5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
4F8MA 4IALA 2SNSA 2LKVA 2F0IA 5CV6A 3RUZA 4B9XA 1A3UA 4R8NA 5ISRA 1SNMA 2EXZA 2F3WA 1TT2A 2F0VA 4KTAA 4EQNA 5EGTA 3EROA 1RKNA 3MXPA 3QOJA 5F2DA 1IHZA 2SNMA 4B9WA 4HMJA 3DHQA 4IZ8A 5CV8A 1JOOA 1STHA 3MZ5A 5EKKA 2F0KA 1A3VA 3D4DA 3NQTA 1AEXA 3E5SA 2F0MA 4K2KA 4EQOA 3S9WA 2F0WA 5J39A 4K6DA 3P75A 3NP8A 3SHLA 4K8JA 2RBMA 2EYMA 5IODA 4RKLA 5CV4A 5I6WA 2F0TA 1JOKA 3TP5A 5NUCA 1STYA 2F0HA 1SYFA 5IGFA 5J1ZA 3U9OA 5CV9A 1KDBA 1STNA 1A3TA 2KQ3A 3NXWA 5JAVA 4PNYA 2EY2A 2EY1A 1NUCA 1A2UA 4K5WA 2QDBA 4QF4A 5KRUA 1SNDA 3LX0A 4WRDA 2OEOA 5CV7A 4F7XA 5M9OA 5C3WA 3MEHA 5KEEA 1ENAA 1KABA 4KV6A 4DF7A 5IGEA 1TQOA 2M00A 4E6IA 4I65A 2O4XA 5CR3A 5C4HA 1SYEA 2WACA 5JOBA 4N9TA 1EY7A 4MIUA 5J22A 5HURA 3DMUA 1EZ6A 1TR5A 1A2TA 4K5VA 4PMCA 3TP8A 4DGZA 1JOQA 1NSNS 3TMEA 3TP7A 5C6AA 1EQVA 2NUCA 1STBA 3OWFA 4NP5A 3SK4A 2PZWA 1EY8A 3SK5A 3QOLA 1STGA 4ID6A 2F0NA 3P1HA 2OF1A 2SOBA 1SNQA 1II3A 1EZ8A 1EY4A 3BDLA 3H6MA 3SK8A 5KYIA 4ZUIA 4K2LA 4PMBA 2PW7A 5IIFA 5KIXA 5IGGA 5C5MA 3VA5A 2KHSA 3D4WA 5E1FA 1EY0A 5EKLA 3OMCA 5IOCA 4OL7A 1STAA 2ENBA 3BDCA 4WORA 3SK6A 1F2MA 3NK9A 2F0DA 4ZUJA 3PMFA 3T13A 5C5LA 4KJOA 2F0EA 3EJIA 4EVOA 3NUCA 2RDFA 3HZXA 2F3VA 4KD3A 4TRDA 4N9PA 1KDAA 2F0JA 2PW5A 3EVQA 4QMGA 1KAAA 1SYCA 3TP6A 3V2TA 3D6CA 1SNOA 4HTHA 2F0QA 4QB4A 2F0GA 5HGTA 4NDXA 2PZUA 1ENCA 1EY6A 2EY6A 3OSOA 4KY5A 2F0PA 4H7BA 4ODGA 4RKBA 1SNCA 2F0LA 2EYHA 1EYCA 3NHHA 5KGUA 1EYDA 2PZTA 2EYPA 5C3XA 5CV5A 5I9OA 4K14A 1U9RA 1F2YA 4KHVA 4NMZA 3SXHA 4EQPA 4LAAA 3SR1A 4NKLA 3HEJA 4DFAA 1JORA 3T16A 2EY5A 2HQEA 4KJNA 2EYLA 1SNPA 4K8IA 1EY5A 1EYAA 4KY6A 4S3SA 4ZQ3A 4DU9A 3MVVA 4K5XA 2PYKA 4KY7A 2EYFA 2F0SA 3ERQA 4ME5A 5I9PA 1EY9A 2EYOA 5IGDA 4IUNA 2F0UA 3C1EA 2F0FA 2F0OA 3OMGA 5C4ZA 2OXPA 4J1MA 5IGBA 1F2ZA 1SYGA 3QB3A 1KDCA 4HMIA 5DAUA 2PQEA 4G57A 3MHBA 5E3FA 3R3OA 5IGCA 4KD4A 2EYJA 1SYDA 5CC4A 5KYLA 5I6YA 2RKSA 3C1FA 5DEHA 3ITPA 4YIJA 1SYBA 4J6HA 5CGKA 3D8GA 5K5PA
chains in the Genus database with same CATH superfamily
1YHBA 3RUZA 1WCMH 4DV5Q 5D65A 2OTLA 4BXXH 2QEJC 2VZAA 4U673 4BY7B 1B4OA 3EBEA 1MIUA 3KJOA 4OWWB 1STHA 1B9MA 1G6PA 3D4DA 4TSSA 1KLGD 2MQHA 2F0MA 1K8MA 4DV1Q 3PUZA 3HOWH 5NUCA 3J7AF 1Y1VB 3MFYA 2XRQD 1GVPA 2G5DA 2KQ3A 1HR0L 3S1NH 4PNYA 4RFBA 4B3RL 2R7DA 3OYYA 1SNDA 1K0SA 1KNEA 3VYUA 2BH8A 4E6IA 2J0TD 4I65A 5GADC 2R92B 4A3JG 1JJGA 1H9MA 4GN5A 1HTLD 4ZYSA 1WTXA 2BOSA 2O2LD 2Z4HA 4ZK9B 1Z47A 1R4QB 4DV2Q 4IFDG 1B3QA 5J3BA 4DV4Q 1HCZA 2D5DA 1GHJA 4IUVA 3Q6SA 3HOUG 1FGBD 3HGBA 1JWSD 3IKJA 3VR5A 4LF6L 2Q2UA 4V190 3S24A 1H9RA 2E2IB 1XX8A 4RGMA 4Y7NH 4LF5L 2K1BA 4ZAIA 1PYWD 4GNXC 4DK3C 4LF9Q 4DKAC 3S15H 3DEOA 3L2PA 1A63A 2OQ0A 1CTMA 1B53A 2R93B 2WB1E 4N8FA 2PI2A 3Q0AA 4HSVA 1IYUA 5I9PA 4JI6Q 2DY8A 5EBDA 1YJNA 3GTKH 2VUMB 3HKZE 2PNHA 4RHRA 1BVSA 4A3FH 1YHAA 3HG9A 4FNFA 1BNZA 1OTCA 2JEBI 2B63H 4KHPQ 2ZJQA 2RA4A 1PH5A 2Y0SB 5ISRA 4JI3L 1SFOB 1VQMA 2F0VA 2HUGA 4OXPA 4JI0Q 4DAVA 2UUAL 2IPKD 1VS0A 1ILQA 2DGYA 3FRPB 3OTOL 2JA6B 1HUMA 3AB9A 3QR8A 1HA6A 5CBAE 1IBLL 3U50C 5CV4A 5I6WA 2NVYH 4IPCA 1I6VC 4QQBX 3HS0C 3S16B 4LF4Q 1F9PA 1E0BA 1QVCA 3A55A 4IQZA 1S3OA 2EY1A 5A2QL 3GTJH 4X3SA 4X66L 1Y1WG 5JJIA 1ENAA 1PRTF 4NB3A 1HTPA 5C4HA 3L0OA 4IURA 4A3KH 4YWKA 4MIUA 1TWAB 2JA7G 3IAYA 3DMUA 2QILA 5C0XH 5FO7B 3TZUA 1VDZA 3OWFA 3K7AH 4A3EG 3QOLA 4DV7L 2Z8LA 3PQIA 4DR7L 2B2UA 4JI7L 4ZUIA 1QUQB 5ELNA 3PF5A 1LUZA 2E5LQ 1EY0A 1YBYA 3CCSA 3PO2G 2XN9C 3BDCA 4A3LG 2NVXB 1NTGA 5D3DA 4DR3L 1HRJA 3EN2A 3GQBA 5FKAC 5JPMC 1N34Q 5M5XH 1Q46A 1KL9A 2CW0C 3M4PA 3KLSA 3T1YL 1HJPA 3U4VA 4LFCQ 4RGOS 3I90A 4CJ1B 1SNCA 1JE4A 3FKIG 4JOIA 3AMUA 4IFDI 2Z9HA 3OOCA 5DNFA 1BBXC 5EKIA 4H0LC 4DV3Q 3S1RB 1EFID 2I07B 4DXGA 3JAMi 4BY1H 5IYDH 3S1MB 3KYHC 1TWCB 4A3DG 1YNNC 3UDGA 2I46A 3ERQA 4IUNA 4PZ8A 2BE5C 1HQRD 3P20A 4P71A 2PQEA 3OPOA 1WI5A 1PTOF 5IWAL 1GUWA 1PH6A 4X64Q 2AMCB 2O5IC 2KCMA 1I4HA 4A76A 1M1KC 1VQGA 1SXTA 2A1AA 1DD2A 5IYBG 2XWJB 3K57A 2ZTDA 5COYA 1AW7A 3T56B 4XXEA 2B2VA 1WD0A 4JI1Q 4HAEA 2NB0A 1HR0Q 3MXPA 4B3RQ 3KLSX 1B8AA 1V1QA 2HHHL 2JA9A 1EOVA 3J80E 1AEXA 1HZBA 1HZCA 2RSNA 5GAEC 4L5QA 2G9HD 