4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC transporter related protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
1EFCA 2BMFA 3TR0A 3AQQA 4EAQA 3GJ8A 4EJSA 3TAHA 3J81k 2K50A 3LNNA 3CRQA 4U00A 1ZD9A 4FI3C 2JEOA 4RZUA 3VU9B 2DN8A 3TREA 1MO5A 2B7CA 3QXSA 3B13B 1JI0A 2ZRNA 4LHZA 3TGPA 2A69C 1PYSB 2IK8A 3EZ2A 4EDHA 3CKLA 5LD2B 4O0AA 1K8AC 3CCMA 4GZMA 3EIHA 3SBDA 2QSZA 4DBLC 3CF0A 1KY2A 5F3WB 4MZ9A 4LBWA 4LFCL 1BYUA 4OI1A 2YTYA 1T8TA 4ZIRA 4W5WA 1KSJA 4KN7C 2GTPA 3KTAB 4PAQA 2UXCL 3DM3A 3A8IE 2K14A 3EIVA 1JXMA 1OPXA 1YZKA 1WE2A 1AQYA 4B3BA 2R9VA 4JI2Q 2UZ3A 1NIJA 2ZJAA 4RD1A 4URXR 2IHBA 1DO2A 1D9ZA 3H86A 3KQNA 5TDHA 3GLIE 1GHJA 2YTXA 1EWIA 2N8NA 4A0FA 4C3HH 1T5IA 1ZIOA 2A5JA 4X8HA 3HOZH 3H0KA 1UBGA 1P60A 1KSGA 5JECA 4DV4Q 1QHGA 5C1BA 4A3GH 3ZD6A 4NBSA 3GO5A 1BYIA 4TQ9A 4OL0A 1CJMA 1MKYA 4X8LA 2HJVA 3AVUA 1XD2B 1G7RA 5GJWC 2F4VL 3QE0A 4LPKA 4D4KA 4ESVA 4TYQA 2CJWA 3U6KA 3S24A 4UNNA 5FBVB 1CR4A 4A82A 4IOAA 2J7KA 1GD7A 1II0A 1KAWA 1NVUQ 2CFMA 1E79D 2YC4C 1XTSA 3OAAD 3K81C 1L4UA 2VW9A 4PX9A 1X86B 1SVKA 5EZ5A 2K75A 1S1CA 4JI4Q 3CRRA 2ODEA 1OHHD 1CKNA 4G7OC 4OO1G 2R93H 2REBA 3I73A 1HNXQ 2JA5G 4KHPQ 1YVDA 2VEDA 4IDHA 3CMAA 1IBML 4Q4JA 3AYHB 2JAQA 3KQHA 2CWAA 2ZE8A 1QHHB 3I2ZA 1BH2A 5FUVA 5HCIA 4BY1G 3B2EA 1OH5A 2RKOA 1OFIA 2ZJBA 1KO1A 4DC9A 1T91A 3CCEA 2D74A 4JI5Q 5K8UA 1MRSA 2H5XA 3DKVA 4JJKA 4BLRA 5KUTA 3O8CA 3UWOA 1ANKA 1I3QH 4A3BG 1N32Q 1I2MA 3U4VA 2CE2X 4LYHA 4LFAL 3ASZA 3OOCA 1MR3F 1KK1A 2P2LA 1VHTA 2EW1A 1EFWA 3QBVA 4JL6A 1SHKA 2RH5A 3NKVA 4DLTA 4J0QA 2WSSD 3BERA 5C4XG 2E1RA 2GETA 2ZI6A 3MFYA 5G53C 1G17A 1YQTA 3MLEA 5JWHA 5DN6D 4B34A 4AYWA 5HY6A 1BS1A 4DDTA 1OSNA 1F2UB 1KO4A 3GJ7A 4ZI2A 3R8FA 4GKJL 1G1MA 1H9SA 1KKMA 1XXHA 4PO9A 3T1QA 3T5DA 1WA5A 4U7DA 3L8YA 1IYJB 4H1VA 4DIDA 2LWIA 5EE9A 4X66L 3Q7PA 2YU9H 4M1YA 5EQTA 3GTOH 4E09A 4IVRA 4HB2A 2V4ZA 3HJNA 4DSTA 1OB5A 1H8HD 2OTJA 3U44B 4GLVB 4POGA 3VFDA 4DK1A 1FGUA 3GTLH 2MSCB 2V55B 3K0AB 3TVTA 3LX8A 1FP6A 4V0ME 1WBBA 3V4RA 4JMPA 3WBJA 4ZI3A 1NF3A 2WB1G 1X3FA 1DAEA 1NVVQ 2JDIA 4BEJA 2ZRFA 1Y1VH 2BH2A 3AGPA 4DR7L 5A0FA 3TE6A 3VHXA 1JJVA 3IHLA 4EPTA 1FTNA 3L82B 521PA 3THXB 3A1UA 4XOIA 1KHIA 2W83A 3Q8DA 3QKRA 4A9AA 4C0AC 3B60A 3C5HA 1TQ2A 3DEFA 1TNDA 4K8OA 1H8ED 2EJGC 1EFRA 3P32A 1JB7A 1Z6HA 1A8VA 2XNDA 1W5TA 1IXRC 2QN6A 4C3JH 2AWOA 2D2EA 5CLQA 2ZYTX 3NDBB 2PPBC 1BMFA 3SE0A 1N32L 4F4CA 3A5UA 1AN0A 3PEWA 4TSFD 4A3FH 1KI9A 1YRAA 1UF9A 1HQCA 1VIAA 4FMCF 4PSKA 2B29A 2EJMA 4W7SA 1IYUA 3LD9A 3F3YA 4RD2A 4C0LA 5FUYA 4LCBA 2AWNA 3PEYA 4CEHA 3BFVA 3BH7A 1KOFA 1SFOH 4KFTA 2B8FA 1Q7YC 2WBLC 1VHLA 3K9GA 4E03A 4B3GA 4GZYC 4JI6Q 1W4RA 1XCGB 4QGGA 4H02A 1DG1G 2CJWB 3L43A 5CM9C 3VR3A 1LVGA 1RRCA 4LUZA 2IW3A 1XCMA 4MQBA 1V9PA 1ZYRC 1PLKA 2GJ8A 1ESMA 3RRZA 3WMGA 3AB3A 3TUJC 4F92B 4O2RA 2C96A 1CR1A 4D2IA 2J46A 4WZAE 1VTKA 5GQOA 1A2KC 4HDQB 2F55A 3AVQA 4QHSA 4AKIA 4RCYA 3U2QA 3BK7A 4LW1A 4P75A 2QM8A 3KJIA 4QGFA 3L0OA 1XB2A 3UE0A 3A8KE 2ANBA 4LHVA 2K5NA 2XTIA 2ZM5A 1YJ9A 1YI2A 2GJKA 2XTZA 2ZIAA 3BD9A 2J45A 3CWQA 4LJ5A 3SC3A 5TVKA 2VSOA 1X54A 4HB3A 1KQSA 2FZLA 2KBFA 1G291 4YHHQ 1GM5A 4O2LA 1RJ9A 4Q02A 4TL6A 4TMZA 4BEBA 4URVR 3CH4B 4BA2I 3GLFA 3EBEA 2FFBA 2GJSA 1X6OA 3CC7A 2BHRA 1W3SA 4KFRA 4G7HC 4TMXA 1G3UA 4DDWA 1RPZA 3ULJA 5C46F 3U6BA 4G3XA 5CJPA 2QEXA 1EG7A 4EPVA 1W0KA 4I1OA 2BKEA 5DO9A 4IOKA 4PTLA 2F43B 3BZKA 3W1GA 3K09A 2OM2A 1PH2A 4MRPA 4AYTA 2GAAA 3UG6A 1Q57A 1JT8A 3CCRA 3FFAA 3N70A 5FBLB 4TLDA 4V0OA 1N5IA 1JXOA 3M7NA 3GDEA 3I5YA 3QENA 5D3QA 4R1JA 5DLQE 4GKKL 1XNJA 3WDNA 3ZVRA 2J7PD 3JVUA 2O8CA 4PG3A 4OJKA 5JSZA 1TXYA 3G6EA 4HJ7A 4QL5A 2ZANA 2QAGA 2WKQA 4IFEA 3TR5A 4RD4A 1SKQA 2RMKA 3S1RH 1E0SA 1MH1A 2IXGA 2ZQ5A 1E2HA 3K0AA 5FUWA 5BW8A 5LPNA 1XPRA 2JA8H 2O5IC 3CRMA 1B70B 1P2VA 3W90A 1TUIA 2VHJA 3PUZA 3HOXH 2YTVA 1SXJD 1UADA 3E5HA 5CYOA 3ZS9A 5JMTA 2EWVA 1NE3A 1TF2A 1VG1A 1OF1A 2DBYA 3S17H 3CC2A 1B9MA 1G5PA 3KJPA 1Z8FA 2NO0A 3C8UA 1Z0KA 1E1TA 4YCWA 4HIKA 2GZHA 2QGNA 4DNTB 4S35A 3U3RA 2ANCA 3WHKA 1SXJE 2HIVA 1P9WA 4ZKEA 5KOYA 3CQZH 1IQPA 3I4NG 1V43A 1ZM9A 4HAUA 4QG7A 5TV2A 2IX3A 2QRNA 4LJYA 3FWYA 1QG4A 4PHGA 3JZAA 3EQLC 4BY1H 4AIMA 2EQSA 2LXJA 2I3BA 1KMQA 4HYYA 4ON9A 3OESA 4RSGA 2BBWA 4NONA 2IA5A 4TZ6A 4PHTA 3RLFA 1GKIA 5DE3A 3WRXC 1SVIA 2RHMA 4V0KA 3VX3A 1QF9A 3R9WA 1DCZA 1VQHA 4JV5L 5G40A 2DNCA 221PA 4EQ5A 2F1RA 4UNRA 3STBC 2ZJQA 4P33A 2OXCA 3UMRA 2DR3A 1FW6A 4A0RA 1VF5C 1FL0A 3DMNA 4P71A 3SJAA 4IPDA 4JLPA 3A4MA 1CF4A 4B33A 4ZPXA 3NEYA 5AJYA 1VQGA 3PCOB 2PMDA 3AEZA 4HIDA 4BECA 2R7DA 3H15A 1D7QA 1HURA 1E2MA 4IPCA 1H9RA 1P5ZB 1SVOA 2CL6X 3ONWA 4L16A 3I4MH 2IYQA 3TQFA 4C3ZA 4ZCLA 1K6MA 3BORA 1IZ6A 1U8YA 2Q3FA 5FOSA 4IFDI 3NEMA 3FYHA 1ZNYA 3J80i 1M34E 4NDZA 3B6EA 3QF7A 1FL9A 2A69D 5ELOA 1ZU5A 3HFZB 1YJNA 4GMDA 4JBYA 1G8HA 5SZKB 3VTKA 4D4JA 1J90A 4OXPA 4DUYQ 1KAGA 1E4VA 3FTQA 1E9CA 2IHEA 1KK3A 1L4YA 1RJ9B 2VBCA 3ZJYC 3P4YA 2GVAA 1GZSA 3KUDA 4Q1CA 4KVGA 4IW3B 3SYKA 1I2DA 4II7A 1IJFA 2FSHA 2WIBA 4WOPA 5KNDA 2CCGA 4KO8A 2PQAB 4B3FX 