1JE5A

Crystal structure of gp2.5, a single-stranded dna binding protein encoded by bacteriophage t7
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
197
structure length
181
Chain Sequence
MAKKIFTSALGTAEPYAYIAKPDYGNGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATDWADEVEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HELIX-DESTABILIZING PROTEIN
publication title Structure of the gene 2.5 protein, a single-stranded DNA binding protein encoded by bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 41
structure length 181
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1je5A00
2OQ0A 4OWWB 2WFWA 4BA2I 2A19A 2UUAL 2VY3A 2JEAI 2MFIA 1HNZQ 5M3MG 4PZ6A 2Q2TA 3BZCA 4LUZA 2WAQE 2RHSB 4GLVB 4DV6Q 4LF9L 1CSQA 2JA9A 1X3GA 3IRBA 2PI2A 1BKBA 3M3YH 3VDYA 2Q2UA 4B3TL 4LF6Q 2N8NA 3EIVA 2PI2E 5JJKA 3KJPA 3F1ZA 4JG2A 4MNOA 2B63H 1M90C 2LXKA 3ZJYC 4POGA 4DR4Q 5C3EG 4X65L 1PYSB 4LF7L 3S17H 1EIFA 1IBMQ 4R4TA 3JAMc 2EQSA 5BR8L 1HZCA 1LUZA 2UXCL 2NVQH 1HNWQ 2EIFA 4MTNA 4NXNL 3UDFA 1PH2A 4FDBA 4B3MQ 3KYHC 1E24A 4DK6C 5C0XG 2A8VA 1Q46A 2PMZE 4GOPB 5C44H 1SLJA 4KLKA 2VUMG 3K0XA 2VQFQ 1HNZL 1VQKA 3CC4A 2CQOA 2WAQG 3GDEA 3M4PA 1QVGA 5AJ3Q 4OXPA 4P75A 4L5SA 2I5MX 3CMEA 3CCEA 3FP9A 3HKSA 1HZBA 2Q2HA 2ASBA 1YZ6A 4LF6L 2Z6KC 4IJHA 3DM3A 5M3FG 4JI5L 2JK8A 4DR6L 4DR2Q 4DV7Q 1Y14B 4DR4L 1KRSA 3E0EA 3S15H 3NENA 2JJQA 2VZAA 3FHWA 4P73A 1HNWL 2ZM6Q 1NE3A 2L15A 3BZKA 1VQJA 4X6AH 4B3ML 2ZJQA 1B70B 1X56A 3KLWA 1UE7A 2Q2IA 5IYBG 1PH9A 4A3GG 4OO1G 2UXDQ 2VQFL 1YHAA 3JAMi 3CC2A 5AJ3L 2KCMA 4A3MG 3CCQA 4OX9Q 4HIOA 5JJLA 1KAWA 3DLLA 1KHIA 3HOWG 1I5FA 5IY0A 4C2MH 4BY7H 1PV4A 1XPRA 4R4OA 4EX5A 2JE6I 2K4KA 3FKIG 3J7ZC 1IL2A 4JCVE 1YJ9A 2PQAA 4WJ4A 3M4QA 1Q86C 3PIPA 3W1GA 2K14A 2CFMA 2R93H 2ZM6L 3PSIA 2UU9Q 2ES2A 2V1CC 5LMUL 3RNUA 2N78A 4DV1L 3TS2A 1EYGA 2UXDL 3ERSX 1N32L 4A3DH 1YIJA 3HOYG 1OXUA 1WCMG 3ULLA 4HJ9A 4YCUA 2JA5G 4JBKA 3NBHB 4OX9L 2IX0A 3HOZH 5IWAL 3CCMA 4NB3A 3RZOH 4JI8Q 2NN6G 5IYDH 2PNHA 1K73C 2ZJPA 3G48A 5E7NA 1S40A 1VQFA 5H1SE 3K80C 4GLXA 4AQYQ 1J5EL 5GROA 3HKZE 1Q1BA 3G4SA 3KF8B 2F4VQ 1I94Q 3J80c 2R7ZH 1GD7A 2YTXA 1V9PA 2BH2A 3GTQH 1GM5A 1D8LA 1C7YA 1EFWA 3B6YA 2DGYA 2KENA 3CCJA 1VQ4A 2C35B 1VQDA 5GADC 5C0XI 3PUWA 1I6HH 3PO3G 3ULPA 4LF9Q 3KDFA 5M5XH 2E2IH 2B63G 2F52A 4IJLA 5JJIA 3UDGA 4A3BH 4B3TQ 1PH1A 4OWTB 4JI8L 4HIKA 4KHZA 4UPAA 2GVAA 2D62A 3HOXH 4DR3Q 1PHJA 3H15A 3PCOB 1EQQA 3HKZG 1Q82C 1YVCA 4X65Q 3KF6B 1E1TA 3CCRA 1K9MC 2F4VL 1I94L 4BBSH 4IOCA 3NEMA 5C4XH 5IP9H 2E2JH 1VQPA 4JBMA 1Q12A 1UWVA 4NXNQ 2RF4A 3AFQA 1VQOA 1M1KC 2ZTEA 3EN2A 2I5HA 3M9BA 3PUXA 3I55A 1CKNA 3KFUA 1C9OA 3PGZA 2QA4A 4APVA 4B3RQ 4PZ7A 2MO0A 3J80i 4YHHL 4XIGS 1PH8A 4C3HH 1VQNA 4LFBL 3RLFA 4K0KL 3UE1A 4DUZQ 1JJGA 4BXXG 1MKHA 1UEBA 1Z47A 2BH8A 3H0GG 3TREA 3PIOA 5EAYA 3F2CA 3GTOH 3RLOA 1CUKA 1PFSA 3E9HA 4OONA 5JEAG 1U5KA 3F8TA 4DK3C 5FLMH 4HJ5A 4DR3L 1KC8C 4JI5Q 3PO2H 1VQ8A 4Y52H 4DR6Q 1WOCA 2IHEA 1X6OA 4DAMA 1SE8A 4L5TA 3MXNB 3HOUG 4DUYQ 1NTGA 2ALYB 2XGTA 4AH6A 2R92H 4GKKQ 2KBNA 1SMXA 1GO3E 4BY1H 5FLXc 2K5HA 3F2DA 1YHQA 4A93H 3I4OA 2OTJA 2UUCL 1VQHA 1UE5A 1HZ9A 1L1OA 1YNXA 3K7UC 4P74A 3CQZH 4DV2L 4GNXA 2E8GA 5IYCG 4B3SL 1BBWA 1U0LA 1SROA 2A1AA 3GD7A 3HOVG 1G6PA 1XPUA 2JA8H 1YJWA 5JEAJ 4DR7Q 4A3FG 2LXJA 3S1QH 1KIXA 4DUZL 1RIPA 4LW1A 2IY5B 3PUYA 4QIWE 4A3CG 3A74A 3BJUA 1QUQA 4L5QA 4LUOA 1N33L 3S16H 3GTLH 4DUYL 2NN6I 3PUVA 5C0XJ 1A63A 4GKKL 3TS0A 2R7FA 3STBD 3GTKH 3S2DH 1C0AA 1A0IA 4A3DG 1HJPA 1P8LA 2B29A 1QVFA 1Q81C 5LMUQ 2E5LL 4JI7L 4DV1Q 2K75A 4A76A 2DUDA 2Y0SE 2B3GA 1E7ZA 4A3EH 1N32Q 4DR7L 1P16A 3MEFA 4YWLA 3CCSA 1TWFH 4LFCL 4AYBE 3L0OA 1RL2A 5LMNQ 1VQ9A 4A3LH 1PH3A 1S72A 2JEBI 4X66L 5IWAQ 1KRTA 3G6EA 2JA7G 1JMCA 4A3KG 2UXBQ 4WJ3M 3D0FA 2HHHQ 3ICEA 3I4NH 4ME3A 1PVOA 1H95A 1J5EQ 4IPHA 4R4IA 4P72A 1NBWA 3S2HH 3T1HQ 1Q1EA 4JBWA 3TQYA 3S1NH 4LF8Q 2YYZA 3HFZB 3JC66 1K8AC 1VQLA 3OTOQ 4HJ8A 3CPFA 4YCWA 4DV0Q 5LMNW 2E2HH 4HIMA 2OWOA 1BBUA 1DGSA 2Y0SG 4X64L 2HT1A 3CF5A 2N3SA 4HIDA 2RCNA 4A3BG 3AQQA 4R1JA 2MQHA 3M4OH 4IFDG 4DV4L 4AYBG 4JC0A 3K81C 3U58A 1CKOA 3D31A 2ZJRA 3HOXG 4UP8A 5ELOA 2VUMH 1Y1VG 5LMNL 1Q7YC 2UUBQ 2YTVA 2NVTH 1CSPA 1SRUA 1Y1WG 2UXBL 4TVAB 1B7YB 3UE0A 2HHHL 4DAYB 1R9TH 2JA6H 3PUZA 2OTLA 1O7IA 1B8AA 2D0PA 2K5NA 3KDFB 4QY7A 1D7QA 1VS0A 4A3IG 2KHJA 3TRZA 3T1HL 4LF8L 4A3JH 4JI2Q 3OTOL 3M85A 4DR5Q 1OXSC 1PH6A 4DV0L 1ASYA 3WWVA 4P71A 1L0WA 1PH7A 3A5ZB 2HQLA 2ID0A 2K50A 1IBLQ 3L7ZC 3Q8DA 1N8RC 2YTYA 1A8VA 4YHHQ 2NZOA 3RN5A 4K0KQ 4LFBQ 5IYBH 4LFAQ 1W3SA 3H3VI 2UUBL 3RLNA 4EQ5A 4LF5Q 2VL6A 3I2ZA 4A3MH 2VQEQ 1K8GA 2R6GA 1HH2P 4GN4B 4BY1G 1VQ5A 4LF7Q 3RR5A 3PF4A 5C4XG 1UE6A 5J3BA 3HOWH 2NVYH 2WB1E 2Z0SA 3CW2C 3M7NA 1MJCA 3UDIA 2YV5A 1IBKQ 1X9NA 4DKAC 1Q8KA 4A75A 4NXMQ 4IPDA 5C44G 1QZGA 2UUCQ 1XNQL 1KQSA 4JI2L 4DR5L 4GKJL 4DV2Q 2D0OA 4DPGA 3RN2A 4HJAA 3A5UA 1J6QA 4B3SQ 1I50H 3GTJH 1YEZA 1AH9A 3STBC 1IBLL 1V43A 3E9IA 4JBJA 2AHOB 3J81j 2I0QA 3CC7A 1XMQQ 4KI0A 4LFAL 1NY4A 2VS1A 3HOYH 1WCMH 1VQBA 1JE5A 5DLQE 2JA5H 1YHBA 4LF5L 1XJVA 1OXTA 1SN8A 2VQEL 1HNXQ 3PV0A 2WB1G 3W1BA 2HIXA 2MO1A 3CP0A 4R4CA 3KJOA 2HIVA 2F3IA 4QL5A 1XPOA 1N33Q 3CD6A 2WP8J 3S1MH 2K5VA 1K3RA 1VQAA 5IE8A 3F2BA 2CWAA 1IBKL 4GN3B 4YCVA 1QUQB 4NPSA 4NXML 1X3EA 4AIMA 3GTPH 1I3QH 5IP7H 1NMGA 2E5LQ 4JI7Q 4A3LG 5FJ8H 1A62A 4JI3Q 4JI6Q 2VNUD 2KHIA 1ASZA 3I4MH 4JV5Q 1EIYB 3CAMA 4LNQA 4BY7G 4DV3Q 1XMQL 3I4NG 3KF6A 1EUJA 4LFCQ 4GNXC 1L1OC 3OYYA 4X66Q 2AWOA 1K0RA 4IFDI 4POFA 4L5RC 4JYAL 1E1OA 4KHPQ 1LYLA 1UE1A 1HNXL 3U50C 1WJJA 2R93G 1GVPA 5C4JH 2GN5A 1SFOH 3U4ZA 4BBRH 1YBYA 1YJNA 1FJGQ 1TXYA 3ULJA 1G51A 5GAHC 2Z6KA 4X62Q 1QZHA 3SGIA 1YITA 4X64Q 2PQAB 4Y7NH 4JI3L 2VW9A 1XMOQ 4JI6L 3HOZG 4JV5L 3CMAA 4JI0Q 4DV6L 2AWNA 3KOJA 4PMWA 5IT9c 5IYDG 4DV4Q 4DV3L 4IO9A 2R7DA 2JA6G 4QQBX 5M3MH 1VQ6A 1GKHA 2IX1A 1PA6A 4UY8C 1AE2A 1KXLA 2ZTCA 4MZ9A 2R7ZG 3H0GH 4YY3Q 1PH4A 4BXXH 4KHPL 4BA1I 3S1RH 4A3JG 1TWGH 4JI1Q 4DV5Q 4GOPA 1MIUA 1IBML 3LGJA 3L2PA 3I7FA 5K36G 2CKZB 3OW2A 2K52A 1EWIA 1FJGL 1HR0Q 3HOUH 2KCTA 5C3EH 3S14H 4X62L 1IYJB 4QJFA 2CWPA 4GOPC 3J81c 3PO3H 4PG3A 1XMOL 2BA1A 1TWAH 1VQMA 4H02A 1JB7A 1OTCA 3S24A 4DR1Q 1T9HA 4OWXB 1FVIA 1X65A 5IYCH 3PF5A 4JI0L 1PYBA 3H3VH 3J7A5 3U4VA 3HOVH 1JJ2A 2FXQA 5M5WH 4A3FH 3CXCA 3T1YQ 2AMCB 1NJIC 1VCIA 1K83H 1FGUA 3K8AA 1YI2A 1HR0W 4B3RL 1VQGA 5M5YH 4BBSG 5IP9G 4YY3L 4DV7L 2BA0A 3A0JA 4DR2L 4LF4Q 1EQRA 2GVBA 2IT1A 2NZHA 4A3CH 2OQKA 4TQUS 4YWMA 4JI1L 4DV5L 1N34Q 4GKJQ 2ZTDA 1AE3A 5M3FH 1LM0A 3TEHB 1IXRA 1EOVA 1TWHH 2AKWB 4LUVA 1HR0L 1E3PA 3ER0A 3GO5A 2IHFA 1XTDA 4DNIA 2OCEA 1X55A 4JOIA 5ELNA 1XNQQ 4IFDJ 4JI4Q 4IPGA 1MJEA 1WI5A 4IPCA 4C3IH 2QEXA 1HZAA 2ATWA 2QGQA 4GN5A 4R4QA 4DR1L 4RG1A 4UP7A 3G71A 5FLMG 3CCVA 1IZ6A 1CKMA 4O2DA 3GTMH 3PO2G 4A3GH 2MNAA 1Z9FA 4JOIC 2YU9H 3T1YL 1CKNB 1XNRQ 2R92G 3J81i 1KD1C 5GQOA 2CCZA 3AYHB 4O0AA 4A93G 2EXDA 4LF4L 1L2FA 3CCUA 1N36Q 2JA7H 4GS3A 3UDXA 4A3KH 1BVSA 1KL9A 3RZDH 1N34L 5IP7G 3CCLA 1QVCA 1NMFA 5FJ8G 5GAEC 3FKIH 2UU9L 1N9WA 3I4MG 4HJ7A 4J15A 1PH5A 2JA8G 1JJCB 2H5XA 2UUAQ 4XTCS 2JQOA 1VQ7A 3GTGH 1WYDA 2I5LX 2NVXH 4JI4L 4UP9A 1SR3A 1LTLA 4RMFA 1W2BA 2RHQB 1TWCH 3AFPA 3EBEA 3CPWA 1WFQA 1L1OB 1X54A 1S3OA 4C3JH 4PZ8A 4GNXB 1JT8A 1VQEA 4IOAA 3W5OA 5HGQA 5GAGC 1OXXK 3I56A 1XNRL 4GLAC 1Y1VH 4BBRG 4JYAQ 1E22A 5HY6A 2XTIA 1G291 3NELA 4AQYL 4YWKA 4OO1I 4A4IA 3AEVA 2N49A 1Y1WH 1N36L 5BR8Q 4QGUA 1VQCA 4ALPA 2UXCQ 2LSSA 1V1QA 1OXVA 1VQIA 1X3FA 3BU2A 1FL0A 3K7AH 4LWCA 4A3IH 4A3EG
chains in the Genus database with same CATH superfamily
4OWWB 1KDCA 2J0TD 2WFWA 4BA2I 1D5XC 2HCIA 4LUZA 3WOFA 3GTGB 2NVXB 1BO0A 2JA9A 4KKSA 4LAAA 2M2LA 5KGUA 3VDYA 2E2IB 3FPUB 3NQTA 5DEHA 3I3CA 3KJPA 3SK4A 2OEOA 5CC4A 4WFN3 4DR4Q 5C3EG 4X65L 1S5BD 1EIFA 1F9QA 3JAMc 1HNWQ 1LUZA 5KNCA 4B3MQ 1PYWD 3KYHC 4IN3A 3P7JA 1I4GA 5C44H 4B3RL 3K0XA 3NTHA 4A3IB 2WAQG 4OXPA 2WIIB 3CMEA 4DAVA 3HP3A 3OIPA 1I4RA 2EY6A 4IJHA 5D14A 3EJIA 1LTID 4V0BA 1KRSA 2G9HD 2R3ZA 3S15H 1A6XA 3TMEA 3FHWA 3NP8A 2G5DA 4F8MA 3J80E 2ZM6Q 2F1MA 3BZKA 5FO8B 4BY1B 5HURA 5JJZA 2ZJQA 2NVQB 1UE7A 3HRZC 1FNUA 3U9OA 2VQFL 5AJ3L 1U4MA 5JJLA 1B3AA 4HMIA 1KHIA 1O78A 2CQAA 5AFWA 5IY0A 3D8GA 1PV4A 4BY7H 1XPRA 3C46A 4R4OA 3OWFA 2K4KA 4DFAA 5C6AA 3S16B 2PQAA 1Q86C 4QF4A 1LTRD 3PIPA 2WKDA 2CFMA 3N6RA 2UU9Q 4J6HA 2ES2A 1MHWC 3L3OC 1U4RA 5J22A 3J80L 1YIJA 3HOYG 1OXUA 1WTHA 3KLRA 3SE0A 4OX9L 3F2UA 1BQQT 4NB3A 3NHHA 3RZOH 2KEDA 1UAPA 1ZXTA 2PNHA 1WTXA 1EY7A 3G48A 5E7NA 4AQYQ 4GLXA 4RHRA 3T56B 1LT3D 3NTKA 5KNDA 1GD7A 3IFTA 5CORA 2E2HB 2KENA 3NBIA 4K5VA 4WRDA 3PUWA 1I6HH 1CM9A 4LF9Q 2F0SA 1HUMA 3KDFA 2B63G 4IJLA 5JJIA 4IFDH 1PH1A 3HOXH 1PHJA 1FNWA 3PCOB 3HKZG 4K14A 3NSWA 3KF6B 4HSPA 3CCRA 4JBMA 3NEMA 5C4XH 1G91A 3KBXA 1UWVA 3DWPA 1JWMD 1Z6HA 4NXNQ 2EDGA 1M1KC 4A3JB 3EN2A 2I5HA 3PUXA 1K3BC 1CKNA 3PGZA 2HQEA 4PZ7A 2MO0A 3TP6A 1HRJA 1PH8A 1CHPD 4LFBL 4K0KL 3RLFA 3FVQA 2B2VA 2XVSA 4IUTA 4P2CB 3TREA 3F2CA 3PIOA 1CUKA 5M5XB 2F0OA 3F8TA 4DK3C 4N8FA 4M8AA 3I91A 1DOLA 4DR6Q 2IHEA 3HOWB 2R92H 1NTGA 4AH6A 4CDCC 4GKKQ 1SMXA 2K5HA 4A93H 1YHQA 3I4OA 1VQHA 4P74A 4GNXA 2A1AA 1G6PA 1LTTD 1GUWA 5JEAJ 5COYA 3S1QH 1RIPA 2IY5B 1T5XD 2ICIA 4A3CG 1CZWA 5E1FA 2L1BA 1LV9A 4LUOA 3D3RA 4CKEA 3PO2B 3S17B 3CU7A 4DUYL 2NN6I 3PUVA 5C0XJ 1C0AA 3GTKH 2K33A 3S2DH 4A3DG 2TSSA 1JQYD 3L9AX 1SJED 2PQEA 2C9OA 5LMUQ 3GTPB 2RVLA 4XQNA 4DV1Q 