4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter related protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
2WJIA 4P71A 2KCTA 1NY6A 1UKYA 2ZPTX 5TB5A 2PI2E 3MXNB 1DG1G 2PT7A 2V9PA 3ASYA 3PV0A 1UBGA 2VP4A 4JBKA 4OHWA 1N6KA 2WTUA 1SXJA 4XWKA 1JBKA 4QQBX 2C9OA 2L0XA 4J15A 3OEHD 2EQBA 3AKCA 4ZO4A 821PA 3REGA 2CHVA 2ALYB 1XEWY 2HJGA 3MWJA 2ZE7A 3VNVA 1YQTA 3CIOA 3PO2G 1IL2A 1HTWA 4IDHA 1S40A 4L9SA 5FPTA 4BLRA 2XB2A 2PQAA 4GNXA 3C16C 4F93B 3VA7A 1IHUA 2C78A 4KVAA 5TARA 2MMCA 4DT1A 2YC2C 4PAOA 1KIXA 4LFCQ 1D5CA 4A3LH 3TNFA 2UZ3A 3W8RA 1G5RA 5JSZA 3A74A 3EPJA 1RIFA 3DM9B 4GRAA 4UXHA 2GJSA 2JJQA 4L9WA 4A3KH 1ZW6A 3IDQA 4AG6A 4OI0A 2UZIR 1N34L 2VHCA 3CPJB 3EPKA 1NLFA 2O8EA 1WRBA 4DRZA 4TT3D 3M3YH 3JAMi 1XXHE 1QHSA 3NG1A 3QPUA 1HT1E 2V54A 4TN1A 3WYFA 4LY6A 2JA1A 3STBD 2DFKB 5KNBA 3H4MA 1W0JA 3IHLA 3MWYW 2R6AA 3S1RH 3PEWA 4TTQA 3SN6A 1CIPA 4IDOA 5CITA 1GFIA 2PCFB 2I0QA 4POAA 1DAKA 1JALA 1P9WA 1J90A 1PH8A 1G4AE 1UE5A 4BBRG 4Q9JA 1KO4A 3CQZH 2VEDA 1VDZA 4RG1A 3BZKA 4IOAA 1XEXB 1TQ6A 4PZYA 3BB4A 1G1MA 1P8LA 2JDIA 4EX5A 4ASUD 4LI0A 3K9LA 4BFSA 3H1TA 3DEFA 2ZI9A 3LV8A 4M1KA 1XD8A 1VS0A 2UUCQ 1Z08A 3EC2A 2AFHE 4RD2A 5DHFA 1U8ZA 2J0SA 2KENA 1JR3E 2A6HD 2UXBQ 1GP2A 3KFVA 4QJ5A 3A8TA 4B2PA 3U4QB 3AQ4A 4GL2A 3GQBA 3KB1A 4TZ0A 2KCMA 1KI6A 3T51B 2ZS9A 3BFXA 4OWWB 1R0WA 2ANBA 4K46A 3TMKA 3L8YA 3K0FA 3WNDA 2CK3D 4NYJQ 3LAWA 2B92A 3SJCA 3HOZG 4A92A 1L1OB 4DEXA 1A0IA 2WAXA 3THOA 1HNZL 4PO1A 1M34E 2IXGA 1G4UR 5BQ5A 4A3DG 2ZI7A 2ZRNA 4OHZA 1KD1C 1K9MC 3MWLA 1KO7A 1R7RA 5KSOA 4IXMA 2GVZC 1JI0A 3ZQJA 4US2R 2XX3A 4W5HA 3EARA 1NI3A 5FBRB 2W0SA 3T5GA 4B3XA 4UNRA 1E24A 5DISB 3PO2H 4A36A 4BPBA 2SHKA 4LHWA 1TU4A 5CYOA 1J8MF 4DDTA 3GLFA 3CF0A 4B3CA 3WY9A 5EZ5A 1SULA 2GK7A 2WB1G 2GZAA 2OZEA 3CM0A 1CKMA 1E2ZA 1GKHA 1VECA 2X8AA 2QMHA 1KHIA 3EWSA 1U99A 1CRPA 4ZKDA 4LWZA 1WMSA 5FL3A 3U44A 4AG5A 3HOYH 3KQUA 1COWA 4G7ZC 4Q1BA 1KC8C 2OSBA 4RZ2A 4CW7A 2J1LA 4IFEA 2PMZE 3WRXC 1IN6A 1S2MA 1VQLA 1G8PA 3VR2A 2XOKD 3I3SR 1FR3A 3P4XA 2VY3A 3BS4A 3MMPA 2NZOA 3I72A 1I94L 2IHEA 1N6IA 2WWXA 2ZS7A 3B1XA 3KUCA 1JJCB 3PEVA 4RVCA 2WWIA 3L0PA 3NDBB 3Q7PA 4R4IA 2BBTA 2G88A 1R5BA 2B63H 3KXIA 1C9OA 4RFSB 4B71A 2W58A 3S14H 1L0WA 4L8JA 4BBRH 3AKYA 2WIAA 2IUSA 4EPVA 1JJGA 2RHDA 1ETUA 2CFMA 4TSFA 5ELXA 1OV4A 2W83A 3BFVA 3FFBA 2ORIA 3E1SA 1M7BA 3B2EA 3CB4A 3HOWG 4H9GA 3EA0A 1KO5A 5CK5A 3BFKA 2JLSA 4PMWA 1Z3IX 2VH5R 3OE7A 2QPTA 5EE3A 5C1BA 2IF0A 4LCBA 3KJEA 1G18A 4BBSG 1JPNA 4YY3Q 4A1FA 3TLXA 5C4JH 1PZNA 3B1WA 1LTQA 3AYHB 5HY6A 3A1SA 1R0XA 2ZRJA 3T1OA 4LW1A 3HOZH 5HKKD 2VF8A 1BBWA 2ANCA 2J0UB 3UMFA 1X54A 3CC4A 121PA 4HIDA 2O0JA 1C9KA 4A3DH 2QI9C 4KFUA 4LYHA 4P75A 1XEXA 2YC4C 4ZCIA 5BWMA 4WW0A 1K0RA 3EWAA 4L5SA 3HPRA 3MGCA 1SMXA 4YDHB 3F2BA 3GPLA 3SFVA 3U7HB 1FFHA 2WKRA 3JAMc 4CEHB 3LWUA 4HLUA 3CBQA 3CONA 2IYXA 1YZNA 1Z0JA 2XJ4A 2G9NA 3TVTA 1N2CE 2OO7A 3B7GA 1YRAA 1CJMA 1A6XA 3H2YA 3LXRA 4TVAB 4K81B 4QRHA 3B9PA 3DDCA 4JBJA 1XPRA 5FTJA 3K8YA 4CEIB 3SQWA 3PF5A 1H9MA 1CXZA 2J3EA 1ONBA 4Q1DA 2X1VA 1L1OA 2F55A 3AM1A 3S2HH 1HYQA 1UJ2A 3VQTA 5FPKA 1RRFA 2B29A 3AFPA 5BR8L 1N5KA 2ZI3A 2PBRA 1OIVA 3CRVA 4J0QA 2AKYA 4KFSA 4R2IA 1HA3A 3R9IA 3T35A 4IDPA 1CKNA 4P72A 3UG7A 2RKOA 3QXHA 2V3CC 2FOLA 3OEHA 1AE3A 2HEIA 1KHTA 3LVRE 3FHCB 2WJGA 1UE6A 3S1MH 2KBEA 4C30A 1U5KA 2YWFA 5FTLA 4G5SA 2H17A 3ADKA 2OQ0A 3NDPA 3GTGH 4BXXG 3H3VH 1CKOA 1E2EA 1O87A 4TMXA 1DO2A 1OH8A 1PH7A 4MRPA 4BLTA 2FFQA 1J5EL 5FUYA 5IYCG 2IYVA 1Z0IA 4BA2I 3D31A 2DFNA 1P60A 2F9LA 1AIPA 2O5VA 3IBYA 4V02A 2LXJA 1YR9A 4MUBA 5AJZA 4HB2A 4R1JA 3OAAD 4WIAA 1KO8A 3HOWH 4QJ3A 3F5FA 3BWDD 3CX6A 5J4YA 4A3EH 1OXVA 4RCNA 4KFTA 5FH9A 5K8IA 1IAQA 5CK4A 1C1YA 2YWEA 3QXXA 3PFIA 3SJBA 1DAIA 1XZPA 3B6YA 1HNXQ 3AVPA 3WP0A 5HCNA 2MMGA 4Z8YA 3J7ZC 2FZLA 1VQCA 2JA7H 4GZLA 1VG9B 2NPFA 2AFIE 3DZ8A 3TUIC 4QM7A 1W4BA 2QU8A 3M7NA 2I4IA 4RFSA 2NO0A 5KSZA 2KJQA 1XD2B 1Z8FA 3LW8A 1XTSA 3FFAA 4OONA 4O0AA 3TH5A 1Q44A 5LPNA 5AK0A 2ZJPA 1AJEA 4LF4L 1Y3AA 2IS2A 4TLEA 2WMOB 3TR5A 3NC0C 5L3RA 2E87A 4ILEA 1Q57A 1VQEA 4A2PA 2PJZA 3IEUA 2JJ8A 2PJRA 2LMCB 2J0VA 2Z0SA 3NWJA 5AJWA 2ZAMA 1MRSA 5AR1A 5F9FA 2W2VA 4POFA 4II7A 2CK3A 3SS8A 3GLIE 2Q3FA 1K8OA 3OIYA 2O8CB 2ES2A 2J0UA 4ZCLA 6Q21A 2G77B 1NBWA 1N5LA 3A4LA 3C5HA 4TYNA 3M9BA 2AXNA 1SXJE 1IN4A 2NO7A 2WVJA 3CW2A 2PEYA 3FWYA 5ELOA 4NCKA 4DCNA 3OHMA 2HXYA 4UNNA 2P0EA 1CUKA 1RPZA 4CEHA 4B3DA 3O47A 4IVPA 2BBSA 3GJ0A 3QENA 2A1AA 4B74A 2EJFC 4BXXH 1I3QH 2XTZA 1MO5A 4X65L 5JFGA 1VQ7A 3MAAC 4IOCA 4XOIA 5IYCH 1FTSA 1GITA 4CEIA 1PLJA 3HR7A 1AA9A 3R8FA 3KJOA 3NE5B 1AZSC 2B7CA 3UATA 1RC8A 2IWRA 5BN4A 2R92G 4M53A 4D0GA 3I73A 2RGGA 4PZ7A 1LF0A 4Q1FA 2IT1A 3UK6A 1OFHA 4IDNA 1E99A 5C3EG 1IBKL 3ECCA 3KOJA 1EWRA 2XOKA 4GS3A 3SGIA 3A4MA 1VQ6A 4Y7NH 5GJBA 1NJGA 1YZKA 3F3YA 3RWMB 5SZKB 3R9WA 4IPGA 1Z6XA 2B3GA 2A9KA 1KI2A 3CLVA 1KI8A 4DIEA 4A8JB 1H9JA 4YCWA 4JJZA 4XSGA 2I5LX 221PA 5IP9G 2OV2A 3PG5A 3VR6A 1TUEA 4WXPA 4DUZQ 4JBXA 4B2LA 1OHHD 3TW4A 3L43A 4YMVA 5E7NA 2K7VA 1NKSA 4MRNA 4B34A 