7A 1KDCA 3EQLC 4DNTB 1IKLA 2F0SA 3S2DB 4BBSB 3SDZA 1TWHB 4A3IB 2V4DA 1CQFA 4F87A 5C4ZA 3I72A 1SNQA 1EY4A 5M5XB 1PTOB 1RJTA 1STBA 3OW7A 1EYAA 1XTCD 2BE5C 3DWPA 4F88A 3S2HB 4C3HB 4X3TA 3TP8A 2F0WA 5KEEA 1TS2A 3J81E 5KIXA 5E3FA 1HPCA 5JAVA 4KN4C 2I07B 1Q3LA 1U9RA 1J9OA 3OSOA 2ZXOA 3I90A 2PZTA 1IHZA 2YYZA 1EIHA 4C3JB 4XQNA 2OF1A 4OO1G 2A74C 4CBVA 3HOWB 4DGZA 1JICA 4V0BA 5LL6S 4OIJA 2M9VA 5JEAH 1E0BA 2R92B 3I8ZA 4OO1I 2F0IA 2RVLA 3OOCA 4KK7A 3BZDB 2EY2A 1Q1BA 2F0NA 3P75A 3BVMA 4GZYC 4EVOA 1PZKD 2B39A 2DNCA 2HDMA 5IODA 1EWHA 3MXUA 2RSOA 4DNRB 1A3VA 4FP5D 2CW0C 1TY2A 1CZWA 4BWGB 5KYLA 2B2TA 2FMCA 1SBBB 1TWCB 1K8OA 3A7LA 3U9SA 1WTXA 1EYCA 4HN7A 1HFGA 2L11A 3BDLA 3RLFA 1SMYC 3C1FA 1BOSA 3DWQA 3HOVB 3HKZB 2Z4IA 1EY6A 1J8IA 4G4KA 5E4WC 1PFBA 3T4AC 2AUKA 1WCMB 1QG7A 2WAQB 1U4LA 5C3XA 3KF8A 3A8IE 4IUQA 3M85A 2RBMA 3VA7A 1BNZA 3OIQA 4RFBA 1PDQA 1H9KA 1ZYRD 2SNSA 4ID6A 1GXDC 1I4RA 1PTOF 2MPMA 2WV6D 2Z4HA 4FXGC 1D5ZC 1ILQA 2L4NA 3IFTA 1UAPA 4IZ8A 3U9OA 1VF7A 3T51B 2F0MA 2JP1A 3NK9A 2CHBD 4KY5A 2L5TA 3EROA 2D5DA 2B63B 2KECA 2WB1B 4IUNA 2SOBA 2F3VA 2EYLA 5FOBB 4IFDH 5J1ZA 1STEA 3OPOA 4ZLTF 2BE5D 2EYHA 2IW3A 1F9PA 3BDCA 4Q0FA 5DEHA 2A68D 3O13A 1QILA 1E2ZA 4PMBA 2F0TA 3QO2A 3S1NB 2XWJB 4NP5A 3TP5A 3OIPA 5CV6A 3M3YB 2FFKB 1EZ8A 3K58A 1MSHA 3RMHA 2AQ1B 3E0JA 1OXUA 4HSVA 4XT3B 3BDOA 1A15A 1EY9A 1SYDA 1I3QB 3LX0A 1HQMC 4XXEA 3PUZA 1ESRA 5EKLA 3ITPA 5FKAC 1HTLD 2NTTA 2PO4A 2RDHA 2EJMA 2H4OA 4IFDG 1A3TA 1CHQD 3L9AX 4QMGA 1M4VA 2A6HC 4B9XA 1QNKA 4H13C 1I4QA 2EJFC 2EDGA 2NN6G 3K5OA 2KCNA 5D65A 2F03A 3T16A 3WOEA 1AFPA 4UDUC 1HA5A 3NPPA 3J7YW 3DUZA 1TY0A 4ZUJA 2PMZB 2BCOA 5LL6X 3RZOB 2VUMB 3BVGA 3CRLC 4K14A 5DNFA 1WD1A 3AMUA 3PUWA 1L0XB 1XX8A 4CKCA 2K04A 4A3JB 2LS01 5C44B 1FD7D 4MHEA 4QUCA 2K6AA 3K0YA 3I73A 2LFNA 2WINB 3S15B 1RCVD 3VR2A 4A3KB 1VMCA 3HOZB 4HAEA 2VB2X 4H7BA 1ZKOA 1A2UA 3QOJA 2JYOA 3VR3A 3ONAB 1M8AA 1STHA 1BO0A 1GUNA 5IGGA 5IGDA 5FLXE 2K5QA 4KKSA 3C3LA 1PRTB 3BVZA 3R93A 2K1BA 5C5MA 3LWEA 2A68C 2M00A 2A5HA 4F8MA 4EQNA 2Q8IB 1G291 3GTJB 5DM73 1T5XD 4X3SA 4QCLA 3I91A 3T56B 5IT9L 3A8KE 5KNDA 3SEBA 5CGKA 4PMWA 1VCIA 2KEEA 2E74C 1I4PA 5C6AA 1I4XA 1EIGA 3TDQA 4M1UB 1WD0A 1SYEA 3M7NA 1T5EA 1OXVA 1EU4A 5EBDA 3D6WA 1O80A 1I4GA 1PMRA 4ZRZA 2PCFB 4WFN3 1L0YB 1BXTA 4HR7B 5M3MB 4PMCA 5C0XG 2MHVA 4K5VA 1R4PB 2B2WA 1QE6A 2PPBC 3NTHA 2IX1A 1G8ZD 5J22A 1XYIA 1KAAA 3H91A 2BOSA 3S1RB 3VYUA 2PNRC 3C2PA 2J4XA 1F2YA 5EPLA 4KMUC 1LTGD 3T13A 2QF7A 2IL8A 4ZYSA 5EKIA 3M4YA 1SE4A 2K28A 2ID0A 1TWFB 1U4PA 4H44C 3RD4A 1S5CD 1LT5D 2KUMA 2PW7A 2KJXA 1STAA 1SE2A 1O7LA 1I6HB 1DJRD 2O5IC 4WJWA 1EYDA 3P1HA 1I50B 1FNWA 4FVMA 1CK1A 2SEBD 1PRTD 1X3PA 1Y8PB 4K2LA 2A6HD 1AZPA 3NBIA 2IT1A 1BUVT 2PZWA 4X3UA 4DK1A 2B2YA 5ISRA 1TS5A 2B2WC 1Y1VB 4U68A 3TSSA 2JA8B 2R93B 3K5MA 1B53A 3V2TA 4ZUIA 3FKIB 1ENAA 3SHLA 4K8JA 1V1PA 3PIO3 1WTQA 3MEHA 3RUZA 2R3ZA 3NBHA 4RKBA 1V8QA 3FPUB 2BA0A 4A3EB 3FPPA 1BCPB 1DZ1A 5A35A 3D4DA 5E4XA 4XQQA 3WOFA 1AN8A 3I4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A3U A;  4PNY A;  4KHV A;  5J22 A;  2EXZ A;  5JAV A;  1A2T A;  1KAA A;  5IOC A;  3SK4 A;  3C1E A;  5KGU A;  3OWF A;  1SYD A;  1U9R A;  2F3W A;  5DAU A;  5HGT A;  3OSO A;  3SK5 A;  3LX0 A;  5C3X A;  1SYB A;  1TT2 A;  4I65 A;  4K5W A;  4R8N A;  4H7B A;  4KTA A;  2F0D A;  4HMI A;  1F2Y A;  5EKL A;  4KJN A;  2PYK A;  1A2U A;  2PZT A;  5J39 A;  3T13 A;  1IHZ A;  2NUC A;  3ITP A;  1SNP A;  4K6D A;  4WRD A;  4OL7 A;  3TP6 A;  4B9W A;  1JOQ A;  2RBM A;  2F0Q A;  2OF1 A;  3QOJ A;  3ERQ A;  1SYG A;  5CV4 A;  2QDB A;  1SNC A;  4DGZ A;  1A3T A;  1JOO A;  1STH A;  2SNS A;  4ID6 A;  1STY A;  4RKL A;  2EYF A;  3EVQ A;  4DU9 A;  2PW7 A;  5CV7 A;  3QB3 A;  4J6H A;  1NSN S;  3HEJ A;  5CV9 A;  5IGG A;  5EKK A;  5IGD A;  1KDA A;  1STA A;  2RDF A;  1SNM A;  4EQP A;  2PQE A;  5E1F A;  4QMG A;  1EYD A;  3P1H A;  4QB4 A;  4IZ8 A;  5C5M A;  4B9X A;  2F0I A;  5CR3 A;  3U9O A;  3S9W A;  2F0J A;  2M00 A;  1II3 A;  4WOR A;  1AEX A;  3E5S A;  2F0M A;  3HZX A;  3TP7 A;  4EQN A;  4F8M A;  4NDX A;  4QF4 A;  3MVV A;  1EY7 A;  2EY6 A;  2O4X A;  1TR5 A;  3NK9 A;  2F0G A;  3QOL A;  2EY2 A;  1EY0 A;  2F0H A;  4K5X A;  4DFA A;  4KY5 A;  4K8I A;  3MHB A;  4K2L A;  5IIF A;  1STN A;  2F0N A;  4MIU A;  3P75 A;  5KRU A;  2KHS A;  3ERO A;  1KAB A;  2PW5 A;  5CV8 A;  4KV6 A;  5JOB A;  4HMJ A;  5HUR A;  2EYP A;  5I6Y A;  1JOR A;  3NXW A;  4EVO A;  4N9P A;  1SYF A;  4IUN A;  1STG A;  2PZW A;  3MXP A;  4NKL A;  4ZQ3 A;  3PMF A;  5CC4 A;  5I9P A;  1F2M A;  2SOB A;  3SK8 A;  1SND A;  2F3V A;  3SXH A;  2EYL A;  3D6C A;  3SR1 A;  3T16 A;  4F7X A;  5ISR A;  5IOD A;  5CGK A;  5KYI A;  5IGE A;  2F0U A;  2PZU A;  5J1Z A;  5F2D A;  2EYM A;  3H6M A;  3D4W A;  4KY7 A;  3TME A;  2F0E A;  5C3W A;  3NP8 A;  4DF7 A;  3DHQ A;  2EYH A;  1KDC A;  3VA5 A;  2RKS A;  5C5L A;  5IGF A;  4N9T A;  3OMC A;  3BDC A;  3SK6 A;  4EQO A;  2F0S A;  5K5P A;  1A3V A;  3V2T A;  2EYJ A;  2EY5 A;  4ZUI A;  4ZUJ A;  4KD3 A;  3R3O A;  4IAL A;  5DEH A;  5C6A A;  5KYL A;  2F0F A;  2LKV A;  3OMG A;  4ME5 A;  4E6I A;  1JOK A;  4PMB A;  4G57 A;  3NUC A;  1ENA A;  2F0T A;  4S3S A;  2ENB A;  5C4H A;  3NQT A;  3SHL A;  4K8J A;  2F0K A;  5IGB A;  5C4Z A;  3D8G A;  4NP5 A;  5CV5 A;  4ODG A;  4YIJ A;  3TP5 A;  3MEH A;  4KJO A;  1SYE A;  5IGC A;  3NHH A;  5CV6 A;  4K14 A;  1SNQ A;  2EY1 A;  1EYC A;  1EQV A;  4LAA A;  1F2Z A;  4HTH A;  3RUZ A;  5M9O A;  4K2K A;  1EY4 A;  2OEO A;  1EY8 A;  1EZ8 A;  1EZ6 A;  2F0L A;  2SNM A;  3BDL A;  4RKB A;  1KDB A;  1NUC A;  1SYC A;  2OXP A;  1STB A;  3C1F A;  1EY5 A;  1EYA A;  2EYO A;  4PMC A;  2WAC A;  1SNO A;  2KQ3 A;  1ENC A;  3MZ5 A;  4K5V A;  4KY6 A;  1TQO A;  2F0O A;  4NMZ A;  4J1M A;  3DMU A;  5I9O A;  1EY6 A;  3D4D A;  1RKN A;  5NUC A;  4KD4 A;  3TP8 A;  5EGT A;  2F0W A;  5I6W A;  2F0P A;  2HQE A;  5KEE A;  3EJI A;  4TRD A;  5KIX A;  5E3F A;  2F0V A;  1EY9 A; 
