1OO9B

Orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
126
structure length
126
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stromelysin-1
publication title Global Orientation of Bound MMP-3 and N-TIMP-1 in Solution via Residual Dipolar Couplings
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 25
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oo9B00
2XWJB 5FO7B 4FXKC 3CU7A 1GXDC 3MA2B 3T4AC 5FO9B 2ICEC 4FXGC 1D2BA 2I07B 1BUVT 2QKIC 1BQQT 1UEAB 2A74C 2B39A 3L3OC 1PXUA 3G6JB 2TMPA 2A73B 2WINB 4ILWA 2WIIB 3HS0C 5JPNC 3CKIB 5JPMC 3OHXC 5FO8B 1XWEA 1JC7A 2XWBB 3FRPB 2J0TD 3I70A 1BR9A 3V96A 1UAPA 5FOBB 2E2DC 1JB3A 3HRZC 3KLSA 1OO9B
chains in the Genus database with same CATH superfamily
1XMOQ 2UU9L 1IYUA 1E3PA 1HR0L 2Q8RE 1JQYD 4HJ7A 3PO3G 5M5YB 4KJOA 1LTAD 4N8X1 2HIVA 5CV4A 5EKLA 1V9PA 2ZT9C 2FJ2A 3M85A 3PUWA 2HQLA 4A3BG 4YWMA 3TREA 3W5OA 2AKWB 4R9WA 4A3DH 4A3IB 4LF5L 3K80C 2PMZE 2F0DA 1V8QA 5JAVA 2QA4A 2DNCA 1TWAB 1HZCA 3K59A 4ILWA 3AYHB 4TKOB 3QR8A 5E7NA 2OEOA 1TWFH 1RTNA 3S1NB 1LT4D 3BVGA 1SMXA 1N34L 1IW7C 4UY8C 3M4PA 3VYTA 3NE5B 5COYA 1ILPA 1O78A 3I4MB 3L3OC 1KNAA 4JBKA 1P16A 3IL8A 2EYHA 2NN6G 5M5YH 3MTSA 4PZ7A 1K73C 3S2HH 4O2DA 4LF9L 4JV5L 3I70A 3WOFA 3G71A 2L4NA 2XIWA 1VQPA 4NXNQ 5JJKA 4J6HA 2D0OA 4H44C 4G7HC 3AEVA 3RR5A 2MO0A 1U4LA 4K2KA 3VR2A 3Q8DA 4P72A 3GTLH 1PLFA 2L0CA 5M5WH 1S5CD 1EYAA 5E3FA 1SE2A 1OXUA 2EY6A 2L5TA 1GUOA 3TBIB 1DOMA 2EPBA 1LTTD 4BY7B 3GO5A 1JWUD 4A3GB 3W2DA 1G2SA 1EUJA 5L37A 1M1KC 1Q1BA 3B6YA 1VQ4A 4KLKA 1SYDA 1T5XD 3CP0A 4X64Q 4A3MB 2HHHQ 2FMMA 3S1NH 1V1PB 1FJGL 4O1NA 2NVYH 1PH1A 2NZ1D 1RHPA 4CBVA 4RG1A 4JI8Q 1VQ5A 1VQEA 4DR6Q 4K8IA 1JWSD 3CMAA 2R92G 5C0XH 2BE5D 4LFCL 1EYCA 2F0NA 1EEFD 1TR5A 1RTOA 4YWKA 4DNTB 2PW7A 1B3QA 1O7YA 4XXEA 1AW7A 5D3DA 2LKVA 2XWJB 5CC4A 2EQSA 4DV7L 2EJMA 1LT3D 1PTOD 4FVMA 3S14H 3R3OA 2VY3A 3MXNB 2SDFA 3PCOB 3U50C 1CI3M 1QJOA 4JVZA 1E2VA 4C3IG 5JJLA 3J81c 1SE3A 3PIO3 3PGZA 1PTOB 3CCVA 4ZKCB 4P71A 4YCVA 4R4TA 1GUNA 1N32Q 2UXDL 4DK1A 1QWYA 1SSOA 3HOWG 1EIHA 1YNJD 2C9OA 4UPAA 2XN9C 2Y0SE 2QCPX 4CKBA 1S72A 3D4RA 2K5WA 2YTVA 3PO2B 2HT1A 4ME5A 3A7AB 5A35A 3HKZE 1VQFA 4HJ5A 4R4QA 1IBMQ 2CH4A 3RN2A 1EIYB 3BDOA 4BBRB 2ZXPA 1Y1WH 1D1KA 4QB4A 4UP8A 4LF8Q 1SNMA 1W2BA 3RMHA 1YIJA 4HJ8A 2B2UC 1HZBA 4C3JG 2L11A 1IXRA 5EPLA 2OTLA 4JOIC 1QOHA 4Q5VA 2SNMA 2Z6BA 5HGTA 4HJAA 3U4ZA 4EX5A 3QOLA 3T56B 1PRTC 3A56A 2BDNA 2HIXA 3J80L 4HSPA 4A3JB 1WTVA 2FINB 4P2CB 1WFQA 4OONA 4J8QA 1JR0D 5LMUQ 3CXCA 3M7GA 1QNUA 5GAHC 3HEJA 4LJZC 2MPMA 2B2WC 2HCIA 4DV6Q 1M4VA 1BBUA 2J0TD 2I0QA 4HIMA 1PTOH 5C0XJ 1FYCA 1ET6A 3TN2A 4X6AH 2R93G 1NMGA 4FO2A 1VQOA 1AP0A 4DU9A 4LFAQ 2CW0C 2UXBL 5EQ0A 4GLAC 1Y69U 2ZJQA 1B50A 2KENA 2RDGA 4L5TA 3L0OA 3CKIB 4CDCC 3PO2H 1P8LA 2NB0A 4P74A 5BN3A 4IUTA 4GOPC 2UUCQ 4KN7C 4DR3Q 5IE8A 2HQEA 4Y7NB 2VXWA 4BBRH 4APVA 1LUZA 2VQEL 1SROA 1BBWA 4QUFA 1HQMC 2DJGC 3HOVB 3EN2A 1JICA 4AYBG 3BZKA 1ASYA 3KBXA 4X65Q 1VQCA 1YHQA 3VYRA 3HOZG 4HMJA 5FLXc 2F0KA 3M4OB 3GQBA 1FGBD 3Q22A 5KGUA 3A7LA 4POGA 4GZYC 1NTGA 3FKIB 2IHFA 2K14A 1KQSA 3MEHA 4IPCA 1EWCA 3M7NA 1ESRA 4UP7A 3VYUA 2N3SA 4X66Q 1GUTA 1MKHA 1D8LA 1Y8NB 3CRKC 1EY7A 3EROA 3AB9A 1JE5A 1RCVD 4KI0A 5K36H 1BQQT 4DK6C 1EOTA 1PFSA 4K5VA 3TP6A 5IT9L 4LUVA 2A69C 1VQ9A 5M3MH 1MGSA 1I94Q 1V1OA 2RSNA 2Z4HA 1I4GA 1RL2A 3OYYA 5CV7A 1IW7D 2EDGA 4X62Q 4A3FB 2PMZB 5T1IA 5H1SE 1YHBA 2VQFL 3PUZA 4ZUJA 5C4XB 4X3UA 1DD2A 1HNWL 1G6ZA 1L2FA 3KBGA 4Y7NH 1WTQA 4YHHQ 1VQMA 1DZ1A 2F3WA 3HZXA 2PI2A 3J80E 1ICWA 1SXTA 4K0KL 1IHZA 1XPRA 5KRUA 4OIKA 2WKCA 4ZLTF 3K58A 3IFTA 5E4WC 3HOYB 1MD2D 3J7YW 1S5DD 1LO5D 1PMRA 3M4OH 2MJ8A 4LFBL 2D9UA 1XPOA 2L9HA 1BF4A 2R7ZH 3H3VH 4JPBW 4IJHA 5NUCA 4LF6Q 2NWGA 4JI0L 1OXSC 1I5FA 1X6OA 4C3HB 2EYMA 1HNZL 2LS01 4KHPL 2NVTB 1G51A 3DHQA 1E2ZA 1FL0A 1NNXA 2ES2A 2K7VA 2JA8G 3EQLC 1STAA 1UNSA 2JXMB 3RLOA 3UDFA 5GAGC 2BH8A 2JN4A 3BVZA 2ZTEA 2WB1E 3P75A 4IURA 4WORA 3CU7A 4N9TA 4A3FH 4JC0A 1QILA 5FLMG 2IX3A 2PCFB 1CHPD 5ISRA 2MO1A 2E5LQ 5LMNW 1TKWB 3SEBA 3A8JE 1Y8PB 1Y1VB 4DUYQ 1UUPA 4P75A 1CKNB 4MTNA 3T1HQ 4DNRB 4YCUA 2D62A 2KEDA 3F1ZA 4WFN3 4DV1Q 3DWPA 3STBC 4BS9A 3A5ZB 2UXCQ 4OO1G 3HOYH 4GNXA 3M9BA 3O13A 1AZQA 5C0XG 4XT1B 1J6QA 4RKBA 1IBLQ 1OXTA 1MSHA 4DFAA 3LX0A 4IPGA 2EZVA 2UUBL 3OMCA 1X56A 5CGKA 3K5NA 5M3FB 5IT9E 1BCPF 4L5SA 3PUVA 4E6IA 1STBA 1SYCA 1ZXTA 2F0GA 1VQ6A 3HG9A 1TWGB 4C3HH 2N55A 3EA6A 4G7ZC 3FRPB 5C5MA 4DXGA 4B3RL 1Q3LA 2ZTCA 4G7OC 5IYDG 4NXMQ 1WCMB 2ATWA 1Q46A 4HSVA 2AQ2B 4DV0L 4B3TQ 4PNYA 1D6EC 1EY6A 3DWQA 3GTKH 1A3VA 1LABA 4UP9A 5C6AA 2E2JB 1XMQL 2RF4A 1UWVA 4JI4L 5JPMC 3SE0A 1EZ6A 4C2MB 1HNXL 1KAWA 5CYUA 2K33A 5BR8Q 1Y1VH 2JQOA 4GKJQ 5EJWA 5ELFA 2F0PA 3A54A 2Y0SB 1U4RA 3A8IE 3SK4A 1PRTD 1RF2D 1S40A 2X69A 3W3AA 3MA2B 1VQHA 1ENCA 2R7DA 5CR3A 5IYCH 3AU7A 2G9HD 5CV6A 1N36Q 3HKZB 1Y1WG 4RGNA 3K81C 4I7AA 1Z7TA 3KF8A 5JOBA 5KYLA 4FF4A 2CHBD 2DN8A 2J4XA 4IUVA 5EBCA 1PRTB 1CKOA 4DR1L 2BCOA 3T53B 5I9PA 2KCMA 4IUPA 1TWGH 2B8FA 5G3LF 3JAMi 2XRSD 3L2PA 2CW0D 4TRDA 2ZTDA 1WD1A 4LF7Q 3GTMB 3FPUB 1DJRD 4KMUC 1K83B 3OWFA 2F0TA 2K04A 3RD4A 2F0IA 1GHKA 1WCMH 5IGEA 2TSSA 2GVAA 1CUKA 2K5DA 4DAYA 4MIUA 4DV4Q 4CJ0B 4DR5Q 2IL8A 4QJFA 4BBSG 3ERSX 4OIJA 5GADC 1PZID 2B2VC 2DY7A 3JC66 2E2JH 3HOUH 1X3GA 4BWGB 5JEAG 5IWAQ 4IZ8A 1CK1A 2WAQG 3MHBA 4EQOA 3CPWA 4C2MH 2KHSA 2Z1CA 4GOPB 5C4JH 1I6HB 1HR0Q 4EGVA 3I4NH 1YZ6A 3NTKA 4XDXA 2D5DA 2O2LD 1ML0D 1O7ZA 2OXPA 3G6JB 3GTQB 1EU3A 3AFPA 1SNQA 4R8IA 3SK6A 1TY0A 3OHXC 4P73A 3WOEA 1WYDA 2K05A 3MEFA 5AJ3Q 5IGDA 1F2YA 1U4MA 4C56C 5I9OA 4HIDA 1R4PB 1LTBD 1DXMA 2F0EA 2PPBC 1UEBA 2A69D 1SR3A 3TRZA 1B9MA 5F2DA 3GTMH 2N78A 3RLNA 2Q8TA 1K83H 5I2YA 4B3ML 3G6EA 1XX8A 2RQXA 4N9PA 2JA5H 1QZHA 2XTIA 3CHBD 2K6AA 3SK5A 1HCZA 2VW9A 3S17B 2EXZA 4DK3C 1N34Q 1DYQA 2OTJA 3HGBA 4A3EB 2KEEA 5M3MG 1K3BC 1MIUA 3NTHA 3TZUA 4A93G 1B8AA 4KKTA 2BOSA 1U4PA 3GD7A 5DLQE 1TWCB 4IUNA 2NVXB 1EOVA 2K5NA 1I4PA 1I6HH 1Q8KA 2E2IB 1JOQA 1Z47A 1KLUD 2KOLA 4R4CA 3RZDB 1BDOA 4DF7A 2MNAA 3GTQH 5KNBA 4LF9Q 4L6TB 4JV5Q 2F3VA 2OF1A 2Q8IB 1CTMA 1ZKOA 3TDQA 1X65A 4JI5L 1UE6A 3T4AC 3I91A 2BA0A 1KIXA 5FJ8H 4DN4M 1KLGD 2KCCA 4J1MA 2B63G 2RBMA 4LNQA 2AQ1B 4JK1C 1CQVA 2WIIB 3GTJB 4BY1H 1RIPA 4DNIA 3U4VA 3U9OA 5ELCA 3H0GB 1PFMA 1K8AC 5IYBH 1YHAA 4JI7L 2AUJD 1EFID 2B2VA 3V2TA 3HOXB 4MZ9A 3GTPB 3S17H 3E0JA 4A3KG 3FP9A 1EIGA 4A3EH 1G291 4K2LA 1TQOA 1IL8A 4B3SL 1Q7YC 1KDCA 2NUCA 1KDBA 2X6LA 3STBD 2NVXH 3ULLA 2EYJA 5FO8B 2WB1B 2EYFA 2ZM6L 1OTCA 2KHJA 5FOBB 3RZDH 1WTRA 2I5LX 1DCZA 5C3EH 3U58A 4DV3Q 2YU9H 4DV7Q 2JA7G 3QJYA 4HMIA 4RMFA 2KJXA 3I8ZA 4DAPA 4K5WA 3CF5A 4M1UB 1K3RA 2YYZA 4TSSA 5C4HA 3DWAA 1YEZA 3L7ZC 2VUMB 4DK0A 1L0XB 1TT2A 4JG2A 4ULLA 1HQRD 1JC7A 2ICIA 3KLRA 1PZKD 2NTTA 4H7BA 1NUCA 1Q90A 1VF7A 3SR1A 2UXDQ 2F0VA 3CW2C 2CVRA 1XXGA 4QQBX 1WTWA 1BUVT 1RKNA 2LMCB 1N33L 2MQHA 5DNFA 3HOXH 5J3BA 4XQJA 2R6GA 3FHWA 4A3IH 2IHEA 1LTLA 1JT8A 4JI1L 4RGMA 5GROA 1FD7D 1HH2P 1TWAH 3G4SA 2PZTA 1SBBB 4OXPA 1CKMA 4PZ6A 3IFDA 3K5LA 3NP8A 2MHVA 2XRQD 3OSOA 1VCIA 3IAYA 4A3CH 2L55A 1QG7A 3RZOB 3KYHC 1E24A 1QZGA 3H15A 1S5FD 4FDBA 3AFQA 1KRTA 4K6DA 1I4XA 4PQXA 1B53A 3DM3A 1QB5D 1LACA 1HR0W 3TP7A 2J7ZA 3I4MH 1D1IA 2VUMH 1C7YA 1LT6D 5ELEA 1JB3A 1ET9A 3HS0C 3KJOA 4LF4L 2SOBA 1A3TA 3D31A 1YI2A 2DGYA 2KCTA 3CAMA 3T51B 1EY0A 5J1ZA 2UXBQ 2V4DA 2CCZA 2GN5A 3KDFA 1L0YB 1GUSA 5IY0A 1LTGD 3K7AB 3S15B 2F0FA 1BR9A 1VQAA 5C44G 3A0JA 2JP1A 3OTOL 3EJIA 2VQEQ 5IP9G 1VF5C 4BY7H 4FXKC 4A3GH 2R7FA 3V05A 1BBXC 1JMCA 5FKAC 1X3FA 3RLFA 3HOUG 1K0SA 3KK7A 4A3MH 4GN3B 3H94A 3ND9A 4DUZL 4F7XA 4K5XA 1YJWA 3RZOH 1SYGA 2PI2E 3I73A 3CQZB 4FP5D 4PMCA 1S3OA 4NDXA 3I4NG 1NBWA 1Q86C 5LL6S 1K9MC 2BH2A 1Q8IA 2ALYB 1IYVA 1X32A 3OMGA 1V1QA 4YIJA 1WTOA 1A8VA 2WINB 4HIKA 2M2LA 3P1HA 3J81i 2CQOA 4MNOA 2A1AA 1HUNA 1CHQD 3OWEB 4DV2L 4IFDI 4L63B 4X64L 2JA6G 2EYLA 2B2YA 2VQFQ 3K7AH 5FO7B 4A75A 3S15H 1HNWQ 1SRUA 3K0XA 2JA5G 3E9IA 2JSOA 3MXUA 4DR6L 2A74C 3H6MA 1B1ZA 1PZJD 1D5XC 2A73B 4JI2L 2Q2TA 2CWAA 2Z6KA 1HFGA 1TXYA 