1CP2A 1GAJA 3QUSA 5C44G 2JLYA 1A62A 2FEOA 4W5WA 1US8B 3DMNA 4JI0L 1E2HA 1H8HD 3W8NA 4I81A 4B6FA 4NXNL 3TR0A 1U94A 4GOXA 1JAHA 2K14A 1Q46A 2W6ID 5A35A 1FOEB 2JCSA 4GI7A 1TTTA 1UM8A 1AH9A 4YONB 1U0HC 1Z6TA 4PHTA 4R71A 2F52A 1QRAA 3SHWA 1EXMA 5IRCD 1KMHB 1ZRHA 1XWIA 1KSHA 1N6OA 2ZRFA 4KSCA 2A3RA 4RD6A 1P9RA 1XTRA 5FI0B 4FCTA 2H16A 1QUQA 3R7WB 3EXAA 1BYIA 1I4LD 1XD2A 3HYRA 2UUBL 2H8KA 4GLVB 1YBYA 1G3MA 2OEPA 3ZIAD 4AIIA 4XWOA 3BDOA 3Q85A 4X8OA 5HGQA 5CDFA 5J4HA 5JRJA 5KU1A 1O7LA 3PJRA 1TWGH 1G5PA 2OILA 4EPWA 4ITRC 2GN5A 3GLFE 5LMUQ 3HOVH 1DBSA 1ZINA 2C03A 4LPKA 1KK1A 3RRNA 2BEJA 5HPYB 4PZZA 5JEDA 4OJQA 2BE5D 2WSSD 3PCRB 1ZJ6A 5K36G 4C2TA 4C7OB 3AUYA 4DXAA 5EQTA 2PLRA 4XJXA 3EPHA 2ZROA 3GJ3A 1MKHA 1SKQA 1N6RA 2O8CA 1E1QD 4HB3A 2R92H 1IBLQ 4A2WA 3CRQA 4EUNA 3KJIA 5FJ8G 5C3EH 4QC2A 2LSSA 1A82A 1X65A 3KXKA 4PG3A 3GMTA 3SBEA 4GNXC 1NN3A 1MOZA 3AVWA 4NP6A 1R8SA 3BORA 4GZYC 5DYGA 1BVSA 1K8GA 4R7ZA 1PLLA 4ZI3A 5EAYA 1H8ED 4Y0VA 1EIFA 4EFLA 3K7UC 3U3OA 2PI2A 1K5DA 4GKKL 5GADC 1E2LA 4ACAA 5C44H 621PA 2Q3MA 2D0OA 1PLKA 3NEYA 5EE1A 3J80i 3VKGA 3OAAA 1EX6A 1W48A 2R6DA 2ZJZA 2VHTA 4DV7L 4M0LA 2ZRAA 3FHOA 2OM2A 2ZR0A 1XU4A 3EA5A 2G0TA 4BLPA 1K8MA 1H9KA 1P3JA 2ZYTX 3IIKA 4HIKA 2D7CA 5H68A 4AK9A 2GTPA 3IRBA 4JI5L 2QA5A 4LJ9A 4UJ5A 4DLYA 1QZHA 5GVSA 4BGDA 1QVAA 4HDQB 3E70C 5D3QA 1R6BX 4A8JA 2C77A 2HCJB 1HZBA 4AKIA 4M1YA 3OEED 3RRMA 4KITB 1N0UA 4F7WA 4A0HA 4GLAC 1D8TA 4P4TA 2P5TB 1W4AA 4OWXB 3K0CC 5G3ZA 4B75A 1CR4A 1JPJA 1US8A 2A2ZA 3BB1A 3PUZA 1Q12A 1YIJA 1HH4A 2HCBA 5KUTA 4DT1B 1ZP6A 4Q9IA 4BFYA 4H0LC 2K50A 5GAGC 3IIJA 3CR8A 2OE2A 2R6FA 2R8RA 4F92B 1KMHA 3HKSA 3U58A 1M8PA 4DWJA 3OIUA 2CXXA 3R7WA 2JAQA 3TSWA 2NZHA 1YZQA 3MRSA 5FJ8H 1FGUA 4LUVA 1OIXA 1XMVA 1FJGL 2WWFA 3C4JA 4LC0A 2WOJA 4PR0A 3LBIA 5E3HA 3ND8A 1JR3A 5EP2A 4JLOA 1Q7YC 1W36B 1VPLA 2H18A 1FMLA 1Q3HA 1R5NA 1LACA 1T3HA 3ZZUA 4OXPA 4HJ9A 4K0KL 4PAQA 5B30A 2Q3HA 2DPXA 3DKPA 4TLCA 2B21A 4DK1A 4TTRA 1F2TB 1XBTA 1VCNA 1G64A 1FPMA 1ZU4A 1FW6A 2CMKA 4IFDH 4C7OA 1AKYA 1G19A 3K9GA 3ONWA 2OAQ1 1M7HA 3VU9B 2EFEB 3CCSA 1SFOH 3KLRA 1DELA 3NXSA 1XD9A 2IYZA 2OG2A 4PHFA 4A9AA 4C0SA 4EPXA 1HH2P 1ZYUA 1AM4D 1JE5A 2EIFA 1VQPA 1IM2A 2AD5A 1IY0A 5LB2A 3RDPA 1G17A 1T0HB 1KK2A 1AS3A 4DV5Q 1S3OA 2FPMA 3I4MG 4DV0L 3AKDA 4DV4L 4QHSA 4AWXA 1EYGA 2VUMG 3KZ1E 4JC0A 1Z63A 1AE2A 2IYYA 4JI7L 2JLXA 3MEFA 4LBWA 1G291 1IXRA 1U9IA 1E32A 3K1JA 3CCVA 2RGBA 1G21E 2AD1A 2ZU6A 3GJ4A 2FX3A 3WHKA 5LD2B 1MJCA 2MO1A 4DDWA 1YZTA 4C2UA 1VCOA 1CLUA 3JVUA 4C3IH 3KKQA 4GOJA 1II9A 1PHJA 1J7KA 1PJRA 4GP7A 3SJAA 1JJ7A 1H8HA 1OSNA 1PH3A 2WOOA 2QPAA 2FSHA 2W6IA 2R7ZG 1TWCH 3I8XA 4TMWA 3LD9A 1KY3A 2KB0A 4JLPA 1HR0W 4P31A 4ESHA 1UKZA 2R65A 2Z5FA 5KOYA 4JVLA 3FHTA 3LVQE 3TZUA 4QFMA 1XJCA 3CD6A 1G20E 5IE8A 2J7PD 4ZV4A 4RKFA 4X64Q 2FPKA 4YWMA 4TQ9A 2BV3A 3IO3A 4HLUC 4TTPA 4JSYA 2IS6A 1G7SA 5KTYA 1DPFA 3BB3A 4JLDA 3QPWA 3ZIAA 4N0EA 1QVFA 5M5XH 1EFTA 1II8B 1SN8A 3OW7A 1RRGA 2Z0MA 3DVLA 2JK8A 2GCNA 5FBQB 1UWVA 1A4RA 4LYFA 3A1VA 3TUZC 3F8TA 3FMCA 4LF8Q 1YZUA 1KMQA 2G1KA 5E4FA 3TQFA 5P21A 2AKWB 4B3SQ 1JB7A 3W1BA 4AQYL 4OX9L 5DI9A 1YI2A 1L1OC 2WSSA 4A93G 3BERA 2UU9Q 4U00A 4DHEA 2W2XA 3SI7A 3OIWA 2D62A 4JL8A 5HZKA 3L2PA 2Z83A 1E1QA 3GLHB 3LRPA 4LK1C 3PITA 2ZJ8A 4KMUC 1HJPA 2ZRLA 4DR7Q 3IIMA 1WYDA 2OTLA 4L8GA 2GVAA 2AXPA 4JLKA 1E22A 3ND9A 4RD0A 3HPQA 3TUJC 3CMAA 1T4GA 4IJMA 1HR0Q 4OI1A 4JZKA 3ETLA 3I4MH 2VTKA 2ZSEA 4A0GA 4KODA 5EJEA 5HZHA 1EWQA 3W90A 1GDDA 2VUMH 1QG2A 3UMSA 2IWHA 3P32A 5JSZB 2QQ0A 1FYCA 2RHSB 1E2FA 3I5XA 3VNUA 1VQ9A 1CTQA 5L3SB 3QIAA 2PZEA 1F2TA 2WMNB 3ZQ6A 3CF6R 3TIFA 1H8EA 1S9HA 5FL7D 4D81A 5AJ3L 2A5JA 2HUPA 3QOFA 4HIOA 4LV5B 3VHXA 2DY1A 1EX7A 5LMNL 3FE2A 3UDFA 1GUOA 4XVUA 1WI5A 1RYFA 2D06A 3STBC 4LJYA 4LYAA 4GDFA 1HQYE 5CIQA 2ID0A 2QA4A 1L2FA 3W5OA 2CEAA 1RZ3A 3V9PA 4PSKA 1TKWB 3GJXC 4BUJA 2R7ZH 3U50C 1MR3F 4DUGD 2VHQA 3EPLA 2AUJD 1DAFA 1BBUA 1UPTA 1NF3A 1N25A 4B43A 4BFWA 3EIQA 3GTQH 1ZM2A 4A3CG 3CNOA 3OEEA 2HF8A 2FSFA 5FLXc 4U7DA 1FTNA 4PZLA 2D0PA 1OXUA 5CDFE 3IFTA 2NG1A 2CHGA 2A6HC 2KI5A 1N36Q 3I5YA 4IJHA 3BD9A 1XCGB 4JMPA 2MSCB 3PIPA 4MKFA 4PC2A 3T15A 4V03A 1GOTA 1CR0A 4Q48A 1B7YB 4DR4L 4YMWA 2F4VL 4BEJA 2UXCQ 2W2TA 2K75A 2E1RA 1E2IA 5TVKA 4US1R 4LBZA 1IN7A 2K52A 4A3MH 1G5TA 2GJ8A 3G5UA 4JBMA 3P4YA 1SLJA 1DGSA 3LX8A 1BMFD 4YDSA 1II0A 3WMFA 4TL8A 4C0QC 5JWRA 3CW2C 3P20A 2YVUA 2HHHQ 4KO8A 1AKEA 4M2LA 4RKEA 1Z28A 5FTKA 3T1QA 4YCUA 2JATA 1RFLA 4DSUA 2P6UA 2ODWA 4P32A 2E2IH 2FG5A 1HQMC 1DAMA 2RGCA 4Q1CA 1JAIA 1YRBA 2IC5A 2GBLA 2VQFQ 3K0EA 3RRZA 1II8A 2OBMA 2OCEA 4IFDJ 3LA6A 4TYQA 4JI0Q 1H95A 1YR6A 4EJSB 3K80C 3BK7A 4MUAA 3VX3A 2VRWA 1IY1A 2CCKA 3NHAA 2JEAI 3SNHA 3GLIA 2IS1A 3E9HA 1IYJB 2X2EA 1ESMA 4M1WA 1FMJA 1NBMD 4G01B 1B8AA 1I2DA 1YR7A 1KI3A 4IHQA 3CAMA 1XNQL 4C4PA 4O2DA 4Q7LA 4TL9A 5JBQA 2XEXA 2RGDA 4PSAA 4E5UA 4Z1MD 3GLHA 3H3VI 2PZFA 3LLUA 2B8TA 5C2JB 1T8UA 4LF7Q 2IX1A 1FL0A 3A5UA 4MH0R 1GG2A 3DLLA 4LUZA 2H57A 2ZRHA 4FXPA 1E2GA 1GHKA 3TAHA 2BMEA 3GTKH 2IUTA 4NYMQ 4YXWA 4DV1L 