2K05A

Structure of sdf1 in complex with the cxcr4 n-terminus containing sulfotyrosines at postitions 7, 12 and 21
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCACQIVARLKNNNRQVCIDPKLKWIQEYLEKCLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Structural basis of CXCR4 sulfotyrosine recognition by the chemokine SDF-1/CXCL12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 8
structure length 68
sequence length 68
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k05A00
1WTOA 1AP0A 3R93A 4UAIA 2KUMA 3P7JA 1BF4A 1B4OA 2B2WA 4IURA 1BO0A 4X3UA 4HAEA 1GUWA 1PFMA 1EOTA 1HFGA 3H91A 2FFKB 3DEOA 1DOKA 2MP1A 3ONAB 2K04A 2Q8TA 1WTQA 2FHTA 1BBXC 2MJ8A 1U4RA 2XIWA 1F9PA 1QE6A 4OIJA 5CBAE 1O80A 1JE4A 1C8CA 3MWYW 1F9RA 1J9OA 2HUGA 3LWEA 2EOTA 4XT3B 2DY8A 2K01A 4HCSA 1WTXA 2L12A 2HCIA 1DZ1A 2NYZD 1KNAA 4IUTA 4LMQD 1ZXTA 1J8IA 2B2WC 1O7YA 2KEEA 1A15A 1F9QA 1G6ZA 2FINB 4ZAIA 4RA8A 2VXWA 1RODA 1NCVA 2HDMA 1X32A 1B53A 2FMMA 1EL0A 3QO2A 1HA6A 4HEDA 2RA4A 3SVMA 1WD0A 1B3AA 1MSGA 5COYA 5EPLA 3IL8A 4R8IA 2KOLA 1CA5A 2X69A 3N52A 1M8AA 2B2TA 2K03A 4ZKBB 3GV6A 4RWSC 1WTPA 5T1IA 2B2YC 1U4LA 3IFDA 1SAPA 2L9HA 3FDTA 1S4ZA 1WD1A 5EPJA 4DN4M 4R9WA 1VMCA 5EJWA 2K1BA 2KEDA 4CJ0B 2X6GA 3HP3A 4CJ2C 2D9UA 2L11A 4QUFA 1HFNA 4XT1B 3D6WA 5DNFA 1CM9A 1IKMA 1DONA 1O7ZA 1TVXA 1SSOA 2DY7A 2HCCA 2K05A 1MGSA 2N55A 1QG7A 2SDFA 1HRJA 1IL8A 1WTRA 2MPMA 1G91A 4IUVA 4MHEA 1DOLA 4QUCA 1MI2A 4ZKCB 4MN3A 1BNZA 1EIGA 1IKLA 5D14A 1EIHA 3G7LA 3DEPA 4X3KA 5CBEE 1ESRA 5CORA 1NAPA 2NWGA 1F9SA 1KNEA 1MSHA 2B2VA 2FJ2A 2JP1A 2J7ZA 4RAUC 2RSNA 2N88A 5EPKA 4X3TA 3TZDA 4ZK9B 4ZLTF 2X6LA 1RTOA 2K28A 1HHVA 5T1GA 1PDQA 1ILQA 3TN2A 3UI2A 2EE1A 2L1BA 3F2UA 1PFBA 1DOMA 4X3SA 1X3QA 2B2UA 4U68A 1WTVA 1G2SA 3I3CA 3I91A 2BDNA 2H1EA 1ML0D 2M2LA 2RVLA 1B2TA 1RTNA 1PFNA 1HUNA 1AZQA 1WTWA 2CVRA 2R3ZA 4O42A 1X3PA 1HUMA 1SDFA 2IL8A 3KUPA 4OIKA 5AFWA 1NR2A 2RSOA 3I8ZA 3I90A 1Q3LA 4CJ1B 1EQTA 1U4PA 1LV9A 2B2VC 3FPUB 2MGSA 2Q8RE 1XX8A 1F2LA 3KBXA 5D65A 1ICWA 2B2TC 1QNKA 4IUUA 5E4WC 5EKIA 5E4XA 4IUQA 1JICA 5EQ0A 2EPBA 2KECA 1CA6A 2B2UC 1AZPA 5CMDA 1VMPA 2KVMA 2B2YA 1B50A 3MTSA 3DM1A 5JJZA 2JYOA 4HSVA 4IUPA 2HDLA 1XYIA 2L4NA 4NW2A 1NR4A 1WVLA 1ILPA 1G2TA 2NZ1D 1RJTA 3GV3A 4XDXA 1RHPA 3Q6SA 1E0BA 1PLFA 1U4MA
chains in the Genus database with same CATH superfamily
1WYDA 1H9SA 4NDXA 2E2IH 4LF5L 4LF7L 3S24A 2RCNA 2QGQA 2KCMA 1JOKA 1O78A 4KHPQ 3MXGA 4HCEA 4IFDH 3X3MA 4DV7Q 1I5FA 4K5VA 4CKCA 4NKLA 4QY7A 4B3SL 1EU4A 1PXUA 1KRSA 3ERSX 5DEHA 5IGBA 1PHJA 1VQHA 5GAHC 3KYHC 1AE2A 1JWUD 2R6GA 1NJIC 1GKHA 2CH4W 1FR3A 1QVFA 1X6OA 2Q8IB 2GVAA 1F9QA 1EIFA 3DM3A 3IFTA 4PZ6A 4PNYA 3EQLC 4ABNA 4NXML 3HS0C 1F2ZA 3NBHB 2B2TA 2AMCB 4A75A 2E2JB 1U4LA 3FDTA 3NUCA 1VQ5A 5K5PA 1I4XA 2Z1CA 3S1QH 3X3NA 1IW7D 1PH1A 4A3IG 3PO3B 1EUJA 4QGUA 3U4ZA 2K14A 2UXDL 4LF9Q 1BKBA 1IKLA 3SXHA 1OXUA 2IX0A 3BVGA 2ES2A 2B2VA 2VUMG 2F3VA 2OCEA 2UXCQ 4DUYL 2YU9H 1CKNB 2JN4A 4RHRA 1R9TH 2R7ZG 1TS2A 5C4XB 3L2PA 1WTVA 2N3SA 3GTKH 4TSSA 2F0VA 2L55A 1X3PA 3E5SA 4KHZA 5IT9c 4DNRB 4C3JB 4DK3C 1IYVA 5M5WB 2D0OA 3HKZB 5G3LF 2CKZB 1A2UA 3URYA 5AJ3Q 4UHVA 4J6HA 1TWHH 5EKIA 3STBD 4A3DB 1PZJD 1D7QA 5CR3A 1JB3A 4C56C 4BY7B 2V1CC 4WJWA 2KECA 2AQ3B 3A5UA 1QWYA 2F0IA 3L9AX 5JOBA 3TP5A 2JYOA 3H15A 2HDLA 1VQ7A 5GAGC 1K8GA 1GJXA 2HQEA 1XWEA 3PO2G 1L1OC 2EYJA 3SDZA 5I6WA 1X3GA 1YJWA 3GTJB 1PLFA 3J80E 2AUJD 5M5XB 1FD7D 1BF4A 2R93B 2ZXPA 1X3FA 4X3UA 2NVTB 1R4PB 1PFMA 4C3IG 2KBNA 5FKAC 1JWMD 3QG1A 4KY7A 3L0OA 3DMUA 5E3FA 1JWSD 2Z6KC 4JBJA 1O80A 3H0GH 3KF6B 1EIYB 3C1EA 1J9OA 4DR2Q 2UUAQ 4FYDA 2K5NA 2IHEA 1DZ1A 2WKDA 3Q23A 1ZXTA 3RN2A 2B63H 1A15A 2K4KA 1LTLA 1PA6A 1I6HB 1X32A 2FMMA 3HKSA 1TWFB 1EWCA 1B3AA 2UUBL 2HHHL 2NTTA 1W6JA 4ID6A 1CT1D 1VQDA 1Y8PB 3NSWA 3KBGA 5ELOA 4DAVA 1EU3A 1C48A 4C2MH 2ZTDA 4DN4M 2X6GA 4KN7C 2AHOB 3M3YB 5I4DA 3I4OA 4XT1B 3P75A 1OXSC 1HNZL 5IODA 1WOCA 1TVXA 4JBWA 2EDGA 4R4OA 5DAUA 5C5MA 2JEAI 5I2XA 3RZDH 3VYRA 1DOLA 2JA7H 4L8JA 1QCBD 3VYSA 2LKVA 4RH6A 5D3DA 1N32Q 2MO1A 4JI4L 3C3LA 2ZJQA 1MBYA 4AYBB 4V190 3A74A 4KN4C 3I7FA 2N8NA 1TXYA 2L1BA 2F0GA 3Q22A 2VQFQ 4EQ5A 1WJJA 2RVLA 3C1FA 3J80c 1B44D 3AU7A 3DHQA 3M9BA 4A93B 1ET9A 1Q46A 2CVRA 4DV6L 1CKOA 1L1OA 4B3RL 1BXTA 1HTPA 1SFOB 2PYKA 2AWOA 3UE0A 4JI2Q 4ULLA 3GP7A 4Q5VA 1JT8A 1DYQA 3WOFA 2WKCA 4G4KA 2EXZA 3N6RA 2F0MA 1FGUA 1EEFD 1PTOF 2XTIA 5BN5A 4EVOA 5M9OA 3UDGA 2OXPA 1ILPA 2ZM6L 1G2TA 4GKKL 1MKHA 4DGZA 4YWKA 1RJTA 1EZ6A 1STYA 2PZWA 1YEZA 5IP7G 1PYWD 2HT1A 1HA5A 1CZWA 1JOQA 3FVQA 3R93A 5C0XH 4JI1Q 3BVZA 3CC2A 5IGEA 2PPBC 5IIFA 1GOZA 1MD2D 4X64L 2C9OA 1SR3A 4PMBA 4A3EG 1YZ6A 1B9MA 1SMYC 1S72A 1N8RC 4A3LG 5C0XJ 1E24A 4G57A 1U4RA 1RDPD 4OIJA 2E2JH 2A6HC 4OO1I 2KCTA 1VQ4A 4OGQC 4RKBA 5JEAH 3J7AV 2K01A 4JOIC 2L12A 1WTXA 3GTGB 2R7DA 2BDOA 2GN5A 1HZ9A 4DR6L 2XNAC 1HQRD 3U58A 3D4WA 3K58A 1Y14B 2K75A 3I4MH 5C3EB 3CP0A 3S1NH 4P72A 4QIWB 1K0SA 1IZ6A 1EFID 1PYSB 3F2BA 5EKLA 2VQEQ 2Z8LA 4BS9A 1QJOA 1L0WA 5EJWA 3HP3A 1TWCB 3IKJA 4I65A 5CV9A 1SE3A 4LK1C 3UDFA 3CMAA 1P8LA 1VQCA 1UAPA 3NEMA 1K83B 3JAML 4IQZA 1HZAA 2L0CA 1HNWQ 1TS4A 4P2CB 4LFBQ 1S5CD 3UDXA 3DXJC 5M5WH 1T5EA 3BS1A 5KYLA 3T13A 4JI5Q 1QUQB 3RNUA 3R2TA 4DAYB 5IYCG 2NUCA 2X6LA 4A3DH 3HOUH 5IE8A 5CV5A 4BY7H 2O5JC 1PFSA 4A3KB 3S1MH 4DV2L 3HOYB 1NMFA 4KKSA 1SJED 4F87A 3S14H 1AZQA 2WB1E 3GTJH 3HFZB 3A5ZB 3FPPA 4CHTB 1EYAA 2Z4IA 5M5XH 2OF1A 5EAYA 5BR8Q 5JJIA 2R93H 2A8VA 2I5MX 4KHPL 5IWAQ 2R92B 4DV7L 3J7AF 3KF8A 1BR9A 4HJAA 1AE3A 2BH8A 1V1PB 1HQMC 4LJZC 1PH3A 4GZYC 2EYFA 1TQOA 4KI0A 1NUCA 4IJLA 2F0SA 1JORA 1I4QA 4YY3L 1X9NA 1KLUD 2K5DA 3GTOB 1YBYA 4NPSA 2L15A 2H5XA 4H0LC 1BO0A 1I6HH 1ET6A 1TWFH 3NHHA 4RG1A 5C3WA 4LFAL 1KD1C 2F0KA 3EFXD 4NXNL 4IO9A 3K59A 1LYLA 3NENA 1XTDA 3VYTA 1HH2P 1Q8KA 2R7FA 2JJQA 3M3YH 4OXPA 1TKWB 1XTCD 1BBWA 1VDZA 3MXNB 3L7ZC 5I6YA 4LF9L 1B53A 3PUZA 3OTOQ 2ZTEA 1IBLQ 1M8AA 2FMCA 4KV6A 1VQNA 1IBKL 2B63G 1PTOD 3CCSA 1EQRA 2MFIA 4RGMA 3V96A 1D6EC 4JPBW 2E5LL 2QCPX 3CCUA 2R61A 4IUVA 3K5NA 3M4PA 4A93H 4GKJQ 4KK7A 3K5MA 5M3MB 1K3RA 2YTYA 5J22A 2AUKA 3PIO3 2I0QA 2NN6I 2LMCB 2Z9HA 1F9SA 3RMHA 1UE6A 2FJ2A 5AJ3L 1KQSA 4GLVB 1KLGD 2F52A 4PMCA 3U9SA 2JA7G 4FXKC 4IPCA 3F2UA 2XN9C 4IPHA 2JA9A 3TRZA 1ML0D 2M2LA 5IT9L 4A3MB 4OX9Q 1XPRA 1VQKA 3MXUA 2HIXA 4LUVA 1E2VA 1J5EL 3GTQH 3K5LA 1LTGD 1Q3LA 4C1NI 5NUCA 2MGSA 1GVPA 2UUBQ 4OWTB 1K73C 1K9MC 1NY4A 1ASZA 1CZGA 1LTRD 1HTLD 2I07B 3SK6A 2D2CC 2K7VA 2PMZB 3CF5A 1UE5A 3KFUA 2VW9A 4JBMA 4PQXA 1VMPA 1VQPA 4G7ZC 1HNZQ 1CTMA 2ICIA 3DLLA 4QQBX 2ATWA 4JI8L 4A3FB 4K2KA 3TBIB 4DR2L 2UUAL 3Q6SA 1Z6HA 4RMFA 2MQHA 4MNOA 3W3AA 4JW0A 3GTGH 3S17H 2BA0A 3A0JA 1GD7A 5ELFA 2Z6BA 2NVXB 2WP8J 1I4RA 3AEVA 3PO2H 3U50C 3JAME 2MP1A 1K8AC 1HR0W 2I5HA 1AW7A 1CHQD 4QB4A 5C3EH 4P74A 4FXGC 3E0EA 5C0XG 3EVQA 3LWEA 3ND9A 4B9XA 1PRTD 2JSOA 3W5OA 4C3IH 2D0PA 3UDIA 3ITPA 4ZAIA 3GTMH 1EL0A 3D3RA 4B3TQ 2F0DA 3MEFA 1UNSA 1B9NA 4L5SA 1N32L 4C3HH 3J81i 1G291 4RWSC 5KYIA 5JJKA 2BCOA 3CHBD 1F2MA 4J8QA 4R9WA 4P75A 2F0OA 1V1OA 1YNJC 3NK9A 4A3KH 2PI2E 1QG7A 2A69C 3I4MG 1PZID 4BBSB 4JI3Q 3MC0B 4MN3A 5KNCA 3CMEA 1EIHA 2KHJA 1AN8A 2E2DC 4WFN3 4ALPA 3NP8A 4JI2L 4X64Q 1X55A 3H6MA 3TZDA 4ZK9B 3EN2A 4GOPB 3H3VH 1CFMA 1FL0A 3CCQA 2R92H 3VR4A 3J80L 5JVG3 1I4HA 5LL6X 4FXDA 2PCFB 1B2TA 2PNRC 1AFPA 1ZYRD 4A3DG 3HOUG 1NR2A 1XPUA 4GN3B 4BY7G 3K0XA 3SK5A 4MIUA 5D65A 1BCPC 4JI1L 2B2TC 4IUUA 4HJ5A 2MUYA 1TY2A 4IUQA 1S40A 5EQ0A 2EPBA 2B2UC 1PH8A 5IY0A 1UUPA 1WVLA 1A8VA 3PF4A 3GV3A 2R93G 1SEBD 1LLRD 4EQOA 3HOWB 1LT3D 4OWWB 5C6AA 1X54A 3NBHA 2A6EC 2Z4HA 3FKIB 4KKTA 5JAVA 3DUZA 4WJ3M 4F7XA 2KHSA 1EYCA 3ONAB 1C9OA 1FNUA 1H9MA 2XIWA 1TS5A 4KKUA 4K5WA 2E8GA 4BWGB 2RDFA 3CC4A 2DY8A 4NMZA 2P5ZX 3T16A 4ME5A 1VQIA 1O7YA 1G6ZA 1D8LA 1Y8OB 4RA8A 4CGYB 2JA6H 4BBRB 1V1QA 5IT9E 1TWGB 3HKZE 3GTLH 1HNWL 3SVMA 1CKNA 4LFBL 4RGOS 1KL9A 5FO9B 3CRKC 1WCMB 2X69A 5LL6S 4JI0L 4JI5L 4A3GB 3OMGA 3IFDA 3D0FA 2QEXA 3K7UC 2KJXA 3TP8A 2CWAA 2JA8B 1CM9A 5KNDA 1SJHD 4YY3Q 5TSSA 3BYTB 1MI2A 1U5KA 4XYQA 3D31A 4LFAQ 5CC4A 3M85A 1G8ZD 3BJUA 4NXNQ 4DV3L 1STHA 4K8JA 5BR8L 2B39A 4RHSA 4RCNA 3A8KE 5EBCA 4ZQ3A 2A73B 5CV6A 5LHY1 5IWAL 4A93G 4UY8C 2WV6D 3W2DA 2B2UA 5EGTA 3TS2A 2WAQE 5ELBA 1RTNA 5IYCH 5KRUA 3FHWA 4A3FH 3L3OC 1E2ZA 4FF4A 2WIIB 1TWAB 3MAQA 3I4NB 3I8ZA 3B6YA 3K81C 2O5IC 5CV7A 4XQJA 3FPUB 3ULPA 1GUTA 3OSOA 4K5XA 1Y1WB 1RCVD 5CV8A 2NVXH 1IBKQ 3BDLA 4CBVA 1ONLA 1N36Q 3TQYA 1KDBA 1HZBA 3AYHB 5J39A 1SYEA 4IJHA 4QL5A 3F1ZA 3KLWA 4H44C 4DFAA 4XQNA 2E5LQ 