1X3GA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
118
structure length
114
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
total genus 16
structure length 114
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3gA00
1Q46A 5ELNA 4B3RQ 4A3MH 4A3BG 4LUZA 3DLLA 4HJ8A 2ID0A 1W2BA 1A0IA 1MKHA 1SN8A 2PNHA 4AQYQ 4C3JH 4A3FG 1IYJB 4DR5L 3W1GA 3RLFA 1OXXK 4LF9Q 5C4XG 4RMFA 4YCWA 4TQUS 4KHPL 4JI3L 4JI6L 2UU9L 3NENA 4QGUA 4NXNQ 4JI1Q 4K0KQ 1HZBA 4C3IH 4POGA 2YV5A 3GTKH 2DUDA 1IBLQ 1Z47A 4DUYL 4HIKA 1HNZQ 2R92G 4IFDI 5K36G 3HOXH 1CKNB 3PIOA 3CCJA 5LMNW 3S1MH 4LFBQ 1TWCH 3UDIA 1QZGA 4JI8L 3KF6B 4A3KG 1P16A 3PSIA 2NVQH 2B3GA 4DV4Q 3S1RH 5M3FH 2I0QA 1X54A 2NN6G 2QGQA 3A0JA 4NPSA 4OWXB 1IBML 4JYAQ 4X6AH 2IHFA 1VQ7A 3F2CA 1XMOL 4UY8C 1Y1WH 3JC66 5LMNQ 4A3FH 4IFDG 3GD7A 2JQOA 3F1ZA 2UUCQ 4DV7L 4A3JG 2GVBA 1K73C 1L1OB 3PUXA 2JA6G 1H95A 1PFSA 4X64L 4Y7NH 2ZTEA 4B3SQ 4IJLA 1TWFH 4JI5L 1Q1EA 1VQ5A 3U4VA 3HOVH 4LUOA 3T1YL 2VS1A 4IFDJ 3EBEA 1DGSA 3HKZE 3KFUA 4B3TQ 2F4VL 1E3PA 2Y0SG 3J81c 3J7ZC 4PZ6A 3I4OA 4A3IH 4BXXH 4DV1Q 3CCQA 1X56A 3PO3G 4QY7A 4ME3A 4JI4L 3Q8DA 4JI0L 3L7ZC 4IO9A 2AMCB 3CCVA 3TQYA 2IHEA 3ULPA 1QUQB 1PV4A 1N36L 4BY1G 2AKWB 4HIOA 1N8RC 3PF4A 3KDFA 1IXRA 5M5YH 5C44G 2DGYA 2HIXA 2NZOA 4DV2L 4JV5L 1I5FA 2HQLA 3D31A 2CWPA 3M4PA 1JB7A 1T9HA 4GOPA 1EYGA 3S24A 4R1JA 2UXDQ 1PYBA 1I94L 5E7NA 3A74A 3GDEA 1SRUA 1PVOA 1KL9A 1OXTA 1U0LA 4IJHA 1XNQQ 1E1TA 2IT1A 2WB1G 5IYDG 1VQ4A 2JA8G 3HOYG 4DUZL 4DR2L 3RZDH 5IE8A 3L2PA 4LFCQ 1YJ9A 1TWHH 4JOIA 1Y14B 5IYBH 1N32Q 1XNRQ 5IWAL 3J81i 3FKIH 4JOIC 2VNUD 4B3ML 4LF8L 4LF6L 4DV0Q 1WOCA 3U4ZA 4UP8A 1PH2A 2JA5G 2CKZB 1YHQA 4JI7L 1K83H 4BBRH 2QA4A 1K8AC 1JMCA 5IP7H 2KBNA 1VQ8A 2Q2UA 2WB1E 4AYBG 4A3IG 4JBKA 4GKJQ 4X62L 3D0FA 2IX0A 5BR8Q 1BVSA 2VUMG 4LW1A 1GO3E 1HR0L 1X9NA 4A3CG 2VQEL 4JI2Q 1PHJA 5IYDH 3RLOA 1HJPA 4X66Q 2UXBL 3OW2A 5M5WH 1NMGA 1PH7A 2HHHL 2JA7G 3S2DH 1Q82C 5C4JH 4DR1Q 2CCZA 1N34L 3AFPA 2RF4A 3HOXG 2B29A 4GNXC 1N33Q 1OXUA 1Q8KA 4X65Q 3F8TA 3CPFA 1KIXA 4NB3A 4LFAQ 5GQOA 1E24A 1K8GA 4WJ4A 1JT8A 2PI2A 1VQ9A 5JEAJ 2VQFL 4RG1A 3PUYA 4K0KL 1VQGA 4J15A 4JCVE 4YWKA 3J7A5 3ULLA 1FGUA 1XPRA 1NJIC 3S1NH 2R6GA 3GTPH 4A75A 3KJOA 1V1QA 2OQKA 1P8LA 3UDGA 4DR7Q 2ATWA 4L5SA 4A3BH 4LFBL 1IL2A 5HGQA 1IBKQ 1VQAA 2R93G 4DV3L 1VQBA 1X55A 3BZKA 2JA7H 4A3DH 2XGTA 1NE3A 3M9BA 3E9IA 3WWVA 4GOPC 4AYBE 1V43A 2RHQB 2E5LQ 3K8AA 2UUBL 5LMNL 1WCMH 3J80i 2LSSA 1EQQA 3PGZA 4MTNA 2BH2A 1L0WA 1KRTA 4OX9L 4LF5L 1X3FA 1FVIA 1KD1C 2RCNA 4L5RC 1VQIA 2AWOA 2EQSA 4QJFA 4R4TA 4LF7Q 1FJGL 2VY3A 1VQOA 1I50H 1J5EL 5LMUQ 4QL5A 5C4XH 1XPOA 4C3HH 4NXMQ 4DAYB 1VQDA 5C3EG 4HIMA 2CWAA 2IY5B 1E1OA 1GM5A 2R93H 1JJGA 5GAEC 1HNWL 4DV6Q 3CCEA 4BA2I 2NVYH 3I4NG 5GAGC 1FL0A 4NXNL 4JI3Q 4KHZA 4JI6Q 1MJEA 1WYDA 5C44H 5GAHC 3KF8B 4JI0Q 4HJ7A 1XMQQ 3AEVA 1C7YA 1HNZL 4GKKQ 1GKHA 2XTIA 3TEHB 4DKAC 1LYLA 2RHSB 4A3KH 2R7ZG 3GTQH 5EAYA 4DR6Q 1X3EA 1VQLA 2PQAB 4LF4L 3K80C 5GADC 1K9MC 3OTOL 4PZ7A 3KF6A 3ICEA 1QVCA 1A63A 4P75A 2E2IH 3NBHB 2K5HA 4DV2Q 1WJJA 3PO3H 4L5TA 1UE1A 4IPCA 4L5QA 4BBSH 3J80c 2JA6H 3ULJA 4PMWA 1C0AA 1EOVA 4AH6A 5J3BA 4OONA 3CCLA 2OTJA 1D8LA 1EFWA 4YWLA 4UP7A 3J81j 1L1OA 3BZCA 4MNOA 2K14A 2BA1A 4A76A 1G291 4JC0A 3H3VH 4BBRG 1N9WA 1L1OC 4LFCL 1QZHA 1X6OA 1UEBA 1G6PA 1YEZA 1A8VA 1PYSB 4A3GH 3U58A 5JEAG 2GN5A 4WJ3M 4DAMA 2ZJPA 3EIVA 5C3EH 1Y1VH 2EXDA 4GNXA 2C35B 1LUZA 1VQNA 1MIUA 3CXCA 4JI4Q 3RR5A 2YTYA 2WAQE 1EWIA 2NZHA 1AE2A 1YHAA 2LXJA 4GLXA 1CUKA 1A62A 1WI5A 2EIFA 1IBLL 4QIWE 1YIJA 3T1HQ 4BY1H 3S16H 4KLKA 1UWVA 3UE1A 3PO2G 1VQJA 2R92H 2UXCQ 4P73A 2R7ZH 2VQEQ 1PH5A 3G71A 4LF9L 1UE6A 2E8GA 2F3IA 2JA5H 4JYAL 2K50A 2VW9A 3EN2A 2KHIA 3KJPA 2A19A 1HR0W 2UUCL 4GOPB 2N8NA 1IZ6A 4GN5A 1XJVA 2Y0SE 4DR3Q 4DV5Q 4YY3L 3M4OH 3FHWA 4JI8Q 2QEXA 4B3SL 3RZOH 4A3DG 1TWAH 4JI5Q 4YHHQ 4BY7H 2KENA 2Q2TA 3GTGH 1OXSC 1L2FA 3CD6A 1HZAA 1XNRL 4A3LH 2BA0A 3CC7A 4DNIA 4HJ5A 3RN5A 4OWWB 1EQRA 4BBSG 3G4SA 2N78A 4JBWA 2OWOA 4YCVA 1Q7YC 4R4OA 2OCEA 3ER0A 2WP8J 4JI1L 3KOJA 1VQCA 1EUJA 2F52A 4BXXG 3CAMA 2ZM6Q 3CP0A 3SGIA 4YCUA 4A3CH 1BKBA 1EIYB 1VQKA 2KCTA 1UE7A 3ZJYC 2V1CC 4POFA 2H5XA 4DR5Q 2Z6KA 2JA8H 3JAMi 2YTXA 5M3MG 5LMUL 3HOYH 3FP9A 3HOWH 3MXNB 3DM3A 2UU9Q 2CQOA 2K4KA 4DR1L 4GLAC 4GLVB 4JBJA 4DV6L 4DUYQ 1AE3A 4YWMA 1MJCA 2N3SA 3IRBA 2B63H 1I94Q 1HNXQ 4C2MH 4A3MG 2A1AA 4X64Q 1N36Q 5DLQE 2R7FA 5FJ8G 5M3FG 1SFOH 2VZAA 5M5XH 3H3VI 4R4QA 2E2JH 1XTDA 1R9TH 3G48A 2NN6I 2KHJA 1EIFA 4GKKL 3PUZA 3CMEA 1VCIA 4HJ9A 3T1YQ 3I56A 1PH8A 4DR4L 4IPDA 1YITA 2D62A 2AHOB 4A3JH 4MZ9A 1VQFA 4B3TL 2F4VQ 2K52A 1LTLA 4XIGS 1Q86C 3HKZG 4B3MQ 3UDXA 5FLXc 1HZCA 4LF8Q 4P71A 2UUAL 3M3YH 3GTOH 4A3LG 1Z9FA 1K3RA 4R4CA 3STBD 5IYCH 4X62Q 2UUBQ 2JA9A 1YNXA 1VQHA 3A5UA 4DUZQ 1B70B 1Q12A 1G51A 4DR2Q 2N49A 1Q81C 4OX9Q 4B3RL 1XPUA 2JEAI 1E7ZA 4TVAB 5AJ3Q 2YYZA 3PIPA 4HIDA 4AQYL 3CC2A 3G6EA 1YBYA 1I6HH 2MO1A 2CFMA 3BJUA 1V9PA 2MNAA 2UXBQ 1JJ2A 1Q1BA 4KHPQ 3NELA 3RLNA 2D0PA 1VQ6A 5M3MH 1ASZA 1HNWQ 3CQZH 3E0EA 1CKNA 2ZJRA 1CSQA 1B8AA 3HFZB 4AIMA 4JBMA 1UE5A 1XNQL 1HR0Q 1X65A 2JJQA 1SROA 4OXPA 1RL2A 3TRZA 3S2HH 4X66L 5FJ8H 1ASYA 3K0XA 3HOUH 2HHHQ 1NBWA 5GROA 1AH9A 3CF5A 1YJWA 1N34Q 1CSPA 2Z0SA 4R4IA 4DV3Q 2L15A 4O2DA 2D0OA 1O7IA 4DV7Q 4LF6Q 4LFAL 2PQAA 2JK8A 3KLWA 3HKSA 1YJNA 3I4MG 4BY7G 1D7QA 1YHBA 3STBC 3I4NH 5C0XJ 1GVPA 5BR8L 3FKIG 1N32L 2K5NA 2I5MX 3UE0A 5IWAQ 4DR3L 1VQPA 1KQSA 1S72A 3H0GG 3I55A 4DK6C 1J5EQ 3I7FA 4OO1G 2HT1A 4P74A 5IP7G 4OWTB 3TS2A 2JE6I 4DV1L 4IOCA 3TREA 2ASBA 2Q2HA 1SR3A 3HOZH 1Y1VG 3M7NA 1QUQA 2ZTDA 1JE5A 2R7DA 4EQ5A 1BBUA 1KHIA 1KRSA 5IP9H 1S3OA 2VQFQ 4LF5Q 4LUVA 3TS0A 2MFIA 1VS0A 3KDFB 2WAQG 1RIPA 4XTCS 4GNXB 2ES2A 4P72A 2VL6A 4LF7L 3I2ZA 3HOWG 4OO1I 4DPGA 1PH4A 1C9OA 4KI0A 4DV4L 1PA6A 4QQBX 1U5KA 3BU2A 1PH3A 1IBMQ 5C0XI 4JV5Q 4PZ8A 5ELOA 1XMOQ 1OTCA 1IBKL 3M85A 2NVTH 5HY6A 2B63G 2UXCL 3HOUG 5IT9c 5FLMH 4X65L 3CCMA 3K81C 2PMZE 4A93G 4Y52H 2KCMA 3M4QA 1NTGA 2K5VA 1CKMA 5H1SE 1B7YB 4UPAA 3F2DA 2E2HH 1YI2A 1KAWA 1YZ6A 5JJKA 4EX5A 4IPGA 3E9HA 3GTJH 1VQMA 1XMQL 4APVA 2I5HA 5IP9G 1Y1WG 1QVGA 2NVXH 1HNXL 3RN2A 4FDBA 4DV5L 4YY3Q 4H02A 2JEBI 3AYHB 1FJGQ 2ZJQA 3UDFA 4A3EG 2A8VA 1PH9A 4BA1I 1LM0A 3OYYA 3OTOQ 1TWGH 1M1KC 4DV0L 3H0GH 2WFWA 4JI7Q 4DR4Q 4NXML 1S40A 2OTLA 4O0AA 5C0XG 2Z6KC 4GKJL 1W3SA 2E5LL 3LGJA 5FLMG 3U50C 1TXYA 1SE8A 4A3GG 3HOZG 2K75A 4GN3B 1NY4A 1SMXA 1X3GA 3S15H 5JJLA 2ZM6L 4JI2L 3B6YA 1OXVA 2OQ0A 3ERSX 3S1QH 2FXQA 3PV0A 3PCOB 5IYBG 1QVFA 1E22A 3S17H 4DR6L 2AWNA 5AJ3L 4LF4Q 1J6QA 1N33L 3PO2H 3K7UC 1WCMG 3W5OA 4DK3C 3CCRA 4LNQA 3H15A 3HOVG 2UXDL 4GN4B 3RNUA 2GVAA 2Q2IA 2YTVA 2YU9H 4IOAA 3CW2C 4A93H 1HH2P 1HZ9A 3NEMA 3GO5A 3W1BA 3KYHC 3PUVA 3K7AH 1YVCA 3L0OA 1BBWA 3MEFA 4HJAA 3T1HL 4JG2A 4DR7L 2VUMH 4UP9A 1GD7A 3CCSA 1KC8C 1K0RA 2BH8A 4YHHL 2HIVA 5JJIA 3CCUA 1I3QH 2ZTCA 5IY0A 3I4MH 1JJCB 4PG3A 3CMAA 4A3EH 1NMFA 2PI2E 3PF5A 3GTLH 3A5ZB 3AQQA 3PUWA 1PH1A 2IX1A 2I5LX 3S14H 2MQHA 2ALYB 1KXLA 4GS3A 4A4IA 1M90C 2MO0A 2UUAQ 5IYCG 3AFQA 3GTMH 3F2BA 1PH6A 4IPHA 3VDYA 1SLJA 1WFQA 3JAMc 3CPWA 1CKOA 3CC4A 1VQEA 2LXKA 4ALPA 4LWCA
chains in the Genus database with same CATH superfamily
3OIQA 4A3BG 1BO0A 1JORA 1HFGA 2HCCA 2ID0A 1W2BA 2PNHA 1XPUA 4LF9Q 4A3FG 4IUUA 4DR5L 3C3LA 1OXXK 4YCWA 2UU9L 4QGUA 5FLXE 2KCCA 4C3IH 2YV5A 3GTKH 1I4GA 4HIKA 1EYCA 3HOVB 5K36G 3HOXH 1CKNB 5C5LA 4LFBQ 4HTHA 4JI8L 3ERQA 1HQRD 3PSIA 3S1RH 1PLFA 4L63B 4ME5A 5C4XB 1IBML 4JYAQ 2L55A 3F2CA 4IUVA 1Y8NB 2BE5C 2F0NA 3JC66 4EQOA 4C3JG 2J0TD 4DV7L 2GVBA 3PUXA 4DNTB 1PFSA 1TWCB 4ZAIA 2ZTEA 2E75C 4KJOA 4LUOA 2X6GA 2XRSD 3T1YL 2VS1A 3HOXB 1W6KA 3L3OC 2F4VL 3J7ZC 1S5BD 3I90A 2E2IB 4A3IH 4DV1Q 3CCQA 2F0WA 3MFYA 1ESFA 3ZYYX 2A74C 4RAUC 4UAIA 3C1FA 2IHEA 2RDGA 3ULPA 1MI2A 2DY7A 4OELB 4HSPA 1T5XD 5F2DA 1I4PA 4HIOA 2HUGA 1EZ8A 4O42A 1IXRA 4XT1B 4ZLTF 5M5YH 1TWGB 5C44G 2NZOA 4DV2L 4M8AA 4IALA 2CWPA 3Q22A 2NVYB 4OHJA 1EYGA 2LY7A 3N6RA 4R1JA 2AUJD 1K3BC 1OXTA 4IJHA 1E1TA 3KBXA 5IYDG 2JA8G 3HOYG 3L2PA 1YJ9A 1TWHH 1Y14B 2L1BA 2K33A 1N32Q 5IWAL 3OPOA 2EY1A 4DU9A 2ICIA 4JOIC 1LTSD 3SK4A 2VNUD 4QIWB 4DV0Q 1PH2A 2JA5G 5FO9B 2QF7A 3K6OA 1AZQA 2I46A 2DNCA 2OT2A 5AFWA 2A5HA 2K5DA 1PHJA 3S9WA 2F0IA 4FNFA 1NMGA 1PH7A 2HHHL 4FF1A 1Q82C 3NQIA 1LACA 2RF4A 1JR0D 2B29A 4HCEA 2Z9HA 2NWGA 3J80L 4GNXC 4A3FB 2B2UA 1JT8A 4WJ4A 1K8GA 3FPUB 2FMCA 5T1GA 3J7A5 1CTMA 4Y7NB 3GTPH 5KRUA 3UDGA 1C8CA 2L11A 4A3BH 1IL2A 4G57A 1IBKQ 4H13C 5I6WA 2Z1CA 3GV6A 2F0SA 3M9BA 4GOPC 5M5WB 4AYBE 5C4ZA 3E0JA 5LMNL 1WCMH 1SNPA 2LSSA 1SSOA 1DD2A 4KD4A 1L0WA 1KRTA 1FVIA 1KD1C 2WINB 1VQIA 2QDBA 2VY3A 5JPNC 3Q0AA 3TMEA 5LMUQ 1GUWA 5JAVA 1V8QA 1KTKA 1VQDA 5C3EG 4HIMA 4XYOA 2KOLA 5CBEE 3CCEA 4BA2I 3C46A 1FL0A 1WYDA 5CV8A 4HJ7A 1XMQQ 4EVOA 1HNZL 4GKKQ 2R7ZG 2RHSB 3BDLA 4IUTA 2PZWA 2VXWA 3GTQH 1VF5C 4DR6Q 3PMFA 2BE5D 2PQAB 2JA8B 3K80C 3HOYB 5GADC 3OTOL 3KF6A 3MWYW 4P75A 2E2IH 2Y0SB 4IPCA 3J80c 2PPBC 3ULJA 3TP5A 3MXGA 1SNQA 4C2MB 1I6VC 2OTJA 1EFWA 3I91A 4XYQA 3J81j 1L1OA 3D6WA 4FF2A 3QWNA 2BA1A 1G291 5EBDA 1L1OC 4IQZA 4LFCL 1G6PA 1X6OA 1SNMA 4UDUC 5JVG3 1PYSB 1LTTD 3U58A 4WJ3M 5G3LF 1I4XA 2EXDA 1LUZA 5E1FA 4QB4A 1EWIA 1WI5A 4QIWE 1YIJA 1RHPA 1JCKB 2KECA 4NMZA 1VMCA 2R92H 4P73A 2VQEQ 1PH5A 3G71A 4LF9L 3CU7A 1Y1VB 2JA5H 4RFBA 4GOPB 2LFNA 1IZ6A 2Y0SE 3O13A 4B3SL 4A3DG 4Q0FA 1GUNA 3EFXD 2D9UA 