4GN4B

Obody am2ep06 bound to hen egg-white lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein/hydrolase
molecule keywords OBody AM2EP06
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 20
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gn4B00
3IRBA 3KF6A 4LF6L 3CCSA 4A3IH 4GNXA 1MJEA 3BZCA 1CSQA 5C4XH 3G4SA 3GD7A 5IYBG 4P72A 4BY7G 3HOWH 5LMNQ 2K50A 4GN5A 3PO2H 2BA0A 1OXXK 3G71A 4A3KG 3PF4A 4C2MH 1A0IA 4A3JH 4KHZA 4UP7A 2JEBI 5EAYA 4NXMQ 3GTQH 5IYDH 2UXDL 1V1QA 1VQGA 3UE1A 3AEVA 3I4MG 4OO1G 4DR5Q 1YVCA 2MO1A 3EN2A 2HQLA 4DR2L 3S15H 3UDGA 1S40A 2PQAB 2EIFA 2CKZB 1FVIA 4DV1Q 1WI5A 4B3SL 2OQKA 4DR4L 1VQ8A 2ZJPA 3S2HH 4YWKA 1QVGA 4LFBQ 1VQEA 5C3EG 1XPRA 3HOUG 1OXSC 4R4QA 4YCUA 4QL5A 5HY6A 1B70B 4A3EG 1JMCA 1JE5A 2UUAQ 4JI5L 4GNXC 1EUJA 2VY3A 4DV4Q 4DV2Q 4HIDA 4JI4Q 2UUBL 1Q12A 1YBYA 1YNXA 2NVXH 4Y52H 1LTLA 3H0GG 3PCOB 3S1QH 2Q2HA 4P74A 3AQQA 3GTMH 3CQZH 4RG1A 5FLMH 5JJKA 2AWNA 4PG3A 4DUYQ 1JB7A 4P75A 3I56A 4LF9Q 1Y1WG 3M7NA 2WB1G 4TVAB 4LFAQ 1PA6A 4DR7Q 5BR8Q 1PFSA 5GROA 1XNRQ 1VQLA 4DV0Q 2VQEQ 1M1KC 3ULJA 3HKSA 1Q1BA 1NY4A 4R4OA 4DR6L 1QUQB 1Q8KA 1TWHH 2HHHL 1NBWA 3CMEA 4HIKA 3T1YQ 2K14A 1IXRA 3CP0A 3M4PA 4POFA 3TS0A 2ZTEA 2EXDA 4J15A 4BY1G 3KJOA 4A3FH 4HJ5A 2NZHA 1E3PA 3PO3G 4MZ9A 1IBML 1VQAA 4JI8Q 4A3CH 1N33L 3AYHB 2V1CC 1EFWA 3VDYA 4JI2L 2JEAI 4A93H 3GO5A 4R1JA 1IBLQ 1XMQL 1VCIA 4BBRG 1HNZL 4YY3Q 1VQ6A 5LMUQ 1OXUA 3D31A 3KFUA 3W1GA 1M90C 2YTVA 5M3FG 1EYGA 1HZBA 1UE5A 2HT1A 2L15A 1SMXA 1C0AA 4B3ML 1Q46A 4LF6Q 4GS3A 4DV1L 4DR3L 2N49A 5JJIA 2IX0A 1BBWA 1MIUA 2JQOA 4LFBL 1GO3E 2PMZE 2E2IH 2UUAL 2JA7H 3NBHB 1Y14B 4DV2L 3S1NH 2BH8A 3CCVA 3HOXG 3UE0A 3CPWA 3KF6B 3CC4A 2VUMG 1MKHA 2LXJA 4GNXB 4DR2Q 1FGUA 3L7ZC 4DUYL 1RIPA 1VQFA 1EIFA 1Z9FA 3U4ZA 1XTDA 2R7ZH 4DR4Q 1X9NA 1X54A 1G6PA 2A8VA 1NE3A 3J80i 1Q86C 3I4NG 3PF5A 3PIPA 4UP8A 2D0OA 4DK3C 3GTPH 3CCEA 5GAGC 4BBSH 2K5NA 2YYZA 2HIXA 3EIVA 2AWOA 4QIWE 2UUBQ 5C44G 2VL6A 2ZJRA 3HKZG 3H15A 4B3TL 1VQKA 1SLJA 4OONA 1A63A 4IPGA 4KI0A 2N8NA 5C0XI 2R92H 2VW9A 1U5KA 1VQIA 1VQOA 4A75A 1CKNA 1J5EL 1K3RA 1KXLA 1JJGA 5IP9H 1AH9A 4JI1L 4A76A 1J6QA 3S14H 4DKAC 4DUZL 4A3DH 1SRUA 5GQOA 2HHHQ 2MQHA 5IYCG 5K36G 2CWAA 1HH2P 3GTOH 1K9MC 4BXXG 4MTNA 4P71A 4JC0A 2A1AA 1VQPA 2UXBQ 1CSPA 4DV7L 3GTLH 4PZ6A 1EWIA 3KYHC 3TS2A 2KHIA 5IYBH 4DAYB 4HIOA 4UPAA 2XGTA 4HJAA 4BY7H 4AYBG 4A3KH 1C7YA 3W1BA 1IBMQ 2NVQH 1D7QA 1QZHA 2EQSA 1N33Q 4GKKL 2IY5B 1KIXA 1VQDA 4JI2Q 3CCUA 4NPSA 2CFMA 3I2ZA 2E2JH 2OCEA 1XMQQ 4LUVA 1PH3A 3I4MH 1HNZQ 2NVTH 3I7FA 2RHQB 1YI2A 1E7ZA 2Y0SE 3G48A 4OX9L 2JA5G 3A5UA 1YEZA 3AFPA 3J81j 2C35B 3ZJYC 3HOYG 4KHPL 4B3MQ 1VQNA 2B63G 1X55A 3F1ZA 4DR3Q 5C3EH 3HOUH 1UE6A 4A3EH 4GN3B 2ATWA 4JI0L 4YWMA 3ICEA 1JT8A 5ELNA 4A3BG 1VQ7A 5AJ3L 3RNUA 1N32L 4JCVE 1KC8C 2AHOB 3JC66 3PUYA 4LUZA 3H0GH 2R6GA 1KAWA 4L5SA 4DAMA 3B6YA 1HR0Q 4GKJL 2F3IA 3S17H 3JAMc 4A3LG 1YHAA 3E9HA 3RZOH 3TEHB 3HOZG 4DV6Q 1Y1WH 2JJQA 4TQUS 4XTCS 2VS1A 1X65A 2Z6KA 2WAQE 2JA6G 2HIVA 3J81i 3PIOA 4PZ8A 2B29A 2KHJA 2IHEA 1I3QH 3CCLA 1I6HH 4GOPA 1PH7A 1SROA 4UY8C 1ASZA 3MEFA 2NN6I 1PH6A 3S2DH 1TWCH 1B7YB 3CPFA 1IBKL 3K81C 4LW1A 3PUXA 2Q2UA 4BY1H 1BKBA 3RLFA 1XNQL 2UXBL 3BU2A 3UDIA 3PO3H 2KBNA 1KL9A 3L2PA 1CUKA 1CKOA 1N34Q 4EQ5A 3MXNB 4B3TQ 4Y7NH 5LMNW 1LYLA 4IFDJ 5FLXc 3KDFA 1B8AA 2IT1A 1HZCA 2ZJQA 2K52A 4B3RQ 1X3GA 2K4KA 4JBWA 1BBUA 2R7DA 1GVPA 5FJ8G 4DV3Q 2LSSA 1UEBA 3FHWA 1PH5A 1J5EQ 4LFCQ 1HZAA 4BBRH 2BA1A 1I50H 4JI1Q 4DR1L 2IHFA 1L0WA 4DPGA 1EIYB 3CC7A 3H3VH 3U50C 4OO1I 4DUZQ 4X66Q 3OW2A 1T9HA 2N78A 2Z6KC 1N9WA 5M3FH 3CD6A 4C3IH 3K0XA 1FL0A 5JEAJ 2FXQA 1YJWA 5C0XJ 1PV4A 4IPHA 4AIMA 4DV7Q 4L5TA 1K0RA 1VQ4A 4GOPC 3F2BA 1YZ6A 1JJCB 1WCMG 4X64L 1CKNB 4BA1I 2PNHA 1XPOA 4KLKA 1YJ9A 4GKKQ 1K83H 1VQMA 3M3YH 1LUZA 1BVSA 1WFQA 3M4QA 4OWWB 4R4TA 2JA8G 2R93G 4DV5Q 3G6EA 3HOXH 1OXVA 4LF5L 1Q82C 2VUMH 1PH8A 2VNUD 1HR0L 4GN4B 4H02A 2E5LL 4PZ7A 4OX9Q 1NMGA 3S1MH 1KQSA 4DV6L 3M4OH 4KHPQ 3D0FA 4HJ8A 3RN5A 1N8RC 1JJ2A 1PH9A 3I4NH 3KF8B 1X3FA 4A3GG 4IFDI 2I5MX 3NEMA 3TQYA 4JI0Q 2UXCQ 1NJIC 1W3SA 2E2HH 2JA9A 4JI7L 5AJ3Q 1DGSA 4LUOA 1N32Q 4L5QA 4YCVA 5C44H 1L1OA 1X56A 1EQQA 3FKIG 1GKHA 1AE2A 2D0PA 4GKJQ 1N34L 4A4IA 3GTGH 3A74A 1IL2A 3J7A5 2YU9H 1KHIA 2GVAA 4GLVB 4B3RL 5GAHC 2QA4A 2ASBA 4IJHA 4LFCL 3RLOA 4DV3L 4O2DA 1TWFH 5IYCH 2QGQA 1TXYA 4BXXH 3T1HL 2K5VA 3F8TA 4X66L 4WJ3M 3W5OA 1Y1VG 1IBKQ 2E8GA 2OWOA 5IT9c 3NELA 5M5WH 4WJ4A 1YHBA 5IP7G 2ZM6Q 3GTJH 1XNQQ 1UE1A 4IOCA 2UU9Q 4JYAQ 4LNQA 3GDEA 1EOVA 2GVBA 1KRSA 3RLNA 2UUCQ 1G51A 1KRTA 1L1OC 1Q7YC 1PH1A 3LGJA 1FJGL 2OQ0A 3K80C 4JI3L 4YHHQ 1VQ5A 2K75A 1Q1EA 2VQFL 1AE3A 4GOPB 5J3BA 4A3MG 4DR1Q 5M3MG 1X3EA 4DV5L 3BJUA 4X65L 1E1OA 3DLLA 1YJNA 2JA5H 2K5HA 2VZAA 2BH2A 3HOYH 3HOVG 1U0LA 2QEXA 4OXPA 2B63H 4MNOA 3PUWA 4YCWA 2I5HA 4IOAA 3KDFB 3J80c 3KOJA 1NTGA 4X64Q 4A3BH 2CWPA 4NXNQ 2UXCL 4LF4L 1SE8A 4QJFA 3RR5A 2ZTDA 3PSIA 1KD1C 4A3IG 2JK8A 3GTKH 4DNIA 3UDFA 2GN5A 4A3LH 5C4XG 4LF5Q 1YITA 3HOZH 3WWVA 4JOIA 3U4VA 3HOWG 2NZOA 2E5LQ 3PO2G 2JA6H 2Y0SG 4JV5Q 3I55A 1XJVA 4A3JG 1VQ9A 3KLWA 1E1TA 5IYDG 1GD7A 4BA2I 1IYJB 2WP8J 1PHJA 4R4IA 3UDXA 3OYYA 5M5XH 1XMOL 2WB1E 2XTIA 1NMFA 2YV5A 4QQBX 2F52A 4HJ7A 2B3GA 2WFWA 3S1RH 4POGA 2NVYH 1WYDA 3TREA 4JI7Q 4LF8L 1QVFA 2IX1A 3EBEA 3CW2C 4OWXB 1W2BA 5M5YH 1YHQA 1HJPA 4JI6L 1VS0A 1UE7A 3K7UC 2ZM6L 3ULPA 5ELOA 2UU9L 4JYAL 5IWAL 3K8AA 1E24A 4K0KQ 2H5XA 4APVA 5FJ8H 3F2DA 4DK6C 4IO9A 1K8AC 2UUCL 5H1SE 4QGUA 2JA8H 2YTXA 1CKMA 1R9TH 2KCMA 1SR3A 2WAQG 2PI2E 4YHHL 4JBKA 4JOIC 1QZGA 2DUDA 1I5FA 3BZKA 3E9IA 3PUZA 3CCMA 1GM5A 1HNWL 3ULLA 1E22A 5FLMG 4LF7L 1N36Q 1L1OB 1WJJA 1RL2A 3T1HQ 2ES2A 3PUVA 3RZDH 2ALYB 2F4VL 3STBC 1TWGH 4IFDG 1C9OA 3CAMA 4AQYL 3OTOQ 1I94Q 1WOCA 4ME3A 4HJ9A 2RF4A 4X62L 1Q81C 1WCMH 2RCNA 1HNXL 4LWCA 4P73A 2I0QA 2N3SA 1Z47A 4JG2A 4C3HH 4HIMA 5JJLA 4ALPA 4QY7A 4PMWA 1EQRA 1FJGQ 1X6OA 4JI3Q 2JE6I 3AFQA 3ERSX 4NXNL 3U58A 2R93H 2PQAA 2VQFQ 4A3FG 4AH6A 1HR0W 2R7FA 5JEAG 1P16A 3STBD 5GADC 5IY0A 5C0XG 2AMCB 5LMNL 4X65Q 5DLQE 1S72A 4A3CG 1MJCA 2PI2A 2MFIA 3SGIA 3J81c 4NXML 4A93G 1A8VA 3S24A 1V43A 2ID0A 2MNAA 1SFOH 4EX5A 2I5LX 4JV5L 4A3GH 1K8GA 2MO0A 4L5RC 1OXTA 3M85A 4DR5L 3PGZA 1OTCA 3F2CA 1L2FA 1VQJA 2AKWB 2Z0SA 2KCTA 4FDBA 3ER0A 4LF4Q 3FKIH 3Q8DA 1G291 3K7AH 2YTYA 1V9PA 1QVCA 3HFZB 4OWTB 3CF5A 1HZ9A 4GLXA 1QUQA 3CCRA 4JBMA 5GAEC 3I4OA 2CCZA 1ASYA 2Q2TA 2DGYA 4DV4L 2UXDQ 4JBJA 2KENA 4JI4L 1A62A 3HKZE 4K0KL 2JA7G 3A5ZB 5C4JH 3KJPA 1VQHA 3L0OA 3J7ZC 3CC2A 2OTJA 5HGQA 1XMOQ 1S3OA 1P8LA 3CMAA 3PV0A 4LF9L 1H95A 4B3SQ 4LFAL 1LM0A 3H3VI 1Y1VH 5BR8L 4DR7L 4NB3A 4LF8Q 1N36L 1XPUA 1XNRL 5E7NA 4DV0L 1SN8A 5IP7H 2RHSB 2VQEL 1IZ6A 2D62A 2R7ZG 2OTLA 3FP9A 4JI6Q 1PYSB 3OTOL 3CCJA 1VQBA 4IPCA 1I94L 4JI5Q 1PVOA 4GLAC 3NENA 3T1YL 5IWAQ 2Q2IA 3RN2A 2ZTCA 4BBSG 1YIJA 1PYBA 2A19A 3M9BA 5IE8A 3E0EA 1PH2A 1TWAH 3CXCA 4A3MH 5M3MH 1VQCA 4RMFA 1D8LA 4AYBE 1O7IA 3DM3A 1HNWQ 3JAMi 3CCQA 4XIGS 4JI8L 1K73C 4LF7Q 2R92G 4UP9A 3HOVH 4DR6Q 4C3JH 4X6AH 4YWLA 2CQOA 1IBLL 2F4VQ 4AQYQ 5IP9G 4R4CA 4O0AA 4YY3L 4X62Q 4IPDA 5LMUL 1HNXQ 3TRZA 4A3DG 2LXKA 4IJLA 1PH4A 3A0JA 1UWVA 2NN6G 3S16H
chains in the Genus database with same CATH superfamily
3KF6A 2Z4HA 4A3IH 1AFPA 1Z6HA 1MJEA 4P72A 4BY7G 2K50A 4GN5A 2EYJA 3PIO3 3G71A 4A3KG 3FDTA 1HRJA 1A0IA 4CJ2C 1PXUA 5IYDH 3UE1A 3SK8A 1VDZA 3X3MA 3S15H 4PQXA 1PDQA 2NWGA 1S40A 1PTOC 3VR5A 1GUGA 1VQ8A 4LFBQ 1QVGA 1VQEA 1XPRA 1OXSC 4A3EG 4QL5A 5CMDA 1QB5D 2UUAQ 5EGTA 1H9SA 1EUJA 4DV4Q 2UUBL 3H0GG 4BBRB 1WD0A 3S1QH 1Q8IA 2AWNA 4P75A 3C46A 3M7NA 1RODA 1PA6A 1PFSA 5GROA 2VQEQ 1Q1BA 1NY4A 4R4OA 2TMPA 1Q8KA 5DNFA 4HMIA 4L6TB 3CMEA 2L4NA 1CQVA 3T1YQ 2XNAC 1IXRA 3CP0A 1K0SA 2WKDA 2ZTEA 4A3FH 4HJ5A 3HOXB 5A2QL 3J80L 1XX8A 2QEJC 2VUMB 3S1NB 3AYHB 1EFWA 2JEAI 2F0HA 4A93H 1VCIA 1HNZL 4K6LA 4IN3A 1U4RA 5EPKA 2R7ZB 5M3FG 1UE5A 1PRTB 2B2TA 2K6AA 4C3IG 2E2HB 4DV1L 1ILPA 3IKJA 3HKZB 5JJIA 5DM73 2IX0A 1BBWA 2JQOA 3T13A 5CR3A 4KK7A 2IX3A 3GTGB 2JA7H 3HP3A 4DXFA 1MHWC 3QR8A 3CCVA 1EEFD 3CC4A 3HZXA 1X3PA 4GNXB 5ELEA 4DUYL 3U4ZA 1EIGA 4KY7A 2A8VA 1NE3A 1Q86C 3I4NG 2CH4W 3PIPA 3ITPA 4UP8A 3GTPH 2L55A 2BDNA 5EQ0A 3T51B 2VL6A 4B3TL 4OONA 1CM9A 2N8NA 1SMYD 2E2JB 2L12A 3A7LA 2FFKB 1S5CD 2HDLA 4UDUC 1VQOA 3VYRA 2B63B 4CGYB 2L0CA 4A76A 1J6QA 3S14H 4K2LA 5D3IB 4OEMB 4MTNA 2UXBQ 2MP1A 4DV7L 5FO7B 1EY7A 3J81L 1M8AA 3TS2A 4RFBA 4BY7H 3I90A 4C1NI 2RQXA 4A3KH 3VYUA 3W1BA 2NVQH 1QZHA 5T1GA 3D6CA 2CW0D 4GKKL 1KDBA 2JA6B 3GP7A 3CCUA 4EGVA 4IUPA 1OO9B 3I7FA 2NVTH 3G48A 2JA5G 3A5UA 1YEZA 4HCSA 3ZJYC 3HOYG 3S1RB 1I3QB 4KKUA 1I6HB 2K05A 1NNXA 4ZUIA 3R93A 4A3EH 4GN3B 2CQAA 4JI0L 4DN4M 4NKLA 3CHBD 5I6YA 1PMRA 4V190 3FPUB 2KEEA 3E6ZX 3Q22A 2JA8B 2AQ3B 2K28A 3PUYA 3H0GH 1R9TB 2R6GA 3BVZA 3B6YA 3UI2A 4GKJL 1YHAA 1I4RA 4RA8A 4DV6Q 3CKIB 3VR6A 4XTCS 1QNKA 1X65A 1GUNA 4XXEA 2B29A 1CZWA 1PH7A 4R9WA 3NTKA 3S2DH 1K8OA 1Q3LA 3CPFA 3BVGA 1JWUD 4FF4A 3UDIA 3DUZA 1N34Q 1GUSA 4EQ5A 3MXNB 1B8AA 2K52A 4B3RQ 1X3GA 4JBWA 1HUNA 2R7DA 3W3AA 1PH5A 3TMEA 1UEBA 4DR1L 2G9HD 1EIYB 4RH6A 4A3GB 4ILWA 3OW2A 5M3FH 4C3IH 4NP5A 2J0TD 1ZKOA 2FXQA 2JN4A 1A3TA 3FKIB 1VQ4A 1JJCB 4DU9A 1LT6D 1VQMA 3M3YH 5G3LD 3M4QA 4OWWB 4R4TA 1GJXA 4Q5VA 4KN7C 3DXJC 1VF7A 1PRTF 1PH8A 2VNUD 4DK0A 4H02A 1HR0L 4OX9Q 4PZ7A 2A5HA 3SHLA 3D0FA 2KOLA 1BQQT 1SNPA 3I4NH 4WORA 1Z7TA 2ICEC 2F0QA 