5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
4PNYA 4K14A 5F2DA 2EY1A 3C1EA 2SOBA 1SYGA 3E5SA 2RDFA 5JAVA 5J22A 5CR3A 4J1MA 5IGFA 2F0NA 1A3UA 3PMFA 4ME5A 5CV5A 3T13A 5KYLA 4MIUA 4ZUIA 4ODGA 3EROA 1STAA 2F0MA 2F0DA 3C1FA 1SNDA 3QOLA 4NDXA 4OL7A 4ZQ3A 5KEEA 5EKKA 2F0IA 4K8JA 4QB4A 5J1ZA 1EZ6A 1STBA 2F0HA 5IOCA 3VA5A 5I9OA 3OWFA 2PQEA 2PYKA 4G57A 5IGBA 4DGZA 1STNA 3U9OA 2EY5A 4S3SA 4N9PA 2EYPA 2F0PA 1ENAA 4LAAA 4N9TA 1EYCA 2F3WA 3R3OA 3HEJA 4PMBA 2OEOA 1II3A 3NQTA 1EY6A 1U9RA 3D4DA 5DAUA 3MEHA 3SHLA 1SYCA 1SYBA 1ENCA 5IODA 1SNQA 4KHVA 5C5MA 2F0LA 3MZ5A 4WRDA 4IZ8A 1F2YA 1SNMA 3NXWA 2F0GA 5K5PA 1A3VA 2OXPA 3NHHA 4E6IA 5KGUA 4EQOA 3SK6A 3NUCA 1JOKA 1EY4A 4K6DA 3H6MA 3NK9A 3OMCA 5C4HA 2F0SA 4EVOA 1KABA 1SNCA 1EY8A 1RKNA 3D6CA 2PZTA 3QOJA 5ISRA 4EQPA 4QMGA 2EYOA 5DEHA 3SK4A 3V2TA 5CGKA 1SYDA 2F0QA 2F0JA 2ENBA 2F0TA 2KQ3A 3P75A 3SK8A 4EQNA 4F8MA 2WACA 5CC4A 3D4WA 4NKLA 3TP7A 5IGDA 5HURA 4R8NA 2EY6A 2M00A 3EJIA 1SNOA 4DF7A 1JOQA 4PMCA 4KY5A 2SNMA 1SNPA 1KDCA 3OMGA 4ZUJA 5C4ZA 1NSNS 2OF1A 2PZWA 2PW7A 4ID6A 4IALA 4RKBA 4KJOA 5I6YA 2RBMA 1JOOA 4QF4A 2EYFA 1EYAA 5C3WA 3SXHA 2F0WA 4TRDA 5C6AA 5IGCA 4NP5A 2EXZA 5M9OA 3TP6A 4DU9A 5KYIA 3QB3A 2RKSA 3MXPA 2NUCA 1STYA 2EYJA 4HMIA 2F0KA 3SR1A 4WORA 1KDAA 1EQVA 2PW5A 1AEXA 1SYFA 1A3TA 5CV7A 4KD4A 2F0OA 5E1FA 3RUZA 4F7XA 1EY5A 1TR5A 1KAAA 1EZ8A 1NUCA 2F3VA 1KDBA 2SNSA 1EY0A 3P1HA 4J6HA 4RKLA 1JORA 1A2UA 3SK5A 4K2LA 3ITPA 2F0VA 1EY9A 4IUNA 4KJNA 1TQOA 2EY2A 4I65A 2F0EA 5CV4A 5NUCA 4DFAA 3DHQA 1STHA 3NP8A 4KY7A 4NMZA 5EGTA 1IHZA 2F0FA 3TP5A 4B9XA 3HZXA 2LKVA 3D8GA 3BDLA 4K5WA 4K8IA 4HMJA 3DMUA 4KV6A 1SYEA 5C5LA 5I6WA 2HQEA 4K5XA 5J39A 4K5VA 3ERQA 4KY6A 3BDCA 4YIJA 2F0UA 5KRUA 4HTHA 4KTAA 5IIFA 5E3FA 2PZUA 1F2MA 4KD3A 3TMEA 5HGTA 1TT2A 2EYHA 5EKLA 5CV9A 5IGEA 3EVQA 5C3XA 4B9WA 3OSOA 5CV8A 5IGGA 3LX0A 4K2KA 1F2ZA 2QDBA 3MHBA 1EY7A 1A2TA 3MVVA 3T16A 3TP8A 5I9PA 1EYDA 5CV6A 4H7BA 2EYLA 2O4XA 2EYMA 5KIXA 2KHSA 3S9WA 1STGA 5JOBA
chains in the Genus database with same CATH superfamily
3CP0A 2RCNA 4NXNL 1TWFB 3HP3A 1ZXTA 4LUZA 4ULLA 4HIKA 3J81L 4G7HC 5A2QE 1LM0A 3RMHA 2F0IA 3U9SA 1A62A 4KKSA 1I4HA 1VQBA 3BVMA 4N8FA 2HQLA 5J3BA 4DV0Q 3D4DA 3X3MA 1D5XC 5C5MA 3J7ZC 1BR9A 1B44D 1B70B 1K83H 1ESFA 3K5NA 1R4PB 3GTKB 3I4MH 2F0TA 3EBEA 3SK8A 3H3VC 4LF4Q 3CQZB 4JI7L 4BWGB 5LMNW 3ER0A 1AZPA 2K14A 4A3FH 3HOXG 3S14B 5JVG3 2B63B 4KJOA 2ICIA 3TBIB 2A8VA 2M9VA 1A15A 4YWMA 1YNND 4A3LH 1EOTA 3EFXD 2O5IC 3TS0A 2NUCA 4L63B 1DOLA 4B3SL 3M3YH 1ML0D 3UI2A 3RUZA 2B2VC 2UU9L 4UPAA 3JAMc 3GTLB 1VMPA 4A3EG 3CRKC 4AH6A 4GOPC 2EJGC 2EY2A 1KQSA 4A76A 4C1NI 3QG1A 1X3EA 4IN3A 2Y0SE 2R93G 2JEAI 4IOAA 1BXTA 1KLGD 1YJ9A 4MN3A 3BDCA 3R2IA 4KD3A 2JE6I 5DLQE 3PO3H 3VR3A 1C48A 2EYHA 2O2LD 5IGEA 2PI2E 1PRTC 2AMCB 4L6TB 2MO0A 1VS0A 4P72A 4JOIC 5CYUA 3LWUA 2ZTCA 2CH4W 4LMQD 1PFBA 4GZYC 3C1EA 3J7YW 5M3MG 2EZVA 1EEFD 1O7LA 4XYOA 4GKKL 3I4OA 5I4DA 1T9HA 4MIUA 4ZUIA 3PO2B 1WOCA 4EGVA 2EJMA 2F0DA 1HNXQ 4A3DG 1VMCA 4JC0A 4X65L 1OXXK 5IGBA 3S2HB 1H9KA 3JAMi 2E5LL 3U9OA 1FR3A 4LAAA 2HIXA 5I2YA 3CU7A 4PMWA 4DV7Q 4JYAQ 1NR2A 3NQTA 4DAMA 5IWAQ 2J4XA 3I8ZA 1ENCA 4P2CB 2DNEA 3D0FA 4DPGA 3T53B 4C3JH 2RHSB 4B3ML 2OXPA 3GTJB 3NUCA 1F77A 3O13A 1EY4A 2CW0D 1S3OA 2F0SA 1PLFA 4DR3Q 1YJNA 2B2VA 1VF5C 2R3ZA 2XRQD 4HCSA 4LUVA 1Y8PB 1E3PA 2RQXA 4GOPA 4RHSA 1GM5A 1BF4A 4R8NA 1MIUA 5JPMC 1SNOA 1KNAA 2ES2A 4QQBX 5GROA 5IYBH 3HOZH 4KK7A 3BVZA 3UDFA 2WAQE 3A74A 3NWTA 3U58A 2MJ8A 1QWYA 1V1QA 1X6OA 2ICEC 2MHVA 2NZOA 3Q6SA 2SEBD 4GLAC 1HNWQ 1D5ZC 1SN8A 1KDAA 3U50C 1QCBD 1C4QA 2IT1A 5ELNA 4JOIA 1Q3LA 3ULJA 2UXCL 1RODA 4YCWA 2I46A 2VZAA 1KDBA 1RTOA 3DLLA 2ZXPA 1FGBD 4PV1C 1QILA 4DR2Q 3AFQA 4RA8A 2F0FA 3OWEB 4A75A 2LKVA 3QIAA 2Q2UA 1Y1WH 2NWGA 2I5MX 3MEFA 3X3NA 1NTGA 5KNDA 2PZUA 2I0QA 4FXDA 5D3DA 4DUZQ 1DXMA 2NZ1D 3DM1A 3K81C 2YU9H 3LX0A 3OHXC 3GDEA 1V1OA 2GVBA 1LLRD 3KF8A 3A8IE 4GNXB 4LFAQ 2A68D 4R4OA 3E5SA 4DNIA 2KA7A 1RIPA 4FXKC 1GUTA 2E2DC 4G4KA 4NDXA 4ZQ3A 3S17H 3E9HA 3G48A 2AWNA 4Z9CB 1STBA 5I9OA 3OWFA 4G57A 4X3SA 2NTTA 4DGZA 3MXNB 3J7AF 2AUJD 3AFPA 1XMQQ 1X55A 2HHHQ 1X3QA 2R7DA 1TWGH 1Q81C 4EQ5A 3GTPB 2ZXRA 3JAME 3SE0A 1Q46A 2F0LA 3DWPA 2L12A 1E1TA 2A6ED 4YWKA 1JOKA 2FMCA 2JXMB 1QG7A 1DM0B 4WJWA 4OEMB 4DV0L 1SNCA 1RKNA 3I4MG 3HKZB 2YTYA 2Z4HA 3SK4A 1GKHA 1HRJA 4QCLA 3CCMA 3S1NH 2PQAA 3FKIB 3TP7A 1Q90A 3GTGH 3MWYW 3RR5A 4A3FG 1JOQA 1WTXA 1N32L 4C3HH 2L5TA 3QO2A 4ZUJA 2YV5A 1WTPA 4LWCA 2PZWA 3T51B 4A3LG 4ID6A 4H02A 1PDQA 1IBKQ 2IJ0A 1LTTD 2CHBD 3QB3A 3A8KE 2QDLA 4HMIA 4LF4L 2AQ2B 1YHQA 4ALPA 5C0XH 4A3BB 4TKOB 2R7ZB 2XRSD 3KF6A 3K0YA 1Y14B 1E2ZA 1E24A 4P75A 4LF8Q 2BDNA 4B3RL 1B1ZA 1WTOA 4BXXH 2F1MA 5COYA 4JI2L 1FL0A 3HFZB 1VF7A 1EFID 3BDLA 3I4NH 2V4DA 2Q8TA 4A4IA 3W1GA 1VQAA 4DUYQ 3ERQA 1IBMQ 3PO3G 2B63G 2VB3X 1FNWA 1PTOF 4AIMA 3J81i 2JA6B 1CSQA 1Q7YC 4HJ9A 3OTOL 2NVTH 1CT1D 1TS4A 1J5EQ 2K28A 3D31A 4FF2A 2ZJQA 1YBYA 4GKJQ 1E7ZA 2SOBA 2NTSA 1BBXC 3AEVA 1AW7A 5IGFA 2Q8RE 3BJUA 3I3CA 3Q24A 3BVGA 4F88A 3K5OA 3D4RA 2Y0SG 2IW3A 1HUNA 4K8JA 5EPKA 2NN6I 4AQYQ 3BS1A 4QUCA 5FJ8H 3STBC 4HIMA 2EYPA 3H0GH 2F3WA 1EL0A 2E2HB 1VQKA 1HNXL 4C3JG 1JE4A 5DAUA 1SXTA 1SNQA 4UP8A 5FLXE 3TRZA 4IZ8A 2BOSA 2DY7A 2LXKA 1M8AA 1PH2A 3MA2B 1IXRA 2A73B 4YWLA 4V0BA 4DV7L 5EBDA 4HJ7A 2HT1A 1UAPA 1IBLL 5IWAL 4EQPA 3KK7A 2HD3A 4ILWA 3P7JA 1IZ6A 1GUGA 5FO8B 1PZID 3K6OA 1C0AA 1ILPA 2PI2A 3HOZG 5DNFA 1N34Q 1VQEA 2XNAC 3NSWA 1SNPA 3H91A 4HJAA 4DR3L 1VQ9A 1HA5A 2OF1A 1EWIA 2EYFA 2IL8A 2CQOA 5JJLA 4IPHA 4OWXB 3BYTB 1STYA 4QL5A 2CVRA 1A3TA 4A3EB 3RLFA 2OWOA 4P73A 4J6HA 1PTOH 1KRTA 1S72A 2OQKA 3SK5A 3T1YQ 4K2LA 1CZWA 4UDUC 1HNWL 3OIPA 4I65A 2F0EA 1JJGA 2F4IA 1Y1WG 4MTNA 2UXDL 3AYHB 2K5QA 4HMJA 1IKLA 2WAQG 2H5XA 1Q86C 1TWHB 1XMOL 4OHJA 1M1KC 5HGTA 1CSPA 5C3XA 2BH2A 2K6AA 4B9WA 2BE5C 5IGGA 4IUPA 3OW7A 4DR2L 2NVXH 2VS1A 5IYCG 4G7OC 1EYDA 1VQLA 3PUWA 5M3MB 2K5HA 3J81E 5M5YB 4IQZA 1B53A 4A3DB 3PF5A 3CW2C 1JWUD 4ME5A 1VQ8A 1LTAD 1MSGA 3ONAB 4JCVE 1GHKA 1O78A 3A54A 3WDNA 1X65A 1SE3A 4IFDI 5AJ3Q 1N32Q 1HA6A 3GV6A 4LUOA 3GTOB 4GOPB 1IYVA 3VA5A 5HY6A 4QJFA 4LFAL 5EKIA 2EY5A 1ZYRC 4IO9A 4LFCL 5LMNQ 4X3KA 1T5XD 1KTKA 3DUZA 1H9JA 4LF6Q 1TWAH 2JEBI 1ZEQX 4KHVA 4PQXA 1C8CA 4DN4M 4X64Q 1PRTB 2B39A 2K05A 4JG2A 4K6DA 1EFWA 3C2PA 1IW7C 4EVOA 5IT9c 4NXML 3AMUA 1BCPD 1EWHA 4A3IH 1HHVA 1NMGA 2RDGA 1AE3A 4X3UA 1N36Q 2B29A 1EIHA 2LY7A 4ZKCB 3D4WA 3EJIA 5C0XJ 5ELOA 3NBIA 5GADC 3PCOB 4OWTB 5C4XH 4JI6Q 2HUGA 1EQQA 1ONLA 5C3WA 2R61A 3SXHA 2F0WA 1SMYC 4XIGS 3M7GA 4CKEA 4KHPQ 2HCCA 1RF2D 5C0XG 4C2MH 4DV1L 3A5ZB 5D3IB 3NWSA 4BXXG 3S2DB 1M4VA 2K75A 1U4PA 1IBKL 4HJ8A 3KF8B 3KBXA 4XXEA 2BA0A 3A8JE 1ENFA 2BA1A 1B7YB 2TMPA 2UUAL 3NP8A 4B9XA 4OELB 4YHHQ 1SSOA 4K5WA 1CUKA 1GUSA 4Y52H 2DJFC 4LF8L 1EOVA 5K36H 4OX9Q 1DOKA 5M5XH 2NBFA 3TMEA 1U4RA 3W1BA 4LFBL 2FINB 1KXLA 2DJGC 4FO2A 4O0AA 4PZ8A 3T16A 4HSVA 1PZJD 3CPWA 2F4VL 4DV2Q 3UE0A 2KECA 2Z8LA 2KHSA 3E9IA 1STGA 2G9DA 1IBML 4IUTA 3CKIB 1X32A 1PH7A 1OXSC 1F9SA 1S5FD 3N52A 1HFNA 4BY1H 5CR3A 3DWAA 5CV5A 1LO5D 5CMDA 1B3QA 2KCCA 4QGUA 1GD7A 3RN5A 1J5EL 3ZYYX 5FJ8G 4L5TA 3PSIA 2PQAB 1Q8IA 3H0GG 5GQOA 4GKJL 5JJKA 2H1EA 1HQRD 4M1UB 4DR1Q 4C1NK 1PTOC 3F2CA 2B8FA 3IFTA 4IUVA 3PGZA 1I6HH 1BQQT 1EU4A 3MZ5A 1HJPA 4LF9Q 1GOZA 4RAUC 4AQYL 2K5WA 2VQEQ 3I4MB 2K1BA 4L8JA 2RSOA 3H6MA 2IY5B 1VQCA 1EYGA 1EY8A 3KF6B 4DV4Q 4JI0L 1WTVA 2WINB 4A3FB 3QWNA 3K58A 4QMGA 5DEHA 1HPCA 1MBYA 2XGTA 2CFMA 1MSHA 5IGDA 5CC4A 1SROA 3E0EA 4RH6A 2WFWA 3M3YB 3OMGA 3IKJA 4IOCA 2DUDA 4KLKA 1SDFA 2RBMA 3HS0C 1TWCH 4TRDA 4CDEC 4XYQA 1BO0A 4DK0A 1FVIA 2R92H 5HGQA 2PW5A 1TY0A 3I90A 5AFWA 5E1FA 2F0OA 4DK6C 2LXJA 3BG3A 2DGYA 1VCIA 2UUBQ 3PIOA 5ELDA 3N6RA 4JV5Q 1EY9A 4XT1B 2K52A 2M2LA 1OXUA 5LHY1 2EQSA 1Z7TA 1SRUA 3PO3B 4R4TA 3R2TA 4K8IA 4IUUA 4K5VA 4AYBE 4OXPA 1NJIC 2E2JH 3GQBA 5KRUA 4LK1C 4HTHA 4RFBA 4DAYA 3PIO3 4GLVB 2KBNA 4A3MH 1M90C 4RCOA 1S5DD 2A5HA 2PCFB 1A0IA 3L9AX 4OIKA 2VNUD 2JJQA 2C9OA 4N8X1 1QVFA 2K03A 4QIWE 1TY2A 1PH8A 4PNYA 2A69D 2Y0SB 1YNJC 1XPRA 1GVPA 2F0NA 1W3SA 4GLXA 2IWHA 4RWSC 3QR8A 4RGTA 1LTLA 5IOCA 5LMUQ 3M4OH 3P20A 1PH5A 1SJED 1SE8A 1B4OA 3LGJA 4C3JB 1X54A 4JVZA 2BH8A 4BY7H 2VB2X 1EQTA 3KDFA 1D1IA 1K73C 1R9TB 4CKCA 3CPFA 2CWPA 2N88A 3NXWA 3Q0AA 3EQLC 1VQPA 1BOSA 2F03A 1LT5D 1SJHD 4A3JH 3NK9A 1Q8KA 1HZBA 4LF6L 1VQJA 3HOZB 2XWBB 1JWMD 2OT2A 4F87A 3CHBD 1L0YB 2DNCA 5GAHC 4CJ2C 4X64L 1LTRD 4JI3Q 3H3VI 5C4XG 2YYZA 1HXYD 1WTHA 1XTDA 2KCTA 3I73A 1NSNS 3BYYB 3PV0A 5I6YA 3H94A 