4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
4EJSB 1YJNA 1MKHA 1T9HA 1GD7A 1Z29A 2OESA 3LX5A 1P16A 2OCYC 2REOA 3C4JA 3CX6A 4IOKA 2ZIAA 1Q1BA 5AJ3L 2FFHA 1L1OC 1NJIC 2UKDA 3KKQA 1WBBA 2DFLA 1DO2A 1LV7A 2EFCB 1S1MA 3NE5B 2V9PA 2ZVQX 3CQZH 2ZI3A 2HF9A 2IS1A 3KFUA 1DBSA 4G1UC 4HLQB 4JBKA 1ZM3A 3CF5A 2OE2A 2VQEL 3WBJA 4PV1C 4FMDB 4GRAA 1KAGA 2PI2E 4DR2Q 2EU8A 3N2IA 3Q9LA 1P2UA 3GJ6A 4KFTA 3AKYA 4WXRA 2ZM6Q 2QTFA 4JVLA 1DAFA 3LRPA 2CCGA 5IYCG 1A4RA 3BAFA 1GAJA 2O0KA 1XU4A 1HZBA 4L5SA 3MEFA 3N6RA 2GZAA 3TREA 3ICQB 2CLSA 4M1YA 1N8RC 3HOXH 1G18A 1B70B 2JJQA 4KU4A 4A6XA 2E87A 3AF0A 4V02A 3NEJA 1X8LA 1EWQA 4PTLA 1ASYA 1N32Q 1VQFA 3NHAA 4Z8XA 1XD8A 3BJIC 3HJNA 5BWMA 4BY7H 3KKMA 3J81k 4C2TA 3LO5A 1IJFA 3VAAA 1KI6A 1R10A 4RD2A 2D2FA 3SNHA 3DM3A 2D3WA 1Q90A 4BBSH 1KIXA 1XJVA 3OEHD 1I94Q 1RL2A 4KKUA 2P65A 3BBPA 2AK2A 1KAWA 4C0BA 1AS0A 2FPKA 2FX3A 4P32A 1H9MA 2KHJA 3UE0A 1C0AA 3B9PA 1L1OB 4YCUA 4Y52H 2J45A 2RF4A 3WYAA 4I81A 3ZS8A 2UVQA 4Q47A 4LPKA 4DV7Q 4H02A 2CXXA 4PMWA 1U0LA 3HOUH 1VQPA 2BM0A 3NHBA 2CHVA 3NENA 4B34A 2B7CA 2O0HA 1ASZA 3D6TB 3D7MA 3K80C 1PHJA 1OYYA 2NN6I 2C99A 2MSEB 4DNRB 1YNXA 1VHTA 2OXRA 2WBLC 3BK7A 4LJ6A 4WZ6A 1BDOA 5LMNQ 2CEAA 3C14C 5KSYA 221PA 1NIPA 3BD9A 4M1TA 1GNQA 3HWSA 4POGA 1D9ZA 4R9UC 5EXTA 2LMCB 1Z6TA 2FNAA 5ANRB 5J47A 5LDDC 4GOXA 2V54A 1GILA 3TQCA 3VNUA 4AYTA 4D25A 1P6XA 2ZITA 5K8IA 1UBCA 4DR4L 3T12A 2V1CC 2OFXA 1B9MA 3REGA 4EDHA 1HNXQ 2VS1A 3T06B 3T1YL 2XZLA 1VQLA 3A7AB 4H13C 4UJ3A 3ZIAA 3VMFA 2MSCB 4JI4Q 1H9JA 1XNRQ 2QORA 4TSFD 3KTAA 5DH9A 4EJSA 3QXXA 3ZVNA 2WP8J 2JEBI 4DPGA 4DR3Q 2UXCQ 1XZQA 4WJ3M 1KO1A 1EYGA 1J2JA 3UWKA 1NL3A 3TSWA 1XCGB 1IM2A 2UUCL 4NONA 4BFUA 2RGXA 5JS8A 1XTKA 1KI9A 4Q01A 1GHKA 4MDEA 2IHBA 2Q6TA 2BMJA 1S96A 1KNXA 2OXCA 5IP9G 2HLDD 1YRBA 5HCNA 1SKYE 2WSSD 3IIJA 4TYPA 1I4LD 4URZR 1HY3A 1D8LA 4LF7L 1Q20A 4ZIRB 3W3ZB 4EPRA 3SYKA 3E9HA 3PCOB 2CLDX 4CF7A 3DXJC 5C44H 1HE8B 1W0JD 2IC5A 2QRZA 4M9QA 3WHKA 2ZEJA 2X8AA 5JI2E 4A3CH 2XZPA 3MJRA 4QRHA 1OXTA 5AR1A 2F1IA 1XMIA 3DMNA 1KK0A 1T6NA 1K8RA 2O8EA 3KQKA 5DN6A 1RVDA 2Q2HA 2YV5A 3FYHA 3QG5A 3QEOA 3BWDD 4YC7A 5C4GB 4RFSB 1RYHA 4B3BA 4Q18A 1S2MA 1GKYA 3PIOA 2HT6A 5CDFA 4NU0A 4BXXH 4M1KA 1FYCA 4P4SB 2HHHL 2HUPA 3VR5A 1U81A 2FGKA 4Q48A 4U5XA 5CYOA 4D81A 2VEDA 1SFOH 4QJ5A 1XPUA 4BFTA 3QXCA 2F1JA 2NN6H 4AKIA 1G8HA 1GUOA 1IN6A 2EFHB 2ZJYA 3S16H 3OYYA 5HZKA 3TE6A 4DK1A 4JBXA 3QKUA 4TKOB 2A78A 5M5YH 2DWQA 1T91A 2OAQ1 2G88A 3PUVA 1L7VC 1MO4A 2FOLA 2OM2A 5H1SE 2XSZD 1DXMA 1DPFA 3E70C 4TT3D 4C2UA 5IT9c 1NKSA 4Q1DA 3T1QA 5CDFE 3FVQA 3K8AA 1U98A 2W0MA 2Q2UA 4LF9Q 4DEYA 1HE1C 1W2GA 4Q66C 4XOIA 3PCRB 2V1XA 1VCIA 3RLFA 3M4PA 1E1QA 4PX9A 1HT2E 2ZE5A 1Y8OB 4KYIB 4US2R 3ULPA 1ZNYA 2C98A 2ZSBA 3PG5A 5IHPA 4IPHA 2W2TA 2NTYC 5BR8L 2J46A 4HZUA 1ONLA 1OYWA 2O0JA 3RS3A 1SVIA 4P75A 4WA7A 1AM4D 2ZJOA 2B8FA 3HGBA 2I5HA 2B92A 4H9GA 1JJVA 4B3XA 3QVVA 4IFDG 4I1UA 4LV8B 1N6NA 2ECKA 2XJ4A 4HIMA 3T56B 2KCTA 3VQTA 4C0HA 4H1VA 3JVVA 3RRZA 4PZ8A 1M1KC 1KZGB 4QGUA 4HB4A 2EYQA 3I4NH 2J41A 1EQRA 1Z28A 1IN4A 4KXFB 4AG5A 4B76A 1KI1A 2GDJA 1VCNA 2I1VB 3AVTA 1YZNA 1IJEA 5FUVA 3PF4A 2ZRMA 4DLUA 4F91B 1Z7TA 2F9MA 4IO9A 3V00A 5C4XH 4G5GA 1FW6A 3SN6A 2NMVA 1QUQA 1KAOA 4X66Q 3I62A 4A8JC 5FLXc 3I3SR 4DCTA 4I99A 2IA5A 3MG9A 2JLRA 1GKIA 1YR9A 3TUIC 4EUNA 3F2CA 2OEPA 4GNXA 5GADC 1Z22A 2DN8A 1JMCA 3NBHB 1NN1A 1N9WA 5KNDA 3A37A 3FMPB 1W7AA 2EXDA 4IOAA 4RJLA 1ZM7A 2CCZA 2JA7G 3QKTA 2QMHA 2ZRJA 2IK8A 3WY9A 3CRMA 3SC3A 4C0SA 3KDFB 1HEIA 1K6MA 3LLUA 4Q19A 4OWWB 3K70C 2IYQA 3T51B 3I8SA 4LBYA 3AB3A 4CT5A 1OHHD 2C95A 4R1JA 4QJFA 2AD5A 1N25A 1NTGA 2FPLA 3H0KA 4ITRC 1T5EA 4DV2Q 1N5LA 3WMEA 1E9SA 4A93G 5DIFA 2R62A 3NC0C 3BB1A 3DKPA 3K9GA 3BJUA 4LWCA 1IBKL 1E2MA 3QPUA 4DDUA 4JK1C 2EIFA 2X77A 4D4JA 1PVOA 1CTQA 1SE8A 4JCVE 5GVSA 3GCGA 1E6CA 4KFSA 4DCSA 4B32A 4DBLC 3DDCA 4LUVA 4MYTA 3TQFA 1RRGA 2CLCX 2ORIA 4YMVA 5G3ZA 2OLJA 4UXIA 3HKZG 4DSTA 3U6KA 4JT2A 4OONA 3SJBA 1A1VA 2CL0X 3IEUA 4A36A 3BU2A 1DAKA 4RKEA 4DV6L 1VHLA 4DR5L 1VG9B 3L82B 4PC1A 4A76A 1AGPA 3RAPR 4A8JB 3AM1A 1S3OA 2N42A 1ZCAA 3FB4A 3FTQA 1AGRA 4LY6A 1J8YF 4DNTB 1OB2A 3AEVA 1JEDA 2NZJA 1HR0Q 121PA 1X3GA 4TTPA 1SHZA 1XMOQ 2R8RA 1BMFD 2EW1A 1N6OA 5TXGA 2A5DA 1II8B 3TAHA 4LF6L 1P9RA 2G83A 2VHJA 1ESNA 4FWTA 3QBTA 2VHUA 3T15A 2NO6A 4LJYA 4B6EA 5KTYA 4US0R 2F52A 2PEZA 1VQEA 3T1OA 2ZVPX 1GM5A 1Q1QA 4DCVA 3K70B 5EQTA 3I72A 4DUZQ 3DPUA 3RHFA 4XD7D 1A62A 4ZKDA 1DADA 3AVUA 3AF2A 4MGYR 3EAQA 4AYWA 1HTPA 3KQNA 2R92G 4M53A 1KZ7B 2KI5A 2R7ZG 3RS5A 4JI2Q 4E22A 4GZMA 2GF9A 2ZJRA 2DYKA 1VQNA 3ADDA 1Y8PB 4IJMA 2ZRHA 1EFCA 4DLTA 1KSFX 5SZJA 3NELA 1U90A 2JJ8A 3I4MG 4DV5L 4Q9LA 5IYDH 1XTJA 2QM8A 3D3QA 4UJ5A 2W6JD 3RLNA 1XNQL 1G4UR 1WXQA 5KU1A 3AVQA 3AYHB 4AQYL 3L0OA 3K9HA 3MRSA 1F2UB 2BCJQ 3NH9A 4Q7LA 3TIFA 3UDIA 1M8PA 1DTSA 2I1QA 4EPTA 5BW8A 3VHXA 2HT1A 1PH7A 4G5RA 3HOWG 3SQXA 1GOTA 3GLIA 1TWHH 2REBA 2ZRFA 2F1RA 1Z2AA 2GEVA 4GMDA 2ODEA 3EIEA 3BB4A 4H0LC 4M1SA 3THOA 1KRTA 1E1RD 2UXDQ 3EG5A 5JFGA 2WM9B 