4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC transporter related protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
3AVYA 2IYQA 3RRZA 2BE5D 1QHIA 1G6OA 1GVPA 1K3RA 3K0FB 4CEHA 1IAQA 4MUAA 4M1MA 5KDOA 4JZKA 4NYIR 4JI2Q 2XNDD 4HSEA 5M5YH 221PA 1VF7A 4A8JA 3AEZA 4KVAA 1T5EA 3DZ8A 4FN5A 4PANA 4JVMA 2EVBA 1GHKA 1E1RA 2ZTEA 1HV8A 2NO6A 4Q4HA 1QVGA 4NXMQ 2ERYA 1HYQA 3BK7A 1NJFA 3LBNA 1WOCA 1DAFA 2CL0X 3UG7A 3G6EA 3UDGA 4HJ8A 4A3EH 2LMCB 3UMFA 4AURA 1Z6HA 4G7ZC 2D2FA 3N70A 3B13B 1W7AA 3RRYA 4CF7A 3C15C 1X1RA 3L7ZC 1XNQL 4LF5Q 2HCBA 4OI2A 1HZCA 3B78A 3RANA 2FDCA 1FTNA 4KFTA 3UPUA 1QBKC 1MKHA 4O2DA 2JJQA 3CC2A 4S2EA 4B75A 4L5QA 1JXOA 2VTKA 1GNRA 2A6HD 3Q8DA 4BY1G 1SXJC 3IDQA 4FW9A 3DOFA 4MZ9A 3FPPA 4OI1A 1DE0A 4PO1A 2JA7G 1L2FA 3LGJA 2NZHA 1Z0JA 4KI0A 3G48A 1X6OA 2CVHA 4FMDF 4QHYA 2UXDQ 4ZO4A 3T34A 1KI3A 4ABYA 4DDWA 5J4YA 3GFTA 3TUZC 2WWYA 3M7NA 1T0JB 2ATVA 1WP9A 1IYVA 4GMXA 4A1FA 4RZUA 4TLDA 5LMUL 3CW2C 3NEJA 3R9IA 2IX0A 1COWA 2DWOA 3CCSA 2EYUA 4A82A 4OONA 4UPAA 2F6RA 4JI3L 4B74A 1W44A 2Q21A 1ESMA 4Z1MA 3RZOH 4LW1A 1YVDA 5C0XH 2YTVA 1G6HA 2XNSA 4ZI3A 1YR8A 1E2WA 2K4KA 3H0GH 1N8RC 2H5EA 3BGWA 4A3MH 4NBSA 1DPFA 4O25A 3ZVRA 1VF5C 2CK3A 3S1AA 3FKIH 1E69A 2HT6A 1G3IA 2AXPA 3DDCA 4FIDA 2K7VA 5FTKA 4EJSB 3CRRA 3PJRA 4DLRA 1Q20A 2JE6I 5JJKA 1S9HA 3CR7A 5J4HA 1OYYA 2BKUA 2YJTD 3QNUA 1ZU5A 5G53C 2Q9BA 4BEJA 3OEED 2YTYA 3KKNA 3KQNA 4HJ7A 1FNMA 4LJ9A 3PENA 1HE8B 4PZ7A 2ANCA 3UMSA 4HIMA 3IIKA 3LBIA 5C46F 5EE9A 3KJOA 4YDSA 2H17A 3E1SA 1VCIA 2JXMB 3EPHA 2J1LA 4OK3A 4AYXA 1MV5A 2P2LA 2O5VA 3MMPA 2K14A 1HNZL 3A8TA 4LZZA 1TU2B 2CJWA 4MKHA 2O8FB 3U58A 1GSIA 3CCMA 5ELXA 3LH5A 4B48A 2JLQA 4TQUS 4BY7H 1K8AC 1FVIA 1EQQA 3SBDA 1QHHA 2ZRAA 4MYTA 3ZGXA 5HCNA 3ZDQA 4HIKA 1Q3TA 2OZEA 5C4GB 2DFKB 4C0BA 5JRJA 4JBKA 2QQEA 1ZUNB 3QKSB 2E5LL 4TL9A 3OOCA 1ODFA 4RSGA 1QUQB 2AKYA 3KDFB 2FZ4A 4IFDJ 5H1SE 2ODWA 4UXJA 4JBYA 3TR0A 1XMOL 4LF6L 3L8ZA 3Q9LA 4A3LG 2Z6VA 1RFLA 4QRHA 2IYTA 4B76A 2JLXA 2XGJA 1N36Q 3P4YA 1NVUQ 3U4VA 2HYIC 1KGDA 3ULLA 2Q3HA 4I7ZC 3V00A 4DEYA 3QEJA 4BZXA 2W6IA 5K8IA 5LMUQ 4IDHA 1ZCBA 2UUBQ 3PUZA 4WOPA 2IEYA 5E7JA 5HE8A 3SR0A 4AI6A 4B3TQ 5JZVA 3GLFA 1MOZA 4PPGA 1NBME 2XITA 2RGNA 1IOZA 5DI9A 4YXWD 1HA3A 2JA1A 3EASA 1KDPA 4M1WA 2JLRA 5IE8A 3L2PA 1WCMH 2C9OA 2UZ3A 3PEUA 1XTRA 1LVGA 1XU4A 1EX6A 1J8MF 1LNZA 1PLLA 1X8LA 3PCOB 1ZKOA 1N0WA 3FFBA 3GEHA 4NCJA 1D2NA 1JR6A 3RSLA 1KOFA 2ZUDA 2PMDA 1CKNA 2JA8G 4KKSA 5BN4A 4AYBG 2E2JH 1E32A 1FP6A 1Z7TA 1KZGB 3L0IB 4KKTA 3I4NH 1B9NA 2XTNA 1OIWA 5FI0B 4JIMA 5BXQC 5IWAL 5HKKD 1G8GA 4YY3Q 3QENA 2IF2A 1SQ5A 1KY2A 3CBQA 4MKIA 1KJYA 3KJGA 2QP4A 4PQFA 4KSBA 3U3JA 5BYKA 2EXDA 1Y8PB 1US8A 5LPNA 1G5PA 2IYXA 1KK0A 1YRAA 3QF7A 4DK3C 2Q2TA 1TF5A 2ZRFA 2ZE7A 4A0RA 2OILA 3T1HL 1Q44A 1R5OA 5EQTA 2AMCB 1T5IA 5F2EA 3IRBA 4Q1AA 3L0SA 2B92A 1GD7A 3LVRE 4QM6A 2ODNA 3NDPA 2A9KA 3U61B 5JEAG 3OFND 2GBLC 1D7QA 4MGIR 4C4PA 2MSDB 3DM5A 2WTUA 3CXCA 2O8CA 2F3IA 3TQCA 4YHHQ 2CVFA 1E9EA 2W6JA 4DV3L 4E09A 2A30A 2V6IA 3BB1A 4IOMA 5CYPA 3FKSA 4ESHA 1BKBA 3JAMi 1E9FA 1E79D 1OFTA 2H1LA 2OFOA 3H84A 3NKVA 4P4SB 3AF4A 4PO9A 2BOVA 3JVUA 4KFRA 3LW7A 1XD9A 1RE0A 1ZUHA 2HIVA 2B8TA 3E0EA 4MYUA 4PSAA 4HUTA 1N33L 2ZM6L 2GF9A 4POFA 1Z0FA 3RS4A 3WMGA 4GDFA 3GLIB 2WM9B 3B1YA 3KLWA 3RWOA 5C4MA 1N5IA 1Q46A 4PHGA 4WXPA 3X1DA 1P4SA 1XFAA 4ZCMA 2VBCA 1RYFA 3TAHA 3HOZG 3K70D 1WRBA 2Z0SA 5GVSA 5TDHA 4QJ5A 4Q21A 1Q3HA 1GKUB 1BBWA 2Q8IB 2JQOA 2QE7A 2W0MA 4P32A 1OIXA 3FHWA 4DR4Q 3DVLA 3RN5A 1TPZA 1CULC 2VF8A 3NDBB 2HLDD 1VQOA 3CD6A 1IXRC 4P72A 4MKGA 4LJZC 3LXRA 3K0XA 4K0KQ 2K5HA 1SXJD 1DADA 2WV9A 4V02A 4OYHA 1A4RA 5KNBA 4MRRA 2GJ9A 3PGZA 5KYKA 3EZ9A 2NN6I 2ORIA 2PMKA 2MQHA 5JECA 1E9AA 1NLYA 5C4XG 3M4PA 1XD8A 2ZAOA 1PH3A 2J9RA 1D6JA 4JYCA 4EFMA 2WOJA 1ZMXA 3Q5DA 3ADBA 4TQAA 4L8JA 2DGYA 1KO4A 3RS5A 4LUOA 1V43A 3DM3A 2WB1E 1E9BA 1HEIA 1LTQA 4LSGA 4DT1B 3BFKA 2C5LA 3U44B 3KXLA 4DV7Q 3BJIC 4GPTA 2DCUA 4FCWA 1BMFA 1KI7A 3B82A 1AH9A 2P5TB 3KDFA 2JCSA 4JI7L 2ZI6A 2DY1A 2QENA 3AB9A 2E2HH 1T5LA 4G1UC 3ZYCA 4B2PA 2WWFA 1PLJA 5FJ8G 4DUZQ 4R4IA 1IBMQ 1G3QA 1ZU4A 4IQZA 4DR2Q 1NVVQ 1R2QA 4LUVA 1YZKA 2K32A 1K9MC 1VQMA 1E2DA 5JEEA 3CP0A 4IOAA 3RDPA 1R7RA 4DCTA 4ZDKA 1MR3F 2NVXH 1G7RA 5EZ6B 4GNXB 3UDFA 1T8TA 2KB0A 3OIVA 3HOXH 2ZANA 3OTOL 3CF2A 1YITA 3QI2A 4BXXH 4AIIA 1EG7A 1W47A 2X2FA 4I1OA 1I4TD 2ZS8A 1VHTA 4LNQA 1XP8A 1II9A 4W7SA 3V9PA 1FX0A 2PEYA 1W2BA 3M3YH 1U0LA 1HNWQ 3DEFA 2ASEA 2VSFA 3HOWH 1X1SA 1KMHA 1NVXQ 2RGEA 4YWMA 3PO3H 3I73A 3QOFA 4KBGA 1IONA 4W5HA 5IYDH 4ESVA 4TMKA 4A3CH 2GETA 1CKNB 1JAIA 4BZQA 1FUKA 3QSYA 3AF3A 2BBOA 3ZVLA 3MWYW 3LX5A 2HCJB 2C9CA 2W00A 1Z29A 1P5ZB 4IVRA 3IIMA 3PEYA 1Z2AA 4GKKQ 4DR6Q 1R4AA 4KFUA 3REGA 4UXHA 4MNOA 1G3UA 3FOZA 2VO1A 5A35A 2XTMA 4KYIB 3TRZA 3VX4A 4PX9A 3FP9A 1T6NA 1IBRA 1T3LA 1VHLA 1IJEA 3HKZE 1QZHA 1PH9A 3A4MA 1E4YA 3LX8A 1ESNA 3QY0A 4M4SA 4L5TA 4V03A 4D4KA 4AYTA 2F4VQ 4LFBL 2UXBL 3ECCA 4URYR 1X3SA 3SEAA 1A6XA 4CEIA 4H0LC 3EA5A 1HZ9A 4LJ5A 4YQFA 1K8OA 3PIRA 4NCIA 4L16A 