#chains in the Genus database with same CATH topology
 5M5X H;  1H9M A;  2UXD L;  2B8F A;  5T1I A;  4FF4 A;  4RGM A;  1Y69 U;  2OTJ A;  4K5W A;  1PYW D;  4H0L C;  1YNN D;  5FK9 C;  4A3J G;  2N55 A;  3M4Q A;  2IY5 B;  4C1N K;  1LT4 D;  2FIN B;  4RGN A;  3TP6 A;  2AQ2 B;  3ERS X;  3UE1 A;  3SVM A;  3J7A 5;  1WJJ A;  2XRS D;  3CC7 A;  2RHS B;  4LF8 Q;  5CV4 A;  2L1B A;  1SNC A;  1Q12 A;  3G4S A;  1AZQ A;  2GA4 B;  2K5H A;  4RCO A;  1N8R C;  2L15 A;  4MTN A;  3CP0 A;  5G3L D;  1D6E C;  4Q5V A;  5CV9 A;  5IP7 H;  2TSS A;  4JBW A;  4LFC L;  3PUY A;  3IFD A;  4IUR A;  4ULL A;  4WJ4 A;  1DM0 B;  3NQI A;  4A3F B;  5TSS A;  4JI5 Q;  1LTL A;  4IN3 A;  4AH6 A;  5C3E B;  2XRQ D;  2XWB B;  1JJC B;  1HR0 L;  1QVF A;  3KK7 A;  1VQM A;  2CCZ A;  1MHW C;  1YJW A;  4QQB X;  5IIF A;  2VQF L;  4QJF A;  1VF5 C;  2UXC Q;  2AUJ D;  5BN3 A;  1Q86 C;  1L1O C;  5AJ3 L;  4JC0 A;  3BZK A;  1CFM A;  2KOL A;  1VQ5 A;  1PXU A;  4DUZ Q;  4GNX A;  1YNN C;  3SE0 A;  4C3J H;  2YV5 A;  4XQJ A;  2NWG A;  2KCT A;  1Q90 A;  3R3O A;  2WB1 G;  4DAY B;  1WTV A;  1HFN A;  2Z1C A;  3S1Q B;  2Q2T A;  3NQT A;  2F4V Q;  4LF5 Q;  1ET9 A;  2E2H B;  3ZJY C;  3J80 L;  2K14 A;  3BJU A;  2JQO A;  2DN8 A;  4TSS A;  3UI2 A;  4BXX G;  1EZ6 A;  5CBE E;  4RCN A;  2R7Z B;  4P71 A;  3CQZ B;  1CKN A;  1BBX C;  1G91 A;  4A3D G;  4XTC S;  4BXX H;  1D7Q A;  2Q8T A;  3DMU A;  4YHH L;  2HDL A;  2JA8 G;  2MQH A;  1IYU A;  2Y0S G;  3DM1 A;  4FNF A;  5NUC A;  2R93 G;  1FR3 A;  3KBG A;  2CVR A;  1IW7 C;  2QEJ C;  3K7U C;  2J7Z A;  2NYZ D;  2E2J B;  1IZ6 A;  1BCP D;  3OYY A;  4BBR G;  1JE4 A;  4RA8 A;  3RZO H;  1TS4 A;  3S1N H;  4A3C G;  1FJG Q;  4PZ6 A;  5J39 A;  4YY3 L;  4LUZ A;  4OIK A;  4JV5 L;  3S1M B;  4DV0 Q;  4KI0 A;  3T1Y L;  3FKI H;  2EJG C;  4LJZ C;  2E75 C;  4XT1 B;  4KKU A;  1PRT F;  1H9J A;  1IYV A;  4V19 0;  4QL5 A;  3QB3 A;  2BA1 A;  5EKK A;  2RDF A;  2D9U A;  3WWV A;  4IJH A;  2PQE A;  4QY7 A;  2E2H H;  2WKD A;  3S1Q H;  1K8A C;  2Y0S B;  4K0K L;  1CKM A;  2KCM A;  4DAM A;  4X66 Q;  3PV0 A;  4DR3 L;  1B44 D;  4B3M Q;  5M3M H;  4JOI A;  4B3T L;  3G6J B;  3UE0 A;  1EFI D;  4J8Q A;  1Y14 B;  1O78 A;  4KV6 A;  1NTG A;  4O1N A;  5JOB A;  3R8B A;  2KA7 A;  4LW1 A;  1PLF A;  3A55 A;  5IWA L;  1STG A;  3MXP A;  4NKL A;  1QB5 D;  1F9S A;  1OXX K;  2MP1 A;  5K36 G;  3PF5 A;  4QUF A;  1BCP C;  3QG1 A;  4DR1 Q;  1PH3 A;  4C3H G;  2F0U A;  4BY7 H;  3D4W A;  2F0E A;  4DR5 L;  1BF4 A;  3TZU A;  3PGZ A;  2JA5 G;  5IGF A;  1A62 A;  2IX0 A;  5FLX c;  3PQI A;  4IUU A;  1V9P A;  5IYC G;  4G7H C;  2FJ2 A;  1PRT C;  1B4O A;  1X56 A;  1VQD A;  4GOP A;  1PZJ D;  2RF4 A;  3NWT A;  1RTN A;  4X3K A;  2NVQ B;  3LWU A;  4UAI A;  5BR8 L;  2F1M A;  3QWN A;  4GNX B;  3K57 A;  4O2D A;  4K2K A;  1CQV A;  3D4R A;  4IPD A;  3GV3 A;  3CME A;  3HOZ G;  1SYC A;  1NAP A;  1SEB D;  2OXP A;  3NTK A;  1EWC A;  2EYO A;  2K5W A;  2VXW A;  3N6R A;  1ENC A;  2ZXR A;  4A93 B;  5JJK A;  1XWE A;  2F0O A;  2N88 A;  4I7A A;  4J1M A;  5LHY 1;  1BQQ T;  1RKN A;  1YI2 A;  1VQA A;  3IL8 A;  5EGT A;  3NWS A;  1QWY A;  2HHH L;  4DV1 Q;  3SK4 A;  3MXG A;  4L63 B;  2UUC Q;  4LF9 L;  3C1E A;  3BYY B;  3H3V I;  3HOU H;  2C9O A;  2MGS A;  1HR0 W;  2OQ0 A;  3CCV A;  5FLX L;  5K36 H;  4ILW A;  1LO5 D;  3Q23 A;  4DR7 Q;  3KBX A;  1JQY D;  3Q22 A;  1MD2 D;  5IT9 c;  1PH8 A;  5CMD A;  3K0X A;  4LF7 L;  2K05 A;  2K03 A;  4LFB Q;  1X3Q A;  1PV4 A;  1Y1W H;  2BH2 A;  5CV7 A;  3HEJ A;  1I94 L;  1E2V A;  2E2I B;  2DUD A;  2P5Z X;  1Y1W B;  4WJ3 M;  1WOC A;  2XIW A;  1NCV A;  4IUT A;  2ZM6 Q;  3A56 A;  4QB4 A;  1KAW A;  1UE5 A;  4JCV E;  1QJO A;  1EEI D;  2QCP X;  1PFS A;  4DV5 Q;  4ZAI A;  1ICW A;  4M8A A;  3NSW A;  4DKA C;  2O4X A;  4K5X A;  2F0G A;  1P8L A;  1SLJ A;  4J15 A;  4A3B B;  5C4X B;  3AEV A;  1C7Y A;  2PW5 A;  1WYD A;  5ELC A;  1LTR D;  2JA7 B;  5LMU Q;  4PQX A;  3GQB A;  2QKI C;  2NVY B;  2QGQ A;  3KFU A;  1YJN A;  4I7Z C;  1TKW B;  3T53 B;  3CU7 A;  4DNI A;  2L55 A;  4JI1 Q;  3D6C A;  4F7X A;  4A3C H;  1JC7 A;  3BYT B;  3CCL A;  1B1Z A;  3NP8 A;  4Z9C B;  4DF7 A;  1C4Q A;  2ZXP A;  3GD7 A;  1CSQ A;  1D5X C;  2B2V A;  3VA5 A;  5FO8 B;  3SK6 A;  1GUT A;  2EYJ A;  3W5O A;  1HUM A;  1SXT A;  2PI2 E;  1GJX A;  2Q2H A;  3OMG A;  2CQO A;  2VNU D;  2PQA A;  3DM3 A;  5C0X I;  4UHV A;  1PH9 A;  3L2P A;  1I50 H;  1RHP A;  3OTO L;  3EIV A;  1PH6 A;  3S16 H;  2A73 B;  2PQA B;  2UXB L;  4A76 A;  4U67 3;  1UEA B;  1GUO A;  1ROD A;  1Q46 A;  4CJ2 C;  3K59 A;  1B50 A;  1CI3 M;  3I70 A;  3CHB D;  5I9O A;  1PTO D;  1RDP D;  5G3L F;  3J80 E;  5M3F G;  3MXN B;  3S14 H;  3LNN A;  4KD4 A;  5DLQ E;  2ICI A;  4DN4 M;  3PIO A;  1SJH D;  1ZEQ X;  4GKJ Q;  2JA6 G;  2VW9 A;  1A2T A;  1F77 A;  3FP9 A;  3P7J A;  4B08 A;  1HQR D;  5HGT A;  1TWC H;  1LM0 A;  1S5F D;  1PH5 A;  4R8N A;  1XPU A;  4LF7 Q;  1GD7 A;  4JI6 L;  5KNB A;  2R61 A;  2MJ8 A;  