1KIMA 1W1WA 2E9SA 3IHWA 3H86A 4LJZC 2RHMA 1D9ZA 4A3CH 4MKIA 3B1ZA 3HOYG 1P61B 1BS1A 1X6VA 4M9XA 5L3SA 4O3MA 4H1VA 1X55A 8OHMA 3LY5A 3RS0A 4OK5A 4WJ3M 1VQFA 2OXCA 4DK3C 4TLDA 2Q9AA 4D82A 4DLTA 4AY2A 1GM5A 1YHNA 3AH8A 3GP8A 2WM9B 3PSIA 4KI0A 1IBRA 4KYUA 5FOXA 1NVVQ 2EFCB 4B76A 4QY7A 2ZT9C 2XSZD 2B63G 2OBLA 3EZFA 4HDOB 1Q81C 1IONA 1E2PA 1N6LA 4JL6A 3OESA 1J6QA 3I32A 1VKJA 1LFDB 5HTKA 1XFAA 1AGPA 4P74A 3J81j 5IT5A 1QHIA 4DR2Q 2J7PA 1FP7A 5HE9A 1JR6A 4AI6A 4LFBQ 2OHFA 2YINC 3WNBA 3S16H 4JV5Q 1KJYA 3TJZA 1YR8A 4H44C 5L8VA 1WBBA 3CCQA 4RD3A 1SVMA 4HJ8A 3M4QA 3HP1A 4FMDF 4GFDA 2IHYA 3S2DH 2XZLA 3U7EB 4GKKQ 3UG6A 4HJ7A 3VTKA 2C5LA 1AZTA 1IXSB 4S2EA 2O8FB 3X1XA 1L7VC 2WPDA 1VF5C 5EXSA 3U7GA 4EDHA 5JRZA 4P0TA 3CNLA 2ZI5A 1P2TA 1OXTA 1TU3A 2DFTA 5KYKA 4DC9A 4JK1C 1CKEA 5FOWA 5LB4A 3FYHA 3W6NA 3M1IA 1P2SA 5DSZA 3U2QA 4HIMA 3DL0A 2GZHA 3AF0A 1E0KA 4LPSA 1CKNB 3B5JA 4IVQA 3CCRA 2WIBA 4NCJA 4DR6L 3F0TA 4QKQA 2VPPA 2VIIA 3NC1C 1YVDA 2CNWA 5IP7H 1LS1A 2L5TA 3GO5A 1NVXQ 4DR3L 1G3UA 2QTVB 2QSYA 3W3ZB 4A3JG 2CBZA 2IW3A 1K5GA 1N32L 3CF2A 5J4KA 3UWKA 2CLCX 3IPXA 3FOZA 1JEDA 3KX2A 4EJSA 1X3GA 5IWAL 2FF7A 2VSXA 2ZJYA 4JKIA 3TVDA 1GKIA 1EFRA 4B3TQ 4ON9A 4JI3L 2ASBA 1DEKA 1AQUA 1Z7TA 3K0XA 4PFSA 5EP4A 1CJTC 1HE8B 1VHLA 2QE7D 3B8HA 4TLAA 3H15A 5FL7A 1VYVA 4WOPA 2R62A 2IEZA 3Q8XB 2D2EA 4AYBE 1C4OA 4MA4A 4A0FA 2A68D 5K8LA 4YLGA 4HLQB 4EPYA 3CX8A 2NO6A 3QXJA 3NBXX 1XNRL 3NEJA 4LUCA 4A8JC 2PMKA 3B78A 3I61A 5EP1A 1F60A 5JLJA 2ATVA 4Q4AB 4DV6Q 4LHVA 4PANA 2G6BA 2ZU0C 1XMQL 1E9SA 1E2WA 1E2KA 4R4TA 1G8GA 2DCUA 2ZJOA 5GADl 1M1KC 1D7QA 2B8FA 1YVCA 2RH5A 4K0KQ 4E03A 1ZU5A 3PR1A 4UKDA 5FOUA 2WJHA 3SEAA 2BJVA 2J87A 4OHXA 3WDNA 4KHPL 4DLSA 4JT2A 4A3EG 4OI2A 4NXML 2YTYA 1ASYA 2R6GA 4DNRB 2YZ2A 3I1FA 1X9NA 1Q20A 3P27A 2LXKA 3RAPR 4KHZA 3JZMA 5EZ6B 5C0XJ 3RZOH 2P67A 2D2FA 3DHWC 3L7ZC 2FWRA 3DOFA 3MUFA 4JI8Q 4QBHA 2JA7G 1QVCA 2I1QA 1WQ1R 1DAGA 1VIYA 3GFTA 2ZJAA 1GJXA 2PNRC 5KNCA 1QZGA 1AN0A 2BH2A 1FUKA 2ZRDA 3CZPA 2P6NA 1JJVA 4MYCA 1U8AA 2CE7A 4I1VA 5CJ2A 2WJJA 4UQOA 3GTOH 3W6OA 3BZCA 5JHGB 3ULLA 4ARZB 2ZUCA 1JXMA 2FN4A 2GEDA 2GILA 2ZIAA 3H0KA 5EXTA 5JS7A 1UE7A 2K5NA 1E2DA 1HT2E 4WBSA 4KSBA 4BEBA 4NMMA 2X2FA 4DKXA 4D25A 3N6RA 1DG3A 3D6TB 3QQ5A 4A3JH 4X66L 4IVRA 1N33L 2O8FA 3N5CA 5TXGA 2AHOB 1VQGA 1VQKA 5J3BA 3DM5A 2WJVA 3CNNA 1I6VC 1M6NA 1Z29A 5CLLA 3NH9A 4TL7A 1U0JA 4PSVA 4MNOA 2PL3A 4TYPA 2A69D 2P6RA 1RRCA 1OKKD 2ZVPX 5L3VA 4OO1G 1UEBA 1C7YA 1QHNA 1TXYA 5ANRB 1VQMA 1H9SB 4Z1MA 3D7MA 5JMTA 4QGGA 3Q8DA 1X8KA 1UKEA 3QKTA 3K70D 3F2CA 1VCIA 3OYYA 1RW4A 3AVQA 1OFUX 2ZREA 1XCMA 1KRSA 4QL5A 4WJ4A 3CC7A 1XZQA 2C99A 2FE4A 2C9CA 1YEZA 3LH5A 3PUWA 1WCMH 2A8VA 1SHZA 4URZR 2E74C 5B2ZA 3SC3A 4Z51A 1KDTA 1IXRC 1P2UA 1U9IC 3O8RA 2WAQG 2A6ED 3BC1A 1NIJA 4QBIA 2AK2A 3NENA 3GFPA 1D2EA 1G8YA 4GT1A 1T0JB 5BN5A 2DHRA 3Q7QA 2O8DB 1LTLA 1GL7A 2W6JD 1W5TA 1EWIA 3TREA 1DO0A 4B3RQ 2ZE5A 1NJFA 1S72A 1SQ5A 2ERYA 4LJ5A 4BLSA 5M04A 5M5WH 1SVKA 1TMKA 3L0OA 4JS0A 3CPWA 2N42A 4TT3A 4FWIB 4IKEA 2B6HA 2ZM6L 1ELOA 3QEOA 1L4YA 1WE2A 4PQRA 1E79D 5SZIA 2XGTA 1K3RA 1W49A 4P3YA 1XF9A 3BBPA 4UPAA 1OXSC 1NN5A 3FMIA 3LNNA 2D74A 5FTNA 4BFUA 5L3QB 2Q2TA 2QORA 4LF9L 1QUQB 5IDVA 3KJGA 3X1DA 2OCAA 1NN1A 2W0MA 2YU9H 4Q4AA 5TY0A 4D4JA 3SU8A 3QKUA 2ZITA 2GXSA 2CW0C 4FI3C 4C0AC 3MWKA 1E3MA 4ASUA 4JI2Q 3JZAA 4JYAQ 2QEXA 4JI4Q 1S3GA 5E7MA 4XSHA 4R4QA 3ERSX 5GROA 3C5CA 3R9XA 1E69A 2REXB 4L5QA 1HNWQ 4LJ8A 4MZ9A 1FZQA 4N3NA 1Q90A 3GJ6A 2UXDL 4QGUA 1RVDA 1OB2A 3HKZE 1NMXA 4JI6Q 2IYQA 2BE5C 2WKPA 1XJVA 2ZANA 1XJ0A 1Z0KA 1MIUA 3MFYA 2QGQA 2WZQA 4M1TA 4NZYA 4YMTA 3GD7A 2O5IC 1A1VA 3TSZA 1KSFX 1TADA 2G83A 3KKMA 1JNYA 2N1BA 2HIVA 4APVA 2CL6X 5G41A 4BECA 3UDXA 4HR7B 4EPRA 4XTCS 1G8FA 4GP6A 2NO1A 4DVGA 4UNQA 1X6OA 2ZSDA 4HJ5A 3GEIA 1GD7A 3BJUA 3CP0A 2FFHA 4OO1H 2QAGB 3AEZA 3CWQA 1T3SA 4OQMA 2CHQA 3CPHA 4TMVA 4BFVA 4DR5L 3GLHE 1NKTA 4TQAA 1PV4A 2E5LL 1D2NA 4O0MA 5AWFC 4ARZA 1W36C 3K70B 4DV2L 3Q3JB 5FI1B 2IYTA 2VQEQ 3T1VA 3HOVG 3L82B 1GILA 4IFDI 1XEWX 2V55B 1HUQA 4UNSA 3AVUA 4WZBE 1P16A 3SJZA 5B57C 1KGDA 2WP8J 2XB4A 2KSQA 5H8WA 3FKQA 5AUQA 4A3FG 3G48A 5LDDC 2X77A 1GRRA 4L15A 5FPHA 2AHOA 2DB3A 3THXB 2ZSAA 4KN4C 2IYUA 4GKJQ 1DD2A 4GOPB 1VQOA 4LC1A 4G0NA 5AUOB 2IK8A 4G7HC 4DUYQ 4LHYA 4PHGA 2QE7A 4GPTA 4LX0A 3GEEA 3SYKA 1YJ5A 4YMUA 1H9SA 1ZYRC 1DADA 2K5VA 5JI2E 2OFOA 3QSYA 2YKGA 3CCEA 2VP2A 1PUIA 2FH5B 2WHXA 5B64A 1HZCA 2OWOA 4I7ZC 1KI1A 5FOVA 1E2JA 2BJWA 3OF5A 1B23P 3KKOA 1E2NA 1UBEA 1S0UA 4Q4JB 2WKQA 4YWKA 1X3FA 2GRJA 3TRFA 2BCGY 4EFMA 4JVMA 2RF4A 4PO8A 4EFNA 5LD2C 2RGAA 2BEKA 2QN6A 1AS0A 1CSQA 2BDOA 4DB4A 4PPGA 5D3MB 4DSNA 4OHYA 2O8DA 1I6HH 3L0IB 1ZD8A 1XEFA 4KBGA 2XTIA 2HLDD 4HZUB 4BFXA 3ZVMA 2NN6I 2FU5C 2QM8A 1IW7C 5AUPB 3PUYA 1GUGA 1FX0B 2ONJA 4LDJA 4M9SA 4DEYA 3U6BA 1NNEA 3AVYA 3ZVNA 4AIMA 3L0SA 5FFMA 3THYB 2DFLA 2QBYB 1QZXA 4KFRA 3CMEA 1YE8A 3ULPA 3MJHA 3X1YA 5L3QA 4CDGA 4IJLA 3ER0A 5HKKA 2NQ2C 1GL6A 1IXZA 1TNDA 3EG5A 4QG7A 2ZETA 1E2MA 1HURA 3QF7A 1Y1VG 4W7SA 3AF1A 4DV1Q 