1X3GA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
118
structure length
114
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRMFDRWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 16
structure length 114
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3gA00
2KHJA 1V1QA 3HOVH 3M4OH 3S24A 3S1RH 3BZKA 3KJPA 2Q2UA 1VQ9A 5M5WH 2K75A 2K5NA 1HZAA 4LW1A 2KHIA 4JV5L 1AH9A 4FDBA 2Y0SE 4JG2A 5HGQA 1SE8A 2VQFQ 3FHWA 4IOAA 4GN4B 4DR1Q 4O0AA 3W1BA 3U4VA 2F52A 4QQBX 2GVAA 3JAMi 3CD6A 4A76A 2RCNA 1QZGA 1UE1A 4DR7Q 4LNQA 3F8TA 2MFIA 4IOCA 3RN5A 1JJCB 4A3MH 2N3SA 2OQKA 1OXTA 1EOVA 1WI5A 2ES2A 4JI7L 4LF6L 4A3CH 1I5FA 4LFAL 4YY3L 5JJKA 3F2BA 3HOUH 1IBKQ 4OWXB 5EAYA 3TS0A 1R9TH 1VQFA 4LF4Q 1HNXL 1HJPA 1FVIA 3DM3A 3HOXG 4GOPB 3S16H 2UUAQ 4DR4L 2JEAI 3JC66 4DKAC 3J81i 1N8RC 3H0GG 1XPUA 4JI0L 3PO2G 3EIVA 1HR0W 3HOZH 2HHHL 4DAMA 4L5TA 4X65L 1K83H 3S1MH 1VCIA 5LMNW 1YHBA 5C0XG 5C0XJ 3I7FA 4UP8A 3M4PA 5BR8Q 4HJAA 4GLAC 3KYHC 4NB3A 4XIGS 1VQGA 2E2IH 3MEFA 1I94Q 4DR1L 1E24A 4KI0A 1CKMA 1S72A 1BBWA 1PH2A 4LFCQ 2VS1A 3UDIA 4DV1Q 4X66L 3ULPA 4GOPC 3I55A 2NVQH 3RZOH 2OTJA 3CAMA 3A0JA 1EQQA 4A3DG 1J6QA 1B8AA 1D8LA 3HOWH 2JA6G 2E8GA 4QY7A 4AQYL 4UPAA 3AEVA 1EQRA 3PO3H 1QUQB 3M7NA 4A4IA 1ASYA 3CPFA 1HNZQ 1Q81C 4A3GG 5LMUL 1A62A 5HY6A 1WJJA 4DUZL 2UXCL 3J81j 2IHEA 1VQOA 1VQMA 3CMEA 2A1AA 1X3EA 3ERSX 4OO1I 1WCMH 3W1GA 3L2PA 3KF6B 3CCRA 4B3RL 3L7ZC 3CC7A 2CFMA 3H3VH 3UE1A 1OTCA 4DV2L 4JBMA 2CQOA 4JBWA 4LFCL 2I5HA 3HOYH 4A3BH 3FKIG 3GTPH 1HH2P 1Y1VH 1MKHA 3MXNB 4R1JA 2ZM6L 1PV4A 4DV3L 1VQLA 2JA5G 4LF5L 3I4OA 3G4SA 4GKKL 4YWMA 4X62L 2AWNA 4GOPA 2B3GA 4GKJL 4R4QA 4GNXC 3GTGH 2JQOA 1KC8C 2R7ZH 1A63A 1IBML 4JCVE 4IPDA 1VQDA 2UXBQ 4DV6Q 3HOVG 4P71A 4EQ5A 4KLKA 3D0FA 4JBKA 1PFSA 3STBD 2ID0A 3T1HL 2EXDA 4A3JH 2N8NA 1Q86C 4JI3L 2Q2IA 1VQAA 1Z9FA 1VQ4A 4MTNA 1FJGQ 4IJHA 5GQOA 2A8VA 2CWAA 4LF8L 1YHQA 1XPRA 1I50H 1NE3A 2AKWB 4A3MG 1LTLA 1A8VA 1HZCA 2PI2A 3F2CA 2F4VL 1O7IA 5IYCH 1XMOQ 3D31A 2VZAA 2B63G 3TEHB 4A3CG 1VQNA 3ZJYC 2VUMH 3HOUG 1OXVA 1Q82C 1YHAA 2NN6I 2WP8J 2EIFA 1UWVA 2JK8A 2VQEQ 4IO9A 3U58A 4JI1Q 3S17H 2UU9Q 1E22A 3J7ZC 3F1ZA 1J5EQ 2YTXA 4AYBE 4DUYL 3HOZG 1MIUA 4P75A 1DGSA 4GNXA 1EFWA 1VQEA 4DV6L 4QGUA 2NZHA 2Z0SA 3E0EA 1PH6A 3J80c 4L5RC 2ZTEA 1M90C 5IP7H 1HZ9A 4IFDI 2YTVA 3KF8B 4JI5L 1MJEA 3CW2C 1T9HA 3CCLA 1JB7A 2WFWA 1AE3A 4DV0L 3KF6A 1NTGA 3H15A 1YITA 1IZ6A 2KCMA 1GKHA 3K7AH 4DV5L 3CCUA 3CC4A 4X6AH 2XTIA 4RMFA 3ULJA 1N36L 1Q46A 1YNXA 2PMZE 1Q1EA 1C0AA 3PUYA 5M3FH 1JJGA 4BXXH 4JI2L 2WAQG 1K73C 3HKZE 3A74A 1IL2A 1XMOL 4A3IH 5AJ3Q 5IY0A 4X64Q 3HOWG 1LM0A 3A5UA 2H5XA 3AQQA 2E5LQ 1X56A 2VQEL 4YWKA 1UE5A 3PO3G 4JI1L 1WYDA 5M5YH 4C3HH 1PHJA 3VDYA 1J5EL 3S15H 4B3TQ 3GTQH 4B3SL 3J7A5 1C9OA 4NXNQ 5IT9c 3CCEA 2R7DA 3RLFA 3CC2A 1PH8A 2AWOA 4JI4Q 1WCMG 3K0XA 4B3MQ 4IJLA 1M1KC 4LFBQ 2CCZA 3FP9A 2UUBQ 2K4KA 4A3BG 5C4JH 4A93H 2K52A 2OWOA 3HOYG 1NMFA 1HZBA 1Y1VG 1BBUA 1X55A 4H02A 2B29A 3TRZA 4A3EH 2VQFL 4DV4Q 2IY5B 4DR6Q 4UP7A 1L1OC 3K80C 3HFZB 2L15A 1EUJA 3G48A 1Y14B 4C3JH 4YWLA 2JA9A 1SFOH 2UUCQ 4YHHQ 4DR7L 2R7ZG 1PH1A 1EYGA 2E5LL 3PO2H 2HQLA 4OWTB 1HNWQ 3OTOQ 2DGYA 4A3FH 3PUZA 4A3KH 1B7YB 1YIJA 1KQSA 1G51A 5FLMH 1IBKL 1D7QA 4OX9Q 1K3RA 4EX5A 4LF4L 1YEZA 4LUOA 1SLJA 4A3JG 4POGA 1JE5A 2XGTA 4QL5A 3CPWA 2UUAL 4IPGA 1PYSB 5GAEC 4LF7Q 2N49A 2V1CC 4JI4L 1JT8A 4K0KQ 3DLLA 3M85A 1X3GA 2JJQA 1A0IA 4GNXB 3PUVA 1BVSA 2K5VA 4JBJA 1NJIC 2UUBL 1U0LA 1XPOA 1N9WA 3T1YQ 4IPCA 4QIWE 5IYCG 4KHPQ 5BR8L 4GN5A 5C3EH 1YI2A 1VS0A 2R7FA 4DV4L 4TQUS 4NXMQ 1I94L 2VUMG 3PF4A 5C0XI 2R93H 2VW9A 3GTMH 2D62A 4JI8Q 1KXLA 2ASBA 1L1OA 2WB1G 4YHHL 1IXRA 4DV1L 2NVXH 2UUCL 1N33Q 4DNIA 4BBSH 3NELA 1MJCA 4P74A 1N34Q 3I56A 3KFUA 1PH5A 3OTOL 1V43A 1HNWL 1G291 4PZ6A 5IP7G 2JA7H 1LYLA 3EBEA 4R4CA 5M5XH 2KBNA 4PG3A 1S40A 2YU9H 1W3SA 2KENA 4OX9L 4AH6A 2NZOA 2MQHA 4IPHA 3PF5A 4YCVA 1IYJB 1X3FA 3PUXA 1HNZL 3RZDH 1VQIA 3S2DH 1K0RA 3RN2A 3S14H 3ULLA 1Q1BA 5IYDH 4AIMA 3STBC 5M3FG 1JJ2A 3TS2A 2JE6I 3I4MH 5M3MH 5IYBH 4BXXG 5J3BA 4A3IG 1C7YA 2UXDQ 2EQSA 3CCJA 3CMAA 3JAMc 2C35B 4J15A 5ELOA 4L5SA 2BH2A 4NXML 3S1NH 3GTJH 4IFDJ 1TWAH 3PUWA 3TQYA 4DR3Q 3M9BA 3CP0A 4DR2Q 1XNRQ 2I0QA 2BA1A 4DAYB 1PYBA 3KOJA 5JJLA 4DR5Q 2IX1A 4NPSA 3AYHB 4JI6Q 2D0PA 3F2DA 1CSQA 1E1OA 3UDGA 3J81c 1Q12A 3G71A 3GD7A 1K8AC 3K8AA 5GADC 2Y0SG 4BY1H 2ZJPA 2UXBL 2PQAB 4Y52H 4BBRH 1XMQQ 1VQ5A 1QVCA 3EN2A 3U4ZA 3LGJA 1Z47A 4MNOA 4ALPA 4A93G 2HIVA 2GN5A 1CUKA 1HR0Q 1SMXA 3RNUA 1B70B 4HJ5A 4A3EG 1YJ9A 1TWCH 2YV5A 4JYAQ 1IBLQ 5LMNQ 1FJGL 3NEMA 3I4NH 3I2ZA 4JC0A 3KJOA 2LXJA 2IX0A 2ZJQA 3GTOH 2OCEA 1KL9A 4JOIC 4JI7Q 4LF6Q 1SN8A 4LFAQ 1AE2A 2Z6KC 4YY3Q 3S1QH 5JEAG 1BKBA 5JEAJ 2E2JH 5IP9H 4A3FG 1ASZA 2VY3A 4A3KG 4DR2L 1NMGA 3GTKH 1I6HH 1X9NA 2K14A 1QZHA 2F3IA 5FLMG 2JEBI 3E9HA 1YJNA 1Q7YC 3PV0A 4DR4Q 4A3LH 1H95A 4JI0Q 5C44H 2UU9L 1PA6A 1VQ8A 4JI6L 1L1OB 3KDFB 4C3IH 2E2HH 3GO5A 4DV7Q 4PMWA 3CQZH 4POFA 1XMQL 1SRUA 4OWWB 5K36G 3NBHB 1GVPA 1WOCA 1TWGH 3CCSA 1YZ6A 4R4OA 1HR0L 3UDXA 3RR5A 2N78A 5ELNA 5C3EG 1WFQA 1VQBA 4HJ9A 4JYAL 1UEBA 3GDEA 3NENA 5LMNL 4OXPA 1IBLL 1GD7A 4X66Q 1K9MC 1XNQQ 2R93G 3KLWA 1N32Q 1LUZA 3TREA 1CSPA 2RF4A 1JMCA 2FXQA 2B63H 4BBSG 4HJ8A 4C2MH 3K81C 1FGUA 1KAWA 2VL6A 1OXSC 2HIXA 3SGIA 1P8LA 2YTYA 2ZTCA 5H1SE 4HIOA 2JA7G 4JOIA 4PZ8A 4AQYQ 1YVCA 2DUDA 2Z6KA 2A19A 4P73A 4DPGA 2WAQE 4X64L 5AJ3L 3ICEA 3S2HH 4P72A 1PH4A 2PQAA 4L5QA 2R92H 4OO1G 1RL2A 3G6EA 5LMUQ 5C4XH 2ATWA 4KHZA 4DUZQ 3J80i 2UXCQ 2JA8H 5FJ8H 4B3TL 3A5ZB 4R4TA 1CKOA 1UE7A 1KHIA 4DV7L 1TWFH 4BY7H 4NXNL 2CWPA 4R4IA 1L2FA 5IYDG 5GAGC 1E3PA 1Y1WH 1VQ6A 1G6PA 1KD1C 3I4MG 1S3OA 5M3MG 4YCUA 5IYBG 4B3ML 2ALYB 4B3RQ 4LFBL 1EWIA 5IWAQ 3ER0A 4GN3B 4DV2Q 3U50C 1XNQL 2ZM6Q 4LF5Q 2LSSA 1N32L 4DV3Q 3CCQA 2OQ0A 1Q8KA 3IRBA 4GKKQ 1NBWA 4X62Q 4DK6C 1W2BA 1PH7A 4DR6L 4GKJQ 3H3VI 1PH9A 1TXYA 3Q8DA 1IBMQ 4UP9A 3KDFA 2KCTA 3AFPA 2RHSB 2PI2E 3M3YH 3PSIA 4TVAB 1E7ZA 4PZ7A 4BY1G 3OYYA 3PIOA 4BBRG 4UY8C 3PIPA 5FLXc 3CCMA 1K8GA 3BJUA 5GROA 1OXUA 3T1HQ 2QA4A 2MNAA 4JI3Q 1I3QH 3W5OA 3HOXH 1U5KA 3CCVA 4RG1A 3E9IA 3BU2A 5DLQE 3UDFA 2IHFA 2YYZA 4LF9Q 3H0GH 1CKNB 4ME3A 2HT1A 2D0OA 3HKSA 4LF8Q 3B6YA 4LF7L 4QJFA 1NY4A 3I4NG 1TWHH 5IE8A 4K0KL 1SROA 5IWAL 1E1TA 3RLOA 4A75A 2NN6G 1OXXK 2F4VQ 5GAHC 1YJWA 4WJ3M 2R6GA 2NVTH 3AFQA 1PH3A 1XTDA 3T1YL 1X65A 2GVBA 2K5HA 5JJIA 4KHPL 1KRSA 5IP9G 1KIXA 1PVOA 2AHOB 1VQJA 1YBYA 2RHQB 3K7UC 1QVGA 1UE6A 4AYBG 4A3LG 4GLXA 1FL0A 4IFDG 2I5LX 2BA0A 2ZTDA 1SR3A 4O2DA 1KRTA 4JI8L 1V9PA 5C44G 4DUYQ 4LUVA 1N33L 2CKZB 1VQPA 1VQ7A 4HIDA 4A3DH 4HIKA 1N34L 4JI5Q 2WB1E 4BA1I 1EIYB 2JA6H 3OW2A 2Q2TA 4DV0Q 1VQCA 3PGZA 1GM5A 4WJ4A 3M4QA 3L0OA 2ZJRA 1X54A 4LUZA 1XJVA 2VNUD 2LXKA 4OONA 3CXCA 2K50A 1RIPA 4Y7NH 4A3GH 4LF9L 5E7NA 4HJ7A 4JV5Q 4GS3A 4DV5Q 2AMCB 3WWVA 4GLVB 2IT1A 1N36Q 3HKZG 1P16A 2Q2HA 3BZCA 4DK3C 2NVYH 2BH8A 4JI2Q 3UE0A 4BA2I 1X6OA 4APVA 3CF5A 4MZ9A 2I5MX 4HIMA 2UXDL 1VQHA 2MO1A 2QGQA 3GTLH 1QUQA 2OTLA 3PCOB 1QVFA 3FKIH 2R92G 2MO0A 4DR3L 2JA5H 4B3SQ 4YCWA 5C4XG 1GO3E 1XNRL 2JA8G 5FJ8G 1HNXQ 1EIFA 4DR5L 4BY7G 1VQKA 1Y1WG 1CKNA 4LWCA 1L0WA 2QEXA 2PNHA 4XTCS 2HHHQ 4X65Q 3RLNA
chains in the Genus database with same CATH superfamily
3OMCA 1OO9B 3MAQA 1G2TA 3S24A 3OW7A 3S1RH 3KJPA 2Q2UA 1VQ9A 3I90A 2EPBA 2KEDA 4LW1A 1SNMA 4K14A 3MXNA 4A3EB 1SE8A 2Z4IA 2HCCA 4O0AA 4QQBX 2GVAA 3ZYYX 1QZGA 2L0CA 2KQ3A 2MFIA 4N9PA 1D2BA 4FXGC 2RQXA 2WAQB 1OXTA 1EOVA 4A3CH 1RJTA 2LS01 1D5XC 1EFID 5ELDA 4OWXB 5EAYA 1QILA 1DOKA 2R61A 3VA5A 2UUAQ 2RVLA 1CZWA 3JC66 3H0GG 1XPUA 1Q3LA 3EIVA 5C4ZA 3HOZH 4DAMA 4L5TA 5A35A 4G7HC 1PRTD 4HN7A 4KY7A 5C0XG 3I7FA 2QEJC 2J7ZA 3GV3A 2B2WC 3KYHC 4XIGS 4KI0A 2F0KA 5I6YA 1CKMA 2WKDA 1S72A 1PH2A 1L0XB 3GQBA 2KECA 2MHVA 2J0TD 3D4RA 4GOPC 4R8NA 2OTJA 1CTMA 1B8AA 1D8LA 2A69C 2ZT9C 2YU9B 2R7ZB 1STYA 2F0FA 5KNCA 4IUTA 3AEVA 1WTPA 3CPFA 1XXGA 3S2DB 2F03A 1A62A 4U68A 3OSOA 4DUZL 1SMYD 4L63B 3J81j 1VQOA 2A1AA 1G2SA 3L2PA 1I50B 3JAML 4B3RL 2XSCA 4LFCL 1ONLA 3FKIG 3GP7A 1HH2P 1Y1VH 4X3SA 1PV4A 2VUMB 4ZLTF 4XDXA 3G4SA 5IGDA 2N88A 4GNXC 2DY8A 1AFPA 4JCVE 4IPDA 1VQDA 2F0IA 4DV6Q 2F0EA 1ESFA 1G6ZA 1BCPD 2RDHA 4MN3A 4L6TB 3TN2A 4LK1C 2L11A 1VQ4A 2ICIA 1FJGQ 1II3A 5GQOA 2A8VA 2NWGA 1JWMD 1YHQA 4H44C 4RGOS 1NE3A 2K01A 2D9UA 1JWUD 1A8VA 1B44D 2CW0D 2PI2A 5COYA 4F87A 1I6HB 3E5SA 2B8FA 1Q82C 2NN6I 1UWVA 5C44B 4IO9A 4JI1Q 1HPCA 1E22A 5HGTA 1JE4A 1J5EQ 2YTXA 3QO2A 5BN4A 3P20A 1DGSA 1LT5D 2FHTA 4QGUA 2P5ZX 2Z0SA 3NXWA 4QB4A 5I2YA 2YTVA 3CCLA 3CW2C 1T9HA 1FNVA 1TVXA 1WTWA 1NTGA 5JPMC 1S5FD 3HKZB 3ND8A 1RF2D 1ENCA 1K3BC 1TY0A 1YNXA 4ODGA 1CI3M 5CMDA 5IY0A 5NUCA 3A5UA 2H5XA 3Q23A 2VQEL 4J1MA 4A3FB 3SK5A 2VB3X 3NWSA 3IL8A 3GTQH 1TWFB 2K04A 1C9OA 1SNPA 3KLRA 1JCKB 2R7DA 2A6HC 2H1EA 3Q0AA 3BYYB 2QDLA 5IT9E 1WCMG 5T1IA 1CHQD 2CCZA 4CKBA 5T1GA 3OMGA 5C4JH 4A3BG 2K52A 3P1HA 3HOYG 1WD0A 1X55A 3QIAA 3TRZA 4A3EH 4DV4Q 2NVXB 4DR7L 4YHHQ 4BBSB 1JR0D 3R2TA 3OTOQ 5FLXL 5JEAH 2QILA 3PUZA 1LTBD 4ZCKA 2SDFA 4EX5A 4LF4L 1SLJA 4IUUA 3CPWA 1EY8A 5GAEC 4LF7Q 2B39A 4JI4L 3DLLA 3M85A 1MHWC 1F9PA 2NVTB 2UUBL 5C6AA 1RKNA 4QIWE 4FVMA 2AQ2B 1DXMA 4KHPQ 5BR8L 4GN5A 1EU4A 4NXMQ 1K8MA 2EY1A 3PF4A 1TWAB 2R93H 1JOQA 2WKCA 4DXFA 3M4YA 1I6VC 1HQRD 2QDBA 1HNWL 1RD9D 1PZID 4NMZA 1LYLA 3EBEA 3R2IA 1LLRD 2TSSA 2YU9H 1LTTD 1IYJB 3PUXA 1HNZL 4PMBA 4IALA 