1JE5A

Crystal structure of gp2.5, a single-stranded dna binding protein encoded by bacteriophage t7
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
197
structure length
181
Chain Sequence
MAKKIFTSALGTAEPYAYIAKPDYGNGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATDWADEVEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the gene 2.5 protein, a single-stranded DNA binding protein encoded by bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Dna binding protein
molecule keywords HELIX-DESTABILIZING PROTEIN
total genus 41
structure length 181
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1je5A00
1JJCB 2LSSA 3HOZH 3ER0A 2YU9H 1XNRQ 3A74A 2ASBA 2K4KA 1VQEA 4YWLA 4DV0Q 3TS0A 4APVA 4B3RQ 2LXKA 2ZJPA 2IY5B 3FP9A 5LMNQ 4IPDA 4IOAA 5IE8A 2WB1E 4JBKA 1PA6A 4L5TA 2PI2E 2ID0A 4QGUA 1HNXQ 3KJPA 3PO2H 1XMQL 4IPHA 3CPWA 4B3MQ 4L5RC 3L7ZC 4BBSG 4FDBA 4A4IA 4A3BG 2NZHA 1YEZA 4LUZA 2QEXA 1YZ6A 2RF4A 5LMUL 3A5ZB 3D0FA 2VUMH 3TEHB 1A0IA 5C0XJ 1CUKA 1TWHH 4B3SQ 1EUJA 3RLOA 2E5LQ 4KHZA 1GO3E 5GAGC 1C7YA 3I4NH 4DAMA 4BXXG 2XGTA 1WYDA 2JA6H 4DV3Q 4NXNL 4GOPB 1YBYA 5JJKA 3W1GA 1PH5A 1LM0A 4X66L 4JBMA 2BH2A 4AQYL 4BY1G 2OWOA 4A3MG 2JA5G 4MZ9A 2VY3A 5IP7H 3DLLA 1Q46A 4A3GG 4UP8A 3H15A 2MQHA 1XMQQ 3JAMi 3H0GG 3HKZE 4ME3A 4LF6L 1E1TA 3AYHB 3S17H 1NE3A 4OWXB 4DK3C 5IP9H 4JOIC 4PG3A 4HIKA 1J5EL 4JYAQ 1SROA 4GNXA 1HNZQ 4JI0L 4JCVE 4R4QA 1K8AC 4R4IA 2MO1A 4NXML 1YI2A 3S1NH 4GLVB 2FXQA 4LWCA 4JI7L 5GADC 4DUZQ 4A3FG 2N3SA 5C44H 2MO0A 4DV7Q 3M85A 1N33L 1I5FA 3BZKA 5IYCG 2IHEA 1IBKL 1GD7A 2NZOA 2R6GA 1TWFH 3S1MH 4JOIA 1PFSA 3Q8DA 3G71A 2K5NA 2QGQA 3K7AH 3KYHC 4IPGA 1NJIC 1X56A 1S3OA 4JV5L 3J81j 2PMZE 4A93H 5GQOA 2I5HA 3RLNA 3E9HA 4YHHQ 1N8RC 1I94Q 2WAQG 4HJAA 4LNQA 2H5XA 2K52A 3E9IA 4QIWE 2V1CC 2JE6I 4X62L 4YCWA 3I2ZA 5M3MG 2VS1A 1IBMQ 1VQ7A 4A3LG 4DR4Q 4GKJL 4OO1I 4A3KG 5M3MH 1OXVA 4A3LH 4DV5L 4JI0Q 3GTLH 2JQOA 3HOXH 4GNXB 5M5WH 1OXTA 4IFDG 1UEBA 1LYLA 1E3PA 5AJ3Q 1YJNA 4P71A 1XJVA 3FHWA 2QA4A 3RNUA 3CMAA 5E7NA 4NB3A 4B3ML 3OYYA 1WFQA 3UDGA 2UXDL 2WB1G 1CSPA 2HQLA 4DR6L 3HFZB 1TWCH 2Q2UA 2Y0SG 3CCRA 1JMCA 3CC7A 3F2CA 3HKSA 4DR1Q 4OWWB 2Y0SE 5IYCH 3HOWG 1BKBA 3D31A 3J80c 4A3MH 2R7DA 3M4PA 3PCOB 1KC8C 4A3KH 2IX1A 1HNWL 4OXPA 4RMFA 2OTLA 3PV0A 2OTJA 3AQQA 2Q2HA 1IL2A 1JT8A 2OQKA 3HOVG 1SRUA 3NELA 3G48A 2DGYA 5FJ8H 2YTXA 2ZTEA 3A0JA 1EFWA 1IBLQ 1Q12A 3S24A 3U4ZA 5FJ8G 4AQYQ 2A8VA 1HZ9A 1PHJA 4LF7L 1N32L 1L1OB 2K14A 1J6QA 4A3CG 2D62A 3IRBA 4JI1L 1VQIA 2F52A 3NEMA 5C4XH 5C0XG 1S40A 2JA7H 2JA7G 2VQEQ 1WI5A 3BZCA 4C3IH 4O2DA 1ASZA 2OQ0A 1YHAA 2F4VQ 4A3JH 4UP7A 4DR2Q 2CCZA 1TWGH 2N8NA 3CD6A 1Q7YC 4AYBE 1VQLA 2KHIA 4DR1L 5J3BA 1N36Q 4POFA 5LMNW 2UUBQ 4J15A 3CCVA 3S1RH 4GS3A 2JJQA 2ZJQA 1L1OC 5IWAL 4OWTB 3DM3A 1QUQA 1HNWQ 1S72A 1YHQA 1N32Q 3JAMc 5IP9G 4DV7L 1PH1A 1VS0A 5M3FG 1OTCA 4IJLA 4BBRG 3CCSA 4AIMA 2RHSB 1QZHA 4B3TQ 1EWIA 5C4XG 1WOCA 3B6YA 4LF6Q 3G4SA 5LMNL 5GROA 2EXDA 4H02A 1VQAA 2UXBL 3CF5A 1QVCA 1YJ9A 4JBWA 4QY7A 1B8AA 1XMOL 1KQSA 4GKKL 3SGIA 2R92G 4JYAL 3A5UA 1L1OA 1MJEA 1Z47A 3CC4A 2GN5A 4JI6L 1NMFA 4LF4Q 5JJLA 2IT1A 3ULLA 4JI5L 4DV1L 4YY3Q 3GTJH 4GLXA 1M90C 1GM5A 3UE0A 1XNQQ 3I4MG 3TRZA 3PUYA 2UU9Q 4DR4L 4GKJQ 4C3JH 2R93G 2VQFL 1XTDA 2DUDA 1CKMA 3JC66 1SMXA 2WP8J 3CCLA 4GN4B 4Y52H 2GVAA 3S1QH 1C0AA 2HHHQ 3AEVA 3U58A 1N34Q 1AE2A 1XNQL 2LXJA 4JI3L 3CCEA 1HH2P 1L0WA 4A3EG 1WCMH 3H3VI 4HJ7A 1EQRA 1SE8A 4DNIA 3EN2A 4NXMQ 4HIDA 1TXYA 3GTOH 3S2DH 1X3GA 1X6OA 3T1HQ 4LW1A 1VQ9A 1VQPA 1UE1A 1SFOH 1KL9A 3F8TA 3K80C 3ULPA 2HT1A 1SR3A 4LFBQ 4DV0L 1VQ4A 2NVTH 1FL0A 1OXXK 2JA6G 3K0XA 1HJPA 1FJGL 1SN8A 1Y1WG 1HR0Q 5JEAG 4GN5A 3PIPA 4DR6Q 4DV4L 1V43A 2BA1A 5FLMG 2Z0SA 1FGUA 3CXCA 3OTOL 4POGA 3CMEA 4UP9A 2UXCL 1HNXL 4IJHA 1H95A 3W5OA 2AWOA 4DUZL 4HIMA 2EIFA 2VQEL 1N34L 4LF5Q 1I3QH 1IBML 3PUWA 1FJGQ 3J7A5 4DR5L 2VL6A 3I4MH 2CFMA 4DPGA 4JI4L 4QJFA 5C0XI 1E22A 3KF8B 4DV2Q 3CAMA 4LF8Q 2KCMA 4BBRH 4Y7NH 3KJOA 1XNRL 4IFDI 4DR7Q 2K5VA 1GVPA 1N36L 4O0AA 2CQOA 1KD1C 5C4JH 4YWKA 4LF5L 2N49A 1YJWA 1XPUA 1PH8A 5C3EG 4OO1G 1IXRA 4R4CA 1IBLL 1Z9FA 2UUCL 1C9OA 4LFCL 2EQSA 3LGJA 5JJIA 3U4VA 1X55A 3KDFA 1LUZA 4MTNA 4YCVA 2AMCB 4K0KQ 1NTGA 3L0OA 4BA1I 3KOJA 3G6EA 1A62A 2A19A 2UXBQ 3CP0A 1YIJA 1VQFA 2I5MX 1PYBA 1UWVA 1E1OA 1UE7A 4DK6C 4GN3B 4ALPA 3S14H 1D7QA 1A8VA 3CCQA 4TQUS 2OCEA 2NN6G 5C3EH 2UXDQ 2RHQB 1Y1WH 3GTKH 1PH6A 1VQMA 1AH9A 2Q2IA 2UUAQ 3PGZA 1IYJB 2KCTA 1CKOA 3T1YL 5HY6A 1WJJA 2F4VL 3CC2A 4X64Q 4GKKQ 4A3IH 2IX0A 5FLXc 3BJUA 4LFAQ 4LFCQ 3HOWH 1K9MC 1AE3A 1IZ6A 5ELOA 4JI6Q 4B3SL 2R92H 4XTCS 4HIOA 4OONA 1RIPA 1QZGA 4A3JG 1Q1BA 2NVYH 4A3DH 1EQQA 1HZBA 4GOPC 1P8LA 2B63G 1I6HH 3TS2A 2Z6KA 2ALYB 4KI0A 1GKHA 4DAYB 1KXLA 3KF6A 1MIUA 1X65A 3S15H 3KLWA 3PSIA 4C2MH 2YV5A 4DR2L 2ZM6L 1OXSC 2XTIA 2VW9A 3UDFA 1HR0L 2PNHA 1IBKQ 4X65Q 1Y1VH 1K3RA 3S2HH 1V1QA 3OTOQ 3CW2C 1NBWA 3I4OA 1UE6A 1PH9A 4LF4L 2UXCQ 4WJ3M 4HJ9A 3PO3G 4A75A 1Q1EA 1JJ2A 1X3EA 1U5KA 4P75A 2NN6I 2KHJA 4RG1A 1JB7A 3UE1A 2NVXH 3KF6B 1Q8KA 2L15A 1MJCA 1R9TH 2PQAA 3NBHB 4WJ4A 3OW2A 1HNZL 1KIXA 4X6AH 3AFQA 1CKNA 3K7UC 5K36G 3J80i 2YTVA 2K50A 1K83H 4IOCA 4A76A 3HOZG 2B63H 5JEAJ 4BY7G 1G291 3K8AA 1CSQA 4KLKA 4L5QA 3KFUA 1KRTA 4DV5Q 2WAQE 4HJ8A 4OX9L 2VNUD 3RR5A 4DR3L 1EIFA 1VQGA 4JBJA 1EIYB 2JA8H 1Y1VG 3HKZG 3ZJYC 1LTLA 3M4QA 5GAHC 4XIGS 5IYBH 4JI2Q 4DV1Q 1PYSB 2BA0A 4DR5Q 3FKIH 1PV4A 1Y14B 1VQCA 4NPSA 3WWVA 1PH2A 2AHOB 4A3DG 3FKIG 5IT9c 1M1KC 4LF8L 3GTGH 3PF4A 5M5XH 4YHHL 3PO3H 3VDYA 1D8LA 1YITA 2E2JH 1YNXA 2Z6KC 4DV6L 1HZAA 2A1AA 4QL5A 4PMWA 1W2BA 1VQBA 1FVIA 4DUYL 1HZCA 2HIVA 4KHPL 1PH3A 2B3GA 4LF9Q 4BA2I 5IY0A 1CKNB 4PZ8A 3HOUH 1E24A 2D0OA 1KRSA 3GTPH 4C3HH 4EX5A 5IP7G 5IWAQ 1V9PA 3KDFB 2ES2A 4GLAC 4OX9Q 3U50C 4DUYQ 3H3VH 4KHPQ 3STBC 4A3FH 1XPOA 1UE5A 2ATWA 2VUMG 4LF9L 3GTMH 3I55A 1VQ5A 4L5SA 3UDXA 1K73C 2GVBA 5EAYA 3M7NA 1VQ8A 1G51A 4IO9A 1O7IA 2JK8A 2I0QA 3I4NG 4P72A 3MEFA 3BU2A 2JA9A 1DGSA 1VQOA 5H1SE 2K75A 3CCJA 3PO2G 3F1ZA 2YTYA 5AJ3L 2R7ZH 2UUAL 2N78A 5C44G 4GNXC 2ZJRA 3ICEA 1Q82C 4A3CH 1OXUA 1QVGA 1EOVA 3W1BA 4JI5Q 5IYDG 4YY3L 2C35B 1RL2A 3J81i 1Q81C 4LF7Q 4QQBX 4PZ7A 4DR7L 1VQDA 4JI1Q 5BR8L 3J7ZC 3F2DA 1L2FA 4JI7Q 5GAEC 4BXXH 1X3FA 4A3IG 4EQ5A 3L2PA 3HOYG 1X9NA 2R7ZG 1W3SA 1HR0W 3HOUG 1NMGA 1VCIA 2MFIA 1KHIA 2ZTDA 3TQYA 5M3FH 4BY1H 1PH7A 4R4TA 2IHFA 3ERSX 5FLMH 2ZM6Q 4LUOA 4R1JA 1J5EQ 4JC0A 4LFAL 4AYBG 3T1HL 2VQFQ 3PUXA 1SLJA 2HIXA 1QUQB 4DV3L 1T9HA 2VZAA 4MNOA 1B70B 4P73A 1N9WA 3TREA 1VQ6A 4IPCA 5IYDH 1TWAH 3NENA 1X54A 3AFPA 1KAWA 3EIVA 2RCNA 3RLFA 3M3YH 3UDIA 2NVQH 2E2HH 2F3IA 4DV4Q 2B29A 3PUZA 3CCMA 3RZDH 4HJ5A 3J81c 2AWNA 1PH4A 4BY7H 2PQAB 4YCUA 3ULJA 2Q2TA 2R93H 1Q86C 4X64L 1VQKA 1WCMG 3MXNB 2JA5H 2PI2A 4BBSH 5HGQA 1QVFA 2UU9L 3RN2A 2MNAA 2AKWB 2CWPA 4DR3Q 4B3TL 4UY8C 4DV2L 4NXNQ 3EBEA 3F2BA 3RN5A 1ASYA 3GTQH 3CCUA 2JEAI 4A3EH 4IFDJ 5M5YH 4X66Q 2R7FA 4DKAC 1XMOQ 4JI2L 2E2IH 2KBNA 4A3GH 1A63A 4JI8Q 4TVAB 1N33Q 4JG2A 4UPAA 5IYBG 4LUVA 3I7FA 3HOYH 2JEBI 4GOPA 3PUVA 4PZ6A 3M4OH 1G6PA 4B3RL 4DV6Q 3GO5A 3GDEA 1VQHA 1XPRA 3PF5A 2E8GA 4JI4Q 4JI8L 1VQNA 3RZOH 1P16A 4X65L 2D0PA 1YVCA 1PVOA 3K81C 1I94L 2WFWA 2CWAA 3M9BA 3HOVH 3H0GH 3S16H 4LFBL 4YWMA 3HOXG 1E7ZA 2YYZA 2KENA 5DLQE 4X62Q 2HHHL 1K0RA 1K8GA 1BVSA 1I50H 2ZTCA 4JI3Q 1MKHA 2UUCQ 4P74A 5ELNA 1BBUA 1B7YB 4R4OA 3STBD 1U0LA 3PIOA 1NY4A 1YHBA 5LMUQ 2I5LX 3CPFA 2JA8G 4K0KL 5BR8Q 4AH6A 3E0EA 1JE5A 3I56A 1VQJA 2K5HA 2BH8A 2UUBL 3T1YQ 1EYGA 1BBWA 4A3BH 2E5LL 3CQZH 4JV5Q 3GD7A 4A93G 1JJGA 2CKZB
chains in the Genus database with same CATH superfamily
5C5LA 5TSSA 3CKIB 3ER0A 5A2QL 2YU9H 4DV0Q 2P5ZX 4JPBW 4IOAA 1PTOD 1ZXTA 1HNXQ 4IUTA 2B2UA 3I73A 4EGVA 1XMQL 3CPWA 4B3MQ 4FDBA 1PTOB 4A4IA 4A3BG 3K5MA 1AZQA 3A5ZB 5C0XJ 2B2VA 2RDFA 1GO3E 4FXKC 2K7VA 2XGTA 2NVTB 2F0MA 3TMEA 4NXNL 1JICA 4X66L 2BH2A 3HOZB 4AQYL 4MZ9A 2AQ2B 2VY3A 3DLLA 4A3GG 3DEPA 3H15A 4G57A 3JAMi 4DXFA 1B3AA 2QDBA 1GHJA 1STEA 2K28A 2DN8A 5IP9H 1YNJD 3SR1A 4JI0L 2Z4IA 4JCVE 4NXML 1CK1A 2TMPA 1QG7A 4L63B 4LWCA 4A93B 1BO0A 1B4OA 1SNOA 2R6GA 3S1MH 1PYWD 1TWFH 4JOIA 3Q8DA 2N88A 4OL7A 1X3QA 2VXWA 5KNDA 2DY7A 1ICWA 1SNQA 3J81j 2PMZE 4A93H 1EEID 2I46A 3I4NB 2WAQG 1GXDC 2H4OA 2V1CC 2JE6I 5IGCA 4YCWA 3I2ZA 1IBMQ 4OO1I 4RGTA 4DR4Q 4C3HG 4KKUA 1WTRA 2JQOA 4GNXB 1KDAA 3J81E 3RD4A 1Y69U 3VYSA 3CMAA 5E7NA 1AZPA 3OYYA 3OOCA 4V0BA 2WB1G 3HFZB 1TWCH 3RMHA 3CCRA 1BCPB 1J9OA 4DR1Q 2Y0SE 3U9OA 2HDMA 5FKAC 1I4GA 2C5CA 1BCPF 1BKBA 5CV5A 2R7DA 4WFN3 1TWFB 3AQQA 2Q2HA 2F0VA 2IL8A 3H3VC 3HOVG 3G48A 1H9SB 1EFWA 4JVZA 1Q12A 5IGEA 4LF7L 1GOZA 4HSVA 1WTWA 1J6QA 2D62A 2O5IC 3BZCA 4C3IH 4O2DA 5IT9E 4UP7A 4DR2Q 1TS5A 3CD6A 4AYBE 4DR1L 1ILPA 4POFA 2UUBQ 3QG1A 3CCVA 1I50B 2JJQA 2EYLA 1QWYA 4ABNA 2IW3A 2Z4HA 1GHKA 1CZWA 3G4SA 4K2KA 2UXBL 2SDFA 1YJ9A 4JBWA 4QY7A 1QNKA 3J80E 2F0JA 2R92G 5IIFA 1MJEA 1BNZA 1EY7A 1Z47A 4JI6L 4LF4Q 3IFTA 3DXJC 4DK1A 1GM5A 2NBFA 1M90C 5CMDA 3W3AA 2MHVA 5EPJA 2R93G 3EQLC 2VQFL 2OF1A 2IWHA 5ELBA 1EIGA 4XQJA 4U673 2GVAA 4CBVA 2HHHQ 3AEVA 2EXZA 2B2WC 3NK9A 4NXMQ 3A55A 4S3SA 1S5CD 1X6OA 2EYJA 2SNMA 3JAME 3T1HQ 2HUGA 1PRTD 3FKIB 5CORA 5IGBA 2KOLA 4U68A 4DV4L 3H09A 3OMGA 1FGUA 3CXCA 3CMEA 1SAPA 4UP9A 1HNXL 4IJHA 4HEDA 1M8AA 2EIFA 2K1BA 1IBML 3PUWA 5J1ZA 4JI4L 3GP7A 5EJWA 5C0XI 4DV2Q 1E22A 2ZXRA 1B44D 3NPPA 2EJGC 2CQOA 4EQNA 5C4JH 2E2IB 4LF5L 2N49A 1YJWA 2NUCA 1PH8A 1FYCA 