4GN4B

Obody am2ep06 bound to hen egg-white lysozyme
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
AVYPKKTHWTAEITPNLHGSEVVVAGWVAHLGDYGRVKIVKVSDREGGAAVPVYLERGKTPDHLFKVFAELSREDVVVIKGIVEASEQYGSATGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags De novo protein/hydrolase
molecule keywords OBody AM2EP06
total genus 20
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gn4B00
4DR3Q 2CKZB 3IRBA 2QGQA 2ZTCA 2ID0A 1FVIA 1YJWA 2IHFA 4LUZA 4HIMA 4A3JH 3CW2C 3AQQA 5IWAL 2VZAA 4BY1G 4HJAA 3U58A 1XPRA 2E2IH 1UEBA 2MNAA 3T1HL 4TQUS 5ELOA 3HOZG 1OXUA 2CFMA 5FLMG 2E5LQ 1Q1EA 1QVCA 1KHIA 4LF8L 3J80i 5ELNA 2UUBQ 1WJJA 5GADC 1JE5A 3J81i 2RHQB 4YY3L 3CPWA 1HNXQ 4FDBA 2PQAA 2K4KA 2K5HA 3JAMc 4DPGA 4BBSG 2UXCQ 1ASYA 2XGTA 3KDFB 4DR5Q 3RN5A 4A3EG 1HJPA 1Q12A 2BA0A 1NE3A 4LF4L 2A8VA 1PH5A 1CUKA 3CF5A 4O0AA 4JI1L 1X3GA 1N33Q 1IL2A 1YHBA 5C44H 3F2DA 1FJGQ 2V1CC 5M3FH 3RNUA 2Q2UA 3H0GH 4POFA 2MO0A 4A76A 3W1GA 1N34Q 2HQLA 4R4TA 4EQ5A 5C0XI 1L1OC 1HZ9A 1Y1WH 3S15H 4DR4L 2UUBL 4A3EH 2UUCL 2EIFA 3U50C 3FKIH 4BY7G 2WB1E 1M1KC 3CCQA 1MJEA 4DK3C 2Z6KC 1I50H 2OTLA 1YBYA 1D8LA 4EX5A 2OQ0A 4JI4L 4A3MG 1Y1VG 2B63H 1GM5A 3AEVA 3CC7A 1YHQA 1UE1A 1EQRA 1LTLA 1XNRL 1EIYB 3F2BA 3H3VI 5FJ8H 4BBRG 1E24A 3HOYH 1CKOA 1LYLA 1J5EQ 3EBEA 3I56A 4IOCA 3K0XA 4LF7L 2K5NA 1GD7A 4L5TA 2ZM6L 3STBC 3I55A 2JA8G 2D0PA 1VQ8A 2A1AA 4UY8C 1OXSC 1U0LA 2VQFL 1IBKQ 1IBML 3NENA 2VUMH 2AWNA 1MIUA 5HGQA 1K3RA 1VQOA 3HOVG 4A3CH 4A3CG 2IHEA 3D31A 1QZGA 4GLXA 3TRZA 2BH8A 1HZCA 1UE5A 1VQFA 1E7ZA 2N3SA 5AJ3L 4P71A 4DR6Q 4PZ6A 4AQYQ 4DV6Q 4Y52H 3S1MH 4BBSH 4B3TL 4BY1H 4DV7L 2GVAA 5C0XG 3JAMi 3CCJA 1PA6A 4OX9Q 3GTOH 2HIXA 2RHSB 5LMUL 2CCZA 4DR3L 4OO1G 1X55A 5BR8L 1XMOQ 4JCVE 2KCTA 3PF5A 1EYGA 5C44G 4AIMA 3I7FA 1KIXA 2ASBA 4DV3Q 1L2FA 3KF8B 4X62Q 3TQYA 4IO9A 5LMUQ 1IBKL 1IBMQ 1BBWA 4JI2L 1YHAA 3GO5A 4P72A 1I6HH 2R93G 4C3IH 1I94Q 1DGSA 2JA5H 4L5RC 3GTKH 3CCVA 3S24A 3S2HH 3I2ZA 5IYBG 2VY3A 4BA1I 1YI2A 1HNXL 4JBKA 4A93H 2WP8J 4B3ML 5EAYA 2DGYA 3J7A5 4LF9Q 4JI2Q 1YIJA 5JJLA 3WWVA 1PH6A 1NTGA 3KJPA 2B63G 2R7ZH 5J3BA 2KHIA 2F4VQ 5LMNL 4DUZQ 1Z9FA 3FP9A 4RG1A 3K80C 2R92H 4LF6Q 3TREA 1E3PA 1Q86C 1UE6A 3UE1A 1PH4A 4UP9A 3CMEA 3PSIA 3OTOL 4YCVA 1SMXA 1X54A 3PUWA 1A0IA 4JC0A 3CCSA 2NZOA 3PCOB 3HOZH 2UUAL 4JYAQ 3G71A 1FJGL 3CD6A 3S1NH 4AYBG 3S1RH 1KRTA 4DV0Q 1Y1WG 4JV5Q 1YVCA 4A75A 1P8LA 1V1QA 3W1BA 1PH7A 1M90C 4LF4Q 3HOYG 5M5YH 1EOVA 2FXQA 3ZJYC 4O2DA 4IPCA 3TS0A 4DNIA 5C3EH 3PO3H 2DUDA 1Y14B 1OXTA 4NXNQ 3GDEA 4P75A 3UDGA 2E8GA 3CQZH 3CCEA 4A3IH 1HR0Q 4DR1Q 4DV5Q 2AKWB 5IP7H 3F2CA 3I4MH 4GKJL 4TVAB 2NVXH 4A3KG 1WCMG 3OTOQ 4YWMA 3J7ZC 1Q82C 3H3VH 2WAQG 1U5KA 5JEAG 2ZM6Q 1QVFA 3E0EA 3GTMH 2VNUD 1VQ4A 1Q46A 1VQAA 4YHHL 1HNWL 3K7UC 1O7IA 1KL9A 3BZCA 4RMFA 5GROA 2R93H 1A62A 2ZTEA 1A63A 3FKIG 4QY7A 3CC4A 2JE6I 2MO1A 2UXDQ 4X6AH 4DV1Q 3I4MG 1W3SA 1XNQQ 3H15A 3NBHB 1GVPA 3E9HA 4LUOA 4H02A 1VQHA 4GN3B 5IYDG 3UE0A 4NXML 1IXRA 4B3RQ 4GNXB 3EIVA 1J5EL 4LF7Q 4DKAC 2XTIA 4ME3A 1YJNA 4JBMA 4JI0L 3HOWH 4AH6A 1CKMA 5IY0A 1LM0A 2F3IA 1XNQL 3CAMA 4YCWA 2JEAI 4A3BH 1E22A 1SRUA 2K75A 1KD1C 3OW2A 1VQKA 1XMQL 2JQOA 3HOXG 1PH3A 3PUYA 3I4NH 3HKSA 1TXYA 4JI0Q 2CWPA 5M3MG 1BBUA 2UU9L 2VUMG 4OWWB 3RLFA 5GAEC 3AFQA 3T1HQ 1VS0A 1VQPA 4JI3Q 2LXJA 4PMWA 3M4PA 1CSPA 2YTYA 5IWAQ 1OXXK 1VQCA 3PUVA 4JV5L 3JC66 4DUYQ 5IE8A 4B3MQ 1PH1A 2F52A 2UU9Q 1GKHA 2E5LL 4LF6L 1QZHA 4B3RL 2AHOB 5C3EG 3I4NG 4BXXG 2F4VL 5E7NA 1AE3A 2QEXA 2NN6I 2AMCB 3ER0A 2ZJQA 4WJ4A 4DUYL 2HIVA 2N49A 1SFOH 3CCRA 4IPGA 3RR5A 1PHJA 2OQKA 2ES2A 1J6QA 3I4OA 2B3GA 4X66Q 4OXPA 4DR5L 1IZ6A 1K8GA 2KBNA 2LXKA 5GQOA 1I3QH 3GD7A 4YHHQ 4HIDA 2WB1G 2JA5G 3TS2A 4B3SL 1KC8C 3PUZA 4A3GH 1K73C 4DR4Q 2GVBA 3H0GG 1UWVA 2K52A 4LW1A 1Q1BA 4R4OA 1YJ9A 4DV2L 3MXNB 3ERSX 4JI5Q 1HNWQ 5LMNW 4A3BG 4KHZA 1CSQA 1QUQB 2R7ZG 4JBWA 3CC2A 1VQ9A 3ULLA 4GKKL 2A19A 1L1OB 2UXDL 3M3YH 1B7YB 3HOXH 4DV3L 1G51A 1EUJA 1W2BA 1SR3A 4POGA 4AQYL 1AE2A 2NVTH 3M4QA 1R9TH 3BU2A 4DAYB 2QA4A 2JEBI 2OCEA 3HFZB 4IOAA 2KENA 1V9PA 1UE7A 4R4IA 2JK8A 1S3OA 2Z6KA 3EN2A 1PH9A 5IYDH 2N78A 2Q2IA 4NB3A 3DLLA 2I5HA 2VQFQ 2D0OA 4B3TQ 1X65A 2CQOA 4GLAC 2EXDA 3TEHB 1G291 2ZJRA 4HIOA 1YNXA 3RZDH 3DM3A 3M9BA 3L0OA 3PUXA 4APVA 2VS1A 3SGIA 4QIWE 3G6EA 2K5VA 4DUZL 1XMOL 4IFDG 4QQBX 1HNZL 3HOUG 1T9HA 1YZ6A 2RF4A 2YYZA 2HT1A 4JG2A 4BA2I 3CP0A 4A3DH 1TWFH 2Q2HA 5C4XH 5M5XH 3PO3G 4LFAQ 3S1QH 4OX9L 3T1YQ 1X6OA 4R1JA 4LFAL 4DR7L 4YWKA 1S72A 4LF8Q 3PO2G 4OO1I 1VCIA 4X62L 2JA9A 4A3MH 3M4OH 3A0JA 2ALYB 3HOWG 4XIGS 4DR2Q 4A3KH 1VQEA 2Y0SE 2L15A 4PG3A 3D0FA 2MQHA 4HJ9A 5JJKA 1X56A 1H95A 4A3GG 1RL2A 4L5QA 3HOUH 4DV1L 3RLNA 1SLJA 1N32Q 1V43A 2PI2E 2R6GA 1PH8A 3OYYA 4DV7Q 3AFPA 1E1TA 4GOPB 1IBLL 3STBD 1Y1VH 2VW9A 1I94L 1ASZA 2E2JH 3ULPA 3RN2A 5M3FG 2YV5A 1N32L 1BVSA 4KLKA 3E9IA 3K81C 2VQEL 2IY5B 3NEMA 4DK6C 2Y0SG 2YTXA 4DV4Q 4K0KQ 4GN5A 1IYJB 1VQBA 1PV4A 2JA7H 4HJ7A 4A3FG 1EIFA 3S17H 2NZHA 4DV0L 3PGZA 2IX1A 2PMZE 2N8NA 1VQ7A 1N9WA 4JI8L 5GAHC 3M7NA 3G4SA 4C2MH 4IFDI 1BKBA 1PFSA 3VDYA 2UUAQ 4OWTB 4JI1Q 2UUCQ 1PVOA 4K0KL 1K8AC 4B3SQ 1EWIA 3KF6B 1YEZA 2ATWA 3U4VA 2K50A 3S2DH 5IP9G 5IYCG 4GKJQ 4A3FH 4A4IA 4JI5L 3CCUA 4DV2Q 1K0RA 1VQJA 1IBLQ 2HHHL 1HZBA 1WFQA 2JJQA 3KJOA 1N36Q 4NXMQ 4NXNL 3LGJA 1A8VA 4MTNA 4BBRH 5LMNQ 4A3LG 2BA1A 1XNRQ 3PO2H 1C9OA 1OXVA 1RIPA 3J81j 2RCNA 4LF5Q 2R7FA 4LF5L 4X64Q 4A3DG 4YCUA 5C4XG 1PYBA 1KRSA 1VQDA 1XPUA 1NMGA 4IJLA 2UXBQ 1C0AA 4QL5A 4PZ7A 4C3HH 2EQSA 1N36L 1K9MC 1GO3E 1C7YA 4XTCS 4JI7L 4OONA 1B8AA 3HOVH 4OWXB 2Q2TA 3PF4A 1VQ6A 2I5MX 3CCLA 2YTVA 1B70B 1VQMA 3UDFA 5BR8Q 1Q81C 1WYDA 4LFCL 4JYAL 4X64L 4LFBL 4JOIA 1KAWA 4GNXC 1QVGA 1HZAA 4LUVA 1FGUA 2LSSA 4JI3L 4AYBE 4JBJA 1JJCB 1Q7YC 4A93G 5C0XJ 3J80c 1JJGA 4DR6L 1QUQA 2KHJA 4MZ9A 5JEAJ 3GTGH 3UDIA 3ULJA 3A5UA 4ALPA 1HH2P 4JI6L 4IPHA 1SE8A 4QJFA 3KDFA 4GLVB 2R92G 3FHWA 3B6YA 1HNZQ 1EFWA 3KF6A 4HJ5A 2B29A 1G6PA 1Z47A 4HIKA 1Q8KA 2PQAB 3J81c 2PNHA 3UDXA 4IPDA 2GN5A 4JI7Q 3BJUA 4PZ8A 3CMAA 4HJ8A 1PYSB 2H5XA 1LUZA 4R4CA 4YY3Q 4QGUA 2K14A 2JA6H 4GOPC 4P74A 5IYBH 1VQNA 4IJHA 2VQEQ 1MKHA 4LF9L 2CWAA 4UPAA 4P73A 1VQGA 1TWGH 1VQIA 4R4QA 2NN6G 3W5OA 2AWOA 3BZKA 1EQQA 4GN4B 4Y7NH 3RZOH 3CPFA 1XJVA 5C4JH 4A3LH 2ZTDA 1XPOA 3CXCA 1HR0W 3PV0A 2D62A 1I5FA 2NVYH 2Z0SA 3CCMA 2OTJA 2E2HH 4C3JH 4DAMA 4GOPA 2KCMA 1OTCA 2ZJPA 1N33L 4YWLA 1X9NA 3T1YL 2R7DA 3HKZE 1VQLA 4DR7Q 4IFDJ 5M5WH 1WI5A 1X3FA 5GAGC 5IP7G 4DV6L 1KXLA 2BH2A 4DR2L 2HHHQ 1XMQQ 2I5LX 5FJ8G 4KI0A 1SROA 5JJIA 3A5ZB 1JB7A 1VQ5A 3AYHB 3PIOA 3G48A 4DV5L 4UP8A 3K7AH 1WOCA 4A3JG 3NELA 3KLWA 4GS3A 3M85A 1N34L 4GKKQ 4NPSA 1NBWA 1JJ2A 1D7QA 4X66L 1TWAH 2UXBL 4LWCA 3Q8DA 5IT9c 1X3EA 4GNXA 5K36G 4X65L 5FLMH 4A3IG 1NY4A 1L0WA 5IP9H 4DV4L 2I0QA 1PH2A 4JOIC 2WFWA 1CKNB 1SN8A 1JT8A 3L7ZC 4JI4Q 3S14H 1WCMH 3S16H 1CKNA 1TWHH 4WJ3M 4JI8Q 1TWCH 2JA6G 2JA7G 3GTQH 1JMCA 2NVQH 1FL0A 1E1OA 2IT1A 1N8RC 4JI6Q 5M3MH 5FLXc 4KHPQ 3K8AA 1MJCA 4DR1L 1NJIC 4LFBQ 1HR0L 1P16A 1L1OA 2IX0A 2YU9H 5AJ3Q 2VL6A 3U4ZA 3A74A 1NMFA 2C35B 1AH9A 1K83H 3RLOA 3HKZG 4UP7A 3F1ZA 1YITA 3PIPA 3KYHC 2PI2A 1KQSA 5IYCH 3L2PA 4X65Q 4KHPL 4L5SA 5H1SE 4LFCQ 3ICEA 2JA8H 2MFIA 1S40A 4BXXH 3MEFA 4BY7H 3KFUA 1XTDA 3GTJH 5DLQE 2OWOA 3GTPH 4J15A 5HY6A 2UXCL 3KOJA 3GTLH 2WAQE 4MNOA 3F8TA 4LNQA
chains in the Genus database with same CATH superfamily
4DR3Q 4DXFA 3IRBA 1YJWA 2IHFA 4HIMA 3CW2C 3U58A 2F0DA 4ILWA 2E2IH 1UEBA 3T1HL 1U4MA 4NP5A 2E74C 4QCLA 1QVCA 4LF8L 4QF4A 2RHQB 5K36H 2CW0D 2F0KA 4FDBA 3VR4A 1F2YA 2A68C 2ICIA 3DWAA 3JAMc 1TWCB 3O13A 2FINB 3KDFB 4O1NA 3RN5A 1HJPA 1NE3A 3CKIB 2A8VA 1ENAA 3Q6SA 3CF5A 4JI1L 1TVXA 1X3GA 1SNDA 3NWSA 1VMCA 2K01A 4RWSC 3AMUA 4KTAA 5KYLA 4R4TA 1L1OC 1H9JA 2UUBL 3FKIH 4V190 4MN3A 4RH6A 4BY7B 1K8MA 1M1KC 1I50B 4EQPA 5CYUA 1YBYA 1S5FD 2JXMB 2MGSA 1GM5A 1UE1A 1LTLA 1PZKD 1QB5D 2R7ZB 3HEJA 5FJ8H 1WVLA 4BBRG 3EVQA 4IOCA 3K0XA 1PZID 2K5NA 4L5TA 2RVLA 2ZM6L 2JA8G 1AFPA 1OXSC 3T16A 2XRSD 4C3HB 5HGQA 1WTRA 3L3OC 2F0QA 5TSSA 3D31A 1HZCA 1UE5A 3V2TA 3VR2A 5AJ3L 1UNSA 4DV6Q 4BBSH 4BY1H 4OX9Q 5C0XG 1PA6A 3CCJA 3IKJA 4L8JA 1PZJD 5LHY1 2CCZA 3URYA 4OO1G 1X55A 1XMOQ 3MAQA 1RD9D 3PF5A 5C3EB 2WKCA 1L2FA 1XX8A 2NBFA 3I4MB 1PMRA 1IBMQ 5AFWA 1CI3M 1PXUA 2H1EA 2R93G 4C3IH 4FXDA 4L5RC 2F3VA 3S2HH 2VY3A 1JC7A 2O5JC 4B3ML 5EAYA 4LF9Q 1DONA 2AUKA 1K0SA 3F2UA 4Y7NB 2R7ZH 4ZUIA 3SK5A 5EGTA 5LMNL 4DUZQ 1VMPA 4UP9A 1QE6A 3PSIA 3BZDB 3PUWA 3CCSA 3FDTA 3PCOB 3D3RA 4DAYA 1ESFA 1J8IA 5FOBB 4RKLA 1KRTA 1PFMA 4JV5Q 1V1QA 2FXQA 3ZJYC 1DOLA 3KUPA 4DNIA 5C3EH 2EXZA 4P75A 3UDGA 1LTRD 2E8GA 4RGMA 3CCEA 1HR0Q 3J7AF 3I4MH 1GHJA 5IP7H 4GKJL 5C4HA 1JE4A 3S14B 3TZDA 3J7ZC 1QVFA 4C3IB 3E0EA 3GTMH 4BS9A 1SJHD 3GTKB 4YHHL 1NCVA 3GTQB 1O7IA 2NVQB 5C0XH 1KL9A 3BZCA 2R93H 1C4QA 4QY7A 1CHQD 2PZTA 4LUOA 2EYMA 3E9HA 5IYDG 1VQHA 1YNJD 1MGSA 3UE0A 2B2WA 1KABA 1IXRA 2PZWA 4B3RQ 3EIVA 1J5EL 1G2TA 3HOWH 4ME3A 3RZOB 4DXGA 1XNQL 2JEAI 1E22A 1HQMC 2NVYB 3GTPB 2MP1A 1U4PA 2JQOA 4KY7A 5M3MG 2UU9L 5I9OA 3RLFA 1XXGA 1LLRD 1VQPA 2CW0C 4PMWA 1NAPA 3W2DA 2BDOA 1EU3A 3H09A 2TSSA 5IE8A 2UU9Q 3QO2A 5E4XA 1PLFA 1HRJA 2AHOB 1T5EA 1GUOA 4G7ZC 5ELFA 1JOKA 1AE3A 2QEXA 4ZLTF 4WJ4A 4DUYL 4FF4A 1SFOH 2N49A 3TDQA 1K8GA 2LXKA 5GQOA 3BYTB 4J6HA 4YHHQ 4HIDA 4ZAIA 1TS4A 2JA5G 4B3SL 1KC8C 3PUZA 2EYJA 3D6WA 2N88A 5M3MB 1YJ9A 4DV2L 3ERSX 1I4XA 4K5XA 5JPMC 4A3BG 1BBXC 3VYRA 