5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
4KY5A 5F2DA 5CV4A 5KRUA 2PW7A 3NP8A 1U9RA 1A2TA 2PW5A 3QOLA 4KJOA 4MIUA 4QF4A 5EKLA 3T16A 5IGEA 5CV6A 2F0EA 2F0KA 5KGUA 3ERQA 3MZ5A 2F0QA 2SOBA 2PYKA 4NDXA 4NP5A 3HZXA 5I6WA 3OMGA 2F0IA 5CV9A 1F2MA 2F0DA 3MXPA 4ID6A 4HTHA 4F7XA 2EYLA 1STBA 1NUCA 2F3WA 2F0WA 4NKLA 2F3VA 2EY6A 3RUZA 4N9TA 4HMIA 5EGTA 2NUCA 3NQTA 5CC4A 4I65A 1EYCA 2EXZA 2OEOA 3DHQA 3NXWA 4H7BA 3TMEA 3S9WA 1EY7A 1JOOA 2PZTA 5IGGA 3D6CA 1STGA 3TP6A 1EYDA 1A2UA 5J39A 4K6DA 4E6IA 4G57A 1EY6A 1KAAA 1KABA 3EJIA 4N9PA 3NUCA 4DGZA 5CGKA 1JORA 2EY1A 4PNYA 1EY0A 4HMJA 1A3VA 1IHZA 3D4WA 4K14A 2F0UA 4KD4A 4B9WA 5KIXA 4PMBA 2F0TA 3QOJA 3P75A 3SXHA 5C4HA 2OF1A 5C3WA 1EY8A 5E1FA 5C6AA 3NK9A 5IGFA 3H6MA 1ENAA 2F0JA 2WACA 5HGTA 2EYOA 2F0SA 5DAUA 5IOCA 3BDLA 1JOKA 4QB4A 2EYMA 1SNQA 2RDFA 4LAAA 1ENCA 5CV7A 4EQPA 4EQOA 2EYPA 4F8MA 5C5LA 3P1HA 5HURA 2F0HA 1JOQA 5I9OA 3MVVA 4K5VA 5KYLA 4EVOA 5I6YA 1NSNS 1TR5A 3C1EA 3R3OA 5EKKA 4EQNA 1STYA 2KQ3A 3TP8A 5IGBA 4ZQ3A 5ISRA 3QB3A 4QMGA 4ZUIA 1STAA 4KD3A 4WORA 5J22A 3SHLA 3OMCA 1STHA 2EY2A 2QDBA 3BDCA 2KHSA 4K8JA 2EYFA 3SK4A 1SNMA 3SK6A 2F0VA 3E5SA 4KY7A 4K5WA 2EYHA 2LKVA 5I9PA 4S3SA 3LX0A 5J1ZA 5JOBA 2ENBA 1RKNA 3EVQA 5C3XA 5IIFA 2EYJA 1SNDA 1SYFA 4ZUJA 1SYGA 2PZUA 2F0OA 4KY6A 5CR3A 5IODA 4KV6A 5E3FA 5IGCA 4DF7A 2RKSA 3U9OA 3NHHA 2F0GA 3HEJA 1SNPA 1EZ8A 2SNSA 4K5XA 5KEEA 2M00A 4IUNA 5IGDA 3OSOA 4J1MA 1A3UA 4DFAA 4DU9A 5KYIA 1F2ZA 4J6HA 2EY5A 1F2YA 4B9XA 3EROA 1EY9A 1SYDA 2OXPA 2PQEA 4ME5A 4OL7A 5NUCA 2F0MA 5M9OA 1KDBA 4YIJA 3D4DA 3SK5A 3T13A 1TT2A 1SNCA 1SNOA 2F0NA 2HQEA 1KDAA 1TQOA 1STNA 2F0PA 2SNMA 4K2KA 3SK8A 4NMZA 4K2LA 5C5MA 1EY4A 3TP5A 3V2TA 5C4ZA 1AEXA 4TRDA 3SR1A 3TP7A 3PMFA 3DMUA 3OWFA 5K5PA 5JAVA 3C1FA 4KHVA 2F0LA 1SYEA 1EY5A 2F0FA 1A3TA 4KJNA 4WRDA 5CV5A 5DEHA 4IALA 4R8NA 2O4XA 3ITPA 4IZ8A 4RKBA 4KTAA 5CV8A 4RKLA 3VA5A 1EYAA 2PZWA 3D8GA 1SYCA 1II3A 2RBMA 1SYBA 3MHBA 3MEHA 1EQVA 1KDCA 4K8IA 4ODGA 4PMCA 1EZ6A
chains in the Genus database with same CATH superfamily
3X3MA 1UEAB 5EPJA 1RF2D 1TWGB 4NDXA 1LTRD 1DOMA 4ID6A 2VUMG 5FJ8G 3S2HH 4KKUA 1HNXL 4LNQA 4A3DH 1EYCA 2X6LA 2OEOA 3L0OA 3TBIB 2K33A 3D6CA 5IWAL 2K75A 1JJGA 1A2UA 4K6DA 1TWHB 4DR5Q 2EY1A 4BBRH 3H15A 1XTDA 2F3IA 1GVPA 3KLSA 1PYWD 2IX1A 1PRTC 1I6HB 4PQXA 2J7ZA 2G9DA 5KNCA 5C3WA 4B3ML 4LFBQ 1SDFA 2E76C 1L1OC 5HGTA 1BKBA 3F8TA 5DM63 1ILQA 2XRSD 2A6HC 1NBWA 5FLXL 4DV0L 3DLLA 3S15H 2YTVA 3D3RA 3CHBD 3CMAA 1Y1WB 3OW7A 3LWEA 1CI3M 1F77A 3NTIA 3S1QB 1MHWC 3C1EA 1PHJA 1VQAA 3TP8A 1QB5D 4KLKA 1STAA 1GHKA 3H0GH 1NR4A 1JQYD 1ET6A 2KEDA 1FVIA 1QCBD 3KJOA 1PH3A 3U50C 2CWPA 4RA8A 2XTIA 5I2XA 5IODA 3HOUH 1O80A 4KV6A 5E3FA 2AWNA 3HOWH 2EPBA 2EVBA 4A3BB 2KJXA 1QVCA 3K6OA 3HGBA 4PG3A 4DFAA 4BY7H 1NJIC 2VS1A 3LWUA 3BDOA 1KDBA 4JOIA 4FNFA 5C4XB 4K2KA 4DR4L 1E2ZA 4KKTA 1Q7YC 4ZKBB 1EQQA 1J8IA 3RNUA 3M4YA 2A1AA 3EQLC 2F0LA 3CQZB 1IYJB 1SE8A 4KJNA 1SLJA 4WRDA 5CV5A 1ICWA 5C3EG 3T1HL 4BY1G 3CCLA 1NNXA 5ELNA 1KD1C 4QL5A 3TDQA 4GKJL 3UDXA 3CCUA 3IKJA 1E7ZA 3BU2A 4OX9Q 1RD9D 4QY7A 4JV5L 4JPBW 3BYTB 5F2DA 3NSWA 2AMCB 4DA2A 4XQNA 1NCVA 3OHXC 1HR0L 3KBXA 1VQIA 3JAMi 2F0EA 3D0FA 3DWQA 1EU4A 2PYKA 2A19A 1U0LA 1ILPA 4F7XA 3NQIA 4IUQA 5H1SE 2IPKD 4FP5D 2B3GA 4G7ZC 4UP8A 4JI5L 3MAQA 4NW2A 2R92H 4JI3L 2CH4A 4O1NA 1R4PB 4HMJA 1SMYC 3D4WA 3DM3A 2HHHL 3VYTA 3BYYB 2NWGA 3Q22A 2A5HA 3VA7A 3GV3A 4G7HC 2JA7G 4IFDJ 4DR2L 2IHFA 3KF6A 3CC2A 1X6OA 3I4MB 1JOKA 3FDTA 2HT1A 4GZYC 4OIJA 3T1YL 1PH8A 1YJNA 4H13C 4RH6A 4A3JH 4LJZC 2K32A 3MVVA 1B3QA 1EEFD 4X62Q 5C4JH 5IT9L 1DYQA 2EDGA 1HJPA 1OXVA 5IYCG 3W5OA 2KQ3A 1B53A 4DUZQ 2YTYA 5E4WC 1D2BA 1V1OA 2RHSB 2B2TC 4OELB 3SK6A 4ZRZA 1S40A 5A2QE 1XX8A 1N8RC 5K36H 5M3FH 5ELBA 1IKLA 4ALPA 4OWWB 2R7ZG 5FOBB 2MJ8A 1LTID 1PZJD 4NXNQ 3CC7A 4DV2Q 1VF5C 2UXCL 2XWJB 1XNQQ 4BS9A 3OPOA 3CRLC 2M00A 4RHSA 3W1GA 4IOCA 1HZCA 4IQZA 2XRQD 5JAVA 4X65Q 1PDQA 4OL7A 4HIOA 3T13A 4RG1A 2ICIA 1PRTB 3X3NA 3J7ZC 1EU3A 3RLOA 1B50A 4EQ5A 2VZAA 3B6YA 1VQ6A 1KC8C 4LF8L 2EXDA 3FEWX 1CSPA 4BXXH 5LL6X 2JA8B 1WI5A 2PO4A 2JEBI 1LTGD 2I0QA 1GUTA 3MEHA 4V0BA 4K8IA 4DK1A 4YY3L 4KY5A 4JI1L 3HOZG 4DXGA 4RMFA 3NP8A 1U9RA 4Y7NH 3J81i 3QOLA 4KKSA 4POFA 4UAIA 5IGEA 2TMPA 5CV6A 2F4IA 2YV5A 5IP7G 3JAML 3MXPA 1CUKA 1SJHD 2F0WA 2IX0A 2WAQB 1B9NA 1E2WA 4I65A 3ZYYX 4DUYL 5IGGA 1Q12A 1ESRA 1IBKL 2WV6D 1JORA 3NUCA 4UPAA 3PIP3 4M8AA 2XNAC 4JI7Q 2IT1A 4KD4A 2HIVA 1QVFA 3GD7A 3QJYA 2LSSA 4DK3C 1HNWL 1FJGQ 1HHVA 4JCVE 4YHHQ 3RZOB 2Z6KA 1I4PA 2L55A 3W3AA 1S4ZA 3GTGB 4MN3A 3L9AX 2N55A 2Q2IA 2KA7A 5EJWA 1NMGA 3KLWA 2NVQB 2GVAA 2NVXB 2NVTH 4GN3B 4IFDI 3MTSA 1SNMA 5ELDA 4KY7A 4A3FH 1Q81C 3M9BA 3D31A 2EYJA 3HOXH 3WOEA 4KY6A 1X3PA 1PFBA 2Z9HA 3KBGA 2C35B 1EWCA 2SNSA 3OSOA 4DU9A 2QDLA 3S1NB 4B9XA 1V1QA 2JA6H 1Y1VG 2OXPA 3OOCA 4PZ6A 1MSHA 5CORA 4A3KH 4ZK9B 2TSSA 1XMOQ 3OTOQ 1G8ZD 1VQNA 1YVCA 4FYDA 1K3RA 2DJFC 3TP7A 2Y0SE 1LABA 2GA4B 2QKIC 3I8ZA 1JB7A 4AIMA 2SEBD 1TWCB 1YHQA 1X3GA 4A76A 4IALA 1IL8A 2RDHA 5IP9H 1EUJA 1OXUA 4A3CG 1BBXC 4FXDA 1PH1A 2NVYB 2CHBD 2Y0SB 4I7ZC 3S14H 4DV4L 1QE6A 1VQDA 5CV4A 1VQHA 1CT1D 2EE1A 1DOLA 1JE4A 1TWFB 4CKBA 4KJOA 1KTKA 2A68D 3DWAA 4LMQD 3K7UC 3J81L 3T4AC 1IYVA 1LTAD 4J8QA 1RCVD 4A3IB 5LMNL 4C1NK 4GLXA 1PH2A 1OXSC 3AYHB 2NUCA 2IJ0A 2PMZB 1PTOB 3M7NA 3FKIB 2KECA 1AFPA 1PV4A 2ATWA 4L5TA 4E6IA 2OCEA 1A15A 4RGTA 1S5CD 5EAYA 4OGQC 1T9HA 3TN2A 3AU7A 2HDLA 4KHPQ 3GP7A 2XSCA 4C3JH 4OWXB 4KMUC 4YCWA 1MKHA 2ES2A 4ZYSA 2LXKA 2RCNA 4A3LH 2Q2HA 5DAUA 4L8JA 3EA6A 1R9TB 3SVMA 2RDFA 1KHIA 5HURA 1G91A 1CZGA 1RIPA 4A4IA 3PGZA 2ZXRA 3I70A 2J4XA 5ELFA 5ELCA 1CHQD 4C3IG 1N32Q 2R93B 5J22A 3MFGA 2MGSA 5GAHC 5LMUQ 2F0VA 1Q1EA 3IL8A 5A35A 1YHBA 4J15A 1K3BC 4DR3Q 4DV3L 1E24A 2KCCA 1PYSB 4IFDH 1ML0D 2K6AA 4LK1C 3BZDB 4LF5Q 1LM0A 4F88A 3BZCA 1CKOA 4BBSH 4WJ4A 3HEJA 1AE2A 2WB1B 5CYUA 4B3TQ 5JJZA 3PUVA 3KOJA 3RZDB 4ME5A 4R4OA 2HQEA 2D5DA 1QJOA 2F0PA 4IUTA 1HZAA 3V2TA 1AEXA 4L63B 3AFPA 3PMFA 2PQAB 3A5ZB 1OO9B 2K50A 4JW0A 4IZ8A 4RKBA 1SBBB 1QOHA 3VA5A 1KRSA 1EYAA 1TWFH 3LGJA 5C44B 2HD3A 1N33Q 5EKLA 1EZ6A 1CHPD 3J80E 4FXGC 1J9OA 4DV6L 1ZYRD 3G6JB 3TS0A 2M9VA 3MWYW 2IHEA 3PV0A 1IW7C 2PNRC 1KLUD 2F0IA 4L6TB 1P16A 3K80C 1K83B 1XPRA 1I6VC 4IJHA 1GHJA 1NUCA 4PV1C 5D14A 4NKLA 4R4QA 4P75A 4N9TA 1PZKD 4HMIA 4A75A 3S9WA 4DR1Q 1WYDA 2F1MA 4C3HB 1STGA 1HQRD 1FNWA 4DAPA 4GNXB 1I3QB 1A62A 3I2ZA 3PIO3 5M5XH 1K28A 4FDBA 5CMDA 5KIXA 3QOJA 2BOSA 2B39A 1P8LA 1IBLQ 1MJEA 4HSPA 5A2QL 5JPMC 4EX5A 2FXQA 4HR7B 2E2HH 4DR7Q 4Q5VA 2UUBL 1I50H 3ULPA 1S3OA 2HIXA 4P73A 1W2BA 1STEA 1AE3A 3TQYA 4JC0A 4X66Q 1VQ9A 1VQGA 4XTCS 5EKKA 2D0OA 3M7GA 1WTPA 4R4CA 3S2HB 1O7IA 1PH7A 2B63G 4KD3A 4WORA 5KNBA 4A3DB 1G291 1HZBA 1J6QA 5IYDH 5FO8B 4IPGA 3U4VA 4LF7Q 3EVQA 2CVRA 1I4XA 2B2WA 2JA5G 2A69C 2L12A 4B08A 3SGIA 1D7QA 2F0GA 2AWOA 1HXYD 3OYYA 4A3GH 3ERSX 5JVH3 3GTPH 3S15B 4R4TA 1GUGA 4JYAL 2E2IH 3NENA 2F0MA 1UE1A 1R4QB 1A0IA 2F0NA 3OIPA 3L3OC 3TP5A 3ULJA 1QILA 4LUZA 3MXNB 4RAUC 3OWFA 4K0KL 3IRBA 3H0GB 1EY5A 1JMCA 1NTGA 3HRZC 2VUMH 2KBNA 2PZWA 5FJ8H 1BCPB 1GD7A 2LFNA 3PIPA 2JP1A 3RLFA 5IYDG 3GDEA 4A3MG 3M3YH 3HOUB 1JJ2A 4IOAA 4LFAQ 1V1PB 3HOWB 4GKKQ 4QF4A 1Q46A 3OW2A 2MO1A 2R7FA 2CW0D 3BVZA 4GN4B 4BY7B 4JK1C 1JR0D 4CDEC 3FRPB 3RUZA 2F3VA 4DV1Q 4A3GG 1DD2A 1EY7A 2PZTA 1Y8PB 1QZGA 5JJLA 2E5LQ 1L2FA 2JA7B 3T51B 4DGZA 4GLAC 2C5CA 4RFBA 3MA2B 1PZID 1IHZA 2HQLA 3RMHA 1RODA 1RL2A 1XTCD 5E1FA 1FGUA 1UUPA 2ZXPA 2EOTA 3OWEB 1LT3D 3GTKH 1IXRA 1QWYA 2K1BA 1FD7D 4QB4A 4TQUS 1Q8IA 4LF9L 3I4NG 1O7YA 3K57A 1WD1A 2RF4A 3E3XA 1HNZL 1RTOA 3QB3A 4UP7A 2NTTA 2VW9A 1GJXA 1HTLD 3GQBA 2R92B 2QDBA 2KENA 3CCVA 4DK0A 3WWVA 4Z9CB 1E1TA 2YTXA 2ENBA 1C4QA 3KF8A 2ICEC 4N8X1 5BR8Q 3S24A 1Z47A 2EJFC 5ELEA 1QNKA 4GOPB 1Z6HA 5C3EH 1WCMG 4R9WA 4APVA 3VDYA 4K5XA 5KEEA 3ULLA 1H9JA 4BY1H 4JI0L 4IUNA 5IGDA 1TY0A 2DGYA 5FO7B 4A3JB 1HH2P 2E8GA 1EY9A 4RGOS 2X6GA 5NUCA 4P72A 1VQKA 5C4JB 1SROA 4RCNA 3SK8A 4K2LA 1CKNB 1E0BA 2ZJPA 3SR1A 3MEFA 3J80c 3HOZB 1LLRD 2A6HD 5M5YH 3W2DA 4CKCA 1LTTD 5M3FB 4C56C 4A93G 1KDCA 3H3VI 4ODGA 2PQAA 1PFNA 2FHTA 5KRUA 2NBFA 1UE7A 4JI8Q 1A63A 3O13A 4DR6L 1YEZA 1XJVA 5KGUA 2F0KA 3HFZB 2AKWB 2Z0SA 4HCSA 1IBMQ 2EYLA 1SRUA 2E2JH 2JA7H 4A3EG 3AQQA 1HUMA 4DAYB 4IN3A 1FL0A 3SEBA 2K28A 5G3LD 3HG9A 2L11A 2E74C 1HR0W 4N9PA 1EY0A 1SMXA 5I4DA 1ENFA 4P74A 1F9SA 2Z1CA 5IYCH 1L0YB 3NBHB 2UXDL 5M3MG 3PF5A 3CU7A 3S1MH 3PO2G 1ENAA 1TIID 3VR2A 2Q8IB 4RHRA 4GNXA 1X3QA 3A8JE 1NY4A 3FVQA 5CV7A 1EWHA 1SNQA 5AJ3L 4Y7NB 