4K8JA 4L6TB 3K80C 1SYFA 4CDCC 3CC4A 3OW2A 1BCPC 3ND8A 3QG1A 4C3IB 1MJEA 5JAVA 1IXRA 2D62A 4RCOA 2UU9L 5CBEE 2ASBA 2N8NA 2FMCA 2M2LA 1ZYRC 1X65A 2D9UA 4AYBG 2M00A 2K4KA 3AU7A 5FJ8G 3U58A 3RZOB 1F9RA 1MSGA 3MC0B 2TMPA 3AEVA 3HOVG 3I4MH 2KENA 2D0OA 4CJ2C 1N8RC 1EY8A 1QCBD 1LABA 4LJZC 4LF5Q 3MXGA 5ELBA 1Y8OB 5M5WH 1GUNA 3D4WA 5E1FA 1M90C 4RMFA 1OXUA 4DK0A 4A3EH 3NK9A 2F0DA 4ZUJA 1YJ9A 2F4VQ 2H5XA 4RH6A 4DNTB 2WB1B 1TXYA 3CPWA 3W5OA 3CRKC 4GOPB 2DUDA 1N32Q 1E22A 5A35A 1JCKB 2B2TA 1KAAA 4OIJA 1QUQA 3GTLH 4O42A 3NTHA 3DEPA 2F3IA 3KDFB 3DLLA 2F0PA 3PO2H 2IHFA 3HKZB 2JQOA 2JN4A 2YTYA 3HOXB 2CW0D 2PCFB 5G3LD 4P75A 1EWIA 3A5ZB 4K14A 2A68C 4IUUA 1HZ9A 1W6KA 3RD4A 4QUFA 4S3SA 3DM1A 4H44C 1E2WA 1EY5A 4DU9A 1K0RA 5C4JB 4OO1H 1HPCA 2F0SA 5I4DA 1CM9A 5C3EB 1HNZL 1HA5A 2UUAQ 1XNRL 1K9MC 5DAUA 1YNND 4UHVA 3OTOQ 3HOYB 4JBMA 2BE5D 1UUPA 2A69C 2R7FA 1LT6D 3J7ZC 3T1HL 2LKVA 4KK7A 1IBLQ 4C3IH 1EEFD 4B9XA 3S2DH 1SNMA 5FK9C 3EROA 1D6EC 3A74A 2UXBL 3F2BA 3MAQA 4JCVE 3R93A 4CDFC 4X66Q 4HJ9A 2ZT9C 4YWLA 3QIAA 4LWCA 4K2KA 2ZXRA 2Q8TA 2PI2E 4UDUC 1LLRD 4K6DA 4DK1A 2QKIC 3NWTA 5AJ3L 1EQTA 3SHLA 1SRUA 2JA8B 5IE8A 1VQKA 4DK6C 3GO5A 3STBC 4M8AA 2UXCL 4L5SA 5E4WC 4DV7Q 1NR2A 4DR7Q 3F2UA 4QF4A 2PQAB 4JI7Q 1H9JA 4F7XA 3CQZH 2NZ1D 3F1ZA 1T5EA 4KV6A 3G6EA 4ULLA 3CW2C 2HCIA 2VQEL 2O5JC 1Y8NB 3EIVA 2OQKA 1K83B 3FPUB 4N9TA 1ZYRD 1ASYA 2DNCA 4CBVA 1X3GA 4DGZA 1ET6A 5BR8L 1FVIA 2NUCA 3TS2A 4NP5A 4JK1C 1JT8A 3I56A 1PH7A 1AN8A 3T1YQ 1XMQL 3S14H 4ZKCB 1PFNA 4JBWA 4K2LA 2PMZE 4XDXA 2QF7A 3VDYA 3HOVH 3OMCA 4JG2A 2H1EA 2JA5H 4A4IA 3ZYYX 4C3HB 3H0GG 4HJ5A 1YEZA 2ZXPA 4C56C 5C44B 1E7ZA 4G4KA 3CCMA 4UAIA 2N3SA 4C1NI 1PRTD 3UI2A 5HGTA 2ZJPA 3K59A 4BA2I 5IWAQ 4A3BB 1YVCA 2BH2A 1SLJA 4GOPA 1E1OA 1F2LA 2K05A 3M9BA 1E1TA 2EPBA 2DN8A 3GV6A 1IBML 2AQ1B 2BA1A 3T16A 5FLMG 1AFPA 3KDFA 1SJHD 2A68D 1I3QB 4ZQ3A 2B2YA 3M7NA 3K6OA 1EFWA 3ZJYC 1TWGB 1FNUA 1XYIA 1PTOB 5C4ZA 4L5RC 2CHBD 3PO3H 2R7ZG 2HHHQ 5E7NA 1X3QA 4FF2A 2TSSA 3BJUA 1WFQA 1PH1A 4F8MA 1BF4A 4X3TA 2A69D 5EPLA 3WWVA 1VQ5A 3V96A 1SE3A 3NELA 3LWEA 5EGTA 1SMYC 2UU9Q 2JSOA 1R4PB 4HIKA 3GTOH 2QA4A 1L0XB 2NVTB 1IYVA 3J81L 4K6LA 3E5SA 4FYDA 1FGUA 3HOZG 5JEAJ 4BXXG 3FHWA 3AYHB 5IODA 5JPNC 1GUTA 1JOKA 1RHPA 1PH2A 1WTQA 3B6YA 4PQXA 5IT9L 3KLRA 3WOEA 2Q8IB 3T53B 3V05A 3BZCA 2QDBA 4G7ZC 3RZDH 4B08A 1UEBA 1SDFA 4B3SL 1YNJD 2NZHA 5ELOA 1NCVA 2VY3A 3HOWG 1SE8A 4RHSA 3KBXA 2L5TA 5JOBA 4ALPA 1EY7A 1VQBA 3I4OA 1A6XA 4LK1C 1HXYD 5BN5A 1VQIA 3VYTA 3JAME 3GV3A 2FINB 3KK7A 1V9PA 2ZJRA 1IKMA 4LF8L 3RR5A 1X56A 1KAWA 2BDOA 4QIWB 1IBKL 3I72A 2R3ZA 3PMFA 3C2PA 3G48A 4EVOA 1YI2A 1VQOA 1KNAA 3VYRA 4DR4L 4N9PA 3V2TA 4WJWA 1HNZQ 4HTHA 5GAHC 1WD1A 4FF4A 4YCWA 1IZ6A 1JB3A 4DV6Q 3J80i 4XQNA 1R9TH 1D1IA 5EPJA 4A3MH 3T1HQ 1F2YA 1TIID 3M4YA 2EVBA 4FDBA 1Q8KA 2E75C 2WAQG 2KVMA 5M5YH 1DM0B 3S1QB 5AFWA 2K6AA 5C4XH 3ULPA 1GXDC 3M4OB 1WTWA 4J1MA 1LT5D 4HR7B 3URYA 1CQVA 1Y14B 1Q81C 3GTQB 1X32A 5LMNW 1L2FA 3E0JA 4YIJA 1BXTA 4J6HA 3D8GA 1N36Q 2AUKA 1VQAA 2A5HA 2B8GA 3W3AA 1J5EL 2XSCA 2E2JB 1RKNA 2CVRA 3PIPA 1Y1VG 2VQFL 1A15A 1PYBA 2Q2IA 1SMYD 5M3MB 1VQ9A 3S9WA 3ERSX 2VQEQ 3CCVA 5DM73 3SEBA 1EU3A 4OELB 4RKLA 4TVAB 4NXNQ 5T1GA 1CUKA 4HIMA 4JV5L 5IGFA 1Q90A 1DYQA 1RTNA 2A19A 2R92G 5BN3A 4A93B 4NPSA 1YHQA 3HOZH 2N88A 3UE0A 1U5KA 1UEAB 1C7YA 2PMZB 5CV7A 3HFZB 2LS01 2RHSB 4MTNA 4JVZA 1WYDA 1S5CD 4BBSB 1CKOA 2B3GA 4NXML 4A3GB 4I7AA 2E2HB 4KKUA 5D3IB 4BBRH 3NBHA 4R4OA 2RQXA 2OF1A 3I73A 3L7ZC 3LWUA 5KNCA 4A3KG 1VQJA 2K5QA 5KIXA 5IGGA 5C5MA 5C0XG 3PIOA 5IOCA 2MO0A 2ENBA 3NQIA 2L12A 3MA2B 1JB7A 2G9DA 2RDFA 3IL8A 2KCTA 2ZM6Q 1YZ6A 1E3PA 3IRBA 1EIGA 1RCVD 1ENCA 4KY5A 5G3LF 5JJZA 4AQYL 4O0AA 3FDTA 4CDEC 1MKHA 1VQPA 2JYOA 3R2TA 4EQPA 1GOZA 2B2WC 4LUZA 3NBIA 4HIDA 2HQEA 4KY6A 3GTMB 1EYAA 2C35B 2KUMA 3S17B 4JYAL 2ID0A 2KBNA 2EYOA 4I7ZC 3BS1A 2Y0SG 1XPOA 1VQ4A 5IGBA 1SYGA 2CWPA 3RMHA 2HD3A 3D0FA 3Q8DA 1BKBA 4F88A 5CC4A 3A56A 4BY1G 5IYDG 3ITPA 5CGKA 4KKSA 3K5MA 5M3FB 2EQSA 4GN4B 5CV6A 4A93H 4PG3A 2B29A 4WJ3M 2K14A 3BYTB 3AFQA 1TS3A 4WJ4A 4BY7H 1B44D 3WDNA 4OHJA 2EXDA 5EKKA 4B3SQ 4J15A 1BBWA 1PH4A 3NQTA 1CT1D 1GM5A 3J7A5 