4JBWA 1L1OB 2UXDL 3HOXH 5FK9C 4POGA 2JA7B 4QUFA 5EPKA 4DAYB 1A6XA 2KENA 1BCPB 1K3BC 2JK8A 1S3OA 3EN2A 1PFNA 3M7GA 5IYDH 2Z6BA 2N78A 2Q2IA 3OW7A 4NB3A 4P2CB 2I5HA 4WJWA 5JVH3 2VQFQ 3HOYB 2D0OA 4HIOA 1YNXA 3MFYA 3PUXA 3CHBD 4QIWE 4DUZL 4QQBX 2HT1A 4IALA 2Q2HA 5C4XH 2EYFA 2L1BA 5CORA 3T1YQ 3S1QH 2ENBA 4XT3B 1MSHA 1WD0A 1BCPD 2L15A 3D0FA 3HOVB 5JJKA 5KRUA 3J80E 1RKNA 4L5QA 2KCCA 3HOUH 3RLNA 1SLJA 1FNWA 4RCOA 1STBA 1X3QA 2MPMA 4K14A 4GOPB 3HRZC 5FKAC 1EY0A 2HQEA 1BQQT 3OPOA 4EQNA 3ULPA 3H6MA 1AZQA 3RN2A 1D2BA 2YV5A 3GTGB 1N32L 2IY5B 5C4ZA 2Y0SG 2YTXA 5BN5A 2K6AA 4WFN3 1VQBA 3HKZB 1PV4A 1GXDC 4HJ7A 4A3FG 5I6YA 2B8GA 4DV0L 2IX1A 2PMZE 1VQ7A 4ABNA 3ND9A 1SJED 5JOBA 4K0KL 4K8IA 2IWHA 1K8AC 4OELB 1YEZA 4DAVA 2K50A 1LTGD 5IYCG 3SVMA 4DV2Q 4HMIA 2QF7A 1IBLQ 1HZBA 2JJQA 3EQLC 1N36Q 3LGJA 5LMNQ 4A3LG 4X3KA 3KBGA 1XTCD 4C3JB 1RIPA 5ISRA 1SYCA 4LF5Q 1NMGA 4A3KB 1C0AA 2M9VA 4C3HH 1K9MC 3A8IE 4FF3A 2P5ZX 4XTCS 2Q2TA 1VQ6A 1JB3A 4LFBL 5BR8Q 1WYDA 3VYUA 2LMCB 3D4DA 1HZAA 4FXGC 1FGUA 4A93G 2PMZB 2MHVA 1QUQA 4MZ9A 5K5PA 3GTGH 2A6ED 3UDIA 2CQAA 1DD2A 1LTID 4IPHA 5JAVA 4O42A 5JJZA 4HN7A 1G6PA 4CJ1B 3A55A 4KD4A 1I6HB 2GN5A 3BJUA 1L0XB 3I72A 3CRLC 4QGUA 3S2HB 4GOPC 4P74A 5IYBH 1VQNA 4IJHA 4KN7C 4IUTA 1R4PB 4R4QA 1VQIA 2NN6G 2AWOA 2B2UA 2XWBB 1QOHA 1ZYRC 2D62A 2F0WA 2VXWA 3CCMA 2OTJA 4C3JH 3D4RA 1RJTA 3I4NB 4IUQA 2EYLA 2JA8B 2WKDA 1KXLA 1F9SA 1Y8OB 2BH2A 1HFNA 4DR2L 2HHHQ 2K5WA 3SEBA 4JVZA 1TY0A 1YNJC 3AYHB 1IW7D 3G48A 3TSSA 3NELA 4GS3A 4NPSA 3X3MA 1TWAH 4LWCA 3RUZA 3NQIA 4GNXA 5K36G 3CQZB 4A3IB 2F0LA 4DV4L 1GUNA 1PRTF 3K6OA 2R3ZA 1CKNA 3PQIA 1TWCH 2JA6G 1FL0A 2R93B 4HMJA 2HDLA 1N8RC 4JI6Q 3K8AA 4DR1L 3NXWA 2IX0A 4LAAA 3A74A 1NMFA 1K83H 3F1ZA 3I4LA 1WTPA 2ICEC 3H0GB 1KQSA 1PTOH 5I9PA 4KHPL 2NWGA 3ICEA 4BXXH 1XTDA 2OWOA 3KOJA 5KNCA 5ELBA 4LNQA 2QGQA 3TMEA 1FVIA 1EY8A 4HJAA 2IW3A 4TQUS 1E2VA 1TWFB 1ICFB 1UEAB 1ET6A 1KHIA 4K5VA 1LT3D 1HUMA 5DAUA 4XQQA 1WJJA 1Z6HA 1FNUA 2J0TD 1H9KA 1HNXQ 2PQAA 2RQXA 2RBMA 3PMFA 1SFOB 4ME5A 5EJWA 1U4LA 3H91A 4BBSG 4DR5Q 3E6ZX 5J39A 4A3EG 1Q12A 3HG9A 4LF4L 2F3WA 1YHBA 2PYKA 1R4QB 1FJGQ 2B2VC 2Q2UA 4KK7A 3H0GH 2MO0A 4A76A 1N34Q 2HQLA 4EQ5A 3RD4A 1HZ9A 5EBCA 3S15H 3JAME 3U50C 4BY7G 3GTJB 2IL8A 1HQRD 1JOOA 3X3NA 2Z6KC 1H9MA 1SNPA 1I50H 1D8LA 5DM73 3HS0C 2B63H 2QDBA 2JN4A 3CC7A 1FYCA 2A6EC 1EQRA 2QILA 2B2TC 1EIYB 3F2BA 2L55A 3A7LA 1CKOA 3EBEA 3I56A 3EA6A 2SOBA 3WDNA 2B2TA 2RA4A 3STBC 3I55A 3G7LA 2D0PA 1U0LA 1IBKQ 4IFDH 4C3HG 1QZGA 3D8GA 4P71A 3R3OA 4PZ6A 4FF1A 3HZXA 2KA7A 2F0FA 2HIXA 2LY7A 1RODA 2DY7A 5M3FB 5BR8L 4JCVE 2NUCA 5C44G 3I7FA 2CH4W 2RKSA 1ENFA 4JI2L 3GO5A 1I6HH 3TP5A 3GTKH 3S24A 2F0HA 2Q8TA 1C48A 4A93H 4PQXA 5CV8A 1RTNA 1SDFA 1LT4D 4QB4A 1YIJA 4FO2A 4C2MB 1LO5D 1EY9A 1KDCA 5J3BA 1CTMA 1I4GA 1Z9FA 3K80C 4LF6Q 3TREA 1EQTA 3K5OA 3CMEA 4MHEA 1MBYA 4FNFA 1UAPA 2LS01 1WTHA 4DU9A 1O80A 1KNEA 4CKBA 5CV5A 3Q23A 4JYAQ 2A69D 4TRDA 1DOMA 2WV6D 3CD6A 1A2TA 3S1NH 4AYBG 1V1OA 4BY1B 1Y1WG 4DV0Q 1YVCA 1P8LA 1PH7A 1S4ZA 1CQFA 1EOVA 1H9RA 4IPCA 4OIKA 3T51B 4XXEA 5J1ZA 3PO3H 2PW7A 3GDEA 3LX0A 4N9PA 4A3IH 4CKCA 1JR0D 3NUCA 4TVAB 2FMMA 1WCMB 5IT9E 3H3VH 2WAQG 1U5KA 2ZM6Q 3S16B 4HTHA 1EWCA 1CA6A 3E0JA 1ICWA 1TKWB 3KLRA 1SSOA 1BCPC 4K8JA 2JE6I 2MO1A 4KJOA 1BR9A 3P7JA 2EOTA 3U9SA 3NBHB 2O5IC 5DNFA 1O7LA 2N55A 4NXML 2PQEA 5IGBA 4LF7Q 4DKAC 5HURA 1JQYD 4AH6A 1CKMA 5A35A 1BF4A 1LM0A 3H3VC 1ESRA 4A3BH 1SRUA 2K75A 1VQKA 3M3YB 1XMQL 3HOXG 3PUYA 1DCZA 4ID6A 4JI0Q 1STAA 4R9WA 4A3JB 1F2MA 4JI3Q 2LXJA 5IWAQ 2DN8A 2F0SA 3A8KE 1OXXK 1PRTB 3PUVA 3JC66 1PH1A 2QW7A 1XYIA 4CGYB 3BG3A 1NR2A 4B3RL 2Z8LA 1HA5A 4ZUJA 2F4VL 5IT9L 2NN6I 3ER0A 1EY5A 3MXUA 4I7AA 2ZJQA 1STEA 4IPGA 1PHJA 2OQKA 4QUCA 4DR5L 1GUTA 4CDEC 2RDHA 1I3QH 1TT2A 3NPPA 1MI2A 2XRQD 3C2PA 2Y0SB 2SDFA 4B9WA 4A3GH 3R2TA 4LW1A 4C1NK 2EY6A 4R4OA 2PPBC 3S15B 3BDLA 5LMNW 1VQ9A 2F0MA 2A19A 5DM63 1B7YB 1EUJA 1SR3A 1XWEA 4AQYL 1R9TH 4G7HC 4H44C 2OCEA 4IOAA 2RDGA 1V9PA 2Z6KA 2K03A 1ONLA 1HCZA 3DLLA 1QCBD 1ZEQX 1X65A 2CQOA 2ZJRA 1KTKA 5LL6X 3SGIA 3G6EA 1XMOL 2K5VA 2VUMB 5COYA 5FLXE 2R61A 3HOUG 1HUNA 3IL8A 5M5XH 4LFAQ 3Q0AA 4OX9L 1X6OA 4R1JA 4LFAL 1FNVA 4LF8Q 4CDDC 4X62L 2JA9A 2WIIB 4M8AA 1B4OA 5FO7B 4KY5A 1CM9A 1LTSD 3OMCA 3J7AV 1TS3A 1X56A 4OO1H 4X3UA 4A3GG 3KF8A 1V43A 4RA8A 5C5LA 3RMHA 3OYYA 3VYSA 3U9OA 1D5ZC 5HGTA 1Y1VH 2HCIA 2OF1A 2G5DA 1GOZA 1BVSA 1IYUA 4KLKA 3E9IA 3NEMA 4DK6C 4DV4Q 3MFGA 1WTOA 3W3AA 2JA7H 5CMDA 3C1FA 1EIHA 3PGZA 1N9WA 4JI8L 5GAHC 3M7NA 2XVSA 3G4SA 4IFDI 1BKBA 2LFNA 4J8QA 3VA5A 4PMCA 1I6VC 1IYVA 3J7YW 2XSCA 2OXPA 2AQ2B 3G6JB 4GKJQ 3QB3A 1KAAA 4JI5L 2RSNA 1WFQA 1Y8PB 1B3QA 3I90A 4NXMQ 2EZVA 1A8VA 2EYHA 4MTNA 5M5XB 2BDNA 1C9OA 1U9RA 3BYYB 1OXVA 4A3DG 2R7FA 3DEPA 1I4QA 3DWPA 1A3UA 5IGEA 1RTOA 3P75A 1CHPD 3EFXD 2EQSA 3K57A 1HA6A 1HFGA 1C7YA 1SYBA 4OWXB 1CQVA 3GQBA 4JOIA 4GNXC 3C1EA 4LUVA 4JI3L 1IL8A 5C0XJ 1OO9B 3K7AB 3NE5B 3ULJA 3A5UA 4ALPA 4IUUA 1HH2P 4NMZA 3R93A 3KDFA 3B6YA 1EFWA 3DWQA 2B29A 3DMUA 1BDOA 2EJFC 1ILPA 4IPDA 2IPKD 2NTTA 4PZ8A 3BVGA 4QMGA 3CMAA 4R4CA 4YY3Q 1LTBD 3LNNA 2NTSA 4UPAA 4P73A 1DOKA 3BZKA 3CPFA 1HHVA 5C4JH 2F0IA 1PTOC 1XPOA 3CXCA 4S3SA 3OMGA 2KEDA 1OTCA 4DR7Q 2R7DA 3HKZE 3K5NA 1M8AA 2WB1B 1X3FA 5GAGC 5IP7G 4OEMB 4DV6L 2J7ZA 4K2KA 1XMQQ 2I5LX 3A5ZB 3NTIA 1JB7A 4UDUC 1VQ5A 4HEDA 4DNRB 2HD3A 3J80L 3DEOA 5EBDA 2K28A 3MXGA 2DJFC 5JVG3 1PTOF 3K5MA 4X65L 5IP9H 4JOIC 2WFWA 1SYGA 4C1NI 5I2XA 3DUZA 1RHPA 3S14H 1V8QA 1QJOA 1TWHH 4F87A 4F88A 4QIWB 2DNEA 1YNND 2IT1A 2Z9HA 4K5WA 3SXHA 1W6KA 1L1OA 2YU9H 3KBXA 1AH9A 2NB0A 3K58A 3RLOA 4UP7A 2E2HB 4C3IG 1YITA 3KYHC 1MSGA 3L2PA 1TIID 1S5DD 4L5SA 4LFCQ 3L9AX 2H4OA 4A3BB 5DEHA 1FD7D 4G7OC 5IGGA 5DLQE 3GTPH 4J15A 2EVBA 5KIXA 2L9HA 3F8TA 2CKZB 2FHTA 5I2YA 2ID0A 4DGZA 2EY5A 4BY1G 3T56B 2MNAA 5ELOA 5C4XB 2Q8IB 1V1PA 2G9HD 1OXUA 2CFMA 5FLMG 2E5LQ 1G6ZA 4FXKC 5CR3A 4A3MB 1JE5A 2HUGA 1I4HA 4UHVA 3CPWA 1TWHB 2K4KA 3TP6A 4DPGA 2UXCQ 1ASYA 2BCOA 2BA0A 1AEXA 1CUKA 4O0AA 4ZK9B 1IL2A 4CDCC 5IIFA 3F2DA 3OOCA 2V1CC 5M3FH 3RNUA 1PDQA 4EGVA 4TSSA 4POFA 3V96A 5CBAE 3OIPA 1EYCA 4A3EH 2EIFA 4ULLA 1JWSD 1F2ZA 5CV9A 3SK4A 4K6LA 4RKBA 4C56C 4EX5A 4JI4L 1DZ1A 4A3MG 1Y1VG 3AEVA 1XNRL 5E1FA 1SE3A 3HOYH 1LYLA 1KDBA 2XWJB 4LF7L 3PO2B 2R92B 4IZ8A 4HAEA 4ZKCB 3OIQA 1B44D 3T53B 1EIGA 1EL0A 1VQOA 4G57A 4GLXA 4KHVA 1VQFA 3UI2A 1ML0D 3J81L 2N3SA 4AQYQ 3DXJC 4Y52H 3S1MH 4B3TL 1EQVA 3DM1A 2GVAA 4DV7L 3JAMi 1WTVA 5FO9B 2WAQB 3D6CA 3MZ5A 1EYGA 1G2SA 2K7VA 2KOLA 1CFMA 1HTLD 4X62Q 4IO9A 1IBKL 1BBWA 1PTOD 1YHAA 4P72A 2XN9C 3CU7A 5I4DA 1I94Q 1DGSA 2JA5H 4LJZC 2F0EA 2SNMA 1HPCA 5IYBG 1YI2A 1QNKA 1HNXL 2WP8J 3AU7A 3J7A5 2DGYA 2ZXRA 5M9OA 4U68A 1TWGB 5JJLA 3WWVA 1PH6A 3KJPA 1VF5C 4ZCKA 3VYTA 2KHIA 2F4VQ 2ZXPA 4RG1A 3SHLA 1LT5D 1E3PA 3P1HA 1Q86C 4A3FB 2X6GA 2Z1CA 3OTOL 2KJXA 1X54A 4JC0A 2NZOA 2D2CC 3HOZH 2AQ3B 2UUAL 5IOCA 3ONAB 4RGTA 1FJGL 4JW0A 1L0YB 4PV1C 1S5ED 3W1BA 2EYPA 1H9SA 3V05A 1SE4A 1M90C 5ELEA 4LF4Q 3HOYG 4UAIA 4O2DA 1EYAA 3E3XA 2EJGC 2C5CA 2BE5C 2DUDA 1OXTA 3CQZH 4DR1Q 4DV5Q 4A3KG 3VA7A 1WCMG 2OEOA 3OWFA 1A2UA 5JEAG 2VNUD 3FPUB 1VQAA 1HNWL 2EYOA 2TMPA 4HSVA 5GROA 2ZTEA 3FKIG 2E75C 3A8JE 3CC4A 2UXDQ 4X6AH 2F4IA 3A7AB 4MIUA 1W3SA 1XNQQ 2K32A 4H02A 4GN3B 2JA6B 5D3DA 1PFBA 5C3WA 2PO4A 2XTIA 5EPLA 4EQOA 4YCWA 5C4JB 1KD1C 3OW2A 3BDCA 3TP7A 1PH3A 3QOLA 1TXYA 3QIAA 2CWPA 2VUMG 1BBUA 2NVTB 5M5WB 4OWWB 5GAEC 2K05A 2BOSA 2SEBD 3MC0B 1CSPA 2YTYA 1VQCA 4JV5L 4DUYQ 1K8OA 1JICA 4Q5VA 1GKHA 3MWYW 2E5LL 1QZHA 5C3EG 3I4NG 3NBHA 4BXXG 1RF2D 5E7NA 2NVXB 2AMCB 3BVMA 4EVOA 1GHKA 4X66Q 5D14A 4OXPA 1IZ6A 3BVZA 4PMBA 3FPPA 3GD7A 4CBVA 4DR4Q 2GVBA 1AN8A 3A54A 1HNWQ 2KQ3A 5I6WA 4KHZA 1Y69U 1QUQB 4KKTA 2R7ZG 4GKKL 4JK1C 2Q8RE 1K83B 5G3LF 1I4RA 3MHBA 3MXPA 1F77A 4YIJA 4E6IA 3GV6A 2A69C 1G51A 2GA4B 4NKLA 1AE2A 3EJIA 3M4QA 1EFID 5CC4A 2JEBI 2B63B 5KNDA 1UE7A 4ZKBB 3Q22A 4ZRZA 2MUYA 1S5BD 5C5MA 3NTKA 3DM3A 3M9BA 4APVA 4RHSA 1STHA 2VS1A 3I73A 4B9XA 1TU2B 4IFDG 1T9HA 2Z4IA 5E4WC 3IAYA 3DHQA 5EKIA 1TWFH 4KKUA 2B8FA 4DR7L 3VR6A 4YWKA 2I46A 4OO1I 2F1MA 3S9WA 4CHTB 4A3MH 4DAPA 3M4OH 3A0JA 1FR3A 2ALYB 4XIGS 1STYA 3GTOB 2PCFB 1STGA 2MQHA 4R8NA 1H95A 2QEJC 2ZXOA 1RL2A 4DV1L 1N32Q 1PH8A 1SAPA 2R6GA 2DNCA 4DV7Q 1D5XC 3AFPA 2E2JH 3FMCA 1ASZA 3NWTA 2AUJD 1B3AA 3QOJA 5M3FG 5C3XA 3K81C 2F0VA 4K0KQ 2F0PA 3BS1A 1EIFA 1WTQA 3QJYA 2NZHA 2ZT9C 2N8NA 4A3EB 3HP3A 4XYOA 4OWTB 4JI1Q 1PVOA 1KNAA 4B3SQ 1EWIA 1LTTD 3U4VA 2F0UA 1LACA 4ZQ3A 4A3FH 2HHHL 1ET9A 3I70A 4NXNL 4Q0FA 4BBRH 1EY4A 2BA1A 1XNRQ 3J81j 1BXTA 3VR3A 4LF5L 5C4XG 1M4VA 1PYBA 2L11A 1XPUA 2UXBQ 1B50A 4PZ7A 1N36L 1GO3E 4JI7L 3HOVH 4A3CG 4OONA 3PF4A 3H94A 3CCLA 2E2DC 1B70B 3UDFA 4LFCL 3I3CA 1EZ6A 4F7XA 3PO3B 1QVGA 2DJGC 1BNZA 1EWHA 2E2JB 3NHHA 4LMQD 3J80c 1JJGA 1CZWA 2A5HA 2KVMA 1U4RA 4JI6L 4QJFA 3AB9A 4ODGA 5JPNC 2L4NA 3FEWX 1HNZQ 2MJ8A 1SNQA 1MHWC 2FJ2A 2PQAB 2PNHA 3J81c 1QWYA 4L63B 1D1KA 1PYSB 2H5XA 2JA6H 2K14A 3ZYYX 1EY6A 1NNXA 2CHBD 1AW7A 2CWAA 4K6DA 4K2LA 3RZOH 4Y7NH 1A15A 3QR8A 1XJVA 5IGCA 1HR0W 3PV0A 2NVYH 4DAMA 2QKIC 3ND8A 2ZJPA 4YWLA 1VQLA 5M5WH 1WI5A 1F9PA 5G3LD 4NW2A 2A74C 2F0JA 2PW5A 2EY1A 4KI0A 5JJIA 3N6RA 3C3LA 3PIOA 3S1RB 2O2LD 1UUPA 4UP8A 4A3JG 5M5YB 1B1ZA 1EZ8A 1D7QA 2UXBL 3Q8DA 1KLUD 5IT9c 1X3EA 1II3A 3FVQA 3GP7A 1CK1A 2NYZD 1NY4A 4N8X1 1D5MC 3MTSA 2O4XA 1JT8A 2I07B 3L7ZC 4JI4Q 