1XX8A 5EBCA 2XN9C 1N36L 3TP6A 4J8QA 1B8AA 5FO9B 1W2BA 1V1PB 2AQ1B 2IX3A 1LACA 4A93H 1V43A 4JI6L 2MPMA 1G6PA 4I7ZC 1Y1WB 2JA5H 4DR6L 3IFDA 1UWVA 3PUZA 4KHPL 2B2YC 3S1RH 5IGCA 2WAQB 5IP9H 1WTRA 2BDOA 1PH6A 3NEMA 2YU9B 5K36G 1VQGA 2UUCQ 2KEDA 2ZT9C 1AN8A 2N3SA 3S1MH 5IIFA 1YHBA 1CTMA 2KUMA 2NB0A 2A6HD 4RGNA 3EVQA 2B3GA 2QF7A 3ICEA 1L2FA 4YHHL 5DM63 4WFN3 4FYDA 4L5SA 3S17B 4XTCS 3VYUA 4DR5L 5JPNC 4L5QA 2CQAA 4OX9L 1ET9A 1RL2A 5J22A 5H1SE 2D2CC 4CDFC 3PMFA 1A3UA 4DR4Q 1MJCA 4JPBW 1QOHA 2Z9HA 3QOLA 3DM3A 4DV2L 1TWGB 3K8AA 4DKAC 2MUYA 5JEAH 3L7ZC 1STNA 2AKWB 3EIVA 4FDBA 1HFGA 1J9OA 1CKMA 5IODA 1PFMA 1R4QB 4R4IA 1CI3M 5IT9L 1H9SA 3GTQH 1A3VA 4E6IA 4HEDA 4EQOA 4Y7NH 1VQNA 3S1NB 4RGMA 2H4OA 4DR1L 3GTGB 5JVH3 4C3HB 2EYOA 1YI2A 3K59A 3MFGA 2ENBA 4LF9L 3NTKA 2B2YA 4FF1A 2WACA 5IY0A 2JA8H 4YCUA 3HOWH 4A3KH 4IUQA 4PMCA 4DV3Q 1PXUA 2RVLA 1CKNA 3I2ZA 4DV4L 2ASBA 3HRZC 1PH1A 3BU2A 5KYIA 1YNNC 3EA6A 1SLJA 1SE4A 3HOUH 4YY3Q 5M3FH 4UAIA 1I4PA 1PYBA 2WKCA 2QA4A 2LFNA 4DNTB 5BR8Q 4QUFA 5EPJA 2L4NA 4MHEA 2E74C 1A2UA 5E4WC 3W2DA 2GA4B 4ZRZA 2EPBA 4LF5Q 1YITA 3E6ZX 3HZXA 5FK9C 5I6WA 1RHPA 4XDXA 2NVTB 5E3FA 4JV5L 4FVMA 2K7VA 3K7UC 1E2WA 4DK1A 1HNZQ 1SE2A 3TP8A 3KUPA 3IRBA 2QKIC 1F9PA 3AU7A 3FMCA 2ZM6Q 3KLWA 2Z6BA 1W6JA 1FGUA 1CA5A 1AZQA 2EY1A 4O2DA 5E4XA 1A8VA 5CBEE 4JI1Q 1G51A 1L0XB 1H9RA 3H0GB 2F0MA 3FPPA 3C1FA 3GTPH 4I7AA 1VQFA 2G9HD 5J1ZA 2KVMA 1SFOH 2F0HA 1BUVT 4AYBG 2K5DA 1HR0W 4BY7G 4RG1A 4L5RC 1XNRQ 4XT3B 1ENAA 4MNOA 3MAQA 1RTNA 2Q2HA 3HEJA 2K5NA 1BKBA 3S15H 2VUMH 1JICA 3WOFA 2LS01 3K5MA 2N49A 1CHPD 4A3JG 1I3QH 3LNNA 2ZTEA 3SK6A 1UE6A 4JBKA 2PMZE 2LMCB 4A3CH 5C4JH 1QE6A 2CW0C 1QZHA 3J7AV 3KBGA 3SVMA 3FEWX 4DAVA 4BBSH 3BZKA 4X6AH 3RZOH 1PV4A 4EQNA 4FF3A 1D8LA 1RJTA 4R8IA 4IPDA 1AFPA 2R7FA 3GO5A 2HCIA 5C44H 1HZCA 1EIFA 1I4QA 4QF4A 1ESRA 5C6AA 1ICFB 4ZKBB 5C3EH 1KL9A 4RHRA 4DAYB 2CCZA 2EYJA 1PTOB 3A56A 2Q2TA 4J15A 4JI3L 4WORA 4A93G 2Z0SA 4JYAL 4XQQA 3J80c 4F7XA 1LT4D 2JA5G 1SAPA 2QGQA 3K80C 1K8MA 1LV9A 4RKLA 2J0TD 2XVSA 1Y1VH 4BA2I 1E1OA 2JQOA 2KOLA 2N55A 3DXJC 5IYBG 3S16H 4ZLTF 4K0KQ 1YVCA 1YIJA 4CDCC 3DHQA 4H44C 4NMZA 2Z6KC 1K3BC 1F9QA 3F8TA 2XIWA 4CJ1B 2NVXB 3GP7A 3BZDB 4LW1A 1Z47A 4YCVA 4ZK9B 1RCVD 1F2MA 2FXQA 2N8NA 3SGIA 3KDFB 3ND9A 4RMFA 3RN2A 3HOYH 2NVYH 1C7YA 1SEBD 3ND8A 4R9WA 5JEAJ 2UUCL 1WCMH 2I07B 5F2DA 5JJZA 1BCPF 4JI7Q 2A68C 4EX5A 2PPBC 3WWVA 1G8ZD 5KEEA 3A7LA 1WTWA 3MFYA 1WI5A 5JEAG 2B2WC 1TWAB 3CD6A 1NY4A 4UHVA 2PO4A 4GS3A 1OTCA 1H95A 1LYLA 1V1PA 4DR4L 2QW7A 4JK1C 5EAYA 2UU9Q 4A3IB 1AP0A 3HOXH 4CJ0B 4DUZL 4CDDC 2A6EC 1FJGQ 3Q8DA 3OMCA 1KRSA 1KABA 2B2TC 1MD2D 3HKSA 5C4XB 2JA8G 1I50B 3K0XA 3CRLC 3HOWG 4A3KG 4GN4B 3CCVA 1QVCA 2XTIA 4OWWB 4UP9A 4JI4Q 2Z6KA 3FPUB 4C2MB 5IYDH 4OIJA 3LWEA 4Q0FA 2YTXA 4X66Q 3URYA 4Q5VA 2L11A 4DU9A 2R93H 2EOTA 3HOUG 2RKSA 1XMQL 3MXPA 5GAGC 5M3FG 4JBMA 2JA7H 1HH2P 4PZ6A 2HHHL 2E2IB 5BN4A 1DCZA 1O7YA 3FVQA 2QEXA 3TDQA 4FP5D 1NUCA 3UE1A 2JN4A 2F3VA 4JI5Q 3P1HA 4C3HG 1F2LA 1Z6HA 3R93A 1U0LA 4DV5Q 4WJ4A 1TQOA 2K32A 2KHJA 5NUCA 3VR4A 5M5XB 2NVQH 4UP7A 4KY7A 1WYDA 1TS3A 4KHZA 3SEBA 4BS9A 4YY3L 1DYQA 2WB1E 3NENA 3D8GA 5C5LA 2B2WA 2GVAA 3A5UA 2ZJPA 3CCEA 1ILQA 2P5ZX 2DN8A 1OO9B 3OW2A 2F52A 1TKWB 4JI8Q 1PRTD 3CCUA 4LF5L 1P8LA 4BY1B 5I9PA 4HIDA 2UXBQ 2I5HA 4DAPA 3S9WA 1H9SB 5JOBA 2VL6A 3I4NG 5JAVA 1Q12A 1CHQD 3G4SA 5KYLA 5D65A 4R4QA 3QJYA 2B2TA 3CXCA 1VQ7A 4OO1I 1STAA 1DGSA 3TN2A 1N33Q 1CQFA 4QB4A 2ZM6L 1I6HB 1NE3A 1UE5A 2VUMG 2F0PA 4DK3C 5LL6S 1CKNB 4JI1L 3KLSX 4C3IH 2D62A 3H09A 1II3A 1A6XA 1D5MC 4DUYL 1CK1A 4B3TQ 3K7AH 4MZ9A 3HOVH 4A3CG 1NR4A 4JW0A 3FRPB 1K8OA 1VQOA 3RLNA 4BBSG 3AB9A 3ERSX 4PZ7A 1F9RA 3GTMH 1G291 1BBUA 5G3LD 2Q2IA 1TWCB 3P75A 1PH4A 1Y8OB 4PG3A 2K50A 5FLMH 2EY6A 5C44G 4DF7A 1CM9A 1K83B 1EWCA 2KENA 5C3EG 1QB5D 2R92B 5JJIA 2EIFA 5CBAE 1Y69U 3ULLA 3J7A5 1JOOA 3FDTA 4NP5A 1JJCB 1L1OC 5T1GA 2B2UA 5A35A 3V96A 1LTGD 1S4ZA 4DR7Q 4X62Q 1LT6D 1TR5A 1Y1VG 3IL8A 3AQQA 1KAAA 1EZ8A 2MGSA 3HG9A 1NBWA 4KN4C 4ABNA 3S1QH 4KMUC 2E2JB 2FFKB 1K28A 3U4VA 3I4LA 2EVBA 1LABA 1I4RA 4A3MB 2FHTA 3OIQA 1D2BA 1STHA 2IX1A 1U4LA 3NTHA 1VQIA 4G7ZC 3RZDH 1YJWA 1SYEA 1TU2B 3M4PA 3D6WA 4K5XA 4WJ3M 4BBRH 4FNFA 1UUPA 5M5WH 3L3OC 3I70A 2L55A 4BA1I 5BN5A 1N34L 1TT2A 4K0KL 5EKLA 3HOYG 3BZCA 2OCEA 1UNSA 2C5CA 2QDBA 3MHBA 1QNKA 5CV6A 1WCMG 3CMEA 2K04A 3G6JB 1LTBD 3F2DA 1SBBB 3M4OB 3RNUA 2G5DA 2L0CA 1RD9D 2VW9A 4A3GH 1N9WA 4AYBB 4UY8C 4BY7B 1EUJA 4DV6Q 5FKAC 2R6GA 1GUOA 1BBWA 1EZ6A 1ZKOA 2JP1A 3NQIA 3T1YL 1TWFH 4RCNA 1XTCD 3PUVA 5IT9E 2OTJA 4N9PA 1TS5A 3R3OA 1NMFA 2XSCA 4A3JB 4QIWB 3B6YA 2OQ0A 2L1BA 3TQYA 2KCNA 3KJOA 1IYJB 5KNCA 4B3RQ 1L1OA 4WRDA 2VQFQ 5K5PA 4JBJA 4JI2Q 1TXYA 1KLUD 2Z1CA 3D6CA 4NB3A 2YTVA 3KLRA 1ASZA 1BCPC 2NZHA 1D6EC 4ZCKA 3BDOA 5KNBA 2J7ZA 1S5ED 3KFUA 5IYDG 3C3LA 1FJGL 2L9HA 2PNHA 1LTSD 3OTOQ 2PW7A 1JJ2A 4IALA 5AJ3L 1LT3D 2WKDA 3V05A 2QCPX 3GTKH 5D14A 5E7NA 3T4AC 4A93B 2EXZA 2JA7G 3CQZH 3J80L 1IL8A 4H13C 4A3IG 2N78A 2JA5B 2BCOA 2NN6H 4KKUA 5LMNL 3S14H 4DXFA 3KOJA 4JI4L 3G7LA 2B63H 3S1RB 2KHIA 1PA6A 2D0OA 1O7ZA 3NBHA 1JT8A 1HTLD 2X6LA 3MC0B 1BDOA 3R8BA 1YZ6A 4X66L 1A63A 1FD7D 4KJNA 3VYSA 3SDZA 3S1MB 1IHZA 4KV6A 3I91A 3GTLH 1YNXA 4JI5L 4YIJA 3Q22A 4FXGC 4ME3A 2FJ2A 1JB7A 1X9NA 1ET6A 4DV5L 5DM73 1HR0Q 1PH3A 4POFA 3OSOA 1DONA 1F2ZA 2X6GA 2VXWA 3RD4A 1C9OA 1I6VC 4X3TA 5FOBB 4H7BA 1PVOA 2O4XA 1IBLQ 3T1HQ 4R4CA 2MO1A 1WVLA 4MTKA 1E2VA 1WTQA 1Z9FA 4J1MA 2D0PA 4JI8L 1VQHA 2RSNA 1QZGA 2WB1G 3G71A 2UXBL 1R9TH 3I56A 1JR0D 4ZAIA 3CCQA 2ZXOA 3T56B 2PQEA 3VR5A 1WD0A 1NAPA 1UEAB 3STBD 3VDYA 2OTLA 4C3IG 2QILA 3GTQB 1XYIA 4S3SA 4N9TA 5A2QL 3PO2H 1I4XA 4Y7NB 1J6QA 1LUZA 4DA2A 1U9RA 3NELA 1JB3A 4BY1G 1N33L 1I4GA 1SYCA 3HOVG 3S2HH 3CC2A 1S40A 1F2YA 3NHHA 3TEHB 4C56C 4JBWA 1Q1BA 1X56A 1PHJA 1HTPA 2JA8B 2KEEA 5EQ0A 3HOWB 4A3KB 2XWJB 2UXDQ 3QOJA 2LSSA 1IYUA 1Q1EA 3V2TA 4B3TL 5CGKA 5FLMG 1O80A 1G6ZA 3GTJH 4IJLA 2F0JA 2HDMA 2PNRC 1XMOQ 1E0BA 5FLXc 4DXGA 1B2TA 1E22A 2MNAA 1EQRA 3E3XA 1KDCA 1JCKB 3PIPA 3HOUB 3M4YA 3L0OA 1RDPD 2WV6D 5M3FB 1XPUA 2JSOA 5TSSA 1EYAA 4POGA 1ICWA 5ELBA 5ELCA 4HIOA 4IFDH 1GUWA 1IL2A 1JQYD 1U4MA 4IPGA 1AEXA 3WOEA 1L0WA 3PIP3 1EY5A 1S5CD 1B3AA 3DEOA 1PFSA 2SNSA 5IP7H 3ULPA 1EY0A 2VQEL 1Q82C 2IX0A 5IYCH 3S24A 1VQ5A 1QJOA 1WFQA 3FP9A 4DR7L 1AE2A 4LFCQ 4BBRG 3M9BA 4X62L 3CF5A 3JC66 2VY3A 2E8GA 2IHFA 4LF7Q 4KY6A 3Q23A 2R92G 1QVGA 1JC7A 2B8GA 2F0UA 2JA9A 4GN5A 2FMMA 4LNQA 2BE5D 1QUQA 5CV9A 1WD1A 3TSSA 3KLSA 3VYTA 1B50A 4K2KA 1XXGA 3RLOA 4NXMQ 3I4NB 3DWQA 5EJWA 1BVSA 3W3AA 1TVXA 1SFOB 4A3GG 1T5EA 1UEBA 1I94Q 1SYGA 3D3RA 2A69C 1PYSB 1DD2A 4A3MG 4TQUS 4XQJA 1PH9A 3S15B 2VUMB 2UUBL 3OYYA 5IE8A 1K8GA 3J81c 3HKZE 1LTID 3EN2A 1KIXA 2X69A 4KN7C 1ZYRD 1I3QB 1HCZA 3FHWA 1VQ4A 4DV1Q 4PMBA 1DOMA 2ID0A 2OEOA 1ASYA 5C4JB 4DV6L 1SYBA 5GAEC 4IPCA 4OO1H 4NW2A 2F0GA 4BBSB 1FNUA 5KGUA 2CH4A 3RZOB 2O5JC 1IW7D 3CC7A 4K6LA 5C4HA 2UUAQ 4APVA 5C44B 1HUMA 3M7NA 1V9PA 2KJXA 2VQFL 3I7FA 1FYCA 5C3EB 5HURA 2M00A 3M85A 1K3RA 2SNMA 4LFBQ 2IPKD 4RKBA 1SMYD 2F4VQ 3FKIH 5LMUL 2RDHA 2NN6G 3W5OA 2PMZB 4B08A 1K8AC 4HCEA 1CKOA 1GJXA 1YHAA 1Y1VB 1O7IA 1PMRA 2F0KA 3SR1A 3F2BA 1EQVA 3S16B 3CAMA 1U5KA 1I5FA 2A19A 3ITPA 1B9NA 1HZAA 1NCVA 1W6KA 5T1IA 1Y8NB 4A3BH 3E0JA 2R7ZH 4OONA 2EJFC 2I5LX 4IJHA 4ZYSA 5BN3A 2D9UA 1H9MA 5I2XA 1XNQQ 1TS2A 3F2UA 3HOYB 2NVYB 3A0JA 4HAEA 4U673 4NXNQ 1J8IA 4P74A 1WCMB 2V1CC 2WIIB 1FNVA 3L2PA 2A6HC 1A2TA 1MKHA 2MP1A 4JI0Q 2EYLA 2EYMA 4U68A 3CCLA 1L1OB 2JA6H 3MTSA 5IP9G 1KD1C 4K14A 2K33A 4IURA 2RDFA 2RCFA 4KKTA 1HR0L 3T13A 3EROA 3OPOA 4O42A 4OL7A 3HGBA 2MFIA 2ALYB 4CGYB 3MXUA 1GO3E 3T1HL 4HN7A 2ATWA 3PO2G 2PYKA 3HOXB 1PTOD 1YEZA 3PUYA 1JMCA 2AQ3B 3NPPA 3UDGA 5ELEA 1K0SA 1SMXA 3ZJYC 1CZGA 3PF4A 1HZ9A 1EY6A 3J81j 3MEHA 1GUNA 1G2SA 1SNMA 3MXGA 2IHEA 3NE5B 2E2HH 3OOCA 3NBHB 1WJJA 2CWAA 4O1NA 3J80i 2GN5A 3JAML 3VA7A 3CCSA 2PZTA 5ISRA 1EIYB 3TZDA 4IFDJ 2CKZB 1MGSA 2F0QA 2RF4A 2KQ3A 4LJZC 4B3SQ 4NKLA 2R93B 2E75C 2SDFA 4KY5A 5C4ZA 2JA7B 2ZJRA 1KNEA 1GHJA 4IFDG 3A7AB 4H0LC 4CBVA 5M9OA 1SR3A 1IKMA 5FO7B 1PRTF 1AH9A 1STEA 4HR7B 2C35B 2AHOB 4GNXC 3VYRA 2NVQB 1SYFA 2L15A 2WP8J 1EU3A 5IP7G 1D7QA 3GD7A 2HIVA 3CCRA 1QNUA 3TREA 4DNRB 1JORA 1G91A 1MI2A 3H15A 4IUNA 2F3IA 3K5LA 1TIID 2AUKA 4DFAA 1X3GA 5EGTA 4NPSA 1BCPB 2K01A 4A3EH 3TP5A 4RGOS 1KAWA 5CORA 5J39A 3I72A 3F1ZA 3GV3A 1MJEA 3IAYA 2JK8A 2D5DA 3PUXA 2E76C 4M8AA 4DV3L 4GKKQ 3DEPA 3M4QA 4QY7A 3MVVA 1VQMA 3VR2A 3H3VH 1TWHH 3A55A 5KIXA 2RHQB 3U4ZA 4X65Q 4LF7L 4R1JA 2TSSA 3KJPA 1YNJD 2HDLA 2ZTDA 4XQNA 2E5LQ 4OGQC 2WB1B 1PYWD 4ODGA 1VDZA 2EE1A 5M3MH 5G3LF 5M5YH 5BR8L 2Z4IA 3I55A 1SNDA 1DJRD 4C3IB 4GN3B 5EKKA 1HQMC 2RA4A 1K9MC 1PFNA 4A3DH 1X3FA 4B3MQ 3K7AB 1B9MA 1I94L 3TZUA 2K5VA 2B2UC 3HOVB 1EYCA 1XWEA 1X3PA 1CA6A 3GTOH 4OO1G 1CQVA 3SHLA 4CKBA 4V190 1I50H 3K57A 3GTMB 3CCJA 2KCMA 4DR6Q 3CMAA 4GNXA 1HNZL 1N8RC 5FLXL 2EDGA 4HSPA 1SYDA 5C0XI 2Q8IB 4F8MA 3HKZG 3KYHC 1PZKD 3CC4A 3MXNA 3J80E 2E2IH 1DZ1A 3FKIG 1OXTA 2UXCQ 1V8QA 2JYOA 3TS2A 1KC8C 1KHIA 3G6EA 1EEID 3VR6A 3UDXA 4DR5Q 5ELFA 5EPLA 1QUQB 3C46A 1XNRL 1NNXA 1S5BD 3S1QB 5LL6X 1OXVA 5CV7A 4KD4A 4CHTB 1G2TA 4HJ5A 2QEJC 3RZDB 2MQHA 2DY8A 1XPOA 1VQDA 4A3BG 4BBRB 1BNZA 2R7ZG 2F0VA 5M5WB 5CV4A 1JE5A 4FF4A 5L37A 2A1AA 1D1KA 4TSSA 3S2DH 1JWSD 1K0RA 1UE7A 3DMUA 2AWOA 3UDIA 1GXDC 2HQEA 4TVAB 1CFMA 1UE1A 2K4KA 1VQ6A 4KTAA 2A74C 2NYZD 5CV8A 2JA6G 1EY7A 4KI0A 1MHWC 4A3GB 3NTIA 4P71A 2EXDA 1XNQL 1P16A 1EIGA 3PQIA 1XJVA
