4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter related protein
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
3TUIC 5UKDA 4PZZA 1GL9B 1KO4A 2XAUA 3EZ2A 3K0XA 5B57C 4IVPA 3OZXA 3KJGA 1XNJA 2EYUA 2FXQA 2SHKA 2CCKA 4OO1I 1GHJA 4IFBA 2ZTDA 2QQ0A 3IO5A 3TK1A 2CNWD 1K9MC 4CYMA 4JLAA 1KY3A 2PQAA 3GTQH 1GFIA 1XXHE 4X8MA 5EXTA 3UG6A 1W5SA 1VQLA 3QKUA 1ONLA 1W7AA 5K8TA 3ECCA 1NLFA 3EPKA 3PUWA 5TVKA 4A8JB 3NELA 1GRQA 2YOHA 2YTXA 1HNWQ 1T8TA 2DYKA 1ZRHA 3M4PA 2ZM5A 2BOVA 1QF9A 3GD7A 4KLKA 1G3MA 3WMGA 4CEJB 3B8HA 1A62A 2FN4A 3AQ4A 2ZI4A 5IYBH 1H9SA 2DUDA 2QBYB 3SJAA 4JVMA 3GQBA 3DHWC 3KB1A 4P74A 1EWHA 1L1OC 3QSYA 1EYGA 1VS0A 3WBJA 4GI7A 2HUPA 2XTNA 2C2HA 2GJ8A 2XSZD 5IWAL 1JJVA 2DB3A 3CIOA 1BKBA 4Z8YA 2WWYA 2ZRDA 1OXUA 1GNRA 4RFSB 5EJEA 4JI1L 2ZJRA 1JBKA 2D3WA 4BXXG 5GADl 4Y7NH 1BVSA 4A3JH 4NXML 1ZU5A 1KO1A 3A1TA 5F98A 1KGDA 1UEJA 3SEAA 5B30A 4KJZA 3AVQA 3FFAA 2ZRBA 4MUBA 2WWXA 3WNCA 1QUQA 5C3EG 3GPLA 1SXJA 2EFGA 5KO2A 4DEXA 4XSHA 4AG6A 4GDFA 1KDPA 3UE1A 1H95A 3OW2A 4F91B 1SFOH 2HLDD 1GVNB 2V1UA 4M4SA 2ZRFA 1YITA 3OF5A 4WW0A 2BC9A 2RGNC 1CR0A 1MO6A 1S9HA 3MJHA 3UG7A 1QZXA 3A1VA 2FH5B 4JS0A 3RSOA 4HI0E 2OBMA 3WYAA 1EK0A 5FOXA 4CGZA 5FLXc 2QT1A 4IDOA 2MFIA 1Z6XA 2OO7A 2IS4A 5EE0A 2O8CA 2WIAA 4RSGA 5FFMA 1J5EQ 2XOKD 5JS7A 2H57A 2I0QA 1M7BA 1WFQA 1PHJA 2CVHA 3P27A 3RAPR 2ZQ5A 4IXMA 3QOFA 5TDHA 4GPTA 2WJIA 4GNXA 4RKEA 3RS5A 3EWSA 1YZLA 2CJWA 1ZMXA 2CE2X 4UNNA 3UMRA 2Z5FA 2Q9BA 3HOZH 4EPTA 2F1MA 2YOGA 4OONA 3B1VA 4JL5A 1E2EA 1ZC3A 1ZUHA 3IEVA 5AUNB 4GOXA 3FHCB 4IOMA 5CITA 4YMUA 2EFHB 2QORA 3SQWA 5LMNL 2DNEA 3UANA 3PR1A 2VIIA 3NHAA 2AUJD 5B58C 4LNQA 3CAMA 3A1SA 2IYUA 2VLIA 3FWYA 2WV9A 5FBVB 2FSGA 4A3EG 1GRRA 5P21A 2BJVA 4OXPA 2WM9B 2QG6A 1H8HA 4DLSA 4PR0A 1XCMA 1F6BA 3H3VI 4E07A 2BHRA 1SKQA 4AY2A 1GUNA 4EJSA 1EQQA 4XWKA 3C14C 1CJMA 3T1VA 4TL7A 2K52A 3BK7A 3THYA 3K81C 1N6NA 3P26A 1HZAA 4A3GH 1UDWA 3QPUA 4DLWA 3KQKA 1F60A 5HZKA 1CP2A 1M2OB 4JC0A 1HY3A 3A74A 3EARA 2XITA 1HR0L 1DAFA 3PQCA 3KX2A 1Z0JA 1N36Q 2G0TA 4MRSA 2PPBC 2G9NA 4BEJA 3PIOA 4D4MA 1E24A 5JI3E 1TTTA 5KU1A 1G3IA 4MYHA 2K14A 2NZOA 5G40A 3OHMA 5CB6A 2ZRIA 2OM2A 4FWTA 3VA7A 4HIMA 3K0AA 2GETA 4F4IA 2WICA 4HJAA 2ZSDA 2ZYWX 3CMAA 3T5DA 3WXMA 1L0WA 2EIFA 1QHHA 2NPIA 3EIVA 5CJ2A 1N25A 2WJGA 3ZIAD 4FMDB 1YRAA 5EP1A 1X86B 3P20A 4IRUB 4Q1FA 4RD1A 4GKKL 5K8UA 1DAHA 3BFVA 1XZPA 2ZI7A 3I55A 3GTPH 3PIPA 4PAQA 3X1YA 1Y8OB 2Q8IB 1NMGA 4B3SQ 1T3SA 2W6JA 3PCOB 2C98A 3UMFA 5C4MA 2JA7G 4Q1CA 2QAGA 1I94L 1JR3D 2VQFL 1DG1G 3EA0A 1W2BA 4TL6A 3X2SA 1U94A 1XD2B 1FMJA 5SZKB 3IEUA 1K8AC 1LACA 1NN5A 4JLDA 1CIPA 5GVSA 2UXCQ 2HDNB 4JK1C 3EBEA 3A8JE 3F8TA 4L5TA 1OW3B 1UJ2A 3NC0C 4LYJA 2QM8A 4PFSA 5AUOB 5GROA 3U3JA 3C15C 3K0FB 2OFOA 2BCGY 5TMPA 3R20A 4NCIA 3ADDA 1YNXA 2ODNA 2NGRA 5LDDC 1NBME 2GDJA 4XOIA 2A5JA 3DEFA 1DD2A 3RABA 3KOJA 2VSFA 4P32A 5BXQC 2JA8H 2NO9A 1NL3A 3AKDA 5HKKA 2ZTCA 1Y1WH 2D62A 1FQKA 1KKMA 2RGAA 1VIYA 1IN6A 2YWFA 5AJXA 1G9XA 1NY6A 3MUFA 3PF5A 2A6EC 4A3CH 2WKQA 3U7GA 2JLVA 2WTUA 1K5DA 4WXPA 3D4RA 3G71A 3KQHA 3M85A 5AK0A 3GLIB 2LXJA 2PCLA 1F5NA 2XEXA 3OTOQ 1KD1C 3THWA 1S1CA 5EUQB 3GLFE 4LZZA 1QHIA 2IWRA 2ONKA 4JVNA 4PZYA 4S35A 1E9FA 1K0RA 1W2GA 1AK2A 1GKUB 2UU9L 1G7TA 1Y1VG 2FEMA 4DUYL 2BWJA 2IXFA 4M9XA 1I2MA 2QNRA 4L9SA 5AJZA 1IXZA 2VA8A 5JHHB 3T1QA 3A5UA 1YJ9A 1KAGA 1TF5A 3M4QA 4NYMQ 2D06A 1EFRA 1P9WA 1U2RA 2QRNA 4GOPB 3C5CA 4PO9A 1YR7A 1GOTA 1P2TA 3U61B 1FR3A 5J4LA 1AGRA 1JR6A 4KKTA 3M7NA 1CKOA 1WRBA 1WCMH 3IO3A 1I6HH 2GK7A 3BB4A 4Q01A 3AEZA 1CLUA 5FJ8G 4PSKA 1SVKA 1T6NA 2ZJZA 4A3JG 1G6HA 5CB8A 1M90C 1Z63A 4O2LA 4TLBA 4A92A 4JI0Q 1XMQQ 1TKWB 2ATWA 1RRFA 3GFOA 4BRUA 3R8CA 1XJVA 4KI0A 4I1OA 1PUIA 3IQWA 3JC66 4PZ7A 4AYBG 3KYHC 2VHQA 3CBQA 4LX0A 2F9LA 1OIWA 3QXCA 2VRWA 1L1OB 4M9ZA 1CUKA 4LF5Q 2IC5A 2ZJ5A 4RVCA 1S96A 1A5TA 1SKYB 2AXPA 3S1MH 1W49A 4LJ4A 1KC8C 4IPDA 4A75A 4BEBA 3WRXC 5LBIA 1YZ6A 1L2TA 3FKIG 4OWTB 4R4CA 2UXDL 1XCGB 2GBLC 2OLJA 3TBKA 4B71A 3TW4A 5JLJA 2FFHA 2D7DA 4GMXA 5EAYA 3K0CA 4MYCA 3DM5A 4DAYB 4C7OA 1HQCA 4Q1DA 1YI2A 5IYCH 1RC8A 1E2VA 3BFKA 1A82A 2AKAB 3W6OA 4ACBA 1OYWA 4A15A 2WIBA 2WB1G 4DR4Q 1RFLA 2BMDA 2F9MA 4KLZA 3B60A 3OEHD 1UAAA 4JI2Q 4EQ5A 4B2PA 4A3DH 1X56A 2A8VA 1PUJA 5ELNA 4JLPA 4MGKR 4PQRA 5EP2A 4B73A 2YTYA 1VF5C 3KJPA 2FSHA 5FTLA 2MO0A 2VZAA 3IUYA 3K70D 1QRAA 3CX8A 4C30A 5H1SE 2Q2TA 1NBMD 4A0HA 1YZNA 3ZVRA 5DI3A 4X65L 3O8DA 2GILA 4Q7JB 2QRZA 3U60B 5KDOA 4D80A 3ULPA 4Q9JA 3FGNA 2HT1A 4E22A 4GS3A 3SYKA 5KSOA 2ZTSA 4TVAB 1AE3A 4HUQA 4NL4H 5FPSA 4B35A 3M9BA 1CKNA 1TXYA 1E2GA 1W0KA 5JECA 3N2IA 2D0OA 1FX0A 2LKDA 4TZ0A 1VHTA 1JJ7A 5BN5A 3R7WB 3T1OA 3MFYA 2NMVA 1Z0IA 4IPCA 4TLAA 4XD7A 3RRMA 4C0BA 3H0GG 4BY1G 3KKQA 3SFZA 5IYDG 4LBWA 1J99A 2RGGA 5FBQB 1N2CE 2C95A 2V54A 2Z6KA 2G0NA 2YC2C 1OIXA 2OCBA 4K81B 5CK4A 2PZGA 1H9MA 3LXRA 1IZ6A 2KHIA 1UFQA 5FBLB 4JI3Q 4F93B 3H86A 1QBKC 4XTCS 1KSJA 2C99A 3NE5B 5KNDA 2ZYVX 3PVSA 4QGAA 3W6PA 2UUCQ 3GJXC 4Q4AA 4Q1EA 4RZ2A 3ZQ6A 2VF8A 5IE8A 421PA 4IFDI 4LHVA 1R7RA 1DO0A 