1OO9B

Orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
126
structure length
126
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Stromelysin-1
publication title Global Orientation of Bound MMP-3 and N-TIMP-1 in Solution via Residual Dipolar Couplings
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oo9B00
2XWBB 5JPNC 1UEAB 3CKIB 5JPMC 3L3OC 3HRZC 3KLSA 3OHXC 3HS0C 3FRPB 5FO7B 5FO8B 3I70A 2XWJB 2QKIC 3G6JB 1PXUA 4FXKC 2B39A 1OO9B 1JB3A 3T4AC 2A74C 2TMPA 1JC7A 2A73B 1XWEA 1BQQT 3MA2B 2WINB 2I07B 5FO9B 2WIIB 4ILWA 1BUVT 3V96A 4FXGC 1GXDC 3CU7A 1UAPA 5FOBB 1D2BA 2J0TD 1BR9A 2E2DC 2ICEC
chains in the Genus database with same CATH superfamily
1I3QH 2Z9HA 5BR8L 4LFBQ 1IHZA 4L63B 5DLQE 2JEAI 2NVQB 5M5XB 4OIKA 1WTRA 4DV6Q 2BDOA 2QKIC 2B63B 3MEFA 2N88A 2F4VQ 4CKEA 4KY7A 2O5IC 3A7AB 2EJGC 2AHOB 2HDMA 3VR3A 3Q24A 4DUYL 3S14B 2F0SA 3FMCA 4G4KA 3H3VC 3NWSA 3QJYA 4A3MB 5JJLA 3A8JE 5C6AA 4A3CH 5HY6A 1EY6A 2K05A 4P74A 4DAMA 1SSOA 3S1QH 4CDFC 3GTGB 2RSOA 5CV5A 4PMWA 1U9RA 3TN2A 1C48A 4DV5Q 4UY8C 4WJ3M 2DY7A 3Q8DA 1EEFD 2VXWA 2ZTCA 4C2MB 2AWNA 1VS0A 1O7ZA 1NMGA 1GO3E 4X3TA 4DAYA 1ET6A 5ELBA 4BS9A 1JWMD 3CMAA 3MFYA 1FL0A 4DFAA 2K50A 4JI3L 2RCNA 5E7NA 1MKHA 4CKBA 1VQ7A 3GTOB 1ONLA 2D9UA 2KVMA 4DA2A 3EROA 1V1PB 1SE3A 2SEBD 4GOPA 5GROA 1LABA 2F0KA 5CV9A 1PRTF 4L6TB 3SDZA 2NN6I 5T1IA 1XXGA 4J1MA 3W5OA 1M90C 4KK7A 4BBRH 2BDNA 4IPGA 2FXQA 2J0TD 4QIWB 4K2KA 2Q8IB 3LWEA 2K5NA 2NVQH 2D0PA 3LX0A 4C1NK 3RZDB 4K6DA 5M5XH 4GNXB 2B63H 2C9OA 5FKAC 5C4XB 1DOKA 1GOZA 1AP0A 2NN6G 3S14H 3OTOL 3T1YQ 1SFOB 1LTRD 4OELB 4QUCA 4K2LA 2R6GA 1VQCA 4A3MH 3KBXA 4P72A 3T53B 1HR0Q 1U4PA 3GTGH 3OSOA 5H1SE 5JVH3 4C3HG 4DV6L 5HGQA 4C2MH 3J80E 2F4VL 3MXNB 3TRZA 1G2TA 1NR2A 3QOJA 1A2TA 4DV7Q 5A35A 2M2LA 4R8IA 4JW0A 1A3VA 4KV6A 3FEWX 3MTSA 2FFKB 2K28A 2B63G 2NYZD 4ME5A 4L5SA 3GTOH 3L3OC 2IWHA 3HRZC 3L9AX 4DR7Q 1K0SA 5IODA 4DV5L 3S16B 4X62Q 1CTMA 3HKSA 5C3EB 5CMDA 1YJ9A 1CUKA 4YCUA 2UUBL 1QZGA 1F2ZA 4RMFA 1XMQQ 2B2WC 1PZKD 4K8JA 5IT9L 3T51B 3RZDH 1W6KA 1KQSA 2RDHA 3BDLA 2L11A 3TDQA 5C4XH 1KC8C 1K8AC 3NK9A 1HUNA 1GJXA 4R4TA 4KMUC 3X3MA 2PZWA 4HIDA 1EY9A 1SFOH 1BKBA 1DCZA 1Z47A 1VQBA 3OOCA 3OWFA 4KI0A 3U50C 1FJGQ 4B3RQ 4C3IG 2LMCB 1N8RC 5IGCA 2XGTA 1ZYRC 1F9RA 2G9DA 4NW2A 3K5NA 4A3GB 2F0OA 1SEBD 4LUVA 4FXGC 1H9JA 1JE5A 1MJEA 3EBEA 2CFMA 3M4YA 4L5QA 2DNEA 4F88A 4ODGA 4PMCA 4U68A 1I4XA 1K83B 3EA6A 2XIWA 3CP0A 2B2WA 3ONAB 4X65Q 4JBJA 1MSGA 1E2ZA 4CKCA 1X3PA 3UDGA 3SK6A 3T1YL 4H7BA 1MSHA 3I4OA 2VY3A 3DWPA 2TMPA 5BN4A 5C0XJ 1QE6A 1VMPA 2ZJRA 1BO0A 5AJ3Q 1HR0L 1PH6A 1YNJD 3BZKA 2JJQA 4ZAIA 3J81j 3CPWA 1I4PA 1WD0A 1IKMA 3S16H 1L1OB 4JCVE 2QA4A 4IFDJ 3C1FA 1YVCA 2FHTA 1T5EA 5C3EH 3M9BA 3HOXB 1LTGD 1E7ZA 1QVCA 2WB1B 3MWYW 4DV7L 1XPRA 3QG1A 4IOCA 4IN3A 5D65A 1JC7A 4PNYA 2VW9A 3IFDA 2JEBI 1FNUA 3FKIB 2WAQG 4DKAC 4DR7L 4OWTB 1G291 1K28A 1SRUA 5C3WA 4X62L 1C4QA 4POFA 2EPBA 2EZVA 3CRLC 1L0WA 3H15A 3X3NA 1EWCA 1XMQL 2A5HA 4A3GH 1VQHA 1LT4D 4JI2Q 1GUGA 2XVSA 1F9PA 1HA5A 1K83H 5JEAH 3C1EA 1LACA 2Z8LA 5KNCA 4E6IA 4DV2Q 1AE2A 1FJGL 4B3RL 4L5TA 2L4NA 4A3KG 4CHTB 2HD3A 3VA7A 3QOLA 1MIUA 3S2HB 4JPBW 2WV6D 1CKOA 2KCMA 1I4QA 2LXKA 2MJ8A 1S40A 2EY1A 4X3KA 2KA7A 1RJTA 2RDGA 1QG7A 2DUDA 3BVZA 4M8AA 3JC66 4X65L 3HOXH 4K8IA 4IPCA 1A2UA 4GOPB 1IL8A 3HS0C 2CQAA 4APVA 1IBLQ 3OIPA 4NKLA 4R9WA 2K04A 3BZDB 3ERQA 4QIWE 1ASZA 2G9HD 2BCOA 2HQLA 3CCUA 2F0EA 2FJ2A 2NB0A 4FDBA 3I4LA 3FKIH 4JBWA 3K5LA 1EIHA 1RF2D 1H9SA 3W1BA 4EQPA 2CH4W 1H9KA 2K5VA 3NUCA 4DXFA 1YITA 2L55A 3K7AB 1PLFA 2AQ1B 1FNWA 3PF4A 1BCPD 4I7ZC 2K32A 1SYGA 1VQ9A 4XYQA 2WP8J 4N9PA 5EBCA 5ELOA 3S15B 2RA4A 4K5XA 2H5XA 2B39A 5KIXA 2ZJQA 1FVIA 5KNBA 1MI2A 1S5ED 4A3FB 2A73B 1S5BD 4OWWB 4EQOA 5M5YB 1SROA 2F03A 1D2BA 1E2WA 1HZBA 1BBXC 3P1HA 2JXMB 3HOYB 2A69D 3TP5A 4BY7G 3I70A 3OIQA 2HT1A 1K8OA 5IYBH 3S2HH 3ND8A 1PH5A 4JI2L 5CBEE 4IOAA 2F0QA 3HKZG 2Y0SG 3A8KE 2IT1A 1Y69U 1Q1EA 3I72A 3VR5A 1UAPA 2DN8A 4JI6Q 1Q1BA 2A19A 1V1QA 1PTOD 3HP3A 4EVOA 4A93B 4N8X1 4DV2L 1PYBA 3OW7A 1WCMG 2CW0C 1EQQA 1BDOA 3J7AV 1S5FD 2K14A 4JBKA 3H0GB 5IGDA 1TT2A 3K0XA 1Q3LA 2F0MA 3J80L 4G7HC 3S1MB 3IAYA 1TWFB 1EY0A 4TRDA 4U673 3MAQA 5ELDA 3K7AH 4DGZA 3M7GA 4YWMA 2A68D 1E22A 3NTKA 1X56A 1SE8A 4IQZA 5C4ZA 1IBLL 1SMYC 2ES2A 3S15H 3F8TA 4ULLA 5CV7A 3ULLA 2HIVA 1PRTC 5E4XA 3DWAA 4IJHA 4KJOA 2JA6G 5JOBA 4A3FH 4BA2I 4OONA 2SNSA 2EJFC 5C5MA 2JQOA 5M5YH 4I7AA 4DR3Q 4EX5A 2I07B 4Q0FA 2JA8B 1K0RA 2NUCA 3SE0A 1B8AA 1TS5A 5GADC 1K73C 1WFQA 3ULPA 3C3LA 3EN2A 4YWKA 4AH6A 1M1KC 3KOJA 1NE3A 3HOYH 1PH9A 3U58A 3DM3A 4DXGA 2B2TC 1CA6A 1E2VA 3K59A 4ZQ3A 1J6QA 3NHHA 2Q2UA 5C0XH 1E3PA 2CKZB 3I3CA 1NCVA 3L7ZC 4BY1B 1IKLA 4A93H 2WB1E 1YNND 3MC0B 4IFDH 4A3LH 1LTLA 3H0GH 1TS4A 1ENFA 2VZAA 3S1MH 1TWFH 4DU9A 1VF7A 1I6HB 1KHIA 2KJXA 4QB4A 1Y8PB 5EAYA 4QF4A 1V43A 3W3AA 3KF8A 2OQKA 1CA5A 2B2TA 4JI6L 1KRTA 3Q23A 2C35B 2XN9C 3FVQA 5KYLA 3NTHA 1UEAB 3TQYA 4PV1C 1ZEQX 4O1NA 1VQKA 1AEXA 4GZYC 4IUPA 2K1BA 3NQIA 5J39A 2F3IA 4JI8Q 1VQFA 4WJ4A 1KNAA 5HGTA 3NTIA 3G48A 4N9TA 2RBMA 1CM9A 2JA8H 3A0JA 1HRJA 4WFN3 1EY8A 1O7IA 1SAPA 4QMGA 3W2DA 2AQ2B 3AQQA 1ILPA 1XNRQ 3N52A 3PIO3 3AU7A 3MXGA 5GQOA 3F1ZA 4RGNA 2TSSA 1UNSA 5F2DA 3L0OA 1B4OA 2UXBQ 3GDEA 4MN3A 3KK7A 1A8VA 1VQNA 2MQHA 5ELCA 1YJWA 1HH2P 3GTPB 2RSNA 4FF2A 2IL8A 2EQSA 4WORA 1WOCA 4OO1I 3V2TA 4DR3L 4BY1H 4J6HA 5ELNA 1I94Q 2YTYA 3AYHB 1P8LA 3CU7A 1TY2A 4ZCKA 3N6RA 2E2IB 1JWUD 4LFAQ 2KECA 3CCLA 5IGGA 2EOTA 1I6HH 4FF3A 2B2UC 2B29A 4R4QA 3CCJA 4ZK9B 4JV5Q 4Q5VA 4PQXA 3BVGA 4OO1G 1Y8NB 4NMZA 4QGUA 5IYCG 2MNAA 2ENBA 2RHQB 1EYCA 2GVBA 4C3HB 4RFBA 2F0UA 2DJFC 4BBSG 5A2QL 4OGQC 5I9OA 1A6XA 4A75A 2L15A 3ND9A 4G7OC 1K3RA 4DAVA 1Q86C 2C5CA 3TP7A 4Y7NB 2K33A 2X6GA 4ZKCB 1AH9A 1ENCA 4C3JG 2UXCQ 1STNA 4BY1G 2N3SA 1PH2A 1VQGA 1DONA 3R2TA 4XT3B 3DM1A 2XSCA 2OEOA 3A7LA 2E5LQ 2B2UA 4P73A 1YEZA 4ZLTF 1YHQA 2VS1A 2PNRC 1JB7A 3GQBA 3EQLC 2F0NA 3Q0AA 3GTPH 4JI8L 1CI3M 1II3A 2ALYB 3T56B 4H0LC 1EFID 4B3MQ 1VQPA 5LL6S 1STEA 2BH2A 1EIGA 1XNRL 2GA4B 2CWAA 1EWHA 3KDFA 2I5HA 3F2UA 2UUBQ 2ZM6Q 2NN6H 2E2IH 2VUMG 2UXBL 2I5LX 1PYWD 5JAVA 1HTPA 2NVYB 1VQ8A 5JVG3 3UDFA 3VYUA 2A8VA 3FDTA 1J5EQ 4C3IB 2O5JC 3J7ZC 3JAMi 2B8GA 3LGJA 2E2JB 3DEOA 4DR4Q 1ZYRD 3PIPA 2F0JA 2PI2A 2YU9B 1YZ6A 3BZCA 2HQEA 1LT3D 4PZ6A 1AFPA 3QO2A 4C3HH 1I94L 4L5RC 4XTCS 3R3OA 5KYIA 2NBFA 1O80A 2E76C 4K14A 1C7YA 1B53A 3MXUA 3PSIA 3RN5A 3NPPA 2G5DA 4LFAL 1L0XB 4Y7NH 4IUUA 3H94A 2EXDA 3CRKC 3LWUA 3CC4A 2YV5A 2M9VA 4JV5L 1HNWQ 1LT6D 2Z6KC 5E4WC 2FMCA 4ALPA 1IYJB 3MHBA 4QL5A 5J3BA 3UE0A 4CGYB 4JI1Q 1U5KA 4HSVA 1YI2A 3OMCA 1EIYB 3M7NA 4JK1C 2HHHQ 4UP9A 2WIIB 2VQEQ 2K4KA 1VQ5A 1TQOA 4NPSA 4LF6L 2JA7G 3RLNA 1KLUD 4KN7C 4YY3Q 1DXMA 3OYYA 3CHBD 1VQ4A 1RODA 3EVQA 1SJED 4JBMA 2UXCL 4GLXA 2WAQB 1F9SA 2K01A 2E5LL 4A3EG 1MGSA 1BCPF 4XXEA 3J7AF 1JOKA 1XPOA 1B9NA 1STHA 1WD1A 2WINB 2NVYH 5KEEA 4HJ8A 1PH4A 1CZGA 2IHEA 3NXWA 1I50B 1EEID 3OWEB 4C3IH 4ZKBB 2ICEC 1X54A 4HJAA 2XRQD 4WRDA 5NUCA 2E2JH 2HCCA 4YCWA 3VA5A 1SYBA 4O42A 1GUWA 1Q90A 2OCEA 2YU9H 1AZPA 2CVRA 4B3ML 5FO7B 4IPDA 1VMCA 1O78A 1LLRD 2K5DA 1KAWA 4FVMA 3DHQA 4AYBG 3SHLA 1BCPB 1HZCA 3HG9A 1JJ2A 1KRSA 2DJGC 1SR3A 2AQ3B 2PW5A 2XRSD 4DNTB 2ZM6L 2F3WA 4IUTA 3WDNA 2K6AA 3ZYYX 4IUVA 3BDOA 1G6ZA 4IALA 1J5EL 3AFQA 4A3KB 5C44G 4RCNA 1P16A 1GUNA 2Q8RE 2ZT9C 1NY4A 4DR4L 2JN4A 5HURA 3DLLA 4HMIA 3K57A 4S3SA 2CH4A 3FRPB 4OHJA 3I4NG 3J81i 1N32Q 1JCKB 3NWTA 2QDBA 1WTQA 2FINB 1LTBD 1OO9B 3D6WA 4C56C 1DGSA 1WVLA 2A6EC 2L12A 1PTOF 3ZJYC 3D0FA 4HIMA 2EYJA 3NP8A 2NZOA 4UDUC 4F87A 1Z6HA 4BBRB 1Q8KA 1SNMA 1IBMQ 2SOBA 5ELFA 4P75A 3HOVG 3RLFA 4UHVA 1HNWL 4XIGS 3UE1A 4JI1L 3J7YW 3TEHB 2D5DA 2OF1A 1IW7D 3FHWA 1BVSA 5K5PA 1TXYA 3BVMA 2K52A 2OTLA 5I2XA 2HHHL 2EY5A 1PTOB 4ZRZA 2VQEL 1QVGA 4HMJA 1ML0D 3GTMB 1I50H 2F4IA 4DK6C 3F2DA 2E8GA 4MNOA 3JAMc 1Q7YC 4YY3L 5ELEA 4JI4Q 1N34Q 1CT1D 2EY2A 1EUJA 1TY0A 4M1UB 4RGTA 3BG3A 1IZ6A 1B3QA 1EQTA 1RTOA 4R4IA 4JOIC 3R8BA 1VF5C 2KHJA 1E24A 4HIOA 2R7ZB 2ICIA 2N49A 1E1OA 1K9MC 1OXTA 