2WIAA 1AS2A 3NBHB 1XTRA 2QP3A 5JEDA 1E1QD 4E22A 2F1MA 5FTKA 3T06B 4GS3A 2RGGA 2NZHA 3A4NA 1D9XA 5DLQC 4RFSB 2O8EB 3PF5A 1YR7A 4GKJQ 2JQOA 2ASEA 2C9YA 2FV8A 2ORWA 2EFEB 4DZZA 2PMZE 1N34L 4UQOA 1K8RA 1TADA 2CL7X 3OE7D 4ZCIA 1N5JA 4LF8Q 5LD2C 3GD7A 3MEFA 1CKOA 1XBTA 2DWQA 1K73C 3A1TA 3EC1A 5KDOA 2E8GA 1GHKA 3A7LA 3LA6A 1W0JD 1GUNA 1UKVY 4LF7L 5AJVB 4NL4H 4URWR 1UEIA 2WWIA 4V03A 2O8BA 1V1QA 1DS6A 2FFHA 4OGQC 1XMQL 1KI2A 2C5LA 4BA1I 4HLQB 2QTFA 5AUQA 3A0JA 3OAAA 4D6PA 1G8YA 3FVQA 3B85A 3LBHA 1U2RA 2FZ4A 2X2EA 3IPXA 3HR8A 1ZYUA 2IXEA 5H1YA 2N78A 1CBUA 2V1CC 1E9AA 4Q00A 1IY0A 4OHYA 3MMPA 3RC3A 1IN7A 1NLZA 4D0GA 5ELXA 4DV3L 2ORIA 4QQBX 1ZNWA 3TJZA 2ZRAA 2X8AA 3BWDD 3A1VA 3IO5A 4GNKA 1XXHB 4HATA 5EE1A 4DEYA 2CLSA 2GAOA 4PANA 3Q72A 5IT5A 1Z2CA 1U5KA 3BZCA 4CW7A 4FCWA 1XNRL 1NY6A 2MO1A 1UKYA 4X8OA 4APVA 5J4YA 1Y3AA 2EYUA 2VQSA 4L5SA 2D7CA 3EAQA 1IW7C 2E2JH 2KWIA 2NQ2C 5D3MB 1TKWB 5KPDA 3U60B 3SQXA 3FHCB 4NXNL 1G3MA 1JALA 2KI5A 4MDEA 2QQEA 1KZGB 3T12A 1S3OA 1KK0A 3IDQA 1VPLA 4TLEA 3S14H 5M3MH 4JL5A 1RW4A 3L7ZC 4DV1L 2ZRLA 2XJ4A 2ZRBA 4RY2A 1YR6A 4TWZA 3GFTA 1N6NA 1XF9A 3BOSA 1VQEA 3CCQA 1H8EA 2PJZA 5DISB 3WP1B 5JI3E 4P4SB 1YHNA 3QKRB 1X8LA 2ZI7A 4IOCA 2TMKA 2ZI4A 4A3LH 3VA7A 4DV5L 2HDNB 2O8DB 2VQFL 4Q18A 4PC7A 3WP0A 1Q86C 121PA 3SJBA 4B71A 2RGAA 3AKCA 4B44A 4DR1L 2C98A 4QNRA 5C0XJ 2VF7A 1UEJA 3T1VA 1KI3A 3RZOH 1I6HH 2G6BA 4CT4B 4X62Q 5F9FA 4A3DH 4A15A 4I81A 4ALPA 1SVLA 4OI2A 1UFQA 3GLIB 1I4TD 1OTCA 1E2GA 5FPTA 1E32A 3ND9A 2FXQA 4HI0E 3TK1A 2H18A 4XWAA 2QGQA 3W5OA 4EPRA 3AUYA 3IIJA 1NBWA 5BN5A 4CIDA 4DV7L 2A6EC 3QEOA 4LY6A 2WAYA 2VZAA 4L9SA 1N33L 5CJ2A 1NIPA 4O3MA 2I5LX 4UY8C 2OBLA 2ZROA 1Z08A 3BAFA 4POAA 4FINA 1XMVA 4BZPA 2NZOA 2DWOA 1N25A 2PL3A 1OE0A 2NZJA 4MKIA 3GTPH 1TWAH 4OK5A 3KZ1E 4JLNA 1P72A 1YNNC 1U98A 4KV9A 4DDVA 2Z83A 4PQYA 3U7GA 3AFQA 2G88A 2VO1A 1DGSA 4HIOA 2YWEA 3B1VA 1OB2A 5KO2A 4TTRA 4JC0A 3X1WA 3KDFA 2XSZD 2YC2C 3NEJA 4FCTA 4PC6A 1EOVA 3DO6A 5FL7A 1GUOA 3U5ZB 2QU8A 4FN5A 4LBYA 2VNUD 2J59A 3K53A 4KJZA 5UKDA 1GRNA 4R98A 2VUMG 3RC8A 1CRPA 4LUVA 1EX6A 1C4OA 3IBGA 2GCNA 3MRSA 1PV4A 5BR8Q 4BWYA 5J4LA 4QGAA 2IUTA 1XNRQ 2ZSFA 2QG6A 1OV4A 4FMCB 3GLFB 4A3CG 1FMLA 2WKRA 3ZQJA 3IUYA 2UXBQ 1YVCA 3GTGH 2OHFA 2Q0HA 3MWYW 4IDNA 4M9QA 3OHMA 3RWMB 2UUCQ 1BOFA 4DLUA 4NYJQ 2PT7A 2VHQA 3TS2A 2EJFC 2VP6A 1WB9A 1CRQA 2F43A 3AFPA 4C9BA 4DEXA 3PEVA 2IHYA 1H65A 1Y14B 1E2DA 1ZVQA 1Q1BA 2IUSA 3D8BA 3IIKA 5FH9A 2AX4A 1E2EA 2NZ8A 4IRUB 1GDDA 4MH0R 4EIWA 4F38A 1RVDA 2GCOB 4G5OA 2OFWA 2HF8A 1LM0A 1KDRA 1ZUNB 2QPOA 1PH4A 2JA6H 1IJEA 2ZUBA 1ZCBA 5TARA 4B35A 5JSZB 1L1OC 2G83A 4OBEA 4IDQA 2A8VA 1B23P 1Z6TA 4DRZA 2ZVPX 4DNIA 4NXML 1P7CA 1HH2P 2GNOA 3CPHA 3EZ7A 5EE0A 4P73A 3T34A 2K7VA 1A2BA 4FW9A 3FP9A 2QUZA 2HLDA 5C44G 1BKDR 1NKTA 3SOPA 4JI5L 3UDXA 5GJCA 4Y7NH 3EWAA 3T35A 2OCYC 3W8NA 4NYIR 1MRNA 2Q6TA 1ASZA 5EAYA 5K36G 3BG3A 1DAKA 4M1WA 1RE0A 1AZSC 2A6HC 3AH8A 3C14C 3GLHA 2J0UB 4LJ4A 1Z29A 4PQFA 4PZYA 4D26A 3FDIA 5K8TA 1G4AE 1VYVA 1YZUA 4QBIA 1N6LA 1UKZA 4I1VA 4X65Q 2XGTA 1E9FA 4BRWA 1P2SA 3QIAA 2ATVA 4KSCA 4F91B 4NCKA 2HIXA 3KKOA 1XCPA 2ZSAA 1BKBA 2WWHA 4LBVA 2Q2UA 4W5JA 5KTYA 1OFUX 2WICA 4TN1A 1O87A 3DPUA 2VL7A 1TEXA 2XB4A 3A37A 3GLGE 2KCTA 5FOXA 4C0HA 4YXWA 4ZO4A 3G71A 3LWNA 4B75A 5BQ5A 4DLVA 2KA7A 1U81A 3CPEA 1TUEA 2CLCX 3PENA 2IT1A 1YHQA 4MITA 4AG5A 1MO3A 1Y8NB 4G0NA 1CJUC 1JJCB 1L8QA 4DAYB 2K5UA 3DOFA 4QFMA 2O8BB 3OEED 5IK2A 3OPOA 1OKKD 2WOOA 3H1TA 2NO6A 2P3SA 1X9NA 4B3MQ 4JLJA 3CRLC 1OFHA 2XSZA 1E9SA 1W4AA 1XJVA 3QNUA 4LJ7A 1LV7A 3RS4A 3RRYA 4Z1MD 2ZXUA 4DSUA 2FH5B 3FMOB 4B3SL 2XZOA 4CEJA 1G19A 5FPHA 3THWA 4DV6L 1SQ5A 3HGBA 1HE8B 1XJQA 2QPAA 1GL9B 2XJ9A 1JAHA 1GWNA 3KOJA 2Q9BA 4MKGA 2F1IA 1ZJ6A 4IJMA 1T5EA 4EFMA 5BXQC 5KNCA 2UKDA 3KDFB 4GNXC 2FG5A 3CD6A 3C15C 3KLRA 5DGXA 5FI0B 1KRTA 2YWFA 1EFTA 1KJWA 5LB2A 4QY7A 3HOWH 2BJVA 3K09C 3MD0A 1E69A 2OAQ1 4PO1A 4IFDJ 1R0YA 4OQFA 4EKDA 2DPXA 4TYYA 2FSIA 2NN6H 1HA3A 2BOVA 1RRPA 2DUDA 1M90C 3BB3A 3R7WB 2IWRA 1W2BA 3LAWA 1X8JA 2ZR0A 3WMFA 3UIEA 2VLIA 4OQMA 1EFRD 5FPYA 1X6VA 3IILA 1AGPA 4PFSA 4IQZA 3KXKA 3D6TB 2LCFA 3TVDA 1Z0IA 1LNZA 4UJ5A 3B9PA 4A4IA 3QSYA 3GQBA 4DVGA 4ZIRB 4KMUC 4A3DG 4ASUA 1KSHA 4PSVA 4Q9IA 1KO7A 4PSAA 3EC2A 1T5LA 3I62A 1ZAKA 4PR0A 2ZS9A 1VQFA 4PQRA 2K32A 3RLOA 5JWOA 1CJVC 3GLGB 2F1HA 3BFXA 4BXXG 2YOHA 4D81A 1S0UA 4I7ZC 1LABA 2GRJA 4OO1I 2R8RA 1VCNA 2REOA 2J5XA 5M5XH 2J87A 4C30A 5DHFA 2NG1A 4TZ0A 3PO2H 1VMAA 3AVPA 1DOAA 5LMNW 2IL1A 2VQEQ 3FMPB 1HT2E 4XD7D 4XWKA 4V0MA 2QA4A 4M8NE 4PMWA 5CITA 4JCVE 1W5SA 2VP2A 3PFIA 1PLLA 1Q3TA 2UZIR 3S16H 3QVVA 1AH9A 3ZZ0A 4B6EA 2ONKA 2B8TA 1D8TA 2RGXA 4A3MG 4NPHA 2DCUA 5F98A 1Y69U 2JA9A 2NPIA 4ABYA 1GNRA 3EA5A 1FR3A 1G8FA 3D3QA 4KXFB 2EVWX 2YYZA 2ES2A 4BGDA 2J0UA 4JBWA 2BDTA 1FQKA 5M04A 5IYDH 4HAXA 2CCKA 2W0MA 1RYFA 1DAFA 5P21A 2B63H 4QXAA 3ADCA 2Y0SE 5C4MA 1WBDA 1PH7A 3WYFA 1P61B 4B2LA 4B48A 4L5QA 3B1YA 2UXDQ 2AHOB 2UUBQ 3TRFA 2NO9A 4OHVA 2ONJA 4PC2A 2EFDB 1QHHA 2NGRA 5EP2A 2VYFA 4JLAA 1H9JA 1PH3A 2RB4A 