2EYPA 3PUYA 4LFCL 4Q0FA 4LF4Q 1K73C 2R7ZH 2UUCQ 2ID0A 2DNEA 1VQJA 2HUGA 4QGUA 2D0PA 1SE3A 2UU9Q 3VR4A 1JC7A 1S5DD 3A7LA 1YNJD 2J0TD 3W1BA 2DJGC 2EYHA 2FFKB 2PZUA 4YWKA 2Z4HA 1EL0A 1VQCA 1LTBD 2OTLA 1VQ8A 1B1ZA 1XMQQ 3TRZA 1WVLA 1HNXQ 4FF1A 1E22A 1M1KC 2PCFB 5IWAQ 3ER0A 3U4ZA 2PQEA 1EIFA 3J80L 3NE5B 1WTOA 5FLMG 4DAMA 3G4SA 1H95A 3M4OH 1SFOH 4IURA 3HOZH 3NELA 4B3MQ 3C1FA 3F2BA 3I3CA 1H9RA 2NVTB 2CH4W 5IYBG 1W3SA 2JJQA 2WFWA 4A3FB 5IP7H 4KTAA 4ZLTF 4POGA 5L37A 4DV0Q 2HCIA 3HOXB 2L4NA 3DEOA 3UDFA 2QILA 3MXNA 1K9MC 5JPNC 1QZHA 1A2TA 3TREA 1FYCA 3H3VH 4CDDC 3K7AH 4YCVA 5CV9A 1HTPA 2JA6B 2HCCA 2JE6I 3G71A 4AQYL 1L1OB 1V1PA 4A3KB 2EXZA 1PTOD 2YYZA 3DHQA 4H7BA 3CCMA 2NN6G 1JWUD 3TP6A 1PH9A 3PO3G 3QWNA 3UE0A 4HIKA 2KOLA 4B3RL 1Y1WG 5GROA 3N52A 2F0TA 5AFWA 1BO0A 1G51A 3AFQA 3VR5A 3K81C 5M5WH 3KDFB 3PUXA 1LV9A 3S14B 4R4IA 1YI2A 4AYBG 2C9OA 2JN4A 4O42A 2EYMA 4DR4Q 2ZT9C 1D1IA 4XDXA 2F0HA 1JOQA 1Y8OB 3T1HQ 1NSNS 2JEAI 2E2DC 4ZUIA 1QG7A 3S1RH 5G3LF 1DXMA 4TVAB 4OONA 2VQFL 1WTWA 4A3BG 1Q3LA 4H02A 4ZAIA 3CXCA 4NXML 1I94L 4JV5Q 2QW7A 1Y1VH 3LX0A 1HR0Q 1HFNA 3GV6A 2D9UA 1CZWA 1C48A 4KHZA 1SYFA 1WTQA 2DUDA 4M1UB 4KN7C 4PZ8A 4C3JB 5C4XG 2VQEL 1CTMA 4R1JA 1AZPA 3V05A 1HQMC 2B2VA 3NWSA 4JI5Q 1A3UA 4A3CH 3J7AV 1J5EL 1HZ9A 3I91A 3EFXD 3S2DH 4ZKCB 2IY5B 1H9MA 2XWBB 3D4DA 4X64L 4GOPA 2I5LX 4CDCC 2HHHQ 1EY4A 5C4ZA 2Q2TA 4IUUA 3GTQH 1SJED 4KHVA 4DR2Q 2O5IC 2XGTA 1Q82C 4DV7L 3T1YQ 1SYBA 4JI4L 1CKNA 1EQVA 1AW7A 2CQOA 4BBSB 2PW5A 4BA2I 3GO5A 2PPBC 4IPHA 1YHAA 1T5EA 2SOBA 1X3FA 3C3LA 5I6WA 1WTRA 1BF4A 1M90C 3BG3A 3OIQA 3WDNA 3TSSA 2JYOA 1K8GA 3NQTA 2QA4A 1DGSA 2O2LD 3I4MG 4PNYA 4FO2A 1JCKB 3H09A 2UXCQ 2D2CC 2IWHA 2KHJA 5E4XA 4RWSC 3HKSA 4ULLA 1VDZA 4C3IH 2KUMA 5CBAE 5LMNW 1A6XA 2B2YA 1KIXA 3HS0C 1TVXA 4EQPA 1Y8NB 1CK1A 2K5NA 4G4KA 2B63B 2G5DA 1U4LA 5I9OA 3S17H 1G6ZA 4DK6C 3NBHA 4XIGS 2F52A 2X69A 4FXKC 4LF8Q 1JWMD 3M85A 2K04A 5IGBA 5ISRA 3F1ZA 5D3IB 1PTOF 2DY8A 4G7OC 3DWPA 2ZTEA 2B8GA 3BDCA 3SK4A 4YY3Q 4JI1Q 5CBEE 2LY7A 2B8FA 5I9PA 5C0XH 2L0CA 2MFIA 3URYA 2K5VA 2YU9H 5M5XB 1K8AC 5HGQA 1GUNA 4K6LA 1F9QA 2R6GA 2ZJRA 1PYBA 2RKSA 3NHHA 1F9RA 5JEAG 1H9SB 1Y69U 1PXUA 2E2HB 1O7LA 3RR5A 1B3AA 1I50B 5FO9B 1VS0A 2DY7A 1IBKQ 4HIDA 2JA8G 4B3SL 1KDAA 2SNMA 1STNA 5LHY1 2VL6A 1BBWA 1N36L 2L1BA 4P71A 5K5PA 3FHWA 1B70B 1QUQB 1HNWQ 1FNUA 2O4XA 4RKLA 5EBDA 3HOYG 2ALYB 1BCPD 1II3A 3MHBA 2WAQG 2ZM6L 5KNDA 3I4LA 5C0XG 4JBKA 1EIHA 1XNRL 4A3GB 3VYUA 4WFN3 4HJAA 4HSVA 3R8BA 3OMGA 3I55A 3GTPB 1F2MA 1DONA 4HTHA 1YITA 2E2IB 1GKHA 4XYOA 1OTCA 4ABNA 3CAMA 5FKAC 2UXBL 2BA1A 3HOVG 3NXWA 2K5WA 1EYGA 2AQ1B 1VQOA 1EYDA 1MSGA 2Q8TA 1ZYRC 2F4VL 4DV5L 4LF6L 2VUMB 3I90A 1OXTA 2OF1A 4JI2L 1L1OA 1EY8A 5C6AA 2B63H 1JT8A 1S5ED 3M3YB 3K5NA 4XXEA 4O2DA 3KLRA 4OO1G 1F9PA 3HKZG 2UUAL 4EQOA 2OQKA 5C5LA 5LL6S 4JI6L 5IT9E 1ESFA 2JA5H 3J7A5 2LS01 2Z6KC 2NZ1D 3LNNA 1DM0B 3KLSX 3GTMH 1N34Q 2A73B 1VQ7A 3DEPA 4DV4Q 1VCIA 4MTKA 3TZDA 3FP9A 4CJ1B 1EOTA 1N9WA 3STBD 4DR5L 2L9HA 4X3KA 5LMNQ 3GTKB 3I4OA 1EZ8A 3NWTA 3K8AA 1E3PA 4LFBL 2A6ED 2PI2E 4HJ5A 2GN5A 2EY5A 4A3MH 4DNIA 1TQOA 1VQ5A 1XYIA 2WKDA 1JJCB 1WTHA 1X32A 1ICFB 2OQ0A 4ME3A 5BN3A 1JB3A 3L2PA 1BDOA 3H3VC 1JWSD 2F0FA 1K8OA 4JVZA 2BH8A 1QVGA 1QNUA 1TKWB 1B4OA 1KLGD 3E0EA 1SYCA 4A3IG 1B7YB 1D5XC 2IW3A 4CJ0B 1ASZA 2PW7A 3FKIG 2ASBA 3NTKA 3R2IA 1XPUA 1LT4D 5C3EB 5D3DA 1MBYA 3U9SA 4AH6A 3ERQA 3MZ5A 4BY1B 4JBJA 1GOZA 2F0DA 2Z8LA 3NPPA 1GO3E 3A56A 1SE4A 5CC4A 4DV3Q 4MNOA 1V43A 3TMEA 3N6RA 1WD0A 3I4NH 4QUFA 4PMBA 3I56A 2MPMA 3SXHA 2CW0C 5C4HA 5M5YB 4FF3A 2AHOB 5IGFA 2WACA 1YNND 3GTJH 3CPFA 2R93G 3M4PA 2ZTCA 4MTNA 1HCZA 3PUZA 1VMCA 2NZHA 1UAPA 1TWAH 4K5VA 5T1IA 1WTXA 4OX9L 1DCZA 5I6YA 2K05A 4R8IA 2BE5D 2K5HA 2E2JB 3V96A 1STYA 3GTLH 4ZQ3A 2AQ2B 2B2TA 1WCMH 3A8KE 3DUZA 3KYHC 3A54A 1LTLA 2FINB 2WB1G 2Z4IA 4I7AA 2XVSA 5FK9C 1U4RA 4S3SA 4TSSA 4DV6Q 1EQTA 3QR8A 1KXLA 3KK7A 2E75C 2JQOA 1HUNA 1RTNA 1TS2A 1DOKA 3E6ZX 4DF7A 2AUJD 1W6JA 2KHIA 3PF4A 3S1MB 5DM73 3CF5A 4PZ7A 2B29A 2RVLA 2WIIB 2KEEA 4A93H 4YWLA 5COYA 2EJMA 3A7AB 5C44G 2BCOA 2R7ZB 1SNCA 1SNOA 2R61A 3SE0A 4NMZA 1H9SA 1I4RA 3UI2A 3J81j 4X62L 1XMQL 1VF7A 1PLFA 4NPSA 1MJCA 3TZUA 5EQ0A 2NN6I 3FPUB 4DUZL 4A3EH 2UUBQ 4CHTB 1UE5A 1Q90A 2CCZA 3J80i 4JBWA 3PUWA 4QCLA 4DNRB 4C3HG 2Q8RE 1QUQA 2F03A 4GLVB 1WOCA 1YBYA 3WOFA 3J81E 3CRKC 2F0QA 3HZXA 2V4DA 1PRTD 4NXNL 4DV2L 3F2DA 3PO3B 1TS3A 5M3MH 1STBA 1YNXA 4AYBE 4C2MH 3PO2H 1XNQL 5EGTA 3M4OB 1SFOB 3GTOH 4X65L 5EPLA 5JEAJ 3ND9A 1EY6A 3EJIA 1WFQA 1H9KA 4B9WA 3CPWA 4AYBB 2XN9C 3KFUA 2OWOA 5IT9c 2AUKA 1LT5D 1U4PA 1FR3A 5EKIA 4JYAQ 3H6MA 1BBUA 4A3DG 2EYOA 2F0SA 3HP3A 1GUSA 4C1NI 1AH9A 2N8NA 3AMUA 1GM5A 3BVGA 3K7AB 4BBRG 3CD6A 5KYLA 4K0KQ 1PVOA 2QEXA 1X65A 1TR5A 3R3OA 3G7LA 3Q6SA 3D6WA 2JK8A 2FMMA 2MQHA 3PSIA 4QMGA 4DN4M 5JVG3 1K8MA 1TS5A 4IUPA 3T56B 2EY2A 5C0XJ 1SR3A 3NBIA 2MHVA 3S16B 4QIWE 2VB2X 3EBEA 5FLMH 1RKNA 1S5FD 1JE5A 2N88A 2Q2UA 3FMCA 3J7YW 5M5WB 4HIMA 1X54A 4JI7L 2B2WC 2N78A 2QF7A 3A0JA 4QIWB 5IYBH 2V1CC 4QUCA 1TWGH 3H0GG 2B2UC 4J1MA 5I2YA 1YNJC 1IKMA 3I73A 1EIGA 1HA6A 5M9OA 1FJGL 3HOUG 4YHHL 4DNTB 1Z7TA 4H44C 1B9MA 4TRDA 3S1RB 3CMEA 3HOWG 1TWHH 1TU2B 4UHVA 1VQEA 1YJWA 1GUWA 4U673 3CCRA 3ITPA 3P20A 2MUYA 1Y1VB 3JAMc 1I6HH 3MXGA 5JJIA 1OXXK 4BY7G 3BS1A 2IL8A 3KUPA 4LF9Q 3H91A 4V190 2EIFA 4N8FA 3C2PA 2A8VA 1V9PA 1G2TA 4PMCA 2NN6H 2PI2A 3PO3H 4IUVA 1HNZQ 2L5TA 2N49A 1SMYD 1Y1WH 4NP5A 5DLQE 2NTSA 3IFDA 4DXFA 3K5LA 3S1QH 3VR6A 1YIJA 1M4VA 3K5OA 5DNFA 3S2DB 1Y14B 5BN4A 1I4HA 4FF2A 3E0JA 2EZVA 4HCEA 1JOOA 3P7JA 3GTQB 2VXWA 4G57A 1KAAA 1KABA 1BNZA 5CGKA 1CM9A 1L0WA 3PIOA 2MO0A 3BVMA 1XMOL 1D6EC 2DN8A 3OTOL 4JI0Q 3QG1A 1DZ1A 2LXJA 3NK9A 1VQPA 4A3BH 3MFYA 1PTOC 3BDLA 1UEBA 1MD2D 3AEVA 2R92G 1ENCA 2RDGA 2AQ3B 3R2TA 1GUOA 1PRTF 1PFMA 4RGNA 1ZEQX 5C4XH 3DXJC 3S16H 2BA0A 1CQFA 1PH6A 3SHLA 2NYZD 3CQZH 2MP1A 1U5KA 2I46A 2KHSA 4K8JA 2EYFA 1D8LA 4ILWA 1XPOA 4A3JG 4DR6Q 2EJGC 4DKAC 1SNDA 1UE6A 1M8AA 1I4QA 5CR3A 1KL9A 2KCNA 5IGCA 2BDOA 1VMPA 5BN5A 2XIWA 3IFTA 4C3IB 1PH5A 1E1OA 1SNPA 4XT1B 5E7NA 4KHPL 1O7ZA 1LUZA 1I5FA 3A74A 2WAQE 1F2ZA 4J6HA 4DPGA 1F2YA 5C0XI 3S17B 1SYDA 3C46A 4GKJQ 5EBCA 2BDNA 5K36G 4YIJA 1FNVA 5M3FG 2JXMB 5C5MA 3UDIA 1S72A 3HOYB 4QQBX 2UXDQ 2PNHA 2VB3X 2K5QA 4R8NA 4HAEA 3J81c 5CV8A 5AJ3Q 1N32L 2YU9B 1MI2A 3UDGA 4LFCQ 3U58A 2WP8J 2K5DA 5LMUL 1X55A 3I72A 1FGBD 2VY3A 4CGYB 3I4MH 4DR3L 4JI3Q 4WJ3M 4IO9A 5TSSA 3HOVB 4LF5L 2HDMA 2O5JC 1HRJA 1ASYA 1NR2A 2K52A 3G48A 3CP0A 4OO1I 4JOIC 4BXXG 2L15A 1CA6A 3VR3A 1LYLA 3HKZE 4CJ2C 4B3TL 1V8QA 2K03A 4YWMA 3F2UA 4IPCA 4KN4C 1LACA 2CQAA 1IZ6A 1KNEA 3FPPA 5J39A 1F2LA 1ZXTA 2OT2A 3Q8DA 1EFID 2RSNA 2NZOA 4LUOA 3HKZB 2H4OA 1RDPD 3A8IE 3CCSA 2F0JA 2JA9A 1BUVT 4XYQA 4F8MA 1RHPA 2MNAA 4GNXC 1CKMA 4GN5A 2K14A 2FJ2A 1N33L 3ZJYC 4FVMA 3KJPA 2CKZB 2P5ZX 1Z9FA 1W6KA 3RN2A 1VQBA 2A68C 1CQVA 4CBVA 5JEAH 4JBMA 4XQQA 1TXYA 4L5SA 3Q23A 3OMCA 3RLNA 3VYRA 4DAYA 3E5SA 3J7AF 4LWCA 1HA5A 1LT6D 2JA8H 1X9NA 5IIFA 4XT3B 5C3XA 4DR1L 4O0AA 1SYGA 1B2TA 5FLXE 2CWAA 1HFGA 4FF4A 1N34L 1ZKOA 3M4QA 4AQYQ 1SAPA 2KCMA 2RSOA 3VYSA 5GADC 4RGMA 1IBLL 4A3FG 3HOYH 2GVBA 4OEMB 1C0AA 2PMZE 3EROA 1CSQA 2R3ZA 3SK5A 2DNCA 4CKEA 4EGVA 3HOXG 4DR7L 4B3RQ 2JA5B 2QEJC 2D62A 1ONLA 1SEBD 3GTMB 2VNUD 3BJUA 3CCEA 1PA6A 1VQLA 2QCPX 4X66L 1E2VA 1ET9A 4X3TA 3MXUA 4JG2A 4X3SA 1BR9A 1T5XD 2JA6G 1BXTA 3HOVH 3Q0AA 1BVSA 3K59A 4DUYQ 4A3KG 3QIAA 2I07B 4HJ8A 4LF7L 3RZOH 2RCFA 3T16A 1RJTA 1CFMA 5IE8A 1SXTA 3NEMA 2VQFQ 3GTGH 5J3BA 1NMFA 3K0XA 5IY0A 5IP9G 1EIYB 4NXMQ 4HJ9A 1HPCA 1I94Q 3A5UA 1X3EA 1BCPC 2EY6A 2NVQH 4A3MB 2Z6BA 1MGSA 2NVXH 4OO1H 4L5RC 3KF8B 3T53B 5D65A 2VQEQ 3A55A 3ND8A 1A3VA 1S5BD 3BZKA 4K14A 4MZ9A 4IJLA 1EQRA 1TS4A 1L0XB 3K5MA 4Y52H 1J5EQ 2WB1E 1UNSA 5IOCA 4X64Q 1O78A 3P1HA 1KQSA 1SE2A 1YJ9A 3S1NH 4OWTB 1TY2A 5EPKA 4QJFA 2JSOA 3CCQA 1G2SA 4LFAL 3RD4A 3RN5A 4GKKL 4C3JG 1KRTA 4GS3A 3UE1A 1Q1BA 4DV7Q 2CFMA 2QGQA 3ICEA 2A74C 2G9HD 4JI4Q 4A3LG 1TWCH 4IPDA 1CA5A 4OHJA 4K5WA 2WKCA 3I4NB 2LKVA 1WTVA 4BA1I 3CW2C 4DV1L 3R93A 3CKIB 2NVYH 4ZUJA 1C8CA 1AZQA 2E5LL 1D5ZC 1Q86C 1G6PA 5GQOA 3K0YA 3U9OA 3GTJB 2K01A 1VQ4A 1SN8A 4MHEA 1EOVA 3KDFA 4BWGB 1EWIA 2B2VC 3PCOB 1TWAB 4U68A 4OIKA 5GAGC 4A3IH 4IFDG 1TT2A 3F2CA 1PTOH 1PFSA 3FKIH 2RHQB 4ZCKA 3GTLB 3STBC 4BBSG 3DMUA 1D5MC 1WCMB 4GOPC 3EIVA 4TKOB 1IW7D 1A3TA 4HN7A 1XWEA 2A6EC 1X56A 3G6EA 2I5HA 4LW1A 1GXDC 2H1EA 3D8GA 2RBMA 3PQIA 1UWVA 1EFWA 3IAYA 1LTSD 2OTJA 3MC0B 1R9TH 2SDFA 3CC4A 3JC66 4MIUA 5HY6A 4WJWA 5BR8L 2LMCB 1WJJA 2Y0SG 5T1GA 5JJKA 1C9OA 5GAEC 1I4GA 3SDZA 3ONAB 2F3WA 4A93B 1B44D 2R93H 2RQXA 1PH4A 4NB3A 3KF6B 3I7FA 3NTHA 4KI0A 3L7ZC 2KCTA 3TEHB 4UP9A 2EQSA 1K0RA 1AN8A 2F0UA 4H0LC 3P75A 1PMRA 1KNAA 1NAPA 1XXGA 4A3EB 4HJ7A 1YZ6A 2ZJQA 4BBRB 1KAWA 3E9IA 4OXPA 3DM1A 2R7DA 3JAME 4B3SQ 2ZTDA 2B2YC 3AB9A 4LAAA 1JICA 2M2LA 1N36Q 2IX3A 1Q8KA 2B2UA 3RZDH 1VQFA 4LUVA 2FMCA 4EVOA 3E9HA 4JI8L 1NE3A 5M3MB 2A69D 4EQNA 3K58A 4C2MB 1BQQT 5FLXc 1SSOA 3PO2B 2KVMA 4KK7A 3GTOB 5ELOA 1IYUA 1YNNC 1MIUA 1STHA 2ZM6Q 4YCUA 1IBML 1B8AA 1BCPF 1EEID 5J1ZA 1IL2A 5JOBA 3D4RA 5C44H 1VQMA 1XNRQ 4HEDA 2WINB 4F87A 2F0OA 2BE5C 2H5XA 1AP0A 4X3UA 4DAVA 4UDUC 3TS2A 4P2CB 2UXBQ 2NB0A 1K0SA 3Q24A 3EN2A 1DJRD 5KYIA 1A8VA 1K83H 2N3SA 2F4VQ 4DV5Q 1C7YA 4LF6Q 1LO5D 4C3HH 1BOSA 4L5QA 4JI2Q 4UY8C 4X6AH 1U4MA 2BH2A 1I3QH 4CDFC 5DEHA 1SYEA 4LF4L 2K4KA 3QO2A 4PMWA 4XQJA 2UUCL 3H94A 1D1KA 2I5MX 2ZXOA 2UUAQ 2K7VA 2UU9L 3CCJA 4JI6Q 4RCOA 2RA4A