5K5PA 2IWHA 2R61A 1FVIA 3UE1A 2VB3X 4LFBQ 1SMYC 1E1TA 4OX9L 1PH8A 1DONA 1K8OA 3S24A 3BVMA 3MXGA 4ZUIA 3J81E 4ME3A 4XT3B 5ELBA 4HCEA 3ER0A 4JI0Q 4C1NI 3VA5A 1SLJA 1C9OA 3RNUA 1HNZQ 1M8AA 4KHPQ 5CORA 2DNEA 5I2XA 3MWYW 1A2UA 4DV5L 4LW1A 1H9JA 3TP5A 1TIID 4AYBE 4A3JH 1HPCA 2RDHA 4GNXC 5FJ8G 3CRLC 1VQIA 5LMNL 3C1FA 3CC2A 4JYAL 1OO9B 3N52A 1N32L 2D0PA 4HN7A 3K57A 2F1MA 2FMCA 4A3LH 3HP3A 2E75C 1YJNA 2FFKB 1MJCA 2N88A 1X54A 1HUMA 3PO3B 3QO2A 1TU2B 2VS1A 1IBML 3ND8A 3BS1A 4A3DG 2AHOB 2K75A 2PW5A 3DEPA 1SNDA 2BDOA 1A6XA 5HURA 2RCNA 1UAPA 1SNOA 4A3BB 4PMWA 1PTOF 2JE6I 1KXLA 2F4IA 4AH6A 1WD0A 4QGUA 3G7LA 2X6GA 1ASZA 3K5OA 4XTCS 2EE1A 4CJ1B 5KNDA 1TS2A 1QE6A 1TY2A 4J15A 1X9NA 3HOVH 1VQLA 1FNVA 2EY5A 3P7JA 1EL0A 4JCVE 1WTPA 1EQQA 3GTGB 3Q0AA 4RCNA 4DR4L 4B3RQ 1W6KA 2PQAA 3FKIH 5G3LD 3N6RA 3KF6A 4NW2A 2QDLA 4H02A 4X3KA 4LFAL 1BNZA 3K0YA 4DV0Q 1BKBA 2EY2A 4EQPA 2NZOA 2I46A 4CJ2C 4DPGA 1XMQQ 3GV3A 1JE4A 2OQ0A 2Z9HA 2QW7A 4JI4Q 3MC0B 1X55A 4ZCKA 1HNXQ 5JJIA 2K32A 1O7IA 4OWXB 1R4QB 3CCEA 5IGGA 2D2CC 1EQRA 2HD3A 1L0WA 4LUOA 3HRZC 3CCUA 3TEHB 4A3IG 3S1RB 1RD9D 2LFNA 1JOOA 4KHVA 3BDLA 4U68A 2AMCB 2K01A 3KLSX 4ZRZA 1F9SA 3H91A 4A3BH 2ICEC 3UE0A 1B2TA 3VYSA 5C4XH 3OIPA 5T1GA 2F0WA 1OXVA 5C3WA 4YY3L 1LT5D 3D6CA 1K8MA 4KV6A 4A3CG 3QWNA 1B70B 3NWTA 4CGYB 4O0AA 3GTGH 1NMFA 1PDQA 2E8GA 3NWSA 1ZEQX 3I4MG 1G91A 2KUMA 4FF3A 4FXGC 1XNQL 2KHIA 4OHJA 5CBAE 5ELNA 5JVH3 3UDIA 1JJ2A 4XQNA 5E4XA 2VNUD 2LY7A 1SFOB 4AQYL 2SEBD 2RVLA 3W1GA 3G48A 2K5QA 3CCQA 2R92B 3JAML 2XSCA 2YTYA 1HHVA 5CV9A 4X3TA 2NVTH 2IT1A 4EQ5A 4KKUA 2XVSA 4EQNA 5BN4A 2NN6H 2ZJPA 1HZ9A 1VQDA 1C8CA 2EJGC 4RGOS 1B9NA 4YHHL 5C3XA 1AN8A 3PUXA 2QKIC 3BYYB 3ICEA 4ZKBB 2JA9A 2JEAI 1ICFB 2F4VQ 5HGQA 1CZWA 3ITPA 3A5UA 3NBIA 5GQOA 5DM73 1AZPA 4IUQA 1F2ZA 4C3IB 4KHZA 4BY7G 1H9SA 4LUZA 2CFMA 3K5MA 4A3GG 2IPKD 4GLVB 1GKHA 3R2TA 4XYOA 1F9PA 2QDBA 3J7ZC 1GHJA 4A3MG 1QCBD 4WJWA 2K1BA 2VB2X 5EAYA 4LF6L 3TP8A 4I7ZC 2IX1A 3HOWB 1I4HA 1EY5A 1EU4A 2TMPA 5ELDA 1K0RA 4KKSA 4B3MQ 4QY7A 1NJIC 3NPPA 1J5EQ 3E0EA 4PG3A 3X3MA 4CDEC 5M3FH 4K6LA 1NCVA 3TSSA 1SFOH 3LWEA 1GJXA 1G2TA 1Y8OB 3NBHA 2KBNA 5LL6X 2R92H 4EVOA 1EZ8A 4GN5A 4C3JB 3UDGA 1SNPA 2R3ZA 3C3LA 1TS4A 3D4DA 2I07B 2E5LL 1SNCA 2N49A 1AE2A 2B39A 1MHWC 3M3YB 2UUAL 1MBYA 3Q24A 1SMYD 3R2IA 5IP7H 1VQ7A 3I72A 1KC8C 1SDFA 1WTXA 3D6WA 1NR4A 2H4OA 2ID0A 1G8ZD 2UXCL 4C3IH 4U673 2SNSA 3UDXA 1XNRL 4KY7A 2MUYA 2RHSB 4JI5Q 5J22A 2UU9Q 5FO9B 2A6EC 5D65A 2R93B 2LXJA 2WAQE 3PO2G 2JEBI 1IZ6A 5DM63 4X3SA 1VS0A 1PA6A 2F0UA 3H09A 1ZYRC 1I50B 2QEJC 3HKSA 2AUKA 1I4QA 4FXDA 4FF2A 1VQJA 1VQGA 3I4LA 3C2PA 3HOWH 4BBRG 4R4OA 3CCJA 3JAME 2CWPA 3MVVA 4CDDC 1OXXK 4JI7Q 3E9HA 4QF4A 1MI2A 4GNXB 4RKLA 4NXML 2G9DA 3MFYA 4S3SA 4LF5Q 1X3PA 4A3JG 3R8BA 1RJTA 4UAIA 1PHJA 3VA7A 4C3JH 1PH6A 5KYIA 4AYBB 1SYFA 4B3SQ 4V0BA 3GTOB 3HOZB 3OW2A 4I65A 5JVG3 1W3SA 1PH2A 2DUDA 3M3YH 2F0JA 2ZM6Q 2LXKA 2NN6I 2C35B 5K36G 1JORA 5EBDA 2MGSA 3DLLA 4JI6L 1E0BA 1HJPA 1H95A 1YVCA 5EPJA 4LAAA 2WKDA 1F77A 4XQQA 4DR7L 1HA5A 3NXWA 1L1OC 4QMGA 3DEOA 1HFNA 1H9SB 2K5HA 1I6VC 4KY5A 4KK7A 1YBYA 4IO9A 1T9HA 4JI3L 1ENAA 5EPKA 3P20A 2F03A 1E1OA 5A2QL 2L12A 1D7QA 4F88A 3HOVG 1CQFA 1U5KA 5C4ZA 1V1PA 2RKSA 1B3AA 1WI5A 3J81j 4YCWA 1KDAA 5E1FA 1N33Q 4ABNA 3R93A 3KF8B 1PH4A 2IX0A 1TWFB 4DV4L 3GP7A 3CPFA 4DR5L 4ZQ3A 2F3IA 3FKIG 3MXPA 3QOJA 2R7ZG 4JI1Q 2Z0SA 1NSNS 1LTRD 1PRTF 3HOZH 1BCPC 2Z4IA 3IKJA 2VZAA 5M9OA 1H9KA 1S5ED 3MXNA 1RODA 1FJGQ 3C1EA 3S2HB 3Q6SA 2RCFA 1EQVA 2OWOA 3H3VC 1EQTA 4WRDA 4DAYB 1IBKL 1EY9A 1TWCH 4LK1C 4LFCQ 5TSSA 1S4ZA 4IQZA 4A3FG 5AJ3L 4RAUC 2EYOA 4XIGS 1PV4A 2E2IH 5C4XG 1KL9A 2JA8B 1IYJB 3GTLB 1LM0A 2EVBA 5M5WB 3NSWA 2ZXRA 3QB3A 4YWLA 4LF4Q 2PZWA 4JBMA 2FXQA 3TS2A 3WWVA 1Q81C 4JW0A 1ESFA 5I6YA 1C4QA 5DAUA 1X3EA 2CH4W 3HOYG 4NMZA 2M9VA 2I5MX 3NTIA 3PIOA 4Q0FA 4KD4A 3T1YL 1PYWD 4NKLA 2XGTA 1T5EA 3VDYA 2NVYB 4GKKL 3I2ZA 3GTJH 4R4IA 3EBEA 4B9WA 1NR2A 4IFDH 3OTOQ 4RFBA 3J7A5 1XYIA 3H0GH 4QL5A 4C3HG 3DXJC 4V190 1CA5A 2EY1A 4FF1A 4CKEA 3GTPH 4DUZQ 4N8FA 2EJFC 1EEID 4DR2L 2OT2A 2EOTA 3BZDB 3L9AX 3OOCA 3PF5A 4IALA 1L1OA 1JOKA 2NZHA 2B2YC 2WV6D 2VL6A 2QILA 4A76A 3NQTA 2AQ3B 5A2QE 3S14B 2HUGA 1NAPA 4UHVA 4BA2I 1XMOL 4DAVA 2B2TA 4IOCA 2KECA 2JA8H 2O5JC 1LYLA 1B7YB 2QF7A 1J8IA 1LLRD 4PMBA 1II3A 3F2BA 2K5VA 3I55A 1Y1VG 2Z6KC 1E22A 1HTLD 2L1BA 3OIQA 4QUCA 3J7AF 2MP1A 5FLMH 4F87A 1EYDA 1YJ9A 5IYCG 1HZAA 1SYEA 4DV2Q 1AH9A 4L8JA 1IKMA 1QVFA 3IRBA 4IPHA 3SK8A 2A68C 4NP5A 1KD1C 5I6WA 2F52A 1KHIA 3I56A 3J81L 5M3FG 3CCRA 4OO1H 1KTKA 5CV5A 1EWHA 1XTDA 1Y1WB 4ALPA 1EWIA 2WACA 4HAEA 1GUWA 3BU2A 4JI2Q 1BOSA 3ONAB 4WJ4A 4PV1C 3BYTB 3WDNA 5JJZA 1F9RA 4OX9Q 3UI2A 3TQYA 2JYOA 4DV3L 2A6ED 3OPOA 1WCMG 3K7UC 3T13A 3W1BA 1HA6A 5IP7G 1EY8A 1TS3A 1ZYRD 3VR3A 3NELA 2F0MA 1JB7A 2HDLA 4CKCA 1UE5A 1A2TA 1D5MC 4MTKA 1A62A 4IFDJ 5IYDH 3BJUA 3VR5A 5ELOA 4DV5Q 1SYBA 5KNCA 3FVQA 4BBSB 2PZUA 2LSSA 2Y0SG 3ZJYC 5LMNQ 4NXNL 3KLWA 3MFGA 4JYAQ 1DOKA 4GLXA 2WAQB 1WOCA 2CQAA 5EKIA 3HKZG 3NHHA 4WJ3M 4H0LC 3D4WA 4GN4B 1SJHD 3D8GA 2G5DA 3QG1A 3PSIA 1I4RA 1Q82C 4IPDA 2E2HB 4R8NA 2DJFC 1W6JA 3S9WA 2CKZB 4HJ9A 4KN4C 5IGFA 3TS0A 3S2DB 3KFUA 3LNNA 4PZ8A 2HHHL 3KUPA 2A6HC 5M5XB 3CCMA 4OWWB 1ENFA 1VMPA 2DY8A 2N8NA 4JI8L 1D2BA 2OQKA 4F8MA 4K0KQ 1CFMA 1A0IA 1SEBD 1TVXA 2Q2HA 4G4KA 1PFNA 3NK9A 4MN3A 3VR4A 2ENBA 1PH7A 2RHQB 1L1OB 2EXDA 3J80c 2ZJRA 4KD3A 1JJGA 4DR4Q 3EFXD 2F0SA 5AFWA 3MZ5A 1LTID 4BBSH 1STNA 3CQZH 3CC4A 4DGZA 3I7FA 3GDEA 1XPUA 1STHA 3A55A 3SHLA 5FLXL 5M3MB 5JEAH 1QNKA 1DM0B 1C0AA 4A93B 1VQKA 5CV8A 2F0LA 1A15A 1IKLA 1Y14B 2KQ3A 3F2CA 1CKNA 4DXFA 1JCKB 1BCPD 1CZGA 2MFIA 1YITA 3TMEA 1ILQA 2E2HH 3URYA 2K28A 2F0HA 3NQIA 4HR7B 2WFWA 3KLSA 1N9WA 4IUUA 1XTCD 2M00A 3EIVA 3FPPA 3S2DH 1Q1EA 2PQEA 1BCPB 4KJNA 3PV0A 4OEMB 2KVMA 4OO1I 4BY1G 2P5ZX 1VQBA 1Z6HA 4HIOA 2B8GA 1BO0A 1PYBA 5C0XI 1EIFA 5M5XH 4QIWE 3S1MB 3VR6A 5IYBG 4KY6A 4YY3Q 2GVBA 2B63B 1YNXA 3KDFB 5EGTA 3J7AV 5IODA 2Z8LA 2EIFA 3J80i 1GO3E 4BXXH 2R7ZB 3ULJA 2RDFA 2KCNA 1XWEA 4LF8L 2GA4B 2A5HA 3V96A 1JJCB 4A3EG 4RGTA 2WP8J 1HTPA 1EY4A 3S16B 1YNNC 3C46A 4ID6A 1H9MA 2E74C 3D3RA 1DGSA 1XNQQ 1B4OA 3NEMA 4A3KB 1LV9A 1F2LA 1U9RA 2UUBQ 4HCSA 5LMUL 3FDTA 4BA1I 5C3EG 4K8JA 4AQYQ 4A93H 1MJEA 3SDZA 1HXYD 2PNHA 4DV6L 1S5BD 1UE1A 3PIPA 4K14A 4RWSC 2HCCA 5IT9c 3QIAA 1FGUA 1X3QA 4H13C 2B2UA 5KEEA 2JA7B 4JOIA 1AFPA 1ONLA 3DUZA 1WVLA 2OCEA 3U9SA 1PXUA 2ZXOA 3I3CA 4IJLA 2C5CA 2K52A 4RA8A 4IFDG 4IN3A 5JEAJ 1F9QA 4ZYSA 3H0GG 4OL7A 3S1MH 4DA2A 3PO3H 1UE7A 2UUCL 4DR3L 2B63H 1B44D 4POFA 4OGQC 5J39A 4M8AA 1VQNA 3HOXG 3PF4A 2B2WA 4B9XA 2RA4A 3PQIA 1GM5A 3CCSA 5FLXE 3HFZB 1PH9A 4MHEA 4X65L 1PYSB 3SGIA 3CD6A 1E7ZA 1I3QB 3S16H 1SE8A 1CSPA 3DMUA 3TZDA 2XNAC 2WB1G 4JBWA 4A3KH 4UDUC 3PMFA 4DAMA 4DR1Q 3BDCA 2A68D 5C5LA 4LWCA 5HY6A 1E2WA 1TWHB 4X66L 1R9TB 3A8KE 3RUZA 4GOPA 3GTKB 1Z9FA 4ODGA 2PNRC 3K6OA 3E6ZX 4L5QA 2AWNA 3FMCA 1H9RA 1UEAB 2K4KA 2VUMG 3KOJA 2EYPA 5CBEE 2YTXA 2NVQB 1VDZA 4QCLA 2JA7H 2UUAQ 4FYDA 1I94L 1FNUA 2O5IC 2Q2IA 1PH5A 1O7LA 4DKAC 1FR3A 2NBFA 3BZCA 4X62L 2IW3A 2NTSA 2E76C 1SAPA 2L15A 1TS5A 2E2DC 1AE3A 4LMQD 1LTSD 1XNRQ 5DEHA 3NENA 4R1JA 5D14A 3KJPA 2H1EA 1K28A 1O80A 1WJJA 1BXTA 1M90C 3S1RH 5KIXA 2RSOA 3SXHA 1CA6A 1I3QH 5IGBA 3PIP3 3F2UA 3F8TA 1GUGA 1U0LA 5GAEC 2PO4A 4KTAA 4NB3A 2AWOA 2FHTA 5C44B 3JAMc 2IY5B 1QUQA 3E3XA 4GS3A 1A3UA 1GXDC 2K50A 4O42A 1TWHH 1R9TH 2O4XA 3LGJA 2B29A 3CMEA 3FEWX 2YV5A 3HOUB 2ASBA 4IOAA 1CT1D 4HTHA 3BG3A 1VMCA 2NVQH 5C4JB 1SN8A 5LHY1 4XYQA 4G57A 3M4QA 2A6HD 3SVMA 3I4NB 3PUYA 4ZK9B 3S1QB 1PVOA 4FNFA 3LWUA 1FNWA 3CCLA 1NY4A 2PQAB 1IL2A 2F0QA 4JI6Q 2BA1A 3KF6B 2KA7A 5FK9C 1C48A 3D0FA 4CHTB 1GD7A 4Y52H 4DR7Q 4RCOA 4DUYL 1PH3A 3T1HL 1GVPA 1G6PA 2B3GA 4DV1L 1WTHA 4HEDA 3OW7A 4C1NK 4JI3Q 1KAAA 2XWBB 2BE5C 1CSQA 3H3VI 2JK8A 4RH6A 2H5XA 1STYA 3I4OA 4B08A 3K8AA 4AIMA 2JA6B 3DM1A 1PFBA 2PYKA 1IBLL 4CDFC 3X3NA 4TVAB 5C44H 1HRJA 1NE3A 2JA5B 1J9OA 1VQ8A 1RDPD 5IP9H 1PTOC 2A8VA 4RHSA 1GOZA 4OWTB 2JJQA 5JPNC 4TQUS 5IOCA 5D3IB 3NUCA 3RN5A 2K03A 5EKKA 1DOLA 4L5RC 5BN5A 3GV6A 1F2MA 2A19A 3Q23A 4NPSA 3A74A 3MAQA 3S1QH 4B3TL 3CC7A 2F4VL 3E5SA 2QEXA 1YNJC 2V1CC 1IBKQ 3ERQA 4JBJA 5IGCA 1SJED 1N8RC 5BR8L 2HDMA 4A3LG 1CM9A 4GKJL 3ZYYX 1YNND 3ULPA 1XJVA 2QGQA 1MSGA 4QIWB 1N36L 4BY1B 4BXXG 1D5ZC 1AEXA 2JA6H 1BVSA 2Q2UA 5CMDA 4OELB 1SE4A 3F2DA 3AQQA 1QVGA 2R93H 2IJ0A 1J5EL 1K8GA 4Z9CB 1I50H 3T1YQ 1KABA 4A3DB 3T16A 1EFWA 3I90A 2B2TC 4GKKQ 1STGA 1QUQB 3EVQA 1V43A 4LF7L 3M4YA 5IIFA 1STEA 4RHRA 3AMUA 1KRSA 1Q12A 5C3EB 4DR2Q 2F0OA 4A4IA 2YU9B 1KNEA 1QVCA 5IWAL 1JWMD 1A63A 1EYGA 3NBHB 5I4DA 3GTOH 2I5HA 4ZAIA 2NYZD
