1OO9B

Orientation in solution of mmp-3 catalytic domain and n-timp-1 from residual dipolar couplings
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
126
structure length
126
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Global Orientation of Bound MMP-3 and N-TIMP-1 in Solution via Residual Dipolar Couplings
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Stromelysin-1
total genus 25
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2003-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oo9B00
2A74C 2J0TD 3OHXC 1D2BA 3CKIB 1UEAB 5JPNC 3HS0C 3G6JB 2E2DC 5FOBB 3MA2B 2TMPA 3I70A 5FO8B 5FO9B 2I07B 3HRZC 1JB3A 1JC7A 2QKIC 2XWBB 3CU7A 1BR9A 4FXKC 2ICEC 2XWJB 3T4AC 2WINB 5FO7B 1PXUA 4FXGC 3V96A 1XWEA 1BUVT 3FRPB 1UAPA 4ILWA 2A73B 2B39A 1OO9B 3L3OC 3KLSA 5JPMC 1BQQT 2WIIB 1GXDC
chains in the Genus database with same CATH superfamily
2I46A 4KI0A 1OXTA 3K5OA 1HNXL 1J9OA 2PW5A 3TDQA 1W6KA 1K8MA 1EUJA 3K0XA 3NPPA 1G291 1PH9A 1JOKA 5FLMH 3PIO3 4NXML 1ZEQX 4DU9A 5IP7G 3T51B 1I50H 1SNMA 5ELOA 4LF7L 2RDGA 5I9PA 4LF9Q 1V1OA 3T13A 3FMCA 2PQEA 2A68C 2PZTA 4IPDA 3VDYA 3G48A 3Q24A 1HUNA 2K5NA 1N32Q 1CKMA 2F0FA 3D6WA 5HGTA 1WTOA 1U4LA 1ET6A 3HKSA 1HFNA 3KF6B 4LF8L 5C3XA 5CV8A 1YITA 4PQXA 3M4YA 1X6OA 1VQ9A 4KKSA 4R4QA 1EEID 3DHQA 4OIKA 4RKBA 1PTOH 4A3GB 1G2SA 4CDFC 1X55A 1SJHD 3OWFA 4XXEA 5LMNQ 3QB3A 2CQAA 4O0AA 1D5XC 1PYSB 1S5ED 1KRSA 1BR9A 1SFOH 2UUBQ 3MC0B 1N34Q 3MFYA 1AFPA 2HUGA 2EYPA 2EYMA 1EWCA 4IPCA 1IZ6A 2F4IA 2JXMB 1YIJA 4HSVA 3K7UC 4HR7B 4RHRA 4MZ9A 2R3ZA 4HJ8A 2K28A 1DXMA 3S2DB 1Y1VH 4XQQA 1S5BD 2JJQA 3HZXA 3IFDA 1CUKA 4V0BA 4RG1A 4LFBQ 1XNQL 1KIXA 1QNKA 1STGA 1WFQA 5C3EB 3LGJA 4A4IA 5IWAL 2L55A 4BY7H 3TZUA 1Y8NB 1GUWA 5GAGC 4GKJQ 1FGBD 1X65A 3PF5A 1NR4A 3HOUB 1DGSA 1GD7A 2JA7H 1BUVT 3FDTA 4DV0L 5IYDG 3S9WA 3A5UA 1EL0A 1J8IA 2G9DA 3UI2A 4GOPB 3F2UA 1CZGA 3S16B 4DAYA 2QW7A 1ILPA 4ZK9B 1PZID 1OTCA 2JA6H 1KRTA 2EJGC 4DV4L 1JOOA 4R4IA 4A3FH 3F2DA 3GTMH 2BE5C 5IGCA 1H9SB 3Q6SA 2HD3A 4K5VA 4CDDC 2XN9C 2EDGA 3L0OA 3M9BA 1P16A 2VY3A 1SE8A 1HR0L 2NVYB 4DUZL 1IHZA 2OTJA 3DWAA 2NVXH 1ICWA 2HHHL 1XMOL 3PO3G 2I07B 2KBNA 3PUWA 3GTGH 1JC7A 3R2IA 4DN4M 4A3MB 2F0DA 4LUOA 1Y14B 1IKLA 2MNAA 2Q8IB 1EY8A 1L1OA 2NN6G 3PUZA 1B8AA 2HIVA 4KHPL 3QR8A 5I2XA 3S1NB 1PTOF 1DM0B 5EPKA 3CMEA 2O5IC 2L15A 1JE4A 1EOVA 1EY6A 2B63H 5KIXA 5M9OA 1AZQA 1I4PA 1NR2A 5LMUQ 3W2DA 1EOTA 2VUMH 1D8LA 2R7ZG 4CJ0B 1E1OA 3SGIA 1JE5A 1ZYRC 2F0GA 4OO1G 3OWEB 5LL6X 3PIP3 2R7ZB 1QG7A 1NE3A 1ESRA 3CRKC 3CCQA 5C4XB 3PQIA 4A3EB 1UEBA 2EZVA 4JI3Q 4A75A 1GUTA 4KLKA 1LTBD 1CSPA 1YHAA 4DR6L 1PRTF 3J7YW 5FLMG 4I7ZC 1H95A 1V9PA 1X3FA 4R4TA 5A35A 1JJCB 1LABA 1MGSA 1H9SA 4A93B 2EOTA 3S1QB 1E0BA 4ME3A 5M3MG 1LLRD 5M3FH 3I56A 1EYDA 4JI1L 4O1NA 1I6HH 4ILWA 1WJJA 3TZDA 3DWQA 4DR2Q 4BY7G 5JJLA 1JWSD 4B3ML 1U4RA 2NBFA 2J7ZA 3RNUA 3HGBA 5K5PA 4L63B 1SLJA 4LFBL 3BYYB 1B3AA 1SJED 2ZTDA 5EBDA 1H9RA 3BZKA 4CGYB 1EY5A 1II3A 3H0GG 3UDXA 3GTOB 2PQAB 4C3JH 2HCCA 1QILA 1AW7A 1GVPA 5DM73 2UUCQ 1SDFA 5C0XG 2ZM6Q 4L5TA 1BXTA 1HNWQ 3F1ZA 1RF2D 4OHJA 1ASZA 1EEFD 2L12A 5IGBA 4IUVA 3I2ZA 3CAMA 4K8JA 5CV4A 1QZGA 2K5DA 1TS5A 4TKOB 2A69C 2MP1A 2OXPA 3BDOA 4F8MA 1STEA 4JI4L 1GUGA 3I90A 3LWEA 4KKUA 1STHA 4RGNA 3CC2A 4IURA 4MNOA 2E2JH 4DPGA 3I7FA 4A3DG 5EPJA 1HA5A 2Q8RE 4IFDI 1UWVA 1HA6A 1E7ZA 4ID6A 4C1NI 2R7FA 3K5MA 5IY0A 3S1MH 3BDLA 1WYDA 1PH6A 3EFXD 4QQBX 4X62Q 3URYA 4DV3Q 1PYWD 5A2QE 2F0OA 1ENAA 1LTLA 2UXDL 4B3RQ 4BY1G 1PFMA 1XTDA 2ZXOA 4LNQA 2F0SA 3I4NB 1A3TA 3KLSX 1N32L 4JI4Q 2A6EC 1STNA 4OO1H 4F7XA 3X3MA 4IUPA 2D5DA 4FF2A 3NTHA 1VQ6A 3KF6A 4DV1L 3PO2G 1Y1WH 3MXPA 1HZAA 3KJOA 4P74A 4C3HG 3I3CA 2JYOA 4LFAL 2EXDA 2ICEC 3TMEA 3QOJA 1HNWL 4DV6L 1CKNB 1QZHA 4A3CH 3D31A 4UP7A 4C2MH 3D4DA 1PDQA 1DZ1A 1B44D 2KQ3A 1K73C 2AUKA 1TWGB 2QDLA 4X66Q 1I4GA 3T1HQ 3F2BA 4J15A 3NXWA 4GZYC 2PQAA 1KNEA 1M4VA 1HPCA 4WORA 4EGVA 1UEAB 2R93B 4JCVE 5FK9C 1AP0A 5DNFA 3SK8A 1PH1A 1Q90A 2CW0C 2ALYB 4DV5Q 1O7IA 1E3PA 1XNQQ 1V43A 1ET9A 2Q2IA 4DV1Q 2CHBD 3MHBA 5EAYA 1L0YB 2WAQB 3S17B 4ALPA 2CQOA 2SNMA 2HQEA 4R9WA 1L1OB 1K28A 1I94Q 4DV2L 4JBWA 4JYAQ 2A73B 2ZJQA 5G3LF 1PFBA 3E9IA 1D1IA 1NMGA 1Z7TA 2ASBA 1Z9FA 3AFQA 1SNCA 3HOZB 2L1BA 4X3TA 1A8VA 2QCPX 3CQZH 2AMCB 3G6JB 5LMNW 1A15A 5C3EG 4BXXH 2FINB 4DR7L 3T1YQ 3J7AV 5ELBA 1EU3A 3V2TA 3HOUH 2BDOA 3WWVA 4XQJA 1R9TH 5IYDH 1VMCA 1PMRA 4P71A 3DLLA 3U9OA 3J80c 1IBML 5C44B 1VCIA 2UXBQ 1ENFA 4LUVA 3M4OH 1JQYD 3CCJA 1BOSA 4C3JB 1SE3A 4GN5A 3GQBA 5J1ZA 4GKKL 2MHVA 5C44G 4APVA 1VQFA 2KHJA 1I4XA 2C5CA 4JI1Q 1VQBA 4GS3A 3GV6A 1TWCB 1S5CD 5ISRA 3NSWA 1B53A 5CV5A 1D1KA 1CA6A 1V1PB 2K7VA 1ESFA 1QNUA 4C3IG 4TRDA 3HFZB 4HIKA 4H02A 1NY4A 4EVOA 3SK5A 4FO2A 3QOLA 3PGZA 4GN4B 2KENA 4A3KG 3OSOA 4NP5A 3ULLA 4DV4Q 2DJFC 4B3TL 3CCVA 1VQPA 3CW2C 3HG9A 4DK1A 4BY1B 1MSHA 2EYJA 1QWYA 3ULJA 2FHTA 1X56A 1X54A 2VQEL 2AHOB 4LAAA 1H9JA 2BH8A 1IBKL 1MJCA 5D14A 1Q1BA 1BBWA 2LKVA 3CCUA 1GUNA 4A3CG 4J1MA 1PA6A 1SNQA 2VB2X 3B6YA 1YNNC 1DD2A 4H7BA 1PVOA 4ZRZA 1QVCA 2IX1A 1CQFA 4JI8Q 3C1FA 3HOWH 2F0WA 2FMCA 2UUAL 5KYIA 2KCTA 5IGFA 2FMMA 4IUUA 3T1YL 2RDHA 5JEAJ 4A3FG 4A3EG 1LYLA 3OMCA 4QCLA 1XPRA 1VQ7A 2F0LA 1VF5C 1VMPA 1PTOC 1G6ZA 1Q1EA 1KLUD 5JPNC 3S1MB 3VR2A 1DOLA 4DR4Q 1IBKQ 3SK6A 4O42A 4ME5A 3JAMc 3K0YA 1EY7A 1I6VC 3GDEA 4XT1B 4HTHA 3RLNA 3AU7A 2E2HH 1EY9A 4JI5Q 4CKEA 4HAEA 5JVG3 5IWAQ 4A3JB 1JORA 4GLAC 4NPSA 4AQYQ 1P8LA 1PTOD 1XYIA 2UU9Q 2PNRC 3J81i 1E24A 1DJRD 5IYBH 1LTRD 3KUPA 2JA6B 1Y1VG 4XYQA 3OW2A 2QEXA 1IBLQ 2KJXA 2DJGC 1FNVA 3GV3A 3S1RH 2CWAA 5CV9A 3PV0A 1XJVA 3PO2H 3S2HB 4DV3L 2VQFQ 1RKNA 1JWUD 4MTNA 5KRUA 2PNHA 4A3GH 1KDAA 4K8IA 1VQAA 4QMGA 4CDCC 3A8JE 2NN6I 3A8KE 1N33L 1PZKD 1EIGA 1MIUA 1YNJD 4IUNA 3J80L 2H5XA 5H1SE 3S14B 1BBXC 3RLFA 3LNNA 5BR8L 1S5FD 1SYCA 1SBBB 2NVQH 3A54A 3K58A 4C3IH 4A3KB 2ATWA 4K14A 2F0JA 3TEHB 3V05A 2K01A 3D3RA 3NWSA 3R3OA 2EVBA 3N6RA 3NP8A 1TT2A 1GHKA 3CP0A 3BS1A 4AIMA 1O7YA 1TWHH 1PZJD 2LS01 4HJAA 4JI7L 4DXFA 1XWEA 1I6HB 3I4NG 5J39A 1K9MC 2DGYA 1B4OA 3K7AH 5CV6A 1XNRL 1D7QA 1XMQL 4LMQD 5M5XB 2CCZA 2ZXRA 4PMCA 1S4ZA 2B29A 1UE1A 3KF8B 2IL8A 1CK1A 3R2TA 3S1RB 3I70A 4LF9L 1RL2A 3OOCA 3CXCA 1HNZQ 4BBSH 1Y8OB 4C1NK 5GROA 4L5RC 1N8RC 2Z0SA 3W1BA 2QILA 4JOIA 3HOWG 4QL5A 2OWOA 1GKHA 2SOBA 4ZCKA 4JPBW 1KDCA 2F3WA 3AQQA 1IYUA 2B8GA 5E7NA 2YTXA 4HIMA 1ASYA 2H1EA 4A93H 3H15A 5EKIA 2RSOA 4EQPA 2VW9A 2B2TA 5M3MB 4IJHA 2LFNA 2JA8G 2ZT9C 1N33Q 1MSGA 2QF7A 4IN3A 4B3RL 4ODGA 2A69D 1EYGA 3OTOL 4EX5A 2ZJPA 1UAPA 2BH2A 4BBRG 1I94L 4BWGB 3BZCA 3DEPA 4POGA 2HQLA 2JA6G 4HCSA 3MAQA 1WOCA 4V190 3HEJA 4JVZA 1EIFA 5HY6A 2KVMA 3CPWA 3L2PA 1WTHA 1L1OC 4IOAA 1BCPB 3HOXG 4O2DA 4DUYQ 5G3LD 1W3SA 4S3SA 1R4QB 4FXGC 3S1NH 1EWIA 1IBMQ 4GKJL 4LF4Q 2VXWA 4DR3Q 1KXLA 3EJIA 2TMPA 4QUFA 3TBIB 3LX0A 1SYBA 4DNRB 3TQYA 5JJIA 1F9SA 1A2TA 4A3JH 3GTLH 2DY8A 5IP9H 5AFWA 3H09A 5EGTA 5KGUA 3DM3A 1B9MA 3CPFA 1O80A 1SFOB 2V1CC 4H0LC 3M85A 1WTWA 1XMOQ 4RMFA 3M4PA 4ZUIA 1EQQA 5CR3A 1NNXA 3NENA 4UY8C 3Q0AA 4DAMA 1G8ZD 2VL6A 3PO3B 3DEOA 3NHHA 1X9NA 4FVMA 4K6DA 4DR6Q 2NN6H 2AWOA 3ERSX 5T1GA 3HOYB 2CKZB 4HMIA 4KY5A 1PRTD 5IOCA 2ENBA 3D8GA 1GO3E 2HDMA 1LTTD 2CVRA 3A74A 4DNTB 1FL0A 1LTGD 1X3GA 4BS9A 4F88A 3CMAA 4DAPA 2E74C 1X32A 2K75A 4ZAIA 3CKIB 2OQ0A 3P7JA 5CBAE 1YI2A 3D4WA 1XTCD 2B2WC 4CKBA 3BZDB 3RR5A 4OWTB 1N9WA 1SEBD 4U68A 3EBEA 5KNDA 4C2MB 1O78A 3P20A 4BBSB 1TS3A 2JN4A 3GTMB 4KKTA 2NYZD 1TWFB 4E6IA 1I3QB 4LF7Q 3RZOB 2R61A 3NBHB 3S17H 4PMWA 3NK9A 3HOXH 2J0TD 1VDZA 3EROA 3ZYYX 2A5HA 2Z6BA 1K0RA 1SAPA 3NQIA 3R93A 5IT9c 3IKJA 1DCZA 2AUJD 4A93G 2MPMA 4GLVB 1VQLA 1XXGA 4DR3L 3U58A 3H3VC 3BU2A 2XWJB 4WFN3 5E1FA 3SDZA 3A55A 4TVAB 4LF6Q 4QGUA 2XGTA 4R8IA 4YWKA 4QY7A 2QDBA 1TKWB 1STBA 3TRZA 3FPUB 2HT1A 3TS2A 1Q3LA 1YZ6A 3EN2A 4JI6L 2XIWA 1FR3A 4C56C 1G6PA 3ND9A 3M7NA 2UXCL 4Y7NB 1Y1WB 4DK0A 1CFMA 1V1PA 4Y52H 2WB1G 1D5MC 4NXMQ 1N34L 1VQKA 1NBWA 2RHSB 4M8AA 2IPKD 3EA6A 2I0QA 1EYCA 4K5XA 3T56B 2UUCL 3VR5A 1K8OA 2E2DC 1U4MA 3JAML 3MVVA 3QWNA 3TP6A 2CW0D 2F0HA 3A0JA 2RDFA 4XTCS 