2D4HA 1T3HA 3K9HA 4S2EA 4DEYA 2E2HH 3MRSA 1R8QA 4DV6L 1ZYRC 4LFCL 4YCVA 2I1QA 4LGMA 2QE7A 3CUEF 4MGZR 4Z1MD 5H8WA 2B8GA 4YMSA 3UDXA 2QSYA 1BKDR 4KYUA 4Q03A 1II8B 2ANCA 2A68C 1R9TH 1W0JA 2RH5A 4FCWA 1PH5A 3K8AA 1IN7A 2WP8J 5IHPA 1MABA 4XWAA 1VQGA 1U81A 1EQRA 2B7BA 1K8OA 4H1UA 1G3RA 5IF9A 1OLOA 5FOTA 4FWIB 1Q0UA 1AKEA 3I32A 1N0WA 1ZD8A 4G1UC 4JG2A 4LF9L 1QVCA 1IBLL 2VEDA 3GJ6A 3U2QA 2MSEB 2JJ2D 4W9MC 1EGAA 1B7YB 2IYRA 4JVSB 3ZVLA 4PHGA 4CEIB 1UKZA 2FU5C 3P4YA 1GNPA 4LRWA 3RRNA 2XXAB 4LOAA 1E32A 4US1R 4QM6A 4NXMQ 1KI8A 2B8TA 4A3BH 4GZLA 1B23P 4D82A 2GXSA 2REBA 4RZUA 4TMWA 6Q21A 1AGPA 1RYFA 2BM0A 2CBZA 5KDDA 1YZTA 2AL7A 2F1JA 4PAMA 3KF6B 3T1YL 2BJWA 3OFND 4RJLA 2KBNA 1SRUA 1VQMA 3K09A 1D9ZA 1NNEA 2CHGA 4MDFA 1COWD 4ZCIA 4DPGA 3FTQA 3BBPA 1GTVA 4DLUA 3DLLA 1E1QD 4TYNA 3U3KA 4LSGA 2PX3A 3SNHA 3Q5EA 4LUVA 1KI7A 3MGCA 3EASA 4W5JA 4MTNA 1UADA 5CIWA 1E2ZA 4Q9LA 4TMZA 1P75A 4W7SA 2LXKA 2IYXA 2OSBA 4LJ6A 2R2AA 4Q19A 4NYIR 5H1YA 3S2DH 5JRJA 4C2TA 3TJZA 2P3SA 3A4LA 1TMKA 1K5GA 1KXLA 1L8QA 4KKSA 2WSMA 3H1TA 3I4NG 4GLXA 1NSTA 1SXJC 2OXCA 4IDPA 1O3YA 5FI1B 4JI5L 3VX4A 4DC9A 3VQTA 4ERNA 5JEEA 3BFXA 2J1LA 1NLYA 1S2MA 1N6OA 3CPJB 4LYFA 4B3BA 4DK0A 4QIWE 1T5EA 3THXA 3WMEA 3T1HL 4C3IH 3U4VA 4HDCA 2JJ1A 4WVFA 1J2JA 4HR7B 2GJ9A 3S1RH 1PFSA 1JI0A 1W4AA 2HJGA 3CWZA 3QF7A 5J4VA 1QJOA 1Y8NB 3T61A 2XB4A 4X8LA 1W2HA 4OJQA 4KU4A 2KCCA 2JIZD 2VHCA 1VYUA 4PQYA 4C0AC 4C2UA 3GTLH 3UDFA 1YZUA 1DTSA 1TF2A 4DB2A 1XTJA 2ALYB 1ZAKA 3S1NH 4LWZA 4LFAL 1TU4A 4A3MH 2FFAA 3BGWA 4QJ3A 3ZD7A 4GRAA 3GDEA 1HQMC 1DVRA 3CPEA 3VTKA 4Q4LA 1E9EA 4GNXC 1F2UA 4TKOB 2DGYA 5DI9A 4JI6L 4DR2L 5EP4A 1LNZA 1UF9A 1R4AA 2ZSAA 1KAWA 1PYSB 2W6ID 2ZU6A 1O87A 5FBRB 5M04A 2QA4A 1KIXA 3S2HH 3AF2A 1RKBA 1TEXA 4DR6Q 3GEEA 5IDVA 1E2KA 4ZPXA 1E4VA 2MSDB 4GN3B 3FYHA 3TEHB 3MMPA 3FHWA 5BR8Q 3G4SA 4X8HA 2XJ9A 2IWHA 3IKJA 4GP6A 2PI2A 4EIWA 2OCAA 3W6NA 2E87A 1N3BA 5IYCG 3B6YA 4WZAE 2OHFA 3CWQA 1XMSA 1XX6A 5FTJA 1R0XA 1OSNA 1HTWA 1E2QA 4NDZA 3VR1A 3C4JA 3LA6A 1IAQA 2G6BA 2YOFA 2X77A 4PHHA 1HA3A 4JYAL 3PEWA 4KYIB 3U6KA 4Q4JA 2J0QA 1Q1QA 3TVTA 4PO8A 3GLHA 3V9PA 3WMFA 4B48A 4EJSC 3N2EA 2JLXA 1XEXA 1U0HC 4GNKA 4M1KA 4PQFA 4DHEA 2NN6G 3L2PA 1NF3A 3LLMA 4B33A 4HEJA 2ZM6Q 4A6XA 4RMFA 2JJQA 4DR3L 4LF4Q 2E2JH 4U7DA 2O8DA 5DO9A 3GP8A 3I4MH 4YONB 4CVNA 3SDZA 4JVLA 3NENA 1VQAA 4DLVA 1E6CA 3CNNA 2I5HA 5FBWB 2LKCA 4X62L 1GKHA 1C9KA 2BMEA 4HZUA 3E9IA 4RCNA 5ANRB 2VQFQ 5BQ5A 2GJAA 2WPDD 2F43B 4Q5IA 5H68A 1GUOA 1GITA 3EW9A 1Z28A 4QL5A 3SQXA 3SI7A 3IIJA 2NQ2C 4HZIA 4AYBE 3CC4A 2G3YA 4PG3A 1ZU4A 2BVNA 1PH6A 3DMNA 3QEOA 4IEEA 4KFUA 4BFYA 1U9IC 4OQLA 1XXHA 2Z4RA 2BDTA 2OCYC 2DPXA 2O8EA 3TAUA 2G1KA 1K6MA 2QAJA 5C0XI 2E8GA 3VR4A 2P6UA 4KODA 4QC2A 4JI7L 5B2ZA 4DV1Q 1BDOA 4IOLA 2QP3A 5A5GA 2O52A 4ZI2A 1OV4A 3EC1A 4DV5Q 5EUMA 4FN5A 2A6HC 3K7UC 2QAGC 2WOOA 1GNQA 3IPYA 3LD9A 3H0KA 4WZBE 3AVXA 1QG4A 1TQDA 3RVBA 4PZ8A 1GL7A 4B2IA 3GLIE 1OB5A 3OPOA 2BE5D 1N0VC 1DAEA 2WKRA 1JECA 2AUKA 1I5FA 4HB3A 2RB4A 5FPHA 5HE9A 4AYTA 2AKYA 1XNQQ 2EYQA 3SS8A 4DCTA 3MXUA 3PUVA 2Z43A 3L82B 3OYYA 3ZZUA 1OFUX 4HSEA 621PA 4HB2A 1KI6B 1C7YA 3KB2A 4Q4HA 3BE4A 4M21A 3KTAA 5A0FA 3FHOA 1Q21A 4BXXH 4KBGA 2Q9AA 1X8KA 1OKKD 4GLVB 2GF9A 4NCJA 2V9PA 3ND9A 4B3RQ 2FA9A 1E1RA 1V9PA 1W3SA 2CLCX 4PC6A 4YXWD 3CRLC 5C3EH 2WJYA 1E2DA 2AR7A 3EIQA 4ESHA 4FIDA 5GJWC 1S1MA 1BO6A 5JCPA 4F7WA 2AX4A 3N70A 2YWEA 4BA2I 1GKYA 4NKRA 1PH3A 2K7VA 4UKDA 2I1VB 1EFWA 1K3RA 4DIEA 2GK6A 3NDBB 3LAWA 4LJ5A 3ADCA 4DR5Q 4X66Q 5JFGA 2R7ZG 3K8YA 4KITB 1GJXA 3CF2A 5GAEC 4PC1A 4URYR 2AHOB 1YVDA 3QG1A 2DFKB 2QPAA 4X64Q 2EQBA 1G8HA 4TYPA 1A1VA 1JEEA 4K46A 5J3BA 5EXXA 2MQHA 1G8PA 2WSSA 2CDNA 3D6TB 3GCGA 3AF3A 2GN5A 2O0HA 2QI9C 4GBMA 2RF4A 4LV5B 1LTLA 1GZSA 4I99A 4MZ9A 1DE0A 2PQAB 1JJCB 4DV0Q 1DARA 1VQCA 3IIMA 3BXZA 1G64A 2HYDA 4A76A 1VKJA 5GAGC 2Q6TA 3I8SA 1Q22A 2CMKA 4AIIA 3ICQB 1TEVA 3KKPA 2Q2IA 1CJVC 2A5FA 4MNOA 3PO3G 4QOSA 5KPDA 5CIQA 4B32A 1IHUA 1ZYUA 2YVUA 1HQYE 4M1YA 3KQUA 4IDQA 4PSAA 4OQFA 2BA0A 2ATVA 1H9SB 2B7CA 1IBRA 2BA1A 2I3BA 4DR1Q 2IEYA 4H9GA 4JT4A 3BDOA 3QF4A 4A3EH 4OQNA 3A6PC 2VYFA 4FXPA 1WMSA 2EFEB 1VG1A 4QGFA 5LB2A 3EPHA 2IUSA 4OHZA 4IDHA 2K5HA 3V4RA 1VCIA 1GUTA 3B9PA 1IXRA 5TB5A 1E2JA 1E9AA 1WBBA 2GHIA 1X3EA 1XNRQ 3IHLA 1ZM9A 1W48A 4GP7A 5DSZA 4LY6A 1ZM7A 3GTOH 2IT1A 3ZD6A 2CCZA 1E9RA 3I61A 1BYUA 4LHZA 1YR8A 1MIUA 3K9LA 3K0CC 4TTRA 1RRGA 4ZCLA 3SC3A 2HJVA 2P5SA 4ZV4A 2JCSA 2ZRAA 4TT3A 1FP6A 2J0UB 4UNRA 2R6GA 1QUQB 3CF5A 2OE2A 4IJHA 2EFCB 1SXJB 4DV2Q 2QMOA 4QBFA 5HCIA 1VCNA 1CKMA 3THOA 4CEHA 1HNXQ 1E2LA 1XJQA 4R4QA 4KHPL 1HUQA 2F6RA 4G5OA 3ZVMA 3HPRA 4U00A 4ABYA 3PO2G 3MWYW 3IBGA 1YE8A 4URZR 4NB3A 3RN5A 2ZEJA 1E79A 3EIEA 3U3RA 2RHMA 4HLDA 4C3JH 2A5GA 3NBHB 4TN1A 3HDTA 3W90A 4Q00A 3VR2A 1S72A 4UNSA 1OYYA 3DM9B 4JV5Q 1GWNA 2IS2A 3J81c 4R4OA 1NY4A 3RS4A 3TKLA 1WDTA 4B47A 3CW2A 3RLNA 2JA7H 4GNXB 1Z0DA 3E1SA 4OI2A 4PMWA 2CJWB 5J47A 2XZOA 1MJCA 4B3MQ 1P2UA 3PEVA 5FI0B 2OQ0A 2K75A 2OQKA 4JOIA 3J80c 1TWGH 4BECA 5K36G 1JJGA 3OEHA 3PIRA 