4KN4C 3MXUA 1LABA 2BA0A 4HJ5A 4OWWB 1SE3A 2WB1B 5CORA 4OGQC 4JBWA 3ND9A 3SGIA 3S1NB 3HGBA 1BKBA 1T5EA 3LWUA 3NTIA 1UE7A 1S5DD 4KY7A 1HUMA 3OIPA 3VR2A 4CBVA 2WIIB 3JAMi 5LMUL 3P20A 3E5SA 1F2LA 5D14A 5E4WC 2JA7B 1CM9A 4OIKA 4FF3A 2N3SA 3VYTA 4C2MH 2A1AA 3NWTA 5FKAC 1EIFA 3Q6SA 5EQ0A 3PUZA 3A8JE 2AHOB 4A3JH 4MZ9A 4B3TL 5EPKA 5NUCA 4A3LG 2QKIC 4P71A 1IL8A 2UUAL 2L0CA 2F0GA 4OL7A 4X62Q 5HURA 2MJ8A 2A73B 5IOCA 4F7XA 3P75A 1TR5A 4HIDA 3KLSA 3G6EA 1YBYA 5CV9A 2QCPX 2MNAA 1EWHA 1JJ2A 1Q1BA 4KHPQ 2D0PA 4NDXA 5M3MH 2EYHA 1ZYRC 2A6ED 3DEOA 2FJ2A 3S15B 1ML0D 1XNQL 2JJQA 4X66L 1TY2A 4DA2A 1AH9A 4O1NA 2PZUA 4O2DA 1O7IA 2ZT9C 4LF6Q 1RKNA 5D65A 3I4MG 3CKIB 4CJ2C 4M1UB 4G7HC 1GVPA 3FKIG 3I4LA 1S72A 3H0GG 2K04A 3I55A 1ILQA 4OO1G 3I7FA 3S2HB 4K5XA 5IP7G 4DV1L 4IOCA 2F0HA 3HOZH 3M7NA 1JE5A 1KHIA 1H9RA 1KRSA 2VB3X 4LF5Q 3SXHA 4LUVA 3W3AA 2ES2A 4BY7H 1RIPA 4XTCS 1JOKA 4LF7L 4OO1I 3I2ZA 1C9OA 2M00A 5T1IA 4QQBX 4ABNA 5C0XI 1XMOQ 2UXCL 2O5JC 1HTPA 5IT9c 5FLMH 3CCMA 5EJWA 4A93G 3R2IA 2N88A 4Y52H 1EY9A 4KKUA 2KCMA 3M4QA 4BY7B 1NTGA 1U9RA 2E2HH 1KAAA 4EX5A 3I3CA 3IFTA 1VQMA 1XMQL 3S1QB 4APVA 2I5HA 1Y1WG 5IGBA 4DV5L 4YY3Q 3R93A 5J22A 1OO9B 1LM0A 3N52A 1A3UA 2WFWA 4NXML 2JYOA 2XN9C 4HAEA 4F8MA 5M3MB 5KGUA 2KVMA 4A3GG 1EWCA 4GN3B 1IKLA 1X3GA 2WAQB 2KCNA 1MGSA 3MA2B 1BNZA 3ERSX 4A3EB 3PV0A 2F0KA 4EQPA 4A3JB 3K7UC 1WCMG 3VR4A 4DK3C 3CCRA 4LNQA 2BCOA 4N8X1 3RNUA 4C3IG 3BS1A 2B8GA 3AMUA 1EZ6A 1HH2P 1HZ9A 3NEMA 3PUVA 2XWJB 3MEFA 1XYIA 2VUMH 5IGEA 3D4RA 1KDAA 3CCUA 2F3VA 1YNNC 3FRPB 2MHVA 1S5CD 1S5FD 3AQQA 3PUWA 1PH1A 2CQAA 2I5LX 1EIGA 5M9OA 3S14H 2ALYB 2MO0A 2UUAQ 3KLSX 3AFQA 5ISRA 3GTMH 4IPHA 1W6JA 1WFQA 3JAMc 3CPWA 3CC4A 5DM73 3DM1A 4LWCA 4A3MH 2K03A 1EQQA 4AQYQ 1SN8A 2NVTB 5C4XG 4C3JH 3RLFA 4RMFA 1KNEA 4YIJA 1WTRA 4JI3L 1FD7D 1JWSD 4POGA 3IAYA 2E74C 1WD1A 1HNZQ 5FLXL 3PIOA 3CCJA 1TWCH 3KF6B 2NB0A 1SYEA 2NVQH 2B3GA 2RBMA 4OO1H 5M3FH 4FXGC 1SE4A 3A0JA 2QGQA 4C3HB 5C4JB 2LMCB 3TZUA 1V1PA 4UY8C 3TP6A 4QMGA 3GD7A 3K58A 2JA6G 4J1MA 2HQEA 4B3SQ 3VR5A 1TWFH 3GTPB 1Q1EA 3HOVH 5JJZA 1DGSA 5C4HA 1BUVT 3T53B 1H9JA 1QB5D 4BXXH 3SK6A 2AUKA 1QILA 4ZYSA 4X3KA 4JI0L 3L7ZC 4IO9A 1H9MA 1HA5A 4MHEA 1PV4A 4QCLA 1N36L 4K8IA 5J39A 1E2VA 4IUNA 3KDFA 2JSOA 3EJIA 2DGYA 1JOOA 2DY8A 5IGGA 3H0GB 1HRJA 1I5FA 3URYA 2UXDQ 2IJ0A 1I94L 5E7NA 3A74A 1G2TA 3GDEA 1KL9A 1XXGA 2PMZB 2WB1G 2FMMA 1EQVA 1B4OA 4LFCQ 4JOIA 1XNRQ 1F9QA 1DYQA 3OOCA 1WOCA 5DNFA 3U4ZA 5EPJA 1K83H 2QA4A 3QOLA 1JMCA 1VQ8A 4GKJQ 2EDGA 2WB1E 5ELEA 3FMCA 3GTKB 4OIJA 4I65A 2IX0A 2VUMG 2VUMB 1HR0L 2EXZA 5LHY1 2LS01 4JI2Q 1HJPA 2MGSA 1EY6A 3OW2A 2UXBL 2F0MA 1DOLA 2QDLA 3D4DA 4C56C 2Z6BA 1BDOA 3HOXG 4ZKBB 3BVZA 3F8TA 4LFAQ 1LLRD 4S3SA 1NCVA 4K6LA 1UAPA 3J80E 1VQGA 2R3ZA 4YWKA 1BCPC 3ULLA 1STBA 3KJOA 1V1QA 1P8LA 4DR7Q 3A8KE 2L12A 4P2CB 3BZKA 2JA7H 2B2WC 5TSSA 1L0XB 2RHQB 2QW7A 3K8AA 1SE2A 4ULLA 3BYYB 2BH2A 3T16A 4OX9L 1X3FA 4QJFA 2EQSA 4R4TA 1KABA 1I50H 1J5EL 4QL5A 1QE6A 5C4XH 1HFNA 4C3HH 4NXMQ 4DAYB 2K5QA 2CWAA 4A3BB 5LL6X 2IY5B 1E1OA 2NVYH 4AYBB 1RODA 4JI3Q 4KHZA 1MJEA 5BN3A 1X3QA 3L9AX 2IX3A 5C44H 5GAHC 3AEVA 1IYVA 1CT1D 2XTIA 1IKMA 3J7AF 4K6DA 4DF7A 1VQLA 4LF4L 3QR8A 1C48A 4PZ7A 1MSGA 1DXMA 1WJJA 3K59A 4L5TA 2JA6H 4DAVA 1Q8IA 1EOVA 4LAAA 2B63B 1VF7A 4OONA 1IYUA 1D8LA 3QOJA 3AB9A 2R7ZB 2K14A 4JC0A 1N9WA 1LT4D 1DM0B 4BY1B 1QZHA 1E0BA 3D8GA 3M3YB 1JC7A 4GNXA 1VQNA 3CXCA 1D2BA 1YHQA 2YTYA 4GLXA 1A15A 1CUKA 1Z6HA 2PYKA 1IBLL 3S16H 4NKLA 4KLKA 1UWVA 3PO2G 1TT2A 2NTTA 5I9OA 4RKLA 3VYSA 2O4XA 2K50A 1K28A 3VYUA 2VW9A 3OHXC 5IGDA 2KHIA 3KJPA 2A19A 3SK5A 3H3VC 2N8NA 1R4QB 4YY3L 3M4OH 4G7ZC 3V05A 1TWAH 4YHHQ 2KENA 2Q2TA 1K8OA 1GUTA 4WJWA 1XNRL 4A3LH 1EY7A 3CC7A 2ZXOA 3HS0C 2EOTA 3KK7A 3EVQA 4YCVA 2OCEA 3M4YA 3NTHA 3OMGA 2KQ3A 5M5XB 2RA4A 2KJXA 3CAMA 3CP0A 3I4NB 2EE1A 1LTRD 2KCTA 2EYLA 3M4OB 4POFA 4CDFC 1WTQA 4Z9CB 5M3MG 3FP9A 3R3OA 3MXNB 3HOWH 3DM3A 2K4KA 4GLVB 1EYDA 1HXYD 3VYRA 2HD3A 5EGTA 1EOTA 4YWMA 1DCZA 1L0YB 5CYUA 5D3IB 1I94Q 1HNXQ 4A3MG 2F0EA 3GTOB 5CMDA 1A3TA 4QF4A 3H3VI 1EY0A 3G48A 2KHJA 1LTID 4GKKL 3CMEA 1NR2A 4DR4L 1YITA 2B2VA 1VQFA 1LTLA 4IZ8A 4XIGS 3K5OA 1Z9FA 2B39A 4R4CA 4CDEC 1I4RA 1VQHA 4DUZQ 3Q23A 1G51A 4OX9Q 2JEAI 1N32L 4TVAB 2YYZA 5CR3A 2CFMA 2XIWA 3K57A 2UXBQ 3NELA 2NUCA 1STGA 4TRDA 4KKTA 1CZWA 2H1EA 2F03A 4XXEA 1GXDC 4PV1C 1HR0Q 1ASYA 3HZXA 1CA5A 2NBFA 3CF5A 1YJWA 2Z0SA 3ONAB 4DV3Q 2L15A 4DV7Q 4LFAL 4B9XA 1B50A 2JK8A 5JPMC 1D7QA 4BY7G 4ZKCB 3BDCA 3NBHA 3I4NH 5C0XJ 4RHRA 4I7ZC 2K5NA 4DR3L 2Q8IB 4DK6C 1J5EQ 2KEEA 3TS2A 4P74A 2IW3A 1I4HA 4JVZA 1QUQA 2R7DA 1FYCA 1HTLD 1S3OA 2VQFQ 3PQIA 3TS0A 4BBSG 2XRQD 2KUMA 4P72A 4EQNA 3MFGA 1PH4A 1PA6A 2EYJA 5IGCA 1U5KA 3K5LA 1PH3A 4TSSA 4A3MB 4PZ8A 4QUCA 1TIID 1SYBA 5C3WA 5FO8B 3MXPA 1HHVA 3K81C 4DK0A 4K2KA 2PMZE 1PFNA 5I9PA 2NYZD 5I4DA 2K5VA 1CKMA 5H1SE 4WFN3 4ZQ3A 1KAWA 3HOZB 4IPGA 2B2TC 2SNSA 2NVXH 5IP9G 4FDBA 1SYDA 2JEBI 3GV3A 2A8VA 2PZTA 4BA1I 3LNNA 3OYYA 1M1KC 4JI7Q 4DR4Q 4K14A 1S40A 1PZKD 5C0XG 2Z6KC 2B8FA 1F2MA 3U50C 1SE8A 2K75A 1FNVA 1EFID 2TMPA 2ZM6L 3RZDB 2CH4A 4WRDA 2D2CC 1ESRA 2PW5A 1DJRD 1E22A 3S17H 1LT3D 1O7LA 1J6QA 3W5OA 2YU9H 4QUFA 3CW2C 3TN2A 1JOQA 3W1BA 4N9TA 1YVCA 1MBYA 1BBWA 3L0OA 3T1HL 4UP9A 3DEPA 2FINB 1GD7A 1XTCD 1KC8C 1KDBA 2BH8A 1O80A 4YHHL 1D5XC 5KNBA 1GUGA 2E76C 5JJIA 2ZTCA 5IY0A 2EY2A 3I4MH 4PG3A 3FPPA 2PI2E 1O7YA 3GTLH 2IX1A 2PW7A 1KXLA 1M90C 5IIFA 1NNXA 3JAME 3VDYA 2K1BA 4ALPA 2GA4B 1Q46A 3I70A 3PIO3 4B3RQ 3FKIB 3DLLA 4HJ8A 3S14B 1QJOA 1MKHA 1IYJB 1X32A 5BN5A 2AQ3B 4TQUS 4KKSA 4JI1Q 1HZBA 1RTOA 4RGOS 1U4LA 1V1OA 1Z47A 4DUYL 1IBLQ 1O78A 2L9HA 4OEMB 2PQEA 2R92G 5J1ZA 1F9PA 4JPBW 1QZGA 1P16A 4DV4Q 1MHWC 2RKSA 1X54A 4K8JA 4OWXB 4XT3B 2EYFA 4X6AH 3LX0A 1VQ7A 1PFMA 1Y1WH 3NPPA 5LMNQ 4IFDG 3F1ZA 3BG3A 5A2QE 1H95A 1GUSA 2RVLA 4X64L 2K05A 3NTKA 4IJLA 2WACA 4LK1C 3DHQA 2C9OA 3R2TA 4CKEA 4EGVA 1BCPF 4KHVA 1A6XA 1EIHA 3RMHA 4IFDJ 5JOBA 3KFUA 3S17B 1E3PA 2Y0SG 1X56A 2NN6H 3PO3B 5I2YA 4ME3A 4JI4L 2F1MA 1TWFB 1Y8OB 4A93B 1CA6A 4RGNA 3GTJB 1QUQB 2F0QA 5C5MA 4U673 1F9RA 2HIXA 1KDCA 3M4PA 3D31A 4JW0A 1JB7A 1T9HA 1CI3M 3CRKC 2A69D 2WKCA 2F0DA 3OWFA 1STYA 1PFBA 4BBRB 5DM63 5FOBB 1A2UA 4DR2L 4A3KB 3RZDH 3S2DB 4IUQA 3GP7A 1A3VA 1TS3A 3J81L 4B3ML 4LF8L 2WV6D 4LF6L 4BBRH 1K8AC 2JP1A 2Q2UA 1DONA 3D0FA 3T13A 1EYAA 1BVSA 1GJXA 3NBIA 4K5WA 5COYA 1RF2D 1BCPD 2VQEL 1FNUA 3RLOA 3NSWA 4X66Q 4B9WA 4LMQD 5M5WH 2JA7G 3S2DH 5C4JH 4DR1Q 1N34L 3C1EA 2EYOA 4XDXA 3U9SA 4CJ1B 1N33Q 1EEFD 4X65Q 2SNMA 1D6EC 1KIXA 4NB3A 5GQOA 1E24A 1TU2B 1VQ9A 5E4XA 3PUYA 4K0KL 2AQ1B 1JWMD 4TKOB 1J8IA 3S1NH 4A75A 3EROA 5KIXA 1VMPA 4L5SA 2WKDA 1B3QA 3A54A 5HGQA 1VQAA 1BOSA 1PMRA 1SBBB 4PMCA 5C6AA 1NE3A 3E9IA 3IKJA 3TZDA 5C44B 2QILA 3BVMA 4K5VA 4MTNA 2RQXA 5EKKA 1Y8PB 2RCNA 1SFOB 3S1MB 1TWAB 3AU7A 4LF7Q 1WTXA 1R9TB 1FJGL 1VQOA 1SYGA 1RD9D 1GM5A 2R93H 1QG7A 1JJGA 5GAEC 1HNWL 4DV6Q 1DOMA 3I4NG 2J7ZA 5GAGC 4FF4A 1B3AA 1E2ZA 2MUYA 1U4RA 4XQNA 4JK1C 1I50B 1LTGD 3KF8B 1EU4A 1LYLA 5EAYA 1I6HB 1NSNS 4F88A 4CKBA 1QCBD 1K9MC 3ICEA 2SEBD 3WDNA 4BBSH 2A6HD 4L5QA 2PNRC 1TS2A 4PMWA 1C0AA 3X3MA 4AH6A 5J3BA 1PTOH 3CCLA 1HUNA 1ET6A 4YWLA 1J9OA 4A76A 3Q24A 1KNAA 3H3VH 4DNRB 1UEBA 3VR3A 1YEZA 3V96A 4A3GH 2EY6A 5JEAG 1O7ZA 4DAMA 2ZJPA 2SOBA 5ELCA 2HDMA 4H7BA 2C35B 3EA6A 3NXWA 3RR5A 1AEXA 2LXJA 2NZHA 2F0OA 2JA6B 2EIFA 4XQJA 5JVH3 1IW7D 3QB3A 2RSNA 3UE1A 4BWGB 2IWHA 2BOSA 5IODA 3SVMA 4IN3A 5C0XH 2UXCQ 3K5NA 1EY4A 1ONLA 2K32A 4DGZA 2F3IA 2RSOA 3EN2A 4FP5D 2UUCL 4ZRZA 2N55A 1TS5A 4C1NI 4DV5Q 4X3TA 4DR3Q 4X3SA 4JI8Q 2QEXA 3RZOH 3RUZA 3DXJC 2TSSA 1OXSC 1E2WA 1ZKOA 2Q8RE 4DAPA 1HZAA 1VDZA 1SMYD 1QOHA 2R92B 3RN5A 4HMJA 1EQRA 1PRTD 2OWOA 3GQBA 2H4OA 3HOWB 4L6TB 4KV6A 2JA5B 2F0UA 1EUJA 1EL0A 2V1CC 1WVLA 2H5XA 4DR5Q 2Z6KA 1CHPD 2YTXA 1HQMC 2UU9Q 1YNJC 4JBJA 1B1ZA 1IW7C 4DUYQ 1AE3A 5KNDA 1HA6A 3IRBA 2B63H 3VA7A 3NHHA 5DAUA 4PQXA 4X64Q 1N36Q 2G5DA 2R7FA 5M3FG 4R4QA 2E2JH 1XTDA 1R9TH 3QJYA 2ENBA 4HJ9A 4U68A 5HGTA 4IURA 3I56A 1PH8A 2K01A 2C5CA 3FEWX 1FGBD 1NUCA 3HKZG 4B3MQ 3UDXA 2B2TA 1HZCA 4LF8Q 3M3YH 1IHZA 1K3RA 1K8MA 5IYCH 1B44D 2JA9A 3A5UA 4DR2Q 1B70B 1Q81C 2G9HD 2CVRA 1E7ZA 1SMYC 4DFAA 2E2JB 3BJUA 3DWQA 1ICWA 1DOKA 2E2DC 1PRTF 2Z8LA 1ASZA 1SEBD 2Z4HA 1ET9A 1D1IA 1UNSA 4ZCKA 4DAYA 1RCVD 5CV7A 5EKIA 1NR4A 2ZJRA 1HPCA 1B8AA 3HFZB 3V2TA 4JBMA 1RTNA 2I07B 1RL2A 4OXPA 1STNA 5FJ8H 1SNOA 3K0XA 4NP5A 2HHHQ 5GROA 1YNJD 3PO2B 4LJZC 4RGTA 4A3GB 5JEAH 2D0OA 2PQAA 3DWPA 5E3FA 3SE0A 3KLWA 2JXMB 3HKSA 1YJNA 3MC0B 2RDFA 3STBC 3BVGA 5FO7B 1GUOA 5BR8L 5ELFA 1PRTB 4J8QA 3UE0A 5IWAQ 1VQPA 1KQSA 3MHBA 3TDQA 2HT1A 2JE6I 3E6ZX 3TREA 2Q2HA 2F0PA 4KMUC 2Q8TA 3J7AV 3CRLC 3GTMB 5IP9H 3W2DA 2KHSA 2MFIA 3KDFB 3HOWG 1TQOA 2EZVA 3BU2A 3IFDA 3K5MA 3A8IE 3MEHA 3M85A 5K36H 3HOUG 1LTBD 4X65L 4RHSA 3HRZC 2F0FA 3I72A 1LT5D 5K5PA 3DMUA 1B7YB 4UPAA 1YZ6A 3GTJH 4ODGA 1H9KA 1B2TA 4G4KA 5EPLA 3UDFA 4F87A 4KY6A 4DXGA 1DZ1A 1TWGH 1CK1A 4MTKA 2ZXPA 4NW2A 2OTLA 3HG9A 2OEOA 4GKJL 1W3SA 2E5LL 1ICFB 4BS9A 1TXYA 1BF4A 3A7AB 2ZXRA 1NY4A 1SMXA 2B2YA 2CHBD 4JI2L 5CBAE 3B6YA 2FHTA 3S1QH 5IYBG 1QVFA 4KD3A 4DR6L 5AJ3L 2DJGC 4LF4Q 1N33L 2EJFC 3HOVG 3H15A 2UXDL 4GN4B 5ELDA 2Q2IA 2YTVA 1CQFA 1GOZA 1H9SA 1S5ED 1M4VA 3KYHC 1PTOD 2AQ2B 1NAPA 1ZEQX 4JG2A 3CCSA 1K0RA 2HIVA 3D6CA 1I3QH 4A3EH 1WTVA 1NMFA 2L5TA 2EJGC 