1JE5A

Crystal structure of gp2.5, a single-stranded dna binding protein encoded by bacteriophage t7
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
197
structure length
181
Chain Sequence
MAKKIFTSALGTAEPYAYIAKPDYGNGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATDWADEVEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the gene 2.5 protein, a single-stranded DNA binding protein encoded by bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Dna binding protein
molecule keywords HELIX-DESTABILIZING PROTEIN
total genus 41
structure length 181
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1je5A00
1YHQA 1XNQL 4IFDI 5IP7G 3HOVG 4BY1G 3CD6A 1OXSC 2MQHA 3A74A 2K5NA 1PH4A 1VQ9A 2PI2E 1KL9A 4LFAQ 3RLFA 1PA6A 4B3SL 3BZCA 4BBRG 4LF8Q 4BY7G 2YV5A 4A3CG 2B29A 4OO1I 4AQYQ 4MTNA 3HOUH 4DV5Q 2LXKA 3M7NA 4A76A 3OW2A 4LF9Q 2NVXH 4DR6L 1JJGA 1K0RA 3CAMA 4DR3Q 2A1AA 1UEBA 4YY3L 4X64L 5GAEC 1VCIA 3T1YL 2WAQE 4IPGA 4DV3Q 3G48A 1RIPA 4A75A 3PF4A 4OWXB 2OQ0A 4Y52H 5JJKA 1GD7A 2EIFA 1SLJA 2JEBI 4NXML 4WJ4A 1WCMH 2JK8A 5GADC 4AYBE 1XNRQ 2UUAL 1X54A 4OXPA 1YJNA 4B3RQ 1KXLA 4JI7Q 4X65Q 3TS2A 4A93G 1XJVA 2E5LQ 4DNIA 1HZBA 3OYYA 4A4IA 3HOYG 1PFSA 5GROA 1KRTA 2HT1A 2A8VA 4R4OA 4L5RC 2IX0A 1WFQA 2LSSA 3STBD 2WFWA 3FKIG 1G291 4GKJL 1O7IA 3W5OA 1Z47A 2PNHA 4POFA 2CFMA 4PZ7A 2ZTDA 1L1OC 2JE6I 1S40A 2UUCQ 1OTCA 4LF5Q 4JI8Q 1CKOA 2WB1G 3JAMc 3T1HQ 5C0XI 1E1OA 1VS0A 1VQIA 1VQAA 2XTIA 4DR2Q 2UU9L 5HGQA 3K0XA 2UUBQ 2JA8H 3NBHB 1XMQL 2KCMA 1I94Q 4DR4Q 2C35B 4DR1Q 4X64Q 2BA0A 4YHHQ 4QL5A 4DUZL 3I2ZA 4JI6L 2DUDA 1EIFA 1XMOL 3E9HA 5FLMH 4R1JA 2JA5H 4JI3Q 3AQQA 1PHJA 1VQ5A 4A3KH 1X3EA 1XNRL 5M3FG 4A93H 3FP9A 4LFCL 1I50H 4UPAA 1WOCA 1RL2A 2FXQA 1B70B 3PUWA 1LUZA 4GS3A 4GNXC 1SN8A 3L0OA 1A0IA 5AJ3L 1FVIA 5ELOA 1N8RC 4OX9Q 2R7ZH 1IBML 1J5EL 1V9PA 1K73C 4YWLA 1N36L 1MIUA 3CC2A 4JBMA 1XMQQ 1Q81C 1VQJA 2JQOA 3PV0A 3OTOL 1PV4A 1X55A 3GTLH 4A3GH 1SMXA 2VNUD 1UE1A 3CC7A 4DV1Q 4DR7L 2QEXA 1PH5A 4JI2Q 3MEFA 2GVAA 3I4MG 1BKBA 2I5LX 4P72A 4GLAC 5IP9G 2QGQA 1VQNA 1NMFA 2PQAA 4UP9A 2OQKA 1CSPA 3BU2A 1OXUA 4A3FG 4R4TA 2E2IH 3HFZB 1VQDA 5FJ8G 1IZ6A 3HOVH 2HIVA 2NN6I 3F2CA 5M3FH 4JI7L 1XNQQ 4A3KG 2BH2A 2PQAB 3NEMA 4QY7A 3CMEA 3S1NH 5FJ8H 3CMAA 1VQKA 1Q86C 3L7ZC 2RCNA 4ME3A 1YIJA 4KLKA 5IYDG 3S1MH 2WAQG 1EQRA 1LTLA 4BXXH 1ASYA 5IWAQ 2AWNA 2N3SA 4Y7NH 2VUMG 4JI5Q 1L2FA 1JT8A 4BA2I 5IE8A 1UWVA 2K50A 4PG3A 1SE8A 4JI5L 4C2MH 2ATWA 1C0AA 1NE3A 1S72A 3GD7A 2UXCQ 2GVBA 4EQ5A 4A3GG 1X3FA 2MNAA 1VQ4A 1QVFA 2GN5A 3PUZA 1ASZA 1U5KA 3FKIH 3W1BA 4LFBL 4K0KL 3PO2G 3U4VA 4DR7Q 4LFCQ 4DR1L 1SR3A 4UP7A 1V43A 1YVCA 2YYZA 4C3HH 1XMOQ 3A5UA 3S17H 1K8GA 4JOIA 1JB7A 4JBJA 5M5WH 5JJLA 2NZHA 1YJWA 1NBWA 4JI4Q 3H0GH 4HJAA 1WCMG 3MXNB 4R4CA 4ALPA 2CKZB 4DR3L 1Q7YC 1QZGA 4GOPA 2B63H 4B3TQ 2NVTH 2NN6G 1JE5A 2OTLA 1N33Q 2JEAI 1KAWA 1PH6A 1HJPA 2VW9A 2BA1A 4DUYQ 1N33L 3J7ZC 5GAGC 1HZ9A 2Q2HA 4HJ7A 3CP0A 4IPDA 4B3MQ 3M4OH 1TXYA 1Q82C 1Y14B 3KF6A 5IYBG 1XPUA 4GOPB 3M4PA 3GDEA 5M5XH 3GTKH 3KDFB 4NB3A 3UDFA 5IYCG 5AJ3Q 2CQOA 4HJ5A 2UUBL 1C9OA 4H02A 4TVAB 3I56A 3PO3G 2NZOA 4A3CH 4A3LH 3KF6B 4BY7H 5C0XG 3S1QH 1VQCA 2AWOA 2D0PA 4JYAQ 2JA6H 3EN2A 1J6QA 3GTGH 2JA5G 5IP7H 1YITA 1X3GA 4LUVA 4DR5L 3DM3A 5C44G 1MJEA 5JJIA 1OXXK 1YNXA 1PH3A 3KJOA 4DV0L 1GKHA 4IPHA 1VQ7A 1IBLQ 1L1OA 1B7YB 1XPRA 2Q2UA 3RN2A 3J81j 2OWOA 2EXDA 5IYCH 1SFOH 2R7DA 1X9NA 1G51A 2IHFA 2UXDL 1I3QH 2NVQH 4DV5L 1OXTA 3I55A 1EYGA 2AHOB 3I4OA 2N8NA 5BR8Q 2D0OA 4YCUA 2I5HA 3BJUA 1JMCA 1A63A 3ULJA 3HOXH 4DV1L 2JA7G 4X62L 2K52A 2B63G 4JOIC 3I7FA 4PMWA 2UUCL 4LF5L 3EIVA 2K5VA 1X65A 3HOUG 3RLOA 3ZJYC 1HZAA 1HNZQ 1W2BA 3K8AA 2MFIA 3CPWA 3B6YA 4JBKA 4LWCA 1IYJB 4AYBG 1HNXL 1LM0A 1BBWA 1T9HA 1E24A 4QGUA 1GM5A 2JA6G 3E9IA 3GTMH 4KHPL 4GN3B 4JI1Q 1FJGQ 2F4VQ 4GN4B 4NXNQ 1N32L 3NENA 1J5EQ 3CQZH 2AKWB 5GQOA 3UDGA 1N34L 3LGJA 4R4IA 5C3EG 2B3GA 3F8TA 4YCVA 2NVYH 3PUYA 4LF4L 1AE2A 1VQPA 2JA7H 3HOXG 5IYBH 3D0FA 1K3RA 1BBUA 2ALYB 3F1ZA 2K4KA 4DAYB 3PIPA 4DV4L 4POGA 3TRZA 1E1TA 3H3VH 2Q2TA 4LUZA 4TQUS 5JEAJ 3TREA 4DV4Q 1VQMA 1NJIC 4JI6Q 2ZTCA 1I5FA 4A3DG 1KQSA 1IBLL 4DUYL 4MZ9A 1PH2A 1IBMQ 3PIOA 2ZJQA 2VS1A 1KRSA 1HR0L 3AEVA 2UU9Q 4JI8L 4UY8C 4BBRH 1UE5A 2QA4A 2HQLA 3PCOB 3GO5A 4JYAL 1HR0W 4IOCA 1Y1VG 2R7FA 5ELNA 3KJPA 3M4QA 1QVGA 1VQEA 3HOZH 1HNZL 2D62A 2LXJA 3E0EA 3IRBA 2R6GA 4A3LG 1Q1BA 3HOZG 4DV3L 4OO1G 3GTJH 2IY5B 1Y1VH 2UXBQ 4QJFA 3CCEA 3M85A 5M3MG 3KF8B 4EX5A 1TWCH 2AMCB 2K5HA 1EUJA 4DV7L 1WJJA 4GN5A 2Z6KC 1TWFH 4AQYL 1VQOA 1QUQB 2ES2A 4NXNL 1FL0A 4DV2L 4DV6L 1M90C 4A3DH 3CCQA 3S24A 5BR8L 2YTVA 1PH9A 1X56A 5C4JH 1PH1A 1N36Q 1VQFA 4P74A 1M1KC 2N78A 2IT1A 1NMGA 1QUQA 5C0XJ 3H0GG 4DR5Q 3J80i 3HOWH 3S2DH 2F3IA 4IOAA 1HNWQ 4KHZA 1EIYB 3A5ZB 1Q8KA 4JCVE 4BBSH 2UXDQ 4A3EH 5LMNQ 3NELA 2VL6A 5LMUL 4X66Q 4LF6L 4DV7Q 1KD1C 2R93G 2F4VL 2Z0SA 1N32Q 3I4NG 1VQBA 2UUAQ 1Y1WG 3HKZE 2VQFQ 1K83H 4X66L 3RR5A 4A3FH 3CPFA 1HR0Q 3GTPH 3CCSA 2R93H 4A3EG 4JI4L 4O2DA 4KI0A 5FLMG 2YU9H 4A3IH 3J80c 5IP9H 3K81C 3U58A 3HOWG 4C3IH 2L15A 2OTJA 4YWKA 2Z6KA 3S16H 1DGSA 3ERSX 2YTYA 3K7UC 1KHIA 3K7AH 3RNUA 4A3MH 3CF5A 4HIMA 3KOJA 2HHHL 3UE0A 1AH9A 3K80C 4HJ8A 2I0QA 1CSQA 4LF8L 2JA9A 2ID0A 2HHHQ 3RLNA 4QQBX 4OWTB 1CKMA 4IFDJ 1PH7A 4L5QA 4LNQA 1TWAH 4DKAC 1TWGH 4B3SQ 1IL2A 5IYDH 2I5MX 3ER0A 3JC66 4AH6A 4HIOA 1KC8C 4C3JH 2K14A 2OCEA 2WB1E 4DR4L 1I6HH 4APVA 2R92G 4GKKL 1E3PA 4PZ8A 5C44H 3M9BA 3OTOQ 1Z9FA 1PYBA 1D8LA 3DLLA 4OONA 3HOYH 4PZ6A 3ULLA 1YHBA 3SGIA 3PUVA 1E22A 4O0AA 5LMUQ 4R4QA 4LF6Q 4L5SA 2XGTA 3AYHB 4GLXA 2RHQB 3CCUA 1FJGL 5H1SE 1UE7A 4JI0Q 3M3YH 4JV5L 2UXBL 1XTDA 1IXRA 1H95A 4BA1I 1YJ9A 1WI5A 3CW2C 4DK3C 2PI2A 1GO3E 4WJ3M 1YBYA 1G6PA 5GAHC 1K8AC 4YHHL 4L5TA 4LUOA 3G4SA 1N9WA 1OXVA 4JBWA 5EAYA 3AFQA 4IO9A 1JJCB 3T1YQ 2E5LL 4LW1A 2BH8A 2ZM6L 2KCTA 3G71A 1IBKL 4B3ML 5DLQE 4B3TL 2YTXA 4IFDG 1Q1EA 5C3EH 4B3RL 4LFBQ 4LF7L 4LFAL 1IBKQ 2R7ZG 5LMNL 2Y0SE 1HNXQ 4X6AH 2Y0SG 3F2DA 4IJHA 3F2BA 3GTOH 3UDIA 4GOPC 3H3VI 1A62A 3D31A 2ZJPA 1I94L 4RG1A 1CUKA 1GVPA 4OWWB 3PO2H 3J7A5 1S3OA 4DR6Q 1NY4A 2CCZA 4X62Q 3CCLA 2EQSA 2JA8G 4NXMQ 1VQGA 4LF7Q 3S14H 4K0KQ 1TWHH 2MO0A 2V1CC 3KLWA 4YCWA 3STBC 3WWVA 4JI2L 4KHPQ 1D7QA 1W3SA 3HKSA 5M5YH 2IX1A 2VUMH 3GTQH 3KFUA 1NTGA 4JI0L 4JV5Q 2CWAA 4A3MG 1EQQA 4DR2L 3KYHC 2VQEQ 1YHAA 2E8GA 1VQHA 4QIWE 3CC4A 2K75A 4JG2A 3JAMi 4A3IG 4A3BH 4LF4Q 3EBEA 1R9TH 1UE6A 3TEHB 2KHIA 3G6EA 4GKKQ 2R92H 3UE1A 4JI3L 4GKJQ 3I4NH 3PF5A 1SROA 2PMZE 1PH8A 1VQLA 1B8AA 3PSIA 4UP8A 3PO3H 5LMNW 1FGUA 2RF4A 1VQ6A 1SRUA 3W1GA 4A3JH 2ZTEA 4J15A 2JJQA 2ASBA 1YI2A 1HZCA 4BBSG 4GNXB 2Q2IA 5C4XG 2VY3A 3L2PA 4YY3Q 3S1RH 3ICEA 2VQFL 2KBNA 3I4MH 1XPOA 4LF9L 3CCRA 4MNOA 3J81i 1QVCA 3KDFA 4GNXA 1A8VA 3U4ZA 4HIDA 1EFWA 2VZAA 3CCMA 4AIMA 3CCJA 3HKZG 1P8LA 1Q12A 1BVSA 4FDBA 4IPCA 3ULPA 5IY0A 1X6OA 4P73A 5C4XH 4DV0Q 5IWAL 1V1QA 3CCVA 5J3BA 3VDYA 1E7ZA 5M3MH 2RHSB 5JEAG 1MJCA 3S15H 1PYSB 1Y1WH 1PVOA 1EOVA 2ZJRA 4BY1H 3PUXA 3AFPA 4YWMA 1L1OB 1N34Q 1JJ2A 4X65L 1QZHA 2DGYA 2F52A 5FLXc 4HIKA 3Q8DA 1K9MC 2MO1A 2HIXA 2E2JH 1WYDA 2IHEA 3TQYA 2H5XA 5IT9c 1CKNA 5K36G 4DUZQ 3RZDH 4A3BG 1L0WA 3PGZA 2ZM6Q 1EWIA 5E7NA 3UDXA 1KIXA 2N49A 2UXCL 2WP8J 3BZKA 2A19A 4DK6C 4DAMA 3RZOH 1HNWL 1Q46A 4DPGA 4IJLA 3TS0A 1U0LA 2KHJA 4GLVB 1CKNB 1LYLA 4BXXG 3U50C 4OX9L 5HY6A 3T1HL 1C7YA 3FHWA 3J81c 3S2HH 3A0JA 4DV2Q 4DV6Q 1HH2P 4JI1L 1P16A 2KENA 4HJ9A 4XIGS 4JC0A 1VQ8A 4A3JG 1AE3A 4P75A 1MKHA 4XTCS 4NPSA 4RMFA 3CXCA 1YEZA 1YZ6A 2E2HH 3RN5A 2VQEL 4P71A 3H15A 2CWPA
chains in the Genus database with same CATH superfamily
4B08A 2F0QA 3C2PA 2GA4B 2K5NA 4I65A 3RLFA 4XT1B 3HOUB 1B44D 1CTMA 2B29A 3HOUH 3E6ZX 1PFMA 2L9HA 3QR8A 3OW2A 2F0LA 2IJ0A 3J7YW 1K0RA 2CH4A 2F1MA 1DCZA 1UEBA 4YY3L 1DOKA 4X64L 3MA2B 5GAEC 3T1YL 3G48A 1DM0B 2OQ0A 1EY8A 2NWGA 1I4GA 2JEBI 3MTSA 4HN7A 4NXML 3S15B 5CV7A 2JN4A 4CHTB 2UUAL 1B9MA 1JB3A 2EYJA 1EYAA 1DXMA 1HZBA 2HT1A 1CK1A 1CFMA 2WKDA 2E2HB 4FXGC 2R61A 1O7ZA 3W5OA 1Z47A 1PLFA 4POFA 4JI8Q 1CKOA 4H0LC 3T1HQ 1JORA 2L12A 1CZGA 4IQZA 2UU9L 2UUBQ 1BBXC 3NBHB 2VB2X 3OHXC 3V05A 1I94Q 1EY5A 4DR4Q 2JXMB 3O13A 2BA0A 4KY7A 3TMEA 3DEPA 4YHHQ 3I2ZA 4DUZL 4K8IA 1JOQA 3E9HA 2PQEA 3NBHA 1PHJA 1CA5A 4A3KH 2XVSA 1KLGD 4A93H 1M4VA 2FXQA 3PUWA 4DXGA 1SN8A 3L0OA 1WTWA 2R7ZH 1K73C 4P2CB 1N36L 3AU7A 1AFPA 2JQOA 3OTOL 1IHZA 1X55A 5JVH3 1UE1A 3CC7A 4DR7L 1LT6D 2F0DA 3MXGA 2QEXA 2JA5B 4JI2Q 4S3SA 3MEFA 1V1OA 3I4MG 4CKCA 1MSGA 2O2LD 2OQKA 2RDGA 4A3FG 1DD2A 1BUVT 3V2TA 4R4TA 3NWTA 4WORA 1XNQQ 4A3KG 5FO9B 2BH2A 1A2UA 2PCFB 4G4KA 1VQKA 2RCNA 4ME3A 4KLKA 2JA7B 4ZUJA 2RA4A 1DOMA 5EKIA 1EQRA 3BS1A 1MHWC 2N3SA 4Y7NH 4JI5Q 2L11A 4KY5A 2BCOA 1VMPA 4KTAA 4ZK9B 4PG3A 3NK9A 1S72A 4A3GG 3AMUA 3S1NB 3SK4A 1Q3LA 2VXWA 4U673 1ASZA 2L4NA 3U4VA 3Q24A 3BYYB 4DR1L 1SFOB 1SR3A 1KAAA 1XMOQ 4KY6A 1K8GA 2PO4A 4PNYA 1JB7A 3SK6A 1RCVD 1V1PA 5A2QL 1WCMG 1FYCA 3MXNB 1A15A 4IUUA 4DR3L 3EVQA 2JEAI 5GAGC 1HZ9A 1WTXA 4IPDA 4B3MQ 3DUZA 3TZDA 5D65A 1Y14B 3KF6A 5IYBG 1FNVA 4OGQC 1GUSA 3GDEA 3QO2A 1ZKOA 3GTKH 3KDFB 4NB3A 2K32A 1E0BA 3UDFA 1C9OA 1H9JA 2F03A 2B8GA 3KF6B 4BY7H 4A3LH 5C0XG 3S1QH 2KECA 2D0PA 3QIAA 1CI3M 1BNZA 3GTGH 1HUNA 1D2BA 1DOLA 5C44G 3S1MB 3MWYW 1OXXK 2EY1A 4XQJA 1PXUA 2WKCA 1PH3A 1GKHA 1VQ7A 4K5WA 5CBEE 5KNDA 2OWOA 4ILWA 5IYCH 1YNJC 1FNUA 4HSPA 5BR8Q 2RBMA 2FINB 3CQZB 1VMCA 2EYMA 4DV1L 4JOIC 4ZKBB 4PMWA 3TP8A 