4KI0A

Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
371
structure length
371
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in the Escherichia coli maltose transport system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords ABC transporter related protein
total genus 111
structure length 371
sequence length 371
chains with identical sequence B
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ki0A02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ki0A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ki0A01
1QZHA 4AIIA 4JLVA 1VQIA 2CK3D 3W1GA 3J80c 4DK6C 4ABYA 4RD0A 1H9JA 1JR3D 3WXMA 4FXPA 1IXRC 4ARZB 4ZI2A 1XP8A 4MA4A 1Q86C 3EPLA 2GZAA 2IYXA 3KDSE 3X1DA 4EPTA 1G8FA 3BB1A 3W3ZB 4Z8YA 3LWNA 4DR4Q 1SXJE 1OIWA 2MO0A 4GKJL 4JBMA 2WVJA 2XEXA 1TWHH 1GOTA 2XGJA 4OX9Q 4MYUA 3BB4A 1D9ZA 1NMXA 1X8LA 4O3MA 2GVAA 3DZ8A 5E7IA 1DXMA 5JFGA 2ZRBA 3DMDA 5KO2A 1Y3AA 1LM0A 2BCJQ 3T1VA 1G3QA 3TLXA 2O0KA 4JLMA 4UQOA 1EFRA 4C2TA 4Q47A 4G5QA 1HR0W 1YBYA 2O5VA 4FMCF 3T34A 1VIAA 4JC0A 4LGMA 4OX9L 3RYTC 4S2EA 3SYKA 3U7GA 3TQYA 2FFAA 3K53A 2ZREA 4EIWA 4B3CA 3GLIA 4LW1A 2HYDA 2Z6VA 4G5SA 2MQHA 1T8TA 3P4YA 1JXOA 3KYHC 3D7MA 2LWIA 2OEPA 3NTUA 3S14H 4IFBA 2XJ4A 2WOJA 3IEUA 4C7OA 5CITA 3AVTA 1RRFA 2NO7A 4DAMA 2R9VA 3HU1A 1GHJA 1Y63A 3U3MA 2ZRLA 4JLAA 4DDUA 1ZM9A 3H2YA 2WP8J 1KI4A 1Z6HA 2UZIR 1WDTA 4DV2Q 1E0KA 4JBWA 2QP4A 3ICEA 4IXMA 4WAUA 4DLVA 3THXA 1XEXB 3VA7A 2OAP1 4KKUA 3V9PA 4G7OC 3RS0A 2QAJA 3GJ5A 4B48A 3SEAA 4EPRA 2ATWA 2FZ4A 3O8RA 1TUEA 1O3YA 1GL7A 3HOWG 1NLZA 4II7A 3T1TA 1I2MA 1Q1ZA 2EFEB 3KLRA 3RLOA 3UE0A 3CW2A 3ZZUA 4XTCS 1SGWA 3AF2A 4YLGA 1XJVA 3BFXA 3SHWA 2F55A 3U3OA 1KL9A 4MGZR 4P4SA 1PHJA 1L2TA 4FIDA 3P20A 4WW0A 1NLFA 5FLXc 3ADKA 3FKIH 3AVOA 1DAMA 3DXJC 4V0MA 4MZ9A 4DV2L 1VTKA 5JEAH 1ESMA 1PYSB 2OG2A 1QVRA 3C7KA 3M7NA 1AKEA 2RHMA 3PVSA 3MWJA 4ZDWA 4DR6Q 4Q4AB 3GTOH 4DR1L 2J1LA 3C5CA 3FGNA 4DV7Q 1K9MC 1E6CA 4NYIQ 4Q4HB 4V02A 4QJ3A 5HZHA 3PEVA 4DRZA 1XCGB 1KI6B 1HJPA 5LDDC 5IP7H 2O8BA 421PA 1VS0A 2B29A 4KLZA 4W5JA 1OXVA 2ZJZA 1OHHA 1Z3IX 1KRTA 2JA5H 4URZR 3B9QA 4US1R 1UFQA 5CB8A 4QL5A 4KAXA 1PH6A 3QXHA 2ZYVX 4HUQA 3L0OA 5JS7A 3RN2A 3K70C 3VHLB 3W5IA 2W83A 3K70D 4LX0A 2E87A 1X6VA 2QZ4A 3P32A 3AFQA 2C95A 4TL8A 4YHHQ 3K9NA 4PO1A 1RC8A 1NBWA 2JLSA 3OIYA 4TZ6A 4BRUA 2OCBA 4V0KA 4X8LA 1NIJA 1XEWX 2E76C 4DLSA 3VQTA 2RGCA 3GP8A 4H0LC 1Q8KA 5AK0A 1WCMG 1D2EA 2C77A 1L4YA 4ZKDA 3J7A5 2EYUA 5BW8A 1RRPA 1Q3HA 3OEHD 2QE7A 2HYIC 2AD5A 2B8GA 1XNRQ 1AH9A 1HV8A 2ZTSA 1AS3A 4Q4AA 4TQAA 4TLEA 1IQPA 1N0WA 3DLLA 3UDGA 3BGWA 1MOZA 3V00A 3WYGA 1K8OA 4JT4A 3TW4A 5JWRA 4HJ8A 3EC1A 4LHWA 1FTSA 1MKYA 4TMTA 1BS1A 1X55A 1RZ3A 4FD2A 2WJGA 1IBRA 1GDDA 1LB1B 2CNWD 3KKMA 4MQBA 4P4SB 2GF9A 4K81B 3WYFA 5ELXA 1E7ZA 1NN1A 2AFIE 5TDHA 4URVR 3I72A 2EFDB 4HAYA 4EPXA 3A1TA 4HJAA 5J4HA 2ZS8A 3BXZA 5DE3A 4QGGA 3CC7A 1HURA 5BYJA 2WPDA 1IZ6A 1XD2A 1IYVA 4NYIR 3SU8A 4PC1A 2HUPA 3A5ZB 2ZI3A 3CPEA 2Q2HA 1Z7TA 4OO1I 1GFIA 4EPVA 3OPOA 1SKYE 1QJOA 1BBUA 4DV3L 2H1LA 3RS3A 4YMUA 2B21A 4LFCQ 4TYWA 5BYKA 4PX9A 3THWA 2GCNA 1H95A 2H57A 1H9RA 2QENA 3PIRA 3RWMB 1KK3A 2BEJA 3B2EA 4RZUA 4B43A 3Q7PA 1VQFA 5C2JB 4IPCA 1N3BA 4WA7A 5FI0B 1RW4A 2A19A 3ZYCA 3SQWA 1NNEA 2XNSA 1MO6A 1QVAA 2ATXA 2E8GA 3H15A 5CM9C 3U60B 1DAHA 4K0KL 4IO9A 4DLUA 4KO8A 3GLGE 3BORA 4Q1CA 1VCIA 4XJXA 4JI4L 2XZOA 2B7BA 1GRNA 2CQOA 2ZE5A 1TMKA 4LV5B 1S96A 2JA6G 2CE2X 3HU3A 2CCZA 2ASBA 1G51A 1ZNYA 4AYWA 4O2DA 1X3EA 1DAGA 4A6PA 2E2JH 2P65A 1DO2A 2PJZA 4WZAE 5JWOA 3OFNA 1U8YA 4JYBA 1ZVQA 4TMWA 4OHZA 4RY2A 1J6QA 4Y0VA 4JBXA 4BFWA 3ZVNA 2FU5C 3I62A 4HIDA 4X64Q 2VPPA 2ZRHA 2JA5G 3E0EA 2N42A 3H3VH 1QUQA 3SE0A 3EA0A 4MGIR 3SHFA 1W4BA 4PSKA 5FPTA 3VNVA 1P62B 4NL4H 2X19A 1KO5A 721PA 2XZLA 1U0LA 2J41A 3OESA 4LC1A 2A5YB 1XPOA 1W4RA 2VSFA 3HU2A 4D4LA 3AM1A 2QP3A 3GLHB 1Z5ZA 1IL2A 2A6HD 4Q5IA 1WCV1 2P5SA 1ZC3A 2ANBA 4DLRA 1T6NA 1SXJA 1XNQQ 1W0KD 4RZ3A 4RZXA 5M3MG 4AG5A 3UDXA 2OXRA 3UMFA 2A2ZA 4KMUC 1I5FA 4NONA 2PMDA 4OQNA 3WY9A 2N78A 2GESA 1G5TA 5A5GA 3HOVH 1GKYA 1E9DA 1NJFA 2PX3A 3DOEA 4JK1C 3P4XA 2ERYA 3FHOA 5CK5A 3AUYA 1LV7A 3EIQA 4AIMA 1QVFA 2ZUDA 5KU1A 4C2UA 4C3HH 3NEYA 4K8OA 2V7QA 1ZC4A 5C1BA 2OQ0A 1P2VA 1Z6GA 1CFMA 2QNRA 1S3SA 4MGYR 4RKFA 3MFYA 1MO3A 3LNNA 2IXEA 2V9PA 4L15A 4RFSB 4D2IA 4DJTA 4JBJA 3KDFA 3KTAB 2N8NA 2KI5A 3EG5A 4PO9A 5TMPA 3TNFA 4KSCA 3ZDQA 1E69A 4IRUB 2RMKA 1ZBDA 2FF7A 1VCMA 3W3AA 1XCMA 1N6IA 4KN4C 3LDAA 5M3FG 4NE2A 4O0MA 4B76A 3PUZA 4EFNA 4D0NA 4GLXA 2QG6A 1E9EA 3TREA 4M53A 4IFDG 4V0NA 2WB1E 3O8CA 2VP4A 1I94L 4B75A 2GZHA 3HKZE 3AF1A 2VP6A 2ZJBA 4GI7A 4HATA 4OK5A 1OXUA 3OW7A 4QJ4A 2GETA 3RRNA 8OHMA 2BBOA 3GJ7A 3BIFA 3DKPA 4JLOA 5K8IA 5HE8A 2ZJPA 3JC66 1HA3A 4CRWB 4ALPA 4JI7L 3WNBA 1NVXQ 2ORVA 3GTPH 1ZM4A 2JASA 2ORWA 1ZM7A 3C15C 3EZ7A 3NG1A 4I4LA 2A30A 1MRSA 1C0AA 1Y8OB 4MKIA 4DDVA 5KDOA 3U44A 5M04A 4HAZA 3TSWA 3LX5A 2VF8A 1QHYA 3L8YA 1N5IA 5J4YA 1OPXA 2WM9B 4IVPA 3RNUA 4PG3A 2QA4A 1JT8A 1JNYA 1XEWY 4QC2A 3T06B 1SN8A 2C9OA 2Q3MA 2WWFA 2HLDD 2WB1G 1HQYE 4UP7A 2W2TA 2OLKA 4UNPA 3S2HH 5EXTA 1KAGA 