1SNDA 5ELBA 2DUDA 4DR7L 2K1BA 3MEFA 5D3IB 4YWLA 3CCSA 2JA8B 3L0OA 1RL2A 1F2LA 1PH3A 5IWAQ 3G6EA 2UXBQ 1SNCA 1IHZA 1CQFA 1J5EQ 1F2ZA 1NBWA 4X3UA 3K58A 3SR1A 1SFOB 4BBRB 1VQLA 3OTOQ 4YCWA 5LMNW 4HIMA 1SE4A 3AQQA 4R1JA 2MQHA 3VYUA 1CKOA 3Q22A 5CV5A 2VUMH 2UUBQ 5LMNL 2FINB 4ME5A 1CSPA 2I46A 3UE0A 5JVG3 1O7IA 2D0PA 4XYOA 3S1RB 2PW7A 2KHJA 4A3IG 3TRZA 1TS4A 4LF8L 3S2HB 4KMUC 4JI2Q 4DV0L 1EY9A 4P71A 4MN3A 4RH6A 3I90A 3A5ZB 2HQLA 1J9OA 3EVQA 3H91A 1IBLQ 3L7ZC 2O5JC 4EQOA 2EJGC 4HMJA 3I2ZA 1K8GA 2R6GA 4WJWA 4BY1G 1VQ5A 2NVTB 5J3BA 1BNZA 2WB1E 4FP5D 1LT6D 2Z0SA 5JVH3 1YNND 1R9TB 1MJCA 1H9SB 4NXMQ 3KBGA 1XNQL 1QE6A 3C2PA 3QR8A 3WDNA 1AH9A 1V43A 3MHBA 5ELFA 4JBJA 2AHOB 1EY6A 3CC7A 3FMCA 4KI0A 5IT9E 1S5FD 2VS1A 4A3GB 3GTMB 1WCMH 5DLQE 4LF5L 5I9PA 4CDEC 3ND8A 1HNXQ 1ESFA 3PV0A 2HIXA 4A3MB 5FO9B 2WP8J 3S1MH 2K5VA 5IE8A 2DNEA 2CH4W 4MIUA 4YCVA 4NPSA 1SMYC 3FKIB 1I3QH 1NMGA 4HSVA 1EZ6A 5FJ8H 5JPNC 2KHIA 3I4MH 4U673 3CAMA 4LNQA 3GTJB 4DV3Q 4KY5A 1EUJA 4X66Q 2AWOA 1K0RA 4IFDI 2BOSA 1UE1A 2K5DA 5IT9L 2JA5B 1LACA 1GVPA 2A73B 2RDHA 1YBYA 5A35A 1TXYA 3M4YA 1DD2A 5GAHC 2Z6KA 5KIXA 1YITA 4Y7NH 4JI6L 3CMAA 4JI0Q 4DV4Q 4PMWA 1PTOC 1BXTA 4FXKC 3X3MA 1Q90A 4XT3B 3K57A 1WVLA 1VQ6A 2IX1A 3E3XA 3R93A 1JWSD 2EXZA 3DWAA 4MZ9A 3I4LA 4ZQ3A 3BS1A 4A3JG 5JEAH 1TWGH 1MIUA 3LGJA 1ENCA 3I7FA 5K36G 2CKZB 3T13A 3OW2A 2K52A 1EWIA 1FJGL 3HOUH 3Q24A 3J81c 2BA1A 1VQMA 4DR1Q 5C0XH 1T9HA 5IYCH 1KNEA 1A15A 2Q8TA 3T1YQ 1DM0B 2AMCB 1NJIC 3PIP3 1K83H 1YI2A 1HR0W 2MP1A 5IP9G 2EYPA 1EQRA 2IT1A 4JI1L 1UUPA 2X6LA 4DV5L 3H0GB 5M3FH 3TEHB 2XRQD 3KK7A 2K28A 5D65A 1EOTA 1SYEA 4ABNA 1HR0L 3GO5A 1JOQA 2RA4A 2OCEA 3C1FA 1IL8A 1VDZA 3S14B 1WI5A 2QEXA 4C3IH 1ZYRC 3PO3B 5FLMG 3CCVA 1IZ6A 1CKMA 1TWAB 1QNKA 2QCPX 3PO2G 3MZ5A 4FF3A 4OO1H 2SEBD 3IAYA 1XNRQ 5GQOA 3AYHB 2EXDA 3CCUA 1N36Q 4A3KH 5M5YB 5BN3A 5EKKA 2DY8A 2AUKA 3V2TA 3K5NA 1NMFA 2EYMA 2UU9L 1N9WA 2JA8G 2UUAQ 3I8ZA 4XTCS 1WYDA 1AP0A 2AQ1B 3A8IE 3GP7A 4RMFA 1TWCH 1IW7C 5EJWA 3CPWA 3LWEA 3SK5A 4PZ8A 2K7VA 3E5SA 3MC0B 4IOAA 2EY2A 4GLAC 3GV3A 4RAUC 4BBRG 4JYAQ 3RZOB 4QUFA 4AQYL 5EQ0A 3AEVA 1IKMA 1O7ZA 4ALPA 2UXCQ 2JA7B 3H09A 1OXVA 3K7AH 4H13C 2A19A 2RQXA 1HNZQ 2Q2TA 4PZ6A 3PIO3 2A6EC 2PZWA 4ZYSA 4LF9L 4DV6Q 4DF7A 1CSQA 1I6HB 1X3GA 4LF6Q 2PI2E 5JJKA 4X3TA 4JG2A 1M90C 4POGA 4QCLA 4CBVA 5D3DA 3HOXB 1I4QA 1PYSB 4K2KA 2RBMA 1H9MA 1KAAA 4NXNL 1E24A 2A8VA 1VMCA 4GOPB 1SLJA 4KLKA 5JOBA 5ISRA 1WTVA 3GTOB 3GDEA 4P75A 3CCEA 3HKSA 3DM3A 2XN9C 3I73A 2JK8A 4DR6L 3R8BA 2Z1CA 1T5EA 1NCVA 4P73A 1NE3A 1RCVD 4A93B 2DNCA 2NTTA 1B70B 1X56A 3KLWA 2Q2IA 4IUPA 4A3GG 2UXDQ 2QW7A 1YHAA 3JAMi 1RJTA 2EJMA 4A3MG 2B2UA 2Q8IB 1TR5A 4HIOA 2TMPA 1KAWA 1MSGA 3DLLA 2L0CA 4EX5A 1SYDA 2PW5A 3FKIG 4C56C 3DM1A 1JC7A 2X69A 3J7ZC 1YJ9A 2B2UC 2XWJB 3M4QA 3BDLA 4K2LA 2O4XA 1SYCA 3HGBA 4HAEA 2EPBA 4FNFA 3PSIA 3GTKB 2WB1B 1E0BA 4RCNA 5LMUL 3RNUA 4DV1L 3NE5B 1L0XB 1HA5A 2L9HA 2AQ3B 3ULLA 1BCPC 4YCUA 2JA5G 4JBKA 5IWAL 2F0KA 3CCMA 1F2MA 2NN6G 1S40A 4C2MB 3K80C 1J5EL 5GROA 3G4SA 2K01A 3KF8B 2EVBA 1I94Q 3J80c 1LTBD 2R7ZH 2YTXA 5CBEE 3GTQH 1GM5A 1D8LA 3OOCA 1EFWA 2EE1A 2RSNA 3B6YA 2F0HA 2PNRC 1PTOH 1X3QA 4B9XA 3CCJA 1SBBB 1VQ4A 1WTPA 4HR7B 1B53A 5C0XI 4DAYA 2ENBA 3ULPA 4B9WA 2F52A 4RA8A 3UDGA 1SE3A 4A3BH 4B3TQ 4JI8L 4HIKA 4DR3Q 4KHZA 3HOZB 4DAPA 5CV4A 3H15A 2EJFC 1U4PA 1EQQA 3CHBD 1Q82C 1YVCA 5C5MA 2F4VL 4BBSH 2E2JH 4CDDC 3NXWA 3IKJA 5EKIA 4OELB 5FK9C 2RF4A 1TU2B 3T4AC 2QA4A 1D1KA 2F3VA 2ZXOA 1VQNA 1AN8A 3BVMA 2F0VA 1LTSD 1BDOA 2BH8A 3H0GG 1Z47A 2PZUA 4OO1I 1PFSA 2LKVA 4OONA 1KC8C 1EYAA 4CKBA 4DU9A 1PRTC 1WOCA 1H9RA 1QG7A 4OIJA 3MXNB 3P20A 3GV6A 1F77A 4O42A 3PO3G 1HQMC 1UE5A 1L1OA 4ODGA 3CQZH 1CA6A 1RHPA 1Z7TA 3SVMA 1YJWA 2WINB 4A3FG 3MA2B 1KIXA 4DUZL 4LW1A 2D5DA 4CJ2C 1QUQA 2CHBD 3G7LA 4UHVA 1SNQA 2QF7A 3X3NA 3GTLH 1NNXA 2VXWA 5CYUA 3M4OB 4RHSA 1ET6A 4G4KA 4XQJA 4A76A 3HS0C 5HGTA 2Y0SE 2B3GA 4A3EH 1M8AA 1GUTA 3E0JA 3I4MB 1TWFH 4AYBE 1QB5D 2F0DA 1S72A 2JEBI 4X66L 3TZUA 2JA7G 1K8MA 1E2VA 2EY5A 2HHHQ 1SMYD 4FF1A 1A3VA 4V190 3I4NH 1TY0A 4XDXA 3HEJA 4ME3A 5I6WA 1PFBA 4CJ1B 4IPHA 1FR3A 1EYCA 3TQYA 3TSSA 2SDFA 5CGKA 3CPFA 1AW7A 2OWOA 2HT1A 1B9MA 3A8KE 4IFDG 5KRUA 4Y7NB 5IIFA 4DV4L 3U58A 3NUCA 3T16A 3HOXG 1SNMA 1FNVA 1I4XA 1SRUA 5KYIA 1Y1WG 4TVAB 1B7YB 3PUZA 2OTLA 5C5LA 1B8AA 3KDFB 1SXTA 2BE5C 3J7YW 2J7ZA 3T1HL 1GJXA 3M7GA 3M85A 4GKJQ 4HN7A 1PH6A 1ASYA 3S1NB 1L0WA 1PH7A 5LL6X 2K50A 2DJFC 3Q8DA 2BDNA 2YTYA 1N8RC 4YHHQ 2NZOA 3FEWX 3SDZA 3DEOA 1VF7A 4EQ5A 1STGA 4LF7Q 2SOBA 4H7BA 3DUZA 4KN7C 2LS01 4A75A 4IPDA 5M3FB 1QZGA 2UUCQ 2XWBB 4K8IA 3OWEB 4DR5L 1I50H 2F0QA 1YEZA 3Q23A 3E9IA 2I0QA 4ZUJA 4LFAL 2O2LD 4N8X1 1GUNA 3HOYH 1CI3M 1VQBA 1OXTA 1SN8A 2VQEL 2WB1G 3NWTA 3KUPA 3KJOA 1XPOA 4NP5A 1RTOA 2B2VC 4A3KB 1IBKL 3K5MA 4GN3B 4IUVA 2RCFA 3VYTA 1NUCA 1CT1D 2KOLA 2M00A 5IP7H 3BZDB 4JI7Q 2Z8LA 3A54A 2C5CA 4K8JA 4PV1C 1ASZA 4K6DA 4JV5Q 1EIYB 4C1NK 1XMQL 2PPBC 3KF6A 4I7ZC 4LFCQ 1TWCB 1FYCA 4GNXC 3QOJA 4L5RC 4JYAL 4KHPQ 1ICWA 1D1IA 5KYLA 2R93G 3V96A 2SNSA 3OMCA 1YJNA 1K8OA 3DMUA 3ULJA 1IW7D 4I65A 1QZHA 4KD3A 2QKIC 3K7AB 1XMOQ 2RKSA 4JI3L 2VW9A 3HOZG 3K5OA 1CQVA 3K5LA 4DV6L 2AWNA 5IT9c 5IYDG 2R7DA 4QQBX 2N55A 1ML0D 1TT2A 5M3MH 1GKHA 2CW0C 4RKBA 1Q8IA 4EVOA 2F03A 1KXLA 1YNJC 4YY3Q 1ENFA 1PH4A 4BA1I 2A68C 4B08A 1EIGA 4MTKA 1HFNA 3J7AF 1A3UA 2KCTA 4OIKA 1HQRD 4TRDA 4X62L 1HA6A 1IYJB 1XX8A 4QJFA 4L6TB 1OTCA 1JB7A 5CV7A 2PO4A 4OWXB 1FVIA 1X65A 1I4PA 2EY1A 1PYBA 3H3VH 3J7A5 1JJ2A 1B50A 2FXQA 5M5WH 4NKLA 1ONLA 1G8ZD 1NAPA 4LF4Q 2BA0A 1HHVA 4A3CH 2OQKA 4TQUS 4YWMA 4KTAA 1N34Q 3VR4A 1LM0A 2Z4HA 1TWHH 1EOVA 1B4OA 3DXJC 1GHKA 2QILA 1E3PA 3ER0A 5E3FA 2IHFA 1XTDA 4JOIA 1F2YA 4KHVA 4CJ0B 2PZTA 5FOBB 2ATWA 2QGQA 5G3LD 5I4DA 4RG1A 4UP7A 4PMCA 1J8IA 3BDCA 2P5ZX 1JR0D 4JOIC 1V1PB 4M1UB 1SNPA 4DXFA 3HOVB 4N9TA 1HXYD 3NQIA 4N9PA 3J81i 2CCZA 3UDXA 1RDPD 5ELEA 3QWNA 5FJ8G 2I07B 3I4MG 4J15A 1JJCB 2H5XA 4PNYA 2JQOA 3GTGH 2I5LX 2NVXH 4JI4L 2L55A 1A2UA 2A6HD 3AFPA 3A7LA 4G57A 1S3OA 1KTKA 5FO7B 1Y8PB 3W5OA 5HGQA 5GAGC 2HDMA 3I56A 4U68A 3GQBA 5KNBA 2OT2A 1E22A 5HY6A 2YU9B 2XTIA 3NELA 4A4IA 4G7OC 2N49A 4DK1A 1HTPA 2LSSA 1VQIA 1BCPD 4LWCA 4ZCKA 1SSOA 4A3IH 2EYJA 3GTQB 5IGFA 2VY3A 4IUUA 4IUNA 3A56A 1S5DD 5T1IA 2KEEA 3BZCA 1PTOB 1EQVA 4DNTB 2F0UA 4RGNA 4H44C 4UDUC 1K28A 3IRBA 1H9SA 1MBYA 4EGVA 5C3WA 4B3TL 2Y0SB 4C3JB 4A3BB 3F1ZA 5I2XA 3VA5A 4AYBB 2O5IC 4KK7A 3ZJYC 1Y1VB 2DN8A 1IBMQ 4R4TA 5BR8L 1HZCA 2NVQH 2EIFA 2VB3X 1PH2A 5EPKA 1SNOA 1I6VC 1TS3A 4FDBA 3VR3A 2E2JB 4DK6C 5C0XG 3TBIB 1SDFA 2VQFQ 2PCFB 1VQKA 2CQOA 1QVGA 5AJ3Q 1AZQA 2F0JA 2I5MX 2KQ3A 2XIWA 1HZBA 1EYDA 2JP1A 3S9WA 2Z6KC 1U4LA 3TP7A 5M3FG 2F0FA 4DR2Q 4DV7Q 1Y14B 4CDFC 4DR4L 3E0EA 2JJQA 2VZAA 2H1EA 1D5ZC 1HNWL 3QIAA 2L15A 4FF2A 1VQJA 4B3ML 1DCZA 5NUCA 2WKCA 5C4ZA 3CQZB 5IYBG 4OO1G 1STAA 3KLSA 5C44B 5DM73 3O13A 1PRTD 4L63B 4OX9Q 2IWHA 1KLGD 3HOWG 1I5FA 1PZID 3OW7A 1IL2A 5LHY1 4R8IA 4WJ4A 1IKLA 2F0NA 3MTSA 2ZM6L 3P1HA 3S15B 2KUMA 3TS2A 1PTOF 4OHJA 1EYGA 3OPOA 4HJ9A 4RGTA 3NBHB 2B2YA 4ILWA 2QDLA 1GHJA 2IX0A 4E6IA 1TWFB 4S3SA 3ONAB 5TSSA 2ZJPA 4BY7B 5H1SE 4HTHA 3I4NB 2KA7A 2B2YC 2X6GA 1STHA 2A74C 1KDAA 2RDFA 1V9PA 5FLXE 3EA6A 1LTAD 4FO2A 5K36H 1RKNA 4Z9CB 1QILA 4HCEA 2C35B 1VQDA 1V1OA 4TSSA 4C1NI 4XYQA 5M5XH 1NR2A 4F88A 2L5TA 5CV8A 2GVAA 4JK1C 1K9MC 1AEXA 4HCSA 5IP9H 5EKLA 1VQPA 1Q12A 4BWGB 1RTNA 1B2TA 2ZTEA 3MXUA 4ZUIA 1C9OA 2FJ2A 5J1ZA 4APVA 5FLXL 5EPLA 4YHHL 3J80i 4K6LA 4C3HH 2ICEC 3UE1A 2A69C 4BXXG 1MKHA 1UEBA 3MWYW 3RUZA 2BE5D 3RLOA 4LF7L 5FLMH 1U5KA 3MAQA 3PO2H 3S17H 4JI5Q 1IYVA 4Y52H 1GUGA 4DAMA 1SE8A 4L5TA 1RODA 4RCOA 4DUYQ 2ALYB 2XGTA 2KBNA 3TP8A 1NSNS 4XXEA 2UUCL 1HZ9A 3K7UC 5EBDA 5C4XB 3TP5A 1BBWA 1U0LA 1SROA 3GD7A 3HOVG 2JA8H 4DR7Q 2F0PA 2MHVA 2LXJA 3NPPA 4L8JA 3QB3A 3OIQA 3A8JE 4OL7A 2MGSA 3PUYA 4QIWE 1H9KA 3A74A 4L5QA 1S5ED 2QDBA 5J39A 1KDBA 2E75C 1FD7D 4GKKL 2R7FA 2R92B 4KJOA 4R9WA 1HJPA 1P8LA 1TS5A 2B29A 2NTSA 3SXHA 1SE2A 1QVFA 1Q81C 1HFGA 3MXGA 4JI7L 2K75A 3HG9A 1JWUD 4LK1C 1BCPB 1E7ZA 5T1GA 1N32Q 4LFCL 5LMNQ 4A3LH 4RFBA 3S1QB 2HD3A 2E2DC 4HEDA 4QB4A 1JMCA 3D0FA 1PVOA 1H95A 1EEID 2JYOA 3S2HH 3ITPA 1AFPA 3VR6A 3HFZB 2F3WA 3JC66 4LF8Q 1K8AC 1TIID 1B1ZA 4JPBW 4DV0Q 4DN4M 3S2DB 1YNNC 1BBUA 1DGSA 5C4HA 2Y0SG 4C3JG 4HIDA 5IGBA 4A3BG 1S5CD 3AU7A 4AYBG 4UP8A 5ELOA 5G3LF 1Y1VG 2K5WA 1Q7YC 4H0LC 2YTVA 2NVTH 4OGQC 5M3MB 2UXBL 4DAYB 1R9TH 1DOKA 1F9RA 2JA6H 4KN4C 4QY7A 1VS0A 2XSCA 2D2CC 2BCOA 5CBAE 3TZDA 2KJXA 3R3OA 3OTOL 1OXSC 3EQLC 3R2IA 3WWVA 2EOTA 1G2TA 1JCKB 4EQPA 1A8VA 1YNJD 1RF2D 1W3SA 2UUBL 3BYYB 3QG1A 3RLNA 4LF5Q 2KHSA 2VL6A 2VUMB 1BUVT 4A3MH 4GN4B 1HH2P 1PRTB 3PF4A 3DWQA 2NVYH 3CW2C 2A5HA 3G6JB 2YV5A 1DYQA 2CH4A 4DKAC 5C44G 1TWHB 2H4OA 1XXGA 2NB0A 4JI2L 4DV2Q 2D0OA 1BCPF 2B2WA 3T51B 4HJAA 3A5UA 1J6QA 4B3SQ 3SK8A 2KCCA 3D4RA 1JOOA 3GTJH 3STBC 1IBLL 1EU3A 3J81j 1R4PB 4LMQD 3KF8A 3R2TA 1W6JA 1CHQD 1JE5A 2JA5H 3H3VC 1EY5A 3MXPA 3ZYYX 2MO1A 3CP0A 4R4CA 1N33Q 2HIVA 2F3IA 4QL5A 2NN6H 5BN5A 3IL8A 2J4XA 1QUQB 4NXML 5BN4A 3A7AB 2ZXRA 3CRLC 1X3EA 4AIMA 1QNUA 4PQXA 2E5LQ 4JI6Q 2VNUD 4JW0A 4BY7G 1ILPA 3I4NG 5C3XA 2AQ2B 1MD2D 1L1OC 4G7HC 3NK9A 4DGZA 2BDOA 1LYLA 1HNXL 2B8GA 1WCMB 3D4WA 2NWGA 4EQNA 5C4JH 1FJGQ 3S1MB 1G51A 2K6AA 3SEBA 3Q6SA 1C48A 4IQZA 2K04A 3OHXC 3SGIA 4X64Q 2PQAB 1I3QB 2EYLA 3KOJA 4IO9A 3MXNA 4DV3L 1PRTF 1EY0A 2LFNA 1W6KA 4UY8C 