4KD4A 3S2DH 2XWJB 3K58A 3S14H 3NUCA 4IUVA 5M3FG 3I4NB 4BXXG 4A3IG 1C7YA 2UXDQ 2IPKD 1NR2A 4L5SA 5ELOA 4UAIA 4XYOA 4F7XA 2BH2A 3GTJH 5C5MA 3S1QB 1PTOD 5JVH3 3TQYA 4C3HG 4RCNA 5BN5A 2I0QA 3KOJA 2F3WA 2EJGC 4DR5Q 4NPSA 4IQZA 1CSQA 5EBDA 3G71A 1H9SB 4BY1H 2PQAB 2PQEA 2EY6A 1VQ5A 3U4ZA 4ALPA 2HIVA 5G3LD 4MTKA 1ICWA 3FEWX 1B70B 4JW0A 1YJ9A 4JYAQ 3LWEA 2KOLA 4K6DA 3GTOH 4JOIC 1SN8A 3D8GA 2Z6KC 5EKKA 3NHHA 5IP9H 1I6HH 3GTKH 2LFNA 1X9NA 2Q8RE 3S16B 1SJED 4A3LH 5C44H 5C4XB 1PA6A 1L1OB 3DEPA 4BY7B 3GO5A 2ICEC 1XMQL 2FMCA 1GVPA 5FKAC 4BWGB 1B50A 3CCSA 3RR5A 2Z8LA 4X3KA 3OWFA 3NENA 1IBLL 1Y8NB 1RCVD 3TREA 4PMCA 3CCJA 2HD3A 1FGUA 1KAWA 2VL6A 1GXDC 2ZTCA 5H1SE 5KIXA 1YVCA 2DUDA 2A19A 1Q8IA 4OO1G 3G6EA 2ATWA 4KHZA 4DUZQ 1GUGA 4DV7L 1UE7A 1TWFH 4NXNL 1WCMB 1TS5A 1Y1WH 1VQ6A 5GAGC 1E3PA 1KLUD 1XWEA 5M3MG 4QIWB 5IYBG 4B3RQ 1FYCA 5IWAQ 3ER0A 5TSSA 5ELBA 3HOYB 3MTSA 3GTPB 4WFN3 2JP1A 3CCQA 2OQ0A 1K8OA 1H9MA 2A69D 2B2TA 3D4DA 2EYHA 2F0UA 4M1UB 1PH9A 1ET9A 1AP0A 4UP9A 1I4GA 2A68C 2KCTA 5KYIA 2PI2E 1ZXTA 3M3YH 3VR3A 4TVAB 2EE1A 1QG7A 4BBRG 3CCMA 3BJUA 1E2VA 3SVMA 3SK8A 3BU2A 2DY7A 2JSOA 3H0GH 4ME3A 5IE8A 1SROA 3H91A 5CV9A 4LAAA 1QNUA 5GAHC 5C0XH 1YJWA 2R6GA 2NVTH 5EPLA 2K5HA 2JN4A 1KRSA 1PVOA 1VQJA 2KA7A 2RHQB 4GLXA 4IFDG 3J81L 2BA0A 1SR3A 4LUVA 4DA2A 2WB1E 3LWUA 1GUWA 3C2PA 1GM5A 2IW3A 3M4QA 2ZJRA 2VXWA 3MXUA 2LXKA 4OONA 5ELFA 5EGTA 4GLVB 2IT1A 1GUOA 1Q90A 3J7YW 4DN4M 2Q2HA 4DK3C 2BH8A 3UE0A 4A3IB 1X6OA 4APVA 3FPUB 1HUNA 2F0JA 1VQHA 4X3TA 3GTLH 1PRTF 4RH6A 2O4XA 4ZAIA 3PCOB 3FKIH 2R92G 2MO0A 4RKLA 3A7AB 3NQIA 3DWQA 1A3VA 1DYQA 3E3XA 2EVBA 1VQKA 2PNHA 1JOOA 1V1QA 5M5WH 2K5NA 1HZAA 3TMEA 2KHIA 4JG2A 4FF2A 5HGQA 3D4WA 4DR1Q 3W1BA 2F52A 2X69A 3JAMi 3CD6A 4A76A 2G9HD 4DR7Q 1ESRA 2AQ1B 4HSPA 2N3SA 1K28A 1F2LA 1BXTA 4G7OC 2A6HD 2XWBB 4DNRB 4LF4Q 3S16H 3H6MA 1KABA 1Z6HA 2E2DC 3PO2G 4DKAC 2XN9C 4X65L 1EY6A 3S1MH 1F77A 3M4PA 5BR8Q 4B08A 3HP3A 1KAAA 4GLAC 2E2IH 1VQGA 1V8QA 1E24A 4DU9A 1HXYD 2VS1A 1BCPF 4FP5D 1Y1VB 5DAUA 1HA5A 4X66L 2M00A 4FF4A 3I55A 2NVQH 3WOFA 1RODA 3T53B 4A3DG 2JA6G 1FGBD 4S3SA 4AQYL 4K8JA 2EYFA 1B53A 2FINB 4TRDA 3M7NA 1HNZQ 4CHTB 3BDLA 4A3GG 3TZDA 5LMUL 3H3VC 1VQMA 3CMEA 1X3EA 1WCMH 3TDQA 3CCRA 3L7ZC 3NPPA 1TS3A 1X3QA 2CFMA 2RSNA 5AFWA 4OELB 1SJHD 2B2WA 1OTCA 4A3BH 2IWHA 3HOYH 4FF3A 5EPKA 2LKVA 3GTPH 1MKHA 2O5JC 4DV3L 3I4OA 3RD4A 4X62L 4GOPA 3FDTA 3MA2B 2F0WA 3GTGH 2JQOA 3G6JB 4UDUC 1SNCA 3HOVG 4CKEA 3D0FA 1PFSA 1X32A 2N8NA 4TSSA 4JI3L 1D5MC 1PZKD 2Q2IA 1EZ6A 3I72A 1XPRA 1I4RA 1GUNA 2F0PA 4A3MG 1HZCA 3NQTA 4K5VA 4KKTA 1O7IA 1XMOQ 2EDGA 2K5WA 1VQNA 3ZJYC 2MGSA 2JK8A 3K5OA 3TP8A 1NAPA 3R3OA 2ZXOA 4N8X1 1GHKA 4ZKBB 3VYSA 4P75A 4GNXA 4EQPA 2NZHA 3J80c 1M90C 2C9OA 4JI5L 2QCPX 3PQIA 2WFWA 1AE3A 3KF6A 3H15A 3CRKC 3NTHA 5C4JB 4DV5L 1GHJA 3KUPA 4X6AH 2K03A 2XTIA 1YNJC 4RMFA 5FO8B 1C0AA 3K6OA 5M3FH 3VR4A 4BXXH 1TR5A 3P75A 1GUTA 3HKZE 5JAVA 2AUJD 2CH4A 4A3IH 2GA4B 3HOWG 1QCBD 1PRTB 4KHVA 4ZRZA 1LT3D 5C3XA 2E5LQ 2F1MA 4QUCA 4YWKA 1UE5A 1WYDA 4C3HH 1PHJA 3VDYA 1R4QB 2F0GA 4XQJA 4B3SL 3EVQA 4NXNQ 1FD7D 3K0XA 4IJLA 1A6XA 1A15A 3A54A 5KRUA 5A2QE 1NCVA 1ZYRC 4J8QA 3MFGA 4XT3B 2K4KA 1SNOA 5IGEA 2OWOA 2VQFL 3T51B 2R93B 1L1OC 3BZDB 3HFZB 2L15A 3BDOA 3G48A 1Y14B 2UUCQ 3X3MA 1EYGA 4OWTB 1F9QA 1SNQA 4IUNA 3KF8A 1YIJA 1KQSA 1G51A 4OX9Q 2EJMA 1K3RA 4POGA 2XGTA 1PTOF 1QWYA 1PYSB 2N49A 3GV6A 1B2TA 5DM63 3S14B 1RDPD 2JJQA 3PUVA 1XPOA 4WJWA 1HHVA 1VS0A 3GTJB 1I94L 1BCPB 4HMIA 2A68D 2ASBA 4KV6A 4DV1L 5C3WA 2PZWA 5G3LF 4DNIA 4A3DB 3NELA 4K5XA 1SDFA 4P74A 3I56A 4PZ6A 1S40A 2KENA 4BY1B 4A3GB 4CDFC 4OO1H 5JPNC 2K5DA 1VQIA 1K0RA 3RN2A 3ULLA 3OIQA 3STBC 5F2DA 1H9KA 3TS2A 1A3TA 5M3MH 5IYBH 4RFBA 3GTOB 1EY5A 4J15A 3S1NH 5CBAE 3M9BA 3GTKB 3KK7A 1WTQA 3W2DA 2RCFA 2BA1A 3Q24A 1LTRD 1DOMA 1V1OA 3CHBD 4JI6Q 3J81c 3K8AA 2Y0SG 2ZJPA 4BBRH 3EN2A 4HSVA 3C1EA 3LGJA 1Z47A 4A93G 3DEOA 3C1FA 2GN5A 2I07B 1CUKA 1WD1A 3I70A 3RNUA 1CFMA 2DNCA 2YV5A 3FVQA 1B4OA 3I2ZA 4XQQA 2AQ3B 2LXJA 2ZJQA 2OCEA 1KTKA 4K6LA 4C1NK 4RCOA 1S5BD 1ASZA 2VY3A 5IT9L 4DR2L 1QOHA 4A3KG 1QZHA 1D5ZC 5FLMG 3E9HA 1HFNA 1VF7A 4IFDH 5CR3A 2B8GA 2EYOA 2UU9L 3G7LA 2ZXPA 5E4XA 1VQ8A 3BDCA 1K83B 1STGA 3TSSA 4PMWA 1NUCA 1I4PA 1Y1WB 3CQZH 4ILWA 4POFA 3BVMA 1SYCA 4IZ8A 4OWWB 1TT2A 3NBHB 1YZ6A 5IGFA 1HR0L 3UDXA 3K57A 1EYCA 3OPOA 1LT6D 4OXPA 3KLSX 4X66Q 5LMNL 1XNQQ 1LT4D 1N32Q 1LUZA 1TIID 1D6EC 2RF4A 2FXQA 1TS4A 2EXZA 4DAYA 2B63H 4C2MH 4CDCC 3MFYA 2JA7G 4HIOA 4JOIA 4AQYQ 3T4AC 5AJ3L 1BQQT 2Z6KA 3M3YB 1T5EA 1PMRA 2CQAA 4N8FA 1PH4A 1NSNS 4L5QA 2R92H 2RKSA 3R93A 5LMUQ 1QNKA 5FOBB 1ICFB 2E75C 3M7GA 3H0GB 4R4IA 5IYDG 5D14A 3I4MG 1S3OA 4YCUA 1EWIA 4DGZA 1C4QA 3I3CA 3U50C 3S17B 2Z4HA 4ZKCB 4DV3Q 1Q8KA 1NBWA 4X62Q 1O80A 1W2BA 1TXYA 1BR9A 1ET6A 1ZKOA 3SDZA 3KDFA 3D6CA 2L5TA 4B9WA 1SE2A 3PIOA 3PIPA 5GROA 2M9VA 4OHJA 1DM0B 5D3DA 4JI3Q 5FLXE 1U5KA 4RG1A 3E9IA 1PTOB 3PO2H 2KUMA 1M8AA 2DN8A 4A75A 1ENFA 1V1PA 2NN6G 1Z7TA 2CH4W 3VYRA 3HRZC 1X65A 3O13A 2QF7A 2E74C 5JJIA 3IKJA 3GTLB 1YBYA 2F0OA 1XX8A 1QVGA 4AYBG 4GZYC 3FKIB 4C1NI 1EOTA 2RSOA 4O2DA 4JI8L 3J80L 4V190 1VQPA 3V05A 1VQ7A 4A3DH 1N34L 4JI5Q 1EIYB 2B2VC 2JA6H 1SSOA 3OW2A 3K5LA 1KLGD 1XJVA 3CXCA 1RIPA 5M5WB 4A3GH 4LF9L 2D2CC 5E7NA 4HJ7A 4DV5Q 2AMCB 1JQYD 4EQNA 2NVYH 2V4DA 4BA2I 2Q8TA 2I5MX 2NTTA 2X6GA 3KBXA 4HCEA 1EWCA 1JICA 2B2UC 4Q0FA 2PW7A 4B3SQ 4YCWA 1RTOA 1RHPA 1DONA 2JA8G 5FJ8G 2SNSA 1EIFA 4FXDA 1CKNA 1DZ1A 2QEXA 2G5DA 4ABNA 1LTGD 2RDGA 3S1MB 3HOVH 2LMCB 5ISRA 3BZKA 4H0LC 1YNJD 3SE0A 4JV5L 4NP5A 4O1NA 1U4LA 2E2IB 2TMPA 2VQFQ 4IOAA 2A74C 3U4VA 1KDBA 1UE1A 3MXGA 4KN4C 4LNQA 3EA6A 3F8TA 3TP7A 4PNYA 1WTOA 2G9DA 3RN5A 2PPBC 4A3MH 2NVQB 2OQKA 1WI5A 2SEBD 2ES2A 1I5FA 4LFAL 4YY3L 2QKIC 1SYBA 5CBEE 5KEEA 4HTHA 4FXKC 3TS0A 1R9TH 1EY7A 1HNXL 1HJPA 3HOXG 3DM3A 4GOPB 1N8RC 1ZYRD 5KGUA 2HHHL 3TP5A 1K83H 1VCIA 2BCOA 2F0HA 1IW7D 1W6JA 4DF7A 3SK6A 4NB3A 4IUQA 3MEFA 1I94Q 3ND9A 4A3BB 1BBWA 3I91A 4LFCQ 3UDIA 1TS2A 4DV1Q 4DAPA 2C5CA 1FNWA 4CJ1B 3RZOH 5C4HA 3CAMA 2XRSD 3GTGB 3KLSA 3HOWH 2E8GA 1XTCD 1EQRA 4CJ0B 1QUQB 3RZDB 1ASYA 1AEXA 5HY6A 1WJJA 1VDZA 2UXCL 4FO2A 2IHEA 5K36H 3I4MB 3ERSX 3W1GA 2F0SA 3KF6B 2EYMA 3J7AV 1HCZA 4OEMB 3H3VH 2CQOA 2EYLA 2I5HA 1SEBD 3S17H 2PYKA 3MXNB 2ZM6L 4R1JA 2JA5G 4LF5L 4GKKL 4RWSC 4DFAA 2AWNA 2BE5C 1KC8C 1UNSA 1GOZA 3EROA 4EQ5A 1WTXA 3DWAA 4JBKA 4WRDA 3STBD 2ID0A 3T1HL 2F0NA 1C8CA 1D1IA 1Q86C 2EOTA 2EJFC 1JORA 1PTOH 4EQOA 2CWAA 4KY6A 2K32A 5M3FB 1S5DD 2BOSA 2B63G 1J8IA 3D31A 2VZAA 1E0BA 1VF5C 3HOUG 1OXVA 1YHAA 2EIFA 2VQEQ 3QR8A 3TZUA 1BO0A 4C3HB 2UU9Q 3J7ZC 3D3RA 3QWNA 4KKUA 1EFWA 4L5RC 4DV6L 1XYIA 3KF8B 4ZQ3A 1STBA 4RHSA 1JB7A 5CGKA 1VMCA 5IIFA 5K5PA 3NTIA 1BNZA 4FF1A 5CV4A 1EYAA 1GKHA 3K7AH 1PFMA 2MPMA 3CCUA 1N36L 3ULJA 1PDQA 2PMZE 1Q1EA 3PUYA 2PW5A 1JJGA 3P7JA 4JI2L 2WAQG 2HDMA 4XXEA 1K73C 1IL2A 5AJ3Q 4RA8A 3BVZA 4DXGA 3AQQA 4HAEA 1PYWD 1PFBA 3K5NA 1I4XA 1X56A 3PO3G 5CV6A 4JI1L 5LL6S 1WTRA 2JA8B 5DEHA 1J5EL 3S15H 1BF4A 1B9NA 3J7A5 4HCSA 5IT9c 3CCEA 3RLFA 4ULLA 4FYDA 1HTPA 2AWOA 4JI4Q 3FP9A 5LL6X 2HDLA 3SEBA 5I6WA 2UUBQ 2K6AA 3K5MA 4HMJA 1EL0A 4A93H 1NMFA 1HA6A 2B29A 2IY5B 3K80C 1MI2A 4K8IA 2XNAC 3AU7A 3DWPA 4YWLA 2JA9A 4N9TA 4CGYB 3MC0B 2R7ZG 1PH1A 2HQLA 1IKLA 1HNWQ 4XT1B 3BYTB 4HEDA 1IYUA 1MGSA 4A3KH 2KCCA 3FRPB 4PV1C 5HURA 5FLMH 1IBKL 4LUOA 4CKCA 4A3JG 2BDOA 1JE5A 1SBBB 5J22A 3URYA 3Q22A 2OT2A 2OEOA 4DNTB 1JT8A 1F2ZA 2KJXA 1HUMA 1X3GA 1A0IA 2XRQD 1BVSA 2K5VA 1KNAA 5EKLA 4XYQA 5M3MB 1N9WA 2Z9HA 4IPCA 5IYCG 3FPPA 5FO7B 3X3NA 2ENBA 1Y69U 1YI2A 2VUMG 3S1NB 5I9PA 4DV4L 4TQUS 4F8MA 3OOCA 5C0XI 3SXHA 1IKMA 4KTAA 2VW9A 3GTMH 4JI8Q 1L1OA 4YHHL 4U673 1D1KA 2PNRC 4R8IA 1R4PB 1N34Q 3OTOL 1V43A 1Y8PB 2JA7H 5IP7G 3EJIA 5IGGA 5M5XH 2KBNA 4RGTA 4PG3A 4AH6A 4Y7NB 2MQHA 4BBRB 3PF5A 4YCVA 1X3FA 3RZDH 1C48A 2L12A 2O5IC 2A5HA 2VB2X 1Q1BA 5IYDH 4YIJA 4I7ZC 2JE6I 3OIPA 3I4MH 1MSHA 2F4IA 5J3BA 1PFNA 2NUCA 1MD2D 2EQSA 3CMAA 1I4QA 1WTVA 3QJYA 3SR1A 4V0BA 4NXML 4IFDJ 2JA5B 2JXMB 1ML0D 3AMUA 1YNND 1QB5D 1PYBA 4I7AA 4DAYB 5JJLA 4X3UA 1EYDA 4ME5A 3AYHB 1CZGA 1Q12A 1K8AC 5GADC 2UXBL 5DM73 3CQZB 3HS0C 1A3UA 2K28A 1LTAD 1XMQQ 4MNOA 1S5ED 4DAVA 1ILPA 1SMXA 4DK1A 3K59A 4HJ5A 2PMZB 4K5WA 4OL7A 3I73A 3VR2A 1IBLQ 3NEMA 4C3JG 2NN6H 4ZUJA 1KL9A 1ILQA 3RMHA 2B63B 3SHLA 4C2MB 3HEJA 4LFAQ 1AE2A 4YY3Q 3HOUB 5JEAJ 2E2JH 4A3FG 1HRJA 1NMGA 4IUPA 4P2CB 5A2QL 2F0DA 2RBMA 2R92B 1B9MA 3KDFB 2E2HH 4DV7Q 3IAYA 2L55A 5JOBA 1SRUA 5K36G 3BVGA 1WOCA 1TWGH 4R4OA 4ZK9B 4BS9A 2NB0A 2HUGA 2N78A 3MVVA 1WFQA 4JPBW 5C3EG 4HJ9A 4JYAL 1UEBA 3GDEA 2EZVA 1GD7A 4RAUC 3KLWA 4CBVA 1CSPA 1SE3A 1LV9A 1V1PB 2PCFB 1EWHA 2WINB 3HZXA 3NSWA 1JMCA 4BBSG 1IW7C 1KXLA 3K81C 1CQFA 1OXSC 2HIXA 1P8LA 2DJGC 1J9OA 4DPGA 4X64L 3PO3B 3ICEA 1LABA 5CYUA 3S2HH 1KDCA 2B2YC 1BOSA 2UXCQ 1QJOA 4L8JA 3J80i 3BS1A 2JA8H 5FJ8H 4B3TL 4R4TA 1CKOA 1KHIA 3PO2B 1B1ZA 1EQTA 3ONAB 1KD1C 4LFBL 4B3ML 4GN3B 2F0MA 2ZM6Q 4LF5Q 4KJOA 3N52A 3IRBA 4GKKQ 3DM1A 1PH7A 4DR6L 3SK4A 3TP6A 1KDAA 3AFPA 5E4WC 2RHSB 3PSIA 1STAA 2JA6B 3A8JE 1E2ZA 4RGNA 1EEID 4A3JB 1PXUA 3T1HQ 2MNAA 3W5OA 1NR4A 2XIWA 3T16A 3HOXH 5I4DA 3UDFA 2HQEA 2IHFA 3MZ5A 2EY5A 1CKNB 2YYZA 3QOJA 2D0OA 3HKSA 3B6YA 1UAPA 4QJFA 3I4NG 4K0KL 5IWAL 4QCLA 2NVYB 1EEFD 1OXXK 4WJ3M 1G8ZD 2NZ1D 2KHSA 2L4NA 3T1YL 1KIXA 1UE6A 2BE5D 2I5LX 3VA7A 3JAME 