2XIWA 5CYUA 1NJIC 4XQJA 2JA9A 4LUOA 1N32Q 4L5QA 1F2MA 2F0JA 4YCVA 1X56A 2OT2A 5LL6X 1EQQA 1WTPA 3D3RA 1AE2A 2B2UA 3OWFA 3A74A 2FMCA 1IL2A 3J7A5 1DXMA 4C56C 5A35A 2RA4A 1JWSD 4O2DA 1DCZA 1ZYRD 4KMUC 2XRSD 2F0NA 1TXYA 3NQIA 4KN4C 1XTCD 2CW0C 4X66L 3HGBA 1Y1VG 4WJ4A 1JCKB 3NELA 4G4KA 5M5WH 1YHBA 1XNQQ 2Z6BA 4LNQA 3GDEA 1EOVA 2GVBA 5FK9C 2XN9C 1CHPD 1B3QA 1STBA 3LGJA 3HOZB 3D4WA 1SXTA 1Q1EA 4GOPB 1X3EA 5C3XA 3DLLA 2JA5H 1GUWA 2VZAA 4ZCKA 3HOYH 4K5VA 2VXWA 4C3JG 5NUCA 3BDLA 2I5HA 2QDBA 2PCFB 3KOJA 1RDPD 3KBGA 2ZTDA 1KD1C 1F9SA 2A6HD 1S5DD 2HD3A 3EQLC 4UAIA 3GTKH 2WAQB 2P5ZX 2GN5A 5C4XG 4S3SA 4LF5Q 1YITA 5AFWA 3GTMB 1PFMA 3U4VA 1O7ZA 3HOWG 2KQ3A 3PO2G 3LWEA 4A3JG 1AZPA 4O42A 1EY6A 1GD7A 3NPPA 1AP0A 2WP8J 4CJ1B 5M5XH 3MA2B 1TWHB 4JK1C 3GV6A 3FVQA 1NMFA 1ESFA 4HJ7A 1NAPA 1WCMB 2A69D 1ONLA 1WYDA 4MN3A 3TREA 3U9OA 2IX1A 4JI6L 5IGCA 3D4DA 3L3OC 5ELOA 4K0KQ 2UUCL 3F2DA 1RF2D 4RCNA 2PI2E 2DUDA 3BZKA 3PUZA 3E9IA 5BN4A 3CCMA 4LF7L 4FXKC 4TRDA 3PUVA 1YNNC 3RZDH 3STBC 4IFDG 1BCPD 1B1ZA 2RF4A 3G6JB 4HJ9A 1Q81C 2KJXA 2RCNA 4P73A 2L9HA 3P1HA 2RSOA 3QJYA 4XDXA 5C4HA 2JE6I 3S9WA 2VQFQ 1F9QA 2VB3X 2R7FA 4ME5A 5JEAG 1P16A 5GADC 5IY0A 5C0XG 2AMCB 4J8QA 4X65Q 5C5LA 5DLQE 3NK9A 3PIP3 3OIPA 5ELFA 2ICIA 3S24A 1OXTA 3LWUA 3M4YA 3M85A 1L2FA 2AKWB 4G7HC 4FDBA 1KDAA 1WTRA 1ZYRC 3HEJA 3CF5A 2Z8LA 3CCRA 1HA5A 3I4OA 2Q2TA 4DV4L 4U68A 5HURA 2G5DA 4RHRA 5C4JH 3CC2A 4IUUA 4CDDC 1D6EC 2OTJA 3OSOA 1S3OA 4A3DB 1ICWA 3WOEA 1Y1VH 4IALA 1STEA 5ISRA 1XPUA 1SN8A 2VQEL 1IZ6A 2QW7A 3EROA 2R7ZG 2A6EC 2OTLA 3WOFA 3A55A 2N88A 3ZYYX 4DFAA 3CCJA 1VQBA 2Q8IB 4MHEA 1EZ6A 2LKVA 3FRPB 3T1YL 1EOTA 2Q2IA 3BYTB 3RN2A 2EZVA 4DGZA 1PYBA 1U4MA 3M9BA 3E0EA 4RMFA 1TQOA 1O7IA 3DM3A 3OIQA 2F03A 1HNWQ 3JAMi 2QDLA 3CCQA 2R92G 4UP9A 4ZKBB 1U9RA 4DR6Q 4C3JH 3NHHA 4PNYA 4CKEA 4YWLA 2F4VQ 5IP9G 4R4CA 1E2VA 5C3EB 1CHQD 3HOUB 3E3XA 2NN6G 2E74C 4DAVA 3ERQA 1EQTA 2ZT9C 3S16H 2KEDA 4GNXA 3BZCA 5C5MA 5C4XH 3G4SA 3HOWH 2Z4IA 3PO2H 3RZOB 5J39A 2AQ1B 3IAYA 4A3JH 4UP7A 1SAPA 2E2DC 2JEBI 1DOKA 3GTQH 4CDFC 4XQQA 4R8NA 4OO1G 1YVCA 2MO1A 3EN2A 1FVIA 2PW5A 2B8GA 3C2PA 2ZJPA 4YCUA 4Y7NB 2L1BA 4JI5L 4HIDA 4WRDA 5JOBA 4DV2Q 4JI4Q 1YBYA 1BCPC 1YNXA 2NVXH 1PTOD 3T4AC 1I50B 5IT9L 1C8CA 3AQQA 5JJKA 4LF9Q 1Y1WG 2WB1G 1STAA 4IFDH 1NSNS 1VQLA 3ULJA 1SYGA 3DWAA 5FLXE 4HIKA 4CKCA 3M4PA 3P7JA 4FXGC 3NBIA 1K83B 2EXDA 4J15A 4IUQA 4KKSA 4K14A 1E3PA 5JEAH 3PO3G 4CDEC 4MZ9A 4EQNA 5C0XH 3PMFA 1D1IA 3S1MB 2LFNA 4HTHA 4FP5D 4R1JA 2NYZD 2PZWA 1IBLQ 4YY3Q 5LMUQ 2DNEA 1BBXC 1UUPA 2HT1A 4G7OC 4LF6Q 2N49A 4N8X1 1A3UA 2PMZE 3K0YA 1PTOB 1CT1D 1XXGA 1Y14B 2X69A 4PV1C 3S1NH 2BH8A 4X3SA 3SK6A 3UE0A 4OGQC 1TWFB 3SVMA 3MZ5A 1MKHA 4DR2Q 3MXNA 1RIPA 1ZEQX 1K3BC 5EPJA 1XTDA 3K59A 2R7ZH 4DR4Q 1X9NA 5FLXL 1ET6A 4IQZA 3PF5A 1VF5C 4AYBB 1EZ8A 3CCEA 4FXDA 5COYA 2YYZA 3H3VC 2HIXA 2FJ2A 3EIVA 4QIWE 4X3KA 4WFN3 2ZJRA 3H15A 1VQKA 1SLJA 3MAQA 4IPGA 4KI0A 1IL8A 2J4XA 2R92H 3DM1A 1QE6A 3DMUA 4QB4A 1K3RA 5IP9H 1AH9A 1A6XA 2E75C 1CTMA 1SRUA 2PZUA 5GQOA 4ZKCB 5IYCG 2NN6H 3GTOH 4A3BB 4P71A 1VQPA 2A1AA 2Q8TA 5C6AA 1GUOA 5I9PA 2EYHA 4JVZA 3GTLH 5K5PA 1G6ZA 3HG9A 2XGTA 2A68C 1IBMQ 1D7QA 3J7AF 4K6DA 4JI2Q 2E2JH 2B39A 2OCEA 1I6VC 4H0LC 5A2QE 3J80E 1B4OA 4LUVA 2B2WA 4OO1H 1C48A 3M7GA 3NTHA 2C5CA 1RHPA 4ZQ3A 4OX9L 2TSSA 3NWSA 2PYKA 4B3MQ 3GQBA 4DR3Q 1RD9D 2Z1CA 3K58A 4F7XA 1IW7C 2ATWA 2IL8A 3ICEA 1JT8A 1HA6A 3QO2A 1B3AA 5TSSA 1N32L 2KCNA 5EKIA 1KAWA 1RTOA 2HCIA 1O7YA 3S17H 4A3LG 3HOZG 1Y1WH 4TQUS 2Z6KA 2HIVA 2NTTA 3C1FA 1G8ZD 2KHJA 1MI2A 1I3QH 3E5SA 1I6HH 1S4ZA 5IGDA 4GOPA 4LJZC 1IHZA 1TWCH 3ONAB 3NUCA 2Q2UA 3NXWA 1XWEA 4XQNA 3IFDA 1XNQL 3BU2A 3PO3H 4ZLTF 2KBNA 1CUKA 1LYLA 5FLXc 1SJED 4KJNA 1HZCA 2ZJQA 1B53A 3MVVA 4DV3Q 2EPBA 3FHWA 4KJOA 3A7AB 2BA1A 1SFOB 1ML0D 1DYQA 3KLRA 1EWHA 3U50C 3I72A 1T9HA 3E0JA 3RMHA 1QWYA 4K5WA 3K0XA 2GA4B 4IPHA 1K0RA 3BDOA 3K7AB 3F2BA 1MD2D 1WCMG 4RGTA 5C44B 1D1KA 1TVXA 4KLKA 4C3HG 5EPLA 3J81E 1BVSA 3DWQA 1LT5D 4LF5L 4I65A 3BS1A 4N9PA 1AEXA 3M4OH 1JJ2A 2O5JC 1DOMA 1EY8A 1H9MA 4LK1C 3NEMA 1JB3A 3TQYA 2UXCQ 3N6RA 4QUCA 3VR2A 1WVLA 4HAEA 1LTRD 1UNSA 1ENFA 2HQEA 2F4IA 4L63B 5BN5A 1IYVA 1JOOA 2YU9H 2GVAA 3MFYA 4RGOS 5CV6A 2QA4A 4LFCL 1F2YA 5IYCH 1EEID 3KBXA 2K5VA 3F8TA 2MUYA 2ZM6Q 1QJOA 1V1PB 4B08A 4A3IB 3GTJH 1STGA 3IFTA 1JOKA 2UU9Q 3DHQA 1PZJD 1G51A 1KRTA 1A3VA 1L1OC 2K5WA 2HCCA 2PW7A 3P75A 1VQ5A 2EJFC 2VQFL 5J3BA 4A3MG 5M3MG 5KNDA 1SEBD 4DV5L 4X65L 2RDGA 2F3VA 4F88A 4RGNA 3NBHA 4IOAA 3J80c 2PZTA 1KDCA 1NTGA 3C3LA 5IOCA 1EYDA 4WJWA 5IGGA 2JK8A 1BUVT 3UDFA 4QF4A 4A3LH 3S1QB 3J7AV 3HOZH 1F2LA 3WWVA 4JOIA 3R8BA 2E5LQ 3MHBA 2Y0SG 4JV5Q 1XJVA 1E0BA 2DN8A 3A8KE 5I6WA 2AUKA 1IYJB 2OXPA 4R4IA 5C4ZA 3OYYA 2F1MA 3EFXD 2WB1E 3I70A 2YV5A 2NVYH 4JI7Q 1QVFA 3EBEA 4OWXB 3BG3A 1TS4A 5M5YH 2ZXPA 1RCVD 4A3FB 3K7UC 3ULPA 4MTKA 1RJTA 3K6OA 2R93B 4O1NA 4JYAL 1E24A 1B44D 4APVA 4DK6C 4IO9A 1WTWA 1K8AC 5H1SE 2ENBA 4A93B 3D6WA 4YHHL 2B2VC 1JOQA 1I5FA 4ZUJA 1HNWL 1BDOA 4M1UB 5FLMG 1N36Q 1SSOA 1WJJA 1ICFB 4EQPA 4OHJA 2F4VL 3MXGA 1C9OA 3OTOQ 5KYLA 1WCMH 2K5DA 4C3HH 4HIMA 1K28A 2FMMA 1HUMA 1FJGQ 1X6OA 4JI3Q 1SBBB 4NXNL 2JA7B 3Q23A 1YNND 3STBD 3NWTA 5DEHA 1PZID 1S72A 1MJCA 2OEOA 5F2DA 3J81c 5DAUA 4CHTB 1A8VA 1H9RA 1V43A 1HHVA 4EX5A 5EBDA 2MO0A 3PGZA 3GTPB 2Z0SA 3JAML 3ER0A 4IURA 3TP8A 3Q8DA 1G291 2R3ZA 2QKIC 4R8IA 2K7VA 3HFZB 1HZ9A 5GAEC 5KRUA 2CCZA 2F0DA 2KENA 4JI4L 1A62A 3NP8A 2XWJB 1G91A 1M4VA 5CBAE 3KJPA 1VQHA 3S14B 3PV0A 4LF9L 1GOZA 3MXPA 3H3VI 4DF7A 1B50A 2RSNA 1DZ1A 2RHSB 2BDOA 1DOLA 3FP9A 1EY4A 1ET9A 1GUTA 1I94L 4BY7B 4NW2A 3I4LA 3NENA 5IWAQ 2NVQB 2ZTCA 1JR0D 2A19A 1TWAH 3NE5B 4C2MB 3T53B 4A3MH 5M3MH 2JP1A 2NVTB 2A6ED 4NMZA 4X6AH 4RAUC 1QNUA 1IBLL 3P20A 4O0AA 2IW3A 4YY3L 4ID6A 5LMUL 3LX0A 4A3EB 3K5OA 4KKTA 4KV6A 2MPMA 1SNCA 4E6IA 2ZXRA 4LF6L 3KF8A 1CSQA 3H0GB 3MXUA 2B2YC 5LMNQ 1GHKA 2BA0A 3T16A 1J9OA 3CU7A 4KHZA 3CQZB 3K5NA 3Q24A 1SJHD 5IODA 1QOHA 2F0PA 2UXDL 1V1QA 4G7ZC 3I4MG 2F0KA 1BR9A 4DR5Q 2HQLA 5JAVA 4DR2L 3UDGA 1SNQA 2PQAB 3S2DB 4DV1Q 4QMGA 4B3SL 2OQKA 2MJ8A 4DR4L 2QILA 3S2HH 1NUCA 4R4QA 1B70B 3NTIA 1AZQA 1DM0B 2SNMA 5EBCA 1JE5A 4DK1A 2XSCA 3QB3A 4F8MA 3A8IE 3OPOA 1Q12A 4H7BA 1LTLA 4P74A 3AMUA 5FLMH 1I4HA 4DUYQ 1JB7A 3I56A 4FF2A 4LFAQ 5BR8Q 4C3IB 3K5LA 4DV0Q 1M1KC 3HKSA 2D5DA 1MGSA 1NBWA 2Q8RE 3VR3A 2KCCA 1AW7A 3M3YB 4FNFA 3KJOA 1SE3A 2PNRC 3EJIA 1DJRD 1EU4A 5LL6S 4HN7A 1IBML 1VQAA 5CGKA 3I3CA 3VDYA 4JI2L 4IUTA 4FYDA 4BBRG 4ZYSA 1HCZA 1VQ6A 4FVMA 2JXMB 4JPBW 3W1GA 1HZBA 2L15A 1C0AA 4B3ML 2HUGA 4DR3L 4BBSB 2E76C 1MIUA 4LFBL 2F0OA 2E2IH 2UUAL 2F0GA 3NBHB 3L9AX 2PQEA 2DNCA 3CRKC 3HOXG 1BO0A 3Q0AA 1TS5A 5IGEA 1EQVA 2VUMG 2EYPA 4DNTB 1VQFA 1BCPB 5M5WB 1X54A 4LAAA 4OIKA 2XWBB 2B2TC 5D14A 1ENCA 2K5NA 2XRQD 1SYCA 5C44G 3HKZG 1A63A 1LTAD 3H91A 2EXZA 3TP7A 5C0XI 2O5IC 1F9PA 1HTPA 1NR4A 3HOYB 5IT9E 3VA7A 4A75A 5M9OA 1MBYA 1JJGA 4DKAC 3SK5A 4UHVA 5G3LF 2NZ1D 2HHHQ 2MQHA 3AB9A 4NDXA 2CWAA 1HH2P 4BXXG 4IUNA 1K9MC 1I4XA 3V05A 4X3UA 3DWPA 1Y69U 3GTKB 1EWIA 3KYHC 4HJAA 1JORA 4DAYB 1SYDA 1C7YA 2FINB 1NR2A 1N33Q 1V8QA 5E1FA 1VQDA 4NPSA 1XMQQ 1PH3A 2R61A 3I4MH 2EYMA 3EVQA 5M5XB 1HQRD 1YI2A 2IJ0A 1E7ZA 2OF1A 2Y0SE 5FKAC 1X32A 5ELBA 3J81j 2I07B 5D65A 3K57A 2A68D 1VQNA 2B63G 1X55A 3RD4A 2F0TA 1UE6A 1B2TA 4BY1B 1F2ZA 5ELNA 1L0YB 1VQ7A 1TY0A 4RGMA 1F9RA 4JCVE 2EYFA 3OW7A 1KC8C 1LT4D 2B2VA 2EVBA 5EKLA 4L5SA 1W6JA 1HR0Q 2F3IA 1V1PA 1BXTA 2JJQA 2VS1A 1IW7D 2JA6G 1UEAB 1CI3M 3RZDB 1A2TA 4PZ8A 1GHJA 2MHVA 3MEHA 3R3OA 5HGTA 1SROA 1ASZA 3MEFA 2NN6I 1B7YB 2IWHA 3K81C 3AU7A 4LW1A 5JVH3 3PUXA 1CZGA 3GV3A 2UXBL 1LTBD 4RKLA 2ZXOA 1CKOA 4I7AA 5LMNW 1O7LA 1ZXTA 2IT1A 2JYOA 1CA5A 1BBUA 1GVPA 2JA8G 1J5EQ 1HZAA 4DNRB 4BBRH 4JI1Q 4ULLA 1L0WA 4X3TA 1YNJD 4OO1I 1SNMA 4DUZQ 4X66Q 1EY9A 4IUVA 1N9WA 2PMZB 3SR1A 4AIMA 4L5TA 4FO2A 2RVLA 1YZ6A 3T56B 1CKNB 1TS2A 1PZKD 1YJ9A 2LS01 2R93G 4L8JA 3DEOA 4HEDA 3O13A 3HOXH 3G6EA 5C4JB 4K5XA 1Q82C 2VUMH 3K5MA 2E5LL 1NMGA 1KQSA 4CDCC 4DV6L 4KHPQ 4HJ8A 3RN5A 1N8RC 3KF8B 5BN3A 4A3GG 4QIWB 2I5MX 2F0LA 3WDNA 2Z9HA 1W3SA 3KLSA 2E2HH 4JI7L 5AJ3Q 1DGSA 1SE2A 2F0IA 5C44H 4I7ZC 3V96A 3FKIG 2B8FA 1A15A 1GKHA 2D0PA 1BCPF 1N34L 4A4IA 1FGBD 3GTGH 3CRLC 2DJFC 2LMCB 4C3JB 1IKLA 4B3RL 5GAHC 4OIJA 3RLOA 1R4PB 1HPCA 2QGQA 4BXXH 4WJ3M 1UAPA 4KTAA 3W5OA 1IBKQ 2E8GA 3S16B 5IT9c 3TBIB 4QUFA 5IP7G 3MC0B 4IOCA 3H6MA 5C4XB 2B2YA 3KLSX 1TY2A 4H13C 1KRSA 4KD4A 3RLNA 2UUCQ 3HOWB 3PO2B 5FO8B 1FJGL 3N52A 2OQ0A 3K80C 4JI3L 4A3JB 4KY6A 1AE3A 2B2UC 3GTQB 2O4XA 3FPPA 2K5HA 3OMCA 1DONA 4OXPA 2B63H 1QILA 3PUWA 2JSOA 4YCWA 3VR4A 5I4DA 3KDFB 3J7YW 2D9UA 2KHSA 4CJ0B 5DM63 1CFMA 4X64Q 1WD1A 2CWPA 1SE8A 4QJFA 2QF7A 3RR5A 3PSIA 4DNIA 1EYAA 5CV8A 2NVXB 3NSWA 2K04A 2LY7A 2NZOA 2WKCA 4HMJA 2J7ZA 2JA6H 3I55A 1VQ9A 3KLWA 1E1TA 2N55A 2D2CC 2NTSA 1PHJA 3MTSA 2AUJD 1TWGB 1ILQA 1C4QA 4QQBX 2B3GA 2WFWA 4PMBA 3S1RH 4POGA 3CW2C 4EVOA 1W2BA 1PRTD 1YNJC 3SK4A 1VS0A 1UE7A 4K2KA 1RTNA 2EJGC 5JJZA 5IWAL 3BYYB 2H5XA 1W6KA 2JA8H 2QCPX 5CV7A 1R9TH 2KCMA 1SR3A 2WAQG 4JBKA 1QZGA 1GM5A 5FO9B 1L1OB 2F0UA 1RL2A 3T1HQ 4ME3A 1A2UA 1S5ED 2L5TA 1HXYD 4LWCA 2I0QA 1EY0A 1Z47A 2N3SA 2AQ2B 5JJLA 4QY7A 4PMWA 1EQRA 3ERSX 2R93H 2PQAA 3VA5A 1TR5A 1HR0W 5LMNL 3U9SA 3HS0C 3R2TA 1D5XC 3H09A 3QWNA 4A3CG 3PQIA 2PI2A 5I2XA 2MFIA 2MNAA 4A3GH 1K8GA 2CHBD 4L5RC 3C1EA 