4JPBW 5FLXL 2E2HH 1TWHB 3R2IA 2RBMA 2LMCB 2F0HA 3OIQA 2L15A 1Y1VH 2Z6KA 3W1GA 1I94Q 2K5DA 1BCPF 3X3MA 4DAYB 4A3IB 1KXLA 5EJWA 2WP8J 2OEOA 4Q0FA 4LF8Q 5C3WA 1LT4D 1I4XA 3M3YB 1VQFA 4YHHL 4XQQA 1VQCA 2R92H 4R8IA 4DUZL 2XVSA 3TP8A 4X3KA 2IX3A 2DJFC 1S5BD 4DR4Q 1J6QA 1NY4A 2PZWA 3TRZA 3BVMA 3SE0A 4DNRB 1SNQA 1UWVA 3HOUB 4JC0A 3BZKA 3I91A 3OHXC 4P74A 4GLVB 5IIFA 4PMBA 2GA4B 5LMNL 3I4MG 2KEEA 4B9WA 2LXJA 2DY7A 1HFNA 5C5LA 2QGQA 3TQYA 2I5LX 2AHOB 1K8GA 1VQ7A 5JEAH 4IPHA 2K50A 2PO4A 1LTLA 1SNOA 1PMRA 5EPKA 2Q8RE 2E2IH 4JW0A 1HUNA 5C0XI 1LV9A 1EYCA 2F52A 1PZKD 1LTBD 3MXNB 3GD7A 4LAAA 4XQJA 3HEJA 4DFAA 2R93H 3I55A 1UAPA 4KJNA 1STEA 2JEAI 1J5EQ 1JJCB 3GTPB 4HEDA 3MWYW 1FJGL 2EJMA 1XJVA 3L3OC 1KC8C 3QO2A 2VQFQ 2C9OA 1JMCA 2VUMH 1TWHH 2EZVA 1E2ZA 1L1OA 1SYDA 1AH9A 3TS0A 1G291 1SYBA 4OO1G 1EWCA 1VQEA 3BU2A 4JV5Q 3K0XA 1SFOH 4KTAA 1Q3LA 1PH3A 3P7JA 3QOJA 1IHZA 1RTOA 4LFBL 3A5UA 3K0YA 2L9HA 3GTGB 2F0KA 5ELDA 4NW2A 4C3IG 1SMXA 2JA6H 2SEBD 1JWMD 3K58A 4OX9L 1J8IA 1Y1WB 5CORA 1LM0A 1STYA 4NXMQ 3RLOA 4R4QA 3S16H 2JA7B 3BVGA 3TEHB 4MTKA 1T9HA 1XWEA 3J81c 2A6HC 1TS2A 3SGIA 3VR2A 1I4GA 2AQ2B 4PV1C 2IX0A 1F9QA 5BN4A 1CKMA 2O4XA 2WACA 1CK1A 4C3JB 1QZGA 1TWAH 1WTHA 3CPFA 5IT9c 4K5VA 1A2TA 2NBFA 1OXSC 3TMEA 3LNNA 4DAYA 5FOBB 1IW7C 2RDHA 1MSHA 2ES2A 2BDNA 1EZ8A 1FNVA 2WB1G 1D2BA 3SK8A 2HDMA 3VR3A 3U9SA 2KCCA 3R8BA 5CYUA 3FEWX 3I4NB 3HKZG 1BOSA 2AKWB 4ZRZA 1JQYD 1S4ZA 4IJLA 3HOXG 2NVXH 4R4TA 1PZID 2B39A 1CQFA 4KD3A 4JYAQ 1EIFA 3D6CA 2CKZB 2RHQB 1HQMC 3JAML 4ODGA 1CSQA 4A3DB 2NTSA 1MD2D 4LF6Q 2JA5G 2K5NA 2EYHA 3NHHA 5C3EG 1U0LA 4KN7C 3S1RH 4KHZA 4KHVA 1VQNA 4OGQC 3S1MH 1TWCH 4GNXA 1M4VA 3C1EA 2EOTA 2F0FA 1PFBA 3OMGA 2RCNA 1F2ZA 1TWFB 4XTCS 1O7ZA 3M85A 3C46A 1AZPA 3MXNA 5E3FA 1I6HB 3CKIB 4RCNA 4KLKA 1DOLA 2EDGA 4LUOA 4LF7L 2EJGC 3E6ZX 2RKSA 3G7LA 5DEHA 2IL8A 4LMQD 4P2CB 2EIFA 1A3UA 4H02A 4QIWE 3DXJC 3PO3G 2K5WA 2J4XA 2Q2HA 4DR1L 1SE4A 1HFGA 4JI3Q 4YY3L 2XWBB 3G71A 4CKEA 4YHHQ 1UNSA 3T4AC 4OO1I 4DUZQ 3N52A 4AYBB 2ZTEA 1QNKA 1QVGA 2SDFA 2KEDA 4L63B 2NTTA 1K3RA 1IL8A 2A6EC 3CC7A 2EY2A 5LHY1 4UP8A 3I2ZA 3LX0A 4XYQA 1JWUD 3W1BA 4DNIA 2A6HD 5CR3A 4C2MB 4K0KL 3RZOH 4MN3A 1TU2B 1C8CA 1S72A 1HNXL 1NSNS 5C6AA 1K73C 4R4IA 2BA0A 1STGA 1G2TA 2F0NA 1I4QA 5C44G 4OONA 2KOLA 1CKNB 1CHPD 4CKCA 1WTPA 1GJXA 1H95A 2FXQA 1PRTB 1BCPD 2MNAA 4C1NK 1PXUA 3H15A 4A3BG 2NN6G 2V1CC 1O7YA 3ONAB 3UE1A 2YU9B 2IX1A 2M9VA 2F0JA 1DJRD 4DR3Q 4RKBA 4P72A 1RF2D 1BR9A 2BCOA 3HOXH 1EYDA 1RDPD 2ZTCA 1U9RA 1D5XC 4Y52H 4IUTA 1EU4A 1TY2A 2CCZA 2A73B 5C4JH 1YITA 4R4CA 5C3EH 1LACA 2CWAA 4A3MG 1XPUA 1VQ8A 1MGSA 3HOYH 1U4PA 3I4LA 4DV5L 2HT1A 4G7HC 2K7VA 3HRZC 4A3CG 1PYSB 5C4XG 5KNBA 4R8NA 1ASZA 4ME3A 2VB2X 3W2DA 1Q12A 2E8GA 5F2DA 3PSIA 3ULJA 1V1PA 1W3SA 3KJPA 4RAUC 4ZKBB 3I8ZA 5J39A 4RGNA 4UY8C 3HKSA 4QCLA 4HIOA 4ILWA 2JA8H 1X54A 1UE6A 3IFTA 1STNA 1IKLA 1C0AA 1HH2P 2VW9A 1SJED 4JI8L 5FLXc 1TY0A 3MEHA 4TQUS 4DF7A 2D0PA 1DXMA 3K8AA 2F4IA 1SYEA 1K83H 2FMMA 2L0CA 1EZ6A 1TR5A 1HR0W 1E2VA 3T51B 3CCLA 3CCEA 1OO9B 1XTDA 4DV2L 3H0GB 2VS1A 1UE7A 5GQOA 4BS9A 4DV0L 1Z6HA 1KTKA 2LY7A 5IP9H 4L8JA 3STBD 3KOJA 3NBHB 4BBRG 4C3HH 4HCEA 3PUVA 4ABNA 1Y69U 5C44H 4GZYC 3NSWA 1CKNA 3TP6A 1JICA 1U4MA 1C48A 1A0IA 1Q1BA 1NNXA 1TS4A 1QVFA 3NTKA 2UUCL 2K04A 2QW7A 2F0LA 1FNWA 4IOAA 4A3BH 1TKWB 2NN6H 5KGUA 4LF7Q 2IJ0A 5I9OA 2R7ZB 2L4NA 1VQLA 2NVQB 2NN6I 4JBKA 3SR1A 1PA6A 4JI6L 3L9AX 3J7YW 1I3QH 3OWEB 2L11A 4K5XA 1U4LA 2IWHA 3K5OA 1EY9A 1FD7D 1TWGH 2N49A 3PGZA 3SDZA 1PTOH 2OXPA 4HSPA 1WTOA 4G57A 3KBGA 4IFDJ 5CMDA 1JE5A 1H9SB 4GN3B 4UP9A 4YCUA 1XNRQ 2CFMA 2MFIA 1H9KA 4JI0L 2WFWA 3EQLC 3TN2A 1WCMB 2SNSA 1WOCA 1V8QA 3ICEA 1ESFA 1GO3E 1QG7A 5HGQA 2GVAA 4HJ8A 3CC2A 1EIHA 3FVQA 1VF5C 1SAPA 2SNMA 3GP7A 3DHQA 4A3CH 1A3VA 4GKKL 2NVTH 2UXBQ 1S5FD 4A93G 4EQOA 2XIWA 2OCEA 5JJKA 2KHJA 2F0WA 4LF4L 3KF6A 2CH4W 1B2TA 1SEBD 4BY7G 3HOWB 4MZ9A 4PZ7A 2MHVA 1HNXQ 1GD7A 2HIXA 3QJYA 3UDIA 2NWGA 3U9OA 3CMEA 4DA2A 5AJ3Q 3S1NB 1A3TA 3E3XA 4LW1A 3A8IE 1BQQT 1UE5A 5DM63 4K5WA 1Q7YC 4CDDC 2ZXOA 1CA6A 1K8AC 2UXCQ 2JXMB 1I50B 4PZ6A 5LL6X 5IGEA 5K36H 4HJAA 5DLQE 1NMGA 2B2UC 1S5DD 3BDOA 4PMCA 3TP7A 