4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
821PA 4AH6A 1WOCA 4PMWA 3EARA 3I4NH 1N6LA 3FKSA 4LCBA 4IFBA 1GNPA 4BLSA 3CD6A 4LHYA 3U2QA 1Q81C 3HYRA 5KTYA 1PFSA 2CW0C 2HIVA 5DN6D 2A6EC 3CCQA 1FVIA 3FP9A 2BEJA 2PBRA 1CULC 3VHLB 2K5VA 1VMAA 1LVGA 1NMYA 1IN8A 2MQHA 2ZRNA 3CNNA 5L3SA 4DSUA 3PUYA 4G3XA 4PSVA 4LFBQ 2WJIA 5FOXA 3ER0A 1QVRA 2BBTA 2F4VL 5CIQA 4PG3A 4AYBE 3TS0A 2RGAA 4FMDF 4B33A 1E1RA 2WSSA 3CF6R 1Q46A 1GKYA 1UFQA 3UG6A 3GEHA 3QG5A 4LJ6A 1TNDA 2P5TB 4BBRH 2AKWB 4HIKA 1F48A 1KDTA 5G3YA 2CFMA 4BBSG 3A6PC 1AK2A 4V0OA 2K5HA 1KC8C 1AIPA 2OAQ1 4PSAA 4ZI3A 1E2EA 1EWIA 2R92H 5DI3B 3KQKA 3A1UA 3HYTA 3T1OA 3LNNA 2VHUA 4DLXA 3ADCA 2ZM5A 4TT3D 4BRWA 4LYFA 2ZI4A 3EZ2A 3P1JA 3RS3A 1OFUX 4AYWA 2XOKA 2KCTA 1VKJA 5K8UA 4MTNA 1QVFA 1WCMH 1JXOA 4GOJA 4KFTA 4XVUA 4AKIA 4MGYR 2IYWA 1Y1WG 4LV6A 1FJGL 1OF1A 1XEXB 3ZS9A 2HXSA 1XTIA 2EJGC 3ND9A 3UE1A 2JA7G 2UXDQ 1M7GA 4LSGA 4YCVA 1S40A 1PA6A 1OTCA 3G82C 1E4YA 2JJQA 4JBMA 2GVDC 3HDTA 3ZZUA 2C99A 4YWKA 1OHHD 3HFZB 2ZVPX 3TAHA 3U3JA 4NYIR 3W34A 1ANKA 4CEJB 1N0VC 1D2EA 1WE2A 1RIPA 3SC3A 2VSFA 1I50H 3CRQA 1LABA 2CQOA 2OO7A 4WZAE 3L2OB 1KK2A 2FZLA 2VHQA 1Z8FA 1U5KA 1YHAA 2VP4A 4QBIA 4AG6A 4B3GA 4BY7G 5C0XH 4DEYA 2VUMH 1SMXA 2CCJA 3J7ZC 2VP0A 3CRLC 2RHSB 3RDPA 3SR0A 1KI2A 5L8VA 4A1FA 3H2YA 3GO5A 1N6PA 2EYUA 3T1QA 4EJSA 2NO9A 3S17H 1LFDB 2L5TA 4L16A 4Q9IA 3TQCA 3WDNA 1PUJA 1TTTA 4RG1A 2IF0A 1VQFA 3IO5A 2YINC 3BXZA 5IF9A 3QKRA 4LF9Q 3CF2A 1R0XA 4HLCA 4TSFD 4BWYA 1V1QA 2Q6TA 2H5XA 2ZRBA 1E1TA 1WF3A 1P2VA 3N70A 4URZR 3PSIA 4QRHA 1QHXA 3ADKA 4Q1BA 4C2MH 4FW9A 2J41A 1T91A 3Q8XB 3I5YA 4O2LA 1Z7TA 4XD7D 5JWRA 4JV5L 2OBMA 5FI1B 2B8GA 3KDFB 2ZSDA 4BBSH 3AVVA 4ZDJA 3B7GA 3QF4B 3CCRA 3AKDA 4I1VA 4OONA 4X64L 3FVQA 3VR6A 4CT4B 5EXTA 2DBYA 4LRWA 3U50C 5C2JB 2ZI9A 4E5UA 3GLIB 3D0FA 3NELA 1PV4A 4A93H 2QE7D 4YCWA 1S3OA 1SULA 4GBMA 4NCIA 3SYNA 1HQMC 4A3IG 1XMSA 4X8HA 1X6VA 2MSDB 4ZV4A 1NVWQ 4MH0R 3BERA 2ZJPA 3CONA 1W4CA 1BDOA 2XJ4A 2W6JD 1G7SA 4CVNA 2AFHE 2F9LA 2XB4A 1A2BA 4HZUA 2OFWA 3HPQA 4M9ZA 2IT1A 3KUDA 1Y1WH 2OCEA 3AF3A 2ANCA 5EE9A 2IWHA 3VFDA 4DUYQ 2XSZD 3A1TA 1M7HA 3THXA 3PGZA 3U3RA 1W4AA 4LV5B 5TVKA 4B48A 4Q00A 4GZMA 2P6NA 1QHIA 1GKUB 1G3RA 3VQTA 1P9NA 1ZM9A 2C35B 2VLIA 3O8CA 5M04A 1LF5A 5FUWA 3GLGE 1WYDA 3SYKA 4MYUA 3FKSD 4XVQA 4DLSA 1HY3A 3NXSA 3OW2A 4HUQB 1SROA 4BFYA 1OPXA 4LJ4A 1HNZL 4M1YA 2WWYA 4IOKA 2G3YA 1P7CA 3STBD 1K73C 1M6NA 3P4YA 1U9IC 4UP7A 2X19A 2D7DA 2JLWA 2HLDA 4R4IA 2FEOA 4ALPA 3CUEF 1KO8A 3SQWA 4KKTA 1P73A 3Q3JB 2YOFA 4M53A 3DLLA 4DAYB 2ATVA 3DEFA 4LZZA 4B6FA 4ZDKA 4RZ2A 1R5NA 2LXJA 1EK0A 4HAXA 4QJ5A 1E1RD 4OHZA 2WSSD 4W9MC 4GOPA 1FOEB 2ZJOA 3FFAA 1BS1A 3I55A 1HZBA 1WQ1R 3JZMA 3BB3A 1IQPA 3T1HQ 2HCJB 2RCNA 1E2WA 4KHZA 1DG3A 2BKUA 1GUOA 2Y0SG 2FN4A 2LKDA 3CP0A 2GRJA 5C0XI 1KSJA 3AH8A 5EE1A 4IOAA 1MO5A 1QG4A 2G1JA 1EUJA 3ULLA 5G40A 5L3VA 1XPOA 4X62Q 3KXKA 1VF7A 3WYGA 3UPUA 2MMGA 5FPHA 2FEMA 5GAHC 4A2PA 4YWMA 1RFLA 3K0CC 2XOKD 2CE2X 4A3IH 3U4QB 1NMZA 1SXJB 1NBWA 2VQFL 3JC66 4QBFA 2WJJA 1U2RA 3I5XA 4LF6Q 1DXMA 3DKPA 4V0MA 3HWSA 2IEZA 5E3HA 1OIWA 1Z06A 4P4SB 1JT8A 3FHCB 5KSPA 3O8RA 1T8TA 4DR6L 2W2VA 1IBLQ 4ZPXA 2QBYB 5AUOB 2IYQA 4MYHA 3A5ZB 4RCZA 4Y7NH 3K70D 4RMFA 1L1OA 2Z0SA 2Z6KC 1G291 1KZ7B 3RWOA 4CRWB 1VQ6A 3S1NH 1CI3M 2O0KA 3A4NA 4NTZA 3LD9A 3U3KA 4BXXH 3KKPA 2ANBA 4MZ9A 5M3FG 4KFUA 5C1BA 3VKHA 2OM2A 1ELOA 4PV1C 1JQJC 1CRQA 3CPJB 4I7ZC 2KBEA 4AYBG 2QROA 3CCSA 4DPGA 4MGKR 1IW7D 4A3KG 1H8HD 5M5YH 5FUYA 3ZIAA 1PH8A 3K7UC 3QXCA 2W6IA 1XCPA 2NG1A 4A0FA 3T51B 2RGNA 1YIJA 1KAWA 1ASZA 4OL0A 3BD9A 1FNNA 2A68C 1UE1A 1DADA 4C9BA 2D5DA 5GADl 3RSLA 3LLMA 4NH0A 4L8JA 2PX0A 5IT5A 4QGGA 1RYHA 5JLJA 1GJXA 4NPSA 2RH5A 2W00A 3IO3A 4TLBA 1DAHA 3WRYC 5E7MA 1CP2A 5BXQC 1YZKA 2JA9A 3T53B 4QIWE 4LFAL 1SXJC 1E6CA 2CL6X 2QTFA 4KU4A 4DSOA 5JJKA 3AVUA 3TVTA 2I0QA 4AD8A 121PA 4C7OA 1EIYB 4DBLC 3GFTA 3LXRA 4B3TL 4PZ8A 2BE5C 4JI3Q 1TL7C 4Q7LA 5IHPA 3H94A 1FFHA 1KIMA 2EFCB 3L0SA 1KI8A 2JXMB 2OQ0A 1XNQL 2VF8A 3PIRA 2DWQA 3EWSA 2FMXA 1XTKA 2IYLD 3C14C 4IXNA 4LJYA 4LK1C 4Y0VA 1G1MA 1YRBA 1E0JA 1U90A 1XMQL 1CR1A 2C9OA 2HV8A 4OHXA 3UATA 3I4LA 2ZTCA 2REXB 4YMSA 3CR8A 1BYIA 1UE7A 2CCKA 1HURA 4BZXA 4HB0A 2H17A 3OEHD 4YY3Q 2BBSA 4YWLA 1Q8KA 1HE8B 1XTJA 3PEUA 1OH8A 4PO8A 2XGTA 1HQYE 3AVYA 4Q47A 4LYJA 1C1YA 4HAWA 5TV2A 2OFOA 4GFDA 2PLRA 2GXUA 4BGDA 1W5SA 2NPIA 1IXSB 1G3MA 1PUIA 4MNOA 1P9RA 2X2FA 4TWZA 3LVQE 3DMNA 3AQQA 3E9IA 4D0NA 4RFVA 1KXLA 3NG1A 1LYLA 2MFIA 2HLDD 1DAMA 4W5JA 1DVRA 4C3HH 1OXSC 1J99A 5CB8A 4X66Q 2MO0A 1AGRA 3C5HA 4X8LA 4ILEA 4KN7C 5IP7H 4URXR 1IJEA 3K9GA 4N1AA 2I1QA 3GTLH 3NBZC 1N34L 1ONBA 1M8PA 3I92A 1BH2A 3GLFA 3REFA 4JSTA 4JS0A 2ZRIA 3BFVA 2AK2A 4DV3L 3TLXA 4JYCA 4AYTA 2GNOA 3NH6A 1E1OA 1D5CA 3L8ZA 3Q7QA 1IJFA 2BC9A 1SE8A 1SRUA 2IUTA 2VL7A 4QL3A 3PQCA 1MIUA 5LD2B 4V03A 4H1UA 2IYTA 2R6AA 3A8IE 1YQTA 2YVUA 5JEDA 2A3RA 1CFMA 2P3SA 2QQEA 3U4ZA 4JBYA 4RZXA 2K50A 3R9WA 4JI7Q 1VG1A 5FBRB 4QNRA 4DT1B 3BORA 2K33A 3NE5B 5JCZA 4OHYA 3HOYG 2CVFA 1GHJA 