2EY1A 1KIXA 5J3BA 2TSSA 3EIVA 2JXMB 4LUZA 1H9SB 2KUMA 3LNNA 2KHIA 5I2YA 3OWEB 3SGIA 1GUWA 3H91A 1EZ8A 1VQ8A 5C44H 4N8X1 3D6CA 3M4YA 1Z7TA 3E9HA 1STBA 3LGJA 4AYBE 3OTOL 4BA1I 2Q8TA 3PMFA 1IBLL 2E76C 4Y7NB 1F9PA 1SMYD 3KDFB 5CBAE 1JE4A 4J1MA 2IHFA 4ODGA 2HUGA 3GQBA 4LF6Q 1PTOB 2IJ0A 3ULJA 1OXTA 4HCSA 3P1HA 3EJIA 2XWJB 1J5EQ 3JC66 5C4JH 4HJ8A 1EQVA 2FINB 5C3EG 4GN4B 4BBSH 1KAWA 1VQOA 2EIFA 2DNEA 2HDMA 3K8AA 5IYBH 3QO2A 4GKJL 2A68C 1AH9A 3PIOA 2QDLA 5COYA 3A56A 2OTJA 2BE5C 1SYFA 1XPOA 1A0IA 4P73A 2D62A 5EPJA 2XVSA 2RDHA 2Y0SB 3K80C 1SE8A 4L6TB 2WAQB 2K5WA 4JI8Q 4KJNA 2O4XA 5LMUL 4POGA 5GAEC 4R4IA 2HCCA 4C3HG 1WTRA 4OX9L 4GNXC 1GXDC 1QILA 1GO3E 4UP8A 2BA1A 2Q2TA 3TZUA 5GADC 3DEPA 2F0EA 4X3KA 5CBEE 5CORA 4BY1B 2NWGA 1KNEA 2RSNA 4A3KG 5EKKA 1ENAA 1NBWA 1GHJA 1FGBD 1X3QA 3QR8A 4N9TA 4NB3A 4F8MA 4JCVE 1Y1VB 3EBEA 4YIJA 5FLXc 1X65A 3CU7A 2BH2A 3H3VC 2AQ2B 5AFWA 2ZJRA 1VQGA 3V05A 2R92G 1VCIA 2NN6H 3MVVA 1F2LA 1MJEA 1X3EA 2EJFC 5E4XA 3PF5A 3CCMA 4QIWE 4L5QA 2B2YA 2DJFC 2QDBA 4NW2A 2GA4B 2QILA 2Z0SA 3BDCA 3P20A 4DUZQ 1JCKB 2JA5B 4AH6A 1PRTB 5C4HA 4FP5D 1JJGA 2ZTCA 1ENFA 4M8AA 4HIMA 1Q7YC 1GUNA 3DWAA 4OHJA 3F2CA 1HFGA 4B3TL 4NP5A 2JQOA 5HGQA 1IW7C 1WCMH 4WRDA 4A3GH 1YI2A 4HJ7A 3K57A 1YHBA 3MWYW 1JE5A 4DV0Q 3U4VA 2MNAA 2JA8H 2QEJC 1EY4A 2A5HA 4A3IB 4K6LA 3M4OB 1RODA 4JI3L 1SNOA 3TREA 1Q12A 4GNXA 4HMJA 3FRPB 4DAYA 2RA4A 1SBBB 1IHZA 3M4QA 4X62L 2J0TD 2KOLA 1N33Q 1BCPF 1CK1A 1EQQA 4ZKBB 4PZ8A 4QJFA 1V8QA 4APVA 1Y69U 1N9WA 1PH6A 3PSIA 1WD1A 1Q1EA 2F0PA 1JR0D 4DK6C 1SNPA 4PMWA 2JA6G 2WB1G 2D9UA 4ME3A 1YJNA 2G5DA 4TVAB 5D3IB 5M3MG 2MO0A 2R7ZB 1A6XA 2SDFA 3S1RB 5BN3A 1G91A 4YHHL 4QUCA 1JJ2A 3PO3H 4ZKCB 2AQ1B 4E6IA 3I56A 1BNZA 5H1SE 1JOOA 1VS0A 3G4SA 5G3LD 1LUZA 1I3QB 1KDAA 4IFDI 4N8FA 4RAUC 1Y1WH 1PH9A 2ENBA 2I5LX 4YWMA 4JV5L 2K6AA 2NZHA 2DN8A 4KLKA 3I3CA 3H09A 2BDNA 2PZTA 3PV0A 2DUDA 5C4XH 3OW7A 1D5ZC 1I94Q 4JBKA 1LACA 3FEWX 5CV4A 2RBMA 3CCRA 1IYJB 2Q8RE 4C3JH 4O2DA 2LXJA 1TS3A 2E2HB 1OXXK 4JI0Q 3D8GA 5J1ZA 1FJGQ 1OO9B 3I2ZA 4A3FG 1CA6A 4R1JA 1QVCA 4IUPA 1ZEQX 4Y7NH 4LF4L 4DKAC 2RQXA 3MXNA 1EEID 1LTTD 3T4AC 3GTPB 3NTIA 2KQ3A 5K36G 3BVMA 3J7ZC 4DV3Q 4K14A 1QVGA 3ZJYC 1E22A 4LF8Q 2CW0C 3DEOA 2PO4A 3PGZA 3SK8A 2NVTH 2NVQB 1YNNC 4KJOA 1Y8NB 2MJ8A 4ZUJA 2OTLA 1QE6A 1EY8A 1CI3M 1F9RA 1SNQA 4V0BA 4WJ4A 5C44G 2NYZD 4IUTA 1J8IA 2KEEA 3CKIB 1ASYA 1A3TA 1HA6A 3S16B 1WD0A 3HOZB 2OEOA 2VS1A 1X56A 4R8NA 1LTAD 3GV6A 1RL2A 1ZKOA 5IOCA 1LT5D 2PMZE 2PQAB 1VMCA 2KEDA 1WI5A 2RHSB 4BBSG 4M1UB 3G6JB 5IYBG 2F0HA 2LY7A 4L5TA 1YNJD 1KTKA 3CCVA 1IXRA 4OWXB 1STEA 3OYYA 1I4GA 3AFPA 3V2TA 4GOPC 3FMCA 1EY7A 5HGTA 3G6EA 1EWHA 4OONA 5M3FB 1SE4A 1BDOA 4FF1A 1R4QB 4X66Q 4X3TA 1JMCA 2K28A 3E6ZX 1EYDA 4G7HC 1N36L 1PFBA 1BQQT 4A3BB 3S2HB 1CSPA 4OIKA 2RF4A 3LWUA 2JA5H 1M4VA 1LV9A 3RZOB 3BDOA 3KBXA 1SFOH 1HR0Q 1EY9A 1K28A 1BCPD 3VR6A 1KAAA 4A3CH 2E75C 2DGYA 3KLSX 4K2LA 5M5YB 4FDBA 4TRDA 5LMUQ 3HOWG 4A3EB 2NN6G 3ULLA 3J7A5 5KEEA 2E2IB 4XDXA 4B9WA 1PH5A 1RIPA 3FKIG 4O0AA 1CQVA 4LF6L 4J15A 1E0BA 5E1FA 3K7AB 1LO5D 2UU9Q 3S15B 1UWVA 5IYDH 5A35A 3M4OH 3AQQA 4HAEA 2A6ED 3CPWA 1KDCA 5HY6A 1D2BA 1FVIA 2YTVA 1E1TA 4BXXG 2XSCA 1D5XC 4R4QA 1A2TA 2F0JA 2ICEC 4DNTB 5IGFA 2K50A 2BOSA 3HRZC 3OIQA 3ERQA 4LMQD 4K8IA 1XMOQ 1CSQA 3S1RH 1SROA 4UDUC 1WCMG 2EXDA 4A3GG 1FNVA 2PQEA 1HZCA 4U673 2RKSA 3E3XA 3CCJA 4GOPA 3K6OA 1SNMA 1TU2B 2JA8G 2EY6A 3S1QB 5DLQE 2L9HA 5LMNW 1YNXA 3A8IE 4CJ0B 1J6QA 3NWSA 4CJ2C 2NZOA 1G51A 3D6WA 4KHVA 5DNFA 1DONA 5FO8B 5A2QE 2CH4A 1TWCH 4G7OC 3HOXB 1IL8A 1T9HA 1I50B 4BA2I 5D14A 3QWNA 2NBFA 3KK7A 1K83H 4HR7B 1H9KA 1ESRA 3I70A 2YU9B 1ICFB 1R9TB 2D5DA 1DM0B 2PZUA 4ZLTF 1Q86C 3U9OA 1A63A 3RLOA 3PO3G 3GTKB 4X3SA 3W1BA 2K32A 4U68A 3I55A 1VQEA 4KY6A 5FLXL 1E3PA 1STAA 3HOYH 1SDFA 2EYHA 1NNXA 4PZ7A 4DUZL 1Y1WG 4GLAC 3MFGA 1EQTA 1U4PA 2YV5A 2EQSA 2F4IA 1HNXQ 3ICEA 3VR2A 4X62Q 2F4VQ 3VA5A 2IX3A 4LFCQ 5C4XG 4HTHA 1JICA 4FO2A 2PW5A 1AZPA 1YJ9A 3CW2C 5IP9G 2NVQH 4JC0A 3Q8DA 4DK0A 2PI2A 3E0JA 4C3JG 2UUCL 4TQUS 5DM63 1JJCB 1F77A 3HKZG 4H02A 4YHHQ 4DV0L 4KY5A 3MFYA 1D5MC 3CXCA 1GUSA 2WINB 4K6DA 4ZRZA 3Q24A 3GDEA 3MEHA 3GTOH 1SNCA 2ZXOA 3RD4A 3PIP3 3S16H 1E2WA 3HOZH 3H0GB 1N33L 2FHTA 4JV5Q 1H95A 2GVBA 5KIXA 3HEJA 4KD4A 3J80i 2LSSA 3NQIA 4IOAA 3TSSA 1PVOA 3BG3A 4LW1A 3G71A 3QB3A 2Y0SG 1VQJA 1I4PA 2WAQG 4Q0FA 1WTPA 1H9JA 2AWNA 1LTSD 4MZ9A 2BE5D 2IY5B 4LF4Q 2L11A 4QUFA 1NE3A 5JPNC 2DY7A 2JA7B 3T51B 1VQBA 4A3BH 4POFA 1YITA 4BY1G 1I94L 3NBIA 4YWLA 1NSNS 3OW2A 2CCZA 1SMXA 4DR4Q 2JP1A 1YHQA 5M3MH 5C3XA 4XQQA 4QMGA 1FJGL 4IZ8A 1ESFA 1PV4A 1STNA 4LAAA 3RUZA 4CKEA 1PDQA 3TN2A 4OO1H 4A4IA 1MIUA 1N34L 2EVBA 2RDGA 1A3UA 2I46A 2H4OA 5KGUA 2EY5A 4JYAQ 1HUMA 2M00A 4A3MH 4AYBG 4R4TA 3K7AH 2V4DA 4DAMA 3S15H 2QF7A 5BN4A 1W3SA 2Q2HA 1Q8IA 3SEBA 1E1OA 3R8BA 4UP9A 3J81j 1GHKA 1BUVT 4KTAA 3KDFA 4LF8L 3NELA 1FNWA 2JA5G 1B50A 3PUWA 2E74C 2FXQA 1PRTC 4IFDJ 2Y0SE 2DNCA 3NXWA 2NZ1D 1S5FD 4DV1Q 1PMRA 4CJ1B 3UE1A 3T1YL 1CHPD 1AP0A 1K3BC 4A3CG 4JI6Q 4DR7Q 1C7YA 1UE1A 2HQLA 1KHIA 1EY5A 3J7YW 3J81E 1XNQQ 1VQ9A 4H7BA 1WTQA 1P16A 1BBXC 3KF6A 1LTID 3A55A 1FYCA 4JI7Q 4LWCA 1C8CA 3NQTA 5K36H 1HJPA 5IYDG 3OWFA 4A3JB 2F3IA 4TKOB 4JG2A 1KC8C 1DXMA 3TDQA 1TIID 1SYGA 1Z9FA 4DR5Q 2B2WC 2ZJPA 2A1AA 2K5HA 3HOXH 2VXWA 2IW3A 5FLXE 1I50H 3I4MB 4HEDA 3S1NB 3TMEA 3NTHA 1STGA 2B2YC 2TMPA 1XMQL 4X66L 2NVYB 1K0RA 1SRUA 1XNRQ 1IKMA 1ZYRC 3I72A 1SYBA 1SSOA 2A6HD 3CRLC 4CDEC 2YYZA 1SNDA 2XRSD 4MHEA 4L63B 1UEAB 3GO5A 1CKMA 2NTSA 4R4CA 2G9DA 3ZYYX 1NAPA 3HOUB 3GD7A 1HR0L 1SXTA 5LMNL 2ZXRA 3S1MB 1YVCA 1BCPB 1ILQA 5T1GA 3RLNA 2NB0A 1G2SA 3S14B 1QZGA 3IAYA 4RCOA 4I7AA 2EZVA 2UXBQ 1HUNA 1WTWA 4O42A 2IL8A 4UP7A 2JK8A 1EY0A 1VQFA 2UU9L 4DR3L 3J81c 3MZ5A 2B8FA 1MHWC 4H13C 4XYOA 4N9PA 5HURA 1W2BA 1XJVA 1YIJA 4JVZA 1EYGA 1OTCA 3R3OA 3WWVA 3HOYG 2WACA 1UE7A 4B3MQ 2HIVA 4YCUA 2L4NA 2VB3X 3CAMA 4LUOA 4DV5Q 4A76A 2OWOA 4FF3A 5FJ8H 1RHPA 1TR5A 2F0FA 4X65Q 1E7ZA 4QCLA 2LXKA 3SR1A 1XMOL 3HOVB 2EY2A 1B4OA 2B2WA 4UPAA 3HOWH 4DK1A 1V9PA 2FFKB 3FKIH 3TP7A 3EA6A 3H3VI 2CW0D 4Z9CB 2K52A 2CHBD 1YNND 3CCLA 2B3GA 2ZT9C 5CGKA 2F0TA 2HCIA 2F0NA 4DV4L 1S5DD 3HOZG 4XXEA 2IX1A 1WTHA 5ELNA 2HD3A 4BXXH 1IL2A 1NCVA 1B8AA 4WORA 1MSGA 3IL8A 4AQYQ 5JJLA 3N52A 4KMUC 4BBRH 1TWGH 4DR1Q 2VL6A 2QKIC 3SE0A 2UUCQ 4RKLA 3F2DA 3HG9A 1LABA 1HRJA 4MTNA 3NWTA 1C4QA 2Q2IA 4DXGA 3QJYA 4ZYSA 3NE5B 1V43A 3CC7A 5M3FG 2OQKA 1B70B 5KNBA 2O2LD 1L0YB 1Q1BA 4OELB 3C2PA 3T53B 3G7LA 1QUQA 4X6AH 2IPKD 3CD6A 2EYLA 5JPMC 4XIGS 1MSHA 4RGNA 1PH7A 3AB9A 3CPFA 1HNXL 2F4VL 4A3BG 3VDYA 4LFCL 1YHAA 1S5ED 2VUMB 1RD9D 1Q81C 2C35B 2Z6KA 5FOBB 4S3SA 4CDDC 3GTQB 3C46A 1KABA 2F3WA 4HMIA 2Q2UA 3BYYB 5L37A 1GUOA 3E9IA 3T1HQ 3BZDB 1TWAH 3STBC 4OO1G 2F0UA 3I4NH 1B1ZA 3PIPA 1GUGA 2F03A 4IUNA 5F2DA 3VA7A 1IBMQ 5EBDA 1V1PA 4B08A 2C5CA 3MXPA 3RR5A 4FVMA 4A3MG 4YCWA 2KVMA 3K0YA 5C5LA 4HSVA 2M9VA 2K5VA 4IFDG 1JC7A 3BZCA 2OT2A 3KJOA 4A3JH 1JB7A 3S17B 4R8IA 1U4MA 1U0LA 1WTOA 1VQAA 4P71A 5IP9H 4GLXA 2ID0A 3PO2B 4IURA 1L1OB 5JEAJ 1CQFA 3D4DA 1CUKA 2KCCA 1EOTA 4IALA 1DOKA 4HSPA 2PQAA 2AKWB 1DD2A 5A2QL 4HIKA 1S3OA 3RN5A 3FP9A 1N34Q 4CKBA 2NVYH 4C3IB 2A19A 3RLFA 4DAPA 3AFQA 3QOJA 4K0KQ 3S2DB 4LF7Q 4LF5Q 1KNAA 3GTMB 1PH2A 1PTOH 1EFWA 4IOCA 1I6VC 5FLMH 4C3HB 4FNFA 1PH4A 3MA2B 3A7AB 4GNXB 3JAMi 4B3SQ 2EJGC 4RGTA 1M1KC 1CA5A 2K03A 4DR4L 1SAPA 1Z47A 2VNUD 1A62A 2PW7A 3HOXG 3QIAA 4QF4A 3SK4A 1PRTF 1IYUA 3ND8A 1O7ZA 3T1YQ 3OOCA 1TT2A 5IGDA 1EIGA 4JYAL 4NXMQ 3PUXA 2SNMA 5C4ZA 1GM5A 5IGCA 1W6KA 3EROA 1BOSA 2F0LA 5ELCA 1EY6A 2XGTA 2SEBD 4BY1H 2QW7A 1QNUA 4CDCC 1UEBA 3TS0A 2LS01 1WFQA 2CQAA 4O1NA 3DWQA 3IRBA 2CWPA 2H1EA 1EOVA 2UXDQ 1O7IA 1L0XB 1XXGA 4DV1L 1C0AA 4JOIA 1Y1VH 1H9RA 1SYDA 2A69D 1K8OA 4RFBA 2WFWA 1XX8A 4JI6L 1A3VA 2F0QA 3HOVH 4DR7L 3NPPA 4DUYQ 1BVSA 1QNKA 5E4WC 5E7NA 3R2IA 1XMQQ 5ELEA 2JE6I 3PCOB 1XNQL 5CMDA 3D4RA 1JQYD 4DU9A 5FK9C 4PG3A 4JI7L 2EYMA 2B8GA 1VQLA 3A54A 1S5BD 2EYPA 1NMGA 1RF2D 2F1MA 2KCNA 4DR5L 1QOHA 3H0GG 4UAIA 1G6PA 3VR3A 2SOBA 3T56B 3AMUA 2K5QA 1HPCA 5LMNQ 5FJ8G 2K04A 2UXCL 3CQZB 1KRTA 1LT6D 3KF8B 3TP6A 4XT3B 2A74C 4EX5A 3KLRA 4OL7A 1XNRL 2JA6B 2WB1B 4DXFA 3KJPA 2N49A 3GTLB 3ER0A 4DR3Q 1U9RA 5ELDA 2ASBA 4FF2A 4A3IH 2LFNA 1MJCA 1HCZA 3PUYA 3Q0AA 1SYCA 2XWBB 2YTXA 5DM73 5I9PA 5T1IA 3NTKA 3M7NA 1HFNA 5CYUA 1LM0A 2VUMH 2L5TA 1O7LA 5I9OA 2B29A 4LNQA 4BBRG 2UXBL 1PZKD 2MPMA 4MTKA 1ENCA 2N78A 2R7ZH 5IGGA 3S9WA 2HHHQ 3HGBA 1F2YA 4Y52H 2J7ZA 2EJMA 4ILWA 1I3QH 1RTOA 3UI2A 3SHLA 1DOMA 4EGVA 1VF5C 4B3ML 1DGSA 4DV4Q 1PFNA 4DA2A 4DV5L 3WDNA 4OEMB 1VQMA 3KUPA 2RSOA 3J81L 4JI4Q 2MHVA 1B3QA 4X65L 1LT4D 5C0XI 2RCFA 3A7LA 1OXVA 1ICWA 1SN8A 4HN7A 3I4LA 2E2HH 5ISRA 4IPDA 3CCEA 3DM1A 1XYIA 1SLJA 1M90C 4PV1C 3I4NG 4DV6Q 3F8TA 4B3RQ 4EQPA 3S2DH 3WOEA 1QZHA 1HXYD 3I73A 4IN3A 3DWPA 3P7JA 1T5XD 2XRQD 5C44B 1TWHB 2OQ0A 2F0WA 3GTPH 5JEAG 4L5RC 2RHQB 1DJRD 2PNHA 4A3JG 3TEHB 4AQYL 4DR1L 1TY0A 2ZM6Q 4GKKQ 1D1KA 1AEXA 1B7YB 1II3A 2VQFL 5C4JB 2EOTA 1NTGA 4AIMA 1L2FA 2DJGC 1SE2A 3OPOA 2VB2X 3HZXA 3MHBA 5EPLA 4GS3A 4I7ZC 4DPGA 1KXLA 1PTOC 4HJ9A 1S4ZA 3H94A 3KOJA 2K1BA 4HIOA 3BU2A 5FLMG 3QOLA 2IWHA 4EQNA 2QA4A 2G9HD 2K05A 2N55A 4DNIA 1MGSA 2B63B 4DR6Q 2JEBI 5GROA 4DF7A 2CFMA 3KLSA 3PQIA 3BZKA 5FO7B 2ALYB 4ZUIA 3JAMc 1VQ6A 4YCVA 1Q90A 2K33A 3T1HL 2KA7A 3O13A 5EPKA 5JVH3 2N88A 2A68D 3OMCA 4KD3A 3K5OA 4C2MB 4F88A 2VY3A 3VYUA 5M3FH 3LX0A 1HHVA 1IBML 4ZCKA 2EE1A 4CDFC 3I91A 3RZDB 1D1IA 1K8MA 3W1GA 3OIPA 3A8JE 2VZAA 2SNSA 1EWIA 4IPGA 2R3ZA 2J4XA 1LTBD 1BBUA 4C1NK 3M7GA 1RKNA 3S2HH 3I90A 2KENA 2B2VC 1QB5D 1Q82C 1DCZA 3OHXC 5GQOA 5IP7H 2IT1A 2EYOA 3RZOH 3PUVA 1PYBA 3G48A 4GN5A 1Y1VG 4JK1C 4HIDA 3MTSA 2VQEL 3CQZH 5JJZA 4DV2Q 2CQOA 1NR4A 3HOVG 3VR5A 5M5YH 4A3EH 1VF7A 4K0KL 4A3LH 4XTCS