5JWOA 1BOFA 4EX5A 2Z6KC 5LMNW 1NJFA 2ZVQX 5HCNA 5L3QA 2XZLA 4DUZL 3GJ0A 4BY7H 2R6CA 4B3FX 4BZQA 1Z83A 2CK3D 2ZRJA 2ASBA 4ASUA 3EPLA 2K32A 2MSCB 4LBZA 3HR8A 3QVVA 3A0JA 1YHBA 2WWWA 3R9IA 2KBEA 3AEVA 1TU3A 3KJHA 3LDAA 4Q7KA 5HTKA 5IK2D 2IXGA 2OV2A 3TGPA 1PLLA 1YBYA 1HE1C 4B3DA 2NO0A 4LF9Q 1TNDA 4DSOA 4GOPC 3KDSE 4O0MA 3U7EB 2HF8A 2ZS8A 3QKRA 1KO8A 4G5GA 3CO5A 4EJSB 4UXHA 2ZU0C 2FSIA 3LWUA 3GLGE 3QI2A 2R8RA 4FMDF 2RGEA 1IBKL 4DLRA 3OIWA 1B8AA 1E2IA 2H16A 1M7HA 1EFCA 4C0QC 1HR0W 1TQ4A 3CCLA 1US8A 3AVOA 3GLFA 5IT5A 2GF0A 1UM8A 1Y1VH 2BDOA 1PV4A 2D2FA 1SVMA 3PG5A 1Z8FA 4IJMA 2IL1A 4DLTA 5L3SB 3RLFA 3E9HA 3CPWA 2OFWA 1N33L 1ELOA 3B1ZA 4G0NA 3AP3A 1KSGA 3U3OA 2J9RA 4QBIA 2ZRPA 2ZUBA 4EAQA 3K0AB 1AZSC 2JLUA 2IY5B 1VG0B 3J7ZC 1JJ2A 3J81j 3GJ7A 3DL0A 4JLNA 1QHHB 4Q9HA 3ZYCA 1E3MA 2H8KA 2R62A 2F3TA 1P7CA 4RCYA 2IX1A 1X1RA 1BMFD 4GL2A 1AM4D 3VHLB 5D3QA 1H9JA 5FJ8H 4POGA 4DV7Q 1M1YE 1V8QA 2CWAA 4UP7A 5LPNA 1MKHA 4OKSA 5CM8B 1FGUA 4B74A 5DGXA 2P6RA 1P9RA 4DV3Q 1N32Q 4QXAA 3ZH9B 2QAGB 1M8PA 3K9NA 5FTNA 1VDZA 3K09C 3WBKA 4Z51A 3J7A5 1RJ9A 4OI1A 1JR3E 5F2EA 3FMOB 4W5HA 3B1XA 1ZC4A 1Q3TA 2O8FA 1A63A 2J0VA 2Q21A 1Q81C 1Q57A 1NE3A 3KFUA 4PX9A 3RANA 4LJ9A 4CZ2A 1SZPA 5AJWA 2I4IA 3KFVA 1YR9A 1F2TA 1UEIA 2ZROA 5AJ3Q 2DY1A 3GTMH 3ASZA 3KFXA 1QVGA 1OXVA 2PCFB 3OIUA 4LV8B 4PPGA 4IDNA 1XMOL 5E7JA 3W5IA 3FKIH 1EWQA 1HZ9A 2DCUA 1FOEB 5CM9C 3NH9A 2VF7A 4BFUA 2ODWA 1D6JA 1I50H 1ZIOA 3Q9LA 3GMTA 4G7ZC 4G01B 4QGGA 3PXGA 4DDWA 3B1YA 5CDFA 5L3VA 4TYYA 3CNOA 4Q21A 2JAQA 4NZYA 1MKYA 1G3QA 2V8OA 4N0EA 1E2WA 3QVUA 2L0XA 4O2RA 3L43A 1ZD1A 3KKNA 3NEYA 2UUBQ 3HYRA 4FCTA 5GJCA 3W3ZB 4DKXA 4DSNA 1YHNA 1UE5A 4TQAA 1XB2A 3THWB 3W1GA 2D2CC 1IONA 2QP4A 1EWRA 3IGFA 5JZVA 3TQYA 2ZRGA 4JZKA 3LFUA 5KSPA 3UKDA 1EX6A 3RN2A 1BS1A 1FUKA 1II0A 1PLKA 2DWOA 2QENA 5FUVA 3DM3A 5K8IA 1Z6YA 1ZP6A 1GUGA 1H8ED 2V1CC 3DOEA 4HATA 4D0GA 1QHNA 1P62B 4LI0A 5C4GB 4ZDIA 4G5QA 3GJ5A 4TMVA 3DPUA 5J40A 2XGTA 1HT1E 2OT3B 4JL6A 1VQ8A 4HAWA 5FL7A 2WWHA 4TMKA 5C46F 1CRPA 3FPPA 2ZANA 4G3XA 1NMYA 4DRZA 3I56A 1ESMA 2JLWA 3CF6R 2E2IH 4H1VA 3KQNA 3F1ZA 4DDVA 4HAZA 1P2SA 2GVDC 3H0GH 4BY1H 2FPMA 4NHOA 5IYDH 2IW3A 1G16A 1XD9A 3X1ZA 4B3GA 1IYVA 3I7FA 4BLTA 3VKWA 2J7PA 1L4UA 2ZVPX 4GZMA 4PC2A 4B6EA 3R8FA 2C04A 3QXSA 2HXYA 2XJ4A 4ZO4A 2OTLA 2BKEA 2JA1A 1LF5A 4XJXA 3MWKA 3TR0A 4A0RA 4NYMR 3LVQE 2KE5A 1CJKC 3ULJA 2WJVA 4AG5A 3DO6A 3CRQA 5E95A 2VP2A 4NP6A 3CD6A 1GM5A 3CLVA 4US0R 3OEED 1ANKA 1T8UA 4A0FA 3VU9A 2G88A 4R7ZA 4X6AH 5CK5A 4BZPA 1EFTA 4AH6A 4LF6L 2C8VA 2R44A 3LBHA 2E9SA 4MKFA 1IBML 4AQYL 4F38A 1Q86C 1DAGA 1T3LA 3U6BA 1SHKA 4EFLA 2VP4A 2LSSA 1X8LA 1Q82C 3L7ZC 2ZSBA 3KL4A 1KMHA 4TYQA 4RG1A 1X8JA 4LF8Q 4C7OB 1XP8A 1XTDA 3BZKA 3ERSX 4JYBA 3MAAC 4C9BA 1T5LA 1NY5A 2A6ED 1ZCBA 3RC3A 4B76A 2IS1A 4LWCA 4A4DA 1PVOA 3RS0A 4A82A 4KFTA 2WJHA 5DLQC 2CKZB 1KZGB 1D8LA 5FR2A 4DT1B 1KHIA 3MXNB 2PL3A 1KQSA 4B3TL 4UPAA 4BY7G 1G1MA 1D7QA 2ZJOA 3UIEA 1PH9A 3MLEA 3W5OA 1PA6A 3K80C 3BWDD 2MMGA 2RGDA 4V02A 2ZAOA 1ONBA 5DI3B 1OHHA 4LHXA 4A3IG 1E0KA 4F92B 3SYNA 2R92H 3VFDA 5DN6A 4KVGA 4AKHA 1CI3M 4JI4L 3AP2A 3KXLA 3S17H 4HUQB 3W3AA 5JRZA 1CKNB 3NVAA 4HIDA 1FX0B 3REGA 1NN3A 3TE6A 1X54A 1G18A 2WPDA 1QZHA 3W8NA 4OBEA 2CCGA 4OWXB 2WMOB 5EZ5A 3RYTC 2HIXA 1VQ5A 5B64A 2JLZA 5F3WB 3QKTA 4TMXA 3FP9A 2NIPA 4P0TA 4JBYA 4QGUA 3CCEA 4DUGA 2JDIA 1FUUA 2YKGA 1WB9A 2O8BA 1P6XA 2Z4SA 4BBRG 1LS1A 3U58A 1P4SA 1U99A 2HT6A 3SU8A 3AVVA 3I4NH 1P3JA 3N6RA 4ZKDA 3FDIA 2ZRLA 1WJJA 5DISB 4DJTA 2WJJA 1VQJA 1FP7A 3HR7A 1Y63A 3ZS8A 2PMKA 1KKLA 3QKSB 2O0KA 1KHTA 2A5DA 1I4LD 3M4YA 3FKSD 3P4XA 1JMCA 2ZE5A 5M3MG 2EFDB 4JLVA 2BMFA 2AN9A 1V1QA 4JLJA 4DSUA 1N6KA 2EU8A 4ZDKA 3SJCA 5FLMH 3HU1A 1TWHH 3WHLA 4KHZA 1N5JA 2CXXA 3IPXA 2QEQA 2ODEA 1DPFA 2ZS9A 3AGPA 4TTQA 4NYJQ 1G20E 4OYHA 2EJMA 1ZNZA 4KV9A 1EX7A 3DDCA 1E1TA 2ZI3A 3WDNA 2K5VA 3L0OA 2H7VA 3LX8A 2C96A 4DWJA 3NH6A 3BH7A 5JHGB 5BWMA 4LFBL 1XTSA 5TXGA 2QROA 2H5EA 4F4JA 3ZGXA 5KUTA 2VBCA 4XVQA 1TPZA 2LWIA 2QL6A 3LRPA 4TSFD 3RHFA 4MITA 3H2YA 2VQEL 2GJKA 4CW7A 4EFNA 2NVQH 1VQHA 2E1RA 2E5LQ 4LK1C 4BFZA 2YWGA 4JI8L 1NKTA 3VR5A 1XDBA 4GSYA 5HR5A 2PH1A 5EP3A 4AWXA 2UUAL 2AMCB 2ZTEA 2VP6A 4BPBA 2V7QA 2HHHL 1NVUQ 1SXJE 4KO8A 5C1BA 2FGJA 1O7LA 2PMDA 1JB1A 4MGYR 3L0IB 3RWOA 3BERA 1KI9A 4Y0VA 1K8GA 1C1YA 2F55A 3HOYG 1P72A 3PITA 3BU2A 4FI3C 3E70C 5G3ZA 4YY3L 3ZQJA 1FYCA 4O0AA 1G8FA 1IXRC 3J81i 4PC7A 4DV4Q 5FUWA 3F0TA 4JBWA 5E3HA 3HOUG 5M5XH 4D81A 1K73C 2H92A 3BS4A 2NN6H 4KFRA 3S1AA 4LF7L 1H9KA 2NZHA 2JATA 1KK0A 2RMKA 1GKIA 3CZPA 3TH5A 2Z83A 3J80i 2IYQA 4ITRC 4JIMA 1VTKA 4CRWB 3B5JA 4OHXA 2P5TB 2PEYA 1P60A 2CL6X 1Z6HA 2WAQG 4P3YA 5JMTA 1KNQA 1KZ7B 1NVVR 3QXHA 3THXB 2DNCA 1CSPA 4NXNL 3FPAA 4OX9Q 4II7A 4MH0R 2QMUA 2IUUA 1IN8A 2IX0A 1JALA 2EJFC 1A2BA 2XTMA 4QNRA 4TTPA 3LW7A 1DAIA 3Q85A 5AJYA 4H44C 3TNFA 2A68D 1YR6A 4IOKA 4LJ8A 1OH5A 4K0KQ 1LF0A 4B75A 1MO5A 2O5IC 1NIJA 4XWOA 1YVCA 1FPMA 2ZR0A 4G7OC 3K9GA 4FW9A 2AFHE 4QHTA 4BLSA 1XMJA 4D4JA 4ZDJA 2DFTA 3TUZC 4TYWA 4IPHA 5LMUL 2B6HA 