3A5ZB 1JWUD 4C3JB 1JE4A 3CQZB 4A4IA 3C2PA 5IYCG 3F2BA 1PH6A 1GHKA 5A2QL 1SJED 4MIUA 1KLUD 1SLJA 2XNAC 3KUPA 3MTSA 2LXKA 3F2UA 3K7AB 1FNWA 5ELNA 5IGFA 2F0TA 4LUZA 1TS4A 2EPBA 1A0IA 4IFDH 2NZ1D 1ZYRD 3W1GA 3T4AC 1AN8A 1XWEA 4A3DB 4KHPL 4JI6L 4NXNQ 3WOFA 3NENA 3KF8A 4K0KQ 2DUDA 1SDFA 1U4MA 4IFDI 2RCFA 3S1MH 5LMNW 3UDIA 3EQLC 4FO2A 4A3KG 1WTHA 2F0VA 2EYPA 3OW7A 2I0QA 2NN6G 4NPSA 1ZXTA 4RWSC 2IHFA 4C3IB 1XMOL 4N8FA 5EKLA 3FDTA 4A3FH 2JQOA 2UUCQ 1STAA 4A3JG 1K73C 1L1OB 2XWBB 1BQQT 4Y7NH 3PIP3 5LL6S 3BZDB 1D1KA 4JI5L 1VQ5A 3H94A 3U4VA 2R61A 3EBEA 3HKZE 4B3TQ 3J81c 4FXKC 4PZ6A 3I4OA 3G6JB 4HSVA 1G6ZA 5M3FB 3PO3G 4QY7A 1EY8A 3Q8DA 1Q90A 2AMCB 3CCVA 3TQYA 1SJHD 1QNUA 4CKCA 3MZ5A 5D3DA 4BY1G 2HCIA 2AKWB 1N8RC 3PF4A 4C1NK 1SNDA 1EEID 1SNCA 3NWSA 4JV5L 2HQLA 3D3RA 5FK9C 1F77A 3I8ZA 1KLGD 4GOPA 1TKWB 3S24A 2X69A 1WTWA 1PYBA 4PNYA 1PVOA 1SRUA 1ENFA 4RCNA 1U0LA 1XNQQ 1Q3LA 2IT1A 1VQ4A 4DUZL 5IE8A 1CFMA 2KEDA 3A56A 5IYBH 2FFKB 1XX8A 3J81i 2K28A 2L4NA 3FKIH 2MP1A 2X6LA 2A6EC 2V4DA 4UP8A 1I4QA 3HEJA 2CKZB 3BDOA 4JI7L 3CD6A 5IT9L 2PCFB 2KBNA 5IP7H 4JBKA 4A3IG 4AYBG 4X62L 4XQQA 1PDQA 1BR9A 5BR8Q 4RA8A 3NK9A 4LW1A 1GO3E 2A6HC 1X9NA 4A3CG 3MXNA 5IYDH 1ILPA 1I3QB 3I4MB 2JN4A 3A55A 1TWHB 2CCZA 3AFPA 3J81E 1OXUA 1Q8KA 1Y1WB 3CPFA 3CHBD 1G2SA 3I73A 2PI2A 4HMIA 5JEAJ 2VQFL 4RG1A 5L37A 4J15A 4JCVE 1FGUA 1XPRA 1R4PB 1NJIC 2R6GA 3S16B 1WCMB 1ENAA 2OQKA 3ND8A 1BBXC 2ATWA 1TVXA 3T56B 1U4PA 3K0YA 2MPMA 4LFBL 3H6MA 2R93G 4DV3L 1VQBA 1X55A 3OMCA 3X3NA 4A3DH 2XGTA 3WWVA 1V43A 3JAML 2E5LQ 2UUBL 2VB2X 3J80i 4DXFA 3PGZA 4RH6A 4LF5L 4L5RC 1F2YA 2AWOA 1B9NA 1ENCA 2NVQB 2DJFC 1XPOA 2XSCA 4CGYB 4BBSB 4ZUJA 5CV4A 1F9SA 1SYCA 3KLRA 3TP8A 1PXUA 4R8IA 2EVBA 4NXNL 4JI6Q 2EYMA 4JI0Q 1C7YA 1GKHA 3TEHB 5KYIA 4DKAC 4A3KH 2RDHA 4E6IA 1X3EA 4ID6A 5CC4A 4CJ0B 1A63A 1QVCA 2OF1A 3NBHB 2K5HA 4DV2Q 3PO3H 1UE1A 1LV9A 1HCZA 2DNEA 2F0LA 1QNKA 4UP7A 1SXTA 4V0BA 3BZCA 4MNOA 5BN4A 3NE5B 4BBRG 1QWYA 3BYTB 4V190 4DN4M 3ITPA 5CGKA 1A8VA 1AW7A 3GTQB 1AP0A 2GN5A 1G91A 3EIVA 5C3EH 1WTOA 1AFPA 1Y1VH 2EY5A 3H09A 1MIUA 3MAQA 4JI4Q 1FR3A 1YHAA 1AE2A 2WAQE 4RGMA 1MSHA 1A62A 1WD0A 3T1HQ 4BY1H 1PTOB 1VQJA 3T51B 2R7ZH 3OSOA 1UE6A 2E8GA 3H91A 4N9PA 3GTGB 4JYAL 1K83B 2SDFA 4ZUIA 4B08A 1HR0W 1B9MA 2O2LD 4G7OC 3E3XA 4GN5A 1XJVA 4C3HG 3TSSA 1D5ZC 1CZGA 3FHWA 4J6HA 3QIAA 4JI5Q 5I6YA 3GTGH 1L2FA 1LO5D 4HCSA 3UI2A 1G8ZD 5G3LD 3QO2A 4KK7A 4DNIA 2R93B 3SEBA 1STEA 3G4SA 2N78A 2NTSA 5I2XA 1Q7YC 4R4OA 3ER0A 2WP8J 4JI1L 3TP7A 3KOJA 1VQCA 2EJMA 2F52A 2M9VA 5CV6A 4BXXG 2ZM6Q 4YCUA 4A3CH 1JB3A 1EIYB 1VQKA 1BCPB 1F2ZA 3KBGA 3ZJYC 1D5MC 4L8JA 2O5IC 1C4QA 2JA8H 3HOYH 1PTOC 1H9SB 3SDZA 2CQOA 4DR1L 4DK1A 1Y69U 4GLAC 3P7JA 2G9DA 4DV6L 3TBIB 1MJCA 3P1HA 3LWEA 5DLQE 1SFOH 5FJ8G 2VZAA 4MN3A 5KNCA 5M5XH 2DN8A 2NN6I 3OWEB 1BXTA 5EBCA 3T1YQ 2IL8A 1VCIA 2K6AA 4IPDA 5C3XA 2D62A 2F3WA 2CW0D 2F4VQ 4IUPA 2K52A 3A7LA 1Q86C 1PZID 2Z4IA 3SR1A 5FLXc 5C3EB 3GTOH 2E2HB 3QG1A 2QEJC 3STBD 2A68C 2UUBQ 3DUZA 1A2TA 1YNXA 1Q12A 1UEAB 2N49A 4HN7A 4B3RL 2F4IA 5AJ3Q 3PIPA 3CC2A 4AQYL 1PTOF 1I6HH 2MO1A 1CHQD 1V9PA 3VA5A 2OXPA 3RLNA 3HOUB 1VQ6A 3MVVA 3U9OA 4KTAA 1HNWQ 3CQZH 3E0EA 1CKNA 1CSQA 1K0SA 4K2LA 1PYWD 4AIMA 1UE5A 1X65A 1SYFA 1SROA 2BDNA 2PO4A 4HEDA 3TRZA 4CDDC 3S2HH 2D5DA 3IL8A 1V1PB 4ILWA 3SK8A 3HOUH 1NBWA 1N34Q 2ICEC 1CSPA 4R4IA 1STHA 1X3PA 3DWAA 2YU9B 3NQTA 1RDPD 1YHBA 3HKZB 2F0JA 1JQYD 3R8BA 4H0LC 3D4WA 1EU3A 2I5MX 5A35A 3S1RB 4H44C 4OWTB 1LT6D 3GTLB 2ASBA 1SAPA 1SR3A 1Y1VG 2ZTDA 4EQ5A 2P5ZX 1BBUA 1TY0A 2IPKD 3SHLA 2B2WA 1B53A 4I7AA 1VS0A 2WAQG 4GNXB 1M8AA 2VL6A 4FYDA 3RZOB 4DPGA 4KI0A 4DV4L 1AZPA 4PMBA 1IBMQ 4JV5Q 2NVXB 1GHJA 5ELOA 1EY5A 1OTCA 1IBKL 2NVTH 4CHTB 5HY6A 2B63G 4R9WA 1II3A 2LKVA 1WTPA 4A3IB 4RCOA 3F2DA 5JJKA 3RD4A 1LTAD 1EQTA 1YI2A 2A69C 3E9HA 4RKBA 5IT9E 1QVGA 5KEEA 3RN2A 1HNXL 1JICA 4FXDA 4H02A 1FJGQ 3AYHB 2ZJQA 4A3EG 1PH9A 1RJTA 3OTOQ 5M5YB 1YNND 4KY5A 4X3UA 4KN7C 4DV0L 3H0GH 2HDLA 1UUPA 4O0AA 4GZYC 3LGJA 5FLMG 2B2YC 2CH4W 3HOZG 4R8NA 2BDOA 3S15H 2CW0C 4Q5VA 5JJLA 2K5WA 1PRTC 5DEHA 1OXVA 2B2UC 2OQ0A 2FXQA 3PCOB 2AWNA 2A68D 3VR6A 3PO2H 1Z7TA 2XVSA 3NP8A 2B2VC 2J4XA 2GVAA 4IOAA 4CDCC 4A93H 1CQVA 3GO5A 3M7GA 3K7AH 5CV5A 3J7YW 4HJAA 4DR7L 1MD2D 3FVQA 3HP3A 1PZJD 1JJCB 2K7VA 4KJNA 3CMAA 3NUCA 3PF5A 5ELBA 5KYLA 4WORA 2MQHA 4GS3A 4ZK9B 3WOEA 3G7LA 1S4ZA 2KA7A 1CKOA 4FVMA 1VQEA 2M2LA 4HR7B 4UHVA
chains in the Genus database with same CATH topology
1Q46A 5ELNA 4B3RQ 4A3MH 4A3BG 4LUZA 3DLLA 4HJ8A 2ID0A 1W2BA 1A0IA 1MKHA 1SN8A 2PNHA 4AQYQ 4C3JH 4A3FG 1IYJB 4DR5L 3W1GA 3RLFA 1OXXK 4LF9Q 5C4XG 4RMFA 4YCWA 4TQUS 4KHPL 4JI3L 4JI6L 2UU9L 3NENA 4QGUA 4NXNQ 4JI1Q 4K0KQ 1HZBA 4C3IH 4POGA 2YV5A 3GTKH 2DUDA 1IBLQ 1Z47A 4DUYL 4HIKA 1HNZQ 2R92G 4IFDI 5K36G 3HOXH 1CKNB 3PIOA 3CCJA 5LMNW 3S1MH 4LFBQ 1TWCH 3UDIA 1QZGA 4JI8L 3KF6B 4A3KG 1P16A 3PSIA 2NVQH 2B3GA 4DV4Q 3S1RH 5M3FH 2I0QA 1X54A 2NN6G 2QGQA 3A0JA 4NPSA 4OWXB 1IBML 4JYAQ 4X6AH 2IHFA 1VQ7A 3F2CA 1XMOL 4UY8C 1Y1WH 3JC66 5LMNQ 4A3FH 4IFDG 3GD7A 2JQOA 3F1ZA 2UUCQ 4DV7L 4A3JG 2GVBA 1K73C 1L1OB 3PUXA 2JA6G 1H95A 1PFSA 4X64L 4Y7NH 2ZTEA 4B3SQ 4IJLA 1TWFH 4JI5L 1Q1EA 1VQ5A 3U4VA 3HOVH 4LUOA 3T1YL 2VS1A 4IFDJ 3EBEA 1DGSA 3HKZE 3KFUA 4B3TQ 2F4VL 1E3PA 2Y0SG 3J81c 3J7ZC 4PZ6A 3I4OA 4A3IH 4BXXH 4DV1Q 3CCQA 1X56A 3PO3G 4QY7A 4ME3A 4JI4L 3Q8DA 4JI0L 3L7ZC 4IO9A 2AMCB 3CCVA 3TQYA 2IHEA 3ULPA 1QUQB 1PV4A 1N36L 4BY1G 2AKWB 4HIOA 1N8RC 3PF4A 3KDFA 1IXRA 5M5YH 5C44G 2DGYA 2HIXA 2NZOA 4DV2L 4JV5L 1I5FA 2HQLA 3D31A 2CWPA 3M4PA 1JB7A 1T9HA 4GOPA 1EYGA 3S24A 4R1JA 2UXDQ 1PYBA 1I94L 5E7NA 3A74A 3GDEA 1SRUA 1PVOA 1KL9A 1OXTA 1U0LA 4IJHA 1XNQQ 1E1TA 2IT1A 2WB1G 5IYDG 1VQ4A 2JA8G 3HOYG 4DUZL 4DR2L 3RZDH 5IE8A 3L2PA 4LFCQ 1YJ9A 1TWHH 4JOIA 1Y14B 5IYBH 1N32Q 1XNRQ 5IWAL 3J81i 3FKIH 4JOIC 2VNUD 4B3ML 4LF8L 4LF6L 4DV0Q 1WOCA 3U4ZA 4UP8A 1PH2A 2JA5G 2CKZB 1YHQA 4JI7L 1K83H 4BBRH 2QA4A 1K8AC 1JMCA 5IP7H 2KBNA 1VQ8A 2Q2UA 2WB1E 4AYBG 4A3IG 4JBKA 4GKJQ 4X62L 3D0FA 2IX0A 5BR8Q 1BVSA 2VUMG 4LW1A 1GO3E 1HR0L 1X9NA 4A3CG 2VQEL 4JI2Q 1PHJA 5IYDH 3RLOA 1HJPA 4X66Q 2UXBL 3OW2A 5M5WH 1NMGA 1PH7A 2HHHL 2JA7G 3S2DH 1Q82C 5C4JH 4DR1Q 2CCZA 1N34L 3AFPA 2RF4A 3HOXG 2B29A 4GNXC 1N33Q 1OXUA 1Q8KA 4X65Q 3F8TA 3CPFA 1KIXA 4NB3A 4LFAQ 5GQOA 1E24A 1K8GA 4WJ4A 1JT8A 2PI2A 1VQ9A 5JEAJ 2VQFL 4RG1A 3PUYA 4K0KL 1VQGA 4J15A 4JCVE 4YWKA 3J7A5 3ULLA 1FGUA 1XPRA 1NJIC 3S1NH 2R6GA 3GTPH 4A75A 3KJOA 1V1QA 2OQKA 1P8LA 3UDGA 4DR7Q 2ATWA 4L5SA 4A3BH 4LFBL 1IL2A 5HGQA 1IBKQ 1VQAA 2R93G 4DV3L 1VQBA 1X55A 3BZKA 2JA7H 4A3DH 2XGTA 1NE3A 3M9BA 3E9IA 3WWVA 4GOPC 4AYBE 1V43A 2RHQB 2E5LQ 3K8AA 2UUBL 5LMNL 1WCMH 3J80i 2LSSA 1EQQA 3PGZA 4MTNA 2BH2A 1L0WA 1KRTA 4OX9L 4LF5L 1X3FA 1FVIA 1KD1C 2RCNA 4L5RC 1VQIA 2AWOA 2EQSA 4QJFA 4R4TA 4LF7Q 1FJGL 2VY3A 1VQOA 1I50H 1J5EL 5LMUQ 4QL5A 5C4XH 1XPOA 4C3HH 4NXMQ 4DAYB 1VQDA 5C3EG 4HIMA 2CWAA 2IY5B 1E1OA 1GM5A 2R93H 1JJGA 5GAEC 1HNWL 4DV6Q 3CCEA 4BA2I 2NVYH 3I4NG 5GAGC 1FL0A 4NXNL 4JI3Q 4KHZA 4JI6Q 1MJEA 1WYDA 5C44H 5GAHC 3KF8B 4JI0Q 4HJ7A 1XMQQ 3AEVA 1C7YA 1HNZL 4GKKQ 1GKHA 2XTIA 3TEHB 4DKAC 1LYLA 2RHSB 4A3KH 2R7ZG 3GTQH 5EAYA 4DR6Q 1X3EA 1VQLA 2PQAB 4LF4L 3K80C 5GADC 1K9MC 3OTOL 4PZ7A 3KF6A 3ICEA 1QVCA 1A63A 4P75A 2E2IH 3NBHB 2K5HA 4DV2Q 1WJJA 3PO3H 4L5TA 1UE1A 4IPCA 4L5QA 4BBSH 3J80c 2JA6H 3ULJA 4PMWA 1C0AA 1EOVA 4AH6A 5J3BA 4OONA 3CCLA 2OTJA 1D8LA 1EFWA 4YWLA 4UP7A 3J81j 1L1OA 3BZCA 4MNOA 2K14A 2BA1A 4A76A 1G291 4JC0A 3H3VH 4BBRG 1N9WA 1L1OC 4LFCL 1QZHA 1X6OA 1UEBA 1G6PA 1YEZA 1A8VA 1PYSB 4A3GH 3U58A 5JEAG 2GN5A 4WJ3M 4DAMA 2ZJPA 3EIVA 5C3EH 1Y1VH 2EXDA 4GNXA 2C35B 1LUZA 1VQNA 1MIUA 3CXCA 4JI4Q 3RR5A 2YTYA 2WAQE 1EWIA 2NZHA 1AE2A 1YHAA 2LXJA 4GLXA 1CUKA 1A62A 1WI5A 2EIFA 1IBLL 4QIWE 1YIJA 3T1HQ 4BY1H 3S16H 4KLKA 1UWVA 3UE1A 3PO2G 1VQJA 2R92H 2UXCQ 4P73A 2R7ZH 2VQEQ 1PH5A 3G71A 4LF9L 1UE6A 2E8GA 2F3IA 2JA5H 4JYAL 2K50A 2VW9A 3EN2A 2KHIA 3KJPA 2A19A 1HR0W 2UUCL 4GOPB 2N8NA 1IZ6A 4GN5A 1XJVA 2Y0SE 4DR3Q 4DV5Q 4YY3L 3M4OH 3FHWA 4JI8Q 2QEXA 4B3SL 3RZOH 4A3DG 1TWAH 4JI5Q 4YHHQ 4BY7H 2KENA 2Q2TA 3GTGH 1OXSC 1L2FA 3CD6A 1HZAA 1XNRL 4A3LH 2BA0A 3CC7A 4DNIA 4HJ5A 3RN5A 4OWWB 1EQRA 4BBSG 3G4SA 2N78A 4JBWA 2OWOA 4YCVA 1Q7YC 4R4OA 2OCEA 3ER0A 2WP8J 4JI1L 3KOJA 1VQCA 1EUJA 2F52A 4BXXG 3CAMA 2ZM6Q 3CP0A 3SGIA 4YCUA 4A3CH 1BKBA 1EIYB 1VQKA 2KCTA 1UE7A 3ZJYC 2V1CC 4POFA 2H5XA 4DR5Q 2Z6KA 2JA8H 3JAMi 2YTXA 5M3MG 5LMUL 3HOYH 3FP9A 3HOWH 3MXNB 3DM3A 2UU9Q 2CQOA 2K4KA 4DR1L 4GLAC 4GLVB 4JBJA 4DV6L 4DUYQ 1AE3A 4YWMA 1MJCA 2N3SA 3IRBA 2B63H 1I94Q 1HNXQ 4C2MH 4A3MG 2A1AA 4X64Q 1N36Q 5DLQE 2R7FA 5FJ8G 5M3FG 1SFOH 2VZAA 5M5XH 3H3VI 4R4QA 2E2JH 1XTDA 1R9TH 3G48A 2NN6I 2KHJA 1EIFA 4GKKL 3PUZA 3CMEA 1VCIA 4HJ9A 3T1YQ 3I56A 1PH8A 4DR4L 4IPDA 1YITA 2D62A 2AHOB 4A3JH 4MZ9A 1VQFA 4B3TL 2F4VQ 2K52A 1LTLA 4XIGS 1Q86C 3HKZG 4B3MQ 3UDXA 5FLXc 1HZCA 4LF8Q 4P71A 2UUAL 3M3YH 3GTOH 4A3LG 1Z9FA 1K3RA 4R4CA 3STBD 5IYCH 4X62Q 2UUBQ 2JA9A 1YNXA 1VQHA 3A5UA 4DUZQ 1B70B 1Q12A 1G51A 4DR2Q 2N49A 1Q81C 4OX9Q 4B3RL 1XPUA 2JEAI 1E7ZA 4TVAB 5AJ3Q 2YYZA 3PIPA 4HIDA 4AQYL 3CC2A 3G6EA 1YBYA 1I6HH 2MO1A 2CFMA 3BJUA 1V9PA 2MNAA 2UXBQ 1JJ2A 1Q1BA 4KHPQ 3NELA 3RLNA 2D0PA 1VQ6A 5M3MH 1ASZA 1HNWQ 3CQZH 3E0EA 1CKNA 2ZJRA 1CSQA 1B8AA 3HFZB 4AIMA 4JBMA 1UE5A 1XNQL 1HR0Q 1X65A 2JJQA 1SROA 4OXPA 1RL2A 