4JV5Q 1RIPA 4X3KA 1QVFA 3KOJA 3FKIG 4A3DB 3K57A 1GM5A 2JA9A 2F0PA 4JI5L 4GLXA 1HNZL 5COYA 3T1HL 2XNAC 3ITPA 4DV0Q 5GQOA 5D65A 1H9MA 3E6ZX 2XTIA 2VQEQ 2B2VC 1RTOA 4FDBA 4K0KQ 3K5LA 1FVIA 1XNRQ 1YJWA 4AYBB 1VQGA 4G7HC 2YV5A 1F77A 2EY2A 1UE7A 1F2ZA 3PMFA 1BF4A 1CKOA 4FF4A 4OL7A 2F03A 2MFIA 1QE6A 2B3GA 1F2MA 2NUCA 3I72A 1H9KA 1WTRA 2B63B 4C3HB 4DAVA 4HMJA 1EIYB 3OIQA 3KDFB 4IQZA 5GADC 1E22A 4DR1Q 1PHJA 3OYYA 3NBHA 3C3LA 3CCEA 4PG3A 3VA7A 4LF5Q 2EJFC 2FFKB 4ZUJA 2VNUD 3GTGB 3HP3A 1FNWA 3RZDH 1ZXTA 3BYTB 4MIUA 4P2CB 1EWHA 3NEMA 5BR8Q 3NTIA 2ICIA 4LFAQ 5C44H 1Q8KA 3ONAB 3M4OB 3D6CA 1U4PA 1TVXA 1PH3A 1IYJB 3IFTA 1SSOA 2K50A 4PZ8A 3H3VI 1UE6A 3L9AX 1DOKA 3E9HA 1Y69U 1UE5A 3VR4A 2SDFA 4GNXA 5TSSA 4UP9A 5FJ8G 4BA2I 2JE6I 4X65L 4UP8A 5JEAH 5K36H 1LV9A 4IZ8A 4YCWA 1DYQA 2K4KA 3J81L 1U9RA 3L3OC 2YU9H 1B9NA 2NTTA 3A56A 3MXGA 3WOFA 4AYBE 4BBRB 2QA4A 3HOZG 1S5DD 2IT1A 4OEMB 3G7LA 5KNCA 2Z4HA 2YYZA 4IALA 3VYUA 4YWLA 1XX8A 1Z47A 1KL9A 1TS4A 1Y8PB 2B2UC 5CGKA 3VA5A 4A3BB 2LXJA 2K04A 1NTGA 4LWCA 1TWHB 2F3IA 3CCMA 4GKKQ 3W3AA 4GNXC 4PV1C 3MXNB 3HOXB 2XSCA 3FRPB 2ZTCA 2PO4A 4R1JA 1PH4A 3H91A 1TWFH 4LF8Q 1K8AC 3GTKH 1SNOA 3M4QA 3FPPA 3J81j 1OXVA 2EYLA 2FJ2A 1YNND 4KJOA 4RGTA 3MXUA 3CU7A 1J5EL 1X3PA 2EIFA 2NVXB 2NVQB 2LSSA 1BBUA 4JW0A 5T1IA 1ICFB 1T5XD 4OX9L 2P5ZX 5IGGA 2WV6D 1X3EA 4LK1C 1LM0A 1Q86C 3KDFA 2NZ1D 2ZM6L 2VB3X 4XDXA 4CBVA 2RSNA 2K6AA 1GXDC 3K59A 3CQZB 4POFA 1F9PA 4JI3L 1HHVA 1AE2A 1YVCA 3DWPA 3J7ZC 1YHQA 5CV7A 3KYHC 4K5WA 1VQEA 4P73A 1SNDA 2MO1A 4FXKC 3CC7A 2XRQD 3V96A 1VQIA 1TQOA 4DXGA 5LMNL 4LUZA 1SE4A 2E5LQ 2KHIA 3RN2A 2MQHA 1MKHA 1IKMA 1EFID 3UDIA 2OT2A 4PZ6A 1OO9B 2F0MA 3F8TA 1EQTA 4GOPA 1WTPA 3GTQH 1NMFA 1WD0A 2M00A 4WJ3M 4DV7L 2N3SA 4K2KA 3DMUA 1NCVA 5JOBA 3STBD 2A19A 4QB4A 1PTOB 1ONLA 2PYKA 5KYLA 1T9HA 3I4MH 4K6LA 2F4VQ 3M3YH 5D3IB 2JA5B 3KBXA 4IUQA 4ZYSA 1RTNA 4BBSG 5IGEA 1WTQA 2UXCQ 3CC4A 2A6ED 4A3KH 4B3SQ 3S2HH 1WVLA 2BDNA 5HGQA 1JT8A 2N78A 4F87A 2ZJRA 4A3IG 2E76C 2A6HD 2KEEA 4RA8A 1EY0A 5FO9B 4A3IB 3OIPA 4YHHL 2X6GA 2I5LX 3I4NH 1VQMA 2PZWA 1W6JA 5FLXL 2I5HA 2K32A 1CHPD 1A3VA 3E3XA 2UU9L 2H4OA 1IYVA 3K8AA 1F9QA 3TREA 1KDBA 3DM1A 1T5EA 2JEBI 5JPMC 4MN3A 3T16A 1IL2A 2EY1A 5IYCG 2CH4W 4X66L 1MHWC 4XQNA 2MJ8A 4L8JA 4RCNA 4QJFA 1F2LA 1Q8IA 1M1KC 3GD7A 3SR1A 4HIDA 3RN5A 1Y1WG 1IXRA 4C3JG 4FF1A 2SEBD 3A7LA 4DUZQ 2NWGA 3FVQA 3I4MG 2RQXA 2JEAI 1SE2A 3QG1A 4OIJA 2AQ3B 4H13C 1E2ZA 4N8FA 3FP9A 2R92H 4B9XA 2K05A 4RHSA 3PUYA 2IX0A 3GP7A 3M7GA 5KEEA 2UUAQ 2DNEA 1U0LA 1A0IA 5IT9L 3T53B 1MI2A 1HXYD 3ICEA 4DK3C 3U9SA 3SE0A 2WKCA 4A3IH 3NQTA 1B70B 2LMCB 1KAAA 5C4JH 1J5EQ 3GTLB 3PSIA 3L7ZC 1KC8C 3LWUA 2IJ0A 4KMUC 2NVTB 3OW7A 4R4CA 1SYEA 4R4OA 2I5MX 2KHSA 4LW1A 2WFWA 5BN3A 2B2TC 2F0UA 3C1EA 5ELDA 3A7AB 1YNXA 5IE8A 3W1GA 1STAA 2Q8TA 2QEJC 3BVGA 4AYBG 1PXUA 4KY7A 4OXPA 1PRTC 2D0OA 3E5SA 2JA7B 1VQHA 3ER0A 4N9PA 1XPOA 4JOIC 2JA7G 3H0GH 2K52A 4KN4C 2CWPA 2NZHA 2AQ2B 5BN5A 3ULPA 4JC0A 4PZ7A 1IL8A 1ZYRD 1I3QH 3I73A 3RZOH 4JYAL 4DAYB 1QVGA 2MGSA 2N8NA 1LO5D 1L0XB 3S16H 2O2LD 4A3EH 2B2UA 4OWXB 2D62A 1O7ZA 1HNXQ 5M3FG 1HJPA 4I65A 1LTAD 3AYHB 3BG3A 1I4RA 3FKIH 2JSOA 1WCMB 2WB1E 4FP5D 5EPLA 4JV5L 2K5WA 4N9TA 1Q82C 1LUZA 1CT1D 4N8X1 3AMUA 1VF7A 2WAQE 4X64Q 4Y7NH 4X3SA 1EZ8A 2B2WA 2HCIA 4RGOS 4TQUS 3RUZA 4BA1I 4DNIA 4WJ4A 1S3OA 5IYBG 4LF5L 1I50B 1YBYA 4KD4A 4HN7A 1C4QA 1SYDA 3AB9A 4ULLA 5L37A 4FF3A 2M9VA 4A3MH 4EQNA 5K36G 3NUCA 4K0KL 2F3VA 1KQSA 4U673 5E4XA 5M5WH 4HEDA 1LT4D 1E1TA 1KLGD 1QUQB 4KJNA 2PZUA 5M5XH 4A3BH 3PUVA 5HURA 2E2IH 4P75A 2WB1B 3CHBD 3EQLC 2EE1A 4B9WA 3SK4A 1K83H 1VQ5A 3I4LA 1SR3A 3KBGA 1S72A 4G7ZC 3CCLA 2L0CA 3SHLA 3TN2A 4DV6Q 2Q2TA 1HR0W 2R92B 3RMHA 2V4DA 5I2YA 3BDCA 4CJ2C 1PFSA 1K3RA 3JAMi 4DR1L 1GUSA 3ERQA 4QF4A 3MZ5A 4ABNA 5FOBB 1OXSC 3GO5A 5C5LA 2BA0A 5C3WA 2D2CC 5M3MH 3GTJB 1CI3M 2YTYA 2B2VA 2XRSD 3AFPA 5FKAC 3VR3A 3C2PA 4I7AA 5C4ZA 4CKCA 1C48A 4JI8L 3S15B 1VQCA 2VS1A 2A8VA 5C3EH 4BXXG 2R6GA 4A3LH 1WD1A 4DV2Q 3KF8A 1FNUA 3N52A 3O13A 3MXNA 2L9HA 1JJGA 2K5HA 1JB3A 4LFCQ 2KUMA 3DXJC 3PO2B 4C3HH 1XPUA 1VS0A 2BE5D 3S24A 1RDPD 2O4XA 1HTPA 3DUZA 3GTOH 3I4OA 1NUCA 1KABA 2E75C 5EQ0A 4J6HA 1MJEA 5ELNA 2B63G 3K7AB 1FD7D 1LTID 5C5MA 1A62A 1UNSA 3A5ZB 4G57A 1EYAA 1I4QA 2JA5G 3HOWB 3JAME 3A8IE 4EQ5A 4HJ5A 4AQYL 1LT3D 4CJ1B 2DN8A 2RCNA 1LACA 2XWBB 2LXKA 3WOEA 4OELB 5JVH3 5I6WA 3HKZG 4K2LA 3TP8A 1BCPD 2JQOA 5M3FB 1IBLL 1C8CA 1STYA 4OGQC 4A3DH 2VQFL 2RVLA 4IO9A 1B7YB 4X65Q 4RWSC 1TY2A 3C46A 1FJGQ 3HS0C 3MA2B 2KECA 1SNPA 3WDNA 2KOLA 2EPBA 3FHWA 4DF7A 4M1UB 2PCFB 3W5OA 1QUQA 3J80E 2WIIB 4IPHA 1HZCA 3F2CA 3K6OA 1VQJA 1L0WA 2EJMA 2NZOA 2K03A 3U50C 3J81c 5C0XH 3NE5B 2C35B 2E2JB 1BDOA 2WP8J 3NWTA 3TP7A 1B3QA 2K5QA 2SNSA 2VZAA 4LFCL 1WTVA 5C4XH 5CMDA 3NELA 4YWMA 1EZ6A 2Z4IA 3BVZA 1C0AA 2EXZA 3PF4A 1QCBD 1YNJC 2ID0A 2PI2A 1JWMD 2B2YA 2HIXA 4X6AH 3U4VA 1VQ8A 3S2DH 4IFDH 2O5JC 3S1QH 1KD1C 2IX3A 1TS2A 4DUYL 1VQ4A 5DEHA 3EIVA 4UPAA 5M5YH 2UXBL 2AKWB 1SMXA 3RZDB 1Q7YC 1TXYA 1Q46A 3QJYA 1N36Q 4Q5VA 4RH6A 2JP1A 3H94A 1TY0A 1YEZA 4QIWB 2EY6A 3MEFA 5A2QL 1HQMC 1TIID 2RA4A 4DFAA 2AQ1B 1Q81C 1E2VA 3ZJYC 1V8QA 5KNBA 4A3LG 1FYCA 1RCVD 4JK1C 1TWAH 2BCOA 5BN4A 1PH7A 4IUTA 4NXNL 4H44C 2X69A 2EYHA 4NB3A 4DGZA 1CA5A 3NBIA 1R9TB 2VUMG 4DR5L 4PNYA 3D0FA 3J7A5 5LHY1 1ENCA 3CRLC 3MEHA 4IFDJ 2Q2HA 4DV5L 1OXXK 3PUXA 1JCKB 2B39A 4WRDA 1S40A 5JJZA 2N88A 3P75A 1SXTA 2NTSA 2HHHQ 2F4VL 3K5NA 3QIAA 4A3FB 3HOVH 1M90C 1BO0A 2RHQB 2GVBA 3TS0A 1PFNA 1VQOA 2OCEA 3J80i 1YJ9A 4UDUC 1QB5D 2RBMA 3M3YB 2IW3A 4KY6A 2AWNA 2F0VA 4KHZA 5FJ8H 4DKAC 4A3GG 1F2YA 4B3SL 3PO3H 1BKBA 1KHIA 2K14A 3HOVG 1NAPA 4IPGA 4YY3L 1HRJA 2R7ZH 4LF4L 2F0QA 1WCMH 4YIJA 5EKLA 1M8AA 5I4DA 5M5YB 2WACA 3KK7A 1CQVA 5DM63 2Z8LA 3J7AF 4J8QA 1RJTA 2KCNA 2Z1CA 2JA8B 3KJPA 1TWAB 1TWCH 2L11A 4A3JG 4HJ7A 1HZ9A 1YJNA 2EQSA 1PYBA 2D0PA 1IW7D 2OEOA 1G2TA 2NB0A 4JI7Q 2EY5A 1CM9A 2PW7A 3K80C 1Z6HA 3AEVA 1Y1VB 4HCEA 2ZXPA 4JI2Q 4HJ9A 4NW2A 5AJ3L 1A6XA 4L5QA 1HR0Q 5GAEC 5D3DA 1ML0D 5DLQE 1C9OA 3RD4A 3RLOA 3GTQB 3G71A 2Y0SG 1GHJA 1GUOA 4OONA 3OMGA 1X3QA 1J6QA 2R7DA 2EYFA 5EKKA 3BJUA 2PMZB 5IP9G 2ZTEA 2MO0A 3STBC 4GOPC 2BA1A 5FLXE 4ZKCB 4JI2L 4NKLA 1NSNS 3P1HA 4DK6C 2IHFA 2RKSA 1WI5A 3GTPB 4KD3A 1CZWA 1JOQA 2DNCA 2L5TA 3MTSA 3I91A 2QGQA 1I5FA 3UE1A 3Q23A 1PV4A 5LL6S 2DUDA 5J22A 4A76A 3KFUA 1QJOA 4JI0L 1HTLD 4C3IB 5F2DA 1I4HA 4YY3Q 2OTLA 2F0IA 1JB7A 1A63A 1D5ZC 1PLFA 1DOMA 2B8FA 1RD9D 3BVMA 1FJGL 5GAHC 2GA4B 1A3UA 3TSSA 4FXDA 2F0TA 2M2LA 1E2WA 4X64L 4AH6A 1O7LA 2YU9B 2E2HB 1TR5A 3Q8DA 3OTOQ 5I9OA 3NTKA 4TSSA 1PH8A 3HOYG 3TP5A 1YHBA 3I55A 5C6AA 1B2TA 5FO8B 4KHPQ 1OXUA 5ELEA 1HQRD 4YCVA 2RCFA 1G51A 3E0EA 4NXNQ 4XYOA 4X62L 5FLXc 4JI0Q 3PIPA 2Z9HA 2A6HC 2D9UA 5LMUL 2EYOA 3CF5A 1SN8A 1NJIC 5CYUA 4Z9CB 3GTPH 1GOZA 3CCRA 1EIHA 5IT9E 1N36L 4JI6Q 4CHTB 5IGDA 2R93G 1K0SA 3J81E 2KCCA 1PH2A 1K8GA 2N55A 2PPBC 4DR4L 1SYGA 4YCUA 2YTVA 4JG2A 4ZKBB 1FGUA 4GN3B 3QO2A 3VYSA 1W2BA 5C4HA 3IRBA 1C7YA 2WAQG 1XMQQ 2Z6KA 4UHVA 4IJLA 1KAWA 2G9HD 3ND8A 2PMZE 2UUBL 1L2FA 5EJWA 2HDLA 3MWYW 3G4SA 3UE0A 3S14H 3HRZC 4BY7B 5I6YA 4BY1H 3PCOB 1EQVA 5ELFA 4JBMA 3PIOA 1LT6D 2NVTH 2CFMA 4LF6L 5E4WC 2IY5B 3G6EA 3SXHA 1DONA 5IP7H 1SMYD 4WJWA 1K83B 2JA8H 2KEDA 4XIGS 4YHHQ 2Y0SB 1G91A 2BOSA 4A3BG 2DY7A 1HH2P 2PI2E 2F0KA 4UAIA 5E3FA 4RGMA 1BVSA 3OPOA 1MBYA 3Q22A 1UUPA 2QKIC 1TWGH 2R93H 3EVQA 2WINB 1HCZA 1AZPA 2JA5H 2R92G 1B1ZA 5EBCA 2LY7A 1SROA 4KHVA 1LTSD 1BCPF 1BCPC 2IWHA 4B3TQ 1AN8A 5JAVA 5CBEE 4P72A 3KLSA 1KNAA 2F1MA 1CSQA 2B2YC 3VYTA 1A2UA 3U4ZA 3S15H 1RHPA 1EFWA 2JK8A 2NVYH 3MFGA 2KA7A 4NMZA 4QUCA 3FKIB 1CHQD 4KV6A 2A68D 3SEBA 1IW7C 3GTJH 2F0NA 4X3UA 4IFDG 4OX9Q 3IAYA 4A3MG 1PH5A 1KTKA 4B3MQ 1RODA 3FEWX 2MUYA 3R8BA 2Y0SE 3HOYH 4RCOA 1SMYC 2K1BA 3HOZH 1VQNA 5J3BA 1PRTB 4G7OC 2RF4A 5JEAG 3HKZE 3IL8A 4MTKA 1JMCA 1D2BA 3KLRA 2IHEA 3I8ZA 1SRUA 1V1QA 1U5KA 1HFGA 2VUMB 4IOCA 2CH4A 3X3NA 1ILQA 2FXQA 4DR7Q 2K5VA 4KK7A 4KTAA 4FYDA 2A1AA 5C0XI 2J4XA 2E2IB 1GJXA 5M5WB 1WTXA 5IODA 3H6MA 1K3BC 2OF1A 1AEXA 5ELCA 4DR5Q 2X6LA 4DV7Q 1Q12A 2A74C 4FNFA 5CC4A 3GTKB 3HOVB 1CKNA 3JC66 3UDFA 5DAUA 4RAUC 4ZLTF 5C4XG 2Z6KC 1TU2B 1R4PB 4OWWB 3HKZB 1JICA 5C0XJ 4RKLA 2WKDA 3VYRA 1AE3A 5C4JB 2XVSA 2L4NA 4KN7C 4DR2L 4XT3B 2GVAA 4R8NA 4ZQ3A 1WCMG 1EQRA 3K81C 2G5DA 2Q2UA 4CDEC 4L5SA 3OHXC 4EQOA 1EU4A 2GN5A 1HUMA 2K33A 1AH9A 4MHEA 4B08A 4BBRH 5CORA 2E8GA 1VQDA 3KLWA 4DA2A 3E0JA 2KCMA 1D6EC 5FO7B 1LT5D 5JJKA 3D4RA 2TSSA 2C9OA 4OO1I 4QIWE 2F0EA 4PMBA 3HOUG 1QOHA 2ES2A 1ZKOA 4GNXB 4JBKA 3H3VH 3SVMA 3H0GB 4NDXA 1MD2D 1JR0D 1B50A 5IYCH 4HSPA 1HZBA 1JJ2A 3I4MB 4JBJA 1F9RA 5IIFA 2N49A 5NUCA 1EY4A 1CTMA 1SYFA 3CCSA 4LJZC 4Q0FA 4RFBA 3T4AC 1BNZA 5AJ3Q 2UXDQ 3UDGA 4L6TB 3VR6A 4HIOA 2OQKA 4G4KA 2F52A 2E5LL 3CD6A 1BQQT