2W58A 4QGGA 3VX3A 4JI2L 2XX3A 1KIXA 4C0JA 4OWWB 5KUTA 3K0FA 2HYDA 1XMIA 2EJMA 2ZYUX 2R92H 3MWLA 1ZP6A 2AK2A 2QU8A 4G01B 3EZFA 1KSHA 3LXXA 4DLXA 4GT1A 1R8QA 3BFVA 4KAXA 4A8JB 2F55A 1ZUIA 1FR3A 3U7HB 3AKCA 4QGHA 4ME3A 3PUVA 1Q0UA 4Q4HB 1GG2A 2KWIA 4DAMA 4IDNA 3VNUA 4TLCA 1DARA 1UKZA 4GOJA 2A7QA 3BH7A 1ZIPA 1KO7A 1MABB 1SGWA 2Q2HA 3A1TA 1JQLB 1WFQA 1M74A 2FSHA 1FOEB 4O2RA 2FSFA 2NZOA 4JBWA 1E1TA 2DWQA 4MRPA 4MGKR 4Q7LA 4GKKL 2E76C 1YZNA 2G0TA 1EIYB 2GK7A 4NYIQ 5JJIA 1TNDA 3AGQA 2O8BA 2W6JD 3K0EA 2DUDA 2F9LA 1S3OA 4LFAL 2HF9A 2IHBA 2QY9A 4CRWB 2ZTSA 1G7TA 1LYLA 3JZAA 4XD7D 2ZE6A 1X65A 3U7EB 1HH4A 2K50A 2LSSA 2RHQB 1PH8A 1YHNA 1W48A 1GRRA 2QAGA 1IBKQ 3CO5A 3GEIA 3RWMB 5J4LA 3OIYA 4GN3B 1WBBA 4MDEA 3S14H 1VQCA 2NVYH 2WVJA 5FBLB 1A5TA 1PHJA 2VH5R 2ZYVX 3S2HH 1OIVA 1A2BA 2J87A 1KDOA 2ZYTX 1OF1A 2KJQA 4JL6A 2JAQA 1R8SA 3A4LA 1Q1QA 1J5EL 4IHQA 4PZ6A 3LLMA 4UQOA 2QI9C 2AHOB 4A2WA 2ES2A 3U44A 1VCNA 2KBNA 2CLCX 3B1XA 4V0NA 5DISB 2WAQE 3WRYC 3ICEA 3K9HA 4F4IA 4RFSA 1LB1B 4Z54A 3AVWA 1E9SA 1E9CA 1PFSA 5GAEC 1G8HA 4DWJA 3TREA 3N2EA 4DUGD 2QMOA 4BA2I 3QXJA 2JEAI 4MQBA 3CB4A 4HDQB 5AJ3L 5GADl 3SGIA 3KUCA 3QF4A 4A3IG 3TK1A 2ZUBA 1XTDA 2EYQA 2IX1A 3BOSA 3R9XA 3HOVH 4G3XA 1JE5A 4QQBX 2RGDA 2ZJYA 1E6CA 1N6LA 3IEUA 2D7CA 3H4MA 4HZUA 4A2QA 1NBMD 3W90A 3N6RA 2UUCL 3X1XA 3A8JE 2AWNA 2ZJAA 4NXML 5BN5A 2WB1G 1WJJA 3E9HA 2AR7A 2ZROA 4B35A 2A69D 5IT9c 4H13C 4DSNA 2QM7A 5C44H 2QGNA 2BWJA 2DFNA 3MXUA 1MJCA 2CEAA 4LUCA 4OHVA 2FEMA 3OTOQ 5HZKA 1LTLA 2O5IC 1UBCA 1YQTA 3TQYA 2FFHA 2OBLA 2QUZA 4X8OA 1B70B 1VQJA 3P20A 1KK3A 3RC8A 1PJRA 1W0JD 3J7ZC 2QG6A 3A6PC 2B8GA 5K36G 1IHUA 5GQOA 1XRJA 2EQBA 4JI5L 1BYUA 2GA8A 3HR7A 4R9UC 2X77A 2QEXA 1SFOH 1S1MA 3KKMA 5J4VA 1XNRL 4QNRA 3O8RA 3STBC 1JB1A 1JJ2A 1TUIA 3ADCA 5B64A 4WJ4A 3CMEA 3PUXA 4BLOA 4JI8Q 2NZ8A 1Z9FA 2RGCA 3BBPA 4DV5L 2C77A 4X65L 4PZLA 4YLGA 1GNQA 3OIWA 1LS6A 3L43A 1KTVA 4B43A 1HTPA 2WKQA 3HP1A 3FMPB 2GJKA 2JASA 2JJ1A 2ONJA 3GTQH 4OHZA 4KLNA 3EWAA 1CR2A 2F43B 1E2KA 1HR0W 1G18A 4EAQA 3K0SA 4HAWA 4OQNA 5KDLA 5DN6A 2WMNB 3RABA 1D2EA 4Q1BA 5C1BA 4ZKEA 3S24A 1EOVA 3RLFA 2ZJ5A 3A5ZB 1QHNA 5JEDA 3NHBA 5IP7H 1A8VA 2V6JA 3ZS8A 4GS3A 4WW0A 4QBFA 4AH6A 4QHSA 4JI6Q 3NH9A 2VYFA 1UBGA 4WZAE 3QXXA 3H15A 4BLPA 2R93G 4TT3A 4OO1G 3SI7A 1AJEA 5SZKB 2YOGA 2IX3A 3KFVA 2Z6KC 2X2EA 2ZI5A 5DLQC 5KO2A 5C3EG 3TE6A 4B3BA 4DK0A 4OJQA 3ZZ0A 3VFDA 5JBQA 1UDWA 2BJVA 3AGPA 3P4XA 3T1YQ 1IN7A 1YU9A 2A68D 3AF2A 1VYTA 2XXAB 4Q1FA 5G40A 1NI3A 5KDDA 3KQLA 5TARA 4QM7A 1YNJC 5TVKA 3U4QB 4A4IA 3TKLA 3I8XA 5EAYA 1HQCA 6Q21A 3AVVA 1WF3A 1ZC4A 3NBXX 3ICQB 3I4MG 1VIYA 4Z8XA 3HKSA 4DLTA 1P9NA 3M9BA 5J5CA 1VQBA 1IY2A 4A3KH 1KDTA 2GXQA 4JLOA 4D0NA 1UAAA 1LY1A 1M34E 3B5JA 1SVOA 3WBKA 1G5TA 5L3QA 3THYA 2ZQ5A 1L1OA 3T61A 2WFWA 3MD0A 3GLGE 4S35A 1WBDA 5CLQA 2IS1A 4OBEA 3ND9A 2ID0A 1XMQL 1GUGA 2BEKA 4D0GA 3LRPA 1T3HA 5C18A 4I4LA 3EAQA 3K53A 3N5CA 1AE2A 3LFUA 3PF4A 1DG1G 4C0AC 4PQYA 3I7FA 3CZPA 4LX0A 1BO6A 5CITA 3VR2A 4LFCL 2WJYA 1D2MA 2BC9A 2WAXA 3AYHB 3HPRA 2G77B 1RVDA 3FWYA 1R10A 1XD2B 4Y0VA 4DSTA 2R6FA 2F52A 2A8VA 2QQ0A 1KYIA 2K5NA 4MDFA 1VKJA 1ZBDA 2QBYA 2VS1A 1X8KA 2E87A 3A1UA 4LF7L 4A3GG 1VS0A 3THWA 3LNCA 4OXPA 2ZTCA 1JAHA 4DV2Q 2VL7A 4Q01A 3VMFA 1M7GA 2NO0A 5JFGA 1OFHA 3KYHC 3WP0A 3MG9A 2ASBA 1Z6GA 2JIZD 2ORVA 1ETUA 1DAGA 3FHCB 4URZR 1C7YA 3I4NG 1DAEA 2WSSA 1G4UR 4OQLA 4E03A 3ZVMA 1EESA 1Z06A 4ZV4A 1E2LA 1HT1E 3WYGA 5FOWA 3VA7A 5M3MG 3U6BA 3GJ0A 4DUYL 1JPJA 3CRW1 1ANKA 3HJNA 1L7VC 1OHHD 4D4MA 3THXA 1W4BA 2OTJA 1E3PA 4BPBA 3ULJA 1CTMA 3H3VH 1OXTA 3BAFA 3SOPA 4JS0A 4TLBA 3CPFA 1KK1A 5AJWA 3H0GG 4LOAA 3SFVA 4RKEA 4DBLC 2FGKA 3I62A 1BDOA 3LNNA 4X64Q 2EVWX 1E2EA 4GBMA 4YXWA 1G17A 2XJ4A 2ZJQA 3QPVA 1KI6A 2UKDA 3B7GA 4M9SA 4B3SQ 1CFMA 2N3SA 3H3VI 2IS4A 1N33Q 3HPQA 4XJXA 3REFA 1M1YE 4YWKA 1S1CA 3MRSA 3TW4A 1CSQA 1Y1WG 1UDXA 1XMSA 1HNXQ 1UE1A 2IEZA 1FTSA 4IVQA 4K46A 4I1UA 1W2HA 5GJCA 5TY0A 1EFHA 2D74A 4HI0E 2YC4C 4LFCQ 4RKFA 5JRZA 5C0XG 4A4DA 1OJLA 2BDTA 4P4TA 2Z4SA 4ACBA 3I4OA 3NC0C 1I3QH 1Q22A 3GLGA 4PZ8A 2VRWA 3IKJA 1TF2A 5FL3A 1CJTC 1YZTA 1GAJA 1XDBA 3DZDA 1YVCA 1R0WA 4P31A 1NL3A 3RYTC 3VKGA 4UNPA 2IHFA 1NMXA 4KV9A 4LBWA 2JK8A 5IYBG 2HDNB 1SN8A 2QM8A 4MKFA 3CCVA 1ASYA 3RRMA 1UPTA 4MTNA 2O52A 4LJ7A 2AUJD 2KE5A 3S1QH 5JHGB 2PEZA 2XTIA 3K9GA 1SVSA 4LWCA 4BECA 1U8ZA 4DEXA 3EPKA 2PCFB 3KOJA 3I1FA 1Z08A 2UVQA 3QVVA 2N49A 4V0LA 4FDBA 3C14C 4AWXA 2FA9A 1RKBA 4LJ4A 4DV2L 4HAYA 4I81A 1HT2E 4IEEA 3HKZG 3T56B 1MH1A 4FCVA 1AS0A 4JK1C 3BFXA 1XZQA 2H7VA 1CR1A 2J45A 5JWHA 2R7DA 3UDIA 5KNCA 1X56A 4BBSG 3CCJA 4KHPQ 1XF9A 1YR6A 2C8VA 2IW3A 2GK6A 4BLTA 3IEVA 3M6AA 1TQ6A 4TTPA 4HUQA 2MSCB 1XCMA 1R9TH 2J0UB 4NPHA 3CWZA 1H95A 4O3MA 3A8KE 4GNKA 4P75A 1FL9A 4HB4A 1GM5A 1ELOA 1E0KA 5BQ5A 2UXCQ 1TWAH 3K0CA 3CONA 1TL7C 1WCV1 1Q7YC 1DTSA 2H8KA 5GAGC 3FHOA 2AD5A 5H68A 4FD2A 2CWPA 3PV0A 2RF4A 2E1RA 5KHOC 4W5JA 3IO5A 4BFZA 3HYRA 4PSVA 4NCNA 5FPSA 2QP3A 1D8LA 4BRWA 2KBFA 3J81k 4HB0A 3ZD6A 5BN3A 3T1YL 4F38A 5BR8L 1EYGA 4AQYQ 2JGNA 3D6TB 