chains in the Genus database with same CATH topology
1TWFB 3HP3A 1ZXTA 4ULLA 3J81L 4G7HC 5A2QE 3RMHA 2F0IA 3U9SA 4KKSA 1I4HA 3BVMA 3D4DA 3X3MA 1D5XC 5C5MA 1BR9A 1B44D 1ESFA 3K5NA 1R4PB 3GTKB 2F0TA 3SK8A 3H3VC 3CQZB 4BWGB 1AZPA 3S14B 5JVG3 2B63B 4KJOA 2ICIA 3TBIB 2M9VA 1A15A 1YNND 1EOTA 3EFXD 2O5IC 2NUCA 4L63B 1DOLA 1ML0D 3UI2A 3RUZA 2B2VC 3GTLB 1VMPA 3CRKC 2EJGC 2EY2A 4C1NI 3QG1A 4IN3A 2JEAI 1BXTA 1KLGD 4MN3A 3BDCA 3R2IA 4KD3A 2JE6I 3VR3A 1C48A 2EYHA 2O2LD 5IGEA 1PRTC 4L6TB 5CYUA 3LWUA 4LMQD 1PFBA 4GZYC 3C1EA 3J7YW 2EZVA 1EEFD 1O7LA 4XYOA 5I4DA 4MIUA 4ZUIA 3PO2B 4EGVA 2EJMA 2F0DA 1VMCA 1OXXK 5IGBA 3S2HB 1H9KA 3U9OA 1FR3A 4LAAA 5I2YA 3CU7A 4PMWA 1NR2A 3NQTA 2J4XA 3I8ZA 1ENCA 4P2CB 2DNEA 3T53B 2OXPA 3GTJB 3NUCA 1F77A 3O13A 1EY4A 2CW0D 2F0SA 1PLFA 2B2VA 1VF5C 2R3ZA 2XRQD 4HCSA 1Y8PB 2RQXA 4RHSA 1BF4A 4R8NA 5JPMC 1SNOA 1KNAA 4KK7A 3BVZA 3NWTA 2MJ8A 1QWYA 2MHVA 2ICEC 3Q6SA 2SEBD 1D5ZC 1KDAA 1QCBD 1C4QA 2IT1A 1Q3LA 1RODA 2I46A 1KDBA 1RTOA 1FGBD 2ZXPA 4PV1C 1QILA 4RA8A 2F0FA 3OWEB 2LKVA 3QIAA 2NWGA 3X3NA 5KNDA 2PZUA 4FXDA 5D3DA 1DXMA 2NZ1D 3DM1A 3LX0A 3OHXC 1V1OA 1LLRD 3KF8A 3A8IE 2A68D 3E5SA 2KA7A 4FXKC 1GUTA 2E2DC 4G4KA 4NDXA 4ZQ3A 2AWNA 4Z9CB 1STBA 5I9OA 3OWFA 4G57A 4X3SA 2NTTA 4DGZA 3J7AF 2AUJD 1X3QA 3GTPB 2ZXRA 3JAME 3SE0A 2F0LA 3DWPA 2L12A 2A6ED 1JOKA 2FMCA 2JXMB 1QG7A 1DM0B 4WJWA 1SNCA 1RKNA 3HKZB 2Z4HA 3SK4A 1HRJA 4QCLA 3FKIB 3TP7A 1Q90A 3MWYW 1JOQA 1WTXA 2L5TA 3QO2A 4ZUJA 1WTPA 2PZWA 3T51B 4ID6A 1PDQA 2IJ0A 1LTTD 2CHBD 3QB3A 3A8KE 4HMIA 2AQ2B 5C0XH 4A3BB 4TKOB 2R7ZB 2XRSD 3K0YA 1E2ZA 2BDNA 1B1ZA 1WTOA 2F1MA 5COYA 1VF7A 1EFID 3BDLA 2V4DA 2Q8TA 3ERQA 2VB3X 1FNWA 1PTOF 2JA6B 1CT1D 1TS4A 2K28A 3D31A 4FF2A 2SOBA 2NTSA 1BBXC 1AW7A 5IGFA 2Q8RE 3I3CA 3Q24A 3BVGA 4F88A 3K5OA 3D4RA 2IW3A 1HUNA 4K8JA 5EPKA 2NN6I 3BS1A 4QUCA 2EYPA 2F3WA 1EL0A 2E2HB 4C3JG 1JE4A 5DAUA 1SXTA 1SNQA 5FLXE 4IZ8A 2BOSA 2DY7A 1M8AA 3MA2B 2A73B 4V0BA 5EBDA 1UAPA 4EQPA 3KK7A 4ILWA 3P7JA 1GUGA 5FO8B 1PZID 3K6OA 1ILPA 5DNFA 2XNAC 3NSWA 1SNPA 3H91A 1HA5A 2OF1A 2EYFA 2IL8A 3BYTB 1STYA 2CVRA 1A3TA 4A3EB 3RLFA 4J6HA 1PTOH 3SK5A 4K2LA 1CZWA 4UDUC 3OIPA 4I65A 2F0EA 2F4IA 2K5QA 4HMJA 1IKLA 1TWHB 4OHJA 5HGTA 5C3XA 2K6AA 4B9WA 2BE5C 5IGGA 4IUPA 3OW7A 4G7OC 1EYDA 3PUWA 5M3MB 3J81E 5M5YB 4IQZA 1B53A 4A3DB 1JWUD 4ME5A 1LTAD 1MSGA 3ONAB 1GHKA 1O78A 3A54A 3WDNA 1SE3A 4IFDI 1HA6A 3GV6A 3GTOB 1IYVA 3VA5A 5EKIA 2EY5A 1ZYRC 4X3KA 1T5XD 1KTKA 3DUZA 1H9JA 2JEBI 1ZEQX 4KHVA 4PQXA 1C8CA 4DN4M 1PRTB 2B39A 2K05A 4K6DA 3C2PA 1IW7C 4EVOA 3AMUA 1BCPD 1EWHA 1HHVA 2RDGA 4X3UA 1EIHA 2LY7A 4ZKCB 3D4WA 3EJIA 5C0XJ 3NBIA 2HUGA 1ONLA 5C3WA 2R61A 3SXHA 2F0WA 1SMYC 4XIGS 3M7GA 4CKEA 2HCCA 1RF2D 5C0XG 5D3IB 3NWSA 3S2DB 1M4VA 1U4PA 3KBXA 4XXEA 2BA0A 3A8JE 1ENFA 2BA1A 2TMPA 3NP8A 4B9XA 1SSOA 4K5WA 1GUSA 5K36H 1DOKA 2NBFA 3TMEA 1U4RA 2FINB 4FO2A 3T16A 4HSVA 1PZJD 2KECA 2Z8LA 2KHSA 1STGA 2G9DA 4IUTA 3CKIB 1X32A 1OXSC 1F9SA 1S5FD 3N52A 1HFNA 5CR3A 3DWAA 5CV5A 1LO5D 5CMDA 2KCCA 3ZYYX 1Q8IA 2H1EA 1HQRD 4M1UB 4C1NK 1PTOC 2B8FA 3IFTA 4IUVA 1BQQT 1EU4A 3MZ5A 1GOZA 4RAUC 2K5WA 3I4MB 2K1BA 4L8JA 2RSOA 3H6MA 1EY8A 1WTVA 2WINB 4A3FB 3QWNA 3K58A 4QMGA 5DEHA 1HPCA 1MBYA 1MSHA 5IGDA 5CC4A 4RH6A 3M3YB 3OMGA 3IKJA 1SDFA 2RBMA 3HS0C 4TRDA 4XYQA 1BO0A 4DK0A 2PW5A 1TY0A 3I90A 5AFWA 5E1FA 2F0OA 3BG3A 1VCIA 5ELDA 3N6RA 1EY9A 4XT1B 2M2LA 5LHY1 1OXUA 1Z7TA 3PO3B 3R2TA 4K8IA 4IUUA 4K5VA 3GQBA 5KRUA 4LK1C 4HTHA 4RFBA 4DAYA 3PIO3 4RCOA 1S5DD 2A5HA 2PCFB 3L9AX 4OIKA 2VNUD 2C9OA 2K03A 1TY2A 4PNYA 2A69D 2Y0SB 1YNJC 2F0NA 2IWHA 4RWSC 4RGTA 5IOCA 3P20A 1SJED 1B4OA 4C3JB 2VB2X 1EQTA 1D1IA 1R9TB 4CKCA 2N88A 3NXWA 3Q0AA 3EQLC 1BOSA 2F03A 1LT5D 1SJHD 3NK9A 3HOZB 2XWBB 1JWMD 2OT2A 4F87A 3CHBD 1L0YB 2DNCA 4CJ2C 1LTRD 2YYZA 1HXYD 3I73A 1NSNS 3BYYB 3PV0A 5I6YA 3H94A 1XX8A 5EBCA 2XN9C 3TP6A 4J8QA 5FO9B 1V1PB 2AQ1B 2IX3A 1LACA 1V43A 2MPMA 4I7ZC 1Y1WB 3IFDA 3PUZA 2B2YC 5IGCA 2WAQB 1WTRA 2BDOA 2YU9B 5K36G 2KEDA 2ZT9C 1AN8A 5IIFA 2KUMA 1CTMA 2NB0A 2A6HD 4RGNA 3EVQA 2QF7A 5DM63 4WFN3 4FYDA 3S17B 4XTCS 3VYUA 5JPNC 2CQAA 1ET9A 5J22A 2D2CC 3PMFA 1A3UA 1QOHA 3QOLA 1TWGB 2MUYA 5JEAH 3L7ZC 1STNA 1HFGA 1J9OA 5IODA 1PFMA 1R4QB 5IT9L 1CI3M 1H9SA 1A3VA 4E6IA 4HEDA 4EQOA 3S1NB 4RGMA 2H4OA 3GTGB 5JVH3 4C3HB 2EYOA 3K59A 3MFGA 2ENBA 3NTKA 2B2YA 4FF1A 2WACA 4IUQA 4PMCA 1PXUA 2RVLA 3HRZC 5KYIA 1YNNC 3EA6A 1SE4A 4UAIA 1I4PA 2WKCA 2LFNA 4DNTB 4QUFA 5EPJA 2L4NA 4MHEA 2E74C 1A2UA 5E4WC 3W2DA 2GA4B 4ZRZA 2EPBA 3E6ZX 3HZXA 5FK9C 5I6WA 1RHPA 4XDXA 2NVTB 5E3FA 4FVMA 2K7VA 1E2WA 4DK1A 1SE2A 3TP8A 3KUPA 2QKIC 1F9PA 3AU7A 3FMCA 1W6JA 1CA5A 1AZQA 2EY1A 5E4XA 5CBEE 1L0XB 1H9RA 3H0GB 2F0MA 3FPPA 3C1FA 2G9HD 5J1ZA 2KVMA 2F0HA 1BUVT 2K5DA 4XT3B 1ENAA 3MAQA 1RTNA 3HEJA 1JICA 3WOFA 2LS01 3K5MA 1CHPD 3LNNA 3SK6A 2LMCB 1QE6A 2CW0C 3J7AV 3KBGA 3SVMA 3FEWX 4DAVA 4EQNA 4FF3A 1RJTA 4R8IA 1AFPA 3GO5A 2HCIA 1I4QA 4QF4A 1ESRA 5C6AA 4ZKBB 4RHRA 2EYJA 1PTOB 3A56A 4WORA 4XQQA 4F7XA 1LT4D 1SAPA 1K8MA 1LV9A 4RKLA 2J0TD 2XVSA 4BA2I 2N55A 2KOLA 3DXJC 4ZLTF 3DHQA 4H44C 4NMZA 1F9QA 2XIWA 4CJ1B 2NVXB 3GP7A 3BZDB 1Z47A 4ZK9B 1RCVD 1F2MA 3ND9A 1SEBD 3ND8A 4R9WA 5JEAJ 2I07B 5F2DA 5JJZA 1BCPF 2A68C 2PPBC 1G8ZD 5KEEA 3A7LA 1WTWA 3MFYA 5JEAG 2B2WC 1TWAB 2PO4A 1V1PA 4JK1C 4A3IB 1AP0A 4CJ0B 2A6EC 3OMCA 1KABA 2B2TC 1MD2D 5C4XB 1I50B 3CRLC 3FPUB 4C2MB 4OIJA 3LWEA 4Q0FA 3URYA 4Q5VA 2L11A 4DU9A 2EOTA 2RKSA 3MXPA 2E2IB 5BN4A 1DCZA 1O7YA 3FVQA 3TDQA 4FP5D 1NUCA 2F3VA 3P1HA 4C3HG 1F2LA 1Z6HA 3R93A 1TQOA 2K32A 5NUCA 3VR4A 5M5XB 4KY7A 1TS3A 4KHZA 3SEBA 4BS9A 1DYQA 3D8GA 5C5LA 2B2WA 1ILQA 2DN8A 1OO9B 1TKWB 1PRTD 4BY1B 5I9PA 4DAPA 3S9WA 1H9SB 5JOBA 5JAVA 1Q12A 1CHQD 5KYLA 5D65A 3QJYA 2B2TA 4OO1I 1STAA 3TN2A 1CQFA 4QB4A 1I6HB 2F0PA 5LL6S 3KLSX 2D62A 3H09A 1II3A 1A6XA 1D5MC 1CK1A 1NR4A 3FRPB 1K8OA 3AB9A 1F9RA 1G291 5G3LD 1TWCB 3P75A 1Y8OB 2EY6A 4DF7A 1CM9A 1K83B 1EWCA 1QB5D 2R92B 5CBAE 1Y69U 1JOOA 3FDTA 4NP5A 5T1GA 2B2UA 5A35A 3V96A 1LTGD 1S4ZA 1LT6D 1TR5A 3IL8A 1KAAA 1EZ8A 2MGSA 3HG9A 4KN4C 4ABNA 4KMUC 2E2JB 2FFKB 3I4LA 2EVBA 1LABA 1I4RA 4A3MB 2FHTA 3OIQA 1D2BA 1STHA 2IX1A 1U4LA 3NTHA 4G7ZC 1SYEA 1TU2B 3D6WA 4K5XA 4FNFA 1UUPA 3L3OC 3I70A 2L55A 4BA1I 5BN5A 1TT2A 5EKLA 1UNSA 2C5CA 2QDBA 3MHBA 1QNKA 5CV6A 2K04A 3G6JB 1LTBD 1SBBB 3M4OB 2L0CA 1RD9D 4AYBB 4BY7B 5FKAC 2R6GA 1GUOA 1EZ6A 1ZKOA 2JP1A 3NQIA 4RCNA 1XTCD 3PUVA 5IT9E 4N9PA 1TS5A 3R3OA 2XSCA 4A3JB 4QIWB 2L1BA 2KCNA 5KNCA 4WRDA 5K5PA 1KLUD 2Z1CA 3D6CA 3KLRA 1BCPC 1D6EC 3BDOA 5KNBA 2J7ZA 1S5ED 3C3LA 2L9HA 1LTSD 2PW7A 4IALA 1LT3D 2WKDA 3V05A 2QCPX 5D14A 3T4AC 4A93B 2EXZA 3J80L 1IL8A 4H13C 2JA5B 2BCOA 2NN6H 4KKUA 4DXFA 3G7LA 3S1RB 3NBHA 1O7ZA 1HTLD 2X6LA 3MC0B 1BDOA 3R8BA 3VYSA 1FD7D 4KJNA 3SDZA 3S1MB 1IHZA 4KV6A 3I91A 4YIJA 3Q22A 4FXGC 2FJ2A 1ET6A 5DM73 3OSOA 1DONA 1F2ZA 2X6GA 2VXWA 3RD4A 1I6VC 4X3TA 5FOBB 4H7BA 2O4XA 1WVLA 1E2VA 1WTQA 4J1MA 2RSNA 1JR0D 4ZAIA 2ZXOA 3T56B 2PQEA 3VR5A 1WD0A 1NAPA 1UEAB 4C3IG 2QILA 3GTQB 1XYIA 4S3SA 4N9TA 5A2QL 1I4XA 4Y7NB 4DA2A 1U9RA 1JB3A 1I4GA 1SYCA 1F2YA 3NHHA 4C56C 4JBWA 1Q1BA 1HTPA 2JA8B 2KEEA 5EQ0A 3HOWB 4A3KB 2XWJB 3QOJA 1IYUA 1Q1EA 3V2TA 1G6ZA 5CGKA 1O80A 2F0JA 2HDMA 2PNRC 1E0BA 4DXGA 1B2TA 1KDCA 1JCKB 3HOUB 3M4YA 1RDPD 2WV6D 5M3FB 2JSOA 5TSSA 1EYAA 1ICWA 5ELBA 5ELCA 1GUWA 4IFDH 1JQYD 1U4MA 3WOEA 1AEXA 3PIP3 1EY5A 1S5CD 1B3AA 3DEOA 2SNSA 1EY0A 2IX0A 1QJOA 4KY6A 3Q23A 1JC7A 2B8GA 2F0UA 2FMMA 2BE5D 5CV9A 1WD1A 3TSSA 3KLSA 3VYTA 1B50A 4K2KA 1XXGA 3I4NB 3DWQA 5EJWA 3W3AA 1TVXA 1SFOB 