2ZE6A 4V0KA 4KCGA 2CW0C 4J0QA 2LMCB 2C78A 3J81k 4WJ3M 3U4ZA 2NVTH 3KLRA 2UXBL 1KI2A 4RFVA 1CFMA 4LPKA 3CW2C 3FB4A 1RIPA 1CEEA 1F2UB 4RCZA 4P4TA 1OE0A 4FCVA 3A1UA 1G21E 3C5HA 1IJFA 2H5XA 3Q7QA 3HPQA 3QXXA 1HV8A 1R0WA 2NN6I 3UE0A 3GLIA 4V0LA 4IVRA 3I3SR 2ZR9A 4A93G 1XPUA 1ZM3A 2RHSB 5M5WH 2F52A 4RD3A 5JJIA 1Z2CA 1W47A 4M1OA 1KTVA 2AK3A 4BA1I 2FV8A 2OBLA 3CRVA 4HB4A 3LBNA 3BJUA 3UPUA 1E2FA 4HIKA 1TF7A 1SROA 3AFPA 4BLPA 1IY1A 2UKDA 3FFBA 5E7NA 1SVWA 3C7KA 3L8ZA 4Q4JB 1GHKA 2ZJPA 1HH2P 2DFLA 1RPZA 3GLHB 1Q46A 4L9WA 3ZJYA 4HUTA 1XEXB 5IT9c 2EVBA 4POFA 5IWAQ 1HCZA 1FJGL 1Q7YC 1FQJA 1WA5A 3CB4A 4AYWA 4D4KA 2CVFA 3I62A 8OHMA 1XRJA 1EFUA 3LQQA 2O8DB 1CR2A 4G7HC 4JI1Q 2FZLA 1EIYB 1E99A 3UMSA 2OXRA 2R7ZH 3EPJA 1RRPA 5H70A 3S15H 1II9A 4JJZA 1SXJD 4DLYA 2ZREA 2R92G 4AYXA 4H13C 2CK3A 2VHUA 2ZI5A 2J45A 4JMPA 4HZUB 2NTYC 1KK1A 4I1VA 5CJPA 1LUZA 5GVRA 1OXXK 3LXXA 3E2IA 1NI3A 1UPTA 4OHVA 4Y52H 2VH5R 3NEJA 4LC0A 1NJGA 4YMTA 1EOVA 2OBNA 3VKGA 1D2EA 2OFXA 1LS6A 1H65A 4WBSA 2GXAA 2CNWA 1XXHB 4IOJA 3CM0A 4OHWA 3SHFA 3IBYA 1DCZA 3OAAD 2O8EB 4A3FG 1WOCA 1XMOQ 2N3SA 3KQLA 3LVRE 3RS7A 1HNWL 3PO3H 2FFQA 3KKMA 1SMXA 3OIVA 4MRRA 3SR0A 3LNNA 1B70B 4C2MH 1VCMA 2OG2A 1Q90A 4MGIR 3W34A 2WWGA 4KBFA 4EDHA 4TZ6A 4M8NE 4EPWA 4HAXA 5GJBA 1VIAA 2B63G 4BFVA 1R10A 1I2DA 3HOXG 1GDDA 3NBXX 5FOSA 2JJ8A 2D2EA 1W1WA 2W00A 1MR3F 2D5DA 5FLMG 1IL2A 1N6IA 1Z5ZA 2A3RA 4DCVA 3OOCA 1KDRA 1SQ5A 2GCOA 4IOAA 5KNBA 2KCMA 2V4DA 5LMNQ 2FX3A 2XSZA 4OK5A 4Q4HB 3S1QH 3KTAB 3KZ1E 1KJZA 1G7RA 1NLZA 1BMFA 2IYWA 3PEUA 4D6PA 4US2R 1H8HD 4LV6A 2B92A 3CRRA 3T51B 3CH5A 2IXEA 1CXZA 1E2MA 4NCHA 5FPKA 2W2TA 1E0AA 3WWVA 3AFQA 3UDGA 1EG7A 5M3FG 2VSOA 1SVIA 3A37A 3U3MA 1J70A 2OILA 4OGQC 1DG3A 1N8RC 1ZJ6A 2W2VA 4NH0A 2HLDA 3LX5A 4Q1AA 1JXOA 1YHQA 3M3YH 2GEUA 1XWIA 3PO2H 3BAFA 1E9DA 4YWLA 2OTJA 5JWHA 5C18A 2HF9A 2FWRA 3KDFB 1ZW6A 3NBYC 4N0DA 4Q7MB 1HTPA 3T53B 4MRVA 4LHYA 3A4MA 1HZCA 1HR0Q 4LJAA 1MO4A 5KTYA 4PSVA 2KHJA 1J5EL 1T4GA 4KVAA 3GFPA 5C44G 3G48A 2ZRMA 2YTVA 1KI4A 2Q9CA 2XOKA 2VL6A 3AUXA 1OH7A 2JEOA 1G4UR 3I72A 1UEBA 1X9NA 2GCNA 2IEZA 3I5YA 2A78A 5AJVB 3QIAA 3EN2A 1FFHA 1X3SA 3STBC 1EWIA 2QGNA 3HOWG 4QG7A 4QHSA 4AQYQ 1C0AA 1ZIPA 2FG5A 1G17A 2MMCA 4JLKA 1S3SA 5KNCA 5K36H 3P1JA 2JEBI 4NTZA 4M1MA 1ZNWA 1ZNXA 4GKKQ 5FTKA 2X19A 3RNLA 3ADBA 2W6JD 2ZRHA 2D74A 1KDTA 1VCOA 2W2XA 5DHFA 2NO7A 4JSTA 1TADA 4ALPA 2A6HD 2A19A 1T9HA 2BBWA 5C4JH 1HH4A 1I4DD 2ASEA 2N1BA 3QPWA 1I94Q 4L15A 1OPXA 4CIDA 4DZZA 1MOZA 4LUOA 1YEZA 3CCJA 3QF4B 5D3MA 4HAYA 4BLOA 5IP7G 3QJYA 1PMRA 5L8VA 2ZJ8A 3L0SA 4DDUA 1IY2A 2JLSA 4TMTA 3S14H 3D8BA 1R5BA 1M1KC 5EE3A 1ZINA 1VYVA 1LV7A 2OEPA 1U8YA 2FEOA 4HDOB 2PT7A 2F3RA 4QJ4A 2FJUA 2IHBA 1VQIA 1KRTA 3A7AB 4PC3A 3GLGA 2TMKA 4JBKA 3QY0A 3U44A 2ZYTX 5FOVA 1OXTA 2CEAA 2D0PA 2C03A 5HKKD 4IEIA 3VAAA 1U98A 1ZUIA 4YDSA 1ASZA 1W5TA 2ERXA 3HGBA 3KLWA 3DKVA 4QHYA 2F4VL 1G5RA 4A2QA 1JQJC 4CEHB 2I5MX 2WZQA 4QKQA 1GUAA 4URUR 1L4YA 4HJ9A 4FDBA 4GOJA 2PNRC 4V0NA 1TX4B 3PENA 2QEXA 2HXSA 2WB1E 1CJUC 1FZQA 3T56B 2J87A 3KJEA 1KAOA 3NWJA 3QENA 4OWWB 1DADA 2EWVA 2P6NA 2RKOA 1S9DA 3WHKA 2ZJBA 4OK3A 2Q3MA 3KXKA 3MWLA 1GL6A 1LYLA 4YHHL 2UU9Q 4E09A 3T15A 4DUYQ 1OH8A 3ZIAA 1DAMA 3U4QA 4WAUA 3CNLA 1WCV1 1EFRD 1FTSA 5LB4A 3G5UA 1B9MA 2BH2A 1YQTA 1CS4C 2AK2A 3WNBA 5JCZA 5ELXA 1CRQA 1ESNA 4B3SL 1QHSA 1GVPA 1Z22A 4NE2A 3B13B 4QBHA 1M74A 1MH1A 2P0EA 2Y8EA 4U02A 1IN4A 2KI5A 2XNDD 2NVYH 4HLUA 1JR3A 2YC4C 2WAQE 2UXCL 2EXDA 3F5FA 3E5HA 3FMIA 1CTQA 5L3QB 3AF4A 3V4FA 4NPHA 3SYLA 2FPKA 3BB1A 4Q66C 4DCUA 1BBUA 1HZBA 2QPTA 3SBDA 4AC9A 3AUYA 4D4LA 5JS8A 2VQSA 4LYAA 1MT0A 3AM1A 4A0GA 4D25A 2P65A 1DOAA 3WP1B 2GXQA 2L15A 1P2VA 2VP5A 5BN3A 4QFMA 4AI6A 1G7SA 2K5UA 1R0YA 5G41A 1F48A 1Z6TA 5J4KA 1N6PA 3CXCA 3U9SA 2RGXA 3FE2A 1C4OA 1SKYE 3AVWA 1IJEA 1LFDB 5BYKA 4BFTA 4TLEA 3PSIA 4R1JA 3Q3JB 1GRNA 2IF2A 2VSXA 1TU2B 4UY8C 3T34A 3B9QA 2UXDQ 2BBTA 3TSZA 1A6XA 2ZRNA 2GEVA 4IXNA 1N34L 4XIGS 3GLFB 1US8B 2JEAI 2ZI6A 3A8KE 2QZ4A 2GVAA 4R4IA 4Z54A 2ZR7A 1KJWA 2QMEA 4V03A 1KI1A 3SBEA 1GAJA 2BH8A 3AYHB 5JEAG 2KB0A 4YMVA 2B21A 2R9VA 3NIBA 1FTNA 4HJ8A 2IYSA 2KENA 1E96A 5G3YA 1SVSA 1Z07A 3VNVA 1X6VA 1GIAA 2IBMA 4QGHA 1CSQA 2QTFA 3HU3A 2P67A 4FINA 4UJ5A 4DCSA 1LB1B 3CRMA 121PA 1RZ3A 2Q3HA 2ZPTX 4V0ME 2DN8A 2HQLA 2ORIA 4I81A 4HIOA 4X65Q 2GBLA 4ZIRA 1G8YA 3FHTA 4M2LA 1GO3E 1VQ6A 4LW1A 1G4AE 3O8BA 1G291 4P4SA 1UE1A 1W0KD 2NG1A 2VL7A 4B3XA 1P9NA 2J5XA 1RJ9B 2GZDA 1DELA 3MEFA 3MJRA 4OQXA 3I92A 1N5KA 4XD7D 4EPXA 3PJRA 4HB0A 3H94A 1P8LA 1BIFA 2H17A 1P16A 4BLQA 2ZXUA 1Q1EA 2O8FB 3U5ZB 4LF5L 5FPTA 2MNAA 1LABA 2ZJAA 1NG9A 2C35B 3AKCA 2FMXA 2EW1A 1HT2E 3ZZ0A 1F2TB 2VY3A 1SR3A 3CKLA 3DZ8A 2DR3A 3B82A 2OESA 3VX3A 3GFTA 1LTQA 4DSTA 2NZ8A 1KO5A 2O8CB 1AQUA 4BASA 4KAXA 3RR5A 1X3GA 3CRW1 3H4MA 3NBZC 4F4CA 1YZQA 4Q02A 2R93H 1GG2A 2GESA 4WJ4A 2WAXA 1E2NA 4OO1H 4HLCA 4URWR 1MRSA 4DR4L 4A3LG 2QE7D 1TUEA 2RGCA 3RC8A 1Z29A 4JI2L 4DV6Q 4LFCQ 2R6FA 5GJVC 1W0JD 4ON9A 2CQOA 2Y0SG 1WYDA 4ESVA 4KKUA 3ZS9A 4XSGA 5KPJA 1IY0A 