chains in the Genus database with same CATH topology
3X3MA 1UEAB 5EPJA 1RF2D 1TWGB 4NDXA 1LTRD 1DOMA 4ID6A 4KKUA 1EYCA 2X6LA 2OEOA 3TBIB 2K33A 3D6CA 1A2UA 4K6DA 1TWHB 2EY1A 3KLSA 1PYWD 2IX1A 1PRTC 1I6HB 4PQXA 2J7ZA 2G9DA 5KNCA 5C3WA 1SDFA 2E76C 5HGTA 5DM63 1ILQA 2XRSD 2A6HC 5FLXL 3D3RA 3CHBD 1Y1WB 3OW7A 3LWEA 1CI3M 1F77A 3NTIA 3S1QB 3C1EA 3TP8A 1QB5D 1STAA 1GHKA 1NR4A 1JQYD 1ET6A 2KEDA 1QCBD 4RA8A 5I2XA 5IODA 1O80A 4KV6A 5E3FA 2AWNA 2EPBA 2EVBA 4A3BB 2KJXA 3K6OA 3HGBA 4DFAA 3LWUA 3BDOA 1KDBA 4FNFA 5C4XB 4K2KA 1E2ZA 4KKTA 4ZKBB 1J8IA 3M4YA 3EQLC 2F0LA 3CQZB 4KJNA 4WRDA 5CV5A 1ICWA 3TDQA 3IKJA 1RD9D 3BYTB 5F2DA 3NSWA 4DA2A 4XQNA 1NCVA 3OHXC 3KBXA 2F0EA 3DWQA 1EU4A 2PYKA 1ILPA 4F7XA 3NQIA 4IUQA 2IPKD 4FP5D 4G7ZC 3MAQA 4NW2A 4O1NA 1R4PB 4HMJA 1SMYC 3D4WA 3VYTA 3BYYB 2NWGA 3Q22A 2A5HA 3VA7A 3GV3A 4G7HC 4IFDJ 3I4MB 1JOKA 3FDTA 4GZYC 4OIJA 4H13C 4RH6A 4LJZC 2K32A 3MVVA 1EEFD 5IT9L 1DYQA 2EDGA 1OXVA 2KQ3A 1B53A 5E4WC 1D2BA 1V1OA 2B2TC 3SK6A 4ZRZA 5A2QE 1XX8A 5K36H 5ELBA 1IKLA 5FOBB 2MJ8A 1LTID 1PZJD 1VF5C 2XWJB 4BS9A 3OPOA 3CRLC 2M00A 4RHSA 4IQZA 2XRQD 5JAVA 1PDQA 4OL7A 3T13A 2ICIA 1PRTB 3X3NA 1EU3A 1B50A 3FEWX 5LL6X 2JA8B 2PO4A 2JEBI 1LTGD 1GUTA 3MEHA 4V0BA 4K8IA 4DK1A 4KY5A 4DXGA 3NP8A 1U9RA 3QOLA 4KKSA 5IGEA 4UAIA 2TMPA 5CV6A 2F4IA 3JAML 3MXPA 1SJHD 2F0WA 2IX0A 2WAQB 1B9NA 1E2WA 4I65A 3ZYYX 5IGGA 1Q12A 1ESRA 2WV6D 1JORA 3NUCA 3PIP3 4M8AA 2XNAC 2IT1A 4KD4A 3GD7A 3QJYA 1HHVA 3RZOB 1I4PA 2L55A 3W3AA 1S4ZA 3GTGB 4MN3A 3L9AX 2N55A 2KA7A 5EJWA 2NVQB 2NVXB 4IFDI 3MTSA 5ELDA 1SNMA 4KY7A 3D31A 2EYJA 3WOEA 4KY6A 1X3PA 1PFBA 3KBGA 1EWCA 2SNSA 3OSOA 4DU9A 3S1NB 4B9XA 2OXPA 3OOCA 1MSHA 5CORA 4ZK9B 2TSSA 1G8ZD 4FYDA 3TP7A 1LABA 2GA4B 2QKIC 3I8ZA 2SEBD 1TWCB 4IALA 1IL8A 2RDHA 1OXUA 1BBXC 4FXDA 2NVYB 2CHBD 2Y0SB 4I7ZC 1QE6A 5CV4A 1CT1D 2EE1A 1DOLA 1JE4A 1TWFB 4CKBA 4KJOA 1KTKA 2A68D 3DWAA 4LMQD 3J81L 3T4AC 1IYVA 1LTAD 4J8QA 1RCVD 4A3IB 4C1NK 1OXSC 2NUCA 2IJ0A 2PMZB 1PTOB 3M7NA 3FKIB 2KECA 1AFPA 4E6IA 1A15A 4RGTA 1S5CD 4OGQC 3TN2A 3AU7A 2HDLA 3GP7A 2XSCA 4KMUC 4ZYSA 5DAUA 4L8JA 3EA6A 1R9TB 3SVMA 2RDFA 5HURA 1G91A 1CZGA 2ZXRA 3I70A 2J4XA 5ELFA 5ELCA 1CHQD 4C3IG 2R93B 5J22A 3MFGA 2MGSA 2F0VA 1Q1EA 3IL8A 5A35A 2KCCA 4IFDH 1ML0D 2K6AA 4LK1C 3BZDB 4F88A 3HEJA 2WB1B 5CYUA 5JJZA 3PUVA 3RZDB 4ME5A 2HQEA 2D5DA 1QJOA 2F0PA 4IUTA 3V2TA 1AEXA 4L63B 3PMFA 1OO9B 4IZ8A 4RKBA 1SBBB 1QOHA 3VA5A 1EYAA 5C44B 5EKLA 1EZ6A 1CHPD 3J80E 4FXGC 1J9OA 1ZYRD 3G6JB 2M9VA 3MWYW 3PV0A 1IW7C 2PNRC 1KLUD 2F0IA 4L6TB 1K83B 1I6VC 5D14A 1GHJA 1NUCA 4PV1C 4NKLA 4N9TA 1PZKD 4HMIA 3S9WA 2F1MA 4C3HB 1STGA 1HQRD 1FNWA 4DAPA 1I3QB 3PIO3 5KIXA 5CMDA 3QOJA 2BOSA 2B39A 4HSPA 5A2QL 5JPMC 4HR7B 4Q5VA 1STEA 4XTCS 5EKKA 3M7GA 1WTPA 3S2HB 4KD3A 4WORA 5KNBA 4A3DB 1G291 5FO8B 3EVQA 2CVRA 1I4XA 2B2WA 2A69C 2L12A 4B08A 2F0GA 2AWOA 1HXYD 5JVH3 3S15B 1GUGA 2F0MA 1R4QB 2F0NA 3OIPA 3L3OC 3TP5A 1QILA 4RAUC 3OWFA 3H0GB 1EY5A 3HRZC 2PZWA 1BCPB 2LFNA 2JP1A 3RLFA 3HOUB 1V1PB 3HOWB 4QF4A 2CW0D 3BVZA 4BY7B 4JK1C 1JR0D 3FRPB 3RUZA 2F3VA 1DD2A 1EY7A 2PZTA 1Y8PB 2JA7B 3T51B 4DGZA 2C5CA 4RFBA 3MA2B 1PZID 1IHZA 3RMHA 1RODA 1XTCD 5E1FA 1UUPA 2ZXPA 2EOTA 3OWEB 1LT3D 1QWYA 2K1BA 1FD7D 4QB4A 4TQUS 1Q8IA 1O7YA 3K57A 1WD1A 1RTOA 3QB3A 2NTTA 1GJXA 1HTLD 3GQBA 2R92B 2QDBA 4DK0A 4Z9CB 2ENBA 1C4QA 3KF8A 2ICEC 1Z47A 2EJFC 5ELEA 1QNKA 1Z6HA 4R9WA 4K5XA 5KEEA 1H9JA 4IUNA 5IGDA 1TY0A 5FO7B 4A3JB 1EY9A 4RGOS 2X6GA 5NUCA 5C4JB 4RCNA 3SK8A 4K2LA 1E0BA 3SR1A 3HOZB 1LLRD 2A6HD 3W2DA 4CKCA 1LTTD 5M3FB 4C56C 1KDCA 4ODGA 1PFNA 2FHTA 5KRUA 2NBFA 3O13A 5KGUA 2F0KA 4HCSA 2EYLA 1HUMA 4IN3A 3SEBA 2K28A 5G3LD 3HG9A 2L11A 2E74C 4N9PA 1EY0A 5I4DA 1ENFA 1F9SA 2Z1CA 1L0YB 3CU7A 1ENAA 1TIID 3VR2A 2Q8IB 4RHRA 1X3QA 3A8JE 3FVQA 5CV7A 1EWHA 1SNQA 4Y7NB 2EYPA 3PUYA 4Q0FA 2ID0A 2DNEA 2HUGA 1SE3A 3VR4A 1JC7A 1S5DD 3A7LA 1YNJD 2J0TD 2EYHA 2FFKB 2PZUA 2Z4HA 1EL0A 1LTBD 1B1ZA 1WVLA 4FF1A 2PCFB 2PQEA 3J80L 3NE5B 1WTOA 4IURA 3C1FA 3I3CA 1H9RA 2NVTB 4A3FB 4KTAA 4ZLTF 2HCIA 3HOXB 2L4NA 3DEOA 2QILA 3MXNA 5JPNC 1A2TA 1FYCA 5CV9A 1HTPA 2JA6B 2HCCA 2JE6I 1V1PA 4A3KB 2EXZA 1PTOD 2YYZA 3DHQA 4H7BA 2NN6G 1JWUD 3TP6A 3QWNA 2KOLA 3N52A 5AFWA 2F0TA 1BO0A 3VR5A 3PUXA 1LV9A 3S14B 2C9OA 4O42A 2EYMA 2ZT9C 1D1IA 4XDXA 2F0HA 1JOQA 1Y8OB 1NSNS 2JEAI 2E2DC 4ZUIA 1QG7A 5G3LF 1DXMA 1WTWA 1Q3LA 4ZAIA 3LX0A 1HFNA 3GV6A 2D9UA 1CZWA 1C48A 4KHZA 1SYFA 1WTQA 4M1UB 4KN7C 4C3JB 1CTMA 1AZPA 3V05A 1HQMC 2B2VA 3NWSA 1A3UA 3J7AV 3I91A 3EFXD 4ZKCB 1H9MA 2XWBB 3D4DA 5C4ZA 1EY4A 4IUUA 1SJED 4KHVA 2O5IC 1SYBA 1EQVA 1AW7A 4BBSB 2PW5A 4BA2I 3GO5A 2PPBC 1T5EA 2SOBA 3C3LA 5I6WA 1WTRA 1BF4A 3BG3A 3OIQA 3WDNA 3TSSA 2JYOA 3NQTA 2O2LD 4PNYA 4FO2A 1JCKB 3H09A 2D2CC 2IWHA 5E4XA 4RWSC 4ULLA 1VDZA 5CBAE 2KUMA 1A6XA 2B2YA 3HS0C 1TVXA 4EQPA 1Y8NB 1CK1A 2B63B 4G4KA 1U4LA 5I9OA 1G6ZA 3NBHA 4XIGS 2X69A 4FXKC 1JWMD 3M85A 2K04A 5IGBA 5ISRA 5D3IB 1PTOF 2DY8A 4G7OC 3DWPA 2B8GA 3BDCA 3SK4A 5CBEE 2LY7A 2B8FA 5I9PA 5C0XH 2L0CA 3URYA 5M5XB 1GUNA 4K6LA 1F9QA 2R6GA 2RKSA 3NHHA 1F9RA 5JEAG 1H9SB 1Y69U 1PXUA 2E2HB 1O7LA 1B3AA 1I50B 5FO9B 2DY7A 1KDAA 2SNMA 1STNA 5LHY1 2L1BA 5K5PA 1FNUA 2O4XA 4RKLA 5EBDA 1BCPD 1II3A 3MHBA 5KNDA 3I4LA 5C0XG 1EIHA 4A3GB 3VYUA 4WFN3 4HSVA 3R8BA 3OMGA 3GTPB 1F2MA 1DONA 4HTHA 2E2IB 4XYOA 4ABNA 5FKAC 2BA1A 3NXWA 2K5WA 2AQ1B 1EYDA 1MSGA 2Q8TA 1ZYRC 2VUMB 3I90A 1OXTA 2OF1A 1EY8A 5C6AA 1S5ED 3M3YB 3K5NA 4XXEA 3KLRA 4OO1G 1F9PA 4EQOA 5C5LA 5LL6S 5IT9E 1ESFA 2LS01 2NZ1D 3LNNA 1DM0B 3KLSX 2A73B 3DEPA 1VCIA 3TZDA 4CJ1B 1EOTA 2L9HA 4X3KA 3GTKB 1EZ8A 3NWTA 2A6ED 2EY5A 1TQOA 1XYIA 2WKDA 5BN3A 1X32A 1JB3A 1BDOA 3H3VC 1JWSD 2F0FA 1K8OA 1QNUA 1TKWB 1B4OA 1KLGD 1SYCA 1D5XC 2IW3A 4CJ0B 2PW7A 3NTKA 3R2IA 1LT4D 5C3EB 5D3DA 1MBYA 3U9SA 3ERQA 3MZ5A 4BY1B 1GOZA 2F0DA 2Z8LA 3NPPA 3A56A 1SE4A 5CC4A 1V43A 3TMEA 3N6RA 1WD0A 4QUFA 4PMBA 2MPMA 3SXHA 2CW0C 5C4HA 5M5YB 4FF3A 5IGFA 2WACA 1YNND 1HCZA 3PUZA 1VMCA 1UAPA 5T1IA 4K5VA 1WTXA 1DCZA 5I6YA 2K05A 4R8IA 2BE5D 2E2JB 3V96A 1STYA 4ZQ3A 2AQ2B 2B2TA 3A8KE 3DUZA 3A54A 2FINB 2Z4IA 2XVSA 5FK9C 1U4RA 4S3SA 4TSSA 1EQTA 3KK7A 2E75C 1HUNA 1RTNA 1TS2A 1DOKA 3E6ZX 4DF7A 2AUJD 1W6JA 3S1MB 5DM73 2RVLA 2WIIB 2KEEA 5COYA 2EJMA 3A7AB 2BCOA 2R7ZB 1SNCA 1SNOA 2R61A 3SE0A 4NMZA 1H9SA 1I4RA 3UI2A 1VF7A 1PLFA 3TZUA 5EQ0A 2NN6I 3FPUB 4CHTB 1Q90A 4JBWA 3PUWA 4QCLA 4DNRB 4C3HG 2Q8RE 2F03A 3WOFA 3J81E 3CRKC 2F0QA 3HZXA 2V4DA 1PRTD 3PO3B 1TS3A 1STBA 5EGTA 3M4OB 1SFOB 5EPLA 5JEAJ 3ND9A 1EY6A 3EJIA 1H9KA 4B9WA 4AYBB 2XN9C 2AUKA 1LT5D 1U4PA 1FR3A 5EKIA 3H6MA 2EYOA 2F0SA 3HP3A 1GUSA 4C1NI 3AMUA 3BVGA 3K7AB 5KYLA 1TR5A 3R3OA 3G7LA 3Q6SA 3D6WA 2FMMA 4QMGA 4DN4M 5JVG3 1K8MA 1TS5A 4IUPA 3T56B 2EY2A 5C0XJ 3NBIA 2MHVA 3S16B 2VB2X 1RKNA 1S5FD 2N88A 3FMCA 3J7YW 5M5WB 2B2WC 2QF7A 4QIWB 4QUCA 2B2UC 4J1MA 5I2YA 1YNJC 1IKMA 3I73A 1EIGA 1HA6A 5M9OA 4DNTB 1Z7TA 4H44C 1B9MA 4TRDA 3S1RB 1TU2B 1GUWA 4U673 3ITPA 3P20A 2MUYA 1Y1VB 3MXGA 1OXXK 3BS1A 2IL8A 3KUPA 3H91A 4V190 3C2PA 1G2TA 4PMCA 2NN6H 4IUVA 2L5TA 1SMYD 4NP5A 2NTSA 3IFDA 4DXFA 3K5LA 3VR6A 1M4VA 3K5OA 5DNFA 3S2DB 5BN4A 1I4HA 4FF2A 3E0JA 2EZVA 4HCEA 1JOOA 3P7JA 3GTQB 2VXWA 4G57A 1KAAA 1KABA 1BNZA 5CGKA 1CM9A 3BVMA 1D6EC 2DN8A 3QG1A 1DZ1A 3NK9A 3MFYA 1PTOC 3BDLA 1MD2D 1ENCA 2RDGA 2AQ3B 3R2TA 1GUOA 1PRTF 1PFMA 4RGNA 1ZEQX 3DXJC 2BA0A 1CQFA 3SHLA 2NYZD 2MP1A 2I46A 2KHSA 4K8JA 2EYFA 4ILWA 2EJGC 1SNDA 1M8AA 1I4QA 5CR3A 2KCNA 5IGCA 2BDOA 1VMPA 5BN5A 2XIWA 3IFTA 4C3IB 1SNPA 4XT1B 1O7ZA 1F2ZA 4J6HA 1F2YA 5C0XI 3S17B 1SYDA 