1G2S A;  4C3I B;  2E2D C;  5IY0 A;  3HOV G;  4FF3 A;  1TWA B;  1EEF D;  5EAY A;  2VY3 A;  4MZ9 A;  1DOM A;  1GOZ A;  5JVG 3;  1VQI A;  3GV6 A;  1UWV A;  1V1P B;  3H3V C;  1JWM D;  3GTK B;  2VQE L;  4LF9 Q;  2KVM A;  1QCB D;  1SRO A;  1MGS A;  3WDN A;  5I4D A;  1LTS D;  4TKO B;  4HCS A;  4IQZ A;  4P72 A;  5IP7 G;  4XYQ A;  2J0T D;  3E5S A;  4QF4 A;  1TR5 A;  4IJL A;  3GP7 A;  3MFY A;  1EY0 A;  2F0H A;  3JAM E;  1XNR L;  1KAB A;  5I6Y A;  3NXW A;  1Q1E A;  1LTB D;  1ENF A;  5BN5 A;  5D3D A;  2NVT B;  2TMP A;  2A69 C;  5JJI A;  5KNC A;  4BY7 G;  2Q8R E;  4HED A;  4A93 G;  3KOJ A;  3DXJ C;  2IHE A;  2QIL A;  3EN2 A;  3CRK C;  4OXP A;  2ASB A;  5C5L A;  1HNX Q;  3GTP B;  1GUS A;  2EOT A;  4A3L H;  3MA2 B;  3I4O A;  3GTM B;  2EY5 A;  3VYS A;  1NR4 A;  1UE7 A;  3TN2 A;  1SDF A;  4R4Q A;  4E6I A;  4OWW B;  4G57 A;  4JPB W;  4S3S A;  1I6V C;  5IP9 G;  1N33 Q;  1H9R A;  4KLK A;  3QIA A;  4XYO A;  3D8G A;  4ODG A;  1SRU A;  2KED A;  3G7L A;  1QNU A;  3NHH A;  2H1E A;  3FEW X;  2SNM A;  3OHX C;  2CH4 W;  2K33 A;  2I46 A;  4B3T Q;  1OO9 B;  3J81 i;  3GTP H;  1E22 A;  5BN4 A;  1TQO A;  1Z47 A;  2R7Z H;  4RHS A;  4P2C B;  3CF5 A;  2HQE A;  4A3K G;  4NPS A;  5IYB H;  2F52 A;  4MN3 A;  1D2B A;  2HIV A;  3EBE A;  4IFD J;  1HXY D;  3E3X A;  1BBU A;  3AU7 A;  1HZB A;  4P73 A;  4JI7 L;  4JVZ A;  1ZYR C;  2D2C C;  2X69 A;  4DPG A;  4WRD A;  1PH4 A;  4GN4 B;  4EQ5 A;  2F0Q A;  4OON A;  4O42 A;  4YY3 Q;  4DV4 L;  1QZG A;  1FJG L;  3E0E A;  4GLA C;  5COY A;  1DOL A;  3FMC A;  1JOO A;  5EQ0 A;  1X32 A;  3NE5 B;  4XIG S;  3EVQ A;  4APV A;  2JEA I;  4FXD A;  4JI0 L;  5M3F B;  1GO3 E;  2NN6 H;  2IPK D;  1TU2 B;  3IRB A;  1BCP F;  1HJP A;  4JBK A;  2AHO B;  4YHH Q;  3R2I A;  2LSS A;  3I4M H;  5A2Q L;  4JBJ A;  3HGB A;  4NDX A;  1CA5 A;  1EY7 A;  4CKE A;  3BG3 A;  5CBA E;  4ABN A;  2JEB I;  1N32 L;  2WP8 J;  3CMA A;  1CTM A;  3D0F A;  5GAG C;  4GKK Q;  2KHS A;  4EX5 A;  1VQ7 A;  3NTI A;  1Y8O B;  5D3I B;  3H94 A;  4PZ7 A;  4JK1 C;  4C3J G;  1X54 A;  1EQQ A;  2N3S A;  5M5Y H;  1LUZ A;  4IUV A;  5IP9 H;  1PZI D;  1HA6 A;  2CWP A;  1HCZ A;  3HOX B;  1MSG A;  4DAP A;  1JCK B;  4Y7N B;  4R4I A;  4GNX C;  1VQO A;  3PF4 A;  1YZ6 A;  2XNA C;  4PV1 C;  4N9T A;  2K5N A;  3MTS A;  3OWE B;  3S17 H;  3STB D;  3EA6 A;  2NTS A;  1ICF B;  4ME5 A;  4QIW E;  1E3P A;  1G2T A;  1XMO L;  1I3Q H;  4GN3 B;  5C4H A;  4DV6 Q;  2K75 A;  3I3C A;  4QIW B;  1V1O A;  4IPH A;  2XSC A;  5JPM C;  4BY1 H;  1F2Z A;  2JXM B;  2UXC L;  4EGV A;  2FHT A;  2QW7 A;  2XVS A;  5JJZ A;  2ZT9 C;  1E1O A;  4IUP A;  1HR0 Q;  1PFN A;  1Y8N B;  4KY6 A;  1J5E Q;  3PO3 B;  3FDT A;  1RF2 D;  4JBM A;  4BY1 G;  2A1A A;  4UY8 C;  4R4C A;  4KHV A;  2IJ0 A;  3K7A B;  2VS1 A;  4R8I A;  3SK5 A;  1D1K A;  2AKW B;  4L8J A;  3RLO A;  4A75 A;  1LTA D;  3ZYY X;  4HMI A;  3SGI A;  3KUP A;  4K6D A;  1JOQ A;  4R1J A;  1ILP A;  4BA1 I;  2AQ3 B;  3CCU A;  3CQZ H;  2B2T C;  4DV6 L;  3TS0 A;  1EFW A;  1U4M A;  1W6J A;  1V43 A;  1SSO A;  3F2U A;  5IYD H;  1WTP A;  1N36 Q;  1S5E D;  1F9R A;  1MJE A;  4JYA Q;  4DU9 A;  1YNX A;  2JA6 H;  3TRZ A;  1EUJ A;  1NSN S;  2UXD Q;  3IKJ A;  3DEO A;  3VYT A;  5COR A;  3CCR A;  1HZC A;  1H9S A;  3GO5 A;  3CAM A;  2H5X A;  1IL2 A;  1N34 Q;  4CJ0 B;  2HD3 A;  4HCE A;  1K3B C;  2EY6 A;  4RGT A;  1XMQ L;  4CJ1 B;  2AWN A;  5A2Q E;  4MIU A;  5KRU A;  4DV2 L;  4OHJ A;  2IWH A;  3MWY W;  1NY4 A;  1K73 C;  1S5B D;  4XDX A;  1OXT A;  3TBI B;  3HP3 A;  4DR6 Q;  3KLS X;  1U4R A;  3SK8 A;  1E1T A;  4ME3 A;  3PUX A;  3A8J E;  5KYI A;  1Q8K A;  2PZU A;  1LTT D;  2EYM A;  3TME A;  1K83 B;  3IAY A;  5C3W A;  3S17 B;  4JI0 Q;  1PTO C;  4B3S Q;  5FLM H;  3VR4 A;  2RCF A;  3VDY A;  2A6E D;  2LKV A;  3KLW A;  3BU2 A;  2WAQ G;  3HOX H;  3CKI B;  2K50 A;  4X65 Q;  4LUO A;  1WTH A;  4B3S L;  3I2Z A;  4HTH A;  2JA7 G;  3MAQ A;  1C0A A;  3Q0A A;  4JI7 Q;  3NEL A;  3ND8 A;  1FL0 A;  1KDB A;  2A69 D;  4IO9 A;  2WAC A;  3H09 A;  4Y52 H;  2I5M X;  4AQY L;  1YNJ D;  4A3G B;  3I55 A;  3U50 C;  3H0G H;  4DR6 L;  3EJI A;  2LY7 A;  3A7A B;  2F0V A;  1VQK A;  1HUN A;  1WFQ A;  2K32 A;  4PNY A;  4LNQ A;  1F9Q A;  2EXZ A;  2ZJP A;  3PO2 H;  1BDO A;  1XXG A;  3VR6 A;  5DAU A;  3T1H L;  5GAE C;  1Q82 C;  3DWA A;  3H15 A;  1EIY B;  5FJ8 H;  1BBW A;  2NUC A;  4A3I H;  1CZG A;  2AMC B;  4JI3 Q;  1B9M A;  4A93 H;  3Q6S A;  4JI8 L;  2E76 C;  2DGY A;  3KYH C;  5EPJ A;  1W6K A;  3R2T A;  3RLN A;  5C0X H;  2EXD A;  4JYA L;  2DY7 A;  4ZK9 B;  4IOA A;  1IKM A;  1XPO A;  1VMP A;  5C0X J;  1N36 L;  4BY1 B;  2CWA A;  3PO2 B;  4OGQ C;  2L9H A;  1B7Y B;  1K8M A;  3N52 A;  3MC0 B;  3CC2 A;  2YTX A;  3MVV A;  3HS0 C;  5K5P A;  4JI2 Q;  1UE1 A;  5JPN C;  3MHB A;  3RZD B;  1GM5 A;  1CA6 A;  1HHV A;  2MO0 A;  1PFM A;  5HUR A;  3I4M B;  1JOR A;  1PH2 A;  4N9P A;  4DXG A;  1TII D;  1S40 A;  1NMG A;  3A54 A;  2UUA Q;  4A3D B;  2E2J H;  1GKH A;  3KDF B;  4HIM A;  2QDL A;  2RQX A;  2MNA A;  2IX3 A;  1MKH A;  1J5E L;  4NXN Q;  5EBC A;  5IGE A;  1EYG A;  3CXC A;  2DY8 A;  2Q2U A;  3VR5 A;  2JA5 H;  2BDN A;  2RKS A;  1JWS D;  1WCM G;  3X3N A;  4EQO A;  2JA5 B;  4YCW A;  2R6G A;  2NB0 A;  3OW2 A;  1K0R A;  3MXN A;  1SFO B;  1JOK A;  1UUP A;  1B3Q A;  3W2D A;  1I6H H;  2Z6K C;  1ASY A;  1UNS A;  4C1N I;  5IGB A;  1XMO Q;  1G6Z A;  1RIP A;  5CV5 A;  2KCC A;  3J7Z C;  1KLU D;  1KTK A;  2EY1 A;  1EQV A;  