3AV0B 4QHTA 1CSPA 5FBVB 4F91B 1KZGB 3TAUA 2YOGA 3AF4A 2GBLC 3RANA 4QGHA 4A2QA 1V43A 4L5BA 5DI3B 1N34Q 3QKRB 4DDVA 3TS2A 4QBFA 5A4JA 2HIXA 1M7GA 2PCJA 4GN4B 4R98A 2BOVA 1MJEA 2GVDC 4HI0E 3GLGE 2BBWA 4M21A 4PC6A 4A3FH 1KK0A 3QG1A 3WNCA 1I50H 3GEHA 4PPNA 2Z6KA 1OB5A 1LABA 3S17H 1SXJC 1E2QA 3ADDA 2C98A 2WWHA 2BC9A 1G9XA 1UFQA 5G3YA 5JZVA 2YJTD 2JA9A 4KAXA 1G3IA 1OKKA 2XZOA 1RL2A 3B82A 2QAGA 2UUAL 1TEXA 1IYUA 3PGZA 3MJRA 4I1SA 1N8RC 1AQYA 1KKMA 1HZAA 5M3MG 3T53B 1DAEA 1MV5A 1ZM4A 4IFBA 2ZM5A 3OW2A 1ESNA 1G6OA 1W47A 1FNNA 2R9VA 2KBNA 3AF3A 4D0NA 1ASZA 3AVTA 1KJZA 2QNRA 2VHUA 3HU1A 1NVVR 1Y14B 2Q2UA 2HQLA 1KO1A 1X1RA 2ZRCA 4MTNA 2ZSBA 2NVYH 4IFDG 1AGRA 4ABYA 3BAFA 2A19A 3OTOL 3THXA 3Q5DA 5AJVB 3KLWA 2JEBI 4G5QA 3RLFA 2V1CC 2IYLD 1K8RA 2W6JA 3J81i 4GOPA 2EFHB 4LOAA 5IF9A 3I7FA 1QHXA 1HNZQ 3EQLC 1XTIA 3EW9A 3LO5A 4LRWA 1XPUA 3QY0A 4JIMA 2JLZA 3PCOB 3C15C 3ZVRA 1E79A 4KYIB 2BDTA 3A36A 3CX7A 1W44A 3RLOA 1VYTA 2QENA 4OK6A 4US0R 3RC3A 2D2CC 3A8IE 5IYDH 3U4QA 3G0HA 2ZSFA 4TMKA 5TDHA 1LB1B 4F38A 2G0NA 4DLZA 1R0YA 2BBOA 4LJ4A 2Y0SE 4C2MH 2UXBL 2QT0A 4Q4JA 1Y1VH 1GSIA 4B3BA 3A1WA 5GQOA 4NYJR 1OXXK 4X8MA 3RS2A 5JJIA 1F3OA 1G8HA 2C04A 4OK3A 4DV3L 5DYIA 2JLQA 5FOSA 1KY2A 1IY2A 1ZVQA 3RRYA 4IXNA 1EG7A 2G3YA 5D3MA 5SZHB 1X8JA 2FV8A 2PCLA 2A30A 4HZUA 1Z6HA 3DXJC 4DSTA 2JA8G 2Z4SA 1BYUA 3AGPA 4FMDB 4KXFB 5F9HA 1FX0A 4K8OA 3C41J 3L2OB 1MABB 3ZS8A 2QF7A 1SROA 4DR1L 2NN6G 3DPUA 5IY0A 4DLUA 2DWPA 3RS7A 4GZMA 1DCZA 3THYA 2QBYA 4HJAA 4LJ6A 1I94Q 1W4CA 1KNXA 1B9NA 1RIPA 2NZJA 2GJ9A 3KFXA 4CIDA 4UXIA 1MKYA 1XNRQ 1HY3A 1ZD9A 5C4XG 1EK0A 1HTPA 1NBME 4U5XA 2CKZB 3HGBA 3KB2A 2PPBC 3K09A 1XMQQ 1KQSA 3T5DA 4HLDA 1EQRA 5M3MH 4LZZA 3KQNA 2XTNA 4X62L 5M3FG 4PZ8A 2YNMA 3G4SA 1L8QA 4MRSA 2KE5A 4WZAE 4MDEA 2PMDA 2QTHA 3WYAA 3WP1B 1SGWA 3T56B 3QKRA 5DI3A 4NCNA 3GTJH 4EJSC 2XGJA 1BH2A 4D4MA 2ONKA 4UXJA 2N46A 2Q21A 1KNQA 5DO9A 2PNHA 1EQQA 4RSGA 1YITA 1OLOA 1MRNA 1ZUIA 2D3WA 4MQBA 1Q1QA 2D4HA 1QG4A 4RCYA 4KV9A 4A3IH 3RSLA 2JJ2D 2OLJA 4P4SB 1XX6A 5KSPA 1A8VA 1P75A 3B13B 3MLEA 2JA5H 3GJ5A 3X1ZA 2BM0A 3LBHA 2GCOB 1BKBA 1VQDA 3IQXA 4A3GH 2Y8EA 2ZRMA 2BVNA 1Z6GA 1TU2B 3FPAA 1XPOA 5J4LA 3KDFB 1J99A 2NZ8A 4XH9B 4AYBG 4YXWD 3FKSD 3GDEA 3A58B 4LFAL 4EQ6A 2CVFA 3WBKA 2GKSA 3X2SA 1N6PA 2YYZA 1OT3A 3IQWA 5EE9A 5IYBG 3UDGA 1HEIA 2VQSA 4PZ6A 1N5JA 4YY3L 1EWHA 1OHHA 1Q22A 1P72A 2BKEA 2J41A 5HCIA 3SDZA 1OF1A 4CRWB 3OZXA 1VQBA 4GMDA 1OYYA 3BGWA 4UNPA 3RNUA 1T3LA 1TWFH 5EXXA 3AB9A 5BR8Q 2JA8H 3AEVA 1NP6A 2BM1A 2V8OA 4N1AA 2H7VA 421PA 4AKGA 4H1UA 2ATXA 1XTDA 2P2LA 1U2RA 2NN6H 1DXMA 1F6BA 3JVVA 1W46A 5AJXA 4Y0AA 2F1IA 2ZTCA 1PH2A 2JA6H 4G5GA 2FFAA 2JLRA 3QBVA 2BKUA 5FPYA 4KLKA 2ODBA 3W1GA 5KDOA 4E09A 4AYTA 5J47A 5DH9A 4ACBA 4ZIRB 5C4XH 2N8NA 4ZPXA 2BIFA 5EUMA 3S1AB 2VP9A 3T1YL 1XB2A 3VHLB 5KDDA 3VKWA 1J5EQ 2N49A 5H1SE 4NPSA 3J81c 1Y8NB 3VR3A 4LBVA 1G3RA 2GESA 3PUXA 5M3FH 2ORVA 3KQHA 3F1ZA 1UBCA 1FP6A 4D2IA 3IPYA 4DBLC 3C14C 4HAUA 4OWTB 4NH0A 2V4DA 4Q00A 2NVQH 5E7JA 5DIFA 5KHOC 5DN6D 1BIFA 5EP3A 2ZJ2A 2R44A 4MGZR 4A3MG 1MABA 1VMAA 3QG5A 3QXSA 2PX0A 4JBYA 3EX7C 2VBCA 5C0XG 3CUEF 4RZXA 4B44A 1E9FA 3A37A 5DNYB 1PH9A 1P9NA 2FDCA 4MYHA 1XMOL 1ZNYA 1S8FA 1XDBA 1JECA 1W0KD 3F2DA 2NIPA 4FD2A 3SE0A 1KAWA 2VL6A 3T61A 4RZ3A 3OPOA 3RN2A 1GRQA 2A5YB 2O5JC 1VQIA 3A0JA 2QM7A 3MCAA 3U6KA 4LF4Q 1UAAA 2J9RA 3K7AH 1Z22A 1I2MA 4TKOB 2RCNA 4P73A 2A7QA 2YWGA 4HAYA 3K9NA 1Q1BA 4TWZA 2RHQB 4C3HH 3LW7A 1F2UB 4A3BG 4Q7MB 1KSGA 2RGNA 3R20A 4Q4LA 1T8TA 1GKUB 3TRZA 1ZM7A 4BWYA 5IYBH 1ZMXA 2PLFA 3BJIC 3GJ7A 2F9MA 3UPUA 2IXFA 1HNXL 1E6CA 2QY9A 1SE8A 4LGMA 3PUVA 4LF5L 5G53C 4BFTA 1KOFA 3RS3A 2OCBA 4P4SA 4OBEA 4BZQA 5JJKA 4DPGA 1WP9A 4IDQA 5J4VA 3T1HL 2H5EA 4AD8A 1E98A 2GCOA 3FMFA 1K6MA 1XCPA 5BYJA 3UXMA 2JLUA 4YHHL 1R9TH 1D9XA 3U61B 3AP3A 1V1QA 4HAWA 4DIDA 3KDFA 3B85A 3NKVA 2HF9A 2ZAOA 1GNRA 3KUDA 2ZE8A 2OUKA 4P4UA 1P5ZB 3S1NH 4I1UA 3I4NG 4JSTA 4X65Q 3U60B 4YWLA 1UADA 4JLNA 2HYIC 1W2GA 1WCV1 1GHJA 2FJUA 3RSOA 1YNNC 3D0FA 4LYJA 2YOHA 1IBKQ 3CZQA 1QDEA 2YWHA 3K0AB 2J0QA 1IBML 1JMCA 2E2JH 2EFDB 3HKZG 3Q5EA 1JJ2A 1CR1A 2ZE6A 3I55A 5C0XH 3K0SA 3WYGA 3A4NA 4FMCF 2AWOA 4C9BA 3CCJA 1Z07A 1SVLA 2DN8A 4ZIRA 4TYYA 1PYBA 1K73C 3CCLA 2GDJA 4QNMA 4JBWA 3FB4A 1IN8A 3S1AA 4BLOA 1N3BA 1Z2CA 2CCZA 1E4VA 1TX4B 1LW7A 1Z06A 3E9IA 3U4VA 1GWNA 2IL1A 3VKHA 2OFWA 3B6EA 3PIRA 4LK2A 5AUNB 3RC8A 3I2ZA 4PAMA 4XD7D 3A7AB 4LUOA 1NVWQ 1TL7C 2C8VA 2ZRBA 3GLGB 1RE0A 3FMPB 2AN9A 1KI4A 4NXNQ 2KBFA 4NDZA 5LBIA 3BU2A 3CRKC 4A3BH 3VDYA 3CO5A 3RWOA 1KAOA 2H1LA 1GNQA 3U3JA 3VFDA 1J8YF 1LNZA 5BW8A 2F1HA 1DVRA 3W3AA 2EYQA 2KCCA 2JJ1D 2ZRKA 3U3RA 3VR5A 1Z83A 4L5TA 2Q0HA 1NN0A 4I4LA 3ZYCA 4Q19A 1VIAA 2NOAA 1CS4C 2JJ2A 1GL9B 2FZ4A 1X8LA 1E96A 1HQCA 4MRRA 5IP7G 1JXOA 4BE7B 4NYIQ 1KDPA 4KLNA 4B47A 1S1CA 4M8NE 4DUZL 2UUBQ 4IPCA 5EUQB 3GTMH 3U3KA 5ELNA 1ZNWA 1KTVA 2V1UA 1I4DD 3ZVLA 1HPCA 1M90C 1W2BA 2VF7A 4KCGA 1B0UA 2Q6TA 3MG9A 4O25A 1LS6A 3KL4A 5JS8A 1Y8PB 2DWQA 3FKSA 2EJGC 4MDFA 3I62A 4MKHA 1NTGA 1RYHA 1X56A 2K32A 