1T5EA 1SYGA 3D3RA 2A69C 1DD2A 4TQUS 4XQJA 3S15B 2VUMB 1LTID 2X69A 4KN7C 1ZYRD 1I3QB 1HCZA 4PMBA 1DOMA 2ID0A 2OEOA 5C4JB 1SYBA 4OO1H 4NW2A 2F0GA 4BBSB 1FNUA 5KGUA 3RZOB 2O5JC 1IW7D 4K6LA 5C4HA 5C44B 1HUMA 3M7NA 2KJXA 1FYCA 5C3EB 5HURA 2M00A 3M85A 2SNMA 2IPKD 4RKBA 1SMYD 2RDHA 2NN6G 2PMZB 4B08A 4HCEA 1GJXA 1Y1VB 1PMRA 2F0KA 3SR1A 1EQVA 3S16B 3ITPA 1B9NA 1NCVA 1W6KA 5T1IA 1Y8NB 3E0JA 2EJFC 4ZYSA 5BN3A 2D9UA 1H9MA 5I2XA 1TS2A 3F2UA 3HOYB 2NVYB 4HAEA 4U673 1J8IA 1WCMB 2WIIB 1FNVA 2A6HC 1A2TA 2MP1A 2EYLA 2EYMA 4U68A 3MTSA 4K14A 2K33A 4IURA 2RDFA 4KKTA 3T13A 3EROA 3OPOA 4O42A 4OL7A 3HGBA 4CGYB 3MXUA 4HN7A 2PYKA 3HOXB 1PTOD 3PUYA 2AQ3B 3NPPA 5ELEA 1CZGA 1EY6A 3MEHA 1GUNA 1G2SA 1SNMA 3MXGA 3NE5B 3OOCA 4O1NA 3JAML 3VA7A 2PZTA 5ISRA 3TZDA 4IFDJ 1MGSA 2F0QA 2KQ3A 4LJZC 4NKLA 2R93B 2E75C 2SDFA 4KY5A 5C4ZA 2JA7B 1KNEA 1GHJA 4IFDG 3A7AB 4H0LC 4CBVA 5M9OA 1IKMA 5FO7B 1PRTF 1STEA 4HR7B 3VYRA 2NVQB 1SYFA 2WP8J 1EU3A 3GD7A 1QNUA 4DNRB 1JORA 1G91A 1MI2A 4IUNA 3K5LA 1TIID 2AUKA 4DFAA 5EGTA 1BCPB 2K01A 3TP5A 4RGOS 5CORA 5J39A 3I72A 3GV3A 3IAYA 2D5DA 3PUXA 2E76C 4M8AA 3DEPA 3MVVA 3VR2A 5KIXA 3A55A 2TSSA 1YNJD 2HDLA 4XQNA 4OGQC 2WB1B 1PYWD 4ODGA 1VDZA 2EE1A 5G3LF 2Z4IA 1SNDA 1DJRD 4C3IB 5EKKA 1HQMC 2RA4A 1PFNA 3K7AB 1B9MA 3TZUA 2B2UC 3HOVB 1EYCA 1XWEA 1X3PA 1CA6A 4OO1G 1CQVA 3SHLA 4CKBA 4V190 3K57A 3GTMB 5FLXL 2EDGA 4HSPA 1SYDA 5C0XI 2Q8IB 4F8MA 1PZKD 3MXNA 3J80E 1DZ1A 1OXTA 1V8QA 2JYOA 1EEID 3VR6A 5ELFA 5EPLA 3C46A 1S5BD 3S1QB 5LL6X 1OXVA 5CV7A 4KD4A 4CHTB 1G2TA 2QEJC 3RZDB 2DY8A 4BBRB 1BNZA 2F0VA 5M5WB 5CV4A 4FF4A 1D1KA 4TSSA 1JWSD 3DMUA 2AWOA 1GXDC 2HQEA 1CFMA 4KTAA 2A74C 2NYZD 5CV8A 1EY7A 4KI0A 4A3GB 3NTIA 1EIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNY A;  4K14 A;  5F2D A;  2EY1 A;  3C1E A;  2SOB A;  1SYG A;  3E5S A;  2RDF A;  5JAV A;  5J22 A;  5CR3 A;  4J1M A;  5IGF A;  2F0N A;  1A3U A;  3PMF A;  4ME5 A;  5CV5 A;  3T13 A;  5KYL A;  4MIU A;  4ZUI A;  4ODG A;  3ERO A;  1STA A;  2F0M A;  2F0D A;  3C1F A;  1SND A;  3QOL A;  4NDX A;  4OL7 A;  4ZQ3 A;  5KEE A;  5EKK A;  2F0I A;  4K8J A;  4QB4 A;  5J1Z A;  1EZ6 A;  1STB A;  2F0H A;  5IOC A;  3VA5 A;  5I9O A;  3OWF A;  2PQE A;  2PYK A;  4G57 A;  5IGB A;  4DGZ A;  1STN A;  3U9O A;  2EY5 A;  4S3S A;  4N9P A;  2EYP A;  2F0P A;  1ENA A;  4LAA A;  4N9T A;  1EYC A;  2F3W A;  3R3O A;  3HEJ A;  4PMB A;  2OEO A;  1II3 A;  3NQT A;  1EY6 A;  1U9R A;  3D4D A;  5DAU A;  3MEH A;  3SHL A;  1SYC A;  1SYB A;  1ENC A;  5IOD A;  1SNQ A;  4KHV A;  5C5M A;  2F0L A;  3MZ5 A;  4WRD A;  4IZ8 A;  1F2Y A;  1SNM A;  3NXW A;  2F0G A;  5K5P A;  1A3V A;  2OXP A;  3NHH A;  4E6I A;  5KGU A;  4EQO A;  3SK6 A;  3NUC A;  1JOK A;  1EY4 A;  4K6D A;  3H6M A;  3NK9 A;  3OMC A;  5C4H A;  2F0S A;  4EVO A;  1KAB A;  1SNC A;  1EY8 A;  1RKN A;  3D6C A;  2PZT A;  3QOJ A;  5ISR A;  4EQP A;  4QMG A;  2EYO A;  5DEH A;  3SK4 A;  3V2T A;  5CGK A;  1SYD A;  2F0Q A;  2F0J A;  2ENB A;  2F0T A;  2KQ3 A;  3P75 A;  3SK8 A;  4EQN A;  4F8M A;  2WAC A;  5CC4 A;  3D4W A;  4NKL A;  3TP7 A;  5IGD A;  5HUR A;  4R8N A;  2EY6 A;  2M00 A;  3EJI A;  1SNO A;  4DF7 A;  1JOQ A;  4PMC A;  4KY5 A;  2SNM A;  1SNP A;  1KDC A;  3OMG A;  4ZUJ A;  5C4Z A;  1NSN S;  2OF1 A;  2PZW A;  2PW7 A;  4ID6 A;  4IAL A;  4RKB A;  4KJO A;  5I6Y A;  2RBM A;  1JOO A;  4QF4 A;  2EYF A;  1EYA A;  5C3W A;  3SXH A;  2F0W A;  4TRD A;  5C6A A;  5IGC A;  4NP5 A;  2EXZ A;  5M9O A;  3TP6 A;  4DU9 A;  5KYI A;  3QB3 A;  2RKS A;  3MXP A;  2NUC A;  1STY A;  2EYJ A;  4HMI A;  2F0K A;  3SR1 A;  4WOR A;  1KDA A;  1EQV A;  2PW5 A;  1AEX A;  1SYF A;  1A3T A;  5CV7 A;  4KD4 A;  2F0O A;  5E1F A;  3RUZ A;  4F7X A;  1EY5 A;  1TR5 A;  1KAA A;  1EZ8 A;  1NUC A;  2F3V A;  1KDB A;  2SNS A;  1EY0 A;  3P1H A;  4J6H A;  4RKL A;  1JOR A;  1A2U A;  3SK5 A;  4K2L A;  3ITP A;  2F0V A;  1EY9 A;  4IUN A;  4KJN A;  1TQO A;  2EY2 A;  4I65 A;  2F0E A;  5CV4 A;  5NUC A;  4DFA A;  3DHQ A;  1STH A;  3NP8 A;  4KY7 A;  4NMZ A;  5EGT A;  1IHZ A;  2F0F A;  3TP5 A;  4B9X A;  3HZX A;  2LKV A;  3D8G A;  3BDL A;  4K5W A;  4K8I A;  4HMJ A;  3DMU A;  4KV6 A;  1SYE A;  5C5L A;  5I6W A;  2HQE A;  4K5X A;  5J39 A;  4K5V A;  3ERQ A;  4KY6 A;  3BDC A;  4YIJ A;  2F0U A;  5KRU A;  4HTH A;  4KTA A;  5IIF A;  5E3F A;  2PZU A;  1F2M A;  4KD3 A;  3TME A;  5HGT A;  1TT2 A;  2EYH A;  5EKL A;  5CV9 A;  5IGE A;  3EVQ A;  5C3X A;  4B9W A;  3OSO A;  5CV8 A;  5IGG A;  3LX0 A;  4K2K A;  1F2Z A;  2QDB A;  3MHB A;  1EY7 A;  1A2T A;  3MVV A;  3T16 A;  3TP8 A;  5I9P A;  1EYD A;  5CV6 A;  4H7B A;  2EYL A;  2O4X A;  2EYM A;  5KIX A;  2KHS A;  3S9W A;  1STG A;  5JOB A; 
#chains in the Genus database with same CATH topology
 3CP0 A;  2RCN A;  4NXN L;  1TWF B;  3HP3 A;  1ZXT A;  4LUZ A;  4ULL A;  4HIK A;  3J81 L;  4G7H C;  5A2Q E;  1LM0 A;  3RMH A;  2F0I A;  3U9S A;  1A62 A;  4KKS A;  1I4H A;  1VQB A;  3BVM A;  4N8F A;  2HQL A;  5J3B A;  4DV0 Q;  3D4D A;  3X3M A;  1D5X C;  5C5M A;  3J7Z C;  1BR9 A;  1B44 D;  1B70 B;  1K83 H;  1ESF A;  3K5N A;  1R4P B;  3GTK B;  3I4M H;  2F0T A;  3EBE A;  3SK8 A;  3H3V C;  4LF4 Q;  3CQZ B;  4JI7 L;  4BWG B;  5LMN W;  3ER0 A;  1AZP A;  2K14 A;  4A3F H;  3HOX G;  3S14 B;  5JVG 3;  2B63 B;  4KJO A;  2ICI A;  3TBI B;  2A8V A;  2M9V A;  1A15 A;  4YWM A;  1YNN D;  4A3L H;  1EOT A;  3EFX D;  2O5I C;  3TS0 A;  2NUC A;  4L63 B;  1DOL A;  4B3S L;  3M3Y H;  1ML0 D;  3UI2 A;  3RUZ A;  2B2V C;  2UU9 L;  4UPA A;  3JAM c;  3GTL B;  1VMP A;  4A3E G;  3CRK C;  4AH6 A;  4GOP C;  2EJG C;  2EY2 A;  1KQS A;  4A76 A;  4C1N I;  3QG1 A;  1X3E A;  4IN3 A;  2Y0S E;  2R93 G;  2JEA I;  4IOA A;  1BXT A;  1KLG D;  1YJ9 A;  4MN3 A;  3BDC A;  3R2I A;  4KD3 A;  2JE6 I;  5DLQ E;  3PO3 H;  3VR3 A;  1C48 A;  2EYH A;  2O2L D;  5IGE A;  2PI2 E;  1PRT C;  2AMC B;  4L6T B;  2MO0 A;  1VS0 A;  4P72 A;  4JOI C;  5CYU A;  3LWU A;  2ZTC A;  2CH4 W;  4LMQ D;  1PFB A;  4GZY C;  3C1E A;  3J7Y W;  5M3M G;  2EZV A;  1EEF D;  1O7L A;  4XYO A;  4GKK L;  3I4O A;  5I4D A;  1T9H A;  4MIU A;  4ZUI A;  3PO2 B;  1WOC A;  4EGV A;  2EJM A;  2F0D A;  1HNX Q;  4A3D G;  1VMC A;  4JC0 A;  4X65 L;  1OXX K;  5IGB A;  3S2H B;  1H9K A;  3JAM i;  2E5L L;  3U9O A;  1FR3 A;  4LAA A;  2HIX A;  5I2Y A;  3CU7 A;  4PMW A;  4DV7 Q;  4JYA Q;  1NR2 A;  3NQT A;  4DAM A;  5IWA Q;  2J4X A;  3I8Z A;  1ENC A;  4P2C B;  2DNE A;  3D0F A;  4DPG A;  3T53 B;  4C3J H;  2RHS B;  4B3M L;  2OXP A;  3GTJ B;  3NUC A;  1F77 A;  3O13 A;  1EY4 A;  2CW0 D;  1S3O A;  2F0S A;  1PLF A;  4DR3 Q;  1YJN A;  2B2V A;  1VF5 C;  2R3Z A;  2XRQ D;  4HCS A;  4LUV A;  1Y8P B;  1E3P A;  2RQX A;  4GOP A;  4RHS A;  1GM5 A;  1BF4 A;  4R8N A;  1MIU A;  5JPM C;  1SNO A;  1KNA A;  2ES2 A;  4QQB X;  5GRO A;  5IYB H;  3HOZ H;  4KK7 A;  3BVZ A;  3UDF A;  2WAQ E;  3A74 A;  3NWT A;  3U58 A;  2MJ8 A;  1QWY A;  1V1Q A;  1X6O A;  2ICE C;  2MHV A;  2NZO A;  3Q6S A;  2SEB D;  4GLA C;  1HNW Q;  1D5Z C;  1SN8 A;  1KDA A;  3U50 C;  1QCB D;  1C4Q A;  2IT1 A;  5ELN A;  4JOI A;  1Q3L A;  3ULJ A;  2UXC L;  1ROD A;  4YCW A;  2I46 A;  2VZA A;  1KDB A;  1RTO A;  3DLL A;  2ZXP A;  1FGB D;  4PV1 C;  1QIL A;  4DR2 Q;  3AFQ A;  4RA8 A;  2F0F A;  3OWE B;  4A75 A;  2LKV A;  3QIA A;  2Q2U A;  1Y1W H;  2NWG A;  2I5M X;  3MEF A;  3X3N A;  1NTG A;  5KND A;  2PZU A;  2I0Q A;  4FXD A;  5D3D A;  4DUZ Q;  1DXM A;  2NZ1 D;  3DM1 A;  3K81 C;  2YU9 H;  3LX0 A;  3OHX C;  3GDE A;  1V1O A;  2GVB A;  1LLR D;  3KF8 A;  3A8I E;  4GNX B;  4LFA Q;  2A68 D;  4R4O A;  3E5S A;  4DNI A;  2KA7 A;  1RIP A;  4FXK C;  1GUT A;  2E2D C;  4G4K A;  4NDX A;  4ZQ3 A;  3S17 H;  3E9H A;  3G48 A;  2AWN A;  4Z9C B;  1STB A;  5I9O A;  3OWF A;  4G57 A;  4X3S A;  2NTT A;  4DGZ A;  3MXN B;  3J7A F;  2AUJ D;  3AFP A;  1XMQ Q;  1X55 A;  2HHH Q;  1X3Q A;  2R7D A;  1TWG H;  1Q81 C;  4EQ5 A;  3GTP B;  2ZXR A;  3JAM E;  3SE0 A;  1Q46 A;  2F0L A;  3DWP A;  2L12 A;  1E1T A;  2A6E D;  4YWK A;  1JOK A;  2FMC A;  2JXM B;  1QG7 A;  1DM0 B;  4WJW A;  4OEM B;  4DV0 L;  1SNC A;  1RKN A;  3I4M G;  3HKZ B;  2YTY A;  2Z4H A;  3SK4 A;  1GKH A;  1HRJ A;  4QCL A;  3CCM A;  3S1N H;  2PQA A;  3FKI B;  3TP7 A;  1Q90 A;  3GTG H;  3MWY W;  3RR5 A;  4A3F G;  1JOQ A;  1WTX A;  1N32 L;  4C3H H;  2L5T A;  3QO2 A;  4ZUJ A;  2YV5 A;  1WTP A;  4LWC A;  2PZW A;  3T51 B;  4A3L G;  4ID6 A;  4H02 A;  1PDQ A;  1IBK Q;  2IJ0 A;  1LTT D;  2CHB D;  3QB3 A;  3A8K E;  2QDL A;  4HMI A;  4LF4 L;  