1J9OA 5BN3A 4WRDA 4JI8Q 4KJNA 4KN4C 2JA7G 1IKMA 1JMCA 2NVQH 5KYIA 1PRTD 2A68D 2FMCA 4JPBW 5M3MH 5FLXc 4KHPQ 1ZKOA 1NJIC 1Y8NB 1RDPD 4IN3A 1HR0L 1P16A 2V4DA 1GJXA 5AJ3Q 1ILQA 2VL6A 5C44B 4KV6A 3OSOA 2L12A 5ELCA 5CV6A 1NUCA 4X65Q 4C3JG 1R9TB 2JA8H 2F03A 5D65A 1S40A 3MEFA 1X32A 1B9NA 3KFUA 4BY7H 5J22A 2EJMA 3M4YA 4LK1C 2UXCL 3GTLH 2D5DA 1TY2A 2ZTCA 1ZXTA 5C6AA 3T4AC 4LUZA 3RZDB 4A3JH 2OT2A 3AQQA 5IWAL 2VZAA 1XPRA 1VDZA 3HOZG 1G91A 1Q1EA 3J80i 4G4KA 5ELNA 2UUBQ 5GADC 3J81i 4YY3L 4IUNA 3KLSX 5CV7A 2K5HA 1JORA 3HGBA 4AYBB 2F0GA 2XGTA 3P20A 1PH5A 4RCNA 4M1UB 1F2LA 1N33Q 4IUVA 2X69A 1QNUA 2K5QA 5C44H 1SBBB 4A3GB 1PRTC 4H13C 3W1GA 1VF7A 5C0XI 1AZPA 1STNA 4DR4L 1SEBD 2EE1A 1Y1WH 2UUCL 1QG7A 2WB1E 2KCNA 3CCQA 1MJEA 4DK3C 1LTAD 2A6HC 5A2QL 3GTLB 1LABA 2OTLA 5KEEA 4XQJA 2OQ0A 4A93B 1SE2A 1YHQA 3H3VI 2DY8A 1RCVD 1E24A 5D3IB 4BBRB 1A3VA 4DK0A 1X3PA 1J5EQ 4OGQC 1GD7A 4U673 1SXTA 1VQ8A 4UY8C 2A1AA 4OIJA 2VQFL 1IBML 2VUMH 3NENA 1DJRD 2AWNA 1MIUA 1K3RA 3HOVG 3OWEB 4A3CH 2IHEA 1BUVT 1NR4A 3TRZA 2BH8A 4V0BA 3R2IA 1E7ZA 1YNNC 4DR6Q 1I4PA 3M4OB 5KNBA 3GTOH 5CBEE 2M00A 2LKVA 3IFDA 2RHSB 4OL7A 5LMUL 3K5LA 5EQ0A 2B2VA 4DR3L 1TS2A 3HOUB 3FRPB 2KCTA 4IQZA 2KEEA 5NUCA 4AIMA 5FO8B 1KIXA 2ASBA 2B2UC 4DV3Q 3KF8B 3TQYA 4Z9CB 5LMUQ 3LWUA 3R8BA 3GTMB 3JAML 3CCVA 3I2ZA 4BA1I 4TKOB 4JBKA 4DK1A 1ENCA 4X3TA 1D1IA 4JI2Q 2RSOA 2EY2A 4DN4M 1NTGA 2B63G 1DM0B 4RGOS 3FP9A 2R92H 1E2WA 1CT1D 1IW7C 1E2ZA 1UE6A 2PZUA 3UE1A 1PH4A 5E3FA 2NZ1D 4YCVA 1SMXA 4XQNA 1A0IA 1BOSA 1LV9A 1SYFA 3NK9A 3G71A 1SNMA 1AP0A 4BBSB 1EEID 3OHXC 4CJ0B 3S1RH 1SNCA 2K1BA 3SR1A 1TS5A 4A75A 1Z7TA 5M5YH 2RCFA 3TS0A 4IUPA 4RAUC 1Y14B 4CKEA 4NXNQ 1DYQA 3MEHA 3I91A 2BE5D 2AKWB 3F2CA 2NVXH 1EEFD 3OTOQ 1WD1A 4YWMA 1Q82C 2C9OA 1WTWA 1VQ4A 1Q46A 1F9RA 1F9QA 3K7UC 4RMFA 1A62A 5LL6S 1A63A 2QCPX 4DV1Q 3I4MG 3H15A 5A2QE 1GUSA 5L37A 1GVPA 2SNSA 2G9DA 4GNXB 1JCKB 4RHRA 1YJNA 4JBMA 4JI0L 1SMYC 5IY0A 2F3IA 5ELDA 3CAMA 2F0OA 5EKLA 1C8CA 1B2TA 5IODA 2JP1A 3SE0A 3HKSA 1MD2D 5CV4A 3I4NH 1HTPA 3AFQA 3T1HQ 1VS0A 3C46A 5T1GA 1GUWA 2Z4HA 3M4PA 1NSNS 4IURA 3TP8A 2E2IB 5IGDA 3MVVA 4BWGB 1DXMA 2JSOA 4B3MQ 1CA5A 2F52A 3E5SA 4LF6L 3I8ZA 4KD3A 3T13A 3LWEA 1V1PB 4H0LC 4I7ZC 2K33A 1TWAB 4A3DB 2HIVA 3CCRA 1KLGD 3S1QB 3RR5A 3MA2B 2ES2A 1J6QA 3I4OA 2B3GA 4DA2A 1PYWD 4NDXA 2KBNA 3SK6A 2IX3A 3NQTA 1QILA 2WB1G 1O7ZA 4FVMA 3TS2A 2WINB 1K73C 2HDMA 3H0GG 3MXNA 1UWVA 5CGKA 2K52A 1Q1BA 3TN2A 2RDFA 3HOWB 3TZUA 3MXNB 4JI5Q 2KUMA 1CSQA 2B2YC 3CC2A 3ULLA 1D6EC 3M3YH 4B08A 4DV3L 1W2BA 1A3TA 2NVTH 3K0YA 3S17B 3BU2A 2QA4A 3HFZB 4FF2A 4R4IA 2NN6H 1PH9A 4KKSA 3SDZA 3NSWA 3SK8A 4B3TQ 4GLAC 2EXDA 3TEHB 1G291 4FYDA 3A56A 3RZDH 3S2DB 3ITPA 3L0OA 2D9UA 1HNZL 1ZYRD 1YZ6A 2RF4A 2YYZA 4BA2I 4JG2A 4A3DH 3CP0A 1TR5A 3PO3G 1S72A 3PO2G 1VCIA 1T5XD 3HOWG 3D4WA 4DR2Q 4A3KH 1VQEA 2Y0SE 4PG3A 4HJ9A 1EU4A 4F8MA 2XNAC 2PI2E 2KECA 3WOFA 1E1TA 1W6JA 1SNOA 1IBLL 3STBD 2VW9A 1I94L 1E0BA 4L6TB 4I65A 2L5TA 5IGFA 5BN4A 2B2WC 2EPBA 2VQEL 1B53A 1JOQA 2JA5B 4GN5A 1IYJB 3S17H 1O78A 5F2DA 1Y1WB 2X6LA 5EKKA 4C2MH 1PFSA 5KGUA 3VDYA 2UUAQ 2UUCQ 2QDLA 3KF6B 2ATWA 1B9MA 4HCEA 3ERQA 3S2DH 4H7BA 5IP9G 4A4IA 3CCUA 1HXYD 1K0RA 1VQJA 3PIP3 4KMUC 3KJOA 1SYDA 2K04A 4XYQA 2KHSA 3BDOA 1SYEA 3IFTA 3PO2H 2E76C 1CZGA 2RCNA 3NBIA 5FLXL 4X64Q 4YCUA 1KRSA 1VQDA 3S1NB 4IJLA 4QL5A 1B8AA 2I5MX 2A73B 2YTVA 4JYAL 1VQMA 1Q81C 3KK7A 3J81E 4X64L 1GUGA 1KAWA 2B2YA 3S1MB 4AYBE 2LSSA 4JBJA 1JJCB 1Q7YC 1Y1VB 4DR6L 3PIO3 2KHJA 4GZYC 5JEAJ 3NTHA 3N52A 1SE8A 1O7YA 4GLVB 4OHJA 2VB2X 2R92G 3FHWA 1BO0A 5EPJA 3KF6A 4HJ5A 1SMYD 3QWNA 1G8ZD 1Z47A 4HIKA 4J1MA 1Q8KA 3UDXA 4JI7Q 4HJ8A 1LUZA 3VR5A 3CRKC 2VQEQ 1MKHA 4LF9L 4XT1B 4CJ2C 4KY6A 2J4XA 1VQGA 1TWGH 4X3SA 3W5OA 1EQQA 4GN4B 4HSPA 2YU9B 2F0NA 2FFKB 4RFBA 4A3LH 2ZTDA 1I5FA 2Z0SA 2L0CA 2F0TA 2E2HH 4GOPA 2EDGA 1WTXA 2KCMA 1N33L 1PTOB 1EY7A 1X9NA 3T1YL 1LT6D 4IFDJ 1FGBD 4HR7B 3Q24A 2VB3X 3HOZB 3WOEA 2CVRA 2A6HD 5FJ8G 1SROA 3EROA 3K59A 4DNTB 4MTKA 4DV5L 3K7AH 1WOCA 1N34L 4GKKQ 1Q90A 1KDAA 3KLWA 3M85A 1NBWA 1JJ2A 3QG1A 4X66L 4HCSA 4WORA 4DFAA 5FLMH 4DF7A 1BCPF 4A3IG 1L0WA 1EYDA 2I0QA 3NP8A 1PH2A 1CKNB 1I3QB 1SN8A 1WCMH 3S16H 4N8FA 3GV3A 5JEAH 4WJ3M 4R8IA 3GTQH 2AQ1B 2K5DA 1E1OA 1Q3LA 3TBIB 1MJCA 4LFBQ 2XIWA 2WACA 2B39A 4ZYSA 3U4ZA 3KLSA 2C35B 2M2LA 3HKZG 1S5CD 2HCCA 3HOXB 1JWMD 3PIPA 1JWUD 2PI2A 2JYOA 5IYCH 1IHZA 4CDFC 2IJ0A 1TQOA 5H1SE 1Q8IA 4XDXA 2CH4A 2MFIA 4N9TA 1H9SB 3FKIB 5T1IA 1EOTA 3GTJH 4PNYA 2PNRC 5HY6A 1IKLA 2WAQE 4MNOA 1K28A 4RGNA 4FP5D
chains in the Genus database with same CATH topology
4DR3Q 2CKZB 3IRBA 2QGQA 2ZTCA 2ID0A 1FVIA 1YJWA 2IHFA 4LUZA 4HIMA 4A3JH 3CW2C 3AQQA 5IWAL 2VZAA 4BY1G 4HJAA 3U58A 1XPRA 2E2IH 1UEBA 2MNAA 3T1HL 4TQUS 5ELOA 3HOZG 1OXUA 2CFMA 5FLMG 2E5LQ 1Q1EA 1QVCA 1KHIA 4LF8L 3J80i 5ELNA 2UUBQ 1WJJA 5GADC 1JE5A 3J81i 2RHQB 4YY3L 3CPWA 1HNXQ 4FDBA 2PQAA 2K4KA 2K5HA 3JAMc 4DPGA 4BBSG 2UXCQ 1ASYA 2XGTA 3KDFB 4DR5Q 3RN5A 4A3EG 1HJPA 1Q12A 2BA0A 1NE3A 4LF4L 2A8VA 1PH5A 1CUKA 3CF5A 4O0AA 4JI1L 1X3GA 1N33Q 1IL2A 1YHBA 5C44H 3F2DA 1FJGQ 2V1CC 5M3FH 3RNUA 2Q2UA 3H0GH 4POFA 2MO0A 4A76A 3W1GA 1N34Q 2HQLA 4R4TA 4EQ5A 5C0XI 1L1OC 1HZ9A 1Y1WH 3S15H 4DR4L 2UUBL 4A3EH 2UUCL 2EIFA 3U50C 3FKIH 4BY7G 2WB1E 1M1KC 3CCQA 1MJEA 4DK3C 2Z6KC 1I50H 2OTLA 1YBYA 1D8LA 4EX5A 2OQ0A 4JI4L 4A3MG 1Y1VG 2B63H 1GM5A 3AEVA 3CC7A 1YHQA 1UE1A 1EQRA 1LTLA 1XNRL 1EIYB 3F2BA 3H3VI 5FJ8H 4BBRG 1E24A 3HOYH 1CKOA 1LYLA 1J5EQ 3EBEA 3I56A 4IOCA 3K0XA 4LF7L 2K5NA 1GD7A 4L5TA 2ZM6L 3STBC 3I55A 2JA8G 2D0PA 1VQ8A 2A1AA 4UY8C 1OXSC 1U0LA 2VQFL 1IBKQ 1IBML 3NENA 2VUMH 2AWNA 1MIUA 5HGQA 1K3RA 1VQOA 3HOVG 4A3CH 4A3CG 2IHEA 3D31A 1QZGA 4GLXA 3TRZA 2BH8A 1HZCA 1UE5A 1VQFA 1E7ZA 2N3SA 5AJ3L 4P71A 4DR6Q 4PZ6A 4AQYQ 4DV6Q 4Y52H 3S1MH 4BBSH 4B3TL 4BY1H 4DV7L 2GVAA 5C0XG 3JAMi 3CCJA 1PA6A 4OX9Q 3GTOH 2HIXA 2RHSB 5LMUL 2CCZA 4DR3L 4OO1G 1X55A 5BR8L 1XMOQ 4JCVE 2KCTA 3PF5A 1EYGA 5C44G 4AIMA 3I7FA 1KIXA 2ASBA 4DV3Q 1L2FA 3KF8B 4X62Q 3TQYA 4IO9A 5LMUQ 1IBKL 1IBMQ 1BBWA 4JI2L 1YHAA 3GO5A 4P72A 1I6HH 2R93G 4C3IH 1I94Q 1DGSA 2JA5H 4L5RC 3GTKH 3CCVA 3S24A 3S2HH 3I2ZA 5IYBG 2VY3A 4BA1I 1YI2A 1HNXL 4JBKA 4A93H 2WP8J 4B3ML 5EAYA 2DGYA 3J7A5 4LF9Q 4JI2Q 1YIJA 5JJLA 3WWVA 1PH6A 1NTGA 3KJPA 2B63G 2R7ZH 5J3BA 2KHIA 2F4VQ 5LMNL 4DUZQ 1Z9FA 3FP9A 4RG1A 3K80C 2R92H 4LF6Q 3TREA 1E3PA 1Q86C 1UE6A 3UE1A 1PH4A 4UP9A 3CMEA 3PSIA 3OTOL 4YCVA 1SMXA 1X54A 3PUWA 1A0IA 4JC0A 3CCSA 2NZOA 3PCOB 3HOZH 2UUAL 4JYAQ 3G71A 1FJGL 3CD6A 3S1NH 4AYBG 3S1RH 1KRTA 4DV0Q 1Y1WG 4JV5Q 1YVCA 4A75A 1P8LA 1V1QA 3W1BA 1PH7A 1M90C 4LF4Q 3HOYG 5M5YH 1EOVA 2FXQA 3ZJYC 4O2DA 4IPCA 3TS0A 4DNIA 5C3EH 3PO3H 2DUDA 1Y14B 1OXTA 4NXNQ 3GDEA 4P75A 3UDGA 2E8GA 3CQZH 3CCEA 4A3IH 1HR0Q 4DR1Q 4DV5Q 2AKWB 5IP7H 3F2CA 3I4MH 4GKJL 4TVAB 2NVXH 4A3KG 1WCMG 3OTOQ 4YWMA 3J7ZC 1Q82C 3H3VH 2WAQG 1U5KA 5JEAG 2ZM6Q 1QVFA 3E0EA 3GTMH 2VNUD 1VQ4A 1Q46A 1VQAA 4YHHL 1HNWL 3K7UC 1O7IA 1KL9A 3BZCA 4RMFA 5GROA 2R93H 1A62A 2ZTEA 1A63A 3FKIG 4QY7A 3CC4A 2JE6I 2MO1A 2UXDQ 4X6AH 4DV1Q 3I4MG 1W3SA 1XNQQ 3H15A 3NBHB 1GVPA 3E9HA 4LUOA 4H02A 1VQHA 4GN3B 5IYDG 3UE0A 4NXML 1IXRA 4B3RQ 4GNXB 3EIVA 1J5EL 4LF7Q 4DKAC 2XTIA 4ME3A 1YJNA 4JBMA 4JI0L 3HOWH 4AH6A 1CKMA 5IY0A 1LM0A 2F3IA 1XNQL 3CAMA 4YCWA 2JEAI 4A3BH 1E22A 1SRUA 2K75A 1KD1C 3OW2A 1VQKA 1XMQL 2JQOA 3HOXG 1PH3A 3PUYA 3I4NH 3HKSA 1TXYA 4JI0Q 2CWPA 5M3MG 1BBUA 2UU9L 2VUMG 4OWWB 3RLFA 5GAEC 3AFQA 3T1HQ 1VS0A 1VQPA 4JI3Q 2LXJA 4PMWA 3M4PA 1CSPA 2YTYA 5IWAQ 1OXXK 1VQCA 3PUVA 4JV5L 3JC66 4DUYQ 5IE8A 4B3MQ 1PH1A 2F52A 2UU9Q 1GKHA 2E5LL 4LF6L 1QZHA 4B3RL 2AHOB 5C3EG 3I4NG 4BXXG 2F4VL 5E7NA 1AE3A 2QEXA 2NN6I 2AMCB 3ER0A 2ZJQA 4WJ4A 4DUYL 2HIVA 2N49A 1SFOH 3CCRA 4IPGA 3RR5A 1PHJA 2OQKA 2ES2A 1J6QA 3I4OA 2B3GA 4X66Q 4OXPA 4DR5L 1IZ6A 1K8GA 2KBNA 2LXKA 5GQOA 1I3QH 3GD7A 4YHHQ 4HIDA 2WB1G 2JA5G 3TS2A 4B3SL 1KC8C 3PUZA 4A3GH 1K73C 4DR4Q 2GVBA 3H0GG 1UWVA 2K52A 4LW1A 1Q1BA 4R4OA 1YJ9A 4DV2L 3MXNB 3ERSX 4JI5Q 1HNWQ 5LMNW 4A3BG 4KHZA 1CSQA 1QUQB 2R7ZG 4JBWA 3CC2A 1VQ9A 3ULLA 4GKKL 2A19A 1L1OB 2UXDL 3M3YH 1B7YB 3HOXH 4DV3L 1G51A 1EUJA 1W2BA 1SR3A 4POGA 4AQYL 1AE2A 2NVTH 3M4QA 1R9TH 3BU2A 4DAYB 2QA4A 2JEBI 2OCEA 3HFZB 4IOAA 2KENA 1V9PA 1UE7A 4R4IA 2JK8A 1S3OA 2Z6KA 3EN2A 1PH9A 5IYDH 2N78A 2Q2IA 4NB3A 3DLLA 2I5HA 2VQFQ 2D0OA 4B3TQ 1X65A 2CQOA 4GLAC 2EXDA 3TEHB 1G291 2ZJRA 4HIOA 1YNXA 3RZDH 3DM3A 3M9BA 3L0OA 3PUXA 4APVA 2VS1A 3SGIA 4QIWE 3G6EA 2K5VA 4DUZL 1XMOL 4IFDG 4QQBX 1HNZL 3HOUG 1T9HA 1YZ6A 2RF4A 2YYZA 2HT1A 4JG2A 4BA2I 3CP0A 4A3DH 1TWFH 2Q2HA 5C4XH 5M5XH 3PO3G 4LFAQ 3S1QH 4OX9L 3T1YQ 1X6OA 4R1JA 4LFAL 4DR7L 4YWKA 1S72A 4LF8Q 3PO2G 4OO1I 1VCIA 4X62L 2JA9A 4A3MH 3M4OH 3A0JA 2ALYB 3HOWG 4XIGS 4DR2Q 4A3KH 1VQEA 2Y0SE 2L15A 4PG3A 3D0FA 2MQHA 4HJ9A 5JJKA 1X56A 1H95A 4A3GG 1RL2A 4L5QA 3HOUH 4DV1L 3RLNA 1SLJA 1N32Q 1V43A 2PI2E 2R6GA 1PH8A 3OYYA 4DV7Q 3AFPA 1E1TA 4GOPB 1IBLL 3STBD 1Y1VH 2VW9A 1I94L 1ASZA 2E2JH 3ULPA 3RN2A 5M3FG 2YV5A 1N32L 1BVSA 4KLKA 3E9IA 3K81C 2VQEL 2IY5B 3NEMA 4DK6C 2Y0SG 2YTXA 4DV4Q 4K0KQ 4GN5A 1IYJB 1VQBA 1PV4A 2JA7H 4HJ7A 4A3FG 1EIFA 3S17H 2NZHA 4DV0L 3PGZA 2IX1A 2PMZE 2N8NA 1VQ7A 1N9WA 4JI8L 5GAHC 3M7NA 3G4SA 4C2MH 4IFDI 1BKBA 1PFSA 3VDYA 2UUAQ 4OWTB 4JI1Q 2UUCQ 1PVOA 4K0KL 1K8AC 4B3SQ 1EWIA 3KF6B 1YEZA 2ATWA 3U4VA 2K50A 3S2DH 5IP9G 5IYCG 4GKJQ 4A3FH 4A4IA 4JI5L 