1EQVA 1G2SA 1QB5D 3SK4A 2NYZD 3SK5A 2MPMA 2WKCA 2WV6D 1WTRA 4IN3A 2E5LL 5EQ0A 3A8KE 3DWQA 1II3A 3LGJA 5BR8Q 2XNAC 4FXDA 2YTXA 3G6JB 3AFPA 5IP7G 1XMQQ 1U4RA 3M4QA 4OL7A 3SK6A 3PUYA 1PHJA 1F2MA 1D5MC 3E9HA 4IJHA 4JOIC 4DXFA 4KJOA 4O2DA 1VF7A 4ZCKA 1DONA 1XMOL 1QJOA 3J80L 3NUCA 4QB4A 3J81j 1HNWL 1LO5D 5CV5A 3OSOA 4Y7NB 1EL0A 2ICEC 2RF4A 3F8TA 1V43A 1B50A 3SVMA 1B9NA 1E24A 5C3XA 2E74C 3MEFA 2Z0SA 5JEAG 3S15B 1LTAD 2RCFA 4WFN3 4DR5L 3KF8A 1JORA 1EQRA 4K8IA 3JAMc 3S2HB 1C9OA 2MO1A 3S1QH 4N8X1 5M3FG 1IBMQ 4X64L 3M4OH 2XGTA 3FP9A 1ZXTA 2B2VC 4HMIA 3QWNA 1Q86C 3GTKB 3E9IA 1VQDA 4A3FB 4RG1A 3GTQH 4QY7A 1X55A 4B3ML 2R93G 5I6YA 3BZDB 4EQ5A 4JI1L 2IY5B 2B63B 4DAPA 1B3AA 4RGTA 3RN2A 1D8LA 5K5PA 1ML0D 2C5CA 4X3UA 3D3RA 1NBWA 3M7GA 1MHWC 1QZHA 2F3WA 2VUMG 2IW3A 2E2JH 1L1OB 1I50H 3E0EA 1Y8PB 1H9SA 4UPAA 1ENFA 4XT1B 4JI8Q 1KLUD 3VYSA 1VMPA 4DUYL 5M3MH 3VA7A 4A3IG 2K75A 4KKTA 3NEMA 2VNUD 3F2DA 2EYMA 2NVYB 4X65L 1GUSA 3TREA 4AH6A 2HCCA 1EIYB 1I4RA 1Q8IA 2MGSA 2JA6G 1NUCA 1QOHA 3GTJB 1JC7A 2KHIA 1CA5A 1QILA 1B1ZA 1KABA 4JI5L 4DV0Q 2N55A 1S5ED 4X6AH 1OXXK 1F77A 4A3KB 4GS3A 4P73A 4LUVA 5HURA 4BBSH 5JJLA 4A3GH 1PFSA 5EAYA 3K7AB 4DAMA 3DUZA 3I70A 2CH4A 3DWAA 1FR3A 1IL2A 4A3JB 2UUCQ 1RL2A 2L55A 2B2TC 1JJ2A 5GAGC 2F4VL 4UP7A 3RLFA 3K5NA 3S2HH 1MI2A 1N32L 2Z6BA 3K5LA 1P16A 3HZXA 5HY6A 2QDLA 1IBKQ 1F9SA 1PLFA 5M5XB 4QGUA 1PZJD 2DJGC 3J81E 4AYBE 2JE6I 4QUCA 2F0QA 5IP7H 1K8OA 2YYZA 3D31A 2EY6A 4YWMA 4J8QA 3NTIA 4OEMB 3K81C 1V1OA 2UXDL 4PMWA 5IT9E 5IYCH 4GKJL 4L5TA 1O7LA 1S40A 4BY1B 2EYLA 4AIMA 3GTMH 1DZ1A 3S17H 4ME5A 5EBCA 3D6WA 1MBYA 1SROA 2GN5A 1PH9A 2K33A 2VL6A 3R3OA 5IGCA 3H3VC 4DR2L 4GKKQ 1XNQL 2KA7A 4GNXB 2PNRC 5M3FH 5D14A 4ZLTF 3BYYB 2I5HA 3ND9A 2K52A 1NE3A 2I5MX 1SE2A 1SSOA 1L0WA 3D4RA 1T5XD 5E4XA 3P75A 4FO2A 2VB3X 3MFGA 1ICWA 1I4PA 2F0TA 1CI3M 1X3PA 3NENA 5J1ZA 4A3JH 2K5VA 4O1NA 1IYJB 4C3JG 5IY0A 2AWNA 3TDQA 2XRSD 3RN5A 1LT3D 1AZQA 4BA1I 4A3IH 2IT1A 3M3YH 1AP0A 4XYOA 3Q23A 3MXUA 4OWXB 1XPRA 1GHKA 2OT2A 4IFDH 1JR0D 1XMOQ 1WVLA 3I4MB 1BBUA 3I4NG 3DM3A 3PUWA 1HNWQ 1EY4A 3HOUH 3BDLA 3CCJA 3CRLC 3KUPA 2AWOA 1NAPA 4R9WA 4CHTB 5M5WB 3VA5A 5EKLA 2FFKB 3I7FA 1STAA 2F1MA 4WORA 3RNUA 3Q22A 4A3EB 3C3LA 1LYLA 3CCRA 5JVG3 4DR5Q 1PVOA 2HQLA 5H1SE 1OXTA 4GOPC 2F3VA 4TRDA 1KDAA 3DWPA 3GTLB 3GDEA 2YTVA 1DOMA 1VQHA 1Z9FA 3PO2B 2LSSA 2B2YC 3I3CA 4B3MQ 2EYPA 1O80A 2GVBA 2B8FA 4FVMA 3VR4A 4AQYQ 2EJFC 1AE3A 1SNPA 2EE1A 3FKIB 1L0YB 1WJJA 2FJ2A 3GTPH 4GLAC 1D1KA 2L1BA 2F0UA 2UUBL 4H13C 2X6LA 2K01A 2YV5A 1KDCA 2KCNA 2ICIA 1LTGD 2B2WA 2CQOA 4DUYQ 1N9WA 4IPGA 4F87A 4QJFA 5T1IA 4QL5A 2WINB 1LTSD 4X65Q 1G91A 1XTCD 5LMUL 3S2DB 2RSOA 4EQNA 4KN4C 3HOYG 4LFAL 4G7OC 3VR6A 1RIPA 3PIP3 2H4OA 1MJCA 1JOOA 2X69A 3MZ5A 5CV8A 3PUXA 1VCIA 4OWTB 3GTGH 1RODA 4JI5Q 1EYGA 1NMFA 3OW7A 1KIXA 1BO0A 3H3VH 1NR4A 1Y1WH 4IUQA 1V1PB 4DPGA 1LTRD 4JBJA 1G51A 2K5HA 3UDXA 2Z1CA 1N33L 4FP5D 3H3VI 1A8VA 2JA7H 2LFNA 3NXWA 3PV0A 1DCZA 4YCVA 3H94A 3ULLA 1G6ZA 4KMUC 4WRDA 3CQZB 4TKOB 1PRTC 2E76C 5KEEA 4FF1A 2JA8G 1TQOA 1VQ6A 4B3TL 5TSSA 3KLWA 4C3JH 3CCQA 4DR6L 1K3BC 1X3FA 1RD9D 3F2CA 4MHEA 4A3LH 4HJ7A 1ONLA 3P1HA 2SOBA 1SR3A 1BCPB 3S14B 3AQQA 4CJ0B 3H6MA 1B7YB 2IHEA 3HOVB 3PIO3 1CZGA 1ILPA 2UXDQ 3I4NH 3BVZA 3T13A 3OIPA 1FYCA 3FKIH 1YIJA 4GKJQ 2JA5B 1D7QA 1C4QA 4EGVA 5LMNQ 3CCUA 3EJIA 1HHVA 2ATWA 4M1UB 1SYCA 1PDQA 2CQAA 4DV6L 2F0GA 3A0JA 4BWGB 2K03A 4R1JA 2QCPX 5FLXE 5IP9G 4A3DH 4C3HG 1K28A 4DR2Q 1XNQQ 3CP0A 2PZTA 3CU7A 3J80c 1WTVA 1IW7D 4JI4L 1YJWA 1PH8A 3SXHA 3Q24A 1TVXA 2DNEA 1OXVA 2EY5A 3A54A 4JI2L 2MP1A 4KY7A 5GROA 2EYFA 5IYBH 5IGDA 4XT3B 2F0OA 2A8VA 3QB3A 3PO3B 1TWFH 1PTOC 3MHBA 1FJGQ 2OWOA 3CD6A 4KD4A 2EYJA 2P5ZX 1N36L 1I6HH 1QWYA 2VXWA 5ELEA 1W6JA 1VMCA 2ALYB 1YNJC 4IALA 4V0BA 4CGYB 3CF5A 4X62L 5A2QE 3FMCA 1SBBB 4HMJA 1B70B 4IZ8A 1YNXA 1GUOA 3GTOB 1X9NA 4NXNL 2NZOA 4LFBQ 2WAQE 5JVH3 5ELCA 2WKDA 2HDLA 1CFMA 4OX9Q 2XTIA 3H09A 5FJ8H 4Z9CB 5CV9A 3PCOB 1KDBA 2LXKA 5KNDA 3J81i 3IFDA 1DGSA 3RZDB 1EEID 1GKHA 3KF6B 4Q5VA 2MUYA 3EA6A 3J7AV 5LL6S 4C2MH 4DV1L 4MNOA 4APVA 1FL0A 4FXGC 1HZAA 4FF3A 1JOQA 1ET9A 2KJXA 3PF4A 2RVLA 1CSPA 5K36G 3A7AB 