2ZTDA 1V9PA 4QMGA 1N33L 4C3IG 1DD2A 1JB3A 2N55A 4HIDA 4WORA 4BA1I 4WJ4A 3PGZA 1X54A 4LUZA 3HOVB 2K5QA 4Y7NH 4IURA 1A2TA 3WWVA 1N36Q 1P16A 1F9RA 2DNEA 3BZCA 4JI2Q 3AB9A 4ZYSA 4A3MB 5M5YB 2OTLA 1E2WA 1UEAB 1QVFA 5EBCA 4DR3L 2JA5H 2WV6D 5C4XG 1GO3E 1R9TB 1XNRL 4BY7G 2Z6BA 4LWCA 1L0WA 1AN8A 4XTCS 3Q6SA 1H9JA 4PQXA 4X65Q 3RLNA 2KHJA 2B2VA 3M4OH 2K75A 1AH9A 1F9SA 4FDBA 1LO5D 2PZTA 2Y0SE 1TQOA 4JVZA 4IN3A 3FHWA 4GN4B 1STHA 5KYLA 4C3JB 1SFOB 1SYDA 2RCNA 3RZOB 4IOCA 1JJCB 2BDNA 3D6WA 4JI7L 4LF6L 3HOWB 5JJKA 2NBFA 3F2BA 3VR6A 5JVG3 2KEEA 3HOUH 2X6LA 2B2UA 1IBKQ 2RA4A 1VQFA 1FVIA 4DR4L 1HFGA 2JEAI 1DOLA 3J81i 4JI0L 1HR0W 5FO9B 2NYZD 2FJ2A 5ELEA 3NTKA 5LMNW 1GJXA 1YHBA 5C0XJ 4TKOB 2EYPA 4UP8A 5I2XA 4M8AA 5FK9C 4HJAA 3A7LA 5C3EB 5EKIA 4DR1L 1CK1A 2A6EC 4KN7C 3BG3A 5I9OA 2FFKB 1EZ8A 1SE4A 5J1ZA 3ULPA 2WIIB 2MUYA 3A8KE 3A0JA 1EQQA 1J6QA 2OF1A 5E1FA 3NBIA 2AUKA 4RGMA 4QY7A 5JJZA 1RTNA 4UPAA 4Z9CB 3PO3H 1CQVA 4KD3A 4A4IA 2IJ0A 1Q81C 2NTSA 1NNXA 3U9OA 3F2UA 4NW2A 2L1BA 4OO1I 1T5XD 3CC7A 2SNMA 3QG1A 3UE1A 4Q5VA 1O7LA 4DV2L 3K0YA 4JBWA 4JBMA 3A8IE 1VQLA 3VYUA 4YWMA 1HQMC 1ENAA 2B3GA 4GKJL 4R4QA 1Y8OB 1A63A 2R7ZH 1KNEA 3NE5B 1IBML 2UXBQ 3IFTA 1DCZA 4P71A 4DK0A 1YNNC 4KLKA 1K0SA 1IL8A 2EXDA 4A3JH 4UHVA 1TWCB 1VQAA 1Z9FA 5CORA 4MTNA 1TU2B 3K7AB 4IJHA 2D5DA 4LF8L 1I50H 2AKWB 3FMCA 1LTLA 5IGBA 3F2CA 2F4VL 1IYVA 5M9OA 4A3CG 5IYCH 3TEHB 1AZPA 1W6KA 2Z1CA 2VUMH 2MJ8A 2WP8J 3U58A 1PZJD 4CJ2C 3F1ZA 4C3IB 1SYGA 1MSGA 3S15B 4AYBE 4DUYL 3HOZG 1MIUA 3MXPA 1VQEA 1PH6A 3E0EA 2ZTEA 5IP7H 1CHPD 1HZ9A 4IFDI 1MJEA 3J80E 4OGQC 2F3VA 4DV0L 2Y0SB 1YITA 1IZ6A 2KCMA 5DNFA 4A93B 2PO4A 3DUZA 3PMFA 1EY0A 1IHZA 3VR5A 3CC4A 2DJFC 3I8ZA 1Q46A 1QE6A 1BUVT 1PLFA 3A74A 1XMOL 3V96A 1F2MA 4X64Q 1LM0A 1LTID 1STEA 2M2LA 5M5YH 1TKWB 4H7BA 4A3KB 1AZQA 4B3TQ 1G91A 5EPJA 4G57A 1GUSA 4O42A 3CC2A 4OIKA 1PH8A 4G4KA 4LFBQ 4B3MQ 1M1KC 3S9WA 4B9XA 2PZUA 1HTLD 5LHY1 1CT1D 3CU7A 1PRTC 3OWEB 1HZBA 1Y1VG 1BBUA 4H02A 4CDDC 1BBXC 4DR6Q 4UP7A 1EUJA 3GTMB 4MIUA 4C3JH 1FR3A 1SFOH 3L3OC 2E5LL 5CV7A 2JA7B 2DGYA 4A3FH 5M5XB 1B7YB 1I3QB 1I4HA 1VMPA 1O7ZA 1D7QA 3NWTA 1YEZA 3V2TA 3WOEA 4QL5A 2UUAL 4IPGA 1EY9A 1MBYA 1TWHB 2V1CC 2H4OA 5CV5A 4K0KQ 2F0LA 4J6HA 4GNXB 3DMUA 3CRLC 4JBJA 1NJIC 1U0LA 4EVOA 1SMYC 1SXTA 3MHBA 3MWYW 3T1YQ 4QF4A 5C3EH 3TBIB 2R7FA 1L0YB 3A56A 2D62A 2NVXH 2WB1G 2UUCL 1IXRA 2O2LD 1N33Q 2A73B 2I46A 4BBSH 1MJCA 3NK9A 3KFUA 1PH5A 3IFDA 3ITPA 1G291 3NBHA 4R4CA 2F0QA 1U4RA 4KY5A 1W3SA 1CM9A 4OX9L 2NZOA 4IPHA 2J4XA 3DHQA 3OHXC 2K05A 4FNFA 1BCPC 4XQNA 4RKBA 4AIMA 1JJ2A 1EU3A 3H09A 4C56C 3JAMc 2C35B 4LMQD 3NP8A 2E2JB 1TWAH 3PUWA 4DR3Q 3CP0A 2CW0C 4DR2Q 1XNRQ 3EQLC 1UUPA 3EFXD 4AYBB 2IX3A 1WTHA 2F0TA 5EQ0A 2IX1A 1SNDA 2E2HB 2D0PA 4I65A 3F2DA 1E1OA 3KBGA 3UDGA 4G7ZC 2EY2A 3GD7A 3R8BA 1JC7A 4JK1C 3S1RB 3I4LA 2JYOA 4Y52H 5D65A 3VYTA 4KJNA 4MHEA 1QVCA 1B3QA 3J81E 3U9SA 1TWGB 5L37A 1LACA 1HR0Q 3C3LA 4A3EG 1CA5A 1EIGA 1TWCH 5LMNQ 1FJGL 4ZUIA 3I4NH 4JC0A 3KJOA 2MP1A 3L9AX 2IX0A 4EGVA 4E6IA 3J7AF 1JWSD 4JI7Q 4LF6Q 2LY7A 4HR7B 3S1QH 5JEAG 1BKBA 3S2HB 2K14A 4QUFA 3LNNA 1SYFA 2F3IA 1A2UA 2JEBI 5IODA 1YJNA 3PV0A 1Q7YC 4DR4Q 1H95A 2CVRA 4JI0Q 3HOZB 1U4MA 5KNDA 4JI6L 1EQVA 4C3IH 2RDFA 4K2KA 3W3AA 1CA6A 2L9HA 1O78A 5ELNA 1VQBA 2CHBD 1X3PA 1K9MC 2R93G 2B2TC 3RUZA 4HJ8A 2K1BA 3SGIA 2KVMA 2YTYA 4LJZC 4PZ8A 4P73A 3HG9A 1LTSD 2E76C 2WAQE 5E3FA 4P72A 1F2YA 1H9SA 2F0VA 2XVSA 2PQAA 3A55A 1RL2A 5IGCA 1EIHA 3T56B 5C4XH 1U4PA 2R3ZA 3HOXB 3A5ZB 4BY7H 2CWPA 5IOCA 1L2FA 3LX0A 1G6PA 1DJRD 1S4ZA 1JOKA 4RHRA 3DXJC 2ALYB 2A6ED 5BN3A 3PIO3 4OIJA 3PIP3 4DV2Q 1AW7A 1XNQL 2LSSA 1N32L 2QW7A 4KKSA 3E6ZX 4DK6C 1SAPA 4GKJQ 2IL8A 3H3VI 5C5LA 3C46A 1IBMQ 3Q8DA 3MEHA 2HCIA 2Q8IB 1WVLA 2OXPA 1S5CD 1E7ZA 4PZ7A 2K7VA 4BY1G 3OYYA 1STNA 4UY8C 1H9RA 4KK7A 5FLXc 1K8GA 1OXUA 5D3IB 2B2YA 2QA4A 1I3QH 4KMUC 3CCVA 1SYEA 5DLQE 1BDOA 4LF9Q 2HT1A 4LF8Q 4F88A 4LF7L 1NY4A 3WDNA 1TWHH 1O7YA 1E1TA 1ZEQX 3RLOA 2F4VQ 1EY4A 5KNBA 3E0JA 3AFQA 1PH3A 1XTDA 4K2LA 2GVBA 4KHPL 5IP9G 2AHOB 4R9WA 3K7UC 1FNUA 4A3LG 2WB1B 3QOLA 1FL0A 1TY2A 1B3AA 5C44G 1KRTA 4DUYQ 1PTOC 2CKZB 4HIKA 3N6RA 5CV8A 2Q2TA 5EJWA 5CC4A 1VQCA 4DV0Q 2ZXRA 3L0OA 3M4OB 2VNUD 4CDEC 2K50A 4NKLA 2EYJA 4JV5Q 4GS3A 2KCNA 3CKIB 5ELCA 3HKZG 3UI2A 4ID6A 3CF5A 4H13C 4MZ9A 3ERQA 2K33A 4HIMA 2FMMA 2MO1A 2UXDL 2SOBA 2QGQA 3T13A 1U9RA 1QUQA 1M4VA 3GTQB 3QB3A 3HGBA 5J39A 3H94A 1HNXQ 4DR5L 4NDXA 1Y1WG 2WACA 2HHHQ
chains in the Genus database with same CATH topology
2KHJA 1V1QA 3HOVH 3M4OH 3S24A 3S1RH 3BZKA 3KJPA 2Q2UA 1VQ9A 5M5WH 2K75A 2K5NA 1HZAA 4LW1A 2KHIA 4JV5L 1AH9A 4FDBA 2Y0SE 4JG2A 5HGQA 1SE8A 2VQFQ 3FHWA 4IOAA 4GN4B 4DR1Q 4O0AA 3W1BA 3U4VA 2F52A 4QQBX 2GVAA 3JAMi 3CD6A 4A76A 2RCNA 1QZGA 1UE1A 4DR7Q 4LNQA 3F8TA 2MFIA 4IOCA 3RN5A 1JJCB 4A3MH 2N3SA 2OQKA 1OXTA 1EOVA 1WI5A 2ES2A 4JI7L 4LF6L 4A3CH 1I5FA 4LFAL 4YY3L 5JJKA 3F2BA 3HOUH 1IBKQ 4OWXB 5EAYA 3TS0A 1R9TH 1VQFA 4LF4Q 1HNXL 1HJPA 1FVIA 3DM3A 3HOXG 4GOPB 3S16H 2UUAQ 4DR4L 2JEAI 3JC66 4DKAC 3J81i 1N8RC 3H0GG 1XPUA 4JI0L 3PO2G 3EIVA 1HR0W 3HOZH 2HHHL 4DAMA 4L5TA 4X65L 1K83H 3S1MH 1VCIA 5LMNW 1YHBA 5C0XG 5C0XJ 3I7FA 4UP8A 3M4PA 5BR8Q 4HJAA 4GLAC 3KYHC 4NB3A 4XIGS 1VQGA 2E2IH 3MEFA 1I94Q 4DR1L 1E24A 4KI0A 1CKMA 1S72A 1BBWA 1PH2A 4LFCQ 2VS1A 3UDIA 4DV1Q 4X66L 3ULPA 4GOPC 3I55A 2NVQH 3RZOH 2OTJA 3CAMA 3A0JA 1EQQA 4A3DG 1J6QA 1B8AA 1D8LA 3HOWH 2JA6G 2E8GA 4QY7A 4AQYL 4UPAA 3AEVA 1EQRA 3PO3H 1QUQB 3M7NA 4A4IA 1ASYA 3CPFA 1HNZQ 1Q81C 4A3GG 5LMUL 1A62A 5HY6A 1WJJA 4DUZL 2UXCL 3J81j 2IHEA 1VQOA 1VQMA 3CMEA 2A1AA 1X3EA 3ERSX 4OO1I 1WCMH 3W1GA 3L2PA 3KF6B 3CCRA 4B3RL 3L7ZC 3CC7A 2CFMA 3H3VH 3UE1A 1OTCA 4DV2L 4JBMA 2CQOA 4JBWA 4LFCL 2I5HA 3HOYH 4A3BH 3FKIG 3GTPH 1HH2P 1Y1VH 1MKHA 3MXNB 4R1JA 2ZM6L 1PV4A 4DV3L 1VQLA 2JA5G 4LF5L 3I4OA 3G4SA 4GKKL 4YWMA 4X62L 2AWNA 4GOPA 2B3GA 4GKJL 4R4QA 4GNXC 3GTGH 2JQOA 1KC8C 2R7ZH 1A63A 1IBML 4JCVE 4IPDA 1VQDA 2UXBQ 4DV6Q 3HOVG 4P71A 4EQ5A 4KLKA 3D0FA 4JBKA 1PFSA 3STBD 2ID0A 3T1HL 2EXDA 4A3JH 2N8NA 1Q86C 4JI3L 2Q2IA 1VQAA 1Z9FA 1VQ4A 4MTNA 1FJGQ 4IJHA 5GQOA 2A8VA 2CWAA 4LF8L 1YHQA 1XPRA 1I50H 1NE3A 2AKWB 4A3MG 1LTLA 1A8VA 1HZCA 2PI2A 3F2CA 2F4VL 1O7IA 5IYCH 1XMOQ 3D31A 2VZAA 2B63G 3TEHB 4A3CG 1VQNA 3ZJYC 2VUMH 3HOUG 1OXVA 1Q82C 1YHAA 2NN6I 2WP8J 2EIFA 1UWVA 2JK8A 2VQEQ 4IO9A 3U58A 4JI1Q 3S17H 2UU9Q 1E22A 3J7ZC 3F1ZA 1J5EQ 2YTXA 4AYBE 4DUYL 3HOZG 1MIUA 4P75A 1DGSA 4GNXA 1EFWA 1VQEA 4DV6L 4QGUA 2NZHA 2Z0SA 3E0EA 1PH6A 3J80c 4L5RC 2ZTEA 1M90C 5IP7H 1HZ9A 4IFDI 2YTVA 3KF8B 4JI5L 1MJEA 3CW2C 1T9HA 3CCLA 1JB7A 2WFWA 1AE3A 4DV0L 3KF6A 1NTGA 3H15A 1YITA 1IZ6A 2KCMA 1GKHA 3K7AH 4DV5L 3CCUA 3CC4A 4X6AH 2XTIA 4RMFA 3ULJA 1N36L 1Q46A 1YNXA 2PMZE 1Q1EA 1C0AA 3PUYA 5M3FH 1JJGA 4BXXH 4JI2L 2WAQG 1K73C 3HKZE 3A74A 1IL2A 1XMOL 4A3IH 5AJ3Q 5IY0A 4X64Q 3HOWG 1LM0A 3A5UA 2H5XA 3AQQA 2E5LQ 1X56A 2VQEL 4YWKA 1UE5A 3PO3G 4JI1L 1WYDA 5M5YH 4C3HH 1PHJA 3VDYA 1J5EL 3S15H 4B3TQ 3GTQH 4B3SL 3J7A5 1C9OA 4NXNQ 5IT9c 3CCEA 2R7DA 3RLFA 3CC2A 1PH8A 2AWOA 4JI4Q 1WCMG 3K0XA 4B3MQ 4IJLA 1M1KC 4LFBQ 2CCZA 3FP9A 2UUBQ 2K4KA 4A3BG 5C4JH 4A93H 2K52A 2OWOA 3HOYG 1NMFA 1HZBA 1Y1VG 1BBUA 1X55A 4H02A 2B29A 3TRZA 4A3EH 2VQFL 4DV4Q 2IY5B 4DR6Q 4UP7A 1L1OC 3K80C 3HFZB 2L15A 1EUJA 3G48A 1Y14B 4C3JH 4YWLA 2JA9A 1SFOH 2UUCQ 4YHHQ 4DR7L 2R7ZG 1PH1A 1EYGA 2E5LL 3PO2H 2HQLA 4OWTB 1HNWQ 3OTOQ 2DGYA 4A3FH 3PUZA 4A3KH 1B7YB 1YIJA 1KQSA 1G51A 5FLMH 1IBKL 1D7QA 4OX9Q 1K3RA 4EX5A 4LF4L 1YEZA 4LUOA 1SLJA 4A3JG 4POGA 1JE5A 2XGTA 4QL5A 3CPWA 2UUAL 4IPGA 1PYSB 5GAEC 4LF7Q 2N49A 2V1CC 4JI4L 1JT8A 4K0KQ 3DLLA 3M85A 1X3GA 2JJQA 1A0IA 4GNXB 3PUVA 1BVSA 2K5VA 4JBJA 1NJIC 2UUBL 1U0LA 1XPOA 1N9WA 3T1YQ 4IPCA 4QIWE 5IYCG 4KHPQ 5BR8L 4GN5A 5C3EH 1YI2A 1VS0A 2R7FA 4DV4L 4TQUS 4NXMQ 1I94L 2VUMG 3PF4A 5C0XI 2R93H 2VW9A 3GTMH 2D62A 4JI8Q 1KXLA 2ASBA 1L1OA 2WB1G 4YHHL 1IXRA 4DV1L 2NVXH 2UUCL 1N33Q 4DNIA 4BBSH 3NELA 1MJCA 4P74A 1N34Q 3I56A 3KFUA 1PH5A 3OTOL 1V43A 1HNWL 1G291 4PZ6A 5IP7G 2JA7H 1LYLA 3EBEA 4R4CA 5M5XH 2KBNA 4PG3A 1S40A 2YU9H 1W3SA 2KENA 4OX9L 4AH6A 2NZOA 2MQHA 4IPHA 3PF5A 4YCVA 1IYJB 1X3FA 3PUXA 1HNZL 3RZDH 1VQIA 3S2DH 1K0RA 3RN2A 3S14H 3ULLA 1Q1BA 5IYDH 4AIMA 3STBC 5M3FG 1JJ2A 3TS2A 2JE6I 3I4MH 5M3MH 5IYBH 4BXXG 5J3BA 4A3IG 1C7YA 2UXDQ 2EQSA 3CCJA 3CMAA 3JAMc 2C35B 4J15A 5ELOA 4L5SA 2BH2A 4NXML 3S1NH 3GTJH 4IFDJ 1TWAH 3PUWA 3TQYA 4DR3Q 3M9BA 3CP0A 4DR2Q 1XNRQ 2I0QA 2BA1A 4DAYB 1PYBA 3KOJA 5JJLA 4DR5Q 2IX1A 4NPSA 3AYHB 4JI6Q 2D0PA 3F2DA 1CSQA 1E1OA 3UDGA 3J81c 1Q12A 3G71A 3GD7A 1K8AC 3K8AA 5GADC 2Y0SG 4BY1H 2ZJPA 2UXBL 2PQAB 4Y52H 4BBRH 1XMQQ 1VQ5A 1QVCA 3EN2A 3U4ZA 3LGJA 1Z47A 4MNOA 4ALPA 4A93G 2HIVA 2GN5A 1CUKA 1HR0Q 1SMXA 3RNUA 1B70B 4HJ5A 4A3EG 1YJ9A 1TWCH 2YV5A 4JYAQ 1IBLQ 5LMNQ 1FJGL 3NEMA 3I4NH 3I2ZA 4JC0A 3KJOA 2LXJA 2IX0A 2ZJQA 3GTOH 2OCEA 1KL9A 4JOIC 4JI7Q 4LF6Q 1SN8A 4LFAQ 1AE2A 2Z6KC 4YY3Q 3S1QH 5JEAG 1BKBA 5JEAJ 2E2JH 5IP9H 4A3FG 1ASZA 2VY3A 4A3KG 4DR2L 1NMGA 3GTKH 1I6HH 1X9NA 2K14A 1QZHA 2F3IA 5FLMG 2JEBI 3E9HA 1YJNA 1Q7YC 3PV0A 4DR4Q 4A3LH 1H95A 4JI0Q 5C44H 2UU9L 1PA6A 1VQ8A 4JI6L 1L1OB 3KDFB 4C3IH 2E2HH 3GO5A 4DV7Q 4PMWA 3CQZH 4POFA 1XMQL 1SRUA 4OWWB 5K36G 3NBHB 1GVPA 1WOCA 1TWGH 3CCSA 1YZ6A 4R4OA 1HR0L 3UDXA 3RR5A 2N78A 5ELNA 5C3EG 1WFQA 1VQBA 4HJ9A 4JYAL 1UEBA 3GDEA 3NENA 5LMNL 4OXPA 1IBLL 1GD7A 