1NUCA 1EU4A 1GHJA 4FNFA 4OX9Q 5C3XA 4A3KH 1AZQA 4BY7B 5FOBB 4CJ1B 1C0AA 4DUZQ 5M3MG 1ET9A 2D2CC 2SDFA 2H1EA 3A5UA 3HKZB 2Y0SB 4JG2A 3KYHC 1A3TA 2CHBD 5CYUA 4AQYQ 1SNCA 4KLKA 1XTDA 1VQOA 3I8ZA 2B2VC 3T4AC 3CMEA 3KJOA 4A4IA 1KL9A 1EIFA 3CQZB 1WTVA 1TWAB 1UE1A 1EWIA 4JOIA 1WCMB 1A62A 2NVTB 1HQRD 2CW0D 5FLMG 1E1TA 4B3TQ 3IFTA 5JPMC 1JQYD 5CORA 4LF7Q 3BYTB 1I4GA 3D6CA 1RD9D 3RR5A 1N32L 1LTTD 1VQLA 1FR3A 4FP5D 1R4QB 4LF9Q 2LFNA 1VQ6A 3PGZA 2B2YC 3HZXA 2IW3A 1PTOH 1S5CD 3KDFB 3PV0A 2JE6I 4DAYB 3GTMH 5GAGC 3DEPA 4K6LA 3RUZA 4DK1A 2XTIA 4HJ9A 1JICA 3VR2A 4CBVA 2A6HD 2VL6A 3PMFA 1SMYD 2YTXA 1IBML 5A2QE 1XNQQ 2JA6B 3TREA 1PRTD 4DAPA 5FLXc 2MPMA 5IGEA 1VQJA 1G91A 1T9HA 2R7ZH 5FJ8G 3U9SA 1BNZA 3NEMA 3VR6A 1QUQA 3TZUA 1CSPA 4V190 1W2BA 3SXHA 2MP1A 4RGOS 4BY7H 4RWSC 2JA9A 4JI4L 2K5HA 4LF5Q 3U4VA 1N34L 4JI7Q 3J81c 1HFNA 1F9QA 2CQOA 3SK4A 4DN4M 2IX0A 2OTJA 4P2CB 3CQZH 4JVZA 1TWAH 3C46A 3OPOA 3I56A 1GD7A 4ID6A 1CSQA 3K5MA 1YJNA 2KBNA 5K36H 1WCMH 4OX9L 1F77A 4IZ8A 2JSOA 2R92G 2NVTH 3A74A 1PV4A 4DUZL 3SGIA 1PH3A 3M3YB 2WAQE 2R7ZG 1KIXA 1B1ZA 2O2LD 3CXCA 4AQYL 1EYGA 4BXXG 2L1BA 3T16A 3NSWA 1GUSA 3TS2A 3STBC 1TR5A 2MUYA 1KD1C 5I6WA 2EXZA 1W3SA 2OT2A 2N78A 4DNIA 3TP6A 3U4ZA 2JA6H 2F0FA 2OWOA 3A54A 5EKKA 4B3TL 4LF7L 3OW2A 2EIFA 4R1JA 4CDCC 1PVOA 2L9HA 4MTNA 4PZ8A 1ZKOA 2Z4IA 4LF9L 3CF5A 3OHXC 3OMGA 1FGUA 1U4RA 4LUOA 5KRUA 5K36G 1CK1A 1I4RA 2HIXA 4OIJA 4GS3A 2BE5D 3RN2A 3H3VI 1R4PB 2IX3A 3BDCA 3R93A 1XNQL 4XDXA 5J1ZA 2DGYA 3AB9A 2A1AA 3C2PA 3UDIA 4GNXC 1DJRD 1BR9A 3PF5A 1Q8IA 3GV3A 4OEMB 5GAEC 3HEJA 2K5QA 1Q12A 4GKJQ 4NXMQ 1EZ8A 4RAUC 3VR4A 2RHSB 4O0AA 3G6JB 2PZTA 3MZ5A 3LNNA 5IGBA 1UWVA 3PO2G 3AFPA 3QIAA 1BBUA 1NSNS 2UUAQ 1D5MC 4HJ7A 1RIPA 2PCFB 4LF5L 3M3YH 3WOEA 4JI7L 4JI5Q 2EYFA 5C4JB 4KTAA 1MD2D 2WACA 1NNXA 3K81C 2JK8A 1PMRA 3R2IA 2DNCA 4BWGB 4BBSB 2F0HA 5IE8A 2Q2TA 5IWAQ 1OXVA 3CAMA 1H9RA 1PZJD 3J7A5 3HOUG 1C8CA 4HCEA 4JI0Q 1HFGA 3CC2A 2WKCA 4C3JB 1GM5A 4B9XA 3EFXD 1VQIA 1UEBA 4K0KQ 4DNRB 1KAAA 4DV0Q 1D6EC 2K7VA 4KJNA 3K58A 1LTSD 1CFMA 3E3XA 2ATWA 2F0PA 2J7ZA 4KHVA 3TSSA 1V1OA 3I91A 5IP9G 1K8GA 4EQNA 5EJWA 1QNKA 2NTSA 3D31A 2MO1A 4B08A 2BA1A 3HKZE 4X3UA 2Y0SE 2O4XA 5EKLA 1HQMC 1D1IA 3SK8A 3GTKB 3RNUA 1A3UA 3Q6SA 1GKHA 2Z6BA 5CR3A 3T1HQ 1PYSB 1U4LA 1B50A 1PFNA 1RCVD 2R3ZA 1YIJA 1M8AA 1SNOA 3GV6A 5AFWA 2VUMB 1L2FA 1Z9FA 2A74C 5LMNW 1NBWA 3L2PA 4A3DB 5CBAE 4LUZA 4G7ZC 4N8FA 1GUOA 2PPBC 5FO9B 4OO1H 2KCNA 4ILWA 3PUYA 4RHRA 5C4JH 4B3SQ 1XTCD 5IYCH 4OL7A 3M85A 1LYLA 1STAA 3TMEA 4QUFA 4GKJL 2RDFA 4NXML 2I5MX 3S9WA 1QOHA 4BBSH 3TP8A 3S2DB 2Q2HA 3NE5B 5IT9c 5FLXL 3FPPA 5EQ0A 5D3DA 4HIKA 3CC7A 4A3JG 3PQIA 2UUAL 3HFZB 4MZ9A 2Q8TA 2HCIA 5IY0A 1KDCA 1FD7D 4YCVA 4C3JH 4GKKQ 5IP7G 4JI5L 4NXNQ 2H4OA 5I4DA 3NENA 1L1OC 2EY6A 4F8MA 1ICWA 1MJCA 1Q81C 4GN3B 1KTKA 3MVVA 4ABNA 2LXJA 1DM0B 1O7LA 4DPGA 4RGMA 2OQ0A 4A76A 5IWAL 2QGQA 4LF4L 3J81L 2JA7B 1HA6A 2N55A 3GTQB 4JI0L 3S1NB 3GTKH 4Z9CB 1H9SB 2RCFA 1UE7A 2LSSA 4A3BG 1D1KA 3KF6A 4K0KL 1TS3A 3I73A 4DV0L 2E74C 1Q46A 5KGUA 3CKIB 4HJ5A 4LFCQ 5EGTA 1L0YB 4A3EB 4LF6Q 1ICFB 2VUMH 1X55A 1AE3A 3BYYB 1SNDA 3S24A 4A3DH 1VDZA 2AMCB 2KEDA 2PNHA 3H91A 4CDDC 1PFBA 1ZXTA 1YNXA 5I9PA 4A3IG 5M3FB 1X3FA 4HCSA 3DXJC 4XQNA 1B7YB 3VYSA 3T1HL 1PZID 2MO0A 1IYUA 4DV4Q 4FXDA 2GN5A 2B3GA 1JR0D 5DEHA 4AYBB 1HJPA 1EFWA 3S2DH 1DD2A 5BN5A 1DOMA 2MHVA 4LNQA 2QEXA 1PH7A 2EJMA 2KHIA 3J80i 1YNNC 2JA5B 2ZTEA 3S17B 5M9OA 3KLWA 4B9WA 4JYAQ 4RKBA 5C44B 3QR8A 1WTWA 3KLSX 1WTHA 1N36Q 3S1RB 2QCPX 2VQFQ 2YTVA 5J22A 1STBA 4B3SL 2EYLA 4UAIA 3I4NB 1EOVA 1QILA 3KLRA 1Y1VG 2CWPA 4OWXB 2E2HB 4GOPC 3PO3G 1MHWC 5JEAJ 4FYDA 5IGFA 1TIID 2PW7A 2KQ3A 2MFIA 4A3DG 4H13C 1HNXQ 3F2BA 2A6ED 4R8NA 1PA6A 2B8FA 2JA7H 1SBBB 3GTQH 1PFMA 3S1NH 1S72A 4RCOA 1JB3A 4QJFA 5EPLA 2ZXPA 4QQBX 2ZXOA 3HOVB 4GKKL 1G6PA 2NWGA 4HSPA 4NXNL 1DOLA 4DR5Q 3PUVA 4LWCA 2UUCQ 4ME3A 4RA8A 1EL0A 4A3EH 1YHBA 3K80C 1G51A 5DM73 3IRBA 3PUZA 4GN4B 1XMOQ 1KLGD 2V1CC 2DY8A 5DM63 2MGSA 5EPKA 2IHFA 3CCQA 1NJIC 2WFWA 1HTLD 5M3FH 3I90A 3TBIB 2F52A 1RDPD 3D4RA 4LF8Q 1LTID 4LAAA 1OXUA 4H02A 4TVAB 4A3CG 5IIFA 1E0BA 4LFCL 4KKTA 3U9OA 2F0LA 2F1MA 4KY6A 1F2LA 4MIUA 5I2YA 2JA5H 3S17H 2L0CA 5C44H 1KDAA 1VQEA 3S1RH 4I65A 1PRTB 4PZ7A 5M3MB 3I2ZA 2NZHA 4J8QA 4ZUIA 3I4NH 1X65A 4RH6A 2QW7A 3AMUA 3HOZB 2E2HH 4LK1C 2Z6KA 4DV4L 3HOWB 1VQMA 4LFBL 1EY7A 1VQAA 1KNEA 1K3BC 4G57A 1DZ1A 3CD6A 5M3FG 4DR1Q 5D14A 3K6OA 2R93B 2LY7A 3CCEA 3HOVH 4JYAL 1QWYA 1WTPA 4HAEA 4BBRG 1N36L 3GD7A 1NR4A 3K5OA 3KF8B 2VQFL 2F0IA 3RD4A 4AIMA 4GLVB 3SK5A 1BQQT 3H09A 4P71A 1O7YA 2JA5G 2PQAA 5CV8A 1HNXL 2K03A 4IJLA 4YWLA 4KN4C 3E0EA 1HNZQ 3SEBA 3D8GA 3JAME 1QNUA 1JWSD 2XNAC 4KKSA 2QDLA 1EY4A 3RZOB 1SXTA 3G7LA 4A3MG 2FMMA 2OXPA 5LMUQ 4DR5L 1D7QA 2KHSA 5DAUA 1ENAA 2UUCL 2IJ0A 1XMOL 5TSSA 1NAPA 2VB2X 3A8IE 1JE4A 3J80c 3WWVA 1TWHB 4BA1I 2LKVA 1A63A 2X6LA 1V9PA 2ZXRA 4XQQA 1B9MA 3K7UC 2I0QA 3P75A 3PIP3 5M3MH 1J9OA 1RTNA 1PH1A 5EPJA 4LF8L 3HOZH 1XX8A 3E6ZX 5E3FA 3HOWH 3KUPA 4DR2Q 1EOTA 3WOFA 1LT5D 1I4HA 1ESRA 1X3GA 1STGA 3DMUA 3KFUA 1X6OA 1UE6A 1JT8A 1HUMA 2IPKD 2R93H 1OXXK 2VNUD 2CCZA 1HR0W 2F0VA 1CKNA 2R92B 5FLMH 3TZDA 2E75C 3K8AA 2PO4A 4TKOB 2R7DA 4KHZA 1LV9A 3QWNA 5G3LD 2EYMA 4JC0A 5EKIA 3EIVA 3KF6B 1VCIA 1TS2A 4F7XA 3GO5A 2BH8A 2VB3X 3GTJB 5C4XG 5CV6A 2RKSA 3GP7A 1KDBA 1JJGA 2X69A 1JMCA 1GVPA 2XWBB 4MTKA 4DR1L 5FK9C 3STBD 1SE2A 2UU9Q 3RMHA 4O2DA 3NELA 5L37A 3RZOH 3HOZG 5FLXE 5FO8B 1IL2A 1W6JA 3HOWG 3SVMA 4NB3A 2NTTA 4CJ2C 4LW1A 5T1GA 1B44D 2AWOA 1T5XD 2QF7A 1MBYA 3IL8A 4AYBE 5FJ8H 4J15A 1WTOA 1FNVA 2R93G 1B3AA 1KABA 2KEEA 1FYCA 3V96A 1TWHH 1D8LA 1HNZL 4DR6Q 3KLSA 1QCBD 4TSSA 5LMUL 3J81E 2KUMA 4ZYSA 4Y52H 3M4QA 4RG1A 1HZ9A 1TKWB 3CCMA 1F2MA 4EQ5A 5EBDA 5C3EG 3NBHA 4FXKC 2B2VA 2V4DA 4X66Q 1CQFA 1A15A 2SNMA 1EQVA 2ZTDA 1X3EA 1N33Q 2R92H 3PO2B 3QB3A 4XT1B 2RVLA 3W1GA 2WKDA 3CCSA 3DUZA 3UI2A 1WYDA 5E1FA 4BXXH 2EYHA 1QB5D 3GTJH 4DV1Q 2EVBA 1H9MA 4DR2L 2AUKA 2B2YA 3I55A 4LJZC 3CCRA 1D5ZC 4HR7B 1SNPA 1I6VC 3ITPA 1YBYA 2BA0A 2LS01 3HOUB 3BS1A 1SYFA 3FP9A 4A3GG 1EU3A 1C9OA 3CW2C 4HN7A 2J4XA 4IUNA 1SLJA 3KJPA 1JJCB 3DWQA 4K5VA 3BJUA 4IURA 3VYRA 2HUGA 2R61A 1B2TA 2PMZB 1IW7C 5AJ3L 2Z1CA 1HXYD 3KBGA 5JEAG 1IBKQ 5JJIA 1BUVT 2YYZA 2D0OA 3PUXA 4UPAA 5I6YA 2UU9L 2BOSA 4KKUA 1A0IA 1OTCA 1HCZA 1CHPD 1M4VA 1YNJC 1LUZA 3RLOA 1Z7TA 2F0TA 3E0JA 4FF4A 1PXUA 1UE5A 1WI5A 4H44C 1F2YA 2UXDQ 3H6MA 1XWEA 3ERSX 4YHHQ 1S4ZA 2PZUA 3HOXG 1SYDA 2AUJD 1HPCA 2K5WA 3H3VH 3PO2H 2WB1G 2D62A 4YIJA 3M4OB 4DR6L 1CZWA 2M00A 5M5WB 3I4MB 4DV3Q 4TQUS 2EYPA 4IUQA 1IXRA 5C4HA 1TU2B 3AEVA 3FKIG 2F0WA 5CV4A 3G4SA 3D4DA 5COYA 2RQXA 1WTXA 1X32A 1CQVA 2QILA 1D5XC 1RHPA 2PQAB 3PIOA 4C1NI 4X66L 3IKJA 1N33L 5LHY1 3HOUH 4A3JB 3SR1A 4L8JA 1SDFA 5C5LA 5IYDH 4XYOA 3K0YA 1Y1WB 1BOSA 4HTHA 2XWJB 5LMNQ 1XYIA 4DV1L 1PH8A 4NP5A 4RHSA 4CDEC 4KHPQ 1SMXA 4OXPA 5ISRA 4DK0A 4X3SA 2EE1A 2L5TA 5KNDA 1U4MA 1V1PA 2F0GA 1B70B 4DK3C 1HZAA 5IP9H 3HGBA 5CC4A 1GHKA 2KENA 5D3IB 1GXDC 4PG3A 1AN8A 2E2DC 1H95A 2I46A 2A6HC 4RKLA 3Q22A 5IYBG 5IOCA 4PMBA 1QZHA 1PHJA 1XPUA 5JJZA 2K75A 1BXTA 4FF1A 1Y8OB 1RL2A 3ICEA 1CHQD 4A3BB 1SJHD 3JAML 4GNXA 4FO2A 3VDYA 4QCLA 5DNFA 4EGVA 1ILQA 1IBKL 4LF4Q 5BN3A 2AKWB 1N9WA 2ID0A 4KD3A 1R9TB 5JJKA 3MFGA 2JYOA 3E9IA 1G8ZD 2F0DA 3M4OH 1RKNA 3NBIA 5IYDG 5M5WH 4KD4A 3I4MH 1CKNB 3MXPA 2NVXB 4UP8A 4WJWA 1ASYA 4A3IB 1TWGB 1BBWA 5GAHC 2ASBA 3BU2A 3MEHA 3O13A 4GLAC 3M4PA 2QEJC 2ZJPA 1BCPC 4LMQD 2UXDL 1QJOA 1EY5A 4DF7A 2P5ZX 4X64Q 1OXSC 4YHHL 1SN8A 3MXNA 1PDQA 1JORA 5IT9E 3ULJA 1SE4A 4QY7A 1S3OA 4A3JH 3P20A 3CCVA 2EYOA 1TWCB 4DV3L 4R4CA 5IP7H 4A3FG 1Y1WH 4IO9A 2KCTA 1LO5D 3V05A 4NDXA 5BR8Q 3F2CA 4CJ0B 3GTLB 1LM0A 1Y1VB 3G6EA 5C0XI 1G2SA 3EJIA 1SYEA 1EQRA 3A56A 3PO3B 1NMFA 2JP1A 1LTAD 4POGA 4KY5A 2A69C 3I4MG 1NTGA 3D3RA 3HOYG 4DUYQ 4ZUJA 2Z4HA 4IFDI 2GVAA 2Q2IA 5JPNC 3B6YA 4MHEA 4A3BH 3URYA 1IYVA 1I3QB 5LMNL 5C0XG 2IY5B 1GUTA 3I7FA 4KHPL 1PTOC 2RF4A 3FPUB 1YHAA 5CGKA 3PUWA 1R9TH 2KOLA 1X3QA 4XQJA 2Z0SA 4A93G 2HDLA 3NBHB 1KXLA 3E9HA 2PI2E 1EYDA 1STYA 4IFDG 2NVXH 4A3LG 1HHVA 1Y1WG 1EZ6A 4R4OA 4HEDA 4A3IH 3H0GG 1I5FA 1TWGH 2BE5C 2KCCA 1ESFA 2PQEA 1SNQA 1CKMA 2IX1A 3UDXA 2N8NA 3VYTA 4JI3Q 1QUQB 3D4WA 2A68C 3S1QB 1AW7A 3CPFA 1QVFA 4GN5A 1X9NA 3T13A 3ER0A 1TVXA 3MA2B 3E5SA 1JOOA 1S5DD 3NQTA 1TWCH 1SYCA 3PCOB 1K8MA 2NZ1D 4IPHA 3GTLH 1UUPA 1V8QA 1XJVA 1Y1VH 2PMZE 4V0BA 2JA8G 3PO3H 4X64L 2EDGA 1L1OA 4UP7A 1DYQA 1Y14B 1VQDA 3A5ZB 1FGBD 1BF4A 1JOQA 1PFSA 1U0LA 1Q82C 3OTOQ 1WJJA 4K5WA 4X6AH 3G71A 3P7JA 2F3VA 3A55A 5LL6X 2PYKA 1EYAA 3TS0A 2R7FA 1J8IA 5G3LF