3H6MA 2ZTCA 3H0GH 2NUCA 4JI1Q 4DV5Q 1IBML 3HZXA 4R8NA 3KLSX 3K59A 1HCZA 4NDXA 1HR0Q 3NWSA 5C3EH 3S14H 3D6CA 1LLRD 1ZEQX 1I4HA 1STBA 2CWPA 3PO3H 1TWAH 3MVVA 4JI0L 1Y8OB 2B39A 2Q8RE 3U4VA 3MFGA 1PMRA 4A3FH 3K8AA 2IW3A 3LWUA 1SYBA 1VQGA 2F0GA 5M5YH 4DR2L 1EWHA 4DV7L 2NBFA 3A0JA 5C4XG 1EU4A 1SAPA 2RSOA 2ZTDA 5DAUA 1IXRA 1TWGB 5JPMC 2F0TA 1Y8NB 4LUVA 2EYOA 2N88A 4DNIA 1KABA 1PTOD 1X55A 5ELNA 3E6ZX 3HOUB 4IPGA 4KV6A 4IPCA 1DOMA 1HZAA 1EY8A 4GN5A 2JSOA 4R4QA 3I70A 4DR1L 1B9NA 4WORA 3AMUA 3T1YL 3QO2A 1CKNB 2R92G 1KD1C 2F4IA 5IGCA 4O0AA 3VYSA 4A93G 1EQTA 1K83B 1LABA 4GS3A 1BVSA 3RZDH 2JA7H 3CCLA 5IP7G 3BVZA 5GAEC 3JAME 4XQQA 5IGDA 4HJ7A 1PH5A 1D2BA 1PFNA 5F2DA 5ELCA 4UP9A 3VR5A 3MEHA 1MGSA 2RDGA 4X3SA 2RHQB 3EBEA 4C3IB 4GNXB 1X54A 2PYKA 1VQEA 1OXXK 1A3TA 3PMFA 1XNRL 2HCCA 3BDOA 2SNMA 1O80A 2Z4IA 1Y1WH 1N36L 1BBXC 4QIWB 4O1NA 4QGUA 1VQCA 4KY7A 1X3FA 1ZYRD 3GTOH 1PDQA 2MPMA 1LT5D 2OQ0A 2UUAL 3JAML 2JEAI 2MFIA 5M3MG 2FFKB 2WAQE 2Z9HA 2RHSB 4GLVB 3TN2A 1LO5D 3M3YH 2PI2A 1BKBA 1XTCD 3T53B 2LMCB 2Q2UA 3RMHA 2N8NA 3EIVA 3FRPB 1TVXA 4MNOA 2B63H 2LXKA 2KVMA 1QOHA 2EQSA 2UXCL 4MTNA 3UDFA 4RWSC 4MHEA 4DNRB 1Q46A 2PMZE 1H9JA 4RKLA 2VUMG 4ZK9B 1HNZL 4CKCA 3CC4A 4L5SA 3M4PA 4KKTA 1EWCA 1O7LA 2L12A 3FP9A 4C3HB 2Q2HA 2ASBA 1YZ6A 4ZRZA 1ESRA 4LF6L 2JN4A 1F9PA 4JI5L 2K32A 4IUQA 5EPJA 3NENA 2HUGA 1DZ1A 2A6ED 1JE4A 4F7XA 4X6AH 2EZVA 2A69D 1PH9A 2M9VA 1LTGD 4BS9A 3OMGA 1GUOA 3CC2A 1UEAB 4RGMA 1SYGA 2KCMA 3CCQA 1CA5A 4LJZC 2FMMA 4C2MH 3W3AA 4Q0FA 1GUSA 2KECA 1HUNA 2JE6I 4JCVE 1JOKA 1UNSA 1M4VA 3W1GA 4Q5VA 2K14A 1WTRA 2R93H 1TKWB 2V1CC 4ULLA 2N78A 2K05A 2UXDL 3ERSX 1N32L 4A3DH 1D6EC 1CTMA 1WCMG 4IALA 3ERQA 5LL6S 4IZ8A 4DK0A 3HOZH 4JI8Q 5IYDH 1K73C 1VQFA 1Y69U 1ICFB 2FHTA 2IPKD 4FXDA 1EEFD 3HKZE 1Q1BA 2F4VQ 1WTQA 1DJRD 1XYIA 2F0MA 1C7YA 2FMCA 3C1EA 3SHLA 2DGYA 4ZKBB 5FKAC 1ILQA 5GADC 2EYFA 2E2IH 2LY7A 4OWTB 4UPAA 3W2DA 2D62A 1F9SA 2IL8A 3VR2A 4KY6A 2JA6B 4X65Q 1E1TA 1I94L 3U9SA 4IOCA 2F0EA 2CVRA 4X3KA 2G9DA 2R7ZB 2XNAC 3AFQA 1NR4A 1VQOA 1BF4A 1V1PA 3M9BA 3I55A 3KFUA 4B3RQ 1WTWA 4XT1B 4XIGS 2L11A 1STYA 3AB9A 1DXMA 4DUZQ 3A55A 1JJGA 1A2TA 5EAYA 5JEAG 3E9HA 4HJ5A 1OO9B 1U9RA 4DR3L 1VQ8A 1MI2A 5IODA 1X6OA 3HOUG 3M4OH 2NVYB 2D9UA 1BR9A 1GO3E 4BY1H 1PLFA 5FLXc 3F2DA 2OTJA 3EFXD 1CFMA 1YNXA 1TS2A 4BBSB 4DV2L 3WOEA 2E8GA 5IYCG 4B3SL 1B3QA 1XPUA 3OSOA 5K5PA 4ZAIA 2L4NA 1SJHD 1IYUA 4IURA 2IJ0A 1S4ZA 4NMZA 1ENAA 1B44D 5L37A 3BJUA 1BOSA 3DHQA 1JORA 3C3LA 1N33L 3S16H 5I6YA 5CR3A 3LNNA 1A63A 3TS0A 3STBD 1QWYA 1EY4A 3IFDA 1TY2A 1A0IA 2VB2X 4C3IG 5ELDA 1SEBD 2E5LL 2NZ1D 1X32A 1CK1A 4FVMA 1P16A 2ZXPA 5CV6A 1VQ9A 2WV6D 1KRTA 2GA4B 3FPPA 4A3KG 4WJ3M 1TQOA 3ICEA 3MFYA 4R4IA 4P72A 3T1HQ 4YIJA 1Q1EA 4JBWA 5IOCA 3S1NH 5C4JB 4J1MA 1XWEA 2YYZA 2XRSD 5IGGA 3GTLB 5M9OA 5CMDA 4HJ8A 2E2HH 1C4QA 2DY7A 2B2TA 4X64L 3CF5A 2N3SA 2RCNA 3BG3A 5CV9A 1STEA 3ND9A 3K81C 4JC0A 5IGEA 3D31A 1HTLD 2ZJRA 1ZKOA 4A3EB 2WACA 5JAVA 3QJYA 2B2TC 1STNA 2HHHL 4CHTB 3J7AV 3BYTB 2K5NA 5KEEA 1D7QA 1MSHA 3P75A 1PFMA 4A3JH 4DR5Q 4C3HG 4CGYB 5C3EB 1O7YA 2ID0A 3DEPA 3D6WA 1R4QB 3RN5A 4K0KQ 4LFBQ 5IYBH 4LFAQ 1X3PA 3H3VI 1HPCA 2VQEQ 4A3FB 2WAQB 1EIHA 3RR5A 1II3A 1UE6A 3HOWH 4GZYC 1QCBD 3M7NA 3UDIA 1IBKQ 1AZPA 1X9NA 2R61A 1Q8KA 3NBHA 4KKUA 2E74C 5EBCA 2B8FA 1G2SA 1KQSA 4GKJL 3I72A 4DPGA 3RN2A 4QUCA 2KCNA 4FYDA 1PXUA 4KJNA 5A2QE 1QJOA 2PMZB 1XMQQ 2F0LA 1NY4A 4K5XA 1YHBA 1XJVA 1JICA 2F0IA 4NW2A 3W1BA 3CD6A 1FGBD 1K3RA 1VQAA 3F2BA 3RZDB 1D5MC 2CWAA 1G6ZA 2IX3A 3GTPH 2V4DA 2MJ8A 1KLUD 4DXGA 4A3LG 4JI3Q 1A62A 4PMBA 3J81E 4K5WA 3V05A 2QEJC 1I50B 5A2QL 3OYYA 4POFA 1RD9D 1E1OA 3HOYB 3U50C 1WJJA 5DNFA 2NYZD 2DJGC 1Q3LA 2GN5A 1SFOH 3U4ZA 1Y1WB 4BBRH 1EFID 2OF1A 2ZT9C 3Q0AA 4X62Q 4FXGC 2JXMB 3UI2A 4ID6A 2EYHA 4JV5L 2HDLA 2JA6G 1VMPA 3J81L 1PA6A 3M3YB 1AE2A 2K03A 4JVZA 3URYA 4KHPL 2R7ZG 4BXXH 1WTOA 3S1RH 4GOPA 1DONA 2B63B 1ET9A 3L2PA 1PZJD 4RGOS 3H94A 2MUYA 2K5QA 4F87A 3HKZB 2E76C 3N52A 3FDTA 2F0WA 5DM63 4GOPC 4PG3A 3EROA 1XMOL 4H02A 1JB3A 3S24A 3PF5A 3PQIA 3HOVH 5I9OA 1V8QA 3CRKC 3CXCA 1VCIA 1FGUA 2A6HC 4BBSG 1K0SA 4YY3L 2GVBA 3K0YA 2NZHA 1AE3A 3VYRA 2AKWB 4OEMB 1XNQQ 1WD0A 4IFDJ 4ZLTF 4JI4Q 1E2WA 4DA2A 1MJEA 1GOZA 2CW0D 4J8QA 1CZGA 1PZKD 3G71A 4KD4A 4O2DA 4A3GH 3GTMH 1SYFA 2MNAA 1Z9FA 2YU9H 2A68D 3K6OA 3LX0A 4TKOB 4QMGA 5M5WB 4LF4L 1L2FA 5E4XA 1KL9A 3BVGA 1N34L 1QVCA 5I2YA 3FKIH 4FF4A 1WD1A 1E2ZA 3NTIA 3QOLA 2R93B 5EGTA 2AUJD 4G7ZC 4UAIA 1VQ7A 1KNAA 1EZ8A 1SR3A 1LTLA 5E4WC 1W2BA 4A3DB 1WFQA 1L1OB 2OXPA 4C3JH 1JT8A 1L0YB 1LT4D 3D4DA 4I7AA 2B2WC 3SK6A 4ZKCB 1Y1VH 1EL0A 1G291 3TDQA 4YWKA 3CKIB 3RD4A 1VF5C 1GXDC 5BR8Q 1V1QA 3VA7A 2Z6BA 1C8CA 3BU2A 1FL0A 2BH2A 4A3EG
chains in the Genus database with same CATH topology
2OQ0A 4OWWB 2WFWA 4BA2I 2A19A 2UUAL 2VY3A 2JEAI 2MFIA 1HNZQ 5M3MG 4PZ6A 2Q2TA 3BZCA 4LUZA 2WAQE 2RHSB 4GLVB 4DV6Q 4LF9L 1CSQA 2JA9A 1X3GA 3IRBA 2PI2A 1BKBA 3M3YH 3VDYA 2Q2UA 4B3TL 4LF6Q 2N8NA 3EIVA 2PI2E 5JJKA 3KJPA 3F1ZA 4JG2A 4MNOA 2B63H 1M90C 2LXKA 3ZJYC 4POGA 4DR4Q 5C3EG 4X65L 1PYSB 4LF7L 3S17H 1EIFA 1IBMQ 4R4TA 3JAMc 2EQSA 5BR8L 1HZCA 1LUZA 2UXCL 2NVQH 1HNWQ 2EIFA 4MTNA 4NXNL 3UDFA 1PH2A 4FDBA 4B3MQ 3KYHC 1E24A 4DK6C 5C0XG 2A8VA 1Q46A 2PMZE 4GOPB 5C44H 1SLJA 4KLKA 2VUMG 3K0XA 2VQFQ 1HNZL 1VQKA 3CC4A 2CQOA 2WAQG 3GDEA 3M4PA 1QVGA 5AJ3Q 4OXPA 4P75A 4L5SA 2I5MX 3CMEA 3CCEA 3FP9A 3HKSA 1HZBA 2Q2HA 2ASBA 1YZ6A 4LF6L 2Z6KC 4IJHA 3DM3A 5M3FG 4JI5L 2JK8A 4DR6L 4DR2Q 4DV7Q 1Y14B 4DR4L 1KRSA 3E0EA 3S15H 3NENA 2JJQA 2VZAA 3FHWA 4P73A 1HNWL 2ZM6Q 1NE3A 2L15A 3BZKA 1VQJA 4X6AH 4B3ML 2ZJQA 1B70B 1X56A 3KLWA 1UE7A 2Q2IA 5IYBG 1PH9A 4A3GG 4OO1G 2UXDQ 2VQFL 1YHAA 3JAMi 3CC2A 5AJ3L 2KCMA 4A3MG 3CCQA 4OX9Q 4HIOA 5JJLA 1KAWA 3DLLA 1KHIA 3HOWG 1I5FA 5IY0A 4C2MH 4BY7H 1PV4A 1XPRA 4R4OA 4EX5A 2JE6I 2K4KA 3FKIG 3J7ZC 1IL2A 4JCVE 1YJ9A 2PQAA 4WJ4A 3M4QA 1Q86C 3PIPA 3W1GA 2K14A 2CFMA 2R93H 2ZM6L 3PSIA 2UU9Q 2ES2A 2V1CC 5LMUL 3RNUA 2N78A 4DV1L 3TS2A 1EYGA 2UXDL 3ERSX 1N32L 4A3DH 1YIJA 3HOYG 1OXUA 1WCMG 3ULLA 4HJ9A 4YCUA 2JA5G 4JBKA 3NBHB 4OX9L 2IX0A 3HOZH 5IWAL 3CCMA 4NB3A 3RZOH 4JI8Q 2NN6G 5IYDH 2PNHA 1K73C 2ZJPA 3G48A 5E7NA 1S40A 1VQFA 5H1SE 3K80C 4GLXA 4AQYQ 1J5EL 5GROA 3HKZE 1Q1BA 3G4SA 3KF8B 2F4VQ 1I94Q 3J80c 2R7ZH 1GD7A 2YTXA 1V9PA 2BH2A 3GTQH 1GM5A 1D8LA 1C7YA 1EFWA 3B6YA 2DGYA 2KENA 3CCJA 1VQ4A 2C35B 1VQDA 5GADC 5C0XI 3PUWA 1I6HH 3PO3G 3ULPA 4LF9Q 3KDFA 5M5XH 2E2IH 2B63G 2F52A 4IJLA 5JJIA 3UDGA 4A3BH 4B3TQ 1PH1A 4OWTB 4JI8L 4HIKA 4KHZA 4UPAA 2GVAA 2D62A 3HOXH 4DR3Q 1PHJA 3H15A 3PCOB 1EQQA 3HKZG 1Q82C 1YVCA 4X65Q 3KF6B 1E1TA 3CCRA 1K9MC 2F4VL 1I94L 4BBSH 4IOCA 3NEMA 5C4XH 5IP9H 2E2JH 1VQPA 4JBMA 1Q12A 1UWVA 4NXNQ 2RF4A 3AFQA 1VQOA 1M1KC 2ZTEA 3EN2A 2I5HA 3M9BA 3PUXA 3I55A 1CKNA 3KFUA 1C9OA 3PGZA 2QA4A 4APVA 4B3RQ 4PZ7A 2MO0A 3J80i 4YHHL 4XIGS 1PH8A 4C3HH 1VQNA 4LFBL 3RLFA 4K0KL 3UE1A 4DUZQ 1JJGA 4BXXG 1MKHA 1UEBA 1Z47A 2BH8A 3H0GG 3TREA 3PIOA 5EAYA 3F2CA 3GTOH 3RLOA 1CUKA 1PFSA 3E9HA 4OONA 5JEAG 1U5KA 3F8TA 4DK3C 5FLMH 4HJ5A 4DR3L 1KC8C 4JI5Q 3PO2H 1VQ8A 4Y52H 4DR6Q 1WOCA 2IHEA 1X6OA 4DAMA 1SE8A 4L5TA 3MXNB 3HOUG 4DUYQ 1NTGA 2ALYB 2XGTA 4AH6A 2R92H 4GKKQ 2KBNA 1SMXA 1GO3E 4BY1H 5FLXc 2K5HA 3F2DA 1YHQA 4A93H 3I4OA 2OTJA 2UUCL 1VQHA 1UE5A 1HZ9A 1L1OA 1YNXA 3K7UC 4P74A 3CQZH 4DV2L 4GNXA 2E8GA 5IYCG 4B3SL 1BBWA 1U0LA 1SROA 2A1AA 3GD7A 3HOVG 1G6PA 1XPUA 2JA8H 1YJWA 5JEAJ 4DR7Q 4A3FG 2LXJA 3S1QH 1KIXA 4DUZL 1RIPA 4LW1A 2IY5B 3PUYA 4QIWE 4A3CG 3A74A 3BJUA 1QUQA 4L5QA 4LUOA 1N33L 3S16H 3GTLH 4DUYL 2NN6I 3PUVA 5C0XJ 1A63A 4GKKL 3TS0A 2R7FA 3STBD 3GTKH 3S2DH 1C0AA 1A0IA 4A3DG 1HJPA 1P8LA 2B29A 1QVFA 1Q81C 5LMUQ 2E5LL 4JI7L 4DV1Q 2K75A 4A76A 2DUDA 2Y0SE 2B3GA 1E7ZA 4A3EH 1N32Q 4DR7L 1P16A 3MEFA 4YWLA 3CCSA 1TWFH 4LFCL 4AYBE 3L0OA 1RL2A 5LMNQ 1VQ9A 4A3LH 1PH3A 1S72A 2JEBI 4X66L 5IWAQ 1KRTA 3G6EA 2JA7G 1JMCA 4A3KG 2UXBQ 4WJ3M 3D0FA 2HHHQ 3ICEA 3I4NH 4ME3A 1PVOA 1H95A 1J5EQ 4IPHA 4R4IA 4P72A 1NBWA 3S2HH 3T1HQ 1Q1EA 4JBWA 3TQYA 3S1NH 4LF8Q 2YYZA 3HFZB 3JC66 1K8AC 1VQLA 3OTOQ 4HJ8A 3CPFA 4YCWA 4DV0Q 5LMNW 2E2HH 4HIMA 2OWOA 1BBUA 1DGSA 2Y0SG 4X64L 2HT1A 3CF5A 2N3SA 4HIDA 2RCNA 4A3BG 3AQQA 4R1JA 2MQHA 3M4OH 4IFDG 4DV4L 4AYBG 4JC0A 3K81C 3U58A 1CKOA 3D31A 2ZJRA 3HOXG 4UP8A 5ELOA 2VUMH 1Y1VG 5LMNL 1Q7YC 2UUBQ 2YTVA 2NVTH 1CSPA 1SRUA 1Y1WG 2UXBL 4TVAB 1B7YB 3UE0A 2HHHL 4DAYB 1R9TH 2JA6H 3PUZA 2OTLA 1O7IA 1B8AA 2D0PA 2K5NA 3KDFB 4QY7A 1D7QA 1VS0A 4A3IG 2KHJA 3TRZA 3T1HL 4LF8L 4A3JH 4JI2Q 3OTOL 3M85A 4DR5Q 1OXSC 1PH6A 4DV0L 1ASYA 3WWVA 4P71A 1L0WA 1PH7A 3A5ZB 2HQLA 2ID0A 2K50A 1IBLQ 3L7ZC 3Q8DA 1N8RC 2YTYA 1A8VA 4YHHQ 2NZOA 3RN5A 4K0KQ 4LFBQ 5IYBH 4LFAQ 1W3SA 3H3VI 2UUBL 3RLNA 4EQ5A 4LF5Q 2VL6A 3I2ZA 4A3MH 2VQEQ 1K8GA 2R6GA 1HH2P 4GN4B 4BY1G 1VQ5A 4LF7Q 3RR5A 3PF4A 5C4XG 1UE6A 5J3BA 3HOWH 2NVYH 2WB1E 2Z0SA 3CW2C 3M7NA 1MJCA 3UDIA 2YV5A 1IBKQ 1X9NA 4DKAC 1Q8KA 4A75A 4NXMQ 4IPDA 5C44G 1QZGA 2UUCQ 1XNQL 1KQSA 4JI2L 4DR5L 4GKJL 4DV2Q 2D0OA 4DPGA 3RN2A 4HJAA 3A5UA 1J6QA 4B3SQ 1I50H 3GTJH 1YEZA 1AH9A 3STBC 1IBLL 1V43A 3E9IA 4JBJA 2AHOB 3J81j 2I0QA 3CC7A 1XMQQ 4KI0A 4LFAL 1NY4A 2VS1A 3HOYH 1WCMH 1VQBA 1JE5A 5DLQE 2JA5H 1YHBA 4LF5L 1XJVA 1OXTA 1SN8A 2VQEL 1HNXQ 3PV0A 2WB1G 3W1BA 2HIXA 2MO1A 3CP0A 4R4CA 3KJOA 2HIVA 2F3IA 4QL5A 1XPOA 1N33Q 3CD6A 2WP8J 3S1MH 2K5VA 1K3RA 1VQAA 5IE8A 3F2BA 2CWAA 1IBKL 4GN3B 4YCVA 1QUQB 