chains in the Genus database with same CATH topology
2I46A 4KI0A 1OXTA 3K5OA 1J9OA 2PW5A 3TDQA 1W6KA 1K8MA 3NPPA 1G291 1JOKA 3PIO3 1ZEQX 4DU9A 3T51B 1SNMA 2RDGA 5I9PA 1V1OA 3T13A 3FMCA 2PQEA 2A68C 2PZTA 3Q24A 1HUNA 2F0FA 3D6WA 5HGTA 1WTOA 1U4LA 1ET6A 1HFNA 5C3XA 5CV8A 4PQXA 3M4YA 4KKSA 1EEID 3DHQA 4OIKA 4RKBA 1PTOH 4A3GB 1G2SA 1SJHD 3OWFA 4XXEA 3QB3A 2CQAA 1D5XC 1S5ED 1BR9A 3MC0B 3MFYA 1AFPA 2HUGA 2EYPA 2EYMA 1EWCA 2F4IA 2JXMB 4HSVA 4HR7B 4RHRA 2R3ZA 2K28A 1DXMA 3S2DB 4XQQA 1S5BD 3IFDA 3HZXA 4V0BA 1QNKA 1STGA 5C3EB 2L55A 3TZUA 1Y8NB 1GUWA 1FGBD 1NR4A 3HOUB 1BUVT 3FDTA 3S9WA 1EL0A 1J8IA 2G9DA 3UI2A 3F2UA 1CZGA 3S16B 4DAYA 1ILPA 4ZK9B 1PZID 2EJGC 1JOOA 2BE5C 5IGCA 1H9SB 3Q6SA 4K5VA 2XN9C 2EDGA 2NVYB 1IHZA 3DWAA 1ICWA 2I07B 3PUWA 1JC7A 3R2IA 4DN4M 4A3MB 2F0DA 1IKLA 2Q8IB 1EY8A 3PUZA 2NN6G 5I2XA 3S1NB 1PTOF 1DM0B 5EPKA 2O5IC 1JE4A 1EY6A 5KIXA 5M9OA 1AZQA 1I4PA 1NR2A 3W2DA 1EOTA 4CJ0B 1ZYRC 2F0GA 4OO1G 3OWEB 5LL6X 3PIP3 2R7ZB 1QG7A 1ESRA 3CRKC 5C4XB 4A3EB 2EZVA 1GUTA 1LTBD 1PRTF 3J7YW 4I7ZC 5A35A 1LABA 1MGSA 1H9SA 4A93B 2EOTA 3S1QB 1E0BA 1LLRD 1EYDA 4O1NA 4ILWA 3TZDA 3DWQA 1JWSD 1U4RA 2NBFA 2J7ZA 3HGBA 5K5PA 4L63B 3BYYB 1B3AA 1SJED 5EBDA 1H9RA 4CGYB 1EY5A 1II3A 3GTOB 2HCCA 1QILA 1AW7A 5DM73 1SDFA 5C0XG 1BXTA 1RF2D 4OHJA 1EEFD 2L12A 5IGBA 4IUVA 4K8JA 5CV4A 2K5DA 1TS5A 4TKOB 2A69C 2MP1A 2OXPA 3BDOA 4F8MA 1STEA 1GUGA 3I90A 3LWEA 4KKUA 1STHA 4RGNA 4IURA 5EPJA 1HA5A 2Q8RE 4IFDI 1HA6A 4ID6A 4C1NI 3K5MA 3BDLA 3EFXD 3URYA 1PYWD 5A2QE 2F0OA 1ENAA 1PFMA 2ZXOA 2F0SA 3I4NB 1A3TA 3KLSX 2A6EC 1STNA 4OO1H 4F7XA 3X3MA 4IUPA 4FF2A 2D5DA 3NTHA 3MXPA 4C3HG 3I3CA 2JYOA 2ICEC 3TMEA 3QOJA 3D31A 3D4DA 1PDQA 1DZ1A 1B44D 2KQ3A 2AUKA 1TWGB 1I4GA 3NXWA 4GZYC 1KNEA 1M4VA 1HPCA 4WORA 4EGVA 1UEAB 2R93B 5FK9C 1AP0A 5DNFA 3SK8A 1Q90A 2CW0C 1V43A 1ET9A 2CHBD 3MHBA 1L0YB 2WAQB 3S17B 2SNMA 4R9WA 2HQEA 4JBWA 2A73B 5G3LF 1PFBA 1D1IA 1Z7TA 1SNCA 3HOZB 2L1BA 4X3TA 2QCPX 3G6JB 1A15A 2FINB 3J7AV 5ELBA 1EU3A 3V2TA 2BDOA 4XQJA 1VMCA 1PMRA 3U9OA 5C44B 1VCIA 1ENFA 1JQYD 1BOSA 4C3JB 1SE3A 3GQBA 5J1ZA 2MHVA 1I4XA 2C5CA 3GV6A 1TWCB 1S5CD 5ISRA 3NSWA 1B53A 1CA6A 1D1KA 5CV5A 1V1PB 2K7VA 1ESFA 1QNUA 4C3IG 4TRDA 4EVOA 3SK5A 4FO2A 3QOLA 3OSOA 4NP5A 3HG9A 4DK1A 4BY1B 1MSHA 2EYJA 1QWYA 2FHTA 4LAAA 1H9JA 5D14A 1Q1BA 2LKVA 1GUNA 4J1MA 1SNQA 2VB2X 1YNNC 1DD2A 4H7BA 4ZRZA 2IX1A 1CQFA 3C1FA 2F0WA 2FMCA 5KYIA 5IGFA 2FMMA 4IUUA 2RDHA 5JEAJ 3OMCA 4QCLA 2F0LA 1VF5C 1VMPA 1PTOC 1G6ZA 1Q1EA 1KLUD 5JPNC 3S1MB 3VR2A 1DOLA 3SK6A 4O42A 4ME5A 3K0YA 1EY7A 1I6VC 4XT1B 4HTHA 3AU7A 1EY9A 4CKEA 4HAEA 5JVG3 4A3JB 1JORA 1PTOD 1XYIA 2PNRC 1DJRD 1LTRD 3KUPA 2JA6B 4XYQA 2KJXA 1FNVA 3GV3A 5CV9A 3PV0A 3S2HB 1RKNA 1JWUD 5KRUA 1KDAA 4K8IA 4QMGA 3A8JE 2NN6I 3A8KE 1PZKD 1EIGA 1YNJD 4IUNA 3J80L 3S14B 1BBXC 3RLFA 3LNNA 1S5FD 1SYCA 1SBBB 3A54A 3K58A 4A3KB 4K14A 2F0JA 3V05A 2K01A 3D3RA 3NWSA 3R3OA 2EVBA 3N6RA 3NP8A 1TT2A 1GHKA 3BS1A 1O7YA 1PZJD 2LS01 4DXFA 1XWEA 1I6HB 5J39A 1B4OA 5CV6A 4LMQD 5M5XB 2ZXRA 4PMCA 1S4ZA 2IL8A 1CK1A 3R2TA 3S1RB 3I70A 3OOCA 1Y8OB 4C1NK 2QILA 2SOBA 1KDCA 2F3WA 1IYUA 2B8GA 2H1EA 5EKIA 2RSOA 4EQPA 2B2TA 5M3MB 2LFNA 2ZT9C 1MSGA 2QF7A 4IN3A 4ODGA 2A69D 1UAPA 4BWGB 3DEPA 4HCSA 3MAQA 4V190 3HEJA 2KVMA 1BCPB 5G3LD 4S3SA 1R4QB 4FXGC 2VXWA 3EJIA 2TMPA 4QUFA 3TBIB 3LX0A 1SYBA 4DNRB 1F9SA 1A2TA 2DY8A 5AFWA 3H09A 5EGTA 5KGUA 1B9MA 1O80A 1SFOB 4H0LC 3M85A 1WTWA 4ZUIA 5CR3A 3Q0AA 3PO3B 1G8ZD 3DEOA 3NHHA 4FVMA 4K6DA 2NN6H 2AWOA 5T1GA 3HOYB 4HMIA 4KY5A 1PRTD 5IOCA 2ENBA 3D8GA 2HDMA 1LTTD 2CVRA 4DNTB 1LTGD 4BS9A 4F88A 4DAPA 2E74C 1X32A 4ZAIA 3CKIB 3P7JA 5CBAE 3D4WA 1XTCD 2B2WC 4CKBA 3BZDB 5KNDA 1SEBD 4U68A 4C2MB 1O78A 3P20A 4BBSB 1TS3A 3GTMB 4KKTA 2NYZD 1TWFB 4E6IA 1I3QB 3RZOB 2R61A 4PMWA 3NK9A 2J0TD 1VDZA 3EROA 3ZYYX 2A5HA 1SAPA 3R93A 3NQIA 3IKJA 1DCZA 2AUJD 2MPMA 1XXGA 3H3VC 2XWJB 4WFN3 5E1FA 3SDZA 3A55A 4R8IA 2QDBA 1TKWB 1STBA 3FPUB 1Q3LA 2XIWA 1FR3A 4C56C 3ND9A 3M7NA 4Y7NB 1Y1WB 4DK0A 1CFMA 1V1PA 1D5MC 4M8AA 2IPKD 3EA6A 1EYCA 4K5XA 3T56B 1K8OA 3VR5A 2E2DC 1U4MA 3JAML 3MVVA 3QWNA 3TP6A 2CW0D 2F0HA 2RDFA 4XTCS 4X3KA 4A3DB 3K57A 2F0PA 5COYA 2XNAC 3ITPA 5D65A 1H9MA 3E6ZX 2B2VC 1RTOA 3K5LA 4AYBB 4G7HC 1F77A 2EY2A 1F2ZA 3PMFA 1BF4A 4FF4A 4OL7A 2F03A 1QE6A 1F2MA 2NUCA 3I72A 1H9KA 1WTRA 2B63B 4C3HB 4DAVA 4HMJA 3OIQA 4IQZA 3NBHA 3C3LA 3VA7A 2VNUD 2EJFC 2FFKB 4ZUJA 3GTGB 3HP3A 1FNWA 1ZXTA 3BYTB 4MIUA 4P2CB 1EWHA 3NTIA 2ICIA 3ONAB 3M4OB 3D6CA 1U4PA 1TVXA 3IFTA 1SSOA 3L9AX 1DOKA 1Y69U 3VR4A 2SDFA 5TSSA 4BA2I 2JE6I 5JEAH 5K36H 1LV9A 4IZ8A 1DYQA 3J81L 1U9RA 3L3OC 1B9NA 2NTTA 3A56A 3WOFA 3MXGA 4BBRB 1S5DD 2IT1A 3G7LA 5KNCA 2Z4HA 2YYZA 4IALA 3VYUA 1XX8A 1Z47A 1TS4A 2B2UC 1Y8PB 5CGKA 3VA5A 4A3BB 2K04A 1TWHB 3W3AA 4PV1C 3HOXB 2XSCA 3FRPB 2PO4A 3H91A 1SNOA 3FPPA 1OXVA 2EYLA 2FJ2A 1YNND 4KJOA 4RGTA 3MXUA 3CU7A 1X3PA 2NVXB 2NVQB 5T1IA 1T5XD 5IGGA 2WV6D 4LK1C 2NZ1D 2VB3X 4XDXA 4CBVA 2RSNA 2K6AA 1GXDC 3K59A 3CQZB 1F9PA 1HHVA 3DWPA 5CV7A 4K5WA 1SNDA 4FXKC 2XRQD 3V96A 1TQOA 4DXGA 1SE4A 1IKMA 1EFID 2OT2A 1OO9B 2F0MA 1EQTA 1WTPA 1WD0A 2M00A 4K2KA 3DMUA 1NCVA 5JOBA 4QB4A 1PTOB 1ONLA 2PYKA 5KYLA 4K6LA 5D3IB 2JA5B 3KBXA 4IUQA 4ZYSA 1RTNA 5IGEA 1WTQA 2A6ED 1WVLA 2BDNA 4F87A 2E76C 2A6HD 2KEEA 4RA8A 1EY0A 5FO9B 4A3IB 3OIPA 2X6GA 2PZWA 1W6JA 5FLXL 2K32A 1CHPD 1A3VA 2H4OA 1IYVA 1F9QA 1KDBA 3DM1A 1T5EA 5JPMC 2JEBI 4MN3A 3T16A 2EY1A 4XQNA 2MJ8A 4L8JA 4RCNA 1F2LA 1Q8IA 3GD7A 3SR1A 4FF1A 4C3JG 2SEBD 3A7LA 2NWGA 3FVQA 2RQXA 2JEAI 1SE2A 3QG1A 4OIJA 2AQ3B 4H13C 1E2ZA 4B9XA 2K05A 4RHSA 2IX0A 3M7GA 5KEEA 3GP7A 3PUYA 2DNEA 5IT9L 3T53B 1MI2A 1HXYD 3U9SA 3SE0A 2WKCA 3NQTA 2LMCB 1KAAA 3GTLB 3L7ZC 3LWUA 2IJ0A 4KMUC 2NVTB 3OW7A 1SYEA 2KHSA 5BN3A 2B2TC 2F0UA 3C1EA 5ELDA 3A7AB 1STAA 2Q8TA 2QEJC 3BVGA 1PXUA 4KY7A 3E5SA 1PRTC 2JA7B 4N9PA 4KN4C 5BN5A 2AQ2B 1IL8A 1ZYRD 3I73A 2MGSA 1LO5D 1L0XB 2O2LD 2B2UA 2D62A 1O7ZA 4I65A 1LTAD 3BG3A 1I4RA 2JSOA 1WCMB 5EPLA 4FP5D 2K5WA 4N9TA 3AMUA 1CT1D 1VF7A 4X3SA 1EZ8A 2B2WA 2HCIA 4RGOS 4TQUS 3RUZA 4BA1I 1I50B 4KD4A 4HN7A 1C4QA 1SYDA 3AB9A 4ULLA 4FF3A 2M9VA 4EQNA 5K36G 3NUCA 2F3VA 4U673 5E4XA 4HEDA 1LT4D 1KLGD 4KJNA 2PZUA 3PUVA 5HURA 2WB1B 3CHBD 3EQLC 2EE1A 4B9WA 3SK4A 3I4LA 3KBGA 4G7ZC 2L0CA 3SHLA 3TN2A 2R92B 3RMHA 2V4DA 5I2YA 3BDCA 4CJ2C 1GUSA 3ERQA 4QF4A 3MZ5A 4ABNA 5FOBB 1OXSC 3GO5A 5C5LA 2BA0A 5C3WA 2D2CC 3GTJB 1CI3M 2B2VA 2XRSD 5FKAC 3VR3A 3C2PA 5C4ZA 4CKCA 1C48A 3S15B 2R6GA 1WD1A 3KF8A 1FNUA 3N52A 3O13A 3MXNA 2L9HA 1JB3A 2KUMA 3DXJC 3PO2B 2BE5D 1RDPD 2O4XA 1HTPA 3DUZA 1NUCA 1KABA 2E75C 5EQ0A 4J6HA 3K7AB 1FD7D 1LTID 5C5MA 1UNSA 4G57A 1EYAA 1I4QA 3HOWB 3JAME 3A8IE 1LT3D 4CJ1B 2DN8A 1LACA 2XWBB 3WOEA 5JVH3 5I6WA 4K2LA 3TP8A 1BCPD 5M3FB 1C8CA 1STYA 4OGQC 2RVLA 4RWSC 1TY2A 3C46A 3HS0C 3MA2B 2KECA 1SNPA 3WDNA 2KOLA 2EPBA 4DF7A 4M1UB 2PCFB 3J80E 2WIIB 3K6OA 2EJMA 2K03A 5C0XH 3NE5B 2E2JB 1BDOA 2WP8J 3NWTA 3TP7A 2K5QA 2SNSA 1WTVA 5CMDA 1EZ6A 2Z4IA 3BVZA 2EXZA 1QCBD 1YNJC 2ID0A 1JWMD 2B2YA 4IFDH 2O5JC 2IX3A 1TS2A 5DEHA 3RZDB 3QJYA 4Q5VA 4RH6A 2JP1A 3H94A 1TY0A 4QIWB 2EY6A 5A2QL 1HQMC 1TIID 2RA4A 4DFAA 2AQ1B 1E2VA 1V8QA 5KNBA 1FYCA 1RCVD 4JK1C 2BCOA 5BN4A 4IUTA 4H44C 2X69A 2EYHA 4DGZA 1CA5A 3NBIA 1R9TB 4PNYA 5LHY1 1ENCA 3CRLC 3MEHA 4IFDJ 1OXXK 3PUXA 1JCKB 2B39A 4WRDA 5JJZA 2N88A 3P75A 1SXTA 