2PW7A 1KHIA 4U68A 1Q82C 2AUJD 3MTSA 2ZM6L 3G4SA 2A6ED 3CXCA 2E2DC 5ELFA 2JJQA 3N6RA 1EUJA 4CKBA 2YU9H 1P8LA 4QMGA 2X6GA 3FPPA 3TSSA 2WIIB 1X6OA 2UUBQ 2PZUA 1Z7TA 4H7BA 1R9TB 4A3MB 4DV4L 3BG3A 4NMZA 1Q1EA 4NKLA 2QEXA 1O78A 5I2XA 5LMUQ 5M5YB 3X3NA 5C4XB 2PYKA 2K32A 1WCMG 4RWSC 4LFAQ 3CAMA 4DN4M 5C0XJ 2A74C 3KF8B 4LF9L 3U4ZA 1ZKOA 3CHBD 1EOTA 2N78A 3C1FA 2MJ8A 1PTOD 4POFA 5J22A 1QNUA 3NE5B 4OIKA 2F0IA 3NWSA 3NPPA 1CZWA 1N33Q 1ICFB 2EXZA 1TT2A 2R61A 5FO9B 1DOKA 2R6GA 2Q2TA 1G8ZD 4POGA 2Z6KC 1M8AA 4HN7A 4DR1Q 4IO9A 2J7ZA 4B3TQ 3NP8A 4YY3Q 4KHPL 4FXKC 1GUGA 1KRSA 2PQAA 3A8JE 1I94L 1X3EA 3TP5A 2Z4IA 2Y0SE 4DR6Q 3RLNA 5M3MG 3HOZB 3A7LA 1A2UA 1ESRA 5KRUA 4GLXA 3HP3A 5M9OA 4IOCA 1D5ZC 1BUVT 1J9OA 1XXGA 3JC66 5FO8B 5L37A 2V4DA 3EFXD 4HCSA 1A62A 1KRTA 4K0KQ 1STBA 4BBRB 1PV4A 4ID6A 4XIGS 1AE2A 3H0GH 4RA8A 2RDGA 3CMAA 1KD1C 5KYIA 4LNQA 1LTID 2FHTA 2JK8A 4BBSG 4IPDA 2KHSA 3WOFA 4A3GG 2HIVA 3H91A 1KQSA 2KECA 1NJIC 1QE6A 4KI0A 4JI4Q 1PFMA 3ER0A 3TBIB 2F0EA 2JP1A 1TS5A 2I0QA 1ZEQX 2K28A 4JI2Q 2PW5A 3EVQA 2PPBC 5FLMH 4NDXA 1EY6A 1W2BA 2AQ3B 1LTTD 3UDFA 5I2YA 2OTJA 1SN8A 2D2CC 2R7ZH 4IUPA 1BDOA 2NVQH 4A3FG 3K7UC 1L1OC 4X62Q 2B63G 1N34L 3MVVA 1EQQA 3KFUA 3TZDA 1UE1A 4LFCL 4EX5A 1O7IA 1EWHA 5IYCG 2F03A 1CHQD 2WAQB 1I5FA 5KYLA 4DV3L 4A75A 3O13A 1RJTA
chains in the Genus database with same CATH topology
3RUZA 5D65A 2QEJC 4U673 4BY7B 1B4OA 1STHA 1B9MA 3D4DA 4TSSA 1KLGD 2F0MA 1K8MA 3PUZA 5NUCA 3J7AF 1Y1VB 3MFYA 2XRQD 2KQ3A 4PNYA 4RFBA 1SNDA 1KNEA 3VYUA 4E6IA 2J0TD 4I65A 2R92B 1H9MA 1HTLD 4ZYSA 1WTXA 2BOSA 2O2LD 2Z4HA 4ZK9B 1Z47A 1R4QB 4IFDG 1HCZA 2D5DA 1GHJA 4IUVA 3Q6SA 1FGBD 3HGBA 1JWSD 3IKJA 3VR5A 4V190 1H9RA 2E2IB 1XX8A 4RGMA 2K1BA 4ZAIA 1PYWD 3DEOA 1CTMA 1B53A 2R93B 3Q0AA 4HSVA 1IYUA 5I9PA 2DY8A 5EBDA 2VUMB 4RHRA 3HG9A 4FNFA 1BNZA 2JEBI 2RA4A 2Y0SB 5ISRA 1SFOB 2F0VA 2HUGA 4DAVA 2IPKD 1ILQA 3FRPB 2JA6B 1HUMA 3AB9A 1HA6A 5CBAE 5CV4A 5I6WA 1I6VC 3HS0C 3S16B 1F9PA 1E0BA 3A55A 4IQZA 2EY1A 5A2QL 4X3SA 1ENAA 1PRTF 1HTPA 5C4HA 4IURA 4MIUA 1TWAB 3IAYA 3DMUA 2QILA 5C0XH 5FO7B 3TZUA 1VDZA 3OWFA 3QOLA 2Z8LA 2B2UA 4ZUIA 1EY0A 2XN9C 3BDCA 2NVXB 5D3DA 1HRJA 3GQBA 5FKAC 5JPMC 2CW0C 3KLSA 4RGOS 3I90A 4CJ1B 1SNCA 1JE4A 3AMUA 4IFDI 3OOCA 5DNFA 1BBXC 5EKIA 4H0LC 3S1RB 1EFID 2I07B 4DXGA 3S1MB 1TWCB 1YNNC 2I46A 3ERQA 4IUNA 2BE5C 1HQRD 3P20A 2PQEA 3OPOA 1PTOF 1GUWA 2O5IC 1I4HA 1SXTA 1DD2A 2XWJB 3K57A 1WD0A 5COYA 1AW7A 3T56B 4XXEA 2B2VA 4HAEA 2NB0A 3MXPA 3KLSX 3J80E 1AEXA 2RSNA 2G9HD 4K8JA 4L6TB 1SYFA 1BCPC 3ND8A 3QG1A 4C3IB 5JAVA 2D62A 4RCOA 5CBEE 2FMCA 2M2LA 1ZYRC 2D9UA 2M00A 3AU7A 3RZOB 1F9RA 1MSGA 3MC0B 2TMPA 4CJ2C 1EY8A 1QCBD 1LABA 4LJZC 3MXGA 5ELBA 1Y8OB 1GUNA 3D4WA 5E1FA 1OXUA 4DK0A 3NK9A 2F0DA 4ZUJA 4DNTB 4RH6A 2WB1B 3CRKC 5A35A 1JCKB 2B2TA 1KAAA 4OIJA 4O42A 3NTHA 3DEPA 2F0PA 3HKZB 3HOXB 2CW0D 2PCFB 5G3LD 4K14A 2A68C 4IUUA 1W6KA 4QUFA 3RD4A 4S3SA 3DM1A 4H44C 1E2WA 1EY5A 4DU9A 5C4JB 4OO1H 1HPCA 2F0SA 5I4DA 1CM9A 5C3EB 1HA5A 5DAUA 1YNND 3HOYB 2BE5D 1UUPA 2A69C 1LT6D 2LKVA 4KK7A 1EEFD 4B9XA 1SNMA 5FK9C 3EROA 1D6EC 3MAQA 3R93A 2ZT9C 3QIAA 4K2KA 2ZXRA 2Q8TA 4UDUC 1LLRD 4K6DA 4DK1A 2QKIC 3NWTA 1EQTA 3SHLA 2JA8B 3GO5A 4M8AA 5E4WC 1NR2A 3F2UA 4QF4A 1H9JA 4F7XA 2NZ1D 4KV6A 1T5EA 4ULLA 2HCIA 2O5JC 1Y8NB 4N9TA 1K83B 3FPUB 1ZYRD 2DNCA 4CBVA 4DGZA 1ET6A 2NUCA 4NP5A 4JK1C 1AN8A 4ZKCB 1PFNA 4JBWA 4K2LA 4XDXA 2QF7A 3OMCA 2H1EA 3ZYYX 4C3HB 2ZXPA 4C56C 5C44B 4G4KA 4UAIA 4C1NI 1PRTD 3UI2A 5HGTA 3K59A 4BA2I 4A3BB 1F2LA 2K05A 2EPBA 2DN8A 3GV6A 2AQ1B 2BA1A 3T16A 1AFPA 1SJHD 2A68D 1I3QB 4ZQ3A 2B2YA 3M7NA 3K6OA 1TWGB 1FNUA 1XYIA 1PTOB 5C4ZA 2CHBD 1X3QA 4FF2A 2TSSA 4F8MA 1BF4A 4X3TA 2A69D 5EPLA 3V96A 1SE3A 3LWEA 5EGTA 1SMYC 2JSOA 1R4PB 2NVTB 1L0XB 1IYVA 3J81L 4K6LA 3E5SA 4FYDA 5JEAJ 5IODA 5JPNC 1GUTA 1JOKA 1RHPA 1WTQA 4PQXA 5IT9L 3KLRA 3WOEA 2Q8IB 3T53B 3V05A 4G7ZC 2QDBA 4B08A 1SDFA 1YNJD 1NCVA 4RHSA 3KBXA 2L5TA 5JOBA 1EY7A 1A6XA 4LK1C 1HXYD 5BN5A 3VYTA 3JAME 3GV3A 2FINB 3KK7A 1IKMA 2BDOA 4QIWB 3I72A 2R3ZA 3PMFA 3C2PA 4EVOA 1KNAA 3VYRA 4N9PA 3V2TA 4WJWA 4HTHA 1WD1A 4FF4A 1JB3A 4XQNA 1D1IA 5EPJA 1F2YA 1TIID 3M4YA 2EVBA 