3IO5A 4HATA 5JZVA 1G3RA 1FVIA 4QM7A 4A82A 1EG7A 3U2QA 3H3VH 1VF5C 2WWWA 4DLWA 3ADBA 4X64L 1KSGA 1U9IC 1VYTA 3B13B 4DR2L 1GUGA 1LS6A 4G5OA 2PH1A 4ERNA 3GLIE 4C0KA 1F60A 1CJMA 4LF5Q 3P20A 1E0KA 2YINC 2ZYWX 2ZJAA 2YTYA 3TSZA 1L8QA 2ZAOA 3S1AA 2V1UA 2JA1A 5BN3A 1E99A 3OTOL 3JZAA 4P0TA 1U8ZA 4C0JA 5D3MB 4Q9HA 3GTOH 1K73C 3QG1A 2AMCB 1I6VC 3A5ZB 4L4UA 1N32L 2KBFA 4UNQA 4WAUA 2PMKA 1P72A 1Y1WG 2BV3A 2ERYA 1UADA 3S1RH 2QI9C 4M4SA 2WJIA 2ZJQA 5C18A 2J7KA 4CZ2A 1RYFA 3KFVA 4QM6A 1Q57A 1ZINA 3A8KE 4TLAA 4A3FG 1JAHA 4OQNA 4BBRH 2ZS7A 5CIQA 1WCMH 4A3GH 1AA9A 3EASA 1DELA 3QJYA 4A3MH 2NVQH 1II8A 2VQEQ 3U61B 3HOZG 2LWIA 3M1IA 1H8HD 4NYIR 4DV7L 1JECA 1DG3A 2GBLC 2D4HA 2ZS9A 4JKYA 5TY0A 5JHHB 2PCJA 5F9HA 1TPZA 2XNSA 4L16A 3S1QH 1SVKA 3WWVA 4NXNQ 3KZ1E 4B3FX 2H5XA 2OCEA 1N6IA 3LNCA 2NGRA 3ZLJA 1RPZA 1LFDB 1FX0B 2WZQA 2XITA 4HAVA 3BIFA 1V43A 2JXMB 5LMNL 1QHIA 5HKKD 3UXMA 3EPJA 1QG4A 1YHAA 2VL7A 4QHYA 3AUYA 3TVDA 5J4YA 4IPCA 4A4IA 1AKYA 4M21A 4PQFA 3THXB 1IL2A 1DAGA 1GRQA 1XJCA 2NO0A 5FOVA 4LFAQ 4MDFA 3OFND 5EXSA 1FUKA 1OTCA 1EFHA 3H4MA 4OI4A 3R7WA 2ZUCA 1BKBA 3UWOA 2Z0MA 4YCVA 3KKNA 5IYCH 1HNXL 2GJ9A 4TL7A 3EQLC 1P2VA 1NNEA 5C44G 1K8AC 2K50A 3K0CC 1E2QA 4JI4L 4JOIC 1XNRL 4LCBA 4D4MA 5A4JA 2OAP1 4NP6A 1Z06A 4Q7MB 1Z63A 1E22A 1IN8A 1KXLA 4HAXA 4DR3L 2UXCL 2RGDA 1LF5A 5J5CA 4HAZA 3VU9B 2QF7A 3X1DA 5EE1A 3ZQJA 4KVGA 4X8OA 4CRWB 1T0HB 4JVSB 1UM8A 4XJXA 3SBEA 4V03A 3ZJYC 2Q21A 2F43B 4OK3A 4P4UA 1KKMA 1FTSA 3OE7A 3VKWA 1G3IA 1ZYUA 2RGGA 4E5UA 4CEIB 3SFZA 5FL7A 5IY0A 2ZRNA 1NMZA 4MGIR 5FTMA 4BWYA 5HR5A 3T61A 4Q4JA 2XXAA 1IY1A 4ZO4A 3GP8A 2VUMG 1M90C 4YMUA 4DUGA 3K70D 1NF3A 1SXJC 3LQRA 1XF9A 5DI3B 2D7CA 4IFBA 1S72A 1FMLA 1CKNB 1JALA 2K33A 1G6PA 1QJOA 5D3MA 2HIXA 2ZREA 1XEFA 3FP9A 3T1YQ 3K9NA 3I55A 1LS1A 3T5GA 4OQXA 1SULA 4EFNA 3GFOA 1G4AE 1LNZA 1P9NA 2GA8A 4DKXA 2DFKB 2AUJD 2ZTEA 4CW7A 1NBMA 1E9AA 2UXBL 1AKEA 4HDQB 5AUNB 1SROA 2E74C 4JLNA 1DOAA 5P21A 4IXMA 2DBYA 1HURA 1A7JA 1PH4A 2VTKA 1ZNWA 3CIOA 1OV4A 1BVSA 2QY9A 2K32A 4V0OA 5J4HA 3KQUA 2O52A 2XOKD 3V4FA 2OG2A 2BBTA 4URUR 4GOPC 3H1TA 2C9OA 1JPJA 4JMPA 2K52A 4NPSA 4LF9L 1N6PA 3H86A 4U00A 2O8CA 2OWOA 4WIAA 1NBME 1N6RA 2GF0A 2AHOB 4B3TQ 1F5NA 4X6AH 4HB0A 2B8WA 4A6PA 3KQLA 4GS3A 1O87A 1US8A 2FSGA 2PLRA 2ZQ5A 3CR8A 4PSKA 1ODFA 2V6JA 5FI0B 4AC9A 1NY5A 3EXAA 2GCNA 1ETUA 3WDNA 1YR7A 2A68C 2C03A 3BFXA 5E7MA 3T34A 4DV3L 3N70A 4V0LA 1NIJA 3ZZUA 4IFDI 1Q46A 1SXJB 5C4XG 5JLJA 2ZRIA 3SR0A 1PLKA 1AZTA 5IP9H 1W49A 2RGCA 2F3RA 2HHHQ 2QMUA 2BA1A 5FL3A 2WKRA 2EDGA 4IVQA 4YONB 1NVXQ 4O0AA 1Z0KA 4GLVB 1Z0DA 2A6EC 2ZU0C 3Q72A 4QJ4A 5GJVC 1G41A 3CXCA 1VPLA 2QROA 2VYFA 1E98A 2R44A 4Z8YA 3RRMA 2NZHA 4C7OB 3U3KA 1EIFA 1DVRA 2A5GA 3VR2A 1FP6A 4G7ZC 2K75A 4BA2I 2OFWA 5K8UA 1E2FA 1MR3F 3G82C 1E2JA 1YHBA 1N5IA 1T8UA 2IF0A 3RYTC 1XEXA 4DLVA 1ZD9A 2JLQA 1WJJA 1C9OA 3TZUA 1E2HA 5KDLA 3AP1A 1Y3AA 3QNUA 1AH9A 3MMPA 4GOPB 2JJ1D 3HU3A 3BE4A 1E94E 1G64A 1TNDA 1UEBA 3W9YA 1CTMA 1Z0IA 2H8KA 3UIEA 3GMTA 1E2LA 3MFYA 1OH7A 3NBFA 5L3QB 4JLJA 3F1ZA 3KXLA 1IXRA 5BR8Q 2EJFC 4CEHB 1I4TD 2YJTD 1UKYA 4Z1MD 1WRBA 3MUFA 1A0IA 3FMIA 4EPWA 1JQLB 1H9SB 2QMEA 2UUBQ 1EX7A 1U8AA 4KI0A 2GWHA 4G7OC 4QFMA 1KO4A 5C0XI 2ANCA 2LSSA 4HUTA 5DI3A 2YOFA 3CF2A 5GAHC 1IYVA 1K3RA 4DV2L 1AS2A 1S1CA 1N5JA 2DFTA 3EZ7A 4PHGA 1NRJB 3CW2A 3HU2A 4OO1G 4NYIQ 1X65A 4N0DA 4P31A 4PQRA 3VR6A 4QBIA 3SI7A 5EAYA 4DV0L 4OYHA 3N5CA 5JEDA 5L3RA 3IIKA 2JA8G 5FTJA 1RW4A 1C9KA 4L8GA 2OCBA 1I4DD 1W3SA 1KY3A 3WXMA 1VCOA 5TMPA 2V4DA 1VQCA 4L5TA 1IXSB 2KSQA 3GLFA 2KENA 4BGDA 4LUOA 3SYNA 5DSZA 4IFDH 4HJ8A 2B8GA 2BE5D 3A8TA 5DE3A 2ODWA 4EX5A 3CMEA 4A3LH 3RDPA 4WXPA 3IDQA 3KLWA 1F3OA 3FHTA 3OHMA 3R9WA 4DKAC 4LJ7A 3U3RA 3FHCB 3LQQA 1QVGA 1SMYC 3TS2A 2BEKA 1M1YE 4DT1B 1HR0L 1GO3E 2A6HC 1FJGQ 4ZV4A 1MJCA 4MH0R 4JYAL 4Q21A 1Z6YA 2MMCA 3GLFE 3RN5A 4HLUA 1M6NA 1E9CA 1X1RA 2VPPA 4TMVA 3BGWA 4XWKA 5KYKA 2P2LA 3HKZE 1BBWA 3A0JA 1NKTA 1IBKQ 4BUJA 4AIMA 2XTNA 2R9VA 4AKHA 2EVBA 5M5WH 5J3BA 1CRQA 3ASZA 2CWAA 5UKDA 2PCLA 2WKPA 4OJKA 3K0XA 4PG3A 4TTRA 5CJPA 3O8CA 1OB5A 2JA7H 4JI3L 4JI2L 4R4QA 1DAHA 2VP5A 4FCVA 4O0MA 3WNDA 5GVRA 1O3YA 3MAAC 3CZQA 4DZZA 1FL9A 1X6VA 1T3HA 2GAAA 3GDEA 4QL3A 5C4MA 2J5XA 2R6CA 2D2CC 5DYGA 4OWXB 1VQ6A 3LAWA 2ONKA 1KI6B 1PMRA 4DR5Q 1K5DA 4KLZA 3K0AA 5J40A 3GEIA 4LF4Q 1I3QH 4A93H 2QPAA 2JJ2D 1GIAA 3B78A 3H2YA 1VQ5A 3Q7PA 4EJSC 3H94A 1XMVA 3OEEA 3RN2A 4JIMA 2VLIA 1I5FA 2WPDA 1DAMA 1OW3B 2WWFA 3A4LA 5HCIA 3S1NH 4OI0A 1AK2A 4GSYA 3S1MH 5FBRB 2VP6A 4IDPA 2HF8A 1KSJA 2GVDC 4B3GA 4YWMA 3CCEA 3Q85A 1OKKA 3LXRA 5CYPA 2BH2A 3EIQA 4CGZA 4IPGA 4UNSA 1KL9A 1BO6A 4TLEA 1BYIA 3QKRA 4PC3A 1GDDA 3FGNA 3SGIA 2PZFA 3Q5EA 1SHKA 2XNDA 2PEYA 3BH7A 2FG5A 3CRRA 4MRPA 3SEAA 4ZDKA 4DLXA 4ZDWA 5FI1B 4G01B 3H0GG 4A75A 1A2KC 1CJVC 2WJJA 3CRW1 1W48A 2NIPA 3AFPA 4TTQA 1E2NA 5AJZA 1FOEB 1XP8A 2GETA 1KMQA 2W58A 3F5FA 1MT0A 2ZT9C 3EC1A 4LF5L 1VQKA 3PO3G 4DR6Q 2CK3D 3TK1A 2Q3FA 2GCOB 2MFIA 4GN5A 1SXJD 4EQ5A 3CX7A 2D0PA 5DI9A 1E9DA 2ONJA 1U8YA 2QPTA 3LFUA 