3TRZA 3S2HH 4X66L 5FJ8H 1ASYA 3K0XA 3HOUH 2HHHQ 1NBWA 5GROA 1AH9A 3CF5A 1YJWA 1N34Q 1CSPA 2Z0SA 4R4IA 4DV3Q 2L15A 4O2DA 2D0OA 1O7IA 4DV7Q 4LF6Q 4LFAL 2PQAA 2JK8A 3KLWA 3HKSA 1YJNA 3I4MG 4BY7G 1D7QA 1YHBA 3STBC 3I4NH 5C0XJ 1GVPA 5BR8L 3FKIG 1N32L 2K5NA 2I5MX 3UE0A 5IWAQ 4DR3L 1VQPA 1KQSA 1S72A 3H0GG 3I55A 4DK6C 1J5EQ 3I7FA 4OO1G 2HT1A 4P74A 5IP7G 4OWTB 3TS2A 2JE6I 4DV1L 4IOCA 3TREA 2ASBA 2Q2HA 1SR3A 3HOZH 1Y1VG 3M7NA 1QUQA 2ZTDA 1JE5A 2R7DA 4EQ5A 1BBUA 1KHIA 1KRSA 5IP9H 1S3OA 2VQFQ 4LF5Q 4LUVA 3TS0A 2MFIA 1VS0A 3KDFB 2WAQG 1RIPA 4XTCS 4GNXB 2ES2A 4P72A 2VL6A 4LF7L 3I2ZA 3HOWG 4OO1I 4DPGA 1PH4A 1C9OA 4KI0A 4DV4L 1PA6A 4QQBX 1U5KA 3BU2A 1PH3A 1IBMQ 5C0XI 4JV5Q 4PZ8A 5ELOA 1XMOQ 1OTCA 1IBKL 3M85A 2NVTH 5HY6A 2B63G 2UXCL 3HOUG 5IT9c 5FLMH 4X65L 3CCMA 3K81C 2PMZE 4A93G 4Y52H 2KCMA 3M4QA 1NTGA 2K5VA 1CKMA 5H1SE 1B7YB 4UPAA 3F2DA 2E2HH 1YI2A 1KAWA 1YZ6A 5JJKA 4EX5A 4IPGA 3E9HA 3GTJH 1VQMA 1XMQL 4APVA 2I5HA 5IP9G 1Y1WG 1QVGA 2NVXH 1HNXL 3RN2A 4FDBA 4DV5L 4YY3Q 4H02A 2JEBI 3AYHB 1FJGQ 2ZJQA 3UDFA 4A3EG 2A8VA 1PH9A 4BA1I 1LM0A 3OYYA 3OTOQ 1TWGH 1M1KC 4DV0L 3H0GH 2WFWA 4JI7Q 4DR4Q 4NXML 1S40A 2OTLA 4O0AA 5C0XG 2Z6KC 4GKJL 1W3SA 2E5LL 3LGJA 5FLMG 3U50C 1TXYA 1SE8A 4A3GG 3HOZG 2K75A 4GN3B 1NY4A 1SMXA 1X3GA 3S15H 5JJLA 2ZM6L 4JI2L 3B6YA 1OXVA 2OQ0A 3ERSX 3S1QH 2FXQA 3PV0A 3PCOB 5IYBG 1QVFA 1E22A 3S17H 4DR6L 2AWNA 5AJ3L 4LF4Q 1J6QA 1N33L 3PO2H 3K7UC 1WCMG 3W5OA 4DK3C 3CCRA 4LNQA 3H15A 3HOVG 2UXDL 4GN4B 3RNUA 2GVAA 2Q2IA 2YTVA 2YU9H 4IOAA 3CW2C 4A93H 1HH2P 1HZ9A 3NEMA 3GO5A 3W1BA 3KYHC 3PUVA 3K7AH 1YVCA 3L0OA 1BBWA 3MEFA 4HJAA 3T1HL 4JG2A 4DR7L 2VUMH 4UP9A 1GD7A 3CCSA 1KC8C 1K0RA 2BH8A 4YHHL 2HIVA 5JJIA 3CCUA 1I3QH 2ZTCA 5IY0A 3I4MH 1JJCB 4PG3A 3CMAA 4A3EH 1NMFA 2PI2E 3PF5A 3GTLH 3A5ZB 3AQQA 3PUWA 1PH1A 2IX1A 2I5LX 3S14H 2MQHA 2ALYB 1KXLA 4GS3A 4A4IA 1M90C 2MO0A 2UUAQ 5IYCG 3AFQA 3GTMH 3F2BA 1PH6A 4IPHA 3VDYA 1SLJA 1WFQA 3JAMc 3CPWA 1CKOA 3CC4A 1VQEA 2LXKA 4ALPA 4LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q46 A;  5ELN A;  4B3R Q;  4A3M H;  4A3B G;  4LUZ A;  3DLL A;  4HJ8 A;  2ID0 A;  1W2B A;  1A0I A;  1MKH A;  1SN8 A;  2PNH A;  4AQY Q;  4C3J H;  4A3F G;  1IYJ B;  4DR5 L;  3W1G A;  3RLF A;  1OXX K;  4LF9 Q;  5C4X G;  4RMF A;  4YCW A;  4TQU S;  4KHP L;  4JI3 L;  4JI6 L;  2UU9 L;  3NEN A;  4QGU A;  4NXN Q;  4JI1 Q;  4K0K Q;  1HZB A;  4C3I H;  4POG A;  2YV5 A;  3GTK H;  2DUD A;  1IBL Q;  1Z47 A;  4DUY L;  4HIK A;  1HNZ Q;  2R92 G;  4IFD I;  5K36 G;  3HOX H;  1CKN B;  3PIO A;  3CCJ A;  5LMN W;  3S1M H;  4LFB Q;  1TWC H;  3UDI A;  1QZG A;  4JI8 L;  3KF6 B;  4A3K G;  1P16 A;  3PSI A;  2NVQ H;  2B3G A;  4DV4 Q;  3S1R H;  5M3F H;  2I0Q A;  1X54 A;  2NN6 G;  2QGQ A;  3A0J A;  4NPS A;  4OWX B;  1IBM L;  4JYA Q;  4X6A H;  2IHF A;  1VQ7 A;  3F2C A;  1XMO L;  4UY8 C;  1Y1W H;  3JC6 6;  5LMN Q;  4A3F H;  4IFD G;  3GD7 A;  2JQO A;  3F1Z A;  2UUC Q;  4DV7 L;  4A3J G;  2GVB A;  1K73 C;  1L1O B;  3PUX A;  2JA6 G;  1H95 A;  1PFS A;  4X64 L;  4Y7N H;  2ZTE A;  4B3S Q;  4IJL A;  1TWF H;  4JI5 L;  1Q1E A;  1VQ5 A;  3U4V A;  3HOV H;  4LUO A;  3T1Y L;  2VS1 A;  4IFD J;  3EBE A;  1DGS A;  3HKZ E;  3KFU A;  4B3T Q;  2F4V L;  1E3P A;  2Y0S G;  3J81 c;  3J7Z C;  4PZ6 A;  3I4O A;  4A3I H;  4BXX H;  4DV1 Q;  3CCQ A;  1X56 A;  3PO3 G;  4QY7 A;  4ME3 A;  4JI4 L;  3Q8D A;  4JI0 L;  3L7Z C;  4IO9 A;  2AMC B;  3CCV A;  3TQY A;  2IHE A;  3ULP A;  1QUQ B;  1PV4 A;  1N36 L;  4BY1 G;  2AKW B;  4HIO A;  1N8R C;  3PF4 A;  3KDF A;  1IXR A;  5M5Y H;  5C44 G;  2DGY A;  2HIX A;  2NZO A;  4DV2 L;  4JV5 L;  1I5F A;  2HQL A;  3D31 A;  2CWP A;  3M4P A;  1JB7 A;  1T9H A;  4GOP A;  1EYG A;  3S24 A;  4R1J A;  2UXD Q;  1PYB A;  1I94 L;  5E7N A;  3A74 A;  3GDE A;  1SRU A;  1PVO A;  1KL9 A;  1OXT A;  1U0L A;  4IJH A;  1XNQ Q;  1E1T A;  2IT1 A;  2WB1 G;  5IYD G;  1VQ4 A;  2JA8 G;  3HOY G;  4DUZ L;  4DR2 L;  3RZD H;  5IE8 A;  3L2P A;  4LFC Q;  1YJ9 A;  1TWH H;  4JOI A;  1Y14 B;  5IYB H;  1N32 Q;  1XNR Q;  5IWA L;  3J81 i;  3FKI H;  4JOI C;  2VNU D;  4B3M L;  4LF8 L;  4LF6 L;  4DV0 Q;  1WOC A;  3U4Z A;  4UP8 A;  1PH2 A;  2JA5 G;  2CKZ B;  1YHQ A;  4JI7 L;  1K83 H;  4BBR H;  2QA4 A;  1K8A C;  1JMC A;  5IP7 H;  2KBN A;  1VQ8 A;  2Q2U A;  2WB1 E;  4AYB G;  4A3I G;  4JBK A;  4GKJ Q;  4X62 L;  3D0F A;  2IX0 A;  5BR8 Q;  1BVS A;  2VUM G;  4LW1 A;  1GO3 E;  1HR0 L;  1X9N A;  4A3C G;  2VQE L;  4JI2 Q;  1PHJ A;  5IYD H;  3RLO A;  1HJP A;  4X66 Q;  2UXB L;  3OW2 A;  5M5W H;  1NMG A;  1PH7 A;  2HHH L;  2JA7 G;  3S2D H;  1Q82 C;  5C4J H;  4DR1 Q;  2CCZ A;  1N34 L;  3AFP A;  2RF4 A;  3HOX G;  2B29 A;  4GNX C;  1N33 Q;  1OXU A;  1Q8K A;  4X65 Q;  3F8T A;  3CPF A;  1KIX A;  4NB3 A;  4LFA Q;  5GQO A;  1E24 A;  1K8G A;  4WJ4 A;  1JT8 A;  2PI2 A;  1VQ9 A;  5JEA J;  2VQF L;  4RG1 A;  3PUY A;  4K0K L;  1VQG A;  4J15 A;  4JCV E;  4YWK A;  3J7A 5;  3ULL A;  1FGU A;  1XPR A;  1NJI C;  3S1N H;  2R6G A;  3GTP H;  4A75 A;  3KJO A;  1V1Q A;  2OQK A;  1P8L A;  3UDG A;  4DR7 Q;  2ATW A;  4L5S A;  4A3B H;  4LFB L;  1IL2 A;  5HGQ A;  1IBK Q;  1VQA A;  2R93 G;  4DV3 L;  1VQB A;  1X55 A;  3BZK A;  2JA7 H;  4A3D H;  2XGT A;  1NE3 A;  3M9B A;  3E9I A;  3WWV A;  4GOP C;  4AYB E;  1V43 A;  2RHQ B;  2E5L Q;  3K8A A;  2UUB L;  5LMN L;  1WCM H;  3J80 i;  2LSS A;  1EQQ A;  3PGZ A;  4MTN A;  2BH2 A;  1L0W A;  1KRT A;  4OX9 L;  4LF5 L;  1X3F A;  1FVI A;  1KD1 C;  2RCN A;  4L5R C;  1VQI A;  2AWO A;  2EQS A;  4QJF A;  4R4T A;  4LF7 Q;  1FJG L;  2VY3 A;  1VQO A;  1I50 H;  1J5E L;  5LMU Q;  4QL5 A;  5C4X H;  1XPO A;  4C3H H;  4NXM Q;  4DAY B;  1VQD A;  5C3E G;  4HIM A;  2CWA A;  2IY5 B;  1E1O A;  1GM5 A;  2R93 H;  1JJG A;  5GAE C;  1HNW L;  4DV6 Q;  3CCE A;  4BA2 I;  2NVY H;  3I4N G;  5GAG C;  1FL0 A;  4NXN L;  4JI3 Q;  4KHZ A;  4JI6 Q;  1MJE A;  1WYD A;  5C44 H;  5GAH C;  3KF8 B;  4JI0 Q;  4HJ7 A;  1XMQ Q;  3AEV A;  1C7Y A;  1HNZ L;  4GKK Q;  1GKH A;  2XTI A;  3TEH B;  4DKA C;  1LYL A;  2RHS B;  4A3K H;  2R7Z G;  3GTQ H;  5EAY A;  4DR6 Q;  1X3E A;  1VQL A;  2PQA B;  4LF4 L;  3K80 C;  5GAD C;  1K9M C;  3OTO L;  4PZ7 A;  3KF6 A;  3ICE A;  1QVC A;  1A63 A;  4P75 A;  2E2I H;  3NBH B;  2K5H A;  4DV2 Q;  1WJJ A;  3PO3 H;  4L5T A;  1UE1 A;  4IPC A;  4L5Q A;  4BBS H;  3J80 c;  2JA6 H;  3ULJ A;  4PMW A;  1C0A A;  1EOV A;  4AH6 A;  5J3B A;  4OON A;  3CCL A;  2OTJ A;  1D8L A;  1EFW A;  4YWL A;  4UP7 A;  3J81 j;  1L1O A;  3BZC A;  4MNO A;  2K14 A;  2BA1 A;  4A76 A;  1G29 1;  4JC0 A;  3H3V H;  4BBR G;  1N9W A;  1L1O C;  4LFC L;  1QZH A;  1X6O A;  1UEB A;  1G6P A;  1YEZ A;  1A8V A;  1PYS B;  4A3G H;  3U58 A;  5JEA G;  2GN5 A;  4WJ3 M;  4DAM A;  2ZJP A;  3EIV A;  5C3E H;  1Y1V H;  2EXD A;  4GNX A;  2C35 B;  1LUZ A;  1VQN A;  1MIU A;  3CXC A;  4JI4 Q;  3RR5 A;  2YTY A;  2WAQ E;  1EWI A;  2NZH A;  1AE2 A;  1YHA A;  2LXJ A;  4GLX A;  1CUK A;  1A62 A;  1WI5 A;  2EIF A;  1IBL L;  4QIW E;  1YIJ A;  3T1H Q;  4BY1 H;  3S16 H;  4KLK A;  1UWV A;  3UE1 A;  3PO2 G;  1VQJ A;  2R92 H;  2UXC Q;  4P73 A;  2R7Z H;  2VQE Q;  1PH5 A;  3G71 A;  4LF9 L;  1UE6 A;  2E8G A;  2F3I A;  2JA5 H;  4JYA L;  2K50 A;  2VW9 A;  3EN2 A;  2KHI A;  3KJP A;  2A19 A;  1HR0 W;  2UUC L;  4GOP B;  2N8N A;  1IZ6 A;  4GN5 A;  1XJV A;  2Y0S E;  4DR3 Q;  4DV5 Q;  4YY3 L;  3M4O H;  3FHW A;  4JI8 Q;  2QEX A;  4B3S L;  3RZO H;  4A3D G;  1TWA H;  4JI5 Q;  4YHH Q;  4BY7 H;  2KEN A;  2Q2T A;  3GTG H;  1OXS C;  1L2F A;  3CD6 A;  1HZA A;  1XNR L;  4A3L H;  2BA0 A;  3CC7 A;  4DNI A;  4HJ5 A;  3RN5 A;  4OWW B;  1EQR A;  4BBS G;  3G4S A;  2N78 A;  4JBW A;  2OWO A;  4YCV A;  1Q7Y C;  4R4O A;  2OCE A;  3ER0 A;  2WP8 J;  4JI1 L;  3KOJ A;  1VQC A;  1EUJ A;  2F52 A;  4BXX G;  3CAM A;  2ZM6 Q;  3CP0 A;  3SGI A;  4YCU A;  4A3C H;  1BKB A;  1EIY B;  1VQK A;  2KCT A;  1UE7 A;  3ZJY C;  2V1C C;  4POF A;  2H5X A;  4DR5 Q;  2Z6K A;  2JA8 H;  3JAM i;  2YTX A;  5M3M G;  5LMU L;  3HOY H;  3FP9 A;  3HOW H;  3MXN B;  3DM3 A;  2UU9 Q;  2CQO A;  2K4K A;  4DR1 L;  4GLA C;  4GLV B;  4JBJ A;  4DV6 L;  4DUY Q;  1AE3 A;  4YWM A;  1MJC A;  2N3S A;  3IRB A;  2B63 H;  1I94 Q;  1HNX Q;  4C2M H;  4A3M G;  2A1A A;  4X64 Q;  1N36 Q;  5DLQ E;  2R7F A;  5FJ8 G;  5M3F G;  1SFO H;  2VZA A;  5M5X H;  3H3V I;  4R4Q A;  2E2J H;  1XTD A;  1R9T H;  3G48 A;  2NN6 I;  2KHJ A;  1EIF A;  4GKK L;  3PUZ A;  3CME A;  1VCI A;  4HJ9 A;  3T1Y Q;  3I56 A;  1PH8 A;  4DR4 L;  4IPD A;  1YIT A;  2D62 A;  2AHO B;  4A3J H;  4MZ9 A;  1VQF A;  4B3T L;  2F4V Q;  2K52 A;  1LTL A;  4XIG S;  1Q86 C;  3HKZ G;  4B3M Q;  3UDX A;  5FLX c;  1HZC A;  4LF8 Q;  4P71 A;  2UUA L;  3M3Y H;  3GTO H;  4A3L G;  1Z9F A;  1K3R A;  4R4C A;  3STB D;  5IYC H;  4X62 Q;  2UUB Q;  2JA9 A;  1YNX A;  1VQH A;  3A5U A;  4DUZ Q;  1B70 B;  1Q12 A;  1G51 A;  4DR2 Q;  2N49 A;  1Q81 C;  4OX9 Q;  4B3R L;  1XPU A;  2JEA I;  1E7Z A;  4TVA B;  5AJ3 Q;  2YYZ A;  3PIP A;  4HID A;  4AQY L;  3CC2 A;  3G6E A;  1YBY A;  1I6H H;  2MO1 A;  2CFM A;  3BJU A;  1V9P A;  2MNA A;  2UXB Q;  1JJ2 A;  1Q1B A;  4KHP Q;  3NEL A;  3RLN A;  2D0P A;  1VQ6 A;  5M3M H;  1ASZ A;  1HNW Q;  3CQZ H;  3E0E A;  1CKN A;  2ZJR A;  1CSQ A;  1B8A A;  3HFZ B;  4AIM A;  4JBM A;  1UE5 A;  1XNQ L;  1HR0 Q;  1X65 A;  2JJQ A;  1SRO A;  4OXP A;  1RL2 