4GN4B

Obody am2ep06 bound to hen egg-white lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
b'AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OBody AM2EP06
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags De novo protein/hydrolase
total genus 20
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gn4B00
2UU9L 2JA7H 1E1OA 1N36L 3L7ZC 3LGJA 4O0AA 5M3FH 2JEAI 4GN4B 3J7A5 4OXPA 4JV5Q 1FJGQ 4GKJL 2JQOA 2JEBI 4X64Q 1N9WA 4A3GH 3EBEA 5IT9c 3BJUA 3ZJYC 3I55A 4JI8L 4HIKA 2ZTCA 3GO5A 5GAEC 3HOWH 3M7NA 1L1OB 2LXJA 4JBKA 2KCMA 4DR4L 1L1OC 3CC7A 2D0OA 4A3KH 4DR7L 1KL9A 4ME3A 4GN5A 4JI4Q 4DR1Q 1XPUA 3NEMA 2DGYA 4LF9L 4AQYQ 2AKWB 5C0XG 4R4IA 2UUCQ 3CC2A 4IJLA 4YCWA 2R92G 4BXXH 4GN3B 2EQSA 1BBUA 1NJIC 2PQAA 2VS1A 1OXUA 3F2BA 1I94Q 5JEAG 4OX9Q 2CWPA 3HKZG 1NE3A 1J6QA 2NVQH 3BZKA 5M5YH 2JA9A 2RCNA 3MXNB 1X9NA 5JJLA 4GKJQ 4JC0A 2CFMA 1KIXA 3S14H 2CWAA 4WJ3M 4BY7H 4A3IH 5IP7H 3HFZB 5C44G 3G4SA 1TWHH 2OQKA 2VUMH 4GS3A 3HOVH 4AH6A 4B3ML 1V43A 4B3TL 1WCMG 3K0XA 2R6GA 4OONA 4DR4Q 1X3EA 3K80C 1HZCA 2KHJA 1C7YA 4YCVA 1IBLL 2JA7G 2Q2TA 4JI7Q 3CW2C 4LF9Q 5M3FG 3CCVA 3CC4A 3TEHB 5M5XH 1Y1WG 1U0LA 2F52A 1I6HH 2ES2A 1MKHA 1NY4A 4X66Q 1VQIA 1V1QA 2MQHA 2N3SA 4JBJA 4X65Q 5C4XH 2K4KA 1UWVA 1XNRL 1D8LA 1E7ZA 4X6AH 1E3PA 2R7FA 3EIVA 2PI2A 4JI5L 3W1GA 1UE1A 5C0XJ 4HJ7A 3HOWG 3GTGH 2WB1G 1CSPA 1YJ9A 4DV4L 4DR3L 1NTGA 1SROA 3B6YA 4DV6L 1X3FA 2A8VA 1EUJA 1VQHA 4LUVA 5JEAJ 5IP9H 1NBWA 2ZM6L 2JA8G 4POFA 1EWIA 3I4OA 5HGQA 4IFDG 1GO3E 4BY7G 1OTCA 1VQ9A 4Y7NH 4B3MQ 3TRZA 3UE1A 3STBD 4DV3L 2OWOA 1HNZQ 4R4QA 1YJWA 3M3YH 4NB3A 4DPGA 5LMUL 3GTKH 2UXDL 4IPGA 3PGZA 4DV7L 4KHPL 2AMCB 1XMQQ 4A3IG 5IP7G 1FGUA 3M85A 1P8LA 1Z9FA 2NZOA 4PZ8A 1PHJA 3PO2H 3HOVG 1S3OA 2YU9H 3VDYA 1VQFA 3L0OA 4DV4Q 1I50H 4DR3Q 3T1HQ 1PV4A 2OCEA 1NMFA 5IE8A 1EIYB 1VQDA 2A1AA 4BA1I 3AFQA 1RIPA 2E2IH 5ELNA 4LF4L 1WYDA 2PNHA 4ALPA 2GN5A 1G51A 4A75A 4X62Q 4JV5L 1Q82C 3F8TA 4IFDJ 1HZBA 2BA1A 1D7QA 3F2CA 3TS0A 2IHEA 4RMFA 2N49A 3H3VH 2VZAA 3S1QH 1CUKA 1KHIA 3RN5A 5LMNW 2EIFA 4DV7Q 1Y1VH 1Q8KA 3GDEA 5IP9G 4KHPQ 4A3MH 2ZTEA 4JCVE 5GROA 2VNUD 5E7NA 1YEZA 4JI6Q 2HIXA 4UP7A 4LFBQ 4JI4L 3SGIA 3KOJA 1VQKA 3E0EA 3PO3G 2WFWA 4DV5Q 2PQAB 2PI2E 2UUCL 3E9HA 2MNAA 3L2PA 1IL2A 3ER0A 3OYYA 1YHBA 4IJHA 1YI2A 2NVXH 4IFDI 4KI0A 2QGQA 1SRUA 4NPSA 4BBSG 5IY0A 1HJPA 2LXKA 2XGTA 2I0QA 2UUAQ 1LM0A 4QQBX 1M90C 1Y1WH 2WP8J 3PO2G 1B70B 3HOYH 4HJ5A 1DGSA 2YTYA 4JBMA 4P72A 4LW1A 2Y0SG 3CCRA 3HOZG 3F1ZA 3PCOB 2B3GA 4NXML 2R7DA 4HIOA 3HKZE 2F4VQ 4QGUA 1TXYA 2HQLA 1LUZA 4LF8Q 1P16A 4JI7L 2JA6H 1H95A 2B29A 2K75A 2JA8H 2AWOA 4HJAA 1HZAA 4DK6C 3HOXG 4LF7L 2NZHA 2K50A 1EOVA 4L5QA 3ULLA 3BZCA 4X66L 2I5HA 3CMAA 2JJQA 1SN8A 3E9IA 1TWGH 5M3MH 4X65L 1VQMA 1K9MC 1M1KC 3CCUA 4DK3C 4J15A 4YHHL 1J5EL 4TQUS 1Y1VG 3K7UC 3CCMA 4JI0L 4A93H 4DV2L 4A3MG 3CCSA 3GTOH 3A5ZB 3CF5A 1IYJB 4A3JH 1SLJA 4L5TA 4KHZA 1PH7A 1U5KA 1HNWQ 1QVGA 1X6OA 4NXMQ 4JBWA 4DUZL 1N32Q 4B3RQ 4JOIC 2WB1E 5M5WH 3DLLA 1HNZL 4L5RC 2H5XA 3G48A 3I2ZA 2Z6KC 4MTNA 3RLNA 2VL6A 4A3EH 1IXRA 4BA2I 1VQ4A 1LTLA 5C4JH 1XMOQ 4LF7Q 2I5MX 1S72A 2GVBA 2V1CC 1RL2A 3AEVA 3HOYG 1X55A 2IX1A 1K0RA 5GAGC 1XMQL 3CCLA 1VQAA 1XTDA 1VQGA 4JG2A 3M9BA 1SR3A 4GLVB 1MJEA 1J5EQ 4YHHQ 2K14A 4KLKA 4JI0Q 1R9TH 4A3DG 2EXDA 4DV2Q 1VQNA 4IPHA 4DV0Q 3T1HL 5H1SE 2NN6G 2VQEQ 3S15H 3MEFA 4PG3A 2YTXA 1EFWA 3HOUG 2JA6G 1HR0Q 4A3LG 2RHQB 4O2DA 3H15A 4OX9L 3W1BA 3GTQH 1VS0A 4WJ4A 4R4CA 1JE5A 3UDGA 1MIUA 2KCTA 1T9HA 4PMWA 5M3MG 4DUZQ 1YIJA 1PH9A 1KC8C 2OTLA 5IYBG 4X62L 1K73C 3K7AH 3RR5A 3PO3H 1I3QH 4Y52H 1AH9A 3ULJA 1PH1A 4JOIA 1UE6A 1E1TA 1G291 1QUQA 3J81j 4A93G 4A3CH 1XNQL 5C0XI 1N34Q 1BKBA 1L2FA 1Z47A 2Z6KA 3K8AA 3WWVA 3PIPA 3I56A 4BBSH 2K5HA 4A3JG 2Q2UA 5EAYA 1PH3A 3H3VI 4JI6L 2BH2A 5FJ8H 4GLAC 4R4OA 4LFAQ 3F2DA 4LFBL 2ZTDA 1PH8A 1AE3A 3GTMH 4JYAL 1C0AA 4DV5L 3CCEA 3S1MH 1YJNA 3H0GH 3CPFA 1WFQA 1KD1C 3HOZH 2LSSA 4IPDA 5BR8L 1ASZA 4UPAA 4A3EG 2XTIA 4PZ7A 1IBKQ 3AYHB 2OQ0A 4OWXB 4GNXC 2ZJPA 1N33Q 1EQRA 1UEBA 1VQCA 2ZJRA 1VQEA 4DR5Q 3I4MH 3UDXA 2UUAL 1MJCA 2UXBQ 3HOXH 3PUVA 5FLMG 4P75A 2UUBQ 4B3RL 1VQPA 4XIGS 5IYCG 4K0KL 1CKNA 5IWAQ 1XNQQ 3ULPA 2QEXA 3G71A 1XJVA 4LF5Q 1YBYA 2ZJQA 4A76A 1OXXK 3GTPH 3U50C 2F4VL 3S24A 1KAWA 4MNOA 4UP9A 1A0IA 4QY7A 3J81c 4DR6L 1B8AA 1FL0A 4HIDA 4YWMA 4LF8L 2MFIA 4JI2L 1BBWA 1QVFA 1G6PA 4JYAQ 3CP0A 1OXTA 4A3FH 4DAMA 4DKAC 1WOCA 3J81i 4GLXA 4DNIA 1FVIA 1YZ6A 5BR8Q 2E5LL 2Y0SE 3ICEA 4C2MH 1CSQA 5GQOA 3RZDH 3NENA 4QL5A 4A3CG 5JJIA 1VQ6A 4PZ6A 1X65A 3CCQA 4C3HH 4L5SA 3M4QA 3I7FA 1JJCB 2GVAA 2WAQG 3KJPA 4GNXA 3CD6A 1LYLA 1XPOA 3RNUA 3TREA 1YNXA 2VQFL 4BY1H 3KDFA 5FJ8G 4GOPA 2NVYH 1PA6A 3RN2A 2DUDA 1VQLA 3S1NH 5IYDH 4LUZA 4K0KQ 2FXQA 4OWTB 3H0GG 1GM5A 1JJ2A 3U58A 3PSIA 3RLFA 1QZHA 2VUMG 1HNWL 4A3DH 1N32L 2UXCQ 3S2DH 4DV1Q 2CQOA 3HKSA 4LWCA 3A0JA 4DR6Q 3HOUH 1VQ5A 4JI2Q 3I4MG 1PYSB 4A3LH 1HH2P 1O7IA 1UE5A 3AFPA 1PH4A 2E2HH 4AYBG 1XMOL 3U4VA 3D31A 1KXLA 3K81C 4C3JH 1HZ9A 2YTVA 1VQBA 2Q2IA 1TWCH 3KF8B 3CCJA 1UE7A 5IYBH 1NMGA 3KF6B 2K5NA 3CQZH 1KRTA 2ASBA 1W3SA 3I4NG 2QA4A 4B3SQ 2K5VA 4YWKA 3OTOQ 4DUYQ 4DV0L 2VQEL 3KLWA 4A4IA 5GAHC 3UDIA 2VQFQ 1VQ8A 1AE2A 4IOAA 3DM3A 3BU2A 3TQYA 2YYZA 3PF5A 3A74A 1HR0L 2HHHQ 4GKKQ 3M4PA 2N78A 2D62A 3J80c 4A3FG 2R7ZH 2I5LX 3S2HH 5GADC 2AHOB 1PFSA 4QJFA 1QUQB 3W5OA 1Q1EA 4EX5A 4IO9A 4OO1G 2NVTH 3J80i 2AWNA 1GD7A 4FDBA 3U4ZA 4BBRG 4P71A 4RG1A 4R1JA 3PUYA 1SMXA 1EIFA 3UE0A 5DLQE 1X3GA 3JAMc 1K8GA 5ELOA 1Q86C 2UU9Q 3FKIH 1N34L 1E24A 4BY1G 2MO0A 4MZ9A 1N36Q 1K83H 2B63G 4IOCA 5IYDG 3CXCA 1IZ6A 5J3BA 4AIMA 3JAMi 2CCZA 3TS2A 2CKZB 5C3EH 1JT8A 5FLMH 4LFCL 4LFAL 5IYCH 5K36G 3G6EA 4XTCS 3STBC 1B7YB 4JI8Q 3PF4A 1PVOA 1BVSA 3KF6A 4A3BG 3CAMA 1KRSA 1KQSA 1A8VA 2R93G 3KJOA 2OTJA 1IBKL 3CPWA 2Q2HA 4DR7Q 3D0FA 1C9OA 1N33L 1A62A 1L1OA 3GD7A 1VQ7A 4DR5L 4HJ9A 4UY8C 2L15A 1K8AC 2UXBL 1CKNB 4YWLA 2RHSB 3FHWA 1IBML 4UP8A 4QIWE 2KHIA 1Q46A 2E5LQ 1JMCA 1HNXL 2UUBL 3GTLH 3KFUA 1GKHA 4A3GG 1E22A 1VCIA 1PH5A 5IWAL 3PUZA 1EQQA 4LF6L 4LF5L 5LMNL 2HT1A 4TVAB 1JB7A 1X54A 4A3KG 4IPCA 2IHFA 4C3IH 4NXNL 3NELA 3S16H 2R7ZG 1PYBA 4LFCQ 5JJKA 1S40A 1HR0W 2JA5H 1Y14B 3PIOA 1VQOA 1OXSC 3KYHC 4BXXG 3PUWA 1PH2A 4B3TQ 1A63A 4YY3L 1EYGA 4H02A 3OW2A 2ATWA 4R4TA 4GNXB 1SFOH 1OXVA 2PMZE 2N8NA 1IBLQ 3FKIG 1VQJA 3RZOH 3KDFB 2VW9A 2A19A 3IRBA 3RLOA 4GOPB 3ERSX 3T1YL 1TWFH 2YV5A 4GOPC 1I5FA 4OO1I 2F3IA 2KENA 4DR2L 3JC66 1L0WA 5C3EG 3GTJH 4HJ8A 4LUOA 1IBMQ 1X56A 2JE6I 4APVA 2ALYB 2KBNA 1HNXQ 1XNRQ 1K3RA 1Q7YC 1PH6A 4JI1L 5AJ3L 1YITA 2BA0A 3PUXA 4JI5Q 2E8GA 1YVCA 4LF6Q 5LMNQ 4JI3L 2C35B 1N8RC 3I4NH 2BH8A 2UXCL 4DV6Q 5FLXc 4DV1L 2IX0A 3S1RH 4NXNQ 1SE8A 2WAQE 3AQQA 2ZM6Q 2IT1A 3FP9A 1QVCA 4YCUA 2NN6I 5HY6A 2D0PA 4YY3Q 5C4XG 1GVPA 1CKOA 3PV0A 4POGA 1CKMA 4DV3Q 2R92H 2MO1A 1FJGL 1Q1BA 1WJJA 4P74A 4X64L 4BBRH 4EQ5A 1Q81C 1Q12A 1W2BA 3T1YQ 2IY5B 4B3SL 5LMUQ 2UXDQ 3OTOL 3CMEA 4DUYL 4DR2Q 3Q8DA 1TWAH 1WI5A 2E2JH 1JJGA 4DAYB 2B63H 4AYBE 2JA5G 2HIVA 4LNQA 2JK8A 4JI1Q 5AJ3Q 2HHHL 3A5UA 1V9PA 1YHQA 4GKKL 2ID0A 4DR1L 3NBHB 4JI3Q 3EN2A 5C44H 4AQYL 4OWWB 4HIMA 3UDFA 3S17H 2K52A 4A3BH 4P73A 1YHAA 2Z0SA 3J7ZC 2VY3A 3M4OH 1XPRA 2R93H 1WCMH 2RF4A 1QZGA 4LF4Q 1I94L 1ASYA
chains in the Genus database with same CATH superfamily
2JA7H 1O80A 3J7A5 1LTBD 4O0AA 5M3FH 4GN4B 1F9RA 2JQOA 2JEBI 4PV1C 1MD2D 1IYUA 2MGSA 2ZTCA 3RZOB 4DA2A 1MBYA 4JBKA 3GP7A 2KCMA 1ML0D 3E0JA 1XPUA 1WTHA 2DGYA 3NEMA 4LF9L 4AQYQ 2AKWB 5C0XG 1VF7A 2UUCQ 4RHRA 3X3NA 4EQOA 4K14A 2PQAA 2RCFA 2VS1A 1OO9B 3BVGA 1NE3A 1XTCD 2HUGA 3E5SA 3MXNB 3F2UA 5JJLA 4GKJQ 4JC0A 2LY7A 1KIXA 3S14H 1JE4A 4A3IH 1CZGA 1HXYD 1BCPF 1UAPA 3BYTB 3OWEB 5CYUA 4AH6A 3RD4A 1WCMG 4DR4Q 4RFBA 1X3EA 2KHJA 2EOTA 3L9AX 1IBLL 2R61A 3T53B 2L12A 2V4DA 3TEHB 1U0LA 1TR5A 3QOLA 2MQHA 3N6RA 3ND8A 1PRTD 1CTMA 2K4KA 1D8LA 1A3UA 1GUGA 1SSOA 5C0XJ 1WCMB 2CH4A 2WB1G 3AMUA 1X3QA 4MTKA 1WTWA 1TY0A 1X3FA 1VQHA 2PW5A 1SNOA 3OOCA 5HGQA 1W6JA 4IFDG 1JOQA 2E2DC 1GO3E 1OTCA 4B3MQ 4KD4A 3TRZA 2OWOA 1HNZQ 2AQ1B 2WB1B 1D5ZC 3OIQA 4ME5A 1ET9A 3PGZA 2PO4A 2F4IA 1PMRA 2NWGA 5EJWA 4BY7G 1FNUA 5IP7G 3M85A 2NZOA 3HOVG 1EY0A 1PTOB 3VDYA 4DV4Q 1QNUA 3TN2A 5E1FA 5IE8A 5M5YB 2A6EC 3AU7A 2E2IH 5ELNA 2PNHA 4ALPA 1TQOA 4BY7B 1KDBA 4MIUA 1G51A 1GUTA 5I6YA 3HOVB 4X62Q 3VA7A 1Q82C 3EQLC 4IFDJ 4KD3A 1HZBA 4LK1C 2BA1A 5F2DA 1D7QA 3TS0A 5KNCA 3BDOA 2N49A 3H3VH 3S1QH 1CUKA 4OELB 1C4QA 1Q8KA 1Y1VH 1EY4A 5E7NA 1YEZA 4JI6Q 5C4XB 4I7ZC 1Q3LA 3PO3G 2D5DA 2UUCL 3GTGB 4QF4A 2EXZA 5CORA 3A54A 4KV6A 4IJHA 3R3OA 5C4ZA 4IFDI 4KI0A 1SRUA 1MGSA 3TSSA 2WKCA 2F0QA 2XGTA 3ND9A 2J7ZA 4IZ8A 1M90C 1BCPC 1Y1WH 3V2TA 4HJ5A 1DGSA 1O7LA 3W3AA 2EY1A 4N8X1 3CCRA 3HOZG 2B3GA 4X3UA 3HKZE 4ZYSA 3FPPA 2NN6H 1SE3A 2B29A 2JA8H 1H95A 1HZAA 3HOXG 3K57A 3F2CA 3CMAA 1SN8A 1GHJA 3AB9A 2Z8LA 1WTXA 2M9VA 4J15A 1J5EL 3SK4A 4A3MG 3QIAA 2L11A 3D6WA 1IL8A 2JYOA 2C9OA 4L5TA 1HNWQ 1U5KA 3ITPA 3PQIA 1TT2A 4DUZL 1N32Q 1Y69U 5M5WH 3DXJC 4DAVA 1HNZL 4C3HG 4A3MB 1K0SA 2Z4IA 4FF2A 2GVBA 3HOYG 1X55A 1SNQA 2RDHA 5KYIA 1RTOA 1VQGA 3M4OB 2K14A 2KJXA 2NVXB 2EXDA 3N52A 1HRJA 1VQNA 1I4RA 5ELCA 1H9KA 4QB4A 3MEFA 4PG3A 3U9OA 2F0GA 1G2TA 1JQYD 4A3LG 3HOYB 1EY6A 4R4CA 4IALA 5KYLA 2KCTA 2WIIB 1PH9A 4Y52H 5IYBG 4X62L 1K73C 3HOWB 1KDAA 4K2KA 4OL7A 1SJHD 2Z9HA 1E1TA 4A93G 2EJGC 1XNQL 1BKBA 2Z6KA 4BBSH 3I56A 5A35A 2K5HA 2XN9C 