4NPSA 4NXML 1X3EA 4AIMA 3GTPH 1I3QH 5IP7H 1NMGA 2E5LQ 4JI7Q 4A3LG 5FJ8H 1A62A 4JI3Q 4JI6Q 2VNUD 2KHIA 1ASZA 3I4MH 4JV5Q 1EIYB 3CAMA 4LNQA 4BY7G 4DV3Q 1XMQL 3I4NG 3KF6A 1EUJA 4LFCQ 4GNXC 1L1OC 3OYYA 4X66Q 2AWOA 1K0RA 4IFDI 4POFA 4L5RC 4JYAL 1E1OA 4KHPQ 1LYLA 1UE1A 1HNXL 3U50C 1WJJA 2R93G 1GVPA 5C4JH 2GN5A 1SFOH 3U4ZA 4BBRH 1YBYA 1YJNA 1FJGQ 1TXYA 3ULJA 1G51A 5GAHC 2Z6KA 4X62Q 1QZHA 3SGIA 1YITA 4X64Q 2PQAB 4Y7NH 4JI3L 2VW9A 1XMOQ 4JI6L 3HOZG 4JV5L 3CMAA 4JI0Q 4DV6L 2AWNA 3KOJA 4PMWA 5IT9c 5IYDG 4DV4Q 4DV3L 4IO9A 2R7DA 2JA6G 4QQBX 5M3MH 1VQ6A 1GKHA 2IX1A 1PA6A 4UY8C 1AE2A 1KXLA 2ZTCA 4MZ9A 2R7ZG 3H0GH 4YY3Q 1PH4A 4BXXH 4KHPL 4BA1I 3S1RH 4A3JG 1TWGH 4JI1Q 4DV5Q 4GOPA 1MIUA 1IBML 3LGJA 3L2PA 3I7FA 5K36G 2CKZB 3OW2A 2K52A 1EWIA 1FJGL 1HR0Q 3HOUH 2KCTA 5C3EH 3S14H 4X62L 1IYJB 4QJFA 2CWPA 4GOPC 3J81c 3PO3H 4PG3A 1XMOL 2BA1A 1TWAH 1VQMA 4H02A 1JB7A 1OTCA 3S24A 4DR1Q 1T9HA 4OWXB 1FVIA 1X65A 5IYCH 3PF5A 4JI0L 1PYBA 3H3VH 3J7A5 3U4VA 3HOVH 1JJ2A 2FXQA 5M5WH 4A3FH 3CXCA 3T1YQ 2AMCB 1NJIC 1VCIA 1K83H 1FGUA 3K8AA 1YI2A 1HR0W 4B3RL 1VQGA 5M5YH 4BBSG 5IP9G 4YY3L 4DV7L 2BA0A 3A0JA 4DR2L 4LF4Q 1EQRA 2GVBA 2IT1A 2NZHA 4A3CH 2OQKA 4TQUS 4YWMA 4JI1L 4DV5L 1N34Q 4GKJQ 2ZTDA 1AE3A 5M3FH 1LM0A 3TEHB 1IXRA 1EOVA 1TWHH 2AKWB 4LUVA 1HR0L 1E3PA 3ER0A 3GO5A 2IHFA 1XTDA 4DNIA 2OCEA 1X55A 4JOIA 5ELNA 1XNQQ 4IFDJ 4JI4Q 4IPGA 1MJEA 1WI5A 4IPCA 4C3IH 2QEXA 1HZAA 2ATWA 2QGQA 4GN5A 4R4QA 4DR1L 4RG1A 4UP7A 3G71A 5FLMG 3CCVA 1IZ6A 1CKMA 4O2DA 3GTMH 3PO2G 4A3GH 2MNAA 1Z9FA 4JOIC 2YU9H 3T1YL 1CKNB 1XNRQ 2R92G 3J81i 1KD1C 5GQOA 2CCZA 3AYHB 4O0AA 4A93G 2EXDA 4LF4L 1L2FA 3CCUA 1N36Q 2JA7H 4GS3A 3UDXA 4A3KH 1BVSA 1KL9A 3RZDH 1N34L 5IP7G 3CCLA 1QVCA 1NMFA 5FJ8G 5GAEC 3FKIH 2UU9L 1N9WA 3I4MG 4HJ7A 4J15A 1PH5A 2JA8G 1JJCB 2H5XA 2UUAQ 4XTCS 2JQOA 1VQ7A 3GTGH 1WYDA 2I5LX 2NVXH 4JI4L 4UP9A 1SR3A 1LTLA 4RMFA 1W2BA 2RHQB 1TWCH 3AFPA 3EBEA 3CPWA 1WFQA 1L1OB 1X54A 1S3OA 4C3JH 4PZ8A 4GNXB 1JT8A 1VQEA 4IOAA 3W5OA 5HGQA 5GAGC 1OXXK 3I56A 1XNRL 4GLAC 1Y1VH 4BBRG 4JYAQ 1E22A 5HY6A 2XTIA 1G291 3NELA 4AQYL 4YWKA 4OO1I 4A4IA 3AEVA 2N49A 1Y1WH 1N36L 5BR8Q 4QGUA 1VQCA 4ALPA 2UXCQ 2LSSA 1V1QA 1OXVA 1VQIA 1X3FA 3BU2A 1FL0A 3K7AH 4LWCA 4A3IH 4A3EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ0 A;  4OWW B;  2WFW A;  4BA2 I;  2A19 A;  2UUA L;  2VY3 A;  2JEA I;  2MFI A;  1HNZ Q;  5M3M G;  4PZ6 A;  2Q2T A;  3BZC A;  4LUZ A;  2WAQ E;  2RHS B;  4GLV B;  4DV6 Q;  4LF9 L;  1CSQ A;  2JA9 A;  1X3G A;  3IRB A;  2PI2 A;  1BKB A;  3M3Y H;  3VDY A;  2Q2U A;  4B3T L;  4LF6 Q;  2N8N A;  3EIV A;  2PI2 E;  5JJK A;  3KJP A;  3F1Z A;  4JG2 A;  4MNO A;  2B63 H;  1M90 C;  2LXK A;  3ZJY C;  4POG A;  4DR4 Q;  5C3E G;  4X65 L;  1PYS B;  4LF7 L;  3S17 H;  1EIF A;  1IBM Q;  4R4T A;  3JAM c;  2EQS A;  5BR8 L;  1HZC A;  1LUZ A;  2UXC L;  2NVQ H;  1HNW Q;  2EIF A;  4MTN A;  4NXN L;  3UDF A;  1PH2 A;  4FDB A;  4B3M Q;  3KYH C;  1E24 A;  4DK6 C;  5C0X G;  2A8V A;  1Q46 A;  2PMZ E;  4GOP B;  5C44 H;  1SLJ A;  4KLK A;  2VUM G;  3K0X A;  2VQF Q;  1HNZ L;  1VQK A;  3CC4 A;  2CQO A;  2WAQ G;  3GDE A;  3M4P A;  1QVG A;  5AJ3 Q;  4OXP A;  4P75 A;  4L5S A;  2I5M X;  3CME A;  3CCE A;  3FP9 A;  3HKS A;  1HZB A;  2Q2H A;  2ASB A;  1YZ6 A;  4LF6 L;  2Z6K C;  4IJH A;  3DM3 A;  5M3F G;  4JI5 L;  2JK8 A;  4DR6 L;  4DR2 Q;  4DV7 Q;  1Y14 B;  4DR4 L;  1KRS A;  3E0E A;  3S15 H;  3NEN A;  2JJQ A;  2VZA A;  3FHW A;  4P73 A;  1HNW L;  2ZM6 Q;  1NE3 A;  2L15 A;  3BZK A;  1VQJ A;  4X6A H;  4B3M L;  2ZJQ A;  1B70 B;  1X56 A;  3KLW A;  1UE7 A;  2Q2I A;  5IYB G;  1PH9 A;  4A3G G;  4OO1 G;  2UXD Q;  2VQF L;  1YHA A;  3JAM i;  3CC2 A;  5AJ3 L;  2KCM A;  4A3M G;  3CCQ A;  4OX9 Q;  4HIO A;  5JJL A;  1KAW A;  3DLL A;  1KHI A;  3HOW G;  1I5F A;  5IY0 A;  4C2M H;  4BY7 H;  1PV4 A;  1XPR A;  4R4O A;  4EX5 A;  2JE6 I;  2K4K A;  3FKI G;  3J7Z C;  1IL2 A;  4JCV E;  1YJ9 A;  2PQA A;  4WJ4 A;  3M4Q A;  1Q86 C;  3PIP A;  3W1G A;  2K14 A;  2CFM A;  2R93 H;  2ZM6 L;  3PSI A;  2UU9 Q;  2ES2 A;  2V1C C;  5LMU L;  3RNU A;  2N78 A;  4DV1 L;  3TS2 A;  1EYG A;  2UXD L;  3ERS X;  1N32 L;  4A3D H;  1YIJ A;  3HOY G;  1OXU A;  1WCM G;  3ULL A;  4HJ9 A;  4YCU A;  2JA5 G;  4JBK A;  3NBH B;  4OX9 L;  2IX0 A;  3HOZ H;  5IWA L;  3CCM A;  4NB3 A;  3RZO H;  4JI8 Q;  2NN6 G;  5IYD H;  2PNH A;  1K73 C;  2ZJP A;  3G48 A;  5E7N A;  1S40 A;  1VQF A;  5H1S E;  3K80 C;  4GLX A;  4AQY Q;  1J5E L;  5GRO A;  3HKZ E;  1Q1B A;  3G4S A;  3KF8 B;  2F4V Q;  1I94 Q;  3J80 c;  2R7Z H;  1GD7 A;  2YTX A;  1V9P A;  2BH2 A;  3GTQ H;  1GM5 A;  1D8L A;  1C7Y A;  1EFW A;  3B6Y A;  2DGY A;  2KEN A;  3CCJ A;  1VQ4 A;  2C35 B;  1VQD A;  5GAD C;  5C0X I;  3PUW A;  1I6H H;  3PO3 G;  3ULP A;  4LF9 Q;  3KDF A;  5M5X H;  2E2I H;  2B63 G;  2F52 A;  4IJL A;  5JJI A;  3UDG A;  4A3B H;  4B3T Q;  1PH1 A;  4OWT B;  4JI8 L;  4HIK A;  4KHZ A;  4UPA A;  2GVA A;  2D62 A;  3HOX H;  4DR3 Q;  1PHJ A;  3H15 A;  3PCO B;  1EQQ A;  3HKZ G;  1Q82 C;  1YVC A;  4X65 Q;  3KF6 B;  1E1T A;  3CCR A;  1K9M C;  2F4V L;  1I94 L;  4BBS H;  4IOC A;  3NEM A;  5C4X H;  5IP9 H;  2E2J H;  1VQP A;  4JBM A;  1Q12 A;  1UWV A;  4NXN Q;  2RF4 A;  3AFQ A;  1VQO A;  1M1K C;  2ZTE A;  3EN2 A;  2I5H A;  3M9B A;  3PUX A;  3I55 A;  1CKN A;  3KFU A;  1C9O A;  3PGZ A;  2QA4 A;  4APV A;  4B3R Q;  4PZ7 A;  2MO0 A;  3J80 i;  4YHH L;  4XIG S;  1PH8 A;  4C3H H;  1VQN A;  4LFB L;  3RLF A;  4K0K L;  3UE1 A;  4DUZ Q;  1JJG A;  4BXX G;  1MKH A;  1UEB A;  1Z47 A;  2BH8 A;  3H0G G;  3TRE A;  3PIO A;  5EAY A;  3F2C A;  3GTO H;  3RLO A;  1CUK A;  1PFS A;  3E9H A;  4OON A;  5JEA G;  1U5K A;  3F8T A;  4DK3 C;  5FLM H;  4HJ5 A;  4DR3 L;  1KC8 C;  4JI5 Q;  3PO2 H;  1VQ8 A;  4Y52 H;  4DR6 Q;  1WOC A;  2IHE A;  1X6O A;  4DAM A;  1SE8 A;  4L5T A;  3MXN B;  3HOU G;  4DUY Q;  1NTG A;  2ALY B;  2XGT A;  4AH6 A;  2R92 H;  4GKK Q;  2KBN A;  1SMX A;  1GO3 E;  4BY1 H;  5FLX c;  2K5H A;  3F2D A;  1YHQ A;  4A93 H;  3I4O A;  2OTJ A;  2UUC L;  1VQH A;  1UE5 A;  1HZ9 A;  1L1O A;  1YNX A;  3K7U C;  4P74 A;  3CQZ H;  4DV2 L;  4GNX A;  2E8G A;  5IYC G;  4B3S L;  1BBW A;  1U0L A;  1SRO A;  2A1A A;  3GD7 A;  3HOV G;  1G6P A;  1XPU A;  2JA8 H;  1YJW A;  5JEA J;  4DR7 Q;  4A3F G;  2LXJ A;  3S1Q H;  1KIX A;  4DUZ L;  1RIP A;  4LW1 A;  2IY5 B;  3PUY A;  4QIW E;  4A3C G;  3A74 A;  3BJU A;  1QUQ A;  4L5Q A;  4LUO A;  1N33 L;  3S16 H;  3GTL H;  4DUY L;  2NN6 I;  3PUV A;  5C0X J;  1A63 A;  4GKK L;  3TS0 A;  2R7F A;  3STB D;  3GTK H;  3S2D H;  1C0A A;  1A0I A;  4A3D G;  1HJP A;  1P8L A;  2B29 A;  1QVF A;  1Q81 C;  5LMU Q;  2E5L L;  4JI7 L;  4DV1 Q;  2K75 A;  4A76 A;  2DUD A;  2Y0S E;  2B3G A;  1E7Z A;  4A3E H;  1N32 Q;  4DR7 L;  1P16 A;  3MEF A;  4YWL A;  3CCS A;  1TWF H;  4LFC L;  4AYB E;  3L0O A;  1RL2 A;  5LMN Q;  1VQ9 A;  4A3L H;  1PH3 A;  1S72 A;  2JEB I;  4X66 L;  5IWA Q;  1KRT A;  3G6E A;  2JA7 G;  1JMC A;  4A3K G;  2UXB Q;  4WJ3 M;  3D0F A;  2HHH Q;  3ICE A;  3I4N H;  4ME3 A;  1PVO A;  1H95 A;  1J5E Q;  4IPH A;  4R4I A;  4P72 A;  1NBW A;  3S2H H;  3T1H Q;  1Q1E A;  4JBW A;  3TQY A;  3S1N H;  4LF8 Q;  2YYZ A;  3HFZ B;  3JC6 6;  1K8A C;  1VQL A;  3OTO Q;  4HJ8 A;  3CPF A;  4YCW A;  4DV0 Q;  5LMN W;  2E2H H;  4HIM A;  2OWO A;  1BBU A;  1DGS A;  2Y0S G;  4X64 L;  2HT1 A;  3CF5 A;  2N3S A;  4HID A;  2RCN A;  4A3B G;  3AQQ A;  4R1J A;  2MQH A;  3M4O H;  4IFD G;  4DV4 L;  4AYB G;  4JC0 A;  3K81 C;  3U58 A;  1CKO A;  3D31 A;  2ZJR A;  3HOX G;  4UP8 A;  5ELO A;  2VUM H;  1Y1V G;  5LMN L;  1Q7Y C;  2UUB Q;  2YTV A;  2NVT H;  1CSP A;  1SRU A;  1Y1W G;  2UXB L;  4TVA B;  1B7Y B;  3UE0 A;  2HHH L;  4DAY B;  1R9T H;  2JA6 H;  3PUZ A;  2OTL A;  1O7I A;  1B8A A;  2D0P A;  2K5N A;  3KDF B;  4QY7 A;  1D7Q A;  1VS0 A;  4A3I G;  2KHJ A;  3TRZ A;  3T1H L;  4LF8 L;  4A3J H;  4JI2 Q;  3OTO L;  3M85 A;  4DR5 Q;  1OXS C;  1PH6 A;  4DV0 L;  1ASY A;  3WWV A;  4P71 A;  1L0W A;  1PH7 A;  3A5Z B;  2HQL A;  2ID0 A;  2K50 A;  1IBL Q;  3L7Z C;  3Q8D A;  1N8R C;  2YTY A;  1A8V A;  4YHH Q;  2NZO A;  3RN5 A;  4K0K Q;  4LFB Q;  5IYB H;  4LFA Q;  1W3S A;  3H3V I;  2UUB L;  3RLN A;  4EQ5 A;  4LF5 Q;  2VL6 A;  3I2Z A;  4A3M H;  2VQE Q;  1K8G A;  2R6G A;  1HH2 P;  4GN4 B;  4BY1 G;  1VQ5 A;  4LF7 Q;  3RR5 A;  3PF4 A;  5C4X G;  1UE6 A;  5J3B A;  3HOW H;  2NVY H;  2WB1 E;  2Z0S A;  3CW2 C;  3M7N A;  1MJC A;  3UDI A;  2YV5 A;  1IBK Q;  1X9N A;  4DKA C;  1Q8K A;  4A75 A;  4NXM Q;  4IPD A;  5C44 G;  1QZG A;  2UUC Q;  1XNQ L;  1KQS A;  4JI2 L;  4DR5 L;  4GKJ L;  4DV2 Q;  2D0O A;  4DPG A;  3RN2 A;  4HJA A;  3A5U A;  1J6Q A;  4B3S Q;  1I50 H;  3GTJ H;  1YEZ A;  1AH9 A;  3STB C;  1IBL L;  1V43 A;  3E9I A;  4JBJ A;  2AHO B;  3J81 j;  2I0Q A;  3CC7 A;  1XMQ Q;  4KI0 A;  4LFA L;  1NY4 A;  2VS1 A;  3HOY H;  1WCM H;  1VQB A;  1JE5 A;  5DLQ E;  2JA5 H;  1YHB A;  4LF5 L;  1XJV A;  1OXT A;  1SN8 A;  2VQE L;  1HNX Q;  3PV0 A;  2WB1 G;  3W1B A;  2HIX A;  2MO1 A;  3CP0 A;  4R4C A;  3KJO A;  2HIV A;  2F3I A;  4QL5 A;  1XPO A;  1N33 Q;  3CD6 A;  2WP8 J;  3S1M H;  2K5V A;  1K3R A;  1VQA A;  5IE8 A;  3F2B A;  2CWA A;  1IBK L;  4GN3 B;  4YCV A;  1QUQ B;  4NPS A;  4NXM L;  1X3E A;  4AIM A;  3GTP H;  1I3Q H;  5IP7 H;  1NMG A;  2E5L Q;  4JI7 Q;  4A3L G;  5FJ8 H;  1A62 A;  4JI3 Q;  4JI6 Q;  2VNU D;  2KHI A;  1ASZ A;  3I4M H;  4JV5 Q;  1EIY B;  3CAM A;  4LNQ A;  4BY7 G;  4DV3 Q;  1XMQ L;  3I4N G;  3KF6 A;  1EUJ A;  4LFC Q;  4GNX C;  1L1O C;  3OYY A;  4X66 Q;  2AWO A;  1K0R A;  4IFD I;  4POF A;  4L5R C;  4JYA L;  1E1O A;  4KHP Q;  1LYL A;  1UE1 A;  1HNX L;  3U50 C;  1WJJ A;  2R93 G;  1GVP A;  5C4J H;  2GN5 A;  1SFO H;  3U4Z A;  4BBR H;  1YBY A;  1YJN A;  1FJG Q;  1TXY A;  3ULJ A;  1G51 A;  5GAH C;  2Z6K A;  4X62 Q;  1QZH A;  3SGI A;  1YIT A;  4X64 Q;  2PQA B;  4Y7N H;  4JI3 L;  2VW9 A;  1XMO Q;  4JI6 L;  3HOZ G;  4JV5 L;  3CMA A;  4JI0 Q;  4DV6 L;  2AWN A;  3KOJ A;  4PMW A;  5IT9 c;  5IYD G;  4DV4 Q;  4DV3 L;  4IO9 A;  2R7D A;  2JA6 G;  4QQB X;  5M3M H;  1VQ6 A;  1GKH A;  2IX1 A;  1PA6 A;  4UY8 C;  1AE2 A;  1KXL A;  2ZTC A;  4MZ9 A;  2R7Z G;  3H0G H;  4YY3 Q;  1PH4 A;  4BXX H;  4KHP L;  4BA1 I;  3S1R H;  4A3J G;  1TWG H;  4JI1 Q;  4DV5 Q;  4GOP A;  1MIU A;  1IBM L;  3LGJ A;  3L2P A;  3I7F A;  5K36 G;  2CKZ B;  3OW2 A;  2K52 A;  1EWI A;  1FJG L;  1HR0 Q;  3HOU H;  2KCT A;  5C3E H;  3S14 H;  4X62 L;  1IYJ B;  4QJF A;  2CWP A;  4GOP C;  3J81 c;  3PO3 H;  4PG3 A;  1XMO L;  2BA1 A;  1TWA H;  1VQM A;  4H02 A;  1JB7 A;  1OTC A;  3S24 A;  4DR1 Q;  1T9H A;  4OWX B;  1FVI A;  1X65 A;  5IYC H;  3PF5 A;  4JI0 L;  1PYB A;  3H3V H;  3J7A 5;  3U4V A;  3HOV H;  1JJ2 A;  2FXQ A;  5M5W H;  4A3F H;  3CXC A;  3T1Y Q;  2AMC B;  1NJI C;  1VCI A;  1K83 H;  1FGU A;  3K8A A;  1YI2 A;  1HR0 W;  4B3R L;  1VQG A;  5M5Y H;  4BBS G;  5IP9 G;  4YY3 L;  4DV7 L;  2BA0 A;  3A0J A;  4DR2 L;  4LF4 Q;  1EQR A;  2GVB A;  2IT1 A;  2NZH A;  4A3C H;  2OQK A;  4TQU S;  4YWM A;  4JI1 L;  4DV5 L;  1N34 Q;  4GKJ Q;  2ZTD A;  1AE3 A;  5M3F H;  1LM0 A;  3TEH B;  1IXR A;  1EOV A;  1TWH H;  2AKW B;  4LUV A;  1HR0 L;  1E3P A;  3ER0 A;  3GO5 A;  2IHF A;  1XTD A;  4DNI A;  2OCE A;  1X55 A;  4JOI A;  5ELN A;  1XNQ Q;  4IFD J;  4JI4 Q;  4IPG A;  1MJE A;  1WI5 A;  4IPC A;  4C3I H;  2QEX A;  1HZA A;  2ATW A;  2QGQ A;  4GN5 A;  4R4Q A;  4DR1 L;  4RG1 A;  4UP7 A;  3G71 A;  5FLM G;  3CCV A;  1IZ6 A;  1CKM A;  4O2D A;  3GTM H;  3PO2 G;  4A3G H;  2MNA A;  1Z9F A;  4JOI C;  2YU9 H;  3T1Y L;  1CKN B;  1XNR Q;  2R92 G;  3J81 i;  1KD1 C;  5GQO A;  2CCZ A;  3AYH B;  4O0A A;  4A93 G;  2EXD A;  4LF4 L;  1L2F A;  3CCU A;  1N36 Q;  2JA7 H;  4GS3 A;  3UDX A;  4A3K H;  1BVS A;  1KL9 A;  3RZD H;  1N34 L;  5IP7 G;  3CCL A;  1QVC A;  1NMF A;  5FJ8 G;  5GAE C;  3FKI H;  2UU9 L;  1N9W A;  3I4M G;  4HJ7 A;  4J15 A;  1PH5 A;  2JA8 G;  1JJC B;  2H5X A;  2UUA Q;  4XTC S;  2JQO A;  1VQ7 A;  3GTG H;  1WYD A;  2I5L X;  2NVX H;  4JI4 L;  4UP9 A;  1SR3 A;  1LTL A;  4RMF A;  1W2B A;  2RHQ B;  1TWC H;  3AFP A;  3EBE A;  3CPW A;  1WFQ A;  1L1O B;  1X54 A;  1S3O A;  4C3J H;  4PZ8 A;  4GNX B;  1JT8 A;  1VQE A;  4IOA A;  3W5O A;  5HGQ A;  5GAG C;  1OXX K;  3I56 A;  1XNR L;  4GLA C;  1Y1V H;  4BBR G;  4JYA Q;  1E22 A;  5HY6 A;  2XTI A;  1G29 1;  3NEL A;  4AQY L;  4YWK A;  4OO1 I;  4A4I A;  3AEV A;  2N49 A;  1Y1W H;  1N36 L;  5BR8 Q;  4QGU A;  1VQC A;  4ALP A;  2UXC Q;  2LSS A;  1V1Q A;  1OXV A;  1VQI A;  1X3F A;  3BU2 A;  1FL0 A;  3K7A H;  4LWC A;  4A3I H;  4A3E G; 
#chains in the Genus database with same CATH topology
 4OWW B;  1KDC A;  2J0T D;  2WFW A;  4BA2 I;  1D5X C;  2HCI A;  4LUZ A;  3WOF A;  3GTG B;  2NVX B;  1BO0 A;  2JA9 A;  4KKS A;  4LAA A;  2M2L A;  5KGU A;  3VDY A;  2E2I B;  3FPU B;  3NQT A;  5DEH A;  3I3C A;  3KJP A;  3SK4 A;  2OEO A;  5CC4 A;  4WFN 3;  4DR4 Q;  5C3E G;  4X65 L;  1S5B D;  1EIF A;  1F9Q A;  3JAM c;  1HNW Q;  1LUZ A;  5KNC A;  4B3M Q;  1PYW D;  3KYH C;  4IN3 A;  3P7J A;  1I4G A;  5C44 H;  4B3R L;  3K0X A;  3NTH A;  4A3I B;  2WAQ G;  4OXP A;  2WII B;  3CME A;  4DAV A;  3HP3 A;  3OIP A;  1I4R A;  2EY6 A;  4IJH A;  5D14 A;  3EJI A;  1LTI D;  4V0B A;  1KRS A;  2G9H D;  2R3Z A;  3S15 H;  1A6X A;  3TME A;  3FHW A;  3NP8 A;  2G5D A;  4F8M A;  3J80 E;  2ZM6 Q;  2F1M A;  3BZK A;  5FO8 B;  4BY1 B;  5HUR A;  5JJZ A;  2ZJQ A;  2NVQ B;  1UE7 A;  3HRZ C;  1FNU A;  3U9O A;  2VQF L;  5AJ3 L;  1U4M A;  5JJL A;  1B3A A;  4HMI A;  1KHI A;  1O78 A;  2CQA A;  5AFW A;  5IY0 A;  3D8G A;  1PV4 A;  4BY7 H;  1XPR A;  3C46 A;  4R4O A;  3OWF A;  2K4K A;  4DFA A;  5C6A A;  3S16 B;  2PQA A;  1Q86 C;  4QF4 A;  1LTR D;  3PIP A;  2WKD A;  2CFM A;  3N6R A;  2UU9 Q;  4J6H A;  2ES2 A;  1MHW C;  3L3O C;  1U4R A;  5J22 A;  3J80 L;  1YIJ A;  3HOY G;  1OXU A;  1WTH A;  3KLR A;  3SE0 A;  4OX9 L;  3F2U A;  1BQQ T;  4NB3 A;  3NHH A;  3RZO H;  2KED A;  1UAP A;  1ZXT A;  2PNH A;  1WTX A;  1EY7 A;  3G48 A;  5E7N A;  4AQY Q;  4GLX A;  4RHR A;  3T56 B;  1LT3 D;  3NTK A;  5KND A;  1GD7 A;  3IFT A;  5COR A;  2E2H B;  2KEN A;  3NBI A;  4K5V A;  4WRD A;  3PUW A;  1I6H H;  1CM9 A;  4LF9 Q;  2F0S A;  1HUM A;  3KDF A;  2B63 G;  4IJL A;  5JJI A;  4IFD H;  1PH1 A;  3HOX H;  1PHJ A;  1FNW A;  3PCO B;  3HKZ G;  4K14 A;  3NSW A;  3KF6 B;  4HSP A;  3CCR A;  4JBM A;  3NEM A;  5C4X H;  1G91 A;  3KBX A;  1UWV A;  3DWP A;  1JWM D;  1Z6H A;  4NXN Q;  2EDG A;  1M1K C;  4A3J B;  3EN2 A;  2I5H A;  3PUX A;  1K3B C;  1CKN A;  3PGZ A;  2HQE A;  4PZ7 A;  2MO0 A;  3TP6 A;  1HRJ A;  1PH8 A;  1CHP D;  4LFB L;  4K0K L;  3RLF A;  3FVQ A;  2B2V A;  2XVS A;  4IUT A;  4P2C B;  3TRE A;  3F2C A;  3PIO A;  1CUK A;  5M5X B;  2F0O A;  3F8T A;  4DK3 C;  4N8F A;  4M8A A;  3I91 A;  1DOL A;  4DR6 Q;  2IHE A;  3HOW B;  2R92 H;  1NTG A;  4AH6 A;  4CDC C;  4GKK Q;  1SMX A;  2K5H A;  4A93 H;  1YHQ A;  3I4O A;  1VQH A;  4P74 A;  4GNX A;  2A1A A;  1G6P A;  1LTT D;  1GUW A;  5JEA J;  5COY A;  3S1Q H;  1RIP A;  2IY5 B;  1T5X D;  2ICI A;  4A3C G;  1CZW A;  5E1F A;  2L1B A;  1LV9 A;  4LUO A;  3D3R A;  4CKE A;  3PO2 B;  3S17 B;  3CU7 A;  4DUY L;  2NN6 I;  3PUV A;  5C0X J;  1C0A A;  3GTK H;  2K33 A;  3S2D H;  4A3D G;  2TSS A;  1JQY D;  3L9A X;  1SJE D;  2PQE A;  2C9O A;  5LMU Q;  3GTP B;  2RVL A;  4XQN A;  4DV1 Q;  1SND A;  5ELB A;  2DUD A;  4DR7 L;  2K1B A;  3MEF A;  5D3I B;  4YWL A;  3CCS A;  2JA8 B;  3L0O A;  1RL2 A;  1F2L A;  1PH3 A;  5IWA Q;  3G6E A;  2UXB Q;  1SNC A;  1IHZ A;  1CQF A;  1J5E Q;  1F2Z A;  1NBW A;  4X3U A;  3K58 A;  3SR1 A;  1SFO B;  4BBR B;  1VQL A;  3OTO Q;  4YCW A;  5LMN W;  4HIM A;  1SE4 A;  3AQQ A;  4R1J A;  2MQH A;  3VYU A;  1CKO A;  3Q22 A;  5CV5 A;  2VUM H;  2UUB Q;  5LMN L;  2FIN B;  4ME5 A;  1CSP A;  2I46 A;  3UE0 A;  5JVG 3;  1O7I A;  2D0P A;  4XYO A;  3S1R B;  2PW7 A;  2KHJ A;  4A3I G;  3TRZ A;  1TS4 A;  4LF8 L;  3S2H B;  4KMU C;  4JI2 Q;  4DV0 L;  1EY9 A;  4P71 A;  4MN3 A;  4RH6 A;  3I90 A;  3A5Z B;  2HQL A;  1J9O A;  3EVQ A;  3H91 A;  1IBL Q;  3L7Z C;  2O5J C;  4EQO A;  2EJG C;  4HMJ A;  3I2Z A;  1K8G A;  2R6G A;  4WJW A;  4BY1 G;  1VQ5 A;  2NVT B;  5J3B A;  1BNZ A;  2WB1 E;  4FP5 D;  1LT6 D;  2Z0S A;  5JVH 3;  1YNN D;  1R9T B;  1MJC A;  1H9S B;  4NXM Q;  3KBG A;  1XNQ L;  1QE6 A;  3C2P A;  3QR8 A;  3WDN A;  1AH9 A;  1V43 A;  3MHB A;  5ELF A;  4JBJ A;  2AHO B;  1EY6 A;  3CC7 A;  3FMC A;  4KI0 A;  5IT9 E;  1S5F D;  2VS1 A;  4A3G B;  3GTM B;  1WCM H;  5DLQ E;  4LF5 L;  5I9P A;  4CDE C;  3ND8 A;  1HNX Q;  1ESF A;  3PV0 A;  2HIX A;  4A3M B;  5FO9 B;  2WP8 J;  3S1M H;  2K5V A;  5IE8 A;  2DNE A;  2CH4 W;  4MIU A;  4YCV A;  4NPS A;  1SMY C;  3FKI B;  1I3Q H;  1NMG A;  4HSV A;  1EZ6 A;  5FJ8 H;  5JPN C;  2KHI A;  3I4M H;  4U67 3;  3CAM A;  4LNQ A;  3GTJ B;  4DV3 Q;  4KY5 A;  1EUJ A;  4X66 Q;  2AWO A;  1K0R A;  4IFD I;  2BOS A;  1UE1 A;  2K5D A;  5IT9 L;  2JA5 B;  1LAC A;  1GVP A;  2A73 B;  2RDH A;  1YBY A;  5A35 A;  1TXY A;  3M4Y A;  1DD2 A;  5GAH C;  2Z6K A;  5KIX A;  1YIT A;  4Y7N H;  4JI6 L;  3CMA A;  4JI0 Q;  4DV4 Q;  4PMW A;  1PTO C;  1BXT A;  4FXK C;  3X3M A;  1Q90 A;  4XT3 B;  3K57 A;  1WVL A;  1VQ6 A;  2IX1 A;  3E3X A;  3R93 A;  1JWS D;  2EXZ A;  3DWA A;  4MZ9 A;  3I4L A;  4ZQ3 A;  3BS1 A;  4A3J G;  5JEA H;  1TWG H;  1MIU A;  3LGJ A;  1ENC A;  3I7F A;  5K36 G;  2CKZ B;  3T13 A;  3OW2 A;  2K52 A;  1EWI A;  1FJG L;  3HOU H;  3Q24 A;  3J81 c;  2BA1 A;  1VQM A;  4DR1 Q;  5C0X H;  1T9H A;  5IYC H;  1KNE A;  1A15 A;  2Q8T A;  3T1Y Q;  1DM0 B;  2AMC B;  1NJI C;  3PIP 3;  1K83 H;  1YI2 A;  1HR0 W;  2MP1 A;  5IP9 G;  2EYP A;  1EQR A;  2IT1 A;  4JI1 L;  1UUP A;  2X6L A;  4DV5 L;  3H0G B;  5M3F H;  3TEH B;  2XRQ D;  3KK7 A;  2K28 A;  5D65 A;  1EOT A;  1SYE A;  4ABN A;  1HR0 L;  3GO5 A;  1JOQ A;  2RA4 A;  2OCE A;  3C1F A;  1IL8 A;  1VDZ A;  3S14 B;  1WI5 A;  2QEX A;  4C3I H;  1ZYR C;  3PO3 B;  5FLM G;  3CCV A;  1IZ6 A;  1CKM A;  1TWA B;  1QNK A;  2QCP X;  3PO2 G;  3MZ5 A;  4FF3 A;  4OO1 H;  2SEB D;  3IAY A;  1XNR Q;  5GQO A;  3AYH B;  2EXD A;  3CCU A;  1N36 Q;  4A3K H;  5M5Y B;  5BN3 A;  5EKK A;  2DY8 A;  2AUK A;  3V2T A;  3K5N A;  1NMF A;  2EYM A;  2UU9 L;  1N9W A;  2JA8 G;  2UUA Q;  3I8Z A;  4XTC S;  1WYD A;  1AP0 A;  2AQ1 B;  3A8I E;  3GP7 A;  4RMF A;  1TWC H;  1IW7 C;  5EJW A;  3CPW A;  3LWE A;  3SK5 A;  4PZ8 A;  2K7V A;  3E5S A;  3MC0 B;  4IOA A;  2EY2 A;  4GLA C;  3GV3 A;  4RAU C;  4BBR G;  4JYA Q;  3RZO B;  4QUF A;  4AQY L;  5EQ0 A;  3AEV A;  1IKM A;  1O7Z A;  4ALP A;  2UXC Q;  2JA7 B;  3H09 A;  1OXV A;  3K7A H;  4H13 C;  2A19 A;  2RQX A;  1HNZ Q;  2Q2T A;  4PZ6 A;  3PIO 3;  2A6E C;  2PZW A;  4ZYS A;  4LF9 L;  4DV6 Q;  4DF7 