3D4WA 3K5OA 4CDFC 1TT2A 3U4VA 3LX0A 3KDFA 1D6EC 1TS4A 4BA1I 3KOJA 5FLXE 3G6EA 1A62A 1Y8PB 3CP0A 1YIJA 3DWPA 1E2VA 1SDFA 1UWVA 3QR8A 4ZYSA 1E1OA 2JA5B 4ALPA 2RQXA 4CJ1B 2D5DA 3MHBA 2BDNA 2B2TC 2SOBA 3DWAA 1AH9A 4IUUA 1CKOA 1WJJA 1F2YA 5FLXc 2QF7A 4LFAQ 1LTBD 2PZUA 1K9MC 3FPUB 1I3QB 2EYFA 2R92H 1XTCD 1K3BC 2F0KA 4DNTB 3D8GA 1HZBA 1HHVA 1KXLA 1E2WA 3J7AF 3S15H 3KLWA 4DR2L 1T5XD 1PFMA 2WV6D 4OEMB 1V1QA 1NBWA 4HJ9A 4A75A 1S5BD 1U5KA 3KF6B 2L15A 4DN4M 1KIXA 4NMZA 3AFQA 1A3TA 1VMPA 3J80i 4A3MB 2KCCA 4A76A 1EFID 4XDXA 2VNUD 4DV5Q 2WAQE 2DNEA 4OX9L 2M2LA 4OO1H 1EIFA 1GUSA 1JOOA 4JBJA 2WINB 1V8QA 2K5WA 2BA0A 1PV4A 4TRDA 1Y14B 1PH2A 3WWVA 1EYCA 2AHOB 1K83B 5C3WA 1YITA 3KBGA 3W2DA 1YNXA 1CQVA 2Z6KC 1JWSD 2A1AA 1R4PB 1A2TA 1VQBA 4PMWA 1HZCA 4LF9Q 4BA2I 3GTPH 4C3HH 3S1RB 2B2WA 3ONAB 5IWAQ 4DGZA 3U50C 4DUYQ 1G2TA 3STBC 4A3FH 2ATWA 1NUCA 3GTMH 4IALA 1EOTA 3UDXA 4IUNA 1G51A 1EY4A 2PQEA 1CT1D 1VQOA 3BU2A 3PO2G 2QDLA 5AJ3L 3MTSA 2UUAL 4KY7A 5G3LF 2EPBA 2ZJRA 3ICEA 1OXUA 1QVGA 1EOVA 2B8GA 3W1BA 4JI5Q 3A54A 5IYDG 3J81i 1RL2A 1K28A 4QQBX 4BBRB 5D3IB 3O13A 1BOSA 2JXMB 4RGMA 4FF1A 1CA5A 3QWNA 1H9JA 3PO3B 4FF3A 1NR4A 4BXXH 4LMQD 1MSGA 1G6ZA 1TY0A 1X3FA 2KEEA 2MP1A 3HOYG 1X9NA 1HR0W 2L4NA 1KLGD 2PNRC 2A6HD 4H7BA 4LUOA 1K0SA 1F77A 4AYBG 3T1HL 2R92B 4JW0A 3URYA 4DV3L 1T9HA 4N9PA 2Z9HA 4MNOA 4P73A 3TREA 4N8X1 4IPCA 1TWCB 3K5LA 2FMCA 3AFPA 3CHBD 1G8ZD 2F3IA 4DV4Q 3CCMA 1PH4A 1Y1WB 3J81c 1STBA 3ULJA 1HFGA 1DJRD 3SK6A 1DZ1A 3RN2A 5I2XA 4DR3Q 4B3TL 4RWSC 5KRUA 3RN5A 2XWJB 2JEAI 1PLFA 2FFKB 5IGDA 2EZVA 3TSSA 4ZUJA 4GOPA 3PUVA 3DM1A 1G6PA 4B3RL 2X69A 4DV6Q 3I8ZA 3GDEA 1VQHA 2A69C 3RZOH 3HKZB 1YVCA 3Q23A 1I6VC 1PVOA 3K81C 1C8CA 1I94L 3S16H 1LT6D 3OW7A 1K8GA 2F0HA 4JI3Q 5ELNA 3FMCA 3PIOA 5LMUQ 2JN4A 4K0KL 1IW7C 5BR8Q 4AH6A 2BH8A 3QOLA 3AB9A 4A3BH 4JV5Q 1ENAA 2CKZB 2LSSA 3HOZH 1B50A 2LMCB 1A6XA 5M3MB 1VQEA 4YWLA 3TS0A 1A3UA 2LXKA 2ZJPA 3RZDB 1MBYA 4ZCKA 3VA7A 5FLXL 5IE8A 2WB1E 1ZKOA 4M1UB 1PA6A 2PI2E 2BDOA 3KJPA 3MFYA 5HURA 1S4ZA 4CKEA 4KY5A 4BBSG 3L7ZC 2HCCA 3MWYW 3NUCA 2K01A 2CHBD 1D2BA 3D6WA 3D0FA 2VUMH 1EY5A 1CUKA 1SMYD 2XN9C 2NVQB 3HRZC 4C56C 2VUMB 3GTPB 3KLRA 1DYQA 4BXXG 1M4VA 2Q8RE 4WJWA 4DU9A 2RBMA 4A3BB 1LM0A 4X3KA 3UI2A 4O42A 4BY1G 2PMZB 3I91A 1JC7A 1XMQQ 3A56A 1TWGB 1F9SA 1E1TA 4CKBA 1ZYRC 3S17H 3S1NB 4HIKA 4KD3A 4JYAQ 1SROA 1HNZQ 2MO1A 4GLVB 2FXQA 5GADC 4DUZQ 3OPOA 4XT3B 3K59A 4A3FG 5C44H 2MO0A 3M85A 1N33L 1I5FA 3BZKA 5IYCG 4PNYA 4KHVA 2NZOA 5COYA 2EY5A 5CYUA 3G71A 2K5NA 3K7AH 3KYHC 1NJIC 1X56A 3HOUB 1PTOF 5GQOA 2I5HA 5D65A 3E9HA 4C3IB 1N8RC 1RKNA 4LNQA 4FO2A 2H1EA 1CI3M 1SNPA 4X62L 5M3MG 1HUMA 1FNUA 1OXVA 4A3LH 2WAQB 4JI0Q 1EL0A 1PRTC 2EJFC 4KMUC 5M5WH 1LYLA 4ID6A 1E3PA 1H9KA 2B2YC 2O4XA 5AJ3Q 2B2TA 3FHWA 4KV6A 2LS01 4RCOA 3U9SA 1EZ8A 5ISRA 2N55A 2Y0SG 4H13C 4R8NA 2B63B 1PFBA 2HDLA 3HOWG 4KJNA 3IFDA 4ZUIA 2K6AA 1KC8C 4A3KH 1HNWL 2OTLA 1WTXA 1UEAB 2OTJA 1IL2A 4P2CB 4DAYA 2EY1A 4N9TA 3IAYA 3NELA 1VDZA 3NSWA 3A0JA 2QILA 1RTOA 2K14A 4JI1L 1VF7A 3BG3A 3NEMA 4K8IA 5C4XH 3I4LA 3GV6A 3S1MB 1JR0D 1YHAA 2CCZA 4CDCC 2N8NA 2NVXB 1N36Q 4F7XA 5LMNW 4IZ8A 4C3HB 3S1RH 2ZJQA 5CV8A 3GTLB 1HNWQ 1S72A 1N32Q 4DV7L 1PH1A 1HQMC 5M5YB 5M3FG 4B3TQ 2NVYB 4BBRG 1RD9D 1WOCA 5EPKA 3BDOA 5GROA 2DJGC 1V1OA 1QVCA 1KQSA 2RDGA 3SGIA 3H94A 3VYTA 4K5WA 4DAVA 3CC4A 2GN5A 4BWGB 5BN5A 1ENFA 1LTSD 5JJLA 3ULLA 5T1GA 3E3XA 1XNQQ 3TRZA 2XNAC 3UE0A 1HA6A 1HXYD 3PUYA 3Q22A 1Y8NB 3J7AV 4IN3A 4RAUC 2WP8J 4DAPA 3CCLA 2HD3A 4DXGA 4UAIA 2A68C 4KK7A 4JI3L 1HRJA 1HH2P 1L0WA 1GJXA 2PW7A 1EQRA 4DNIA 1U4MA 3OWFA 4HIDA 1SYBA 3S2DH 1X3GA 3R2TA 3GTKB 5D14A 2R7ZB 1UE1A 5IT9L 1KL9A 3MVVA 4PQXA 4LFBQ 4DV0L 1VQ4A 1I4RA 4RCNA 1HR0Q 1IHZA 3PQIA 4DR6Q 1V43A 1V1PA 4POGA 1BCPC 4H0LC 5FO8B 1RHPA 3CU7A 4DUZL 1HTLD 3G7LA 4EVOA 4HIMA 1I3QH 3J7A5 1FJGQ 4DR5L 2VL6A 4I7AA 2CFMA 3WDNA 2WACA 4LF8Q 3CAMA 1SYCA 2K5VA 2NB0A 1XXGA 4ZQ3A 1UNSA 4O0AA 1NNXA 4JK1C 4YWKA 1XPUA 2MGSA 1TVXA 3TP7A 5LL6X 5C3EG 3TN2A 4R4CA 1I4QA 2WKCA 1Z9FA 1U9RA 2EQSA 4LFCL 2L0CA 1X55A 1NTGA 4OIJA 3L3OC 3F2UA 2ZXOA 3VR6A 2E75C 3S14H 4QCLA 1CQFA 1SYGA 3I72A 1Y1WH 3GTKH 1PH6A 3GTJB 1EYDA 1IYJB 3T1YL 5HY6A 4GKKQ 3CC2A 3BJUA 4JI6Q 1ILQA 2ICIA 4B3SL 3TDQA 4HIOA 1RIPA 1QZGA 1BBXC 5M9OA 1Q1BA 4A3DH 2F0QA 1I6HH 4QMGA 5F2DA 2Z6KA 1TWAB 4HN7A 3LWUA 1STNA 4DAYB 3FVQA 3C46A 3KF6A 1PZID 1X65A 3PSIA 1XYIA 4C3JG 2YV5A 2ZM6L 3HOVB 3QB3A 1HCZA 2PNHA 1XWEA 3OTOQ 2UXCQ 3CW2C 3I4OA 1UE6A 3PO3G 1Q1EA 4C1NK 1JJ2A 1X3EA 4CDEC 4I65A 3GTQB 3UE1A 1N32L 1R9TH 4L8JA 3MXPA 1K8MA 1AEXA 4X6AH 3DWQA 1CKNA 2EJMA 2YTVA 2XSCA 1TKWB 1K83H 1LO5D 5KEEA 2HQEA 5JEAJ 2MJ8A 4KLKA 1CSQA 2NTTA 4R8IA 1HUNA 1Y1VG 3ZJYC 5IYBH 4JI2Q 1PYSB 4NDXA 3FKIH 1PZJD 1VQCA 1Z7TA 5FK9C 3L9AX 5IT9c 1M1KC 4F88A 4YHHL 5KIXA 3VDYA 2O2LD 4RKLA 1W2BA 1FVIA 2HIVA 3MA2B 2FINB 1VMCA 2B3GA 4FXGC 5IY0A 1CKNB 1S5DD 3HOUH 2QEJC 1E24A 5C0XH 1KRSA 4EX5A 4QUFA 4OX9Q 4QB4A 3H3VH 1QJOA 4KHPQ 1EWHA 5IODA 1RJTA 1FNVA 4LF9L 2Q8TA 5JOBA 4K6DA 3HZXA 2EYPA 5M5WB 3BVGA 1O7IA 3A8KE 3NXWA 4TSSA 1WTVA 5KNCA 1EQTA 1DGSA 5H1SE 4FF2A 3J81L 2YTYA 2A73B 2R7ZH 2XVSA 3BDLA 1CM9A 1ZYRD 1GUOA 3M7GA 2G9HD 1DXMA 2F0GA 3BDCA 1ENCA 4PZ7A 5BR8L 3SHLA 1Q90A 4H44C 5I9PA 2RCFA 1W6KA 4JI7Q 1CTMA 4C2MB 4A3IG 4EQ5A 3L2PA 3FPPA 1SJED 1W3SA 2EY2A 1MHWC 4HCSA 5M3FH 1PH7A 3T51B 3DEOA 5FLMH 1HPCA 2PZTA 3MXUA 3S17B 2WB1B 2VQFQ 1SLJA 1QUQB 1RF2D 1N9WA 5C4ZA 1VQ6A 4J1MA 2LFNA 3D3RA 1KAWA 1R4QB 2RCNA 1L0YB 3RLFA 1SE4A 2E2HH 2VB2X 2QW7A 4HJ5A 4CHTB 2R93H 2XIWA 1VQKA 1WCMG 1LTRD 2PI2A 2JA5H 3OHXC 3IL8A 2UU9L 5DAUA 2AKWB 4DV2L 4NXNQ 3CCUA 3E0JA 3D6CA 4X66Q 2M00A 4DKAC 3K58A 1XMOQ 1CA6A 1PFNA 5KYIA 4ULLA 1I6HB 5C4XB 2JYOA 4TVAB 4JG2A 4LUVA 4CDDC 1SJHD 4G4KA 2F1MA 4B9XA 4PZ6A 1SXTA 1DOMA 1TS3A 4WORA 4HTHA 1RODA 4JI4Q 4JI8L 2EYMA 1ESFA 3OIPA 3TP5A 3TP6A 4DNRB 2WFWA 2CWAA 3M9BA 3NTKA 3HOVH 2YYZA 5DEHA 2KENA 5DLQE 2ZTCA 1MKHA 3OSOA 5JPMC 4P74A 1B7YB 1U0LA 2PPBC 1NY4A 1YHBA 1R9TB 5A2QE 2JA8G 3E0EA 3I56A 2K5HA 3MAQA 1EYGA 2E5LL 3GTOB 1WD0A 1KTKA 2NWGA 4IUVA 2BE5C 4V190 1XNRQ 3A74A 2R93B 4XQQA 4APVA 4B3RQ 2I07B 5IOCA 2IY5B 5LMNQ 4IPDA 4C3JB 1II3A 5AFWA 3Q6SA 1SNCA 2J7ZA 4DF7A 4DFAA 4MHEA 5IGGA 3K7AB 4UHVA 4L5RC 1YNNC 2NZHA 4LUZA 2RF4A 5M3FB 5LMUL 1A0IA 1B9NA 1TWHH 4B3SQ 2AUJD 1JB3A 4KD4A 3NBIA 2E5LQ 1PMRA 3PMFA 4KHZA 1C7YA 1SYEA 3QJYA 5EKLA 4DAMA 5DM63 2IJ0A 2ICEC 1WYDA 3SK8A 1PTOH 3VR4A 4GOPB 2ZXPA 4M8AA 2F3VA 5JJKA 3W1GA 3H0GB 4J6HA 4A3MG 5IP7H 4ME3A 4LF6L 3ND9A 3AYHB 5JVG3 3LNNA 1J5EL 3WOEA 4GNXA 4IURA 4QF4A 1MD2D 2QKIC 1K8AC 4ODGA 1YI2A 3S1NH 4IFDH 4JI7L 2K04A 3NE5B 2N3SA 1PZKD 1GD7A 1BXTA 1STGA 1PFSA 5JVH3 4BBSB 5EQ0A 1U4RA 2QGQA 3QIAA 3KLSA 1TWHB 2L55A 4YHHQ 1I94Q 4HJAA 2H5XA 2K52A 4QIWE 5I6YA 1F2MA 4A3LG 3BYTB 1LV9A 4A3KG 5M3MH 1UAPA 3GTLH 2L1BA 3HOXH 4E6IA 5IGFA 5I9OA 1OXTA 4IFDG 1UEBA 4Q5VA 2E74C 2A6EC 4MTKA 5A35A 2Z1CA 3K6OA 1YJNA 1XJVA 4B3ML 3UDGA 1WFQA 1JE4A 1JMCA 2BE5D 3Q0AA 1HQRD 4BS9A 4OWWB 5ELEA 5IYCH 1NCVA 3D31A 3J80c 1X32A 1LTID 1BDOA 2XWBB 3PCOB 4A3MH 4OXPA 3A7AB 3PV0A 2MUYA 2F3WA 1SRUA 2DGYA 3MC0B 5E1FA 1EY8A 2YTXA 2ZTEA 4WRDA 1IBLQ 3S24A 1QE6A 3J7YW 4AQYQ 1HZ9A 2AQ3B 2JA7H 1S40A 4LK1C 5C0XG 5HGTA 1EEFD 1WI5A 1ASZA 4PMBA 3S2HB 1VQLA 2KHIA 4F8MA 4X3UA 3FDTA 2KJXA 4OWTB 3DM3A 1KAAA 1YHQA 3JAMc 4NP5A 1OTCA 4ZKCB 4IJLA 3HG9A 1EWIA 3A8JE 3B6YA 3Q24A 5LMNL 1O80A 1VQAA 1IKLA 3CF5A 4RKBA 3D4DA 3A8IE 4JYAL 3A5UA 2A5HA 2PYKA 1QB5D 2A6HC 1BF4A 3I4MG 5EBDA 4GKJQ 3EVQA 4DR4L 5J39A 3OMCA 4A3KB 1O7ZA 1O7LA 1XTDA 2DUDA 1SMXA 4I7ZC 4Y52H 2F0OA 1AE2A 2LXJA 1SEBD 3CCEA 4A3EG 1Y8OB 1E0BA 1WCMH 3E6ZX 1SE8A 2EVBA 1JOKA 3GTOH 5C5MA 4A3JB 1DM0B 4LW1A 3SEBA 1VQPA 1SFOH 3K80C 3ULPA 1H9RA 4TKOB 1SR3A 3BZDB 3R3OA 3CQZB 3EJIA 2HT1A 2JA6G 3K0XA 4FXDA 1BQQT 5JEAH 1HJPA 5NUCA 1SN8A 4GN5A 3PIPA 1WTOA 5FLMG 2Z0SA 5C4HA 2CVRA 3G6JB 1H95A 2KVMA 3W5OA 2AWOA 4O1NA 1LACA 2VQEL 2F0DA 4DPGA 5G3LD 4QJFA 3KF8B 2KCMA 4BBRH 3KJOA 1XNRL 4A3EB 1C48A 1KD1C 3D4RA 1GUTA 2GA4B 3BYYB 1IXRA 4OO1G 2SNSA 2UUCL 1C9OA 3LGJA 4L6TB 1LUZA 5LL6S 2AMCB 4K5XA 4KKSA 2UXBQ 3TBIB 1NSNS 3VR3A 1VQFA 4G7OC 1UE7A 3BS1A 4AYBB 4DK6C 1T5EA 4NW2A 3R8BA 1Q8IA 4TQUS 2UXDQ 2J0TD 4RHSA 2K5DA 3NWTA 4PV1C 4KKTA 1JOQA 2VB3X 2B8FA 2Q2IA 2UUAQ 4BY7B 2KCTA 1YNND 2NZ1D 4X64Q 4A3IH 4LFCQ 3HOWH 2X6LA 1B9MA 1AN8A 3I4MB 1IZ6A 5ELOA 4QUCA 5C3EB 4DA2A 2KUMA 4XTCS 4OONA 3MZ5A 1YNJC 4NKLA 4A3JG 2ALYB 3S9WA 2EYHA 2J4XA 1CZGA 1TU2B 4HSPA 3EA6A 1WCMB 3C2PA 2FJ2A 3S16B 3SDZA 3UDFA 2RDHA 4X65Q 1K3RA 3S2HH 5CBEE 1B1ZA 4WJ3M 1JB7A 2NVXH 2NN6I 4BY7G 1HFNA 1MJCA 4WJ4A 2PQAA 3NBHB 3NQIA 1PDQA 3T16A 4ZK9B 1B2TA 5K36G 1RDPD 3GTGB 4IOCA 2B63H 3K8AA 3KFUA 4DR3L 3KUPA 1WD1A 1BCPD 3HKZG 2JA8H 1LTLA 5GAHC 5I6WA 4DV1Q 4DR5Q 1PTOC 4NPSA 5CC4A 3T13A 4A3DG 3FKIG 4LF8L 4ME5A 1D1IA 3PO3H 1GUGA 2A68D 5C44B 1QNUA 2F03A 2PO4A 1SE3A 5DNFA 4C1NI 2D0OA 1I4PA 1G2SA 4RH6A 3IKJA 2EYOA 3KDFB 3HEJA 5KNBA 1BUVT 1CHQD 2F0TA 2NYZD 1XPOA 1B3QA 2VUMG 2F0EA 1IW7D 3ZYYX 1TY2A 2GVBA 3M4YA 5EAYA 4IO9A 2I0QA 3I4NG 4P72A 1ZEQX 3SK5A 4PMCA 1WTPA 3RUZA 1A15A 1EU4A 3P20A 4G7ZC 1Q3LA 1Q82C 1EY0A 2C35B 1Q81C 1VQDA 3VYRA 4A3DB 3J7ZC 1KDCA 1BR9A 5BN4A 3BVMA 1SNMA 3KF8A 3S2DB 2K05A 5E3FA 2R7ZG 4IUPA 3PIP3 4DK0A 1VCIA 2ZTDA 1KHIA 1U4PA 3HS0C 2K32A 1ONLA 1TQOA 2L12A 3ERSX 3VR2A 1J5EQ 1F9QA 4N8FA 1LLRD 2F0NA 2CW0C 3PUXA 2HIXA 2KCNA 4R9WA 2VZAA 3GQBA 5K36H 2A74C 