chains in the Genus database with same CATH topology
1IYUA 2Q8RE 1JQYD 5M5YB 4KJOA 1LTAD 5CV4A 5EKLA 2ZT9C 2FJ2A 3M85A 3PUWA 4R9WA 4A3IB 2F0DA 1V8QA 5JAVA 2DNCA 1TWAB 3K59A 4ILWA 4TKOB 2OEOA 1RTNA 3S1NB 1LT4D 3BVGA 1IW7C 3VYTA 3NE5B 5COYA 1ILPA 1O78A 3I4MB 3L3OC 1KNAA 3IL8A 2EYHA 2NN6G 3MTSA 3I70A 3WOFA 2L4NA 2XIWA 4J6HA 4H44C 4G7HC 3VR2A 1U4LA 4K2KA 1PLFA 2L0CA 1S5CD 1EYAA 5E3FA 1SE2A 1OXUA 2EY6A 2L5TA 1GUOA 3TBIB 1DOMA 2EPBA 1LTTD 4BY7B 3GO5A 1JWUD 4A3GB 3W2DA 1G2SA 1Q1BA 1SYDA 1T5XD 4A3MB 2FMMA 1V1PB 4O1NA 2NZ1D 1RHPA 4CBVA 4K8IA 1JWSD 5C0XH 2BE5D 1EYCA 2F0NA 1EEFD 1TR5A 1RTOA 4DNTB 2PW7A 1O7YA 4XXEA 1AW7A 5D3DA 2LKVA 2XWJB 5CC4A 2EJMA 1LT3D 1PTOD 4FVMA 3R3OA 2SDFA 1CI3M 1QJOA 1E2VA 4C3IG 3PIO3 1SE3A 1PTOB 4ZKCB 1GUNA 4DK1A 1QWYA 1SSOA 1EIHA 1YNJD 2C9OA 2XN9C 2QCPX 4CKBA 3D4RA 2K5WA 3PO2B 4ME5A 3A7AB 5A35A 3BDOA 4BBRB 2ZXPA 1D1KA 4QB4A 1SNMA 3RMHA 2B2UC 4C3JG 2L11A 5EPLA 1QOHA 4Q5VA 2SNMA 5HGTA 3QOLA 3T56B 1PRTC 3A56A 2BDNA 3J80L 4A3JB 4HSPA 1WTVA 2FINB 4P2CB 4J8QA 1JR0D 3M7GA 1QNUA 3HEJA 4LJZC 2MPMA 2B2WC 2HCIA 1M4VA 2J0TD 1PTOH 5C0XJ 1FYCA 1ET6A 3TN2A 4FO2A 1AP0A 4DU9A 2CW0C 5EQ0A 1Y69U 1B50A 2RDGA 3CKIB 2NB0A 5BN3A 4IUTA 4KN7C 2HQEA 4Y7NB 2VXWA 4QUFA 1HQMC 3HOVB 1JICA 3KBXA 3VYRA 4HMJA 2F0KA 3M4OB 3GQBA 1FGBD 3Q22A 5KGUA 3A7LA 4GZYC 3FKIB 3MEHA 1EWCA 3M7NA 1ESRA 3VYUA 1GUTA 1Y8NB 3CRKC 1EY7A 3EROA 3AB9A 1RCVD 4KI0A 5K36H 1BQQT 1EOTA 4K5VA 3TP6A 5IT9L 2A69C 1MGSA 1V1OA 2RSNA 2Z4HA 1I4GA 5CV7A 1IW7D 2EDGA 4A3FB 2PMZB 5T1IA 5C4XB 3PUZA 4ZUJA 4X3UA 1DD2A 1G6ZA 3KBGA 1WTQA 1DZ1A 2F3WA 3HZXA 3J80E 1ICWA 1SXTA 1IHZA 5KRUA 4OIKA 2WKCA 4ZLTF 3K58A 3IFTA 5E4WC 3HOYB 1MD2D 3J7YW 1S5DD 1LO5D 1PMRA 2MJ8A 2D9UA 2L9HA 1BF4A 5NUCA 2NWGA 1OXSC 4C3HB 2EYMA 2LS01 2NVTB 3DHQA 1E2ZA 2K7VA 3EQLC 1STAA 1UNSA 2JXMB 3BVZA 3P75A 4IURA 4WORA 3CU7A 4N9TA 1QILA 2IX3A 2PCFB 1CHPD 5ISRA 1TKWB 3SEBA 3A8JE 1Y8PB 1Y1VB 1UUPA 4DNRB 2D62A 2KEDA 4WFN3 3DWPA 4BS9A 4OO1G 3O13A 1AZQA 5C0XG 4XT1B 4RKBA 1OXTA 1MSHA 4DFAA 3LX0A 2EZVA 3OMCA 5CGKA 3K5NA 5M3FB 5IT9E 1BCPF 3PUVA 4E6IA 1STBA 1SYCA 1ZXTA 2F0GA 3HG9A 1TWGB 2N55A 3EA6A 4G7ZC 3FRPB 5C5MA 4DXGA 1Q3LA 4G7OC 1WCMB 4HSVA 2AQ2B 4PNYA 1D6EC 1EY6A 3DWQA 1A3VA 1LABA 5C6AA 2E2JB 5JPMC 3SE0A 1EZ6A 4C2MB 5CYUA 2K33A 5EJWA 5ELFA 2F0PA 3A54A 2Y0SB 1U4RA 3A8IE 3SK4A 1PRTD 1RF2D 2X69A 3W3AA 3MA2B 1ENCA 5CR3A 3AU7A 2G9HD 5CV6A 3HKZB 4RGNA 1Z7TA 3KF8A 5JOBA 5KYLA 4FF4A 2CHBD 2DN8A 2J4XA 4IUVA 5EBCA 1PRTB 2BCOA 3T53B 5I9PA 4IUPA 2B8FA 5G3LF 2XRSD 2CW0D 4TRDA 1WD1A 3GTMB 3FPUB 1DJRD 4KMUC 1K83B 3OWFA 2F0TA 2K04A 3RD4A 2F0IA 1GHKA 5IGEA 2TSSA 2K5DA 4DAYA 4MIUA 4CJ0B 2IL8A 4OIJA 1PZID 2B2VC 2DY7A 4BWGB 5JEAG 4IZ8A 1CK1A 3MHBA 4EQOA 2KHSA 2Z1CA 1I6HB 4EGVA 3NTKA 4XDXA 2D5DA 2O2LD 1ML0D 1O7ZA 2OXPA 3G6JB 3GTQB 1EU3A 1SNQA 4R8IA 3SK6A 1TY0A 3OHXC 3WOEA 2K05A 5IGDA 1F2YA 1U4MA 4C56C 5I9OA 1R4PB 1LTBD 1DXMA 2F0EA 2PPBC 2A69D 1B9MA 5F2DA 2Q8TA 5I2YA 1XX8A 2RQXA 4N9PA 3CHBD 2K6AA 3SK5A 1HCZA 3S17B 2EXZA 1DYQA 3HGBA 4A3EB 2KEEA 3NTHA 3TZUA 4KKTA 2BOSA 1U4PA 3GD7A 1TWCB 4IUNA 2NVXB 1I4PA 2E2IB 1JOQA 1Z47A 1KLUD 2KOLA 3RZDB 1BDOA 4DF7A 5KNBA 4L6TB 2F3VA 2OF1A 2Q8IB 1CTMA 1ZKOA 3TDQA 3T4AC 3I91A 2BA0A 4DN4M 1KLGD 2KCCA 4J1MA 2RBMA 2AQ1B 4JK1C 1CQVA 2WIIB 3GTJB 3U9OA 5ELCA 3H0GB 1PFMA 2AUJD 1EFID 2B2VA 3V2TA 3HOXB 3GTPB 3E0JA 1EIGA 1G291 4K2LA 1TQOA 1IL8A 1KDCA 2NUCA 1KDBA 2X6LA 2EYJA 5FO8B 2WB1B 2EYFA 5FOBB 1WTRA 1DCZA 3QJYA 4HMIA 2KJXA 3I8ZA 4DAPA 4K5WA 4M1UB 5C4HA 2YYZA 4TSSA 3DWAA 3L7ZC 2VUMB 4DK0A 1L0XB 1TT2A 4ULLA 1HQRD 1JC7A 2ICIA 3KLRA 1PZKD 2NTTA 4H7BA 1NUCA 1Q90A 1VF7A 3SR1A 2F0VA 2CVRA 1XXGA 1WTWA 1BUVT 1RKNA 2LMCB 5DNFA 4XQJA 2R6GA 4RGMA 1FD7D 2PZTA 1SBBB 3IFDA 3K5LA 3NP8A 2MHVA 2XRQD 3OSOA 1VCIA 3IAYA 2L55A 1QG7A 3RZOB 1S5FD 4K6DA 1I4XA 4PQXA 1B53A 1QB5D 1LACA 3TP7A 2J7ZA 1D1IA 1LT6D 5ELEA 1JB3A 1ET9A 3HS0C 2SOBA 1A3TA 3D31A 3T51B 1EY0A 5J1ZA 2V4DA 1L0YB 1GUSA 1LTGD 3K7AB 3S15B 2F0FA 1BR9A 2JP1A 3EJIA 1VF5C 4FXKC 3V05A 1BBXC 5FKAC 3RLFA 3KK7A 3H94A 3ND9A 4F7XA 4K5XA 1SYGA 3I73A 3CQZB 4FP5D 4PMCA 4NDXA 5LL6S 1Q8IA 1IYVA 1X32A 3OMGA 4YIJA 1WTOA 2WINB 2M2LA 3P1HA 1HUNA 1CHQD 3OWEB 4IFDI 4L63B 2EYLA 2B2YA 5FO7B 2JSOA 3MXUA 2A74C 3H6MA 1B1ZA 1PZJD 1D5XC 2A73B 1HFGA 5K5PA 2IWHA 2R61A 2VB3X 1SMYC 1DONA 1K8OA 3BVMA 3MXGA 4ZUIA 3J81E 4XT3B 5ELBA 4HCEA 4C1NI 3VA5A 1M8AA 5CORA 2DNEA 5I2XA 3MWYW 1A2UA 1H9JA 3TP5A 1TIID 1HPCA 2RDHA 3CRLC 3C1FA 1OO9B 3N52A 4HN7A 3K57A 2F1MA 2FMCA 3HP3A 2E75C 2FFKB 2N88A 1HUMA 3PO3B 3QO2A 1TU2B 3ND8A 3BS1A 2PW5A 3DEPA 1SNDA 2BDOA 1A6XA 5HURA 1UAPA 1SNOA 4A3BB 4PMWA 1PTOF 2JE6I 2F4IA 1WD0A 3G7LA 2X6GA 3K5OA 4XTCS 2EE1A 4CJ1B 5KNDA 1TS2A 1QE6A 1TY2A 1FNVA 2EY5A 3P7JA 1EL0A 1WTPA 3GTGB 3Q0AA 4RCNA 1W6KA 5G3LD 3N6RA 4NW2A 4X3KA 1BNZA 3K0YA 2EY2A 4EQPA 2I46A 4CJ2C 3GV3A 1JE4A 3MC0B 2K32A 1R4QB 5IGGA 2D2CC 3HRZC 3S1RB 1RD9D 2LFNA 1JOOA 4KHVA 3BDLA 4U68A 2K01A 3KLSX 4ZRZA 1F9SA 3H91A 2ICEC 1B2TA 3VYSA 3OIPA 5T1GA 2F0WA 1OXVA 5C3WA 1LT5D 3D6CA 1K8MA 4KV6A 3QWNA 3NWTA 4CGYB 1PDQA 3NWSA 1ZEQX 1G91A 2KUMA 4FF3A 4FXGC 4OHJA 5CBAE 5JVH3 4XQNA 5E4XA 2VNUD 2LY7A 1SFOB 2SEBD 2RVLA 2K5QA 2R92B 3JAML 2XSCA 1HHVA 5CV9A 4X3TA 2IT1A 4KKUA 2XVSA 4EQNA 5BN4A 2NN6H 1C8CA 2EJGC 4RGOS 1B9NA 5C3XA 1AN8A 3PUXA 2QKIC 3BYYB 4ZKBB 2JEAI 1CZWA 3ITPA 3NBIA 5DM73 1AZPA 4IUQA 1F2ZA 4C3IB 4KHZA 1H9SA 3K5MA 2IPKD 4XYOA 3R2TA 1F9PA 2QDBA 1GHJA 1QCBD 4WJWA 2K1BA 2VB2X 3TP8A 4I7ZC 2IX1A 3HOWB 1I4HA 1EY5A 1EU4A 2TMPA 5ELDA 4KKSA 3NPPA 3X3MA 4K6LA 1NCVA 3TSSA 3LWEA 1GJXA 1G2TA 1Y8OB 3NBHA 5LL6X 4EVOA 1EZ8A 4C3JB 1SNPA 2R3ZA 3C3LA 1TS4A 3D4DA 2I07B 1SNCA 2B39A 3M3YB 1MBYA 3Q24A 1SMYD 3R2IA 3I72A 1SDFA 1WTXA 3D6WA 1NR4A 2H4OA 2ID0A 1G8ZD 4U673 2SNSA 4KY7A 2MUYA 5J22A 5FO9B 2A6EC 5D65A 2R93B 2JEBI 5DM63 4X3SA 2F0UA 1ZYRC 3H09A 1I50B 2QEJC 2AUKA 1I4QA 4FXDA 4FF2A 3I4LA 3C2PA 3JAME 3MVVA 1OXXK 4QF4A 1MI2A 4RKLA 2G9DA 3MFYA 4S3SA 1X3PA 3R8BA 1RJTA 4UAIA 3VA7A 5KYIA 4AYBB 1SYFA 4V0BA 3GTOB 3HOZB 4I65A 5JVG3 2F0JA 5K36G 2NN6I 1JORA 5EBDA 2MGSA 1E0BA 5EPJA 4LAAA 2WKDA 1F77A 4XQQA 1HA5A 3NXWA 4QMGA 3DEOA 1HFNA 1H9SB 1I6VC 4KY5A 4KK7A 1ENAA 5EPKA 3P20A 2F03A 5A2QL 2L12A 4F88A 1CQFA 5C4ZA 1V1PA 2RKSA 1B3AA 1KDAA 5E1FA 4ABNA 3R93A 2IX0A 1TWFB 3GP7A 4ZQ3A 3MXPA 3QOJA 1NSNS 1LTRD 1PRTF 1BCPC 2Z4IA 3IKJA 5M9OA 1H9KA 1S5ED 3MXNA 1RODA 3C1EA 3S2HB 3Q6SA 1EQVA 3H3VC 1EQTA 4WRDA 1EY9A 4LK1C 5TSSA 1S4ZA 4IQZA 4RAUC 2EYOA 4XIGS 2JA8B 3GTLB 2EVBA 5M5WB 3NSWA 2ZXRA 3QB3A 2PZWA 1ESFA 5I6YA 1C4QA 5DAUA 4NMZA 2M9VA 3NTIA 4Q0FA 4KD4A 1PYWD 4NKLA 1T5EA 2NVYB 4B9WA 1NR2A 4IFDH 4RFBA 1XYIA 4C3HG 3DXJC 4V190 1CA5A 2EY1A 4FF1A 4CKEA 2EJFC 1EEID 2OT2A 2EOTA 3BZDB 3L9AX 3OOCA 4IALA 1JOKA 2B2YC 2WV6D 2QILA 3S14B 3NQTA 2AQ3B 5A2QE 2HUGA 1NAPA 4BA2I 4DAVA 2B2TA 2KECA 2O5JC 2QF7A 1J8IA 1LLRD 4PMBA 1II3A 3OIQA 1HTLD 2L1BA 4QUCA 3J7AF 2MP1A 4F87A 1EYDA 1SYEA 4L8JA 1IKMA 3SK8A 2A68C 4NP5A 5I6WA 3J81L 4OO1H 1KTKA 5CV5A 1EWHA 1Y1WB 2WACA 4HAEA 1GUWA 1BOSA 3ONAB 4PV1C 3BYTB 3WDNA 5JJZA 1F9RA 3UI2A 2JYOA 2A6ED 3OPOA 3T13A 1HA6A 1EY8A 1TS3A 1ZYRD 3VR3A 2F0MA 2HDLA 4CKCA 1A2TA 1D5MC 4IFDJ 3VR5A 1SYBA 5KNCA 3FVQA 4BBSB 2PZUA 3MFGA 1DOKA 2WAQB 2CQAA 5EKIA 3NHHA 4H0LC 3D4WA 1SJHD 3D8GA 3QG1A 1I4RA 2E2HB 4R8NA 1W6JA 3S9WA 4KN4C 5IGFA 3S2DB 3LNNA 3KUPA 2A6HC 5M5XB 1ENFA 1VMPA 2DY8A 1D2BA 4F8MA 1CFMA 1SEBD 1TVXA 4G4KA 1PFNA 3NK9A 4MN3A 3VR4A 2ENBA 