4DR5L 1OTCA 5IIFA 3F2CA 1ESRA 1PTOF 5T1IA 1D2BA 4HCEA 2BE5C 4DAPA 4LF4Q 2K1BA 3SEBA 3SDZA 3FKIH 1EY5A 1V9PA 1O78A 2R92B 4G57A 2DGYA 2L11A 3HKZE 4K0KL 3A5ZB 3HOVB 1WTVA 1PYWD 3L0OA 3J7ZC 5HGQA 1XMOQ 4M8AA 4XYQA 4LFAL 3TZUA 1LM0A 5BR8L 1BNZA 3GTOB 4NB3A 4LF8Q 2EJMA 4DV0L 5IP7H 1I4PA 3GTLB 4GZYC 4BWGB 4IPCA 1PVOA 4JI5Q 5CC4A 4Q0FA 3TP6A 3F2UA 4BBSG 2EY5A 1YIJA 3QOJA 5IE8A 5LHY1 1QG7A 4DA2A 1PH2A 4B9XA 5KNCA 1B9NA 1D8LA 1PLFA 2M00A 4K8IA 5J22A 3OOCA 1EYCA 1KABA 2CQOA 3S15B 2K32A 4AQYQ 2V4DA 4X62Q 2MGSA 3OWEB 1HNXQ 4A3DG 2LXKA 4HSVA 3A0JA 1LTID 3IRBA 1II3A 3CCSA 1Y8PB 1FNVA 3MFGA 1HFNA 3GD7A 5E4WC 5IYBG 3MWYW 5I9OA 3S17B 1OXXK 3PF4A 1Y1WB 1NCVA 4KD3A 2WB1B 5E3FA 4C2MH 2PPBC 1LABA 1PRTC 5EAYA 4NXMQ 1VQGA 1I4GA 3AEVA 1SNDA 2EYOA 1SYEA 2EIFA 2CKZB 1TWCB 1WI5A 4YWKA 5C3EG 3JAME 3HOUG 5HY6A 1JMCA 3PO3B 3V2TA 4N8FA 1G2TA 4GNXC 1K8MA 2VY3A 2F3WA 4Y52H 3PCOB 2Q2HA 3NQTA 1S5BD 3GTMH 3CQZH 4RG1A 4PG3A 4KY5A 4TVAB 3BDCA 4DAYA 4DR7Q 1XNRQ 1JWMD 4DR6L 1QUQB 2NUCA 1FNWA 1TWHH 2HHHL 1O80A 1GXDC 1HTLD 2K14A 1KAAA 3SE0A 3W2DA 4POFA 3TS0A 1JE4A 4JW0A 4BY1G 1WTQA 2F0SA 2NZHA 4RWSC 4JI8Q 4A3CH 1N33L 1H9JA 2V1CC 3ND9A 3I73A 3GO5A 3M4OB 3ND8A 1XMQL 1LV9A 2EYLA 1OXUA 3D31A 3KFUA 1B9MA 1TIID 2A73B 2RBMA 1M90C 2YTVA 1EYGA 1SMXA 5CV5A 1Q46A 4GS3A 4QCLA 1KLGD 2F0FA 4XT3B 1GO3E 2SEBD 2WINB 1S5FD 1E2WA 1QCBD 2G9DA 2YU9B 3FEWX 1H9KA 4DV2L 4DXGA 3CPWA 3KF6B 1EL0A 2LXJA 1FGUA 2A74C 3L7ZC 1EIFA 1WTHA 1Z9FA 1SMYC 4K8JA 1G6PA 3J80i 3GTJB 4BS9A 3BZDB 1FYCA 2XVSA 2D0OA 4DK3C 5GAGC 1WTOA 2EE1A 4BBSH 5IGBA 1G2SA 4A3KB 2AWOA 2UUBQ 1U4LA 2WACA 4KHVA 2VW9A 1T5EA 2PO4A 1U5KA 1VQIA 1CKNA 1J5EL 1KXLA 4JI1L 1LACA 4DUZL 4A3DH 1H9SB 3TZDA 5K36G 4JC0A 3QIAA 3A54A 4CKBA 1CSPA 1U4PA 4PZ6A 1VMCA 2KHIA 5IYBH 4HIOA 4UPAA 1LTGD 4AYBG 3D4RA 2EQSA 2RKSA 4XT1B 2IY5B 4HR7B 1KIXA 2CFMA 3I2ZA 5C3WA 4Z9CB 3RUZA 3QG1A 5ELDA 1HNZQ 2RHQB 2DJGC 3A8JE 1KLUD 3AFPA 1Y8NB 2C35B 3HRZC 4KHPL 2NVYB 5CORA 1EWCA 1BF4A 2F0WA 3F1ZA 5M5YB 1DD2A 4FF3A 5C3EH 3HOUH 4YWMA 4PMCA 4A3BG 3KK7A 5AJ3L 3RNUA 5JPNC 2K03A 3KUPA 4CBVA 2AHOB 3JC66 4LUZA 4DAMA 2C9OA 2WIIB 3JAMc 3E9HA 3RZOH 3TEHB 1I4QA 4EQOA 3FMCA 4F87A 2O2LD 3EA6A 2WAQE 4C1NK 3J81i 2B2WC 2RDHA 3PIOA 5M3FB 3D8GA 3Q6SA 1EIHA 2IHEA 3CCLA 3DEPA 4UY8C 1PH6A 4C3HB 1IBKL 5L37A 1T5XD 4RHSA 4BY1H 1BKBA 3RLFA 1LT3D 1KL9A 3L2PA 4B3TQ 2K33A 4IFDJ 4Y7NH 3KDFA 2K4KA 1TT2A 2M9VA 2KA7A 5FJ8G 4LFCQ 2LSSA 1I50H 2IHFA 4DPGA 2KVMA 2M2LA 4LMQD 3CC7A 3H3VH 4V0BA 2N78A 2Z6KC 3I4NB 1LO5D 3CD6A 2EOTA 1FL0A 5JEAJ 1YJWA 5C0XJ 1PV4A 4DV7Q 2H1EA 4ABNA 4GOPC 4RCOA 1FR3A 2H4OA 4X64L 1TKWB 4BA1I 1EU3A 4ZK9B 2PNHA 1EFID 1XPOA 4U673 4GKKQ 1K83H 2NB0A 1LUZA 1WFQA 4B9WA 1VMPA 1CA6A 2HDMA 4DV5Q 1OXVA 5EJWA 4GN4B 3S1MH 3I8ZA 5JPMC 1PH9A 1X3QA 1X3FA 5KGUA 4IFDI 3X3NA 1STYA 1CK1A 2VB2X 3H94A 4JI0Q 1L1OA 2SNSA 3IL8A 1Y8OB 1TWAB 4A3MB 5M3MB 4GKJQ 4J1MA 1RKNA 1PFNA 1PTOH 3OMGA 1KNEA 1KHIA 1SE4A 4GLVB 2JA5B 2ASBA 4IJHA 1KTKA 4DV3L 3URYA 1HQMC 1TWFH 5K36H 4IZ8A 1MSGA 3T1HL 1R4QB 4TSSA 2OWOA 2FHTA 1SDFA 1UE1A 4JYAQ 1JC7A 1BOSA 1Q7YC 1PH1A 2Y0SB 4YHHQ 2K75A 4DR1Q 4YIJA 1LTSD 3BJUA 2A6HC 1E1OA 1YJNA 2BH2A 1IYUA 1U0LA 3R2IA 2QEXA 5I2YA 3HOVG 5E4XA 4MNOA 5J1ZA 5FOBB 3OHXC 3S2HB 1L0XB 1IKMA 4A3BH 2EDGA 4NXNQ 2UXCL 4LF4L 1D5MC 1FD7D 2IPKD 4A3IG 4OL7A 4TKOB 2A69C 1MSHA 1WTXA 1KNAA 1F77A 2DY7A 5IYDG 4BA2I 3UDXA 3LNNA 1XMOL 2XTIA 4N9TA 3I91A 2F52A 4LF8L 2EY1A 1D5ZC 1SYBA 2F0VA 1YHQA 1HJPA 1V1OA 1Q90A 2ZM6L 2SOBA 2K01A 2UU9L 3K8AA 1FNUA 5FJ8H 4QGUA 2YTXA 1CKMA 4H44C 3TDQA 4JOIC 3QOLA 3ULLA 1E22A 1TS3A 2KECA 5CBEE 2ES2A 2ALYB 1PFBA 1E2ZA 2K5QA 1TWGH 1XYIA 3CAMA 2BCOA 1ENAA 4AQYL 1I94Q 1WOCA 5KEEA 4X62L 5KIXA 4FF1A 5KYIA 4HSPA 1HNXL 4JG2A 3VYTA 4ALPA 2I46A 2E2IB 3AFQA 3U58A 3VYSA 5JVG3 4A3FG 4AH6A 1AN8A 3SGIA 4NXML 4A93G 5KNBA 2ID0A 4ODGA 1SFOH 4JV5L 2I5LX 1Y1VB 4MIUA 2DY8A 3TP5A 1JICA 1VQJA 2KCTA 5CV9A 1TU2B 2BOSA 3K7AH 2YTYA 3TSSA 1QVCA 2SDFA 3TN2A 4OWTB 2F0EA 4GLXA 2CH4A 1QUQA 2X6GA 4JBMA 5CV4A 1ASYA 2RCFA 1LTTD 4JBJA 2UXDQ 2RDFA 3BVMA 4XYOA 1STHA 2JA7G 2BE5D 3CMAA 1P8LA 1H95A 4B3SQ 3G7LA 4DR7L 1N36L 5EKKA 1XNRL 2KUMA 2EY2A 4RKBA 5E7NA 5D3DA 2D62A 4OELB 4JI6Q 1PYSB 1STNA 3OTOL 4GLAC 3A56A 1LLRD 4ZAIA 1J8IA 5IGFA 3SXHA 3CXCA 2NBFA 1VQCA 4AYBE 1CQFA 1SYFA 3I4MB 4XIGS 4JI8L 1K73C 4LF7Q 2EY6A 4P2CB 3HOVH 2F0MA 1JQYD 4J6HA 1HFGA 2WV6D 4ZRZA 5ELCA 2X6LA 4IPDA 3TRZA 2CVRA 4IJLA 1PH4A 1UWVA 1SNOA
chains in the Genus database with same CATH topology
3IRBA 3KF6A 4LF6L 3CCSA 4A3IH 4GNXA 1MJEA 3BZCA 1CSQA 5C4XH 3G4SA 3GD7A 5IYBG 4P72A 4BY7G 3HOWH 5LMNQ 2K50A 4GN5A 3PO2H 2BA0A 1OXXK 3G71A 4A3KG 3PF4A 4C2MH 1A0IA 4A3JH 4KHZA 4UP7A 2JEBI 5EAYA 4NXMQ 3GTQH 5IYDH 2UXDL 1V1QA 1VQGA 3UE1A 3AEVA 3I4MG 4OO1G 4DR5Q 1YVCA 2MO1A 3EN2A 2HQLA 4DR2L 3S15H 3UDGA 1S40A 2PQAB 2EIFA 2CKZB 1FVIA 4DV1Q 1WI5A 4B3SL 2OQKA 4DR4L 1VQ8A 2ZJPA 3S2HH 4YWKA 1QVGA 4LFBQ 1VQEA 5C3EG 1XPRA 3HOUG 1OXSC 4R4QA 4YCUA 4QL5A 5HY6A 1B70B 4A3EG 1JMCA 1JE5A 2UUAQ 4JI5L 4GNXC 1EUJA 2VY3A 4DV4Q 4DV2Q 4HIDA 4JI4Q 2UUBL 1Q12A 1YBYA 1YNXA 2NVXH 4Y52H 1LTLA 3H0GG 3PCOB 3S1QH 2Q2HA 4P74A 3AQQA 3GTMH 3CQZH 4RG1A 5FLMH 5JJKA 2AWNA 4PG3A 4DUYQ 1JB7A 4P75A 3I56A 4LF9Q 1Y1WG 3M7NA 2WB1G 4TVAB 4LFAQ 1PA6A 4DR7Q 5BR8Q 1PFSA 5GROA 1XNRQ 1VQLA 4DV0Q 2VQEQ 1M1KC 3ULJA 3HKSA 1Q1BA 1NY4A 4R4OA 4DR6L 1QUQB 1Q8KA 1TWHH 2HHHL 1NBWA 3CMEA 4HIKA 3T1YQ 2K14A 1IXRA 3CP0A 3M4PA 4POFA 3TS0A 2ZTEA 2EXDA 4J15A 4BY1G 3KJOA 4A3FH 4HJ5A 2NZHA 1E3PA 3PO3G 4MZ9A 1IBML 1VQAA 4JI8Q 4A3CH 1N33L 3AYHB 2V1CC 1EFWA 3VDYA 4JI2L 2JEAI 4A93H 3GO5A 4R1JA 1IBLQ 1XMQL 1VCIA 4BBRG 1HNZL 4YY3Q 1VQ6A 5LMUQ 1OXUA 3D31A 3KFUA 3W1GA 1M90C 2YTVA 5M3FG 1EYGA 1HZBA 1UE5A 2HT1A 2L15A 1SMXA 1C0AA 4B3ML 1Q46A 4LF6Q 4GS3A 4DV1L 4DR3L 2N49A 5JJIA 2IX0A 1BBWA 1MIUA 2JQOA 4LFBL 1GO3E 2PMZE 2E2IH 2UUAL 2JA7H 3NBHB 1Y14B 4DV2L 3S1NH 2BH8A 3CCVA 3HOXG 3UE0A 3CPWA 3KF6B 3CC4A 2VUMG 1MKHA 2LXJA 4GNXB 4DR2Q 1FGUA 3L7ZC 4DUYL 1RIPA 1VQFA 1EIFA 1Z9FA 3U4ZA 1XTDA 2R7ZH 4DR4Q 1X9NA 1X54A 1G6PA 2A8VA 1NE3A 3J80i 1Q86C 3I4NG 3PF5A 3PIPA 4UP8A 2D0OA 4DK3C 3GTPH 3CCEA 5GAGC 4BBSH 2K5NA 2YYZA 2HIXA 3EIVA 2AWOA 4QIWE 2UUBQ 5C44G 2VL6A 2ZJRA 3HKZG 3H15A 4B3TL 1VQKA 1SLJA 4OONA 1A63A 4IPGA 4KI0A 2N8NA 5C0XI 2R92H 2VW9A 1U5KA 1VQIA 1VQOA 4A75A 1CKNA 1J5EL 1K3RA 1KXLA 1JJGA 5IP9H 1AH9A 4JI1L 4A76A 1J6QA 3S14H 4DKAC 4DUZL 4A3DH 1SRUA 5GQOA 2HHHQ 2MQHA 5IYCG 5K36G 2CWAA 1HH2P 3GTOH 1K9MC 4BXXG 4MTNA 4P71A 4JC0A 2A1AA 1VQPA 2UXBQ 1CSPA 4DV7L 3GTLH 4PZ6A 1EWIA 3KYHC 3TS2A 2KHIA 5IYBH 4DAYB 4HIOA 4UPAA 2XGTA 4HJAA 4BY7H 4AYBG 4A3KH 1C7YA 3W1BA 1IBMQ 2NVQH 1D7QA 1QZHA 2EQSA 1N33Q 4GKKL 2IY5B 1KIXA 1VQDA 4JI2Q 3CCUA 4NPSA 2CFMA 3I2ZA 2E2JH 2OCEA 1XMQQ 4LUVA 1PH3A 3I4MH 1HNZQ 2NVTH 3I7FA 2RHQB 1YI2A 1E7ZA 2Y0SE 3G48A 4OX9L 2JA5G 3A5UA 1YEZA 3AFPA 3J81j 2C35B 3ZJYC 3HOYG 4KHPL 4B3MQ 1VQNA 2B63G 1X55A 3F1ZA 4DR3Q 5C3EH 3HOUH 1UE6A 4A3EH 4GN3B 2ATWA 4JI0L 4YWMA 3ICEA 1JT8A 5ELNA 4A3BG 1VQ7A 5AJ3L 3RNUA 1N32L 4JCVE 1KC8C 2AHOB 3JC66 3PUYA 4LUZA 3H0GH 2R6GA 1KAWA 4L5SA 4DAMA 3B6YA 1HR0Q 4GKJL 2F3IA 3S17H 3JAMc 4A3LG 1YHAA 3E9HA 3RZOH 3TEHB 3HOZG 4DV6Q 1Y1WH 2JJQA 4TQUS 4XTCS 2VS1A 1X65A 2Z6KA 2WAQE 2JA6G 2HIVA 3J81i 3PIOA 4PZ8A 2B29A 2KHJA 2IHEA 1I3QH 3CCLA 1I6HH 4GOPA 1PH7A 1SROA 4UY8C 1ASZA 3MEFA 2NN6I 1PH6A 3S2DH 1TWCH 1B7YB 3CPFA 1IBKL 3K81C 4LW1A 3PUXA 2Q2UA 4BY1H 1BKBA 3RLFA 1XNQL 2UXBL 3BU2A 3UDIA 3PO3H 2KBNA 1KL9A 3L2PA 1CUKA 1CKOA 1N34Q 4EQ5A 3MXNB 4B3TQ 4Y7NH 5LMNW 1LYLA 4IFDJ 5FLXc 3KDFA 1B8AA 2IT1A 1HZCA 2ZJQA 2K52A 4B3RQ 1X3GA 2K4KA 4JBWA 1BBUA 2R7DA 1GVPA 5FJ8G 4DV3Q 2LSSA 1UEBA 3FHWA 1PH5A 1J5EQ 4LFCQ 1HZAA 4BBRH 2BA1A 1I50H 4JI1Q 4DR1L 2IHFA 1L0WA 4DPGA 1EIYB 3CC7A 3H3VH 3U50C 4OO1I 4DUZQ 4X66Q 3OW2A 1T9HA 2N78A 2Z6KC 1N9WA 5M3FH 3CD6A 4C3IH 3K0XA 1FL0A 5JEAJ 2FXQA 1YJWA 5C0XJ 1PV4A 4IPHA 4AIMA 4DV7Q 4L5TA 1K0RA 1VQ4A 4GOPC 3F2BA 1YZ6A 1JJCB 1WCMG 4X64L 1CKNB 4BA1I 2PNHA 1XPOA 4KLKA 1YJ9A 4GKKQ 1K83H 1VQMA 3M3YH 1LUZA 1BVSA 1WFQA 3M4QA 4OWWB 4R4TA 2JA8G 2R93G 4DV5Q 3G6EA 3HOXH 1OXVA 4LF5L 1Q82C 2VUMH 1PH8A 2VNUD 1HR0L 4GN4B 4H02A 2E5LL 4PZ7A 4OX9Q 1NMGA 3S1MH 1KQSA 4DV6L 3M4OH 4KHPQ 3D0FA 4HJ8A 3RN5A 1N8RC 1JJ2A 1PH9A 3I4NH 3KF8B 1X3FA 4A3GG 4IFDI 2I5MX 3NEMA 3TQYA 4JI0Q 2UXCQ 1NJIC 1W3SA 2E2HH 2JA9A 4JI7L 5AJ3Q 1DGSA 4LUOA 1N32Q 4L5QA 4YCVA 5C44H 1L1OA 1X56A 1EQQA 3FKIG 1GKHA 1AE2A 2D0PA 4GKJQ 1N34L 4A4IA 3GTGH 3A74A 1IL2A 3J7A5 2YU9H 1KHIA 2GVAA 4GLVB 4B3RL 5GAHC 2QA4A 2ASBA 4IJHA 4LFCL 3RLOA 4DV3L 4O2DA 1TWFH 5IYCH 2QGQA 1TXYA 4BXXH 3T1HL 2K5VA 3F8TA 4X66L 4WJ3M 3W5OA 1Y1VG 1IBKQ 2E8GA 2OWOA 5IT9c 3NELA 5M5WH 4WJ4A 1YHBA 5IP7G 2ZM6Q 3GTJH 1XNQQ 1UE1A 4IOCA 2UU9Q 4JYAQ 4LNQA 3GDEA 1EOVA 2GVBA 1KRSA 3RLNA 2UUCQ 1G51A 1KRTA 1L1OC 1Q7YC 1PH1A 3LGJA 1FJGL 2OQ0A 3K80C 4JI3L 4YHHQ 1VQ5A 2K75A 1Q1EA 2VQFL 1AE3A 4GOPB 5J3BA 4A3MG 4DR1Q 5M3MG 1X3EA 4DV5L 3BJUA 4X65L 1E1OA 3DLLA 1YJNA 2JA5H 2K5HA 2VZAA 2BH2A 3HOYH 3HOVG 1U0LA 2QEXA 4OXPA 2B63H 4MNOA 3PUWA 4YCWA 2I5HA 4IOAA 3KDFB 3J80c 3KOJA 1NTGA 4X64Q 4A3BH 2CWPA 4NXNQ 2UXCL 4LF4L 1SE8A 4QJFA 3RR5A 2ZTDA 3PSIA 1KD1C 4A3IG 2JK8A 3GTKH 4DNIA 3UDFA 2GN5A 4A3LH 5C4XG 4LF5Q 1YITA 3HOZH 3WWVA 4JOIA 3U4VA 3HOWG 2NZOA 2E5LQ 3PO2G 2JA6H 2Y0SG 4JV5Q 3I55A 1XJVA 4A3JG 1VQ9A 3KLWA 1E1TA 5IYDG 1GD7A 4BA2I 1IYJB 2WP8J 1PHJA 