1TL7C 2X2EA 2Z4SA 3CF2A 2ZI6A 3TJZA 3ZIAA 4GNXB 3TVDA 2UUAL 5A35A 3I55A 4LHZA 1G7TA 2WAXA 1S9HA 5DGXA 3EPKA 4Q01A 4C0KA 3I73A 5FUYA 4BFYA 2BBTA 4OI2A 821PA 3ZD7A 1XPUA 2DHRA 4JL8A 2WJVA 1TF7A 3GDEA 2PEYA 2ZRJA 4DIDA 1N36Q 3MJRA 4HLUC 3RVBA 4F4CA 5F98A 1N32Q 1E9RA 4QIWE 4LWZA 1TUIA 5HKKA 1LACA 2DY1A 1IXSB 4A93G 5L3QA 4XWAA 4MYCA 5JEDA 3JAMi 2PT5A 4DB2A 2I5MX 5DLQC 4AYTA 2C5LA 1RIPA 3L82B 2FSGA 3MAAC 4M9SA 1RE0A 4DC9A 3OFND 2FE4A 1E4VA 3AP3A 5CLQA 2ZRMA 5BQ5A 3ADBA 1N6KA 1RRGA 1WRBA 4D6PA 3SFZA 1FL0A 1IJFA 1II8B 2J0VA 3LLUA 2W6JA 5B58C 3ZD6A 3TQCA 4IOJA 2JLVA 3VHXA 1HZ9A 3RZDH 1E2HA 2K5NA 2GN5A 3TBKA 1ANKA 3WNCA 3HR8A 1F6BA 2DPXA 1PFSA 2D7DA 3KKQA 1X86B 5FFMA 2P67A 1CR0A 3W6NA 4ACBA 1VQ6A 3S1NH 2WMOB 3G5UA 4M1YA 1ASYA 3LXRA 2XJ9A 3EZ6A 4BLSA 1KIMA 2ZI9A 1H9SB 2VP0A 4BFSA 1G4UR 4IFDH 2QROA 2VHJA 4HDQB 5EE5B 2A9KA 4ZIRA 4UY8C 4E5UA 2ZYWX 5FTMA 1Z83A 2H8KA 4DV6Q 5C0XI 3VKWA 1R0ZA 3M85A 1N8RC 1NJIC 4A8JB 4B33A 3AKCA 2BWJA 4OKSA 1CTMA 1JQLB 1P16A 1PH9A 3LWUA 1BVSA 4GMXA 2IHYA 4W5HA 4ARZA 2HIVA 2QSZA 4MUAA 4X62Q 5C4GB 5CB6A 2WBLC 2G77B 3QIAA 4Q9HA 3KF6B 2C2HA 3STBD 3H84A 5HCIA 3FPAA 2DFLA 4L9SA 3PF5A 1BKDR 2IF0A 1Z2AA 1LUZA 3CAMA 1PUJA 1MJEA 5D3QA 4LFAQ 4FMCB 2VLIA 4MKGA 5TV2A 3NBFA 3CW2C 3M4PA 1R7RA 3IQWA 3JVUA 3TS0A 1AE2A 2GZDA 3IUYA 3PITA 3U4VA 4YCVA 3CCUA 1LF5A 1YHAA 4RKEA 2GNOA 1VPLA 1ZJ6A 2H5EA 3T5GA 1E1OA 5JJKA 3ULPA 1M7HA 3QKRB 4HB2A 1EX7A 4PPFA 1LABA 4FINA 2NO9A 1N6PA 3AB9A 1XMOL 1E2MA 1OYWA 3MMPA 1U5KA 3QEJA 2K5VA 1W1WA 4B3MQ 221PA 2HQLA 1VQJA 4RFSA 4DSOA 3CC2A 1UF9A 2ZI5A 3VR1A 4JOIC 2ZSEA 4JI4Q 2G88A 4HSEA 2CEAA 1JBKA 3CX8A 4GP6A 4LF5Q 2K50A 3KJIA 2KENA 1N6NA 2A3RA 1N34L 5FPYA 4A3GH 1JJGA 1YE8A 4XOIA 4TTQA 1RIFA 3BS4A 4QM6A 2IYSA 1WYDA 4LF4L 4LF6L 5AR1A 4ZDJA 5EQTA 3VX3A 3OEED 2P6NA 1YVCA 4HIMA 4M1SA 1GZSA 3A6PC 2ES2A 2JEOA 1R0YA 4P4TA 4D4JA 3IIMA 1NF3A 2ZU0C 3LAWA 4A1FA 1EUJA 3NELA 5J4KA 2QQ0A 3NXSA 1HT2E 3J80i 1GD7A 3S15H 4JS0A 3WBJA 4AURA 1P75A 3CWQA 3CUEF 1DG3A 3GJ6A 4GOPC 5E7JA 4KODA 4L16A 2FMXA 1L0WA 1KI9A 1ZRHA 3HWSA 5KSZA 3KJEA 2O8FB 2CE7A 3I7FA 4JI5L 2JDID 4RCZA 4G7ZC 2VTKA 1TAGA 3ULLA 2JA8G 2UUBQ 4DV1L 1W0JD 1HH4A 1SQ5A 2AXNA 5HZKA 1QHGA 2B63H 1G16A 4C30A 4ZCIA 3U7FB 2CL6X 2IHFA 4NXNQ 1PH4A 1E2DA 1G64A 3BOSA 4HB4A 4LPSA 4DR7Q 4Q00A 4OK6A 4W7SA 3K0XA 1EFHA 4LYHA 2H16A 2NGRA 2EJGC 3OAAA 4DVGA 3L2OB 5KNDA 4DHEA 4JVSB 5J4VA 2ZR7A 3BH6A 4PPNA 1IYUA 2RF4A 1TWFH 2IYQA 3R9WA 4Y0AA 2B8FA 4NXML 3NHBA 5JJIA 3ER0A 1N6HA 4G0NA 5FOXA 4PQRA 1G21E 1OE0A 3Q5DA 4IW3B 2VP9A 4DBLC 4EDHA 1O7IA 4HLQB 2D06A 4BZPA 3K9HA 5IWAL 2BJVA 1EWRA 3SOPA 5IYCH 4Q1BA 3TMKA 4D4KA 3CC4A 3AFPA 3QPUA 5DHAA 2JJQA 3L43A 3RC3A 3ICQB 2WWXA 1UE6A 3X1ZA 3GLHA 2CNWA 1NE3A 2ZRKA 1E1RD 1C9KA 2IWHA 4L5BA 5IYDH 3I4MG 1P8LA 2ZRAA 2A6EC 1YJNA 3PCOB 4JYAQ 4XWOA 1RYHA 3QBTA 3B6YA 3HFZB 2YNMA 3CCVA 3B8HA 5FBRB 1F48A 3VR5A 2JIZD 1XD8A 5IDVA 2IS1A 5FTKA 4L5TA 1PZNA 2VIIA 5CIWA 4UJ5A 5J4LA 1W2HA 5GADl 1WE2A 3KQHA 1H9SA 1AGRA 1NMZA 3KQUA 4AK9A 2F3RA 1T8UA 1GJXA 4G5OA 1T4GA 2ANCA 4QGHA 4OO1H 3LLMA 2FA9A 3S17H 1P7CA 4TLDA 5JI3E 1I4DD 4JLKA 3M0EA 4JV5Q 1JAHA 2DWOA 1Z07A 2R7FA 1X65A 3K0EA 4A3FG 4IHQA 3WHLA 5LMNL 1JPJA 2QMEA 5EUQB 5J3BA 2W6ID 5L3QB 3GLFB 1US8B 2ODEA 2FSHA 3Q5EA 3TEHB 2DYKA 2RGNA 4CW7A 3NH6A 1HNWQ 4LDJA 4Z54A 1HYQA 2FXQA 3PO2H 3OTOL 4BFTA 5H1SE 1ETUA 3NDPA 1OHHD 1T91A 3WNDA 4C0SA 1M1YE 4QKQA 4M21A 4BUJA 4P73A 1Q1QA 2DB3A 4HJ5A 4BLQA 1CULC 1E99A 4EQ6B 2WKRA 2BBWA 2I1QA 4IDPA 5LD2C 1D2NA 1YQTA 2K4KA 2ZVPX 3QQ5A 4MYTA 5EE9A 3KFVA 1A1VA 3KUCA 1XD9A 4UJ3A 1PUIA 2UU9L 1DAIA 1A8VA 4JOIA 3M4QA 4LUVA 4PZ8A 2P5TB 2XTIA 3EA5A 3RRZA 1ODFA 1BO6A 3QVVA 4ZCMA 2GJ8A 4Q7LA 1XWIA 4FWTA 3EIVA 3FHTA 1I4TD 4DDWA 1QVGA 2J5XA 3H0KA 1W7AA 2JA8H 3TE6A 4PV1C 1K8MA 3CRKC 4PC3A 3TVTA 3IFTA 4LHXA 2WSSD 3ND8A 3A4NA 4IOMA 4GN4B 4DEXA 3I5XA 1N0VC 3ADDA 3KJOA 3ZLJA 4POAA 1H8ED 1T5LA 1EOVA 1S40A 2PPBC 1XMQQ 1S0UA 4CIDA 4IOLA 4R4CA 5IP9G 1K5GA 2DNCA 2OILA 3FHCB 5SZJA 3R7WA 5JLJA 3FKSD 3TQFA 1Z0IA 2FFBA 4H1UA 5C3EG 4CDGA 3NE5B 3BDOA 4MTNA 3Q8XB 2FJUA 1KOFA 4JVLA 1EWQA 2H7VA 1Q20A 3CWZA 4DCSA 3VKGA 5ANRB 4ZDIA 3KQLA 1ZD9A 1TTTA 4RD3A 1ZCBA 4Q18A 5E4FA 4LI0A 2O8BB 1PA6A 1HR0L 1N9WA 1RYFA 2FFHA 1IBLL 1I2DA 2YTVA 2ZE8A 1YR8A 2ZRPA 3GLGA 1HQMC 1HTWA 4KKSA 1ZW6A 4APVA 4A3GG 4Q4HA 3KF8B 1WQ1R 2FFQA 5EXPA 2GEVA 1PH8A 5DI9A 3KJPA 5F3WB 1DOAA 1KMHA 4BY7G 1JEEA 3UWKA 3A1VA 3VR2A 3GO5A 1AM4D 1CEEA 2NQ2C 1CJVC 3CPJB 4IEEA 4Q7MB 1G9XA 3I4MH 1TPZA 2UVQA 1YNXA 3RNLA 1AS2A 1ESNA 1CRQA 5G40A 1UDWA 3DM9B 4AKEA 2NN6H 3IILA 2QBYA 3EN2A 1OV4A 4YWLA 1A4RA 1AQUA 1QHHA 2OZEA 4JYCA 5CM8B 5G3YA 1I50H 5HGQA 2ZRIA 4M4SA 2ZJ5A 1DG1G 4Q48A 2DGYA 4UNNA 2CXXA 4DV0Q 4GPTA 3KQNA 3I32A 1A63A 5LB2A 1U90A 3PXGA 3ZVMA 4MDEA 2D5DA 1BMFD 2Z6KC 1KMQA 2VS1A 1KSFX 2ZRGA 3KKPA 3QVUA 1BOFA 3VTKA 4RVCA 3RWOA 3WHKA 2O8EB 2C04A 5JWHA 4BEJA 2NZ8A 3T15A 2O5IC 3GTKH 3D6TB 4V0OA 1ZUNB 1A0IA 3HOYG 3C5HA 1NMGA 1JECA 2IYLD 2QGZA 3QPVA 5M3MH 3CCMA 1JR3A 3CP0A 1YJ9A 4DLWA 1KI8A 2EVWX 1N33Q 4DR6L 3PO2G 5JCZA 3GLFE 1OSNA 1SROA 1ZP6A 4KKTA 2ZRNA 