1OFUX 5E7IA 3NEMA 3AEZA 4DV5Q 1N36L 4A3MG 4ME3A 2F4VQ 4YY3L 2QQ0A 3HYRA 3P32A 2FFQA 1XNQQ 1SKYB 4KFRA 4S35A 2CE7A 3CPEA 3RSLA 4CDGA 2FU5C 3MCAA 4ASUD 2O5JC 4KVAA 1KDRA 3KTAB 2PI2A 3CWQA 3IUYA 3I1FA 2R92H 1P9WA 2JA9A 2WIBA 2R7ZH 4UPAA 2IYYA 4AYBG 2N8NA 3AKDA 3GFTA 2ZSFA 1S0UA 4BQSA 1Z07A 3RC8A 2FZ4A 1Z47A 2GN5A 5A5GA 5EP3A 4GBMA 1EFRA 4DT1A 1MO3A 4NZYA 5EP2A 3AVVA 1LF0A 3OEHA 4KAXA 3I4MH 1BYUA 1QF9A 2QGNA 1OH6A 4IW3B 4F93B 5GAEC 1E2VA 2FPMA 4URYR 4AKEA 4X64Q 5KOYA 5C0XJ 3F2BA 1X3EA 4LX0A 3M9BA 4M0LA 5FBWB 1II0A 4JI5Q 4F4JA 3C5HA 1LACA 4NXNL 3HOWH 3FKSA 5FPTA 1CSQA 2O8EB 1K8GA 1H8ED 2K5HA 3OTOQ 3QF4A 3Q3JB 1ESMA 1XBTA 2A68D 3UKDA 2FJUA 5KHOC 2YTVA 1E2PA 4LDJA 1XPOA 1Z6GA 2IX1A 3GTQH 2V7QD 5KO2A 1E9BA 4DHEA 3QXSA 1M7GA 1KO5A 1JPNA 3B7GA 5DNYB 2KBNA 4LFAL 2XGTA 4FIDA 3DOFA 3TR5A 1VQ4A 1MO5A 3DEFA 3A6PC 2WSMA 4M9SA 4ESHA 2A6ED 5FLMG 3AV0B 1W4RA 4LJ4A 4M1WA 2C77A 1L4UA 4D26A 2JIZD 2ZI7A 1NVUQ 5FBQB 2R65A 2ERXA 1W5SA 4TMTA 1OT3A 4AH6A 2MNAA 4RZ3A 2A2ZA 1KOFA 1KI8A 1A82A 3MJHA 5CITA 3LX8A 1TKWB 2WWIA 3FMFA 4GNXC 4RD4A 4TSFA 4NYJR 5FPYA 1GL6A 4WJ4A 2K7VA 4HR7B 2OLKA 4NMMA 4QBFA 2OQ0A 4KV9A 4C3JH 2R6DA 1Y1WH 1OJLA 4I4LA 4E09A 2C35B 1E2ZA 3WHLA 3VNVA 3L8YA 2IF2A 5DISB 2BMEA 2AWOA 1K8MA 4HZUB 4QXAA 3SZRA 2MSDB 2P5SA 3CNLA 1ZU5A 3TAUA 4A3FH 2CW0C 2OBMA 3QPWA 4KCGA 4PSVA 5KSOA 1Q1EA 1SLJA 4PR0A 3AVWA 2WSSA 2GILA 1WA5A 1IW7C 4JI1L 5FOWA 2QP4A 2CNWD 2GCOA 4PFSA 4NXMQ 2RAPA 3HOZH 3G0HA 2WJVA 4JLKA 2GESA 1SRUA 3CF0A 2DGYA 3ER0A 4JI0L 4DB2A 1ZD8A 2DY1A 4X8MA 5EXXA 1TWGH 1UKVY 4EQ6A 2ZETA 3UDFA 4HSEA 2D7DA 4HEJA 5B57C 2H16A 4DSOA 1VQ7A 1DEKA 3PFIA 3GQBA 2YOGA 5TVKA 4L9SA 2YNMA 3AH8A 3RRNA 1X6OA 2XTIA 3RR5A 3J81j 4Y0VA 2ZUBA 1QUQB 1DAEA 4IOLA 1COWD 3QQ5A 2WTUA 1W44A 2P6UA 1YZQA 1D2EA 1A6XA 3KJPA 5EUQB 3CWZA 4Q9IA 3P27A 1G6HA 4GNXB 1G1MA 4TZ6A 2NPIA 2VH5R 3KFXA 3AP3A 1NE3A 2C04A 1G8YA 1MV5A 3X1ZA 2XSZA 1O7IA 1I50H 2A6HD 4Y7NH 3IGFA 4FCWA 4RCZA 4B3TL 3J7A5 3CNOA 3L43A 4ZCIA 4IFEA 4UNNA 1QZHA 1HNWL 2GZHA 1FNNA 1Z6AA 2ZRKA 3NG1A 5LPNA 4IHQA 1UKZA 4M8NE 5L3VA 1W0KA 5LD2C 3A8IE 1OFIA 3A4NA 1PV4A 4KBFA 5B2ZA 4WOPA 2EWVA 1CFMA 3B60A 4TYWA 3PUXA 1PLJA 2C2HA 4HLCA 4G5QA 3UG6A 3F8TA 1RJ9B 3I4LA 1ZJ6A 2GK7A 1MOZA 1R5NA 2UXBQ 3M4OH 3NDPA 3A1TA 2VP4A 1YQTA 4OGQC 1YR8A 2D74A 3G71A 1G3QA 2VBCA 4MYCA 2VUMH 4RCNA 1UWVA 1X3FA 2F3IA 2PNRC 2J0UA 4G5SA 4LHVA 4TMKA 1FFHA 4B73A 1KSHA 2J0QA 1T3LA 3VX3A 1S3SA 1GJXA 1XWIA 5E7JA 3ZIAD 1W2HA 1NVWQ 5CB8A 2A69D 1HNZL 1BS1A 3MGCA 821PA 4FDBA 1H9RA 1H65A 1MO6A 3F2DA 3HOYG 2CCJA 3SJAA 4NL4H 3LLMA 4TYQA 4YXWA 4JL5A 4DUYL 4M2LA 4AWXA 2VQFL 3ULJA 1IN7A 3KB2A 3KL4A 2V8OA 3C7KA 4X62Q 3B1XA 3SQWA 5GROA 1V9PA 1RZ3A 1CEEA 3DZ8A 4APVA 1WDTA 4Q4HA 3ZZ0A 1E0AA 3U5ZB 1DCZA 4DV3Q 1LUZA 4Q03A 3ECCA 5HTKA 2R6GA 4P73A 2ZRGA 5LB4A 5AK0A 2IEZA 3CH4B 1FL0A 3CPHA 1P3JA 3TW4A 2UUBL 4W5JA 5KSZA 2XX3A 2IUSA 5KDOA 1Y14B 1G9XA 1VG1A 2BJWA 5LD2B 1FQKA 3GJ0A 3HR7A 4LPSA 4OO1I 5FUXA 2BKUA 5JJIA 3B1YA 4NKRA 1JJCB 1S40A 1TF7A 4A3LG 2EJMA 1W47A 3E1SA 1VQIA 4KLNA 5GADl 3FFAA 5FUYA 5HPYB 1PH3A 2ALYB 3OAAD 1E1TA 5EZ6B 3S17H 5JEAG 2CVHA 4KFUA 2BVNA 3GTLH 1NLZA 4E07A 4TL8A 3E9IA 1HT1E 1OIXA 2A5YB 2K5VA 1U0HC 3LW7A 2VP0A 4QNRA 3EPLA 3L7ZC 2YC2C 3U4ZA 2OTLA 1HTWA 3OIWA 4DWJA 2QU8A 4BFWA 1MABA 1A63A 5J4VA 1RRFA 3EA0A 5DHAA 2IYWA 5IYBG 1XMJA 3H84A 2YTXA 1XPRA 1IY0A 4POAA 3GLIB 4V0MA 4JZKA 2BOVA 3E0EA 3CLVA 2JASA 4LBWA 4M9ZA 2ORVA 1AQUA 4BLOA 1MRSA 3L0IB 3IEVA 1D7QA 3GEHA 2P3SA 4UY8C 3AUXA 4DR1Q 3OIYA 3CCUA 4W5WA 3I5YA 2BDOA 1FJGL 1KMHB 2WFWA 5CIWA 4NYMR 3W8RA 2KWIA 4A3KG 1OXVA 3WBKA 4PPGA 4AD8A 2HQLA 5IWAQ 1XJQA 1ZW6A 2VSFA 2VSXA 4DVGA 1LYLA 1S9DA 5KNBA 1BMFA 2W2VA 3ERSX 2QSYA 4GZLA 4NYJQ 2Y8EA 4TLCA 1GFIA 4V0ME 4L8JA 3UDXA 4DV0Q 1JEEA 2O8FA 1U5KA 1E2GA 3S1AB 3W34A 4A9AA 3KX2A 5KDDA 1G8FA 4QNMA 4GKKQ 1RJ9A 1NG1A 2KBEA 3O8DA 1CKOA 1JI0A 4GFDA 4IKEA 5HE8A 1KIMA 2JA6G 1FPMA 3KJGA 2XB4A 3TR0A 5KPJA 1NG9A 1J8MF 4ZI2A 1Q21A 3REFA 5DO9A 5FBVB 1KYIA 4PO1A 3U3MA 2X19A 4QBHA 2IEYA 5JSZA 3THYA 3H3VI 5JRZA 4RCYA 1GUAA 1YE8A 3TS0A 3Q5DA 2B3GA 3EW9A 4LWZA 4LF4L 1Z83A 1V8QA 3HPQA 4OO1H 1R0ZA 2W6IA 3BXZA 4PHTA 3TH5A 1K9MC 2QBYB 1LTLA 3U3JA 2GXQA 1WF3A 3LNNA 4DLRA 1ZYRC 4B47A 2J59A 4MKHA 3K53A 2JA8H 3TQYA 4DLYA 1WE2A 4M1OA 5D3QA 1GITA 4IOCA 4JYAQ 1CS4C 1QVFA 2VHTA 2W6JA 3CCQA 1F48A 1A8VA 2Q2TA 1B7YB 1D9XA 1U94A 4Q1CA 3CR7A 3LBIA 2SHKA 3ADCA 4CYMA 1S9HA 3SS8A 5KSPA 3VKGA 1XZPA 1GWNA 4TQ9A 1SVLA 3PENA 4KBGA 1XMQQ 3W6PA 4OX9Q 3X1WA 4LYJA 3EWSA 3PO2G 2XGJA 1E1RA 1T8TA 1UBGA 4LZZA 3KJHA 3KXIA 5E95A 2HV8A 4HJ5A 2F1MA 1UJ2A 4JI3Q 5AJVB 2XZOA 2QG6A 4F4IA 1VG0B 1KQSA 1W1WA 1AN0A 3TSOA 4GN4B 4OHXA 1N6HA 2CDNA 3RWMB 4DR6L 5GJWC 4CEJA 4OXPA 2OZEA 3K7UC 1KK3A 2G1JA 1OFHA 3R7WB 2W00A 4BZQA 4NCIA 2F4VL 4IDNA 3NBYC 3TMKA 1E32A 1UFQA 2B6HA 2PNHA 1NY6A 5JRJA 2QE7D 4YLGA 2LXJA 4JL6A 1XRJA 2K4KA 3CCMA 1MRNA 2H57A 1MH1A 3NVAA 4HJAA 4QGGA 4RD0A 3VTKA 1RRPA 4EFLA 4A92A 4C0QC 1G16A 3PIRA 4DDWA 2W0SA 4QY7A 2GTPA 4R98A 2BMDA 4DK6C 2CL6X 2FZLA 