4Q4JA 4A93H 3GFPA 4QGAA 4DR1L 2O8DA 4IOLA 5HPYB 3FMCA 1WI5A 2R7FA 1DOAA 1FZQA 1GL6A 1IM2A 3P27A 4HDCA 2G88A 2ZI9A 5K36H 1TQ2A 2BBTA 2OESA 3QBTA 4Q5IA 4JI6L 2WJJA 4DV0Q 2FG5A 5FPTA 4MYHA 3TMKA 5JCPA 1G1MA 1Q90A 2J46A 4LPSA 4FMCF 4B2IA 2OHFA 2KCTA 1FQKA 3AP2A 3EC1A 3J81c 1FGUA 1XPUA 1DO0A 3A1SA 4IPDA 1UKYA 4X8MA 1HUQA 3ZQJA 2Z0MA 4A3DH 1NBMA 5JS8A 1WB9A 1YNXA 2QEQA 5CLLA 4B34A 1LFDB 4YMTA 4JI5Q 1OYWA 4KVGA 3PIPA 2B63H 3AV0B 3RNLA 5DI3B 3THWB 3T1HQ 1UEIA 1PYBA 5FTMA 4JMPA 4C0KA 1NSTA 4WA7A 5FOUA 3W8RA 2MMGA 3KTAB 1Y63A 4RD0A 1G51A 3GLIA 3TSWA 2QF7A 1GP2A 1N3BA 1PH7A 2CNWA 5B30A 3P1JA 4GI7A 1CJMA 4DV5Q 3BH6A 5EP1A 1S72A 2BH8A 4N1AA 4LCBA 2ZVQX 4GSYA 1L2TA 3THXB 3NBZC 5IY0A 1U8AA 3TRFA 1RJ9A 1FL0A 1VIAA 2QA5A 3VR1A 3A58B 1U5KA 5C2JB 2DPXA 3CPJB 3PCRB 5HY6A 2NGRA 4NTZA 3FMIA 1XEXB 2ZRJA 1AQYA 4Q19A 1JR3E 3U6KA 2W2TA 3UMRA 5KSYA 2CWAA 1NF3A 3UWKA 1NN1A 4Q4AB 1TUEA 4D81A 4JI8L 4HAZA 1KSJA 4BFUA 1UWVA 2JLYA 5AJ3Q 4J0QA 2Y8EA 1G21E 1SXJB 3E70C 4KBFA 2JATA 1N36L 1P2SA 2IYYA 2YHSA 4U00A 4OX9Q 4KHZA 1M7HA 3B8HA 4G7OC 3LQRA 4HLUA 4JLNA 4C0LA 1OKKA 1DVRA 4B3SL 2VSXA 4C3IH 4IVPA 1GUSA 5CM8B 3U60B 1XTKA 1O3YA 4OO1I 4BASA 2IS6A 1W5SA 3BD9A 2GVDC 5L3RA 2CKZB 2REXB 3B85A 4OK6A 4A2PA 2YKGA 4XWAA 4ITRC 1D9ZA 1G8YA 4K0KL 3BWDD 2CHVA 3X2SA 2FV8A 1ZW6A 2D2CC 3J81i 1J5EQ 4GKJQ 3W34A 1YJ5A 4A0GA 4WBSA 4W5WA 3SZRA 4JI7Q 2A5GA 2GRJA 3QPWA 1G8PA 4UJ5A 3X1ZA 4P4UA 3C16C 4QBIA 4AD8A 2KBEA 4NE2A 4C7OB 2HXSA 3NHAA 2VP0A 2RAPA 2A68C 4A3MG 5DYGA 2I1VB 3RN2A 3BZCA 1H9JA 3BERA 1I5FA 3AVQA 1TWCH 2EW1A 2FGJA 3VR4A 3I2ZA 4XVUA 2ZJBA 4KKUA 4BRUA 3W3ZB 4TYNA 1X54A 1OV4A 4OHYA 5C4XH 3VHLB 1KAGA 2OXRA 4EPYA 1UE7A 2RGAA 3NEYA 1SXJE 2DWPA 2GJ8A 3IHLA 3SC3A 2LKCA 4OJKA 2IS2A 3TLXA 3UATA 2CL7X 1CEEA 1KI2A 2V55B 4M9XA 5DSZA 5FR2A 4LC1A 1ZD1A 2VLIA 2ZJOA 3TH5A 4GOPA 4BFSA 3BH0A 2HV8A 1XJQA 1DD2A 5LMNL 4IFEA 4A0HA 1XTQA 3BDOA 2GAOA 1GUOA 4LHWA 1CLUA 2R6DA 1IBLL 4FI3C 4HLDA 1SKYE 1RPZA 3SFZA 1NNEA 1DO2A 3RLOA 1O78A 1ZD9A 5EE0A 2OQKA 4E5UA 3PEWA 1QVCA 2CCZA 4LF7Q 5GJBA 4JLJA 1KO1A 2MSEB 3MWKA 1YKSA 5IK2A 2V7QA 4BQSA 2KENA 3EPJA 3SYLA 2QPOA 2RGNC 1CR4A 2WSSD 2XOKD 4P71A 1Y69U 2VHTA 4XIGS 3IPYA 4A3CG 2VHJA 3WHKA 4IKEA 2P67A 3BC1A 2YTXA 4PC7A 3J81j 4PC2A 2GEVA 3PO3G 5AWFC 4P0TA 1SVKA 2QTHA 3CCEA 3Q7PA 4AKIA 1K0RA 2F4VL 4LFBQ 1EFRD 2WKRA 3KZ1E 4PHHA 2VHUA 1YEZA 4HB3A 5L3SA 4EX5A 5M3MH 2QZ4A 3THOA 4UKDA 2KCCA 1CJVC 1Y1WH 2RHDA 1WDTA 2XGTA 3EIQA 3IBYA 4AK9A 3B60A 4V0MA 1EK0A 4U5XA 3CCQA 3KQUA 3T1QA 1R0YA 2ZS7A 4LUZA 4YONB 2FSGA 1GFIA 2BVNA 1IN6A 4RD2A 5EZ5A 1PH5A 4NH0A 1K6MA 3CX7A 1TX4B 3WMFA 1N6NA 1E22A 3T06B 4A3FG 1H65A 3GCGA 5DI3A 2AWOA 4H02A 4DR1Q 1W1WA 4DCVA 2OQ0A 2ZRPA 2V1CC 1UKVY 2WKPA 3B9QA 5HTKA 5ANRB 1SULA 4DUGA 4N0DA 3O8BA 2CQOA 2HQLA 1CRPA 3LV8A 2XB2A 2QAJA 3K8AA 4N3NA 1XJ0A 3KLRA 4TLAA 2UUBL 4G0NA 4A3BH 1RC8A 2C04A 2NTYC 3I32A 4JVSB 1CF4A 2P3SA 3AUXA 2NO1A 4GLVB 1KKMA 4LF8L 4C3ZA 2IK8A 2IYUA 4RG1A 1H9SB 1T3SA 3EC2A 3U3OA 2R6AA 5TMPA 4EDHA 1N25A 3CF6R 4GN4B 5CB8A 1CP2A 3Q3JB 1F2TB 1UKEA 5IK2D 5HZHA 1O7LA 4ZI2A 3GQBA 4K81B 1AIPA 1YHBA 3LDAA 4JBXA 4PQRA 3AKDA 2HLDA 3QKRA 3QG1A 4XD7A 3TJZA 4TZ6A 1OW3B 2WJHA 4QHTA 4WAUA 2R92G 2A78A 3DKVA 2JA8H 1JJVA 1R5NA 1FMLA 2PMZE 1XMJA 2CCJA 3VR5A 3D7MA 5TV2A 1I6HH 3TSZA 2ZSAA 4BFWA 2QBYB 3AVXA 1RW4A 4A3JG 5E7MA 4D2IA 4DSOA 4C0QC 1JBKA 3F5FA 2FH5B 4AKGA 1XX6A 4GL2A 1VQIA 1KI1A 4HEJA 1TAGA 3SBEA 2QP9X 4HAXA 3NBYC 1K5DA 2GEDA 4II7A 2IXFA 4B6FA 3TZUA 2ZI3A 4LPKA 1GKHA 4JC0A 4JI3Q 3LBHA 1FFHA 2IYWA 1NG9A 4CEHB 2KA7A 4JG2A 2JLVA 3AF0A 5FLXc 5AJZA 4CW7A 5EE3A 2IXEA 2ZSBA 3GJ3A 2JEBI 5JEAJ 1N32L 4DLSA 4X64L 5EE5B 4LF4Q 3CRQA 2J0SA 3GTLH 5EXSA 1Q86C 5AUQA 1CI3M 2IT1A 1VTKA 3MWJA 1OXXK 4LJYA 3UDXA 4A3FH 4GFDA 2CK3D 4Q9JA 4IFDG 1QRAA 4ZIRB 4F91B 3S1MH 1J7KA 1VPLA 1Z0DA 2CL6X 5CB6A 1VG8A 2I3BA 1E2IA 4HJ5A 1F5NA 3HYTA 4HAUA 4Y7NH 1QF9A 1Z0AA 3TVTA 3W9YA 1DGSA 4A3KG 4KJZA 4MITA 2NN6G 4JV5Q 1JR3D 1XEFA 2YWEA 3EW9A 1IXZA 2AK3A 4RZXA 4TMWA 1XNRQ 2FMXA 2G3YA 4LC0A 3VU9B 3FHTA 2FFAA 1YZGA 1RIFA 4BFVA 2ERXA 3EXAA 1BIFA 3NH6A 1Z83A 4JI0Q 1E2JA 1V5WA 2NZJA 4HJ9A 1ZM7A 4JYAL 5FI1B 4B44A 4B2LA 5JI2E 4PMWA 4IXMA 5FUXA 1Y1VH 4DLZA 2NQ2C 4QC2A 2R8RA 4DV4L 1VYUA 5A4JA 3STBD 5JJLA 4FMBB 4BLQA 2J5XA 1Q8KA 5KSOA 1TU4A 1VQGA 1O87A 4M1OA 1XMOQ 4PC1A 4GKJL 2P6RA 1EUJA 4BA1I 2IA5A 2PX3A 1NVVR 4Q4LA 4LF5L 1N6PA 1ASZA 2A3RA 4Q9IA 4DHEA 1A82A 3SDZA 4YCUA 2EJFC 1JQJC 1UFQA 2ZRGA 3QXHA 2H5XA 4ZDWA 2BV3A 4LI0A 2WJIA 3GJ7A 4LFAQ 5FTJA 1NLZA 1NLFA 4UNQA 1NKTA 4TMTA 3ZJYC 1KD1C 1PZNA 2IWRA 3GTMH 3EIVA 2IWHA 1N0UA 1NJGA 3L82B 4RD6A 4YDHB 1GOTA 3S15H 4YMUA 3EARA 4DR3L 1W3SA 1ZRHA 4L5BA 1A0IA 4IFDI 2EFEB 5M5XH 1E1QA 4AY2A 4BEBA 4JSYA 5FJ8H 1IL2A 1MO4A 421PA 2J0UA 3L2OB 1UEBA 1N5JA 2VQEL 3SYNA 3PSIA 2JDID 5SZJA 4R1JA 1IYUA 3UXMA 1U90A 1N6OA 2D3WA 2PI2E 3S1AB 2ZRHA 2EQSA 2Z5FA 3E2IA 5EXXA 3SQXA 2C35B 2I0QA 1G41A 5IP9H 3CUEF 4EJSA 2ODBA 3LWNA 4RJLA 3RHFA 2ZI4A 2FFQA 1BVSA 1J70A 2DR3A 2OCYC 4LY6A 4Q1EA 4TT3D 4JT2A 1XJVA 2A2ZA 4GMDA 