3C46A 5EBCA 2BDNA 5K36G 4YIJA 1FNVA 2JXMB 5C5MA 3HOYB 2VB3X 2K5QA 4R8NA 4HAEA 5CV8A 2YU9B 1MI2A 2WP8J 2K5DA 3I72A 1FGBD 4CGYB 5TSSA 3HOVB 2HDMA 2O5JC 1HRJA 1NR2A 4OO1I 1CA6A 3VR3A 4CJ2C 1V8QA 2K03A 3F2UA 4KN4C 1LACA 2CQAA 1KNEA 5J39A 3FPPA 1F2LA 1ZXTA 2OT2A 1EFID 2RSNA 3HKZB 2H4OA 1RDPD 3A8IE 2F0JA 1BUVT 4XYQA 4F8MA 1RHPA 2FJ2A 4FVMA 1W6KA 2A68C 1CQVA 4CBVA 5JEAH 4XQQA 3Q23A 3OMCA 3VYRA 4DAYA 3E5SA 3J7AF 1HA5A 1LT6D 5IIFA 4XT3B 5C3XA 1SYGA 1B2TA 5FLXE 1HFGA 4FF4A 1ZKOA 1SAPA 2RSOA 3VYSA 4RGMA 3EROA 2R3ZA 3SK5A 2DNCA 4CKEA 4EGVA 2JA5B 2QEJC 2D62A 1ONLA 1SEBD 3GTMB 2VNUD 2QCPX 1E2VA 1ET9A 4X3TA 3MXUA 4X3SA 1BR9A 1T5XD 1BXTA 3Q0AA 3K59A 3QIAA 2I07B 3T16A 1RJTA 1CFMA 1SXTA 1HPCA 1BCPC 2EY6A 4A3MB 1MGSA 4OO1H 3T53B 5D65A 3A55A 3ND8A 1A3VA 1S5BD 4K14A 1TS4A 1L0XB 3K5MA 1UNSA 5IOCA 1O78A 3P1HA 1SE2A 1TY2A 5EPKA 2JSOA 1G2SA 3RD4A 4C3JG 1Q1BA 2A74C 2G9HD 1CA5A 4OHJA 4K5WA 2WKCA 3I4NB 2LKVA 1WTVA 4BA1I 3R93A 3CKIB 4ZUJA 1C8CA 1AZQA 1D5ZC 3K0YA 3U9OA 3GTJB 2K01A 4MHEA 4BWGB 2B2VC 1TWAB 4U68A 4OIKA 4IFDG 1TT2A 1PTOH 3GTLB 3DMUA 1D5MC 1WCMB 4TKOB 1IW7D 1A3TA 4HN7A 1XWEA 2A6EC 1GXDC 2H1EA 3D8GA 2RBMA 3IAYA 1LTSD 3MC0B 2SDFA 4MIUA 4WJWA 2LMCB 5T1GA 1I4GA 3SDZA 3ONAB 2F3WA 4A93B 1B44D 2RQXA 3NTHA 4KI0A 3L7ZC 1AN8A 2F0UA 4H0LC 3P75A 1PMRA 1KNAA 1NAPA 1XXGA 4A3EB 4BBRB 3DM1A 3JAME 2B2YC 3AB9A 4LAAA 1JICA 2M2LA 2IX3A 2B2UA 2FMCA 4EVOA 5M3MB 2A69D 4EQNA 3K58A 4C2MB 1BQQT 3PO2B 1SSOA 2KVMA 4KK7A 3GTOB 1IYUA 1YNNC 1STHA 1BCPF 1EEID 5J1ZA 5JOBA 3D4RA 4HEDA 2WINB 4F87A 2F0OA 2BE5C 1AP0A 4X3UA 4DAVA 4UDUC 4P2CB 2NB0A 3Q24A 1DJRD 5KYIA 1LO5D 1BOSA 1U4MA 5DEHA 1SYEA 3QO2A 4PMWA 4XQJA 3H94A 1D1KA 2ZXOA 2K7VA 4RCOA 2RA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  5F2D A;  5CV4 A;  5KRU A;  2PW7 A;  3NP8 A;  1U9R A;  1A2T A;  2PW5 A;  3QOL A;  4KJO A;  4MIU A;  4QF4 A;  5EKL A;  3T16 A;  5IGE A;  5CV6 A;  2F0E A;  2F0K A;  5KGU A;  3ERQ A;  3MZ5 A;  2F0Q A;  2SOB A;  2PYK A;  4NDX A;  4NP5 A;  3HZX A;  5I6W A;  3OMG A;  2F0I A;  5CV9 A;  1F2M A;  2F0D A;  3MXP A;  4ID6 A;  4HTH A;  4F7X A;  2EYL A;  1STB A;  1NUC A;  2F3W A;  2F0W A;  4NKL A;  2F3V A;  2EY6 A;  3RUZ A;  4N9T A;  4HMI A;  5EGT A;  2NUC A;  3NQT A;  5CC4 A;  4I65 A;  1EYC A;  2EXZ A;  2OEO A;  3DHQ A;  3NXW A;  4H7B A;  3TME A;  3S9W A;  1EY7 A;  1JOO A;  2PZT A;  5IGG A;  3D6C A;  1STG A;  3TP6 A;  1EYD A;  1A2U A;  5J39 A;  4K6D A;  4E6I A;  4G57 A;  1EY6 A;  1KAA A;  1KAB A;  3EJI A;  4N9P A;  3NUC A;  4DGZ A;  5CGK A;  1JOR A;  2EY1 A;  4PNY A;  1EY0 A;  4HMJ A;  1A3V A;  1IHZ A;  3D4W A;  4K14 A;  2F0U A;  4KD4 A;  4B9W A;  5KIX A;  4PMB A;  2F0T A;  3QOJ A;  3P75 A;  3SXH A;  5C4H A;  2OF1 A;  5C3W A;  1EY8 A;  5E1F A;  5C6A A;  3NK9 A;  5IGF A;  3H6M A;  1ENA A;  2F0J A;  2WAC A;  5HGT A;  2EYO A;  2F0S A;  5DAU A;  5IOC A;  3BDL A;  1JOK A;  4QB4 A;  2EYM A;  1SNQ A;  2RDF A;  4LAA A;  1ENC A;  5CV7 A;  4EQP A;  4EQO A;  2EYP A;  4F8M A;  5C5L A;  3P1H A;  5HUR A;  2F0H A;  1JOQ A;  5I9O A;  3MVV A;  4K5V A;  5KYL A;  4EVO A;  5I6Y A;  1NSN S;  1TR5 A;  3C1E A;  3R3O A;  5EKK A;  4EQN A;  1STY A;  2KQ3 A;  3TP8 A;  5IGB A;  4ZQ3 A;  5ISR A;  3QB3 A;  4QMG A;  4ZUI A;  1STA A;  4KD3 A;  4WOR A;  5J22 A;  3SHL A;  3OMC A;  1STH A;  2EY2 A;  2QDB A;  3BDC A;  2KHS A;  4K8J A;  2EYF A;  3SK4 A;  1SNM A;  3SK6 A;  2F0V A;  3E5S A;  4KY7 A;  4K5W A;  2EYH A;  2LKV A;  5I9P A;  4S3S A;  3LX0 A;  5J1Z A;  5JOB A;  2ENB A;  1RKN A;  3EVQ A;  5C3X A;  5IIF A;  2EYJ A;  1SND A;  1SYF A;  4ZUJ A;  1SYG A;  2PZU A;  2F0O A;  4KY6 A;  5CR3 A;  5IOD A;  4KV6 A;  5E3F A;  5IGC A;  4DF7 A;  2RKS A;  3U9O A;  3NHH A;  2F0G A;  3HEJ A;  1SNP A;  1EZ8 A;  2SNS A;  4K5X A;  5KEE A;  2M00 A;  4IUN A;  5IGD A;  3OSO A;  4J1M A;  1A3U A;  4DFA A;  4DU9 A;  5KYI A;  1F2Z A;  4J6H A;  2EY5 A;  1F2Y A;  4B9X A;  3ERO A;  1EY9 A;  1SYD A;  2OXP A;  2PQE A;  4ME5 A;  4OL7 A;  5NUC A;  2F0M A;  5M9O A;  1KDB A;  4YIJ A;  3D4D A;  3SK5 A;  3T13 A;  1TT2 A;  1SNC A;  1SNO A;  2F0N A;  2HQE A;  1KDA A;  1TQO A;  1STN A;  2F0P A;  2SNM A;  4K2K A;  3SK8 A;  4NMZ A;  4K2L A;  5C5M A;  1EY4 A;  3TP5 A;  3V2T A;  5C4Z A;  1AEX A;  4TRD A;  3SR1 A;  3TP7 A;  3PMF A;  3DMU A;  3OWF A;  5K5P A;  5JAV A;  3C1F A;  4KHV A;  2F0L A;  1SYE A;  1EY5 A;  2F0F A;  1A3T A;  4KJN A;  4WRD A;  5CV5 A;  5DEH A;  4IAL A;  4R8N A;  2O4X A;  3ITP A;  4IZ8 A;  4RKB A;  4KTA A;  5CV8 A;  4RKL A;  3VA5 A;  1EYA A;  2PZW A;  3D8G A;  1SYC A;  1II3 A;  2RBM A;  1SYB A;  3MHB A;  3MEH A;  1EQV A;  1KDC A;  4K8I A;  4ODG A;  4PMC A;  1EZ6 A; 
#chains in the Genus database with same CATH topology
 3X3M A;  1UEA B;  5EPJ A;  1RF2 D;  1TWG B;  4NDX A;  1LTR D;  1DOM A;  4ID6 A;  2VUM G;  5FJ8 G;  3S2H H;  4KKU A;  1HNX L;  4LNQ A;  4A3D H;  1EYC A;  2X6L A;  2OEO A;  3L0O A;  3TBI B;  2K33 A;  3D6C A;  5IWA L;  2K75 A;  1JJG A;  1A2U A;  4K6D A;  1TWH B;  4DR5 Q;  2EY1 A;  4BBR H;  3H15 A;  1XTD A;  2F3I A;  1GVP A;  3KLS A;  1PYW D;  2IX1 A;  1PRT C;  1I6H B;  4PQX A;  2J7Z A;  2G9D A;  5KNC A;  5C3W A;  4B3M L;  4LFB Q;  1SDF A;  2E76 C;  1L1O C;  5HGT A;  1BKB A;  3F8T A;  5DM6 3;  1ILQ A;  2XRS D;  2A6H C;  1NBW A;  5FLX L;  4DV0 L;  3DLL A;  3S15 H;  2YTV A;  3D3R A;  3CHB D;  3CMA A;  1Y1W B;  3OW7 A;  3LWE A;  1CI3 M;  1F77 A;  3NTI A;  3S1Q B;  1MHW C;  3C1E A;  1PHJ A;  1VQA A;  3TP8 A;  1QB5 D;  4KLK A;  1STA A;  1GHK A;  3H0G H;  1NR4 A;  1JQY D;  1ET6 A;  2KED A;  1FVI A;  1QCB D;  3KJO A;  1PH3 A;  3U50 C;  2CWP A;  4RA8 A;  2XTI A;  5I2X A;  5IOD A;  3HOU H;  1O80 A;  4KV6 A;  5E3F A;  2AWN A;  3HOW H;  2EPB A;  2EVB A;  4A3B B;  2KJX A;  1QVC A;  3K6O A;  3HGB A;  4PG3 A;  4DFA A;  4BY7 H;  1NJI C;  2VS1 A;  3LWU A;  3BDO A;  1KDB A;  4JOI A;  4FNF A;  5C4X B;  4K2K A;  4DR4 L;  1E2Z A;  4KKT A;  1Q7Y C;  4ZKB B;  1EQQ A;  1J8I A;  3RNU A;  3M4Y A;  2A1A A;  3EQL C;  2F0L A;  3CQZ B;  1IYJ B;  1SE8 A;  4KJN A;  1SLJ A;  4WRD A;  5CV5 A;  1ICW A;  5C3E G;  3T1H L;  4BY1 G;  3CCL A;  1NNX A;  5ELN A;  1KD1 C;  4QL5 A;  3TDQ A;  4GKJ L;  3UDX A;  3CCU A;  3IKJ A;  1E7Z A;  3BU2 A;  4OX9 Q;  1RD9 D;  4QY7 A;  4JV5 L;  4JPB W;  3BYT B;  5F2D A;  3NSW A;  2AMC B;  4DA2 A;  4XQN A;  1NCV A;  3OHX C;  1HR0 L;  3KBX A;  1VQI A;  3JAM i;  2F0E A;  3D0F A;  3DWQ A;  1EU4 A;  2PYK A;  2A19 A;  1U0L A;  1ILP A;  4F7X A;  3NQI A;  4IUQ A;  5H1S E;  2IPK D;  4FP5 D;  2B3G A;  4G7Z C;  4UP8 A;  4JI5 L;  3MAQ A;  4NW2 A;  2R92 H;  4JI3 L;  2CH4 A;  4O1N A;  1R4P B;  4HMJ A;  1SMY C;  3D4W A;  3DM3 A;  2HHH L;  3VYT A;  3BYY B;  2NWG A;  3Q22 A;  2A5H A;  3VA7 A;  3GV3 A;  4G7H C;  2JA7 G;  4IFD J;  4DR2 L;  2IHF A;  3KF6 A;  3CC2 A;  1X6O A;  3I4M B;  1JOK A;  3FDT A;  2HT1 A;  4GZY C;  4OIJ A;  3T1Y L;  1PH8 A;  1YJN A;  4H13 C;  4RH6 A;  4A3J H;  4LJZ C;  2K32 A;  3MVV A;  1B3Q A;  1EEF D;  4X62 Q;  5C4J H;  5IT9 L;  1DYQ A;  2EDG A;  1HJP A;  1OXV A;  5IYC G;  3W5O A;  2KQ3 A;  1B53 A;  4DUZ Q;  2YTY A;  5E4W C;  1D2B A;  1V1O A;  2RHS B;  2B2T C;  4OEL B;  3SK6 A;  4ZRZ A;  1S40 A;  5A2Q E;  1XX8 A;  1N8R C;  5K36 H;  5M3F H;  5ELB A;  1IKL A;  4ALP A;  4OWW B;  2R7Z G;  5FOB B;  2MJ8 A;  1LTI D;  1PZJ D;  4NXN Q;  3CC7 A;  4DV2 Q;  1VF5 C;  2UXC L;  2XWJ B;  1XNQ Q;  4BS9 A;  3OPO A;  3CRL C;  2M00 A;  4RHS A;  3W1G A;  4IOC A;  1HZC A;  4IQZ A;  2XRQ D;  5JAV A;  4X65 Q;  1PDQ A;  4OL7 A;  4HIO A;  3T13 A;  4RG1 A;  2ICI A;  1PRT B;  3X3N A;  3J7Z C;  1EU3 A;  3RLO A;  1B50 A;  4EQ5 A;  2VZA A;  3B6Y A;  1VQ6 A;  1KC8 C;  4LF8 L;  2EXD A;  3FEW X;  1CSP A;  4BXX H;  5LL6 X;  2JA8 B;  1WI5 A;  2PO4 A;  2JEB I;  1LTG D;  2I0Q A;  1GUT A;  3MEH A;  4V0B A;  4K8I A;  4DK1 A;  4YY3 L;  4KY5 A;  4JI1 L;  3HOZ G;  4DXG A;  4RMF A;  3NP8 A;  1U9R A;  4Y7N H;  3J81 i;  3QOL A;  4KKS A;  4POF A;  4UAI A;  5IGE A;  2TMP A;  5CV6 A;  2F4I A;  2YV5 A;  5IP7 G;  3JAM L;  3MXP A;  1CUK A;  1SJH D;  2F0W A;  2IX0 A;  2WAQ B;  1B9N A;  1E2W A;  4I65 A;  3ZYY X;  4DUY L;  5IGG A;  1Q12 A;  1ESR A;  1IBK L;  2WV6 D;  1JOR A;  3NUC A;  4UPA A;  3PIP 3;  4M8A A;  2XNA C;  4JI7 Q;  2IT1 A;  4KD4 A;  2HIV A;  1QVF A;  3GD7 A;  3QJY A;  2LSS A;  4DK3 C;  1HNW L;  1FJG Q;  1HHV A;  4JCV E;  4YHH Q;  3RZO B;  2Z6K A;  1I4P A;  2L55 A;  3W3A A;  1S4Z A;  3GTG B;  4MN3 A;  3L9A X;  2N55 A;  2Q2I A;  