chains in the Genus database with same CATH topology
1IHZA 4L63B 2JEAI 2NVQB 5M5XB 4OIKA 1WTRA 2BDOA 2QKIC 2B63B 2N88A 4CKEA 4KY7A 2O5IC 3A7AB 2EJGC 2HDMA 3VR3A 3Q24A 3S14B 2F0SA 3FMCA 4G4KA 3H3VC 3NWSA 3QJYA 4A3MB 3A8JE 5C6AA 1EY6A 2K05A 1SSOA 3GTGB 2RSOA 5CV5A 4PMWA 1U9RA 3TN2A 1C48A 2DY7A 1EEFD 2VXWA 4C2MB 2AWNA 1O7ZA 4X3TA 4DAYA 1ET6A 5ELBA 4BS9A 1JWMD 3MFYA 4DFAA 4CKBA 3GTOB 1ONLA 2D9UA 2KVMA 4DA2A 3EROA 1V1PB 1SE3A 2SEBD 1LABA 2F0KA 5CV9A 1PRTF 4L6TB 3SDZA 2NN6I 5T1IA 1XXGA 4J1MA 4KK7A 2BDNA 2J0TD 4QIWB 4K2KA 2Q8IB 3LWEA 3LX0A 4C1NK 3RZDB 4K6DA 2C9OA 5FKAC 5C4XB 1DOKA 1GOZA 1AP0A 2NN6G 1SFOB 1LTRD 4QUCA 4K2LA 2R6GA 3KBXA 3T53B 1U4PA 3OSOA 5JVH3 4C3HG 3J80E 1G2TA 1NR2A 3QOJA 1A2TA 5A35A 2M2LA 4R8IA 1A3VA 4KV6A 3FEWX 3MTSA 2FFKB 2K28A 2NYZD 4ME5A 3L3OC 2IWHA 3HRZC 3L9AX 5IODA 3S16B 1CTMA 5C3EB 5CMDA 1F2ZA 2B2WC 1PZKD 4K8JA 5IT9L 3T51B 1W6KA 2RDHA 3BDLA 2L11A 3TDQA 1HUNA 3NK9A 1GJXA 4KMUC 3X3MA 2PZWA 1EY9A 3OOCA 1DCZA 1Z47A 3OWFA 4KI0A 4C3IG 2LMCB 5IGCA 1ZYRC 1F9RA 2G9DA 4NW2A 3K5NA 4A3GB 2F0OA 1SEBD 4FXGC 1H9JA 3M4YA 2DNEA 4F88A 4ODGA 4PMCA 4U68A 1I4XA 1K83B 3EA6A 2XIWA 2B2WA 3ONAB 1MSGA 1E2ZA 4CKCA 1X3PA 3SK6A 4H7BA 1MSHA 3DWPA 2TMPA 5BN4A 5C0XJ 1QE6A 1VMPA 1BO0A 1YNJD 4ZAIA 1I4PA 1WD0A 1IKMA 4IFDJ 3C1FA 2FHTA 1T5EA 3HOXB 1LTGD 2WB1B 3MWYW 3QG1A 4IN3A 5D65A 1JC7A 4PNYA 3IFDA 2JEBI 1FNUA 3FKIB 1G291 5C3WA 1C4QA 2EPBA 2EZVA 3CRLC 3X3NA 1EWCA 2A5HA 1LT4D 1GUGA 2XVSA 1F9PA 1HA5A 5JEAH 3C1EA 1LACA 2Z8LA 5KNCA 4E6IA 2L4NA 4CHTB 3VA7A 3QOLA 3S2HB 2WV6D 1I4QA 2MJ8A 2EY1A 4X3KA 2KA7A 1RJTA 2RDGA 1QG7A 3BVZA 4M8AA 4K8IA 1A2UA 1IL8A 3HS0C 2CQAA 3OIPA 4NKLA 4R9WA 2K04A 3BZDB 3ERQA 2G9HD 2BCOA 2F0EA 2FJ2A 2NB0A 3I4LA 4JBWA 3K5LA 1EIHA 1RF2D 1H9SA 4EQPA 4DXFA 1H9KA 3NUCA 2L55A 3K7AB 1PLFA 2AQ1B 1FNWA 1BCPD 4I7ZC 2K32A 1SYGA 4XYQA 2WP8J 4N9PA 5EBCA 3S15B 2RA4A 4K5XA 2B39A 5KIXA 5KNBA 1MI2A 1S5ED 4A3FB 2A73B 1S5BD 4EQOA 5M5YB 2F03A 1D2BA 1E2WA 1BBXC 3P1HA 2JXMB 3HOYB 2A69D 3TP5A 3I70A 3OIQA 1K8OA 3ND8A 5CBEE 2F0QA 3A8KE 2IT1A 1Y69U 1Q1EA 3I72A 3VR5A 1UAPA 2DN8A 1Q1BA 1PTOD 3HP3A 4EVOA 4A93B 2CW0C 3OW7A 3J7AV 1BDOA 1S5FD 3H0GB 5IGDA 1TT2A 1Q3LA 2F0MA 3J80L 4G7HC 3S1MB 3IAYA 1TWFB 1EY0A 4TRDA 4U673 3MAQA 5ELDA 4DGZA 3M7GA 2A68D 3NTKA 4IQZA 5C4ZA 1SMYC 4ULLA 5CV7A 1PRTC 5E4XA 3DWAA 4KJOA 5JOBA 4BA2I 2SNSA 2EJFC 5C5MA 2I07B 4Q0FA 2JA8B 2NUCA 3SE0A 1TS5A 3C3LA 4DXGA 2B2TC 1CA6A 1E2VA 3K59A 4ZQ3A 3NHHA 5C0XH 3I3CA 1NCVA 3L7ZC 4BY1B 1IKLA 1YNND 3MC0B 4IFDH 1TS4A 1ENFA 4DU9A 1VF7A 1I6HB 2KJXA 4QB4A 1Y8PB 4QF4A 1V43A 3W3AA 3KF8A 1CA5A 2B2TA 3Q23A 3FVQA 2XN9C 5KYLA 3NTHA 1UEAB 4PV1C 1ZEQX 4O1NA 1AEXA 4GZYC 4IUPA 2K1BA 3NQIA 5J39A 1KNAA 5HGTA 3NTIA 4N9TA 2RBMA 1CM9A 1HRJA 4WFN3 1EY8A 1SAPA 4QMGA 3W2DA 2AQ2B 1ILPA 3N52A 3PIO3 3AU7A 3MXGA 4RGNA 2TSSA 1UNSA 5F2DA 1B4OA 4MN3A 3KK7A 5ELCA 3GTPB 2RSNA 4FF2A 2IL8A 4WORA 4OO1I 3V2TA 4J6HA 3CU7A 1TY2A 3N6RA 2E2IB 1JWUD 2KECA 5IGGA 2EOTA 4FF3A 2B2UC 4ZK9B 4Q5VA 4PQXA 3BVGA 4OO1G 1Y8NB 4NMZA 2ENBA 1EYCA 4C3HB 4RFBA 2F0UA 5A2QL 4OGQC 5I9OA 1A6XA 3ND9A 4G7OC 4DAVA 2C5CA 3TP7A 4Y7NB 2K33A 2X6GA 4ZKCB 1ENCA 4C3JG 1STNA 1DONA 3R2TA 4XT3B 3DM1A 2XSCA 2OEOA 3A7LA 2B2UA 4ZLTF 2PNRC 3GQBA 3EQLC 2F0NA 3Q0AA 1CI3M 1II3A 3T56B 4H0LC 1EFID 5LL6S 1STEA 1EIGA 2GA4B 1EWHA 3F2UA 2NN6H 1PYWD 5JAVA 1HTPA 2NVYB 5JVG3 3VYUA 3FDTA 4C3IB 2O5JC 2B8GA 2E2JB 3DEOA 1ZYRD 2F0JA 2YU9B 2HQEA 1LT3D 1AFPA 3QO2A 4XTCS 3R3OA 5KYIA 2NBFA 1O80A 2E76C 4K14A 1B53A 3MXUA 3NPPA 1L0XB 4IUUA 3H94A 3CRKC 3LWUA 2M9VA 1LT6D 5E4WC 2FMCA 3MHBA 4CGYB 4HSVA 3OMCA 3M7NA 4JK1C 2WIIB 1TQOA 1KLUD 4KN7C 1DXMA 3CHBD 1RODA 3EVQA 1SJED 2WAQB 1F9SA 2K01A 1MGSA 1BCPF 4XXEA 3J7AF 1JOKA 1B9NA 1STHA 1WD1A 2WINB 5KEEA 1CZGA 3NXWA 1I50B 1EEID 3OWEB 4ZKBB 2ICEC 2XRQD 4WRDA 5NUCA 2HCCA 3VA5A 1SYBA 4O42A 1GUWA 1Q90A 1AZPA 2CVRA 5FO7B 1VMCA 1O78A 1LLRD 2K5DA 4FVMA 3DHQA 3SHLA 1BCPB 3HG9A 2AQ3B 2XRSD 2PW5A 4DNTB 2F3WA 4IUTA 3WDNA 2K6AA 3ZYYX 4IUVA 3BDOA 1G6ZA 4IALA 4A3KB 4RCNA 1GUNA 2Q8RE 2ZT9C 5HURA 4HMIA 3K57A 4S3SA 3FRPB 4OHJA 1JCKB 3NWTA 2QDBA 1WTQA 2FINB 1LTBD 1OO9B 3D6WA 4C56C 1WVLA 2A6EC 2L12A 1PTOF 2EYJA 3NP8A 4UDUC 4F87A 1Z6HA 4BBRB 1SNMA 2SOBA 5ELFA 3RLFA 4XIGS 3J7YW 2D5DA 2OF1A 1IW7D 5K5PA 3BVMA 5I2XA 2EY5A 1PTOB 4ZRZA 4HMJA 1ML0D 3GTMB 2F4IA 5ELEA 1CT1D 2EY2A 1TY0A 4M1UB 4RGTA 3BG3A 1EQTA 1RTOA 3R8BA 1VF5C 2R7ZB 2ICIA 1OXTA 1NUCA 1EU4A 1GHJA 4FNFA 5C3XA 4BY7B 1AZQA 5FOBB 4CJ1B 1ET9A 2D2CC 2SDFA 2H1EA 3HKZB 2Y0SB 1A3TA 2CHBD 5CYUA 1SNCA 3I8ZA 2B2VC 3T4AC 1WTVA 3CQZB 1TWAB 1WCMB 2NVTB 1HQRD 2CW0D 3IFTA 5JPMC 1JQYD 5CORA 3BYTB 1I4GA 3D6CA 1RD9D 1LTTD 1FR3A 4FP5D 1R4QB 2LFNA 2B2YC 2IW3A 3HZXA 1PTOH 1S5CD 2JE6I 3PV0A 3DEPA 4K6LA 3RUZA 4DK1A 1JICA 3VR2A 4CBVA 2A6HD 3PMFA 1SMYD 5A2QE 2JA6B 4DAPA 1PRTD 2MPMA 5IGEA 1G91A 3U9SA 1BNZA 3VR6A 3TZUA 4V190 3SXHA 2MP1A 4RGOS 4RWSC 1HFNA 1F9QA 3SK4A 4DN4M 2IX0A 4P2CB 3C46A 3OPOA 4ID6A 3K5MA 5K36H 1F77A 4IZ8A 2JSOA 3M3YB 1B1ZA 2O2LD 2L1BA 3T16A 3NSWA 1GUSA 1TR5A 2MUYA 5I6WA 2EXZA 2OT2A 3TP6A 2F0FA 3A54A 5EKKA 2L9HA 1ZKOA 2Z4IA 3OHXC 3OMGA 1U4RA 5KRUA 5K36G 1CK1A 1I4RA 4OIJA 2BE5D 1R4PB 2IX3A 3BDCA 3R93A 4XDXA 5J1ZA 3AB9A 3C2PA 1DJRD 1BR9A 1Q8IA 3GV3A 3HEJA 2K5QA 1Q12A 1EZ8A 4RAUC 3VR4A 3G6JB 2PZTA 3MZ5A 3LNNA 5IGBA 3QIAA 1NSNS 1D5MC 2PCFB 3WOEA 2EYFA 5C4JB 4KTAA 1MD2D 2WACA 1PMRA 3R2IA 2DNCA 4BWGB 4BBSB 2F0HA 1OXVA 1H9RA 1PZJD 1C8CA 4HCEA 1HFGA 2WKCA 4C3JB 4B9XA 3EFXD 4DNRB 1KAAA 1D6EC 2K7VA 4KJNA 3K58A 1LTSD 1CFMA 2F0PA 2J7ZA 4KHVA 3TSSA 1V1OA 3I91A 4EQNA 5EJWA 1QNKA 2NTSA 3D31A 4B08A 2BA1A 4X3UA 2O4XA 5EKLA 1HQMC 1D1IA 3SK8A 3GTKB 1A3UA 3Q6SA 5CR3A 1U4LA 1B50A 1PFNA 1RCVD 2R3ZA 1M8AA 1SNOA 3GV6A 5AFWA 2VUMB 2A74C 4A3DB 5CBAE 4G7ZC 1GUOA 2PPBC 5FO9B 4OO1H 2KCNA 4ILWA 3PUYA 4RHRA 1XTCD 4OL7A 3M85A 1STAA 3TMEA 4QUFA 2RDFA 3S9WA 1QOHA 3TP8A 3S2DB 3NE5B 5FLXL 3FPPA 5EQ0A 5D3DA 2Q8TA 2HCIA 1KDCA 1FD7D 2H4OA 5I4DA 2EY6A 4F8MA 1ICWA 1KTKA 3MVVA 4ABNA 1DM0B 1O7LA 4RGMA 3J81L 2JA7B 1HA6A 2N55A 3GTQB 3S1NB 4Z9CB 1H9SB 1D1KA 1TS3A 3I73A 2E74C 5KGUA 3CKIB 5EGTA 1L0YB 4A3EB 3BYYB 1SNDA 1VDZA 2KEDA 3H91A 1PFBA 1ZXTA 5I9PA 5M3FB 4HCSA 3DXJC 4XQNA 3VYSA 1PZID 1IYUA 4FXDA 1JR0D 5DEHA 4AYBB 1DD2A 5BN5A 1DOMA 2MHVA 2EJMA 1YNNC 2JA5B 3S17B 5M9OA 4B9WA 4RKBA 5C44B 1WTWA 3KLSX 3S1RB 2QCPX 5J22A 1STBA 2EYLA 4UAIA 3I4NB 1QILA 3KLRA 2E2HB 5JEAJ 4FYDA 5IGFA 1TIID 2PW7A 2KQ3A 4H13C 2A6ED 4R8NA 2B8FA 1SBBB 1PFMA 4RCOA 1JB3A 5EPLA 2ZXPA 2ZXOA 3HOVB 2NWGA 4HSPA 1DOLA 3PUVA 4RA8A 1EL0A 5DM73 3PUZA 1KLGD 2DY8A 5DM63 2MGSA 5EPKA 1HTLD 3I90A 3TBIB 1RDPD 3D4RA 1LTID 4LAAA 1OXUA 5IIFA 1E0BA 4KKTA 3U9OA 2F0LA 2F1MA 4KY6A 1F2LA 4MIUA 5I2YA 2L0CA 1KDAA 4I65A 1PRTB 5M3MB 4J8QA 4ZUIA 4RH6A 3AMUA 3HOZB 4LK1C 3HOWB 1EY7A 1KNEA 4G57A 1DZ1A 5D14A 3K6OA 2R93B 2LY7A 1QWYA 1WTPA 4HAEA 3GD7A 1NR4A 3K5OA 2F0IA 3RD4A 3SK5A 1BQQT 3H09A 1O7YA 5CV8A 2K03A 4KN4C 3SEBA 3D8GA 3JAME 1QNUA 1JWSD 2XNAC 4KKSA 1EY4A 3RZOB 1SXTA 3G7LA 2FMMA 2OXPA 2KHSA 5DAUA 1ENAA 2IJ0A 5TSSA 1NAPA 2VB2X 3A8IE 1JE4A 1TWHB 4BA1I 2LKVA 2X6LA 2ZXRA 4XQQA 1B9MA 3P75A 3PIP3 1J9OA 1RTNA 5EPJA 1XX8A 3E6ZX 5E3FA 3KUPA 1EOTA 3WOFA 1LT5D 1I4HA 1ESRA 3DMUA 1STGA 1HUMA 2IPKD 1OXXK 2VNUD 2F0VA 2R92B 3TZDA 2E75C 4TKOB 2PO4A 4KHZA 1LV9A 3QWNA 5G3LD 2EYMA 5EKIA 1VCIA 1TS2A 4F7XA 3GO5A 2VB3X 3GTJB 5CV6A 2RKSA 3GP7A 1KDBA 2X69A 2XWBB 5FK9C 1SE2A 3RMHA 5FLXE 5FO8B 1W6JA 3SVMA 2NTTA 4CJ2C 5T1GA 1B44D 2AWOA 1T5XD 