1FJGL 1R5NA 2QP9X 5AJZA 1YJ5A 4ZCMA 2OO7A 1XMOQ 1U94A 1T3SA 1Z22A 3MJRA 3ZIAA 1VQIA 3WY9A 1X8KA 2MFIA 4JBXA 5EZ6B 3UATA 1H9MA 4B3SQ 1NY5A 2BMEA 3BH6A 4M9XA 4TQAA 3ZD7A 1G7SA 2WM9B 3CRW1 1ZC4A 3RRMA 1E9DA 2J0SA 3VR6A 4DV7Q 3CNOA 3E9IA 1N5KA 4RZ3A 4WZ6A 1PMRA 1HNWQ 1KIXA 3SQWA 1T4GA 1Q44A 1J8MF 1Z0JA 4KKTA 1YR8A 4DV0Q 2JA7H 2YJTD 2ZEJA 3DM9B 4JS0A 4YLGA 4B3XA 1K83H 5L3SA 3KLWA 2R6CA 2ZM6Q 3A7AB 1H9SB 1SVMA 3GLIA 1AJEA 3PUYA 4O25A 3IQWA 5FR2A 1KK2A 3PCRB 3RDPA 2VP4A 3S1AB 4DR3L 5EJEA 1VQJA 1OH7A 3QKSB 5EP1A 5BN3A 4LWCA 4IOMA 4M9SA 5G41A 1RIFA 4DV6Q 3B7GA 1CKEA 3ICQB 1OLOA 2AR7A 3QG5A 1KSFX 2IYXA 4LHWA 4MYCA 3UDGA 2QPTA 1IN5A 1W0JA 4LUCA 4AQYQ 2ATWA 1Y1WH 4YXWD 1RC8A 2ZM6L 3QY0A 2B21A 3U3OA 4URZR 2NVQH 3H94A 4IO9A 3EG5A 4UXJA 3RANA 3WYGA 2VL6A 1DTSA 4OX9Q 4HLUC 1PZNA 4TLAA 3HKZG 3M3YH 4AWXA 3QEJA 4A0HA 3W6NA 2IYZA 1OIVA 1MABB 3QPWA 3U3KA 2VQEL 4LHYA 1GITA 5HKKD 5TMPA 2D7DA 1CR0A 4OQXA 2C95A 4LJZC 1CULC 5FTJA 1EFHA 4DHEA 1JR6A 3N5CA 4Q03A 1QHIA 1AE3A 2EDGA 2GEVA 2Z43A 3BDOA 4XVRA 1U0HC 1MKHA 1GUGA 1D2MA 1II8B 3AF1A 3HOVH 1ZUIA 1L7VC 3PXGA 2L0XA 3GLGA 2IX1A 4JLOA 4OI4A 4MKFA 2FWRA 4RD3A 2Z6VA 1NRJB 1CIPA 4A8JC 3EWSA 5H1SE 3T5GA 4X65L 4NXMQ 1S96A 2CK3D 3W3AA 4IFDG 1MO4A 1ZMXA 4B74A 2CDNA 1KDOA 1P9RA 3SHWA 4HJ8A 3T51B 5B57C 5KSZA 2RHSB 3OIYA 2IF2A 3RN5A 4WBSA 5A35A 3QXCA 4GP6A 1KYIA 5FL3A 2PNRC 3T53B 2CNWA 1X1RA 2AUJD 1AE2A 3CCJA 2FSGA 4JL8A 2P65A 4JT2A 3G82C 2FPMA 1SE8A 2CE7A 2VP5A 4IOJA 3K9NA 2J1LA 2R6AA 3ICEA 1HY3A 2SHKA 4IJHA 3RNUA 1ZIPA 2GESA 4YMUA 1PH5A 4GN4B 2JA1A 4BZXA 1WRBA 2C03A 4Q01A 5JEAH 1LF5A 3KJGA 1ZM3A 4KFUA 4HLUA 3PITA 3PUXA 2JLXA 1AZTA 4LF5L 4CEJB 3THWB 3EIQA 5KHOC 3UKDA 4BPBA 4ASUD 2ZTCA 1EWRA 2QMEA 1GKUB 1M8PA 4JBMA 1EFUA 3THYB 2GILA 1I4LD 3VKHA 2D2CC 2PX0A 3U7EB 4DKXA 2VP9A 3H84A 4JLVA 1KI7A 3LGJA 4GOPC 4JYAL 1ZRHA 2AHOA 2D06A 2H16A 2HF9A 3VQTA 1IBMQ 2CVHA 1M6NA 2HJGA 2NO7A 3I61A 2JJ2D 3SYLA 2IYVA 4HSEA 3O8BA 4GKKQ 1Y1VG 4DCSA 2VIIA 3REFA 2LXKA 4A3LG 4BLTA 3NELA 1NMGA 2ZRGA 3FHOA 4FMDF 2AN9A 2RGNA 4Z8YA 2O8FB 4XD7A 5DI9A 1WCMG 4JI4L 1GRQA 3AVYA 4N3NA 1U8AA 3BBPA 5KSYA 4YDSA 4PZ8A 3GLHB 2GCPA 4IXMA 1HZ9A 3Q9LA 5L3QB 4A3KG 4AQYL 2XITA 3VKGA 4A6XA 3FPPA 3TQCA 1QBKC 1SRUA 2P5TB 1A1VA 4B2IA 2JDID 1XU4A 1KI1A 3SYNA 3GFOA 2BE5C 3EW9A 4GI7A 1YR9A 2ODBA 621PA 2PJRA 4JI1Q 3OTOQ 2E75C 1J6QA 4JV5Q 4HB4A 1P8LA 5L3SB 3CF6R 1XEXA 1M74A 2CL0X 4HUTA 2ZJPA 1VQLA 3I8SA 4Q48A 5LMUL 3K70C 3N2IA 2O52A 4K46A 3QKSA 4LDJA 2OQ0A 5K8LA 1Q1EA 2OFXA 4C2UA 2P6UA 3KL4A 3J81j 4DR6Q 3K80C 5C3EG 3M9BA 1X1SA 3CPFA 1IY1A 4C4PA 2YWHA 2IS1A 2A5FA 4DNRB 2QT0A 2CEAA 2FGKA 3CCSA 1VQDA 1VQKA 1YZLA 3MCAA 4AIIA 5FOWA 3MXUA 4M1SA 1GKHA 2OTLA 4OK6A 5IYDG 2BCGY 1QVFA 1FUUA 2FMXA 1D6JA 3C16C 2B63G 3VNUA 4IJLA 2VQFQ 1QHSA 2ZJZA 1IONA 5SZIA 3V00A 5JCPA 4YQFA 3ZDQA 3U4ZA 1E4YA 2UXDL 1M2OB 2R44A 1Z83A 2W00A 3PR1A 2GHIA 4JSTA 1DAMA 3CCVA 1EX7A 2Q9CA 4ZKDA 2ZJRA 2V54A 2X2FA 2XZPA 3R8CA 2AD1A 1FX0A 4BBRH 4AY2A 1OW3B 4PPNA 4Q1AA 4PPGA 4C0SA 4HLDA 1OKKA 3CUEF 3K7AH 2E5LL 3ZVNA 1YEZA 2A30A 2O5VA 1TWGH 3RYTC 5CB6A 2Z0MA 3RHFA 4YY3L 4M53A 2FPKA 4JI8L 3H3VI 2EQBA 3BE4A 1CLUA 1Z6XA 3I8XA 1COWD 4G7ZC 1JR3A 1ZC3A 3TZUA 1VQOA 3R7WA 2Z5FA 3VR4A 4DV2Q 2QTVB 3QBTA 1C9KA 3FFBA 4WJ3M 4FMDB 4HZIA 5FJ8H 1IOZA 2AXNA 3T1HL 1IBRA 4KVAA 3GJ0A 4MYTA 4Q1BA 3PVSA 5AWFC 1R8QA 2AK3A 3E0EA 1W36C 4DCTA 1E7ZA 3GEEA 4NKRA 3X1ZA 2PLRA 1T3HA 4OYHA 1G7TA 1R2QA 4RKEA 2DY1A 4J15A 2ZS7A 5J4KA 3K0EA 2R7FA 3EXAA 4NCHA 3E2IA 4Y0VA 5FBWB 3TBKA 3AVWA 2HV8A 2QY9A 1H8HA 4FIDA 2ZT9C 4JZKA 4YMSA 4E07A 2Y8EA 4NU0A 3S1AA 1KO5A 2E2HH 1YZQA 2PX3A 2PLFA 3HKSA 4R4TA 4DIEA 3A8JE 5KNBA 2GXSA 3HOXG 1IYVA 1JMCA 3L8ZA 3PIRA 2PEZA 3QOFA 4GN3B 2ZR9A 1ZINA 4UKDA 2NIPA 5CYPA 2REXB 4DCUA 1E2LA 1U0LA 4FCVA 3EARA 3DL0A 3ULPA 3CX8A 2H8KA 4BFZA 1KJYA 3D4RA 4YCUA 2NO1A 2F6RA 2H1LA 5G3YA 4DB2A 4OK3A 2PZEA 4TYNA 1P16A 4ZDWA 4N0DA 2W6IA 5C0XH 4W5HA 5TY0A 1Q22A 4D0NA 1HZCA 2Q3HA 5H70A 1HJPA 4Q1DA 2JLWA 5F2EA 2JLRA 1TAGA 2JA5H 2EYQA 2ZI3A 4OX9L 2WAQE 1R4AA 3TUIC 3A6PC 2PBRA 4Q4AB 1U90A 4LYJA 5KU1A 4E5UA 3K70D 4JIMA 2ZI5A 1II8A 3TS0A 2OG2A 4QGHA 1KL9A 2ZRMA 2A68C 3NIBA 4XVQA 3TH5A 3OFNA 3VX4A 8OHMA 3U7HB 5FOVA 2J0QA 1PH9A 5E7MA 2ALYB 1S3GA 3VHLB 2IS4A 1NSFA 2FX3A 1UE7A 3AP3A 4KAXA 2FN4A 3GTKH 4FMBB 3MWLA 1G51A 1Z3IX 2J0VA 5CK5A 1Y63A 2PMKA 4MRSA 4MYHA 4GRAA 4OHZA 2AFIE 4TL8A 4DV0L 2ERYA 4UJ3A 1NP6A 4BRUA 1E2JA 1G8GA 1K5DA 3WHLA 3WNDA 3KQLA 1E2QA 2Z4RA 1U8ZA 1R5BA 3OW7A 2F9LA 1Q90A 1XX6A 1GUTA 3RLNA 1A6XA 4A2QA 2MMCA 2PNHA 1WP9A 2EFHB 2IS6A 1G6OA 1ZNZA 1HYQA 4Z1MA 4AC9A 1P2UA 1FJGQ 2WPDD 4JLMA 3KKMA 4BZQA 1JECA 2A6HD 2W0SA 3I4OA 1NVXQ 3IIMA 1AS0A 1Y8OB 3TSWA 3STBD 3NH6A 1ZP6A 3FKSA 1XNQQ 4A93H 1Z5ZA 4AURA 4R2IA 3SFZA 4PPQA 3AM1A 2KE5A 1HV8A 1VCOA 4DR5L 1P9NA 3ECCA 3SJZA 3UE1A 3DKPA 2I5HA 4KFSA 4LJAA 4DT1A 3FB4A 3W1BA 1R8SA 4UXIA 4DR7Q 1OIXA 1Q12A 2WSMA 1NBMD 4BFTA 4D82A 4TT3D 1DE0A 1MABA 3TQYA 2R92H 1XMJA 1OXUA 1Q0UA 3CB4A 1X3GA 1O7IA 3IQXA 4AI6A 4B3RQ 4GOKA 1KDTA 2EXDA 1N6RA 3M85A 