A;  1CSQ A;  1I6H B;  1X3G A;  4LF6 Q;  2PI2 E;  5JJK A;  4X3T A;  4JG2 A;  1M90 C;  4POG A;  4QCL A;  4CBV A;  5D3D A;  3HOX B;  1I4Q A;  1PYS B;  4K2K A;  2RBM A;  1H9M A;  1KAA A;  4NXN L;  1E24 A;  2A8V A;  1VMC A;  4GOP B;  1SLJ A;  4KLK A;  5JOB A;  5ISR A;  1WTV A;  3GTO B;  3GDE A;  4P75 A;  3CCE A;  3HKS A;  3DM3 A;  2XN9 C;  3I73 A;  2JK8 A;  4DR6 L;  3R8B A;  2Z1C A;  1T5E A;  1NCV A;  4P73 A;  1NE3 A;  1RCV D;  4A93 B;  2DNC A;  2NTT A;  1B70 B;  1X56 A;  3KLW A;  2Q2I A;  4IUP A;  4A3G G;  2UXD Q;  2QW7 A;  1YHA A;  3JAM i;  1RJT A;  2EJM A;  4A3M G;  2B2U A;  2Q8I B;  1TR5 A;  4HIO A;  2TMP A;  1KAW A;  1MSG A;  3DLL A;  2L0C A;  4EX5 A;  1SYD A;  2PW5 A;  3FKI G;  4C56 C;  3DM1 A;  1JC7 A;  2X69 A;  3J7Z C;  1YJ9 A;  2B2U C;  2XWJ B;  3M4Q A;  3BDL A;  4K2L A;  2O4X A;  1SYC A;  3HGB A;  4HAE A;  2EPB A;  4FNF A;  3PSI A;  3GTK B;  2WB1 B;  1E0B A;  4RCN A;  5LMU L;  3RNU A;  4DV1 L;  3NE5 B;  1L0X B;  1HA5 A;  2L9H A;  2AQ3 B;  3ULL A;  1BCP C;  4YCU A;  2JA5 G;  4JBK A;  5IWA L;  2F0K A;  3CCM A;  1F2M A;  2NN6 G;  1S40 A;  4C2M B;  3K80 C;  1J5E L;  5GRO A;  3G4S A;  2K01 A;  3KF8 B;  2EVB A;  1I94 Q;  3J80 c;  1LTB D;  2R7Z H;  2YTX A;  5CBE E;  3GTQ H;  1GM5 A;  1D8L A;  3OOC A;  1EFW A;  2EE1 A;  2RSN A;  3B6Y A;  2F0H A;  2PNR C;  1PTO H;  1X3Q A;  4B9X A;  3CCJ A;  1SBB B;  1VQ4 A;  1WTP A;  4HR7 B;  1B53 A;  5C0X I;  4DAY A;  2ENB A;  3ULP A;  4B9W A;  2F52 A;  4RA8 A;  3UDG A;  1SE3 A;  4A3B H;  4B3T Q;  4JI8 L;  4HIK A;  4DR3 Q;  4KHZ A;  3HOZ B;  4DAP A;  5CV4 A;  3H15 A;  2EJF C;  1U4P A;  1EQQ A;  3CHB D;  1Q82 C;  1YVC A;  5C5M A;  2F4V L;  4BBS H;  2E2J H;  4CDD C;  3NXW A;  3IKJ A;  5EKI A;  4OEL B;  5FK9 C;  2RF4 A;  1TU2 B;  3T4A C;  2QA4 A;  1D1K A;  2F3V A;  2ZXO A;  1VQN A;  1AN8 A;  3BVM A;  2F0V A;  1LTS D;  1BDO A;  2BH8 A;  3H0G G;  1Z47 A;  2PZU A;  4OO1 I;  1PFS A;  2LKV A;  4OON A;  1KC8 C;  1EYA A;  4CKB A;  4DU9 A;  1PRT C;  1WOC A;  1H9R A;  1QG7 A;  4OIJ A;  3MXN B;  3P20 A;  3GV6 A;  1F77 A;  4O42 A;  3PO3 G;  1HQM C;  1UE5 A;  1L1O A;  4ODG A;  3CQZ H;  1CA6 A;  1RHP A;  1Z7T A;  3SVM A;  1YJW A;  2WIN B;  4A3F G;  3MA2 B;  1KIX A;  4DUZ L;  4LW1 A;  2D5D A;  4CJ2 C;  1QUQ A;  2CHB D;  3G7L A;  4UHV A;  1SNQ A;  2QF7 A;  3X3N A;  3GTL H;  1NNX A;  2VXW A;  5CYU A;  3M4O B;  4RHS A;  1ET6 A;  4G4K A;  4XQJ A;  4A76 A;  3HS0 C;  5HGT A;  2Y0S E;  2B3G A;  4A3E H;  1M8A A;  1GUT A;  3E0J A;  3I4M B;  1TWF H;  4AYB E;  1QB5 D;  2F0D A;  1S72 A;  2JEB I;  4X66 L;  3TZU A;  2JA7 G;  1K8M A;  1E2V A;  2EY5 A;  2HHH Q;  1SMY D;  4FF1 A;  1A3V A;  4V19 0;  3I4N H;  1TY0 A;  4XDX A;  3HEJ A;  4ME3 A;  5I6W A;  1PFB A;  4CJ1 B;  4IPH A;  1FR3 A;  1EYC A;  3TQY A;  3TSS A;  2SDF A;  5CGK A;  3CPF A;  1AW7 A;  2OWO A;  2HT1 A;  1B9M A;  3A8K E;  4IFD G;  5KRU A;  4Y7N B;  5IIF A;  4DV4 L;  3U58 A;  3NUC A;  3T16 A;  3HOX G;  1SNM A;  1FNV A;  1I4X A;  1SRU A;  5KYI A;  1Y1W G;  4TVA B;  1B7Y B;  3PUZ A;  2OTL A;  5C5L A;  1B8A A;  3KDF B;  1SXT A;  2BE5 C;  3J7Y W;  2J7Z A;  3T1H L;  1GJX A;  3M7G A;  3M85 A;  4GKJ Q;  4HN7 A;  1PH6 A;  1ASY A;  3S1N B;  1L0W A;  1PH7 A;  5LL6 X;  2K50 A;  2DJF C;  3Q8D A;  2BDN A;  2YTY A;  1N8R C;  4YHH Q;  2NZO A;  3FEW X;  3SDZ A;  3DEO A;  1VF7 A;  4EQ5 A;  1STG A;  4LF7 Q;  2SOB A;  4H7B A;  3DUZ A;  4KN7 C;  2LS0 1;  4A75 A;  4IPD A;  5M3F B;  1QZG A;  2UUC Q;  2XWB B;  4K8I A;  3OWE B;  4DR5 L;  1I50 H;  2F0Q A;  1YEZ A;  3Q23 A;  3E9I A;  2I0Q A;  4ZUJ A;  4LFA L;  2O2L D;  4N8X 1;  1GUN A;  3HOY H;  1CI3 M;  1VQB A;  1OXT A;  1SN8 A;  2VQE L;  2WB1 G;  3NWT A;  3KUP A;  3KJO A;  1XPO A;  4NP5 A;  1RTO A;  2B2V C;  4A3K B;  1IBK L;  3K5M A;  4GN3 B;  4IUV A;  2RCF A;  3VYT A;  1NUC A;  1CT1 D;  2KOL A;  2M00 A;  5IP7 H;  3BZD B;  4JI7 Q;  2Z8L A;  3A54 A;  2C5C A;  4K8J A;  4PV1 C;  1ASZ A;  4K6D A;  4JV5 Q;  1EIY B;  4C1N K;  1XMQ L;  2PPB C;  3KF6 A;  4I7Z C;  4LFC Q;  1TWC B;  1FYC A;  4GNX C;  3QOJ A;  4L5R C;  4JYA L;  4KHP Q;  1ICW A;  1D1I A;  5KYL A;  2R93 G;  3V96 A;  2SNS A;  3OMC A;  1YJN A;  1K8O A;  3DMU A;  3ULJ A;  1IW7 D;  4I65 A;  1QZH A;  4KD3 A;  2QKI C;  3K7A B;  1XMO Q;  2RKS A;  4JI3 L;  2VW9 A;  3HOZ G;  3K5O A;  1CQV A;  3K5L A;  4DV6 L;  2AWN A;  5IT9 c;  5IYD G;  2R7D A;  4QQB X;  2N55 A;  1ML0 D;  1TT2 A;  5M3M H;  1GKH A;  2CW0 C;  4RKB A;  1Q8I A;  4EVO A;  2F03 A;  1KXL A;  1YNJ C;  4YY3 Q;  1ENF A;  1PH4 A;  4BA1 I;  2A68 C;  4B08 A;  1EIG A;  4MTK A;  1HFN A;  3J7A F;  1A3U A;  2KCT A;  4OIK A;  1HQR D;  4TRD A;  4X62 L;  1HA6 A;  1IYJ B;  1XX8 A;  4QJF A;  4L6T B;  1OTC A;  1JB7 A;  5CV7 A;  2PO4 A;  4OWX B;  1FVI A;  1X65 A;  1I4P A;  2EY1 A;  1PYB A;  3H3V H;  3J7A 5;  1JJ2 A;  1B50 A;  2FXQ A;  5M5W H;  4NKL A;  1ONL A;  1G8Z D;  1NAP A;  4LF4 Q;  2BA0 A;  1HHV A;  4A3C H;  2OQK A;  4TQU S;  4YWM A;  4KTA A;  1N34 Q;  3VR4 A;  1LM0 A;  2Z4H A;  1TWH H;  1EOV A;  1B4O A;  3DXJ C;  1GHK A;  2QIL A;  1E3P A;  3ER0 A;  5E3F A;  2IHF A;  1XTD A;  4JOI A;  1F2Y A;  4KHV A;  4CJ0 B;  2PZT A;  5FOB B;  2ATW A;  2QGQ A;  5G3L D;  5I4D A;  4RG1 A;  4UP7 A;  4PMC A;  1J8I A;  3BDC A;  2P5Z X;  1JR0 D;  4JOI C;  1V1P B;  4M1U B;  1SNP A;  4DXF A;  3HOV B;  4N9T A;  1HXY D;  3NQI A;  4N9P A;  3J81 i;  2CCZ A;  3UDX A;  1RDP D;  5ELE A;  3QWN A;  5FJ8 G;  2I07 B;  3I4M G;  4J15 A;  1JJC B;  2H5X A;  4PNY A;  2JQO A;  3GTG H;  2I5L X;  2NVX H;  4JI4 L;  2L55 A;  1A2U A;  2A6H D;  3AFP A;  3A7L A;  4G57 A;  1S3O A;  1KTK A;  5FO7 B;  1Y8P B;  3W5O A;  5HGQ A;  5GAG C;  2HDM A;  3I56 A;  4U68 A;  3GQB A;  5KNB A;  2OT2 A;  1E22 A;  5HY6 A;  2YU9 B;  2XTI A;  3NEL A;  4A4I A;  4G7O C;  2N49 A;  4DK1 A;  1HTP A;  2LSS A;  1VQI A;  1BCP D;  4LWC A;  4ZCK A;  1SSO A;  4A3I H;  2EYJ A;  3GTQ B;  5IGF A;  2VY3 A;  4IUU A;  4IUN A;  3A56 A;  1S5D D;  5T1I A;  2KEE A;  3BZC A;  1PTO B;  1EQV A;  4DNT B;  2F0U A;  4RGN A;  4H44 C;  4UDU C;  1K28 A;  3IRB A;  1H9S A;  1MBY A;  4EGV A;  5C3W A;  4B3T L;  2Y0S B;  4C3J B;  4A3B B;  3F1Z A;  5I2X A;  3VA5 A;  4AYB B;  2O5I C;  4KK7 A;  3ZJY C;  1Y1V B;  2DN8 A;  1IBM Q;  4R4T A;  5BR8 L;  1HZC A;  2NVQ H;  2EIF A;  2VB3 X;  1PH2 A;  5EPK A;  1SNO A;  1I6V C;  1TS3 A;  4FDB A;  3VR3 A;  2E2J B;  4DK6 C;  5C0X G;  3TBI B;  1SDF A;  2VQF Q;  2PCF B;  1VQK A;  2CQO A;  1QVG A;  5AJ3 Q;  1AZQ A;  2F0J A;  2I5M X;  2KQ3 A;  2XIW A;  1HZB A;  1EYD A;  2JP1 A;  3S9W A;  2Z6K C;  1U4L A;  3TP7 A;  5M3F G;  2F0F A;  4DR2 Q;  4DV7 Q;  1Y14 B;  4CDF C;  4DR4 L;  3E0E A;  2JJQ A;  2VZA A;  2H1E A;  1D5Z C;  1HNW L;  3QIA A;  2L15 A;  4FF2 A;  1VQJ A;  4B3M L;  1DCZ A;  5NUC A;  2WKC A;  5C4Z A;  3CQZ B;  5IYB G;  4OO1 G;  1STA A;  3KLS A;  5C44 B;  5DM7 3;  3O13 A;  1PRT D;  4L63 B;  4OX9 Q;  2IWH A;  1KLG D;  3HOW G;  1I5F A;  1PZI D;  3OW7 A;  1IL2 A;  5LHY 1;  4R8I A;  4WJ4 A;  1IKL A;  2F0N A;  3MTS A;  2ZM6 L;  3P1H A;  3S15 B;  2KUM A;  3TS2 A;  1PTO F;  4OHJ A;  1EYG A;  3OPO A;  4HJ9 A;  4RGT A;  3NBH B;  2B2Y A;  4ILW A;  2QDL A;  1GHJ A;  2IX0 A;  4E6I A;  1TWF B;  4S3S A;  3ONA B;  5TSS A;  2ZJP A;  4BY7 B;  5H1S E;  4HTH A;  3I4N B;  2KA7 A;  2B2Y C;  2X6G A;  1STH A;  2A74 C;  1KDA A;  2RDF A;  1V9P A;  5FLX E;  3EA6 A;  1LTA D;  4FO2 A;  5K36 H;  1RKN A;  4Z9C B;  1QIL A;  4HCE A;  2C35 B;  1VQD A;  1V1O A;  4TSS A;  4C1N I;  4XYQ A;  5M5X H;  1NR2 A;  4F88 A;  2L5T A;  5CV8 A;  2GVA A;  4JK1 C;  1K9M C;  1AEX A;  4HCS A;  5IP9 H;  5EKL A;  1VQP A;  1Q12 A;  4BWG B;  1RTN A;  1B2T A;  2ZTE A;  3MXU A;  4ZUI A;  1C9O A;  2FJ2 A;  5J1Z A;  4APV A;  5FLX L;  5EPL A;  4YHH L;  3J80 i;  4K6L A;  4C3H H;  2ICE C;  3UE1 A;  2A69 C;  4BXX G;  1MKH A;  1UEB A;  3MWY W;  3RUZ A;  2BE5 D;  3RLO A;  4LF7 L;  5FLM H;  1U5K A;  3MAQ A;  3PO2 H;  3S17 H;  4JI5 Q;  1IYV A;  4Y52 H;  1GUG A;  4DAM A;  1SE8 A;  4L5T A;  1ROD A;  4RCO A;  4DUY Q;  2ALY B;  2XGT A;  2KBN A;  3TP8 A;  1NSN S;  4XXE A;  2UUC L;  1HZ9 A;  3K7U C;  5EBD A;  5C4X B;  3TP5 A;  1BBW A;  1U0L A;  1SRO A;  3GD7 A;  3HOV G;  2JA8 H;  4DR7 Q;  2F0P A;  2MHV A;  2LXJ A;  3NPP A;  4L8J A;  3QB3 A;  3OIQ A;  3A8J E;  4OL7 A;  2MGS A;  3PUY A;  4QIW E;  1H9K A;  3A74 A;  4L5Q A;  1S5E D;  2QDB A;  5J39 A;  1KDB A;  2E75 C;  1FD7 D;  4GKK L;  2R7F A;  2R92 B;  4KJO A;  4R9W A;  1HJP A;  1P8L A;  1TS5 A;  2B29 A;  2NTS A;  3SXH A;  1SE2 A;  1QVF A;  1Q81 C;  1HFG A;  3MXG A;  4JI7 L;  2K75 A;  3HG9 A;  1JWU D;  4LK1 C;  1BCP B;  1E7Z A;  5T1G A;  1N32 Q;  4LFC L;  5LMN Q;  4A3L H;  4RFB A;  3S1Q B;  2HD3 A;  2E2D C;  4HED A;  4QB4 A;  1JMC A;  3D0F A;  1PVO A;  1H95 A;  1EEI D;  2JYO A;  3S2H H;  3ITP A;  1AFP A;  3VR6 A;  3HFZ B;  2F3W A;  3JC6 6;  4LF8 Q;  1K8A C;  1TII D;  1B1Z A;  4JPB W;  4DV0 Q;  4DN4 M;  3S2D B;  1YNN C;  1BBU A;  1DGS A;  5C4H A;  2Y0S G;  4C3J G;  4HID A;  5IGB A;  4A3B G;  1S5C D;  3AU7 A;  4AYB G;  4UP8 A;  5ELO A;  5G3L F;  1Y1V G;  2K5W A;  1Q7Y C;  4H0L C;  2YTV A;  2NVT H;  4OGQ C;  5M3M B;  2UXB L;  4DAY B;  1R9T H;  1DOK A;  1F9R A;  2JA6 H;  4KN4 C;  4QY7 A;  1VS0 A;  2XSC A;  2D2C C;  2BCO A;  5CBA E;  3TZD A;  2KJX A;  3R3O A;  3OTO L;  1OXS C;  3EQL C;  3R2I