1T5EA 2MFIA 1IYJB 3R8BA 2MPMA 4AYBG 1XWEA 1BBWA 1E24A 3E9IA 5C0XH 4IN3A 1BCPD 4KHPL 2F4VQ 2B2TA 1J5EQ 1SJHD 5GQOA 1N34L 4R4IA 2N55A 3I4LA 3A7AB 3PUYA 4C3HB 2JA7H 2A68C 2EJFC 4DV4L 2K4KA 3PIPA 2Q2TA 3TREA 4DV4Q 2ZTCA 1FNWA 3K5MA 1LLRD 1IBLL 5AFWA 1RTOA 2L1BA 1DONA 3EJIA 4WFN3 4B9WA 2PW7A 2UU9Q 1ILPA 3D8GA 4BBRH 2F0OA 5C4HA 1PRTD 5K5PA 3M4QA 3HOZH 1K8OA 4A3FB 1HNZL 2K04A 4KD3A 5JPMC 3DXJC 1F77A 4OO1G 2ZT9C 2NTTA 4BBSB 2UXBQ 1XX8A 5ELBA 3KF8B 1DZ1A 2AMCB 1WJJA 1TWAB 1VF7A 3E3XA 2DJFC 1KDCA 1EYCA 1U4RA 1LABA 3S24A 3KF8A 4DFAA 5DM73 5C4JH 1SE2A 1PRTF 2KCNA 2SNSA 2HCIA 2R3ZA 2F0KA 1PZID 1F9RA 1NMGA 3HOWH 3J80i 1F2LA 3OMCA 1I6HB 2F0NA 1PDQA 3K5LA 1EIYB 2MGSA 2B2VC 4X66Q 1ESRA 1N32Q 1VQBA 3T4AC 4X66L 3CPFA 1GUOA 2EZVA 4O2DA 5FLMG 2YU9H 5IP9H 3U58A 4RH6A 4C3IH 2L15A 3S16H 2TSSA 3I4MB 3ERSX 3TZUA 3HOYB 2EOTA 3K7AH 4A3MH 3CF5A 2C9OA 2HHHL 2I0QA 1CSQA 1LV9A 2PYKA 4LF8L 2HHHQ 1TWHB 1CKMA 1PRTB 4L5QA 2K6AA 2XN9C 2X6GA 4MIUA 4DKAC 4B3SQ 5D3IB 3NSWA 2WB1E 4APVA 4GKKL 1S5ED 1E3PA 4PZ8A 1Z9FA 3ULLA 1YHBA 4R4QA 4L5SA 2XGTA 2AQ2B 2OXPA 4JK1C 2RHQB 1TWFB 3CRLC 3SDZA 1SSOA 1XTDA 5I9OA 1A3TA 2L5TA 1TWGB 4FXDA 3TP5A 4WJ3M 4X3TA 2EJGC 4L5TA 3T13A 3SK8A 5EAYA 2F0IA 1R9TB 3G71A 4B3ML 4LFAL 3MHBA 3PIO3 3U9SA 1QB5D 3F2BA 5CGKA 4AYBB 3AB9A 3D31A 3SEBA 3WOEA 4A3IB 1B4OA 1EWCA 1I4QA 3K59A 3H09A 1STYA 1ZYRC 3R2TA 1CUKA 5JVG3 1S3OA 2CCZA 5IT9E 1ET6A 5EGTA 2R93B 4NXMQ 4K0KQ 3KLWA 2V1CC 5C4XB 3D4DA 4RGTA 5ELFA 3HZXA 1CZWA 2KVMA 4JV5Q 4Z9CB 3KYHC 3A7LA 1YHAA 5ELDA 3A8JE 5C44B 4JVZA 5CV6A 1PZKD 5IGBA 2IX3A 4LF4Q 2E2DC 1UE6A 2FHTA 3ND9A 4ZUIA 4JI3L 4HMJA 3PF5A 2PMZE 1KDAA 3PSIA 5LMNW 1FGUA 1GHKA 5D14A 4J15A 3H3VC 1S4ZA 4ZRZA 3S1RH 1HQMC 3ICEA 3TP6A 1XPOA 3D6WA 1C48A 3I91A 4HIDA 1CHQD 1EYDA 2B2YC 3CCMA 1BVSA 3ULPA 4ME5A 3MXPA 4P73A 1E7ZA 2RHSB 1Q90A 1PYSB 1I50B 3FEWX 3MFGA 1ML0D 3PUXA 3P1HA 1L1OB 4X65L 3EROA 2F52A 5FLXc 3PIP3 3Q8DA 3VR3A 2E2JH 3OW7A 2IHEA 5E7NA 1HUMA 1NUCA 2N49A 1B3QA 2WP8J 3BZKA 3M3YB 4DAMA 3RZOH 3DMUA 4DPGA 1BCPF 1EQTA 2IL8A 2PW5A 5EKKA 4BXXG 2F0PA 3TBIB 3J81c 1R4QB 3OWFA 4JI1L 1P16A 2KENA 1VQ8A 1TS3A 1IL8A 4FP5D 1JICA 2JA8B 3KUPA 1XNQL 3DWPA 1GUNA 3CD6A 2QDLA 1OXSC 2MQHA 5EPKA 2B63B 1YNJD 4LFAQ 1PA6A 4B3SL 2YV5A 2KOLA 1D5ZC 2F0EA 4M1UB 4MTNA 4A76A 5CV5A 4LF9Q 4DR6L 1JJGA 2A1AA 2LY7A 3SE0A 3GTLB 4DV3Q 4A3JB 5DAUA 4A75A 2QEJC 3RZDB 3BDCA 5JJKA 4A3KB 1JE4A 1LT5D 4CBVA 2BE5D 2JK8A 1G8ZD 4AYBE 2SOBA 2R7ZB 4Q5VA 1SEBD 4OXPA 1YJNA 1BF4A 5E3FA 4X65Q 3TS2A 2AQ1B 2NTSA 4QUCA 4MHEA 4DNIA 5I2XA 1LTAD 3NE5B 3G6JB 2WFWA 4NW2A 3FKIG 4DK1A 5CR3A 1O7IA 3WDNA 4GKJL 3J81L 4GZYC 2Z9HA 2CFMA 4PZ7A 2JE6I 4J8QA 1S40A 2UUCQ 1F2YA 1TS4A 2K01A 1VS0A 1VQIA 4RHSA 4DR2Q 2BOSA 1SNMA 2C35B 1PYWD 3IL8A 4QL5A 1WCMB 1SBBB 3C3LA 4JI6L 2DUDA 4H44C 4XYOA 5A2QE 3BVGA 5FLMH 4R1JA 2JA5H 3AQQA 1XNRL 1X3EA 4LFCL 1I50H 4UPAA 5EPLA 3JAME 1LUZA 4GNXC 1A0IA 5AJ3L 5ELOA 1N8RC 1IBML 2JSOA 3CC2A 3L9AX 4DN4M 4JBMA 1IKMA 1XMQQ 2V4DA 1SYGA 1Q81C 5COYA 3H6MA 1SAPA 1E2VA 1RJTA 3CKIB 3QWNA 2NVTB 4XYQA 4DV1Q 1PH5A 2GVAA 3IFDA 4BWGB 1CM9A 5M9OA 4GLAC 5IP9G 1PFNA 2QGQA 1RD9D 1NMFA 2PQAA 5LHY1 3J80E 3BU2A 1A3UA 3ZYYX 1VQDA 1STNA 4DNRB 5I6WA 2CW0C 2PQAB 5FJ8H 1BXTA 1ILQA 4ZAIA 5CV4A 3MAQA 1FD7D 1QNUA 5IGDA 3VR5A 3H94A 5EKLA 2KEEA 4IUQA 2SNMA 5IWAQ 3A56A 3S1QB 4JI5L 1SYEA 4C2MH 1NE3A 2FJ2A 5C5MA 3GD7A 2UXCQ 2GVBA 2OT2A 1X3FA 1QVFA 1U5KA 3FKIH 4LFBL 3DEOA 1JR0D 4LFCQ 3J7AF 1SYBA 3J81E 3Q23A 2O5IC 2F0FA 2YYZA 3HGBA 1UNSA 4JOIA 4K8JA 1JWSD 4JBJA 5M5WH 4RGOS 1YJWA 1EU4A 1NBWA 1TR5A 4JI4Q 1LT3D 4R4CA 2CKZB 5KYLA 2TMPA 4B3TQ 2B63H 2OTLA 4M8AA 1N33Q 5C5LA 2M9VA 1U4MA 2BA1A 4DUYQ 4HJ7A 3M4OH 4LK1C 3OIPA 1Q82C 1XPUA 2A69C 1HQRD 1C4QA 2PZUA 3RD4A 3MZ5A 3S2DB 1PRTC 1S5BD 5AJ3Q 4H02A 1LACA 4OIKA 3GQBA 1AW7A 2K03A 5LL6X 4LUVA 1MJEA 2MJ8A 3KJOA 4KHVA 4IPHA 4ZYSA 4DV0L 4F8MA 2CVRA 2K05A 1B7YB 1XPRA 2Q2UA 1E2ZA 1X9NA 1H9SB 3I4OA 2D0OA 4YCUA 3BZDB 2CW0D 1A63A 2F0GA 4X3KA 1HXYD 4CDEC 3DWQA 3EIVA 1X65A 3HOUG 4DGZA 2F0JA 5FOBB 3B6YA 4JBKA 4LWCA 2JA6G 1T9HA 3GTMH 2H1EA 2K1BA 5CV8A 1FJGQ 3VR6A 3LGJA 1OO9B 2B3GA 2F0MA 2NVYH 5IYBH 1K3RA 3T16A 2C5CA 4POGA 3F1ZA 4DAYB 1U9RA 3H3VH 4TQUS 1ZXTA 3CRKC 4JI6Q 2B2WC 1KQSA 1B3AA 2PZTA 4MZ9A 1TVXA 4MTKA 3PIOA 1KRSA 4DAYA 4KKSA 3AEVA 3MFYA 1SNOA 2AQ3B 4JI8L 1G91A 1UE5A 2QA4A 1CQFA 1E2WA 4IOCA 1TIID 3FKIB 3BYTB 2LXJA 2XIWA 3S1RB 4K14A 3CCEA 3M85A 5DNFA 2J0TD 1RTNA 3A55A 3GTJB 3D4RA 4N9PA 4CDDC 1VQOA 4IUVA 1PTOB 4NXNL 4DV6L 1EOTA 4A3DH 5CYUA 2K33A 5BR8L 1N36Q 1DJRD 2RSOA 3S2DH 1IKLA 1HNWQ 4KHZA 3GTKB 4UDUC 3FMCA 1J9OA 2UXDQ 3DM1A 2FFKB 5LMNQ 3NELA 2VL6A 2R93G 4K6DA 1PTOC 4DV7Q 2F4VL 2Z0SA 5ELCA 2UUAQ 1K83H 2R93H 3RR5A 1ICFB 1TQOA 5JOBA 1LTGD 3S9WA 4KI0A 3I90A 5LL6S 2HDLA 3S16B 5EJWA 4A3MB 4K2LA 3RNUA 3K7UC 4QIWB 4LMQD 1AH9A 3K80C 4HJ8A 2F3WA 2ID0A 2JA9A 3OPOA 1STGA 3NWSA 1IL2A 5IYDH 1WTOA 2EE1A 3JC66 3ER0A 4HIOA 1BR9A 2K14A 4KV6A 2OCEA 4DR4L 1ENCA 4L63B 3F2UA 3OTOQ 1D8LA 4PZ6A 2DNCA 5IIFA 3PUVA 4O0AA 1X3QA 5LMUQ 4LF6Q 3VA7A 2BDOA 1A3VA 4GLXA 1DYQA 2X69A 1U4LA 1A2TA 3K58A 4JV5L 2UXBL 1SNPA 4DK3C 4C3JB 1K8AC 4LUOA 3G4SA 3QG1A 5FLXE 3FDTA 3L3OC 1JJCB 2E5LL 2AUKA 4KD4A 4LW1A 2BH8A 4KJOA 3JAML 2ZM6L 2BDNA 4IFDG 2NZ1D 1Q1EA 2HD3A 4LF7L 2R7ZG 3VYTA 5LMNL 2Y0SE 1NSNS 4X6AH 4K6LA 1Y8OB 1G2TA 1TY2A 1UAPA 3UDIA 5ISRA 5G3LD 1TKWB 2Q8TA 3D4WA 1GVPA 5A35A 3J7A5 3NP8A 4C3JG 1AEXA 3CCLA 2EQSA 1VQGA 1R4PB 1G6ZA 4YCWA 4KHPQ 4RKLA 1PTOD 3HKSA 2IX1A 5L37A 2VUMH 4A3DB 2ZXRA 3R3OA 4PMCA 3S2HB 1F9SA 2VQEQ 1GUGA 2E8GA 3VYSA 5JPNC 4QIWE 3CC4A 5TSSA 4JG2A 3JAMi 4A3IG 1KABA 4OO1H 4HEDA 3TEHB 1V1PB 3N52A 4DAVA 3G6EA 4GKKQ 5I4DA 2R92H 5IGCA 3Q22A 3I4NH 1VQLA 3PO3H 1VQ6A 2QCPX 4A3JH 2ZTEA 3A8IE 5C4XG 4GNXB 4UAIA 1AZQA 3I4MH 1B2TA 1EL0A 3HG9A 2A5HA 3KDFA 4GNXA 1X3PA 1EFWA 2VZAA 4PQXA 2KJXA 1LTTD 5J3BA 5JEAG 3OSOA 1H9RA 1PVOA 4C3HG 2ZJRA 2E2JB 2A6ED 1S5DD 1QZHA 4HIKA 1WYDA 5K36G 1CKNA 4A3BG 2NYZD 1L0WA 3PGZA 2D5DA 2ZM6Q 3RZOB 2F0UA 2A19A 4DK6C 1B50A 1HNWL 1Q46A 4KN7C 4IJLA 3GTQB 1SNQA 3TS0A 1U0LA 1CKNB 1LYLA 4OX9L 5D3DA 3M4YA 2EDGA 4DV6Q 4N8X1 1AE3A 2QKIC 1EY6A 5DEHA 3KLRA 4CJ1B 3IAYA 1YZ6A 2E2HH 3V96A 4RG1A 3DWAA 1Y69U 4IFDI 5IP7G 4FNFA 1PH4A 1VQ9A 2PI2E 4LF8Q 2EY5A 4OO1I 3VR2A 4AQYQ 1PFBA 2LXKA 3M7NA 1SNCA 4F87A 1AP0A 1TS5A 2WAQE 3P7JA 4IPGA 1RIPA 3PF4A 2KA7A 4OWXB 3FVQA 1GD7A 1QNKA 1SLJA 2EIFA 2EYPA 4XT3B 1WCMH 2A69D 2QDBA 4H13C 2WIIB 4CGYB 3MXUA 4B3RQ 4JI7Q 1BDOA 2E5LQ 4JW0A 1O78A 4A4IA 1YNNC 3HOYG 2CHBD 2HUGA 5GROA 5I2YA 4R4OA 4L5RC 1WFQA 1W6JA 2RSNA 3STBD 5M3FB 2F4IA 1G291 3ITPA 2PNHA 3PQIA 1XYIA 3GP7A 1L1OC 4LF5Q 2RQXA 3J7AV 5C0XI 2K5QA 2KUMA 1L0YB 1VQAA 2XSCA 5HGQA 3K0XA 1XMQL 2KCMA 1D6EC 2VB3X 2KCCA 1RKNA 1SYCA 1EIFA 2JA6B 1XMOL 1VQ5A 5CORA 5M3FG 4FO2A 1WTHA 1RODA 4GS3A 1FVIA 2M00A 4OX9Q 1J5EL 1CT1D 4V190 1VQJA 3QOJA 1A6XA 3PV0A 2VNUD 4HMIA 4FF2A 4TSSA 2WAQB 5IOCA 1GUTA 4BY7B 2XWBB 1KLUD 1I4RA 1NR4A 5C4ZA 2I5LX 1O7YA 1I4PA 1VQNA 1GUWA 3NTIA 1CSPA 2Q8IB 4TKOB 1IZ6A 1TWCB 3HOVH 3F2CA 2E2IB 3NEMA 4QY7A 3CMEA 3S1NH 1EZ6A 5J22A 3T53B 4FF1A 1YIJA 5IYDG 3S1MH 5BN3A 1EWHA 4RWSC 2MHVA 4BXXH 1ASYA 3KBXA 4BA2I 5IE8A 1UWVA 4N8FA 1SE8A 3GTGB 1C0AA 1ESFA 1EEID 5CC4A 2MNAA 2SDFA 1FR3A 3NQIA 4K0KL 3BG3A 1MGSA 2D9UA 2X6LA 5FKAC 4OHJA 1QCBD 4UP7A 1V43A 2EYLA 4C3HH 2EVBA 3S17H 4Y7NB 1JCKB 5JJLA 2NZHA 1D5MC 4ALPA 4B3RL 1J8IA 2MP1A 1QZGA 4GOPA 2WINB 4CDFC 3CHBD 2EYOA 1JOKA 1N33L 3J7ZC 1EU3A 1KTKA 1TXYA 4GOPB 1MBYA 2BE5C 1STAA 5IYCG 4TVAB 4FYDA 3K57A 4FXKC 2JA6H 1J6QA 2QW7A 2JA5G 2A74C 5IP7H 5JJIA 1X3GA 1HHVA 1YNXA 2B2VA 1QE6A 4QUFA 1IBLQ 3RN2A 1SFOH 2WV6D 2R7DA 3D3RA 2Z4HA 1I3QH 5C3EB 4DV5L 3I55A 1EYGA 2N8NA 4ZQ3A 3HOXB 2OF1A 2I5HA 4HCSA 3BJUA 1QILA 5EPJA 2CQAA 4J6HA 3ULJA 3HOXH 2JA7G 4X62L 2H4OA 1XTCD 5FO7B 2NN6H 2B63G 3BVZA 3I7FA 1QOHA 5C4JB 2UUCL 3ZJYC 1HZAA 1HNZQ 5ELEA 1HRJA 3K8AA 1PTOF 1HNXL 4RFBA 2I46A 4C3IB 3VR4A 1STHA 3HKZB 4ID6A 4GN3B 4JI1Q 2E75C 1Y1VB 4GN4B 3NENA 3CQZH 2AKWB 3UDGA 3LWEA 4LAAA 1HA5A 4YCVA 4KN4C 1AE2A 2DY7A 1VQPA 3HOZB 3D0FA 2Z1CA 2OEOA 3M4OB 3NPPA 1ICWA 1RHPA 4LUZA 1VQMA 1NJIC 2NVQB 1I5FA 4A3DG 3URYA 1CHPD 3LNNA 1IBMQ 3SK5A 2ZJQA 2VS1A 4DF7A 4IZ8A 1SMYD 4G57A 3K6OA 2ENBA 3PCOB 4DK0A 1WTVA 4G7OC 1WVLA 5ELNA 1QVGA 2ZXOA 3BDLA 1K83B 1S5CD 2R6GA 4A3LG 3HOZG 3S17B 3GTJH 2IY5B 1Y1VH 3K5NA 4EX5A 1TWCH 2K5HA 3HOVB 2Q8RE 3QJYA 4HSVA 4GN5A 4AQYL 2PZWA 1QUQB 3D6CA 1FL0A 1M90C 3CCQA 4DA2A 1D1KA 1D1IA 4QMGA 1VQFA 2NUCA 1PH1A 2N78A 4QCLA 4IURA 1QUQA 3H0GG 4IOAA 1GXDC 2F3IA 4DAPA 1Q8KA 4JCVE 5KEEA 4BBSH 4A3EH 1PZJD 2UXDL 1KD1C 1W6KA 3I4NG 1Y1WG 5E1FA 2KQ3A 3HKZE 2VQFQ 1HR0Q 3CCSA 2PMZB 4DU9A 4A3EG 4JI4L 2NVYB 3J80c 3EFXD 3K81C 3HOWG 2OTJA 1ZYRD 4YWKA 4IFDH 1DGSA 2YTYA 1BO0A 4HIMA 3KOJA 3UE0A 2F3VA 3H0GB 5HGTA 1NNXA 3I72A 1TU2B 1TWAH 1TWGH 5I9PA 2G5DA 2I5MX 1KC8C 5J1ZA 4C3JH 2JYOA 4HCEA 1Y8PB 3NTHA 2R92G 3SVMA 3M9BA 3OIQA 1GOZA 1VF5C 4JPBW 5IGEA 1WD0A 3DLLA 3SGIA 4ODGA 5C3WA 3ONAB 4UHVA 2B2YA 1JWMD 3CCUA 2F0VA 5H1SE 1UE7A 1I4HA 3M7GA 1H95A 3CW2C 4KKUA 2PI2A 1GO3E 1G6PA 4IUNA 4U68A 3TN2A 1N9WA 4JBWA 1K28A 2IW3A 1HPCA 3T1YQ 2A6EC 2LKVA 2KCTA 3QOLA 4XXEA 1EIGA 5DLQE 4B3TL 2R92B 5C3EH 1K0SA 3K7AB 2RCFA 5FO8B 4HR7B 1JWUD 1HFNA 2A73B 5C3XA 3GTOH 1A62A 4RKBA 2YU9B 2ZJPA 1I94L 1UUPA 2M2LA 3PMFA 2K7VA 5EBDA 3PO2H 3WOFA 4OWWB 4R9WA 4DR6Q 4KKTA 1NY4A 4KK7A 4KMUC 4MN3A 4X62Q 4QF4A 4NP5A 1AN8A 