4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC transporter related protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
3IHLA 1YJ9A 5L3SB 3TS2A 2YTXA 4DT1B 4QGGA 1UE7A 1D2NA 1N6OA 2VP6A 5CB8A 4H0LC 2D62A 2OCYC 2CEAA 2F1JA 2Q9BA 3N70A 1VHLA 3I72A 3NENA 3DLLA 1X54A 1HE1C 1R0ZA 4A76A 2ES2A 1OSNA 2KCTA 1E0SA 3C14C 4CF7A 2CWPA 2ODBA 3TBKA 4G7ZC 1NN0A 1KI2A 1HTWA 2FPMA 3PO3G 4KFSA 2EDGA 5JJLA 1G20E 5LBIA 4DKXA 1E0AA 1IXRA 4DR1Q 1T5LA 4A3MH 2GJAA 2QPTA 2X77A 3QVUA 2ZE7A 3Q5DA 2V54A 5FPSA 1W49A 1PA6A 4ERNA 2QQEA 3I3SR 4OQLA 5DN6D 1YHBA 1FX0B 2W2VA 5KNCA 2VQFQ 2C03A 2VP2A 2A6HC 1FL9A 4C3ZA 2KB0A 3AP1A 1F2UB 1A63A 2EVWX 4DEXA 5LPNA 2WHXA 2WP8J 2VS1A 3ULLA 1IN4A 2OE2A 4CGZA 2UUAL 2G6BA 1Z0FA 3E1SA 5JWRA 3I61A 5DHFA 1RRCA 1EUJA 5EAYA 2R7ZG 1MH1A 2CCKA 3KTAA 4Y52H 1OV4A 3B7GA 5BW8A 2H7VA 2WVJA 1MO4A 3RYTC 2OCBA 4J15A 4HB3A 3H86A 3QIAA 4F4JA 4LPSA 3U7HB 1S1MA 3A1SA 2VHUA 1LV7A 3ZJYC 1ZNWA 2F1RA 1VQDA 2AWOA 4G3XA 5GJCA 3DM3A 3GDEA 4GNKA 5B57C 3OHMA 5IHPA 1ZNXA 2Q2HA 2QGNA 5FBWB 4B71A 1YBYA 1XTSA 4NMMA 5IYCG 4O0MA 2UXDL 3ZH9B 4TZ0A 2E2IH 2WSSA 2ORWA 4JSTA 3OEHD 4QXAA 1CU1A 2YVUA 1WFQA 2VUMH 3IEUA 1Q81C 5DI3A 3QKRB 3H0GG 4MQBA 4D6PA 5IP9G 5DLQC 2OZEA 1VHTA 5K36H 1T5IA 4QQBX 2W2XA 5TVKA 4DR2Q 3PENA 1W7AA 2D5DA 1UBCA 2F4VQ 3HOWG 1FFHA 4ILEA 4TLCA 4PZZA 4ARZB 2QT1A 3I73A 4DVGA 2SHKA 1ESMA 4PAQA 1M2OB 221PA 2A68C 4LK2A 1XEXA 1ZM9A 1WE2A 3AP2A 3R9IA 5E7MA 1NY5A 2CLSA 3OAAA 4Q4JA 3AF3A 4Q9HA 5JI2E 4W9MC 2XXAA 4Y7NH 1SKYB 4KHPL 4MRSA 2ZJRA 2D3WA 2KA7A 3I7FA 2JLXA 2KWIA 4BPBA 3UATA 1RJ9B 2BH2A 3AVYA 4TQUS 2Q3HA 2IF0A 1ZM7A 3K70C 4Q4LA 1IQPA 1L4YA 1ZIOA 3KLWA 1KKLA 3EZ9A 2HXYA 4PZ6A 5CYPA 1DO2A 4TMWA 2BMDA 2FFHA 4C3IH 2JJ1D 4QBGB 1SXJA 1YZ6A 3UDFA 3F3YA 2D7DA 4QL5A 1E2ZA 2EFGA 4HAWA 4HAXA 5CDFA 2JDID 5D3MB 2X2FA 2P3SA 1X86B 3T51B 2ZRKA 4DV6L 4B3TL 3W5JA 1DOAA 4PXAA 2DGYA 2ID0A 4IDQA 2C98A 2CE2X 3B9QA 3G4SA 2XTNA 1N33L 1YE8A 3FWYA 3HPQA 2VQSA 4PPGA 3WHLA 1P9NA 1KO8A 5H1YA 1Q3HA 1VQKA 4ALPA 1AE2A 2VEDA 4PC1A 4QL3A 1K3RA 1HE8B 3UPUA 4JOIC 3EXAA 2J7KA 3H3VH 2AMCB 2BJWA 3DPUA 1EG7A 2J0VA 2V6IA 3LNCA 4DHEA 2ZETA 3QXJA 1JJ7A 2IA5A 3LO5A 5TB5A 3DDCA 2ZVQX 3RLOA 1US8A 3Q5EA 4D4JA 3CMAA 1ANKA 2FFAA 2HCJB 4IPCA 3HGBA 3NEMA 1ZUNB 1YQTA 4MGIR 1COWA 4BY7H 1H9JA 3E5HA 4HIOA 3TUIC 5C0XI 1YJWA 5CJPA 1AZTA 2J41A 3VHXA 1DADA 5FUWA 1BS1A 4PR0A 3SYLA 4HR7B 2Z0SA 4QGHA 3A5UA 4C0KA 2OLKA 1QG2A 3EIQA 3EAQA 3FPPA 3QKSB 5KUTA 1N9WA 3QVVA 2FPLA 2JA6G 2EJMA 1MV5A 3BU2A 4TLEA 1DS6A 3GO5A 2H1LA 2HXSA 3SE0A 4Q1BA 2IL1A 1K6MA 4PX9A 3M3YH 3PEYA 1FPMA 2EQBA 5E7IA 1G6OA 2CW0C 3REGA 5KHOC 2GEUA 4DNRB 2XNDD 2CK3D 1X3FA 4HLUA 2IS4A 2Z0MA 1DAFA 3T1TA 3FFBA 4LYAA 1GVPA 1Z7TA 2J45A 4JBMA 2Y8EA 5DIFA 3SJCA 3EPKA 2E1RA 2F55A 3A6PC 1I94L 3RC8A 3WNBA 4WW0A 2ZSDA 1WMSA 3AKDA 3QUSA 4D81A 421PA 3ND9A 5KO2A 1SVLA 4R4OA 4GLXA 1XMIA 2GEVA 2JATA 5LB2A 4MGKR 3CF5A 3GLIE 2X2EA 1Y8NB 1X3SA 2YHSA 1XMOQ 1L7VC 3DL0A 2G9NA 4BZPA 4AYBE 4RD0A 1UM8A 3HOZG 4R4IA 4ESVA 2B21A 2G0NA 3KJOA 4IOJA 3F8TA 4M1KA 2PMKA 4PSAA 5FLXc 2PCLA 3LDAA 4KXFB 1W3SA 1U99A 2C9OA 5IYBG 3H1TA 2N46A 5FI1B 1A8VA 2GESA 3RABA 1YRBA 2P6RA 2KBEA 4ZKDA 3A1UA 3TW4A 2E5LL 2K5HA 3FP9A 2XJ9A 4C30A 4TSFD 2E5LQ 1NLZA 3K0CA 3ZS9A 3LQQA 2BDTA 4Q47A 2K5NA 1Q46A 4YONB 3RSOA 1WDTA 1YR7A 1XMQQ 2HLDD 1II0A 1DCZA 5EUQB 4P75A 2HJVA 2VL7A 2VY3A 2ZR9A 4G5SA 4DV1Q 4ZV4A 4QRHA 2O8FB 2Z6KC 1T0HB 2ONKA 4BFTA 1HEIA 2FEMA 4Q21A 2Z6VA 5FUVA 1S9DA 4UQOA 1W0KD 4D26A 4Q18A 2WJJA 3P4YA 3HWSA 3CO5A 1IY0A 1ZBDA 3HPRA 1Q7YC 4WZBE 4Q00A 3IO3A 3U3KA 4LF8Q 2EFDB 3LRPA 3W5OA 3VHLB 3IQXA 3TAUA 4JV5L 4NYIQ 1T6NA 5KYKA 2EXDA 1OKKD 521PA 1BBUA 3REFA 1QHSA 2ATVA 3AVTA 1HNZL 2VP5A 3FHOA 4RCYA 1IOZA 3TEHB 1H95A 1H8HA 2JA8H 3A8TA 4FMCB 1RVDA 1Y1WH 1DXMA 4C4PA 2WAQG 4BFYA 1Z6HA 5IP9H 4ZDWA 5M5XH 1TNDA 2GJ9A 3U7GA 4XOIA 4DIEA 1DAHA 3MMPA 2XAUA 3NEJA 3LLMA 4UP9A 2LWIA 2CJWA 1E9SA 2HCBA 3NKVA 4M53A 4OYHA 5TXGA 1XTDA 4QM6A 4JLNA 1VECA 1S3GA 1IL2A 2BBOA 1JNYA 4K0KQ 1U9IA 1E1RD 3MWKA 5LDDC 5G41A 4DUZL 1NMYA 2GXQA 4LFCL 2L5TA 1HQMC 2BWJA 2WPDD 4TMVA 4C0JA 4EKDA 4DUZQ 2EJGC 1I2MA 4F7WA 2DUDA 1TWFH 1CJMA 4YWKA 1F3OA 3A4NA 4LGMA 4LZZA 1CKMA 2EU8A 2Q2TA 2HF9A 1QUQB 3SS8A 2I3BA 2RCNA 1NVUQ 2C99A 3IDQA 4LY6A 5IYBH 1D2EA 1OLOA 4IEEA 2D74A 3BJUA 4O2LA 4KITB 5L3QA 4RD3A 1KJWA 4JI7L 4DLUA 4OGQC 2WICA 3C8UA 1I5FA 1Y1VH 5J4LA 4XVUA 1GKIA 1SVIA 3PEUA 4LUOA 3H2YA 3L8YA 3QBTA 4YMTA 2IEZA 1EFTA 3IGFA 3D31A 1JEEA 2QP4A 4M0LA 2E9SA 2EIFA 1KD1C 2CL0X 2I0QA 2XOKA 2XX3A 3K9NA 3KQUA 1KGDA 1IN7A 4KI0A 3AV0B 5GQOA 3J7ZC 1AA9A 2WJHA 1FNNA 3B8HA 3PUXA 3CB4A 2ZS7A 4PZLA 1W5TA 3FKQA 1XXHB 3L82B 1QHHA 4JLKA 1KHIA 4MYCA 3PO3H 1OT3A 1NL3A 3GLFA 2FZLA 1JMCA 4K81B 4Q9IA 3ONWA 4FCWA 1LF5A 4RD4A 3TVTA 3U44A 4DSUA 4YY3L 3QPVA 1IBLL 1FGUA 4DR1L 3RZDH 4JLAA 2B63G 1SQ5A 2IS1A 4AWXA 1VQPA 4Z8YA 1VQLA 4BEJA 3AYHB 1UKYA 4LHXA 1S72A 4C0AC 4BASA 4WZ6A 3HR8A 1D6JA 2ONJA 3B82A 3OZXA 1OH7A 5AUNB 1EIYB 2NN6H 2XTIA 2VSOA 4NYJR 5EZ5A 1UKEA 5EJEA 3BZCA 1JXMA 5CLLA 3X2SA 