1R4AA 1YBYA 2IW3A 3CM0A 2Q9CA 1HZAA 2JLYA 1UE1A 1J90A 4Q4AA 1KMHA 2YHSA 4HAWA 2Z4SA 1RRCA 1SN8A 4EFMA 2NQ2C 2BEJA 3VDYA 4KODA 1ZIOA 2AR7A 2VA8A 3HOVG 4QIWE 4OHZA 1YHQA 2XXAB 1JR3A 3D8BA 1OXUA 4Q4JB 5E3HA 3BFVA 1ELOA 5AJYA 1LABA 4A0GA 3IBGA 3U7FB 1NJFA 4JI5L 1JB1A 3A1SA 2QQEA 1D5CA 1VS0A 3WYFA 4YMTA 2E8GA 3I7FA 1BKDR 2E1RA 3M4YA 5LMNW 4B74A 2DUDA 3EX7C 2EWWA 2NOAA 1Q86C 2K5UA 4JLDA 4AYBE 1R0WA 1WYDA 2NZ8A 2HEIA 5FTNA 1KK1A 1N36Q 2J1LA 4LYAA 2VHCA 1CR1A 4YY3Q 3UG7A 4LFCL 3KOJA 4YHHL 2ZI4A 3HU1A 4R4OA 5IK2D 1E79D 3VFDA 2BJVA 3QOFA 2ZTDA 1JR3E 1KTVA 4XSGA 3BC1A 1P4SA 3LW8A 4LYFA 3RS0A 4XVUA 5HKKA 3H0GH 2ANBA 1Z08A 2H1LA 4BFYA 1W4BA 2DFNA 5JWOA 4AY2A 2ZROA 4D6PA 1QHXA 1NI3A 4IXNA 4C3ZA 1L0WA 2FN4A 3PO3H 3K81C 2QBYA 4AYXA 5AUOB 4RY2A 1TQ2A 5LB2A 2B8TA 1SZPA 4NHOA 1I2DA 1OXXK 1DARA 3K09A 4V0KA 4L9WA 3SHWA 1B8AA 3RNUA 4A0HA 4BE7B 2HIVA 4PZYA 5DLQE 1EUJA 1R5OA 1YU9A 2O8CB 1E2KA 2RHQB 4L5RC 2QEQA 1JT8A 1IXRC 1P61B 2AUKA 4RD6A 2IS6A 3TLXA 1GTVA 2K14A 3U6BA 2AL7A 2REXB 1US8B 2B21A 4DC9A 4O25A 4N1AA 1L2TA 2FGJA 1Q7YC 2ZPTX 4B48A 3M0EA 4R4TA 2WMOB 2E5LL 1VG8A 4K46A 1VQHA 4KSBA 4F7WA 1QRAA 2JLUA 2CBZA 4KLKA 1GUNA 3CW2C 1I6HH 1NN5A 1QVRA 1W4AA 4I7ZC 1EIYB 1CULC 1UF9A 1Z8FA 2WJYA 3P26A 4NYMQ 4RD1A 4UXHA 5AJWA 4NXML 4Q1AA 2Y0SG 2HJVA 4CT4B 1KGDA 4HB3A 1TF5A 1W5TA 3HKSA 2X1VA 2C78A 2E2JH 3TUZC 1KJYA 3GJXC 3PXGA 4TMZA 3AQQA 1VYVA 2ZRLA 3C8UA 2IS2A 1Z0JA 4NBSA 4DCUA 1XEXB 3HFZB 3QY0A 3ZD7A 1Z9FA 2JCSA 2QPOA 1KO7A 3IHLA 3IIMA 3B9QA 4S2EA 4XWAA 1PH8A 5IE8A 3FKIG 4Q1BA 4OKSA 3Q7QA 1N6LA 1SQ5A 4XSHA 5H68A 2RGNA 1TQDA 4A1FA 4GP7A 2O5IC 4Q7JB 4U7DA 2P0EA 1GUSA 4HLDA 5FLMH 4DV1Q 1F2TB 5K8LA 3BZCA 3D4RA 2N46A 1LB1B 3IQXA 4YDSA 4OI2A 1E7ZA 2E2IH 3AB9A 3LY5A 1CR4A 4HLUC 4TWZA 2UZ3A 3GEEA 4O2RA 1R8QA 1NMYA 5J4LA 1E3MA 3ND9A 2DWOA 3AQ4A 4JI1Q 5KPDA 4PPQA 1OH8A 1BOFA 4KN7C 2QNRA 4OL0A 2C9CA 5FBLB 4C0LA 4B2PA 1FUUA 2PT5A 3FHOA 2YYZA 4JI0Q 3U44A 2YC4C 4QKQA 3L0SA 4NCJA 4RZ2A 2K5NA 3KKOA 1GRNA 1YHNA 4Q4LA 3I32A 3PEYA 4G7HC 1CXZA 2FFAA 1IYJB 2VIIA 3UDGA 3ZGXA 3CO5A 2NVXH 2DCUA 3O8BA 5M3MG 2A5FA 1O7LA 3CUEF 2QT0A 2AKAB 2GEDA 4ZDIA 3KF6A 3GLFB 3R20A 4B71A 1N34L 1JR6A 4TMWA 4LC1A 5FUWA 2BDTA 1N0WA 5JWHA 4MRNA 1XMSA 5GQOA 1J99A 2DHRA 1WBDA 1LTQA 2H7VA 5FOXA 1Y69U 4Z54A 2IX0A 4P74A 2J0VA 3DLLA 1QHHA 3LH5A 4KO8A 1GL9B 2OFOA 3TRFA 2X2FA 3PVSA 1XD9A 4B3ML 1YKSA 2BBSA 4GZYC 3EPKA 4HZIA 4X62L 1KK2A 1HNWQ 1E4YA 3FHWA 2OILA 1W4CA 5M3FG 2XB2A 4DLSA 3IRBA 3B6EA 4LGMA 3RSOA 2G77B 3N2EA 4B3CA 4BLTA 1Y1VG 4HB2A 5FL7D 1BIFA 4R71A 2BH8A 3UMRA 1TU4A 2LKCA 4HAUA 3ZQ6A 2JLXA 4LJAA 3EIHA 1QG2A 1FZQA 3CRLC 1G17A 1T5IA 3IO3A 4OI1A 4DUGD 2O8DA 4LI0A 1IAQA 1WMSA 2JDID 3SFVA 3LVQE 2EJGC 3CPFA 1PA6A 3TNFA 2ODBA 4EIWA 4TZ0A 1R5BA 3EZ9A 4HI0E 1ZU4A 4QL5A 4OWTB 2ATVA 3IPXA 2VW9A 3NBXX 521PA 4EAQA 1HNZQ 5KNCA 2CHQA 3MD0A 3K0AB 2F6RA 1PYBA 1DE0A 4DR7Q 3B1VA 1XTQA 2JATA 1K5GA 3OZXA 4RFVA 3SU8A 1L2FA 5G53C 1D6JA 3WNBA 1CR0A 3IQWA 4BECA 1MKYA 4DUYQ 3LWNA 1NY4A 2VQFQ 4OK6A 2PZEA 4JVNA 5AWFC 5EJEA 3L2OB 4PZ7A 2QGZA 3I56A 4Q00A 3E5HA 1G51A 4BZPA 1F2TA 1Z3IX 5M5XH 1XFAA 1CU1A 1QDEA 3IILA 1HR0W 4LFBQ 3QKRB 2WKQA 1YZTA 4BEJA 2JLZA 4DR1L 3EPHA 5B30A 1IBML 5H1YA 4LBZA 3AP2A 1FTNA 1JXMA 4HUQA 2ZAMA 1N33L 5EZ5A 4JBWA 3HOYH 5BYKA 4KHZA 1TWFH 4XVQA 4PXAA 5IWAL 3MWKA 2KCCA 5SZIA 1YRAA 4B44A 1C1YA 1S3GA 3HPRA 4JLBA 4MUBA 2PPBC 2GVAA 4UKDA 2Z5FA 3NIBA 5EE9A 1E0SA 4G0NA 1XEWX 4GKKL 4IJLA 1XB2A 1JAIA 3SDZA 2OQKA 1OE0A 1PUIA 5K36G 4C3HH 2DWPA 2YZ2A 3CCRA 1X9NA 3CRVA 2IY5B 2NVYH 3JVUA 1JE5A 3J81i 2ZR7A 5L3SA 4E03A 1CP2A 2ZRCA 2ZRPA 4QHTA 3TBKA 4UP7A 4UP8A 1IOZA 1D8TA 4R4IA 2FV8A 2DB3A 1XD2A 2OBNA 1G7SA 3MWJA 3PR1A 1R8SA 5JEAH 3ICEA 4KJZA 4OQMA 1R0YA 2A8VA 4LSGA 4UP9A 3FWYA 1YJWA 3OW2A 1Q3HA 1SKQA 1WCV1 2EFDB 2R7DA 3M4QA 4TL9A 4A3JG 2WAXA 1ZNZA 4LK1C 3K0FA 2ZR9A 1XMQL 2WOJA 1IONA 5GJBA 4RKFA 5IYBH 3A74A 4OX9L 1QZXA 2GK6A 2BC9A 2F1HA 2Z43A 1NMFA 2H5EA 2JE6I 2FSFA 4K8OA 4ARZA 3AKEA 3QF4B 3U60B 1D2MA 4EPYA 4QOSA 2G0TA 3PIPA 2Q3HA 2KHIA 4JJZA 3DM5A 4LJ5A 3A1WA 1UBEA 2L15A 1CIPA 4LC0A 1E69A 1OIVA 3TJZA 3I61A 4FWIB 2PQAA 2IBMA 4D4LA 1PH5A 1HZ9A 4IOJA 4RMFA 4A3KH 2YWEA 1KRSA 1TAGA 3PGZA 5JS7A 2ES2A 1EFTA 3UE1A 4L15A 3AVOA 4W9MC 3FMCA 1I2MA 2ZSAA 3VR4A 2J7PA 4GPTA 4BLSA 1LM0A 3WMFA 5IRCD 4FCTA 4O3MA 4PC6A 1XCMA 2W2XA 2IL1A 4DAYB 5FOSA 1VQBA 3Q8DA 3OIVA 3B6YA 2UZIR 2X2EA 2JA6H 3LGJA 3RLOA 5SZHB 2ZI9A 1VQDA 4QHSA 1X54A 4BA1I 3EZ6A 1AQYA 4JLVA 2IWHA 1C4OA 2QP3A 3DKVA 4L5BA 1CSPA 1HQYE 5BN5A 3B82A 4HJ9A 4IFDJ 1CJTC 4JLMA 1FNMA 4DRZA 4IDQA 1HA3A 1X86B 3HYTA 3WMGA 4YQFA 1U99A 4QGFA 1QHGA 5EE5B 2F3TA 4XIGS 3SJZA 1K83H 3CF6R 1UAAA 1G8GA 1GL7A 2EFGA 2JA5G 3MWLA 1PJRA 2D62A 4DSUA 3PQCA 2PLFA 1YVDA 3R8FA 3C16C 4L5QA 2PMZE 4PHHA 1G5TA 3GLHA 4IVRA 3X1XA 4DEXA 2MQHA 1E4VA 4B3SQ 2CQOA 4EQ6B 4X8HA 1W46A 4TL6A 4PC2A 2BIFA 3D0FA 4R7ZA 4A3BG 2R2AA 2Z0SA 3PO2H 3TUJC 5FPSA 3QF7A 4JYCA 4PANA 3THWB 4PZLA 1BBUA 4BLRA 2V7QA 2GXSA 4B35A 1X8JA 4H44C 1GZSA 1W36C 2DNCA 1ZNXA 1YR6A 3PEVA 