4R4IA 3UDXA 3OYYA 5M5XH 1XMOL 2WB1E 2XTIA 1NMFA 2YV5A 4QQBX 2F52A 4HJ7A 2B3GA 2WFWA 3S1RH 4POGA 2NVYH 1WYDA 3TREA 4JI7Q 4LF8L 1QVFA 2IX1A 3EBEA 3CW2C 4OWXB 1W2BA 5M5YH 1YHQA 1HJPA 4JI6L 1VS0A 1UE7A 3K7UC 2ZM6L 3ULPA 5ELOA 2UU9L 4JYAL 5IWAL 3K8AA 1E24A 4K0KQ 2H5XA 4APVA 5FJ8H 3F2DA 4DK6C 4IO9A 1K8AC 2UUCL 5H1SE 4QGUA 2JA8H 2YTXA 1CKMA 1R9TH 2KCMA 1SR3A 2WAQG 2PI2E 4YHHL 4JBKA 4JOIC 1QZGA 2DUDA 1I5FA 3BZKA 3E9IA 3PUZA 3CCMA 1GM5A 1HNWL 3ULLA 1E22A 5FLMG 4LF7L 1N36Q 1L1OB 1WJJA 1RL2A 3T1HQ 2ES2A 3PUVA 3RZDH 2ALYB 2F4VL 3STBC 1TWGH 4IFDG 1C9OA 3CAMA 4AQYL 3OTOQ 1I94Q 1WOCA 4ME3A 4HJ9A 2RF4A 4X62L 1Q81C 1WCMH 2RCNA 1HNXL 4LWCA 4P73A 2I0QA 2N3SA 1Z47A 4JG2A 4C3HH 4HIMA 5JJLA 4ALPA 4QY7A 4PMWA 1EQRA 1FJGQ 1X6OA 4JI3Q 2JE6I 3AFQA 3ERSX 4NXNL 3U58A 2R93H 2PQAA 2VQFQ 4A3FG 4AH6A 1HR0W 2R7FA 5JEAG 1P16A 3STBD 5GADC 5IY0A 5C0XG 2AMCB 5LMNL 4X65Q 5DLQE 1S72A 4A3CG 1MJCA 2PI2A 2MFIA 3SGIA 3J81c 4NXML 4A93G 1A8VA 3S24A 1V43A 2ID0A 2MNAA 1SFOH 4EX5A 2I5LX 4JV5L 4A3GH 1K8GA 2MO0A 4L5RC 1OXTA 3M85A 4DR5L 3PGZA 1OTCA 3F2CA 1L2FA 1VQJA 2AKWB 2Z0SA 2KCTA 4FDBA 3ER0A 4LF4Q 3FKIH 3Q8DA 1G291 3K7AH 2YTYA 1V9PA 1QVCA 3HFZB 4OWTB 3CF5A 1HZ9A 4GLXA 1QUQA 3CCRA 4JBMA 5GAEC 3I4OA 2CCZA 1ASYA 2Q2TA 2DGYA 4DV4L 2UXDQ 4JBJA 2KENA 4JI4L 1A62A 3HKZE 4K0KL 2JA7G 3A5ZB 5C4JH 3KJPA 1VQHA 3L0OA 3J7ZC 3CC2A 2OTJA 5HGQA 1XMOQ 1S3OA 1P8LA 3CMAA 3PV0A 4LF9L 1H95A 4B3SQ 4LFAL 1LM0A 3H3VI 1Y1VH 5BR8L 4DR7L 4NB3A 4LF8Q 1N36L 1XPUA 1XNRL 5E7NA 4DV0L 1SN8A 5IP7H 2RHSB 2VQEL 1IZ6A 2D62A 2R7ZG 2OTLA 3FP9A 4JI6Q 1PYSB 3OTOL 3CCJA 1VQBA 4IPCA 1I94L 4JI5Q 1PVOA 4GLAC 3NENA 3T1YL 5IWAQ 2Q2IA 3RN2A 2ZTCA 4BBSG 1YIJA 1PYBA 2A19A 3M9BA 5IE8A 3E0EA 1PH2A 1TWAH 3CXCA 4A3MH 5M3MH 1VQCA 4RMFA 1D8LA 4AYBE 1O7IA 3DM3A 1HNWQ 3JAMi 3CCQA 4XIGS 4JI8L 1K73C 4LF7Q 2R92G 4UP9A 3HOVH 4DR6Q 4C3JH 4X6AH 4YWLA 2CQOA 1IBLL 2F4VQ 4AQYQ 5IP9G 4R4CA 4O0AA 4YY3L 4X62Q 4IPDA 5LMUL 1HNXQ 3TRZA 4A3DG 2LXKA 4IJLA 1PH4A 3A0JA 1UWVA 2NN6G 3S16H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRB A;  3KF6 A;  4LF6 L;  3CCS A;  4A3I H;  4GNX A;  1MJE A;  3BZC A;  1CSQ A;  5C4X H;  3G4S A;  3GD7 A;  5IYB G;  4P72 A;  4BY7 G;  3HOW H;  5LMN Q;  2K50 A;  4GN5 A;  3PO2 H;  2BA0 A;  1OXX K;  3G71 A;  4A3K G;  3PF4 A;  4C2M H;  1A0I A;  4A3J H;  4KHZ A;  4UP7 A;  2JEB I;  5EAY A;  4NXM Q;  3GTQ H;  5IYD H;  2UXD L;  1V1Q A;  1VQG A;  3UE1 A;  3AEV A;  3I4M G;  4OO1 G;  4DR5 Q;  1YVC A;  2MO1 A;  3EN2 A;  2HQL A;  4DR2 L;  3S15 H;  3UDG A;  1S40 A;  2PQA B;  2EIF A;  2CKZ B;  1FVI A;  4DV1 Q;  1WI5 A;  4B3S L;  2OQK A;  4DR4 L;  1VQ8 A;  2ZJP A;  3S2H H;  4YWK A;  1QVG A;  4LFB Q;  1VQE A;  5C3E G;  1XPR A;  3HOU G;  1OXS C;  4R4Q A;  4YCU A;  4QL5 A;  5HY6 A;  1B70 B;  4A3E G;  1JMC A;  1JE5 A;  2UUA Q;  4JI5 L;  4GNX C;  1EUJ A;  2VY3 A;  4DV4 Q;  4DV2 Q;  4HID A;  4JI4 Q;  2UUB L;  1Q12 A;  1YBY A;  1YNX A;  2NVX H;  4Y52 H;  1LTL A;  3H0G G;  3PCO B;  3S1Q H;  2Q2H A;  4P74 A;  3AQQ A;  3GTM H;  3CQZ H;  4RG1 A;  5FLM H;  5JJK A;  2AWN A;  4PG3 A;  4DUY Q;  1JB7 A;  4P75 A;  3I56 A;  4LF9 Q;  1Y1W G;  3M7N A;  2WB1 G;  4TVA B;  4LFA Q;  1PA6 A;  4DR7 Q;  5BR8 Q;  1PFS A;  5GRO A;  1XNR Q;  1VQL A;  4DV0 Q;  2VQE Q;  1M1K C;  3ULJ A;  3HKS A;  1Q1B A;  1NY4 A;  4R4O A;  4DR6 L;  1QUQ B;  1Q8K A;  1TWH H;  2HHH L;  1NBW A;  3CME A;  4HIK A;  3T1Y Q;  2K14 A;  1IXR A;  3CP0 A;  3M4P A;  4POF A;  3TS0 A;  2ZTE A;  2EXD A;  4J15 A;  4BY1 G;  3KJO A;  4A3F H;  4HJ5 A;  2NZH A;  1E3P A;  3PO3 G;  4MZ9 A;  1IBM L;  1VQA A;  4JI8 Q;  4A3C H;  1N33 L;  3AYH B;  2V1C C;  1EFW A;  3VDY A;  4JI2 L;  2JEA I;  4A93 H;  3GO5 A;  4R1J A;  1IBL Q;  1XMQ L;  1VCI A;  4BBR G;  1HNZ L;  4YY3 Q;  1VQ6 A;  5LMU Q;  1OXU A;  3D31 A;  3KFU A;  3W1G A;  1M90 C;  2YTV A;  5M3F G;  1EYG A;  1HZB A;  1UE5 A;  2HT1 A;  2L15 A;  1SMX A;  1C0A A;  4B3M L;  1Q46 A;  4LF6 Q;  4GS3 A;  4DV1 L;  4DR3 L;  2N49 A;  5JJI A;  2IX0 A;  1BBW A;  1MIU A;  2JQO A;  4LFB L;  1GO3 E;  2PMZ E;  2E2I H;  2UUA L;  2JA7 H;  3NBH B;  1Y14 B;  4DV2 L;  3S1N H;  2BH8 A;  3CCV A;  3HOX G;  3UE0 A;  3CPW A;  3KF6 B;  3CC4 A;  2VUM G;  1MKH A;  2LXJ A;  4GNX B;  4DR2 Q;  1FGU A;  3L7Z C;  4DUY L;  1RIP A;  1VQF A;  1EIF A;  1Z9F A;  3U4Z A;  1XTD A;  2R7Z H;  4DR4 Q;  1X9N A;  1X54 A;  1G6P A;  2A8V A;  1NE3 A;  3J80 i;  1Q86 C;  3I4N G;  3PF5 A;  3PIP A;  4UP8 A;  2D0O A;  4DK3 C;  3GTP H;  3CCE A;  5GAG C;  4BBS H;  2K5N A;  2YYZ A;  2HIX A;  3EIV A;  2AWO A;  4QIW E;  2UUB Q;  5C44 G;  2VL6 A;  2ZJR A;  3HKZ G;  3H15 A;  4B3T L;  1VQK A;  1SLJ A;  4OON A;  1A63 A;  4IPG A;  4KI0 A;  2N8N A;  5C0X I;  2R92 H;  2VW9 A;  1U5K A;  1VQI A;  1VQO A;  4A75 A;  1CKN A;  1J5E L;  1K3R A;  1KXL A;  1JJG A;  5IP9 H;  1AH9 A;  4JI1 L;  4A76 A;  1J6Q A;  3S14 H;  4DKA C;  4DUZ L;  4A3D H;  1SRU A;  5GQO A;  2HHH Q;  2MQH A;  5IYC G;  5K36 G;  2CWA A;  1HH2 P;  3GTO H;  1K9M C;  4BXX G;  4MTN A;  4P71 A;  4JC0 A;  2A1A A;  1VQP A;  2UXB Q;  1CSP A;  4DV7 L;  3GTL H;  4PZ6 A;  1EWI A;  3KYH C;  3TS2 A;  2KHI A;  5IYB H;  4DAY B;  4HIO A;  4UPA A;  2XGT A;  4HJA A;  4BY7 H;  4AYB G;  4A3K H;  1C7Y A;  3W1B A;  1IBM Q;  2NVQ H;  1D7Q A;  1QZH A;  2EQS A;  1N33 Q;  4GKK L;  2IY5 B;  1KIX A;  1VQD A;  4JI2 Q;  3CCU A;  4NPS A;  2CFM A;  3I2Z A;  2E2J H;  2OCE A;  1XMQ Q;  4LUV A;  1PH3 A;  3I4M H;  1HNZ Q;  2NVT H;  3I7F A;  2RHQ B;  1YI2 A;  1E7Z A;  2Y0S E;  3G48 A;  4OX9 L;  2JA5 G;  3A5U A;  1YEZ A;  3AFP A;  3J81 j;  2C35 B;  3ZJY C;  3HOY G;  4KHP L;  4B3M Q;  1VQN A;  2B63 G;  1X55 A;  3F1Z A;  4DR3 Q;  5C3E H;  3HOU H;  1UE6 A;  4A3E H;  4GN3 B;  2ATW A;  4JI0 L;  4YWM A;  3ICE A;  1JT8 A;  5ELN A;  4A3B G;  1VQ7 A;  5AJ3 L;  3RNU A;  1N32 L;  4JCV E;  1KC8 C;  2AHO B;  3JC6 6;  3PUY A;  4LUZ A;  3H0G H;  2R6G A;  1KAW A;  4L5S A;  4DAM A;  3B6Y A;  1HR0 Q;  4GKJ L;  2F3I A;  3S17 H;  3JAM c;  4A3L G;  1YHA A;  3E9H A;  3RZO H;  3TEH B;  3HOZ G;  4DV6 Q;  1Y1W H;  2JJQ A;  4TQU S;  4XTC S;  2VS1 A;  1X65 A;  2Z6K A;  2WAQ E;  2JA6 G;  2HIV A;  3J81 i;  3PIO A;  4PZ8 A;  2B29 A;  2KHJ A;  2IHE A;  1I3Q H;  3CCL A;  1I6H H;  4GOP A;  1PH7 A;  1SRO A;  4UY8 C;  1ASZ A;  3MEF A;  2NN6 I;  1PH6 A;  3S2D H;  1TWC H;  1B7Y B;  3CPF A;  1IBK L;  3K81 C;  4LW1 A;  3PUX A;  2Q2U A;  4BY1 H;  1BKB A;  3RLF A;  1XNQ L;  2UXB L;  3BU2 A;  3UDI A;  3PO3 H;  2KBN A;  1KL9 A;  3L2P A;  1CUK A;  1CKO A;  1N34 Q;  4EQ5 A;  3MXN B;  4B3T Q;  4Y7N H;  5LMN W;  1LYL A;  4IFD J;  5FLX c;  3KDF A;  1B8A A;  2IT1 A;  1HZC A;  2ZJQ A;  2K52 A;  4B3R Q;  1X3G A;  2K4K A;  4JBW A;  1BBU A;  2R7D A;  1GVP A;  5FJ8 G;  4DV3 Q;  2LSS A;  1UEB A;  3FHW A;  1PH5 A;  1J5E Q;  4LFC Q;  1HZA A;  4BBR H;  2BA1 A;  1I50 H;  4JI1 Q;  4DR1 L;  2IHF A;  1L0W A;  4DPG A;  1EIY B;  3CC7 A;  3H3V H;  3U50 C;  4OO1 I;  4DUZ Q;  4X66 Q;  3OW2 A;  1T9H A;  2N78 A;  2Z6K C;  1N9W A;  5M3F H;  3CD6 A;  4C3I H;  3K0X A;  1FL0 A;  5JEA J;  2FXQ A;  1YJW A;  5C0X J;  1PV4 A;  4IPH A;  4AIM A;  4DV7 Q;  4L5T A;  1K0R A;  1VQ4 A;  4GOP C;  3F2B A;  1YZ6 A;  1JJC B;  1WCM G;  4X64 L;  1CKN B;  4BA1 I;  2PNH A;  1XPO A;  4KLK A;  1YJ9 A;  4GKK Q;  1K83 H;  1VQM A;  3M3Y H;  1LUZ A;  1BVS A;  1WFQ A;  3M4Q A;  4OWW B;  4R4T A;  2JA8 G;  2R93 G;  4DV5 Q;  3G6E A;  3HOX H;  1OXV A;  4LF5 L;  1Q82 C;  2VUM H;  1PH8 A;  2VNU D;  1HR0 L;  4GN4 B;  4H02 A;  2E5L L;  4PZ7 A;  4OX9 Q;  1NMG A;  3S1M H;  1KQS A;  4DV6 L;  3M4O H;  4KHP Q;  3D0F A;  4HJ8 A;  3RN5 A;  1N8R C;  1JJ2 A;  1PH9 A;  3I4N H;  3KF8 B;  1X3F A;  4A3G G;  4IFD I;  2I5M X;  3NEM A;  3TQY A;  4JI0 Q;  2UXC Q;  1NJI C;  1W3S A;  2E2H H;  2JA9 A;  4JI7 L;  5AJ3 Q;  1DGS A;  4LUO A;  1N32 Q;  4L5Q A;  4YCV A;  5C44 H;  1L1O A;  1X56 A;  1EQQ A;  3FKI G;  1GKH A;  1AE2 A;  2D0P A;  4GKJ Q;  1N34 L;  4A4I A;  3GTG H;  3A74 A;  1IL2 A;  3J7A 5;  2YU9 H;  1KHI A;  2GVA A;  4GLV B;  4B3R L;  5GAH C;  2QA4 A;  2ASB A;  4IJH A;  4LFC L;  3RLO A;  4DV3 L;  4O2D A;  1TWF H;  5IYC H;  2QGQ A;  1TXY A;  4BXX H;  3T1H L;  2K5V A;  3F8T A;  4X66 L;  4WJ3 M;  3W5O A;  1Y1V G;  1IBK Q;  2E8G A;  2OWO A;  5IT9 c;  3NEL A;  5M5W H;  4WJ4 A;  1YHB A;  5IP7 G;  2ZM6 Q;  3GTJ H;  1XNQ Q;  1UE1 A;  4IOC A;  2UU9 Q;  4JYA Q;  4LNQ A;  3GDE A;  1EOV A;  2GVB A;  1KRS A;  3RLN A;  2UUC Q;  1G51 A;  1KRT A;  1L1O C;  1Q7Y C;  1PH1 A;  3LGJ A;  1FJG L;  2OQ0 A;  3K80 C;  4JI3 L;  4YHH Q;  1VQ5 A;  2K75 A;  1Q1E A;  2VQF L;  1AE3 A;  4GOP B;  5J3B A;  4A3M G;  4DR1 Q;  5M3M G;  1X3E A;  4DV5 L;  3BJU A;  4X65 L;  1E1O A;  3DLL A;  1YJN A;  2JA5 H;  2K5H A;  2VZA A;  2BH2 A;  3HOY H;  3HOV G;  1U0L A;  2QEX A;  4OXP A;  2B63 H;  4MNO A;  3PUW A;  4YCW A;  2I5H A;  4IOA A;  3KDF B;  3J80 c;  3KOJ A;  1NTG A;  4X64 Q;  4A3B H;  2CWP A;  4NXN Q;  2UXC L;  4LF4 L;  1SE8 A;  4QJF A;  3RR5 A;  2ZTD A;  3PSI A;  1KD1 C;  4A3I G;  2JK8 A;  3GTK H;  4DNI A;  3UDF A;  2GN5 A;  4A3L H;  5C4X G;  4LF5 Q;  1YIT A;  3HOZ H;  3WWV A;  4JOI A;  3U4V A;  3HOW G;  2NZO A;  2E5L Q;  3PO2 G;  2JA6 H;  2Y0S G;  4JV5 Q;  3I55 A;  1XJV A;  4A3J G;  1VQ9 A;  3KLW A;  1E1T A;  5IYD G;  1GD7 A;  4BA2 I;  1IYJ B;  2WP8 J;  1PHJ A;  