4DR4L 2ZRNA 3Q7QA 4A3EH 2LKDA 2QEXA 1XTKA 4PTLA 3G6EA 2ZSBA 1N6IA 1IYJB 5IWAQ 3HJNA 1OFHA 3C16C 1Z9FA 4A3DH 1DAMA 3GCGA 1NJGA 2ZVPX 3PCOB 2ZQ5A 2ZU0C 1MKYA 1ZNYA 3MWJA 2EFCB 2FWRA 3T34A 4B74A 1BYIA 3I4LA 1C9KA 1YZNA 2C5LA 5TY0A 5C4XH 3W90A 3OEED 4D80A 3A36A 1E69A 2JQOA 1C4OA 3ZZ0A 1B9NA 4EPWA 2GJSA 4L5TA 3T1YL 4KFRA 3TSOA 2GBLC 1FQKA 4P4SB 3TLXA 4IDOA 4GN3B 1Q1BA 2QGQA 2J3EA 4HJ9A 2NZJA 1M74A 2X19A 4LSGA 2ZUDA 5KSZA 2PEYA 4L9WA 4EQ6A 1V8QA 3KF6A 4OX9Q 1TWGH 1E94E 1KZGB 2OM2A 1G64A 2QG6A 4WOPA 2W00A 3L7ZC 1VQ6A 2IYTA 3OAAD 1A4RA 3I56A 5AJZA 1XF9A 2DWPA 4Z1MD 5C4JH 3I4NG 3CP0A 1JXOA 3PUWA 4LHVA 4R98A 4DV4L 4C3JH 4HJAA 4DR7L 2D2FA 3W6NA 4AD8A 1IAQA 2BKEA 2OBLA 1RYHA 2IYZA 2PJZA 3AVPA 1JAHA 4XD7D 3ULPA 4IOLA 2ZU6A 1VMAA 2J0UA 3L0IB 4IO9A 2ZR7A 3BC1A 2QAJA 2RHMA 1CFMA 2XB4A 2EQSA 5EXSA 4R71A 1KAGA 2QI9C 2BM0A 4GBMA 1E2GA 1GHKA 2FG5A 2W6JA 3N2IA 2BE5D 4LF6Q 4DLVA 4LJ8A 3L43A 2L15A 4JBJA 4LF6L 4IFDI 4JI6L 1J5EL 1EFUA 1GKHA 5EQTA 4NXNL 2BE5C 1I94Q 1KYIA 1BKBA 1XTIA 5HCIA 5LMUL 1NN1A 3U44B 1E4YA 3I1FA 3LVQE 3OTOQ 3JVUA 4GKKL 3UDXA 3LBIA 4TSFA 4EJSC 3AGPA 2JE6I 1HCZA 1FVIA 2FV8A 4TTPA 2AKWB 2ASBA 4CRWB 4LW1A 3H84A 4KV9A 2FDCA 1BH2A 4AG6A 3VU9A 3AVUA 1N6PA 3S14H 4LYJA 3GFOA 3EPLA 4BE7B 3CBQA 4BFWA 1G8FA 3FKIG 2VA8A 2ZRGA 5DI3B 2H5XA 4Q4HA 1GRNA 3TJZA 2HYDA 1OH5A 3HOWH 4F91B 4JVLA 3RRMA 4DSOA 3M1IA 4RZ2A 3TRFA 1D9ZA 4BZXA 1CRPA 1OHHD 2JA5H 3PSIA 4DR3Q 2V8OA 3QPWA 4RZXA 2WWGA 3S1MH 1VQBA 2WJGA 1GNRA 1E2HA 5IY0A 1KAOA 3AQ4A 4M1MA 2V4DA 4IVPA 4GMDA 3CRVA 3EA5A 3ER0A 5DYIA 1BKDR 1KK3A 4DV0L 4C0BA 3W3AA 4HB2A 1KZ7B 1GJXA 2IYSA 1ZC4A 2AR7A 2ZE6A 3B85A 2B8WA 4IVQA 3VR2A 5CK4A 4FCVA 4X8LA 1M1YE 4MDEA 2DFKB 2ZJ8A 1U8YA 1EYGA 3S17H 1PUIA 2WJYA 3THXB 1MKHA 4X64L 1GNPA 4OX9L 1GIAA 4DV5Q 2WAQE 3MFYA 3EW9A 1HNWQ 2WB1E 3L0SA 5JWOA 4ESHA 3T1VA 3VU9B 2JJQA 1AS0A 2AD1A 5JRJA 1H9SB 4AYWA 1SE8A 4BLPA 1XRJA 4ZDIA 1BBWA 4GNXB 2GHIA 1ONBA 2O5VA 3HOUG 5A5GA 1UKZA 4A3DG 4UNQA 3X1DA 4TLAA 1S3OA 2ZS9A 4NHOA 2GF0A 2H18A 3U4VA 3THWB 2NO9A 3O47A 4JS0A 1VQOA 1YNJC 2QMHA 3U4QB 1PH4A 1VG0B 2LXJA 4KKUA 3GTLH 4URVR 3N2EA 1Z63A 5HR5A 4B3BA 3J80i 1P7CA 4KAXA 4OQNA 3PO2H 1CS4C 1KOFA 4D4LA 3ADCA 4C2TA 2IHFA 1Q21A 1G5TA 3AUYA 3KDFA 2BBWA 2J1LA 3SR0A 5H68A 1GUSA 2QA5A 4UPAA 2JJ8A 2V4ZA 3W6OA 3X1YA 4A2QA 4FW9A 3PIOA 1WCMH 2I5MX 2ECKA 3BFVA 1ONLA 4A2WA 1NP6A 3BB4A 4B3ML 1WCV1 4A3IH 2ANBA 3ZYCA 2JA7H 4LYFA 2ANCA 1F6BA 4XWAA 3FOZA 2ZT9C 1SVWA 1A7JA 2N1BA 3M0EA 3N5CA 1GM5A 1J8MF 1F48A 4JL6A 3I5YA 1CUKA 2FFQA 1SROA 3A37A 3NBZC 2BDOA 1Z6YA 4L4UA 5CM8B 1G41A 1NVVR 3QF4A 1P8LA 4OHVA 4US0R 1S96A 1DARA 4I81A 4R7ZA 4KKSA 1V43A 3BB3A 3OFND 3CPJB 5AUOB 3JVVA 1CKEA 2VF8A 3GTKH 4B2PA 4P4TA 1W0KA 1YR6A 4DDWA 1TF2A 1E98A 1HV8A 4RKFA 4GZYC 4LDJA 4IPGA 4B76A 4TYQA 1OYYA 1J70A 2BOVA 1KI1A 3AB3A 4A9AA 2YWHA 4MKGA 5CITA 4JI1Q 2NZ8A 2B3GA 2Y0SE 4HIDA 1N34Q 3A7AB 1BO6A 3HKZG 3S1NH 2OCAA 4IFDJ 1D5CA 3FVQA 1BIFA 4TKOB 4EQ5A 1Q86C 2FGKA 3NWJA 1OXTA 1QHYA 4KJZA 2NQ2C 1XFAA 1YKSA 2ZJZA 2FJUA 1IXSB 5HCNA 1LNZA 3SZRA 1OHHA 3QEJA 3TREA 2F9LA 1TEVA 4BEBA 3VNUA 1A0IA 5HGQA 1JBKA 1E1RA 5DLQE 3U3MA 4Q19A 1AH9A 2VH5R 1HT2E 2WSMA 4URWR 4EPRA 1VG8A 5UKDA 2H57A 1GOTA 2UUAQ 4Z1MA 3AKYA 1CI3M 3GTMH 2GAAA 2D2CC 2LMCB 1BVSA 1OPXA 1VQJA 2EJFC 1RYFA 1Y1WG 2DFTA 2A6EC 4GS3A 4A3KG 121PA 3VKWA 1NJIC 4DLRA 1CF4A 3BH6A 1JR3D 5FBRB 4U7DA 1E9CA 2PCJA 2VUMG 1XBTA 2HDNB 3GEEA 1ZINA 5B30A 4FXPA 3E9IA 4U02A 3EZ7A 4R1JA 2OTLA 1E1OA 1E2FA 2GZHA 5K36G 3T1HQ 2WZQA 4L5RC 3HFZB 3TZUA 3KFUA 3FKSA 3ND8A 4B48A 4DLYA 3B5JA 1U2RA 3RANA 4GLAC 3I4MH 2QTHA 1TX4B 4D0GA 2XGJA 4DT1A 5CIQA 5FFMA 3B6EA 1UE6A 1N25A 1KMQA 4LF5L 4BFUA 3U61B 2OCEA 2GETA 1E9BA 2ODNA 3WNDA 4C7OA 2OFWA 3U7EB 3VX4A 2R44A 1U98A 2MO1A 3KKMA 5M3MG 1UWVA 4JI7Q 3GLGE 4CEHB 5FTKA 1P62B 1Q90A 1TWCH 4DUGA 1GRRA 4YQFA 1ZYRC 2XZOA 2LKCA 1KI4A 3SYKA 3CRLC 2R6AA 1Z3IX 1Q82C 1VCNA 4M9ZA 2WWHA 4JBWA 3WMEA 5JCPA 4HLQB 5SZJA 2V1XA 1IN8A 1E1QA 1LUZA 1YITA 1DAGA 1ODFA 1X8LA 3UWKA 1QZHA 3HKZE 4DNIA 2Q6TA 5FPTA 2LCFA 1A62A 4QIWE 2Q9AA 3GTOH 5FPHA 3AVVA 3LWUA 1RE0A 2FOLA 3IILA 4XH9B 5J4YA 3QNUA 2PZGA 1VQFA 3KDFB 2DHRA 4FWIB 2XSZA 1XD2A 5BN3A 3CXCA 1G3UA 2VW9A 4I1OA 2QM8A 2AKAB 2GNOA 3ADBA 2KBFA 5E7NA 4QGFA 2FSIA 2ZREA 4Q66C 1Q1ZA 1JECA 2B29A 3VR5A 3M7NA 3A7LA 1KK2A 4II7A 1WBBA 3GMTA 3PEWA 1NVVQ 3CW2C 1KJYA 2B8TA 5LMNW 2GXAA 1EX7A 2N42A 3I55A 1E3PA 1AN0A 2IYUA 4DRZA 2O8FA 1W2BA 1VTKA 1OFIA 4PSKA 2UXCQ 4I99A 3MEFA 5GROA 2E74C 4ZIRB 3ZIAD 1GD7A 5KDOA 4A3CH 5IWAL 1AQUA 3KKOA 5GVRA 3X1WA 3R20A 3QJYA 3K7UC 2IF2A 4C0QC 2CBZA 1E9EA 3K53A 4CEJB 3IEVA 2AL7A 1CTMA 4JLJA 3KB2A 1R0XA 2WIBA 4V03A 1N33Q 4ZI3A 4ZCIA 3AH8A 1OE0A 3ZDQA 4UJ3A 1M90C 1C1YA 1VPLA 3BOSA 1MIUA 1E96A 2CNWA 3EARA 4X8HA 2UUCQ 1KJZA 3CM0A 3ASYA 3B1YA 4UY8C 1AS3A 1D8LA 2ZJQA 1N6RA 2N8NA 4L8JA 1Y1VG 1LVGA 4R2IA 4URUR 5C18A 3HOXG 2KENA 5EZ6B 1VF7A 1N0UA 1JAIA 1X8JA 2AD5A 1EESA 4B6EA 3QG1A 2HF8A 3FHWA 3A1VA 4HYYA 4BY1G 3K0AB 3P32A 4EUNA 3E9HA 3AVXA 3L2PA 1QUQA 5EXPA 3LW8A 3EC2A 3NIBA 4LJ7A 