4WBSA 1ZBDA 3QXHA 1VIYA 5GJCA 2QT1A 3GLHE 2WVJA 4IPDA 4OBEA 4DSNA 3UPUA 3G48A 4TN1A 3PUWA 1JB7A 1WI5A 2TMKA 1UBFA 3CP0A 1G21E 4TQAA 1HQCA 3R8CA 1TTTA 2KB0A 2XAUA 3ASYA 3MXUA 1UDXA 2BM1A 2EYUA 1OKKD 4W5HA 1YZLA 4A15A 1P8LA 4FN5A 4MKGA 3HP1A 4GL2A 1N0UA 1UEJA 1AIPA 1M2OB 1TX4B 3FE2A 3ZVLA 4ABYA 2IWRA 4ACAA 2XNDD 1HJPA 4A3DG 3KJIA 4LFCQ 4PO9A 4LJ8A 4YHHQ 3QXJA 4PAQA 3U7GA 1IY2A 4JI7L 2LCFA 1YI2A 4TQUS 2I5MX 4I1SA 4JI8L 3M6AA 3DO6A 3HOVH 3I8XA 4JSTA 1KD1C 5C4JH 3AF4A 1KDOA 2N78A 1QHYA 3VR3A 1HUQA 3W5IA 3T1TA 2VP2A 3GLGA 4IRUB 4PAOA 2IYUA 3I2ZA 2JQOA 2CNWA 2J0UB 2F9LA 2C9YA 2FA9A 1TL7C 4OQLA 3A8JE 5L8VA 3AF1A 3CCSA 3U4QA 2WICA 1W36B 2XJ9A 2ATXA 2I3BA 3G6EA 2Z6VA 3L8ZA 5HGQA 3U58A 1OFTA 1ZRHA 5FTLA 2QN6A 3EARA 4A4DA 1RC8A 5CM8B 4KHPL 3JC66 2BHRA 3AKCA 4DK0A 2OHFA 4MKIA 2RGAA 3GLGE 3VKHA 4LJZC 2G3YA 3WP0A 3TKLA 2Y0SE 1EFRD 1OIWA 2J3EA 1COWA 4DV1L 4Q4HB 5C3EG 1G8PA 2L5TA 4ZI3A 4X65Q 2E5LQ 3RS2A 4PZZA 3ADKA 2Z6KA 5CLLA 2ZTSA 1KJZA 2HLDA 4Q02A 1HH2P 2QGQA 2CHGA 2B63G 3FFBA 3LXXA 3P4YA 3UK6A 3CX8A 1E2IA 1Q0UA 2YWHA 5JECA 1TMKA 2PX0A 1OLOA 2ZYVX 4GLXA 4YWLA 3FKSD 3KUDA 1W0JA 3P4XA 2CVFA 3W90A 3PJRA 4X8LA 1N6KA 5H8WA 1RKBA 2A19A 3U9SA 1VQ8A 1XTRA 1LW7A 5DYIA 3CCLA 3U4VA 4B43A 3GJ3A 4PO8A 4GNKA 1EWIA 3W8NA 4JI6L 4XWOA 5JI3E 2ZI6A 2W83A 3THWA 1FR3A 4GT1A 1P60A 3T5DA 2IYLD 1HV8A 1CUKA 2HCBA 1KJWA 3GJ4A 4LUCA 2OSBA 4W7SA 1MABB 4GKJL 2B7BA 4BFXA 1MJEA 3M85A 3S14H 2Q3MA 4C0AC 3CCJA 2GJKA 5KUTA 2UUAL 3DM9B 1FQJA 2DR3A 2QAGA 4F4CA 4DAMA 1JJ7A 2YWGA 3TVTA 1XXHA 4NCHA 2NO9A 1RIFA 2ZJ5A 3K8YA 1KKLA 1E2DA 2RHDA 1XNJA 4FINA 4II7A 3AGQA 3SYLA 3BERA 2CCKA 4TT3A 1SVSA 3OPOA 1QVAA 4LRWA 3IKJA 2NPFA 3PEWA 3HDTA 2OV2A 1C7YA 4JT4A 5TV2A 2LXKA 4MNOA 4LUZA 2VQSA 1J5EQ 3FKIH 4KYUA 2WJHA 1X3SA 4UNPA 4DIDA 2GJSA 4KITB 1XTIA 2OCAA 4JYBA 2G0NA 4IJHA 1EOVA 1XXHE 3X2SA 2O8FB 3L2PA 1L4YA 3QENA 1ZCBA 4EPXA 2CMKA 3SJCA 3DZDA 4MZ9A 4NTZA 1N3BA 1NN0A 2PMDA 1TU2B 1OSNA 2J87A 1VMAA 1ZUIA 2PBRA 3ZYCA 4TVAB 4A3IG 5BYJA 1N34Q 1GVNB 3NKVA 3GO5A 1YITA 3EC2A 5FOTA 4BRUA 4BEBA 1VECA 1JNYA 5JSZB 3ULLA 2AXPA 2E75C 1CF4A 3THYB 2NVTH 1YJ5A 2H92A 1KDTA 3BB3A 4HIDA 1VQ9A 3A58B 1IZ6A 4KSCA 1G7TA 4DR7L 1X8KA 2QAJA 3CONA 3KXKA 2KCMA 4JJKA 3OAAA 3NWJA 4US1R 3I5XA 3W1BA 2WAQE 3U50C 4EKDA 2GXUA 2YWFA 1B9NA 3I4OA 2HYDA 4B3MQ 2E2HH 4NDZA 5M3MH 3L0PA 1QBKC 3K0EA 3M7NA 1E0JA 2IHFA 5LMUL 2Z4RA 4R2HA 4A2PA 4AKGA 2D2EA 2HYIC 2IUTA 2QRNA 4N3NA 1NLFA 1OXSC 1Y8NB 2ZRAA 4LFBL 5CLQA 4GP6A 5E4FA 2AN9A 2L0XA 1N5KA 3LWUA 3QEJA 5CK5A 5IP7G 2WB1E 4YCWA 1AZSC 1VTKA 1E9RA 1LVGA 1TUEA 3DMDA 1L1OA 1UEIA 1T5LA 4LF8L 2NZOA 1D2NA 1TUIA 4JLAA 4AIIA 3BS4A 1T3SA 3J80i 1FP7A 4ZDJA 5DN6D 421PA 2A1AA 1Q22A 2AXNA 2JLWA 2EVWX 2QA4A 1DAIA 1W0KD 3AGPA 3AFQA 3G5UA 1OHHA 1UKEA 3RS7A 2ZJPA 3W5JA 4CEJB 4H1UA 1KO8A 5M3FH 1NJGA 1VF7A 2VRWA 4C9BA 3G4SA 4YMSA 2GVBA 2GZDA 4JLOA 5DLQC 5FPHA 3T1HL 2GRJA 3FPAA 1Y1VH 4MTNA 2Z83A 3TGPA 3CD6A 2RB4A 3WRXC 4A0FA 1BH2A 3B1WA 3PF5A 4NCKA 3ZVMA 4P33A 4MGZR 3P1JA 4BY1G 4KMUC 3WP1B 3GJ7A 1NSTA 3SBDA 4DLZA 3ETLA 1X55A 4B3RQ 8OHMA 2FEMA 4YDHB 1SGWA 1IBLL 3GTMH 1P73A 4QBGB 4Q9JA 4AI6A 3KLRA 3K09C 2FSIA 2H17A 4HIOA 3IPYA 1R0XA 1W36D 4NH0A 2R93G 4LV5B 3JAMi 4WZBE 2GXAA 1W2BA 4Q4AB 2RGEA 5BN4A 1IBMQ 4YXWD 4JL8A 5FOUA 3KJOA 2G6BA 3KF8B 2AX4A 5AUPB 1N33Q 2LKDA 3F3YA 1E1QD 2GVZC 2J9RA 2GJAA 2YOHA 5CJ2A 3U7EB 3UMFA 1SVMA 2VO1A 3R9XA 1VYUA 2MMGA 2QTVB 3NTUA 1TEVA 2A30A 4MGKR 3OESA 4HDOB 3GTKH 3UANA 1HPCA 3RRYA 1G19A 1DD2A 1J7KA 1Q81C 1ZVQA 1M74A 4D80A 5AJXA 1JBKA 4A0RA 1GP2A 2OBLA 3T1VA 2V4ZA 2PT7A 4MRRA 1RE0A 2ZJ2A 3A1VA 4ZIRA 1O78A 1OF1A 4XD7A 1Y63A 3BOSA 4URXR 1SVOA 4K0KQ 4A3EG 1PUJA 4PPNA 1ANKA 3OW7A 1EFWA 1JQJC 1VQMA 2OUKA 4WZAE 3ZD6A 1HQMC 2PJZA 2UU9Q 4WW0A 2VF7A 4D4KA 2V3CC 1JXOA 1GVPA 2RCNA 2JGNA 2I4IA 3NXSA 3QBVA 4RZUA 5G41A 5F2EA 5C0XG 2J0SA 3QI2A 1R6BX 4BPBA 4RFSA 3K0SA 2A3RA 1Z5ZA 2BBWA 2JEOA 4IEIA 1Z0FA 4ESVA 3OOCA 4OHYA 1Q44A 1DGSA 4MRSA 1II9A 4P4SA 2BWJA 4MYUA 1ZUNB 4GOJA 2MO1A 1KHTA 2QMOA 1K8OA 3CPWA 1KY2A 1N2CE 2RHMA 2RGNC 4PQYA 4B6FA 1U2RA 5K36H 2IYSA 2QE7A 4C3IH 1VQJA 2OCPA 5AUQA 1YZKA 4QGAA 5FR2A 4DXAA 2WWYA 2ZU6A 2ZJ8A 2O8BB 4DV4Q 1PH6A 4B3DA 5HZHA 4KKSA 4G3XA 4NB3A 2NO7A 2Q9BA 1EFUA 4BLPA 2QSZA 2CWPA 1HH4A 1S4QA 1K0RA 2BMFA 4N0EA 3QSYA 2Q8IB 3VR1A 3ZH9B 2VZAA 4QG7A 2ASBA 4MA4A 3GJ5A 2FWRA 4WVFA 4AG6A 4DDTA 1TU3A 1VCMA 3T35A 3FDIA 1IW7D 3JZMA 5EE0A 4XTCS 5FJ8G 2O5VA 4B2LA 5CK4A 3T53B 4A3JH 4JV5Q 2BKEA 4TLDA 621PA 1YJ9A 3KB1A 1NVVR 1NBWA 2ZXUA 4B3SL 1R7RA 5BQ5A 2CE2X 1EESA 3A5UA 1RFLA 3O47A 3Q8XB 1G3MA 3AVPA 1WP9A 3CZPA 3DOEA 1P2TA 4BZXA 1J6QA 4HDCA 4FMCB 4ZCMA 5IK2A 1E79A 1UE6A 3S24A 2A9KA 1B0UA 1G7CA 1G291 5TDHA 3IBYA 3SOPA 4BFVA 2W6ID 1OH5A 5C2JB 4URVR 2ZE7A 3KDSE 1CKEA 3DVLA 3QIAA 1FGUA 1G3UA 4IEEA 2E76C 4R4CA 1HCZA 2XTZA 3B8HA 3D31A 5C46F 1GNRA 4FXPA 4YMWA 3W1GA 5FTKA 3TW8B 2ZJZA 3ZDQA 1YIJA 2G9NA 2ORWA 1HZCA 1PLLA 1H8HA 1ZM2A 5F9FA 4LV6A 2D0OA 3IFTA 1P75A 1M34E 3U44B 1R9TH 3PSIA 3HOXG 4B2IA 1NN3A 4DB4A 4TYYA 1NMXA 2HXSA 