2KA7 A;  5EJW A;  1NMG A;  3KLW A;  2NVQ B;  2GVA A;  2NVX B;  2NVT H;  4GN3 B;  4IFD I;  3MTS A;  1SNM A;  5ELD A;  4KY7 A;  4A3F H;  1Q81 C;  3M9B A;  3D31 A;  2EYJ A;  3HOX H;  3WOE A;  4KY6 A;  1X3P A;  1PFB A;  2Z9H A;  3KBG A;  2C35 B;  1EWC A;  2SNS A;  3OSO A;  4DU9 A;  2QDL A;  3S1N B;  4B9X A;  1V1Q A;  2JA6 H;  1Y1V G;  2OXP A;  3OOC A;  4PZ6 A;  1MSH A;  5COR A;  4A3K H;  4ZK9 B;  2TSS A;  1XMO Q;  3OTO Q;  1G8Z D;  1VQN A;  1YVC A;  4FYD A;  1K3R A;  2DJF C;  3TP7 A;  2Y0S E;  1LAB A;  2GA4 B;  2QKI C;  3I8Z A;  1JB7 A;  4AIM A;  2SEB D;  1TWC B;  1YHQ A;  1X3G A;  4A76 A;  4IAL A;  1IL8 A;  2RDH A;  5IP9 H;  1EUJ A;  1OXU A;  4A3C G;  1BBX C;  4FXD A;  1PH1 A;  2NVY B;  2CHB D;  2Y0S B;  4I7Z C;  3S14 H;  4DV4 L;  1QE6 A;  1VQD A;  5CV4 A;  1VQH A;  1CT1 D;  2EE1 A;  1DOL A;  1JE4 A;  1TWF B;  4CKB A;  4KJO A;  1KTK A;  2A68 D;  3DWA A;  4LMQ D;  3K7U C;  3J81 L;  3T4A C;  1IYV A;  1LTA D;  4J8Q A;  1RCV D;  4A3I B;  5LMN L;  4C1N K;  4GLX A;  1PH2 A;  1OXS C;  3AYH B;  2NUC A;  2IJ0 A;  2PMZ B;  1PTO B;  3M7N A;  3FKI B;  2KEC A;  1AFP A;  1PV4 A;  2ATW A;  4L5T A;  4E6I A;  2OCE A;  1A15 A;  4RGT A;  1S5C D;  5EAY A;  4OGQ C;  1T9H A;  3TN2 A;  3AU7 A;  2HDL A;  4KHP Q;  3GP7 A;  2XSC A;  4C3J H;  4OWX B;  4KMU C;  4YCW A;  1MKH A;  2ES2 A;  4ZYS A;  2LXK A;  2RCN A;  4A3L H;  2Q2H A;  5DAU A;  4L8J A;  3EA6 A;  1R9T B;  3SVM A;  2RDF A;  1KHI A;  5HUR A;  1G91 A;  1CZG A;  1RIP A;  4A4I A;  3PGZ A;  2ZXR A;  3I70 A;  2J4X A;  5ELF A;  5ELC A;  1CHQ D;  4C3I G;  1N32 Q;  2R93 B;  5J22 A;  3MFG A;  2MGS A;  5GAH C;  5LMU Q;  2F0V A;  1Q1E A;  3IL8 A;  5A35 A;  1YHB A;  4J15 A;  1K3B C;  4DR3 Q;  4DV3 L;  1E24 A;  2KCC A;  1PYS B;  4IFD H;  1ML0 D;  2K6A A;  4LK1 C;  3BZD B;  4LF5 Q;  1LM0 A;  4F88 A;  3BZC A;  1CKO A;  4BBS H;  4WJ4 A;  3HEJ A;  1AE2 A;  2WB1 B;  5CYU A;  4B3T Q;  5JJZ A;  3PUV A;  3KOJ A;  3RZD B;  4ME5 A;  4R4O A;  2HQE A;  2D5D A;  1QJO A;  2F0P A;  4IUT A;  1HZA A;  3V2T A;  1AEX A;  4L63 B;  3AFP A;  3PMF A;  2PQA B;  3A5Z B;  1OO9 B;  2K50 A;  4JW0 A;  4IZ8 A;  4RKB A;  1SBB B;  1QOH A;  3VA5 A;  1KRS A;  1EYA A;  1TWF H;  3LGJ A;  5C44 B;  2HD3 A;  1N33 Q;  5EKL A;  1EZ6 A;  1CHP D;  3J80 E;  4FXG C;  1J9O A;  4DV6 L;  1ZYR D;  3G6J B;  3TS0 A;  2M9V A;  3MWY W;  2IHE A;  3PV0 A;  1IW7 C;  2PNR C;  1KLU D;  2F0I A;  4L6T B;  1P16 A;  3K80 C;  1K83 B;  1XPR A;  1I6V C;  4IJH A;  1GHJ A;  1NUC A;  4PV1 C;  5D14 A;  4NKL A;  4R4Q A;  4P75 A;  4N9T A;  1PZK D;  4HMI A;  4A75 A;  3S9W A;  4DR1 Q;  1WYD A;  2F1M A;  4C3H B;  1STG A;  1HQR D;  1FNW A;  4DAP A;  4GNX B;  1I3Q B;  1A62 A;  3I2Z A;  3PIO 3;  5M5X H;  1K28 A;  4FDB A;  5CMD A;  5KIX A;  3QOJ A;  2BOS A;  2B39 A;  1P8L A;  1IBL Q;  1MJE A;  4HSP A;  5A2Q L;  5JPM C;  4EX5 A;  2FXQ A;  4HR7 B;  2E2H H;  4DR7 Q;  4Q5V A;  2UUB L;  1I50 H;  3ULP A;  1S3O A;  2HIX A;  4P73 A;  1W2B A;  1STE A;  1AE3 A;  3TQY A;  4JC0 A;  4X66 Q;  1VQ9 A;  1VQG A;  4XTC S;  5EKK A;  2D0O A;  3M7G A;  1WTP A;  4R4C A;  3S2H B;  1O7I A;  1PH7 A;  2B63 G;  4KD3 A;  4WOR A;  5KNB A;  4A3D B;  1G29 1;  1HZB A;  1J6Q A;  5IYD H;  5FO8 B;  4IPG A;  3U4V A;  4LF7 Q;  3EVQ A;  2CVR A;  1I4X A;  2B2W A;  2JA5 G;  2A69 C;  2L12 A;  4B08 A;  3SGI A;  1D7Q A;  2F0G A;  2AWO A;  1HXY D;  3OYY A;  4A3G H;  3ERS X;  5JVH 3;  3GTP H;  3S15 B;  4R4T A;  1GUG A;  4JYA L;  2E2I H;  3NEN A;  2F0M A;  1UE1 A;  1R4Q B;  1A0I A;  2F0N A;  3OIP A;  3L3O C;  3TP5 A;  3ULJ A;  1QIL A;  4LUZ A;  3MXN B;  4RAU C;  3OWF A;  4K0K L;  3IRB A;  3H0G B;  1EY5 A;  1JMC A;  1NTG A;  3HRZ C;  2VUM H;  2KBN A;  2PZW A;  5FJ8 H;  1BCP B;  1GD7 A;  2LFN A;  3PIP A;  2JP1 A;  3RLF A;  5IYD G;  3GDE A;  4A3M G;  3M3Y H;  3HOU B;  1JJ2 A;  4IOA A;  4LFA Q;  1V1P B;  3HOW B;  4GKK Q;  4QF4 A;  1Q46 A;  3OW2 A;  2MO1 A;  2R7F A;  2CW0 D;  3BVZ A;  4GN4 B;  4BY7 B;  4JK1 C;  1JR0 D;  4CDE C;  3FRP B;  3RUZ A;  2F3V A;  4DV1 Q;  4A3G G;  1DD2 A;  1EY7 A;  2PZT A;  1Y8P B;  1QZG A;  5JJL A;  2E5L Q;  1L2F A;  2JA7 B;  3T51 B;  4DGZ A;  4GLA C;  2C5C A;  4RFB A;  3MA2 B;  1PZI D;  1IHZ A;  2HQL A;  3RMH A;  1ROD A;  1RL2 A;  1XTC D;  5E1F A;  1FGU A;  1UUP A;  2ZXP A;  2EOT A;  3OWE B;  1LT3 D;  3GTK H;  1IXR A;  1QWY A;  2K1B A;  1FD7 D;  4QB4 A;  4TQU S;  1Q8I A;  4LF9 L;  3I4N G;  1O7Y A;  3K57 A;  1WD1 A;  2RF4 A;  3E3X A;  1HNZ L;  1RTO A;  3QB3 A;  4UP7 A;  2NTT A;  2VW9 A;  1GJX A;  1HTL D;  3GQB A;  2R92 B;  2QDB A;  2KEN A;  3CCV A;  4DK0 A;  3WWV A;  4Z9C B;  1E1T A;  2YTX A;  2ENB A;  1C4Q A;  3KF8 A;  2ICE C;  4N8X 1;  5BR8 Q;  3S24 A;  1Z47 A;  2EJF C;  5ELE A;  1QNK A;  4GOP B;  1Z6H A;  5C3E H;  1WCM G;  4R9W A;  4APV A;  3VDY A;  4K5X A;  5KEE A;  3ULL A;  1H9J A;  4BY1 H;  4JI0 L;  4IUN A;  5IGD A;  1TY0 A;  2DGY A;  5FO7 B;  4A3J B;  1HH2 P;  2E8G A;  1EY9 A;  4RGO S;  2X6G A;  5NUC A;  4P72 A;  1VQK A;  5C4J B;  1SRO A;  4RCN A;  3SK8 A;  4K2L A;  1CKN B;  1E0B A;  2ZJP A;  3SR1 A;  3MEF A;  3J80 c;  3HOZ B;  1LLR D;  2A6H D;  5M5Y H;  3W2D A;  4CKC A;  1LTT D;  5M3F B;  4C56 C;  4A93 G;  1KDC A;  3H3V I;  4ODG A;  2PQA A;  1PFN A;  2FHT A;  5KRU A;  2NBF A;  1UE7 A;  4JI8 Q;  1A63 A;  3O13 A;  4DR6 L;  1YEZ A;  1XJV A;  5KGU A;  2F0K A;  3HFZ B;  2AKW B;  2Z0S A;  4HCS A;  1IBM Q;  2EYL A;  1SRU A;  2E2J H;  2JA7 H;  4A3E G;  3AQQ A;  1HUM A;  4DAY B;  4IN3 A;  1FL0 A;  3SEB A;  2K28 A;  5G3L D;  3HG9 A;  2L11 A;  2E74 C;  1HR0 W;  4N9P A;  1EY0 A;  1SMX A;  5I4D A;  1ENF A;  4P74 A;  1F9S A;  2Z1C A;  5IYC H;  1L0Y B;  3NBH B;  2UXD L;  5M3M G;  3PF5 A;  3CU7 A;  3S1M H;  3PO2 G;  1ENA A;  1TII D;  3VR2 A;  2Q8I B;  4RHR A;  4GNX A;  1X3Q A;  3A8J E;  1NY4 A;  3FVQ A;  5CV7 A;  1EWH A;  1SNQ A;  5AJ3 L;  4Y7N B;  2EYP A;  3PUY A;  4LFC L;  4Q0F A;  4LF4 Q;  1K73 C;  2R7Z H;  2UUC Q;  2ID0 A;  2DNE A;  1VQJ A;  2HUG A;  4QGU A;  2D0P A;  1SE3 A;  2UU9 Q;  3VR4 A;  1JC7 A;  1S5D D;  3A7L A;  1YNJ D;  2J0T D;  3W1B A;  2DJG C;  2EYH A;  2FFK B;  2PZU A;  4YWK A;  2Z4H A;  1EL0 A;  1VQC A;  1LTB D;  2OTL A;  1VQ8 A;  1B1Z A;  1XMQ Q;  3TRZ A;  1WVL A;  1HNX Q;  4FF1 A;  1E22 A;  1M1K C;  2PCF B;  5IWA Q;  3ER0 A;  3U4Z A;  2PQE A;  1EIF A;  3J80 L;  3NE5 B;  1WTO A;  5FLM G;  4DAM A;  3G4S A;  1H95 A;  3M4O H;  1SFO H;  4IUR A;  3HOZ H;  3NEL A;  4B3M Q;  3C1F A;  3F2B A;  3I3C A;  1H9R A;  2NVT B;  2CH4 W;  5IYB G;  1W3S A;  2JJQ A;  2WFW A;  4A3F B;  5IP7 H;  4KTA A;  4ZLT F;  4POG A;  5L37 A;  4DV0 Q;  2HCI A;  3HOX B;  2L4N A;  3DEO A;  3UDF A;  2QIL A;  3MXN A;  1K9M C;  5JPN C;  1QZH A;  1A2T A;  3TRE A;  1FYC A;  3H3V H;  4CDD C;  3K7A H;  4YCV A;  5CV9 A;  1HTP A;  2JA6 B;  2HCC A;  2JE6 I;  3G71 A;  4AQY L;  1L1O B;  1V1P A;  4A3K B;  2EXZ A;  1PTO D;  2YYZ A;  3DHQ A;  4H7B A;  3CCM A;  2NN6 G;  1JWU D;  3TP6 A;  1PH9 A;  3PO3 G;  3QWN A;  3UE0 A;  4HIK A;  2KOL A;  4B3R L;  1Y1W G;  5GRO A;  3N52 A;  2F0T A;  5AFW A;  1BO0 A;  1G51 A;  3AFQ A;  3VR5 A;  3K81 C;  5M5W H;  3KDF B;  3PUX A;  1LV9 A;  3S14 B;  4R4I A;  1YI2 A;  4AYB G;  2C9O A;  2JN4 A;  4O42 A;  2EYM A;  4DR4 Q;  2ZT9 C;  1D1I A;  4XDX A;  2F0H A;  1JOQ A;  1Y8O B;  3T1H Q;  1NSN S;  2JEA I;  2E2D C;  4ZUI A;  1QG7 A;  3S1R H;  5G3L F;  1DXM A;  4TVA B;  4OON A;  2VQF L;  1WTW A;  4A3B G;  1Q3L A;  4H02 A;  4ZAI A;  3CXC A;  4NXM L;  1I94 L;  4JV5 Q;  2QW7 A;  1Y1V H;  3LX0 A;  1HR0 Q;  1HFN A;  3GV6 A;  2D9U A;  1CZW A;  1C48 A;  4KHZ A;  1SYF A;  1WTQ A;  2DUD A;  4M1U B;  4KN7 C;  4PZ8 A;  4C3J B;  5C4X G;  2VQE L;  1CTM A;  4R1J A;  1AZP A;  3V05 A;  1HQM C;  2B2V A;  3NWS A;  4JI5 Q;  1A3U A;  4A3C H;  3J7A V;  1J5E L;  1HZ9 A;  3I91 A;  3EFX D;  3S2D H;  4ZKC B;  2IY5 B;  1H9M A;  2XWB B;  3D4D A;  4X64 L;  4GOP A;  2I5L X;  4CDC C;  2HHH Q;  1EY4 A;  5C4Z A;  2Q2T A;  4IUU A;  3GTQ H;  1SJE D;  4KHV A;  4DR2 Q;  2O5I C;  2XGT A;  1Q82 C;  4DV7 L;  3T1Y Q;  1SYB A;  4JI4 L;  1CKN A;  1EQV A;  1AW7 A;  2CQO A;  4BBS B;  2PW5 A;  4BA2 I;  3GO5 A;  2PPB C;  4IPH A;  1YHA A;  1T5E A;  2SOB A;  1X3F A;  3C3L A;  5I6W A;  1WTR A;  1BF4 A;  1M90 C;  3BG3 A;  3OIQ A;  3WDN A;  3TSS A;  2JYO A;  1K8G A;  3NQT A;  2QA4 A;  1DGS A;  2O2L D;  3I4M G;  4PNY A;  4FO2 A;  1JCK B;  3H09 A;  2UXC Q;  2D2C C;  2IWH A;  2KHJ A;  5E4X A;  4RWS C;  3HKS A;  4ULL A;  