4GOPC 1TADA 2OCPA 4NBSA 4TL9A 3WMGA 1EGAA 1JR3A 1SVMA 3W1GA 3R8FA 2A5FA 2IW3A 2C96A 1BOFA 5HPYB 3LX8A 1OIWA 3BAFA 1UDWA 1G19A 1YHNA 4OI2A 5ANRB 5C46F 4PZ8A 5H1SE 1QVGA 4AKIA 1X6OA 3OIVA 4B6FA 2I5HA 2JJ1A 4UNRA 1XD9A 3BBPA 1W1WA 2RGAA 2ZM6Q 1I2DA 3A1TA 4P0TA 5M3FH 4PAMA 1XTJA 4HEJA 2IC5A 2A68D 3N6RA 3JAMi 3TS0A 1YHQA 1SFOH 4LF4L 4IJHA 4P72A 5C3EH 2J7PA 1PH5A 3LA6A 3TK1A 4KFUA 2XZPA 4GPTA 1MRNA 1JQLB 4HJ7A 3PJRA 3PGZA 3DKVA 3BERA 4F38A 1JR6A 1EWHA 1SMYC 1UF9A 1YZGA 4GOPA 2CLDX 3KQKA 4AYTA 3J81c 4I1UA 4Q4JB 3NBFA 1Y8PB 4YMWA 3CR8A 2G0TA 2NVTH 2ZI6A 2HIXA 4B3SQ 2PT7A 3KLRA 3M4QA 4NXML 4A93G 2MMGA 2ZJBA 1UE5A 1KNQA 3AUXA 3BIFA 3FGNA 3K09A 1T3HA 1DG3A 4DK1A 2GCOA 1KI3A 2VHQA 5HTKA 4GNXA 4X65L 2J0QA 4GMXA 5K8TA 1E2DA 3S1AA 1LFDB 3GJ7A 3LWNA 2QM7A 1FL0A 3KF8B 1U0JA 1B7YB 1LS6A 1SZPA 3SHFA 3RNLA 4P4SA 3F2DA 4PC2A 3T56B 1XJVA 3QKTA 4M21A 4US1R 2UXBL 1COWD 4JI2Q 4TTQA 4B3DA 1GAJA 1P2TA 2ZAMA 4RMFA 4JLMA 5AUPB 4GOKA 3KQHA 3F2BA 2H92A 2QT0A 5FOWA 4Q7LA 1E2NA 4NP6A 3ERSX 2R7FA 4PO8A 1W4BA 2G77B 2N3SA 1TUEA 3MLEA 4JKYA 2YYZA 1E9RA 1DE0A 4P73A 1E24A 2QBYB 2VO1A 4TMZA 4V0MA 1O7IA 1S2MA 4PC7A 3D7MA 4MYTA 3SYNA 1Q57A 4TMTA 1HNXQ 2WBLC 3I5XA 2ZPTX 3AKEA 4MGYR 1VQ4A 1GHJA 1VQ7A 1C0AA 4MYHA 4P33A 5AJVB 3TVDA 3LVRE 3MAAC 3H94A 4ITRC 2B8FA 1VCMA 2Z83A 4UNSA 5GJWC 3K0SA 1RPZA 3OE7A 3CW2A 1CJTC 2OSBA 3U6KA 1Z8FA 1Q0UA 1X1SA 2V7QD 4QFMA 4CW7A 1Z6TA 4DWJA 2JASA 3O8DA 1HYQA 2PQAB 3GJ4A 4DSTA 3LXXA 4PQYA 4A0HA 1GUGA 3A8KE 3F5FA 3U3OA 2CNWD 2G1JA 2DY1A 4GI7A 4A3FG 1RRFA 1G9XA 1R0WA 3NEYA 4B43A 1Z0JA 3KXIA 4G5QA 3I2ZA 1NIPA 4BFXA 4B34A 2K7VA 4QM7A 1SVOA 2BM1A 4LFBL 4Q7JB 4HLDA 1ZD8A 1G3MA 4I7ZC 3NVAA 4HZUB 4WXPA 1JPNA 1IY1A 4BGDA 2WKQA 5K8LA 1HPCA 3K0FA 2YJTD 3BK7A 3RWOA 3MJRA 3CWQA 5D3QA 1L4UA 4BY7G 4XSGA 4EPVA 1SVKA 2WSSD 1AGPA 2GVZC 2ZRDA 2IYLD 5C1BA 1A1VA 4Q1AA 3MJHA 1QJOA 4P74A 2VP4A 4LV6A 3PIRA 1MO3A 4KFTA 1E6CA 1W46A 4HLCA 3STBC 5C0XJ 4AIIA 721PA 3CNNA 2A8VA 4JL5A 3RLNA 3AVQA 3F0TA 1DAKA 1E1TA 1ZNZA 5JWHA 2ZRPA 4GKKQ 5JRZA 1N36Q 3DM9B 3KYHC 3G82C 3KL4A 2OV2A 4JI2L 2RB4A 2D4HA 1KRTA 2J7PD 1LM0A 2ZTEA 2XNDA 4WBSA 1XJ0A 5FOXA 2DNCA 1GL7A 4JMPA 4C3HH 1VG1A 4KODA 1AIPA 4L5BA 2NN6I 2XOKD 4AG5A 2XTMA 1UADA 2C78A 3HP1A 1DEKA 4Y0AA 1X6VA 3CQZH 3EQLC 3S16H 1P60A 4NH0A 4URZR 4CVNA 5P21A 1Z0IA 3GTQH 2BCJQ 3I4MG 1VQAA 3M4YA 4Q1DA 4V02A 3TE6A 1UKVY 4KCGA 1E2IA 2BMJA 1NNEA 3IHWA 4IPDA 1GUAA 2G83A 4JI5Q 3TH5A 3K0XA 3OIWA 2X1VA 1VF5C 1NRJB 2PZFA 5GAHC 2QA4A 3FMPB 3M6AA 5E7JA 1W2GA 1EWQA 2NVQH 1VDZA 1R8SA 2J9RA 4OBEA 2XITA 2YC2C 1X3GA 5DYGA 5KTYA 5M5YH 2LXKA 3W3ZB 1TQ6A 2WKPA 4BFZA 4HAYA 1E2WA 3P26A 2IXGA 4OWTB 4X8OA 2DFNA 2ZIAA 3ZJYA 2FEOA 3EG5A 2XNSA 3LAWA 3LD9A 4DV5L 2BA1A 1IBRA 3AF2A 2BVNA 1LACA 3KXLA 4LBVA 4OQXA 1KNXA 1E3MA 4JL8A 5BN4A 4JI4Q 4KMUC 3K9LA 4LYHA 4V0ME 1KSGA 2AUJD 3T1HL 2MFIA 3I8XA 4AC9A 2OBNA 3SNHA 1GUTA 4H02A 1WB9A 5DNYB 2J5XA 3PUYA 2EWVA 4E07A 1OYWA 1FQJA 3V4RA 1YVCA 5GAGC 1TMKA 5LD2C 4LJZC 2OO7A 1K8RA 1NI3A 5M3FG 1QHIA 3LNNA 1VYVA 4JLOA 1W36B 2EFHB 4JJKA 3THYB 3AFQA 3W1BA 1OKKA 3K9GA 5SZIA 4PANA 3HU3A 4RZ3A 3T12A 4IPHA 1K83H 4JI0L 4ZO4A 4JLVA 2DFLA 1GKYA 4ZDJA 1HJPA 2EYQA 3P20A 2V7QA 1GWNA 4Q1EA 1ZCBA 1CKNB 2FF7A 3X1ZA 5C4GB 4BLSA 2C95A 3NDPA 1N36L 1WP9A 4E09A 5BWMA 2ZROA 3HOXH 3T1YQ 2OESA 3RRYA 3RS0A 3KKQA 5FL7A 1NKSA 4MNOA 4ASUD 1M34E 4X6AH 1ZC3A 4IDHA 1VQIA 4V0OA 2H8KA 4EAQA 1G51A 2AK3A 2OFXA 4LV5B 3C15C 1IJFA 3LFUA 2HEIA 4RJLA 3HOZH 2IYQA 3FTQA 2O8CB 5G3ZA 3CUEF 5AJ3Q 5EP4A 1CRQA 2QRNA 3CCVA 3U50C 4QGUA 4Z8XA 1KXLA 5AJ3L 4OJQA 3UDGA 1N0WA 1KI6A 3B1VA 2OXRA 1M7GA 4RD6A 3ZIAA 4B3RQ 5BN5A 1Y63A 2ZJ2A 4KVAA 5KSOA 1UAAA 4RCNA 4DUYQ 4DR4Q 2QORA 2QP3A 4QHSA 3ZVMA 3T61A 2QROA 3DMNA 1KO5A 3NTUA 2VHTA 4NPSA 1G3RA 1TXYA 3EWSA 4M2LA 2E76C 1CIPA 1G8HA 1Q44A 5C4MA 1CJKC 4U00A 4D4KA 1K0RA 1R8QA 2B7CA 1WF3A 3MWLA 4DC9A 1JR3E 2IX1A 1VCIA 3C4JA 4TLBA 5FTLA 4MTNA 1ZYUA 2GWHA 4ABYA 5CDFE 1OF1A 1PJRA 4PHTA 3DO6A 2VQFL 3J81i 1G3IA 1KY2A 1P6XA 1YI2A 1IHUA 1XJCA 2IXFA 3KQLA 3AP3A 5C44G 2QMOA 2K52A 1E2JA 3NHBA 4FMDF 1G4AE 4KLZA 2JEBI 1OB5A 5IT5A 2H5EA 4JCVE 2YOHA 3QKUA 4UXJA 3UKDA 4LF5Q 1YZUA 1ASYA 5GAEC 4Q7KA 2IEYA 2O8CA 2J87A 3IBGA 4PC6A 3FMIA 1XJQA 1SLJA 3LV8A 1CBUA 2QRZA 5TARA 4TTRA 1NN3A 1Z0AA 1N6HA 2NTYC 2W6JD 3CX6A 4JJZA 1UFQA 3CZQA 4GOXA 1ZIPA 1UE1A 1HNWL 5A0FA 1G3QA 1Q22A 4NE2A 5E3HA 4QHTA 2NO7A 1YEZA 4DV7L 2ZM5A 2PH1A 2HUPA 3S2DH 3RNUA 4DB4A 1G5RA 1VQNA 5AJWA 4AURA 1W36C 1RZ3A 2ZRJA 3UE0A 2NIPA 1I3QH 3KJHA 2VQEQ 4PQRA 3RWMB 4LF9L 3P4XA 3IIMA 5SZHB 3DXJC 4EX5A 4HIMA 1G16A 3MGCA 1SRUA 1NSFA 4XTRA 3SC3A 1DO0A 4QNMA 4DV4Q 4DR7Q 5EE1A 4MUBA 5FR1A 2F7SA 1Q1EA 1M1KC 1EFRD 2BKUA 2XXAB 1NF3A 1CR0A 1H65A 3CNLA 5TDHA 4A3BG 1EXMA 3CX7A 1E4VA 2ASEA 1II9A 1KDPA 1PH6A 2RGBA 3T53B 2HHHQ 1D2MA 5SZKB 3HOVG 1Z5ZA 2O8EB 4JI3L 1ZM2A 4DCVA 1XPRA 1YZTA 5IDVA 2YZ2A 4DLTA 3WY9A 4C7OB 5EP1A 2GBLA 4JBKA 3T06B 2R6DA 3GJXC 3EZ6A 3AKCA 4BA1I 3K70B 2RAPA 2R8RA 1PVOA 1X55A 2AWNA 2R93H 1P61B 2B6HA 2GK7A 3OYYA 3A4LA 4YHHL 4IFEA 2MNAA 