2NTSA 3K5NA 3QIAA 4A3FB 1BO0A 1PFNA 4UDUC 1QB5D 2RBMA 3M3YB 2IW3A 4KY6A 2AWNA 2F0VA 4KHZA 1F2YA 1NAPA 1HRJA 2F0QA 4YIJA 5EKLA 1M8AA 5I4DA 5M5YB 2WACA 3KK7A 1CQVA 5DM63 2Z8LA 3J7AF 4J8QA 1RJTA 2KCNA 2Z1CA 2JA8B 1TWAB 2L11A 2OEOA 1IW7D 1G2TA 2NB0A 2EY5A 1CM9A 2PW7A 1Z6HA 1Y1VB 4HCEA 2ZXPA 4NW2A 1A6XA 5D3DA 1ML0D 3RD4A 3GTQB 1GHJA 1GUOA 3OMGA 1X3QA 2EYFA 5EKKA 2PMZB 2BA1A 5FLXE 4ZKCB 4NKLA 1NSNS 3P1HA 2RKSA 3GTPB 4KD3A 1CZWA 1JOQA 2DNCA 2L5TA 3MTSA 3I91A 3Q23A 5LL6S 5J22A 1QJOA 1HTLD 4C3IB 5F2DA 1I4HA 2F0IA 1D5ZC 1PLFA 1DOMA 2B8FA 1RD9D 3BVMA 2GA4B 1A3UA 3TSSA 4FXDA 2F0TA 2M2LA 1E2WA 1O7LA 2YU9B 2E2HB 1TR5A 5I9OA 3NTKA 4TSSA 3TP5A 5C6AA 1B2TA 5FO8B 1OXUA 5ELEA 1HQRD 4XYOA 2A6HC 2D9UA 2EYOA 5CYUA 4Z9CB 1GOZA 1EIHA 5IT9E 4CHTB 5IGDA 3J81E 2KCCA 2N55A 2PPBC 1SYGA 4ZKBB 3QO2A 3VYSA 5C4HA 2G9HD 3ND8A 5EJWA 2HDLA 3MWYW 3HRZC 4BY7B 5I6YA 1EQVA 5ELFA 1LT6D 5E4WC 3SXHA 1DONA 1SMYD 4WJWA 1K83B 2KEDA 4XIGS 2Y0SB 1G91A 2BOSA 2DY7A 2F0KA 4UAIA 5E3FA 4RGMA 3OPOA 1MBYA 3Q22A 1UUPA 2QKIC 3EVQA 2WINB 1HCZA 1AZPA 1B1ZA 5EBCA 2LY7A 4KHVA 1LTSD 1BCPF 1BCPC 2IWHA 1AN8A 5JAVA 5CBEE 3KLSA 1KNAA 2F1MA 2B2YC 3VYTA 1A2UA 1RHPA 3MFGA 2KA7A 4NMZA 4QUCA 3FKIB 1CHQD 4KV6A 2A68D 3SEBA 1IW7C 4IFDG 2F0NA 4X3UA 3IAYA 1KTKA 1RODA 3FEWX 2MUYA 3R8BA 4RCOA 1SMYC 2K1BA 1PRTB 4G7OC 5JEAG 3IL8A 1D2BA 3KLRA 3I8ZA 1HFGA 2VUMB 3X3NA 1ILQA 4KK7A 4KTAA 4FYDA 5C0XI 2J4XA 2E2IB 1GJXA 5M5WB 1WTXA 5IODA 3H6MA 2OF1A 1AEXA 5ELCA 2X6LA 1Q12A 2A74C 4FNFA 5CC4A 3GTKB 3HOVB 5DAUA 4RAUC 4ZLTF 1TU2B 1R4PB 3HKZB 1JICA 5C0XJ 4RKLA 2WKDA 3VYRA 5C4JB 2XVSA 2L4NA 4KN7C 4XT3B 4R8NA 4ZQ3A 3OHXC 4EQOA 1EU4A 1HUMA 2K33A 4MHEA 4B08A 5CORA 4DA2A 3E0JA 1D6EC 5FO7B 1LT5D 3D4RA 2TSSA 2C9OA 4OO1I 2F0EA 4PMBA 1QOHA 1ZKOA 3SVMA 3H0GB 4NDXA 1MD2D 1JR0D 1B50A 4HSPA 3I4MB 1F9RA 5IIFA 5NUCA 1EY4A 1CTMA 1SYFA 4LJZC 4Q0FA 4RFBA 3T4AC 1BNZA 4L6TB 3VR6A 4G4KA 1BQQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A74 C;  2J0T D;  3OHX C;  1D2B A;  3CKI B;  1UEA B;  5JPN C;  3HS0 C;  3G6J B;  2E2D C;  5FOB B;  3MA2 B;  2TMP A;  3I70 A;  5FO8 B;  5FO9 B;  2I07 B;  3HRZ C;  1JB3 A;  1JC7 A;  2QKI C;  2XWB B;  3CU7 A;  1BR9 A;  4FXK C;  2ICE C;  2XWJ B;  3T4A C;  2WIN B;  5FO7 B;  1PXU A;  4FXG C;  3V96 A;  1XWE A;  1BUV T;  3FRP B;  1UAP A;  4ILW A;  2A73 B;  2B39 A;  1OO9 B;  3L3O C;  3KLS A;  5JPM C;  1BQQ T;  2WII B;  1GXD C; 
#chains in the Genus database with same CATH topology
 2I46 A;  4KI0 A;  1OXT A;  3K5O A;  1HNX L;  1J9O A;  2PW5 A;  3TDQ A;  1W6K A;  1K8M A;  1EUJ A;  3K0X A;  3NPP A;  1G29 1;  1PH9 A;  1JOK A;  5FLM H;  3PIO 3;  4NXM L;  1ZEQ X;  4DU9 A;  5IP7 G;  3T51 B;  1I50 H;  1SNM A;  5ELO A;  4LF7 L;  2RDG A;  5I9P A;  4LF9 Q;  1V1O A;  3T13 A;  3FMC A;  2PQE A;  2A68 C;  2PZT A;  4IPD A;  3VDY A;  3G48 A;  3Q24 A;  1HUN A;  2K5N A;  1N32 Q;  1CKM A;  2F0F A;  3D6W A;  5HGT A;  1WTO A;  1U4L A;  1ET6 A;  3HKS A;  1HFN A;  3KF6 B;  4LF8 L;  5C3X A;  5CV8 A;  1YIT A;  4PQX A;  3M4Y A;  1X6O A;  1VQ9 A;  4KKS A;  4R4Q A;  1EEI D;  3DHQ A;  4OIK A;  4RKB A;  1PTO H;  4A3G B;  1G2S A;  4CDF C;  1X55 A;  1SJH D;  3OWF A;  4XXE A;  5LMN Q;  3QB3 A;  2CQA A;  4O0A A;  1D5X C;  1PYS B;  1S5E D;  1KRS A;  1BR9 A;  1SFO H;  2UUB Q;  3MC0 B;  1N34 Q;  3MFY A;  1AFP A;  2HUG A;  2EYP A;  2EYM A;  1EWC A;  4IPC A;  1IZ6 A;  2F4I A;  2JXM B;  1YIJ A;  4HSV A;  3K7U C;  4HR7 B;  4RHR A;  4MZ9 A;  2R3Z A;  4HJ8 A;  2K28 A;  1DXM A;  3S2D B;  1Y1V H;  4XQQ A;  1S5B D;  2JJQ A;  3HZX A;  3IFD A;  1CUK A;  4V0B A;  4RG1 A;  4LFB Q;  1XNQ L;  1KIX A;  1QNK A;  1STG A;  1WFQ A;  5C3E B;  3LGJ A;  4A4I A;  5IWA L;  2L55 A;  4BY7 H;  3TZU A;  1Y8N B;  1GUW A;  5GAG C;  4GKJ Q;  1FGB D;  1X65 A;  3PF5 A;  1NR4 A;  3HOU B;  1DGS A;  1GD7 A;  2JA7 H;  1BUV T;  3FDT A;  4DV0 L;  5IYD G;  3S9W A;  3A5U A;  1EL0 A;  1J8I A;  2G9D A;  3UI2 A;  4GOP B;  3F2U A;  1CZG A;  3S16 B;  4DAY A;  2QW7 A;  1ILP A;  4ZK9 B;  1PZI D;  1OTC A;  2JA6 H;  1KRT A;  2EJG C;  4DV4 L;  1JOO A;  4R4I A;  4A3F H;  3F2D A;  3GTM H;  2BE5 C;  5IGC A;  1H9S B;  3Q6S A;  2HD3 A;  4K5V A;  4CDD C;  2XN9 C;  2EDG A;  3L0O A;  3M9B A;  1P16 A;  2VY3 A;  1SE8 A;  1HR0 L;  2NVY B;  4DUZ L;  1IHZ A;  2OTJ A;  3DWA A;  2NVX H;  1ICW A;  2HHH L;  1XMO L;  3PO3 G;  2I07 B;  2KBN A;  3PUW A;  3GTG H;  1JC7 A;  3R2I A;  4DN4 M;  4A3M B;  2F0D A;  4LUO A;  1Y14 B;  1IKL A;  2MNA A;  2Q8I B;  1EY8 A;  1L1O A;  2NN6 G;  3PUZ A;  1B8A A;  2HIV A;  4KHP L;  3QR8 A;  5I2X A;  3S1N B;  1PTO F;  1DM0 B;  5EPK A;  3CME A;  2O5I C;  2L15 A;  1JE4 A;  1EOV A;  1EY6 A;  2B63 H;  5KIX A;  5M9O A;  1AZQ A;  1I4P A;  1NR2 A;  5LMU Q;  3W2D A;  1EOT A;  2VUM H;  1D8L A;  2R7Z G;  4CJ0 B;  1E1O A;  3SGI A;  1JE5 A;  1ZYR C;  2F0G A;  4OO1 G;  3OWE B;  5LL6 X;  3PIP 3;  2R7Z B;  1QG7 A;  1NE3 A;  1ESR A;  3CRK C;  3CCQ A;  5C4X B;  3PQI A;  4A3E B;  1UEB A;  2EZV A;  4JI3 Q;  4A75 A;  1GUT A;  4KLK A;  1LTB D;  1CSP A;  1YHA A;  4DR6 L;  1PRT F;  3J7Y W;  5FLM G;  4I7Z C;  1H95 A;  1V9P A;  1X3F A;  4R4T A;  5A35 A;  1JJC B;  1LAB A;  1MGS A;  1H9S A;  4A93 B;  2EOT A;  3S1Q B;  1E0B A;  4ME3 A;  5M3M G;  1LLR D;  5M3F H;  3I56 A;  1EYD A;  4JI1 L;  4O1N A;  1I6H H;  4ILW A;  1WJJ A;  3TZD A;  3DWQ A;  4DR2 Q;  4BY7 G;  5JJL A;  1JWS D;  4B3M L;  1U4R A;  2NBF A;  2J7Z A;  3RNU A;  3HGB A;  5K5P A;  4L63 B;  1SLJ A;  4LFB L;  3BYY B;  1B3A A;  1SJE D;  2ZTD A;  5EBD A;  1H9R A;  3BZK A;  4CGY B;  1EY5 A;  1II3 A;  3H0G G;  3UDX A;  3GTO B;  2PQA B;  4C3J H;  2HCC A;  1QIL A;  1AW7 A;  1GVP A;  5DM7 3;  2UUC Q;  1SDF A;  5C0X G;  2ZM6 Q;  4L5T A;  1BXT A;  1HNW Q;  3F1Z A;  1RF2 D;  4OHJ A;  1ASZ A;  1EEF D;  2L12 A;  5IGB A;  4IUV A;  3I2Z A;  3CAM A;  4K8J A;  5CV4 A;  1QZG A;  2K5D A;  1TS5 A;  4TKO B;  2A69 C;  2MP1 A;  2OXP A;  3BDO A;  4F8M A;  1STE A;  4JI4 L;  1GUG A;  3I90 A;  3LWE A;  4KKU A;  1STH A;  4RGN A;  3CC2 A;  4IUR A;  4MNO A;  2E2J H;  4DPG A;  3I7F A;  4A3D G;  5EPJ A;  1HA5 A;  2Q8R E;  4IFD I;  1UWV A;  1HA6 A;  1E7Z A;  4ID6 A;  4C1N I;  2R7F A;  3K5M A;  5IY0 A;  3S1M H;  3BDL A;  1WYD A;  1PH6 A;  3EFX D;  4QQB X;  4X62 Q;  3URY A;  4DV3 Q;  1PYW D;  5A2Q E;  2F0O A;  1ENA A;  1LTL A;  2UXD L;  4B3R Q;  4BY1 G;  1PFM A;  1XTD A;  2ZXO A;  4LNQ A;  2F0S A;  3I4N B;  1A3T A;  3KLS X;  1N32 L;  4JI4 Q;  2A6E C;  1STN A;  4OO1 H;  4F7X A;  3X3M A;  4IUP A;  2D5D A;  4FF2 A;  3NTH A;  1VQ6 A;  3KF6 A;  4DV1 L;  3PO2 G;  1Y1W H;  3MXP A;  1HZA A;  3KJO A;  4P74 A;  4C3H G;  3I3C A;  2JYO A;  4LFA L;  2EXD A;  2ICE C;  3TME A;  3QOJ A;  1HNW L;  4DV6 L;  1CKN B;  1QZH A;  4A3C H;  3D31 A;  4UP7 A;  4C2M H;  3D4D A;  1PDQ A;  1DZ1 A;  1B44 D;  2KQ3 A;  1K73 C;  2AUK A;  1TWG B;  2QDL A;  4X66 Q;  1I4G A;  3T1H Q;  3F2B A;  4J15 A;  3NXW A;  4GZY C;  2PQA A;  1KNE A;  1M4V A;  1HPC A;  4WOR A;  4EGV A;  1UEA B;  2R93 B;  4JCV E;  5FK9 C;  1AP0 A;  5DNF A;  3SK8 A;  1PH1 A;  1Q90 A;  2CW0 C;  2ALY B;  4DV5 Q;  1O7I A;  1E3P A;  1XNQ Q;  1V43 A;  1ET9 A;  2Q2I A;  4DV1 Q;  2CHB D;  3MHB A;  5EAY A;  1L0Y B;  2WAQ B;  3S17 B;  4ALP A;  2CQO A;  2SNM A;  2HQE A;  4R9W A;  1L1O B;  1K28 A;  1I94 Q;  4DV2 L;  4JBW A;  4JYA Q;  2A73 B;  2ZJQ A;  5G3L F;  1PFB A;  3E9I A;  1D1I A;  1NMG A;  1Z7T A;  2ASB A;  1Z9F A;  3AFQ A;  1SNC A;  3HOZ B;  2L1B A;  4X3T A;  1A8V A;  2QCP X;  3CQZ H;  2AMC B;  3G6J B;  5LMN W;  1A15 A;  5C3E G;  4BXX H;  2FIN B;  4DR7 L;  3T1Y Q;  3J7A V;  5ELB A;  1EU3 A;  3V2T A;  3HOU H;  2BDO A;  3WWV A;  4XQJ A;  1R9T H;  5IYD H;  1VMC A;  1PMR A;  4P71 A;  3DLL A;  3U9O A;  3J80 c;  1IBM L;  5C44 B;  1VCI A;  2UXB Q;  1ENF A;  4LUV A;  3M4O H;  1JQY D;  3CCJ A;  1BOS A;  4C3J B;  1SE3 A;  4GN5 A;  3GQB A;  5J1Z A;  4GKK L;  2MHV A;  5C44 G;  4APV A;  1VQF A;  2KHJ A;  1I4X A;  2C5C A;  4JI1 Q;  1VQB A;  4GS3 A;  3GV6 A;  1TWC B;  1S5C D;  5ISR A;  3NSW A;  1B53 