4X66Q 1K9MC 1XNQQ 2R93G 3KLWA 1N32Q 1LUZA 3TREA 1CSPA 2RF4A 1JMCA 2FXQA 2B63H 4BBSG 4HJ8A 4C2MH 3K81C 1FGUA 1KAWA 2VL6A 1OXSC 2HIXA 3SGIA 1P8LA 2YTYA 2ZTCA 5H1SE 4HIOA 2JA7G 4JOIA 4PZ8A 4AQYQ 1YVCA 2DUDA 2Z6KA 2A19A 4P73A 4DPGA 2WAQE 4X64L 5AJ3L 3ICEA 3S2HH 4P72A 1PH4A 2PQAA 4L5QA 2R92H 4OO1G 1RL2A 3G6EA 5LMUQ 5C4XH 2ATWA 4KHZA 4DUZQ 3J80i 2UXCQ 2JA8H 5FJ8H 4B3TL 3A5ZB 4R4TA 1CKOA 1UE7A 1KHIA 4DV7L 1TWFH 4BY7H 4NXNL 2CWPA 4R4IA 1L2FA 5IYDG 5GAGC 1E3PA 1Y1WH 1VQ6A 1G6PA 1KD1C 3I4MG 1S3OA 5M3MG 4YCUA 5IYBG 4B3ML 2ALYB 4B3RQ 4LFBL 1EWIA 5IWAQ 3ER0A 4GN3B 4DV2Q 3U50C 1XNQL 2ZM6Q 4LF5Q 2LSSA 1N32L 4DV3Q 3CCQA 2OQ0A 1Q8KA 3IRBA 4GKKQ 1NBWA 4X62Q 4DK6C 1W2BA 1PH7A 4DR6L 4GKJQ 3H3VI 1PH9A 1TXYA 3Q8DA 1IBMQ 4UP9A 3KDFA 2KCTA 3AFPA 2RHSB 2PI2E 3M3YH 3PSIA 4TVAB 1E7ZA 4PZ7A 4BY1G 3OYYA 3PIOA 4BBRG 4UY8C 3PIPA 5FLXc 3CCMA 1K8GA 3BJUA 5GROA 1OXUA 3T1HQ 2QA4A 2MNAA 4JI3Q 1I3QH 3W5OA 3HOXH 1U5KA 3CCVA 4RG1A 3E9IA 3BU2A 5DLQE 3UDFA 2IHFA 2YYZA 4LF9Q 3H0GH 1CKNB 4ME3A 2HT1A 2D0OA 3HKSA 4LF8Q 3B6YA 4LF7L 4QJFA 1NY4A 3I4NG 1TWHH 5IE8A 4K0KL 1SROA 5IWAL 1E1TA 3RLOA 4A75A 2NN6G 1OXXK 2F4VQ 5GAHC 1YJWA 4WJ3M 2R6GA 2NVTH 3AFQA 1PH3A 1XTDA 3T1YL 1X65A 2GVBA 2K5HA 5JJIA 4KHPL 1KRSA 5IP9G 1KIXA 1PVOA 2AHOB 1VQJA 1YBYA 2RHQB 3K7UC 1QVGA 1UE6A 4AYBG 4A3LG 4GLXA 1FL0A 4IFDG 2I5LX 2BA0A 2ZTDA 1SR3A 4O2DA 1KRTA 4JI8L 1V9PA 5C44G 4DUYQ 4LUVA 1N33L 2CKZB 1VQPA 1VQ7A 4HIDA 4A3DH 4HIKA 1N34L 4JI5Q 2WB1E 4BA1I 1EIYB 2JA6H 3OW2A 2Q2TA 4DV0Q 1VQCA 3PGZA 1GM5A 4WJ4A 3M4QA 3L0OA 2ZJRA 1X54A 4LUZA 1XJVA 2VNUD 2LXKA 4OONA 3CXCA 2K50A 1RIPA 4Y7NH 4A3GH 4LF9L 5E7NA 4HJ7A 4JV5Q 4GS3A 4DV5Q 2AMCB 3WWVA 4GLVB 2IT1A 1N36Q 3HKZG 1P16A 2Q2HA 3BZCA 4DK3C 2NVYH 2BH8A 4JI2Q 3UE0A 4BA2I 1X6OA 4APVA 3CF5A 4MZ9A 2I5MX 4HIMA 2UXDL 1VQHA 2MO1A 2QGQA 3GTLH 1QUQA 2OTLA 3PCOB 1QVFA 3FKIH 2R92G 2MO0A 4DR3L 2JA5H 4B3SQ 4YCWA 5C4XG 1GO3E 1XNRL 2JA8G 5FJ8G 1HNXQ 1EIFA 4DR5L 4BY7G 1VQKA 1Y1WG 1CKNA 4LWCA 1L0WA 2QEXA 2PNHA 4XTCS 2HHHQ 4X65Q 3RLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHJ A;  1V1Q A;  3HOV H;  3M4O H;  3S24 A;  3S1R H;  3BZK A;  3KJP A;  2Q2U A;  1VQ9 A;  5M5W H;  2K75 A;  2K5N A;  1HZA A;  4LW1 A;  2KHI A;  4JV5 L;  1AH9 A;  4FDB A;  2Y0S E;  4JG2 A;  5HGQ A;  1SE8 A;  2VQF Q;  3FHW A;  4IOA A;  4GN4 B;  4DR1 Q;  4O0A A;  3W1B A;  3U4V A;  2F52 A;  4QQB X;  2GVA A;  3JAM i;  3CD6 A;  4A76 A;  2RCN A;  1QZG A;  1UE1 A;  4DR7 Q;  4LNQ A;  3F8T A;  2MFI A;  4IOC A;  3RN5 A;  1JJC B;  4A3M H;  2N3S A;  2OQK A;  1OXT A;  1EOV A;  1WI5 A;  2ES2 A;  4JI7 L;  4LF6 L;  4A3C H;  1I5F A;  4LFA L;  4YY3 L;  5JJK A;  3F2B A;  3HOU H;  1IBK Q;  4OWX B;  5EAY A;  3TS0 A;  1R9T H;  1VQF A;  4LF4 Q;  1HNX L;  1HJP A;  1FVI A;  3DM3 A;  3HOX G;  4GOP B;  3S16 H;  2UUA Q;  4DR4 L;  2JEA I;  3JC6 6;  4DKA C;  3J81 i;  1N8R C;  3H0G G;  1XPU A;  4JI0 L;  3PO2 G;  3EIV A;  1HR0 W;  3HOZ H;  2HHH L;  4DAM A;  4L5T A;  4X65 L;  1K83 H;  3S1M H;  1VCI A;  5LMN W;  1YHB A;  5C0X G;  5C0X J;  3I7F A;  4UP8 A;  3M4P A;  5BR8 Q;  4HJA A;  4GLA C;  3KYH C;  4NB3 A;  4XIG S;  1VQG A;  2E2I H;  3MEF A;  1I94 Q;  4DR1 L;  1E24 A;  4KI0 A;  1CKM A;  1S72 A;  1BBW A;  1PH2 A;  4LFC Q;  2VS1 A;  3UDI A;  4DV1 Q;  4X66 L;  3ULP A;  4GOP C;  3I55 A;  2NVQ H;  3RZO H;  2OTJ A;  3CAM A;  3A0J A;  1EQQ A;  4A3D G;  1J6Q A;  1B8A A;  1D8L A;  3HOW H;  2JA6 G;  2E8G A;  4QY7 A;  4AQY L;  4UPA A;  3AEV A;  1EQR A;  3PO3 H;  1QUQ B;  3M7N A;  4A4I A;  1ASY A;  3CPF A;  1HNZ Q;  1Q81 C;  4A3G G;  5LMU L;  1A62 A;  5HY6 A;  1WJJ A;  4DUZ L;  2UXC L;  3J81 j;  2IHE A;  1VQO A;  1VQM A;  3CME A;  2A1A A;  1X3E A;  3ERS X;  4OO1 I;  1WCM H;  3W1G A;  3L2P A;  3KF6 B;  3CCR A;  4B3R L;  3L7Z C;  3CC7 A;  2CFM A;  3H3V H;  3UE1 A;  1OTC A;  4DV2 L;  4JBM A;  2CQO A;  4JBW A;  4LFC L;  2I5H A;  3HOY H;  4A3B H;  3FKI G;  3GTP H;  1HH2 P;  1Y1V H;  1MKH A;  3MXN B;  4R1J A;  2ZM6 L;  1PV4 A;  4DV3 L;  1VQL A;  2JA5 G;  4LF5 L;  3I4O A;  3G4S A;  4GKK L;  4YWM A;  4X62 L;  2AWN A;  4GOP A;  2B3G A;  4GKJ L;  4R4Q A;  4GNX C;  3GTG H;  2JQO A;  1KC8 C;  2R7Z H;  1A63 A;  1IBM L;  4JCV E;  4IPD A;  1VQD A;  2UXB Q;  4DV6 Q;  3HOV G;  4P71 A;  4EQ5 A;  4KLK A;  3D0F A;  4JBK A;  1PFS A;  3STB D;  2ID0 A;  3T1H L;  2EXD A;  4A3J H;  2N8N A;  1Q86 C;  4JI3 L;  2Q2I A;  1VQA A;  1Z9F A;  1VQ4 A;  4MTN A;  1FJG Q;  4IJH A;  5GQO A;  2A8V A;  2CWA A;  4LF8 L;  1YHQ A;  1XPR A;  1I50 H;  1NE3 A;  2AKW B;  4A3M G;  1LTL A;  1A8V A;  1HZC A;  2PI2 A;  3F2C A;  2F4V L;  1O7I A;  5IYC H;  1XMO Q;  3D31 A;  2VZA A;  2B63 G;  3TEH B;  4A3C G;  1VQN A;  3ZJY C;  2VUM H;  3HOU G;  1OXV A;  1Q82 C;  1YHA A;  2NN6 I;  2WP8 J;  2EIF A;  1UWV A;  2JK8 A;  2VQE Q;  4IO9 A;  3U58 A;  4JI1 Q;  3S17 H;  2UU9 Q;  1E22 A;  3J7Z C;  3F1Z A;  1J5E Q;  2YTX A;  4AYB E;  4DUY L;  3HOZ G;  1MIU A;  4P75 A;  1DGS A;  4GNX A;  1EFW A;  1VQE A;  4DV6 L;  4QGU A;  2NZH A;  2Z0S A;  3E0E A;  1PH6 A;  3J80 c;  4L5R C;  2ZTE A;  1M90 C;  5IP7 H;  1HZ9 A;  4IFD I;  2YTV A;  3KF8 B;  4JI5 L;  1MJE A;  3CW2 C;  1T9H A;  3CCL A;  1JB7 A;  2WFW A;  1AE3 A;  4DV0 L;  3KF6 A;  1NTG A;  3H15 A;  1YIT A;  1IZ6 A;  2KCM A;  1GKH A;  3K7A H;  4DV5 L;  3CCU A;  3CC4 A;  4X6A H;  2XTI A;  4RMF A;  3ULJ A;  1N36 L;  1Q46 A;  1YNX A;  2PMZ E;  1Q1E A;  1C0A A;  3PUY A;  5M3F H;  1JJG A;  4BXX H;  4JI2 L;  2WAQ G;  1K73 C;  3HKZ E;  3A74 A;  1IL2 A;  1XMO L;  4A3I H;  5AJ3 Q;  5IY0 A;  4X64 Q;  3HOW G;  1LM0 A;  3A5U A;  2H5X A;  3AQQ A;  2E5L Q;  1X56 A;  2VQE L;  4YWK A;  1UE5 A;  3PO3 G;  4JI1 L;  1WYD A;  5M5Y H;  4C3H H;  1PHJ A;  3VDY A;  1J5E L;  3S15 H;  4B3T Q;  3GTQ H;  4B3S L;  3J7A 5;  1C9O A;  4NXN Q;  5IT9 c;  3CCE A;  2R7D A;  3RLF A;  3CC2 A;  1PH8 A;  2AWO A;  4JI4 Q;  1WCM G;  3K0X A;  4B3M Q;  4IJL A;  1M1K C;  4LFB Q;  2CCZ A;  3FP9 A;  2UUB Q;  2K4K A;  4A3B G;  5C4J H;  4A93 H;  2K52 A;  2OWO A;  3HOY G;  1NMF A;  1HZB A;  1Y1V G;  1BBU A;  1X55 A;  4H02 A;  2B29 A;  3TRZ A;  4A3E H;  2VQF L;  4DV4 Q;  2IY5 B;  4DR6 Q;  4UP7 A;  1L1O C;  3K80 C;  3HFZ B;  2L15 A;  1EUJ A;  3G48 A;  1Y14 B;  4C3J H;  4YWL A;  2JA9 A;  1SFO H;  2UUC Q;  4YHH Q;  4DR7 L;  2R7Z G;  1PH1 A;  1EYG A;  2E5L L;  3PO2 H;  2HQL A;  4OWT B;  1HNW Q;  3OTO Q;  2DGY A;  4A3F H;  3PUZ A;  4A3K H;  1B7Y B;  1YIJ A;  1KQS A;  1G51 A;  5FLM H;  1IBK L;  1D7Q A;  4OX9 Q;  1K3R A;  4EX5 A;  4LF4 L;  1YEZ A;  4LUO A;  1SLJ A;  4A3J G;  4POG A;  1JE5 A;  2XGT A;  4QL5 A;  3CPW A;  2UUA L;  4IPG A;  1PYS B;  5GAE C;  4LF7 Q;  2N49 A;  2V1C C;  4JI4 L;  1JT8 A;  4K0K Q;  3DLL A;  3M85 A;  1X3G A;  2JJQ A;  1A0I A;  4GNX B;  3PUV A;  1BVS A;  2K5V A;  4JBJ A;  1NJI C;  2UUB L;  1U0L A;  1XPO A;  1N9W A;  3T1Y Q;  4IPC A;  4QIW E;  5IYC G;  4KHP Q;  5BR8 L;  4GN5 A;  5C3E H;  1YI2 A;  1VS0 A;  2R7F A;  4DV4 L;  4TQU S;  4NXM Q;  1I94 L;  2VUM G;  3PF4 A;  5C0X I;  2R93 H;  2VW9 A;  3GTM H;  2D62 A;  4JI8 Q;  1KXL A;  2ASB A;  1L1O A;  2WB1 G;  4YHH L;  1IXR A;  4DV1 L;  2NVX H;  2UUC L;  1N33 Q;  4DNI A;  4BBS H;  3NEL A;  1MJC A;  4P74 A;  1N34 Q;  3I56 A;  3KFU A;  1PH5 A;  3OTO L;  1V43 A;  1HNW L;  1G29 1;  4PZ6 A;  5IP7 G;  2JA7 H;  1LYL A;  3EBE A;  4R4C A;  5M5X H;  2KBN A;  4PG3 A;  1S40 A;  2YU9 H;  1W3S A;  2KEN A;  4OX9 L;  4AH6 A;  2NZO A;  2MQH A;  4IPH A;  3PF5 A;  4YCV A;  1IYJ B;  1X3F A;  3PUX A;  1HNZ L;  3RZD H;  1VQI A;  3S2D H;  1K0R A;  3RN2 A;  3S14 H;  3ULL A;  1Q1B A;  5IYD H;  4AIM A;  3STB C;  5M3F G;  1JJ2 A;  3TS2 A;  2JE6 I;  3I4M H;  5M3M H;  5IYB H;  4BXX G;  5J3B A;  4A3I G;  1C7Y A;  2UXD Q;  2EQS A;  3CCJ A;  3CMA A;  3JAM c;  2C35 B;  4J15 A;  5ELO A;  4L5S A;  2BH2 A;  4NXM L;  3S1N H;  3GTJ H;  4IFD J;  1TWA H;  3PUW A;  3TQY A;  4DR3 Q;  3M9B A;  3CP0 A;  4DR2 Q;  1XNR Q;  2I0Q A;  2BA1 A;  4DAY B;  1PYB A;  3KOJ A;  5JJL A;  4DR5 Q;  2IX1 A;  4NPS A;  3AYH B;  4JI6 Q;  2D0P A;  3F2D A;  1CSQ A;  1E1O A;  3UDG A;  3J81 c;  1Q12 A;  3G71 A;  3GD7 A;  1K8A C;  3K8A A;  5GAD C;  2Y0S G;  4BY1 H;  2ZJP A;  2UXB L;  2PQA B;  4Y52 H;  4BBR H;  1XMQ Q;  1VQ5 A;  1QVC A;  3EN2 A;  3U4Z A;  3LGJ A;  1Z47 A;  4MNO A;  4ALP A;  4A93 G;  2HIV A;  2GN5 A;  1CUK A;  1HR0 Q;  1SMX A;  3RNU A;  1B70 B;  4HJ5 A;  4A3E G;  1YJ9 A;  1TWC H;  2YV5 A;  4JYA Q;  1IBL Q;  5LMN Q;  1FJG L;  3NEM A;  3I4N H;  3I2Z A;  4JC0 A;  3KJO A;  2LXJ A;  2IX0 A;  2ZJQ A;  3GTO H;  2OCE A;  1KL9 A;  4JOI C;  4JI7 Q;  4LF6 Q;  1SN8 A;  4LFA Q;  1AE2 A;  2Z6K C;  4YY3 Q;  3S1Q H;  5JEA G;  1BKB A;  5JEA J;  2E2J H;  5IP9 H;  4A3F G;  1ASZ A;  2VY3 A;  4A3K G;  4DR2 L;  1NMG A;  3GTK H;  1I6H H;  1X9N A;  2K14 A;  1QZH A;  2F3I A;  5FLM G;  2JEB I;  3E9H A;  1YJN A;  1Q7Y C;  3PV0 A;  4DR4 Q;  4A3L H;  1H95 A;  4JI0 Q;  5C44 H;  2UU9 L;  1PA6 A;  1VQ8 A;  4JI6 L;  1L1O B;  3KDF B;  4C3I H;  2E2H H;  3GO5 A;  4DV7 Q;  4PMW A;  3CQZ H;  4POF A;  1XMQ L;  1SRU A;  4OWW B;  5K36 G;  3NBH B;  1GVP A;  1WOC A;  1TWG H;  3CCS A;  1YZ6 A;  4R4O A;  1HR0 L;  3UDX A;  3RR5 A;  2N78 A;  5ELN A;  5C3E G;  1WFQ A;  1VQB A;  4HJ9 A;  4JYA L;  1UEB A;  3GDE A;  3NEN A;  5LMN L;  4OXP A;  1IBL L;  1GD7 A;  4X66 Q;  1K9M