3L0OA 1QHHB 1YNNC 4RMFA 1SVMA 1UADA 2H92A 2P65A 5FH9A 3TS0A 3VHXA 5IP7G 4LBVA 3KKQA 2P0EA 2GVAA 2J7PD 2ZJ2A 2I5MX 2QMUA 4PR0A 4RZ3A 4Q4JB 4ZPXA 5ELNA 2EIFA 4NHOA 4NCHA 4OO1H 1QUQA 2B7CA 4DKAC 4DDVA 1II8B 3GP8A 1AZSC 3PXGA 3LVQE 4OX9L 4DIDA 4ILEA 4NYJQ 2BBSA 3AQQA 2PI2A 1F2TA 5GVRA 1XCGB 1PUIA 1PMRA 1GO3E 2Y0SG 3WRXC 5M3FG 5TXGA 4BWYA 5F9FA 1JALA 3JVVA 3K0AA 2AN9A 3LY5A 4C9BA 2O8EB 2FPKA 4PC6A 2CXXA 4DV1Q 3K09A 3T15A 3AF1A 1PH4A 2Q0HA 4IJLA 3X1YA 2GNOA 3DMNA 3G0HA 3LQQA 4Q7JB 4Z51A 4US2R 2E5LQ 1N5KA 3WNBA 2YWHA 4JOIC 2YV5A 4JYAQ 1VQPA 1U98A 1E1RD 2WWGA 2ZE8A 4MUBA 4JI4L 4ASUA 1J2JA 2D0PA 4JBJA 1K5GA 1HNWL 4Z1MD 2OXCA 4Q00A 3GMTA 2DB3A 3LD9A 4D4LA 1W0JA 1H8HA 3T5GA 4CVNA 1FPMA 1Q57A 2W6ID 4DR3Q 3CRLC 3QUSA 5J3BA 1BKDR 3UK6A 4UP8A 4URXR 5HR5A 3ZLJA 3CRMA 2OV2A 5CK4A 1KNXA 4TL7A 5FBRB 2HHHL 2DYKA 2FWRA 2RB4A 2Q3FA 5GJWC 4IO9A 1NMGA 2V7QD 3A1VA 2EDGA 2FSIA 2GJAA 3MLEA 1GUNA 1VQAA 4B3TL 2XOKA 4YCVA 1OH8A 1VCMA 2F9MA 2QGQA 3MJHA 3Q7QA 4BGDA 1D9XA 5CM9C 4Q4AA 2XEXA 2B29A 2KCMA 4YWLA 1LV7A 1QG2A 1S4QA 1F2UA 1K8RA 1N32Q 1US8B 2DNCA 4CIDA 2XZOA 1VQ4A 2IYRA 3DL0A 5F9HA 2F3TA 1GL9B 4G5OA 2HT1A 1SLJA 1GDDA 4I1VA 2ZXUA 3CW2A 1GUTA 3RNUA 4ARZB 3U2QA 3NE5B 4C2UA 4QNMA 5F98A 4AIMA 5F3WB 4QGFA 2VQFQ 1E2QA 1W49A 1C1YA 4DNRB 1NN3A 5H70A 521PA 4EQ6A 4DK6C 3EIHA 5IRCD 2EFDB 2D5DA 2HIXA 1KKLA 3PEVA 5L8VA 3W6PA 2FPLA 4IFBA 5CJPA 2K33A 4B6EA 5JSZB 2IY5B 2XNDA 3WP1B 2UUAQ 4MH0R 1EFRA 1TU3A 1YE8A 4F4CA 3CWQA 4TTRA 2E2IH 3ND8A 1A1VA 1ZNYA 3H2YA 3AKYA 2OWOA 4KFSA 2UUCQ 3SN6A 3U50C 1FJGL 3I4LA 4A3DG 2IBMA 2KSQA 3QG5A 1TWHH 1DG3A 2QMHA 3AUYA 4GRAA 3CMAA 3NBHB 3OEEA 3SJAA 3OPOA 4UNNA 2WJVA 2C95A 2YOHA 3W1GA 2YOFA 2HJGA 3KXKA 2R6CA 4H9GA 1F60A 2O8CB 4D26A 1Z6YA 4X62Q 2ZPTX 5E7IA 5JI3E 5K8LA 2RH5A 4DB4A 2I5LX 3CKLA 3OAAD 2GKSA 5B57C 1JB7A 4YC7A 2OFXA 1KHTA 1QZGA 4KHPL 1HQYE 2QTFA 3P32A 1JEDA 2F1IA 2JA6H 5HGQA 1EWRA 4UNSA 4M53A 1KMQA 4WVFA 4BFXA 3HOXG 1JMCA 1I94L 4DK1A 2OE2A 1P8LA 3EN2A 2GAAA 1U0HC 4R4TA 1KL9A 5DN6D 5GADC 2L5TA 3ULPA 1UJ2A 1Z22A 4DRZA 3C8UA 4F93B 3OE7D 1B7YB 4C2TA 3PO2G 5FFMA 4R4CA 5CJ2A 2GILA 4KMUC 4DV3Q 2F3RA 4M1SA 4Z8YA 1XCPA 3SNHA 5FOVA 1KAWA 3S1RH 1YRBA 1U9IC 2A19A 1I2MA 1NY6A 2V4DA 2BJWA 1AA9A 2K5VA 1BOFA 4NU0A 3I55A 4JBMA 2XSZD 3HOYG 1G9XA 4AG6A 2J0QA 3KKOA 3GD7A 4ALPA 2IUUA 4A6PA 1AGPA 4TVAB 4QXAA 5UKDA 5FPYA 1FUUA 3EWSA 3CF5A 2AD1A 1EFUA 1BH2A 3AKEA 4PXAA 4NP6A 1KRTA 1SVIA 3S16H 3CRKC 3CQZH 3F1ZA 4FWTA 4IDQA 1L0WA 2MMCA 1NE3A 4FWIB 4JLKA 1HZAA 2R7ZH 1G16A 4DV0L 3HWSA 4BLRA 3KL4A 5EP3A 4TYWA 1K83H 4R4QA 1Q1EA 2IYSA 3T5DA 2AKWB 2R62A 1SE8A 3O47A 3F8TA 1E2HA 1W46A 1AM4D 4DV6L 3K0AB 3TQFA 4FINA 1KXLA 1WXQA 1B23P 3OZXA 2OCAA 3WXMA 2ZR7A 1NIJA 5BR8Q 1R0ZA 2O5JC 1SMXA 1KHIA 3BB4A 3O8DA 4B71A 3U3RA 3GJ5A 4RCYA 4XTRA 4LBYA 4IDPA 4O2LA 4UY8C 2P6NA 4AYBE 1IZ6A 3CNOA 3DO6A 3K9LA 3T53B 2VA8A 4L9SA 4BZPA 5AJXA 4A8JC 1B0UA 2ZJZA 4CT5A 5LB4A 3OAAA 1YI2A 4NB3A 1KQSA 4HJAA 2D62A 2Z83A 5J4KA 1E2VA 3WWVA 3G5UA 3HOUG 1CR0A 1RRFA 2VHQA 4QGUA 4PHTA 1XZPA 3U3MA 2ZEJA 4MGYR 3J7A5 4TSFA 4GN5A 1OFUX 3ADKA 4EPTA 2J41A 4IEIA 1Q12A 2ATWA 3C7KA 2NVQH 2IHEA 2ZU0C 3I92A 4ACAA 2CJWB 3SU8A 4PPNA 4A15A 4QJ4A 2ZT9C 4CGZA 4QY7A 2FX3A 1FMJA 1RZ3A 1M6NA 4Q47A 3RS2A 2VY3A 2ZM5A 2CMKA 3IIJA 3HOZH 1JXMA 4HYYA 1Q1ZA 2F1MA 3QKRB 3QVUA 3CCRA 1F2UB 4BLSA 2EFGA 2QSZA 1MO5A 3EA0A 3WYFA 2R9VA 2C03A 1UBFA 4GZLA 4YMSA 2RHSB 2A6ED 1LABA 5LMNW 2A5FA 2JA5G 2V8OA 2WWXA 1F3OA 2ZI7A 3AH8A 4EKDA 3HU3A 1E79A 1ZM3A 4R4OA 3UWOA 3KF6A 4DZZA 4OHXA 1W4AA 1ZNXA 3OEHD 4NDZA 1S3SA 1RYHA 3U9SA 1UBEA 3TR5A 3I61A 2DN8A 2XTZA 1CIPA 4OWTB 2OEPA 1E0AA 3UIEA 5J40A 1QHXA 1H8EA 1HTWA 3TIFA 3ZZUA 1FP7A 2JJ2A 2C99A 3MGCA 2WIAA 4OL0A 4B3ML 5JSZA 3AVTA 4EPWA 4X66L 1ZAKA 4DR5Q 4LK2A 1WYDA 5DLQE 2C2HA 2CCKA 5IT5A 2PQAB 5KU1A 1N6KA 1UM8A 4F92B 1HNZQ 3AFPA 4QOSA 1I6VC 3W6OA 3FFAA 4PV1C 1E2FA 1KSFX 2I1QA 1HURA 4AG5A 4F4JA 1OKKD 3K09C 4ZCLA 1ONLA 3A0JA 1FJGQ 2R2AA 4EUNA 4GP6A 2ZVPX 4JI1Q 1GVNB 2WMOB 1DAIA 1CU1A 2LXJA 2GVZC 2REOA 4TLEA 4D6PA 4DVGA 1RRGA 3A8IE 4PFSA 4V0ME 5GROA 1JR3A 5DE3A 2P6UA 4M21A 1RIPA 1W5TA 4HR7B 2QTVB 2RGBA 4AYWA 5E7NA 3IQXA 4TL8A 4GOKA 2ZTDA 3CF0A 3D4RA 1TADA 3VU9A 4PTLA 3SS8A 3QIAA 1GIAA 3UKDA 1KNQA 1ZM2A 3ADDA 3N2IA 2Y0SE 3PIOA 2IUSA 1ONBA 4LYHA 2JEOA 621PA 2PBRA 1EFTA 2VIIA 5BYJA 1VQ9A 1MT0A 2VUMG 5JLJA 2QAGB 4L15A 5D3QA 2WSMA 1I2DA 1ZJ6A 4MA4A 4LHZA 2ZIAA 4A3LH 3FB4A 1AK2A 3FTQA 4MYCA 4Q02A 3SJZA 3ZH9B 1BMFD 3T51B 2C96A 3K7UC 1YZUA 2J0VA 3KFXA 4HDOB 2WPDA 5JMTA 3ZD7A 1DAKA 1E1QD 1YJ9A 2VP2A 3FMFA 4ZDJA 3JZMA 1ZVQA 2N78A 1BS1A 2LCFA 1Y8OB 1E4VA 1XWIA 3IO3A 2PL3A 3GLHA 3JC66 4DLUA 1CKEA 2G6BA 5GJVC 2ONKA 3A7LA 2QRNA 4AC9A 4DKXA 2G1KA 1HQMC 1Z07A 2OBMA 2GVBA 3CC4A 2F7SA 2OG2A 4X65Q 3DLLA 1TQDA 4LJ6A 5G3YA 4RFSB 2H16A 3RZDH 1CXZA 4DR4L 2ZRLA 2FJUA 5GAHC 1UF9A 2V54A 2H18A 1E24A 4WJ3M 3KJHA 1QJOA 1H8ED 2OT3B 4P4SA 5H1YA 3BORA 5KPJA 4L5RC 3FGNA 3GO5A 1P2UA 1E2GA 3OE7A 1XB2A 1C9OA 3QKUA 5DIFA 4DV7L 4UJ3A 4YY3L 4B33A 5LD2B 4LDJA 4A0FA 3EQLC 4CZ2A 