2ZRGA 2OLKA 2Q2IA 1F2UA 4OQLA 4A76A 3MXUA 2A5FA 2EVWX 3I4NH 2Q8IB 4LJ7A 1VQ8A 4XTRA 1E9AA 5GAEC 3WRYC 3QEJA 4BQSA 1QHYA 2JASA 2NO9A 1G51A 2R6CA 2ZTEA 2YHSA 2JE6I 4POGA 1X3SA 2QZ4A 4DCUA 4Z54A 2QP4A 2GVBA 3DO6A 2YTVA 3NBZC 1QHHA 4Q4HB 2NPIA 1E4YA 2XITA 1LF5A 2NTYC 3ZD7A 3H94A 1S9DA 1ZIOA 3MD0A 5FLMH 2UUAQ 1BKDR 2K4KA 2J5XA 4C3JH 2Q9BA 2IX3A 3GTLH 1JT8A 4ESVA 4HATA 4Y52H 1S3SA 2AMCB 2YV5A 1UEIA 5BN3A 1EUJA 3KXLA 1O78A 5CIWA 5HE8A 5LMUL 1CBUA 1O7IA 4S35A 4NBSA 3QBTA 4RZUA 4H02A 4AKEA 2MQHA 4WXRA 3PVSA 2IUUA 1B70B 4NHOA 4WA7A 1Y69U 2O0HA 4UP8A 1E7ZA 5BXQC 1VTKA 3EZ7A 4PPQA 5FUWA 3OTOQ 2C9YA 4ZCMA 4JG2A 1MO4A 1YJWA 2BHRA 1IBLL 5GVRA 3E0EA 2V1XA 4OO1I 3LQRA 2Z6KC 4DV7Q 1IN5A 1E0JA 4FCVA 5DN6A 2GXQA 2ZYVX 1D6JA 4HLCA 1EIYB 4R4CA 4M1OA 3K0AA 3ICQB 1XTJA 5DLQE 1Z2AA 2A69C 5FR1A 2V6IA 4JI5Q 2QAGC 2EQSA 3BOSA 3CKLA 3KKNA 3WHLA 1E9DA 4V0OA 2XNSA 3EC1A 2FNAA 4XVRA 2CVHA 5KSYA 2D7DA 1YKSA 2NGRA 2WJYA 2PH1A 3EASA 1K83H 3CRRA 3Q9LA 4BZXA 4Q9HA 3K70C 1L2TA 1W0KA 1A7JA 2ZXUA 3B1VA 3K0CA 3K81C 2FGJA 4EPTA 1OTCA 3DOEA 4R4OA 4OQNA 3VMFA 2J46A 3AF2A 3TW8B 5J40A 3RR5A 3QKSB 4DV3Q 4L5RC 3BE4A 1OH7A 3HFZB 2A6EC 2GEVA 1NY5A 2IA5A 5IT9c 2W00A 3KJHA 4NU0A 3GLGA 2IX0A 1NL3A 3PO3G 4DNTB 5GJCA 2H5XA 3ADBA 4XVQA 3M85A 3OFND 1DE0A 1N0WA 4OQXA 4WVFA 1LYLA 3HOXG 4R9UC 4C0BA 4GOPC 2ZEJA 4MRVA 4Q9LA 1CF4A 4DR1Q 1T9HA 3KFUA 5FUVA 1X3EA 2GK6A 1U8YA 3ZLJA 4DCTA 2KHJA 4V0KA 1TPZA 2XXAB 3BXZA 3A8KE 1SHKA 1WCMG 3BH6A 3C8UA 3PXGA 1FJGQ 3ZJYA 4DUGA 4ZDKA 5A5GA 1TF7A 1RJ9B 3KTAB 4X62Q 1PVOA 721PA 1YHAA 1BOFA 4A4DA 2HXSA 1N6NA 3X1WA 2EVBA 4TQUS 4IOMA 4V0NA 4BY7G 1E1OA 5IK2D 2YTXA 1YJ9A 3LWNA 1DS6A 4L4UA 1XJQA 2F43B 3NH6A 5CM9C 4DAYB 4Q02A 4D26A 1EFHA 2GXUA 4LJAA 2RGXA 2Y0SG 2GAOA 4JLAA 4BA1I 2K5UA 2DYKA 4BASA 3J81k 1E9EA 1ZKOA 2AR7A 1VQJA 2GZDA 4Q4HA 3CC2A 2F1JA 1OPXA 5JEAJ 2ZYWX 3CWZA 4DK0A 4KKSA 1TF2A 2Q9CA 4MGKR 4XWAA 3QVUA 2BMJA 1Z47A 4QJFA 2FMXA 1YNXA 1KSJA 5FBWB 1BMFA 1WF3A 5FPSA 2BWJA 4DV0Q 1OFIA 4DV4Q 3K09C 1X1SA 2ZTSA 1VQNA 3ULJA 3G6EA 3J7A5 1I5FA 1PUJA 3O8BA 3KF8B 2CJWB 1WBDA 1T5EA 4LFAQ 4GLXA 1T5LA 3TEHB 4JI7Q 3C7KA 3NIBA 2VP0A 4XIGS 4C3ZA 2OESA 2ZJRA 5E95A 3UWOA 3ZS9A 4PC3A 2O52A 1Z5ZA 1SZPA 5A0FA 1ZIPA 4O2LA 2KWIA 3TE6A 3WXMA 4M1MA 2VL7A 1EESA 4OJKA 4GN3B 1Q0UA 1PH5A 4XD7A 1JEEA 1Y63A 2H92A 2WICA 4NONA 1W3SA 3PF4A 1S4QA 5DLQC 1YZLA 4BFZA 3PO3H 2ATWA 5FTMA 5DHAA 1NG1A 1N0VC 1TQ4A 4WZ6A 1OIWA 4X8HA 1E3PA 3W5JA 3HOXH 4CT5A 4G5RA 1XMIA 4Q7KA 1Z6AA 1NBMA 3BH7A 1NE3A 4DV5L 1JB1A 2GNOA 2JJ1A 2FFBA 4JT4A 1W5SA 2ZR9A 4GOKA 3T1TA 3VX4A 2OFXA 3LQQA 1R5OA 3TK1A 1XNJA 4JL5A 1OE0A 3TBKA 3U5ZB 1KYIA 4OHVA 4G7OC 3KQLA 4HDCA 2OQKA 3D4RA 3EIVA 1KZ7B 3DZDA 4LBYA 4EKDA 5F3WB 1VCMA 1VQ5A 1GUSA 1VG0B 3T1YQ 1UKVY 3ZZTA 2E75C 1XRJA 4AURA 4D4LA 2AKAB 1C0AA 3I8SA 5B58C 2IHBA 4LV8B 3FGNA 5LMNW 3QKSA 1CU1A 4RY2A 3EZ6A 3CPFA 2NMVA 3W34A 4E22A 2OT3B 1W7AA 3B1YA 4PQFA 2CLSA 3LGJA 1QVRA 3UE0A 2BA1A 3K53A 4KBFA 4BY7H 4AH6A 4C0KA 1BDOA 1IJFA 4OX9Q 4HAXA 4AQYQ 3A6PC 2ZVQX 5G40A 4CF7A 4CT4B 1GUNA 4ME3A 4MGYR 3RZDH 2C95A 2ZJQA 3ZZ0A 1IYVA 2F3TA 4X64L 1N9WA 4D80A 3OOCA 3SOPA 1V9PA 1XMOQ 5JWOA 1ZNZA 1FL9A 1ZNXA 4KKTA 4Q66C 2XXAA 2C35B 2WWGA 1PA6A 4IW3B 2XSZA 1XMSA 1TWHH 3THWA 1RJ9A 4Z8XA 2VSOA 3KTAA 3TQCA 1N6HA 2PT5A 1VG1A 4FCWA 4DLWA 1VQ4A 4QOSA 4B2IA 4LF8L 4PV1C 1NJIC 3TS0A 2BMFA 3H84A 2OTJA 2Z6VA 4MYUA 2DNCA 4B3SL 1NMYA 3IILA 2F43A 5IHPA 5JCZA 2UU9L 5H1YA 2Z43A 3JC66 1GKYA 4HSEA 3VAAA 4BBSH 3HR8A 1M2OB 1TEVA 4LF6L 1G7TA 2CCJA 1A2KC 5AJ3Q 4URYR 1UDXA 1PFSA 5C46F 1SMYC 5LMNQ 4LF5Q 3RNLA 1LVGA 1ZD1A 2E2HH 5E7IA 1ONLA 3S24A 1A63A 1V8QA 4DR7L 5JJLA 4CEJB 1D8LA 1NSTA 4PPFA 1TWAH 3UE1A 3T1HQ 1AK2A 1CULC 3SYLA 1KDOA 1BO6A 2D5DA 4YHHQ 4NPHA 4QIWE 2HT1A 1HR0L 1WDTA 3CH4B 2I1VB 5EE5B 1ZC4A 1E9BA 1M1YE 2ZTDA 2OCPA 4LSGA 1VG8A 4A0RA 2CJWA 3W9YA 2O8BB 5GAHC 1HE1C 1MO3A 1FVIA 4C0LA 1TQ2A 1P2VA 3PEYA 3ZDQA 1SVWA 2IBMA 2J7KA 1NMZA 5CYPA 2N3SA 4B3ML 1CEEA 2CE2X 2VW9A 4B3GA 4URVR 4I1OA 1W2HA 2RGNC 4WAUA 2ZUBA 2QG6A 4V0ME 1Q1ZA 3O8DA 1LY1A 2AL7A 2P3SA 4HEJA 1B9MA 1Y8OB 4O2RA 5CM8B 3AKEA 3RS4A 3G71A 2LKCA 4DR4Q 2F4VQ 1CTMA 3IBGA 1PH4A 3OFNA 2JLVA 3V4FA 4NE2A 4ALPA 4JOIA 4Q01A 4RD4A 1IBMQ 4MKGA 4OGQC 3AGQA 1JR3D 1OYWA 1DARA 1FNMA 1G41A 4V0LA 4OKSA 2BH8A 3U7FB 1UF9A 1UE1A 1LUZA 1WA5A 4X8LA 4C0HA 3PENA 4QBGB 1OH6A 3UDIA 1QHGA 2VHJA 3AP2A 1DAHA 4QNRA 4FMBB 4PC1A 2VZAA 1KI7A 2ODEA 3UKDA 2HV8A 4N0DA 3AVXA 2JEOA 1S1MA 1N36L 3ASZA 4DSOA 4Q18A 2GWHA 1S96A 2V6JA 4C0JA 3WMGA 4QGAA 2REOA 2XZPA 2UXCL 1R8QA 4KVGA 2F3RA 3I56A 2IXEA 5IK2A 2EWWA 2HT6A 4B3FX 1R0ZA 2DNEA 2ZI6A 2ERXA 2QRNA 2I3BA 3CRMA 4LHZA 1YHBA 2EXDA 1XNQQ 2HHHL 1OJLA 4IO9A 3IO5A 4FDBA 1GUAA 4Q03A 2UVQA 4GN5A 2QPOA 3A1UA 3NHBA 3UIEA 4LV6A 5JCPA 4DB2A 3EAQA 1NY4A 3EN2A 4AYWA 5IYDG 2UKDA 4DK6C 3MSXA 3PEUA 1CR2A 1GRNA 4URUR 1SKYE 4PC7A 2VQFL 1GUTA 3BG3A 1XMJA 1XXHB 3SQXA 1T5IA 3BRWD 4P33A 1V5WA 5M5YH 3KYHC 1VYUA 4JI1L 4FMCB 4M9ZA 4DLXA 1KXLA 4HUQB 1WFQA 1F48A 2HYDA 1G7CA 4UJ3A 1JQLB 1OFTA 4M22A 1Q3TA 1P7CA 