3NENA 3V2TA 1IKMA 5EKIA 4K14A 4QIWB 3M3YH 3UDIA 2A69D 2NVQH 4LJZC 2WIIB 2B29A 4KTAA 3PUZA 3RZDH 4BY7H 2AWNA 2XRSD 2PQAB 2QCPX 4YCUA 2A6ED 2B39A 1Q86C 4X64L 3MXNB 1DONA 1E2ZA 3HOWB 1XX8A 3HP3A 1QVFA 4FYDA 2MNAA 2CWPA 3ITPA 3P7JA 3F2BA 1ASYA 3GTQH 4IFDJ 1JQYD 4A3EH 3NBHA 5M5YH 2R7FA 4JI2L 3EROA 1SNDA 4ZRZA 3V05A 1N33Q 4UPAA 5IYBG 2Z8LA 3I7FA 4GZYC 3HOYH 2DY8A 3GO5A 3I90A 1VQNA 1SBBB 1P16A 4X65L 2AQ1B 2D0PA 1SYDA 4K0KQ 4K5VA 4YWMA 1KNEA 1BVSA 1I50H 3MXNA 1QCBD 1BBUA 1D5ZC 2ENBA 2CH4W 2KA7A 1I4XA 1JE5A 2IPKD 3T1YQ 1TS2A 4A93G 3GD7A 1JJCB 2F4IA 2ASBA 2K4KA 1SFOB 3FP9A 3N6RA 5CV7A 1LT5D 2KHSA 1Z6HA 5LHY1 4JBKA 1SYFA 2PZWA 2JA8B 4L5TA 2ID0A 4QGUA 4ZAIA 2E2JB 3PO2H 1HA5A 4IPHA 3NHHA 1LTGD 2RSNA 4FP5D 3T53B 1YEZA 3MEHA 2QEXA 3PO2B 1YZ6A 3K5NA 2F0IA 1KABA 3GV3A 1SSOA 1FD7D 3TEHB 1EUJA 3RLOA 3SE0A 4CKCA 5GAGC 3I4NH 1EIHA 4YIJA 5FOBB 4CJ2C 2JA6H 4DV3Q 4CJ0B 1MI2A 1YBYA 4JBMA 1PH5A 1O7YA 2B2YA 2OWOA 2JA5G 2B2VC 1J8IA 1Q46A 2F0FA 4UP8A 2MQHA 3H0GG 3HKZE 3JAML 1H9SA 1NE3A 4OWXB 4DK3C 4JOIC 4PG3A 4EQOA 3AU7A 1A3VA 4R4QA 4R4IA 2E76C 1WVLA 2E2HB 1RTNA 3OIQA 2Q8IB 4DV7Q 5CV9A 1IBKL 2IHEA 4K8JA 2MPMA 4IPGA 4JV5L 1S3OA 4FF4A 3RLNA 4RGNA 3E9IA 1ET6A 5EPLA 1GUWA 2VS1A 1VQ7A 4GKJL 1WTHA 4DV5L 5CR3A 4C3IG 2WKDA 3M3YB 3R2IA 4P71A 5T1IA 2QA4A 3RNUA 4KN4C 4NB3A 2UXDL 1CSPA 2HQLA 4DR6L 2Q2UA 3QO2A 3TZDA 4KY6A 3CC7A 3F2CA 1DOKA 3HKSA 4OELB 4CGYB 3HOXB 2PCFB 1A2UA 2Z6BA 3NTIA 3M4PA 1DOLA 2IX1A 4RMFA 5L37A 1I4HA 3AMUA 1JT8A 2OQKA 2RSOA 5FJ8H 5C6AA 3J80L 1PRTF 3BVZA 5FJ8G 3U4ZA 5EGTA 2A8VA 1PHJA 2BOSA 3CRLC 1L1OB 2F0PA 4A3CG 3KK7A 3IRBA 1LT4D 1DCZA 1VQIA 2F52A 1JCKB 4Q0FA 2JA7G 2VQEQ 5BN3A 4EQPA 2OQ0A 5I2YA 1D5MC 2F4VQ 4A3JH 2SEBD 1TWGH 1FGBD 1X3PA 1Q7YC 1IYVA 1KDBA 1O78A 5J3BA 3X3MA 5KYLA 4J15A 3TP8A 4GS3A 2IX3A 3V96A 1L1OC 5IWAL 1QUQA 3DHQA 1F2ZA 5IP9G 1VS0A 1H9MA 5EBCA 5JAVA 2KECA 3CCSA 4AIMA 2RHSB 1QZHA 5D3DA 4Z9CB 5C4XG 1IL8A 4LF6Q 2EXDA 2EDGA 4H02A 4GKKL 1XMOL 1B8AA 5JPNC 2DNCA 1C4QA 1L1OA 1AFPA 3C1EA 1NMFA 5ELCA 1EU3A 2F0WA 5KGUA 2IT1A 4JI5L 4DV1L 4YY3Q 3GTJH 4GLXA 2OEOA 3VR5A 2UU9Q 4FVMA 4C3JH 4HMJA 4HMIA 1CKMA 3JC66 4GN4B 3S1QH 1C0AA 1PRTB 3LWEA 1ET9A 1NR2A 4LAAA 3U58A 1N34Q 1XNQL 4G7HC 1S5ED 1EY6A 1TR5A 2F0SA 2HCIA 3H3VI 4HJ7A 1L0XB 1U4LA 3EN2A 3HGBA 1TXYA 4BY1B 3KBXA 5CBAE 1VQ9A 1IYUA 3F8TA 4KN7C 5ELFA 2NVTH 1FL0A 1OXXK 1FJGL 1Y1WG 5JEAG 2BA1A 3OTOL 2UXCL 3NWSA 1EZ6A 1ICFB 4LF5Q 1N34L 1STYA 2JA7B 3I4MH 4RGOS 4UDUC 4B9WA 4Y7NH 3SK4A 2JSOA 4IFDI 4DR7Q 1GVPA 1N36L 5EKKA 4A3FB 3T56B 3GTMB 2L11A 3HOYB 1F9PA 1IBLL 1F9RA 5JJIA 4YCVA 4MTNA 5FO7B 2JA6B 3L0OA 1UUPA 2A19A 2G9DA 2B2UC 1D5XC 4XXEA 2I5MX 5CV4A 4XQNA 1DD2A 1PYBA 2G5DA 4GN3B 3C3LA 2V4DA 1D7QA 4HCEA 1A8VA 3CCQA 2OCEA 2NN6G 5C3EH 2RHQB 4XYOA 1VQMA 4A3IB 2LKVA 3PGZA 1LTTD 3K0YA 4B08A 2F4VL 1AW7A 2IX0A 5CV6A 2YU9B 3FRPB 1AE3A 3ERQA 2DJFC 4MIUA 1WTQA 4ZLTF 2NVYH 3K57A 3WOFA 2Y0SB 4GOPC 1P8LA 1EQQA 2B63G 3TS2A 4A3GB 4KI0A 1GKHA 1S5FD 1MIUA 1W6JA 3I70A 1FNWA 3KLSX 4C2MH 1OXSC 2XTIA 2VW9A 5FO9B 1HR0L 2C9OA 2CW0D 1EY9A 1IBKQ 4J8QA 3S15B 1Y1VH 3P75A 1PH9A 1JWUD 3QOJA 2K03A 4LF4L 2F0LA 4OGQC 2L9HA 4P75A 1ESRA 4RG1A 2KHJA 4XT1B 1Q8KA 5K5PA 2K33A 3OW2A 1HNZL 2X6GA 3K7UC 3MFGA 2K50A 3A7LA 3HOZG 2D2CC 1OO9B 1D1KA 2E2DC 1MSHA 1G291 2NTSA 3NP8A 4L5QA 1QOHA 1KRTA 1CFMA 4HJ8A 3RR5A 1VQGA 3SXHA 1EIYB 1G91A 2PW5A 1LABA 3M4QA 3T4AC 5JJZA 1V1PB 2CQAA 4XIGS 3H91A 1KNAA 2OT2A 3ND8A 3GTGH 5C3XA 3PF4A 5M5XH 2K5QA 1D8LA 1KLUD 2E2JH 2XRQD 3VA5A 4X3TA 4DV6L 1HZAA 1PXUA 4QL5A 2LY7A 4DUYL 4KHPL 3TZUA 2OXPA 1PH3A 4PZ8A 5J22A 1SMYC 5IP7G 3X3NA 1V9PA 2ES2A 4X3SA 4GLAC 3EFXD 1EWCA 2BCOA 5C4JB 1UE5A 4KJOA 5DM73 3I55A 1VQ5A 2EOTA 1MGSA 1LTAD 4L5SA 1K73C 3M7NA 1VQ8A 3NQTA 1VF5C 4RHRA 1JORA 2JK8A 3P1HA 3MEFA 3E5SA 2JA9A 5E4WC 3MXGA 3R93A 2K75A 2JP1A 2FMMA 3CCJA 4ZKBB 3F1ZA 3C1FA 3VYUA 4MN3A 2N78A 5C44G 4GNXC 4A3CH 1CHPD 4YY3L 4LF7Q 4Y7NB 2RVLA 1GUNA 4DR7L 4JI1Q 3F2DA 4HR7B 5M5XB 1L2FA 4K6LA 3S1QB 4ILWA 1EYAA 3PIO3 5GAEC 3DUZA 2M9VA 4OHJA 2F0UA 2EE1A 3RZOB 2D9UA 4FNFA 3SVMA 3HOUG 1NMGA 3H6MA 3NTHA 1RCVD 4K2LA 2MFIA 4BY1H 3TQYA 4R4TA 2IHFA 2ZM6Q 2NN6H 4R1JA 4JC0A 4LFAL 1JWMD 2O5JC 4XYQA 2CH4A 3S14B 2RA4A 1B70B 2R3ZA 5IYDH 1TWAH 1X54A 4HAEA 3EIVA 4RFBA 3OWEB 1HTPA 2TSSA 1QILA 3N52A 4IUQA 1EQVA 2Q2TA 2ZT9C 5I4DA 4OIKA 2AUKA 2FHTA 4BBSH 1NAPA 5HGQA 1STAA 1K8OA 4RA8A 3DMUA 4UY8C 5E4XA 3EBEA 1STHA 2KQ3A 2E2IH 2KBNA 1B53A 4A3GH 1A63A 4JI8Q 2L5TA 1FR3A 3FEWX 1ML0D 4IQZA 2JEBI 2RKSA 3M4OH 1XPRA 3PF5A 2E8GA 1AP0A 2KEDA 1Y1VB 3M4OB 4LFBL 1SE2A 3CRKC 3H0GH 3HOXG 2HHHL 1E7ZA 2EY6A 4X62Q 1K0RA 1TIID 5CGKA 2UUCQ 4R4OA 3STBD 2I5LX 3CPFA 3I3CA 2UUBL 1VQJA 5ELDA 1LT3D 4F87A 2R61A 1BBWA 1JJGA 3CQZH 1F2LA
chains in the Genus database with same CATH topology
1JJCB 2LSSA 3HOZH 3ER0A 2YU9H 1XNRQ 3A74A 2ASBA 2K4KA 1VQEA 4YWLA 4DV0Q 3TS0A 4APVA 4B3RQ 2LXKA 2ZJPA 2IY5B 3FP9A 5LMNQ 4IPDA 4IOAA 5IE8A 2WB1E 4JBKA 1PA6A 4L5TA 2PI2E 2ID0A 4QGUA 1HNXQ 3KJPA 3PO2H 1XMQL 4IPHA 3CPWA 4B3MQ 4L5RC 3L7ZC 4BBSG 4FDBA 4A4IA 4A3BG 2NZHA 1YEZA 4LUZA 2QEXA 1YZ6A 2RF4A 5LMUL 3A5ZB 3D0FA 2VUMH 3TEHB 1A0IA 5C0XJ 1CUKA 1TWHH 4B3SQ 1EUJA 3RLOA 2E5LQ 4KHZA 1GO3E 5GAGC 1C7YA 3I4NH 4DAMA 4BXXG 2XGTA 1WYDA 2JA6H 4DV3Q 4NXNL 4GOPB 1YBYA 5JJKA 3W1GA 1PH5A 1LM0A 4X66L 4JBMA 2BH2A 4AQYL 4BY1G 2OWOA 4A3MG 2JA5G 4MZ9A 2VY3A 5IP7H 3DLLA 1Q46A 4A3GG 4UP8A 3H15A 2MQHA 1XMQQ 3JAMi 3H0GG 3HKZE 4ME3A 4LF6L 1E1TA 3AYHB 3S17H 1NE3A 4OWXB 4DK3C 5IP9H 4JOIC 4PG3A 4HIKA 1J5EL 4JYAQ 1SROA 4GNXA 1HNZQ 4JI0L 4JCVE 4R4QA 1K8AC 4R4IA 2MO1A 4NXML 1YI2A 3S1NH 4GLVB 2FXQA 4LWCA 4JI7L 5GADC 4DUZQ 4A3FG 2N3SA 5C44H 2MO0A 4DV7Q 3M85A 1N33L 1I5FA 3BZKA 5IYCG 2IHEA 1IBKL 1GD7A 2NZOA 2R6GA 1TWFH 3S1MH 4JOIA 1PFSA 3Q8DA 3G71A 2K5NA 2QGQA 3K7AH 3KYHC 4IPGA 1NJIC 1X56A 1S3OA 4JV5L 3J81j 2PMZE 4A93H 5GQOA 2I5HA 3RLNA 3E9HA 4YHHQ 1N8RC 1I94Q 2WAQG 4HJAA 4LNQA 2H5XA 2K52A 3E9IA 4QIWE 2V1CC 2JE6I 4X62L 4YCWA 3I2ZA 5M3MG 2VS1A 1IBMQ 1VQ7A 4A3LG 4DR4Q 4GKJL 4OO1I 4A3KG 5M3MH 1OXVA 4A3LH 4DV5L 4JI0Q 3GTLH 2JQOA 3HOXH 4GNXB 5M5WH 1OXTA 4IFDG 1UEBA 1LYLA 1E3PA 5AJ3Q 1YJNA 4P71A 1XJVA 3FHWA 2QA4A 3RNUA 3CMAA 5E7NA 4NB3A 4B3ML 3OYYA 1WFQA 3UDGA 2UXDL 2WB1G 1CSPA 2HQLA 4DR6L 3HFZB 1TWCH 2Q2UA 2Y0SG 3CCRA 1JMCA 3CC7A 3F2CA 3HKSA 4DR1Q 4OWWB 2Y0SE 5IYCH 3HOWG 1BKBA 3D31A 3J80c 4A3MH 2R7DA 3M4PA 3PCOB 1KC8C 4A3KH 2IX1A 1HNWL 4OXPA 4RMFA 2OTLA 3PV0A 2OTJA 3AQQA 2Q2HA 1IL2A 1JT8A 2OQKA 3HOVG 1SRUA 3NELA 3G48A 2DGYA 5FJ8H 2YTXA 2ZTEA 3A0JA 1EFWA 1IBLQ 1Q12A 3S24A 3U4ZA 5FJ8G 4AQYQ 2A8VA 1HZ9A 1PHJA 4LF7L 1N32L 1L1OB 2K14A 1J6QA 4A3CG 2D62A 3IRBA 4JI1L 1VQIA 2F52A 3NEMA 5C4XH 5C0XG 1S40A 2JA7H 2JA7G 2VQEQ 1WI5A 3BZCA 4C3IH 4O2DA 1ASZA 2OQ0A 1YHAA 2F4VQ 4A3JH 4UP7A 4DR2Q 2CCZA 1TWGH 2N8NA 3CD6A 1Q7YC 4AYBE 1VQLA 2KHIA 4DR1L 5J3BA 1N36Q 4POFA 5LMNW 2UUBQ 4J15A 3CCVA 3S1RH 4GS3A 2JJQA 2ZJQA 1L1OC 5IWAL 4OWTB 3DM3A 1QUQA 1HNWQ 1S72A 1YHQA 1N32Q 3JAMc 5IP9G 4DV7L 1PH1A 1VS0A 5M3FG 1OTCA 4IJLA 4BBRG 3CCSA 4AIMA 2RHSB 1QZHA 4B3TQ 1EWIA 5C4XG 1WOCA 3B6YA 4LF6Q 3G4SA 5LMNL 5GROA 2EXDA 4H02A 1VQAA 2UXBL 3CF5A 1QVCA 1YJ9A 4JBWA 4QY7A 1B8AA 1XMOL 1KQSA 4GKKL 3SGIA 2R92G 4JYAL 3A5UA 1L1OA 1MJEA 1Z47A 3CC4A 2GN5A 4JI6L 1NMFA 4LF4Q 5JJLA 2IT1A 3ULLA 4JI5L 4DV1L 4YY3Q 3GTJH 4GLXA 1M90C 1GM5A 3UE0A 1XNQQ 3I4MG 3TRZA 3PUYA 2UU9Q 4DR4L 4GKJQ 4C3JH 2R93G 2VQFL 1XTDA 2DUDA 1CKMA 3JC66 1SMXA 2WP8J 3CCLA 4GN4B 4Y52H 2GVAA 3S1QH 1C0AA 2HHHQ 3AEVA 3U58A 1N34Q 1AE2A 1XNQL 2LXJA 4JI3L 3CCEA 1HH2P 1L0WA 4A3EG 1WCMH 3H3VI 4HJ7A 1EQRA 1SE8A 4DNIA 3EN2A 4NXMQ 4HIDA 1TXYA 3GTOH 3S2DH 1X3GA 1X6OA 3T1HQ 4LW1A 1VQ9A 1VQPA 1UE1A 1SFOH 1KL9A 3F8TA 3K80C 3ULPA 2HT1A 1SR3A 4LFBQ 4DV0L 1VQ4A 2NVTH 1FL0A 1OXXK 2JA6G 3K0XA 1HJPA 1FJGL 1SN8A 1Y1WG 1HR0Q 5JEAG 4GN5A 3PIPA 4DR6Q 4DV4L 1V43A 2BA1A 5FLMG 2Z0SA 1FGUA 3CXCA 3OTOL 4POGA 3CMEA 4UP9A 2UXCL 1HNXL 4IJHA 1H95A 3W5OA 2AWOA 4DUZL 4HIMA 2EIFA 2VQEL 1N34L 4LF5Q 1I3QH 1IBML 3PUWA 1FJGQ 3J7A5 4DR5L 2VL6A 3I4MH 2CFMA 4DPGA 4JI4L 4QJFA 5C0XI 1E22A 3KF8B 4DV2Q 3CAMA 4LF8Q 2KCMA 4BBRH 4Y7NH 3KJOA 1XNRL 4IFDI 4DR7Q 2K5VA 1GVPA 1N36L 4O0AA 2CQOA 1KD1C 5C4JH 4YWKA 4LF5L 2N49A 1YJWA 1XPUA 1PH8A 5C3EG 4OO1G 1IXRA 4R4CA 1IBLL 1Z9FA 2UUCL 1C9OA 4LFCL 2EQSA 3LGJA 5JJIA 3U4VA 1X55A 3KDFA 1LUZA 4MTNA 4YCVA 2AMCB 4K0KQ 1NTGA 3L0OA 4BA1I 3KOJA 3G6EA 1A62A 2A19A 2UXBQ 3CP0A 1YIJA 1VQFA 2I5MX 1PYBA 1UWVA 1E1OA 1UE7A 4DK6C 4GN3B 4ALPA 3S14H 1D7QA 1A8VA 3CCQA 4TQUS 2OCEA 2NN6G 5C3EH 2UXDQ 2RHQB 1Y1WH 3GTKH 1PH6A 1VQMA 1AH9A 2Q2IA 2UUAQ 3PGZA 1IYJB 2KCTA 1CKOA 3T1YL 5HY6A 1WJJA 2F4VL 3CC2A 4X64Q 4GKKQ 4A3IH 2IX0A 5FLXc 3BJUA 4LFAQ 4LFCQ 3HOWH 1K9MC 1AE3A 1IZ6A 5ELOA 4JI6Q 4B3SL 2R92H 4XTCS 4HIOA 4OONA 1RIPA 1QZGA 4A3JG 1Q1BA 2NVYH 4A3DH 1EQQA 1HZBA 4GOPC 1P8LA 2B63G 1I6HH 3TS2A 2Z6KA 2ALYB 4KI0A 1GKHA 4DAYB 1KXLA 3KF6A 1MIUA 1X65A 3S15H 3KLWA 3PSIA 4C2MH 2YV5A 4DR2L 2ZM6L 1OXSC 2XTIA 2VW9A 3UDFA 1HR0L 2PNHA 1IBKQ 4X65Q 1Y1VH 1K3RA 3S2HH 1V1QA 3OTOQ 3CW2C 1NBWA 3I4OA 1UE6A 1PH9A 4LF4L 2UXCQ 4WJ3M 4HJ9A 3PO3G 4A75A 1Q1EA 1JJ2A 1X3EA 1U5KA 4P75A 2NN6I 2KHJA 4RG1A 1JB7A 3UE1A 2NVXH 3KF6B 1Q8KA 2L15A 1MJCA 1R9TH 2PQAA 3NBHB 4WJ4A 3OW2A 1HNZL 1KIXA 4X6AH 3AFQA 1CKNA 3K7UC 5K36G 3J80i 2YTVA 2K50A 1K83H 4IOCA 4A76A 3HOZG 2B63H 5JEAJ 4BY7G 1G291 3K8AA 1CSQA 4KLKA 4L5QA 3KFUA 1KRTA 4DV5Q 2WAQE 4HJ8A 4OX9L 2VNUD 3RR5A 4DR3L 