3AVPA 1XRJA 3D0FA 1E98A 4OJKA 3HOWH 4Q7KA 3QF4B 3X1XA 5AJ3Q 2JK8A 2O0HA 2BA1A 1TWAH 3U6KA 3GLGB 1G3MA 2EWVA 4BZXA 4LYAA 4NCIA 1OH6A 3RR5A 2R92H 1AKYA 1BYUA 2BVNA 3PUVA 1E0AA 3PIPA 1E2IA 3SR0A 2BM0A 1HZCA 3C16C 4I1UA 4EQ6A 1E1RA 4X8OA 4LF9Q 1DAFA 1VF5C 4MKFA 4DSUA 5FUWA 5CYOA 2JA6H 4ESHA 4XVUA 1XMJA 5AUOB 4YHHL 1KI7A 1O7LA 4HI0E 4LYFA 4EJSC 2F7SA 5C3EH 1TU3A 3KXKA 1CUKA 1KI3A 4P3YA 5KNCA 5IP7G 1Q46A 3UWOA 3OHMA 2VYFA 2VHTA 1WFQA 2QL6A 4GBMA 4LJ5A 1Z0FA 1FP7A 4FI3C 2Q3HA 4Q9IA 3PJRA 2J7PA 3HKZG 1J70A 3G82C 4U02A 1J99A 3M6AA 4PZ7A 4JI1L 3OAAD 2KJQA 4LF9L 4GOKA 4A3LH 4OWXB 1VQGA 4URUR 2ZRDA 1VQ8A 4LBYA 1SRUA 5EP1A 3J81k 2QPAA 2HCJB 2GA8A 1MIUA 5FLMH 1M6NA 2YWFA 4X6AH 2VHQA 2HLDA 3RLFA 4I7ZC 1HNXL 1EFUA 1EG7A 1LS6A 5E95A 4C0HA 4R4IA 2AWOA 1M7GA 1W0JA 3ASYA 3BK7A 3AVYA 2W2XA 2PZFA 1U8AA 1VQHA 1ZINA 2JA1A 5JEEA 4ASUA 3K1JA 4M8NE 4KSBA 4C0JA 1Q21A 1P72A 4DV4Q 4UXHA 2BIFA 4R7ZA 1W2BA 4B3BA 1CKNB 3T1YQ 4G5GA 2WJJA 1M90C 3NIBA 4PSVA 4Q21A 4LUCA 1GRRA 5DHFA 1Q1BA 3ZS9A 1J5EQ 2EU8A 4KHPL 3NC0C 3BZKA 3B1WA 4NU0A 5UKDA 2K5UA 3KTAA 3F0TA 5FOWA 3FMOB 1WOCA 2FX3A 2P3SA 2EDGA 4A2PA 1DBSA 4EPYA 2GXAA 3BFVA 2XXAA 3GD7A 2V55B 5AJYA 5SZIA 3S24A 2BHRA 4GN3B 2KBEA 3AF0A 5H1YA 3WMGA 1GTVA 4B6EA 3IO3A 1FPMA 1R5NA 2IT1A 2G0NA 1XNRL 2KWIA 2CKZB 2BBSA 4HLUA 3A1UA 4A3MH 1P60A 1G8YA 4JLPA 2REBA 1C9OA 4P32A 2GJAA 2PLFA 4M9XA 1FUKA 4JSYA 3TUIC 4TVAB 3NH9A 3JAMc 1E2GA 4DUZL 2Q21A 1HUQA 4TLCA 1Z29A 2ZJAA 1COWA 1RPZA 3HOZH 1IY0A 3SQXA 1WJJA 2R92G 2MSEB 1E2LA 1A6XA 2W6JD 2C9YA 4R4OA 4OI4A 4WIAA 3I1FA 2CJWB 4NCHA 1P9NA 2ZPTX 2NIPA 2YV5A 1ZD1A 1G6HA 4JL5A 3CRLC 3CZPA 4Q9LA 4EPWA 2BMFA 3NBYC 1EWIA 1K83H 3TKLA 2GJ9A 3NDBB 4QJ5A 4IJMA 1EYGA 2G1JA 1E96A 1I4LD 3FWYA 3LVRE 4B3SL 4XH9B 1OT3A 2QRZA 2V4ZA 3SYLA 4IXNA 2JLRA 2CBZA 5C44H 3MUFA 4ZV4A 2WAQE 1YEZA 1II0A 1ZKOA 1N25A 2QAGB 3K8YA 4DWJA 3IQXA 2OCEA 1GUSA 2Q9AA 3CRMA 4TQUS 3SN6A 1UEJA 3BB3A 3EZ9A 1P9WA 1ZCAA 1NY5A 5TB5A 2NN6G 2OM2A 2WWHA 3B1YA 4IPDA 4G5RA 5JSZA 1PLLA 4IJLA 3SC3A 4NPSA 1HNZL 3QPWA 1RJ9A 4HZUA 4TYYA 3JZMA 1KI1A 4MRSA 4CEJB 3O8BA 4IDOA 4DK3C 3KJGA 3KUDA 4KV9A 2EXDA 1JB7A 4E07A 1WA5A 1Q0UA 1NMFA 4XIGS 1SVWA 4OO1G 1US8A 1PH3A 2YC2C 1F5NA 4L5SA 2HF8A 1KSHA 2YINC 3GFPA 4FMDF 5E7MA 3QXXA 3GQBA 1NIPA 2CMKA 5IHPA 1MRNA 4PR0A 2MSDB 4OHYA 3PUXA 2A6HC 3CF0A 1VQ9A 3IDQA 4URYR 4WJ3M 4QBHA 4G7HC 1JEDA 1Z47A 1HNZQ 1A82A 1GAJA 2QMHA 2AMCB 3DVLA 3CXCA 3NHAA 4A4DA 1X3FA 4FWIB 5F9HA 5P21A 5M5YH 2ZAMA 3H0GH 4JCVE 5M3FH 4DR7L 4P74A 4GNXA 4N3NA 2F3IA 4C3ZA 621PA 1EQRA 4UXIA 2KCCA 5AJVB 1IONA 3IRBA 4Y7NH 1H8EA 1TQDA 2QM7A 3X2SA 2AKYA 2V54A 4U7DA 2IW3A 4HDCA 4XWKA 1K73C 1X9NA 1W47A 1G6OA 2A78A 2AD1A 2W00A 2WSSA 5HR5A 4AKIA 1S1CA 2TMKA 4DCVA 2NTYC 1NBMD 2IUSA 1JXMA 1XNQL 5JI2E 1AN0A 2A68C 4M1KA 1Z22A 4GRAA 3QSYA 2A69D 4A76A 1IAQA 4PZYA 2A69C 3QKUA 3X1WA 1SHKA 4NBSA 4XTRA 4PHHA 2JEAI 1H65A 5KDDA 2BDOA 2KHIA 1DAKA 1WMSA 3QOFA 1Z0AA 2QORA 2WIAA 1N6RA 2I5LX 2PMKA 5DO9A 3IHLA 3CRW1 3QKTA 1C1YA 1OIVA 4NB3A 2OFWA 2ZSDA 3GEIA 5DISB 3QENA 4LJ6A 5GJCA 1G20E 3SJAA 5DYIA 3ADCA 1X6OA 1GM5A 3F5FA 1ONBA 3W6OA 2OUKA 4D80A 4HAWA 1O87A 1E79A 2IS2A 1OFTA 3AVQA 4M1OA 3FB4A 2OCYC 3AF4A 2IX3A 2XNDA 1HZAA 2CLCX 3CQZH 2RGEA 1KKMA 3ULJA 1PJRA 4TYPA 4NMMA 2WZQA 4FMDB 1Z6XA 1TEVA 1P2UA 4NYJQ 1BDOA 2JLQA 2YJTD 4R71A 2QP9X 4TZ0A 4HUQB 5CJPA 1WBBA 3FMPB 4OBEA 4Q1DA 1PH1A 3U44B 4LJAA 1KSJA 3QBVA 2E9SA 3LY5A 4BGDA 2D62A 5FJ8H 4LHVA 4M1MA 1SVOA 1Q1EA 3EC2A 3F8TA 4WZ6A 2AHOB 5JEAJ 2VL6A 2VEDA 2ZANA 2ZUBA 3ECCA 3L8ZA 4TN1A 1F2TB 3AP1A 2GDJA 4MGKR 2CW0C 3TGPA 4JI7Q 2VW9A 4JLNA 3ZQJA 4BFVA 5CYPA 1DELA 1KJWA 4JBYA 1AGPA 2KE5A 1GP2A 3T35A 4HIKA 3K8AA 1KY2A 2KBNA 3N5CA 1DPFA 5EE1A 1FP6A 1T3LA 3AP2A 1SKYB 2F4VQ 1VDZA 2WAYA 2R6GA 1DO0A 3J81i 4UP8A 4FW9A 4LJ8A 4P33A 1FNMA 4RCYA 3J7ZC 5D3MA 2K5HA 4FCWA 2CJWA 2AX4A 4I99A 3SDZA 3EPJA 2GJSA 1BYIA 3LXXA 4RD4A 4F38A 2VNUD 2WHXA 5DN6A 1X3GA 1OH5A 3KXLA 1XX6A 2G9NA 4LF5L 2N49A 4AQYL 2VUMH 1XU4A 3U7EB 3A74A 1N34Q 3SFVA 4BE7B 1JJCB 2PCFB 1IW7C 3ND9A 5E7NA 4B2IA 1SE8A 4BLRA 5L3SA 3K9LA 1SMYC 5CJ2A 1V8QA 3UDIA 3AQQA 1KDOA 3MLEA 4B2PA 1W0KA 5FI1B 1VQOA 3DPUA 3GCGA 2IX0A 2C78A 1VF7A 5GJVC 1UE7A 4D4MA 2J45A 1UBEA 1HPCA 1ZD8A 3K0FB 2QMUA 2QRNA 1I3QH 2V4DA 3QE0A 3GLIE 4XVQA 3NWJA 3RSOA 3I4NG 2DWQA 2WWYA 3A8KE 4BBSH 1JAIA 3C14C 4AYBE 2HV8A 2ZQ5A 2FN4A 2R8RA 4PXAA 5FBLB 3S1AB 4GL2A 2J3EA 5FPKA 2VO1A 1YZKA 4JJKA 2Q8IB 4LF7Q 4P72A 1OLOA 2ZIAA 2CHVA 3C41J 3FFBA 3K09C 3I56A 2YOGA 3EPHA 4CZ2A 4CVNA 1K6MA 1UKVY 5TY0A 5LMUQ 2V1CC 4GZMA 3LA6A 1AQYA 2E75C 1J2JA 2RH5A 4BA1I 2JJ1D 4DCUA 2IS4A 1N0UA 4DPGA 3RANA 4PAQA 1W46A 5LB4A 2W6IA 1B23P 5EP4A 1E3PA 2D0PA 2LKDA 4MNOA 3CRVA 2LMCB 3Q7QA 3TUJC 1KK0A 2JLUA 1T0JB 4HAVA 1J8MF 3BC1A 4OI0A 4UP9A 3I8SA 2J0SA 3TRFA 3AVVA 4JI0Q 4YQFA 5FJ8G 4OI1A 2UUCQ 1XMIA 5J47A 2UXCQ 3K0CA 1FW6A 1NVVR 1U94A 1IN4A 4OONA 3IO5A 4HIOA 1Y1WG 1N2CE 1RKBA 1UDXA 3CMEA 1HQCA 2YC4C 2IWRA 3T5DA 3GLFA 5GROA 4BZQA 2QPOA 2YOHA 1RRCA 2CL0X 2GVDC 1N6LA 2R2AA 3A36A 4C0LA 2PL3A 4R4TA 2BCGY 4B3SQ 2ZSFA 3G48A 2A5GA 2GJKA 4OHVA 1YITA 