3VR2A 4JI6L 5IIFA 2EPBA 2EZVA 3CRKC 3GTMH 1HTPA 4JYAL 3TP6A 4A93B 3SR1A 5BR8L 4UPAA 1I4PA 4PZ7A 2F1MA 2HD3A 4GNXC 4XDXA 2ZJRA 1VQCA 1VQEA 2X6GA 3EFXD 5IGCA 1EY9A 1EIHA 2UUBQ 3X3MA 2H4OA 5IYCG 4K0KL 1CKNA 5IWAQ 3I90A 4F7XA 2QEXA 1MSGA 2F0LA 5IODA 2ZJQA 1OXXK 4FF1A 5C4JB 4ID6A 3H91A 1A0IA 4UP9A 1LTID 1WD0A 2B8FA 1JC7A 1FL0A 4S3SA 4YWMA 2EJFC 3QOJA 3CP0A 1OXTA 4DNIA 4K5VA 4G7OC 4XQQA 4JVZA 3S15B 1DD2A 1UNSA 5JJIA 3BVMA 5EBCA 4PZ6A 1X65A 2OT2A 4L5SA 1JJCB 2WAQG 1ESFA 3GTQB 1CFMA 2EVBA 3CD6A 1D5MC 4B3RQ 3RN2A 1VQLA 1HHVA 2FXQA 1SE2A 3H0GG 1GM5A 3U58A 1QZHA 1HNWL 1N32L 2UXCQ 4DNTB 3KLRA 1EYAA 2CQOA 3HKSA 4JK1C 2N88A 3OWFA 1ZKOA 1UE5A 3AFPA 5DM63 3L3OC 2YU9B 3D31A 1KXLA 4L8JA 5IOCA 1HZ9A 1JICA 2Y0SB 4HCSA 1UE7A 3NPPA 1RD9D 3S9WA 3KF6B 1JCKB 2LFNA 1W3SA 3DHQA 2ASBA 3I4NG 1SYGA 2QA4A 3NK9A 4B3SQ 1DZ1A 3OTOQ 4DGZA 4DUYQ 1F2YA 3KLWA 1I4QA 2VQFQ 2KEEA 4IN3A 1AE2A 3MAQA 3BU2A 2BE5D 1ENFA 4GKKQ 3J80c 2D62A 3S2HH 5GADC 1PRTB 4DAYA 2NTTA 2AHOB 5E3FA 3I3CA 1Q1EA 4OO1G 2TSSA 1GHKA 1PTOH 4P71A 1YNND 3O13A 1B1ZA 2MO0A 3P20A 2B63G 5IYDG 3CXCA 1IZ6A 4AIMA 3JAMi 2CKZB 1EWCA 5EBDA 1H9MA 2F0KA 1B7YB 1BVSA 2F0JA 3A56A 3KUPA 3SEBA 3HRZC 5NUCA 3KJOA 4HR7B 2NVYB 1L1OA 2PCFB 2PNRC 4HJ9A 2RSNA 2K6AA 3FHWA 4UP8A 2UUBL 2F3VA 1JMCA 1HNXL 3GTLH 1VMPA 1E22A 2NZ1D 3NE5B 1PH5A 5JOBA 5IWAL 1EQQA 5LMNL 4CDCC 1ILQA 4IPCA 2IHFA 4PMCA 1SXTA 3IFTA 4KY6A 1VDZA 2JA5H 1VQOA 3PIOA 1OXSC 3CQZB 3M4YA 3PUWA 1A63A 4H02A 4OEMB 3OW2A 1J9OA 1STNA 3KBXA 1OXVA 4V190 3FKIG 1M4VA 1KLGD 3T1YL 4H0LC 1I5FA 4OO1I 4XYQA 1NUCA 3SE0A 1IBMQ 1TIID 1FD7D 1Q7YC 1YITA 2BA0A 2K5QA 4K2LA 4A3EB 1N8RC 4K8JA 2C35B 5JVG3 3VR5A 2UXCL 2K33A 4DV6Q 2MHVA 1SE8A 2ZM6Q 3TDQA 4R9WA 5I6WA 5FK9C 1QVCA 3BS1A 1BR9A 1DCZA 4H13C 2IL8A 4X64L 1Q12A 1W2BA 1I4HA 2IY5B 4B3SL 5LMUQ 5E4XA 3OTOL 4DUYL 2AQ3B 2E2JH 4AYBE 2HIVA 3H09A 2MP1A 1KNAA 1V9PA 4GKKL 4JI3Q 4OWWB 1KNEA 1RTNA 4A3BH 1WTOA 4P73A 2Z0SA 2R93H 3M4OH 2BOSA 2F0FA 4ZUJA 1NAPA 4WORA 1I94L 1TY2A 1IKLA 4RHSA 4RKBA 3LGJA 2DY8A 2JEAI 4OXPA 1B3QA 1FJGQ 1LTAD 2CQAA 3CKIB 4CDEC 4CDFC 2B2UC 1N9WA 1SFOB 3EBEA 5IT9c 4A3GH 1M8AA 1U4PA 1SJED 3HOWH 2M2LA 3C46A 3I4MB 4KTAA 3EA6A 2F0PA 3BDCA 1AZQA 1KL9A 4GN5A 4JI4Q 1GUOA 2AUJD 2EDGA 5FO8B 3V96A 4IJLA 4YCWA 3NWSA 4GN3B 1NJIC 2X6LA 3S1RB 3C3LA 3F2BA 4OX9Q 5JEAG 3HKZG 2JA9A 2RCNA 1X9NA 1SYCA 4A3FB 2F3WA 2LMCB 2CWAA 1RKNA 4C2MB 4KMUC 3HFZB 5C44G 4LAAA 2IJ0A 4BBRB 1V43A 4OONA 1AFPA 3HKZB 3K80C 1HZCA 4O1NA 2A69D 4CJ2C 1LTTD 1BQQT 4LF9Q 3QG1A 1Y1WG 2ES2A 1NY4A 1IYVA 1MSHA 1V1QA 4JBJA 4PQXA 5C44B 1UWVA 4X6AH 2K03A 4HAEA 4RGOS 4FNFA 4BS9A 4HJ7A 2K05A 2FINB 1NTGA 3B6YA 4DV6L 2EY5A 5JEAJ 2ZM6L 5IP9H 3MZ5A 2JA8G 1EWIA 3I4OA 1A2UA 3STBD 4R4QA 5FLXE 4A3KB 1HQRD 5LMUL 3GTKH 4DV7L 2B2WA 4KHPL 4K6DA 2YU9H 2FFKB 1W6KA 3L0OA 4IURA 3LNNA 3T1HQ 2OCEA 2NVQB 1NMFA 1EIYB 1DYQA 1VQDA 2A1AA 4KJOA 3AFQA 4BA1I 3SHLA 1TWHB 1O7YA 3FPUB 3TZDA 2IHEA 4LJZC 1ZYRD 2JP1A 3NP8A 2CHBD 2EIFA 4K5WA 5CV5A 5M5XB 1LT6D 4CHTB 4JCVE 5GROA 2HIXA 2KCNA 3K5OA 4LFBQ 4JI4L 4CJ0B 3VYSA 1H9SB 2QKIC 1AN8A 1KAAA 1VQKA 1V1OA 1IL2A 3ER0A 3OYYA 1ENCA 2F0WA 3ONAB 4FP5D 1S5FD 2QGQA 4BBSG 5IY0A 2LXKA 2BE5C 3IFDA 4QQBX 3PO2G 4Y7NB 3SVMA 3I4LA 5J39A 3JAME 3BZDB 3T56B 4HIOA 2F4VQ 1TXYA 1YNNC 2HQLA 3GTJB 4QMGA 4LF8Q 3J7AF 4RGMA 3Q6SA 1YNJD 4R8NA 4DK6C 3PO2B 2Q8TA 4HSVA 5J22A 1EOVA 3ULLA 1E2ZA 3E9IA 1TWGH 1FR3A 2DN8A 1M1KC 1LO5D 4TQUS 3K7UC 2F0SA 3FDTA 4DV2L 3NHHA 3CCSA 3GTOH 3A5ZB 3CF5A 1JWUD 3E6ZX 2PQEA 1RDPD 1IYJB 4X3KA 4A3JH 3C2PA 3VYUA 4KHZA 1X6OA 3LWEA 5LHY1 3J80L 4ILWA 3MEHA 3OSOA 2H5XA 1DOMA 2Z6KC 2B2TA 1KDCA 2VL6A 4MTNA 4A3EH 4BA2I 1XMOQ 1WD1A 2SEBD 4F87A 5L37A 1K0RA 3CCLA 1VQAA 1XTDA 2A5HA 4JG2A 2DJFC 1SR3A 1MJEA 1J5EQ 1GUNA 2K7VA 2EYMA 3KF8A 5M9OA 4I65A 3T1HL 5H1SE 3PIP3 5DM73 2Z6BA 5JAVA 3TMEA 2YTXA 2JA6G 3UI2A 1V1PA 1SE4A 4FVMA 4O2DA 2RDGA 3T16A 3W1BA 1ICWA 4WJ4A 2A73B 5HURA 2OTLA 1S4ZA 1T9HA 2CVRA 5M3MG 4DUZQ 3KLSX 5K36G 5I2XA 4NDXA 1AH9A 5I9OA 2HQEA 1EFID 4RCOA 2Z4HA 1QUQA 1SYEA 4A3CH 5C0XI 1C8CA 1Z47A 4RCNA 2JA6B 1RJTA 2MUYA 5EAYA 3SK5A 4G7ZC 3A8JE 2BH2A 4LFBL 4GLAC 1B3AA 2X69A 1SBBB 2EJMA 2ZTDA 1C0AA 3S1MH 1YJNA 2EYFA 4TKOB 1ASZA 2SDFA 2XTIA 3AYHB 1T5EA 2OQ0A 5I4DA 1EQRA 1KLUD 3I4MH 3MC0B 4Q5VA 3PUVA 4XIGS 5D14A 5EKLA 4DFAA 4L6TB 1XWEA 3ULPA 1XNQQ 3G71A 1XJVA 4LF5Q 1YBYA 2L0CA 2F4VL 1EU3A 4MNOA 4DR6L 1B8AA 2B8GA 4LF8L 3NWTA 4EQPA 1G6PA 4JYAQ 3U9SA 4A3FH 4DAMA 3OW7A 1WOCA 3J81i 2QDBA 4E6IA 1FVIA 5BR8Q 5A2QL 3W2DA 4C2MH 1CSQA 2PZUA 1EU4A 3CCQA 4H7BA 1BCPB 4EVOA 1I4XA 3TREA 3RNUA 3E3XA 3KDFA 4KK7A 5FJ8G 4BY1H 2DUDA 3S1NH 3PO3B 4K0KQ 3K7AB 4OWTB 1BDOA 1JJ2A 1WTRA 3V05A 3RLFA 4DN4M 2VUMG 3M3YB 4A3DH 1JORA 4ZUIA 1S5BD 3MVVA 5C5LA 1VF5C 3A0JA 3K6OA 3HOUH 1S5ED 1PYSB 2F0TA 3A8IE 5EKKA 3IL8A 1PH4A 4AYBG 1XMOL 3U4VA 2A68D 2CW0D 3K81C 4C3JH 1I50B 2YTVA 1VQBA 1TWCH 3HOZB 1KRTA 2WV6D 3HZXA 5FO7B 1BNZA 3MWYW 4NMZA 4A4IA 5GAHC 2A69C 5IT9L 5I2YA 5KEEA 2YYZA 1L0YB 4H44C 3HOXB 3A74A 2HHHQ 3DWQA 2N78A 2TMPA 1CM9A 2I5LX 5CV6A 1A3TA 1WTVA 2AWNA 2RKSA 3NBHA 2OF1A 3GTPB 3PUYA 2F0NA 5DLQE 1E24A 4DF7A 2CCZA 3TS2A 5C3EH 5KNDA 2D9UA 4LFCL 5FLMH 3RZDB 2G9DA 1NCVA 4XTCS 3STBC 1STEA 4A3BG 2ICEC 4C3HB 2R93G 2OTJA 3MXGA 4DR7Q 1HFNA 1SEBD 1VQ7A 4DXGA 1WTQA 2B39A 2L4NA 1Q46A 2ENBA 1VMCA 3S2DB 4A3GG 1VCIA 5D3IB 3I70A 1K8OA 3PUZA 4LF6L 4LF5L 3LX0A 5CV7A 4CKCA 1X54A 2E2HB 4C3IH 4NXNL 3NELA 3S16H 1G91A 2R7ZG 1PYBA 2M00A 1CHQD 5JJKA 3MXNA 1ICFB 1Y14B 1B9NA 5HGTA 3KK7A 3KYHC 3Q24A 4B3TQ 3DUZA 4YY3L 1EYGA 2DNEA 4GNXB 1ZYRC 2PMZE 2E74C 5JJZA 3RZOH 4GOPB 4GOPC 2HCIA 2R7ZB 1LT4D 1JWSD 2F3IA 2KENA 2ZXRA 3GTJH 4HJ8A 4LUOA 2ALYB 2KBNA 2KECA 4QIWB 1HNXQ 1XNRQ 1PH6A 4JI5Q 3PUXA 3HEJA 5LMNQ 1LV9A 2XNAC 2P5ZX 4KY5A 2PYKA 1STHA 2IX0A 1K83B 4F88A 3VYRA 3HGBA 3FP9A 1SYBA 2IW3A 5HY6A 5E4WC 3K5LA 1R9TB 2WKDA 3PMFA 4MN3A 4POGA 4WJWA 5C0XH 1EQTA 1KTKA 1UUPA 3CRLC 5C3WA 4DV3Q 1Q1BA 3NTHA 3T1YQ 4ZKBB 2UXDQ 3Q8DA 4DXFA 1QWYA 4M8AA 1Z6HA 1YNJC 2JK8A 4ZK9B 2HHHL 1J8IA 3A5UA 1I3QB 1EZ8A 2ID0A 4DR1L 1NR2A 2HCCA 1IKMA 2K52A 1HPCA 3J7ZC 1V8QA 1XPRA 1WCMH 2WAQB 4N9TA 1HUNA 5BN5A 3CCEA 1QZGA 4LF4Q 3GQBA 4F8MA 2XSCA 1SYDA 5EQ0A 2E76C 2L55A 3H0GB 1SAPA 1XYIA 4X64Q 3MHBA 3BJUA 3ZJYC 2J4XA 1HQMC 2EYHA 3GO5A 4UHVA 3M7NA 1TWFB 3CC7A 2D0OA 4DR7L 4ME3A 4IFDH 1EQVA 1EZ6A 1SYFA 1BBXC 2R92G 4BXXH 1E2VA 3I4NB 2EQSA 2RVLA 1OXUA 1I94Q 5JPNC 5M5YH 4QUCA 4JW0A 2CFMA 1STGA 4BY7H 5IP7H 1F77A 2OQKA 3HOVH 3SXHA 4B3TL 3K0XA 2R6GA 1C7YA 1TWAB 4O42A 4YCVA 2JA7G 2B63B 2Q2TA 1FYCA 5M3FG 2RDFA 3ZYYX 5C4XH 1XNRL 1E3PA 2JXMB 2R7FA 4JI5L 1CQVA 3GTGH 1AEXA 1CSPA 1YJ9A 1B4OA 2RA4A 4DR3L 4N8FA 2JA7B 5IGGA 5CMDA 1T5XD 2A8VA 1EUJA 4LUVA 1D1IA 5M3FB 4POFA 1BF4A 5ELFA 2G9HD 4DV3L 4DK1A 1E0BA 1YJWA 3M7GA 4RH6A 3M3YH 3J81E 4C1NK 4KKTA 1XX8A 4DPGA 2UXDL 4IPGA 5FKAC 5BN4A 4KKSA 2AMCB 3FVQA 3QJYA 4A3IG 1XMQQ 3H94A 1P8LA 1Z9FA 1PHJA 1CQFA 4PZ8A 3IAYA 2B2YC 3G6JB 1LT3D 2KQ3A 1I50H 1SMYD 1GJXA 3FKIB 1E2WA 3I73A 1TS5A 4RGTA 1D1KA 2QILA 3GV6A 4XYOA 3Q22A 1WTPA 4LF4L 1WYDA 3GV3A 1KABA 4UAIA 3S14B 2GN5A 2F0OA 2LS01 2ZXOA 2PW7A 3I72A 4XXEA 1RF2D 2I46A 4CBVA 1Q90A 2NTSA 4KY7A 1LTSD 1KHIA 2SOBA 4DV7Q 3GDEA 4KHPQ 4A3MH 4HTHA 2VNUD 2A68C 2CW0C 4XT1B 3KOJA 2PQAB 3E9HA 4XQJA 1PTOD 1YHBA 2NVXH 5KRUA 1PZID 1LTGD 1CK1A 2RSOA 5KNBA 1D2BA 1HJPA 1Y8NB 4X3SA 2WP8J 1B70B 3HOYH 1SDFA 2K5DA 2YTYA 4LW1A 3T51B 4KN4C 3F1ZA 4NXML 2R7DA 2B2TC 5DAUA 2B2VA 3D4WA 1LUZA 1F2ZA 4L63B 2AWOA 1C48A 5D65A 4LF7L 3C1EA 2K50A 2E5LQ 3CCJA 3BZCA 4OIJA 3HG9A 1VQMA 4RKLA 4DK3C 4FYDA 4YHHL 3SK6A 1Y1VG 4FXGC 3CCMA 4JI0L 4A93H 2E2IB 2KCCA 1R4PB 3H6MA 3D3RA 1SNDA 5KGUA 3VA5A 1SLJA 5DNFA 2XWBB 1QVGA 4JBWA 3H3VC 4RAUC 3NUCA 3RLNA 3G48A 1IXRA 1PDQA 1VQ4A 5C4JH 4IUTA 2V1CC 1RL2A 3AEVA 2QW7A 4ZKCB 2IX1A 5GAGC 1XMQL 2VB3X 3S17B 1Y8PB 1G2SA 4GLVB 4UDUC 1R9TH 4A3DG 4DV2Q 3RMHA 4DV0Q 2VQEQ 2NN6G 3S15H 2AUKA 1EFWA 3HOUG 5ELEA 3DWPA 1HR0Q 2EY6A 1Y1WB 1L0XB 3GTQH 1U4MA 1VS0A 5CBEE 4C3JG 1JE5A 1YIJA 1MIUA 3FRPB 4PMWA 5BN3A 2EYOA 1EWHA 1I3QH 2Q8RE 3ULJA 1PH1A 4JOIA 1UE6A 1GXDC 1G291 3TZUA 1N34Q 1L2FA 3PIPA 2JA8B 4DNRB 2Q2UA 1ET6A 2MJ8A 1PH3A 3H3VI 3SDZA 1PH8A 1CI3M 2ZXPA 3H0GH 2K01A 1KD1C 2LSSA 2FHTA 4DU9A 1G8ZD 4HMIA 5IGDA 4CGYB 4GZYC 5FLMG 1PXUA 2ZT9C 3C1FA 1B9MA 1ILPA 1ENAA 4A76A 2K04A 3S24A 1KAWA 1I6HB 1U4LA 4HIDA 4JI2L 1BBWA 1EEFD 1QVFA 2F0UA 5CBAE 1JR0D 2VB2X 4GLXA 2E5LL 2Y0SE 4OO1H 3NENA 4B9XA 4NP5A 2AQ2B 1FGBD 2RQXA 3M4QA 2Q8IB 3KJPA 2JN4A 1LYLA 1STAA 1XPOA 1YNXA 2NVYH 5IYDH 1S5CD 2HDMA 3D4RA 3LWUA 4BBSB 2O5IC 2NUCA 4M1UB 3WDNA 2F0MA 4WRDA 5IGBA 1VQ5A 2FMMA 1PTOF 4DR6Q 1QB5D 1O7IA 3NTIA 2DY7A 5EPKA 3GTMB 1QNKA 4IUNA 3A55A 4LMQD 1R4QB 1NMGA 5G3LD 2K5NA 3CQZH 3R8BA 4G4KA 4YWKA 1DJRD 4DV0L 2VQEL 3UDIA 1VQ8A 4IOAA 5CGKA 3DM3A 3OMGA 2FMCA 1HR0L 3K5NA 4DK0A 3M4PA 1PZKD 1EY7A 1F2MA 3W5OA 4EX5A 4IO9A 3T4AC 3J80i 1GD7A 2A74C 4RG1A 4R1JA 1EY8A 1K8MA 1AP0A 3UE0A 3DMUA 3VYTA 1X3GA 3JAMc 1B2TA 5ELOA 2UU9Q 3FKIH 1N34L 1QILA 4Z9CB 5CV9A 1STBA 4MZ9A 1PFBA 1N36Q 3TP5A 4IOCA 5J3BA 4C56C 2FJ2A 2A6HC 4ZLTF 4JI8Q 4C1NI 2B2UA 1KQSA 2KUMA 3HP3A 1C9OA 4UY8C 1O78A 3ERQA 1CKNB 5C5MA 3FMCA 2HDLA 2KHIA 5CV4A 1GKHA 1SMYC 4G7HC 2BDOA 2HT1A 1JB7A 1HA6A 5FO9B 5EPLA 1NSNS 4LFCQ 1S40A 2ICIA 5M3MB 3RUZA 3NBIA 5LL6X 4BXXG 1PH2A 2J0TD 4R4TA 1MI2A 1SFOH 2N8NA 2VW9A 2A19A 3IRBA 3RLOA 3ERSX 2YV5A 