4KD3A 3EFXD 2F0SA 5AFWA 3MZ5A 1LTID 1STNA 4DGZA 1STHA 3A55A 3SHLA 5FLXL 5M3MB 5JEAH 1QNKA 1DM0B 4A93B 5CV8A 2F0LA 1A15A 1IKLA 2KQ3A 4DXFA 1JCKB 1BCPD 1CZGA 3TMEA 1ILQA 3URYA 2K28A 2F0HA 3NQIA 4HR7B 3KLSA 4IUUA 1XTCD 2M00A 3FPPA 1Q1EA 2PQEA 1BCPB 4KJNA 3PV0A 2KVMA 4OO1I 1Z6HA 2B8GA 1BO0A 5C0XI 3S1MB 3VR6A 4KY6A 2B63B 5EGTA 3J7AV 5IODA 2Z8LA 2R7ZB 2RDFA 2KCNA 1XWEA 2GA4B 2A5HA 3V96A 4RGTA 2WP8J 1HTPA 1EY4A 3S16B 1YNNC 3C46A 4ID6A 1H9MA 2E74C 3D3RA 1B4OA 4A3KB 1LV9A 1F2LA 1U9RA 4HCSA 3FDTA 4BA1I 4K8JA 3SDZA 1HXYD 1S5BD 4K14A 4RWSC 2HCCA 3QIAA 1X3QA 4H13C 2B2UA 5KEEA 2JA7B 1AFPA 1ONLA 3DUZA 1WVLA 3U9SA 1PXUA 2ZXOA 3I3CA 2C5CA 4RA8A 4IFDG 4IN3A 5JEAJ 1F9QA 4ZYSA 4OL7A 4DA2A 1B44D 4OGQC 5J39A 4M8AA 2B2WA 4B9XA 2RA4A 5FLXE 4MHEA 1I3QB 3DMUA 3TZDA 2XNAC 4JBWA 4UDUC 3PMFA 3BDCA 2A68D 5C5LA 1E2WA 1TWHB 1R9TB 3A8KE 3RUZA 3GTKB 4ODGA 2PNRC 3K6OA 3E6ZX 2AWNA 3FMCA 1H9RA 1UEAB 2EYPA 5CBEE 2NVQB 1VDZA 4QCLA 4FYDA 1FNUA 2O5IC 1O7LA 1FR3A 2NBFA 2IW3A 2E76C 1SAPA 2NTSA 1TS5A 2E2DC 4LMQD 1LTSD 5DEHA 5D14A 2H1EA 1O80A 1BXTA 5KIXA 2RSOA 3SXHA 1CA6A 5IGBA 3PIP3 3F2UA 1GUGA 2PO4A 4KTAA 2AWOA 2FHTA 5C44B 1A3UA 1GXDC 4O42A 2O4XA 3FEWX 3HOUB 1CT1D 4HTHA 3BG3A 1VMCA 5C4JB 5LHY1 4XYQA 4G57A 2A6HD 3SVMA 3I4NB 3PUYA 4ZK9B 3S1QB 4FNFA 3LWUA 1FNWA 2F0QA 2BA1A 2KA7A 5FK9C 1C48A 4CHTB 4RCOA 4HEDA 3OW7A 4C1NK 1KAAA 2XWBB 2BE5C 4RH6A 1STYA 4B08A 2JA6B 3DM1A 1PFBA 2PYKA 3X3NA 1HRJA 2JA5B 1J9OA 1RDPD 1PTOC 4RHSA 1GOZA 5JPNC 4TQUS 5IOCA 5D3IB 3NUCA 2K03A 5EKKA 1DOLA 5BN5A 3GV6A 1F2MA 3Q23A 3MAQA 3E5SA 1YNJC 3ERQA 5IGCA 1SJED 2HDMA 1CM9A 3ZYYX 1YNND 1MSGA 4QIWB 4BY1B 1D5ZC 1AEXA 5CMDA 1SE4A 2IJ0A 4Z9CB 1KABA 4A3DB 3T16A 3I90A 2B2TC 1STGA 3EVQA 1V43A 3M4YA 5IIFA 1STEA 4RHRA 3AMUA 1Q12A 5C3EB 2F0OA 2YU9B 1KNEA 1JWMD 5I4DA 4ZAIA 2NYZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWJ B;  5FO7 B;  4FXK C;  3CU7 A;  1GXD C;  3MA2 B;  3T4A C;  5FO9 B;  2ICE C;  4FXG C;  1D2B A;  2I07 B;  1BUV T;  2QKI C;  1BQQ T;  1UEA B;  2A74 C;  2B39 A;  3L3O C;  1PXU A;  3G6J B;  2TMP A;  2A73 B;  2WIN B;  4ILW A;  2WII B;  3HS0 C;  5JPN C;  3CKI B;  5JPM C;  3OHX C;  5FO8 B;  1XWE A;  1JC7 A;  2XWB B;  3FRP B;  2J0T D;  3I70 A;  1BR9 A;  3V96 A;  1UAP A;  5FOB B;  2E2D C;  1JB3 A;  3HRZ C;  3KLS A;  1OO9 B; 
#chains in the Genus database with same CATH topology
 1XMO Q;  2UU9 L;  1IYU A;  1E3P A;  1HR0 L;  2Q8R E;  1JQY D;  4HJ7 A;  3PO3 G;  5M5Y B;  4KJO A;  1LTA D;  4N8X 1;  2HIV A;  5CV4 A;  5EKL A;  1V9P A;  2ZT9 C;  2FJ2 A;  3M85 A;  3PUW A;  2HQL A;  4A3B G;  4YWM A;  3TRE A;  3W5O A;  2AKW B;  4R9W A;  4A3D H;  4A3I B;  4LF5 L;  3K80 C;  2PMZ E;  2F0D A;  1V8Q A;  5JAV A;  2QA4 A;  2DNC A;  1TWA B;  1HZC A;  3K59 A;  4ILW A;  3AYH B;  4TKO B;  3QR8 A;  5E7N A;  2OEO A;  1TWF H;  1RTN A;  3S1N B;  1LT4 D;  3BVG A;  1SMX A;  1N34 L;  1IW7 C;  4UY8 C;  3M4P A;  3VYT A;  3NE5 B;  5COY A;  1ILP A;  1O78 A;  3I4M B;  3L3O C;  1KNA A;  4JBK A;  1P16 A;  3IL8 A;  2EYH A;  2NN6 G;  5M5Y H;  3MTS A;  4PZ7 A;  1K73 C;  3S2H H;  4O2D A;  4LF9 L;  4JV5 L;  3I70 A;  3WOF A;  3G71 A;  2L4N A;  2XIW A;  1VQP A;  4NXN Q;  5JJK A;  4J6H A;  2D0O A;  4H44 C;  4G7H C;  3AEV A;  3RR5 A;  2MO0 A;  1U4L A;  4K2K A;  3VR2 A;  3Q8D A;  4P72 A;  3GTL H;  1PLF A;  2L0C A;  5M5W H;  1S5C D;  1EYA A;  5E3F A;  1SE2 A;  1OXU A;  2EY6 A;  2L5T A;  1GUO A;  3TBI B;  1DOM A;  2EPB A;  1LTT D;  4BY7 B;  3GO5 A;  1JWU D;  4A3G B;  3W2D A;  1G2S A;  1EUJ A;  5L37 A;  1M1K C;  1Q1B A;  3B6Y A;  1VQ4 A;  4KLK A;  1SYD A;  1T5X D;  3CP0 A;  4X64 Q;  4A3M B;  2HHH Q;  2FMM A;  3S1N H;  1V1P B;  1FJG L;  4O1N A;  2NVY H;  1PH1 A;  2NZ1 D;  1RHP A;  4CBV A;  4RG1 A;  4JI8 Q;  1VQ5 A;  1VQE A;  4DR6 Q;  4K8I A;  1JWS D;  3CMA A;  2R92 G;  5C0X H;  2BE5 D;  4LFC L;  1EYC A;  2F0N A;  1EEF D;  1TR5 A;  1RTO A;  4YWK A;  4DNT B;  2PW7 A;  1B3Q A;  1O7Y A;  4XXE A;  1AW7 A;  5D3D A;  2LKV A;  2XWJ B;  5CC4 A;  2EQS A;  4DV7 L;  2EJM A;  1LT3 D;  1PTO D;  4FVM A;  3S14 H;  3R3O A;  2VY3 A;  3MXN B;  2SDF A;  3PCO B;  3U50 C;  1CI3 M;  1QJO A;  4JVZ A;  1E2V A;  4C3I G;  5JJL A;  3J81 c;  1SE3 A;  3PIO 3;  3PGZ A;  1PTO B;  3CCV A;  4ZKC B;  4P71 A;  4YCV A;  4R4T A;  1GUN A;  1N32 Q;  2UXD L;  4DK1 A;  1QWY A;  1SSO A;  3HOW G;  1EIH A;  1YNJ D;  2C9O A;  4UPA A;  2XN9 C;  2Y0S E;  2QCP X;  4CKB A;  1S72 A;  3D4R A;  2K5W A;  2YTV A;  3PO2 B;  2HT1 A;  4ME5 A;  3A7A B;  5A35 A;  3HKZ E;  1VQF A;  4HJ5 A;  4R4Q A;  1IBM Q;  2CH4 A;  3RN2 A;  1EIY B;  3BDO A;  4BBR B;  2ZXP A;  1Y1W H;  1D1K A;  4QB4 A;  4UP8 A;  4LF8 Q;  1SNM A;  1W2B A;  3RMH A;  1YIJ A;  4HJ8 A;  2B2U C;  1HZB A;  4C3J G;  2L11 A;  1IXR A;  5EPL A;  2OTL A;  4JOI C;  1QOH A;  4Q5V A;  2SNM A;  2Z6B A;  5HGT A;  4HJA A;  3U4Z A;  4EX5 A;  3QOL A;  3T56 B;  1PRT C;  3A56 A;  2BDN A;  2HIX A;  3J80 L;  4HSP A;  4A3J B;  1WTV A;  2FIN B;  4P2C B;  1WFQ A;  4OON A;  4J8Q A;  1JR0 D;  5LMU Q;  3CXC A;  3M7G A;  1QNU A;  5GAH C;  3HEJ A;  4LJZ C;  2MPM A;  2B2W C;  2HCI A;  4DV6 Q;  1M4V A;  1BBU A;  2J0T D;  2I0Q A;  4HIM A;  1PTO H;  5C0X J;  1FYC A;  1ET6 A;  3TN2 A;  4X6A H;  2R93 G;  1NMG A;  4FO2 A;  1VQO A;  1AP0 A;  4DU9 A;  4LFA Q;  2CW0 C;  2UXB L;  5EQ0 A;  4GLA C;  1Y69 U;  2ZJQ A;  1B50 A;  2KEN A;  2RDG A;  4L5T A;  3L0O A;  3CKI B;  4CDC C;  3PO2 H;  1P8L A;  2NB0 A;  4P74 A;  5BN3 A;  4IUT A;  4GOP C;  2UUC Q;  4KN7 C;  4DR3 Q;  5IE8 A;  2HQE A;  4Y7N B;  2VXW A;  4BBR H;  4APV A;  1LUZ A;  2VQE L;  1SRO A;  1BBW A;  4QUF A;  1HQM C;  2DJG C;  3HOV B;  3EN2 A;  1JIC A;  4AYB G;  3BZK A;  1ASY A;  3KBX A;  4X65 Q;  1VQC A;  1YHQ A;  3VYR A;  3HOZ G;  4HMJ A;  5FLX c;  2F0K A;  3M4O B;  3GQB A;  1FGB D;  3Q22 A;  5KGU A;  3A7L A;  4POG A;  4GZY C;  1NTG A;  3FKI B;  2IHF A;  2K14 A;  1KQS A;  3MEH A;  4IPC A;  1EWC A;  3M7N A;  1ESR A;  4UP7 A;  3VYU A;  2N3S A;  4X66 Q;  1GUT A;  1MKH A;  1D8L A;  1Y8N B;  3CRK C;  1EY7 A;  3ERO A;  3AB9 A;  1JE5 A;  1RCV D;  4KI0 A;  5K36 H;  1BQQ T;  4DK6 C;  1EOT A;  1PFS A;  4K5V A;  3TP6 A;  5IT9 L;  4LUV A;  2A69 C;  1VQ9 A;  5M3M H;  1MGS A;  1I94 Q;  1V1O A;  2RSN A;  2Z4H A;  1I4G A;  1RL2 A;  3OYY A;  5CV7 A;  1IW7 D;  2EDG A;  4X62 Q;  4A3F B;  2PMZ B;  5T1I A;  5H1S E;  1YHB A;  2VQF L;  3PUZ A;  4ZUJ A;  5C4X B;  4X3U A;  1DD2 A;  1HNW L;  1G6Z A;  1L2F A;  3KBG A;  4Y7N H;  1WTQ A;  4YHH Q;  1VQM A;  1DZ1 A;  2F3W A;  3HZX A;  2PI2 A;  3J80 E;  1ICW A;  1SXT A;  4K0K L;  1IHZ A;  1XPR A;  5KRU A;  4OIK A;  2WKC A;  4ZLT F;  3K58 A;  3IFT A;  5E4W C;  3HOY B;  1MD2 D;  3J7Y W;  1S5D D;  1LO5 D;  1PMR A;  3M4O H;  2MJ8 A;  4LFB L;  2D9U A;  1XPO A;  2L9H A;  1BF4 A;  2R7Z H;  3H3V H;  4JPB W;  4IJH A;  5NUC A;  4LF6 Q;  2NWG A;  4JI0 L;  1OXS C;  1I5F A;  1X6O A;  4C3H B;  2EYM A;  1HNZ L;  2LS0 1;  4KHP L;  2NVT B;  1G51 A;  3DHQ A;  1E2Z A;  1FL0 A;  1NNX A;  2ES2 A;  2K7V A;  2JA8 G;  3EQL C;  1STA A;  1UNS A;  2JXM B;  3RLO A;  3UDF A;  5GAG C;  2BH8 A;  2JN4 A;  3BVZ A;  2ZTE A;  2WB1 E;  3P75 A;  4IUR A;  4WOR A;  3CU7 A;  4N9T A;  4A3F H;  4JC0 A;  1QIL A;  5FLM G;  2IX3 A;  2PCF B;  1CHP D;  5ISR A;  2MO1 A;  2E5L Q;  5LMN W;  1TKW B;  3SEB A;  3A8J E;  1Y8P B;  1Y1V B;  4DUY Q;  1UUP A;  4P75 A;  1CKN B;  4MTN A;  3T1H Q;  4DNR B;  4YCU A;  2D62 A;  2KED A;  3F1Z A;  4WFN 3;  4DV1 Q;  3DWP A;  3STB C;  4BS9 A;  3A5Z B;  2UXC Q;  4OO1 G;  3HOY H;  4GNX A;  3M9B A;  3O13 A;  1AZQ A;  5C0X G;  4XT1 B;  1J6Q A;  4RKB A;  1IBL Q;  1OXT A;  1MSH A;  4DFA A;  3LX0 A;  4IPG A;  2EZV A;  2UUB L;  3OMC A;  1X56 A;  5CGK A;  3K5N A;  5M3F B;  5IT9 E;  1BCP F;  4L5S A;  3PUV A;  4E6I A;  1STB A;  1SYC A;  1ZXT A;  2F0G A;  1VQ6 A;  3HG9 A;  1TWG B;  4C3H H;  2N55 A;  3EA6 A;  4G7Z C;  3FRP B;  5C5M A;  4DXG A;  4B3R L;  1Q3L A;  2ZTC A;  4G7O C;  5IYD G;  4NXM Q;  1WCM B;  2ATW A;  1Q46 A;  4HSV A;  2AQ2 