4JLVA 3QF7A 4P31A 4R2HA 4QM6A 2H18A 3CZPA 2XTIA 4Y0AA 4DAMA 2QY9A 1E0KA 3A4LA 3X1ZA 1HA3A 3NWJA 1MV5A 1ODFA 4KVAA 1UWVA 4TYPA 2V1CC 1ZYUA 1EQRA 4GPTA 1CKEA 1CR2A 1VG0B 2G83A 2P2LA 3KB2A 3HOZH 1LS1A 3K9NA 4B6EA 2GEDA 3QKRB 4G5SA 2DR3A 2D7CA 2V4DA 5TY0A 2OV2A 3TMKA 2F4VQ 1XD2B 3FWYA 4JLNA 2JE6I 5C4XG 1HR0W 3ZD7A 1R8QA 3A1WA 1M34E 3QE0A 4TTQA 2Z0MA 1QJOA 1G21E 5C44G 2ZE8A 4B76A 4G5GA 5EZ6B 1H8EA 1HR0L 3T12A 1SN8A 4PAQA 5E95A 1M2OB 3TKLA 3GLIE 1HH4A 1OYWA 4UNPA 5LD2C 2QN6A 1KO5A 2AN9A 4Q4AA 3QJYA 4A6PA 5JZVA 1CSQA 2OCPA 4Z1MA 3D6TB 2ZRAA 4FCWA 4ZIRA 2OG2A 5AJWA 2FE4A 5DISB 1VDZA 1IXRC 3CXCA 2IUSA 2PMDA 2ZAMA 1K5DA 3GTQH 4HIDA 1QHGA 2FPKA 1KI3A 1X55A 4JBWA 1Q22A 3ZGXA 2YOGA 2AL7A 1N25A 1FJGQ 2VQEL 1KMHB 2O8EB 5KPDA 4S35A 1ZAKA 1VQ8A 2FFBA 3DMDA 4K0KL 3PF4A 4FIDA 1GKHA 4C0AC 3MWYW 2R8RA 1I5FA 4IDPA 2OLKA 2JA5G 4MRPA 1K8AC 4EUNA 1EESA 2ZANA 1WDTA 2HDNB 1Q1QA 1DARA 3JZAA 4BFWA 4BFZA 4HLQB 4C0HA 4M8NE 4A3MG 3RZOH 3GLGA 3SBEA 2E76C 3F3YA 1Z6XA 4DR2L 4KFRA 3TQFA 3RC3A 4MRSA 4U00A 2X2EA 4B73A 2YWGA 5C0XJ 1QRAA 2JLQA 5F9HA 2E2JH 3QVVA 4DC9A 1GAJA 3C41J 5ELXA 1KDOA 3FMCA 4PC7A 3UK6A 2QP3A 4BZQA 1GDDA 1LS6A 3RLNA 2JATA 2PL3A 2HIXA 3U5ZB 2PH1A 3LGJA 2A5DA 4IJHA 1DEKA 1GHKA 4G7OC 4PSKA 2ZQ5A 1AA9A 5JMTA 2WFWA 1KY3A 5JS7A 4HATA 2YTVA 2YNMA 3HU1A 4KBFA 3GTPH 2GJSA 1CTQA 5J4HA 3ADBA 1LUZA 3VR5A 3S16H 1X3SA 2BDOA 2WAXA 4V0KA 4JV5Q 4G5QA 4XJXA 1XJVA 3GJ5A 3VTKA 3GPLA 5FPYA 2FF7A 1JNYA 3J81j 4F4JA 4KCGA 4X64Q 3V4FA 4PAMA 2HHHL 5FH9A 1WA5A 4QQBX 2GBLC 1TU3A 4QG7A 1N5LA 3KYHC 2DN8A 4L5TA 1S2MA 4Q1EA 5CYPA 2AWOA 4AIMA 3CCUA 4A3CG 2ZI3A 3NC1C 5FR1A 1I6VC 1CKMA 1NE3A 3KKQA 4B35A 2XJ9A 3OIYA 3DL0A 3A58B 3MG9A 2HYIC 1ZC3A 2I5MX 3TSZA 4C3JH 1VECA 5C3EG 3LW7A 3U61B 5CYOA 2IY5B 1W0KD 1HJPA 4DKXA 1F2TB 1GL7A 4DR3L 1KOFA 1TQ6A 1K8GA 2A6HD 1KJYA 1Z28A 3DZDA 1D8TA 4NYJQ 1E2PA 5D3MB 2BHRA 4PTLA 5J47A 2DGYA 3C16C 1R0ZA 1XXHE 1HNWL 4L9SA 1YVDA 1G6PA 4G0NA 1CJUC 4A3MH 5EUQB 1P60A 2DPXA 1OV4A 1W4BA 4PPNA 4RD1A 1W36B 5FLMG 4NYMR 4TYNA 5DN6A 4CF7A 1HNZQ 3AEVA 4B44A 1N3BA 3N2IA 4A3BH 1K3RA 1M1KC 2A7QA 1K9MC 2CLCX 4XWOA 4M0LA 3U44B 1FL9A 2JA1A 2QRNA 2Q0HA 4KBGA 4URUR 1KRTA 4A0RA 4EPWA 2R6CA 3G6EA 5KNDA 1S1CA 2QORA 4JVLA 1TWAH 4MYTA 4JCVE 4J0QA 2ZITA 1MRSA 1EOVA 4LF8Q 1YU9A 4FWIB 5IDVA 2IW3A 2IYSA 5DE3A 3THYB 1KYIA 1TPZA 1YR7A 2O8CA 1H9JA 3LWUA 1Z22A 1EX7A 2IYRA 3NDPA 2WWXA 2CK3A 1WFQA 3H15A 2MSCB 2O5IC 2GVZC 2EFHB 3OIWA 4HI0E 3S14H 4X62L 1H8ED 2ZR0A 4DR1L 3IPXA 1OKKA 3MUFA 1JALA 4HLUC 5E7IA 3Q8DA 5J3BA 1I4LD 1P2TA 1A4RA 5FTKA 5AJVB 1VQ9A 2RHMA 2B7BA 1PH6A 1RJ9A 2WPDA 4DCNA 2HT6A 4Z1MD 2QAGB 2FV8A 2W0SA 4BECA 2P6UA 3K80C 5IWAL 4Q4HB 4B74A 2BIFA 2JLUA 2WV9A 3CH4B 3CLVA 4L5RC 4ITRC 4KFSA 4YMWA 4DK3C 3CMAA 3IUYA 1CKOA 1HT1E 2VQFQ 4DV2L 2MMCA 1D6JA 2W2XA 1E1QA 3THWA 2ZJRA 2A6ED 2F6RA 1XF9A 3BH0A 2XTNA 1XTSA 4X8OA 1Z6YA 3W90A 5C3EH 4KI0A 5IP9G 3SJBA 2ATXA 2JJ2D 4ARZB 2VF7A 4DR6Q 5KNCA 1A62A 3B8HA 1KQSA 1IN6A 2XTMA 2J46A 2D4HA 3ZVNA 1TWFH 4OQFA 5IYBG 3HPRA 3QKUA 1MJEA 1XEWY 2GZAA 3BG3A 4B3ML 621PA 4NYIQ 1N2CE 4B32A 4C0KA 4I1OA 4ACBA 1HE1C 5E7JA 4PC3A 1KK1A 3KFVA 4LY6A 5DNYB 2JQOA 2MSEB 4BUJA 1E9DA 4F4CA 2N1BA 1FQJA 2CXXA 5LMNW 4TT3A 4QBHA 2OILA 1I94Q 3KXIA 4XWKA 5DLQE 2ZM6L 2PQAA 2WOJA 2B63H 1U0HC 3IIMA 3H84A 3OFNA 4JLKA 4KODA 1U0LA 4GN5A 3GLHA 3GLFB 1QF9A 2QAGC 2GJ9A 5G53C 3A37A 1VQIA 2FSHA 2EDGA 4P74A 1RVDA 1JBKA 3KZ1E 2BM0A 2V1UA 1CS4C 3VU9A 2Z4SA 1K8MA 1ZU5A 2QEQA 3AF4A 3TRZA 2RKOA 3WY9A 1NMFA 2DUDA 4LFAQ 1YZTA 4PQFA 4U5XA 4IPHA 1TQDA 4DXAA 4OI1A 2ZXUA 5AK0A 2VYFA 2QPOA 2J0VA 1YZ6A 1NRJB 3MSXA 4B3TQ 4UNNA 3L82B 3UE0A 1XEFA 2WJYA 2REBA 1P2SA 4N0DA 3SQXA 3CPWA 1KJZA 3AM1A 1TU4A 4NE2A 4Q19A 5CM9C 4C30A 1XNQQ 5SZKB 3I72A 4C3IH 1VQNA 4PC2A 3TS2A 2EQSA 5EP4A 3EPLA 3NBFA 5CDFE 1E24A 1QVCA 5G3ZA 3H4MA 1VQ4A 3K1JA 3VDYA 4LWCA 1XMQQ 1ZD1A 3PEWA 4IPDA 4KLZA 3KJGA 3CWQA 4D4KA 2XXAA 1GRQA 3TZUA 3RNUA 4JLDA 2CJWA 4TL9A 2R7ZG 4BBRG 1TXYA 4OQNA 4O3MA 4Y52H 2F1RA 4EAQA 3QG1A 1CIPA 5JJLA 2GJ8A 1X8KA 2GKSA 4P3YA 3R9XA 5BN4A 5AJ3L 2Q21A 3B1XA 2AMCB 1Q57A 4LHWA 2Q2IA 1RYFA 2R92G 2B92A 4X66L 5EJEA 2YOHA 3NBYC 2V6IA 1KHIA 3PO2H 4BEJA 3A8KE 1AE2A 3LBNA 4Q4AB 3OOCA 1NBME 1E32A 5HCIA 3CW2C 3EPKA 5IK2A 4BA2I 2JASA 1FPMA 1FX0B 3EXAA 2ZPTX 1AS0A 3CCVA 3GTMH 4EQ6A 3P27A 4TYYA 1WCMG 3I3SR 3R20A 5HPYB 1IONA 5F3WB 2GCOA 1NJGA 2WJGA 1GUSA 3NHBA 4R2IA 4YC7A 1GZSA 3UG7A 5KHOC 1QBKC 4DIDA 2RGDA 4Q9JA 2JAQA 3RANA 5KSYA 1E94E 1CJMA 1N34Q 2EJMA 1EFCA 3W5OA 4RVCA 3W5JA 4BFUA 2OCAA 4LJ8A 2XSZA 3AB3A 1CJTC 4TTPA 4Z8XA 2PNHA 1FUKA 4DHEA 2KCMA 1XXHA 3PG5A 1HTWA 3SS8A 3KB1A 1OKKD 2YJTD 5CK5A 4HJAA 1B0UA 1J7KA 1XD8A 5AJZA 3K0XA 3W8RA 4AKHA 2CHQA 4JT2A 4PHGA 2G1KA 3OTOL 3SFVA 2CWPA 4H13C 3K0FB 1NIPA 2J9RA 4O25A 2WPDD 3NDBB 4NMMA 4TQ9A 1GITA 2ZRMA 4MGIR 4A0GA 2J7PD 4PPFA 5C0XG 2VUMG 1ZM3A 3AFQA 4TYQA 3VR4A 1N8RC 1US8B 3TH5A 1TUEA 3H0GH 2V1XA 1HYQA 1P3JA 5CJ2A 3LNCA 4ESHA 3B82A 4LK2A 4C0LA 3I73A 2VHTA 1AKYA 1J70A 1TWHH 2RGBA 3KL4A 3QI2A 1E1QD 4HAVA 1Q1BA 