4QC2A 5B64A 4LOAA 1KHIA 3KQHA 4MQBA 3KDFA 1NP6A 3J7ZC 1SVWA 3QPVA 1ZMXA 4D82A 3FOZA 1EX6A 1E1OA 4BY7G 3LBHA 2I5LX 1S8FA 3KJEA 1AE2A 1QVCA 1LY1A 3OF5A 3J81c 4B33A 4M22A 2R6AA 5DGXA 1P62B 3KF6B 1YZUA 4BBSG 4J0QA 5H70A 1XTSA 2ZM6L 1V1QA 2JA5H 2ZANA 2Q0HA 2WAYA 1ZP6A 3OFNA 3STBC 1EGAA 3CPJB 4XVRA 3KUCA 3BG3A 4JBJA 1G7RA 1X1SA 2VP9A 4PZ6A 1HYQA 4LNQA 3BORA 5G3YA 3VA7A 4B75A 2VF8A 3ZS9A 3CNNA 4NCNA 1WB9A 1QHHB 2FSHA 1PYSB 2O8BA 3HOUG 4A3BH 3EWAA 4LHYA 3CRKC 1TWAH 4CVNA 2BE5C 3AVXA 2OTJA 1ZUHA 1GNPA 3NBZC 5JJKA 4D0GA 2GNOA 3U3OA 2FH5B 1IBRA 1I94L 5AJ3Q 4X65L 4A8JA 4LYHA 4UNRA 5FR1A 2WJGA 3EBEA 1H9KA 1YZGA 1R2QA 1ZKOA 1IHUA 2OO7A 1JR3D 3AF3A 4JS0A 4U02A 4POFA 1TWCH 4RG1A 4JI7Q 1G5RA 3PUZA 5HY6A 1Z2CA 4DJTA 1A5TA 1KC8C 2IYTA 2WHXA 4JI8Q 1WQ1R 4LHZA 4LW1A 2ZR0A 4ZPXA 3RABA 2O8DB 1AS3A 4AURA 1N0VC 3W3AA 1T4GA 1CI3M 1GSIA 2R7FA 1P2SA 4IDOA 2N3SA 3RNLA 2AFHE 2KJQA 4FMDF 2E9SA 4J15A 1CJKC 2F55A 3TEHB 1F6BA 3CMAA 4JG2A 3UMSA 1ZM9A 4TMXA 2ZE8A 3NEYA 4A3DH 3FMOB 1X56A 2WWGA 1DO0A 1GUTA 3S2HH 2EQBA 1E24A 2QM7A 4KHPQ 4FD2A 2JAQA 1YNNC 2IYVA 2ZE6A 5A35A 4MITA 3W6NA 3K7AH 2RKOA 2YVUA 3BH0A 1PH2A 3U7HB 5SZKB 4P72A 3EA5A 3CCVA 2ZTCA 2HXYA 2WMNB 2ZYUX 2ZI5A 4OHWA 1F2UA 2VSOA 2XOKA 3A4MA 5EP1A 4A3CG 1EXMA 4RSGA 2AKWB 4HUQB 2WWXA 4MUAA 4MYHA 1J5EL 2B29A 2ZS8A 3RVBA 3DHWC 3EZFA 5HE9A 3CRQA 3AVYA 3W5OA 2VY3A 2P5TB 3WNCA 3M3YH 3BFKA 3RS4A 4JI6Q 1IYUA 4YWKA 2ZJBA 3E2IA 4HYYA 4BXXG 4PC7A 4HJ7A 1E2WA 5C3EH 5F98A 2HJGA 2PZGA 4UXJA 2N1BA 2NN6G 1ZAKA 1WFQA 3WRYC 2FDCA 4PPFA 4BFSA 3EN2A 3ZZTA 4Q1EA 2B63H 2GCPA 4OJQA 3TRZA 5K8TA 4GKJQ 2KE5A 2C5LA 2KA7A 2GKSA 3B5JA 5L3SB 2GJ8A 3V9PA 2EQSA 2IS4A 2JLSA 1M7HA 2UUAQ 2JDIA 2XTMA 3A36A 1E9FA 3QVUA 4FMBB 4A2WA 4DR4Q 3PV0A 4IDHA 3W6OA 1XD2B 3KYHC 1NVVQ 2OT3B 2PX3A 3HR8A 2R6FA 2EFEB 3GTJH 2ZYTX 1RIPA 1QZGA 4Q9KA 3VHLB 2GHIA 2VL6A 4BFZA 4RZXA 4D0NA 3OE7D 3LVRE 2C8VA 5JWRA 3B85A 2UUCQ 2JJ1A 3B2EA 3K0FB 2WAQG 1KI3A 2BBOA 3RZDH 2FE4A 4ILEA 1CRPA 4ARZB 1CBUA 4EPVA 2GEUA 2DPXA 1NMGA 2FEOA 1ONBA 4Q5IA 4Z1MA 5IT5A 4LF7Q 2YU9H 1OPXA 4Q1FA 2I0QA 5TB5A 1NLYA 2Q9AA 3KKPA 2IYXA 5EP4A 3I4NG 2PQAB 2AK3A 3LBNA 3LD9A 3QE0A 2QZ4A 4URWR 4ZKEA 1VQGA 2A5JA 2C96A 1VQOA 3V4RA 1U9IA 4LHWA 2WB1G 2QL6A 1E2EA 1FX0A 2FFBA 1U0JA 4JBYA 2IHEA 1Z0AA 2NG1A 4KN4C 1CKMA 2IXEA 3GTPH 3BZKA 1EWRA 1NBMD 1TADA 4A2QA 4BASA 4D2IA 4Q7KA 1G5PA 1UE5A 3THXA 2CL7X 5A0FA 2GAOA 3ND8A 2DNEA 3IHWA 5EUMA 5JBQA 2JK8A 1IN5A 1CR2A 1KI2A 3ONWA 3QUSA 4B3RL 4LK2A 1EK0A 3K1JA 1VIAA 1QHSA 5LMUQ 4UQOA 4IOMA 3WYGA 5B58C 3NDBB 1Q12A 4A3IH 5JHGB 1Q82C 1CLUA 4LBVA 1PH9A 1DG1G 4QJ3A 1YVCA 4IVPA 4R2IA 1AJEA 5ELOA 2IYRA 1PFSA 1JJ2A 3EZ2A 1FMJA 4JSYA 2Q2IA 3FKQA 3H15A 2IXGA 4ZCLA 2RMKA 3X1YA 4DDVA 1UE7A 4LF8Q 1IQPA 4HIKA 2QP9X 2WWHA 2V55B 5JCZA 5ELXA 2MO0A 1JJGA 2ZRBA 3QKSB 4C4PA 3VU9A 3F0TA 4P71A 1TF2A 2ODNA 1XCPA 4X66L 1DS6A 4JKIA 3UATA 2QEXA 3A1UA 4OHVA 3GJ8A 4F38A 1YEZA 1P5ZB 1T0JB 2F43A 2CJWB 2IHYA 2CKZB 5G40A 4HAYA 2GBLA 3SE0A 3MLEA 4OQFA 4CEIA 3T1HQ 3GLHB 2ZSDA 4C2MH 5JEEA 1TEXA 4K0KL 2PCFB 2ATWA 1VKJA 5IP7H 5FFMA 3BDOA 2UU9L 5FH9A 4QGHA 4JVMA 4GMXA 1P7CA 5M04A 1ZIPA 1GKHA 3MXNB 5IDVA 1IBLQ 1CKNA 4C30A 3CH5A 4O2LA 4P4TA 4FW9A 4NPHA 1VDZA 2PL3A 2PJRA 2NO1A 3STBD 3C41J 2ID0A 1XEWY 2JJ2A 3C15C 4KKTA 1A2BA 2P67A 3NC1C 4I1VA 4PSAA 5J4KA 2P6RA 3CC4A 4GI7A 3K0CA 3O8RA 2CFMA 4JOIA 2WIAA 1Q3TA 2ZM5A 4DV4L 4BY1H 1KNQA 2ZRDA 3BH6A 1TQ6A 4DNIA 3BRWD 2Z6KC 3CKLA 5EE3A 1Z6HA 1ZC3A 2RGBA 1Q1ZA 1E3PA 1TQ4A 2XEXA 3LDAA 2RHSB 2R93H 4JLPA 3ZJYA 4DK3C 2RH5A 4BLQA 3MSXA 1E96A 3I92A 1IXZA 2AHOA 2FXQA 1XMOL 6Q21A 1M7BA 2IXFA 4GOKA 3PEUA 4CIDA 2D5DA 3A7LA 4IQZA 1VQAA 4P3YA 4JV5L 1KDPA 3GLGB 1B23P 5IYDG 4GN3B 4QQBX 1SMXA 2CK3A 5F3WB 2JLVA 5IF9A 5JJLA 1SXJA 4DUZL 3CC2A 3S15H 1Z6XA 2P6NA 4PAMA 4DCNA 2JEAI 1XTDA 3ZVRA 4ALPA 1MIUA 3OIUA 2ZSEA 3U4QB 3LV8A 5EXPA 2BA0A 1SR3A 2QENA 2QTHA 3GTGH 4M9XA 5DHFA 2AKYA 2FF7A 4ASUA 2VHQA 4RVCA 1H95A 4A3EH 2QAGC 1Q8KA 2IT1A 1QHNA 1V5WA 1YZ6A 1GHJA 1YNJC 3NH6A 4M1MA 1TXYA 3CBQA 3SHFA 2VNUD 4MKFA 3GD7A 3GFPA 4C7OA 2HCJB 2ZUDA 1WOCA 2A69C 4DV6Q 2A7QA 4LJ9A 4TLBA 5C0XH 2D06A 1PZNA 1XDBA 1ZM4A 3PUYA 1SXJE 3MWYW 5LBIA 3R9IA 3RC3A 4FI3C 5JCPA 3RWOA 4K81B 2AFIE 4DIEA 1UPTA 2F7SA 3QKSA 4Y0AA 2WOOA 1PH1A 2IX3A 1XX6A 4LHXA 4GOPA 3DL0A 4PHFA 3CAMA 4BRWA 5C1BA 4O2DA 3J80c 3PITA 2V6IA 2ASEA 1GRRA 2CJWA 5JEAJ 1CJUC 1UDWA 3EIVA 4LF6Q 3LA6A 4GLAC 4I1OA 4MRVA 4XTRA 5CB6A 5FPKA 3C5CA 5L3QA 5BXQC 2FMXA 4CEHA 3FPPA 3I73A 3RZOH 2UXDL 3B1ZA 4OK5A 721PA 1G20E 2G1KA 1NSFA 1H9SA 4ACBA 2QUZA 1H8EA 1EQQA 5ELNA 1EWHA 4TYNA 2H18A 2AWNA 4XH9B 3CC7A 2AD1A 2QA5A 1KI4A 4D0LB 1XJ0A 2YKGA 4JC0A 3VX4A 5GAGC 4ON9A 2N49A 2HDNB 2BCGY 4FMCF 4RD3A 4Z51A 1J70A 1GG2A 2J7PD 2IUUA 3S2DH 3OEED 4NE2A 4BBRG 5FJ8H 5E7NA 5TARA 4AK9A 5JMTA 1GKUB 2WV9A 2WPDD 5CM9C 3RANA 1WCMG 2QAGB 4GDFA 4A3GG 3JAMc 3GPLA 1XXHB 2JIZA 4JBMA 1G6OA 1ZD1A 3CB4A 4V0NA 4AQYQ 1AE3A 1KI7A 3K9LA 4F92B 1ZC4A 1E9EA 2IYZA
chains in the Genus database with same CATH superfamily