B;  4DV0 L;  4B3T Q;  4PNY A;  1D6E C;  1EY6 A;  3DWQ A;  3GTK H;  1A3V A;  1LAB A;  4UP9 A;  5C6A A;  2E2J B;  1XMQ L;  2RF4 A;  1UWV A;  4JI4 L;  5JPM C;  3SE0 A;  1EZ6 A;  4C2M B;  1HNX L;  1KAW A;  5CYU A;  2K33 A;  5BR8 Q;  1Y1V H;  2JQO A;  4GKJ Q;  5EJW A;  5ELF A;  2F0P A;  3A54 A;  2Y0S B;  1U4R A;  3A8I E;  3SK4 A;  1PRT D;  1RF2 D;  1S40 A;  2X69 A;  3W3A A;  3MA2 B;  1VQH A;  1ENC A;  2R7D A;  5CR3 A;  5IYC H;  3AU7 A;  2G9H D;  5CV6 A;  1N36 Q;  3HKZ B;  1Y1W G;  4RGN A;  3K81 C;  4I7A A;  1Z7T A;  3KF8 A;  5JOB A;  5KYL A;  4FF4 A;  2CHB D;  2DN8 A;  2J4X A;  4IUV A;  5EBC A;  1PRT B;  1CKO A;  4DR1 L;  2BCO A;  3T53 B;  5I9P A;  2KCM A;  4IUP A;  1TWG H;  2B8F A;  5G3L F;  3JAM i;  2XRS D;  3L2P A;  2CW0 D;  4TRD A;  2ZTD A;  1WD1 A;  4LF7 Q;  3GTM B;  3FPU B;  1DJR D;  4KMU C;  1K83 B;  3OWF A;  2F0T A;  2K04 A;  3RD4 A;  2F0I A;  1GHK A;  1WCM H;  5IGE A;  2TSS A;  2GVA A;  1CUK A;  2K5D A;  4DAY A;  4MIU A;  4DV4 Q;  4CJ0 B;  4DR5 Q;  2IL8 A;  4QJF A;  4BBS G;  3ERS X;  4OIJ A;  5GAD C;  1PZI D;  2B2V C;  2DY7 A;  3JC6 6;  2E2J H;  3HOU H;  1X3G A;  4BWG B;  5JEA G;  5IWA Q;  4IZ8 A;  1CK1 A;  2WAQ G;  3MHB A;  4EQO A;  3CPW A;  4C2M H;  2KHS A;  2Z1C A;  4GOP B;  5C4J H;  1I6H B;  1HR0 Q;  4EGV A;  3I4N H;  1YZ6 A;  3NTK A;  4XDX A;  2D5D A;  2O2L D;  1ML0 D;  1O7Z A;  2OXP A;  3G6J B;  3GTQ B;  1EU3 A;  3AFP A;  1SNQ A;  4R8I A;  3SK6 A;  1TY0 A;  3OHX C;  4P73 A;  3WOE A;  1WYD A;  2K05 A;  3MEF A;  5AJ3 Q;  5IGD A;  1F2Y A;  1U4M A;  4C56 C;  5I9O A;  4HID A;  1R4P B;  1LTB D;  1DXM A;  2F0E A;  2PPB C;  1UEB A;  2A69 D;  1SR3 A;  3TRZ A;  1B9M A;  5F2D A;  3GTM H;  2N78 A;  3RLN A;  2Q8T A;  1K83 H;  5I2Y A;  4B3M L;  3G6E A;  1XX8 A;  2RQX A;  4N9P A;  2JA5 H;  1QZH A;  2XTI A;  3CHB D;  2K6A A;  3SK5 A;  1HCZ A;  2VW9 A;  3S17 B;  2EXZ A;  4DK3 C;  1N34 Q;  1DYQ A;  2OTJ A;  3HGB A;  4A3E B;  2KEE A;  5M3M G;  1K3B C;  1MIU A;  3NTH A;  3TZU A;  4A93 G;  1B8A A;  4KKT A;  2BOS A;  1U4P A;  3GD7 A;  5DLQ E;  1TWC B;  4IUN A;  2NVX B;  1EOV A;  2K5N A;  1I4P A;  1I6H H;  1Q8K A;  2E2I B;  1JOQ A;  1Z47 A;  1KLU D;  2KOL A;  4R4C A;  3RZD B;  1BDO A;  4DF7 A;  2MNA A;  3GTQ H;  5KNB A;  4LF9 Q;  4L6T B;  4JV5 Q;  2F3V A;  2OF1 A;  2Q8I B;  1CTM A;  1ZKO A;  3TDQ A;  1X65 A;  4JI5 L;  1UE6 A;  3T4A C;  3I91 A;  2BA0 A;  1KIX A;  5FJ8 H;  4DN4 M;  1KLG D;  2KCC A;  4J1M A;  2B63 G;  2RBM A;  4LNQ A;  2AQ1 B;  4JK1 C;  1CQV A;  2WII B;  3GTJ B;  4BY1 H;  1RIP A;  4DNI A;  3U4V A;  3U9O A;  5ELC A;  3H0G B;  1PFM A;  1K8A C;  5IYB H;  1YHA A;  4JI7 L;  2AUJ D;  1EFI D;  2B2V A;  3V2T A;  3HOX B;  4MZ9 A;  3GTP B;  3S17 H;  3E0J A;  4A3K G;  3FP9 A;  1EIG A;  4A3E H;  1G29 1;  4K2L A;  1TQO A;  1IL8 A;  4B3S L;  1Q7Y C;  1KDC A;  2NUC A;  1KDB A;  2X6L A;  3STB D;  2NVX H;  3ULL A;  2EYJ A;  5FO8 B;  2WB1 B;  2EYF A;  2ZM6 L;  1OTC A;  2KHJ A;  5FOB B;  3RZD H;  1WTR A;  2I5L X;  1DCZ A;  5C3E H;  3U58 A;  4DV3 Q;  2YU9 H;  4DV7 Q;  2JA7 G;  3QJY A;  4HMI A;  4RMF A;  2KJX A;  3I8Z A;  4DAP A;  4K5W A;  3CF5 A;  4M1U B;  1K3R A;  2YYZ A;  4TSS A;  5C4H A;  3DWA A;  1YEZ A;  3L7Z C;  2VUM B;  4DK0 A;  1L0X B;  1TT2 A;  4JG2 A;  4ULL A;  1HQR D;  1JC7 A;  2ICI A;  3KLR A;  1PZK D;  2NTT A;  4H7B A;  1NUC A;  1Q90 A;  1VF7 A;  3SR1 A;  2UXD Q;  2F0V A;  3CW2 C;  2CVR A;  1XXG A;  4QQB X;  1WTW A;  1BUV T;  1RKN A;  2LMC B;  1N33 L;  2MQH A;  5DNF A;  3HOX H;  5J3B A;  4XQJ A;  2R6G A;  3FHW A;  4A3I H;  2IHE A;  1LTL A;  1JT8 A;  4JI1 L;  4RGM A;  5GRO A;  1FD7 D;  1HH2 P;  1TWA H;  3G4S A;  2PZT A;  1SBB B;  4OXP A;  1CKM A;  4PZ6 A;  3IFD A;  3K5L A;  3NP8 A;  2MHV A;  2XRQ D;  3OSO A;  1VCI A;  3IAY A;  4A3C H;  2L55 A;  1QG7 A;  3RZO B;  3KYH C;  1E24 A;  1QZG A;  3H15 A;  1S5F D;  4FDB A;  3AFQ A;  1KRT A;  4K6D A;  1I4X A;  4PQX A;  1B53 A;  3DM3 A;  1QB5 D;  1LAC A;  1HR0 W;  3TP7 A;  2J7Z A;  3I4M H;  1D1I A;  2VUM H;  1C7Y A;  1LT6 D;  5ELE A;  1JB3 A;  1ET9 A;  3HS0 C;  3KJO A;  4LF4 L;  2SOB A;  1A3T A;  3D31 A;  1YI2 A;  2DGY A;  2KCT A;  3CAM A;  3T51 B;  1EY0 A;  5J1Z A;  2UXB Q;  2V4D A;  2CCZ A;  2GN5 A;  3KDF A;  1L0Y B;  1GUS A;  5IY0 A;  1LTG D;  3K7A B;  3S15 B;  2F0F A;  1BR9 A;  1VQA A;  5C44 G;  3A0J A;  2JP1 A;  3OTO L;  3EJI A;  2VQE Q;  5IP9 G;  1VF5 C;  4BY7 H;  4FXK C;  4A3G H;  2R7F A;  3V05 A;  1BBX C;  1JMC A;  5FKA C;  1X3F A;  3RLF A;  3HOU G;  1K0S A;  3KK7 A;  4A3M H;  4GN3 B;  3H94 A;  3ND9 A;  4DUZ L;  4F7X A;  4K5X A;  1YJW A;  3RZO H;  1SYG A;  2PI2 E;  3I73 A;  3CQZ B;  4FP5 D;  4PMC A;  1S3O A;  4NDX A;  3I4N G;  1NBW A;  1Q86 C;  5LL6 S;  1K9M C;  2BH2 A;  1Q8I A;  2ALY B;  1IYV A;  1X32 A;  3OMG A;  1V1Q A;  4YIJ A;  1WTO A;  1A8V A;  2WIN B;  4HIK A;  2M2L A;  3P1H A;  3J81 i;  2CQO A;  4MNO A;  2A1A A;  1HUN A;  1CHQ D;  3OWE B;  4DV2 L;  4IFD I;  4L63 B;  4X64 L;  2JA6 G;  2EYL A;  2B2Y A;  2VQF Q;  3K7A H;  5FO7 B;  4A75 A;  3S15 H;  1HNW Q;  1SRU A;  3K0X A;  2JA5 G;  3E9I A;  2JSO A;  3MXU A;  4DR6 L;  2A74 C;  3H6M A;  1B1Z A;  1PZJ D;  1D5X C;  2A73 B;  4JI2 L;  2Q2T A;  2CWA A;  2Z6K A;  1HFG A;  1TXY A;  5K5P A;  2IWH A;  2R61 A;  1FVI A;  3UE1 A;  2VB3 X;  4LFB Q;  1SMY C;  1E1T A;  4OX9 L;  1PH8 A;  1DON A;  1K8O A;  3S24 A;  3BVM A;  3MXG A;  4ZUI A;  3J81 E;  4ME3 A;  4XT3 B;  5ELB A;  4HCE A;  3ER0 A;  4JI0 Q;  4C1N I;  3VA5 A;  1SLJ A;  1C9O A;  3RNU A;  1HNZ Q;  1M8A A;  4KHP Q;  5COR A;  2DNE A;  5I2X A;  3MWY W;  1A2U A;  4DV5 L;  4LW1 A;  1H9J A;  3TP5 A;  1TII D;  4AYB E;  4A3J H;  1HPC A;  2RDH A;  4GNX C;  5FJ8 G;  3CRL C;  1VQI A;  5LMN L;  3C1F A;  3CC2 A;  4JYA L;  1OO9 B;  3N52 A;  1N32 L;  2D0P A;  4HN7 A;  3K57 A;  2F1M A;  2FMC A;  4A3L H;  3HP3 A;  2E75 C;  1YJN A;  2FFK B;  1MJC A;  2N88 A;  1X54 A;  1HUM A;  3PO3 B;  3QO2 A;  1TU2 B;  2VS1 A;  1IBM L;  3ND8 A;  3BS1 A;  4A3D G;  2AHO B;  2K75 A;  2PW5 A;  3DEP A;  1SND A;  2BDO A;  1A6X A;  5HUR A;  2RCN A;  1UAP A;  1SNO A;  4A3B B;  4PMW A;  1PTO F;  2JE6 I;  1KXL A;  2F4I A;  4AH6 A;  1WD0 A;  4QGU A;  3G7L A;  2X6G A;  1ASZ A;  3K5O A;  4XTC S;  2EE1 A;  4CJ1 B;  5KND A;  1TS2 A;  1QE6 A;  1TY2 A;  4J15 A;  1X9N A;  3HOV H;  1VQL A;  1FNV A;  2EY5 A;  3P7J A;  1EL0 A;  4JCV E;  1WTP A;  1EQQ A;  3GTG B;  3Q0A A;  4RCN A;  4DR4 L;  4B3R Q;  1W6K A;  2PQA A;  3FKI H;  5G3L D;  3N6R A;  3KF6 A;  4NW2 A;  2QDL A;  4H02 A;  4X3K A;  4LFA L;  1BNZ A;  3K0Y A;  4DV0 Q;  1BKB A;  2EY2 A;  4EQP A;  2NZO A;  2I46 A;  4CJ2 C;  4DPG A;  1XMQ Q;  3GV3 A;  1JE4 A;  2OQ0 A;  2Z9H A;  2QW7 A;  4JI4 Q;  3MC0 B;  1X55 A;  4ZCK A;  1HNX Q;  5JJI A;  2K32 A;  1O7I A;  4OWX B;  1R4Q B;  3CCE A;  5IGG A;  2D2C C;  1EQR A;  2HD3 A;  1L0W A;  4LUO A;  3HRZ C;  3CCU A;  3TEH B;  4A3I G;  3S1R B;  1RD9 D;  2LFN A;  1JOO A;  4KHV A;  3BDL A;  4U68 A;  2AMC B;  2K01 A;  3KLS X;  4ZRZ A;  1F9S A;  3H91 A;  4A3B H;  2ICE C;  3UE0 A;  1B2T A;  3VYS A;  5C4X H;  3OIP A;  5T1G A;  2F0W A;  1OXV A;  5C3W A;  4YY3 L;  1LT5 D;  3D6C A;  1K8M A;  4KV6 A;  4A3C G;  3QWN A;  1B70 B;  3NWT A;  4CGY B;  4O0A A;  3GTG H;  1NMF A;  1PDQ A;  2E8G A;  3NWS A;  1ZEQ X;  3I4M G;  1G91 A;  2KUM A;  4FF3 A;  4FXG C;  1XNQ L;  2KHI A;  4OHJ A;  5CBA E;  5ELN A;  5JVH 3;  3UDI A;  1JJ2 A;  4XQN A;  5E4X A;  2VNU D;  2LY7 A;  1SFO B;  4AQY L;  2SEB D;  2RVL A;  3W1G A;  3G48 A;  2K5Q A;  3CCQ A;  2R92 B;  3JAM L;  2XSC A;  2YTY A;  1HHV A;  5CV9 A;  4X3T A;  2NVT H;  2IT1 A;  4EQ5 A;  4KKU A;  2XVS A;  4EQN A;  5BN4 A;  2NN6 H;  2ZJP A;  1HZ9 A;  1VQD A;  1C8C A;  2EJG C;  4RGO S;  1B9N A;  4YHH L;  5C3X A;  1AN8 A;  3PUX A;  2QKI C;  3BYY B;  3ICE A;  4ZKB B;  2JA9 A;  2JEA I;  1ICF B;  2F4V Q;  5HGQ A;  1CZW A;  3ITP A;  3A5U A;  3NBI A;  5GQO A;  5DM7 3;  1AZP A;  4IUQ A;  1F2Z A;  4C3I B;  4KHZ A;  4BY7 G;  1H9S A;  4LUZ A;  2CFM A;  3K5M