5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
2F0NA 4HMIA 5ISRA 4RKLA 4KJNA 3MHBA 1EY0A 1SNDA 4K6DA 3QOJA 4NMZA 4KD3A 4S3SA 2EYFA 3NQTA 2F0VA 4J6HA 4K2LA 4KY5A 2F0SA 2RKSA 4KY6A 4DGZA 5I9OA 3LX0A 3D4WA 1TR5A 4KY7A 1TT2A 2F0OA 2O4XA 2WACA 5CV5A 4YIJA 5E1FA 3R3OA 2OF1A 1STHA 4N9PA 3P75A 3EVQA 4LAAA 1ENAA 1A3UA 4QB4A 4IALA 1STYA 2OEOA 1F2MA 4HMJA 2EYPA 4K8JA 4NKLA 1EY5A 2PYKA 2M00A 1EY9A 4K5XA 4IZ8A 4R8NA 1SYGA 2PZTA 3T13A 3H6MA 3MZ5A 4RKBA 4DF7A 4I65A 4ZUJA 2KQ3A 1SNOA 2F0DA 4WORA 4K5WA 2PQEA 5C5MA 1KDBA 5DAUA 2F0IA 5EGTA 1SYCA 1STNA 5KYLA 4K8IA 4ZQ3A 3MEHA 4N9TA 3SK4A 3NK9A 3DHQA 4KV6A 3SR1A 1II3A 2HQEA 4B9XA 5C4HA 2SNMA 4K2KA 1STGA 2PW5A 3C1EA 4DU9A 1EQVA 4J1MA 5CV7A 5KYIA 4ID6A 5CC4A 4EQNA 4NP5A 3D6CA 2NUCA 2RBMA 5EKLA 3PMFA 5DEHA 2F0GA 1JOQA 2EY1A 2PW7A 5IODA 4PMBA 3QOLA 2PZWA 2F0QA 4IUNA 5J1ZA 1SNPA 4OL7A 5NUCA 5EKKA 4DFAA 2F0MA 4PNYA 5C4ZA 3RUZA 5J22A 1SNMA 3EROA 5HURA 2F0FA 2OXPA 5I9PA 5CV8A 3TP8A 1AEXA 2F0TA 2QDBA 1EYAA 2EYLA 3BDCA 3OSOA 3SK8A 5C5LA 2F0JA 5C3XA 5CR3A 4ODGA 3D4DA 1KAAA 2F0LA 5E3FA 4NDXA 1EY7A 1RKNA 5IOCA 4TRDA 3SHLA 5F2DA 4EQPA 5IGGA 4EQOA 3ERQA 3OMGA 4QF4A 1EZ8A 1SYFA 2EYHA 4B9WA 1SYDA 5C3WA 1F2ZA 2F0UA 3QB3A 4PMCA 1JOOA 1KDCA 2KHSA 4KD4A 5IGBA 2EYJA 5KRUA 4ME5A 5CGKA 1U9RA 3OWFA 3TMEA 4G57A 5HGTA 2F0KA 2LKVA 4F7XA 3ITPA 3NXWA 3HEJA 1EY4A 3TP7A 2EYOA 3SK5A 5IGDA 5JAVA 4MIUA 5JOBA 4KJOA 4WRDA 2ENBA 5IGCA 1JORA 5I6WA 5K5PA 2EY2A 1STAA 3BDLA 1SYEA 1A3TA 3DMUA 4K5VA 4EVOA 1KDAA 1IHZA 1EY6A 3VA5A 4KTAA 1A2UA 5KEEA 1A2TA 3HZXA 1SYBA 1A3VA 4QMGA 2EY5A 1NUCA 4KHVA 3V2TA 4HTHA 2EY6A 3NHHA 4H7BA 4E6IA 2F0EA 4F8MA 5IGEA 1EY8A 3D8GA 4K14A 1SNQA 5CV9A 1STBA 2F3VA 5CV6A 3P1HA 2EYMA 3EJIA 3SXHA 3TP5A 1F2YA 2F0PA 3C1FA 3E5SA 1ENCA 5CV4A 4ZUIA 1EZ6A 5KGUA 2PZUA 3NUCA 5C6AA 5I6YA 3NP8A 3T16A 1JOKA 3U9OA 1EYDA 1NSNS 5J39A 3TP6A 2F0WA 3S9WA 2F3WA 1TQOA 5IGFA 2F0HA 5M9OA 2EXZA 2SOBA 3MXPA 3MVVA 3SK6A 5IIFA 5KIXA 2SNSA 1SNCA 2RDFA 3OMCA 1KABA 1EYCA
chains in the Genus database with same CATH superfamily
2KCCA 1KLGD 3MHBA 5IP9H 1JE4A 1PYSB 3RLOA 2RHSB 2IW3A 2HIXA 2F0SA 4DV7Q 4IUVA 4KY7A 3IAYA 4NB3A 3NENA 2OF1A 3U4ZA 3VR6A 3ICEA 4FNFA 1K0RA 2AUKA 3VR5A 2B8GA 2PCFB 2A8VA 1A6XA 1LT5D 1SYGA 3OIPA 4ZUJA 2Z4HA 1SJHD 3CP0A 2R92B 3PV0A 2YV5A 1CHPD 4C2MB 1SLJA 4FXGC 1PH1A 2JA7B 3LWEA 4A3FG 3C1EA 1A15A 3VA7A 5M5XB 1IBLQ 3OYYA 4GNXC 3S16H 1GUTA 4LWCA 5NUCA 4LUVA 1S5FD 1YNJC 4JW0A 1NCVA 4JK1C 3WOEA 4C2MH 1K73C 2F4VQ 3KF6A 1N36Q 1PYBA 2Z1CA 4Q0FA 2HCCA 1K9MC 3BDCA 3K6OA 3OW7A 3CRKC 3GTQB 4X62L 5C3XA 1T5XD 3GP7A 2UU9L 1L1OC 5M3MG 3D4DA 4LNQA 2JA7H 3CQZB 4EQ5A 3PIO3 2HHHL 4HJ7A 4TRDA 4EQPA 5M5XH 1HJPA 4BY7G 2J4XA 5M5WB 3GTMB 5C3WA 5GROA 4HN7A 3HP3A 3BS1A 2E2IB 2EYJA 4FF2A 2BOSA 3S1QB 2WINB 2ASBA 1QVCA 4DV7L 1X54A 1HNWQ 3PUVA 1SE3A 1B53A 4MIUA 5C0XI 3NE5B 1SYEA 1X6OA 2IX3A 3GTMH 1IHZA 3F2BA 1I94Q 5FLXL 2E2IH 3HOXG 4P75A 1EWIA 4B3TQ 2CW0C 4QCLA 5IYCG 2QW7A 2MUYA 2QILA 4KLKA 1N32Q 2KCTA 1P16A 3A56A 3RN5A 3SXHA 4A3FB 1FJGQ 3E5SA 2N3SA 1IBLL 1CZWA 1EQTA 1UWVA 3T16A 1HQMC 1EYDA 3BVZA 2B2TA 2F4VL 1CQVA 2N8NA 1N36L 1G91A 3IFDA 4RKLA 2Z8LA 4KN4C 3RD4A 2MPMA 4A3FH 3KF8B 5EAYA 4CJ1B 4FF4A 2VNUD 1I3QB 4BY7B 1TR5A 2F0OA 4UHVA 2EJMA 4LAAA 3EVQA 1GKHA 1A3UA 1HXYD 1ONLA 4CHTB 4NKLA 1PH8A 4L5TA 3JAMi 2NBFA 1HNWL 3G4SA 1IKMA 4ZAIA 1VF7A 1BBWA 2FFKB 3HRZC 2K5WA 3SE0A 2KCMA 4YWKA 4ALPA 1I3QH 1DXMA 1STNA 1EQRA 1I94L 4BY7H 1LYLA 1V8QA 1YJNA 2PNRC 4O2DA 1B9MA 2OT2A 4JYAQ 1PH7A 1DD2A 4B3TL 3I4MG 3HOXB 3KLWA 2K28A 2KHIA 1N32L 3VYTA 1SE4A 5J1ZA 5J22A 1FJGL 1DJRD 1JMCA 3A8IE 1C0AA 5I9PA 4IPGA 1RHPA 3NBHA 1V1PB 5CV8A 1AW7A 3URYA 2PMZB 2QDBA 2C35B 1YZ6A 3I4LA 1WTHA 1HA6A 2J0TD 4EQOA 1HQRD 1NR2A 2A19A 1F2ZA 3S17H 2OCEA 3ULPA 1K3RA 4KD4A 3MEFA 3FKIG 1E24A 5FLXc 1IYJB 3CCVA 4A3KH 1XNRQ 1PTOD 4TVAB 2O5IC 3H09A 2EXDA 4DXGA 5I6WA 1JORA 4X3KA 2ZM6Q 3BDLA 3J80L 1D5MC 3J81i 1A2TA 4QQBX 1B70B 2RSOA 4HJ8A 4DV6Q 2BH2A 3ND8A 2PI2E 4JYAL 2BH8A 3CC4A 3Q24A 1SN8A 2KA7A 4R8IA 4BY1H 4JI4Q 1IYUA 1ET6A 1HCZA 1PH4A 3BVGA 3NP8A 1FGUA 2E5LQ 3EN2A 1DCZA 5AFWA 5CBAE 5JEAJ 3STBC 3T4AC 2XTIA 3IFTA 4OONA 4YCVA 4A4IA 3L7ZC 1HZ9A 5COYA 1TS2A 1BR9A 4ZRZA 3U58A 4K6DA 3AQQA 3R2TA 1WD0A 1FNVA 2PPBC 1JJGA 5JJKA 1S5DD 5EBDA 4P74A 2JA6G 4F88A 2AUJD 2CWPA 2WACA 1EIFA 3HKZG 1KL9A 4HJAA 2R6GA 4RH6A 4HSPA 1LTBD 2KUMA 2R7FA 5ELBA 4OO1G 1WJJA 5IYBG 3S1RB 2WIIB 3RZDB 1XNRL 1SNOA 3MFYA 3A74A 2HUGA 2ZM6L 1K8OA 1HZCA 2PO4A 3MEHA 1HPCA 4BS9A 4CJ0B 1S5BD 2HQEA 5IYDH 1UE6A 2KCNA 3L9AX 5CC4A 4DV6L 1I4QA 1CUKA 4GKKQ 1CKNA 4F87A 1SNPA 3RZDH 3FEWX 3J7AF 5C4JB 1YBYA 4JV5Q 4JI4L 4IO9A 3S2HH 1BBUA 3D6WA 4IPDA 2E5LL 5C3EB 1BVSA 2BA0A 1AEXA 1H9JA 4MTNA 4M1UB 5IY0A 3Q0AA 1EY7A 3DEOA 4CDCC 3FDTA 1I6VC 1PZJD 3H91A 2JP1A 3PF5A 1SRUA 2Q2IA 1VQBA 5CGKA 2R7ZG 1X65A 2K5HA 5C3EH 4IUTA 1VQ6A 3NTHA 1QNKA 2RCNA 1B8AA 2E8GA 3HKZB 4DR3Q 5I2XA 2WKDA 1H9RA 2K01A 3DMUA 5FJ8H 1WTOA 3PO3G 1RD9D 1HRJA 4KTAA 3NSWA 4M8AA 2ALYB 4K6LA 1E2ZA 1Y1VH 2GVAA 1SJED 1MJCA 3NHHA 4HTHA 2GVBA 3BZCA 1SNQA 4B08A 1K8AC 1OXSC 1F9QA 3I70A 5KGUA 3HFZB 4GKKL 1JOKA 1R4QB 4JV5L 1E1OA 1C48A 2K33A 4DAYB 2CH4A 2R93H 4YHHQ 1C7YA 3AFPA 3OPOA 1XPUA 2ZJRA 1E2VA 2LMCB 3F2CA 1QZHA 2WAQE 4S3SA 5C0XG 3BU2A 1EU4A 2MO0A 5DM63 5M3FG 1A0IA 3M4YA 1VQ7A 2ZTCA 2B2WC 1VCIA 1ESFA 3VR3A 4NXNQ 2R7ZB 1PVOA 3WOFA 4QUFA 2EJGC 1BNZA 2YTYA 2J7ZA 4RKBA 1GHKA 4DR3L 2KQ3A 1HUMA 3K7UC 3Q8DA 1KDBA 2F0IA 5EPLA 2K5DA 4K8IA 1UE7A 2M9VA 3DHQA 3KDFB 1CZGA 4B9XA 1BCPB 2SNMA 4JOIA 1JR0D 2JK8A 3SDZA 1G6ZA 4GN3B 2RBMA 2R7ZH 3HKZE 3E3XA 2JN4A 3F2DA 4PZ7A 2KEEA 3ERSX 3RUZA 1VQLA 5FKAC 4V0BA 4R1JA 1M4VA 3S24A 2L5TA 4IN3A 3T51B 4H13C 4YHHL 1U4MA 3IL8A 3PIOA 2MQHA 1ICFB 1SYDA 1J6QA 4HAEA 3DM1A 1NE3A 2C5CA 4J8QA 3X3MA 3QWNA 4KKSA 3I55A 3TZUA 3UE1A 5M3FB 3K8AA 3NXWA 4GN4B 1XJVA 5ELDA 2Z0SA 4KJOA 4NXNL 3HOUG 4HEDA 1VQCA 3ZJYC 1FR3A 3MXUA 2B63H 1VQNA 4NW2A 1A3VA 1X3FA 1NUCA 4APVA 1F9PA 3TSSA 4DNTB 2A73B 1LLRD 1CT1D 1EY8A 1GVPA 5T1IA 1S5ED 1AE2A 1NMGA 2EYMA 3LWUA 3VR2A 4A3GH 2C9OA 1Y1WG 3HOZG 4L63B 1B7YB 3I8ZA 2OTLA 1NTGA 1XMQL 3UE0A 2F0WA 3VYUA 3C46A 5GQOA 3GV3A 3GTJB 3MXPA 4AIMA 1KD1C 1JCKB 1XTCD 2RDFA 2D62A 2F0NA 3TQYA 3G6EA 3CHBD 1TIID 3HGBA 1VQPA 1E0BA 1QJOA 1FNWA 3K80C 4IQZA 4QJFA 2VQEQ 4J6HA 2F0VA 4OIKA 1AFPA 2JE6I 4JI2Q 4HIKA 1AE3A 2RF4A 1EL0A 1TT2A 3IRBA 2LFNA 2A68D 5EPKA 2F4IA 5LL6X 1F2MA 1VQFA 3H0GB 4DK0A 4XQNA 2KBNA 2PZTA 3X3NA 1KQSA 4A76A 2UUCQ 1R9TB 2ZJQA 5E4WC 2F0DA 3FPUB 4FXDA 2UXCQ 5DAUA 2CHBD 3HOUB 2ZXOA 5G3LD 3CPFA 2QA4A 4LFCQ 4C3JG 2L15A 4O1NA 3H0GH 4NP5A 1H95A 2FMMA 2XWJB 1Y8NB 1R9TH 1T9HA 3CXCA 1IZ6A 4X65Q 1B50A 1GO3E 2B2TC 3QG1A 1D6EC 1VS0A 3HOZB 4IJLA 3UDIA 2R61A 1L0XB 3NWSA 5HGQA 4A75A 4NDXA 1DONA 5DNFA 1PTOH 2UXDQ 1C8CA 2NVXB 1SYFA 2KEDA 4DV4Q 1ASYA 3KUPA 4LW1A 4ABNA 2KHSA 2VQEL 4DR7Q 4IURA 4JI2L 4G57A 4GNXB 2L11A 2D0PA 3I4OA 4Z9CB 5BR8Q 3T56B 2WKCA 2UUCL 3J80i 1L1OB 3M3YB 2UXCL 1VQIA 2AKWB 2FMCA 1OXXK 4NXMQ 2E2JH 3NEMA 4DR5Q 3OTOQ 4LFCL 1PZKD 1SMYC 2NB0A 1H9MA 2Q8RE 1QUQB 3C1FA 3BJUA 1ENCA 4G4KA 4C3JB 1Y69U 3NUCA 4RHSA 3U9OA 1PMRA 1KNAA 4HIDA 3DUZA 4X65L 3M3YH 5KIXA 1ET9A 2JSOA 4UAIA 1YJWA 4IPCA 1EEFD 1G6PA 1BOSA 4FF1A 2K6AA 2OQKA 4DUYQ 2JXMB 2UXDL 2RA4A 4DV4L 3NQTA 1IL2A 1VQ4A 3UDGA 1YNND 5CV7A 4DR7L 4ZYSA 3S1NH 1STYA 3SGIA 3J7ZC 2PYKA 1S5CD 3O13A 1XTDA 4HSVA 5C44G 1FVIA 4RGTA 3MXGA 4I65A 5J3BA 2Q8TA 1KHIA 5ELEA 4OWWB 2D5DA 4XQJA 3MXNB 4DPGA 1YHAA 4IOCA 1N9WA 3MAQA 4G7ZC 1DOKA 1E7ZA 4PG3A 4DU9A 4NXML 2Q2UA 1NR4A 3PMFA 4DR5L 3OTOL 4QIWE 3HOWG 5EQ0A 2PW7A 3TN2A 4PMBA 4IUQA 2K52A 2R7DA 3NBIA 3H3VI 4KMUC 1UE5A 1B3QA 4XT3B 1QB5D 1EYAA 3KLSX 2X6GA 4P71A 2WFWA 3W1BA 5F2DA 2NYZD 2XWBB 1RTOA 1VQ5A 2FJ2A 2ICEC 4DUYL 4FF3A 2CKZB 1QWYA 2BE5C 3P7JA 4H02A 4MZ9A 1WTVA 1YJ9A 2IJ0A 2O2LD 3KOJA 2OQ0A 1JQYD 2R92H 1EY4A 3Q23A 5FK9C 1CFMA 3K7AB 1D8LA 1OTCA 4BBSG 1B3AA 1WTWA 1HUNA 2H4OA 1WTQA 5C44B 1JE5A 4BXXG 1LO5D 4FO2A 1KIXA 2I5MX 1MSHA 3DEPA 2A6ED 2FHTA 1U5KA 3V2TA 5IP7H 2F0EA 4ME3A 4TQUS 5CV9A 4DAVA 1F2YA 3K0XA 4OX9Q 3PO2G 2HDLA 1BCPD 1TY2A 1HZAA 3GTQH 1YHBA 2CWAA 4DAYA 5IGFA 2JEAI 3TS0A 3CQZH 1K0SA 5M5WH 1Q86C 2K4KA 1ILPA 4FXKC 1SAPA 2BA1A 1GUNA 3S1QH 1O80A 1CQFA 1WCMG 1RJTA 3TEHB 3U50C 3MWYW 3D4WA 5BN4A 5CV5A 3R3OA 3FP9A 4GOPB 1VMCA 4JBMA 4UPAA 4IALA 5T1GA 2M00A 5CBEE 3ULJA 4B3RQ 4R8NA 5A2QL 2VUMG 3A8KE 2ZTDA 1PFBA 2JEBI 5C5MA 4BBSB 3RR5A 3VDYA 3R2IA 2YTXA 4MN3A 1SYCA 5KYLA 4KV6A 4C3HG 1UNSA 4R4OA 5M3MB 1ESRA 2XVSA 4RGNA 1VQ8A 2NVQB 5EKLA 