1VDZ A;  4C3I H;  2KUM A;  5CBA E;  5LMN W;  1A6X A;  2B2Y A;  1KIX A;  3HS0 C;  1TVX A;  4EQP A;  1Y8N B;  1CK1 A;  2K5N A;  4G4K A;  2B63 B;  2G5D A;  1U4L A;  5I9O A;  3S17 H;  1G6Z A;  4DK6 C;  3NBH A;  4XIG S;  2F52 A;  2X69 A;  4FXK C;  4LF8 Q;  1JWM D;  3M85 A;  2K04 A;  5IGB A;  5ISR A;  3F1Z A;  5D3I B;  1PTO F;  2DY8 A;  4G7O C;  3DWP A;  2ZTE A;  2B8G A;  3BDC A;  3SK4 A;  4YY3 Q;  4JI1 Q;  5CBE E;  2LY7 A;  2B8F A;  5I9P A;  5C0X H;  2L0C A;  2MFI A;  3URY A;  2K5V A;  2YU9 H;  5M5X B;  1K8A C;  5HGQ A;  1GUN A;  4K6L A;  1F9Q A;  2R6G A;  2ZJR A;  1PYB A;  2RKS A;  3NHH A;  1F9R A;  5JEA G;  1H9S B;  1Y69 U;  1PXU A;  2E2H B;  1O7L A;  3RR5 A;  1B3A A;  1I50 B;  5FO9 B;  1VS0 A;  2DY7 A;  1IBK Q;  4HID A;  2JA8 G;  4B3S L;  1KDA A;  2SNM A;  1STN A;  5LHY 1;  2VL6 A;  1BBW A;  1N36 L;  2L1B A;  4P71 A;  5K5P A;  3FHW A;  1B70 B;  1QUQ B;  1HNW Q;  1FNU A;  2O4X A;  4RKL A;  5EBD A;  3HOY G;  2ALY B;  1BCP D;  1II3 A;  3MHB A;  2WAQ G;  2ZM6 L;  5KND A;  3I4L A;  5C0X G;  4JBK A;  1EIH A;  1XNR L;  4A3G B;  3VYU A;  4WFN 3;  4HJA A;  4HSV A;  3R8B A;  3OMG A;  3I55 A;  3GTP B;  1F2M A;  1DON A;  4HTH A;  1YIT A;  2E2I B;  1GKH A;  4XYO A;  1OTC A;  4ABN A;  3CAM A;  5FKA C;  2UXB L;  2BA1 A;  3HOV G;  3NXW A;  2K5W A;  1EYG A;  2AQ1 B;  1VQO A;  1EYD A;  1MSG A;  2Q8T A;  1ZYR C;  2F4V L;  4DV5 L;  4LF6 L;  2VUM B;  3I90 A;  1OXT A;  2OF1 A;  4JI2 L;  1L1O A;  1EY8 A;  5C6A A;  2B63 H;  1JT8 A;  1S5E D;  3M3Y B;  3K5N A;  4XXE A;  4O2D A;  3KLR A;  4OO1 G;  1F9P A;  3HKZ G;  2UUA L;  4EQO A;  2OQK A;  5C5L A;  5LL6 S;  4JI6 L;  5IT9 E;  1ESF A;  2JA5 H;  3J7A 5;  2LS0 1;  2Z6K C;  2NZ1 D;  3LNN A;  1DM0 B;  3KLS X;  3GTM H;  1N34 Q;  2A73 B;  1VQ7 A;  3DEP A;  4DV4 Q;  1VCI A;  4MTK A;  3TZD A;  3FP9 A;  4CJ1 B;  1EOT A;  1N9W A;  3STB D;  4DR5 L;  2L9H A;  4X3K A;  5LMN Q;  3GTK B;  3I4O A;  1EZ8 A;  3NWT A;  3K8A A;  1E3P A;  4LFB L;  2A6E D;  2PI2 E;  4HJ5 A;  2GN5 A;  2EY5 A;  4A3M H;  4DNI A;  1TQO A;  1VQ5 A;  1XYI A;  2WKD A;  1JJC B;  1WTH A;  1X32 A;  1ICF B;  2OQ0 A;  4ME3 A;  5BN3 A;  1JB3 A;  3L2P A;  1BDO A;  3H3V C;  1JWS D;  2F0F A;  1K8O A;  4JVZ A;  2BH8 A;  1QVG A;  1QNU A;  1TKW B;  1B4O A;  1KLG D;  3E0E A;  1SYC A;  4A3I G;  1B7Y B;  1D5X C;  2IW3 A;  4CJ0 B;  1ASZ A;  2PW7 A;  3FKI G;  2ASB A;  3NTK A;  3R2I A;  1XPU A;  1LT4 D;  5C3E B;  5D3D A;  1MBY A;  3U9S A;  4AH6 A;  3ERQ A;  3MZ5 A;  4BY1 B;  4JBJ A;  1GOZ A;  2F0D A;  2Z8L A;  3NPP A;  1GO3 E;  3A56 A;  1SE4 A;  5CC4 A;  4DV3 Q;  4MNO A;  1V43 A;  3TME A;  3N6R A;  1WD0 A;  3I4N H;  4QUF A;  4PMB A;  3I56 A;  2MPM A;  3SXH A;  2CW0 C;  5C4H A;  5M5Y B;  4FF3 A;  2AHO B;  5IGF A;  2WAC A;  1YNN D;  3GTJ H;  3CPF A;  2R93 G;  3M4P A;  2ZTC A;  4MTN A;  1HCZ A;  3PUZ A;  1VMC A;  2NZH A;  1UAP A;  1TWA H;  4K5V A;  5T1I A;  1WTX A;  4OX9 L;  1DCZ A;  5I6Y A;  2K05 A;  4R8I A;  2BE5 D;  2K5H A;  2E2J B;  3V96 A;  1STY A;  3GTL H;  4ZQ3 A;  2AQ2 B;  2B2T A;  1WCM H;  3A8K E;  3DUZ A;  3KYH C;  3A54 A;  1LTL A;  2FIN B;  2WB1 G;  2Z4I A;  4I7A A;  2XVS A;  5FK9 C;  1U4R A;  4S3S A;  4TSS A;  4DV6 Q;  1EQT A;  3QR8 A;  1KXL A;  3KK7 A;  2E75 C;  2JQO A;  1HUN A;  1RTN A;  1TS2 A;  1DOK A;  3E6Z X;  4DF7 A;  2AUJ D;  1W6J A;  2KHI A;  3PF4 A;  3S1M B;  5DM7 3;  3CF5 A;  4PZ7 A;  2B29 A;  2RVL A;  2WII B;  2KEE A;  4A93 H;  4YWL A;  5COY A;  2EJM A;  3A7A B;  5C44 G;  2BCO A;  2R7Z B;  1SNC A;  1SNO A;  2R61 A;  3SE0 A;  4NMZ A;  1H9S A;  1I4R A;  3UI2 A;  3J81 j;  4X62 L;  1XMQ L;  1VF7 A;  1PLF A;  4NPS A;  1MJC A;  3TZU A;  5EQ0 A;  2NN6 I;  3FPU B;  4DUZ L;  4A3E H;  2UUB Q;  4CHT B;  1UE5 A;  1Q90 A;  2CCZ A;  3J80 i;  4JBW A;  3PUW A;  4QCL A;  4DNR B;  4C3H G;  2Q8R E;  1QUQ A;  2F03 A;  4GLV B;  1WOC A;  1YBY A;  3WOF A;  3J81 E;  3CRK C;  2F0Q A;  3HZX A;  2V4D A;  1PRT D;  4NXN L;  4DV2 L;  3F2D A;  3PO3 B;  1TS3 A;  5M3M H;  1STB A;  1YNX A;  4AYB E;  4C2M H;  3PO2 H;  1XNQ L;  5EGT A;  3M4O B;  1SFO B;  3GTO H;  4X65 L;  5EPL A;  5JEA J;  3ND9 A;  1EY6 A;  3EJI A;  1WFQ A;  1H9K A;  4B9W A;  3CPW A;  4AYB B;  2XN9 C;  3KFU A;  2OWO A;  5IT9 c;  2AUK A;  1LT5 D;  1U4P A;  1FR3 A;  5EKI A;  4JYA Q;  3H6M A;  1BBU A;  4A3D G;  2EYO A;  2F0S A;  3HP3 A;  1GUS A;  4C1N I;  1AH9 A;  2N8N A;  3AMU A;  1GM5 A;  3BVG A;  3K7A B;  4BBR G;  3CD6 A;  5KYL A;  4K0K Q;  1PVO A;  2QEX A;  1X65 A;  1TR5 A;  3R3O A;  3G7L A;  3Q6S A;  3D6W A;  2JK8 A;  2FMM A;  2MQH A;  3PSI A;  4QMG A;  4DN4 M;  5JVG 3;  1K8M A;  1TS5 A;  4IUP A;  3T56 B;  2EY2 A;  5C0X J;  1SR3 A;  3NBI A;  2MHV A;  3S16 B;  4QIW E;  2VB2 X;  3EBE A;  5FLM H;  1RKN A;  1S5F D;  1JE5 A;  2N88 A;  2Q2U A;  3FMC A;  3J7Y W;  5M5W B;  4HIM A;  1X54 A;  4JI7 L;  2B2W C;  2N78 A;  2QF7 A;  3A0J A;  4QIW B;  5IYB H;  2V1C C;  4QUC A;  1TWG H;  3H0G G;  2B2U C;  4J1M A;  5I2Y A;  1YNJ C;  1IKM A;  3I73 A;  1EIG A;  1HA6 A;  5M9O A;  1FJG L;  3HOU G;  4YHH L;  4DNT B;  1Z7T A;  4H44 C;  1B9M A;  4TRD A;  3S1R B;  3CME A;  3HOW G;  1TWH H;  1TU2 B;  4UHV A;  1VQE A;  1YJW A;  1GUW A;  4U67 3;  3CCR A;  3ITP A;  3P20 A;  2MUY A;  1Y1V B;  3JAM c;  1I6H H;  3MXG A;  5JJI A;  1OXX K;  4BY7 G;  3BS1 A;  2IL8 A;  3KUP A;  4LF9 Q;  3H91 A;  4V19 0;  2EIF A;  4N8F A;  3C2P A;  2A8V A;  1V9P A;  1G2T A;  4PMC A;  2NN6 H;  2PI2 A;  3PO3 H;  4IUV A;  1HNZ Q;  2L5T A;  2N49 A;  1SMY D;  1Y1W H;  4NP5 A;  5DLQ E;  2NTS A;  3IFD A;  4DXF A;  3K5L A;  3S1Q H;  3VR6 A;  1YIJ A;  1M4V A;  3K5O A;  5DNF A;  3S2D B;  1Y14 B;  5BN4 A;  1I4H A;  4FF2 A;  3E0J A;  2EZV A;  4HCE A;  1JOO A;  3P7J A;  3GTQ B;  2VXW A;  4G57 A;  1KAA A;  1KAB A;  1BNZ A;  5CGK A;  1CM9 A;  1L0W A;  3PIO A;  2MO0 A;  3BVM A;  1XMO L;  1D6E C;  2DN8 A;  3OTO L;  4JI0 Q;  3QG1 A;  1DZ1 A;  2LXJ A;  3NK9 A;  1VQP A;  4A3B H;  3MFY A;  1PTO C;  3BDL A;  1UEB A;  1MD2 D;  3AEV A;  2R92 G;  1ENC A;  2RDG A;  2AQ3 B;  3R2T A;  1GUO A;  1PRT F;  1PFM A;  4RGN A;  1ZEQ X;  5C4X H;  3DXJ C;  3S16 H;  2BA0 A;  1CQF A;  1PH6 A;  3SHL A;  2NYZ D;  3CQZ H;  2MP1 A;  1U5K A;  2I46 A;  2KHS A;  4K8J A;  2EYF A;  1D8L A;  4ILW A;  1XPO A;  4A3J G;  4DR6 Q;  2EJG C;  4DKA C;  1SND A;  1UE6 A;  1M8A A;  1I4Q A;  5CR3 A;  1KL9 A;  2KCN A;  5IGC A;  2BDO A;  1VMP A;  5BN5 A;  2XIW A;  3IFT A;  4C3I B;  1PH5 A;  1E1O A;  1SNP A;  4XT1 B;  5E7N A;  4KHP L;  1O7Z A;  1LUZ A;  1I5F A;  3A74 A;  2WAQ E;  1F2Z A;  4J6H A;  4DPG A;  1F2Y A;  5C0X I;  3S17 B;  1SYD A;  3C46 A;  4GKJ Q;  5EBC A;  2BDN A;  5K36 G;  4YIJ A;  1FNV A;  5M3F G;  2JXM B;  5C5M A;  3UDI A;  1S72 A;  3HOY B;  4QQB X;  2UXD Q;  2PNH A;  2VB3 X;  2K5Q A;  4R8N A;  4HAE A;  3J81 c;  5CV8 A;  5AJ3 Q;  1N32 L;  2YU9 B;  1MI2 A;  3UDG A;  4LFC Q;  3U58 A;  2WP8 J;  2K5D A;  5LMU L;  1X55 A;  3I72 A;  1FGB D;  2VY3 A;  4CGY B;  3I4M H;  4DR3 L;  4JI3 Q;  4WJ3 M;  4IO9 A;  5TSS A;  3HOV B;  4LF5 L;  2HDM A;  2O5J C;  1HRJ A;  1ASY A;  1NR2 A;  2K52 A;  3G48 A;  3CP0 A;  4OO1 I;  4JOI C;  4BXX G;  2L15 A;  1CA6 A;  3VR3 A;  1LYL A;  3HKZ E;  4CJ2 C;  4B3T L;  1V8Q A;  2K03 A;  4YWM A;  3F2U A;  4IPC A;  4KN4 C;  1LAC A;  2CQA A;  1IZ6 A;  1KNE A;  3FPP A;  5J39 A;  1F2L A;  1ZXT A;  2OT2 A;  3Q8D A;  1EFI D;  2RSN A;  2NZO A;  4LUO A;  3HKZ B;  2H4O A;  1RDP D;  3A8I E;  3CCS A;  2F0J A;  2JA9 A;  1BUV T;  4XYQ A;  4F8M A;  1RHP A;  2MNA A;  4GNX C;  1CKM A;  4GN5 A;  2K14 A;  2FJ2 A;  1N33 L;  3ZJY C;  4FVM A;  3KJP A;  2CKZ B;  2P5Z X;  1Z9F A;  1W6K A;  3RN2 A;  1VQB A;  2A68 C;  1CQV A;  4CBV A;  5JEA H;  4JBM A;  4XQQ A;  1TXY A;  4L5S A;  3Q23 A;  3OMC A;  3RLN A;  3VYR A;  4DAY A;  3E5S A;  3J7A F;  4LWC A;  1HA5 A;  1LT6 D;  2JA8 H;  1X9N A;  5IIF A;  4XT3 B;  5C3X A;  4DR1 L;  4O0A A;  1SYG A;  1B2T A;  5FLX E;  2CWA A;  1HFG A;  4FF4 A;  1N34 L;  1ZKO A;  3M4Q A;  4AQY Q;  1SAP A;  2KCM A;  2RSO A;  3VYS A;  5GAD C;  4RGM A;  1IBL L;  4A3F G;  3HOY H;  2GVB A;  4OEM B;  1C0A A;  2PMZ E;  3ERO A;  1CSQ A;  2R3Z A;  3SK5 A;  2DNC A;  4CKE A;  4EGV A;  3HOX G;  4DR7 L;  4B3R Q;  2JA5 B;  2QEJ C;  2D62 A;  1ONL A;  1SEB D;  3GTM B;  2VNU D;  3BJU A;  3CCE A;  1PA6 A;  1VQL A;  2QCP X;  4X66 L;  1E2V A;  1ET9 A;  4X3T A;  3MXU A;  4JG2 A;  4X3S A;  1BR9 A;  1T5X D;  2JA6 G;  1BXT A;  3HOV H;  3Q0A A;  1BVS A;  3K59 A;  4DUY Q;  4A3K