A;  5CV5 A;  1D1K A;  1CA6 A;  1V1P B;  2K7V A;  1ESF A;  1QNU A;  4C3I G;  4TRD A;  3HFZ B;  4HIK A;  4H02 A;  1NY4 A;  4EVO A;  3SK5 A;  4FO2 A;  3QOL A;  3PGZ A;  4GN4 B;  2KEN A;  4A3K G;  3OSO A;  4NP5 A;  3ULL A;  4DV4 Q;  2DJF C;  4B3T L;  3CCV A;  1VQP A;  3CW2 C;  3HG9 A;  4DK1 A;  4BY1 B;  1MSH A;  2EYJ A;  1QWY A;  3ULJ A;  2FHT A;  1X56 A;  1X54 A;  2VQE L;  2AHO B;  4LAA A;  1H9J A;  2BH8 A;  1IBK L;  1MJC A;  5D14 A;  1Q1B A;  1BBW A;  2LKV A;  3CCU A;  1GUN A;  4A3C G;  4J1M A;  1PA6 A;  1SNQ A;  2VB2 X;  3B6Y A;  1YNN C;  1DD2 A;  4H7B A;  1PVO A;  4ZRZ A;  1QVC A;  2IX1 A;  1CQF A;  4JI8 Q;  3C1F A;  3HOW H;  2F0W A;  2FMC A;  2UUA L;  5KYI A;  2KCT A;  5IGF A;  2FMM A;  4IUU A;  3T1Y L;  2RDH A;  5JEA J;  4A3F G;  4A3E G;  1LYL A;  3OMC A;  4QCL A;  1XPR A;  1VQ7 A;  2F0L A;  1VF5 C;  1VMP A;  1PTO C;  1G6Z A;  1Q1E A;  1KLU D;  5JPN C;  3S1M B;  3VR2 A;  1DOL A;  4DR4 Q;  1IBK Q;  3SK6 A;  4O42 A;  4ME5 A;  3JAM c;  3K0Y A;  1EY7 A;  1I6V C;  3GDE A;  4XT1 B;  4HTH A;  3RLN A;  3AU7 A;  2E2H H;  1EY9 A;  4JI5 Q;  4CKE A;  4HAE A;  5JVG 3;  5IWA Q;  4A3J B;  1JOR A;  4GLA C;  4NPS A;  4AQY Q;  1P8L A;  1PTO D;  1XYI A;  2UU9 Q;  2PNR C;  3J81 i;  1E24 A;  1DJR D;  5IYB H;  1LTR D;  3KUP A;  2JA6 B;  1Y1V G;  4XYQ A;  3OW2 A;  2QEX A;  1IBL Q;  2KJX A;  2DJG C;  1FNV A;  3GV3 A;  3S1R H;  2CWA A;  5CV9 A;  3PV0 A;  1XJV A;  3PO2 H;  3S2H B;  4DV3 L;  2VQF Q;  1RKN A;  1JWU D;  4MTN A;  5KRU A;  2PNH A;  4A3G H;  1KDA A;  4K8I A;  1VQA A;  4QMG A;  4CDC C;  3A8J E;  2NN6 I;  3A8K E;  1N33 L;  1PZK D;  1EIG A;  1MIU A;  1YNJ D;  4IUN A;  3J80 L;  2H5X A;  5H1S E;  3S14 B;  1BBX C;  3RLF A;  3LNN A;  5BR8 L;  1S5F D;  1SYC A;  1SBB B;  2NVQ H;  3A54 A;  3K58 A;  4C3I H;  4A3K B;  2ATW A;  4K14 A;  2F0J A;  3TEH B;  3V05 A;  2K01 A;  3D3R A;  3NWS A;  3R3O A;  2EVB A;  3N6R A;  3NP8 A;  1TT2 A;  1GHK A;  3CP0 A;  3BS1 A;  4AIM A;  1O7Y A;  1TWH H;  1PZJ D;  2LS0 1;  4HJA A;  4JI7 L;  4DXF A;  1XWE A;  1I6H B;  3I4N G;  5J39 A;  1K9M C;  2DGY A;  1B4O A;  3K7A H;  5CV6 A;  1XNR L;  1D7Q A;  1XMQ L;  4LMQ D;  5M5X B;  2CCZ A;  2ZXR A;  4PMC A;  1S4Z A;  2B29 A;  1UE1 A;  3KF8 B;  2IL8 A;  1CK1 A;  3R2T A;  3S1R B;  3I70 A;  4LF9 L;  1RL2 A;  3OOC A;  3CXC A;  1HNZ Q;  4BBS H;  1Y8O B;  4C1N K;  5GRO A;  4L5R C;  1N8R C;  2Z0S A;  3W1B A;  2QIL A;  4JOI A;  3HOW G;  4QL5 A;  2OWO A;  1GKH A;  2SOB A;  4ZCK A;  4JPB W;  1KDC A;  2F3W A;  3AQQ A;  1IYU A;  2B8G A;  5E7N A;  2YTX A;  4HIM A;  1ASY A;  2H1E A;  4A93 H;  3H15 A;  5EKI A;  2RSO A;  4EQP A;  2VW9 A;  2B2T A;  5M3M B;  4IJH A;  2LFN A;  2JA8 G;  2ZT9 C;  1N33 Q;  1MSG A;  2QF7 A;  4IN3 A;  4B3R L;  4ODG A;  2A69 D;  1EYG A;  3OTO L;  4EX5 A;  2ZJP A;  1UAP A;  2BH2 A;  4BBR G;  1I94 L;  4BWG B;  3BZC A;  3DEP A;  4POG A;  2HQL A;  2JA6 G;  4HCS A;  3MAQ A;  1WOC A;  4V19 0;  3HEJ A;  4JVZ A;  1EIF A;  5HY6 A;  2KVM A;  3CPW A;  3L2P A;  1WTH A;  1L1O C;  4IOA A;  1BCP B;  3HOX G;  4O2D A;  4DUY Q;  5G3L D;  1W3S A;  4S3S A;  1R4Q B;  4FXG C;  3S1N H;  1EWI A;  1IBM Q;  4GKJ L;  4LF4 Q;  2VXW A;  4DR3 Q;  1KXL A;  3EJI A;  2TMP A;  4QUF A;  3TBI B;  3LX0 A;  1SYB A;  4DNR B;  3TQY A;  5JJI A;  1F9S A;  1A2T A;  4A3J H;  3GTL H;  2DY8 A;  5IP9 H;  5AFW A;  3H09 A;  5EGT A;  5KGU A;  3DM3 A;  1B9M A;  3CPF A;  1O80 A;  1SFO B;  2V1C C;  4H0L C;  3M85 A;  1WTW A;  1XMO Q;  4RMF A;  3M4P A;  4ZUI A;  1EQQ A;  5CR3 A;  1NNX A;  3NEN A;  4UY8 C;  3Q0A A;  4DAM A;  1G8Z D;  2VL6 A;  3PO3 B;  3DEO A;  3NHH A;  1X9N A;  4FVM A;  4K6D A;  4DR6 Q;  2NN6 H;  2AWO A;  3ERS X;  5T1G A;  3HOY B;  2CKZ B;  4HMI A;  4KY5 A;  1PRT D;  5IOC A;  2ENB A;  3D8G A;  1GO3 E;  2HDM A;  1LTT D;  2CVR A;  3A74 A;  4DNT B;  1FL0 A;  1LTG D;  1X3G A;  4BS9 A;  4F88 A;  3CMA A;  4DAP A;  2E74 C;  1X32 A;  2K75 A;  4ZAI A;  3CKI B;  2OQ0 A;  3P7J A;  5CBA E;  1YI2 A;  3D4W A;  1XTC D;  2B2W C;  4CKB A;  3BZD B;  3RR5 A;  4OWT B;  1N9W A;  1SEB D;  4U68 A;  3EBE A;  5KND A;  4C2M B;  1O78 A;  3P20 A;  4BBS B;  1TS3 A;  2JN4 A;  3GTM B;  4KKT A;  2NYZ D;  1TWF B;  4E6I A;  1I3Q B;  4LF7 Q;  3RZO B;  2R61 A;  3NBH B;  3S17 H;  4PMW A;  3NK9 A;  3HOX H;  2J0T D;  1VDZ A;  3ERO A;  3ZYY X;  2A5H A;  2Z6B A;  1K0R A;  1SAP A;  3NQI A;  3R93 A;  5IT9 c;  3IKJ A;  1DCZ A;  2AUJ D;  4A93 G;  2MPM A;  4GLV B;  1VQL A;  1XXG A;  4DR3 L;  3U58 A;  3H3V C;  3BU2 A;  2XWJ B;  4WFN 3;  5E1F A;  3SDZ A;  3A55 A;  4TVA B;  4LF6 Q;  4QGU A;  2XGT A;  4R8I A;  4YWK A;  4QY7 A;  2QDB A;  1TKW B;  1STB A;  3TRZ A;  3FPU B;  2HT1 A;  3TS2 A;  1Q3L A;  1YZ6 A;  3EN2 A;  4JI6 L;  2XIW A;  1FR3 A;  4C56 C;  1G6P A;  3ND9 A;  3M7N A;  2UXC L;  4Y7N B;  1Y1W B;  4DK0 A;  1CFM A;  1V1P A;  4Y52 H;  2WB1 G;  1D5M C;  4NXM Q;  1N34 L;  1VQK A;  1NBW A;  2RHS B;  4M8A A;  2IPK D;  3EA6 A;  2I0Q A;  1EYC A;  4K5X A;  3T56 B;  2UUC L;  3VR5 A;  1K8O A;  2E2D C;  1U4M A;  3JAM L;  3MVV A;  3QWN A;  3TP6 A;  2CW0 D;  2F0H A;  3A0J A;  2RDF A;  4XTC S;  4JV5 Q;  1RIP A;  4X3K A;  1QVF A;  3KOJ A;  3FKI G;  4A3D B;  3K57 A;  1GM5 A;  2JA9 A;  2F0P A;  4JI5 L;  4GLX A;  1HNZ L;  5COY A;  3T1H L;  2XNA C;  3ITP A;  4DV0 Q;  5GQO A;  5D65 A;  1H9M A;  3E6Z X;  2XTI A;  2VQE Q;  2B2V C;  1RTO A;  4FDB A;  4K0K Q;  3K5L A;  1FVI A;  1XNR Q;  1YJW A;  4AYB B;  1VQG A;  4G7H C;  2YV5 A;  1F77 A;  2EY2 A;  1UE7 A;  1F2Z A;  3PMF A;  1BF4 A;  1CKO A;  4FF4 A;  4OL7 A;  2F03 A;  2MFI A;  1QE6 A;  2B3G A;  1F2M A;  2NUC A;  3I72 A;  1H9K A;  1WTR A;  2B63 B;  4C3H B;  4DAV A;  4HMJ A;  1EIY B;  3OIQ A;  3KDF B;  4IQZ A;  5GAD C;  1E22 A;  4DR1 Q;  1PHJ A;  3OYY A;  3NBH A;  3C3L A;  3CCE A;  4PG3 A;  3VA7 A;  4LF5 Q;  2EJF C;  2FFK B;  4ZUJ A;  2VNU D;  3GTG B;  3HP3 A;  1FNW A;  3RZD H;  1ZXT A;  3BYT B;  4MIU A;  4P2C B;  1EWH A;  3NEM A;  5BR8 Q;  3NTI A;  2ICI A;  4LFA Q;  5C44 H;  1Q8K A;  3ONA B;  3M4O B;  3D6C A;  1U4P A;  1TVX A;  1PH3 A;  1IYJ B;  3IFT A;  1SSO A;  2K50 A;  4PZ8 A;  3H3V I;  1UE6 A;  3L9A X;  1DOK A;  3E9H A;  1Y69 U;  1UE5 A;  3VR4 A;  2SDF A;  4GNX A;  5TSS A;  4UP9 A;  5FJ8 G;  4BA2 I;  2JE6 I;  4X65 L;  4UP8 A;  5JEA H;  5K36 H;  1LV9 A;  4IZ8 A;  4YCW A;  1DYQ A;  2K4K A;  3J81 L;  1U9R A;  3L3O C;  2YU9 H;  1B9N A;  2NTT A;  3A56 A;  3MXG A;  3WOF A;  4AYB E;  4BBR B;  2QA4 A;  3HOZ G;  1S5D D;  2IT1 A;  4OEM B;  3G7L A;  5KNC A;  2Z4H A;  2YYZ A;  4IAL A;  3VYU A;  4YWL A;  1XX8 A;  1Z47 A;  1KL9 A;  1TS4 A;  1Y8P B;  2B2U C;  5CGK A;  3VA5 A;  4A3B B;  2LXJ A;  2K04 A;  1NTG A;  4LWC A;  1TWH B;  2F3I A;  3CCM A;  4GKK Q;  3W3A A;  4GNX C;  4PV1 C;  3MXN B;  3HOX B;  2XSC A;  3FRP B;  2ZTC A;  2PO4 A;  4R1J A;  1PH4 A;  3H91 A;  1TWF H;  4LF8 Q;  1K8A C;  3GTK H;  1SNO A;  3M4Q A;  3FPP A;  3J81 j;  1OXV A;  2EYL A;  2FJ2 A;  1YNN D;  4KJO A;  4RGT A;  3MXU A;  3CU7 A;  1J5E L;  1X3P A;  2EIF A;  2NVX B;  2NVQ B;  2LSS A;  1BBU A;  4JW0 A;  5T1I A;  1ICF B;  1T5X D;  4OX9 L;  2P5Z X;  5IGG A;  2WV6 D;  1X3E A;  4LK1 C;  1LM0 A;  1Q86 C;  3KDF A;  2NZ1 D;  2ZM6 L;  2VB3 X;  4XDX A;  4CBV A;  2RSN A;  2K6A A;  1GXD C;  3K59 A;  3CQZ B;  4POF A;  1F9P A;  4JI3 L;  1HHV A;  1AE2 A;  1YVC A;  3DWP A;  3J7Z C;  1YHQ A;  5CV7 A;  3KYH C;  4K5W A;  1VQE A;  4P73 A;  1SND A;  2MO1 A;  4FXK C;  3CC7 A;  2XRQ D;  3V96 A;  1VQI A;  1TQO A;  4DXG A;  5LMN L;  4LUZ A;  1SE4 A;  2E5L Q;  2KHI A;  3RN2 A;  2MQH A;  1MKH A;  1IKM A;  1EFI D;  3UDI A;  2OT2 A;  4PZ6 A;  1OO9 B;  2F0M A;  3F8T A;  1EQT A;  4GOP A;  1WTP A;  3GTQ H;  1NMF A;  1WD0 A;  2M00 A;  4WJ3 M;  4DV7 L;  2N3S A;  4K2K A;  3DMU A;  1NCV A;  5JOB A;  3STB D;  2A19 A;  4QB4 A;  1PTO B;  1ONL A;  2PYK A;  5KYL A;  1T9H A;  3I4M H;  4K6L A;  2F4V Q;  3M3Y H;  5D3I B;  2JA5 B;  3KBX A;  4IUQ A;  4ZYS A;  1RTN A;  4BBS G;  5IGE A;  1WTQ A;  2UXC Q;  3CC4 A;  2A6E D;  4A3K H;  4B3S