1HTLD 1PTOF 1OXTA 1VDZA 2EY1A 4P73A 1PV4A 2K05A 3R8BA 3M4OB 1G291 5IWAQ 1PH5A 1DGSA 1MI2A 2IX1A 1GUSA 5FO9B 2K5VA 2BCOA 4OX9L 4BBSH 2Z6KA 1YI2A 4YWMA 2OXPA 1VQDA 1V1OA 3PO2B 2QGQA 2K5QA 3QR8A 1X9NA 4RMFA 1HNXQ 5M3MH 1N8RC 1PRTD 4DR4Q 5IOCA 1WTPA 1GJXA 1Q12A 3IKJA 4CJ2C 3QB3A 3M4OH 1EOTA 4ME5A 4RFBA 1KRTA 4A3MG 2LKVA 3H15A 4OELB 3MA2B 4A3EG 2B8FA 1S4ZA 5FO7B 3G7LA 4V190 5JAVA 1NNXA 3K5MA 5GADC 4DV2Q 4B3RL 2EY2A 3K5NA 1VQOA 1DZ1A 3I3CA 1WD1A 4JI6Q 4IFDJ 3L2PA 3CAMA 2VUMB 4HR7B 4YCWA 3GTPB 2CH4W 1W3SA 3HOXH 4JOIC 4JI0Q 2AHOB 5IYCH 3AEVA 3G6JB 3RLNA 4C3HB 3Q6SA 5CV6A 1MKHA 1EZ6A 1NY4A 5JEAG 4R4TA 5IWAL 2NVTB 2PNHA 1IYVA 1NSNS 4JBJA 3WDNA 3AMUA 4JBWA 2VUMH 2WV6D 3GTPH 2H1EA 2AQ2B 2DNCA 3CCMA 4WRDA 1JJ2A 1HTPA 5ISRA 1HNXL 2L9HA 4ILWA 1K28A 1ML0D 1YNXA 4PMWA 2I5LX 4C3HH 4DR4L 4POGA 1ILQA 1LTAD 4X6AH 3J81j 4U673 5JJLA 1X3GA 2F1MA 4LUZA 1UEBA 2WAQG 2NVTH 4LUOA 5IT9E 5EBCA 1TWAB 1KXLA 5ELNA 3H94A 3VYSA 2OEOA 3I4MB 1XWEA 2HT1A 4A3MB 1CKMA 4A3EB 1HNZQ 3M9BA 1EUJA 4DV2L 1ZKOA 2B3GA 3A5ZB 4JI6L 2JA5G 3NK9A 5DM73 3SR1A 1TWAH 1YNJD 1B1ZA 4J1MA 4JI0L 4KKUA 1FD7D 3I4MH 5TSSA 2NUCA 3V96A 3GQBA 2RSNA 1G8ZD 3ER0A 4X3TA 4A3MH 1IXRA 2RDGA 3FKIB 3EROA 2QCPX 5JPMC 5M5YB 4BA2I 4L5QA 5C5LA 3TRZA 4EX5A 1U4RA 3RLFA 3N52A 3U4VA 2L12A 2PQAB 3RNUA 4O42A 1A63A 2ZTEA 1K8MA 1Q90A 1PLFA 3FKIH 1RCVD 3M7GA 1KLUD 1GXDC 1WVLA 3TMEA 3NTKA 4UP8A 3S1RH 1UAPA 5M5YH 2WAQB 1E2WA 2Y0SE 2TMPA 2CW0D 2ENBA 2ZXRA 3K5OA 2MGSA 2F03A 1HNZL 1PYWD 4BBRG 3L3OC 3KJPA 1O7ZA 2D0OA 1MD2D 2EJFC 3K81C 3HOYG 2HCIA 2AQ1B 4MTKA 4DV5Q 1V43A 4H7BA 5K36G 1IW7C 2B39A 1Z7TA 2JA5B 1QUQA 4ZKCB 5C4JH 2F3VA 3P1HA 1P8LA 2HQLA 2V1CC 2B29A 2JA6B 5LMNQ 3A8JE 4CGYB 1HFNA 2DJFC 4FP5D 3SK6A 4OEMB 1IBKQ 4JG2A 1GM5A 1RTNA 2A68C 1KABA 5K5PA 1JWUD 4UP7A 1SSOA 4RWSC 1S40A 2MP1A 2P5ZX 3QOJA 1D5ZC 3CC7A 3EQLC 2JA6H 4NPSA 2RHQB 1XX8A 2NZHA 3P75A 3T1YQ 2EYPA 3I4NG 1G51A 4XYOA 3NWTA 4IZ8A 4OO1H 1CSPA 5IYBH 3GTGB 1EWCA 2K50A 3KF6B 5HY6A 3MXNA 4LF9Q 2IHEA 5BN5A 2HIVA 3CW2C 4BBRB 4DA2A 3CCUA 4A3JG 4A93G 1H9KA 4MHEA 5KYIA 1ZYRC 1FNUA 3W5OA 4EQNA 4DV5L 3HOYB 4RGOS 4IUPA 1LTTD 1U4PA 5IODA 3CU7A 2B2YA 1SROA 2F0QA 3PGZA 3CMEA 2ATWA 3D3RA 3GTGH 5EKKA 4DFAA 1PFNA 2KJXA 4C56C 2EZVA 3I2ZA 5LMNL 4Y7NB 2YYZA 1TWHB 2F0JA 3A54A 4ZLTF 4BBRH 2A69C 2F0LA 3H3VH 1IBKL 1I6HB 3I72A 2A5HA 4FYDA 4QF4A 3PO3B 2ZJPA 3K0YA 5IGBA 1Q8IA 5D65A 1B44D 1GUGA 3KBXA 1SR3A 2CVRA 1ASZA 2HDMA 3A55A 3LNNA 2N88A 4DN4M 3SK5A 1TKWB 1I50B 3T1YL 5I2YA 3I4NB 1XPRA 1STAA 1W6JA 3PO3H 2IT1A 4BA1I 4CKCA 4LF9L 1A2UA 1LV9A 2A6HC 1MJEA 4F8MA 3STBD 1QVFA 4XIGS 4A3JB 3CD6A 3TP5A 3J7YW 4X66Q 4KKTA 1MSGA 3I4NH 3GTKB 1CHQD 3TP6A 3S9WA 5G3LF 5ELCA 2ZXPA 3QIAA 5H1SE 4X64Q 4X3SA 4RCOA 4HIMA 3I56A 2D2CC 2NTTA 5ELFA 3A7AB 2NZ1D 5C0XH 2LY7A 3PUWA 2BDOA 1MBYA 1AN8A 5M3FH 5IT9c 5EKIA 4XXEA 2I0QA 4YIJA 1STHA 1ENAA 2MJ8A 1QVGA 1EY9A 1PRTB 2IL8A 4K5XA 4WFN3 2NVYB 1JB3A 3MC0B 4DK3C 3T13A 2JA8G 3MZ5A 4U68A 2EVBA 3BDOA 3EA6A 1FL0A 1IBMQ 2PQEA 1QG7A 3LGJA 2XIWA 1J8IA 1TU2B 1TWFB 4YCUA 4RG1A 3KF8A 1SXTA 4JI8Q 2L4NA 2IWHA 2JQOA 3HOVG 1Z9FA 3BZDB 4IFDI 3MFGA 2HD3A 4QUCA 1YITA 2KENA 3I73A 3D4RA 5DEHA 1TWCB 3AB9A 4IUNA 1PHJA 3UI2A 2Q8IB 4CBVA 2PI2A 1LTLA 4X66L 1EU3A 3GTJH 2VXWA 1VMPA 1YHQA 5HURA 3E0JA 2ID0A 3I90A 1QCBD 2KVMA 1TWFH 3GO5A 1I4GA 1WI5A 4AYBE 2NN6G 1KAAA 4X64L 1RKNA 3S1MB 3EIVA 3FHWA 3ERQA 4DV3Q 2UUAQ 2V4DA 5FOBB 4TSSA 1JOOA 2MFIA 2VL6A 4QGUA 5EPJA 4JI3Q 1U9RA 1PXUA 1X32A 1M8AA 4CDEC 2F0KA 1LTSD 2YTVA 3ITPA 1PA6A 1V1PA 1SEBD 1XNQQ 4H0LC 2ICIA 4A3IG 3FMCA 3HOUH 1Y1WB 4I7ZC 4LMQD 4CKEA 5C4XG 1OXVA 1IBML 3QO2A 2JA8B 2F3IA 2E2HB 3BVMA 3GTLB 4A3LG 1EYGA 3RN2A 4PZ8A 4E6IA 3M85A 4JI8L 4XQQA 4R4IA 1FYCA 1LTGD 1RF2D 4LF4Q 1D2BA 3HOVB 3CCEA 3BYYB 1CA6A 1WOCA 5C6AA 1Y1WH 3HOZH 1JJCB 3D31A 2Z6KC 3OHXC 2K7VA 2L55A 2JA8H 5M9OA 2E2HH 4QIWB 1LTID 3OMCA 5FLMG 2LXJA 2NVXH 2QF7A 3PUYA 2EE1A 4P72A 1CM9A 3CF5A 5JJIA 3S14B 5IP9G 4KJNA 1JB7A 3W1GA 1Z47A 3ND9A 1PFMA 4DV3L 2UUAL 5I9OA 2LSSA 4ZUIA 1RIPA 4B3MQ 3MTSA 2VZAA 4JI3L 4DV0Q 1CKNB 2E74C 2BDNA 1VQMA 2NTSA 1EEID 1A62A 3S14H 1XNQL 3CCQA 1EWHA 5EGTA 5I4DA 1Q82C 2L1BA 2DJGC 4N9TA 1HR0Q 5C4XB 1KNEA 1MHWC 1Y8OB 4C3JH 3AU7A 3D6CA 3CCLA 4DAMA 4RAUC 1JOQA 1TY0A 1VQ9A 4LF4L 3HG9A 3S15B 3E9IA 1VQKA 1C4QA 4K0KQ 2A1AA 5BR8L 2JA7G 1EIYB 3J7A5 2PQAA 5E7NA 4Q5VA 4CDDC 5IGGA 2K75A 3M4PA 2RVLA 1EZ8A 4B9WA 3S2DB 2IY5B 1LT3D 3EBEA 1BCPF 2G9DA 5ELOA 5GAHC 3S15H 4A3CG 3TDQA 2O5JC 5HGTA 3I91A 4F7XA 4CDFC 4B3ML 1RODA 4DV0L 5JOBA 1QOHA 4KHPQ 1IKLA 3T53B 3K57A 3S2DH 1OXUA 2JA9A 4JI5Q 3PCOB 1L2FA 3PQIA 3HZXA 1AH9A 1PTOC 3DWQA 3NPPA 3DLLA 1HR0L 4R4QA 3RMHA 3B6YA 2F0PA 1STEA 1Q3LA 1I4HA 3S16B 5J39A 3KLRA 1JWSD 1TQOA 2RDHA 2EXZA 3MVVA 4DUZQ 2SNSA 4K0KL 2DN8A 1N34Q 1BQQT 1X3QA 1TVXA 2EIFA 2EYFA 3A0JA 2QEXA 3D0FA 4K2LA 4KY6A 3V05A 2B2UA 3LX0A 2OWOA 3CKIB 3K7AH 1LABA 3U9SA 2UUBQ 4K8JA 1EY5A 1LT4D 4L5SA 3HOWB 1PRTF 3A5UA 5C44H 2XNAC 4ZKBB 1CKOA 4KHPL 5JVH3 3K58A 4LF7Q 1F77A 4R9WA 4JI5L 1EFID 3KLSA 4OWTB 1II3A 1STGA 3J80E 3DWAA 1HHVA 4KI0A 1M1KC 4A3CH 4KN7C 3HOWH 3QOLA 2VB3X 4ZCKA 2AWOA 1BDOA 3VYRA 1D5XC 4GKJQ 3A7LA 1TXYA 4PQXA 1SMXA 5IGCA 5D3DA 1JICA 1FGBD 4ODGA 4DUZL 5CORA 3BG3A 3KDFA 1RL2A 4N8FA 1PFSA 2Z6BA 3BYTB 1H9SB 4O0AA 2ES2A 2EYHA 2F52A 4YWLA 1N34L 1X3PA 3BZKA 3M4QA 2E75C 1CI3M 3PIP3 1MIUA 2R3ZA 4A3KG 3AYHB 1ENFA 1JWMD 2UUBL 3F2UA 4IFDG 2Y0SG 1Q1EA 1SMYD 1IL8A 2K14A 3NTIA 4WJ4A 2I5HA 4BXXH 3HS0C 4J15A 1VQEA 4N8X1 1NMFA 4LF5Q 4LF7L 2NVQH 4C3IG 1YVCA 4K14A 3D8GA 1F9SA 1K3BC 5BN3A 4DXFA 4XDXA 3EJIA 2B2YC 2QKIC 1XXGA 4BY1G 1WCMB 4IJHA 3PO2H 1MGSA 1ZEQX 4H44C 4GS3A 1R4PB 3G48A 2EOTA 4GKJL 2B2VA 1B2TA 2JYOA 3T1HQ 2SDFA 4HMIA 4YY3Q 5JPNC 1SNDA 3KFUA 4NMZA 1WCMH 4KY5A 2RKSA 1HA5A 4Y52H 2O4XA 3S17B 5E1FA 4RA8A 2WB1G 4LK1C 5D14A 1SFOB 3H6MA 4GLXA 1VF5C 4A3KB 1O78A 4WORA 1CK1A 2NZOA 4A3BG 1HH2P 2Y0SB 4LJZC 5AJ3Q 2CQAA 3E6ZX 5IYDG 4LF5L 5KNDA 1NAPA 1BF4A 4C3IB 4DV1Q 4PZ6A 1SFOH 4L6TB 4RGMA 1X56A 2NN6I 4PNYA 5C4ZA 4IFDH 1WFQA 2F0FA 4BY1B 2BE5D 1Q81C 2F0TA 5D3IB 4B3SQ 5CR3A 1DYQA 4OIJA 2AQ3B 4CKBA 5E3FA 3T1HL 4DK6C 2KECA 2LS01 4YY3L 1O7YA 4C3IH 2DGYA 5JJZA 1EQQA 1E3PA 2I46A 4GOPC 5CMDA 4G7OC 2K03A 2SEBD 5KNCA 5C3EG 4DAPA 4A3EH 1VQGA 3TP7A 2EYOA 4LFBQ 1GOZA 2WB1B 1M90C 1SBBB 4EGVA 5FJ8G 2EQSA 5GAEC 4L5RC 2NWGA 1J5EQ 4PV1C 2GN5A 2DY7A 3OOCA 1VQHA 5AJ3L 4A3DG 4A3BB 1Y1VG 2X69A 1DOLA 2Q2HA 1ZXTA 1AZPA 4JCVE 2PMZE 1CTMA 2E76C 3CCRA 4GNXA 4DV1L 3CMAA 5JEAH 1Q7YC 2E2DC 5LMUQ 4GLVB 4XT1B 3S2HB 5IIFA 2R93G 1BUVT 1S3OA 1SNCA 4A3BH 2F0GA 1L1OA 4B3SL 3JAME 3GDEA 1D1IA 3E0EA 4KD3A 4OGQC 1N33Q 4FVMA 4LF8Q 4RCNA 3R93A 1X55A 3PUXA 3TZDA 1NJIC 3FRPB 5DLQE 2CFMA 4KK7A 4LFBL 1EIHA 2L0CA 2XRQD 1SE8A 4K5WA 4ZK9B 2IX0A 4P2CB 4UDUC 2XRSD 2JJQA 1O7IA 1QILA 2JA5H 1B9NA 1J5EL 4K2KA 2PW5A 3WWVA 3J80c 3QJYA 4DR1Q 4HJ9A 4JPBW 1TS3A 1EQVA 1E22A 4A3DB 1I4XA 1VQJA 2N55A 1Y1VB 2WB1E 5LMNW 5JVG3 1F2LA 1SNMA 1LTRD 3KBGA 3GTOB 1J9OA 2ZT9C 3TP8A 5LMUL 2WP8J 3OSOA 2MO1A 3N6RA 1KTKA 1D7QA 1X3EA 5IT9L 3ZYYX 2R93B 3SHLA 4AYBG 4WJ3M 1GD7A 4HCSA 4JVZA 4A3DH 4TKOB 5FO8B 2KHJA 3W3AA 2F0UA 2CQOA 2DY8A 1WTXA 1AZQA 1N33L 3J81E 3GTOH 4JI1Q 4DNRB 2GA4B 4LF8L 3HEJA 1V9PA 3PUZA 1HZBA 2RQXA 4BWGB 2EPBA 1D1KA 3VA5A 2B63G 1W6KA 2M2LA 1L0YB 1V1QA 4QY7A 3HOYH 3NELA 4JC0A 3VR4A 3K59A 2UXBQ 5K36H 1K83B 4DR1L 2XN9C 1STBA 4A3GG 3J7AV 1YIJA 4AQYQ 4Y7NH 1TWHH 1UEAB 2VS1A 3SEBA 5IE8A 1CA5A 4IPHA 1I6HH 4DR6Q 3K5LA 1TS5A 1PZID 1K83H 1EY0A 2K32A 2Q2TA 3KYHC 4AYBB 5C0XJ 1LUZA 1WTRA 2FINB 3HKSA 4HCEA 1VQAA 4A93B 4N9PA 1OO9B 1I50H 4RHRA 1XMQQ 1Q8KA 3JAML 4JI1L 1PH3A 1O7LA 3PF4A 4DF7A 2DUDA 2K5NA 2AMCB 1YNNC 1BBXC 3SVMA 2K1BA 2VW9A 4IUUA 4QL5A 2G5DA 5KNBA 5C4HA 3FPPA 2B63B 3UDXA 1E1TA 4A3JH 4A93H 2XSCA 3H0GG 4ID6A 5L37A 3CCSA 2UXBL 4GOPA 4FDBA 3GTKH 3TBIB 3CPWA 2Z4IA 4OL7A 2X6LA 4OXPA 2F0MA 1EFWA 4A3GB 4AQYL 2XGTA 4IOAA 1TWGB 3DWPA 3C2PA 1I5FA 4OHJA 3L0OA 3NBHB 1PDQA 1G2TA 1H9SA 5GAGC 4DR6L 2K04A 1HFGA 3G71A 3ONAB 1I4RA 2QDLA 5A35A 3GD7A 4PMCA 1G2SA 4GLAC 1KDCA 5CYUA 5LL6S 5KRUA 2B2UC 2YU9B 1QE6A 3P20A 2NVYH 1BXTA 1TWGH 3PIPA 1Z6HA 1PH6A 1JT8A 2TSSA 3E9HA 2VQFQ 4LFAQ 1LT6D 3W2DA 5IGDA 1IW7D 5EJWA 2VY3A 4K5VA 2MHVA 2OTJA 1BO0A 1EY6A 3J81L 3H3VC 4GZYC 1SYBA 1BKBA 4QMGA 1C9OA 2QEJC 1K8GA 2YU9H 4DNIA 1Y14B 3Q22A 1TWCH 4HJ5A 3KJOA 3AFQA 1T5EA 4C1NK 4GN5A 1Y8PB 4L8JA 4OWXB 2A6EC 4I7AA 4DR2Q 3TS2A 1F9RA 3DM3A 3DXJC 1B4OA 3C3LA 1LM0A 2SOBA 2RCFA 1I4PA 3S1MH 2H5XA 5LHY1 3CRLC 5CV4A 3KK7A 3JAMc 4LF6Q 3I7FA 1BCPC 3GV6A 3F1ZA 3FVQA 4C1NI 2EDGA 1LACA 1PTOB 4UY8C 1NBWA 4DKAC 2MNAA 3EFXD 4DGZA 4G7HC 1GHJA 4QB4A 4HMJA 4JI7Q 1DOMA 1A8VA 2VQFL 1PH2A 4LFAL 3ULLA 1U4LA 1U0LA 1ZYRD 3GTLH 5E4XA 3CC2A 4XYQA 1L0WA 4ZQ3A 3SK4A 2G9HD 1XMOQ 1TS4A 3M7NA 4WJWA 3HOVH 1GUOA 3CCJA 2E2JB 1YEZA 4POFA 2PZWA 2A69D 2D9UA 4HIOA 4KHZA 4AH6A 1QZGA 2FXQA 1UUPA 2IHFA 1DM0B 1KC8C 2LXKA 1Q1BA 2B2VC 4DR2L 3OW2A 2EYLA 3SK8A 4XTCS 1GUWA 2NN6H 1EIGA 4DK1A 1WYDA 4A3IB 1RDPD 4ULLA 4LF6L 2N49A 3OMGA 1UE1A 3NQIA 1XYIA 1KAWA 4MNOA 3J81c 1SDFA 2AWNA 2IPKD 5FLXE 3OWFA 2VB2X 1PRTC 1JC7A 1XPOA 4R4CA 3PSIA 2R92G 2I07B 2B2WA 2Z9HA 1S72A 4JI7L 2A6HD 3OWEB 3S1NB 3RZOB 4A3IH 1A3TA 4EVOA 1KDAA 5C4XH 3TREA 1KRSA 4X3UA 1HR0W 1QNUA 5KEEA 2N78A 3OIQA 5A2QE 1SE2A 2EY5A 3UDFA 2KOLA 4KHVA 4UP9A 1PH9A 4A3LH 4JBKA 2DNEA 2EY6A 4OO1I 5IP7G 1Q46A 1XMOL 5IGEA 2CCZA 1CSQA 1ICWA 1EOVA 3RZOH 2PZUA 2A74C 5I6YA 1W2BA 1AP0A 3JC66 2F3WA 2F0HA 4X62Q 2UU9Q 3F8TA 5FLMH 1EYCA 2HHHQ