4DSNA 4XVRA 1PH7A 3ETLA 3VQTA 1UEIA 1G6PA 3GLIB 1NG1A 3QKRA 2QAGC 1Z6AA 4LUVA 1XNRQ 4LWZA 4A0GA 3KKPA 4GZMA 4C0SA 3THWA 4A36A 2P6NA 1ZD1A 1XNRL 4JI1L 4LOAA 3ZD7A 1XNQL 2QP9X 5IYCH 3U3JA 3SJBA 5L3VA 3RLFA 1YZQA 2FU5C 4M9QA 4LJYA 2ZJOA 4IDPA 4KHZA 1QHGA 2CL7X 3GLGA 3UMFA 1XX6A 1R5OA 2FH5B 4BXXG 5TMPA 3CPEA 1H9SA 3SI7A 4FI3C 1H8EA 5DI9A 4IDNA 2IBMA 1GVNB 2UUBL 4DR3L 5IF9A 2OAQ1 3ZS8A 1DD2A 5C0XG 1IZ6A 3B6YA 2AN9A 3G48A 4MRNA 2PQAA 3OW2A 1XEWX 2ZUCA 2IYWA 3E70C 2VSFA 2NG1A 3ZVLA 4OHXA 3VNVA 1FNMA 4V0KA 2PLRA 3HU2A 4H1UA 4CEIB 3WXMA 4IHQA 3WP0A 1HURA 4C0LA 1I50H 2A7QA 3F1ZA 2CXXA 4XTCS 3C5HA 3W34A 1E22A 4WJ3M 3AF4A 2BBTA 2R65A 4NPHA 1NLYA 2C9CA 4IKEA 4OHZA 1L2TA 2VZAA 3K70D 1KC8C 4HAZA 3U7FB 4DR6Q 3GTGH 1W4AA 1FP6A 2GVBA 1J99A 4OWWB 2JA7G 1SVSA 1YU9A 2BC9A 4DR6L 4B75A 2CVHA 1O78A 1MJCA 4ACBA 2JEOA 5CK5A 5JJIA 4PMWA 1R6BX 1B23P 5LD2B 1NBMA 4MA4A 4C0HA 2XGTA 3PQCA 2FA9A 1J7KA 1EFHA 2F4VL 1S1CA 4KSBA 3RRZA 4ZDKA 3CMEA 3WDNA 1ZAKA 2WWYA 1UEJA 1SR3A 5IE8A 2OG2A 4IFDG 1HTPA 3CWZA 3AM1A 1J2JA 3RVBA 3IUYA 1XD8A 1NN5A 3GPLA 3D0FA 2QSZA 2PNHA 2JEAI 4JLPA 3U5ZB 1R2QA 3DM5A 3X1XA 4A3EG 4G01B 1QF9A 2RGGA 2F1MA 4A3FH 2VLIA 3LBNA 5DISB 5JHHB 3GLFE 4EPYA 2Q0HA 4AKHA 3PEVA 1ZUHA 3B1WA 4LI0A 3CF2A 5J40A 1ASZA 2JCSA 3HU1A 4KSCA 3DEFA 2HT1A 3DZ8A 3L2OB 1KI7A 4A3MG 2ZRHA 4B35A 4FMBB 3K9HA 4DCUA 4YCWA 4DR2L 3FKSD 5JEDA 5JBQA 4HLUC 4MKHA 1XMOL 4AYXA 3KUCA 2KI5A 4ZI2A 2E75C 4R9UC 4DCSA 3GJ5A 1H9RA 4DLWA 1XD2B 2MSCB 3CZPA 4A8JB 4QGAA 3WRXC 5KSYA 2O0HA 5BQ5A 1OJLA 4YWMA 4NL4H 4KYUA 1EWIA 1ETUA 1QVCA 3TRZA 1RW4A 4LBZA 4AKGA 1KSFX 3TR5A 4F4IA 2MO0A 3GLFB 4GOJA 2WTUA 4ZCMA 4BA2I 4A3LG 2ZJ5A 2GA8A 3EIHA 4H44C 2JLYA 3NC0C 2QAGA 4UNPA 1CEEA 1WA5A 2K5VA 3NC1C 4PPQA 4DUYL 4L9SA 2O0KA 1P3JA 1HH4A 5CM9C 3VA7A 3L0OA 1ZM3A 1L2FA 1CULC 2VP9A 2IS2A 1QZXA 1DPFA 1NVXQ 4RFVA 4S35A 2F3RA 4DDTA 5IP7G 2G88A 4PPNA 2VHJA 5J4KA 1T4GA 1Z08A 1Z28A 1D9XA 2QE7D 1P73A 2ZR0A 3DHWC 2NMVA 5LMNL 3TQYA 3K0CC 4HDCA 5AJXA 4JG2A 5A4JA 1Z6GA 3O8CA 3EA0A 2YTVA 1G7SA 3CRMA 3TMKA 1P16A 3UE1A 5FOVA 1PH9A 1XP8A 3CPFA 3A0JA 3TQFA 5HZKA 2PNRC 2C77A 4E5UA 3SN6A 3AF1A 1MR3F 5DHAA 3OIYA 1YNXA 3RRNA 2WIAA 1CJUC 1BMFD 2W6IA 3WNCA 4YLGA 3GLGB 2O8BB 4R4TA 2PX3A 5EE0A 3THOA 5DH9A 4B3GA 2K33A 3BS4A 3DKPA 5KPJA 1MRSA 5AUQA 2QY9A 4LJAA 2R9VA 4IOCA 1Q8KA 4X8MA 1KHTA 3CLVA 2O8DB 4UNNA 1CR4A 1S9HA 1I6VC 4LCBA 3T35A 1N3BA 4UKDA 3SEAA 4UXHA 2AHOB 3GLHB 3LLUA 4LJ5A 4FN5A 3UG7A 4A93H 4FINA 3I62A 2ZRBA 4G0NA 5HKKD 4BFSA 5LB4A 4C2MH 1L1OB 2GXUA 1L0WA 3Q8DA 4YCVA 4EDHA 1CJVC 2WAYA 4TT3D 4A3GH 3RS4A 3R9XA 4DV2Q 3AEZA 1KRSA 2ZI3A 1VQ9A 4OO1G 2ZSFA 3E0EA 1F2TA 1Q20A 1AM4D 1GRQA 2W0MA 4KBGA 4L16A 2PCFB 2JK8A 5K8UA 1AKEA 1XWIA 3B1ZA 3D6TB 4JSYA 1E79A 1FTSA 1QHNA 2BIFA 4J0QA 2GJ8A 4NZYA 1U8ZA 1S8FA 2R2AA 2K32A 5TV2A 3RDPA 4Q9JA 4BLRA 4GP6A 2FE4A 5KU1A 4A75A 2REBA 2WKRA 5E95A 3U60B 4EFNA 3S24A 4Z54A 3KDSE 4BUJA 2R6CA 1SKQA 1XTQA 3Q9LA 3WYAA 2BJVA 1CLUA 3VTKA 3ICQB 2R7ZH 1TF5A 2WWIA 3WBJA 2CKZB 2B92A 4OK6A 4IOAA 4Q1FA 4TL8A 2IYYA 3CC4A 1XCMA 2JIZA 1B8AA 2KBNA 4YCUA 1J6QA 3RN5A 1E9DA 2WOJA 3GLHE 4Q48A 3T1OA 3FHTA 3QE0A 3TAHA 4WJ4A 3TNFA 1N5KA 3UXMA 3GJ3A 4DXAA 3CC7A 3VR4A 4QG7A 5E4FA 1PLJA 4ZKEA 4MRVA 2JLVA 1A82A 5DSZA 4CEHA 3GTJH 2GCNA 2A5DA 4URYR 1QRAA 1QZGA 2Q3MA 2R62A 2GN5A 1XNQQ 3G0HA 3UK6A 1WCMG 3S1QH 5FTJA 3MSXA 4HATA 4LHWA 2NO6A 4IXMA 4JV5Q 2YU9H 3CD6A 2ZRAA 4UJ5A 3HYRA 1PYBA 3QQ5A 1CXZA 2ZYVX 2QTVB 4AK9A 4L8GA 2CL6X 2ZI5A 1P2UA 4RD1A 2PX0A 1TQ4A 4DDUA 3ADDA 2QF7A 2KHIA 3JAMc 1UBGA 3FHCB 4BBRG 5JEAG 3UDIA 5IK2D 4R4CA 2FN4A 2VBCA 3FE2A 1SXJC 4JOIA 3J7A5 2WV9A 3NBHB 4KLKA 2H16A 1OIXA 1W4CA 1FMLA 2AKYA 2WPDA 1PV4A 1N32L 2D06A 1E7ZA 1HQCA 4BBSH 1Q12A 3Q72A 4YXWA 4D82A 5JI3E 3K1JA 2MMCA 2Z4RA 4HDOB 4O3MA 2H17A 3FFAA 2NO1A 2ZI4A 3WMFA 4NYIR 3TUJC 1KMHA 3B2EA 3QOFA 1NG9A 1W0JD 1LW7A 2W0SA 1AS2A 4OI0A 2AUKA 3LX5A 1Z83A 4GN4B 1QHXA 2O5IC 3KZ1E 1IJEA 1WI5A 2YINC 4O2RA 3PUZA 1CKOA 4CZ2A 1KTVA 5A35A 2CQOA 2B63H 2YOGA 3EPHA 1XXHE 2UXBQ 1KAWA 4I1VA 3PF4A 1C9OA 4NXNQ 4JLDA 3THXA 3IIJA 4YDSA 5KOYA 1IW7C 3NXSA 4WA7A 4JYCA 1NIJA 2OUKA 2RMKA 1T5EA 4NCNA 2YWGA 1BMFA 1GITA 2W6ID 3ZZUA 5FTMA 2JLZA 1HH2P 4M1WA 2GCPA 1T91A 3CCRA 1G21E 3O8BA 3QF7A 1U0HC 1Y69U 4NKRA 4OO1I 2WJIA 3BH7A 1OFUX 2IYRA 5EE5B 3U4ZA 5JEEA 3OE7D 1ZU5A 2VYFA 3P27A 4OQMA 2GAOA 2ZEJA 2PMZE 5AWFC 4FCTA 4B3XA 4X62L 2FMXA 2DBYA 4HB0A 1FUKA 1DELA 5IYDH 2ORIA 3GTPH 2JA5G 1WRBA 1RRGA 2WMOB 3EWAA 3T15A 3V9PA 4QJ3A 1YZKA 5L3QB 3TR0A 1CKNA 4LPKA 3T5DA 5JLJA 3K7AH 5HE9A 2ZTDA 1IBML 1MT0A 2QQ0A 3A1WA 3V00A 5BYKA 4LNQA 2OQ0A 1KDOA 2VL6A 4X65Q 2QU8A 5FOSA 4A3KH 5GADl 3UANA 1CSQA 1YJNA 1SGWA 2P5TB 4O2DA 3AVWA 2OLJA 3THYA 2WWXA 3C41J 3ICEA 3QF4B 2A9KA 4NCIA 1FUUA 3HDTA 5CJ2A 3OTOL 2PJRA 2FGJA 2JLSA 1E79D 2ZUBA 3EN2A 3ULJA 3KX2A 4LBWA 4DR5Q 2IYVA 2Q8IB 1FOEB 2PZEA 4KN7C 1IXZA 4NYMR 4LUCA 4D0NA 4GKJQ 1XPOA 2VPPA 5G53C 3KUDA 1GL9B 4DV1L 4V0NA 3QSYA 3BFXA 1NVWQ 4JYBA 1YZLA 4NXMQ 1FP7A 2WMNB 2HYIC 4DNTB 2EFEB 1JE5A 4JIMA 1FW6A 1UDXA 3IO5A 