chains in the Genus database with same CATH topology
1H9SA 4NDXA 1JOKA 1O78A 3MXGA 4HCEA 4IFDH 3X3MA 4K5VA 4CKCA 4NKLA 1EU4A 1PXUA 5DEHA 5IGBA 1JWUD 2R6GA 1FR3A 2Q8IB 1F9QA 3IFTA 4PNYA 3EQLC 4ABNA 3HS0C 1F2ZA 2B2TA 2E2JB 1U4LA 3FDTA 3NUCA 5K5PA 1I4XA 2Z1CA 3X3NA 1IW7D 3PO3B 1IKLA 3SXHA 1OXUA 2IX0A 3BVGA 2B2VA 2F3VA 4RHRA 1TS2A 5C4XB 1WTVA 4TSSA 2F0VA 2L55A 1X3PA 3E5SA 4KHZA 4DNRB 4C3JB 1IYVA 5M5WB 3HKZB 5G3LF 1A2UA 3URYA 4J6HA 5EKIA 4A3DB 1PZJD 5CR3A 1JB3A 4C56C 4BY7B 4WJWA 2KECA 2AQ3B 1QWYA 2F0IA 3L9AX 5JOBA 3TP5A 2JYOA 2HDLA 1GJXA 2HQEA 1XWEA 2EYJA 3SDZA 5I6WA 3GTJB 1PLFA 3J80E 2AUJD 5M5XB 1FD7D 1BF4A 2R93B 2ZXPA 4X3UA 2NVTB 1R4PB 1PFMA 4C3IG 5FKAC 1JWMD 3QG1A 4KY7A 3DMUA 5E3FA 1JWSD 1O80A 3C1EA 1J9OA 4FYDA 1DZ1A 2WKDA 3Q23A 1ZXTA 1A15A 1I6HB 1X32A 2FMMA 1TWFB 1EWCA 1B3AA 2NTTA 1W6JA 4ID6A 1CT1D 1Y8PB 3NSWA 3KBGA 4DAVA 1EU3A 1C48A 4DN4M 2X6GA 4KN7C 3M3YB 5I4DA 4XT1B 3P75A 1OXSC 5IODA 4JBWA 1TVXA 2EDGA 5DAUA 5C5MA 2JEAI 5I2XA 3VYRA 1DOLA 4L8JA 1QCBD 3VYSA 2LKVA 4RH6A 5D3DA 3C3LA 1MBYA 4AYBB 4V190 4KN4C 2L1BA 2F0GA 3Q22A 2RVLA 3C1FA 1B44D 3AU7A 3DHQA 4A93B 1ET9A 2CVRA 1BXTA 1HTPA 1SFOB 2PYKA 2AWOA 4ULLA 3GP7A 4Q5VA 1DYQA 3WOFA 2WKCA 4G4KA 2EXZA 3N6RA 2F0MA 5BN5A 1EEFD 1PTOF 4EVOA 5M9OA 2OXPA 1ILPA 1G2TA 4DGZA 1RJTA 1EZ6A 1STYA 2PZWA 1PYWD 1HA5A 1CZWA 1JOQA 3FVQA 3R93A 5C0XH 3BVZA 5IGEA 2PPBC 5IIFA 1GOZA 1MD2D 2C9OA 4PMBA 1B9MA 1SMYC 5C0XJ 4G57A 1U4RA 1RDPD 4OIJA 2A6HC 4OO1I 4OGQC 4RKBA 5JEAH 3J7AV 2K01A 1WTXA 2L12A 3GTGB 2BDOA 2XNAC 1HQRD 3D4WA 3K58A 5C3EB 4QIWB 1EFID 5EKLA 2Z8LA 4BS9A 1QJOA 5EJWA 3HP3A 1TWCB 3IKJA 4I65A 5CV9A 1SE3A 4LK1C 1UAPA 1K83B 3JAML 4IQZA 2L0CA 1TS4A 4P2CB 1S5CD 3DXJC 1T5EA 3BS1A 5KYLA 3T13A 3R2TA 2NUCA 2X6LA 2O5JC 5CV5A 4A3KB 3HOYB 4KKSA 1SJED 4F87A 1AZQA 3FPPA 4CHTB 1EYAA 2Z4IA 2OF1A 2R92B 3J7AF 3KF8A 1BR9A 1V1PB 1HQMC 4LJZC 4GZYC 2EYFA 1TQOA 4KI0A 1NUCA 1JORA 2F0SA 1I4QA 1KLUD 2K5DA 3GTOB 4H0LC 1BO0A 1ET6A 3NHHA 5C3WA 2F0KA 3EFXD 3K59A 3VYTA 1TKWB 1XTCD 1VDZA 3L7ZC 5I6YA 1B53A 3PUZA 1M8AA 2FMCA 4KV6A 1PTOD 4RGMA 3V96A 1D6EC 2QCPX 2R61A 4IUVA 3K5NA 4KK7A 3K5MA 5M3MB 5J22A 2AUKA 3PIO3 2NN6I 2LMCB 1F9SA 3RMHA 2FJ2A 1KLGD 4PMCA 3U9SA 4FXKC 3F2UA 2XN9C 1ML0D 2M2LA 5IT9L 4A3MB 3MXUA 1E2VA 3K5LA 1LTGD 1Q3LA 4C1NI 5NUCA 2MGSA 1CZGA 1LTRD 1HTLD 2I07B 3SK6A 2D2CC 2K7VA 2PMZB 4PQXA 1VMPA 4G7ZC 1CTMA 2ICIA 4A3FB 4K2KA 3TBIB 3Q6SA 1Z6HA 3W3AA 2BA0A 5ELFA 2NVXB 2WP8J 1I4RA 3JAME 2MP1A 1AW7A 1CHQD 4QB4A 4FXGC 5C0XG 3EVQA 3LWEA 3ND9A 4B9XA 1PRTD 2JSOA 3ITPA 4ZAIA 1EL0A 3D3RA 2F0DA 1UNSA 1B9NA 1G291 4RWSC 5KYIA 2BCOA 3CHBD 1F2MA 4J8QA 4R9WA 2F0OA 1V1OA 1YNJC 3NK9A 1QG7A 2A69C 1PZID 4BBSB 3MC0B 4MN3A 5KNCA 1EIHA 1AN8A 2E2DC 4WFN3 3NP8A 3H6MA 3TZDA 4ZK9B 1CFMA 3VR4A 3J80L 5JVG3 1I4HA 5LL6X 4FXDA 2PCFB 1B2TA 2PNRC 1AFPA 1ZYRD 1NR2A 3SK5A 4MIUA 5D65A 1BCPC 2B2TC 4IUUA 2MUYA 1TY2A 4IUQA 5EQ0A 2EPBA 2B2UC 1UUPA 1WVLA 3GV3A 1SEBD 1LLRD 4EQOA 3HOWB 1LT3D 5C6AA 3NBHA 2A6EC 2Z4HA 3FKIB 4KKTA 5JAVA 3DUZA 4F7XA 2KHSA 1EYCA 3ONAB 1FNUA 1H9MA 2XIWA 1TS5A 4KKUA 4K5WA 4BWGB 2RDFA 2DY8A 4NMZA 3T16A 4ME5A 1O7YA 1G6ZA 1Y8OB 4RA8A 4CGYB 4BBRB 5IT9E 1TWGB 3SVMA 4RGOS 5FO9B 3CRKC 1WCMB 2X69A 5LL6S 4A3GB 3OMGA 3IFDA 2KJXA 3TP8A 2JA8B 1CM9A 5KNDA 1SJHD 5TSSA 3BYTB 1MI2A 4XYQA 3D31A 5CC4A 3M85A 1G8ZD 1STHA 4K8JA 2B39A 4RHSA 4RCNA 3A8KE 5EBCA 4ZQ3A 2A73B 5CV6A 5LHY1 2WV6D 3W2DA 2B2UA 5EGTA 5ELBA 1RTNA 5KRUA 3L3OC 1E2ZA 4FF4A 2WIIB 1TWAB 3MAQA 3I4NB 3I8ZA 2O5IC 5CV7A 4XQJA 3FPUB 1GUTA 3OSOA 4K5XA 1Y1WB 1RCVD 5CV8A 3BDLA 4CBVA 1ONLA 1KDBA 5J39A 1SYEA 4H44C 4DFAA 4XQNA 2EY1A 2TSSA 2JXMB 1H9SB 2KUMA 3LNNA 5I2YA 3OWEB 1GUWA 3H91A 1EZ8A 3D6CA 1Z7TA 3M4YA 1STBA 4BA1I 2Q8TA 3PMFA 2E76C 4Y7NB 1F9PA 1SMYD 5CBAE 1JE4A 4J1MA 4ODGA 2HUGA 3GQBA 1PTOB 2IJ0A 1OXTA 4HCSA 3P1HA 3EJIA 2XWJB 1EQVA 2FINB 2HDMA 2DNEA 3QO2A 2A68C 5COYA 3A56A 2BE5C 1SYFA 2D62A 5EPJA 2XVSA 2RDHA 2Y0SB 4L6TB 2WAQB 2K5WA 4KJNA 2O4XA 2HCCA 4C3HG 1WTRA 1GXDC 1QILA 2BA1A 3TZUA 3DEPA 2F0EA 4X3KA 5CBEE 5CORA 4BY1B 2NWGA 1KNEA 2RSNA 5EKKA 1ENAA 1GHJA 1FGBD 1X3QA 4N9TA 4F8MA 1Y1VB 4YIJA 3CU7A 3H3VC 2AQ2B 5AFWA 3V05A 1VCIA 2NN6H 3MVVA 1F2LA 2EJFC 5E4XA 2B2YA 2QDBA 4NW2A 2GA4B 2QILA 3BDCA 3P20A 1JCKB 2JA5B 1PRTB 5C4HA 4FP5D 1ENFA 4M8AA 1GUNA 3DWAA 4OHJA 1HFGA 4NP5A 1IW7C 4WRDA 3K57A 3MWYW 2QEJC 1EY4A 2A5HA 4A3IB 4K6LA 3M4OB 1RODA 1SNOA 1Q12A 4HMJA 3FRPB 4DAYA 2RA4A 1SBBB 1IHZA 2J0TD 2KOLA 1BCPF 1CK1A 4ZKBB 1V8QA 1Y69U 1WD1A 1Q1EA 2F0PA 1JR0D 1SNPA 4PMWA 2D9UA 5D3IB 2R7ZB 1A6XA 2SDFA 3S1RB 5BN3A 1G91A 4QUCA 4ZKCB 2AQ1B 4E6IA 1BNZA 1JOOA 5G3LD 1I3QB 1KDAA 4IFDI 4RAUC 2ENBA 2K6AA 2DN8A 3I3CA 3H09A 2BDNA 2PZTA 3PV0A 3OW7A 1D5ZC 1LACA 3FEWX 5CV4A 2RBMA 2Q8RE 1TS3A 2E2HB 1OXXK 3D8GA 5J1ZA 1OO9B 1CA6A 4IUPA 1ZEQX 2RQXA 3MXNA 1EEID 1LTTD 3T4AC 3GTPB 3NTIA 2KQ3A 5K36G 3BVMA 4K14A 2CW0C 3DEOA 2PO4A 3SK8A 2NVQB 1YNNC 4KJOA 1Y8NB 2MJ8A 4ZUJA 1QE6A 1EY8A 1CI3M 1F9RA 1SNQA 4V0BA 2NYZD 4IUTA 1J8IA 2KEEA 3CKIB 1A3TA 1HA6A 3S16B 1WD0A 3HOZB 2OEOA 4R8NA 1LTAD 3GV6A 1ZKOA 5IOCA 1LT5D 1VMCA 2KEDA 4M1UB 3G6JB 2F0HA 2LY7A 1YNJD 1KTKA 1STEA 1I4GA 3V2TA 3FMCA 1EY7A 5HGTA 1EWHA 5M3FB 1SE4A 1BDOA 4FF1A 1R4QB 4X3TA 2K28A 3E6ZX 1EYDA 4G7HC 1PFBA 1BQQT 4A3BB 3S2HB 4OIKA 3LWUA 1M4VA 1LV9A 3RZOB 3BDOA 3KBXA 1EY9A 1BCPD 3VR6A 1KAAA 2E75C 3KLSX 4K2LA 5M5YB 4TRDA 4A3EB 2NN6G 5KEEA 2E2IB 4XDXA 4B9WA 1CQVA 1E0BA 5E1FA 3K7AB 1LO5D 3S15B 5A35A 4HAEA 2A6ED 1KDCA 1D2BA 2XSCA 1D5XC 1A2TA 2F0JA 2ICEC 4DNTB 5IGFA 2BOSA 3HRZC 3OIQA 3ERQA 4LMQD 4K8IA 4UDUC 1FNVA 2PQEA 4U673 2RKSA 3K6OA 1SNMA 1TU2B 2EY6A 3S1QB 2L9HA 3A8IE 4CJ0B 3NWSA 4CJ2C 3D6WA 4KHVA 5DNFA 1DONA 5FO8B 5A2QE 4G7OC 3HOXB 1IL8A 1I50B 4BA2I 5D14A 3QWNA 2NBFA 3KK7A 4HR7B 1H9KA 1ESRA 3I70A 2YU9B 1R9TB 2D5DA 1DM0B 2PZUA 4ZLTF 3U9OA 3GTKB 4X3SA 2K32A 4U68A 4KY6A 5FLXL 1STAA 1SDFA 2EYHA 3MFGA 1EQTA 1U4PA 2F4IA 3VR2A 3VA5A 2IX3A 4HTHA 1JICA 4FO2A 2PW5A 1AZPA 4DK0A 3E0JA 4C3JG 4TQUS 5DM63 1F77A 4KY5A 3MFYA 1D5MC 1GUSA 2WINB 4K6DA 4ZRZA 3Q24A 3MEHA 1SNCA 2ZXOA 3RD4A 3PIP3 1E2WA 3H0GB 2FHTA 5KIXA 3HEJA 4KD4A 3NQIA 3TSSA 3BG3A 3QB3A 1I4PA 4Q0FA 1WTPA 1H9JA 2AWNA 1LTSD 2BE5D 2L11A 4QUFA 5JPNC 2DY7A 2JA7B 3T51B 3NBIA 1NSNS 2JP1A 5C3XA 4XQQA 4QMGA 4IZ8A 1ESFA 1STNA 4LAAA 3RUZA 4CKEA 1PDQA 3TN2A 4OO1H 2EVBA 2RDGA 1A3UA 2I46A 2H4OA 5KGUA 2EY5A 1HUMA 2M00A 2V4DA 2QF7A 5BN4A 1Q8IA 3SEBA 3R8BA 1GHKA 1BUVT 4KTAA 1FNWA 1B50A 3PUWA 2E74C 1PRTC 4IFDJ 2DNCA 3NXWA 2NZ1D 1S5FD 1PMRA 4CJ1B 1CHPD 1AP0A 1EY5A 3J7YW 3J81E 4H7BA 1WTQA 1BBXC 1LTID 3A55A 1FYCA 1C8CA 3NQTA 5K36H 3OWFA 4A3JB 4TKOB 1DXMA 3TDQA 1TIID 1SYGA 2B2WC 2VXWA 2IW3A 5FLXE 3I4MB 4HEDA 3S1NB 3TMEA 3NTHA 1STGA 2B2YC 2TMPA 2NVYB 1IKMA 1ZYRC 3I72A 1SYBA 1SSOA 2A6HD 3CRLC 2YYZA 1SNDA 2XRSD 4MHEA 4L63B 1UEAB 3GO5A 2NTSA 2G9DA 3ZYYX 1NAPA 3HOUB 3GD7A 1SXTA 2ZXRA 3S1MB 5T1GA 1BCPB 1ILQA 2NB0A 1G2SA 3S14B 3IAYA 4RCOA 2EZVA 1HUNA 1WTWA 4O42A 2IL8A 1EY0A 3MZ5A 2B8FA 4H13C 4XYOA 4N9PA 5HURA 3R3OA 2WACA 2L4NA 2VB3X 4FF3A 1RHPA 1TR5A 2F0FA 4QCLA 3SR1A 3HOVB 2EY2A 1B4OA 2B2WA 4DK1A 2FFKB 3TP7A 3EA6A 2CW0D 4Z9CB 2CHBD 1YNND 2ZT9C 5CGKA 2F0TA 2HCIA 2F0NA 1S5DD 4XXEA 2IX1A 1NCVA 4WORA 1MSGA 3IL8A 3N52A 4KMUC 2QKIC 3SE0A 4RKLA 3HG9A 1LABA 1HRJA 3NWTA 