4PO9A 4UXJA 5EXPA 5HR5A 2YU9H 4H0LC 1SVOA 2QSZA 1DAFA 3L0IB 4LPKA 4YMTA 1XRJA 3OPOA 4A9AA 2NO0A 1P72A 4M1SA 3K09C 3GTJH 3B78A 4TLAA 2R7ZH 3ZVMA 1NKTA 2HF8A 2FNAA 1I4DD 3QY0A 1OB2A 3SZRA 3AVWA 1PYBA 1II8A 4CEHA 3T5DA 1G8PA 1LTQA 1OW3B 4PFSA 3KF6B 2RAPA 1BKDR 2CEAA 3S1AA 5JWOA 1DO0A 2ZYTX 5KDOA 4B75A 3IKJA 1G51A 5B58C 3GEEA 4EFNA 1MOZA 1LF0A 3A74A 2DFKB 3A7LA 3WNDA 4G5OA 3NENA 1HR0Q 4A93G 4JOIC 4LBWA 3SDZA 1FW6A 1Z6AA 2BJWA 4G5RA 1EFHA 4RFSB 3TGPA 1MRNA 3OFND 3LLUA 3LO5A 1MO6A 1TF2A 2P65A 2KCCA 3CPEA 2KE5A 2N8NA 3BZCA 1NY6A 4DWJA 1RPZA 4PQYA 5M5XH 3IEVA 3BRWD 1KNQA 1PJRA 1LV7A 4TLCA 1CR4A 5H70A 4JLJA 1KI6B 4TMKA 2JLSA 3G5UA 3PUWA 2JA6H 4R71A 2ZSEA 3IIJA 1VHTA 5JSZA 3G48A 1KSGA 4RKEA 3TW4A 1B23P 2VQEQ 1BOFA 1CR0A 2JJ8A 4TZ6A 4K0KQ 1FTNA 2OTJA 1TU2B 1GNQA 4R7ZA 2J0UB 1MT0A 2D62A 4LUOA 1X8JA 2LCFA 3TRFA 1AN0A 4UXIA 2HUPA 2ZI5A 2ZTDA 3IDQA 3K8AA 4Q1AA 3PV0A 4D4JA 1GP2A 2R6FA 1FR3A 2IX3A 5KUTA 1RRPA 1P9WA 2H1LA 4DR2Q 1H8HA 2QAJA 4JI8L 3QOFA 5FL7A 4LC0A 3RNLA 3GTGH 2BMDA 1UDXA 2IYZA 2JEAI 2YKGA 1K8RA 2HT1A 3L0PA 3OF5A 5J5CA 2IXEA 4HSEA 1LM0A 1VF5C 1Q20A 3SE0A 2EIFA 4HAYA 4IJLA 4BZPA 3LRPA 1SLJA 2EFEB 4DKAC 1AQUA 1UEIA 3V4RA 1RL2A 1W5TA 3HU3A 3K8YA 3GTKH 3QEOA 1IXRA 3AF1A 4WXRA 4QXAA 2E75C 2MNAA 4GOXA 5FOVA 1Q7YC 1NTGA 4FMCB 5UKDA 1E9BA 4CW7A 2A5FA 1ZNWA 4LF4L 1MKYA 5IK2D 3S1MH 1AH9A 5CDFA 3HOUG 2ZRPA 4DK6C 4M1KA 1GOTA 2BE5D 1E96A 1IZ6A 1X86B 3ECCA 1YZLA 2AHOA 2X8AA 2ZVQX 3ZLJA 5IE8A 2AK3A 2HHHQ 4Z51A 2J59A 2W58A 1PHJA 4DV5L 3E5HA 2IS1A 5LPNA 5FJ8H 2IHYA 3KX2A 4GP6A 4RSGA 5FTMA 5FFMA 2B8FA 2ORWA 2RGXA 4LFCL 2F43B 3OEHA 4BEBA 1VQDA 1MR3F 1H9RA 4H44C 1ZM7A 1ZCBA 1NJFA 1A82A 1R5OA 3TSOA 3H3VH 3WHKA 1R2QA 2VY3A 1IXZA 3ZH9B 4BXXG 1V43A 2Q9AA 4JI6L 4DR3Q 2IYYA 2F1JA 3W8NA 4A3JH 4AKEA 4N0EA 1NBMA 3GP8A 1LNZA 3I4OA 3BOSA 5L3QB 1N9WA 2GAOA 3ULPA 1G8YA 2O0JA 2QGNA 4IDOA 1XX6A 1ZYRC 1G8HA 1OIXA 2IS2A 5GVRA 1P6XA 4ZI2A 4F93B 3PEYA 4TZ0A 1HNWQ 1X3FA 1E2DA 1YZGA 1NN3A 2F3RA 1B9NA 3SJCA 2F3IA 3GTOH 1IN7A 3GFPA 5JRJA 1QZGA 2WIBA 2WWGA 1UE5A 1J90A 1EFRA 1JPNA 1NKSA 3PEVA 1KL9A 1YHNA 3B9PA 4UQOA 1UAAA 3SHWA 2UU9L 3SGIA 4IPCA 4LF8L 1JR3E 4KLNA 2A8VA 2GTPA 3BB1A 1Q3TA 4A3GH 3DOEA 4US0R 1GWNA 4Q4LA 3TR0A 1N6RA 1E9EA 5DIFA 1C9OA 4A36A 3F5FA 4Q01A 3ICQB 3VU9B 2NN6H 5HGQA 3D7MA 1PH9A 4Q4JA 4D6PA 5B30A 1OFHA 3FMFA 4E09A 1DOAA 2ZT9C 1WMSA 5BYJA 1VCIA 4C2TA 1CXZA 4A8JA 4EKDA 3VKWA 4DR1Q 5H68A 4DJTA 3WP0A 2WTUA 1OSNA 1Y8PB 2QSYA 3KKMA 1A6XA 4D2IA 1XBTA 4A3EH 3HOUH 1EWHA 4B3XA 4JVMA 4Q18A 4EQ5A 2P6RA 1G19A 1KRSA 5IWAQ 1EXMA 1KO7A 2QTHA 4KV9A 3TQYA 2GILA 2YHSA 3CO5A 3SBDA 1KDPA 4DUGA 2D2FA 1IYVA 1BMFD 2V8OA 1SHZA 2MO1A 1NVVR 3UDIA 1WCV1 1ZNYA 4M9SA 4DIEA 4GN4B 4DV2Q 3GD7A 1MABA 2C2HA 1P62B 1SKYE 2ZSBA 4RCNA 2N46A 4MKFA 1ZD8A 1YNXA 4HUTA 2WJVA 3NIBA 2RGEA 3IGFA 3U7HB 5GAEC 1QHHA 1CKNB 1PH1A 1IY0A 1F3OA 1KGDA 1J8YF 2ZRCA 4FMDB 4Q1DA 4DSNA 4M9XA 2UUCL 3WWVA 4NKRA 3MD0A 2E2HH 2C8VA 4TMWA 4B3MQ 2CE7A 3DDCA 4MRRA 2GXSA 4M1MA 1I94L 4RY2A 1AJEA 2A30A 2E8GA 5FL7D 1SVWA 2BBOA 2ZTEA 2OXCA 5IP7G 3MJHA 3S24A 2OAP1 3OEEA 2RB4A 5EZ5A 2JLYA 1OJLA 1FGUA 1XMVA 2N49A 2QMHA 4AG5A 1W2HA 2C9YA 5SZIA 3R9IA 3H3VI 3QKSA 3CPFA 1YZQA 1H9SB 5TDHA 5BWMA 1U99A 3MXNB 2K75A 3VR2A 2ZM6Q 3T06B 4F92B 3I8SA 1HZ9A 1E2VA 1JPJA 3AV0B 4YHHQ 1VCMA 1ZD9A 4AC9A 1W49A 3BK7A 5LMNQ 2ZRLA 4JVSB 1M1YE 2CWAA 4JK1C 1C9KA 1F2UB 2R9VA 4P72A 4NCKA 5HZKA 5F98A 2F1HA 2FSGA 2A69D 4GN3B 1JB1A 1Z08A 1KK3A 3KLRA 2PCJA 2VRWA 1GRRA 4LBVA 2FFAA 1NN1A 1XPUA 3DKVA 3O8DA 4MKHA 4B3RL 3L0OA 1M7BA 4QC2A 5DGXA 4D4MA 721PA 3UANA 2ZRJA 4DV0L 4JLBA 4CEIA 4OBEA 1E9CA 4X65L 2QL6A 3IIKA 1G17A 3CM0A 3CF5A 1HEIA 1Z0AA 5L3RA 1II9A 4K81B 5EP3A 5DHFA 1XU4A 4Q66C 2YTYA 1G6HA 3KTAA 2IX0A 1N5IA 4GKJL 1YHQA 2WICA 3CMEA 4MUAA 4R4QA 2DWOA 2O5VA 1OXXK 2WIAA 2IEYA 2WKQA 4B3CA 4D4LA 2WKPA 3C7KA 5BYKA 3RC8A 3X1DA 1BBWA 1OLOA 2BJVA 5ELNA 2NN6I 3HOZG 1II0A 2I4IA 2LMCB 2W0MA 1KO4A 3ZJYC 1GVPA 1T6NA 2HJVA 5L3SB 4A15A 3MMPA 1GO3E 3B2EA 1GL9B 2IHBA 3SU8A 2VH5R 1R7RA 1G6OA 4TMZA 4C4PA 3UWOA 4QGFA 4HAUA 4B3DA 3CRW1 1VCNA 4M1TA 4P33A 2FFQA 3AF0A 1NBMD 4HJ8A 2GZHA 4FI3C 3TUJC 2UXCL 1U8YA 1GM5A 3NVAA 1NIJA 2NZ8A 3DO6A 5CK4A 1YJNA 4IVRA 1ESMA 5AJ3Q 1KDRA 2PCFB 3QVUA 2BCJQ 5CLQA 2B3GA 3TUZC 1H9KA 4TTRA 3R8FA 4DV6L 4DNRB 3T1YL 3B5JA 3FFBA 5DI9A 4DDWA 3ZQ6A 1EFRD 4WJ3M 2I5HA 3FHWA 1VQMA 2YWFA 1G9XA 2ZETA 4WAUA 2VW9A 4HB2A 4NYMQ 1QUQA 3WRXC 5TXGA 2DHRA 5FR2A 1SVMA 3KKOA 2XZOA 1DS6A 1J5EL 2NO1A 4TYWA 2UVQA 1DTSA 2ZJQA 3EC1A 1VYVA 2B21A 3WP1B 1YHBA 1HTPA 5KPJA 1RRGA 5KSOA 3STBC 1S8FA 1Y8NB 2Q3HA 5A0FA 3X1YA 2YWHA 3D8BA 4G7HC 2W83A 3CX6A 1P8LA 1NVUQ 4DLUA 1U8ZA 2R93H 1NLFA 3CAMA 3AEZA 3GJ0A 1XNRQ 1P75A 2R2AA 1W0KA 4OYHA 1T3SA 5EE5B 4A0HA 3ZDQA 1Z0IA 4BRUA 3K70B 3DOFA 4GNXA 4IFDH 4PZ6A 3CC7A 1KO1A 1E7ZA 2ODBA 4XWAA 2XX3A 3A7AB 4P73A 1SR3A 1XZPA 3FDIA 4LPSA 4PX9A 1A0IA 3OTOQ 2Q9CA 3IQWA 5AUPB 2J0QA 4I99A 4UP8A 2KWIA 4DLYA 1FP7A 2IX1A 4Q7KA 4KLKA 3T5GA 4EJSB 4LUZA 2WZQA 4DUGD 2CNWD 2VBCA 4HIMA 2YTXA 2JEOA 