1EIFA 1VQGA 4JBJA 1EIYB 2JA8H 1Y1VG 3HKZG 3ZJYC 1LTLA 3M4QA 5GAHC 4XIGS 5IYBH 4JI2Q 4DV1Q 1PYSB 2BA0A 4DR5Q 3FKIH 1PV4A 1Y14B 1VQCA 4NPSA 3WWVA 1PH2A 2AHOB 4A3DG 3FKIG 5IT9c 1M1KC 4LF8L 3GTGH 3PF4A 5M5XH 4YHHL 3PO3H 3VDYA 1D8LA 1YITA 2E2JH 1YNXA 2Z6KC 4DV6L 1HZAA 2A1AA 4QL5A 4PMWA 1W2BA 1VQBA 1FVIA 4DUYL 1HZCA 2HIVA 4KHPL 1PH3A 2B3GA 4LF9Q 4BA2I 5IY0A 1CKNB 4PZ8A 3HOUH 1E24A 2D0OA 1KRSA 3GTPH 4C3HH 4EX5A 5IP7G 5IWAQ 1V9PA 3KDFB 2ES2A 4GLAC 4OX9Q 3U50C 4DUYQ 3H3VH 4KHPQ 3STBC 4A3FH 1XPOA 1UE5A 2ATWA 2VUMG 4LF9L 3GTMH 3I55A 1VQ5A 4L5SA 3UDXA 1K73C 2GVBA 5EAYA 3M7NA 1VQ8A 1G51A 4IO9A 1O7IA 2JK8A 2I0QA 3I4NG 4P72A 3MEFA 3BU2A 2JA9A 1DGSA 1VQOA 5H1SE 2K75A 3CCJA 3PO2G 3F1ZA 2YTYA 5AJ3L 2R7ZH 2UUAL 2N78A 5C44G 4GNXC 2ZJRA 3ICEA 1Q82C 4A3CH 1OXUA 1QVGA 1EOVA 3W1BA 4JI5Q 5IYDG 4YY3L 2C35B 1RL2A 3J81i 1Q81C 4LF7Q 4QQBX 4PZ7A 4DR7L 1VQDA 4JI1Q 5BR8L 3J7ZC 3F2DA 1L2FA 4JI7Q 5GAEC 4BXXH 1X3FA 4A3IG 4EQ5A 3L2PA 3HOYG 1X9NA 2R7ZG 1W3SA 1HR0W 3HOUG 1NMGA 1VCIA 2MFIA 1KHIA 2ZTDA 3TQYA 5M3FH 4BY1H 1PH7A 4R4TA 2IHFA 3ERSX 5FLMH 2ZM6Q 4LUOA 4R1JA 1J5EQ 4JC0A 4LFAL 4AYBG 3T1HL 2VQFQ 3PUXA 1SLJA 2HIXA 1QUQB 4DV3L 1T9HA 2VZAA 4MNOA 1B70B 4P73A 1N9WA 3TREA 1VQ6A 4IPCA 5IYDH 1TWAH 3NENA 1X54A 3AFPA 1KAWA 3EIVA 2RCNA 3RLFA 3M3YH 3UDIA 2NVQH 2E2HH 2F3IA 4DV4Q 2B29A 3PUZA 3CCMA 3RZDH 4HJ5A 3J81c 2AWNA 1PH4A 4BY7H 2PQAB 4YCUA 3ULJA 2Q2TA 2R93H 1Q86C 4X64L 1VQKA 1WCMG 3MXNB 2JA5H 2PI2A 4BBSH 5HGQA 1QVFA 2UU9L 3RN2A 2MNAA 2AKWB 2CWPA 4DR3Q 4B3TL 4UY8C 4DV2L 4NXNQ 3EBEA 3F2BA 3RN5A 1ASYA 3GTQH 3CCUA 2JEAI 4A3EH 4IFDJ 5M5YH 4X66Q 2R7FA 4DKAC 1XMOQ 4JI2L 2E2IH 2KBNA 4A3GH 1A63A 4JI8Q 4TVAB 1N33Q 4JG2A 4UPAA 5IYBG 4LUVA 3I7FA 3HOYH 2JEBI 4GOPA 3PUVA 4PZ6A 3M4OH 1G6PA 4B3RL 4DV6Q 3GO5A 3GDEA 1VQHA 1XPRA 3PF5A 2E8GA 4JI4Q 4JI8L 1VQNA 3RZOH 1P16A 4X65L 2D0PA 1YVCA 1PVOA 3K81C 1I94L 2WFWA 2CWAA 3M9BA 3HOVH 3H0GH 3S16H 4LFBL 4YWMA 3HOXG 1E7ZA 2YYZA 2KENA 5DLQE 4X62Q 2HHHL 1K0RA 1K8GA 1BVSA 1I50H 2ZTCA 4JI3Q 1MKHA 2UUCQ 4P74A 5ELNA 1BBUA 1B7YB 4R4OA 3STBD 1U0LA 3PIOA 1NY4A 1YHBA 5LMUQ 2I5LX 3CPFA 2JA8G 4K0KL 5BR8Q 4AH6A 3E0EA 1JE5A 3I56A 1VQJA 2K5HA 2BH8A 2UUBL 3T1YQ 1EYGA 1BBWA 4A3BH 2E5LL 3CQZH 4JV5Q 3GD7A 4A93G 1JJGA 2CKZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJC B;  2LSS A;  3HOZ H;  3ER0 A;  2YU9 H;  1XNR Q;  3A74 A;  2ASB A;  2K4K A;  1VQE A;  4YWL A;  4DV0 Q;  3TS0 A;  4APV A;  4B3R Q;  2LXK A;  2ZJP A;  2IY5 B;  3FP9 A;  5LMN Q;  4IPD A;  4IOA A;  5IE8 A;  2WB1 E;  4JBK A;  1PA6 A;  4L5T A;  2PI2 E;  2ID0 A;  4QGU A;  1HNX Q;  3KJP A;  3PO2 H;  1XMQ L;  4IPH A;  3CPW A;  4B3M Q;  4L5R C;  3L7Z C;  4BBS G;  4FDB A;  4A4I A;  4A3B G;  2NZH A;  1YEZ A;  4LUZ A;  2QEX A;  1YZ6 A;  2RF4 A;  5LMU L;  3A5Z B;  3D0F A;  2VUM H;  3TEH B;  1A0I A;  5C0X J;  1CUK A;  1TWH H;  4B3S Q;  1EUJ A;  3RLO A;  2E5L Q;  4KHZ A;  1GO3 E;  5GAG C;  1C7Y A;  3I4N H;  4DAM A;  4BXX G;  2XGT A;  1WYD A;  2JA6 H;  4DV3 Q;  4NXN L;  4GOP B;  1YBY A;  5JJK A;  3W1G A;  1PH5 A;  1LM0 A;  4X66 L;  4JBM A;  2BH2 A;  4AQY L;  4BY1 G;  2OWO A;  4A3M G;  2JA5 G;  4MZ9 A;  2VY3 A;  5IP7 H;  3DLL A;  1Q46 A;  4A3G G;  4UP8 A;  3H15 A;  2MQH A;  1XMQ Q;  3JAM i;  3H0G G;  3HKZ E;  4ME3 A;  4LF6 L;  1E1T A;  3AYH B;  3S17 H;  1NE3 A;  4OWX B;  4DK3 C;  5IP9 H;  4JOI C;  4PG3 A;  4HIK A;  1J5E L;  4JYA Q;  1SRO A;  4GNX A;  1HNZ Q;  4JI0 L;  4JCV E;  4R4Q A;  1K8A C;  4R4I A;  2MO1 A;  4NXM L;  1YI2 A;  3S1N H;  4GLV B;  2FXQ A;  4LWC A;  4JI7 L;  5GAD C;  4DUZ Q;  4A3F G;  2N3S A;  5C44 H;  2MO0 A;  4DV7 Q;  3M85 A;  1N33 L;  1I5F A;  3BZK A;  5IYC G;  2IHE A;  1IBK L;  1GD7 A;  2NZO A;  2R6G A;  1TWF H;  3S1M H;  4JOI A;  1PFS A;  3Q8D A;  3G71 A;  2K5N A;  2QGQ A;  3K7A H;  3KYH C;  4IPG A;  1NJI C;  1X56 A;  1S3O A;  4JV5 L;  3J81 j;  2PMZ E;  4A93 H;  5GQO A;  2I5H A;  3RLN A;  3E9H A;  4YHH Q;  1N8R C;  1I94 Q;  2WAQ G;  4HJA A;  4LNQ A;  2H5X A;  2K52 A;  3E9I A;  4QIW E;  2V1C C;  2JE6 I;  4X62 L;  4YCW A;  3I2Z A;  5M3M G;  2VS1 A;  1IBM Q;  1VQ7 A;  4A3L G;  4DR4 Q;  4GKJ L;  4OO1 I;  4A3K G;  5M3M H;  1OXV A;  4A3L H;  4DV5 L;  4JI0 Q;  3GTL H;  2JQO A;  3HOX H;  4GNX B;  5M5W H;  1OXT A;  4IFD G;  1UEB A;  1LYL A;  1E3P A;  5AJ3 Q;  1YJN A;  4P71 A;  1XJV A;  3FHW A;  2QA4 A;  3RNU A;  3CMA A;  5E7N A;  4NB3 A;  4B3M L;  3OYY A;  1WFQ A;  3UDG A;  2UXD L;  2WB1 G;  1CSP A;  2HQL A;  4DR6 L;  3HFZ B;  1TWC H;  2Q2U A;  2Y0S G;  3CCR A;  1JMC A;  3CC7 A;  3F2C A;  3HKS A;  4DR1 Q;  4OWW B;  2Y0S E;  5IYC H;  3HOW G;  1BKB A;  3D31 A;  3J80 c;  4A3M H;  2R7D A;  3M4P A;  3PCO B;  1KC8 C;  4A3K H;  2IX1 A;  1HNW L;  4OXP A;  4RMF A;  2OTL A;  3PV0 A;  2OTJ A;  3AQQ A;  2Q2H A;  1IL2 A;  1JT8 A;  2OQK A;  3HOV G;  1SRU A;  3NEL A;  3G48 A;  2DGY A;  5FJ8 H;  2YTX A;  2ZTE A;  3A0J A;  1EFW A;  1IBL Q;  1Q12 A;  3S24 A;  3U4Z A;  5FJ8 G;  4AQY Q;  2A8V A;  1HZ9 A;  1PHJ A;  4LF7 L;  1N32 L;  1L1O B;  2K14 A;  1J6Q A;  4A3C G;  2D62 A;  3IRB A;  4JI1 L;  1VQI A;  2F52 A;  3NEM A;  5C4X H;  5C0X G;  1S40 A;  2JA7 H;  2JA7 G;  2VQE Q;  1WI5 A;  3BZC A;  4C3I H;  4O2D A;  1ASZ A;  2OQ0 A;  1YHA A;  2F4V Q;  4A3J H;  4UP7 A;  4DR2 Q;  2CCZ A;  1TWG H;  2N8N A;  3CD6 A;  1Q7Y C;  4AYB E;  1VQL A;  2KHI A;  4DR1 L;  5J3B A;  1N36 Q;  4POF A;  5LMN W;  2UUB Q;  4J15 A;  3CCV A;  3S1R H;  4GS3 A;  2JJQ A;  2ZJQ A;  1L1O C;  5IWA L;  4OWT B;  3DM3 A;  1QUQ A;  1HNW Q;  1S72 A;  1YHQ A;  1N32 Q;  3JAM c;  5IP9 G;  4DV7 L;  1PH1 A;  1VS0 A;  5M3F G;  1OTC A;  4IJL A;  4BBR G;  3CCS A;  4AIM A;  2RHS B;  1QZH A;  4B3T Q;  1EWI A;  5C4X G;  1WOC A;  3B6Y A;  4LF6 Q;  3G4S A;  5LMN L;  5GRO A;  2EXD A;  4H02 A;  1VQA A;  2UXB L;  3CF5 A;  1QVC A;  1YJ9 A;  4JBW A;  4QY7 A;  1B8A A;  1XMO L;  1KQS A;  4GKK L;  3SGI A;  2R92 G;  4JYA L;  3A5U A;  1L1O A;  1MJE A;  1Z47 A;  3CC4 A;  2GN5 A;  4JI6 L;  1NMF A;  4LF4 Q;  5JJL A;  2IT1 A;  3ULL A;  4JI5 L;  4DV1 L;  4YY3 Q;  3GTJ H;  4GLX A;  1M90 C;  1GM5 A;  3UE0 A;  1XNQ Q;  3I4M G;  3TRZ A;  3PUY A;  2UU9 Q;  4DR4 L;  4GKJ Q;  4C3J H;  2R93 G;  2VQF L;  1XTD A;  2DUD A;  1CKM A;  3JC6 6;  1SMX A;  2WP8 J;  3CCL A;  4GN4 B;  4Y52 H;  2GVA A;  3S1Q H;  1C0A A;  2HHH Q;  3AEV A;  3U58 A;  1N34 Q;  1AE2 A;  1XNQ L;  2LXJ A;  4JI3 L;  3CCE A;  1HH2 P;  1L0W A;  4A3E G;  1WCM H;  3H3V I;  4HJ7 A;  1EQR A;  1SE8 A;  4DNI A;  3EN2 A;  4NXM Q;  4HID A;  1TXY A;  3GTO H;  3S2D H;  1X3G A;  1X6O A;  3T1H Q;  4LW1 A;  1VQ9 A;  1VQP A;  1UE1 A;  1SFO H;  1KL9 A;  3F8T A;  3K80 C;  3ULP A;  2HT1 A;  1SR3 A;  4LFB Q;  4DV0 L;  1VQ4 A;  2NVT H;  1FL0 A;  1OXX K;  2JA6 G;  3K0X A;  1HJP A;  1FJG L;  1SN8 A;  1Y1W G;  1HR0 Q;  5JEA G;  4GN5 A;  3PIP A;  4DR6 Q;  4DV4 L;  1V43 A;  2BA1 A;  5FLM G;  2Z0S A;  1FGU A;  3CXC A;  3OTO L;  4POG A;  3CME A;  4UP9 A;  2UXC L;  1HNX L;  4IJH A;  1H95 A;  3W5O A;  2AWO A;  4DUZ L;  4HIM A;  2EIF A;  2VQE L;  1N34 L;  4LF5 Q;  1I3Q H;  1IBM L;  3PUW A;  1FJG Q;  3J7A 5;  4DR5 L;  2VL6 A;  3I4M H;  2CFM A;  4DPG A;  4JI4 L;  4QJF A;  5C0X I;  1E22 A;  3KF8 B;  4DV2 Q;  3CAM A;  4LF8 Q;  2KCM A;  4BBR H;  4Y7N H;  3KJO A;  1XNR L;  4IFD I;  4DR7 Q;  2K5V A;  1GVP A;  1N36 L;  4O0A A;  2CQO A;  1KD1 C;  5C4J H;  4YWK A;  4LF5 L;  2N49 A;  1YJW A;  1XPU A;  1PH8 A;  5C3E G;  4OO1 G;  1IXR A;  4R4C A;  1IBL L;  1Z9F A;  2UUC L;  1C9O A;  4LFC L;  2EQS A;  3LGJ A;  5JJI A;  3U4V A;  1X55 A;  3KDF A;  1LUZ A;  4MTN A;  4YCV A;  2AMC B;  4K0K Q;  1NTG A;  3L0O A;  4BA1 I;  3KOJ A;  3G6E A;  1A62 A;  2A19 A;  2UXB Q;  3CP0 A;  1YIJ A;  1VQF A;  2I5M X;  1PYB A;  1UWV A;  1E1O A;  1UE7 A;  4DK6 C;  4GN3 B;  4ALP A;  3S14 H;  1D7Q A;  1A8V A;  3CCQ A;  4TQU S;  2OCE A;  2NN6 G;  5C3E H;  2UXD Q;  2RHQ B;  1Y1W H;  3GTK H;  1PH6 A;  1VQM A;  1AH9 A;  2Q2I A;  2UUA Q;  3PGZ A;  1IYJ B;  2KCT A;  1CKO A;  3T1Y L;  5HY6 A;  1WJJ A;  2F4V L;  3CC2 A;  4X64 Q;  4GKK Q;  4A3I H;  2IX0 A;  5FLX c;  3BJU A;  4LFA Q;  4LFC Q;  3HOW H;  1K9M C;  1AE3 A;  1IZ6 A;  5ELO A;  4JI6 Q;  4B3S L;  2R92 H;  4XTC S;  4HIO A;  4OON A;  1RIP A;  1QZG A;  4A3J G;  1Q1B A;  2NVY H;  4A3D H;  1EQQ A;  1HZB A;  4GOP C;  1P8L A;  2B63 G;  1I6H H;  3TS2 A;  2Z6K A;  2ALY B;  4KI0 A;  1GKH A;  4DAY B;  1KXL A;  3KF6 A;  1MIU A;  1X65 A;  3S15 H;  3KLW A;  3PSI A;  4C2M H;  2YV5 A;  4DR2 L;  2ZM6 L;  1OXS C;  2XTI A;  2VW9 A;  3UDF A;  1HR0 L;  2PNH A;  1IBK Q;  4X65 Q;  1Y1V H;  1K3R A;  3S2H H;  1V1Q A;  3OTO Q;  3CW2 C;  1NBW A;  3I4O A;  1UE6 A;  1PH9 A;  4LF4 L;  2UXC Q;  4WJ3 M;  4HJ9 A;  3PO3 G;  4A75 A;  1Q1E A;  1JJ2 A;  1X3E A;  1U5K A;  4P75 A;  2NN6 I;  2KHJ A;  4RG1 A;  1JB7 A;  3UE1 A;  2NVX H;  3KF6 B;  1Q8K A;  2L15 A;  1MJC A;  1R9T H;  2PQA A;  3NBH B;  4WJ4 A;  3OW2 A;  1HNZ L;  1KIX A;  4X6A H;  3AFQ A;  1CKN A;  3K7U C;  5K36 G;  3J80 i;  2YTV A;  2K50 A;  1K83 H;  4IOC A;  4A76 A;  3HOZ G;  2B63 H;  5JEA J;  4BY7 G;  1G29 1;  3K8A A;  1CSQ A;  4KLK A;  4L5Q A;  3KFU A;  1KRT A;  4DV5 Q;  2WAQ E;  4HJ8 A;  4OX9 L;  2VNU D;  3RR5 A;  4DR3 L;  1EIF A;  1VQG A;  4JBJ A;  1EIY B;  2JA8 H;  1Y1V G;  3HKZ G;  3ZJY C;  1LTL A;  3M4Q A;  5GAH C;  4XIG S;  5IYB H;  4JI2 Q;  4DV1 Q;  1PYS B;  2BA0 A;  4DR5 