4LF7L 4IXNA 3RC3A 1RIPA 1NY6A 1RIFA 2FSHA 1AK2A 2JIZD 5JJKA 3NH6A 4LF7Q 5EE9A 4FWTA 1G7RA 4LBYA 2XB2A 1PYSB 2G1KA 2F1HA 1HZ9A 1WXQA 4OL0A 2IHYA 1XZQA 2ATXA 2PMDA 4CT5A 5IP7H 5JZVA 1N5LA 1G4UR 2X8AA 4KO8A 4M9XA 2CDNA 4OQFA 2Q21A 1OH6A 3NH9A 3CX8A 1SN8A 3CCUA 4HIKA 1TL7C 2HT6A 4LX0A 2A69D 2KJQA 4XSHA 2IS6A 1LTQA 4BY1H 1W4RA 4HI0E 4EPTA 4CDGA 1CR1A 1AJEA 2O0JA 3LXRA 1T3LA 4LUZA 2I1VB 4PHHA 1HUQA 1TAGA 3QXCA 2J0SA 1JALA 4DEYA 5B58C 2O5JC 5CB6A 5C4XG 5IRCD 4MKFA 2W58A 2OTJA 1BDOA 1QG4A 4Q4AA 1ZKOA 3LQRA 3D3QA 5D3MA 1RC8A 3K81C 2QENA 2HJGA 4YXWD 5JFGA 3CPHA 3GQBA 2RGNC 1VQ5A 4AIMA 4QOSA 5J3BA 2KCMA 4A2PA 5L8VA 4AY2A 3EPJA 2RGEA 4US2R 1L1OC 2ATWA 1W0JA 2R7DA 2GRJA 4PZYA 5EXTA 3OEEA 4IOKA 5HZHA 4NTZA 4XJXA 4QHYA 1RJ9A 2F1IA 3BORA 1QBKC 5J5CA 1OXXK 5LMUQ 2RHDA 4HJ8A 1YIJA 3GP8A 4A0FA 4B73A 1IN5A 3A74A 1EQRA 3R9WA 3R8CA 3RS7A 1EOVA 5J4VA 1JQJC 3VDYA 3K0FB 3V4FA 4CYMA 5F3WB 2RH5A 4BWYA 4KKTA 1Z2AA 4JI4L 1CSPA 2JDIA 2BH8A 4PPFA 3ECCA 3CKLA 3M4PA 1II8A 2TMKA 3EZFA 3SGIA 4Q1CA 4GZLA 4URXR 4PQFA 4YMSA 3A8IE 1G291 2HHHL 1TU4A 5F9HA 1VQCA 1VQHA 1X56A 5EE3A 1II8B 1E0JA 2BEKA 2XEXA 3S1AB 4A82A 4TMKA 4I1SA 3A5ZB 1VIYA 5AR1A 1RFLA 2QMEA 1TQDA 1U9IC 3PR1A 3M9BA 4XWOA 2JLUA 2ZI7A 2A19A 4TYYA 2I1QA 4JI5L 2REOA 2HV8A 4FMDB 4TZ6A 4DV0Q 3D8BA 2ZTCA 5JCZA 5BXQC 3WYFA 4OI4A 3CRQA 4A4DA 2EVBA 3TKLA 2MSEB 3LH5A 4P3YA 1GZSA 3LY5A 1X65A 1KO7A 4X66Q 1P9RA 4YY3Q 4Q01A 2O8BA 4IFDH 2ZRMA 2CWAA 1PHJA 2C04A 5L3RA 3EX7C 1AZSC 3IRBA 2ZI9A 2IUUA 3EASA 2QBYA 1ZD9A 3DOEA 3GJ6A 1OTCA 4LRWA 2A69C 2IUTA 4GN5A 1WQ1R 3KF6B 2KSQA 2V1CC 1JB7A 2BEJA 3GFTA 1ZP6A 1IYUA 3ZD6A 3AF0A 1NTGA 5M5WH 2Q3FA 5JMTA 3CH5A 2GZDA 4NONA 4CEJA 5IT9c 1LABA 1VYTA 3BRWD 1M7BA 4Q4HB 3W5IA 5FJ8G 3IQWA 3KQNA 3MCAA 1NE3A 2Z6KA 1GO3E 3NELA 4AH6A 1I4LD 1MO6A 2CCJA 4A4IA 4AYBG 1N32Q 2CJWB 3DMDA 3W6PA 4A6PA 1DGSA 1T9HA 1F2UA 4C9BA 1O7LA 3CRW1 2P67A 3HYTA 1E2VA 1JI0A 2ZJAA 1KL9A 4X66L 1W48A 2AFIE 2QEQA 4G1UC 2QAGB 4TQ9A 2AXPA 3ZQJA 4ASUA 3S2HH 1EFWA 4B44A 1TU2B 4AQYQ 1OXUA 4MGZR 3MXUA 3H0KA 4C2UA 1X1RA 1X9NA 1G5PA 3K8YA 3R7WB 4A8JA 3HOYG 1UEBA 2QTFA 1AKYA 3A8JE 1XMVA 4A3JG 3UMSA 2VQEL 3K8AA 4DV2L 5GJVC 1KKMA 2C9YA 1MJEA 4TVAB 3PVSA 1Z47A 2C2HA 4MKIA 1KY3A 1GP2A 1VKJA 3R7WA 3ZVRA 3JC66 1K8OA 1E2LA 1Z0DA 1Y3AA 4QBFA 1KSHA 2JA1A 3PCRB 2C8VA 4G7HC 2ZJYA 4TLDA 2DYKA 2D2EA 4DPGA 1SXJE 2GJKA 3KB1A 4G5RA 3BD9A 1X3EA 2FXQA 2QPOA 3SJAA 4MYUA 1LF0A 2KE5A 2NPIA 1DVRA 1X8KA 1XXHA 2V55B 2FPKA 4HUQA 4RCZA 3RZOH 2D0OA 3SJZA 5M04A 4JYAL 1S3SA 3B9PA 4JI6Q 2AX4A 2J59A 5H70A 3U58A 1KQSA 2R92G 4TL6A 4OWXB 5FBLB 1KO4A 1HZCA 1MO5A 3IPXA 1W47A 3L0PA 3EZ2A 4BRWA 2YKGA 1KSJA 1EQQA 1PUJA 4A15A 2XJ4A 3AFPA 1N34L 1K9MC 1H9KA 3MD0A 1KDTA 4DK0A 1IW7D 1D7QA 2P65A 1SMXA 1G17A 1WYDA 4W5HA 5FOUA 1NMFA 4A1FA 2QL6A 2F3TA 1R5NA 5DE3A 1IONA 3EIVA 3FMCA 1HZBA 4JKIA 1CTQA 4KBFA 4M4SA 4N3NA 2I5LX 4B2LA 2UUCL 4HJ5A 4QJFA 4A3IG 5G3YA 2UUBQ 4A3LH 1TPZA 1D8TA 1T0JB 2JAQA 2ODEA 4G5OA 1GUOA 4ON9A 3U9SA 1L1OA 2PL3A 4A0RA 5F98A 2IY5B 4R4QA 1B70B 3HKSA 1HR0Q 4LC1A 4N1AA 1DTSA 1XEWY 1HR0L 4EIWA 1OB2A 3QY0A 1K5GA 1GILA 3KXKA 4W5JA 4Q9KA 2W83A 5KDDA 3CCEA 1GNQA 1UBEA 4YHHQ 1GTVA 1XTRA 3NBXX 4ZIRA 3OEHA 4MDFA 2ZJPA 1SXJD 3SQWA 1VQMA 1K8MA 4L5SA 4XWKA 1M7HA 2EYUA 2W2TA 2V9PA 2DWOA 1N5JA 4B3CA 1FX0A 5K8IA 4YWLA 1OXVA 3LW7A 1H9MA 1C7YA 4A3CG 2CK3A 2P2LA 3CF6R 4M1YA 5B2ZA 1HT1E 1Y8OB 1E99A 1TQ2A 2GXSA 4IVRA 4IW3B 4OK5A 2K75A 3O8RA 2QGZA 1EFRA 1TWHH 4HDQB 4IRUB 2UVQA 2QSYA 1GL6A 3TSWA 2OWOA 1XMSA 5GJBA 1DAIA 4F92B 4W5WA 3NBYC 4MITA 4MH0R 1HQYE 5GADC 2GVAA 3RS2A 3SFVA 1E1QD 3BJIC 5JSZB 3S15H 2J0UB 2CE7A 8OHMA 2NVYH 3BGWA 1Q1QA 1KI6B 4X64Q 2K4KA 4LJ6A 4HB4A 1OW3B 4I4LA 2YV5A 2IYXA 1L8QA 3HR7A 4GSYA 2K5UA 1ZM4A 4DCTA 5FLMG 4DLSA 2JA9A 3BE4A 1VS0A 2XSZD 4JI8Q 1QVFA 2NGRA 4KHPQ 4D2IA 3WWVA 4HUQB 4ZPXA 3PIPA 2OHFA 2VSXA 4XIGS 4DZZA 2ZTSA 4PC3A 4IEIA 4Q4AB 3QG5A 1JEDA 3T5GA 3WHKA 3GEIA 3B1XA 3VR3A 1K8AC 1GSIA 1N2CE 4S2EA 4TN1A 5HE8A 4A3GG 4D4MA 2UZIR 1WJJA 1DBSA 5FH9A 5JEAJ 4DAMA 3FYHA 4OONA 1GFIA 1NJFA 3AGQA 4LHYA 3UWOA 4DB2A 3KFXA 1E2QA 4QY7A 3RSLA 3A4MA 4G7OC 3STBD 3SOPA 1GG2A 4WXRA 4TWZA 2YC4C 3KJGA 2R92H 4A3JH 1PLLA 5JSZA 2RGXA 3GEHA 1FYCA 2JLQA 4DV6Q 4B3TQ 4H13C 5EXXA 4TMXA 4GKJL 3CCJA 1N6LA 3KJPA 1G1MA 1QVAA 1XDBA 1Z29A 2UZ3A 4JT2A 1A5TA 2J46A 3PXGA 4P31A 4YMVA 1JJ2A 1G8YA 2LSSA 4N0EA 2DB3A 3RAPR 1GDDA 1UBFA 4POAA 1IBKQ 4LFAL 4A92A 3D4RA 4FD2A 2IX3A 4UP8A 3BH0A 2UU9Q 4MRPA 1ELOA 1YVDA 4KN4C 1Z06A 2CLCX 1G8GA 3H3VI 1P4SA 5FPYA 2Z4SA 4B2IA 4HAVA 1E2EA 5ELXA 1PFSA 1S4QA 2OILA 3C5CA 3JZMA 4OKSA 2WOOA 4PV1C 2R6GA 4WZAE 4NB3A 1U90A 1NBMD 2CHQA 2P5SA 3BFKA 3P1JA 3PG5A 4JBYA 3HOYH 1VQGA 4MUAA 4YMUA 5JS8A 4JLBA 5C3EG 2A5JA 4B47A 2ZYTX 3J81j 4BQSA 1A2KC 3I4NH 1IM2A 1SHKA 1GUNA 2QMUA 1G6HA 1YNNC 1JJGA 4OJKA 4FIDA 4BZQA 4AI6A 1TTTA 2JJ2D 2DR3A 1KI8A 1HZAA 3I4OA 2EW1A 2FNAA 5KNDA 2JGNA 3UIEA 4M1OA 4LFBQ 1Z6XA 2ORVA 5F9FA 3PV0A 4X62Q 1IXRC 1YJ5A 2UU9L 4CT4B 1H8ED 4DCNA 4JI8L 3M4OH 1WOCA 2RKOA 2WWWA 4P71A 2Z5FA 4DIDA 2BHRA 