3A1TA 4ZDJA 1CJUC 1MT0A 2V4ZA 1VQHA 1ZC3A 1W4RA 1G3QA 2QGZA 4HYYA 4KN7C 3H0GG 4NYIR 1U81A 4NCHA 4ERNA 4W9MC 3TKLA 1E1RD 5F98A 4M1SA 1ODFA 1OW3B 4EIWA 4LF7L 4R2HA 3CR7A 4CEJA 4QM6A 3VR4A 2F3IA 4TYWA 1A5TA 4NYMR 2O0KA 2C2HA 3CCUA 5CLQA 4TMTA 3HDTA 1MO6A 1ZUNB 4JYCA 3FPPA 3WWVA 3QPVA 4A4IA 3KQKA 1SVIA 2MNAA 4AC9A 2VS1A 3IGFA 4LFCL 3FTQA 4KLZA 5EE0A 3GLIB 4NB3A 2EDGA 3HOUG 1KI9A 2XNDD 2O8BA 2OAP1 2R2AA 2GHIA 3E5HA 3IUYA 4QL3A 3OIVA 3DMDA 2NVTH 1IQPA 1YU9A 4G5OA 2FXQA 3AVVA 4EQ6B 5JI3E 5K8TA 3EIHA 1TF5A 1K8AC 3EZ9A 3ZH9B 2V7QD 4KJZA 4E07A 4YCVA 3DM3A 2VA8A 4GBMA 4JYBA 4M4SA 3SYNA 4B33A 2R93G 4G3XA 3FP9A 3CCMA 1N5IA 4A3IG 1SVOA 3SZRA 4F4CA 3QVVA 2JQOA 3V4RA 2WB1E 3I4LA 1GIAA 3ZD6A 2JA5G 4CYMA 4GMXA 3NTUA 1CI3M 1PMRA 2AWNA 4LNQA 1FQKA 4A3GG 3AVOA 4KU4A 1NMFA 2CQOA 2AX4A 5H70A 2JIZD 3BIFA 3UANA 1W36D 4DR2L 2CDNA 3G82C 4Q21A 4RD1A 3U9SA 4LFBL 1NRJB 4DR6Q 5FR2A 1E0AA 2GCPA 2QAJA 3R8CA 2QP9X 2A78A 4JV5L 5IP9H 5KNDA 1L4UA 2QP3A 4CVNA 5K8UA 2ZI4A 4X6AH 4AKHA 2UUCL 3O8CA 1CJKC 4DR3Q 2IYSA 4U02A 1O3YA 4BRWA 1E94E 5JECA 3TSOA 2FPLA 1N32Q 2FSIA 3FDIA 1R2QA 2IY5B 4URWR 1G7RA 3FHWA 5IWAQ 3ICEA 1NSFA 3HU3A 5KO2A 4HB4A 3LNCA 2B8WA 3AUXA 4D6PA 4JI3Q 1XTKA 1WB9A 2OBNA 2RGEA 4MYTA 2K33A 2L15A 1JQJC 4F4IA 1YZGA 1HZ9A 5C0XI 2QUZA 4PO9A 2ZR7A 4Q1AA 4TLBA 4JKYA 5CJPA 5EXPA 5FUXA 4EAQA 2GXAA 521PA 4DJTA 4A82A 3H0GH 4OL0A 3IEVA 1PYSB 4D0LB 3I4OA 2ODNA 4NKRA 4H13C 2JA6G 2GJKA 4NTZA 2HDNB 3RS5A 2J45A 3M4YA 3GJ8A 3EIEA 5FBLB 4FN5A 1QBKC 2LKDA 2WWYA 2DUDA 4CGZA 4B73A 1XXHA 2B7BA 4A6XA 4I99A 1Z0FA 2OXRA 3SHFA 3HOUH 3RLNA 2ZRIA 1A2BA 3CRLC 4DDUA 4NCIA 1IW7D 4HUQA 4B3TL 2B8GA 2VP5A 4D4KA 2IF2A 1E2VA 2KHIA 4KHPQ 2PEZA 5UKDA 2ZUDA 5K36H 3ZGXA 4IQZA 1Y1WG 4NXMQ 3NBFA 3WMEA 2IYWA 2QTFA 4FW9A 4IEIA 4ZDWA 4LHXA 5C18A 4Q7JB 2R93H 2ASEA 1HCZA 1IZ6A 1YNJC 1Z9FA 1PH1A 4A75A 1DTSA 2A5DA 2FSGA 3CH5A 2QMUA 3I92A 2GF9A 1TAGA 3KJPA 2ZJ5A 3NBHB 5C4MA 2VLIA 1WJJA 1RKBA 3T34A 4IOKA 1DOAA 1Q82C 4DV6L 1ZCAA 3T06B 4BRUA 4F4JA 4UP9A 2JGNA 4GSYA 3V00A 3CF5A 3N70A 3LDAA 1Z6YA 3ZJYC 1ZUHA 2VNUD 1CFMA 2CL7X 3QI2A 4HUTA 2QQEA 4RJLA 3B9QA 4ZI2A 1Q21A 5FOTA 2XTMA 3Q72A 1YJNA 4PX9A 3K8AA 5HR5A 3EBEA 2BMDA 2A5GA 4A6PA 4B48A 1SXJD 4X66Q 3HWSA 1N33Q 4NL4H 3S15H 4TL6A 3QJYA 1G16A 4L16A 1G6HA 4JLJA 3U3MA 4DLVA 4JLMA 1PH6A 2GEUA 2RAPA 1GNPA 5CB6A 4JI8L 2VSFA 3CPEA 4JVSB 1RRPA 2IEYA 1FQJA 1IJEA 1KKLA 2LCFA 2VYFA 2ZJBA 2HLDA 2WAQE 3A7LA 5F2EA 1HV8A 4FINA 4JLBA 2DR3A 3ADCA 1T6NA 5KDLA 2NVXH 1Q86C 2K5HA 3TQYA 2EU8A 2ORWA 3A8JE 3GCGA 3P26A 1EOVA 2QRZA 2YOFA 1LM0A 4JLVA 3KDSE 1GVNB 1VHTA 3DKVA 4BY1G 5CB8A 2QSZA 4DAMA 3RHFA 5AJYA 2MSDB 2HJVA 3LBNA 3BH0A 3KKPA 3PQCA 5JHHB 4RCZA 4PQYA 3KF6B 2F1RA 1W0JD 2VP6A 4RFVA 2GAAA 2PZGA 1GZSA 3UMRA 4HAZA 1NMGA 4YC7A 2WFWA 1ZM3A 3D8BA 3RVBA 4IOLA 1SRUA 4IPHA 2TMKA 1Y1WH 2J59A 3CRW1 2ZRPA 2ZM6Q 1QF9A 2GJAA 2CLDX 3T12A 3M4PA 1H65A 2P5SA 2JDID 1E1RA 2MO0A 2FA9A 1NG9A 2EFGA 2QEQA 4DCSA 1UBFA 3SFZA 5JEAG 3J80c 4FWTA 4LF9Q 3N2IA 2ZYUX 2I5MX 1LV7A 4DKAC 1ZAKA 3NVAA 5TMPA 3B60A 3M0EA 4LWCA 3CXCA 5KPDA 2F1MA 4PXAA 4QHYA 3QNUA 1ZBDA 2WPDD 4JCVE 2XNDA 3HJNA 3QF4B 4TZ6A 1Q1EA 3AFQA 2F7SA 3U44B 1FUUA 2RB4A 1U0LA 3M4OH 1P62B 3GFOA 2N78A 3GTPH 3QXCA 4A15A 4B3RL 2XAUA 3FKIG 4DNIA 3A5ZB 4Q1EA 2I5HA 2UXDQ 4LF6Q 2V7QA 3FMOB 3QE0A 2CWPA 1YHQA 2IS4A 1SXJB 4HB0A 3RN5A 1NVUQ 4G1UC 5SZJA 1KDRA 1KK3A 1NLYA 4BLQA 1OH5A 1SR3A 1EGAA 4PTLA 4IEEA 2CNWD 2WBLC 3AP1A 1VF7A 2BA0A 1KL9A 1D2MA 2CWAA 2DGYA 4JVNA 1QHHB 5GJVC 3REFA 3S1QH 1P6XA 3K9HA 4ZDIA 2PQAB 4GNXB 1WXQA 1TQDA 3W5IA 4Q47A 4YMSA 2GF0A 2ZQ5A 5C4GB 1J70A 4GNKA 2JIZA 2EJMA 4ZKEA 4CZ2A 4DCVA 4DR5Q 2OCYC 4EQ5A 4JI2L 3U4ZA 1NLZA 3LLMA 4IRUB 4JYAL 2E5LQ 2AK3A 4JI4L 1COWD 1EFRD 2F6RA 2IYRA 1M74A 2JXMB 4DV2Q 1UEJA 1ZM9A 2X19A 4B32A 2O8EB 1T91A 1HNWL 4OQFA 4B3MQ 1U90A 2QGNA 4BY1H 4KKUA 4UY8C 1E9CA 2E76C 4JI6L 3VU9A 2QROA 1CRQA 3LXXA 2R7FA 2R7DA 3AB3A 2DWOA 3HU2A 4UP7A 3WBJA 4OYHA 5DE3A 1H9RA 4PHHA 5GJWC 2PX3A 4QJ4A 2GA8A 4Q9KA 4DLRA 3NEMA 2AUKA 3TGPA 3E2IA 4QXAA 3HYTA 5KPJA 1UDWA 3LX5A 4B6EA 1X86B 2QT1A 2EWVA 2IHFA 5FLMG 1KRTA 4HZIA 1P73A 2QL6A 4A3LG 1EFCA 2WAYA 4TSFD 1SKYB 2LWIA 1ZCBA 2CCGA 3D3QA 1E1TA 3N2EA 1Z0DA 4TMZA 4A3KG 2WWWA 3NBYC 1G6PA 3EZ2A 5JEAH 2VQEL 1J2JA 1MH1A 5TV2A 2P65A 1R4AA 3AQQA 1QVGA 4RMFA 2ECKA 2EW1A 2VO1A 3OE7D 5BYKA 2WSMA 1CJVC 4MGIR 1YZ6A 3W6PA 2Z4RA 1TUIA 4OI4A 2JLWA 3KF6A 2FEMA 1SVSA 1KI6B 3M6AA 3NELA 3THWB 1NIPA 3K0FB 2CL0X 4M9QA 3RYTC 1Q8KA 3SBDA 1R10A 4GKJL 1XP8A 3FKIH 4A93H 2ZS8A 4IPDA 3L8ZA 4MITA 1WOCA 4DUYL 2WV9A 3FVQA 1ANKA 1GVPA 2Q2HA 2DBYA 2G1JA 4YQFA 1EFUA 4JOIC 1XTQA 4AYXA 4Q5IA 3RABA 1U98A 3IKJA 1F5NA 1P4SA 1QJOA 2MFIA 1I4TD 1Z0AA 2C96A 3P1JA 4HAVA 5J5CA 2FGKA 4URXR 4B35A 1GO3E 1KAGA 1IOZA 2XJ9A 4IOJA 3VR1A 2A68C 4FIDA 3GLFB 2E8GA 3PIOA 5DGXA 2BCJQ 2QMOA 2RMKA 3LFUA 4W5JA 4BZPA 2REBA 1EFWA 4DZZA 2MSEB 4QGFA 1KJWA 2KA7A 3QF4A 1E0SA 4V0MA 3SR0A 4JI1Q 1E9RA 1VQAA 1AS2A 1GTVA 2EYUA 5JEEA 4JJKA 2QMEA 2GETA 5JWHA
chains in the Genus database with same CATH superfamily