chains in the Genus database with same CATH topology
2KCCA 1KLGD 3MHBA 1JE4A 2IW3A 2F0SA 4IUVA 4KY7A 3IAYA 2OF1A 3VR6A 4FNFA 2AUKA 3VR5A 1A6XA 2B8GA 2PCFB 1LT5D 1SYGA 3OIPA 4ZUJA 2Z4HA 1SJHD 2R92B 3PV0A 1CHPD 4C2MB 4FXGC 2JA7B 3LWEA 3C1EA 1A15A 3VA7A 5M5XB 1GUTA 5NUCA 1S5FD 1YNJC 4JK1C 1NCVA 3WOEA 2Z1CA 4Q0FA 2HCCA 3GTQB 3BDCA 3K6OA 3OW7A 3CRKC 5C3XA 1T5XD 3GP7A 3D4DA 3CQZB 3PIO3 4TRDA 4EQPA 2J4XA 5M5WB 3GTMB 5C3WA 4HN7A 3HP3A 3BS1A 2E2IB 2EYJA 4FF2A 2BOSA 3S1QB 2WINB 3PUVA 1SE3A 1B53A 4MIUA 5C0XI 3NE5B 1SYEA 2IX3A 1IHZA 5FLXL 4QCLA 2CW0C 2MUYA 2QILA 3A56A 4A3FB 3SXHA 3E5SA 1CZWA 1EQTA 3T16A 1HQMC 1EYDA 3BVZA 2B2TA 1CQVA 1G91A 3IFDA 4RKLA 2Z8LA 4KN4C 3RD4A 2MPMA 4CJ1B 4FF4A 2VNUD 1I3QB 4BY7B 1TR5A 2F0OA 2EJMA 4LAAA 3EVQA 1A3UA 1HXYD 1ONLA 4CHTB 4NKLA 2NBFA 1IKMA 4ZAIA 1VF7A 2FFKB 3HRZC 2K5WA 3SE0A 1DXMA 1STNA 1V8QA 2PNRC 1B9MA 2OT2A 1DD2A 3HOXB 2K28A 3VYTA 1SE4A 5J1ZA 5J22A 1DJRD 3A8IE 5I9PA 1RHPA 3NBHA 1V1PB 5CV8A 1AW7A 3URYA 2PMZB 2QDBA 3I4LA 1HA6A 2J0TD 4EQOA 1HQRD 1NR2A 1F2ZA 4KD4A 1PTOD 2O5IC 3H09A 4DXGA 5I6WA 1JORA 4X3KA 3BDLA 3J80L 1D5MC 1A2TA 2RSOA 3ND8A 3Q24A 2KA7A 4R8IA 1IYUA 1ET6A 1HCZA 3BVGA 3NP8A 1DCZA 5AFWA 5CBAE 5JEAJ 3T4AC 3IFTA 3L7ZC 5COYA 1TS2A 1BR9A 4ZRZA 4K6DA 3R2TA 1WD0A 1FNVA 2PPBC 1S5DD 5EBDA 4F88A 2AUJD 2WACA 2R6GA 4RH6A 4HSPA 1LTBD 2KUMA 5ELBA 4OO1G 3S1RB 2WIIB 3RZDB 1SNOA 3MFYA 2HUGA 1K8OA 2PO4A 3MEHA 1HPCA 4BS9A 4CJ0B 1S5BD 2HQEA 2KCNA 3L9AX 5CC4A 1I4QA 4F87A 1SNPA 3FEWX 3J7AF 5C4JB 3D6WA 5C3EB 2BA0A 1AEXA 1H9JA 4M1UB 3Q0AA 1EY7A 3DEOA 3FDTA 1I6VC 1PZJD 3H91A 2JP1A 5CGKA 4IUTA 3NTHA 1QNKA 3HKZB 5I2XA 2WKDA 1H9RA 2K01A 3DMUA 1WTOA 1RD9D 1HRJA 4KTAA 3NSWA 4M8AA 4K6LA 1E2ZA 3NHHA 4HTHA 1SJED 1SNQA 4B08A 1OXSC 1F9QA 3I70A 5KGUA 1JOKA 1R4QB 1C48A 2K33A 3OPOA 1E2VA 2LMCB 4S3SA 5C0XG 1EU4A 5DM63 3M4YA 2B2WC 1VCIA 1ESFA 3VR3A 2R7ZB 3WOFA 4QUFA 2EJGC 1BNZA 2J7ZA 4RKBA 1GHKA 2KQ3A 1HUMA 1KDBA 2F0IA 5EPLA 2K5DA 4K8IA 2M9VA 3DHQA 1CZGA 4B9XA 1BCPB 2SNMA 1JR0D 3SDZA 1G6ZA 2RBMA 2KEEA 3RUZA 5FKAC 4V0BA 1M4VA 2L5TA 4IN3A 3T51B 4H13C 1U4MA 3IL8A 1SYDA 4HAEA 3DM1A 2C5CA 4J8QA 3X3MA 3QWNA 4KKSA 3TZUA 5M3FB 3NXWA 5ELDA 4KJOA 4HEDA 1FR3A 3MXUA 4NW2A 1A3VA 1NUCA 1F9PA 3TSSA 4DNTB 2A73B 1LLRD 1CT1D 1EY8A 5T1IA 1S5ED 2EYMA 3VR2A 3LWUA 2C9OA 4L63B 3I8ZA 2F0WA 3VYUA 3C46A 3GV3A 3GTJB 3MXPA 1JCKB 1XTCD 2RDFA 2D62A 2F0NA 3CHBD 1TIID 3HGBA 1E0BA 1QJOA 1FNWA 4IQZA 4J6HA 2F0VA 4OIKA 1AFPA 2JE6I 1EL0A 1TT2A 2LFNA 2A68D 5EPKA 2F4IA 5LL6X 1F2MA 3H0GB 4DK0A 4XQNA 2PZTA 3X3NA 1R9TB 5E4WC 2F0DA 3FPUB 4FXDA 5DAUA 2CHBD 3HOUB 2ZXOA 5G3LD 4C3JG 4O1NA 4NP5A 2FMMA 2XWJB 1Y8NB 1B50A 2B2TC 3QG1A 1D6EC 3HOZB 2R61A 1L0XB 3NWSA 4NDXA 1DONA 5DNFA 1PTOH 1C8CA 2NVXB 1SYFA 2KEDA 3KUPA 4ABNA 2KHSA 4IURA 4G57A 2L11A 4Z9CB 3T56B 2WKCA 3M3YB 2FMCA 1OXXK 1PZKD 1SMYC 2NB0A 1H9MA 2Q8RE 3C1FA 1ENCA 4G4KA 4C3JB 1Y69U 3NUCA 4RHSA 3U9OA 1PMRA 1KNAA 3DUZA 5KIXA 1ET9A 2JSOA 4UAIA 1EEFD 1BOSA 4FF1A 2K6AA 2JXMB 2RA4A 3NQTA 1YNND 5CV7A 4ZYSA 1STYA 2PYKA 1S5CD 3O13A 4HSVA 4RGTA 3MXGA 4I65A 2Q8TA 5ELEA 2D5DA 4XQJA 3MAQA 4G7ZC 1DOKA 4DU9A 1NR4A 3PMFA 5EQ0A 2PW7A 3TN2A 4PMBA 4IUQA 3NBIA 4KMUC 4XT3B 1QB5D 1EYAA 3KLSX 2X6GA 5F2DA 2NYZD 2XWBB 1RTOA 2FJ2A 2ICEC 4FF3A 1QWYA 2BE5C 3P7JA 1WTVA 2IJ0A 2O2LD 1JQYD 1EY4A 3Q23A 5FK9C 1CFMA 3K7AB 1B3AA 1WTWA 1HUNA 2H4OA 1WTQA 5C44B 1LO5D 4FO2A 1MSHA 3DEPA 2A6ED 2FHTA 3V2TA 2F0EA 4TQUS 5CV9A 4DAVA 1F2YA 2HDLA 1BCPD 1TY2A 4DAYA 5IGFA 2JEAI 1ILPA 4FXKC 1SAPA 2BA1A 1GUNA 1O80A 1CQFA 1RJTA 3MWYW 3D4WA 5BN4A 5CV5A 3R3OA 1VMCA 4IALA 5T1GA 2M00A 5CBEE 4R8NA 5A2QL 3A8KE 1PFBA 2JEBI 5C5MA 4BBSB 3R2IA 4MN3A 1SYCA 5KYLA 4KV6A 4C3HG 1UNSA 5M3MB 1ESRA 2XVSA 4RGNA 2NVQB 5EKLA 1HTLD 1PTOF 1OXTA 1VDZA 2EY1A 2K05A 3R8BA 3M4OB 1G291 1MI2A 2IX1A 1GUSA 5FO9B 2BCOA 2OXPA 3PO2B 1V1OA 2K5QA 1PRTD 5IOCA 1WTPA 1GJXA 1Q12A 3IKJA 4CJ2C 3QB3A 1EOTA 4ME5A 4RFBA 2LKVA 3MA2B 2B8FA 1S4ZA 5FO7B 3G7LA 4V190 5JAVA 3K5MA 2EY2A 3K5NA 1DZ1A 3I3CA 1WD1A 4IFDJ 2VUMB 4HR7B 3GTPB 3G6JB 4C3HB 3Q6SA 5CV6A 1EZ6A 5JEAG 2NVTB 1IYVA 1NSNS 3WDNA 3AMUA 4JBWA 2WV6D 2H1EA 2AQ2B 2DNCA 4WRDA 1HTPA 5ISRA 2L9HA 4ILWA 1ML0D 4PMWA 1ILQA 1LTAD 4U673 2F1MA 5IT9E 5EBCA 1TWAB 3H94A 3VYSA 2OEOA 3I4MB 1XWEA 4A3MB 4A3EB 1ZKOA 3NK9A 5DM73 3SR1A 1YNJD 1B1ZA 4J1MA 4KKUA 1FD7D 5TSSA 2NUCA 3V96A 3GQBA 2RSNA 1G8ZD 4X3TA 2RDGA 3FKIB 3EROA 2QCPX 5JPMC 5M5YB 4BA2I 5C5LA 1U4RA 3RLFA 3N52A 2L12A 4O42A 1K8MA 1Q90A 1PLFA 1RCVD 3M7GA 1KLUD 1GXDC 1WVLA 3TMEA 3NTKA 1UAPA 2WAQB 1E2WA 2TMPA 2CW0D 2ENBA 2ZXRA 3K5OA 2MGSA 2F03A 1PYWD 3L3OC 1O7ZA 1MD2D 2EJFC 2HCIA 2AQ1B 1V43A 4H7BA 5K36G 1IW7C 2B39A 1Z7TA 2JA5B 4ZKCB 2F3VA 3P1HA 2JA6B 3A8JE 4CGYB 1HFNA 4FP5D 3SK6A 1RTNA 5K5PA 2A68C 1KABA 1JWUD 1SSOA 4RWSC 2MP1A 3QOJA 1D5ZC 3EQLC 1XX8A 3P75A 2EYPA 4XYOA 3NWTA 4IZ8A 4OO1H 3GTGB 1EWCA 3MXNA 5BN5A 4BBRB 4DA2A 1H9KA 4MHEA 5KYIA 1ZYRC 1FNUA 3HOYB 4EQNA 4RGOS 4IUPA 1LTTD 1U4PA 5IODA 3CU7A 2B2YA 2F0QA 3D3RA 5EKKA 4DFAA 1PFNA 2KJXA 4C56C 2EZVA 4Y7NB 2YYZA 1TWHB 2F0JA 3A54A 4ZLTF 2A69C 2F0LA 1I6HB 3I72A 2A5HA 4FYDA 4QF4A 3PO3B 3K0YA 5IGBA 1Q8IA 5D65A 1B44D 1GUGA 3KBXA 2CVRA 2HDMA 3A55A 3LNNA 2N88A 4DN4M 3SK5A 1TKWB 1I50B 5I2YA 3I4NB 1STAA 1W6JA 2IT1A 4BA1I 4CKCA 1A2UA 1LV9A 2A6HC 4F8MA 4XIGS 4A3JB 3TP5A 3J7YW 4KKTA 1MSGA 3GTKB 1CHQD 3TP6A 3S9WA 5G3LF 5ELCA 2ZXPA 3QIAA 4X3SA 4RCOA 2D2CC 2NTTA 5ELFA 3A7AB 2NZ1D 5C0XH 2LY7A 3PUWA 2BDOA 1MBYA 1AN8A 5EKIA 4XXEA 4YIJA 1STHA 1ENAA 2MJ8A 1EY9A 1PRTB 2IL8A 4K5XA 4WFN3 2NVYB 1JB3A 3MC0B 3T13A 3MZ5A 4U68A 2EVBA 3BDOA 3EA6A 2PQEA 1QG7A 2XIWA 1J8IA 1TU2B 1TWFB 3KF8A 1SXTA 2L4NA 2IWHA 3BZDB 4IFDI 3MFGA 4QUCA 3I73A 3D4RA 5DEHA 1TWCB 3AB9A 4IUNA 3UI2A 2Q8IB 4CBVA 1EU3A 2VXWA 1VMPA 5HURA 3E0JA 2ID0A 3I90A 1QCBD 2KVMA 3GO5A 1I4GA 2NN6G 1KAAA 1RKNA 3S1MB 3ERQA 2V4DA 5FOBB 4TSSA 1JOOA 5EPJA 1U9RA 1PXUA 1X32A 1M8AA 2F0KA 1LTSD 3ITPA 1V1PA 1SEBD 4H0LC 2ICIA 3FMCA 1Y1WB 4I7ZC 4LMQD 4CKEA 1OXVA 3QO2A 2JA8B 2E2HB 3BVMA 3GTLB 4E6IA 3M85A 4XQQA 1FYCA 1LTGD 1RF2D 1D2BA 3HOVB 3BYYB 1CA6A 5C6AA 3D31A 3OHXC 2K7VA 2L55A 5M9OA 4QIWB 1LTID 3OMCA 2QF7A 3PUYA 2EE1A 1CM9A 3S14B 4KJNA 1Z47A 3ND9A 1PFMA 5I9OA 4ZUIA 3MTSA 2E74C 2BDNA 2NTSA 1EEID 1EWHA 5EGTA 5I4DA 2L1BA 4N9TA 5C4XB 1KNEA 1Y8OB 3AU7A 3D6CA 4RAUC 1JOQA 1TY0A 3HG9A 3S15B 1C4QA 4Q5VA 5IGGA 2RVLA 1EZ8A 4B9WA 3S2DB 1LT3D 1BCPF 2G9DA 3TDQA 2O5JC 5HGTA 3I91A 4F7XA 1RODA 5JOBA 1QOHA 1IKLA 3T53B 3K57A 1OXUA 3HZXA 1PTOC 3DWQA 3NPPA 3RMHA 2F0PA 1STEA 1Q3LA 1I4HA 3S16B 5J39A 3KLRA 1JWSD 1TQOA 2RDHA 2EXZA 3MVVA 2SNSA 2DN8A 1BQQT 1X3QA 1TVXA 2EYFA 4K2LA 4KY6A 3V05A 2B2UA 3LX0A 3CKIB 1LABA 3U9SA 4K8JA 1EY5A 1LT4D 3HOWB 1PRTF 2XNAC 4ZKBB 5JVH3 3K58A 1F77A 4R9WA 1EFID 3KLSA 1II3A 1STGA 3J80E 3DWAA 1HHVA 4KI0A 4KN7C 3QOLA 2VB3X 2AWOA 1BDOA 3VYRA 1D5XC 3A7LA 4PQXA 5IGCA 5D3DA 1JICA 1FGBD 4ODGA 5CORA 3BG3A 3BYTB 1H9SB 2EYHA 1X3PA 2E75C 1CI3M 3PIP3 2R3ZA 1ENFA 1JWMD 3F2UA 4IFDG 1Q1EA 1SMYD 1IL8A 3NTIA 3HS0C 4C3IG 4K14A 3D8GA 1F9SA 5BN3A 4DXFA 4XDXA 3EJIA 2B2YC 2QKIC 1XXGA 1WCMB 1MGSA 1ZEQX 4H44C 1R4PB 2EOTA 2B2VA 1B2TA 2JYOA 2SDFA 4HMIA 5JPNC 1SNDA 4NMZA 4KY5A 2RKSA 1HA5A 2O4XA 3S17B 5E1FA 4RA8A 4LK1C 5D14A 1SFOB 3H6MA 1VF5C 4A3KB 1O78A 4WORA 1CK1A 2Y0SB 4LJZC 2CQAA 3E6ZX 5KNDA 1NAPA 1BF4A 4C3IB 4L6TB 4RGMA 2NN6I 4PNYA 5C4ZA 4IFDH 2F0FA 4BY1B 2BE5D 2F0TA 5D3IB 5CR3A 1DYQA 4OIJA 2AQ3B 4CKBA 5E3FA 2KECA 2LS01 1O7YA 5JJZA 2I46A 5CMDA 4G7OC 2K03A 2SEBD 5KNCA 4DAPA 3TP7A 2EYOA 1GOZA 2WB1B 1SBBB 4EGVA 2NWGA 4PV1C 3OOCA 2DY7A 