4RY2A 5B64A 2B7BA 3B78A 5BR8Q 1W44A 3IKJA 4JZKA 2CHVA 5BR8L 4PG3A 1PH2A 4WVFA 3NHAA 3CC2A 4E22A 1YR8A 2JLWA 1FMJA 3RHFA 3FMFA 1F2TB 1FTNA 3QEOA 3CR7A 5AJYA 1H8HD 2DCUA 4M1TA 2V1UA 2IK8A 1RRPA 4D0LB 5EP2A 1NKTA 4DDVA 4LF4Q 2O52A 5EUMA 4CEIA 4O0AA 1F60A 2WWFA 2FX3A 2QN6A 3CAMA 2ZE8A 4M1SA 4XVQA 2XZLA 2CCZA 3RR5A 2NN6G 1GKUB 1NMXA 3BB1A 4NCJA 4EPXA 1SXJB 4GP7A 4OK3A 4FDBA 1O87A 4PAOA 3UG6A 1TKWB 1KIMA 3CCLA 2WB1G 4TL7A 3W8RA 4IFBA 1U81A 3CNOA 2VF7A 2JA6H 3GLIA 1PH8A 4B3SL 3WP1B 2A3RA 1V9PA 4GFDA 2A6ED 3VX3A 3VR6A 1RKBA 5FBVB 4YC7A 5GVSA 1IBKL 4Y0VA 1VCOA 1KI9A 1XCPA 4LV8B 2DN8A 2HLDA 4JYAQ 4V0LA 1V1QA 5DO9A 1N5IA 1K73C 1LS1A 2PI2A 1US8B 2PEZA 3DOFA 3KOJA 1A2BA 2ZRCA 4PHFA 2KCCA 1VIAA 4PO9A 5KSPA 4E03A 3U4QA 1G7CA 5F2EA 2V3CC 4L5QA 3U3RA 2GF9A 1E9AA 3VKHA 1XNJA 4PHGA 4KVGA 4RSGA 3HOUH 4K8OA 3AB9A 3WRYC 5ELOA 3RS5A 2BMFA 2GKSA 2NO0A 2FSFA 2F43A 5ELNA 2RGCA 4BLOA 3BG3A 2RHQB 2ZSEA 3Q8XB 4DR5L 1E2KA 3BZKA 1NY4A 5G40A 4NYMQ 1B9MA 1KDRA 4TQAA 1XMQL 1BYUA 2CCGA 4PSVA 3TSZA 4DV3L 3W8NA 5KPDA 4DAYB 3CCSA 3ADKA 3KJIA 3Q85A 3EC1A 4JC0A 1J90A 3CONA 2ALYB 4GT1A 2JLRA 4LJ9A 1HNXL 1HY3A 2RF4A 3OESA 1N8RC 1P72A 4HZIA 2D0PA 3SHWA 3S1RH 4JBXA 1E0KA 2UXCL 1M6NA 4P32A 2IXEA 1YHAA 2IHBA 2P6UA 3SDZA 1OIVA 3CRKC 5HKKA 3J81k 5LMNQ 1IYVA 1TUIA 4F4CA 2IHEA 1HNZQ 1B0UA 3VAAA 4RKEA 2ZS8A 4TT3A 3BWDD 1SKYE 1Z07A 1V5WA 2GILA 2F52A 4EJSA 3M85A 3EIEA 2FSGA 3U6BA 4LWCA 2GK6A 2R6FA 3MXNB 3QENA 2Q2UA 1MABA 4G5GA 4BLTA 4EFMA 2F3IA 4Q02A 3CRRA 2Y0SG 1VYUA 1F5NA 4OO1H 1ZRHA 3GJ8A 1TF7A 2REXB 3IIKA 1U0LA 4K0KL 2JJ2A 4PO1A 2VIIA 3VKGA 4DK3C 3VFDA 1KIXA 2OT3B 2BCGY 4ARZA 3WBKA 3I8SA 2IUSA 3CIOA 4UXIA 2AXNA 4MZ9A 2ZYUX 3L8ZA 1YR9A 1QHHB 3FKIH 2UKDA 4WAUA 2YWEA 1J5EQ 3QI2A 2ZM6L 3MUFA 4NDZA 2AHOA 3GLHA 4BLQA 2Q9CA 2FFBA 3FMOB 3H15A 4QBIA 3QPUA 2GVDC 3ZLJA 4Q7MB 2OBMA 2VRWA 3GFPA 3TW8B 3OF5A 1RL2A 4OXPA 1Z0KA 2QZ4A 2KHJA 4HZUA 4QJ5A 3IPYA 4MRRA 1PMRA 4RD2A 4GLVB 4POGA 2R93G 5FJ8H 1S40A 2GZAA 1P2SA 4H9GA 2NZHA 3A58B 2BV3A 2GEDA 3DZDA 3FB4A 4APVA 1R10A 4RFSB 1T3SA 5KNBA 2QNRA 1R9TH 1HA3A 1UJ2A 3AVOA 4BFVA 5FPKA 3TGPA 2O8EA 2ERXA 4K46A 4GNXC 4DV3Q 4NU0A 3OW7A 1QVRA 6Q21A 4A3BH 3QXSA 1W36D 4EQ6B 3CF0A 3H0GH 2E87A 5JHGB 2E8GA 4UP7A 4M8NE 2JXMB 4TYPA 2IWHA 4Z51A 2WM9B 3SU8A 4W7SA 2VTKA 3PF5A 821PA 1ESNA 5FLMH 4H1VA 4KU4A 2ERYA 2BA0A 2YWFA 4BECA 3PUVA 1FR3A 2YTYA 3GD7A 3OPOA 2G3YA 3FPAA 1Y14B 2BBSA 2P0EA 5J4HA 2VNUD 3FDIA 4JK1C 4LHZA 4JT4A 1KMHB 3LBHA 1ZU4A 2ZRIA 4P4UA 4TYNA 2NVXH 4F93B 3W9YA 3E2IA 1KK0A 2OXCA 5C44H 2D7CA 4AQYL 1R0YA 1XB2A 4CIDA 5JECA 3ZVNA 3CPWA 1E32A 1NMGA 2IWRA 2CFMA 1EIFA 1TWAH 3Q7PA 2WAXA 4HAUA 3SQXA 3BXZA 1XZPA 1I4TD 1E2MA 1Q3TA 1JPJA 2F6RA 3QXXA 4JVSB 621PA 2BMEA 2IT1A 1LTLA 1P75A 5FTNA 5BYJA 1ZCAA 2YNMA 2DNEA 2A6HD 4BBSG 4DJTA 2OFOA 2YOFA 1U94A 5FOTA 2Q2IA 1MOZA 5FUYA 1NMZA 4B3FX 5FR2A 2N49A 1XEFA 3B60A 2F43B 3C7KA 1OXSC 5JEAH 4XD7A 3SBEA 3JZAA 4A6XA 2UXDQ 5L3SA 2PT5A 1R5BA 1SHZA 1DG1G 5EP3A 3RS3A 1EFCA 2QE7A 2A5GA 3I32A 4NCHA 3G5UA 1XEXB 2N78A 1PH1A 1KK1A 3VMFA 1N6NA 2ZXUA 1Z2CA 4FMCF 4RG1A 3SBDA 4BRUA 3I92A 4LF8L 4RZUA 5CLQA 2K14A 1IY2A 2CHGA 1O3YA 4Q03A 5FBQB 4BBRH 4GOPB 4TYWA 3DVLA 3WYGA 1I6HH 3ZZTA 2F9MA 3U2QA 1U5KA 1PZNA 2ZE5A 1IBMQ 5CIWA 2ODWA 2AFHE 5KDLA 5J47A 2VP0A 3G71A 2VHCA 4GRAA 1DAEA 1TU3A 2ZYWX 3NG1A 3Q3JB 4IJMA 4L15A 5AK0A 2PLFA 5CYOA 3TUZC 1LY1A 1J8YF 2I4IA 1FJGL 3F2CA 1JT8A 2ZSAA 4AKEA 4GL2A 1I4DD 5M3MH 1AQYA 2QUZA 2K50A 3H4MA 2PPBC 4QKQA 1P5ZB 3OIUA 1NLFA 3K09C 1G7TA 1W5SA 3MG9A 1LYLA 1WBDA 1T8TA 1SULA 4DLXA 2QPAA 5C2JB 1XMJA 1ZUIA 4B3RL 2HQLA 2PI2E 2NZOA 4ZCLA 4B33A 3BDOA 1K5DA 5C0XH 2OAP1 1ZW6A 2B8GA 5H8WA 3K0EA 4RFSA 4YDHB 1S0UA 4QC2A 1IBLQ 5DN6A 1R7RA 2ZANA 3VR1A 2CVFA 1EWRA 1VG9B 3K0AA 3CCMA 4HSEA 4R2HA 4A8JC 1ZJ6A 1EX6A 2XTZA 4DK6C 2NOAA 5IK2A 1XU4A 3KTAB 3QKSA 4GDFA 1ZVQA 3PITA 1G8PA 3TIFA 1JJVA 5FL7D 3K80C 4LK1C 4JVNA 5FI0B 4EFLA 4LFAQ 3GJ0A 3CCQA 2O8DA 1UPTA 2EWWA 1PLKA 4NCKA 4BXXH 1VQ8A 4LC0A 2ZITA 3NDBB 2NPFA 1ZMXA 4IOMA 4PZ7A 4HUTA 3NE5B 4OHYA 1U8AA 1G18A 3AEVA 2A5YB 2CMKA 3J80c 4M22A 2HIVA 3OFNA 3ZQ6A 1FZQA 3KFVA 3EBEA 4DBLC 4LJ4A 4N0DA 3KKNA 1W2HA 2A78A 2GDJA 3SFZA 4KLNA 1CP2A 4Q9LA 4Q5IA 1E9FA 1VQEA 1LB1B 2ZRLA 2PBRA 1K8GA 2C35B 2E2HH 4PFSA 3MWYW 2OQKA 1OFTA 1R4AA 2JA8G 2WFWA 4ME3A 4M9SA 4DKAC 5FL3A 4QBHA 4U5XA 4DLZA 2DPXA 2A1AA 1MABB 3ASZA 1IN6A 4RVCA 2MSDB 3TQCA 4WIAA 3UMRA 4ACAA 4B3MQ 2OEPA 4EJSB 4DV7Q 4DUGD 3HOVH 2GTPA 3QXHA 2IX0A 2DWQA 2RHSB 2V6JA 4POFA 4D25A 1A6XA 1AGRA 4NYJQ 1TEXA 3OOCA 1Z22A 5DGXA 5FUXA 4JVMA 1FJGQ 1M8PA 3ZGXA 1P2VA 4LF9Q 1AE3A 1P9WA 2A30A 1T8UA 4O25A 1NSTA 5IYDG 2ZRFA 3IBYA 3PFIA 4JI0Q 2AK2A 2A2ZA 1EK0A 2WJVA 4IQZA 5HY6A 4LFCQ 1KO1A 2E2JH 4KYIB 2ZAOA 3IFTA 1N6KA 1JB1A 1YRAA 1CR2A 4OI1A 5JS7A 1JJCB 4JI3Q 1E2PA 3LGJA 1QDEA 2FZ4A 3QBVA 4B32A 3T1QA 1XPUA 4OHWA 4IJLA 1OH8A 1HR0W 2Z43A 4QJ4A 1NBME 2L0XA 3KJEA 3AQQA 3B13B 2RGNA 1PH3A 2RGDA 2GCOB 1N0VC 3RN2A 2MQHA 3CH4B 3PO2G 1XCGB 4QNRA 3MRSA 1NBWA
chains in the Genus database with same CATH superfamily