A;  4A3G G;  2IPK D;  4GLV B;  1GKH A;  3R2T A;  4XYO A;  1F9P A;  2QDB A;  3J7Z C;  1GHJ A;  4A3M G;  1QCB D;  4WJW A;  2K1B A;  2VB2 X;  5EAY A;  4LF6 L;  3TP8 A;  4I7Z C;  2IX1 A;  3HOW B;  1I4H A;  1EY5 A;  1EU4 A;  2TMP A;  5ELD A;  1K0R A;  4KKS A;  4B3M Q;  4QY7 A;  1NJI C;  3NPP A;  1J5E Q;  3E0E A;  4PG3 A;  3X3M A;  4CDE C;  5M3F H;  4K6L A;  1NCV A;  3TSS A;  1SFO H;  3LWE A;  1GJX A;  1G2T A;  1Y8O B;  3NBH A;  2KBN A;  5LL6 X;  2R92 H;  4EVO A;  1EZ8 A;  4GN5 A;  4C3J B;  3UDG A;  1SNP A;  2R3Z A;  3C3L A;  1TS4 A;  3D4D A;  2I07 B;  2E5L L;  1SNC A;  2N49 A;  1AE2 A;  2B39 A;  1MHW C;  3M3Y B;  2UUA L;  1MBY A;  3Q24 A;  1SMY D;  3R2I A;  5IP7 H;  1VQ7 A;  3I72 A;  1KC8 C;  1SDF A;  1WTX A;  3D6W A;  1NR4 A;  2H4O A;  2ID0 A;  1G8Z D;  2UXC L;  4C3I H;  4U67 3;  2SNS A;  3UDX A;  1XNR L;  4KY7 A;  2MUY A;  2RHS B;  4JI5 Q;  5J22 A;  2UU9 Q;  5FO9 B;  2A6E C;  5D65 A;  2R93 B;  2LXJ A;  2WAQ E;  3PO2 G;  2JEB I;  1IZ6 A;  5DM6 3;  4X3S A;  1VS0 A;  1PA6 A;  2F0U A;  3H09 A;  1ZYR C;  1I50 B;  2QEJ C;  3HKS A;  2AUK A;  1I4Q A;  4FXD A;  4FF2 A;  1VQJ A;  1VQG A;  3I4L A;  3C2P A;  3HOW H;  4BBR G;  4R4O A;  3CCJ A;  3JAM E;  2CWP A;  3MVV A;  4CDD C;  1OXX K;  4JI7 Q;  3E9H A;  4QF4 A;  1MI2 A;  4GNX B;  4RKL A;  4NXM L;  2G9D A;  3MFY A;  4S3S A;  4LF5 Q;  1X3P A;  4A3J G;  3R8B A;  1RJT A;  4UAI A;  1PHJ A;  3VA7 A;  4C3J H;  1PH6 A;  5KYI A;  4AYB B;  1SYF A;  4B3S Q;  4V0B A;  3GTO B;  3HOZ B;  3OW2 A;  4I65 A;  5JVG 3;  1W3S A;  1PH2 A;  2DUD A;  3M3Y H;  2F0J A;  2ZM6 Q;  2LXK A;  2NN6 I;  2C35 B;  5K36 G;  1JOR A;  5EBD A;  2MGS A;  3DLL A;  4JI6 L;  1E0B A;  1HJP A;  1H95 A;  1YVC A;  5EPJ A;  4LAA A;  2WKD A;  1F77 A;  4XQQ A;  4DR7 L;  1HA5 A;  3NXW A;  1L1O C;  4QMG A;  3DEO A;  1HFN A;  1H9S B;  2K5H A;  1I6V C;  4KY5 A;  4KK7 A;  1YBY A;  4IO9 A;  1T9H A;  4JI3 L;  1ENA A;  5EPK A;  3P20 A;  2F03 A;  1E1O A;  5A2Q L;  2L12 A;  1D7Q A;  4F88 A;  3HOV G;  1CQF A;  1U5K A;  5C4Z A;  1V1P A;  2RKS A;  1B3A A;  1WI5 A;  3J81 j;  4YCW A;  1KDA A;  5E1F A;  1N33 Q;  4ABN A;  3R93 A;  3KF8 B;  1PH4 A;  2IX0 A;  1TWF B;  4DV4 L;  3GP7 A;  3CPF A;  4DR5 L;  4ZQ3 A;  2F3I A;  3FKI G;  3MXP A;  3QOJ A;  2R7Z G;  4JI1 Q;  2Z0S A;  1NSN S;  1LTR D;  1PRT F;  3HOZ H;  1BCP C;  2Z4I A;  3IKJ A;  2VZA A;  5M9O A;  1H9K A;  1S5E D;  3MXN A;  1ROD A;  1FJG Q;  3C1E A;  3S2H B;  3Q6S A;  2RCF A;  1EQV A;  2OWO A;  3H3V C;  1EQT A;  4WRD A;  4DAY B;  1IBK L;  1EY9 A;  1TWC H;  4LK1 C;  4LFC Q;  5TSS A;  1S4Z A;  4IQZ A;  4A3F G;  5AJ3 L;  4RAU C;  2EYO A;  4XIG S;  1PV4 A;  2E2I H;  5C4X G;  1KL9 A;  2JA8 B;  1IYJ B;  3GTL B;  1LM0 A;  2EVB A;  5M5W B;  3NSW A;  2ZXR A;  3QB3 A;  4YWL A;  4LF4 Q;  2PZW A;  4JBM A;  2FXQ A;  3TS2 A;  3WWV A;  1Q81 C;  4JW0 A;  1ESF A;  5I6Y A;  1C4Q A;  5DAU A;  1X3E A;  2CH4 W;  3HOY G;  4NMZ A;  2M9V A;  2I5M X;  3NTI A;  3PIO A;  4Q0F A;  4KD4 A;  3T1Y L;  1PYW D;  4NKL A;  2XGT A;  1T5E A;  3VDY A;  2NVY B;  4GKK L;  3I2Z A;  3GTJ H;  4R4I A;  3EBE A;  4B9W A;  1NR2 A;  4IFD H;  3OTO Q;  4RFB A;  3J7A 5;  1XYI A;  3H0G H;  4QL5 A;  4C3H G;  3DXJ C;  4V19 0;  1CA5 A;  2EY1 A;  4FF1 A;  4CKE A;  3GTP H;  4DUZ Q;  4N8F A;  2EJF C;  1EEI D;  4DR2 L;  2OT2 A;  2EOT A;  3BZD B;  3L9A X;  3OOC A;  3PF5 A;  4IAL A;  1L1O A;  1JOK A;  2NZH A;  2B2Y C;  2WV6 D;  2VL6 A;  2QIL A;  4A76 A;  3NQT A;  2AQ3 B;  5A2Q E;  3S14 B;  2HUG A;  1NAP A;  4UHV A;  4BA2 I;  1XMO L;  4DAV A;  2B2T A;  4IOC A;  2KEC A;  2JA8 H;  2O5J C;  1LYL A;  1B7Y B;  2QF7 A;  1J8I A;  1LLR D;  4PMB A;  1II3 A;  3F2B A;  2K5V A;  3I55 A;  1Y1V G;  2Z6K C;  1E22 A;  1HTL D;  2L1B A;  3OIQ A;  4QUC A;  3J7A F;  2MP1 A;  5FLM H;  4F87 A;  1EYD A;  1YJ9 A;  5IYC G;  1HZA A;  1SYE A;  4DV2 Q;  1AH9 A;  4L8J A;  1IKM A;  1QVF A;  3IRB A;  4IPH A;  3SK8 A;  2A68 C;  4NP5 A;  1KD1 C;  5I6W A;  2F52 A;  1KHI A;  3I56 A;  3J81 L;  5M3F G;  3CCR A;  4OO1 H;  1KTK A;  5CV5 A;  1EWH A;  1XTD A;  1Y1W B;  4ALP A;  1EWI A;  2WAC A;  4HAE A;  1GUW A;  3BU2 A;  4JI2 Q;  1BOS A;  3ONA B;  4WJ4 A;  4PV1 C;  3BYT B;  3WDN A;  5JJZ A;  1F9R A;  4OX9 Q;  3UI2 A;  3TQY A;  2JYO A;  4DV3 L;  2A6E D;  3OPO A;  1WCM G;  3K7U C;  3T13 A;  3W1B A;  1HA6 A;  5IP7 G;  1EY8 A;  1TS3 A;  1ZYR D;  3VR3 A;  3NEL A;  2F0M A;  1JB7 A;  2HDL A;  4CKC A;  1UE5 A;  1A2T A;  1D5M C;  4MTK A;  1A62 A;  4IFD J;  5IYD H;  3BJU A;  3VR5 A;  5ELO A;  4DV5 Q;  1SYB A;  5KNC A;  3FVQ A;  4BBS B;  2PZU A;  2LSS A;  2Y0S G;  3ZJY C;  5LMN Q;  4NXN L;  3KLW A;  3MFG A;  4JYA Q;  1DOK A;  4GLX A;  2WAQ B;  1WOC A;  2CQA A;  5EKI A;  3HKZ G;  3NHH A;  4WJ3 M;  4H0L C;  3D4W A;  4GN4 B;  1SJH D;  3D8G A;  2G5D A;  3QG1 A;  3PSI A;  1I4R A;  1Q82 C;  4IPD A;  2E2H B;  4R8N A;  2DJF C;  1W6J A;  3S9W A;  2CKZ B;  4HJ9 A;  4KN4 C;  5IGF A;  3TS0 A;  3S2D B;  3KFU A;  3LNN A;  4PZ8 A;  2HHH L;  3KUP A;  2A6H C;  5M5X B;  3CCM A;  4OWW B;  1ENF A;  1VMP A;  2DY8 A;  2N8N A;  4JI8 L;  1D2B A;  2OQK A;  4F8M A;  4K0K Q;  1CFM A;  1A0I A;  1SEB D;  1TVX A;  2Q2H A;  4G4K A;  1PFN A;  3NK9 A;  4MN3 A;  3VR4 A;  2ENB A;  1PH7 A;  2RHQ B;  1L1O B;  2EXD A;  3J80 c;  2ZJR A;  4KD3 A;  1JJG A;  4DR4 Q;  3EFX D;  2F0S A;  5AFW A;  3MZ5 A;  1LTI D;  4BBS H;  1STN A;  3CQZ H;  3CC4 A;  4DGZ A;  3I7F A;  3GDE A;  1XPU A;  1STH A;  3A55 A;  3SHL A;  5FLX L;  5M3M B;  5JEA H;  1QNK A;  1DM0 B;  1C0A A;  4A93 B;  1VQK A;  5CV8 A;  2F0L A;  1A15 A;  1IKL A;  1Y14 B;  2KQ3 A;  3F2C A;  1CKN A;  4DXF A;  1JCK B;  1BCP D;  1CZG A;  2MFI A;  1YIT A;  3TME A;  1ILQ A;  2E2H H;  3URY A;  2K28 A;  2F0H A;  3NQI A;  4HR7 B;  2WFW A;  3KLS A;  1N9W A;  4IUU A;  1XTC D;  2M00 A;  3EIV A;  3FPP A;  3S2D H;  1Q1E A;  2PQE A;  1BCP B;  4KJN A;  3PV0 A;  4OEM B;  2KVM A;  4OO1 I;  4BY1 G;  2P5Z X;  1VQB A;  1Z6H A;  4HIO A;  2B8G A;  1BO0 A;  1PYB A;  5C0X I;  1EIF A;  5M5X H;  4QIW E;  3S1M B;  3VR6 A;  5IYB G;  4KY6 A;  4YY3 Q;  2GVB A;  2B63 B;  1YNX A;  3KDF B;  5EGT A;  3J7A V;  5IOD A;  2Z8L A;  2EIF A;  3J80 i;  1GO3 E;  4BXX H;  2R7Z B;  3ULJ A;  2RDF A;  2KCN A;  1XWE A;  4LF8 L;  2GA4 B;  2A5H A;  3V96 A;  1JJC B;  4A3E G;  4RGT A;  2WP8 J;  1HTP A;  1EY4 A;  3S16 B;  1YNN C;  3C46 A;  4ID6 A;  1H9M A;  2E74 C;  3D3R A;  1DGS A;  1XNQ Q;  1B4O A;  3NEM A;  4A3K B;  1LV9 A;  1F2L A;  1U9R A;  2UUB Q;  4HCS A;  5LMU L;  3FDT A;  4BA1 I;  5C3E G;  4K8J A;  4AQY Q;  4A93 H;  1MJE A;  3SDZ A;  1HXY D;  2PNH A;  4DV6 L;  1S5B D;  1UE1 A;  3PIP A;  4K14 A;  4RWS C;  2HCC A;  5IT9 c;  3QIA A;  1FGU A;  1X3Q A;  4H13 C;  2B2U A;  5KEE A;  2JA7 B;  4JOI A;  1AFP A;  1ONL A;  3DUZ A;  1WVL A;  2OCE A;  3U9S A;  1PXU A;  2ZXO A;  3I3C A;  4IJL A;  2C5C A;  2K52 A;  4RA8 A;  4IFD G;  4IN3 A;  5JEA J;  1F9Q A;  4ZYS A;  3H0G G;  4OL7 A;  3S1M H;  4DA2 A;  3PO3 H;  1UE7 A;  2UUC L;  4DR3 L;  2B63 H;  1B44 D;  4POF A;  4OGQ C;  5J39 A;  4M8A A;  1VQN A;  3HOX G;  3PF4 A;  2B2W A;  4B9X A;  2RA4 A;  3PQI A;  1GM5 A;  3CCS A;  5FLX E;  3HFZ B;  1PH9 A;  4MHE A;  4X65 L;  1PYS B;  3SGI A;  3CD6 A;  1E7Z A;  1I3Q B;  3S16 H;  1SE8 A;  1CSP A;  3DMU A;  3TZD A;  2XNA C;  2WB1 G;  4JBW A;  4A3K H;  4UDU C;  3PMF A;  4DAM A;  4DR1 Q;  3BDC A;  2A68 D;  5C5L A;  4LWC A;  5HY6 A;  1E2W A;  1TWH B;  4X66 L;  1R9T B;  3A8K E;  3RUZ A;  4GOP A;  3GTK B;  1Z9F A;  4ODG A;  2PNR C;  3K6O A;  3E6Z X;  4L5Q A;  2AWN A;  3FMC A;  1H9R A;  1UEA B;  2K4K A;  2VUM G;  3KOJ A;  2EYP A;  5CBE E;  2YTX A;  2NVQ B;  1VDZ A;  4QCL A;  2JA7 H;  2UUA Q;  4FYD A;  1I94 L;  1FNU A;  2O5I C;  2Q2I A;  1PH5 A;  1O7L A;  4DKA C;  1FR3 A;  2NBF A;  3BZC A;  4X62 L;  2IW3 A;  2NTS A;  2E76 C;  1SAP A;  2L15 A;  1TS5 A;  2E2D C;  1AE3 A;  4LMQ D;  1LTS D;  1XNR Q;  5DEH A;  3NEN A;  4R1J A;  5D14 A;  3KJP A;  2H1E A;  1K28 A;  1O80 A;  1WJJ A;  1BXT A;  