4A3BB 2X69A 1DOLA 1ZXTA 1AZPA 1CTMA 2E76C 5JEAH 2E2DC 4XT1B 3S2HB 5IIFA 1SNCA 1BUVT 2F0GA 3JAME 1D1IA 4KD3A 4OGQC 4FVMA 4RCNA 3R93A 3PUXA 3TZDA 3FRPB 4KK7A 1EIHA 2L0CA 2XRQD 4K5WA 4ZK9B 2IX0A 4P2CB 4UDUC 2XRSD 1QILA 1B9NA 4K2KA 2PW5A 3QJYA 1TS3A 1EQVA 4A3DB 1I4XA 2N55A 1Y1VB 5JVG3 1F2LA 1SNMA 1LTRD 3KBGA 3GTOB 1J9OA 2ZT9C 3TP8A 2WP8J 3OSOA 3N6RA 1KTKA 5IT9L 3ZYYX 2R93B 3SHLA 4HCSA 4TKOB 5FO8B 3W3AA 2F0UA 2DY8A 1WTXA 1AZQA 3J81E 4DNRB 2GA4B 3HEJA 3PUZA 2RQXA 4BWGB 2EPBA 1D1KA 3VA5A 1W6KA 2M2LA 1L0YB 3K59A 3VR4A 5K36H 1K83B 2XN9C 1STBA 3J7AV 1UEAB 3SEBA 1CA5A 3K5LA 1TS5A 1PZID 1EY0A 2K32A 4AYBB 5C0XJ 1WTRA 2FINB 4HCEA 4A93B 4N9PA 1OO9B 4RHRA 3JAML 1O7LA 4DF7A 1YNNC 1BBXC 3SVMA 2K1BA 4IUUA 5KNBA 5C4HA 3FPPA 2B63B 2XSCA 4ID6A 3TBIB 2Z4IA 4OL7A 2X6LA 2F0MA 4A3GB 1TWGB 3DWPA 3C2PA 4OHJA 1G2TA 1PDQA 1H9SA 2K04A 1HFGA 3ONAB 1I4RA 5A35A 3GD7A 4PMCA 1G2SA 1KDCA 5CYUA 5LL6S 5KRUA 2B2UC 2YU9B 1QE6A 3P20A 1BXTA 1Z6HA 2TSSA 1LT6D 3W2DA 5IGDA 1IW7D 5EJWA 4K5VA 2MHVA 1BO0A 1EY6A 3J81L 3H3VC 4GZYC 1SYBA 4QMGA 2QEJC 3Q22A 1T5EA 4C1NK 1Y8PB 4L8JA 2A6EC 1F9RA 3DXJC 1B4OA 3C3LA 2SOBA 1I4PA 5LHY1 3CRLC 5CV4A 3KK7A 1BCPC 3GV6A 3FVQA 4C1NI 2EDGA 1LACA 1PTOB 3EFXD 4DGZA 4G7HC 1GHJA 4QB4A 4HMJA 1DOMA 1U4LA 1ZYRD 5E4XA 4XYQA 4ZQ3A 3SK4A 2G9HD 1TS4A 3M7NA 4WJWA 1GUOA 2E2JB 2PZWA 2A69D 2D9UA 4KHZA 1UUPA 1DM0B 1Q1BA 2B2VC 2EYLA 3SK8A 4XTCS 1GUWA 2NN6H 1EIGA 4DK1A 4A3IB 1RDPD 4ULLA 3OMGA 3NQIA 1XYIA 1SDFA 2AWNA 2IPKD 5FLXE 3OWFA 2VB2X 1PRTC 1JC7A 2I07B 2B2WA 2A6HD 3OWEB 3S1NB 3RZOB 1A3TA 4EVOA 1KDAA 4X3UA 1QNUA 5KEEA 3OIQA 5A2QE 1SE2A 2EY5A 2KOLA 4KHVA 2DNEA 2EY6A 4OO1I 5IGEA 1ICWA 2PZUA 2A74C 5I6YA 1AP0A 2F3WA 2F0HA 1EYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0N A;  4HMI A;  5ISR A;  4RKL A;  4KJN A;  3MHB A;  1EY0 A;  1SND A;  4K6D A;  3QOJ A;  4NMZ A;  4KD3 A;  4S3S A;  2EYF A;  3NQT A;  2F0V A;  4J6H A;  4K2L A;  4KY5 A;  2F0S A;  2RKS A;  4KY6 A;  4DGZ A;  5I9O A;  3LX0 A;  3D4W A;  1TR5 A;  4KY7 A;  1TT2 A;  2F0O A;  2O4X A;  2WAC A;  5CV5 A;  4YIJ A;  5E1F A;  3R3O A;  2OF1 A;  1STH A;  4N9P A;  3P75 A;  3EVQ A;  4LAA A;  1ENA A;  1A3U A;  4QB4 A;  4IAL A;  1STY A;  2OEO A;  1F2M A;  4HMJ A;  2EYP A;  4K8J A;  4NKL A;  1EY5 A;  2PYK A;  2M00 A;  1EY9 A;  4K5X A;  4IZ8 A;  4R8N A;  1SYG A;  2PZT A;  3T13 A;  3H6M A;  3MZ5 A;  4RKB A;  4DF7 A;  4I65 A;  4ZUJ A;  2KQ3 A;  1SNO A;  2F0D A;  4WOR A;  4K5W A;  2PQE A;  5C5M A;  1KDB A;  5DAU A;  2F0I A;  5EGT A;  1SYC A;  1STN A;  5KYL A;  4K8I A;  4ZQ3 A;  3MEH A;  4N9T A;  3SK4 A;  3NK9 A;  3DHQ A;  4KV6 A;  3SR1 A;  1II3 A;  2HQE A;  4B9X A;  5C4H A;  2SNM A;  4K2K A;  1STG A;  2PW5 A;  3C1E A;  4DU9 A;  1EQV A;  4J1M A;  5CV7 A;  5KYI A;  4ID6 A;  5CC4 A;  4EQN A;  4NP5 A;  3D6C A;  2NUC A;  2RBM A;  5EKL A;  3PMF A;  5DEH A;  2F0G A;  1JOQ A;  2EY1 A;  2PW7 A;  5IOD A;  4PMB A;  3QOL A;  2PZW A;  2F0Q A;  4IUN A;  5J1Z A;  1SNP A;  4OL7 A;  5NUC A;  5EKK A;  4DFA A;  2F0M A;  4PNY A;  5C4Z A;  3RUZ A;  5J22 A;  1SNM A;  3ERO A;  5HUR A;  2F0F A;  2OXP A;  5I9P A;  5CV8 A;  3TP8 A;  1AEX A;  2F0T A;  2QDB A;  1EYA A;  2EYL A;  3BDC A;  3OSO A;  3SK8 A;  5C5L A;  2F0J A;  5C3X A;  5CR3 A;  4ODG A;  3D4D A;  1KAA A;  2F0L A;  5E3F A;  4NDX A;  1EY7 A;  1RKN A;  5IOC A;  4TRD A;  3SHL A;  5F2D A;  4EQP A;  5IGG A;  4EQO A;  3ERQ A;  3OMG A;  4QF4 A;  1EZ8 A;  1SYF A;  2EYH A;  4B9W A;  1SYD A;  5C3W A;  1F2Z A;  2F0U A;  3QB3 A;  4PMC A;  1JOO A;  1KDC A;  2KHS A;  4KD4 A;  5IGB A;  2EYJ A;  5KRU A;  4ME5 A;  5CGK A;  1U9R A;  3OWF A;  3TME A;  4G57 A;  5HGT A;  2F0K A;  2LKV A;  4F7X A;  3ITP A;  3NXW A;  3HEJ A;  1EY4 A;  3TP7 A;  2EYO A;  3SK5 A;  5IGD A;  5JAV A;  4MIU A;  5JOB A;  4KJO A;  4WRD A;  2ENB A;  5IGC A;  1JOR A;  5I6W A;  5K5P A;  2EY2 A;  1STA A;  3BDL A;  1SYE A;  1A3T A;  3DMU A;  4K5V A;  4EVO A;  1KDA A;  1IHZ A;  1EY6 A;  3VA5 A;  4KTA A;  1A2U A;  5KEE A;  1A2T A;  3HZX A;  1SYB A;  1A3V A;  4QMG A;  2EY5 A;  1NUC A;  4KHV A;  3V2T A;  4HTH A;  2EY6 A;  3NHH A;  4H7B A;  4E6I A;  2F0E A;  4F8M A;  5IGE A;  1EY8 A;  3D8G A;  4K14 A;  1SNQ A;  5CV9 A;  1STB A;  2F3V A;  5CV6 A;  3P1H A;  2EYM A;  3EJI A;  3SXH A;  3TP5 A;  1F2Y A;  2F0P A;  3C1F A;  3E5S A;  1ENC A;  5CV4 A;  4ZUI A;  1EZ6 A;  5KGU A;  2PZU A;  3NUC A;  5C6A A;  5I6Y A;  3NP8 A;  3T16 A;  1JOK A;  3U9O A;  1EYD A;  1NSN S;  5J39 A;  3TP6 A;  2F0W A;  3S9W A;  2F3W A;  1TQO A;  5IGF A;  2F0H A;  5M9O A;  2EXZ A;  2SOB A;  3MXP A;  3MVV A;  3SK6 A;  5IIF A;  5KIX A;  2SNS A;  1SNC A;  2RDF A;  3OMC A;  1KAB A;  1EYC A; 
#chains in the Genus database with same CATH topology
 2KCC A;  1KLG D;  3MHB A;  5IP9 H;  1JE4 A;  1PYS B;  3RLO A;  2RHS B;  2IW3 A;  2HIX A;  2F0S A;  4DV7 Q;  4IUV A;  4KY7 A;  3IAY A;  4NB3 A;  3NEN A;  2OF1 A;  3U4Z A;  3VR6 A;  3ICE A;  4FNF A;  1K0R A;  2AUK A;  3VR5 A;  2B8G A;  2PCF B;  2A8V A;  1A6X A;  1LT5 D;  1SYG A;  3OIP A;  4ZUJ A;  2Z4H A;  1SJH D;  3CP0 A;  2R92 B;  3PV0 A;  2YV5 A;  1CHP D;  4C2M B;  1SLJ A;  4FXG C;  1PH1 A;  2JA7 B;  3LWE A;  4A3F G;  3C1E A;  1A15 A;  3VA7 A;  5M5X B;  1IBL Q;  3OYY A;  4GNX C;  3S16 H;  1GUT A;  4LWC A;  5NUC A;  4LUV A;  1S5F D;  1YNJ C;  4JW0 A;  1NCV A;  4JK1 C;  3WOE A;  4C2M H;  1K73 C;  2F4V Q;  3KF6 A;  1N36 Q;  1PYB A;  2Z1C A;  4Q0F A;  2HCC A;  1K9M C;  3BDC A;  3K6O A;  3OW7 A;  3CRK C;  3GTQ B;  4X62 L;  5C3X A;  1T5X D;  3GP7 A;  2UU9 L;  1L1O C;  5M3M G;  3D4D A;  4LNQ A;  2JA7 H;  3CQZ B;  4EQ5 A;  3PIO 3;  2HHH L;  4HJ7 A;  4TRD A;  4EQP A;  5M5X H;  1HJP A;  4BY7 G;  2J4X A;  5M5W B;  3GTM B;  5C3W A;  5GRO A;  4HN7 A;  3HP3 A;  3BS1 A;  2E2I B;  2EYJ A;  4FF2 A;  2BOS A;  3S1Q B;  2WIN B;  2ASB A;  1QVC A;  4DV7 L;  1X54 A;  1HNW Q;  3PUV A;  1SE3 A;  1B53 A;  4MIU A;  5C0X I;  3NE5 B;  1SYE A;  1X6O A;  2IX3 A;  3GTM H;  1IHZ A;  3F2B A;  1I94 Q;  5FLX L;  2E2I H;  3HOX G;  4P75 A;  1EWI A;  4B3T Q;  2CW0 C;  4QCL A;  5IYC G;  2QW7 A;  2MUY A;  2QIL A;  4KLK A;  1N32 Q;  2KCT A;  1P16 A;  3A56 A;  3RN5 A;  3SXH A;  4A3F B;  1FJG Q;  3E5S A;  2N3S A;  1IBL L;  1CZW A;  1EQT A;  1UWV A;  3T16 A;  1HQM C;  1EYD A;  3BVZ A;  2B2T A;  2F4V L;  1CQV A;  2N8N A;  1N36 L;  1G91 A;  3IFD A;  4RKL A;  2Z8L A;  4KN4 C;  3RD4 A;  2MPM A;  4A3F H;  3KF8 B;  5EAY A;  4CJ1 B;  4FF4 A;  2VNU D;  1I3Q B;  4BY7 B;  1TR5 A;  2F0O A;  4UHV A;  2EJM A;  4LAA A;  3EVQ A;  1GKH A;  1A3U A;  1HXY D;  1ONL A;  4CHT B;  4NKL A;  1PH8 A;  4L5T A;  3JAM i;  2NBF A;  1HNW L;  3G4S A;  1IKM A;  4ZAI A;  1VF7 A;  1BBW A;  2FFK B;  3HRZ C;  2K5W A;  3SE0 A;  2KCM A;  4YWK A;  4ALP A;  1I3Q H;  1DXM A;  1STN A;  1EQR A;  1I94 L;  4BY7 H;  1LYL A;  1V8Q A;  1YJN A;  2PNR C;  4O2D A;  1B9M A;  2OT2 A;  4JYA Q;  1PH7 A;  1DD2 A;  4B3T L;  3I4M G;  3HOX B;  3KLW A;  2K28 A;  2KHI A;  1N32 L;  3VYT A;  1SE4 A;  5J1Z A;  5J22 A;  1FJG L;  1DJR D;  1JMC A;  3A8I E;  1C0A A;  5I9P A;  4IPG A;  1RHP A;  3NBH A;  1V1P B;  5CV8 A;  1AW7 A;  3URY A;  2PMZ B;  2QDB A;  2C35 B;  1YZ6 A;  3I4L A;  1WTH A;  1HA6 A;  2J0T D;  4EQO A;  1HQR D;  1NR2 A;  2A19 A;  1F2Z A;  3S17 H;  2OCE A;  3ULP A;  1K3R A;  4KD4 A;  3MEF A;  3FKI G;  1E24 A;  5FLX c;  1IYJ B;  3CCV A;  4A3K H;  1XNR Q;  1PTO D;  4TVA B;  2O5I C;  3H09 A;  2EXD A;  4DXG A;  5I6W A;  1JOR A;  4X3K A;  2ZM6 Q;  3BDL A;  3J80 L;  1D5M C;  3J81 i;  1A2T A;  4QQB X;  1B70 B;  2RSO A;  4HJ8 A;  4DV6 Q;  2BH2 A;  3ND8 A;  2PI2 E;  4JYA L;  2BH8 A;  3CC4 A;  3Q24 A;  1SN8 A;  2KA7 A;  4R8I A;  4BY1 H;  4JI4 Q;  1IYU A;  1ET6 A;  1HCZ A;  1PH4 A;  3BVG A;  3NP8 A;  1FGU A;  2E5L Q;  3EN2 A;  1DCZ A;  5AFW A;  5CBA E;  5JEA J;  3STB C;  3T4A C;  2XTI A;  3IFT A;  4OON A;  4YCV A;  4A4I A;  3L7Z C;  1HZ9 A;  5COY A;  1TS2 A;  1BR9 A;  4ZRZ A;  3U58 A;  4K6D A;  3AQQ A;  3R2T A;  1WD0 A;  1FNV A;  2PPB C;  1JJG A;  5JJK A;  1S5D D;  5EBD A;  4P74 A;  2JA6 G;  4F88 A;  2AUJ D;  2CWP A;  2WAC A;  1EIF A;  3HKZ G;  1KL9 A;  4HJA A;  2R6G A;  4RH6 A;  4HSP A;  1LTB D;  2KUM A;  2R7F A;  5ELB A;  4OO1 G;  1WJJ A;  5IYB G;  3S1R B;  2WII B;  3RZD B;  1XNR L;  1SNO A;  3MFY A;  3A74 A;  2HUG A;  2ZM6 L;  1K8O A;  1HZC A;  2PO4 A;  3MEH A;  1HPC A;  4BS9 A;  4CJ0 B;  1S5B D;  2HQE A;  5IYD H;  1UE6 A;  2KCN A;  3L9A X;  5CC4 A;  4DV6 L;  1I4Q A;  1CUK A;  4GKK Q;  