3TW8B 3BIFA 4I99A 1HZBA 1IJFA 1OLOA 1W2GA 2CHQA 1VQEA 1ZNWA 2AX4A 2ZRKA 4P33A 1P2TA 4HATA 1NIPA 4TZ0A 3IGFA 3SHFA 4B3GA 1E0JA 2UZIR 3CZQA 5IYBH 3T1OA 2VPPA 4G5QA 2V1UA 2VQFL 3FYHA 1VQ6A 1U99A 1G7CA 2BM0A 3CNLA 3VQTA 3I8SA 1VQ5A 2GJSA 3TEHB 2F1RA 1W0KD 1G64A 2ZRMA 2AXNA 4HZUB 2PCJA 4LYAA 5IF9A 1PVOA 1W36C 2A69C 3C4JA 4BUJA 3W3AA 2VUMH 4OQFA 4PAMA 2NIPA 4Q03A 1SKYB 1EWIA 2ZJ8A 5H8WA 1ZD8A 1H9KA 3GLIE 1SHKA 1AKYA 4OQXA 3R8FA 1CTQA 1KO8A 3RR5A 2OUKA 1LF0A 3K81C 4DT1A 2BH2A 2LKDA 3EZ2A 4EFNA 3DPUA 1DS6A 5EUQB 5E3HA 4GNXA 3LW8A 4MRVA 4ZCIA 1K8GA 3UANA 3BE4A 4BFYA 3EZ6A 3K1JA 3S2DH 3KF6B 3QQ5A 1A62A 5DNYB 4QJFA 3J80i 5KSZA 1NMYA 3MAAC 1Z8FA 4HB2A 1QHSA 4LV6A 3B1ZA 4RD4A 4ASUD 3C5HA 4R98A 1IW7D 1V1QA 5EXPA 2QSYA 3ZJYA 2WJGA 1PH2A 2ZRNA 3VTKA 4BE7B 3KQHA 2FFBA 4DUYQ 3KJEA 3NEMA 2YU9H 2L0XA 4A3IH 1IBLQ 4R71A 1ZYUA 2CBZA 2ZRDA 3IQWA 4Q1DA 4OHWA 2GESA 3GJXC 3LA6A 4XOIA 1GKIA 4LRWA 3Q85A 1EFWA 1QVFA 2GCNA 2JDIA 5K8TA 5LD2C 4QL3A 1XTJA 4BY7G 1TQ4A 1TWGH 3Q5EA 4IPCA 3GFOA 1VQ7A 4O0AA 1AQUA 2IF0A 1OTCA 3L0PA 3KB1A 4XVQA 4OI0A 4RZ2A 4KLZA 4DCUA 1NG1A 2WICA 3PFIA 3ZIAD 1EFCA 4L8GA 4LWZA 4TYPA 4EPRA 5EP2A 4PZYA 1IW7C 2GZAA 4EPXA 4X6AH 4IOJA 3W5JA 5C44G 2Z43A 4A3JH 4KYUA 4JVNA 1XXHE 2X8AA 3AP1A 3A36A 4M2LA 1WA5A 4B32A 2PNRC 2BMJA 1IY1A 2J7PA 4BFTA 2QORA 2C78A 4DNIA 1YR7A 3DOEA 3RC3A 2B7BA 4OQMA 1EGAA 4Q48A 5FR1A 5AUPB 5LMNQ 4QBHA 1SKQA 1VQDA 1LUZA 2LXKA 1G3RA 4EQ6B 1L4YA 4M1YA 4PC3A 1A2KC 5DYIA 3SJBA 2SHKA 1SVWA 1CKMA 1OHHA 2UU9Q 1C4OA 1U2RA 3PF5A 2BCGY 2G0NA 3FDIA 4G5GA 4IPGA 3THYB 2XXAA 1UE6A 1R5BA 2VSOA 1HNXL 1W36B 1NVWQ 1IN8A 3A37A 2PJZA 4I1SA 1N34L 2CCGA 5FUVA 1NSFA 4CEIB 3ERSX 3AVOA 2YNMA 5DH9A 1GZSA 3I56A 1XXHA 4J15A 4JSTA 4LYFA 5KTYA 4IOCA 3U5ZB 4JLVA 3PUWA 4Q66C 1MO6A 5FUWA 4BXXG 1MABA 2A5JA 4TSFD 2BMDA 2ECKA 1VDZA 5EE1A 1KRSA 5L3QB 3H0KA 1S96A 1NTGA 2DHRA 5B2ZA 1PV4A 2VW9A 2D2EA 2HJVA 3MSXA 3MFYA 2BMEA 3BRWD 3HOWG 2RGGA 2NN6H 1YJNA 1HCZA 1O7IA 3ZVNA 4D80A 1VG9B 4QKQA 1IBKL 3UG6A 4B3RQ 4PPFA 4LF8Q 4LV8B 1XMQQ 2LWIA 3W5IA 3KX2A 1Q21A 5EJEA 1YBYA 3CPWA 2QNRA 3WHLA 2AFHE 5FOXA 1IY0A 4LBZA 4OI4A 1P72A 4L5SA 1YZLA 2QGZA 2V1XA 3ZIAA 2JLUA 1N9WA 4NL4H 4CDGA 1CKOA 2G1JA 2O8BB 1MKYA 2IHYA 2Z6KA 2K75A 2ZSFA 4NCKA 3GPLA 2B8FA 3A1WA 2YZ2A 1WQ1R 2D4HA 4EIWA 5KSPA 2PZEA 4RFVA 2ZUCA 1N2CE 1OXVA 5P21A 4NYMQ 3OIUA 4B3MQ 1QG4A 4KXFB 3QXSA 2N1BA 2Q2IA 3QF4B 3GLFE 3HGBA 2CLDX 2K5UA 3CM0A 2FOLA 3FE2A 1A7JA 3AEVA 4DR7Q 2ZSDA 5IYCH 2AHOA 3OW7A 2OFWA 3NXSA 4DCSA 2X19A 5KOYA 3HR8A 3MUFA 1NRJB 3EIEA 1KC8C 2VQEQ 1E99A 1QVRA 3GTKH 3HFZB 1X86B 2QN6A 4C30A 3CCUA 3RVBA 4IRUB 2ZETA 2CW0C 2XZLA 2K52A 3H1TA 4FXPA 4B3CA 4E22A 2GXAA 2GBLA 3MXNB 1I4DD 3K0CC 4PPQA 1BBUA 4D4JA 4NPSA 1S8FA 2ANBA 2WWIA 5J47A 2E8GA 5IDVA 1C0AA 2UXDL 4RCNA 5HE9A 4LHYA 2OTLA 4LF6Q 2OO7A 3AFQA 4M1TA 2OLJA 3X1WA 3OEHA 1N6IA 2IC5A 1OB5A 1N34Q 2JLWA 5DGXA 1ZINA 1XPOA 2FU5C 4DB2A 1S0UA 2EU8A 5K8UA 3B6YA 1EWQA 3B2EA 5CK5A 1T8UA 3IPXA 1E3MA 2DNEA 2ZJPA 5FL7D 3PO2H 2JIZA 2QRZA 1HH2P 1VECA 2NPIA 1SMYC 3HU1A 4JLDA 2G9NA 1HPCA 3WBJA 4JVLA 3FKIG 3M4QA 1E9RA 3I5XA 1CUKA 4KU4A 1RRCA 1I94Q 4C3JH 1P3JA 3FKSD 5CIWA 1Z63A 1KK2A 3EG5A 4QIWE 2VL6A 4DIEA 2ZRIA 1COWD 2RCNA 1GTVA 1X6VA 3V4FA 1VQFA 4EPVA 4KITB 1U8YA 2BA1A 1DBSA 1G5RA 3K70C 2JA9A 1Z2CA 3G82C 4RCZA 1XEWX 3D8BA 4AKHA 3M4OH 1E9DA 2YWGA 3KUDA 4DSUA 2GDJA 4DR6L 4M9ZA 1SVLA 3C41J 1A63A 1Y14B 2B6HA 4TQ9A 3OW2A 4Q9LA 1TEVA 5BWMA 2HEIA 4CEJB 3GTGH 2JJ2D 4HUQB 4LV5B 3I3SR 1EQRA 3GDEA 1YIJA 3GEEA 1RL2A 1OH6A 4NMMA 1U94A 1NY4A 3QEOA 1Z6XA 4ERNA 2QE7D 2FXQA 1VQ8A 4H44C 1Z47A 2PQAA 1XPRA 3PVSA 1JPNA 2ZR9A 3F2BA 2B8WA 3U7GA 2FPMA 3ASYA 1KIMA 1JT8A 5L3VA 4Q9KA 3F2CA 1E7ZA 1Z5ZA 3U4QA 4M22A 1AS3A 4GNXC 4U02A 2F43A 3TGPA 1I50H 2P5SA 1MRNA 1B8AA 1VQNA 1G4AE 1J8YF 4HLCA 4X62L 3BS4A 2VF7A 3SYKA 4PAQA 3MCAA 3TSOA 4NXNQ 1XJCA 2N42A 2OAQ1 1E0SA 1LS1A 1X9NA 3CNNA 2ALYB 4FMDB 3QKTA 4M0LA 5AUOB 1X3EA 4G5RA 2NMVA 1ZCAA 3HOUH 821PA 1HY3A 2ZREA 4FMCB 2RKOA 4U7DA 5IYDG 2IYZA 5C0XI 1W4CA 5M5WH 3BB3A 2WOOA 4F7WA 4IW3B 1IQPA 5JCZA 1Z6AA 5LDDC 1QVAA 1R6BX 2A5YB 2FE4A 2O0HA 3RS3A 1ZYRC 4GLAC 4DV1L 1W0KA 2EFCB 2GHIA 4LJ8A 1WCMG 2O8FA 1VQHA 1JEEA 1N0VC 2XJ9A 4UNRA 2WAQG 1N6HA 3RRNA 4YMVA 1L1OB 2GTPA 1JJ7A 1MO3A 3BZKA 3B1VA 5LB2A 1KZ7B 1PUJA 3VKWA 1GILA 3W6NA 4TYYA 4RD3A 3SQWA 1OT3A 2VEDA 1G19A 2JA5H 3GLHB 1FQJA 2V4ZA 3KTAA 1TEXA 1X8JA 1Q1BA 4OKSA 4R7ZA 3WMEA 4Q18A 5FOTA 3RSOA 2GXSA 2CFMA 2DBYA 4OGQC 5E4FA 3K70B 3PR1A 3ASZA 1KI8A 5DO9A 1OE0A 2IL1A 4DLWA 1SXJA 1SHZA 3SE0A 3FVQA 4JI4Q 1PH6A 4JLPA 2ZYWX 3A5UA 1Y3AA 1N5LA 4E07A 1C9KA 3U4ZA 1YZ6A 4TMZA 3IFTA 1RRPA 4TMXA 1NN5A 2ATXA 2G83A 4NYMR 2PLRA 3M1IA 3BXZA 2RHMA 2W2VA 2YWFA 1QHYA 3NWJA 1EXMA 1GNPA 3HU2A 5AJVB 2NG1A 3PG5A 1ZM9A 2V9PA 1MJEA 3CRVA 5ELOA 1F48A 1XBTA 3H86A 4JKIA 4MRNA 4QBGB 4WXRA 4XSHA 2ZSEA 4C0SA 2TMKA 3IUYA 2PZFA 4GOPC 1XD2A 3AVPA 3GJ8A 3R7WB 1QHGA 4TYQA 3U3KA 4NYJR 3DKPA 4JJZA 2YYZA 1OH5A 1Y8NB 1IYJB 3RLNA 1J6QA 4EQ5A 1I4LD 2OLKA 2JA6G 2QL6A 2REBA 2H57A 2ZE5A 2ZJRA 5JEAH 