2E75C 2KVMA 1DM0B 3S1QB 5AFWA 2K6AA 1GXDC 3M4OB 1WTWA 4J1MA 1LT5D 4HR7B 3URYA 1CQVA 3GTQB 1X32A 3E0JA 4YIJA 1BXTA 4J6HA 3D8GA 2AUKA 2A5HA 2B8GA 3W3AA 2XSCA 2E2JB 1RKNA 2CVRA 1A15A 1SMYD 5M3MB 3S9WA 5DM73 3SEBA 1EU3A 4RKLA 5T1GA 5IGFA 1Q90A 1DYQA 1RTNA 5BN3A 4A93B 2N88A 1UEAB 2PMZB 5CV7A 2LS01 1S5CD 4BBSB 4A3GB 2E2HB 4KKUA 5D3IB 3NBHA 2RQXA 2OF1A 3I73A 3L7ZC 3LWUA 5KNCA 2K5QA 5KIXA 5IGGA 5C5MA 5C0XG 5IOCA 2ENBA 3NQIA 2L12A 3MA2B 2G9DA 2RDFA 3IL8A 1EIGA 1RCVD 1ENCA 4KY5A 5G3LF 5JJZA 3FDTA 2JYOA 4EQPA 3R2TA 1GOZA 2B2WC 3NBIA 2HQEA 4KY6A 3GTMB 1EYAA 2KUMA 3S17B 2ID0A 2EYOA 4I7ZC 3BS1A 5IGBA 1SYGA 3RMHA 4F88A 5CC4A 3A56A 3ITPA 5CGKA 4KKSA 3K5MA 5M3FB 5CV6A 3BYTB 1TS3A 1B44D 3WDNA 4OHJA 5EKKA 3NQTA 1CT1D 5FLXL 1TWHB 3R2IA 2RBMA 2LMCB 2F0HA 3OIQA 2K5DA 1BCPF 3X3MA 4A3IB 5EJWA 2WP8J 2OEOA 4Q0FA 5C3WA 1LT4D 1I4XA 3M3YB 4XQQA 4R8IA 2XVSA 3TP8A 4X3KA 2IX3A 1S5BD 2PZWA 3BVMA 3SE0A 4DNRB 1SNQA 3HOUB 3I91A 3OHXC 5IIFA 4PMBA 2GA4B 2KEEA 4B9WA 2DY7A 1HFNA 5C5LA 5JEAH 2PO4A 1SNOA 1PMRA 5EPKA 2Q8RE 1HUNA 5C0XI 1LV9A 1EYCA 1PZKD 1LTBD 3GD7A 4LAAA 4XQJA 3HEJA 4DFAA 1UAPA 4KJNA 1STEA 2JEAI 3GTPB 4HEDA 3MWYW 2EJMA 3L3OC 3QO2A 2C9OA 2EZVA 1E2ZA 1SYDA 1G291 1SYBA 4OO1G 1EWCA 4KTAA 1Q3LA 3P7JA 3QOJA 1IHZA 1RTOA 3K0YA 2L9HA 3GTGB 2F0KA 5ELDA 4NW2A 4C3IG 2SEBD 1JWMD 3K58A 1J8IA 1Y1WB 5CORA 1STYA 2JA7B 3BVGA 1XWEA 2A6HC 1TS2A 3VR2A 1I4GA 2AQ2B 4PV1C 2IX0A 1F9QA 5BN4A 2O4XA 2WACA 1CK1A 4C3JB 4K5VA 1A2TA 2NBFA 1OXSC 3TMEA 3LNNA 4DAYA 5FOBB 1IW7C 2RDHA 1MSHA 2BDNA 1EZ8A 1FNVA 1D2BA 3SK8A 2HDMA 3VR3A 3U9SA 2KCCA 3R8BA 5CYUA 3FEWX 3I4NB 1BOSA 4ZRZA 1JQYD 1S4ZA 1PZID 2B39A 1CQFA 4KD3A 3D6CA 1HQMC 3JAML 4ODGA 4A3DB 2NTSA 1MD2D 2EYHA 3NHHA 4KN7C 4KHZA 4KHVA 4OGQC 1M4VA 3C1EA 2EOTA 2F0FA 1PFBA 3OMGA 1F2ZA 1TWFB 4XTCS 1O7ZA 3M85A 3C46A 1AZPA 3MXNA 5E3FA 1I6HB 3CKIB 4RCNA 1DOLA 2EDGA 2EJGC 3E6ZX 2RKSA 3G7LA 5DEHA 2IL8A 4LMQD 4P2CB 1A3UA 3DXJC 2K5WA 2J4XA 1SE4A 1HFGA 2XWBB 4CKEA 1UNSA 3T4AC 4OO1I 3N52A 4AYBB 1QNKA 2SDFA 2KEDA 4L63B 2NTTA 1IL8A 2A6EC 2EY2A 5LHY1 3LX0A 4XYQA 1JWUD 2A6HD 5CR3A 4C2MB 4MN3A 1TU2B 1C8CA 1NSNS 5C6AA 2BA0A 1STGA 1G2TA 2F0NA 1I4QA 2KOLA 1CHPD 4CKCA 1WTPA 1GJXA 1PRTB 1BCPD 4C1NK 1PXUA 2NN6G 1O7YA 3ONAB 2YU9B 2IX1A 2M9VA 2F0JA 1DJRD 4RKBA 1RF2D 1BR9A 2BCOA 1EYDA 1RDPD 1U9RA 1D5XC 4IUTA 1EU4A 1TY2A 2A73B 1LACA 1MGSA 1U4PA 3I4LA 4G7HC 2K7VA 3HRZC 5KNBA 4R8NA 2VB2X 3W2DA 1Q12A 5F2DA 1V1PA 4RAUC 4ZKBB 3I8ZA 5J39A 4RGNA 4QCLA 4ILWA 3IFTA 1STNA 1IKLA 1SJED 1TY0A 3MEHA 4TQUS 4DF7A 1DXMA 2F4IA 1SYEA 2FMMA 2L0CA 1EZ6A 1TR5A 1E2VA 3T51B 1OO9B 3H0GB 4BS9A 1Z6HA 1KTKA 2LY7A 4L8JA 4HCEA 3PUVA 4ABNA 1Y69U 4GZYC 3NSWA 3TP6A 1JICA 1U4MA 1C48A 1Q1BA 1TS4A 3NTKA 2K04A 2F0LA 1FNWA 1TKWB 2NN6H 5KGUA 2IJ0A 5I9OA 2R7ZB 2L4NA 2NVQB 2NN6I 3SR1A 3L9AX 3J7YW 3OWEB 4K5XA 2L11A 2IWHA 1U4LA 3K5OA 1EY9A 1FD7D 3SDZA 1PTOH 2OXPA 4HSPA 1WTOA 4G57A 3KBGA 4IFDJ 5CMDA 1H9SB 1H9KA 3EQLC 3TN2A 1WCMB 2SNSA 1V8QA 1ESFA 1QG7A 1EIHA 3FVQA 1VF5C 1SAPA 2SNMA 3GP7A 3DHQA 1A3VA 1S5FD 4EQOA 2XIWA 2F0WA 1B2TA 1SEBD 3HOWB 2MHVA 3QJYA 2NWGA 3U9OA 4DA2A 3S1NB 1A3TA 3A8IE 1BQQT 5DM63 4K5WA 2ZXOA 1CA6A 2JXMB 1I50B 5LL6X 5IGEA 5K36H 2B2UC 1S5DD 3BDOA 4PMCA 3TP7A 1EQVA 1G2SA 1QB5D 3SK4A 2NYZD 3SK5A 2MPMA 2WKCA 2WV6D 1WTRA 4IN3A 5EQ0A 3A8KE 3DWQA 1II3A 2XNAC 4FXDA 3G6JB 1U4RA 4OL7A 3SK6A 3PUYA 1F2MA 1D5MC 4DXFA 4KJOA 1VF7A 1DONA 1QJOA 3J80L 3NUCA 4QB4A 1LO5D 5CV5A 3OSOA 4Y7NB 1EL0A 2ICEC 1V43A 1B50A 3SVMA 1B9NA 5C3XA 2E74C 5JEAG 3S15B 1LTAD 4WFN3 3KF8A 1JORA 4K8IA 3S2HB 1ZXTA 2B2VC 4HMIA 3QWNA 3GTKB 4A3FB 5I6YA 3BZDB 2B63B 4DAPA 1B3AA 4RGTA 5K5PA 1ML0D 2C5CA 4X3UA 3D3RA 3M7GA 2F3WA 2IW3A 1Y8PB 1H9SA 1ENFA 4XT1B 1KLUD 3VYSA 1VMPA 3VA7A 4KKTA 2VNUD 2EYMA 2NVYB 1GUSA 2HCCA 1I4RA 1Q8IA 2MGSA 1NUCA 1QOHA 3GTJB 1JC7A 1CA5A 1QILA 1B1ZA 1KABA 2N55A 1S5ED 1OXXK 1F77A 4A3KB 5HURA 3K7AB 3DUZA 3I70A 3DWAA 1FR3A 4A3JB 2L55A 2B2TC 3RLFA 3K5NA 1MI2A 3K5LA 3HZXA 1F9SA 1PLFA 5M5XB 1PZJD 3J81E 2JE6I 4QUCA 2F0QA 1K8OA 2YYZA 3D31A 2EY6A 4J8QA 3NTIA 1V1OA 4PMWA 5IT9E 1O7LA 4BY1B 2EYLA 1DZ1A 4ME5A 5EBCA 3D6WA 1MBYA 2K33A 3R3OA 5IGCA 3H3VC 2KA7A 