Q;  3FKI H;  1PV4 A;  1Y14 B;  1VQC A;  4NPS A;  3WWV A;  1PH2 A;  2AHO B;  4A3D G;  3FKI G;  5IT9 c;  1M1K C;  4LF8 L;  3GTG H;  3PF4 A;  5M5X H;  4YHH L;  3PO3 H;  3VDY A;  1D8L A;  1YIT A;  2E2J H;  1YNX A;  2Z6K C;  4DV6 L;  1HZA A;  2A1A A;  4QL5 A;  4PMW A;  1W2B A;  1VQB A;  1FVI A;  4DUY L;  1HZC A;  2HIV A;  4KHP L;  1PH3 A;  2B3G A;  4LF9 Q;  4BA2 I;  5IY0 A;  1CKN B;  4PZ8 A;  3HOU H;  1E24 A;  2D0O A;  1KRS A;  3GTP H;  4C3H H;  4EX5 A;  5IP7 G;  5IWA Q;  1V9P A;  3KDF B;  2ES2 A;  4GLA C;  4OX9 Q;  3U50 C;  4DUY Q;  3H3V H;  4KHP Q;  3STB C;  4A3F H;  1XPO A;  1UE5 A;  2ATW A;  2VUM G;  4LF9 L;  3GTM H;  3I55 A;  1VQ5 A;  4L5S A;  3UDX A;  1K73 C;  2GVB A;  5EAY A;  3M7N A;  1VQ8 A;  1G51 A;  4IO9 A;  1O7I A;  2JK8 A;  2I0Q A;  3I4N G;  4P72 A;  3MEF A;  3BU2 A;  2JA9 A;  1DGS A;  1VQO A;  5H1S E;  2K75 A;  3CCJ A;  3PO2 G;  3F1Z A;  2YTY A;  5AJ3 L;  2R7Z H;  2UUA L;  2N78 A;  5C44 G;  4GNX C;  2ZJR A;  3ICE A;  1Q82 C;  4A3C H;  1OXU A;  1QVG A;  1EOV A;  3W1B A;  4JI5 Q;  5IYD G;  4YY3 L;  2C35 B;  1RL2 A;  3J81 i;  1Q81 C;  4LF7 Q;  4QQB X;  4PZ7 A;  4DR7 L;  1VQD A;  4JI1 Q;  5BR8 L;  3J7Z C;  3F2D A;  1L2F A;  4JI7 Q;  5GAE C;  4BXX H;  1X3F A;  4A3I G;  4EQ5 A;  3L2P A;  3HOY G;  1X9N A;  2R7Z G;  1W3S A;  1HR0 W;  3HOU G;  1NMG A;  1VCI A;  2MFI A;  1KHI A;  2ZTD A;  3TQY A;  5M3F H;  4BY1 H;  1PH7 A;  4R4T A;  2IHF A;  3ERS X;  5FLM H;  2ZM6 Q;  4LUO A;  4R1J A;  1J5E Q;  4JC0 A;  4LFA L;  4AYB G;  3T1H L;  2VQF Q;  3PUX A;  1SLJ A;  2HIX A;  1QUQ B;  4DV3 L;  1T9H A;  2VZA A;  4MNO A;  1B70 B;  4P73 A;  1N9W A;  3TRE A;  1VQ6 A;  4IPC A;  5IYD H;  1TWA H;  3NEN A;  1X54 A;  3AFP A;  1KAW A;  3EIV A;  2RCN A;  3RLF A;  3M3Y H;  3UDI A;  2NVQ H;  2E2H H;  2F3I A;  4DV4 Q;  2B29 A;  3PUZ A;  3CCM A;  3RZD H;  4HJ5 A;  3J81 c;  2AWN A;  1PH4 A;  4BY7 H;  2PQA B;  4YCU A;  3ULJ A;  2Q2T A;  2R93 H;  1Q86 C;  4X64 L;  1VQK A;  1WCM G;  3MXN B;  2JA5 H;  2PI2 A;  4BBS H;  5HGQ A;  1QVF A;  2UU9 L;  3RN2 A;  2MNA A;  2AKW B;  2CWP A;  4DR3 Q;  4B3T L;  4UY8 C;  4DV2 L;  4NXN Q;  3EBE A;  3F2B A;  3RN5 A;  1ASY A;  3GTQ H;  3CCU A;  2JEA I;  4A3E H;  4IFD J;  5M5Y H;  4X66 Q;  2R7F A;  4DKA C;  1XMO Q;  4JI2 L;  2E2I H;  2KBN A;  4A3G H;  1A63 A;  4JI8 Q;  4TVA B;  1N33 Q;  4JG2 A;  4UPA A;  5IYB G;  4LUV A;  3I7F A;  3HOY H;  2JEB I;  4GOP A;  3PUV A;  4PZ6 A;  3M4O H;  1G6P A;  4B3R L;  4DV6 Q;  3GO5 A;  3GDE A;  1VQH A;  1XPR A;  3PF5 A;  2E8G A;  4JI4 Q;  4JI8 L;  1VQN A;  3RZO H;  1P16 A;  4X65 L;  2D0P A;  1YVC A;  1PVO A;  3K81 C;  1I94 L;  2WFW A;  2CWA A;  3M9B A;  3HOV H;  3H0G H;  3S16 H;  4LFB L;  4YWM A;  3HOX G;  1E7Z A;  2YYZ A;  2KEN A;  5DLQ E;  4X62 Q;  2HHH L;  1K0R A;  1K8G A;  1BVS A;  1I50 H;  2ZTC A;  4JI3 Q;  1MKH A;  2UUC Q;  4P74 A;  5ELN A;  1BBU A;  1B7Y B;  4R4O A;  3STB D;  1U0L A;  3PIO A;  1NY4 A;  1YHB A;  5LMU Q;  2I5L X;  3CPF A;  2JA8 G;  4K0K L;  5BR8 Q;  4AH6 A;  3E0E A;  1JE5 A;  3I56 A;  1VQJ A;  2K5H A;  2BH8 A;  2UUB L;  3T1Y Q;  1EYG A;  1BBW A;  4A3B H;  2E5L L;  3CQZ H;  4JV5 Q;  3GD7 A;  4A93 G;  1JJG A;  2CKZ B; 
#chains in the Genus database with same CATH topology
 5C5L A;  5TSS A;  3CKI B;  3ER0 A;  5A2Q L;  2YU9 H;  4DV0 Q;  2P5Z X;  4JPB W;  4IOA A;  1PTO D;  1ZXT A;  1HNX Q;  4IUT A;  2B2U A;  3I73 A;  4EGV A;  1XMQ L;  3CPW A;  4B3M Q;  4FDB A;  1PTO B;  4A4I A;  4A3B G;  3K5M A;  1AZQ A;  3A5Z B;  5C0X J;  2B2V A;  2RDF A;  1GO3 E;  4FXK C;  2K7V A;  2XGT A;  2NVT B;  2F0M A;  3TME A;  4NXN L;  1JIC A;  4X66 L;  2BH2 A;  3HOZ B;  4AQY L;  4MZ9 A;  2AQ2 B;  2VY3 A;  3DLL A;  4A3G G;  3DEP A;  3H15 A;  4G57 A;  3JAM i;  4DXF A;  1B3A A;  2QDB A;  1GHJ A;  1STE A;  2K28 A;  2DN8 A;  5IP9 H;  1YNJ D;  3SR1 A;  4JI0 L;  2Z4I A;  4JCV E;  4NXM L;  1CK1 A;  2TMP A;  1QG7 A;  4L63 B;  4LWC A;  4A93 B;  1BO0 A;  1B4O A;  1SNO A;  2R6G A;  3S1M H;  1PYW D;  1TWF H;  4JOI A;  3Q8D A;  2N88 A;  4OL7 A;  1X3Q A;  2VXW A;  5KND A;  2DY7 A;  1ICW A;  1SNQ A;  3J81 j;  2PMZ E;  4A93 H;  1EEI D;  2I46 A;  3I4N B;  2WAQ G;  1GXD C;  2H4O A;  2V1C C;  2JE6 I;  5IGC A;  4YCW A;  3I2Z A;  1IBM Q;  4OO1 I;  4RGT A;  4DR4 Q;  4C3H G;  4KKU A;  1WTR A;  2JQO A;  4GNX B;  1KDA A;  3J81 E;  3RD4 A;  1Y69 U;  3VYS A;  3CMA A;  5E7N A;  1AZP A;  3OYY A;  3OOC A;  4V0B A;  2WB1 G;  3HFZ B;  1TWC H;  3RMH A;  3CCR A;  1BCP B;  1J9O A;  4DR1 Q;  2Y0S E;  3U9O A;  2HDM A;  5FKA C;  1I4G A;  2C5C A;  1BCP F;  1BKB A;  5CV5 A;  2R7D A;  4WFN 3;  1TWF B;  3AQQ A;  2Q2H A;  2F0V A;  2IL8 A;  3H3V C;  3HOV G;  3G48 A;  1H9S B;  1EFW A;  4JVZ A;  1Q12 A;  5IGE A;  4LF7 L;  1GOZ A;  4HSV A;  1WTW A;  1J6Q A;  2D62 A;  2O5I C;  3BZC A;  4C3I H;  4O2D A;  5IT9 E;  4UP7 A;  4DR2 Q;  1TS5 A;  3CD6 A;  4AYB E;  4DR1 L;  1ILP A;  4POF A;  2UUB Q;  3QG1 A;  3CCV A;  1I50 B;  2JJQ A;  2EYL A;  1QWY A;  4ABN A;  2IW3 A;  2Z4H A;  1GHK A;  1CZW A;  3G4S A;  4K2K A;  2UXB L;  2SDF A;  1YJ9 A;  4JBW A;  4QY7 A;  1QNK A;  3J80 E;  2F0J A;  2R92 G;  5IIF A;  1MJE A;  1BNZ A;  1EY7 A;  1Z47 A;  4JI6 L;  4LF4 Q;  3IFT A;  3DXJ C;  4DK1 A;  1GM5 A;  2NBF A;  1M90 C;  5CMD A;  3W3A A;  2MHV A;  5EPJ A;  2R93 G;  3EQL C;  2VQF L;  2OF1 A;  2IWH A;  5ELB A;  1EIG A;  4XQJ A;  4U67 3;  2GVA A;  4CBV A;  2HHH Q;  3AEV A;  2EXZ A;  2B2W C;  3NK9 A;  4NXM Q;  3A55 A;  4S3S A;  1S5C D;  1X6O A;  2EYJ A;  2SNM A;  3JAM E;  3T1H Q;  2HUG A;  1PRT D;  3FKI B;  5COR A;  5IGB A;  2KOL A;  4U68 A;  4DV4 L;  3H09 A;  3OMG A;  1FGU A;  3CXC A;  3CME A;  1SAP A;  4UP9 A;  1HNX L;  4IJH A;  4HED A;  1M8A A;  2EIF A;  2K1B A;  1IBM L;  3PUW A;  5J1Z A;  4JI4 L;  3GP7 A;  5EJW A;  5C0X I;  4DV2 Q;  1E22 A;  2ZXR A;  1B44 D;  3NPP A;  2EJG C;  2CQO A;  4EQN A;  5C4J H;  2E2I B;  4LF5 L;  2N49 A;  1YJW A;  2NUC A;  1PH8 A;  1FYC A;  3D4W A;  3K5O A;  4CDF C;  1TT2 A;  3U4V A;  3LX0 A;  3KDF A;  1D6E C;  1TS4 A;  4BA1 I;  3KOJ A;  5FLX E;  3G6E A;  1A62 A;  1Y8P B;  3CP0 A;  1YIJ A;  3DWP A;  1E2V A;  1SDF A;  1UWV A;  3QR8 A;  4ZYS A;  1E1O A;  2JA5 B;  4ALP A;  2RQX A;  4CJ1 B;  2D5D A;  3MHB A;  2BDN A;  2B2T C;  2SOB A;  3DWA A;  1AH9 A;  4IUU A;  1CKO A;  1WJJ A;  1F2Y A;  5FLX c;  2QF7 A;  4LFA Q;  1LTB D;  2PZU A;  1K9M C;  3FPU B;  1I3Q B;  2EYF A;  2R92 H;  1XTC D;  1K3B C;  2F0K A;  4DNT B;  3D8G A;  1HZB A;  1HHV A;  1KXL A;  1E2W A;  3J7A F;  3S15 H;  3KLW A;  4DR2 L;  1T5X D;  1PFM A;  2WV6 D;  4OEM B;  1V1Q A;  1NBW A;  4HJ9 A;  4A75 A;  1S5B D;  1U5K A;  3KF6 B;  2L15 A;  4DN4 M;  1KIX A;  4NMZ A;  3AFQ A;  1A3T A;  1VMP A;  3J80 i;  4A3M B;  2KCC A;  4A76 A;  1EFI D;  4XDX A;  2VNU D;  4DV5 Q;  2WAQ E;  2DNE A;  4OX9 L;  2M2L A;  4OO1 H;  1EIF A;  1GUS A;  1JOO A;  4JBJ A;  2WIN B;  1V8Q A;  2K5W A;  2BA0 A;  1PV4 A;  4TRD A;  1Y14 B;  1PH2 A;  3WWV A;  1EYC A;  2AHO B;  1K83 B;  5C3W A;  1YIT A;  3KBG A;  3W2D A;  1YNX A;  1CQV A;  2Z6K C;  1JWS D;  2A1A A;  1R4P B;  1A2T A;  1VQB A;  4PMW A;  1HZC A;  4LF9 Q;  4BA2 I;  3GTP H;  4C3H H;  3S1R B;  2B2W A;  3ONA B;  5IWA Q;  4DGZ A;  3U50 C;  4DUY Q;  1G2T A;  3STB C;  4A3F H;  2ATW A;  1NUC A;  3GTM H;  4IAL A;  1EOT A;  3UDX A;  4IUN A;  1G51 A;  1EY4 A;  2PQE A;  1CT1 D;  1VQO A;  3BU2 A;  3PO2 G;  2QDL A;  5AJ3 L;  3MTS A;  2UUA L;  4KY7 A;  5G3L F;  2EPB A;  2ZJR A;  3ICE A;  1OXU A;  1QVG A;  1EOV A;  2B8G A;  3W1B A;  4JI5 Q;  3A54 A;  5IYD G;  3J81 i;  1RL2 A;  1K28 A;  4QQB X;  4BBR B;  5D3I B;  3O13 A;  1BOS A;  2JXM B;  4RGM A;  4FF1 A;  1CA5 A;  3QWN A;  1H9J A;  3PO3 B;  4FF3 A;  1NR4 A;  4BXX H;  4LMQ D;  1MSG A;  1G6Z A;  1TY0 A;  1X3F A;  2KEE A;  2MP1 A;  3HOY G;  1X9N A;  1HR0 W;  2L4N A;  1KLG D;  2PNR C;  2A6H D;  4H7B A;  4LUO A;  1K0S A;  1F77 A;  4AYB G;  3T1H L;  2R92 B;  4JW0 A;  3URY A;  4DV3 L;  1T9H A;  4N9P A;  2Z9H A;  4MNO A;  4P73 A;  3TRE A;  4N8X 1;  4IPC A;  1TWC B;  3K5L A;  2FMC A;  3AFP A;  3CHB D;  1G8Z D;  2F3I A;  4DV4 Q;  3CCM A;  1PH4 A;  1Y1W B;  3J81 c;  1STB A;  3ULJ A;  1HFG A;  1DJR D;  3SK6 A;  1DZ1 A;  3RN2 A;  5I2X A;  4DR3 Q;  4B3T L;  4RWS C;  5KRU A;  3RN5 A;  2XWJ B;  2JEA I;  1PLF A;  2FFK B;  5IGD A;  2EZV A;  3TSS A;  4ZUJ A;  4GOP A;  3PUV A;  3DM1 A;  1G6P A;  4B3R L;  2X69 A;  4DV6 Q;  3I8Z A;  3GDE A;  1VQH A;  2A69 C;  3RZO H;  3HKZ B;  1YVC A;  3Q23 A;  1I6V C;  1PVO A;  3K81 C;  1C8C A;  1I94 L;  3S16 H;  1LT6 D;  3OW7 A;  1K8G A;  2F0H A;  4JI3 Q;  5ELN A;  3FMC A;  3PIO A;  5LMU Q;  2JN4 A;  4K0K L;  1IW7 C;  5BR8 Q;  4AH6 A;  2BH8 A;  3QOL A;  3AB9 A;  4A3B H;  4JV5 Q;  1ENA A;  2CKZ B;  2LSS A;  3HOZ H;  1B50 A;  2LMC B;  1A6X A;  5M3M B;  1VQE A;  4YWL A;  3TS0 A;  1A3U A;  2LXK A;  2ZJP A;  3RZD B;  1MBY A;  4ZCK A;  3VA7 A;  5FLX L;  5IE8 A;  2WB1 E;  1ZKO A;  4M1U B;  1PA6 A;  2PI2 E;  2BDO A;  3KJP A;  3MFY A;  5HUR A;  1S4Z A;  4CKE A;  4KY5 A;  4BBS G;  3L7Z C;  2HCC A;  3MWY W;  3NUC A;  2K01 A;  2CHB D;  1D2B A;  3D6W A;  3D0F A;  2VUM H;  1EY5 A;  1CUK A;  1SMY D;  2XN9 C;  2NVQ B;  3HRZ C;  4C56 C;  2VUM B;  3GTP B;  3KLR A;  1DYQ A;  4BXX G;  1M4V A;  2Q8R E;  4WJW A;  4DU9 A;  2RBM A;  4A3B B;  1LM0 A;  4X3K A;  3UI2 A;  4O42 A;  4BY1 G;  2PMZ B;  