2JA8G 4IUTA 2HQEA 1TWHH 3MXNA 4G7ZC 5M5YH 4E6IA 3EA6A 1NTGA 4JI0L 2CWAA 4RHRA 4DNTB 4DR2L 2IPKD 3KLSA 1VQHA 5NUCA 2K75A 4A3BH 3MC0B 4FF4A 2KHIA 4OL7A 1KNEA 4A3GB 4WJWA 4EQOA 3UE1A 4GKJQ 2JP1A 4WRDA 1SROA 1HTPA 1PH8A 1B8AA 4UP8A 1SRUA 2ASBA 1YI2A 2Q2IA 4YY3Q 1Q8IA 2VQFL 3CCRA 3J81i 1QVCA 1SMYC 4C3IG 4QB4A 4AIMA 3NUCA 1P8LA 3P75A 4IPCA 1IW7C 5IY0A 3CCVA 4X3UA 1MJCA 3S15H 1B9NA 2DJGC 5KIXA 5EBCA 1Y1WH 4HTHA 1EOVA 2D2CC 4YWMA 1JJ2A 5KGUA 1Y1WB 2DGYA 5KNBA 1K9MC 2MO1A 2HIXA 4A3EB 5IT9c 4OEMB 3UI2A 3RZDH 2RVLA 4CKEA 2LS01 2Y0SB 2P5ZX 2KHJA 4YIJA 3S2HH 5HY6A 2EY2A 3FHWA 3A0JA 5KNCA 1WTRA 4G7HC 4XIGS 4JC0A 1EEFD 3S14B 4NPSA 4F88A 3CXCA 1YEZA 1LTBD 1IW7D 2B2UC 5C6AA 4P71A 3H15A 3CPWA 1X56A 1YHQA 4L8JA 3HOVG 4BY1G 2LFNA 2CH4W 3A74A 4ABNA 3GTOB 3VYRA 1ENAA 1KL9A 1XXGA 1Z7TA 3BZCA 4BBRG 2DY8A 4BY7G 4A93B 4A3CG 3LWUA 4DV5Q 4H7BA 1PMRA 2NVXH 2EPBA 3CAMA 4DR3Q 4R8NA 1VCIA 3OMGA 4I7AA 3ERQA 1BQQT 3HEJA 4Y52H 3BVMA 2B2WA 4J1MA 1C8CA 4WJ4A 3NBIA 5JAVA 5GADC 1XNRQ 5IT9L 1EFID 1X54A 4ZCKA 4ULLA 1KXLA 4A93G 1XJVA 5T1IA 3OYYA 1PFSA 1KRTA 2HDMA 2A8VA 2IX0A 3X3MA 2LSSA 4RCOA 3HP3A 5IODA 1EY7A 2ZTDA 1OTCA 2WB1G 2EXZA 1JOOA 3JAMc 1E1OA 1SDFA 2XRSD 4X3SA 2XTIA 5M5XB 1ONLA 2JA8H 4EQPA 1NAPA 1MD2D 3I8ZA 4C1NK 4C2MB 1TT2A 3HS0C 4X64Q 4DR1Q 3E5SA 3X3NA 5K36H 4JI3Q 3I3CA 3FP9A 1LT4D 1WOCA 1RL2A 1B70B 4TRDA 2SEBD 1V9PA 3A54A 4YWLA 4ZLTF 1MIUA 4OIJA 4Q0FA 5T1GA 1PV4A 4A3GH 3GTLH 1SMXA 2K5WA 1SJED 5F2DA 1EY4A 1L0XB 5JJZA 1STBA 1ENFA 1MI2A 1QG7A 1BKBA 1Z6HA 4P72A 4N9TA 1B1ZA 4UP9A 3TP7A 4OELB 5EQ0A 2DNEA 3GV6A 1OXUA 4K2KA 2E2IH 3HFZB 1CA6A 4CDCC 5FJ8G 2G9HD 5KRUA 2HIVA 2NN6I 3OOCA 3C1EA 5M3FH 4PMBA 4JI7L 2PPBC 1I3QB 1BOSA 3CMAA 5M3MB 1Q86C 3L7ZC 4RGNA 2O4XA 5CBAE 2HCCA 2WAQG 1LTRD 1F2MA 1LTLA 2AWNA 2VUMG 3W3AA 5M5WB 1L2FA 1UEAB 1JT8A 5G3LF 1WTPA 2K50A 2ATWA 3NHHA 3P20A 4EQ5A 1VQ4A 1O80A 1HCZA 1H9MA 2GN5A 3PUZA 3KLSX 4XQNA 3W1BA 5J39A 3PO2G 4DR7Q 1EY9A 1YVCA 3A5UA 2B2UA 1TY0A 2F0TA 2RDHA 4RAUC 1EQVA 1QJOA 3H0GH 4HJAA 1HFGA 4FF3A 1Q7YC 4XDXA 2NVTH 1JC7A 1SYFA 2NN6G 3C46A 1JE5A 2F0SA 1KAWA 1PH6A 1HJPA 3DHQA 2VW9A 3FPPA 2Q2HA 3CP0A 4I7ZC 2O5JC 2NBFA 1F2ZA 3EQLC 3M4PA 5M5XH 2EYFA 3T56B 5I6YA 4HJ5A 2CQOA 2UUBL 4ZKCB 3PO3G 5HURA 3MVVA 3I56A 2NZOA 3R93A 4CKBA 4A3CH 5FK9C 1VQCA 2AWOA 4JYAQ 3EN2A 1HA6A 1YITA 1KDBA 4DR5L 3DM3A 5E4WC 3H91A 1CQVA 4O42A 1L1OA 2A68D 3J81j 2EXDA 3RMHA 1G51A 2IHFA 2J7ZA 2NVQH 2RKSA 1OXTA 2AHOB 3IKJA 2XWJB 1BCPC 3N6RA 1JMCA 2K52A 1SE4A 4B9XA 4LF5L 2DN8A 2K5VA 1MSHA 3RLOA 2RDFA 1GHJA 1W2BA 2MUYA 1GJXA 4CJ0B 4EQNA 1LM0A 4QGUA 1GM5A 5DM63 3VYUA 1N32L 4NXNQ 2KHSA 3QB3A 4IALA 4RCNA 1AZPA 5C3EG 5M5YB 2FMCA 3F8TA 1II3A 4LF4L 2N88A 4BS9A 3HOXG 1BBUA 2ALYB 4L6TB 2E76C 1HTLD 4IUPA 1E1TA 3FPUB 5CMDA 3TRZA 5JEAJ 1RF2D 1B53A 1WD1A 3K5OA 2K5DA 4DUYL 1PH2A 4V0BA 1HR0L 1I6VC 1RDPD 4UY8C 1FGBD 4NMZA 4C56C 1PTOH 2HQLA 4NKLA 3GO5A 3LX0A 3G7LA 4JYAL 1HR0W 1Y1VG 2R7FA 3KJPA 1VQEA 1LO5D 2A6HD 2D62A 3E0EA 3IRBA 4FVMA 1Q1BA 4DV3L 4QJFA 5M3MG 4O1NA 3I70A 1K3BC 1EUJA 4DV7L 2IWHA 4RA8A 2Z6KC 1TWFH 3C1FA 2AUJD 2ES2A 3NTKA 2FMMA 4DV2L 3RUZA 2LMCB 3T51B 1VDZA 2YTVA 3Q0AA 1PH9A 3TDQA 1M1KC 4P74A 2KEDA 2IT1A 4DXFA 5C0XJ 4DR5Q 1S5FD 2J4XA 4RGMA 3A5ZB 2G9DA 1IYVA 5LMUL 4LF6L 3CU7A 1NR2A 4A3FH 3GTPH 1JQYD 1SYDA 5IGFA 4A3IH 2WACA 1Y8NB 3GTMB 2Z6KA 3IFTA 1U4PA 1KHIA 1X32A 1ET9A 3RLNA 4QQBX 3FRPB 4OWTB 4IFDJ 1PH7A 3KBGA 4LNQA 3HRZC 1NCVA 4AH6A 3I4NB 1KNAA 4XQQA 3PO3B 1I6HH 1STEA 2L0CA 3E0JA 4BY1B 4NDXA 4EVOA 5C44H 1PYBA 2XNAC 2E74C 4OONA 3ND8A 3HOYH 1E22A 3HOWB 4BBRB 3AYHB 3OWEB 3GTPB 4F7XA 1FJGL 1M8AA 1EIHA 2L55A 1I4XA 4JI0Q 3M3YH 1IXRA 4BA1I 1YJ9A 1WI5A 1G2SA 1YBYA 5GAHC 4C1NI 4YHHL 1OXVA 3J80L 4CJ2C 3PO2B 3AFQA 3K0YA 4IO9A 2B2TC 1K8MA 1IBKL 4LFBQ 2YTXA 5CV9A 2XRQD 2PNRC 2QILA 1IBKQ 4A3BB 1HNXQ 3SR1A 5IGGA 2Y0SG 3F2DA 4IJHA 3Q6SA 4GOPC 3H3VI 4K5VA 3NXWA 3R2IA 4PV1C 3SHLA 1D5XC 2EYHA 2QF7A 2ZXPA 4R8IA 4LF7Q 2F0WA 3S14H 2MO0A 3STBC 3WWVA 1EZ8A 4EGVA 4JI2L 1D7QA 1W3SA 1YNND 3GTQH 1F9QA 3KFUA 1F9PA 4A3MG 1EQQA 3U9OA 5FLXL 2K28A 2F0HA 3EBEA 1R9TH 5BN5A 3GV3A 2I07B 1BCPB 1WTQA 4KJNA 1QWYA 1T5XD 2RF4A 3W1GA 3SXHA 4BBSG 2JJQA 1HZCA 3NQTA 2VY3A 3L2PA 2ICEC 2KBNA 2A6HC 3I73A 3MEHA 3VA5A 4LF9L 4HAEA 1H9KA 5BN4A 4MNOA 1SE3A 1A8VA 3U4ZA 1H9SA 3BDOA 3CCJA 3HKZG 1Q12A 4FDBA 1X6OA 5C4XH 4DV0Q 5IWAL 1V1QA 3VDYA 2B39A 1IYUA 3W2DA 5M3MH 1O7LA 4LJZC 1LTSD 2Z6BA 2WB1B 4BY1H 2NVXB 2ICIA 3AFPA 1N34Q 5JEAH 3TQYA 2H5XA 5KYIA 4DUZQ 1EWIA 1LTID 3UDXA 1KIXA 2B8FA 2UXCL 1EY0A 2NB0A 1V8QA 2VUMB 1SXTA 4K5XA 3TSSA 4GLVB 2Z4IA 2EY6A 3U50C 3T1HL 1C7YA 3KK7A 1ZEQX 3A8KE 5E4XA 4DV2Q 1HH2P 4HJ9A 1TS2A 4A3JG 4P75A 1MKHA 4XTCS 2EJMA 4RMFA 3RN5A 2VQEL 1SNDA 2Z8LA 2CWPA
chains in the Genus database with same CATH topology
1YHQA 1XNQL 4IFDI 5IP7G 3HOVG 4BY1G 3CD6A 1OXSC 2MQHA 3A74A 2K5NA 1PH4A 1VQ9A 2PI2E 1KL9A 4LFAQ 3RLFA 1PA6A 4B3SL 3BZCA 4BBRG 4LF8Q 4BY7G 2YV5A 4A3CG 2B29A 4OO1I 4AQYQ 4MTNA 3HOUH 4DV5Q 2LXKA 3M7NA 4A76A 3OW2A 4LF9Q 2NVXH 4DR6L 1JJGA 1K0RA 3CAMA 4DR3Q 2A1AA 1UEBA 4YY3L 4X64L 5GAEC 1VCIA 3T1YL 2WAQE 4IPGA 4DV3Q 3G48A 1RIPA 4A75A 3PF4A 4OWXB 2OQ0A 4Y52H 5JJKA 1GD7A 2EIFA 1SLJA 2JEBI 4NXML 4WJ4A 1WCMH 2JK8A 5GADC 4AYBE 1XNRQ 2UUAL 1X54A 4OXPA 1YJNA 4B3RQ 1KXLA 4JI7Q 4X65Q 3TS2A 4A93G 1XJVA 2E5LQ 4DNIA 1HZBA 3OYYA 4A4IA 3HOYG 1PFSA 5GROA 1KRTA 2HT1A 2A8VA 4R4OA 4L5RC 2IX0A 1WFQA 2LSSA 3STBD 2WFWA 3FKIG 1G291 4GKJL 1O7IA 3W5OA 1Z47A 2PNHA 4POFA 2CFMA 4PZ7A 2ZTDA 1L1OC 2JE6I 1S40A 2UUCQ 1OTCA 4LF5Q 4JI8Q 1CKOA 2WB1G 3JAMc 3T1HQ 5C0XI 1E1OA 1VS0A 1VQIA 1VQAA 2XTIA 4DR2Q 2UU9L 5HGQA 3K0XA 2UUBQ 2JA8H 3NBHB 1XMQL 2KCMA 1I94Q 4DR4Q 2C35B 4DR1Q 4X64Q 2BA0A 4YHHQ 4QL5A 4DUZL 3I2ZA 4JI6L 2DUDA 1EIFA 1XMOL 3E9HA 5FLMH 4R1JA 2JA5H 4JI3Q 3AQQA 1PHJA 1VQ5A 4A3KH 1X3EA 1XNRL 5M3FG 4A93H 3FP9A 4LFCL 1I50H 4UPAA 1WOCA 1RL2A 2FXQA 1B70B 3PUWA 1LUZA 4GS3A 4GNXC 1SN8A 3L0OA 1A0IA 5AJ3L 1FVIA 5ELOA 1N8RC 4OX9Q 2R7ZH 1IBML 1J5EL 1V9PA 1K73C 4YWLA 1N36L 1MIUA 3CC2A 4JBMA 1XMQQ 1Q81C 1VQJA 2JQOA 3PV0A 3OTOL 1PV4A 1X55A 3GTLH 4A3GH 1SMXA 2VNUD 1UE1A 3CC7A 4DV1Q 4DR7L 2QEXA 1PH5A 4JI2Q 3MEFA 2GVAA 3I4MG 1BKBA 2I5LX 4P72A 4GLAC 5IP9G 2QGQA 1VQNA 1NMFA 2PQAA 4UP9A 2OQKA 1CSPA 3BU2A 1OXUA 4A3FG 4R4TA 2E2IH 3HFZB 1VQDA 5FJ8G 1IZ6A 3HOVH 2HIVA 2NN6I 3F2CA 5M3FH 4JI7L 1XNQQ 4A3KG 2BH2A 2PQAB 3NEMA 4QY7A 3CMEA 3S1NH 5FJ8H 3CMAA 1VQKA 1Q86C 3L7ZC 2RCNA 4ME3A 1YIJA 4KLKA 5IYDG 3S1MH 2WAQG 1EQRA 1LTLA 4BXXH 1ASYA 5IWAQ 2AWNA 2N3SA 4Y7NH 2VUMG 4JI5Q 1L2FA 1JT8A 4BA2I 5IE8A 1UWVA 2K50A 4PG3A 1SE8A 4JI5L 4C2MH 2ATWA 1C0AA 1NE3A 1S72A 3GD7A 2UXCQ 2GVBA 4EQ5A 4A3GG 1X3FA 2MNAA 1VQ4A 1QVFA 2GN5A 3PUZA 1ASZA 1U5KA 3FKIH 3W1BA 4LFBL 4K0KL 3PO2G 3U4VA 4DR7Q 4LFCQ 4DR1L 1SR3A 4UP7A 1V43A 1YVCA 2YYZA 4C3HH 1XMOQ 3A5UA 3S17H 1K8GA 4JOIA 1JB7A 4JBJA 5M5WH 5JJLA 2NZHA 1YJWA 1NBWA 4JI4Q 3H0GH 4HJAA 1WCMG 3MXNB 4R4CA 4ALPA 2CKZB 4DR3L 1Q7YC 1QZGA 4GOPA 2B63H 4B3TQ 2NVTH 2NN6G 1JE5A 2OTLA 1N33Q 2JEAI 1KAWA 1PH6A 1HJPA 2VW9A 2BA1A 4DUYQ 1N33L 3J7ZC 5GAGC 1HZ9A 2Q2HA 4HJ7A 3CP0A 4IPDA 4B3MQ 3M4OH 1TXYA 1Q82C 1Y14B 3KF6A 5IYBG 1XPUA 4GOPB 3M4PA 3GDEA 5M5XH 3GTKH 3KDFB 4NB3A 3UDFA 5IYCG 5AJ3Q 2CQOA 4HJ5A 2UUBL 1C9OA 4H02A 4TVAB 3I56A 3PO3G 2NZOA 4A3CH 4A3LH 3KF6B 4BY7H 5C0XG 3S1QH 1VQCA 2AWOA 2D0PA 4JYAQ 2JA6H 3EN2A 1J6QA 3GTGH 2JA5G 5IP7H 1YITA 1X3GA 4LUVA 4DR5L 3DM3A 5C44G 1MJEA 5JJIA 1OXXK 1YNXA 1PH3A 3KJOA 4DV0L 1GKHA 4IPHA 1VQ7A 1IBLQ 1L1OA 1B7YB 1XPRA 2Q2UA 3RN2A 3J81j 2OWOA 2EXDA 5IYCH 1SFOH 2R7DA 1X9NA 1G51A 2IHFA 2UXDL 1I3QH 2NVQH 4DV5L 1OXTA 3I55A 1EYGA 2AHOB 3I4OA 2N8NA 5BR8Q 2D0OA 4YCUA 2I5HA 3BJUA 1JMCA 1A63A 3ULJA 3HOXH 4DV1L 2JA7G 4X62L 2K52A 2B63G 4JOIC 3I7FA 4PMWA 2UUCL 4LF5L 3EIVA 2K5VA 1X65A 3HOUG 3RLOA 3ZJYC 1HZAA 1HNZQ 1W2BA 3K8AA 2MFIA 3CPWA 3B6YA 4JBKA 4LWCA 1IYJB 4AYBG 1HNXL 1LM0A 1BBWA 1T9HA 1E24A 4QGUA 1GM5A 2JA6G 3E9IA 3GTMH 4KHPL 4GN3B 4JI1Q 1FJGQ 2F4VQ 4GN4B 4NXNQ 1N32L 3NENA 1J5EQ 3CQZH 2AKWB 5GQOA 3UDGA 1N34L 3LGJA 4R4IA 5C3EG 2B3GA 3F8TA 4YCVA 2NVYH 3PUYA 4LF4L 1AE2A 1VQPA 2JA7H 3HOXG 5IYBH 3D0FA 1K3RA 1BBUA 2ALYB 3F1ZA 2K4KA 4DAYB 3PIPA 4DV4L 4POGA 3TRZA 1E1TA 3H3VH 2Q2TA 4LUZA 4TQUS 5JEAJ 3TREA 4DV4Q 1VQMA 1NJIC 4JI6Q 2ZTCA 1I5FA 4A3DG 1KQSA 1IBLL 4DUYL 4MZ9A 1PH2A 1IBMQ 3PIOA 2ZJQA 2VS1A 1KRSA 1HR0L 3AEVA 2UU9Q 4JI8L 4UY8C 4BBRH 1UE5A 2QA4A 2HQLA 3PCOB 3GO5A 4JYAL 1HR0W 4IOCA 1Y1VG 2R7FA 5ELNA 3KJPA 3M4QA 1QVGA 1VQEA 3HOZH 1HNZL 2D62A 2LXJA 3E0EA 3IRBA 2R6GA 4A3LG 1Q1BA 3HOZG 4DV3L 4OO1G 3GTJH 2IY5B 1Y1VH 2UXBQ 4QJFA 3CCEA 3M85A 5M3MG 3KF8B 4EX5A 1TWCH 2AMCB 2K5HA 1EUJA 4DV7L 1WJJA 4GN5A 2Z6KC 1TWFH 4AQYL 1VQOA 1QUQB 2ES2A 4NXNL 1FL0A 4DV2L 4DV6L 1M90C 4A3DH 3CCQA 3S24A 5BR8L 2YTVA 1PH9A 1X56A 5C4JH 1PH1A 1N36Q 1VQFA 4P74A 1M1KC 2N78A 2IT1A 1NMGA 1QUQA 5C0XJ 3H0GG 4DR5Q 3J80i 3HOWH 3S2DH 2F3IA 4IOAA 1HNWQ 4KHZA 1EIYB 3A5ZB 1Q8KA 4JCVE 4BBSH 2UXDQ 4A3EH 5LMNQ 3NELA 2VL6A 5LMUL 4X66Q 4LF6L 4DV7Q 1KD1C 2R93G 2F4VL 2Z0SA 1N32Q 3I4NG 1VQBA 2UUAQ 1Y1WG 3HKZE 2VQFQ 1K83H 4X66L 3RR5A 4A3FH 3CPFA 1HR0Q 3GTPH 3CCSA 2R93H 4A3EG 4JI4L 4O2DA 4KI0A 5FLMG 2YU9H 4A3IH 3J80c 5IP9H 3K81C 3U58A 3HOWG 4C3IH 2L15A 2OTJA 4YWKA 2Z6KA 3S16H 1DGSA 3ERSX 2YTYA 3K7UC 1KHIA 3K7AH 3RNUA 4A3MH 3CF5A 4HIMA 3KOJA 2HHHL 3UE0A 1AH9A 3K80C 4HJ8A 2I0QA 1CSQA 4LF8L 2JA9A 2ID0A 2HHHQ 3RLNA 4QQBX 4OWTB 1CKMA 4IFDJ 1PH7A 