4YCUA 1GG2A 1KD1C 5K8UA 1EWHA 1G7SA 3A7AB 4O2LA 1LW7A 3HPRA 4C4PA 3BD9A 3GEEA 2V7QD 1TWCH 5ELOA 2D74A 1R6BX 4LYJA 4BLPA 3Q9LA 3HOUH 1K0RA 1Z6TA 3GFTA 3D8BA 3DDCA 4CEIA 1XTIA 4D25A 2BKEA 1QBKC 2B63G 4A0HA 3A5UA 4DAYB 3MEFA 4X65Q 2REXB 4Q7JB 1XTRA 3F3YA 1E0SA 2VUMG 5CDFA 3IPXA 5J5CA 1XMOQ 3RS5A 4C2MH 3I61A 4TMZA 5TXGA 4IPGA 4JG2A 4NCJA 2PCLA 1TWGH 2YTYA 3VU9A 2Q2TA 1GRQA 1AIPA 4CYMA 1N5JA 1EESA 1ZYRC 1Z08A 3AF3A 3UXMA 1M34E 3UK6A 4DR1Q 4E22A 3TSOA 4LFBQ 1SXJD 5KYKA 1W36B 1CR2A 3N2EA 2XOKD 1DADA 1UPTA 3MG9A 2LXKA 1JI0A 1TQ2A 2QSYA 3QNUA 1DAEA 2VSOA 1GHKA 4W5WA 4X8MA 4M1WA 3V4FA 3QXJA 1DCZA 1U0HC 3HGBA 3QKRA 4GSYA 4G01B 4MYHA 2DWPA 5JMTA 4QNRA 1UKEA 4CGZA 1S3OA 1QZXA 1VYTA 4GKKQ 2FZLA 4LF4Q 4LF6Q 2EFGA 3HR7A 4M2LA 5KUTA 4NYMQ 2RGBA 3UIEA 3PO3H 1FOEB 1KYIA 2J46A 1OKKA 4JI1Q 1PV4A 4TWZA 2XZPA 1X1SA 1NLYA 4DNTB 2DNEA 4LFBL 2D2FA 2F9LA 1SKQA 3DEFA 3NBXX 5K8TA 4N1AA 4RZ2A 3B1ZA 3WRXC 2PI2E 3OEEA 1NVUQ 4MUBA 2WSMA 4JYAL 2ERXA 1F2UB 1ZMXA 1ZIPA 3KB1A 2ZAOA 2ZJ2A 3BZCA 3CRQA 1P5ZB 4QY7A 2DBYA 4V03A 4D0LB 3E2IA 5JHGB 5HKKD 2ZSAA 4LK1C 2GVZC 3RABA 4DUYL 2ZTCA 3B78A 3EASA 3OIWA 2HDNB 4JVMA 3RS7A 2C96A 4LF8Q 1FQJA 3WYAA 4EFLA 3T1YL 2H92A 4LSGA 1ZYUA 5JRJA 3ERSX 1XMQL 1CXZA 2I4IA 5BWMA 4PMWA 5C4XH 4GOJA 1RVDA 3U5ZB 3CZQA 4A0RA 4BLOA 4F93B 3ONWA 2IXFA 3FE2A 1Z8FA 2NG1A 4PHFA 4DB4A 4HEJA 3U4QA 4NXMQ 3R9XA 3A7LA 4YWMA 1E2WA 4UNSA 1AK2A 4DR4L 2QT1A 4TSFD 3REGA 3WMEA 4B2LA 4MH0R 2V3CC 4GKJQ 2WWWA 5AJWA 1IBLQ 2OAQ1 3EWAA 2RGAA 3A0JA 2WV9A 3LQRA 2ZXUA 3GLIB 2D7CA 1VG8A 1RFLA 1H9MA 4ME3A 1VQ4A 4PC2A 2ZM6L 5C18A 2FEMA 1VG1A 1FUUA 2LXJA 1QRAA 1TU4A 2K32A 1G8PA 4M0LA 2ZS7A 4X66Q 1F3OA 2AXPA 4PC7A 3RS4A 4RCNA 2CCGA 3EW9A 1VECA 4J0QA 4QRHA 4FCVA 3W5JA 1VYVA 3NVAA 3AGQA 2HHHL 2QEQA 1FFHA 2A68D 4BECA 3WMFA 4LCBA 2R93H 3OIUA 2NZJA 4GLAC 4YCWA 2R65A 2WAQG 2EJFC 4HYYA 4R98A 5A4JA 3UG7A 5L3VA 4DV0L 2OHFA 1HCZA 3QF7A 4IOKA 4A3FH 1PLJA 2EFCB 5F2EA 5M5WH 4DR5Q 3S2DH 2Z0MA 2ZTDA 3ZH9B 3I5YA 2XITA 3A8TA 2A5FA 2QE7D 1NRJB 3OEHA 1TXYA 5IP9H 1DGSA 4MRRA 2V1UA 5IE8A 1KK1A 1FJGL 1C4OA 1S9DA 5FUVA 3W34A 4RMFA 2REOA 1DTSA 1S3GA 3AQ4A 4I1OA 1T5EA 2OSBA 3SJBA 3WRYC 5KSYA 5FTLA 2LSSA 2RHSB 2ECKA 1P2SA 2VY3A 2JATA 4TMKA 2C9CA 4JI8L 1CR4A 1GSIA 1NKTA 5AUQA 4GOPA 1ZNXA 3K09A 4TL6A 3Q3JB 3H1TA 2I1VB 2F1MA 1R8QA 3S1AA 2C03A 4NCKA 1NY6A 1XZQA 3TH5A 1SR3A 4A8JA 2BOVA 3B1VA 4TTPA 2RGNC 3UATA 3D3QA 1B7YB 3P1JA 2HF9A 3BFKA 3SGIA 3UANA 4M22A 4YDSA 1TKWB 2WTUA 4Q1AA 5C4JH 5EUMA 3ZJYC 2IUUA 3HOXG 2D2EA 2YKGA 2N3SA 2GILA 1KKLA 2ZU6A 4UNQA 4TYQA 2V8OA 5B57C 1W36C 3DM5A 4OK3A 3RRYA 4OQFA 3LFUA 2PZGA 3EIHA 3KKOA 4RSGA 5FH9A 1KNQA 1QHHB 4R9UC 4WJ4A 2IX1A 5C44G 1S8FA 4ILEA 4TT3D 3VR6A 2Q9BA 1S4QA 5AWFC 4US2R 2NPIA 2WMNB 1KDTA 3QXCA 5EZ6B 1G5RA 2J0UA 2SHKA 2G1KA 3UPUA 1RJ9B 1KXLA 2RGXA 4NH0A 4KVGA 2L5TA 2PX0A 4DCTA 4YMSA 1NVWQ 1Z6AA 1QF9A 1NBMA 1KRSA 2BDTA 4U00A 3K0SA 4EX5A 1UEBA 4JBKA 3FYHA 3THOA 5SZHB 3OYYA 5KNBA 1JR6A 3IPYA 4EJSA 3BERA 2K52A 1A2BA 2J59A 3PUYA 2CWAA 3TW8B 1L4UA 1R9TH 1NVVQ 1AE3A 1GKIA 1L8QA 1LTQA 1VMAA 2DFTA 1E3MA 1MO4A 2QPTA 5BR8Q 2XGTA 3OW2A 4O25A 1KY3A 3NEMA 1Y8NB 3DO6A 4JI0L 3AGPA 5GAEC 1TF2A 2UKDA 4I81A 1N33L 2WFWA 4OXPA 1LY1A 1YKSA 5IYBH 4BY1H 4P31A 1JJ7A 4BBRG 2B6HA 1G6PA 4DNIA 1N32L 1QZGA 2CHGA 3PF4A 3I8XA 1I94Q 1OXSC 1QVCA 2OTLA 4NYJR 3T61A 1P61B 2QQEA 3NC1C 2UXBL 4B44A 2Q6TA 1E2KA 4R2HA 2HT1A 2F43A 1BKBA 3CPHA 4PANA 4TLBA 1Q57A 5F9FA 4Q19A 2RHQB 5K36G 3D31A 1DARA 1OYYA 4QHYA 2ZVQX 1SXJC 4EUNA 2PJRA 2HT6A 1UAAA 3K0CC 3KOJA 1EFRD 3U61B 2D0OA 2FWRA 2ZRCA 2WKQA 3AB3A 2IXGA 1BIFA 2CWPA 3AUXA 3HP1A 3EBEA 4L4UA 4P4UA 5FTNA 1IN8A 4DR2Q 1XB2A 3GPLA 2K7VA 2O8CB 1N5LA 2ALYB 1R5OA 1W49A 2YYZA 4CEIB 1ASZA 4C3JH 1D8LA 2KCTA 1EXMA 2GAOA 2GRJA 4A3LG 3B85A 3SZRA 3IGFA 3U3JA 1JMCA 4UPAA 4LZZA 1E79D 1CS4C 4V0ME 1MABB 1U8ZA 1CKMA 4DV6L 5LPNA 2E2IH 3FFAA 4BA2I 3HOXH 3GFOA 4AI6A 3H94A 1OTCA 1K8GA 3GMTA 1KO1A 1CKNA 3VX4A 4B3GA 2EQSA 3U3KA 3THYA 3CLVA 3UMRA 2MO1A 2W2VA 3D4RA 3U58A 3RLNA 2MMCA 3NKVA 2FSFA 4JMPA 2A7QA 4A3BH 2Q2IA 3THXB 1JE5A 2B3GA 4GKKL 3KL4A 1XBTA 1N36L 4JIMA 1DS6A 1NSTA 2HCBA 1NG1A 2ORIA 1P4SA 1QHNA 2VA8A 4KFSA 4LBZA 4PHTA 1GO3E 1ZU4A 2J0QA 1X3SA 1Z2CA 4POGA 4A3EG 4ON9A 3PEWA 2L15A 1W2GA 4HUTA 3EAQA 3WDNA 3MWYW 2ZITA 2ODBA 4TKOB 3CR8A 3G0HA 1KC8C 3UDFA 2QTHA 3CH4B 1XF9A 1OF1A 1FVIA 4WOPA 3K70B 3CNNA 3RSLA 1II8A 5FR2A 4JI3Q 1JPNA 2NPFA 3C8UA 1IHUA 4DKAC 4A3EH 4KJZA 2GK6A 4A3MG 1M1KC 2HXYA 4J15A 2BJWA 2ZETA 2JLYA 3H0GG 1NN5A 2IC5A 4LNQA 5FOSA 3IEVA 4LPKA 2CDNA 2RCNA 4QGUA 1G8HA 5JJLA 1G7CA 4LF8L 1CR1A 1FTNA 1E9FA 1KJZA 2CVFA 2JLZA 2OESA 4JL6A 4QHSA 2VHUA 4YMTA 1EX6A 2L0XA 5FBQB 1IOZA 2HXSA 4LF7L 2EIFA 3GTJH 1NMYA 1P9RA 1XZPA 2PNHA 4XVRA 3EQLC 3B1XA 5FR1A 2QEXA 3FOZA 1IW7D 2ID0A 4LJYA 2ZJRA 1CIPA 3GTLH 4DLZA 1UWVA 3F2BA 3BH0A 1MT0A 4S35A 2I5HA 1ZAKA 4AWXA 2JAQA 5JRZA 1OH8A 5C0XG 1PH7A 2RHDA 4IFDJ 4B3TQ 1TQ4A 1XD2B 1HY3A 2JCSA 2G3YA 3ZS8A 2IEYA 2QGNA 4DZZA 1J5EL 4LY6A 4GLVB 3MXUA 4A0FA 2JXMB 4QXAA 4TMXA 2GHIA 4OJQA 1OH7A 3MGCA 3U2QA 3PEYA 1XNJA 2GBLC 3CCRA 2JJ2D 4RG1A 4IDHA 