5C0XG 5J4YA 1X6OA 1VQNA 3CR7A 2KCTA 2C77A 5ELOA 2A7QA 3EXAA 1G19A 1NBMA 3M1IA 3WYGA 5AWFC 4A3IH 3TQFA 2J7KA 3K7AH 1JPJA 1VQ7A 1IBLQ 4QQBX 4OI0A 2G83A 1SMYC 1ZUNB 4AURA 1OT3A 1RW4A 1KOFA 1Q1ZA 4DAMA 2NO1A 2PX0A 5CLLA 2GVZC 5JSZA 3U7HB 4ILEA 2DFNA 2PZFA 4OHYA 5HZHA 2C9YA 4BUJA 3B6EA 4ARZA 3CP0A 4BZXA 1J7KA 2AHOA 1ETUA 4DCNA 1SVLA 5F9HA 1D2MA 1N6HA 3C16C 4DNRB 4JI3L 3T1YQ 1XMVA 3SJBA 3PUZA 3FMCA 3OW7A 1DXMA 4BBRH 5IP9G 2QTVB 2W0MA 5DLQE 1HPCA 1T5IA 2BEJA 3L8YA 2UUCL 3EIHA 3ZJYC 4JJKA 1GP2A 3VU9B 2XGJA 3CCSA 2XB2A 1N0UA 1BBWA 3UXMA 4EUNA 2YINC 2IYVA 3CPHA 4DK3C 3SJZA 5M3MH 2VHJA 4YQFA 1M34E 2O0JA 2ANBA 3ZVNA 1G3UA 4Z1MA 1NMFA 5IRCD 4IOCA 3AKEA 2WMNB 2BMJA 3RWMB 1KMHB 3HOVG 4MYTA 4OK6A 4C0KA 3B85A 2UZ3A 2VNUD 5GAHC 4JI5Q 4POAA 2Z0SA 5FL3A 3T1TA 2HCJB 1CULC 1TUIA 1SVOA 2BKUA 2PZEA 2ZITA 4Q9IA 2JJ1D 4B44A 4B6FA 2GNOA 1JE5A 2V4ZA 4FD2A 2WFWA 2N8NA 3T1HQ 4Q9KA 1E2HA 1FW6A 1K8RA 1CR1A 4TLDA 1CF4A 3G6EA 2YJTD 3UDIA 4DK6C 2OZEA 5JJLA 3T06B 2QSZA 2V6IA 3OESA 1UWVA 2N46A 3WY9A 2JJ2A 5M5YH 4EQ6A 2RCNA 2IHYA 1W4CA 4IKEA 1R5OA 4JLOA 2FDCA 1HYQA 2QU8A 4TL8A 5J5CA 4Y0AA 1VF7A 3LV8A 2AFIE 2ZS7A 1CJTC 3S24A 4LFAQ 1EIFA 4L5BA 5SZIA 4D0LB 1G5TA 4BBSG 2C5LA 2J0UA 2PJRA 1G6PA 2V3CC 1NN1A 3X1WA 4KN7C 1O78A 2QT0A 3EG5A 4PTLA 4M9QA 4UP8A 3IRBA 4DR2Q 4JI6Q 4ZDWA 5KOYA 4HJ7A 3OFNA 4M0LA 3HOYH 2X8AA 3D31A 2G1JA 2R7DA 2ORWA 3H3VH 4RD6A 5AR1A 4E5UA 4DB4A 3TSOA 2AWNA 1COWA 3QNUA 1QZGA 3TW8B 3I5XA 3HOUH 1E1QA 2BIFA 3F3YA 1YNJC 3D0FA 1JAHA 2Q0HA 2PCJA 1ZVQA 3NXSA 3OAAA 2ZSEA 1ZD9A 5CLQA 3ADKA 5DE3A 3H15A 2O8BB 3Q8XB 3CCQA 1K83H 3BJIC 1XD8A 1IW7D 1DBSA 4JYAQ 3KF8B 2JA5G 1WQ1R 4LBVA 4R71A 1V43A 4CDGA 3TVDA 1J90A 2FZ4A 2NZJA 4XH9B 3CCMA 3QG5A 3HKSA 2ODBA 3D3QA 4KSBA 4OQMA 2UVQA 4DR3Q 2F1RA 3IQXA 2PEZA 2IYYA 2ZE8A 1FMLA 1OJLA 3PUXA 1NKSA 2DWPA 4N3NA 3I4LA 4TLCA 2YHSA 3WYFA 1RL2A 1UBGA 3VMFA 1CR4A 2EQSA 4X62Q 5A35A 5J4HA 4P31A 1U8ZA 2JIZA 3NKVA 4YC7A 1E9BA 5SZJA 2OWOA 5EE1A 4E03A 5A4JA 1XFAA 5C4XG 4Q1BA 1VECA 2L5TA 1JXMA 1IW7C 2YU9H 1E4YA 2IYZA 4GOKA 1KL9A 1KRSA 4D2IA 3TRZA 1WP9A 5DIFA 1SULA 5E7MA 4DVGA 4R9UC 1W4BA 4LCBA 5F9FA 3MG9A 3A36A 2RAPA 3KXIA 2IHEA 4M9SA 2W6IA 4DR6L 4A8JA 2YZ2A 3MD0A 4BQSA 4ZI3A 4TQUS 4A93H 4JI7Q 1X1SA 3CF0A 5BR8L 3CONA 5DYGA 2ECKA 4HJ5A 2QA5A 4CEJA 2K5NA 4NYJR 1VQEA 2F4VQ 4Z8XA 2R93G 1ZKOA 1ZNYA 1RYHA 2QBYA 1KI3A 1VQPA 4OO1G 4FMCF 5L3SA 1E9CA 3CQZH 1JT8A 3P32A 2BCJQ 1GUSA 1Z2AA 1AKYA 1YNNC 1UKVY 1T0JB 3CR8A 4LJYA 2EVWX 4MRNA 2Q3FA 4YWKA 3TIFA 5EXSA 4JLBA 1U9IA 2VW9A 4LDJA 2C9OA 1YHAA 2ZM6L 3S1AB 1E2PA 4C3ZA 4LF4L 2JA6G 3LLUA 4YHHQ 4RFSA 1HNZL 1C9OA 4M1WA 1E1RD 4QJFA 2CCJA 5AUPB 3RLOA 3RRZA 1CTMA 4B3CA 2ZJYA 3Q7PA 4M53A 4AKGA 3G0HA 1SLJA 1N5IA 3OE7D 1CBUA 5BW8A 4A3KG 1XPRA 3BOSA 3SFVA 1OB2A 2K50A 4BRWA 3R9WA 4QNMA 4JCVE 1W44A 1OFHA 4P33A 4B43A 1U0LA 4DXAA 2VUMG 2AXNA 3F2CA 3DOFA 3W9YA 1WI5A 2GVBA 1W36B 1UE6A 1X55A 4XVRA 3BC1A 4P72A 5GQOA 2GCPA 4DR7L 2WSSD 2ZSFA 1RE0A 4A3FH 3QBTA 1Z9FA 1XTRA 1EUJA 1YRBA 3EWAA 4A9AA 5JEDA 4AIMA 3U50C 3CH4B 4DV1L 3NC1C 4JT2A 1N5LA 2GWHA 5EZ6B 4UXIA 3CZQA 4I1UA 1HURA 2VTKA 4DV5L 3KJOA 4Q4AB 1XU4A 5LD2C 1UKYA 1XJCA 1PJRA 2H18A 2QTHA 2IYLD 4HLUC 2B63H 2GZHA 4PZ6A 1ZCAA 2B3GA 1KSHA 3HOXH 4QRHA 5DYIA 3A8TA 1R8SA 4WZ6A 1XNQL 1BYIA 3LO5A 1AZTA 2F1HA 2A2ZA 1VG9B 3K0EA 3HKZG 4L8GA 1N34Q 3I8XA 4UNPA 1P61B 2JGNA 5FUYA 4LUZA 2Y0SE 1LY1A 3NDPA 3REFA 5IYBG 1MABB 1NVWQ 5HGQA 3QEJA 5FTMA 2EDGA 2N78A 4MYUA 2EJGC 2Q2UA 4B3RL 1QVAA 3I1FA 2REXB 2FNAA 2W58A 1TWCH 1OKKA 2PNHA 1YU9A 3JZAA 1EFHA 3IILA 2Z6VA 2AD1A 2YV5A 4BLRA 4YXWA 5M3FH 2QY9A 3X1XA 2ES2A 3CRKC 2AD5A 3FVQA 4Q47A 4JBMA 4EPVA 5JI2E 1AS0A 4GKJL 4HAVA 3GTGH 2XNDA 1VQKA 1T91A 4DR5L 4X66L 1VHLA 1YZKA 3N5CA 4TT3D 4W5WA 2A5YB 3RDPA 5EXPA 4KXFB 2QPOA 1UKEA 4GT1A 3PCRB 4EPRA 4L5RC 1MO3A 2F1IA 4X64L 1JPNA 4UJ3A 2QGZA 3IFTA 1NMZA 3BD9A 1IN5A 2N49A 3MWJA 4NCKA 4BFSA 4CT4B 3NG1A 2RGBA 4PPNA 1VG8A 2DWQA 4A1FA 5C44H 4KHPQ 1DO2A 1XEWY 1XTQA 3A7LA 1WXQA 3UWOA 221PA 2OLKA 1E79D 4DV0L 1ZM4A 4OJKA 1AQYA 1G5PA 1RVDA 1OTCA 2QN6A 3JVVA 1R5NA 1QVRA 3C41J 3TLXA 4RD2A 1ZBDA 2O5VA 1EXMA 1SGWA 2J46A 4PXAA 2JLYA 3HOWH 3AKYA 1TWFH 4YDHB 5HPYB 3O8CA 2CL7X 4O3MA 4TL9A 1G51A 3GJ3A 5TV2A 2YWHA 4DLXA 5CDFE 1SHZA 2A9KA 4YWMA 4P71A 4D26A 1W4RA 4XTRA 3O47A 1G7CA 1S8FA 4GZYC 2F7SA 2HEIA 2BBSA 1F3OA 3M4OH 4I4LA 4DR1L 3CCUA 4EFMA 1Q44A 2FPLA 1XD2A 3VDYA 5IP7H 3HOZG 1P5ZB 2D7CA 2VPPA 3L2OB 1R6BX 1Y69U 4FMCB 1QHYA 3LH5A 4ZCMA 1L2FA 4IFDH 3KJIA 4JKIA 1QVFA 1E0SA 3ZLJA 1FNMA 4P4UA 3M6AA 4QL3A 5JJKA 4ZKEA 1D5CA 4DKAC 4GLAC 4DUZQ 1XNRL 1D8TA 4ASUD 3AB3A 2LCFA 3A1WA 2GCOB 3FKQA 2PMZE 3K0FA 3LWNA 3QQ5A 4A2PA 3PUYA 1VMAA 3AP1A 3TREA 3CX7A 4PPQA 3TMKA 2MO1A 5L3RA 1AJEA 1Y3AA 4M22A 521PA 1PH1A 4L16A 1MRNA 1TWAH 1Z0AA 4DV2L 2VP0A 4A6PA 2WBLC 3HP1A 1ASYA 4IO9A 1GSIA 4B34A 5TY0A 3B7GA 4YCWA 5HE8A 3OIYA 3CMEA 1HNXL 1TAGA 1E94E 1HJPA 5KDLA 4JOIC 4TQ9A 1IBKQ 1Q1BA 4KFSA 1YZGA 4A3GG 1UBEA 2JLRA 4RZ3A 1JAIA 3E0EA 1U0JA 2QUZA 3HYTA 1KDOA 4R2HA 4IVQA 4LHWA 3TSWA 3WRYC 1S0UA 