3CCUA 4DV2Q 1K0RA 1VQJA 1IBLQ 2HHHL 1HZBA 1WFQA 2JJQA 3KJOA 1N36Q 4NXMQ 4NXNL 3LGJA 1A8VA 4MTNA 4BBRH 5LMNQ 4A3LG 2BA1A 1XNRQ 3PO2H 1C9OA 1OXVA 1RIPA 3J81j 2RCNA 4LF5Q 2R7FA 4LF5L 4X64Q 4A3DG 4YCUA 5C4XG 1PYBA 1KRSA 1VQDA 1XPUA 1NMGA 4IJLA 2UXBQ 1C0AA 4QL5A 4PZ7A 4C3HH 2EQSA 1N36L 1K9MC 1GO3E 1C7YA 4XTCS 4JI7L 4OONA 1B8AA 3HOVH 4OWXB 2Q2TA 3PF4A 1VQ6A 2I5MX 3CCLA 2YTVA 1B70B 1VQMA 3UDFA 5BR8Q 1Q81C 1WYDA 4LFCL 4JYAL 4X64L 4LFBL 4JOIA 1KAWA 4GNXC 1QVGA 1HZAA 4LUVA 1FGUA 2LSSA 4JI3L 4AYBE 4JBJA 1JJCB 1Q7YC 4A93G 5C0XJ 3J80c 1JJGA 4DR6L 1QUQA 2KHJA 4MZ9A 5JEAJ 3GTGH 3UDIA 3ULJA 3A5UA 4ALPA 1HH2P 4JI6L 4IPHA 1SE8A 4QJFA 3KDFA 4GLVB 2R92G 3FHWA 3B6YA 1HNZQ 1EFWA 3KF6A 4HJ5A 2B29A 1G6PA 1Z47A 4HIKA 1Q8KA 2PQAB 3J81c 2PNHA 3UDXA 4IPDA 2GN5A 4JI7Q 3BJUA 4PZ8A 3CMAA 4HJ8A 1PYSB 2H5XA 1LUZA 4R4CA 4YY3Q 4QGUA 2K14A 2JA6H 4GOPC 4P74A 5IYBH 1VQNA 4IJHA 2VQEQ 1MKHA 4LF9L 2CWAA 4UPAA 4P73A 1VQGA 1TWGH 1VQIA 4R4QA 2NN6G 3W5OA 2AWOA 3BZKA 1EQQA 4GN4B 4Y7NH 3RZOH 3CPFA 1XJVA 5C4JH 4A3LH 2ZTDA 1XPOA 3CXCA 1HR0W 3PV0A 2D62A 1I5FA 2NVYH 2Z0SA 3CCMA 2OTJA 2E2HH 4C3JH 4DAMA 4GOPA 2KCMA 1OTCA 2ZJPA 1N33L 4YWLA 1X9NA 3T1YL 2R7DA 3HKZE 1VQLA 4DR7Q 4IFDJ 5M5WH 1WI5A 1X3FA 5GAGC 5IP7G 4DV6L 1KXLA 2BH2A 4DR2L 2HHHQ 1XMQQ 2I5LX 5FJ8G 4KI0A 1SROA 5JJIA 3A5ZB 1JB7A 1VQ5A 3AYHB 3PIOA 3G48A 4DV5L 4UP8A 3K7AH 1WOCA 4A3JG 3NELA 3KLWA 4GS3A 3M85A 1N34L 4GKKQ 4NPSA 1NBWA 1JJ2A 1D7QA 4X66L 1TWAH 2UXBL 4LWCA 3Q8DA 5IT9c 1X3EA 4GNXA 5K36G 4X65L 5FLMH 4A3IG 1NY4A 1L0WA 5IP9H 4DV4L 2I0QA 1PH2A 4JOIC 2WFWA 1CKNB 1SN8A 1JT8A 3L7ZC 4JI4Q 3S14H 1WCMH 3S16H 1CKNA 1TWHH 4WJ3M 4JI8Q 1TWCH 2JA6G 2JA7G 3GTQH 1JMCA 2NVQH 1FL0A 1E1OA 2IT1A 1N8RC 4JI6Q 5M3MH 5FLXc 4KHPQ 3K8AA 1MJCA 4DR1L 1NJIC 4LFBQ 1HR0L 1P16A 1L1OA 2IX0A 2YU9H 5AJ3Q 2VL6A 3U4ZA 3A74A 1NMFA 2C35B 1AH9A 1K83H 3RLOA 3HKZG 4UP7A 3F1ZA 1YITA 3PIPA 3KYHC 2PI2A 1KQSA 5IYCH 3L2PA 4X65Q 4KHPL 4L5SA 5H1SE 4LFCQ 3ICEA 2JA8H 2MFIA 1S40A 4BXXH 3MEFA 4BY7H 3KFUA 1XTDA 3GTJH 5DLQE 2OWOA 3GTPH 4J15A 5HY6A 2UXCL 3KOJA 3GTLH 2WAQE 4MNOA 3F8TA 4LNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 Q;  2CKZ B;  3IRB A;  2QGQ A;  2ZTC A;  2ID0 A;  1FVI A;  1YJW A;  2IHF A;  4LUZ A;  4HIM A;  4A3J H;  3CW2 C;  3AQQ A;  5IWA L;  2VZA A;  4BY1 G;  4HJA A;  3U58 A;  1XPR A;  2E2I H;  1UEB A;  2MNA A;  3T1H L;  4TQU S;  5ELO A;  3HOZ G;  1OXU A;  2CFM A;  5FLM G;  2E5L Q;  1Q1E A;  1QVC A;  1KHI A;  4LF8 L;  3J80 i;  5ELN A;  2UUB Q;  1WJJ A;  5GAD C;  1JE5 A;  3J81 i;  2RHQ B;  4YY3 L;  3CPW A;  1HNX Q;  4FDB A;  2PQA A;  2K4K A;  2K5H A;  3JAM c;  4DPG A;  4BBS G;  2UXC Q;  1ASY A;  2XGT A;  3KDF B;  4DR5 Q;  3RN5 A;  4A3E G;  1HJP A;  1Q12 A;  2BA0 A;  1NE3 A;  4LF4 L;  2A8V A;  1PH5 A;  1CUK A;  3CF5 A;  4O0A A;  4JI1 L;  1X3G A;  1N33 Q;  1IL2 A;  1YHB A;  5C44 H;  3F2D A;  1FJG Q;  2V1C C;  5M3F H;  3RNU A;  2Q2U A;  3H0G H;  4POF A;  2MO0 A;  4A76 A;  3W1G A;  1N34 Q;  2HQL A;  4R4T A;  4EQ5 A;  5C0X I;  1L1O C;  1HZ9 A;  1Y1W H;  3S15 H;  4DR4 L;  2UUB L;  4A3E H;  2UUC L;  2EIF A;  3U50 C;  3FKI H;  4BY7 G;  2WB1 E;  1M1K C;  3CCQ A;  1MJE A;  4DK3 C;  2Z6K C;  1I50 H;  2OTL A;  1YBY A;  1D8L A;  4EX5 A;  2OQ0 A;  4JI4 L;  4A3M G;  1Y1V G;  2B63 H;  1GM5 A;  3AEV A;  3CC7 A;  1YHQ A;  1UE1 A;  1EQR A;  1LTL A;  1XNR L;  1EIY B;  3F2B A;  3H3V I;  5FJ8 H;  4BBR G;  1E24 A;  3HOY H;  1CKO A;  1LYL A;  1J5E Q;  3EBE A;  3I56 A;  4IOC A;  3K0X A;  4LF7 L;  2K5N A;  1GD7 A;  4L5T A;  2ZM6 L;  3STB C;  3I55 A;  2JA8 G;  2D0P A;  1VQ8 A;  2A1A A;  4UY8 C;  1OXS C;  1U0L A;  2VQF L;  1IBK Q;  1IBM L;  3NEN A;  2VUM H;  2AWN A;  1MIU A;  5HGQ A;  1K3R A;  1VQO A;  3HOV G;  4A3C H;  4A3C G;  2IHE A;  3D31 A;  1QZG A;  4GLX A;  3TRZ A;  2BH8 A;  1HZC A;  1UE5 A;  1VQF A;  1E7Z A;  2N3S A;  5AJ3 L;  4P71 A;  4DR6 Q;  4PZ6 A;  4AQY Q;  4DV6 Q;  4Y52 H;  3S1M H;  4BBS H;  4B3T L;  4BY1 H;  4DV7 L;  2GVA A;  5C0X G;  3JAM i;  3CCJ A;  1PA6 A;  4OX9 Q;  3GTO H;  2HIX A;  2RHS B;  5LMU L;  2CCZ A;  4DR3 L;  4OO1 G;  1X55 A;  5BR8 L;  1XMO Q;  4JCV E;  2KCT A;  3PF5 A;  1EYG A;  5C44 G;  4AIM A;  3I7F A;  1KIX A;  2ASB A;  4DV3 Q;  1L2F A;  3KF8 B;  4X62 Q;  3TQY A;  4IO9 A;  5LMU Q;  1IBK L;  1IBM Q;  1BBW A;  4JI2 L;  1YHA A;  3GO5 A;  4P72 A;  1I6H H;  2R93 G;  4C3I H;  1I94 Q;  1DGS A;  2JA5 H;  4L5R C;  3GTK H;  3CCV A;  3S24 A;  3S2H H;  3I2Z A;  5IYB G;  2VY3 A;  4BA1 I;  1YI2 A;  1HNX L;  4JBK A;  4A93 H;  2WP8 J;  4B3M L;  5EAY A;  2DGY A;  3J7A 5;  4LF9 Q;  4JI2 Q;  1YIJ A;  5JJL A;  3WWV A;  1PH6 A;  1NTG A;  3KJP A;  2B63 G;  2R7Z H;  5J3B A;  2KHI A;  2F4V Q;  5LMN L;  4DUZ Q;  1Z9F A;  3FP9 A;  4RG1 A;  3K80 C;  2R92 H;  4LF6 Q;  3TRE A;  1E3P A;  1Q86 C;  1UE6 A;  3UE1 A;  1PH4 A;  4UP9 A;  3CME A;  3PSI A;  3OTO L;  4YCV A;  1SMX A;  1X54 A;  3PUW A;  1A0I A;  4JC0 A;  3CCS A;  2NZO A;  3PCO B;  3HOZ H;  2UUA L;  4JYA Q;  3G71 A;  1FJG L;  3CD6 A;  3S1N H;  4AYB G;  3S1R H;  1KRT A;  4DV0 Q;  1Y1W G;  4JV5 Q;  1YVC A;  4A75 A;  1P8L A;  1V1Q A;  3W1B A;  1PH7 A;  1M90 C;  4LF4 Q;  3HOY G;  5M5Y H;  1EOV A;  2FXQ A;  3ZJY C;  4O2D A;  4IPC A;  3TS0 A;  4DNI A;  5C3E H;  3PO3 H;  2DUD A;  1Y14 B;  1OXT A;  4NXN Q;  3GDE A;  4P75 A;  3UDG A;  2E8G A;  3CQZ H;  3CCE A;  4A3I H;  1HR0 Q;  4DR1 Q;  4DV5 Q;  2AKW B;  5IP7 H;  3F2C A;  3I4M H;  4GKJ L;  4TVA B;  2NVX H;  4A3K G;  1WCM G;  3OTO Q;  4YWM A;  3J7Z C;  1Q82 C;  3H3V H;  2WAQ G;  1U5K A;  5JEA G;  2ZM6 Q;  1QVF A;  3E0E A;  3GTM H;  2VNU D;  1VQ4 A;  1Q46 A;  1VQA A;  4YHH L;  1HNW L;  3K7U C;  1O7I A;  1KL9 A;  3BZC A;  4RMF A;  5GRO A;  2R93 H;  1A62 A;  2ZTE A;  1A63 A;  3FKI G;  4QY7 A;  3CC4 A;  2JE6 I;  2MO1 A;  2UXD Q;  4X6A H;  4DV1 Q;  3I4M G;  1W3S A;  1XNQ Q;  3H15 A;  3NBH B;  1GVP A;  3E9H A;  4LUO A;  4H02 A;  1VQH A;  4GN3 B;  5IYD G;  3UE0 A;  4NXM L;  1IXR A;  4B3R Q;  4GNX B;  3EIV A;  1J5E L;  4LF7 Q;  4DKA C;  2XTI A;  4ME3 A;  1YJN A;  4JBM A;  4JI0 L;  3HOW H;  4AH6 A;  1CKM A;  5IY0 A;  1LM0 A;  2F3I A;  1XNQ L;  3CAM A;  4YCW A;  2JEA I;  4A3B H;  1E22 A;  1SRU A;  2K75 A;  1KD1 C;  3OW2 A;  1VQK A;  1XMQ L;  2JQO A;  3HOX G;  1PH3 A;  3PUY A;  3I4N H;  3HKS A;  1TXY A;  4JI0 Q;  2CWP A;  5M3M G;  1BBU A;  2UU9 L;  2VUM G;  4OWW B;  3RLF A;  5GAE C;  3AFQ A;  3T1H Q;  1VS0 A;  1VQP A;  4JI3 Q;  2LXJ A;  4PMW A;  3M4P A;  1CSP A;  2YTY A;  5IWA Q;  1OXX K;  1VQC A;  3PUV A;  4JV5 L;  3JC6 6;  4DUY Q;  5IE8 A;  4B3M Q;  1PH1 A;  2F52 A;  2UU9 Q;  1GKH A;  2E5L L;  4LF6 L;  1QZH A;  4B3R L;  2AHO B;  5C3E G;  3I4N G;  4BXX G;  2F4V L;  5E7N A;  1AE3 A;  2QEX A;  2NN6 I;  2AMC B;  3ER0 A;  2ZJQ A;  4WJ4 A;  4DUY L;  2HIV A;  2N49 A;  1SFO H;  3CCR A;  4IPG A;  3RR5 A;  1PHJ A;  2OQK A;  2ES2 A;  1J6Q A;  3I4O A;  2B3G A;  4X66 Q;  4OXP A;  4DR5 L;  1IZ6 A;  1K8G A;  2KBN A;  2LXK A;  5GQO A;  1I3Q H;  3GD7 A;  4YHH Q;  4HID A;  2WB1 G;  2JA5 G;  3TS2 A;  4B3S L;  1KC8 C;  3PUZ A;  4A3G H;  1K73 C;  4DR4 Q;  2GVB A;  3H0G G;  1UWV A;  2K52 A;  4LW1 A;  1Q1B A;  4R4O A;  1YJ9 A;  4DV2 L;  3MXN B;  3ERS X;  4JI5 Q;  1HNW Q;  5LMN W;  4A3B G;  4KHZ A;  1CSQ A;  1QUQ B;  2R7Z G;  4JBW A;  3CC2 A;  1VQ9 A;  3ULL A;  4GKK L;  2A19 A;  1L1O B;  2UXD L;  3M3Y H;  1B7Y B;  3HOX H;  4DV3 L;  1G51 A;  1EUJ A;  1W2B A;  1SR3 A;  4POG A;  4AQY L;  1AE2 A;  2NVT H;  3M4Q A;  1R9T H;  3BU2 A;  4DAY B;  2QA4 A;  2JEB I;  2OCE A;  3HFZ B;  4IOA A;  2KEN A;  1V9P A;  1UE7 A;  4R4I A;  2JK8 A;  1S3O A;  2Z6K A;  3EN2 A;  1PH9 A;  5IYD H;  2N78 A;  2Q2I A;  4NB3 A;  3DLL A;  2I5H A;  2VQF Q;  2D0O A;  4B3T Q;  1X65 A;  2CQO A;  4GLA C;  2EXD A;  3TEH B;  1G29 1;  2ZJR A;  4HIO A;  1YNX A;  3RZD H;  3DM3 A;  3M9B A;  3L0O A;  3PUX A;  4APV A;  2VS1 A;  3SGI A;  4QIW E;  3G6E A;  2K5V A;  4DUZ L;  1XMO L;  4IFD G;  4QQB X;  1HNZ L;  3HOU G;  1T9H A;  1YZ6 A;  2RF4 A;  2YYZ A;  2HT1 A;  4JG2 A;  4BA2 I;  3CP0 A;  4A3D H;  1TWF H;  2Q2H A;  5C4X H;  5M5X H;  3PO3 G;  4LFA Q;  3S1Q H;  4OX9 L;  3T1Y Q;  1X6O A;  4R1J A;  4LFA L;  4DR7 L;  4YWK A;  1S72 A;  4LF8 Q;  3PO2 G;  4OO1 I;  1VCI A;  4X62 L;  2JA9 A;  4A3M H;  3M4O H;  3A0J A;  2ALY B;  3HOW G;  4XIG S;  4DR2 Q;  4A3K H;  1VQE A;  2Y0S E;  2L15 A;  4PG3 A;  3D0F A;  2MQH A;  4HJ9 A;  5JJK A;  1X56 A;  1H95 A;  4A3G G;  1RL2 A;  4L5Q A;  3HOU H;  4DV1 L;  3RLN A;  1SLJ A;  1N32 Q;  1V43 A;  2PI2 E;  2R6G A;  1PH8 A;  3OYY A;  4DV7 Q;  3AFP A;  1E1T A;  4GOP B;  1IBL L;  3STB D;  1Y1V H;  2VW9 A;  1I94 L;  1ASZ A;  2E2J H;  3ULP A;  3RN2 A;  5M3F G;  2YV5 A;  1N32 L;  1BVS A;  4KLK A;  3E9I A;  3K81 C;  2VQE L;  2IY5 B;  3NEM A;  4DK6 C;  2Y0S G;  2YTX A;  4DV4 Q;  4K0K Q;  4GN5 A;  1IYJ B;  1VQB A;  1PV4 A;  2JA7 H;  4HJ7 A;  4A3F G;  1EIF A;  3S17 H;  2NZH A;  4DV0 L;  3PGZ A;  2IX1 A;  2PMZ E;  2N8N A;  1VQ7 A;  1N9W A;  4JI8 L;  5GAH C;  3M7N A;  3G4S A;  4C2M H;  4IFD I;  1BKB A;  1PFS A;  3VDY A;  2UUA Q;  4OWT B;  4JI1 Q;  2UUC Q;  1PVO A;  4K0K L;  1K8A C;  4B3S Q;  1EWI A;  3KF6 B;  1YEZ A;  2ATW A;  3U4V A;  2K50 A;  3S2D H;  5IP9 G;  5IYC G;  4GKJ Q;  4A3F H;  4A4I A;  4JI5 L;  3CCU A;  4DV2 Q;  1K0R A;  1VQJ A;  1IBL Q;  2HHH L;  1HZB