4L5QA 4LNQA 1TWAH 4DKAC 1TWGH 4B3SQ 1IL2A 5IYDH 2I5MX 3ER0A 3JC66 4AH6A 4HIOA 1KC8C 4C3JH 2K14A 2OCEA 2WB1E 4DR4L 1I6HH 4APVA 2R92G 4GKKL 1E3PA 4PZ8A 5C44H 3M9BA 3OTOQ 1Z9FA 1PYBA 1D8LA 3DLLA 4OONA 3HOYH 4PZ6A 3ULLA 1YHBA 3SGIA 3PUVA 1E22A 4O0AA 5LMUQ 4R4QA 4LF6Q 4L5SA 2XGTA 3AYHB 4GLXA 2RHQB 3CCUA 1FJGL 5H1SE 1UE7A 4JI0Q 3M3YH 4JV5L 2UXBL 1XTDA 1IXRA 1H95A 4BA1I 1YJ9A 1WI5A 3CW2C 4DK3C 2PI2A 1GO3E 4WJ3M 1YBYA 1G6PA 5GAHC 1K8AC 4YHHL 4L5TA 4LUOA 3G4SA 1N9WA 1OXVA 4JBWA 5EAYA 3AFQA 4IO9A 1JJCB 3T1YQ 2E5LL 4LW1A 2BH8A 2ZM6L 2KCTA 3G71A 1IBKL 4B3ML 5DLQE 4B3TL 2YTXA 4IFDG 1Q1EA 5C3EH 4B3RL 4LFBQ 4LF7L 4LFAL 1IBKQ 2R7ZG 5LMNL 2Y0SE 1HNXQ 4X6AH 2Y0SG 3F2DA 4IJHA 3F2BA 3GTOH 3UDIA 4GOPC 3H3VI 1A62A 3D31A 2ZJPA 1I94L 4RG1A 1CUKA 1GVPA 4OWWB 3PO2H 3J7A5 1S3OA 4DR6Q 1NY4A 2CCZA 4X62Q 3CCLA 2EQSA 2JA8G 4NXMQ 1VQGA 4LF7Q 3S14H 4K0KQ 1TWHH 2MO0A 2V1CC 3KLWA 4YCWA 3STBC 3WWVA 4JI2L 4KHPQ 1D7QA 1W3SA 3HKSA 5M5YH 2IX1A 2VUMH 3GTQH 3KFUA 1NTGA 4JI0L 4JV5Q 2CWAA 4A3MG 1EQQA 4DR2L 3KYHC 2VQEQ 1YHAA 2E8GA 1VQHA 4QIWE 3CC4A 2K75A 4JG2A 3JAMi 4A3IG 4A3BH 4LF4Q 3EBEA 1R9TH 1UE6A 3TEHB 2KHIA 3G6EA 4GKKQ 2R92H 3UE1A 4JI3L 4GKJQ 3I4NH 3PF5A 1SROA 2PMZE 1PH8A 1VQLA 1B8AA 3PSIA 4UP8A 3PO3H 5LMNW 1FGUA 2RF4A 1VQ6A 1SRUA 3W1GA 4A3JH 2ZTEA 4J15A 2JJQA 2ASBA 1YI2A 1HZCA 4BBSG 4GNXB 2Q2IA 5C4XG 2VY3A 3L2PA 4YY3Q 3S1RH 3ICEA 2VQFL 2KBNA 3I4MH 1XPOA 4LF9L 3CCRA 4MNOA 3J81i 1QVCA 3KDFA 4GNXA 1A8VA 3U4ZA 4HIDA 1EFWA 2VZAA 3CCMA 4AIMA 3CCJA 3HKZG 1P8LA 1Q12A 1BVSA 4FDBA 4IPCA 3ULPA 5IY0A 1X6OA 4P73A 5C4XH 4DV0Q 5IWAL 1V1QA 3CCVA 5J3BA 3VDYA 1E7ZA 5M3MH 2RHSB 5JEAG 1MJCA 3S15H 1PYSB 1Y1WH 1PVOA 1EOVA 2ZJRA 4BY1H 3PUXA 3AFPA 4YWMA 1L1OB 1N34Q 1JJ2A 4X65L 1QZHA 2DGYA 2F52A 5FLXc 4HIKA 3Q8DA 1K9MC 2MO1A 2HIXA 2E2JH 1WYDA 2IHEA 3TQYA 2H5XA 5IT9c 1CKNA 5K36G 4DUZQ 3RZDH 4A3BG 1L0WA 3PGZA 2ZM6Q 1EWIA 5E7NA 3UDXA 1KIXA 2N49A 2UXCL 2WP8J 3BZKA 2A19A 4DK6C 4DAMA 3RZOH 1HNWL 1Q46A 4DPGA 4IJLA 3TS0A 1U0LA 2KHJA 4GLVB 1CKNB 1LYLA 4BXXG 3U50C 4OX9L 5HY6A 3T1HL 1C7YA 3FHWA 3J81c 3S2HH 3A0JA 4DV2Q 4DV6Q 1HH2P 4JI1L 1P16A 2KENA 4HJ9A 4XIGS 4JC0A 1VQ8A 4A3JG 1AE3A 4P75A 1MKHA 4XTCS 4NPSA 4RMFA 3CXCA 1YEZA 1YZ6A 2E2HH 3RN5A 2VQEL 4P71A 3H15A 2CWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ A;  1XNQ L;  4IFD I;  5IP7 G;  3HOV G;  4BY1 G;  3CD6 A;  1OXS C;  2MQH A;  3A74 A;  2K5N A;  1PH4 A;  1VQ9 A;  2PI2 E;  1KL9 A;  4LFA Q;  3RLF A;  1PA6 A;  4B3S L;  3BZC A;  4BBR G;  4LF8 Q;  4BY7 G;  2YV5 A;  4A3C G;  2B29 A;  4OO1 I;  4AQY Q;  4MTN A;  3HOU H;  4DV5 Q;  2LXK A;  3M7N A;  4A76 A;  3OW2 A;  4LF9 Q;  2NVX H;  4DR6 L;  1JJG A;  1K0R A;  3CAM A;  4DR3 Q;  2A1A A;  1UEB A;  4YY3 L;  4X64 L;  5GAE C;  1VCI A;  3T1Y L;  2WAQ E;  4IPG A;  4DV3 Q;  3G48 A;  1RIP A;  4A75 A;  3PF4 A;  4OWX B;  2OQ0 A;  4Y52 H;  5JJK A;  1GD7 A;  2EIF A;  1SLJ A;  2JEB I;  4NXM L;  4WJ4 A;  1WCM H;  2JK8 A;  5GAD C;  4AYB E;  1XNR Q;  2UUA L;  1X54 A;  4OXP A;  1YJN A;  4B3R Q;  1KXL A;  4JI7 Q;  4X65 Q;  3TS2 A;  4A93 G;  1XJV A;  2E5L Q;  4DNI A;  1HZB A;  3OYY A;  4A4I A;  3HOY G;  1PFS A;  5GRO A;  1KRT A;  2HT1 A;  2A8V A;  4R4O A;  4L5R C;  2IX0 A;  1WFQ A;  2LSS A;  3STB D;  2WFW A;  3FKI G;  1G29 1;  4GKJ L;  1O7I A;  3W5O A;  1Z47 A;  2PNH A;  4POF A;  2CFM A;  4PZ7 A;  2ZTD A;  1L1O C;  2JE6 I;  1S40 A;  2UUC Q;  1OTC A;  4LF5 Q;  4JI8 Q;  1CKO A;  2WB1 G;  3JAM c;  3T1H Q;  5C0X I;  1E1O A;  1VS0 A;  1VQI A;  1VQA A;  2XTI A;  4DR2 Q;  2UU9 L;  5HGQ A;  3K0X A;  2UUB Q;  2JA8 H;  3NBH B;  1XMQ L;  2KCM A;  1I94 Q;  4DR4 Q;  2C35 B;  4DR1 Q;  4X64 Q;  2BA0 A;  4YHH Q;  4QL5 A;  4DUZ L;  3I2Z A;  4JI6 L;  2DUD A;  1EIF A;  1XMO L;  3E9H A;  5FLM H;  4R1J A;  2JA5 H;  4JI3 Q;  3AQQ A;  1PHJ A;  1VQ5 A;  4A3K H;  1X3E A;  1XNR L;  5M3F G;  4A93 H;  3FP9 A;  4LFC L;  1I50 H;  4UPA A;  1WOC A;  1RL2 A;  2FXQ A;  1B70 B;  3PUW A;  1LUZ A;  4GS3 A;  4GNX C;  1SN8 A;  3L0O A;  1A0I A;  5AJ3 L;  1FVI A;  5ELO A;  1N8R C;  4OX9 Q;  2R7Z H;  1IBM L;  1J5E L;  1V9P A;  1K73 C;  4YWL A;  1N36 L;  1MIU A;  3CC2 A;  4JBM A;  1XMQ Q;  1Q81 C;  1VQJ A;  2JQO A;  3PV0 A;  3OTO L;  1PV4 A;  1X55 A;  3GTL H;  4A3G H;  1SMX A;  2VNU D;  1UE1 A;  3CC7 A;  4DV1 Q;  4DR7 L;  2QEX A;  1PH5 A;  4JI2 Q;  3MEF A;  2GVA A;  3I4M G;  1BKB A;  2I5L X;  4P72 A;  4GLA C;  5IP9 G;  2QGQ A;  1VQN A;  1NMF A;  2PQA A;  4UP9 A;  2OQK A;  1CSP A;  3BU2 A;  1OXU A;  4A3F G;  4R4T A;  2E2I H;  3HFZ B;  1VQD A;  5FJ8 G;  1IZ6 A;  3HOV H;  2HIV A;  2NN6 I;  3F2C A;  5M3F H;  4JI7 L;  1XNQ Q;  4A3K G;  2BH2 A;  2PQA B;  3NEM A;  4QY7 A;  3CME A;  3S1N H;  5FJ8 H;  3CMA A;  1VQK A;  1Q86 C;  3L7Z C;  2RCN A;  4ME3 A;  1YIJ A;  4KLK A;  5IYD G;  3S1M H;  2WAQ G;  1EQR A;  1LTL A;  4BXX H;  1ASY A;  5IWA Q;  2AWN A;  2N3S A;  4Y7N H;  2VUM G;  4JI5 Q;  1L2F A;  1JT8 A;  4BA2 I;  5IE8 A;  1UWV A;  2K50 A;  4PG3 A;  1SE8 A;  4JI5 L;  4C2M H;  2ATW A;  1C0A A;  1NE3 A;  1S72 A;  3GD7 A;  2UXC Q;  2GVB A;  4EQ5 A;  4A3G G;  1X3F A;  2MNA A;  1VQ4 A;  1QVF A;  2GN5 A;  3PUZ A;  1ASZ A;  1U5K A;  3FKI H;  3W1B A;  4LFB L;  4K0K L;  3PO2 G;  3U4V A;  4DR7 Q;  4LFC Q;  4DR1 L;  1SR3 A;  4UP7 A;  1V43 A;  1YVC A;  2YYZ A;  4C3H H;  1XMO Q;  3A5U A;  3S17 H;  1K8G A;  4JOI A;  1JB7 A;  4JBJ A;  5M5W H;  5JJL A;  2NZH A;  1YJW A;  1NBW A;  4JI4 Q;  3H0G H;  4HJA A;  1WCM G;  3MXN B;  4R4C A;  4ALP A;  2CKZ B;  4DR3 L;  1Q7Y C;  1QZG A;  4GOP A;  2B63 H;  4B3T Q;  2NVT H;  2NN6 G;  1JE5 A;  2OTL A;  1N33 Q;  2JEA I;  1KAW A;  1PH6 A;  1HJP A;  2VW9 A;  2BA1 A;  4DUY Q;  1N33 L;  3J7Z C;  5GAG C;  1HZ9 A;  2Q2H A;  4HJ7 A;  3CP0 A;  4IPD A;  4B3M Q;  3M4O H;  1TXY A;  1Q82 C;  1Y14 B;  3KF6 A;  5IYB G;  1XPU A;  4GOP B;  3M4P A;  3GDE A;  5M5X H;  3GTK H;  3KDF B;  4NB3 A;  3UDF A;  5IYC G;  5AJ3 Q;  2CQO A;  4HJ5 A;  2UUB L;  1C9O A;  4H02 A;  4TVA B;  3I56 A;  3PO3 G;  2NZO A;  4A3C H;  4A3L H;  3KF6 B;  4BY7 H;  5C0X G;  3S1Q H;  1VQC A;  2AWO A;  2D0P A;  4JYA Q;  2JA6 H;  3EN2 A;  1J6Q A;  3GTG H;  2JA5 G;  5IP7 H;  1YIT A;  1X3G A;  4LUV A;  4DR5 L;  3DM3 A;  5C44 G;  1MJE A;  5JJI A;  1OXX K;  1YNX A;  1PH3 A;  3KJO A;  4DV0 L;  1GKH A;  4IPH A;  1VQ7 A;  1IBL Q;  1L1O A;  1B7Y B;  1XPR A;  2Q2U A;  3RN2 A;  3J81 j;  2OWO A;  2EXD A;  5IYC H;  1SFO H;  2R7D A;  1X9N A;  1G51 A;  2IHF A;  2UXD L;  1I3Q H;  2NVQ H;  4DV5 L;  1OXT A;  3I55 A;  1EYG A;  2AHO B;  3I4O A;  2N8N A;  5BR8 Q;  2D0O A;  4YCU A;  2I5H A;  3BJU A;  1JMC A;  1A63 A;  3ULJ A;  3HOX H;  4DV1 L;  2JA7 G;  4X62 L;  2K52 A;  2B63 G;  4JOI C;  3I7F A;  4PMW A;  2UUC L;  4LF5 L;  3EIV A;  2K5V A;  1X65 A;  3HOU G;  3RLO A;  3ZJY C;  1HZA A;  1HNZ Q;  1W2B A;  3K8A A;  2MFI A;  3CPW A;  3B6Y A;  4JBK A;  4LWC A;  1IYJ B;  4AYB G;  1HNX L;  1LM0 A;  1BBW A;  1T9H A;  1E24 A;  4QGU A;  1GM5 A;  2JA6 G;  3E9I A;  3GTM H;  4KHP L;  4GN3 B;  4JI1 Q;  1FJG Q;  2F4V Q;  4GN4 B;  4NXN Q;  1N32 L;  3NEN A;  1J5E Q;  3CQZ H;  2AKW B;  5GQO A;  3UDG A;  1N34 L;  3LGJ A;  4R4I A;  5C3E G;  2B3G A;  3F8T A;  4YCV A;  2NVY H;  3PUY A;  4LF4 L;  1AE2 A;  1VQP A;  2JA7 H;  3HOX G;  5IYB H;  3D0F A;  1K3R A;  1BBU A;  2ALY B;  3F1Z A;  2K4K A;  4DAY B;  3PIP A;  4DV4 L;  4POG A;  3TRZ A;  1E1T A;  3H3V H;  2Q2T A;  4LUZ A;  4TQU S;  5JEA J;  3TRE A;  4DV4 Q;  1VQM A;  1NJI C;  4JI6 Q;  2ZTC A;  1I5F A;  4A3D G;  1KQS A;  1IBL L;  4DUY L;  4MZ9 A;  1PH2 A;  1IBM Q;  3PIO A;  2ZJQ A;  2VS1 A;  1KRS A;  1HR0 L;  3AEV A;  2UU9 Q;  4JI8 L;  4UY8 C;  4BBR H;  1UE5 A;  2QA4 A;  2HQL A;  3PCO B;  3GO5 A;  4JYA L;  1HR0 W;  4IOC A;  1Y1V G;  2R7F A;  5ELN A;  3KJP A;  3M4Q A;  1QVG A;  1VQE A;  3HOZ H;  1HNZ L;  2D62 A;  2LXJ A;  3E0E A;  3IRB A;  2R6G A;  4A3L G;  1Q1B A;  3HOZ G;  4DV3 L;  4OO1 G;  3GTJ H;  2IY5 B;  1Y1V H;  2UXB Q;  4QJF A;  3CCE A;  3M85 A;  5M3M G;  3KF8 B;  4EX5 A;  1TWC H;  2AMC B;  2K5H A;  1EUJ A;  4DV7 L;  1WJJ A;  4GN5 A;  2Z6K C;  1TWF H;  4AQY L;  1VQO A;  1QUQ B;  2ES2 A;  4NXN L;  1FL0 A;  4DV2 L;  4DV6 L;  1M90 C;  4A3D H;  3CCQ A;  3S24 A;  5BR8 L;  2YTV A;  1PH9 A;  1X56 A;  5C4J H;  1PH1 A;  1N36 Q;  1VQF A;  4P74 A;  1M1K C;  2N78 A;  2IT1 A;  1NMG A;  1QUQ A;  5C0X J;  3H0G G;  4DR5 Q;  3J80 i;  3HOW H;  3S2D H;  2F3I A;  4IOA A;  1HNW Q;  4KHZ A;  1EIY B;  3A5Z B;  1Q8K A;  4JCV E;  4BBS H;  2UXD Q;  4A3E H;  5LMN Q;  3NEL A;  2VL6 A;  5LMU L;  4X66 Q;  4LF6 L;  4DV7 Q;  1KD1 C;  2R93 G;  2F4V L;  2Z0S A;  1N32 Q;  3I4N G;  1VQB A;  2UUA Q;  1Y1W G;  3HKZ E;  2VQF Q;  1K83 H;  4X66 L;  3RR5 A;  4A3F H;  3CPF A;  1HR0 Q;  3GTP H;  3CCS A;  2R93 H;  4A3E G;  4JI4 L;  4O2D A;  4KI0 A;  5FLM G;  2YU9 H;  4A3I H;  3J80 c;  5IP9 H;  3K81 C;  3U58 A;  3HOW G;  4C3I H;  2L15 A;  2OTJ A;  4YWK A;  2Z6K A;  3S16 H;  1DGS A;  3ERS X;  2YTY A;  3K7U C;  1KHI A;  3K7A H;  3RNU A;  4A3M H;  3CF5 A;  4HIM A;  3KOJ A;  2HHH L;  3UE0 A;  1AH9 A;  3K80 C;  4HJ8 A;  2I0Q A;  1CSQ A;  4LF8 L;  2JA9 A;  2ID0 A;  2HHH Q;  3RLN A;  4QQB X;  4OWT B;  1CKM A;  4IFD J;  1PH7 A;  4L5Q A;  4LNQ A;  1TWA H;  4DKA C;  1TWG H;  4B3S Q;  1IL2 A;  5IYD H;  2I5M X;  3ER0 A;  3JC6 6;  4AH6 A;  4HIO A;  1KC8 C;  4C3J H;  2K14 A;  2OCE A;  2WB1 E;  4DR4 