5M3F H;  4X64 Q;  2LMC B;  5M3M G;  1YNJ C;  4LUV A;  2EVB A;  3RNU A;  3S2H H;  4DAV A;  1SAP A;  1IW7 D;  1SNO A;  4KN7 C;  2FMM A;  2Z6B A;  1Z7T A;  1AP0 A;  1PH1 A;  2NVX B;  5FO9 B;  4OWT B;  2F4I A;  4L5T A;  3G71 A;  4FYD A;  3CC4 A;  5GRO A;  3CPF A;  4AIM A;  2B2U C;  4RWS C;  5IOC A;  4HJ9 A;  2EZV A;  3A0J A;  3I56 A;  1FGB D;  1KRS A;  4NW2 A;  1EU3 A;  3C46 A;  4I65 A;  2DJG C;  2UXB Q;  4DR4 Q;  3QR8 A;  3PO2 G;  2X6G A;  4C2M B;  4A3M H;  1GUG A;  2RCN A;  4BBR H;  5LMN W;  3HKS A;  3E6Z X;  4QGU A;  1PHJ A;  4X62 L;  5T1G A;  2C35 B;  1SNM A;  2JA9 A;  4LK1 C;  5E1F A;  1I4H A;  1E2W A;  4LMQ D;  5C4J B;  4A3D H;  2B2Y C;  1AEX A;  3GTL H;  3AQQ A;  2RSN A;  5I2X A;  3QOL A;  3J7A V;  1O7Z A;  1QVC A;  5LMU L;  1STN A;  1S5D D;  1VQF A;  4MTK A;  1RD9 D;  1Y1W G;  1T9H A;  4DA2 A;  3HOU B;  2SDF A;  1G6P A;  5C3E G;  5D14 A;  5F2D A;  3GTK H;  2RA4 A;  3W1G A;  2JSO A;  3W3A A;  1I94 Q;  5IYB G;  4BBS G;  3K5L A;  1Q7Y C;  2ZJR A;  2KHI A;  4C2M H;  4A3M B;  1K83 H;  4LFB L;  2EPB A;  1FNV A;  1JJG A;  1HRJ A;  1C48 A;  3NUC A;  3CCS A;  1MBY A;  3HOY B;  4DR7 L;  1LLR D;  3CCQ A;  2A6E C;  1LT3 D;  5M9O A;  2ZTC A;  5FO7 B;  3KDF A;  1EY8 A;  4HSP A;  2F0L A;  1HNX L;  3EFX D;  1R4Q B;  1NUC A;  2WKC A;  1EL0 A;  2UUC L;  3GTG B;  3S14 B;  4UP9 A;  1YIJ A;  2KQ3 A;  3MZ5 A;  1M90 C;  1KNE A;  1TWG B;  4NMZ A;  3FVQ A;  1Q8I A;  2G9D A;  3L7Z C;  3PO3 G;  2O2L D;  1DON A;  5ELB A;  2M2L A;  4TRD A;  4MNO A;  4FDB A;  3V96 A;  1HZ9 A;  3L3O C;  3K81 C;  2HUG A;  2KBN A;  4IFD I;  2F3W A;  1IXR A;  4RGO S;  3HOW H;  1SYB A;  1VQE A;  2F0D A;  1MI2 A;  2Y0S E;  2PYK A;  2CFM A;  1CUK A;  4OL7 A;  1L0W A;  1ESF A;  5JEA J;  1F2L A;  3J81 j;  3HOW G;  2K5D A;  3J7A F;  3HG9 A;  1O7I A;  4N8X 1;  2QDB A;  4AYB B;  4BA2 I;  3DEP A;  4JOI C;  3AYH B;  3GTO H;  3S24 A;  3M4O B;  1X3F A;  3LGJ A;  2NZ1 D;  1KDA A;  1OXS C;  1KQS A;  4A3E G;  2EE1 A;  3KLR A;  2BH8 A;  2OT2 A;  1CM9 A;  3BS1 A;  4DR1 L;  5JEA G;  5CR3 A;  1EWI A;  1DYQ A;  1II3 A;  3TP7 A;  4JI6 Q;  3URY A;  1JWU D;  3K6O A;  2O5J C;  1B9N A;  2WII B;  4RHR A;  1DD2 A;  4OO1 H;  2EYP A;  2JE6 I;  1IL8 A;  1SYF A;  4B3M L;  4L5Q A;  4CDC C;  5CC4 A;  3PMF A;  3CCM A;  1D5M C;  4X66 L;  3SXH A;  4TQU S;  4C3I G;  2HCI A;  1O7Y A;  3V05 A;  5CYU A;  3GTO B;  2NVY H;  2JA6 B;  3H6M A;  2BDO A;  1H9S B;  4AYB G;  3DHQ A;  1B70 B;  2E5L L;  1EQT A;  1X3G A;  3TRE A;  1PA6 A;  5C3E H;  1X65 A;  1QUQ B;  4G7O C;  2F0F A;  4HID A;  2WFW A;  4HIK A;  2ENB A;  4OEL B;  3TZD A;  4DV0 L;  2G9H D;  2RDG A;  4KJO A;  3L0O A;  5IGC A;  2UU9 Q;  5M5Y B;  4RH6 A;  2ICE C;  2NN6 I;  4CDE C;  1K28 A;  4X62 Q;  2E2I H;  2NVQ H;  2VUM H;  1GUW A;  4K6L A;  4P75 A;  4BS9 A;  1WTR A;  2XN9 C;  3I4N G;  2NBF A;  1EY5 A;  3AB9 A;  5DM6 3;  3HKZ G;  4OX9 L;  2XGT A;  1KIX A;  4POG A;  1E24 A;  1ZXT A;  1ET6 A;  4Y7N H;  4OWX B;  1VDZ A;  4BY7 B;  2F0P A;  1VQC A;  4DR4 L;  1A3U A;  5ELD A;  4CKB A;  1VQH A;  3FRP B;  5KGU A;  3KF6 A;  3OWF A;  1B3A A;  1R9T B;  4KTA A;  4BBR B;  4CDD C;  4KJN A;  4DV5 L;  1WTO A;  4CDF C;  5ELE A;  4B9W A;  4LF5 L;  5IT9 E;  2ZM6 L;  3Q8D A;  3ERQ A;  4NB3 A;  3JC6 6;  4C3I H;  3W1B A;  1GHJ A;  2FXQ A;  1A6X A;  4RKL A;  1HTP A;  1QVG A;  1STY A;  1VQN A;  2EYF A;  3S16 B;  2C5C A;  4FXK C;  4OEM B;  4YCU A;  3MFG A;  3U4Z A;  4DUZ L;  1TS3 A;  1YIT A;  4H02 A;  3P20 A;  1WTW A;  2Z8L A;  4EQP A;  4RMF A;  1D8L A;  1ONL A;  2L12 A;  4KHZ A;  4DXF A;  3HRZ C;  2NVX H;  2K01 A;  1SE3 A;  5JVH 3;  1BR9 A;  4DFA A;  1CT1 D;  3S1M H;  3HOY G;  1AH9 A;  2K52 A;  1KLG D;  2VB3 X;  3GTJ H;  4A3E H;  1DCZ A;  5EJW A;  2B2V C;  4DK0 A;  2VQF Q;  4HMJ A;  3GTL B;  1Y1V H;  4A3L G;  2YU9 B;  2HHH Q;  5C4J H;  4L5R C;  5I9P A;  1LTI D;  1F2M A;  4NXN L;  1AW7 A;  1LV9 A;  3SR1 A;  4JI5 L;  3U4V A;  5I2Y A;  3QJY A;  4GLV B;  3K5N A;  2PNH A;  2CW0 D;  1NR2 A;  4DAY A;  4DK3 C;  4IPG A;  4ZKB B;  2UUA L;  2X6L A;  1JR0 D;  4GOP B;  4FF1 A;  1DOK A;  3PIP 3;  3OMC A;  4A3J H;  4CHT B;  4KD3 A;  4IAL A;  5AFW A;  1FNU A;  1KC8 C;  2JJQ A;  2Z6K A;  1XJV A;  2F0K A;  1C8C A;  1GVP A;  1JB3 A;  2OWO A;  4YIJ A;  4LWC A;  3VYR A;  4POF A;  3F2C A;  3HOZ H;  2MUY A;  1B2T A;  1VQ6 A;  5M5W B;  5JJL A;  1S4Z A;  4LAA A;  3ND9 A;  4L6T B;  3UDX A;  2OEO A;  4LF4 Q;  4C56 C;  1WVL A;  1JMC A;  2B63 G;  3PCO B;  4JI8 Q;  3I7F A;  2ZTD A;  2I5H A;  3JAM c;  4RAU C;  1K8G A;  4DR2 L;  5EPK A;  2D0O A;  1R9T H;  2ES2 A;  1KL9 A;  3STB C;  5I6W A;  1LAC A;  5IWA Q;  3D31 A;  3T1H Q;  1D1I A;  1LT6 D;  2HCC A;  1HNZ L;  1ML0 D;  2I0Q A;  1L1O A;  3GTQ B;  3Q24 A;  1TT2 A;  4A3B G;  5C4X G;  4DR3 Q;  3PUV A;  1EOT A;  3JAM L;  4BBS H;  4A3I G;  5HGQ A;  3NEM A;  1TVX A;  3ULP A;  1SNP A;  1SMY D;  1KNA A;  2L0C A;  3X3M A;  3RZD H;  1Y1V G;  2GN5 A;  4AQY Q;  1FYC A;  1Z6H A;  1IBM L;  4KHP Q;  1SYG A;  3D3R A;  4G7Z C;  3I4N B;  3UDF A;  2VZA A;  1SJE D;  1CHP D;  2K7V A;  1RTO A;  2B2U A;  2B8G A;  1YVC A;  1PTO H;  4KKT A;  4J6H A;  3CPW A;  2D62 A;  3J81 L;  3H0G B;  5ELF A;  4ZKC B;  1H95 A;  5ELN A;  3S9W A;  3J80 i;  3KF6 B;  2F0J A;  4WOR A;  3HZX A;  1KD1 C;  1I5F A;  2LXK A;  4K8I A;  4R9W A;  2DNE A;  3RN5 A;  3KLS A;  4NXM Q;  5CV8 A;  2AWO A;  3ULJ A;  3FKI G;  4FF2 A;  4A4I A;  4ZQ3 A;  2CQA A;  3HOX G;  