A;  1WFQ A;  2JJQ A;  3KJO A;  1N36 Q;  4NXM Q;  4NXN L;  3LGJ A;  1A8V A;  4MTN A;  4BBR H;  5LMN Q;  4A3L G;  2BA1 A;  1XNR Q;  3PO2 H;  1C9O A;  1OXV A;  1RIP A;  3J81 j;  2RCN A;  4LF5 Q;  2R7F A;  4LF5 L;  4X64 Q;  4A3D G;  4YCU A;  5C4X G;  1PYB A;  1KRS A;  1VQD A;  1XPU A;  1NMG A;  4IJL A;  2UXB Q;  1C0A A;  4QL5 A;  4PZ7 A;  4C3H H;  2EQS A;  1N36 L;  1K9M C;  1GO3 E;  1C7Y A;  4XTC S;  4JI7 L;  4OON A;  1B8A A;  3HOV H;  4OWX B;  2Q2T A;  3PF4 A;  1VQ6 A;  2I5M X;  3CCL A;  2YTV A;  1B70 B;  1VQM A;  3UDF A;  5BR8 Q;  1Q81 C;  1WYD A;  4LFC L;  4JYA L;  4X64 L;  4LFB L;  4JOI A;  1KAW A;  4GNX C;  1QVG A;  1HZA A;  4LUV A;  1FGU A;  2LSS A;  4JI3 L;  4AYB E;  4JBJ A;  1JJC B;  1Q7Y C;  4A93 G;  5C0X J;  3J80 c;  1JJG A;  4DR6 L;  1QUQ A;  2KHJ A;  4MZ9 A;  5JEA J;  3GTG H;  3UDI A;  3ULJ A;  3A5U A;  4ALP A;  1HH2 P;  4JI6 L;  4IPH A;  1SE8 A;  4QJF A;  3KDF A;  4GLV B;  2R92 G;  3FHW A;  3B6Y A;  1HNZ Q;  1EFW A;  3KF6 A;  4HJ5 A;  2B29 A;  1G6P A;  1Z47 A;  4HIK A;  1Q8K A;  2PQA B;  3J81 c;  2PNH A;  3UDX A;  4IPD A;  2GN5 A;  4JI7 Q;  3BJU A;  4PZ8 A;  3CMA A;  4HJ8 A;  1PYS B;  2H5X A;  1LUZ A;  4R4C A;  4YY3 Q;  4QGU A;  2K14 A;  2JA6 H;  4GOP C;  4P74 A;  5IYB H;  1VQN A;  4IJH A;  2VQE Q;  1MKH A;  4LF9 L;  2CWA A;  4UPA A;  4P73 A;  1VQG A;  1TWG H;  1VQI A;  4R4Q A;  2NN6 G;  3W5O A;  2AWO A;  3BZK A;  1EQQ A;  4GN4 B;  4Y7N H;  3RZO H;  3CPF A;  1XJV A;  5C4J H;  4A3L H;  2ZTD A;  1XPO A;  3CXC A;  1HR0 W;  3PV0 A;  2D62 A;  1I5F A;  2NVY H;  2Z0S A;  3CCM A;  2OTJ A;  2E2H H;  4C3J H;  4DAM A;  4GOP A;  2KCM A;  1OTC A;  2ZJP A;  1N33 L;  4YWL A;  1X9N A;  3T1Y L;  2R7D A;  3HKZ E;  1VQL A;  4DR7 Q;  4IFD J;  5M5W H;  1WI5 A;  1X3F A;  5GAG C;  5IP7 G;  4DV6 L;  1KXL A;  2BH2 A;  4DR2 L;  2HHH Q;  1XMQ Q;  2I5L X;  5FJ8 G;  4KI0 A;  1SRO A;  5JJI A;  3A5Z B;  1JB7 A;  1VQ5 A;  3AYH B;  3PIO A;  3G48 A;  4DV5 L;  4UP8 A;  3K7A H;  1WOC A;  4A3J G;  3NEL A;  3KLW A;  4GS3 A;  3M85 A;  1N34 L;  4GKK Q;  4NPS A;  1NBW A;  1JJ2 A;  1D7Q A;  4X66 L;  1TWA H;  2UXB L;  4LWC A;  3Q8D A;  5IT9 c;  1X3E A;  4GNX A;  5K36 G;  4X65 L;  5FLM H;  4A3I G;  1NY4 A;  1L0W A;  5IP9 H;  4DV4 L;  2I0Q A;  1PH2 A;  4JOI C;  2WFW A;  1CKN B;  1SN8 A;  1JT8 A;  3L7Z C;  4JI4 Q;  3S14 H;  1WCM H;  3S16 H;  1CKN A;  1TWH H;  4WJ3 M;  4JI8 Q;  1TWC H;  2JA6 G;  2JA7 G;  3GTQ H;  1JMC A;  2NVQ H;  1FL0 A;  1E1O A;  2IT1 A;  1N8R C;  4JI6 Q;  5M3M H;  5FLX c;  4KHP Q;  3K8A A;  1MJC A;  4DR1 L;  1NJI C;  4LFB Q;  1HR0 L;  1P16 A;  1L1O A;  2IX0 A;  2YU9 H;  5AJ3 Q;  2VL6 A;  3U4Z A;  3A74 A;  1NMF A;  2C35 B;  1AH9 A;  1K83 H;  3RLO A;  3HKZ G;  4UP7 A;  3F1Z A;  1YIT A;  3PIP A;  3KYH C;  2PI2 A;  1KQS A;  5IYC H;  3L2P A;  4X65 Q;  4KHP L;  4L5S A;  5H1S E;  4LFC Q;  3ICE A;  2JA8 H;  2MFI A;  1S40 A;  4BXX H;  3MEF A;  4BY7 H;  3KFU A;  1XTD A;  3GTJ H;  5DLQ E;  2OWO A;  3GTP H;  4J15 A;  5HY6 A;  2UXC L;  3KOJ A;  3GTL H;  2WAQ E;  4MNO A;  3F8T A;  4LNQ A; 
#chains in the Genus database with same CATH topology
 4DR3 Q;  4DXF A;  3IRB A;  1YJW A;  2IHF A;  4HIM A;  3CW2 C;  3U58 A;  2F0D A;  4ILW A;  2E2I H;  1UEB A;  3T1H L;  1U4M A;  4NP5 A;  2E74 C;  4QCL A;  1QVC A;  4LF8 L;  4QF4 A;  2RHQ B;  5K36 H;  2CW0 D;  2F0K A;  4FDB A;  3VR4 A;  1F2Y A;  2A68 C;  2ICI A;  3DWA A;  3JAM c;  1TWC B;  3O13 A;  2FIN B;  3KDF B;  4O1N A;  3RN5 A;  1HJP A;  1NE3 A;  3CKI B;  2A8V A;  1ENA A;  3Q6S A;  3CF5 A;  4JI1 L;  1TVX A;  1X3G A;  1SND A;  3NWS A;  1VMC A;  2K01 A;  4RWS C;  3AMU A;  4KTA A;  5KYL A;  4R4T A;  1L1O C;  1H9J A;  2UUB L;  3FKI H;  4V19 0;  4MN3 A;  4RH6 A;  4BY7 B;  1K8M A;  1M1K C;  1I50 B;  4EQP A;  5CYU A;  1YBY A;  1S5F D;  2JXM B;  2MGS A;  1GM5 A;  1UE1 A;  1LTL A;  1PZK D;  1QB5 D;  2R7Z B;  3HEJ A;  5FJ8 H;  1WVL A;  4BBR G;  3EVQ A;  4IOC A;  3K0X A;  1PZI D;  2K5N A;  4L5T A;  2RVL A;  2ZM6 L;  2JA8 G;  1AFP A;  1OXS C;  3T16 A;  2XRS D;  4C3H B;  5HGQ A;  1WTR A;  3L3O C;  2F0Q A;  5TSS A;  3D31 A;  1HZC A;  1UE5 A;  3V2T A;  3VR2 A;  5AJ3 L;  1UNS A;  4DV6 Q;  4BBS H;  4BY1 H;  4OX9 Q;  5C0X G;  1PA6 A;  3CCJ A;  3IKJ A;  4L8J A;  1PZJ D;  5LHY 1;  2CCZ A;  3URY A;  4OO1 G;  1X55 A;  1XMO Q;  3MAQ A;  1RD9 D;  3PF5 A;  5C3E B;  2WKC A;  1L2F A;  1XX8 A;  2NBF A;  3I4M B;  1PMR A;  1IBM Q;  5AFW A;  1CI3 M;  1PXU A;  2H1E A;  2R93 G;  4C3I H;  4FXD A;  4L5R C;  2F3V A;  3S2H H;  2VY3 A;  1JC7 A;  2O5J C;  4B3M L;  5EAY A;  4LF9 Q;  1DON A;  2AUK A;  1K0S A;  3F2U A;  4Y7N B;  2R7Z H;  4ZUI A;  3SK5 A;  5EGT A;  5LMN L;  4DUZ Q;  1VMP A;  4UP9 A;  1QE6 A;  3PSI A;  3BZD B;  3PUW A;  3CCS A;  3FDT A;  3PCO B;  3D3R A;  4DAY A;  1ESF A;  1J8I A;  5FOB B;  4RKL A;  1KRT A;  1PFM A;  4JV5 Q;  1V1Q A;  2FXQ A;  3ZJY C;  1DOL A;  3KUP A;  4DNI A;  5C3E H;  2EXZ A;  4P75 A;  3UDG A;  1LTR D;  2E8G A;  4RGM A;  3CCE A;  1HR0 Q;  3J7A F;  3I4M H;  1GHJ A;  5IP7 H;  4GKJ L;  5C4H A;  1JE4 A;  3S14 B;  3TZD A;  3J7Z C;  1QVF A;  4C3I B;  3E0E A;  3GTM H;  4BS9 A;  1SJH D;  3GTK B;  4YHH L;  1NCV A;  3GTQ B;  1O7I A;  2NVQ B;  5C0X H;  1KL9 A;  3BZC A;  2R93 H;  1C4Q A;  4QY7 A;  1CHQ D;  2PZT A;  4LUO A;  2EYM A;  3E9H A;  5IYD G;  1VQH A;  1YNJ D;  1MGS A;  3UE0 A;  2B2W A;  1KAB A;  1IXR A;  2PZW A;  4B3R Q;  3EIV A;  1J5E L;  1G2T A;  3HOW H;  4ME3 A;  3RZO B;  4DXG A;  1XNQ L;  2JEA I;  1E22 A;  1HQM C;  2NVY B;  3GTP B;  2MP1 A;  1U4P A;  2JQO A;  4KY7 A;  5M3M G;  2UU9 L;  5I9O A;  3RLF A;  1XXG A;  1LLR D;  1VQP A;  2CW0 C;  4PMW A;  1NAP A;  3W2D A;  2BDO A;  1EU3 A;  3H09 A;  2TSS A;  5IE8 A;  2UU9 Q;  3QO2 A;  5E4X A;  1PLF A;  1HRJ A;  2AHO B;  1T5E A;  1GUO A;  4G7Z C;  5ELF A;  1JOK A;  1AE3 A;  2QEX A;  4ZLT F;  4WJ4 A;  4DUY L;  4FF4 A;  1SFO H;  2N49 A;  3TDQ A;  1K8G A;  2LXK A;  5GQO A;  3BYT B;  4J6H A;  4YHH Q;  4HID A;  4ZAI A;  1TS4 A;  2JA5 G;  4B3S L;  1KC8 C;  3PUZ A;  2EYJ A;  3D6W A;  2N88 A;  5M3M B;  1YJ9 A;  4DV2 L;  3ERS X;  1I4X A;  4K5X A;  5JPM C;  4A3B G;  1BBX C;  3VYR A;  4JBW A;  1L1O B;  2UXD L;  3HOX H;  5FK9 C;  4POG A;  2JA7 B;  4QUF A;  5EPK A;  4DAY B;  1A6X A;  2KEN A;  1BCP B;  1K3B C;  2JK8 A;  1S3O A;  3EN2 A;  1PFN A;  3M7G A;  5IYD H;  2Z6B A;  2N78 A;  2Q2I A;  3OW7 A;  4NB3 A;  4P2C B;  2I5H A;  4WJW A;  5JVH 3;  2VQF Q;  3HOY B;  2D0O A;  4HIO A;  1YNX A;  3MFY A;  3PUX A;  3CHB D;  4QIW E;  4DUZ L;  4QQB X;  2HT1 A;  4IAL A;  2Q2H A;  5C4X H;  2EYF A;  2L1B A;  5COR A;  3T1Y Q;  3S1Q H;  2ENB A;  4XT3 B;  1MSH A;  1WD0 A;  1BCP D;  2L15 A;  3D0F A;  3HOV B;  5JJK A;  5KRU A;  3J80 E;  1RKN A;  4L5Q A;  2KCC A;  3HOU H;  3RLN A;  1SLJ A;  1FNW A;  4RCO A;  1STB A;  1X3Q A;  2MPM A;  4K14 A;  4GOP B;  3HRZ C;  5FKA C;  1EY0 A;  2HQE A;  1BQQ T;  3OPO A;  4EQN A;  3ULP A;  3H6M A;  1AZQ A;  3RN2 A;  1D2B A;  2YV5 A;  3GTG B;  1N32 L;  2IY5 B;  5C4Z A;  2Y0S G;  2YTX A;  5BN5 A;  2K6A A;  4WFN 3;  1VQB A;  3HKZ B;  1PV4 A;  1GXD C;  4HJ7 A;  4A3F G;  5I6Y A;  2B8G A;  4DV0 L;  2IX1 A;  2PMZ E;  1VQ7 A;  4ABN A;  3ND9 A;  1SJE D;  5JOB A;  4K0K L;  4K8I A;  2IWH A;  1K8A C;  4OEL B;  1YEZ A;  4DAV A;  2K50 A;  1LTG D;  5IYC G;  3SVM A;  4DV2 Q;  4HMI A;  2QF7 A;  1IBL Q;  1HZB A;  2JJQ A;  3EQL C;  1N36 Q;  3LGJ A;  5LMN Q;  4A3L G;  4X3K A;  3KBG A;  1XTC D;  4C3J B;  1RIP A;  5ISR A;  1SYC A;  4LF5 Q;  1NMG A;  4A3K B;  1C0A A;  2M9V A;  4C3H H;  1K9M C;  3A8I E;  4FF3 A;  2P5Z X;  4XTC S;  2Q2T A;  1VQ6 A;  1JB3 A;  4LFB L;  5BR8 Q;  1WYD A;  3VYU A;  2LMC B;  3D4D A;  1HZA A;  4FXG C;  1FGU A;  4A93 G;  2PMZ B;  2MHV A;  1QUQ A;  4MZ9 A;  5K5P A;  3GTG H;  2A6E D;  3UDI A;  2CQA A;  1DD2 A;  1LTI D;  4IPH A;  5JAV A;  4O42 A;  5JJZ A;  4HN7 A;  1G6P A;  4CJ1 B;  3A55 A;  4KD4 A;  1I6H B;  2GN5 A;  3BJU A;  1L0X B;  3I72 A;  3CRL C;  4QGU A;  3S2H B;  4GOP C;  4P74 A;  5IYB H;  1VQN A;  4IJH A;  4KN7 C;  4IUT A;  1R4P B;  4R4Q A;  1VQI A;  2NN6 G;  2AWO A;  2B2U A;  2XWB B;  1QOH A;  1ZYR C;  2D62 A;  2F0W A;  2VXW A;  3CCM A;  2OTJ A;  4C3J H;  3D4R A;  1RJT A;  3I4N B;  4IUQ A;  2EYL A;  2JA8 B;  2WKD A;  1KXL A;  1F9S A;  1Y8O B;  2BH2 A;  1HFN A;  4DR2 L;  2HHH Q;  2K5W A;  3SEB A;  4JVZ A;  1TY0 A;  1YNJ C;  3AYH B;  1IW7 D;  3G48 A;  3TSS A;  3NEL A;  4GS3 A;  4NPS A;  3X3M A;  1TWA H;  4LWC A;  3RUZ A;  3NQI A;  4GNX A;  5K36 G;  3CQZ B;  4A3I B;  2F0L A;  4DV4 L;  1GUN A;  1PRT F;  3K6O A;  2R3Z A;  1CKN A;  3PQI A;  1TWC H;  2JA6 G;  1FL0 A;  2R93 B;  4HMJ A;  2HDL A;  1N8R C;  4JI6 Q;  3K8A A;  4DR1 L;  3NXW A;  2IX0 A;  4LAA A;  3A74 A;  1NMF A;  1K83 H;  3F1Z A;  3I4L A;  1WTP A;  2ICE C;  3H0G B;  1KQS A;  1PTO H;  5I9P A;  4KHP L;  2NWG A;  3ICE A;  4BXX H;  1XTD A;  2OWO A;  3KOJ A;  5KNC A;  5ELB A;  4LNQ A;  2QGQ A;  3TME A;  1FVI A;  1EY8 A;  4HJA A;  2IW3 A;  4TQU S;  1E2V A;  1TWF B;  1ICF B;  1UEA B;  1ET6 A;  1KHI A;  4K5V A;  1LT3 D;  1HUM A;  5DAU A;  4XQQ A;  1WJJ A;  1Z6H A;  1FNU A;  2J0T D;  1H9K A;  1HNX Q;  2PQA A;  2RQX A;  2RBM A;  3PMF A;  1SFO B;  4ME5 A;  5EJW A;  1U4L A;  3H91 A;  4BBS G;  4DR5 Q;  3E6Z X;  5J39 A;  4A3E G;  1Q12 A;  3HG9 A;  4LF4 L;  2F3W