3I91 A;  1JC7 A;  1XMQ Q;  3A56 A;  1TWG B;  1F9S A;  1E1T A;  4CKB A;  1ZYR C;  3S17 H;  3S1N B;  4HIK A;  4KD3 A;  4JYA Q;  1SRO A;  1HNZ Q;  2MO1 A;  4GLV B;  2FXQ A;  5GAD C;  4DUZ Q;  3OPO A;  4XT3 B;  3K59 A;  4A3F G;  5C44 H;  2MO0 A;  3M85 A;  1N33 L;  1I5F A;  3BZK A;  5IYC G;  4PNY A;  4KHV A;  2NZO A;  5COY A;  2EY5 A;  5CYU A;  3G71 A;  2K5N A;  3K7A H;  3KYH C;  1NJI C;  1X56 A;  3HOU B;  1PTO F;  5GQO A;  2I5H A;  5D65 A;  3E9H A;  4C3I B;  1N8R C;  1RKN A;  4LNQ A;  4FO2 A;  2H1E A;  1CI3 M;  1SNP A;  4X62 L;  5M3M G;  1HUM A;  1FNU A;  1OXV A;  4A3L H;  2WAQ B;  4JI0 Q;  1EL0 A;  1PRT C;  2EJF C;  4KMU C;  5M5W H;  1LYL A;  4ID6 A;  1E3P A;  1H9K A;  2B2Y C;  2O4X A;  5AJ3 Q;  2B2T A;  3FHW A;  4KV6 A;  2LS0 1;  4RCO A;  3U9S A;  1EZ8 A;  5ISR A;  2N55 A;  2Y0S G;  4H13 C;  4R8N A;  2B63 B;  1PFB A;  2HDL A;  3HOW G;  4KJN A;  3IFD A;  4ZUI A;  2K6A A;  1KC8 C;  4A3K H;  1HNW L;  2OTL A;  1WTX A;  1UEA B;  2OTJ A;  1IL2 A;  4P2C B;  4DAY A;  2EY1 A;  4N9T A;  3IAY A;  3NEL A;  1VDZ A;  3NSW A;  3A0J A;  2QIL A;  1RTO A;  2K14 A;  4JI1 L;  1VF7 A;  3BG3 A;  3NEM A;  4K8I A;  5C4X H;  3I4L A;  3GV6 A;  3S1M B;  1JR0 D;  1YHA A;  2CCZ A;  4CDC C;  2N8N A;  2NVX B;  1N36 Q;  4F7X A;  5LMN W;  4IZ8 A;  4C3H B;  3S1R H;  2ZJQ A;  5CV8 A;  3GTL B;  1HNW Q;  1S72 A;  1N32 Q;  4DV7 L;  1PH1 A;  1HQM C;  5M5Y B;  5M3F G;  4B3T Q;  2NVY B;  4BBR G;  1RD9 D;  1WOC A;  5EPK A;  3BDO A;  5GRO A;  2DJG C;  1V1O A;  1QVC A;  1KQS A;  2RDG A;  3SGI A;  3H94 A;  3VYT A;  4K5W A;  4DAV A;  3CC4 A;  2GN5 A;  4BWG B;  5BN5 A;  1ENF A;  1LTS D;  5JJL A;  3ULL A;  5T1G A;  3E3X A;  1XNQ Q;  3TRZ A;  2XNA C;  3UE0 A;  1HA6 A;  1HXY D;  3PUY A;  3Q22 A;  1Y8N B;  3J7A V;  4IN3 A;  4RAU C;  2WP8 J;  4DAP A;  3CCL A;  2HD3 A;  4DXG A;  4UAI A;  2A68 C;  4KK7 A;  4JI3 L;  1HRJ A;  1HH2 P;  1L0W A;  1GJX A;  2PW7 A;  1EQR A;  4DNI A;  1U4M A;  3OWF A;  4HID A;  1SYB A;  3S2D H;  1X3G A;  3R2T A;  3GTK B;  5D14 A;  2R7Z B;  1UE1 A;  5IT9 L;  1KL9 A;  3MVV A;  4PQX A;  4LFB Q;  4DV0 L;  1VQ4 A;  1I4R A;  4RCN A;  1HR0 Q;  1IHZ A;  3PQI A;  4DR6 Q;  1V43 A;  1V1P A;  4POG A;  1BCP C;  4H0L C;  5FO8 B;  1RHP A;  3CU7 A;  4DUZ L;  1HTL D;  3G7L A;  4EVO A;  4HIM A;  1I3Q H;  3J7A 5;  1FJG Q;  4DR5 L;  2VL6 A;  4I7A A;  2CFM A;  3WDN A;  2WAC A;  4LF8 Q;  3CAM A;  1SYC A;  2K5V A;  2NB0 A;  1XXG A;  4ZQ3 A;  1UNS A;  4O0A A;  1NNX A;  4JK1 C;  4YWK A;  1XPU A;  2MGS A;  1TVX A;  3TP7 A;  5LL6 X;  5C3E G;  3TN2 A;  4R4C A;  1I4Q A;  2WKC A;  1Z9F A;  1U9R A;  2EQS A;  4LFC L;  2L0C A;  1X55 A;  1NTG A;  4OIJ A;  3L3O C;  3F2U A;  2ZXO A;  3VR6 A;  2E75 C;  3S14 H;  4QCL A;  1CQF A;  1SYG A;  3I72 A;  1Y1W H;  3GTK H;  1PH6 A;  3GTJ B;  1EYD A;  1IYJ B;  3T1Y L;  5HY6 A;  4GKK Q;  3CC2 A;  3BJU A;  4JI6 Q;  1ILQ A;  2ICI A;  4B3S L;  3TDQ A;  4HIO A;  1RIP A;  1QZG A;  1BBX C;  5M9O A;  1Q1B A;  4A3D H;  2F0Q A;  1I6H H;  4QMG A;  5F2D A;  2Z6K A;  1TWA B;  4HN7 A;  3LWU A;  1STN A;  4DAY B;  3FVQ A;  3C46 A;  3KF6 A;  1PZI D;  1X65 A;  3PSI A;  1XYI A;  4C3J G;  2YV5 A;  2ZM6 L;  3HOV B;  3QB3 A;  1HCZ A;  2PNH A;  1XWE A;  3OTO Q;  2UXC Q;  3CW2 C;  3I4O A;  1UE6 A;  3PO3 G;  1Q1E A;  4C1N K;  1JJ2 A;  1X3E A;  4CDE C;  4I65 A;  3GTQ B;  3UE1 A;  1N32 L;  1R9T H;  4L8J A;  3MXP A;  1K8M A;  1AEX A;  4X6A H;  3DWQ A;  1CKN A;  2EJM A;  2YTV A;  2XSC A;  1TKW B;  1K83 H;  1LO5 D;  5KEE A;  2HQE A;  5JEA J;  2MJ8 A;  4KLK A;  1CSQ A;  2NTT A;  4R8I A;  1HUN A;  1Y1V G;  3ZJY C;  5IYB H;  4JI2 Q;  1PYS B;  4NDX A;  3FKI H;  1PZJ D;  1VQC A;  1Z7T A;  5FK9 C;  3L9A X;  5IT9 c;  1M1K C;  4F88 A;  4YHH L;  5KIX A;  3VDY A;  2O2L D;  4RKL A;  1W2B A;  1FVI A;  2HIV A;  3MA2 B;  2FIN B;  1VMC A;  2B3G A;  4FXG C;  5IY0 A;  1CKN B;  1S5D D;  3HOU H;  2QEJ C;  1E24 A;  5C0X H;  1KRS A;  4EX5 A;  4QUF A;  4OX9 Q;  4QB4 A;  3H3V H;  1QJO A;  4KHP Q;  1EWH A;  5IOD A;  1RJT A;  1FNV A;  4LF9 L;  2Q8T A;  5JOB A;  4K6D A;  3HZX A;  2EYP A;  5M5W B;  3BVG A;  1O7I A;  3A8K E;  3NXW A;  4TSS A;  1WTV A;  5KNC A;  1EQT A;  1DGS A;  5H1S E;  4FF2 A;  3J81 L;  2YTY A;  2A73 B;  2R7Z H;  2XVS A;  3BDL A;  1CM9 A;  1ZYR D;  1GUO A;  3M7G A;  2G9H D;  1DXM A;  2F0G A;  3BDC A;  1ENC A;  4PZ7 A;  5BR8 L;  3SHL A;  1Q90 A;  4H44 C;  5I9P A;  2RCF A;  1W6K A;  4JI7 Q;  1CTM A;  4C2M B;  4A3I G;  4EQ5 A;  3L2P A;  3FPP A;  1SJE D;  1W3S A;  2EY2 A;  1MHW C;  4HCS A;  5M3F H;  1PH7 A;  3T51 B;  3DEO A;  5FLM H;  1HPC A;  2PZT A;  3MXU A;  3S17 B;  2WB1 B;  2VQF Q;  1SLJ A;  1QUQ B;  1RF2 D;  1N9W A;  5C4Z A;  1VQ6 A;  4J1M A;  2LFN A;  3D3R A;  1KAW A;  1R4Q B;  2RCN A;  1L0Y B;  3RLF A;  1SE4 A;  2E2H H;  2VB2 X;  2QW7 A;  4HJ5 A;  4CHT B;  2R93 H;  2XIW A;  1VQK A;  1WCM G;  1LTR D;  2PI2 A;  2JA5 H;  3OHX C;  3IL8 A;  2UU9 L;  5DAU A;  2AKW B;  4DV2 L;  4NXN Q;  3CCU A;  3E0J A;  3D6C A;  4X66 Q;  2M00 A;  4DKA C;  3K58 A;  1XMO Q;  1CA6 A;  1PFN A;  5KYI A;  4ULL A;  1I6H B;  5C4X B;  2JYO A;  4TVA B;  4JG2 A;  4LUV A;  4CDD C;  1SJH D;  4G4K A;  2F1M A;  4B9X A;  4PZ6 A;  1SXT A;  1DOM A;  1TS3 A;  4WOR A;  4HTH A;  1ROD A;  4JI4 Q;  4JI8 L;  2EYM A;  1ESF A;  3OIP A;  3TP5 A;  3TP6 A;  4DNR B;  2WFW A;  2CWA A;  3M9B A;  3NTK A;  3HOV H;  2YYZ A;  5DEH A;  2KEN A;  5DLQ E;  2ZTC A;  1MKH A;  3OSO A;  5JPM C;  4P74 A;  1B7Y B;  1U0L A;  2PPB C;  1NY4 A;  1YHB A;  1R9T B;  5A2Q E;  2JA8 G;  3E0E A;  3I56 A;  2K5H A;  3MAQ A;  1EYG A;  2E5L L;  3GTO B;  1WD0 A;  1KTK A;  2NWG A;  4IUV A;  2BE5 C;  4V19 0;  1XNR Q;  3A74 A;  2R93 B;  4XQQ A;  4APV A;  4B3R Q;  2I07 B;  5IOC A;  2IY5 B;  5LMN Q;  4IPD A;  4C3J B;  1II3 A;  5AFW A;  3Q6S A;  1SNC A;  2J7Z A;  4DF7 A;  4DFA A;  4MHE A;  5IGG A;  3K7A B;  4UHV A;  4L5R C;  1YNN C;  2NZH A;  4LUZ A;  2RF4 A;  5M3F B;  5LMU L;  1A0I A;  1B9N A;  1TWH H;  4B3S Q;  2AUJ D;  1JB3 A;  4KD4 A;  3NBI A;  2E5L Q;  1PMR A;  3PMF A;  4KHZ A;  1C7Y A;  1SYE A;  3QJY A;  5EKL A;  4DAM A;  5DM6 3;  2IJ0 A;  2ICE C;  1WYD A;  3SK8 A;  1PTO H;  3VR4 A;  4GOP B;  2ZXP A;  4M8A A;  2F3V A;  5JJK A;  3W1G A;  3H0G B;  4J6H A;  4A3M G;  5IP7 H;  4ME3 A;  4LF6 L;  3ND9 A;  3AYH B;  5JVG 3;  3LNN A;  1J5E L;  3WOE A;  4GNX A;  4IUR A;  4QF4 A;  1MD2 D;  2QKI C;  1K8A C;  4ODG A;  1YI2 A;  3S1N H;  4IFD H;  4JI7 L;  2K04 A;  3NE5 B;  2N3S A;  1PZK D;  1GD7 A;  1BXT A;  1STG A;  1PFS A;  5JVH 3;  4BBS B;  5EQ0 A;  1U4R A;  2QGQ A;  3QIA A;  3KLS A;  1TWH B;  2L55 A;  4YHH Q;  1I94 Q;  4HJA A;  2H5X A;  2K52 A;  4QIW E;  5I6Y A;  1F2M A;  4A3L G;  3BYT B;  1LV9 A;  4A3K G;  5M3M H;  1UAP A;  3GTL H;  2L1B A;  3HOX H;  4E6I A;  5IGF A;  5I9O A;  1OXT A;  4IFD G;  1UEB A;  4Q5V A;  2E74 C;  2A6E C;  4MTK A;  5A35 A;  2Z1C A;  3K6O A;  1YJN A;  1XJV A;  4B3M L;  3UDG A;  1WFQ A;  1JE4 A;  1JMC A;  2BE5 D;  3Q0A A;  1HQR D;  4BS9 A;  4OWW B;  5ELE A;  5IYC H;  1NCV A;  3D31 A;  3J80 c;  1X32 A;  1LTI D;  1BDO A;  2XWB B;  3PCO B;  4A3M H;  4OXP A;  3A7A B;  3PV0 A;  2MUY A;  2F3W A;  1SRU A;  2DGY A;  3MC0 B;  5E1F A;  1EY8 A;  2YTX A;  2ZTE A;  4WRD A;  1IBL Q;  3S24 A;  1QE6 A;  3J7Y W;  4AQY Q;  1HZ9 A;  2AQ3 B;  2JA7 H;  1S40 A;  4LK1 C;  5C0X G;  5HGT A;  1EEF D;  1WI5 A;  1ASZ A;  4PMB A;  3S2H B;  1VQL A;  2KHI A;  4F8M A;  4X3U A;  3FDT A;  2KJX A;  4OWT B;  3DM3 A;  1KAA A;  1YHQ A;  3JAM c;  4NP5 A;  1OTC A;  4ZKC B;  4IJL A;  3HG9 A;  1EWI A;  3A8J E;  3B6Y A;  3Q24 A;  5LMN L;  1O80 A;  1VQA A;  1IKL A;  3CF5 A;  4RKB A;  3D4D A;  3A8I E;  4JYA L;  3A5U A;  2A5H A;  2PYK A;  1QB5 D;  2A6H C;  1BF4 A;  3I4M G;  5EBD A;  4GKJ Q;  3EVQ A;  4DR4 L;  5J39 A;  3OMC A;  4A3K B;  1O7Z A;  1O7L A;  1XTD A;  2DUD A;  1SMX A;  4I7Z C;  4Y52 H;  2F0O A;  1AE2 A;  2LXJ A;  1SEB D;  3CCE A;  4A3E G;  1Y8O B;  1E0B A;  1WCM H;  3E6Z X;  1SE8 A;  2EVB A;  1JOK A;  3GTO H;  5C5M A;  4A3J B;  1DM0 B;  4LW1 A;  3SEB A;  1VQP A;  1SFO H;  3K80 C;  3ULP A;  1H9R A;  4TKO B;  1SR3 A;  3BZD B;  3R3O A;  3CQZ B;  3EJI A;  2HT1 A;  2JA6 G;  3K0X A;  4FXD A;  1BQQ T;  5JEA H;  1HJP A;  5NUC A;  1SN8 A;  4GN5 A;  3PIP A;  1WTO A;  5FLM G;  2Z0S A;  5C4H A;  2CVR A;  3G6J B;  1H95 A;  2KVM A;  3W5O A;  2AWO A;  4O1N A;  1LAC A;  2VQE L;  2F0D A;  4DPG A;  5G3L D;  4QJF A;  3KF8 B;  2KCM A;  4BBR H;  3KJO A;  1XNR L;  4A3E B;  1C48 A;  1KD1 C;  3D4R A;  1GUT A;  2GA4 B;  3BYY B;  1IXR A;  4OO1 G;  2SNS A;  2UUC L;  1C9O A;  3LGJ A;  4L6T B;  1LUZ A;  5LL6 S;  2AMC B;  4K5X A;  4KKS A;  2UXB Q;  3TBI B;  1NSN S;  3VR3 A;  1VQF A;  4G7O C;  1UE7 A;  3BS1 A;  4AYB B;  4DK6 C;  1T5E A;  4NW2 A;  3R8B A;  1Q8I A;  4TQU S;  2UXD Q;  2J0T D;  4RHS A;  2K5D A;  3NWT A;  4PV1 C;  4KKT A;  1JOQ A;  2VB3 X;  2B8F A;  2Q2I A;  2UUA Q;  4BY7 B;  2KCT A;  1YNN D;  2NZ1 D;  4X64 Q;  4A3I H;  4LFC Q;  3HOW H;  2X6L A;  1B9M A;  1AN8 A;  3I4M B;  1IZ6 A;  5ELO A;  4QUC A;  5C3E B;  4DA2 A;  2KUM A;  4XTC S;  4OON A;  3MZ5 A;  1YNJ C;  4NKL A;  4A3J G;  2ALY B;  3S9W A;  2EYH A;  2J4X A;  1CZG A;  1TU2 B;  4HSP A;  3EA6 A;  1WCM B;  3C2P A;  2FJ2 A;  3S16 B;  3SDZ A;  3UDF A;  2RDH A;  4X65 Q;  1K3R A;  3S2H H;  5CBE E;  1B1Z A;  4WJ3 M;  