Q;  3S2H H;  1WVL A;  2BDN A;  5HGQ A;  1JT8 A;  2N78 A;  4F87 A;  2ZJR A;  4A3I G;  2E76 C;  2A6H D;  2KEE A;  4RA8 A;  1EY0 A;  5FO9 B;  4A3I B;  3OIP A;  4YHH L;  2X6G A;  2I5L X;  3I4N H;  1VQM A;  2PZW A;  1W6J A;  5FLX L;  2I5H A;  2K32 A;  1CHP D;  1A3V A;  3E3X A;  2UU9 L;  2H4O A;  1IYV A;  3K8A A;  1F9Q A;  3TRE A;  1KDB A;  3DM1 A;  1T5E A;  2JEB I;  5JPM C;  4MN3 A;  3T16 A;  1IL2 A;  2EY1 A;  5IYC G;  2CH4 W;  4X66 L;  1MHW C;  4XQN A;  2MJ8 A;  4L8J A;  4RCN A;  4QJF A;  1F2L A;  1Q8I A;  1M1K C;  3GD7 A;  3SR1 A;  4HID A;  3RN5 A;  1Y1W G;  1IXR A;  4C3J G;  4FF1 A;  2SEB D;  3A7L A;  4DUZ Q;  2NWG A;  3FVQ A;  3I4M G;  2RQX A;  2JEA I;  1SE2 A;  3QG1 A;  4OIJ A;  2AQ3 B;  4H13 C;  1E2Z A;  4N8F A;  3FP9 A;  2R92 H;  4B9X A;  2K05 A;  4RHS A;  3PUY A;  2IX0 A;  3GP7 A;  3M7G A;  5KEE A;  2UUA Q;  2DNE A;  1U0L A;  1A0I A;  5IT9 L;  3T53 B;  1MI2 A;  1HXY D;  3ICE A;  4DK3 C;  3U9S A;  3SE0 A;  2WKC A;  4A3I H;  3NQT A;  1B70 B;  2LMC B;  1KAA A;  5C4J H;  1J5E Q;  3GTL B;  3PSI A;  3L7Z C;  1KC8 C;  3LWU A;  2IJ0 A;  4KMU C;  2NVT B;  3OW7 A;  4R4C A;  1SYE A;  4R4O A;  2I5M X;  2KHS A;  4LW1 A;  2WFW A;  5BN3 A;  2B2T C;  2F0U A;  3C1E A;  5ELD A;  3A7A B;  1YNX A;  5IE8 A;  3W1G A;  1STA A;  2Q8T A;  2QEJ C;  3BVG A;  4AYB G;  1PXU A;  4KY7 A;  4OXP A;  1PRT C;  2D0O A;  3E5S A;  2JA7 B;  1VQH A;  3ER0 A;  4N9P A;  1XPO A;  4JOI C;  2JA7 G;  3H0G H;  2K52 A;  4KN4 C;  2CWP A;  2NZH A;  2AQ2 B;  5BN5 A;  3ULP A;  4JC0 A;  4PZ7 A;  1IL8 A;  1ZYR D;  1I3Q H;  3I73 A;  3RZO H;  4JYA L;  4DAY B;  1QVG A;  2MGS A;  2N8N A;  1LO5 D;  1L0X B;  3S16 H;  2O2L D;  4A3E H;  2B2U A;  4OWX B;  2D62 A;  1O7Z A;  1HNX Q;  5M3F G;  1HJP A;  4I65 A;  1LTA D;  3AYH B;  3BG3 A;  1I4R A;  3FKI H;  2JSO A;  1WCM B;  2WB1 E;  4FP5 D;  5EPL A;  4JV5 L;  2K5W A;  4N9T A;  1Q82 C;  1LUZ A;  1CT1 D;  4N8X 1;  3AMU A;  1VF7 A;  2WAQ E;  4X64 Q;  4Y7N H;  4X3S A;  1EZ8 A;  2B2W A;  2HCI A;  4RGO S;  4TQU S;  3RUZ A;  4BA1 I;  4DNI A;  4WJ4 A;  1S3O A;  5IYB G;  4LF5 L;  1I50 B;  1YBY A;  4KD4 A;  4HN7 A;  1C4Q A;  1SYD A;  3AB9 A;  4ULL A;  5L37 A;  4FF3 A;  2M9V A;  4A3M H;  4EQN A;  5K36 G;  3NUC A;  4K0K L;  2F3V A;  1KQS A;  4U67 3;  5E4X A;  5M5W H;  4HED A;  1LT4 D;  1E1T A;  1KLG D;  1QUQ B;  4KJN A;  2PZU A;  5M5X H;  4A3B H;  3PUV A;  5HUR A;  2E2I H;  4P75 A;  2WB1 B;  3CHB D;  3EQL C;  2EE1 A;  4B9W A;  3SK4 A;  1K83 H;  1VQ5 A;  3I4L A;  1SR3 A;  3KBG A;  1S72 A;  4G7Z C;  3CCL A;  2L0C A;  3SHL A;  3TN2 A;  4DV6 Q;  2Q2T A;  1HR0 W;  2R92 B;  3RMH A;  2V4D A;  5I2Y A;  3BDC A;  4CJ2 C;  1PFS A;  1K3R A;  3JAM i;  4DR1 L;  1GUS A;  3ERQ A;  4QF4 A;  3MZ5 A;  4ABN A;  5FOB B;  1OXS C;  3GO5 A;  5C5L A;  2BA0 A;  5C3W A;  2D2C C;  5M3M H;  3GTJ B;  1CI3 M;  2YTY A;  2B2V A;  2XRS D;  3AFP A;  5FKA C;  3VR3 A;  3C2P A;  4I7A A;  5C4Z A;  4CKC A;  1C48 A;  4JI8 L;  3S15 B;  1VQC A;  2VS1 A;  2A8V A;  5C3E H;  4BXX G;  2R6G A;  4A3L H;  1WD1 A;  4DV2 Q;  3KF8 A;  1FNU A;  3N52 A;  3O13 A;  3MXN A;  2L9H A;  1JJG A;  2K5H A;  1JB3 A;  4LFC Q;  2KUM A;  3DXJ C;  3PO2 B;  4C3H H;  1XPU A;  1VS0 A;  2BE5 D;  3S24 A;  1RDP D;  2O4X A;  1HTP A;  3DUZ A;  3GTO H;  3I4O A;  1NUC A;  1KAB A;  2E75 C;  5EQ0 A;  4J6H A;  1MJE A;  5ELN A;  2B63 G;  3K7A B;  1FD7 D;  1LTI D;  5C5M A;  1A62 A;  1UNS A;  3A5Z B;  4G57 A;  1EYA A;  1I4Q A;  2JA5 G;  3HOW B;  3JAM E;  3A8I E;  4EQ5 A;  4HJ5 A;  4AQY L;  1LT3 D;  4CJ1 B;  2DN8 A;  2RCN A;  1LAC A;  2XWB B;  2LXK A;  3WOE A;  4OEL B;  5JVH 3;  5I6W A;  3HKZ G;  4K2L A;  3TP8 A;  1BCP D;  2JQO A;  5M3F B;  1IBL L;  1C8C A;  1STY A;  4OGQ C;  4A3D H;  2VQF L;  2RVL A;  4IO9 A;  1B7Y B;  4X65 Q;  4RWS C;  1TY2 A;  3C46 A;  1FJG Q;  3HS0 C;  3MA2 B;  2KEC A;  1SNP A;  3WDN A;  2KOL A;  2EPB A;  3FHW A;  4DF7 A;  4M1U B;  2PCF B;  3W5O A;  1QUQ A;  3J80 E;  2WII B;  4IPH A;  1HZC A;  3F2C A;  3K6O A;  1VQJ A;  1L0W A;  2EJM A;  2NZO A;  2K03 A;  3U50 C;  3J81 c;  5C0X H;  3NE5 B;  2C35 B;  2E2J B;  1BDO A;  2WP8 J;  3NWT A;  3TP7 A;  1B3Q A;  2K5Q A;  2SNS A;  2VZA A;  4LFC L;  1WTV A;  5C4X H;  5CMD A;  3NEL A;  4YWM A;  1EZ6 A;  2Z4I A;  3BVZ A;  1C0A A;  2EXZ A;  3PF4 A;  1QCB D;  1YNJ C;  2ID0 A;  2PI2 A;  1JWM D;  2B2Y A;  2HIX A;  4X6A H;  3U4V A;  1VQ8 A;  3S2D H;  4IFD H;  2O5J C;  3S1Q H;  1KD1 C;  2IX3 A;  1TS2 A;  4DUY L;  1VQ4 A;  5DEH A;  3EIV A;  4UPA A;  5M5Y H;  2UXB L;  2AKW B;  1SMX A;  3RZD B;  1Q7Y C;  1TXY A;  1Q46 A;  3QJY A;  1N36 Q;  4Q5V A;  4RH6 A;  2JP1 A;  3H94 A;  1TY0 A;  1YEZ A;  4QIW B;  2EY6 A;  3MEF A;  5A2Q L;  1HQM C;  1TII D;  2RA4 A;  4DFA A;  2AQ1 B;  1Q81 C;  1E2V A;  3ZJY C;  1V8Q A;  5KNB A;  4A3L G;  1FYC A;  1RCV D;  4JK1 C;  1TWA H;  2BCO A;  5BN4 A;  1PH7 A;  4IUT A;  4NXN L;  4H44 C;  2X69 A;  2EYH A;  4NB3 A;  4DGZ A;  1CA5 A;  3NBI A;  1R9T B;  2VUM G;  4DR5 L;  4PNY A;  3D0F A;  3J7A 5;  5LHY 1;  1ENC A;  3CRL C;  3MEH A;  4IFD J;  2Q2H A;  4DV5 L;  1OXX K;  3PUX A;  1JCK B;  2B39 A;  4WRD A;  1S40 A;  5JJZ A;  2N88 A;  3P75 A;  1SXT A;  2NTS A;  2HHH Q;  2F4V L;  3K5N A;  3QIA A;  4A3F B;  3HOV H;  1M90 C;  1BO0 A;  2RHQ B;  2GVB A;  3TS0 A;  1PFN A;  1VQO A;  2OCE A;  3J80 i;  1YJ9 A;  4UDU C;  1QB5 D;  2RBM A;  3M3Y B;  2IW3 A;  4KY6 A;  2AWN A;  2F0V A;  4KHZ A;  5FJ8 H;  4DKA C;  4A3G G;  1F2Y A;  4B3S L;  3PO3 H;  1BKB A;  1KHI A;  2K14 A;  3HOV G;  1NAP A;  4IPG A;  4YY3 L;  1HRJ A;  2R7Z H;  4LF4 L;  2F0Q A;  1WCM H;  4YIJ A;  5EKL A;  1M8A A;  5I4D A;  5M5Y B;  2WAC A;  3KK7 A;  1CQV A;  5DM6 3;  2Z8L A;  3J7A F;  4J8Q A;  1RJT A;  2KCN A;  2Z1C A;  2JA8 B;  3KJP A;  1TWA B;  1TWC H;  2L11 A;  4A3J G;  4HJ7 A;  1HZ9 A;  1YJN A;  2EQS A;  1PYB A;  2D0P A;  1IW7 D;  2OEO A;  1G2T A;  2NB0 A;  4JI7 Q;  2EY5 A;  1CM9 A;  2PW7 A;  3K80 C;  1Z6H A;  3AEV A;  1Y1V B;  4HCE A;  2ZXP A;  4JI2 Q;  4HJ9 A;  4NW2 A;  5AJ3 L;  1A6X A;  4L5Q A;  1HR0 Q;  5GAE C;  5D3D A;  1ML0 D;  5DLQ E;  1C9O A;  3RD4 A;  3RLO A;  3GTQ B;  3G71 A;  2Y0S G;  1GHJ A;  1GUO A;  4OON A;  3OMG A;  1X3Q A;  1J6Q A;  2R7D A;  2EYF A;  5EKK A;  3BJU A;  2PMZ B;  5IP9 G;  2ZTE A;  2MO0 A;  3STB C;  4GOP C;  2BA1 A;  5FLX E;  4ZKC B;  4JI2 L;  4NKL A;  1NSN S;  3P1H A;  4DK6 C;  2IHF A;  2RKS A;  1WI5 A;  3GTP B;  4KD3 A;  1CZW A;  1JOQ A;  2DNC A;  2L5T A;  3MTS A;  3I91 A;  2QGQ A;  1I5F A;  3UE1 A;  3Q23 A;  1PV4 A;  5LL6 S;  2DUD A;  5J22 A;  4A76 A;  3KFU A;  1QJO A;  4JI0 L;  1HTL D;  4C3I B;  5F2D A;  1I4H A;  4YY3 Q;  2OTL A;  2F0I A;  1JB7 A;  1A63 A;  1D5Z C;  1PLF A;  1DOM A;  2B8F A;  1RD9 D;  3BVM A;  1FJG L;  5GAH C;  2GA4 B;  1A3U A;  3TSS A;  4FXD A;  2F0T A;  2M2L A;  1E2W A;  4X64 L;  4AH6 A;  1O7L A;  2YU9 B;  2E2H B;  1TR5 A;  3Q8D A;  3OTO Q;  5I9O A;  3NTK A;  4TSS A;  1PH8 A;  3HOY G;  3TP5 A;  1YHB A;  3I55 A;  5C6A A;  1B2T A;  5FO8 B;  4KHP Q;  1OXU A;  5ELE A;  1HQR D;  4YCV A;  2RCF A;  1G51 A;  3E0E A;  4NXN Q;  4XYO A;  4X62 L;  5FLX c;  4JI0 Q;  3PIP A;  2Z9H A;  2A6H C;  2D9U A;  5LMU L;  2EYO A;  3CF5 A;  1SN8 A;  1NJI C;  5CYU A;  4Z9C B;  3GTP H;  1GOZ A;  3CCR A;  1EIH A;  5IT9 E;  1N36 L;  4JI6 Q;  4CHT B;  5IGD A;  2R93 G;  1K0S A;  3J81 E;  2KCC A;  1PH2 A;  1K8G A;  2N55 A;  2PPB C;  4DR4 L;  1SYG A;  4YCU A;  2YTV A;  4JG2 A;  4ZKB B;  1FGU A;  4GN3 B;  3QO2 A;  3VYS A;  1W2B A;  5C4H A;  3IRB A;  1C7Y A;  2WAQ G;  1XMQ Q;  2Z6K A;  4UHV A;  4IJL A;  1KAW A;  2G9H D;  3ND8 A;  2PMZ E;  2UUB L;  1L2F A;  5EJW A;  2HDL A;  3MWY W;  3G4S A;  3UE0 A;  3S14 H;  3HRZ C;  4BY7 B;  5I6Y A;  4BY1 H;  3PCO B;  1EQV A;  5ELF A;  4JBM A;  3PIO A;  1LT6 D;  2NVT H;  2CFM A;  4LF6 L;  5E4W C;  2IY5 B;  3G6E A;  3SXH A;  1DON A;  5IP7 H;  1SMY D;  4WJW A;  1K83 B;  2JA8 H;  2KED A;  4XIG S;  4YHH Q;  2Y0S B;  1G91 A;  2BOS A;  4A3B G;  2DY7 A;  1HH2 P;  2PI2 E;  2F0K A;  4UAI A;  