1C4QA 4DXGA 3QJYA 4ZYSA 3NE5B 1V43A 5KNBA 2O2LD 1L0YB 1Q1BA 3C2PA 3T53B 3G7LA 2IPKD 2EYLA 5JPMC 4XIGS 1MSHA 4RGNA 3AB9A 1S5ED 2VUMB 1RD9D 5FOBB 4S3SA 3GTQB 3C46A 1KABA 2F3WA 4HMIA 3BYYB 4OO1G 1GUOA 3BZDB 2F0UA 1B1ZA 1GUGA 2F03A 4IUNA 5F2DA 3VA7A 5EBDA 1V1PA 4B08A 2C5CA 3MXPA 4FVMA 2KVMA 3K0YA 5C5LA 4HSVA 2M9VA 4IFDG 1JC7A 2OT2A 3S17B 4R8IA 1U4MA 1WTOA 2ID0A 3PO2B 4IURA 5JEAJ 1CQFA 3D4DA 2KCCA 1EOTA 4IALA 1DOKA 4HSPA 1DD2A 5A2QL 4CKBA 4C3IB 3RLFA 4DAPA 3QOJA 3S2DB 3GTMB 1KNAA 1PTOH 1I6VC 4C3HB 4FNFA 3MA2B 3A7AB 2EJGC 4RGTA 1CA5A 2K03A 1SAPA 1Z47A 2VNUD 2PW7A 3QIAA 4QF4A 3SK4A 1PRTF 1IYUA 3ND8A 1O7ZA 3OOCA 1TT2A 5IGDA 1EIGA 3PUXA 2SNMA 5C4ZA 5IGCA 1W6KA 3EROA 1BOSA 2F0LA 5ELCA 1EY6A 2SEBD 1QNUA 2LS01 2CQAA 4O1NA 3DWQA 2H1EA 1L0XB 1XXGA 1H9RA 1SYDA 2A69D 1K8OA 4RFBA 1XX8A 1A3VA 2F0QA 3NPPA 1QNKA 5E4WC 3R2IA 5ELEA 2JE6I 5CMDA 3D4RA 1JQYD 4DU9A 5FK9C 2EYMA 2B8GA 3A54A 1S5BD 2EYPA 1RF2D 2F1MA 2KCNA 1QOHA 4UAIA 3VR3A 2SOBA 3T56B 3AMUA 2K5QA 1HPCA 2K04A 3CQZB 1LT6D 3TP6A 4XT3B 2A74C 3KLRA 4OL7A 2JA6B 2WB1B 4DXFA 3GTLB 1U9RA 5ELDA 4FF2A 2LFNA 1HCZA 3PUYA 3Q0AA 1SYCA 2XWBB 5DM73 5I9PA 5T1IA 3NTKA 3M7NA 1HFNA 5CYUA 2L5TA 1O7LA 5I9OA 1PZKD 2MPMA 1ENCA 5IGGA 3S9WA 3HGBA 1F2YA 2J7ZA 2EJMA 4ILWA 1RTOA 3UI2A 3SHLA 1DOMA 4EGVA 1VF5C 1PFNA 4DA2A 3WDNA 3KUPA 2RSOA 3J81L 2MHVA 1LT4D 5C0XI 3A7LA 1ICWA 1OXVA 4HN7A 3I4LA 5ISRA 3DM1A 1XYIA 4PV1C 4EQPA 3WOEA 1HXYD 3I73A 4IN3A 3DWPA 3P7JA 1T5XD 2XRQD 5C44B 1TWHB 2F0WA 5JEAG 1DJRD 1TY0A 1D1KA 1AEXA 1II3A 5C4JB 2EOTA 1SE2A 3OPOA 2VB2X 3HZXA 3MHBA 5EPLA 4I7ZC 1PTOC 1S4ZA 3H94A 2K1BA 3QOLA 2IWHA 4EQNA 2G9HD 2K05A 2N55A 1MGSA 2B63B 2JEBI 4DF7A 3KLSA 5FO7B 4ZUIA 1Q90A 2K33A 2KA7A 3O13A 5EPKA 5JVH3 2N88A 2A68D 3OMCA 4KD3A 3K5OA 4C2MB 4F88A 3VYUA 1HHVA 3LX0A 2EE1A 3I91A 3RZDB 1D1IA 1K8MA 3OIPA 3A8JE 2SNSA 2R3ZA 2J4XA 1LTBD 4C1NK 3M7GA 1RKNA 3I90A 2B2VC 1QB5D 1DCZA 3OHXC 2IT1A 2EYOA 3PUVA 4JK1C 3MTSA 5JJZA 1NR4A 3VR5A 1VF7A 4XTCS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTO A;  1AP0 A;  3R93 A;  4UAI A;  2KUM A;  3P7J A;  1BF4 A;  1B4O A;  2B2W A;  4IUR A;  1BO0 A;  4X3U A;  4HAE A;  1GUW A;  1PFM A;  1EOT A;  1HFG A;  3H91 A;  2FFK B;  3DEO A;  1DOK A;  2MP1 A;  3ONA B;  2K04 A;  2Q8T A;  1WTQ A;  2FHT A;  1BBX C;  2MJ8 A;  1U4R A;  2XIW A;  1F9P A;  1QE6 A;  4OIJ A;  5CBA E;  1O80 A;  1JE4 A;  1C8C A;  3MWY W;  1F9R A;  1J9O A;  2HUG A;  3LWE A;  2EOT A;  4XT3 B;  2DY8 A;  2K01 A;  4HCS A;  1WTX A;  2L12 A;  2HCI A;  1DZ1 A;  2NYZ D;  1KNA A;  4IUT A;  4LMQ D;  1ZXT A;  1J8I A;  2B2W C;  1O7Y A;  2KEE A;  1A15 A;  1F9Q A;  1G6Z A;  2FIN B;  4ZAI A;  4RA8 A;  2VXW A;  1ROD A;  1NCV A;  2HDM A;  1X32 A;  1B53 A;  2FMM A;  1EL0 A;  3QO2 A;  1HA6 A;  4HED A;  2RA4 A;  3SVM A;  1WD0 A;  1B3A A;  1MSG A;  5COY A;  5EPL A;  3IL8 A;  4R8I A;  2KOL A;  1CA5 A;  2X69 A;  3N52 A;  1M8A A;  2B2T A;  2K03 A;  4ZKB B;  3GV6 A;  4RWS C;  1WTP A;  5T1I A;  2B2Y C;  1U4L A;  3IFD A;  1SAP A;  2L9H A;  3FDT A;  1S4Z A;  1WD1 A;  5EPJ A;  4DN4 M;  4R9W A;  1VMC A;  5EJW A;  2K1B A;  2KED A;  4CJ0 B;  2X6G A;  3HP3 A;  4CJ2 C;  2D9U A;  2L11 A;  4QUF A;  1HFN A;  4XT1 B;  3D6W A;  5DNF A;  1CM9 A;  1IKM A;  1DON A;  1O7Z A;  1TVX A;  1SSO A;  2DY7 A;  2HCC A;  2K05 A;  1MGS A;  2N55 A;  1QG7 A;  2SDF A;  1HRJ A;  1IL8 A;  1WTR A;  2MPM A;  1G91 A;  4IUV A;  4MHE A;  1DOL A;  4QUC A;  1MI2 A;  4ZKC B;  4MN3 A;  1BNZ A;  1EIG A;  1IKL A;  5D14 A;  1EIH A;  3G7L A;  3DEP A;  4X3K A;  5CBE E;  1ESR A;  5COR A;  1NAP A;  2NWG A;  1F9S A;  1KNE A;  1MSH A;  2B2V A;  2FJ2 A;  2JP1 A;  2J7Z A;  4RAU C;  2RSN A;  2N88 A;  5EPK A;  4X3T A;  3TZD A;  4ZK9 B;  4ZLT F;  2X6L A;  1RTO A;  2K28 A;  1HHV A;  5T1G A;  1PDQ A;  1ILQ A;  3TN2 A;  3UI2 A;  2EE1 A;  2L1B A;  3F2U A;  1PFB A;  1DOM A;  4X3S A;  1X3Q A;  2B2U A;  4U68 A;  1WTV A;  1G2S A;  3I3C A;  3I91 A;  2BDN A;  2H1E A;  1ML0 D;  2M2L A;  2RVL A;  1B2T A;  1RTN A;  1PFN A;  1HUN A;  1AZQ A;  1WTW A;  2CVR A;  2R3Z A;  4O42 A;  1X3P A;  1HUM A;  1SDF A;  2IL8 A;  3KUP A;  4OIK A;  5AFW A;  1NR2 A;  2RSO A;  3I8Z A;  3I90 A;  1Q3L A;  4CJ1 B;  1EQT A;  1U4P A;  1LV9 A;  2B2V C;  3FPU B;  2MGS A;  2Q8R E;  1XX8 A;  1F2L A;  3KBX A;  5D65 A;  1ICW A;  2B2T C;  1QNK A;  4IUU A;  5E4W C;  5EKI A;  5E4X A;  4IUQ A;  1JIC A;  5EQ0 A;  2EPB A;  2KEC A;  1CA6 A;  2B2U C;  1AZP A;  5CMD A;  1VMP A;  2KVM A;  2B2Y A;  1B50 A;  3MTS A;  3DM1 A;  5JJZ A;  2JYO A;  4HSV A;  4IUP A;  2HDL A;  1XYI A;  2L4N A;  4NW2 A;  1NR4 A;  1WVL A;  1ILP A;  1G2T A;  2NZ1 D;  1RJT A;  3GV3 A;  4XDX A;  1RHP A;  3Q6S A;  1E0B A;  1PLF A;  1U4M A; 
#chains in the Genus database with same CATH topology
 1WYD A;  1H9S A;  4NDX A;  2E2I H;  4LF5 L;  4LF7 L;  3S24 A;  2RCN A;  2QGQ A;  2KCM A;  1JOK A;  1O78 A;  4KHP Q;  3MXG A;  4HCE A;  4IFD H;  3X3M A;  4DV7 Q;  1I5F A;  4K5V A;  4CKC A;  4NKL A;  4QY7 A;  4B3S L;  1EU4 A;  1PXU A;  1KRS A;  3ERS X;  5DEH A;  5IGB A;  1PHJ A;  1VQH A;  5GAH C;  3KYH C;  1AE2 A;  1JWU D;  2R6G A;  1NJI C;  1GKH A;  2CH4 W;  1FR3 A;  1QVF A;  1X6O A;  2Q8I B;  2GVA A;  1F9Q A;  1EIF A;  3DM3 A;  3IFT A;  4PZ6 A;  4PNY A;  3EQL C;  4ABN A;  4NXM L;  3HS0 C;  1F2Z A;  3NBH B;  2B2T A;  2AMC B;  4A75 A;  2E2J B;  1U4L A;  3FDT A;  3NUC A;  1VQ5 A;  5K5P A;  1I4X A;  2Z1C A;  3S1Q H;  3X3N A;  1IW7 D;  1PH1 A;  4A3I G;  3PO3 B;  1EUJ A;  4QGU A;  3U4Z A;  2K14 A;  2UXD L;  4LF9 Q;  1BKB A;  1IKL A;  3SXH A;  1OXU A;  2IX0 A;  3BVG A;  2ES2 A;  2B2V A;  2VUM G;  2F3V A;  2OCE A;  2UXC Q;  4DUY L;  2YU9 H;  1CKN B;  2JN4 A;  4RHR A;  1R9T H;  2R7Z G;  1TS2 A;  5C4X B;  3L2P A;  1WTV A;  2N3S A;  3GTK H;  4TSS A;  2F0V A;  2L55 A;  1X3P A;  3E5S A;  4KHZ A;  5IT9 c;  4DNR B;  4C3J B;  4DK3 C;  1IYV A;  5M5W B;  2D0O A;  3HKZ B;  5G3L F;  2CKZ B;  1A2U A;  3URY A;  5AJ3 Q;  4UHV A;  4J6H A;  1TWH H;  5EKI A;  3STB D;  4A3D B;  1PZJ D;  1D7Q A;  5CR3 A;  1JB3 A;  4C56 C;  4BY7 B;  2V1C C;  4WJW A;  2KEC A;  2AQ3 B;  3A5U A;  1QWY A;  2F0I A;  3L9A X;  5JOB A;  3TP5 A;  2JYO A;  3H15 A;  2HDL A;  1VQ7 A;  5GAG C;  1K8G A;  1GJX A;  2HQE A;  1XWE A;  3PO2 G;  1L1O C;  2EYJ A;  3SDZ A;  5I6W A;  1X3G A;  1YJW A;  3GTJ B;  1PLF A;  3J80 E;  2AUJ D;  5M5X B;  1FD7 D;  1BF4 A;  2R93 B;  2ZXP A;  1X3F A;  4X3U A;  2NVT B;  1R4P B;  1PFM A;  4C3I G;  2KBN A;  5FKA C;  1JWM D;  3QG1 A;  4KY7 A;  3L0O A;  3DMU A;  5E3F A;  1JWS D;  2Z6K C;  4JBJ A;  1O80 A;  3H0G H;  3KF6 B;  1EIY B;  3C1E A;  1J9O A;  4DR2 Q;  2UUA Q;  4FYD A;  2K5N A;  2IHE A;  1DZ1 A;  2WKD A;  3Q23 A;  1ZXT A;  3RN2 A;  2B63 H;  1A15 A;  2K4K A;  1LTL A;  1PA6 A;  1I6H B;  1X32 A;  2FMM A;  3HKS A;  1TWF B;  1EWC A;  1B3A A;  2UUB L;  2HHH L;  2NTT A;  1W6J A;  4ID6 A;  1CT1 D;  1VQD A;  1Y8P B;  3NSW A;  3KBG A;  5ELO A;  4DAV A;  1EU3 A;  1C48 A;  4C2M H;  2ZTD A;  4DN4 M;  2X6G A;  4KN7 C;  2AHO B;  3M3Y B;  5I4D A;  3I4O A;  4XT1 B;  3P75 A;  1OXS C;  1HNZ L;  5IOD A;  1WOC A;  1TVX A;  4JBW A;  2EDG A;  4R4O A;  5DAU A;  5C5M A;  2JEA I;  5I2X A;  3RZD H;  3VYR A;  1DOL A;  2JA7 H;  4L8J A;  1QCB D;  3VYS A;  2LKV A;  4RH6 A;  5D3D A;  1N32 Q;  2MO1 A;  4JI4 L;  3C3L A;  2ZJQ A;  1MBY A;  4AYB B;  4V19 0;  3A74 A;  4KN4 C;  3I7F A;  2N8N A;  1TXY A;  2L1B A;  2F0G A;  3Q22 A;  2VQF Q;  4EQ5 A;  1WJJ A;  2RVL A;  3C1F A;  3J80 c;  1B44 D;  3AU7 A;  3DHQ A;  3M9B A;  4A93 B;  1ET9 A;  1Q46 A;  2CVR A;  4DV6 L;  1CKO A;  1L1O A;  4B3R L;  1BXT A;  1HTP A;  1SFO B;  2PYK A;  2AWO A;  3UE0 A;  4JI2 Q;  4ULL A;  3GP7 A;  4Q5V A;  1JT8 A;  1DYQ A;  3WOF A;  2WKC A;  4G4K A;  2EXZ A;  3N6R A;  2F0M A;  1FGU A;  1EEF D;  1PTO F;  2XTI A;  5BN5 A;  4EVO A;  5M9O A;  3UDG A;  2OXP A;  1ILP A;  2ZM6 L;  1G2T A;  4GKK L;  1MKH A;  4DGZ A;  4YWK A;  1RJT A;  1EZ6 A;  1STY A;  2PZW A;  1YEZ A;  5IP7 G;  1PYW D;  2HT1 A;  1HA5 A;  1CZW A;  1JOQ A;  3FVQ A;  3R93 A;  5C0X H;  4JI1 Q;  3BVZ A;  3CC2 A;  5IGE A;  2PPB C;  5IIF A;  1GOZ A;  1MD2 D;  4X64 L;  2C9O A;  1SR3 A;  4PMB A;  4A3E G;  1YZ6 A;  1B9M A;  1SMY C;  1S72 A;  1N8R C;  4A3L G;  5C0X J;  1E24 A;  4G57 A;  1U4R A;  1RDP D;  4OIJ A;  2E2J H;  2A6H C;  4OO1 I;  2KCT A;  1VQ4 A;  4OGQ C;  4RKB A;  5JEA H;  3J7A V;  2K01 A;  4JOI C;  2L12 A;  1WTX A;  3GTG B;  2R7D A;  2BDO A;  2GN5 A;  1HZ9 A;  4DR6 L;  2XNA C;  1HQR