3S2HB 4DR2L 3JC66 1L0WA 1ONLA 1A6XA 1X56A 2JE6I 4APVA 5KIXA 3K0YA 1K3RA 2L1BA 4JI1L 5AJ3L 2XWJB 4KJNA 1G6ZA 4IUQA 4B9WA 2E8GA 3HS0C 1H9RA 4LF6Q 1PTOC 5JVH3 3VR6A 2IWHA 1HTLD 3URYA 4NXNQ 3S1RH 1EYDA 4CKEA 4U673 2IT1A 4J1MA 2SNMA 4YCUA 4FXDA 1WVLA 5D3DA 4YY3Q 5C4XG 1CKOA 3PV0A 1CKMA 1FNWA 2MO1A 2K28A 2DJGC 3OHXC 4P74A 4BBRH 4FO2A 1Q81C 1CZWA 5JEAH 3CMEA 5DEHA 4FF4A 1WI5A 2PZWA 1UEAB 4DAYB 2EYJA 2JA5G 4ZCKA 4EQNA 1DXMA 1TS3A 3GTLB 4NKLA 3J81L 5C44H 4AQYL 1LLRD 4B08A 4HIMA 3S17H 2Z1CA 1YHAA 1GOZA 2RF4A 1K3BC 2K1BA 2UU9L 2JA5B 1E1OA 1N36L 3L7ZC 4JV5Q 4RA8A 4GKJL 2VUMB 1ZEQX 4OIKA 3J7AV 3I55A 4JI8L 2L9HA 4HIKA 3P75A 1PLFA 4J6HA 5GAEC 1L1OB 2LXJA 5IGFA 3TBIB 4DR4L 1L1OC 4AYBB 4A3KH 4DR1Q 1QCBD 4HSPA 2EYLA 4R4IA 3QO2A 3CC2A 2KOLA 3R2IA 1BBUA 5JPMC 2SNSA 1H9SA 2E75C 4X3TA 1IW7D 2CWPA 3D6CA 4U68A 1J6QA 5G3LF 2F0DA 2NVQH 3BZKA 4P2CB 1A2TA 4FF3A 5J1ZA 3A7LA 3BDLA 4G57A 4WJ3M 3G4SA 1TWHH 4GS3A 1RCVD 2BDNA 3K58A 3Q0AA 4B3ML 2E2JB 2O4XA 4JI7Q 3CW2C 3NQIA 3CCVA 3CC4A 5M5XH 1I6HH 2F52A 1MKHA 4X66Q 1VQIA 2N3SA 4X65Q 1E7ZA 4A3BB 3EIVA 2PI2A 3W1GA 5EGTA 1A3VA 1UE1A 2R93B 3HOWG 1DM0B 3DWAA 4DV4L 1SROA 1B53A 2LKVA 1F9QA 4CKBA 3T13A 1NBWA 1VQ9A 5T1GA 4Y7NH 4A3GB 4ZQ3A 1F9PA 3UE1A 3P1HA 3VR4A 4KHVA 2L5TA 1PRTF 4NB3A 2VXWA 1X3PA 1FGUA 2NVTB 4ULLA 3PO2H 1S3OA 1VQFA 2PZTA 4DR3Q 2DNCA 1PV4A 2N55A 1RIPA 1LABA 4HN7A 2KA7A 3QB3A 4IUVA 4A75A 1D5XC 1D6EC 4JV5L 3F8TA 3TP7A 4RMFA 2VZAA 4BWGB 3RN5A 5LMNW 2B2VC 5IP9G 3WOFA 2ZTEA 2I07B 3MA2B 4UP7A 1JWMD 3SGIA 5FLXL 4PNYA 3E0EA 2WFWA 4DV5Q 2PI2E 2MNAA 3L2PA 1YI2A 3VR3A 2XRSD 4NPSA 4OHJA 2KVMA 1K28A 3J80E 2UUAQ 2I0QA 4ODGA 1LM0A 2XVSA 4JBMA 1TVXA 4P72A 3D4DA 2Y0SG 1FNVA 1I6VC 1EOTA 1ZXTA 3PCOB 4JPBW 2F0EA 5C3XA 4QGUA 3GTKB 4NW2A 1P16A 4JI7L 2JA6H 2K75A 2R3ZA 1QE6A 4HJAA 2EY2A 2NZHA 2NBFA 4L5QA 3DEOA 4X66L 2I5HA 2JJQA 4X65L 5M3MH 1K9MC 5K36H 1PZJD 3CCUA 2EYPA 1SNCA 1B50A 4K8IA 4XQNA 2K32A 2R92B 1F2LA 1PH7A 4NXMQ 1PRTC 4K6LA 4JOIC 2K5WA 2WB1E 3DLLA 1U4RA 4L5RC 2NB0A 3I2ZA 2B2WC 1LTLA 4K5XA 4LF7Q 1GUWA 2I5MX 1S72A 3EJIA 1AZPA 5ELDA 3MFGA 4WFN3 3JAML 3M9BA 1MHWC 3K5MA 4YHHQ 1QG7A 4KLKA 4JI0Q 4V0BA 4IPHA 3NQTA 2QCPX 1QJOA 3OMCA 2IX3A 3P7JA 2IPKD 4ZAIA 2RHQB 3H15A 1EL0A 1TKWB 1RODA 3UDGA 2A6HD 3WOEA 5CR3A 1KC8C 3PO3H 3K7AH 3RR5A 3EROA 4ZRZA 3K59A 2EE1A 3J81j 4RGNA 3WWVA 3K8AA 5A2QE 4A3JG 1CA5A 1NNXA 3I8ZA 4RWSC 1IHZA 1SNPA 1NR4A 2CH4W 5FJ8H 4LFAQ 4R4OA 1TWGB 3F2DA 1Q8IA 1HA5A 4CDDC 2QEJC 1AE3A 4CJ1B 5K5PA 4DV5L 3OPOA 3CPFA 3IKJA 1WFQA 3HOZH 2VUMH 4IPDA 4A3EG 1JB3A 1IBKQ 3GTOB 4OWXB 2ZJPA 1N33Q 4A3JB 4DR5Q 1UEBA 3R2TA 4A3IB 3UDXA 3BVZA 1MJCA 2UUAL 1O7ZA 2UXBQ 4MHEA 3HOXH 1PYWD 1X32A 4P75A 4B3RL 1JOOA 1VQPA 5T1IA 3NTKA 4EGVA 2XIWA 1BOSA 3MXUA 3GTPH 3U50C 4QY7A 3J81c 2XRQD 3A7AB 2MFIA 1H9JA 4DKAC 5IT9E 1YZ6A 3ICEA 2BCOA 2QF7A 3RZDH 5GQOA 4QL5A 4A3CG 1VQ6A 4HMJA 2A6ED 4C3HH 3I7FA 4GNXA 2GVAA 4N9PA 1BXTA 2VQFL 4GOPA 1PA6A 1CA6A 3DEPA 4LUZA 3R93A 1STYA 5TSSA 1BUVT 3PSIA 5C4HA 4DAPA 5I9PA 1Y8OB 3S2DH 4DV1Q 4TRDA 1IW7C 1TS4A 1PFMA 4LWCA 4JI2Q 3I4MG 1HCZA 1HH2P 4A3LH 2E2HH 4IUPA 5COYA 3KF8B 2Q2IA 3S1MB 2D2CC 2PPBC 5IYBH 2QDLA 3QR8A 4KKUA 5EPJA 3G7LA 3D8GA 2WACA 3OIPA 2K5VA 2F0HA 2MPMA 5ISRA 1V1PB 3BYYB 1JOKA 3CHBD 3DM1A 3TQYA 3PF5A 1LT5D 2G5DA 1BCPD 3BG3A 1DOLA 4FXKC 4A3FG 1DOKA 3KLSA 2R7ZH 4R8IA 1PFSA 4OGQC 4QJFA 3S1QB 1QUQB 3MFYA 1LACA 2NVTH 4FDBA 1Y1VB 3KBGA 1HUMA 4YIJA 1TS2A 2H1EA 3U4ZA 4BBRG 5IGEA 1EIFA 1SMXA 4TSSA 1B44D 2RBMA 3NXWA 1K8GA 1Q86C 1QOHA 4BY1G 1K83H 2O5JC 2NYZD 1F9SA 4ABNA 1JT8A 2F0VA 1GUSA 4LFAL 4HEDA 5LL6S 5FOBB 1A15A 5IYCH 1SNMA 3G6EA 5EKIA 3PF4A 1PVOA 1XXGA 3KF6A 3CAMA 1KRSA 1A8VA 2WINB 5AFWA 3I91A 1EIGA 1IBKL 2OXPA 3CPWA 2Q2HA 3D0FA 4BY1B 1N33L 2C5CA 1A62A 3GD7A 3S1NB 4DR5L 3MXPA 2L15A 3PIO3 1BO0A 1K8AC 3SK8A 2UXBL 4YWLA 1EEID 1AW7A 2RHSB 1IBML 4QIWE 3KFUA 4A3DB 4QCLA 4I7AA 3HOUB 1EY5A 2F0IA 1PFNA 2KHSA 4TVAB 3Q23A 2OEOA 4HCEA 4A3KG 4Q0FA 3NSWA 4C3JB 1HR0W 1TWCB 5ELBA 2F03A 2ATWA 3FEWX 1IBLQ 5CC4A 2GA4B 1VQJA 3KDFB 1II3A 1TWFH 1I4GA 1Z7TA 3A8KE 5C3EG 4QUFA 3CU7A 1RHPA 5M5WB 1HFGA 1YVCA 4JI3L 4J8QA 3I4NH 2BH8A 1DONA 5FLXc 4DV1L 1LTRD 3TP8A 2WAQE 3AQQA 4XT3B 1U9RA 1CT1D 1EYCA 5C3EB 3EVQA 2NN6I 2D0PA 1GVPA 4IQZA 2R92H 1FJGL 3QWNA 1WJJA 2KEDA 2PMZB 4EQ5A 3MTSA 1ESRA 1TU2B 4C3IG 4KN7C 4DR2Q 2O2LD 1TWAH 1JJGA 4PMBA 2B63H 3J7YW 4LNQA 4JI1Q 5AJ3Q 1YHQA 5C6AA 3NBHB 3EN2A 1CHPD 2B2YA 3UDFA 2VY3A 4IUUA 2JSOA 4C3IB 3S16B 4OX9L 1S5DD 1ASYA 5CV8A
chains in the Genus database with same CATH topology
2UU9L 2JA7H 1E1OA 1N36L 3L7ZC 3LGJA 4O0AA 5M3FH 2JEAI 4GN4B 3J7A5 4OXPA 4JV5Q 1FJGQ 4GKJL 2JQOA 2JEBI 4X64Q 1N9WA 4A3GH 3EBEA 5IT9c 3BJUA 3ZJYC 3I55A 4JI8L 4HIKA 2ZTCA 3GO5A 5GAEC 3HOWH 3M7NA 1L1OB 2LXJA 4JBKA 2KCMA 4DR4L 1L1OC 3CC7A 2D0OA 4A3KH 4DR7L 1KL9A 4ME3A 4GN5A 4JI4Q 4DR1Q 1XPUA 3NEMA 2DGYA 4LF9L 4AQYQ 2AKWB 5C0XG 4R4IA 2UUCQ 3CC2A 4IJLA 4YCWA 2R92G 4BXXH 4GN3B 2EQSA 1BBUA 1NJIC 2PQAA 2VS1A 1OXUA 3F2BA 1I94Q 5JEAG 4OX9Q 2CWPA 3HKZG 1NE3A 1J6QA 2NVQH 3BZKA 5M5YH 2JA9A 2RCNA 3MXNB 1X9NA 5JJLA 4GKJQ 4JC0A 2CFMA 1KIXA 3S14H 2CWAA 4WJ3M 4BY7H 4A3IH 5IP7H 3HFZB 5C44G 3G4SA 1TWHH 2OQKA 2VUMH 4GS3A 3HOVH 4AH6A 4B3ML 1V43A 4B3TL 1WCMG 3K0XA 2R6GA 4OONA 4DR4Q 1X3EA 3K80C 1HZCA 2KHJA 1C7YA 4YCVA 1IBLL 2JA7G 2Q2TA 4JI7Q 3CW2C 4LF9Q 5M3FG 3CCVA 3CC4A 3TEHB 5M5XH 1Y1WG 1U0LA 2F52A 1I6HH 2ES2A 1MKHA 1NY4A 4X66Q 1VQIA 1V1QA 2MQHA 2N3SA 4JBJA 4X65Q 5C4XH 2K4KA 1UWVA 1XNRL 1D8LA 1E7ZA 4X6AH 1E3PA 2R7FA 3EIVA 2PI2A 4JI5L 3W1GA 1UE1A 5C0XJ 4HJ7A 3HOWG 3GTGH 2WB1G 1CSPA 1YJ9A 4DV4L 4DR3L 1NTGA 1SROA 3B6YA 4DV6L 1X3FA 2A8VA 1EUJA 1VQHA 4LUVA 5JEAJ 5IP9H 1NBWA 2ZM6L 2JA8G 4POFA 1EWIA 3I4OA 5HGQA 4IFDG 1GO3E 4BY7G 1OTCA 1VQ9A 4Y7NH 4B3MQ 3TRZA 3UE1A 3STBD 4DV3L 2OWOA 1HNZQ 4R4QA 1YJWA 3M3YH 4NB3A 4DPGA 5LMUL 3GTKH 2UXDL 4IPGA 3PGZA 4DV7L 4KHPL 2AMCB 1XMQQ 4A3IG 5IP7G 1FGUA 3M85A 1P8LA 1Z9FA 2NZOA 4PZ8A 1PHJA 3PO2H 3HOVG 1S3OA 2YU9H 3VDYA 1VQFA 3L0OA 4DV4Q 1I50H 4DR3Q 3T1HQ 1PV4A 2OCEA 1NMFA 5IE8A 1EIYB 1VQDA 2A1AA 4BA1I 3AFQA 1RIPA 2E2IH 5ELNA 4LF4L 1WYDA 2PNHA 4ALPA 2GN5A 1G51A 4A75A 4X62Q 4JV5L 1Q82C 3F8TA 4IFDJ 1HZBA 2BA1A 1D7QA 3F2CA 3TS0A 2IHEA 4RMFA 2N49A 3H3VH 2VZAA 3S1QH 1CUKA 1KHIA 3RN5A 5LMNW 2EIFA 4DV7Q 1Y1VH 1Q8KA 3GDEA 5IP9G 4KHPQ 4A3MH 2ZTEA 4JCVE 5GROA 2VNUD 5E7NA 1YEZA 4JI6Q 2HIXA 4UP7A 4LFBQ 4JI4L 3SGIA 3KOJA 1VQKA 3E0EA 3PO3G 2WFWA 4DV5Q 2PQAB 2PI2E 2UUCL 3E9HA 2MNAA 3L2PA 1IL2A 3ER0A 3OYYA 1YHBA 4IJHA 1YI2A 2NVXH 4IFDI 4KI0A 2QGQA 1SRUA 4NPSA 4BBSG 5IY0A 1HJPA 2LXKA 2XGTA 2I0QA 2UUAQ 1LM0A 4QQBX 1M90C 1Y1WH 2WP8J 3PO2G 1B70B 3HOYH 4HJ5A 1DGSA 2YTYA 4JBMA 4P72A 4LW1A 2Y0SG 3CCRA 3HOZG 3F1ZA 3PCOB 2B3GA 4NXML 2R7DA 4HIOA 3HKZE 2F4VQ 4QGUA 1TXYA 2HQLA 1LUZA 4LF8Q 1P16A 4JI7L 2JA6H 1H95A 2B29A 2K75A 2JA8H 2AWOA 4HJAA 1HZAA 4DK6C 3HOXG 4LF7L 2NZHA 2K50A 1EOVA 4L5QA 3ULLA 3BZCA 4X66L 2I5HA 3CMAA 2JJQA 1SN8A 3E9IA 1TWGH 5M3MH 4X65L 1VQMA 1K9MC 1M1KC 3CCUA 4DK3C 4J15A 4YHHL 1J5EL 4TQUS 1Y1VG 3K7UC 3CCMA 4JI0L 4A93H 4DV2L 4A3MG 3CCSA 3GTOH 3A5ZB 3CF5A 1IYJB 4A3JH 1SLJA 4L5TA 4KHZA 1PH7A 1U5KA 1HNWQ 1QVGA 1X6OA 4NXMQ 4JBWA 4DUZL 1N32Q 4B3RQ 4JOIC 2WB1E 5M5WH 3DLLA 1HNZL 4L5RC 2H5XA 3G48A 3I2ZA 2Z6KC 4MTNA 3RLNA 2VL6A 4A3EH 1IXRA 4BA2I 1VQ4A 1LTLA 5C4JH 1XMOQ 4LF7Q 2I5MX 1S72A 2GVBA 2V1CC 1RL2A 3AEVA 3HOYG 1X55A 2IX1A 1K0RA 5GAGC 1XMQL 3CCLA 1VQAA 1XTDA 1VQGA 4JG2A 3M9BA 1SR3A 4GLVB 1MJEA 1J5EQ 4YHHQ 2K14A 4KLKA 4JI0Q 1R9TH 4A3DG 2EXDA 4DV2Q 1VQNA 4IPHA 4DV0Q 3T1HL 5H1SE 2NN6G 2VQEQ 3S15H 3MEFA 4PG3A 2YTXA 1EFWA 3HOUG 2JA6G 1HR0Q 4A3LG 2RHQB 4O2DA 3H15A 4OX9L 3W1BA 3GTQH 1VS0A 4WJ4A 4R4CA 1JE5A 3UDGA 1MIUA 2KCTA 1T9HA 4PMWA 5M3MG 4DUZQ 1YIJA 1PH9A 1KC8C 2OTLA 5IYBG 4X62L 1K73C 3K7AH 3RR5A 3PO3H 1I3QH 4Y52H 1AH9A 3ULJA 1PH1A 4JOIA 1UE6A 1E1TA 1G291 1QUQA 3J81j 4A93G 4A3CH 1XNQL 5C0XI 1N34Q 1BKBA 1L2FA 1Z47A 2Z6KA 3K8AA 3WWVA 3PIPA 3I56A 4BBSH 2K5HA 4A3JG 2Q2UA 5EAYA 1PH3A 3H3VI 4JI6L 2BH2A 5FJ8H 4GLAC 4R4OA 4LFAQ 3F2DA 4LFBL 2ZTDA 1PH8A 1AE3A 3GTMH 4JYAL 1C0AA 4DV5L 3CCEA 3S1MH 1YJNA 3H0GH 3CPFA 1WFQA 1KD1C 3HOZH 2LSSA 4IPDA 5BR8L 1ASZA 4UPAA 4A3EG 2XTIA 4PZ7A 1IBKQ 3AYHB 2OQ0A 4OWXB 4GNXC 2ZJPA 1N33Q 1EQRA 1UEBA 1VQCA 2ZJRA 1VQEA 4DR5Q 3I4MH 3UDXA 2UUAL 1MJCA 2UXBQ 3HOXH 3PUVA 5FLMG 4P75A 2UUBQ 4B3RL 1VQPA 4XIGS 5IYCG 4K0KL 1CKNA 5IWAQ 1XNQQ 3ULPA 2QEXA 3G71A 1XJVA 4LF5Q 1YBYA 2ZJQA 4A76A 1OXXK 3GTPH 3U50C 2F4VL 3S24A 1KAWA 4MNOA 4UP9A 1A0IA 4QY7A 3J81c 4DR6L 1B8AA 1FL0A 4HIDA 4YWMA 4LF8L 2MFIA 4JI2L 1BBWA 1QVFA 1G6PA 4JYAQ 3CP0A 1OXTA 4A3FH 4DAMA 4DKAC 1WOCA 3J81i 4GLXA 4DNIA 1FVIA 1YZ6A 5BR8Q 2E5LL 2Y0SE 3ICEA 4C2MH 1CSQA 5GQOA 3RZDH 3NENA 4QL5A 4A3CG 5JJIA 1VQ6A 4PZ6A 1X65A 3CCQA 4C3HH 4L5SA 3M4QA 3I7FA 1JJCB 2GVAA 2WAQG 3KJPA 4GNXA 3CD6A 1LYLA 1XPOA 3RNUA 3TREA 1YNXA 2VQFL 4BY1H 3KDFA 5FJ8G 4GOPA 2NVYH 1PA6A 3RN2A 2DUDA 1VQLA 3S1NH 5IYDH 4LUZA 4K0KQ 2FXQA 4OWTB 3H0GG 1GM5A 1JJ2A 3U58A 3PSIA 3RLFA 1QZHA 2VUMG 1HNWL 4A3DH 1N32L 2UXCQ 3S2DH 4DV1Q 2CQOA 3HKSA 4LWCA 3A0JA 4DR6Q 3HOUH 1VQ5A 4JI2Q 3I4MG 1PYSB 4A3LH 1HH2P 1O7IA 1UE5A 3AFPA 1PH4A 2E2HH 4AYBG 1XMOL 3U4VA 3D31A 1KXLA 3K81C 4C3JH 1HZ9A 2YTVA 1VQBA 2Q2IA 1TWCH 3KF8B 3CCJA 1UE7A 5IYBH 1NMGA 3KF6B 2K5NA 3CQZH 1KRTA 2ASBA 1W3SA 3I4NG 2QA4A 4B3SQ 2K5VA 4YWKA 3OTOQ 4DUYQ 4DV0L 2VQEL 3KLWA 4A4IA 5GAHC 