2AQ2 B;  1YHQ A;  4ALP A;  5C0X H;  4A3B B;  4TKO B;  2R7Z B;  2XRS D;  3KF6 A;  3K0Y A;  1Y14 B;  1E2Z A;  1E24 A;  4P75 A;  4LF8 Q;  2BDN A;  4B3R L;  1B1Z A;  1WTO A;  4BXX H;  2F1M A;  5COY A;  4JI2 L;  1FL0 A;  3HFZ B;  1VF7 A;  1EFI D;  3BDL A;  3I4N H;  2V4D A;  2Q8T A;  4A4I A;  3W1G A;  1VQA A;  4DUY Q;  3ERQ A;  1IBM Q;  3PO3 G;  2B63 G;  2VB3 X;  1FNW A;  1PTO F;  4AIM A;  3J81 i;  2JA6 B;  1CSQ A;  1Q7Y C;  4HJ9 A;  3OTO L;  2NVT H;  1CT1 D;  1TS4 A;  1J5E Q;  2K28 A;  3D31 A;  4FF2 A;  2ZJQ A;  1YBY A;  4GKJ Q;  1E7Z A;  2SOB A;  2NTS A;  1BBX C;  3AEV A;  1AW7 A;  5IGF A;  2Q8R E;  3BJU A;  3I3C A;  3Q24 A;  3BVG A;  4F88 A;  3K5O A;  3D4R A;  2Y0S G;  2IW3 A;  1HUN A;  4K8J A;  5EPK A;  2NN6 I;  4AQY Q;  3BS1 A;  4QUC A;  5FJ8 H;  3STB C;  4HIM A;  2EYP A;  3H0G H;  2F3W A;  1EL0 A;  2E2H B;  1VQK A;  1HNX L;  4C3J G;  1JE4 A;  5DAU A;  1SXT A;  1SNQ A;  4UP8 A;  5FLX E;  3TRZ A;  4IZ8 A;  2BOS A;  2DY7 A;  2LXK A;  1M8A A;  1PH2 A;  3MA2 B;  1IXR A;  2A73 B;  4YWL A;  4V0B A;  4DV7 L;  5EBD A;  4HJ7 A;  2HT1 A;  1UAP A;  1IBL L;  5IWA L;  4EQP A;  3KK7 A;  2HD3 A;  4ILW A;  3P7J A;  1IZ6 A;  1GUG A;  5FO8 B;  1PZI D;  3K6O A;  1C0A A;  1ILP A;  2PI2 A;  3HOZ G;  5DNF A;  1N34 Q;  1VQE A;  2XNA C;  3NSW A;  1SNP A;  3H91 A;  4HJA A;  4DR3 L;  1VQ9 A;  1HA5 A;  2OF1 A;  1EWI A;  2EYF A;  2IL8 A;  2CQO A;  5JJL A;  4IPH A;  4OWX B;  3BYT B;  1STY A;  4QL5 A;  2CVR A;  1A3T A;  4A3E B;  3RLF A;  2OWO A;  4P73 A;  4J6H A;  1PTO H;  1KRT A;  1S72 A;  2OQK A;  3SK5 A;  3T1Y Q;  4K2L A;  1CZW A;  4UDU C;  1HNW L;  3OIP A;  4I65 A;  2F0E A;  1JJG A;  2F4I A;  1Y1W G;  4MTN A;  2UXD L;  3AYH B;  2K5Q A;  4HMJ A;  1IKL A;  2WAQ G;  2H5X A;  1Q86 C;  1TWH B;  1XMO L;  4OHJ A;  1M1K C;  5HGT A;  1CSP A;  5C3X A;  2BH2 A;  2K6A A;  4B9W A;  2BE5 C;  5IGG A;  4IUP A;  3OW7 A;  4DR2 L;  2NVX H;  2VS1 A;  5IYC G;  4G7O C;  1EYD A;  1VQL A;  3PUW A;  5M3M B;  2K5H A;  3J81 E;  5M5Y B;  4IQZ A;  1B53 A;  4A3D B;  3PF5 A;  3CW2 C;  1JWU D;  4ME5 A;  1VQ8 A;  1LTA D;  1MSG A;  3ONA B;  4JCV E;  1GHK A;  1O78 A;  3A54 A;  3WDN A;  1X65 A;  1SE3 A;  4IFD I;  5AJ3 Q;  1N32 Q;  1HA6 A;  3GV6 A;  4LUO A;  3GTO B;  4GOP B;  1IYV A;  3VA5 A;  5HY6 A;  4QJF A;  4LFA L;  5EKI A;  2EY5 A;  1ZYR C;  4IO9 A;  4LFC L;  5LMN Q;  4X3K A;  1T5X D;  1KTK A;  3DUZ A;  1H9J A;  4LF6 Q;  1TWA H;  2JEB I;  1ZEQ X;  4KHV A;  4PQX A;  1C8C A;  4DN4 M;  4X64 Q;  1PRT B;  2B39 A;  2K05 A;  4JG2 A;  4K6D A;  1EFW A;  3C2P A;  1IW7 C;  4EVO A;  5IT9 c;  4NXM L;  3AMU A;  1BCP D;  1EWH A;  4A3I H;  1HHV A;  1NMG A;  2RDG A;  1AE3 A;  4X3U A;  1N36 Q;  2B29 A;  1EIH A;  2LY7 A;  4ZKC B;  3D4W A;  3EJI A;  5C0X J;  5ELO A;  3NBI A;  5GAD C;  3PCO B;  4OWT B;  5C4X H;  4JI6 Q;  2HUG A;  1EQQ A;  1ONL A;  5C3W A;  2R61 A;  3SXH A;  2F0W A;  1SMY C;  4XIG S;  3M7G A;  4CKE A;  4KHP Q;  2HCC A;  1RF2 D;  5C0X G;  4C2M H;  4DV1 L;  3A5Z B;  5D3I B;  3NWS A;  4BXX G;  3S2D B;  1M4V A;  2K75 A;  1U4P A;  1IBK L;  4HJ8 A;  3KF8 B;  3KBX A;  4XXE A;  2BA0 A;  3A8J E;  1ENF A;  2BA1 A;  1B7Y B;  2TMP A;  2UUA L;  3NP8 A;  4B9X A;  4OEL B;  4YHH Q;  1SSO A;  4K5W A;  1CUK A;  1GUS A;  4Y52 H;  2DJF C;  4LF8 L;  1EOV A;  5K36 H;  4OX9 Q;  1DOK A;  5M5X H;  2NBF A;  3TME A;  1U4R A;  3W1B A;  4LFB L;  2FIN B;  1KXL A;  2DJG C;  4FO2 A;  4O0A A;  4PZ8 A;  3T16 A;  4HSV A;  1PZJ D;  3CPW A;  2F4V L;  4DV2 Q;  3UE0 A;  2KEC A;  2Z8L A;  2KHS A;  3E9I A;  1STG A;  2G9D A;  1IBM L;  4IUT A;  3CKI B;  1X32 A;  1PH7 A;  1OXS C;  1F9S A;  1S5F D;  3N52 A;  1HFN A;  4BY1 H;  5CR3 A;  3DWA A;  5CV5 A;  1LO5 D;  5CMD A;  1B3Q A;  2KCC A;  4QGU A;  1GD7 A;  3RN5 A;  1J5E L;  3ZYY X;  5FJ8 G;  4L5T A;  3PSI A;  2PQA B;  1Q8I A;  3H0G G;  5GQO A;  4GKJ L;  5JJK A;  2H1E A;  1HQR D;  4M1U B;  4DR1 Q;  4C1N K;  1PTO C;  3F2C A;  2B8F A;  3IFT A;  4IUV A;  3PGZ A;  1I6H H;  1BQQ T;  1EU4 A;  3MZ5 A;  1HJP A;  4LF9 Q;  1GOZ A;  4RAU C;  4AQY L;  2K5W A;  2VQE Q;  3I4M B;  2K1B A;  4L8J A;  2RSO A;  3H6M A;  2IY5 B;  1VQC A;  1EYG A;  1EY8 A;  3KF6 B;  4DV4 Q;  4JI0 L;  1WTV A;  2WIN B;  4A3F B;  3QWN A;  3K58 A;  4QMG A;  5DEH A;  1HPC A;  1MBY A;  2XGT A;  2CFM A;  1MSH A;  5IGD A;  5CC4 A;  1SRO A;  3E0E A;  4RH6 A;  2WFW A;  3M3Y B;  3OMG A;  3IKJ A;  4IOC A;  2DUD A;  4KLK A;  1SDF A;  2RBM A;  3HS0 C;  1TWC H;  4TRD A;  4CDE C;  4XYQ A;  1BO0 A;  4DK0 A;  1FVI A;  2R92 H;  5HGQ A;  2PW5 A;  1TY0 A;  3I90 A;  5AFW A;  5E1F A;  2F0O A;  4DK6 C;  2LXJ A;  3BG3 A;  2DGY A;  1VCI A;  2UUB Q;  3PIO A;  5ELD A;  3N6R A;  4JV5 Q;  1EY9 A;  4XT1 B;  2K52 A;  2M2L A;  1OXU A;  5LHY 1;  2EQS A;  1Z7T A;  1SRU A;  3PO3 B;  4R4T A;  3R2T A;  4K8I A;  4IUU A;  4K5V A;  4AYB E;  4OXP A;  1NJI C;  2E2J H;  3GQB A;  5KRU A;  4LK1 C;  4HTH A;  4RFB A;  4DAY A;  3PIO 3;  4GLV B;  2KBN A;  4A3M H;  1M90 C;  4RCO A;  1S5D D;  2A5H A;  2PCF B;  1A0I A;  3L9A X;  4OIK A;  2VNU D;  2JJQ A;  2C9O A;  4N8X 1;  1QVF A;  2K03 A;  4QIW E;  1TY2 A;  1PH8 A;  4PNY A;  2A69 D;  2Y0S B;  1YNJ C;  1XPR A;  1GVP A;  2F0N A;  1W3S A;  4GLX A;  2IWH A;  4RWS C;  3QR8 A;  4RGT A;  1LTL A;  5IOC A;  5LMU Q;  3M4O H;  3P20 A;  1PH5 A;  1SJE D;  1SE8 A;  1B4O A;  3LGJ A;  4C3J B;  1X54 A;  4JVZ A;  2BH8 A;  4BY7 H;  2VB2 X;  1EQT A;  3KDF A;  1D1I A;  1K73 C;  1R9T B;  4CKC A;  3CPF A;  2CWP A;  2N88 A;  3NXW A;  3Q0A A;  3EQL C;  1VQP A;  1BOS A;  2F03 A;  1LT5 D;  1SJH D;  4A3J H;  3NK9 A;  1Q8K A;  1HZB A;  4LF6 L;  1VQJ A;  3HOZ B;  2XWB B;  1JWM D;  2OT2 A;  4F87 A;  3CHB D;  1L0Y B;  2DNC A;  5GAH C;  4CJ2 C;  4X64 L;  1LTR D;  4JI3 Q;  3H3V I;  5C4X G;  2YYZ A;  1HXY D;  1WTH A;  1XTD A;  2KCT A;  3I73 A;  1NSN S;  3BYY B;  3PV0 A;  5I6Y A;  3H94 A;  1XX8 A;  5EBC A;  2XN9 C;  1N36 L;  3TP6 A;  4J8Q A;  1B8A A;  5FO9 B;  1W2B A;  1V1P B;  2AQ1 B;  2IX3 A;  1LAC A;  4A93 H;  1V43 A;  4JI6 L;  2MPM A;  1G6P A;  4I7Z C;  1Y1W B;  2JA5 H;  4DR6 L;  3IFD A;  1UWV A;  3PUZ A;  4KHP L;  2B2Y C;  3S1R H;  5IGC A;  2WAQ B;  5IP9 H;  1WTR A;  2BDO A;  1PH6 A;  3NEM A;  2YU9 B;  5K36 G;  1VQG A;  2UUC Q;  2KED A;  2ZT9 C;  1AN8 A;  2N3S A;  3S1M H;  5IIF A;  1YHB A;  1CTM A;  2KUM A;  2NB0 A;  2A6H D;  4RGN A;  3EVQ A;  2B3G A;  2QF7 A;  3ICE A;  1L2F A;  4YHH L;  5DM6 3;  4WFN 3;  4FYD A;  4L5S A;  3S17 B;  4XTC S;  3VYU A;  4DR5 L;  5JPN C;  4L5Q A;  2CQA A;  4OX9 L;  1ET9 A;  1RL2 A;  5J22 A;  5H1S E;  2D2C C;  4CDF C;  3PMF A;  1A3U A;  4DR4 Q;  1MJC A;  4JPB W;  1QOH A;  2Z9H A;  3QOL A;  3DM3 A;  4DV2 L;  1TWG B;  3K8A A;  4DKA C;  2MUY A;  5JEA H;  3L7Z C;  1STN A;  2AKW B;  3EIV A;  4FDB A;  1HFG A;  1J9O A;  1CKM A;  5IOD A;  1PFM A;  1R4Q B;  4R4I A;  1CI3 M;  5IT9 L;  1H9S A;  3GTQ H;  1A3V A;  4E6I A;  4HED A;  4EQO A;  4Y7N H;  1VQN A;  3S1N B;  4RGM A;  2H4O A;  4DR1 L;  3GTG B;  5JVH 3;  4C3H B;  2EYO A;  1YI2 A;  3K59 A;  3MFG A;  2ENB A;  4LF9 L;  3NTK A;  2B2Y A;  4FF1 A;  2WAC A;  5IY0 A;  2JA8 H;  4YCU A;  3HOW H;  4A3K H;  4IUQ A;  4PMC A;  4DV3 Q;  1PXU A;  2RVL A;  1CKN A;  3I2Z A;  4DV4 L;  2ASB A;  3HRZ C;  1PH1 A;  3BU2 A;  5KYI A;  1YNN C;  3EA6 A;  1SLJ A;  1SE4 A;  3HOU H;  4YY3 Q;  5M3F H;  4UAI A;  1I4P A;  1PYB A;  2WKC A;  2QA4 A;  2LFN A;  4DNT B;  5BR8 Q;  4QUF A;  5EPJ A;  2L4N A;  4MHE A;  2E74 C;  1A2U A;  5E4W C;  3W2D A;  2GA4 B;  4ZRZ A;  2EPB A;  4LF5 Q;  1YIT A;  3E6Z X;  3HZX A;  5FK9 C;  5I6W A;  1RHP A;  4XDX A;  2NVT B;  5E3F A;  4JV5 L;  4FVM A;  2K7V A;  3K7U C;  1E2W A;  4DK1 A;  1HNZ Q;  1SE2 A;  3TP8 A;  3KUP A;  3IRB A;  2QKI C;  1F9P A;  3AU7 A;  3FMC A;  2ZM6 Q;  3KLW A;  2Z6B A;  1W6J A;  1FGU A;  1CA5 A;  1AZQ A;  2EY1 A;  4O2D A;  5E4X A;  1A8V A;  5CBE E;  4JI1 Q;  1G51 A;  1L0X B;  1H9R A;  3H0G B;  2F0M A;  3FPP A;  3C1F A;  3GTP H;  4I7A A;  1VQF A;  2G9H D;  5J1Z A;  2KVM A;  1SFO H;  2F0H A;  1BUV T;  4AYB G;  2K5D A;  1HR0 W;  4BY7 G;  4RG1 A;  4L5R C;  1XNR Q;  4XT3 B;  1ENA A;  4MNO A;  3MAQ A;  1RTN A;  2Q2H A;  3HEJ A;  2K5N A;  1BKB A;  3S15 H;  2VUM H;  1JIC A;  3WOF A;  2LS0 1;  3K5M A;  2N49 A;  1CHP D;  4A3J G;  1I3Q H;  3LNN A;  2ZTE A;  3SK6 A;  1UE6 A;  4JBK A;  2PMZ E;  2LMC B;  4A3C H;  5C4J H;  1QE6 A;  2CW0 C;  1QZH A;  3J7A V;  3KBG A;  3SVM A;  3FEW X;  4DAV A;  4BBS H;  3BZK A;  4X6A H;  