L;  1I6H H;  4APV A;  2R92 G;  4GKK L;  1E3P A;  4PZ8 A;  5C44 H;  3M9B A;  3OTO Q;  1Z9F A;  1PYB A;  1D8L A;  3DLL A;  4OON A;  3HOY H;  4PZ6 A;  3ULL A;  1YHB A;  3SGI A;  3PUV A;  1E22 A;  4O0A A;  5LMU Q;  4R4Q A;  4LF6 Q;  4L5S A;  2XGT A;  3AYH B;  4GLX A;  2RHQ B;  3CCU A;  1FJG L;  5H1S E;  1UE7 A;  4JI0 Q;  3M3Y H;  4JV5 L;  2UXB L;  1XTD A;  1IXR A;  1H95 A;  4BA1 I;  1YJ9 A;  1WI5 A;  3CW2 C;  4DK3 C;  2PI2 A;  1GO3 E;  4WJ3 M;  1YBY A;  1G6P A;  5GAH C;  1K8A C;  4YHH L;  4L5T A;  4LUO A;  3G4S A;  1N9W A;  1OXV A;  4JBW A;  5EAY A;  3AFQ A;  4IO9 A;  1JJC B;  3T1Y Q;  2E5L L;  4LW1 A;  2BH8 A;  2ZM6 L;  2KCT A;  3G71 A;  1IBK L;  4B3M L;  5DLQ E;  4B3T L;  2YTX A;  4IFD G;  1Q1E A;  5C3E H;  4B3R L;  4LFB Q;  4LF7 L;  4LFA L;  1IBK Q;  2R7Z G;  5LMN L;  2Y0S E;  1HNX Q;  4X6A H;  2Y0S G;  3F2D A;  4IJH A;  3F2B A;  3GTO H;  3UDI A;  4GOP C;  3H3V I;  1A62 A;  3D31 A;  2ZJP A;  1I94 L;  4RG1 A;  1CUK A;  1GVP A;  4OWW B;  3PO2 H;  3J7A 5;  1S3O A;  4DR6 Q;  1NY4 A;  2CCZ A;  4X62 Q;  3CCL A;  2EQS A;  2JA8 G;  4NXM Q;  1VQG A;  4LF7 Q;  3S14 H;  4K0K Q;  1TWH H;  2MO0 A;  2V1C C;  3KLW A;  4YCW A;  3STB C;  3WWV A;  4JI2 L;  4KHP Q;  1D7Q A;  1W3S A;  3HKS A;  5M5Y H;  2IX1 A;  2VUM H;  3GTQ H;  3KFU A;  1NTG A;  4JI0 L;  4JV5 Q;  2CWA A;  4A3M G;  1EQQ A;  4DR2 L;  3KYH C;  2VQE Q;  1YHA A;  2E8G A;  1VQH A;  4QIW E;  3CC4 A;  2K75 A;  4JG2 A;  3JAM i;  4A3I G;  4A3B H;  4LF4 Q;  3EBE A;  1R9T H;  1UE6 A;  3TEH B;  2KHI A;  3G6E A;  4GKK Q;  2R92 H;  3UE1 A;  4JI3 L;  4GKJ Q;  3I4N H;  3PF5 A;  1SRO A;  2PMZ E;  1PH8 A;  1VQL A;  1B8A A;  3PSI A;  4UP8 A;  3PO3 H;  5LMN W;  1FGU A;  2RF4 A;  1VQ6 A;  1SRU A;  3W1G A;  4A3J H;  2ZTE A;  4J15 A;  2JJQ A;  2ASB A;  1YI2 A;  1HZC A;  4BBS G;  4GNX B;  2Q2I A;  5C4X G;  2VY3 A;  3L2P A;  4YY3 Q;  3S1R H;  3ICE A;  2VQF L;  2KBN A;  3I4M H;  1XPO A;  4LF9 L;  3CCR A;  4MNO A;  3J81 i;  1QVC A;  3KDF A;  4GNX A;  1A8V A;  3U4Z A;  4HID A;  1EFW A;  2VZA A;  3CCM A;  4AIM A;  3CCJ A;  3HKZ G;  1P8L A;  1Q12 A;  1BVS A;  4FDB A;  4IPC A;  3ULP A;  5IY0 A;  1X6O A;  4P73 A;  5C4X H;  4DV0 Q;  5IWA L;  1V1Q A;  3CCV A;  5J3B A;  3VDY A;  1E7Z A;  5M3M H;  2RHS B;  5JEA G;  1MJC A;  3S15 H;  1PYS B;  1Y1W H;  1PVO A;  1EOV A;  2ZJR A;  4BY1 H;  3PUX A;  3AFP A;  4YWM A;  1L1O B;  1N34 Q;  1JJ2 A;  4X65 L;  1QZH A;  2DGY A;  2F52 A;  5FLX c;  4HIK A;  3Q8D A;  1K9M C;  2MO1 A;  2HIX A;  2E2J H;  1WYD A;  2IHE A;  3TQY A;  2H5X A;  5IT9 c;  1CKN A;  5K36 G;  4DUZ Q;  3RZD H;  4A3B G;  1L0W A;  3PGZ A;  2ZM6 Q;  1EWI A;  5E7N A;  3UDX A;  1KIX A;  2N49 A;  2UXC L;  2WP8 J;  3BZK A;  2A19 A;  4DK6 C;  4DAM A;  3RZO H;  1HNW L;  1Q46 A;  4DPG A;  4IJL A;  3TS0 A;  1U0L A;  2KHJ A;  4GLV B;  1CKN B;  1LYL A;  4BXX G;  3U50 C;  4OX9 L;  5HY6 A;  3T1H L;  1C7Y A;  3FHW A;  3J81 c;  3S2H H;  3A0J A;  4DV2 Q;  4DV6 Q;  1HH2 P;  4JI1 L;  1P16 A;  2KEN A;  4HJ9 A;  4XIG S;  4JC0 A;  1VQ8 A;  4A3J G;  1AE3 A;  4P75 A;  1MKH A;  4XTC S;  4NPS A;  4RMF A;  3CXC A;  1YEZ A;  1YZ6 A;  2E2H H;  3RN5 A;  2VQE L;  4P71 A;  3H15 A;  2CWP A; 
#chains in the Genus database with same CATH topology
 4B08 A;  2F0Q A;  3C2P A;  2GA4 B;  2K5N A;  4I65 A;  3RLF A;  4XT1 B;  3HOU B;  1B44 D;  1CTM A;  2B29 A;  3HOU H;  3E6Z X;  1PFM A;  2L9H A;  3QR8 A;  3OW2 A;  2F0L A;  2IJ0 A;  3J7Y W;  1K0R A;  2CH4 A;  2F1M A;  1DCZ A;  1UEB A;  4YY3 L;  1DOK A;  4X64 L;  3MA2 B;  5GAE C;  3T1Y L;  3G48 A;  1DM0 B;  2OQ0 A;  1EY8 A;  2NWG A;  1I4G A;  2JEB I;  3MTS A;  4HN7 A;  4NXM L;  3S15 B;  5CV7 A;  2JN4 A;  4CHT B;  2UUA L;  1B9M A;  1JB3 A;  2EYJ A;  1EYA A;  1DXM A;  1HZB A;  2HT1 A;  1CK1 A;  1CFM A;  2WKD A;  2E2H B;  4FXG C;  2R61 A;  1O7Z A;  3W5O A;  1Z47 A;  1PLF A;  4POF A;  4JI8 Q;  1CKO A;  4H0L C;  3T1H Q;  1JOR A;  2L12 A;  1CZG A;  4IQZ A;  2UU9 L;  2UUB Q;  1BBX C;  3NBH B;  2VB2 X;  3OHX C;  3V05 A;  1I94 Q;  1EY5 A;  4DR4 Q;  2JXM B;  3O13 A;  2BA0 A;  4KY7 A;  3TME A;  3DEP A;  4YHH Q;  3I2Z A;  4DUZ L;  4K8I A;  1JOQ A;  3E9H A;  2PQE A;  3NBH A;  1PHJ A;  1CA5 A;  4A3K H;  2XVS A;  1KLG D;  4A93 H;  1M4V A;  2FXQ A;  3PUW A;  4DXG A;  1SN8 A;  3L0O A;  1WTW A;  2R7Z H;  1K73 C;  4P2C B;  1N36 L;  3AU7 A;  1AFP A;  2JQO A;  3OTO L;  1IHZ A;  1X55 A;  5JVH 3;  1UE1 A;  3CC7 A;  4DR7 L;  1LT6 D;  2F0D A;  3MXG A;  2QEX A;  2JA5 B;  4JI2 Q;  4S3S A;  3MEF A;  1V1O A;  3I4M G;  4CKC A;  1MSG A;  2O2L D;  2OQK A;  2RDG A;  4A3F G;  1DD2 A;  1BUV T;  3V2T A;  4R4T A;  3NWT A;  4WOR A;  1XNQ Q;  4A3K G;  5FO9 B;  2BH2 A;  1A2U A;  2PCF B;  4G4K A;  1VQK A;  2RCN A;  4ME3 A;  4KLK A;  2JA7 B;  4ZUJ A;  2RA4 A;  1DOM A;  5EKI A;  1EQR A;  3BS1 A;  1MHW C;  2N3S A;  4Y7N H;  4JI5 Q;  2L11 A;  4KY5 A;  2BCO A;  1VMP A;  4KTA A;  4ZK9 B;  4PG3 A;  3NK9 A;  1S72 A;  4A3G G;  3AMU A;  3S1N B;  3SK4 A;  1Q3L A;  2VXW A;  4U67 3;  1ASZ A;  2L4N A;  3U4V A;  3Q24 A;  3BYY B;  4DR1 L;  1SFO B;  1SR3 A;  1KAA A;  1XMO Q;  4KY6 A;  1K8G A;  2PO4 A;  4PNY A;  1JB7 A;  3SK6 A;  1RCV D;  1V1P A;  5A2Q L;  1WCM G;  1FYC A;  3MXN B;  1A15 A;  4IUU A;  4DR3 L;  3EVQ A;  2JEA I;  5GAG C;  1HZ9 A;  1WTX A;  4IPD A;  4B3M Q;  3DUZ A;  3TZD A;  5D65 A;  1Y14 B;  3KF6 A;  5IYB G;  1FNV A;  4OGQ C;  1GUS A;  3GDE A;  3QO2 A;  1ZKO A;  3GTK H;  3KDF B;  4NB3 A;  2K32 A;  1E0B A;  3UDF A;  1C9O A;  1H9J A;  2F03 A;  2B8G A;  3KF6 B;  4BY7 H;  4A3L H;  5C0X G;  3S1Q H;  2KEC A;  2D0P A;  3QIA A;  1CI3 M;  1BNZ A;  3GTG H;  1HUN A;  1D2B A;  1DOL A;  5C44 G;  3S1M B;  3MWY W;  1OXX K;  2EY1 A;  4XQJ A;  1PXU A;  2WKC A;  1PH3 A;  1GKH A;  1VQ7 A;  4K5W A;  5CBE E;  5KND A;  2OWO A;  4ILW A;  5IYC H;  1YNJ C;  1FNU A;  4HSP A;  5BR8 Q;  2RBM A;  2FIN B;  3CQZ B;  1VMC A;  2EYM A;  4DV1 L;  4JOI C;  4ZKB B;  4PMW A;  3TP8 A;  1T5E A;  2MFI A;  1IYJ B;  3R8B A;  2MPM A;  4AYB G;  1XWE A;  1BBW A;  1E24 A;  3E9I A;  5C0X H;  4IN3 A;  1BCP D;  4KHP L;  2F4V Q;  2B2T A;  1J5E Q;  1SJH D;  5GQO A;  1N34 L;  4R4I A;  2N55 A;  3I4L A;  3A7A B;  3PUY A;  4C3H B;  2JA7 H;  2A68 C;  2EJF C;  4DV4 L;  2K4K A;  3PIP A;  2Q2T A;  3TRE A;  4DV4 Q;  2ZTC A;  1FNW A;  3K5M A;  1LLR D;  1IBL L;  5AFW A;  1RTO A;  2L1B A;  1DON A;  3EJI A;  4WFN 3;  4B9W A;  2PW7 A;  2UU9 Q;  1ILP A;  3D8G A;  4BBR H;  2F0O A;  5C4H A;  1PRT D;  5K5P A;  3M4Q A;  3HOZ H;  1K8O A;  4A3F B;  1HNZ L;  2K04 A;  4KD3 A;  5JPM C;  3DXJ C;  1F77 A;  4OO1 G;  2ZT9 C;  2NTT A;  4BBS B;  2UXB Q;  1XX8 A;  5ELB A;  3KF8 B;  1DZ1 A;  2AMC B;  1WJJ A;  1TWA B;  1VF7 A;  3E3X A;  2DJF C;  1KDC A;  1EYC A;  1U4R A;  1LAB A;  3S24 A;  3KF8 A;  4DFA A;  5DM7 3;  5C4J H;  1SE2 A;  1PRT F;  2KCN A;  2SNS A;  2HCI A;  2R3Z A;  2F0K A;  1PZI D;  1F9R A;  1NMG A;  3HOW H;  3J80 i;  1F2L A;  3OMC A;  1I6H B;  2F0N A;  1PDQ A;  3K5L A;  1EIY B;  2MGS A;  2B2V C;  4X66 Q;  1ESR A;  1N32 Q;  1VQB A;  3T4A C;  4X66 L;  3CPF A;  1GUO A;  2EZV A;  4O2D A;  5FLM G;  2YU9 H;  5IP9 H;  3U58 A;  4RH6 A;  4C3I H;  2L15 A;  3S16 H;  2TSS A;  3I4M B;  3ERS X;  3TZU A;  3HOY B;  2EOT A;  3K7A H;  4A3M H;  3CF5 A;  2C9O A;  2HHH L;  2I0Q A;  1CSQ A;  1LV9 A;  2PYK A;  4LF8 L;  2HHH Q;  1TWH B;  1CKM A;  1PRT B;  4L5Q A;  2K6A A;  2XN9 C;  2X6G A;  4MIU A;  4DKA C;  4B3S Q;  5D3I B;  3NSW A;  2WB1 E;  4APV A;  4GKK L;  1S5E D;  1E3P A;  4PZ8 A;  1Z9F A;  3ULL A;  1YHB A;  4R4Q A;  4L5S A;  2XGT A;  2AQ2 B;  2OXP A;  4JK1 C;  2RHQ B;  1TWF B;  3CRL C;  3SDZ A;  1SSO A;  1XTD A;  5I9O A;  1A3T A;  2L5T A;  1TWG B;  4FXD A;  3TP5 A;  4WJ3 M;  4X3T A;  2EJG C;  4L5T A;  3T13 A;  3SK8 A;  5EAY A;  2F0I A;  1R9T B;  3G71 A;  4B3M L;  4LFA L;  3MHB A;  3PIO 3;  3U9S A;  1QB5 D;  3F2B A;  5CGK A;  4AYB B;  3AB9 A;  3D31 A;  3SEB A;  3WOE A;  4A3I B;  1B4O A;  1EWC A;  1I4Q A;  3K59 A;  3H09 A;  1STY A;  1ZYR C;  3R2T A;  1CUK A;  5JVG 3;  1S3O A;  2CCZ A;  5IT9 E;  1ET6 A;  5EGT A;  2R93 B;  4NXM Q;  4K0K Q;  3KLW A;  2V1C C;  5C4X B;  3D4D A;  4RGT A;  5ELF A;  3HZX A;  1CZW A;  2KVM A;  4JV5 Q;  4Z9C B;  3KYH C;  3A7L A;  1YHA A;  5ELD A;  3A8J E;  5C44 B;  4JVZ A;  5CV6 A;  1PZK D;  5IGB A;  2IX3 A;  4LF4 Q;  2E2D C;  1UE6 A;  2FHT A;  3ND9 A;  4ZUI A;  4JI3 L;  4HMJ A;  3PF5 A;  2PMZ E;  1KDA A;  3PSI A;  5LMN W;  1FGU A;  1GHK A;  5D14 A;  4J15 A;  3H3V C;  1S4Z A;  4ZRZ A;  3S1R H;  1HQM C;  3ICE A;  3TP6 A;  1XPO A;  3D6W A;  1C48 A;  3I91 A;  4HID A;  1CHQ D;  1EYD A;  2B2Y C;  3CCM A;  1BVS A;  3ULP A;  4ME5 A;  3MXP A;  4P73 A;  1E7Z A;  2RHS B;  1Q90 A;  1PYS B;  1I50 B;  3FEW X;  3MFG A;  1ML0 D;  3PUX A;  3P1H A;  1L1O B;  4X65 L;  3ERO A;  2F52 A;  5FLX c;  3PIP 3;  3Q8D A;  3VR3 A;  2E2J H;  3OW7 A;  2IHE A;  5E7N A;  1HUM A;  1NUC A;  2N49 A;  1B3Q A;  2WP8 J;  3BZK A;  3M3Y B;  4DAM A;  3RZO H;  3DMU A;  4DPG A;  1BCP F;  1EQT A;  2IL8 A;  2PW5 A;  5EKK A;  4BXX G;  2F0P A;  3TBI B;  3J81 c;  1R4Q B;  3OWF A;  4JI1 L;  1P16 A;  2KEN A;  1VQ8 A;  1TS3 A;  1IL8 A;  4FP5 D;  1JIC A;  2JA8 B;  3KUP A;  1XNQ L;  3DWP A;  1GUN A;  3CD6 A;  2QDL A;  1OXS C;  2MQH A;  5EPK A;  2B63 B;  1YNJ D;  4LFA Q;  1PA6 A;  4B3S L;  2YV5 A;  2KOL A;  1D5Z C;  2F0E A;  