A;  3TRZ A;  3S2H H;  4X66 L;  5FJ8 H;  1ASY A;  3K0X A;  3HOU H;  2HHH Q;  1NBW A;  5GRO A;  1AH9 A;  3CF5 A;  1YJW A;  1N34 Q;  1CSP A;  2Z0S A;  4R4I A;  4DV3 Q;  2L15 A;  4O2D A;  2D0O A;  1O7I A;  4DV7 Q;  4LF6 Q;  4LFA L;  2PQA A;  2JK8 A;  3KLW A;  3HKS A;  1YJN A;  3I4M G;  4BY7 G;  1D7Q A;  1YHB A;  3STB C;  3I4N H;  5C0X J;  1GVP A;  5BR8 L;  3FKI G;  1N32 L;  2K5N A;  2I5M X;  3UE0 A;  5IWA Q;  4DR3 L;  1VQP A;  1KQS A;  1S72 A;  3H0G G;  3I55 A;  4DK6 C;  1J5E Q;  3I7F A;  4OO1 G;  2HT1 A;  4P74 A;  5IP7 G;  4OWT B;  3TS2 A;  2JE6 I;  4DV1 L;  4IOC A;  3TRE A;  2ASB A;  2Q2H A;  1SR3 A;  3HOZ H;  1Y1V G;  3M7N A;  1QUQ A;  2ZTD A;  1JE5 A;  2R7D A;  4EQ5 A;  1BBU A;  1KHI A;  1KRS A;  5IP9 H;  1S3O A;  2VQF Q;  4LF5 Q;  4LUV A;  3TS0 A;  2MFI A;  1VS0 A;  3KDF B;  2WAQ G;  1RIP A;  4XTC S;  4GNX B;  2ES2 A;  4P72 A;  2VL6 A;  4LF7 L;  3I2Z A;  3HOW G;  4OO1 I;  4DPG A;  1PH4 A;  1C9O A;  4KI0 A;  4DV4 L;  1PA6 A;  4QQB X;  1U5K A;  3BU2 A;  1PH3 A;  1IBM Q;  5C0X I;  4JV5 Q;  4PZ8 A;  5ELO A;  1XMO Q;  1OTC A;  1IBK L;  3M85 A;  2NVT H;  5HY6 A;  2B63 G;  2UXC L;  3HOU G;  5IT9 c;  5FLM H;  4X65 L;  3CCM A;  3K81 C;  2PMZ E;  4A93 G;  4Y52 H;  2KCM A;  3M4Q A;  1NTG A;  2K5V A;  1CKM A;  5H1S E;  1B7Y B;  4UPA A;  3F2D A;  2E2H H;  1YI2 A;  1KAW A;  1YZ6 A;  5JJK A;  4EX5 A;  4IPG A;  3E9H A;  3GTJ H;  1VQM A;  1XMQ L;  4APV A;  2I5H A;  5IP9 G;  1Y1W G;  1QVG A;  2NVX H;  1HNX L;  3RN2 A;  4FDB A;  4DV5 L;  4YY3 Q;  4H02 A;  2JEB I;  3AYH B;  1FJG Q;  2ZJQ A;  3UDF A;  4A3E G;  2A8V A;  1PH9 A;  4BA1 I;  1LM0 A;  3OYY A;  3OTO Q;  1TWG H;  1M1K C;  4DV0 L;  3H0G H;  2WFW A;  4JI7 Q;  4DR4 Q;  4NXM L;  1S40 A;  2OTL A;  4O0A A;  5C0X G;  2Z6K C;  4GKJ L;  1W3S A;  2E5L L;  3LGJ A;  5FLM G;  3U50 C;  1TXY A;  1SE8 A;  4A3G G;  3HOZ G;  2K75 A;  4GN3 B;  1NY4 A;  1SMX A;  1X3G A;  3S15 H;  5JJL A;  2ZM6 L;  4JI2 L;  3B6Y A;  1OXV A;  2OQ0 A;  3ERS X;  3S1Q H;  2FXQ A;  3PV0 A;  3PCO B;  5IYB G;  1QVF A;  1E22 A;  3S17 H;  4DR6 L;  2AWN A;  5AJ3 L;  4LF4 Q;  1J6Q A;  1N33 L;  3PO2 H;  3K7U C;  1WCM G;  3W5O A;  4DK3 C;  3CCR A;  4LNQ A;  3H15 A;  3HOV G;  2UXD L;  4GN4 B;  3RNU A;  2GVA A;  2Q2I A;  2YTV A;  2YU9 H;  4IOA A;  3CW2 C;  4A93 H;  1HH2 P;  1HZ9 A;  3NEM A;  3GO5 A;  3W1B A;  3KYH C;  3PUV A;  3K7A H;  1YVC A;  3L0O A;  1BBW A;  3MEF A;  4HJA A;  3T1H L;  4JG2 A;  4DR7 L;  2VUM H;  4UP9 A;  1GD7 A;  3CCS A;  1KC8 C;  1K0R A;  2BH8 A;  4YHH L;  2HIV A;  5JJI A;  3CCU A;  1I3Q H;  2ZTC A;  5IY0 A;  3I4M H;  1JJC B;  4PG3 A;  3CMA A;  4A3E H;  1NMF A;  2PI2 E;  3PF5 A;  3GTL H;  3A5Z B;  3AQQ A;  3PUW A;  1PH1 A;  2IX1 A;  2I5L X;  3S14 H;  2MQH A;  2ALY B;  1KXL A;  4GS3 A;  4A4I A;  1M90 C;  2MO0 A;  2UUA Q;  5IYC G;  3AFQ A;  3GTM H;  3F2B A;  1PH6 A;  4IPH A;  3VDY A;  1SLJ A;  1WFQ A;  3JAM c;  3CPW A;  1CKO A;  3CC4 A;  1VQE A;  2LXK A;  4ALP A;  4LWC A; 
#chains in the Genus database with same CATH topology
 3OIQ A;  4A3B G;  1BO0 A;  1JOR A;  1HFG A;  2HCC A;  2ID0 A;  1W2B A;  2PNH A;  1XPU A;  4LF9 Q;  4A3F G;  4IUU A;  4DR5 L;  3C3L A;  1OXX K;  4YCW A;  2UU9 L;  4QGU A;  5FLX E;  2KCC A;  4C3I H;  2YV5 A;  3GTK H;  1I4G A;  4HIK A;  1EYC A;  3HOV B;  5K36 G;  3HOX H;  1CKN B;  5C5L A;  4LFB Q;  4HTH A;  4JI8 L;  3ERQ A;  1HQR D;  3PSI A;  3S1R H;  1PLF A;  4L63 B;  4ME5 A;  5C4X B;  1IBM L;  4JYA Q;  2L55 A;  3F2C A;  4IUV A;  1Y8N B;  2BE5 C;  2F0N A;  3JC6 6;  4EQO A;  4C3J G;  2J0T D;  4DV7 L;  2GVB A;  3PUX A;  4DNT B;  1PFS A;  1TWC B;  4ZAI A;  2ZTE A;  2E75 C;  4KJO A;  4LUO A;  2X6G A;  2XRS D;  3T1Y L;  2VS1 A;  3HOX B;  1W6K A;  3L3O C;  2F4V L;  3J7Z C;  1S5B D;  3I90 A;  2E2I B;  4A3I H;  4DV1 Q;  3CCQ A;  2F0W A;  3MFY A;  1ESF A;  3ZYY X;  2A74 C;  4RAU C;  4UAI A;  3C1F A;  2IHE A;  2RDG A;  3ULP A;  1MI2 A;  2DY7 A;  4OEL B;  4HSP A;  1T5X D;  5F2D A;  1I4P A;  4HIO A;  2HUG A;  1EZ8 A;  4O42 A;  1IXR A;  4XT1 B;  4ZLT F;  5M5Y H;  1TWG B;  5C44 G;  2NZO A;  4DV2 L;  4M8A A;  4IAL A;  2CWP A;  3Q22 A;  2NVY B;  4OHJ A;  1EYG A;  2LY7 A;  3N6R A;  4R1J A;  2AUJ D;  1K3B C;  1OXT A;  4IJH A;  1E1T A;  3KBX A;  5IYD G;  2JA8 G;  3HOY G;  3L2P A;  1YJ9 A;  1TWH H;  1Y14 B;  2L1B A;  2K33 A;  1N32 Q;  5IWA L;  3OPO A;  2EY1 A;  4DU9 A;  2ICI A;  4JOI C;  1LTS D;  3SK4 A;  2VNU D;  4QIW B;  4DV0 Q;  1PH2 A;  2JA5 G;  5FO9 B;  2QF7 A;  3K6O A;  1AZQ A;  2I46 A;  2DNC A;  2OT2 A;  5AFW A;  2A5H A;  2K5D A;  1PHJ A;  3S9W A;  2F0I A;  4FNF A;  1NMG A;  1PH7 A;  2HHH L;  4FF1 A;  1Q82 C;  3NQI A;  1LAC A;  2RF4 A;  1JR0 D;  2B29 A;  4HCE A;  2Z9H A;  2NWG A;  3J80 L;  4GNX C;  4A3F B;  2B2U A;  1JT8 A;  4WJ4 A;  1K8G A;  3FPU B;  2FMC A;  5T1G A;  3J7A 5;  1CTM A;  4Y7N B;  3GTP H;  5KRU A;  3UDG A;  1C8C A;  2L11 A;  4A3B H;  1IL2 A;  4G57 A;  1IBK Q;  4H13 C;  5I6W A;  2Z1C A;  3GV6 A;  2F0S A;  3M9B A;  4GOP C;  5M5W B;  4AYB E;  5C4Z A;  3E0J A;  5LMN L;  1WCM H;  1SNP A;  2LSS A;  1SSO A;  1DD2 A;  4KD4 A;  1L0W A;  1KRT A;  1FVI A;  1KD1 C;  2WIN B;  1VQI A;  2QDB A;  2VY3 A;  5JPN C;  3Q0A A;  3TME A;  5LMU Q;  1GUW A;  5JAV A;  1V8Q A;  1KTK A;  1VQD A;  5C3E G;  4HIM A;  4XYO A;  2KOL A;  5CBE E;  3CCE A;  4BA2 I;  3C46 A;  1FL0 A;  1WYD A;  5CV8 A;  4HJ7 A;  1XMQ Q;  4EVO A;  1HNZ L;  4GKK Q;  2R7Z G;  2RHS B;  3BDL A;  4IUT A;  2PZW A;  2VXW A;  3GTQ H;  1VF5 C;  4DR6 Q;  3PMF A;  2BE5 D;  2PQA B;  2JA8 B;  3K80 C;  3HOY B;  5GAD C;  3OTO L;  3KF6 A;  3MWY W;  4P75 A;  2E2I H;  2Y0S B;  4IPC A;  3J80 c;  2PPB C;  3ULJ A;  3TP5 A;  3MXG A;  1SNQ A;  4C2M B;  1I6V C;  2OTJ A;  1EFW A;  3I91 A;  4XYQ A;  3J81 j;  1L1O A;  3D6W A;  4FF2 A;  3QWN A;  2BA1 A;  1G29 1;  5EBD A;  1L1O C;  4IQZ A;  4LFC L;  1G6P A;  1X6O A;  1SNM A;  4UDU C;  5JVG 3;  1PYS B;  1LTT D;  3U58 A;  4WJ3 M;  5G3L F;  1I4X A;  2EXD A;  1LUZ A;  5E1F A;  4QB4 A;  1EWI A;  1WI5 A;  4QIW E;  1YIJ A;  1RHP A;  1JCK B;  2KEC A;  4NMZ A;  1VMC A;  2R92 H;  4P73 A;  2VQE Q;  1PH5 A;  3G71 A;  4LF9 L;  3CU7 A;  1Y1V B;  2JA5 H;  4RFB A;  4GOP B;  2LFN A;  1IZ6 A;  2Y0S E;  3O13 A;  4B3S L;  4A3D G;  4Q0F A;  1GUN A;  3EFX D;  2D9U A;  4KN4 C;  3MXU A;  1LAB A;  2BA0 A;  4HJ5 A;  4OWW B;  1SE3 A;  2WB1 B;  5COR A;  4OGQ C;  4JBW A;  3ND9 A;  3SGI A;  3S1N B;  3HGB A;  1BKB A;  1T5E A;  3LWU A;  3NTI A;  1UE7 A;  1S5D D;  4KY7 A;  1HUM A;  3OIP A;  3VR2 A;  4CBV A;  2WII B;  3JAM i;  5LMU L;  3P20 A;  3E5S A;  1F2L A;  5D14 A;  5E4W C;  2JA7 B;  1CM9 A;  4OIK A;  4FF3 A;  2N3S A;  3VYT A;  4C2M H;  2A1A A;  3NWT A;  5FKA C;  1EIF A;  3Q6S A;  5EQ0 A;  3PUZ A;  3A8J E;  2AHO B;  4A3J H;  4MZ9 A;  4B3T L;  5EPK A;  5NUC A;  4A3L G;  2QKI C;  4P71 A;  1IL8 A;  2UUA L;  2L0C A;  2F0G A;  4OL7 A;  4X62 Q;  5HUR A;  2MJ8 A;  2A73 B;  5IOC A;  4F7X A;  3P75 A;  1TR5 A;  4HID A;  3KLS A;  3G6E A;  1YBY A;  5CV9 A;  2QCP X;  2MNA A;  1EWH A;  1JJ2 A;  1Q1B A;  4KHP Q;  2D0P A;  4NDX A;  5M3M H;  2EYH A;  1ZYR C;  2A6E D;  3DEO A;  2FJ2 A;  3S15 B;  1ML0 D;  1XNQ L;  2JJQ A;  4X66 L;  1TY2 A;  4DA2 A;  1AH9 A;  4O1N A;  2PZU A;  4O2D A;  1O7I A;  2ZT9 C;  4LF6 Q;  1RKN A;  5D65 A;  3I4M G;  3CKI B;  4CJ2 C;  4M1U B;  4G7H C;  1GVP A;  3FKI G;  3I4L A;  1S72 A;  3H0G G;  2K04 A;  3I55 A;  1ILQ A;  4OO1 G;  3I7F A;  3S2H B;  4K5X A;  5IP7 G;  4DV1 L;  4IOC A;  2F0H A;  3HOZ H;  3M7N A;  1JE5 A;  1KHI A;  1H9R A;  1KRS A;  2VB3 X;  4LF5 Q;  3SXH A;  4LUV A;  3W3A A;  2ES2 A;  4BY7 H;  1RIP A;  4XTC S;  1JOK A;  4LF7 L;  4OO1 I;  3I2Z A;  1C9O A;  2M00 A;  5T1I A;  4QQB X;  4ABN A;  5C0X I;  1XMO Q;  2UXC L;  2O5J C;  1HTP A;  5IT9 c;  5FLM H;  3CCM A;  5EJW A;  4A93 G;  3R2I A;  2N88 A;  4Y52 H;  1EY9 A;  4KKU A;  2KCM A;  3M4Q A;  4BY7 B;  1NTG A;  1U9R A;  2E2H H;  1KAA A;  4EX5 A;  3I3C A;  3IFT A;  1VQM A;  1XMQ L;  3S1Q B;  4APV A;  2I5H A;  1Y1W G;  5IGB A;  4DV5 L;  4YY3 Q;  3R93 A;  5J22 A;  1OO9 B;  1LM0 A;  3N52 A;  1A3U A;  2WFW A;  4NXM L;  2JYO A;  2XN9 C;  4HAE A;  4F8M A;  5M3M B;  5KGU A;  2KVM A;  4A3G G;  1EWC A;  4GN3 B;  1IKL A;  1X3G A;  2WAQ B;  2KCN A;  1MGS A;  3MA2 B;  1BNZ A;  3ERS X;  4A3E B;  3PV0 A;  2F0K A;  4EQP A;  4A3J B;  3K7U C;  1WCM G;  3VR4 A;  4DK3 C;  3CCR A;  4LNQ A;  2BCO A;  4N8X 1;  3RNU A;  4C3I G;  3BS1 A;  2B8G A;  3AMU A;  1EZ6 A;  1HH2 P;  1HZ9 A;  3NEM A;  3PUV A;  2XWJ B;  3MEF A;  1XYI A;  2VUM H;  5IGE A;  3D4R A;  1KDA A;  3CCU A;  2F3V A;  1YNN C;  3FRP B;  2MHV A;  1S5C D;  1S5F D;  3AQQ A;  3PUW A;  1PH1 A;  2CQA A;  2I5L X;  1EIG A;  5M9O A;  3S14 H;  2ALY B;  2MO0 A;  2UUA Q;  3KLS X;  3AFQ A;  5ISR A;  3GTM H;  4IPH A;  1W6J A;  1WFQ A;  3JAM c;  3CPW A;  3CC4 A;  5DM7 3;  3DM1 A;  4LWC A;  4A3M H;  2K03 A;  1EQQ A;  4AQY Q;  1SN8 A;  2NVT B;  5C4X G;  4C3J H;  3RLF A;  4RMF A;  1KNE A;  4YIJ A;  1WTR A;  4JI3 L;  1FD7 D;  1JWS D;  4POG A;  3IAY A;  2E74 C;  1WD1 A;  1HNZ Q;  5FLX L;  3PIO A;  3CCJ A;  1TWC H;  3KF6 B;  2NB0 A;  1SYE A;  2NVQ H;  2B3G A;  2RBM A;  4OO1 H;  5M3F H;  4FXG C;  1SE4 A;  3A0J A;  2QGQ A;  4C3H B;  5C4J B;  2LMC B;  3TZU A;  1V1P A;  4UY8 C;  3TP6 A;  