4BFUA 1YNJC 2J7KA 3ZIAD 4BASA 4GP7A 1KMHB 3T12A 1IN6A 2N1BA 2O8FA 2IK8A 1NL3A 3IBYA 1ZNWA 5IK2D 4Z51A 4BY7H 3GJXC 4UXJA 1OW3B 4QBGB 2AN9A 3MWKA 4D81A 2IYYA 1ZM2A 4B71A 3G71A 1YZ6A 1FYCA 1KTVA 5FL7A 3GJ3A 4X64L 1VQ7A 3B82A 2Q3FA 1VCOA 3X1YA 1LYLA 2QAGA 3U6BA 2F1JA 1YRBA 5HY6A 1G19A 2F1HA 2F6RA 2YZ2A 1YR6A 3B7GA 4NP6A 2MMGA 5H8WA 2DFKB 4FMBB 1CI3M 1FJGQ 4FDBA 4AYBG 3W8NA 4AY2A 2RKOA 3RS2A 1ZM3A 3EZFA 4B74A 1OKKD 3DOFA 4A3CG 4R2IA 1GUNA 1ONLA 5EP2A 2F43B 3W90A 5FOTA 4KHZA 4BBRH 4B6FA 4KFRA 4DNRB 4H13C 1TU2B 2FNAA 2WWIA 4N0EA 1G3IA 521PA 1GUTA 1E9AA 1CU1A 1G3UA 4JI2Q 1QHIA 3L7ZC 3B13B 3KXIA 5KTYA 1K5DA 3O47A 2CL7X 5L8VA 3PV0A 3HOYH 1TEXA 2YWEA 1YNNC 5IF9A 2JA7H 1GNQA 1AZTA 2OFOA 3NEJA 4NDZA 4DDTA 4Z8XA 2VF7A 2GTPA 1Y8PB 2IYVA 2MSCB 3CNOA 1C7YA 1OFIA 3BRWD 3DL0A 3H86A 4MDFA 2CCKA 4GNXC 5B2ZA 1DEKA 4KN7C 4LC0A 4HJ7A 2EFHB 1KAWA 4EFMA 1VIYA 1FR3A 1YZUA 2JEBI 4B47A 1J7KA 2B8TA 3QG5A 4PPQA 4PPGA 3HOUG 2VHCA 1CJTC 4NKRA 1E2FA 2CK3A 2A5DA 3IHWA 5JECA 1NBME 1DVRA 3ASZA 1D7QA 1KAOA 5JHHB 1MJCA 4A2QA 1E2NA 2WOOA 1P2TA 5KHOC 2AR7A 2JA7G 3F1ZA 3G4SA 1FNNA 1ZNZA 4A0GA 5C0XH 1CSPA 4BQSA 2Y0SE 2CCJA 3FMCA 2O0JA 1G7RA 5DLQE 1TF5A 2A1AA 3RN5A 3LBHA 4PQYA 4AD8A 4NTZA 4IFDI 3QUSA 3H4MA 4NZYA 5AUNB 5GJWC 3IBGA 1OFHA 5FPSA 1VQAA 2DUDA 4ZIRB 4D0GA 5BR8L 3CF5A 1T9HA 4PZLA 1Y1VH 2D3WA 1G41A 3CR7A 4WZBE 4EAQA 2DFNA 3CCQA 3HPQA 2Z6KA 2E1RA 1NJGA 2Q0HA 2R6FA 3HYTA 1H8HD 3EX7C 1E94E 3MJHA 4HR7B 1GITA 3E70C 1CRPA 5C0XJ 1S2MA 2FGJA 4GFDA 4HJ9A 4TL7A 2K33A 1UE5A 1KHTA 2R6AA 2IYWA 1FX0B 1XTDA 3F2DA 1JR3E 3PR1A 1HZBA 2BEKA 3ZGXA 4CEJA 1MABA 3A4LA 2BH8A 3DM3A 2NVTH 1OIXA 2JE6I 3IKJA 3L2PA 1SULA 4WXPA 3VFDA 1NTGA 3A1SA 3FHWA 2QUZA 3JZAA 1EQQA 1EFWA 1B9NA 1VQBA 3R8CA 1IN7A 4HZUB 5B64A 2E5LQ 4IJHA 2D4HA 1QUQB 1Q81C 1UBCA 4JV5L 2I3BA 1D6JA 1E4YA 1GNPA 2ZR9A 3LGJA 3DMNA 121PA 4DR2L 2R6CA 3THWB 5CLLA 5LMNQ 4H02A 5LD2B 2HHHQ 2BMDA 2IHBA 1IN5A 3GJ4A 4V0LA 1V43A 1E32A 1W36D 1CJMA 2IUTA 3V4RA 4OWTB 2N46A 4D26A 3GTGH 3AVXA 1U0JA 4TSFA 2ZYUX 3VR3A 2NZOA 2VZAA 2ZJYA 2AFHE 4PSAA 5DI3A 1JJ2A 1L1OA 4IQZA 3FVQA 4DUGD 3CCSA 1VCNA 3QI2A 4B32A 2FPKA 5D3MB 4IEIA 4TT3A 1UM8A 1OJLA 2C99A 3K0FA 2UXDL 4MRPA 4C0QC 5DNYB 3BU2A 2OTJA 2UU9Q 2AL7A 1G4AE 4ZO4A 3A58B 3U4QB 1M74A 4LJ7A 1X54A 1R4AA 4ACAA 1G8GA 3P26A 2QGQA 4B73A 2VL7A 4YXWA 1E1TA 4B3DA 2QTVB 3KB2A 4DR3L 2B8WA 2ZSBA 1YZGA 4M9QA 2O8CA 4WVFA 2ZJQA 3MXNB 5HTKA 3CO5A 4DT1A 2O8DA 2AK3A 1IXZA 3CPWA 1F2TA 5BN4A 1OB2A 1IJEA 5LBIA 3PG5A 2QMOA 1W4CA 2DCUA 1VQ5A 4GMDA 4IFEA 3AEZA 3EARA 2OQKA 1HH2P 3KJHA 2OBNA 3LO5A 1WBDA 2JGNA 1D5CA 3LV8A 4DK1A 4Q66C 4JI3L 1Q82C 2JIZA 3SJZA 4DLXA 2QBYB 1IBML 4F91B 1N5KA 3A37A 2QA5A 3PO3G 4H9GA 3Q85A 1VHTA 3TR5A 3CBQA 5EAYA 3L0SA 4HZIA 4TTRA 1NN3A 1S1MA 2O52A 1CP2A 1LNZA 2KA7A 4B34A 4TLAA 4GNKA 1VQPA 3CD6A 2FH5B 4RD2A 3TAHA 1CJUC 2PT7A 3I4OA 5G3ZA 1YR9A 5AJ3L 1TADA 2AUJD 4JVNA 5FOUA 4JI5Q 2A8VA 1U98A 2XOKA 5LMNW 5E3HA 1BH2A 5M5XH 1P3JA 3B60A 4KYUA 3CMAA 4LFAL 1PH5A 3K0AA 1B70B 2H18A 1GUOA 1YIJA 2AHOA 3PIOA 2XSZD 4IVQA 4ITRC 4EKDA 2VSXA 4LUOA 5IYCG 2GEUA 1I6VC 4FCTA 3S1RH 2B92A 4WBSA 4DUGA 5JS8A 4F4IA 3E5HA 4A9AA 5IT9c 5JCPA 1VG9B 2FSIA 4BEBA 2P6UA 2W58A 3AKDA 2OWOA 2NMVA 4NYMR 2GXSA 1G17A 3CF6R 1WI5A 1Y14B 4YWKA 4A3DH 1HT1E 2ODNA 4KFTA 5GVRA 1EIFA 2BMJA 1OXXK 5LMUL 1T0HB 1UBGA 2J0UB 5FPHA 3M3YH 1E1QA 4XD7A 4GOPB 4RJLA 2GAAA 5EXXA 5C4XG 1MH1A 1KDRA 3A1WA 1YHBA 3R9IA 4QL3A 2V1XA 5G53C 3FPPA 4ZKEA 1SFOH 4KLKA 1AS0A 1G3RA 3RRMA 4M1TA 2R7ZG 3LNCA 4KBFA 1CSQA 2KB0A 2V6IA 2PCJA 3CCEA 3BJIC 3H3VI 3FKQA 1I6HH 2BV3A 3FMIA 2J9RA 2NVXH 4CEHB 3TAUA 4AKHA 4RD1A 5DH9A 2J7PD 1FMJA 3LBIA 4GDFA 1NKSA 2BMEA 2GK7A 3I2ZA 2KSQA 2QU8A 2J87A 4MKHA 4L9WA 2RGGA 4OQMA 4QQBX 2IY5B 2QTFA 3QEOA 2PMZE 2UUCL 3GJ0A 3FDIA 2WJIA 3IIJA 3CB4A 5IRCD 4TMVA 1IXRA 4DV4L 1VHLA 5IT5A 1EGAA 1H8HA 3W5OA 2FOLA 1E9CA 2CFMA 1A7JA 2UZ3A 3CRRA 4Q4JB 4M9ZA 1G291 1NP6A 1Y1VG 1EFTA 1EK0A 1XTQA 3Q8DA 2F1RA 2JJ1A 4MITA 4K0KQ 3CPFA 2YWGA 3AYHB 1GL9B 4YONB 1CBUA 2XTNA 2WJYA 3LQQA 4Q9KA 2FGKA 4F92B 4ZCLA 2Z0SA 4Z1MD 3RHFA 3PGZA 2FV8A 5AUPB 1SHZA 4IDQA 4K46A 4YC7A 3REFA 1Q12A 4KI0A 4AKGA 1R5BA 1NN0A 2GF0A 4DV5L 5CK4A 4A4IA 4PZZA 1J90A 1HNWL 1CF4A 3OIVA 2XX3A 3P27A 3R8FA 4X65L 1O78A 3OTOQ 1IM2A 3CCJA 1J8YF 1KZGB 1SVSA 3A8IE 2OT3B 4Q4LA 3RC8A 1KJYA 5AJXA 3W6PA 1XMSA 4YXWD 4A3BG 2GVBA 3BJUA 2GXQA 4YDHB 4DR5L 4JI6Q 4JLJA 2RB4A 4CT4B 4DV3Q 1FL9A 3DHWC 1SMXA 2BC9A 2ZUCA 3CONA 3QY0A 3K81C 1RL2A 2Y8EA 2WKPA 2FDCA 2VQEQ 3PUWA 2PQAA 2XNDD 4B35A 4IDNA 3U9SA 4PFSA 4DV5Q 3ZQ6A 1QG2A 6Q21A 1XTJA 3THYB 5JSZB 1A2KC 4B3RQ 2F1IA 2ASEA 3N70A 3EXAA 5DYGA 2G6BA 2G83A 4YY3L 5EJEA 1DD2A 3S1QH 5DIFA 1UBFA 4GZYC 3BWDD 2IYZA 3SS8A 2ZEJA 4JI6L 2Z5FA 1UKZA 3AKYA 4H1VA 4JKIA 4DIEA 5GAHC 4IOCA 1GL6A 4L8GA 4A3KH 2GKSA 3CNLA 1VQMA 3S1MH 1G1MA 2CLDX 4YMVA 1X8JA 1XCPA 2NOAA 4I1VA 3O8DA 1G18A 4UKDA 3R7WB 1FQKA 4LUZA 3QXSA 4H44C 1NI3A 2D2CC 3JVVA 4URWR 2XB2A 4B3RL 3A8JE 3TRZA 1LS1A 2ZT9C 4X66L 1GKUB 2KCMA 4YY3Q 2WJHA 4MRVA 5G41A 4DKXA 1YVDA 2ZRFA 1Z0JA 2NVQH 3B9PA 2A5JA 4Z1MA 4DXAA 2XAUA 2H17A 