A;  3WWV A;  2EOT A;  1G2T A;  1JCK B;  4EQP A;  1A8V A;  1YNJ D;  1RF2 D;  1W3S A;  2UUB L;  3BYY B;  3QG1 A;  3RLN A;  4LF5 Q;  2KHS A;  2VL6 A;  2VUM B;  1BUV T;  4A3M H;  4GN4 B;  1HH2 P;  1PRT B;  3PF4 A;  3DWQ A;  2NVY H;  3CW2 C;  2A5H A;  3G6J B;  2YV5 A;  1DYQ A;  2CH4 A;  4DKA C;  5C44 G;  1TWH B;  2H4O A;  1XXG A;  2NB0 A;  4JI2 L;  4DV2 Q;  2D0O A;  1BCP F;  2B2W A;  3T51 B;  4HJA A;  3A5U A;  1J6Q A;  4B3S Q;  3SK8 A;  2KCC A;  3D4R A;  1JOO A;  3GTJ H;  3STB C;  1IBL L;  1EU3 A;  3J81 j;  1R4P B;  4LMQ D;  3KF8 A;  3R2T A;  1W6J A;  1CHQ D;  1JE5 A;  2JA5 H;  3H3V C;  1EY5 A;  3MXP A;  3ZYY X;  2MO1 A;  3CP0 A;  4R4C A;  1N33 Q;  2HIV A;  2F3I A;  4QL5 A;  2NN6 H;  5BN5 A;  3IL8 A;  2J4X A;  1QUQ B;  4NXM L;  5BN4 A;  3A7A B;  2ZXR A;  3CRL C;  1X3E A;  4AIM A;  1QNU A;  4PQX A;  2E5L Q;  4JI6 Q;  2VNU D;  4JW0 A;  4BY7 G;  1ILP A;  3I4N G;  5C3X A;  2AQ2 B;  1MD2 D;  1L1O C;  4G7H C;  3NK9 A;  4DGZ A;  2BDO A;  1LYL A;  1HNX L;  2B8G A;  1WCM B;  3D4W A;  2NWG A;  4EQN A;  5C4J H;  1FJG Q;  3S1M B;  1G51 A;  2K6A A;  3SEB A;  3Q6S A;  1C48 A;  4IQZ A;  2K04 A;  3OHX C;  3SGI A;  4X64 Q;  2PQA B;  1I3Q B;  2EYL A;  3KOJ A;  4IO9 A;  3MXN A;  4DV3 L;  1PRT F;  1EY0 A;  2LFN A;  1W6K A;  4UY8 C;  3H6M A;  2ZTC A;  3H0G H;  2NUC A;  4JI1 Q;  4DV5 Q;  1IBM L;  3HZX A;  4R8N A;  3KLS X;  3K59 A;  1HCZ A;  4NDX A;  1HR0 Q;  3NWS A;  5C3E H;  3S14 H;  3D6C A;  1LLR D;  1ZEQ X;  1I4H A;  1STB A;  2CWP A;  3PO3 H;  1TWA H;  3MVV A;  4JI0 L;  1Y8O B;  2B39 A;  2Q8R E;  3U4V A;  3MFG A;  1PMR A;  4A3F H;  3K8A A;  2IW3 A;  3LWU A;  1SYB A;  1VQG A;  2F0G A;  5M5Y H;  4DR2 L;  1EWH A;  4DV7 L;  2NBF A;  3A0J A;  5C4X G;  1EU4 A;  1SAP A;  2RSO A;  2ZTD A;  5DAU A;  1IXR A;  1TWG B;  5JPM C;  2F0T A;  1Y8N B;  4LUV A;  2EYO A;  2N88 A;  4DNI A;  1KAB A;  1PTO D;  1X55 A;  5ELN A;  3E6Z X;  3HOU B;  4IPG A;  4KV6 A;  4IPC A;  1DOM A;  1HZA A;  1EY8 A;  4GN5 A;  2JSO A;  4R4Q A;  3I70 A;  4DR1 L;  1B9N A;  4WOR A;  3AMU A;  3T1Y L;  3QO2 A;  1CKN B;  2R92 G;  1KD1 C;  2F4I A;  5IGC A;  4O0A A;  3VYS A;  4A93 G;  1EQT A;  1K83 B;  1LAB A;  4GS3 A;  1BVS A;  3RZD H;  2JA7 H;  3CCL A;  5IP7 G;  3BVZ A;  5GAE C;  3JAM E;  4XQQ A;  5IGD A;  4HJ7 A;  1PH5 A;  1D2B A;  1PFN A;  5F2D A;  5ELC A;  4UP9 A;  3VR5 A;  3MEH A;  1MGS A;  2RDG A;  4X3S A;  2RHQ B;  3EBE A;  4C3I B;  4GNX B;  1X54 A;  2PYK A;  1VQE A;  1OXX K;  1A3T A;  3PMF A;  1XNR L;  2HCC A;  3BDO A;  2SNM A;  1O80 A;  2Z4I A;  1Y1W H;  1N36 L;  1BBX C;  4QIW B;  4O1N A;  4QGU A;  1VQC A;  4KY7 A;  1X3F A;  1ZYR D;  3GTO H;  1PDQ A;  2MPM A;  1LT5 D;  2OQ0 A;  2UUA L;  3JAM L;  2JEA I;  2MFI A;  5M3M G;  2FFK B;  2WAQ E;  2Z9H A;  2RHS B;  4GLV B;  3TN2 A;  1LO5 D;  3M3Y H;  2PI2 A;  1BKB A;  1XTC D;  3T53 B;  2LMC B;  2Q2U A;  3RMH A;  2N8N A;  3EIV A;  3FRP B;  1TVX A;  4MNO A;  2B63 H;  2LXK A;  2KVM A;  1QOH A;  2EQS A;  2UXC L;  4MTN A;  3UDF A;  4RWS C;  4MHE A;  4DNR B;  1Q46 A;  2PMZ E;  1H9J A;  4RKL A;  2VUM G;  4ZK9 B;  1HNZ L;  4CKC A;  3CC4 A;  4L5S A;  3M4P A;  4KKT A;  1EWC A;  1O7L A;  2L12 A;  3FP9 A;  4C3H B;  2Q2H A;  2ASB A;  1YZ6 A;  4ZRZ A;  1ESR A;  4LF6 L;  2JN4 A;  1F9P A;  4JI5 L;  2K32 A;  4IUQ A;  5EPJ A;  3NEN A;  2HUG A;  1DZ1 A;  2A6E D;  1JE4 A;  4F7X A;  4X6A H;  2EZV A;  2A69 D;  1PH9 A;  2M9V A;  1LTG D;  4BS9 A;  3OMG A;  1GUO A;  3CC2 A;  1UEA B;  4RGM A;  1SYG A;  2KCM A;  3CCQ A;  1CA5 A;  4LJZ C;  2FMM A;  4C2M H;  3W3A A;  4Q0F A;  1GUS A;  2KEC A;  1HUN A;  2JE6 I;  4JCV E;  1JOK A;  1UNS A;  1M4V A;  3W1G A;  4Q5V A;  2K14 A;  1WTR A;  2R93 H;  1TKW B;  2V1C C;  4ULL A;  2N78 A;  2K05 A;  2UXD L;  3ERS X;  1N32 L;  4A3D H;  1D6E C;  1CTM A;  1WCM G;  4IAL A;  3ERQ A;  5LL6 S;  4IZ8 A;  4DK0 A;  3HOZ H;  4JI8 Q;  5IYD H;  1K73 C;  1VQF A;  1Y69 U;  1ICF B;  2FHT A;  2IPK D;  4FXD A;  1EEF D;  3HKZ E;  1Q1B A;  2F4V Q;  1WTQ A;  1DJR D;  1XYI A;  2F0M A;  1C7Y A;  2FMC A;  3C1E A;  3SHL A;  2DGY A;  4ZKB B;  5FKA C;  1ILQ A;  5GAD C;  2EYF A;  2E2I H;  2LY7 A;  4OWT B;  4UPA A;  3W2D A;  2D62 A;  1F9S A;  2IL8 A;  3VR2 A;  4KY6 A;  2JA6 B;  4X65 Q;  1E1T A;  1I94 L;  3U9S A;  4IOC A;  2F0E A;  2CVR A;  4X3K A;  2G9D A;  2R7Z B;  2XNA C;  3AFQ A;  1NR4 A;  1VQO A;  1BF4 A;  1V1P A;  3M9B A;  3I55 A;  3KFU A;  4B3R Q;  1WTW A;  4XT1 B;  4XIG S;  2L11 A;  1STY A;  3AB9 A;  1DXM A;  4DUZ Q;  3A55 A;  1JJG A;  1A2T A;  5EAY A;  5JEA G;  3E9H A;  4HJ5 A;  1OO9 B;  1U9R A;  4DR3 L;  1VQ8 A;  1MI2 A;  5IOD A;  1X6O A;  3HOU G;  3M4O H;  2NVY B;  2D9U A;  1BR9 A;  1GO3 E;  4BY1 H;  1PLF A;  5FLX c;  3F2D A;  2OTJ A;  3EFX D;  1CFM A;  1YNX A;  1TS2 A;  4BBS B;  4DV2 L;  3WOE A;  2E8G A;  5IYC G;  4B3S L;  1B3Q A;  1XPU A;  3OSO A;  5K5P A;  4ZAI A;  2L4N A;  1SJH D;  1IYU A;  4IUR A;  2IJ0 A;  1S4Z A;  4NMZ A;  1ENA A;  1B44 D;  5L37 A;  3BJU A;  1BOS A;  3DHQ A;  1JOR A;  3C3L A;  1N33 L;  3S16 H;  5I6Y A;  5CR3 A;  3LNN A;  1A63 A;  3TS0 A;  3STB D;  1QWY A;  1EY4 A;  3IFD A;  1TY2 A;  1A0I A;  2VB2 X;  4C3I G;  5ELD A;  1SEB D;  2E5L L;  2NZ1 D;  1X32 A;  1CK1 A;  4FVM A;  1P16 A;  2ZXP A;  5CV6 A;  1VQ9 A;  2WV6 D;  1KRT A;  2GA4 B;  3FPP A;  4A3K G;  4WJ3 M;  1TQO A;  3ICE A;  3MFY A;  4R4I A;  4P72 A;  3T1H Q;  4YIJ A;  1Q1E A;  4JBW A;  5IOC A;  3S1N H;  5C4J B;  4J1M A;  1XWE A;  2YYZ A;  2XRS D;  5IGG A;  3GTL B;  5M9O A;  5CMD A;  4HJ8 A;  2E2H H;  1C4Q A;  2DY7 A;  2B2T A;  4X64 L;  3CF5 A;  2N3S A;  2RCN A;  3BG3 A;  5CV9 A;  1STE A;  3ND9 A;  3K81 C;  4JC0 A;  5IGE A;  3D31 A;  1HTL D;  2ZJR A;  1ZKO A;  4A3E B;  2WAC A;  5JAV A;  3QJY A;  2B2T C;  1STN A;  2HHH L;  4CHT B;  3J7A V;  3BYT B;  2K5N A;  5KEE A;  1D7Q A;  1MSH A;  3P75 A;  1PFM A;  4A3J H;  4DR5 Q;  4C3H G;  4CGY B;  5C3E B;  1O7Y A;  2ID0 A;  3DEP A;  3D6W A;  1R4Q B;  3RN5 A;  4K0K Q;  4LFB Q;  5IYB H;  4LFA Q;  1X3P A;  3H3V I;  1HPC A;  2VQE Q;  4A3F B;  2WAQ B;  1EIH A;  3RR5 A;  1II3 A;  1UE6 A;  3HOW H;  4GZY C;  1QCB D;  3M7N A;  3UDI A;  1IBK Q;  1AZP A;  1X9N A;  2R61 A;  1Q8K A;  3NBH A;  4KKU A;  2E74 C;  5EBC A;  2B8F A;  1G2S A;  1KQS A;  4GKJ L;  3I72 A;  4DPG A;  3RN2 A;  4QUC A;  2KCN A;  4FYD A;  1PXU A;  4KJN A;  5A2Q E;  1QJO A;  2PMZ B;  1XMQ Q;  2F0L A;  1NY4 A;  4K5X A;  1YHB A;  1XJV A;  1JIC A;  2F0I A;  4NW2 A;  3W1B A;  3CD6 A;  1FGB D;  1K3R A;  1VQA A;  3F2B A;  3RZD B;  1D5M C;  2CWA A;  1G6Z A;  2IX3 A;  3GTP H;  2V4D A;  2MJ8 A;  1KLU D;  4DXG A;  4A3L G;  4JI3 Q;  1A62 A;  4PMB A;  3J81 E;  4K5W A;  3V05 A;  2QEJ C;  1I50 B;  5A2Q L;  3OYY A;  4POF A;  1RD9 D;  1E1O A;  3HOY B;  3U50 C;  1WJJ A;  5DNF A;  2NYZ D;  2DJG C;  1Q3L A;  2GN5 A;  1SFO H;  3U4Z A;  1Y1W B;  4BBR H;  1EFI D;  2OF1 A;  2ZT9 C;  3Q0A A;  4X62 Q;  4FXG C;  2JXM B;  3UI2 A;  4ID6 A;  2EYH A;  4JV5 L;  2HDL A;  2JA6 G;  1VMP A;  3J81 L;  1PA6 A;  3M3Y B;  1AE2 A;  2K03 A;  4JVZ A;  3URY A;  4KHP L;  2R7Z G;  4BXX H;  1WTO A;  3S1R H;  4GOP A;  1DON A;  2B63 B;  1ET9 A;  3L2P A;  1PZJ D;  4RGO S;  3H94 A;  2MUY A;  2K5Q A;  4F87 A;  3HKZ B;  2E76 C;  3N52 A;  3FDT A;  2F0W A;  5DM6 3;  4GOP C;  4PG3 A;  3ERO A;  1XMO L;  4H02 A;  1JB3 A;  3S24 A;  3PF5 A;  3PQI A;  3HOV H;  5I9O A;  1V8Q A;  3CRK C;  3CXC A;  1VCI A;  1FGU A;  2A6H C;  4BBS G;  1K0S A;  4YY3 L;  2GVB A;  3K0Y A;  2NZH A;  1AE3 A;  3VYR A;  2AKW B;  4OEM B;  1XNQ Q;  1WD0 A;  4IFD J;  4ZLT F;  4JI4 Q;  1E2W A;  4DA2 A;  1MJE A;  1GOZ A;  2CW0 D;  4J8Q A;  1CZG A;  1PZK D;  3G71 A;  4KD4 A;  4O2D A;  4A3G H;  3GTM H;  1SYF A;  2MNA A;  1Z9F A;  2YU9 H;  2A68 D;  3K6O A;  3LX0 A;  4TKO B;  4QMG A;  5M5W B;  4LF4 L;  1L2F A;  5E4X A;  1KL9 A;  3BVG A;  1N34 L;  1QVC A;  5I2Y A;  3FKI H;  4FF4 A;  1WD1 A;  1E2Z A;  3NTI A;  3QOL A;  2R93 B;  5EGT A;  2AUJ D;  4G7Z C;  4UAI A;  1VQ7 A;  1KNA A;  1EZ8 A;  1SR3 A;  1LTL A;  5E4W C;  1W2B A;  4A3D B;  1WFQ A;  1L1O B;  2OXP A;  4C3J H;  1JT8 A;  1L0Y B;  1LT4 D;  3D4D A;  4I7A A;  2B2W C;  3SK6 A;  4ZKC B;  1Y1V H;  1EL0 A;  1G29 1;  3TDQ A;  4YWK A;  3CKI B;  3RD4 A;  1VF5 C;  1GXD C;  5BR8 Q;  1V1Q A;  3VA7 A;  2Z6B A;  1C8C A;  3BU2 A;  1FL0 A;  2BH2 A;  4A3E G; 
#chains in the Genus database with same CATH homology