D;  3U58 A;  3D4W A;  3K58 A;  1Y14 B;  2K75 A;  3I4M H;  5C3E B;  3CP0 A;  3S1N H;  4P72 A;  4QIW B;  1K0S A;  1IZ6 A;  1EFI D;  1PYS B;  3F2B A;  5EKL A;  2VQE Q;  2Z8L A;  4BS9 A;  1QJO A;  1L0W A;  5EJW A;  3HP3 A;  1TWC B;  3IKJ A;  4I65 A;  5CV9 A;  1SE3 A;  4LK1 C;  3UDF A;  3CMA A;  1P8L A;  1VQC A;  1UAP A;  3NEM A;  1K83 B;  3JAM L;  4IQZ A;  1HZA A;  2L0C A;  1HNW Q;  1TS4 A;  4P2C B;  4LFB Q;  1S5C D;  3UDX A;  3DXJ C;  5M5W H;  1T5E A;  3BS1 A;  5KYL A;  3T13 A;  4JI5 Q;  1QUQ B;  3RNU A;  3R2T A;  4DAY B;  5IYC G;  2NUC A;  2X6L A;  4A3D H;  3HOU H;  5IE8 A;  5CV5 A;  4BY7 H;  2O5J C;  1PFS A;  4A3K B;  3S1M H;  4DV2 L;  3HOY B;  1NMF A;  4KKS A;  1SJE D;  4F87 A;  3S14 H;  1AZQ A;  2WB1 E;  3GTJ H;  3HFZ B;  3A5Z B;  3FPP A;  4CHT B;  1EYA A;  2Z4I A;  5M5X H;  2OF1 A;  5EAY A;  5BR8 Q;  5JJI A;  2R93 H;  2A8V A;  2I5M X;  4KHP L;  5IWA Q;  2R92 B;  4DV7 L;  3J7A F;  3KF8 A;  1BR9 A;  4HJA A;  1AE3 A;  2BH8 A;  1V1P B;  1HQM C;  4LJZ C;  1PH3 A;  4GZY C;  2EYF A;  1TQO A;  4KI0 A;  1NUC A;  4IJL A;  2F0S A;  1JOR A;  1I4Q A;  4YY3 L;  1X9N A;  1KLU D;  2K5D A;  3GTO B;  1YBY A;  4NPS A;  2L15 A;  2H5X A;  4H0L C;  1BO0 A;  1I6H H;  1ET6 A;  1TWF H;  3NHH A;  4RG1 A;  5C3W A;  4LFA L;  1KD1 C;  2F0K A;  3EFX D;  4NXN L;  4IO9 A;  3K59 A;  1LYL A;  3NEN A;  1XTD A;  3VYT A;  1HH2 P;  1Q8K A;  2R7F A;  2JJQ A;  3M3Y H;  4OXP A;  1TKW B;  1XTC D;  1BBW A;  1VDZ A;  3MXN B;  3L7Z C;  5I6Y A;  4LF9 L;  1B53 A;  3PUZ A;  3OTO Q;  2ZTE A;  1IBL Q;  1M8A A;  2FMC A;  4KV6 A;  1VQN A;  1IBK L;  2B63 G;  1PTO D;  3CCS A;  1EQR A;  2MFI A;  4RGM A;  3V96 A;  1D6E C;  4JPB W;  2E5L L;  2QCP X;  3CCU A;  2R61 A;  4IUV A;  3K5N A;  3M4P A;  4A93 H;  4GKJ Q;  4KK7 A;  3K5M A;  5M3M B;  1K3R A;  2YTY A;  5J22 A;  2AUK A;  3PIO 3;  2I0Q A;  2NN6 I;  2LMC B;  2Z9H A;  1F9S A;  3RMH A;  1UE6 A;  2FJ2 A;  5AJ3 L;  1KQS A;  4GLV B;  1KLG D;  2F52 A;  4PMC A;  3U9S A;  2JA7 G;  4FXK C;  4IPC A;  3F2U A;  2XN9 C;  4IPH A;  2JA9 A;  3TRZ A;  1ML0 D;  2M2L A;  5IT9 L;  4A3M B;  4OX9 Q;  1XPR A;  1VQK A;  3MXU A;  2HIX A;  4LUV A;  1E2V A;  1J5E L;  3GTQ H;  3K5L A;  1LTG D;  1Q3L A;  4C1N I;  5NUC A;  2MGS A;  1GVP A;  2UUB Q;  4OWT B;  1K73 C;  1K9M C;  1NY4 A;  1ASZ A;  1CZG A;  1LTR D;  1HTL D;  2I07 B;  3SK6 A;  2D2C C;  2K7V A;  2PMZ B;  3CF5 A;  1UE5 A;  3KFU A;  2VW9 A;  4JBM A;  4PQX A;  1VMP A;  1VQP A;  4G7Z C;  1HNZ Q;  1CTM A;  2ICI A;  3DLL A;  4QQB X;  2ATW A;  4JI8 L;  4A3F B;  4K2K A;  3TBI B;  4DR2 L;  2UUA L;  3Q6S A;  1Z6H A;  4RMF A;  2MQH A;  4MNO A;  3W3A A;  4JW0 A;  3GTG H;  3S17 H;  2BA0 A;  3A0J A;  1GD7 A;  5ELF A;  2Z6B A;  2NVX B;  2WP8 J;  1I4R A;  3AEV A;  3PO2 H;  3U50 C;  3JAM E;  2MP1 A;  1K8A C;  1HR0 W;  2I5H A;  1AW7 A;  1CHQ D;  4QB4 A;  5C3E H;  4P74 A;  4FXG C;  3E0E A;  5C0X G;  3EVQ A;  3LWE A;  3ND9 A;  4B9X A;  1PRT D;  2JSO A;  3W5O A;  4C3I H;  2D0P A;  3UDI A;  3ITP A;  4ZAI A;  3GTM H;  1EL0 A;  3D3R A;  4B3T Q;  2F0D A;  3MEF A;  1UNS A;  1B9N A;  4L5S A;  1N32 L;  4C3H H;  3J81 i;  1G29 1;  4RWS C;  5KYI A;  5JJK A;  2BCO A;  3CHB D;  1F2M A;  4J8Q A;  4R9W A;  4P75 A;  2F0O A;  1V1O A;  1YNJ C;  3NK9 A;  4A3K H;  2PI2 E;  1QG7 A;  2A69 C;  3I4M G;  1PZI D;  4BBS B;  4JI3 Q;  3MC0 B;  4MN3 A;  5KNC A;  3CME A;  1EIH A;  2KHJ A;  1AN8 A;  2E2D C;  4WFN 3;  4ALP A;  3NP8 A;  4JI2 L;  4X64 Q;  1X55 A;  3H6M A;  3TZD A;  4ZK9 B;  3EN2 A;  4GOP B;  3H3V H;  1CFM A;  1FL0 A;  3CCQ A;  2R92 H;  3VR4 A;  3J80 L;  5JVG 3;  1I4H A;  5LL6 X;  4FXD A;  2PCF B;  1B2T A;  2PNR C;  1AFP A;  1ZYR D;  4A3D G;  3HOU G;  1NR2 A;  1XPU A;  4GN3 B;  4BY7 G;  3K0X A;  3SK5 A;  4MIU A;  5D65 A;  1BCP C;  4JI1 L;  2B2T C;  4IUU A;  4HJ5 A;  2MUY A;  1TY2 A;  4IUQ A;  1S40 A;  5EQ0 A;  2EPB A;  2B2U C;  1PH8 A;  5IY0 A;  1UUP A;  1WVL A;  1A8V A;  3PF4 A;  3GV3 A;  2R93 G;  1SEB D;  1LLR D;  4EQO A;  3HOW B;  1LT3 D;  4OWW B;  5C6A A;  1X54 A;  3NBH A;  2A6E C;  2Z4H A;  3FKI B;  4KKT A;  5JAV A;  3DUZ A;  4WJ3 M;  4F7X A;  2KHS A;  1EYC A;  3ONA B;  1C9O A;  1FNU A;  1H9M A;  2XIW A;  1TS5 A;  4KKU A;  4K5W A;  2E8G A;  4BWG B;  2RDF A;  3CC4 A;  2DY8 A;  4NMZ A;  2P5Z X;  3T16 A;  4ME5 A;  1VQI A;  1O7Y A;  1G6Z A;  1D8L A;  1Y8O B;  4RA8 A;  4CGY B;  2JA6 H;  4BBR B;  1V1Q A;  5IT9 E;  1TWG B;  3HKZ E;  3GTL H;  1HNW L;  3SVM A;  1CKN A;  4LFB L;  4RGO S;  1KL9 A;  5FO9 B;  3CRK C;  1WCM B;  2X69 A;  5LL6 S;  4JI0 L;  4JI5 L;  4A3G B;  3OMG A;  3IFD A;  3D0F A;  2QEX A;  3K7U C;  2KJX A;  3TP8 A;  2CWA A;  2JA8 B;  1CM9 A;  5KND A;  1SJH D;  4YY3 Q;  5TSS A;  3BYT B;  1MI2 A;  1U5K A;  4XYQ A;  3D31 A;  4LFA Q;  5CC4 A;  3M85 A;  1G8Z D;  3BJU A;  4NXN Q;  4DV3 L;  1STH A;  4K8J A;  5BR8 L;  2B39 A;  4RHS A;  4RCN A;  3A8K E;  5EBC A;  4ZQ3 A;  2A73 B;  5CV6 A;  5LHY 1;  5IWA L;  4A93 G;  4UY8 C;  2WV6 D;  3W2D A;  2B2U A;  5EGT A;  3TS2 A;  2WAQ E;  5ELB A;  1RTN A;  5IYC H;  5KRU A;  3FHW A;  4A3F H;  3L3O C;  1E2Z A;  4FF4 A;  2WII B;  1TWA B;  3MAQ A;  3I4N B;  3I8Z A;  3B6Y A;  3K81 C;  2O5I C;  5CV7 A;  4XQJ A;  3FPU B;  3ULP A;  1GUT A;  3OSO A;  4K5X A;  1Y1W B;  1RCV D;  5CV8 A;  2NVX H;  1IBK Q;  3BDL A;  4CBV A;  1ONL A;  1N36 Q;  3TQY A;  1KDB A;  1HZB A;  3AYH B;  5J39 A;  1SYE A;  4IJH A;  4QL5 A;  3F1Z A;  3KLW A;  4H44 C;  4DFA A;  4XQN A;  2E5L Q;  2EY1 A;  1KIX A;  5J3B A;  2TSS A;  3EIV A;  2JXM B;  4LUZ A;  1H9S B;  2KUM A;  3LNN A;  2KHI A;  5I2Y A;  3OWE B;  3SGI A;  1GUW A;  3H91 A;  1EZ8 A;  1VQ8 A;  5C44 H;  4N8X 1;  3D6C A;  3M4Y A;  1Z7T A;  3E9H A;  1STB A;  3LGJ A;  4AYB E;  3OTO L;  4BA1 I;  2Q8T A;  3PMF A;  1IBL L;  2E76 C;  4Y7N B;  1F9P A;  1SMY D;  3KDF B;  5CBA E;  1JE4 A;  4J1M A;  2IHF A;  4ODG A;  2HUG A;  3GQB A;  4LF6 Q;  1PTO B;  2IJ0 A;  3ULJ A;  1OXT A;  4HCS A;  3P1H A;  3EJI A;  2XWJ B;  1J5E Q;  3JC6 6;  5C4J H;  4HJ8 A;  1EQV A;  2FIN B;  5C3E G;  4GN4 B;  4BBS H;  1KAW A;  1VQO A;  2EIF A;  2DNE A;  2HDM A;  3K8A A;  5IYB H;  3QO2 A;  4GKJ L;  2A68 C;  1AH9 A;  3PIO A;  2QDL A;  5COY A;  3A56 A;  2OTJ A;  2BE5 C;  1SYF A;  1XPO A;  1A0I A;  4P73 A;  2D62 A;  5EPJ A;  2XVS A;  2RDH A;  2Y0S B;  3K80 C;  1SE8 A;  4L6T B;  2WAQ B;  2K5W A;  4JI8 Q;  4KJN A;  2O4X A;  5LMU L;  4POG A;  5GAE C;  4R4I A;  2HCC A;  4C3H G;  1WTR A;  4OX9 L;  4GNX C;  1GXD C;  1QIL A;  1GO3 E;  4UP8 A;  2BA1 A;  2Q2T A;  3TZU A;  5GAD C;  3DEP A;  2F0E A;  4X3K A;  5CBE E;  5COR A;  4BY1 B;  2NWG A;  1KNE A;  2RSN A;  4A3K G;  5EKK A;  1ENA A;  1NBW A;  1GHJ A;  1FGB D;  1X3Q A;  3QR8 A;  4N9T A;  4NB3 A;  4F8M A;  4JCV E;  1Y1V B;  3EBE A;  4YIJ A;  5FLX c;  1X65 A;  3CU7 A;  2BH2 A;  3H3V C;  2AQ2 B;  5AFW A;  2ZJR A;  1VQG A;  3V05 A;  2R92 G;  1VCI A;  2NN6 H;  3MVV A;  1F2L A;  1MJE A;  1X3E A;  2EJF C;  5E4X A;  3PF5 A;  3CCM A;  4QIW E;  4L5Q A;  2B2Y A;  2DJF C;  2QDB A;  4NW2 A;  2GA4 B;  2QIL A;  2Z0S A;  3BDC A;  3P20 A;  4DUZ Q;  1JCK B;  2JA5 B;  4AH6 A;  1PRT B;  5C4H A;  4FP5 D;  1JJG A;  2ZTC A;  1ENF A;  4M8A A;  4HIM A;  1Q7Y C;  1GUN A;  3DWA A;  4OHJ A;  3F2C A;  1HFG A;  4B3T L;  4NP5 A;  2JQO A;  5HGQ A;  1IW7 C;  1WCM H;  4WRD A;  4A3G H;  1YI2 A;  4HJ7 A;  3K57 A;  1YHB A;  3MWY W;  1JE5 A;  4DV0 Q;  3U4V A;  2MNA A;  2JA8 H;  2QEJ C;  1EY4 A;  2A5H A;  4A3I B;  4K6L A;  3M4O B;  1ROD A;  4JI3 L;  1SNO A;  3TRE A;  1Q12 A;  4GNX A;  4HMJ A;  3FRP B;  4DAY A;  2RA4 A;  1SBB B;  1IHZ A;  3M4Q A;  4X62 L;  2J0T D;  2KOL A;  1N33 Q;  1BCP F;  1CK1 A;  1EQQ A;  4ZKB B;  4PZ8 A;  4QJF A;  1V8Q A;  4APV A;  1Y69 U;  1N9W A;  1PH6 A;  3PSI A;  1WD1 A;  1Q1E A;  2F0P A;  1JR0 D;  4DK6 C;  1SNP A;  4PMW A;  2JA6 G;  2WB1 G;  2D9U A;  4ME3 A;  1YJN A;  2G5D A;  4TVA B;  5D3I B;  5M3M G;  2MO0 A;  2R7Z B;  1A6X A;  2SDF A;  3S1R B;  5BN3 A;  1G91 A;  4YHH L;  4QUC A;  1JJ2 A;  3PO3 H;  4ZKC B;  2AQ1 B;  4E6I A;  3I56 A;  1BNZ A;  5H1S E;  1JOO A;  1VS0 A;  3G4S A;  5G3L D;  1LUZ A;  1I3Q B;  1KDA A;  4IFD I;  4N8F A;  4RAU C;  1Y1W H;  1PH9 A;  2ENB A;  2I5L X;  4YWM A;  4JV5 L;  2K6A A;  2NZH A;  2DN8 A;  4KLK A;  3I3C A;  3H09 A;  2BDN A;  2PZT A;  3PV0 A;  2DUD A;  5C4X H;  3OW7 A;  1D5Z C;  1I94 Q;  4JBK A;  1LAC A;  3FEW X;  5CV4 A;  2RBM A;  3CCR A;  1IYJ B;  2Q8R E;  4C3J H;  4O2D A;  2LXJ A;  1TS3 A;  2E2H B;  1OXX