1LAB A;  1SND A;  4CGY B;  3JAM i;  1GHK A;  3U58 A;  1QOH A;  1DXM A;  1P16 A;  1SN8 A;  3M7G A;  4FO2 A;  2OTL A;  4KY7 A;  2ALY B;  4R4O A;  1KDC A;  3EQL C;  4DNT B;  4A3M G;  1IKL A;  4P74 A;  1VQ8 A;  2F0S A;  2OCE A;  4DV2 Q;  2A8V A;  4ZCK A;  3S2D B;  4BBS B;  1CKO A;  3SDZ A;  1TWH B;  4A3I B;  2V4D A;  1CQF A;  1NJI C;  2F4V L;  4F87 A;  1N34 L;  1HNW L;  3UDI A;  2MFI A;  5C4Z A;  3A5U A;  3I72 A;  1SNQ A;  1PH7 A;  2JK8 A;  1TXY A;  3PIP A;  1EY4 A;  5M5X B;  1PTO B;  2CKZ B;  1MJC A;  1RJT A;  1STB A;  3OW7 A;  1EYA A;  1XTC D;  2LXJ A;  2BE5 C;  3DWP A;  4F88 A;  1MIU A;  3S2H B;  4C3H B;  4X3T A;  1U0L A;  2WAQ E;  3UDG A;  4DV3 Q;  2Q2I A;  3TP8 A;  2F0W A;  5KEE A;  1TS2 A;  5ELO A;  3J81 E;  5KIX A;  5E3F A;  1IBK Q;  1SR3 A;  1YHB A;  1HPC A;  3M4O H;  5JAV A;  4KN4 C;  2I07 B;  5IYD G;  1Q3L A;  1U9R A;  1J9O A;  3OSO A;  1YHQ A;  2ZXO A;  1PYS B;  3I90 A;  1IBM Q;  2PZT A;  1IHZ A;  2MO1 A;  2YYZ A;  1EIH A;  4C3J B;  4XQN A;  2OF1 A;  4OO1 G;  2A74 C;  4LFC Q;  4CBV A;  1BVS A;  2K4K A;  3HOW B;  4DGZ A;  4GOP C;  1JIC A;  4V0B A;  5LL6 S;  4OIJ A;  2M9V A;  3NBH B;  5JEA H;  1E0B A;  2R92 B;  1JB7 A;  3I8Z A;  4A3F G;  4TVA B;  4OO1 I;  1EIF A;  2NZH A;  2F0I A;  2RVL A;  3RR5 A;  3OOC A;  4KK7 A;  3DLL A;  1YBY A;  3BZD B;  2EY2 A;  1Q1B A;  2F0N A;  3P75 A;  3BVM A;  4LF4 L;  4GZY C;  1K0S A;  4ALP A;  4EVO A;  5J3B A;  1PZK D;  2B39 A;  2DNC A;  2HDM A;  2UUB Q;  1EQR A;  5IOD A;  1N9W A;  1JT8 A;  1EWH A;  3MXU A;  4RG1 A;  1E7Z A;  2RSO A;  4DNR B;  1J6Q A;  4GKK L;  1A3V A;  4FP5 D;  2CW0 C;  1TWG H;  3PO3 H;  1TY2 A;  1CZW A;  4BWG B;  1N32 Q;  5KYL A;  2B2T A;  5HY6 A;  2FMC A;  2KEN A;  1SBB B;  1TWC B;  1K8O A;  1KRT A;  3A7L A;  3U9S A;  1WTX A;  1LYL A;  2A19 A;  2PMZ E;  2XTI A;  2N8N A;  1EYC A;  4HN7 A;  1HFG A;  2L11 A;  3BDL A;  2G5D A;  1SMY C;  3RLF A;  3C1F A;  1TWH H;  5L37 A;  1CKN B;  2VL6 A;  1BOS A;  4DV4 Q;  3DWQ A;  3HOV B;  3HKZ B;  1VQP A;  2Z4I A;  1EY6 A;  1K9M C;  2B29 A;  2NZO A;  3F8T A;  1JJ2 A;  1J8I A;  2RHQ B;  3KF8 B;  4G4K A;  5E4W C;  1PFB A;  3T4A C;  1X55 A;  2AUK A;  4YWL A;  1WCM B;  1PYB A;  1QG7 A;  2WAQ B;  4LFA Q;  1U4L A;  5C3X A;  3KF8 A;  3A8I E;  2R92 G;  3M4P A;  4IUQ A;  4HJ5 A;  1S72 A;  3M85 A;  2RBM A;  2YTV A;  3VA7 A;  1BKB A;  1BNZ A;  3OIQ A;  4RFB A;  2JA8 H;  2GVA A;  4N8F A;  2R93 H;  1PDQ A;  1H9K A;  1ZYR D;  2SNS A;  4ID6 A;  1GXD C;  1I4R A;  5M5W H;  5C44 G;  1PTO F;  3AFP A;  2MPM A;  2WV6 D;  2Z4H A;  4FXG C;  1D5Z C;  1ILQ A;  1C9O A;  2L4N A;  3IFT A;  2HT1 A;  5GAH C;  4UP8 A;  1UAP A;  4IZ8 A;  4B3R Q;  3U9O A;  1VF7 A;  3T51 B;  1N33 L;  2F0M A;  1QZH A;  2JP1 A;  4OX9 Q;  3NK9 A;  4A3G H;  1OTC A;  2CHB D;  4KY5 A;  2L5T A;  3ERO A;  2D5D A;  2B63 B;  2OQK A;  2ATW A;  2N78 A;  4X6A H;  2KEC A;  5GQO A;  2WB1 B;  4IUN A;  3J80 c;  2UU9 L;  3GTQ H;  2SOB A;  2F3V A;  2EYL A;  5FOB B;  4IFD H;  2CH4 A;  4PG3 A;  5J1Z A;  3PSI A;  1YJ9 A;  4DUY Q;  2Z9H A;  1STE A;  3OPO A;  4ZLT F;  2BE5 D;  2EYH A;  2IW3 A;  1F9P A;  3BDC A;  4Q0F A;  1XNR Q;  2GVB A;  2E5L Q;  5DEH A;  2A68 D;  1SE8 A;  2PI2 A;  5LMN Q;  3O13 A;  1DGS A;  1XNQ L;  1QIL A;  1E2Z A;  1FVI A;  4PMB A;  4DV7 Q;  2F0T A;  3QO2 A;  2DJF C;  2B3G A;  1KXL A;  3S1N B;  2XWJ B;  4NP5 A;  3TP5 A;  3OIP A;  1NNX A;  5CV6 A;  3M3Y B;  1ASZ A;  2FFK B;  2VQE Q;  1EZ8 A;  1L2F A;  3K58 A;  1MSH A;  3RMH A;  2E8G A;  2AQ1 B;  2R7F A;  3E0J A;  3K80 C;  1YHA A;  1QUQ A;  1OXU A;  4O0A A;  1IBL Q;  2WB1 E;  4HSV A;  4XT3 B;  3BDO A;  1A15 A;  1EY9 A;  4HJA A;  4UPA A;  1EOV A;  3CW2 C;  1SYD A;  1I3Q B;  3LX0 A;  1VQ9 A;  3GDE A;  3KJO A;  1HQM C;  4JG2 A;  3PUZ A;  4XXE A;  3KJP A;  1ESR A;  4GKJ L;  5EKL A;  3HOV H;  1V1Q A;  3ITP A;  5FKA C;  2HIX A;  1JE5 A;  2I5L X;  1HTL D;  3G48 A;  2NTT A;  2Z0S A;  1X9N A;  4DV7 L;  4JI4 L;  1XNQ Q;  2PO4 A;  2RDH A;  2EJM A;  2EIF A;  2H4O A;  4IFD G;  1A3T A;  1HH2 P;  1CHQ D;  3L9A X;  3OTO Q;  4DUY L;  4QMG A;  1M4V A;  2IHF A;  2A6H C;  4B9X A;  4DK6 C;  4A3G G;  1QNK A;  4H13 C;  2R7D A;  4LF6 L;  1I4Q A;  2EJF C;  2EDG A;  2NN6 G;  2F3I A;  3BZC A;  3K5O A;  2KCN A;  5D65 A;  2F03 A;  3HKZ E;  3T16 A;  4JI1 L;  3WOE A;  4B3R L;  1AFP A;  3G6E A;  1NBW A;  4UDU C;  1HA5 A;  2ZTE A;  3NPP A;  3J7Y W;  3DUZ A;  3FHW A;  4YWK A;  1A63 A;  3H0G G;  2V1C C;  1TY0 A;  2N49 A;  4ZUJ A;  2PMZ B;  1W2B A;  3AFQ A;  4GLX A;  2BCO A;  1Z9F A;  5LL6 X;  3RZO B;  3HFZ B;  1B8A A;  1A0I A;  3BVG A;  3CRL C;  4A3K H;  2VUM B;  4K14 A;  5DNF A;  1VQ4 A;  1WD1 A;  3AMU A;  3PUW A;  2JA7 H;  2R7Z G;  4IPC A;  1L0X B;  1XX8 A;  3K8A A;  4CKC A;  2K04 A;  4A3J B;  1NMF A;  1U5K A;  2LS0 1;  5C44 B;  1FD7 D;  4MHE A;  4QUC A;  5FLM G;  2K6A A;  1VS0 A;  3K0Y A;  1A8V A;  3I73 A;  2LFN A;  2WIN B;  3S15 B;  1RCV D;  3VR2 A;  2HQL A;  4A3K B;  1VMC A;  1HZA A;  2D0P A;  2YU9 H;  3HOZ B;  4HAE A;  2VB2 X;  1SFO H;  4LF6 Q;  4H7B A;  4DV1 L;  1ZKO A;  1A2U A;  3QOJ A;  3F2B A;  2JYO A;  3VR3 A;  1UE6 A;  1Q81 C;  3HOU G;  3ONA B;  4HJ8 A;  2QA4 A;  1M8A A;  1STH A;  1BO0 A;  1GUN A;  5IGG A;  5IGD A;  3E9I A;  5FLX E;  2K5Q A;  4KKS A;  3C3L A;  3M3Y H;  4JI4 Q;  1PRT B;  3E9H A;  3BVZ A;  3R93 A;  2K1B A;  2K5V A;  5C5M A;  5BR8 Q;  4HIO A;  3LWE A;  3J81 c;  1XPR A;  2A68 C;  2M00 A;  2A5H A;  