1JB7 A;  2NVX H;  2NN6 I;  4BY7 G;  1HFN A;  1MJC A;  4WJ4 A;  2PQA A;  3NBH B;  3NQI A;  1PDQ A;  3T16 A;  4ZK9 B;  1B2T A;  5K36 G;  1RDP D;  3GTG B;  4IOC A;  2B63 H;  3K8A A;  3KFU A;  4DR3 L;  3KUP A;  1WD1 A;  1BCP D;  3HKZ G;  2JA8 H;  1LTL A;  5GAH C;  5I6W A;  4DV1 Q;  4DR5 Q;  1PTO C;  4NPS A;  5CC4 A;  3T13 A;  4A3D G;  3FKI G;  4LF8 L;  4ME5 A;  1D1I A;  3PO3 H;  1GUG A;  2A68 D;  5C44 B;  1QNU A;  2F03 A;  2PO4 A;  1SE3 A;  5DNF A;  4C1N I;  2D0O A;  1I4P A;  1G2S A;  4RH6 A;  3IKJ A;  2EYO A;  3KDF B;  3HEJ A;  5KNB A;  1BUV T;  1CHQ D;  2F0T A;  2NYZ D;  1XPO A;  1B3Q A;  2VUM G;  2F0E A;  1IW7 D;  3ZYY X;  1TY2 A;  2GVB A;  3M4Y A;  5EAY A;  4IO9 A;  2I0Q A;  3I4N G;  4P72 A;  1ZEQ X;  3SK5 A;  4PMC A;  1WTP A;  3RUZ A;  1A15 A;  1EU4 A;  3P20 A;  4G7Z C;  1Q3L A;  1Q82 C;  1EY0 A;  2C35 B;  1Q81 C;  1VQD A;  3VYR A;  4A3D B;  3J7Z C;  1KDC A;  1BR9 A;  5BN4 A;  3BVM A;  1SNM A;  3KF8 A;  3S2D B;  2K05 A;  5E3F A;  2R7Z G;  4IUP A;  3PIP 3;  4DK0 A;  1VCI A;  2ZTD A;  1KHI A;  1U4P A;  3HS0 C;  2K32 A;  1ONL A;  1TQO A;  2L12 A;  3ERS X;  3VR2 A;  1J5E Q;  1F9Q A;  4N8F A;  1LLR D;  2F0N A;  2CW0 C;  3PUX A;  2HIX A;  2KCN A;  4R9W A;  2VZA A;  3GQB A;  5K36 H;  2A74 C;  3NEN A;  3V2T A;  1IKM A;  5EKI A;  4K14 A;  4QIW B;  3M3Y H;  3UDI A;  2A69 D;  2NVQ H;  4LJZ C;  2WII B;  2B29 A;  4KTA A;  3PUZ A;  3RZD H;  4BY7 H;  2AWN A;  2XRS D;  2PQA B;  2QCP X;  4YCU A;  2A6E D;  2B39 A;  1Q86 C;  4X64 L;  3MXN B;  1DON A;  1E2Z A;  3HOW B;  1XX8 A;  3HP3 A;  1QVF A;  4FYD A;  2MNA A;  2CWP A;  3ITP A;  3P7J A;  3F2B A;  1ASY A;  3GTQ H;  4IFD J;  1JQY D;  4A3E H;  3NBH A;  5M5Y H;  2R7F A;  4JI2 L;  3ERO A;  1SND A;  4ZRZ A;  3V05 A;  1N33 Q;  4UPA A;  5IYB G;  2Z8L A;  3I7F A;  4GZY C;  3HOY H;  2DY8 A;  3GO5 A;  3I90 A;  1VQN A;  1SBB B;  1P16 A;  4X65 L;  2AQ1 B;  2D0P A;  1SYD A;  4K0K Q;  4K5V A;  4YWM A;  1KNE A;  1BVS A;  1I50 H;  3MXN A;  1QCB D;  1BBU A;  1D5Z C;  2ENB A;  2CH4 W;  2KA7 A;  1I4X A;  1JE5 A;  2IPK D;  3T1Y Q;  1TS2 A;  4A93 G;  3GD7 A;  1JJC B;  2F4I A;  2ASB A;  2K4K A;  1SFO B;  3FP9 A;  3N6R A;  5CV7 A;  1LT5 D;  2KHS A;  1Z6H A;  5LHY 1;  4JBK A;  1SYF A;  2PZW A;  2JA8 B;  4L5T A;  2ID0 A;  4QGU A;  4ZAI A;  2E2J B;  3PO2 H;  1HA5 A;  4IPH A;  3NHH A;  1LTG D;  2RSN A;  4FP5 D;  3T53 B;  1YEZ A;  3MEH A;  2QEX A;  3PO2 B;  1YZ6 A;  3K5N A;  2F0I A;  1KAB A;  3GV3 A;  1SSO A;  1FD7 D;  3TEH B;  1EUJ A;  3RLO A;  3SE0 A;  4CKC A;  5GAG C;  3I4N H;  1EIH A;  4YIJ A;  5FOB B;  4CJ2 C;  2JA6 H;  4DV3 Q;  4CJ0 B;  1MI2 A;  1YBY A;  4JBM A;  1PH5 A;  1O7Y A;  2B2Y A;  2OWO A;  2JA5 G;  2B2V C;  1J8I A;  1Q46 A;  2F0F A;  4UP8 A;  2MQH A;  3H0G G;  3HKZ E;  3JAM L;  1H9S A;  1NE3 A;  4OWX B;  4DK3 C;  4JOI C;  4PG3 A;  4EQO A;  3AU7 A;  1A3V A;  4R4Q A;  4R4I A;  2E76 C;  1WVL A;  2E2H B;  1RTN A;  3OIQ A;  2Q8I B;  4DV7 Q;  5CV9 A;  1IBK L;  2IHE A;  4K8J A;  2MPM A;  4IPG A;  4JV5 L;  1S3O A;  4FF4 A;  3RLN A;  4RGN A;  3E9I A;  1ET6 A;  5EPL A;  1GUW A;  2VS1 A;  1VQ7 A;  4GKJ L;  1WTH A;  4DV5 L;  5CR3 A;  4C3I G;  2WKD A;  3M3Y B;  3R2I A;  4P71 A;  5T1I A;  2QA4 A;  3RNU A;  4KN4 C;  4NB3 A;  2UXD L;  1CSP A;  2HQL A;  4DR6 L;  2Q2U A;  3QO2 A;  3TZD A;  4KY6 A;  3CC7 A;  3F2C A;  1DOK A;  3HKS A;  4OEL B;  4CGY B;  3HOX B;  2PCF B;  1A2U A;  2Z6B A;  3NTI A;  3M4P A;  1DOL A;  2IX1 A;  4RMF A;  5L37 A;  1I4H A;  3AMU A;  1JT8 A;  2OQK A;  2RSO A;  5FJ8 H;  5C6A A;  3J80 L;  1PRT F;  3BVZ A;  5FJ8 G;  3U4Z A;  5EGT A;  2A8V A;  1PHJ A;  2BOS A;  3CRL C;  1L1O B;  2F0P A;  4A3C G;  3KK7 A;  3IRB A;  1LT4 D;  1DCZ A;  1VQI A;  2F52 A;  1JCK B;  4Q0F A;  2JA7 G;  2VQE Q;  5BN3 A;  4EQP A;  2OQ0 A;  5I2Y A;  1D5M C;  2F4V Q;  4A3J H;  2SEB D;  1TWG H;  1FGB D;  1X3P A;  1Q7Y C;  1IYV A;  1KDB A;  1O78 A;  5J3B A;  3X3M A;  5KYL A;  4J15 A;  3TP8 A;  4GS3 A;  2IX3 A;  3V96 A;  1L1O C;  5IWA L;  1QUQ A;  3DHQ A;  1F2Z A;  5IP9 G;  1VS0 A;  1H9M A;  5EBC A;  5JAV A;  2KEC A;  3CCS A;  4AIM A;  2RHS B;  1QZH A;  5D3D A;  4Z9C B;  5C4X G;  1IL8 A;  4LF6 Q;  2EXD A;  2EDG A;  4H02 A;  4GKK L;  1XMO L;  1B8A A;  5JPN C;  2DNC A;  1C4Q A;  1L1O A;  1AFP A;  3C1E A;  1NMF A;  5ELC A;  1EU3 A;  2F0W A;  5KGU A;  2IT1 A;  4JI5 L;  4DV1 L;  4YY3 Q;  3GTJ H;  4GLX A;  2OEO A;  3VR5 A;  2UU9 Q;  4FVM A;  4C3J H;  4HMJ A;  4HMI A;  1CKM A;  3JC6 6;  4GN4 B;  3S1Q H;  1C0A A;  1PRT B;  3LWE A;  1ET9 A;  1NR2 A;  4LAA A;  3U58 A;  1N34 Q;  1XNQ L;  4G7H C;  1S5E D;  1EY6 A;  1TR5 A;  2F0S A;  2HCI A;  3H3V I;  4HJ7 A;  1L0X B;  1U4L A;  3EN2 A;  3HGB A;  1TXY A;  4BY1 B;  3KBX A;  5CBA E;  1VQ9 A;  1IYU A;  3F8T A;  4KN7 C;  5ELF A;  2NVT H;  1FL0 A;  1OXX K;  1FJG L;  1Y1W G;  5JEA G;  2BA1 A;  3OTO L;  2UXC L;  3NWS A;  1EZ6 A;  1ICF B;  4LF5 Q;  1N34 L;  1STY A;  2JA7 B;  3I4M H;  4RGO S;  4UDU C;  4B9W A;  4Y7N H;  3SK4 A;  2JSO A;  4IFD I;  4DR7 Q;  1GVP A;  1N36 L;  5EKK A;  4A3F B;  3T56 B;  3GTM B;  2L11 A;  3HOY B;  1F9P A;  1IBL L;  1F9R A;  5JJI A;  4YCV A;  4MTN A;  5FO7 B;  2JA6 B;  3L0O A;  1UUP A;  2A19 A;  2G9D A;  2B2U C;  1D5X C;  4XXE A;  2I5M X;  5CV4 A;  4XQN A;  1DD2 A;  1PYB A;  2G5D A;  4GN3 B;  3C3L A;  2V4D A;  1D7Q A;  4HCE A;  1A8V A;  3CCQ A;  2OCE A;  2NN6 G;  5C3E H;  2RHQ B;  4XYO A;  1VQM A;  4A3I B;  2LKV A;  3PGZ A;  1LTT D;  3K0Y A;  4B08 A;  2F4V L;  1AW7 A;  2IX0 A;  5CV6 A;  2YU9 B;  3FRP B;  1AE3 A;  3ERQ A;  2DJF C;  4MIU A;  1WTQ A;  4ZLT F;  2NVY H;  3K57 A;  3WOF A;  2Y0S B;  4GOP C;  1P8L A;  1EQQ A;  2B63 G;  3TS2 A;  4A3G B;  4KI0 A;  1GKH A;  1S5F D;  1MIU A;  1W6J A;  3I70 A;  1FNW A;  3KLS X;  4C2M H;  1OXS C;  2XTI A;  2VW9 A;  5FO9 B;  1HR0 L;  2C9O A;  2CW0 D;  1EY9 A;  1IBK Q;  4J8Q A;  3S15 B;  1Y1V H;  3P75 A;  1PH9 A;  1JWU D;  3QOJ A;  2K03 A;  4LF4 L;  2F0L A;  4OGQ C;  2L9H A;  4P75 A;  1ESR A;  4RG1 A;  2KHJ A;  4XT1 B;  1Q8K A;  5K5P A;  2K33 A;  3OW2 A;  1HNZ L;  2X6G A;  3K7U C;  3MFG A;  2K50 A;  3A7L A;  3HOZ G;  2D2C C;  1OO9 B;  1D1K A;  2E2D C;  1MSH A;  1G29 1;  2NTS A;  3NP8 A;  4L5Q A;  1QOH A;  1KRT A;  1CFM A;  4HJ8 A;  3RR5 A;  1VQG A;  3SXH A;  1EIY B;  1G91 A;  2PW5 A;  1LAB A;  3M4Q A;  3T4A C;  5JJZ A;  1V1P B;  2CQA A;  4XIG S;  3H91 A;  1KNA A;  2OT2 A;  3ND8 A;  3GTG H;  5C3X A;  3PF4 A;  5M5X H;  2K5Q A;  1D8L A;  1KLU D;  2E2J H;  2XRQ D;  3VA5 A;  4X3T A;  4DV6 L;  1HZA A;  1PXU A;  4QL5 A;  2LY7 A;  4DUY L;  4KHP L;  3TZU A;  2OXP A;  1PH3 A;  4PZ8 A;  5J22 A;  1SMY C;  5IP7 G;  3X3N A;  1V9P A;  2ES2 A;  4X3S A;  4GLA C;  3EFX D;  1EWC A;  2BCO A;  5C4J B;  1UE5 A;  4KJO A;  5DM7 3;  3I55 A;  1VQ5 A;  2EOT A;  1MGS A;  1LTA D;  4L5S A;  1K73 C;  3M7N A;  1VQ8 A;  3NQT A;  1VF5 C;  4RHR A;  1JOR A;  2JK8 A;  3P1H A;  3MEF A;  3E5S A;  2JA9 A;  5E4W C;  3MXG A;  3R93 A;  2K75 A;  2JP1 A;  2FMM A;  3CCJ A;  4ZKB B;  3F1Z A;  3C1F A;  3VYU A;  4MN3 A;  2N78 A;  5C44 G;  4GNX C;  4A3C H;  1CHP D;  4YY3 L;  4LF7 Q;  4Y7N B;  2RVL A;  1GUN A;  4DR7 L;  4JI1 Q;  3F2D A;  4HR7 B;  5M5X B;  1L2F A;  4K6L A;  3S1Q B;  4ILW A;  1EYA A;  3PIO 3;  5GAE C;  3DUZ A;  2M9V A;  4OHJ A;  2F0U A;  2EE1 A;  3RZO B;  2D9U A;  4FNF A;  3SVM A;  3HOU G;  1NMG A;  3H6M A;  3NTH A;  1RCV D;  4K2L A;  2MFI A;  4BY1 H;  3TQY A;  4R4T A;  2IHF A;  2ZM6 Q;  2NN6 H;  4R1J A;  4JC0 A;  4LFA L;  1JWM D;  2O5J C;  4XYQ A;  2CH4 A;  3S14 B;  2RA4 A;  1B70 B;  2R3Z A;  5IYD H;  1TWA H;  1X54 A;  4HAE A;  3EIV A;  4RFB A;  3OWE B;  1HTP A;  2TSS A;  1QIL A;  3N52 A;  4IUQ A;  1EQV A;  2Q2T A;  2ZT9 C;  5I4D A;  4OIK A;  2AUK A;  2FHT A;  4BBS H;  1NAP A;  5HGQ A;  1STA A;  1K8O A;  4RA8 A;  3DMU A;  4UY8 C;  5E4X A;  3EBE A;  1STH A;  2KQ3 A;  2E2I H;  2KBN A;  1B53 A;  4A3G H;  1A63 A;  4JI8 Q;  2L5T A;  1FR3 A;  3FEW X;  1ML0 D;  4IQZ A;  2JEB I;  2RKS A;  3M4O H;  1XPR A;  3PF5 A;  2E8G A;  1AP0 A;  2KED A;  1Y1V B;  3M4O B;  4LFB L;  1SE2 A;  3CRK C;  3H0G H;  3HOX G;  2HHH L;  1E7Z A;  2EY6 A;  4X62 Q;  1K0R A;  1TII D;  5CGK A;  2UUC Q;  4R4O A;  3STB D;  2I5L X;  3CPF A;  3I3C A;  2UUB L;  1VQJ A;  5ELD A;  1LT3 D;  4F87 A;  2R61 A;  1BBW A;  1JJG A;  3CQZ H;  1F2L A; 
#chains in the Genus database with same CATH homology