2QF7A 1MBYA 3IL8A 1WTOA 1FNVA 1B3AA 1KABA 2KEEA 1FYCA 3V96A 3KLSA 1QCBD 4TSSA 3J81E 2KUMA 4ZYSA 1TKWB 1F2MA 5EBDA 3NBHA 4FXKC 2B2VA 2V4DA 1CQFA 1A15A 2SNMA 1EQVA 3PO2B 3QB3A 4XT1B 2RVLA 2WKDA 3DUZA 3UI2A 5E1FA 2EYHA 1QB5D 2EVBA 1H9MA 2AUKA 2B2YA 4LJZC 1D5ZC 4HR7B 1SNPA 1I6VC 3ITPA 2LS01 2BA0A 3HOUB 3BS1A 1SYFA 1EU3A 4HN7A 2J4XA 4IUNA 3DWQA 4K5VA 4IURA 3VYRA 2HUGA 2R61A 1B2TA 2PMZB 1IW7C 2Z1CA 1HXYD 3KBGA 5JEAG 1BUVT 2YYZA 3PUXA 5I6YA 2BOSA 4KKUA 1HCZA 1CHPD 1M4VA 1YNJC 1Z7TA 2F0TA 3E0JA 4FF4A 1PXUA 4H44C 1F2YA 3H6MA 1XWEA 1S4ZA 2PZUA 1SYDA 2AUJD 1HPCA 2K5WA 2D62A 4YIJA 3M4OB 1CZWA 2M00A 5M5WB 3I4MB 4TQUS 2EYPA 4IUQA 5C4HA 1TU2B 2F0WA 5CV4A 3D4DA 5COYA 2RQXA 1WTXA 1X32A 1CQVA 2QILA 1D5XC 1RHPA 4C1NI 3IKJA 5LHY1 4A3JB 3SR1A 4L8JA 1SDFA 5C5LA 4XYOA 3K0YA 1Y1WB 1BOSA 4HTHA 2XWJB 1XYIA 4NP5A 4RHSA 5ISRA 4DK0A 4X3SA 2EE1A 2L5TA 5KNDA 1U4MA 1V1PA 2F0GA 3HGBA 5CC4A 1GHKA 5D3IB 1GXDC 1AN8A 2E2DC 2I46A 2A6HC 4RKLA 3Q22A 5IOCA 4PMBA 5JJZA 1BXTA 4FF1A 1Y8OB 1CHQD 4A3BB 1SJHD 3JAML 4FO2A 4QCLA 5DNFA 4EGVA 1ILQA 5BN3A 2ID0A 4KD3A 1R9TB 3MFGA 2JYOA 1G8ZD 2F0DA 1RKNA 3NBIA 4KD4A 3MXPA 2NVXB 4WJWA 4A3IB 1TWGB 3MEHA 3O13A 2QEJC 1BCPC 4LMQD 1QJOA 1EY5A 4DF7A 1OXSC 1JORA 3MXNA 1PDQA 5IT9E 1SE4A 3P20A 2EYOA 1TWCB 1LO5D 3V05A 4NDXA 4CJ0B 3GTLB 1Y1VB 5C0XI 1G2SA 3EJIA 1SYEA 3A56A 3PO3B 2JP1A 1LTAD 4KY5A 2A69C 3D3RA 4ZUJA 2Z4HA 4IFDI 5JPNC 4MHEA 3URYA 1IYVA 1I3QB 5C0XG 1GUTA 1PTOC 3FPUB 5CGKA 3PUWA 2KOLA 1X3QA 4XQJA 2HDLA 1EYDA 1STYA 4IFDG 1HHVA 1EZ6A 4HEDA 2BE5C 2KCCA 1ESFA 2PQEA 1SNQA 2IX1A 3VYTA 3D4WA 2A68C 3S1QB 1AW7A 3T13A 1TVXA 3MA2B 3E5SA 1JOOA 1S5DD 3NQTA 1SYCA 1K8MA 2NZ1D 1UUPA 1V8QA 4V0BA 2EDGA 1DYQA 1FGBD 1BF4A 1JOQA 4K5WA 3P7JA 2F3VA 3A55A 5LL6X 2PYKA 1EYAA 1J8IA 5G3LF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWB B;  5JPN C;  1UEA B;  3CKI B;  5JPM C;  3L3O C;  3HRZ C;  3KLS A;  3OHX C;  3HS0 C;  3FRP B;  5FO7 B;  5FO8 B;  3I70 A;  2XWJ B;  2QKI C;  3G6J B;  1PXU A;  4FXK C;  2B39 A;  1OO9 B;  1JB3 A;  3T4A C;  2A74 C;  2TMP A;  1JC7 A;  2A73 B;  1XWE A;  1BQQ T;  3MA2 B;  2WIN B;  2I07 B;  5FO9 B;  2WII B;  4ILW A;  1BUV T;  3V96 A;  4FXG C;  1GXD C;  3CU7 A;  1UAP A;  5FOB B;  1D2B A;  2J0T D;  1BR9 A;  2E2D C;  2ICE C; 
#chains in the Genus database with same CATH topology
 1I3Q H;  2Z9H A;  5BR8 L;  4LFB Q;  1IHZ A;  4L63 B;  5DLQ E;  2JEA I;  2NVQ B;  5M5X B;  4OIK A;  1WTR A;  4DV6 Q;  2BDO A;  2QKI C;  2B63 B;  3MEF A;  2N88 A;  2F4V Q;  4CKE A;  4KY7 A;  2O5I C;  3A7A B;  2EJG C;  2AHO B;  2HDM A;  3VR3 A;  3Q24 A;  4DUY L;  3S14 B;  2F0S A;  3FMC A;  4G4K A;  3H3V C;  3NWS A;  3QJY A;  4A3M B;  5JJL A;  3A8J E;  5C6A A;  4A3C H;  5HY6 A;  1EY6 A;  2K05 A;  4P74 A;  4DAM A;  1SSO A;  3S1Q H;  4CDF C;  3GTG B;  2RSO A;  5CV5 A;  4PMW A;  1U9R A;  3TN2 A;  1C48 A;  4DV5 Q;  4UY8 C;  4WJ3 M;  2DY7 A;  3Q8D A;  1EEF D;  2VXW A;  2ZTC A;  4C2M B;  2AWN A;  1VS0 A;  1O7Z A;  1NMG A;  1GO3 E;  4X3T A;  4DAY A;  1ET6 A;  5ELB A;  4BS9 A;  1JWM D;  3CMA A;  3MFY A;  1FL0 A;  4DFA A;  2K50 A;  4JI3 L;  2RCN A;  5E7N A;  1MKH A;  4CKB A;  1VQ7 A;  3GTO B;  1ONL A;  2D9U A;  2KVM A;  4DA2 A;  3ERO A;  1V1P B;  1SE3 A;  2SEB D;  4GOP A;  5GRO A;  1LAB A;  2F0K A;  5CV9 A;  1PRT F;  4L6T B;  3SDZ A;  2NN6 I;  5T1I A;  1XXG A;  4J1M A;  3W5O A;  1M90 C;  4KK7 A;  4BBR H;  2BDN A;  4IPG A;  2FXQ A;  2J0T D;  4QIW B;  4K2K A;  2Q8I B;  3LWE A;  2K5N A;  2NVQ H;  2D0P A;  3LX0 A;  4C1N K;  3RZD B;  4K6D A;  5M5X H;  4GNX B;  2B63 H;  2C9O A;  5FKA C;  5C4X B;  1DOK A;  1GOZ A;  1AP0 A;  2NN6 G;  3S14 H;  3OTO L;  3T1Y Q;  1SFO B;  1LTR D;  4OEL B;  4QUC A;  4K2L A;  2R6G A;  1VQC A;  4A3M H;  3KBX A;  4P72 A;  3T53 B;  1HR0 Q;  1U4P A;  3GTG H;  3OSO A;  5H1S E;  5JVH 3;  4C3H G;  4DV6 L;  5HGQ A;  4C2M H;  3J80 E;  2F4V L;  3MXN B;  3TRZ A;  1G2T A;  1NR2 A;  3QOJ A;  1A2T A;  4DV7 Q;  5A35 A;  2M2L A;  4R8I A;  4JW0 A;  1A3V A;  4KV6 A;  3FEW X;  3MTS A;  2FFK B;  2K28 A;  2B63 G;  2NYZ D;  4ME5 A;  4L5S A;  3GTO H;  3L3O C;  2IWH A;  3HRZ C;  3L9A X;  4DR7 Q;  1K0S A;  5IOD A;  4DV5 L;  3S16 B;  4X62 Q;  1CTM A;  3HKS A;  5C3E B;  5CMD A;  1YJ9 A;  1CUK A;  4YCU A;  2UUB L;  1QZG A;  1F2Z A;  4RMF A;  1XMQ Q;  2B2W C;  1PZK D;  4K8J A;  5IT9 L;  3T51 B;  3RZD H;  1W6K A;  1KQS A;  2RDH A;  3BDL A;  2L11 A;  3TDQ A;  5C4X H;  1KC8 C;  1K8A C;  3NK9 A;  1HUN A;  1GJX A;  4R4T A;  4KMU C;  3X3M A;  2PZW A;  4HID A;  1EY9 A;  1SFO H;  1BKB A;  1DCZ A;  1Z47 A;  1VQB A;  3OOC A;  3OWF A;  4KI0 A;  3U50 C;  1FJG Q;  4B3R Q;  4C3I G;  2LMC B;  1N8R C;  5IGC A;  2XGT A;  1ZYR C;  1F9R A;  2G9D A;  4NW2 A;  3K5N A;  4A3G B;  2F0O A;  1SEB D;  4LUV A;  4FXG C;  1H9J A;  1JE5 A;  1MJE A;  3EBE A;  2CFM A;  3M4Y A;  4L5Q A;  2DNE A;  4F88 A;  4ODG A;  4PMC A;  4U68 A;  1I4X A;  1K83 B;  3EA6 A;  2XIW A;  3CP0 A;  2B2W A;  3ONA B;  4X65 Q;  4JBJ A;  1MSG A;  1E2Z A;  4CKC A;  1X3P A;  3UDG A;  3SK6 A;  3T1Y L;  4H7B A;  1MSH A;  3I4O A;  2VY3 A;  3DWP A;  2TMP A;  5BN4 A;  5C0X J;  1QE6 A;  1VMP A;  2ZJR A;  1BO0 A;  5AJ3 Q;  1HR0 L;  1PH6 A;  1YNJ D;  3BZK A;  2JJQ A;  4ZAI A;  3J81 j;  3CPW A;  1I4P A;  1WD0 A;  1IKM A;  3S16 H;  1L1O B;  4JCV E;  2QA4 A;  4IFD J;  3C1F A;  1YVC A;  2FHT A;  1T5E A;  5C3E H;  3M9B A;  3HOX B;  1LTG D;  1E7Z A;  1QVC A;  2WB1 B;  3MWY W;  4DV7 L;  1XPR A;  3QG1 A;  4IOC A;  4IN3 A;  5D65 A;  1JC7 A;  4PNY A;  2VW9 A;  3IFD A;  2JEB I;  1FNU A;  3FKI B;  2WAQ G;  4DKA C;  4DR7 L;  4OWT B;  1G29 1;  1K28 A;  1SRU A;  5C3W A;  4X62 L;  1C4Q A;  4POF A;  2EPB A;  2EZV A;  3CRL C;  1L0W A;  3H15 A;  3X3N A;  1EWC A;  1XMQ L;  2A5H A;  4A3G H;  1VQH A;  1LT4 D;  4JI2 Q;  1GUG A;  2XVS A;  1F9P A;  1HA5 A;  1K83 H;  5JEA H;  3C1E A;  1LAC A;  2Z8L A;  5KNC A;  4E6I A;  4DV2 Q;  1AE2 A;  1FJG L;  4B3R L;  4L5T A;  2L4N A;  4A3K G;  4CHT B;  2HD3 A;  3VA7 A;  3QOL A;  1MIU A;  3S2H B;  4JPB W;  2WV6 D;  1CKO A;  2KCM A;  1I4Q A;  2LXK A;  2MJ8 A;  1S40 A;  2EY1 A;  4X3K A;  2KA7 A;  1RJT A;  2RDG A;  1QG7 A;  2DUD A;  3BVZ A;  4M8A A;  3JC6 6;  4X65 L;  3HOX H;  4K8I A;  4IPC A;  1A2U A;  4GOP B;  1IL8 A;  3HS0 C;  2CQA A;  4APV A;  1IBL Q;  3OIP A;  4NKL A;  4R9W A;  2K04 A;  3BZD B;  3ERQ A;  4QIW E;  1ASZ A;  2G9H D;  2BCO A;  2HQL A;  3CCU A;  2F0E A;  2FJ2 A;  2NB0 A;  4FDB A;  3I4L A;  3FKI H;  4JBW A;  3K5L A;  1EIH A;  1RF2 D;  1H9S A;  3W1B A;  4EQP A;  2CH4 W;  1H9K A;  2K5V A;  3NUC A;  4DXF A;  1YIT A;  2L55 A;  3K7A B;  1PLF A;  2AQ1 B;  1FNW A;  3PF4 A;  1BCP D;  4I7Z C;  2K32 A;  1SYG A;  1VQ9 A;  4XYQ A;  2WP8 J;  4N9P A;  5EBC A;  5ELO A;  3S15 B;  2RA4 A;  4K5X A;  2H5X A;  2B39 A;  5KIX A;  2ZJQ A;  1FVI A;  5KNB A;  1MI2 A;  1S5E D;  4A3F B;  2A73 B;  1S5B D;  4OWW B;  4EQO A;  5M5Y B;  1SRO A;  2F03 A;  1D2B A;  1E2W A;  1HZB A;  1BBX C;  3P1H A;  2JXM B;  3HOY B;  2A69 D;  3TP5 A;  4BY7 G;  3I70 A;  3OIQ A;  2HT1 A;  1K8O A;  5IYB H;  3S2H H;  3ND8 A;  1PH5 A;  4JI2 L;  5CBE E;  4IOA A;  2F0Q A;  3HKZ G;  2Y0S G;  3A8K E;  2IT1 A;  1Y69 U;  1Q1E A;  3I72 A;  3VR5 A;  1UAP A;  2DN8 A;  4JI6 Q;  1Q1B A;  2A19 A;  1V1Q A;  1PTO D;  3HP3 A;  4EVO A;  4A93 B;  4N8X 1;  4DV2 L;  1PYB A;  3OW7 A;  1WCM G;  2CW0 C;  1EQQ A;  1BDO A;  3J7A V;  1S5F D;  2K14 A;  4JBK A;  3H0G B;  5IGD A;  1TT2 A;  3K0X A;  1Q3L A;  2F0M A;  3J80 L;  4G7H C;  3S1M B;  3IAY A;  1TWF B;  1EY0 A;  4TRD A;  4U67 3;  3MAQ A;  5ELD A;  3K7A H;  4DGZ A;  3M7G A;  4YWM A;  2A68 D;  1E22 A;  3NTK A;  1X56 A;  1SE8 A;  4IQZ A;  5C4Z A;  1IBL L;  1SMY C;  2ES2 A;  3S15 H;  3F8T A;  4ULL A;  5CV7 A;  3ULL A;  2HIV A;  1PRT C;  5E4X A;  3DWA A;  4IJH A;  4KJO A;  2JA6 G;  5JOB A;  4A3F H;  4BA2 I;  4OON A;  2SNS A;  2EJF C;  5C5M A;  2JQO A;  5M5Y H;  4I7A A;  4DR3 Q;  4EX5 A;  2I07 B;  4Q0F A;  2JA8 B;  1K0R A;  2NUC A;  3SE0 A;  1B8A A;  