2PNRC 5D14A 4ZLTF 3BYYB 3ND9A 1SE2A 1SSOA 3D4RA 1T5XD 5E4XA 3P75A 4FO2A 2VB3X 3MFGA 1ICWA 1I4PA 2F0TA 1CI3M 1X3PA 5J1ZA 4O1NA 4C3JG 2AWNA 3TDQA 2XRSD 1LT3D 1AZQA 4BA1I 2IT1A 1AP0A 4XYOA 3Q23A 3MXUA 1GHKA 2OT2A 4IFDH 1JR0D 1WVLA 3I4MB 3PUWA 1EY4A 3BDLA 3CRLC 3KUPA 2AWOA 1NAPA 4R9WA 4CHTB 5M5WB 3VA5A 5EKLA 2FFKB 1STAA 2F1MA 4WORA 4A3EB 3Q22A 3C3LA 5JVG3 1OXTA 2F3VA 4TRDA 1KDAA 3DWPA 3GTLB 1DOMA 3PO2B 2B2YC 3I3CA 2EYPA 1O80A 2B8FA 4FVMA 3VR4A 2EJFC 1SNPA 2EE1A 3FKIB 1L0YB 2FJ2A 1D1KA 2L1BA 2F0UA 4H13C 2X6LA 2K01A 1KDCA 2KCNA 2ICIA 1LTGD 2B2WA 4F87A 5T1IA 2WINB 1LTSD 1G91A 1XTCD 3S2DB 2RSOA 4EQNA 4KN4C 4G7OC 3VR6A 3PIP3 2H4OA 2X69A 1JOOA 3MZ5A 5CV8A 3PUXA 1VCIA 1RODA 3OW7A 1BO0A 1NR4A 4IUQA 1V1PB 1LTRD 2Z1CA 4FP5D 2LFNA 3NXWA 3PV0A 1DCZA 3H94A 1G6ZA 4KMUC 4WRDA 3CQZB 4TKOB 1PRTC 2E76C 5KEEA 4FF1A 1TQOA 5TSSA 1RD9D 4MHEA 1ONLA 3P1HA 2SOBA 1BCPB 3S14B 4CJ0B 3H6MA 3HOVB 3PIO3 1CZGA 1ILPA 2JA5B 3BVZA 3T13A 3OIPA 1FYCA 1C4QA 4EGVA 3EJIA 1HHVA 4M1UB 1SYCA 1PDQA 2CQAA 2F0GA 4BWGB 2K03A 2QCPX 5FLXE 4C3HG 2PZTA 3CU7A 1WTVA 1IW7D 3SXHA 3Q24A 1TVXA 2DNEA 1OXVA 2EY5A 3A54A 2MP1A 4KY7A 2EYFA 5IGDA 4XT3B 2F0OA 3QB3A 3PO3B 1PTOC 3MHBA 4KD4A 2EYJA 1QWYA 2VXWA 5ELEA 1W6JA 1VMCA 1YNJC 4IALA 4V0BA 4CGYB 5A2QE 3FMCA 1SBBB 4HMJA 4IZ8A 1GUOA 3GTOB 5JVH3 5ELCA 2WKDA 2HDLA 1CFMA 3H09A 4Z9CB 5CV9A 1KDBA 5KNDA 3IFDA 3RZDB 1EEID 4Q5VA 2MUYA 3EA6A 3J7AV 5LL6S 4FXGC 4FF3A 1JOQA 1ET9A 2KJXA 2RVLA 5K36G 3A7AB 2PW7A 4U68A 2AUJD 3MTSA 2A6ED 2E2DC 5ELFA 3N6RA 4CKBA 4QMGA 2X6GA 3FPPA 3TSSA 2WIIB 2PZUA 1Z7TA 4H7BA 1R9TB 4A3MB 3BG3A 4NMZA 1Q1EA 4NKLA 1O78A 5I2XA 5M5YB 3X3NA 5C4XB 2PYKA 2K32A 4RWSC 4DN4M 5C0XJ 2A74C 1ZKOA 3CHBD 1EOTA 3C1FA 2MJ8A 1PTOD 5J22A 1QNUA 3NE5B 4OIKA 2F0IA 3NWSA 3NPPA 1CZWA 2EXZA 1TT2A 2R61A 5FO9B 1DOKA 2R6GA 1G8ZD 1M8AA 4HN7A 2J7ZA 3NP8A 4FXKC 1GUGA 3A8JE 3TP5A 2Z4IA 3HOZB 3A7LA 1A2UA 1ESRA 5KRUA 3HP3A 5M9OA 1D5ZC 1BUVT 1J9OA 1XXGA 5FO8B 2V4DA 3EFXD 4HCSA 1STBA 4BBRB 4ID6A 4XIGS 4RA8A 2RDGA 5KYIA 1LTID 2FHTA 2KHSA 3WOFA 3H91A 2KECA 1QE6A 4KI0A 1PFMA 3TBIB 2F0EA 2JP1A 1TS5A 1ZEQX 2K28A 2PW5A 3EVQA 2PPBC 4NDXA 1EY6A 2AQ3B 1LTTD 5I2YA 2D2CC 4IUPA 1BDOA 3MVVA 3TZDA 1EWHA 2F03A 1CHQD 2WAQB 5KYLA 3O13A 1RJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8M A;  4IAL A;  2SNS A;  2LKV A;  2F0I A;  5CV6 A;  3RUZ A;  4B9X A;  1A3U A;  4R8N A;  5ISR A;  1SNM A;  2EXZ A;  2F3W A;  1TT2 A;  2F0V A;  4KTA A;  4EQN A;  5EGT A;  3ERO A;  1RKN A;  3MXP A;  3QOJ A;  5F2D A;  1IHZ A;  2SNM A;  4B9W A;  4HMJ A;  3DHQ A;  4IZ8 A;  5CV8 A;  1JOO A;  1STH A;  3MZ5 A;  5EKK A;  2F0K A;  1A3V A;  3D4D A;  3NQT A;  1AEX A;  3E5S A;  2F0M A;  4K2K A;  4EQO A;  3S9W A;  2F0W A;  5J39 A;  4K6D A;  3P75 A;  3NP8 A;  3SHL A;  4K8J A;  2RBM A;  2EYM A;  5IOD A;  4RKL A;  5CV4 A;  5I6W A;  2F0T A;  1JOK A;  3TP5 A;  5NUC A;  1STY A;  2F0H A;  1SYF A;  5IGF A;  5J1Z A;  3U9O A;  5CV9 A;  1KDB A;  1STN A;  1A3T A;  2KQ3 A;  3NXW A;  5JAV A;  4PNY A;  2EY2 A;  2EY1 A;  1NUC A;  1A2U A;  4K5W A;  2QDB A;  4QF4 A;  5KRU A;  1SND A;  3LX0 A;  4WRD A;  2OEO A;  5CV7 A;  4F7X A;  5M9O A;  5C3W A;  3MEH A;  5KEE A;  1ENA A;  1KAB A;  4KV6 A;  4DF7 A;  5IGE A;  1TQO A;  2M00 A;  4E6I A;  4I65 A;  2O4X A;  5CR3 A;  5C4H A;  1SYE A;  2WAC A;  5JOB A;  4N9T A;  1EY7 A;  4MIU A;  5J22 A;  5HUR A;  3DMU A;  1EZ6 A;  1TR5 A;  1A2T A;  4K5V A;  4PMC A;  3TP8 A;  4DGZ A;  1JOQ A;  1NSN S;  3TME A;  3TP7 A;  5C6A A;  1EQV A;  2NUC A;  1STB A;  3OWF A;  4NP5 A;  3SK4 A;  2PZW A;  1EY8 A;  3SK5 A;  3QOL A;  1STG A;  4ID6 A;  2F0N A;  3P1H A;  2OF1 A;  2SOB A;  1SNQ A;  1II3 A;  1EZ8 A;  1EY4 A;  3BDL A;  3H6M A;  3SK8 A;  5KYI A;  4ZUI A;  4K2L A;  4PMB A;  2PW7 A;  5IIF A;  5KIX A;  5IGG A;  5C5M A;  3VA5 A;  2KHS A;  3D4W A;  5E1F A;  1EY0 A;  5EKL A;  3OMC A;  5IOC A;  4OL7 A;  1STA A;  2ENB A;  3BDC A;  4WOR A;  3SK6 A;  1F2M A;  3NK9 A;  2F0D A;  4ZUJ A;  3PMF A;  3T13 A;  5C5L A;  4KJO A;  2F0E A;  3EJI A;  4EVO A;  3NUC A;  2RDF A;  3HZX A;  2F3V A;  4KD3 A;  4TRD A;  4N9P A;  1KDA A;  2F0J A;  2PW5 A;  3EVQ A;  