K;  4JI0 Q;  3D8G A;  5J1Z A;  1FJG Q;  1OO9 B;  3I2Z A;  4A3F G;  1CA6 A;  4R1J A;  1QVC A;  4IUP A;  1ZEQ X;  4Y7N H;  4LF4 L;  4DKA C;  2RQX A;  3MXN A;  1EEI D;  1LTT D;  3T4A C;  3GTP B;  3NTI A;  2KQ3 A;  5K36 G;  3BVM A;  3J7Z C;  4DV3 Q;  4K14 A;  1QVG A;  3ZJY C;  1E22 A;  4LF8 Q;  2CW0 C;  3DEO A;  2PO4 A;  3PGZ A;  3SK8 A;  2NVT H;  2NVQ B;  1YNN C;  4KJO A;  1Y8N B;  2MJ8 A;  4ZUJ A;  2OTL A;  1QE6 A;  1EY8 A;  1CI3 M;  1F9R A;  1SNQ A;  4V0B A;  4WJ4 A;  5C44 G;  2NYZ D;  4IUT A;  1J8I A;  2KEE A;  3CKI B;  1ASY A;  1A3T A;  1HA6 A;  3S16 B;  1WD0 A;  3HOZ B;  2OEO A;  2VS1 A;  1X56 A;  4R8N A;  1LTA D;  3GV6 A;  1RL2 A;  1ZKO A;  5IOC A;  1LT5 D;  2PMZ E;  2PQA B;  1VMC A;  2KED A;  1WI5 A;  2RHS B;  4BBS G;  4M1U B;  3G6J B;  5IYB G;  2F0H A;  2LY7 A;  4L5T A;  1YNJ D;  1KTK A;  3CCV A;  1IXR A;  4OWX B;  1STE A;  3OYY A;  1I4G A;  3AFP A;  3V2T A;  4GOP C;  3FMC A;  1EY7 A;  5HGT A;  3G6E A;  1EWH A;  4OON A;  5M3F B;  1SE4 A;  1BDO A;  4FF1 A;  1R4Q B;  4X66 Q;  4X3T A;  1JMC A;  2K28 A;  3E6Z X;  1EYD A;  4G7H C;  1N36 L;  1PFB A;  1BQQ T;  4A3B B;  3S2H B;  1CSP A;  4OIK A;  2RF4 A;  3LWU A;  2JA5 H;  1M4V A;  1LV9 A;  3RZO B;  3BDO A;  3KBX A;  1SFO H;  1HR0 Q;  1EY9 A;  1K28 A;  1BCP D;  3VR6 A;  1KAA A;  4A3C H;  2E75 C;  2DGY A;  3KLS X;  4K2L A;  5M5Y B;  4FDB A;  4TRD A;  5LMU Q;  3HOW G;  4A3E B;  2NN6 G;  3ULL A;  3J7A 5;  5KEE A;  2E2I B;  4XDX A;  4B9W A;  1PH5 A;  1RIP A;  3FKI G;  4O0A A;  1CQV A;  4LF6 L;  4J15 A;  1E0B A;  5E1F A;  3K7A B;  1LO5 D;  2UU9 Q;  3S15 B;  1UWV A;  5IYD H;  5A35 A;  3M4O H;  3AQQ A;  4HAE A;  2A6E D;  3CPW A;  1KDC A;  5HY6 A;  1D2B A;  1FVI A;  2YTV A;  1E1T A;  4BXX G;  2XSC A;  1D5X C;  4R4Q A;  1A2T A;  2F0J A;  2ICE C;  4DNT B;  5IGF A;  2K50 A;  2BOS A;  3HRZ C;  3OIQ A;  3ERQ A;  4LMQ D;  4K8I A;  1XMO Q;  1CSQ A;  3S1R H;  1SRO A;  4UDU C;  1WCM G;  2EXD A;  4A3G G;  1FNV A;  2PQE A;  1HZC A;  4U67 3;  2RKS A;  3E3X A;  3CCJ A;  4GOP A;  3K6O A;  1SNM A;  1TU2 B;  2JA8 G;  2EY6 A;  3S1Q B;  5DLQ E;  2L9H A;  5LMN W;  1YNX A;  3A8I E;  4CJ0 B;  1J6Q A;  3NWS A;  4CJ2 C;  2NZO A;  1G51 A;  3D6W A;  4KHV A;  5DNF A;  1DON A;  5FO8 B;  5A2Q E;  2CH4 A;  1TWC H;  4G7O C;  3HOX B;  1IL8 A;  1T9H A;  1I50 B;  4BA2 I;  5D14 A;  3QWN A;  2NBF A;  3KK7 A;  1K83 H;  4HR7 B;  1H9K A;  1ESR A;  3I70 A;  2YU9 B;  1ICF B;  1R9T B;  2D5D A;  1DM0 B;  2PZU A;  4ZLT F;  1Q86 C;  3U9O A;  1A63 A;  3RLO A;  3PO3 G;  3GTK B;  4X3S A;  3W1B A;  2K32 A;  4U68 A;  3I55 A;  1VQE A;  4KY6 A;  5FLX L;  1E3P A;  1STA A;  3HOY H;  1SDF A;  2EYH A;  1NNX A;  4PZ7 A;  4DUZ L;  1Y1W G;  4GLA C;  3MFG A;  1EQT A;  1U4P A;  2YV5 A;  2EQS A;  2F4I A;  1HNX Q;  3ICE A;  3VR2 A;  4X62 Q;  2F4V Q;  3VA5 A;  2IX3 A;  4LFC Q;  5C4X G;  4HTH A;  1JIC A;  4FO2 A;  2PW5 A;  1AZP A;  1YJ9 A;  3CW2 C;  5IP9 G;  2NVQ H;  4JC0 A;  3Q8D A;  4DK0 A;  2PI2 A;  3E0J A;  4C3J G;  2UUC L;  4TQU S;  5DM6 3;  1JJC B;  1F77 A;  3HKZ G;  4H02 A;  4YHH Q;  4DV0 L;  4KY5 A;  3MFY A;  1D5M C;  3CXC A;  1GUS A;  2WIN B;  4K6D A;  4ZRZ A;  3Q24 A;  3GDE A;  3MEH A;  3GTO H;  1SNC A;  2ZXO A;  3RD4 A;  3PIP 3;  3S16 H;  1E2W A;  3HOZ H;  3H0G B;  1N33 L;  2FHT A;  4JV5 Q;  1H95 A;  2GVB A;  5KIX A;  3HEJ A;  4KD4 A;  3J80 i;  2LSS A;  3NQI A;  4IOA A;  3TSS A;  1PVO A;  3BG3 A;  4LW1 A;  3G71 A;  3QB3 A;  2Y0S G;  1VQJ A;  1I4P A;  2WAQ G;  4Q0F A;  1WTP A;  1H9J A;  2AWN A;  1LTS D;  4MZ9 A;  2BE5 D;  2IY5 B;  4LF4 Q;  2L11 A;  4QUF A;  1NE3 A;  5JPN C;  2DY7 A;  2JA7 B;  3T51 B;  1VQB A;  4A3B H;  4POF A;  1YIT A;  4BY1 G;  1I94 L;  3NBI A;  4YWL A;  1NSN S;  3OW2 A;  2CCZ A;  1SMX A;  4DR4 Q;  2JP1 A;  1YHQ A;  5M3M H;  5C3X A;  4XQQ A;  4QMG A;  1FJG L;  4IZ8 A;  1ESF A;  1PV4 A;  1STN A;  4LAA A;  3RUZ A;  4CKE A;  1PDQ A;  3TN2 A;  4OO1 H;  4A4I A;  1MIU A;  1N34 L;  2EVB A;  2RDG A;  1A3U A;  2I46 A;  2H4O A;  5KGU A;  2EY5 A;  4JYA Q;  1HUM A;  2M00 A;  4A3M H;  4AYB G;  4R4T A;  3K7A H;  2V4D A;  4DAM A;  3S15 H;  2QF7 A;  5BN4 A;  1W3S A;  2Q2H A;  1Q8I A;  3SEB A;  1E1O A;  3R8B A;  4UP9 A;  3J81 j;  1GHK A;  1BUV T;  4KTA A;  3KDF A;  4LF8 L;  3NEL A;  1FNW A;  2JA5 G;  1B50 A;  3PUW A;  2E74 C;  2FXQ A;  1PRT C;  4IFD J;  2Y0S E;  2DNC A;  3NXW A;  2NZ1 D;  1S5F D;  4DV1 Q;  1PMR A;  4CJ1 B;  3UE1 A;  3T1Y L;  1CHP D;  1AP0 A;  1K3B C;  4A3C G;  4JI6 Q;  4DR7 Q;  1C7Y A;  1UE1 A;  2HQL A;  1KHI A;  1EY5 A;  3J7Y W;  3J81 E;  1XNQ Q;  1VQ9 A;  4H7B A;  1WTQ A;  1P16 A;  1BBX C;  3KF6 A;  1LTI D;  3A55 A;  1FYC A;  4JI7 Q;  4LWC A;  1C8C A;  3NQT A;  5K36 H;  1HJP A;  5IYD G;  3OWF A;  4A3J B;  2F3I A;  4TKO B;  4JG2 A;  1KC8 C;  1DXM A;  3TDQ A;  1TII D;  1SYG A;  1Z9F A;  4DR5 Q;  2B2W C;  2ZJP A;  2A1A A;  2K5H A;  3HOX H;  2VXW A;  2IW3 A;  5FLX E;  1I50 H;  3I4M B;  4HED A;  3S1N B;  3TME A;  3NTH A;  1STG A;  2B2Y C;  2TMP A;  1XMQ L;  4X66 L;  2NVY B;  1K0R A;  1SRU A;  1XNR Q;  1IKM A;  1ZYR C;  3I72 A;  1SYB A;  1SSO A;  2A6H D;  3CRL C;  4CDE C;  2YYZ A;  1SND A;  2XRS D;  4MHE A;  4L63 B;  1UEA B;  3GO5 A;  1CKM A;  2NTS A;  4R4C A;  2G9D A;  3ZYY X;  1NAP A;  3HOU B;  3GD7 A;  1HR0 L;  1SXT A;  5LMN L;  2ZXR A;  3S1M B;  1YVC A;  1BCP B;  1ILQ A;  5T1G A;  3RLN A;  2NB0 A;  1G2S A;  3S14 B;  1QZG A;  3IAY A;  4RCO A;  4I7A A;  2EZV A;  2UXB Q;  1HUN A;  1WTW A;  4O42 A;  2IL8 A;  4UP7 A;  2JK8 A;  1EY0 A;  1VQF A;  2UU9 L;  4DR3 L;  3J81 c;  3MZ5 A;  2B8F A;  1MHW C;  4H13 C;  4XYO A;  4N9P A;  5HUR A;  1W2B A;  1XJV A;  1YIJ A;  4JVZ A;  1EYG A;  1OTC A;  3R3O A;  3WWV A;  3HOY G;  2WAC A;  1UE7 A;  4B3M Q;  2HIV A;  4YCU A;  2L4N A;  2VB3 X;  3CAM A;  4LUO A;  4DV5 Q;  4A76 A;  2OWO A;  4FF3 A;  5FJ8 H;  1RHP A;  1TR5 A;  2F0F A;  4X65 Q;  1E7Z A;  4QCL A;  2LXK A;  3SR1 A;  1XMO L;  3HOV B;  2EY2 A;  1B4O A;  2B2W A;  4UPA A;  3HOW H;  4DK1 A;  1V9P A;  2FFK B;  3FKI H;  3TP7 A;  3EA6 A;  3H3V I;  2CW0 D;  4Z9C B;  2K52 A;  2CHB D;  1YNN D;  3CCL A;  2B3G A;  2ZT9 C;  5CGK A;  2F0T A;  2HCI A;  2F0N A;  4DV4 L;  1S5D D;  3HOZ G;  4XXE A;  2IX1 A;  1WTH A;  5ELN A;  2HD3 A;  4BXX H;  1IL2 A;  1NCV A;  1B8A A;  4WOR A;  1MSG A;  3IL8 A;  4AQY Q;  5JJL A;  3N52 A;  4KMU C;  4BBR H;  1TWG H;  4DR1 Q;  2VL6 A;  2QKI C;  3SE0 A;  2UUC Q;  4RKL A;  3F2D A;  3HG9 A;  1LAB A;  1HRJ A;  4MTN A;  3NWT A;  1C4Q A;  2Q2I A;  4DXG A;  3QJY A;  4ZYS A;  3NE5 B;  1V43 A;  3CC7 A;  5M3F G;  2OQK A;  1B70 B;  5KNB A;  2O2L D;  1L0Y B;  1Q1B A;  4OEL B;  3C2P A;  3T53 B;  3G7L A;  1QUQ A;  4X6A H;  2IPK D;  3CD6 A;  2EYL A;  5JPM C;  4XIG S;  1MSH A;  4RGN A;  1PH7 A;  3AB9 A;  3CPF A;  1HNX L;  2F4V L;  4A3B G;  3VDY A;  4LFC L;  1YHA A;  1S5E D;  2VUM B;  1RD9 D;  1Q81 C;  2C35 B;  2Z6K A;  5FOB B;  4S3S A;  4CDD C;  3GTQ B;  3C46 A;  1KAB A;  2F3W A;  4HMI A;  2Q2U A;  3BYY B;  5L37 A;  1GUO A;  3E9I A;  3T1H Q;  3BZD B;  1TWA H;  3STB C;  4OO1 G;  2F0U A;  3I4N H;  1B1Z A;  3PIP A;  1GUG A;  2F03 A;  4IUN A;  5F2D A;  3VA7 A;  1IBM Q;  5EBD A;  1V1P A;  4B08 A;  2C5C A;  3MXP A;  3RR5 A;  4FVM A;  4A3M G;  4YCW A;  2KVM A;  3K0Y A;  5C5L A;  4HSV A;  2M9V A;  2K5V A;  4IFD G;  1JC7 A;  3BZC A;  2OT2 A;  3KJO A;  4A3J H;  1JB7 A;  3S17 B;  4R8I A;  1U4M A;  1U0L A;  1WTO A;  1VQA A;  4P71 A;  5IP9 H;  4GLX A;  2ID0 A;  3PO2 B;  4IUR A;  1L1O B;  5JEA J;  1CQF A;  3D4D A;  1CUK A;  2KCC A;  1EOT A;  4IAL A;  1DOK A;  4HSP A;  2PQA A;  2AKW B;  1DD2 A;  5A2Q L;  4HIK A;  1S3O A;  3RN5 A;  3FP9 A;  1N34 Q;  4CKB A;  2NVY H;  4C3I B;  2A19 A;  3RLF A;  4DAP A;  3AFQ A;  3QOJ A;  4K0K Q;  3S2D B;  4LF7 Q;  4LF5 Q;  1KNA A;  3GTM B;  1PH2 A;  1PTO H;  1EFW A;  4IOC A;  1I6V C;  5FLM H;  4C3H B;  4FNF A;  1PH4 A;  3MA2 B;  3A7A B;  4GNX B;  3JAM i;  4B3S Q;  2EJG C;  4RGT A;  1M1K C;  1CA5 A;  2K03 A;  4DR4 L;  1SAP A;  1Z47 A;  2VNU D;  1A62 A;  2PW7 A;  3HOX G;  3QIA A;  4QF4 A;  3SK4 A;  1PRT F;  1IYU A;  3ND8 A;  1O7Z A;  3T1Y Q;  3OOC A;  1TT2 A;  5IGD A;  1EIG A;  4JYA L;  4NXM Q;  3PUX A;  2SNM A;  5C4Z A;  1GM5 A;  5IGC A;  1W6K A;  3ERO A;  1BOS A;  2F0L A;  5ELC A;  1EY6 A;  2XGT A;  2SEB D;  4BY1 H;  2QW7 A;  1QNU A;  4CDC C;  1UEB A;  3TS0 A;  2LS0 1;  1WFQ A;  2CQA A;  4O1N A;  3DWQ A;  3IRB A;  2CWP A;  2H1E A;  1EOV A;  2UXD Q;  1O7I A;  1L0X B;  1XXG