1CKN A;  4F87 A;  1SNP A;  3RZD H;  3FEW X;  3J7A F;  5C4J B;  1YBY A;  4JV5 Q;  4JI4 L;  4IO9 A;  3S2H H;  1BBU A;  3D6W A;  4IPD A;  2E5L L;  5C3E B;  1BVS A;  2BA0 A;  1AEX A;  1H9J A;  4MTN A;  4M1U B;  5IY0 A;  3Q0A A;  1EY7 A;  3DEO A;  4CDC C;  3FDT A;  1I6V C;  1PZJ D;  3H91 A;  2JP1 A;  3PF5 A;  1SRU A;  2Q2I A;  1VQB A;  5CGK A;  2R7Z G;  1X65 A;  2K5H A;  5C3E H;  4IUT A;  1VQ6 A;  3NTH A;  1QNK A;  2RCN A;  1B8A A;  2E8G A;  3HKZ B;  4DR3 Q;  5I2X A;  2WKD A;  1H9R A;  2K01 A;  3DMU A;  5FJ8 H;  1WTO A;  3PO3 G;  1RD9 D;  1HRJ A;  4KTA A;  3NSW A;  4M8A A;  2ALY B;  4K6L A;  1E2Z A;  1Y1V H;  2GVA A;  1SJE D;  1MJC A;  3NHH A;  4HTH A;  2GVB A;  3BZC A;  1SNQ A;  4B08 A;  1K8A C;  1OXS C;  1F9Q A;  3I70 A;  5KGU A;  3HFZ B;  4GKK L;  1JOK A;  1R4Q B;  4JV5 L;  1E1O A;  1C48 A;  2K33 A;  4DAY B;  2CH4 A;  2R93 H;  4YHH Q;  1C7Y A;  3AFP A;  3OPO A;  1XPU A;  2ZJR A;  1E2V A;  2LMC B;  3F2C A;  1QZH A;  2WAQ E;  4S3S A;  5C0X G;  3BU2 A;  1EU4 A;  2MO0 A;  5DM6 3;  5M3F G;  1A0I A;  3M4Y A;  1VQ7 A;  2ZTC A;  2B2W C;  1VCI A;  1ESF A;  3VR3 A;  4NXN Q;  2R7Z B;  1PVO A;  3WOF A;  4QUF A;  2EJG C;  1BNZ A;  2YTY A;  2J7Z A;  4RKB A;  1GHK A;  4DR3 L;  2KQ3 A;  1HUM A;  3K7U C;  3Q8D A;  1KDB A;  2F0I A;  5EPL A;  2K5D A;  4K8I A;  1UE7 A;  2M9V A;  3DHQ A;  3KDF B;  1CZG A;  4B9X A;  1BCP B;  2SNM A;  4JOI A;  1JR0 D;  2JK8 A;  3SDZ A;  1G6Z A;  4GN3 B;  2RBM A;  2R7Z H;  3HKZ E;  3E3X A;  2JN4 A;  3F2D A;  4PZ7 A;  2KEE A;  3ERS X;  3RUZ A;  1VQL A;  5FKA C;  4V0B A;  4R1J A;  1M4V A;  3S24 A;  2L5T A;  4IN3 A;  3T51 B;  4H13 C;  4YHH L;  1U4M A;  3IL8 A;  3PIO A;  2MQH A;  1ICF B;  1SYD A;  1J6Q A;  4HAE A;  3DM1 A;  1NE3 A;  2C5C A;  4J8Q A;  3X3M A;  3QWN A;  4KKS A;  3I55 A;  3TZU A;  3UE1 A;  5M3F B;  3K8A A;  3NXW A;  4GN4 B;  1XJV A;  5ELD A;  2Z0S A;  4KJO A;  4NXN L;  3HOU G;  4HED A;  1VQC A;  3ZJY C;  1FR3 A;  3MXU A;  2B63 H;  1VQN A;  4NW2 A;  1A3V A;  1X3F A;  1NUC A;  4APV A;  1F9P A;  3TSS A;  4DNT B;  2A73 B;  1LLR D;  1CT1 D;  1EY8 A;  1GVP A;  5T1I A;  1S5E D;  1AE2 A;  1NMG A;  2EYM A;  3LWU A;  3VR2 A;  4A3G H;  2C9O A;  1Y1W G;  3HOZ G;  4L63 B;  1B7Y B;  3I8Z A;  2OTL A;  1NTG A;  1XMQ L;  3UE0 A;  2F0W A;  3VYU A;  3C46 A;  5GQO A;  3GV3 A;  3GTJ B;  3MXP A;  4AIM A;  1KD1 C;  1JCK B;  1XTC D;  2RDF A;  2D62 A;  2F0N A;  3TQY A;  3G6E A;  3CHB D;  1TII D;  3HGB A;  1VQP A;  1E0B A;  1QJO A;  1FNW A;  3K80 C;  4IQZ A;  4QJF A;  2VQE Q;  4J6H A;  2F0V A;  4OIK A;  1AFP A;  2JE6 I;  4JI2 Q;  4HIK A;  1AE3 A;  2RF4 A;  1EL0 A;  1TT2 A;  3IRB A;  2LFN A;  2A68 D;  5EPK A;  2F4I A;  5LL6 X;  1F2M A;  1VQF A;  3H0G B;  4DK0 A;  4XQN A;  2KBN A;  2PZT A;  3X3N A;  1KQS A;  4A76 A;  2UUC Q;  1R9T B;  2ZJQ A;  5E4W C;  2F0D A;  3FPU B;  4FXD A;  2UXC Q;  5DAU A;  2CHB D;  3HOU B;  2ZXO A;  5G3L D;  3CPF A;  2QA4 A;  4LFC Q;  4C3J G;  2L15 A;  4O1N A;  3H0G H;  4NP5 A;  1H95 A;  2FMM A;  2XWJ B;  1Y8N B;  1R9T H;  1T9H A;  3CXC A;  1IZ6 A;  4X65 Q;  1B50 A;  1GO3 E;  2B2T C;  3QG1 A;  1D6E C;  1VS0 A;  3HOZ B;  4IJL A;  3UDI A;  2R61 A;  1L0X B;  3NWS A;  5HGQ A;  4A75 A;  4NDX A;  1DON A;  5DNF A;  1PTO H;  2UXD Q;  1C8C A;  2NVX B;  1SYF A;  2KED A;  4DV4 Q;  1ASY A;  3KUP A;  4LW1 A;  4ABN A;  2KHS A;  2VQE L;  4DR7 Q;  4IUR A;  4JI2 L;  4G57 A;  4GNX B;  2L11 A;  2D0P A;  3I4O A;  4Z9C B;  5BR8 Q;  3T56 B;  2WKC A;  2UUC L;  3J80 i;  1L1O B;  3M3Y B;  2UXC L;  1VQI A;  2AKW B;  2FMC A;  1OXX K;  4NXM Q;  2E2J H;  3NEM A;  4DR5 Q;  3OTO Q;  4LFC L;  1PZK D;  1SMY C;  2NB0 A;  1H9M A;  2Q8R E;  1QUQ B;  3C1F A;  3BJU A;  1ENC A;  4G4K A;  4C3J B;  1Y69 U;  3NUC A;  4RHS A;  3U9O A;  1PMR A;  1KNA A;  4HID A;  3DUZ A;  4X65 L;  3M3Y H;  5KIX A;  1ET9 A;  2JSO A;  4UAI A;  1YJW A;  4IPC A;  1EEF D;  1G6P A;  1BOS A;  4FF1 A;  2K6A A;  2OQK A;  4DUY Q;  2JXM B;  2UXD L;  2RA4 A;  4DV4 L;  3NQT A;  1IL2 A;  1VQ4 A;  3UDG A;  1YNN D;  5CV7 A;  4DR7 L;  4ZYS A;  3S1N H;  1STY A;  3SGI A;  3J7Z C;  2PYK A;  1S5C D;  3O13 A;  1XTD A;  4HSV A;  5C44 G;  1FVI A;  4RGT A;  3MXG A;  4I65 A;  5J3B A;  2Q8T A;  1KHI A;  5ELE A;  4OWW B;  2D5D A;  4XQJ A;  3MXN B;  4DPG A;  1YHA A;  4IOC A;  1N9W A;  3MAQ A;  4G7Z C;  1DOK A;  1E7Z A;  4PG3 A;  4DU9 A;  4NXM L;  2Q2U A;  1NR4 A;  3PMF A;  4DR5 L;  3OTO L;  4QIW E;  3HOW G;  5EQ0 A;  2PW7 A;  3TN2 A;  4PMB A;  4IUQ A;  2K52 A;  2R7D A;  3NBI A;  3H3V I;  4KMU C;  1UE5 A;  1B3Q A;  4XT3 B;  1QB5 D;  1EYA A;  3KLS X;  2X6G A;  4P71 A;  2WFW A;  3W1B A;  5F2D A;  2NYZ D;  2XWB B;  1RTO A;  1VQ5 A;  2FJ2 A;  2ICE C;  4DUY L;  4FF3 A;  2CKZ B;  1QWY A;  2BE5 C;  3P7J A;  4H02 A;  4MZ9 A;  1WTV A;  1YJ9 A;  2IJ0 A;  2O2L D;  3KOJ A;  2OQ0 A;  1JQY D;  2R92 H;  1EY4 A;  3Q23 A;  5FK9 C;  1CFM A;  3K7A B;  1D8L A;  1OTC A;  4BBS G;  1B3A A;  1WTW A;  1HUN A;  2H4O A;  1WTQ A;  5C44 B;  1JE5 A;  4BXX G;  1LO5 D;  4FO2 A;  1KIX A;  2I5M X;  1MSH A;  3DEP A;  2A6E D;  2FHT A;  1U5K A;  3V2T A;  5IP7 H;  2F0E A;  4ME3 A;  4TQU S;  5CV9 A;  4DAV A;  1F2Y A;  3K0X A;  4OX9 Q;  3PO2 G;  2HDL A;  1BCP D;  1TY2 A;  1HZA A;  3GTQ H;  1YHB A;  2CWA A;  4DAY A;  5IGF A;  2JEA I;  3TS0 A;  3CQZ H;  1K0S A;  5M5W H;  1Q86 C;  2K4K A;  1ILP A;  4FXK C;  1SAP A;  2BA1 A;  1GUN A;  3S1Q H;  1O80 A;  1CQF A;  1WCM G;  1RJT A;  3TEH B;  3U50 C;  3MWY W;  3D4W A;  5BN4 A;  5CV5 A;  3R3O A;  3FP9 A;  4GOP B;  1VMC A;  4JBM A;  4UPA A;  4IAL A;  5T1G A;  2M00 A;  5CBE E;  3ULJ A;  4B3R Q;  4R8N A;  5A2Q L;  2VUM G;  3A8K E;  2ZTD A;  1PFB A;  2JEB I;  5C5M A;  4BBS B;  3RR5 A;  3VDY A;  3R2I A;  2YTX A;  4MN3 A;  1SYC A;  5KYL A;  4KV6 A;  4C3H G;  1UNS A;  4R4O A;  5M3M B;  1ESR A;  2XVS A;  4RGN A;  1VQ8 A;  2NVQ B;  5EKL A;  1HTL D;  1PTO F;  1OXT A;  1VDZ A;  2EY1 A;  4P73 A;  1PV4 A;  2K05 A;  3R8B A;  3M4O B;  1G29 1;  5IWA Q;  1PH5 A;  1DGS A;  1MI2 A;  2IX1 A;  1GUS A;  5FO9 B;  2K5V A;  2BCO A;  4OX9 L;  4BBS H;  2Z6K A;  1YI2 A;  4YWM A;  2OXP A;  1VQD A;  1V1O A;  3PO2 B;  2QGQ A;  2K5Q A;  3QR8 A;  1X9N A;  4RMF A;  1HNX Q;  5M3M H;  1N8R C;  1PRT D;  4DR4 Q;  5IOC A;  1WTP A;  1GJX A;  1Q12 A;  3IKJ A;  4CJ2 C;  3QB3 A;  3M4O H;  1EOT A;  4ME5 A;  4RFB A;  1KRT A;  4A3M G;  2LKV A;  3H15 A;  4OEL B;  3MA2 B;  4A3E G;  2B8F A;  1S4Z A;  5FO7 B;  3G7L A;  4V19 0;  5JAV A;  1NNX A;  3K5M A;  5GAD C;  4DV2 Q;  4B3R L;  2EY2 A;  3K5N A;  1VQO A;  1DZ1 A;  3I3C A;  1WD1 A;  4JI6 Q;  4IFD J;  3L2P A;  3CAM A;  2VUM B;  4HR7 B;  4YCW A;  3GTP B;  2CH4 W;  1W3S A;  3HOX H;  4JOI C;  4JI0 Q;  2AHO B;  5IYC H;  3AEV A;  3G6J B;  3RLN A;  4C3H B;  3Q6S A;  5CV6 A;  1MKH A;  1EZ6 A;  1NY4 A;  5JEA G;  4R4T A;  5IWA L;  2NVT B;  2PNH A;  1IYV A;  1NSN S;  4JBJ A;  3WDN A;  3AMU A;  4JBW A;  2VUM H;  2WV6 D;  3GTP H;  2H1E A;  2AQ2 B;  2DNC A;  3CCM A;  4WRD A;  1JJ2 A;  1HTP A;  5ISR A;  1HNX L;  2L9H A;  4ILW A;  1K28 A;  1ML0 D;  1YNX A;  4PMW A;  2I5L X;  4C3H H;  4DR4 L;  4POG A;  1ILQ A;  1LTA D;  4X6A H;  3J81 j;  4U67 3;  5JJL A;  1X3G A;  2F1M A;  4LUZ A;  1UEB A;  2WAQ G;  2NVT H;  4LUO A;  5IT9 E;  5EBC A;  1TWA B;  1KXL A;  5ELN A;  3H94 A;  3VYS A;  2OEO A;  3I4M B;  1XWE A;  2HT1 A;  4A3M B;  1CKM A;  4A3E B;  1HNZ Q;  3M9B A;  1EUJ A;  4DV2 L;  1ZKO A;  2B3G A;  3A5Z B;  4JI6 L;  2JA5 G;  3NK9 A;  5DM7 3;  3SR1 A;  1TWA H;  1YNJ D;  1B1Z A;  4J1M A;  4JI0 L;  4KKU A;  1FD7 D;  3I4M H;  5TSS A;  2NUC A;  3V96 A;  3GQB A;  2RSN A;  1G8Z D;  3ER0 A;  4X3T A;  4A3M H;  1IXR A;  2RDG A;  3FKI B;  3ERO A;  2QCP X;  5JPM C;  5M5Y B;  4BA2 I;  4L5Q A;  5C5L A;  3TRZ A;  4EX5 A;  1U4R A;  3RLF A;  3N52 A;  3U4V A;  2L12 A;  2PQA B;  3RNU A;  4O42 A;  1A63 A;  2ZTE A;  1K8M A;  1Q90 A;  1PLF A;  3FKI H;  1RCV D;  3M7G A;  1KLU D;  1GXD C;  1WVL A;  3TME A;  3NTK A;  4UP8 A;  3S1R H;  1UAP A;  5M5Y H;  2WAQ B;  1E2W A;  2Y0S E;  2TMP A;  2CW0 D;  2ENB A;  2ZXR A;  3K5O A;  2MGS A;  2F03 A;  1HNZ L;  1PYW D;  4BBR G;  3L3O C;  3KJP A;  1O7Z A;  2D0O A;  1MD2 D;  2EJF C;  3K81 C;  3HOY G;  2HCI A;  2AQ1 B;  4MTK A;  4DV5 Q;  1V43 A;  4H7B A;  5K36 G;  1IW7 C;  2B39 A;  1Z7T A;  2JA5 B;  1QUQ A;  4ZKC B;  5C4J H;  2F3V A;  3P1H A;  1P8L A;  2HQL A;  2V1C C;  2B29 A;  2JA6 B;  5LMN Q;  3A8J E;  4CGY B;  1HFN A;  2DJF C;  4FP5 D;  3SK6 A;  