4P5DA 1EUYA 1YJ9A 4HNTA 1C3VA 2EYMA 3TS2A 1CQXA 1PD1A 3M4ZA 4WKPA 3W0LB 3SFTA 5CW1A 5U9CA 3OQOA 1R9JA 4MWBA 3T9CA 5JE8A 3K1AB 1G5HA 4B48A 3I72A 3NENA 3DLLA 3EBLA 1R6TA 1R0ZA 3LHFA 4HDSA 3FPJA 3C14C 3TP6A 4HQFA 5CV8A 3T9DA 4E70A 3TZKA 1KI2A 2WZBA 1HTWA 2HSEA 3B5EA 1ZG3A 4H6WA 1UODA 5JJLA 1G20E 1WUYA 1WNFA 2VZ8A 4G0ZA 4KFSA 3TTSA 1TCAA 2OR3A 1E0AA 1XZBA 1IXRA 4YRFA 4DR1Q 1DV1A 2GD6A 1XYGA 3L1UA 5FPSA 2Z8ZA 2DQYA 1W49A 4BMCA 1CJCA 1Y37A 4AP6A 4CMIB 4ITVA 4TWJA 5FORA 2RD2A 3BIXA 2CKDA 4Y2RA 2C03A 5K3OA 4GM1A 1FL9A 4XX0A 2C8JA 1GGMA 4FILA 1A63A 5LOVB 2VRCA 2EVWX 2IV2X 2WP8J 2VS1A 3NWBA 2YU9B 1IN4A 1BA2A 4YREA 1YDFA 3CCFA 3MAQA 5JWRA 3F73A 3I61A 5F4BA 1EUJA 3FFWA 5EAYA 4LYEA 3WRYA 1MH1A 5E3JA 4DPMA 1MGSA 3E3LA 4LTNA 1OV4A 1U2EA 5E95A 5K3EA 3T5AA 2H7VA 1YBAA 1NPTO 3A9TA 4XIIA 1WU8A 3VPXA 1MC4A 2OCBA 1V9SA 2OZKA 3EMDA 4HB3A 3VI4B 3FNQA 5FLEX 1ZJJA 4BGIA 3QIAA 4D3SA 4DZRA 4IICA 4LPSA 3E9CA 1UAYA 3EXIB 3L6EA 3A1SA 4CIVA 2VHUA 3O3CA 3HK2A 2HQRA 3KCQA 2X8LA 1I4RA 4ZYUA 1JIVA 4X3KA 4FYMA 3DM3A 3GDEA 1K8QA 3JQ8B 3OHMA 5FBWB 1C3JA 4B71A 5FUQA 1YBYA 2HNKA 1YDWA 3I30X 3EK2A 3VA5A 4Y9UA 4YGYA 3ZH9B 4DQVA 2E2IH 2WSSA 2PD3A 3IPLA 4UE2A 4U2BA 4OHCA 1CIJA 1V4NA 3QEMB 2NTJA 3IEUA 1HNNA 3MOIA 2PBFA 4C1NA 4HVCA 3QKRB 4MQBA 2R8XA 3EDRA 4M55A 3OT4A 1N4DA 1UJ5A 2OZEA 4WECA 3LC0A 1M1YA 2W2XA 1P4JA 2K5WA 4S0XA 1QRTA 5LYJA 1KZ6A 3V97A 1WB5A 4ZJYA 1UBCA 2P41A 1GPH1 2QN1A 2F4VQ 5EHQA 3HOWG 3FBTA 1FFHA 3LUHA 5BPFA 2QVGA 4XR4A 1BCPD 2SHKA 3PX2A 1ESMA 2P7HA 4PAQA 2A68C 1QJ4A 3SZGA 1Q91A 3R0VA 3H5WA 2PMZB 1E61A 3T99A 4CQLB 3AP2A 3OTHA 1BU8A 2CHEA 4MW1A 1L5LA 1YL6A 4MA0A 4W4TA 3PDIB 2XXAA 4JN6B 1SUFA 4Y7NH 2VYND 4BXOB 1WSDA 1UXJA 4UFPA 2ZJRA 4CNBA 2ZJ6A 3P2JA 3F4LA 2X5XA 3I7FA 3L5OA 3N1UA 1RJ9B 2E6KA 3HDHA 4YJ2B 3HVJA 2IF0A 3A1DA 5F73A 3H5LA 4I46A 4JXXA 2QJRA 3MGGA 4WORA 1ZIOA 3OQIA 4RIHA 2KEEA 1N2GA 3WGIA 3EZ9A 4X1IB 2XUKA 4PZ6A 5D3IB 3ZWMA 1G9TA 3CFYA 3E7DA 1BQQT 1E1CB 2HBYA 3DFMA 1SXJA 2XUOA 2YMLA 3UDFA 4OXYA 3M5DA 1Z2PX 2D0PB 1SZDA 2JAOA 2EFGA 1GY8A 2YXLA 3CA8A 5CDFA 1NTRA 1ZNQO 2P2NA 1AW7A 3EGDA 3ZU2A 4C29A 4M46A 1PV2A 3B3JA 4FFLA 2X2FA 4BCDA 1MEJA 1VSBA 2B83A 3T51B 1TIKA 1NJ1A 1WPXA 2IYNA 3NATA 4UOQA 2P78A 4Y6GB 3QW4B 4KUHA 2JARA 4IDQA 4ZOBA 2C98A 2CE2X 3U7JA 2GA4B 3ZGLA 1HNWB 1NVEA 2BFDB 2IHVA 3Q40A 4EITA 2FW6A 5G4KA 5HF6A 4RJTA 3AO0B 3WHLA 1KO8A 1A5ZA 3FYSA 1IE3A 3LHDA 2VEDA 3ZCRA 2Y27A 4JOIC 3EXAA 3LZ6A 4O63O 5COBA 3DPUA 3PFGA 2A0WA 4MPPA 4R0MA 1EG7A 2J0VA 1VHQA 2V6IA 4PCUA 2A14A 3E5SA 4RXMA 2ZETA 5I4IA 3WQRA 1MZPA 1QYIA 2JKYA 4YAEA 2WWRA 5IJZA 4C3IB 1YS2X 3LO5A 3J7TA 3DVSX 2ZVQX 1MXFA 1T8YA 3RAGA 3Q5EA 3UOAB 3S2GA 3BN3A 2HA2A 1ANKA 4CL0A 3OD5A 2HCJB 4V2IA 3NEMA 1YQTA 2XODA 3HQ4O 1J8FA 2QJFA 3A10A 4FHDA 5JVDA 1X7ZB 5JPDA 4YDQA 2V7GA 5AXDA 4HIOA 4JELA 2CMFA 5C0XI 3A6GA 2J41A 3BCUA 4YMIA 3IMKA 3SK4A 2Q1WA 4QXPA 3UA3A 3ZN2A 3MT0A 3OCWA 3OG9A 4C4ZA 5KYNA 4PR0A 3SYLA 2SCUA 1UNSA 2Z0SA 3A5UA 3IAYA 1CNFA 2PXXA 3EIQA 1B2RA 1JVNA 3G2JA 3I9NA 3JATA 5K3SA 3B8EA 3K15A 4AFNA 1MV5A 1FFSA 1JFFB 2XADA 1DS6A 1PUXA 2HXSA 4TLEA 1CZUA 1ACMA 2CY0A 2PTGA 2DHEA 2WT8A 3INNA 3M3YH 1NBWB 2CW0C 1EFPA 2FHSA 5DBGA 4GAEA 3U17A 3LZCA 4R2XA 3PGMA 5KTPA 2CK3D 1X3FA 3ZBPA 3UGJA 2IS4A 1ONOA 2DPLA 3RBAA 4Y18A 3SNKA 5LQCA 3EPKA 2E1RA 1I94L 4TX1A 3V8RA 2VDOB 4L8FA 4H7DA 4WACA 1DLIA 3J7AV 1J25A 2OQVA 2WHRA 1RQRA 4EYQA 4ZKBB 1FXUA 4DLPA 3ND9A 1LLRD 3ISTA 5TR9A 3VSDA 4R4OA 4GLXA 1XMIA 2WFZA 2JATA 3OU6A 3Q5GA 1F51E 4OQZA 1EFKA 1TUBA 2Z1CA 4HH3C 1T9AA 2ZTMA 4MGKR 2X2EA 1Y8NB 1EK1A 2HK9A 5ARCA 5F5LA 1L7VC 4EF6A 3U4HA 3SEQA 4RD0A 4AZWA 2QDLA 4NJMB 2EYHA 2B21A 1T5BA 4IOJA 3MJVA 5FO9B 2H59A 2KX7A 4HUJA 1MX5A 5EJIA 2SNSA 1KERA 4AY5A 5F51A 5AW0A 1W3SA 5GTDA 2W71A 2KVMA 3TBIB 4H7IA 1RWPA 3QSGA 2E5LL 2XJ9A 1EQ2A 3KO8A 5HFAA 3ZS9A 4FE4A 1QLHA 4DRXA 3LQQA 4B45A 4OHOA 1UCFA 2QB5A 3S1QB 3SQMA 2HO4A 3TOVA 4OATA 1ZSVA 1QO9A 1LDYA 4JXJA 1DCZA 1ZXTA 3NXWA 2INGX 4A5OA 2Z6KC 5DX8A 2ZBQA 2K7ZA 1QTNA 3SDBA 4B0OA 1S9DA 1W0KD 2BCEA 1BE8A 1DXQA 3E0XA 3EIUA 3KQSA 3LBFA 4Q18A 4WHMA 1ZBDA 5I9MA 4ZI7F 4L78A 1XUOA 1JLSA 1D2CA 1E77A 1UPAA 3VHLB 4AX8A 1RFGE 3TAUA 3BXPA 5KYKA 2XNAC 1F2DA 1MB0A 2EIXA 1B73A 4GI2A 3AVTA 1HNZL 3OTIA 7MHTA 1XVUA 3ZLTA 1H95A 2G82A 3HLYA 5TE9A 4FMCB 5KEEA 2WTXA 5BW6B 1UIRA 3DZKA 2YQ5A 2WAQG 1XIVA 5IP9H 1AHIA 1CZWA 2E4ZA 3TLGB 1X7XA 1VE5A 1MAVA 1DAHA 1Y8QB 1Z4JA 2Y2VA 3I05A 3NEJA 2K28A 3HZHA 2QSJA 4KOEC 3T0GA 1E9SA 3NKVA 4M53A 1UDCA 5JO9A 3IT3A 1W30A 2BBOA 2HA0A 1DRKA 3DMRA 3L0DA 4MLCA 4C7MA 3RYCA 4Y7NB 4K0KQ 4O4LB 1E1RD 2Z6QA 3NBUA 1D04A 3ZY4A 4MICA 2QIPA 4DUZL 1NMYA 2M2IA 2WPDD 3CGWA 1HQMC 1MZVA 2BWJA 3FMGA 3PD7A 4MUGA 4QFCA 3WDMA 3ZCXA 3OJFA 4UVDA 2LCQA 4E4TA 1OLUB 1J2TA 4LGMA 3SIWA 5CXUA 2BT4A 2Q2TA 1C30A 1SNYA 4I4TB 4KR2A 1DJQA 1BWQA 3HZXA 1QGZA 2C99A 4L7QA 5JG7A 3U4GA 5B1SA 4O59O 2D74A 2K6GA 4KITB 1Z4QA 2I99A 1RMYA 3OT1B 4JEMA 4UUOA 2OQRA 2PUHA 2Y3IA 4KX5A 4QECA 1BHO1 1XZCA 1AGNA 1L6RA 2VJAA 1P5JA 3G9ZA 2X0EA 4CFZA 1V1RA 3L7LA 