4G5SA 3AVYA 3K70C 1J6QA 3FMFA 2A69D 3M0EA 1Z08A 3GTKH 1XEWX 2R6AA 3RS2A 4JV5L 3BORA 2DHRA 2ZRKA 4HDQB 4TWZA 2IS6A 1N33Q 4I1SA 1VQOA 1A7JA 3BZCA 4H02A 5JBQA 1XZQA 1AA9A 2BEKA 4O2DA 3HJNA 4GOPA 2JA9A 2R6DA 4DNTB 1M6NA 4B3ML 3LBIA 3Q5DA 1GD7A 3EZ7A 3QKSA 3I2ZA 2PBRA 3EZFA 4NCNA 3RS3A 1KIMA 4A4IA 1E9SA 3ICEA 4JYCA 2QF7A 3IIKA 2QGQA 2B8WA 2IK8A 2XZPA 3ZZTA 4D0NA 4URXR 4EPYA 1Z0FA 4L4UA 2AKWB 3HWSA 4CF7A 1G8GA 1YJ5A 3A8IE 2KWIA 2R65A 3QE0A 3TS2A 2H1LA 3BH6A 2ZRCA 2WHXA 2A69C 5D3MB 2GAOA 2P2LA 3JAMc 1B0UA 2NOAA 1HE8B 1L1OA 3QXJA 5IK2A 2HCBA 1WE2A 5FOWA 2Z0MA 1PYBA 3X1DA 2OAP1 5DHAA 3U44B 3K53A 2PJZA 3GLGB 4M1TA 1GILA 1KO7A 1KK2A 1SE8A 4HAUA 1DGSA 4NONA 3TUJC 1MJEA 4LJ7A 1IYUA 3PFIA 4K8OA 3T35A 3TRFA 3NHBA 2JA8G 3ER0A 1MV5A 2KSQA 1Q8KA 1Y1WG 1TQ2A 1OFTA 4L8JA 4IPGA 2FFBA 5FOUA 4UP9A 1CU1A 3EZ9A 4R4TA 4FMBB 4IFEA 1FNNA 3CX6A 3ZDQA 4A2WA 4A3CG 2YYZA 1KMQA 3ETLA 4LYHA 1LVGA 5JEAH 1NVVQ 2CHVA 2FOLA 5BN4A 2NVXH 3U7FB 2OCPA 5FPYA 2IYTA 4JKYA 3SN6A 3PEYA 2DBYA 2HV8A 3EX7C 1TQ6A 2BBOA 2XX3A 3T12A 2RGNA 2KJQA 1XBTA 4YMWA 4CT5A 2Q2HA 3GEHA 4WOPA 1NJIC 1UBCA 3FMPB 2WAYA 3GO5A 3PGZA 1I3QH 4DV7L 2CFMA 1OF1A 4V0MA 4JLMA 4NMMA 3U4QB 5FH9A 5KHOC 4BFXA 1NIPA 5FL7D 4MQBA 4U5XA 3TS0A 4DV3L 1N32L 1IQPA 5LD2B 4MUAA 1D2NA 5CYOA 5KSYA 3UWKA 3SGIA 3STBD 1AS3A 1KK3A 1KJYA 1QG2A 1W46A 1Z6GA 2V1XA 3BH0A 3VR3A 4G5RA 2J59A 2VS1A 1RIFA 1WCMG 1S40A 3LY5A 4OI4A 4R98A 3R7WA 4LK2A 4P75A 1K8MA 4AK9A 2J7PD 4UNQA 4BWYA 3QUSA 4JSYA 5AJ3L 3GJ8A 3CCRA 3F2DA 4WXRA 1UE7A 2F3IA 2GJSA 1OXSC 2ZT9C 1U5KA 3F2BA 1DEKA 2QQEA 1A4RA 2ONJA 1Q3HA 3T5GA 3PV0A 2OAQ1 2WOJA 5BYJA 3O8RA 1NG1A 3ND8A 1Z6AA 1WF3A 2WVJA 3AVPA 3SZRA 2JXMB 3QBVA 1JB7A 1BH2A 4PO1A 2B29A 4BE7B 4LF6Q 4A3LH 4LC1A 2JQOA 3EZ6A 2UUBL 1E22A 1VQBA 1IBMQ 1UBFA 3EQLC 2PT5A 4GFDA 3WNDA 3D7MA 5HY6A 4NU0A 2O5JC 2FGKA 3RZOH 1NMXA 5KSZA 2GTPA 1II8A 1N9WA 3AF0A 2ZAMA 2A1AA 5C0XH 2IF0A 3MCAA 4JL8A 3HKZE 1V5WA 2CLDX 5CYPA 2BM1A 2X2FA 1DS6A 1A0IA 3AH8A 2C9CA 4OL0A 1XEFA 2GRJA 4KSCA 1H8EA 4ME3A 4LUCA 3RRYA 2KA7A 2WKPA 1A2KC 1NRJB 2VO1A 4A3DG 2W83A 5E4FA 3Q72A 2HYIC 4MRPA 4RD4A 4IFDG 1KYIA 2RHDA 3R9XA 4DDTA 3ONWA 4IHQA 4NBSA 4I7ZC 1YKSA 2J3EA 4EKDA 4B3TQ 4N1AA 1SN8A 4CEIA 1XJ0A 3AV0B 3DKPA 2V55B 4PHTA 1OHHD 4LPSA 2NPFA 4A8JC 3VKHA 3AQQA 1HNZQ 4RKFA 4RZXA 3WP0A 2XXAA 4ZIRB 2XNSA 2HIVA 4NYIQ 5DN6D 4V0OA 2E76C 1ZM2A 4P4SB 3SE0A 5DNYB 1QDEA 3B2EA 2ZIAA 4DNIA 4JI4Q 4IFDJ 2R7FA 2QP9X 4PV1C 3EAQA 3KF6A 1N36L 5AUQA 4J15A 1YIJA 3NEMA 4PHFA 2YNMA 1Z3IX 2X2EA 5IP9H 4LBYA 3JZMA 3BB3A 2JASA 1XTKA 3VNUA 3I4OA 1R0ZA 5SZHB 1X65A 3H84A 3OEEA 4DUGD 2JDID 1LM0A 4DR7Q 3B1WA 2NO6A 2K33A 4C0HA 5DH9A 4HLQB 1VQ4A 1HEIA 3UK6A 2X1VA 3BIFA 4BGDA 4C0JA 1N6RA 4LF8L 3HOVH 1Y14B 1XF9A 2GAAA 3HU2A 4APVA 3AB9A 2G77B 1E98A 4IW3B 3AVUA 3NTUA 3K0SA 1Z0KA 3LNCA 2JE6I 1EESA 1AN0A 5TARA 2KBFA 1I6VC 3PF4A 3AGQA 4GN4B 4LJZC 3KKOA 2QM7A 3I73A 1XMIA 4YCUA 2VHTA 4Q18A 3C8UA 4AKIA 2XTZA 1FL9A 4DLZA 1AE2A 4ACAA 1Q12A 1DAKA 1U8AA 4R2IA 4BFWA 2OUKA 3VR6A 2ERYA 1PH7A 2VP9A 2JLQA 4L5QA 5G53C 3TQCA 1VQ9A 1PZNA 4KLNA 3W8RA 4XVUA 3CC2A 3K70B 1IYJB 2IUTA 2I5LX 5JWRA 2CHQA 4WA7A 1RRCA 3NBFA 3RZDH 3EC2A 3SOPA 4DT1A 2A30A 1VQDA 1E1OA 3A4NA 3K1JA 1QHXA 1G6OA 4BBSH 2EWWA 3CC7A 4LFBQ 2V6JA 4C0LA 2GKSA 3QKRB 1YJNA 1XCPA 3ASYA 2JK8A 3OE7A 4JBXA 3RNUA 1ODFA 5JSZB 1WBDA 3AF1A 1E69A 2VQEQ 2OCEA 4GKJQ 2FSFA 3TAHA 1Z47A 2BE5C 2ZJ2A 1NP6A 3IDQA 4JI8Q 1M7GA 1PLJA 2V7QD 5KYKA 4ARZB 1U90A 3OTOL 2UUAQ 4A3BG 2J41A 3EA5A 3G82C 4O25A 3KDFA 2HHHQ 4GMDA 5E7IA 5EE9A 3LGJA 1NN0A 4JBJA 4MKHA 1O7IA 3AVTA 2REOA 3SHWA 3TR5A 1XPOA 2IA5A 3DVLA 1E7ZA 1FVIA 4KMUC 3JVUA 4B2LA 3CCVA 3W1BA 4YLGA 1NBWA 4Q48A 1OH6A 4RY2A 1A8VA 2JA5H 4YY3Q 3S16H 2CE7A 1NVXQ 4QJ5A 821PA 4C3HH 2ATXA 3A58B 1TL7C 3DMDA 4WIAA 4KN4C 4GN5A 2BV3A 2XTIA 4LF7Q 1PH8A 2RHQB 3GEIA 2FF7A 1T0HB 3FKSA 4NPSA 3QPVA 5C2JB 1AH9A 2ORVA 2WWIA 5JEAJ 3CPFA 1J8YF 2CLSA 2GZAA 2ZI9A 3B78A 5IY0A 2FE4A 4X8OA 1JNYA 1VPLA 5GADC 1IOZA 3TZUA 4RD0A 2PLRA 4JI0L 1XMQL 4H0LC 1KY2A 1G41A 4M1SA 3KUCA 3VHXA 4DK1A 4NXNQ 2F43A 1YJWA 3ULLA 2E75C 5C4XH 4PPFA 4QM7A 1VQFA 2W0SA 1P73A 1JQLB 1W36D 1B9NA 2GA8A 3RSLA 1FL0A 4EQ6B 1J8MF 3MSXA 1KNXA 1NSFA 2GXUA 2E5LL 4TSFA 3GJ4A 3LW8A 1S4QA 4QY7A 5LMUQ 1PH4A 2UZIR 4C4PA 2ZETA 4A3MG 3BRWD 2UXBQ 4IQZA 2CWPA 3LQRA 3Q8DA 3DZDA 4Q7LA 1Q20A 2AWOA 4P73A 1E0JA 5FR1A 3FOZA 1CKEA 1IXSB 1LW7A 1Z7TA 1JEDA 2ZYUX 1N6LA 1OFIA 3L0PA 2K4KA 5EQTA 2QMHA 2E74C 1QHGA 4MA4A 1OIVA 2WWFA 4PAOA 2B8FA 4DV4L 3THYB 1AS2A 3GTJH 2PI2E 4PZLA 2N42A 1S3OA 721PA 1W36C 3A5ZB 1H9RA 4MDEA 4DIDA 5FUXA 2IHFA 1R2QA 3V00A 1L7VC 2JA6H 1KI6A 4URVR 4DBLC 1Z06A 1X3FA 4IJLA 4AD8A 2CL0X 4C0SA 3DXJC 1D9XA 2ZUDA 3IHWA 4QBGB 4UQOA 4MKIA 3HFZB 1KSFX 1AIPA 1UDXA 3GLHE 4UXJA 1Y8PB 1S3GA 2PLFA 4HYYA 3W5JA 4AKEA 2ZUCA 4A36A 1E3PA 1FJGQ 4A3KH 3BG3A 4OX9L 1VYTA 1XTIA 1PH2A 4MKGA 5K8LA 2ID0A 2ZE7A 4PANA 5C0XJ 4L5SA 3KUDA 3UATA 2ZJQA 1IM2A 2J0SA 2GEDA 2IX3A 3I4MG 1I4TD 2VUMH 3JAMi 5EE5B 4K0KL 1NTGA
chains in the Genus database with same CATH superfamily