3FP9A 1HR0Q 2Z83A 2EW1A 1XMVA 3TK1A 3VU9B 4F4JA 4OHWA 3SI7A 2QF7A 3PFIA 5KSPA 4C0AC 2AKWB 5KPJA 1K8RA 2XB4A 5CIQA 2P2LA 2OLJA 4LBWA 2ZE6A 1YHQA 2IYRA 2ZROA 1XXHE 2DR3A 5KOYA 5TARA 4A3IH 1U81A 5IK2A 1ZUHA 4L5RC 1L7VC 1TQ6A 1R2QA 2HJVA 2PLRA 1YU9A 3K7AH 2F52A 2QY9A 4A75A 1F60A 4LBVA 2JLXA 1R0WA 1LVGA 4OL0A 2X8AA 4IKEA 4IVRA 4ZI3A 3R20A 5HCNA 3BG3A 3U4ZA 1KQSA 3VMFA 4NHOA 4DLYA 1VQDA 2VRWA 2EJMA 3WP1B 4JLBA 5B30A 3FKIG 3CH5A 2VH5R 1X8KA 1XPRA 5KPDA 1JJVA 3M4OH 2H5XA 3KDFB 1VQNA 1UADA 2CVHA 2OE2A 3MSXA 1FX0A 2RGDA 1UEIA 1E1QD 5CDFE 4NCNA 4LRWA 2E2HH 2UXBQ 1E2QA 3KLWA 2AK2A 2OCAA 5L3RA 2O5JC 1TNDA 1OB5A 2JDIA 4A82A 5BN3A 5J40A 4PQFA 2QM8A 1XEFA 1PYBA 1PMRA 3M1IA 4KITB 4BFZA 2ONKA 2FPMA 4BRWA 4DT1B 1Z0DA 3LW7A 3LW8A 1E2ZA 3TS2A 3PQCA 1Q44A 2DN8A 1VQCA 4QGAA 3OOCA 3I4LA 4FN5A 2XSZA 3AVWA 2A6ED 1E2EA 4O0AA 1NSFA 2V6JA 5DN6D 1K3RA 4DLTA 2KBFA 3QF4A 2VP5A 4QBIA 4A8JC 3ZZTA 1Z0KA 4JI8Q 2YTXA 4Q4JA 1VYUA 3SNHA 3SYNA 1IYJB 2ZM5A 2F3TA 4P71A 1KHIA 3KZ1E 3ZVLA 1SXJB 1V1QA 1L1OB 1QHXA 2GWHA 2X77A 1WB9A 1COWD 1YZNA 4DV7L 5DI3B 4EQ5A 3SBEA 4DSNA 1II9A 2WIBA 1PVOA 1HE1C 1YZQA 2LKCA 2W0SA 2Y0SG 5JZVA 2R6DA 4JLDA 4I1SA 1KZ7B 4TL9A 1CJKC 2IF2A 1U9IA 1KK2A 2PEZA 1W4AA 2FPLA 5GADC 2BH2A 2C8VA 3DZDA 3EZ2A 4JZKA 1UJ2A 2ZYTX 3OE7D 3KFUA 1OXTA 1GKHA 3CX6A 3U3RA 3W8RA 1UKYA 1VG0B 3VDYA 2B7CA 3IIKA 4HB0A 2XTMA 2NO0A 3BBPA 3I3SR 3HOVG 1Q7YC 4RFVA 1MO5A 5FL7D 3NBZC 2IS6A 1KO8A 2R93G 4A3DG 4A6XA 3ZZ0A 1OFUX 4A92A 2KHJA 1Z6YA 5AJZA 5L3SB 1YRAA 1E24A 3CX7A 4KVAA 1Q90A 1HNXQ 3K9GA 3UKDA 1T3SA 3J81j 3STBC 2BKUA 3KFXA 2OO7A 4HAUA 4LOAA 5GQOA 1KNXA 3LH5A 2ZJ8A 2GBLA 1SVIA 1MKHA 1DE0A 1JB1A 1YJ5A 2MNAA 2LCFA 4QNMA 4KCGA 3I4NH 2O8EA 4OGQC 4LJZC 4LK2A 4X62L 1IY1A 3BAFA 1Z06A 1IBKL 2IBMA 3KKNA 5JEAG 3W1BA 4KHPQ 5EXSA 4E03A 1M7BA 3GTMH 3KX2A 3K0AB 1U2RA 2F9MA 1U99A 3LVQE 3MCAA 2EQBA 2BM1A 2ZS9A 4CF7A 4HLDA 3CCLA 3BE4A 2E74C 3N2IA 1GVNB 2ZI4A 2ODWA 3TIFA 1U9IC 2AUKA 1R10A 3EWSA 4EJSB 1AJEA 4GZLA 4CT5A 4ERNA 2EYQA 2IYTA 3PCRB 4W9MC 3K80C 1SZPA 4PO8A 5KDLA 3U7HB 5TVKA 2AWNA 5JBQA 3FMFA 4C0BA 3QKSA 1B9MA 1IBKQ 4IOAA 3T1HL 1XFAA 4A3JG 1JALA 3QG1A 2PH1A 2Q9CA 4DUZQ 1LFDB 1W48A 3T1QA 3CIOA 3OZXA 1GUGA 1E2VA 3AEVA 2VBCA 4OQLA 1B8AA 5DSZA 4QM7A 2GEDA 1X1RA 4DK0A 1NY4A 4LFCL 4AG6A 2IYUA 3AH8A 4LJ9A 1F2UA 2P0EA 1XTSA 5BN5A 2VP2A 4A3CH 1XXHA 1KI2A 3T1OA 2I0QA 3W9YA 4A3JH 3ZVRA 2YHSA 3MWLA 4LV6A 4BLTA 4GS3A 1KGDA 1Z63A 1QHSA 2EWWA 4A36A 3T1HQ 4PHGA 1XJ0A 4C9BA 1MR3F 2Z43A 2O8DB 3DKVA 2JJ2A 2HEIA 4PAMA 5IYDG 2JQOA 1E0JA 3OF5A 2FEOA 4ASUD 4QFMA 4DSTA 2YWHA 3TSZA 1VKJA 4ZDKA 3TUZC 1N6OA 2MFIA 4HAXA 1V9PA 5EE3A 5IY0A 4A3KG 4KXFB 1KO7A 1L2FA 2VQEL 1TX4B 2WPDD 3F2CA 1HE8B 1E9SA 1E22A 1LTLA 3E9IA 4HB3A 4PTLA 4C7OB 4L5QA 4GOXA 3VAAA 4JKYA 4LV8B 4Q02A 4PZ6A 2IHEA 1R0XA 1WP9A 4OYHA 2C35B 2OBLA 2FG5A 2ZTEA 2IA5A 3EIEA 1T5IA 3M9BA 4Q1FA 4POFA 1IBMQ 4BFXA 1GUAA 4N0DA 4R4QA 4Q9JA 1CKOA 1D2MA 1W5SA 2GCPA 1ELOA 4JI2L 2VQSA 4U5XA 4E09A 3PSIA 2OCPA 3RAPR 2ZJOA 1YR7A 1A62A 2X2FA 4Q03A 4YMWA 2GCOB 3KQKA 3I92A 4AH6A 2HJGA 4G1UC 2PZEA 1S72A 1EFCA 1FZQA 3A4MA 4JJZA 4UNRA 1B0UA 5GJBA 4B3XA 3WBKA 2K75A 2PBRA 4QJFA 1Z9FA 1A5TA 5K36H 3T53B 1KI6A 1XJCA 2ZE7A 1Y69U 3AKEA 5HE9A 3PEUA 1W3SA 3SBDA 3C4JA 3MRSA 3RDPA 1MV5A 1XJQA 2OBMA 3KF6A 3TZUA 2VQFQ 1CKEA 1V5WA 1ZIOA 3U50C 1Q22A 3B5JA 3CKLA 2NN6I 1AA9A 3AV0B 1YZTA 4XSHA 2PNRC 4BXXG 3BH7A 3CM0A 1SVLA 3OE7A 2WWGA 1XTKA 2R44A 1AZSC 4JSTA 4RD6A 1SVMA 1GVPA 3GJ8A 3HOZG 2EVBA 1SLJA 1E2PA 1G5PA 2NO1A 3HYRA 5FUXA 3VR4A 2PQAB 4A15A 4ESVA 4NPHA 1PLKA 4R1JA 1L1OC 4AC9A 1T3HA 4URXR 2NVYH 3ZJYA 3HDTA 1YZLA 1GILA 1E9BA 2HIXA 4DV1Q 2VQFL 2X1VA 2R7DA 4IPHA 2ZR0A 2R7ZH 1XEXA 2AKAB 1D9XA 2JJ8A 2GCOA 4C3IH 4NXNL 2UXCL 4JT2A 3TR0A 1KDPA 3K7UC 3AVUA 1PH2A 1HTPA 3LX8A 1WF3A 1GWNA 3SJCA 4B3TL 3GEHA 5C4MA 3E9HA 4HDOB 2C98A 4AYXA 4KBGA 3UG6A 4D82A 3LBNA 2QI9C 3VKHA 4B3ML 1HEIA 1QDEA 4KFUA 3NENA 2BE5D 4TYNA 1BMFA 4HLCA 2ONJA 2NO6A 3GLHE 2XTZA 5EP3A 3PENA 1KIXA 2OFXA 3FTQA 5EZ5A 2YOFA 5BXQC 3T56B 3HKSA 4XSGA 2QT0A 4QOSA 3VNUA 5FLMG 1XDBA 4GT1A 4BWYA 4QGFA 5IWAQ 1M2OB 2QAGC 2QN6A 5FBVB 4XD7D 3Q72A 4LJ4A 2W0MA 1P6XA 5FOVA 2R62A 4OQXA 1ZU5A 2NZHA 2CLSA 2BA0A 1GIAA 3L0PA 3LRPA 4ZPXA 2E5LL 3E1SA 1Q3TA 5H68A 4OHXA 1Z28A 4OWWB 2P6RA 4MRNA 1IY2A 4O2RA 4PC6A 4BPBA 1XXHB 1H9KA 1K8AC 1E2JA 1YHNA 3UMSA 5K8LA 1EIYB 4CEHA 1Y1WH 2OV2A 4QHTA 1W44A 2IL1A 4LWCA 3LD9A 4B3FX 4A3IG 2XXAB 5GVSA 3G6EA 2ATVA 3M4YA 3RZOH 1KO4A 1ZUIA 2WICA 3MD0A 2BE5C 5C46F 3J81c 1SVKA 2IEZA 1WCMH 1M8PA 4QBFA 4Y52H 1GNRA 1QG4A 3ETLA 4GN5A 4KU4A 1VQEA 3UE1A 5FBWB 2UUBL 3N6RA 2K14A 2ZM6Q 1JQJC 3QKSB 2Q2UA 4WXRA 2RAPA 2UUAQ 3QJYA 5ELNA 2G0TA 1KSGA 3NBHB 2ZI7A 1CTQA 2JA9A 2PI2A 2F4VL 3GTQH 1LF0A 1VQLA 1P73A 3FKSA 4QG7A 4US0R 4P75A 5FL3A 5SZKB 1UE1A 4Q1EA 2OXCA 4P0TA 3HJNA 2UXDQ 1X56A 1YJWA 4PAOA 5EE0A 5GAGC 3L0IB 4A93H 1W5TA 4LHYA 2GXUA 1FMLA 4G3XA 3B6EA 5H70A 5A0FA 4DEYA 5HPYB 4BY1G 5IYBG 1VQKA 4BXXH 2Z4RA 1WXQA 1YI2A 2CHQA 5FTJA 2YVUA 3WP0A 1BBWA 4DCNA 4KYIB 4X8HA 1FGUA 4DR3Q 1D8TA 3T51B 2JLWA 4BBSG 1R8SA 4F7WA 4AQYQ 4TQ9A 1CLUA 3S16H 3WWVA 4KLNA 1NG9A 4A2WA 4DUYQ 2YU9H 5KSOA 4L8JA