 1JJC B;  2LSS A;  3HOZ H;  3ER0 A;  2YU9 H;  1XNR Q;  3A74 A;  2ASB A;  2K4K A;  1VQE A;  4YWL A;  4DV0 Q;  3TS0 A;  4APV A;  4B3R Q;  2LXK A;  2ZJP A;  2IY5 B;  3FP9 A;  5LMN Q;  4IPD A;  4IOA A;  5IE8 A;  2WB1 E;  4JBK A;  1PA6 A;  4L5T A;  2PI2 E;  2ID0 A;  4QGU A;  1HNX Q;  3KJP A;  3PO2 H;  1XMQ L;  4IPH A;  3CPW A;  4B3M Q;  4L5R C;  3L7Z C;  4BBS G;  4FDB A;  4A4I A;  4A3B G;  2NZH A;  1YEZ A;  4LUZ A;  2QEX A;  1YZ6 A;  2RF4 A;  5LMU L;  3A5Z B;  3D0F A;  2VUM H;  3TEH B;  1A0I A;  5C0X J;  1CUK A;  1TWH H;  4B3S Q;  1EUJ A;  3RLO A;  2E5L Q;  4KHZ A;  1GO3 E;  5GAG C;  1C7Y A;  3I4N H;  4DAM A;  4BXX G;  2XGT A;  1WYD A;  2JA6 H;  4DV3 Q;  4NXN L;  4GOP B;  1YBY A;  5JJK A;  3W1G A;  1PH5 A;  1LM0 A;  4X66 L;  4JBM A;  2BH2 A;  4AQY L;  4BY1 G;  2OWO A;  4A3M G;  2JA5 G;  4MZ9 A;  2VY3 A;  5IP7 H;  3DLL A;  1Q46 A;  4A3G G;  4UP8 A;  3H15 A;  2MQH A;  1XMQ Q;  3JAM i;  3H0G G;  3HKZ E;  4ME3 A;  4LF6 L;  1E1T A;  3AYH B;  3S17 H;  1NE3 A;  4OWX B;  4DK3 C;  5IP9 H;  4JOI C;  4PG3 A;  4HIK A;  1J5E L;  4JYA Q;  1SRO A;  4GNX A;  1HNZ Q;  4JI0 L;  4JCV E;  4R4Q A;  1K8A C;  4R4I A;  2MO1 A;  4NXM L;  1YI2 A;  3S1N H;  4GLV B;  2FXQ A;  4LWC A;  4JI7 L;  5GAD C;  4DUZ Q;  4A3F G;  2N3S A;  5C44 H;  2MO0 A;  4DV7 Q;  3M85 A;  1N33 L;  1I5F A;  3BZK A;  5IYC G;  2IHE A;  1IBK L;  1GD7 A;  2NZO A;  2R6G A;  1TWF H;  3S1M H;  4JOI A;  1PFS A;  3Q8D A;  3G71 A;  2K5N A;  2QGQ A;  3K7A H;  3KYH C;  4IPG A;  1NJI C;  1X56 A;  1S3O A;  4JV5 L;  3J81 j;  2PMZ E;  4A93 H;  5GQO A;  2I5H A;  3RLN A;  3E9H A;  4YHH Q;  1N8R C;  1I94 Q;  2WAQ G;  4HJA A;  4LNQ A;  2H5X A;  2K52 A;  3E9I A;  4QIW E;  2V1C C;  2JE6 I;  4X62 L;  4YCW A;  3I2Z A;  5M3M G;  2VS1 A;  1IBM Q;  1VQ7 A;  4A3L G;  4DR4 Q;  4GKJ L;  4OO1 I;  4A3K G;  5M3M H;  1OXV A;  4A3L H;  4DV5 L;  4JI0 Q;  3GTL H;  2JQO A;  3HOX H;  4GNX B;  5M5W H;  1OXT A;  4IFD G;  1UEB A;  1LYL A;  1E3P A;  5AJ3 Q;  1YJN A;  4P71 A;  1XJV A;  3FHW A;  2QA4 A;  3RNU A;  3CMA A;  5E7N A;  4NB3 A;  4B3M L;  3OYY A;  1WFQ A;  3UDG A;  2UXD L;  2WB1 G;  1CSP A;  2HQL A;  4DR6 L;  3HFZ B;  1TWC H;  2Q2U A;  2Y0S G;  3CCR A;  1JMC A;  3CC7 A;  3F2C A;  3HKS A;  4DR1 Q;  4OWW B;  2Y0S E;  5IYC H;  3HOW G;  1BKB A;  3D31 A;  3J80 c;  4A3M H;  2R7D A;  3M4P A;  3PCO B;  1KC8 C;  4A3K H;  2IX1 A;  1HNW L;  4OXP A;  4RMF A;  2OTL A;  3PV0 A;  2OTJ A;  3AQQ A;  2Q2H A;  1IL2 A;  1JT8 A;  2OQK A;  3HOV G;  1SRU A;  3NEL A;  3G48 A;  2DGY A;  5FJ8 H;  2YTX A;  2ZTE A;  3A0J A;  1EFW A;  1IBL Q;  1Q12 A;  3S24 A;  3U4Z A;  5FJ8 G;  4AQY Q;  2A8V A;  1HZ9 A;  1PHJ A;  4LF7 L;  1N32 L;  1L1O B;  2K14 A;  1J6Q A;  4A3C G;  2D62 A;  3IRB A;  4JI1 L;  1VQI A;  2F52 A;  3NEM A;  5C4X H;  5C0X G;  1S40 A;  2JA7 H;  2JA7 G;  2VQE Q;  1WI5 A;  3BZC A;  4C3I H;  4O2D A;  1ASZ A;  2OQ0 A;  1YHA A;  2F4V Q;  4A3J H;  4UP7 A;  4DR2 Q;  2CCZ A;  1TWG H;  2N8N A;  3CD6 A;  1Q7Y C;  4AYB E;  1VQL A;  2KHI A;  4DR1 L;  5J3B A;  1N36 Q;  4POF A;  5LMN W;  2UUB Q;  4J15 A;  3CCV A;  3S1R H;  4GS3 A;  2JJQ A;  2ZJQ A;  1L1O C;  5IWA L;  4OWT B;  3DM3 A;  1QUQ A;  1HNW Q;  1S72 A;  1YHQ A;  1N32 Q;  3JAM c;  5IP9 G;  4DV7 L;  1PH1 A;  1VS0 A;  5M3F G;  1OTC A;  4IJL A;  4BBR G;  3CCS A;  4AIM A;  2RHS B;  1QZH A;  4B3T Q;  1EWI A;  5C4X G;  1WOC A;  3B6Y A;  4LF6 Q;  3G4S A;  5LMN L;  5GRO A;  2EXD A;  4H02 A;  1VQA A;  2UXB L;  3CF5 A;  1QVC A;  1YJ9 A;  4JBW A;  4QY7 A;  1B8A A;  1XMO L;  1KQS A;  4GKK L;  3SGI A;  2R92 G;  4JYA L;  3A5U A;  1L1O A;  1MJE A;  1Z47 A;  3CC4 A;  2GN5 A;  4JI6 L;  1NMF A;  4LF4 Q;  5JJL A;  2IT1 A;  3ULL A;  4JI5 L;  4DV1 L;  4YY3 Q;  3GTJ H;  4GLX A;  1M90 C;  1GM5 A;  3UE0 A;  1XNQ Q;  3I4M G;  3TRZ A;  3PUY A;  2UU9 Q;  4DR4 L;  4GKJ Q;  4C3J H;  2R93 G;  2VQF L;  1XTD A;  2DUD A;  1CKM A;  3JC6 6;  1SMX A;  2WP8 J;  3CCL A;  4GN4 B;  4Y52 H;  2GVA A;  3S1Q H;  1C0A A;  2HHH Q;  3AEV A;  3U58 A;  1N34 Q;  1AE2 A;  1XNQ L;  2LXJ A;  4JI3 L;  3CCE A;  1HH2 P;  1L0W A;  4A3E G;  1WCM H;  3H3V I;  4HJ7 A;  1EQR A;  1SE8 A;  4DNI A;  3EN2 A;  4NXM Q;  4HID A;  1TXY A;  3GTO H;  3S2D H;  1X3G A;  1X6O A;  3T1H Q;  4LW1 A;  1VQ9 A;  1VQP A;  1UE1 A;  1SFO H;  1KL9 A;  3F8T A;  3K80 C;  3ULP A;  2HT1 A;  1SR3 A;  4LFB Q;  4DV0 L;  1VQ4 A;  2NVT H;  1FL0 A;  1OXX K;  2JA6 G;  3K0X A;  1HJP A;  1FJG L;  1SN8 A;  1Y1W G;  1HR0 Q;  5JEA G;  4GN5 A;  3PIP A;  4DR6 Q;  4DV4 L;  1V43 A;  2BA1 A;  5FLM G;  2Z0S A;  1FGU A;  3CXC A;  3OTO L;  4POG A;  3CME A;  4UP9 A;  2UXC L;  1HNX L;  4IJH A;  1H95 A;  3W5O A;  2AWO A;  4DUZ L;  4HIM A;  2EIF A;  2VQE L;  1N34 L;  4LF5 Q;  1I3Q H;  1IBM L;  3PUW A;  1FJG Q;  3J7A 5;  4DR5 L;  2VL6 A;  3I4M H;  2CFM A;  4DPG A;  4JI4 L;  4QJF A;  5C0X I;  1E22 A;  3KF8 B;  4DV2 Q;  3CAM A;  4LF8 Q;  2KCM A;  4BBR H;  4Y7N H;  3KJO A;  1XNR L;  4IFD I;  4DR7 Q;  2K5V A;  1GVP A;  1N36 L;  4O0A A;  2CQO A;  1KD1 C;  5C4J H;  4YWK A;  4LF5 L;  2N49 A;  1YJW A;  1XPU A;  1PH8 A;  5C3E G;  4OO1 G;  1IXR A;  4R4C A;  1IBL L;  1Z9F A;  2UUC L;  1C9O A;  4LFC L;  2EQS A;  3LGJ A;  5JJI A;  3U4V A;  1X55 A;  3KDF A;  1LUZ A;  4MTN A;  4YCV A;  2AMC B;  4K0K Q;  1NTG A;  3L0O A;  4BA1 I;  3KOJ A;  3G6E A;  1A62 A;  2A19 A;  2UXB Q;  3CP0 A;  1YIJ A;  1VQF A;  2I5M X;  1PYB A;  1UWV A;  1E1O A;  1UE7 A;  4DK6 C;  4GN3 B;  4ALP A;  3S14 H;  1D7Q A;  1A8V A;  3CCQ A;  4TQU S;  2OCE A;  2NN6 G;  5C3E H;  2UXD Q;  2RHQ B;  1Y1W H;  3GTK H;  1PH6 A;  1VQM A;  1AH9 A;  2Q2I A;  2UUA Q;  3PGZ A;  1IYJ B;  2KCT A;  1CKO A;  3T1Y L;  5HY6 A;  1WJJ A;  2F4V L;  3CC2 A;  4X64 Q;  4GKK Q;  4A3I H;  2IX0 A;  5FLX c;  3BJU A;  4LFA Q;  4LFC Q;  3HOW H;  1K9M C;  1AE3 A;  1IZ6 A;  5ELO A;  4JI6 Q;  4B3S L;  2R92 H;  4XTC S;  4HIO A;  4OON A;  1RIP A;  1QZG A;  4A3J G;  1Q1B A;  2NVY H;  4A3D H;  1EQQ A;  1HZB A;  4GOP C;  1P8L A;  2B63 G;  1I6H H;  3TS2 A;  2Z6K A;  2ALY B;  4KI0 A;  1GKH A;  4DAY B;  1KXL A;  3KF6 A;  1MIU A;  1X65 A;  3S15 H;  3KLW A;  3PSI A;  4C2M H;  2YV5 A;  4DR2 L;  2ZM6 L;  1OXS C;  2XTI A;  2VW9 A;  3UDF A;  1HR0 L;  2PNH A;  1IBK Q;  4X65 Q;  1Y1V H;  1K3R A;  3S2H H;  1V1Q A;  3OTO Q;  3CW2 C;  1NBW A;  3I4O A;  1UE6 A;  1PH9 A;  4LF4 L;  2UXC Q;  4WJ3 M;  4HJ9 A;  3PO3 G;  4A75 A;  1Q1E A;  1JJ2 A;  1X3E A;  1U5K A;  4P75 A;  2NN6 I;  2KHJ A;  4RG1 A;  1JB7 A;  3UE1 A;  2NVX H;  3KF6 B;  1Q8K A;  2L15 A;  1MJC A;  1R9T H;  2PQA A;  3NBH B;  4WJ4 A;  3OW2 A;  1HNZ L;  1KIX A;  4X6A H;  3AFQ A;  1CKN A;  3K7U C;  5K36 G;  3J80 i;  2YTV A;  2K50 A;  1K83 H;  4IOC A;  4A76 A;  3HOZ G;  2B63 H;  5JEA J;  4BY7 G;  1G29 1;  3K8A A;  1CSQ A;  4KLK A;  4L5Q A;  3KFU A;  1KRT A;  4DV5 Q;  2WAQ E;  4HJ8 A;  4OX9 L;  2VNU D;  3RR5 A;  4DR3 L;  1EIF A;  1VQG A;  4JBJ A;  1EIY B;  2JA8 H;  1Y1V G;  3HKZ G;  3ZJY C;  1LTL A;  3M4Q A;  5GAH C;  4XIG S;  5IYB H;  4JI2 Q;  4DV1 Q;  1PYS B;  2BA0 A;  4DR5 Q;  3FKI H;  1PV4 A;  1Y14 B;  1VQC A;  4NPS A;  3WWV A;  1PH2 A;  2AHO B;  4A3D G;  3FKI G;  5IT9 c;  1M1K C;  4LF8 L;  3GTG H;  3PF4 A;  5M5X H;  4YHH L;  3PO3 H;  3VDY A;  1D8L A;  1YIT A;  2E2J H;  1YNX A;  2Z6K C;  4DV6 L;  1HZA A;  2A1A A;  4QL5 A;  4PMW A;  1W2B A;  1VQB A;  1FVI A;  4DUY L;  1HZC A;  2HIV A;  4KHP L;  1PH3 A;  2B3G A;  4LF9 Q;  4BA2 I;  5IY0 A;  1CKN B;  4PZ8 A;  3HOU H;  1E24 A;  2D0O A;  1KRS A;  3GTP H;  4C3H H;  4EX5 A;  5IP7 G;  5IWA Q;  1V9P A;  3KDF B;  2ES2 A;  4GLA C;  4OX9 Q;  3U50 C;  4DUY Q;  3H3V H;  4KHP Q;  3STB C;  4A3F H;  1XPO A;  1UE5 A;  2ATW A;  2VUM G;  4LF9 L;  3GTM H;  3I55 A;  1VQ5 A;  4L5S A;  3UDX A;  1K73 C;  2GVB A;  5EAY A;  3M7N A;  1VQ8 A;  1G51 A;  4IO9 A;  1O7I A;  2JK8 A;  2I0Q A;  3I4N G;  4P72 A;  3MEF A;  3BU2 A;  2JA9 A;  1DGS A;  1VQO A;  5H1S E;  2K75 A;  3CCJ A;  3PO2 G;  3F1Z A;  2YTY A;  5AJ3 L;  2R7Z H;  2UUA L;  2N78 A;  5C44 G;  4GNX C;  2ZJR A;  3ICE A;  1Q82 C;  4A3C H;  1OXU A;  1QVG A;  1EOV A;  3W1B A;  4JI5 Q;  5IYD G;  4YY3 L;  2C35 B;  1RL2 A;  3J81 i;  1Q81 C;  4LF7 Q;  4QQB X;  4PZ7 A;  4DR7 L;  1VQD A;  4JI1 Q;  5BR8 L;  3J7Z C;  3F2D A;  1L2F A;  4JI7 Q;  5GAE C;  4BXX H;  1X3F A;  4A3I G;  4EQ5 A;  3L2P A;  3HOY G;  1X9N A;  2R7Z G;  1W3S A;  1HR0 W;  3HOU G;  1NMG A;  1VCI A;  2MFI A;  1KHI A;  2ZTD A;  3TQY A;  5M3F H;  4BY1 H;  1PH7 A;  4R4T A;  2IHF A;  3ERS X;  5FLM H;  2ZM6 Q;  4LUO A;  4R1J A;  1J5E Q;  4JC0 A;  4LFA L;  4AYB G;  3T1H L;  2VQF Q;  3PUX A;  1SLJ A;  2HIX A;  1QUQ B;  4DV3 L;  1T9H A;  2VZA A;  4MNO A;  1B70 B;  4P73 A;  1N9W A;  3TRE A;  1VQ6 A;  4IPC A;  5IYD H;  1TWA H;  3NEN A;  1X54 A;  3AFP A;  1KAW A;  3EIV A;  2RCN A;  3RLF A;  3M3Y H;  3UDI A;  2NVQ H;  2E2H H;  2F3I A;  4DV4 Q;  2B29 A;  3PUZ A;  3CCM A;  3RZD H;  4HJ5 A;  3J81 c;  2AWN A;  1PH4 A;  4BY7 H;  2PQA B;  4YCU A;  3ULJ A;  2Q2T A;  2R93 H;  1Q86 C;  4X64 L;  1VQK A;  1WCM G;  3MXN B;  2JA5 H;  2PI2 A;  4BBS H;  5HGQ A;  1QVF A;  2UU9 L;  3RN2 A;  2MNA A;  2AKW B;  2CWP A;  4DR3 Q;  4B3T L;  4UY8 C;  4DV2 L;  4NXN Q;  3EBE A;  3F2B A;  3RN5 A;  1ASY A;  3GTQ H;  3CCU A;  2JEA I;  4A3E H;  4IFD J;  5M5Y H;  4X66 Q;  2R7F A;  4DKA C;  1XMO Q;  4JI2 L;  2E2I H;  2KBN A;  4A3G H;  1A63 A;  4JI8 Q;  4TVA B;  1N33 Q;  4JG2 A;  4UPA A;  5IYB G;  4LUV A;  3I7F A;  3HOY H;  2JEB I;  4GOP A;  3PUV A;  4PZ6 A;  3M4O H;  1G6P A;  4B3R L;  4DV6 Q;  3GO5 A;  3GDE A;  1VQH A;  1XPR A;  3PF5 A;  2E8G A;  4JI4 Q;  4JI8 L;  1VQN A;  3RZO H;  1P16 A;  4X65 L;  2D0P A;  1YVC A;  1PVO A;  3K81 C;  1I94 L;  2WFW A;  2CWA A;  3M9B A;  3HOV H;  3H0G H;  3S16 H;  4LFB L;  4YWM A;  3HOX G;  1E7Z A;  2YYZ A;  2KEN A;  5DLQ E;  4X62 Q;  2HHH L;  1K0R A;  1K8G A;  1BVS A;  1I50 H;  2ZTC A;  4JI3 Q;  1MKH A;  2UUC Q;  4P74 A;  5ELN A;  1BBU A;  1B7Y B;  4R4O A;  3STB D;  1U0L A;  3PIO A;  1NY4 A;  1YHB A;  5LMU Q;  2I5L X;  3CPF A;  2JA8 G;  4K0K L;  5BR8 Q;  4AH6 A;  3E0E A;  1JE5 A;  3I56 A;  1VQJ A;  2K5H A;  2BH8 A;  2UUB L;  3T1Y Q;  1EYG A;  1BBW A;  4A3B H;  2E5L L;  3CQZ H;  4JV5 Q;  3GD7 A;  4A93 G;  1JJG A;  2CKZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...