5AJXA 5CDFE 5CK4A 1ASYA 4JI7Q 5L3QA 4LC1A 1A82A 1G16A 1S9HA 3ZZTA 1XTDA 1AQUA 2JLSA 1P73A 4PZLA 3C41J 3P20A 1DO0A 3B1XA 1S9DA 1JJ2A 1NN1A 2YOGA 4LK1C 2QP4A 4YMWA 5FTMA 1FP7A 2B8WA 4GLAC 1UE1A 2YKGA 5BR8L 2IYSA 4B3DA 1I94Q 3B1WA 3HYRA 5GAHC 2AD5A 4GSYA 1Q1QA 5B2ZA 4LFBL 1XP8A 3C5CA 5JWRA 1VQAA 1QHXA 4DB4A 1KNXA 4A3IG 2OBNA 1WXQA 2V1UA 1G5TA 1G41A 2QI9C 4Q7JB 3B6YA 1ESNA 2WB1E 1G20E 3CRKC 4P72A 2B3GA 2I0QA 2YVUA 2ZREA 3K0FB 5CM8B 3CCLA 2IEZA 1PHJA 3OEHA 2KSQA 4A3JH 3UANA 3FPAA 4HAWA 1KGDA 3KKPA 4KCGA 3LXXA 1YNJC 3U3MA 1NJIC 4G5RA 4HAZA 4LSGA 2HXYA 2QL6A 4V02A 2DNEA 1HTWA 2LKCA 3K8AA 1XDBA 1TPZA 5IF9A 2PT5A 4XJXA 4MGYR 5FBQB 4PC1A 3QXXA 4GDFA 1I5FA 5C4GB 2V6IA 1OIWA 3VR2A 4Q4AA 4KHZA 4MDFA 2X19A 3LH5A 4LZZA 1WFQA 2WFWA 2WP8J 4IVQA 2BWJA 4TMVA 2CWPA 1FX0B 3NC1C 1UWVA 5EE5B 4EFNA 2QMOA 4QIWE 4L8GA 2AMCB 5M3MG 1GILA 1VG9B 4TMWA 1TF7A 1F6BA 1W2GA 1IL2A 4KLNA 4N0EA 5DH9A 3ULLA 4K0KL 2BH8A 3MG9A 3CMEA 4LRWA 4QNMA 5JS8A 2Q9AA 1MT0A 5IDVA 3HU3A 3NH9A 1N34Q 2O8FA 1N6PA 2ZRKA 1NN3A 3LLMA 5HR5A 5JRJA 3W5JA 4JVNA 3T61A 2B6HA 1TWFH 4IEIA 1LACA 2WWFA 4YC7A 1ZKOA 1Z06A 5JHGB 2QE7D 3I72A 1G21E 2ZJ8A 4JBJA 1G6HA 5SZHB 3LBIA 5LMUQ 4QJ3A 4F93B 2V3CC 4WXRA 3VMFA 3E9HA 2JJ2A 1NVWQ 2YINC 3M4PA 4DV1Q 3AKYA 2YWGA 1KMHB 2KENA 3I92A 1E2WA 4R9UC 3I7FA 4DUYL 1MO6A 5IP9G 1RRFA 2FFQA 2KCMA 1EYGA 1Q1ZA 4AYBG 2GEDA 1QVAA 2MMGA 3EZ6A 1E98A 2JLVA 2O0HA 1Y1WG 4LC0A 2BMDA 2IY5B 4D0LB 1NJGA 2A5GA 2AKYA 3G4SA 3UDIA 3NBZC 3P4XA 4LOAA 4RMFA 2FOLA 2KBEA 3BB4A 4UNPA 4Q5IA 2AXPA 1NTGA 1O3YA 4HIMA 1XMSA 4TVAB 2ZAOA 3E70C 3MUFA 3E1SA 1C9OA 2H5EA 1YZTA 3OIUA 1W7AA 4RVCA 3GCGA 2GVBA 4C0KA 1ZM4A 3HPQA 1F3OA 1P3JA 3V9PA 4US1R 3NBXX 2NVXH 821PA 3B8HA 2JGNA 1G3QA 2A1AA 1WJJA 4L5RC 4WVFA 4TLBA 3W6PA 1HR0W 3U4QB 1YRBA 1I94L 5F9HA 4H9GA 2E74C 4A75A 1VQ9A 4BBSH 2ZRCA 4MKHA 2C9OA 3LXRA 4M1TA 1RIPA 1K9MC 2BC9A 3M4QA 2VUMH 1K8OA 1YITA 2AKAB 4BY7G 2C2HA 4FWIB 2JJQA 3K0SA 2HHHQ 1Z63A 3H4MA 2PH1A 5JJIA 1TU3A 1AGRA 2LKDA 1FUKA 4HR7B 4A3CH 2OBMA 2ECKA 1K0RA 4BLSA 1JAIA 4LK2A 2GZAA 1YNXA 3ZZUA 3I3SR 1KJZA 1XEWX 1QHYA 3ZYCA 2WJHA 3AF0A 5HKKA 2A6ED 3K7UC 3TW8B 1IBKL 2W6JA 4WIAA 3CXCA 4G5GA 3ZJYA 5JLJA 1SXJC 1AK2A 3NE5B 2C77A 3I5XA 4BQSA 1F5NA 5AJ3Q 3I56A 3T15A 1XTQA 1ONBA 2IBMA 4LF7Q 4G5QA 3WWVA 3T1OA 5IHPA 2RGNC 3QPVA 3F0TA 4X66Q 3H3VH 4JT4A 3CR8A 2A19A 2A9KA 4PAMA 3SHFA 4PZZA 1R7RA 3GLHE 3KB1A 5BYJA 1Z6AA 2GK6A 3X1YA 2RHQB 1QHNA 5C44H 1FYCA 1WMSA 4JKYA 3KJHA 1G8PA 2BVNA 1O7LA 1X56A 2QMUA 4K81B 1Z9FA 3RRNA 3AP2A 4DUZQ 2HCJB 2KBNA 1KI4A 3CZPA 3J81i 2BV3A 4AH6A 2WMOB 1GL7A 2ZE5A 3QPUA 4M21A 5H8WA 3AVTA 2W6ID 4GMXA 3PIOA 5HE8A 1SULA 2IYLD 2ZSBA 4BFYA 1P6XA 1M1KC 2ZRDA 3P27A 1PUJA 4LWZA 3GEHA 1XMIA 1CKMA 3OEHD 5JHHB 5M3FG 3EN2A 5DNYB 1FMJA 4AKGA 3HOYG 1G5RA 1HEIA 1NMXA 1QZXA 3CWZA 4HZUA 4NTZA 3B9QA 4QBGB 4URUR 2CQOA 2XNSA 3CC4A 2ASBA 3TKLA 1VQ8A 4H1UA 2A5DA 1QVRA 3PG5A 4DR4Q 2VY3A 4XSGA 4H44C 4PZ6A 5DI3A 3KXIA 1E0KA 4US0R 3DMDA 1IY2A 4OHXA 1TEVA 2V7QD 2ZJOA 1K5GA 4IPHA 1PLJA 2ZR7A 2C04A 3IPYA 3KJEA 4R2HA 5ANRB 2QAJA 1HNWL 3A74A 4DJTA 5GAGC 2DFKB 2OEPA 4FDBA 5IYCG 2P6NA 4B3CA 1PFSA 4QRHA 2K52A 1EK0A 2ZUDA 2C78A 4NYJR 2QQ0A 2WZQA 2R2AA 4MUAA 2YHSA 5LMNL 3A1SA 4IDPA 1P2TA 2BA0A 2C99A 2OV2A 2UXCQ 4MRVA 4ACAA 4BLQA 1BDOA 2F4VQ 3BS4A 2QEQA 4TTQA 5AJWA 1I6VC 4JLDA 4A3EG 4D4MA 1FFHA 2PI2A 3DZDA 4NH0A 4Q7LA 2RAPA 4BBRG 4Q9LA 2JXMB 2ODWA 4RG1A 4DV4L 2WPDA 1E3PA 3HWSA 3UPUA 5EXPA 3NC0C 1V5WA 5GVRA 4JI6L 3EPKA 2IC5A 3SI7A 4JI3Q 3BJUA 2FSFA 4R4OA 1LF0A 4O2DA 1VS0A 2GXAA 5FLMG 2UUAL 2D62A 3CP0A 4R7ZA 3IHWA 4B43A 4JOIA 2MO0A 1XJCA 5AR1A 1T9HA 2NN6G 4RD6A 3KUCA 1US8B 5E3HA 2GKSA 4DR1Q 2OCPA 2VPPA 1TQ6A 1HT1E 5C0XI 3BJIC 1QUQA 2XAUA 5JBQA 3U4QA 5FJ8G 5CB8A 3ZVMA 3T1HQ 2K4KA 2O0KA 4Q4HB 3ZIAD 1GL6A 3CX7A 1VQMA 3KKQA 1QJOA 2GEUA 2UU9Q 3AB9A 1HR0Q 1X3EA 4JOIC 4LF4L 1M7GA 1DARA 2HUPA 5KPJA 2HHHL 1GO3E 1J2JA 5E7JA 4X6AH 3HOZG 4C0BA 1U99A 1W44A 1AKEA 5BWMA 3MAAC 4HB0A 4C0QC 1NMYA 2FDCA 2XZLA 1DBSA 5JEAJ 1N2CE 1SZPA 4IEEA 4B3TQ 3BGWA 5DYGA 4FXPA 4L5TA 2WKPA 4M0LA 4BLOA 3UDFA 4OKSA 2XGJA 1MV5A 3BFKA 1F60A 5IP9H 3U50C 3I4LA 2FA9A 2C35B 3LFUA 4X8MA 2JIZA 2Q3MA 1T8UA 4RD0A 1FVIA 2ID0A 4PHFA 2GN5A 4MTNA 3K9HA 1VQNA 4X64L 1JB1A 1BBWA 2V1XA 4R71A 5HZKA 2C8VA 2FFAA 3D0FA 1PH6A 3G5UA 3AP1A 3SNHA 5IP7G 4ITRC 3TAUA 4JI8Q 4CGZA 1HPCA 2GDJA 2ZS8A 3KFVA 4GZLA 4L5BA 5J4VA 3O8DA 4C7OA 2NN6I 4BE7B 3CPWA 3K0FA 4LF8L 1UM8A 4JLBA 5L8VA 3NBFA 4NPSA 1T6NA 5C0XG 3ZQ6A 4EQ6B 4LFBQ 3RS2A 3RVBA 3CF5A 5FL7D 3HU1A 1K8GA 3M4YA 1KIMA 1XRJA 3DOEA 2UUAQ 5BN4A 4JI3L 4FD2A 1K3RA 4LBZA 4Q47A 3C4JA 2VHCA 1I4DD 2ODNA 3O47A 4P4UA 1Q82C 1IXZA 2NOAA 2CHQA 3ASYA 1A7JA 2QTHA 2ZETA 2E2IH 4BY7H 2FE4A 3NVAA 5JEEA 1UBFA 4A3BH 3LDAA 2A7QA 4AKHA 2YZ2A 3CNNA 4LI0A 2F3IA 1HZBA 4DR2Q 3TLXA 5DHAA 4X62L 1QDEA 4UNQA 3L0IB 3BIFA 4KKUA 5C4XH 1LY1A 3RAPR 1E2IA 5EE3A 3SBEA 1EWHA 2GJ9A 1N6OA 2IYRA 3CIOA 1LS1A 3PV0A 4TKOB 2G1KA 3B78A 4LV5B 2VP0A 1UE6A 3X1XA 4LPSA 4P74A 1LYLA 2GBLC 2A3RA 2FNAA 2QNRA 3LW7A 3CH5A 1JEEA 4Q4LA 