3RZO H;  1PV4 A;  4EQN A;  4FF3 A;  1D8L A;  1RJT A;  4R8I A;  4IPD A;  1AFP A;  2R7F A;  3GO5 A;  2HCI A;  5C44 H;  1HZC A;  1EIF A;  1I4Q A;  4QF4 A;  1ESR A;  5C6A A;  1ICF B;  4ZKB B;  5C3E H;  1KL9 A;  4RHR A;  4DAY B;  2CCZ A;  2EYJ A;  1PTO B;  3A56 A;  2Q2T A;  4J15 A;  4JI3 L;  4WOR A;  4A93 G;  2Z0S A;  4JYA L;  4XQQ A;  3J80 c;  4F7X A;  1LT4 D;  2JA5 G;  1SAP A;  2QGQ A;  3K80 C;  1K8M A;  1LV9 A;  4RKL A;  2J0T D;  2XVS A;  1Y1V H;  4BA2 I;  1E1O A;  2JQO A;  2KOL A;  2N55 A;  3DXJ C;  5IYB G;  3S16 H;  4ZLT F;  4K0K Q;  1YVC A;  1YIJ A;  4CDC C;  3DHQ A;  4H44 C;  4NMZ A;  2Z6K C;  1K3B C;  1F9Q A;  3F8T A;  2XIW A;  4CJ1 B;  2NVX B;  3GP7 A;  3BZD B;  4LW1 A;  1Z47 A;  4YCV A;  4ZK9 B;  1RCV D;  1F2M A;  2FXQ A;  2N8N A;  3SGI A;  3KDF B;  3ND9 A;  4RMF A;  3RN2 A;  3HOY H;  2NVY H;  1C7Y A;  1SEB D;  3ND8 A;  4R9W A;  5JEA J;  2UUC L;  1WCM H;  2I07 B;  5F2D A;  5JJZ A;  1BCP F;  4JI7 Q;  2A68 C;  4EX5 A;  2PPB C;  3WWV A;  1G8Z D;  5KEE A;  3A7L A;  1WTW A;  3MFY A;  1WI5 A;  5JEA G;  2B2W C;  1TWA B;  3CD6 A;  1NY4 A;  4UHV A;  2PO4 A;  4GS3 A;  1OTC A;  1H95 A;  1LYL A;  1V1P A;  4DR4 L;  2QW7 A;  4JK1 C;  5EAY A;  2UU9 Q;  4A3I B;  1AP0 A;  3HOX H;  4CJ0 B;  4DUZ L;  4CDD C;  2A6E C;  1FJG Q;  3Q8D A;  3OMC A;  1KRS A;  1KAB A;  2B2T C;  1MD2 D;  3HKS A;  5C4X B;  2JA8 G;  1I50 B;  3K0X A;  3CRL C;  3HOW G;  4A3K G;  4GN4 B;  3CCV A;  1QVC A;  2XTI A;  4OWW B;  4UP9 A;  4JI4 Q;  2Z6K A;  3FPU B;  4C2M B;  5IYD H;  4OIJ A;  3LWE A;  4Q0F A;  2YTX A;  4X66 Q;  3URY A;  4Q5V A;  2L11 A;  4DU9 A;  2R93 H;  2EOT A;  3HOU G;  2RKS A;  1XMQ L;  3MXP A;  5GAG C;  5M3F G;  4JBM A;  2JA7 H;  1HH2 P;  4PZ6 A;  2HHH L;  2E2I B;  5BN4 A;  1DCZ A;  1O7Y A;  3FVQ A;  2QEX A;  3TDQ A;  4FP5 D;  1NUC A;  3UE1 A;  2JN4 A;  2F3V A;  4JI5 Q;  3P1H A;  4C3H G;  1F2L A;  1Z6H A;  3R93 A;  1U0L A;  4DV5 Q;  4WJ4 A;  1TQO A;  2K32 A;  2KHJ A;  5NUC A;  3VR4 A;  5M5X B;  2NVQ H;  4UP7 A;  4KY7 A;  1WYD A;  1TS3 A;  4KHZ A;  3SEB A;  4BS9 A;  4YY3 L;  1DYQ A;  2WB1 E;  3NEN A;  3D8G A;  5C5L A;  2B2W A;  2GVA A;  3A5U A;  2ZJP A;  3CCE A;  1ILQ A;  2P5Z X;  2DN8 A;  1OO9 B;  3OW2 A;  2F52 A;  1TKW B;  4JI8 Q;  1PRT D;  3CCU A;  4LF5 L;  1P8L A;  4BY1 B;  5I9P A;  4HID A;  2UXB Q;  2I5H A;  4DAP A;  3S9W A;  1H9S B;  5JOB A;  2VL6 A;  3I4N G;  5JAV A;  1Q12 A;  1CHQ D;  3G4S A;  5KYL A;  5D65 A;  4R4Q A;  3QJY A;  2B2T A;  3CXC A;  1VQ7 A;  4OO1 I;  1STA A;  1DGS A;  3TN2 A;  1N33 Q;  1CQF A;  4QB4 A;  2ZM6 L;  1I6H B;  1NE3 A;  1UE5 A;  2VUM G;  2F0P A;  4DK3 C;  5LL6 S;  1CKN B;  4JI1 L;  3KLS X;  4C3I H;  2D62 A;  3H09 A;  1II3 A;  1A6X A;  1D5M C;  4DUY L;  1CK1 A;  4B3T Q;  3K7A H;  4MZ9 A;  3HOV H;  4A3C G;  1NR4 A;  4JW0 A;  3FRP B;  1K8O A;  1VQO A;  3RLN A;  4BBS G;  3AB9 A;  3ERS X;  4PZ7 A;  1F9R A;  3GTM H;  1G29 1;  1BBU A;  5G3L D;  2Q2I A;  1TWC B;  3P75 A;  1PH4 A;  1Y8O B;  4PG3 A;  2K50 A;  5FLM H;  2EY6 A;  5C44 G;  4DF7 A;  1CM9 A;  1K83 B;  1EWC A;  2KEN A;  5C3E G;  1QB5 D;  2R92 B;  5JJI A;  2EIF A;  5CBA E;  1Y69 U;  3ULL A;  3J7A 5;  1JOO A;  3FDT A;  4NP5 A;  1JJC B;  1L1O C;  5T1G A;  2B2U A;  5A35 A;  3V96 A;  1LTG D;  1S4Z A;  4DR7 Q;  4X62 Q;  1LT6 D;  1TR5 A;  1Y1V G;  3IL8 A;  3AQQ A;  1KAA A;  1EZ8 A;  2MGS A;  3HG9 A;  1NBW A;  4KN4 C;  4ABN A;  3S1Q H;  4KMU C;  2E2J B;  2FFK B;  1K28 A;  3U4V A;  3I4L A;  2EVB A;  1LAB A;  1I4R A;  4A3M B;  2FHT A;  3OIQ A;  1D2B A;  1STH A;  2IX1 A;  1U4L A;  3NTH A;  1VQI A;  4G7Z C;  3RZD H;  1YJW A;  1SYE A;  1TU2 B;  3M4P A;  3D6W A;  4K5X A;  4WJ3 M;  4BBR H;  4FNF A;  1UUP A;  5M5W H;  3L3O C;  3I70 A;  2L55 A;  4BA1 I;  5BN5 A;  1N34 L;  1TT2 A;  4K0K L;  5EKL A;  3HOY G;  3BZC A;  2OCE A;  1UNS A;  2C5C A;  2QDB A;  3MHB A;  1QNK A;  5CV6 A;  1WCM G;  3CME A;  2K04 A;  3G6J B;  1LTB D;  3F2D A;  1SBB B;  3M4O B;  3RNU A;  2G5D A;  2L0C A;  1RD9 D;  2VW9 A;  4A3G H;  1N9W A;  4AYB B;  4UY8 C;  4BY7 B;  1EUJ A;  4DV6 Q;  5FKA C;  2R6G A;  1GUO A;  1BBW A;  1EZ6 A;  1ZKO A;  2JP1 A;  3NQI A;  3T1Y L;  1TWF H;  4RCN A;  1XTC D;  3PUV A;  5IT9 E;  2OTJ A;  4N9P A;  1TS5 A;  3R3O A;  1NMF A;  2XSC A;  4A3J B;  4QIW B;  3B6Y A;  2OQ0 A;  2L1B A;  3TQY A;  2KCN A;  3KJO A;  1IYJ B;  5KNC A;  4B3R Q;  1L1O A;  4WRD A;  2VQF Q;  5K5P A;  4JBJ A;  4JI2 Q;  1TXY A;  1KLU D;  2Z1C A;  3D6C A;  4NB3 A;  2YTV A;  3KLR A;  1ASZ A;  1BCP C;  2NZH A;  1D6E C;  4ZCK A;  3BDO A;  5KNB A;  2J7Z A;  1S5E D;  3KFU A;  5IYD G;  3C3L A;  1FJG L;  2L9H A;  2PNH A;  1LTS D;  3OTO Q;  2PW7 A;  1JJ2 A;  4IAL A;  5AJ3 L;  1LT3 D;  2WKD A;  3V05 A;  2QCP X;  3GTK H;  5D14 A;  5E7N A;  3T4A C;  4A93 B;  2EXZ A;  2JA7 G;  3CQZ H;  3J80 L;  1IL8 A;  4H13 C;  4A3I G;  2N78 A;  2JA5 B;  2BCO A;  2NN6 H;  4KKU A;  5LMN L;  3S14 H;  4DXF A;  3KOJ A;  4JI4 L;  3G7L A;  2B63 H;  3S1R B;  2KHI A;  1PA6 A;  2D0O A;  1O7Z A;  3NBH A;  1JT8 A;  1HTL D;  2X6L A;  3MC0 B;  1BDO A;  3R8B A;  1YZ6 A;  4X66 L;  1A63 A;  1FD7 D;  4KJN A;  3VYS A;  3SDZ A;  3S1M B;  1IHZ A;  4KV6 A;  3I91 A;  3GTL H;  1YNX A;  4JI5 L;  4YIJ A;  3Q22 A;  4FXG C;  4ME3 A;  2FJ2 A;  1JB7 A;  1X9N A;  1ET6 A;  4DV5 L;  5DM7 3;  1HR0 Q;  1PH3 A;  4POF A;  3OSO A;  1DON A;  1F2Z A;  2X6G A;  2VXW A;  3RD4 A;  1C9O A;  1I6V C;  4X3T A;  5FOB B;  4H7B A;  1PVO A;  2O4X A;  1IBL Q;  3T1H Q;  4R4C A;  2MO1 A;  1WVL A;  4MTK A;  1E2V A;  1WTQ A;  1Z9F A;  4J1M A;  2D0P A;  4JI8 L;  1VQH A;  2RSN A;  1QZG A;  2WB1 G;  3G71 A;  2UXB L;  1R9T H;  3I56 A;  1JR0 D;  4ZAI A;  3CCQ A;  2ZXO A;  3T56 B;  2PQE A;  3VR5 A;  1WD0 A;  1NAP A;  1UEA B;  3STB D;  3VDY A;  2OTL A;  4C3I G;  2QIL A;  3GTQ B;  1XYI A;  4S3S A;  4N9T A;  5A2Q L;  3PO2 H;  1I4X A;  4Y7N B;  1J6Q A;  1LUZ A;  4DA2 A;  1U9R A;  3NEL A;  1JB3 A;  4BY1 G;  1N33 L;  1I4G A;  1SYC A;  3HOV G;  3S2H H;  3CC2 A;  1S40 A;  1F2Y A;  3NHH A;  3TEH B;  4C56 C;  4JBW A;  1Q1B A;  1X56 A;  1PHJ A;  1HTP A;  2JA8 B;  2KEE A;  5EQ0 A;  3HOW B;  4A3K B;  2XWJ B;  2UXD Q;  3QOJ A;  2LSS A;  1IYU A;  1Q1E A;  3V2T A;  4B3T L;  5CGK A;  5FLM G;  1O80 A;  1G6Z A;  3GTJ H;  4IJL A;  2F0J A;  2HDM A;  2PNR C;  1XMO Q;  1E0B A;  5FLX c;  4DXG A;  1B2T A;  1E22 A;  2MNA A;  1EQR A;  3E3X A;  1KDC A;  1JCK B;  3PIP A;  3HOU B;  3M4Y A;  3L0O A;  1RDP D;  2WV6 D;  5M3F B;  1XPU A;  2JSO A;  5TSS A;  1EYA A;  4POG A;  1ICW A;  5ELB A;  5ELC A;  4HIO A;  4IFD H;  1GUW A;  1IL2 A;  1JQY D;  1U4M A;  4IPG A;  1AEX A;  3WOE A;  1L0W A;  3PIP 3;  1EY5 A;  1S5C D;  1B3A A;  3DEO A;  1PFS A;  2SNS A;  5IP7 H;  3ULP A;  1EY0 A;  2VQE L;  1Q82 C;  2IX0 A;  5IYC H;  3S24 A;  1VQ5 A;  1QJO A;  1WFQ A;  3FP9 A;  4DR7 L;  1AE2 A;  4LFC Q;  4BBR G;  3M9B A;  4X62 L;  3CF5 A;  3JC6 6;  2VY3 A;  2E8G A;  2IHF A;  4LF7 Q;  4KY6 A;  3Q23 A;  2R92 G;  1QVG A;  1JC7 A;  2B8G A;  2F0U A;  2JA9 A;  4GN5 A;  2FMM A;  4LNQ A;  2BE5 D;  1QUQ A;  5CV9 A;  1WD1 A;  3TSS A;  3KLS A;  3VYT A;  1B50 A;  4K2K A;  1XXG A;  3RLO A;  4NXM Q;  3I4N B;  3DWQ A;  5EJW A;  1BVS A;  3W3A A;  1TVX A;  1SFO B;  4A3G G;  1T5E A;  1UEB A;  1I94 Q;  1SYG A;  3D3R A;  2A69 C;  1PYS B;  1DD2 A;  4A3M G;  4TQU S;  4XQJ A;  1PH9 A;  3S15 B;  2VUM B;  2UUB L;  3OYY A;  5IE8 A;  1K8G A;  3J81 c;  3HKZ E;  1LTI D;  3EN2 A;  1KIX A;  2X69 A;  4KN7 C;  1ZYR D;  1I3Q B;  1HCZ A;  3FHW A;  1VQ4 A;  4DV1 Q;  4PMB A;  1DOM A;  2ID0 A;  2OEO A;  1ASY A;  5C4J B;  4DV6 L;  1SYB A;  5GAE C;  4IPC A;  4OO1 H;  4NW2 A;  2F0G A;  4BBS B;  1FNU A;  5KGU A;  2CH4 A;  3RZO B;  2O5J C;  1IW7 D;  3CC7 A;  4K6L A;  5C4H A;  2UUA Q;  4APV A;  5C44 B;  1HUM A;  3M7N A;  1V9P A;  2KJX A;  2VQF L;  3I7F A;  1FYC A;  5C3E B;  5HUR A;  2M00 A;  3M85 A;  1K3R A;  2SNM A;  4LFB Q;  2IPK D;  4RKB A;  1SMY D;  2F4V Q;  3FKI H;  5LMU L;  2RDH A;  2NN6 G;  3W5O A;  2PMZ B;  4B08 A;  1K8A C;  4HCE A;  1CKO A;  1GJX A;  1YHA A;  1Y1V B;  1O7I A;  1PMR A;  2F0K A;  3SR1 A;  3F2B A;  1EQV A;  3S16 B;  3CAM A;  1U5K A;  1I5F A;  2A19 A;  3ITP A;  1B9N A;  1HZA A;  1NCV A;  1W6K A;  5T1I A;  1Y8N B;  4A3B H;  3E0J A;  2R7Z H;  4OON A;  2EJF C;  2I5L X;  4IJH A;  4ZYS A;  5BN3 A;  2D9U A;  1H9M A;  5I2X A;  1XNQ Q;  1TS2 A;  3F2U A;  3HOY B;  2NVY B;  3A0J A;  4HAE A;  4U67 3;  4NXN Q;  1J8I A;  4P74 A;  1WCM B;  2V1C C;  