1PVO A;  1K3R A;  4F8M A;  4PZ8 A;  4EQN A;  2Q8I B;  1G29 1;  2ZJQ A;  3GTJ B;  1VQG A;  5DM7 3;  1T5X D;  3CCE A;  4X3S A;  4A3F H;  4QCL A;  1L1O B;  4X64 L;  5GAD C;  1KHI A;  3I91 A;  3T56 B;  5IT9 L;  4DR5 Q;  2YTY A;  1WCM H;  3A8K E;  3CCJ A;  5KND A;  1M1K C;  1IBL L;  3SEB A;  4L5S A;  4GN5 A;  3CD6 A;  3MEF A;  3TS2 A;  5CGK A;  3ICE A;  5IYC H;  3ER0 A;  3RN2 A;  4PMW A;  2EQS A;  1VCI A;  2KEE A;  1S3O A;  2E74 C;  1I4P A;  3F2D A;  4C3H H;  5C6A A;  3GTG H;  1I4X A;  1EIG A;  4K0K Q;  3TDQ A;  5IE8 A;  1CSP A;  4M1U B;  1WD0 A;  5LMN L;  1SYE A;  3S1R H;  3M7N A;  1T5E A;  1OXV A;  1EU4 A;  5EBD A;  4AYB E;  3D6W A;  3HOY H;  3F1Z A;  1O80 A;  1I4G A;  1PMR A;  4ZRZ A;  2PCF B;  4WFN 3;  1L0Y B;  1BXT A;  4HR7 B;  4JI2 L;  5M3M B;  4PMC A;  5C0X G;  1IBK L;  2KHJ A;  2MHV A;  4K5V A;  1R4P B;  2B2W A;  1QE6 A;  3T1Y Q;  1VQJ A;  4DV3 L;  2PPB C;  4JV5 Q;  3NTH A;  5FJ8 G;  2IX1 A;  4IOC A;  1G8Z D;  5J22 A;  1XYI A;  1KAA A;  3H91 A;  2BOS A;  3VYU A;  1W3S A;  1XTD A;  3S1R B;  2PNR C;  3A5Z B;  3C2P A;  2J4X A;  1F2Y A;  5EPL A;  4YWM A;  4KMU C;  1LTG D;  3T13 A;  4JI3 L;  2QF7 A;  2IL8 A;  1HNW Q;  3M9B A;  1SMX A;  4ZYS A;  5EKI A;  3H3V H;  1TWA H;  4JW0 A;  3M4Y A;  1SE4 A;  2K28 A;  2ID0 A;  1TWF B;  1U4P A;  4H44 C;  3RD4 A;  1S5C D;  1LT5 D;  2KUM A;  2PW7 A;  2KJX A;  3A74 A;  3I4M G;  1STA A;  1SE2 A;  1O7L A;  1I6H B;  1DJR D;  2O5I C;  4WJW A;  1EYD A;  3P1H A;  1I50 B;  3ULL A;  1IYJ B;  4GS3 A;  1FNW A;  4FVM A;  1WI5 A;  5C44 H;  3I4N H;  1CK1 A;  2SEB D;  1PRT D;  1X3P A;  5H1S E;  4LFA L;  1Y8P B;  4K2L A;  2VUM G;  3B6Y A;  2A6H D;  1AZP A;  3NBI A;  1VQL A;  1UEB A;  2IT1 A;  4NXM L;  1BUV T;  2PZW A;  3K7A H;  4X3U A;  1AE2 A;  3TQY A;  4DK1 A;  4X65 L;  3S15 H;  2JN4 A;  2B2Y A;  5ISR A;  1TS5 A;  2B2W C;  2R92 H;  5AJ3 Q;  1TWF H;  1Y1V B;  5E7N A;  4U68 A;  1FGU A;  3TSS A;  2JA8 B;  2R93 B;  3S2D H;  3K5M A;  1B53 A;  2QEX A;  3V2T A;  5C4X H;  4A3B H;  4ZUI A;  3FKI B;  3TEH B;  4HJ7 A;  4UP7 A;  4KHP L;  1ENA A;  1RL2 A;  3SHL A;  1VQB A;  4K8J A;  1V1P A;  3PIO 3;  1WTQ A;  1X3E A;  1AE3 A;  3MEH A;  2NVT H;  3RUZ A;  2R3Z A;  3NBH A;  4RKB A;  1V8Q A;  3FPU B;  1HNZ Q;  2B63 H;  1XMQ Q;  2BA0 A;  4A3E B;  1X6O A;  4LF8 L;  3FPP A;  1BCP B;  3GTM H;  4R4T A;  1DZ1 A;  5A35 A;  3NEN A;  2UUB L;  3D4D A;  5E4X A;  1YEZ A;  1NE3 A;  4YCV A;  4XQQ A;  3WOF A;  1G51 A;  4DR2 Q;  1AN8 A;  3I4L A; 
#chains in the Genus database with same CATH homology
 1H9M A;  2B8F A;  5T1I A;  4FF4 A;  4RGM A;  1Y69 U;  4K5W A;  1PYW D;  4H0L C;  1YNN D;  5FK9 C;  2N55 A;  4C1N K;  1LT4 D;  2FIN B;  4RGN A;  3TP6 A;  2AQ2 B;  3SVM A;  2XRS D;  5CV4 A;  2L1B A;  1SNC A;  1Q12 A;  1AZQ A;  2GA4 B;  4RCO A;  5G3L D;  1D6E C;  4Q5V A;  5CV9 A;  2TSS A;  4JBW A;  3PUY A;  3IFD A;  4IUR A;  4ULL A;  1DM0 B;  3NQI A;  4A3F B;  5TSS A;  4IN3 A;  5C3E B;  2XRQ D;  2XWB B;  3KK7 A;  5IIF A;  1VF5 C;  2AUJ D;  5BN3 A;  1CFM A;  2KOL A;  1PXU A;  1YNN C;  3SE0 A;  4XQJ A;  2NWG A;  3R3O A;  1Q90 A;  1WTV A;  1HFN A;  2Z1C A;  3S1Q B;  3NQT A;  1ET9 A;  2E2H B;  3J80 L;  2DN8 A;  4TSS A;  3UI2 A;  1EZ6 A;  5CBE E;  4RCN A;  2R7Z B;  3CQZ B;  1G91 A;  1BBX C;  4XTC S;  2Q8T A;  3DMU A;  2HDL A;  4FNF A;  1IYU A;  3DM1 A;  5NUC A;  1FR3 A;  3KBG A;  2CVR A;  1IW7 C;  2QEJ C;  2J7Z A;  2NYZ D;  2E2J B;  1BCP D;  1JE4 A;  4RA8 A;  1TS4 A;  5J39 A;  4OIK A;  3S1M B;  4KI0 A;  2EJG C;  4LJZ C;  2E75 C;  4XT1 B;  4KKU A;  1PRT F;  1H9J A;  1IYV A;  4V19 0;  3QB3 A;  2BA1 A;  5EKK A;  2RDF A;  2D9U A;  2PQE A;  2WKD A;  2Y0S B;  3PV0 A;  1B44 D;  3G6J B;  1EFI D;  4J8Q A;  1O78 A;  4KV6 A;  4O1N A;  5JOB A;  3R8B A;  2KA7 A;  1PLF A;  3A55 A;  1STG A;  3MXP A;  4NKL A;  1QB5 D;  1F9S A;  1OXX K;  2MP1 A;  5K36 G;  4QUF A;  1BCP C;  3QG1 A;  4C3H G;  2F0U A;  3D4W A;  2F0E A;  1BF4 A;  3TZU A;  5IGF A;  2IX0 A;  4IUU A;  4G7H C;  2FJ2 A;  1PRT C;  1B4O A;  1PZJ D;  4X3K A;  3NWT A;  1RTN A;  2NVQ B;  3LWU A;  4UAI A;  2F1M A;  3QWN A;  3K57 A;  4K2K A;  1CQV A;  3D4R A;  3GV3 A;  1SYC A;  1NAP A;  1SEB D;  2OXP A;  3NTK A;  1EWC A;  2EYO A;  2K5W A;  2VXW A;  3N6R A;  1ENC A;  2ZXR A;  4A93 B;  1XWE A;  2F0O A;  2N88 A;  4J1M A;  5LHY 1;  1BQQ T;  1RKN A;  3IL8 A;  5EGT A;  3NWS A;  1QWY A;  3SK4 A;  3MXG A;  4L63 B;  3C1E A;  3BYY B;  2C9O A;  2MGS A;  5FLX L;  5K36 H;  4ILW A;  1LO5 D;  3Q23 A;  3KBX A;  1JQY D;  3Q22 A;  1MD2 D;  5CMD A;  2K05 A;  2K03 A;  1X3Q A;  5CV7 A;  3HEJ A;  1E2V A;  2E2I B;  1Y1W B;  2XIW A;  1NCV A;  4IUT A;  3A56 A;  4QB4 A;  1QJO A;  1EEI D;  2QCP X;  4ZAI A;  1ICW A;  4M8A A;  3NSW A;  2O4X A;  4K5X A;  2F0G A;  4A3B B;  5C4X B;  2PW5 A;  5ELC A;  1LTR D;  2JA7 B;  4PQX A;  3GQB A;  2QKI C;  2NVY B;  4I7Z C;  1TKW B;  3T53 B;  3CU7 A;  2L55 A;  3D6C A;  4F7X A;  1JC7 A;  3BYT B;  1B1Z A;  3NP8 A;  4Z9C B;  4DF7 A;  1C4Q A;  2ZXP A;  3GD7 A;  3VA5 A;  1D5X C;  2B2V A;  5FO8 B;  3SK6 A;  1GUT A;  2EYJ A;  1HUM A;  1SXT A;  1GJX A;  3OMG A;  2VNU D;  5C0X I;  1RHP A;  2A73 B;  4U67 3;  1UEA B;  1GUO A;  1ROD A;  4CJ2 C;  3K59 A;  1B50 A;  1CI3 M;  3I70 A;  3CHB D;  5I9O A;  1PTO D;  1RDP D;  5G3L F;  3J80 E;  3LNN A;  4KD4 A;  2ICI A;  4DN4 M;  1SJH D;  1ZEQ X;  1A2T A;  1F77 A;  3P7J A;  4B08 A;  1HQR D;  5HGT A;  1S5F D;  4R8N A;  5KNB