4R4I A;  3UDX A;  3OYY A;  5M5X H;  1XMO L;  2WB1 E;  2XTI A;  1NMF A;  2YV5 A;  4QQB X;  2F52 A;  4HJ7 A;  2B3G A;  2WFW A;  3S1R H;  4POG A;  2NVY H;  1WYD A;  3TRE A;  4JI7 Q;  4LF8 L;  1QVF A;  2IX1 A;  3EBE A;  3CW2 C;  4OWX B;  1W2B A;  5M5Y H;  1YHQ A;  1HJP A;  4JI6 L;  1VS0 A;  1UE7 A;  3K7U C;  2ZM6 L;  3ULP A;  5ELO A;  2UU9 L;  4JYA L;  5IWA L;  3K8A A;  1E24 A;  4K0K Q;  2H5X A;  4APV A;  5FJ8 H;  3F2D A;  4DK6 C;  4IO9 A;  1K8A C;  2UUC L;  5H1S E;  4QGU A;  2JA8 H;  2YTX A;  1CKM A;  1R9T H;  2KCM A;  1SR3 A;  2WAQ G;  2PI2 E;  4YHH L;  4JBK A;  4JOI C;  1QZG A;  2DUD A;  1I5F A;  3BZK A;  3E9I A;  3PUZ A;  3CCM A;  1GM5 A;  1HNW L;  3ULL A;  1E22 A;  5FLM G;  4LF7 L;  1N36 Q;  1L1O B;  1WJJ A;  1RL2 A;  3T1H Q;  2ES2 A;  3PUV A;  3RZD H;  2ALY B;  2F4V L;  3STB C;  1TWG H;  4IFD G;  1C9O A;  3CAM A;  4AQY L;  3OTO Q;  1I94 Q;  1WOC A;  4ME3 A;  4HJ9 A;  2RF4 A;  4X62 L;  1Q81 C;  1WCM H;  2RCN A;  1HNX L;  4LWC A;  4P73 A;  2I0Q A;  2N3S A;  1Z47 A;  4JG2 A;  4C3H H;  4HIM A;  5JJL A;  4ALP A;  4QY7 A;  4PMW A;  1EQR A;  1FJG Q;  1X6O A;  4JI3 Q;  2JE6 I;  3AFQ A;  3ERS X;  4NXN L;  3U58 A;  2R93 H;  2PQA A;  2VQF Q;  4A3F G;  4AH6 A;  1HR0 W;  2R7F A;  5JEA G;  1P16 A;  3STB D;  5GAD C;  5IY0 A;  5C0X G;  2AMC B;  5LMN L;  4X65 Q;  5DLQ E;  1S72 A;  4A3C G;  1MJC A;  2PI2 A;  2MFI A;  3SGI A;  3J81 c;  4NXM L;  4A93 G;  1A8V A;  3S24 A;  1V43 A;  2ID0 A;  2MNA A;  1SFO H;  4EX5 A;  2I5L X;  4JV5 L;  4A3G H;  1K8G A;  2MO0 A;  4L5R C;  1OXT A;  3M85 A;  4DR5 L;  3PGZ A;  1OTC A;  3F2C A;  1L2F A;  1VQJ A;  2AKW B;  2Z0S A;  2KCT A;  4FDB A;  3ER0 A;  4LF4 Q;  3FKI H;  3Q8D A;  1G29 1;  3K7A H;  2YTY A;  1V9P A;  1QVC A;  3HFZ B;  4OWT B;  3CF5 A;  1HZ9 A;  4GLX A;  1QUQ A;  3CCR A;  4JBM A;  5GAE C;  3I4O A;  2CCZ A;  1ASY A;  2Q2T A;  2DGY A;  4DV4 L;  2UXD Q;  4JBJ A;  2KEN A;  4JI4 L;  1A62 A;  3HKZ E;  4K0K L;  2JA7 G;  3A5Z B;  5C4J H;  3KJP A;  1VQH A;  3L0O A;  3J7Z C;  3CC2 A;  2OTJ A;  5HGQ A;  1XMO Q;  1S3O A;  1P8L A;  3CMA A;  3PV0 A;  4LF9 L;  1H95 A;  4B3S Q;  4LFA L;  1LM0 A;  3H3V I;  1Y1V H;  5BR8 L;  4DR7 L;  4NB3 A;  4LF8 Q;  1N36 L;  1XPU A;  1XNR L;  5E7N A;  4DV0 L;  1SN8 A;  5IP7 H;  2RHS B;  2VQE L;  1IZ6 A;  2D62 A;  2R7Z G;  2OTL A;  3FP9 A;  4JI6 Q;  1PYS B;  3OTO L;  3CCJ A;  1VQB A;  4IPC A;  1I94 L;  4JI5 Q;  1PVO A;  4GLA C;  3NEN A;  3T1Y L;  5IWA Q;  2Q2I A;  3RN2 A;  2ZTC A;  4BBS G;  1YIJ A;  1PYB A;  2A19 A;  3M9B A;  5IE8 A;  3E0E A;  1PH2 A;  1TWA H;  3CXC A;  4A3M H;  5M3M H;  1VQC A;  4RMF A;  1D8L A;  4AYB E;  1O7I A;  3DM3 A;  1HNW Q;  3JAM i;  3CCQ A;  4XIG S;  4JI8 L;  1K73 C;  4LF7 Q;  2R92 G;  4UP9 A;  3HOV H;  4DR6 Q;  4C3J H;  4X6A H;  4YWL A;  2CQO A;  1IBL L;  2F4V Q;  4AQY Q;  5IP9 G;  4R4C A;  4O0A A;  4YY3 L;  4X62 Q;  4IPD A;  5LMU L;  1HNX Q;  3TRZ A;  4A3D G;  2LXK A;  4IJL A;  1PH4 A;  3A0J A;  1UWV A;  2NN6 G;  3S16 H; 
#chains in the Genus database with same CATH topology
 3KF6 A;  2Z4H A;  4A3I H;  1AFP A;  1Z6H A;  1MJE A;  4P72 A;  4BY7 G;  2K50 A;  4GN5 A;  2EYJ A;  3PIO 3;  3G71 A;  4A3K G;  3FDT A;  1HRJ A;  1A0I A;  4CJ2 C;  1PXU A;  5IYD H;  3UE1 A;  3SK8 A;  1VDZ A;  3X3M A;  3S15 H;  4PQX A;  1PDQ A;  2NWG A;  1S40 A;  1PTO C;  3VR5 A;  1GUG A;  1VQ8 A;  4LFB Q;  1QVG A;  1VQE A;  1XPR A;  1OXS C;  4A3E G;  4QL5 A;  5CMD A;  1QB5 D;  2UUA Q;  5EGT A;  1H9S A;  1EUJ A;  4DV4 Q;  2UUB L;  3H0G G;  4BBR B;  1WD0 A;  3S1Q H;  1Q8I A;  2AWN A;  4P75 A;  3C46 A;  3M7N A;  1ROD A;  1PA6 A;  1PFS A;  5GRO A;  2VQE Q;  1Q1B A;  1NY4 A;  4R4O A;  2TMP A;  1Q8K A;  5DNF A;  4HMI A;  4L6T B;  3CME A;  2L4N A;  1CQV A;  3T1Y Q;  2XNA C;  1IXR A;  3CP0 A;  1K0S A;  2WKD A;  2ZTE A;  4A3F H;  4HJ5 A;  3HOX B;  5A2Q L;  3J80 L;  1XX8 A;  2QEJ C;  2VUM B;  3S1N B;  3AYH B;  1EFW A;  2JEA I;  2F0H A;  4A93 H;  1VCI A;  1HNZ L;  4K6L A;  4IN3 A;  1U4R A;  5EPK A;  2R7Z B;  5M3F G;  1UE5 A;  1PRT B;  2B2T A;  2K6A A;  4C3I G;  2E2H B;  4DV1 L;  1ILP A;  3IKJ A;  3HKZ B;  5JJI A;  5DM7 3;  2IX0 A;  1BBW A;  2JQO A;  3T13 A;  5CR3 A;  4KK7 A;  2IX3 A;  3GTG B;  2JA7 H;  3HP3 A;  4DXF A;  1MHW C;  3QR8 A;  3CCV A;  1EEF D;  3CC4 A;  3HZX A;  1X3P A;  4GNX B;  5ELE A;  4DUY L;  3U4Z A;  1EIG A;  4KY7 A;  2A8V A;  1NE3 A;  1Q86 C;  3I4N G;  2CH4 W;  3PIP A;  3ITP A;  4UP8 A;  3GTP H;  2L55 A;  2BDN A;  5EQ0 A;  3T51 B;  2VL6 A;  4B3T L;  4OON A;  1CM9 A;  2N8N A;  1SMY D;  2E2J B;  2L12 A;  3A7L A;  2FFK B;  1S5C D;  2HDL A;  4UDU C;  1VQO A;  3VYR A;  2B63 B;  4CGY B;  2L0C A;  4A76 A;  1J6Q A;  3S14 H;  4K2L A;  5D3I B;  4OEM B;  4MTN A;  2UXB Q;  2MP1 A;  4DV7 L;  5FO7 B;  1EY7 A;  3J81 L;  1M8A A;  3TS2 A;  4RFB A;  4BY7 H;  3I90 A;  4C1N I;  2RQX A;  4A3K H;  3VYU A;  3W1B A;  2NVQ H;  1QZH A;  5T1G A;  3D6C A;  2CW0 D;  4GKK L;  1KDB A;  2JA6 B;  3GP7 A;  3CCU A;  4EGV A;  4IUP A;  1OO9 B;  3I7F A;  2NVT H;  3G48 A;  2JA5 G;  3A5U A;  1YEZ A;  4HCS A;  3ZJY C;  3HOY G;  3S1R B;  1I3Q B;  4KKU A;  1I6H B;  2K05 A;  1NNX A;  4ZUI A;  3R93 A;  4A3E H;  4GN3 B;  2CQA A;  4JI0 L;  4DN4 M;  4NKL A;  3CHB D;  5I6Y A;  1PMR A;  4V19 0;  3FPU B;  2KEE A;  3E6Z X;  3Q22 A;  2JA8 B;  2AQ3 B;  2K28 A;  3PUY A;  3H0G H;  1R9T B;  2R6G A;  3BVZ A;  3B6Y A;  3UI2 A;  4GKJ L;  1YHA A;  1I4R A;  4RA8 A;  4DV6 Q;  3CKI B;  3VR6 A;  4XTC S;  1QNK A;  1X65 A;  1GUN A;  4XXE A;  2B29 A;  1CZW A;  1PH7 A;  4R9W A;  3NTK A;  3S2D H;  1K8O A;  1Q3L A;  3CPF A;  3BVG A;  1JWU D;  4FF4 A;  3UDI A;  3DUZ A;  1N34 Q;  1GUS A;  4EQ5 A;  3MXN B;  1B8A A;  2K52 A;  4B3R Q;  1X3G A;  4JBW A;  1HUN A;  2R7D A;  3W3A A;  1PH5 A;  3TME A;  1UEB A;  4DR1 L;  2G9H D;  1EIY B;  4RH6 A;  4A3G B;  4ILW A;  3OW2 A;  5M3F H;  4C3I H;  4NP5 A;  2J0T D;  1ZKO A;  2FXQ A;  2JN4 A;  1A3T A;  3FKI B;  1VQ4 A;  1JJC B;  4DU9 A;  1LT6 D;  1VQM A;  3M3Y H;  5G3L D;  3M4Q A;  4OWW B;  4R4T A;  1GJX A;  4Q5V A;  4KN7 C;  3DXJ C;  1VF7 A;  1PRT F;  1PH8 A;  2VNU D;  4DK0 A;  4H02 A;  1HR0 L;  4OX9 Q;  4PZ7 A;  2A5H A;  3SHL A;  3D0F A;  2KOL A;  1BQQ T;  1SNP A;  3I4N H;  4WOR A;  1Z7T A;  2ICE C;  2F0Q A;  2XIW A;  5CYU A;  1NJI C;  4XQJ A;  2JA9 A;  4LUO A;  1N32 Q;  4L5Q A;  1F2M A;  2F0J A;  4YCV A;  1X56 A;  2OT2 A;  5LL6 X;  1EQQ A;  1WTP A;  3D3R A;  1AE2 A;  2B2U A;  3OWF A;  3A74 A;  2FMC A;  1IL2 A;  3J7A 5;  1DXM A;  4C56 C;  5A35 A;  2RA4 A;  1JWS D;  4O2D A;  1DCZ A;  1ZYR D;  4KMU C;  2XRS D;  2F0N A;  1TXY A;  3NQI A;  4KN4 C;  1XTC D;  2CW0 C;  4X66 L;  3HGB A;  1Y1V G;  4WJ4 A;  1JCK B;  3NEL A;  4G4K A;  5M5W H;  1YHB A;  1XNQ Q;  2Z6B A;  4LNQ A;  3GDE A;  1EOV A;  2GVB A;  5FK9 C;  2XN9 C;  1CHP D;  1B3Q A;  1STB A;  3LGJ A;  3HOZ B;  3D4W A;  1SXT A;  1Q1E A;  4GOP B;  1X3E A;  5C3X A;  3DLL A;  2JA5 H;  1GUW A;  2VZA A;  4ZCK A;  3HOY H;  4K5V A;  2VXW A;  4C3J G;  5NUC A;  3BDL A;  2I5H A;  2QDB A;  2PCF B;  3KOJ A;  1RDP D;  3KBG A;  2ZTD A;  1KD1 C;  1F9S A;  2A6H D;  1S5D D;  2HD3 A;  3EQL C;  4UAI A;  3GTK H;  2WAQ B;  2P5Z X;  2GN5 A;  5C4X G;  4S3S A;  4LF5 Q;  1YIT A;  5AFW A;  3GTM B;  1PFM A;  3U4V A;  1O7Z A;  3HOW G;  2KQ3 A;  3PO2 G;  3LWE A;  4A3J G;  1AZP A;  4O42 A;  1EY6 A;  1GD7 A;  3NPP A;  1AP0 A;  2WP8 J;  4CJ1 B;  5M5X H;  3MA2 B;  1TWH B;  4JK1 C;  3GV6 A;  3FVQ A;  1NMF A;  1ESF A;  4HJ7 A;  1NAP A;  1WCM B;  2A69 D;  1ONL A;  1WYD A;  4MN3 A;  3TRE A;  3U9O A;  2IX1 A;  4JI6 L;  5IGC A;  3D4D A;  3L3O C;  5ELO A;  4K0K Q;  2UUC L;  3F2D A;  1RF2 D;  4RCN A;  2PI2 E;  2DUD A;  3BZK A;  3PUZ A;  3E9I A;  5BN4 A;  3CCM A;  4LF7 L;  4FXK C;  4TRD A;  3PUV A;  1YNN C;  3RZD H;  3STB C;  4IFD G;  1BCP D;  1B1Z A;  2RF4 A;  3G6J B;  4HJ9 A;  1Q81 C;  2KJX A;  2RCN A;  4P73 A;  2L9H A;  3P1H A;  2RSO A;  3QJY A;  4XDX A;  5C4H A;  2JE6 I;  3S9W A;  2VQF Q;  1F9Q A;  2VB3 X;  2R7F A;  4ME5 A;  5JEA G;  1P16 A;  5GAD C;  5IY0 A;  5C0X G;  2AMC B;  4J8Q A;  4X65 Q;  5C5L A;  5DLQ E;  3NK9 A;  3PIP 3;  3OIP A;  5ELF A;  2ICI A;  3S24 A;  1OXT A;  3LWU A;  3M4Y A;  3M85 A;  1L2F A;  2AKW B;  4G7H C;  4FDB A;  1KDA A;  1WTR A;  1ZYR C;  3HEJ A;  3CF5 A;  2Z8L A;  3CCR A;  1HA5 A;  3I4O A;  2Q2T A;  4DV4 L;  4U68 A;  5HUR A;  2G5D A;  4RHR A;  5C4J H;  3CC2 A;  4IUU A;  4CDD C;  1D6E C;  2OTJ A;  3OSO A;  1S3O A;  4A3D B;  1ICW A;  3WOE A;  1Y1V H;  4IAL A;  1STE A;  5ISR A;  1XPU A;  1SN8 A;  2VQE L;  1IZ6 A;  2QW7 A;  3ERO A;  2R7Z G;  2A6E C;  2OTL A;  3WOF A;  3A55 A;  2N88 A;  3ZYY X;  4DFA A;  3CCJ A;  1VQB A;  2Q8I B;  4MHE A;  1EZ6 A;  2LKV A;  3FRP B;  3T1Y L;  1EOT A;  2Q2I A;  3BYT B;  3RN2 A;  2EZV A;  4DGZ A;  1PYB A;  1U4M A;  3M9B A;  3E0E A;  4RMF A;  1TQO A;  1O7I A;  3DM3 A;  3OIQ A;  2F03 A;  1HNW Q;  3JAM i;  2QDL A;  3CCQ A;  2R92 G;  4UP9 A;  4ZKB B;  1U9R A;  4DR6 Q;  4C3J H;  3NHH A;  4PNY A;  4CKE A;  4YWL A;  2F4V Q;  5IP9 G;  4R4C A;  1E2V A;  5C3E B;  1CHQ D;  3HOU B;  3E3X A;  2NN6 G;  2E74 C;  4DAV A;  3ERQ A;  1EQT A;  2ZT9 C;  3S16 H;  2KED A;  4GNX A;  3BZC A;  5C5M A;  5C4X H;  3G4S A;  3HOW H;  2Z4I A;  3PO2 H;  3RZO B;  5J39 A;  2AQ1 B;  3IAY A;  4A3J H;  