1JE5A

Crystal structure of gp2.5, a single-stranded dna binding protein encoded by bacteriophage t7
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
197
structure length
181
Chain Sequence
MAKKIFTSALGTAEPYAYIAKPDYGNGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATDWADEVEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HELIX-DESTABILIZING PROTEIN
publication title Structure of the gene 2.5 protein, a single-stranded DNA binding protein encoded by bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Dna binding protein
total genus 41
structure length 181
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1je5A00
2HIVA 3HOXH 4R4QA 4DK6C 1KQSA 1M90C 4YCWA 3W1GA 1Q1EA 2JEAI 3GTQH 4LFBL 4Y52H 1GO3E 2AWNA 4L5RC 2B29A 4JI1L 2YU9H 1NY4A 3I4MG 3CQZH 1NBWA 4DV6Q 1W2BA 4GN3B 4DV7Q 3M85A 2ZJRA 2A19A 5IP7G 5ELOA 1PFSA 4IFDI 1X54A 1N32L 2Z6KA 1HNZQ 1OXTA 3HOZG 1IYJB 2EQSA 1PYSB 2FXQA 2UUBL 1UE6A 3CC2A 4JI4L 3AFQA 3PGZA 4YCUA 5BR8L 3M7NA 2NVQH 4LFBQ 2OTLA 1K3RA 1YI2A 2UUCL 5HGQA 2B63H 4B3TL 4NXNQ 2I5LX 2R93G 1P16A 4QJFA 4JI1Q 2CWAA 3CCVA 4J15A 5JJLA 1VQMA 5HY6A 1Q7YC 1N32Q 3PUVA 1YJWA 4UY8C 1Q82C 5IYDG 3T1YQ 4LF7L 5AJ3L 2R7DA 4IOCA 1KIXA 4DAYB 1HZBA 4DV0L 2E2HH 2UUBQ 2K4KA 3E0EA 5FJ8H 4IPGA 5IP9H 4JI4Q 3F1ZA 4A3CG 5BR8Q 3S2HH 4A3DH 3GTPH 3KFUA 2VZAA 4IPCA 1PH7A 1E24A 2WAQE 3KF8B 1L0WA 2R92G 1Q1BA 3S14H 1KXLA 1HJPA 2KHJA 4DV2L 3PO2H 3L0OA 4A75A 1D8LA 1VQAA 5GROA 2OTJA 4X65L 1EIFA 4GN5A 2A1AA 3EBEA 4DKAC 4OWXB 3ULPA 4MTNA 1PH6A 2E5LQ 3GTGH 1A62A 2BA1A 3B6YA 3FHWA 4PZ6A 4DR3L 5AJ3Q 3H3VI 3T1HL 4AH6A 1FL0A 2R6GA 4UPAA 5M3MG 4DV0Q 4DV5L 2JA8G 1IBML 1HR0L 5C4XG 1AE3A 4GNXA 1XMOL 4X64L 4A3KG 1I50H 3U4ZA 4A4IA 4YWKA 3RLOA 1N9WA 4OXPA 5C44G 2OQKA 3IRBA 4DV2Q 2HIXA 3BU2A 3J80i 1SLJA 1E1OA 1YEZA 1KRSA 2MQHA 2OCEA 3CW2C 3HOWG 2ID0A 3I4MH 2YTYA 4P73A 5IP7H 4NPSA 1U5KA 2ATWA 4DR3Q 1WYDA 2R7FA 2VY3A 2VL6A 1S72A 1MIUA 1KC8C 4DV3Q 1Y1VG 3MEFA 4DV5Q 3LGJA 5GADC 3HOZH 1WJJA 5C3EG 4PZ7A 3HOXG 3CCLA 1VQDA 4NXML 1CKNB 1BBWA 4X64Q 2ZTDA 2CQOA 4L5SA 1X3GA 2UXBL 4R4CA 4LF6L 3I4NG 5FLXc 4UP7A 4JBWA 4HJ5A 2RF4A 2R93H 4LFCQ 4JBKA 4A3LG 3GTMH 2CFMA 1N33L 3PUZA 4EX5A 3NELA 3KDFA 2EIFA 4R4IA 4APVA 1H95A 5IYDH 3CP0A 1AH9A 2XGTA 3CCUA 1L1OC 4A3CH 4NXMQ 3DLLA 3U58A 2ES2A 2UXBQ 2WB1G 1JT8A 2N49A 2R92H 1VQLA 4OO1G 2WB1E 3AYHB 4XIGS 4A3EG 1TWHH 2DGYA 2GN5A 4IPHA 4HJ7A 4A3JG 1VQ8A 4QGUA 3OW2A 1N33Q 3KF6A 5GQOA 1KD1C 5JEAJ 1V43A 1CUKA 1I5FA 4QQBX 2GVBA 1A8VA 2A8VA 5IYBG 4PMWA 2ZTCA 3GDEA 1G291 1C7YA 5M3MH 2JA8H 2PI2E 2ASBA 4XTCS 1P8LA 2KENA 4BBRG 5C4XH 2Z0SA 3G48A 4JCVE 4DR1L 4LFAL 1VCIA 1TWAH 4A3KH 2BH8A 3GO5A 1QVCA 3ZJYC 4WJ4A 1UEBA 1UE5A 5C44H 1VQCA 2KCMA 4K0KL 2NN6G 3F2DA 1EOVA 4QY7A 1EYGA 1C9OA 2IT1A 3EN2A 3OYYA 4DPGA 2HT1A 5C0XI 5LMNW 2HQLA 1QVFA 4EQ5A 4TVAB 2QA4A 4HIMA 1Y1VH 1S40A 2UXDL 3PF4A 2VW9A 4GOPC 4LFAQ 5C3EH 4KHZA 3W5OA 4DR1Q 1X55A 5FLMG 3RNUA 1KRTA 4A3MG 5JJIA 2K50A 4YWLA 4WJ3M 2JA5G 1OTCA 3I4NH 4NXNL 1WOCA 2PI2A 2LXJA 3PUWA 4AYBG 3JC66 3OTOQ 2BA0A 2CWPA 1PH1A 4K0KQ 4A3LH 4AYBE 4B3RQ 3GTJH 1N8RC 3UDXA 1XJVA 1Q12A 2C35B 4KI0A 1VQ4A 1KHIA 4DUYL 3A0JA 1QZHA 3T1YL 5K36G 2UXDQ 3ER0A 3RLNA 3EIVA 4DR4Q 1PH5A 4LUZA 4IO9A 3HFZB 1YHQA 4BBSH 2IHEA 1BVSA 1PH8A 5C0XJ 4DR5L 3UE1A 4X66L 4A3EH 4A3JH 1X3EA 3D0FA 1K0RA 2LXKA 3CMEA 4GOPB 3H3VH 2D0PA 1K83H 1SFOH 4POFA 4A93G 1IZ6A 3RLFA 1VQIA 4X62Q 2E5LL 5IYBH 4DUYQ 4C3JH 1HNXL 4HJAA 1I94L 1E22A 1NMGA 1T9HA 3E9HA 5M3FG 1JJ2A 4AQYL 1W3SA 1VQBA 3K81C 4JC0A 3U4VA 4BBRH 1L2FA 1X56A 4ALPA 3M4QA 1J5EQ 2YTVA 3K7AH 1JJCB 2KBNA 1YITA 1Y1WG 4DR5Q 1Q81C 3RR5A 4X66Q 1K8GA 4OWWB 1K8AC 2JA7G 4OONA 2UUAL 2E2JH 2ZM6Q 2MFIA 2YYZA 2PMZE 3UDIA 2WP8J 3VDYA 2ZJPA 3F8TA 1JE5A 3UDFA 1HNXQ 1QUQB 1I94Q 3G6EA 3CMAA 4DV3L 2AMCB 3K8AA 1WCMG 4P74A 3STBD 4AQYQ 1CKMA 2ZJQA 2R7ZH 4A3GG 4C2MH 5FLMH 1V1QA 4A3MH 2V1CC 2LSSA 1EUJA 1AE2A 3FKIG 3PIOA 2JA5H 4BA1I 4LF5Q 4IFDG 4DR6Q 4LFCL 4UP9A 3PV0A 1QZGA 2UUAQ 3I4OA 4JI0L 2Q2HA 3J81c 2IX1A 2IHFA 4GKJL 2F3IA 4POGA 2EXDA 2AHOB 4JOIC 3STBC 4LUOA 4FDBA 1HR0W 2YTXA 4YWMA 1YIJA 1XPOA 3CD6A 2B3GA 4A3IG 1VQ9A 3TRZA 3A74A 2Y0SG 1EQQA 1SE8A 3S1QH 2Y0SE 3F2BA 4RG1A 4BY7G 4JI7L 3PCOB 1X3FA 1Q86C 4JI0Q 4GLVB 5C4JH 2WFWA 1K9MC 4A93H 4GKJQ 1CKNA 1G51A 4IJLA 4LWCA 2I0QA 1XMQL 2BH2A 2E8GA 4JI6Q 4LF9L 2RCNA 2I5MX 1B70B 3HOVG 3CAMA 4OX9L 3SGIA 1VQ6A 3S24A 5M3FH 4O0AA 1Q8KA 1FGUA 1SROA 2JE6I 2E2IH 4JBJA 3K7UC 4BBSG 1LYLA 2GVAA 3H0GG 5ELNA 1EQRA 1LM0A 4AIMA 4DV4Q 1Y1WH 3S17H 2JA7H 5LMUQ 2MO0A 1D7QA 4JI7Q 2NVTH 2K14A 1SR3A 4YY3L 3NENA 3KJPA 1KAWA 2XTIA 1XMQQ 1PV4A 4LF9Q 1S3OA 2F4VL 1MJEA 1RL2A 3CC7A 2RHSB 4OX9Q 1TWCH 3S15H 5DLQE 1FJGL 1WCMH 1PHJA 2NVXH 3CXCA 1DGSA 1PA6A 4RMFA 3TS2A 4A3GH 4MNOA 2AKWB 4JV5Q 1NMFA 3CCRA 1LUZA 3GTOH 1IL2A 3FKIH 3M4PA 3UDGA 1QVGA 4JI3Q 3I7FA 4B3ML 3OTOL 3RZDH 4PZ8A 1YJNA 2H5XA 3AQQA 5M5XH 4YY3Q 5IWAQ 2UU9Q 5JEAG 4HIDA 1VQOA 4B3RL 2CCZA 1MKHA 3U50C 3KJOA 5JJKA 3ERSX 4HJ8A 2F4VQ 1I3QH 3HOUG 1KL9A 4LF4L 4LW1A 1R9TH 1EIYB 3A5UA 4LF5L 2PNHA 1G6PA 4H02A 2NZHA 5LMNL 2Z6KC 4JI8Q 1FJGQ 2R7ZG 3I55A 4YHHL 1L1OA 3ULJA 4DR4L 3BJUA 4C3IH 4A3IH 1SN8A 4GLAC 2K52A 1XPUA 3HOYG 3AEVA 3S2DH 4BY1H 2PQAB 1EFWA 2Q2UA 4B3MQ 3PSIA 2Q2TA 1HNWL 4BY7H 1XTDA 3JAMi 4KHPQ 3S1MH 1CSQA 5EAYA 5IT9c 5IY0A 4X62L 4LF4Q 3K80C 3J80c 3H15A 1PH4A 4JBMA 2QGQA 1E7ZA 2VS1A 3KOJA 5LMNQ 1X6OA 4DV1L 4GS3A 3HOVH 3CCJA 4YHHQ 4LF8L 1Z47A 1K73C 1ASYA 4TQUS 3S1NH 1GKHA 3H0GH 4YCVA 3M9BA 4JYAQ 1X65A 1N34L 1PH3A 1HNWQ 3NBHB 3CCSA 4JI5Q 1YBYA 1VQKA 2VQFQ 3FP9A 2ZM6L 4R4OA 1LTLA 1YNXA 2UXCL 3K0XA 3CF5A 1CKOA 3I56A 2N3SA 3GTKH 2F52A 3CCMA 4X6AH 5M5WH 4DV1Q 4GOPA 1N36Q 4LF8Q 4GLXA 1YHAA 1JB7A 1VQHA 4DAMA 4UP8A 1HZ9A 2IY5B 5C0XG 4LNQA 1RIPA 4GNXC 4PG3A 1N34Q 1PVOA 3KLWA 2YV5A 3CPWA 1M1KC 1NTGA 4DR6L 2HHHL 4HJ9A 3RN2A 1VQFA 2UXCQ 3GTLH 1YZ6A 1IBKL 3HOUH 2K5NA 3F2CA 3BZKA 2QEXA 1NJIC 4ME3A 1B7YB 1MJCA 3W1BA 4BA2I 1OXSC 4JG2A 4L5TA 1HH2P 5IE8A 5H1SE 3PIPA 4JI2L 4O2DA 3Q8DA 2I5HA 5E7NA 4A3BG 1Z9FA 4QL5A 1WI5A 2D62A 4Y7NH 2WAQG 3HOYH 3KYHC 1BBUA 2OQ0A 2AWOA 4L5QA 2UUCQ 4B3TQ 1QUQA 2NVYH 3RZOH 2HHHQ 4A3FG 1TWFH 1O7IA 1GD7A 4IFDJ 4P72A 1VQ7A 1FVIA 2CKZB 1UE1A 5GAGC 5GAEC 1XNQL 3PUXA 4GNXB 5IYCH 4P71A 1IBKQ 3TQYA 2IX0A 4JI6L 4OO1I 2VQEL 3S16H 2KCTA 4LF7Q 4GN4B 1GVPA 4JI2Q 3G71A 3TEHB 4BXXG 1JJGA 3PO3G 4DR7L 2DUDA 4DV4L 4BY1G 4GKKL 3D31A 1IXRA 1PH9A 2JA6G 4C3HH 5LMUL 1JMCA 3HKSA 1NE3A 3CC4A 1C0AA 4X65Q 1XNQQ 1A0IA 2L15A 3DM3A 4DR2L 2K5HA 3GD7A 1WFQA 1EWIA 2ZTEA 3JAMc 1Y14B 2VQEQ 3I2ZA 5J3BA 3CCEA 2K75A 1VQEA 2NN6I 3T1HQ 4IJHA 1GM5A 1CSPA 5GAHC 2OWOA 2VUMG 3ICEA 4DR7Q 3CCQA 1HR0Q 1IBMQ 4JV5L 4KLKA 1UE7A 4MZ9A 1YJ9A 3HKZG 4DUZL 1XMOQ 1ASZA 3KDFB 4JI3L 4HIKA 1VQNA 4GKKQ 1OXXK 3RN5A 3HKZE 2UU9L 5IWAL 1HZCA 3CPFA 4DR2Q 2N8NA 2NZOA 2ALYB 3ULLA 4QIWE 1XNRL 4R1JA 4IPDA 4JOIA 3G4SA 4JI8L 2JQOA 2JK8A 3M3YH 3KF6B 4DNIA 3AFPA 1VQPA 1IBLL 3PUYA 3J7A5 4A3BH 1VS0A 4R4TA 3WWVA 4DUZQ 4A76A 2B63G 2N78A 4LF6Q 4A3FH 1J6QA 3J81j 4KHPL 4NB3A 4OWTB 2MO1A 3TS0A 1B8AA 1HZAA 4DK3C 3J7ZC 1V9PA 1VQGA 1OXUA 1TXYA 1XNRQ 4IOAA 1Q46A 1BKBA 4B3SL 2JJQA 2JA9A 1SMXA 2VNUD 1A63A 1IBLQ 3L7ZC 4LUVA 5IP9G 5FJ8G 2Q2IA 1J5EL 1TWGH 3MXNB 3PO3H 4BXXH 4A3DG 2KHIA 1PH2A 1YVCA 3L2PA 2RHQB 1SRUA 3J81i 2JA6H 4JYAL 4JI5L 3UE0A 2VQFL 1VQ5A 1OXVA 2K5VA 1VQJA 3NEMA 2D0OA 1PYBA 3TREA 3PO2G 5M5YH 1YHBA 1L1OB 2MNAA 4DV6L 3HOWH 3M4OH 5IYCG 4DV7L 3BZCA 3PF5A 1X9NA 1I6HH 3S1RH 2PQAA 4B3SQ 1UWVA 4HIOA 1E3PA 3E9IA 1HNZL 2JEBI 1N36L 4P75A 2VUMH 3A5ZB 1XPRA 1E1TA 1U0LA
chains in the Genus database with same CATH superfamily
2K03A 3DM1A 2RDGA 3W1GA 3GTQH 2HCCA 1LTTD 1SE4A 2B29A 1M4VA 1UEAB 2YU9H 4DV6Q 4GN3B 3HOUB 4PNYA 4P2CB 4DAVA 3QOJA 1IYJB 1PYSB 2RSNA 5KYIA 4XYOA 3CC2A 1JWMD 4YCUA 4HCEA 4CJ0B 3QJYA 2OTLA 3HOYB 2UUCL 3BYTB 1VDZA 1P16A 3CCVA 2A69D 2KJXA 5HY6A 2DY8A 3S16B 5IYDG 3T1YQ 2RQXA 2R7DA 5FKAC 5CORA 1HZBA 5FJ8H 2PW5A 4A3CG 3GTPH 1DD2A 2F0FA 3H6MA 3S14H 2VB3X 3ERQA 5E4WC 2A69C 2RVLA 5GROA 2B2TA 3M7GA 4IN3A 4DKAC 3WOEA 3ULPA 1B50A 3GTGH 1S5BD 4DR3L 2RCFA 2V4DA 2F0LA 3H3VI 4J8QA 2RSOA 2JA8G 5M3FB 4DV5L 2NBFA 4ZRZA 1HR0L 3KBXA 5KGUA 1TQOA 3S17B 3U4ZA 3K57A 1N9WA 3IRBA 2G9HD 2PMZB 1E1OA 1YEZA 2L0CA 3CW2C 2ID0A 2KUMA 2FHTA 2YTYA 1VF7A 1MGSA 4DR3Q 4CKCA 1WYDA 5KNCA 3MEFA 4DV5Q 4A3GB 5CV4A 1JOQA 1WJJA 2Z6BA 1CKNB 2CQOA 3D4RA 1X3GA 4R4CA 4LF6L 1XTCD 1HFNA 5COYA 4UP7A 4JBWA 3SVMA 1CZWA 1IHZA 4MTKA 1H9RA 3PUZA 1F77A 2P5ZX 3QOLA 4EX5A 3HS0C 1R9TB 2EIFA 2N88A 5IYDH 1PYWD 3CP0A 1PFMA 4A3CH 1TS3A 3DLLA 3U58A 4XDXA 1KDBA 5AFWA 4A3EG 2GN5A 4HJ7A 4KMUC 3I8ZA 3OW2A 1TT2A 5JEAJ 4QQBX 4N9TA 3GDEA 3HOVB 1HRJA 1C7YA 2JA8H 1S4ZA 4XTCS 4N9PA 1E2ZA 1DCZA 2WIIB 2KA7A 4IFDH 2KCMA 4K0KL 3F2DA 1EOVA 4QY7A 1C9OA 2IT1A 3EN2A 4G4KA 4DPGA 2KEEA 2EYPA 2HT1A 2EVBA 4UDUC 5C0XI 1SYFA 1QVFA 1YNND 1TS4A 5T1IA 3OIQA 1MHWC 2M9VA 5EPKA 4NXNL 1WOCA 2PI2A 4AYBG 4Q5VA 1PH1A 3UI2A 2CWPA 4K0KQ 4AYBE 1CQFA 2C5CA 4K2LA 1JOKA 3W2DA 4XYQA 1QWYA 1GUOA 1VQ4A 3K0YA 2F0PA 4EQOA 4DUYL 3KLSX 4IZ8A 2B39A 4NW2A 3RLNA 3EIVA 2WV6D 4DA2A 1HCZA 4LUZA 3S2HB 4F8MA 2ICIA 2IHEA 4DR5L 1TWFB 4A3EH 1STBA 1X3EA 1CM9A 4KKUA 2K28A 3TP7A 2PPBC 1KLUD 3TN2A 1SFOH 4POFA 1VQIA 2R3ZA 4DUYQ 1HNXL 1E22A 1XXGA 5I9OA 4G57A 1CK1A 5M3FG 4AQYL 2K05A 1W3SA 4JC0A 3U4VA 1X56A 4ALPA 3MAQA 1PZJD 1J9OA 1YITA 4DR5Q 4OONA 2ZM6Q 2MFIA 2F0HA 2PMZE 3UDIA 2ZJPA 3F8TA 1HNXQ 3KF8A 1EEID 1WCMG 4P74A 4AQYQ 4A3GG 1CKMA 2ZJQA 1EYAA 3NHHA 2V1CC 2B2YC 5ELDA 3SK5A 4LFCL 4UP9A 3PV0A 1IYUA 1RF2D 2F3IA 2I46A 3CKIB 1NCVA 1D5MC 2AHOB 1IYVA 1K0SA 2L55A 1XPOA 2WAQB 1FGBD 3A74A 3A7AB 1R4PB 4ILWA 1D1KA 5IGCA 4A3FB 4RG1A 1BR9A 4GZYC 1X3FA 4HCSA 5FK9C 1XMQL 1EYDA 2K01A 1I6VC 3HOVG 5HGTA 1VQ6A 3S24A 5M3FH 3ND9A 1FGUA 2CH4W 2KQ3A 4RCOA 4DV4Q 3S17H 4RHRA 1STGA 1D7QA 3BYYB 1SR3A 2F0SA 1GXDC 2BE5D 1XMQQ 1PV4A 2F4VL 1PFNA 3K6OA 4C1NK 5EKKA 5C4HA 1IL8A 1WCMH 2NVXH 4A3GH 3CXCA 5C3EB 2KEDA 3T53B 3HOXB 3CCRA 1WTRA 4WORA 4JI3Q 5KEEA 3FEWX 5CBAE 2FJ2A 4B3ML 1YJNA 4HIDA 3CQZB 1VQOA 1B2TA 1W6KA 2CCZA 1MKHA 3U50C 3KLRA 1T5EA 2BE5C 4KN4C 2A6HD 2F4VQ 4LW1A 5A35A 1R9TH 2PNHA 4H02A 2VXWA 3RMHA 1ENFA 1R4QB 2R7ZG 2JSOA 3OSOA 1ENAA 3BJUA 5J22A 4H7BA 2NVQB 2WB1B 4GLAC 2AQ1B 3S2DH 1SYDA 5CV8A 4B3MQ 1HNWL 1I4HA 5DAUA 1KDCA 1H9SB 5IY0A 2A6HC 3J80c 1E7ZA 2VS1A 1X6OA 3HOVH 3DHQA 4LF8L 1Z47A 4C1NI 1K73C 3H91A 1GKHA 5CBEE 3R3OA 1X65A 1N34L 5C3XA 1HNWQ 3CCSA 1DOKA 4R4OA 1RJTA 3CF5A 3HGBA 2QDBA 1Y8NB 1WTWA 3VR6A 1EY8A 1N36Q 4LF8Q 1YHAA 2LS01 1EY0A 2M2LA 3MHBA 2WKDA 4PG3A 1N34Q 3KLWA 1B53A 2YV5A 4RWSC 1PLFA 5C5LA 2E75C 5T1GA 2EXZA 3D4DA 3F2CA 2K33A 2FFKB 1I4GA 2QEXA 1NJIC 1B7YB 2HCIA 3HOZB 1S5CD 3PIPA 1TS2A 1Z9FA 1WI5A 2WAQG 2AWOA 4L5QA 4H44C 2R93B 4A3FG 1TWFH 4TRDA 3SEBA 1HXYD 1XNQL 4GNXB 1SEBD 1DJRD 4OO1I 1CZGA 1EFID 2KCTA 4GN4B 2F1MA 3WDNA 4BXXG 1JCKB 2DUDA 4BS9A 2KCNA 3MZ5A 2EY6A 2JA7B 3IL8A 1TVXA 1TWHB 4QCLA 2ICEC 4PQXA 3CC4A 2XIWA 1XNQQ 4DR2L 1EWIA 3JAMc 2B8FA 2IW3A 5J3BA 1VQEA 3LWUA 3T1HQ 4ULLA 5GAHC 3TZUA 5C4XB 3CCQA 1AZQA 1TWAB 1AEXA 4HMJA 4OL7A 1XMOQ 4DUZL 1VQNA 5NUCA 5C44B 3RN5A 3J80L 3OWEB 2H4OA 4DR2Q 2N8NA 2WACA 1XNRL 4KD3A 4JOIA 4R1JA 3RUZA 4RGTA 3G4SA 4I7ZC 2PW7A 2JK8A 3KF6B 1K8MA 1V1PB 3AFPA 4DUZQ 1U4PA 1F2MA 4N8X1 2Z9HA 4A3FH 1BF4A 1TR5A 3DXJC 1SDFA 4I7AA 1SYCA 3A56A 4RGOS 1V9PA 1EIGA 1XNRQ 1WD1A 1SMXA 4CBVA 4ABNA 4BXXH 1JWUD 2KHIA 3L2PA 4JI5L 2VQFL 1VQ5A 1PYBA 1YHBA 1L1OB 4B9XA 5IYCG 1O78A 4C3JB 3S1RH 2PQAA 5JOBA 4XXEA 3E9IA 1HNZL 2JEBI 1Y8OB 2B2UA 4H0LC 3HOXH 2KOLA 4DK6C 1KQSA 3QG1A 3MA2B 2XSCA 1GO3E 3BVZA 4ID6A 1NY4A 2NYZD 3CQZH 3M85A 2A19A 5IP7G 5ELOA 1PFSA 1N32L 1X54A 3NBHA 1HNZQ 4OIJA 3HOZG 2MHVA 2FXQA 1A3VA 1UE6A 3AFQA 5BR8L 4KJNA 2NVQH 2JA5B 1YI2A 1C48A 3JAML 2I5LX 2R93G 2L1BA 3U9SA 2D2CC 1Z7TA 1NR4A 3NK9A 1WTPA 1N32Q 3ITPA 3PUVA 3OMGA 1GUTA 5AJ3L 1SAPA 4IOCA 1KIXA 4DAYB 2E2HH 1LTGD 1G91A 4JVZA 5EKIA 5BR8Q 3KFUA 1E2VA 4IPCA 1F9SA 1E24A 5BN3A 1PH7A 1L0WA 3S1QB 4KY7A 4X3TA 3SK6A 4A75A 2OTJA 4OGQC 4FXDA 1BQQT 5CV6A 4EVOA 3NQTA 2A1AA 3EBEA 3QIAA 1EYCA 3R2TA 2Q8RE 1MBYA 2E5LQ 1HHVA 3B6YA 2F3WA 5AJ3Q 2R6GA 4K6LA 1SE3A 1IBML 2RDHA 5C4XG 1AE3A 3IAYA 4X64L 4A4IA 5C44G 2NVTB 2HIXA 3J80i 4IUPA 3G7LA 3HOWG 1KRSA 1DXMA 3DWPA 5IP7H 3VA7A 3D6CA 4IQZA 3MTSA 2ATWA 1KC8C 1TWCB 2VL6A 4CHTB 3TSSA 3HOZH 2HDLA 3M3YB 3PQIA 4PZ7A 3CCLA 4NXML 4X64Q 1EWCA 2UXBL 4MHEA 2X6LA 5FLXc 3A7LA 5M5XB 5I6YA 2R93H 2CFMA 3A55A 3KDFA 4R4IA 1U4LA 4CJ1B 1L1OC 2X69A 4NXMQ 1LTID 2Y0SB 2UXBQ 4BY1B 2N49A 4XIGS 1KABA 1GUWA 1IW7D 4DN4M 1X32A 1TWHH 1FNVA 3I70A 4CDFC 1DYQA 3M4OB 1A8VA 2NWGA 1BDOA 1SYEA 1A2TA 2EYHA 4C3JG 1BUVT 2L11A 2ZTCA 4HMIA 1F9PA 1G291 4WJWA 3TZDA 5C4XH 4JCVE 3NWSA 3S1NB 1TWAH 4G7ZC 1GUSA 2RDFA 1LTAD 1UEBA 4FF1A 5C44H 1IW7C 1VQCA 1TS5A 1EYGA 4KN7C 3MXNA 1KLGD 3GTKB 4QIWB 5LMNW 2HQLA 4TVAB 2UXDL 1ONLA 3N6RA 4GOPC 4F87A 3L3OC 3KLSA 4A3MG 1HPCA 2K50A 4YWLA 2JA5G 1EY9A 2B63B 3JC66 1E0BA 4KY5A 2J4XA 4B3RQ 3UDXA 1XJVA 1Q12A 1U4RA 2C35B 4KI0A 3A0JA 1QZHA 3T1YL 5K36G 2UXDQ 4KTAA 3TMEA 3HFZB 1XWEA 1PH8A 1EY5A 1EZ8A 1SSOA 5C0XJ 4X66L 3D0FA 3H3VH 3CMEA 3PO2B 4UHVA 1A2UA 1O7YA 4X62Q 3W3AA 1SNQA 4C3JH 1B44D 1NMGA 4HTHA 2B2WA 3E9HA 1JJ2A 5CR3A 1JC7A 4K5VA 4HAEA 5BN5A 4LF5L 2KBNA 1EZ6A 4X66Q 3X3MA 1K8AC 1M8AA 2K5DA 2YYZA 5CMDA 4LAAA 3VDYA 4RKLA 1KDAA 2NTTA 3UDFA 1DZ1A 1PMRA 1QUQB 3SK8A 1F2YA 3NBIA 1V1QA 4A3MH 4L63B 1IKMA 3PIOA 4LF5Q 2JA5H 4BA1I 3PMFA 2XRSD 4IFDG 2PQEA 3I91A 3NPPA 3FVQA 4FF3A 1ILQA 1TKWB 3I4OA 4DU9A 4EGVA 2QILA 2X6GA 4DK0A 2BDNA 2IX1A 2WKCA 4GKJL 4K6DA 3N52A 1STHA 5K36H 3VR2A 3C3LA 1LACA 4LUOA 1HR0W 3CD6A 2B3GA 2E74C 3TRZA 1EQQA 2Y0SG 4ZQ3A 1SE8A 5IIFA 4G7OC 3S1QH 1ZXTA 2Y0SE 3D4WA 3MVVA 3PCOB 4JI7L 4O1NA 1LTBD 4GLVB 3C2PA 2OT2A 1U9RA 4GKJQ 1CKNA 1G51A 4IJLA 4LWCA 2I0QA 2E8GA 4EQNA 4OX9L 3SGIA 1Q8KA 2JE6I 1RCVD 4JBJA 1LYLA 1TIID 1EQRA 1V1OA 5LMUQ 2B2YA 2MO0A 4JI7Q 2NVTH 1STEA 2DJFC 3P7JA 1QG7A 3NENA 1EU4A 1RKNA 1S3OA 3SE0A 5ELFA 3CC7A 2RHSB 4OX9Q 1TWCH 4HR7B 3S15H 2VUMB 1PHJA 3E6ZX 3A54A 1ET9A 1VF5C 3HKZB 1QVGA 4ZK9B 3TDQA 2R61A 2Z4IA 2H5XA 5M5XH 2UU9Q 4U68A 5JEAG 1AFPA 3ERSX 5LHY1 1B9NA 4HJ8A 3HOUG 3P75A 2B2VC 4LF4L 2KVMA 3ZYYX 4JI8Q 2PYKA 1SJHD 3IKJA 4XT1B 3HOYG 2NTSA 3K58A 1II3A 4BY1H 1FNUA 2EYJA 1CA6A 1XTDA 5EAYA 1S5ED 5IT9c 1DONA 3GV3A 4LF4Q 3OIPA 2CW0D 1D6EC 1PRTF 2QGQA 4JBMA 1Y8PB 1KTKA 3NTKA 2FMCA 4G7HC 4GS3A 1ML0D 3CCJA 1ASYA 4TQUS 3S1NH 2EYOA 1SNDA 4EQPA 4DNRB 4JYAQ 3DWQA 4FYDA 2EY5A 2O2LD 2ZM6L 3FRPB 2B2TC 3IFDA 3GTKH 3M4YA 2CW0C 1JR0D 3V05A 1EL0A 1VQHA 1SYGA 4UP8A 2Q8TA 1HZ9A 2IY5B 4F7XA 1I50B 1PVOA 5IGFA 2HHHL 2KECA 5JEAH 1B1ZA 3I4MB 4V0BA 1WD0A 3HOUH 3BZDB 1OXSC 1CFMA 1HH2P 5H1SE 4JI2L 4K5XA 1AN8A 3K5OA 4QL5A 2D62A 3HOYH 4B3TQ 3AU7A 3T4AC 2HHHQ 3A8IE 3GTMB 4P72A 4L6TB 1Q90A 5GAGC 2A73B 1A15A 4A93B 4KV6A 3TQYA 2IX0A 1PTOF 2E2DC 3S16H 2O5JC 4LF7Q 3BG3A 4JI2Q 3J80E 3BDLA 1SNCA 1RTOA 2G9DA 3G71A 2K32A 4DR7L 1BBXC 4L8JA 1S5DD 4DV4L 4GKKL 3D31A 3QR8A 3HKSA 1PRTD 1C0AA 4X65Q 4ZCKA 2RKSA 2K5HA 1WFQA 3I2ZA 2K75A 5M3MB 2PO4A 3MXUA 3HRZC 1ICWA 1GM5A 2VUMG 2E76C 1CT1D 4DR7Q 4KLKA 1ENCA 4MZ9A 1LV9A 2F0UA 3HKZG 4A3KB 4JI3L 4GKKQ 1G2TA 3HKZE 1LT5D 4TKOB 1PRTC 5ISRA 3K5MA 2K7VA 5IGEA 1JB3A 2NZOA 2ALYB 4IPDA 3TP5A 4C56C 1QE6A 1LABA 2TMPA 5F2DA 4NMZA 3TP8A 4C3IB 2ENBA 4A76A 4KKTA 4BY7B 4ODGA 4OWTB 3PIO3 3TS0A 5ELEA 3GTJB 4S3SA 4DK3C 3NQIA 5KIXA 1WTVA 2VNUD 3D6WA 4RHSA 4LUVA 3QB3A 5IP9G 1J5EL 5I4DA 4BBSB 3H0GB 1V8QA 2RHQB 3T56B 1WTQA 1UUPA 4A3JB 1VQJA 1PTOD 1F2ZA 4CDCC 1A6XA 5G3LF 1I4XA 1HA5A 4IUNA 1N36L 2VUMH 1J5EQ 3JAME 1H9SA 3SDZA 1U0LA 4R4QA 1M90C 4Y52H 3K7AB 1FR3A 4U673 3CU7A 2AWNA 3C1EA 4L5RC 1PTOC 1ZEQX 4JI1L 4CKEA 3HG9A 1EOTA 1H9MA 1NBWA 4K14A 3I4MG 1W2BA 3EROA 4QMGA 5ELCA 2Z6KA 1OXTA 1PXUA 4RFBA 2UUBL 4C2MB 2MUYA 4JI4L 3PGZA 3M7NA 4Y7NB 2F0MA 4OO1H 2JN4A 1CHPD 4JI1Q 1VQMA 1HTPA 2QF7A 1YJWA 4UY8C 1Q82C 2SNSA 3SXHA 1EU3A 4DV0L 2UUBQ 2K4KA 3E0EA 2F4IA 5IP9H 1K28A 4JI4Q 1LO5D 1YNJD 3S2HH 4JPBW 1T5XD 2VZAA 2PZUA 2WAQE 4C3HB 1Q1BA 3DMUA 4PMCA 1HJPA 3T51B 4DV2L 1NNXA 3QWNA 1VQAA 2IL8A 1PH6A 4FP5D 2BA1A 2QKIC 3FHWA 2XVSA 3T1HL 4AH6A 5M3MG 4DV0Q 4RKBA 5C3WA 2E2IB 1YNJC 1ZKOA 4GNXA 1XMOL 3IFTA 4A3KG 1XYIA 1Y1WB 1I50H 4LK1C 3SHLA 4YWKA 4HSPA 3RD4A 4OXPA 5G3LD 4DV2Q 3BU2A 2OEOA 2F0JA 3I4MH 3SR1A 2EOTA 1U5KA 4NPSA 2EPBA 2R7FA 1S72A 1MIUA 4DV3Q 3C1FA 1WTHA 3LGJA 5GADC 1SBBB 5C3EG 3BVMA 3HOXG 5FO9B 1VQDA 5EKLA 1BBWA 4HJ5A 2Q8IB 4JBKA 3GTMH 2AQ2B 4FXKC 3NELA 1I3QB 2MPMA 1HTLD 3KUPA 1I4RA 3HZXA 4APVA 1CQVA 3Q24A 1AH9A 3V96A 4O42A 2WB1G 1JT8A 1VQLA 2WB1E 3AYHB 2HQEA 3DEOA 2PNRC 4A3JG 1H9KA 1I4QA 1VQ8A 3KF6A 2EE1A 1V1PA 1EEFD 3S9WA 1CUKA 2CHBD 2A8VA 1JE4A 1B9MA 5M3MH 2ASBA 1P8LA 4LFAL 1NUCA 2Z0SA 3G48A 4A3KH 2F0GA 3GO5A 1QVCA 3ZJYC 3GQBA 2NN6G 1HUMA 3T13A 4N8FA 3J7AV 4R8NA 1J8IA 1S40A 3PF4A 2VW9A 4LFAQ 5C3EH 1X55A 5FLMG 4V190 5CV5A 4FF4A 2I07B 5JPMC 4QF4A 1OTCA 3PUWA 2LXJA 3OTOQ 2BA0A 5KRUA 5FO7B 3GTLB 2EJMA 5FLXE 3GTJH 1LTSD 2DY7A 1KHIA 4KD4A 5HURA 3ER0A 3GV6A 2DJGC 1IKLA 4DR4Q 1PH5A 2F0EA 2QEJC 1HFGA 4QB4A 4IO9A 1YHQA 3GTPB 4BBSH 2NVYB 3RZOB 3UE1A 4A3JH 1STAA 4GOPB 5C4ZA 3RLFA 4ZUJA 2E5LL 1W6JA 4HJAA 3Q0AA 1I94L 1T9HA 3FPPA 1VQBA 3K81C 3M4QA 1Y1WG 3K7AH 1JJCB 1DOLA 3NP8A 4ZLTF 1Q81C 2JA7G 4IUTA 2NN6H 3H09A 4DAYA 4DK1A 3K59A 4KJOA 2WP8J 1JE5A 2AUKA 2L9HA 1I94Q 3G6EA 3OWFA 2AMCB 3K8AA 5EJWA 2JXMB 1RD9D 4C2MH 2XRQD 5FLMH 1C8CA 4OELB 3BS1A 1AE2A 1BCPF 4R9WA 1LT3D 3J7YW 4DGZA 4ZYSA 4DR6Q 1QZGA 2MGSA 3J81c 4E6IA 1UAPA 3R93A 4POGA 3K5NA 5J39A 2EXDA 1EQTA 1K8OA 4JOIC 4R8IA 1G2SA 1YIJA 3OMCA 5KNDA 3D8GA 1B3AA 2QW7A 3CHBD 2TSSA 4BWGB 4DXGA 4Q0FA 3VYUA 4JI6Q 5CV7A 2RCNA 2I5MX 1B70B 2IWHA 4H13C 4O0AA 1SROA 1TWGB 2E2IH 3K7UC 3PIP3 4AIMA 1Y1WH 4RA8A 2JA7H 2CH4A 1B3QA 2K14A 5M5YB 3KJPA 1KAWA 5TSSA 2XTIA 4CJ2C 1I6HB 1QILA 3FDTA 1FJGL 3OHXC 3TS2A 2AKWB 2LFNA 4JV5Q 2B2UC 1RHPA 1Q3LA 3EQLC 4FXGC 1IL2A 1ZYRD 3I7FA 1TU2B 4PZ8A 1SXTA 5IWAQ 2L12A 5DEHA 2MJ8A 4B3RL 5E3FA 5JJKA 2D5DA 3OW7A 1AW7A 1I3QH 4DXFA 1KL9A 1EIYB 5EQ0A 1BCPD 2NZHA 5LMNL 1FJGQ 4OEMB 3I55A 4YHHL 3ULJA 1FNWA 1SN8A 1XPUA 1ZYRC 1EFWA 3VR4A 3PSIA 3JAMi 2NUCA 4KHPQ 1CSQA 1SFOB 1WTOA 4X62L 3NSWA 3NXWA 1DOMA 2EYFA 3K80C 1CTMA 3EFXD 3VR3A 3H15A 1PH4A 5LMNQ 1BCPC 5L37A 1HQRD 3MXGA 4YHHQ 1QNKA 1OO9B 2D9UA 4A3DB 3J81L 5JAVA 3M9BA 1PH3A 2EJFC 5DM73 2A68D 4B9WA 1YBYA 3K5LA 2BCOA 1VQKA 4CDDC 3FP9A 1I4PA 1YNXA 2A6ED 2UXCL 3K0XA 1CKOA 1KNEA 5FOBB 5D3IB 1EQVA 3I56A 2B2VA 4X6AH 4X3UA 4RCNA 5FLXL 4GLXA 1JB7A 4DAMA 2FINB 3DUZA 3Q23A 2LMCB 3H94A 5C0XG 1RIPA 3TBIB 2CVRA 2A68C 4QUCA 4DAPA 1NTGA 4AYBB 1M1KC 1BO0A 4HJ9A 1VQFA 2UXCQ 3GTLH 2A6EC 1GOZA 1YZ6A 2BDOA 5EPJA 5JPNC 5LL6X 1LT4D 5D65A 2K5NA 3Q22A 3BZKA 2Z1CA 3W1BA 4BA2I 5IE8A 4WFN3 4O2DA 3Q8DA 5E7NA 3GP7A 5IOCA 3KYHC 2UUCQ 1QUQA 2NVYH 4FF2A 