1TS5 A;  5GAD C;  1K73 C;  1WFQ A;  3ULP A;  3C3L A;  3EN2 A;  4YWK A;  4AH6 A;  1M1K C;  3KOJ A;  1NE3 A;  3HOY H;  1PH9 A;  3U58 A;  3DM3 A;  4DXG A;  2B2T C;  1CA6 A;  1E2V A;  3K59 A;  4ZQ3 A;  1J6Q A;  3NHH A;  2Q2U A;  5C0X H;  1E3P A;  2CKZ B;  3I3C A;  1NCV A;  3L7Z C;  4BY1 B;  1IKL A;  4A93 H;  2WB1 E;  1YNN D;  3MC0 B;  4IFD H;  4A3L H;  1LTL A;  3H0G H;  1TS4 A;  1ENF A;  2VZA A;  3S1M H;  1TWF H;  4DU9 A;  1VF7 A;  1I6H B;  1KHI A;  2KJX A;  4QB4 A;  1Y8P B;  5EAY A;  4QF4 A;  1V43 A;  3W3A A;  3KF8 A;  2OQK A;  1CA5 A;  2B2T A;  4JI6 L;  1KRT A;  3Q23 A;  2C35 B;  2XN9 C;  3FVQ A;  5KYL A;  3NTH A;  1UEA B;  3TQY A;  4PV1 C;  1ZEQ X;  4O1N A;  1VQK A;  1AEX A;  4GZY C;  4IUP A;  2K1B A;  3NQI A;  5J39 A;  2F3I A;  4JI8 Q;  1VQF A;  4WJ4 A;  1KNA A;  5HGT A;  3NTI A;  3G48 A;  4N9T A;  2RBM A;  1CM9 A;  2JA8 H;  3A0J A;  1HRJ A;  4WFN 3;  1EY8 A;  1O7I A;  1SAP A;  4QMG A;  3W2D A;  2AQ2 B;  3AQQ A;  1ILP A;  1XNR Q;  3N52 A;  3PIO 3;  3AU7 A;  3MXG A;  5GQO A;  3F1Z A;  4RGN A;  2TSS A;  1UNS A;  5F2D A;  3L0O A;  1B4O A;  2UXB Q;  3GDE A;  4MN3 A;  3KK7 A;  1A8V A;  1VQN A;  2MQH A;  5ELC A;  1YJW A;  1HH2 P;  3GTP B;  2RSN A;  4FF2 A;  2IL8 A;  2EQS A;  4WOR A;  1WOC A;  4OO1 I;  3V2T A;  4DR3 L;  4BY1 H;  4J6H A;  5ELN A;  1I94 Q;  2YTY A;  3AYH B;  1P8L A;  3CU7 A;  1TY2 A;  4ZCK A;  3N6R A;  2E2I B;  1JWU D;  4LFA Q;  2KEC A;  3CCL A;  5IGG A;  2EOT A;  1I6H H;  4FF3 A;  2B2U C;  2B29 A;  4R4Q A;  3CCJ A;  4ZK9 B;  4JV5 Q;  4Q5V A;  4PQX A;  3BVG A;  4OO1 G;  1Y8N B;  4NMZ A;  4QGU A;  5IYC G;  2MNA A;  2ENB A;  2RHQ B;  1EYC A;  2GVB A;  4C3H B;  4RFB A;  2F0U A;  2DJF C;  4BBS G;  5A2Q L;  4OGQ C;  5I9O A;  1A6X A;  4A75 A;  2L15 A;  3ND9 A;  4G7O C;  1K3R A;  4DAV A;  1Q86 C;  2C5C A;  3TP7 A;  4Y7N B;  2K33 A;  2X6G A;  4ZKC B;  1AH9 A;  1ENC A;  4C3J G;  2UXC Q;  1STN A;  4BY1 G;  2N3S A;  1PH2 A;  1VQG A;  1DON A;  3R2T A;  4XT3 B;  3DM1 A;  2XSC A;  2OEO A;  3A7L A;  2E5L Q;  2B2U A;  4P73 A;  1YEZ A;  4ZLT F;  1YHQ A;  2VS1 A;  2PNR C;  1JB7 A;  3GQB A;  3EQL C;  2F0N A;  3Q0A A;  3GTP H;  4JI8 L;  1CI3 M;  1II3 A;  2ALY B;  3T56 B;  4H0L C;  1EFI D;  4B3M Q;  1VQP A;  5LL6 S;  1STE A;  2BH2 A;  1EIG A;  1XNR L;  2GA4 B;  2CWA A;  1EWH A;  3KDF A;  2I5H A;  3F2U A;  2UUB Q;  2ZM6 Q;  2NN6 H;  2E2I H;  2VUM G;  2UXB L;  2I5L X;  1PYW D;  5JAV A;  1HTP A;  2NVY B;  1VQ8 A;  5JVG 3;  3UDF A;  3VYU A;  2A8V A;  3FDT A;  1J5E Q;  4C3I B;  2O5J C;  3J7Z C;  3JAM i;  2B8G A;  3LGJ A;  2E2J B;  3DEO A;  4DR4 Q;  1ZYR D;  3PIP A;  2F0J A;  2PI2 A;  2YU9 B;  1YZ6 A;  3BZC A;  2HQE A;  1LT3 D;  4PZ6 A;  1AFP A;  3QO2 A;  4C3H H;  1I94 L;  4L5R C;  4XTC S;  3R3O A;  5KYI A;  2NBF A;  1O80 A;  2E76 C;  4K14 A;  1C7Y A;  1B53 A;  3MXU A;  3PSI A;  3RN5 A;  3NPP A;  2G5D A;  4LFA L;  1L0X B;  4Y7N H;  4IUU A;  3H94 A;  2EXD A;  3CRK C;  3LWU A;  3CC4 A;  2YV5 A;  2M9V A;  4JV5 L;  1HNW Q;  1LT6 D;  2Z6K C;  5E4W C;  2FMC A;  4ALP A;  1IYJ B;  3MHB A;  4QL5 A;  5J3B A;  3UE0 A;  4CGY B;  4JI1 Q;  1U5K A;  4HSV A;  1YI2 A;  3OMC A;  1EIY B;  3M7N A;  4JK1 C;  2HHH Q;  4UP9 A;  2WII B;  2VQE Q;  2K4K A;  1VQ5 A;  1TQO A;  4NPS A;  4LF6 L;  2JA7 G;  3RLN A;  1KLU D;  4KN7 C;  4YY3 Q;  1DXM A;  3OYY A;  3CHB D;  1VQ4 A;  1ROD A;  3EVQ A;  1SJE D;  4JBM A;  2UXC L;  4GLX A;  2WAQ B;  1F9S A;  2K01 A;  2E5L L;  4A3E G;  1MGS A;  1BCP F;  4XXE A;  3J7A F;  1JOK A;  1XPO A;  1B9N A;  1STH A;  1WD1 A;  2WIN B;  2NVY H;  5KEE A;  4HJ8 A;  1PH4 A;  1CZG A;  2IHE A;  3NXW A;  1I50 B;  1EEI D;  3OWE B;  4C3I H;  4ZKB B;  2ICE C;  1X54 A;  4HJA A;  2XRQ D;  4WRD A;  5NUC A;  2E2J H;  2HCC A;  4YCW A;  3VA5 A;  1SYB A;  4O42 A;  1GUW A;  1Q90 A;  2OCE A;  2YU9 H;  1AZP A;  2CVR A;  4B3M L;  5FO7 B;  4IPD A;  1VMC A;  1O78 A;  1LLR D;  2K5D A;  1KAW A;  4FVM A;  3DHQ A;  4AYB G;  3SHL A;  1BCP B;  1HZC A;  3HG9 A;  1JJ2 A;  1KRS A;  2DJG C;  1SR3 A;  2AQ3 B;  2PW5 A;  2XRS D;  4DNT B;  2ZM6 L;  2F3W A;  4IUT A;  3WDN A;  2K6A A;  3ZYY X;  4IUV A;  3BDO A;  1G6Z A;  4IAL A;  1J5E L;  3AFQ A;  4A3K B;  5C44 G;  4RCN A;  1P16 A;  1GUN A;  2Q8R E;  2ZT9 C;  1NY4 A;  4DR4 L;  2JN4 A;  5HUR A;  3DLL A;  4HMI A;  3K57 A;  4S3S A;  2CH4 A;  3FRP B;  4OHJ A;  3I4N G;  3J81 i;  1N32 Q;  1JCK B;  3NWT A;  2QDB A;  1WTQ A;  2FIN B;  1LTB D;  1OO9 B;  3D6W A;  4C56 C;  1DGS A;  1WVL A;  2A6E C;  2L12 A;  1PTO F;  3ZJY C;  3D0F A;  4HIM A;  2EYJ A;  3NP8 A;  2NZO A;  4UDU C;  4F87 A;  1Z6H A;  4BBR B;  1Q8K A;  1SNM A;  1IBM Q;  2SOB A;  5ELF A;  4P75 A;  3HOV G;  3RLF A;  4UHV A;  1HNW L;  4XIG S;  3UE1 A;  4JI1 L;  3J7Y W;  3TEH B;  2D5D A;  2OF1 A;  1IW7 D;  3FHW A;  1BVS A;  5K5P A;  1TXY A;  3BVM A;  2K52 A;  2OTL A;  5I2X A;  2HHH L;  2EY5 A;  1PTO B;  4ZRZ A;  2VQE L;  1QVG A;  4HMJ A;  1ML0 D;  3GTM B;  1I50 H;  2F4I A;  4DK6 C;  3F2D A;  2E8G A;  4MNO A;  3JAM c;  1Q7Y C;  4YY3 L;  5ELE A;  4JI4 Q;  1N34 Q;  1CT1 D;  2EY2 A;  1EUJ A;  1TY0 A;  4M1U B;  4RGT A;  3BG3 A;  1IZ6 A;  1B3Q A;  1EQT A;  1RTO A;  4R4I A;  4JOI C;  3R8B A;  1VF5 C;  2KHJ A;  1E24 A;  4HIO A;  2R7Z B;  2ICI A;  2N49 A;  1E1O A;  1K9M C;  1OXT A;  1NUC A;  1EU4 A;  1GHJ A;  4FNF A;  4OX9 Q;  5C3X A;  4A3K H;  1AZQ A;  4BY7 B;  5FOB B;  4CJ1 B;  1C0A A;  4DUZ Q;  5M3M G;  1ET9 A;  2D2C C;  2SDF A;  2H1E A;  3A5U A;  3HKZ B;  2Y0S B;  4JG2 A;  3KYH C;  1A3T A;  2CHB D;  5CYU A;  4AQY Q;  1SNC A;  4KLK A;  1XTD A;  1VQO A;  3I8Z A;  2B2V C;  3T4A C;  3CME A;  3KJO A;  4A4I A;  1KL9 A;  1EIF A;  3CQZ B;  1WTV A;  1TWA B;  1UE1 A;  1EWI A;  4JOI A;  1WCM B;  1A62 A;  2NVT B;  1HQR D;  2CW0 D;  5FLM G;  1E1T A;  4B3T Q;  3IFT A;  5JPM C;  1JQY D;  5COR A;  4LF7 Q;  3BYT B;  1I4G A;  3D6C A;  1RD9 D;  3RR5 A;  1N32 L;  1LTT D;  1VQL A;  1FR3 A;  4FP5 D;  1R4Q B;  4LF9 Q;  2LFN A;  1VQ6 A;  3PGZ A;  2B2Y C;  3HZX A;  2IW3 A;  1PTO H;  1S5C D;  3KDF B;  3PV0 A;  2JE6 I;  4DAY B;  3GTM H;  5GAG C;  3DEP A;  4K6L A;  3RUZ A;  4DK1 A;  2XTI A;  4HJ9 A;  1JIC A;  3VR2 A;  4CBV A;  2A6H D;  2VL6 A;  3PMF A;  1SMY D;  2YTX A;  1IBM L;  5A2Q E;  1XNQ Q;  2JA6 B;  3TRE A;  1PRT D;  4DAP A;  5FLX c;  2MPM A;  5IGE A;  1VQJ A;  1G91 A;  1T9H A;  2R7Z H;  5FJ8 G;  3U9S A;  1BNZ A;  3NEM A;  3VR6 A;  1QUQ A;  3TZU A;  1CSP A;  4V19 0;  1W2B A;  3SXH A;  2MP1 A;  4RGO S;  4BY7 H;  4RWS C;  2JA9 A;  4JI4 L;  2K5H A;  4LF5 Q;  3U4V A;  1N34 L;  4JI7 Q;  3J81 c;  1HFN A;  1F9Q A;  2CQO A;  3SK4 A;  4DN4 M;  2IX0 A;  2OTJ A;  4P2C B;  3CQZ H;  4JVZ A;  1TWA H;  3C46 A;  3OPO A;  3I56 A;  1GD7 A;  4ID6 A;  1CSQ A;  3K5M A;  1YJN A;  2KBN A;  5K36 H;  1WCM H;  4OX9 L;  1F77 A;  4IZ8 A;  2JSO A;  2R92 G;  2NVT H;  3A74 A;  1PV4 A;  4DUZ L;  3SGI A;  1PH3 A;  3M3Y B;  2WAQ E;  2R7Z G;  1KIX A;  1B1Z A;  2O2L D;  3CXC A;  4AQY L;  1EYG A;  4BXX G;  2L1B A;  3T16 A;  3NSW A;  1GUS A;  3TS2 A;  3STB C;  1TR5 A;  2MUY A;  1KD1 C;  5I6W A;  2EXZ A;  1W3S A;  2OT2 A;  2N78 A;  4DNI A;  3TP6 A;  3U4Z A;  2JA6 H;  2F0F A;  2OWO A;  3A54 A;  5EKK A;  4B3T L;  4LF7 L;  3OW2 A;  2EIF A;  4R1J A;  4CDC C;  1PVO A;  2L9H A;  4MTN A;  4PZ8 A;  1ZKO A;  2Z4I A;  4LF9 L;  3CF5 A;  3OHX C;  3OMG A;  1FGU A;  1U4R A;  4LUO A;  5KRU A;  5K36 G;  1CK1 A;  1I4R A;  2HIX A;  4OIJ A;  4GS3 A;  2BE5 D;  3RN2 A;  3H3V I;  1R4P B;  2IX3 A;  3BDC A;  3R93 A;  1XNQ L;  4XDX A;  5J1Z A;  2DGY A;  3AB9 A;  2A1A A;  3C2P A;  3UDI A;  4GNX C;  1DJR D;  1BR9 A;  3PF5 A;  1Q8I A;  3GV3 A;  4OEM B;  5GAE C;  3HEJ A;  2K5Q A;  1Q12 A;  4GKJ Q;  4NXM Q;  1EZ8 A;  4RAU C;  3VR4 A;  2RHS B;  4O0A A;  3G6J B;  2PZT A;  3MZ5 A;  3LNN A;  5IGB A;  1UWV A;  3PO2 G;  3AFP A;  3QIA A;  1BBU A;  1NSN S;  2UUA Q;  1D5M C;  4HJ7 A;  1RIP A;  2PCF B;  4LF5 L;  3M3Y H;  3WOE A;  4JI7 L;  4JI5 Q;  2EYF A;  5C4J B;  4KTA A;  1MD2 D;  2WAC A;  