4OEM B;  1IBK Q;  4JG2 A;  1GM5 A;  1RTN A;  2A68 C;  1KAB A;  5K5P A;  1JWU D;  4UP7 A;  1SSO A;  4RWS C;  1S40 A;  2MP1 A;  2P5Z X;  3QOJ A;  1D5Z C;  3CC7 A;  3EQL C;  2JA6 H;  4NPS A;  2RHQ B;  1XX8 A;  2NZH A;  3P75 A;  3T1Y Q;  2EYP A;  3I4N G;  1G51 A;  4XYO A;  3NWT A;  4IZ8 A;  4OO1 H;  1CSP A;  5IYB H;  3GTG B;  1EWC A;  2K50 A;  3KF6 B;  5HY6 A;  3MXN A;  4LF9 Q;  2IHE A;  5BN5 A;  2HIV A;  3CW2 C;  4BBR B;  4DA2 A;  3CCU A;  4A3J G;  4A93 G;  1H9K A;  4MHE A;  5KYI A;  1ZYR C;  1FNU A;  3W5O A;  4EQN A;  4DV5 L;  3HOY B;  4RGO S;  4IUP A;  1LTT D;  1U4P A;  5IOD A;  3CU7 A;  2B2Y A;  1SRO A;  2F0Q A;  3PGZ A;  3CME A;  2ATW A;  3D3R A;  3GTG H;  5EKK A;  4DFA A;  1PFN A;  2KJX A;  4C56 C;  2EZV A;  3I2Z A;  5LMN L;  4Y7N B;  2YYZ A;  1TWH B;  2F0J A;  3A54 A;  4ZLT F;  4BBR H;  2A69 C;  2F0L A;  3H3V H;  1IBK L;  1I6H B;  3I72 A;  2A5H A;  4FYD A;  4QF4 A;  3PO3 B;  2ZJP A;  3K0Y A;  5IGB A;  1Q8I A;  5D65 A;  1B44 D;  1GUG A;  3KBX A;  1SR3 A;  2CVR A;  1ASZ A;  2HDM A;  3A55 A;  3LNN A;  2N88 A;  4DN4 M;  3SK5 A;  1TKW B;  1I50 B;  3T1Y L;  5I2Y A;  3I4N B;  1XPR A;  1STA A;  1W6J A;  3PO3 H;  2IT1 A;  4BA1 I;  4CKC A;  4LF9 L;  1A2U A;  1LV9 A;  2A6H C;  1MJE A;  4F8M A;  3STB D;  1QVF A;  4XIG S;  4A3J B;  3CD6 A;  3TP5 A;  3J7Y W;  4X66 Q;  4KKT A;  1MSG A;  3I4N H;  3GTK B;  1CHQ D;  3TP6 A;  3S9W A;  5G3L F;  5ELC A;  2ZXP A;  3QIA A;  5H1S E;  4X64 Q;  4X3S A;  4RCO A;  4HIM A;  3I56 A;  2D2C C;  2NTT A;  5ELF A;  3A7A B;  2NZ1 D;  5C0X H;  2LY7 A;  3PUW A;  2BDO A;  1MBY A;  1AN8 A;  5M3F H;  5IT9 c;  5EKI A;  4XXE A;  2I0Q A;  4YIJ A;  1STH A;  1ENA A;  2MJ8 A;  1QVG A;  1EY9 A;  1PRT B;  2IL8 A;  4K5X A;  4WFN 3;  2NVY B;  1JB3 A;  3MC0 B;  4DK3 C;  3T13 A;  2JA8 G;  3MZ5 A;  4U68 A;  2EVB A;  3BDO A;  3EA6 A;  1FL0 A;  1IBM Q;  2PQE A;  1QG7 A;  3LGJ A;  2XIW A;  1J8I A;  1TU2 B;  1TWF B;  4YCU A;  4RG1 A;  3KF8 A;  1SXT A;  4JI8 Q;  2L4N A;  2IWH A;  2JQO A;  3HOV G;  1Z9F A;  3BZD B;  4IFD I;  3MFG A;  2HD3 A;  4QUC A;  1YIT A;  2KEN A;  3I73 A;  3D4R A;  5DEH A;  1TWC B;  3AB9 A;  4IUN A;  1PHJ A;  3UI2 A;  2Q8I B;  4CBV A;  2PI2 A;  1LTL A;  4X66 L;  1EU3 A;  3GTJ H;  2VXW A;  1VMP A;  1YHQ A;  5HUR A;  3E0J A;  2ID0 A;  3I90 A;  1QCB D;  2KVM A;  1TWF H;  3GO5 A;  1I4G A;  1WI5 A;  4AYB E;  2NN6 G;  1KAA A;  4X64 L;  1RKN A;  3S1M B;  3EIV A;  3FHW A;  3ERQ A;  4DV3 Q;  2UUA Q;  2V4D A;  5FOB B;  4TSS A;  1JOO A;  2MFI A;  2VL6 A;  4QGU A;  5EPJ A;  4JI3 Q;  1U9R A;  1PXU A;  1X32 A;  1M8A A;  4CDE C;  2F0K A;  1LTS D;  2YTV A;  3ITP A;  1PA6 A;  1V1P A;  1SEB D;  1XNQ Q;  4H0L C;  2ICI A;  4A3I G;  3FMC A;  3HOU H;  1Y1W B;  4I7Z C;  4LMQ D;  4CKE A;  5C4X G;  1OXV A;  1IBM L;  3QO2 A;  2JA8 B;  2F3I A;  2E2H B;  3BVM A;  3GTL B;  4A3L G;  1EYG A;  3RN2 A;  4PZ8 A;  4E6I A;  3M85 A;  4JI8 L;  4XQQ A;  4R4I A;  1FYC A;  1LTG D;  1RF2 D;  4LF4 Q;  1D2B A;  3HOV B;  3CCE A;  3BYY B;  1CA6 A;  1WOC A;  5C6A A;  1Y1W H;  3HOZ H;  1JJC B;  3D31 A;  2Z6K C;  3OHX C;  2K7V A;  2L55 A;  2JA8 H;  5M9O A;  2E2H H;  4QIW B;  1LTI D;  3OMC A;  5FLM G;  2LXJ A;  2NVX H;  2QF7 A;  3PUY A;  2EE1 A;  4P72 A;  1CM9 A;  3CF5 A;  5JJI A;  3S14 B;  5IP9 G;  4KJN A;  1JB7 A;  3W1G A;  1Z47 A;  3ND9 A;  1PFM A;  4DV3 L;  2UUA L;  5I9O A;  2LSS A;  4ZUI A;  1RIP A;  4B3M Q;  3MTS A;  2VZA A;  4JI3 L;  4DV0 Q;  1CKN B;  2E74 C;  2BDN A;  1VQM A;  2NTS A;  1EEI D;  1A62 A;  3S14 H;  1XNQ L;  3CCQ A;  1EWH A;  5EGT A;  5I4D A;  1Q82 C;  2L1B A;  2DJG C;  4N9T A;  1HR0 Q;  5C4X B;  1KNE A;  1MHW C;  1Y8O B;  4C3J H;  3AU7 A;  3D6C A;  3CCL A;  4DAM A;  4RAU C;  1JOQ A;  1TY0 A;  1VQ9 A;  4LF4 L;  3HG9 A;  3S15 B;  3E9I A;  1VQK A;  1C4Q A;  4K0K Q;  2A1A A;  5BR8 L;  2JA7 G;  1EIY B;  3J7A 5;  2PQA A;  5E7N A;  4Q5V A;  4CDD C;  5IGG A;  2K75 A;  3M4P A;  2RVL A;  1EZ8 A;  4B9W A;  3S2D B;  2IY5 B;  1LT3 D;  3EBE A;  1BCP F;  2G9D A;  5ELO A;  5GAH C;  3S15 H;  4A3C G;  3TDQ A;  2O5J C;  5HGT A;  3I91 A;  4F7X A;  4CDF C;  4B3M L;  1ROD A;  4DV0 L;  5JOB A;  1QOH A;  4KHP Q;  1IKL A;  3T53 B;  3K57 A;  3S2D H;  1OXU A;  2JA9 A;  4JI5 Q;  3PCO B;  1L2F A;  3PQI A;  3HZX A;  1AH9 A;  1PTO C;  3DWQ A;  3NPP A;  3DLL A;  1HR0 L;  4R4Q A;  3RMH A;  3B6Y A;  2F0P A;  1STE A;  1Q3L A;  1I4H A;  3S16 B;  5J39 A;  3KLR A;  1JWS D;  1TQO A;  2RDH A;  2EXZ A;  3MVV A;  4DUZ Q;  2SNS A;  4K0K L;  2DN8 A;  1N34 Q;  1BQQ T;  1X3Q A;  1TVX A;  2EIF A;  2EYF A;  3A0J A;  2QEX A;  3D0F A;  4K2L A;  4KY6 A;  3V05 A;  2B2U A;  3LX0 A;  2OWO A;  3CKI B;  3K7A H;  1LAB A;  3U9S A;  2UUB Q;  4K8J A;  1EY5 A;  1LT4 D;  4L5S A;  3HOW B;  1PRT F;  3A5U A;  5C44 H;  2XNA C;  4ZKB B;  1CKO A;  4KHP L;  5JVH 3;  3K58 A;  4LF7 Q;  1F77 A;  4R9W A;  4JI5 L;  1EFI D;  3KLS A;  4OWT B;  1II3 A;  1STG A;  3J80 E;  3DWA A;  1HHV A;  4KI0 A;  1M1K C;  4A3C H;  4KN7 C;  3HOW H;  3QOL A;  2VB3 X;  4ZCK A;  2AWO A;  1BDO A;  3VYR A;  1D5X C;  4GKJ Q;  3A7L A;  1TXY A;  4PQX A;  1SMX A;  5IGC A;  5D3D A;  1JIC A;  1FGB D;  4ODG A;  4DUZ L;  5COR A;  3BG3 A;  3KDF A;  1RL2 A;  4N8F A;  1PFS A;  2Z6B A;  3BYT B;  1H9S B;  4O0A A;  2ES2 A;  2EYH A;  2F52 A;  4YWL A;  1N34 L;  1X3P A;  3BZK A;  3M4Q A;  2E75 C;  1CI3 M;  3PIP 3;  1MIU A;  2R3Z A;  4A3K G;  3AYH B;  1ENF A;  1JWM D;  2UUB L;  3F2U A;  4IFD G;  2Y0S G;  1Q1E A;  1SMY D;  1IL8 A;  2K14 A;  3NTI A;  4WJ4 A;  2I5H A;  4BXX H;  3HS0 C;  4J15 A;  1VQE A;  4N8X 1;  1NMF A;  4LF5 Q;  4LF7 L;  2NVQ H;  4C3I G;  1YVC A;  4K14 A;  3D8G A;  1F9S A;  1K3B C;  5BN3 A;  4DXF A;  4XDX A;  3EJI A;  2B2Y C;  2QKI C;  1XXG A;  4BY1 G;  1WCM B;  4IJH A;  3PO2 H;  1MGS A;  1ZEQ X;  4H44 C;  4GS3 A;  1R4P B;  3G48 A;  2EOT A;  4GKJ L;  2B2V A;  1B2T A;  2JYO A;  3T1H Q;  2SDF A;  4HMI A;  4YY3 Q;  5JPN C;  1SND A;  3KFU A;  4NMZ A;  1WCM H;  4KY5 A;  2RKS A;  1HA5 A;  4Y52 H;  2O4X A;  3S17 B;  5E1F A;  4RA8 A;  2WB1 G;  4LK1 C;  5D14 A;  1SFO B;  3H6M A;  4GLX A;  1VF5 C;  4A3K B;  1O78 A;  4WOR A;  1CK1 A;  2NZO A;  4A3B G;  1HH2 P;  2Y0S B;  4LJZ C;  5AJ3 Q;  2CQA A;  3E6Z X;  5IYD G;  4LF5 L;  5KND A;  1NAP A;  1BF4 A;  4C3I B;  4DV1 Q;  4PZ6 A;  1SFO H;  4L6T B;  4RGM A;  1X56 A;  2NN6 I;  4PNY A;  5C4Z A;  4IFD H;  1WFQ A;  2F0F A;  4BY1 B;  2BE5 D;  1Q81 C;  2F0T A;  5D3I B;  4B3S Q;  5CR3 A;  1DYQ A;  4OIJ A;  2AQ3 B;  4CKB A;  5E3F A;  3T1H L;  4DK6 C;  2KEC A;  2LS0 1;  4YY3 L;  1O7Y A;  4C3I H;  2DGY A;  5JJZ A;  1EQQ A;  1E3P A;  2I46 A;  4GOP C;  5CMD A;  4G7O C;  2K03 A;  2SEB D;  5KNC A;  5C3E G;  4DAP A;  4A3E H;  1VQG A;  3TP7 A;  2EYO A;  4LFB Q;  1GOZ A;  2WB1 B;  1M90 C;  1SBB B;  4EGV A;  5FJ8 G;  2EQS A;  5GAE C;  4L5R C;  2NWG A;  1J5E Q;  4PV1 C;  2GN5 A;  2DY7 A;  3OOC A;  1VQH A;  5AJ3 L;  4A3D G;  4A3B B;  1Y1V G;  2X69 A;  1DOL A;  2Q2H A;  1ZXT A;  1AZP A;  4JCV E;  2PMZ E;  1CTM A;  2E76 C;  3CCR A;  4GNX A;  4DV1 L;  3CMA A;  5JEA H;  1Q7Y C;  2E2D C;  5LMU Q;  4GLV B;  4XT1 B;  3S2H B;  5IIF A;  2R93 G;  1BUV T;  1S3O A;  1SNC A;  4A3B H;  2F0G A;  1L1O A;  4B3S L;  3JAM E;  3GDE A;  1D1I A;  3E0E A;  4KD3 A;  4OGQ C;  1N33 Q;  4FVM A;  4LF8 Q;  4RCN A;  3R93 A;  1X55 A;  3PUX A;  3TZD A;  1NJI C;  3FRP B;  5DLQ E;  2CFM A;  4KK7 A;  4LFB L;  1EIH A;  2L0C A;  2XRQ D;  1SE8 A;  4K5W A;  4ZK9 B;  2IX0 A;  4P2C B;  4UDU C;  2XRS D;  2JJQ A;  1O7I A;  1QIL A;  2JA5 H;  1B9N A;  1J5E L;  4K2K A;  2PW5 A;  3WWV A;  3J80 c;  3QJY A;  4DR1 Q;  4HJ9 A;  4JPB W;  1TS3 A;  1EQV A;  1E22 A;  4A3D B;  1I4X A;  1VQJ A;  2N55 A;  1Y1V B;  2WB1 E;  5LMN W;  5JVG 3;  1F2L A;  1SNM A;  1LTR D;  3KBG A;  3GTO B;  1J9O A;  2ZT9 C;  3TP8 A;  5LMU L;  2WP8 J;  3OSO A;  2MO1 A;  3N6R A;  1KTK A;  1D7Q A;  1X3E A;  5IT9 L;  3ZYY X;  2R93 B;  3SHL A;  4AYB G;  4WJ3 M;  1GD7 A;  4HCS A;  4JVZ A;  4A3D H;  4TKO B;  5FO8 B;  2KHJ A;  3W3A A;  2F0U A;  2CQO A;  2DY8 A;  1WTX A;  1AZQ A;  1N33 L;  3J81 E;  3GTO H;  4JI1 Q;  4DNR B;  2GA4 B;  4LF8 L;  3HEJ A;  1V9P A;  3PUZ A;  1HZB A;  2RQX A;  4BWG B;  2EPB A;  1D1K A;  3VA5 A;  2B63 G;  1W6K A;  2M2L A;  1L0Y B;  1V1Q A;  4QY7 A;  3HOY H;  3NEL A;  4JC0 A;  3VR4 A;  3K59 A;  2UXB Q;  5K36 H;  1K83 B;  4DR1 L;  2XN9 C;  1STB A;  4A3G G;  3J7A V;  1YIJ A;  4AQY Q;  4Y7N H;  1TWH H;  1UEA B;  2VS1 A;  3SEB A;  