3RZOH 5C5MA 1GD7A 2OF1A 5KYLA 4K2KA 2F03A 4IFDJ 4TSSA 1VQ7A 1FVIA 2CKZB 1UE1A 5GAEC 3PUXA 1ICFB 4P71A 4JK1C 5BN4A 2VQEL 5IT9E 2CQAA 5I9PA 1GVPA 4XQJA 2XN9C 3FPUB 1JJGA 4JW0A 4BY1G 2R92B 5LMUL 1JMCA 2HD3A 2F0OA 1A0IA 2L15A 3DM3A 2EY2A 2SOBA 5CYUA 2VQEQ 3BDOA 4DF7A 5JVG3 4IUVA 1WCMB 2OWOA 2NVXB 3ICEA 3MFYA 2IPKD 1HR0Q 1UE7A 3MXPA 5C0XH 1YJ9A 1ASZA 4HIKA 3VR5A 1K3BC 1AZPA 1JOOA 2UU9L 1O7LA 2AQ3B 1HZCA 1D1IA 1JQYD 1QJOA 4QIWE 4XT3B 1Y1VB 4JI8L 3M3YH 1IBLL 3J7A5 1VQPA 1MSGA 3OOCA 5EGTA 5I6WA 3I4NB 3S2DB 2B63G 2N78A 3O13A 4X3KA 4LF6Q 1U4MA 3J81j 1CA5A 4NB3A 5EBCA 1B8AA 1HZAA 1VMCA 3J7ZC 3DWAA 3LWEA 1X3QA 1OXUA 1TXYA 2C9OA 4IOAA 1Q46A 3HP3A 2JJQA 1STNA 5A2QE 1PRTB 1A63A 1GHJA 1IBLQ 2Q2IA 5I2YA 1TWGH 4A3DG 1YVCA 1RODA 4JYAL 1SRUA 3J81i 1WTXA 3P1HA 4KK7A 3UE0A 3SK4A 3PO2G 3TREA 1G8ZD 1K83B 5M5YH 2MNAA 5D14A 3M4OH 4M1UB 4DV7L 3BZCA 1X9NA 4J6HA 3E5SA 1I6HH 2MP1A 3NUCA 1UWVA 1E3PA 1EY6A 2KCCA 4K8IA 4M8AA 2B2WC 1E1TA 4BBRB 2F3VA 2HIVA 2ZT9C 4ZUIA 4YIJA 2FMMA 4YCWA 3T16A 1Q1EA 2JEAI 4LFBL 4K8JA 3EVQA 2RA4A 3I3CA 4RGNA 1KNAA 2E2JB 4CDEC 4DV7Q 1LTRD 2M00A 5IGGA 2ZJRA 3NE5B 3TP6A 4IFDI 1YNNC 1PZID 2EQSA 2R7ZB 2PZTA 1B4OA 2H1EA 4LFBQ 1K3RA 4MIUA 5HGQA 2B63H 4B3TL 4NXNQ 1PZKD 2SEBD 4QJFA 2CWAA 4J15A 2PCFB 5JJLA 2F0KA 1JORA 1Q7YC 4DFAA 4LF7L 1PTOB 4IPGA 3BDCA 3F1ZA 2N55A 4A3DH 2R92G 3KF8B 1KXLA 2KHJA 3PO2H 3L0OA 1D8LA 5C4JB 2F0DA 4X65L 4UAIA 1EIFA 4GN5A 3EA6A 2L4NA 4WRDA 4OWXB 4MTNA 3NTIA 1A62A 2PZWA 4PZ6A 5IGBA 1O80A 1FL0A 4UPAA 1Q8IA 2IJ0A 1D2BA 2XWBB 2K5QA 1STYA 3RLOA 1CHQD 2OQKA 3OPOA 1NAPA 1SLJA 2OCEA 2MQHA 2HDMA 1GUGA 4P73A 2XWJB 2VY3A 1L0XB 3BVGA 1Y1VG 5C6AA 1EY4A 5IT9L 3GTOB 3FKIB 2ZTDA 4L5SA 3I4NG 1SNOA 3RZDB 2RF4A 4LFCQ 4A3LG 1N33L 4NP5A 1DM0B 4XQNA 1QB5D 3Q6SA 5DM63 5I2XA 1H95A 1SNPA 3C46A 2XGTA 3CCUA 2RBMA 4A3IB 2ES2A 2F0NA 2R92H 4OO1G 4ZKCB 2Z4HA 2DGYA 4IPHA 2K5WA 3S1MB 1LT6D 4QGUA 1N33Q 2JYOA 4NKLA 5GQOA 1KD1C 1V43A 1I5FA 2GVBA 5IYBG 4PMWA 3S1RB 4HEDA 2PI2E 2F0QA 2KENA 4IALA 4BBRG 1EY7A 4DR1L 4CKBA 1VCIA 2WINB 2BH8A 4WJ4A 1UE5A 1VMPA 4FNFA 4OHJA 1ILPA 4IUQA 1QNUA 3OYYA 2L5TA 2O5IC 2EYLA 3I73A 4XQQA 4ZAIA 5M5WB 4EQ5A 4OIKA 2QA4A 4HIMA 1Y1VH 1XX8A 2G5DA 3R2IA 1MSHA 2EDGA 4KHZA 4KY6A 3W5OA 4DR1Q 3RNUA 1KRTA 5A2QL 5JJIA 4WJ3M 3VA5A 3I4NH 1SYBA 3HEJA 4A3LH 1HA6A 2QDLA 2EYMA 1N8RC 3MEHA 1GHKA 1H9JA 2F0TA 2E2HB 3I90A 5E4XA 4CGYB 4QUFA 2DN8A 1BVSA 3ND8A 3L9AX 1K0RA 2LXKA 2D0PA 3WOFA 1K83H 4A93G 5CGKA 1IZ6A 3E3XA 1FD7D 5IYBH 3VYSA 2LY7A 1SMYD 3U9OA 2EZVA 3ONAB 5EPLA 4BBRH 1L2FA 3AB9A 2YTVA 3LNNA 4IURA 1K8GA 2A74C 4OWWB 3RR5A 4B08A 2UUAL 2E2JH 1TY2A 1WVLA 1JWSD 3CMAA 1SMYC 4DV3L 3STBD 4K5WA 2R7ZH 2LSSA 1EUJA 2BOSA 3FKIG 3MC0B 4HSVA 3NWTA 3G6JB 2K6AA 2UUAQ 4JI0L 2Q2HA 2IHFA 1PTOH 1RDPD 3STBC 4FDBA 2YTXA 3I4LA 4YWMA 4A3BB 4C3IG 5D3DA 4A3IG 1VQ9A 3F2BA 4BY7G 4J1MA 4JI0Q 1Q86C 5C4JH 2WFWA 2ZXOA 1K9MC 4A93H 2BH2A 1PFBA 4LF9L 1BNZA 2DNCA 3CAMA 4ME5A 3PO3B 4BBSG 2GVAA 3H0GG 5ELNA 2JA6B 1ESRA 1LM0A 5JVH3 1A3UA 2GA4B 2SNMA 4YY3L 1KAAA 5LL6S 3HOWB 1JICA 4ZKBB 4LF9Q 2O4XA 1MJEA 1O7ZA 5DNFA 1RL2A 5DLQE 2HUGA 1X3PA 2VB2X 1DGSA 3CRKC 4RMFA 1PA6A 4MNOA 1NMFA 1F9RA 2XNAC 1EWHA 1LUZA 2J7ZA 3CRLC 3GTOH 3FKIH 3M4PA 3UDGA 3GTQB 3V2TA 2ZXRA 3OTOL 3RZDH 1TY0A 3AQQA 5M9OA 4YY3Q 4PV1C 2YU9B 3AMUA 3KJOA 4HN7A 1QOHA 4FO2A 1G6PA 3J81E 3A5UA 5CV9A 3MWYW 3NTHA 1ESFA 2Z6KC 1L1OA 2NB0A 4DR4L 4RGMA 4C3IH 4A3IH 2K52A 3AEVA 5ELBA 1UNSA 2PQAB 2Q2UA 2Q2TA 4BY7H 3S1MH 1LLRD 5IODA 1BOSA 2A5HA 3EJIA 3URYA 5K5PA 4IUUA 5IGDA 3KOJA 4DV1L 1Z6HA 2K04A 2OXPA 1F9QA 3H0GH 4YCVA 4Z9CB 3KBGA 4C3HG 3NBHB 4JI5Q 3S14B 4PMBA 2VQFQ 1LTLA 4X3SA 2N3SA 2F52A 3CCMA 3GTGB 5M5WH 1E2WA 4DV1Q 2EJGC 4GOPA 2AUJD 4KHVA 4A3MB 3P20A 1GJXA 4LNQA 1NSNS 4GNXC 1BCPB 1L0YB 3CPWA 4DR6L 2KHSA 3RN2A 2LKVA 1IBKL 2QCPX 1CI3M 1Y69U 4ME3A 1MJCA 4FVMA 4JG2A 4L5TA 3KK7A 3VYTA 3DEPA 3R8BA 2I5HA 4A3BG 1FYCA 5E1FA 4Y7NH 1BBUA 2OQ0A 1O7IA 1ET6A 1RTNA 2ZXPA 1A3TA 1IBKQ 5IYCH 4JI6L 2F0IA 4NDXA 2JP1A 3QO2A 5CC4A 3FMCA 2Z8LA 1BXTA 3D3RA 3TEHB 3PO3G 2B8GA 5J1ZA 1IXRA 1PH9A 2JA6G 4C3HH 3J7AF 1G6ZA 1NE3A 1GUNA 2IX3A 4F88A 3A8JE 3GD7A 2ZTEA 1Y14B 4LJZC 3CCEA 2NN6I 2JA8B 3S15B 4LMQD 1SNMA 4IJHA 1CSPA 3MFGA 3A8KE 4JV5L 1IBMQ 2SDFA 1D5ZC 3KDFB 5KNBA 1OXXK 1NR2A 5IWAL 1HQMC 3CPFA 3F2UA 5EBDA 2F0VA 3ULLA 2NZ1D 2JQOA 2EY1A 3H3VC 1EIHA 4I65A 4DNIA 4A3BH 2J0TD 3PUYA 1VS0A 4R4TA 3WWVA 5FO8B 4RH6A 1J6QA 4KHPL 2K1BA 2MO1A 3E0JA 2DNEA 3I72A 1F2LA 1VQGA 1BKBA 3VYRA 4B3SL 1MI2A 2JA9A 4RAUC 1MD2D 1AP0A 4DNTB 3L7ZC 5FJ8G 1D5XC 3MXNB 3PO3H 1PH2A 2JA6H 4A3EB 1C4QA 3LX0A 1S5FD 1OXVA 2K5VA 3NEMA 2D0OA 3X3NA 5JJZA 3HOWH 4KKSA 4DV6L 3PF5A 1SJED 1HUNA 4B3SQ 4MN3A 4HIOA 4P75A 1SE2A 3A5ZB 1XPRA 2F0WA 1PDQA 1QCBD
chains in the Genus database with same CATH topology
2HIVA 3HOXH 4R4QA 4DK6C 1KQSA 1M90C 4YCWA 3W1GA 1Q1EA 2JEAI 3GTQH 4LFBL 4Y52H 1GO3E 2AWNA 4L5RC 2B29A 4JI1L 2YU9H 1NY4A 3I4MG 3CQZH 1NBWA 4DV6Q 1W2BA 4GN3B 4DV7Q 3M85A 2ZJRA 2A19A 5IP7G 5ELOA 1PFSA 4IFDI 1X54A 1N32L 2Z6KA 1HNZQ 1OXTA 3HOZG 1IYJB 2EQSA 1PYSB 2FXQA 2UUBL 1UE6A 3CC2A 4JI4L 3AFQA 3PGZA 4YCUA 5BR8L 3M7NA 2NVQH 4LFBQ 2OTLA 1K3RA 1YI2A 2UUCL 5HGQA 2B63H 4B3TL 4NXNQ 2I5LX 2R93G 1P16A 4QJFA 4JI1Q 2CWAA 3CCVA 4J15A 5JJLA 1VQMA 5HY6A 1Q7YC 1N32Q 3PUVA 1YJWA 4UY8C 1Q82C 5IYDG 3T1YQ 4LF7L 5AJ3L 2R7DA 4IOCA 1KIXA 4DAYB 1HZBA 4DV0L 2E2HH 2UUBQ 2K4KA 3E0EA 5FJ8H 4IPGA 5IP9H 4JI4Q 3F1ZA 4A3CG 5BR8Q 3S2HH 4A3DH 3GTPH 3KFUA 2VZAA 4IPCA 1PH7A 1E24A 2WAQE 3KF8B 1L0WA 2R92G 1Q1BA 3S14H 1KXLA 1HJPA 2KHJA 4DV2L 3PO2H 3L0OA 4A75A 1D8LA 1VQAA 5GROA 2OTJA 4X65L 1EIFA 4GN5A 2A1AA 3EBEA 4DKAC 4OWXB 3ULPA 4MTNA 1PH6A 2E5LQ 3GTGH 1A62A 2BA1A 3B6YA 3FHWA 4PZ6A 4DR3L 5AJ3Q 3H3VI 3T1HL 4AH6A 1FL0A 2R6GA 4UPAA 5M3MG 4DV0Q 4DV5L 2JA8G 1IBML 1HR0L 5C4XG 1AE3A 4GNXA 1XMOL 4X64L 4A3KG 1I50H 3U4ZA 4A4IA 4YWKA 3RLOA 1N9WA 4OXPA 5C44G 2OQKA 3IRBA 4DV2Q 2HIXA 3BU2A 3J80i 1SLJA 1E1OA 1YEZA 1KRSA 2MQHA 2OCEA 3CW2C 3HOWG 2ID0A 3I4MH 2YTYA 4P73A 5IP7H 4NPSA 1U5KA 2ATWA 4DR3Q 1WYDA 2R7FA 2VY3A 2VL6A 1S72A 1MIUA 1KC8C 4DV3Q 1Y1VG 3MEFA 4DV5Q 3LGJA 5GADC 3HOZH 1WJJA 5C3EG 4PZ7A 3HOXG 3CCLA 1VQDA 4NXML 1CKNB 1BBWA 4X64Q 2ZTDA 2CQOA 4L5SA 1X3GA 2UXBL 4R4CA 4LF6L 3I4NG 5FLXc 4UP7A 4JBWA 4HJ5A 2RF4A 2R93H 4LFCQ 4JBKA 4A3LG 3GTMH 2CFMA 1N33L 3PUZA 4EX5A 3NELA 3KDFA 2EIFA 4R4IA 4APVA 1H95A 5IYDH 3CP0A 1AH9A 2XGTA 3CCUA 1L1OC 4A3CH 4NXMQ 3DLLA 3U58A 2ES2A 2UXBQ 2WB1G 1JT8A 2N49A 2R92H 1VQLA 4OO1G 2WB1E 3AYHB 4XIGS 4A3EG 1TWHH 2DGYA 2GN5A 4IPHA 4HJ7A 4A3JG 1VQ8A 4QGUA 3OW2A 1N33Q 3KF6A 5GQOA 1KD1C 5JEAJ 1V43A 1CUKA 1I5FA 4QQBX 2GVBA 1A8VA 2A8VA 5IYBG 4PMWA 2ZTCA 3GDEA 1G291 1C7YA 5M3MH 2JA8H 2PI2E 2ASBA 4XTCS 1P8LA 2KENA 4BBRG 5C4XH 2Z0SA 3G48A 4JCVE 4DR1L 4LFAL 1VCIA 1TWAH 4A3KH 2BH8A 3GO5A 1QVCA 3ZJYC 4WJ4A 1UEBA 1UE5A 5C44H 1VQCA 2KCMA 4K0KL 2NN6G 3F2DA 1EOVA 4QY7A 1EYGA 1C9OA 2IT1A 3EN2A 3OYYA 4DPGA 2HT1A 5C0XI 5LMNW 2HQLA 1QVFA 4EQ5A 4TVAB 2QA4A 4HIMA 1Y1VH 1S40A 2UXDL 3PF4A 2VW9A 4GOPC 4LFAQ 5C3EH 4KHZA 3W5OA 4DR1Q 1X55A 5FLMG 3RNUA 1KRTA 4A3MG 5JJIA 2K50A 4YWLA 4WJ3M 2JA5G 1OTCA 3I4NH 4NXNL 1WOCA 2PI2A 2LXJA 3PUWA 4AYBG 3JC66 3OTOQ 2BA0A 2CWPA 1PH1A 4K0KQ 4A3LH 4AYBE 4B3RQ 3GTJH 1N8RC 3UDXA 1XJVA 1Q12A 2C35B 4KI0A 1VQ4A 1KHIA 4DUYL 3A0JA 1QZHA 3T1YL 5K36G 2UXDQ 3ER0A 3RLNA 3EIVA 4DR4Q 1PH5A 4LUZA 4IO9A 3HFZB 1YHQA 4BBSH 2IHEA 1BVSA 1PH8A 5C0XJ 4DR5L 3UE1A 4X66L 4A3EH 4A3JH 1X3EA 3D0FA 1K0RA 2LXKA 3CMEA 4GOPB 3H3VH 2D0PA 1K83H 1SFOH 4POFA 4A93G 1IZ6A 3RLFA 1VQIA 4X62Q 2E5LL 5IYBH 4DUYQ 4C3JH 1HNXL 4HJAA 1I94L 1E22A 1NMGA 1T9HA 3E9HA 5M3FG 1JJ2A 4AQYL 1W3SA 1VQBA 3K81C 4JC0A 3U4VA 4BBRH 1L2FA 1X56A 4ALPA 3M4QA 1J5EQ 2YTVA 3K7AH 1JJCB 2KBNA 1YITA 1Y1WG 4DR5Q 1Q81C 3RR5A 4X66Q 1K8GA 4OWWB 1K8AC 2JA7G 4OONA 2UUAL 2E2JH 2ZM6Q 2MFIA 2YYZA 2PMZE 3UDIA 2WP8J 3VDYA 2ZJPA 3F8TA 1JE5A 3UDFA 1HNXQ 1QUQB 1I94Q 3G6EA 3CMAA 4DV3L 2AMCB 3K8AA 1WCMG 4P74A 3STBD 4AQYQ 1CKMA 2ZJQA 2R7ZH 4A3GG 4C2MH 5FLMH 1V1QA 4A3MH 2V1CC 2LSSA 1EUJA 1AE2A 3FKIG 3PIOA 2JA5H 4BA1I 4LF5Q 4IFDG 4DR6Q 4LFCL 4UP9A 3PV0A 1QZGA 2UUAQ 3I4OA 4JI0L 2Q2HA 3J81c 2IX1A 2IHFA 4GKJL 2F3IA 4POGA 2EXDA 2AHOB 4JOIC 3STBC 4LUOA 4FDBA 1HR0W 2YTXA 4YWMA 1YIJA 1XPOA 3CD6A 2B3GA 4A3IG 1VQ9A 3TRZA 3A74A 2Y0SG 1EQQA 1SE8A 3S1QH 2Y0SE 3F2BA 4RG1A 4BY7G 4JI7L 3PCOB 1X3FA 1Q86C 4JI0Q 4GLVB 5C4JH 2WFWA 1K9MC 4A93H 4GKJQ 1CKNA 1G51A 4IJLA 4LWCA 2I0QA 1XMQL 2BH2A 2E8GA 4JI6Q 4LF9L 2RCNA 2I5MX 1B70B 3HOVG 3CAMA 4OX9L 3SGIA 1VQ6A 3S24A 5M3FH 4O0AA 1Q8KA 1FGUA 1SROA 2JE6I 2E2IH 4JBJA 3K7UC 4BBSG 1LYLA 2GVAA 3H0GG 5ELNA 1EQRA 1LM0A 4AIMA 4DV4Q 1Y1WH 3S17H 2JA7H 5LMUQ 2MO0A 1D7QA 4JI7Q 2NVTH 2K14A 1SR3A 4YY3L 3NENA 3KJPA 1KAWA 2XTIA 1XMQQ 1PV4A 4LF9Q 1S3OA 2F4VL 1MJEA 1RL2A 3CC7A 2RHSB 4OX9Q 1TWCH 3S15H 5DLQE 1FJGL 1WCMH 1PHJA 2NVXH 3CXCA 1DGSA 1PA6A 4RMFA 3TS2A 4A3GH 4MNOA 2AKWB 4JV5Q 1NMFA 3CCRA 1LUZA 3GTOH 1IL2A 3FKIH 3M4PA 3UDGA 1QVGA 4JI3Q 3I7FA 4B3ML 3OTOL 3RZDH 4PZ8A 1YJNA 2H5XA 3AQQA 5M5XH 4YY3Q 5IWAQ 2UU9Q 5JEAG 4HIDA 1VQOA 4B3RL 2CCZA 1MKHA 3U50C 3KJOA 5JJKA 3ERSX 4HJ8A 2F4VQ 1I3QH 3HOUG 1KL9A 4LF4L 4LW1A 1R9TH 1EIYB 3A5UA 4LF5L 2PNHA 1G6PA 4H02A 2NZHA 5LMNL 2Z6KC 4JI8Q 1FJGQ 2R7ZG 3I55A 4YHHL 1L1OA 3ULJA 4DR4L 3BJUA 4C3IH 4A3IH 1SN8A 4GLAC 2K52A 1XPUA 3HOYG 3AEVA 3S2DH 4BY1H 2PQAB 1EFWA 2Q2UA 4B3MQ 3PSIA 2Q2TA 1HNWL 4BY7H 1XTDA 3JAMi 4KHPQ 3S1MH 