1NNX A;  3K81 C;  2JK8 A;  1PMR A;  3R2I A;  2DNC A;  4BWG B;  4BBS B;  2F0H A;  5IE8 A;  2Q2T A;  5IWA Q;  1OXV A;  3CAM A;  1H9R A;  1PZJ D;  3J7A 5;  3HOU G;  1C8C A;  4HCE A;  4JI0 Q;  1HFG A;  3CC2 A;  2WKC A;  4C3J B;  1GM5 A;  4B9X A;  3EFX D;  1VQI A;  1UEB A;  4K0K Q;  4DNR B;  1KAA A;  4DV0 Q;  1D6E C;  2K7V A;  4KJN A;  3K58 A;  1LTS D;  1CFM A;  3E3X A;  2ATW A;  2F0P A;  2J7Z A;  4KHV A;  3TSS A;  1V1O A;  3I91 A;  5IP9 G;  1K8G A;  4EQN A;  5EJW A;  1QNK A;  2NTS A;  3D31 A;  2MO1 A;  4B08 A;  2BA1 A;  3HKZ E;  4X3U A;  2Y0S E;  2O4X A;  5EKL A;  1HQM C;  1D1I A;  3SK8 A;  3GTK B;  3RNU A;  1A3U A;  3Q6S A;  1GKH A;  2Z6B A;  5CR3 A;  3T1H Q;  1PYS B;  1U4L A;  1B50 A;  1PFN A;  1RCV D;  2R3Z A;  1YIJ A;  1M8A A;  1SNO A;  3GV6 A;  5AFW A;  2VUM B;  1L2F A;  1Z9F A;  2A74 C;  5LMN W;  1NBW A;  3L2P A;  4A3D B;  5CBA E;  4LUZ A;  4G7Z C;  4N8F A;  1GUO A;  2PPB C;  5FO9 B;  4OO1 H;  2KCN A;  4ILW A;  3PUY A;  4RHR A;  5C4J H;  4B3S Q;  1XTC D;  5IYC H;  4OL7 A;  3M85 A;  1LYL A;  1STA A;  3TME A;  4QUF A;  4GKJ L;  2RDF A;  4NXM L;  2I5M X;  3S9W A;  1QOH A;  4BBS H;  3TP8 A;  3S2D B;  2Q2H A;  3NE5 B;  5IT9 c;  5FLX L;  3FPP A;  5EQ0 A;  5D3D A;  4HIK A;  3CC7 A;  4A3J G;  3PQI A;  2UUA L;  3HFZ B;  4MZ9 A;  2Q8T A;  2HCI A;  5IY0 A;  1KDC A;  1FD7 D;  4YCV A;  4C3J H;  4GKK Q;  5IP7 G;  4JI5 L;  4NXN Q;  2H4O A;  5I4D A;  3NEN A;  1L1O C;  2EY6 A;  4F8M A;  1ICW A;  1MJC A;  1Q81 C;  4GN3 B;  1KTK A;  3MVV A;  4ABN A;  2LXJ A;  1DM0 B;  1O7L A;  4DPG A;  4RGM A;  2OQ0 A;  4A76 A;  5IWA L;  2QGQ A;  4LF4 L;  3J81 L;  2JA7 B;  1HA6 A;  2N55 A;  3GTQ B;  4JI0 L;  3S1N B;  3GTK H;  4Z9C B;  1H9S B;  2RCF A;  1UE7 A;  2LSS A;  4A3B G;  1D1K A;  3KF6 A;  4K0K L;  1TS3 A;  3I73 A;  4DV0 L;  2E74 C;  1Q46 A;  5KGU A;  3CKI B;  4HJ5 A;  4LFC Q;  5EGT A;  1L0Y B;  4A3E B;  4LF6 Q;  1ICF B;  2VUM H;  1X55 A;  1AE3 A;  3BYY B;  1SND A;  3S24 A;  4A3D H;  1VDZ A;  2AMC B;  2KED A;  2PNH A;  3H91 A;  4CDD C;  1PFB A;  1ZXT A;  1YNX A;  5I9P A;  4A3I G;  5M3F B;  1X3F A;  4HCS A;  3DXJ C;  4XQN A;  1B7Y B;  3VYS A;  3T1H L;  1PZI D;  2MO0 A;  1IYU A;  4DV4 Q;  4FXD A;  2GN5 A;  2B3G A;  1JR0 D;  5DEH A;  4AYB B;  1HJP A;  1EFW A;  3S2D H;  1DD2 A;  5BN5 A;  1DOM A;  2MHV A;  4LNQ A;  2QEX A;  1PH7 A;  2EJM A;  2KHI A;  3J80 i;  1YNN C;  2JA5 B;  2ZTE A;  3S17 B;  5M9O A;  3KLW A;  4B9W A;  4JYA Q;  4RKB A;  5C44 B;  3QR8 A;  1WTW A;  3KLS X;  1WTH A;  1N36 Q;  3S1R B;  2QCP X;  2VQF Q;  2YTV A;  5J22 A;  1STB A;  4B3S L;  2EYL A;  4UAI A;  3I4N B;  1EOV A;  1QIL A;  3KLR A;  1Y1V G;  2CWP A;  4OWX B;  2E2H B;  4GOP C;  3PO3 G;  1MHW C;  5JEA J;  4FYD A;  5IGF A;  1TII D;  2PW7 A;  2KQ3 A;  2MFI A;  4A3D G;  4H13 C;  1HNX Q;  3F2B A;  2A6E D;  4R8N A;  1PA6 A;  2B8F A;  2JA7 H;  1SBB B;  3GTQ H;  1PFM A;  3S1N H;  1S72 A;  4RCO A;  1JB3 A;  4QJF A;  5EPL A;  2ZXP A;  4QQB X;  2ZXO A;  3HOV B;  4GKK L;  1G6P A;  2NWG A;  4HSP A;  4NXN L;  1DOL A;  4DR5 Q;  3PUV A;  4LWC A;  2UUC Q;  4ME3 A;  4RA8 A;  1EL0 A;  4A3E H;  1YHB A;  3K80 C;  1G51 A;  5DM7 3;  3IRB A;  3PUZ A;  4GN4 B;  1XMO Q;  1KLG D;  2V1C C;  2DY8 A;  5DM6 3;  2MGS A;  5EPK A;  2IHF A;  3CCQ A;  1NJI C;  2WFW A;  1HTL D;  5M3F H;  3I90 A;  3TBI B;  2F52 A;  1RDP D;  3D4R A;  4LF8 Q;  1LTI D;  4LAA A;  1OXU A;  4H02 A;  4TVA B;  4A3C G;  5IIF A;  1E0B A;  4LFC L;  4KKT A;  3U9O A;  2F0L A;  2F1M A;  4KY6 A;  1F2L A;  4MIU A;  5I2Y A;  2JA5 H;  3S17 H;  2L0C A;  5C44 H;  1KDA A;  1VQE A;  3S1R H;  4I65 A;  1PRT B;  4PZ7 A;  5M3M B;  3I2Z A;  2NZH A;  4J8Q A;  4ZUI A;  3I4N H;  1X65 A;  4RH6 A;  2QW7 A;  3AMU A;  3HOZ B;  2E2H H;  4LK1 C;  2Z6K A;  4DV4 L;  3HOW B;  1VQM A;  4LFB L;  1EY7 A;  1VQA A;  1KNE A;  1K3B C;  4G57 A;  1DZ1 A;  3CD6 A;  5M3F G;  4DR1 Q;  5D14 A;  3K6O A;  2R93 B;  2LY7 A;  3CCE A;  3HOV H;  4JYA L;  1QWY A;  1WTP A;  4HAE A;  4BBR G;  1N36 L;  3GD7 A;  1NR4 A;  3K5O A;  3KF8 B;  2VQF L;  2F0I A;  3RD4 A;  4AIM A;  4GLV B;  3SK5 A;  1BQQ T;  3H09 A;  4P71 A;  1O7Y A;  2JA5 G;  2PQA A;  5CV8 A;  1HNX L;  2K03 A;  4IJL A;  4YWL A;  4KN4 C;  3E0E A;  1HNZ Q;  3SEB A;  3D8G A;  3JAM E;  1QNU A;  1JWS D;  2XNA C;  4KKS A;  2QDL A;  1EY4 A;  3RZO B;  1SXT A;  3G7L A;  4A3M G;  2FMM A;  2OXP A;  5LMU Q;  4DR5 L;  1D7Q A;  2KHS A;  5DAU A;  1ENA A;  2UUC L;  2IJ0 A;  1XMO L;  5TSS A;  1NAP A;  2VB2 X;  3A8I E;  1JE4 A;  3J80 c;  3WWV A;  1TWH B;  4BA1 I;  2LKV A;  1A63 A;  2X6L A;  1V9P A;  2ZXR A;  4XQQ A;  1B9M A;  3K7U C;  2I0Q A;  3P75 A;  3PIP 3;  5M3M H;  1J9O A;  1RTN A;  1PH1 A;  5EPJ A;  4LF8 L;  3HOZ H;  1XX8 A;  3E6Z X;  5E3F A;  3HOW H;  3KUP A;  4DR2 Q;  1EOT A;  3WOF A;  1LT5 D;  1I4H A;  1ESR A;  1X3G A;  1STG A;  3DMU A;  3KFU A;  1X6O A;  1UE6 A;  1JT8 A;  1HUM A;  2IPK D;  2R93 H;  1OXX K;  2VNU D;  2CCZ A;  1HR0 W;  2F0V A;  1CKN A;  2R92 B;  5FLM H;  3TZD A;  2E75 C;  3K8A A;  2PO4 A;  4TKO B;  2R7D A;  4KHZ A;  1LV9 A;  3QWN A;  5G3L D;  2EYM A;  4JC0 A;  5EKI A;  3EIV A;  3KF6 B;  1VCI A;  1TS2 A;  4F7X A;  3GO5 A;  2BH8 A;  2VB3 X;  3GTJ B;  5C4X G;  5CV6 A;  2RKS A;  3GP7 A;  1KDB A;  1JJG A;  2X69 A;  1JMC A;  1GVP A;  2XWB B;  4MTK A;  4DR1 L;  5FK9 C;  3STB D;  1SE2 A;  2UU9 Q;  3RMH A;  4O2D A;  3NEL A;  5L37 A;  3RZO H;  3HOZ G;  5FLX E;  5FO8 B;  1IL2 A;  1W6J A;  3HOW G;  3SVM A;  4NB3 A;  2NTT A;  4CJ2 C;  4LW1 A;  5T1G A;  1B44 D;  2AWO A;  1T5X D;  2QF7 A;  1MBY A;  3IL8 A;  4AYB E;  5FJ8 H;  4J15 A;  1WTO A;  1FNV A;  2R93 G;  1B3A A;  1KAB A;  2KEE A;  1FYC A;  3V96 A;  1TWH H;  1D8L A;  1HNZ L;  4DR6 Q;  3KLS A;  1QCB D;  4TSS A;  5LMU L;  3J81 E;  2KUM A;  4ZYS A;  4Y52 H;  3M4Q A;  4RG1 A;  1HZ9 A;  1TKW B;  3CCM A;  1F2M A;  4EQ5 A;  5EBD A;  5C3E G;  3NBH A;  4FXK C;  2B2V A;  2V4D A;  4X66 Q;  1CQF A;  1A15 A;  2SNM A;  1EQV A;  2ZTD A;  1X3E A;  1N33 Q;  2R92 H;  3PO2 B;  3QB3 A;  4XT1 B;  2RVL A;  3W1G A;  2WKD A;  3CCS A;  3DUZ A;  3UI2 A;  1WYD A;  5E1F A;  4BXX H;  2EYH A;  1QB5 D;  3GTJ H;  4DV1 Q;  2EVB A;  1H9M A;  4DR2 L;  2AUK A;  2B2Y A;  3I55 A;  4LJZ C;  3CCR A;  1D5Z C;  4HR7 B;  1SNP A;  1I6V C;  3ITP A;  1YBY A;  2BA0 A;  2LS0 1;  3HOU B;  3BS1 A;  1SYF A;  3FP9 A;  4A3G G;  1EU3 A;  1C9O A;  3CW2 C;  4HN7 A;  2J4X A;  4IUN A;  1SLJ A;  3KJP A;  1JJC B;  3DWQ A;  4K5V A;  3BJU A;  4IUR A;  3VYR A;  2HUG A;  2R61 A;  1B2T A;  2PMZ B;  1IW7 C;  5AJ3 L;  2Z1C A;  1HXY D;  3KBG A;  5JEA G;  1IBK Q;  5JJI A;  1BUV T;  2YYZ A;  2D0O A;  3PUX A;  4UPA A;  5I6Y A;  2UU9 L;  2BOS A;  4KKU A;  1A0I A;  1OTC A;  1HCZ A;  1CHP D;  1M4V A;  1YNJ C;  1LUZ A;  3RLO A;  1Z7T A;  2F0T A;  3E0J A;  4FF4 A;  1PXU A;  1UE5 A;  1WI5 A;  4H44 C;  1F2Y A;  2UXD Q;  3H6M A;  1XWE A;  3ERS X;  4YHH Q;  1S4Z A;  2PZU A;  3HOX G;  1SYD A;  2AUJ D;  1HPC A;  2K5W A;  3H3V H;  3PO2 H;  2WB1 G;  2D62 A;  4YIJ A;  3M4O B;  4DR6 L;  1CZW A;  2M00 A;  5M5W B;  3I4M B;  4DV3 Q;  4TQU S;  2EYP A;  4IUQ A;  1IXR A;  5C4H A;  1TU2 B;  3AEV A;  3FKI G;  2F0W A;  5CV4 A;  3G4S A;  3D4D A;  5COY A;  2RQX A;  1WTX A;  1X32 A;  1CQV A;  2QIL A;  1D5X C;  1RHP A;  2PQA B;  3PIO A;  4C1N I;  4X66 L;  3IKJ A;  1N33 L;  5LHY 1;  3HOU H;  4A3J B;  3SR1 A;  4L8J A;  1SDF A;  5C5L A;  5IYD H;  4XYO A;  3K0Y A;  1Y1W B;  1BOS A;  4HTH A;  2XWJ B;  5LMN Q;  1XYI A;  4DV1 L;  1PH8 A;  4NP5 A;  4RHS A;  4CDE C;  4KHP Q;  1SMX A;  4OXP A;  5ISR A;  4DK0 A;  4X3S A;  2EE1 A;  2L5T A;  5KND A;  1U4M A;  1V1P A;  2F0G A;  1B70 B;  4DK3 C;  1HZA A;  5IP9 H;  3HGB A;  5CC4 A;  1GHK A;  2KEN A;  5D3I B;  1GXD C;  4PG3 A;  1AN8 A;  2E2D C;  1H95 A;  2I46 A;  2A6H C;  4RKL A;  3Q22 A;  5IYB G;  5IOC A;  4PMB A;  1QZH A;  1PHJ A;  1XPU A;  5JJZ A;  2K75 A;  1BXT A;  4FF1 A;  1Y8O B;  1RL2 A;  3ICE A;  1CHQ D;  4A3B B;  1SJH D;  3JAM L;  4GNX A;  4FO2 A;  