A;  2R61 A;  2MJ8 A;  1G2S A;  4C3I B;  2E2D C;  4FF3 A;  1TWA B;  1EEF D;  1DOM A;  1GOZ A;  5JVG 3;  3GV6 A;  1V1P B;  3H3V C;  1JWM D;  3GTK B;  2KVM A;  1QCB D;  1MGS A;  3WDN A;  5I4D A;  1LTS D;  4TKO B;  4HCS A;  4IQZ A;  4XYQ A;  2J0T D;  3E5S A;  4QF4 A;  1TR5 A;  3GP7 A;  3MFY A;  1EY0 A;  2F0H A;  3JAM E;  1KAB A;  5I6Y A;  3NXW A;  1Q1E A;  1LTB D;  1ENF A;  5BN5 A;  5D3D A;  2NVT B;  2TMP A;  2A69 C;  5KNC A;  2Q8R E;  4HED A;  3DXJ C;  2QIL A;  3CRK C;  5C5L A;  3GTP B;  1GUS A;  2EOT A;  3MA2 B;  3GTM B;  2EY5 A;  3VYS A;  1NR4 A;  3TN2 A;  1SDF A;  4E6I A;  4G57 A;  4S3S A;  1I6V C;  1H9R A;  3QIA A;  4XYO A;  3D8G A;  4ODG A;  2KED A;  3G7L A;  1QNU A;  3NHH A;  2H1E A;  3FEW X;  2SNM A;  3OHX C;  2K33 A;  2I46 A;  1OO9 B;  5BN4 A;  1TQO A;  1Z47 A;  4RHS A;  4P2C B;  2HQE A;  4MN3 A;  1D2B A;  4IFD J;  1HXY D;  3AU7 A;  1ZYR C;  2D2C C;  2X69 A;  4WRD A;  2F0Q A;  4O42 A;  5COY A;  1DOL A;  3FMC A;  1JOO A;  5EQ0 A;  1X32 A;  3NE5 B;  4XIG S;  3EVQ A;  2JEA I;  4FXD A;  5M3F B;  2NN6 H;  2IPK D;  1TU2 B;  1BCP F;  3R2I A;  5A2Q L;  3HGB A;  4NDX A;  1CA5 A;  1EY7 A;  4CKE A;  3BG3 A;  5CBA E;  4ABN A;  2JEB I;  2WP8 J;  1CTM A;  2KHS A;  3NTI A;  1Y8O B;  5D3I B;  3H94 A;  4JK1 C;  4C3J G;  4IUV A;  1PZI D;  1HA6 A;  1HCZ A;  3HOX B;  1MSG A;  4DAP A;  1JCK B;  4Y7N B;  2XNA C;  4PV1 C;  4N9T A;  3OWE B;  3MTS A;  3EA6 A;  2NTS A;  4ME5 A;  1G2T A;  5C4H A;  3I3C A;  4QIW B;  1V1O A;  2XSC A;  5JPM C;  1F2Z A;  2JXM B;  4EGV A;  2FHT A;  2XVS A;  5JJZ A;  2ZT9 C;  4IUP A;  1PFN A;  1Y8N B;  4KY6 A;  3PO3 B;  3FDT A;  1RF2 D;  4KHV A;  2IJ0 A;  3K7A B;  4R8I A;  3SK5 A;  1D1K A;  4L8J A;  1LTA D;  3ZYY X;  4HMI A;  3KUP A;  4K6D A;  1JOQ A;  1ILP A;  4BA1 I;  2AQ3 B;  2B2T C;  1U4M A;  1W6J A;  1V43 A;  1SSO A;  3F2U A;  1WTP A;  1S5E D;  1F9R A;  4DU9 A;  1NSN S;  3IKJ A;  3DEO A;  3VYT A;  5COR A;  1H9S A;  3GO5 A;  4CJ0 B;  4HCE A;  2EY6 A;  4RGT A;  4CJ1 B;  2AWN A;  5A2Q E;  4MIU A;  5KRU A;  4OHJ A;  2IWH A;  3MWY W;  1S5B D;  4XDX A;  1OXT A;  3TBI B;  3HP3 A;  3KLS X;  1U4R A;  3SK8 A;  3PUX A;  3A8J E;  5KYI A;  2PZU A;  1LTT D;  2EYM A;  3TME A;  1K83 B;  3IAY A;  5C3W A;  3S17 B;  1PTO C;  3VR4 A;  2A6E D;  2LKV A;  3CKI B;  4HTH A;  3MAQ A;  3Q0A A;  3ND8 A;  2A69 D;  1KDB A;  2WAC A;  3H09 A;  1YNJ D;  4A3G B;  3EJI A;  2LY7 A;  3A7A B;  2F0V A;  1HUN A;  2K32 A;  4PNY A;  1F9Q A;  2EXZ A;  1BDO A;  1XXG A;  3VR6 A;  5DAU A;  3DWA A;  2NUC A;  1CZG A;  1B9M A;  3Q6S A;  2E76 C;  5EPJ A;  1W6K A;  3R2T A;  5C0X H;  2DY7 A;  4ZK9 B;  1IKM A;  1VMP A;  5C0X J;  4BY1 B;  3PO2 B;  4OGQ C;  2L9H A;  1K8M A;  3N52 A;  3MC0 B;  3MVV A;  3HS0 C;  5K5P A;  5JPN C;  3MHB A;  3RZD B;  1CA6 A;  1HHV A;  1PFM A;  5HUR A;  3I4M B;  1JOR A;  4A3D B;  4N9P A;  4DXG A;  1TII D;  3A54 A;  2RQX A;  2IX3 A;  5EBC A;  5IGE A;  2DY8 A;  3VR5 A;  2BDN A;  2RKS A;  1JWS D;  3X3N A;  4EQO A;  2JA5 B;  2R6G A;  2NB0 A;  3MXN A;  1SFO B;  1JOK A;  1UUP A;  3W2D A;  1UNS A;  4C1N I;  5IGB A;  1G6Z A;  5CV5 A;  2KCC A;  1KLU D;  1KTK A;  2EY1 A;  1EQV A;  2LMC B;  1YNJ C;  2EVB A;  4DAV A;  1SAP A;  1IW7 D;  1SNO A;  4KN7 C;  2FMM A;  1Z7T A;  1AP0 A;  2NVX B;  5FO9 B;  2F4I A;  4FYD A;  2B2U C;  4RWS C;  5IOC A;  2EZV A;  1FGB D;  1EU3 A;  4NW2 A;  3C46 A;  4I65 A;  2X6G A;  4C2M B;  1GUG A;  3E6Z X;  5T1G A;  1SNM A;  4LK1 C;  5E1F A;  1I4H A;  1E2W A;  4LMQ D;  5C4J B;  2B2Y C;  1AEX A;  2RSN A;  5I2X A;  3QOL A;  3J7A V;  1O7Z A;  1STN A;  1S5D D;  1RD9 D;  4DA2 A;  3HOU B;  2SDF A;  5D14 A;  5F2D A;  2RA4 A;  2JSO A;  3W3A A;  3K5L A;  4A3M B;  2EPB A;  1FNV A;  1HRJ A;  1C48 A;  3NUC A;  1MBY A;  3HOY B;  1LLR D;  2A6E C;  1LT3 D;  5M9O A;  5FO7 B;  1EY8 A;  4HSP A;  2F0L A;  3EFX D;  1R4Q B;  1NUC A;  2WKC A;  1EL0 A;  3GTG B;  3S14 B;  2KQ3 A;  3MZ5 A;  1KNE A;  1TWG B;  4NMZ A;  3FVQ A;  1Q8I A;  2G9D A;  3L7Z C;  2O2L D;  1DON A;  5ELB A;  2M2L A;  4TRD A;  3V96 A;  3L3O C;  2HUG A;  4IFD I;  2F3W A;  4RGO S;  1SYB A;  2F0D A;  1MI2 A;  2PYK A;  4OL7 A;  1ESF A;  5JEA J;  1F2L A;  2K5D A;  3J7A F;  3HG9 A;  2QDB A;  4AYB B;  4BA2 I;  3DEP A;  3M4O B;  2NZ1 D;  1KDA A;  1OXS C;  2EE1 A;  3KLR A;  2OT2 A;  1CM9 A;  3BS1 A;  5JEA G;  5CR3 A;  1DYQ A;  1II3 A;  3TP7 A;  3URY A;  1JWU D;  3K6O A;  2O5J C;  1B9N A;  2WII B;  4RHR A;  1DD2 A;  4OO1 H;  2EYP A;  2JE6 I;  1IL8 A;  1SYF A;  5CC4 A;  3PMF A;  1D5M C;  3SXH A;  4TQU S;  4C3I G;  2HCI A;  1O7Y A;  3V05 A;  5CYU A;  3GTO B;  2JA6 B;  3H6M A;  2BDO A;  1H9S B;  3DHQ A;  1EQT A;  4G7O C;  2F0F A;  2ENB A;  3TZD A;  2G9H D;  2RDG A;  4KJO A;  5IGC A;  5M5Y B;  4RH6 A;  2ICE C;  2NN6 I;  1GUW A;  4K6L A;  4BS9 A;  1WTR A;  2XN9 C;  2NBF A;  1EY5 A;  3AB9 A;  5DM6 3;  1ZXT A;  1ET6 A;  1VDZ A;  4BY7 B;  2F0P A;  1A3U A;  5ELD A;  4CKB A;  3FRP B;  5KGU A;  3OWF A;  1B3A A;  1R9T B;  4KTA A;  4BBR B;  4KJN A;  1WTO A;  5ELE A;  4B9W A;  5IT9 E;  3ERQ A;  1GHJ A;  1A6X A;  4RKL A;  1HTP A;  3S16 B;  1STY A;  2EYF A;  2C5C A;  4FXK C;  3MFG A;  1TS3 A;  3P20 A;  1WTW A;  2Z8L A;  4EQP A;  1ONL A;  2L12 A;  4KHZ A;  4DXF A;  3HRZ C;  2K01 A;  1SE3 A;  5JVH 3;  1BR9 A;  4DFA A;  1CT1 D;  1KLG D;  2VB3 X;  1DCZ A;  5EJW A;  2B2V C;  4DK0 A;  4HMJ A;  3GTL B;  2YU9 B;  5I9P A;  1LTI D;  1F2M A;  1AW7 A;  1LV9 A;  3SR1 