4MCIA 4IOKA 1L1OC 4B6GA 4RXUA 4AZ3B 3CQZH 1G2IA 1P2UA 4R81A 3N6RA 3KAPA 5IT9L 3WBBA 1TKRA 1X8XA 4KU4A 1NFRA 3HYNA 1QNFA 1AUXA 3KE9A 2UDPA 3KT6A 4RD2A 2B5VA 2VYNA 3OEHD 3HKCA 4L02A 1KAWA 1Y8RA 3IUJA 4YAEA 4P32A 3PP8A 2K1BA 2GM3A 4YRKA 4DV7Q 2C5CA 3IALA 3FKJA 3H19A 1PHJA 1VLQA 1RT9A 1BDOA 3NTHA 3OT1B 1LPOA 4DGSA 2LUOA 3REGA 4EUEA 1A9OA 1HUNA 4UJ3A 5BN4B 3LUGA 4EHIA 1KEZA 4OSEA 1EWYA 1IM2A 5JS8A 1EE9A 1B74A 4H2DA 4FO2A 4ZIRB 3WGGA 3PCOB 1N2CB 1HE8B 4IYJA 3Q41A 4A3CH 4QOJA 4D46A 3QEOA 1CQFA 1D04A 4Q18A 4N5LA 1LVHA 1MIOB 1Y34E 1FCJA 2D1SA 4Q48A 1RAHA 2NAFA 1V7PC 3M2TA 3TE6A 4B7AA 4RTPA 2F0IA 3QKUA 5M5YH 4D9CA 2RVLA 3DLTA 1OJ7A 4NMHA 3Q15C 2C2MA 1LI5A 4DEYA 3IFDA 1W2GA 2QCPX 2IY9A 4WPGA 4YP1A 2GYYA 2IDKA 7GPBA 4US2R 3FW1A 1DP4A 3ABSB 2FHTA 1YRWA 5KU7A 4H9GA 1UP7A 3OKAA 3T56B 2V7EA 3IDZA 2F17A 4P92A 3EJ6A 3PHLA 2WG1A 2YX1A 3ESBA 4IO9A 3DTVB 2BMVA 1QUQA 5CT6A 2AEFA 4I99A 3DDZX 3F2CA 3M89A 3NBHB 4IOAA 2CCZA 1WTCA 4GVXA 3SM9A 2FPLA 3D3EA 5FNVB 2SNIE 1FXWF 2B6NA 4B32A 3U4HA 3GMSA 4I9UA 1VHLA 1Q0HA 1NW9B 2A1TR 1AGRA 1NXQA 1OB2A 3R77A 1X3GA 5TQ0B 3OQMA 2HK9A 3DDHA 3FLMA 4R54A 5IVHA 2NT3A 4RWZA 4DUZQ 4D99A 1KPGA 1N92A 2XKBA 1KFJB 4TV8B 4RIEA 3ILVA 4MPDA 1WPXA 4G5XA 1NUTA 4J3NA 4EATA 3OEWA 4Q7LA 5AKZA 3FHJA 4ESVA 3EG5A 3IO5A 3VDXA 4K8IA 5E1OA 2Q4DA 1JU3A 1XKXA 3TBIB 2ZYWX 3ZLVA 2FYTA 3Q22A 1PT9A 4KO4S 4P81A 2H4HA 1YB5A 4Q9HA 3KBGA 3G9TA 3J81E 5F2OA 1ORTA 1N2XA 1P72A 3QE3A 4EB8A 3N0RA 4E5YA 3K3PA 1WM1A 5JPCA 3G2OA 4PLYA 1NV9A 1DRUA 3TL6A 1WMAA 3LWZA 1J4AA 4KPUB 3LXMA 1YJBA 2NGRA 1LFDB 3HR4A 2AJ8A 2JIQA 2VZ8A 2PMFA 1K3FA 1M83A 3O90A 4RH3A 4RK0A 3G88A 2GJ9A 4U68A 3UB4A 2RKBA 1C2YA 4Q7MB 1QNUA 2IHKA 4FFOA 2RGDA 3R4CA 1LF5A 1NF9A 4MROA 4GGPA 3RR2A 4Q4JA 1M8AA 5U1PA 1QMPA 1SNOA 5A7FA 3K70D 4K14A 1E3WA 3THRA 1QJOA 1H1TA 3UTDA 4BEVA 4IRXA 3T1YQ 4AAYA 4KC0A 2J4FA 2BHTA 3IXMA 3Q9NA 4A6EA 4OHRA 2BBTA 1G9TA 4N8X1 1N6PA 2O8CA 1XN1A 1EUCA 4HYTA 5HQTA 3EXEA 1ETUA 2A68C 5JLJA 4O1HA 1GFWA 8AT1A 3DL7A 2ZIXB 1BEUB 1BWRA 3SICE 4TTSA 2R44A 4D4GA 1E2JA 1VIDA 4Z3DA 3JY6A 3TFOA 2XVZA 3QNUA 4GWLA 4HN7A 4ZEOA 1E89A 4LJLA 1UKYA 4Z9FA 1H9SB 3FZQA 2KQUA 5C0XI 3CO0S 5HKLA 1YRHA 5F5LA 4P31A 1X65A 1JJBA 4AWBA 1GZ4A 4BP9A 4KMRA 5FTJA 2PSHA 3KJXA 1W3SA 2VF2A 2FX5A 4G56A 3L84A 4HJ8A 5DNEA 3G0DA 5BORA 1RLTA 3DMTC 5KYYB 2G7MC 2PGDA 2RARA 2P2LA 4H1HA 2R9VA 1U2DC 5JS1A 2DQSA 5UKDA 4OJKA 1ZK0A 3RGGA 5EKIA 3H1PA 4B4WA 3IP5A 1FL9A 2GAAA 2H1CA 2I4OA 1VQ6A 1UOOA 3CT4A 2VLIA 1OW3B 3A4LA 5DM0A 3J80A 2A57A 3AU8A 3TR6A 2WHPB 3CCEA 1OKKA 4PM4A 1PZKD 1H2HA 3B2QA 4MUIA 2D0DA 1YQWA 3WYDA 5AW1A 3F5FA 2O3TA 3D64A 1A8IA 1CY8A 3TK1A 2MFIA 3CX7A 3I2KA 2DPYA 2RSLA 1FTGA 5FFNA 1PR3A 1SYCA 2ZSFA 2XIQA 2Z5GA 5D84A 1CCWA 4IXTA 4R83A 3OEHA 2LXNA 4RLHA 2FPMA 4URYR 1LTTD 4KUEA 1UJ4A 3SMVA 4AW9A 4NRDA 5IXYA 2YTVA 2NU6A 4B6PA 3M3HA 1JWBB 4QYWA 2A9FA 1UUFA 2A2ZA 2D5IA 2IH5A 4RETA 3DE2X 3ETCA 3D2LA 4QRIA 2AWOA 3DFMA 4ANFA 1L5MA 4LI3X 4LIPD 1Q7TA 3WJ2A 4AJ1A 4YJFB 4KN5A 5IGCA 3B6MA 3RR5A 3OJOA 4YA6A 3FI0A 3TDNA 2FI1A 3JZDA 4BPRA 4GI3A 2VH5R 1CQJA 4HADA 5FO7B 2X69A 3CNOA 4ZCIA 2H7XA 1PGOA 1BXTA 5LPNA 2VG8A 5JMOA 4TYWA 1P5JA 1ZR4A 4J76A 4DIBA 3PUHA 2V6GA 1FFHA 3QE2A 3DMPA 4I0WB 5JYBA 2GLXA 4O4IF 5IF3A 2AXEA 4RGYA 5B6PA 5TQVA 1EM8A 2I4MA 1CEEA 1WG8A 5K99A 5IOCA 4YJ2F 1MMFB 2BF4A 3WTBA 2JCGA 4YS6A 5HKAA 2EW2A 4LPSA 5DTEA 1VQIA 2ZSUA 5LBUA 1WV1A 4XUEA 1OIXA 2X9GA 4GYKA 4M7OA 4Q3EA 3C7TA 4DIFA 2YTXA 3UJCA 4LBWA 3S1QB 3NM5A 3UGJA 5HUQA 1AKVA 4Y9TA 4KACA 3OIYA 2BL4A 2QVYX 3LJKA 1GLVA 3DJYA 3DV0A 1SU7A 3NTOA 1GFIA 1SG0A 5BXYA 4EG8A 5T6BA 4A9AA 2EZ9A 3L6OO 4DANA 1I3OA 1DUSA 4X61A 5EIBD 4XUGB 3PDIA 3HPQA 1WF3A 3KSZO 2PU7A 3OOSA 3CLUC 2Q2TA 2SHKA 1DC3A 5JCXA 1S9HA 2A7XA 4TKZA 3NQTA 2HADA 1IHXA 1SVLA 3AYXB 4DV6B 1T8TA 1Z7GA 2NVXB 4LWQA 1RQPA 3NT5A 3U7QB 5H83A 1SBZA 3ZWYA 2YMQA 3IMCA 5M2QA 4ZGGA 5AJYA 4A0GA 2QR3A 3I7FA 3TOSA 1YJ8A 5F3RA 3O74A 1JR3E 5D6OA 4X64B 2IXBA 4LMRA 5GY7A 4OHBA 1Z5PA 4FEEA 4KR9A 1RZUA 4BE7B 1B8AA 5DM1A 2VTVA 4FGLA 3U6BA 1P0IA 2ZPTX 1X74A 2CBZA 5CVUA 1I6HH 4RD1A 4HKTA 1G42A 1GNLA 3IPLA 1TVKB 2VQDA 1KFCB 3MD9A 2NAPA 3UK7A 3PXAA 1G9SA 4B6SA 2OZPA 4V0SA 4U7DA 2HUGA 2KQ3A 1N1MA 4HMIA 4QXOA 3ERQA 3NGLA 5LQUA 3G85A 2YZKA 5DCUA 5CFRA 1IYJB 2AKAB 4B71A 1RPNA 2IITA 2BDTA 1GHTA 1JXQA 1V35A 2H7VA 1Y69U 3T3HA 1GL9B 3K6RA 4GZYC 2XQVA 4ZHSA 1JV2B 1DXYA 2GM5A 1SUBA 4LZJA 5AT1A 2H59A 3IQZA 3EG9A 1AUOA 2BH8A 1D2RA 5BSEA 5H0IA 3EIWA 4D9IA 1JB3A 1DMSA 4TZ0A 4EIWA 1R5BA 2DKOA 3VYSB 3ZU2A 1CZWA 1L2FA 1JG6A 4ZWNA 3KLSA 1FW8A 1G51A 1U7WA 1N9GB 4HGPA 2V98A 2EC5A 5FUMA 1TWFH 4PXAA 3K5HA 1GEEA 2EYHA 4LOKA 2CWWA 2PD3A 4R4JA 3ZWDA 2IPOA 3JVUA 4MW7A 4QHTA 1D8TA 1G7SA 4AKTA 3A2LA 4OQMA 2X1HA 4EVRA 1SCNE 2WINI 1F38A 2AR0A 1C3EA 2GEKA 2QW8A 3JWPA 2GK6A 2O2GA 2XCSB 5EG5A 1OWMA 3HRIA 2KHIA 4GLOA 1JA0A 2FP4A 1G98A 2E6KA 1QORA 2ES2A 3AVOA 1ENCA 1L5RA 4JUCA 3VBEA 4JOSA 4BP1A 5JXJA 1HOXA 2VDQB 2ERCA 4NENA 2QUKA 4QGFA 5AHWA 4CDFC 1LBEA 4XIGS 3SJZA 4ME6A 2IGTA 2EP5A 5AM3A 5TSSA 2G80A 