4QMG A;  3GD7 A;  3K58 A;  2JA6 G;  4J1M A;  2HQE A;  4B3S Q;  3VR5 A;  1TWF H;  3GTP B;  1Q1E A;  3HOV H;  5JJZ A;  1DGS A;  5C4H A;  1BUV T;  3T53 B;  1H9J A;  1QB5 D;  4BXX H;  3SK6 A;  2AUK A;  1QIL A;  4ZYS A;  4X3K A;  4JI0 L;  3L7Z C;  4IO9 A;  1H9M A;  1HA5 A;  4MHE A;  1PV4 A;  4QCL A;  1N36 L;  4K8I A;  5J39 A;  1E2V A;  4IUN A;  3KDF A;  2JSO A;  3EJI A;  2DGY A;  1JOO A;  2DY8 A;  5IGG A;  3H0G B;  1HRJ A;  1I5F A;  3URY A;  2UXD Q;  2IJ0 A;  1I94 L;  5E7N A;  3A74 A;  1G2T A;  3GDE A;  1KL9 A;  1XXG A;  2PMZ B;  2WB1 G;  2FMM A;  1EQV A;  1B4O A;  4LFC Q;  4JOI A;  1XNR Q;  1F9Q A;  1DYQ A;  3OOC A;  1WOC A;  5DNF A;  3U4Z A;  5EPJ A;  1K83 H;  2QA4 A;  3QOL A;  1JMC A;  1VQ8 A;  4GKJ Q;  2EDG A;  2WB1 E;  5ELE A;  3FMC A;  3GTK B;  4OIJ A;  4I65 A;  2IX0 A;  2VUM G;  2VUM B;  1HR0 L;  2EXZ A;  5LHY 1;  2LS0 1;  4JI2 Q;  1HJP A;  2MGS A;  1EY6 A;  3OW2 A;  2UXB L;  2F0M A;  1DOL A;  2QDL A;  3D4D A;  4C56 C;  2Z6B A;  1BDO A;  3HOX G;  4ZKB B;  3BVZ A;  3F8T A;  4LFA Q;  1LLR D;  4S3S A;  1NCV A;  4K6L A;  1UAP A;  3J80 E;  1VQG A;  2R3Z A;  4YWK A;  1BCP C;  3ULL A;  1STB A;  3KJO A;  1V1Q A;  1P8L A;  4DR7 Q;  3A8K E;  2L12 A;  4P2C B;  3BZK A;  2JA7 H;  2B2W C;  5TSS A;  1L0X B;  2RHQ B;  2QW7 A;  3K8A A;  1SE2 A;  4ULL A;  3BYY B;  2BH2 A;  3T16 A;  4OX9 L;  1X3F A;  4QJF A;  2EQS A;  4R4T A;  1KAB A;  1I50 H;  1J5E L;  4QL5 A;  1QE6 A;  5C4X H;  1HFN A;  4C3H H;  4NXM Q;  4DAY B;  2K5Q A;  2CWA A;  4A3B B;  5LL6 X;  2IY5 B;  1E1O A;  2NVY H;  4AYB B;  1ROD A;  4JI3 Q;  4KHZ A;  1MJE A;  5BN3 A;  1X3Q A;  3L9A X;  2IX3 A;  5C44 H;  5GAH C;  3AEV A;  1IYV A;  1CT1 D;  2XTI A;  1IKM A;  3J7A F;  4K6D A;  4DF7 A;  1VQL A;  4LF4 L;  3QR8 A;  1C48 A;  4PZ7 A;  1MSG A;  1DXM A;  1WJJ A;  3K59 A;  4L5T A;  2JA6 H;  4DAV A;  1Q8I A;  1EOV A;  4LAA A;  2B63 B;  1VF7 A;  4OON A;  1IYU A;  1D8L A;  3QOJ A;  3AB9 A;  2R7Z B;  2K14 A;  4JC0 A;  1N9W A;  1LT4 D;  1DM0 B;  4BY1 B;  1QZH A;  1E0B A;  3D8G A;  3M3Y B;  1JC7 A;  4GNX A;  1VQN A;  3CXC A;  1D2B A;  1YHQ A;  2YTY A;  4GLX A;  1A15 A;  1CUK A;  1Z6H A;  2PYK A;  1IBL L;  3S16 H;  4NKL A;  4KLK A;  1UWV A;  3PO2 G;  1TT2 A;  2NTT A;  5I9O A;  4RKL A;  3VYS A;  2O4X A;  2K50 A;  1K28 A;  3VYU A;  2VW9 A;  3OHX C;  5IGD A;  2KHI A;  3KJP A;  2A19 A;  3SK5 A;  3H3V C;  2N8N A;  1R4Q B;  4YY3 L;  3M4O H;  4G7Z C;  3V05 A;  1TWA H;  4YHH Q;  2KEN A;  2Q2T A;  1K8O A;  1GUT A;  4WJW A;  1XNR L;  4A3L H;  1EY7 A;  3CC7 A;  2ZXO A;  3HS0 C;  2EOT A;  3KK7 A;  3EVQ A;  4YCV A;  2OCE A;  3M4Y A;  3NTH A;  3OMG A;  2KQ3 A;  5M5X B;  2RA4 A;  2KJX A;  3CAM A;  3CP0 A;  3I4N B;  2EE1 A;  1LTR D;  2KCT A;  2EYL A;  3M4O B;  4POF A;  4CDF C;  1WTQ A;  4Z9C B;  5M3M G;  3FP9 A;  3R3O A;  3MXN B;  3HOW H;  3DM3 A;  2K4K A;  4GLV B;  1EYD A;  1HXY D;  3VYR A;  2HD3 A;  5EGT A;  1EOT A;  4YWM A;  1DCZ A;  1L0Y B;  5CYU A;  5D3I B;  1I94 Q;  1HNX Q;  4A3M G;  2F0E A;  3GTO B;  5CMD A;  1A3T A;  4QF4 A;  3H3V I;  1EY0 A;  3G48 A;  2KHJ A;  1LTI D;  4GKK L;  3CME A;  1NR2 A;  4DR4 L;  1YIT A;  2B2V A;  1VQF A;  1LTL A;  4IZ8 A;  4XIG S;  3K5O A;  1Z9F A;  2B39 A;  4R4C A;  4CDE C;  1I4R A;  1VQH A;  4DUZ Q;  3Q23 A;  1G51 A;  4OX9 Q;  2JEA I;  1N32 L;  4TVA B;  2YYZ A;  5CR3 A;  2CFM A;  2XIW A;  3K57 A;  2UXB Q;  3NEL A;  2NUC A;  1STG A;  4TRD A;  4KKT A;  1CZW A;  2H1E A;  2F03 A;  4XXE A;  1GXD C;  4PV1 C;  1HR0 Q;  1ASY A;  3HZX A;  1CA5 A;  2NBF A;  3CF5 A;  1YJW A;  2Z0S A;  3ONA B;  4DV3 Q;  2L15 A;  4DV7 Q;  4LFA L;  4B9X A;  1B50 A;  2JK8 A;  5JPM C;  1D7Q A;  4BY7 G;  4ZKC B;  3BDC A;  3NBH A;  3I4N H;  5C0X J;  4RHR A;  4I7Z C;  2K5N A;  4DR3 L;  2Q8I B;  4DK6 C;  1J5E Q;  2KEE A;  3TS2 A;  4P74 A;  2IW3 A;  1I4H A;  4JVZ A;  1QUQ A;  2R7D A;  1FYC A;  1HTL D;  1S3O A;  2VQF Q;  3PQI A;  3TS0 A;  4BBS G;  2XRQ D;  2KUM A;  4P72 A;  4EQN A;  3MFG A;  1PH4 A;  1PA6 A;  2EYJ A;  5IGC A;  1U5K A;  3K5L A;  1PH3 A;  4TSS A;  4A3M B;  4PZ8 A;  4QUC A;  1TII D;  1SYB A;  5C3W A;  5FO8 B;  3MXP A;  1HHV A;  3K81 C;  4DK0 A;  4K2K A;  2PMZ E;  1PFN A;  5I9P A;  2NYZ D;  5I4D A;  2K5V A;  1CKM A;  5H1S E;  4WFN 3;  4ZQ3 A;  1KAW A;  3HOZ B;  4IPG A;  2B2T C;  2SNS A;  2NVX H;  5IP9 G;  4FDB A;  1SYD A;  2JEB I;  3GV3 A;  2A8V A;  2PZT A;  4BA1 I;  3LNN A;  3OYY A;  1M1K C;  4JI7 Q;  4DR4 Q;  4K14 A;  1S40 A;  1PZK D;  5C0X G;  2Z6K C;  2B8F A;  1F2M A;  3U50 C;  1SE8 A;  2K75 A;  1FNV A;  1EFI D;  2TMP A;  2ZM6 L;  3RZD B;  2CH4 A;  4WRD A;  2D2C C;  1ESR A;  2PW5 A;  1DJR D;  1E22 A;  3S17 H;  1LT3 D;  1O7L A;  1J6Q A;  3W5O A;  2YU9 H;  4QUF A;  3CW2 C;  3TN2 A;  1JOQ A;  3W1B A;  4N9T A;  1YVC A;  1MBY A;  1BBW A;  3L0O A;  3T1H L;  4UP9 A;  3DEP A;  2FIN B;  1GD7 A;  1XTC D;  1KC8 C;  1KDB A;  2BH8 A;  1O80 A;  4YHH L;  1D5X C;  5KNB A;  1GUG A;  2E76 C;  5JJI A;  2ZTC A;  5IY0 A;  2EY2 A;  3I4M H;  4PG3 A;  3FPP A;  2PI2 E;  1O7Y A;  3GTL H;  2IX1 A;  2PW7 A;  1KXL A;  1M90 C;  5IIF A;  1NNX A;  3JAM E;  3VDY A;  2K1B A;  4ALP A;  2GA4 B;  1Q46 A;  3I70 A;  3PIO 3;  4B3R Q;  3FKI B;  3DLL A;  4HJ8 A;  3S14 B;  1QJO A;  1MKH A;  1IYJ B;  1X32 A;  5BN5 A;  2AQ3 B;  4TQU S;  4KKS A;  4JI1 Q;  1HZB A;  1RTO A;  4RGO S;  1U4L A;  1V1O A;  1Z47 A;  4DUY L;  1IBL Q;  1O78 A;  2L9H A;  4OEM B;  2PQE A;  2R92 G;  5J1Z A;  1F9P A;  4JPB W;  1QZG A;  1P16 A;  4DV4 Q;  1MHW C;  2RKS A;  1X54 A;  4K8J A;  4OWX B;  4XT3 B;  2EYF A;  4X6A H;  3LX0 A;  1VQ7 A;  1PFM A;  1Y1W H;  3NPP A;  5LMN Q;  4IFD G;  3F1Z A;  3BG3 A;  5A2Q E;  1H95 A;  1GUS A;  2RVL A;  4X64 L;  2K05 A;  3NTK A;  4IJL A;  2WAC A;  4LK1 C;  3DHQ A;  2C9O A;  3R2T A;  4CKE A;  4EGV A;  1BCP F;  4KHV A;  1A6X A;  1EIH A;  3RMH A;  4IFD J;  5JOB A;  3KFU A;  3S17 B;  1E3P A;  2Y0S G;  1X56 A;  2NN6 H;  3PO3 B;  5I2Y A;  4ME3 A;  4JI4 L;  2F1M A;  1TWF B;  1Y8O B;  4A93 B;  1CA6 A;  4RGN A;  3GTJ B;  1QUQ B;  2F0Q A;  5C5M A;  4U67 3;  1F9R A;  2HIX A;  1KDC A;  3M4P A;  3D31 A;  4JW0 A;  1JB7 A;  1T9H A;  1CI3 M;  3CRK C;  2A69 D;  2WKC A;  2F0D A;  3OWF A;  1STY A;  1PFB A;  4BBR B;  5DM6 3;  5FOB B;  1A2U A;  4DR2 L;  4A3K B;  3RZD H;  3S2D B;  4IUQ A;  3GP7 A;  1A3V A;  1TS3 A;  3J81 L;  4B3M L;  4LF8 L;  2WV6 D;  4LF6 L;  4BBR H;  1K8A C;  2JP1 A;  2Q2U A;  1DON A;  3D0F A;  3T13 A;  1EYA A;  1BVS A;  1GJX A;  3NBI A;  4K5W A;  5COY A;  1RF2 D;  1BCP D;  2VQE L;  1FNU A;  3RLO A;  3NSW A;  4X66 Q;  4B9W A;  4LMQ D;  5M5W H;  2JA7 G;  3S2D H;  5C4J H;  4DR1 Q;  1N34 L;  3C1E A;  2EYO A;  4XDX A;  3U9S A;  4CJ1 B;  1N33 Q;  1EEF D;  4X65 Q;  2SNM A;  1D6E C;  1KIX A;  4NB3 A;  5GQO A;  1E24 A;  1TU2 B;  1VQ9 A;  5E4X A;  3PUY A;  4K0K L;  2AQ1 B;  1JWM D;  4TKO B;  1J8I A;  3S1N H;  4A75 A;  3ERO A;  5KIX A;  1VMP A;  4L5S A;  2WKD A;  1B3Q A;  3A54 A;  5HGQ A;  1VQA A;  1BOS A;  1PMR A;  1SBB B;  4PMC A;  5C6A A;  1NE3 A;  3E9I A;  3IKJ A;  3TZD A;  5C44 B;  2QIL A;  3BVM A;  4K5V A;  4MTN A;  2RQX A;  5EKK A;  1Y8P B;  2RCN A;  1SFO B;  3S1M B;  1TWA B;  3AU7 A;  4LF7 Q;  1WTX A;  1R9T B;  1FJG L;  1VQO A;  1SYG A;  1RD9 D;  1GM5 A;  2R93 H;  1QG7 A;  1JJG A;  5GAE C;  1HNW L;  4DV6 Q;  1DOM A;  3I4N G;  2J7Z A;  5GAG C;  4FF4 A;  1B3A A;  1E2Z A;  2MUY A;  1U4R A;  4XQN A;  4JK1 C;  1I50 B;  1LTG D;  3KF8 B;  1EU4 A;  1LYL A;  5EAY A;  1I6H B;  1NSN S;  4F88 A;  4CKB A;  1QCB D;  1K9M C;  3ICE A;  2SEB D;  3WDN A;  4BBS H;  2A6H D;  4L5Q A;  2PNR C;  1TS2 A;  4PMW A;  1C0A A;  3X3M A;  4AH6 A;  5J3B A;  1PTO H;  3CCL A;  1HUN A;  1ET6 A;  4YWL A;  1J9O A;  4A76 A;  3Q24 A;  1KNA A;  3H3V H;  4DNR B;  1UEB A;  3VR3 A;  1YEZ A;  3V96 A;  4A3G H;  2EY6 A;  5JEA G;  1O7Z A;  4DAM A;  2ZJP A;  2SOB A;  5ELC A;  2HDM A;  4H7B A;  2C35 B;  3EA6 A;  3NXW A;  3RR5 A;  1AEX A;  2LXJ A;  2NZH A;  2F0O A;  2JA6 B;  2EIF A;  4XQJ A;  5JVH 3;  1IW7 D;  3QB3 A;  2RSN A;  3UE1 A;  4BWG B;  2IWH A;  2BOS A;  5IOD A;  3SVM A;  4IN3 A;  5C0X H;  2UXC Q;  3K5N A;  1EY4 A;  1ONL A;  2K32 A;  4DGZ A;  2F3I A;  2RSO A;  3EN2 A;  4FP5 D;  2UUC L;  4ZRZ A;  2N55 A;  1TS5 A;  4C1N I;  4DV5 Q;  4X3T A;  4DR3 Q;  4X3S A;  4JI8 Q;  2QEX A;  3RZO H;  3RUZ A;  3DXJ C;  2TSS A;  1OXS C;  1E2W A;  1ZKO A;  2Q8R E;  4DAP A;  1HZA A;  1VDZ A;  1SMY D;  1QOH A;  2R92 B;  3RN5 A;  4HMJ A;  1EQR A;  1PRT D;  2OWO A;  3GQB A;  2H4O A;  3HOW B;  4L6T B;  4KV6 A;  2JA5 B;  2F0U A;  1EUJ A;  1EL0 A;  2V1C C;  1WVL A;  2H5X A;  4DR5 Q;  2Z6K A;  1CHP D;  2YTX A;  1HQM C;  2UU9 Q;  1YNJ C;  4JBJ A;  1B1Z A;  1IW7 C;  4DUY Q;  1AE3 A;  5KND A;  1HA6 A;  3IRB A;  2B63 H;  3VA7 A;  3NHH A;  5DAU A;  4PQX A;  4X64 Q;  1N36 Q;  2G5D A;  2R7F A;  5M3F G;  4R4Q A;  2E2J H;  1XTD A;  1R9T H;  3QJY A;  2ENB A;  4HJ9 A;  4U68 A;  5HGT A;  4IUR A;  3I56 A;  1PH8 A;  2K01 A;  2C5C A;  3FEW X;  1FGB D;  1NUC A;  3HKZ G;  4B3M Q;  3UDX A;  2B2T A;  1HZC A;  4LF8 Q;  3M3Y H;  1IHZ A;  1K3R A;  1K8M A;  5IYC H;  1B44 D;  2JA9 A;  3A5U A;  4DR2 Q;  1B70 B;  1Q81 C;  2G9H D;  2CVR A;  1E7Z A;  1SMY C;  4DFA A;  2E2J B;  3BJU A;  3DWQ A;  1ICW A;  1DOK A;  2E2D C;  1PRT F;  2Z8L A;  1ASZ A;  