5E3F A;  4RGM A;  1BVS A;  3OPO A;  1MBY A;  3Q22 A;  1UUP A;  2QKI C;  1TWG H;  2R93 H;  3EVQ A;  2WIN B;  1HCZ A;  1AZP A;  2JA5 H;  2R92 G;  1B1Z A;  5EBC A;  2LY7 A;  1SRO A;  4KHV A;  1LTS D;  1BCP F;  1BCP C;  2IWH A;  4B3T Q;  1AN8 A;  5JAV A;  5CBE E;  4P72 A;  3KLS A;  1KNA A;  2F1M A;  1CSQ A;  2B2Y C;  3VYT A;  1A2U A;  3U4Z A;  3S15 H;  1RHP A;  1EFW A;  2JK8 A;  2NVY H;  3MFG A;  2KA7 A;  4NMZ A;  4QUC A;  3FKI B;  1CHQ D;  4KV6 A;  2A68 D;  3SEB A;  1IW7 C;  3GTJ H;  2F0N A;  4X3U A;  4IFD G;  4OX9 Q;  3IAY A;  4A3M G;  1PH5 A;  1KTK A;  4B3M Q;  1ROD A;  3FEW X;  2MUY A;  3R8B A;  2Y0S E;  3HOY H;  4RCO A;  1SMY C;  2K1B A;  3HOZ H;  1VQN A;  5J3B A;  1PRT B;  4G7O C;  2RF4 A;  5JEA G;  3HKZ E;  3IL8 A;  4MTK A;  1JMC A;  1D2B A;  3KLR A;  2IHE A;  3I8Z A;  1SRU A;  1V1Q A;  1U5K A;  1HFG A;  2VUM B;  4IOC A;  2CH4 A;  3X3N A;  1ILQ A;  2FXQ A;  4DR7 Q;  2K5V A;  4KK7 A;  4KTA A;  4FYD A;  2A1A A;  5C0X I;  2J4X A;  2E2I B;  1GJX A;  5M5W B;  1WTX A;  5IOD A;  3H6M A;  1K3B C;  2OF1 A;  1AEX A;  5ELC A;  4DR5 Q;  2X6L A;  4DV7 Q;  1Q12 A;  2A74 C;  4FNF A;  5CC4 A;  3GTK B;  3HOV B;  1CKN A;  3JC6 6;  3UDF A;  5DAU A;  4RAU C;  4ZLT F;  5C4X G;  2Z6K C;  1TU2 B;  1R4P B;  4OWW B;  3HKZ B;  1JIC A;  5C0X J;  4RKL A;  2WKD A;  3VYR A;  1AE3 A;  5C4J B;  2XVS A;  2L4N A;  4KN7 C;  4DR2 L;  4XT3 B;  2GVA A;  4R8N A;  4ZQ3 A;  1WCM G;  1EQR A;  3K81 C;  2G5D A;  2Q2U A;  4CDE C;  4L5S A;  3OHX C;  4EQO A;  1EU4 A;  2GN5 A;  1HUM A;  2K33 A;  1AH9 A;  4MHE A;  4B08 A;  4BBR H;  5COR A;  2E8G A;  1VQD A;  3KLW A;  4DA2 A;  3E0J A;  2KCM A;  1D6E C;  5FO7 B;  1LT5 D;  5JJK A;  3D4R A;  2TSS A;  2C9O A;  4OO1 I;  4QIW E;  2F0E A;  4PMB A;  3HOU G;  1QOH A;  2ES2 A;  1ZKO A;  4GNX B;  4JBK A;  3H3V H;  3SVM A;  3H0G B;  4NDX A;  1MD2 D;  1JR0 D;  1B50 A;  5IYC H;  4HSP A;  1HZB A;  1JJ2 A;  3I4M B;  4JBJ A;  1F9R A;  5IIF A;  2N49 A;  5NUC A;  1EY4 A;  1CTM A;  1SYF A;  3CCS A;  4LJZ C;  4Q0F A;  4RFB A;  3T4A C;  1BNZ A;  5AJ3 Q;  2UXD Q;  3UDG A;  4L6T B;  3VR6 A;  4HIO A;  2OQK A;  4G4K A;  2F52 A;  2E5L L;  3CD6 A;  1BQQ T; 
#chains in the Genus database with same CATH homology
 2I46 A;  4KI0 A;  1OXT A;  3K5O A;  1J9O A;  2PW5 A;  3TDQ A;  1W6K A;  1K8M A;  3NPP A;  1G29 1;  1JOK A;  3PIO 3;  1ZEQ X;  4DU9 A;  3T51 B;  1SNM A;  2RDG A;  5I9P A;  1V1O A;  3T13 A;  3FMC A;  2PQE A;  2A68 C;  2PZT A;  3Q24 A;  1HUN A;  2F0F A;  3D6W A;  5HGT A;  1WTO A;  1U4L A;  1ET6 A;  1HFN A;  5C3X A;  5CV8 A;  4PQX A;  3M4Y A;  4KKS A;  1EEI D;  3DHQ A;  4OIK A;  4RKB A;  1PTO H;  4A3G B;  1G2S A;  1SJH D;  3OWF A;  4XXE A;  3QB3 A;  2CQA A;  1D5X C;  1S5E D;  1BR9 A;  3MC0 B;  3MFY A;  1AFP A;  2HUG A;  2EYP A;  2EYM A;  1EWC A;  2F4I A;  2JXM B;  4HSV A;  4HR7 B;  4RHR A;  2R3Z A;  2K28 A;  1DXM A;  3S2D B;  4XQQ A;  1S5B D;  3IFD A;  3HZX A;  4V0B A;  1QNK A;  1STG A;  5C3E B;  2L55 A;  3TZU A;  1Y8N B;  1GUW A;  1FGB D;  1NR4 A;  3HOU B;  1BUV T;  3FDT A;  3S9W A;  1EL0 A;  1J8I A;  2G9D A;  3UI2 A;  3F2U A;  1CZG A;  3S16 B;  4DAY A;  1ILP A;  4ZK9 B;  1PZI D;  2EJG C;  1JOO A;  2BE5 C;  5IGC A;  1H9S B;  3Q6S A;  4K5V A;  2XN9 C;  2EDG A;  2NVY B;  1IHZ A;  3DWA A;  1ICW A;  2I07 B;  3PUW A;  1JC7 A;  3R2I A;  4DN4 M;  4A3M B;  2F0D A;  1IKL A;  2Q8I B;  1EY8 A;  3PUZ A;  2NN6 G;  5I2X A;  3S1N B;  1PTO F;  1DM0 B;  5EPK A;  2O5I C;  1JE4 A;  1EY6 A;  5KIX A;  5M9O A;  1AZQ A;  1I4P A;  1NR2 A;  3W2D A;  1EOT A;  4CJ0 B;  1ZYR C;  2F0G A;  4OO1 G;  3OWE B;  5LL6 X;  3PIP 3;  2R7Z B;  1QG7 A;  1ESR A;  3CRK C;  5C4X B;  4A3E B;  2EZV A;  1GUT A;  1LTB D;  1PRT F;  3J7Y W;  4I7Z C;  5A35 A;  1LAB A;  1MGS A;  1H9S A;  4A93 B;  2EOT A;  3S1Q B;  1E0B A;  1LLR D;  1EYD A;  4O1N A;  4ILW A;  3TZD A;  3DWQ A;  1JWS D;  1U4R A;  2NBF A;  2J7Z A;  3HGB A;  5K5P A;  4L63 B;  3BYY B;  1B3A A;  1SJE D;  5EBD A;  1H9R A;  4CGY B;  1EY5 A;  1II3 A;  3GTO B;  2HCC A;  1QIL A;  1AW7 A;  5DM7 3;  1SDF A;  5C0X G;  1BXT A;  1RF2 D;  4OHJ A;  1EEF D;  2L12 A;  5IGB A;  4IUV A;  4K8J A;  5CV4 A;  2K5D A;  1TS5 A;  4TKO B;  2A69 C;  2MP1 A;  2OXP A;  3BDO A;  4F8M A;  1STE A;  1GUG A;  3I90 A;  3LWE A;  4KKU A;  1STH A;  4RGN A;  4IUR A;  5EPJ A;  1HA5 A;  2Q8R E;  4IFD I;  1HA6 A;  4ID6 A;  4C1N I;  3K5M A;  3BDL A;  3EFX D;  3URY A;  1PYW D;  5A2Q E;  2F0O A;  1ENA A;  1PFM A;  2ZXO A;  2F0S A;  3I4N B;  1A3T A;  3KLS X;  2A6E C;  1STN A;  4OO1 H;  4F7X A;  3X3M A;  4IUP A;  4FF2 A;  2D5D A;  3NTH A;  3MXP A;  4C3H G;  3I3C A;  2JYO A;  2ICE C;  3TME A;  3QOJ A;  3D31 A;  3D4D A;  1PDQ A;  1DZ1 A;  1B44 D;  2KQ3 A;  2AUK A;  1TWG B;  1I4G A;  3NXW A;  4GZY C;  1KNE A;  1M4V A;  1HPC A;  4WOR A;  4EGV A;  1UEA B;  2R93 B;  5FK9 C;  1AP0 A;  5DNF A;  3SK8 A;  1Q90 A;  2CW0 C;  1V43 A;  1ET9 A;  2CHB D;  3MHB A;  1L0Y B;  2WAQ B;  3S17 B;  2SNM A;  4R9W A;  2HQE A;  4JBW A;  2A73 B;  5G3L F;  1PFB A;  1D1I A;  1Z7T A;  1SNC A;  3HOZ B;  2L1B A;  4X3T A;  2QCP X;  3G6J B;  1A15 A;  2FIN B;  3J7A V;  5ELB A;  1EU3 A;  3V2T A;  2BDO A;  4XQJ A;  1VMC A;  1PMR A;  3U9O A;  5C44 B;  1VCI A;  1ENF A;  1JQY D;  1BOS A;  4C3J B;  1SE3 A;  3GQB A;  5J1Z A;  2MHV A;  1I4X A;  2C5C A;  3GV6 A;  1TWC B;  1S5C D;  5ISR A;  3NSW A;  1B53 A;  1CA6 A;  1D1K A;  5CV5 A;  1V1P B;  2K7V A;  1ESF A;  1QNU A;  4C3I G;  4TRD A;  4EVO A;  3SK5 A;  4FO2 A;  3QOL A;  3OSO A;  4NP5 A;  3HG9 A;  4DK1 A;  4BY1 B;  1MSH A;  2EYJ A;  1QWY A;  2FHT A;  4LAA A;  1H9J A;  5D14 A;  1Q1B A;  2LKV A;  1GUN A;  4J1M A;  1SNQ A;  2VB2 X;  1YNN C;  1DD2 A;  4H7B A;  4ZRZ A;  2IX1 A;  1CQF A;  3C1F A;  2F0W A;  2FMC A;  5KYI A;  5IGF A;  2FMM A;  4IUU A;  2RDH A;  5JEA J;  3OMC A;  4QCL A;  2F0L A;  1VF5 C;  1VMP A;  1PTO C;  1G6Z A;  1Q1E A;  1KLU D;  5JPN C;  3S1M B;  3VR2 A;  1DOL A;  3SK6 A;  4O42 A;  4ME5 A;  3K0Y A;  1EY7 A;  1I6V C;  4XT1 B;  4HTH A;  3AU7 A;  1EY9 A;  4CKE A;  4HAE A;  5JVG 3;  4A3J B;  1JOR A;  1PTO D;  1XYI A;  2PNR C;  1DJR D;  1LTR D;  3KUP A;  2JA6 B;  4XYQ A;  2KJX A;  1FNV A;  3GV3 A;  5CV9 A;  3PV0 A;  3S2H B;  1RKN A;  1JWU D;  5KRU A;  1KDA A;  4K8I A;  4QMG A;  3A8J E;  2NN6 I;  3A8K E;  1PZK D;  1EIG A;  1YNJ D;  4IUN A;  3J80 L;  3S14 B;  1BBX C;  3RLF A;  3LNN A;  1S5F D;  1SYC A;  1SBB B;  3A54 A;  3K58 A;  4A3K B;  4K14 A;  2F0J A;  3V05 A;  2K01 A;  3D3R A;  3NWS A;  3R3O A;  2EVB A;  3N6R A;  3NP8 A;  1TT2 A;  1GHK A;  3BS1 A;  1O7Y A;  1PZJ D;  2LS0 1;  4DXF A;  1XWE A;  1I6H B;  5J39 A;  1B4O A;  5CV6 A;  4LMQ D;  5M5X B;  2ZXR A;  4PMC A;  1S4Z A;  2IL8 A;  1CK1 A;  3R2T A;  3S1R B;  3I70 A;  3OOC A;  1Y8O B;  4C1N K;  2QIL A;  2SOB A;  1KDC A;  2F3W A;  1IYU A;  2B8G A;  2H1E A;  5EKI A;  2RSO A;  4EQP A;  2B2T A;  5M3M B;  2LFN A;  2ZT9 C;  1MSG A;  2QF7 A;  4IN3 A;  4ODG A;  2A69 D;  1UAP A;  4BWG B;  3DEP A;  4HCS A;  3MAQ A;  4V19 0;  3HEJ A;  2KVM A;  1BCP B;  5G3L D;  4S3S A;  1R4Q B;  4FXG C;  2VXW A;  3EJI A;  2TMP A;  4QUF A;  3TBI B;  3LX0 A;  1SYB A;  4DNR B;  1F9S A;  1A2T A;  2DY8 A;  5AFW A;  3H09 A;  5EGT A;  5KGU A;  1B9M A;  1O80 A;  1SFO B;  4H0L C;  3M85 A;  1WTW A;  4ZUI A;  5CR3 A;  3Q0A A;  3PO3 B;  1G8Z D;  3DEO A;  3NHH A;  4FVM A;  4K6D A;  2NN6 H;  2AWO A;  5T1G A;  3HOY B;  4HMI A;  4KY5 A;  1PRT D;  5IOC A;  2ENB A;  3D8G A;  2HDM A;  1LTT D;  2CVR A;  4DNT B;  1LTG D;  4BS9 A;  4F88 A;  4DAP A;  2E74 C;  1X32 A;  4ZAI A;  3CKI B;  3P7J A;  5CBA E;  3D4W A;  1XTC D;  2B2W C;  4CKB A;  3BZD B;  5KND A;  1SEB D;  4U68 A;  4C2M B;  1O78 A;  3P20 A;  4BBS B;  1TS3 A;  3GTM B;  4KKT A;  2NYZ D;  1TWF B;  4E6I A;  1I3Q B;  3RZO B;  2R61 A;  4PMW A;  3NK9 A;  2J0T D;  1VDZ A;  3ERO A;  3ZYY X;  2A5H A;  1SAP A;  3R93 A;  3NQI A;  3IKJ A;  1DCZ A;  2AUJ D;  2MPM A;  1XXG A;  3H3V C;  2XWJ B;  4WFN 3;  5E1F A;  3SDZ A;  3A55 A;  4R8I A;  2QDB A;  