4M1U B;  4MTN A;  4A76 A;  5CV5 A;  4LF9 Q;  4DR6 L;  1JJG A;  2A1A A;  2LY7 A;  3SE0 A;  3GTL B;  4DV3 Q;  4A3J B;  5DAU A;  4A75 A;  2QEJ C;  3RZD B;  3BDC A;  5JJK A;  4A3K B;  1JE4 A;  1LT5 D;  4CBV A;  2BE5 D;  2JK8 A;  1G8Z D;  4AYB E;  2SOB A;  2R7Z B;  4Q5V A;  1SEB D;  4OXP A;  1YJN A;  1BF4 A;  5E3F A;  4X65 Q;  3TS2 A;  2AQ1 B;  2NTS A;  4QUC A;  4MHE A;  4DNI A;  5I2X A;  1LTA D;  3NE5 B;  3G6J B;  2WFW A;  4NW2 A;  3FKI G;  4DK1 A;  5CR3 A;  1O7I A;  3WDN A;  4GKJ L;  3J81 L;  4GZY C;  2Z9H A;  2CFM A;  4PZ7 A;  2JE6 I;  4J8Q A;  1S40 A;  2UUC Q;  1F2Y A;  1TS4 A;  2K01 A;  1VS0 A;  1VQI A;  4RHS A;  4DR2 Q;  2BOS A;  1SNM A;  2C35 B;  1PYW D;  3IL8 A;  4QL5 A;  1WCM B;  1SBB B;  3C3L A;  4JI6 L;  2DUD A;  4H44 C;  4XYO A;  5A2Q E;  3BVG A;  5FLM H;  4R1J A;  2JA5 H;  3AQQ A;  1XNR L;  1X3E A;  4LFC L;  1I50 H;  4UPA A;  5EPL A;  3JAM E;  1LUZ A;  4GNX C;  1A0I A;  5AJ3 L;  5ELO A;  1N8R C;  1IBM L;  2JSO A;  3CC2 A;  3L9A X;  4DN4 M;  4JBM A;  1IKM A;  1XMQ Q;  2V4D A;  1SYG A;  1Q81 C;  5COY A;  3H6M A;  1SAP A;  1E2V A;  1RJT A;  3CKI B;  3QWN A;  2NVT B;  4XYQ A;  4DV1 Q;  1PH5 A;  2GVA A;  3IFD A;  4BWG B;  1CM9 A;  5M9O A;  4GLA C;  5IP9 G;  1PFN A;  2QGQ A;  1RD9 D;  1NMF A;  2PQA A;  5LHY 1;  3J80 E;  3BU2 A;  1A3U A;  3ZYY X;  1VQD A;  1STN A;  4DNR B;  5I6W A;  2CW0 C;  2PQA B;  5FJ8 H;  1BXT A;  1ILQ A;  4ZAI A;  5CV4 A;  3MAQ A;  1FD7 D;  1QNU A;  5IGD A;  3VR5 A;  3H94 A;  5EKL A;  2KEE A;  4IUQ A;  2SNM A;  5IWA Q;  3A56 A;  3S1Q B;  4JI5 L;  1SYE A;  4C2M H;  1NE3 A;  2FJ2 A;  5C5M A;  3GD7 A;  2UXC Q;  2GVB A;  2OT2 A;  1X3F A;  1QVF A;  1U5K A;  3FKI H;  4LFB L;  3DEO A;  1JR0 D;  4LFC Q;  3J7A F;  1SYB A;  3J81 E;  3Q23 A;  2O5I C;  2F0F A;  2YYZ A;  3HGB A;  1UNS A;  4JOI A;  4K8J A;  1JWS D;  4JBJ A;  5M5W H;  4RGO S;  1YJW A;  1EU4 A;  1NBW A;  1TR5 A;  4JI4 Q;  1LT3 D;  4R4C A;  2CKZ B;  5KYL A;  2TMP A;  4B3T Q;  2B63 H;  2OTL A;  4M8A A;  1N33 Q;  5C5L A;  2M9V A;  1U4M A;  2BA1 A;  4DUY Q;  4HJ7 A;  3M4O H;  4LK1 C;  3OIP A;  1Q82 C;  1XPU A;  2A69 C;  1HQR D;  1C4Q A;  2PZU A;  3RD4 A;  3MZ5 A;  3S2D B;  1PRT C;  1S5B D;  5AJ3 Q;  4H02 A;  1LAC A;  4OIK A;  3GQB A;  1AW7 A;  2K03 A;  5LL6 X;  4LUV A;  1MJE A;  2MJ8 A;  3KJO A;  4KHV A;  4IPH A;  4ZYS A;  4DV0 L;  4F8M A;  2CVR A;  2K05 A;  1B7Y B;  1XPR A;  2Q2U A;  1E2Z A;  1X9N A;  1H9S B;  3I4O A;  2D0O A;  4YCU A;  3BZD B;  2CW0 D;  1A63 A;  2F0G A;  4X3K A;  1HXY D;  4CDE C;  3DWQ A;  3EIV A;  1X65 A;  3HOU G;  4DGZ A;  2F0J A;  5FOB B;  3B6Y A;  4JBK A;  4LWC A;  2JA6 G;  1T9H A;  3GTM H;  2H1E A;  2K1B A;  5CV8 A;  1FJG Q;  3VR6 A;  3LGJ A;  1OO9 B;  2B3G A;  2F0M A;  2NVY H;  5IYB H;  1K3R A;  3T16 A;  2C5C A;  4POG A;  3F1Z A;  4DAY B;  1U9R A;  3H3V H;  4TQU S;  1ZXT A;  3CRK C;  4JI6 Q;  2B2W C;  1KQS A;  1B3A A;  2PZT A;  4MZ9 A;  1TVX A;  4MTK A;  3PIO A;  1KRS A;  4DAY A;  4KKS A;  3AEV A;  3MFY A;  1SNO A;  2AQ3 B;  4JI8 L;  1G91 A;  1UE5 A;  2QA4 A;  1CQF A;  1E2W A;  4IOC A;  1TII D;  3FKI B;  3BYT B;  2LXJ A;  2XIW A;  3S1R B;  4K14 A;  3CCE A;  3M85 A;  5DNF A;  2J0T D;  1RTN A;  3A55 A;  3GTJ B;  3D4R A;  4N9P A;  4CDD C;  1VQO A;  4IUV A;  1PTO B;  4NXN L;  4DV6 L;  1EOT A;  4A3D H;  5CYU A;  2K33 A;  5BR8 L;  1N36 Q;  1DJR D;  2RSO A;  3S2D H;  1IKL A;  1HNW Q;  4KHZ A;  3GTK B;  4UDU C;  3FMC A;  1J9O A;  2UXD Q;  3DM1 A;  2FFK B;  5LMN Q;  3NEL A;  2VL6 A;  2R93 G;  4K6D A;  1PTO C;  4DV7 Q;  2F4V L;  2Z0S A;  5ELC A;  2UUA Q;  1K83 H;  2R93 H;  3RR5 A;  1ICF B;  1TQO A;  5JOB A;  1LTG D;  3S9W A;  4KI0 A;  3I90 A;  5LL6 S;  2HDL A;  3S16 B;  5EJW A;  4A3M B;  4K2L A;  3RNU A;  3K7U C;  4QIW B;  4LMQ D;  1AH9 A;  3K80 C;  4HJ8 A;  2F3W A;  2ID0 A;  2JA9 A;  3OPO A;  1STG A;  3NWS A;  1IL2 A;  5IYD H;  1WTO A;  2EE1 A;  3JC6 6;  3ER0 A;  4HIO A;  1BR9 A;  2K14 A;  4KV6 A;  2OCE A;  4DR4 L;  1ENC A;  4L63 B;  3F2U A;  3OTO Q;  1D8L A;  4PZ6 A;  2DNC A;  5IIF A;  3PUV A;  4O0A A;  1X3Q A;  5LMU Q;  4LF6 Q;  3VA7 A;  2BDO A;  1A3V A;  4GLX A;  1DYQ A;  2X69 A;  1U4L A;  1A2T A;  3K58 A;  4JV5 L;  2UXB L;  1SNP A;  4DK3 C;  4C3J B;  1K8A C;  4LUO A;  3G4S A;  3QG1 A;  5FLX E;  3FDT A;  3L3O C;  1JJC B;  2E5L L;  2AUK A;  4KD4 A;  4LW1 A;  2BH8 A;  4KJO A;  3JAM L;  2ZM6 L;  2BDN A;  4IFD G;  2NZ1 D;  1Q1E A;  2HD3 A;  4LF7 L;  2R7Z G;  3VYT A;  5LMN L;  2Y0S E;  1NSN S;  4X6A H;  4K6L A;  1Y8O B;  1G2T A;  1TY2 A;  1UAP A;  3UDI A;  5ISR A;  5G3L D;  1TKW B;  2Q8T A;  3D4W A;  1GVP A;  5A35 A;  3J7A 5;  3NP8 A;  4C3J G;  1AEX A;  3CCL A;  2EQS A;  1VQG A;  1R4P B;  1G6Z A;  4YCW A;  4KHP Q;  4RKL A;  1PTO D;  3HKS A;  2IX1 A;  5L37 A;  2VUM H;  4A3D B;  2ZXR A;  3R3O A;  4PMC A;  3S2H B;  1F9S A;  2VQE Q;  1GUG A;  2E8G A;  3VYS A;  5JPN C;  4QIW E;  3CC4 A;  5TSS A;  4JG2 A;  3JAM i;  4A3I G;  1KAB A;  4OO1 H;  4HED A;  3TEH B;  1V1P B;  3N52 A;  4DAV A;  3G6E A;  4GKK Q;  5I4D A;  2R92 H;  5IGC A;  3Q22 A;  3I4N H;  1VQL A;  3PO3 H;  1VQ6 A;  2QCP X;  4A3J H;  2ZTE A;  3A8I E;  5C4X G;  4GNX B;  4UAI A;  1AZQ A;  3I4M H;  1B2T A;  1EL0 A;  3HG9 A;  2A5H A;  3KDF A;  4GNX A;  1X3P A;  1EFW A;  2VZA A;  4PQX A;  2KJX A;  1LTT D;  5J3B A;  5JEA G;  3OSO A;  1H9R A;  1PVO A;  4C3H G;  2ZJR A;  2E2J B;  2A6E D;  1S5D D;  1QZH A;  4HIK A;  1WYD A;  5K36 G;  1CKN A;  4A3B G;  2NYZ D;  1L0W A;  3PGZ A;  2D5D A;  2ZM6 Q;  3RZO B;  2F0U A;  2A19 A;  4DK6 C;  1B50 A;  1HNW L;  1Q46 A;  4KN7 C;  4IJL A;  3GTQ B;  1SNQ A;  3TS0 A;  1U0L A;  1CKN B;  1LYL A;  4OX9 L;  5D3D A;  3M4Y A;  2EDG A;  4DV6 Q;  4N8X 1;  1AE3 A;  2QKI C;  1EY6 A;  5DEH A;  3KLR A;  4CJ1 B;  3IAY A;  1YZ6 A;  2E2H H;  3V96 A;  4RG1 A;  3DWA A;  1Y69 U;  4IFD I;  5IP7 G;  4FNF A;  1PH4 A;  1VQ9 A;  2PI2 E;  4LF8 Q;  2EY5 A;  4OO1 I;  3VR2 A;  4AQY Q;  1PFB A;  2LXK A;  3M7N A;  1SNC A;  4F87 A;  1AP0 A;  1TS5 A;  2WAQ E;  3P7J A;  4IPG A;  1RIP A;  3PF4 A;  2KA7 A;  4OWX B;  3FVQ A;  1GD7 A;  1QNK A;  1SLJ A;  2EIF A;  2EYP A;  4XT3 B;  1WCM H;  2A69 D;  2QDB A;  4H13 C;  2WII B;  4CGY B;  3MXU A;  4B3R Q;  4JI7 Q;  1BDO A;  2E5L Q;  4JW0 A;  1O78 A;  4A4I A;  1YNN C;  3HOY G;  2CHB D;  2HUG A;  5GRO A;  5I2Y A;  4R4O A;  4L5R C;  1WFQ A;  1W6J A;  2RSN A;  3STB D;  5M3F B;  2F4I A;  1G29 1;  3ITP A;  2PNH A;  3PQI A;  1XYI A;  3GP7 A;  1L1O C;  4LF5 Q;  2RQX A;  3J7A V;  5C0X I;  2K5Q A;  2KUM A;  1L0Y B;  1VQA A;  2XSC A;  5HGQ A;  3K0X A;  1XMQ L;  2KCM A;  1D6E C;  2VB3 X;  2KCC A;  1RKN A;  1SYC A;  1EIF A;  2JA6 B;  1XMO L;  1VQ5 A;  5COR A;  5M3F G;  4FO2 A;  1WTH A;  1ROD A;  4GS3 A;  1FVI A;  2M00 A;  4OX9 Q;  1J5E L;  1CT1 D;  4V19 0;  1VQJ A;  3QOJ A;  1A6X A;  3PV0 A;  2VNU D;  4HMI A;  4FF2 A;  4TSS A;  2WAQ B;  5IOC A;  1GUT A;  4BY7 B;  2XWB B;  1KLU D;  1I4R A;  1NR4 A;  5C4Z A;  2I5L X;  1O7Y A;  1I4P A;  1VQN A;  1GUW A;  3NTI A;  1CSP A;  2Q8I B;  4TKO B;  1IZ6 A;  1TWC B;  3HOV H;  3F2C A;  2E2I B;  3NEM A;  4QY7 A;  3CME A;  3S1N H;  1EZ6 A;  5J22 A;  3T53 B;  4FF1 A;  1YIJ A;  5IYD G;  3S1M H;  5BN3 A;  1EWH A;  4RWS C;  2MHV A;  4BXX H;  1ASY A;  3KBX A;  4BA2 I;  5IE8 A;  1UWV A;  4N8F A;  1SE8 A;  3GTG B;  1C0A A;  1ESF A;  1EEI D;  5CC4 A;  2MNA A;  2SDF A;  1FR3 A;  3NQI A;  4K0K L;  3BG3 A;  1MGS A;  2D9U A;  2X6L A;  5FKA C;  4OHJ A;  1QCB D;  4UP7 A;  1V43 A;  2EYL A;  4C3H H;  2EVB A;  3S17 H;  4Y7N B;  1JCK B;  5JJL A;  2NZH A;  1D5M C;  4ALP A;  4B3R L;  1J8I A;  2MP1 A;  1QZG A;  4GOP A;  2WIN B;  4CDF C;  3CHB D;  2EYO A;  1JOK A;  1N33 L;  3J7Z C;  1EU3 A;  1KTK A;  1TXY A;  4GOP B;  1MBY A;  2BE5 C;  1STA A;  5IYC G;  4TVA B;  4FYD A;  3K57 A;  4FXK C;  2JA6 H;  1J6Q A;  2QW7 A;  2JA5 G;  2A74 C;  5IP7 H;  5JJI A;  1X3G A;  1HHV A;  1YNX A;  2B2V A;  1QE6 A;  4QUF A;  1IBL Q;  3RN2 A;  1SFO H;  2WV6 D;  2R7D A;  3D3R A;  2Z4H A;  1I3Q H;  5C3E B;  4DV5 L;  3I55 A;  1EYG A;  2N8N A;  4ZQ3 A;  3HOX B;  2OF1 A;  2I5H A;  4HCS A;  3BJU A;  1QIL A;  5EPJ A;  2CQA A;  4J6H A;  3ULJ A;  3HOX H;  2JA7 G;  4X62 L;  2H4O A;  1XTC D;  5FO7 B;  2NN6 H;  2B63 G;  3BVZ A;  3I7F A;  1QOH A;  5C4J B;  2UUC L;  3ZJY C;  1HZA A;  1HNZ Q;  5ELE A;  1HRJ A;  3K8A A;  1PTO F;  1HNX L;  4RFB A;  2I46 A;  4C3I B;  3VR4 A;  1STH A;  3HKZ B;  4ID6 A;  4GN3 B;  4JI1 Q;  2E75 C;  1Y1V B;  4GN4 B;  3NEN A;  3CQZ H;  2AKW B;  3UDG A;  3LWE A;  4LAA A;  1HA5 A;  4YCV A;  4KN4 C;  1AE2 A;  2DY7 A;  1VQP A;  3HOZ B;  3D0F A;  2Z1C A;  2OEO A;  3M4O B;  3NPP A;  1ICW A;  1RHP A;  4LUZ A;  1VQM A;  1NJI C;  2NVQ B;  1I5F A;  4A3D G;  3URY A;  1CHP D;  3LNN A;  1IBM Q;  3SK5 A;  2ZJQ A;  2VS1 A;  4DF7 A;  4IZ8 A;  1SMY D;  4G57 A;  3K6O A;  2ENB A;  3PCO B;  4DK0 A;  1WTV A;  4G7O C;  1WVL A;  5ELN A;  1QVG A;  2ZXO A;  3BDL A;  1K83 B;  1S5C D;  2R6G A;  4A3L G;  3HOZ G;  3S17 B;  3GTJ H;  2IY5 B;  1Y1V H;  3K5N A;  4EX5 A;  1TWC H;  2K5H A;  3HOV B;  2Q8R E;  3QJY A;  4HSV A;  4GN5 A;  4AQY L;  2PZW A;  1QUQ B;  3D6C A;  1FL0 A;  1M90 C;  3CCQ A;  4DA2 A;  1D1K A;  1D1I A;  4QMG A;  1VQF A;  2NUC A;  1PH1 A;  2N78 A;  4QCL A;  4IUR A;  1QUQ A;  3H0G G;  4IOA A;  1GXD C;  2F3I A;  4DAP A;  1Q8K A;  4JCV E;  