A;  1YHB A;  2PYK A;  1R4Q B;  1FJG Q;  2B2V C;  2Q2U A;  4KK7 A;  3H0G H;  2MO0 A;  4A76 A;  1N34 Q;  2HQL A;  4EQ5 A;  3RD4 A;  1HZ9 A;  5EBC A;  3S15 H;  3JAM E;  3U50 C;  4BY7 G;  3GTJ B;  2IL8 A;  1HQR D;  1JOO A;  3X3N A;  2Z6K C;  1H9M A;  1SNP A;  1I50 H;  1D8L A;  5DM7 3;  3HS0 C;  2B63 H;  2QDB A;  2JN4 A;  3CC7 A;  1FYC A;  2A6E C;  1EQR A;  2QIL A;  2B2T C;  1EIY B;  3F2B A;  2L55 A;  3A7L A;  1CKO A;  3EBE A;  3I56 A;  3EA6 A;  2SOB A;  3WDN A;  2B2T A;  2RA4 A;  3STB C;  3I55 A;  3G7L A;  2D0P A;  1U0L A;  1IBK Q;  4IFD H;  4C3H G;  1QZG A;  3D8G A;  4P71 A;  3R3O A;  4PZ6 A;  4FF1 A;  3HZX A;  2KA7 A;  2F0F A;  2HIX A;  2LY7 A;  1ROD A;  2DY7 A;  5M3F B;  5BR8 L;  4JCV E;  2NUC A;  5C44 G;  3I7F A;  2CH4 W;  2RKS A;  1ENF A;  4JI2 L;  3GO5 A;  1I6H H;  3TP5 A;  3GTK H;  3S24 A;  2F0H A;  2Q8T A;  1C48 A;  4A93 H;  4PQX A;  5CV8 A;  1RTN A;  1SDF A;  1LT4 D;  4QB4 A;  1YIJ A;  4FO2 A;  4C2M B;  1LO5 D;  1EY9 A;  1KDC A;  5J3B A;  1CTM A;  1I4G A;  1Z9F A;  3K80 C;  4LF6 Q;  3TRE A;  1EQT A;  3K5O A;  3CME A;  4MHE A;  1MBY A;  4FNF A;  1UAP A;  2LS0 1;  1WTH A;  4DU9 A;  1O80 A;  1KNE A;  4CKB A;  5CV5 A;  3Q23 A;  4JYA Q;  2A69 D;  4TRD A;  1DOM A;  2WV6 D;  3CD6 A;  1A2T A;  3S1N H;  4AYB G;  1V1O A;  4BY1 B;  1Y1W G;  4DV0 Q;  1YVC A;  1P8L A;  1PH7 A;  1S4Z A;  1CQF A;  1EOV A;  1H9R A;  4IPC A;  4OIK A;  3T51 B;  4XXE A;  5J1Z A;  3PO3 H;  2PW7 A;  3GDE A;  3LX0 A;  4N9P A;  4A3I H;  4CKC A;  1JR0 D;  3NUC A;  4TVA B;  2FMM A;  1WCM B;  5IT9 E;  3H3V H;  2WAQ G;  1U5K A;  2ZM6 Q;  3S16 B;  4HTH A;  1EWC A;  1CA6 A;  3E0J A;  1ICW A;  1TKW B;  3KLR A;  1SSO A;  1BCP C;  4K8J A;  2JE6 I;  2MO1 A;  4KJO A;  1BR9 A;  3P7J A;  2EOT A;  3U9S A;  3NBH B;  2O5I C;  5DNF A;  1O7L A;  2N55 A;  4NXM L;  2PQE A;  5IGB A;  4LF7 Q;  4DKA C;  5HUR A;  1JQY D;  4AH6 A;  1CKM A;  5A35 A;  1BF4 A;  1LM0 A;  3H3V C;  1ESR A;  4A3B H;  1SRU A;  2K75 A;  1VQK A;  3M3Y B;  1XMQ L;  3HOX G;  3PUY A;  1DCZ A;  4ID6 A;  4JI0 Q;  1STA A;  4R9W A;  4A3J B;  1F2M A;  4JI3 Q;  2LXJ A;  5IWA Q;  2DN8 A;  2F0S A;  3A8K E;  1OXX K;  1PRT B;  3PUV A;  3JC6 6;  1PH1 A;  2QW7 A;  1XYI A;  4CGY B;  3BG3 A;  1NR2 A;  4B3R L;  2Z8L A;  1HA5 A;  4ZUJ A;  2F4V L;  5IT9 L;  2NN6 I;  3ER0 A;  1EY5 A;  3MXU A;  4I7A A;  2ZJQ A;  1STE A;  4IPG A;  1PHJ A;  2OQK A;  4QUC A;  4DR5 L;  1GUT A;  4CDE C;  2RDH A;  1I3Q H;  1TT2 A;  3NPP A;  1MI2 A;  2XRQ D;  3C2P A;  2Y0S B;  2SDF A;  4B9W A;  4A3G H;  3R2T A;  4LW1 A;  4C1N K;  2EY6 A;  4R4O A;  2PPB C;  3S15 B;  3BDL A;  5LMN W;  1VQ9 A;  2F0M A;  2A19 A;  5DM6 3;  1B7Y B;  1EUJ A;  1SR3 A;  1XWE A;  4AQY L;  1R9T H;  4G7H C;  4H44 C;  2OCE A;  4IOA A;  2RDG A;  1V9P A;  2Z6K A;  2K03 A;  1ONL A;  1HCZ A;  3DLL A;  1QCB D;  1ZEQ X;  1X65 A;  2CQO A;  2ZJR A;  1KTK A;  5LL6 X;  3SGI A;  3G6E A;  1XMO L;  2K5V A;  2VUM B;  5COY A;  5FLX E;  2R61 A;  3HOU G;  1HUN A;  3IL8 A;  5M5X H;  4LFA Q;  3Q0A A;  4OX9 L;  1X6O A;  4R1J A;  4LFA L;  1FNV A;  4LF8 Q;  4CDD C;  4X62 L;  2JA9 A;  2WII B;  4M8A A;  1B4O A;  5FO7 B;  4KY5 A;  1CM9 A;  1LTS D;  3OMC A;  3J7A V;  1TS3 A;  1X56 A;  4OO1 H;  4X3U A;  4A3G G;  3KF8 A;  1V43 A;  4RA8 A;  5C5L A;  3RMH A;  3OYY A;  3VYS A;  3U9O A;  1D5Z C;  5HGT A;  1Y1V H;  2HCI A;  2OF1 A;  2G5D A;  1GOZ A;  1BVS A;  1IYU A;  4KLK A;  3E9I A;  3NEM A;  4DK6 C;  4DV4 Q;  3MFG A;  1WTO A;  3W3A A;  2JA7 H;  5CMD A;  3C1F A;  1EIH A;  3PGZ A;  1N9W A;  4JI8 L;  5GAH C;  3M7N A;  2XVS A;  3G4S A;  4IFD I;  1BKB A;  2LFN A;  4J8Q A;  3VA5 A;  4PMC A;  1I6V C;  1IYV A;  3J7Y W;  2XSC A;  2OXP A;  2AQ2 B;  3G6J B;  4GKJ Q;  3QB3 A;  1KAA A;  4JI5 L;  2RSN A;  1WFQ A;  1Y8P B;  1B3Q A;  3I90 A;  4NXM Q;  2EZV A;  1A8V A;  2EYH A;  4MTN A;  5M5X B;  2BDN A;  1C9O A;  1U9R A;  3BYY B;  1OXV A;  4A3D G;  2R7F A;  3DEP A;  1I4Q A;  3DWP A;  1A3U A;  5IGE A;  1RTO A;  3P75 A;  1CHP D;  3EFX D;  2EQS A;  3K57 A;  1HA6 A;  1HFG A;  1C7Y A;  1SYB A;  4OWX B;  1CQV A;  3GQB A;  4JOI A;  4GNX C;  3C1E A;  4LUV A;  4JI3 L;  1IL8 A;  5C0X J;  1OO9 B;  3K7A B;  3NE5 B;  3ULJ A;  3A5U A;  4ALP A;  4IUU A;  1HH2 P;  4NMZ A;  3R93 A;  3KDF A;  3B6Y A;  1EFW A;  3DWQ A;  2B29 A;  3DMU A;  1BDO A;  2EJF C;  1ILP A;  4IPD A;  2IPK D;  2NTT A;  4PZ8 A;  3BVG A;  4QMG A;  3CMA A;  4R4C A;  4YY3 Q;  1LTB D;  3LNN A;  2NTS A;  4UPA A;  4P73 A;  1DOK A;  3BZK A;  3CPF A;  1HHV A;  5C4J H;  2F0I A;  1PTO C;  1XPO A;  3CXC A;  4S3S A;  3OMG A;  2KED A;  1OTC A;  4DR7 Q;  2R7D A;  3HKZ E;  3K5N A;  1M8A A;  2WB1 B;  1X3F A;  5GAG C;  5IP7 G;  4OEM B;  4DV6 L;  2J7Z A;  4K2K A;  1XMQ Q;  2I5L X;  3A5Z B;  3NTI A;  1JB7 A;  4UDU C;  1VQ5 A;  4HED A;  4DNR B;  2HD3 A;  3J80 L;  3DEO A;  5EBD A;  2K28 A;  3MXG A;  2DJF C;  5JVG 3;  1PTO F;  3K5M A;  4X65 L;  5IP9 H;  4JOI C;  2WFW A;  1SYG A;  4C1N I;  5I2X A;  3DUZ A;  1RHP A;  3S14 H;  1V8Q A;  1QJO A;  1TWH H;  4F87 A;  4F88 A;  4QIW B;  2DNE A;  1YNN D;  2IT1 A;  2Z9H A;  4K5W A;  3SXH A;  1W6K A;  1L1O A;  2YU9 H;  3KBX A;  1AH9 A;  2NB0 A;  3K58 A;  3RLO A;  4UP7 A;  2E2H B;  4C3I G;  1YIT A;  3KYH C;  1MSG A;  3L2P A;  1TII D;  1S5D D;  4L5S A;  4LFC Q;  3L9A X;  2H4O A;  4A3B B;  5DEH A;  1FD7 D;  4G7O C;  5IGG A;  5DLQ E;  3GTP H;  4J15 A;  2EVB A;  5KIX A;  2L9H A;  3F8T A;  2CKZ B;  2FHT A;  5I2Y A;  2ID0 A;  4DGZ A;  2EY5 A;  4BY1 G;  3T56 B;  2MNA A;  5ELO A;  5C4X B;  2Q8I B;  1V1P A;  2G9H D;  1OXU A;  2CFM A;  5FLM G;  2E5L Q;  1G6Z A;  4FXK C;  5CR3 A;  4A3M B;  1JE5 A;  2HUG A;  1I4H A;  4UHV A;  3CPW A;  1TWH B;  2K4K A;  3TP6 A;  4DPG A;  2UXC Q;  1ASY A;  2BCO A;  2BA0 A;  1AEX A;  1CUK A;  4O0A A;  4ZK9 B;  1IL2 A;  4CDC C;  5IIF A;  3F2D A;  3OOC A;  2V1C C;  5M3F H;  3RNU A;  1PDQ A;  4EGV A;  4TSS A;  4POF A;  3V96 A;  5CBA E;  3OIP A;  1EYC A;  4A3E H;  2EIF A;  4ULL A;  1JWS D;  1F2Z A;  5CV9 A;  3SK4 A;  4K6L A;  4RKB A;  4C56 C;  4EX5 A;  4JI4 L;  1DZ1 A;  4A3M G;  1Y1V G;  3AEV A;  1XNR L;  5E1F A;  1SE3 A;  3HOY H;  1LYL A;  1KDB A;  2XWJ B;  4LF7 L;  3PO2 B;  2R92 B;  4IZ8 A;  4HAE A;  4ZKC B;  3OIQ A;  1B44 D;  3T53 B;  1EIG A;  1EL0 A;  1VQO A;  4G57 A;  4GLX A;  4KHV A;  1VQF A;  3UI2 A;  1ML0 D;  3J81 L;  2N3S A;  4AQY Q;  3DXJ C;  4Y52 H;  3S1M H;  4B3T L;  1EQV A;  3DM1 A;  2GVA A;  4DV7 L;  3JAM i;  1WTV A;  5FO9 B;  2WAQ B;  3D6C A;  3MZ5 A;  1EYG A;  1G2S A;  2K7V A;  2KOL A;  1CFM A;  1HTL D;  4X62 Q;  4IO9 A;  1IBK L;  1BBW A;  1PTO D;  1YHA A;  4P72 A;  2XN9 C;  3CU7 A;  5I4D A;  1I94 Q;  1DGS A;  2JA5 H;  4LJZ C;  2F0E A;  2SNM A;  1HPC A;  5IYB G;  1YI2 A;  1QNK A;  1HNX L;  2WP8 J;  3AU7 A;  3J7A 5;  2DGY A;  2ZXR A;  5M9O A;  4U68 A;  1TWG B;  5JJL A;  3WWV A;  1PH6 A;  3KJP A;  1VF5 C;  4ZCK A;  3VYT A;  2KHI A;  2F4V Q;  2ZXP A;  4RG1 A;  3SHL A;  1LT5 D;  1E3P A;  3P1H A;  1Q86 C;  4A3F B;  2X6G A;  2Z1C A;  3OTO L;  2KJX A;  1X54 A;  4JC0 A;  2NZO A;  2D2C C;  3HOZ H;  2AQ3 B;  2UUA L;  5IOC A;  3ONA B;  4RGT A;  1FJG L;  4JW0 A;  1L0Y B;  4PV1 C;  1S5E D;  3W1B A;  2EYP A;  1H9S A;  3V05 A;  1SE4 A;  1M90 C;  5ELE A;  4LF4 Q;  3HOY G;  4UAI A;  4O2D A;  1EYA A;  3E3X A;  2EJG C;  2C5C A;  2BE5 C;  2DUD A;  1OXT A;  3CQZ H;  4DR1 Q;  4DV5 Q;  4A3K G;  3VA7 A;  1WCM G;  2OEO A;  3OWF A;  1A2U A;  5JEA G;  2VNU D;  3FPU B;  1VQA A;  1HNW L;  2EYO A;  2TMP A;  4HSV A;  5GRO A;  2ZTE A;  3FKI G;  2E75 C;  3A8J E;  3CC4 A;  2UXD Q;  4X6A H;  2F4I A;  3A7A B;  4MIU A;  1W3S A;  1XNQ Q;  2K32 A;  4H02 A;  4GN3 B;  2JA6 B;  5D3D A;  1PFB A;  5C3W A;  2PO4 A;  2XTI A;  5EPL A;  4EQO A;  4YCW A;  5C4J B;  1KD1 C;  3OW2 A;  3BDC A;  3TP7 A;  1PH3 A;  3QOL A;  1TXY A;  3QIA A;  2CWP A;  2VUM G;  1BBU A;  2NVT B;  5M5W B;  4OWW B;  5GAE C;  2K05 A;  2BOS A;  2SEB D;  3MC0 B;  1CSP A;  2YTY A;  1VQC A;  4JV5 L;  4DUY Q;  1K8O A;  1JIC A;  4Q5V A;  1GKH A;  3MWY W;  2E5L L;  1QZH A;  5C3E G;  3I4N G;  3NBH A;  4BXX G;  1RF2 D;  5E7N A;  2NVX B;  2AMC B;  3BVM A;  4EVO A;  1GHK A;  4X66 Q;  5D14 A;  4OXP A;  1IZ6 A;  3BVZ A;  4PMB A;  3FPP A;  3GD7 A;  4CBV A;  4DR4 Q;  2GVB A;  1AN8 A;  3A54 A;  1HNW Q;  2KQ3 A;  5I6W A;  4KHZ A;  1Y69 U;  1QUQ B;  4KKT A;  2R7Z G;  4GKK L;  4JK1 C;  2Q8R E;  1K83 B;  5G3L F;  1I4R A;  3MHB A;  3MXP A;  1F77 A;  4YIJ A;  4E6I A;  3GV6 A;  2A69 C;  1G51 A;  2GA4 B;  4NKL A;  1AE2 A;  3EJI A;  3M4Q A;  1EFI D;  5CC4 A;  2JEB I;  2B63 B;  5KND A;  1UE7 A;  4ZKB B;  3Q22 A;  4ZRZ A;  2MUY A;  1S5B D;  5C5M A;  3NTK A;  3DM3 A;  3M9B A;  4APV A;  4RHS A;  1STH A;  2VS1 A;  3I73 A;  4B9X A;  1TU2 B;  4IFD G;  1T9H A;  2Z4I A;  5E4W C;  3IAY A;  3DHQ A;  5EKI A;  1TWF H;  4KKU A;  2B8F A;  4DR7 L;  3VR6 A;  4YWK A;  2I46 A;  4OO1 I;  2F1M A;  3S9W A;  4CHT B;  4A3M H;  4DAP A;  3M4O H;  3A0J A;  1FR3 A;  2ALY B;  4XIG S;  1STY A;  3GTO B;  2PCF B;  1STG A;  2MQH A;  4R8N A;  1H95 A;  2QEJ C;  2ZXO A;  1RL2 A;  4DV1 L;  1N32 Q;  1PH8 A;  1SAP A;  2R6G A;  2DNC A;  4DV7 Q;  1D5X C;  3AFP A;  2E2J H;  3FMC A;  1ASZ A;  3NWT A;  2AUJ D;  1B3A A;  3QOJ A;  5M3F G;  5C3X A;  3K81 C;  2F0V A;  4K0K Q;  2F0P A;  3BS1 A;  1EIF A;  1WTQ A;  3QJY A;  2NZH A;  2ZT9 C;  2N8N A;  4A3E B;  3HP3 A;  4XYO A;  4OWT B;  4JI1 Q;  1PVO A;  1KNA A;  4B3S Q;  1EWI A;  1LTT D;  3U4V A;  2F0U A;  1LAC A;  4ZQ3 A;  4A3F H;  2HHH L;  1ET9 A;  3I70 A;  4NXN L;  4Q0F A;  4BBR H;  1EY4 A;  2BA1 A;  1XNR Q;  3J81 j;  1BXT A;  3VR3 A;  4LF5 L;  5C4X G;  1M4V A;  1PYB A;  2L11 A;  1XPU A;  2UXB Q;  1B50 A;  4PZ7 A;  1N36 L;  1GO3 E;  4JI7 L;  3HOV H;  4A3C G;  4OON A;  3PF4 A;  3H94 A;  3CCL A;  2E2D C;  1B70 B;  3UDF A;  4LFC L;  3I3C A;  1EZ6 A;  4F7X A;  3PO3 B;  1QVG A;  2DJG C;  1BNZ A;  1EWH A;  2E2J B;  3NHH A;  4LMQ D;  3J80 c;  1JJG A;  1CZW A;  2A5H A;  2KVM A;  1U4R A;  4JI6 L;  4QJF A;  3AB9 A;  4ODG A;  5JPN C;  2L4N A;  3FEW X;  1HNZ Q;  2MJ8 A;  1SNQ A;  1MHW C;  2FJ2 A;  2PQA B;  2PNH A;  3J81 c;  1QWY A;  4L63 B;  1D1K A;  1PYS B;  2H5X A;  2JA6 H;  2K14 A;  3ZYY X;  1EY6 A;  1NNX A;  2CHB D;  1AW7 A;  2CWA A;  4K6D A;  4K2L A;  3RZO H;  4Y7N H;  1A15 A;  3QR8 A;  1XJV A;  5IGC A;  1HR0 W;  3PV0 A;  2NVY H;  4DAM A;  2QKI C;  3ND8 A;  2ZJP A;  4YWL A;  1VQL A;  5M5W H;  1WI5 A;  1F9P A;  5G3L D;  4NW2 A;  2A74 C;  2F0J A;  2PW5 A;  2EY1 A;  4KI0 A;  5JJI A;  3N6R A;  3C3L A;  3PIO A;  3S1R B;  2O2L D;  1UUP A;  4UP8 A;  4A3J G;  5M5Y B;  1B1Z A;  1EZ8 A;  1D7Q A;  2UXB L;  3Q8D A;  1KLU D;  5IT9 c;  1X3E A;  1II3 A;  3FVQ A;  3GP7 A;  1CK1 A;  2NYZ D;  1NY4 A;  4N8X 1;  1D5M C;  3MTS A;  2O4X A;  1JT8 A;  2I07 B;  3L7Z C;  4JI4 Q;  1J9O A;  5BN3 A;  4WRD A;  4JI8 Q;  4KJN A;  4KN4 C;  2JA7 G;  1IKM A;  1JMC A;  2NVQ H;  5KYI A;  1PRT D;  2A68 D;  2FMC A;  4JPB W;  5M3M H;  5FLX c;  4KHP Q;  1ZKO A;  1NJI C;  1Y8N B;  1RDP D;  4IN3 A;  1HR0 L;  1P16 A;  2V4D A;  1GJX A;  5AJ3 Q;  1ILQ A;  2VL6 A;  5C44 B;  4KV6 A;  3OSO A;  2L12 A;  5ELC A;  5CV6 A;  1NUC A;  4X65 Q;  4C3J G;  1R9T B;  2JA8 H;  2F03 A;  5D65 A;  1S40 A;  3MEF A;  1X32 A;  1B9N A;  3KFU A;  4BY7 H;  5J22 A;  2EJM A;  3M4Y A;  4LK1 C;  2UXC L;  3GTL H;  2D5D A;  1TY2 A;  2ZTC A;  1ZXT A;  5C6A A;  3T4A C;  4LUZ A;  3RZD B;  4A3J H;  2OT2 A;  3AQQ A;  5IWA L;  2VZA A;  1XPR A;  1VDZ A;  3HOZ G;  1G91 A;  1Q1E A;  3J80 i;  4G4K A;  5ELN A;  2UUB Q;  5GAD C;  3J81 i;  4YY3 L;  4IUN A;  3KLS X;  5CV7 A;  2K5H A;  1JOR A;  3HGB A;  4AYB B;  2F0G A;  2XGT A;  3P20 A;  1PH5 A;  4RCN A;  4M1U B;  1F2L A;  1N33 Q;  4IUV A;  2X69 A;  1QNU A;  2K5Q A;  5C44 H;  1SBB B;  4A3G B;  1PRT C;  4H13 C;  3W1G A;  1VF7 A;  5C0X I;  1AZP A;  1STN A;  4DR4 L;  1SEB D;  2EE1 A;  1Y1W H;  2UUC L;  1QG7 A;  2WB1 E;  2KCN A;  3CCQ A;  1MJE A;  4DK3 C;  1LTA D;  2A6H C;  5A2Q L;  3GTL B;  1LAB A;  2OTL A;  5KEE A;  4XQJ A;  2OQ0 A;  4A93 B;  1SE2 A;  1YHQ A;  3H3V I;  2DY8 A;  1RCV D;  1E24 A;  5D3I B;  4BBR B;  1A3V A;  4DK0 A;  1X3P A;  1J5E Q;  4OGQ C;  1GD7 A;  4U67 3;  1SXT A;  1VQ8 A;  4UY8 C;  2A1A A;  4OIJ A;  2VQF L;  1IBM L;  2VUM H;  3NEN A;  1DJR D;  2AWN A;  1MIU A;  1K3R A;  3HOV G;  3OWE B;  4A3C H;  2IHE A;  1BUV T;  1NR4 A;  3TRZ A;  2BH8 A;  4V0B A;  3R2I A;  1E7Z A;  1YNN C;  4DR6 Q;  1I4P A;  3M4O B;  5KNB A;  3GTO H;  5CBE E;  2M00 A;  2LKV A;  3IFD A;  2RHS B;  4OL7 A;  5LMU L;  3K5L A;  5EQ0 A;  2B2V A;  4DR3 L;  1TS2 A;  3HOU B;  3FRP B;  2KCT A;  4IQZ A;  2KEE A;  5NUC A;  4AIM A;  5FO8 B;  1KIX A;  2ASB A;  2B2U C;  4DV3 Q;  3KF8 B;  3TQY A;  4Z9C B;  5LMU Q;  3LWU A;  3R8B A;  3GTM B;  3JAM L;  3CCV A;  3I2Z A;  4BA1 I;  4TKO B;  4JBK A;  4DK1 A;  1ENC A;  4X3T A;  1D1I A;  4JI2 Q;  2RSO A;  2EY2 A;  4DN4 M;  1NTG A;  2B63 G;  1DM0 B;  4RGO S;  3FP9 A;  2R92 H;  1E2W A;  1CT1 D;  1IW7 C;  1E2Z A;  1UE6 A;  2PZU A;  3UE1 A;  1PH4 A;  5E3F A;  2NZ1 D;  4YCV A;  1SMX A;  4XQN A;  1A0I A;  1BOS A;  1LV9 A;  1SYF A;  3NK9 A;  3G71 A;  1SNM A;  1AP0 A;  4BBS B;  1EEI D;  3OHX C;  4CJ0 B;  3S1R H;  1SNC A;  2K1B A;  3SR1 A;  1TS5 A;  4A75 A;  1Z7T A;  5M5Y H;  2RCF A;  3TS0 A;  4IUP A;  4RAU C;  1Y14 B;  4CKE A;  4NXN Q;  1DYQ A;  3MEH A;  3I91 A;  2BE5 D;  2AKW B;  3F2C A;  2NVX H;  1EEF D;  3OTO Q;  1WD1 A;  4YWM A;  1Q82 C;  2C9O A;  1WTW A;  1VQ4 A;  1Q46 A;  1F9R A;  1F9Q A;  3K7U C;  4RMF A;  1A62 A;  5LL6 S;  1A63 A;  2QCP X;  4DV1 Q;  3I4M G;  3H15 A;  5A2Q E;  1GUS A;  5L37 A;  1GVP A;  2SNS A;  2G9D A;  4GNX B;  1JCK B;  4RHR A;  1YJN A;  4JBM A;  4JI0 L;  1SMY C;  5IY0 A;  2F3I A;  5ELD A;  3CAM A;  2F0O A;  5EKL A;  1C8C A;  1B2T A;  5IOD A;  2JP1 A;  3SE0 A;  3HKS A;  1MD2 D;  5CV4 A;  3I4N H;  1HTP A;  3AFQ A;  3T1H Q;  1VS0 A;  3C46 A;  5T1G A;  1GUW A;  2Z4H A;  3M4P A;  1NSN S;  4IUR A;  3TP8 A;  2E2I B;  5IGD A;  3MVV A;  4BWG B;  1DXM A;  2JSO A;  4B3M Q;  1CA5 A;  2F52 A;  3E5S A;  4LF6 L;  3I8Z A;  4KD3 A;  3T13 A;  3LWE A;  1V1P B;  4H0L C;  4I7Z C;  2K33 A;  1TWA B;  4A3D B;  2HIV A;  3CCR A;  1KLG D;  3S1Q B;  3RR5 A;  3MA2 B;  2ES2 A;  1J6Q A;  3I4O A;  2B3G A;  4DA2 A;  1PYW D;  4NDX A;  2KBN A;  3SK6 A;  2IX3 A;  3NQT A;  1QIL A;  2WB1 G;  1O7Z A;  4FVM A;  3TS2 A;  2WIN B;  1K73 C;  2HDM A;  3H0G G;  3MXN A;  1UWV A;  5CGK A;  2K52 A;  1Q1B A;  3TN2 A;  2RDF A;  3HOW B;  3TZU A;  3MXN B;  4JI5 Q;  2KUM A;  1CSQ A;  2B2Y C;  3CC2 A;  3ULL A;  1D6E C;  3M3Y H;  4B08 A;  4DV3 L;  1W2B A;  1A3T A;  2NVT H;  3K0Y A;  3S17 B;  3BU2 A;  2QA4 A;  3HFZ B;  4FF2 A;  4R4I A;  2NN6 H;  1PH9 A;  4KKS A;  3SDZ A;  3NSW A;  3SK8 A;  4B3T Q;  4GLA C;  2EXD A;  3TEH B;  1G29 1;  4FYD A;  3A56 A;  3RZD H;  3S2D B;  3ITP A;  3L0O A;  2D9U A;  1HNZ L;  1ZYR D;  1YZ6 A;  2RF4 A;  2YYZ A;  4BA2 I;  4JG2 A;  4A3D H;  3CP0 A;  1TR5 A;  3PO3 G;  1S72 A;  3PO2 G;  1VCI A;  1T5X D;  3HOW G;  3D4W A;  4DR2 Q;  4A3K H;  1VQE A;  2Y0S E;  4PG3 A;  4HJ9 A;  1EU4 A;  4F8M A;  2XNA C;  2PI2 E;  2KEC A;  3WOF A;  1E1T A;  1W6J A;  1SNO A;  1IBL L;  3STB D;  2VW9 A;  1I94 L;  1E0B A;  4L6T B;  4I65 A;  2L5T A;  5IGF A;  5BN4 A;  2B2W C;  2EPB A;  2VQE L;  1B53 A;  1JOQ A;  2JA5 B;  4GN5 A;  1IYJ B;  3S17 H;  1O78 A;  5F2D A;  1Y1W B;  2X6L A;  5EKK A;  4C2M H;  1PFS A;  5KGU A;  3VDY A;  2UUA Q;  2UUC Q;  2QDL A;  3KF6 B;  2ATW A;  1B9M A;  4HCE A;  3ERQ A;  3S2D H;  4H7B A;  5IP9 G;  4A4I A;  3CCU A;  1HXY D;  1K0R A;  1VQJ A;  3PIP 3;  4KMU C;  3KJO A;  1SYD A;  2K04 A;  4XYQ A;  2KHS A;  3BDO A;  1SYE A;  3IFT A;  3PO2 H;  2E76 C;  1CZG A;  2RCN A;  3NBI A;  5FLX L;  4X64 Q;  4YCU A;  1KRS A;  1VQD A;  3S1N B;  4IJL A;  4QL5 A;  1B8A A;  2I5M X;  2A73 B;  2YTV A;  4JYA L;  1VQM A;  1Q81 C;  3KK7 A;  3J81 E;  4X64 L;  1GUG A;  1KAW A;  2B2Y A;  3S1M B;  4AYB E;  2LSS A;  4JBJ A;  1JJC B;  1Q7Y C;  1Y1V B;  4DR6 L;  3PIO 3;  2KHJ A;  4GZY C;  5JEA J;  3NTH A;  3N52 A;  1SE8 A;  1O7Y A;  4GLV B;  4OHJ A;  2VB2 X;  2R92 G;  3FHW A;  1BO0 A;  5EPJ A;  3KF6 A;  4HJ5 A;  1SMY D;  3QWN A;  1G8Z D;  1Z47 A;  4HIK A;  4J1M A;  1Q8K A;  3UDX A;  4JI7 Q;  4HJ8 A;  1LUZ A;  3VR5 A;  3CRK C;  2VQE Q;  1MKH A;  4LF9 L;  4XT1 B;  4CJ2 C;  4KY6 A;  2J4X A;  1VQG A;  1TWG H;  4X3S A;  3W5O A;  1EQQ A;  4GN4 B;  4HSP A;  2YU9 B;  2F0N A;  2FFK B;  4RFB A;  4A3L H;  2ZTD A;  1I5F A;  2Z0S A;  2L0C A;  2F0T A;  2E2H H;  4GOP A;  2EDG A;  1WTX A;  2KCM A;  1N33 L;  1PTO B;  1EY7 A;  1X9N A;  3T1Y L;  1LT6 D;  4IFD J;  1FGB D;  4HR7 B;  3Q24 A;  2VB3 X;  3HOZ B;  3WOE A;  2CVR A;  2A6H D;  5FJ8 G;  1SRO A;  3ERO A;  3K59 A;  4DNT B;  4MTK A;  4DV5 L;  3K7A H;  1WOC A;  1N34 L;  4GKK Q;  1Q90 A;  1KDA A;  3KLW A;  3M85 A;  1NBW A;  1JJ2 A;  3QG1 A;  4X66 L;  4HCS A;  4WOR A;  4DFA A;  5FLM H;  4DF7 A;  1BCP F;  4A3I G;  1L0W A;  1EYD A;  2I0Q A;  3NP8 A;  1PH2 A;  1CKN B;  1I3Q B;  1SN8 A;  1WCM H;  3S16 H;  4N8F A;  3GV3 A;  5JEA H;  4WJ3 M;  4R8I A;  3GTQ H;  2AQ1 B;  2K5D A;  1E1O A;  1Q3L A;  3TBI B;  1MJC A;  4LFB Q;  2XIW A;  2WAC A;  2B39 A;  4ZYS A;  3U4Z A;  3KLS A;  2C35 B;  2M2L A;  3HKZ G;  1S5C D;  2HCC A;  3HOX B;  1JWM D;  3PIP A;  1JWU D;  2PI2 A;  2JYO A;  5IYC H;  1IHZ A;  4CDF C;  2IJ0 A;  1TQO A;  5H1S E;  1Q8I A;  4XDX A;  2CH4 A;  2MFI A;  4N9T A;  1H9S B;  3FKI B;  5T1I A;  1EOT A;  3GTJ H;  4PNY A;  2PNR C;  5HY6 A;  1IKL A;  2WAQ E;  4MNO A;  1K28 A;  4RGN A;  4FP5 D; 
#chains in the Genus database with same CATH homology