2WP8J 1VYVA 5AUNB 1L4UA 4K8OA 2QAGC 3TS2A 1F6BA 3L8YA 3QE0A 1DELA 2Q9AA 3GLHE 2EWVA 5FUYA 4DV6Q 3WNDA 3E9IA 1Z0IA 1KI6B 1NY5A 3F3YA 4GZYC 1EX7A 3HOYH 4L9WA 4KSCA 4R2IA 4GLXA 5HCIA 5A5GA 3OHMA 1HR0Q 4Q7MB 2R7ZG 1UEJA 2VP4A 1H9MA 4FCTA 1XMVA 3S17H 5LBIA 4A3BG 1BYIA 2XZPA 4CT4B 2EFHB 4US0R 2WWHA 2A6EC 3E5HA 5JHHB 2ZR0A 4HIDA 5IWAQ 2WHXA 4C7OA 1NKSA 4W9MC 1YZQA 1GRQA 2GXUA 2FF7A 3GLGB 5BW8A 2PCLA 3IHWA 1P16A 1MRSA 2BIFA 1NBWA 1SROA 1X55A 4DV4Q 1HE1C 2CE2X 3QBVA 4LHVA 5CDFA 1PH1A 1M1KC 1P9WA 2MNAA 4LK1C 2PT5A 1L1OC 3NC1C 4A6XA 1TMKA 1ZC3A 4KN7C 4QL5A 1SR3A 121PA 1B9MA 4UP7A 1U0JA 1G291 1H9RA 1P62B 2F1HA 3KXIA 1LW7A 2WAYA 1E96A 2VHCA 5C4JH 3CPHA 3NBFA 3H94A 2N8NA 4EJSC 1FYCA 2MO0A 4DPGA 2B63G 4QFMA 2ZAMA 1CSPA 4JOIA 2R6GA 1CRQA 5JWRA 3FKQA 4DLYA 1Z0KA 1E98A 3R9WA 1OB2A 2A1AA 1Q81C 4OK5A 5IHPA 1TKWB 4KO8A 3I72A 1FNNA 4X8HA 4EFLA 1S3GA 1E1OA 2Q6TA 3BJUA 5CDFE 2A5DA 3VR6A 5AK0A 2ZRBA 3CIOA 4DLVA 2VQSA 1K73C 2PZGA 2CNWD 1T9HA 2Q2UA 5FLMH 2A6HC 4JT4A 4WZBE 3P26A 3PQCA 4QJ3A 1T4GA 3HDTA 3B6EA 4A3GH 4NZYA 5EUMA 4P73A 2OSBA 3KF8B 4A75A 1P2VA 2C9YA 2QT1A 3T12A 1J90A 2PT7A 4XWKA 4PG3A 4D25A 2GCOB 5FTNA 5G41A 4NXNL 2QT0A 1YHAA 3NG1A 4A36A 3Q8XB 4HIOA 4DDTA 1YHQA 2GCPA 2KHIA 4G7HC 1YR9A 2BCJQ 721PA 4MGZR 3A4NA 1XNJA 3F2DA 3BU2A 1LM0A 2R65A 2HF8A 1U81A 5IYCG 2J59A 1LF5A 1JNYA 3ZS9A 1NMFA 1GKYA 1H9SA 2XB4A 2OAP1 3C5CA 4IFDH 3S1NH 4IJMA 4M9QA 4Q7KA 4XSGA 3NVAA 1XXHB 2BHRA 2EWWA 2F1JA 3MJRA 2V3CC 3VNVA 1G3MA 1PLKA 4JKYA 1DEKA 2BE5C 3D3QA 4O0MA 2Q3MA 5AJYA 2DFTA 4AQYL 3TBKA 2CLSA 1II0A 3KKPA 5FOSA 2BDOA 1S9DA 1P61B 1EWHA 3EZ7A 2FN4A 3QKSA 5G3ZA 3GTPH 2R44A 3KDSE 1OSNA 4BY1H 3CH4B 2PLFA 5FTLA 2O8DB 2WPDD 4BBRG 2YVUA 1QZXA 4KCGA 2Q9CA 2JLZA 1L8QA 4JI0L 2E9SA 2NOAA 1V9PA 4URUR 1KAOA 1E2ZA 1K8MA 5DHAA 2JJ8A 2RGXA 5C3EH 4A92A 1Q82C 4TN1A 1JI0A 4JLBA 2XSZA 1TXYA 3TAUA 2ZS9A 2VP5A 2ZRCA 1IXSB 3B9PA 3K8YA 2OBNA 3O8CA 3PUYA 4LF9Q 3U7FB 3LO5A 3MEFA 4A3EG 5E95A 3WYAA 5JWOA 3I5YA 2OCEA 4MRSA 3VDYA 4B73A 4LF4L 2J3EA 4ZIRA 4ZKDA 2NO7A 4NKRA 3A7AB 1X3FA 5TB5A 4B47A 1LACA 1SRUA 3K80C 1Z3IX 3GTJH 4DNTB 3D0FA 1XEWY 2FNAA 4JYBA 1GJXA 4KN4C 4PHFA 1HJPA 5D3MB 4XH9B 4XTCS 1GWNA 2UUAL 3G4SA 4BBSH 3LLUA 1Z28A 1IXRA 4XVRA 4ZDIA 4M8NE 1UE5A 4V0KA 1RJ9B 3T1TA 5SZHB 2JA7H 2ZM6Q 2B21A 1E2PA 4RVCA 4US1R 2IUTA 3M4YA 3WNCA 2C98A 2AFIE 4Q1CA 3CX6A 4DR5L 1OXSC 1XEXA 4BBRH 3K9NA 3NTUA 4JLAA 5AR1A 5SZIA 2GN5A 2D0OA 1OXUA 3A74A 4P74A 4A76A 2NPFA 4TTQA 2BKEA 4OWXB 2MO1A 1GHJA 2J7KA 4R2HA 1XNQQ 2GWHA 4B3XA 1KO5A 2YC2C 4QG7A 2HUPA 3M0EA 5CYOA 2EJGC 3UE1A 1AKEA 2QROA 1M90C 4H1UA 3W8NA 2I5HA 4URWR 1E94E 3TNFA 1P73A 1VMAA 2AKAB 1DXMA 1VQKA 1WMSA 2IXGA 4IDOA 5FBQB 2QA4A 4NONA 4DXAA 2ZU6A 2OCBA 3ER0A 3KJPA 1YJWA 3VAAA 3B1WA 3UE0A 3CLVA 3ZZTA 3OYYA 2IYLD 2QMEA 2HHHQ 3DM9B 3CCLA 1D5CA 3CH5A 4PO8A 3IILA 3QJYA 1DCZA 5M3FH 4JLMA 1WE2A 2AL7A 3EX7C 3NENA 4H1VA 1OFIA 3R20A 3V4RA 1S40A 5FL7A 5FPHA 4DC9A 3CX8A 4JL5A 2CDNA 4WZ6A 4TL6A 2Z4RA 1KSGA 1AZTA 4GOPB 1DAMA 2VNUD 3HOVG 4P3YA 2KHJA 4C0HA 1D8TA 1PYSB 2D06A 1XTIA 4HZIA 4PAOA 1CBUA 5C0XJ 2BEJA 4URVR 3LWUA 4DDUA 3DMDA 3NELA 2WWWA 4L4UA 3KQKA 4CYMA 1OPXA 2VZAA 2BM1A 2RMKA 1DAHA 3F0TA 1KDRA 4LGMA 2X1VA 1IN5A 1AGRA 2GCOA 8OHMA 5HKKA 1CS4C 1P6XA 4LHXA 2PX0A 1H8HD 2ORWA 2OCPA 3CR8A 4CEJA 2JLSA 2OM2A 3ETLA 2GZHA 1NMZA 2I4IA 2CE7A 5M04A 5EP4A 1KJZA 4KODA 3GJ6A 3EPLA 3GTOH 3M85A 2PNHA 4Y0AA 3Q72A 4D0LB 1P9RA 1G7SA 2NVTH 2IYVA 3CPEA 1V8QA 1TF7A 1T91A 1Y1VG 1JJCB 4HLUC 1G6PA 4X66Q 2GZDA 2W2XA 3QPUA 4V0OA 1E2NA 2GEUA 3T1VA 5KPDA 3AM1A 2AUKA 2YINC 3FPAA 3IBGA 3VKHA 3OFNA 1G8FA 1M7BA 1P75A 2O0KA 2QPAA 4YCWA 3DHWC 2QPTA 4M1KA 2PH1A 5FPKA 1P7CA 4X8LA 3AVUA 2XAUA 2BBWA 3KB2A 4Y52H 2WBLC 4JI1L 1NN0A 1VG0B 1VCOA 2DFLA 1HR0L 3ONWA 2VP9A 4PZZA 3W5OA 1N6RA 2NO9A 2B3GA 2FEOA 4DJTA 1TWFH 1JJGA 1KJWA 1FW6A 4GOXA 1II8A 1AN0A 1S2MA 3PITA 3CC7A 5L3SB 1P60A 1GL7A 4JJKA 2N46A 4XWOA 3RS7A 2L15A 4IOKA 1W36D 1M8PA 1M2OB 1NP6A 1KI4A 3KJIA 4B3FX 3LAWA 4PSKA 3AQ4A 2CHGA 2PPBC 5KNDA 3AP3A 3QXCA 3SJCA 4WIAA 1MIUA 4RD1A 4TKOB 4IPHA 4DR2L 1VG1A 3WY9A 4YHHL 2D7DA 2UU9L 2O8EA 3ZQ6A 1KY3A 4B3DA 1SZPA 4LJAA 3SHWA 3TUIC 2W0SA 3KFUA 2WIBA 5DHFA 3RAPR 4UP9A 4A9AA 1CJKC 3FMOB 1W4RA 5FBVB 4C3HH 1GRNA 1GUAA 4LF9L 4YMWA 1QDEA 4B3RL 1Z6TA 2E74C 5FBWB 2PJRA 1VQLA 4ON9A 2MFIA 1FX0B 1IN4A 3W1BA 1XTSA 4N0EA 1AE3A 4IJHA 1T0HB 3TVDA 3T35A 5JS7A 5D3MA 1KMHB 3K7AH 4JCVE 5B58C 2FZLA 4DCNA 4C2MH 1NJIC 1J99A 4JL8A 4DAYB 4TMVA 5CIQA 5A0FA 4AKEA 4ARZA 2R93H 3AB3A 1CJUC 3TUJC 2BMFA 2JJ1D 4HLQB 2KI5A 4Q9HA 1G20E 3BG3A 4A93G 1EIFA 1PA6A 1GITA 1ZM4A 3WDNA 3EBEA 4D82A 1U9IA 4GZMA 4RY2A 1E2MA 2WZQA 3CAMA 2UXCL 1ZIOA 4LYJA 3GJ4A 4JV5L 4GP7A 1AS2A 1R0XA 3R8CA 3D31A 4IXNA 2E75C 1KI9A 4HAVA 3OF5A 3R7WA 3OESA 3J80c 2O0JA 2W83A 2ODEA 4G5SA 3I4MH 3NIBA 2BA0A 4POGA 2VP6A 3GLFB 5FLMG 3DXJC 4POAA 4UXIA 1OH7A 1TTTA 1JECA 4DUZL 4APVA 1IBML 2ZITA 3RS0A 4TWZA 1ZNZA 4KLKA 2GF0A 2HXYA 1X3GA 4DR7L 3VR3A 2UXBQ 3G71A 3JAMc 5EXTA 5IP9G
chains in the Genus database with same CATH superfamily