1CSQA 5EAYA 5IT9c 5IY0A 4X62L 4LF4Q 3K80C 3J80c 3H15A 1PH4A 4JBMA 2QGQA 1E7ZA 2VS1A 3KOJA 5LMNQ 1X6OA 4DV1L 4GS3A 3HOVH 3CCJA 4YHHQ 4LF8L 1Z47A 1K73C 1ASYA 4TQUS 3S1NH 1GKHA 3H0GH 4YCVA 3M9BA 4JYAQ 1X65A 1N34L 1PH3A 1HNWQ 3NBHB 3CCSA 4JI5Q 1YBYA 1VQKA 2VQFQ 3FP9A 2ZM6L 4R4OA 1LTLA 1YNXA 2UXCL 3K0XA 3CF5A 1CKOA 3I56A 2N3SA 3GTKH 2F52A 3CCMA 4X6AH 5M5WH 4DV1Q 4GOPA 1N36Q 4LF8Q 4GLXA 1YHAA 1JB7A 1VQHA 4DAMA 4UP8A 1HZ9A 2IY5B 5C0XG 4LNQA 1RIPA 4GNXC 4PG3A 1N34Q 1PVOA 3KLWA 2YV5A 3CPWA 1M1KC 1NTGA 4DR6L 2HHHL 4HJ9A 3RN2A 1VQFA 2UXCQ 3GTLH 1YZ6A 1IBKL 3HOUH 2K5NA 3F2CA 3BZKA 2QEXA 1NJIC 4ME3A 1B7YB 1MJCA 3W1BA 4BA2I 1OXSC 4JG2A 4L5TA 1HH2P 5IE8A 5H1SE 3PIPA 4JI2L 4O2DA 3Q8DA 2I5HA 5E7NA 4A3BG 1Z9FA 4QL5A 1WI5A 2D62A 4Y7NH 2WAQG 3HOYH 3KYHC 1BBUA 2OQ0A 2AWOA 4L5QA 2UUCQ 4B3TQ 1QUQA 2NVYH 3RZOH 2HHHQ 4A3FG 1TWFH 1O7IA 1GD7A 4IFDJ 4P72A 1VQ7A 1FVIA 2CKZB 1UE1A 5GAGC 5GAEC 1XNQL 3PUXA 4GNXB 5IYCH 4P71A 1IBKQ 3TQYA 2IX0A 4JI6L 4OO1I 2VQEL 3S16H 2KCTA 4LF7Q 4GN4B 1GVPA 4JI2Q 3G71A 3TEHB 4BXXG 1JJGA 3PO3G 4DR7L 2DUDA 4DV4L 4BY1G 4GKKL 3D31A 1IXRA 1PH9A 2JA6G 4C3HH 5LMUL 1JMCA 3HKSA 1NE3A 3CC4A 1C0AA 4X65Q 1XNQQ 1A0IA 2L15A 3DM3A 4DR2L 2K5HA 3GD7A 1WFQA 1EWIA 2ZTEA 3JAMc 1Y14B 2VQEQ 3I2ZA 5J3BA 3CCEA 2K75A 1VQEA 2NN6I 3T1HQ 4IJHA 1GM5A 1CSPA 5GAHC 2OWOA 2VUMG 3ICEA 4DR7Q 3CCQA 1HR0Q 1IBMQ 4JV5L 4KLKA 1UE7A 4MZ9A 1YJ9A 3HKZG 4DUZL 1XMOQ 1ASZA 3KDFB 4JI3L 4HIKA 1VQNA 4GKKQ 1OXXK 3RN5A 3HKZE 2UU9L 5IWAL 1HZCA 3CPFA 4DR2Q 2N8NA 2NZOA 2ALYB 3ULLA 4QIWE 1XNRL 4R1JA 4IPDA 4JOIA 3G4SA 4JI8L 2JQOA 2JK8A 3M3YH 3KF6B 4DNIA 3AFPA 1VQPA 1IBLL 3PUYA 3J7A5 4A3BH 1VS0A 4R4TA 3WWVA 4DUZQ 4A76A 2B63G 2N78A 4LF6Q 4A3FH 1J6QA 3J81j 4KHPL 4NB3A 4OWTB 2MO1A 3TS0A 1B8AA 1HZAA 4DK3C 3J7ZC 1V9PA 1VQGA 1OXUA 1TXYA 1XNRQ 4IOAA 1Q46A 1BKBA 4B3SL 2JJQA 2JA9A 1SMXA 2VNUD 1A63A 1IBLQ 3L7ZC 4LUVA 5IP9G 5FJ8G 2Q2IA 1J5EL 1TWGH 3MXNB 3PO3H 4BXXH 4A3DG 2KHIA 1PH2A 1YVCA 3L2PA 2RHQB 1SRUA 3J81i 2JA6H 4JYAL 4JI5L 3UE0A 2VQFL 1VQ5A 1OXVA 2K5VA 1VQJA 3NEMA 2D0OA 1PYBA 3TREA 3PO2G 5M5YH 1YHBA 1L1OB 2MNAA 4DV6L 3HOWH 3M4OH 5IYCG 4DV7L 3BZCA 3PF5A 1X9NA 1I6HH 3S1RH 2PQAA 4B3SQ 1UWVA 4HIOA 1E3PA 3E9IA 1HNZL 2JEBI 1N36L 4P75A 2VUMH 3A5ZB 1XPRA 1E1TA 1U0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIV A;  3HOX H;  4R4Q A;  4DK6 C;  1KQS A;  1M90 C;  4YCW A;  3W1G A;  1Q1E A;  2JEA I;  3GTQ H;  4LFB L;  4Y52 H;  1GO3 E;  2AWN A;  4L5R C;  2B29 A;  4JI1 L;  2YU9 H;  1NY4 A;  3I4M G;  3CQZ H;  1NBW A;  4DV6 Q;  1W2B A;  4GN3 B;  4DV7 Q;  3M85 A;  2ZJR A;  2A19 A;  5IP7 G;  5ELO A;  1PFS A;  4IFD I;  1X54 A;  1N32 L;  2Z6K A;  1HNZ Q;  1OXT A;  3HOZ G;  1IYJ B;  2EQS A;  1PYS B;  2FXQ A;  2UUB L;  1UE6 A;  3CC2 A;  4JI4 L;  3AFQ A;  3PGZ A;  4YCU A;  5BR8 L;  3M7N A;  2NVQ H;  4LFB Q;  2OTL A;  1K3R A;  1YI2 A;  2UUC L;  5HGQ A;  2B63 H;  4B3T L;  4NXN Q;  2I5L X;  2R93 G;  1P16 A;  4QJF A;  4JI1 Q;  2CWA A;  3CCV A;  4J15 A;  5JJL A;  1VQM A;  5HY6 A;  1Q7Y C;  1N32 Q;  3PUV A;  1YJW A;  4UY8 C;  1Q82 C;  5IYD G;  3T1Y Q;  4LF7 L;  5AJ3 L;  2R7D A;  4IOC A;  1KIX A;  4DAY B;  1HZB A;  4DV0 L;  2E2H H;  2UUB Q;  2K4K A;  3E0E A;  5FJ8 H;  4IPG A;  5IP9 H;  4JI4 Q;  3F1Z A;  4A3C G;  5BR8 Q;  3S2H H;  4A3D H;  3GTP H;  3KFU A;  2VZA A;  4IPC A;  1PH7 A;  1E24 A;  2WAQ E;  3KF8 B;  1L0W A;  2R92 G;  1Q1B A;  3S14 H;  1KXL A;  1HJP A;  2KHJ A;  4DV2 L;  3PO2 H;  3L0O A;  4A75 A;  1D8L A;  1VQA A;  5GRO A;  2OTJ A;  4X65 L;  1EIF A;  4GN5 A;  2A1A A;  3EBE A;  4DKA C;  4OWX B;  3ULP A;  4MTN A;  1PH6 A;  2E5L Q;  3GTG H;  1A62 A;  2BA1 A;  3B6Y A;  3FHW A;  4PZ6 A;  4DR3 L;  5AJ3 Q;  3H3V I;  3T1H L;  4AH6 A;  1FL0 A;  2R6G A;  4UPA A;  5M3M G;  4DV0 Q;  4DV5 L;  2JA8 G;  1IBM L;  1HR0 L;  5C4X G;  1AE3 A;  4GNX A;  1XMO L;  4X64 L;  4A3K G;  1I50 H;  3U4Z A;  4A4I A;  4YWK A;  3RLO A;  1N9W A;  4OXP A;  5C44 G;  2OQK A;  3IRB A;  4DV2 Q;  2HIX A;  3BU2 A;  3J80 i;  1SLJ A;  1E1O A;  1YEZ A;  1KRS A;  2MQH A;  2OCE A;  3CW2 C;  3HOW G;  2ID0 A;  3I4M H;  2YTY A;  4P73 A;  5IP7 H;  4NPS A;  1U5K A;  2ATW A;  4DR3 Q;  1WYD A;  2R7F A;  2VY3 A;  2VL6 A;  1S72 A;  1MIU A;  1KC8 C;  4DV3 Q;  1Y1V G;  3MEF A;  4DV5 Q;  3LGJ A;  5GAD C;  3HOZ H;  1WJJ A;  5C3E G;  4PZ7 A;  3HOX G;  3CCL A;  1VQD A;  4NXM L;  1CKN B;  1BBW A;  4X64 Q;  2ZTD A;  2CQO A;  4L5S A;  1X3G A;  2UXB L;  4R4C A;  4LF6 L;  3I4N G;  5FLX c;  4UP7 A;  4JBW A;  4HJ5 A;  2RF4 A;  2R93 H;  4LFC Q;  4JBK A;  4A3L G;  3GTM H;  2CFM A;  1N33 L;  3PUZ A;  4EX5 A;  3NEL A;  3KDF A;  2EIF A;  4R4I A;  4APV A;  1H95 A;  5IYD H;  3CP0 A;  1AH9 A;  2XGT A;  3CCU A;  1L1O C;  4A3C H;  4NXM Q;  3DLL A;  3U58 A;  2ES2 A;  2UXB Q;  2WB1 G;  1JT8 A;  2N49 A;  2R92 H;  1VQL A;  4OO1 G;  2WB1 E;  3AYH B;  4XIG S;  4A3E G;  1TWH H;  2DGY A;  2GN5 A;  4IPH A;  4HJ7 A;  4A3J G;  1VQ8 A;  4QGU A;  3OW2 A;  1N33 Q;  3KF6 A;  5GQO A;  1KD1 C;  5JEA J;  1V43 A;  1CUK A;  1I5F A;  4QQB X;  2GVB A;  1A8V A;  2A8V A;  5IYB G;  4PMW A;  2ZTC A;  3GDE A;  1G29 1;  1C7Y A;  5M3M H;  2JA8 H;  2PI2 E;  2ASB A;  4XTC S;  1P8L A;  2KEN A;  4BBR G;  5C4X H;  2Z0S A;  3G48 A;  4JCV E;  4DR1 L;  4LFA L;  1VCI A;  1TWA H;  4A3K H;  2BH8 A;  3GO5 A;  1QVC A;  3ZJY C;  4WJ4 A;  1UEB A;  1UE5 A;  5C44 H;  1VQC A;  2KCM A;  4K0K L;  2NN6 G;  3F2D A;  1EOV A;  4QY7 A;  1EYG A;  1C9O A;  2IT1 A;  3EN2 A;  3OYY A;  4DPG A;  2HT1 A;  5C0X I;  5LMN W;  2HQL A;  1QVF A;  4EQ5 A;  4TVA B;  2QA4 A;  4HIM A;  1Y1V H;  1S40 A;  2UXD L;  3PF4 A;  2VW9 A;  4GOP C;  4LFA Q;  5C3E H;  4KHZ A;  3W5O A;  4DR1 Q;  1X55 A;  5FLM G;  3RNU A;  1KRT A;  4A3M G;  5JJI A;  2K50 A;  4YWL A;  4WJ3 M;  2JA5 G;  1OTC A;  3I4N H;  4NXN L;  1WOC A;  2PI2 A;  2LXJ A;  3PUW A;  4AYB G;  3JC6 6;  3OTO Q;  2BA0 A;  2CWP A;  1PH1 A;  4K0K Q;  4A3L H;  4AYB E;  4B3R Q;  3GTJ H;  1N8R C;  3UDX A;  1XJV A;  1Q12 A;  2C35 B;  4KI0 A;  1VQ4 A;  1KHI A;  4DUY L;  3A0J A;  1QZH A;  3T1Y L;  5K36 G;  2UXD Q;  3ER0 A;  3RLN A;  3EIV A;  4DR4 Q;  1PH5 A;  4LUZ A;  4IO9 A;  3HFZ B;  1YHQ A;  4BBS H;  2IHE A;  1BVS A;  1PH8 A;  5C0X J;  4DR5 L;  3UE1 A;  4X66 L;  4A3E H;  4A3J H;  1X3E A;  3D0F A;  1K0R A;  2LXK A;  3CME A;  4GOP B;  3H3V H;  2D0P A;  1K83 H;  1SFO H;  4POF A;  4A93 G;  1IZ6 A;  3RLF A;  1VQI A;  4X62 Q;  2E5L L;  5IYB H;  4DUY Q;  4C3J H;  1HNX L;  4HJA A;  1I94 L;  1E22 A;  1NMG A;  1T9H A;  3E9H A;  5M3F G;  1JJ2 A;  4AQY L;  1W3S A;  1VQB A;  3K81 C;  4JC0 A;  3U4V A;  4BBR H;  1L2F A;  1X56 A;  4ALP A;  3M4Q A;  1J5E Q;  2YTV A;  3K7A H;  1JJC B;  2KBN A;  1YIT A;  1Y1W G;  4DR5 Q;  1Q81 C;  3RR5 A;  4X66 Q;  1K8G A;  4OWW B;  1K8A C;  2JA7 G;  4OON A;  2UUA L;  2E2J H;  2ZM6 Q;  2MFI A;  2YYZ A;  2PMZ E;  3UDI A;  2WP8 J;  3VDY A;  2ZJP A;  3F8T A;  1JE5 A;  3UDF A;  1HNX Q;  1QUQ B;  1I94 Q;  3G6E A;  3CMA A;  4DV3 L;  2AMC B;  3K8A A;  1WCM G;  4P74 A;  3STB D;  4AQY Q;  1CKM A;  2ZJQ A;  2R7Z H;  4A3G G;  4C2M H;  5FLM H;  1V1Q A;  4A3M H;  2V1C C;  2LSS A;  1EUJ A;  1AE2 A;  3FKI G;  3PIO A;  2JA5 H;  4BA1 I;  4LF5 Q;  4IFD G;  4DR6 Q;  4LFC L;  4UP9 A;  3PV0 A;  1QZG A;  2UUA Q;  3I4O A;  4JI0 L;  2Q2H A;  3J81 c;  2IX1 A;  2IHF A;  4GKJ L;  2F3I A;  4POG A;  2EXD A;  2AHO B;  4JOI C;  3STB C;  4LUO A;  4FDB A;  1HR0 W;  2YTX A;  4YWM A;  1YIJ A;  1XPO A;  3CD6 A;  2B3G A;  4A3I G;  1VQ9 A;  3TRZ A;  3A74 A;  2Y0S G;  1EQQ A;  1SE8 A;  3S1Q H;  2Y0S E;  3F2B A;  4RG1 A;  4BY7 G;  4JI7 L;  3PCO B;  1X3F A;  1Q86 C;  4JI0 Q;  4GLV B;  5C4J H;  2WFW A;  1K9M C;  4A93 H;  4GKJ Q;  1CKN A;  1G51 A;  4IJL A;  4LWC A;  2I0Q A;  1XMQ L;  2BH2 A;  2E8G A;  4JI6 Q;  4LF9 L;  2RCN A;  2I5M X;  1B70 B;  3HOV G;  3CAM A;  4OX9 L;  3SGI A;  1VQ6 A;  3S24 A;  5M3F H;  4O0A A;  1Q8K A;  1FGU A;  1SRO A;  2JE6 I;  2E2I H;  4JBJ A;  3K7U C;  4BBS G;  1LYL A;  2GVA A;  3H0G G;  5ELN A;  1EQR A;  1LM0 A;  4AIM A;  4DV4 Q;  1Y1W H;  3S17 H;  2JA7 H;  5LMU Q;  2MO0 A;  1D7Q A;  4JI7 Q;  2NVT H;  2K14 A;  1SR3 A;  4YY3 L;  3NEN A;  3KJP A;  1KAW A;  2XTI A;  1XMQ Q;  1PV4 A;  4LF9 Q;  1S3O A;  2F4V L;  1MJE A;  1RL2 A;  3CC7 A;  2RHS B;  4OX9 Q;  1TWC H;  3S15 H;  5DLQ E;  1FJG L;  1WCM H;  1PHJ A;  2NVX H;  3CXC A;  1DGS A;  1PA6 A;  4RMF A;  3TS2 A;  4A3G H;  4MNO A;  2AKW B;  4JV5 Q;  1NMF A;  3CCR A;  1LUZ A;  3GTO H;  1IL2 A;  3FKI H;  3M4P A;  3UDG A;  1QVG A;  4JI3 Q;  3I7F A;  4B3M L;  3OTO L;  3RZD H;  4PZ8 A;  1YJN A;  2H5X A;  3AQQ A;  5M5X H;  4YY3 Q;  5IWA Q;  2UU9 Q;  5JEA G;  4HID A;  1VQO A;  4B3R L;  2CCZ A;  1MKH A;  3U50 C;  3KJO A;  5JJK A;  3ERS X;  4HJ8 A;  2F4V Q;  1I3Q H;  3HOU G;  1KL9 A;  4LF4 L;  4LW1 A;  1R9T H;  1EIY B;  3A5U A;  4LF5 L;  2PNH A;  1G6P A;  4H02 A;  2NZH A;  5LMN L;  2Z6K C;  4JI8 Q;  1FJG Q;  2R7Z G;  3I55 A;  4YHH L;  1L1O A;  3ULJ A;  4DR4 L;  3BJU A;  4C3I H;  4A3I H;  1SN8 A;  4GLA C;  2K52 A;  1XPU A;  3HOY G;  3AEV A;  3S2D H;  4BY1 H;  2PQA B;  1EFW A;  2Q2U A;  4B3M Q;  3PSI A;  2Q2T A;  1HNW L;  4BY7 H;  1XTD A;  3JAM i;  4KHP Q;  3S1M H;  1CSQ A;  5EAY A;  5IT9 c;  5IY0 A;  4X62 L;  4LF4 Q;  3K80 C;  3J80 c;  3H15 A;  1PH4 A;  4JBM A;  2QGQ A;  1E7Z A;  2VS1 A;  3KOJ A;  5LMN Q;  1X6O A;  4DV1 L;  4GS3 A;  