5J4LA 3OQNA 3PEUA 3QKIA 4LUOA 4GP9A 1PI3A 1A5BB 1Q50A 2IEZA 4RULA 5I7OA 3D31A 2JGJA 1I30A 1ZN2A 3KXDA 5DNFA 4M0LA 2I0QA 3K9NA 2B20A 5M5YB 3NRCA 4NWIA 4OHUA 4PQEA 4KI0A 1CERA 5GQOA 2ESRA 2QD3A 3B8HA 4OQLA 5AW4A 4AZ0B 4BBSB 3OOJA 2NTTA 3FKQA 4JLKA 1E8DA 4MYCA 2HNBA 1QP4A 1FSSA 1W29A 1OT3A 2FZLA 1EL0A 1ULSA 1JMCA 3PU6A 4Q9IA 3RB8A 3BS1A 4FCWA 2IU6A 4RD4A 3VV3A 3U44A 2O4XA 3ANYB 3K7AB 4DR1L 3NEAA 4JB8A 4JLAA 4MKZA 3RTAA 2GH1A 4IGKA 5DEOA 3NHMA 3NW9A 1VQLA 1X2BA 1UKYA 5JH7F 3ZQKA 3KVVA 3EDYA 5LSAA 2EOAA 2OP0A 3UMCA 2B94A 4RJ2A 4GMGA 1YONA 4IEFB 5FWAA 2C5EA 2NZYA 3OZXA 3V7NA 4CM5A 1EK6A 3KRTA 3CKMA 4EGSA 5AUNB 2NN6H 1G21A 1Z33A 1BMDA 1Q83A 2JVIA 3NJRA 4E88A 5D3DA 1KAAA 1I1HA 1JXMA 4MHSA 1YNOA 1QBGA 2QEXA 1SA0B 1XTKA 3QWFA 4YHHB 1N6IA 1QRDA 1OFUA 5A4MS 1OFHA 2IXTA 3C16C 5BSUA 4LECA 4ALIA 5A9SB 1ILPA 5KYXA 1TZMA 4ZKCB 4HVLA 1ZNYA 2EFCB 3E3XA 1IK6A 5TY0A 1W9MA 2C5LA 4YJ3B 3EIFA 2O2JA 3M6FA 2W98A 3W90A 1FU7A 1M1ZA 3PGA1 3A36A 1F9QA 4D80A 4PRLA 2JQOA 5JXWA 3K70C 1B9NA 1AHNA 1SXGA 4ZXPA 3GX1A 1DEOA 1FQKA 1Q17A 1T9CA 3HA5A 16PKA 2OGTA 4BKRA 1X92A 2Z1MA 2F0PA 1HFEL 2J3EA 2XUQA 3I6IA 4MWSA 4N6OA 4P35A 2ZUDA 4BNZA 3OZDA 1RQNA 4ESOA 4H77A 2D9UA 2VJPA 2PEYA 5CVJA 4EQ6A 2XSCA 4OX9Q 2OM2A 2HA5A 2QG6A 1D7AA 1G64A 1KZ4A 1V26A 3ELBA 3ICOA 5HJ2A 1HLPA 2O1EA 3D8UA 5IUNC 5COYA 4PU0A 1SYGA 1XF9A 2HPAA 3L8DA 3R0ZA 3WGQA 4HX2A 4EB6B 2QRVB 5G0UA 2JZOA 4AQ7A 4MRAA 4R98A 4DV4L 3LT4A 2L0CA 2RONA 2YWJA 1IAQA 1H2BA 2BKEA 1RYHA 2OBLA 4QFDA 5A3QA 2GN2A 1JRLA 3IFDA 2J0EA 2ZOSA 3NIBA 2ZR7A 4ZTBA 2PSHA 3BC1A 2OF1A 1VGRA 4H16A 4KVFA 2IBTA 2QI9C 3KG2A 4GBMA 5F5NA 3VKVA 3E22A 4JX9A 2FG5A 1F8FA 4LF6Q 2WP0A 3MINB 3IA2A 2GT1A 3JYQA 4DQDA 2L15A 4LF6L 4MS3A 4BBJA 5HUHA 4ULLA 2BMAA 2P77A 3TEFA 3RYIA 2RHHA 4NXNL 1B26A 1RRMA 3PXUA 1PNQA 4X9XA 1ULTA 3ZDXB 3ZE6A 3X3NA 5LMUL 3AR4A 4WDQA 3I1FA 1SMYD 3OTOQ 1DBIA 3JVUA 4GW3A 4W5RA 1PNRA 1YK0A 3PFWO 1JFFA 2KOLA 3TSAA 2JE6I 1YB5A 5IOCA 2VTDA 2FV8A 2VCEA 1YE3A 4TTPA 3VZCA 3I2YX 4KV9A 1H6BA 2FDCA 4RM2A 3VC1A 1ATIA 5ELDA 4A0QA 5IMBA 3RROA 5DEHA 1P5HA 2PKWA 3FFTA 3N0XA 4CM4A 3FKIG 4JU9A 5IZCC 4F5YA 2ZRGA 4UZEA 4Q4HA 4RFBA 1RXYA 2E37A 3TEMA 4CKXA 3HOWH 5A4KA 4F91B 4ZCTA 3WJ7A 3LGSA 4JVLA 4EBFA 4DSOA 3MJSA 2F3QA 4RZ2A 1RPTA 1SG6A 3A6HA 1WXWA 4ZP1A 1CRPA 2EBFX 4D9FA 2JA5H 2RDHA 2H2WA 4LVNA 1Z34A 4H6VA 1BFDA 4RZXA 3S1MH 2ZB8A 5HA5A 4IIBA 5IY0A 2GYYA 1Z9BA 4MR8A 5ITZB 4R69A 1GUBA 3CRVA 4H7BA 1GN9A 1K9SA 2CH4W 3W3AA 3EYAA 2IYSA 1GJXA 3FUCA 2AR7A 3KR0A 3B85A 3OMLA 4IVQA 1PEYA 1JEJA 5LJIA 2ORYA 5EIBC 3GRRA 4C22A 4ZCQA 2CEKA 2PLAA 2OGSA 2I71A 4QTUB 4X44A 3WGZA 5KOHB 1IQUA 2AUTA 2VT6A 1TCBA 3T38A 1HTTA 3JALB 4JW0A 1PUIA 2WJYA 4FO2A 5CPBA 3O31A 4X64L 1GIAA 4OX9L 2B5WA 2WAQE 3PQ6A 3MFYA 1U4OA 1UMCB 3WSVA 2OBFA 3N8NA 5JWOA 4ZT3A 4OO3A 2VYVD 3VU9B 3BXGA 3BGOS 1WPRA 1AS0A 4NH4A 3AFOA 3I0ZA 5DOVA 4IH9A 5SY4A 5K2OA 4PYMA 1SXPA 1FQWA 4F6LA 5LP1A 4K03A 1S6YA 4ZDIA 5HF9A 2FF5A 2GCEA 1VLMA 3VXKA 2XYGA 2YXPX 4UNQA 1VLZA 2QR5A 4N8DA 4ZI7B 5G02A 3RJMA 5JANA 4U68A 2VAMA 5DLPA 1MC8A 3TX2A 1UH5A 4B84A 2KJXA 1KP9A 1OTXA 2XXBA 4JS0A 4ER7A 3QLUA 1YNJC 2QMHA 3ND5A 3C6QA 3F5SA 1VG0B 2G8NA 5CX4A 4URVR 4TZTA 4B3BA 5L95A 3ELUA 4OQNA 1CS4C 4WL0A 3FLMA 5EINA 3FPSA 2UVDA 4C2TA 1Q21A 2BGKA 3LDGA 1LLQA 3KDFA 2J1LA 2AVNA 4DA9A 3R7FA 4DR6B 3X1YA 2V7EA 4UPAA 2R4UA 1C7ZA 1DC7A 2EW2A 2JHGA 4Z9BA 4FW9A 5KOJA 4CN9A 2I5MX 3RVDA 5CW2A 4G1BA 1AKQA 4R5MA 4B3ML 2RHLA 2V7VA 3QYPA 5IJ0A 3THSA 4AMYA 5JJCA 3QEBZ 2IXDA 5K3FB 3FOZA 1LTGD 1A7JA 3M0EA 1L4HA 3N5CA 4AKSA 4B3JA 1AUXA 1KVTA 5HBRA 3MS4A 4N40A 3VR5D 5CM8B 4L4UA 3CLTD 3L07A 3LOUA 1JILA 3DOCA 3TLEA 3U3ZA 4FKMA 3W9UA 4R6WA 5DW3A 1QB7A 2PGXA 2OWEA 2WABA 3CPJB 3RKSA 4O2BB 4OMDA 4PZUA 4OHRA 1A8HA 1T9GR 1Y6ZA 3JWEA 4BCBA 2QRMA 3IYLW 1W0KA 3R09A 5KRUA 3D7SA 4P4TA 4S1NA 1HV8A 4RKFA 3PI7A 4YGXB 1ZHFA 3LGXA 3S8MA 4UREA 3QLUC 2FX5A 4KC0A 1VRVA 1KI1A 3AB3A 4QD3A 1UXGA 3VR0A 1T9BA 4JUDX 2A59A 1VSVA 1EUDB 1QS0B 2Y9MB 4HIDA 5EQ0A 1OMOA 3HLKA 2GF2A 3KT0A 4NNPA 5HM6A 2ZBDA 4B46A 2OCAA 1UOQA 1ENAA 4YIJA 1JP7A 3AR2A 4IFDJ 4P38A 1F6DA 4TKOB 1RD9D 2X23A 2FGKA 2VEOA 4TKLA 5F7ZA 4WADA 5FEUA 4ME5A 1IUNA 4BMNA 2I7TA 2FJUA 3D4PA 1IXSB 1LNZA 3A3KA 4X71A 4X3TA 4QXOA 2FVXA 4RVFA 3ZY5A 4IZOA 3TREA 2F9LA 4TV8A 5HGQA 1JBKA 1E1RA 2WJ4A 3I0MA 3H5OA 4FMPA 3OQ6A 4N12A 4ND3A 3RREA 1KZ1A 5IBQA 4MQFA 2WSMA 5JAQA 4EPRA 3CMCO 4FGKA 4IDAA 4YEDA 5H02A 3VC7A 5KNCD 4E7PA 2UUAQ 3C8MA 3AKYA 3HKBB 3KVYA 1NJ6A 3GTMH 2GAAA 4BQNA 2LMCB 4EO4A 1GNTA 3TMAA 1VQJA 2DFTA 4Z2YA 1K9VF 2YV4A 121PA 2FLKA 1NJIC 3BH6A 3NPAA 5AKHA 3QOWA 2GZMA 2PCJA 4PGGA 2VUMG 4H3VA 3HKCA 4OGWA 1BCRA 4UW9A 2OXTA 3VAYA 5B30A 2TECE 4AJ4A 5KSWB 5C53B 5CLGA 1CHNA 4YK7A 3SLRA 5IF3A 4WN9B 5LQUA 3EZ7A 3MZ0A 5K6RA 4EGVA 3ZBQA 3T1HQ 5C3XA 3F8SA 1K28A 2GRAA 3HCEA 1AXRA 4WBNF 3VI3B 1NZDA 3SXPA 3FKSA 1TI7A 3ND8A 1YK1A 2WM2A 5H80A 3RANA 1DKMA 1X1EA 4GLAC 3I4MH 2I2AA 4DLYA 1QU2A 4YMHA 2DGDA 5FFMA 3H5AA 3WTCA 1XVVA 4F60A 4BFUA 3IOEA 1AKUA 2OCEA 4WJWA 1E9BA 1PGJA 2GETA 2Q6KA