3UDIA 2VQFQ 1VQ8A 1AE2A 4IOAA 3DM3A 3BU2A 3TQYA 2YYZA 3PF5A 3A74A 1HR0L 2HHHQ 4GKKQ 3M4PA 2N78A 2D62A 3J80c 4A3FG 2R7ZH 2I5LX 3S2HH 5GADC 2AHOB 1PFSA 4QJFA 1QUQB 3W5OA 1Q1EA 4EX5A 4IO9A 4OO1G 2NVTH 3J80i 2AWNA 1GD7A 4FDBA 3U4ZA 4BBRG 4P71A 4RG1A 4R1JA 3PUYA 1SMXA 1EIFA 3UE0A 5DLQE 1X3GA 3JAMc 1K8GA 5ELOA 1Q86C 2UU9Q 3FKIH 1N34L 1E24A 4BY1G 2MO0A 4MZ9A 1N36Q 1K83H 2B63G 4IOCA 5IYDG 3CXCA 1IZ6A 5J3BA 4AIMA 3JAMi 2CCZA 3TS2A 2CKZB 5C3EH 1JT8A 5FLMH 4LFCL 4LFAL 5IYCH 5K36G 3G6EA 4XTCS 3STBC 1B7YB 4JI8Q 3PF4A 1PVOA 1BVSA 3KF6A 4A3BG 3CAMA 1KRSA 1KQSA 1A8VA 2R93G 3KJOA 2OTJA 1IBKL 3CPWA 2Q2HA 4DR7Q 3D0FA 1C9OA 1N33L 1A62A 1L1OA 3GD7A 1VQ7A 4DR5L 4HJ9A 4UY8C 2L15A 1K8AC 2UXBL 1CKNB 4YWLA 2RHSB 3FHWA 1IBML 4UP8A 4QIWE 2KHIA 1Q46A 2E5LQ 1JMCA 1HNXL 2UUBL 3GTLH 3KFUA 1GKHA 4A3GG 1E22A 1VCIA 1PH5A 5IWAL 3PUZA 1EQQA 4LF6L 4LF5L 5LMNL 2HT1A 4TVAB 1JB7A 1X54A 4A3KG 4IPCA 2IHFA 4C3IH 4NXNL 3NELA 3S16H 2R7ZG 1PYBA 4LFCQ 5JJKA 1S40A 1HR0W 2JA5H 1Y14B 3PIOA 1VQOA 1OXSC 3KYHC 4BXXG 3PUWA 1PH2A 4B3TQ 1A63A 4YY3L 1EYGA 4H02A 3OW2A 2ATWA 4R4TA 4GNXB 1SFOH 1OXVA 2PMZE 2N8NA 1IBLQ 3FKIG 1VQJA 3RZOH 3KDFB 2VW9A 2A19A 3IRBA 3RLOA 4GOPB 3ERSX 3T1YL 1TWFH 2YV5A 4GOPC 1I5FA 4OO1I 2F3IA 2KENA 4DR2L 3JC66 1L0WA 5C3EG 3GTJH 4HJ8A 4LUOA 1IBMQ 1X56A 2JE6I 4APVA 2ALYB 2KBNA 1HNXQ 1XNRQ 1K3RA 1Q7YC 1PH6A 4JI1L 5AJ3L 1YITA 2BA0A 3PUXA 4JI5Q 2E8GA 1YVCA 4LF6Q 5LMNQ 4JI3L 2C35B 1N8RC 3I4NH 2BH8A 2UXCL 4DV6Q 5FLXc 4DV1L 2IX0A 3S1RH 4NXNQ 1SE8A 2WAQE 3AQQA 2ZM6Q 2IT1A 3FP9A 1QVCA 4YCUA 2NN6I 5HY6A 2D0PA 4YY3Q 5C4XG 1GVPA 1CKOA 3PV0A 4POGA 1CKMA 4DV3Q 2R92H 2MO1A 1FJGL 1Q1BA 1WJJA 4P74A 4X64L 4BBRH 4EQ5A 1Q81C 1Q12A 1W2BA 3T1YQ 2IY5B 4B3SL 5LMUQ 2UXDQ 3OTOL 3CMEA 4DUYL 4DR2Q 3Q8DA 1TWAH 1WI5A 2E2JH 1JJGA 4DAYB 2B63H 4AYBE 2JA5G 2HIVA 4LNQA 2JK8A 4JI1Q 5AJ3Q 2HHHL 3A5UA 1V9PA 1YHQA 4GKKL 2ID0A 4DR1L 3NBHB 4JI3Q 3EN2A 5C44H 4AQYL 4OWWB 4HIMA 3UDFA 3S17H 2K52A 4A3BH 4P73A 1YHAA 2Z0SA 3J7ZC 2VY3A 3M4OH 1XPRA 2R93H 1WCMH 2RF4A 1QZGA 4LF4Q 1I94L 1ASYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 L;  2JA7 H;  1E1O A;  1N36 L;  3L7Z C;  3LGJ A;  4O0A A;  5M3F H;  2JEA I;  4GN4 B;  3J7A 5;  4OXP A;  4JV5 Q;  1FJG Q;  4GKJ L;  2JQO A;  2JEB I;  4X64 Q;  1N9W A;  4A3G H;  3EBE A;  5IT9 c;  3BJU A;  3ZJY C;  3I55 A;  4JI8 L;  4HIK A;  2ZTC A;  3GO5 A;  5GAE C;  3HOW H;  3M7N A;  1L1O B;  2LXJ A;  4JBK A;  2KCM A;  4DR4 L;  1L1O C;  3CC7 A;  2D0O A;  4A3K H;  4DR7 L;  1KL9 A;  4ME3 A;  4GN5 A;  4JI4 Q;  4DR1 Q;  1XPU A;  3NEM A;  2DGY A;  4LF9 L;  4AQY Q;  2AKW B;  5C0X G;  4R4I A;  2UUC Q;  3CC2 A;  4IJL A;  4YCW A;  2R92 G;  4BXX H;  4GN3 B;  2EQS A;  1BBU A;  1NJI C;  2PQA A;  2VS1 A;  1OXU A;  3F2B A;  1I94 Q;  5JEA G;  4OX9 Q;  2CWP A;  3HKZ G;  1NE3 A;  1J6Q A;  2NVQ H;  3BZK A;  5M5Y H;  2JA9 A;  2RCN A;  3MXN B;  1X9N A;  5JJL A;  4GKJ Q;  4JC0 A;  2CFM A;  1KIX A;  3S14 H;  2CWA A;  4WJ3 M;  4BY7 H;  4A3I H;  5IP7 H;  3HFZ B;  5C44 G;  3G4S A;  1TWH H;  2OQK A;  2VUM H;  4GS3 A;  3HOV H;  4AH6 A;  4B3M L;  1V43 A;  4B3T L;  1WCM G;  3K0X A;  2R6G A;  4OON A;  4DR4 Q;  1X3E A;  3K80 C;  1HZC A;  2KHJ A;  1C7Y A;  4YCV A;  1IBL L;  2JA7 G;  2Q2T A;  4JI7 Q;  3CW2 C;  4LF9 Q;  5M3F G;  3CCV A;  3CC4 A;  3TEH B;  5M5X H;  1Y1W G;  1U0L A;  2F52 A;  1I6H H;  2ES2 A;  1MKH A;  1NY4 A;  4X66 Q;  1VQI A;  1V1Q A;  2MQH A;  2N3S A;  4JBJ A;  4X65 Q;  5C4X H;  2K4K A;  1UWV A;  1XNR L;  1D8L A;  1E7Z A;  4X6A H;  1E3P A;  2R7F A;  3EIV A;  2PI2 A;  4JI5 L;  3W1G A;  1UE1 A;  5C0X J;  4HJ7 A;  3HOW G;  3GTG H;  2WB1 G;  1CSP A;  1YJ9 A;  4DV4 L;  4DR3 L;  1NTG A;  1SRO A;  3B6Y A;  4DV6 L;  1X3F A;  2A8V A;  1EUJ A;  1VQH A;  4LUV A;  5JEA J;  5IP9 H;  1NBW A;  2ZM6 L;  2JA8 G;  4POF A;  1EWI A;  3I4O A;  5HGQ A;  4IFD G;  1GO3 E;  4BY7 G;  1OTC A;  1VQ9 A;  4Y7N H;  4B3M Q;  3TRZ A;  3UE1 A;  3STB D;  4DV3 L;  2OWO A;  1HNZ Q;  4R4Q A;  1YJW A;  3M3Y H;  4NB3 A;  4DPG A;  5LMU L;  3GTK H;  2UXD L;  4IPG A;  3PGZ A;  4DV7 L;  4KHP L;  2AMC B;  1XMQ Q;  4A3I G;  5IP7 G;  1FGU A;  3M85 A;  1P8L A;  1Z9F A;  2NZO A;  4PZ8 A;  1PHJ A;  3PO2 H;  3HOV G;  1S3O A;  2YU9 H;  3VDY A;  1VQF A;  3L0O A;  4DV4 Q;  1I50 H;  4DR3 Q;  3T1H Q;  1PV4 A;  2OCE A;  1NMF A;  5IE8 A;  1EIY B;  1VQD A;  2A1A A;  4BA1 I;  3AFQ A;  1RIP A;  2E2I H;  5ELN A;  4LF4 L;  1WYD A;  2PNH A;  4ALP A;  2GN5 A;  1G51 A;  4A75 A;  4X62 Q;  4JV5 L;  1Q82 C;  3F8T A;  4IFD J;  1HZB A;  2BA1 A;  1D7Q A;  3F2C A;  3TS0 A;  2IHE A;  4RMF A;  2N49 A;  3H3V H;  2VZA A;  3S1Q H;  1CUK A;  1KHI A;  3RN5 A;  5LMN W;  2EIF A;  4DV7 Q;  1Y1V H;  1Q8K A;  3GDE A;  5IP9 G;  4KHP Q;  4A3M H;  2ZTE A;  4JCV E;  5GRO A;  2VNU D;  5E7N A;  1YEZ A;  4JI6 Q;  2HIX A;  4UP7 A;  4LFB Q;  4JI4 L;  3SGI A;  3KOJ A;  1VQK A;  3E0E A;  3PO3 G;  2WFW A;  4DV5 Q;  2PQA B;  2PI2 E;  2UUC L;  3E9H A;  2MNA A;  3L2P A;  1IL2 A;  3ER0 A;  3OYY A;  1YHB A;  4IJH A;  1YI2 A;  2NVX H;  4IFD I;  4KI0 A;  2QGQ A;  1SRU A;  4NPS A;  4BBS G;  5IY0 A;  1HJP A;  2LXK A;  2XGT A;  2I0Q A;  2UUA Q;  1LM0 A;  4QQB X;  1M90 C;  1Y1W H;  2WP8 J;  3PO2 G;  1B70 B;  3HOY H;  4HJ5 A;  1DGS A;  2YTY A;  4JBM A;  4P72 A;  4LW1 A;  2Y0S G;  3CCR A;  3HOZ G;  3F1Z A;  3PCO B;  2B3G A;  4NXM L;  2R7D A;  4HIO A;  3HKZ E;  2F4V Q;  4QGU A;  1TXY A;  2HQL A;  1LUZ A;  4LF8 Q;  1P16 A;  4JI7 L;  2JA6 H;  1H95 A;  2B29 A;  2K75 A;  2JA8 H;  2AWO A;  4HJA A;  1HZA A;  4DK6 C;  3HOX G;  4LF7 L;  2NZH A;  2K50 A;  1EOV A;  4L5Q A;  3ULL A;  3BZC A;  4X66 L;  2I5H A;  3CMA A;  2JJQ A;  1SN8 A;  3E9I A;  1TWG H;  5M3M H;  4X65 L;  1VQM A;  1K9M C;  1M1K C;  3CCU A;  4DK3 C;  4J15 A;  4YHH L;  1J5E L;  4TQU S;  1Y1V G;  3K7U C;  3CCM A;  4JI0 L;  4A93 H;  4DV2 L;  4A3M G;  3CCS A;  3GTO H;  3A5Z B;  3CF5 A;  1IYJ B;  4A3J H;  1SLJ A;  4L5T A;  4KHZ A;  1PH7 A;  1U5K A;  1HNW Q;  1QVG A;  1X6O A;  4NXM Q;  4JBW A;  4DUZ L;  1N32 Q;  4B3R Q;  4JOI C;  2WB1 E;  5M5W H;  3DLL A;  1HNZ L;  4L5R C;  2H5X A;  3G48 A;  3I2Z A;  2Z6K C;  4MTN A;  3RLN A;  2VL6 A;  4A3E H;  1IXR A;  4BA2 I;  1VQ4 A;  1LTL A;  5C4J H;  1XMO Q;  4LF7 Q;  2I5M X;  1S72 A;  2GVB A;  2V1C C;  1RL2 A;  3AEV A;  3HOY G;  1X55 A;  2IX1 A;  1K0R A;  5GAG C;  1XMQ L;  3CCL A;  1VQA A;  1XTD A;  1VQG A;  4JG2 A;  3M9B A;  1SR3 A;  4GLV B;  1MJE A;  1J5E Q;  4YHH Q;  2K14 A;  4KLK A;  4JI0 Q;  1R9T H;  4A3D G;  2EXD A;  4DV2 Q;  1VQN A;  4IPH A;  4DV0 Q;  3T1H L;  5H1S E;  2NN6 G;  2VQE Q;  3S15 H;  3MEF A;  4PG3 A;  2YTX A;  1EFW A;  3HOU G;  2JA6 G;  1HR0 Q;  4A3L G;  2RHQ B;  4O2D A;  3H15 A;  4OX9 L;  3W1B A;  3GTQ H;  1VS0 A;  4WJ4 A;  4R4C A;  1JE5 A;  3UDG A;  1MIU A;  2KCT A;  1T9H A;  4PMW A;  5M3M G;  4DUZ Q;  1YIJ A;  1PH9 A;  1KC8 C;  2OTL A;  5IYB G;  4X62 L;  1K73 C;  3K7A H;  3RR5 A;  3PO3 H;  1I3Q H;  4Y52 H;  1AH9 A;  3ULJ A;  1PH1 A;  4JOI A;  1UE6 A;  1E1T A;  1G29 1;  1QUQ A;  3J81 j;  4A93 G;  4A3C H;  1XNQ L;  5C0X I;  1N34 Q;  1BKB A;  1L2F A;  1Z47 A;  2Z6K A;  3K8A A;  3WWV A;  3PIP A;  3I56 A;  4BBS H;  2K5H A;  4A3J G;  2Q2U A;  5EAY A;  1PH3 A;  3H3V I;  4JI6 L;  2BH2 A;  5FJ8 H;  4GLA C;  4R4O A;  4LFA Q;  3F2D A;  4LFB L;  2ZTD A;  1PH8 A;  1AE3 A;  3GTM H;  4JYA L;  1C0A A;  4DV5 L;  3CCE A;  3S1M H;  1YJN A;  3H0G H;  3CPF A;  1WFQ A;  1KD1 C;  3HOZ H;  2LSS A;  4IPD A;  5BR8 L;  1ASZ A;  4UPA A;  4A3E G;  2XTI A;  4PZ7 A;  1IBK Q;  3AYH B;  2OQ0 A;  4OWX B;  4GNX C;  2ZJP A;  1N33 Q;  1EQR A;  1UEB A;  1VQC A;  2ZJR A;  1VQE A;  4DR5 Q;  3I4M H;  3UDX A;  2UUA L;  1MJC A;  2UXB Q;  3HOX H;  3PUV A;  5FLM G;  4P75 A;  2UUB Q;  4B3R L;  1VQP A;  4XIG S;  5IYC G;  4K0K L;  1CKN A;  5IWA Q;  1XNQ Q;  3ULP A;  2QEX A;  3G71 A;  1XJV A;  4LF5 Q;  1YBY A;  2ZJQ A;  4A76 A;  1OXX K;  3GTP H;  3U50 C;  2F4V L;  3S24 A;  1KAW A;  4MNO A;  4UP9 A;  1A0I A;  4QY7 A;  3J81 c;  4DR6 L;  1B8A A;  1FL0 A;  4HID A;  4YWM A;  4LF8 L;  2MFI A;  4JI2 L;  1BBW A;  1QVF A;  1G6P A;  4JYA Q;  3CP0 A;  1OXT A;  4A3F H;  4DAM A;  4DKA C;  1WOC A;  3J81 i;  4GLX A;  4DNI A;  1FVI A;  1YZ6 A;  5BR8 Q;  2E5L L;  2Y0S E;  3ICE A;  4C2M H;  1CSQ A;  5GQO A;  3RZD H;  3NEN A;  4QL5 A;  4A3C G;  5JJI A;  1VQ6 A;  4PZ6 A;  1X65 A;  3CCQ A;  4C3H H;  4L5S A;  3M4Q A;  3I7F A;  1JJC B;  2GVA A;  2WAQ G;  3KJP A;  4GNX A;  3CD6 A;  1LYL A;  1XPO A;  3RNU A;  3TRE A;  1YNX A;  2VQF L;  4BY1 H;  3KDF A;  5FJ8 G;  4GOP A;  2NVY H;  1PA6 A;  3RN2 A;  2DUD A;  1VQL A;  3S1N H;  5IYD H;  4LUZ A;  4K0K Q;  2FXQ A;  4OWT B;  3H0G G;  1GM5 A;  1JJ2 A;  3U58 A;  3PSI A;  3RLF A;  1QZH A;  2VUM G;  1HNW L;  4A3D H;  1N32 L;  2UXC Q;  3S2D H;  4DV1 Q;  2CQO A;  3HKS A;  4LWC A;  3A0J A;  4DR6 Q;  3HOU H;  1VQ5 A;  4JI2 Q;  3I4M G;  1PYS B;  4A3L H;  1HH2 P;  1O7I A;  1UE5 A;  3AFP A;  1PH4 A;  2E2H H;  4AYB G;  1XMO L;  3U4V A;  3D31 A;  1KXL A;  3K81 C;  4C3J H;  1HZ9 A;  2YTV A;  1VQB A;  2Q2I A;  1TWC H;  3KF8 B;  3CCJ A;  1UE7 A;  5IYB H;  1NMG A;  3KF6 B;  2K5N A;  3CQZ H;  1KRT A;  2ASB A;  1W3S A;  3I4N G;  2QA4 A;  4B3S Q;  2K5V A;  4YWK A;  3OTO Q;  4DUY Q;  4DV0 L;  2VQE L;  3KLW A;  4A4I A;  5GAH C;  3UDI A;  2VQF Q;  1VQ8 A;  