4EVSA 5CVTA 2JAPA 4IF6A 5T5QA 3S2EA 4OJMX 4QQBX 4LZNA 4K14A 1M2WA 1WEKA 1SKUA 1T8WA 3G59A 1K9VF 3M34A 4LFCQ 5JSZA 2P9GA 1A4XA 2EC5A 1V16B 2WUDA 1IPEA 4INOA 3VR5H 5KNBA 3CRNA 1AKNA 4D79A 3F1KA 2H4FA 2KHZA 1FBTA 1F2VA 3SHVA 1KO4A 1B8NA 3BB4A 1G1MA 1OPRA 3BMQA 5DKFA 2UUCQ 4RD2A 1U8ZA 3F6SA 2YJGA 1R0WA 1QC5A 2B92A 2GRAA 3K0YA 4A5SA 3DBHA 5BWBA 5C5LA 1H6AA 3MGAA 2AZXA 1DIGA 2HDWA 1SK8A 5A5VA 1COWA 1EWVA 5JO9A 3VR2A 4OUDB 3BMOA 1BVHA 2WTXA 2QRHA 2EP7A 3GJRA 1Q92A 4WY8A 5CGKA 4Y1RA 1DKPA 4QTUB 3D43A 3OE7A 4MR9B 3KJEA 4FLMA 1G18A 3AY3A 5EHXA 5A0VA 1VLMA 3I64A 1EQVA 1PFMA 121PA 1NBWB 1C0KA 3RM3A 5JALA 4ZCKA 1E1CB 1L7AA 4I8IA 1X38A 5EG5A 5HQTA 3PXBA 2J5RA 3K32A 3LC0A 5FTJA 4L73A 3K8YA 1MQ8B 1TYDE 4RQTA 5JAQA 1VBFA 3S2HH 2C2YA 2JB9A 4QBKA 4LGYA 1K75A 2VH2A 3AYZB 5KYXB 3RAFC 2O7RA 3UJNA 2BEVA 3H3VH 1E92A 2IYVA 2O5VA 3KYCA 1X7WA 5AJZA 1KYQA 4P4LA 4DV3B 1WUHS 5J4YA 4F46A 2O8NA 2YWEA 4JNCA 2MMGA 4N8X1 3DZ8A 1RWWA 5D14A 4YQYA 4OONA 1Y4ZA 4K5QA 2C82A 2O54A 2DTDA 2E87A 3OQBA 4C2MB 2PJRA 4B6GA 5F9FA 4POFA 4Z9AA 5EMHA 2AUMA 2GN9A 3HUTA 5IBPA 3C5VA 3CW2A 4JC4A 2P0EA 3J81E 2BBSA 1HDZA 3NE5B 1RC8A 2R92G 4M53A 4PZ7A 1Z56C 1IHZA 3MINB 4Y7NH 5SZKB 2XIWA 5I4CA 2GGSA 1NXXA 5DPMA 4D9GA 1TUEA 1SU8A 4JBXA 4HCSA 1OHHD 3WRWA 2K7VA 4JJ8A 1Q46A 3WRYA 1NW5A 3PXXA 1OTHA 2YZMA 4KSCA 1V3TA 1QAOA 1P9RA 2CKDA 1ENZA 4XWOA 5JJZA 4JKOA 3MFGA 4EPWA 4GMFA 4QOEA 4BO0A 3DBRA 4LVCA 4UTVA 2ZROA 3GJ3A 1MKHA 1UFRA 3BMCA 2B98A 2O8CA 3PR3A 5IKEA 5KCZA 1HWYA 3IT2A 4IURA 2K7ZA 5FJ8G 1GO2A 3KXKA 3L7JA 2HB6A 3AVWA 3S4YA 3T1HB 1DT5A 2P2ZA 4R6WA 2ONYA 2CNBA 3KSDO 4OIFA 1AUOA 3RC2A 3WBFA 3RHTA 1PLLA 4ZI3A 3U0VA 3N8DA 5J39A 5CH3A 3ZH2A 3OAAA 2GF2A 1CZKA 3NHJA 1Z36A 3OMWA 1QZHA 4BGDA 1QVAA 4TRRA 1J0EA 3CUKA 3N1UA 2IXBA 3BB1A 1HH4A 3EQ7A 3R3UA 4QPDA 1AMUA 2J31A 1ZK4A 3T9CA 1BXTA 2PUGA 4M1EA 2Q1UA 4UM8B 1N92A 3ND8A 4FNGA 2R86A 2O2ZA 4PLHA 2XV1A 5DVZA 3M8KA 3HC7A 1C0EA 1E3EA 2P5ZX 3KLRA 1QG7A 4MWBA 2IYZA 1YI1A 3TEMA 1JMKC 1IMJA 1X80A 1BVUA 3H99A 3I4MG 3QVWA 1P2GA 4CMBA 2OXFA 1J07A 1MZPA 4J1TA 4I19A 1V37A 2D0PB 2E4WA 4N5DA 4MYDA 1YZTA 4I9FA 1DUSA 3AF5A 3X43A 3RT9A 2KB0A 1WLYA 1R00A 4QYSA 4H7EA 3DV9A 2FPKA 4NAUA 3IO3A 4G36A 1PJLA 2G36A 1AZPA 3MJVA 521PA 4AQYL 1SQGA 4U00A 3T3IA 2L12A 1K4MA 3PC4A 1E1QA 3PITA 3HB1A 3JASA 3ND9A 3CMAA 2QTMA 5FWXB 5EJEA 1VQ9A 3DWPA 1T9DA 1H8EA 4HJXA 3UQYS 4HH4A 2I4OA 3FE2A 5DSTA 1RYFA 4K6GA 1KQOA 1G6Q1 4EUKA 4A6EA 4AY4A 2DFDA 4HGNA 5BVGB 1ZM2A 5ESRA 3SLKA 3IFTA 1E7RA 2GN8A 4JY7A 4MKFA 3GYBA 3KPJA 3WIBA 2UXCQ 4OSEA 3ZIUA 5IFKA 4IGIA 2QQGA 5K01A 5CFRA 4FQ7A 4RW0A 4HNTA 4J0DA 3RVOA 1HQMC 1J8FA 3MMXA 4HRVA 1CZLA 3BK7A 1S5ED 1EI9A 3VX3A 1CUGA 4G26A 3OJXA 2GBGA 1XA3A 4IHQA 1NQWA 2Q6LA 4TRNA 3D7LA 3QEMB 5C35A 1JHRA 3PD1A 4M1UB 3UI2A 4IH4A 1FNBA 1P7PA 3VSBA 1YHNA 4OYLA 4R8RA 2UYOA 2E5FA 4PMCA 2XDQB 4P82A 1KJ9A 4AO8A 1E18A 1J6QA 3SZUA 1VKJA 4Z7OB 2RKSA 4G81A 1HR0B 1B00A 1N0IA 4TS1A 4JV5Q 4J2TA 4F85A 1ZONA 2C5LA 2O8FB 2K2WA 2CNLA 4I2NA 5BV0A 3G1UA 1GKKA 1NVMB 4CLHA 1CKNB 4EHHA 3O13A 3FB1A 2B1GA 5JO0A 5IGBA 3GELA 2J6BA 4G0VA 3K15A 2QM0A 1MZVA 3FPLA 4NC9A 2NLOA 1GTL1 3RU9A 2VZ8A 5K20A 1S5DD 5KMGB 2PWZA 4KJNA 2GBIA 4A0FA 2WTMA 4MW5A 4ZKCB 3KWJA 1SWWA 2ZIZA 4FX2A 4O4IF 4A8JC 4EHNA 1FRZA 4KXWA 1E2WA 2D0DA 2RHGB 3WJ1A 1LI7A 4DLSA 3H16A 1BVRA 3WLKX 3PJEA 4KC0A 4QU5A 1JJVA 4LVNA 2Z08A 2ZUCA 3QFFA 5CR9A 4FDUA 1HT2E 5I8WA 1PGJA 3QMWA 4X66L 3NTKA 2SNIE 3FIUA 3DXYA 3R44A 2WJVA 2VTVA 3NH9A 4D8UA 5L3VA 1C7YA 2YJ4A 3ODPA 2IOYA 3OZUA 3QFSA 3LH5A 1WCMH 4E2FA 4QDTA 4QYIB 4NARA 3BC1A 3R40A 5DX1A 3DL2A 3GMSA 3DR5A 1T0JB 5BN5A 2ZE5A 5M5WH 1FXUA 4JEIA 4DADA 3NW9A 3R6TA 1XF9A 3OMCA 5KI6A 2ZUVA 3TLKA 1D5ZC 3SU8A 2GXSA 3JZAA 3NTLA 5GROA 4FLEA 1RVDA 3JATA 3R7NA 2A35A 2ZANA 4IZ8A 1PTOB 5DM60 4BECA 3WK5A 3CISA 3BJUA 3CP0A 4QIHA 3TNDA 3LLCA 4IFDI 3FA2A 2MYNA 4TTTS 3I2YX 3SK4A 4FHDA 2A4MA 3Q6IA 3IVXA 1E2UA 4CMHA 4NV1A 1N7JA 2E82A 3NTIA 5EI5A 2E5WA 1L7DA 2WHXA 2I62A 5G02A 4D4GA 2GZ2A 2QN6A 4AROA 1I6HH 1U8FO 3DZIA 2QM8A 2DR2A 4DEYA 4E2YA 1AB5A 2YJ3A 4KFRA 3HCWA 2ZETA 1SZJG 3L92A 4FS8A 2EEPA 1MJEA 2GVDC 2O7VA 2BBWA 2GUWA 4EA9A 3ITKA 2CXNA 4AJPA 4MI1A 3T7KA 3MT9A 3K8ZA 3PJDA 3LGXA 2NT3A 1OZFA 4ENQA 5K0JA 1NYTA 1FTGA 3PC8C 1YBHA 3UXEA 1PNVA 2HQLA 4CWAA 4PMBA 3Q2OA 4ABYA 5C32A 3B1KA 2X5XA 1LBEA 4QPNA 5KTMA 4C3HB 4NQRA 5LKRA 3EVEA 4UREA 3UICA 2OAEA 5MN4A 4KV7A 2AW3A 2ZSFA 3W2IA 1YQGA 1PJZA 2Q1SA 1FA9A 2OCLA 2G3YA 2PZLA 1QS0B 5BRNA 4ZZ3A 4CV3A 3RVKA 3C41J 2DWPA 3JD1A 1Y34E 4TZKA 3SK0A 3HO8A 3EZGA 5C4XG 2QRMA 1U5BB 3N52A 3UMVA 4CJ0B 4EJSC 3G0OA 1LCIA 1I24A 1V7ZA 2BFBB 3ON5A 4OU4A 4BVFA 4MQBA 4QMGA 3W05A 1P75A 1FBNA 1XPOA 3MS4A 5JVDB 1TRKA 1SD2A 1SNMA 2BR4A 5EQJB 1P72A 1R8JA 2BKEA 4AXXA 4HNHA 1CEYA 3BGWA 2GEJA 3GGOA 5T6BA 1TQ8A 2F0JA 3E5RA 1XNGA 4GDMA 1CQZA 4ID6A 1CA6A 4DG8A 2AH5A 2MOKA 4HWTA 4BGVA 4F45A 3DVAB 3WQHA 4MGZR 2ODPA 2P77A 5CBAE 4R6XA 2VBCA 3EGVA 2LCQA 1P9NA 2ZBQA 1ZNYA 1S8FA 2XYQA 1NF2A 4UOZA 2VL6A 2O5JC 4LF4Q 2GHQA 1GRVA 3H2HA 4JOCA 