4DSOA 1TU4A 3KQKA 5E95A 1OXTA 1EXMA 1JEDA 1CI3M 5B30A 3QXJA 1KD1C 4YCVA 2ATXA 2H17A 5J3BA 1W1WA 3F5FA 3TMKA 5FOUA 1TL7C 2HEIA 2GZDA 2CMKA 3AKDA 4BLPA 1LUZA 3CNLA 2JJ8A 4A76A 2ZUCA 1FTSA 2VTKA 3MGCA 4Q9JA 4MGIR 3ADDA 1JPJA 1ODFA 5FFMA 1XD8A 2VH5R 3LY5A 3LVRE 4QBFA 2G9NA 4TQUS 2L15A 2EVBA 2ZI9A 1G3RA 4DAMA 1KMHA 2BEKA 2CK3A 3H0GG 1OH6A 4A93G 4MUBA 3LQRA 4DK0A 2A68D 1EUJA 3PF4A 1E79A 1CSQA 3THYA 1SMXA 1W46A 2OE2A 4Y0AA 4W9MC 1LW7A 3OIVA 1PH8A 4BUJA 4TL9A 4ACBA 2FEOA 1Q21A 2WJGA 4NE2A 2JLUA 2EU8A 4RZXA 4KKSA 1P62B 1QUQB 4XH9B 1DAIA 1RRGA 3SU8A 2R92G 2N49A 1KDPA 4A3FG 1F2TB 5K36H 4LNQA 1OT3A 4CZ2A 5IWAL 1M1YE 1JE5A 3HOYH 2I1VB 5AUPB 5HZHA 4ME3A 1IN6A 5TXGA 2QENA 3BU2A 1XMQQ 1BMFD 5CLLA 4ZDKA 5JI2E 4DUGD 2RGDA 3PSIA 5AJ3L 4UP8A 5HE9A 2ZRPA 1KI6B 2Q2TA 4A8JA 1G6PA 1D8LA 3KFXA 3OFND 5FI1B 4QKQA 2AFHE 4G5SA 4DKAC 3QKTA 5H68A 1CTQA 2WHXA 2QBYA 5IYCH 4RFVA 4GN5A 3TUZC 1E0JA 1XEXB 1UJ2A 3KDSE 3D31A 721PA 4P31A 3CW2A 3MJHA 4PC3A 4AD8A 3K0CA 2J41A 5J40A 2ZYVX 1FQJA 3KF8B 3HDTA 3PQCA 4U02A 3LBNA 1LS6A 2D3WA 4XTRA 4GOJA 4OQLA 4PPFA 4TYWA 1VCIA 1W36D 1IAQA 2WAQG 3LQQA 2CLDX 4EQ6A 2A5YB 2GXQA 2JASA 4ZV4A 3B5JA 3GFPA 1GG2A 1NSTA 3RS3A 4A0GA 4RCZA 5JEAG 4HEJA 3GJXC 2UVQA 1GKYA 3J80c 2IEYA 1UEBA 3BB1A 4KI0A 3O8RA 5FLMH 1N5LA 5DIFA 2E5LQ 1L1OA 1JQLB 3M4OH 3WNBA 1T0JB 3F2DA 1W49A 4KODA 3LLUA 1GUAA 4Z8XA 5EUMA 2BM0A 3TSZA 4JLKA 2GF0A 1TU2B 1IHUA 3T1YL 2DFNA 3QJYA 3W34A 1GP2A 2UU9L 1KZ7B 1CJTC 3BC1A 5FOTA 4JI0L 1YU9A 1QG2A 4B3RL 5M5YH 1US8A 2CBZA 4IFBA 2C9CA 1E94E 3LX5A 4M9ZA 1WCMH 2WJJA 3DVLA 3UMFA 3ADKA 2P67A 1RZ3A 4OONA 1RYHA 1WF3A 1B8AA 1YIJA 4US2R 5L3VA 2D0PA 3CBQA 1JPNA 4Q4HA 4V0LA 3QUSA 2G0TA 2W2XA 5GROA 4K0KQ 4CRWB 1YZGA 3CPJB 2ZSEA 1N33Q 3GEIA 5SZJA 1XTKA 1CSPA 3HPRA 1XNQL 2WVJA 2R7ZG 1L0WA 3JC66 2PCLA 1Q8KA 4C3IH 2X1VA 1PVOA 5L3RA 3ZS8A 2JLYA 1NJFA 3CW2C 3RN2A 2IHFA 1QVGA 1OYYA 2AL7A 2E9SA 4M4SA 4NCIA 5C18A 2BCJQ 1S1MA 4M1MA 4QC2A 1COWA 1JR3D 4YMVA 1DEKA 1UKEA 2OESA 1XZQA 4PAOA 4JJZA 1DADA 1GRRA 2QA5A 3W6OA 1K8MA 1ZM2A 3SGIA 4B47A 2XB2A 2IXFA 4LX0A 3K70B 2KJQA 4N1AA 3FKQA 3KKNA 4LJ9A 1N6HA 2OILA 2CCZA 3RS7A 3J7ZC 4YMTA 2QE7A 5JS7A 4AK9A 1LTLA 3EPHA 1Q81C 2BE5D 2OCEA 1TMKA 2QRZA 4NZYA 5EP4A 4A1FA 5FPSA 1CEEA 4BBSG 3T56B 4DSNA 4JSYA 3NHAA 5B64A 5DSZA 4TT3A 2ZTDA 3AV0B 3PGZA 1B0UA 1C0AA 4PXAA 3AKEA 3A8TA 4DLRA 4LYFA 1MOZA 2DYKA 2FU5C 4GLXA 4Q7KA 3REGA 2OT3B 1KNQA 1UPTA 2BBTA 1S40A 1GOTA 1L2TA 1ZM7A 4QHTA 4A2PA 2JEBI 2QAGC 3UG7A 4AG6A 2HQLA 4EFLA 3OIWA 2HYDA 4BFVA 2KCCA 4WA7A 5JJKA 1Q46A 3HKZE 5GADC 4DV3Q 1CU1A 2VSXA 1Z6GA 3NTUA 4P3YA 3UXMA 4DCNA 1IM2A 3NG1A 2J7PA 2I5MX 1XPUA 1EWQA 1J99A 3CCUA 4PHHA 1ONLA 3IKJA 1E6CA 5HGQA 1JQJC 3GTQH 4DR5Q 2GWHA 1S2MA 2E87A 1WCV1 4GT1A 1MJEA 2ZU0C 3TSOA 3J7A5 4KLKA 1NG9A 2JA7G 4DK3C 1R9TH 1GNPA 2OZEA 5JJLA 2R6FA 2JJ1A 3ER0A 4CT5A 1W2HA 2FJUA 3GJ3A 4JKIA 4HJ5A 4WXPA 4YWLA 2FPLA 1KI8A 4TLCA 2OUKA 4MGZR 2VA8A 1C1YA 3X1DA 4DUGA 1FZQA 1ZD1A 4CYMA 2RF4A 5GADl 2Q21A 3LV8A 1VG0B 1HUQA 4RJLA 2BA1A 2R62A 4RZ2A 3VNVA 5IWAQ 2OWOA 4D25A 1XZPA 1VKJA 4Q4JB 2GBLA 1SLJA 1JBKA 4IVPA 1DAGA 3WMEA 2B92A 3HP1A 2ZE6A 3DHWC 3A58B 2WOJA 1SXJB 4Q1EA 4BFXA 5IYBH 1Z28A 5IE8A 3VDYA 2ZRHA 4S2EA 3SFVA 2G0NA 4DT1B 2A78A 1KAOA 1HCZA 2X77A 1HE1C 4DV2L 5K8IA 1NLYA 1WI5A 4LF9L 1ZW6A 3L0SA 1HQYE 1N6KA 1Z47A 2F1JA 2NPFA 3JVVA 3R20A 4QM6A 5EXXA 4YWKA 4YY3Q 2P0EA 3M1IA 3B82A 3QG1A 2BMJA 4B6FA 3LO5A 5J5CA 2N3SA 3HOVG 1N6IA 2JATA 5G3ZA 3EA0A 3EZFA 4YONB 4OI0A 5EXSA 3PUVA 3GLFE 4TL7A 2FEMA 3A36A 3OEEA 4QJ4A 4DWJA 2V9PA 1NN0A 4F4IA 5IK2D 1HNXL 5JZVA 2BBSA 3CM0A 1GAJA 4ZDIA 1SROA 2EIFA 4QL3A 2DFTA 3NHBA 4I1SA 3ZLJA 4KBFA 4CEIA 1HZAA 3SR0A 1T0HB 2Z6KA 3S15H 2ZTSA 1E2NA 1R0WA 2F3RA 1B7YB 3I1FA 1SR3A 4B76A 2OCAA 1D2NA 5LBIA 1XD9A 5GJBA 2JK8A 2JLQA 4I99A 1FNNA 3Q3JB 4HJ9A 1SKYB 2PCJA 1EIFA 3S2DH 3AF3A 2WMNB 3V4FA 4LV6A 2WAXA 4DLYA 5E4FA 5JCZA 2Z0SA 3THXA 4UNSA 1XWIA 3S2HH 3P26A 2XTMA 3SEAA 1W4CA 1H95A 2ZSDA 2ZITA 2VS1A 4H0LC 2EWWA 421PA 4DLZA 2WWWA 4M1OA 3I55A 4NP6A 2LSSA 1R0XA 2IYWA 4DLXA 1TTTA 2YOFA 1U0JA 3FGNA 1HNZQ 2OQKA 4JYCA 1EQQA 1NMZA 5A5GA 4Q7MB 5C2JB 4URYR 1NNEA 2MQHA 3CAMA 4BFSA 3LNCA 4QGUA 4WJ4A 1XTIA 3TNFA 1DPFA 3LW8A 4GP7A 2RGEA 2D0OA 4WZBE 4AKEA 2XTNA 3TEHB 5GAEC 1BIFA 4HJAA 4GNXA 3T1YQ 4NMMA 4GL2A 1X55A 3RSOA 4B32A 3SDZA 1F48A 4Q19A 5FR1A 4UP7A 1E1RD 5B58C 1E0AA 5DYIA 2IX0A 1KHTA 4CF7A 4Q1FA 1AS3A 1M7HA 2H7VA 1PH1A 3KB2A 1KXLA 2JA8G 3AF2A 2WJYA 4JYAQ 4OQNA 4EJSC 4FWTA 2Z6KC 1A4RA 5GJVC 3EPLA 2W6JD 3TRZA 4DK6C 1SHZA 3PUWA 5ELNA 5IT9c 3I32A 1QZHA 5IP7H 4DLWA 1P75A 4R4IA 1HR0L 4LF4Q 5LB4A 1YKSA 2KHIA 3JAMi 2HXSA 3FOZA 4JK1C 3RZDH 5C3EH 3OW2A 1Z07A 3GMTA 1AKYA 3GP8A 3NENA 3I4NH 3PEUA 3Q7QA 2RCNA 1NY4A 1VG8A 6Q21A 2Q2HA 1M7BA 2RHDA 2QSYA 1U9IA 1VQ5A 3ZVLA 1D5CA 3PO3H 1XXHE 4KBGA 2JCSA 4Q66C 4F7WA 2WTUA 3HOUH 1VYTA 3FKSD 1RFLA 3UWKA 2JE6I 4A36A 3CX6A 2H92A 3DDCA 3PIPA 4Z54A 5J47A 1LB1B 4ZDJA 2JEAI 3THOA 5LDDC 2VHUA 4YHHL 4NYMQ 1JNYA 1N9WA 1NG1A 4JI7L 2XOKD 3WXMA 1G64A 3OE7A 4CDGA 3M0EA 5E7NA 