2WII B;  1FNV A;  3L2P A;  2A6H C;  1A2T A;  1MKH A;  2MP1 A;  4JI0 Q;  2EYL A;  2EYM A;  4U68 A;  3CCL A;  1L1O B;  2JA6 H;  3MTS A;  5IP9 G;  1KD1 C;  4K14 A;  2K33 A;  4IUR A;  2RDF A;  2RCF A;  4KKT A;  1HR0 L;  3T13 A;  3ERO A;  3OPO A;  4O42 A;  4OL7 A;  3HGB A;  2MFI A;  2ALY B;  4CGY B;  3MXU A;  1GO3 E;  3T1H L;  4HN7 A;  2ATW A;  3PO2 G;  2PYK A;  3HOX B;  1PTO D;  1YEZ A;  3PUY A;  1JMC A;  2AQ3 B;  3NPP A;  3UDG A;  5ELE A;  1K0S A;  1SMX A;  3ZJY C;  1CZG A;  3PF4 A;  1HZ9 A;  1EY6 A;  3J81 j;  3MEH A;  1GUN A;  1G2S A;  1SNM A;  3MXG A;  2IHE A;  3NE5 B;  2E2H H;  3OOC A;  3NBH B;  1WJJ A;  2CWA A;  4O1N A;  3J80 i;  2GN5 A;  3JAM L;  3VA7 A;  3CCS A;  2PZT A;  5ISR A;  1EIY B;  3TZD A;  4IFD J;  2CKZ B;  1MGS A;  2F0Q A;  2RF4 A;  2KQ3 A;  4LJZ C;  4B3S Q;  4NKL A;  2R93 B;  2E75 C;  2SDF A;  4KY5 A;  5C4Z A;  2JA7 B;  2ZJR A;  1KNE A;  1GHJ A;  4IFD G;  3A7A B;  4H0L C;  4CBV A;  5M9O A;  1SR3 A;  1IKM A;  5FO7 B;  1PRT F;  1AH9 A;  1STE A;  4HR7 B;  2C35 B;  2AHO B;  4GNX C;  3VYR A;  2NVQ B;  1SYF A;  2L15 A;  2WP8 J;  1EU3 A;  5IP7 G;  1D7Q A;  3GD7 A;  2HIV A;  3CCR A;  1QNU A;  3TRE A;  4DNR B;  1JOR A;  1G91 A;  1MI2 A;  3H15 A;  4IUN A;  2F3I A;  3K5L A;  1TII D;  2AUK A;  4DFA A;  1X3G A;  5EGT A;  4NPS A;  1BCP B;  2K01 A;  4A3E H;  3TP5 A;  4RGO S;  1KAW A;  5COR A;  5J39 A;  3I72 A;  3F1Z A;  3GV3 A;  1MJE A;  3IAY A;  2JK8 A;  2D5D A;  3PUX A;  2E76 C;  4M8A A;  4DV3 L;  4GKK Q;  3DEP A;  3M4Q A;  4QY7 A;  3MVV A;  1VQM A;  3VR2 A;  3H3V H;  1TWH H;  3A55 A;  5KIX A;  2RHQ B;  3U4Z A;  4X65 Q;  4LF7 L;  4R1J A;  2TSS A;  3KJP A;  1YNJ D;  2HDL A;  2ZTD A;  4XQN A;  2E5L Q;  4OGQ C;  2WB1 B;  1PYW D;  4ODG A;  1VDZ A;  2EE1 A;  5M3M H;  5G3L F;  5M5Y H;  5BR8 L;  2Z4I A;  3I55 A;  1SND A;  1DJR D;  4C3I B;  4GN3 B;  5EKK A;  1HQM C;  2RA4 A;  1K9M C;  1PFN A;  4A3D H;  1X3F A;  4B3M Q;  3K7A B;  1B9M A;  1I94 L;  3TZU A;  2K5V A;  2B2U C;  3HOV B;  1EYC A;  1XWE A;  1X3P A;  1CA6 A;  3GTO H;  4OO1 G;  1CQV A;  3SHL A;  4CKB A;  4V19 0;  1I50 H;  3K57 A;  3GTM B;  3CCJ A;  2KCM A;  4DR6 Q;  3CMA A;  4GNX A;  1HNZ L;  1N8R C;  5FLX L;  2EDG A;  4HSP A;  1SYD A;  5C0X I;  2Q8I B;  4F8M A;  3HKZ G;  3KYH C;  1PZK D;  3CC4 A;  3MXN A;  3J80 E;  2E2I H;  1DZ1 A;  3FKI G;  1OXT A;  2UXC Q;  1V8Q A;  2JYO A;  3TS2 A;  1KC8 C;  1KHI A;  3G6E A;  1EEI D;  3VR6 A;  3UDX A;  4DR5 Q;  5ELF A;  5EPL A;  1QUQ B;  3C46 A;  1XNR L;  1NNX A;  1S5B D;  3S1Q B;  5LL6 X;  1OXV A;  5CV7 A;  4KD4 A;  4CHT B;  1G2T A;  4HJ5 A;  2QEJ C;  3RZD B;  2MQH A;  2DY8 A;  1XPO A;  1VQD A;  4A3B G;  4BBR B;  1BNZ A;  2R7Z G;  2F0V A;  5M5W B;  5CV4 A;  1JE5 A;  4FF4 A;  5L37 A;  2A1A A;  1D1K A;  4TSS A;  3S2D H;  1JWS D;  1K0R A;  1UE7 A;  3DMU A;  2AWO A;  3UDI A;  1GXD C;  2HQE A;  4TVA B;  1CFM A;  1UE1 A;  2K4K A;  1VQ6 A;  4KTA A;  2A74 C;  2NYZ D;  5CV8 A;  2JA6 G;  1EY7 A;  4KI0 A;  1MHW C;  4A3G B;  3NTI A;  4P71 A;  2EXD A;  1XNQ L;  1P16 A;  1EIG A;  3PQI A;  1XJV A; 
#chains in the Genus database with same CATH homology
 1TWF B;  3HP3 A;  1ZXT A;  4ULL A;  3J81 L;  4G7H C;  5A2Q E;  3RMH A;  2F0I A;  3U9S A;  4KKS A;  1I4H A;  3BVM A;  3D4D A;  3X3M A;  1D5X C;  5C5M A;  1BR9 A;  1B44 D;  1ESF A;  3K5N A;  1R4P B;  3GTK B;  2F0T A;  3SK8 A;  3H3V C;  3CQZ B;  4BWG B;  1AZP A;  3S14 B;  5JVG 3;  2B63 B;  4KJO A;  2ICI A;  3TBI B;  2M9V A;  1A15 A;  1YNN D;  1EOT A;  3EFX D;  2O5I C;  2NUC A;  4L63 B;  1DOL A;  1ML0 D;  3UI2 A;  3RUZ A;  2B2V C;  3GTL B;  1VMP A;  3CRK C;  2EJG C;  2EY2 A;  4C1N I;  3QG1 A;  4IN3 A;  2JEA I;  1BXT A;  1KLG D;  4MN3 A;  3BDC A;  3R2I A;  4KD3 A;  2JE6 I;  3VR3 A;  1C48 A;  2EYH A;  2O2L D;  5IGE A;  1PRT C;  4L6T B;  5CYU A;  3LWU A;  4LMQ D;  1PFB A;  4GZY C;  3C1E A;  3J7Y W;  2EZV A;  1EEF D;  1O7L A;  4XYO A;  5I4D A;  4MIU A;  4ZUI A;  3PO2 B;  4EGV A;  2EJM A;  2F0D A;  1VMC A;  1OXX K;  5IGB A;  3S2H B;  1H9K A;  3U9O A;  1FR3 A;  4LAA A;  5I2Y A;  3CU7 A;  4PMW A;  1NR2 A;  3NQT A;  2J4X A;  3I8Z A;  1ENC A;  4P2C B;  2DNE A;  3T53 B;  2OXP A;  3GTJ B;  3NUC A;  1F77 A;  3O13 A;  1EY4 A;  2CW0 D;  2F0S A;  1PLF A;  2B2V A;  1VF5 C;  2R3Z A;  2XRQ D;  4HCS A;  1Y8P B;  2RQX A;  4RHS A;  1BF4 A;  4R8N A;  5JPM C;  1SNO A;  1KNA A;  4KK7 A;  3BVZ A;  3NWT A;  2MJ8 A;  1QWY A;  2MHV A;  2ICE C;  3Q6S A;  2SEB D;  1D5Z C;  1KDA A;  1QCB D;  1C4Q A;  2IT1 A;  1Q3L A;  1ROD A;  2I46 A;  1KDB A;  1RTO A;  1FGB D;  2ZXP A;  4PV1 C;  1QIL A;  4RA8 A;  2F0F A;  3OWE B;  2LKV A;  3QIA A;  2NWG A;  3X3N A;  5KND A;  2PZU A;  4FXD A;  5D3D A;  1DXM A;  2NZ1 D;  3DM1 A;  3LX0 A;  3OHX C;  1V1O A;  1LLR D;  3KF8 A;  3A8I E;  2A68 D;  3E5S A;  2KA7 A;  4FXK C;  1GUT A;  2E2D C;  4G4K A;  4NDX A;  4ZQ3 A;  2AWN A;  4Z9C B;  1STB A;  5I9O A;  3OWF A;  4G57 A;  4X3S A;  2NTT A;  4DGZ A;  3J7A F;  2AUJ D;  1X3Q A;  3GTP B;  2ZXR A;  3JAM E;  3SE0 A;  2F0L A;  3DWP A;  2L12 A;  2A6E D;  1JOK A;  2FMC A;  2JXM B;  1QG7 A;  1DM0 B;  4WJW A;  1SNC A;  1RKN A;  3HKZ B;  2Z4H A;  3SK4 A;  1HRJ A;  4QCL A;  3FKI B;  3TP7 A;  1Q90 A;  3MWY W;  1JOQ A;  1WTX A;  2L5T A;  3QO2 A;  4ZUJ A;  1WTP A;  2PZW A;  3T51 B;  4ID6 A;  1PDQ A;  2IJ0 A;  1LTT D;  2CHB D;  3QB3 A;  3A8K E;  4HMI A;  2AQ2 B;  5C0X H;  4A3B B;  4TKO B;  2R7Z B;  2XRS D;  3K0Y A;  1E2Z A;  2BDN A;  1B1Z A;  1WTO A;  2F1M A;  5COY A;  1VF7 A;  1EFI D;  3BDL A;  2V4D A;  2Q8T A;  3ERQ A;  2VB3 X;  1FNW A;  1PTO F;  2JA6 B;  1CT1 D;  1TS4 A;  2K28 A;  3D31 A;  4FF2 A;  2SOB A;  2NTS A;  1BBX C;  1AW7 A;  5IGF A;  2Q8R E;  3I3C A;  3Q24 A;  3BVG A;  4F88 A;  3K5O A;  3D4R A;  2IW3 A;  1HUN A;  4K8J A;  5EPK A;  2NN6 I;  3BS1 A;  4QUC A;  2EYP A;  2F3W A;  1EL0 A;  2E2H B;  4C3J G;  1JE4 A;  5DAU A;  1SXT A;  1SNQ A;  5FLX E;  4IZ8 A;  2BOS A;  2DY7 A;  1M8A A;  3MA2 B;  2A73 B;  4V0B A;  5EBD A;  1UAP A;  4EQP A;  3KK7 A;  4ILW A;  3P7J A;  1GUG A;  5FO8 B;  1PZI D;  3K6O A;  1ILP A;  5DNF A;  2XNA C;  3NSW A;  1SNP A;  3H91 A;  1HA5 A;  2OF1 A;  2EYF A;  2IL8 A;  3BYT B;  1STY A;  2CVR A;  1A3T A;  4A3E B;  3RLF A;  4J6H A;  1PTO H;  3SK5 A;  4K2L A;  1CZW A;  4UDU C;  3OIP A;  4I65 A;  2F0E A;  2F4I A;  2K5Q A;  4HMJ A;  1IKL A;  1TWH B;  4OHJ A;  5HGT A;  5C3X A;  2K6A A;  4B9W A;  2BE5 C;  5IGG A;  4IUP A;  3OW7 A;  4G7O C;  1EYD A;  3PUW A;  5M3M B;  3J81 E;  5M5Y B;  4IQZ A;  1B53 A;  4A3D B;  1JWU D;  4ME5 A;  1LTA D;  1MSG A;  3ONA B;  1GHK A;  1O78 A;  3A54 A;  3WDN A;  1SE3 A;  4IFD I;  1HA6 A;  3GV6 A;  3GTO B;  1IYV A;  3VA5 A;  5EKI A;  2EY5 A;  1ZYR C;  4X3K A;  1T5X D;  1KTK A;  3DUZ A;  1H9J A;  2JEB I;  1ZEQ X;  4KHV A;  4PQX A;  1C8C A;  4DN4 M;  1PRT B;  2B39 A;  2K05 A;  4K6D A;  3C2P A;  1IW7 C;  4EVO A;  3AMU A;  1BCP D;  1EWH A;  1HHV A;  2RDG A;  4X3U A;  1EIH A;  2LY7 A;  4ZKC B;  3D4W A;  3EJI A;  5C0X J;  3NBI A;  2HUG A;  1ONL A;  5C3W A;  2R61 A;  3SXH A;  2F0W A;  1SMY C;  4XIG S;  3M7G A;  4CKE A;  2HCC A;  1RF2 D;  5C0X G;  5D3I B;  3NWS A;  3S2D B;  1M4V A;  1U4P A;  3KBX A;  4XXE A;  2BA0 A;  3A8J E;  1ENF A;  2BA1 A;  2TMP A;  3NP8 A;  4B9X A;  1SSO A;  4K5W A;  1GUS A;  5K36 H;  1DOK A;  2NBF A;  3TME A;  1U4R A;  2FIN B;  4FO2 A;  3T16 A;  4HSV A;  1PZJ D;  2KEC A;  2Z8L A;  2KHS A;  1STG A;  2G9D A;  4IUT A;  3CKI B;  1X32 A;  1OXS C;  1F9S A;  1S5F D;  3N52 A;  1HFN A;  5CR3 A;  3DWA A;  5CV5 A;  1LO5 D;  5CMD A;  2KCC A;  3ZYY X;  1Q8I A;  2H1E A;  1HQR D;  4M1U B;  4C1N K;  1PTO C;  2B8F A;  3IFT A;  4IUV A;  1BQQ T;  1EU4 A;  3MZ5 A;  1GOZ A;  4RAU C;  2K5W A;  3I4M B;  2K1B A;  4L8J A;  2RSO A;  3H6M A;  1EY8 A;  1WTV A;  2WIN B;  4A3F B;  3QWN A;  3K58 A;  4QMG A;  5DEH A;  1HPC A;  1MBY A;  1MSH A;  5IGD A;  5CC4 A;  4RH6 A;  3M3Y B;  3OMG A;  3IKJ A;  1SDF A;  2RBM A;  3HS0 C;  4TRD A;  4XYQ A;  1BO0 A;  4DK0 A;  2PW5 A;  1TY0 A;  3I90 A;  5AFW A;  5E1F A;  2F0O A;  3BG3 A;  1VCI A;  5ELD A;  3N6R A;  1EY9 A;  4XT1 B;  2M2L A;  5LHY 1;  1OXU A;  1Z7T A;  3PO3 B;  3R2T A;  4K8I A;  4IUU A;  4K5V A;  3GQB A;  5KRU A;  4LK1 C;  4HTH A;  4RFB A;  4DAY A;  3PIO 3;  4RCO A;  1S5D D;  2A5H A;  2PCF B;  3L9A X;  4OIK A;  2VNU D;  2C9O A;  2K03 A;  1TY2 A;  4PNY A;  2A69 D;  2Y0S B;  1YNJ C;  2F0N A;  2IWH A;  4RWS C;  4RGT A;  5IOC A;  3P20 A;  1SJE D;  1B4O