2R2AA 3QF7A 3THWB 4DWVA 4ZOQI 4Z4QA 1ZNXA 2QS9A 1X9GA 3T0FA 3VVCA 2XGOA 2OFFA 3ICCA 4LE0A 3CNQS 4GIBA 3OZIA 5FO1A 4BNKA 2PRYA 3LC0A 4RTJA 1RLJA 1Y8QB 4N7BA 4DMGA 2NZ1D 3RUHA 1JC7A 4AU1A 3GLGA 1CVRA 1NVDA 2IYUA 2J0UB 5L8VA 9ATCA 3G6EA 2X2OA 1L6IA 3KEMA 2Q4BA 4H77A 5IBRA 3NTXA 1MX3A 3TKLA 3SK5A 5K0SA 4Q4HB 3ITNA 1Y8AA 2XD9A 2Q5CA 5CLLA 4Y2XA 3LPCA 2VYVD 1HH2P 3E35A 1UJMA 1Z18A 1T5SA 5FLYA 4FQ8A 1ZLXA 3P4XA 2LFNA 4AZTA 1NDHA 1P18A 4PFJA 4B43A 4DAOA 5JI3E 1TCCA 4D92A 2ZI6A 4UVIA 1M4VA 3CX4A 1Q83A 3OVMA 3JALA 4QFCA 5HOEA 1TC2A 3EPPA 2Q6VA 5KYUB 1XMPA 3HDTA 3ZCUA 2FXVA 4E08A 1XV5A 3X2SA 5BQFA 3S5UA 3MMSA 1SC3A 3FTFA 1MAAA 5JH7A 4KR0A 4BRUA 1V71A 5FOTA 4KQ1A 2NVTH 5LP6A 2P3OA 4PW0A 2NSJA 2KCMA 1YDWA 4MQFA 1PNVA 2WR8A 3M7NA 1U9RA 3PWZA 2V7UA 5REQB 5CK5A 4TZTA 3ZU4A 1RJTA 4AIIA 5EPUA 1FP7A 3OLCX 421PA 1W0KD 4YAKA 3AFQA 3SS9X 2YFKA 4IHAA 3ZV7A 3GP5A 2V0NA 2L12A 4Q9JA 4AI6A 1Y80A 4BO1A 4F2WA 3TGLA 2H0QA 1VYUA 2MMGA 3A9SA 4MGKR 1CEQA 3AMVA 4RKWA 5KMGA 2DKNA 1B1ZA 5D5PA 1P6UA 2PT7A 3A1VA 3N2KA 3RNOA 1O03A 5DN9A 3H42B 1VQMA 1HQMC 2VF7A 1U1FA 4UQPA 3HA3A 4CDEC 4HX9A 3KZXA 2AOTB 1G2SA 1A9XB 4YP5A 4CM3A 1KHTA 4QO7A 4X6YA 4QGAA 5HFAA 4DV4Q 1ZXXA 5KNDD 4NFLA 1EFUA 5CEFA 3UT5A 3TEFA 4U7JA 3CISA 1MQAA 4WVFA 5C1DA 3JZMA 2QXUA 1E3JA 2GN1A 4X54A 3FWZA 1SCUB 3SXUB 1YJ9A 621PA 2CVZA 3CUUA 1R50A 1UPCA 1EESA 1CA6A 1RKVA 2BSXA 3BCHA 2ZCJA 1AURA 1J6QA 3WC4A 3V3KA 1C48A 1GPUA 3S24A 1B0UA 5C2JB 3KDSE 1T2DA 4ZAFA 4FXPA 2G67A 3E5NA 1YDGA 1ADFA 4DOMA 4OQ4A 4KMSA 4JVZA 5FADA 4WFJA 3KBBA 1KHIA 4E12A 4WBNA 1NR5A 1EI9A 2R6AA 3AR5A 2F1KA 2OHXA 4JI5B 4QEZA 5KWSA 2O2IA 4WN3A 4NCNA 1R1DA 4MWBA 2XYHA 4C08A 2B94A 2GHRA 4LKOA 3UXHA 3WQSB 1YZGA 1ZKOA 1CW2B 1QDLB 2MYPA 3ED5A 2YH2A 1DNPA 3IODA 1YHZA 3IAXA 3DBOB 3CMAA 4TMXA 4A3DH 1KMCA 4D9KA 4E13A 4HDKB 4HPWA 1V45E 1GUTA 4R16A 4Q16A 4C4XA 1QH9A 2G63A 2GYWA 1ZJ5A 1KVTA 5GGYA 2ZI5A 3E3LA 4I8XA 2DQKA 2GK4A 5E4TA 2P5TB 1QBGA 4C56C 1Q0QA 4HYYA 5EXEA 4WJWA 3WRYC 3TRZA 2J3HA 3QE4A 1YC5A 3MA2B 4RY0A 1VKNA 3HLYA 3DDNA 3G2NA 4MEAA 2CB9A 4ER0A 3B85A 4UM9B 2WAQG 4M1UB 3R7SA 4KNVA 3NUZA 2P5YA 2XODA 3B9RA 2H5LA 4BNJA 4J1QA 2P1DA 2PWPA 2QM0A 3IVMA 4PF1A 3V4RA 6ADHA 1QGOA 3LT0A 1RI4A 4N49A 4LK2A 3WYGA 1EK0A 3DE1X 2WNSA 3EZ2A 2BGJA 4LISA 4L95C 5L3ZA 4EVIA 3CQZB 3QKSB 5DNDA 2W42A 4PRKA 4TT8A 2ZSDA 3K15A 4MARA 1VKJA 2BUAA 3SCZA 2KUMA 4RLSA 5BMOA 3OZUA 4GMXA 5I2XA 1ZMBA 2IOFA 2I6FA 5MDHA 1P0PA 1T5DX 1VDZA 2PL3A 1VL0A 1QP4A 2JJ2A 1F2MA 4GKKB 3FPBA 3NC1C 1TM3E 1T8SA 2XRFA 2ZM5A 1Q3TA 2VDUE 5EE3A 4DNIA 4TKLA 4IINA 3I64A 1R4NA 1D5WA 2JD2A 1BE6A 5ALKA 1PR6A 5IVIA 2AHOA 3Q0TA 1KJJA 4IQZA 1VQAA 2B3TA 3H9JA 4ND5A 2PQ2A 5IF9A 3MMXA 1UINA 4RABA 2W5UA 4ASUA 2QU7A 2CUZA 2GPSA 1YZ6A 3GAAA 2L9HA 5JASA 2I6QA 3RWOA 4GOPA 3PITA 2CFSA 1TYBE 5FPKA 3C5CA 3VC7A 5L45A 1DV2A 5ELNA 5HW0A 1WSBA 4YPFA 4R2MA 3VPAA 1GR0A 1QYIA 5ALWA 1N5OX 3PFGA 5FJIA 1KJQA 1WCMG 4L78A 3V96A 4A3GG 5A5FA 3ONEA 4FZVA 1I8TA 3HJAA 5CD9A 2FPKA 1ZUD1 4EGFA 4ZPJA 1DBRA 3C4JA 1B1CA 4RL4A 1XLUA 1PJ3A 1WBBA 1JEAA 1BU5A 2HF9A 4FTWA 2IS1A 5IASA 4UHHA 1WTOA 3T3EA 1FNWA 3WNBA 1ECJA 4FSDA 3VO1A 3BZWA 5JNRA 1B70B 1ZRSA 3OHXC 2JLCA 3ICWA 3BJIC 3KKMA 3RVLA 5IJ9B 4AF6A 2D3WA 3BIOA 4X92A 3MTDA 1JHAA 4IJ6A 4OP2A 4C0BA 3TL2A 1LQ2A 1SOUA 1PJBA 1XCBA 1SK8A 3AJRA 4QQ8A 2CXXA 4Z6KA 4ARVA 4RHTA 4MP3A 4AIRA 5K20A 3OX2A 4ZICA 3CLSC 1GNQA 3HWSA 2BDUA 5LDDC 4EMBA 2ONZA 1WY7A 1EQAA 4LJSA 2V1CC 5HTOA 2AG0A 4JB0A 4R68A 4H13C 2JEYA 1KTKA 3F4BA 2YIVX 2JEBI 2O9JA 5K03A 1EYGA 2NU8A 3FUVA 1IHOA 2BMJA 1XRMA 3BDVA 3DMGA 1TT5A 4TYPA 1I4LD 5ELLA 2P2DA 3DXJC 2IC5A 1CG6A 2J67A 1HNWB 1HE2A 4EY5A 4EHKA 3PPXA 2P11A 4N01A 3LHIA 1WHSB 1K7FB 4BBAA 3AXTA 1Y9AA 5H1SE 1HNZB 3UI2A 2PH3A 1RKUA 2XSZD 4XQQA 2X14A 1ZL0A 3Q2KA 4PFKA 1X2EA 1Z0UA 5K6AA 2C0QA 3GZJA 1ZGZA 5HFNA 3QW2A 3K05A 1NBWB 2ZJOA 2BAGA 3RFFA 1G0OA 3EVBA 3T7EA 4HIMA 5AKGA 1LSJA 5J43A 4F12A 2EYQA 3TQQA 3I9V6 1IN4A 3ZVKA 4Q6BA 4OATA 4RVUA 4RCOA 1ZD2P 5C8XA 1CZOA 1OWPA 4I4NA 2NMVA 4BBPA 2IFTA 1DYQA 2V8BA 3VNRA 5IEJA 1Q50A 4G57A 3ZIDA 3VA5A 5KNDA 3TD9A 2LRHA 3Q6IA 3AWIA 2IK8A 2VTBA 3DLAA 3QW4B 5B5SA 3MJDA 5TF0A 3ZDFA 3ZGYA 5ALLA 1N25A 4GYWA 1NW5A 4XCQA 4LWCA 4GXTA 5KOJA 4DCSA 4LUVA 5KYWA 3LBYA 4OONA 1DAKA 2AFHB 3L82B 3HB4X 3RC2A 2NADA 5BWLA 2XCIA 2CV2A 1K88A 3I5AA 1SCBA 4N48A 2Q5LA 1MQ9A 3KQNA 3GTJB 4OA5A 1FE8A 2C94A 4IJMA 4DLKA 2K5DA 3CZMA 1PFWA 2IYAA 3RUFA 4HGQA 4DV5L 3KV1A 1G8ZD 2QM8A 3IUSA 4YT5A 3OLZA 4AQYL 1NLMA 2GK3A 1V5GA 2I1QA 2I3ZA 3VOSA 4FD3A 3GLIA 3EIEA 2V9ZA 2HIHA 4XT1B 1SRQA 4H7JA 1HT3A 2WJZB 3PLAE 2G07A 3FM9A 4WKNA 1O6ZA 5ABPA 1QGED 1DCFA 5NLLA 1V4NA 5B3AA 3OTOL 1Y1RA 1L0BA 3BXGA 4WADA 2AMCB 1I6VC 4JYMA 2REQA 1T1EA 4OQNA 3BZDB 1D0IA 2ZS7A 1DBPA 1SEBD 2VQEQ 4B0PA 1NHWA 4JKYA 4N7RA 4XWWA 3B1KA 3S1QH 1SVKA 5DSXA 1QH0A 1V43A 5LMNL 4ZK2A 3ESAA 3AUYA 2QRHA 5T1IA 4BO7A 1RJGA 4GQIA 4MDFA 1H4TA 1P0CA 2DERA 1ZOLA 1KMNA 1HNXL 1P31A 4TL7A 2JJYA 2V97A 3OSUA 4RE6A 4FR5A 1E22A 4F9EA 4IDFA 5BOSB 4CFYA 3C3XA 2G40A 3DEYX