3BH6A 5GJCA 3UDGA 4FD2A 2WWHA 2O8FA 3A1VA 1JB7A 2QM7A 5JRZA 2JEBI 4A76A 1VG8A 3I56A 4JJKA 3HOXH 2QM8A 4HIOA 3QBTA 1P2UA 1K8OA 1KHTA 2WB1E 1VYTA 4OJQA 2A1AA 3CRMA 1YITA 4JLOA 1GRNA 4P4UA 3M0EA 3R7WA 4V0NA 3QENA 3NHAA 4HLDA 3DXJC 1Q1EA 1GUAA 3PIPA 1CU1A 4IDQA 4AY2A 3F1ZA 2ALYB 4PANA 2G88A 3U9SA 1QHYA 4ASUA 4DCUA 4YDSA 4JI4L 3GCGA 3G4SA 4JL6A 4PZYA 3HU2A 4MDFA 4NHOA 3ADDA 2A9KA 3QSYA 2UUBL 1R0YA 1T9HA 4CGZA 1OFTA 3K70C 1Z6GA 2J5XA 3OEED 1PVOA 2CHGA 1YI2A 3DHWC 4DLRA 2K52A 3EG5A 3AB9A 4TLDA 1S1MA 3S2HH 3EZ6A 3FPPA 3NEYA 2LSSA 3LFUA 1SHKA 3PR1A 4HZUB 2GK7A 2ZUBA 2ZTSA 4KYIB 1Y69U 3FMPB 1WBBA 3FGNA 4DSTA 4EPTA 3DM9B 4A3LG 1UE6A 2L15A 3AVQA 3E1SA 4E03A 1UKZA 1CTMA 4TQUS 2FSIA 1A63A 4JI1L 4EJSC 1IBKL 3THXB 5GJVC 1N32L 2BA0A 2VP2A 3N5CA 3QQ5A 5CJPA 1BVSA 4DR7L 2JJ2A 2BKEA 1KK0A 3L43A 2NTYC 1OT3A 4A3DH 1UBCA 2ZR9A 1HH2P 1TX4B 1E99A 1VQCA 3N6RA 2W2TA 1GUNA 3UMFA 2ZSAA 4JLPA 1Y1VH 1ZUNB 3OAAD 4Z54A 1TWCH 3GJ8A 3QPWA 2AKAB 4R98A 3BH7A 1AS2A 1EX6A 3PCOB 5DYIA 3IEUA 4LHZA 2DYKA 3WMFA 3EQLC 4A3BG 4G01B 4ON9A 2OT3B 3IQXA 4PZZA 4B3FX 5JECA 2OSBA 4JI8Q 4NZYA 3WHLA 4JVNA 4LUVA 4LI0A 4OI0A 1G16A 3P32A 4BA1I 2UZIR 4GOPB 1E2HA 2B7CA 2WMOB 1VQGA 4IFDI 2IK8A 1S9HA 1UKVY 4PXAA 3GQBA 2ERYA 2EVBA 3KQLA 3KOJA 2XZLA 1IYJB 1SFOH 2IYUA 3CKLA 1WB9A 4IVQA 3FHTA 5J4LA 4HEJA 2OLJA 2D74A 4JBXA 2A5YB 1E98A 2Z5FA 4OI2A 4A2WA 3FMIA 5EUMA 1T5IA 4H1VA 1GSIA 1EG7A 3VR3A 5GQOA 1NVXQ 1X56A 3V9PA 3RZDH 4BLTA 1N5KA 4DLZA 1EWQA 3U4VA 1XMOL 4DZZA 4OO1H 4WJ4A 2IC5A 2PEYA 3K9LA 3O47A 3SN6A 1FZQA 2KI5A 4IVPA 4EX5A 4LF4Q 2ZREA 3ONWA 4US2R 2IA5A 4Q21A 1SXJE 3KQHA 5FOWA 3OE7D 4RD0A 1T0HB 3ND8A 1T5EA 3KF8B 2QENA 4JIMA 3SI7A 4B43A 1KKMA 2NQ2C 1Q0UA 1Y8OB 1Q86C 1S72A 3KJIA 1Z2CA 2BMFA 2FXQA 2ZJ2A 3A8TA 2FWRA 4OQXA 2NPFA 4DV5Q 1VQEA 1RRCA 5BR8L 2QF7A 4A3LH 5GVSA 4A82A 1N6IA 4ZKEA 4LF7L 2DFNA 4GLXA 1RIFA 2K5UA 1RW4A 4LFCQ 2ZUCA 1L1OB 2NMVA 2NOAA 4XTCS 5SZJA 3A1SA 2ONJA 1I2MA 4GOPC 1TWGH 2OXRA 3M3YH 2KSQA 3CX7A 5AR1A 4JI6Q 2J3EA 2XTZA 4AURA 3PCRB 2E9SA 4GT1A 2R6GA 3KJHA 1Y63A 4GKKL 1JR3D 1Z47A 4AIIA 2QP4A 1B9MA 2BH2A 5FUVA 1TAGA 1XEXA 8OHMA 1E2JA 4RZUA 2B63G 2AKYA 2HQLA 1A5TA 4JBKA 1MO3A 1VIAA 2E87A 2FJUA 2ORVA 4L5BA 3EZ7A 2EQBA 3QBVA 4B2IA 1GG2A 1C7YA 5H1YA 1XTRA 1ZIOA 4CEJA 2UU9Q 4ZDWA 3ETLA 1AKEA 1PMRA 4HJ9A 1LW7A 4N3NA 1GFIA 3BFXA 2D3WA 2AFIE 2NZJA 4C7OB 4DUZL 3MCAA 4TMTA 2Q3FA 3BU2A 3S1QH 1DAGA 3EC2A 4IEEA 4NU0A 4ASUD 3LW8A 1EFTA 4IEIA 2KHJA 3I8XA 4A6XA 1KI7A 3BS4A 4OQMA 2ZJYA 2ZYVX 4RD2A 3B13B 1W3SA 3K9HA 4TMVA 1E3PA 3LAWA 3SNHA 3LH5A 1K0RA 5C18A 1W4RA 1G8GA 5GJWC 4QKQA 3J81i 3ZVLA 2J7PA 3KTAB 1UBGA 4LJ5A 3W9YA 1D9XA 2VZAA 1OE0A 2P0EA 1YEZA 5FBQB 3QXHA 1QVAA 3JVVA 2A19A 2QMOA 3CCLA 3QXSA 2NZOA 5B57C 1W0JA 1ZRHA 3TVDA 2H92A 3B60A 4LNQA 5EE3A 1OH5A 3PJRA 1EWRA 3AGPA 5GADC 3EA5A 4TMXA 4UNQA 1W36C 4MRVA 1U9IA 2WWFA 2E2IH 4TL6A 1E0AA 3KDFA 1IN4A 4FN5A 2RGNC 1L2TA 2ZR7A 4YXWA 3T1TA 3FHOA 1OH6A 1B70B 3FKQA 4LYAA 2ECKA 3ZQJA 4BFTA 2I1VB 2ID0A 1NN0A 4W7SA 4OO1I 4J15A 3I1FA 3KKNA 4H9GA 4U02A 1NG9A 1T8UA 4A3FH 3GLIA 4BLOA 1IL2A 1GIAA 4GLAC 3A36A 1SVIA 2QP9X 4GLVB 3TNFA 5IYDG 1XJQA 2DWPA 3PO2G 3Q5EA 2XNSA 1YJ9A 1Z2AA 2UUCQ 2ES2A 1E2MA 2ZAOA 1VTKA 5CB6A 2WB1G 3LQQA 1TUIA 4OKSA 4P0TA 5J4YA 4MITA 1E79D 3CBQA 4JI2L 3F0TA 2Q9BA 4L9WA 4R4CA 3I2ZA 2H8KA 5A5GA 5JHHB 3MGCA 3UDFA 1ASYA 1BO6A 4YHHL 2FX3A 5IY0A 1Z6HA 5LMNL 1DE0A 1DPFA 1VCOA 3SOPA 1X3EA 2EYQA 4EFMA 4XSHA 2WSMA 4NP6A 3DZ8A 4PHFA 3JAMc 1Q90A 3PUXA 2F52A 1I3QH 3ULJA 4DNIA 2PPBC 3K0CA 1E9RA 2ZS8A 1GVNB 4NXML 3CCJA 2YZ2A 2KA7A 2ZE5A 3RS2A 3GLGB 1DGSA 1E69A 3IHLA 4PPGA 5FTLA 4HUQA 1OFIA 1E2QA 3PVSA 5TB5A 5JEAG 2IHFA 3J7A5 2F9MA 3ICEA 4JKIA 4F38A 4DK0A 2LXKA 2NO6A 4B3RQ 1G8FA 1O3YA 4OWXB 3A4MA 5FL3A 1FQKA 4DV0Q 2ZJBA 1AM4D 3LY5A 3P4XA 3SYLA 1N6KA 2Z6KA 4HAZA 5EE0A 2H16A 4X65Q 3LXXA 4IHQA 1G64A 3H0GG 2OESA 3K0AA 5F2EA 5JBQA 1AQYA 4BPBA 1MH1A 3RRNA 1QZHA 1OXTA 4YCUA 1TMKA 3UXMA 3T1VA 4DCVA 4GKJQ 3D3QA 1YZNA 5KU1A 4C0JA 3GJ7A 5B2ZA 3BC1A 4IPGA 4Q7MB 2RHDA 1UBEA 1L0WA 2FZ4A 2ZJAA 1U98A 1H65A 1EFWA 1E2NA 1HT2E 4XH9B 4WOPA 1YE8A 1R6BX 2TMKA 4EPVA 2ERXA 4R1JA 5FOTA 4MDEA 1NL3A 1K6MA 2FPMA 4F4IA 1SVSA 3I62A 1YR9A 2RGCA 1XJCA 1HZCA 2D0OA 1ZBDA 1QZXA 2Z4RA 1XCGB 2KB0A 4PHTA 4UJ5A 5D3QA 4KAXA 2UXCQ 4JC0A 5IYDH 1NI3A 3J80c 1T3HA 1FL0A 1SXJA 1YR8A 3U4QA 2ATWA 1P16A 2ZIAA 3BAFA 3EWAA 4LBYA 3CQZH 4NXNL 4LOAA 2PNRC 3EBEA 2BBWA 2F3TA 2A6HC 2ZI7A 1UADA 2KBNA 1N6OA 4M4SA 3TW8B 4HJ5A 3W3ZB 2CL0X 1RKBA 4XVRA 4ZIRB 4DV6Q 2R44A 3T1YQ 1I2DA 2QBYA 4RJLA 1O7LA 2BV3A 2JCSA 2QU8A 3FPAA 4FMBB 4XIGS 3FKIH 3TAUA 4POGA 1N6NA 2P5SA 2PLFA 2C77A 3KFUA 1GL6A 1NF3A 2NGRA 1KD1C 1F5NA 2QZ4A 1J5EQ 1XNRL 2JA6G 4A2QA 4JLAA 3KLWA 4XTRA 4YMUA 3V00A 4YONB 1G7TA 4QGUA 3RLOA 1NLYA 2ONKA 1AZTA 2KHIA 1H95A 4QHSA 4O0AA 4Z8YA 4A75A 3WMGA 2BH8A 3NTUA 5LDDC 5JEAH 4KN4C 3G0HA 1I4TD 3GFOA 1ZIPA 1G41A 3CX8A 1VQPA 3LDAA 1TQ2A 3QXXA 1P4SA 4PPQA 3PO3H 1W46A 2R62A 1LY1A 1MJCA 3AKYA 4CYMA 4TKOB 2ZRKA 5ELOA 5CLLA 2BM1A 4ESVA 4QHYA 2AD5A 