5KEE A;  4BBS H;  4A3E H;  1PZJ D;  2UXD L;  1KD1 C;  1W6K A;  3I4N G;  1Y1W G;  5E1F A;  2KQ3 A;  3HKZ E;  2VQF Q;  1HR0 Q;  3CCS A;  2PMZ B;  4DU9 A;  4A3E G;  4JI4 L;  2NVY B;  3J80 c;  3EFX D;  3K81 C;  3HOW G;  2OTJ A;  1ZYR D;  4YWK A;  4IFD H;  1DGS A;  2YTY A;  1BO0 A;  4HIM A;  3KOJ A;  3UE0 A;  2F3V A;  3H0G B;  5HGT A;  1NNX A;  3I72 A;  1TU2 B;  1TWA H;  1TWG H;  5I9P A;  2G5D A;  2I5M X;  1KC8 C;  5J1Z A;  4C3J H;  2JYO A;  4HCE A;  1Y8P B;  3NTH A;  2R92 G;  3SVM A;  3M9B A;  3OIQ A;  1GOZ A;  1VF5 C;  4JPB W;  5IGE A;  1WD0 A;  3DLL A;  3SGI A;  4ODG A;  5C3W A;  3ONA B;  4UHV A;  2B2Y A;  1JWM D;  3CCU A;  2F0V A;  5H1S E;  1UE7 A;  1I4H A;  3M7G A;  1H95 A;  3CW2 C;  4KKU A;  2PI2 A;  1GO3 E;  1G6P A;  4IUN A;  4U68 A;  3TN2 A;  1N9W A;  4JBW A;  1K28 A;  2IW3 A;  1HPC A;  3T1Y Q;  2A6E C;  2LKV A;  2KCT A;  3QOL A;  4XXE A;  1EIG A;  5DLQ E;  4B3T L;  2R92 B;  5C3E H;  1K0S A;  3K7A B;  2RCF A;  5FO8 B;  4HR7 B;  1JWU D;  1HFN A;  2A73 B;  5C3X A;  3GTO H;  1A62 A;  4RKB A;  2YU9 B;  2ZJP A;  1I94 L;  1UUP A;  2M2L A;  3PMF A;  2K7V A;  5EBD A;  3PO2 H;  3WOF A;  4OWW B;  4R9W A;  4DR6 Q;  4KKT A;  1NY4 A;  4KK7 A;  4KMU C;  4MN3 A;  4X62 Q;  4QF4 A;  4NP5 A;  1AN8 A;  2JA8 G;  4IUT A;  2HQE A;  1TWH H;  3MXN A;  4G7Z C;  5M5Y H;  4E6I A;  3EA6 A;  1NTG A;  4JI0 L;  2CWA A;  4RHR A;  4DNT B;  4DR2 L;  2IPK D;  3KLS A;  1VQH A;  5NUC A;  2K75 A;  4A3B H;  3MC0 B;  4FF4 A;  2KHI A;  4OL7 A;  1KNE A;  4A3G B;  4WJW A;  4EQO A;  3UE1 A;  4GKJ Q;  2JP1 A;  4WRD A;  1SRO A;  1HTP A;  1PH8 A;  1B8A A;  4UP8 A;  1SRU A;  2ASB A;  1YI2 A;  2Q2I A;  4YY3 Q;  1Q8I A;  2VQF L;  3CCR A;  3J81 i;  1QVC A;  1SMY C;  4C3I G;  4QB4 A;  4AIM A;  3NUC A;  1P8L A;  3P75 A;  4IPC A;  1IW7 C;  5IY0 A;  3CCV A;  4X3U A;  1MJC A;  3S15 H;  1B9N A;  2DJG C;  5KIX A;  5EBC A;  1Y1W H;  4HTH A;  1EOV A;  2D2C C;  4YWM A;  1JJ2 A;  5KGU A;  1Y1W B;  2DGY A;  5KNB A;  1K9M C;  2MO1 A;  2HIX A;  4A3E B;  5IT9 c;  4OEM B;  3UI2 A;  3RZD H;  2RVL A;  4CKE A;  2LS0 1;  2Y0S B;  2P5Z X;  2KHJ A;  4YIJ A;  3S2H H;  5HY6 A;  2EY2 A;  3FHW A;  3A0J A;  5KNC A;  1WTR A;  4G7H C;  4XIG S;  4JC0 A;  1EEF D;  3S14 B;  4NPS A;  4F88 A;  3CXC A;  1YEZ A;  1LTB D;  1IW7 D;  2B2U C;  5C6A A;  4P71 A;  3H15 A;  3CPW A;  1X56 A;  1YHQ A;  4L8J A;  3HOV G;  4BY1 G;  2LFN A;  2CH4 W;  3A74 A;  4ABN A;  3GTO B;  3VYR A;  1ENA A;  1KL9 A;  1XXG A;  1Z7T A;  3BZC A;  4BBR G;  2DY8 A;  4BY7 G;  4A93 B;  4A3C G;  3LWU A;  4DV5 Q;  4H7B A;  1PMR A;  2NVX H;  2EPB A;  3CAM A;  4DR3 Q;  4R8N A;  1VCI A;  3OMG A;  4I7A A;  3ERQ A;  1BQQ T;  3HEJ A;  4Y52 H;  3BVM A;  2B2W A;  4J1M A;  1C8C A;  4WJ4 A;  3NBI A;  5JAV A;  5GAD C;  1XNR Q;  5IT9 L;  1EFI D;  1X54 A;  4ZCK A;  4ULL A;  1KXL A;  4A93 G;  1XJV A;  5T1I A;  3OYY A;  1PFS A;  1KRT A;  2HDM A;  2A8V A;  2IX0 A;  3X3M A;  2LSS A;  4RCO A;  3HP3 A;  5IOD A;  1EY7 A;  2ZTD A;  1OTC A;  2WB1 G;  2EXZ A;  1JOO A;  3JAM c;  1E1O A;  1SDF A;  2XRS D;  4X3S A;  2XTI A;  5M5X B;  1ONL A;  2JA8 H;  4EQP A;  1NAP A;  1MD2 D;  3I8Z A;  4C1N K;  4C2M B;  1TT2 A;  3HS0 C;  4X64 Q;  4DR1 Q;  3E5S A;  3X3N A;  5K36 H;  4JI3 Q;  3I3C A;  3FP9 A;  1LT4 D;  1WOC A;  1RL2 A;  1B70 B;  4TRD A;  2SEB D;  1V9P A;  3A54 A;  4YWL A;  4ZLT F;  1MIU A;  4OIJ A;  4Q0F A;  5T1G A;  1PV4 A;  4A3G H;  3GTL H;  1SMX A;  2K5W A;  1SJE D;  5F2D A;  1EY4 A;  1L0X B;  5JJZ A;  1STB A;  1ENF A;  1MI2 A;  1QG7 A;  1BKB A;  1Z6H A;  4P72 A;  4N9T A;  1B1Z A;  4UP9 A;  3TP7 A;  4OEL B;  5EQ0 A;  2DNE A;  3GV6 A;  1OXU A;  4K2K A;  2E2I H;  3HFZ B;  1CA6 A;  4CDC C;  5FJ8 G;  2G9H D;  5KRU A;  2HIV A;  2NN6 I;  3OOC A;  3C1E A;  5M3F H;  4PMB A;  4JI7 L;  2PPB C;  1I3Q B;  1BOS A;  3CMA A;  5M3M B;  1Q86 C;  3L7Z C;  4RGN A;  2O4X A;  5CBA E;  2HCC A;  2WAQ G;  1LTR D;  1F2M A;  1LTL A;  2AWN A;  2VUM G;  3W3A A;  5M5W B;  1L2F A;  1UEA B;  1JT8 A;  5G3L F;  1WTP A;  2K50 A;  2ATW A;  3NHH A;  3P20 A;  4EQ5 A;  1VQ4 A;  1O80 A;  1HCZ A;  1H9M A;  2GN5 A;  3PUZ A;  3KLS X;  4XQN A;  3W1B A;  5J39 A;  3PO2 G;  4DR7 Q;  1EY9 A;  1YVC A;  3A5U A;  2B2U A;  1TY0 A;  2F0T A;  2RDH A;  4RAU C;  1EQV A;  1QJO A;  3H0G H;  4HJA A;  1HFG A;  4FF3 A;  1Q7Y C;  4XDX A;  2NVT H;  1JC7 A;  1SYF A;  2NN6 G;  3C46 A;  1JE5 A;  2F0S A;  1KAW A;  1PH6 A;  1HJP A;  3DHQ A;  2VW9 A;  3FPP A;  2Q2H A;  3CP0 A;  4I7Z C;  2O5J C;  2NBF A;  1F2Z A;  3EQL C;  3M4P A;  5M5X H;  2EYF A;  3T56 B;  5I6Y A;  4HJ5 A;  2CQO A;  2UUB L;  4ZKC B;  3PO3 G;  5HUR A;  3MVV A;  3I56 A;  2NZO A;  3R93 A;  4CKB A;  4A3C H;  5FK9 C;  1VQC A;  2AWO A;  4JYA Q;  3EN2 A;  1HA6 A;  1YIT A;  1KDB A;  4DR5 L;  3DM3 A;  5E4W C;  3H91 A;  1CQV A;  4O42 A;  1L1O A;  2A68 D;  3J81 j;  2EXD A;  3RMH A;  1G51 A;  2IHF A;  2J7Z A;  2NVQ H;  2RKS A;  1OXT A;  2AHO B;  3IKJ A;  2XWJ B;  1BCP C;  3N6R A;  1JMC A;  2K52 A;  1SE4 A;  4B9X A;  4LF5 L;  2DN8 A;  2K5V A;  1MSH A;  3RLO A;  2RDF A;  1GHJ A;  1W2B A;  2MUY A;  1GJX A;  4CJ0 B;  4EQN A;  1LM0 A;  4QGU A;  1GM5 A;  5DM6 3;  3VYU A;  1N32 L;  4NXN Q;  2KHS A;  3QB3 A;  4IAL A;  4RCN A;  1AZP A;  5C3E G;  5M5Y B;  2FMC A;  3F8T A;  1II3 A;  4LF4 L;  2N88 A;  4BS9 A;  3HOX G;  1BBU A;  2ALY B;  4L6T B;  2E76 C;  1HTL D;  4IUP A;  1E1T A;  3FPU B;  5CMD A;  3TRZ A;  5JEA J;  1RF2 D;  1B53 A;  1WD1 A;  3K5O A;  2K5D A;  4DUY L;  1PH2 A;  4V0B A;  1HR0 L;  1I6V C;  1RDP D;  4UY8 C;  1FGB D;  4NMZ A;  4C56 C;  1PTO H;  2HQL A;  4NKL A;  3GO5 A;  3LX0 A;  3G7L A;  4JYA L;  1HR0 W;  1Y1V G;  2R7F A;  3KJP A;  1VQE A;  1LO5 D;  2A6H D;  2D62 A;  3E0E A;  3IRB A;  4FVM A;  1Q1B A;  4DV3 L;  4QJF A;  5M3M G;  4O1N A;  3I70 A;  1K3B C;  1EUJ A;  4DV7 L;  2IWH A;  4RA8 A;  2Z6K C;  1TWF H;  3C1F A;  2AUJ D;  2ES2 A;  3NTK A;  2FMM A;  4DV2 L;  3RUZ A;  2LMC B;  3T51 B;  1VDZ A;  2YTV A;  3Q0A A;  1PH9 A;  3TDQ A;  1M1K C;  4P74 A;  2KED A;  2IT1 A;  4DXF A;  5C0X J;  4DR5 Q;  1S5F D;  2J4X A;  4RGM A;  3A5Z B;  2G9D A;  1IYV A;  5LMU L;  4LF6 L;  3CU7 A;  1NR2 A;  4A3F H;  3GTP H;  1JQY D;  1SYD A;  5IGF A;  4A3I H;  2WAC A;  1Y8N B;  3GTM B;  2Z6K A;  3IFT A;  1U4P A;  1KHI A;  1X32 A;  1ET9 A;  3RLN A;  4QQB X;  3FRP B;  4OWT B;  4IFD J;  1PH7 A;  3KBG A;  4LNQ A;  3HRZ C;  1NCV A;  4AH6 A;  3I4N B;  1KNA A;  4XQQ A;  3PO3 B;  1I6H H;  1STE A;  2L0C A;  3E0J A;  4BY1 B;  4NDX A;  4EVO A;  5C44 H;  1PYB A;  2XNA C;  2E74 C;  4OON A;  3ND8 A;  3HOY H;  1E22 A;  3HOW B;  4BBR B;  3AYH B;  3OWE B;  3GTP B;  4F7X A;  1FJG L;  1M8A A;  1EIH A;  2L55 A;  1I4X A;  4JI0 Q;  3M3Y H;  1IXR A;  4BA1 I;  1YJ9 A;  1WI5 A;  1G2S A;  1YBY A;  5GAH C;  4C1N I;  4YHH L;  1OXV A;  3J80 L;  4CJ2 C;  3PO2 B;  3AFQ A;  3K0Y A;  4IO9 A;  2B2T C;  1K8M A;  1IBK L;  4LFB Q;  2YTX A;  5CV9 A;  2XRQ D;  2PNR C;  2QIL A;  1IBK Q;  4A3B B;  1HNX Q;  3SR1 A;  5IGG A;  2Y0S G;  3F2D A;  4IJH A;  3Q6S A;  4GOP C;  3H3V I;  4K5V A;  3NXW A;  3R2I A;  4PV1 C;  3SHL A;  1D5X C;  2EYH A;  2QF7 A;  2ZXP A;  4R8I A;  4LF7 Q;  2F0W A;  3S14 H;  2MO0 A;  3STB C;  3WWV A;  1EZ8 A;  4EGV A;  4JI2 L;  1D7Q A;  1W3S A;  1YNN D;  3GTQ H;  1F9Q A;  3KFU A;  1F9P A;  4A3M G;  1EQQ A;  3U9O A;  5FLX L;  2K28 A;  2F0H A;  3EBE A;  1R9T H;  5BN5 A;  3GV3 A;  2I07 B;  1BCP B;  1WTQ A;  4KJN A;  1QWY A;  1T5X D;  2RF4 A;  3W1G A;  3SXH A;  4BBS G;  2JJQ A;  1HZC A;  3NQT A;  2VY3 A;  3L2P A;  2ICE C;  2KBN A;  2A6H C;  3I73 A;  3MEH A;  3VA5 A;  4LF9 L;  4HAE A;  1H9K A;  5BN4 A;  4MNO A;  1SE3 A;  1A8V A;  3U4Z A;  1H9S A;  3BDO A;  3CCJ A;  3HKZ G;  1Q12 A;  4FDB A;  1X6O A;  5C4X H;  4DV0 Q;  5IWA L;  1V1Q A;  3VDY A;  2B39 A;  1IYU A;  3W2D A;  5M3M H;  1O7L A;  4LJZ C;  1LTS D;  2Z6B A;  2WB1 B;  4BY1 H;  2NVX B;  2ICI A;  3AFP A;  1N34 Q;  5JEA H;  3TQY A;  2H5X A;  5KYI A;  4DUZ Q;  1EWI A;  1LTI D;  3UDX A;  1KIX A;  2B8F A;  2UXC L;  1EY0 A;  2NB0 A;  1V8Q A;  2VUM B;  1SXT A;  4K5X A;  3TSS A;  4GLV B;  2Z4I A;  2EY6 A;  3U50 C;  3T1H L;  1C7Y A;  3KK7 A;  1ZEQ X;  3A8K E;  5E4X A;  4DV2 Q;  1HH2 P;  4HJ9 A;  1TS2 A;  4A3J G;  4P75 A;  1MKH A;  4XTC S;  2EJM A;  4RMF A;  3RN5 A;  2VQE L;  1SND A;  2Z8L A;  2CWP A; 
#chains in the Genus database with same CATH homology