G;  3QIA A;  2I07 B;  4HJ8 A;  4LF7 L;  3RZO H;  2RCF A;  3T16 A;  1RJT A;  1CFM A;  5IE8 A;  1SXT A;  3NEM A;  2VQF Q;  3GTG H;  5J3B A;  1NMF A;  3K0X A;  5IY0 A;  5IP9 G;  1EIY B;  4NXM Q;  4HJ9 A;  1HPC A;  1I94 Q;  3A5U A;  1X3E A;  1BCP C;  2EY6 A;  2NVQ H;  4A3M B;  2Z6B A;  1MGS A;  2NVX H;  4OO1 H;  4L5R C;  3KF8 B;  3T53 B;  5D65 A;  2VQE Q;  3A55 A;  3ND8 A;  1A3V A;  1S5B D;  3BZK A;  4K14 A;  4MZ9 A;  4IJL A;  1EQR A;  1TS4 A;  1L0X B;  3K5M A;  4Y52 H;  1J5E Q;  2WB1 E;  1UNS A;  5IOC A;  4X64 Q;  1O78 A;  3P1H A;  1KQS A;  1SE2 A;  1YJ9 A;  3S1N H;  4OWT B;  1TY2 A;  5EPK A;  4QJF A;  2JSO A;  3CCQ A;  1G2S A;  4LFA L;  3RD4 A;  3RN5 A;  4GKK L;  4C3J G;  1KRT A;  4GS3 A;  3UE1 A;  1Q1B A;  4DV7 Q;  2CFM A;  2QGQ A;  3ICE A;  2A74 C;  2G9H D;  4JI4 Q;  4A3L G;  1TWC H;  4IPD A;  1CA5 A;  4OHJ A;  4K5W A;  2WKC A;  3I4N B;  2LKV A;  1WTV A;  4BA1 I;  3CW2 C;  4DV1 L;  3R93 A;  3CKI B;  2NVY H;  4ZUJ A;  1C8C A;  1AZQ A;  2E5L L;  1D5Z C;  1Q86 C;  1G6P A;  5GQO A;  3K0Y A;  3U9O A;  3GTJ B;  2K01 A;  1VQ4 A;  1SN8 A;  4MHE A;  1EOV A;  3KDF A;  4BWG B;  1EWI A;  2B2V C;  3PCO B;  1TWA B;  4U68 A;  4OIK A;  5GAG C;  4A3I H;  4IFD G;  1TT2 A;  3F2C A;  1PTO H;  1PFS A;  3FKI H;  2RHQ B;  4ZCK A;  3GTL B;  3STB C;  4BBS G;  3DMU A;  1D5M C;  1WCM B;  4GOP C;  3EIV A;  4TKO B;  1IW7 D;  1A3T A;  4HN7 A;  1XWE A;  2A6E C;  1X56 A;  3G6E A;  2I5H A;  4LW1 A;  1GXD C;  2H1E A;  3D8G A;  2RBM A;  3PQI A;  1UWV A;  1EFW A;  3IAY A;  1LTS D;  2OTJ A;  3MC0 B;  1R9T H;  2SDF A;  3CC4 A;  3JC6 6;  4MIU A;  5HY6 A;  4WJW A;  5BR8 L;  2LMC B;  1WJJ A;  2Y0S G;  5T1G A;  5JJK A;  1C9O A;  5GAE C;  1I4G A;  3SDZ A;  3ONA B;  2F3W A;  4A93 B;  1B44 D;  2R93 H;  2RQX A;  1PH4 A;  4NB3 A;  3KF6 B;  3I7F A;  3NTH A;  4KI0 A;  3L7Z C;  2KCT A;  3TEH B;  4UP9 A;  2EQS A;  1K0R A;  1AN8 A;  2F0U A;  4H0L C;  3P75 A;  1PMR A;  1KNA A;  1NAP A;  1XXG A;  4A3E B;  4HJ7 A;  1YZ6 A;  2ZJQ A;  4BBR B;  1KAW A;  3E9I A;  4OXP A;  3DM1 A;  2R7D A;  3JAM E;  4B3S Q;  2ZTD A;  2B2Y C;  3AB9 A;  4LAA A;  1JIC A;  2M2L A;  1N36 Q;  2IX3 A;  1Q8K A;  2B2U A;  3RZD H;  1VQF A;  4LUV A;  2FMC A;  4EVO A;  3E9H A;  4JI8 L;  1NE3 A;  5M3M B;  2A69 D;  4EQN A;  3K58 A;  4C2M B;  1BQQ T;  5FLX c;  1SSO A;  3PO2 B;  2KVM A;  4KK7 A;  3GTO B;  5ELO A;  1IYU A;  1YNN C;  1MIU A;  1STH A;  2ZM6 Q;  4YCU A;  1IBM L;  1B8A A;  1BCP F;  1EEI D;  5J1Z A;  1IL2 A;  5JOB A;  3D4R A;  5C44 H;  1VQM A;  1XNR Q;  4HED A;  2WIN B;  4F87 A;  2F0O A;  2BE5 C;  2H5X A;  1AP0 A;  4X3U A;  4DAV A;  4UDU C;  3TS2 A;  4P2C B;  2UXB Q;  2NB0 A;  1K0S A;  3Q24 A;  3EN2 A;  1DJR D;  5KYI A;  1A8V A;  1K83 H;  2N3S A;  2F4V Q;  4DV5 Q;  1C7Y A;  4LF6 Q;  1LO5 D;  4C3H H;  1BOS A;  4L5Q A;  4JI2 Q;  4UY8 C;  4X6A H;  1U4M A;  2BH2 A;  1I3Q H;  4CDF C;  5DEH A;  1SYE A;  4LF4 L;  2K4K A;  3QO2 A;  4PMW A;  4XQJ A;  2UUC L;  3H94 A;  1D1K A;  2I5M X;  2ZXO A;  2UUA Q;  2K7V A;  2UU9 L;  3CCJ A;  4JI6 Q;  4RCO A;  2RA4 A; 
#chains in the Genus database with same CATH homology
 3X3M A;  1UEA B;  5EPJ A;  1RF2 D;  1TWG B;  4NDX A;  1LTR D;  1DOM A;  4ID6 A;  4KKU A;  1EYC A;  2X6L A;  2OEO A;  3TBI B;  2K33 A;  3D6C A;  1A2U A;  4K6D A;  1TWH B;  2EY1 A;  3KLS A;  1PYW D;  2IX1 A;  1PRT C;  1I6H B;  4PQX A;  2J7Z A;  2G9D A;  5KNC A;  5C3W A;  1SDF A;  2E76 C;  5HGT A;  5DM6 3;  1ILQ A;  2XRS D;  2A6H C;  5FLX L;  3D3R A;  3CHB D;  1Y1W B;  3OW7 A;  3LWE A;  1CI3 M;  1F77 A;  3NTI A;  3S1Q B;  3C1E A;  3TP8 A;  1QB5 D;  1STA A;  1GHK A;  1NR4 A;  1JQY D;  1ET6 A;  2KED A;  1QCB D;  4RA8 A;  5I2X A;  5IOD A;  1O80 A;  4KV6 A;  5E3F A;  2AWN A;  2EPB A;  2EVB A;  4A3B B;  2KJX A;  3K6O A;  3HGB A;  4DFA A;  3LWU A;  3BDO A;  1KDB A;  4FNF A;  5C4X B;  4K2K A;  1E2Z A;  4KKT A;  4ZKB B;  1J8I A;  3M4Y A;  3EQL C;  2F0L A;  3CQZ B;  4KJN A;  4WRD A;  5CV5 A;  1ICW A;  3TDQ A;  3IKJ A;  1RD9 D;  3BYT B;  5F2D A;  3NSW A;  4DA2 A;  4XQN A;  1NCV A;  3OHX C;  3KBX A;  2F0E A;  3DWQ A;  1EU4 A;  2PYK A;  1ILP A;  4F7X A;  3NQI A;  4IUQ A;  2IPK D;  4FP5 D;  4G7Z C;  3MAQ A;  4NW2 A;  4O1N A;  1R4P B;  4HMJ A;  1SMY C;  3D4W A;  3VYT A;  3BYY B;  2NWG A;  3Q22 A;  2A5H A;  3VA7 A;  3GV3 A;  4G7H C;  4IFD J;  3I4M B;  1JOK A;  3FDT A;  4GZY C;  4OIJ A;  4H13 C;  4RH6 A;  4LJZ C;  2K32 A;  3MVV A;  1EEF D;  5IT9 L;  1DYQ A;  2EDG A;  1OXV A;  2KQ3 A;  1B53 A;  5E4W C;  1D2B A;  1V1O A;  2B2T C;  3SK6 A;  4ZRZ A;  5A2Q E;  1XX8 A;  5K36 H;  5ELB A;  1IKL A;  5FOB B;  2MJ8 A;  1LTI D;  1PZJ D;  1VF5 C;  2XWJ B;  4BS9 A;  3OPO A;  3CRL C;  2M00 A;  4RHS A;  4IQZ A;  2XRQ D;  5JAV A;  1PDQ A;  4OL7 A;  3T13 A;  2ICI A;  1PRT B;  3X3N A;  1EU3 A;  1B50 A;  3FEW X;  5LL6 X;  2JA8 B;  2PO4 A;  2JEB I;  1LTG D;  1GUT A;  3MEH A;  4V0B A;  4K8I A;  4DK1 A;  4KY5 A;  4DXG A;  3NP8 A;  1U9R A;  3QOL A;  4KKS A;  5IGE A;  4UAI A;  2TMP A;  5CV6 A;  2F4I A;  3JAM L;  3MXP A;  1SJH D;  2F0W A;  2IX0 A;  2WAQ B;  1B9N A;  1E2W A;  4I65 A;  3ZYY X;  5IGG A;  1Q12 A;  1ESR A;  2WV6 D;  1JOR A;  3NUC A;  3PIP 3;  4M8A A;  2XNA C;  2IT1 A;  4KD4 A;  3GD7 A;  3QJY A;  1HHV A;  3RZO B;  1I4P A;  2L55 A;  3W3A A;  1S4Z A;  3GTG B;  4MN3 A;  3L9A X;  2N55 A;  2KA7 A;  5EJW A;  2NVQ B;  2NVX B;  4IFD I;  3MTS A;  5ELD A;  1SNM A;  4KY7 A;  3D31 A;  2EYJ A;  3WOE A;  4KY6 A;  1X3P A;  1PFB A;  3KBG A;  1EWC A;  2SNS A;  3OSO A;  4DU9 A;  3S1N B;  4B9X A;  2OXP A;  3OOC A;  1MSH A;  5COR A;  4ZK9 B;  2TSS A;  1G8Z D;  4FYD A;  3TP7 A;  1LAB A;  2GA4 B;  2QKI C;  3I8Z A;  2SEB D;  1TWC B;  4IAL A;  1IL8 A;  2RDH A;  1OXU A;  1BBX C;  4FXD A;  2NVY B;  2CHB D;  2Y0S B;  4I7Z C;  1QE6 A;  5CV4 A;  1CT1 D;  2EE1 A;  1DOL A;  1JE4 A;  1TWF B;  4CKB A;  4KJO A;  1KTK A;  2A68 D;  3DWA A;  4LMQ D;  3J81 L;  3T4A C;  1IYV A;  1LTA D;  4J8Q A;  1RCV D;  4A3I B;  4C1N K;  1OXS C;  2NUC A;  2IJ0 A;  2PMZ B;  1PTO B;  3M7N A;  3FKI B;  2KEC A;  1AFP A;  4E6I A;  1A15 A;  4RGT A;  1S5C D;  4OGQ C;  3TN2 A;  3AU7 A;  2HDL A;  3GP7 A;  2XSC A;  4KMU C;  4ZYS A;  5DAU A;  4L8J A;  3EA6 A;  1R9T B;  3SVM A;  2RDF A;  5HUR A;  1G91 A;  1CZG A;  2ZXR A;  3I70 A;  2J4X A;  5ELF A;  5ELC A;  1CHQ D;  4C3I G;  2R93 B;  5J22 A;  3MFG A;  2MGS A;  2F0V A;  1Q1E A;  3IL8 A;  5A35 A;  2KCC A;  4IFD H;  1ML0 D;  2K6A A;  4LK1 C;  3BZD B;  4F88 A;  3HEJ A;  2WB1 B;  5CYU A;  5JJZ A;  3PUV A;  3RZD B;  4ME5 A;  2HQE A;  2D5D A;  1QJO A;  2F0P A;  4IUT A;  3V2T A;  1AEX A;  4L63 B;  3PMF A;  1OO9 B;  4IZ8 A;  4RKB A;  1SBB B;  1QOH A;  3VA5 A;  1EYA A;  5C44 B;  5EKL A;  1EZ6 A;  1CHP D;  3J80 E;  4FXG C;  1J9O A;  1ZYR D;  3G6J B;  2M9V A;  3MWY W;  3PV0 A;  1IW7 C;  2PNR C;  1KLU D;  2F0I A;  4L6T B;  1K83 B;  1I6V C;  5D14 A;  1GHJ A;  1NUC A;  4PV1 C;  4NKL A;  4N9T A;  1PZK D;  4HMI A;  3S9W A;  2F1M A;  4C3H B;  1STG A;  1HQR D;  1FNW A;  4DAP A;  1I3Q B;  3PIO 3;  5KIX A;  5CMD A;  3QOJ A;  2BOS A;  2B39 A;  4HSP A;  5A2Q L;  5JPM C;  4HR7 B;  4Q5V A;  1STE A;  4XTC S;  5EKK A;  3M7G A;  1WTP A;  3S2H B;  4KD3 A;  4WOR A;  5KNB A;  4A3D B;  1G29 1;  5FO8 B;  3EVQ A;  2CVR A;  1I4X A;  2B2W A;  2A69 C;  2L12 A;  4B08 A;  2F0G A;  2AWO A;  1HXY D;  5JVH 3;  3S15 B;  1GUG A;  2F0M A;  1R4Q B;  2F0N A;  3OIP A;  3L3O C;  3TP5 A;  1QIL A;  4RAU C;  3OWF A;  3H0G B;  1EY5 A;  3HRZ C;  2PZW A;  1BCP B;  2LFN A;  2JP1 A;  3RLF A;  3HOU B;  1V1P B;  3HOW B;  4QF4 A;  2CW0 D;  3BVZ A;  4BY7 B;  4JK1 C;  1JR0 D;  3FRP B;  3RUZ A;  2F3V A;  1DD2 A;  1EY7 A;  2PZT A;  1Y8P B;  2JA7 B;  3T51 B;  4DGZ A;  2C5C A;  4RFB A;  3MA2 B;  1PZI D;  1IHZ A;  3RMH A;  1ROD A;  1XTC D;  5E1F A;  1UUP A;  2ZXP A;  2EOT A;  3OWE B;  1LT3 D;  1QWY A;  2K1B A;  1FD7 D;  4QB4 A;  4TQU S;  1Q8I A;  1O7Y A;  3K57 A;  1WD1 A;  1RTO A;  3QB3 A;  2NTT A;  1GJX A;  1HTL D;  3GQB A;  2R92 B;  2QDB A;  4DK0 A;  4Z9C B;  2ENB A;  1C4Q A;  3KF8 A;  2ICE C;  1Z47 A;  2EJF C;  5ELE A;  1QNK A;  1Z6H A;  4R9W A;  4K5X A;  5KEE A;  1H9J A;  4IUN A;  5IGD A;  1TY0 A;  5FO7 B;  4A3J B;  1EY9 A;  4RGO S;  2X6G A;  5NUC A;  5C4J B;  4RCN A;  3SK8 A;  4K2L A;  1E0B A;  3SR1 A;  3HOZ B;  1LLR D;  2A6H D;  3W2D A;  4CKC A;  1LTT D;  5M3F B;  4C56 C;  1KDC A;  4ODG A;  1PFN A;  2FHT A;  5KRU A;  2NBF A;  3O13 A;  5KGU A;  2F0K A;  4HCS