4UP7 A;  1SAP A;  2E2D C;  2JEB I;  1DOK A;  3GTQ H;  4CDF C;  4XQQ A;  4R8N A;  4OO1 G;  1YVC A;  2MO1 A;  3EN2 A;  1FVI A;  2PW5 A;  2B8G A;  3C2P A;  2ZJP A;  4YCU A;  4Y7N B;  2L1B A;  4JI5 L;  4HID A;  4WRD A;  5JOB A;  4DV2 Q;  4JI4 Q;  1YBY A;  1BCP C;  1YNX A;  2NVX H;  1PTO D;  3T4A C;  1I50 B;  5IT9 L;  1C8C A;  3AQQ A;  5JJK A;  4LF9 Q;  1Y1W G;  2WB1 G;  1STA A;  4IFD H;  1NSN S;  1VQL A;  3ULJ A;  1SYG A;  3DWA A;  5FLX E;  4HIK A;  4CKC A;  3M4P A;  3P7J A;  4FXG C;  3NBI A;  1K83 B;  2EXD A;  4J15 A;  4IUQ A;  4KKS A;  4K14 A;  1E3P A;  5JEA H;  3PO3 G;  4CDE C;  4MZ9 A;  4EQN A;  5C0X H;  3PMF A;  1D1I A;  3S1M B;  2LFN A;  4HTH A;  4FP5 D;  4R1J A;  2NYZ D;  2PZW A;  1IBL Q;  4YY3 Q;  5LMU Q;  2DNE A;  1BBX C;  1UUP A;  2HT1 A;  4G7O C;  4LF6 Q;  2N49 A;  4N8X 1;  1A3U A;  2PMZ E;  3K0Y A;  1PTO B;  1CT1 D;  1XXG A;  1Y14 B;  2X69 A;  4PV1 C;  3S1N H;  2BH8 A;  4X3S A;  3SK6 A;  3UE0 A;  4OGQ C;  1TWF B;  3SVM A;  3MZ5 A;  1MKH A;  4DR2 Q;  3MXN A;  1RIP A;  1ZEQ X;  1K3B C;  5EPJ A;  1XTD A;  3K59 A;  2R7Z H;  4DR4 Q;  1X9N A;  5FLX L;  1ET6 A;  4IQZ A;  3PF5 A;  1VF5 C;  4AYB B;  1EZ8 A;  3CCE A;  4FXD A;  5COY A;  2YYZ A;  3H3V C;  2HIX A;  2FJ2 A;  3EIV A;  4QIW E;  4X3K A;  4WFN 3;  2ZJR A;  3H15 A;  1VQK A;  1SLJ A;  3MAQ A;  4IPG A;  4KI0 A;  1IL8 A;  2J4X A;  2R92 H;  3DM1 A;  1QE6 A;  3DMU A;  4QB4 A;  1K3R A;  5IP9 H;  1AH9 A;  1A6X A;  2E75 C;  1CTM A;  1SRU A;  2PZU A;  5GQO A;  4ZKC B;  5IYC G;  2NN6 H;  3GTO H;  4A3B B;  4P71 A;  1VQP A;  2A1A A;  2Q8T A;  5C6A A;  1GUO A;  5I9P A;  2EYH A;  4JVZ A;  3GTL H;  5K5P A;  1G6Z A;  3HG9 A;  2XGT A;  2A68 C;  1IBM Q;  1D7Q A;  3J7A F;  4K6D A;  4JI2 Q;  2E2J H;  2B39 A;  2OCE A;  1I6V C;  4H0L C;  5A2Q E;  3J80 E;  1B4O A;  4LUV A;  2B2W A;  4OO1 H;  1C48 A;  3M7G A;  3NTH A;  2C5C A;  1RHP A;  4ZQ3 A;  4OX9 L;  2TSS A;  3NWS A;  2PYK A;  4B3M Q;  3GQB A;  4DR3 Q;  1RD9 D;  2Z1C A;  3K58 A;  4F7X A;  1IW7 C;  2ATW A;  2IL8 A;  3ICE A;  1JT8 A;  1HA6 A;  3QO2 A;  1B3A A;  5TSS A;  1N32 L;  2KCN A;  5EKI A;  1KAW A;  1RTO A;  2HCI A;  1O7Y A;  3S17 H;  4A3L G;  3HOZ G;  1Y1W H;  4TQU S;  2Z6K A;  2HIV A;  2NTT A;  3C1F A;  1G8Z D;  2KHJ A;  1MI2 A;  1I3Q H;  3E5S A;  1I6H H;  1S4Z A;  5IGD A;  4GOP A;  4LJZ C;  1IHZ A;  1TWC H;  3ONA B;  3NUC A;  2Q2U A;  3NXW A;  1XWE A;  4XQN A;  3IFD A;  1XNQ L;  3BU2 A;  3PO3 H;  4ZLT F;  2KBN A;  1CUK A;  1LYL A;  5FLX c;  1SJE D;  4KJN A;  1HZC A;  2ZJQ A;  1B53 A;  3MVV A;  4DV3 Q;  2EPB A;  3FHW A;  4KJO A;  3A7A B;  2BA1 A;  1SFO B;  1ML0 D;  1DYQ A;  3KLR A;  1EWH A;  3U50 C;  3I72 A;  1T9H A;  3E0J A;  3RMH A;  1QWY A;  4K5W A;  3K0X A;  2GA4 B;  4IPH A;  1K0R A;  3BDO A;  3K7A B;  3F2B A;  1MD2 D;  1WCM G;  4RGT A;  5C44 B;  1D1K A;  1TVX A;  4KLK A;  4C3H G;  5EPL A;  3J81 E;  1BVS A;  3DWQ A;  1LT5 D;  4LF5 L;  4I65 A;  3BS1 A;  4N9P A;  1AEX A;  3M4O H;  1JJ2 A;  2O5J C;  1DOM A;  1EY8 A;  1H9M A;  4LK1 C;  3NEM A;  1JB3 A;  3TQY A;  2UXC Q;  3N6R A;  4QUC A;  3VR2 A;  1WVL A;  4HAE A;  1LTR D;  1UNS A;  1ENF A;  2HQE A;  2F4I A;  4L63 B;  5BN5 A;  1IYV A;  1JOO A;  2YU9 H;  2GVA A;  3MFY A;  4RGO S;  5CV6 A;  2QA4 A;  4LFC L;  1F2Y A;  5IYC H;  1EEI D;  3KBX A;  2K5V A;  3F8T A;  2MUY A;  2ZM6 Q;  1QJO A;  1V1P B;  4B08 A;  4A3I B;  3GTJ H;  1STG A;  3IFT A;  1JOK A;  2UU9 Q;  3DHQ A;  1PZJ D;  1G51 A;  1KRT A;  1A3V A;  1L1O C;  2K5W A;  2HCC A;  2PW7 A;  3P75 A;  1VQ5 A;  2EJF C;  2VQF L;  5J3B A;  4A3M G;  5M3M G;  5KND A;  1SEB D;  4DV5 L;  4X65 L;  2RDG A;  2F3V A;  4F88 A;  4RGN A;  3NBH A;  4IOA A;  3J80 c;  2PZT A;  1KDC A;  1NTG A;  3C3L A;  5IOC A;  1EYD A;  4WJW A;  5IGG A;  2JK8 A;  1BUV T;  3UDF A;  4QF4 A;  4A3L H;  3S1Q B;  3J7A V;  3HOZ H;  1F2L A;  3WWV A;  4JOI A;  3R8B A;  2E5L Q;  3MHB A;  2Y0S G;  4JV5 Q;  1XJV A;  1E0B A;  2DN8 A;  3A8K E;  5I6W A;  2AUK A;  1IYJ B;  2OXP A;  4R4I A;  5C4Z A;  3OYY A;  2F1M A;  3EFX D;  2WB1 E;  3I70 A;  2YV5 A;  2NVY H;  4JI7 Q;  1QVF A;  3EBE A;  4OWX B;  3BG3 A;  1TS4 A;  5M5Y H;  2ZXP A;  1RCV D;  4A3F B;  3K7U C;  3ULP A;  4MTK A;  1RJT A;  3K6O A;  2R93 B;  4O1N A;  4JYA L;  1E24 A;  1B44 D;  4APV A;  4DK6 C;  4IO9 A;  1WTW A;  1K8A C;  5H1S E;  2ENB A;  4A93 B;  3D6W A;  4YHH L;  2B2V C;  1JOQ A;  1I5F A;  4ZUJ A;  1HNW L;  1BDO A;  4M1U B;  5FLM G;  1N36 Q;  1SSO A;  1WJJ A;  1ICF B;  4EQP A;  4OHJ A;  2F4V L;  3MXG A;  1C9O A;  3OTO Q;  5KYL A;  1WCM H;  2K5D A;  4C3H H;  4HIM A;  1K28 A;  2FMM A;  1HUM A;  1FJG Q;  1X6O A;  4JI3 Q;  1SBB B;  4NXN L;  2JA7 B;  3Q23 A;  1YNN D;  3STB D;  3NWT A;  5DEH A;  1PZI D;  1S72 A;  1MJC A;  2OEO A;  5F2D A;  3J81 c;  5DAU A;  4CHT B;  1A8V A;  1H9R A;  1V43 A;  1HHV A;  4EX5 A;  5EBD A;  2MO0 A;  3PGZ A;  3GTP B;  2Z0S A;  3JAM L;  3ER0 A;  4IUR A;  3TP8 A;  3Q8D A;  1G29 1;  2R3Z A;  2QKI C;  4R8I A;  2K7V A;  3HFZ B;  1HZ9 A;  5GAE C;  5KRU A;  2CCZ A;  2F0D A;  2KEN A;  4JI4 L;  1A62 A;  3NP8 A;  2XWJ B;  1G91 A;  1M4V A;  5CBA E;  3KJP A;  1VQH A;  3S14 B;  3PV0 A;  4LF9 L;  1GOZ A;  3MXP A;  3H3V I;  4DF7 A;  1B50 A;  2RSN A;  1DZ1 A;  2RHS B;  2BDO A;  1DOL A;  3FP9 A;  1EY4 A;  1ET9 A;  1GUT A;  1I94 L;  4BY7 B;  4NW2 A;  3I4L A;  3NEN A;  5IWA Q;  2NVQ B;  2ZTC A;  1JR0 D;  2A19 A;  1TWA H;  3NE5 B;  4C2M B;  3T53 B;  4A3M H;  5M3M H;  2JP1 A;  2NVT B;  2A6E D;  4NMZ A;  4X6A H;  4RAU C;  1QNU A;  1IBL L;  3P20 A;  4O0A A;  2IW3 A;  4YY3 L;  4ID6 A;  5LMU L;  3LX0 A;  4A3E B;  3K5O A;  4KKT A;  4KV6 A;  2MPM A;  1SNC A;  4E6I A;  2ZXR A;  4LF6 L;  3KF8 A;  1CSQ A;  3H0G B;  3MXU A;  2B2Y C;  5LMN Q;  1GHK A;  2BA0 A;  3T16 A;  1J9O A;  3CU7 A;  4KHZ A;  3CQZ B;  3K5N A;  3Q24 A;  1SJH D;  5IOD A;  1QOH A;  2F0P A;  2UXD L;  1V1Q A;  4G7Z C;  3I4M G;  2F0K A;  1BR9 A;  4DR5 Q;  2HQL A;  5JAV A;  4DR2 L;  3UDG A;  1SNQ A;  2PQA B;  3S2D B;  4DV1 Q;  4QMG A;  4B3S L;  2OQK A;  2MJ8 A;  4DR4 L;  2QIL A;  3S2H H;  1NUC A;  4R4Q A;  1B70 B;  3NTI A;  1AZQ A;  1DM0 B;  2SNM A;  5EBC A;  1JE5 A;  4DK1 A;  2XSC A;  3QB3 A;  4F8M A;  3A8I E;  3OPO A;  1Q12 A;  4H7B A;  1LTL A;  4P74 A;  3AMU A;  5FLM H;  1I4H A;  4DUY Q;  1JB7 A;  3I56 A;  4FF2 A;  4LFA Q;  5BR8 Q;  4C3I B;  3K5L A;  4DV0 Q;  1M1K C;  3HKS A;  2D5D A;  1MGS A;  1NBW A;  2Q8R E;  3VR3 A;  2KCC A;  1AW7 A;  3M3Y B;  4FNF A;  3KJO A;  1SE3 A;  2PNR C;  3EJI A;  1DJR D;  1EU4 A;  5LL6 S;  4HN7 A;  1IBM L;  1VQA A;  5CGK A;  3I3C A;  3VDY A;  4JI2 L;  4IUT A;  4FYD A;  4BBR G;  4ZYS A;  1HCZ A;  1VQ6 A;  4FVM A;  2JXM B;  4JPB W;  3W1G A;  1HZB A;  2L15 A;  1C0A A;  4B3M L;  2HUG A;  4DR3 L;  4BBS B;  2E76 C;  1MIU A;  4LFB L;  2F0O A;  2E2I H;  2UUA L;  2F0G A;  3NBH B;  3L9A X;  2PQE A;  2DNC A;  3CRK C;  3HOX G;  1BO0 A;  3Q0A A;  1TS5 A;  5IGE A;  1EQV A;  2VUM G;  2EYP A;  4DNT B;  1VQF A;  1BCP B;  5M5W B;  1X54 A;  4LAA A;  4OIK A;  2XWB B;  2B2T C;  5D14 A;  1ENC A;  2K5N A;  2XRQ D;  1SYC A;  5C44 G;  3HKZ G;  1A63 A;  1LTA D;  3H91 A;  2EXZ A;  3TP7 A;  5C0X I;  2O5I C;  1F9P A;  1HTP A;  1NR4 A;  3HOY B;  5IT9 E;  3VA7 A;  4A75 A;  5M9O A;  1MBY A;  1JJG A;  4DKA C;  3SK5 A;  4UHV A;  5G3L F;  2NZ1 D;  2HHH Q;  2MQH A;  3AB9 A;  4NDX A;  2CWA A;  1HH2 P;  4BXX G;  4IUN A;  1K9M C;  1I4X A;  3V05 A;  4X3U A;  3DWP A;  1Y69 U;  3GTK B;  1EWI A;  3KYH C;  4HJA A;  1JOR A;  4DAY B;  1SYD A;  1C7Y A;  2FIN B;  1NR2 A;  1N33 Q;  1V8Q A;  5E1F A;  1VQD A;  4NPS A;  1XMQ Q;  1PH3 A;  2R61 A;  3I4M H;  2EYM A;  3EVQ A;  5M5X B;  1HQR D;  1YI2 A;  2IJ0 A;  1E7Z A;  2OF1 A;  2Y0S E;  5FKA C;  1X32 A;  5ELB A;  3J81 j;  2I07 B;  5D65 A;  3K57 A;  2A68 D;  1VQN A;  2B63 G;  1X55 A;  3RD4 A;  2F0T A;  1UE6 A;  1B2T A;  4BY1 B;  1F2Z A;  5ELN A;  1L0Y B;  1VQ7 A;  1TY0 A;  4RGM A;  1F9R A;  4JCV E;  2EYF A;  3OW7 A;  1KC8 C;  1LT4 D;  2B2V A;  2EVB A;  5EKL A;  4L5S A;  1W6J A;  1HR0 Q;  2F3I A;  1V1P A;  1BXT A;  2JJQ A;  2VS1 A;  1IW7 D;  2JA6 G;  1UEA B;  1CI3 M;  3RZD B;  1A2T A;  4PZ8 A;  1GHJ A;  2MHV A;  3MEH A;  3R3O A;  5HGT A;  1SRO A;  1ASZ A;  3MEF A;  2NN6 I;  1B7Y B;  2IWH A;  3K81 C;  3AU7 A;  4LW1 A;  5JVH 3;  3PUX A;  1CZG A;  3GV3 A;  2UXB L;  1LTB D;  4RKL A;  2ZXO A;  1CKO A;  4I7A A;  5LMN W;  1O7L A;  1ZXT A;  2IT1 A;  2JYO A;  1CA5 A;  1BBU A;  1GVP A;  2JA8 G;  1J5E Q;  1HZA A;  4DNR B;  4BBR H;  4JI1 Q;  4ULL A;  1L0W A;  4X3T A;  1YNJ D;  4OO1 I;  1SNM A;  4DUZ Q;  4X66 Q;  1EY9 A;  4IUV A;  1N9W A;  2PMZ B;  3SR1 A;  4AIM A;  4L5T A;  4FO2 A;  2RVL A;  1YZ6 A;  3T56 B;  1CKN B;  1TS2 A;  1PZK D;  1YJ9 A;  2LS0 1;  2R93 G;  4L8J A;  3DEO A;  4HED A;  3O13 A;  3HOX H;  3G6E A;  5C4J B;  4K5X A;  1Q82 C;  2VUM H;  3K5M A;  2E5L L;  1NMG A;  1KQS A;  4CDC C;  4DV6 L;  4KHP Q;  4HJ8 A;  3RN5 A;  1N8R C;  3KF8 B;  5BN3 A;  4A3G G;  4QIW B;  2I5M X;  2F0L A;  3WDN A;  2Z9H A;  1W3S A;  3KLS A;  2E2H H;  4JI7 L;  5AJ3 Q;  1DGS A;  1SE2 A;  2F0I A;  5C44 H;  4I7Z C;  3V96 A;  3FKI G;  2B8F A;  1A15 A;  1GKH A;  2D0P A;  1BCP F;  1N34 L;  4A4I A;  1FGB D;  3GTG H;  3CRL C;  2DJF C;  2LMC B;  4C3J B;  1IKL A;  4B3R L;  5GAH C;  4OIJ A;  3RLO