1OXBB 3K6JA 2WB1B 1KAMA 3HJUA 5ALGA 2G80A 1YBMA 3IDAA 5FX2A 4RTRA 1QHIA 4C2BA 3KJXA 4ZFNA 2VPXA 1Q1NA 5CX1B 1BD4A 3ILXA 2ON6A 1Z7BA 2G40A 3IQGX 4N49A 4P5PA 5F3DA 4CEHA 4WN3A 3ITPA 4JZKA 1XDGA 2AQ2B 3SXUA 4HDMA 2HBYA 1UNSA 4HSEA 3PIO3 1PW5A 1UC8A 2AE2A 2H85A 1TJNA 2MSLA 2V7BA 5M5YH 2NNLD 1VF7A 4RKYA 2GRAA 3DBRB 5ALIA 4B6OA 1T5EA 3B3JA 2NN3C 4JVMA 3NHKA 1O6ZA 1DJOA 1HV8A 4Q4HA 1QVGA 1HYQA 1NJFA 4OP1A 2CVPA 1ULAA 3GZJA 5BSEA 1WOCA 4FPXA 4MVWA 3FX2A 2CL0X 1P1RA 4ZZ2A 1HFJA 4RLSA 4BNTA 3BT7A 2VNIA 2N9UA 3NGXA 3N70A 3TNJA 5BXYA 4CNQA 4JPBW 2C4TA 3AG6A 3SHOA 2KUMA 3ITNA 2Y0CA 2HCBA 2X5OA 1U4PA 1BAPA 1HZCA 2MINB 3B78A 3IAS6 4Y1EA 4A0SA 3OZGA 2G1PA 1ZL0A 4YJ3F 2WJAA 3CC2A 4K5XA 4O2DA 1BD3A 1I7PA 2DJGC 4L5QA 1DEAA 1IB0A 1U3TA 3KTFA 1GNRA 1SBHA 4MPDA 1SXJC 2NVWA 4B40A 1KL7A 4JIGA 2P2YA 2TSSA 4EHNA 5LWHA 1DE0A 4H7EA 1NOIA 2R8OA 3HKCA 1L2FA 3LGJA 4L85A 3G48A 1X6OA 4AG3A 4FYXA 3URMA 2UXDQ 3YASA 3V8RA 4ABYA 4C04A 4JN6B 3V8NA 3GFTA 4DDWA 4U2BA 3U1VA 1VMPA 2WACA 4GMXA 1KKUA 4XIFA 3MXGA 4K26A 4A1FA 4CMKA 1FNDA 5H3CA 3GW8A 1XNQB 4ODGA 5DT2A 3CCSA 4A82A 1PNVA 3T7CA 4OONA 1YC2A 3O1HB 4L7VA 5E4WC 2F6RA 4YUYA 1SB9A 3FPFA 1XC7A 3S9WA 5C4HA 3KO8A 1WTOA 1W44A 3DCJA 4UBNA 3PX7A 4DU9A 1ESMA 1H2BA 4MVCA 4R31A 5ALOA 1RF2D 1U9YA 3ZE0B 4JB8A 1Z2OX 2YVLA 4CTOA 4E1VA 1YR8A 3BGWA 1AC5A 2RH8A 1PVVA 4G4SP 3G59A 4IG9A 4NQZA 1DPFA 4O25A 5SYNA 1VF5C 1M72A 1T13A 3S1AA 4V1CA 1RJFA 5B55A 3QMWA 2HT6A 2JH3A 2OGSA 2Q0XA 2AXPA 1LEHA 2P2SA 3DDCA 4PXSA 2UUBB 4Q0FA 1PEAA 5JJKA 1H6BA 2QRHA 3S8YA 1FFWA 1LTKA 1OYYA 2RHHA 3LDGA 1EY7A 4RWZA 3ABOB 2VRNA 3QNUA 2G28A 2WT4A 3ZTWA 1I3NA 3ZEAA 1P81A 3LL4A 3KQNA 1FNMA 1MUUA 3OQ6A 4E32A 1HE8B 3LZ6A 2ANCA 3Q7EA 2XYHA 3FMGA 1P2DA 4ZI7A 5C46F 5EE9A 1GN9A 2NSJA 3KJOA 4QECA 1X9IA 4FXGC 3AIKA 2KYRA 5E6SA 3NSWA 4X20B 4MULA 1RHRA 2I62A 2OHJA 1J1ZA 3A8TA 4RS3A 4TXNA 1FDUA 3CVOA 4ZP1A 5A9RA 5AHRA 5ELXA 2YXPX 1HRKA 4I4CA 2A73B 1PGQA 4LF6B 5AYVA 4RY9A 3D6WA 1Z26A 2QUBA 1K8AC 3OP1A 4WZAB 3Q8KA 1FVIA 1QHHA 1K5PA 2ZRAA 3DAGA 5IUKC 2RK3A 3PRYA 2VDJA 16PKA 2DFKB 2N0SA 4JBKA 4XYOA 1ZL2A 1ZUNB 3QKSB 1XQWA 4OYLA 4WY5A 4EYSA 3OOCA 1GUWA 1JA9A 3OSZA 4CETA 4HAEA 4MPPA 4RGVA 5H1SE 2ODWA 3MA0A 4MR8A 3B5IA 5TS2A 3O2SB 4LF6L 2GYVA 3Q9LA 4QRHA 4X63A 2IYTA 1OJ7A 1U7WA 4NECA 4P8RA 3D0QA 3TLAA 1E66A 1G9TA 2R7NA 4NPCA 1J4AA 2HXGA 4DEYA 2VRCA 3QEJA 1EY6A 3JQ8A 2HV9A 4MA5A 2UUBQ 3GGOA 3PHCA 1GARA 5E7JA 3QOXA 4CMGA 5IGEA 3SR0A 2WV7A 2H9IA 1ZI8A 1CJSA 2QB5A 4WL0A 5JZVA 3ZX5A 1ONOA 3GLFA 3TSYA 2O54A 5I8PA 2GZ1A 3RIMA 4YXWD 4JASB 2BRUA 2I8AA 1VBNA 4NK5A 2CH4A 3EASA 2C84A 2R6JA 1N1MA 1HSZA 1NVAA 3KPYA 5D1NA 3EG9B 1UMBA 3NOXA 1WULS 3DE2X 1XU4A 1J8MF 1X8LA 3PCOB 3R40A 3QBEA 1N0WA 3FFBA 4NCJA 1QR2A 1D2NA 1J49A 3C87A 4I4TA 4UVIA 5FLYA 4XASA 1KOFA 3RSLA 2PMDA 1CKNA 2JA8G 2IXTA 2Y1GA 4AYBG 1L7MA 2HWWA 4YIJA 4DLUA 4UU7A 3V1YA 4KKTA 1G6Q1 1ZVJA 1YRHA 2R85A 2XCUA 3KOUA 1OIWA 3P5BA 4HN2A 3KQPA 4C03A 1DGQA 4YY3Q 3CE6A 4GDMA 1M6VB 5JH7B 3CBQA 4YRJA 1DX4A 1KJYA 2HDLA 3JD1A 3IPCA 3SX0A 5JAUA 1Q7EA 2P4UA 2RGUA 3G0OA 4NNJA 1WKBA 5BYKA 1SCKA 3H0CA 5LPNA 4JC5A 3ETCA 3RUPA 4I19A 2Q5CA 4C7XA 1RDPD 3AL2A 2VUIB 2YZGA 4A0RA 5LLDA 4MDHA 1I7SB 3B51X 1E8NA 4YV7A 4MEBA 3GN1A 1Q44A 2AMCB 2WM2A 1RAAA 3D7SA 5F2EA 4DMCA 1MENA 2HHHB 4P7KA 2JD2A 1MC5A 2ODNA 3I28A 1N2XA 4FYMA 4WXHA 5C9ZA 5DYWA 3X0DA 5JEAG 1VJ5A 2PBZA 4UC0A 5C4IA 1GPBA 2MSDB 3DM5A 3EODA 1M5RA 2O8CA 4OBWA 3TQCA 4O2BA 3M6VA 1D3AA 3KLOA 1NYRA 1I4RA 2J5BA 4KQIA 1EVJA 1J23A 1ICEA 2LTAA 3UAVA 4E09A 4OJNA 1I33A 4P82A 3PPWA 4AZ0B 4RPHA 3JAMi 1E9FA 1OFTA 2OFOA 4XGIA 3AF4A 4Y9SA 5FCDA 3JVUA 3LW7A 1XD9A 4QT0A 3PXDA 1L5LA 1RE0A 4E5SA 4MMXB 1VKHA 3MMSA 1AMUA 1R9MA 3E0EA 3BS1A 4MYUA 4PSAA 5AIBA 1E7YA 4L8WB 4AWAA 2ZM6L 1WSDA 4POFA 1P7WA 1Z0FA 2D7JA 1UBJS 3CJQA 4PLPA 1K06A 2WM9B 3IULA 3RS4A 3KLWA 3RWOA 5C4MA 1DXHA 2YV3A 4H0NA 3X1DA 3PUIA 1EG2A 1LSUA 3KETA 3OLYA 2I6QA 3COVA 5L3SB 1EIZA 1RYFA 3HOZG 4Y7NB 1RP1A 5GVSA 3OU2A 5TDHA 2G67A 3FA2A 4QJ5A 3UHPA 1BBWA 2QE7A 2JQOA 3PO3B 4DR4Q 4MS3B 4RANA 2ACVA 2VF8A 4MVJD 4R41A 4CL8A 1NP3A 1RJGA 4S24A 1ID8A 1LPPA 1VQOA 3RFUA 1PFKA 2XUIA 3QU2A 1ZXXA 1B43A 5JVDF 3K0XA 2CSUA 4DJ5X 1AO0A 2K5HA 1JG1A 1SXJD 4V02A 4G97A 1A4RA 1WQ4A 4CLDA 2ALJA 3PGZA 1ZO8A 3EZ9A 2FZCA 1ZA2A 3HN6A 3PK0A 3Q12A 1H0RA 4PFJA 2X0FA 5HP4A 3HCFA 2JIMA 2QLTA 1VGVA 1CRZA 1FTWA 1E9AA 2HIMA 3BKXA 5B6JA 4CM8B 3M4PA 2GOYA 1IATA 3N2NA 1LBHA 5JAZA 4NCBA 1UMDA 2ZAOA 2EDAA 2HK6A 4QQ8A 4LISA 1VZ3A 3E3LA 3FCXA 3WL6A 1ZMXA 2HK9A 1DIRA 5L9AA 5BUCA 4L8JA 2DGYA 1OCEA 2Y76A 3MHPA 3DM3A 4DV3B 4N76A 2C2OA 1WPQA 4QIWB 3C7DB 5AT1A 1U4MA 1TRKA 4G9BA 3B82A 3DF9A 3H18A 1AH9A 3K71B 2EE1A 2XYQA 1Q3KA 5EHXA 4CV2A 1JG3A 2DY1A 3AB9A 2HO4A 3F2IA 4MW7A 4O5AA 2CNLA 5F2KA 4KKVA 2AG5A 4B46A 4QE3A 2WWFA 5AW5A 1M3SA 1RZRD 3HY3A 4RH3A 4O2AB 3UAOA 4L8FA 2DQYA 1W85B 4GKAA 5EYPA 3T3IA 1MAHA 4EI7A 3FKIB 2QDKA 2DCMA 5COAA 2Q29A 3H0GB 1E2DA 4NATA 3L8CA 4G85A 4HEA6 4OM8A 2NUAB 3SHQA 4XSVA 4RH6A 3LGAA 1PD0A 3FLMA 4R8VA 1MR3F 3RDPA 