1PQYA 2VDUE 3ZI0A 1KSGA 3ZBTA 3ZGNA 1JG7A 1ZXBA 4S1VA 3PUVA 5GGXA 1HHVA 4AP6A 1V1QA 3GAFA 5E0KB 2V74B 4RIGA 2ZAOA 1UBLS 1ESEA 2H1HA 4EUHA 2EY6A 4QREA 4FX5A 4DY6A 2FJUA 1Z4KA 5I3ZA 2EF1A 4XWWA 4KXUA 4LYJA 3WRXA 2VDKB 1JJ2A 3GARA 1PX0A 4OB8A 4JBWA 3HLTA 1F8YA 3U4VA 4UW9A 4PAMA 4D8WA 1HA5A 4BBPA 2XGMA 1DRJA 2F1HA 1IFXA 2ZRKA 4BAZA 4MHEA 4JXKA 5KYVA 2E4VA 3M3PA 2UUBQ 3PI7A 3L4JA 4KCGA 4YRKA 2ZJ1A 1F2UA 4OQLA 3GRCA 2NO9A 2JE6I 4Z54A 2ZYRA 1QHHA 5BMOA 2Q9BA 2DXIA 3C87A 4C3JH 3NHYA 4KQIA 1CFJA 2RHHA 3TL3A 4NBSA 2QLLA 3QBTA 1E7ZA 3SF8B 2ZUUA 1U1GA 1T24A 3DEOA 3IQHX 2V1XA 2GXQA 2ZYVX 4KMSA 4BBSB 3BOSA 3FEWX 2G09A 4O2BA 1AK9A 1A77A 4MULA 2ZBEA 2Q5FA 5F35A 3P2OA 4WZAB 1O0SA 1YQUA 3B1VA 3USCS 3BSFA 2QIOA 4C5AA 3H9JA 3NATA 4MQ4A 1NY5A 4MCHA 4YREA 3OPQA 2O5CA 1UMKA 1QK5A 4H3SA 3ADBA 3M85A 1DE0A 5EHIA 4GOPC 4UC0A 1ZHHA 1PL7A 3DEYX 1CLEA 4AZ3A 4DXFA 3FCSB 1J9GA 3OP4A 3RADC 1Z15A 4X62Q 3SICE 1LBQA 3LWNA 4CLRA 4D26A 1GA1A 5LXTA 2RHLA 4U9IS 2VG8A 2BKLA 3EZYA 2D1FA 2HQSA 4C3OB 4RK7A 5ALRA 3K09C 1X1SA 1EVLA 2JLBA 4EEZA 4XIGS 1IAVA 1KPIA 4MVYA 4AN0A 3K1TA 1H94A 4ENTA 4NONA 2PTHA 5ALTA 5DHAA 1NG1A 1XWFA 1CY4A 3W7BA 1JB1A 4BQEA 5CMDA 1XNJA 3RKUA 4OHVA 1T43A 1C3EA 3Q87B 1SFRA 5CVUA 4AURA 4D0SA 2AKAB 3D6UA 3QKSA 4PQFA 2CLSA 1OLSA 2BA1A 3BKWA 4M0FA 3ZZ1A 1P0CA 4LHSA 4HAXA 2HAEA 4BMPB 1GYRA 3F9RA 3RZDH 1Z4JA 3KOZA 3WVNA 4D80A 3OIGA 5F1PA 4DW8A 5AKZA 1NXPA 1JGTA 1XMSA 1ILEA 3E9YA 1VLHA 3VJMA 2RA4A 4CMGA 1YQWA 4OREX 4IHJF 2CCJA 5AJ3Q 4B3TB 4HWRA 4TRDA 4BP3A 1BO6A 3SBXA 4YHHQ 3JR7A 3ZGOA 1I5OA 3SZOA 1VG8A 1XTBA 2VJLA 2VJCA 1TCAA 1D1SA 1CEEA 4IDCA 2ZUBA 5E9JA 2HHCA 1NQ5A 3UW3A 4S3SA 1A0OA 2SECE 2A0YA 2VUSA 4MKGA 3BJRA 3AGQA 5ARDA 3C3YA 1OH6A 3IALA 3F6PA 1DINA 1RCVD 2WU0A 2XZPA 4BNWA 2NXCA 1UDBA 3V1YA 4B3FX 3WLIA 5EKKA 5CUQA 3UT5A 3D7SA 3WL5A 1WVGA 3FNEA 3P5BA 1NR4A 1XHEA 2VJPA 3OZWA 1SKYE 1XXHB 3FRPB 4FXOA 1UAPA 4JELA 3M5DA 4ARVA 1WFQA 1SUPA 4XM0A 4HYYA 4FR2A 1U81A 2A7XA 1TM7E 3MTEA 7MHTA 1V6AA 2BHLA 3FAZA 4MVXA 1JQKA 3MWDA 4R2KA 2P1DA 2EDGA 1KI9A 4BVJA 3AYXB 1K8AC 4MZXA 3D1VA 3SYNA 4R8IA 1ORTA 3D8UA 4G3XA 5AW5A 1ESZA 4A3IG 3DFMA 5DEHA 4LNQA 4A3GG 1G0OA 2W2QA 4H16A 1E0AA 4MRAA 2QP3A 2QJTA 5FWYB 1NLUA 4XFDA 4MP6A 6YASA 4Q39A 1G7RA 5IWAQ 3DWAA 2A74C 4X3UA 1NXWA 2GXAA 4DJTA 2F0WA 4D0LB 2O2YA 4NTZA 1FMTA 1XZ8A 2X1HA 2LKDA 3EEIA 3ICVA 1FYWA 1AB6A 5TIIA 3OP1A 5UKDA 3KJXA 4KMOA 2I5PO 3WMEA 1CY6A 3KHSA 2ASEA 2O1SA 5KNDH 1KY5A 1NCVA 2O5RA 1TFRA 1YDEA 3KLBA 9GPBA 3DD1A 4D4IA 3EBEA 2A5GA 3GVPA 3S15H 4JU9A 3AHIA 3ZUPA 4FFVA 5IJXA 2CDAA 3A7LA 2FWAA 4MRMB 2H1SA 1GFWA 3GJTA 2JG3A 4FINA 5C1IA 4S1WA 5DMXA 2VKTA 3F98A 3DW3X 4PWYA 2ALJA 2IYEA 2FLVA 4KVZA 5TQ0A 2PZGA 1XLTA 1DIBA 4IPHA 4G0WA 2UYQA 1XKTA 3R3ZA 2W2OA 5EKUA 2Y99A 2J5BA 4E5SA 1WTXA 3PYXA 3ACBA 4UHBA 5DGTA 2VPXA 3M4OH 1NURA 5JVH3 3FKIG 1CIVA 2IS4A 3T41A 1SJHD 1NLYA 1SR3A 1JHUA 2ZR8A 2EKZA 4FKBA 5AD1A 1DRVA 4MV7A 2BMVA 4YRJA 1NRIA 3HFJA 3WB0A 1N7GA 3ZVKA 2BFOA 1MW9X 1MDBA 4OYHA 2PX3A 3E23A 3JRWA 4PS1A 3O7WA 2WYUA 3ADPA 5D3IB 2YXEA 3BWEA 2XCQA 2A9VA 5JDCC 4KQMA 5AVQA 3D3RA 2CXTA 5ALMA 2WV9A 5I7RA 4LIPD 3TZQA 3QTTA 5JATA 4C1NI 5LJIA 2RDFA 2JD0A 3I91A 1KAGA 4LTMA 3AMVA 1A9SA 5JPNC 3HTXA 4NBVA 3M3DA 4AKSA 4A3DB 5BPFA 3HHPA 3UMYA 2V03A 4WLVA 1JDJA 2Y0DA 4JBKA 4FILA 3DEPA 3E27A 3J80A 5FO8B 1LSUA 1PZHA 2R1UA 4IJQA 2WG1A 2B20A 3CW9A 3D8RA 1WRBA 3GTGB 4JK3A 3W3AH 3QPUA 3ZE6A 4Y8VA 2IY9A 2WIKA 2R6AA 4KE8A 2PCFB 2I76A 5I7VA 5L4NA 4AO7A 1XEXB 4TXNA 1P8LA 2JDIA 2E4YA 4ZZ2A 2M1ZA 4QJ5A 3QOLA 4F7WA 4KAJA 3GUCA 3K0FA 3R1IA 4GQBA 1G4UR 3CXUA 4US2R 1T2UA 5FBRB 4B3XA 10MHA 3EQZA 2IXTA 1E6LA 3LHSA 2OD9A 2HPZA 1CKMA 1VECA 1DXQA 1XCBA 2H29A 4H59A 1NUSA 1BH6A 1N57A 4OXIA 2AG5A 3JQRA 4MIOA 2J9FB 3PEVA 3NDBB 4WLFA 2FPPB 1DC7A 2AOUA 4Q3LA 3ZYZA 3U7IA 4ECEA 3L7IA 3FFBA 1RHKA 3IRVA 2PLNA 2IU0A 5D5HA 4A1FA 3SOZA 3HOZH 4HTAA 4J1SA 2FOXA 4F3KA 2YC4C 5BWMA 3EWAA 5KQMA 4D5GA 4CEHB 4GHWA 2UUAB 4M38A 3JQBC 1QFZA 4YH1A 3WMRA 4GLBA 4EYGA 3DMPA 3HVKA 3BTOA 1WUYA 1U2PA 3C7AA 2GSDA 2PUJA 1NVTA 2B29A 3AFPA 3CRVA 3UFBA 5J1ZA 2C20A 3QELA 3S1MH 1DSSG 5DTEA 1LQ2A 2WT9A 2LXJA 5HYVA 4KI7A 1VHQA 4OAPA 1EJBA 1C1YA 3THSA 1U7TA 4CMAA 3O75A 3URKA 1HT3A 3PC2A 3VU8A 1BX3A 3HCBA 4GZLA 3PGKA 3ANSA 1KWGA 4BC1A 2VDWA 1I2BA 5LPNA 3K6SA 4ND3A 2ZJPA 3DT6A 3H5OA 1Y4AE 3BTSA 1BGVA 1P5FA 2H5LA 2HO5A 1HLPA 4ZCLA 5LIPA 4MQ6A 1N5LA 4DBVO 4BWGB 3FWYA 3RF7A 5ELOA 3H2IA 1A3CA 3CZAA 4IDAA 5IJZA 3A6DA 2A1AA 1EYCA 1O8BA 4UAGA 1WSAA 4N5NA 3O1LA 2WKSA 3ETDA 2CUTA 3UK6A 3I01M 4W99A 1XRSB 1CD5A 3CLVA 3H6MA 1KI8A 2VDPB 1H9JA 5BSKA 4P35A 221PA 3FFTA 1HGXA 1U0FA 3DCNA 2D2VA 5F1OA 4OIKA 3H6HA 1Y8QA 5JRDS 1VE7A 1X1BA 3BSSA 1ZRHA 1OBFO 5L4SA 4R4JA 3G49A 1XD2A 3HYRA 4GLVB 3RUEA 4X8OA 1SOAA 3IB6A 1P81A 2PQ2A 3W9BA 1ZK3A 4JH0A 4A2WA 2NBFA 4GNXC 2Z3VA 3MJ4A 3BORA 4HNRA 3I6MA 4R7ZA 4X45A 4K87A 1I1OA 3KJZA 3N0RA 4OCZA 3FHOA 2OM2A 5HMMA 2X13A 3WLPA 3DTVD 1HXYD 4YRMA 2YUTA 4B3HA 4PQEA 4UHCA 1KC1A 3VC2A 1UT8A 2F8SA 3DHQA 1VPWA 3QHAA 1MAHA 2VEOA 3WYBA