1AE2 A;  4IOA A;  3DM3 A;  3BU2 A;  3TQY A;  2YYZ A;  3PF5 A;  3A74 A;  1HR0 L;  2HHH Q;  4GKK Q;  3M4P A;  2N78 A;  2D62 A;  3J80 c;  4A3F G;  2R7Z H;  2I5L X;  3S2H H;  5GAD C;  2AHO B;  1PFS A;  4QJF A;  1QUQ B;  3W5O A;  1Q1E A;  4EX5 A;  4IO9 A;  4OO1 G;  2NVT H;  3J80 i;  2AWN A;  1GD7 A;  4FDB A;  3U4Z A;  4BBR G;  4P71 A;  4RG1 A;  4R1J A;  3PUY A;  1SMX A;  1EIF A;  3UE0 A;  5DLQ E;  1X3G A;  3JAM c;  1K8G A;  5ELO A;  1Q86 C;  2UU9 Q;  3FKI H;  1N34 L;  1E24 A;  4BY1 G;  2MO0 A;  4MZ9 A;  1N36 Q;  1K83 H;  2B63 G;  4IOC A;  5IYD G;  3CXC A;  1IZ6 A;  5J3B A;  4AIM A;  3JAM i;  2CCZ A;  3TS2 A;  2CKZ B;  5C3E H;  1JT8 A;  5FLM H;  4LFC L;  4LFA L;  5IYC H;  5K36 G;  3G6E A;  4XTC S;  3STB C;  1B7Y B;  4JI8 Q;  3PF4 A;  1PVO A;  1BVS A;  3KF6 A;  4A3B G;  3CAM A;  1KRS A;  1KQS A;  1A8V A;  2R93 G;  3KJO A;  2OTJ A;  1IBK L;  3CPW A;  2Q2H A;  4DR7 Q;  3D0F A;  1C9O A;  1N33 L;  1A62 A;  1L1O A;  3GD7 A;  1VQ7 A;  4DR5 L;  4HJ9 A;  4UY8 C;  2L15 A;  1K8A C;  2UXB L;  1CKN B;  4YWL A;  2RHS B;  3FHW A;  1IBM L;  4UP8 A;  4QIW E;  2KHI A;  1Q46 A;  2E5L Q;  1JMC A;  1HNX L;  2UUB L;  3GTL H;  3KFU A;  1GKH A;  4A3G G;  1E22 A;  1VCI A;  1PH5 A;  5IWA L;  3PUZ A;  1EQQ A;  4LF6 L;  4LF5 L;  5LMN L;  2HT1 A;  4TVA B;  1JB7 A;  1X54 A;  4A3K G;  4IPC A;  2IHF A;  4C3I H;  4NXN L;  3NEL A;  3S16 H;  2R7Z G;  1PYB A;  4LFC Q;  5JJK A;  1S40 A;  1HR0 W;  2JA5 H;  1Y14 B;  3PIO A;  1VQO A;  1OXS C;  3KYH C;  4BXX G;  3PUW A;  1PH2 A;  4B3T Q;  1A63 A;  4YY3 L;  1EYG A;  4H02 A;  3OW2 A;  2ATW A;  4R4T A;  4GNX B;  1SFO H;  1OXV A;  2PMZ E;  2N8N A;  1IBL Q;  3FKI G;  1VQJ A;  3RZO H;  3KDF B;  2VW9 A;  2A19 A;  3IRB A;  3RLO A;  4GOP B;  3ERS X;  3T1Y L;  1TWF H;  2YV5 A;  4GOP C;  1I5F A;  4OO1 I;  2F3I A;  2KEN A;  4DR2 L;  3JC6 6;  1L0W A;  5C3E G;  3GTJ H;  4HJ8 A;  4LUO A;  1IBM Q;  1X56 A;  2JE6 I;  4APV A;  2ALY B;  2KBN A;  1HNX Q;  1XNR Q;  1K3R A;  1Q7Y C;  1PH6 A;  4JI1 L;  5AJ3 L;  1YIT A;  2BA0 A;  3PUX A;  4JI5 Q;  2E8G A;  1YVC A;  4LF6 Q;  5LMN Q;  4JI3 L;  2C35 B;  1N8R C;  3I4N H;  2BH8 A;  2UXC L;  4DV6 Q;  5FLX c;  4DV1 L;  2IX0 A;  3S1R H;  4NXN Q;  1SE8 A;  2WAQ E;  3AQQ A;  2ZM6 Q;  2IT1 A;  3FP9 A;  1QVC A;  4YCU A;  2NN6 I;  5HY6 A;  2D0P A;  4YY3 Q;  5C4X G;  1GVP A;  1CKO A;  3PV0 A;  4POG A;  1CKM A;  4DV3 Q;  2R92 H;  2MO1 A;  1FJG L;  1Q1B A;  1WJJ A;  4P74 A;  4X64 L;  4BBR H;  4EQ5 A;  1Q81 C;  1Q12 A;  1W2B A;  3T1Y Q;  2IY5 B;  4B3S L;  5LMU Q;  2UXD Q;  3OTO L;  3CME A;  4DUY L;  4DR2 Q;  3Q8D A;  1TWA H;  1WI5 A;  2E2J H;  1JJG A;  4DAY B;  2B63 H;  4AYB E;  2JA5 G;  2HIV A;  4LNQ A;  2JK8 A;  4JI1 Q;  5AJ3 Q;  2HHH L;  3A5U A;  1V9P A;  1YHQ A;  4GKK L;  2ID0 A;  4DR1 L;  3NBH B;  4JI3 Q;  3EN2 A;  5C44 H;  4AQY L;  4OWW B;  4HIM A;  3UDF A;  3S17 H;  2K52 A;  4A3B H;  4P73 A;  1YHA A;  2Z0S A;  3J7Z C;  2VY3 A;  3M4O H;  1XPR A;  2R93 H;  1WCM H;  2RF4 A;  1QZG A;  4LF4 Q;  1I94 L;  1ASY A; 
#chains in the Genus database with same CATH topology
 2JA7 H;  1O80 A;  3J7A 5;  1LTB D;  4O0A A;  5M3F H;  4GN4 B;  1F9R A;  2JQO A;  2JEB I;  4PV1 C;  1MD2 D;  1IYU A;  2MGS A;  2ZTC A;  3RZO B;  4DA2 A;  1MBY A;  4JBK A;  3GP7 A;  2KCM A;  1ML0 D;  3E0J A;  1XPU A;  1WTH A;  2DGY A;  3NEM A;  4LF9 L;  4AQY Q;  2AKW B;  5C0X G;  1VF7 A;  2UUC Q;  4RHR A;  3X3N A;  4EQO A;  4K14 A;  2PQA A;  2RCF A;  2VS1 A;  1OO9 B;  3BVG A;  1NE3 A;  1XTC D;  2HUG A;  3E5S A;  3MXN B;  3F2U A;  5JJL A;  4GKJ Q;  4JC0 A;  2LY7 A;  1KIX A;  3S14 H;  1JE4 A;  4A3I H;  1CZG A;  1HXY D;  1BCP F;  1UAP A;  3BYT B;  3OWE B;  5CYU A;  4AH6 A;  3RD4 A;  1WCM G;  4DR4 Q;  4RFB A;  1X3E A;  2KHJ A;  2EOT A;  3L9A X;  1IBL L;  2R61 A;  3T53 B;  2L12 A;  2V4D A;  3TEH B;  1U0L A;  1TR5 A;  3QOL A;  2MQH A;  3N6R A;  3ND8 A;  1PRT D;  1CTM A;  2K4K A;  1D8L A;  1A3U A;  1GUG A;  1SSO A;  5C0X J;  1WCM B;  2CH4 A;  2WB1 G;  3AMU A;  1X3Q A;  4MTK A;  1WTW A;  1TY0 A;  1X3F A;  1VQH A;  2PW5 A;  1SNO A;  3OOC A;  5HGQ A;  1W6J A;  4IFD G;  1JOQ A;  2E2D C;  1GO3 E;  1OTC A;  4B3M Q;  4KD4 A;  3TRZ A;  2OWO A;  1HNZ Q;  2AQ1 B;  2WB1 B;  1D5Z C;  3OIQ A;  4ME5 A;  1ET9 A;  3PGZ A;  2PO4 A;  2F4I A;  1PMR A;  2NWG A;  5EJW A;  4BY7 G;  1FNU A;  5IP7 G;  3M85 A;  2NZO A;  3HOV G;  1EY0 A;  1PTO B;  3VDY A;  4DV4 Q;  1QNU A;  3TN2 A;  5E1F A;  5IE8 A;  5M5Y B;  2A6E C;  3AU7 A;  2E2I H;  5ELN A;  2PNH A;  4ALP A;  1TQO A;  4BY7 B;  1KDB A;  4MIU A;  1G51 A;  1GUT A;  5I6Y A;  3HOV B;  4X62 Q;  3VA7 A;  1Q82 C;  3EQL C;  4IFD J;  4KD3 A;  1HZB A;  4LK1 C;  2BA1 A;  5F2D A;  1D7Q A;  3TS0 A;  5KNC A;  3BDO A;  2N49 A;  3H3V H;  3S1Q H;  1CUK A;  4OEL B;  1C4Q A;  1Q8K A;  1Y1V H;  1EY4 A;  5E7N A;  1YEZ A;  4JI6 Q;  5C4X B;  4I7Z C;  1Q3L A;  3PO3 G;  2D5D A;  2UUC L;  3GTG B;  4QF4 A;  2EXZ A;  5COR A;  3A54 A;  4KV6 A;  4IJH A;  3R3O A;  5C4Z A;  4IFD I;  4KI0 A;  1SRU A;  1MGS A;  3TSS A;  2WKC A;  2F0Q A;  2XGT A;  3ND9 A;  2J7Z A;  4IZ8 A;  1M90 C;  1BCP C;  1Y1W H;  3V2T A;  4HJ5 A;  1DGS A;  1O7L A;  3W3A A;  2EY1 A;  4N8X 1;  3CCR A;  3HOZ G;  2B3G A;  4X3U A;  3HKZ E;  4ZYS A;  3FPP A;  2NN6 H;  1SE3 A;  2B29 A;  2JA8 H;  1H95 A;  1HZA A;  3HOX G;  3K57 A;  3F2C A;  3CMA A;  1SN8 A;  1GHJ A;  3AB9 A;  2Z8L A;  1WTX A;  2M9V A;  4J15 A;  1J5E L;  3SK4 A;  4A3M G;  3QIA A;  2L11 A;  3D6W A;  1IL8 A;  2JYO A;  2C9O A;  4L5T A;  1HNW Q;  1U5K A;  3ITP A;  3PQI A;  1TT2 A;  4DUZ L;  1N32 Q;  1Y69 U;  5M5W H;  3DXJ C;  4DAV A;  1HNZ L;  4C3H G;  4A3M B;  1K0S A;  2Z4I A;  4FF2 A;  2GVB A;  3HOY G;  1X55 A;  1SNQ A;  2RDH A;  5KYI A;  1RTO A;  1VQG A;  3M4O B;  2K14 A;  2KJX A;  2NVX B;  2EXD A;  3N52 A;  1HRJ A;  1VQN A;  1I4R A;  5ELC A;  1H9K A;  4QB4 A;  3MEF A;  4PG3 A;  3U9O A;  2F0G A;  1G2T A;  1JQY D;  4A3L G;  3HOY B;  1EY6 A;  4R4C A;  4IAL A;  5KYL A;  2KCT A;  2WII B;  1PH9 A;  4Y52 H;  5IYB G;  4X62 L;  1K73 C;  3HOW B;  1KDA A;  4K2K A;  4OL7 A;  1SJH D;  2Z9H A;  1E1T A;  4A93 G;  2EJG C;  1XNQ L;  1BKB A;  2Z6K A;  4BBS H;  3I56 A;  5A35 A;  2K5H A;  2XN9 C;  3VR2 A;  4JI6 L;  5IIF A;  2EPB A;  2EZV A;  3CRK C;  3GTM H;  1HTP A;  4JYA L;  3TP6 A;  4A93 B;  3SR1 A;  5BR8 L;  4UPA A;  1I4P A;  4PZ7 A;  2F1M A;  2HD3 A;  4GNX C;  4XDX A;  2ZJR A;  1VQC A;  1VQE A;  2X6G A;  3EFX D;  5IGC A;  1EY9 A;  1EIH A;  2UUB Q;  3X3M A;  2H4O A;  5IYC G;  4K0K L;  1CKN A;  5IWA Q;  3I90 A;  4F7X A;  2QEX A;  1MSG A;  2F0L A;  5IOD A;  2ZJQ A;  1OXX K;  4FF1 A;  5C4J B;  4ID6 A;  3H91 A;  1A0I A;  4UP9 A;  1LTI D;  1WD0 A;  2B8F A;  1JC7 A;  1FL0 A;  4S3S A;  4YWM A;  2EJF C;  3QOJ A;  3CP0 A;  1OXT A;  4DNI A;  4K5V A;  4G7O C;  4XQQ A;  4JVZ A;  3S15 B;  1DD2 A;  1UNS A;  5JJI A;  3BVM A;  5EBC A;  4PZ6 A;  1X65 A;  2OT2 A;  4L5S A;  1JJC B;  2WAQ G;  1ESF A;  3GTQ B;  1CFM A;  2EVB A;  3CD6 A;  1D5M C;  4B3R Q;  3RN2 A;  1VQL A;  1HHV A;  2FXQ A;  1SE2 A;  3H0G G;  1GM5 A;  3U58 A;  1QZH A;  1HNW L;  1N32 L;  2UXC Q;  4DNT B;  3KLR A;  1EYA A;  2CQO A;  3HKS A;  4JK1 C;  2N88 A;  3OWF A;  1ZKO A;  1UE5 A;  3AFP A;  5DM6 3;  3L3O C;  2YU9 B;  3D31 A;  1KXL A;  4L8J A;  5IOC A;  1HZ9 A;  1JIC A;  2Y0S B;  4HCS A;  1UE7 A;  3NPP A;  1RD9 D;  3S9W A;  3KF6 B;  1JCK B;  2LFN A;  1W3S A;  3DHQ A;  2ASB A;  3I4N G;  1SYG A;  2QA4 A;  3NK9 A;  4B3S Q;  1DZ1 A;  3OTO Q;  4DGZ A;  4DUY Q;  1F2Y A;  3KLW A;  1I4Q A;  2VQF Q;  2KEE A;  4IN3 A;  1AE2 A;  3MAQ A;  3BU2 A;  2BE5 D;  1ENF A;  4GKK Q;  3J80 c;  2D62 A;  3S2H H;  5GAD C;  1PRT B;  4DAY A;  2NTT A;  2AHO B;  5E3F A;  3I3C A;  1Q1E A;  4OO1 G;  2TSS A;  1GHK A;  1PTO H;  4P71 A;  1YNN D;  3O13 A;  1B1Z A;  2MO0 A;  3P20 A;  2B63 G;  5IYD G;  3CXC A;  1IZ6 A;  4AIM A;  3JAM i;  2CKZ B;  1EWC A;  5EBD A;  1H9M A;  2F0K A;  1B7Y B;  1BVS A;  2F0J A;  3A56 A;  3KUP A;  3SEB A;  3HRZ C;  5NUC A;  3KJO A;  4HR7 B;  2NVY B;  1L1O A;  2PCF B;  2PNR C;  4HJ9 A;  2RSN A;  2K6A A;  3FHW A;  4UP8 A;  2UUB L;  2F3V A;  1JMC A;  1HNX L;  3GTL H;  1VMP A;  1E22 A;  2NZ1 D;  3NE5 B;  1PH5 A;  5JOB A;  5IWA L;  1EQQ A;  5LMN L;  4CDC C;  1ILQ A;  4IPC A;  2IHF A;  4PMC A;  1SXT A;  3IFT A;  4KY6 A;  1VDZ A;  2JA5 H;  1VQO A;  3PIO A;  1OXS C;  3CQZ B;  3M4Y A;  3PUW A;  1A63 A;  4H02 A;  4OEM B;  3OW2 A;  1J9O A;  1STN A;  3KBX A;  1OXV A;  4V19 0;  3FKI G;  1M4V A;  1KLG D;  3T1Y L;  4H0L C;  1I5F A;  4OO1 I;  4XYQ A;  1NUC A;  3SE0 A;  1IBM Q;  1TII D;  1FD7 D;  1Q7Y C;  1YIT A;  2BA0 A;  2K5Q A;  4K2L A;  4A3E B;  1N8R C;  4K8J A;  2C35 B;  5JVG 3;  3VR5 A;  2UXC L;  2K33 A;  4DV6 Q;  2MHV A;  1SE8 A;  2ZM6 Q;  3TDQ A;  4R9W A;  5I6W A;  5FK9 C;  1QVC A;  3BS1 A;  1BR9 A;  1DCZ A;  4H13 C;  2IL8 A;  4X64 L;  1Q12 A;  1W2B A;  1I4H A;  2IY5 B;  4B3S L;  5LMU Q;  5E4X A;  3OTO L;  4DUY L;  2AQ3 B;  2E2J H;  4AYB E;  2HIV A;  3H09 A;  2MP1 A;  1KNA A;  1V9P A;  4GKK L;  4JI3 Q;  4OWW B;  1KNE A;  1RTN A;  4A3B H;  1WTO A;  4P73 A;  2Z0S A;  2R93 H;  3M4O H;  2BOS A;  2F0F A;  4ZUJ A;  1NAP A;  4WOR A;  1I94 L;  1TY2 A;  1IKL A;  4RHS A;  4RKB A;  3LGJ A;  2DY8 A;  2JEA I;  4OXP A;  1B3Q A;  1FJG Q;  1LTA D;  2CQA A;  3CKI