5IE8 A;  1CA5 A;  4IPH A;  1I6H H;  4DR6 Q;  3K5L A;  1TS5 A;  1PZI D;  1K83 H;  1EY0 A;  2K32 A;  2Q2T A;  3KYH C;  4AYB B;  5C0X J;  1LUZ A;  1WTR A;  2FIN B;  3HKS A;  4HCE A;  1VQA A;  4A93 B;  4N9P A;  1OO9 B;  1I50 H;  4RHR A;  1XMQ Q;  1Q8K A;  3JAM L;  4JI1 L;  1PH3 A;  1O7L A;  3PF4 A;  4DF7 A;  2DUD A;  2K5N A;  2AMC B;  1YNN C;  1BBX C;  3SVM A;  2K1B A;  2VW9 A;  4IUU A;  4QL5 A;  2G5D A;  5KNB A;  5C4H A;  3FPP A;  2B63 B;  3UDX A;  1E1T A;  4A3J H;  4A93 H;  2XSC A;  3H0G G;  4ID6 A;  5L37 A;  3CCS A;  2UXB L;  4GOP A;  4FDB A;  3GTK H;  3TBI B;  3CPW A;  2Z4I A;  4OL7 A;  2X6L A;  4OXP A;  2F0M A;  1EFW A;  4A3G B;  4AQY L;  2XGT A;  4IOA A;  1TWG B;  3DWP A;  3C2P A;  1I5F A;  4OHJ A;  3L0O A;  3NBH B;  1PDQ A;  1G2T A;  1H9S A;  5GAG C;  4DR6 L;  2K04 A;  1HFG A;  3G71 A;  3ONA B;  1I4R A;  2QDL A;  5A35 A;  3GD7 A;  4PMC A;  1G2S A;  4GLA C;  1KDC A;  5CYU A;  5LL6 S;  5KRU A;  2B2U C;  2YU9 B;  1QE6 A;  3P20 A;  2NVY H;  1BXT A;  1TWG H;  3PIP A;  1Z6H A;  1PH6 A;  1JT8 A;  2TSS A;  3E9H A;  2VQF Q;  4LFA Q;  1LT6 D;  3W2D A;  5IGD A;  1IW7 D;  5EJW A;  2VY3 A;  4K5V A;  2MHV A;  2OTJ A;  1BO0 A;  1EY6 A;  3J81 L;  3H3V C;  4GZY C;  1SYB A;  1BKB A;  4QMG A;  1C9O A;  2QEJ C;  1K8G A;  2YU9 H;  4DNI A;  1Y14 B;  3Q22 A;  1TWC H;  4HJ5 A;  3KJO A;  3AFQ A;  1T5E A;  4C1N K;  4GN5 A;  1Y8P B;  4L8J A;  4OWX B;  2A6E C;  4I7A A;  4DR2 Q;  3TS2 A;  1F9R A;  3DM3 A;  3DXJ C;  1B4O A;  3C3L A;  1LM0 A;  2SOB A;  2RCF A;  1I4P A;  3S1M H;  2H5X A;  5LHY 1;  3CRL C;  5CV4 A;  3KK7 A;  3JAM c;  4LF6 Q;  3I7F A;  1BCP C;  3GV6 A;  3F1Z A;  3FVQ A;  4C1N I;  2EDG A;  1LAC A;  1PTO B;  4UY8 C;  1NBW A;  4DKA C;  2MNA A;  3EFX D;  4DGZ A;  4G7H C;  1GHJ A;  4QB4 A;  4HMJ A;  4JI7 Q;  1DOM A;  1A8V A;  2VQF L;  1PH2 A;  4LFA L;  3ULL A;  1U4L A;  1U0L A;  1ZYR D;  3GTL H;  5E4X A;  3CC2 A;  4XYQ A;  1L0W A;  4ZQ3 A;  3SK4 A;  2G9H D;  1XMO Q;  1TS4 A;  3M7N A;  4WJW A;  3HOV H;  1GUO A;  3CCJ A;  2E2J B;  1YEZ A;  4POF A;  2PZW A;  2A69 D;  2D9U A;  4HIO A;  4KHZ A;  4AH6 A;  1QZG A;  2FXQ A;  1UUP A;  2IHF A;  1DM0 B;  1KC8 C;  2LXK A;  1Q1B A;  2B2V C;  4DR2 L;  3OW2 A;  2EYL A;  3SK8 A;  4XTC S;  1GUW A;  2NN6 H;  1EIG A;  4DK1 A;  1WYD A;  4A3I B;  1RDP D;  4ULL A;  4LF6 L;  2N49 A;  3OMG A;  1UE1 A;  3NQI A;  1XYI A;  1KAW A;  4MNO A;  3J81 c;  1SDF A;  2AWN A;  2IPK D;  5FLX E;  3OWF A;  2VB2 X;  1PRT C;  1JC7 A;  1XPO A;  4R4C A;  3PSI A;  2R92 G;  2I07 B;  2B2W A;  2Z9H A;  1S72 A;  4JI7 L;  2A6H D;  3OWE B;  3S1N B;  3RZO B;  4A3I H;  1A3T A;  4EVO A;  1KDA A;  5C4X H;  3TRE A;  1KRS A;  4X3U A;  1HR0 W;  1QNU A;  5KEE A;  2N78 A;  3OIQ A;  5A2Q E;  1SE2 A;  2EY5 A;  3UDF A;  2KOL A;  4KHV A;  4UP9 A;  1PH9 A;  4A3L H;  4JBK A;  2DNE A;  2EY6 A;  4OO1 I;  5IP7 G;  1Q46 A;  1XMO L;  5IGE A;  2CCZ A;  1CSQ A;  1ICW A;  1EOV A;  3RZO H;  2PZU A;  2A74 C;  5I6Y A;  1W2B A;  1AP0 A;  3JC6 6;  2F3W A;  2F0H A;  4X62 Q;  2UU9 Q;  3F8T A;  5FLM H;  1EYC A;  2HHH Q; 
#chains in the Genus database with same CATH homology
 2KCC A;  1KLG D;  3MHB A;  1JE4 A;  2IW3 A;  2F0S A;  4IUV A;  4KY7 A;  3IAY A;  2OF1 A;  3VR6 A;  4FNF A;  2AUK A;  3VR5 A;  1A6X A;  2B8G A;  2PCF B;  1LT5 D;  1SYG A;  3OIP A;  4ZUJ A;  2Z4H A;  1SJH D;  2R92 B;  3PV0 A;  1CHP D;  4C2M B;  4FXG C;  2JA7 B;  3LWE A;  3C1E A;  1A15 A;  3VA7 A;  5M5X B;  1GUT A;  5NUC A;  1S5F D;  1YNJ C;  4JK1 C;  1NCV A;  3WOE A;  2Z1C A;  4Q0F A;  2HCC A;  3GTQ B;  3BDC A;  3K6O A;  3OW7 A;  3CRK C;  5C3X A;  1T5X D;  3GP7 A;  3D4D A;  3CQZ B;  3PIO 3;  4TRD A;  4EQP A;  2J4X A;  5M5W B;  3GTM B;  5C3W A;  4HN7 A;  3HP3 A;  3BS1 A;  2E2I B;  2EYJ A;  4FF2 A;  2BOS A;  3S1Q B;  2WIN B;  3PUV A;  1SE3 A;  1B53 A;  4MIU A;  5C0X I;  3NE5 B;  1SYE A;  2IX3 A;  1IHZ A;  5FLX L;  4QCL A;  2CW0 C;  2MUY A;  2QIL A;  3A56 A;  4A3F B;  3SXH A;  3E5S A;  1CZW A;  1EQT A;  3T16 A;  1HQM C;  1EYD A;  3BVZ A;  2B2T A;  1CQV A;  1G91 A;  3IFD A;  4RKL A;  2Z8L A;  4KN4 C;  3RD4 A;  2MPM A;  4CJ1 B;  4FF4 A;  2VNU D;  1I3Q B;  4BY7 B;  1TR5 A;  2F0O A;  2EJM A;  4LAA A;  3EVQ A;  1A3U A;  1HXY D;  1ONL A;  4CHT B;  4NKL A;  2NBF A;  1IKM A;  4ZAI A;  1VF7 A;  2FFK B;  3HRZ C;  2K5W A;  3SE0 A;  1DXM A;  1STN A;  1V8Q A;  2PNR C;  1B9M A;  2OT2 A;  1DD2 A;  3HOX B;  2K28 A;  3VYT A;  1SE4 A;  5J1Z A;  5J22 A;  1DJR D;  3A8I E;  5I9P A;  1RHP A;  3NBH A;  1V1P B;  5CV8 A;  1AW7 A;  3URY A;  2PMZ B;  2QDB A;  3I4L A;  1HA6 A;  2J0T D;  4EQO A;  1HQR D;  1NR2 A;  1F2Z A;  4KD4 A;  1PTO D;  2O5I C;  3H09 A;  4DXG A;  5I6W A;  1JOR A;  4X3K A;  3BDL A;  3J80 L;  1D5M C;  1A2T A;  2RSO A;  3ND8 A;  3Q24 A;  2KA7 A;  4R8I A;  1IYU A;  1ET6 A;  1HCZ A;  3BVG A;  3NP8 A;  1DCZ A;  5AFW A;  5CBA E;  5JEA J;  3T4A C;  3IFT A;  3L7Z C;  5COY A;  1TS2 A;  1BR9 A;  4ZRZ A;  4K6D A;  3R2T A;  1WD0 A;  1FNV A;  2PPB C;  1S5D D;  5EBD A;  4F88 A;  2AUJ D;  2WAC A;  2R6G A;  4RH6 A;  4HSP A;  1LTB D;  2KUM A;  5ELB A;  4OO1 G;  3S1R B;  2WII B;  3RZD B;  1SNO A;  3MFY A;  2HUG A;  1K8O A;  2PO4 A;  3MEH A;  1HPC A;  4BS9 A;  4CJ0 B;  1S5B D;  2HQE A;  2KCN A;  3L9A X;  5CC4 A;  1I4Q A;  4F87 A;  1SNP A;  3FEW X;  3J7A F;  5C4J B;  3D6W A;  5C3E B;  2BA0 A;  1AEX A;  1H9J A;  4M1U B;  3Q0A A;  1EY7 A;  3DEO A;  3FDT A;  1I6V C;  1PZJ D;  3H91 A;  2JP1 A;  5CGK A;  4IUT A;  3NTH A;  1QNK A;  3HKZ B;  5I2X A;  2WKD A;  1H9R A;  2K01 A;  3DMU A;  1WTO A;  1RD9 D;  1HRJ A;  4KTA A;  3NSW A;  4M8A A;  4K6L A;  1E2Z A;  3NHH A;  4HTH A;  1SJE D;  1SNQ A;  4B08 A;  1OXS C;  1F9Q A;  3I70 A;  5KGU A;  1JOK A;  1R4Q B;  1C48 A;  2K33 A;  3OPO A;  1E2V A;  2LMC B;  4S3S A;  5C0X G;  1EU4 A;  5DM6 3;  3M4Y A;  2B2W C;  1VCI A;  1ESF A;  3VR3 A;  2R7Z B;  3WOF A;  4QUF A;  2EJG C;  1BNZ A;  2J7Z A;  4RKB A;  1GHK A;  2KQ3 A;  1HUM A;  1KDB A;  2F0I A;  5EPL A;  2K5D A;  4K8I A;  2M9V A;  3DHQ A;  1CZG A;  4B9X A;  1BCP B;  2SNM A;  1JR0 D;  3SDZ A;  1G6Z A;  2RBM A;  2KEE A;  3RUZ A;  5FKA C;  4V0B A;  1M4V A;  2L5T A;  4IN3 A;  3T51 B;  4H13 C;  1U4M A;  3IL8 A;  1SYD A;  4HAE A;  3DM1 A;  2C5C A;  4J8Q A;  3X3M A;  3QWN A;  4KKS A;  3TZU A;  5M3F B;  3NXW A;  5ELD A;  4KJO A;  4HED A;  1FR3 A;  3MXU A;  4NW2 A;  1A3V A;  1NUC A;  1F9P A;  3TSS A;  4DNT B;  2A73 B;  1LLR D;  1CT1 D;  1EY8 A;  5T1I A;  1S5E D;  2EYM A;  3VR2 A;  3LWU A;  2C9O A;  4L63 B;  3I8Z A;  2F0W A;  3VYU A;  3C46 A;  3GV3 A;  3GTJ B;  3MXP A;  1JCK B;  1XTC D;  2RDF A;  2D62 A;  2F0N A;  3CHB D;  1TII D;  3HGB A;  1E0B A;  1QJO A;  1FNW A;  4IQZ A;  4J6H A;  2F0V A;  4OIK A;  1AFP A;  2JE6 I;  1EL0 A;  1TT2 A;  2LFN A;  2A68 D;  5EPK A;  2F4I A;  5LL6 X;  1F2M A;  3H0G B;  4DK0 A;  4XQN A;  2PZT A;  3X3N A;  1R9T B;  5E4W C;  2F0D A;  3FPU B;  4FXD A;  5DAU A;  2CHB D;  3HOU B;  2ZXO A;  5G3L D;  4C3J G;  4O1N A;  4NP5 A;  2FMM A;  2XWJ B;  1Y8N B;  1B50 A;  2B2T C;  3QG1 A;  1D6E C;  3HOZ B;  2R61 A;  1L0X B;  3NWS A;  4NDX A;  1DON A;  5DNF A;  1PTO H;  1C8C A;  2NVX B;  1SYF A;  2KED A;  3KUP A;  4ABN A;  2KHS A;  4IUR A;  4G57 A;  2L11 A;  4Z9C B;  3T56 B;  2WKC A;  3M3Y B;  2FMC A;  1OXX K;  1PZK D;  1SMY C;  2NB0 A;  1H9M A;  2Q8R E;  3C1F A;  1ENC A;  4G4K A;  4C3J B;  1Y69 U;  3NUC A;  4RHS A;  3U9O A;  1PMR A;  1KNA A;  3DUZ A;  5KIX A;  1ET9 A;  2JSO A;  4UAI A;  1EEF D;  1BOS A;  4FF1 A;  2K6A A;  2JXM B;  2RA4 A;  3NQT A;  1YNN D;  5CV7 A;  4ZYS A;  1STY A;  2PYK A;  1S5C D;  3O13 A;  4HSV A;  4RGT A;  3MXG A;  4I65 A;  2Q8T A;  5ELE A;  2D5D A;  4XQJ A;  3MAQ A;  4G7Z C;  1DOK A;  4DU9 A;  1NR4 A;  3PMF A;  5EQ0 A;  2PW7 A;  3TN2 A;  4PMB A;  4IUQ A;  3NBI A;  4KMU C;  4XT3 B;  1QB5 D;  1EYA A;  3KLS X;  2X6G A;  5F2D A;  2NYZ D;  2XWB B;  1RTO A;  2FJ2 A;  2ICE C;  4FF3 A;  1QWY A;  2BE5 C;  3P7J A;  1WTV A;  2IJ0 A;  2O2L D;  1JQY D;  1EY4 A;  3Q23 A;  5FK9 C;  1CFM A;  3K7A B;  1B3A A;  1WTW A;  1HUN A;  2H4O A;  1WTQ A;  5C44 B;  1LO5 D;  4FO2 A;  1MSH A;  3DEP A;  2A6E D;  2FHT A;  3V2T A;  2F0E A;  4TQU S;  5CV9 A;  4DAV A;  1F2Y A;  2HDL A;  1BCP D;  1TY2 A;  4DAY A;  5IGF A;  2JEA I;  1ILP A;  4FXK C;  1SAP A;  2BA1 A;  1GUN A;  1O80 A;  1CQF A;  1RJT A;  3MWY W;  3D4W A;  5BN4 A;  5CV5 A;  3R3O A;  1VMC A;  4IAL A;  5T1G A;  2M00 A;  5CBE E;  4R8N A;  5A2Q L;  3A8K