A;  1R4P B;  1HPC A;  2QGQ A;  4BXX H;  4WJ3 M;  1UAP A;  4KTA A;  3W5O A;  1IBK Q;  2E8G A;  3S16 B;  5IT9 c;  3TBI B;  4QUF A;  5IP7 G;  3MC0 B;  4IOC A;  3H6M A;  5C4X B;  2B2Y A;  3KLS X;  1TY2 A;  4H13 C;  1KRS A;  4KD4 A;  3RLN A;  2UUC Q;  3HOW B;  3PO2 B;  5FO8 B;  1FJG L;  3N52 A;  2OQ0 A;  3K80 C;  4JI3 L;  4A3J B;  4KY6 A;  1AE3 A;  2B2U C;  3GTQ B;  2O4X A;  3FPP A;  2K5H A;  3OMC A;  1DON A;  4OXP A;  2B63 H;  1QIL A;  3PUW A;  2JSO A;  4YCW A;  3VR4 A;  5I4D A;  3KDF B;  3J7Y W;  2D9U A;  2KHS A;  4CJ0 B;  5DM6 3;  1CFM A;  4X64 Q;  1WD1 A;  2CWP A;  1SE8 A;  4QJF A;  2QF7 A;  3RR5 A;  3PSI A;  4DNI A;  1EYA A;  5CV8 A;  2NVX B;  3NSW A;  2K04 A;  2LY7 A;  2NZO A;  2WKC A;  4HMJ A;  2J7Z A;  2JA6 H;  3I55 A;  1VQ9 A;  3KLW A;  1E1T A;  2N55 A;  2D2C C;  2NTS A;  1PHJ A;  3MTS A;  2AUJ D;  1TWG B;  1ILQ A;  1C4Q A;  4QQB X;  2B3G A;  2WFW A;  4PMB A;  3S1R H;  4POG A;  3CW2 C;  4EVO A;  1W2B A;  1PRT D;  1YNJ C;  3SK4 A;  1VS0 A;  1UE7 A;  4K2K A;  1RTN A;  2EJG C;  5JJZ A;  5IWA L;  3BYY B;  2H5X A;  1W6K A;  2JA8 H;  2QCP X;  5CV7 A;  1R9T H;  2KCM A;  1SR3 A;  2WAQ G;  4JBK A;  1QZG A;  1GM5 A;  5FO9 B;  1L1O B;  2F0U A;  1RL2 A;  3T1H Q;  4ME3 A;  1A2U A;  1S5E D;  2L5T A;  1HXY D;  4LWC A;  2I0Q A;  1EY0 A;  1Z47 A;  2N3S A;  2AQ2 B;  5JJL A;  4QY7 A;  4PMW A;  1EQR A;  3ERS X;  2R93 H;  2PQA A;  3VA5 A;  1TR5 A;  1HR0 W;  5LMN L;  3U9S A;  3HS0 C;  3R2T A;  1D5X C;  3H09 A;  3QWN A;  4A3C G;  3PQI A;  2PI2 A;  5I2X A;  2MFI A;  2MNA A;  4A3G H;  1K8G A;  2CHB D;  4L5R C;  3C1E A;  4DR5 L;  1OTC A;  5IIF A;  3F2C A;  1ESR A;  1PTO F;  5T1I A;  1D2B A;  4HCE A;  2BE5 C;  4DAP A;  4LF4 Q;  2K1B A;  3SEB A;  3SDZ A;  3FKI H;  1EY5 A;  1V9P A;  1O78 A;  2R92 B;  4G57 A;  2DGY A;  2L11 A;  3HKZ E;  4K0K L;  3A5Z B;  3HOV B;  1WTV A;  1PYW D;  3L0O A;  3J7Z C;  5HGQ A;  1XMO Q;  4M8A A;  4XYQ A;  4LFA L;  3TZU A;  1LM0 A;  5BR8 L;  1BNZ A;  3GTO B;  4NB3 A;  4LF8 Q;  2EJM A;  4DV0 L;  5IP7 H;  1I4P A;  3GTL B;  4GZY C;  4BWG B;  4IPC A;  1PVO A;  4JI5 Q;  5CC4 A;  4Q0F A;  3TP6 A;  3F2U A;  4BBS G;  2EY5 A;  1YIJ A;  3QOJ A;  5IE8 A;  5LHY 1;  1QG7 A;  4DA2 A;  1PH2 A;  4B9X A;  5KNC A;  1B9N A;  1D8L A;  1PLF A;  2M00 A;  4K8I A;  5J22 A;  3OOC A;  1EYC A;  1KAB A;  2CQO A;  3S15 B;  2K32 A;  4AQY Q;  2V4D A;  4X62 Q;  2MGS A;  3OWE B;  1HNX Q;  4A3D G;  2LXK A;  4HSV A;  3A0J A;  1LTI D;  3IRB A;  1II3 A;  3CCS A;  1Y8P B;  1FNV A;  3MFG A;  1HFN A;  3GD7 A;  5E4W C;  5IYB G;  3MWY W;  5I9O A;  3S17 B;  1OXX K;  3PF4 A;  1Y1W B;  1NCV A;  4KD3 A;  2WB1 B;  5E3F A;  4C2M H;  2PPB C;  1LAB A;  1PRT C;  5EAY A;  4NXM Q;  1VQG A;  1I4G A;  3AEV A;  1SND A;  2EYO A;  1SYE A;  2EIF A;  2CKZ B;  1TWC B;  1WI5 A;  4YWK A;  5C3E G;  3JAM E;  3HOU G;  5HY6 A;  1JMC A;  3PO3 B;  3V2T A;  4N8F A;  1G2T A;  4GNX C;  1K8M A;  2VY3 A;  2F3W A;  4Y52 H;  3PCO B;  2Q2H A;  3NQT A;  1S5B D;  3GTM H;  3CQZ H;  4RG1 A;  4PG3 A;  4KY5 A;  4TVA B;  3BDC A;  4DAY A;  4DR7 Q;  1XNR Q;  1JWM D;  4DR6 L;  1QUQ B;  2NUC A;  1FNW A;  1TWH H;  2HHH L;  1O80 A;  1GXD C;  1HTL D;  2K14 A;  1KAA A;  3SE0 A;  3W2D A;  4POF A;  3TS0 A;  1JE4 A;  4JW0 A;  4BY1 G;  1WTQ A;  2F0S A;  2NZH A;  4RWS C;  4JI8 Q;  4A3C H;  1N33 L;  1H9J A;  2V1C C;  3ND9 A;  3I73 A;  3GO5 A;  3M4O B;  3ND8 A;  1XMQ L;  1LV9 A;  2EYL A;  1OXU A;  3D31 A;  3KFU A;  1B9M A;  1TII D;  2A73 B;  2RBM A;  1M90 C;  2YTV A;  1EYG A;  1SMX A;  5CV5 A;  1Q46 A;  4GS3 A;  4QCL A;  1KLG D;  2F0F A;  4XT3 B;  1GO3 E;  2SEB D;  2WIN B;  1S5F D;  1E2W A;  1QCB D;  2G9D A;  2YU9 B;  3FEW X;  1H9K A;  4DV2 L;  4DXG A;  3CPW A;  3KF6 B;  1EL0 A;  2LXJ A;  1FGU A;  2A74 C;  3L7Z C;  1EIF A;  1WTH A;  1Z9F A;  1SMY C;  4K8J A;  1G6P A;  3J80 i;  3GTJ B;  4BS9 A;  3BZD B;  1FYC A;  2XVS A;  2D0O A;  4DK3 C;  5GAG C;  1WTO A;  2EE1 A;  4BBS H;  5IGB A;  1G2S A;  4A3K B;  2AWO A;  2UUB Q;  1U4L A;  2WAC A;  4KHV A;  2VW9 A;  1T5E A;  2PO4 A;  1U5K A;  1VQI A;  1CKN A;  1J5E L;  1KXL A;  4JI1 L;  1LAC A;  4DUZ L;  4A3D H;  1H9S B;  3TZD A;  5K36 G;  4JC0 A;  3QIA A;  3A54 A;  4CKB A;  1CSP A;  1U4P A;  4PZ6 A;  1VMC A;  2KHI A;  5IYB H;  4HIO A;  4UPA A;  1LTG D;  4AYB G;  3D4R A;  2EQS A;  2RKS A;  4XT1 B;  2IY5 B;  4HR7 B;  1KIX A;  2CFM A;  3I2Z A;  5C3W A;  4Z9C B;  3RUZ A;  3QG1 A;  5ELD A;  1HNZ Q;  2RHQ B;  2DJG C;  3A8J E;  1KLU D;  3AFP A;  1Y8N B;  2C35 B;  3HRZ C;  4KHP L;  2NVY B;  5COR A;  1EWC A;  1BF4 A;  2F0W A;  3F1Z A;  5M5Y B;  1DD2 A;  4FF3 A;  5C3E H;  3HOU H;  4YWM A;  4PMC A;  4A3B G;  3KK7 A;  5AJ3 L;  3RNU A;  5JPN C;  2K03 A;  3KUP A;  4CBV A;  2AHO B;  3JC6 6;  4LUZ A;  4DAM A;  2C9O A;  2WII B;  3JAM c;  3E9H A;  3RZO H;  3TEH B;  1I4Q A;  4EQO A;  3FMC A;  4F87 A;  2O2L D;  3EA6 A;  2WAQ E;  4C1N K;  3J81 i;  2B2W C;  2RDH A;  3PIO A;  5M3F B;  3D8G A;  3Q6S A;  1EIH A;  2IHE A;  3CCL A;  3DEP A;  4UY8 C;  1PH6 A;  4C3H B;  1IBK L;  5L37 A;  1T5X D;  4RHS A;  4BY1 H;  1BKB A;  3RLF A;  1LT3 D;  1KL9 A;  3L2P A;  4B3T Q;  2K33 A;  4IFD J;  4Y7N H;  3KDF A;  2K4K A;  1TT2 A;  2M9V A;  2KA7 A;  5FJ8 G;  4LFC Q;  2LSS A;  1I50 H;  2IHF A;  4DPG A;  2KVM A;  2M2L A;  4LMQ D;  3CC7 A;  3H3V H;  4V0B A;  2N78 A;  2Z6K C;  3I4N B;  1LO5 D;  3CD6 A;  2EOT A;  1FL0 A;  5JEA J;  1YJW A;  5C0X J;  1PV4 A;  4DV7 Q;  2H1E A;  4ABN A;  4GOP C;  4RCO A;  1FR3 A;  2H4O A;  4X64 L;  1TKW B;  4BA1 I;  1EU3 A;  4ZK9 B;  2PNH A;  1EFI D;  1XPO A;  4U67 3;  4GKK Q;  1K83 H;  2NB0 A;  1LUZ A;  1WFQ A;  4B9W A;  1VMP A;  1CA6 A;  2HDM A;  4DV5 Q;  1OXV A;  5EJW A;  4GN4 B;  3S1M H;  3I8Z A;  5JPM C;  1PH9 A;  1X3Q A;  1X3F A;  5KGU A;  4IFD I;  3X3N A;  1STY A;  1CK1 A;  2VB2 X;  3H94 A;  4JI0 Q;  1L1O A;  2SNS A;  3IL8 A;  1Y8O B;  1TWA B;  4A3M B;  5M3M B;  4GKJ Q;  4J1M A;  1RKN A;  1PFN A;  1PTO H;  3OMG A;  1KNE A;  1KHI A;  1SE4 A;  4GLV B;  2JA5 B;  2ASB A;  4IJH A;  1KTK A;  4DV3 L;  3URY A;  1HQM C;  1TWF H;  5K36 H;  4IZ8 A;  1MSG A;  3T1H L;  1R4Q B;  4TSS A;  2OWO A;  2FHT A;  1SDF A;  1UE1 A;  4JYA Q;  1JC7 A;  1BOS A;  1Q7Y C;  1PH1 A;  2Y0S B;  4YHH Q;  2K75 A;  4DR1 Q;  4YIJ A;  1LTS D;  3BJU A;  2A6H C;  1E1O A;  1YJN A;  2BH2 A;  1IYU A;  1U0L A;  3R2I A;  2QEX A;  5I2Y A;  3HOV G;  5E4X A;  4MNO A;  5J1Z A;  5FOB B;  3OHX C;  3S2H B;  1L0X B;  1IKM A;  4A3B H;  2EDG A;  4NXN Q;  2UXC L;  4LF4 L;  1D5M C;  1FD7 D;  2IPK D;  4A3I G;  4OL7 A;  4TKO B;  2A69 C;  1MSH A;  1WTX A;  1KNA A;  1F77 A;  2DY7 A;  5IYD G;  4BA2 I;  3UDX A;  3LNN A;  1XMO L;  2XTI A;  4N9T A;  3I91 A;  2F52 A;  4LF8 L;  2EY1 A;  1D5Z C;  1SYB A;  2F0V A;  1YHQ A;  1HJP A;  1V1O A;  1Q90 A;  2ZM6 L;  2SOB A;  2K01 A;  2UU9 L;  3K8A A;  1FNU A;  5FJ8 H;  4QGU A;  2YTX A;  1CKM A;  4H44 C;  3TDQ A;  4JOI C;  3QOL A;  3ULL A;  1E22 A;  1TS3 A;  2KEC A;  5CBE E;  2ES2 A;  2ALY B;  1PFB A;  1E2Z A;  2K5Q A;  1TWG H;  1XYI A;  3CAM A;  2BCO A;  1ENA A;  4AQY L;  1I94 Q;  1WOC A;  5KEE A;  4X62 L;  5KIX A;  4FF1 A;  5KYI A;  4HSP A;  1HNX L;  4JG2 A;  3VYT A;  4ALP A;  2I46 A;  2E2I B;  3AFQ A;  3U58 A;  3VYS A;  5JVG 3;  4A3F G;  4AH6 A;  1AN8 A;  3SGI A;  4NXM L;  4A93 G;  5KNB A;  2ID0 A;  4ODG A;  1SFO H;  4JV5 L;  2I5L X;  1Y1V B;  4MIU A;  2DY8 A;  3TP5 A;  1JIC A;  1VQJ A;  2KCT A;  5CV9 A;  1TU2 B;  2BOS A;  3K7A H;  2YTY A;  3TSS A;  1QVC A;  2SDF A;  3TN2 A;  4OWT B;  2F0E A;  4GLX A;  2CH4 A;  1QUQ A;  2X6G A;  4JBM A;  5CV4 A;  1ASY A;  2RCF A;  1LTT D;  4JBJ A;  2UXD Q;  2RDF A;  3BVM A;  4XYO A;  1STH A;  2JA7 G;  2BE5 D;  3CMA A;  1P8L A;  1H95 A;  4B3S Q;  3G7L A;  4DR7 L;  1N36 L;  5EKK A;  1XNR L;  2KUM A;  2EY2 A;  4RKB A;  5E7N A;  5D3D A;  2D62 A;  4OEL B;  4JI6 Q;  1PYS B;  1STN A;  3OTO L;  4GLA C;  3A56 A;  1LLR D;  4ZAI A;  1J8I A;  5IGF A;  3SXH A;  3CXC A;  2NBF A;  1VQC A;  4AYB E;  1CQF A;  1SYF A;  3I4M B;  4XIG S;  4JI8 L;  1K73 C;  4LF7 Q;  2EY6 A;  4P2C B;  3HOV H;  2F0M A;  1JQY D;  4J6H A;  1HFG A;  2WV6 D;  4ZRZ A;  5ELC A;  2X6L A;  4IPD A;  3TRZ A;  2CVR A;  4IJL A;  1PH4 A;  1UWV A;  1SNO A; 
#chains in the Genus database with same CATH homology