1M90 C;  3S1R H;  5KIX A;  2RSO A;  3SXH A;  1CA6 A;  1I3Q H;  5IGB A;  3PIP 3;  3F2U A;  3F8T A;  1GUG A;  1U0L A;  5GAE C;  2PO4 A;  4KTA A;  4NB3 A;  2AWO A;  2FHT A;  5C44 B;  3JAM c;  2IY5 B;  1QUQ A;  3E3X A;  4GS3 A;  1A3U A;  1GXD C;  2K50 A;  4O42 A;  1TWH H;  1R9T H;  2O4X A;  3LGJ A;  2B29 A;  3CME A;  3FEW X;  2YV5 A;  3HOU B;  2ASB A;  4IOA A;  1CT1 D;  4HTH A;  3BG3 A;  1VMC A;  2NVQ H;  5C4J B;  1SN8 A;  5LHY 1;  4XYQ A;  4G57 A;  3M4Q A;  2A6H D;  3SVM A;  3I4N B;  3PUY A;  4ZK9 B;  3S1Q B;  1PVO A;  4FNF A;  3LWU A;  1FNW A;  3CCL A;  1NY4 A;  2PQA B;  1IL2 A;  2F0Q A;  4JI6 Q;  2BA1 A;  3KF6 B;  2KA7 A;  5FK9 C;  1C48 A;  3D0F A;  4CHT B;  1GD7 A;  4Y52 H;  4DR7 Q;  4RCO A;  4DUY L;  1PH3 A;  3T1H L;  1GVP A;  1G6P A;  2B3G A;  4DV1 L;  1WTH A;  4HED A;  3OW7 A;  4C1N K;  4JI3 Q;  1KAA A;  2XWB B;  2BE5 C;  1CSQ A;  3H3V I;  2JK8 A;  4RH6 A;  2H5X A;  1STY A;  3I4O A;  4B08 A;  3K8A A;  4AIM A;  2JA6 B;  3DM1 A;  1PFB A;  2PYK A;  1IBL L;  4CDF C;  3X3N A;  4TVA B;  5C44 H;  1HRJ A;  1NE3 A;  2JA5 B;  1J9O A;  1VQ8 A;  1RDP D;  5IP9 H;  1PTO C;  2A8V A;  4RHS A;  1GOZ A;  4OWT B;  2JJQ A;  5JPN C;  4TQU S;  5IOC A;  5D3I B;  3NUC A;  3RN5 A;  2K03 A;  5EKK A;  1DOL A;  4L5R C;  5BN5 A;  3GV6 A;  1F2M A;  2A19 A;  3Q23 A;  4NPS A;  3A74 A;  3MAQ A;  3S1Q H;  4B3T L;  3CC7 A;  2F4V L;  3E5S A;  2QEX A;  1YNJ C;  2V1C C;  1IBK Q;  3ERQ A;  4JBJ A;  5IGC A;  1SJE D;  1N8R C;  5BR8 L;  2HDM A;  4A3L G;  1CM9 A;  4GKJ L;  3ZYY X;  1YNN D;  3ULP A;  1XJV A;  2QGQ A;  1MSG A;  4QIW B;  1N36 L;  4BY1 B;  4BXX G;  1D5Z C;  1AEX A;  2JA6 H;  1BVS A;  2Q2U A;  5CMD A;  4OEL B;  1SE4 A;  3F2D A;  3AQQ A;  1QVG A;  2R93 H;  2IJ0 A;  1J5E L;  1K8G A;  4Z9C B;  1I50 H;  3T1Y Q;  1KAB A;  4A3D B;  3T16 A;  1EFW A;  3I90 A;  2B2T C;  4GKK Q;  1STG A;  1QUQ B;  3EVQ A;  1V43 A;  4LF7 L;  3M4Y A;  5IIF A;  1STE A;  4RHR A;  3AMU A;  1KRS A;  1Q12 A;  5C3E B;  4DR2 Q;  2F0O A;  4A4I A;  2YU9 B;  1KNE A;  1QVC A;  5IWA L;  1JWM D;  1A63 A;  1EYG A;  3NBH B;  5I4D A;  3GTO H;  2I5H A;  4ZAI A;  2NYZ D; 
#chains in the Genus database with same CATH homology
 1IYU A;  2Q8R E;  1JQY D;  5M5Y B;  4KJO A;  1LTA D;  5CV4 A;  5EKL A;  2ZT9 C;  2FJ2 A;  3M85 A;  3PUW A;  4R9W A;  4A3I B;  2F0D A;  1V8Q A;  5JAV A;  2DNC A;  1TWA B;  3K59 A;  4ILW A;  4TKO B;  2OEO A;  1RTN A;  3S1N B;  1LT4 D;  3BVG A;  1IW7 C;  3VYT A;  3NE5 B;  5COY A;  1ILP A;  1O78 A;  3I4M B;  3L3O C;  1KNA A;  3IL8 A;  2EYH A;  2NN6 G;  3MTS A;  3I70 A;  3WOF A;  2L4N A;  2XIW A;  4J6H A;  4H44 C;  4G7H C;  3VR2 A;  1U4L A;  4K2K A;  1PLF A;  2L0C A;  1S5C D;  1EYA A;  5E3F A;  1SE2 A;  1OXU A;  2EY6 A;  2L5T A;  1GUO A;  3TBI B;  1DOM A;  2EPB A;  1LTT D;  4BY7 B;  3GO5 A;  1JWU D;  4A3G B;  3W2D A;  1G2S A;  1Q1B A;  1SYD A;  1T5X D;  4A3M B;  2FMM A;  1V1P B;  4O1N A;  2NZ1 D;  1RHP A;  4CBV A;  4K8I A;  1JWS D;  5C0X H;  2BE5 D;  1EYC A;  2F0N A;  1EEF D;  1TR5 A;  1RTO A;  4DNT B;  2PW7 A;  1O7Y A;  4XXE A;  1AW7 A;  5D3D A;  2LKV A;  2XWJ B;  5CC4 A;  2EJM A;  1LT3 D;  1PTO D;  4FVM A;  3R3O A;  2SDF A;  1CI3 M;  1QJO A;  1E2V A;  4C3I G;  3PIO 3;  1SE3 A;  1PTO B;  4ZKC B;  1GUN A;  4DK1 A;  1QWY A;  1SSO A;  1EIH A;  1YNJ D;  2C9O A;  2XN9 C;  2QCP X;  4CKB A;  3D4R A;  2K5W A;  3PO2 B;  4ME5 A;  3A7A B;  5A35 A;  3BDO A;  4BBR B;  2ZXP A;  1D1K A;  4QB4 A;  1SNM A;  3RMH A;  2B2U C;  4C3J G;  2L11 A;  5EPL A;  1QOH A;  4Q5V A;  2SNM A;  5HGT A;  3QOL A;  3T56 B;  1PRT C;  3A56 A;  2BDN A;  3J80 L;  4A3J B;  4HSP A;  1WTV A;  2FIN B;  4P2C B;  4J8Q A;  1JR0 D;  3M7G A;  1QNU A;  3HEJ A;  4LJZ C;  2MPM A;  2B2W C;  2HCI A;  1M4V A;  2J0T D;  1PTO H;  5C0X J;  1FYC A;  1ET6 A;  3TN2 A;  4FO2 A;  1AP0 A;  4DU9 A;  2CW0 C;  5EQ0 A;  1Y69 U;  1B50 A;  2RDG A;  3CKI B;  2NB0 A;  5BN3 A;  4IUT A;  4KN7 C;  2HQE A;  4Y7N B;  2VXW A;  4QUF A;  1HQM C;  3HOV B;  1JIC A;  3KBX A;  3VYR A;  4HMJ A;  2F0K A;  3M4O B;  3GQB A;  1FGB D;  3Q22 A;  5KGU A;  3A7L A;  4GZY C;  3FKI B;  3MEH A;  1EWC A;  3M7N A;  1ESR A;  3VYU A;  1GUT A;  1Y8N B;  3CRK C;  1EY7 A;  3ERO A;  3AB9 A;  1RCV D;  4KI0 A;  5K36 H;  1BQQ T;  1EOT A;  4K5V A;  3TP6 A;  5IT9 L;  2A69 C;  1MGS A;  1V1O A;  2RSN A;  2Z4H A;  1I4G A;  5CV7 A;  1IW7 D;  2EDG A;  4A3F B;  2PMZ B;  5T1I A;  5C4X B;  3PUZ A;  4ZUJ A;  4X3U A;  1DD2 A;  1G6Z A;  3KBG A;  1WTQ A;  1DZ1 A;  2F3W A;  3HZX A;  3J80 E;  1ICW A;  1SXT A;  1IHZ A;  5KRU A;  4OIK A;  2WKC A;  4ZLT F;  3K58 A;  3IFT A;  5E4W C;  3HOY B;  1MD2 D;  3J7Y W;  1S5D D;  1LO5 D;  1PMR A;  2MJ8 A;  2D9U A;  2L9H A;  1BF4 A;  5NUC A;  2NWG A;  1OXS C;  4C3H B;  2EYM A;  2LS0 1;  2NVT B;  3DHQ A;  1E2Z A;  2K7V A;  3EQL C;  1STA A;  1UNS A;  2JXM B;  3BVZ A;  3P75 A;  4IUR A;  4WOR A;  3CU7 A;  4N9T A;  1QIL A;  2IX3 A;  2PCF B;  1CHP D;  5ISR A;  1TKW B;  3SEB A;  3A8J E;  1Y8P B;  1Y1V B;  1UUP A;  4DNR B;  2D62 A;  2KED A;  4WFN 3;  3DWP A;  4BS9 A;  4OO1 G;  3O13 A;  1AZQ A;  5C0X G;  4XT1 B;  4RKB A;  1OXT A;  1MSH A;  4DFA A;  3LX0 A;  2EZV A;  3OMC A;  5CGK A;  3K5N A;  5M3F B;  5IT9 E;  1BCP F;  3PUV A;  4E6I A;  1STB A;  1SYC A;  1ZXT A;  2F0G A;  3HG9 A;  1TWG B;  2N55 A;  3EA6 A;  4G7Z C;  3FRP B;  5C5M A;  4DXG A;  1Q3L A;  4G7O C;  1WCM B;  4HSV A;  2AQ2 B;  4PNY A;  1D6E C;  1EY6 A;  3DWQ A;  1A3V A;  1LAB A;  5C6A A;  2E2J B;  5JPM C;  3SE0 A;  1EZ6 A;  4C2M B;  5CYU A;  2K33 A;  5EJW A;  5ELF A;  2F0P A;  3A54 A;  2Y0S B;  1U4R A;  3A8I E;  3SK4 A;  1PRT D;  1RF2 D;  2X69 A;  3W3A A;  3MA2 B;  1ENC A;  5CR3 A;  3AU7 A;  2G9H D;  5CV6 A;  3HKZ B;  4RGN A;  1Z7T A;  3KF8 A;  5JOB A;  5KYL A;  4FF4 A;  2CHB D;  2DN8 A;  2J4X A;  4IUV A;  5EBC A;  1PRT B;  2BCO A;  3T53 B;  5I9P A;  4IUP A;  2B8F A;  5G3L F;  2XRS D;  2CW0 D;  4TRD A;  1WD1 A;  3GTM B;  3FPU B;  1DJR D;  4KMU C;  1K83 B;  3OWF A;  2F0T A;  2K04 A;  3RD4 A;  2F0I A;  1GHK A;  5IGE A;  2TSS A;  2K5D A;  4DAY A;  4MIU A;  4CJ0 B;  2IL8 A;  4OIJ A;  1PZI D;  2B2V C;  2DY7 A;  4BWG B;  5JEA G;  4IZ8 A;  1CK1 A;  3MHB A;  4EQO A;  2KHS A;  2Z1C A;  1I6H B;  4EGV A;  3NTK A;  4XDX A;  2D5D A;  2O2L D;  1ML0 D;  1O7Z A;  2OXP A;  3G6J B;  3GTQ B;  1EU3 A;  1SNQ A;  4R8I A;  3SK6 A;  1TY0 A;  3OHX C;  3WOE A;  2K05 A;  5IGD A;  1F2Y A;  1U4M A;  4C56 C;  5I9O A;  1R4P B;  1LTB D;  1DXM A;  2F0E A;  2PPB C;  2A69 D;  1B9M A;  5F2D A;  2Q8T A;  5I2Y A;  1XX8 A;  2RQX A;  4N9P A;  3CHB D;  2K6A A;  3SK5 A;  1HCZ A;  3S17 B;  2EXZ A;  1DYQ A;  3HGB A;  4A3E B;  2KEE A;  3NTH A;  3TZU A;  4KKT A;  2BOS A;  1U4P A;  3GD7 A;  1TWC B;  4IUN A;  2NVX B;  1I4P A;  2E2I B;  1JOQ A;  1Z47 A;  1KLU D;  2KOL A;  3RZD B;  1BDO A;  4DF7 A;  5KNB A;  4L6T B;  2F3V A;  2OF1 A;  2Q8I B;  1CTM A;  1ZKO A;  3TDQ A;  3T4A C;  3I91 A;  2BA0 A;  4DN4 M;  1KLG D;  2KCC A;  4J1M A;  2RBM A;  2AQ1 B;  4JK1 C;  1CQV A;  2WII B;  3GTJ B;  3U9O A;  5ELC A;  3H0G B;  1PFM A;  2AUJ D;  1EFI D;  2B2V A;  3V2T A;  3HOX B;  3GTP B;  3E0J A;  1EIG A;  1G29 1;  4K2L A;  1TQO A;  1IL8 A;  1KDC A;  2NUC A;  1KDB A;  2X6L A;  2EYJ A;  5FO8 B;  2WB1 B;  2EYF A;  5FOB B;  1WTR A;  1DCZ A;  3QJY A;  4HMI A;  2KJX A;  3I8Z A;  4DAP A;  4K5W A;  4M1U B;  5C4H A;  2YYZ A;  4TSS A;  3DWA A;  3L7Z C;  2VUM B;  4DK0 A;  1L0X B;  1TT2 A;  4ULL A;  1HQR D;  1JC7 A;  2ICI A;  3KLR A;  1PZK D;  2NTT A;  4H7B A;  1NUC A;  1Q90 A;  1VF7 A;  3SR1 A;  2F0V A;  2CVR A;  1XXG A;  1WTW A;  1BUV T;  1RKN A;  2LMC B;  5DNF A;  4XQJ A;  2R6G A;  4RGM A;  1FD7 D;  2PZT A;  1SBB B;  3IFD A;  3K5L A;  3NP8 A;  2MHV A;  2XRQ D;  3OSO A;  1VCI A;  3IAY A;  2L55 A;  1QG7 A;  3RZO B;  1S5F D;  4K6D A;  1I4X A;  4PQX A;  1B53 A;  1QB5 D;  1LAC A;  3TP7 A;  2J7Z A;  1D1I A;  1LT6 D;  5ELE A;  1JB3 A;  1ET9 A;  3HS0 C;  2SOB A;  1A3T A;  3D31 A;  3T51 B;  1EY0 A;  5J1Z A;  