 2OQ0 A;  4OWW B;  2WFW A;  4BA2 I;  2A19 A;  2UUA L;  2VY3 A;  2JEA I;  2MFI A;  1HNZ Q;  5M3M G;  4PZ6 A;  2Q2T A;  3BZC A;  4LUZ A;  2WAQ E;  2RHS B;  4GLV B;  4DV6 Q;  4LF9 L;  1CSQ A;  2JA9 A;  1X3G A;  3IRB A;  2PI2 A;  1BKB A;  3M3Y H;  3VDY A;  2Q2U A;  4B3T L;  4LF6 Q;  2N8N A;  3EIV A;  2PI2 E;  5JJK A;  3KJP A;  3F1Z A;  4JG2 A;  4MNO A;  2B63 H;  1M90 C;  2LXK A;  3ZJY C;  4POG A;  4DR4 Q;  5C3E G;  4X65 L;  1PYS B;  4LF7 L;  3S17 H;  1EIF A;  1IBM Q;  4R4T A;  3JAM c;  2EQS A;  5BR8 L;  1HZC A;  1LUZ A;  2UXC L;  2NVQ H;  1HNW Q;  2EIF A;  4MTN A;  4NXN L;  3UDF A;  1PH2 A;  4FDB A;  4B3M Q;  3KYH C;  1E24 A;  4DK6 C;  5C0X G;  2A8V A;  1Q46 A;  2PMZ E;  4GOP B;  5C44 H;  1SLJ A;  4KLK A;  2VUM G;  3K0X A;  2VQF Q;  1HNZ L;  1VQK A;  3CC4 A;  2CQO A;  2WAQ G;  3GDE A;  3M4P A;  1QVG A;  5AJ3 Q;  4OXP A;  4P75 A;  4L5S A;  2I5M X;  3CME A;  3CCE A;  3FP9 A;  3HKS A;  1HZB A;  2Q2H A;  2ASB A;  1YZ6 A;  4LF6 L;  2Z6K C;  4IJH A;  3DM3 A;  5M3F G;  4JI5 L;  2JK8 A;  4DR6 L;  4DR2 Q;  4DV7 Q;  1Y14 B;  4DR4 L;  1KRS A;  3E0E A;  3S15 H;  3NEN A;  2JJQ A;  2VZA A;  3FHW A;  4P73 A;  1HNW L;  2ZM6 Q;  1NE3 A;  2L15 A;  3BZK A;  1VQJ A;  4X6A H;  4B3M L;  2ZJQ A;  1B70 B;  1X56 A;  3KLW A;  1UE7 A;  2Q2I A;  5IYB G;  1PH9 A;  4A3G G;  4OO1 G;  2UXD Q;  2VQF L;  1YHA A;  3JAM i;  3CC2 A;  5AJ3 L;  2KCM A;  4A3M G;  3CCQ A;  4OX9 Q;  4HIO A;  5JJL A;  1KAW A;  3DLL A;  1KHI A;  3HOW G;  1I5F A;  5IY0 A;  4C2M H;  4BY7 H;  1PV4 A;  1XPR A;  4R4O A;  4EX5 A;  2JE6 I;  2K4K A;  3FKI G;  3J7Z C;  1IL2 A;  4JCV E;  1YJ9 A;  2PQA A;  4WJ4 A;  3M4Q A;  1Q86 C;  3PIP A;  3W1G A;  2K14 A;  2CFM A;  2R93 H;  2ZM6 L;  3PSI A;  2UU9 Q;  2ES2 A;  2V1C C;  5LMU L;  3RNU A;  2N78 A;  4DV1 L;  3TS2 A;  1EYG A;  2UXD L;  3ERS X;  1N32 L;  4A3D H;  1YIJ A;  3HOY G;  1OXU A;  1WCM G;  3ULL A;  4HJ9 A;  4YCU A;  2JA5 G;  4JBK A;  3NBH B;  4OX9 L;  2IX0 A;  3HOZ H;  5IWA L;  3CCM A;  4NB3 A;  3RZO H;  4JI8 Q;  2NN6 G;  5IYD H;  2PNH A;  1K73 C;  2ZJP A;  3G48 A;  5E7N A;  1S40 A;  1VQF A;  5H1S E;  3K80 C;  4GLX A;  4AQY Q;  1J5E L;  5GRO A;  3HKZ E;  1Q1B A;  3G4S A;  3KF8 B;  2F4V Q;  1I94 Q;  3J80 c;  2R7Z H;  1GD7 A;  2YTX A;  1V9P A;  2BH2 A;  3GTQ H;  1GM5 A;  1D8L A;  1C7Y A;  1EFW A;  3B6Y A;  2DGY A;  2KEN A;  3CCJ A;  1VQ4 A;  2C35 B;  1VQD A;  5GAD C;  5C0X I;  3PUW A;  1I6H H;  3PO3 G;  3ULP A;  4LF9 Q;  3KDF A;  5M5X H;  2E2I H;  2B63 G;  2F52 A;  4IJL A;  5JJI A;  3UDG A;  4A3B H;  4B3T Q;  1PH1 A;  4OWT B;  4JI8 L;  4HIK A;  4KHZ A;  4UPA A;  2GVA A;  2D62 A;  3HOX H;  4DR3 Q;  1PHJ A;  3H15 A;  3PCO B;  1EQQ A;  3HKZ G;  1Q82 C;  1YVC A;  4X65 Q;  3KF6 B;  1E1T A;  3CCR A;  1K9M C;  2F4V L;  1I94 L;  4BBS H;  4IOC A;  3NEM A;  5C4X H;  5IP9 H;  2E2J H;  1VQP A;  4JBM A;  1Q12 A;  1UWV A;  4NXN Q;  2RF4 A;  3AFQ A;  1VQO A;  1M1K C;  2ZTE A;  3EN2 A;  2I5H A;  3M9B A;  3PUX A;  3I55 A;  1CKN A;  3KFU A;  1C9O A;  3PGZ A;  2QA4 A;  4APV A;  4B3R Q;  4PZ7 A;  2MO0 A;  3J80 i;  4YHH L;  4XIG S;  1PH8 A;  4C3H H;  1VQN A;  4LFB L;  3RLF A;  4K0K L;  3UE1 A;  4DUZ Q;  1JJG A;  4BXX G;  1MKH A;  1UEB A;  1Z47 A;  2BH8 A;  3H0G G;  3TRE A;  3PIO A;  5EAY A;  3F2C A;  3GTO H;  3RLO A;  1CUK A;  1PFS A;  3E9H A;  4OON A;  5JEA G;  1U5K A;  3F8T A;  4DK3 C;  5FLM H;  4HJ5 A;  4DR3 L;  1KC8 C;  4JI5 Q;  3PO2 H;  1VQ8 A;  4Y52 H;  4DR6 Q;  1WOC A;  2IHE A;  1X6O A;  4DAM A;  1SE8 A;  4L5T A;  3MXN B;  3HOU G;  4DUY Q;  1NTG A;  2ALY B;  2XGT A;  4AH6 A;  2R92 H;  4GKK Q;  2KBN A;  1SMX A;  1GO3 E;  4BY1 H;  5FLX c;  2K5H A;  3F2D A;  1YHQ A;  4A93 H;  3I4O A;  2OTJ A;  2UUC L;  1VQH A;  1UE5 A;  1HZ9 A;  1L1O A;  1YNX A;  3K7U C;  4P74 A;  3CQZ H;  4DV2 L;  4GNX A;  2E8G A;  5IYC G;  4B3S L;  1BBW A;  1U0L A;  1SRO A;  2A1A A;  3GD7 A;  3HOV G;  1G6P A;  1XPU A;  2JA8 H;  1YJW A;  5JEA J;  4DR7 Q;  4A3F G;  2LXJ A;  3S1Q H;  1KIX A;  4DUZ L;  1RIP A;  4LW1 A;  2IY5 B;  3PUY A;  4QIW E;  4A3C G;  3A74 A;  3BJU A;  1QUQ A;  4L5Q A;  4LUO A;  1N33 L;  3S16 H;  3GTL H;  4DUY L;  2NN6 I;  3PUV A;  5C0X J;  1A63 A;  4GKK L;  3TS0 A;  2R7F A;  3STB D;  3GTK H;  3S2D H;  1C0A A;  1A0I A;  4A3D G;  1HJP A;  1P8L A;  2B29 A;  1QVF A;  1Q81 C;  5LMU Q;  2E5L L;  4JI7 L;  4DV1 Q;  2K75 A;  4A76 A;  2DUD A;  2Y0S E;  2B3G A;  1E7Z A;  4A3E H;  1N32 Q;  4DR7 L;  1P16 A;  3MEF A;  4YWL A;  3CCS A;  1TWF H;  4LFC L;  4AYB E;  3L0O A;  1RL2 A;  5LMN Q;  1VQ9 A;  4A3L H;  1PH3 A;  1S72 A;  2JEB I;  4X66 L;  5IWA Q;  1KRT A;  3G6E A;  2JA7 G;  1JMC A;  4A3K G;  2UXB Q;  4WJ3 M;  3D0F A;  2HHH Q;  3ICE A;  3I4N H;  4ME3 A;  1PVO A;  1H95 A;  1J5E Q;  4IPH A;  4R4I A;  4P72 A;  1NBW A;  3S2H H;  3T1H Q;  1Q1E A;  4JBW A;  3TQY A;  3S1N H;  4LF8 Q;  2YYZ A;  3HFZ B;  3JC6 6;  1K8A C;  1VQL A;  3OTO Q;  4HJ8 A;  3CPF A;  4YCW A;  4DV0 Q;  5LMN W;  2E2H H;  4HIM A;  2OWO A;  1BBU A;  1DGS A;  2Y0S G;  4X64 L;  2HT1 A;  3CF5 A;  2N3S A;  4HID A;  2RCN A;  4A3B G;  3AQQ A;  4R1J A;  2MQH A;  3M4O H;  4IFD G;  4DV4 L;  4AYB G;  4JC0 A;  3K81 C;  3U58 A;  1CKO A;  3D31 A;  2ZJR A;  3HOX G;  4UP8 A;  5ELO A;  2VUM H;  1Y1V G;  5LMN L;  1Q7Y C;  2UUB Q;  2YTV A;  2NVT H;  1CSP A;  1SRU A;  1Y1W G;  2UXB L;  4TVA B;  1B7Y B;  3UE0 A;  2HHH L;  4DAY B;  1R9T H;  2JA6 H;  3PUZ A;  2OTL A;  1O7I A;  1B8A A;  2D0P A;  2K5N A;  3KDF B;  4QY7 A;  1D7Q A;  1VS0 A;  4A3I G;  2KHJ A;  3TRZ A;  3T1H L;  4LF8 L;  4A3J H;  4JI2 Q;  3OTO L;  3M85 A;  4DR5 Q;  1OXS C;  1PH6 A;  4DV0 L;  1ASY A;  3WWV A;  4P71 A;  1L0W A;  1PH7 A;  3A5Z B;  2HQL A;  2ID0 A;  2K50 A;  1IBL Q;  3L7Z C;  3Q8D A;  1N8R C;  2YTY A;  1A8V A;  4YHH Q;  2NZO A;  3RN5 A;  4K0K Q;  4LFB Q;  5IYB H;  4LFA Q;  1W3S A;  3H3V I;  2UUB L;  3RLN A;  4EQ5 A;  4LF5 Q;  2VL6 A;  3I2Z A;  4A3M H;  2VQE Q;  1K8G A;  2R6G A;  1HH2 P;  4GN4 B;  4BY1 G;  1VQ5 A;  4LF7 Q;  3RR5 A;  3PF4 A;  5C4X G;  1UE6 A;  5J3B A;  3HOW H;  2NVY H;  2WB1 E;  2Z0S A;  3CW2 C;  3M7N A;  1MJC A;  3UDI A;  2YV5 A;  1IBK Q;  1X9N A;  4DKA C;  1Q8K A;  4A75 A;  4NXM Q;  4IPD A;  5C44 G;  1QZG A;  2UUC Q;  1XNQ L;  1KQS A;  4JI2 L;  4DR5 L;  4GKJ L;  4DV2 Q;  2D0O A;  4DPG A;  3RN2 A;  4HJA A;  3A5U A;  1J6Q A;  4B3S Q;  1I50 H;  3GTJ H;  1YEZ A;  1AH9 A;  3STB C;  1IBL L;  1V43 A;  3E9I A;  4JBJ A;  2AHO B;  3J81 j;  2I0Q A;  3CC7 A;  1XMQ Q;  4KI0 A;  4LFA L;  1NY4 A;  2VS1 A;  3HOY H;  1WCM H;  1VQB A;  1JE5 A;  5DLQ E;  2JA5 H;  1YHB A;  4LF5 L;  1XJV A;  1OXT A;  1SN8 A;  2VQE L;  1HNX Q;  3PV0 A;  2WB1 G;  3W1B A;  2HIX A;  2MO1 A;  3CP0 A;  4R4C A;  3KJO A;  2HIV A;  2F3I A;  4QL5 A;  1XPO A;  1N33 Q;  3CD6 A;  2WP8 J;  3S1M H;  2K5V A;  1K3R A;  1VQA A;  5IE8 A;  3F2B A;  2CWA A;  1IBK L;  4GN3 B;  4YCV A;  1QUQ B;  4NPS A;  4NXM L;  1X3E A;  4AIM A;  3GTP H;  1I3Q H;  5IP7 H;  1NMG A;  2E5L Q;  4JI7 Q;  4A3L G;  5FJ8 H;  1A62 A;  4JI3 Q;  4JI6 Q;  2VNU D;  2KHI A;  1ASZ A;  3I4M H;  4JV5 Q;  1EIY B;  3CAM A;  4LNQ A;  4BY7 G;  4DV3 Q;  1XMQ L;  3I4N G;  3KF6 A;  1EUJ A;  4LFC Q;  4GNX C;  1L1O C;  3OYY A;  4X66 Q;  2AWO A;  1K0R A;  4IFD I;  4POF A;  4L5R C;  4JYA L;  1E1O A;  4KHP Q;  1LYL A;  1UE1 A;  1HNX L;  3U50 C;  1WJJ A;  2R93 G;  1GVP A;  5C4J H;  2GN5 A;  1SFO H;  3U4Z A;  4BBR H;  1YBY A;  1YJN A;  1FJG Q;  1TXY A;  3ULJ A;  1G51 A;  5GAH C;  2Z6K A;  4X62 Q;  1QZH A;  3SGI A;  1YIT A;  4X64 Q;  2PQA B;  4Y7N H;  4JI3 L;  2VW9 A;  1XMO Q;  4JI6 L;  3HOZ G;  4JV5 L;  3CMA A;  4JI0 Q;  4DV6 L;  2AWN A;  3KOJ A;  4PMW A;  5IT9 c;  5IYD G;  4DV4 Q;  4DV3 L;  4IO9 A;  2R7D A;  2JA6 G;  4QQB X;  5M3M H;  1VQ6 A;  1GKH A;  2IX1 A;  1PA6 A;  4UY8 C;  1AE2 A;  1KXL A;  2ZTC A;  4MZ9 A;  2R7Z G;  3H0G H;  4YY3 Q;  1PH4 A;  4BXX H;  4KHP L;  4BA1 I;  3S1R H;  4A3J G;  1TWG H;  4JI1 Q;  4DV5 Q;  4GOP A;  1MIU A;  1IBM L;  3LGJ A;  3L2P A;  3I7F A;  5K36 G;  2CKZ B;  3OW2 A;  2K52 A;  1EWI A;  1FJG L;  1HR0 Q;  3HOU H;  2KCT A;  5C3E H;  3S14 H;  4X62 L;  1IYJ B;  4QJF A;  2CWP A;  4GOP C;  3J81 c;  3PO3 H;  4PG3 A;  1XMO L;  2BA1 A;  1TWA H;  1VQM A;  4H02 A;  1JB7 A;  1OTC A;  3S24 A;  4DR1 Q;  1T9H A;  4OWX B;  1FVI A;  1X65 A;  5IYC H;  3PF5 A;  4JI0 L;  1PYB A;  3H3V H;  3J7A 5;  3U4V A;  3HOV H;  1JJ2 A;  2FXQ A;  5M5W H;  4A3F H;  3CXC A;  3T1Y Q;  2AMC B;  1NJI C;  1VCI A;  1K83 H;  1FGU A;  3K8A A;  1YI2 A;  1HR0 W;  4B3R L;  1VQG A;  5M5Y H;  4BBS G;  5IP9 G;  4YY3 L;  4DV7 L;  2BA0 A;  3A0J A;  4DR2 L;  4LF4 Q;  1EQR A;  2GVB A;  2IT1 A;  2NZH A;  4A3C H;  2OQK A;  4TQU S;  4YWM A;  4JI1 L;  4DV5 L;  1N34 Q;  4GKJ Q;  2ZTD A;  1AE3 A;  5M3F H;  1LM0 A;  3TEH B;  1IXR A;  1EOV A;  1TWH H;  2AKW B;  4LUV A;  1HR0 L;  1E3P A;  3ER0 A;  3GO5 A;  2IHF A;  1XTD A;  4DNI A;  2OCE A;  1X55 A;  4JOI A;  5ELN A;  1XNQ Q;  4IFD J;  4JI4 Q;  4IPG A;  1MJE A;  1WI5 A;  4IPC A;  4C3I H;  2QEX A;  1HZA A;  2ATW A;  2QGQ A;  4GN5 A;  4R4Q A;  4DR1 L;  4RG1 A;  4UP7 A;  3G71 A;  5FLM G;  3CCV A;  1IZ6 A;  1CKM A;  4O2D A;  3GTM H;  3PO2 G;  4A3G H;  2MNA A;  1Z9F A;  4JOI C;  2YU9 H;  3T1Y L;  1CKN B;  1XNR Q;  2R92 G;  3J81 i;  1KD1 C;  5GQO A;  2CCZ A;  3AYH B;  4O0A A;  4A93 G;  2EXD A;  4LF4 L;  1L2F A;  3CCU A;  1N36 Q;  2JA7 H;  4GS3 A;  3UDX A;  4A3K H;  1BVS A;  1KL9 A;  3RZD H;  1N34 L;  5IP7 G;  3CCL A;  1QVC A;  1NMF A;  5FJ8 G;  5GAE C;  3FKI H;  2UU9 L;  1N9W A;  3I4M G;  4HJ7 A;  4J15 A;  1PH5 A;  2JA8 G;  1JJC B;  2H5X A;  2UUA Q;  4XTC S;  2JQO A;  1VQ7 A;  3GTG H;  1WYD A;  2I5L X;  2NVX H;  4JI4 L;  4UP9 A;  1SR3 A;  1LTL A;  4RMF A;  1W2B A;  2RHQ B;  1TWC H;  3AFP A;  3EBE A;  3CPW A;  1WFQ A;  1L1O B;  1X54 A;  1S3O A;  4C3J H;  4PZ8 A;  4GNX B;  1JT8 A;  1VQE A;  4IOA A;  3W5O A;  5HGQ A;  5GAG C;  1OXX K;  3I56 A;  1XNR L;  4GLA C;  1Y1V H;  4BBR G;  4JYA Q;  1E22 A;  5HY6 A;  2XTI A;  1G29 1;  3NEL A;  4AQY L;  4YWK A;  4OO1 I;  4A4I A;  3AEV A;  2N49 A;  1Y1W H;  1N36 L;  5BR8 Q;  4QGU A;  1VQC A;  4ALP A;  2UXC Q;  2LSS A;  1V1Q A;  1OXV A;  1VQI A;  1X3F A;  3BU2 A;  1FL0 A;  3K7A H;  4LWC A;  4A3I H;  4A3E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...