C;  1XNQ Q;  2R93 G;  3KLW A;  1N32 Q;  1LUZ A;  3TRE A;  1CSP A;  2RF4 A;  1JMC A;  2FXQ A;  2B63 H;  4BBS G;  4HJ8 A;  4C2M H;  3K81 C;  1FGU A;  1KAW A;  2VL6 A;  1OXS C;  2HIX A;  3SGI A;  1P8L A;  2YTY A;  2ZTC A;  5H1S E;  4HIO A;  2JA7 G;  4JOI A;  4PZ8 A;  4AQY Q;  1YVC A;  2DUD A;  2Z6K A;  2A19 A;  4P73 A;  4DPG A;  2WAQ E;  4X64 L;  5AJ3 L;  3ICE A;  3S2H H;  4P72 A;  1PH4 A;  2PQA A;  4L5Q A;  2R92 H;  4OO1 G;  1RL2 A;  3G6E A;  5LMU Q;  5C4X H;  2ATW A;  4KHZ A;  4DUZ Q;  3J80 i;  2UXC Q;  2JA8 H;  5FJ8 H;  4B3T L;  3A5Z B;  4R4T A;  1CKO A;  1UE7 A;  1KHI A;  4DV7 L;  1TWF H;  4BY7 H;  4NXN L;  2CWP A;  4R4I A;  1L2F A;  5IYD G;  5GAG C;  1E3P A;  1Y1W H;  1VQ6 A;  1G6P A;  1KD1 C;  3I4M G;  1S3O A;  5M3M G;  4YCU A;  5IYB G;  4B3M L;  2ALY B;  4B3R Q;  4LFB L;  1EWI A;  5IWA Q;  3ER0 A;  4GN3 B;  4DV2 Q;  3U50 C;  1XNQ L;  2ZM6 Q;  4LF5 Q;  2LSS A;  1N32 L;  4DV3 Q;  3CCQ A;  2OQ0 A;  1Q8K A;  3IRB A;  4GKK Q;  1NBW A;  4X62 Q;  4DK6 C;  1W2B A;  1PH7 A;  4DR6 L;  4GKJ Q;  3H3V I;  1PH9 A;  1TXY A;  3Q8D A;  1IBM Q;  4UP9 A;  3KDF A;  2KCT A;  3AFP A;  2RHS B;  2PI2 E;  3M3Y H;  3PSI A;  4TVA B;  1E7Z A;  4PZ7 A;  4BY1 G;  3OYY A;  3PIO A;  4BBR G;  4UY8 C;  3PIP A;  5FLX c;  3CCM A;  1K8G A;  3BJU A;  5GRO A;  1OXU A;  3T1H Q;  2QA4 A;  2MNA A;  4JI3 Q;  1I3Q H;  3W5O A;  3HOX H;  1U5K A;  3CCV A;  4RG1 A;  3E9I A;  3BU2 A;  5DLQ E;  3UDF A;  2IHF A;  2YYZ A;  4LF9 Q;  3H0G H;  1CKN B;  4ME3 A;  2HT1 A;  2D0O A;  3HKS A;  4LF8 Q;  3B6Y A;  4LF7 L;  4QJF A;  1NY4 A;  3I4N G;  1TWH H;  5IE8 A;  4K0K L;  1SRO A;  5IWA L;  1E1T A;  3RLO A;  4A75 A;  2NN6 G;  1OXX K;  2F4V Q;  5GAH C;  1YJW A;  4WJ3 M;  2R6G A;  2NVT H;  3AFQ A;  1PH3 A;  1XTD A;  3T1Y L;  1X65 A;  2GVB A;  2K5H A;  5JJI A;  4KHP L;  1KRS A;  5IP9 G;  1KIX A;  1PVO A;  2AHO B;  1VQJ A;  1YBY A;  2RHQ B;  3K7U C;  1QVG A;  1UE6 A;  4AYB G;  4A3L G;  4GLX A;  1FL0 A;  4IFD G;  2I5L X;  2BA0 A;  2ZTD A;  1SR3 A;  4O2D A;  1KRT A;  4JI8 L;  1V9P A;  5C44 G;  4DUY Q;  4LUV A;  1N33 L;  2CKZ B;  1VQP A;  1VQ7 A;  4HID A;  4A3D H;  4HIK A;  1N34 L;  4JI5 Q;  2WB1 E;  4BA1 I;  1EIY B;  2JA6 H;  3OW2 A;  2Q2T A;  4DV0 Q;  1VQC A;  3PGZ A;  1GM5 A;  4WJ4 A;  3M4Q A;  3L0O A;  2ZJR A;  1X54 A;  4LUZ A;  1XJV A;  2VNU D;  2LXK A;  4OON A;  3CXC A;  2K50 A;  1RIP A;  4Y7N H;  4A3G H;  4LF9 L;  5E7N A;  4HJ7 A;  4JV5 Q;  4GS3 A;  4DV5 Q;  2AMC B;  3WWV A;  4GLV B;  2IT1 A;  1N36 Q;  3HKZ G;  1P16 A;  2Q2H A;  3BZC A;  4DK3 C;  2NVY H;  2BH8 A;  4JI2 Q;  3UE0 A;  4BA2 I;  1X6O A;  4APV A;  3CF5 A;  4MZ9 A;  2I5M X;  4HIM A;  2UXD L;  1VQH A;  2MO1 A;  2QGQ A;  3GTL H;  1QUQ A;  2OTL A;  3PCO B;  1QVF A;  3FKI H;  2R92 G;  2MO0 A;  4DR3 L;  2JA5 H;  4B3S Q;  4YCW A;  5C4X G;  1GO3 E;  1XNR L;  2JA8 G;  5FJ8 G;  1HNX Q;  1EIF A;  4DR5 L;  4BY7 G;  1VQK A;  1Y1W G;  1CKN A;  4LWC A;  1L0W A;  2QEX A;  2PNH A;  4XTC S;  2HHH Q;  4X65 Q;  3RLN A; 
#chains in the Genus database with same CATH topology
 3OMC A;  1OO9 B;  3MAQ A;  1G2T A;  3S24 A;  3OW7 A;  3S1R H;  3KJP A;  2Q2U A;  1VQ9 A;  3I90 A;  2EPB A;  2KED A;  4LW1 A;  1SNM A;  4K14 A;  3MXN A;  4A3E B;  1SE8 A;  2Z4I A;  2HCC A;  4O0A A;  4QQB X;  2GVA A;  3ZYY X;  1QZG A;  2L0C A;  2KQ3 A;  2MFI A;  4N9P A;  1D2B A;  4FXG C;  2RQX A;  2WAQ B;  1OXT A;  1EOV A;  4A3C H;  1RJT A;  2LS0 1;  1D5X C;  1EFI D;  5ELD A;  4OWX B;  5EAY A;  1QIL A;  1DOK A;  2R61 A;  3VA5 A;  2UUA Q;  2RVL A;  1CZW A;  3JC6 6;  3H0G G;  1XPU A;  1Q3L A;  3EIV A;  5C4Z A;  3HOZ H;  4DAM A;  4L5T A;  5A35 A;  4G7H C;  1PRT D;  4HN7 A;  4KY7 A;  5C0X G;  3I7F A;  2QEJ C;  2J7Z A;  3GV3 A;  2B2W C;  3KYH C;  4XIG S;  4KI0 A;  2F0K A;  5I6Y A;  1CKM A;  2WKD A;  1S72 A;  1PH2 A;  1L0X B;  3GQB A;  2KEC A;  2MHV A;  2J0T D;  3D4R A;  4GOP C;  4R8N A;  2OTJ A;  1CTM A;  1B8A A;  1D8L A;  2A69 C;  2ZT9 C;  2YU9 B;  2R7Z B;  1STY A;  2F0F A;  5KNC A;  4IUT A;  3AEV A;  1WTP A;  3CPF A;  1XXG A;  3S2D B;  2F03 A;  1A62 A;  4U68 A;  3OSO A;  4DUZ L;  1SMY D;  4L63 B;  3J81 j;  1VQO A;  2A1A A;  1G2S A;  3L2P A;  1I50 B;  3JAM L;  4B3R L;  2XSC A;  4LFC L;  1ONL A;  3FKI G;  3GP7 A;  1HH2 P;  1Y1V H;  4X3S A;  1PV4 A;  2VUM B;  4ZLT F;  4XDX A;  3G4S A;  5IGD A;  2N88 A;  4GNX C;  2DY8 A;  1AFP A;  4JCV E;  4IPD A;  1VQD A;  2F0I A;  4DV6 Q;  2F0E A;  1ESF A;  1G6Z A;  1BCP D;  2RDH A;  4MN3 A;  4L6T B;  3TN2 A;  4LK1 C;  2L11 A;  1VQ4 A;  2ICI A;  1FJG Q;  1II3 A;  5GQO A;  2A8V A;  2NWG A;  1JWM D;  1YHQ A;  4H44 C;  4RGO S;  1NE3 A;  2K01 A;  2D9U A;  1JWU D;  1A8V A;  1B44 D;  2CW0 D;  2PI2 A;  5COY A;  4F87 A;  1I6H B;  3E5S A;  2B8F A;  1Q82 C;  2NN6 I;  1UWV A;  5C44 B;  4IO9 A;  4JI1 Q;  1HPC A;  1E22 A;  5HGT A;  1JE4 A;  1J5E Q;  2YTX A;  3QO2 A;  5BN4 A;  3P20 A;  1DGS A;  1LT5 D;  2FHT A;  4QGU A;  2P5Z X;  2Z0S A;  3NXW A;  4QB4 A;  5I2Y A;  2YTV A;  3CCL A;  3CW2 C;  1T9H A;  1FNV A;  1TVX A;  1WTW A;  1NTG A;  5JPM C;  1S5F D;  3HKZ B;  3ND8 A;  1RF2 D;  1ENC A;  1K3B C;  1TY0 A;  1YNX A;  4ODG A;  1CI3 M;  5CMD A;  5IY0 A;  5NUC A;  3A5U A;  2H5X A;  3Q23 A;  2VQE L;  4J1M A;  4A3F B;  3SK5 A;  2VB3 X;  3NWS A;  3IL8 A;  3GTQ H;  1TWF B;  2K04 A;  1C9O A;  1SNP A;  3KLR A;  1JCK B;  2R7D A;  2A6H C;  2H1E A;  3Q0A A;  3BYY B;  2QDL A;  5IT9 E;  1WCM G;  5T1I A;  1CHQ D;  2CCZ A;  4CKB A;  5T1G A;  3OMG A;  5C4J H;  4A3B G;  2K52 A;  3P1H A;  3HOY G;  1WD0 A;  1X55 A;  3QIA A;  3TRZ A;  4A3E H;  4DV4 Q;  2NVX B;  4DR7 L;  4YHH Q;  4BBS B;  1JR0 D;  3R2T A;  3OTO Q;  5FLX L;  5JEA H;  2QIL A;  3PUZ A;  1LTB D;  4ZCK A;  2SDF A;  4EX5 A;  4LF4 L;  1SLJ A;  4IUU A;  3CPW A;  1EY8 A;  5GAE C;  4LF7 Q;  2B39 A;  4JI4 L;  3DLL A;  3M85 A;  1MHW C;  1F9P A;  2NVT B;  2UUB L;  5C6A A;  1RKN A;  4QIW E;  4FVM A;  2AQ2 B;  1DXM A;  4KHP Q;  5BR8 L;  4GN5 A;  1EU4 A;  4NXM Q;  1K8M A;  2EY1 A;  3PF4 A;  1TWA B;  2R93 H;  1JOQ A;  2WKC A;  4DXF A;  3M4Y A;  1I6V C;  1HQR D;  2QDB A;  1HNW L;  1RD9 D;  1PZI D;  4NMZ A;  1LYL A;  3EBE A;  3R2I A;  1LLR D;  2TSS A;  2YU9 H;  1LTT D;  1IYJ B;  3PUX A;  1HNZ L;  4PMB A;  4IAL A;  4KD4 A;  3S2D H;  2XWJ B;  3K58 A;  3S14 H;  3NUC A;  4IUV A;  5M3F G;  3I4N B;  4BXX G;  4A3I G;  1C7Y A;  2UXD Q;  2IPK D;  1NR2 A;  4L5S A;  5ELO A;  4UAI A;  4XYO A;  4F7X A;  2BH2 A;  3GTJ H;  5C5M A;  3S1Q B;  1PTO D;  5JVH 3;  3TQY A;  4C3H G;  4RCN A;  5BN5 A;  2I0Q A;  3KOJ A;  2F3W A;  2EJG C;  4DR5 Q;  4NPS A;  4IQZ A;  1CSQ A;  5EBD A;  3G71 A;  1H9S B;  4BY1 H;  2PQA B;  2PQE A;  2EY6 A;  1VQ5 A;  3U4Z A;  4ALP A;  2HIV A;  5G3L D;  4MTK A;  1ICW A;  3FEW X;  1B70 B;  4JW0 A;  1YJ9 A;  4JYA Q;  3LWE A;  2KOL A;  4K6D A;  3GTO H;  4JOI C;  1SN8 A;  3D8G A;  2Z6K C;  5EKK A;  3NHH A;  5IP9 H;  1I6H H;  3GTK H;  2LFN A;  1X9N A;  2Q8R E;  3S16 B;  1SJE D;  4A3L H;  5C44 H;  5C4X B;  1PA6 A;  1L1O B;  3DEP A;  4BY7 B;  3GO5 A;  2ICE C;  1XMQ L;  2FMC A;  1GVP A;  5FKA C;  4BWG B;  1B50 A;  3CCS A;  3RR5 A;  2Z8L A;  4X3K A;  3OWF A;  3NEN A;  1IBL L;  1Y8N B;  1RCV D;  3TRE A;  4PMC A;  3CCJ A;  2HD3 A;  1FGU A;  1KAW A;  2VL6 A;  1GXD C;  2ZTC A;  5H1S E;  5KIX A;  1YVC A;  2DUD A;  2A19 A;  1Q8I A;  4OO1 G;  3G6E A;  2ATW A;  4KHZ A;  4DUZ Q;  1GUG A;  4DV7 L;  1UE7 A;  1TWF H;  4NXN L;  1WCM B;  1TS5 A;  1Y1W H;  1VQ6 A;  5GAG C;  1E3P A;  1KLU D;  1XWE A;  5M3M G;  4QIW B;  5IYB G;  4B3R Q;  1FYC A;  5IWA Q;  3ER0 A;  5TSS A;  5ELB A;  3HOY B;  3MTS A;  3GTP B;  4WFN 3;  2JP1 A;  3CCQ A;  2OQ0 A;  1K8O A;  1H9M A;  2A69 D;  2B2T A;  3D4D A;  2EYH A;  2F0U A;  4M1U B;  1PH9 A;  1ET9 A;  1AP0 A;  4UP9 A;  1I4G A;  2A68 C;  2KCT A;  5KYI A;  2PI2 E;  1ZXT A;  3M3Y H;  3VR3 A;  4TVA B;  2EE1 A;  1QG7 A;  4BBR G;  3CCM A;  3BJU A;  1E2V A;  3SVM A;  3SK8 A;  3BU2 A;  2DY7 A;  2JSO A;  3H0G H;  4ME3 A;  5IE8 A;  1SRO A;  3H91 A;  5CV9 A;  4LAA A;  1QNU A;  5GAH C;  5C0X H;  1YJW A;  2R6G A;  2NVT H;  5EPL A;  2K5H A;  2JN4 A;  1KRS A;  1PVO A;  1VQJ A;  2KA7 A;  2RHQ B;  4GLX A;  4IFD G;  3J81 L;  2BA0 A;  1SR3 A;  4LUV A;  4DA2 A;  2WB1 E;  3LWU A;  1GUW A;  3C2P A;  1GM5 A;  2IW3 A;  3M4Q A;  2ZJR A;  2VXW A;  3MXU A;  2LXK A;  4OON A;  5ELF A;  5EGT A;  4GLV B;  2IT1 A;  1GUO A;  1Q90 A;  3J7Y W;  4DN4 M;  2Q2H A;  4DK3 C;  2BH8 A;  3UE0 A;  4A3I B;  1X6O A;  4APV A;  3FPU B;  1HUN A;  2F0J A;  1VQH A;  4X3T A;  3GTL H;  1PRT F;  4RH6 A;  2O4X A;  4ZAI A;  3PCO B;  3FKI H;  2R92 G;  2MO0 A;  4RKL A;  3A7A B;  3NQI A;  3DWQ A;  1A3V A;  1DYQ A;  3E3X A;  2EVB A;  1VQK A;  2PNH A;  1JOO A;  1V1Q A;  5M5W H;  2K5N A;  1HZA A;  3TME A;  2KHI A;  4JG2 A;  4FF2 A;  5HGQ A;  3D4W A;  4DR1 Q;  3W1B A;  2F52 A;  2X69 A;  3JAM i;  3CD6 A;  4A76 A;  2G9H D;  4DR7 Q;  1ESR A;  2AQ1 B;  4HSP A;  2N3S A;  1K28 A;  1F2L A;  1BXT A;  4G7O C;  2A6H D;  2XWB B;  4DNR B;  4LF4 Q;  3S16 H;  3H6M A;  1KAB A;  1Z6H A;  2E2D C;  3PO2 G;  4DKA C;  2XN9 C;  4X65 L;  1EY6 A;  3S1M H;  1F77 A;  3M4P A;  5BR8 Q;  4B08 A;  3HP3 A;  1KAA A;  4GLA C;  2E2I H;  1VQG A;  1V8Q A;  1E24 A;  4DU9 A;  1HXY D;  2VS1 A;  1BCP F;  4FP5 D;  1Y1V B;  5DAU A;  1HA5 A;  