2V4D A;  1L0Y B;  1GUS A;  1LTG D;  3K7A B;  3S15 B;  2F0F A;  1BR9 A;  2JP1 A;  3EJI A;  1VF5 C;  4FXK C;  3V05 A;  1BBX C;  5FKA C;  3RLF A;  3KK7 A;  3H94 A;  3ND9 A;  4F7X A;  4K5X A;  1SYG A;  3I73 A;  3CQZ B;  4FP5 D;  4PMC A;  4NDX A;  5LL6 S;  1Q8I A;  1IYV A;  1X32 A;  3OMG A;  4YIJ A;  1WTO A;  2WIN B;  2M2L A;  3P1H A;  1HUN A;  1CHQ D;  3OWE B;  4IFD I;  4L63 B;  2EYL A;  2B2Y A;  5FO7 B;  2JSO A;  3MXU A;  2A74 C;  3H6M A;  1B1Z A;  1PZJ D;  1D5X C;  2A73 B;  1HFG A;  5K5P A;  2IWH A;  2R61 A;  2VB3 X;  1SMY C;  1DON A;  1K8O A;  3BVM A;  3MXG A;  4ZUI A;  3J81 E;  4XT3 B;  5ELB A;  4HCE A;  4C1N I;  3VA5 A;  1M8A A;  5COR A;  2DNE A;  5I2X A;  3MWY W;  1A2U A;  1H9J A;  3TP5 A;  1TII D;  1HPC A;  2RDH A;  3CRL C;  3C1F A;  1OO9 B;  3N52 A;  4HN7 A;  3K57 A;  2F1M A;  2FMC A;  3HP3 A;  2E75 C;  2FFK B;  2N88 A;  1HUM A;  3PO3 B;  3QO2 A;  1TU2 B;  3ND8 A;  3BS1 A;  2PW5 A;  3DEP A;  1SND A;  2BDO A;  1A6X A;  5HUR A;  1UAP A;  1SNO A;  4A3B B;  4PMW A;  1PTO F;  2JE6 I;  2F4I A;  1WD0 A;  3G7L A;  2X6G A;  3K5O A;  4XTC S;  2EE1 A;  4CJ1 B;  5KND A;  1TS2 A;  1QE6 A;  1TY2 A;  1FNV A;  2EY5 A;  3P7J A;  1EL0 A;  1WTP A;  3GTG B;  3Q0A A;  4RCN A;  1W6K A;  5G3L D;  3N6R A;  4NW2 A;  4X3K A;  1BNZ A;  3K0Y A;  2EY2 A;  4EQP A;  2I46 A;  4CJ2 C;  3GV3 A;  1JE4 A;  3MC0 B;  2K32 A;  1R4Q B;  5IGG A;  2D2C C;  3HRZ C;  3S1R B;  1RD9 D;  2LFN A;  1JOO A;  4KHV A;  3BDL A;  4U68 A;  2K01 A;  3KLS X;  4ZRZ A;  1F9S A;  3H91 A;  2ICE C;  1B2T A;  3VYS A;  3OIP A;  5T1G A;  2F0W A;  1OXV A;  5C3W A;  1LT5 D;  3D6C A;  1K8M A;  4KV6 A;  3QWN A;  3NWT A;  4CGY B;  1PDQ A;  3NWS A;  1ZEQ X;  1G91 A;  2KUM A;  4FF3 A;  4FXG C;  4OHJ A;  5CBA E;  5JVH 3;  4XQN A;  5E4X A;  2VNU D;  2LY7 A;  1SFO B;  2SEB D;  2RVL A;  2K5Q A;  2R92 B;  3JAM L;  2XSC A;  1HHV A;  5CV9 A;  4X3T A;  2IT1 A;  4KKU A;  2XVS A;  4EQN A;  5BN4 A;  2NN6 H;  1C8C A;  2EJG C;  4RGO S;  1B9N A;  5C3X A;  1AN8 A;  3PUX A;  2QKI C;  3BYY B;  4ZKB B;  2JEA I;  1CZW A;  3ITP A;  3NBI A;  5DM7 3;  1AZP A;  4IUQ A;  1F2Z A;  4C3I B;  4KHZ A;  1H9S A;  3K5M A;  2IPK D;  4XYO A;  3R2T A;  1F9P A;  2QDB A;  1GHJ A;  1QCB D;  4WJW A;  2K1B A;  2VB2 X;  3TP8 A;  4I7Z C;  2IX1 A;  3HOW B;  1I4H A;  1EY5 A;  1EU4 A;  2TMP A;  5ELD A;  4KKS A;  3NPP A;  3X3M A;  4K6L A;  1NCV A;  3TSS A;  3LWE A;  1GJX A;  1G2T A;  1Y8O B;  3NBH A;  5LL6 X;  4EVO A;  1EZ8 A;  4C3J B;  1SNP A;  2R3Z A;  3C3L A;  1TS4 A;  3D4D A;  2I07 B;  1SNC A;  2B39 A;  3M3Y B;  1MBY A;  3Q24 A;  1SMY D;  3R2I A;  3I72 A;  1SDF A;  1WTX A;  3D6W A;  1NR4 A;  2H4O A;  2ID0 A;  1G8Z D;  4U67 3;  2SNS A;  4KY7 A;  2MUY A;  5J22 A;  5FO9 B;  2A6E C;  5D65 A;  2R93 B;  2JEB I;  5DM6 3;  4X3S A;  2F0U A;  1ZYR C;  3H09 A;  1I50 B;  2QEJ C;  2AUK A;  1I4Q A;  4FXD A;  4FF2 A;  3I4L A;  3C2P A;  3JAM E;  3MVV A;  1OXX K;  4QF4 A;  1MI2 A;  4RKL A;  2G9D A;  3MFY A;  4S3S A;  1X3P A;  3R8B A;  1RJT A;  4UAI A;  3VA7 A;  5KYI A;  4AYB B;  1SYF A;  4V0B A;  3GTO B;  3HOZ B;  4I65 A;  5JVG 3;  2F0J A;  5K36 G;  2NN6 I;  1JOR A;  5EBD A;  2MGS A;  1E0B A;  5EPJ A;  4LAA A;  2WKD A;  1F77 A;  4XQQ A;  1HA5 A;  3NXW A;  4QMG A;  3DEO A;  1HFN A;  1H9S B;  1I6V C;  4KY5 A;  4KK7 A;  1ENA A;  5EPK A;  3P20 A;  2F03 A;  5A2Q L;  2L12 A;  4F88 A;  1CQF A;  5C4Z A;  1V1P A;  2RKS A;  1B3A A;  1KDA A;  5E1F A;  4ABN A;  3R93 A;  2IX0 A;  1TWF B;  3GP7 A;  4ZQ3 A;  3MXP A;  3QOJ A;  1NSN S;  1LTR D;  1PRT F;  1BCP C;  2Z4I A;  3IKJ A;  5M9O A;  1H9K A;  1S5E D;  3MXN A;  1ROD A;  3C1E A;  3S2H B;  3Q6S A;  1EQV A;  3H3V C;  1EQT A;  4WRD A;  1EY9 A;  4LK1 C;  5TSS A;  1S4Z A;  4IQZ A;  4RAU C;  2EYO A;  4XIG S;  2JA8 B;  3GTL B;  2EVB A;  5M5W B;  3NSW A;  2ZXR A;  3QB3 A;  2PZW A;  1ESF A;  5I6Y A;  1C4Q A;  5DAU A;  4NMZ A;  2M9V A;  3NTI A;  4Q0F A;  4KD4 A;  1PYW D;  4NKL A;  1T5E A;  2NVY B;  4B9W A;  1NR2 A;  4IFD H;  4RFB A;  1XYI A;  4C3H G;  3DXJ C;  4V19 0;  1CA5 A;  2EY1 A;  4FF1 A;  4CKE A;  2EJF C;  1EEI D;  2OT2 A;  2EOT A;  3BZD B;  3L9A X;  3OOC A;  4IAL A;  1JOK A;  2B2Y C;  2WV6 D;  2QIL A;  3S14 B;  3NQT A;  2AQ3 B;  5A2Q E;  2HUG A;  1NAP A;  4BA2 I;  4DAV A;  2B2T A;  2KEC A;  2O5J C;  2QF7 A;  1J8I A;  1LLR D;  4PMB A;  1II3 A;  3OIQ A;  1HTL D;  2L1B A;  4QUC A;  3J7A F;  2MP1 A;  4F87 A;  1EYD A;  1SYE A;  4L8J A;  1IKM A;  3SK8 A;  2A68 C;  4NP5 A;  5I6W A;  3J81 L;  4OO1 H;  1KTK A;  5CV5 A;  1EWH A;  1Y1W B;  2WAC A;  4HAE A;  1GUW A;  1BOS A;  3ONA B;  4PV1 C;  3BYT B;  3WDN A;  5JJZ A;  1F9R A;  3UI2 A;  2JYO A;  2A6E D;  3OPO A;  3T13 A;  1HA6 A;  1EY8 A;  1TS3 A;  1ZYR D;  3VR3 A;  2F0M A;  2HDL A;  4CKC A;  1A2T A;  1D5M C;  4IFD J;  3VR5 A;  1SYB A;  5KNC A;  3FVQ A;  4BBS B;  2PZU A;  3MFG A;  1DOK A;  2WAQ B;  2CQA A;  5EKI A;  3NHH A;  4H0L C;  3D4W A;  1SJH D;  3D8G A;  3QG1 A;  1I4R A;  2E2H B;  4R8N A;  1W6J A;  3S9W A;  4KN4 C;  5IGF A;  3S2D B;  3LNN A;  3KUP A;  2A6H C;  5M5X B;  1ENF A;  1VMP A;  2DY8 A;  1D2B A;  4F8M A;  1CFM A;  1SEB D;  1TVX A;  4G4K A;  1PFN A;  3NK9 A;  4MN3 A;  3VR4 A;  2ENB A;  4KD3 A;  3EFX D;  2F0S A;  5AFW A;  3MZ5 A;  1LTI D;  1STN A;  4DGZ A;  1STH A;  3A55 A;  3SHL A;  5FLX L;  5M3M B;  5JEA H;  1QNK A;  1DM0 B;  4A93 B;  5CV8 A;  2F0L A;  1A15 A;  1IKL A;  2KQ3 A;  4DXF A;  1JCK B;  1BCP D;  1CZG A;  3TME A;  1ILQ A;  3URY A;  2K28 A;  2F0H A;  3NQI A;  4HR7 B;  3KLS A;  4IUU A;  1XTC D;  2M00 A;  3FPP A;  1Q1E A;  2PQE A;  1BCP B;  4KJN A;  3PV0 A;  2KVM A;  4OO1 I;  1Z6H A;  2B8G A;  1BO0 A;  5C0X I;  3S1M B;  3VR6 A;  4KY6 A;  2B63 B;  5EGT A;  3J7A V;  5IOD A;  2Z8L A;  2R7Z B;  2RDF A;  2KCN A;  1XWE A;  2GA4 B;  2A5H A;  3V96 A;  4RGT A;  2WP8 J;  1HTP A;  1EY4 A;  3S16 B;  1YNN C;  3C46 A;  4ID6 A;  1H9M A;  2E74 C;  3D3R A;  1B4O A;  4A3K B;  1LV9 A;  1F2L A;  1U9R A;  4HCS A;  3FDT A;  4BA1 I;  4K8J A;  3SDZ A;  1HXY D;  1S5B D;  4K14 A;  4RWS C;  2HCC A;  3QIA A;  1X3Q A;  4H13 C;  2B2U A;  5KEE A;  2JA7 B;  1AFP A;  1ONL A;  3DUZ A;  1WVL A;  3U9S A;  1PXU A;  2ZXO A;  3I3C A;  2C5C A;  4RA8 A;  4IFD G;  4IN3 A;  5JEA J;  1F9Q A;  4ZYS A;  4OL7 A;  4DA2 A;  1B44 D;  4OGQ C;  5J39 A;  4M8A A;  2B2W A;  4B9X A;  2RA4 A;  5FLX E;  4MHE A;  1I3Q B;  3DMU A;  3TZD A;  2XNA C;  4JBW A;  4UDU C;  3PMF A;  3BDC A;  2A68 D;  5C5L A;  1E2W A;  1TWH B;  1R9T B;  3A8K E;  3RUZ A;  3GTK B;  4ODG A;  2PNR C;  3K6O A;  3E6Z X;  2AWN A;  3FMC A;  1H9R A;  1UEA B;  2EYP A;  5CBE E;  2NVQ B;  1VDZ A;  4QCL A;  4FYD A;  1FNU A;  2O5I C;  1O7L A;  1FR3 A;  2NBF A;  2IW3 A;  2E76 C;  1SAP A;  2NTS A;  1TS5 A;  2E2D C;  4LMQ D;  1LTS D;  5DEH A;  5D14 A;  2H1E A;  1O80 A;  1BXT A;  5KIX A;  2RSO A;  3SXH A;  1CA6 A;  5IGB A;  3PIP 3;  3F2U A;  1GUG A;  2PO4 A;  4KTA A;  2AWO A;  2FHT A;  5C44 B;  1A3U A;  1GXD C;  4O42 A;  2O4X A;  3FEW X;  3HOU B;  1CT1 D;  4HTH A;  3BG3 A;  1VMC A;  5C4J B;  5LHY 1;  4XYQ A;  4G57 A;  2A6H D;  3SVM A;  3I4N B;  3PUY A;  4ZK9 B;  3S1Q B;  4FNF A;  3LWU A;  1FNW A;  2F0Q A;  2BA1 A;  2KA7 A;  5FK9 C;  1C48 A;  4CHT B;  4RCO A;  4HED A;  3OW7 A;  4C1N K;  1KAA A;  2XWB B;  2BE5 C;  4RH6 A;  1STY A;  4B08 A;  2JA6 B;  3DM1 A;  1PFB A;  2PYK A;  3X3N A;  1HRJ A;  2JA5 B;  1J9O A;  1RDP D;  1PTO C;  4RHS A;  1GOZ A;  5JPN C;  4TQU S;  5IOC A;  5D3I B;  3NUC A;  2K03 A;  5EKK A;  1DOL A;  5BN5 A;  3GV6 A;  1F2M A;  3Q23 A;  3MAQ A;  3E5S A;  1YNJ C;  3ERQ A;  5IGC A;  1SJE D;  2HDM A;  1CM9 A;  3ZYY X;  1YNN D;  1MSG A;  4QIW B;  4BY1 B;  1D5Z C;  1AEX A;  5CMD A;  1SE4 A;  2IJ0 A;  4Z9C B;  1KAB A;  4A3D B;  3T16 A;  3I90 A;  2B2T C;  1STG A;  3EVQ A;  1V43 A;  3M4Y A;  5IIF A;  1STE A;  4RHR A;  3AMU A;  1Q12 A;  5C3E B;  2F0O A;  2YU9 B;  1KNE A;  1JWM D;  5I4D A;  4ZAI A;  2NYZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...