2C96A 3M7NA 2YC4C 1VIYA 5AUQA 1L4YA 4JI0L 3QXJA 1W0JD 2JLXA 1JR6A 3GDEA 1Z0KA 1ZUIA 2Q2UA 4IRUB 5AJXA 1OH7A 3CCEA 4NYJR 4P32A 5FTNA 3ZZ0A 1YNNC 1IBRA 4JYAL 4GNKA 3REGA 4C0BA 4L15A 1IY1A 2N3SA 3W3AA 4HDQB 4YXWD 3P26A 4QM7A 4D25A 4K46A 1HNXL 3TEHB 1EFUA 1NVVQ 2B8TA 2IYXA 4HZIA 3NC0C 3D4RA 5BW8A 4OQLA 1NJIC 1ZNZA 3NEMA 3NKVA 4ERNA 4UY8C 4B3BA 4QY7A 5A4JA 1IM2A 2JLZA 4FXPA 4CZ2A 4DR5L 3M4OH 1ZUHA 3C5CA 5C4JH 1W2BA 1N36Q 2XAUA 4GP7A 3MWJA 1P61B 1TF7A 4DV4L 1TF5A 1GUGA 3IRBA 3JVUA 3QEJA 4I1SA 4L4UA 3U7EB 4ABYA 2VEDA 4D0LB 2OCBA 1AE3A 3B6EA 4BY1H 4JI4Q 2G6BA 1G5RA 2JJ1D 2UUBQ 1Z29A 3AQ4A 3OZXA 3Q5DA 1GD7A 2N78A 3QNUA 3CH5A 4V0ME 4FCVA 1CJVC 5FJ8G 1I6HH 1WP9A 3ZZTA 4GI7A 1Z0FA 4OXPA 1XFAA 4JT4A 1BMFA 5KYKA 2GK6A 1HQCA 1OYYA 1QG2A 2Z6VA 4LWZA 4QFMA 3ZYCA 3AYHB 1YJWA 2PT5A 2JDIA 4ME3A 4NB3A 4GS3A 2FU5C 2V54A 1ZNXA 4JSYA 3EW9A 4JYBA 3UIEA 3WNBA 4TVAB 4JI1Q 1IBKQ 4KSBA 3CC4A 1N32Q 2ZSFA 4URVR 5J4VA 2XITA 5K36H 4A3JG 4UNSA 4PC6A 4DR7Q 1Y14B 3F2CA 1X1SA 1UKYA 2EFGA 2OBLA 2GN5A 5KO2A 5AJYA 4XOIA 1A2KC 1RE0A 1YJ5A 2QI9C 2QPTA 3R8CA 4DCTA 5H8WA 2YYZA 3I7FA 1GNRA 1UBFA 3IBYA 4OK6A 2PZEA 4PZLA 5IYCH 5FI0B 4D80A 2GDJA 1E2LA 4Q9HA 2EFDB 1W7AA 2FDCA 2PZGA 2JLVA 1QHSA 3BZKA 2ZS7A 3EX7C 1YZUA 4F91B 1E3MA 3T35A 1K5GA 1EYGA 4A3GG 3MWLA 2J0SA 3DVLA 1DAEA 1NG1A 3B9QA 2ZRDA 2O8CB 2EXDA 3AKCA 2A68D 2NN6G 1E2GA 1UJ2A 1O87A 4DT1A 3I4MH 5JI2E 5HTKA 1WJJA 1JQLB 1JEDA 3C8UA 1D2NA 4JI5L 4B3SL 1L4UA 1SXJD 1LTLA 3JAMi 2GCNA 4BE7B 3W6PA 2ZRHA 4JJZA 2C5LA 3CCMA 4MUBA 1RJ9B 3F8TA 1CF4A 2GJAA 4TQAA 3BDOA 1GILA 4O0MA 4A3EG 4Q9KA 4AKGA 1XMOQ 1S3GA 4MGZR 2VO1A 2R6DA 2ZYUX 3WMEA 4DLTA 3HP1A 1PLLA 1XTDA 3QPVA 4I81A 4JLMA 1W44A 3LQRA 2UUAL 1XD2A 4JKYA 4LJZC 5E4FA 4B2LA 3MEFA 4EPYA 3THWB 1N33L 3HKZE 1KJWA 1PH2A 1TADA 4KXFB 5FBLB 4QGHA 3I32A 2NVQH 2VP9A 4LYHA 3THOA 3B1ZA 1SGWA 2P67A 4EDHA 5HKKA 4TL8A 5BR8Q 2IYVA 2QMUA 5FBVB 2XB2A 1U94A 1DO2A 2QA5A 1T3LA 2QQ0A 4F7WA 2CMKA 4LF7Q 2V7QA 3RYTC 1R10A 1E2IA 3DPUA 4APVA 4OWWB 1ESNA 2JIZD 2KJQA 2QGZA 1NY5A 2QMEA 3LV8A 1C4OA 3CZQA 3WYFA 6Q21A 2IBMA 3QPUA 5FOSA 3OW7A 4AK9A 4QJ3A 2PMZE 1ZC4A 2DB3A 1S4QA 2VNUD 1JXMA 2GEUA 2N42A 3H86A 2VTKA 4LHXA 1G5PA 3LWNA 2LKCA 4GKKQ 4KKSA 2J7KA 2PQAB 3L7ZC 2JA7H 1M90C 2J87A 1S96A 3BBPA 4LC1A 4M1OA 4OHWA 1KMHA 1N6HA 3J80i 3GLHB 1A8VA 3GLFE 1RC8A 2JA8G 2O8EA 2K32A 1U81A 4UPAA 3VAAA 1GTVA 2X77A 3MJRA 2JK8A 5LMUL 3AUYA 4HDOB 2GBLA 1Q82C 4WVFA 3FMOB 1D9ZA 3RHFA 5JJIA 3AVPA 2ZROA 1V8QA 4KVGA 2VL6A 4R4OA 4BY7H 2VHJA 3CIOA 4UKDA 3TK1A 4DUZQ 3WNCA 2ASBA 3GJ4A 2VSXA 3BGWA 3IFTA 4DDVA 1XZQA 1Q3HA 3W5IA 1YVCA 1JJGA 4FCTA 4HYYA 2H57A 5TMPA 1CRPA 3B6YA 1S9DA 1X8LA 1DAKA 1KI1A 3K0AB 3MAAC 5HY6A 4IXMA 5DYGA 5AWFC 2F1MA 4D82A 2DNEA 3IHWA 3RABA 1XPRA 2VQSA 2BMEA 3DM5A 1Z63A 2IS4A 5K8LA 1G4AE 3RN2A 2CNWA 3UMRA 5FLXc 5EXSA 1YNJC 2A5JA 2GA8A 2HJGA 2G9NA 1H9MA 4FDBA 1GKIA 4QOSA 2XXAB 2CLDX 1BKBA 3WBJA 1ZM4A 2CJWB 1NLZA 2JDID 2ODNA 5JWHA 4KO8A 4JMPA 2CDNA 4OK5A 1KAGA 4HR7B 1JE5A 4OJKA 4W5WA 4DB2A 4DV7Q 2QGQA 2GVAA 1WXQA 3QIAA 3AUXA 4GSYA 4PO1A 1KAOA 4DEXA 4Q1CA 1IN5A 1X1RA 2GJKA 4IOJA 2CCZA 1HUQA 5E7NA 1N5JA 2XNDA 2PI2E 2WOOA 4QJFA 2A2ZA 2C98A 3UDXA 4OX9L 3PENA 1NP6A 4HDCA 4HLUA 4D81A 4OGQC 3PF5A 2WKRA 4WW0A 3PIOA 4EQ6B 3LVRE 2BVNA 1VHLA 2YWEA 2FOLA 2GCOB 4QNMA 2EJFC 3U3MA 1F2TA 4AQYL 4JI2Q 2E5LL 2JA8H 3CB4A 2BWJA 3VX3A 4C0SA 3GEIA 3ZD6A 2EW1A 4CIDA 1JI0A 5D3MA 1D2MA 5FBWB 3A5UA 2R93G 1G3IA 1L7VC 1XXHB 1UEJA 1Z6TA 2OBNA 2D2CC 1XDBA 3MRSA 4MRNA 4AWXA 4KHPQ 5JHGB 4NXMQ 2AXNA 3U3OA 1TKWB 4IFDG 4LJAA 4RD6A 4ZCMA 3WBKA 1XWIA 2AUJD 4DDUA 3FOZA 3D31A 221PA 2GEVA 2UXBL 4DK1A 1G3UA 4ZDIA 2QT0A 3EPHA 3U44A 1EGAA 1G18A 2BDTA 1VQLA 1IAQA 1S3SA 1YRAA 3EAQA 3OAAA 4MKIA 1E22A 4MYCA 2AXPA 4B47A 4LHVA 2GXAA 1FMJA 2ZRFA 1L2FA 1IBML 5BQ5A 1COWA 2V4ZA 4R4TA 2O5JC 2PX3A 3THYA 3TJZA 1VQAA 5HE9A 2GXQA 3T34A 3HOXG 3GJ3A 2BOVA 5EQTA 4A4DA 4WIAA 1Q1ZA 2WMNB 1G7RA 4LDJA 1IY2A 4LJ9A 5J40A 4BFSA 5HKKD 5JEEA 3KQUA 5F9FA 1VQ7A 1SQ5A 1RRFA 2BA1A 1J2JA 2ZUDA 3X2SA 2V7QD 1E2KA 2RHQB 3TSWA 2BCGY 1II8B 4IFEA 4QJ4A 4L5SA 1SKQA 3N2EA 5HE8A 3SHFA 3SEAA 3PUVA 3TR5A 4CDGA 3S1AB 3E0EA 5EP2A 2QAGA 4LF5L 1U0JA 4Q5IA 4Q4HA 1VPLA 1D8LA 4G1UC 2ASEA 2QUZA 3B1VA 4WA7A 3M4PA 2Q3MA 1TEXA 1VQJA 1AZSC 5LB4A 2O0HA 4II7A 4B2PA 1R5BA 2NVYH 3L2PA 1BBUA 2RMKA 4GZYC 2VA8A 4P4TA 4BLPA 4JBJA 3KUCA 4NXNQ 3OIVA 4NONA 3BJUA 5HZHA 1JECA 3HR8A 4S2EA 4DV1L 1X3GA 4NCJA 3S2DH 3OE7A 5FUXA 3W6NA 3W6OA 2OFXA 5FPKA 4ARZA 1ZJ6A 4AI6A 1R8SA 2X1VA 1FYCA 1DD2A 1G20E 5GJBA 3MXUA 1MKHA 5M3FH 1XB2A 3O8BA 1KIXA 4JZKA 1J6QA 4GZLA 4EIWA 1SVLA 5JSZB 1UM8A 2ZE7A 3H0KA 2CKZB 2C78A 4E22A 3J81c 1NY4A 2FGJA 2H7VA 5DO9A 4A3DG 1UDWA 4A3KH 2H5EA 3L8YA 4IKEA 4FWTA 5JEAJ 4QL5A 1TEVA 3AFPA 1Y1VG 3W1BA 1G4UR 3HKZG 3Q72A 4O2RA 1HCZA 1G5TA 4PR0A 2C9CA 5JFGA 4DB4A 3KJPA 4M1WA 3EPJA 5A35A 1W48A 4GRAA 2E1RA 1AS3A 3AP1A 5JCPA 1JR3A 1NMXA 2O8BA 5H1SE 3EIQA 1C0AA 1EIFA 2E74C 2AWNA 1U8AA 3M9BA 4JI0Q 1Z83A 2ZU0C 4IJMA 4Q03A 2GETA 4DR4Q 3OIUA 3M85A 1PH4A 1CBUA 3AF2A 