4X66 L;  2M00 A;  4FF4 A;  3I55 A;  2NVQ H;  3WOF A;  1ROD A;  3T53 B;  4A3D G;  2JA6 G;  1FGB D;  4S3S A;  4AQY L;  4K8J A;  2EYF A;  1B53 A;  2FIN B;  4TRD A;  3M7N A;  1HNZ Q;  4CHT B;  3BDL A;  4A3G G;  3TZD A;  5LMU L;  3H3V C;  1VQM A;  3CME A;  1X3E A;  1WCM H;  3TDQ A;  3CCR A;  3L7Z C;  3NPP A;  1TS3 A;  1X3Q A;  2CFM A;  2RSN A;  5AFW A;  4OEL B;  1SJH D;  2B2W A;  1OTC A;  4A3B H;  2IWH A;  3HOY H;  4FF3 A;  5EPK A;  2LKV A;  3GTP H;  1MKH A;  2O5J C;  4DV3 L;  3I4O A;  3RD4 A;  4X62 L;  4GOP A;  3FDT A;  3MA2 B;  2F0W A;  3GTG H;  2JQO A;  3G6J B;  4UDU C;  1SNC A;  3HOV G;  4CKE A;  3D0F A;  1PFS A;  1X32 A;  2N8N A;  4TSS A;  4JI3 L;  1D5M C;  1PZK D;  2Q2I A;  1EZ6 A;  3I72 A;  1XPR A;  1I4R A;  1GUN A;  2F0P A;  4A3M G;  1HZC A;  3NQT A;  4K5V A;  4KKT A;  1O7I A;  1XMO Q;  2EDG A;  2K5W A;  1VQN A;  3ZJY C;  2MGS A;  2JK8 A;  3K5O A;  3TP8 A;  1NAP A;  3R3O A;  2ZXO A;  4N8X 1;  1GHK A;  4ZKB B;  3VYS A;  4P75 A;  4GNX A;  4EQP A;  2NZH A;  3J80 c;  1M90 C;  2C9O A;  4JI5 L;  2QCP X;  3PQI A;  2WFW A;  1AE3 A;  3KF6 A;  3H15 A;  3CRK C;  3NTH A;  5C4J B;  4DV5 L;  1GHJ A;  3KUP A;  4X6A H;  2K03 A;  2XTI A;  1YNJ C;  4RMF A;  5FO8 B;  1C0A A;  3K6O A;  5M3F H;  3VR4 A;  4BXX H;  1TR5 A;  3P75 A;  1GUT A;  3HKZ E;  5JAV A;  2AUJ D;  2CH4 A;  4A3I H;  2GA4 B;  3HOW G;  1QCB D;  1PRT B;  4KHV A;  4ZRZ A;  1LT3 D;  5C3X A;  2E5L Q;  2F1M A;  4QUC A;  4YWK A;  1UE5 A;  1WYD A;  4C3H H;  1PHJ A;  3VDY A;  1R4Q B;  2F0G A;  4XQJ A;  4B3S L;  3EVQ A;  4NXN Q;  1FD7 D;  3K0X A;  4IJL A;  1A6X A;  1A15 A;  3A54 A;  5KRU A;  5A2Q E;  1NCV A;  1ZYR C;  4J8Q A;  3MFG A;  4XT3 B;  2K4K A;  1SNO A;  5IGE A;  2OWO A;  2VQF L;  3T51 B;  2R93 B;  1L1O C;  3BZD B;  3HFZ B;  2L15 A;  3BDO A;  3G48 A;  1Y14 B;  2UUC Q;  3X3M A;  1EYG A;  4OWT B;  1F9Q A;  1SNQ A;  4IUN A;  3KF8 A;  1YIJ A;  1KQS A;  1G51 A;  4OX9 Q;  2EJM A;  1K3R A;  4POG A;  2XGT A;  1PTO F;  1QWY A;  1PYS B;  2N49 A;  3GV6 A;  1B2T A;  5DM6 3;  3S14 B;  1RDP D;  2JJQ A;  3PUV A;  1XPO A;  4WJW A;  1HHV A;  1VS0 A;  3GTJ B;  1I94 L;  1BCP B;  4HMI A;  2A68 D;  2ASB A;  4KV6 A;  4DV1 L;  5C3W A;  2PZW A;  5G3L F;  4DNI A;  4A3D B;  3NEL A;  4K5X A;  1SDF A;  4P74 A;  3I56 A;  4PZ6 A;  1S40 A;  2KEN A;  4BY1 B;  4A3G B;  4CDF C;  4OO1 H;  5JPN C;  2K5D A;  1VQI A;  1K0R A;  3RN2 A;  3ULL A;  3OIQ A;  3STB C;  5F2D A;  1H9K A;  3TS2 A;  1A3T A;  5M3M H;  5IYB H;  4RFB A;  3GTO B;  1EY5 A;  4J15 A;  3S1N H;  5CBA E;  3M9B A;  3GTK B;  3KK7 A;  1WTQ A;  3W2D A;  2RCF A;  2BA1 A;  3Q24 A;  1LTR D;  1DOM A;  1V1O A;  3CHB D;  4JI6 Q;  3J81 c;  3K8A A;  2Y0S G;  2ZJP A;  4BBR H;  3EN2 A;  4HSV A;  3C1E A;  3LGJ A;  1Z47 A;  4A93 G;  3DEO A;  3C1F A;  2GN5 A;  2I07 B;  1CUK A;  1WD1 A;  3I70 A;  3RNU A;  1CFM A;  2DNC A;  2YV5 A;  3FVQ A;  1B4O A;  3I2Z A;  4XQQ A;  2AQ3 B;  2LXJ A;  2ZJQ A;  2OCE A;  1KTK A;  4K6L A;  4C1N K;  4RCO A;  1S5B D;  1ASZ A;  2VY3 A;  5IT9 L;  4DR2 L;  1QOH A;  4A3K G;  1QZH A;  1D5Z C;  5FLM G;  3E9H A;  1HFN A;  1VF7 A;  4IFD H;  5CR3 A;  2B8G A;  2EYO A;  2UU9 L;  3G7L A;  2ZXP A;  5E4X A;  1VQ8 A;  3BDC A;  1K83 B;  1STG A;  3TSS A;  4PMW A;  1NUC A;  1I4P A;  1Y1W B;  3CQZ H;  4ILW A;  4POF A;  3BVM A;  1SYC A;  4IZ8 A;  4OWW B;  1TT2 A;  3NBH B;  1YZ6 A;  5IGF A;  1HR0 L;  3UDX A;  3K57 A;  1EYC A;  3OPO A;  1LT6 D;  4OXP A;  3KLS X;  4X66 Q;  5LMN L;  1XNQ Q;  1LT4 D;  1N32 Q;  1LUZ A;  1TII D;  1D6E C;  2RF4 A;  2FXQ A;  1TS4 A;  2EXZ A;  4DAY A;  2B63 H;  4C2M H;  4CDC C;  3MFY A;  2JA7 G;  4HIO A;  4JOI A;  4AQY Q;  3T4A C;  5AJ3 L;  1BQQ T;  2Z6K A;  3M3Y B;  1T5E A;  1PMR A;  2CQA A;  4N8F A;  1PH4 A;  1NSN S;  4L5Q A;  2R92 H;  2RKS A;  3R93 A;  5LMU Q;  1QNK A;  5FOB B;  1ICF B;  2E75 C;  3M7G A;  3H0G B;  4R4I A;  5IYD G;  5D14 A;  3I4M G;  1S3O A;  4YCU A;  1EWI A;  4DGZ A;  1C4Q A;  3I3C A;  3U50 C;  3S17 B;  2Z4H A;  4ZKC B;  4DV3 Q;  1Q8K A;  1NBW A;  4X62 Q;  1O80 A;  1W2B A;  1TXY A;  1BR9 A;  1ET6 A;  1ZKO A;  3SDZ A;  3KDF A;  3D6C A;  2L5T A;  4B9W A;  1SE2 A;  3PIO A;  3PIP A;  5GRO A;  2M9V A;  4OHJ A;  1DM0 B;  5D3D A;  4JI3 Q;  5FLX E;  1U5K A;  4RG1 A;  3E9I A;  1PTO B;  3PO2 H;  2KUM A;  1M8A A;  2DN8 A;  4A75 A;  1ENF A;  1V1P A;  2NN6 G;  1Z7T A;  2CH4 W;  3VYR A;  3HRZ C;  1X65 A;  3O13 A;  2QF7 A;  2E74 C;  5JJI A;  3IKJ A;  3GTL B;  1YBY A;  2F0O A;  1XX8 A;  1QVG A;  4AYB G;  4GZY C;  3FKI B;  4C1N I;  1EOT A;  2RSO A;  4O2D A;  4JI8 L;  3J80 L;  4V19 0;  1VQP A;  3V05 A;  1VQ7 A;  4A3D H;  1N34 L;  4JI5 Q;  1EIY B;  2B2V C;  2JA6 H;  1SSO A;  3OW2 A;  3K5L A;  1KLG D;  1XJV A;  3CXC A;  1RIP A;  5M5W B;  4A3G H;  4LF9 L;  2D2C C;  5E7N A;  4HJ7 A;  4DV5 Q;  2AMC B;  1JQY D;  4EQN A;  2NVY H;  2V4D A;  4BA2 I;  2Q8T A;  2I5M X;  2NTT A;  2X6G A;  3KBX A;  4HCE A;  1EWC A;  1JIC A;  2B2U C;  4Q0F A;  2PW7 A;  4B3S Q;  4YCW A;  1RTO A;  1RHP A;  1DON A;  2JA8 G;  5FJ8 G;  2SNS A;  1EIF A;  4FXD A;  1CKN A;  1DZ1 A;  2QEX A;  2G5D A;  4ABN A;  1LTG D;  2RDG A;  3S1M B;  3HOV H;  2LMC B;  5ISR A;  3BZK A;  4H0L C;  1YNJ D;  3SE0 A;  4JV5 L;  4NP5 A;  4O1N A;  1U4L A;  2E2I B;  2TMP A;  2VQF Q;  4IOA A;  2A74 C;  3U4V A;  1KDB A;  1UE1 A;  3MXG A;  4KN4 C;  4LNQ A;  3EA6 A;  3F8T A;  3TP7 A;  4PNY A;  1WTO A;  2G9D A;  3RN5 A;  2PPB C;  4A3M H;  2NVQ B;  2OQK A;  1WI5 A;  2SEB D;  2ES2 A;  1I5F A;  4LFA L;  4YY3 L;  2QKI C;  1SYB A;  5CBE E;  5KEE A;  4HTH A;  4FXK C;  3TS0 A;  1R9T H;  1EY7 A;  1HNX L;  1HJP A;  3HOX G;  3DM3 A;  4GOP B;  1N8R C;  1ZYR D;  5KGU A;  2HHH L;  3TP5 A;  1K83 H;  1VCI A;  2BCO A;  2F0H A;  1IW7 D;  1W6J A;  4DF7 A;  3SK6 A;  4NB3 A;  4IUQ A;  3MEF A;  1I94 Q;  3ND9 A;  4A3B B;  1BBW A;  3I91 A;  4LFC Q;  3UDI A;  1TS2 A;  4DV1 Q;  4DAP A;  2C5C A;  1FNW A;  4CJ1 B;  3RZO H;  5C4H A;  3CAM A;  2XRS D;  3GTG B;  3KLS A;  3HOW H;  2E8G A;  1XTC D;  1EQR A;  4CJ0 B;  1QUQ B;  3RZD B;  1ASY A;  1AEX A;  5HY6 A;  1WJJ A;  1VDZ A;  2UXC L;  4FO2 A;  2IHE A;  5K36 H;  3I4M B;  3ERS X;  3W1G A;  2F0S A;  3KF6 B;  2EYM A;  3J7A V;  1HCZ A;  4OEM B;  3H3V H;  2CQO A;  2EYL A;  2I5H A;  1SEB D;  3S17 H;  2PYK A;  3MXN B;  2ZM6 L;  4R1J A;  2JA5 G;  4LF5 L;  4GKK L;  4RWS C;  4DFA A;  2AWN A;  2BE5 C;  1KC8 C;  1UNS A;  1GOZ A;  3ERO A;  4EQ5 A;  1WTX A;  3DWA A;  4JBK A;  4WRD A;  3STB D;  2ID0 A;  3T1H L;  2F0N A;  1C8C A;  1D1I A;  1Q86 C;  2EOT A;  2EJF C;  1JOR A;  1PTO H;  4EQO A;  2CWA A;  4KY6 A;  2K32 A;  5M3F B;  1S5D D;  2BOS A;  2B63 G;  1J8I A;  3D31 A;  2VZA A;  1E0B A;  1VF5 C;  3HOU G;  1OXV A;  1YHA A;  2EIF A;  2VQE Q;  3QR8 A;  3TZU A;  1BO0 A;  4C3H B;  2UU9 Q;  3J7Z C;  3D3R A;  3QWN A;  4KKU A;  1EFW A;  4L5R C;  4DV6 L;  1XYI A;  3KF8 B;  4ZQ3 A;  1STB A;  4RHS A;  1JB7 A;  5CGK A;  1VMC A;  5IIF A;  5K5P A;  3NTI A;  1BNZ A;  4FF1 A;  5CV4 A;  1EYA A;  1GKH A;  3K7A H;  1PFM A;  2MPM A;  3CCU A;  1N36 L;  3ULJ A;  1PDQ A;  2PMZ E;  1Q1E A;  3PUY A;  2PW5 A;  1JJG A;  3P7J A;  4JI2 L;  2WAQ G;  2HDM A;  4XXE A;  1K73 C;  1IL2 A;  5AJ3 Q;  4RA8 A;  3BVZ A;  4DXG A;  3AQQ A;  4HAE A;  1PYW D;  1PFB A;  3K5N A;  1I4X A;  1X56 A;  3PO3 G;  5CV6 A;  4JI1 L;  5LL6 S;  1WTR A;  2JA8 B;  5DEH A;  1J5E L;  3S15 H;  1BF4 A;  1B9N A;  3J7A 5;  4HCS A;  5IT9 c;  3CCE A;  3RLF A;  4ULL A;  4FYD A;  1HTP A;  2AWO A;  4JI4 Q;  3FP9 A;  5LL6 X;  2HDL A;  3SEB A;  5I6W A;  2UUB Q;  2K6A A;  3K5M A;  4HMJ A;  1EL0 A;  4A93 H;  1NMF A;  1HA6 A;  2B29 A;  2IY5 B;  3K80 C;  1MI2 A;  4K8I A;  2XNA C;  3AU7 A;  3DWP A;  4YWL A;  2JA9 A;  4N9T A;  4CGY B;  3MC0 B;  2R7Z G;  1PH1 A;  2HQL A;  1IKL A;  1HNW Q;  4XT1 B;  3BYT B;  4HED A;  1IYU A;  1MGS A;  4A3K H;  2KCC A;  3FRP B;  4PV1 C;  5HUR A;  5FLM H;  1IBK L;  4LUO A;  4CKC A;  4A3J G;  2BDO A;  1JE5 A;  1SBB B;  5J22 A;  3URY A;  3Q22 A;  2OT2 A;  2OEO A;  4DNT B;  1JT8 A;  1F2Z A;  2KJX A;  1HUM A;  1X3G A;  1A0I A;  2XRQ D;  1BVS A;  2K5V A;  1KNA A;  5EKL A;  4XYQ A;  5M3M B;  1N9W A;  2Z9H A;  4IPC A;  5IYC G;  3FPP A;  5FO7 B;  3X3N A;  2ENB A;  1Y69 U;  1YI2 A;  2VUM G;  3S1N B;  5I9P A;  4DV4 L;  4TQU S;  4F8M A;  3OOC A;  5C0X I;  3SXH A;  1IKM A;  4KTA A;  2VW9 A;  3GTM H;  4JI8 Q;  1L1O A;  4YHH L;  4U67 3;  1D1K A;  2PNR C;  4R8I A;  1R4P B;  1N34 Q;  3OTO L;  1V43 A;  1Y8P B;  2JA7 H;  5IP7 G;  3EJI A;  5IGG A;  5M5X H;  2KBN A;  4RGT A;  4PG3 A;  4AH6 A;  4Y7N B;  2MQH A;  4BBR B;  3PF5 A;  4YCV A;  1X3F A;  3RZD H;  1C48 A;  2L12 A;  2O5I C;  2A5H A;  2VB2 X;  1Q1B A;  5IYD H;  4YIJ A;  4I7Z C;  2JE6 I;  3OIP A;  3I4M H;  1MSH A;  2F4I A;  5J3B A;  1PFN A;  2NUC A;  1MD2 D;  2EQS A;  3CMA A;  1I4Q A;  1WTV A;  3QJY A;  3SR1 A;  4V0B A;  4NXM L;  4IFD J;  2JA5 B;  2JXM B;  1ML0 D;  3AMU A;  1YNN D;  1QB5 D;  1PYB A;  4I7A A;  4DAY B;  5JJL A;  4X3U A;  1EYD A;  4ME5 A;  3AYH B;  1CZG A;  1Q12 A;  1K8A C;  5GAD C;  2UXB L;  5DM7 3;  3CQZ B;  3HS0 C;  1A3U A;  2K28 A;  1LTA D;  1XMQ Q;  4MNO A;  1S5E D;  4DAV A;  1ILP A;  1SMX A;  4DK1 A;  3K59 A;  4HJ5 A;  2PMZ B;  4K5W A;  4OL7 A;  3I73 A;  3VR2 A;  1IBL Q;  3NEM A;  4C3J G;  2NN6 H;  4ZUJ A;  1KL9 A;  1ILQ A;  3RMH A;  2B63 B;  3SHL A;  4C2M B;  3HEJ A;  4LFA Q;  1AE2 A;  4YY3 Q;  3HOU B;  5JEA J;  2E2J H;  4A3F G;  1HRJ A;  1NMG A;  4IUP A;  4P2C B;  5A2Q L;  2F0D A;  2RBM A;  2R92 B;  1B9M A;  3KDF B;  2E2H H;  4DV7 Q;  3IAY A;  2L55 A;  5JOB A;  1SRU A;  5K36 G;  3BVG A;  1WOC A;  1TWG H;  4R4O A;  4ZK9 B;  4BS9 A;  2NB0 A;  2HUG A;  2N78 A;  3MVV A;  1WFQ A;  4JPB W;  5C3E G;  4HJ9 A;  4JYA L;  1UEB A;  3GDE A;  2EZV A;  1GD7 A;  4RAU C;  3KLW A;  4CBV A;  1CSP A;  1SE3 A;  1LV9 A;  1V1P B;  2PCF B;  1EWH A;  2WIN B;  3HZX A;  3NSW A;  1JMC A;  4BBS G;  1IW7 C;  1KXL A;  3K81 C;  1CQF A;  1OXS C;  2HIX A;  1P8L A;  2DJG C;  1J9O A;  4DPG A;  4X64 L;  3PO3 B;  3ICE A;  1LAB A;  5CYU A;  3S2H H;  1KDC A;  2B2Y C;  1BOS A;  2UXC Q;  1QJO A;  4L8J A;  3J80 i;  3BS1 A;  2JA8 H;  5FJ8 H;  4B3T L;  4R4T A;  1CKO A;  1KHI A;  3PO2 B;  1B1Z A;  1EQT A;  3ONA B;  1KD1 C;  4LFB L;  4B3M L;  4GN3 B;  2F0M A;  2ZM6 Q;  4LF5 Q;  4KJO A;  3N52 A;  3IRB A;  4GKK Q;  3DM1 A;  1PH7 A;  4DR6 L;  3SK4 A;  3TP6 A;  1KDA A;  3AFP A;  5E4W C;  2RHS B;  3PSI A;  1STA A;  2JA6 B;  3A8J E;  1E2Z A;  4RGN A;  1EEI D;  4A3J B;  1PXU A;  3T1H Q;  2MNA A;  3W5O A;  1NR4 A;  2XIW A;  3T16 A;  3HOX H;  5I4D A;  3UDF A;  2HQE A;  2IHF A;  3MZ5 A;  2EY5 A;  1CKN B;  2YYZ A;  3QOJ A;  2D0O A;  3HKS A;  3B6Y A;  1UAP A;  4QJF A;  3I4N G;  4K0K L;  5IWA L;  4QCL A;  2NVY B;  1EEF D;  1OXX K;  4WJ3 M;  1G8Z D;  2NZ1 D;  2KHS A;  2L4N A;  3T1Y L;  1KIX A;  1UE6 A;  2BE5 D;  2I5L X;  3VA7 A;  3JAM E;  2ZTD A;  1V9P A;  4QMG A;  1N33 L;  4C3I G;  1DD2 A;  1JB3 A;  2N55 A;  4HID A;  4WOR A;  4BA1 I;  4WJ4 A;  3PGZ A;  1X54 A;  4LUZ A;  3HOV B;  2K5Q A;  4Y7N H;  4IUR A;  1A2T A;  3WWV A;  1N36 Q;  1P16 A;  1F9R A;  2DNE A;  3BZC A;  4JI2 Q;  3AB9 A;  4ZYS A;  4A3M B;  5M5Y B;  2OTL A;  1E2W A;  1UEA B;  1QVF A;  5EBC A;  4DR3 L;  2JA5 H;  2WV6 D;  5C4X G;  1GO3 E;  1R9T B;  1XNR L;  4BY7 G;  2Z6B A;  4LWC A;  1L0W A;  1AN8 A;  4XTC S;  3Q6S A;  1H9J A;  4PQX A;  4X65 Q;  3RLN A;  2KHJ A;  2B2V A;  3M4O H;  2K75 A;  1AH9 A;  1F9S A;  4FDB A;  1LO5 D;  2PZT A;  2Y0S E;  1TQO A;  4JVZ A;  4IN3 A;  3FHW A;  4GN4 B;  1STH A;  5KYL A;  4C3J B;  1SFO B;  1SYD A;  2RCN A;  3RZO B;  4IOC A;  1JJC B;  2BDN A;  3D6W A;  4JI7 L;  4LF6 L;  3HOW B;  5JJK A;  2NBF A;  3F2B A;  3VR6 A;  5JVG 3;  2KEE A;  3HOU H;  2X6L A;  2B2U A;  1IBK Q;  2RA4 A;  1VQF A;  1FVI A;  4DR4 L;  1HFG A;  2JEA I;  1DOL A;  3J81 i;  4JI0 L;  1HR0 W;  5FO9 B;  2NYZ D;  2FJ2 A;  5ELE A;  3NTK A;  5LMN W;  1GJX A;  1YHB A;  5C0X J;  4TKO B;  2EYP A;  4UP8 A;  5I2X A;  4M8A A;  5FK9 C;  4HJA A;  3A7L A;  5C3E B;  5EKI A;  4DR1 L;  1CK1 A;  2A6E C;  4KN7 C;  3BG3 A;  5I9O A;  2FFK B;  1EZ8 A;  1SE4 A;  5J1Z A;  3ULP A;  2WII B;  2MUY A;  3A8K E;  3A0J A;  1EQQ A;  1J6Q A;  2OF1 A;  5E1F A;  3NBI A;  2AUK A;  4RGM A;  4QY7 A;  5JJZ A;  1RTN A;  4UPA A;  4Z9C B;  3PO3 H;  1CQV A;  4KD3 A;  4A4I A;  2IJ0 A;  1Q81 C;  2NTS A;  1NNX A;  3U9O A;  3F2U A;  4NW2 A;  2L1B A;  4OO1 I;  1T5X D;  3CC7 A;  2SNM A;  3QG1 A;  3UE1 A;  4Q5V A;  1O7L A;  4DV2 L;  3K0Y A;  4JBW A;  4JBM A;  3A8I E;  1VQL A;  3VYU A;  4YWM A;  1HQM C;  1ENA A;  2B3G A;  4GKJ L;  4R4Q A;  1Y8O B;  1A63 A;  2R7Z H;  1KNE A;  3NE5 B;  1IBM L;  2UXB Q;  3IFT A;  1DCZ A;  4P71 A;  4DK0 A;  1YNN C;  4KLK A;  1K0S A;  1IL8 A;  2EXD A;  4A3J H;  4UHV A;  1TWC B;  1VQA A;  1Z9F A;  5COR A;  4MTN A;  1TU2 B;  3K7A B;  4IJH A;  2D5D A;  4LF8 L;  1I50 H;  2AKW B;  3FMC A;  1LTL A;  5IGB A;  3F2C A;  2F4V L;  1IYV A;  5M9O A;  4A3C G;  5IYC H;  3TEH B;  1AZP A;  1W6K A;  2Z1C A;  2VUM H;  2MJ8 A;  2WP8 J;  3U58 A;  1PZJ D;  4CJ2 C;  3F1Z A;  4C3I B;  1SYG A;  1MSG A;  3S15 B;  4AYB E;  4DUY L;  3HOZ G;  1MIU A;  3MXP A;  1VQE A;  1PH6 A;  3E0E A;  2ZTE A;  5IP7 H;  1CHP D;  1HZ9 A;  4IFD I;  1MJE A;  3J80 E;  4OGQ C;  2F3V A;  4DV0 L;  2Y0S B;  1YIT A;  1IZ6 A;  2KCM A;  5DNF A;  4A93 B;  2PO4 A;  3DUZ A;  3PMF A;  1EY0 A;  1IHZ A;  3VR5 A;  3CC4 A;  2DJF C;  3I8Z A;  1Q46 A;  1QE6 A;  1BUV T;  1PLF A;  3A74 A;  1XMO L;  3V96 A;  1F2M A;  4X64 Q;  1LM0 A;  1LTI D;  1STE A;  2M2L A;  5M5Y H;  1TKW B;  4H7B A;  4A3K B;  1AZQ A;  4B3T Q;  1G91 A;  5EPJ A;  4G57 A;  1GUS A;  4O42 A;  3CC2 A;  4OIK A;  1PH8 A;  4G4K A;  4LFB Q;  4B3M Q;  1M1K C;  3S9W A;  4B9X A;  2PZU A;  1HTL D;  5LHY 1;  1CT1 D;  3CU7 A;  1PRT C;  3OWE B;  1HZB A;  1Y1V G;  1BBU A;  4H02 A;  4CDD C;  1BBX C;  4DR6 Q;  4UP7 A;  1EUJ A;  3GTM B;  4MIU A;  4C3J H;  1FR3 A;  1SFO H;  3L3O C;  2E5L L;  5CV7 A;  2JA7 B;  2DGY A;  4A3F H;  5M5X B;  1B7Y B;  1I3Q B;  1I4H A;  1VMP A;  1O7Z A;  1D7Q A;  3NWT A;  1YEZ A;  3V2T A;  3WOE A;  4QL5 A;  2UUA L;  4IPG A;  1EY9 A;  1MBY A;  1TWH B;  2V1C C;  2H4O A;  5CV5 A;  4K0K Q;  2F0L A;  4J6H A;  4GNX B;  3DMU A;  3CRL C;  4JBJ A;  1NJI C;  1U0L A;  4EVO A;  1SMY C;  1SXT A;  3MHB A;  3MWY W;  3T1Y Q;  4QF4 A;  5C3E H;  3TBI B;  2R7F A;  1L0Y B;  3A56 A;  2D62 A;  2NVX H;  2WB1 G;  2UUC L;  1IXR A;  2O2L D;  1N33 Q;  2A73 B;  2I46 A;  4BBS H;  1MJC A;  3NK9 A;  3KFU A;  1PH5 A;  3IFD A;  3ITP A;  1G29 1;  3NBH A;  4R4C A;  2F0Q A;  1U4R A;  4KY5 A;  1W3S A;  1CM9 A;  4OX9 L;  2NZO A;  4IPH A;  2J4X A;  3DHQ A;  3OHX C;  2K05 A;  4FNF A;  1BCP C;  4XQN A;  4RKB A;  4AIM A;  1JJ2 A;  1EU3 A;  3H09 A;  4C56 C;  3JAM c;  2C35 B;  4LMQ D;  3NP8 A;  2E2J B;  1TWA H;  3PUW A;  4DR3 Q;  3CP0 A;  2CW0 C;  4DR2 Q;  1XNR Q;  3EQL C;  1UUP A;  3EFX D;  4AYB B;  2IX3 A;  1WTH A;  2F0T A;  5EQ0 A;  2IX1 A;  1SND A;  2E2H B;  2D0P A;  4I65 A;  3F2D A;  1E1O A;  3KBG A;  3UDG A;  4G7Z C;  2EY2 A;  3GD7 A;  3R8B A;  1JC7 A;  4JK1 C;  3S1R B;  3I4L A;  2JYO A;  4Y52 H;  5D65 A;  3VYT A;  4KJN A;  4MHE A;  1QVC A;  1B3Q A;  3J81 E;  3U9S A;  1TWG B;  5L37 A;  1LAC A;  1HR0 Q;  3C3L A;  4A3E G;  1CA5 A;  1EIG A;  1TWC H;  5LMN Q;  1FJG L;  4ZUI A;  3I4N H;  4JC0 A;  3KJO A;  2MP1 A;  3L9A X;  2IX0 A;  4EGV A;  4E6I A;  3J7A F;  1JWS D;  4JI7 Q;  4LF6 Q;  2LY7 A;  4HR7 B;  3S1Q H;  5JEA G;  1BKB A;  3S2H B;  2K14 A;  4QUF A;  3LNN A;  1SYF A;  2F3I A;  1A2U A;  2JEB I;  5IOD A;  1YJN A;  3PV0 A;  1Q7Y C;  4DR4 Q;  1H95 A;  2CVR A;  4JI0 Q;  3HOZ B;  1U4M A;  5KND A;  4JI6 L;  1EQV A;  4C3I H;  2RDF A;  4K2K A;  3W3A A;  1CA6 A;  2L9H A;  1O78 A;  5ELN A;  1VQB A;  2CHB D;  1X3P A;  1K9M C;  2R93 G;  2B2T C;  3RUZ A;  4HJ8 A;  2K1B A;  3SGI A;  2KVM A;  2YTY A;  4LJZ C;  4PZ8 A;  4P73 A;  3HG9 A;  1LTS D;  2E76 C;  2WAQ E;  5E3F A;  4P72 A;  1F2Y A;  1H9S A;  2F0V A;  2XVS A;  2PQA A;  3A55 A;  1RL2 A;  5IGC A;  1EIH A;  3T56 B;  5C4X H;  1U4P A;  2R3Z A;  3HOX B;  3A5Z B;  4BY7 H;  2CWP A;  5IOC A;  1L2F A;  3LX0 A;  1G6P A;  1DJR D;  1S4Z A;  1JOK A;  4RHR A;  3DXJ C;  2ALY B;  2A6E D;  5BN3 A;  3PIO 3;  4OIJ A;  3PIP 3;  4DV2 Q;  1AW7 A;  1XNQ L;  2LSS A;  1N32 L;  2QW7 A;  4KKS A;  3E6Z X;  4DK6 C;  1SAP A;  4GKJ Q;  2IL8 A;  3H3V I;  5C5L A;  3C46 A;  1IBM Q;  3Q8D A;  3MEH A;  2HCI A;  2Q8I B;  1WVL A;  2OXP A;  1S5C D;  1E7Z A;  4PZ7 A;  2K7V A;  4BY1 G;  3OYY A;  1STN A;  4UY8 C;  1H9R A;  4KK7 A;  5FLX c;  1K8G A;  1OXU A;  5D3I B;  2B2Y A;  2QA4 A;  1I3Q H;  4KMU C;  3CCV A;  1SYE A;  5DLQ E;  1BDO A;  4LF9 Q;  2HT1 A;  4LF8 Q;  4F88 A;  4LF7 L;  1NY4 A;  3WDN A;  1TWH H;  1O7Y A;  1E1T A;  1ZEQ X;  3RLO A;  2F4V Q;  1EY4 A;  5KNB A;  3E0J A;  3AFQ A;  1PH3 A;  1XTD A;  4K2L A;  2GVB A;  4KHP L;  5IP9 G;  2AHO B;  4R9W A;  3K7U C;  1FNU A;  4A3L G;  2WB1 B;  3QOL A;  1FL0 A;  1TY2 A;  1B3A A;  5C44 G;  1KRT A;  4DUY Q;  1PTO C;  2CKZ B;  4HIK A;  3N6R A;  5CV8 A;  2Q2T A;  5EJW A;  5CC4 A;  1VQC A;  4DV0 Q;  2ZXR A;  3L0O A;  3M4O B;  2VNU D;  4CDE C;  2K50 A;  4NKL A;  2EYJ A;  4JV5 Q;  4GS3 A;  2KCN A;  3CKI B;  5ELC A;  3HKZ G;  3UI2 A;  4ID6 A;  3CF5 A;  4H13 C;  4MZ9 A;  3ERQ A;  2K33 A;  4HIM A;  2FMM A;  2MO1 A;  2UXD L;  2SOB A;  2QGQ A;  3T13 A;  1U9R A;  1QUQ A;  1M4V A;  3GTQ B;  3QB3 A;  3HGB A;  5J39 A;  3H94 A;  1HNX Q;  4DR5 L;  4NDX A;  1Y1W G;  2WAC A;  2HHH Q; 
#chains in the Genus database with same CATH homology