chains in the Genus database with same CATH superfamily
5E2BA 2CK3D 3OQMA 3J80c 4REOA 3BYYB 1PYWD 5D7BA 1J0DA 1DX9A 3LUFA 4RD0A 4ABYA 1HO3A 3D8UA 4FXPA 2XTJA 4ZI2A 1OYOA 2OP1A 3OU7A 2GZAA 2IU4A 4F71A 1DCTA 2XUFA 2UZ1B 3PQ3A 4EPTA 4Z3KA 1SKAA 2PXCA 5JH7B 4Z8YA 5LWHA 3HRHA 4DR4Q 1CUYA 5AVVA 3H04A 3HP3A 2MO0A 3T3MB 3K5NA 4FYDA 5LQKA 2HA5A 2W9XA 3C6BA 1Y5IA 5ALGA 3ROEA 1SPBS 1XN1A 1NMXA 2GYYA 5FI5A 3KR9A 5GONA 3TZHA 2JIDA 2EATA 3I42A 2VJQA 5JVH3 4DM7A 3DMDA 1U2SA 3WK6A 2XVMA 3OPQA 1ISGA 2GN2A 3O4JA 4A3MB 3H5RA 1E63A 4EQNA 1LM0A 1RWNA 2E4VA 1Z88A 4OKIA 4UQOA 5AIAA 4IUDS 1U7XA 3OD1A 4J6FA 2YASA 9ATCA 3INNA 2O5VA 4QYSA 2C5BA 2ZWPA 1VIAA 4JC0A 1C3EA 4M8SA 3LX0A 3DC7A 3U7GA 2ATCA 3ZOZA 4IH1A 4NDAA 2LDXA 3R7BA 2OXPA 3HZZA 4EIWA 1MI2A 1EHCA 2WAQB 5ELCA 3AONB 3NTLA 1GPDG 2Z6VA 1JXOA 2WD7A 4JEUA 1Q3KA 2OEPA 4IFBA 1BBXC 3N07A 2WOJA 3COVA 5KQRA 3OQNA 3C3MA 2PBFA 2WD9A 4OQZA 4DAMA 1N92A 1GHJA 1CUDA 1FEZA 2PX8A 3DAFA 1ZI6A 3EPRA 3EUWA 2B63B 1DLJA 3JAML 1PRYA 1ZS9A 3AU8A 4L76A 4BMZA 4DDUA 1Z6HA 2YS6A 2UZIR 3SZGA 4JBWA 1L6IA 4DLVA 3NUCA 3O83A 4U63A 3QX8A 3G17A 3THXA 5CFRA 4KKUA 1Z18A 1ZQ1A 5E1BA 5TS2A 5HKAA 4G7OC 4OB6A 2QAJA 3GJ5A 1U2EA 4EPRA 3FPEA 2A1TS 3OMLA 4CG1A 4O4LA 5U1PA 3L1VA 3VI4B 5IXJA 2OHHA 3W2IA 4HVLA 5K7SA 3AF2A 4B81A 1CY8A 1B3BA 3EVFA 2EIHA 3MCTA 3T3PB 4L02A 4EY5A 1RAEA 5DXFA 3WGHA 1SCJA 3FLEA 1CUZA 1IULA 4MR8B 2B2XA 1K08A 1OLXB 1GPAA 3RYFA 1NLFA 3IP1A 1GUWA 4JP2A 3NS7A 4V0MA 3SS7X 4B9EA 2RG1A 4AJ4A 1PYSB 2FMUA 2VXWA 2BGLA 3M7NA 1CETA 5HF6A 1AKEA 3IOYA 1KORA 4X71A 1EGQA 4ZDWA 4DR6Q 3FGZA 4Q4AB 1RM5A 4E21A 1R4NB 4N3CA 3TFQA 3ZU6A 3GWGA 1JEJA 3I1JA 421PA 3MTEA 1P2GA 4HDSB 3OH8A 3R93A 3NORA 4B6JA 2ZJZA 3UK1A 4FDUA 5BSEA 1K6XA 1XAJA 3QV2A 3TS1A 1XJWA 3W3AH 1FTWA 3EW7A 3DB1A 2QD3A 1WMEA 3JU3A 3ZE2B 1BC5A 4P0QB 2C8JA 4IXDA 4HUQA 3T7KA 2AC2A 1WTHA 4H27A 4C3IG 1OD6A 4IHJF 3EXHC 2E87A 1VRVA 1YRLA 2QZ4A 3FPSA 3FTFA 1BG6A 4PO1A 2CGEA 3QLVA 3SYMA 2OBXA 1L5LA 1GCIA 3DD5A 3IBCA 4WZZA 4HADA 1EY7A 2AEFA 5HBGA 1PFVA 3R23A 5LQAA 1K7FB 1NIJA 4DLSA 1HGXA 4G1CA 3HKZB 4E6IA 4RJJA 3TTTA 4F46A 3GP8A 1EU3A 1Q8KA 4H0LC 1KFKB 1W85B 4JUBA 4DMRA 2IVZA 4KAJA 5B5SA 3J7A5 1BAPA 1Q3HA 2EW8A 2IDZA 3ROPA 1HV8A 4X7RA 4BC1A 1EVYA 1TMGE 1VSUA 3ANSA 2NBFA 4TLEA 4Z9BA 3O84A 3RUDA 1AG9A 3UDGA 1F0PA 3MTDA 2C31A 3WE7A 3EOAI 1MOZA 3LM8A 3EGVA 1GPNA 1Y4DE 1K8OA 1N0IA 3SLRA 4J0FA 1NBHA 4FZ3A 4AKSA 3EC1A 2IH5A 1XL0A 1FTSA 1MKYA 4TMTA 1AGYA 3HNOA 3WWCA 3K30A 1LB1B 3HUDA 2COUA 4P4SB 4XD7A 2PGDA 3DBHB 3TLYA 4CMKA 4KY5A 1P33A 4QQKA 5EMHA 4K81B 1QZTA 1E7ZA 1NN1A 1P6QA 1ML4A 1NXPA 1ZJ5A 2HRCA 2JKYA 1BQ3A 2EFDB 3LYHA 5TDHA 2GN6A 3MTAA 4HJAA 1L1FA 2A5LA 4EPXA 5DE3A 1N5RA 2JPDA 1XQ9A 2PUGA 2P41A 4LYDA 2YUIA 2DJGC 1ZGJA 5IC4A 3WKAA 2OD9A 1Z8DA 2PUCA 4DFAA 1EP2B 1PGNA 2UV8A 2HUPA 3CPEA 2C2MA 3EHEA 5KYYB 2Q2HA 2R8XA 1GFIA 3A3NA 3QWIA 4FUTA 4Q3LA 4EPVA 4O4JA 1UT6A 1SKYE 2P4EA 2YXPX 5AH0A 4YMUA 2B21A 3GTGB 1YGYA 1H95A 1M6WA 2FE1A 2QENA 4Y6GB 4GF5A 3H6MA 2BGIA 1NI4A 2C88A 2WIKA 2BEJA 3CZAA 1BKYA 4LZWA 3Q7PA 1VQFA 2ZIUB 5C2JB 1L3CA 3E7DA 3TL3A 3IBFA 2JF0A 3K6SA 1MO6A 1KLGD 4I9NA 2J4FA 3IMKA 1ZXXA 4MR8A 1XR3A 2I1WA 1EDBA 4V190 1JQEA 1PEYA 5CM9C 3E3MA 4IJKA 4OGGA 2O2EA 1TTPB 2P1RA 3BORA 4I50F 5EC8A 4ZC8A 2QX9A 1LSOA 3OMXA 1NI5A 4MRMA 5IGDA 1P5RA 2CQOA 5JARA 4RHRA 1B1CA 1D0VA 3LLSA 4NU5A 4GRDA 1V45E 3N6VA 4LNHA 4AYWA 1DAGA 2O6LA 2R8BA 4MMXB 2E2JH 1O9GA 1XA3A 4IGFA 3RTEA 3S70A 4C7VA 4D42A 5JWOA 4DNOA 1U8YA 5J1TB 4W8GA 5PNTA 4OHZA 4RPCA 1V7CA 1A27A 1C81A 1JDSA 3IAUA 4JBXA 1GTMA 4Y0VA 5A7HA 4BFWA 2FU5C 3H13A 4L4SA 4HIDA 4X64Q 2I46A 4EKNB 4NQZA 3I62A 2QV7A 3AERA 5CHYA 4UHFA 3MTIA 1RADA 3BD8A 4I66A 4QOFA 1QUQA 2ECPA 4LQLA 4TTSA 5A3RA 3EA0A 4MGIR 4CLOA 3QPBA 3E22B 1RP7A 1W4BA 3S2FA 4UUAA 2E85A 1F0YA 3BSFA 1UK6A 3FSEA 3G0GA 3BT7A 2FSVC 2LGJA 2ZFUA 4Y98A 3M82A 3ZDRA 4LC1A 2A5YB 3ZW9A 1WCYA 3EA6A 1XPOA 3HU2A 4H3SA 5DP1A 3GLHB 1JHDA 1Z5ZA 1W5AA 3CXUA 1IL2A 1DX6A 1K3FA 2P5SA 2B7LA 4D96A 4DLRA 4PLWA 2PRSA 1SXJA 1XNQQ 3RARA 1W0KD 2B1IA 2YU9H 3P2MA 1RQRA 4JUCA 4XR4A 3VDMA 5BSWA 3GLQA 1XC7A 3O4RA 3K71B 2XN9C 4CGYB 1I5FA 3FR7A 1W4LA 3Q5GA 2FDRA 2B2YC 2N78A 3MGAA 1ZJYA 4M46A 2ZW9A 4DL9A 3C74A 4ZCKA 3RT9A 4MDHA 3WGMA 2XWBB 3H9GA 3K2BA 1ZWKA 1C4XA 4P3OA 4QO7A 4R8LA 2YMMA 2L18A 4W7IA 4ZEWA 4EA9A 4Z5XA 5C7OO 4JI0B 3AUYA 2GM5A 4AIMA 4Q5VA 4B46A 1PU2A 2MJ8A 1DZ3A 4FJ1A 4MUNA 4C2UA 3WYEA 2Q3JA 2W2LA 1JEOA 3ICCA 5DLEA 5C1BA 2OQ0A 1P2VA 1Z6GA 2XUKA 1CFMA 2YUTA 4R8NA 3MIZA 3MT8A 1TXGA 2QNRA 1SBNE 5DF1A 4E2FA 1S3SA 3GVHA 3NXWA 1HZZC 4MGYR 2I6UA 1LNSA 2Y2VA 3MFYA 1MO3A 1U5BA 1T15A 3MUOA 5E3JA 1A9RA 1P4GA 2HZBA 2KI5A 3EG5A 2IYPA 4MR9B 1SBQA 3FNBA 1LW6E 3OZDA 4N8SA 1E69A 4IRUB 3GP7A 1ZBDA 1RXSA 4BNLA 4KN4C 1K89A 4EFNA 4Y3UA 4X3SA 4IUBS 4M53A 3FSGD 2WB1E 2G9VA 2KHZA 3HY4A 1T2UA 2EJCA 3QTLA 2GZHA 5LA6B 4AIRA 2VP6A 2ZJBA 5DU2A 4DILA 3NOVA 2LIVA 3RADC 1OXUA 3OW7A 3G7SA 1KARA 4QJ4A 2W2KA 4FP5D 4N82A 1XWFA 3E15A 4UEWA 2F67A 3GJ7A 3BIFA 3O91A 4I5IA 4KH0A 3QBJA 1JB9A 