1SEB D;  2Z4H A;  1ET9 A;  1D1I A;  1UNS A;  4ZCK A;  4DAY A;  1RCV D;  5CV7 A;  5EKI A;  1NR4 A;  2ZJR A;  1HPC A;  1B8A A;  3HFZ B;  3V2T A;  4JBM A;  1RTN A;  2I07 B;  1RL2 A;  4OXP A;  1STN A;  5FJ8 H;  1SNO A;  3K0X A;  4NP5 A;  2HHH Q;  5GRO A;  1YNJ D;  3PO2 B;  4LJZ C;  4RGT A;  4A3G B;  5JEA H;  2D0O A;  2PQA A;  3DWP A;  5E3F A;  3SE0 A;  3KLW A;  2JXM B;  3HKS A;  1YJN A;  3MC0 B;  2RDF A;  3STB C;  3BVG A;  5FO7 B;  1GUO A;  5BR8 L;  5ELF A;  1PRT B;  4J8Q A;  3UE0 A;  5IWA Q;  1VQP A;  1KQS A;  3MHB A;  3TDQ A;  2HT1 A;  2JE6 I;  3E6Z X;  3TRE A;  2Q2H A;  2F0P A;  4KMU C;  2Q8T A;  3J7A V;  3CRL C;  3GTM B;  5IP9 H;  3W2D A;  2KHS A;  2MFI A;  3KDF B;  3HOW G;  1TQO A;  2EZV A;  3BU2 A;  3IFD A;  3K5M A;  3A8I E;  3MEH A;  3M85 A;  5K36 H;  3HOU G;  1LTB D;  4X65 L;  4RHS A;  3HRZ C;  2F0F A;  3I72 A;  1LT5 D;  5K5P A;  3DMU A;  1B7Y B;  4UPA A;  1YZ6 A;  3GTJ H;  4ODG A;  1H9K A;  1B2T A;  4G4K A;  5EPL A;  3UDF A;  4F87 A;  4KY6 A;  4DXG A;  1DZ1 A;  1TWG H;  1CK1 A;  4MTK A;  2ZXP A;  4NW2 A;  2OTL A;  3HG9 A;  2OEO A;  4GKJ L;  1W3S A;  2E5L L;  1ICF B;  4BS9 A;  1TXY A;  1BF4 A;  3A7A B;  2ZXR A;  1NY4 A;  1SMX A;  2B2Y A;  2CHB D;  4JI2 L;  5CBA E;  3B6Y A;  2FHT A;  3S1Q H;  5IYB G;  1QVF A;  4KD3 A;  4DR6 L;  5AJ3 L;  2DJG C;  4LF4 Q;  1N33 L;  2EJF C;  3HOV G;  3H15 A;  2UXD L;  4GN4 B;  5ELD A;  2Q2I A;  2YTV A;  1CQF A;  1GOZ A;  1H9S A;  1S5E D;  1M4V A;  3KYH C;  1PTO D;  2AQ2 B;  1NAP A;  1ZEQ X;  4JG2 A;  3CCS A;  1K0R A;  2HIV A;  3D6C A;  1I3Q H;  4A3E H;  1WTV A;  1NMF A;  2L5T A;  2EJG C;  3A5Z B;  1JWU D;  4C3J B;  1JE4 A;  3CQZ B;  4A4I A;  3C2P A;  5IYC G;  3F2B A;  1PH6 A;  1GHK A;  5A2Q L;  1SJE D;  4MIU A;  1KLU D;  1SLJ A;  2XNA C;  3KUP A;  3MTS A;  2LXK A;  3F2U A;  3K7A B;  1FNW A;  5ELN A;  5IGF A;  2F0T A;  4LUZ A;  1TS4 A;  2EPB A;  1A0I A;  4IFD H;  2NZ1 D;  1ZYR D;  3W1G A;  3T4A C;  1AN8 A;  1XWE A;  4A3D B;  4KHP L;  4JI6 L;  4NXN Q;  3WOF A;  3NEN A;  3KF8 A;  4K0K Q;  2DUD A;  1SDF A;  1U4M A;  4IFD I;  2RCF A;  3S1M H;  5LMN W;  3UDI A;  3EQL C;  4FO2 A;  4A3K G;  1WTH A;  2F0V A;  2EYP A;  3OW7 A;  2I0Q A;  2NN6 G;  4NPS A;  1ZXT A;  4RWS C;  2IHF A;  4C3I B;  1XMO L;  4N8F A;  5EKL A;  3FDT A;  4A3F H;  2JQO A;  2UUC Q;  1STA A;  4A3J G;  1K73 C;  1L1O B;  2XWB B;  1BQQ T;  4Y7N H;  3PIP 3;  5LL6 S;  3BZD B;  1D1K A;  4JI5 L;  1VQ5 A;  3H94 A;  3U4V A;  2R61 A;  3EBE A;  3HKZ E;  4B3T Q;  3J81 c;  4FXK C;  4PZ6 A;  3I4O A;  3G6J B;  4HSV A;  1G6Z A;  5M3F B;  3PO3 G;  4QY7 A;  1EY8 A;  3Q8D A;  1Q90 A;  2AMC B;  3CCV A;  3TQY A;  1SJH D;  1QNU A;  4CKC A;  3MZ5 A;  5D3D A;  4BY1 G;  2HCI A;  2AKW B;  1N8R C;  3PF4 A;  4C1N K;  1SND A;  1EEI D;  1SNC A;  3NWS A;  4JV5 L;  2HQL A;  3D3R A;  5FK9 C;  1F77 A;  3I8Z A;  1KLG D;  4GOP A;  1TKW B;  3S24 A;  2X69 A;  1WTW A;  1PYB A;  4PNY A;  1PVO A;  1SRU A;  1ENF A;  4RCN A;  1U0L A;  1XNQ Q;  1Q3L A;  2IT1 A;  1VQ4 A;  4DUZ L;  5IE8 A;  1CFM A;  2KED A;  3A56 A;  5IYB H;  2FFK B;  1XX8 A;  3J81 i;  2K28 A;  2L4N A;  3FKI H;  2MP1 A;  2X6L A;  2A6E C;  2V4D A;  4UP8 A;  1I4Q A;  3HEJ A;  2CKZ B;  3BDO A;  4JI7 L;  3CD6 A;  5IT9 L;  2PCF B;  2KBN A;  5IP7 H;  4JBK A;  4A3I G;  4AYB G;  4X62 L;  4XQQ A;  1PDQ A;  1BR9 A;  5BR8 Q;  4RA8 A;  3NK9 A;  4LW1 A;  1GO3 E;  2A6H C;  1X9N A;  4A3C G;  3MXN A;  5IYD H;  1ILP A;  1I3Q B;  3I4M B;  2JN4 A;  3A55 A;  1TWH B;  2CCZ A;  3AFP A;  3J81 E;  1OXU A;  1Q8K A;  1Y1W B;  3CPF A;  3CHB D;  1G2S A;  3I73 A;  2PI2 A;  4HMI A;  5JEA J;  2VQF L;  4RG1 A;  5L37 A;  4J15 A;  4JCV E;  1FGU A;  1XPR A;  1R4P B;  1NJI C;  2R6G A;  3S16 B;  1WCM B;  1ENA A;  2OQK A;  3ND8 A;  1BBX C;  2ATW A;  1TVX A;  3T56 B;  1U4P A;  3K0Y A;  2MPM A;  4LFB L;  3H6M A;  2R93 G;  4DV3 L;  1VQB A;  1X55 A;  3OMC A;  3X3N A;  4A3D H;  2XGT A;  3WWV A;  1V43 A;  3JAM L;  2E5L Q;  2UUB L;  2VB2 X;  3J80 i;  4DXF A;  3PGZ A;  4RH6 A;  4LF5 L;  4L5R C;  1F2Y A;  2AWO A;  1B9N A;  1ENC A;  2NVQ B;  2DJF C;  1XPO A;  2XSC A;  4CGY B;  4BBS B;  4ZUJ A;  5CV4 A;  1F9S A;  1SYC A;  3KLR A;  3TP8 A;  1PXU A;  4R8I A;  2EVB A;  4NXN L;  4JI6 Q;  2EYM A;  4JI0 Q;  1C7Y A;  1GKH A;  3TEH B;  5KYI A;  4DKA C;  4A3K H;  2RDH A;  4E6I A;  1X3E A;  4ID6 A;  5CC4 A;  4CJ0 B;  1A63 A;  1QVC A;  2OF1 A;  3NBH B;  2K5H A;  4DV2 Q;  3PO3 H;  1UE1 A;  1LV9 A;  1HCZ A;  2DNE A;  2F0L A;  1QNK A;  4UP7 A;  1SXT A;  4V0B A;  3BZC A;  4MNO A;  5BN4 A;  3NE5 B;  4BBR G;  1QWY A;  3BYT B;  4V19 0;  4DN4 M;  3ITP A;  5CGK A;  1A8V A;  1AW7 A;  3GTQ B;  1AP0 A;  2GN5 A;  1G91 A;  3EIV A;  5C3E H;  1WTO A;  1AFP A;  1Y1V H;  2EY5 A;  3H09 A;  1MIU A;  3MAQ A;  4JI4 Q;  1FR3 A;  1YHA A;  1AE2 A;  2WAQ E;  4RGM A;  1MSH A;  1A62 A;  1WD0 A;  3T1H Q;  4BY1 H;  1PTO B;  1VQJ A;  3T51 B;  2R7Z H;  3OSO A;  1UE6 A;  2E8G A;  3H91 A;  4N9P A;  3GTG B;  4JYA L;  1K83 B;  2SDF A;  4ZUI A;  4B08 A;  1HR0 W;  1B9M A;  2O2L D;  4G7O C;  3E3X A;  4GN5 A;  1XJV A;  4C3H G;  3TSS A;  1D5Z C;  1CZG A;  3FHW A;  4J6H A;  3QIA A;  4JI5 Q;  5I6Y A;  3GTG H;  1L2F A;  1LO5 D;  4HCS A;  3UI2 A;  1G8Z D;  5G3L D;  3QO2 A;  4KK7 A;  4DNI A;  2R93 B;  3SEB A;  1STE A;  3G4S A;  2N78 A;  2NTS A;  5I2X A;  1Q7Y C;  4R4O A;  3ER0 A;  2WP8 J;  4JI1 L;  3TP7 A;  3KOJ A;  1VQC A;  2EJM A;  2F52 A;  2M9V A;  5CV6 A;  4BXX G;  2ZM6 Q;  4YCU A;  4A3C H;  1JB3 A;  1EIY B;  1VQK A;  1BCP B;  1F2Z A;  3KBG A;  3ZJY C;  1D5M C;  4L8J A;  2O5I C;  1C4Q A;  2JA8 H;  3HOY H;  1PTO C;  1H9S B;  3SDZ A;  2CQO A;  4DR1 L;  4DK1 A;  1Y69 U;  4GLA C;  3P7J A;  2G9D A;  4DV6 L;  3TBI B;  1MJC A;  3P1H A;  3LWE A;  5DLQ E;  1SFO H;  5FJ8 G;  2VZA A;  4MN3 A;  5KNC A;  5M5X H;  2DN8 A;  2NN6 I;  3OWE B;  1BXT A;  5EBC A;  3T1Y Q;  2IL8 A;  1VCI A;  2K6A A;  4IPD A;  5C3X A;  2D62 A;  2F3W A;  2CW0 D;  2F4V Q;  4IUP A;  2K52 A;  3A7L A;  1Q86 C;  1PZI D;  2Z4I A;  3SR1 A;  5FLX c;  5C3E B;  3GTO H;  2E2H B;  3QG1 A;  2QEJ C;  3STB D;  2A68 C;  2UUB Q;  3DUZ A;  1A2T A;  1YNX A;  1Q12 A;  1UEA B;  2N49 A;  4HN7 A;  4B3R L;  2F4I A;  5AJ3 Q;  3PIP A;  3CC2 A;  4AQY L;  1PTO F;  1I6H H;  2MO1 A;  1CHQ D;  1V9P A;  3VA5 A;  2OXP A;  3RLN A;  3HOU B;  1VQ6 A;  3MVV A;  3U9O A;  4KTA A;  1HNW Q;  3CQZ H;  3E0E A;  1CKN A;  1CSQ A;  1K0S A;  4K2L A;  1PYW D;  4AIM A;  1UE5 A;  1X65 A;  1SYF A;  1SRO A;  2BDN A;  2PO4 A;  4HED A;  3TRZ A;  4CDD C;  3S2H H;  2D5D A;  3IL8 A;  1V1P B;  4ILW A;  3SK8 A;  3HOU H;  1NBW A;  1N34 Q;  2ICE C;  1CSP A;  4R4I A;  1STH A;  1X3P A;  3DWA A;  2YU9 B;  3NQT A;  1RDP D;  1YHB A;  3HKZ B;  2F0J A;  1JQY D;  3R8B A;  4H0L C;  3D4W A;  1EU3 A;  2I5M X;  5A35 A;  3S1R B;  4H44 C;  4OWT B;  1LT6 D;  3GTL B;  2ASB A;  1SAP A;  1SR3 A;  1Y1V G;  2ZTD A;  4EQ5 A;  2P5Z X;  1BBU A;  1TY0 A;  2IPK D;  3SHL A;  2B2W A;  1B53 A;  4I7A A;  1VS0 A;  2WAQ G;  4GNX B;  1M8A A;  2VL6 A;  4FYD A;  3RZO B;  4DPG A;  4KI0 A;  4DV4 L;  1AZP A;  4PMB A;  1IBM Q;  4JV5 Q;  2NVX B;  1GHJ A;  5ELO A;  1EY5 A;  1OTC A;  1IBK L;  2NVT H;  4CHT B;  5HY6 A;  2B63 G;  4R9W A;  1II3 A;  2LKV A;  1WTP A;  4A3I B;  4RCO A;  3F2D A;  5JJK A;  3RD4 A;  1LTA D;  1EQT A;  1YI2 A;  2A69 C;  3E9H A;  4RKB A;  5IT9 E;  1QVG A;  5KEE A;  3RN2 A;  1HNX L;  1JIC A;  4FXD A;  4H02 A;  1FJG Q;  3AYH B;  2ZJQ A;  4A3E G;  1PH9 A;  1RJT A;  3OTO Q;  5M5Y B;  1YNN D;  4KY5 A;  4X3U A;  4KN7 C;  4DV0 L;  3H0G H;  2HDL A;  1UUP A;  4O0A A;  4GZY C;  3LGJ A;  5FLM G;  2B2Y C;  2CH4 W;  3HOZ G;  4R8N A;  2BDO A;  3S15 H;  2CW0 C;  4Q5V A;  5JJL A;  2K5W A;  1PRT C;  5DEH A;  1OXV A;  2B2U C;  2OQ0 A;  2FXQ A;  3PCO B;  2AWN A;  2A68 D;  3VR6 A;  3PO2 H;  1Z7T A;  2XVS A;  3NP8 A;  2B2V C;  2J4X A;  2GVA A;  4IOA A;  4CDC C;  4A93 H;  1CQV A;  3GO5 A;  3M7G A;  3K7A H;  5CV5 A;  3J7Y W;  4HJA A;  4DR7 L;  1MD2 D;  3FVQ A;  3HP3 A;  1PZJ D;  1JJC B;  2K7V A;  4KJN A;  3CMA A;  3NUC A;  3PF5 A;  5ELB A;  5KYL A;  4WOR A;  2MQH A;  4GS3 A;  4ZK9 B;  3WOE A;  3G7L A;  1S4Z A;  2KA7 A;  1CKO A;  4FVM A;  1VQE A;  2M2L A;  4HR7 B;  4UHV A; 
#chains in the Genus database with same CATH homology