A;  4C3J B;  2VB2 X;  1EQT A;  1D1I A;  1R9T B;  4CKC A;  2N88 A;  3NXW A;  3Q0A A;  3EQL C;  1BOS A;  2F03 A;  1LT5 D;  1SJH D;  3NK9 A;  3HOZ B;  2XWB B;  1JWM D;  2OT2 A;  4F87 A;  3CHB D;  1L0Y B;  2DNC A;  4CJ2 C;  1LTR D;  2YYZ A;  1HXY D;  3I73 A;  1NSN S;  3BYY B;  3PV0 A;  5I6Y A;  3H94 A;  1XX8 A;  5EBC A;  2XN9 C;  3TP6 A;  4J8Q A;  5FO9 B;  1V1P B;  2AQ1 B;  2IX3 A;  1LAC A;  1V43 A;  2MPM A;  4I7Z C;  1Y1W B;  3IFD A;  3PUZ A;  2B2Y C;  5IGC A;  2WAQ B;  1WTR A;  2BDO A;  2YU9 B;  5K36 G;  2KED A;  2ZT9 C;  1AN8 A;  5IIF A;  2KUM A;  1CTM A;  2NB0 A;  2A6H D;  4RGN A;  3EVQ A;  2QF7 A;  5DM6 3;  4WFN 3;  4FYD A;  3S17 B;  4XTC S;  3VYU A;  5JPN C;  2CQA A;  1ET9 A;  5J22 A;  2D2C C;  3PMF A;  1A3U A;  1QOH A;  3QOL A;  1TWG B;  2MUY A;  5JEA H;  3L7Z C;  1STN A;  1HFG A;  1J9O A;  5IOD A;  1PFM A;  1R4Q B;  5IT9 L;  1CI3 M;  1H9S A;  1A3V A;  4E6I A;  4HED A;  4EQO A;  3S1N B;  4RGM A;  2H4O A;  3GTG B;  5JVH 3;  4C3H B;  2EYO A;  3K59 A;  3MFG A;  2ENB A;  3NTK A;  2B2Y A;  4FF1 A;  2WAC A;  4IUQ A;  4PMC A;  1PXU A;  2RVL A;  3HRZ C;  5KYI A;  1YNN C;  3EA6 A;  1SE4 A;  4UAI A;  1I4P A;  2WKC A;  2LFN A;  4DNT B;  4QUF A;  5EPJ A;  2L4N A;  4MHE A;  2E74 C;  1A2U A;  5E4W C;  3W2D A;  2GA4 B;  4ZRZ A;  2EPB A;  3E6Z X;  3HZX A;  5FK9 C;  5I6W A;  1RHP A;  4XDX A;  2NVT B;  5E3F A;  4FVM A;  2K7V A;  1E2W A;  4DK1 A;  1SE2 A;  3TP8 A;  3KUP A;  2QKI C;  1F9P A;  3AU7 A;  3FMC A;  1W6J A;  1CA5 A;  1AZQ A;  2EY1 A;  5E4X A;  5CBE E;  1L0X B;  1H9R A;  3H0G B;  2F0M A;  3FPP A;  3C1F A;  2G9H D;  5J1Z A;  2KVM A;  2F0H A;  1BUV T;  2K5D A;  4XT3 B;  1ENA A;  3MAQ A;  1RTN A;  3HEJ A;  1JIC A;  3WOF A;  2LS0 1;  3K5M A;  1CHP D;  3LNN A;  3SK6 A;  2LMC B;  1QE6 A;  2CW0 C;  3J7A V;  3KBG A;  3SVM A;  3FEW X;  4DAV A;  4EQN A;  4FF3 A;  1RJT A;  4R8I A;  1AFP A;  3GO5 A;  2HCI A;  1I4Q A;  4QF4 A;  1ESR A;  5C6A A;  4ZKB B;  4RHR A;  2EYJ A;  1PTO B;  3A56 A;  4WOR A;  4XQQ A;  4F7X A;  1LT4 D;  1SAP A;  1K8M A;  1LV9 A;  4RKL A;  2J0T D;  2XVS A;  4BA2 I;  2N55 A;  2KOL A;  3DXJ C;  4ZLT F;  3DHQ A;  4H44 C;  4NMZ A;  1F9Q A;  2XIW A;  4CJ1 B;  2NVX B;  3GP7 A;  3BZD B;  1Z47 A;  4ZK9 B;  1RCV D;  1F2M A;  3ND9 A;  1SEB D;  3ND8 A;  4R9W A;  5JEA J;  2I07 B;  5F2D A;  5JJZ A;  1BCP F;  2A68 C;  2PPB C;  1G8Z D;  5KEE A;  3A7L A;  1WTW A;  3MFY A;  5JEA G;  2B2W C;  1TWA B;  2PO4 A;  1V1P A;  4JK1 C;  4A3I B;  1AP0 A;  4CJ0 B;  2A6E C;  3OMC A;  1KAB A;  2B2T C;  1MD2 D;  5C4X B;  1I50 B;  3CRL C;  3FPU B;  4C2M B;  4OIJ A;  3LWE A;  4Q0F A;  3URY A;  4Q5V A;  2L11 A;  4DU9 A;  2EOT A;  2RKS A;  3MXP A;  2E2I B;  5BN4 A;  1DCZ A;  1O7Y A;  3FVQ A;  3TDQ A;  4FP5 D;  1NUC A;  2F3V A;  3P1H A;  4C3H G;  1F2L A;  1Z6H A;  3R93 A;  1TQO A;  2K32 A;  5NUC A;  3VR4 A;  5M5X B;  4KY7 A;  1TS3 A;  4KHZ A;  3SEB A;  4BS9 A;  1DYQ A;  3D8G A;  5C5L A;  2B2W A;  1ILQ A;  2DN8 A;  1OO9 B;  1TKW B;  1PRT D;  4BY1 B;  5I9P A;  4DAP A;  3S9W A;  1H9S B;  5JOB A;  5JAV A;  1Q12 A;  1CHQ D;  5KYL A;  5D65 A;  3QJY A;  2B2T A;  4OO1 I;  1STA A;  3TN2 A;  1CQF A;  4QB4 A;  1I6H B;  2F0P A;  5LL6 S;  3KLS X;  2D62 A;  3H09 A;  1II3 A;  1A6X A;  1D5M C;  1CK1 A;  1NR4 A;  3FRP B;  1K8O A;  3AB9 A;  1F9R A;  1G29 1;  5G3L D;  1TWC B;  3P75 A;  1Y8O B;  2EY6 A;  4DF7 A;  1CM9 A;  1K83 B;  1EWC A;  1QB5 D;  2R92 B;  5CBA E;  1Y69 U;  1JOO A;  3FDT A;  4NP5 A;  5T1G A;  2B2U A;  5A35 A;  3V96 A;  1LTG D;  1S4Z A;  1LT6 D;  1TR5 A;  3IL8 A;  1KAA A;  1EZ8 A;  2MGS A;  3HG9 A;  4KN4 C;  4ABN A;  4KMU C;  2E2J B;  2FFK B;  3I4L A;  2EVB A;  1LAB A;  1I4R A;  4A3M B;  2FHT A;  3OIQ A;  1D2B A;  1STH A;  2IX1 A;  1U4L A;  3NTH A;  4G7Z C;  1SYE A;  1TU2 B;  3D6W A;  4K5X A;  4FNF A;  1UUP A;  3L3O C;  3I70 A;  2L55 A;  4BA1 I;  5BN5 A;  1TT2 A;  5EKL A;  1UNS A;  2C5C A;  2QDB A;  3MHB A;  1QNK A;  5CV6 A;  2K04 A;  3G6J B;  1LTB D;  1SBB B;  3M4O B;  2L0C A;  1RD9 D;  4AYB B;  4BY7 B;  5FKA C;  2R6G A;  1GUO A;  1EZ6 A;  1ZKO A;  2JP1 A;  3NQI A;  4RCN A;  1XTC D;  3PUV A;  5IT9 E;  4N9P A;  1TS5 A;  3R3O A;  2XSC A;  4A3J B;  4QIW B;  2L1B A;  2KCN A;  5KNC A;  4WRD A;  5K5P A;  1KLU D;  2Z1C A;  3D6C A;  3KLR A;  1BCP C;  1D6E C;  3BDO A;  5KNB A;  2J7Z A;  1S5E D;  3C3L A;  2L9H A;  1LTS D;  2PW7 A;  4IAL A;  1LT3 D;  2WKD A;  3V05 A;  2QCP X;  5D14 A;  3T4A C;  4A93 B;  2EXZ A;  3J80 L;  1IL8 A;  4H13 C;  2JA5 B;  2BCO A;  2NN6 H;  4KKU A;  4DXF A;  3G7L A;  3S1R B;  3NBH A;  1O7Z A;  1HTL D;  2X6L A;  3MC0 B;  1BDO A;  3R8B A;  3VYS A;  1FD7 D;  4KJN A;  3SDZ A;  3S1M B;  1IHZ A;  4KV6 A;  3I91 A;  4YIJ A;  3Q22 A;  4FXG C;  2FJ2 A;  1ET6 A;  5DM7 3;  3OSO A;  1DON A;  1F2Z A;  2X6G A;  2VXW A;  3RD4 A;  1I6V C;  4X3T A;  5FOB B;  4H7B A;  2O4X A;  1WVL A;  1E2V A;  1WTQ A;  4J1M A;  2RSN A;  1JR0 D;  4ZAI A;  2ZXO A;  3T56 B;  2PQE A;  3VR5 A;  1WD0 A;  1NAP A;  1UEA B;  4C3I G;  2QIL A;  3GTQ B;  1XYI A;  4S3S A;  4N9T A;  5A2Q L;  1I4X A;  4Y7N B;  4DA2 A;  1U9R A;  1JB3 A;  1I4G A;  1SYC A;  1F2Y A;  3NHH A;  4C56 C;  4JBW A;  1Q1B A;  1HTP A;  2JA8 B;  2KEE A;  5EQ0 A;  3HOW B;  4A3K B;  2XWJ B;  3QOJ A;  1IYU A;  1Q1E A;  3V2T A;  1G6Z A;  5CGK A;  1O80 A;  2F0J A;  2HDM A;  2PNR C;  1E0B A;  4DXG A;  1B2T A;  1KDC A;  1JCK B;  3HOU B;  3M4Y A;  1RDP D;  2WV6 D;  5M3F B;  2JSO A;  5TSS A;  1EYA A;  1ICW A;  5ELB A;  5ELC A;  1GUW A;  4IFD H;  1JQY D;  1U4M A;  3WOE A;  1AEX A;  3PIP 3;  1EY5 A;  1S5C D;  1B3A A;  3DEO A;  2SNS A;  1EY0 A;  2IX0 A;  1QJO A;  4KY6 A;  3Q23 A;  1JC7 A;  2B8G A;  2F0U A;  2FMM A;  2BE5 D;  5CV9 A;  1WD1 A;  3TSS A;  3KLS A;  3VYT A;  1B50 A;  4K2K A;  1XXG A;  3I4N B;  3DWQ A;  5EJW A;  3W3A A;  1TVX A;  1SFO B;  1T5E A;  1SYG A;  3D3R A;  2A69 C;  1DD2 A;  4TQU S;  4XQJ A;  3S15 B;  2VUM B;  1LTI D;  2X69 A;  4KN7 C;  1ZYR D;  1I3Q B;  1HCZ A;  4PMB A;  1DOM A;  2ID0 A;  2OEO A;  5C4J B;  1SYB A;  4OO1 H;  4NW2 A;  2F0G A;  4BBS B;  1FNU A;  5KGU A;  3RZO B;  2O5J C;  1IW7 D;  4K6L A;  5C4H A;  5C44 B;  1HUM A;  3M7N A;  2KJX A;  1FYC A;  5C3E B;  5HUR A;  2M00 A;  3M85 A;  2SNM A;  2IPK D;  4RKB A;  1SMY D;  2RDH A;  2NN6 G;  2PMZ B;  4B08 A;  4HCE A;  1GJX A;  1Y1V B;  1PMR A;  2F0K A;  3SR1 A;  1EQV A;  3S16 B;  3ITP A;  1B9N A;  1NCV A;  1W6K A;  5T1I A;  1Y8N B;  3E0J A;  2EJF C;  4ZYS A;  5BN3 A;  2D9U A;  1H9M A;  5I2X A;  1TS2 A;  3F2U A;  3HOY B;  2NVY B;  4HAE A;  4U67 3;  1J8I A;  1WCM B;  2WII B;  1FNV A;  2A6H C;  1A2T A;  2MP1 A;  2EYL A;  2EYM A;  4U68 A;  3MTS A;  4K14 A;  2K33 A;  4IUR A;  2RDF A;  4KKT A;  3T13 A;  3ERO A;  3OPO A;  4O42 A;  4OL7 A;  3HGB A;  4CGY B;  3MXU A;  4HN7 A;  2PYK A;  3HOX B;  1PTO D;  3PUY A;  2AQ3 B;  3NPP A;  5ELE A;  1CZG A;  1EY6 A;  3MEH A;  1GUN A;  1G2S A;  1SNM A;  3MXG A;  3NE5 B;  3OOC A;  4O1N A;  3JAM L;  3VA7 A;  2PZT A;  5ISR A;  3TZD A;  4IFD J;  1MGS A;  2F0Q A;  2KQ3 A;  4LJZ C;  4NKL A;  2R93 B;  2E75 C;  2SDF A;  4KY5 A;  5C4Z A;  2JA7 B;  1KNE A;  1GHJ A;  4IFD G;  3A7A B;  4H0L C;  4CBV A;  5M9O A;  1IKM A;  5FO7 B;  1PRT F;  1STE A;  4HR7 B;  3VYR A;  2NVQ B;  1SYF A;  2WP8 J;  1EU3 A;  3GD7 A;  1QNU A;  4DNR B;  1JOR A;  1G91 A;  1MI2 A;  4IUN A;  3K5L A;  1TII D;  2AUK A;  4DFA A;  5EGT A;  1BCP B;  2K01 A;  3TP5 A;  4RGO S;  5COR A;  5J39 A;  3I72 A;  3GV3 A;  3IAY A;  2D5D A;  3PUX A;  2E76 C;  4M8A A;  3DEP A;  3MVV A;  3VR2 A;  5KIX A;  3A55 A;  2TSS A;  1YNJ D;  2HDL A;  4XQN A;  4OGQ C;  2WB1 B;  1PYW D;  4ODG A;  1VDZ A;  2EE1 A;  5G3L F;  2Z4I A;  1SND A;  1DJR D;  4C3I B;  5EKK A;  1HQM C;  2RA4 A;  1PFN A;  3K7A B;  1B9M A;  3TZU A;  2B2U C;  3HOV B;  1EYC A;  1XWE A;  1X3P A;  1CA6 A;  4OO1 G;  1CQV A;  3SHL A;  4CKB A;  4V19 0;  3K57 A;  3GTM B;  5FLX L;  2EDG A;  4HSP A;  1SYD A;  5C0X I;  2Q8I B;  4F8M A;  1PZK D;  3MXN A;  3J80 E;  1DZ1 A;  1OXT A;  1V8Q A;  2JYO A;  1EEI D;  3VR6 A;  5ELF A;  5EPL A;  3C46 A;  1S5B D;  3S1Q B;  5LL6 X;  1OXV A;  5CV7 A;  4KD4 A;  4CHT B;  1G2T A;  2QEJ C;  3RZD B;  2DY8 A;  4BBR B;  1BNZ A;  2F0V A;  5M5W B;  5CV4 A;  4FF4 A;  1D1K A;  4TSS A;  1JWS D;  3DMU A;  2AWO A;  1GXD C;  2HQE A;  1CFM A;  4KTA A;  2A74 C;  2NYZ D;  5CV8 A;  1EY7 A;  4KI0 A;  4A3G B;  3NTI A;  1EIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...