4LWPA 1N4AA 2H0RA 3SG0A 4QZVA 5HE8A 3SPXA 1HA3A 1YS1X 2BFDB 5REQA 2RAFA 3WNBA 1NVXQ 1WP4A 3Q7TA 5JSYA 2ORWA 3T4XA 4CM4B 1T2FA 3NUZA 3FCCA 1Y82A 2JBAA 1BX0A 4DDVA 2IJ0A 4PCUA 4MV7A 3R7AA 3LX5A 1E66A 2VF8A 2IODA 3OFSA 3OVMA 4BP3A 3ZD8A 5CMLA 5J4YA 3OZAA 4QDKA 5DFAA 5FX2A 4G23A 4PG3A 5J43A 1JNYA 5KAPA 3HCBA 1SBZA 3T06B 3W9BA 1SN8A 2C9OA 2WWFA 4XM2A 1AHNA 5KNDH 2ZCJA 1JLLA 4UP7A 5EPKA 1LRKA 1V37A 3S2HH 1STAA 1I6MA 1ORRA 1TL7C 2X2EA 4I6GA 4PBRA 4Q6WA 3V1KA 4B8WA 3TVDA 3WK5A 3ZW8A 3QVKA 4UQLA 2BTOA 2OGWA 3NSWA 2UUAL 5A35A 3R3ZA 4HQ0A 2VHXA 4NESA 1G7TA 4H16A 1S9HA 4PCVA 3P9QA 1R4NA 4B0PA 4IKOA 2ZUSA 3I73A 4C0KA 1R0KA 2H2GA 5FUBA 3RG8A 4UQPA 1XZJA 1OLUA 3J80L 1I51A 2DHRA 3RYCB 1Y1TA 5EY5B 2CMGA 3GDEA 4R1TA 4JC8A 4G4IA 2CYAA 1N36Q 1TUBA 1R66A 4HLUC 1T8WA 3F2UA 3MAQA 4LXYA 1E1CA 4QIWE 1NNUA 3E9CA 4P82A 4HC4A 4AUMA 3D8GA 4A93G 3PI7A 2IEGA 5DLQC 2C5LA 2WAAA 2X3UA 5EFZA 4C0WA 3L82B 1TJYA 3GXOA 4M9SA 1WPGA 4U7TB 5BSFA 1PCXA 2FE4A 5HRUA 1C8KA 2AC4A 4ZVSA 4ZOLA 2M6SA 4TUYB 1GR0A 1IJFA 3EDMA 3ZD6A 4IOJA 4YJDA 4C3VA 3VHXA 1H0HA 1TZBA 3QELB 1S7GA 2R7AA 2VXOA 4QYIB 3HR8A 4MUFA 1PFSA 1NF2A 2L9HA 1N3LA 3HB0A 5MN5A 4GXRA 1X86B 1C2TA 4HR7A 5J2TA 4DRXA 3H2BA 4JR1A 1LPPA 4U68A 1VQ6A 2NQ8A 2WMOB 3G5UA 4GM4A 4R2JA 2CV0A 4MVJD 5BXYA 1V2HE 2XJ9A 2R1VA 1Q0QA 3EZ6A 4BLSA 3DZIA 3QVMA 1Z12A 5LXTB 3P97A 1H9SB 3L0ZA 2JKVA 5LLDA 4BFSA 1LDMA 2HMYB 5K99A 5CB4B 1M6VB 4HDQB 5EE5B 2KHSA 2HU5A 2W2QA 3V7FA 4ZIRA 4DIOA 2BMVA 2IZ5A 4HEA6 5ICCA 2ZYWX 5FTMA 3TNDA 4DV6Q 5C0XI 1R0ZA 3NT5A 3K8QA 1NJIC 1C1XA 4OKSA 1CTMA 1M66A 1P16A 1PH9A 3ABRB 3GMIA 2NZ1D 2CUZA 4HDMB 4RSMA 2IY7A 1GRCA 2OPBA 2X5KO 4U5QA 5H4GA 5IWAB 1RABA 3ZY3A 3JWEA 2ZULA 3WLPA 2G77B 3QIAA 1H66A 3PUIA 2C2HA 4QTZA 3STBD 3I9OA 3F7TA 4V0RA 2DFLA 2I54A 2Q6VA 3GC6A 4E2XA 4LF6B 2F0LA 1LUZA 1EFVA 2YWCA 3FPKA 4B4WA 3WGIA 1TZ2A 5E9AA 4LFAQ 3CPSA 5B7GA 1EFID 3JYHA 3CLTD 2BRUA 1BFDA 3CW2C 3HZRA 3PITA 3IUYA 1Z4IA 3VHRA 2CXHA 2FHPA 4WK2B 3RK4A 3UEOA 1U8TA 3JASA 1G59A 3DHNA 4RKEA 5IIFA 1VPLA 1DFHA 4BJHB 2C7OA 2D1FA 1QGDA 1ZYRD 2E4YA 2A33A 1Q5PA 3QKRB 4PPFA 3QKIA 3EZLA 4KIFA 2NO9A 1CRWG 4UTRA 2EJVA 1BCRA 2QW8A 3DZHA 2K5VA 3QEJA 2BUAA 3NEAA 4BPRA 3ONDA 4DSOA 3KSMA 3UJAA 3CC2A 3IAAA 2VDVE 4PINA 3TKAA 1RF2D 2ZSEA 4JI4Q 3VR1A 3ZHOA 5I7EA 1GAQA 2CEAA 3CX8A 4YR9A 3S17B 1IZYA 1P3Y1 3KYCB 4GP6A 3B38A 4UDXX 1QLHA 1N7IA 1QKIA 4L57A 1QQTA 4IY1A 3V55A 3HI6A 3JAWB 2WFAA 1N1EA 4XOIA 4CKBB 2ZUWA 1BE8A 3FNRA 10MHA 3CIFA 1RIFA 1TEHA 3F71A 4RELA 4AF7A 1CUVA 2O2JA 3B7WA 3OTOB 1JTFA 4AS1A 1Q14A 1W25A 3H2ZA 5IJAA 3KAJA 3R6GA 1YFKA 4CJ2C 2P68A 3B36A 4HV4A 4M1SA 1RZUA 3KD3A 2XYGA 1EY8A 2ES2A 1KMNA 4MV9A 5DZSA 1MJFA 4XE5A 4W1PA 3T5BA 1EUJA 2KMLA 3J81L 5KRUA 3NDIA 1Y48E 3WBJA 5E7JA 3CWQA 3GP5A 2B30A 4KODA 4HBGA 2CFSA 3HWSA 3JD1A 2OK7A 4L16A 3K6KA 4L6AA 4TTAA 5A62A 3IT2A 2Q0XA 3C48A 2ZYDA 4FC6A 1BQ4A 1IC6A 3S1NB 2JA8G 1E1DA 1P0IA 2ET6A 3QYFA 1KDBA 4JNCA 5ALZA 4DV1L 3HKEB 1SYFA 1NR5A 4O02B 5HZKA 4UAGA 1Y98A 2O5EA 1G16A 4LJKA 3DWGA 4Z9AA 3QO2A 2CL6X 4HB4A 4E46A 2P2DA 4LPSA 4DR7Q 5LXTA 1A8PA 3RC9A 4CDRA 5AK3A 3AX6A 4Q3DA 1NHWA 4TVKA 2NGRA 2PH3A 3BXFA 3TTSA 3OAAA 3L2OB 3F5QA 5J4VA 1U11A 1YQUA 2P9GA 4UPDA 3BH6A 2VJKA 3L9XA 3OZGA 1Q95A 1JHXA 2GNPA 3AERB 3STWA 2A8YA 2B8FA 1BMDA 2FVYA 5A2QE 1BMTA 3ER0A 4TVOA 4G0NA 1YJBA 4FDLA 5D14A 4MVCA 1G21E 2F03A 4IW3B 1YDFA 2VP9A 5FOXA 4DBLC 4DVJA 3MNFA 3VKVA 4EDHA 3I04M 3K31A 2F0IA 3K9HA 2C5HA 3U4IA 2WUVA 5IYCH 5ECYA 3V3KA 3JY6A 2QR5A 4XI9A 3IVCA 2Q50A 3AFPA 5JRDS 3L43A 2H0AA 1QOPB 3L6CA 1YC5A 1UE6A 1NE3A 2HMSA 3OLWA 4R1QA 3UUGA 3D4PA 1YJNA 3ZDCA 1STNA 5SY6A 5I01A 3V8BA 5E9WA 5PGMA 4S0XA 4MINA 3R3OA 3H1PA 4AQDA 3TZCA 4EJMA 2IS1A 1B3RA 1Z5UA 2W22A 3IUSA 3KJQA 6GPBA 5LLSA 4L5TA 4BHTA 5CIWA 1A8IA 2I9PA 3KAQA 4KWHA 5KYVA 1PRTC 2Y0PA 4JJGA 4IHAA 1OFVA 1AGRA 3KQHA 2DR2A 4NARA 4M37A 1PN3A 4TMFA 3WLQA 3LC7O 3V46A 4DMUB 1XG5A 2ANCA 2O1XA 4OO1H 1V11A 3S17H 4F5ZA 2ROQA 4JLKA 1N2SA 5K3CA 1NXQA 3HMQA 4ZTBA 3ZGOA 1CEQA 2LR0A 1EA7A 3BWEA 4GL4A 4MA0A 3RU7A 1YR2A 3WHLA 4ZQFA 1JPJA 5EUQB 1APBA 4FYWA 3CUKA 1IRIA 1UT5A 2XUDA 4MICA 4CTJA 1NZFA 3E0XA 1TJ3A 3P94A 5E6UA 2FSHA 2PWAA 1TCUA 2AG0A 3TEHB 1B4OA 2G8NA 3E5RA 5KEEA 4BS9A 1HNWQ 1AGXA 1UAPA 3H75A 3PLRA 1Z2OX 2A0KA 3OTOL 4G97A 5SV2A 5H1SE 1A71A 1ETUA 1UBOS 5DB4A 3DBHA 4DJAA 4EJ6A 3O4FA 1WMDA 2AOUB 4YACA 4BUJA 5ALTA 1GPH1 3Q3IA 2QZSA 1CULC 2QUBA 4WZAA 2WKRA 3GO4A 1BE0A 1LK0A 1KYVA 4IDPA 5LD2C 4Z4IA 2Q8PA 5D87A 2FUKA 2E5WA 4Z9YA 4DWVA 1MFPA 5IAEA 1WD5A 2GH1A 3C8HA 1A1VA 5IGEA 4NFLA 4UJ3A 3W1WA 4FE3A 2E7ZA 3GT7A 1DAIA 3ZDBA 2NTVA 4I4CA 3RRZA 1U8CB 3ZWYA 4A8TA 1YHZA 5ICEA 1VJ0A 1ODFA 1BO6A 1BJKA 1QE5A 1FDOA 3CRNA 2EBUA 3SIXA 2Z9BA 1XWIA 1I4TD 1VL0A 1YBFA 3UICA 2H2HA 4DDWA 4NZOA 1W7AA 4Y2TA 3ZJUA 1L4HA 5LLTA 1K8MA 3IFTA 2WSSD 3ND8A 4H3HB 4IOMA 3ADDA 1RFGE 1N0VC 1TQ8A 4L5YA 1JDVA 3ZLJA 1WMBA 4FSHA 4DZRA 4QFCA 1QNFA 2PRZA 4P58A 1S40A 5HKBA 4MTCA 1S0UA 4QVKA 2FEKA 1QZZA 3R7WA 3TKYA 3FKSD 4ZYWA 1ODLA 1PTOB 4H1UA 5C3EG 1X0XA 5IVPA 4MTNA 3IAYA 1YHYA 2H7VA 3N0VA 5B1EA 3CWZA 4L3WA 5E6RA 5ANRB 3DH0A