1AT1A 3TUIC 4GH5A 1FVFA 1A3TA 1JAZA 4IFBA 3U09A 2QQ0A 2C0PA 5H16A 2XWJI 2Z3VA 3FFTA 5SICE 4PQXA 2F17A 3VYSB 3SYTA 3RUAA 4A8JB 3BQ9A 4PNYA 2YTXA 4PR3A 4ZKBB 4OFBA 4UVGA 2EL9A 1EWHA 2H2DA 2BF4A 2HUPA 3ZBTA 2GJ8A 1EFVB 2D3WA 2W8ZA 5GADl 3R3HA 4JJ6A 3SIPA 3JASB 5DTQA 2Q5IA 1L5SA 4F91B 2Y0PA 3A1VA 2C4TA 4TS4A 2JFFA 3RW9A 5KYWA 5ELFA 4I1RA 2L9HA 2NUTA 4F3RA 1YZLA 4GL4A 2KQUA 4MHOA 1S2NA 1D4FA 3AR6A 4OONA 4JL5A 1J8DA 1JLMA 2EAUA 4JNKA 4GOXA 1ZCJA 2QORA 4HNUA 4KQ1A 2BFEA 4CTNA 3A3NA 2OCDA 4CIXA 2E0IA 3T1VA 4ZI7B 2W4IA 4JBNA 2AYZA 1BXTA 3A74A 2ZCUA 5F33A 4IMRA 1DAFA 1OTHA 1JB9A 4IX1A 1Y3CE 4WCVA 5C8ZA 2QKYA 4OGWA 2OBBA 3WG9A 3W04A 2YDYA 3G0OA 5EP1A 1BCSA 2ZI7A 2EFYA 1EEID 3I55A 2IX9A 4BX3A 2CH4A 4EMBA 2HUNA 5C4MA 4CV0A 4Q1CA 1QRTA 1RHKA 3RVOA 3A8JE 4BNWA 2EY2A 3R20A 4NCIA 3M1YA 2JGKA 2O8NA 1BXRA 2P9CA 3AKDA 3Q0EA 1KKMA 3CEJA 1I50B 4E88A 4AN1A 1SUPA 4BO3A 3R3JA 3G71A 2X7JA 1E3SA 3H87A 1XGKA 3ZQ4A 3FBWA 2IWRA 2XXBA 1K0RA 2FEMA 2IXFA 3R40A 3H5LA 4HNTA 4I5IA 2X5OA 4EG5A 5SYAA 4GOPB 3TYXA 1U0GA 1K83B 4OEMB 3H9CA 1WCMH 4QOGA 1SVKA 1G6HA 4B46A 4FEYA 1I0IA 2J9XB 1C0IA 5KCMA 3OCJA 1PJTA 1PYWD 2PSSA 3C24A 1VJTA 4DGQA 1KMNA 4Y2VA 1UBJS 4QFBA 3C98A 4KMSA 4B2PA 4A3DH 3FVWA 2YTYA 3JQ8A 3GOQA 2XRSD 3L6BA 1QGDA 3W05A 4YP9A 2GILA 1EIGA 5KVVA 2QVGA 3SYKA 3KUPA 2P79A 1BH6A 2GLXA 3K2QA 1LLQA 1B0AA 3MFYA 4K87A 3R5FA 3F5SA 3IUSA 2YC2C 3CFYA 4LZLA 1SCUB 5B7NA 4QGAA 1YS1X 1EEHA 4AXBA 4PO3X 1O94C 2PGDA 421PA 4TQGA 2OBYA 4LHVA 1T3HA 4NLLA 2RB5A 1ZYRC 5H8WA 4MGZR 4PLFA 3RBZA 2H5JA 3R41A 4FCWA 1TAQA 4KN5A 4XWAA 1U81A 4J0KA 5KYLA 4X3TA 5FOTA 5F21A 2PXXA 1YC5A 5AI9A 1O9HA 4GZLA 6Q21A 1CJCA 1N7IA 5LQCA 4Q7EA 3ETNA 4LQ4A 2VZEA 1NNEA 3PRJA 1FBNA 3FTQA 1RWWA 3NQTA 2P9BA 4MEAA 4HRAA 1KI7A 1G4HA 1ULBA 4TMZA 2P2YA 2OSBA 1A88A 2J0EA 5M5XB 4A10A 1F9QA 2E2WA 4HN2A 1OI4A 1PZEA 3VQTA 5TPZD 1T5EA 3EZYA 3ZXYA 1V26A 3QF7A 2JAPA 5EMNA 2AJLI 2C7PA 1D0VA 5CH5A 3D8UA 3OFSA 4DB2A 2IV2X 5CHEA 2SECE 3LBYA 3I91A 2EX1A 5FCDA 2H4HA 4DA9A 1WDLA 1T36A 1L7BA 1KIXA 3RG8A 2FPIA 2VYVD 3OOSA 3PJGA 3FYHA 2Q6VA 5BR8Q 5ARBA 3CT6A 1R0XA 4NDZA 1HTWA 3LA6A 2JI4A 5DM4A 4BVKA 1BROA 2X3YA 1NF3A 4A6XA 2F00A 1LC3A 3W0LB 3CVUA 4NXNB 4KKVA 1YBHA 3DLAA 4OYRA 1Q11A 3IJPA 1CF2O 5F35A 4UAIA 3IRVA 1PQUA 2E55A 3BMQA 3CC4A 2QS9A 4DQUA 2C94A 5EJ6A 4AO8A 1YVPA 3K7UC 3LD9A 2NYRA 3GEMA 4HB3A 3PUVA 2V7TA 3T13A 5CPFA 3DEPA 1MVLA 4M21A 1NQXA 3CW9A 5JBNA 3BSYA 4YXFA 4YXWD 3GAMA 5GJWC 3DCJA 1E2BA 4U2BA 3T1YB 3IQDB 5GAEC 2AHOB 1GUYA 3WAGA 2QPAA 2ATIA 2HSJA 2RI1A 2RC5A 5EHXA 2CDNA 3GCGA 3CNHA 2W6CX 3SSOA 2QI9C 3BYYB 1MDBA 3O21A 2K04A 3CUSA 3O8OA 4TLLB 3MT8A 4UEQA 4QOSA 4B32A 4QQRA 4Z3KA 2KX7A 1IOLA 2DY0A 4DG8A 1EXWA 4NJMA 1CRLA 3A6PC 1SCBA 4QGFA 1XAIA 4OUDB 5LP6C 3ODGA 2IOFA 2OKCA 4EUSA 3ECSA 4JT9A 4LHZA 3TZBA 4ZCLA 2P5SA 5JYEA 4IP0A 3EBPA 3KLMX 1E2LA 4KHPL 1FC0A 4G5OA 4CMJA 3KVYA 1ZVJA 3AWIA 1D2GA 3QOJA 2JI6A 3CYFA 4ZT3A 2PQ6A 3BILA 4UNSA 4DDMA 2O3JA 3JQ9C 1V3TA 4PMWA 1VIVA 4OO3A 2K75A 3SZ3A 4BECA 2QUAA 3B7WA 2VJKA 4G2TA 2OP0A 3IP8A 3H5OA 4UPVA 2HWKA 5KREA 3I9MA 4G8JA 4B3DA 3B38A 1B8AA 2EX0A 4CKWB 1UM8A 1SVMA 3EZLA 1KSGA 3ACCA 4JLNA 1E3MA 4B3SB 5C5IA 1RS0A 4Z51A 2WT8A 2W8BA 2Q21A 3NOOA 5K0FA 2YJZA 2OPHA 3HUTA 4CLRB 5IFLA 3WSWA 4JUBA 1XMOL 3Q9LA 3VJMA 5H59A 4PX3A 5D00A 3AR3A 2NV6A 4G97A 4TQAA 4IURA 3IGFA 1EX6A 1ONSA 3LSTA 2YQ5A 1U3WA 3KBGA 1KMCA 3N2KB 2JA6B 4R41A 3OT5A 3HCOA 2QQFA 4RHSA 4G3XA 4RYDA 1SKUA 2JLWA 1KLUD 5DWVA 1C4QA 3Q3VA 3R5XA 1L4UA 4NZ9A 2WABA 3GRRA 2YNMD 3FBTA 2VUMB 2IU3A 3H6KA 1JA0A 3RGGA 5FOQA 3CD6A 3ROFA 3RJZA 4N39A 3VU9A 2IH4A 4BZPA 5DGDA 1HLPA 4AH6A 3MELA 1RXCA 1KKUA 5IVKA 2CFSA 2Z04A 3QFFA 1Q82C 3KL4A 3UCXA 4E2ZA 4J4BA 4RG1A 3T5AA 1E63A 4B76A 4ZK9B 4QTYA 4X3PA 3LPNA 4QXMA 3UN1A 3W5OA 3K80C 5DMHA 2P6OA 4LW8A 3QWIA 4ALNA 4AKHA 4Y2TA 3S17H 3MRXA 1BUVT 1ZI8A 4O4JB 5DAUA 4OWXB 3INRA 5E6RA 1MC8A 1XN4A 3LYHA 2P1RA 5H80A 4OQQA 2Z4SA 2AN3A 4E30A 1XZDA 2BF7A 4P3KA 4PRZA 4IILA 3QELB 3TDKA 4TS9A 4H17A 4YJGB 1HI9A 3ED5A 3E9NA 2QEQA 4KV9A 2VXBA 1PGOA 5KUTA 1A9XB 2QD2A 5LLSA 3OA2A 1XDWA 1XVLA 2YU9B 1I8TA 3OCXA 5EP3A 2COUA 3T54A 2VP6A 3ETHA 4U6SA 3PITA 2XMPA 1GVHA 1FYCA 1IXRC 4EGCB 2AYYA 1JQDA 5DN9A 2Q0SA 3AIKA 4FN4A 3GH1A 5DTEA 2QZSA 4G09A 2HADA 1S4ZA 2IDZA 4IOKA 3VPCA 1JDSA 4FPXA 4HH0A 1MO5A 1I30A 4JUDX 2UXBL 1OZHA 4MYSA 3GDWA 3I3SR 4AJKA 1Z2CA 5HMMA 2QIOA 1ZKMA 2NWQA 1KAAA 2WUVA 3LQQA 5ALRA 1II9A 4OHCA 4HQRA 3V2GA 3CC8A 1KK1A 4DR7B 4PYOA 3LCVB 1K6IA 1LS6A 2I3ZA 3LT5A 5J39A 3CM0A 1S5CD 3IBYA 2TMPA 4AKSA 2XDWA 1LTHR 1HNWL 4CCYB 4UTOA 1TWFB 5FLEX 3WOFA 4YUZA 2CC2A 1P6UA 1Q5PA 4B09A 1GDDA 5BWLA 1UM9A 1YL5A 4B3RB 4L51A 2FWAA 2W00A 3WLKX 3MA0A 4V39A 3OOYA 3PEUA 3DVAA 1AV6A 3QU2A 3UK2A 3HFRA 1P1IA 1WCIA 2FWRA 2BONA 1Y82A 3T53B 3STXA 3A4MA 4B7CA 4P2BA 1TI7A 1QO9A 1T4GA 3GFPA 4C6TB 1IZ7A 1QX4A 3N53A 3QIAA 3U4GA 2V7GA 3OJCA 3RNLA 1YULA 3JD0A 3I5UA 1K75A 1UC8A 5JSKA 1DEXA 1CUYA 4DJ5X 3LUJA 3LVFO 2ZIUB 3PFBA 1VQIA 3A7AB 2XI4A 3QY0A 4WNAB 1BVYF 5FOVA 2CF6A 1HNXB 