2IUUA 2JLZA 4H13C 1W4BA 2OLKA 5E7IA 5KSPA 1A63A 4P4TA 3M6AA 5LMNQ 4TMTA 1E24A 4LGMA 2O8DA 1N36Q 1CR2A 4KLZA 4UXHA 2OAP1 3SJCA 1IBLL 4JI2L 2WSSA 4HUQB 1GVPA 3I4MG 1GFIA 2QORA 3NXSA 4D4LA 2O8CB 1ZCAA 1BBUA 3WNCA 4G1UC 5AUOB 4JVMA 3QF4B 2QAGB 3S1NH 1VQBA 3K1JA 1E9RA 4TMKA 3N6RA 1UE5A 2JA6G 2HT1A 4A4DA 1JJGA 4EPWA 2CHGA 1S4QA 4DR4L 1TX4B 2V7QA 3WYAA 2DGYA 1XFAA 1C7YA 2DHRA 4JI1L 3OTOL 2G3YA 2KHJA 1O78A 1VQ7A 2K33A 1RL2A 1E9EA 2CCJA 4PO8A 4KITB 3KF6A 5FTLA 2XXAB 4NB3A 2H57A 2PI2E 1J70A 2V8OA 4MRRA 2BKUA 1II9A 3A5ZB 1NKSA 2OCBA 3MWJA 3R9XA 5CDFA 4UPAA 2W58A 4WAUA 2A2ZA 1TQDA 4B3ML 1SVWA 1SN8A 4Q9HA 4QM7A 1DVRA 2OXRA 4DUZL 3AQ4A 5IYBG 2XNDD 4L15A 3W8RA 3CONA 4NHOA 4P0TA 3EASA 3H2YA 4IOLA 1B9NA 1OXVA 2ZVQX 3QVUA 4OO1H 2R93G 1D2EA 4IXNA 1EESA 4PV1C 1PJRA 1W0KD 2Z4SA 1W36B 4JVSB 1N36L 3KQUA 3EPJA 4MNOA 3FHWA 4KYIB 5EXTA 3OYYA 4DCVA 3U58A 3TW4A 2ZJ2A 3X2SA 1U9IC 4IDOA 2GF9A 2ZYUX 4DLSA 4LF6Q 4I4LA 3C7KA 3LRPA 1JJ7A 1E3MA 1S8FA 4HAYA 3BXZA 2D4HA 4QJ5A 1DELA 4HZUB 2FF7A 2ZPTX 5JFGA 4A2WA 3F2CA 1G3IA 4HDOB 2EFGA 1JR3E 2XX3A 4MYUA 1SGWA 3Q5DA 1PA6A 2ZYWX 1AIPA 5FTNA 3QXHA 2PEYA 3RR5A 1UDXA 3MXNB 1T3LA 3RWOA 1VF7A 3VAAA 4OJQA 5DI3B 3DLLA 1VQ4A 4M1KA 2W2TA 2CNWD 5C4JH 4CEIB 4L9WA 2Q8IB 1CP2A 4TTPA 3N2EA 2R6GA 1L2FA 2FGJA 3SN6A 3GTMH 3QQ5A 4EJSB 1MJCA 4O0MA 4ESHA 1J5EL 2WWGA 2YNMA 4A6PA 1DD2A 3UK6A 1A62A 3WRYC 1WYDA 3K9LA 1VECA 2QROA 2WV9A 1NBME 1KKLA 4DXAA 2PQAA 1EGAA 2NTYC 4G01B 1HTPA 4GOXA 2N42A 3FKIH 5M5WH 3R9IA 3G0HA 2MNAA 3U7FB 1CUKA 1UBCA 3QI2A 3LWUA 2ZJ5A 4GFDA 3ADBA 1DG3A 4OWWB 3DM5A 4XTCS 1KO8A 1A5TA 4RFSA 2O8EA 3A4LA 1E2ZA 4OWXB 4GOPA 3JAMc 3HR7A 2Y0SG 4LHXA 3GTJH 1OFTA 1PUIA 4NCJA 1I50H 1YHAA 4QHYA 4RKFA 1VQ6A 3J81c 4EUNA 1AM4D 2UUCL 1OXXK 4UP9A 2ZTEA 5FBRB 4WW0A 3RS0A 1UBEA 1QVCA 2J9RA 3BH0A 3Q85A 4HUQA 3ZGXA 2OFOA 4NYMR 1SMYC 2CVFA 1ZNXA 3W5IA 1SXJA 2F9MA 3AF4A 1J7KA 2F7SA 3JZMA 4JVLA 4BXXH 2D5DA 1LFDB 5M3FH 2F52A 2R7ZH 2MSDB 3HU2A 4GNXB 4PZ7A 4DR2L 2IYTA 2QZ4A 4QOSA 1G18A 4OWTB 3RSLA 1R10A 1IXSB 1XD2A 3L2OB 5CIQA 2XXAA 4DR6L 4XSHA 3ETLA 4R4QA 1N3BA 1UDWA 2G77B 3ZH9B 4EX5A 3AUXA 5HCNA 4ARZA 2O0JA 1VQPA 1G4UR 1N0UA 4NYIQ 4JBKA 2CHVA 5J4HA 4KN4C 5KYKA 3DXJC 1E96A 1IN4A 3IEUA 4A3IH 3F2BA 3AVOA 1UAAA 1CXZA 2NMVA 2GVZC 4NCNA 1WQ1R 1CKNB 3PO3G 2RGCA 3GJ6A 3CR7A 4LV8B 5D3MA 1XMOL 4RCNA 3SZRA 3HOUG 2ORVA 4JI0Q 1Q3HA 2QGZA 3KX2A 1E1OA 5KSOA 1CFMA 4A3JG 3IO3A 2CXXA 4F4JA 1R0ZA 5DN6A 3KYHC 3CO5A 3NBYC 2AK2A 5FPKA 4C7OB 2BDOA 2IWHA 4BASA 2CW0C 4LFCQ 1J8YF 1NI3A 2J3EA 3GPLA 2VRWA 1IN8A 1E1QA 4A3EH 3NDPA 2UUBL 3IBYA 5HTKA 1VDZA 4HAVA 2WWXA 3GJ5A 2WJVA 4M2LA 4YDHB 4P4SA 2OSBA 4JG2A 4NXNQ 3VR1A 1ZD8A 3RABA 2KB0A 3KTAA 2R65A 4LJ8A 1E2FA 2P6RA 3S1QH 4AYBE 1TWHH 1Z6YA 3L0PA 5EUQB 3VR5A 2O5JC 4OHWA 4D80A 1TQ4A 3DZ8A 4DV5Q 1QZGA 1R6BX 3Q5EA 1NL3A 3U3JA 1Z7TA 1ETUA 1YHBA 1N8RC 4QBHA 5GVSA 3B1ZA 1EQRA 1Z0FA 1Z0AA 2DFLA 3D7MA 3WBKA 4MGKR 5HPYB 2BEJA 2MSEB 3FE2A 1QRAA 2W2VA 4C2MH 1YJWA 4DDUA 2G1JA 1MIUA 1H9KA 1HNZL 2AKWB 1CS4C 1HH4A 1Z0DA 4B73A 1GIAA 2WWYA 1OJLA 3IFTA 4L8JA 4B3TL 4Q9KA 1FNMA 2QF7A 1YZ6A 4YWMA 2ZAMA 3LVQE 3U61B 4M22A 2ZU6A 3ND8A 2PZFA 3U9SA 4U5XA 5A4JA 1OH8A 2VHTA 5JRZA 4A3GG 1Y8PB 3VKWA 2BM1A 2K5VA 4EPXA 1DAHA 3KF6B 1ZUHA 4TYPA 2P5SA 2B8GA 2EFCB 3A1WA 4KYUA 1OXSC 1X65A 1Q20A 1X3SA 3K0CC 1BVSA 4GOPB 3G48A 4BFWA 1W48A 3TIFA 4MA4A 1Z2AA 1OYWA 1XEWY 3EIEA 4IKEA 4KSBA 1VQCA 1N0WA 2HCBA 4Z51A 4B2PA 5FUXA 2V6JA 3CLVA 4CVNA 3IGFA 1S72A 3FHTA 1SKYE 4ERNA 3VU9A 4TSFA 2GK7A 3SS8A 4L4UA 3IEVA 3OZXA 5IRCD 3L2PA 1F2TA 1BO6A 2N1BA 2VF8A 4I1UA 2CKZB 1WDTA 4IFDH 2GVDC 4C2TA 1NMFA 3W9YA 1YZNA 2V4DA 2Q2IA 1GNQA 2RGBA 3MSXA 4AYXA 1E99A 2ZRIA 1ZBDA 2K5HA 2HLDD 4Q21A 1S3SA 1HQMC 2IF0A 5EP3A 3P1JA 1DXMA 4ARZB 3BRWD 2IYUA 1F2UA 2DWPA 1KI6A 1OHHA 3FMIA 3OF5A 4A8JB 2OLJA 3UMSA 1V8QA 4LUOA 2VSFA 4JYBA 2GCOA 4Y52H 1EIYB 3NWJA 2ERXA 3KJOA 2LMCB 4C0JA 1XTJA 2L5TA 4LJ6A 1IXRA 2QBYB 1PYBA 3S1MH 1XEFA 3KFUA 3T1TA 3QF4A 3U44A 3RS5A 2ZJYA 2AUKA 1KC8C 2GA8A 1VIYA 5CIWA 1GVNB 3IRBA 1ZU4A 3AEVA 5TB5A 2XOKA 2WJIA 1IBLQ 3FKIG 3QKUA 4BFUA 3HOWG 3RNLA 4ILEA 4DR3Q 4LF9Q 1FPMA 1P4SA 3MWKA 1AA9A 1KRSA 5IY0A 2ZE7A 3W3ZB 4HDCA 1RKBA 1WOCA 4LF5Q 3Q8XB 1E1RA 1J5EQ 2GXUA 5AK0A 3K0XA 1CTMA 4R4CA 3H0GH 4XWOA 5FLXc 4A92A 1E2VA 3F8TA 1TWCH 1E2PA 4QJFA 3PJRA 2XEXA 2HT6A 3EX7C 1IBKQ 1L1OB 2NVTH 4POFA 3ERSX 1NLFA 4P32A 2PZGA 3HYTA 4GPTA 4A3KH 1GJXA 2QM7A 4MRNA 5KDLA 4HLCA 1CJKC 1NBMA 2I4IA 1GSIA 2D2FA 3K8YA 2E76C 3CRVA 2HYIC 4XVUA 2DB3A 1GUSA 4XIGS 1XPOA 4GBMA 4V0NA 3CF2A 3AGQA 5KDDA 2IS2A 1VYUA 4X64Q 4LF6L 1SVSA 1YBYA 2BIFA 2F3TA 3GJ4A 1KY3A 3KXLA 4CEHB 1XJ0A 4KU4A 3F1ZA 1E2KA 3AVXA 1GTVA 3EZ9A 3PO2G 2PCFB 2I1QA 2B7BA 1N0VC 2ZRJA 1IW7D 1LTQA 1FOEB 1G9XA 4EPYA 5BYKA 1E22A 5AUNB 1W47A 2IYYA 1R5OA 1TF5A 4IHQA 4LYAA 1E9BA 4DPGA 3FMCA 2JIZD 3FMFA 1G7CA 2NVYH 4A3MH 4KHPL 2N46A 2YV5A 2GJAA 1ELOA 2R6DA 4LFAQ 2JJ1D 1A0IA 1VCMA 2BJWA 1KTVA 2UXBL 1NVVR 2BBOA 4IPGA 1NN5A 3CZQA 2QMHA 3AVVA 2QT1A 1YE8A
chains in the Genus database with same CATH superfamily