1TKW B;  1STB A;  3FPU B;  1Q3L A;  2XIW A;  1FR3 A;  4C56 C;  3ND9 A;  3M7N A;  4Y7N B;  1Y1W B;  4DK0 A;  1CFM A;  1V1P A;  1D5M C;  4M8A A;  2IPK D;  3EA6 A;  1EYC A;  4K5X A;  3T56 B;  1K8O A;  3VR5 A;  2E2D C;  1U4M A;  3JAM L;  3MVV A;  3QWN A;  3TP6 A;  2CW0 D;  2F0H A;  2RDF A;  4XTC S;  4X3K A;  4A3D B;  3K57 A;  2F0P A;  5COY A;  2XNA C;  3ITP A;  5D65 A;  1H9M A;  3E6Z X;  2B2V C;  1RTO A;  3K5L A;  4AYB B;  4G7H C;  1F77 A;  2EY2 A;  1F2Z A;  3PMF A;  1BF4 A;  4FF4 A;  4OL7 A;  2F03 A;  1QE6 A;  1F2M A;  2NUC A;  3I72 A;  1H9K A;  1WTR A;  2B63 B;  4C3H B;  4DAV A;  4HMJ A;  3OIQ A;  4IQZ A;  3NBH A;  3C3L A;  3VA7 A;  2VNU D;  2EJF C;  2FFK B;  4ZUJ A;  3GTG B;  3HP3 A;  1FNW A;  1ZXT A;  3BYT B;  4MIU A;  4P2C B;  1EWH A;  3NTI A;  2ICI A;  3ONA B;  3M4O B;  3D6C A;  1U4P A;  1TVX A;  3IFT A;  1SSO A;  3L9A X;  1DOK A;  1Y69 U;  3VR4 A;  2SDF A;  5TSS A;  4BA2 I;  2JE6 I;  5JEA H;  5K36 H;  1LV9 A;  4IZ8 A;  1DYQ A;  3J81 L;  1U9R A;  3L3O C;  1B9N A;  2NTT A;  3A56 A;  3WOF A;  3MXG A;  4BBR B;  1S5D D;  2IT1 A;  3G7L A;  5KNC A;  2Z4H A;  2YYZ A;  4IAL A;  3VYU A;  1XX8 A;  1Z47 A;  1TS4 A;  2B2U C;  1Y8P B;  5CGK A;  3VA5 A;  4A3B B;  2K04 A;  1TWH B;  3W3A A;  4PV1 C;  3HOX B;  2XSC A;  3FRP B;  2PO4 A;  3H91 A;  1SNO A;  3FPP A;  1OXV A;  2EYL A;  2FJ2 A;  1YNN D;  4KJO A;  4RGT A;  3MXU A;  3CU7 A;  1X3P A;  2NVX B;  2NVQ B;  5T1I A;  1T5X D;  5IGG A;  2WV6 D;  4LK1 C;  2NZ1 D;  2VB3 X;  4XDX A;  4CBV A;  2RSN A;  2K6A A;  1GXD C;  3K59 A;  3CQZ B;  1F9P A;  1HHV A;  3DWP A;  5CV7 A;  4K5W A;  1SND A;  4FXK C;  2XRQ D;  3V96 A;  1TQO A;  4DXG A;  1SE4 A;  1IKM A;  1EFI D;  2OT2 A;  1OO9 B;  2F0M A;  1EQT A;  1WTP A;  1WD0 A;  2M00 A;  4K2K A;  3DMU A;  1NCV A;  5JOB A;  4QB4 A;  1PTO B;  1ONL A;  2PYK A;  5KYL A;  4K6L A;  5D3I B;  2JA5 B;  3KBX A;  4IUQ A;  4ZYS A;  1RTN A;  5IGE A;  1WTQ A;  2A6E D;  1WVL A;  2BDN A;  4F87 A;  2E76 C;  2A6H D;  2KEE A;  4RA8 A;  1EY0 A;  5FO9 B;  4A3I B;  3OIP A;  2X6G A;  2PZW A;  1W6J A;  5FLX L;  2K32 A;  1CHP D;  1A3V A;  2H4O A;  1IYV A;  1F9Q A;  1KDB A;  3DM1 A;  1T5E A;  5JPM C;  2JEB I;  4MN3 A;  3T16 A;  2EY1 A;  4XQN A;  2MJ8 A;  4L8J A;  4RCN A;  1F2L A;  1Q8I A;  3GD7 A;  3SR1 A;  4FF1 A;  4C3J G;  2SEB D;  3A7L A;  2NWG A;  3FVQ A;  2RQX A;  2JEA I;  1SE2 A;  3QG1 A;  4OIJ A;  2AQ3 B;  4H13 C;  1E2Z A;  4B9X A;  2K05 A;  4RHS A;  2IX0 A;  3M7G A;  5KEE A;  3GP7 A;  3PUY A;  2DNE A;  5IT9 L;  3T53 B;  1MI2 A;  1HXY D;  3U9S A;  3SE0 A;  2WKC A;  3NQT A;  2LMC B;  1KAA A;  3GTL B;  3L7Z C;  3LWU A;  2IJ0 A;  4KMU C;  2NVT B;  3OW7 A;  1SYE A;  2KHS A;  5BN3 A;  2B2T C;  2F0U A;  3C1E A;  5ELD A;  3A7A B;  1STA A;  2Q8T A;  2QEJ C;  3BVG A;  1PXU A;  4KY7 A;  3E5S A;  1PRT C;  2JA7 B;  4N9P A;  4KN4 C;  5BN5 A;  2AQ2 B;  1IL8 A;  1ZYR D;  3I73 A;  2MGS A;  1LO5 D;  1L0X B;  2O2L D;  2B2U A;  2D62 A;  1O7Z A;  4I65 A;  1LTA D;  3BG3 A;  1I4R A;  2JSO A;  1WCM B;  5EPL A;  4FP5 D;  2K5W A;  4N9T A;  3AMU A;  1CT1 D;  1VF7 A;  4X3S A;  1EZ8 A;  2B2W A;  2HCI A;  4RGO S;  4TQU S;  3RUZ A;  4BA1 I;  1I50 B;  4KD4 A;  4HN7 A;  1C4Q A;  1SYD A;  3AB9 A;  4ULL A;  4FF3 A;  2M9V A;  4EQN A;  5K36 G;  3NUC A;  2F3V A;  4U67 3;  5E4X A;  4HED A;  1LT4 D;  1KLG D;  4KJN A;  2PZU A;  3PUV A;  5HUR A;  2WB1 B;  3CHB D;  3EQL C;  2EE1 A;  4B9W A;  3SK4 A;  3I4L A;  3KBG A;  4G7Z C;  2L0C A;  3SHL A;  3TN2 A;  2R92 B;  3RMH A;  2V4D A;  5I2Y A;  3BDC A;  4CJ2 C;  1GUS A;  3ERQ A;  4QF4 A;  3MZ5 A;  4ABN A;  5FOB B;  1OXS C;  3GO5 A;  5C5L A;  2BA0 A;  5C3W A;  2D2C C;  3GTJ B;  1CI3 M;  2B2V A;  2XRS D;  5FKA C;  3VR3 A;  3C2P A;  5C4Z A;  4CKC A;  1C48 A;  3S15 B;  2R6G A;  1WD1 A;  3KF8 A;  1FNU A;  3N52 A;  3O13 A;  3MXN A;  2L9H A;  1JB3 A;  2KUM A;  3DXJ C;  3PO2 B;  2BE5 D;  1RDP D;  2O4X A;  1HTP A;  3DUZ A;  1NUC A;  1KAB A;  2E75 C;  5EQ0 A;  4J6H A;  3K7A B;  1FD7 D;  1LTI D;  5C5M A;  1UNS A;  4G57 A;  1EYA A;  1I4Q A;  3HOW B;  3JAM E;  3A8I E;  1LT3 D;  4CJ1 B;  2DN8 A;  1LAC A;  2XWB B;  3WOE A;  5JVH 3;  5I6W A;  4K2L A;  3TP8 A;  1BCP D;  5M3F B;  1C8C A;  1STY A;  4OGQ C;  2RVL A;  4RWS C;  1TY2 A;  3C46 A;  3HS0 C;  3MA2 B;  2KEC A;  1SNP A;  3WDN A;  2KOL A;  2EPB A;  4DF7 A;  4M1U B;  2PCF B;  3J80 E;  2WII B;  3K6O A;  2EJM A;  2K03 A;  5C0X H;  3NE5 B;  2E2J B;  1BDO A;  2WP8 J;  3NWT A;  3TP7 A;  2K5Q A;  2SNS A;  1WTV A;  5CMD A;  1EZ6 A;  2Z4I A;  3BVZ A;  2EXZ A;  1QCB D;  1YNJ C;  2ID0 A;  1JWM D;  2B2Y A;  4IFD H;  2O5J C;  2IX3 A;  1TS2 A;  5DEH A;  3RZD B;  3QJY A;  4Q5V A;  4RH6 A;  2JP1 A;  3H94 A;  1TY0 A;  4QIW B;  2EY6 A;  5A2Q L;  1HQM C;  1TII D;  2RA4 A;  4DFA A;  2AQ1 B;  1E2V A;  1V8Q A;  5KNB A;  1FYC A;  1RCV D;  4JK1 C;  2BCO A;  5BN4 A;  4IUT A;  4H44 C;  2X69 A;  2EYH A;  4DGZ A;  1CA5 A;  3NBI A;  1R9T B;  4PNY A;  5LHY 1;  1ENC A;  3CRL C;  3MEH A;  4IFD J;  1OXX K;  3PUX A;  1JCK B;  2B39 A;  4WRD A;  5JJZ A;  2N88 A;  3P75 A;  1SXT A;  2NTS A;  3K5N A;  3QIA A;  4A3F B;  1BO0 A;  1PFN A;  4UDU C;  1QB5 D;  2RBM A;  3M3Y B;  2IW3 A;  4KY6 A;  2AWN A;  2F0V A;  4KHZ A;  1F2Y A;  1NAP A;  1HRJ A;  2F0Q A;  4YIJ A;  5EKL A;  1M8A A;  5I4D A;  5M5Y B;  2WAC A;  3KK7 A;  1CQV A;  5DM6 3;  2Z8L A;  3J7A F;  4J8Q A;  1RJT A;  2KCN A;  2Z1C A;  2JA8 B;  1TWA B;  2L11 A;  2OEO A;  1IW7 D;  1G2T A;  2NB0 A;  2EY5 A;  1CM9 A;  2PW7 A;  1Z6H A;  1Y1V B;  4HCE A;  2ZXP A;  4NW2 A;  1A6X A;  5D3D A;  1ML0 D;  3RD4 A;  3GTQ B;  1GHJ A;  1GUO A;  3OMG A;  1X3Q A;  2EYF A;  5EKK A;  2PMZ B;  2BA1 A;  5FLX E;  4ZKC B;  4NKL A;  1NSN S;  3P1H A;  2RKS A;  3GTP B;  4KD3 A;  1CZW A;  1JOQ A;  2DNC A;  2L5T A;  3MTS A;  3I91 A;  3Q23 A;  5LL6 S;  5J22 A;  1QJO A;  1HTL D;  4C3I B;  5F2D A;  1I4H A;  2F0I A;  1D5Z C;  1PLF A;  1DOM A;  2B8F A;  1RD9 D;  3BVM A;  2GA4 B;  1A3U A;  3TSS A;  4FXD A;  2F0T A;  2M2L A;  1E2W A;  1O7L A;  2YU9 B;  2E2H B;  1TR5 A;  5I9O A;  3NTK A;  4TSS A;  3TP5 A;  5C6A A;  1B2T A;  5FO8 B;  1OXU A;  5ELE A;  1HQR D;  4XYO A;  2A6H C;  2D9U A;  2EYO A;  5CYU A;  4Z9C B;  1GOZ A;  1EIH A;  5IT9 E;  4CHT B;  5IGD A;  3J81 E;  2KCC A;  2N55 A;  2PPB C;  1SYG A;  4ZKB B;  3QO2 A;  3VYS A;  5C4H A;  2G9H D;  3ND8 A;  5EJW A;  2HDL A;  3MWY W;  3HRZ C;  4BY7 B;  5I6Y A;  1EQV A;  5ELF A;  1LT6 D;  5E4W C;  3SXH A;  1DON A;  1SMY D;  4WJW A;  1K83 B;  2KED A;  4XIG S;  2Y0S B;  1G91 A;  2BOS A;  2DY7 A;  2F0K A;  4UAI A;  5E3F A;  4RGM A;  3OPO A;  1MBY A;  3Q22 A;  1UUP A;  2QKI C;  3EVQ A;  2WIN B;  1HCZ A;  1AZP A;  1B1Z A;  5EBC A;  2LY7 A;  4KHV A;  1LTS D;  1BCP F;  1BCP C;  2IWH A;  1AN8 A;  5JAV A;  5CBE E;  3KLS A;  1KNA A;  2F1M A;  2B2Y C;  3VYT A;  1A2U A;  1RHP A;  3MFG A;  2KA7 A;  4NMZ A;  4QUC A;  3FKI B;  1CHQ D;  4KV6 A;  2A68 D;  3SEB A;  1IW7 C;  4IFD G;  2F0N A;  4X3U A;  3IAY A;  1KTK A;  1ROD A;  3FEW X;  2MUY A;  3R8B A;  4RCO A;  1SMY C;  2K1B A;  1PRT B;  4G7O C;  5JEA G;  3IL8 A;  1D2B A;  3KLR A;  3I8Z A;  1HFG A;  2VUM B;  3X3N A;  1ILQ A;  4KK7 A;  4KTA A;  4FYD A;  5C0X I;  2J4X A;  2E2I B;  1GJX A;  5M5W B;  1WTX A;  5IOD A;  3H6M A;  2OF1 A;  1AEX A;  5ELC A;  2X6L A;  1Q12 A;  2A74 C;  4FNF A;  5CC4 A;  3GTK B;  3HOV B;  5DAU A;  4RAU C;  4ZLT F;  1TU2 B;  1R4P B;  3HKZ B;  1JIC A;  5C0X J;  4RKL A;  2WKD A;  3VYR A;  5C4J B;  2XVS A;  2L4N A;  4KN7 C;  4XT3 B;  4R8N A;  4ZQ3 A;  3OHX C;  4EQO A;  1EU4 A;  1HUM A;  2K33 A;  4MHE A;  4B08 A;  5COR A;  4DA2 A;  3E0J A;  1D6E C;  5FO7 B;  1LT5 D;  3D4R A;  2TSS A;  2C9O A;  4OO1 I;  2F0E A;  4PMB A;  1QOH A;  1ZKO A;  3SVM A;  3H0G B;  4NDX A;  1MD2 D;  1JR0 D;  1B50 A;  4HSP A;  3I4M B;  1F9R A;  5IIF A;  5NUC A;  1EY4 A;  1CTM A;  1SYF A;  4LJZ C;  4Q0F A;  4RFB A;  3T4A C;  1BNZ A;  4L6T B;  3VR6 A;  4G4K A;  1BQQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...