3VDY A;  4QCL A;  5DNF A;  4EGV A;  1ILQ A;  1IBK L;  4LF4 Q;  5BN3 A;  2AKW B;  1N9W A;  2ID0 A;  4KD3 A;  1R9T B;  5JJK A;  3MFG A;  2JYO A;  3E9I A;  1G8Z D;  2F0D A;  3M4O H;  1RKN A;  3NBI A;  5IYD G;  5M5W H;  4KD4 A;  3I4M H;  1CKN B;  3MXP A;  2NVX B;  4UP8 A;  4WJW A;  1ASY A;  4A3I B;  1TWG B;  1BBW A;  5GAH C;  2ASB A;  3BU2 A;  3MEH A;  3O13 A;  4GLA C;  3M4P A;  2QEJ C;  2ZJP A;  1BCP C;  4LMQ D;  2UXD L;  1QJO A;  1EY5 A;  4DF7 A;  2P5Z X;  4X64 Q;  1OXS C;  4YHH L;  1SN8 A;  3MXN A;  1PDQ A;  1JOR A;  5IT9 E;  3ULJ A;  1SE4 A;  4QY7 A;  1S3O A;  4A3J H;  3P20 A;  3CCV A;  2EYO A;  1TWC B;  4DV3 L;  4R4C A;  5IP7 H;  4A3F G;  1Y1W H;  4IO9 A;  2KCT A;  1LO5 D;  3V05 A;  4NDX A;  5BR8 Q;  3F2C A;  4CJ0 B;  3GTL B;  1LM0 A;  1Y1V B;  3G6E A;  5C0X I;  1G2S A;  3EJI A;  1SYE A;  1EQR A;  3A56 A;  3PO3 B;  1NMF A;  2JP1 A;  1LTA D;  4POG A;  4KY5 A;  2A69 C;  3I4M G;  1NTG A;  3D3R A;  3HOY G;  4DUY Q;  4ZUJ A;  2Z4H A;  4IFD I;  2GVA A;  2Q2I A;  5JPN C;  3B6Y A;  4MHE A;  4A3B H;  3URY A;  1IYV A;  1I3Q B;  5LMN L;  5C0X G;  2IY5 B;  1GUT A;  3I7F A;  4KHP L;  1PTO C;  2RF4 A;  3FPU B;  1YHA A;  5CGK A;  3PUW A;  1R9T H;  2KOL A;  1X3Q A;  4XQJ A;  2Z0S A;  4A93 G;  2HDL A;  3NBH B;  1KXL A;  3E9H A;  2PI2 E;  1EYD A;  1STY A;  4IFD G;  2NVX H;  4A3L G;  1HHV A;  1Y1W G;  1EZ6 A;  4R4O A;  4HED A;  4A3I H;  3H0G G;  1I5F A;  1TWG H;  2BE5 C;  2KCC A;  1ESF A;  2PQE A;  1SNQ A;  1CKM A;  2IX1 A;  3UDX A;  2N8N A;  3VYT A;  4JI3 Q;  1QUQ B;  3D4W A;  2A68 C;  3S1Q B;  1AW7 A;  3CPF A;  1QVF A;  4GN5 A;  1X9N A;  3T13 A;  3ER0 A;  1TVX A;  3MA2 B;  3E5S A;  1JOO A;  1S5D D;  3NQT A;  1TWC H;  1SYC A;  3PCO B;  1K8M A;  2NZ1 D;  4IPH A;  3GTL H;  1UUP A;  1V8Q A;  1XJV A;  1Y1V H;  2PMZ E;  4V0B A;  2JA8 G;  3PO3 H;  4X64 L;  2EDG A;  1L1O A;  4UP7 A;  1DYQ A;  1Y14 B;  1VQD A;  3A5Z B;  1FGB D;  1BF4 A;  1JOQ A;  1PFS A;  1U0L A;  1Q82 C;  3OTO Q;  1WJJ A;  4K5W A;  4X6A H;  3G71 A;  3P7J A;  2F3V A;  3A55 A;  5LL6 X;  2PYK A;  1EYA A;  3TS0 A;  2R7F A;  1J8I A;  5G3L F; 
#chains in the Genus database with same CATH homology
 1IHZ A;  4L63 B;  2JEA I;  2NVQ B;  5M5X B;  4OIK A;  1WTR A;  2BDO A;  2QKI C;  2B63 B;  2N88 A;  4CKE A;  4KY7 A;  2O5I C;  3A7A B;  2EJG C;  2HDM A;  3VR3 A;  3Q24 A;  3S14 B;  2F0S A;  3FMC A;  4G4K A;  3H3V C;  3NWS A;  3QJY A;  4A3M B;  3A8J E;  5C6A A;  1EY6 A;  2K05 A;  1SSO A;  3GTG B;  2RSO A;  5CV5 A;  4PMW A;  1U9R A;  3TN2 A;  1C48 A;  2DY7 A;  1EEF D;  2VXW A;  4C2M B;  2AWN A;  1O7Z A;  4X3T A;  4DAY A;  1ET6 A;  5ELB A;  4BS9 A;  1JWM D;  3MFY A;  4DFA A;  4CKB A;  3GTO B;  1ONL A;  2D9U A;  2KVM A;  4DA2 A;  3ERO A;  1V1P B;  1SE3 A;  2SEB D;  1LAB A;  2F0K A;  5CV9 A;  1PRT F;  4L6T B;  3SDZ A;  2NN6 I;  5T1I A;  1XXG A;  4J1M A;  4KK7 A;  2BDN A;  2J0T D;  4QIW B;  4K2K A;  2Q8I B;  3LWE A;  3LX0 A;  4C1N K;  3RZD B;  4K6D A;  2C9O A;  5FKA C;  5C4X B;  1DOK A;  1GOZ A;  1AP0 A;  2NN6 G;  1SFO B;  1LTR D;  4QUC A;  4K2L A;  2R6G A;  3KBX A;  3T53 B;  1U4P A;  3OSO A;  5JVH 3;  4C3H G;  3J80 E;  1G2T A;  1NR2 A;  3QOJ A;  1A2T A;  5A35 A;  2M2L A;  4R8I A;  1A3V A;  4KV6 A;  3FEW X;  3MTS A;  2FFK B;  2K28 A;  2NYZ D;  4ME5 A;  3L3O C;  2IWH A;  3HRZ C;  3L9A X;  5IOD A;  3S16 B;  1CTM A;  5C3E B;  5CMD A;  1F2Z A;  2B2W C;  1PZK D;  4K8J A;  5IT9 L;  3T51 B;  1W6K A;  2RDH A;  3BDL A;  2L11 A;  3TDQ A;  1HUN A;  3NK9 A;  1GJX A;  4KMU C;  3X3M A;  2PZW A;  1EY9 A;  3OOC A;  1DCZ A;  1Z47 A;  3OWF A;  4KI0 A;  4C3I G;  2LMC B;  5IGC A;  1ZYR C;  1F9R A;  2G9D A;  4NW2 A;  3K5N A;  4A3G B;  2F0O A;  1SEB D;  4FXG C;  1H9J A;  3M4Y A;  2DNE A;  4F88 A;  4ODG A;  4PMC A;  4U68 A;  1I4X A;  1K83 B;  3EA6 A;  2XIW A;  2B2W A;  3ONA B;  1MSG A;  1E2Z A;  4CKC A;  1X3P A;  3SK6 A;  4H7B A;  1MSH A;  3DWP A;  2TMP A;  5BN4 A;  5C0X J;  1QE6 A;  1VMP A;  1BO0 A;  1YNJ D;  4ZAI A;  1I4P A;  1WD0 A;  1IKM A;  4IFD J;  3C1F A;  2FHT A;  1T5E A;  3HOX B;  1LTG D;  2WB1 B;  3MWY W;  3QG1 A;  4IN3 A;  5D65 A;  1JC7 A;  4PNY A;  3IFD A;  2JEB I;  1FNU A;  3FKI B;  1G29 1;  5C3W A;  1C4Q A;  2EPB A;  2EZV A;  3CRL C;  3X3N A;  1EWC A;  2A5H A;  1LT4 D;  1GUG A;  2XVS A;  1F9P A;  1HA5 A;  5JEA H;  3C1E A;  1LAC A;  2Z8L A;  5KNC A;  4E6I A;  2L4N A;  4CHT B;  3VA7 A;  3QOL A;  3S2H B;  2WV6 D;  1I4Q A;  2MJ8 A;  2EY1 A;  4X3K A;  2KA7 A;  1RJT A;  2RDG A;  1QG7 A;  3BVZ A;  4M8A A;  4K8I A;  1A2U A;  1IL8 A;  3HS0 C;  2CQA A;  3OIP A;  4NKL A;  4R9W A;  2K04 A;  3BZD B;  3ERQ A;  2G9H D;  2BCO A;  2F0E A;  2FJ2 A;  2NB0 A;  3I4L A;  4JBW A;  3K5L A;  1EIH A;  1RF2 D;  1H9S A;  4EQP A;  4DXF A;  1H9K A;  3NUC A;  2L55 A;  3K7A B;  1PLF A;  2AQ1 B;  1FNW A;  1BCP D;  4I7Z C;  2K32 A;  1SYG A;  4XYQ A;  2WP8 J;  4N9P A;  5EBC A;  3S15 B;  2RA4 A;  4K5X A;  2B39 A;  5KIX A;  5KNB A;  1MI2 A;  1S5E D;  4A3F B;  2A73 B;  1S5B D;  4EQO A;  5M5Y B;  2F03 A;  1D2B A;  1E2W A;  1BBX C;  3P1H A;  2JXM B;  3HOY B;  2A69 D;  3TP5 A;  3I70 A;  3OIQ A;  1K8O A;  3ND8 A;  5CBE E;  2F0Q A;  3A8K E;  2IT1 A;  1Y69 U;  1Q1E A;  3I72 A;  3VR5 A;  1UAP A;  2DN8 A;  1Q1B A;  1PTO D;  3HP3 A;  4EVO A;  4A93 B;  2CW0 C;  3OW7 A;  3J7A V;  1BDO A;  1S5F D;  3H0G B;  5IGD A;  1TT2 A;  1Q3L A;  2F0M A;  3J80 L;  4G7H C;  3S1M B;  3IAY A;  1TWF B;  1EY0 A;  4TRD A;  4U67 3;  3MAQ A;  5ELD A;  4DGZ A;  3M7G A;  2A68 D;  3NTK A;  4IQZ A;  5C4Z A;  1SMY C;  4ULL A;  5CV7 A;  1PRT C;  5E4X A;  3DWA A;  4KJO A;  5JOB A;  4BA2 I;  2SNS A;  2EJF C;  5C5M A;  2I07 B;  4Q0F A;  2JA8 B;  2NUC A;  3SE0 A;  1TS5 A;  3C3L A;  4DXG A;  2B2T C;  1CA6 A;  1E2V A;  3K59 A;  4ZQ3 A;  3NHH A;  5C0X H;  3I3C A;  1NCV A;  3L7Z C;  4BY1 B;  1IKL A;  1YNN D;  3MC0 B;  4IFD H;  1TS4 A;  1ENF A;  4DU9 A;  1VF7 A;  1I6H B;  2KJX A;  4QB4 A;  1Y8P B;  4QF4 A;  1V43 A;  3W3A A;  3KF8 A;  1CA5 A;  2B2T A;  3Q23 A;  3FVQ A;  2XN9 C;  5KYL A;  3NTH A;  1UEA B;  4PV1 C;  1ZEQ X;  4O1N A;  1AEX A;  4GZY C;  4IUP A;  2K1B A;  3NQI A;  5J39 A;  1KNA A;  5HGT A;  3NTI A;  4N9T A;  2RBM A;  1CM9 A;  1HRJ A;  4WFN 3;  1EY8 A;  1SAP A;  4QMG A;  3W2D A;  2AQ2 B;  1ILP A;  3N52 A;  3PIO 3;  3AU7 A;  3MXG A;  4RGN A;  2TSS A;  1UNS A;  5F2D A;  1B4O A;  4MN3 A;  3KK7 A;  5ELC A;  3GTP B;  2RSN A;  4FF2 A;  2IL8 A;  4WOR A;  4OO1 I;  3V2T A;  4J6H A;  3CU7 A;  1TY2 A;  3N6R A;  2E2I B;  1JWU D;  2KEC A;  5IGG A;  2EOT A;  4FF3 A;  2B2U C;  4ZK9 B;  4Q5V A;  4PQX A;  3BVG A;  4OO1 G;  1Y8N B;  4NMZ A;  2ENB A;  1EYC A;  4C3H B;  4RFB A;  2F0U A;  5A2Q L;  4OGQ C;  5I9O A;  1A6X A;  3ND9 A;  4G7O C;  4DAV A;  2C5C A;  3TP7 A;  4Y7N B;  2K33 A;  2X6G A;  4ZKC B;  1ENC A;  4C3J G;  1STN A;  1DON A;  3R2T A;  4XT3 B;  3DM1 A;  2XSC A;  2OEO A;  3A7L A;  2B2U A;  4ZLT F;  2PNR C;  3GQB A;  3EQL C;  2F0N A;  3Q0A A;  1CI3 M;  1II3 A;  3T56 B;  4H0L C;  1EFI D;  5LL6 S;  1STE A;  1EIG A;  2GA4 B;  1EWH A;  3F2U A;  2NN6 H;  1PYW D;  5JAV A;  1HTP A;  2NVY B;  5JVG 3;  3VYU A;  3FDT A;  4C3I B;  2O5J C;  2B8G A;  2E2J B;  3DEO A;  1ZYR D;  2F0J A;  2YU9 B;  2HQE A;  1LT3 D;  1AFP A;  3QO2 A;  4XTC S;  3R3O A;  5KYI A;  2NBF A;  1O80 A;  2E76 C;  4K14 A;  1B53 A;  3MXU A;  3NPP A;  1L0X B;  4IUU A;  3H94 A;  3CRK C;  3LWU A;  2M9V A;  1LT6 D;  5E4W C;  2FMC A;  3MHB A;  4CGY B;  4HSV A;  3OMC A;  3M7N A;  4JK1 C;  2WII B;  1TQO A;  1KLU D;  4KN7 C;  1DXM A;  3CHB D;  1ROD A;  3EVQ A;  1SJE D;  2WAQ B;  1F9S A;  2K01 A;  1MGS A;  1BCP F;  4XXE A;  3J7A F;  1JOK A;  1B9N A;  1STH A;  1WD1 A;  2WIN B;  5KEE A;  1CZG A;  3NXW A;  1I50 B;  1EEI D;  3OWE B;  4ZKB B;  2ICE C;  2XRQ D;  4WRD A;  5NUC A;  2HCC A;  3VA5 A;  1SYB A;  4O42 A;  1GUW A;  1Q90 A;  1AZP A;  2CVR A;  5FO7 B;  1VMC A;  1O78 A;  1LLR D;  2K5D A;  4FVM A;  3DHQ A;  3SHL A;  1BCP B;  3HG9 A;  2AQ3 B;  2XRS D;  