 1YHQ A;  1XNQ L;  4IFD I;  5IP7 G;  3HOV G;  4BY1 G;  3CD6 A;  1OXS C;  2MQH A;  3A74 A;  2K5N A;  1PH4 A;  1VQ9 A;  2PI2 E;  1KL9 A;  4LFA Q;  3RLF A;  1PA6 A;  4B3S L;  3BZC A;  4BBR G;  4LF8 Q;  4BY7 G;  2YV5 A;  4A3C G;  2B29 A;  4OO1 I;  4AQY Q;  4MTN A;  3HOU H;  4DV5 Q;  2LXK A;  3M7N A;  4A76 A;  3OW2 A;  4LF9 Q;  2NVX H;  4DR6 L;  1JJG A;  1K0R A;  3CAM A;  4DR3 Q;  2A1A A;  1UEB A;  4YY3 L;  4X64 L;  5GAE C;  1VCI A;  3T1Y L;  2WAQ E;  4IPG A;  4DV3 Q;  3G48 A;  1RIP A;  4A75 A;  3PF4 A;  4OWX B;  2OQ0 A;  4Y52 H;  5JJK A;  1GD7 A;  2EIF A;  1SLJ A;  2JEB I;  4NXM L;  4WJ4 A;  1WCM H;  2JK8 A;  5GAD C;  4AYB E;  1XNR Q;  2UUA L;  1X54 A;  4OXP A;  1YJN A;  4B3R Q;  1KXL A;  4JI7 Q;  4X65 Q;  3TS2 A;  4A93 G;  1XJV A;  2E5L Q;  4DNI A;  1HZB A;  3OYY A;  4A4I A;  3HOY G;  1PFS A;  5GRO A;  1KRT A;  2HT1 A;  2A8V A;  4R4O A;  4L5R C;  2IX0 A;  1WFQ A;  2LSS A;  3STB D;  2WFW A;  3FKI G;  1G29 1;  4GKJ L;  1O7I A;  3W5O A;  1Z47 A;  2PNH A;  4POF A;  2CFM A;  4PZ7 A;  2ZTD A;  1L1O C;  2JE6 I;  1S40 A;  2UUC Q;  1OTC A;  4LF5 Q;  4JI8 Q;  1CKO A;  2WB1 G;  3JAM c;  3T1H Q;  5C0X I;  1E1O A;  1VS0 A;  1VQI A;  1VQA A;  2XTI A;  4DR2 Q;  2UU9 L;  5HGQ A;  3K0X A;  2UUB Q;  2JA8 H;  3NBH B;  1XMQ L;  2KCM A;  1I94 Q;  4DR4 Q;  2C35 B;  4DR1 Q;  4X64 Q;  2BA0 A;  4YHH Q;  4QL5 A;  4DUZ L;  3I2Z A;  4JI6 L;  2DUD A;  1EIF A;  1XMO L;  3E9H A;  5FLM H;  4R1J A;  2JA5 H;  4JI3 Q;  3AQQ A;  1PHJ A;  1VQ5 A;  4A3K H;  1X3E A;  1XNR L;  5M3F G;  4A93 H;  3FP9 A;  4LFC L;  1I50 H;  4UPA A;  1WOC A;  1RL2 A;  2FXQ A;  1B70 B;  3PUW A;  1LUZ A;  4GS3 A;  4GNX C;  1SN8 A;  3L0O A;  1A0I A;  5AJ3 L;  1FVI A;  5ELO A;  1N8R C;  4OX9 Q;  2R7Z H;  1IBM L;  1J5E L;  1V9P A;  1K73 C;  4YWL A;  1N36 L;  1MIU A;  3CC2 A;  4JBM A;  1XMQ Q;  1Q81 C;  1VQJ A;  2JQO A;  3PV0 A;  3OTO L;  1PV4 A;  1X55 A;  3GTL H;  4A3G H;  1SMX A;  2VNU D;  1UE1 A;  3CC7 A;  4DV1 Q;  4DR7 L;  2QEX A;  1PH5 A;  4JI2 Q;  3MEF A;  2GVA A;  3I4M G;  1BKB A;  2I5L X;  4P72 A;  4GLA C;  5IP9 G;  2QGQ A;  1VQN A;  1NMF A;  2PQA A;  4UP9 A;  2OQK A;  1CSP A;  3BU2 A;  1OXU A;  4A3F G;  4R4T A;  2E2I H;  3HFZ B;  1VQD A;  5FJ8 G;  1IZ6 A;  3HOV H;  2HIV A;  2NN6 I;  3F2C A;  5M3F H;  4JI7 L;  1XNQ Q;  4A3K G;  2BH2 A;  2PQA B;  3NEM A;  4QY7 A;  3CME A;  3S1N H;  5FJ8 H;  3CMA A;  1VQK A;  1Q86 C;  3L7Z C;  2RCN A;  4ME3 A;  1YIJ A;  4KLK A;  5IYD G;  3S1M H;  2WAQ G;  1EQR A;  1LTL A;  4BXX H;  1ASY A;  5IWA Q;  2AWN A;  2N3S A;  4Y7N H;  2VUM G;  4JI5 Q;  1L2F A;  1JT8 A;  4BA2 I;  5IE8 A;  1UWV A;  2K50 A;  4PG3 A;  1SE8 A;  4JI5 L;  4C2M H;  2ATW A;  1C0A A;  1NE3 A;  1S72 A;  3GD7 A;  2UXC Q;  2GVB A;  4EQ5 A;  4A3G G;  1X3F A;  2MNA A;  1VQ4 A;  1QVF A;  2GN5 A;  3PUZ A;  1ASZ A;  1U5K A;  3FKI H;  3W1B A;  4LFB L;  4K0K L;  3PO2 G;  3U4V A;  4DR7 Q;  4LFC Q;  4DR1 L;  1SR3 A;  4UP7 A;  1V43 A;  1YVC A;  2YYZ A;  4C3H H;  1XMO Q;  3A5U A;  3S17 H;  1K8G A;  4JOI A;  1JB7 A;  4JBJ A;  5M5W H;  5JJL A;  2NZH A;  1YJW A;  1NBW A;  4JI4 Q;  3H0G H;  4HJA A;  1WCM G;  3MXN B;  4R4C A;  4ALP A;  2CKZ B;  4DR3 L;  1Q7Y C;  1QZG A;  4GOP A;  2B63 H;  4B3T Q;  2NVT H;  2NN6 G;  1JE5 A;  2OTL A;  1N33 Q;  2JEA I;  1KAW A;  1PH6 A;  1HJP A;  2VW9 A;  2BA1 A;  4DUY Q;  1N33 L;  3J7Z C;  5GAG C;  1HZ9 A;  2Q2H A;  4HJ7 A;  3CP0 A;  4IPD A;  4B3M Q;  3M4O H;  1TXY A;  1Q82 C;  1Y14 B;  3KF6 A;  5IYB G;  1XPU A;  4GOP B;  3M4P A;  3GDE A;  5M5X H;  3GTK H;  3KDF B;  4NB3 A;  3UDF A;  5IYC G;  5AJ3 Q;  2CQO A;  4HJ5 A;  2UUB L;  1C9O A;  4H02 A;  4TVA B;  3I56 A;  3PO3 G;  2NZO A;  4A3C H;  4A3L H;  3KF6 B;  4BY7 H;  5C0X G;  3S1Q H;  1VQC A;  2AWO A;  2D0P A;  4JYA Q;  2JA6 H;  3EN2 A;  1J6Q A;  3GTG H;  2JA5 G;  5IP7 H;  1YIT A;  1X3G A;  4LUV A;  4DR5 L;  3DM3 A;  5C44 G;  1MJE A;  5JJI A;  1OXX K;  1YNX A;  1PH3 A;  3KJO A;  4DV0 L;  1GKH A;  4IPH A;  1VQ7 A;  1IBL Q;  1L1O A;  1B7Y B;  1XPR A;  2Q2U A;  3RN2 A;  3J81 j;  2OWO A;  2EXD A;  5IYC H;  1SFO H;  2R7D A;  1X9N A;  1G51 A;  2IHF A;  2UXD L;  1I3Q H;  2NVQ H;  4DV5 L;  1OXT A;  3I55 A;  1EYG A;  2AHO B;  3I4O A;  2N8N A;  5BR8 Q;  2D0O A;  4YCU A;  2I5H A;  3BJU A;  1JMC A;  1A63 A;  3ULJ A;  3HOX H;  4DV1 L;  2JA7 G;  4X62 L;  2K52 A;  2B63 G;  4JOI C;  3I7F A;  4PMW A;  2UUC L;  4LF5 L;  3EIV A;  2K5V A;  1X65 A;  3HOU G;  3RLO A;  3ZJY C;  1HZA A;  1HNZ Q;  1W2B A;  3K8A A;  2MFI A;  3CPW A;  3B6Y A;  4JBK A;  4LWC A;  1IYJ B;  4AYB G;  1HNX L;  1LM0 A;  1BBW A;  1T9H A;  1E24 A;  4QGU A;  1GM5 A;  2JA6 G;  3E9I A;  3GTM H;  4KHP L;  4GN3 B;  4JI1 Q;  1FJG Q;  2F4V Q;  4GN4 B;  4NXN Q;  1N32 L;  3NEN A;  1J5E Q;  3CQZ H;  2AKW B;  5GQO A;  3UDG A;  1N34 L;  3LGJ A;  4R4I A;  5C3E G;  2B3G A;  3F8T A;  4YCV A;  2NVY H;  3PUY A;  4LF4 L;  1AE2 A;  1VQP A;  2JA7 H;  3HOX G;  5IYB H;  3D0F A;  1K3R A;  1BBU A;  2ALY B;  3F1Z A;  2K4K A;  4DAY B;  3PIP A;  4DV4 L;  4POG A;  3TRZ A;  1E1T A;  3H3V H;  2Q2T A;  4LUZ A;  4TQU S;  5JEA J;  3TRE A;  4DV4 Q;  1VQM A;  1NJI C;  4JI6 Q;  2ZTC A;  1I5F A;  4A3D G;  1KQS A;  1IBL L;  4DUY L;  4MZ9 A;  1PH2 A;  1IBM Q;  3PIO A;  2ZJQ A;  2VS1 A;  1KRS A;  1HR0 L;  3AEV A;  2UU9 Q;  4JI8 L;  4UY8 C;  4BBR H;  1UE5 A;  2QA4 A;  2HQL A;  3PCO B;  3GO5 A;  4JYA L;  1HR0 W;  4IOC A;  1Y1V G;  2R7F A;  5ELN A;  3KJP A;  3M4Q A;  1QVG A;  1VQE A;  3HOZ H;  1HNZ L;  2D62 A;  2LXJ A;  3E0E A;  3IRB A;  2R6G A;  4A3L G;  1Q1B A;  3HOZ G;  4DV3 L;  4OO1 G;  3GTJ H;  2IY5 B;  1Y1V H;  2UXB Q;  4QJF A;  3CCE A;  3M85 A;  5M3M G;  3KF8 B;  4EX5 A;  1TWC H;  2AMC B;  2K5H A;  1EUJ A;  4DV7 L;  1WJJ A;  4GN5 A;  2Z6K C;  1TWF H;  4AQY L;  1VQO A;  1QUQ B;  2ES2 A;  4NXN L;  1FL0 A;  4DV2 L;  4DV6 L;  1M90 C;  4A3D H;  3CCQ A;  3S24 A;  5BR8 L;  2YTV A;  1PH9 A;  1X56 A;  5C4J H;  1PH1 A;  1N36 Q;  1VQF A;  4P74 A;  1M1K C;  2N78 A;  2IT1 A;  1NMG A;  1QUQ A;  5C0X J;  3H0G G;  4DR5 Q;  3J80 i;  3HOW H;  3S2D H;  2F3I A;  4IOA A;  1HNW Q;  4KHZ A;  1EIY B;  3A5Z B;  1Q8K A;  4JCV E;  4BBS H;  2UXD Q;  4A3E H;  5LMN Q;  3NEL A;  2VL6 A;  5LMU L;  4X66 Q;  4LF6 L;  4DV7 Q;  1KD1 C;  2R93 G;  2F4V L;  2Z0S A;  1N32 Q;  3I4N G;  1VQB A;  2UUA Q;  1Y1W G;  3HKZ E;  2VQF Q;  1K83 H;  4X66 L;  3RR5 A;  4A3F H;  3CPF A;  1HR0 Q;  3GTP H;  3CCS A;  2R93 H;  4A3E G;  4JI4 L;  4O2D A;  4KI0 A;  5FLM G;  2YU9 H;  4A3I H;  3J80 c;  5IP9 H;  3K81 C;  3U58 A;  3HOW G;  4C3I H;  2L15 A;  2OTJ A;  4YWK A;  2Z6K A;  3S16 H;  1DGS A;  3ERS X;  2YTY A;  3K7U C;  1KHI A;  3K7A H;  3RNU A;  4A3M H;  3CF5 A;  4HIM A;  3KOJ A;  2HHH L;  3UE0 A;  1AH9 A;  3K80 C;  4HJ8 A;  2I0Q A;  1CSQ A;  4LF8 L;  2JA9 A;  2ID0 A;  2HHH Q;  3RLN A;  4QQB X;  4OWT B;  1CKM A;  4IFD J;  1PH7 A;  4L5Q A;  4LNQ A;  1TWA H;  4DKA C;  1TWG H;  4B3S Q;  1IL2 A;  5IYD H;  2I5M X;  3ER0 A;  3JC6 6;  4AH6 A;  4HIO A;  1KC8 C;  4C3J H;  2K14 A;  2OCE A;  2WB1 E;  4DR4 L;  1I6H H;  4APV A;  2R92 G;  4GKK L;  1E3P A;  4PZ8 A;  5C44 H;  3M9B A;  3OTO Q;  1Z9F A;  1PYB A;  1D8L A;  3DLL A;  4OON A;  3HOY H;  4PZ6 A;  3ULL A;  1YHB A;  3SGI A;  3PUV A;  1E22 A;  4O0A A;  5LMU Q;  4R4Q A;  4LF6 Q;  4L5S A;  2XGT A;  3AYH B;  4GLX A;  2RHQ B;  3CCU A;  1FJG L;  5H1S E;  1UE7 A;  4JI0 Q;  3M3Y H;  4JV5 L;  2UXB L;  1XTD A;  1IXR A;  1H95 A;  4BA1 I;  1YJ9 A;  1WI5 A;  3CW2 C;  4DK3 C;  2PI2 A;  1GO3 E;  4WJ3 M;  1YBY A;  1G6P A;  5GAH C;  1K8A C;  4YHH L;  4L5T A;  4LUO A;  3G4S A;  1N9W A;  1OXV A;  4JBW A;  5EAY A;  3AFQ A;  4IO9 A;  1JJC B;  3T1Y Q;  2E5L L;  4LW1 A;  2BH8 A;  2ZM6 L;  2KCT A;  3G71 A;  1IBK L;  4B3M L;  5DLQ E;  4B3T L;  2YTX A;  4IFD G;  1Q1E A;  5C3E H;  4B3R L;  4LFB Q;  4LF7 L;  4LFA L;  1IBK Q;  2R7Z G;  5LMN L;  2Y0S E;  1HNX Q;  4X6A H;  2Y0S G;  3F2D A;  4IJH A;  3F2B A;  3GTO H;  3UDI A;  4GOP C;  3H3V I;  1A62 A;  3D31 A;  2ZJP A;  1I94 L;  4RG1 A;  1CUK A;  1GVP A;  4OWW B;  3PO2 H;  3J7A 5;  1S3O A;  4DR6 Q;  1NY4 A;  2CCZ A;  4X62 Q;  3CCL A;  2EQS A;  2JA8 G;  4NXM Q;  1VQG A;  4LF7 Q;  3S14 H;  4K0K Q;  1TWH H;  2MO0 A;  2V1C C;  3KLW A;  4YCW A;  3STB C;  3WWV A;  4JI2 L;  4KHP Q;  1D7Q A;  1W3S A;  3HKS A;  5M5Y H;  2IX1 A;  2VUM H;  3GTQ H;  3KFU A;  1NTG A;  4JI0 L;  4JV5 Q;  2CWA A;  4A3M G;  1EQQ A;  4DR2 L;  3KYH C;  2VQE Q;  1YHA A;  2E8G A;  1VQH A;  4QIW E;  3CC4 A;  2K75 A;  4JG2 A;  3JAM i;  4A3I G;  4A3B H;  4LF4 Q;  3EBE A;  1R9T H;  1UE6 A;  3TEH B;  2KHI A;  3G6E A;  4GKK Q;  2R92 H;  3UE1 A;  4JI3 L;  4GKJ Q;  3I4N H;  3PF5 A;  1SRO A;  2PMZ E;  1PH8 A;  1VQL A;  1B8A A;  3PSI A;  4UP8 A;  3PO3 H;  5LMN W;  1FGU A;  2RF4 A;  1VQ6 A;  1SRU A;  3W1G A;  4A3J H;  2ZTE A;  4J15 A;  2JJQ A;  2ASB A;  1YI2 A;  1HZC A;  4BBS G;  4GNX B;  2Q2I A;  5C4X G;  2VY3 A;  3L2P A;  4YY3 Q;  3S1R H;  3ICE A;  2VQF L;  2KBN A;  3I4M H;  1XPO A;  4LF9 L;  3CCR A;  4MNO A;  3J81 i;  1QVC A;  3KDF A;  4GNX A;  1A8V A;  3U4Z A;  4HID A;  1EFW A;  2VZA A;  3CCM A;  4AIM A;  3CCJ A;  3HKZ G;  1P8L A;  1Q12 A;  1BVS A;  4FDB A;  4IPC A;  3ULP A;  5IY0 A;  1X6O A;  4P73 A;  5C4X H;  4DV0 Q;  5IWA L;  1V1Q A;  3CCV A;  5J3B A;  3VDY A;  1E7Z A;  5M3M H;  2RHS B;  5JEA G;  1MJC A;  3S15 H;  1PYS B;  1Y1W H;  1PVO A;  1EOV A;  2ZJR A;  4BY1 H;  3PUX A;  3AFP A;  4YWM A;  1L1O B;  1N34 Q;  1JJ2 A;  4X65 L;  1QZH A;  2DGY A;  2F52 A;  5FLX c;  4HIK A;  3Q8D A;  1K9M C;  2MO1 A;  2HIX A;  2E2J H;  1WYD A;  2IHE A;  3TQY A;  2H5X A;  5IT9 c;  1CKN A;  5K36 G;  4DUZ Q;  3RZD H;  4A3B G;  1L0W A;  3PGZ A;  2ZM6 Q;  1EWI A;  5E7N A;  3UDX A;  1KIX A;  2N49 A;  2UXC L;  2WP8 J;  3BZK A;  2A19 A;  4DK6 C;  4DAM A;  3RZO H;  1HNW L;  1Q46 A;  4DPG A;  4IJL A;  3TS0 A;  1U0L A;  2KHJ A;  4GLV B;  1CKN B;  1LYL A;  4BXX G;  3U50 C;  4OX9 L;  5HY6 A;  3T1H L;  1C7Y A;  3FHW A;  3J81 c;  3S2H H;  3A0J A;  4DV2 Q;  4DV6 Q;  1HH2 P;  4JI1 L;  1P16 A;  2KEN A;  4HJ9 A;  4XIG S;  4JC0 A;  1VQ8 A;  4A3J G;  1AE3 A;  4P75 A;  1MKH A;  4XTC S;  4NPS A;  4RMF A;  3CXC A;  1YEZ A;  1YZ6 A;  2E2H H;  3RN5 A;  2VQE L;  4P71 A;  3H15 A;  2CWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...