2D0PA 5HKKD 4XEUA 2J31A 3CZRA 4U2GA 3A1EA 1ATZA 2P9QA 1L5LA 4YRMA 4HJ9A 1KGSA 3JU3A 5I8ZA 1DV1A 1C0PA 4E09A 1IRIA 3G2PA 4AT1A 5LXTA 2JG3A 2Y05A 3EOZA 4O2BF 1IN4A 2WAQE 5HRCA 1ZL0A 2I65A 3E5HA 3U49A 3C3CA 1YS4A 2I6GA 1RPJA 3AM1A 4MO2A 4NBRA 1DOAA 5EJWA 3IEPA 4IQ8A 1Z6TA 3N8IA 2VZ0A 1O8CA 4BFTA 3H16A 2AQ1B 3N0VA 4WNCA 1VL0A 2V6BA 3FUWA 4L6AA 1V1JA 1KABA 2PZMA 3DA8A 3A8KE 2Q4RA 1MJFA 4DARA 3F98A 4HGQA 1X6VA 3FIJA 4RTLA 2ZB3A 3FDXA 4OREX 2WFAA 4RSMA 4I81A 3NETA 3GPCA 4MUEA 1DC5A 5JS6A 2AEMA 2AN1A 2NG1A 3ANSA 2VL7A 4B3XA 1Y0BA 2GPWA 2YYAA 3PU6A 3H94A 2ZXUA 4KXUA 1FE8A 3CKLA 4OLHA 4EW1A 2O8CB 1E58A 1PFVA 4O3FA 1T2AA 3FLBA 2WF5A 4DR4L 1N9KA 3QE9Y 1KVQA 5JPDA 4REOA 4ESVA 4KKUA 1N3YA 3P5SA 3ZZNA 3FRPB 3EROA 1V3QE 1K4YA 3FSEA 4DLTA 4IEFB 4DAMA 2YJ3A 4PYIA 2AOTA 2Z4HA 2VPWA 3UAWA 1WSAA 5KYXB 4DCNA 2YWDA 1Q84A 1DXMA 1Y81A 3ZEAA 4HH4A 2AEJA 2FRXA 3JQBC 3RAJA 1OI2A 4YQFA 2O0JA 3S40A 4K1XA 3BVZA 4YECA 4JI5Q 1BA2A 1SR8A 1E1KA 4Q9IA 1EIHA 4E6PA 4Q3EA 1OAOC 5JJ5A 1E7YA 4PBRA 1L0BA 1O7YA 2OZEA 2QSZA 4N0PA 3NNNA 2CW5A 3KBXA 4IKEA 2P9GA 1G2SA 2KW5A 4JITA 1EIFA 1M6HA 4YQZA 1NN1A 4KPEC 4KN7C 1U7TA 4F2GA 1KXZA 1EYCA 4DJDC 4L4XA 4RD6A 2H1HA 4UDYX 2QTWB 4X3SA 1U0EA 5JAHA 2EZ8A 2A67A 3A0UA 1U0TA 4NY1A 3OAAA 1R27A 2HK7A 1PFGA 1PEKE 2I62A 1XD8A 7REQB 4FGLA 5C8XA 4JYAQ 2FEXA 4EW3A 2NZJA 3CCMA 3J81E 1B00A 1UXKA 3D3RA 3IQXA 4DR3Q 4AO6A 1KJNA 3L7NA 4PLHA 3FOCA 2FR1A 1BS2A 3GARA 2EDCA 4R9UC 1RQ2A 2O3QA 4AP6A 4ZI3A 1XZNA 4NYJR 5FJIA 4FMCF 3L06A 1AHNA 2BCJQ 1BDMA 1Z2AA 5IC6A 2XZDA 2MSNA 4RPJA 1YHAA 3FOEC 2JFVA 4EQOA 3IT2A 4A2CA 4MVJG 3O4GA 2POCA 5I4CA 2HJWA 4B3CA 1NVKA 1V7ZA 1O0CA 4YO8A 1JX6A 1OB2A 2K50A 4D8WA 4AO7A 4FNGA 1UE6A 4BU0A 3HCRA 2WSSD 3WB0A 4OLAA 3Q8MA 3NC1C 1E6MA 1TTHA 2GWHA 4JJFA 2IE8A 2F0QA 3HFJA 4R1OA 1DJNA 3X1MA 5BNIA 1XNQL 4YRDA 3HOZB 2HF7A 1VHQA 3REFA 1B1AA 3AI1A 1C0KA 2FOIA 3NI2A 1H69A 4ZALA 2HHJA 1BQEA 2AD1A 1R4QB 2ZBVA 4A27A 4GKJL 4X66L 1VHLA 1T6YA 2GYUA 3E7WA 3IJRA 3A1NA 2X0JA 3LHDA 4M99A 2C61A 5A4MS 3H42B 4O3MA 3OZBA 5LDHA 2HQRA 4EBBA 3OZ7A 4P71A 1QHEA 4XTRA 4XB6B 1IXKA 2CLHB 4RA6B 1Y37A 1U0OC 3KPVA 3VR6H 4R0NA 3CS3A 4LI3X 3BN3A 2V6FA 3JAMA 5FV7A 3KOMA 1N2GA 3W2HA 1RABA 1YZYA 3C3MA 3QMWA 3RV4A 1Q1BA 4KFSA 1Z35A 5FI3A 3RVLA 3AVYA 3K70C 4DN6A 4GBGA 1XZQA 1UIMA 3OQVA 4RM3A 4RIFA 3FSGD 4YJHB 5IJ9A 3RFCA 3DP9A 1QGYA 3EZGA 1GAQA 2ZWOA 2ZRCA 1L1OA 1UMDB 4JP8A 1FPQA 5G2OA 4XWWA 2Q2QA 3J7TA 2PJZA 3J7AV 1K97A 5ELBA 4FUQA 4TV9B 4UP9A 1DKNA 2ZG6A 1KMQA 2DBYA 2Q1XA 1TQ6A 1OBOA 1PJLA 5LZ9A 2GERA 2WYVA 5C6AA 1WXHA 5FH9A 4DV3L 3MXOA 4MUAA 3HBNA 3MTEA 2DJFC 1Z2NX 4J7AA 1ADYA 4FM9A 1BR9A 3N2NA 3F2DA 2QQEA 2C5GA 2WOJA 5DBOA 1UPCA 3LRTA 4PZ9A 2IYOA 3SHQA 2CXNA 3AEYA 2VK1A 3FWNA 2UUBL 1E22A 2PT5A 1T2EA 4CHTB 1KEUA 1N8KA 2W48A 5AM5A 4CKXA 2IF0A 3SF8A 1WMBA 1A0IA 4HQ0A 4QFCA 4GEKA 1UBTS 1QYRA 4BJHB 4X65B 1IQRA 4IFDG 5F9MA 1JKIA 3JR3A 3CRZA 1DIOB 5C81A 4RKFA 4D8UA 2JFBA 2WWRA 3HRKA 2ZIAA 1Z3IX 2IVFA 4UTPA 1SE2A 3KTFA 2PU7A 1XTKA 4QBTA 5DGIA 3MGBA 3DMYA 4BQRA 4MPDA 1ZD3A 4JFAA 3ANLA 5GV7A 4GN4B 1XMIA 1GTL1 1AE2A 1T9GR 2E4XA 3CC2A 1BMQA 1G6OA 5SYNA 3ONNA 1YJNA 4IG4A 4CJ2C 3BFJA 3H83A 1UL1X 1MEOA 2X9VA 7ADHA 3M7GA 1GKLA 5HFJA 2IHVA 4F5DA 3BZDB 1EGQA 3C2QA 5ED0A 4P7GA 3LGJA 1NN0A 1RWKA 3AESA 2REOA 4WLFA 3PPVA 2VOJA 4Q48A 4GAEA 4WFN3 1NVXQ 4WIAA 3RRBA 4TTVA 1NPYA 2ZUVA 1SBNE 1WY5A 2D5IA 3LW8A 1S4QA 4QY7A 4IH4A 5EUBA 1XKLA 2XAAA 3OUTA 5ALMA 3FOZA 4GHWA 3ND5A 3OWHA 4Q3CA 1Q2XA 2B8FA 5AVVA 4ID6A 1X92A 4DBLC 5KYYA 3EB9A 1NVDA 1UT5A 1YFLA 1S3GA 1MXFA 2ZXRA 1E3PA 2YMLA 2ACKA 2FI1A 3VYVA 4K0KL 4M8NE 1V5IA 3RKRA 3ZLBA 3KWFA 4HXGA 4IVPA 5AW3A 1AURA 4U9HS 2FXQA 2SHKA 4OO1I 4H3HB 4JI7B 1ZLYA 3N86A 2VUUA 3PLNA 5IBQA 3I2FA 1W5SA 3MUEA 3NO4A 4RYLA 1PQYA 1Z36A 1OFGA 1XRPA 4NIMA 2FQYA 5IKMA 5DKFA 2YS7A 1J8QA 1G5IA 4HDKB 3W8FA 2PUJA 3LQ4A 3PFGA 1YNJD 3GLUA 2DB3A 1LPSA 1ODKA 4TRRA 4LSMA 4OSEA 3AVQA 4ZZ2A 1SXJA 1L6RA 3P71T 2HLDD 3RCBA 4MCIA 3DJYA 1GYRA 3RSOA 3VR0A 3KT6A 1B3QA 2Q49A 1SXGA 3ITNA 1JQYD 5LL6S 2XOKD 5G0TA 2I0QA 3NXWA 5AVWA 2J67A 4C29A 1R64A 3QUCA 2F1MA 1OYOA 4MQFA 3B1VA 1GGMA 4JQOA 2X8WA 4IOMA 5IJ0A 4RCOA 4CUKA 2D54A 4D9CA 2DFPA 2DR0A 2Q9UA 4RK6A 1FU7A 1KF0A 2AI2A 3H9JA 1H05A 2I5PO 4LHSA 3H3VI 4FF4A 1RWBA 1FEZA 3ZGZA 2XN9C 2WIJA 2VQ6A 1ECPA 2DHCA 1XT6A 2XITA 1BVRA 2YY7A 3PI6A 5KU1A 2K14A 3FWHA 4Z7JA 2ZRIA 5DCUA 3DWAA 2I7VA 4HJAA 2F0DA 3JAWB 1FFGA 1YQWA 2WNSA 4HGYA 2K6GA 1IWBB 2OXIA 2JKVA 2OGSA 1DT5A 3P9YA 3KVOA 3IR6A 5GVSA 4FLMA 4EITA 4PFSA 1P0CA 4MWDA 2GD1O 2ODNA 3IEKA 5LQNA 4JPBW 1J25A 2ZTCA 1W87A 1NCVA 2H1OA 1HOTA 4N3GA 2ZQZA 2PCLA 1F5NA 3OTOQ 3IC5A 2GKGA 3EEIA 3GA0A 3ADBA 4M9XA 2OLEA 5BQOA 4LSZA 2AS0A 4NBLA 3U61B 1WRBA 3IO3A 1T6NA 2CBXA 5BSTA 1TGVA 4LX0A 3UKOA 2ZBDA 3PC4A 1TT5B 1PYOA 2JIPA 3TW4A 4ZWNA 1A82A 2V6GA 2LZ0A 4YMHA 4ZEOA 2XRQD 3KJPA 4DIFA 2MO0A 4G0YA 1NUCA 3A04A 2GSWA 3U60B 1UOOA 3H9GA 3MQ4A 5TQ0B 4QTUB 4TKUB 2XCLA 4RLSA 4ID3A 2C95A 2OQIA 2PFGA 1INLA 1LSUA 2BFNA 5CA0F 3H86A 1NAIA 3W6PA 4IDCA 3SGLA 2QJRA