3HOV H;  3CCJ A;  4YHH Q;  4LF8 L;  1Z47 A;  1K73 C;  1ASY A;  4TQU S;  3S1N H;  1GKH A;  3H0G H;  4YCV A;  3M9B A;  4JYA Q;  1X65 A;  1N34 L;  1PH3 A;  1HNW Q;  3NBH B;  3CCS A;  4JI5 Q;  1YBY A;  1VQK A;  2VQF Q;  3FP9 A;  2ZM6 L;  4R4O A;  1LTL A;  1YNX A;  2UXC L;  3K0X A;  3CF5 A;  1CKO A;  3I56 A;  2N3S A;  3GTK H;  2F52 A;  3CCM A;  4X6A H;  5M5W H;  4DV1 Q;  4GOP A;  1N36 Q;  4LF8 Q;  4GLX A;  1YHA A;  1JB7 A;  1VQH A;  4DAM A;  4UP8 A;  1HZ9 A;  2IY5 B;  5C0X G;  4LNQ A;  1RIP A;  4GNX C;  4PG3 A;  1N34 Q;  1PVO A;  3KLW A;  2YV5 A;  3CPW A;  1M1K C;  1NTG A;  4DR6 L;  2HHH L;  4HJ9 A;  3RN2 A;  1VQF A;  2UXC Q;  3GTL H;  1YZ6 A;  1IBK L;  3HOU H;  2K5N A;  3F2C A;  3BZK A;  2QEX A;  1NJI C;  4ME3 A;  1B7Y B;  1MJC A;  3W1B A;  4BA2 I;  1OXS C;  4JG2 A;  4L5T A;  1HH2 P;  5IE8 A;  5H1S E;  3PIP A;  4JI2 L;  4O2D A;  3Q8D A;  2I5H A;  5E7N A;  4A3B G;  1Z9F A;  4QL5 A;  1WI5 A;  2D62 A;  4Y7N H;  2WAQ G;  3HOY H;  3KYH C;  1BBU A;  2OQ0 A;  2AWO A;  4L5Q A;  2UUC Q;  4B3T Q;  1QUQ A;  2NVY H;  3RZO H;  2HHH Q;  4A3F G;  1TWF H;  1O7I A;  1GD7 A;  4IFD J;  4P72 A;  1VQ7 A;  1FVI A;  2CKZ B;  1UE1 A;  5GAG C;  5GAE C;  1XNQ L;  3PUX A;  4GNX B;  5IYC H;  4P71 A;  1IBK Q;  3TQY A;  2IX0 A;  4JI6 L;  4OO1 I;  2VQE L;  3S16 H;  2KCT A;  4LF7 Q;  4GN4 B;  1GVP A;  4JI2 Q;  3G71 A;  3TEH B;  4BXX G;  1JJG A;  3PO3 G;  4DR7 L;  2DUD A;  4DV4 L;  4BY1 G;  4GKK L;  3D31 A;  1IXR A;  1PH9 A;  2JA6 G;  4C3H H;  5LMU L;  1JMC A;  3HKS A;  1NE3 A;  3CC4 A;  1C0A A;  4X65 Q;  1XNQ Q;  1A0I A;  2L15 A;  3DM3 A;  4DR2 L;  2K5H A;  3GD7 A;  1WFQ A;  1EWI A;  2ZTE A;  3JAM c;  1Y14 B;  2VQE Q;  3I2Z A;  5J3B A;  3CCE A;  2K75 A;  1VQE A;  2NN6 I;  3T1H Q;  4IJH A;  1GM5 A;  1CSP A;  5GAH C;  2OWO A;  2VUM G;  3ICE A;  4DR7 Q;  3CCQ A;  1HR0 Q;  1IBM Q;  4JV5 L;  4KLK A;  1UE7 A;  4MZ9 A;  1YJ9 A;  3HKZ G;  4DUZ L;  1XMO Q;  1ASZ A;  3KDF B;  4JI3 L;  4HIK A;  1VQN A;  4GKK Q;  1OXX K;  3RN5 A;  3HKZ E;  2UU9 L;  5IWA L;  1HZC A;  3CPF A;  4DR2 Q;  2N8N A;  2NZO A;  2ALY B;  3ULL A;  4QIW E;  1XNR L;  4R1J A;  4IPD A;  4JOI A;  3G4S A;  4JI8 L;  2JQO A;  2JK8 A;  3M3Y H;  3KF6 B;  4DNI A;  3AFP A;  1VQP A;  1IBL L;  3PUY A;  3J7A 5;  4A3B H;  1VS0 A;  4R4T A;  3WWV A;  4DUZ Q;  4A76 A;  2B63 G;  2N78 A;  4LF6 Q;  4A3F H;  1J6Q A;  3J81 j;  4KHP L;  4NB3 A;  4OWT B;  2MO1 A;  3TS0 A;  1B8A A;  1HZA A;  4DK3 C;  3J7Z C;  1V9P A;  1VQG A;  1OXU A;  1TXY A;  1XNR Q;  4IOA A;  1Q46 A;  1BKB A;  4B3S L;  2JJQ A;  2JA9 A;  1SMX A;  2VNU D;  1A63 A;  1IBL Q;  3L7Z C;  4LUV A;  5IP9 G;  5FJ8 G;  2Q2I A;  1J5E L;  1TWG H;  3MXN B;  3PO3 H;  4BXX H;  4A3D G;  2KHI A;  1PH2 A;  1YVC A;  3L2P A;  2RHQ B;  1SRU A;  3J81 i;  2JA6 H;  4JYA L;  4JI5 L;  3UE0 A;  2VQF L;  1VQ5 A;  1OXV A;  2K5V A;  1VQJ A;  3NEM A;  2D0O A;  1PYB A;  3TRE A;  3PO2 G;  5M5Y H;  1YHB A;  1L1O B;  2MNA A;  4DV6 L;  3HOW H;  3M4O H;  5IYC G;  4DV7 L;  3BZC A;  3PF5 A;  1X9N A;  1I6H H;  3S1R H;  2PQA A;  4B3S Q;  1UWV A;  4HIO A;  1E3P A;  3E9I A;  1HNZ L;  2JEB I;  1N36 L;  4P75 A;  2VUM H;  3A5Z B;  1XPR A;  1E1T A;  1U0L A; 
#chains in the Genus database with same CATH topology
 2K03 A;  3DM1 A;  2RDG A;  3W1G A;  3GTQ H;  2HCC A;  1LTT D;  1SE4 A;  2B29 A;  1M4V A;  1UEA B;  2YU9 H;  4DV6 Q;  4GN3 B;  3HOU B;  4PNY A;  4P2C B;  4DAV A;  3QOJ A;  1IYJ B;  1PYS B;  2RSN A;  5KYI A;  4XYO A;  3CC2 A;  1JWM D;  4YCU A;  4HCE A;  4CJ0 B;  3QJY A;  2OTL A;  3HOY B;  2UUC L;  3BYT B;  1VDZ A;  1P16 A;  3CCV A;  2A69 D;  2KJX A;  5HY6 A;  2DY8 A;  3S16 B;  5IYD G;  3T1Y Q;  2RQX A;  2R7D A;  5FKA C;  5COR A;  1HZB A;  5FJ8 H;  2PW5 A;  4A3C G;  3GTP H;  1DD2 A;  2F0F A;  3H6M A;  3S14 H;  2VB3 X;  3ERQ A;  5E4W C;  2A69 C;  2RVL A;  5GRO A;  2B2T A;  3M7G A;  4IN3 A;  4DKA C;  3WOE A;  3ULP A;  1B50 A;  3GTG H;  1S5B D;  4DR3 L;  2RCF A;  2V4D A;  2F0L A;  3H3V I;  4J8Q A;  2RSO A;  2JA8 G;  5M3F B;  4DV5 L;  2NBF A;  4ZRZ A;  1HR0 L;  3KBX A;  5KGU A;  1TQO A;  3S17 B;  3U4Z A;  3K57 A;  1N9W A;  3IRB A;  2G9H D;  2PMZ B;  1E1O A;  1YEZ A;  2L0C A;  3CW2 C;  2ID0 A;  2KUM A;  2FHT A;  2YTY A;  1VF7 A;  1MGS A;  4DR3 Q;  4CKC A;  1WYD A;  5KNC A;  3MEF A;  4DV5 Q;  4A3G B;  5CV4 A;  1JOQ A;  1WJJ A;  2Z6B A;  1CKN B;  2CQO A;  3D4R A;  1X3G A;  4R4C A;  4LF6 L;  1XTC D;  1HFN A;  5COY A;  4UP7 A;  4JBW A;  3SVM A;  1CZW A;  1IHZ A;  4MTK A;  1H9R A;  3PUZ A;  1F77 A;  2P5Z X;  3QOL A;  4EX5 A;  3HS0 C;  1R9T B;  2EIF A;  2N88 A;  5IYD H;  1PYW D;  3CP0 A;  1PFM A;  4A3C H;  1TS3 A;  3DLL A;  3U58 A;  4XDX A;  1KDB A;  5AFW A;  4A3E G;  2GN5 A;  4HJ7 A;  4KMU C;  3I8Z A;  3OW2 A;  1TT2 A;  5JEA J;  4QQB X;  4N9T A;  3GDE A;  3HOV B;  1HRJ A;  1C7Y A;  2JA8 H;  1S4Z A;  4XTC S;  4N9P A;  1E2Z A;  1DCZ A;  2WII B;  2KA7 A;  4IFD H;  2KCM A;  4K0K L;  3F2D A;  1EOV A;  4QY7 A;  1C9O A;  2IT1 A;  3EN2 A;  4G4K A;  4DPG A;  2KEE A;  2EYP A;  2HT1 A;  2EVB A;  4UDU C;  5C0X I;  1SYF A;  1QVF A;  1YNN D;  1TS4 A;  5T1I A;  3OIQ A;  1MHW C;  2M9V A;  5EPK A;  4NXN L;  1WOC A;  2PI2 A;  4AYB G;  4Q5V A;  1PH1 A;  3UI2 A;  2CWP A;  4K0K Q;  4AYB E;  1CQF A;  2C5C A;  4K2L A;  1JOK A;  3W2D A;  4XYQ A;  1QWY A;  1GUO A;  1VQ4 A;  3K0Y A;  2F0P A;  4EQO A;  4DUY L;  3KLS X;  4IZ8 A;  2B39 A;  4NW2 A;  3RLN A;  3EIV A;  2WV6 D;  4DA2 A;  1HCZ A;  4LUZ A;  3S2H B;  4F8M A;  2ICI A;  2IHE A;  4DR5 L;  1TWF B;  4A3E H;  1STB A;  1X3E A;  1CM9 A;  4KKU A;  2K28 A;  3TP7 A;  2PPB C;  1KLU D;  3TN2 A;  1SFO H;  4POF A;  1VQI A;  2R3Z A;  4DUY Q;  1HNX L;  1E22 A;  1XXG A;  5I9O A;  4G57 A;  1CK1 A;  5M3F G;  4AQY L;  2K05 A;  1W3S A;  4JC0 A;  3U4V A;  1X56 A;  4ALP A;  3MAQ A;  1PZJ D;  1J9O A;  1YIT A;  4DR5 Q;  4OON A;  2ZM6 Q;  2MFI A;  2F0H A;  2PMZ E;  3UDI A;  2ZJP A;  3F8T A;  1HNX Q;  3KF8 A;  1EEI D;  1WCM G;  4P74 A;  4AQY Q;  4A3G G;  1CKM A;  2ZJQ A;  1EYA A;  3NHH A;  2V1C C;  2B2Y C;  5ELD A;  3SK5 A;  4LFC L;  4UP9 A;  3PV0 A;  1IYU A;  1RF2 D;  2F3I A;  2I46 A;  3CKI B;  1NCV A;  1D5M C;  2AHO B;  1IYV A;  1K0S A;  2L55 A;  1XPO A;  2WAQ B;  1FGB D;  3A74 A;  3A7A B;  1R4P B;  4ILW A;  1D1K A;  5IGC A;  4A3F B;  4RG1 A;  1BR9 A;  4GZY C;  1X3F A;  4HCS A;  5FK9 C;  1XMQ L;  1EYD A;  2K01 A;  1I6V C;  3HOV G;  5HGT A;  1VQ6 A;  3S24 A;  5M3F H;  3ND9 A;  1FGU A;  2CH4 W;  2KQ3 A;  4RCO A;  4DV4 Q;  3S17 H;  4RHR A;  1STG A;  1D7Q A;  3BYY B;  1SR3 A;  2F0S A;  1GXD C;  2BE5 D;  1XMQ Q;  1PV4 A;  2F4V L;  1PFN A;  3K6O A;  4C1N K;  5EKK A;  5C4H A;  1IL8 A;  1WCM H;  2NVX H;  4A3G H;  3CXC A;  5C3E B;  2KED A;  3T53 B;  3HOX B;  3CCR A;  1WTR A;  4WOR A;  4JI3 Q;  5KEE A;  3FEW X;  5CBA E;  2FJ2 A;  4B3M L;  1YJN A;  4HID A;  3CQZ B;  1VQO A;  1B2T A;  1W6K A;  2CCZ A;  1MKH A;  3U50 C;  3KLR A;  1T5E A;  2BE5 C;  4KN4 C;  2A6H D;  2F4V Q;  4LW1 A;  5A35 A;  1R9T H;  2PNH A;  4H02 A;  2VXW A;  3RMH A;  1ENF A;  1R4Q B;  2R7Z G;  2JSO A;  3OSO A;  1ENA A;  3BJU A;  5J22 A;  4H7B A;  2NVQ B;  2WB1 B;  4GLA C;  2AQ1 B;  3S2D H;  1SYD A;  5CV8 A;  4B3M Q;  1HNW L;  1I4H A;  5DAU A;  1KDC A;  1H9S B;  5IY0 A;  2A6H C;  3J80 c;  1E7Z A;  2VS1 A;  1X6O A;  3HOV H;  3DHQ A;  4LF8 L;  1Z47 A;  4C1N I;  1K73 C;  3H91 A;  1GKH A;  5CBE E;  3R3O A;  1X65 A;  1N34 L;  5C3X A;  1HNW Q;  3CCS A;  1DOK A;  4R4O A;  1RJT A;  3CF5 A;  3HGB A;  2QDB A;  1Y8N B;  1WTW A;  3VR6 A;  1EY8 A;  1N36 Q;  4LF8 Q;  1YHA A;  2LS0 1;  1EY0 A;  2M2L A;  3MHB A;  2WKD A;  4PG3 A;  1N34 Q;  3KLW A;  1B53 A;  2YV5 A;  4RWS C;  1PLF A;  5C5L A;  2E75 C;  5T1G A;  2EXZ A;  3D4D A;  3F2C A;  2K33 A;  2FFK B;  1I4G A;  2QEX A;  1NJI C;  1B7Y B;  2HCI A;  3HOZ B;  1S5C D;  3PIP A;  1TS2 A;  1Z9F A;  1WI5 A;  2WAQ G;  2AWO A;  4L5Q A;  4H44 C;  2R93 B;  4A3F G;  1TWF H;  4TRD A;  3SEB A;  1HXY D;  1XNQ L;  4GNX B;  1SEB D;  1DJR D;  4OO1 I;  1CZG A;  1EFI D;  2KCT A;  4GN4 B;  2F1M A;  3WDN A;  4BXX G;  1JCK B;  2DUD A;  4BS9 A;  2KCN A;  3MZ5 A;  2EY6 A;  2JA7 B;  3IL8 A;  1TVX A;  1TWH B;  4QCL A;  2ICE C;  4PQX A;  3CC4 A;  2XIW A;  1XNQ Q;  4DR2 L;  1EWI A;  3JAM c;  2B8F A;  2IW3 A;  5J3B A;  1VQE A;  3LWU A;  3T1H Q;  4ULL A;  5GAH C;  3TZU A;  5C4X B;  3CCQ A;  1AZQ A;  1TWA B;  1AEX A;  4HMJ A;  4OL7 A;  1XMO Q;  4DUZ L;  1VQN A;  5NUC A;  5C44 B;  3RN5 A;  3J80 L;  3OWE B;  2H4O A;  4DR2 Q;  2N8N A;  2WAC A;  1XNR L;  4KD3 A;  4JOI A;  4R1J A;  3RUZ A;  4RGT A;  3G4S A;  4I7Z C;  2PW7 A;  2JK8 A;  3KF6 B;  1K8M A;  1V1P B;  3AFP A;  4DUZ Q;  1U4P A;  1F2M A;  4N8X 1;  2Z9H A;  4A3F H;  1BF4 A;  1TR5 A;  3DXJ C;  1SDF A;  4I7A A;  1SYC A;  3A56 A;  4RGO S;  1V9P A;  1EIG A;  1XNR Q;  1WD1 A;  1SMX A;  4CBV A;  4ABN A;  4BXX H;  1JWU D;  2KHI A;  3L2P A;  4JI5 L;  2VQF L;  1VQ5 A;  1PYB A;  1YHB A;  1L1O B;  4B9X A;  5IYC G;  1O78 A;  4C3J B;  3S1R H;  2PQA A;  5JOB A;  4XXE A;  3E9I A;  1HNZ L;  2JEB I;  1Y8O B;  2B2U A;  4H0L C;  3HOX H;  2KOL A;  4DK6 C;  1KQS A;  3QG1 A;  3MA2 B;  2XSC A;  1GO3 E;  3BVZ A;  4ID6 A;  1NY4 A;  2NYZ D;  3CQZ H;  3M85 A;  2A19 A;  5IP7 G;  5ELO A;  1PFS A;  1N32 L;  1X54 A;  3NBH A;  1HNZ Q;  4OIJ A;  3HOZ G;  2MHV A;  2FXQ A;  1A3V A;  