B;  4CDE C;  4CDF C;  2B2U C;  1N9W A;  1SFO B;  3EBE A;  5IT9 c;  4A3G H;  1M8A A;  1U4P A;  1SJE D;  3HOW H;  2M2L A;  3C46 A;  3I4M B;  4KTA A;  3EA6 A;  2F0P A;  3BDC A;  1AZQ A;  1KL9 A;  4GN5 A;  4JI4 Q;  1GUO A;  2AUJ D;  2EDG A;  5FO8 B;  3V96 A;  4IJL A;  4YCW A;  3NWS A;  4GN3 B;  1NJI C;  2X6L A;  3S1R B;  3C3L A;  3F2B A;  4OX9 Q;  5JEA G;  3HKZ G;  2JA9 A;  2RCN A;  1X9N A;  1SYC A;  4A3F B;  2F3W A;  2LMC B;  2CWA A;  1RKN A;  4C2M B;  4KMU C;  3HFZ B;  5C44 G;  4LAA A;  2IJ0 A;  4BBR B;  1V43 A;  4OON A;  1AFP A;  3HKZ B;  3K80 C;  1HZC A;  4O1N A;  2A69 D;  4CJ2 C;  1LTT D;  1BQQ T;  4LF9 Q;  3QG1 A;  1Y1W G;  2ES2 A;  1NY4 A;  1IYV A;  1MSH A;  1V1Q A;  4JBJ A;  4PQX A;  5C44 B;  1UWV A;  4X6A H;  2K03 A;  4HAE A;  4RGO S;  4FNF A;  4BS9 A;  4HJ7 A;  2K05 A;  2FIN B;  1NTG A;  3B6Y A;  4DV6 L;  2EY5 A;  5JEA J;  2ZM6 L;  5IP9 H;  3MZ5 A;  2JA8 G;  1EWI A;  3I4O A;  1A2U A;  3STB D;  4R4Q A;  5FLX E;  4A3K B;  1HQR D;  5LMU L;  3GTK H;  4DV7 L;  2B2W A;  4KHP L;  4K6D A;  2YU9 H;  2FFK B;  1W6K A;  3L0O A;  4IUR A;  3LNN A;  3T1H Q;  2OCE A;  2NVQ B;  1NMF A;  1EIY B;  1DYQ A;  1VQD A;  2A1A A;  4KJO A;  3AFQ A;  4BA1 I;  3SHL A;  1TWH B;  1O7Y A;  3FPU B;  3TZD A;  2IHE A;  4LJZ C;  1ZYR D;  2JP1 A;  3NP8 A;  2CHB D;  2EIF A;  4K5W A;  5CV5 A;  5M5X B;  1LT6 D;  4CHT B;  4JCV E;  5GRO A;  2HIX A;  2KCN A;  3K5O A;  4LFB Q;  4JI4 L;  4CJ0 B;  3VYS A;  1H9S B;  2QKI C;  1AN8 A;  1KAA A;  1VQK A;  1V1O A;  1IL2 A;  3ER0 A;  3OYY A;  1ENC A;  2F0W A;  3ONA B;  4FP5 D;  1S5F D;  2QGQ A;  4BBS G;  5IY0 A;  2LXK A;  2BE5 C;  3IFD A;  4QQB X;  3PO2 G;  4Y7N B;  3SVM A;  3I4L A;  5J39 A;  3JAM E;  3BZD B;  3T56 B;  4HIO A;  2F4V Q;  1TXY A;  1YNN C;  2HQL A;  3GTJ B;  4QMG A;  4LF8 Q;  3J7A F;  4RGM A;  3Q6S A;  1YNJ D;  4R8N A;  4DK6 C;  3PO2 B;  2Q8T A;  4HSV A;  5J22 A;  1EOV A;  3ULL A;  1E2Z A;  3E9I A;  1TWG H;  1FR3 A;  2DN8 A;  1M1K C;  1LO5 D;  4TQU S;  3K7U C;  2F0S A;  3FDT A;  4DV2 L;  3NHH A;  3CCS A;  3GTO H;  3A5Z B;  3CF5 A;  1JWU D;  3E6Z X;  2PQE A;  1RDP D;  1IYJ B;  4X3K A;  4A3J H;  3C2P A;  3VYU A;  4KHZ A;  1X6O A;  3LWE A;  5LHY 1;  3J80 L;  4ILW A;  3MEH A;  3OSO A;  2H5X A;  1DOM A;  2Z6K C;  2B2T A;  1KDC A;  2VL6 A;  4MTN A;  4A3E H;  4BA2 I;  1XMO Q;  1WD1 A;  2SEB D;  4F87 A;  5L37 A;  1K0R A;  3CCL A;  1VQA A;  1XTD A;  2A5H A;  4JG2 A;  2DJF C;  1SR3 A;  1MJE A;  1J5E Q;  1GUN A;  2K7V A;  2EYM A;  3KF8 A;  5M9O A;  4I65 A;  3T1H L;  5H1S E;  3PIP 3;  5DM7 3;  2Z6B A;  5JAV A;  3TME A;  2YTX A;  2JA6 G;  3UI2 A;  1V1P A;  1SE4 A;  4FVM A;  4O2D A;  2RDG A;  3T16 A;  3W1B A;  1ICW A;  4WJ4 A;  2A73 B;  5HUR A;  2OTL A;  1S4Z A;  1T9H A;  2CVR A;  5M3M G;  4DUZ Q;  3KLS X;  5K36 G;  5I2X A;  4NDX A;  1AH9 A;  5I9O A;  2HQE A;  1EFI D;  4RCO A;  2Z4H A;  1QUQ A;  1SYE A;  4A3C H;  5C0X I;  1C8C A;  1Z47 A;  4RCN A;  2JA6 B;  1RJT A;  2MUY A;  5EAY A;  3SK5 A;  4G7Z C;  3A8J E;  2BH2 A;  4LFB L;  4GLA C;  1B3A A;  2X69 A;  1SBB B;  2EJM A;  2ZTD A;  1C0A A;  3S1M H;  1YJN A;  2EYF A;  4TKO B;  1ASZ A;  2SDF A;  2XTI A;  3AYH B;  1T5E A;  2OQ0 A;  5I4D A;  1EQR A;  1KLU D;  3I4M H;  3MC0 B;  4Q5V A;  3PUV A;  4XIG S;  5D14 A;  5EKL A;  4DFA A;  4L6T B;  1XWE A;  3ULP A;  1XNQ Q;  3G71 A;  1XJV A;  4LF5 Q;  1YBY A;  2L0C A;  2F4V L;  1EU3 A;  4MNO A;  4DR6 L;  1B8A A;  2B8G A;  4LF8 L;  3NWT A;  4EQP A;  1G6P A;  4JYA Q;  3U9S A;  4A3F H;  4DAM A;  3OW7 A;  1WOC A;  3J81 i;  2QDB A;  4E6I A;  1FVI A;  5BR8 Q;  5A2Q L;  3W2D A;  4C2M H;  1CSQ A;  2PZU A;  1EU4 A;  3CCQ A;  4H7B A;  1BCP B;  4EVO A;  1I4X A;  3TRE A;  3RNU A;  3E3X A;  3KDF A;  4KK7 A;  5FJ8 G;  4BY1 H;  2DUD A;  3S1N H;  3PO3 B;  4K0K Q;  3K7A B;  4OWT B;  1BDO A;  1JJ2 A;  1WTR A;  3V05 A;  3RLF A;  4DN4 M;  2VUM G;  3M3Y B;  4A3D H;  1JOR A;  4ZUI A;  1S5B D;  3MVV A;  5C5L A;  1VF5 C;  3A0J A;  3K6O A;  3HOU H;  1S5E D;  1PYS B;  2F0T A;  3A8I E;  5EKK A;  3IL8 A;  1PH4 A;  4AYB G;  1XMO L;  3U4V A;  2A68 D;  2CW0 D;  3K81 C;  4C3J H;  1I50 B;  2YTV A;  1VQB A;  1TWC H;  3HOZ B;  1KRT A;  2WV6 D;  3HZX A;  5FO7 B;  1BNZ A;  3MWY W;  4NMZ A;  4A4I A;  5GAH C;  2A69 C;  5IT9 L;  5I2Y A;  5KEE A;  2YYZ A;  1L0Y B;  4H44 C;  3HOX B;  3A74 A;  2HHH Q;  3DWQ A;  2N78 A;  2TMP A;  1CM9 A;  2I5L X;  5CV6 A;  1A3T A;  1WTV A;  2AWN A;  2RKS A;  3NBH A;  2OF1 A;  3GTP B;  3PUY A;  2F0N A;  5DLQ E;  1E24 A;  4DF7 A;  2CCZ A;  3TS2 A;  5C3E H;  5KND A;  2D9U A;  4LFC L;  5FLM H;  3RZD B;  2G9D A;  1NCV A;  4XTC S;  3STB C;  1STE A;  4A3B G;  2ICE C;  4C3H B;  2R93 G;  2OTJ A;  3MXG A;  4DR7 Q;  1HFN A;  1SEB D;  1VQ7 A;  4DXG A;  1WTQ A;  2B39 A;  2L4N A;  1Q46 A;  2ENB A;  1VMC A;  3S2D B;  4A3G G;  1VCI A;  5D3I B;  3I70 A;  1K8O A;  3PUZ A;  4LF6 L;  4LF5 L;  3LX0 A;  5CV7 A;  4CKC A;  1X54 A;  2E2H B;  4C3I H;  4NXN L;  3NEL A;  3S16 H;  1G91 A;  2R7Z G;  1PYB A;  2M00 A;  1CHQ D;  5JJK A;  3MXN A;  1ICF B;  1Y14 B;  1B9N A;  5HGT A;  3KK7 A;  3KYH C;  3Q24 A;  4B3T Q;  3DUZ A;  4YY3 L;  1EYG A;  2DNE A;  4GNX B;  1ZYR C;  2PMZ E;  2E74 C;  5JJZ A;  3RZO H;  4GOP B;  4GOP C;  2HCI A;  2R7Z B;  1LT4 D;  1JWS D;  2F3I A;  2KEN A;  2ZXR A;  3GTJ H;  4HJ8 A;  4LUO A;  2ALY B;  2KBN A;  2KEC A;  4QIW B;  1HNX Q;  1XNR Q;  1PH6 A;  4JI5 Q;  3PUX A;  3HEJ A;  5LMN Q;  1LV9 A;  2XNA C;  2P5Z X;  4KY5 A;  2PYK A;  1STH A;  2IX0 A;  1K83 B;  4F88 A;  3VYR A;  3HGB A;  3FP9 A;  1SYB A;  2IW3 A;  5HY6 A;  5E4W C;  3K5L A;  1R9T B;  2WKD A;  3PMF A;  4MN3 A;  4POG A;  4WJW A;  5C0X H;  1EQT A;  1KTK A;  1UUP A;  3CRL C;  5C3W A;  4DV3 Q;  1Q1B A;  3NTH A;  3T1Y Q;  4ZKB B;  2UXD Q;  3Q8D A;  4DXF A;  1QWY A;  4M8A A;  1Z6H A;  1YNJ C;  2JK8 A;  4ZK9 B;  2HHH L;  1J8I A;  3A5U A;  1I3Q B;  1EZ8 A;  2ID0 A;  4DR1 L;  1NR2 A;  2HCC A;  1IKM A;  2K52 A;  1HPC A;  3J7Z C;  1V8Q A;  1XPR A;  1WCM H;  2WAQ B;  4N9T A;  1HUN A;  5BN5 A;  3CCE A;  1QZG A;  4LF4 Q;  3GQB A;  4F8M A;  2XSC A;  1SYD A;  5EQ0 A;  2E76 C;  2L55 A;  3H0G B;  1SAP A;  1XYI A;  4X64 Q;  3MHB A;  3BJU A;  3ZJY C;  2J4X A;  1HQM C;  2EYH A;  3GO5 A;  4UHV A;  3M7N A;  1TWF B;  3CC7 A;  2D0O A;  4DR7 L;  4ME3 A;  4IFD H;  1EQV A;  1EZ6 A;  1SYF A;  1BBX C;  2R92 G;  4BXX H;  1E2V A;  3I4N B;  2EQS A;  2RVL A;  1OXU A;  1I94 Q;  5JPN C;  5M5Y H;  4QUC A;  4JW0 A;  2CFM A;  1STG A;  4BY7 H;  5IP7 H;  1F77 A;  2OQK A;  3HOV H;  3SXH A;  4B3T L;  3K0X A;  2R6G A;  1C7Y A;  1TWA B;  4O42 A;  4YCV A;  2JA7 G;  2B63 B;  2Q2T A;  1FYC A;  5M3F G;  2RDF A;  3ZYY X;  5C4X H;  1XNR L;  1E3P A;  2JXM B;  2R7F A;  4JI5 L;  1CQV A;  3GTG H;  1AEX A;  1CSP A;  1YJ9 A;  1B4O A;  2RA4 A;  4DR3 L;  4N8F A;  2JA7 B;  5IGG A;  5CMD A;  1T5X D;  2A8V A;  1EUJ A;  4LUV A;  1D1I A;  5M3F B;  4POF A;  1BF4 A;  5ELF A;  2G9H D;  4DV3 L;  4DK1 A;  1E0B A;  1YJW A;  3M7G A;  4RH6 A;  3M3Y H;  3J81 E;  4C1N K;  4KKT A;  1XX8 A;  4DPG A;  2UXD L;  4IPG A;  5FKA C;  5BN4 A;  4KKS A;  2AMC B;  3FVQ A;  3QJY A;  4A3I G;  1XMQ Q;  3H94 A;  1P8L A;  1Z9F A;  1PHJ A;  1CQF A;  4PZ8 A;  3IAY A;  2B2Y C;  3G6J B;  1LT3 D;  2KQ3 A;  1I50 H;  1SMY D;  1GJX A;  3FKI B;  1E2W A;  3I73 A;  1TS5 A;  4RGT A;  1D1K A;  2QIL A;  3GV6 A;  4XYO A;  3Q22 A;  1WTP A;  4LF4 L;  1WYD A;  3GV3 A;  1KAB A;  4UAI A;  3S14 B;  2GN5 A;  2F0O A;  2LS0 1;  2ZXO A;  2PW7 A;  3I72 A;  4XXE A;  1RF2 D;  2I46 A;  4CBV A;  1Q90 A;  2NTS A;  4KY7 A;  1LTS D;  1KHI A;  2SOB A;  4DV7 Q;  3GDE A;  4KHP Q;  4A3M H;  4HTH A;  2VNU D;  2A68 C;  2CW0 C;  4XT1 B;  3KOJ A;  2PQA B;  3E9H A;  4XQJ A;  1PTO D;  1YHB A;  2NVX H;  5KRU A;  1PZI D;  1LTG D;  1CK1 A;  2RSO A;  5KNB A;  1D2B A;  1HJP A;  1Y8N B;  4X3S A;  2WP8 J;  1B70 B;  3HOY H;  1SDF A;  2K5D A;  2YTY A;  4LW1 A;  3T51 B;  4KN4 C;  3F1Z A;  4NXM L;  2R7D A;  2B2T C;  5DAU A;  2B2V A;  3D4W A;  1LUZ A;  1F2Z A;  4L63 B;  2AWO A;  1C48 A;  5D65 A;  4LF7 L;  3C1E A;  2K50 A;  2E5L Q;  3CCJ A;  3BZC A;  4OIJ A;  3HG9 A;  1VQM A;  4RKL A;  4DK3 C;  4FYD A;  4YHH L;  3SK6 A;  1Y1V G;  4FXG C;  3CCM A;  4JI0 L;  4A93 H;  2E2I B;  2KCC A;  1R4P B;  3H6M A;  3D3R A;  1SND A;  5KGU A;  3VA5 A;  1SLJ A;  5DNF A;  2XWB B;  1QVG A;  4JBW A;  3H3V C;  4RAU C;  3NUC A;  3RLN A;  3G48 A;  1IXR A;  1PDQ A;  1VQ4 A;  5C4J H;  4IUT A;  2V1C C;  1RL2 A;  3AEV A;  2QW7 A;  4ZKC B;  2IX1 A;  5GAG C;  1XMQ L;  2VB3 X;  3S17 B;  1Y8P B;  1G2S A;  4GLV B;  4UDU C;  1R9T H;  4A3D G;  4DV2 Q;  3RMH A;  4DV0 Q;  2VQE Q;  2NN6 G;  3S15 H;  2AUK A;  1EFW A;  3HOU G;  5ELE A;  3DWP A;  1HR0 Q;  2EY6 A;  1Y1W B;  1L0X B;  3GTQ H;  1U4M A;  1VS0 A;  5CBE E;  4C3J G;  1JE5 A;  1YIJ A;  1MIU A;  3FRP B;  4PMW A;  5BN3 A;  2EYO A;  1EWH A;  1I3Q H;  2Q8R E;  3ULJ A;  1PH1 A;  4JOI A;  1UE6 A;  1GXD C;  1G29 1;  3TZU A;  1N34 Q;  1L2F A;  3PIP A;  2JA8 B;  4DNR B;  2Q2U A;  1ET6 A;  2MJ8 A;  1PH3 A;  3H3V I;  3SDZ A;  1PH8 A;  1CI3 M;  2ZXP A;  3H0G H;  2K01 A;  1KD1 C;  2LSS A;  2FHT A;  4DU9 A;  1G8Z D;  4HMI A;  5IGD A;  4CGY B;  4GZY C;  5FLM G;  1PXU A;  2ZT9 C;  3C1F A;  1B9M A;  1ILP A;  1ENA A;  4A76 A;  2K04 A;  3S24 A;  1KAW A;  1I6H