4AN4A 2VYVA 1G7RA 4A5SA 3WYEA 2ZANA 3OTOL 2FMFA 3RUFA 2PZJA 3GRVA 1DV2A 2OK8A 1W47A 5E4XA 5AM2A 4KPYA 2R6ZA 3PGVA 1R74A 1ZMRA 1A2TA 2P62A 2ZS8A 4LNQA 1XP8A 2NYAA 3E81A 3NHZA 4W7SA 1B7GO 4DSZA 3UBTA 3BXGA 3M3YH 1HNWQ 2XWJI 4WORA 2VSFA 3QU4A 1N9GA 3EISA 2RGEA 2XQVA 1QIKA 2H1VA 2NSYA 2AR0A 1D5WA 4H3KB 3B20A 1M66A 4XOUA 5DBEX 2PYDA 5B3JC 3ITKA 1DJLA 1TAHA 2G1UA 2XMPA 4OA5A 4TMKA 2NYUA 4AW9A 6LDHA 1ACLA 2VUTA 3NTVA 4BZQA 2QJWA 4FTWA 3QSYA 4UMVA 1VRCA 3TRDA 3MWYW 3LX5A 1YUNA 2JNWA 2C9CA 2OGTA 4OPMA 1GZUA 1TJ3A 4XEHA 5EZYB 3AF6A 4IVRA 1KP3A 2JA8B 4DR6Q 3V3KA 1IQ0A 4W6ZA 3FOZA 1ICWA 5A35A 1U8UA 4LFAB 3SR1A 1OZGA 3KE9A 3F7TA 3N5KA 1M73E 1T6NA 1J42A 1IBRA 1K8XB 1LC3A 3TDKA 4AUMA 5AVVA 5C1IA 4OQ4A 3PL5A 3A4MA 1PR3A 2J5RA 3ZHVA 4ZYYA 2X7HA 4AYTA 3IXMA 3V42A 1X3SA 5LZ4A 4CEIA 4PPYA 1N32B 1HZ9A 3OKAA 3R74A 1XAGA 2PX6A 4G0QA 1YU6A 2P27A 3FTPA 4BP9A 2Q28A 4NCIA 3TQSA 4DFAA 2EPBA 4JGGA 4UARA 4L16A 5JPIA 2Z95A 1TS5A 2B61A 3VX3A 5KC9A 3G0CA 4WEOA 1KIXA 1TAQA 2HYDA 1ULZA 4JP2A 4UM9B 1X13A 1XMIA 4JODA 2EJMA 3AYZB 4FNFA 1IJBA 3MWLA 3SC6A 2QU8A 4F9GA 1R3UA 1VHDA 3AZQA 1KSHA 5COQA 3LXXA 2YWBA 4TXMA 4GT1A 5L53A 5C8DA 1VE1A 3EUEA 4K86A 4Q3OA 2WIGA 4X7PA 3U7HB 2B2NA 3AKCA 1O6BA 4A3JB 2J85A 2AMJA 3FPKA 2WU3A 4PCUA 4ETIA 1UKZA 1MC1A 5SICE 5ARCA 2A7QA 4LYGA 4QUDA 1D6NA 4TUYF 1ZIPA 4MMYB 1MABB 4V2IA 1RWKA 4HMPA 3FCSB 5CBEE 1JQLB 1BHO1 1M74A 3MEQA 3U37A 3DVAB 2G6TA 3U4QA 4HR7A 4Q7LA 3CEMA 3ML1A 4MRPA 5K3FB 1F06A 1AF4A 2E76C 4XRGA 1XUOA 2GK7A 5JJIA 3P0HA 2W6JD 3ZI0A 2DUDA 2F9LA 1S3OA 3LO8A 2JFUA 3NATA 4GQIA 4WLEA 3RSQA 4CRWB 3GLUA 2LBPA 5KWJA 4F2GA 1HH4A 1KAEA 1PH8A 1BWPA 1EB9A 2H3EA 3PDIA 4UUNA 3GEIA 5FHRA 1XYVA 3RWMB 1IBKQ 3CO5A 2JGDA 1CHDA 2AJ8A 4E1AA 2RHRA 2W4MA 3W6ZA 4WOJA 1WUIS 2E48A 3EUWA 4MDEA 3R2TA 1V9LA 3EQ2A 3GNLA 4LNUB 1A5TA 1SCNE 2VH5R 2GNPA 3A3OA 4I8IA 2WTNA 1ZUD1 1A2BA 2TSYB 1P7VA 1NU6A 1T15A 1ZOLA 1J5EL 2GEBA 3DONA 4IHQA 2B1IA 4ARVA 4JI8B 3MVVA 2AHOB 3A54A 1ISSA 2QI9C 2W98A 3HJCA 2I71A 3OD1A 1TTPB 4M0PA 5K3AA 2DFPA 4A2WA 2QW7A 1FJXA 1AH2A 1VMEA 3U9LA 3WB2A 2KBNA 1FP4A 3K73O 3I39X 4J4BA 1EUDA 3WRYC 2VTDA 5KTSA 3VVLA 4EA7A 3QPBA 4PCAA 1E9SA 4QNNA 1E9CA 5GAEC 2EQ5A 4QGSA 4YUWA 2QMOA 4DMLA 4BA2I 3OWHA 2JEAI 3DTTA 2IYEA 4F21A 1BQQT 3TK1A 1CW2B 2YNMC 2ZUBA 3KB8A 3L18A 3R0IA 4ZUJA 2C8LA 2O1EA 1GQ2A 3BAZA 3R9XA 1N33B 2CUKA 1TIID 4G3XA 2RGDA 3LNTA 4MQEA 4KD4A 2FLWA 5CBAE 2Z3VA 1QMGA 1A9ZA 4L72A 3N8KA 1ZK4A 3Q3GE 2ZBVA 3VPSA 4ZV7A 2HPAA 2ID4A 1GXSA 1KGSA 2ZYGA 1NBMD 5IC5A 3THSA 2UUCL 4CUZA 4N18A 4CDMA 2C3UA 4NXML 1V3QE 4Z53A 2DPYA 1GGHA 4B35A 2FMIA 3JWIA 3L93A 5IT9c 4NP5A 1AY0A 4H13C 3IUNA 2I80A 1DC4A 1E5QA 2FZGA 1ODCA 1P9LA 2JRCA 4N6GA 3RYHB 3S1RB 4RPCA 3VSDA 2XLCA 3DYIA 1I4WA 2CEAA 1T9ZA 4KMOA 4OHVA 3UXHA 4BNLA 2O5IC 3KOXA 2QIOA 2OBLA 3CIFA 2FFHA 1IG3A 2QUZA 4G8CA 4IUDS 1B70B 4YGXB 1VQJA 1FDWA 3TPFA 1JQAA 3P20A 3VR6H 3J81A 1ZJWA 2C5HA 4KN6A 5M3FB 1IQRA 3J7ZC 4M7WA 2IOFA 1IHUA 3ZDRA 2GQ0A 5KSWB 1Q84A 4R9UC 1BYUA 3FTEA 1GTZA 2X77A 4BZZA 3LI2A 1XVUA 3JYNA 3KKMA 3MZ0A 1XNRL 2JHFA 1F7UA 1BDHA 3IE1A 1JB1A 4DWWA 1VJRA 4J0FA 1V1PB 3CMEA 4XRRA 4D42A 3QNMA 4X3PA 4K9LA 2NZ8A 2QMZA 2RGCA 4WUTA 3BBPA 5TEVA 3V4VB 3VSCA 2C77A 2YXDA 4K8IA 2FUG6 5KRUA 1XU9A 4RZSA 4YAJA 1AUXA 5DOVA 5ELLA 1LS6A 4MHSA 1HE3A 3BRWA 1H3EA 1SIUA 1SNDA 3HP1A 3IEKA 4H4EA 3FMPB 3OD5A 3RV4A 2OV4A 1F6DA 1CUEA 2GJKA 3AR5A 4H7HA 4OSPA 2JJ1A 4X6YA 1ZLXA 3M1LA 3DJYA 5TPZA 1PVDA 3EWAA 1CR2A 4G41A 2F43B 4N3GA 4E2XA 4F7XA 1DTWB 2V7PA 4DNXA 1NWCA 4OQNA 5BR4A 1IHXA 4MXDA 5DN6A 2J67A 1D4FA 2IPNA 1ZI6A 4Q1BA 5C1BA 4ZKEA 1EOVA 3RLFA 1KS9A 2HSWA 3A5ZB 4I4TB 1FDVA 4Q05A 3L6UA 3OTHA 1W8IA 3TTVA 5IP7H 3ZS8A 1HDXA 4DREA 4HNTA 3KLBA 2C9ZA 4C1NK 1NT4A 2VYFA 2P9JA 1ZKMA 2R93G 1QPBA 4OO1G 1WHSB 3AUTA 3HDGA 4TT3A 3SI7A 3IMCA 1M6VA 4XQGA 5DLQC 2PJUA 5PGMA 2RVLA 3RHTA 3Q23A 1NPDA 2OFPA 3M83A 2HNAA 3MELA 4QO7A 1AN9A 1UDWA 2BD0A 2XBUA 3AGPA 1IN7A 3GLKA 4NG5A 2XXAB 1MX3A 3AF2A 4MGHA 2PFGA 2RJOA 5G40A 2WYHA 2RC6A 3KQLA 1BCSB 2P5YA 1HMPA 5TARA 4AJKA 5F2DA 3IBFA 4JLWA 3TKLA 3IL2A 2JPDA 3MBIA 3MAQA 4F11A 1HQCA 1Z25A 4FVTA 3V6LA 1DLIA 1WF3A 4G4JA 1NNSA 4IH4A 4JQSA 4K6CA 4OIFA 4X95A 3HKSA 3KDPA 1X8XA 2F8SA 1MGOA 1VL0A 2IYAA 1UKCA 2C3PA 3CUVA 4N40A 3QM1A 5D3ZA 3L1HA 5DT9A 1SCQA 2P9ZA 1D6MA 4DV0B 3D4LA 4GKJB 2KCNA 2XVXA 2YJZA 3GI1A 1SYFA 4RACA 1QTIA 4FC7A 5L3QA 1SVOA 3THYA 3D2CA 2L55A 3H2ZA 5E1FA 3WLNA 3GCDA 3T61A 2WFWA 1XMPA 3AL0C 1CQWA 2HRDA 1QZ3A 1JNXX 3H9UA 4OBEA 5BMVA 3RVOA 2Q0SA 5DGHA 2XVSA 1W76A 1UOQA 2IU3A 3E9CA 4INPA 3BSYA 4IKPA 1KFEB 3L8HA 3N5CA 1Z4PX 3PF4A 2DE0X 4F7DA 1F17A 1SE3A 1D2AA 3I7FA 2LVBA 3DO5A 3MM4A 4FBMA 4LX0A 4LFCL 2WJYA 5CFPA 1ITZA 3BA6A 3JAKA 1WMDA 3HPRA 3C5VA 4L4RA 4LYEA 4B74A 1R10A 3NIGB 2R93B 2RHLA 3RO7A 2Q4OA 3CLKA 5LM3A 3AKZA 5A5EA 2O14A 2GLXA 4BMYA 2M6SA 4L2IB 4OXPA 2VL7A 4WRRA 3H42B 5KYWA 3E3XA 3DEJA 2PBFA 1OFHA 3KYHC 1I6HB 1SNPA 3EA4A 3BCHA 3OT1A 4BDSA 5JFGA 2IS2A 1JDZA 5ERXA 1ETUA 1N2GA 1PZHA 1C7YA 1ZGAA 2MSKA 3UF0A 4E03A 2QTTA 2WHPB 4JDPA