A;  2EYL A;  1HUM A;  4IN3 A;  3SEB A;  2K28 A;  5G3L D;  3HG9 A;  2L11 A;  2E74 C;  4N9P A;  1EY0 A;  5I4D A;  1ENF A;  1F9S A;  2Z1C A;  1L0Y B;  3CU7 A;  1ENA A;  1TII D;  3VR2 A;  2Q8I B;  4RHR A;  1X3Q A;  3A8J E;  3FVQ A;  5CV7 A;  1EWH A;  1SNQ A;  4Y7N B;  2EYP A;  3PUY A;  4Q0F A;  2ID0 A;  2DNE A;  2HUG A;  1SE3 A;  3VR4 A;  1JC7 A;  1S5D D;  3A7L A;  1YNJ D;  2J0T D;  2EYH A;  2FFK B;  2PZU A;  2Z4H A;  1EL0 A;  1LTB D;  1B1Z A;  1WVL A;  4FF1 A;  2PCF B;  2PQE A;  3J80 L;  3NE5 B;  1WTO A;  4IUR A;  3C1F A;  3I3C A;  1H9R A;  2NVT B;  4A3F B;  4KTA A;  4ZLT F;  2HCI A;  3HOX B;  2L4N A;  3DEO A;  2QIL A;  3MXN A;  5JPN C;  1A2T A;  1FYC A;  5CV9 A;  1HTP A;  2JA6 B;  2HCC A;  2JE6 I;  1V1P A;  4A3K B;  2EXZ A;  1PTO D;  2YYZ A;  3DHQ A;  4H7B A;  2NN6 G;  1JWU D;  3TP6 A;  3QWN A;  2KOL A;  3N52 A;  5AFW A;  2F0T A;  1BO0 A;  3VR5 A;  3PUX A;  1LV9 A;  3S14 B;  2C9O A;  4O42 A;  2EYM A;  2ZT9 C;  1D1I A;  4XDX A;  2F0H A;  1JOQ A;  1Y8O B;  1NSN S;  2JEA I;  2E2D C;  4ZUI A;  1QG7 A;  5G3L F;  1DXM A;  1WTW A;  1Q3L A;  4ZAI A;  3LX0 A;  1HFN A;  3GV6 A;  2D9U A;  1CZW A;  1C48 A;  4KHZ A;  1SYF A;  1WTQ A;  4M1U B;  4KN7 C;  4C3J B;  1CTM A;  1AZP A;  3V05 A;  1HQM C;  2B2V A;  3NWS A;  1A3U A;  3J7A V;  3I91 A;  3EFX D;  4ZKC B;  1H9M A;  2XWB B;  3D4D A;  5C4Z A;  1EY4 A;  4IUU A;  1SJE D;  4KHV A;  2O5I C;  1SYB A;  1EQV A;  1AW7 A;  4BBS B;  2PW5 A;  4BA2 I;  3GO5 A;  2PPB C;  1T5E A;  2SOB A;  3C3L A;  5I6W A;  1WTR A;  1BF4 A;  3BG3 A;  3OIQ A;  3WDN A;  3TSS A;  2JYO A;  3NQT A;  2O2L D;  4PNY A;  4FO2 A;  1JCK B;  3H09 A;  2D2C C;  2IWH A;  5E4X A;  4RWS C;  4ULL A;  1VDZ A;  5CBA E;  2KUM A;  1A6X A;  2B2Y A;  3HS0 C;  1TVX A;  4EQP A;  1Y8N B;  1CK1 A;  2B63 B;  4G4K A;  1U4L A;  5I9O A;  1G6Z A;  3NBH A;  4XIG S;  2X69 A;  4FXK C;  1JWM D;  3M85 A;  2K04 A;  5IGB A;  5ISR A;  5D3I B;  1PTO F;  2DY8 A;  4G7O C;  3DWP A;  2B8G A;  3BDC A;  3SK4 A;  5CBE E;  2LY7 A;  2B8F A;  5I9P A;  5C0X H;  2L0C A;  3URY A;  5M5X B;  1GUN A;  4K6L A;  1F9Q A;  2R6G A;  2RKS A;  3NHH A;  1F9R A;  5JEA G;  1H9S B;  1Y69 U;  1PXU A;  2E2H B;  1O7L A;  1B3A A;  1I50 B;  5FO9 B;  2DY7 A;  1KDA A;  2SNM A;  1STN A;  5LHY 1;  2L1B A;  5K5P A;  1FNU A;  2O4X A;  4RKL A;  5EBD A;  1BCP D;  1II3 A;  3MHB A;  5KND A;  3I4L A;  5C0X G;  1EIH A;  4A3G B;  3VYU A;  4WFN 3;  4HSV A;  3R8B A;  3OMG A;  3GTP B;  1F2M A;  1DON A;  4HTH A;  2E2I B;  4XYO A;  4ABN A;  5FKA C;  2BA1 A;  3NXW A;  2K5W A;  2AQ1 B;  1EYD A;  1MSG A;  2Q8T A;  1ZYR C;  2VUM B;  3I90 A;  1OXT A;  2OF1 A;  1EY8 A;  5C6A A;  1S5E D;  3M3Y B;  3K5N A;  4XXE A;  3KLR A;  4OO1 G;  1F9P A;  4EQO A;  5C5L A;  5LL6 S;  5IT9 E;  1ESF A;  2LS0 1;  2NZ1 D;  3LNN A;  1DM0 B;  3KLS X;  2A73 B;  3DEP A;  1VCI A;  3TZD A;  4CJ1 B;  1EOT A;  2L9H A;  4X3K A;  3GTK B;  1EZ8 A;  3NWT A;  2A6E D;  2EY5 A;  1TQO A;  1XYI A;  2WKD A;  5BN3 A;  1X32 A;  1JB3 A;  1BDO A;  3H3V C;  1JWS D;  2F0F A;  1K8O A;  1QNU A;  1TKW B;  1B4O A;  1KLG D;  1SYC A;  1D5X C;  2IW3 A;  4CJ0 B;  2PW7 A;  3NTK A;  3R2I A;  1LT4 D;  5C3E B;  5D3D A;  1MBY A;  3U9S A;  3ERQ A;  3MZ5 A;  4BY1 B;  1GOZ A;  2F0D A;  2Z8L A;  3NPP A;  3A56 A;  1SE4 A;  5CC4 A;  1V43 A;  3TME A;  3N6R A;  1WD0 A;  4QUF A;  4PMB A;  2MPM A;  3SXH A;  2CW0 C;  5C4H A;  5M5Y B;  4FF3 A;  5IGF A;  2WAC A;  1YNN D;  1HCZ A;  3PUZ A;  1VMC A;  1UAP A;  5T1I A;  4K5V A;  1WTX A;  1DCZ A;  5I6Y A;  2K05 A;  4R8I A;  2BE5 D;  2E2J B;  3V96 A;  1STY A;  4ZQ3 A;  2AQ2 B;  2B2T A;  3A8K E;  3DUZ A;  3A54 A;  2FIN B;  2Z4I A;  2XVS A;  5FK9 C;  1U4R A;  4S3S A;  4TSS A;  1EQT A;  3KK7 A;  2E75 C;  1HUN A;  1RTN A;  1TS2 A;  1DOK A;  3E6Z X;  4DF7 A;  2AUJ D;  1W6J A;  3S1M B;  5DM7 3;  2RVL A;  2WII B;  2KEE A;  5COY A;  2EJM A;  3A7A B;  2BCO A;  2R7Z B;  1SNC A;  1SNO A;  2R61 A;  3SE0 A;  4NMZ A;  1H9S A;  1I4R A;  3UI2 A;  1VF7 A;  1PLF A;  3TZU A;  5EQ0 A;  2NN6 I;  3FPU B;  4CHT B;  1Q90 A;  4JBW A;  3PUW A;  4QCL A;  4DNR B;  4C3H G;  2Q8R E;  2F03 A;  3WOF A;  3J81 E;  3CRK C;  2F0Q A;  3HZX A;  2V4D A;  1PRT D;  3PO3 B;  1TS3 A;  1STB A;  5EGT A;  3M4O B;  1SFO B;  5EPL A;  5JEA J;  3ND9 A;  1EY6 A;  3EJI A;  1H9K A;  4B9W A;  4AYB B;  2XN9 C;  2AUK A;  1LT5 D;  1U4P A;  1FR3 A;  5EKI A;  3H6M A;  2EYO A;  2F0S A;  3HP3 A;  1GUS A;  4C1N I;  3AMU A;  3BVG A;  3K7A B;  5KYL A;  1TR5 A;  3R3O A;  3G7L A;  3Q6S A;  3D6W A;  2FMM A;  4QMG A;  4DN4 M;  5JVG 3;  1K8M A;  1TS5 A;  4IUP A;  3T56 B;  2EY2 A;  5C0X J;  3NBI A;  2MHV A;  3S16 B;  2VB2 X;  1RKN A;  1S5F D;  2N88 A;  3FMC A;  3J7Y W;  5M5W B;  2B2W C;  2QF7 A;  4QIW B;  4QUC A;  2B2U C;  4J1M A;  5I2Y A;  1YNJ C;  1IKM A;  3I73 A;  1EIG A;  1HA6 A;  5M9O A;  4DNT B;  1Z7T A;  4H44 C;  1B9M A;  4TRD A;  3S1R B;  1TU2 B;  1GUW A;  4U67 3;  3ITP A;  3P20 A;  2MUY A;  1Y1V B;  3MXG A;  1OXX K;  3BS1 A;  2IL8 A;  3KUP A;  3H91 A;  4V19 0;  3C2P A;  1G2T A;  4PMC A;  2NN6 H;  4IUV A;  2L5T A;  1SMY D;  4NP5 A;  2NTS A;  3IFD A;  4DXF A;  3K5L A;  3VR6 A;  1M4V A;  3K5O A;  5DNF A;  3S2D B;  5BN4 A;  1I4H A;  4FF2 A;  3E0J A;  2EZV A;  4HCE A;  1JOO A;  3P7J A;  3GTQ B;  2VXW A;  4G57 A;  1KAA A;  1KAB A;  1BNZ A;  5CGK A;  1CM9 A;  3BVM A;  1D6E C;  2DN8 A;  3QG1 A;  1DZ1 A;  3NK9 A;  3MFY A;  1PTO C;  3BDL A;  1MD2 D;  1ENC A;  2RDG A;  2AQ3 B;  3R2T A;  1GUO A;  1PRT F;  1PFM A;  4RGN A;  1ZEQ X;  3DXJ C;  2BA0 A;  1CQF A;  3SHL A;  2NYZ D;  2MP1 A;  2I46 A;  2KHS A;  4K8J A;  2EYF A;  4ILW A;  2EJG C;  1SND A;  1M8A A;  1I4Q A;  5CR3 A;  2KCN A;  5IGC A;  2BDO A;  1VMP A;  5BN5 A;  2XIW A;  3IFT A;  4C3I B;  1SNP A;  4XT1 B;  1O7Z A;  1F2Z A;  4J6H A;  1F2Y A;  5C0X I;  3S17 B;  1SYD A;  3C46 A;  5EBC A;  2BDN A;  5K36 G;  4YIJ A;  1FNV A;  2JXM B;  5C5M A;  3HOY B;  2VB3 X;  2K5Q A;  4R8N A;  4HAE A;  5CV8 A;  2YU9 B;  1MI2 A;  2WP8 J;  2K5D A;  3I72 A;  1FGB D;  4CGY B;  5TSS A;  3HOV B;  2HDM A;  2O5J C;  1HRJ A;  1NR2 A;  4OO1 I;  1CA6 A;  3VR3 A;  4CJ2 C;  1V8Q A;  2K03 A;  3F2U A;  4KN4 C;  1LAC A;  2CQA A;  1KNE A;  5J39 A;  3FPP A;  1F2L A;  1ZXT A;  2OT2 A;  1EFI D;  2RSN A;  3HKZ B;  2H4O A;  1RDP D;  3A8I E;  2F0J A;  1BUV T;  4XYQ A;  4F8M A;  1RHP A;  2FJ2 A;  4FVM A;  1W6K A;  2A68 C;  1CQV A;  4CBV A;  5JEA H;  4XQQ A;  3Q23 A;  3OMC A;  3VYR A;  4DAY A;  3E5S A;  3J7A F;  1HA5 A;  1LT6 D;  5IIF A;  4XT3 B;  5C3X A;  1SYG A;  1B2T A;  5FLX E;  1HFG A;  4FF4 A;  1ZKO A;  1SAP A;  2RSO A;  3VYS A;  4RGM A;  3ERO A;  2R3Z A;  3SK5 A;  2DNC A;  4CKE A;  4EGV A;  2JA5 B;  2QEJ C;  2D62 A;  1ONL A;  1SEB D;  3GTM B;  2VNU D;  2QCP X;  1E2V A;  1ET9 A;  4X3T A;  3MXU A;  4X3S A;  1BR9 A;  1T5X D;  1BXT A;  3Q0A A;  3K59 A;  3QIA A;  2I07 B;  3T16 A;  1RJT A;  1CFM A;  1SXT A;  1HPC A;  1BCP C;  2EY6 A;  4A3M B;  1MGS A;  4OO1 H;  3T53 B;  5D65 A;  3A55 A;  3ND8 A;  1A3V A;  1S5B D;  4K14 A;  1TS4 A;  1L0X B;  3K5M A;  1UNS A;  5IOC A;  1O78 A;  3P1H A;  1SE2 A;  1TY2 A;  5EPK A;  2JSO A;  1G2S A;  3RD4 A;  4C3J G;  1Q1B A;  2A74 C;  2G9H D;  1CA5 A;  4OHJ A;  4K5W A;  2WKC A;  3I4N B;  2LKV A;  1WTV A;  4BA1 I;  3R93 A;  3CKI B;  4ZUJ A;  1C8C A;  1AZQ A;  1D5Z C;  3K0Y A;  3U9O A;  3GTJ B;  2K01 A;  4MHE A;  4BWG B;  2B2V C;  1TWA B;  4U68 A;  4OIK A;  4IFD G;  1TT2 A;  1PTO H;  3GTL B;  3DMU A;  1D5M C;  1WCM B;  4TKO B;  1IW7 D;  1A3T A;  4HN7 A;  1XWE A;  2A6E C;  1GXD C;  2H1E A;  3D8G A;  2RBM A;  3IAY A;  1LTS D;  3MC0 B;  2SDF A;  4MIU A;  4WJW A;  2LMC B;  5T1G A;  1I4G A;  3SDZ A;  3ONA B;  2F3W A;  4A93 B;  1B44 D;  2RQX A;  3NTH A;  4KI0 A;  3L7Z C;  1AN8 A;  2F0U A;  4H0L C;  3P75 A;  1PMR A;  1KNA A;  1NAP A;  1XXG A;  4A3E B;  4BBR B;  3DM1 A;  3JAM E;  2B2Y C;  3AB9 A;  4LAA A;  1JIC A;  2M2L A;  2IX3 A;  2B2U A;  2FMC A;  4EVO A;  5M3M B;  2A69 D;  4EQN A;  3K58 A;  4C2M B;  1BQQ T;  3PO2 B;  1SSO A;  2KVM A;  4KK7 A;  3GTO B;  1IYU A;  1YNN C;  1STH A;  1BCP F;  1EEI D;  5J1Z A;  5JOB A;  3D4R A;  4HED A;  2WIN B;  4F87 A;  2F0O A;  2BE5 C;  1AP0 A;  4X3U A;  4DAV A;  4UDU C;  4P2C B;  2NB0 A;  3Q24 A;  1DJR D;  5KYI A;  1LO5 D;  1BOS A;  1U4M A;  5DEH A;  1SYE A;  3QO2 A;  4PMW A;  4XQJ A;  3H94 A;  1D1K A;  2ZXO A;  2K7V A;  4RCO A;  2RA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...