4DNTB 3KJOA 1DG1G 1O78A 1NN5A 2IF2A 3CW2A 3CRKC 4TL7A 4JYAQ 1XJ0A 2VSOA 3K7AH 1F60A 3Q7PA 2IS6A 1BYUA 1HPCA 4QHTA 4NBSA 1HNXQ 1PH3A 4PZ7A 4IOCA 1KSHA 2PEZA 3B1WA 3Q9LA 1DELA 3HOVG 3AGQA 1N36L 3K53A 1Z0JA 4ACAA 4UNRA 1A1VA 1FTSA 4I4LA 2NVTH 2XNDD 1O7IA 3RS5A 2R7DA 2ZI6A 5M3MG 4OO1G 1PLJA 4TLEA 4DR5Q 3E70C 1QVGA 4LFBL 3X1XA 1ONLA 4P71A 3ERSX 3NEJA 1W47A 2J1LA 4DV4Q 1KKLA 3T56B 2AHOB 2QT1A 2IXFA 5K8TA 1J8MF 4HJ7A 1CEEA 1VYUA 1XD9A 2A78A 4RD3A 5AUNB 5DLQC 3MWKA 4Q1FA 1Z07A 2K5NA 2WAQE 2ZRGA 3F2DA 1IW7C 3M4QA 2ZJ8A 5FPTA 4EPXA 4Q9LA 421PA 1R0WA 1OIVA 2HF9A 1ZW6A 4L5QA 2O8DA 5CIWA 3RRZA 3ZIAD 2GZDA 1TQ4A 3KXLA 2W6ID 1W36D 2F7SA 2FG5A 3BJIC 2DFTA 2OTLA 3FE2A 1PLKA 2PI2A 2OE2A 2O8DB 4M9QA 4M22A 2CL7X 3HGBA 1FX0A 2WVJA 2IL1A 4LX0A 1VQKA 4XSGA 2GAAA 3K09A 2ZU6A 4C0QC 5B64A 2VPPA 4GL2A 1NSFA 3EIVA 2BMJA 2D0PA 2UXDL 3ASZA 1COWD 2A69C 2LWIA 1BIFA 1E9AA 3Q85A 3RS7A 4TN1A 4YLGA 2AX4A 4CEHB 4U7DA 1PYSB 4YDHB 2PT7A 4V0LA 3GLHE 1ZM2A 3CRRA 3PXGA 1E79A 4LGMA 3MLEA 4NPHA 1Z9FA 3KFXA 4GMXA 2G0NA 4Q7JB 3M1IA 3FTQA 2RF4A 4DDTA 4JOIA 2JGNA 2GF9A 3H1TA 3EA0A 4BQSA 2ZYWX 3IPYA 3IBGA 2R65A 4DLVA 2B8WA 2OUKA 3QUSA 3TE6A 3EIHA 2QNRA 1JMCA 3RS4A 4PQRA 4Q4JB 3SFZA 3K0FA 3HJNA 4Q48A 2HCBA 1JAIA 3HOVH 1W2GA 3HOYH 2GVBA 4ZCIA 4A8JB 1US8A 5EAYA 2GHIA 4URYR 2D06A 1E2ZA 4PAOA 1KI9A 2OQKA 5KDDA 4JI5Q 3PUZA 4BFVA 4B3SQ 3EIEA 2Q2TA 1X54A 5M3MH 1EQQA 4IQZA 4OI4A 4LF9L 3TREA 4ZCLA 3RRMA 2OWOA 2FSFA 3TUIC 1NMGA 2NIPA 1Z5ZA 4UXHA 3X1WA 4DCSA 1ZCAA 3VA7A 3IILA 3A0JA 4MQBA 2ZS9A 2C04A 1YKSA 2QA4A 4M2LA 3ZVRA 1XMIA 5C4XH 5C4MA 1CLUA 1XNJA 2VHCA 1KMQA 2UUAQ 3KF6A 1MABB 3VNVA 4LBZA 3SJAA 4YQFA 1NNEA 5C44H 1N33Q 1X65A 5KNBA 4UJ3A 2ZEJA 5EP1A 1PH5A 4DLWA 2VP6A 4ZKDA 3C15C 2K7VA 1KI4A 1F6BA 2OZEA 5DI3A 4A3FG 1DAIA 3EN2A 1QHHB 5CM8B 1FMLA 2FA9A 3CR7A 4HB3A 3AVOA 4PC1A 5GROA 4C3ZA 1RZ3A 3UMSA 2KBFA 1WRBA 1VQ5A 1Y3AA 4RFSA 5DSZA 4NL4H 1S0UA 3OESA 2HYDA 4DUYL 2GWHA 2AUKA 4URWR 5EXXA 2V3CC 2YV5A 3EASA 3OYYA 2GESA 1VQHA 4A8JC 5IRCD 1E2FA 4POAA 3OHMA 1VQBA 3RLFA 3HOWG 1JAHA 1G7CA 5CITA 1KI6A 1AGPA 3PITA 2QPAA 3QKSB 3B1YA 1CSPA 1P5ZB 1Z3IX 3VX4A 1YR6A 2EVWX 5M5WH 1QHNA 2GF0A 5IT9c 3U6KA 3CC2A 4UP9A 2ODEA 2Z83A 3RRYA 2JA5H 3KQNA 2FH5B 2PJZA 4B71A 2J0UA 4EFLA 5LMUQ 5BN3A 5JI3E 1SMYC 3U7FB 4IOMA 4WXPA 5G41A 1T0JB 1DBSA 4O2DA 2REOA 4KJZA 4BLRA 2A5GA 4CEIB 5FOUA 2OCYC 1G3QA 1JJVA 2Z43A 4HB4A 4M21A 2RGGA 1KY2A 2DNCA 3GJXC 3K0EA 1L1OC 2J45A 2XGJA 2Q2HA 5LBIA 1W1WA 2CHVA 2L0XA 3WYAA 1WBDA 4MA4A 1ZVQA 3T1HL 2K14A 1M74A 4B34A 2WJHA 5JS8A 2PJRA 1CJKC 1SZPA 3TBKA 3RSOA 3U60B 2V9PA 3QKTA 4P75A 3GJ6A 2ODWA 3AP3A 3I61A 3GMTA 3SJZA 5DH9A 1VS0A 4LJ7A 3RWMB 4DV7L 4W5HA 2EWWA 3P20A 2I5LX 1Q21A 3QF4A 3TIFA 3BFKA 4DVGA 2QG6A 3PFIA 4H02A 2R7FA 1X9NA 1ZMXA 2C03A 5KOYA 4KMUC 4YMVA 2WP8J 5FPSA 3E9HA 3EZ9A 1QDEA 3UWKA 1HV8A 1ZU4A 2XZPA 1KZGB 5C46F 1KSFX 1KTVA 4LF6L 1SVKA 2DY1A 2ZE6A 3AKEA 4Q02A 1UF9A 2HEIA 521PA 4A3CH 2FGKA 5P21A 1X6OA 2V6JA 1IBLL 1ZP6A 2WWWA 1OXUA 4OHVA 5LB2A 1DCZA 5DHAA 2I3BA 1QUQB 4KITB 2F43A 1A7JA 4OX9Q 2IHEA 3HOWH 2JJ1A 4JL8A 4IW3B 2PZFA 3FKIG 1D7QA 2FFHA 4BLQA 4WZ6A 2CLSA 3B85A 5C4GB 3NBHB 4D0GA 4AQYQ 3NH9A 2E5LQ 3LX8A 3T61A 4A92A 3E2IA 4KHPL 5HCNA 1T4GA 3CNLA 3FB4A 4IOLA 3W1GA 5L3QA 2B6HA 4WZBE 3CRVA 2GCPA 4BASA 4US1R 3DM3A 2EWVA 3LBHA 4GNXB 1XMJA 2UKDA 5BN5A 2Q8IB 2F1IA 3J81k 4LW1A 1E0SA 5FLMH 4LUCA 4QGAA 3LBIA 1E9FA 1ZKOA 3PO3G 3UKDA 1LACA 3VMFA 2WAQG 5FTJA 3RAPR 2CVHA 2SHKA 2UXBQ 3M6AA 4R9UC 1OXVA 4L8GA 2D2EA 1Q44A 4MKGA 1B7YB 2YC2C 3C4JA 2O8BB 1L8QA 3K0SA 3VNUA 2IXGA 3M4YA 1ZINA 4FMCF 3U7GA 1IYUA 2OEPA 2G77B 2C95A 1JJ2A 1IBMQ 3RN5A 1MO4A 2QRZA 4EPRA 2HXYA 2O8FB 4WBSA 2QTVB 2QEXA 4G7ZC 1V9PA 4JI3L 5GAGC 3FYHA 1ETUA 2AR7A 2G0TA 2NVXH 2WM9B 1R9TH 1OHHA 2PMKA 2BEKA 4FINA 5ANRB 4BFXA 3LA6A 2CBZA 2FPLA 3HKSA 2Y8EA 4OK3A 4GOKA 3AP2A 3VKGA 2ZJZA 1FNMA 2WWIA 1OB5A 3I4NG 3R7WB 3BWDD 3BB4A 1NSTA 1JEEA 3ZS8A 3HR7A 3U58A 2F55A 4IO9A 3VHXA 1PZNA 4X8MA 3VR1A 2B29A 4RKFA 4LF5Q 4YY3L 1UKEA 2PCLA 4K8OA 4BY1G 3RVBA 1VG9B 3AVTA 3CNOA 1UPTA 1LB1B 2WAYA 4GNXC 5SZHB 2AD1A 4C2UA 4IDNA 5J4KA 4P4SA 1IHUA 2VIIA 2DFLA 2VS1A 1XEWX 4TSFA 5IP9H 2KENA 4GDFA 1B8AA 3EZFA 1SKYB 3K81C 4OWTB 2UZ3A 4DV1Q 2ZJ5A 1V5WA 1GUTA 4CT5A 4POFA 1R4AA 2VP5A 4LV8B 1CUKA 4E07A 4XD7A 1CKNA 5IYBH 2CCGA 5KDLA 1N0WA 4ZO4A 4NDZA 1T5LA 3A8JE 2DCUA 3F2BA 1Z0DA 3LX5A 5K8IA 2WHXA 3CWZA 2V55B 4PHHA 4DRZA 3KJEA 4D26A 5K36G 4JG2A 3ZJYA 1KNXA 3CF0A 4AYXA 1PH7A 2OHFA 3G71A 4KYUA 1K83H 3BE4A 1E4VA 1FP6A 2Y0SE 3KDSE 4IFDJ 1XTQA 2QE7A 4NCNA 2IUUA 2NZHA 2JIZA 1XCMA 2O52A 3CPHA 3U6BA 1HZAA 1N0UA 1WI5A 3BIFA 4JL5A 1XP8A 4GMDA 4A4IA 4QBGB 1E9SA 5IYCG 1H9SA 1FUUA 2W6JA 4KSCA 3S1RH 1JJ7A 3MFYA 2WBLC 4IDHA 4NCHA 3T15A 4DR4L 2K4KA 3S15H 4RCYA 5TARA 3WXMA 2CK3D 2XEXA 4RD4A 2ORIA 3AVXA 1JJCB 4X6AH 3RR5A 4DV3Q 1F2UA 3NBXX 2JLRA 4V02A 2IWRA 4RZ3A 1YBYA 4JI7L 4I1UA 5KSZA 3ASYA 1IOZA 1UEBA 3RS0A 1VQOA 2EU8A 2NO7A 3I4MG 4KKUA 1Q12A
chains in the Genus database with same CATH superfamily