1EFCA 5F35A 1NF2A 1DLJA 4PYOA 4EAQA 3UPUA 3N0VA 4MB6A 3TAHA 3J81k 4U00A 2JI6A 3CRQA 3R5XA 4CLRB 4FNOA 2DN8A 3TREA 1TPYA 3EXIB 2OR3A 3KLMX 4FFMA 1ORWA 1U2SA 2OSVA 4ID9A 4KDCA 4LHZA 4PFQA 3I1JA 5COQA 3SHVA 1Z5VA 3EZ2A 4EDHA 3CKLA 4O0AA 3CCMA 1JX6A 1NW3A 3N8KA 3ZWOA 3ESQA 1KEEA 2QSZA 3IBCA 2O0MA 5K3FB 3K0HA 1QQTA 4LBWA 2DQKA 1EKXA 3DVQX 4NSNA 2GFHA 3GRRA 2YTYA 3GQBB 3WK6A 2GZ2A 1B1AA 2O7QA 2V65A 1HLPA 3UH0A 3WV5A 4W5WA 4FSDA 4ZIRA 2GTPA 4PAQA 5B1SA 3A8IE 5THKA 1GNSA 1RC8A 1CHDA 3KAPA 1WE2A 1AQYA 4B3BA 2UZ3A 4LYDA 4XGRA 1LBHA 1AG9A 3RU7A 5IPFA 2X5OA 1QZTA 2W6ZA 3CB2A 4DA7A 3SLRA 4YPOA 1CQJB 1D9ZA 4KXMA 5AHRA 2FW7A 4TKUB 5TDHA 3SG0A 4CMEC 4DA0A 4RJJA 3GLIE 4DLKA 4DUYB 4FWBA 5HX7A 1FNUA 2N8NA 2Y0CA 4J9VA 2NB0A 4C3HH 1T5IA 4A0FA 2A5JA 3V1YA 4Q9NA 1CUSA 4PMCA 5DTQA 3UFXA 4CIXA 4EGSA 2FEWB 4DV4Q 5C1BA 4A3GH 4H7DA 1EFKA 2GPSA 2R92B 3ZI7A 2RBMA 1EQUA 4TQ9A 2RHWA 1MKYA 1NQAO 3V2IA 4K6MA 1PQYA 1W2WB 3KKQA 2F4VL 4NFSA 4PW0A 4NPCA 1R1DA 3ZZ1A 4RLFA 4UUAA 3FPKA 3SEZA 5BWLA 4EHLA 3DHNA 3TLCA 3HI4A 2P2NA 5IIFA 2YMLA 5FBVB 1CR4A 4DADA 1YQXA 5TT0A 1GD7A 1F0KA 3M5WA 1XJ5A 4QQ8A 4BDTA 4G2TA 3KXPA 3L02A 4UM9D 4DMFA 2ZAGA 2VW9A 2UYGA 3KSDO 4UPDA 1CJCA 4JI4Q 2QUAA 5FKAC 1CKNA 1VJGA 3IP8A 3V5NA 1GPNA 2FW0A 4CU5A 1QJCA 5I9SA 1NWHA 4GVPA 3FOZA 1YVDA 3NCHA 4IDHA 5CX1A 2BI8A 3LPMA 1L5HA 4BIMA 3ZXUB 2JAQA 4I14A 1JHQA 5H9VA 3VJLA 2JAPA 4KQIA 4NICA 5M5XB 5HCIA 3VH1A 2B9EA 1OH5A 2HMUA 2JKYA 3FSGD 2FG6C 1QNUA 2ZJBA 3P52A 4BWVA 1MMFB 2Q7OE 2D74A 2IELA 3PHHA 4JI5Q 1YS6A 4PYLA 3RUIA 2BGMA 4JJKA 2UDPA 3ROKA 3ZHCA 5KUTA 1UC4B 2WU1A 1BHO1 2WAMA 4IYJA 3UJ7A 4Q15A 3U4VA 4PIPA 4WKGA 1FJ2A 4H7HA 4WADA 3OOCA 3PHCA 4HEA6 1MR3F 1RCUA 2X8BA 2VB2X 2EW1A 3LWDA 1M54A 4KQCA 4MWGA 3GV6A 1PGJA 1O6BA 4F72A 1U1IA 3ZTWA 4C6SA 1L8AA 3DAHA 3TZBA 3BGIA 5IVKA 2QGFA 3HP3A 1YQTA 2AFRA 2C58A 4B34A 5HOEA 3G85A 1BS1A 1F2UB 1WZCA 2JEZA 3GELA 3R8FA 1WM1A 3R4CA 1H9SA 1G6KA 1XXHA 3B3JA 3T5DA 1WA5A 1SC4A 4U7DA 4QFCA 4X85A 3DBHB 1IYJB 4H1VA 4W5TA 1WTXA 4J0GA 1PKXA 4WGGA 4YRTA 4L5AA 5CV9A 3Q7PA 4M1YA 1KEZA 3DWPA 1HX7A 3OUZA 3SE7A 1WHTB 4QFBA 3WS7A 3BIWA 1WKBA 4HB2A 3IDOA 4DSTA 2Z9CA 4DBLE 2G67A 3C4QA 3VR5H 1A7UA 4GLVB 3R6WA 3VFDA 2O4CA 4DK1A 3GTLH 2NAFA 2V55B 4R8NA 1ZN2A 1I6HB 1JFVA 3KPVA 5CDUA 2Q5JA 1FP6A 1QNKA 4UHEA 1VE9A 2Y93A 4ZI3A 5HGTA 4UUPA 2JIPA 1I4HA 5LHY1 1LI5A 1AO3A 2P5UA 2J9YB 2IUYA 2KEEA 2VDNB 1Y1VH 1WD0A 2BH2A 2CHFA 2QVCA 3RD5A 2IZ6A 4RKQA 5J58A 5E4WC 3GXOA 3L82B 3HSSA 3THXB 5BWOA 4WDQA 2W83A 3WNVA 3DAPA 1HNNA 2HBYA 4BKOA 3T4AC 3DEFA 3GX1A 4HNSA 2HBQA 4Z4CA 3HO1A 2EJGC 3URYA 4K87A 5JSKA 5I7RA 4RTMA 4ZCQA 2D2EA 4CR6A 2ZYTX 2C3UA 3OC6A 3IEMA 1SUFA 3SE0A 1N32L 1ZVMA 3SOZA 3PEWA 1AN0A 3BTUA 5EIFA 4A3FH 1WL8A 2HN9A 4L6AA 1SC1A 3ZDZB 4FMCF 1VIAA 3GUVA 4G41A 1L7OA 1DPGA 1V3TA 4K1XA 2B29A 4PSKA 5K7SA 3MBOA 2WD8A 3WB2A 2E37A 3F3YA 3LD9A 4H7IA 4B45A 3K2IA 1HDIA 5DU2A 5FUYA 3X43A 3GJYA 3H6GA 3HJTA 4G1FA 3HOUB 4WORA 1UP4A 3TZCA 3ZJUA 1CUDA 2AWNA 1KOFA 5CAEB 1I1NA 5JZSA 1C81A 1POWA 1SCIA 2VRNA 3H2IA 4KFTA 1UMDB 1M5TA 4GZYC 2I33A 3L77A 4BMSA 4PN3A 4ZRZA 4H02A 1DKQA 1UXJA 2HGSA 2HNKA 3L43A 4Q3EA 1S5BD 4YQEA 1FS4A 2IW3A 1B8OA 5EKKA 1V9PA 2GJ8A 1YHZA 4DJEC 3WMGA 2QRLA 5ICSA 1QYRA 2P69A 2C96A 3MSCA 1IL0A 4F92B 3HCCA 5A2QL 2VLBA 2J46A 3R6LA 4WZAE 1AD2A 1Y3HA 3CEMA 1A2KC 3GL9A 3AEUA 2G5GX 4XSVA 4PZ9A 2V4MA 3C6KA 4ITUA 3U2QA 3WLQA 3ICOA 4P75A 4XYBA 4BWFB 3IX7A 2NVWA 3L0OA 5K05A 3FTPA 1XB2A 1CA6A 2DTDA 4YRRA 2UXBB 1G8ZD 2MHVA 1BN7A 2XTIA 3KQVA 4AB1A 2GJKA 3CWQA 2MUYA 1UAPA 4LJ5A 1RCVD 3L8HA 5TVKA 4DCOA 3HJRA 4DY4A 4B3MB 2KBFA 1G291 4O2LA 4Q02A 1ZSNA 4TMZA 5BSUA 5JC1A 3KCNA 1W73A 3EBEA 2GJSA 1HRJA 5I45A 2B4KA 2WABA 2VH2A 3FRJA 4G7HC 3O94A 2PAAA 4RQTA 2GEBA 5GINE 3I04A 1P8JA 1E1NA 3QVGA 1FQWA 2I80A 1Z7EA 3IA7A 4G3XA 4JUDX 1EG7A 5CJPA 5CVJA 4B4VA 1YE3A 5AVKA 3Q23A 5D14A 1C30B 3ROQA 2P78A 2VWPA 2AT1A 3OFKA 5E6RB 1IUOA 3DH0A 4PTLA 4L75A 3W1GA 4EYEA 1PH2A 2XDAA 4AF8A 2GAAA 3FFAA 4YMIA 2C2XA 4TLDA 5ALFA 4MEJA 3QXGA 1N5IA 1G8JA 2XQGA 3K73O 3QENA 5D3QA 5EOVA 4C1NI 4J76A 5EY5B 5F1OA 4GKKL 1SXGA 2G0AA 3K15A 3VYUB 1ZBQA 3ZVRA 3FKJA 1H05A 4J7UA 3AX6A 4OJKA 3H65A 4IFEA 4YP6A 1R4MA 4OHBA 5IAJA 4C5CA 4MPJA 5JAUA 1IHPA 2PZUA 4N65A 1NTOA 3B5EA 1IZYA 1SU6A 2O3TA 4J4TA 4W99A 4A5SA 1E89A 2PGNA 2CKMA 2V45A 3CRMA 1Z2DA 1B70B 1GQYA 3WOEA 2R8EA 3EMDA 3IEKA 3HXPA 4MNTA 4Q24A 3PUZA 1SXJD 2YTVA 2IZ5A 3WJ7A 5CYGA 3UFBA 2CXRA 2EWVA 4I5FA 2HUGA 1OF1A 2OOSA 2VJKA 2OPHA 4C43A 2HK7A 3P0EA 4EHBA 1OGIA 1G5PA 2C2MA 5HG0A 1Z8FA 4MUAA 4N8X1 4YCWA 4HIKA 1C3OB 1SFOB 2QGNA 2QUHA 3WHKA 4UDUC 4RENA 1SXJE 2HIVA 3G02A 4HQNA 3RV4A 4ZCTA 5EIWA 3CQZH 1DLIA 5KOYA 2V74B 1V43A 5TV2A 1NXTA 3PGKA 1HETA 2IPNA 2QRNA 4MK4A 4LJYA 3X0DA 1LT4D 2WWRA 3EQLC 1PJ2A 1RBMA 2ET6A 1QILA 3JZAA 1OROA 4V2IA 4XCVA 3PI6A 3TZ6A 5A7FA 4HN7A 2EQSA 3SVMA 3EVBA 1OI4A 2XCTB 1DFHA 3KDAA 4UHDA 3CC8A 3MJSA 1LC0A 4NONA 2OTCA 4P5DA 5D2CA 4PHTA 4EQPA 3VOBA 4HPJB 1AB5A 1E6KA 3QE4A 4EGJA 3TSSA 1QK4A 4NEHB 4W1QA 5E3JA 5EYPB 