E;  1PFB A;  2JEB I;  5C5M A;  4BBS B;  3R2I A;  4MN3 A;  1SYC A;  5KYL A;  4KV6 A;  4C3H G;  1UNS A;  5M3M B;  1ESR A;  2XVS A;  4RGN A;  2NVQ B;  5EKL A;  1HTL D;  1PTO F;  1OXT A;  1VDZ A;  2EY1 A;  2K05 A;  3R8B A;  3M4O B;  1G29 1;  1MI2 A;  2IX1 A;  1GUS A;  5FO9 B;  2BCO A;  2OXP A;  3PO2 B;  1V1O A;  2K5Q A;  1PRT D;  5IOC A;  1WTP A;  1GJX A;  1Q12 A;  3IKJ A;  4CJ2 C;  3QB3 A;  1EOT A;  4ME5 A;  4RFB A;  2LKV A;  3MA2 B;  2B8F A;  1S4Z A;  5FO7 B;  3G7L A;  4V19 0;  5JAV A;  3K5M A;  2EY2 A;  3K5N A;  1DZ1 A;  3I3C A;  1WD1 A;  4IFD J;  2VUM B;  4HR7 B;  3GTP B;  3G6J B;  4C3H B;  3Q6S A;  5CV6 A;  1EZ6 A;  5JEA G;  2NVT B;  1IYV A;  1NSN S;  3WDN A;  3AMU A;  4JBW A;  2WV6 D;  2H1E A;  2AQ2 B;  2DNC A;  4WRD A;  1HTP A;  5ISR A;  2L9H A;  4ILW A;  1ML0 D;  4PMW A;  1ILQ A;  1LTA D;  4U67 3;  2F1M A;  5IT9 E;  5EBC A;  1TWA B;  3H94 A;  3VYS A;  2OEO A;  3I4M B;  1XWE A;  4A3M B;  4A3E B;  1ZKO A;  3NK9 A;  5DM7 3;  3SR1 A;  1YNJ D;  1B1Z A;  4J1M A;  4KKU A;  1FD7 D;  5TSS A;  2NUC A;  3V96 A;  3GQB A;  2RSN A;  1G8Z D;  4X3T A;  2RDG A;  3FKI B;  3ERO A;  2QCP X;  5JPM C;  5M5Y B;  4BA2 I;  5C5L A;  1U4R A;  3RLF A;  3N52 A;  2L12 A;  4O42 A;  1K8M A;  1Q90 A;  1PLF A;  1RCV D;  3M7G A;  1KLU D;  1GXD C;  1WVL A;  3TME A;  3NTK A;  1UAP A;  2WAQ B;  1E2W A;  2TMP A;  2CW0 D;  2ENB A;  2ZXR A;  3K5O A;  2MGS A;  2F03 A;  1PYW D;  3L3O C;  1O7Z A;  1MD2 D;  2EJF C;  2HCI A;  2AQ1 B;  1V43 A;  4H7B A;  5K36 G;  1IW7 C;  2B39 A;  1Z7T A;  2JA5 B;  4ZKC B;  2F3V A;  3P1H A;  2JA6 B;  3A8J E;  4CGY B;  1HFN A;  4FP5 D;  3SK6 A;  1RTN A;  5K5P A;  2A68 C;  1KAB A;  1JWU D;  1SSO A;  4RWS C;  2MP1 A;  3QOJ A;  1D5Z C;  3EQL C;  1XX8 A;  3P75 A;  2EYP A;  4XYO A;  3NWT A;  4IZ8 A;  4OO1 H;  3GTG B;  1EWC A;  3MXN A;  5BN5 A;  4BBR B;  4DA2 A;  1H9K A;  4MHE A;  5KYI A;  1ZYR C;  1FNU A;  3HOY B;  4EQN A;  4RGO S;  4IUP A;  1LTT D;  1U4P A;  5IOD A;  3CU7 A;  2B2Y A;  2F0Q A;  3D3R A;  5EKK A;  4DFA A;  1PFN A;  2KJX A;  4C56 C;  2EZV A;  4Y7N B;  2YYZ A;  1TWH B;  2F0J A;  3A54 A;  4ZLT F;  2A69 C;  2F0L A;  1I6H B;  3I72 A;  2A5H A;  4FYD A;  4QF4 A;  3PO3 B;  3K0Y A;  5IGB A;  1Q8I A;  5D65 A;  1B44 D;  1GUG A;  3KBX A;  2CVR A;  2HDM A;  3A55 A;  3LNN A;  2N88 A;  4DN4 M;  3SK5 A;  1TKW B;  1I50 B;  5I2Y A;  3I4N B;  1STA A;  1W6J A;  2IT1 A;  4BA1 I;  4CKC A;  1A2U A;  1LV9 A;  2A6H C;  4F8M A;  4XIG S;  4A3J B;  3TP5 A;  3J7Y W;  4KKT A;  1MSG A;  3GTK B;  1CHQ D;  3TP6 A;  3S9W A;  5G3L F;  5ELC A;  2ZXP A;  3QIA A;  4X3S A;  4RCO A;  2D2C C;  2NTT A;  5ELF A;  3A7A B;  2NZ1 D;  5C0X H;  2LY7 A;  3PUW A;  2BDO A;  1MBY A;  1AN8 A;  5EKI A;  4XXE A;  4YIJ A;  1STH A;  1ENA A;  2MJ8 A;  1EY9 A;  1PRT B;  2IL8 A;  4K5X A;  4WFN 3;  2NVY B;  1JB3 A;  3MC0 B;  3T13 A;  3MZ5 A;  4U68 A;  2EVB A;  3BDO A;  3EA6 A;  2PQE A;  1QG7 A;  2XIW A;  1J8I A;  1TU2 B;  1TWF B;  3KF8 A;  1SXT A;  2L4N A;  2IWH A;  3BZD B;  4IFD I;  3MFG A;  4QUC A;  3I73 A;  3D4R A;  5DEH A;  1TWC B;  3AB9 A;  4IUN A;  3UI2 A;  2Q8I B;  4CBV A;  1EU3 A;  2VXW A;  1VMP A;  5HUR A;  3E0J A;  2ID0 A;  3I90 A;  1QCB D;  2KVM A;  3GO5 A;  1I4G A;  2NN6 G;  1KAA A;  1RKN A;  3S1M B;  3ERQ A;  2V4D A;  5FOB B;  4TSS A;  1JOO A;  5EPJ A;  1U9R A;  1PXU A;  1X32 A;  1M8A A;  2F0K A;  1LTS D;  3ITP A;  1V1P A;  1SEB D;  4H0L C;  2ICI A;  3FMC A;  1Y1W B;  4I7Z C;  4LMQ D;  4CKE A;  1OXV A;  3QO2 A;  2JA8 B;  2E2H B;  3BVM A;  3GTL B;  4E6I A;  3M85 A;  4XQQ A;  1FYC A;  1LTG D;  1RF2 D;  1D2B A;  3HOV B;  3BYY B;  1CA6 A;  5C6A A;  3D31 A;  3OHX C;  2K7V A;  2L55 A;  5M9O A;  4QIW B;  1LTI D;  3OMC A;  2QF7 A;  3PUY A;  2EE1 A;  1CM9 A;  3S14 B;  4KJN A;  1Z47 A;  3ND9 A;  1PFM A;  5I9O A;  4ZUI A;  3MTS A;  2E74 C;  2BDN A;  2NTS A;  1EEI D;  1EWH A;  5EGT A;  5I4D A;  2L1B A;  4N9T A;  5C4X B;  1KNE A;  1Y8O B;  3AU7 A;  3D6C A;  4RAU C;  1JOQ A;  1TY0 A;  3HG9 A;  3S15 B;  1C4Q A;  4Q5V A;  5IGG A;  2RVL A;  1EZ8 A;  4B9W A;  3S2D B;  1LT3 D;  1BCP F;  2G9D A;  3TDQ A;  2O5J C;  5HGT A;  3I91 A;  4F7X A;  1ROD A;  5JOB A;  1QOH A;  1IKL A;  3T53 B;  3K57 A;  1OXU A;  3HZX A;  1PTO C;  3DWQ A;  3NPP A;  3RMH A;  2F0P A;  1STE A;  1Q3L A;  1I4H A;  3S16 B;  5J39 A;  3KLR A;  1JWS D;  1TQO A;  2RDH A;  2EXZ A;  3MVV A;  2SNS A;  2DN8 A;  1BQQ T;  1X3Q A;  1TVX A;  2EYF A;  4K2L A;  4KY6 A;  3V05 A;  2B2U A;  3LX0 A;  3CKI B;  1LAB A;  3U9S A;  4K8J A;  1EY5 A;  1LT4 D;  3HOW B;  1PRT F;  2XNA C;  4ZKB B;  5JVH 3;  3K58 A;  1F77 A;  4R9W A;  1EFI D;  3KLS A;  1II3 A;  1STG A;  3J80 E;  3DWA A;  1HHV A;  4KI0 A;  4KN7 C;  3QOL A;  2VB3 X;  2AWO A;  1BDO A;  3VYR A;  1D5X C;  3A7L A;  4PQX A;  5IGC A;  5D3D A;  1JIC A;  1FGB D;  4ODG A;  5COR A;  3BG3 A;  3BYT B;  1H9S B;  2EYH A;  1X3P A;  2E75 C;  1CI3 M;  3PIP 3;  2R3Z A;  1ENF A;  1JWM D;  3F2U A;  4IFD G;  1Q1E A;  1SMY D;  1IL8 A;  3NTI A;  3HS0 C;  4C3I G;  4K14 A;  3D8G A;  1F9S A;  5BN3 A;  4DXF A;  4XDX A;  3EJI A;  2B2Y C;  2QKI C;  1XXG A;  1WCM B;  1MGS A;  1ZEQ X;  4H44 C;  1R4P B;  2EOT A;  2B2V A;  1B2T A;  2JYO A;  2SDF A;  4HMI A;  5JPN C;  1SND A;  4NMZ A;  4KY5 A;  2RKS A;  1HA5 A;  2O4X A;  3S17 B;  5E1F A;  4RA8 A;  4LK1 C;  5D14 A;  1SFO B;  3H6M A;  1VF5 C;  4A3K B;  1O78 A;  4WOR A;  1CK1 A;  2Y0S B;  4LJZ C;  2CQA A;  3E6Z X;  5KND A;  1NAP A;  1BF4 A;  4C3I B;  4L6T B;  4RGM A;  2NN6 I;  4PNY A;  5C4Z A;  4IFD H;  2F0F A;  4BY1 B;  2BE5 D;  2F0T A;  5D3I B;  5CR3 A;  1DYQ A;  4OIJ A;  2AQ3 B;  4CKB A;  5E3F A;  2KEC A;  2LS0 1;  1O7Y A;  5JJZ A;  2I46 A;  5CMD A;  4G7O C;  2K03 A;  2SEB D;  5KNC A;  4DAP A;  3TP7 A;  2EYO A;  1GOZ A;  2WB1 B;  1SBB B;  4EGV A;  2NWG A;  4PV1 C;  3OOC A;  2DY7 A;  4A3B B;  2X69 A;  1DOL A;  1ZXT A;  1AZP A;  1CTM A;  2E76 C;  5JEA H;  2E2D C;  4XT1 B;  3S2H B;  5IIF A;  1SNC A;  1BUV T;  2F0G A;  3JAM E;  1D1I A;  4KD3 A;  4OGQ C;  4FVM A;  4RCN A;  3R93 A;  3PUX A;  3TZD A;  3FRP B;  4KK7 A;  1EIH A;  2L0C A;  2XRQ D;  4K5W A;  4ZK9 B;  2IX0 A;  4P2C B;  4UDU C;  2XRS D;  1QIL A;  1B9N A;  4K2K A;  2PW5 A;  3QJY A;  1TS3 A;  1EQV A;  4A3D B;  1I4X A;  2N55 A;  1Y1V B;  5JVG 3;  1F2L A;  1SNM A;  1LTR D;  3KBG A;  3GTO B;  1J9O A;  2ZT9 C;  3TP8 A;  2WP8 J;  3OSO A;  3N6R A;  1KTK A;  5IT9 L;  3ZYY X;  2R93 B;  3SHL A;  4HCS A;  4TKO B;  5FO8 B;  3W3A A;  2F0U A;  2DY8 A;  1WTX A;  1AZQ A;  3J81 E;  4DNR B;  2GA4 B;  3HEJ A;  3PUZ A;  2RQX A;  4BWG B;  2EPB A;  1D1K A;  3VA5 A;  1W6K A;  2M2L A;  1L0Y B;  3K59 A;  3VR4 A;  5K36 H;  1K83 B;  2XN9 C;  1STB A;  3J7A V;  1UEA B;  3SEB A;  1CA5 A;  3K5L A;  1TS5 A;  1PZI D;  1EY0 A;  2K32 A;  4AYB B;  5C0X J;  1WTR A;  2FIN B;  4HCE A;  4A93 B;  4N9P A;  1OO9 B;  4RHR A;  3JAM L;  1O7L A;  4DF7 A;  1YNN C;  1BBX C;  3SVM A;  2K1B A;  4IUU A;  5KNB A;  5C4H A;  3FPP A;  2B63 B;  2XSC A;  4ID6 A;  3TBI B;  2Z4I A;  4OL7 A;  2X6L A;  2F0M A;  4A3G B;  1TWG B;  3DWP A;  3C2P A;  4OHJ A;  1G2T A;  1PDQ A;  1H9S A;  2K04 A;  1HFG A;  3ONA B;  1I4R A;  5A35 A;  3GD7 A;  4PMC A;  1G2S A;  1KDC A;  5CYU A;  5LL6 S;  5KRU A;  2B2U C;  2YU9 B;  1QE6 A;  3P20 A;  1BXT A;  1Z6H A;  2TSS A;  1LT6 D;  3W2D A;  5IGD A;  1IW7 D;  5EJW A;  4K5V A;  2MHV A;  1BO0 A;  1EY6 A;  3J81 L;  3H3V C;  4GZY C;  1SYB A;  4QMG A;  2QEJ C;  3Q22 A;  1T5E A;  4C1N K;  1Y8P B;  4L8J A;  2A6E C;  1F9R A;  3DXJ C;  1B4O A;  3C3L A;  2SOB A;  1I4P A;  5LHY 1;  3CRL C;  5CV4 A;  3KK7 A;  1BCP C;  3GV6 A;  3FVQ A;  4C1N I;  2EDG A;  1LAC A;  1PTO B;  3EFX D;  4DGZ A;  4G7H C;  1GHJ A;  4QB4 A;  4HMJ A;  1DOM A;  1U4L A;  1ZYR D;  5E4X A;  4XYQ A;  4ZQ3 A;  3SK4 A;  2G9H D;  1TS4 A;  3M7N A;  4WJW A;  1GUO A;  2E2J B;  2PZW A;  2A69 D;  2D9U A;  4KHZ A;  1UUP A;  1DM0 B;  1Q1B A;  2B2V C;  2EYL A;  3SK8 A;  4XTC S;  1GUW A;  2NN6 H;  1EIG A;  4DK1 A;  4A3I B;  1RDP D;  4ULL A;  3OMG A;  3NQI A;  1XYI A;  1SDF A;  2AWN A;  2IPK D;  5FLX E;  3OWF A;  2VB2 X;  1PRT C;  1JC7 A;  2I07 B;  2B2W A;  2A6H D;  3OWE B;  3S1N B;  3RZO B;  1A3T A;  4EVO A;  1KDA A;  4X3U A;  1QNU A;  5KEE A;  3OIQ A;  5A2Q E;  1SE2 A;  2EY5 A;  2KOL A;  4KHV A;  2DNE A;  2EY6 A;  4OO1 I;  5IGE A;  1ICW A;  2PZU A;  2A74 C;  5I6Y A;  1AP0 A;  2F3W A;  2F0H A;  1EYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...