 3IRB A;  3KF6 A;  4LF6 L;  3CCS A;  4A3I H;  4GNX A;  1MJE A;  3BZC A;  1CSQ A;  5C4X H;  3G4S A;  3GD7 A;  5IYB G;  4P72 A;  4BY7 G;  3HOW H;  5LMN Q;  2K50 A;  4GN5 A;  3PO2 H;  2BA0 A;  1OXX K;  3G71 A;  4A3K G;  3PF4 A;  4C2M H;  1A0I A;  4A3J H;  4KHZ A;  4UP7 A;  2JEB I;  5EAY A;  4NXM Q;  3GTQ H;  5IYD H;  2UXD L;  1V1Q A;  1VQG A;  3UE1 A;  3AEV A;  3I4M G;  4OO1 G;  4DR5 Q;  1YVC A;  2MO1 A;  3EN2 A;  2HQL A;  4DR2 L;  3S15 H;  3UDG A;  1S40 A;  2PQA B;  2EIF A;  2CKZ B;  1FVI A;  4DV1 Q;  1WI5 A;  4B3S L;  2OQK A;  4DR4 L;  1VQ8 A;  2ZJP A;  3S2H H;  4YWK A;  1QVG A;  4LFB Q;  1VQE A;  5C3E G;  1XPR A;  3HOU G;  1OXS C;  4R4Q A;  4YCU A;  4QL5 A;  5HY6 A;  1B70 B;  4A3E G;  1JMC A;  1JE5 A;  2UUA Q;  4JI5 L;  4GNX C;  1EUJ A;  2VY3 A;  4DV4 Q;  4DV2 Q;  4HID A;  4JI4 Q;  2UUB L;  1Q12 A;  1YBY A;  1YNX A;  2NVX H;  4Y52 H;  1LTL A;  3H0G G;  3PCO B;  3S1Q H;  2Q2H A;  4P74 A;  3AQQ A;  3GTM H;  3CQZ H;  4RG1 A;  5FLM H;  5JJK A;  2AWN A;  4PG3 A;  4DUY Q;  1JB7 A;  4P75 A;  3I56 A;  4LF9 Q;  1Y1W G;  3M7N A;  2WB1 G;  4TVA B;  4LFA Q;  1PA6 A;  4DR7 Q;  5BR8 Q;  1PFS A;  5GRO A;  1XNR Q;  1VQL A;  4DV0 Q;  2VQE Q;  1M1K C;  3ULJ A;  3HKS A;  1Q1B A;  1NY4 A;  4R4O A;  4DR6 L;  1QUQ B;  1Q8K A;  1TWH H;  2HHH L;  1NBW A;  3CME A;  4HIK A;  3T1Y Q;  2K14 A;  1IXR A;  3CP0 A;  3M4P A;  4POF A;  3TS0 A;  2ZTE A;  2EXD A;  4J15 A;  4BY1 G;  3KJO A;  4A3F H;  4HJ5 A;  2NZH A;  1E3P A;  3PO3 G;  4MZ9 A;  1IBM L;  1VQA A;  4JI8 Q;  4A3C H;  1N33 L;  3AYH B;  2V1C C;  1EFW A;  3VDY A;  4JI2 L;  2JEA I;  4A93 H;  3GO5 A;  4R1J A;  1IBL Q;  1XMQ L;  1VCI A;  4BBR G;  1HNZ L;  4YY3 Q;  1VQ6 A;  5LMU Q;  1OXU A;  3D31 A;  3KFU A;  3W1G A;  1M90 C;  2YTV A;  5M3F G;  1EYG A;  1HZB A;  1UE5 A;  2HT1 A;  2L15 A;  1SMX A;  1C0A A;  4B3M L;  1Q46 A;  4LF6 Q;  4GS3 A;  4DV1 L;  4DR3 L;  2N49 A;  5JJI A;  2IX0 A;  1BBW A;  1MIU A;  2JQO A;  4LFB L;  1GO3 E;  2PMZ E;  2E2I H;  2UUA L;  2JA7 H;  3NBH B;  1Y14 B;  4DV2 L;  3S1N H;  2BH8 A;  3CCV A;  3HOX G;  3UE0 A;  3CPW A;  3KF6 B;  3CC4 A;  2VUM G;  1MKH A;  2LXJ A;  4GNX B;  4DR2 Q;  1FGU A;  3L7Z C;  4DUY L;  1RIP A;  1VQF A;  1EIF A;  1Z9F A;  3U4Z A;  1XTD A;  2R7Z H;  4DR4 Q;  1X9N A;  1X54 A;  1G6P A;  2A8V A;  1NE3 A;  3J80 i;  1Q86 C;  3I4N G;  3PF5 A;  3PIP A;  4UP8 A;  2D0O A;  4DK3 C;  3GTP H;  3CCE A;  5GAG C;  4BBS H;  2K5N A;  2YYZ A;  2HIX A;  3EIV A;  2AWO A;  4QIW E;  2UUB Q;  5C44 G;  2VL6 A;  2ZJR A;  3HKZ G;  3H15 A;  4B3T L;  1VQK A;  1SLJ A;  4OON A;  1A63 A;  4IPG A;  4KI0 A;  2N8N A;  5C0X I;  2R92 H;  2VW9 A;  1U5K A;  1VQI A;  1VQO A;  4A75 A;  1CKN A;  1J5E L;  1K3R A;  1KXL A;  1JJG A;  5IP9 H;  1AH9 A;  4JI1 L;  4A76 A;  1J6Q A;  3S14 H;  4DKA C;  4DUZ L;  4A3D H;  1SRU A;  5GQO A;  2HHH Q;  2MQH A;  5IYC G;  5K36 G;  2CWA A;  1HH2 P;  3GTO H;  1K9M C;  4BXX G;  4MTN A;  4P71 A;  4JC0 A;  2A1A A;  1VQP A;  2UXB Q;  1CSP A;  4DV7 L;  3GTL H;  4PZ6 A;  1EWI A;  3KYH C;  3TS2 A;  2KHI A;  5IYB H;  4DAY B;  4HIO A;  4UPA A;  2XGT A;  4HJA A;  4BY7 H;  4AYB G;  4A3K H;  1C7Y A;  3W1B A;  1IBM Q;  2NVQ H;  1D7Q A;  1QZH A;  2EQS A;  1N33 Q;  4GKK L;  2IY5 B;  1KIX A;  1VQD A;  4JI2 Q;  3CCU A;  4NPS A;  2CFM A;  3I2Z A;  2E2J H;  2OCE A;  1XMQ Q;  4LUV A;  1PH3 A;  3I4M H;  1HNZ Q;  2NVT H;  3I7F A;  2RHQ B;  1YI2 A;  1E7Z A;  2Y0S E;  3G48 A;  4OX9 L;  2JA5 G;  3A5U A;  1YEZ A;  3AFP A;  3J81 j;  2C35 B;  3ZJY C;  3HOY G;  4KHP L;  4B3M Q;  1VQN A;  2B63 G;  1X55 A;  3F1Z A;  4DR3 Q;  5C3E H;  3HOU H;  1UE6 A;  4A3E H;  4GN3 B;  2ATW A;  4JI0 L;  4YWM A;  3ICE A;  1JT8 A;  5ELN A;  4A3B G;  1VQ7 A;  5AJ3 L;  3RNU A;  1N32 L;  4JCV E;  1KC8 C;  2AHO B;  3JC6 6;  3PUY A;  4LUZ A;  3H0G H;  2R6G A;  1KAW A;  4L5S A;  4DAM A;  3B6Y A;  1HR0 Q;  4GKJ L;  2F3I A;  3S17 H;  3JAM c;  4A3L G;  1YHA A;  3E9H A;  3RZO H;  3TEH B;  3HOZ G;  4DV6 Q;  1Y1W H;  2JJQ A;  4TQU S;  4XTC S;  2VS1 A;  1X65 A;  2Z6K A;  2WAQ E;  2JA6 G;  2HIV A;  3J81 i;  3PIO A;  4PZ8 A;  2B29 A;  2KHJ A;  2IHE A;  1I3Q H;  3CCL A;  1I6H H;  4GOP A;  1PH7 A;  1SRO A;  4UY8 C;  1ASZ A;  3MEF A;  2NN6 I;  1PH6 A;  3S2D H;  1TWC H;  1B7Y B;  3CPF A;  1IBK L;  3K81 C;  4LW1 A;  3PUX A;  2Q2U A;  4BY1 H;  1BKB A;  3RLF A;  1XNQ L;  2UXB L;  3BU2 A;  3UDI A;  3PO3 H;  2KBN A;  1KL9 A;  3L2P A;  1CUK A;  1CKO A;  1N34 Q;  4EQ5 A;  3MXN B;  4B3T Q;  4Y7N H;  5LMN W;  1LYL A;  4IFD J;  5FLX c;  3KDF A;  1B8A A;  2IT1 A;  1HZC A;  2ZJQ A;  2K52 A;  4B3R Q;  1X3G A;  2K4K A;  4JBW A;  1BBU A;  2R7D A;  1GVP A;  5FJ8 G;  4DV3 Q;  2LSS A;  1UEB A;  3FHW A;  1PH5 A;  1J5E Q;  4LFC Q;  1HZA A;  4BBR H;  2BA1 A;  1I50 H;  4JI1 Q;  4DR1 L;  2IHF A;  1L0W A;  4DPG A;  1EIY B;  3CC7 A;  3H3V H;  3U50 C;  4OO1 I;  4DUZ Q;  4X66 Q;  3OW2 A;  1T9H A;  2N78 A;  2Z6K C;  1N9W A;  5M3F H;  3CD6 A;  4C3I H;  3K0X A;  1FL0 A;  5JEA J;  2FXQ A;  1YJW A;  5C0X J;  1PV4 A;  4IPH A;  4AIM A;  4DV7 Q;  4L5T A;  1K0R A;  1VQ4 A;  4GOP C;  3F2B A;  1YZ6 A;  1JJC B;  1WCM G;  4X64 L;  1CKN B;  4BA1 I;  2PNH A;  1XPO A;  4KLK A;  1YJ9 A;  4GKK Q;  1K83 H;  1VQM A;  3M3Y H;  1LUZ A;  1BVS A;  1WFQ A;  3M4Q A;  4OWW B;  4R4T A;  2JA8 G;  2R93 G;  4DV5 Q;  3G6E A;  3HOX H;  1OXV A;  4LF5 L;  1Q82 C;  2VUM H;  1PH8 A;  2VNU D;  1HR0 L;  4GN4 B;  4H02 A;  2E5L L;  4PZ7 A;  4OX9 Q;  1NMG A;  3S1M H;  1KQS A;  4DV6 L;  3M4O H;  4KHP Q;  3D0F A;  4HJ8 A;  3RN5 A;  1N8R C;  1JJ2 A;  1PH9 A;  3I4N H;  3KF8 B;  1X3F A;  4A3G G;  4IFD I;  2I5M X;  3NEM A;  3TQY A;  4JI0 Q;  2UXC Q;  1NJI C;  1W3S A;  2E2H H;  2JA9 A;  4JI7 L;  5AJ3 Q;  1DGS A;  4LUO A;  1N32 Q;  4L5Q A;  4YCV A;  5C44 H;  1L1O A;  1X56 A;  1EQQ A;  3FKI G;  1GKH A;  1AE2 A;  2D0P A;  4GKJ Q;  1N34 L;  4A4I A;  3GTG H;  3A74 A;  1IL2 A;  3J7A 5;  2YU9 H;  1KHI A;  2GVA A;  4GLV B;  4B3R L;  5GAH C;  2QA4 A;  2ASB A;  4IJH A;  4LFC L;  3RLO A;  4DV3 L;  4O2D A;  1TWF H;  5IYC H;  2QGQ A;  1TXY A;  4BXX H;  3T1H L;  2K5V A;  3F8T A;  4X66 L;  4WJ3 M;  3W5O A;  1Y1V G;  1IBK Q;  2E8G A;  2OWO A;  5IT9 c;  3NEL A;  5M5W H;  4WJ4 A;  1YHB A;  5IP7 G;  2ZM6 Q;  3GTJ H;  1XNQ Q;  1UE1 A;  4IOC A;  2UU9 Q;  4JYA Q;  4LNQ A;  3GDE A;  1EOV A;  2GVB A;  1KRS A;  3RLN A;  2UUC Q;  1G51 A;  1KRT A;  1L1O C;  1Q7Y C;  1PH1 A;  3LGJ A;  1FJG L;  2OQ0 A;  3K80 C;  4JI3 L;  4YHH Q;  1VQ5 A;  2K75 A;  1Q1E A;  2VQF L;  1AE3 A;  4GOP B;  5J3B A;  4A3M G;  4DR1 Q;  5M3M G;  1X3E A;  4DV5 L;  3BJU A;  4X65 L;  1E1O A;  3DLL A;  1YJN A;  2JA5 H;  2K5H A;  2VZA A;  2BH2 A;  3HOY H;  3HOV G;  1U0L A;  2QEX A;  4OXP A;  2B63 H;  4MNO A;  3PUW A;  4YCW A;  2I5H A;  4IOA A;  3KDF B;  3J80 c;  3KOJ A;  1NTG A;  4X64 Q;  4A3B H;  2CWP A;  4NXN Q;  2UXC L;  4LF4 L;  1SE8 A;  4QJF A;  3RR5 A;  2ZTD A;  3PSI A;  1KD1 C;  4A3I G;  2JK8 A;  3GTK H;  4DNI A;  3UDF A;  2GN5 A;  4A3L H;  5C4X G;  4LF5 Q;  1YIT A;  3HOZ H;  3WWV A;  4JOI A;  3U4V A;  3HOW G;  2NZO A;  2E5L Q;  3PO2 G;  2JA6 H;  2Y0S G;  4JV5 Q;  3I55 A;  1XJV A;  4A3J G;  1VQ9 A;  3KLW A;  1E1T A;  5IYD G;  1GD7 A;  4BA2 I;  1IYJ B;  2WP8 J;  1PHJ A;  4R4I A;  3UDX A;  3OYY A;  5M5X H;  1XMO L;  2WB1 E;  2XTI A;  1NMF A;  2YV5 A;  4QQB X;  2F52 A;  4HJ7 A;  2B3G A;  2WFW A;  3S1R H;  4POG A;  2NVY H;  1WYD A;  3TRE A;  4JI7 Q;  4LF8 L;  1QVF A;  2IX1 A;  3EBE A;  3CW2 C;  4OWX B;  1W2B A;  5M5Y H;  1YHQ A;  1HJP A;  4JI6 L;  1VS0 A;  1UE7 A;  3K7U C;  2ZM6 L;  3ULP A;  5ELO A;  2UU9 L;  4JYA L;  5IWA L;  3K8A A;  1E24 A;  4K0K Q;  2H5X A;  4APV A;  5FJ8 H;  3F2D A;  4DK6 C;  4IO9 A;  1K8A C;  2UUC L;  5H1S E;  4QGU A;  2JA8 H;  2YTX A;  1CKM A;  1R9T H;  2KCM A;  1SR3 A;  2WAQ G;  2PI2 E;  4YHH L;  4JBK A;  4JOI C;  1QZG A;  2DUD A;  1I5F A;  3BZK A;  3E9I A;  3PUZ A;  3CCM A;  1GM5 A;  1HNW L;  3ULL A;  1E22 A;  5FLM G;  4LF7 L;  1N36 Q;  1L1O B;  1WJJ A;  1RL2 A;  3T1H Q;  2ES2 A;  3PUV A;  3RZD H;  2ALY B;  2F4V L;  3STB C;  1TWG H;  4IFD G;  1C9O A;  3CAM A;  4AQY L;  3OTO Q;  1I94 Q;  1WOC A;  4ME3 A;  4HJ9 A;  2RF4 A;  4X62 L;  1Q81 C;  1WCM H;  2RCN A;  1HNX L;  4LWC A;  4P73 A;  2I0Q A;  2N3S A;  1Z47 A;  4JG2 A;  4C3H H;  4HIM A;  5JJL A;  4ALP A;  4QY7 A;  4PMW A;  1EQR A;  1FJG Q;  1X6O A;  4JI3 Q;  2JE6 I;  3AFQ A;  3ERS X;  4NXN L;  3U58 A;  2R93 H;  2PQA A;  2VQF Q;  4A3F G;  4AH6 A;  1HR0 W;  2R7F A;  5JEA G;  1P16 A;  3STB D;  5GAD C;  5IY0 A;  5C0X G;  2AMC B;  5LMN L;  4X65 Q;  5DLQ E;  1S72 A;  4A3C G;  1MJC A;  2PI2 A;  2MFI A;  3SGI A;  3J81 c;  4NXM L;  4A93 G;  1A8V A;  3S24 A;  1V43 A;  2ID0 A;  2MNA A;  1SFO H;  4EX5 A;  2I5L X;  4JV5 L;  4A3G H;  1K8G A;  2MO0 A;  4L5R C;  1OXT A;  3M85 A;  4DR5 L;  3PGZ A;  1OTC A;  3F2C A;  1L2F A;  1VQJ A;  2AKW B;  2Z0S A;  2KCT A;  4FDB A;  3ER0 A;  4LF4 Q;  3FKI H;  3Q8D A;  1G29 1;  3K7A H;  2YTY A;  1V9P A;  1QVC A;  3HFZ B;  4OWT B;  3CF5 A;  1HZ9 A;  4GLX A;  1QUQ A;  3CCR A;  4JBM A;  5GAE C;  3I4O A;  2CCZ A;  1ASY A;  2Q2T A;  2DGY A;  4DV4 L;  2UXD Q;  4JBJ A;  2KEN A;  4JI4 L;  1A62 A;  3HKZ E;  4K0K L;  2JA7 G;  3A5Z B;  5C4J H;  3KJP A;  1VQH A;  3L0O A;  3J7Z C;  3CC2 A;  2OTJ A;  5HGQ A;  1XMO Q;  1S3O A;  1P8L A;  3CMA A;  3PV0 A;  4LF9 L;  1H95 A;  4B3S Q;  4LFA L;  1LM0 A;  3H3V I;  1Y1V H;  5BR8 L;  4DR7 L;  4NB3 A;  4LF8 Q;  1N36 L;  1XPU A;  1XNR L;  5E7N A;  4DV0 L;  1SN8 A;  5IP7 H;  2RHS B;  2VQE L;  1IZ6 A;  2D62 A;  2R7Z G;  2OTL A;  3FP9 A;  4JI6 Q;  1PYS B;  3OTO L;  3CCJ A;  1VQB A;  4IPC A;  1I94 L;  4JI5 Q;  1PVO A;  4GLA C;  3NEN A;  3T1Y L;  5IWA Q;  2Q2I A;  3RN2 A;  2ZTC A;  4BBS G;  1YIJ A;  1PYB A;  2A19 A;  3M9B A;  5IE8 A;  3E0E A;  1PH2 A;  1TWA H;  3CXC A;  4A3M H;  5M3M H;  1VQC A;  4RMF A;  1D8L A;  4AYB E;  1O7I A;  3DM3 A;  1HNW Q;  3JAM i;  3CCQ A;  4XIG S;  4JI8 L;  1K73 C;  4LF7 Q;  2R92 G;  4UP9 A;  3HOV H;  4DR6 Q;  4C3J H;  4X6A H;  4YWL A;  2CQO A;  1IBL L;  2F4V Q;  4AQY Q;  5IP9 G;  4R4C A;  4O0A A;  4YY3 L;  4X62 Q;  4IPD A;  5LMU L;  1HNX Q;  3TRZ A;  4A3D G;  2LXK A;  4IJL A;  1PH4 A;  3A0J A;  1UWV A;  2NN6 G;  3S16 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...