B;  1U4L A;  4HID A;  4JI2 L;  1BBW A;  1EEF D;  1QVF A;  2F0U A;  5CBA E;  1JR0 D;  2VB2 X;  4GLX A;  2E5L L;  2Y0S E;  4OO1 H;  3NEN A;  4B9X A;  4NP5 A;  2AQ2 B;  1FGB D;  2RQX A;  3M4Q A;  2Q8I B;  3KJP A;  2JN4 A;  1LYL A;  1STA A;  1XPO A;  1YNX A;  2NVY H;  5IYD H;  1S5C D;  2HDM A;  3D4R A;  3LWU A;  4BBS B;  2O5I C;  2NUC A;  4M1U B;  3WDN A;  2F0M A;  4WRD A;  5IGB A;  1VQ5 A;  2FMM A;  1PTO F;  4DR6 Q;  1QB5 D;  1O7I A;  3NTI A;  2DY7 A;  5EPK A;  3GTM B;  1QNK A;  4IUN A;  3A55 A;  4LMQ D;  1R4Q B;  1NMG A;  5G3L D;  2K5N A;  3CQZ H;  3R8B A;  4G4K A;  4YWK A;  1DJR D;  4DV0 L;  2VQE L;  3UDI A;  1VQ8 A;  4IOA A;  5CGK A;  3DM3 A;  3OMG A;  2FMC A;  1HR0 L;  3K5N A;  4DK0 A;  3M4P A;  1PZK D;  1EY7 A;  1F2M A;  3W5O A;  4EX5 A;  4IO9 A;  3T4A C;  3J80 i;  1GD7 A;  2A74 C;  4RG1 A;  4R1J A;  1EY8 A;  1K8M A;  1AP0 A;  3UE0 A;  3DMU A;  3VYT A;  1X3G A;  3JAM c;  1B2T A;  5ELO A;  2UU9 Q;  3FKI H;  1N34 L;  1QIL A;  4Z9C B;  5CV9 A;  1STB A;  4MZ9 A;  1PFB A;  1N36 Q;  3TP5 A;  4IOC A;  5J3B A;  4C56 C;  2FJ2 A;  2A6H C;  4ZLT F;  4JI8 Q;  4C1N I;  2B2U A;  1KQS A;  2KUM A;  3HP3 A;  1C9O A;  4UY8 C;  1O78 A;  3ERQ A;  1CKN B;  5C5M A;  3FMC A;  2HDL A;  2KHI A;  5CV4 A;  1GKH A;  1SMY C;  4G7H C;  2BDO A;  2HT1 A;  1JB7 A;  1HA6 A;  5FO9 B;  5EPL A;  1NSN S;  4LFC Q;  1S40 A;  2ICI A;  5M3M B;  3RUZ A;  3NBI A;  5LL6 X;  4BXX G;  1PH2 A;  2J0T D;  4R4T A;  1MI2 A;  1SFO H;  2N8N A;  2VW9 A;  2A19 A;  3IRB A;  3RLO A;  3ERS X;  2YV5 A;  3S2H B;  4DR2 L;  3JC6 6;  1L0W A;  1ONL A;  1A6X A;  1X56 A;  2JE6 I;  4APV A;  5KIX A;  3K0Y A;  1K3R A;  2L1B A;  4JI1 L;  5AJ3 L;  2XWJ B;  4KJN A;  1G6Z A;  4IUQ A;  4B9W A;  2E8G A;  3HS0 C;  1H9R A;  4LF6 Q;  1PTO C;  5JVH 3;  3VR6 A;  2IWH A;  1HTL D;  3URY A;  4NXN Q;  3S1R H;  1EYD A;  4CKE A;  4U67 3;  2IT1 A;  4J1M A;  2SNM A;  4YCU A;  4FXD A;  1WVL A;  5D3D A;  4YY3 Q;  5C4X G;  1CKO A;  3PV0 A;  1CKM A;  1FNW A;  2MO1 A;  2K28 A;  2DJG C;  3OHX C;  4P74 A;  4BBR H;  4FO2 A;  1Q81 C;  1CZW A;  5JEA H;  3CME A;  5DEH A;  4FF4 A;  1WI5 A;  2PZW A;  1UEA B;  4DAY B;  2EYJ A;  2JA5 G;  4ZCK A;  4EQN A;  1DXM A;  1TS3 A;  3GTL B;  4NKL A;  3J81 L;  5C44 H;  4AQY L;  1LLR D;  4B08 A;  4HIM A;  3S17 H;  2Z1C A;  1YHA A;  1GOZ A;  2RF4 A;  1K3B C;  2K1B A;  2UU9 L;  2JA5 B;  1E1O A;  1N36 L;  3L7Z C;  4JV5 Q;  4RA8 A;  4GKJ L;  2VUM B;  1ZEQ X;  4OIK A;  3J7A V;  3I55 A;  4JI8 L;  2L9H A;  4HIK A;  3P75 A;  1PLF A;  4J6H A;  5GAE C;  1L1O B;  2LXJ A;  5IGF A;  3TBI B;  4DR4 L;  1L1O C;  4AYB B;  4A3K H;  4DR1 Q;  1QCB D;  4HSP A;  2EYL A;  4R4I A;  3QO2 A;  3CC2 A;  2KOL A;  3R2I A;  1BBU A;  5JPM C;  2SNS A;  1H9S A;  2E75 C;  4X3T A;  1IW7 D;  2CWP A;  3D6C A;  4U68 A;  1J6Q A;  5G3L F;  2F0D A;  2NVQ H;  3BZK A;  4P2C B;  1A2T A;  4FF3 A;  5J1Z A;  3A7L A;  3BDL A;  4G57 A;  4WJ3 M;  3G4S A;  1TWH H;  4GS3 A;  1RCV D;  2BDN A;  3K58 A;  3Q0A A;  4B3M L;  2E2J B;  2O4X A;  4JI7 Q;  3CW2 C;  3NQI A;  3CCV A;  3CC4 A;  5M5X H;  1I6H H;  2F52 A;  1MKH A;  4X66 Q;  1VQI A;  2N3S A;  4X65 Q;  1E7Z A;  4A3B B;  3EIV A;  2PI2 A;  3W1G A;  5EGT A;  1A3V A;  1UE1 A;  2R93 B;  3HOW G;  1DM0 B;  3DWA A;  4DV4 L;  1SRO A;  1B53 A;  2LKV A;  1F9Q A;  4CKB A;  3T13 A;  1NBW A;  1VQ9 A;  5T1G A;  4Y7N H;  4A3G B;  4ZQ3 A;  1F9P A;  3UE1 A;  3P1H A;  3VR4 A;  4KHV A;  2L5T A;  1PRT F;  4NB3 A;  2VXW A;  1X3P A;  1FGU A;  2NVT B;  4ULL A;  3PO2 H;  1S3O A;  1VQF A;  2PZT A;  4DR3 Q;  2DNC A;  1PV4 A;  2N55 A;  1RIP A;  1LAB A;  4HN7 A;  2KA7 A;  3QB3 A;  4IUV A;  4A75 A;  1D5X C;  1D6E C;  4JV5 L;  3F8T A;  3TP7 A;  4RMF A;  2VZA A;  4BWG B;  3RN5 A;  5LMN W;  2B2V C;  5IP9 G;  3WOF A;  2ZTE A;  2I07 B;  3MA2 B;  4UP7 A;  1JWM D;  3SGI A;  5FLX L;  4PNY A;  3E0E A;  2WFW A;  4DV5 Q;  2PI2 E;  2MNA A;  3L2P A;  1YI2 A;  3VR3 A;  2XRS D;  4NPS A;  4OHJ A;  2KVM A;  1K28 A;  3J80 E;  2UUA Q;  2I0Q A;  4ODG A;  1LM0 A;  2XVS A;  4JBM A;  1TVX A;  4P72 A;  3D4D A;  2Y0S G;  1FNV A;  1I6V C;  1EOT A;  1ZXT A;  3PCO B;  4JPB W;  2F0E A;  5C3X A;  4QGU A;  3GTK B;  4NW2 A;  1P16 A;  4JI7 L;  2JA6 H;  2K75 A;  2R3Z A;  1QE6 A;  4HJA A;  2EY2 A;  2NZH A;  2NBF A;  4L5Q A;  3DEO A;  4X66 L;  2I5H A;  2JJQ A;  4X65 L;  5M3M H;  1K9M C;  5K36 H;  1PZJ D;  3CCU A;  2EYP A;  1SNC A;  1B50 A;  4K8I A;  4XQN A;  2K32 A;  2R92 B;  1F2L A;  1PH7 A;  4NXM Q;  1PRT C;  4K6L A;  4JOI C;  2K5W A;  2WB1 E;  3DLL A;  1U4R A;  4L5R C;  2NB0 A;  3I2Z A;  2B2W C;  1LTL A;  4K5X A;  4LF7 Q;  1GUW A;  2I5M X;  1S72 A;  3EJI A;  1AZP A;  5ELD A;  3MFG A;  4WFN 3;  3JAM L;  3M9B A;  1MHW C;  3K5M A;  4YHH Q;  1QG7 A;  4KLK A;  4JI0 Q;  4V0B A;  4IPH A;  3NQT A;  2QCP X;  1QJO A;  3OMC A;  2IX3 A;  3P7J A;  2IPK D;  4ZAI A;  2RHQ B;  3H15 A;  1EL0 A;  1TKW B;  1ROD A;  3UDG A;  2A6H D;  3WOE A;  5CR3 A;  1KC8 C;  3PO3 H;  3K7A H;  3RR5 A;  3ERO A;  4ZRZ A;  3K59 A;  2EE1 A;  3J81 j;  4RGN A;  3WWV A;  3K8A A;  5A2Q E;  4A3J G;  1CA5 A;  1NNX A;  3I8Z A;  4RWS C;  1IHZ A;  1SNP A;  1NR4 A;  2CH4 W;  5FJ8 H;  4LFA Q;  4R4O A;  1TWG B;  3F2D A;  1Q8I A;  1HA5 A;  4CDD C;  2QEJ C;  1AE3 A;  4CJ1 B;  5K5P A;  4DV5 L;  3OPO A;  3CPF A;  3IKJ A;  1WFQ A;  3HOZ H;  2VUM H;  4IPD A;  4A3E G;  1JB3 A;  1IBK Q;  3GTO B;  4OWX B;  2ZJP A;  1N33 Q;  4A3J B;  4DR5 Q;  1UEB A;  3R2T A;  4A3I B;  3UDX A;  3BVZ A;  1MJC A;  2UUA L;  1O7Z A;  2UXB Q;  4MHE A;  3HOX H;  1PYW D;  1X32 A;  4P75 A;  4B3R L;  1JOO A;  1VQP A;  5T1I A;  3NTK A;  4EGV A;  2XIW A;  1BOS A;  3MXU A;  3GTP H;  3U50 C;  4QY7 A;  3J81 c;  2XRQ D;  3A7A B;  2MFI A;  1H9J A;  4DKA C;  5IT9 E;  1YZ6 A;  3ICE A;  2BCO A;  2QF7 A;  3RZD H;  5GQO A;  4QL5 A;  4A3C G;  1VQ6 A;  4HMJ A;  2A6E D;  4C3H H;  3I7F A;  4GNX A;  2GVA A;  4N9P A;  1BXT A;  2VQF L;  4GOP A;  1PA6 A;  1CA6 A;  3DEP A;  4LUZ A;  3R93 A;  1STY A;  5TSS A;  1BUV T;  3PSI A;  5C4H A;  4DAP A;  5I9P A;  1Y8O B;  3S2D H;  4DV1 Q;  4TRD A;  1IW7 C;  1TS4 A;  1PFM A;  4LWC A;  4JI2 Q;  3I4M G;  1HCZ A;  1HH2 P;  4A3L H;  2E2H H;  4IUP A;  5COY A;  3KF8 B;  2Q2I A;  3S1M B;  2D2C C;  2PPB C;  5IYB H;  2QDL A;  3QR8 A;  4KKU A;  5EPJ A;  3G7L A;  3D8G A;  2WAC A;  3OIP A;  2K5V A;  2F0H A;  2MPM A;  5ISR A;  1V1P B;  3BYY B;  1JOK A;  3CHB D;  3DM1 A;  3TQY A;  3PF5 A;  1LT5 D;  2G5D A;  1BCP D;  3BG3 A;  1DOL A;  4FXK C;  4A3F G;  1DOK A;  3KLS A;  2R7Z H;  4R8I A;  1PFS A;  4OGQ C;  4QJF A;  3S1Q B;  1QUQ B;  3MFY A;  1LAC A;  2NVT H;  4FDB A;  1Y1V B;  3KBG A;  1HUM A;  4YIJ A;  1TS2 A;  2H1E A;  3U4Z A;  4BBR G;  5IGE A;  1EIF A;  1SMX A;  4TSS A;  1B44 D;  2RBM A;  3NXW A;  1K8G A;  1Q86 C;  1QOH A;  4BY1 G;  1K83 H;  2O5J C;  2NYZ D;  1F9S A;  4ABN A;  1JT8 A;  2F0V A;  1GUS A;  4LFA L;  4HED A;  5LL6 S;  5FOB B;  1A15 A;  5IYC H;  1SNM A;  3G6E A;  5EKI A;  3PF4 A;  1PVO A;  1XXG A;  3KF6 A;  3CAM A;  1KRS A;  1A8V A;  2WIN B;  5AFW A;  3I91 A;  1EIG A;  1IBK L;  2OXP A;  3CPW A;  2Q2H A;  3D0F A;  4BY1 B;  1N33 L;  2C5C A;  1A62 A;  3GD7 A;  3S1N B;  4DR5 L;  3MXP A;  2L15 A;  3PIO 3;  1BO0 A;  1K8A C;  3SK8 A;  2UXB L;  4YWL A;  1EEI D;  1AW7 A;  2RHS B;  1IBM L;  4QIW E;  3KFU A;  4A3D B;  4QCL A;  4I7A A;  3HOU B;  1EY5 A;  2F0I A;  1PFN A;  2KHS A;  4TVA B;  3Q23 A;  2OEO A;  4HCE A;  4A3K G;  4Q0F A;  3NSW A;  4C3J B;  1HR0 W;  1TWC B;  5ELB A;  2F03 A;  2ATW A;  3FEW X;  1IBL Q;  5CC4 A;  2GA4 B;  1VQJ A;  3KDF B;  1II3 A;  1TWF H;  1I4G A;  1Z7T A;  3A8K E;  5C3E G;  4QUF A;  3CU7 A;  1RHP A;  5M5W B;  1HFG A;  1YVC A;  4JI3 L;  4J8Q A;  3I4N H;  2BH8 A;  1DON A;  5FLX c;  4DV1 L;  1LTR D;  3TP8 A;  2WAQ E;  3AQQ A;  4XT3 B;  1U9R A;  1CT1 D;  1EYC A;  5C3E B;  3EVQ A;  2NN6 I;  2D0P A;  1GVP A;  4IQZ A;  2R92 H;  1FJG L;  3QWN A;  1WJJ A;  2KED A;  2PMZ B;  4EQ5 A;  3MTS A;  1ESR A;  1TU2 B;  4C3I G;  4KN7 C;  4DR2 Q;  2O2L D;  1TWA H;  1JJG A;  4PMB A;  2B63 H;  3J7Y W;  4LNQ A;  4JI1 Q;  5AJ3 Q;  1YHQ A;  5C6A A;  3NBH B;  3EN2 A;  1CHP D;  2B2Y A;  3UDF A;  2VY3 A;  4IUU A;  2JSO A;  4C3I B;  3S16 B;  4OX9 L;  1S5D D;  1ASY A;  5CV8 A; 
#chains in the Genus database with same CATH homology