 4DR3 Q;  2CKZ B;  3IRB A;  2QGQ A;  2ZTC A;  2ID0 A;  1FVI A;  1YJW A;  2IHF A;  4LUZ A;  4HIM A;  4A3J H;  3CW2 C;  3AQQ A;  5IWA L;  2VZA A;  4BY1 G;  4HJA A;  3U58 A;  1XPR A;  2E2I H;  1UEB A;  2MNA A;  3T1H L;  4TQU S;  5ELO A;  3HOZ G;  1OXU A;  2CFM A;  5FLM G;  2E5L Q;  1Q1E A;  1QVC A;  1KHI A;  4LF8 L;  3J80 i;  5ELN A;  2UUB Q;  1WJJ A;  5GAD C;  1JE5 A;  3J81 i;  2RHQ B;  4YY3 L;  3CPW A;  1HNX Q;  4FDB A;  2PQA A;  2K4K A;  2K5H A;  3JAM c;  4DPG A;  4BBS G;  2UXC Q;  1ASY A;  2XGT A;  3KDF B;  4DR5 Q;  3RN5 A;  4A3E G;  1HJP A;  1Q12 A;  2BA0 A;  1NE3 A;  4LF4 L;  2A8V A;  1PH5 A;  1CUK A;  3CF5 A;  4O0A A;  4JI1 L;  1X3G A;  1N33 Q;  1IL2 A;  1YHB A;  5C44 H;  3F2D A;  1FJG Q;  2V1C C;  5M3F H;  3RNU A;  2Q2U A;  3H0G H;  4POF A;  2MO0 A;  4A76 A;  3W1G A;  1N34 Q;  2HQL A;  4R4T A;  4EQ5 A;  5C0X I;  1L1O C;  1HZ9 A;  1Y1W H;  3S15 H;  4DR4 L;  2UUB L;  4A3E H;  2UUC L;  2EIF A;  3U50 C;  3FKI H;  4BY7 G;  2WB1 E;  1M1K C;  3CCQ A;  1MJE A;  4DK3 C;  2Z6K C;  1I50 H;  2OTL A;  1YBY A;  1D8L A;  4EX5 A;  2OQ0 A;  4JI4 L;  4A3M G;  1Y1V G;  2B63 H;  1GM5 A;  3AEV A;  3CC7 A;  1YHQ A;  1UE1 A;  1EQR A;  1LTL A;  1XNR L;  1EIY B;  3F2B A;  3H3V I;  5FJ8 H;  4BBR G;  1E24 A;  3HOY H;  1CKO A;  1LYL A;  1J5E Q;  3EBE A;  3I56 A;  4IOC A;  3K0X A;  4LF7 L;  2K5N A;  1GD7 A;  4L5T A;  2ZM6 L;  3STB C;  3I55 A;  2JA8 G;  2D0P A;  1VQ8 A;  2A1A A;  4UY8 C;  1OXS C;  1U0L A;  2VQF L;  1IBK Q;  1IBM L;  3NEN A;  2VUM H;  2AWN A;  1MIU A;  5HGQ A;  1K3R A;  1VQO A;  3HOV G;  4A3C H;  4A3C G;  2IHE A;  3D31 A;  1QZG A;  4GLX A;  3TRZ A;  2BH8 A;  1HZC A;  1UE5 A;  1VQF A;  1E7Z A;  2N3S A;  5AJ3 L;  4P71 A;  4DR6 Q;  4PZ6 A;  4AQY Q;  4DV6 Q;  4Y52 H;  3S1M H;  4BBS H;  4B3T L;  4BY1 H;  4DV7 L;  2GVA A;  5C0X G;  3JAM i;  3CCJ A;  1PA6 A;  4OX9 Q;  3GTO H;  2HIX A;  2RHS B;  5LMU L;  2CCZ A;  4DR3 L;  4OO1 G;  1X55 A;  5BR8 L;  1XMO Q;  4JCV E;  2KCT A;  3PF5 A;  1EYG A;  5C44 G;  4AIM A;  3I7F A;  1KIX A;  2ASB A;  4DV3 Q;  1L2F A;  3KF8 B;  4X62 Q;  3TQY A;  4IO9 A;  5LMU Q;  1IBK L;  1IBM Q;  1BBW A;  4JI2 L;  1YHA A;  3GO5 A;  4P72 A;  1I6H H;  2R93 G;  4C3I H;  1I94 Q;  1DGS A;  2JA5 H;  4L5R C;  3GTK H;  3CCV A;  3S24 A;  3S2H H;  3I2Z A;  5IYB G;  2VY3 A;  4BA1 I;  1YI2 A;  1HNX L;  4JBK A;  4A93 H;  2WP8 J;  4B3M L;  5EAY A;  2DGY A;  3J7A 5;  4LF9 Q;  4JI2 Q;  1YIJ A;  5JJL A;  3WWV A;  1PH6 A;  1NTG A;  3KJP A;  2B63 G;  2R7Z H;  5J3B A;  2KHI A;  2F4V Q;  5LMN L;  4DUZ Q;  1Z9F A;  3FP9 A;  4RG1 A;  3K80 C;  2R92 H;  4LF6 Q;  3TRE A;  1E3P A;  1Q86 C;  1UE6 A;  3UE1 A;  1PH4 A;  4UP9 A;  3CME A;  3PSI A;  3OTO L;  4YCV A;  1SMX A;  1X54 A;  3PUW A;  1A0I A;  4JC0 A;  3CCS A;  2NZO A;  3PCO B;  3HOZ H;  2UUA L;  4JYA Q;  3G71 A;  1FJG L;  3CD6 A;  3S1N H;  4AYB G;  3S1R H;  1KRT A;  4DV0 Q;  1Y1W G;  4JV5 Q;  1YVC A;  4A75 A;  1P8L A;  1V1Q A;  3W1B A;  1PH7 A;  1M90 C;  4LF4 Q;  3HOY G;  5M5Y H;  1EOV A;  2FXQ A;  3ZJY C;  4O2D A;  4IPC A;  3TS0 A;  4DNI A;  5C3E H;  3PO3 H;  2DUD A;  1Y14 B;  1OXT A;  4NXN Q;  3GDE A;  4P75 A;  3UDG A;  2E8G A;  3CQZ H;  3CCE A;  4A3I H;  1HR0 Q;  4DR1 Q;  4DV5 Q;  2AKW B;  5IP7 H;  3F2C A;  3I4M H;  4GKJ L;  4TVA B;  2NVX H;  4A3K G;  1WCM G;  3OTO Q;  4YWM A;  3J7Z C;  1Q82 C;  3H3V H;  2WAQ G;  1U5K A;  5JEA G;  2ZM6 Q;  1QVF A;  3E0E A;  3GTM H;  2VNU D;  1VQ4 A;  1Q46 A;  1VQA A;  4YHH L;  1HNW L;  3K7U C;  1O7I A;  1KL9 A;  3BZC A;  4RMF A;  5GRO A;  2R93 H;  1A62 A;  2ZTE A;  1A63 A;  3FKI G;  4QY7 A;  3CC4 A;  2JE6 I;  2MO1 A;  2UXD Q;  4X6A H;  4DV1 Q;  3I4M G;  1W3S A;  1XNQ Q;  3H15 A;  3NBH B;  1GVP A;  3E9H A;  4LUO A;  4H02 A;  1VQH A;  4GN3 B;  5IYD G;  3UE0 A;  4NXM L;  1IXR A;  4B3R Q;  4GNX B;  3EIV A;  1J5E L;  4LF7 Q;  4DKA C;  2XTI A;  4ME3 A;  1YJN A;  4JBM A;  4JI0 L;  3HOW H;  4AH6 A;  1CKM A;  5IY0 A;  1LM0 A;  2F3I A;  1XNQ L;  3CAM A;  4YCW A;  2JEA I;  4A3B H;  1E22 A;  1SRU A;  2K75 A;  1KD1 C;  3OW2 A;  1VQK A;  1XMQ L;  2JQO A;  3HOX G;  1PH3 A;  3PUY A;  3I4N H;  3HKS A;  1TXY A;  4JI0 Q;  2CWP A;  5M3M G;  1BBU A;  2UU9 L;  2VUM G;  4OWW B;  3RLF A;  5GAE C;  3AFQ A;  3T1H Q;  1VS0 A;  1VQP A;  4JI3 Q;  2LXJ A;  4PMW A;  3M4P A;  1CSP A;  2YTY A;  5IWA Q;  1OXX K;  1VQC A;  3PUV A;  4JV5 L;  3JC6 6;  4DUY Q;  5IE8 A;  4B3M Q;  1PH1 A;  2F52 A;  2UU9 Q;  1GKH A;  2E5L L;  4LF6 L;  1QZH A;  4B3R L;  2AHO B;  5C3E G;  3I4N G;  4BXX G;  2F4V L;  5E7N A;  1AE3 A;  2QEX A;  2NN6 I;  2AMC B;  3ER0 A;  2ZJQ A;  4WJ4 A;  4DUY L;  2HIV A;  2N49 A;  1SFO H;  3CCR A;  4IPG A;  3RR5 A;  1PHJ A;  2OQK A;  2ES2 A;  1J6Q A;  3I4O A;  2B3G A;  4X66 Q;  4OXP A;  4DR5 L;  1IZ6 A;  1K8G A;  2KBN A;  2LXK A;  5GQO A;  1I3Q H;  3GD7 A;  4YHH Q;  4HID A;  2WB1 G;  2JA5 G;  3TS2 A;  4B3S L;  1KC8 C;  3PUZ A;  4A3G H;  1K73 C;  4DR4 Q;  2GVB A;  3H0G G;  1UWV A;  2K52 A;  4LW1 A;  1Q1B A;  4R4O A;  1YJ9 A;  4DV2 L;  3MXN B;  3ERS X;  4JI5 Q;  1HNW Q;  5LMN W;  4A3B G;  4KHZ A;  1CSQ A;  1QUQ B;  2R7Z G;  4JBW A;  3CC2 A;  1VQ9 A;  3ULL A;  4GKK L;  2A19 A;  1L1O B;  2UXD L;  3M3Y H;  1B7Y B;  3HOX H;  4DV3 L;  1G51 A;  1EUJ A;  1W2B A;  1SR3 A;  4POG A;  4AQY L;  1AE2 A;  2NVT H;  3M4Q A;  1R9T H;  3BU2 A;  4DAY B;  2QA4 A;  2JEB I;  2OCE A;  3HFZ B;  4IOA A;  2KEN A;  1V9P A;  1UE7 A;  4R4I A;  2JK8 A;  1S3O A;  2Z6K A;  3EN2 A;  1PH9 A;  5IYD H;  2N78 A;  2Q2I A;  4NB3 A;  3DLL A;  2I5H A;  2VQF Q;  2D0O A;  4B3T Q;  1X65 A;  2CQO A;  4GLA C;  2EXD A;  3TEH B;  1G29 1;  2ZJR A;  4HIO A;  1YNX A;  3RZD H;  3DM3 A;  3M9B A;  3L0O A;  3PUX A;  4APV A;  2VS1 A;  3SGI A;  4QIW E;  3G6E A;  2K5V A;  4DUZ L;  1XMO L;  4IFD G;  4QQB X;  1HNZ L;  3HOU G;  1T9H A;  1YZ6 A;  2RF4 A;  2YYZ A;  2HT1 A;  4JG2 A;  4BA2 I;  3CP0 A;  4A3D H;  1TWF H;  2Q2H A;  5C4X H;  5M5X H;  3PO3 G;  4LFA Q;  3S1Q H;  4OX9 L;  3T1Y Q;  1X6O A;  4R1J A;  4LFA L;  4DR7 L;  4YWK A;  1S72 A;  4LF8 Q;  3PO2 G;  4OO1 I;  1VCI A;  4X62 L;  2JA9 A;  4A3M H;  3M4O H;  3A0J A;  2ALY B;  3HOW G;  4XIG S;  4DR2 Q;  4A3K H;  1VQE A;  2Y0S E;  2L15 A;  4PG3 A;  3D0F A;  2MQH A;  4HJ9 A;  5JJK A;  1X56 A;  1H95 A;  4A3G G;  1RL2 A;  4L5Q A;  3HOU H;  4DV1 L;  3RLN A;  1SLJ A;  1N32 Q;  1V43 A;  2PI2 E;  2R6G A;  1PH8 A;  3OYY A;  4DV7 Q;  3AFP A;  1E1T A;  4GOP B;  1IBL L;  3STB D;  1Y1V H;  2VW9 A;  1I94 L;  1ASZ A;  2E2J H;  3ULP A;  3RN2 A;  5M3F G;  2YV5 A;  1N32 L;  1BVS A;  4KLK A;  3E9I A;  3K81 C;  2VQE L;  2IY5 B;  3NEM A;  4DK6 C;  2Y0S G;  2YTX A;  4DV4 Q;  4K0K Q;  4GN5 A;  1IYJ B;  1VQB A;  1PV4 A;  2JA7 H;  4HJ7 A;  4A3F G;  1EIF A;  3S17 H;  2NZH A;  4DV0 L;  3PGZ A;  2IX1 A;  2PMZ E;  2N8N A;  1VQ7 A;  1N9W A;  4JI8 L;  5GAH C;  3M7N A;  3G4S A;  4C2M H;  4IFD I;  1BKB A;  1PFS A;  3VDY A;  2UUA Q;  4OWT B;  4JI1 Q;  2UUC Q;  1PVO A;  4K0K L;  1K8A C;  4B3S Q;  1EWI A;  3KF6 B;  1YEZ A;  2ATW A;  3U4V A;  2K50 A;  3S2D H;  5IP9 G;  5IYC G;  4GKJ Q;  4A3F H;  4A4I A;  4JI5 L;  3CCU A;  4DV2 Q;  1K0R A;  1VQJ A;  1IBL Q;  2HHH L;  1HZB A;  1WFQ A;  2JJQ A;  3KJO A;  1N36 Q;  4NXM Q;  4NXN L;  3LGJ A;  1A8V A;  4MTN A;  4BBR H;  5LMN Q;  4A3L G;  2BA1 A;  1XNR Q;  3PO2 H;  1C9O A;  1OXV A;  1RIP A;  3J81 j;  2RCN A;  4LF5 Q;  2R7F A;  4LF5 L;  4X64 Q;  4A3D G;  4YCU A;  5C4X G;  1PYB A;  1KRS A;  1VQD A;  1XPU A;  1NMG A;  4IJL A;  2UXB Q;  1C0A A;  4QL5 A;  4PZ7 A;  4C3H H;  2EQS A;  1N36 L;  1K9M C;  1GO3 E;  1C7Y A;  4XTC S;  4JI7 L;  4OON A;  1B8A A;  3HOV H;  4OWX B;  2Q2T A;  3PF4 A;  1VQ6 A;  2I5M X;  3CCL A;  2YTV A;  1B70 B;  1VQM A;  3UDF A;  5BR8 Q;  1Q81 C;  1WYD A;  4LFC L;  4JYA L;  4X64 L;  4LFB L;  4JOI A;  1KAW A;  4GNX C;  1QVG A;  1HZA A;  4LUV A;  1FGU A;  2LSS A;  4JI3 L;  4AYB E;  4JBJ A;  1JJC B;  1Q7Y C;  4A93 G;  5C0X J;  3J80 c;  1JJG A;  4DR6 L;  1QUQ A;  2KHJ A;  4MZ9 A;  5JEA J;  3GTG H;  3UDI A;  3ULJ A;  3A5U A;  4ALP A;  1HH2 P;  4JI6 L;  4IPH A;  1SE8 A;  4QJF A;  3KDF A;  4GLV B;  2R92 G;  3FHW A;  3B6Y A;  1HNZ Q;  1EFW A;  3KF6 A;  4HJ5 A;  2B29 A;  1G6P A;  1Z47 A;  4HIK A;  1Q8K A;  2PQA B;  3J81 c;  2PNH A;  3UDX A;  4IPD A;  2GN5 A;  4JI7 Q;  3BJU A;  4PZ8 A;  3CMA A;  4HJ8 A;  1PYS B;  2H5X A;  1LUZ A;  4R4C A;  4YY3 Q;  4QGU A;  2K14 A;  2JA6 H;  4GOP C;  4P74 A;  5IYB H;  1VQN A;  4IJH A;  2VQE Q;  1MKH A;  4LF9 L;  2CWA A;  4UPA A;  4P73 A;  1VQG A;  1TWG H;  1VQI A;  4R4Q A;  2NN6 G;  3W5O A;  2AWO A;  3BZK A;  1EQQ A;  4GN4 B;  4Y7N H;  3RZO H;  3CPF A;  1XJV A;  5C4J H;  4A3L H;  2ZTD A;  1XPO A;  3CXC A;  1HR0 W;  3PV0 A;  2D62 A;  1I5F A;  2NVY H;  2Z0S A;  3CCM A;  2OTJ A;  2E2H H;  4C3J H;  4DAM A;  4GOP A;  2KCM A;  1OTC A;  2ZJP A;  1N33 L;  4YWL A;  1X9N A;  3T1Y L;  2R7D A;  3HKZ E;  1VQL A;  4DR7 Q;  4IFD J;  5M5W H;  1WI5 A;  1X3F A;  5GAG C;  5IP7 G;  4DV6 L;  1KXL A;  2BH2 A;  4DR2 L;  2HHH Q;  1XMQ Q;  2I5L X;  5FJ8 G;  4KI0 A;  1SRO A;  5JJI A;  3A5Z B;  1JB7 A;  1VQ5 A;  3AYH B;  3PIO A;  3G48 A;  4DV5 L;  4UP8 A;  3K7A H;  1WOC A;  4A3J G;  3NEL A;  3KLW A;  4GS3 A;  3M85 A;  1N34 L;  4GKK Q;  4NPS A;  1NBW A;  1JJ2 A;  1D7Q A;  4X66 L;  1TWA H;  2UXB L;  4LWC A;  3Q8D A;  5IT9 c;  1X3E A;  4GNX A;  5K36 G;  4X65 L;  5FLM H;  4A3I G;  1NY4 A;  1L0W A;  5IP9 H;  4DV4 L;  2I0Q A;  1PH2 A;  4JOI C;  2WFW A;  1CKN B;  1SN8 A;  1JT8 A;  3L7Z C;  4JI4 Q;  3S14 H;  1WCM H;  3S16 H;  1CKN A;  1TWH H;  4WJ3 M;  4JI8 Q;  1TWC H;  2JA6 G;  2JA7 G;  3GTQ H;  1JMC A;  2NVQ H;  1FL0 A;  1E1O A;  2IT1 A;  1N8R C;  4JI6 Q;  5M3M H;  5FLX c;  4KHP Q;  3K8A A;  1MJC A;  4DR1 L;  1NJI C;  4LFB Q;  1HR0 L;  1P16 A;  1L1O A;  2IX0 A;  2YU9 H;  5AJ3 Q;  2VL6 A;  3U4Z A;  3A74 A;  1NMF A;  2C35 B;  1AH9 A;  1K83 H;  3RLO A;  3HKZ G;  4UP7 A;  3F1Z A;  1YIT A;  3PIP A;  3KYH C;  2PI2 A;  1KQS A;  5IYC H;  3L2P A;  4X65 Q;  4KHP L;  4L5S A;  5H1S E;  4LFC Q;  3ICE A;  2JA8 H;  2MFI A;  1S40 A;  4BXX H;  3MEF A;  4BY7 H;  3KFU A;  1XTD A;  3GTJ H;  5DLQ E;  2OWO A;  3GTP H;  4J15 A;  5HY6 A;  2UXC L;  3KOJ A;  3GTL H;  2WAQ E;  4MNO A;  3F8T A;  4LNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...