3T8YA 1T13A 1D6MA 5K03A 2GASA 3RVDA 5HIMA 1VMAA 4D43A 4Z9XA 1J0DA 2F4VL 3TS0A 2PQ0A 1Q46A 4BBRH 3VO8A 4V0OA 3TTTA 5ELDA 5DI3B 3R09A 1WTRA 1OFUX 1GG8A 1Y1WG 3EIFA 4I9FA 1PFKA 1FQWA 1X13A 2ZBGA 4JDPA 3BIOA 2ZVPX 1DQRA 3K5NA 1T9GS 1N0VC 2C92A 3E9RA 1D2EA 4CEJB 2WINI 2B69A 4FB5A 3JQFC 4NMWA 3RVQA 4GXNA 5C0XH 3LFHA 2EYUA 2EQ5A 3FF4A 5IMSA 3WDNA 1DZIA 1TZKA 3QKRA 4ZU6X 1GTSA 1MBYA 2OBMA 1Z5UA 4L1KA 1EDOA 3C6MA 2QE7D 1SULA 5ILGA 4A3IG 4QPNA 5HM6A 1TFRA 2MSDB 4MVJA 3P1HA 3N8KA 1MJGM 4DUYQ 5FJJA 3GDFA 1WUYA 2IE0A 3ZW9A 3MD9A 3V80A 3Q7EA 1P9NA 3QP9A 3BKXA 3JTEA 1PGJA 3STBD 5E4YA 3SQWA 2EBWA 3D1LA 3MB8A 4LQCA 4IRMA 5DIZA 3UBMA 2CXNA 2XT9A 1WQ1R 4L9RA 1A8SA 1Y37A 1Z5WA 2FN4A 4WL0A 1Z17A 2Q49A 2Z4TA 2G1JA 3HLKA 3DCJA 3UV7A 1BWQA 3KXKA 4BNHA 2H9AA 3K0CC 1R66A 2YCLA 3NJ4A 1DXMA 3DV9A 1T8TA 4LG1A 3ZHSA 3H5RA 1KZ7B 2FVYA 2B2TA 1PQ4A 5B7QA 1OLUB 3FF1A 5C1BA 4BXXH 1D6SA 1Y7TA 5F9MA 1ELOA 1TA4A 1RS0A 2I1WA 3PFGA 4AYBG 2QROA 3NW9A 2ZBFA 3IAM6 2XUJA 3MJ4A 2KJXA 1WVIA 3O1IC 4O4HA 1BCPD 1EYAA 5IT5A 4WINA 4TLBA 4C14A 2HSJA 4LFAL 1YQ9A 4WZAA 1KVQA 1TMOA 4GBGA 4MHSA 4HADA 4N4AA 1N2GA 4LGCA 1G1MA 1THZA 3E8MA 2HV8A 4EB0A 4OHXA 1MNQA 4YMSA 2CCKA 4MAAA 1GQYA 1DBRA 1QE0A 2JCXA 1H66A 4MQEB 4TOIA 3BMCB 3GT7A 4U2KA 1YB2A 1TM5E 5U4QA 5B1HA 4U7JA 1GR0A 1CA5A 4TWZA 4R0NA 3BSFA 4I4CA 3VZPA 4N01A 5DZSA 2MO0A 2R3ZA 4QLOA 4C5CA 1PS8A 3KBBA 4YA6A 4FYMA 4BOYA 3Q7QA 1KFEB 2R6AA 1U3FA 4UC0A 1TCAA 4JI7Q 4DT1B 5FRDA 1II3A 3T9AA 4KQ6A 2ZBUA 3ZKWB 2QUJA 2Y6UA 3B3GA 1WSBA 1CKEA 1CR2A 1H1LA 1QFZA 1JQKA 2XD4A 2GEDA 2VJAA 2OK7A 3CTPA 3GP5A 4DMRA 5BUCA 3JCZA 1HR0W 1K68A 1M34E 5HGXA 4EG1A 5C8VA 2XF2A 3NWSA 4BIIA 3DB1A 3TKLA 3BA1A 3ETNA 1CEQA 2HBQA 4DUZB 4Z1MA 3D6TB 2O5CA 2ZRAA 2HD3A 2ZAMA 2FPKA 4BMXA 1R4MA 1ZAKA 3Q7SA 3MWYW 5DEIA 1NMSA 3F98A 4YT5A 5B3LA 2C5EA 1M0SA 4R2JA 4BFWA 4HLQB 4QUFA 4KO2S 2E76C 3DAOA 2PGAA 1CZKA 3PPVA 1W6JA 1GDDA 3T3IA 3ICOA 1CTQA 2WE8A 1LUZA 5EVJA 1IPEA 1X7XA 1UFKA 3B8EA 4QT4A 1RJWA 4R2KA 2NUPB 3A58B 5C1IA 3HCDA 1HKUA 1MC5A 1FSGA 2B8JA 2FK8A 4DR3L 1KJYA 4UUNA 3RIXA 1U6IA 1YVDA 5HGTA 4PG4A 4O2AB 5FLMG 2OAGA 3D8RA 4V39A 2ZCUA 5FLEX 4XWOA 2QI9F 3HSYA 3JAME 4W4TA 4G84A 1O8CA 1YU9A 3K15A 4IMPA 1PYGA 1EX7A 3NDPA 4AECA 3PTLA 4GH5A 5D14A 5EHQA 3OIWA 3FYSA 3P19A 3I12A 1L5LA 4MV8A 3R6LA 4Z1MD 4L28A 1JPUA 4OJNA 3MPOA 5CFNA 1VHDA 1EEID 5CNKA 4FYHA 3CH4B 4ITRC 4W9NC 2RJ3A 3PQEA 1HYBA 2CUKA 1UUPA 4IIJA 3B8HA 3GZ4A 4RF3A 1S5BD 1MJEA 2HV9A 1SUDA 4FUQA 4R1LA 4CDEC 3LY7A 3KSAC 5DNYB 4PNEA 3V3TA 2OENG 4CHTA 6REQA 1E4OA 2ISQA 2WV7A 2GJ9A 4LIPD 3DE3X 3KZ1E 2GX6A 3QOYA 2WMYA 4U5XA 1ICWA 5AK0A 2V6BA 3T4UA 4W1SA 5INTA 2Z95A 4QUIA 2QIPA 4PC2A 3H5AA 2QB5A 3CWQA 5FBKA 1RJDA 4UNIA 4D9CA 5C7YA 3KVOA 2XIWA 5IAJA 3S2FA 3AFGA 1LQUA 1FX0B 4O4LA 4ZU3A 5DASA 1Y8CA 1AS0A 1JBQA 3I3SR 4CMCA 1BVYF 3UA4A 1EFCA 2JK1A 3QXGA 4E5NA 4OF4A 3O92A 2ID8A 2CJFA 3FPFA 1T9AA 1XD8A 4L6CA 4S1NA 2UUAB 3HXOA 3UKOA 2CWPA 4MUGA 4OFXA 5FLXL 3IP8A 2EATA 5D65A 2NN3C 3WQSB 4ZQFA 1CQIA 3NNSA 4HDSB 2VHTA 5BQPA 1SVOA 1ZH8A 2V7XA 3EY4A 2AJDA 1V8DA 3LF2A 3A6EA 1CIVA 3QY0A 3ESRA 3SZRA 5GOZA 2X0JA 4ZYYA 2OQIA 2I99A 4HNAA 2W8BB 3KM0A 1K3UB 2DFKB 2B94A 3WNDA 1I3QB 5J2TA 4LBWA 2O4UX 4C7XA 7AT1A 5C7IO 4RFSB 3DKIA 3C3PA 3BX1A 1EVYA 1CR4A 4JLJA 1HL3A 3RH0A 1QZ3A 2VH1A 3LC2O 4E31A 3NUZA 1NRWA 3GUVA 1TU2B 2YMMA 2WB4A 5A4FS 2ZTDA 3PV0A 1IZZA 2XQKA 3O3CA 1P9WA 1H8HA 5ESWA 1V9SA 3AEXA 3TDNA 2GLUA 3L6RA 2IXEA 4HSEA 3SE0A 4OX9B 2ATEA 4WY8A 1GA1A 1IXRA 4AQYB 1Q7YC 1QLJA 2A5FA 4ZYZA 4ETMA 2AZTA 2R97A 1MKYA 1VGVA 4YIJA 2ZXEA 3PL5A 2X8AA 2WG2A 3S2EA 2IHYA 5ALDA 4LFCL 1IBMB 4LXHA 5I7AA 4JI6L 2NTTA 3QVTA 1NVDA 1X87A 2GAOA 4KR2A 4V0QA 1OIXA 5A5VA 1P6XA 4IDBA 4UFPA 1JPNA 1DG9A 2OHJA 4FFSA 2N47A 2A8VA 4A3GH 4A36A 4HWGA 4IIFA 5B30A 4E09A 2NXJA 4UAUA 4DJTA 4BNUA 1R0SA 1Q7GA 3BSSA 2BSXA 4MWTA 4OA8A 5G0VA 1OWLA 2RARA 3HUFA 2GILA 2IZZA 2K5DA 5CVCA 1T4CA 2F4NA 3RHSA 4UVDA 1HX7A 3PVZA 3W2DA 6ADHA 3AQIA 2QN3A 5GAEC 1QHHA 2GZSA 1OV6A 1KVRA 1NM5C 4EGVA 1I94L 2VCHA 1YV9A 1MJFA 2BBOA 2OXCA 2EYLA 4BU0A 3MJTA 5GP1A 3FROA 4D8YA 3DWIA 3VR2A 3JY6A 1E2VA 4XYBA 3P75A 3PKZA 5JNTA 1C50A 3O4IA 2OO5C 4HEHA 4JLBA 2NVQB 1TAQA 2AOUA 2XUZA 3UYLA 2OV1A 2J08A 4MUAA 2WIAA 2XI4A 1VFNA 3MXGA 1XTPA 3CFYA 1M1NB 4IDDA 1RWOA 2Z6BA 3EGXA 4YP9A 2BP7A 3AF0A 4L8FA 3LYHA 3B89A 3DO6A 3FCCA 3ODGA 1ESMA 1GVHA 4ME6A 3HO6A 2FN8A 1ATZA 3CF4A 1DS6A 1T1EA 3FGOA 1VLQA 4LZLA 3NHKA 5ALYA 1S8FA 4G7HC 2QQ5A 4ZVMA 3U4CA 1XVVA 3RYIB 2XLBA 3FWPA 2Q9CA 3IHKA 4DMMA 2IH2A 2I7DA 2RB5A 4EJSB 2W2PA 2CNWD 2YXNA 1MAUA 3IESA 1DIHA 2O8FA 4A76A 4JENA 3HEAA 1VYTA 1QFJA 5CDTA 1SE2A 1QP0A 1CU1A 3EXHA 3TM4A 4PANA 3ORSA 3ADDA 2UUBL 1JFRA 3AJEA 3MBIA 1OD6A 3EG5A 1NW4A 4HGZA 4PS1A 2C5AA 1B3RA 2XMDA 4TQUS 3I30X 4JEHA 2HLHA 2BFNA 3LPNA 3HB1A 4G86A 4K3VA 1XIVA 1K9SA 4P83A 1JH8A 3P32A 2DF8A 1E2HA 4CDRA 4J1TC 1IOLA 2D1SA 4UCQA 4ZCSA 4ECAA 4IVQA 1CUVA 3HABA 4A27A 2IBSA 2D74A 1QC5A 4UW9A 1SUAA 4E1VA 1STOA 4BXOA 3ONWA 1NPYA 3QLUC 3E4DA 5FEMA 1ENCA 1W75A 1FVOA 4GE3A 4UD6A 4K9SA 3IDOA 2FWRA 2QF7A 2RQXA 3RRJA 1X9HA 2FLVA 1Y3DE 4XTCS 5SZJA 5FHRA 5AR1A 3G7LA 1KY5A 3CKMA 2X41A 1TEHA 5K20A 3AG6A 4RPCA 1MO3A 1EL0A 4UTXA 1ZCFA 3EZ7A 2D6FA 1RFGE 1H2YA 2VRNA 3ETLA 1S3IA 3KRTA 3QWHA 3C1OA 2X0FA 3CCFA 1DYQA 1USKA 5D7NA 2EZVA 1CHQD 1EVEA 1UBGA 5ER6A 4DDKA 4YV0A 3QXSA 1W0JA 4MVXA 4ND7A 1YUMA 3AT1A 2RGNC 4XT1B 2I1VB 1WKCA 3LKZA 1C3OA 4GLVB 3WGJA 4OQEA 2FUG6 2OB1A 5HG0A 2Q3EA 2X9VA 2EX4A 3MLAA 3HOYB 2WU8A 1ASYA 1TYCA 5LQSA 2X0EA 4DV4B 5E3FA 5T67A 3RFXA 4Z9BA 1Q90A 3TQIA 3ULJA 1J9ZA 3M6MD 2KA7A 3KJZA 3ESXA 4JJGA 2HWYA 5JTTA 2PUHA 3I3OA 1V9CA 1U4SA 5C4XB 2V6MA 3PFHA 4YRCA 1XJWA 1Y4AE 3W05A 1MH1A 4EUEA 1H94A 4PBTA 1OXTA 1PDWA 3NTOA 3BC1A 3IEXA 4YCNA 3ORQA 2O4CA 1FP1D 2X15A 4F4IA 3DR5A 1QZXA 5D3QA 1HUNA 2N75A 4PW0A 4EY6A 4MINA 4NXNL 1XDDA 3TXAA 4MVJE 5T4HA 5K9ZA 2R44A 4L5AA 1ST3A 4XIGS 5E7QA 3TAUA 5A62A 3SC2A 3OZWA 3DLBA 3IUNA 2WSBA 3I05A 1UMBA 3Q6MA 3D6MA 3IQFA 4HDRB 2RHRA 5EMKA 2HFKA 1L4FA 1V4BA 1W0JD 4LDPA 1OH7A 3I5AA 3MTSA 1WL8A 4GOOD 2FWNA 1Q0QA 2IYXA 1YIOA 5BW8A 1TZCA 1IM2A 5ALSA 2JLZA 2ZB7A 3C5CA 3F5MA 1EXWA 1TF5A 1IIBA 2OCBA 3CUUA 3OMWA 3RJZA 4FT4A 3D2CA 1XFAA 3W1WA 3IEPA 1GSHA 4R9NA 4IH9A 3IVXA 5K36H 4A91A 3VVBA 1A9OA 4P58A 4WZZA 4XSVA 2NVXB 1WZIA 1STHA 4C4TA 1O54A 4AXBA 3M2TA 3GLTA 2ZS7A 4F91B 2WM8A 3WLOA 4IFTA 2LUOA 2A9PA 5GWXA 4RADA 5DNUA 4ZCRA 4AF7A 1IWOA 3C0KA 2C5LA 4IIVA 4A3EG 2WTNA 2AJTA 2A9QA 2XRSD 3E9DA 1USVA 3ZWYA 4I81A 3KTFA 1J0EA 2IGBA 3ZCPA 5TF0A 1JQ5A 2VPWA 4TL8A 3ABIA 4GXRA 3BWBA 1H3EA 6Q21A 3KXPA 4KGZA 4QJ3A 5TQJA 3M5WA 2PMZE 5BQFA 1QO0A 1S4QA 3L6OO 4E1AA 2X6TA 3W5SA 1A76A 4RA9B 1GTVA 3I5MA 3BK2A 3RVMA 2VT7A 1VSQA 1GA4A 4G25A 3D4BA 4P7GA 3BGWA 3HWX1 4OAQA 1NUTA 1JJGA 1O94C 1XPRA 2BMEA 2HA6A 3EWIA 4FDBA 1NLZA 3V2HA 3KQWA 4DV3B 3OSOA 3ZHBA 2GJKA 3RVPA 1DWPA 1TJ5A 3JARB 5E6UB 1I50B 2VK2A 1X1AA 2XPCA 1A7KA 2GWRA 4FE7A 2FMMA 1WUIS 1OJ7A 3D9QX 2JVIA 1KRHA 5BYAA 1Q95A 1QR2A 3MINB 1LK7A 4MRNA 1XDBA 1LC0A 1UKAA 3ANXA 3LTNC 4IFDG 1CX9B 1SBHA 3H75A 1BS9A 4BNMA 3D31A 1EK5A 3NPPA 4M60A 5DWQA 4BBSB 1HR0B 5I7VA 1G18A 1RJGA 1YRAA 4B47A 1FFXB 2AXPA 5BQ5A 3CLUC 3D6VA 1GNSA 3D6AA 4FYPA 2SCUA 5J40A 1XKQA 4KQIA 5ENVA 5DW3A 2BA1A 3H2SA 2VQEB 4BMYA 5B3JA 3S1AB 2F0TA 2BDUA 4HTAA 3F1LA 1QO0D 4II7A 4X97A 4GZYC 4N9WA 4NVRA 2YFYA 3KHSA 3ABQB 1XB2A 4PYQA 2Q45A 3LIIA 2CKZB 1FZTA 3JQAB 3OEYA 4FLMA 2WF6A 4A3DG 1BOOA 3L8YA 4TRRA 4BNLA 1HCZA 1V8OA 3LZDA 4M6WB 1SUIA 3RYFA 3D6NB 2GZRA 3EIQA 1C0AA 1EIFA 5EESA 5EKKA 2BFDA 2OHOA 1FVFA 1D1TA 1XJ0A 2YIMA 4GEKA 3TZDA 5D6OA 1HPCA 4D1YA 2NZUG 5DNFA 1PL7A 3V2GA 4M0KA 3SLGA 3UFXA 1GGVA 5C37A 2JD0A 2YVKA 4IWNA 4J9UE 3RYCA 3M4QA 3RFVA 4Y1RB 1GUZA 3A2LA 3IDAA 2PI2A 1VB5A 3HKBB 4LZWA 2IW1A 2YXEA 3ASZA 1D4OA 3GH1A 4EO7A 4ZZ1A 2YS6A 1ZXXA 1E79A 4X60A 4ZODA 4LRSB 5TPZA 1SNYA 2FZCA 1JMCA 3K9WA 5CHEA 3HFGA 1LUAA 2I22A 5M3MH 1A9SA 2AYYA 5JO9A 1ZCAA 2O1XA 1P39A 3ELBA 4MQBA 1W19A 4CTJA 5C4MA 3IKTA 4HPXB 1P4JA 4YQEA 1N33Q 2VP6A 3VAYA 5DI3A 4A8HA 4C3ZA 1RZ3A 2CXOA 5DSZA 2BKVA 1H9AA 5LLSA 5BW5A 1MW9X 1ZJ4A 4W1PA 1Z8NA 4D3ZA 3U6KA 2Z4IA 4B71A 1T0JB 2VCEA 1SCDA 2R4QA 4BQFA 2A5GA 1JJVA 4HB4A 3VO9A 3I9V1 3FSRA 4DIUA 1ILPA 1L1OC 4LSZA 4I36A 2CHVA 4WJWA 5CW1A 2AW3A 1SZPA 1DJQA 2HO5A 2C2GA 5CP8A 3DL7A 3SJZA 2ETVA 4DV7L 3B2NA 2PYIA 4YMLA 1O1YA 2GEJA 4WBNA 4QBKA 3PXXA 3G2OA 1TO1E 2DY0A 4TXNA 1NASA 4KAJA 3KAKA 2FGKA 2DQKA 5BT8A 2EYJA 1Q16A 1PJ3A 4AICA 4K05A 1TT5A 1MVLA 3DWEX 2CBGA 2ERCA 3N2ZB 4KHPL 5HCNA 4OFZA 4CFYA 1GZDA 3VMFA 1B7YB 3D0QA 3K0SA 1V8BA 2C95A 4DA9A 1G8AA 3HI4A 2LP4Y 3A6ZA 2PMKA 4FINA 4OK3A 4C4AA 1ZD4A 3KXDA 4GOKA 3EGOA 3R7WB 3BB4A 1VPEA 4U6QA 3QKWA 3R5XA 2PCLA 1YS2X 3CNOA 4WFKA 1IPHA 5SZHB 3V55A 2AD1A 5EY5B 4H60A 4CNBA 1SKYB 4OWTB 2R5WA 1ZXBA 1NRXA 4A3BB 1OLUA 1V47A 3W1VA 2JA2A 4D26A 1KNXA 2PUVA 2GD2A 3OLVA 4ARIA 1HZAA 1OBHA 4DUPA 2UAGA 4LWPA 3N0TA 2Z9CA 5LC1A 5TARA 2C5FA 3PWSA 2DJ5A 2OG1A 2NVUB 5CYGA 1R88A 4JLPA 4NCXA 1L1EA 1U2PA 3PEFA 3ND6A 4RSHA 5CEEA 4PXYA 2BEJA 3L6UA 4DSUA 2PANA 3UG6A 4MUNA 1SZJG 1JHAA 1PR5A 1FNVA 4MQUA 1AIPA 1OX4A 4BRWA 3LWBA 1Y89A 4JQCA 5JSFA 5TMDA 3GFQA 4BCCA 3GDGA 1OF1A 1WPGA 3L8MA 1OTCA 4HL6A 5BWNA 4QLBA 3KOYA 2OO7A 3JAWA 1YGPA 4MCAA 4MARA 1JWMD 4P22A 1DU4A 2IF0A 3SXPA 5IF9A 4EUKA 1V1QA 5B55A 4URZR 1ZLXA 1PFBA 4FW9A 3JRNA 3KP1A 3AXTA 4JV5L 3PPIA 5J2UA 2IP2A 3QF4B 3WV5A 1BN6A 3CG4A 1K7SN 4GBMA 3SYNA 1OMOA 2EYMA 4ZV4A 3Q8KA 3BERA 2XB4A 1PTJC 5SY6A 2ANCA 4X95A 3H0GB 4DWWA 3VQTA 1ZM9A 2C35B 1ZMRA 1QG7A 3SYKA 4XVQA 2YU9B 3OW2A 4HUQB 2I6SA 4IOKA 3C6XA 3GTJB 2R7ZB 2QUAA 5LMZA 3GV3A 4RCVA 1GFZA 1XCBA 4GOPA 3FFAA 3TG2A 3GAMA 2O2HA 5DK6A 4FNGA 3PNQA 5EE1A 3G6KA 4PLHA 3TRKA 5FPHA 1Z4QA 2F0JA 1H2HA 2CE2X 2AYZA 4RTPA 5K6AA 3OOJA 1X8XA 2IEZA 1OBOA 3L3OC 2QBYB 5AUOB 3T5AA 3HNOA 3DE2X 4Y7NH 3K70D 3EYAA 2Z6KC 2PZAA 1A5SB 3L79A 4PV1C 4I7ZC 4O2AA 2P9HA 1FDRA 1UQTA 1BG6A 5JBNA 2X6LA 2GB4A 3WAGA 1WABA 3R77A 1RHKA 3S1MB 4KU4A 2AQ2B 4P93A 4DSOA 3HFJA 5AKXA 4HQOA 3LDGA 4HXYA 4IY1A 4WNAB 1U5BA 2L0CA 2XSCA 1VL6A 3MIZA 4CTMA