A;  4DV1 L;  1C0A A;  4JOI A;  1Y1V H;  1H9R A;  1SYD A;  2A69 D;  1K8O A;  4RFB A;  2WFW A;  1XX8 A;  4JI6 L;  1A3V A;  2F0Q A;  3HOV H;  4DR7 L;  3NPP A;  4DUY Q;  1BVS A;  1QNK A;  5E4W C;  5E7N A;  3R2I A;  1XMQ Q;  5ELE A;  2JE6 I;  3PCO B;  1XNQ L;  5CMD A;  3D4R A;  1JQY D;  4DU9 A;  5FK9 C;  4PG3 A;  4JI7 L;  2EYM A;  2B8G A;  1VQL A;  3A54 A;  1S5B D;  2EYP A;  1NMG A;  1RF2 D;  2F1M A;  2KCN A;  4DR5 L;  1QOH A;  3H0G G;  4UAI A;  1G6P A;  3VR3 A;  2SOB A;  3T56 B;  3AMU A;  2K5Q A;  1HPC A;  5LMN Q;  5FJ8 G;  2K04 A;  2UXC L;  3CQZ B;  1KRT A;  1LT6 D;  3KF8 B;  3TP6 A;  4XT3 B;  2A74 C;  4EX5 A;  3KLR A;  4OL7 A;  1XNR L;  2JA6 B;  2WB1 B;  4DXF A;  3KJP A;  2N49 A;  3GTL B;  3ER0 A;  4DR3 Q;  1U9R A;  5ELD A;  2ASB A;  4FF2 A;  4A3I H;  2LFN A;  1MJC A;  1HCZ A;  3PUY A;  3Q0A A;  1SYC A;  2XWB B;  2YTX A;  5DM7 3;  5I9P A;  5T1I A;  3NTK A;  3M7N A;  1HFN A;  5CYU A;  1LM0 A;  2VUM H;  2L5T A;  1O7L A;  5I9O A;  2B29 A;  4LNQ A;  4BBR G;  2UXB L;  1PZK D;  2MPM A;  4MTK A;  1ENC A;  2N78 A;  2R7Z H;  5IGG A;  3S9W A;  2HHH Q;  3HGB A;  1F2Y A;  4Y52 H;  2J7Z A;  2EJM A;  4ILW A;  1I3Q H;  1RTO A;  3UI2 A;  3SHL A;  1DOM A;  4EGV A;  1VF5 C;  4B3M L;  1DGS A;  4DV4 Q;  1PFN A;  4DA2 A;  4DV5 L;  3WDN A;  4OEM B;  1VQM A;  3KUP A;  2RSO A;  3J81 L;  4JI4 Q;  2MHV A;  1B3Q A;  4X65 L;  1LT4 D;  5C0X I;  2RCF A;  3A7L A;  1OXV A;  1ICW A;  1SN8 A;  4HN7 A;  3I4L A;  2E2H H;  5ISR A;  4IPD A;  3CCE A;  3DM1 A;  1XYI A;  1SLJ A;  1M90 C;  4PV1 C;  3I4N G;  4DV6 Q;  3F8T A;  4B3R Q;  4EQP A;  3S2D H;  3WOE A;  1QZH A;  1HXY D;  3I73 A;  4IN3 A;  3DWP A;  3P7J A;  1T5X D;  2XRQ D;  5C44 B;  1TWH B;  2OQ0 A;  2F0W A;  3GTP H;  5JEA G;  4L5R C;  2RHQ B;  1DJR D;  2PNH A;  4A3J G;  3TEH B;  4AQY L;  4DR1 L;  1TY0 A;  2ZM6 Q;  4GKK Q;  1D1K A;  1AEX A;  1B7Y B;  1II3 A;  2VQF L;  5C4J B;  2EOT A;  1NTG A;  4AIM A;  1L2F A;  2DJG C;  1SE2 A;  3OPO A;  2VB2 X;  3HZX A;  3MHB A;  5EPL A;  4GS3 A;  4I7Z C;  4DPG A;  1KXL A;  1PTO C;  4HJ9 A;  1S4Z A;  3H94 A;  3KOJ A;  2K1B A;  4HIO A;  3BU2 A;  5FLM G;  3QOL A;  2IWH A;  4EQN A;  2QA4 A;  2G9H D;  2K05 A;  2N55 A;  4DNI A;  1MGS A;  2B63 B;  4DR6 Q;  2JEB I;  5GRO A;  4DF7 A;  2CFM A;  3KLS A;  3PQI A;  3BZK A;  5FO7 B;  2ALY B;  4ZUI A;  3JAM c;  1VQ6 A;  4YCV A;  1Q90 A;  2K33 A;  3T1H L;  2KA7 A;  3O13 A;  5EPK A;  5JVH 3;  2N88 A;  2A68 D;  3OMC A;  4KD3 A;  3K5O A;  4C2M B;  4F88 A;  2VY3 A;  3VYU A;  5M3F H;  3LX0 A;  1HHV A;  1IBM L;  4ZCK A;  2EE1 A;  4CDF C;  3I91 A;  3RZD B;  1D1I A;  1K8M A;  3W1G A;  3OIP A;  3A8J E;  2VZA A;  2SNS A;  1EWI A;  4IPG A;  2R3Z A;  2J4X A;  1LTB D;  1BBU A;  4C1N K;  3M7G A;  1RKN A;  3S2H H;  3I90 A;  2KEN A;  2B2V C;  1QB5 D;  1Q82 C;  1DCZ A;  3OHX C;  5GQO A;  5IP7 H;  2IT1 A;  2EYO A;  3RZO H;  3PUV A;  1PYB A;  3G48 A;  4GN5 A;  1Y1V G;  4JK1 C;  4HID A;  3MTS A;  2VQE L;  3CQZ H;  5JJZ A;  4DV2 Q;  2CQO A;  1NR4 A;  3HOV G;  3VR5 A;  5M5Y H;  4A3E H;  1VF7 A;  4K0K L;  4A3L H;  4XTC S; 
#chains in the Genus database with same CATH homology
 1H9S A;  4NDX A;  1JOK A;  1O78 A;  3MXG A;  4HCE A;  4IFD H;  3X3M A;  4K5V A;  4CKC A;  4NKL A;  1EU4 A;  1PXU A;  5DEH A;  5IGB A;  1JWU D;  2R6G A;  1FR3 A;  2Q8I B;  1F9Q A;  3IFT A;  4PNY A;  3EQL C;  4ABN A;  3HS0 C;  1F2Z A;  2B2T A;  2E2J B;  1U4L A;  3FDT A;  3NUC A;  5K5P A;  1I4X A;  2Z1C A;  3X3N A;  1IW7 D;  3PO3 B;  1IKL A;  3SXH A;  1OXU A;  2IX0 A;  3BVG A;  2B2V A;  2F3V A;  4RHR A;  1TS2 A;  5C4X B;  1WTV A;  4TSS A;  2F0V A;  2L55 A;  1X3P A;  3E5S A;  4KHZ A;  4DNR B;  4C3J B;  1IYV A;  5M5W B;  3HKZ B;  5G3L F;  1A2U A;  3URY A;  4J6H A;  5EKI A;  4A3D B;  1PZJ D;  5CR3 A;  1JB3 A;  4C56 C;  4BY7 B;  4WJW A;  2KEC A;  2AQ3 B;  1QWY A;  2F0I A;  3L9A X;  5JOB A;  3TP5 A;  2JYO A;  2HDL A;  1GJX A;  2HQE A;  1XWE A;  2EYJ A;  3SDZ A;  5I6W A;  3GTJ B;  1PLF A;  3J80 E;  2AUJ D;  5M5X B;  1FD7 D;  1BF4 A;  2R93 B;  2ZXP A;  4X3U A;  2NVT B;  1R4P B;  1PFM A;  4C3I G;  5FKA C;  1JWM D;  3QG1 A;  4KY7 A;  3DMU A;  5E3F A;  1JWS D;  1O80 A;  3C1E A;  1J9O A;  4FYD A;  1DZ1 A;  2WKD A;  3Q23 A;  1ZXT A;  1A15 A;  1I6H B;  1X32 A;  2FMM A;  1TWF B;  1EWC A;  1B3A A;  2NTT A;  1W6J A;  4ID6 A;  1CT1 D;  1Y8P B;  3NSW A;  3KBG A;  4DAV A;  1EU3 A;  1C48 A;  4DN4 M;  2X6G A;  4KN7 C;  3M3Y B;  5I4D A;  4XT1 B;  3P75 A;  1OXS C;  5IOD A;  4JBW A;  1TVX A;  2EDG A;  5DAU A;  5C5M A;  2JEA I;  5I2X A;  3VYR A;  1DOL A;  4L8J A;  1QCB D;  3VYS A;  2LKV A;  4RH6 A;  5D3D A;  3C3L A;  1MBY A;  4AYB B;  4V19 0;  4KN4 C;  2L1B A;  2F0G A;  3Q22 A;  2RVL A;  3C1F A;  1B44 D;  3AU7 A;  3DHQ A;  4A93 B;  1ET9 A;  2CVR A;  1BXT A;  1HTP A;  1SFO B;  2PYK A;  2AWO A;  4ULL A;  3GP7 A;  4Q5V A;  1DYQ A;  3WOF A;  2WKC A;  4G4K A;  2EXZ A;  3N6R A;  2F0M A;  5BN5 A;  1EEF D;  1PTO F;  4EVO A;  5M9O A;  2OXP A;  1ILP A;  1G2T A;  4DGZ A;  1RJT A;  1EZ6 A;  1STY A;  2PZW A;  1PYW D;  1HA5 A;  1CZW A;  1JOQ A;  3FVQ A;  3R93 A;  5C0X H;  3BVZ A;  5IGE A;  2PPB C;  5IIF A;  1GOZ A;  1MD2 D;  2C9O A;  4PMB A;  1B9M A;  1SMY C;  5C0X J;  4G57 A;  1U4R A;  1RDP D;  4OIJ A;  2A6H C;  4OO1 I;  4OGQ C;  4RKB A;  5JEA H;  3J7A V;  2K01 A;  1WTX A;  2L12 A;  3GTG B;  2BDO A;  2XNA C;  1HQR D;  3D4W A;  3K58 A;  5C3E B;  4QIW B;  1EFI D;  5EKL A;  2Z8L A;  4BS9 A;  1QJO A;  5EJW A;  3HP3 A;  1TWC B;  3IKJ A;  4I65 A;  5CV9 A;  1SE3 A;  4LK1 C;  1UAP A;  1K83 B;  3JAM L;  4IQZ A;  2L0C A;  1TS4 A;  4P2C B;  1S5C D;  3DXJ C;  1T5E A;  3BS1 A;  5KYL A;  3T13 A;  3R2T A;  2NUC A;  2X6L A;  2O5J C;  5CV5 A;  4A3K B;  3HOY B;  4KKS A;  1SJE D;  4F87 A;  1AZQ A;  3FPP A;  4CHT B;  1EYA A;  2Z4I A;  2OF1 A;  2R92 B;  3J7A F;  3KF8 A;  1BR9 A;  1V1P B;  1HQM C;  4LJZ C;  4GZY C;  2EYF A;  1TQO A;  4KI0 A;  1NUC A;  1JOR A;  2F0S A;  1I4Q A;  1KLU D;  2K5D A;  3GTO B;  4H0L C;  1BO0 A;  1ET6 A;  3NHH A;  5C3W A;  2F0K A;  3EFX D;  3K59 A;  3VYT A;  1TKW B;  1XTC D;  1VDZ A;  3L7Z C;  5I6Y A;  1B53 A;  3PUZ A;  1M8A A;  2FMC A;  4KV6 A;  1PTO D;  4RGM A;  3V96 A;  1D6E C;  2QCP X;  2R61 A;  4IUV A;  3K5N A;  4KK7 A;  3K5M A;  5M3M B;  5J22 A;  2AUK A;  3PIO 3;  2NN6 I;  2LMC B;  1F9S A;  3RMH A;  2FJ2 A;  1KLG D;  4PMC A;  3U9S A;  4FXK C;  3F2U A;  2XN9 C;  1ML0 D;  2M2L A;  5IT9 L;  4A3M B;  3MXU A;  1E2V A;  3K5L A;  1LTG D;  1Q3L A;  4C1N I;  5NUC A;  2MGS A;  1CZG A;  1LTR D;  1HTL D;  2I07 B;  3SK6 A;  2D2C C;  2K7V A;  2PMZ B;  4PQX A;  1VMP A;  4G7Z C;  1CTM A;  2ICI A;  4A3F B;  4K2K A;  3TBI B;  3Q6S A;  1Z6H A;  3W3A A;  2BA0 A;  5ELF A;  2NVX B;  2WP8 J;  1I4R A;  3JAM E;  2MP1 A;  1AW7 A;  1CHQ D;  4QB4 A;  4FXG C;  5C0X G;  3EVQ A;  3LWE A;  3ND9 A;  4B9X A;  1PRT D;  2JSO A;  3ITP A;  4ZAI A;  1EL0 A;  3D3R A;  2F0D A;  1UNS A;  1B9N A;  1G29 1;  4RWS C;  5KYI A;  2BCO A;  3CHB D;  1F2M A;  4J8Q A;  4R9W A;  2F0O A;  1V1O A;  1YNJ C;  3NK9 A;  1QG7 A;  2A69 C;  1PZI D;  4BBS B;  3MC0 B;  4MN3 A;  5KNC A;  1EIH A;  1AN8 A;  2E2D C;  4WFN 3;  3NP8 A;  3H6M A;  3TZD A;  4ZK9 B;  1CFM A;  3VR4 A;  3J80 L;  5JVG 3;  1I4H A;  5LL6 X;  4FXD A;  2PCF B;  1B2T A;  2PNR C;  1AFP A;  1ZYR D;  1NR2 A;  3SK5 A;  4MIU A;  5D65 A;  1BCP C;  2B2T C;  4IUU A;  2MUY A;  1TY2 A;  4IUQ A;  5EQ0 A;  2EPB A;  2B2U C;  1UUP A;  1WVL A;  3GV3 A;  1SEB D;  1LLR D;  4EQO A;  3HOW B;  1LT3 D;  5C6A A;  3NBH A;  2A6E C;  2Z4H A;  3FKI B;  4KKT A;  5JAV A;  3DUZ A;  4F7X A;  2KHS A;  1EYC A;  3ONA B;  1FNU A;  1H9M A;  2XIW A;  1TS5 A;  4KKU A;  4K5W A;  4BWG B;  2RDF A;  2DY8 A;  4NMZ A;  3T16 A;  4ME5 A;  1O7Y A;  1G6Z A;  1Y8O B;  4RA8 A;  4CGY B;  4BBR B;  5IT9 E;  1TWG B;  3SVM A;  4RGO S;  5FO9 B;  3CRK C;  1WCM B;  2X69 A;  5LL6 S;  4A3G B;  3OMG A;  3IFD A;  2KJX A;  3TP8 A;  2JA8 B;  1CM9 A;  5KND A;  1SJH D;  5TSS A;  3BYT B;  1MI2 A;  4XYQ A;  3D31 A;  5CC4 A;  3M85 A;  1G8Z D;  1STH A;  4K8J A;  2B39 A;  4RHS A;  4RCN A;  3A8K E;  5EBC A;  4ZQ3 A;  2A73 B;  5CV6 A;  5LHY 1;  2WV6 D;  3W2D A;  2B2U A;  5EGT A;  5ELB A;  1RTN A;  5KRU A;  3L3O C;  1E2Z A;  4FF4 A;  2WII B;  1TWA B;  3MAQ A;  3I4N B;  3I8Z A;  2O5I C;  5CV7 A;  4XQJ A;  3FPU B;  1GUT A;  3OSO A;  4K5X A;  1Y1W B;  1RCV D;  5CV8 A;  3BDL A;  4CBV A;  1ONL A;  1KDB A;  5J39 A;  1SYE A;  4H44 C;  4DFA A;  4XQN