1UE6 A;  3AFQ A;  5BR8 L;  4KJN A;  2NVQ H;  2JA5 B;  1YI2 A;  1C48 A;  3JAM L;  2I5L X;  2R93 G;  2L1B A;  3U9S A;  2D2C C;  1Z7T A;  1NR4 A;  3NK9 A;  1WTP A;  1N32 Q;  3ITP A;  3PUV A;  3OMG A;  1GUT A;  5AJ3 L;  1SAP A;  4IOC A;  1KIX A;  4DAY B;  2E2H H;  1LTG D;  1G91 A;  4JVZ A;  5EKI A;  5BR8 Q;  3KFU A;  1E2V A;  4IPC A;  1F9S A;  1E24 A;  5BN3 A;  1PH7 A;  1L0W A;  3S1Q B;  4KY7 A;  4X3T A;  3SK6 A;  4A75 A;  2OTJ A;  4OGQ C;  4FXD A;  1BQQ T;  5CV6 A;  4EVO A;  3NQT A;  2A1A A;  3EBE A;  3QIA A;  1EYC A;  3R2T A;  2Q8R E;  1MBY A;  2E5L Q;  1HHV A;  3B6Y A;  2F3W A;  5AJ3 Q;  2R6G A;  4K6L A;  1SE3 A;  1IBM L;  2RDH A;  5C4X G;  1AE3 A;  3IAY A;  4X64 L;  4A4I A;  5C44 G;  2NVT B;  2HIX A;  3J80 i;  4IUP A;  3G7L A;  3HOW G;  1KRS A;  1DXM A;  3DWP A;  5IP7 H;  3VA7 A;  3D6C A;  4IQZ A;  3MTS A;  2ATW A;  1KC8 C;  1TWC B;  2VL6 A;  4CHT B;  3TSS A;  3HOZ H;  2HDL A;  3M3Y B;  3PQI A;  4PZ7 A;  3CCL A;  4NXM L;  4X64 Q;  1EWC A;  2UXB L;  4MHE A;  2X6L A;  5FLX c;  3A7L A;  5M5X B;  5I6Y A;  2R93 H;  2CFM A;  3A55 A;  3KDF A;  4R4I A;  1U4L A;  4CJ1 B;  1L1O C;  2X69 A;  4NXM Q;  1LTI D;  2Y0S B;  2UXB Q;  4BY1 B;  2N49 A;  4XIG S;  1KAB A;  1GUW A;  1IW7 D;  4DN4 M;  1X32 A;  1TWH H;  1FNV A;  3I70 A;  4CDF C;  1DYQ A;  3M4O B;  1A8V A;  2NWG A;  1BDO A;  1SYE A;  1A2T A;  2EYH A;  4C3J G;  1BUV T;  2L11 A;  2ZTC A;  4HMI A;  1F9P A;  1G29 1;  4WJW A;  3TZD A;  5C4X H;  4JCV E;  3NWS A;  3S1N B;  1TWA H;  4G7Z C;  1GUS A;  2RDF A;  1LTA D;  1UEB A;  4FF1 A;  5C44 H;  1IW7 C;  1VQC A;  1TS5 A;  1EYG A;  4KN7 C;  3MXN A;  1KLG D;  3GTK B;  4QIW B;  5LMN W;  2HQL A;  4TVA B;  2UXD L;  1ONL A;  3N6R A;  4GOP C;  4F87 A;  3L3O C;  3KLS A;  4A3M G;  1HPC A;  2K50 A;  4YWL A;  2JA5 G;  1EY9 A;  2B63 B;  3JC6 6;  1E0B A;  4KY5 A;  2J4X A;  4B3R Q;  3UDX A;  1XJV A;  1Q12 A;  1U4R A;  2C35 B;  4KI0 A;  3A0J A;  1QZH A;  3T1Y L;  5K36 G;  2UXD Q;  4KTA A;  3TME A;  3HFZ B;  1XWE A;  1PH8 A;  1EY5 A;  1EZ8 A;  1SSO A;  5C0X J;  4X66 L;  3D0F A;  3H3V H;  3CME A;  3PO2 B;  4UHV A;  1A2U A;  1O7Y A;  4X62 Q;  3W3A A;  1SNQ A;  4C3J H;  1B44 D;  1NMG A;  4HTH A;  2B2W A;  3E9H A;  1JJ2 A;  5CR3 A;  1JC7 A;  4K5V A;  4HAE A;  5BN5 A;  4LF5 L;  2KBN A;  1EZ6 A;  4X66 Q;  3X3M A;  1K8A C;  1M8A A;  2K5D A;  2YYZ A;  5CMD A;  4LAA A;  3VDY A;  4RKL A;  1KDA A;  2NTT A;  3UDF A;  1DZ1 A;  1PMR A;  1QUQ B;  3SK8 A;  1F2Y A;  3NBI A;  1V1Q A;  4A3M H;  4L63 B;  1IKM A;  3PIO A;  4LF5 Q;  2JA5 H;  4BA1 I;  3PMF A;  2XRS D;  4IFD G;  2PQE A;  3I91 A;  3NPP A;  3FVQ A;  4FF3 A;  1ILQ A;  1TKW B;  3I4O A;  4DU9 A;  4EGV A;  2QIL A;  2X6G A;  4DK0 A;  2BDN A;  2IX1 A;  2WKC A;  4GKJ L;  4K6D A;  3N52 A;  1STH A;  5K36 H;  3VR2 A;  3C3L A;  1LAC A;  4LUO A;  1HR0 W;  3CD6 A;  2B3G A;  2E74 C;  3TRZ A;  1EQQ A;  2Y0S G;  4ZQ3 A;  1SE8 A;  5IIF A;  4G7O C;  3S1Q H;  1ZXT A;  2Y0S E;  3D4W A;  3MVV A;  3PCO B;  4JI7 L;  4O1N A;  1LTB D;  4GLV B;  3C2P A;  2OT2 A;  1U9R A;  4GKJ Q;  1CKN A;  1G51 A;  4IJL A;  4LWC A;  2I0Q A;  2E8G A;  4EQN A;  4OX9 L;  3SGI A;  1Q8K A;  2JE6 I;  1RCV D;  4JBJ A;  1LYL A;  1TII D;  1EQR A;  1V1O A;  5LMU Q;  2B2Y A;  2MO0 A;  4JI7 Q;  2NVT H;  1STE A;  2DJF C;  3P7J A;  1QG7 A;  3NEN A;  1EU4 A;  1RKN A;  1S3O A;  3SE0 A;  5ELF A;  3CC7 A;  2RHS B;  4OX9 Q;  1TWC H;  4HR7 B;  3S15 H;  2VUM B;  1PHJ A;  3E6Z X;  3A54 A;  1ET9 A;  1VF5 C;  3HKZ B;  1QVG A;  4ZK9 B;  3TDQ A;  2R61 A;  2Z4I A;  2H5X A;  5M5X H;  2UU9 Q;  4U68 A;  5JEA G;  1AFP A;  3ERS X;  5LHY 1;  1B9N A;  4HJ8 A;  3HOU G;  3P75 A;  2B2V C;  4LF4 L;  2KVM A;  3ZYY X;  4JI8 Q;  2PYK A;  1SJH D;  3IKJ A;  4XT1 B;  3HOY G;  2NTS A;  3K58 A;  1II3 A;  4BY1 H;  1FNU A;  2EYJ A;  1CA6 A;  1XTD A;  5EAY A;  1S5E D;  5IT9 c;  1DON A;  3GV3 A;  4LF4 Q;  3OIP A;  2CW0 D;  1D6E C;  1PRT F;  2QGQ A;  4JBM A;  1Y8P B;  1KTK A;  3NTK A;  2FMC A;  4G7H C;  4GS3 A;  1ML0 D;  3CCJ A;  1ASY A;  4TQU S;  3S1N H;  2EYO A;  1SND A;  4EQP A;  4DNR B;  4JYA Q;  3DWQ A;  4FYD A;  2EY5 A;  2O2L D;  2ZM6 L;  3FRP B;  2B2T C;  3IFD A;  3GTK H;  3M4Y A;  2CW0 C;  1JR0 D;  3V05 A;  1EL0 A;  1VQH A;  1SYG A;  4UP8 A;  2Q8T A;  1HZ9 A;  2IY5 B;  4F7X A;  1I50 B;  1PVO A;  5IGF A;  2HHH L;  2KEC A;  5JEA H;  1B1Z A;  3I4M B;  4V0B A;  1WD0 A;  3HOU H;  3BZD B;  1OXS C;  1CFM A;  1HH2 P;  5H1S E;  4JI2 L;  4K5X A;  1AN8 A;  3K5O A;  4QL5 A;  2D62 A;  3HOY H;  4B3T Q;  3AU7 A;  3T4A C;  2HHH Q;  3A8I E;  3GTM B;  4P72 A;  4L6T B;  1Q90 A;  5GAG C;  2A73 B;  1A15 A;  4A93 B;  4KV6 A;  3TQY A;  2IX0 A;  1PTO F;  2E2D C;  3S16 H;  2O5J C;  4LF7 Q;  3BG3 A;  4JI2 Q;  3J80 E;  3BDL A;  1SNC A;  1RTO A;  2G9D A;  3G71 A;  2K32 A;  4DR7 L;  1BBX C;  4L8J A;  1S5D D;  4DV4 L;  4GKK L;  3D31 A;  3QR8 A;  3HKS A;  1PRT D;  1C0A A;  4X65 Q;  4ZCK A;  2RKS A;  2K5H A;  1WFQ A;  3I2Z A;  2K75 A;  5M3M B;  2PO4 A;  3MXU A;  3HRZ C;  1ICW A;  1GM5 A;  2VUM G;  2E76 C;  1CT1 D;  4DR7 Q;  4KLK A;  1ENC A;  4MZ9 A;  1LV9 A;  2F0U A;  3HKZ G;  4A3K B;  4JI3 L;  4GKK Q;  1G2T A;  3HKZ E;  1LT5 D;  4TKO B;  1PRT C;  5ISR A;  3K5M A;  2K7V A;  5IGE A;  1JB3 A;  2NZO A;  2ALY B;  4IPD A;  3TP5 A;  4C56 C;  1QE6 A;  1LAB A;  2TMP A;  5F2D A;  4NMZ A;  3TP8 A;  4C3I B;  2ENB A;  4A76 A;  4KKT A;  4BY7 B;  4ODG A;  4OWT B;  3PIO 3;  3TS0 A;  5ELE A;  3GTJ B;  4S3S A;  4DK3 C;  3NQI A;  5KIX A;  1WTV A;  2VNU D;  3D6W A;  4RHS A;  4LUV A;  3QB3 A;  5IP9 G;  1J5E L;  5I4D A;  4BBS B;  3H0G B;  1V8Q A;  2RHQ B;  3T56 B;  1WTQ A;  1UUP A;  4A3J B;  1VQJ A;  1PTO D;  1F2Z A;  4CDC C;  1A6X A;  5G3L F;  1I4X A;  1HA5 A;  4IUN A;  1N36 L;  2VUM H;  1J5E Q;  3JAM E;  1H9S A;  3SDZ A;  1U0L A;  4R4Q A;  1M90 C;  4Y52 H;  3K7A B;  1FR3 A;  4U67 3;  3CU7 A;  2AWN A;  3C1E A;  4L5R C;  1PTO C;  1ZEQ X;  4JI1 L;  4CKE A;  3HG9 A;  1EOT A;  1H9M A;  1NBW A;  4K14 A;  3I4M G;  1W2B A;  3ERO A;  4QMG A;  5ELC A;  2Z6K A;  1OXT A;  1PXU A;  4RFB A;  2UUB L;  4C2M B;  2MUY A;  4JI4 L;  3PGZ A;  3M7N A;  4Y7N B;  2F0M A;  4OO1 H;  2JN4 A;  1CHP D;  4JI1 Q;  1VQM A;  1HTP A;  2QF7 A;  1YJW A;  4UY8 C;  1Q82 C;  2SNS A;  3SXH A;  1EU3 A;  4DV0 L;  2UUB Q;  2K4K A;  3E0E A;  2F4I A;  5IP9 H;  1K28 A;  4JI4 Q;  1LO5 D;  1YNJ D;  3S2H H;  4JPB W;  1T5X D;  2VZA A;  2PZU A;  2WAQ E;  4C3H B;  1Q1B A;  3DMU A;  4PMC A;  1HJP A;  3T51 B;  4DV2 L;  1NNX A;  3QWN A;  1VQA A;  2IL8 A;  1PH6 A;  4FP5 D;  2BA1 A;  2QKI C;  3FHW A;  2XVS A;  3T1H L;  4AH6 A;  5M3M G;  4DV0 Q;  4RKB A;  5C3W A;  2E2I B;  1YNJ C;  1ZKO A;  4GNX A;  1XMO L;  3IFT A;  4A3K G;  1XYI A;  1Y1W B;  1I50 H;  4LK1 C;  3SHL A;  4YWK A;  4HSP A;  3RD4 A;  4OXP A;  5G3L D;  4DV2 Q;  3BU2 A;  2OEO A;  2F0J A;  3I4M H;  3SR1 A;  2EOT A;  1U5K A;  4NPS A;  2EPB A;  2R7F A;  1S72 A;  1MIU A;  4DV3 Q;  3C1F A;  1WTH A;  3LGJ A;  5GAD C;  1SBB B;  5C3E G;  3BVM A;  3HOX G;  5FO9 B;  1VQD A;  5EKL A;  1BBW A;  4HJ5 A;  2Q8I B;  4JBK A;  3GTM H;  2AQ2 B;  4FXK C;  3NEL A;  1I3Q B;  2MPM A;  1HTL D;  3KUP A;  1I4R A;  3HZX A;  4APV A;  1CQV A;  3Q24 A;  1AH9 A;  3V96 A;  4O42 A;  2WB1 G;  1JT8 A;  1VQL A;  2WB1 E;  3AYH B;  2HQE A;  3DEO A;  2PNR C;  4A3J G;  1H9K A;  1I4Q A;  1VQ8 A;  3KF6 A;  2EE1 A;  1V1P A;  1EEF D;  3S9W A;  1CUK A;  2CHB D;  2A8V A;  1JE4 A;  1B9M A;  5M3M H;  2ASB A;  1P8L A;  4LFA L;  1NUC A;  2Z0S A;  3G48 A;  4A3K H;  2F0G A;  3GO5 A;  1QVC A;  3ZJY C;  3GQB A;  2NN6 G;  1HUM A;  3T13 A;  4N8F A;  3J7A V;  4R8N A;  1J8I A;  1S40 A;  3PF4 A;  2VW9 A;  4LFA Q;  5C3E H;  1X55 A;  5FLM G;  4V19 0;  5CV5 A;  4FF4 A;  2I07 B;  5JPM C;  4QF4 A;  1OTC A;  3PUW A;  2LXJ A;  3OTO Q;  2BA0 A;  5KRU A;  5FO7 B;  3GTL B;  2EJM A;  5FLX E;  3GTJ H;  1LTS D;  2DY7 A;  1KHI A;  4KD4 A;  5HUR A;  3ER0 A;  3GV6 A;  2DJG C;  1IKL A;  4DR4 Q;  1PH5 A;  2F0E A;  2QEJ C;  1HFG A;  4QB4 A;  4IO9 A;  1YHQ A;  3GTP B;  4BBS H;  2NVY B;  3RZO B;  3UE1 A;  4A3J H;  1STA A;  4GOP B;  5C4Z A;  3RLF A;  4ZUJ A;  2E5L L;  1W6J A;  4HJA A;  3Q0A A;  1I94 L;  1T9H A;  3FPP A;  1VQB A;  3K81 C;  3M4Q A;  1Y1W G;  3K7A H;  1JJC B;  1DOL A;  3NP8 A;  4ZLT F;  1Q81 C;  2JA7 G;  4IUT A;  2NN6 H;  3H09 A;  4DAY A;  4DK1 A;  3K59 A;  4KJO A;  2WP8 J;  1JE5 A;  2AUK A;  2L9H A;  1I94 Q;  3G6E A;  3OWF A;  2AMC B;  3K8A A;  5EJW A;  2JXM B;  1RD9 D;  4C2M H;  2XRQ D;  5FLM H;  1C8C A;  4OEL B;  3BS1 A;  1AE2 A;  1BCP F;  4R9W A;  1LT3 D;  3J7Y W;  4DGZ A;  4ZYS A;  4DR6 Q;  1QZG A;  2MGS A;  3J81 c;  4E6I A;  1UAP A;  3R93 A;  4POG A;  3K5N A;  5J39 A;  2EXD A;  1EQT A;  1K8O A;  4JOI C;  4R8I A;  1G2S A;  1YIJ A;  3OMC A;  5KND A;  3D8G A;  1B3A A;  2QW7 A;  3CHB D;  2TSS A;  4BWG B;  4DXG A;  4Q0F A;  3VYU A;  4JI6 Q;  5CV7 A;  2RCN A;  2I5M X;  1B70 B;  2IWH A;  4H13 C;  4O0A A;  1SRO A;  1TWG B;  2E2I H;  3K7U C;  3PIP 3;  4AIM A;  1Y1W H;  4RA8 A;  2JA7 H;  2CH4 A;  1B3Q A;  2K14 A;  5M5Y B;  3KJP A;  1KAW A;  5TSS A;  2XTI A;  4CJ2 C;  1I6H B;  1QIL A;  3FDT A;  1FJG L;  3OHX C;  3TS2 A;  2AKW B;  2LFN A;  4JV5 Q;  2B2U C;  1RHP A;  1Q3L A;  3EQL C;  4FXG C;  1IL2 A;  1ZYR D;  3I7F A;  1TU2 B;  4PZ8 A;  1SXT A;  5IWA Q;  2L12 A;  5DEH A;  2MJ8 