2PW5 A;  4DNT B;  2F3W A;  4IUT A;  3WDN A;  2K6A A;  3ZYY X;  4IUV A;  3BDO A;  1G6Z A;  4IAL A;  4A3K B;  4RCN A;  1GUN A;  2Q8R E;  2ZT9 C;  5HUR A;  4HMI A;  3K57 A;  4S3S A;  3FRP B;  4OHJ A;  1JCK B;  3NWT A;  2QDB A;  1WTQ A;  2FIN B;  1LTB D;  1OO9 B;  3D6W A;  4C56 C;  1WVL A;  2A6E C;  2L12 A;  1PTO F;  2EYJ A;  3NP8 A;  4UDU C;  4F87 A;  1Z6H A;  4BBR B;  1SNM A;  2SOB A;  5ELF A;  3RLF A;  4XIG S;  3J7Y W;  2D5D A;  2OF1 A;  1IW7 D;  5K5P A;  3BVM A;  5I2X A;  2EY5 A;  1PTO B;  4ZRZ A;  4HMJ A;  1ML0 D;  3GTM B;  2F4I A;  5ELE A;  1CT1 D;  2EY2 A;  1TY0 A;  4M1U B;  4RGT A;  3BG3 A;  1EQT A;  1RTO A;  3R8B A;  1VF5 C;  2R7Z B;  2ICI A;  1OXT A;  1NUC A;  1EU4 A;  1GHJ A;  4FNF A;  5C3X A;  4BY7 B;  1AZQ A;  5FOB B;  4CJ1 B;  1ET9 A;  2D2C C;  2SDF A;  2H1E A;  3HKZ B;  2Y0S B;  1A3T A;  2CHB D;  5CYU A;  1SNC A;  3I8Z A;  2B2V C;  3T4A C;  1WTV A;  3CQZ B;  1TWA B;  1WCM B;  2NVT B;  1HQR D;  2CW0 D;  3IFT A;  5JPM C;  1JQY D;  5COR A;  3BYT B;  1I4G A;  3D6C A;  1RD9 D;  1LTT D;  1FR3 A;  4FP5 D;  1R4Q B;  2LFN A;  2B2Y C;  2IW3 A;  3HZX A;  1PTO H;  1S5C D;  2JE6 I;  3PV0 A;  3DEP A;  4K6L A;  3RUZ A;  4DK1 A;  1JIC A;  3VR2 A;  4CBV A;  2A6H D;  3PMF A;  1SMY D;  5A2Q E;  2JA6 B;  4DAP A;  1PRT D;  2MPM A;  5IGE A;  1G91 A;  3U9S A;  1BNZ A;  3VR6 A;  3TZU A;  4V19 0;  3SXH A;  2MP1 A;  4RGO S;  4RWS C;  1HFN A;  1F9Q A;  3SK4 A;  4DN4 M;  2IX0 A;  4P2C B;  3C46 A;  3OPO A;  4ID6 A;  3K5M A;  5K36 H;  1F77 A;  4IZ8 A;  2JSO A;  3M3Y B;  1B1Z A;  2O2L D;  2L1B A;  3T16 A;  3NSW A;  1GUS A;  1TR5 A;  2MUY A;  5I6W A;  2EXZ A;  2OT2 A;  3TP6 A;  2F0F A;  3A54 A;  5EKK A;  2L9H A;  1ZKO A;  2Z4I A;  3OHX C;  3OMG A;  1U4R A;  5KRU A;  5K36 G;  1CK1 A;  1I4R A;  4OIJ A;  2BE5 D;  1R4P B;  2IX3 A;  3BDC A;  3R93 A;  4XDX A;  5J1Z A;  3AB9 A;  3C2P A;  1DJR D;  1BR9 A;  1Q8I A;  3GV3 A;  3HEJ A;  2K5Q A;  1Q12 A;  1EZ8 A;  4RAU C;  3VR4 A;  3G6J B;  2PZT A;  3MZ5 A;  3LNN A;  5IGB A;  3QIA A;  1NSN S;  1D5M C;  2PCF B;  3WOE A;  2EYF A;  5C4J B;  4KTA A;  1MD2 D;  2WAC A;  1PMR A;  3R2I A;  2DNC A;  4BWG B;  4BBS B;  2F0H A;  1OXV A;  1H9R A;  1PZJ D;  1C8C A;  4HCE A;  1HFG A;  2WKC A;  4C3J B;  4B9X A;  3EFX D;  4DNR B;  1KAA A;  1D6E C;  2K7V A;  4KJN A;  3K58 A;  1LTS D;  1CFM A;  2F0P A;  2J7Z A;  4KHV A;  3TSS A;  1V1O A;  3I91 A;  4EQN A;  5EJW A;  1QNK A;  2NTS A;  3D31 A;  4B08 A;  2BA1 A;  4X3U A;  2O4X A;  5EKL A;  1HQM C;  1D1I A;  3SK8 A;  3GTK B;  1A3U A;  3Q6S A;  5CR3 A;  1U4L A;  1B50 A;  1PFN A;  1RCV D;  2R3Z A;  1M8A A;  1SNO A;  3GV6 A;  5AFW A;  2VUM B;  2A74 C;  4A3D B;  5CBA E;  4G7Z C;  1GUO A;  2PPB C;  5FO9 B;  4OO1 H;  2KCN A;  4ILW A;  3PUY A;  4RHR A;  1XTC D;  4OL7 A;  3M85 A;  1STA A;  3TME A;  4QUF A;  2RDF A;  3S9W A;  1QOH A;  3TP8 A;  3S2D B;  3NE5 B;  5FLX L;  3FPP A;  5EQ0 A;  5D3D A;  2Q8T A;  2HCI A;  1KDC A;  1FD7 D;  2H4O A;  5I4D A;  2EY6 A;  4F8M A;  1ICW A;  1KTK A;  3MVV A;  4ABN A;  1DM0 B;  1O7L A;  4RGM A;  3J81 L;  2JA7 B;  1HA6 A;  2N55 A;  3GTQ B;  3S1N B;  4Z9C B;  1H9S B;  1D1K A;  1TS3 A;  3I73 A;  2E74 C;  5KGU A;  3CKI B;  5EGT A;  1L0Y B;  4A3E B;  3BYY B;  1SND A;  1VDZ A;  2KED A;  3H91 A;  1PFB A;  1ZXT A;  5I9P A;  5M3F B;  4HCS A;  3DXJ C;  4XQN A;  3VYS A;  1PZI D;  1IYU A;  4FXD A;  1JR0 D;  5DEH A;  4AYB B;  1DD2 A;  5BN5 A;  1DOM A;  2MHV A;  2EJM A;  1YNN C;  2JA5 B;  3S17 B;  5M9O A;  4B9W A;  4RKB A;  5C44 B;  1WTW A;  3KLS X;  3S1R B;  2QCP X;  5J22 A;  1STB A;  2EYL A;  4UAI A;  3I4N B;  1QIL A;  3KLR A;  2E2H B;  5JEA J;  4FYD A;  5IGF A;  1TII D;  2PW7 A;  2KQ3 A;  4H13 C;  2A6E D;  4R8N A;  2B8F A;  1SBB B;  1PFM A;  4RCO A;  1JB3 A;  5EPL A;  2ZXP A;  2ZXO A;  3HOV B;  2NWG A;  4HSP A;  1DOL A;  3PUV A;  4RA8 A;  1EL0 A;  5DM7 3;  3PUZ A;  1KLG D;  2DY8 A;  5DM6 3;  2MGS A;  5EPK A;  1HTL D;  3I90 A;  3TBI B;  1RDP D;  3D4R A;  1LTI D;  4LAA A;  1OXU A;  5IIF A;  1E0B A;  4KKT A;  3U9O A;  2F0L A;  2F1M A;  4KY6 A;  1F2L A;  4MIU A;  5I2Y A;  2L0C A;  1KDA A;  4I65 A;  1PRT B;  5M3M B;  4J8Q A;  4ZUI A;  4RH6 A;  3AMU A;  3HOZ B;  4LK1 C;  3HOW B;  1EY7 A;  1KNE A;  4G57 A;  1DZ1 A;  5D14 A;  3K6O A;  2R93 B;  2LY7 A;  1QWY A;  1WTP A;  4HAE A;  3GD7 A;  1NR4 A;  3K5O A;  2F0I A;  3RD4 A;  3SK5 A;  1BQQ T;  3H09 A;  1O7Y A;  5CV8 A;  2K03 A;  4KN4 C;  3SEB A;  3D8G A;  3JAM E;  1QNU A;  1JWS D;  2XNA C;  4KKS A;  1EY4 A;  3RZO B;  1SXT A;  3G7L A;  2FMM A;  2OXP A;  2KHS A;  5DAU A;  1ENA A;  2IJ0 A;  5TSS A;  1NAP A;  2VB2 X;  3A8I E;  1JE4 A;  1TWH B;  4BA1 I;  2LKV A;  2X6L A;  2ZXR A;  4XQQ A;  1B9M A;  3P75 A;  3PIP 3;  1J9O A;  1RTN A;  5EPJ A;  1XX8 A;  3E6Z X;  5E3F A;  3KUP A;  1EOT A;  3WOF A;  1LT5 D;  1I4H A;  1ESR A;  3DMU A;  1STG A;  1HUM A;  2IPK D;  1OXX K;  2VNU D;  2F0V A;  2R92 B;  3TZD A;  2E75 C;  4TKO B;  2PO4 A;  4KHZ A;  1LV9 A;  3QWN A;  5G3L D;  2EYM A;  5EKI A;  1VCI A;  1TS2 A;  4F7X A;  3GO5 A;  2VB3 X;  3GTJ B;  5CV6 A;  2RKS A;  3GP7 A;  1KDB A;  2X69 A;  2XWB B;  5FK9 C;  1SE2 A;  3RMH A;  5FLX E;  5FO8 B;  1W6J A;  3SVM A;  2NTT A;  4CJ2 C;  5T1G A;  1B44 D;  2AWO A;  1T5X D;  2QF7 A;  1MBY A;  3IL8 A;  1WTO A;  1FNV A;  1B3A A;  1KAB A;  2KEE A;  1FYC A;  3V96 A;  3KLS A;  1QCB D;  4TSS A;  3J81 E;  2KUM A;  4ZYS A;  1TKW B;  1F2M A;  5EBD A;  3NBH A;  4FXK C;  2B2V A;  2V4D A;  1CQF A;  1A15 A;  2SNM A;  1EQV A;  3PO2 B;  3QB3 A;  4XT1 B;  2RVL A;  2WKD A;  3DUZ A;  3UI2 A;  5E1F A;  2EYH A;  1QB5 D;  2EVB A;  1H9M A;  2AUK A;  2B2Y A;  4LJZ C;  1D5Z C;  4HR7 B;  1SNP A;  1I6V C;  3ITP A;  2LS0 1;  2BA0 A;  3HOU B;  3BS1 A;  1SYF A;  1EU3 A;  4HN7 A;  2J4X A;  4IUN A;  3DWQ A;  4K5V A;  4IUR A;  3VYR A;  2HUG A;  2R61 A;  1B2T A;  2PMZ B;  1IW7 C;  2Z1C A;  1HXY D;  3KBG A;  5JEA G;  1BUV T;  2YYZ A;  3PUX A;  5I6Y A;  2BOS A;  4KKU A;  1HCZ A;  1CHP D;  1M4V A;  1YNJ C;  1Z7T A;  2F0T A;  3E0J A;  4FF4 A;  1PXU A;  4H44 C;  1F2Y A;  3H6M A;  1XWE A;  1S4Z A;  2PZU A;  1SYD A;  2AUJ D;  1HPC A;  2K5W A;  2D62 A;  4YIJ A;  3M4O B;  1CZW A;  2M00 A;  5M5W B;  3I4M B;  4TQU S;  2EYP A;  4IUQ A;  5C4H A;  1TU2 B;  2F0W A;  5CV4 A;  3D4D A;  5COY A;  2RQX A;  1WTX A;  1X32 A;  1CQV A;  2QIL A;  1D5X C;  1RHP A;  4C1N I;  3IKJ A;  5LHY 1;  4A3J B;  3SR1 A;  4L8J A;  1SDF A;  5C5L A;  4XYO A;  3K0Y A;  1Y1W B;  1BOS A;  4HTH A;  2XWJ B;  1XYI A;  4NP5 A;  4RHS A;  5ISR A;  4DK0 A;  4X3S A;  2EE1 A;  2L5T A;  5KND A;  1U4M A;  1V1P A;  2F0G A;  3HGB A;  5CC4 A;  1GHK A;  5D3I B;  1GXD C;  1AN8 A;  2E2D C;  2I46 A;  2A6H C;  4RKL A;  3Q22 A;  5IOC A;  4PMB A;  5JJZ A;  1BXT A;  4FF1 A;  1Y8O B;  1CHQ D;  4A3B B;  1SJH D;  3JAM L;  4FO2 A;  4QCL A;  5DNF A;  4EGV A;  1ILQ A;  5BN3 A;  2ID0 A;  4KD3 A;  1R9T B;  3MFG A;  2JYO A;  1G8Z D;  2F0D A;  1RKN A;  3NBI A;  4KD4 A;  3MXP A;  2NVX B;  4WJW A;  4A3I B;  1TWG B;  3MEH A;  3O13 A;  2QEJ C;  1BCP C;  4LMQ D;  1QJO A;  1EY5 A;  4DF7 A;  1OXS C;  1JOR A;  3MXN A;  1PDQ A;  5IT9 E;  1SE4 A;  3P20 A;  2EYO A;  1TWC B;  1LO5 D;  3V05 A;  4NDX A;  4CJ0 B;  3GTL B;  1Y1V B;  5C0X I;  1G2S A;  3EJI A;  1SYE A;  3A56 A;  3PO3 B;  2JP1 A;  1LTA D;  4KY5 A;  2A69 C;  3D3R A;  4ZUJ A;  2Z4H A;  4IFD I;  5JPN C;  4MHE A;  3URY A;  1IYV A;  1I3Q B;  5C0X G;  1GUT A;  1PTO C;  3FPU B;  5CGK A;  3PUW A;  2KOL A;  1X3Q A;  4XQJ A;  2HDL A;  1EYD A;  1STY A;  4IFD G;  1HHV A;  1EZ6 A;  4HED A;  2BE5 C;  2KCC A;  1ESF A;  2PQE A;  1SNQ A;  2IX1 A;  3VYT A;  3D4W A;  2A68 C;  3S1Q B;  1AW7 A;  3T13 A;  1TVX A;  3MA2 B;  3E5S A;  1JOO A;  1S5D D;  3NQT A;  1SYC A;  1K8M A;  2NZ1 D;  1UUP A;  1V8Q A;  4V0B A;  2EDG A;  1DYQ A;  1FGB D;  1BF4 A;  1JOQ A;  4K5W A;  3P7J A;  2F3V A;  3A55 A;  5LL6 X;  2PYK A;  1EYA A;  1J8I A;  5G3L F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...