 2UU9 L;  2JA7 H;  1E1O A;  1N36 L;  3L7Z C;  3LGJ A;  4O0A A;  5M3F H;  2JEA I;  4GN4 B;  3J7A 5;  4OXP A;  4JV5 Q;  1FJG Q;  4GKJ L;  2JQO A;  2JEB I;  4X64 Q;  1N9W A;  4A3G H;  3EBE A;  5IT9 c;  3BJU A;  3ZJY C;  3I55 A;  4JI8 L;  4HIK A;  2ZTC A;  3GO5 A;  5GAE C;  3HOW H;  3M7N A;  1L1O B;  2LXJ A;  4JBK A;  2KCM A;  4DR4 L;  1L1O C;  3CC7 A;  2D0O A;  4A3K H;  4DR7 L;  1KL9 A;  4ME3 A;  4GN5 A;  4JI4 Q;  4DR1 Q;  1XPU A;  3NEM A;  2DGY A;  4LF9 L;  4AQY Q;  2AKW B;  5C0X G;  4R4I A;  2UUC Q;  3CC2 A;  4IJL A;  4YCW A;  2R92 G;  4BXX H;  4GN3 B;  2EQS A;  1BBU A;  1NJI C;  2PQA A;  2VS1 A;  1OXU A;  3F2B A;  1I94 Q;  5JEA G;  4OX9 Q;  2CWP A;  3HKZ G;  1NE3 A;  1J6Q A;  2NVQ H;  3BZK A;  5M5Y H;  2JA9 A;  2RCN A;  3MXN B;  1X9N A;  5JJL A;  4GKJ Q;  4JC0 A;  2CFM A;  1KIX A;  3S14 H;  2CWA A;  4WJ3 M;  4BY7 H;  4A3I H;  5IP7 H;  3HFZ B;  5C44 G;  3G4S A;  1TWH H;  2OQK A;  2VUM H;  4GS3 A;  3HOV H;  4AH6 A;  4B3M L;  1V43 A;  4B3T L;  1WCM G;  3K0X A;  2R6G A;  4OON A;  4DR4 Q;  1X3E A;  3K80 C;  1HZC A;  2KHJ A;  1C7Y A;  4YCV A;  1IBL L;  2JA7 G;  2Q2T A;  4JI7 Q;  3CW2 C;  4LF9 Q;  5M3F G;  3CCV A;  3CC4 A;  3TEH B;  5M5X H;  1Y1W G;  1U0L A;  2F52 A;  1I6H H;  2ES2 A;  1MKH A;  1NY4 A;  4X66 Q;  1VQI A;  1V1Q A;  2MQH A;  2N3S A;  4JBJ A;  4X65 Q;  5C4X H;  2K4K A;  1UWV A;  1XNR L;  1D8L A;  1E7Z A;  4X6A H;  1E3P A;  2R7F A;  3EIV A;  2PI2 A;  4JI5 L;  3W1G A;  1UE1 A;  5C0X J;  4HJ7 A;  3HOW G;  3GTG H;  2WB1 G;  1CSP A;  1YJ9 A;  4DV4 L;  4DR3 L;  1NTG A;  1SRO A;  3B6Y A;  4DV6 L;  1X3F A;  2A8V A;  1EUJ A;  1VQH A;  4LUV A;  5JEA J;  5IP9 H;  1NBW A;  2ZM6 L;  2JA8 G;  4POF A;  1EWI A;  3I4O A;  5HGQ A;  4IFD G;  1GO3 E;  4BY7 G;  1OTC A;  1VQ9 A;  4Y7N H;  4B3M Q;  3TRZ A;  3UE1 A;  3STB D;  4DV3 L;  2OWO A;  1HNZ Q;  4R4Q A;  1YJW A;  3M3Y H;  4NB3 A;  4DPG A;  5LMU L;  3GTK H;  2UXD L;  4IPG A;  3PGZ A;  4DV7 L;  4KHP L;  2AMC B;  1XMQ Q;  4A3I G;  5IP7 G;  1FGU A;  3M85 A;  1P8L A;  1Z9F A;  2NZO A;  4PZ8 A;  1PHJ A;  3PO2 H;  3HOV G;  1S3O A;  2YU9 H;  3VDY A;  1VQF A;  3L0O A;  4DV4 Q;  1I50 H;  4DR3 Q;  3T1H Q;  1PV4 A;  2OCE A;  1NMF A;  5IE8 A;  1EIY B;  1VQD A;  2A1A A;  4BA1 I;  3AFQ A;  1RIP A;  2E2I H;  5ELN A;  4LF4 L;  1WYD A;  2PNH A;  4ALP A;  2GN5 A;  1G51 A;  4A75 A;  4X62 Q;  4JV5 L;  1Q82 C;  3F8T A;  4IFD J;  1HZB A;  2BA1 A;  1D7Q A;  3F2C A;  3TS0 A;  2IHE A;  4RMF A;  2N49 A;  3H3V H;  2VZA A;  3S1Q H;  1CUK A;  1KHI A;  3RN5 A;  5LMN W;  2EIF A;  4DV7 Q;  1Y1V H;  1Q8K A;  3GDE A;  5IP9 G;  4KHP Q;  4A3M H;  2ZTE A;  4JCV E;  5GRO A;  2VNU D;  5E7N A;  1YEZ A;  4JI6 Q;  2HIX A;  4UP7 A;  4LFB Q;  4JI4 L;  3SGI A;  3KOJ A;  1VQK A;  3E0E A;  3PO3 G;  2WFW A;  4DV5 Q;  2PQA B;  2PI2 E;  2UUC L;  3E9H A;  2MNA A;  3L2P A;  1IL2 A;  3ER0 A;  3OYY A;  1YHB A;  4IJH A;  1YI2 A;  2NVX H;  4IFD I;  4KI0 A;  2QGQ A;  1SRU A;  4NPS A;  4BBS G;  5IY0 A;  1HJP A;  2LXK A;  2XGT A;  2I0Q A;  2UUA Q;  1LM0 A;  4QQB X;  1M90 C;  1Y1W H;  2WP8 J;  3PO2 G;  1B70 B;  3HOY H;  4HJ5 A;  1DGS A;  2YTY A;  4JBM A;  4P72 A;  4LW1 A;  2Y0S G;  3CCR A;  3HOZ G;  3F1Z A;  3PCO B;  2B3G A;  4NXM L;  2R7D A;  4HIO A;  3HKZ E;  2F4V Q;  4QGU A;  1TXY A;  2HQL A;  1LUZ A;  4LF8 Q;  1P16 A;  4JI7 L;  2JA6 H;  1H95 A;  2B29 A;  2K75 A;  2JA8 H;  2AWO A;  4HJA A;  1HZA A;  4DK6 C;  3HOX G;  4LF7 L;  2NZH A;  2K50 A;  1EOV A;  4L5Q A;  3ULL A;  3BZC A;  4X66 L;  2I5H A;  3CMA A;  2JJQ A;  1SN8 A;  3E9I A;  1TWG H;  5M3M H;  4X65 L;  1VQM A;  1K9M C;  1M1K C;  3CCU A;  4DK3 C;  4J15 A;  4YHH L;  1J5E L;  4TQU S;  1Y1V G;  3K7U C;  3CCM A;  4JI0 L;  4A93 H;  4DV2 L;  4A3M G;  3CCS A;  3GTO H;  3A5Z B;  3CF5 A;  1IYJ B;  4A3J H;  1SLJ A;  4L5T A;  4KHZ A;  1PH7 A;  1U5K A;  1HNW Q;  1QVG A;  1X6O A;  4NXM Q;  4JBW A;  4DUZ L;  1N32 Q;  4B3R Q;  4JOI C;  2WB1 E;  5M5W H;  3DLL A;  1HNZ L;  4L5R C;  2H5X A;  3G48 A;  3I2Z A;  2Z6K C;  4MTN A;  3RLN A;  2VL6 A;  4A3E H;  1IXR A;  4BA2 I;  1VQ4 A;  1LTL A;  5C4J H;  1XMO Q;  4LF7 Q;  2I5M X;  1S72 A;  2GVB A;  2V1C C;  1RL2 A;  3AEV A;  3HOY G;  1X55 A;  2IX1 A;  1K0R A;  5GAG C;  1XMQ L;  3CCL A;  1VQA A;  1XTD A;  1VQG A;  4JG2 A;  3M9B A;  1SR3 A;  4GLV B;  1MJE A;  1J5E Q;  4YHH Q;  2K14 A;  4KLK A;  4JI0 Q;  1R9T H;  4A3D G;  2EXD A;  4DV2 Q;  1VQN A;  4IPH A;  4DV0 Q;  3T1H L;  5H1S E;  2NN6 G;  2VQE Q;  3S15 H;  3MEF A;  4PG3 A;  2YTX A;  1EFW A;  3HOU G;  2JA6 G;  1HR0 Q;  4A3L G;  2RHQ B;  4O2D A;  3H15 A;  4OX9 L;  3W1B A;  3GTQ H;  1VS0 A;  4WJ4 A;  4R4C A;  1JE5 A;  3UDG A;  1MIU A;  2KCT A;  1T9H A;  4PMW A;  5M3M G;  4DUZ Q;  1YIJ A;  1PH9 A;  1KC8 C;  2OTL A;  5IYB G;  4X62 L;  1K73 C;  3K7A H;  3RR5 A;  3PO3 H;  1I3Q H;  4Y52 H;  1AH9 A;  3ULJ A;  1PH1 A;  4JOI A;  1UE6 A;  1E1T A;  1G29 1;  1QUQ A;  3J81 j;  4A93 G;  4A3C H;  1XNQ L;  5C0X I;  1N34 Q;  1BKB A;  1L2F A;  1Z47 A;  2Z6K A;  3K8A A;  3WWV A;  3PIP A;  3I56 A;  4BBS H;  2K5H A;  4A3J G;  2Q2U A;  5EAY A;  1PH3 A;  3H3V I;  4JI6 L;  2BH2 A;  5FJ8 H;  4GLA C;  4R4O A;  4LFA Q;  3F2D A;  4LFB L;  2ZTD A;  1PH8 A;  1AE3 A;  3GTM H;  4JYA L;  1C0A A;  4DV5 L;  3CCE A;  3S1M H;  1YJN A;  3H0G H;  3CPF A;  1WFQ A;  1KD1 C;  3HOZ H;  2LSS A;  4IPD A;  5BR8 L;  1ASZ A;  4UPA A;  4A3E G;  2XTI A;  4PZ7 A;  1IBK Q;  3AYH B;  2OQ0 A;  4OWX B;  4GNX C;  2ZJP A;  1N33 Q;  1EQR A;  1UEB A;  1VQC A;  2ZJR A;  1VQE A;  4DR5 Q;  3I4M H;  3UDX A;  2UUA L;  1MJC A;  2UXB Q;  3HOX H;  3PUV A;  5FLM G;  4P75 A;  2UUB Q;  4B3R L;  1VQP A;  4XIG S;  5IYC G;  4K0K L;  1CKN A;  5IWA Q;  1XNQ Q;  3ULP A;  2QEX A;  3G71 A;  1XJV A;  4LF5 Q;  1YBY A;  2ZJQ A;  4A76 A;  1OXX K;  3GTP H;  3U50 C;  2F4V L;  3S24 A;  1KAW A;  4MNO A;  4UP9 A;  1A0I A;  4QY7 A;  3J81 c;  4DR6 L;  1B8A A;  1FL0 A;  4HID A;  4YWM A;  4LF8 L;  2MFI A;  4JI2 L;  1BBW A;  1QVF A;  1G6P A;  4JYA Q;  3CP0 A;  1OXT A;  4A3F H;  4DAM A;  4DKA C;  1WOC A;  3J81 i;  4GLX A;  4DNI A;  1FVI A;  1YZ6 A;  5BR8 Q;  2E5L L;  2Y0S E;  3ICE A;  4C2M H;  1CSQ A;  5GQO A;  3RZD H;  3NEN A;  4QL5 A;  4A3C G;  5JJI A;  1VQ6 A;  4PZ6 A;  1X65 A;  3CCQ A;  4C3H H;  4L5S A;  3M4Q A;  3I7F A;  1JJC B;  2GVA A;  2WAQ G;  3KJP A;  4GNX A;  3CD6 A;  1LYL A;  1XPO A;  3RNU A;  3TRE A;  1YNX A;  2VQF L;  4BY1 H;  3KDF A;  5FJ8 G;  4GOP A;  2NVY H;  1PA6 A;  3RN2 A;  2DUD A;  1VQL A;  3S1N H;  5IYD H;  4LUZ A;  4K0K Q;  2FXQ A;  4OWT B;  3H0G G;  1GM5 A;  1JJ2 A;  3U58 A;  3PSI A;  3RLF A;  1QZH A;  2VUM G;  1HNW L;  4A3D H;  1N32 L;  2UXC Q;  3S2D H;  4DV1 Q;  2CQO A;  3HKS A;  4LWC A;  3A0J A;  4DR6 Q;  3HOU H;  1VQ5 A;  4JI2 Q;  3I4M G;  1PYS B;  4A3L H;  1HH2 P;  1O7I A;  1UE5 A;  3AFP A;  1PH4 A;  2E2H H;  4AYB G;  1XMO L;  3U4V A;  3D31 A;  1KXL A;  3K81 C;  4C3J H;  1HZ9 A;  2YTV A;  1VQB A;  2Q2I A;  1TWC H;  3KF8 B;  3CCJ A;  1UE7 A;  5IYB H;  1NMG A;  3KF6 B;  2K5N A;  3CQZ H;  1KRT A;  2ASB A;  1W3S A;  3I4N G;  2QA4 A;  4B3S Q;  2K5V A;  4YWK A;  3OTO Q;  4DUY Q;  4DV0 L;  2VQE L;  3KLW A;  4A4I A;  5GAH C;  3UDI A;  2VQF Q;  1VQ8 A;  1AE2 A;  4IOA A;  3DM3 A;  3BU2 A;  3TQY A;  2YYZ A;  3PF5 A;  3A74 A;  1HR0 L;  2HHH Q;  4GKK Q;  3M4P A;  2N78 A;  2D62 A;  3J80 c;  4A3F G;  2R7Z H;  2I5L X;  3S2H H;  5GAD C;  2AHO B;  1PFS A;  4QJF A;  1QUQ B;  3W5O A;  1Q1E A;  4EX5 A;  4IO9 A;  4OO1 G;  2NVT H;  3J80 i;  2AWN A;  1GD7 A;  4FDB A;  3U4Z A;  4BBR G;  4P71 A;  4RG1 A;  4R1J A;  3PUY A;  1SMX A;  1EIF A;  3UE0 A;  5DLQ E;  1X3G A;  3JAM c;  1K8G A;  5ELO A;  1Q86 C;  2UU9 Q;  3FKI H;  1N34 L;  1E24 A;  4BY1 G;  2MO0 A;  4MZ9 A;  1N36 Q;  1K83 H;  2B63 G;  4IOC A;  5IYD G;  3CXC A;  1IZ6 A;  5J3B A;  4AIM A;  3JAM i;  2CCZ A;  3TS2 A;  2CKZ B;  5C3E H;  1JT8 A;  5FLM H;  4LFC L;  4LFA L;  5IYC H;  5K36 G;  3G6E A;  4XTC S;  3STB C;  1B7Y B;  4JI8 Q;  3PF4 A;  1PVO A;  1BVS A;  3KF6 A;  4A3B G;  3CAM A;  1KRS A;  1KQS A;  1A8V A;  2R93 G;  3KJO A;  2OTJ A;  1IBK L;  3CPW A;  2Q2H A;  4DR7 Q;  3D0F A;  1C9O A;  1N33 L;  1A62 A;  1L1O A;  3GD7 A;  1VQ7 A;  4DR5 L;  4HJ9 A;  4UY8 C;  2L15 A;  1K8A C;  2UXB L;  1CKN B;  4YWL A;  2RHS B;  3FHW A;  1IBM L;  4UP8 A;  4QIW E;  2KHI A;  1Q46 A;  2E5L Q;  1JMC A;  1HNX L;  2UUB L;  3GTL H;  3KFU A;  1GKH A;  4A3G G;  1E22 A;  1VCI A;  1PH5 A;  5IWA L;  3PUZ A;  1EQQ A;  4LF6 L;  4LF5 L;  5LMN L;  2HT1 A;  4TVA B;  1JB7 A;  1X54 A;  4A3K G;  4IPC A;  2IHF A;  4C3I H;  4NXN L;  3NEL A;  3S16 H;  2R7Z G;  1PYB A;  4LFC Q;  5JJK A;  1S40 A;  1HR0 W;  2JA5 H;  1Y14 B;  3PIO A;  1VQO A;  1OXS C;  3KYH C;  4BXX G;  3PUW A;  1PH2 A;  4B3T Q;  1A63 A;  4YY3 L;  1EYG A;  4H02 A;  3OW2 A;  2ATW A;  4R4T A;  4GNX B;  1SFO H;  1OXV A;  2PMZ E;  2N8N A;  1IBL Q;  3FKI G;  1VQJ A;  3RZO H;  3KDF B;  2VW9 A;  2A19 A;  3IRB A;  3RLO A;  4GOP B;  3ERS X;  3T1Y L;  1TWF H;  2YV5 A;  4GOP C;  1I5F A;  4OO1 I;  2F3I A;  2KEN A;  4DR2 L;  3JC6 6;  1L0W A;  5C3E G;  3GTJ H;  4HJ8 A;  4LUO A;  1IBM Q;  1X56 A;  2JE6 I;  4APV A;  2ALY B;  2KBN A;  1HNX Q;  1XNR Q;  1K3R A;  1Q7Y C;  1PH6 A;  4JI1 L;  5AJ3 L;  1YIT A;  2BA0 A;  3PUX A;  4JI5 Q;  2E8G A;  1YVC A;  4LF6 Q;  5LMN Q;  4JI3 L;  2C35 B;  1N8R C;  3I4N H;  2BH8 A;  2UXC L;  4DV6 Q;  5FLX c;  4DV1 L;  2IX0 A;  3S1R H;  4NXN Q;  1SE8 A;  2WAQ E;  3AQQ A;  2ZM6 Q;  2IT1 A;  3FP9 A;  1QVC A;  4YCU A;  2NN6 I;  5HY6 A;  2D0P A;  4YY3 Q;  5C4X G;  1GVP A;  1CKO A;  3PV0 A;  4POG A;  1CKM A;  4DV3 Q;  2R92 H;  2MO1 A;  1FJG L;  1Q1B A;  1WJJ A;  4P74 A;  4X64 L;  4BBR H;  4EQ5 A;  1Q81 C;  1Q12 A;  1W2B A;  3T1Y Q;  2IY5 B;  4B3S L;  5LMU Q;  2UXD Q;  3OTO L;  3CME A;  4DUY L;  4DR2 Q;  3Q8D A;  1TWA H;  1WI5 A;  2E2J H;  1JJG A;  4DAY B;  2B63 H;  4AYB E;  2JA5 G;  2HIV A;  4LNQ A;  2JK8 A;  4JI1 Q;  5AJ3 Q;  2HHH L;  3A5U A;  1V9P A;  1YHQ A;  4GKK L;  2ID0 A;  4DR1 L;  3NBH B;  4JI3 Q;  3EN2 A;  5C44 H;  4AQY L;  4OWW B;  4HIM A;  3UDF A;  3S17 H;  2K52 A;  4A3B H;  4P73 A;  1YHA A;  2Z0S A;  3J7Z C;  2VY3 A;  3M4O H;  1XPR A;  2R93 H;  1WCM H;  2RF4 A;  1QZG A;  4LF4 Q;  1I94 L;  1ASY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...