 2KHJ A;  1V1Q A;  3HOV H;  3M4O H;  3S24 A;  3S1R H;  3BZK A;  3KJP A;  2Q2U A;  1VQ9 A;  5M5W H;  2K75 A;  2K5N A;  1HZA A;  4LW1 A;  2KHI A;  4JV5 L;  1AH9 A;  4FDB A;  2Y0S E;  4JG2 A;  5HGQ A;  1SE8 A;  2VQF Q;  3FHW A;  4IOA A;  4GN4 B;  4DR1 Q;  4O0A A;  3W1B A;  3U4V A;  2F52 A;  4QQB X;  2GVA A;  3JAM i;  3CD6 A;  4A76 A;  2RCN A;  1QZG A;  1UE1 A;  4DR7 Q;  4LNQ A;  3F8T A;  2MFI A;  4IOC A;  3RN5 A;  1JJC B;  4A3M H;  2N3S A;  2OQK A;  1OXT A;  1EOV A;  1WI5 A;  2ES2 A;  4JI7 L;  4LF6 L;  4A3C H;  1I5F A;  4LFA L;  4YY3 L;  5JJK A;  3F2B A;  3HOU H;  1IBK Q;  4OWX B;  5EAY A;  3TS0 A;  1R9T H;  1VQF A;  4LF4 Q;  1HNX L;  1HJP A;  1FVI A;  3DM3 A;  3HOX G;  4GOP B;  3S16 H;  2UUA Q;  4DR4 L;  2JEA I;  3JC6 6;  4DKA C;  3J81 i;  1N8R C;  3H0G G;  1XPU A;  4JI0 L;  3PO2 G;  3EIV A;  1HR0 W;  3HOZ H;  2HHH L;  4DAM A;  4L5T A;  4X65 L;  1K83 H;  3S1M H;  1VCI A;  5LMN W;  1YHB A;  5C0X G;  5C0X J;  3I7F A;  4UP8 A;  3M4P A;  5BR8 Q;  4HJA A;  4GLA C;  3KYH C;  4NB3 A;  4XIG S;  1VQG A;  2E2I H;  3MEF A;  1I94 Q;  4DR1 L;  1E24 A;  4KI0 A;  1CKM A;  1S72 A;  1BBW A;  1PH2 A;  4LFC Q;  2VS1 A;  3UDI A;  4DV1 Q;  4X66 L;  3ULP A;  4GOP C;  3I55 A;  2NVQ H;  3RZO H;  2OTJ A;  3CAM A;  3A0J A;  1EQQ A;  4A3D G;  1J6Q A;  1B8A A;  1D8L A;  3HOW H;  2JA6 G;  2E8G A;  4QY7 A;  4AQY L;  4UPA A;  3AEV A;  1EQR A;  3PO3 H;  1QUQ B;  3M7N A;  4A4I A;  1ASY A;  3CPF A;  1HNZ Q;  1Q81 C;  4A3G G;  5LMU L;  1A62 A;  5HY6 A;  1WJJ A;  4DUZ L;  2UXC L;  3J81 j;  2IHE A;  1VQO A;  1VQM A;  3CME A;  2A1A A;  1X3E A;  3ERS X;  4OO1 I;  1WCM H;  3W1G A;  3L2P A;  3KF6 B;  3CCR A;  4B3R L;  3L7Z C;  3CC7 A;  2CFM A;  3H3V H;  3UE1 A;  1OTC A;  4DV2 L;  4JBM A;  2CQO A;  4JBW A;  4LFC L;  2I5H A;  3HOY H;  4A3B H;  3FKI G;  3GTP H;  1HH2 P;  1Y1V H;  1MKH A;  3MXN B;  4R1J A;  2ZM6 L;  1PV4 A;  4DV3 L;  1VQL A;  2JA5 G;  4LF5 L;  3I4O A;  3G4S A;  4GKK L;  4YWM A;  4X62 L;  2AWN A;  4GOP A;  2B3G A;  4GKJ L;  4R4Q A;  4GNX C;  3GTG H;  2JQO A;  1KC8 C;  2R7Z H;  1A63 A;  1IBM L;  4JCV E;  4IPD A;  1VQD A;  2UXB Q;  4DV6 Q;  3HOV G;  4P71 A;  4EQ5 A;  4KLK A;  3D0F A;  4JBK A;  1PFS A;  3STB D;  2ID0 A;  3T1H L;  2EXD A;  4A3J H;  2N8N A;  1Q86 C;  4JI3 L;  2Q2I A;  1VQA A;  1Z9F A;  1VQ4 A;  4MTN A;  1FJG Q;  4IJH A;  5GQO A;  2A8V A;  2CWA A;  4LF8 L;  1YHQ A;  1XPR A;  1I50 H;  1NE3 A;  2AKW B;  4A3M G;  1LTL A;  1A8V A;  1HZC A;  2PI2 A;  3F2C A;  2F4V L;  1O7I A;  5IYC H;  1XMO Q;  3D31 A;  2VZA A;  2B63 G;  3TEH B;  4A3C G;  1VQN A;  3ZJY C;  2VUM H;  3HOU G;  1OXV A;  1Q82 C;  1YHA A;  2NN6 I;  2WP8 J;  2EIF A;  1UWV A;  2JK8 A;  2VQE Q;  4IO9 A;  3U58 A;  4JI1 Q;  3S17 H;  2UU9 Q;  1E22 A;  3J7Z C;  3F1Z A;  1J5E Q;  2YTX A;  4AYB E;  4DUY L;  3HOZ G;  1MIU A;  4P75 A;  1DGS A;  4GNX A;  1EFW A;  1VQE A;  4DV6 L;  4QGU A;  2NZH A;  2Z0S A;  3E0E A;  1PH6 A;  3J80 c;  4L5R C;  2ZTE A;  1M90 C;  5IP7 H;  1HZ9 A;  4IFD I;  2YTV A;  3KF8 B;  4JI5 L;  1MJE A;  3CW2 C;  1T9H A;  3CCL A;  1JB7 A;  2WFW A;  1AE3 A;  4DV0 L;  3KF6 A;  1NTG A;  3H15 A;  1YIT A;  1IZ6 A;  2KCM A;  1GKH A;  3K7A H;  4DV5 L;  3CCU A;  3CC4 A;  4X6A H;  2XTI A;  4RMF A;  3ULJ A;  1N36 L;  1Q46 A;  1YNX A;  2PMZ E;  1Q1E A;  1C0A A;  3PUY A;  5M3F H;  1JJG A;  4BXX H;  4JI2 L;  2WAQ G;  1K73 C;  3HKZ E;  3A74 A;  1IL2 A;  1XMO L;  4A3I H;  5AJ3 Q;  5IY0 A;  4X64 Q;  3HOW G;  1LM0 A;  3A5U A;  2H5X A;  3AQQ A;  2E5L Q;  1X56 A;  2VQE L;  4YWK A;  1UE5 A;  3PO3 G;  4JI1 L;  1WYD A;  5M5Y H;  4C3H H;  1PHJ A;  3VDY A;  1J5E L;  3S15 H;  4B3T Q;  3GTQ H;  4B3S L;  3J7A 5;  1C9O A;  4NXN Q;  5IT9 c;  3CCE A;  2R7D A;  3RLF A;  3CC2 A;  1PH8 A;  2AWO A;  4JI4 Q;  1WCM G;  3K0X A;  4B3M Q;  4IJL A;  1M1K C;  4LFB Q;  2CCZ A;  3FP9 A;  2UUB Q;  2K4K A;  4A3B G;  5C4J H;  4A93 H;  2K52 A;  2OWO A;  3HOY G;  1NMF A;  1HZB A;  1Y1V G;  1BBU A;  1X55 A;  4H02 A;  2B29 A;  3TRZ A;  4A3E H;  2VQF L;  4DV4 Q;  2IY5 B;  4DR6 Q;  4UP7 A;  1L1O C;  3K80 C;  3HFZ B;  2L15 A;  1EUJ A;  3G48 A;  1Y14 B;  4C3J H;  4YWL A;  2JA9 A;  1SFO H;  2UUC Q;  4YHH Q;  4DR7 L;  2R7Z G;  1PH1 A;  1EYG A;  2E5L L;  3PO2 H;  2HQL A;  4OWT B;  1HNW Q;  3OTO Q;  2DGY A;  4A3F H;  3PUZ A;  4A3K H;  1B7Y B;  1YIJ A;  1KQS A;  1G51 A;  5FLM H;  1IBK L;  1D7Q A;  4OX9 Q;  1K3R A;  4EX5 A;  4LF4 L;  1YEZ A;  4LUO A;  1SLJ A;  4A3J G;  4POG A;  1JE5 A;  2XGT A;  4QL5 A;  3CPW A;  2UUA L;  4IPG A;  1PYS B;  5GAE C;  4LF7 Q;  2N49 A;  2V1C C;  4JI4 L;  1JT8 A;  4K0K Q;  3DLL A;  3M85 A;  1X3G A;  2JJQ A;  1A0I A;  4GNX B;  3PUV A;  1BVS A;  2K5V A;  4JBJ A;  1NJI C;  2UUB L;  1U0L A;  1XPO A;  1N9W A;  3T1Y Q;  4IPC A;  4QIW E;  5IYC G;  4KHP Q;  5BR8 L;  4GN5 A;  5C3E H;  1YI2 A;  1VS0 A;  2R7F A;  4DV4 L;  4TQU S;  4NXM Q;  1I94 L;  2VUM G;  3PF4 A;  5C0X I;  2R93 H;  2VW9 A;  3GTM H;  2D62 A;  4JI8 Q;  1KXL A;  2ASB A;  1L1O A;  2WB1 G;  4YHH L;  1IXR A;  4DV1 L;  2NVX H;  2UUC L;  1N33 Q;  4DNI A;  4BBS H;  3NEL A;  1MJC A;  4P74 A;  1N34 Q;  3I56 A;  3KFU A;  1PH5 A;  3OTO L;  1V43 A;  1HNW L;  1G29 1;  4PZ6 A;  5IP7 G;  2JA7 H;  1LYL A;  3EBE A;  4R4C A;  5M5X H;  2KBN A;  4PG3 A;  1S40 A;  2YU9 H;  1W3S A;  2KEN A;  4OX9 L;  4AH6 A;  2NZO A;  2MQH A;  4IPH A;  3PF5 A;  4YCV A;  1IYJ B;  1X3F A;  3PUX A;  1HNZ L;  3RZD H;  1VQI A;  3S2D H;  1K0R A;  3RN2 A;  3S14 H;  3ULL A;  1Q1B A;  5IYD H;  4AIM A;  3STB C;  5M3F G;  1JJ2 A;  3TS2 A;  2JE6 I;  3I4M H;  5M3M H;  5IYB H;  4BXX G;  5J3B A;  4A3I G;  1C7Y A;  2UXD Q;  2EQS A;  3CCJ A;  3CMA A;  3JAM c;  2C35 B;  4J15 A;  5ELO A;  4L5S A;  2BH2 A;  4NXM L;  3S1N H;  3GTJ H;  4IFD J;  1TWA H;  3PUW A;  3TQY A;  4DR3 Q;  3M9B A;  3CP0 A;  4DR2 Q;  1XNR Q;  2I0Q A;  2BA1 A;  4DAY B;  1PYB A;  3KOJ A;  5JJL A;  4DR5 Q;  2IX1 A;  4NPS A;  3AYH B;  4JI6 Q;  2D0P A;  3F2D A;  1CSQ A;  1E1O A;  3UDG A;  3J81 c;  1Q12 A;  3G71 A;  3GD7 A;  1K8A C;  3K8A A;  5GAD C;  2Y0S G;  4BY1 H;  2ZJP A;  2UXB L;  2PQA B;  4Y52 H;  4BBR H;  1XMQ Q;  1VQ5 A;  1QVC A;  3EN2 A;  3U4Z A;  3LGJ A;  1Z47 A;  4MNO A;  4ALP A;  4A93 G;  2HIV A;  2GN5 A;  1CUK A;  1HR0 Q;  1SMX A;  3RNU A;  1B70 B;  4HJ5 A;  4A3E G;  1YJ9 A;  1TWC H;  2YV5 A;  4JYA Q;  1IBL Q;  5LMN Q;  1FJG L;  3NEM A;  3I4N H;  3I2Z A;  4JC0 A;  3KJO A;  2LXJ A;  2IX0 A;  2ZJQ A;  3GTO H;  2OCE A;  1KL9 A;  4JOI C;  4JI7 Q;  4LF6 Q;  1SN8 A;  4LFA Q;  1AE2 A;  2Z6K C;  4YY3 Q;  3S1Q H;  5JEA G;  1BKB A;  5JEA J;  2E2J H;  5IP9 H;  4A3F G;  1ASZ A;  2VY3 A;  4A3K G;  4DR2 L;  1NMG A;  3GTK H;  1I6H H;  1X9N A;  2K14 A;  1QZH A;  2F3I A;  5FLM G;  2JEB I;  3E9H A;  1YJN A;  1Q7Y C;  3PV0 A;  4DR4 Q;  4A3L H;  1H95 A;  4JI0 Q;  5C44 H;  2UU9 L;  1PA6 A;  1VQ8 A;  4JI6 L;  1L1O B;  3KDF B;  4C3I H;  2E2H H;  3GO5 A;  4DV7 Q;  4PMW A;  3CQZ H;  4POF A;  1XMQ L;  1SRU A;  4OWW B;  5K36 G;  3NBH B;  1GVP A;  1WOC A;  1TWG H;  3CCS A;  1YZ6 A;  4R4O A;  1HR0 L;  3UDX A;  3RR5 A;  2N78 A;  5ELN A;  5C3E G;  1WFQ A;  1VQB A;  4HJ9 A;  4JYA L;  1UEB A;  3GDE A;  3NEN A;  5LMN L;  4OXP A;  1IBL L;  1GD7 A;  4X66 Q;  1K9M C;  1XNQ Q;  2R93 G;  3KLW A;  1N32 Q;  1LUZ A;  3TRE A;  1CSP A;  2RF4 A;  1JMC A;  2FXQ A;  2B63 H;  4BBS G;  4HJ8 A;  4C2M H;  3K81 C;  1FGU A;  1KAW A;  2VL6 A;  1OXS C;  2HIX A;  3SGI A;  1P8L A;  2YTY A;  2ZTC A;  5H1S E;  4HIO A;  2JA7 G;  4JOI A;  4PZ8 A;  4AQY Q;  1YVC A;  2DUD A;  2Z6K A;  2A19 A;  4P73 A;  4DPG A;  2WAQ E;  4X64 L;  5AJ3 L;  3ICE A;  3S2H H;  4P72 A;  1PH4 A;  2PQA A;  4L5Q A;  2R92 H;  4OO1 G;  1RL2 A;  3G6E A;  5LMU Q;  5C4X H;  2ATW A;  4KHZ A;  4DUZ Q;  3J80 i;  2UXC Q;  2JA8 H;  5FJ8 H;  4B3T L;  3A5Z B;  4R4T A;  1CKO A;  1UE7 A;  1KHI A;  4DV7 L;  1TWF H;  4BY7 H;  4NXN L;  2CWP A;  4R4I A;  1L2F A;  5IYD G;  5GAG C;  1E3P A;  1Y1W H;  1VQ6 A;  1G6P A;  1KD1 C;  3I4M G;  1S3O A;  5M3M G;  4YCU A;  5IYB G;  4B3M L;  2ALY B;  4B3R Q;  4LFB L;  1EWI A;  5IWA Q;  3ER0 A;  4GN3 B;  4DV2 Q;  3U50 C;  1XNQ L;  2ZM6 Q;  4LF5 Q;  2LSS A;  1N32 L;  4DV3 Q;  3CCQ A;  2OQ0 A;  1Q8K A;  3IRB A;  4GKK Q;  1NBW A;  4X62 Q;  4DK6 C;  1W2B A;  1PH7 A;  4DR6 L;  4GKJ Q;  3H3V I;  1PH9 A;  1TXY A;  3Q8D A;  1IBM Q;  4UP9 A;  3KDF A;  2KCT A;  3AFP A;  2RHS B;  2PI2 E;  3M3Y H;  3PSI A;  4TVA B;  1E7Z A;  4PZ7 A;  4BY1 G;  3OYY A;  3PIO A;  4BBR G;  4UY8 C;  3PIP A;  5FLX c;  3CCM A;  1K8G A;  3BJU A;  5GRO A;  1OXU A;  3T1H Q;  2QA4 A;  2MNA A;  4JI3 Q;  1I3Q H;  3W5O A;  3HOX H;  1U5K A;  3CCV A;  4RG1 A;  3E9I A;  3BU2 A;  5DLQ E;  3UDF A;  2IHF A;  2YYZ A;  4LF9 Q;  3H0G H;  1CKN B;  4ME3 A;  2HT1 A;  2D0O A;  3HKS A;  4LF8 Q;  3B6Y A;  4LF7 L;  4QJF A;  1NY4 A;  3I4N G;  1TWH H;  5IE8 A;  4K0K L;  1SRO A;  5IWA L;  1E1T A;  3RLO A;  4A75 A;  2NN6 G;  1OXX K;  2F4V Q;  5GAH C;  1YJW A;  4WJ3 M;  2R6G A;  2NVT H;  3AFQ A;  1PH3 A;  1XTD A;  3T1Y L;  1X65 A;  2GVB A;  2K5H A;  5JJI A;  4KHP L;  1KRS A;  5IP9 G;  1KIX A;  1PVO A;  2AHO B;  1VQJ A;  1YBY A;  2RHQ B;  3K7U C;  1QVG A;  1UE6 A;  4AYB G;  4A3L G;  4GLX A;  1FL0 A;  4IFD G;  2I5L X;  2BA0 A;  2ZTD A;  1SR3 A;  4O2D A;  1KRT A;  4JI8 L;  1V9P A;  5C44 G;  4DUY Q;  4LUV A;  1N33 L;  2CKZ B;  1VQP A;  1VQ7 A;  4HID A;  4A3D H;  4HIK A;  1N34 L;  4JI5 Q;  2WB1 E;  4BA1 I;  1EIY B;  2JA6 H;  3OW2 A;  2Q2T A;  4DV0 Q;  1VQC A;  3PGZ A;  1GM5 A;  4WJ4 A;  3M4Q A;  3L0O A;  2ZJR A;  1X54 A;  4LUZ A;  1XJV A;  2VNU D;  2LXK A;  4OON A;  3CXC A;  2K50 A;  1RIP A;  4Y7N H;  4A3G H;  4LF9 L;  5E7N A;  4HJ7 A;  4JV5 Q;  4GS3 A;  4DV5 Q;  2AMC B;  3WWV A;  4GLV B;  2IT1 A;  1N36 Q;  3HKZ G;  1P16 A;  2Q2H A;  3BZC A;  4DK3 C;  2NVY H;  2BH8 A;  4JI2 Q;  3UE0 A;  4BA2 I;  1X6O A;  4APV A;  3CF5 A;  4MZ9 A;  2I5M X;  4HIM A;  2UXD L;  1VQH A;  2MO1 A;  2QGQ A;  3GTL H;  1QUQ A;  2OTL A;  3PCO B;  1QVF A;  3FKI H;  2R92 G;  2MO0 A;  4DR3 L;  2JA5 H;  4B3S Q;  4YCW A;  5C4X G;  1GO3 E;  1XNR L;  2JA8 G;  5FJ8 G;  1HNX Q;  1EIF A;  4DR5 L;  4BY7 G;  1VQK A;  1Y1W G;  1CKN A;  4LWC A;  1L0W A;  2QEX A;  2PNH A;  4XTC S;  2HHH Q;  4X65 Q;  3RLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...