 1Q46 A;  5ELN A;  4B3R Q;  4A3M H;  4A3B G;  4LUZ A;  3DLL A;  4HJ8 A;  2ID0 A;  1W2B A;  1A0I A;  1MKH A;  1SN8 A;  2PNH A;  4AQY Q;  4C3J H;  4A3F G;  1IYJ B;  4DR5 L;  3W1G A;  3RLF A;  1OXX K;  4LF9 Q;  5C4X G;  4RMF A;  4YCW A;  4TQU S;  4KHP L;  4JI3 L;  4JI6 L;  2UU9 L;  3NEN A;  4QGU A;  4NXN Q;  4JI1 Q;  4K0K Q;  1HZB A;  4C3I H;  4POG A;  2YV5 A;  3GTK H;  2DUD A;  1IBL Q;  1Z47 A;  4DUY L;  4HIK A;  1HNZ Q;  2R92 G;  4IFD I;  5K36 G;  3HOX H;  1CKN B;  3PIO A;  3CCJ A;  5LMN W;  3S1M H;  4LFB Q;  1TWC H;  3UDI A;  1QZG A;  4JI8 L;  3KF6 B;  4A3K G;  1P16 A;  3PSI A;  2NVQ H;  2B3G A;  4DV4 Q;  3S1R H;  5M3F H;  2I0Q A;  1X54 A;  2NN6 G;  2QGQ A;  3A0J A;  4NPS A;  4OWX B;  1IBM L;  4JYA Q;  4X6A H;  2IHF A;  1VQ7 A;  3F2C A;  1XMO L;  4UY8 C;  1Y1W H;  3JC6 6;  5LMN Q;  4A3F H;  4IFD G;  3GD7 A;  2JQO A;  3F1Z A;  2UUC Q;  4DV7 L;  4A3J G;  2GVB A;  1K73 C;  1L1O B;  3PUX A;  2JA6 G;  1H95 A;  1PFS A;  4X64 L;  4Y7N H;  2ZTE A;  4B3S Q;  4IJL A;  1TWF H;  4JI5 L;  1Q1E A;  1VQ5 A;  3U4V A;  3HOV H;  4LUO A;  3T1Y L;  2VS1 A;  4IFD J;  3EBE A;  1DGS A;  3HKZ E;  3KFU A;  4B3T Q;  2F4V L;  1E3P A;  2Y0S G;  3J81 c;  3J7Z C;  4PZ6 A;  3I4O A;  4A3I H;  4BXX H;  4DV1 Q;  3CCQ A;  1X56 A;  3PO3 G;  4QY7 A;  4ME3 A;  4JI4 L;  3Q8D A;  4JI0 L;  3L7Z C;  4IO9 A;  2AMC B;  3CCV A;  3TQY A;  2IHE A;  3ULP A;  1QUQ B;  1PV4 A;  1N36 L;  4BY1 G;  2AKW B;  4HIO A;  1N8R C;  3PF4 A;  3KDF A;  1IXR A;  5M5Y H;  5C44 G;  2DGY A;  2HIX A;  2NZO A;  4DV2 L;  4JV5 L;  1I5F A;  2HQL A;  3D31 A;  2CWP A;  3M4P A;  1JB7 A;  1T9H A;  4GOP A;  1EYG A;  3S24 A;  4R1J A;  2UXD Q;  1PYB A;  1I94 L;  5E7N A;  3A74 A;  3GDE A;  1SRU A;  1PVO A;  1KL9 A;  1OXT A;  1U0L A;  4IJH A;  1XNQ Q;  1E1T A;  2IT1 A;  2WB1 G;  5IYD G;  1VQ4 A;  2JA8 G;  3HOY G;  4DUZ L;  4DR2 L;  3RZD H;  5IE8 A;  3L2P A;  4LFC Q;  1YJ9 A;  1TWH H;  4JOI A;  1Y14 B;  5IYB H;  1N32 Q;  1XNR Q;  5IWA L;  3J81 i;  3FKI H;  4JOI C;  2VNU D;  4B3M L;  4LF8 L;  4LF6 L;  4DV0 Q;  1WOC A;  3U4Z A;  4UP8 A;  1PH2 A;  2JA5 G;  2CKZ B;  1YHQ A;  4JI7 L;  1K83 H;  4BBR H;  2QA4 A;  1K8A C;  1JMC A;  5IP7 H;  2KBN A;  1VQ8 A;  2Q2U A;  2WB1 E;  4AYB G;  4A3I G;  4JBK A;  4GKJ Q;  4X62 L;  3D0F A;  2IX0 A;  5BR8 Q;  1BVS A;  2VUM G;  4LW1 A;  1GO3 E;  1HR0 L;  1X9N A;  4A3C G;  2VQE L;  4JI2 Q;  1PHJ A;  5IYD H;  3RLO A;  1HJP A;  4X66 Q;  2UXB L;  3OW2 A;  5M5W H;  1NMG A;  1PH7 A;  2HHH L;  2JA7 G;  3S2D H;  1Q82 C;  5C4J H;  4DR1 Q;  2CCZ A;  1N34 L;  3AFP A;  2RF4 A;  3HOX G;  2B29 A;  4GNX C;  1N33 Q;  1OXU A;  1Q8K A;  4X65 Q;  3F8T A;  3CPF A;  1KIX A;  4NB3 A;  4LFA Q;  5GQO A;  1E24 A;  1K8G A;  4WJ4 A;  1JT8 A;  2PI2 A;  1VQ9 A;  5JEA J;  2VQF L;  4RG1 A;  3PUY A;  4K0K L;  1VQG A;  4J15 A;  4JCV E;  4YWK A;  3J7A 5;  3ULL A;  1FGU A;  1XPR A;  1NJI C;  3S1N H;  2R6G A;  3GTP H;  4A75 A;  3KJO A;  1V1Q A;  2OQK A;  1P8L A;  3UDG A;  4DR7 Q;  2ATW A;  4L5S A;  4A3B H;  4LFB L;  1IL2 A;  5HGQ A;  1IBK Q;  1VQA A;  2R93 G;  4DV3 L;  1VQB A;  1X55 A;  3BZK A;  2JA7 H;  4A3D H;  2XGT A;  1NE3 A;  3M9B A;  3E9I A;  3WWV A;  4GOP C;  4AYB E;  1V43 A;  2RHQ B;  2E5L Q;  3K8A A;  2UUB L;  5LMN L;  1WCM H;  3J80 i;  2LSS A;  1EQQ A;  3PGZ A;  4MTN A;  2BH2 A;  1L0W A;  1KRT A;  4OX9 L;  4LF5 L;  1X3F A;  1FVI A;  1KD1 C;  2RCN A;  4L5R C;  1VQI A;  2AWO A;  2EQS A;  4QJF A;  4R4T A;  4LF7 Q;  1FJG L;  2VY3 A;  1VQO A;  1I50 H;  1J5E L;  5LMU Q;  4QL5 A;  5C4X H;  1XPO A;  4C3H H;  4NXM Q;  4DAY B;  1VQD A;  5C3E G;  4HIM A;  2CWA A;  2IY5 B;  1E1O A;  1GM5 A;  2R93 H;  1JJG A;  5GAE C;  1HNW L;  4DV6 Q;  3CCE A;  4BA2 I;  2NVY H;  3I4N G;  5GAG C;  1FL0 A;  4NXN L;  4JI3 Q;  4KHZ A;  4JI6 Q;  1MJE A;  1WYD A;  5C44 H;  5GAH C;  3KF8 B;  4JI0 Q;  4HJ7 A;  1XMQ Q;  3AEV A;  1C7Y A;  1HNZ L;  4GKK Q;  1GKH A;  2XTI A;  3TEH B;  4DKA C;  1LYL A;  2RHS B;  4A3K H;  2R7Z G;  3GTQ H;  5EAY A;  4DR6 Q;  1X3E A;  1VQL A;  2PQA B;  4LF4 L;  3K80 C;  5GAD C;  1K9M C;  3OTO L;  4PZ7 A;  3KF6 A;  3ICE A;  1QVC A;  1A63 A;  4P75 A;  2E2I H;  3NBH B;  2K5H A;  4DV2 Q;  1WJJ A;  3PO3 H;  4L5T A;  1UE1 A;  4IPC A;  4L5Q A;  4BBS H;  3J80 c;  2JA6 H;  3ULJ A;  4PMW A;  1C0A A;  1EOV A;  4AH6 A;  5J3B A;  4OON A;  3CCL A;  2OTJ A;  1D8L A;  1EFW A;  4YWL A;  4UP7 A;  3J81 j;  1L1O A;  3BZC A;  4MNO A;  2K14 A;  2BA1 A;  4A76 A;  1G29 1;  4JC0 A;  3H3V H;  4BBR G;  1N9W A;  1L1O C;  4LFC L;  1QZH A;  1X6O A;  1UEB A;  1G6P A;  1YEZ A;  1A8V A;  1PYS B;  4A3G H;  3U58 A;  5JEA G;  2GN5 A;  4WJ3 M;  4DAM A;  2ZJP A;  3EIV A;  5C3E H;  1Y1V H;  2EXD A;  4GNX A;  2C35 B;  1LUZ A;  1VQN A;  1MIU A;  3CXC A;  4JI4 Q;  3RR5 A;  2YTY A;  2WAQ E;  1EWI A;  2NZH A;  1AE2 A;  1YHA A;  2LXJ A;  4GLX A;  1CUK A;  1A62 A;  1WI5 A;  2EIF A;  1IBL L;  4QIW E;  1YIJ A;  3T1H Q;  4BY1 H;  3S16 H;  4KLK A;  1UWV A;  3UE1 A;  3PO2 G;  1VQJ A;  2R92 H;  2UXC Q;  4P73 A;  2R7Z H;  2VQE Q;  1PH5 A;  3G71 A;  4LF9 L;  1UE6 A;  2E8G A;  2F3I A;  2JA5 H;  4JYA L;  2K50 A;  2VW9 A;  3EN2 A;  2KHI A;  3KJP A;  2A19 A;  1HR0 W;  2UUC L;  4GOP B;  2N8N A;  1IZ6 A;  4GN5 A;  1XJV A;  2Y0S E;  4DR3 Q;  4DV5 Q;  4YY3 L;  3M4O H;  3FHW A;  4JI8 Q;  2QEX A;  4B3S L;  3RZO H;  4A3D G;  1TWA H;  4JI5 Q;  4YHH Q;  4BY7 H;  2KEN A;  2Q2T A;  3GTG H;  1OXS C;  1L2F A;  3CD6 A;  1HZA A;  1XNR L;  4A3L H;  2BA0 A;  3CC7 A;  4DNI A;  4HJ5 A;  3RN5 A;  4OWW B;  1EQR A;  4BBS G;  3G4S A;  2N78 A;  4JBW A;  2OWO A;  4YCV A;  1Q7Y C;  4R4O A;  2OCE A;  3ER0 A;  2WP8 J;  4JI1 L;  3KOJ A;  1VQC A;  1EUJ A;  2F52 A;  4BXX G;  3CAM A;  2ZM6 Q;  3CP0 A;  3SGI A;  4YCU A;  4A3C H;  1BKB A;  1EIY B;  1VQK A;  2KCT A;  1UE7 A;  3ZJY C;  2V1C C;  4POF A;  2H5X A;  4DR5 Q;  2Z6K A;  2JA8 H;  3JAM i;  2YTX A;  5M3M G;  5LMU L;  3HOY H;  3FP9 A;  3HOW H;  3MXN B;  3DM3 A;  2UU9 Q;  2CQO A;  2K4K A;  4DR1 L;  4GLA C;  4GLV B;  4JBJ A;  4DV6 L;  4DUY Q;  1AE3 A;  4YWM A;  1MJC A;  2N3S A;  3IRB A;  2B63 H;  1I94 Q;  1HNX Q;  4C2M H;  4A3M G;  2A1A A;  4X64 Q;  1N36 Q;  5DLQ E;  2R7F A;  5FJ8 G;  5M3F G;  1SFO H;  2VZA A;  5M5X H;  3H3V I;  4R4Q A;  2E2J H;  1XTD A;  1R9T H;  3G48 A;  2NN6 I;  2KHJ A;  1EIF A;  4GKK L;  3PUZ A;  3CME A;  1VCI A;  4HJ9 A;  3T1Y Q;  3I56 A;  1PH8 A;  4DR4 L;  4IPD A;  1YIT A;  2D62 A;  2AHO B;  4A3J H;  4MZ9 A;  1VQF A;  4B3T L;  2F4V Q;  2K52 A;  1LTL A;  4XIG S;  1Q86 C;  3HKZ G;  4B3M Q;  3UDX A;  5FLX c;  1HZC A;  4LF8 Q;  4P71 A;  2UUA L;  3M3Y H;  3GTO H;  4A3L G;  1Z9F A;  1K3R A;  4R4C A;  3STB D;  5IYC H;  4X62 Q;  2UUB Q;  2JA9 A;  1YNX A;  1VQH A;  3A5U A;  4DUZ Q;  1B70 B;  1Q12 A;  1G51 A;  4DR2 Q;  2N49 A;  1Q81 C;  4OX9 Q;  4B3R L;  1XPU A;  2JEA I;  1E7Z A;  4TVA B;  5AJ3 Q;  2YYZ A;  3PIP A;  4HID A;  4AQY L;  3CC2 A;  3G6E A;  1YBY A;  1I6H H;  2MO1 A;  2CFM A;  3BJU A;  1V9P A;  2MNA A;  2UXB Q;  1JJ2 A;  1Q1B A;  4KHP Q;  3NEL A;  3RLN A;  2D0P A;  1VQ6 A;  5M3M H;  1ASZ A;  1HNW Q;  3CQZ H;  3E0E A;  1CKN A;  2ZJR A;  1CSQ A;  1B8A A;  3HFZ B;  4AIM A;  4JBM A;  1UE5 A;  1XNQ L;  1HR0 Q;  1X65 A;  2JJQ A;  1SRO A;  4OXP A;  1RL2 A;  3TRZ A;  3S2H H;  4X66 L;  5FJ8 H;  1ASY A;  3K0X A;  3HOU H;  2HHH Q;  1NBW A;  5GRO A;  1AH9 A;  3CF5 A;  1YJW A;  1N34 Q;  1CSP A;  2Z0S A;  4R4I A;  4DV3 Q;  2L15 A;  4O2D A;  2D0O A;  1O7I A;  4DV7 Q;  4LF6 Q;  4LFA L;  2PQA A;  2JK8 A;  3KLW A;  3HKS A;  1YJN A;  3I4M G;  4BY7 G;  1D7Q A;  1YHB A;  3STB C;  3I4N H;  5C0X J;  1GVP A;  5BR8 L;  3FKI G;  1N32 L;  2K5N A;  2I5M X;  3UE0 A;  5IWA Q;  4DR3 L;  1VQP A;  1KQS A;  1S72 A;  3H0G G;  3I55 A;  4DK6 C;  1J5E Q;  3I7F A;  4OO1 G;  2HT1 A;  4P74 A;  5IP7 G;  4OWT B;  3TS2 A;  2JE6 I;  4DV1 L;  4IOC A;  3TRE A;  2ASB A;  2Q2H A;  1SR3 A;  3HOZ H;  1Y1V G;  3M7N A;  1QUQ A;  2ZTD A;  1JE5 A;  2R7D A;  4EQ5 A;  1BBU A;  1KHI A;  1KRS A;  5IP9 H;  1S3O A;  2VQF Q;  4LF5 Q;  4LUV A;  3TS0 A;  2MFI A;  1VS0 A;  3KDF B;  2WAQ G;  1RIP A;  4XTC S;  4GNX B;  2ES2 A;  4P72 A;  2VL6 A;  4LF7 L;  3I2Z A;  3HOW G;  4OO1 I;  4DPG A;  1PH4 A;  1C9O A;  4KI0 A;  4DV4 L;  1PA6 A;  4QQB X;  1U5K A;  3BU2 A;  1PH3 A;  1IBM Q;  5C0X I;  4JV5 Q;  4PZ8 A;  5ELO A;  1XMO Q;  1OTC A;  1IBK L;  3M85 A;  2NVT H;  5HY6 A;  2B63 G;  2UXC L;  3HOU G;  5IT9 c;  5FLM H;  4X65 L;  3CCM A;  3K81 C;  2PMZ E;  4A93 G;  4Y52 H;  2KCM A;  3M4Q A;  1NTG A;  2K5V A;  1CKM A;  5H1S E;  1B7Y B;  4UPA A;  3F2D A;  2E2H H;  1YI2 A;  1KAW A;  1YZ6 A;  5JJK A;  4EX5 A;  4IPG A;  3E9H A;  3GTJ H;  1VQM A;  1XMQ L;  4APV A;  2I5H A;  5IP9 G;  1Y1W G;  1QVG A;  2NVX H;  1HNX L;  3RN2 A;  4FDB A;  4DV5 L;  4YY3 Q;  4H02 A;  2JEB I;  3AYH B;  1FJG Q;  2ZJQ A;  3UDF A;  4A3E G;  2A8V A;  1PH9 A;  4BA1 I;  1LM0 A;  3OYY A;  3OTO Q;  1TWG H;  1M1K C;  4DV0 L;  3H0G H;  2WFW A;  4JI7 Q;  4DR4 Q;  4NXM L;  1S40 A;  2OTL A;  4O0A A;  5C0X G;  2Z6K C;  4GKJ L;  1W3S A;  2E5L L;  3LGJ A;  5FLM G;  3U50 C;  1TXY A;  1SE8 A;  4A3G G;  3HOZ G;  2K75 A;  4GN3 B;  1NY4 A;  1SMX A;  1X3G A;  3S15 H;  5JJL A;  2ZM6 L;  4JI2 L;  3B6Y A;  1OXV A;  2OQ0 A;  3ERS X;  3S1Q H;  2FXQ A;  3PV0 A;  3PCO B;  5IYB G;  1QVF A;  1E22 A;  3S17 H;  4DR6 L;  2AWN A;  5AJ3 L;  4LF4 Q;  1J6Q A;  1N33 L;  3PO2 H;  3K7U C;  1WCM G;  3W5O A;  4DK3 C;  3CCR A;  4LNQ A;  3H15 A;  3HOV G;  2UXD L;  4GN4 B;  3RNU A;  2GVA A;  2Q2I A;  2YTV A;  2YU9 H;  4IOA A;  3CW2 C;  4A93 H;  1HH2 P;  1HZ9 A;  3NEM A;  3GO5 A;  3W1B A;  3KYH C;  3PUV A;  3K7A H;  1YVC A;  3L0O A;  1BBW A;  3MEF A;  4HJA A;  3T1H L;  4JG2 A;  4DR7 L;  2VUM H;  4UP9 A;  1GD7 A;  3CCS A;  1KC8 C;  1K0R A;  2BH8 A;  4YHH L;  2HIV A;  5JJI A;  3CCU A;  1I3Q H;  2ZTC A;  5IY0 A;  3I4M H;  1JJC B;  4PG3 A;  3CMA A;  4A3E H;  1NMF A;  2PI2 E;  3PF5 A;  3GTL H;  3A5Z B;  3AQQ A;  3PUW A;  1PH1 A;  2IX1 A;  2I5L X;  3S14 H;  2MQH A;  2ALY B;  1KXL A;  4GS3 A;  4A4I A;  1M90 C;  2MO0 A;  2UUA Q;  5IYC G;  3AFQ A;  3GTM H;  3F2B A;  1PH6 A;  4IPH A;  3VDY A;  1SLJ A;  1WFQ A;  3JAM c;  3CPW A;  1CKO A;  3CC4 A;  1VQE A;  2LXK A;  4ALP A;  4LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...