A;  4B3R L;  5E3F A;  5JJK A;  2D5D A;  3OW7 A;  1AW7 A;  1I3Q H;  4DXF A;  1KL9 A;  1EIY B;  5EQ0 A;  1BCP D;  2NZH A;  5LMN L;  1FJG Q;  4OEM B;  3I55 A;  4YHH L;  3ULJ A;  1FNW A;  1SN8 A;  1XPU A;  1ZYR C;  1EFW A;  3VR4 A;  3PSI A;  3JAM i;  2NUC A;  4KHP Q;  1CSQ A;  1SFO B;  1WTO A;  4X62 L;  3NSW A;  3NXW A;  1DOM A;  2EYF A;  3K80 C;  1CTM A;  3EFX D;  3VR3 A;  3H15 A;  1PH4 A;  5LMN Q;  1BCP C;  5L37 A;  1HQR D;  3MXG A;  4YHH Q;  1QNK A;  1OO9 B;  2D9U A;  4A3D B;  3J81 L;  5JAV A;  3M9B A;  1PH3 A;  2EJF C;  5DM7 3;  2A68 D;  4B9W A;  1YBY A;  3K5L A;  2BCO A;  1VQK A;  4CDD C;  3FP9 A;  1I4P A;  1YNX A;  2A6E D;  2UXC L;  3K0X A;  1CKO A;  1KNE A;  5FOB B;  5D3I B;  1EQV A;  3I56 A;  2B2V A;  4X6A H;  4X3U A;  4RCN A;  5FLX L;  4GLX A;  1JB7 A;  4DAM A;  2FIN B;  3DUZ A;  3Q23 A;  2LMC B;  3H94 A;  5C0X G;  1RIP A;  3TBI B;  2CVR A;  2A68 C;  4QUC A;  4DAP A;  1NTG A;  4AYB B;  1M1K C;  1BO0 A;  4HJ9 A;  1VQF A;  2UXC Q;  3GTL H;  2A6E C;  1GOZ A;  1YZ6 A;  2BDO A;  5EPJ A;  5JPN C;  5LL6 X;  1LT4 D;  5D65 A;  2K5N A;  3Q22 A;  3BZK A;  2Z1C A;  3W1B A;  4BA2 I;  5IE8 A;  4WFN 3;  4O2D A;  3Q8D A;  5E7N A;  3GP7 A;  5IOC A;  3KYH C;  2UUC Q;  1QUQ A;  2NVY H;  4FF2 A;  3RZO H;  5C5M A;  1GD7 A;  2OF1 A;  5KYL A;  4K2K A;  2F03 A;  4IFD J;  4TSS A;  1VQ7 A;  1FVI A;  2CKZ B;  1UE1 A;  5GAE C;  3PUX A;  1ICF B;  4P71 A;  4JK1 C;  5BN4 A;  2VQE L;  5IT9 E;  2CQA A;  5I9P A;  1GVP A;  4XQJ A;  2XN9 C;  3FPU B;  1JJG A;  4JW0 A;  4BY1 G;  2R92 B;  5LMU L;  1JMC A;  2HD3 A;  2F0O A;  1A0I A;  2L15 A;  3DM3 A;  2EY2 A;  2SOB A;  5CYU A;  2VQE Q;  3BDO A;  4DF7 A;  5JVG 3;  4IUV A;  1WCM B;  2OWO A;  2NVX B;  3ICE A;  3MFY A;  2IPK D;  1HR0 Q;  1UE7 A;  3MXP A;  5C0X H;  1YJ9 A;  1ASZ A;  4HIK A;  3VR5 A;  1K3B C;  1AZP A;  1JOO A;  2UU9 L;  1O7L A;  2AQ3 B;  1HZC A;  1D1I A;  1JQY D;  1QJO A;  4QIW E;  4XT3 B;  1Y1V B;  4JI8 L;  3M3Y H;  1IBL L;  3J7A 5;  1VQP A;  1MSG A;  3OOC A;  5EGT A;  5I6W A;  3I4N B;  3S2D B;  2B63 G;  2N78 A;  3O13 A;  4X3K A;  4LF6 Q;  1U4M A;  3J81 j;  1CA5 A;  4NB3 A;  5EBC A;  1B8A A;  1HZA A;  1VMC A;  3J7Z C;  3DWA A;  3LWE A;  1X3Q A;  1OXU A;  1TXY A;  2C9O A;  4IOA A;  1Q46 A;  3HP3 A;  2JJQ A;  1STN A;  5A2Q E;  1PRT B;  1A63 A;  1GHJ A;  1IBL Q;  2Q2I A;  5I2Y A;  1TWG H;  4A3D G;  1YVC A;  1ROD A;  4JYA L;  1SRU A;  3J81 i;  1WTX A;  3P1H A;  4KK7 A;  3UE0 A;  3SK4 A;  3PO2 G;  3TRE A;  1G8Z D;  1K83 B;  5M5Y H;  2MNA A;  5D14 A;  3M4O H;  4M1U B;  4DV7 L;  3BZC A;  1X9N A;  4J6H A;  3E5S A;  1I6H H;  2MP1 A;  3NUC A;  1UWV A;  1E3P A;  1EY6 A;  2KCC A;  4K8I A;  4M8A A;  2B2W C;  1E1T A;  4BBR B;  2F3V A;  2HIV A;  2ZT9 C;  4ZUI A;  4YIJ A;  2FMM A;  4YCW A;  3T16 A;  1Q1E A;  2JEA I;  4LFB L;  4K8J A;  3EVQ A;  2RA4 A;  3I3C A;  4RGN A;  1KNA A;  2E2J B;  4CDE C;  4DV7 Q;  1LTR D;  2M00 A;  5IGG A;  2ZJR A;  3NE5 B;  3TP6 A;  4IFD I;  1YNN C;  1PZI D;  2EQS A;  2R7Z B;  2PZT A;  1B4O A;  2H1E A;  4LFB Q;  1K3R A;  4MIU A;  5HGQ A;  2B63 H;  4B3T L;  4NXN Q;  1PZK D;  2SEB D;  4QJF A;  2CWA A;  4J15 A;  2PCF B;  5JJL A;  2F0K A;  1JOR A;  1Q7Y C;  4DFA A;  4LF7 L;  1PTO B;  4IPG A;  3BDC A;  3F1Z A;  2N55 A;  4A3D H;  2R92 G;  3KF8 B;  1KXL A;  2KHJ A;  3PO2 H;  3L0O A;  1D8L A;  5C4J B;  2F0D A;  4X65 L;  4UAI A;  1EIF A;  4GN5 A;  3EA6 A;  2L4N A;  4WRD A;  4OWX B;  4MTN A;  3NTI A;  1A62 A;  2PZW A;  4PZ6 A;  5IGB A;  1O80 A;  1FL0 A;  4UPA A;  1Q8I A;  2IJ0 A;  1D2B A;  2XWB B;  2K5Q A;  1STY A;  3RLO A;  1CHQ D;  2OQK A;  3OPO A;  1NAP A;  1SLJ A;  2OCE A;  2MQH A;  2HDM A;  1GUG A;  4P73 A;  2XWJ B;  2VY3 A;  1L0X B;  3BVG A;  1Y1V G;  5C6A A;  1EY4 A;  5IT9 L;  3GTO B;  3FKI B;  2ZTD A;  4L5S A;  3I4N G;  1SNO A;  3RZD B;  2RF4 A;  4LFC Q;  4A3L G;  1N33 L;  4NP5 A;  1DM0 B;  4XQN A;  1QB5 D;  3Q6S A;  5DM6 3;  5I2X A;  1H95 A;  1SNP A;  3C46 A;  2XGT A;  3CCU A;  2RBM A;  4A3I B;  2ES2 A;  2F0N A;  2R92 H;  4OO1 G;  4ZKC B;  2Z4H A;  2DGY A;  4IPH A;  2K5W A;  3S1M B;  1LT6 D;  4QGU A;  1N33 Q;  2JYO A;  4NKL A;  5GQO A;  1KD1 C;  1V43 A;  1I5F A;  2GVB A;  5IYB G;  4PMW A;  3S1R B;  4HED A;  2PI2 E;  2F0Q A;  2KEN A;  4IAL A;  4BBR G;  1EY7 A;  4DR1 L;  4CKB A;  1VCI A;  2WIN B;  2BH8 A;  4WJ4 A;  1UE5 A;  1VMP A;  4FNF A;  4OHJ A;  1ILP A;  4IUQ A;  1QNU A;  3OYY A;  2L5T A;  2O5I C;  2EYL A;  3I73 A;  4XQQ A;  4ZAI A;  5M5W B;  4EQ5 A;  4OIK A;  2QA4 A;  4HIM A;  1Y1V H;  1XX8 A;  2G5D A;  3R2I A;  1MSH A;  2EDG A;  4KHZ A;  4KY6 A;  3W5O A;  4DR1 Q;  3RNU A;  1KRT A;  5A2Q L;  5JJI A;  4WJ3 M;  3VA5 A;  3I4N H;  1SYB A;  3HEJ A;  4A3L H;  1HA6 A;  2QDL A;  2EYM A;  1N8R C;  3MEH A;  1GHK A;  1H9J A;  2F0T A;  2E2H B;  3I90 A;  5E4X A;  4CGY B;  4QUF A;  2DN8 A;  1BVS A;  3ND8 A;  3L9A X;  1K0R A;  2LXK A;  2D0P A;  3WOF A;  1K83 H;  4A93 G;  5CGK A;  1IZ6 A;  3E3X A;  1FD7 D;  5IYB H;  3VYS A;  2LY7 A;  1SMY D;  3U9O A;  2EZV A;  3ONA B;  5EPL A;  4BBR H;  1L2F A;  3AB9 A;  2YTV A;  3LNN A;  4IUR A;  1K8G A;  2A74 C;  4OWW B;  3RR5 A;  4B08 A;  2UUA L;  2E2J H;  1TY2 A;  1WVL A;  1JWS D;  3CMA A;  1SMY C;  4DV3 L;  3STB D;  4K5W A;  2R7Z H;  2LSS A;  1EUJ A;  2BOS A;  3FKI G;  3MC0 B;  4HSV A;  3NWT A;  3G6J B;  2K6A A;  2UUA Q;  4JI0 L;  2Q2H A;  2IHF A;  1PTO H;  1RDP D;  3STB C;  4FDB A;  2YTX A;  3I4L A;  4YWM A;  4A3B B;  4C3I G;  5D3D A;  4A3I G;  1VQ9 A;  3F2B A;  4BY7 G;  4J1M A;  4JI0 Q;  1Q86 C;  5C4J H;  2WFW A;  2ZXO A;  1K9M C;  4A93 H;  2BH2 A;  1PFB A;  4LF9 L;  1BNZ A;  2DNC A;  3CAM A;  4ME5 A;  3PO3 B;  4BBS G;  2GVA A;  3H0G G;  5ELN A;  2JA6 B;  1ESR A;  1LM0 A;  5JVH 3;  1A3U A;  2GA4 B;  2SNM A;  4YY3 L;  1KAA A;  5LL6 S;  3HOW B;  1JIC A;  4ZKB B;  4LF9 Q;  2O4X A;  1MJE A;  1O7Z A;  5DNF A;  1RL2 A;  5DLQ E;  2HUG A;  1X3P A;  2VB2 X;  1DGS A;  3CRK C;  4RMF A;  1PA6 A;  4MNO A;  1NMF A;  1F9R A;  2XNA C;  1EWH A;  1LUZ A;  2J7Z A;  3CRL C;  3GTO H;  3FKI H;  3M4P A;  3UDG A;  3GTQ B;  3V2T A;  2ZXR A;  3OTO L;  3RZD H;  1TY0 A;  3AQQ A;  5M9O A;  4YY3 Q;  4PV1 C;  2YU9 B;  3AMU A;  3KJO A;  4HN7 A;  1QOH A;  4FO2 A;  1G6P A;  3J81 E;  3A5U A;  5CV9 A;  3MWY W;  3NTH A;  1ESF A;  2Z6K C;  1L1O A;  2NB0 A;  4DR4 L;  4RGM A;  4C3I H;  4A3I H;  2K52 A;  3AEV A;  5ELB A;  1UNS A;  2PQA B;  2Q2U A;  2Q2T A;  4BY7 H;  3S1M H;  1LLR D;  5IOD A;  1BOS A;  2A5H A;  3EJI A;  3URY A;  5K5P A;  4IUU A;  5IGD A;  3KOJ A;  4DV1 L;  1Z6H A;  2K04 A;  2OXP A;  1F9Q A;  3H0G H;  4YCV A;  4Z9C B;  3KBG A;  4C3H G;  3NBH B;  4JI5 Q;  3S14 B;  4PMB A;  2VQF Q;  1LTL A;  4X3S A;  2N3S A;  2F52 A;  3CCM A;  3GTG B;  5M5W H;  1E2W A;  4DV1 Q;  2EJG C;  4GOP A;  2AUJ D;  4KHV A;  4A3M B;  3P20 A;  1GJX A;  4LNQ A;  1NSN S;  4GNX C;  1BCP B;  1L0Y B;  3CPW A;  4DR6 L;  2KHS A;  3RN2 A;  2LKV A;  1IBK L;  2QCP X;  1CI3 M;  1Y69 U;  4ME3 A;  1MJC A;  4FVM A;  4JG2 A;  4L5T A;  3KK7 A;  3VYT A;  3DEP A;  3R8B A;  2I5H A;  4A3B G;  1FYC A;  5E1F A;  4Y7N H;  1BBU A;  2OQ0 A;  1O7I A;  1ET6 A;  1RTN A;  2ZXP A;  1A3T A;  1IBK Q;  5IYC H;  4JI6 L;  2F0I A;  4NDX A;  2JP1 A;  3QO2 A;  5CC4 A;  3FMC A;  2Z8L A;  1BXT A;  3D3R A;  3TEH B;  3PO3 G;  2B8G A;  5J1Z A;  1IXR A;  1PH9 A;  2JA6 G;  4C3H H;  3J7A F;  1G6Z A;  1NE3 A;  1GUN A;  2IX3 A;  4F88 A;  3A8J E;  3GD7 A;  2ZTE A;  1Y14 B;  4LJZ C;  3CCE A;  2NN6 I;  2JA8 B;  3S15 B;  4LMQ D;  1SNM A;  4IJH A;  1CSP A;  3MFG A;  3A8K E;  4JV5 L;  1IBM Q;  2SDF A;  1D5Z C;  3KDF B;  5KNB A;  1OXX K;  1NR2 A;  5IWA L;  1HQM C;  3CPF A;  3F2U A;  5EBD A;  2F0V A;  3ULL A;  2NZ1 D;  2JQO A;  2EY1 A;  3H3V C;  1EIH A;  4I65 A;  4DNI A;  4A3B H;  2J0T D;  3PUY A;  1VS0 A;  4R4T A;  3WWV A;  5FO8 B;  4RH6 A;  1J6Q A;  4KHP L;  2K1B A;  2MO1 A;  3E0J A;  2DNE A;  3I72 A;  1F2L A;  1VQG A;  1BKB A;  3VYR A;  4B3S L;  1MI2 A;  2JA9 A;  4RAU C;  1MD2 D;  1AP0 A;  4DNT B;  3L7Z C;  5FJ8 G;  1D5X C;  3MXN B;  3PO3 H;  1PH2 A;  2JA6 H;  4A3E B;  1C4Q A;  3LX0 A;  1S5F D;  1OXV A;  2K5V A;  3NEM A;  2D0O A;  3X3N A;  5JJZ A;  3HOW H;  4KKS A;  4DV6 L;  3PF5 A;  1SJE D;  1HUN A;  4B3S Q;  4MN3 A;  4HIO A;  4P75 A;  1SE2 A;  3A5Z B;  1XPR A;  2F0W A;  1PDQ A;  1QCB D; 
#chains in the Genus database with same CATH homology