A;  2EY1 A;  2TSS A;  2JXM B;  1H9S B;  2KUM A;  3LNN A;  5I2Y A;  3OWE B;  1GUW A;  3H91 A;  1EZ8 A;  3D6C A;  1Z7T A;  3M4Y A;  1STB A;  4BA1 I;  2Q8T A;  3PMF A;  2E76 C;  4Y7N B;  1F9P A;  1SMY D;  5CBA E;  1JE4 A;  4J1M A;  4ODG A;  2HUG A;  3GQB A;  1PTO B;  2IJ0 A;  1OXT A;  4HCS A;  3P1H A;  3EJI A;  2XWJ B;  1EQV A;  2FIN B;  2HDM A;  2DNE A;  3QO2 A;  2A68 C;  5COY A;  3A56 A;  2BE5 C;  1SYF A;  2D62 A;  5EPJ A;  2XVS A;  2RDH A;  2Y0S B;  4L6T B;  2WAQ B;  2K5W A;  4KJN A;  2O4X A;  2HCC A;  4C3H G;  1WTR A;  1GXD C;  1QIL A;  2BA1 A;  3TZU A;  3DEP A;  2F0E A;  4X3K A;  5CBE E;  5COR A;  4BY1 B;  2NWG A;  1KNE A;  2RSN A;  5EKK A;  1ENA A;  1GHJ A;  1FGB D;  1X3Q A;  4N9T A;  4F8M A;  1Y1V B;  4YIJ A;  3CU7 A;  3H3V C;  2AQ2 B;  5AFW A;  3V05 A;  1VCI A;  2NN6 H;  3MVV A;  1F2L A;  2EJF C;  5E4X A;  2B2Y A;  2QDB A;  4NW2 A;  2GA4 B;  2QIL A;  3BDC A;  3P20 A;  1JCK B;  2JA5 B;  1PRT B;  5C4H A;  4FP5 D;  1ENF A;  4M8A A;  1GUN A;  3DWA A;  4OHJ A;  1HFG A;  4NP5 A;  1IW7 C;  4WRD A;  3K57 A;  3MWY W;  2QEJ C;  1EY4 A;  2A5H A;  4A3I B;  4K6L A;  3M4O B;  1ROD A;  1SNO A;  1Q12 A;  4HMJ A;  3FRP B;  4DAY A;  2RA4 A;  1SBB B;  1IHZ A;  2J0T D;  2KOL A;  1BCP F;  1CK1 A;  4ZKB B;  1V8Q A;  1Y69 U;  1WD1 A;  1Q1E A;  2F0P A;  1JR0 D;  1SNP A;  4PMW A;  2D9U A;  5D3I B;  2R7Z B;  1A6X A;  2SDF A;  3S1R B;  5BN3 A;  1G91 A;  4QUC A;  4ZKC B;  2AQ1 B;  4E6I A;  1BNZ A;  1JOO A;  5G3L D;  1I3Q B;  1KDA A;  4IFD I;  4RAU C;  2ENB A;  2K6A A;  2DN8 A;  3I3C A;  3H09 A;  2BDN A;  2PZT A;  3PV0 A;  3OW7 A;  1D5Z C;  1LAC A;  3FEW X;  5CV4 A;  2RBM A;  2Q8R E;  1TS3 A;  2E2H B;  1OXX K;  3D8G A;  5J1Z A;  1OO9 B;  1CA6 A;  4IUP A;  1ZEQ X;  2RQX A;  3MXN A;  1EEI D;  1LTT D;  3T4A C;  3GTP B;  3NTI A;  2KQ3 A;  5K36 G;  3BVM A;  4K14 A;  2CW0 C;  3DEO A;  2PO4 A;  3SK8 A;  2NVQ B;  1YNN C;  4KJO A;  1Y8N B;  2MJ8 A;  4ZUJ A;  1QE6 A;  1EY8 A;  1CI3 M;  1F9R A;  1SNQ A;  4V0B A;  2NYZ D;  4IUT A;  1J8I A;  2KEE A;  3CKI B;  1A3T A;  1HA6 A;  3S16 B;  1WD0 A;  3HOZ B;  2OEO A;  4R8N A;  1LTA D;  3GV6 A;  1ZKO A;  5IOC A;  1LT5 D;  1VMC A;  2KED A;  4M1U B;  3G6J B;  2F0H A;  2LY7 A;  1YNJ D;  1KTK A;  1STE A;  1I4G A;  3V2T A;  3FMC A;  1EY7 A;  5HGT A;  1EWH A;  5M3F B;  1SE4 A;  1BDO A;  4FF1 A;  1R4Q B;  4X3T A;  2K28 A;  3E6Z X;  1EYD A;  4G7H C;  1PFB A;  1BQQ T;  4A3B B;  3S2H B;  4OIK A;  3LWU A;  1M4V A;  1LV9 A;  3RZO B;  3BDO A;  3KBX A;  1EY9 A;  1BCP D;  3VR6 A;  1KAA A;  2E75 C;  3KLS X;  4K2L A;  5M5Y B;  4TRD A;  4A3E B;  2NN6 G;  5KEE A;  2E2I B;  4XDX A;  4B9W A;  1CQV A;  1E0B A;  5E1F A;  3K7A B;  1LO5 D;  3S15 B;  5A35 A;  4HAE A;  2A6E D;  1KDC A;  1D2B A;  2XSC A;  1D5X C;  1A2T A;  2F0J A;  2ICE C;  4DNT B;  5IGF A;  2BOS A;  3HRZ C;  3OIQ A;  3ERQ A;  4LMQ D;  4K8I A;  4UDU C;  1FNV A;  2PQE A;  4U67 3;  2RKS A;  3K6O A;  1SNM A;  1TU2 B;  2EY6 A;  3S1Q B;  2L9H A;  3A8I E;  4CJ0 B;  3NWS A;  4CJ2 C;  3D6W A;  4KHV A;  5DNF A;  1DON A;  5FO8 B;  5A2Q E;  4G7O C;  3HOX B;  1IL8 A;  1I50 B;  4BA2 I;  5D14 A;  3QWN A;  2NBF A;  3KK7 A;  4HR7 B;  1H9K A;  1ESR A;  3I70 A;  2YU9 B;  1R9T B;  2D5D A;  1DM0 B;  2PZU A;  4ZLT F;  3U9O A;  3GTK B;  4X3S A;  2K32 A;  4U68 A;  4KY6 A;  5FLX L;  1STA A;  1SDF A;  2EYH A;  3MFG A;  1EQT A;  1U4P A;  2F4I A;  3VR2 A;  3VA5 A;  2IX3 A;  4HTH A;  1JIC A;  4FO2 A;  2PW5 A;  1AZP A;  4DK0 A;  3E0J A;  4C3J G;  4TQU S;  5DM6 3;  1F77 A;  4KY5 A;  3MFY A;  1D5M C;  1GUS A;  2WIN B;  4K6D A;  4ZRZ A;  3Q24 A;  3MEH A;  1SNC A;  2ZXO A;  3RD4 A;  3PIP 3;  1E2W A;  3H0G B;  2FHT A;  5KIX A;  3HEJ A;  4KD4 A;  3NQI A;  3TSS A;  3BG3 A;  3QB3 A;  1I4P A;  4Q0F A;  1WTP A;  1H9J A;  2AWN A;  1LTS D;  2BE5 D;  2L11 A;  4QUF A;  5JPN C;  2DY7 A;  2JA7 B;  3T51 B;  3NBI A;  1NSN S;  2JP1 A;  5C3X A;  4XQQ A;  4QMG A;  4IZ8 A;  1ESF A;  1STN A;  4LAA A;  3RUZ A;  4CKE A;  1PDQ A;  3TN2 A;  4OO1 H;  2EVB A;  2RDG A;  1A3U A;  2I46 A;  2H4O A;  5KGU A;  2EY5 A;  1HUM A;  2M00 A;  2V4D A;  2QF7 A;  5BN4 A;  1Q8I A;  3SEB A;  3R8B A;  1GHK A;  1BUV T;  4KTA A;  1FNW A;  1B50 A;  3PUW A;  2E74 C;  1PRT C;  4IFD J;  2DNC A;  3NXW A;  2NZ1 D;  1S5F D;  1PMR A;  4CJ1 B;  1CHP D;  1AP0 A;  1EY5 A;  3J7Y W;  3J81 E;  4H7B A;  1WTQ A;  1BBX C;  1LTI D;  3A55 A;  1FYC A;  1C8C A;  3NQT A;  5K36 H;  3OWF A;  4A3J B;  4TKO B;  1DXM A;  3TDQ A;  1TII D;  1SYG A;  2B2W C;  2VXW A;  2IW3 A;  5FLX E;  3I4M B;  4HED A;  3S1N B;  3TME A;  3NTH A;  1STG A;  2B2Y C;  2TMP A;  2NVY B;  1IKM A;  1ZYR C;  3I72 A;  1SYB A;  1SSO A;  2A6H D;  3CRL C;  2YYZ A;  1SND A;  2XRS D;  4MHE A;  4L63 B;  1UEA B;  3GO5 A;  2NTS A;  2G9D A;  3ZYY X;  1NAP A;  3HOU B;  3GD7 A;  1SXT A;  2ZXR A;  3S1M B;  5T1G A;  1BCP B;  1ILQ A;  2NB0 A;  1G2S A;  3S14 B;  3IAY A;  4RCO A;  2EZV A;  1HUN A;  1WTW A;  4O42 A;  2IL8 A;  1EY0 A;  3MZ5 A;  2B8F A;  4H13 C;  4XYO A;  4N9P A;  5HUR A;  3R3O A;  2WAC A;  2L4N A;  2VB3 X;  4FF3 A;  1RHP A;  1TR5 A;  2F0F A;  4QCL A;  3SR1 A;  3HOV B;  2EY2 A;  1B4O A;  2B2W A;  4DK1 A;  2FFK B;  3TP7 A;  3EA6 A;  2CW0 D;  4Z9C B;  2CHB D;  1YNN D;  2ZT9 C;  5CGK A;  2F0T A;  2HCI A;  2F0N A;  1S5D D;  4XXE A;  2IX1 A;  1NCV A;  4WOR A;  1MSG A;  3IL8 A;  3N52 A;  4KMU C;  2QKI C;  3SE0 A;  4RKL A;  3HG9 A;  1LAB A;  1HRJ A;  3NWT A;  1C4Q A;  4DXG A;  3QJY A;  4ZYS A;  3NE5 B;  1V43 A;  5KNB A;  2O2L D;  1L0Y B;  1Q1B A;  3C2P A;  3T53 B;  3G7L A;  2IPK D;  2EYL A;  5JPM C;  4XIG S;  1MSH A;  4RGN A;  3AB9 A;  1S5E D;  2VUM B;  1RD9 D;  5FOB B;  4S3S A;  3GTQ B;  3C46 A;  1KAB A;  2F3W A;  4HMI A;  3BYY B;  4OO1 G;  1GUO A;  3BZD B;  2F0U A;  1B1Z A;  1GUG A;  2F03 A;  4IUN A;  5F2D A;  3VA7 A;  5EBD A;  1V1P A;  4B08 A;  2C5C A;  3MXP A;  4FVM A;  2KVM A;  3K0Y A;  5C5L A;  4HSV A;  2M9V A;  4IFD G;  1JC7 A;  2OT2 A;  3S17 B;  4R8I A;  1U4M A;  1WTO A;  2ID0 A;  3PO2 B;  4IUR A;  5JEA J;  1CQF A;  3D4D A;  2KCC A;  1EOT A;  4IAL A;  1DOK A;  4HSP A;  1DD2 A;  5A2Q L;  4CKB A;  4C3I B;  3RLF A;  4DAP A;  3QOJ A;  3S2D B;  3GTM B;  1KNA A;  1PTO H;  1I6V C;  4C3H B;  4FNF A;  3MA2 B;  3A7A B;  2EJG C;  4RGT A;  1CA5 A;  2K03 A;  1SAP A;  1Z47 A;  2VNU D;  2PW7 A;  3QIA A;  4QF4 A;  3SK4 A;  1PRT F;  1IYU A;  3ND8 A;  1O7Z A;  3OOC A;  1TT2 A;  5IGD A;  1EIG A;  3PUX A;  2SNM A;  5C4Z A;  5IGC A;  1W6K A;  3ERO A;  1BOS A;  2F0L A;  5ELC A;  1EY6 A;  2SEB D;  1QNU A;  2LS0 1;  2CQA A;  4O1N A;  3DWQ A;  2H1E A;  1L0X B;  1XXG A;  1H9R A;  1SYD A;  2A69 D;  1K8O A;  4RFB A;  1XX8 A;  1A3V A;  2F0Q A;  3NPP A;  1QNK A;  5E4W C;  3R2I A;  5ELE A;  2JE6 I;  5CMD A;  3D4R A;  1JQY D;  4DU9 A;  5FK9 C;  2EYM A;  2B8G A;  3A54 A;  1S5B D;  2EYP A;  1RF2 D;  2F1M A;  2KCN A;  1QOH A;  4UAI A;  3VR3 A;  2SOB A;  3T56 B;  3AMU A;  2K5Q A;  1HPC A;  2K04 A;  3CQZ B;  1LT6 D;  3TP6 A;  4XT3 B;  2A74 C;  3KLR A;  4OL7 A;  2JA6 B;  2WB1 B;  4DXF A;  3GTL B;  1U9R A;  5ELD A;  4FF2 A;  2LFN A;  1HCZ A;  3PUY A;  3Q0A A;  1SYC A;  2XWB B;  5DM7 3;  5I9P A;  5T1I A;  3NTK A;  3M7N A;  1HFN A;  5CYU A;  2L5T A;  1O7L A;  5I9O A;  1PZK D;  2MPM A;  1ENC A;  5IGG A;  3S9W A;  3HGB A;  1F2Y A;  2J7Z A;  2EJM A;  4ILW A;  1RTO A;  3UI2 A;  3SHL A;  1DOM A;  4EGV A;  1VF5 C;  1PFN A;  4DA2 A;  3WDN A;  3KUP A;  2RSO A;  3J81 L;  2MHV A;  1LT4 D;  5C0X I;  3A7L A;  1ICW A;  1OXV A;  4HN7 A;  3I4L A;  5ISR A;  3DM1 A;  1XYI A;  4PV1 C;  4EQP A;  3WOE A;  1HXY D;  3I73 A;  4IN3 A;  3DWP A;  3P7J A;  1T5X D;  2XRQ D;  5C44 B;  1TWH B;  2F0W A;  5JEA G;  1DJR D;  1TY0 A;  1D1K A;  1AEX A;  1II3 A;  5C4J B;  2EOT A;  1SE2 A;  3OPO A;  2VB2 X;  3HZX A;  3MHB A;  5EPL A;  4I7Z C;  1PTO C;  1S4Z A;  3H94 A;  2K1B A;  3QOL A;  2IWH A;  4EQN A;  2G9H D;  2K05 A;  2N55 A;  1MGS A;  2B63 B;  2JEB I;  4DF7 A;  3KLS A;  5FO7 B;  4ZUI A;  1Q90 A;  2K33 A;  2KA7 A;  3O13 A;  5EPK A;  5JVH 3;  2N88 A;  2A68 D;  3OMC A;  4KD3 A;  3K5O A;  4C2M B;  4F88 A;  3VYU A;  1HHV A;  3LX0 A;  2EE1 A;  3I91 A;  3RZD B;  1D1I A;  1K8M A;  3OIP A;  3A8J E;  2SNS A;  2R3Z A;  2J4X A;  1LTB D;  4C1N K;  3M7G A;  1RKN A;  3I90 A;  2B2V C;  1QB5 D;  1DCZ A;  3OHX C;  2IT1 A;  2EYO A;  3PUV A;  4JK1 C;  3MTS A;  5JJZ A;  1NR4 A;  3VR5 A;  1VF7 A;  4XTC S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...