A;  5I2Y A;  3QJY A;  3K5N A;  2CW0 D;  1NR2 A;  4DAY A;  4ZKB B;  2X6L A;  1JR0 D;  4FF1 A;  1DOK A;  3PIP 3;  3OMC A;  4CHT B;  4KD3 A;  4IAL A;  5AFW A;  1FNU A;  2F0K A;  1C8C A;  1JB3 A;  4YIJ A;  3VYR A;  2MUY A;  1B2T A;  5M5W B;  1S4Z A;  4LAA A;  3ND9 A;  4L6T B;  2OEO A;  4C56 C;  1WVL A;  4RAU C;  5EPK A;  5I6W A;  1LAC A;  3D31 A;  1D1I A;  1LT6 D;  2HCC A;  1ML0 D;  3GTQ B;  3Q24 A;  1TT2 A;  3PUV A;  1EOT A;  3JAM L;  1TVX A;  1SNP A;  1SMY D;  1KNA A;  2L0C A;  3X3M A;  1FYC A;  1Z6H A;  1SYG A;  3D3R A;  4G7Z C;  3I4N B;  1SJE D;  1CHP D;  2K7V A;  1RTO A;  2B2U A;  2B8G A;  4KKT A;  1PTO H;  4J6H A;  2D62 A;  3J81 L;  3H0G B;  5ELF A;  4ZKC B;  3S9W A;  2F0J A;  4WOR A;  3HZX A;  4K8I A;  4R9W A;  2DNE A;  3KLS A;  5CV8 A;  2AWO A;  4FF2 A;  4ZQ3 A;  2CQA A;  1LAB A;  1SND A;  4CGY B;  1GHK A;  1QOH A;  1DXM A;  3M7G A;  4FO2 A;  4KY7 A;  1KDC A;  3EQL C;  4DNT B;  1IKL A;  2F0S A;  3S2D B;  4BBS B;  3SDZ A;  1TWH B;  4A3I B;  2V4D A;  1CQF A;  4F87 A;  5C4Z A;  3I72 A;  1SNQ A;  1EY4 A;  5M5X B;  1PTO B;  1RJT A;  1STB A;  3OW7 A;  1EYA A;  1XTC D;  2BE5 C;  3DWP A;  4F88 A;  3S2H B;  4C3H B;  4X3T A;  3TP8 A;  2F0W A;  5KEE A;  1TS2 A;  3J81 E;  5KIX A;  5E3F A;  1HPC A;  5JAV A;  4KN4 C;  2I07 B;  1Q3L A;  1U9R A;  1J9O A;  3OSO A;  2ZXO A;  3I90 A;  2PZT A;  1IHZ A;  2YYZ A;  1EIH A;  4C3J B;  4XQN A;  2OF1 A;  4OO1 G;  2A74 C;  4CBV A;  3HOW B;  4DGZ A;  1JIC A;  4V0B A;  5LL6 S;  4OIJ A;  2M9V A;  5JEA H;  1E0B A;  2R92 B;  3I8Z A;  4OO1 I;  2F0I A;  2RVL A;  3OOC A;  4KK7 A;  3BZD B;  2EY2 A;  1Q1B A;  2F0N A;  3P75 A;  3BVM A;  4GZY C;  4EVO A;  1PZK D;  2B39 A;  2DNC A;  2HDM A;  5IOD A;  1EWH A;  3MXU A;  2RSO A;  4DNR B;  1A3V A;  4FP5 D;  2CW0 C;  1TY2 A;  1CZW A;  4BWG B;  5KYL A;  2B2T A;  2FMC A;  1SBB B;  1TWC B;  1K8O A;  3A7L A;  3U9S A;  1WTX A;  1EYC A;  4HN7 A;  1HFG A;  2L11 A;  3BDL A;  3RLF A;  1SMY C;  3C1F A;  1BOS A;  3DWQ A;  3HOV B;  3HKZ B;  2Z4I A;  1EY6 A;  1J8I A;  4G4K A;  5E4W C;  1PFB A;  3T4A C;  2AUK A;  1WCM B;  1QG7 A;  2WAQ B;  1U4L A;  5C3X A;  3KF8 A;  3A8I E;  4IUQ A;  3M85 A;  2RBM A;  3VA7 A;  1BNZ A;  3OIQ A;  4RFB A;  1PDQ A;  1H9K A;  1ZYR D;  2SNS A;  4ID6 A;  1GXD C;  1I4R A;  1PTO F;  2MPM A;  2WV6 D;  2Z4H A;  4FXG C;  1D5Z C;  1ILQ A;  2L4N A;  3IFT A;  1UAP A;  4IZ8 A;  3U9O A;  1VF7 A;  3T51 B;  2F0M A;  2JP1 A;  3NK9 A;  2CHB D;  4KY5 A;  2L5T A;  3ERO A;  2D5D A;  2B63 B;  2KEC A;  2WB1 B;  4IUN A;  2SOB A;  2F3V A;  2EYL A;  5FOB B;  4IFD H;  5J1Z A;  1STE A;  3OPO A;  4ZLT F;  2BE5 D;  2EYH A;  2IW3 A;  1F9P A;  3BDC A;  4Q0F A;  5DEH A;  2A68 D;  3O13 A;  1QIL A;  1E2Z A;  4PMB A;  2F0T A;  3QO2 A;  3S1N B;  2XWJ B;  4NP5 A;  3TP5 A;  3OIP A;  5CV6 A;  3M3Y B;  2FFK B;  1EZ8 A;  3K58 A;  1MSH A;  3RMH A;  2AQ1 B;  3E0J A;  1OXU A;  4HSV A;  4XT3 B;  3BDO A;  1A15 A;  1EY9 A;  1SYD A;  1I3Q B;  3LX0 A;  1HQM C;  4XXE A;  3PUZ A;  1ESR A;  5EKL A;  3ITP A;  5FKA C;  1HTL D;  2NTT A;  2PO4 A;  2RDH A;  2EJM A;  2H4O A;  4IFD G;  1A3T A;  1CHQ D;  3L9A X;  4QMG A;  1M4V A;  2A6H C;  4B9X A;  1QNK A;  4H13 C;  1I4Q A;  2EJF C;  2EDG A;  2NN6 G;  3K5O A;  2KCN A;  5D65 A;  2F03 A;  3T16 A;  3WOE A;  1AFP A;  4UDU C;  1HA5 A;  3NPP A;  3J7Y W;  3DUZ A;  1TY0 A;  4ZUJ A;  2PMZ B;  2BCO A;  5LL6 X;  3RZO B;  2VUM B;  3BVG A;  3CRL C;  4K14 A;  5DNF A;  1WD1 A;  3AMU A;  3PUW A;  1L0X B;  1XX8 A;  4CKC A;  2K04 A;  4A3J B;  2LS0 1;  5C44 B;  1FD7 D;  4MHE A;  4QUC A;  2K6A A;  3K0Y A;  3I73 A;  2LFN A;  2WIN B;  3S15 B;  1RCV D;  3VR2 A;  4A3K B;  1VMC A;  3HOZ B;  4HAE A;  2VB2 X;  4H7B A;  1ZKO A;  1A2U A;  3QOJ A;  2JYO A;  3VR3 A;  3ONA B;  1M8A A;  1STH A;  1BO0 A;  1GUN A;  5IGG A;  5IGD A;  5FLX E;  2K5Q A;  4KKS A;  3C3L A;  1PRT B;  3BVZ A;  3R93 A;  2K1B A;  5C5M A;  3LWE A;  2A68 C;  2M00 A;  2A5H A;  4F8M A;  4EQN A;  2Q8I B;  1G29 1;  3GTJ B;  5DM7 3;  1T5X D;  4X3S A;  4QCL A;  3I91 A;  3T56 B;  5IT9 L;  3A8K E;  5KND A;  3SEB A;  5CGK A;  4PMW A;  1VCI A;  2KEE A;  2E74 C;  1I4P A;  5C6A A;  1I4X A;  1EIG A;  3TDQ A;  4M1U B;  1WD0 A;  1SYE A;  3M7N A;  1T5E A;  1OXV A;  1EU4 A;  5EBD A;  3D6W A;  1O80 A;  1I4G A;  1PMR A;  4ZRZ A;  2PCF B;  4WFN 3;  1L0Y B;  1BXT A;  4HR7 B;  5M3M B;  4PMC A;  5C0X G;  2MHV A;  4K5V A;  1R4P B;  2B2W A;  1QE6 A;  2PPB C;  3NTH A;  2IX1 A;  1G8Z D;  5J22 A;  1XYI A;  1KAA A;  3H91 A;  2BOS A;  3S1R B;  3VYU A;  2PNR C;  3C2P A;  2J4X A;  1F2Y A;  5EPL A;  4KMU C;  1LTG D;  3T13 A;  2QF7 A;  2IL8 A;  4ZYS A;  5EKI A;  3M4Y A;  1SE4 A;  2K28 A;  2ID0 A;  1TWF B;  1U4P A;  4H44 C;  3RD4 A;  1S5C D;  1LT5 D;  2KUM A;  2PW7 A;  2KJX A;  1STA A;  1SE2 A;  1O7L A;  1I6H B;  1DJR D;  2O5I C;  4WJW A;  1EYD A;  3P1H A;  1I50 B;  1FNW A;  4FVM A;  1CK1 A;  2SEB D;  1PRT D;  1X3P A;  1Y8P B;  4K2L A;  2A6H D;  1AZP A;  3NBI A;  2IT1 A;  1BUV T;  2PZW A;  4X3U A;  4DK1 A;  2B2Y A;  5ISR A;  1TS5 A;  2B2W C;  1Y1V B;  4U68 A;  3TSS A;  2JA8 B;  2R93 B;  3K5M A;  1B53 A;  3V2T A;  4ZUI A;  3FKI B;  1ENA A;  3SHL A;  4K8J A;  1V1P A;  3PIO 3;  1WTQ A;  3MEH A;  3RUZ A;  2R3Z A;  3NBH A;  4RKB A;  1V8Q A;  3FPU B;  2BA0 A;  4A3E B;  3FPP A;  1BCP B;  1DZ1 A;  5A35 A;  3D4D A;  5E4X A;  4XQQ A;  3WOF A;  1AN8 A;  3I4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...