1FB5A 2SCUA 1PTOH 1WR8A 1KFKB 4IYRA 4JV5L 5G40A 2DNCA 1HRDA 3BGOS 1BJTA 2F1RA 2OWEA 3E3NA 4ZZ3A 2ZJQA 3UMRA 4A8PA 5C37A 3SLKA 3N2NA 1IQUA 4JHXA 3JVIA 4BNNA 2DHQA 2H06A 3TL3A 2CMHA 2YMPA 4MVJI 1DXYA 4IGEA 3HWRA 1NI4A 1N2JA 1CF4A 5CDYA 1TYEB 1PFQA 3U56A 2DF8A 3PCOB 1ULUA 1L5MA 5TQ0A 1S4ZA 2R7DA 1EZ1A 1HURA 4ZPJA 3M1AA 1SNOA 3MTBA 3R3XA 3ONWA 4QUIA 3I4MH 3CN9A 1Y6JA 3WRXC 1Q16A 1IZ6A 4NS4A 2KJXA 3AQIA 5M3MB 3FYHA 1STHA 1SBIA 1U9CA 1ESZA 3VA5A 1XRQA 3D7LA 3T3OA 2XUQA 1EUDB 3IJPA 4DC0A 3HFZB 4DQ0A 3N7TA 5T6BA 2WU0A 1WTHA 1J90A 4FC7A 4LC0A 3P9XA 3ZJYC 3ZLVA 1GZSA 3KUDA 2JRLA 2NU9A 3OZAA 3OPYI 3TFQA 1L5OA 1MT3A 3COWA 3JQRA 2WIBA 3TL2A 1DEHA 2CCGA 4KO8A 2OFFA 3UJ6A 3WICA 2WIAA 4B3FX 3NBHB 2HPZA 4Y2UA 5JATA 3W5HA 4E7PA 5M2QA 5C8ZA 3M70A 1RXSA 5B58T 5FF9A 2V6MA 1YA8A 4NBLA 4RH1A 3HCDA 4GS3A 5CVVA 2BFEB 3O7WA 3DW1X 1A8HA 1D9XA 2GERA 1RC0A 4IWNA 3ZDAA 1I9CA 3UAZA 3Q2KA 4UATA 5CNMA 2XY4A 2FV8A 2EFEB 1VJRA 1JZSA 1Q92A 1YWGO 1I01A 2UYYA 3QV2A 4TLLB 1K8RA 4RA8A 1NVKA 1KYQA 1TADA 1L5HB 2CL7X 4IH4A 4UQOA 4X20B 4XCQA 1RXVA 3PC6A 4OFZA 3OT5A 3HJHA 1T0BA 4BBPA 3EC1A 4TXJA 1N7JA 4PXYA 1CZWA 1GZVA 2CH4A 3A7LA 1W0JD 2TMGA 3LA6A 1UKVY 2BT4A 2X8LA 5AJVB 3WWEA 1SYGA 1Q17A 2WWIA 3H1GA 2BW0A 4R68A 4FO2A 1XMQL 3NO4A 4HLQB 3JYQA 3NP7A 3I34X 1T8RA 3L7YA 1U2RA 1Y42X 4K9OA 2WT9A 5DMXA 3IPXA 4PYJA 4TWIA 1DKLA 5IT4A 2FZKA 2I7XA 1ZYUA 2ZVJA 4BDSA 4D96A 4EP1A 4Q00A 8ADHA 3K5HA 3RC3A 3KM0A 4OO3A 5LWQA 1NLZA 4D0GA 2ORIA 5B3KA 1CYEA 2DWCA 4EEZA 1GZUA 3HSYA 3TJZA 4GNKA 3VBEA 2W6PA 1TS2A 4W6ZA 4X3UA 4MA0A 1VE3A 4LOLA 4UQPA 5EE1A 1K8XB 5IT5A 3P0RA 1EM8A 2PYKA 1PRTB 1NGSA 1IDOA 4ZGBA 3BZCA 3C8MA 1P0PA 1S2NA 1ZUNA 3R5JA 4APVA 5J4YA 1Y3AA 2EYUA 3UHPA 3GMDA 2D7CA 1Y6RA 5HMLA 2QN2A 3LY9A 4RETA 3L8GA 1TKWB 2VTBA 3SQXA 2WNHA 3FHCB 2N88A 2ZKIA 3EMVA 4CMIB 2FUG1 2YJNA 2QQEA 4X84A 2GF2A 4R01A 1S3OA 2PKXA 1RTOA 1NE7A 2OB1A 5M3MH 3QI7A 1RW4A 4MV3A 4FGZA 3KBOA 3GFTA 2Z9BA 5DISB 1DB3A 2XNJA 5T4FA 2H2IA 3WZMA 4KWIA 4P4SB 4KPGA 2TMKA 2K2WA 4A3LH 1D2RA 4KHPB 5LQSA 1NI4B 2HDNB 2VQFL 3WP0A 1NP3A 4JQOA 4ND8B 4TM8A 4B71A 1B1CA 3LBFA 3R93A 4GR9A 3ABSB 3PUKA 1D1IA 4B46A 4XUDA 5DNWA 2Z6AA 1UEJA 2B4YA 1ZQ1A 1GHTA 2G6BA 1QIHA 2PIDA 1HFWA 1PR3A 4CT4B 5K0FA 4A3DH 4U9UA 4S1WA 5J1SB 4ALPA 2KHSA 1SVLA 2ZYGA 1UFQA 2EZUA 3D3WB 4OI2A 2WB2A 1EM6A 1Z73A 1GZDA 2XUAA 5CBPA 1U4MA 1JAXA 2PJUA 2XTAA 4HI0E 2EYJA 4JFRA 1AQIA 1CY0A 2W4MA 4GSLA 1U1GA 4KQGA 4XWAA 1LZLA 3ZV6A 4EPRA 3A04A 4KX5A 3HR4A 4ER0A 1TVMA 1ZY2A 3IIEA 5CAEA 2VZAA 3H97A 1BQQT 5IGCA 3FBGA 2CSXA 1L3BA 1NIPA 1Q19A 3ELDA 2OAGA 4RE6A 4CKBA 5C5IA 1P6UA 4EY8A 4YP5A 3HOYB 2JFFA 5DM60 2HQ1A 2NZJA 4L2IA 3VJRA 1MAVA 4OK5A 4OIFA 2V7XA 2HOQA 4JLNA 3N2KA 1KYVA 1U98A 3AFQA 2G88A 4MVWA 4QULA 1OB2A 2ISCA 3B1VA 1B8VA 1AY0A 2GX6A 3ER6A 3L4BA 3M49A 4CI0B 1D5XC 3IUBA 4PWZA 3KDFA 3RUDA 2ZPUA 3X1WA 5K0BA 4X20A 4LBYA 2MTBA 4KJZA 4OXYA 3K53A 4Q7EA 1AQ6A 1C0EA 1NBOA 4U9IS 4DU9A 5KKCA 1U3TA 1CRPA 4LUVA 3E9QA 1KVRA 4AIRA 4BWYA 5BWCA 4Y9UA 3OZDA 3RC7A 1AZLA 2IUTA 1XNRQ 1PYGA 2XDQB 3LQ4A 4A3CG 3W4KA 3DZBA 4MV6A 1PWHA 1NTRA 1YQWA 4TZTA 2Q0HA 2W7TA 3MWYW 1ZJ4A 1TAQA 1U1CA 2GZ3A 4IDNA 2AI1A 3RWMB 3QOJA 1YK0A 3S28A 3I8ZA 4QBTA 5AMXA 5L51A 4X3SA 2VHQA 2EJFC 1W8IA 3RVPA 2F43A 4BAZA 1QPGA 3PEVA 2CH4W 1EFPA 1H65A 2IUSA 3C6XA 1Q1BA 3D8BA 1U4SA 3GLTA 2P0AA 2AX4A 3OKCA 1S8OA 3NLLA 1GDDA 4MH0R 4O5OA 3PICA 2GCOB 4G5OA 2OFWA 4MV9A 4CPDA 4P0PB 3VSBA 1LLUA 3FH0A 4E13A 5EESA 3USCS 4B35A 3MTSA 1QFSA 1LLRD 5D8DA 2J9XB 2XOEA 1ZK2A 4BP8A 1B1ZA 1P7CA 4NXML 1FTYA 2GNOA 2BELA 1HA6A 2QUIA 1YR2A 3EZ7A 3ONVA 3T34A 4G0PA 5BW5A 1GFSA 5C44G 1BKDR 3P0FA 4M8AA 4BATA 3T9AA 3SOPA 3UDXA 2C3YA 1F2LA 2QQGA 2YTZA 3PA8A 1EE1A 5GJCA 4L63B 3UI2A 1PI3A 3H19A 3T35A 3SAJA 4CL2A 1MRNA 1B44D 1AKTA 4ZT6A 5ICMA 1LPNA 1YNOA 4C01A 3C8ZA 4WLOA 4Z2YA 2R3ZA 1RE0A 3C14C 2A6HC 3UYKA 3GLHA 4PQFA 1T4CB 2VR1A 4DQUA 1V8BA 4KN8A 1ZSYA 1G4AE 1YZUA 2I6SA 3HJCA 4QBIA 3WVNA 1XVAA 3QUTA 5JXGA 1E9FA 4IHAA 4QUGA 4DHWA 2K5WA 1KZ4A 3CLSD 4B7AA 4BC1A 5BT8A 3CGGA 4MV5A 2WICA 2XF2A 4MI3A 3TLGA 2PRZA 4YAKA 1PTJA 1X7WB 1ENCA 4JUCA 1CM9A 1C0PA 1WXEA 2KCTA 1P9OA 3RZDB 2GKGA 2A1TS 4ZO4A 3OQJA 5FOXA 1HE4A 5FYDA 4ATNA 1U81A 3CPEA 4ME6A 2CLCX 4G89A 1G2IA 2UZ1B 3WGHA 1YHQA 1RM5A 4WOCA 4QCLA 1MO3A 5GM2A 3EPPA 1JJCB 2R1ZA 4DAYB 2K5UA 3FNBA 1ZOOA 5KC8A 1ILEA 3W8EA 2WOOA 1OKKD 5LBTA 2RD2A 1DKRA 2R66A 4IZHA 5DJ5A 3PDWA 2SKDA 2B63B 1FDTA 2WYWA 4LJ7A 1GD1O 1XJVA 3RS4A 4ULLA 1ND5A 4DSUA 1IIRA 1KHHA 1TMOA 4HLNA 5EAIA 4B3SL 1YJXA 1GRVA 2XZOA 1G19A 1H6BA 4ZJYA 3N2KB 2XMZA 3FBWA 1LEHA 1L9KA 3HGBA 1PX0A 2BMAA 1XJQA 1PZJD 1BX0A 2XJ9A 3H9GA 4D8WA 1GWNA 1DCTA 4H1TA 4MKGA 2PKQO 4IJMA 1ZJ6A 4BNXA 4EFMA 3I09A 1PZID 1F06A 3HJAA 2UKDA 3Q0IA 2Q45A 4KP7A 3KDFB 3F3MA 4H6WA 3KFLA 4O8CA 3ZVNA 1OFUA 3CD6A 4FNMA 5DGXA 1AGYA 4KK7A 2YWFA 4K6FA 1EFTA 1HL7A 5DGDA 1LDNA 2OBFA 3TKAA 5J43A 5KYKA 5DEOA 4LYGA 1WHSA 4O4HA 5I7WA 2IBSA 3GJQA 2BR4A 3KJZA 1JU9A 4KWTA 2DPXA 3SQOA 2FSIA 5HJ5A 1FGBD 3PXBA 1EJ6A 3E58A 1M90C 3ZJTA 1XYIA 3BB3A