 2HIV A;  3HOX H;  4R4Q A;  4DK6 C;  1KQS A;  1M90 C;  4YCW A;  3W1G A;  1Q1E A;  2JEA I;  3GTQ H;  4LFB L;  4Y52 H;  1GO3 E;  2AWN A;  4L5R C;  2B29 A;  4JI1 L;  2YU9 H;  1NY4 A;  3I4M G;  3CQZ H;  1NBW A;  4DV6 Q;  1W2B A;  4GN3 B;  4DV7 Q;  3M85 A;  2ZJR A;  2A19 A;  5IP7 G;  5ELO A;  1PFS A;  4IFD I;  1X54 A;  1N32 L;  2Z6K A;  1HNZ Q;  1OXT A;  3HOZ G;  1IYJ B;  2EQS A;  1PYS B;  2FXQ A;  2UUB L;  1UE6 A;  3CC2 A;  4JI4 L;  3AFQ A;  3PGZ A;  4YCU A;  5BR8 L;  3M7N A;  2NVQ H;  4LFB Q;  2OTL A;  1K3R A;  1YI2 A;  2UUC L;  5HGQ A;  2B63 H;  4B3T L;  4NXN Q;  2I5L X;  2R93 G;  1P16 A;  4QJF A;  4JI1 Q;  2CWA A;  3CCV A;  4J15 A;  5JJL A;  1VQM A;  5HY6 A;  1Q7Y C;  1N32 Q;  3PUV A;  1YJW A;  4UY8 C;  1Q82 C;  5IYD G;  3T1Y Q;  4LF7 L;  5AJ3 L;  2R7D A;  4IOC A;  1KIX A;  4DAY B;  1HZB A;  4DV0 L;  2E2H H;  2UUB Q;  2K4K A;  3E0E A;  5FJ8 H;  4IPG A;  5IP9 H;  4JI4 Q;  3F1Z A;  4A3C G;  5BR8 Q;  3S2H H;  4A3D H;  3GTP H;  3KFU A;  2VZA A;  4IPC A;  1PH7 A;  1E24 A;  2WAQ E;  3KF8 B;  1L0W A;  2R92 G;  1Q1B A;  3S14 H;  1KXL A;  1HJP A;  2KHJ A;  4DV2 L;  3PO2 H;  3L0O A;  4A75 A;  1D8L A;  1VQA A;  5GRO A;  2OTJ A;  4X65 L;  1EIF A;  4GN5 A;  2A1A A;  3EBE A;  4DKA C;  4OWX B;  3ULP A;  4MTN A;  1PH6 A;  2E5L Q;  3GTG H;  1A62 A;  2BA1 A;  3B6Y A;  3FHW A;  4PZ6 A;  4DR3 L;  5AJ3 Q;  3H3V I;  3T1H L;  4AH6 A;  1FL0 A;  2R6G A;  4UPA A;  5M3M G;  4DV0 Q;  4DV5 L;  2JA8 G;  1IBM L;  1HR0 L;  5C4X G;  1AE3 A;  4GNX A;  1XMO L;  4X64 L;  4A3K G;  1I50 H;  3U4Z A;  4A4I A;  4YWK A;  3RLO A;  1N9W A;  4OXP A;  5C44 G;  2OQK A;  3IRB A;  4DV2 Q;  2HIX A;  3BU2 A;  3J80 i;  1SLJ A;  1E1O A;  1YEZ A;  1KRS A;  2MQH A;  2OCE A;  3CW2 C;  3HOW G;  2ID0 A;  3I4M H;  2YTY A;  4P73 A;  5IP7 H;  4NPS A;  1U5K A;  2ATW A;  4DR3 Q;  1WYD A;  2R7F A;  2VY3 A;  2VL6 A;  1S72 A;  1MIU A;  1KC8 C;  4DV3 Q;  1Y1V G;  3MEF A;  4DV5 Q;  3LGJ A;  5GAD C;  3HOZ H;  1WJJ A;  5C3E G;  4PZ7 A;  3HOX G;  3CCL A;  1VQD A;  4NXM L;  1CKN B;  1BBW A;  4X64 Q;  2ZTD A;  2CQO A;  4L5S A;  1X3G A;  2UXB L;  4R4C A;  4LF6 L;  3I4N G;  5FLX c;  4UP7 A;  4JBW A;  4HJ5 A;  2RF4 A;  2R93 H;  4LFC Q;  4JBK A;  4A3L G;  3GTM H;  2CFM A;  1N33 L;  3PUZ A;  4EX5 A;  3NEL A;  3KDF A;  2EIF A;  4R4I A;  4APV A;  1H95 A;  5IYD H;  3CP0 A;  1AH9 A;  2XGT A;  3CCU A;  1L1O C;  4A3C H;  4NXM Q;  3DLL A;  3U58 A;  2ES2 A;  2UXB Q;  2WB1 G;  1JT8 A;  2N49 A;  2R92 H;  1VQL A;  4OO1 G;  2WB1 E;  3AYH B;  4XIG S;  4A3E G;  1TWH H;  2DGY A;  2GN5 A;  4IPH A;  4HJ7 A;  4A3J G;  1VQ8 A;  4QGU A;  3OW2 A;  1N33 Q;  3KF6 A;  5GQO A;  1KD1 C;  5JEA J;  1V43 A;  1CUK A;  1I5F A;  4QQB X;  2GVB A;  1A8V A;  2A8V A;  5IYB G;  4PMW A;  2ZTC A;  3GDE A;  1G29 1;  1C7Y A;  5M3M H;  2JA8 H;  2PI2 E;  2ASB A;  4XTC S;  1P8L A;  2KEN A;  4BBR G;  5C4X H;  2Z0S A;  3G48 A;  4JCV E;  4DR1 L;  4LFA L;  1VCI A;  1TWA H;  4A3K H;  2BH8 A;  3GO5 A;  1QVC A;  3ZJY C;  4WJ4 A;  1UEB A;  1UE5 A;  5C44 H;  1VQC A;  2KCM A;  4K0K L;  2NN6 G;  3F2D A;  1EOV A;  4QY7 A;  1EYG A;  1C9O A;  2IT1 A;  3EN2 A;  3OYY A;  4DPG A;  2HT1 A;  5C0X I;  5LMN W;  2HQL A;  1QVF A;  4EQ5 A;  4TVA B;  2QA4 A;  4HIM A;  1Y1V H;  1S40 A;  2UXD L;  3PF4 A;  2VW9 A;  4GOP C;  4LFA Q;  5C3E H;  4KHZ A;  3W5O A;  4DR1 Q;  1X55 A;  5FLM G;  3RNU A;  1KRT A;  4A3M G;  5JJI A;  2K50 A;  4YWL A;  4WJ3 M;  2JA5 G;  1OTC A;  3I4N H;  4NXN L;  1WOC A;  2PI2 A;  2LXJ A;  3PUW A;  4AYB G;  3JC6 6;  3OTO Q;  2BA0 A;  2CWP A;  1PH1 A;  4K0K Q;  4A3L H;  4AYB E;  4B3R Q;  3GTJ H;  1N8R C;  3UDX A;  1XJV A;  1Q12 A;  2C35 B;  4KI0 A;  1VQ4 A;  1KHI A;  4DUY L;  3A0J A;  1QZH A;  3T1Y L;  5K36 G;  2UXD Q;  3ER0 A;  3RLN A;  3EIV A;  4DR4 Q;  1PH5 A;  4LUZ A;  4IO9 A;  3HFZ B;  1YHQ A;  4BBS H;  2IHE A;  1BVS A;  1PH8 A;  5C0X J;  4DR5 L;  3UE1 A;  4X66 L;  4A3E H;  4A3J H;  1X3E A;  3D0F A;  1K0R A;  2LXK A;  3CME A;  4GOP B;  3H3V H;  2D0P A;  1K83 H;  1SFO H;  4POF A;  4A93 G;  1IZ6 A;  3RLF A;  1VQI A;  4X62 Q;  2E5L L;  5IYB H;  4DUY Q;  4C3J H;  1HNX L;  4HJA A;  1I94 L;  1E22 A;  1NMG A;  1T9H A;  3E9H A;  5M3F G;  1JJ2 A;  4AQY L;  1W3S A;  1VQB A;  3K81 C;  4JC0 A;  3U4V A;  4BBR H;  1L2F A;  1X56 A;  4ALP A;  3M4Q A;  1J5E Q;  2YTV A;  3K7A H;  1JJC B;  2KBN A;  1YIT A;  1Y1W G;  4DR5 Q;  1Q81 C;  3RR5 A;  4X66 Q;  1K8G A;  4OWW B;  1K8A C;  2JA7 G;  4OON A;  2UUA L;  2E2J H;  2ZM6 Q;  2MFI A;  2YYZ A;  2PMZ E;  3UDI A;  2WP8 J;  3VDY A;  2ZJP A;  3F8T A;  1JE5 A;  3UDF A;  1HNX Q;  1QUQ B;  1I94 Q;  3G6E A;  3CMA A;  4DV3 L;  2AMC B;  3K8A A;  1WCM G;  4P74 A;  3STB D;  4AQY Q;  1CKM A;  2ZJQ A;  2R7Z H;  4A3G G;  4C2M H;  5FLM H;  1V1Q A;  4A3M H;  2V1C C;  2LSS A;  1EUJ A;  1AE2 A;  3FKI G;  3PIO A;  2JA5 H;  4BA1 I;  4LF5 Q;  4IFD G;  4DR6 Q;  4LFC L;  4UP9 A;  3PV0 A;  1QZG A;  2UUA Q;  3I4O A;  4JI0 L;  2Q2H A;  3J81 c;  2IX1 A;  2IHF A;  4GKJ L;  2F3I A;  4POG A;  2EXD A;  2AHO B;  4JOI C;  3STB C;  4LUO A;  4FDB A;  1HR0 W;  2YTX A;  4YWM A;  1YIJ A;  1XPO A;  3CD6 A;  2B3G A;  4A3I G;  1VQ9 A;  3TRZ A;  3A74 A;  2Y0S G;  1EQQ A;  1SE8 A;  3S1Q H;  2Y0S E;  3F2B A;  4RG1 A;  4BY7 G;  4JI7 L;  3PCO B;  1X3F A;  1Q86 C;  4JI0 Q;  4GLV B;  5C4J H;  2WFW A;  1K9M C;  4A93 H;  4GKJ Q;  1CKN A;  1G51 A;  4IJL A;  4LWC A;  2I0Q A;  1XMQ L;  2BH2 A;  2E8G A;  4JI6 Q;  4LF9 L;  2RCN A;  2I5M X;  1B70 B;  3HOV G;  3CAM A;  4OX9 L;  3SGI A;  1VQ6 A;  3S24 A;  5M3F H;  4O0A A;  1Q8K A;  1FGU A;  1SRO A;  2JE6 I;  2E2I H;  4JBJ A;  3K7U C;  4BBS G;  1LYL A;  2GVA A;  3H0G G;  5ELN A;  1EQR A;  1LM0 A;  4AIM A;  4DV4 Q;  1Y1W H;  3S17 H;  2JA7 H;  5LMU Q;  2MO0 A;  1D7Q A;  4JI7 Q;  2NVT H;  2K14 A;  1SR3 A;  4YY3 L;  3NEN A;  3KJP A;  1KAW A;  2XTI A;  1XMQ Q;  1PV4 A;  4LF9 Q;  1S3O A;  2F4V L;  1MJE A;  1RL2 A;  3CC7 A;  2RHS B;  4OX9 Q;  1TWC H;  3S15 H;  5DLQ E;  1FJG L;  1WCM H;  1PHJ A;  2NVX H;  3CXC A;  1DGS A;  1PA6 A;  4RMF A;  3TS2 A;  4A3G H;  4MNO A;  2AKW B;  4JV5 Q;  1NMF A;  3CCR A;  1LUZ A;  3GTO H;  1IL2 A;  3FKI H;  3M4P A;  3UDG A;  1QVG A;  4JI3 Q;  3I7F A;  4B3M L;  3OTO L;  3RZD H;  4PZ8 A;  1YJN A;  2H5X A;  3AQQ A;  5M5X H;  4YY3 Q;  5IWA Q;  2UU9 Q;  5JEA G;  4HID A;  1VQO A;  4B3R L;  2CCZ A;  1MKH A;  3U50 C;  3KJO A;  5JJK A;  3ERS X;  4HJ8 A;  2F4V Q;  1I3Q H;  3HOU G;  1KL9 A;  4LF4 L;  4LW1 A;  1R9T H;  1EIY B;  3A5U A;  4LF5 L;  2PNH A;  1G6P A;  4H02 A;  2NZH A;  5LMN L;  2Z6K C;  4JI8 Q;  1FJG Q;  2R7Z G;  3I55 A;  4YHH L;  1L1O A;  3ULJ A;  4DR4 L;  3BJU A;  4C3I H;  4A3I H;  1SN8 A;  4GLA C;  2K52 A;  1XPU A;  3HOY G;  3AEV A;  3S2D H;  4BY1 H;  2PQA B;  1EFW A;  2Q2U A;  4B3M Q;  3PSI A;  2Q2T A;  1HNW L;  4BY7 H;  1XTD A;  3JAM i;  4KHP Q;  3S1M H;  1CSQ A;  5EAY A;  5IT9 c;  5IY0 A;  4X62 L;  4LF4 Q;  3K80 C;  3J80 c;  3H15 A;  1PH4 A;  4JBM A;  2QGQ A;  1E7Z A;  2VS1 A;  3KOJ A;  5LMN Q;  1X6O A;  4DV1 L;  4GS3 A;  3HOV H;  3CCJ A;  4YHH Q;  4LF8 L;  1Z47 A;  1K73 C;  1ASY A;  4TQU S;  3S1N H;  1GKH A;  3H0G H;  4YCV A;  3M9B A;  4JYA Q;  1X65 A;  1N34 L;  1PH3 A;  1HNW Q;  3NBH B;  3CCS A;  4JI5 Q;  1YBY A;  1VQK A;  2VQF Q;  3FP9 A;  2ZM6 L;  4R4O A;  1LTL A;  1YNX A;  2UXC L;  3K0X A;  3CF5 A;  1CKO A;  3I56 A;  2N3S A;  3GTK H;  2F52 A;  3CCM A;  4X6A H;  5M5W H;  4DV1 Q;  4GOP A;  1N36 Q;  4LF8 Q;  4GLX A;  1YHA A;  1JB7 A;  1VQH A;  4DAM A;  4UP8 A;  1HZ9 A;  2IY5 B;  5C0X G;  4LNQ A;  1RIP A;  4GNX C;  4PG3 A;  1N34 Q;  1PVO A;  3KLW A;  2YV5 A;  3CPW A;  1M1K C;  1NTG A;  4DR6 L;  2HHH L;  4HJ9 A;  3RN2 A;  1VQF A;  2UXC Q;  3GTL H;  1YZ6 A;  1IBK L;  3HOU H;  2K5N A;  3F2C A;  3BZK A;  2QEX A;  1NJI C;  4ME3 A;  1B7Y B;  1MJC A;  3W1B A;  4BA2 I;  1OXS C;  4JG2 A;  4L5T A;  1HH2 P;  5IE8 A;  5H1S E;  3PIP A;  4JI2 L;  4O2D A;  3Q8D A;  2I5H A;  5E7N A;  4A3B G;  1Z9F A;  4QL5 A;  1WI5 A;  2D62 A;  4Y7N H;  2WAQ G;  3HOY H;  3KYH C;  1BBU A;  2OQ0 A;  2AWO A;  4L5Q A;  2UUC Q;  4B3T Q;  1QUQ A;  2NVY H;  3RZO H;  2HHH Q;  4A3F G;  1TWF H;  1O7I A;  1GD7 A;  4IFD J;  4P72 A;  1VQ7 A;  1FVI A;  2CKZ B;  1UE1 A;  5GAG C;  5GAE C;  1XNQ L;  3PUX A;  4GNX B;  5IYC H;  4P71 A;  1IBK Q;  3TQY A;  2IX0 A;  4JI6 L;  4OO1 I;  2VQE L;  3S16 H;  2KCT A;  4LF7 Q;  4GN4 B;  1GVP A;  4JI2 Q;  3G71 A;  3TEH B;  4BXX G;  1JJG A;  3PO3 G;  4DR7 L;  2DUD A;  4DV4 L;  4BY1 G;  4GKK L;  3D31 A;  1IXR A;  1PH9 A;  2JA6 G;  4C3H H;  5LMU L;  1JMC A;  3HKS A;  1NE3 A;  3CC4 A;  1C0A A;  4X65 Q;  1XNQ Q;  1A0I A;  2L15 A;  3DM3 A;  4DR2 L;  2K5H A;  3GD7 A;  1WFQ A;  1EWI A;  2ZTE A;  3JAM c;  1Y14 B;  2VQE Q;  3I2Z A;  5J3B A;  3CCE A;  2K75 A;  1VQE A;  2NN6 I;  3T1H Q;  4IJH A;  1GM5 A;  1CSP A;  5GAH C;  2OWO A;  2VUM G;  3ICE A;  4DR7 Q;  3CCQ A;  1HR0 Q;  1IBM Q;  4JV5 L;  4KLK A;  1UE7 A;  4MZ9 A;  1YJ9 A;  3HKZ G;  4DUZ L;  1XMO Q;  1ASZ A;  3KDF B;  4JI3 L;  4HIK A;  1VQN A;  4GKK Q;  1OXX K;  3RN5 A;  3HKZ E;  2UU9 L;  5IWA L;  1HZC A;  3CPF A;  4DR2 Q;  2N8N A;  2NZO A;  2ALY B;  3ULL A;  4QIW E;  1XNR L;  4R1J A;  4IPD A;  4JOI A;  3G4S A;  4JI8 L;  2JQO A;  2JK8 A;  3M3Y H;  3KF6 B;  4DNI A;  3AFP A;  1VQP A;  1IBL L;  3PUY A;  3J7A 5;  4A3B H;  1VS0 A;  4R4T A;  3WWV A;  4DUZ Q;  4A76 A;  2B63 G;  2N78 A;  4LF6 Q;  4A3F H;  1J6Q A;  3J81 j;  4KHP L;  4NB3 A;  4OWT B;  2MO1 A;  3TS0 A;  1B8A A;  1HZA A;  4DK3 C;  3J7Z C;  1V9P A;  1VQG A;  1OXU A;  1TXY A;  1XNR Q;  4IOA A;  1Q46 A;  1BKB A;  4B3S L;  2JJQ A;  2JA9 A;  1SMX A;  2VNU D;  1A63 A;  1IBL Q;  3L7Z C;  4LUV A;  5IP9 G;  5FJ8 G;  2Q2I A;  1J5E L;  1TWG H;  3MXN B;  3PO3 H;  4BXX H;  4A3D G;  2KHI A;  1PH2 A;  1YVC A;  3L2P A;  2RHQ B;  1SRU A;  3J81 i;  2JA6 H;  4JYA L;  4JI5 L;  3UE0 A;  2VQF L;  1VQ5 A;  1OXV A;  2K5V A;  1VQJ A;  3NEM A;  2D0O A;  1PYB A;  3TRE A;  3PO2 G;  5M5Y H;  1YHB A;  1L1O B;  2MNA A;  4DV6 L;  3HOW H;  3M4O H;  5IYC G;  4DV7 L;  3BZC A;  3PF5 A;  1X9N A;  1I6H H;  3S1R H;  2PQA A;  4B3S Q;  1UWV A;  4HIO A;  1E3P A;  3E9I A;  1HNZ L;  2JEB I;  1N36 L;  4P75 A;  2VUM H;  3A5Z B;  1XPR A;  1E1T A;  1U0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...