4QMG A;  1KAA A;  1SYC A;  3TP6 A;  3V2T A;  3D6C A;  1SNO A;  4HTH A;  2F0Q A;  4QB4 A;  2F0G A;  5HGT A;  4NDX A;  2PZU A;  1ENC A;  1EY6 A;  2EY6 A;  3OSO A;  4KY5 A;  2F0P A;  4H7B A;  4ODG A;  4RKB A;  1SNC A;  2F0L A;  2EYH A;  1EYC A;  3NHH A;  5KGU A;  1EYD A;  2PZT A;  2EYP A;  5C3X A;  5CV5 A;  5I9O A;  4K14 A;  1U9R A;  1F2Y A;  4KHV A;  4NMZ A;  3SXH A;  4EQP A;  4LAA A;  3SR1 A;  4NKL A;  3HEJ A;  4DFA A;  1JOR A;  3T16 A;  2EY5 A;  2HQE A;  4KJN A;  2EYL A;  1SNP A;  4K8I A;  1EY5 A;  1EYA A;  4KY6 A;  4S3S A;  4ZQ3 A;  4DU9 A;  3MVV A;  4K5X A;  2PYK A;  4KY7 A;  2EYF A;  2F0S A;  3ERQ A;  4ME5 A;  5I9P A;  1EY9 A;  2EYO A;  5IGD A;  4IUN A;  2F0U A;  3C1E A;  2F0F A;  2F0O A;  3OMG A;  5C4Z A;  2OXP A;  4J1M A;  5IGB A;  1F2Z A;  1SYG A;  3QB3 A;  1KDC A;  4HMI A;  5DAU A;  2PQE A;  4G57 A;  3MHB A;  5E3F A;  3R3O A;  5IGC A;  4KD4 A;  2EYJ A;  1SYD A;  5CC4 A;  5KYL A;  5I6Y A;  2RKS A;  3C1F A;  5DEH A;  3ITP A;  4YIJ A;  1SYB A;  4J6H A;  5CGK A;  3D8G A;  5K5P A; 
#chains in the Genus database with same CATH topology
 1YHB A;  3RUZ A;  1WCM H;  4DV5 Q;  5D65 A;  2OTL A;  4BXX H;  2QEJ C;  2VZA A;  4U67 3;  4BY7 B;  1B4O A;  3EBE A;  1MIU A;  3KJO A;  4OWW B;  1STH A;  1B9M A;  1G6P A;  3D4D A;  4TSS A;  1KLG D;  2MQH A;  2F0M A;  1K8M A;  4DV1 Q;  3PUZ A;  3HOW H;  5NUC A;  3J7A F;  1Y1V B;  3MFY A;  2XRQ D;  1GVP A;  2G5D A;  2KQ3 A;  1HR0 L;  3S1N H;  4PNY A;  4RFB A;  4B3R L;  2R7D A;  3OYY A;  1SND A;  1K0S A;  1KNE A;  3VYU A;  2BH8 A;  4E6I A;  2J0T D;  4I65 A;  5GAD C;  2R92 B;  4A3J G;  1JJG A;  1H9M A;  4GN5 A;  1HTL D;  4ZYS A;  1WTX A;  2BOS A;  2O2L D;  2Z4H A;  4ZK9 B;  1Z47 A;  1R4Q B;  4DV2 Q;  4IFD G;  1B3Q A;  5J3B A;  4DV4 Q;  1HCZ A;  2D5D A;  1GHJ A;  4IUV A;  3Q6S A;  3HOU G;  1FGB D;  3HGB A;  1JWS D;  3IKJ A;  3VR5 A;  4LF6 L;  2Q2U A;  4V19 0;  3S24 A;  1H9R A;  2E2I B;  1XX8 A;  4RGM A;  4Y7N H;  4LF5 L;  2K1B A;  4ZAI A;  1PYW D;  4GNX C;  4DK3 C;  4LF9 Q;  4DKA C;  3S15 H;  3DEO A;  3L2P A;  1A63 A;  2OQ0 A;  1CTM A;  1B53 A;  2R93 B;  2WB1 E;  4N8F A;  2PI2 A;  3Q0A A;  4HSV A;  1IYU A;  5I9P A;  4JI6 Q;  2DY8 A;  5EBD A;  1YJN A;  3GTK H;  2VUM B;  3HKZ E;  2PNH A;  4RHR A;  1BVS A;  4A3F H;  1YHA A;  3HG9 A;  4FNF A;  1BNZ A;  1OTC A;  2JEB I;  2B63 H;  4KHP Q;  2ZJQ A;  2RA4 A;  1PH5 A;  2Y0S B;  5ISR A;  4JI3 L;  1SFO B;  1VQM A;  2F0V A;  2HUG A;  4OXP A;  4JI0 Q;  4DAV A;  2UUA L;  2IPK D;  1VS0 A;  1ILQ A;  2DGY A;  3FRP B;  3OTO L;  2JA6 B;  1HUM A;  3AB9 A;  3QR8 A;  1HA6 A;  5CBA E;  1IBL L;  3U50 C;  5CV4 A;  5I6W A;  2NVY H;  4IPC A;  1I6V C;  4QQB X;  3HS0 C;  3S16 B;  4LF4 Q;  1F9P A;  1E0B A;  1QVC A;  3A55 A;  4IQZ A;  1S3O A;  2EY1 A;  5A2Q L;  3GTJ H;  4X3S A;  4X66 L;  1Y1W G;  5JJI A;  1ENA A;  1PRT F;  4NB3 A;  1HTP A;  5C4H A;  3L0O A;  4IUR A;  4A3K H;  4YWK A;  4MIU A;  1TWA B;  2JA7 G;  3IAY A;  3DMU A;  2QIL A;  5C0X H;  5FO7 B;  3TZU A;  1VDZ A;  3OWF A;  3K7A H;  4A3E G;  3QOL A;  4DV7 L;  2Z8L A;  3PQI A;  4DR7 L;  2B2U A;  4JI7 L;  4ZUI A;  1QUQ B;  5ELN A;  3PF5 A;  1LUZ A;  2E5L Q;  1EY0 A;  1YBY A;  3CCS A;  3PO2 G;  2XN9 C;  3BDC A;  4A3L G;  2NVX B;  1NTG A;  5D3D A;  4DR3 L;  1HRJ A;  3EN2 A;  3GQB A;  5FKA C;  5JPM C;  1N34 Q;  5M5X H;  1Q46 A;  1KL9 A;  2CW0 C;  3M4P A;  3KLS A;  3T1Y L;  1HJP A;  3U4V A;  4LFC Q;  4RGO S;  3I90 A;  4CJ1 B;  1SNC A;  1JE4 A;  3FKI G;  4JOI A;  3AMU A;  4IFD I;  2Z9H A;  3OOC A;  5DNF A;  1BBX C;  5EKI A;  4H0L C;  4DV3 Q;  3S1R B;  1EFI D;  2I07 B;  4DXG A;  3JAM i;  4BY1 H;  5IYD H;  3S1M B;  3KYH C;  1TWC B;  4A3D G;  1YNN C;  3UDG A;  2I46 A;  3ERQ A;  4IUN A;  4PZ8 A;  2BE5 C;  1HQR D;  3P20 A;  4P71 A;  2PQE A;  3OPO A;  1WI5 A;  1PTO F;  5IWA L;  1GUW A;  1PH6 A;  4X64 Q;  2AMC B;  2O5I C;  2KCM A;  1I4H A;  4A76 A;  1M1K C;  1VQG A;  1SXT A;  2A1A A;  1DD2 A;  5IYB G;  2XWJ B;  3K57 A;  2ZTD A;  5COY A;  1AW7 A;  3T56 B;  4XXE A;  2B2V A;  1WD0 A;  4JI1 Q;  4HAE A;  2NB0 A;  1HR0 Q;  3MXP A;  4B3R Q;  3KLS X;  1B8A A;  1V1Q A;  2HHH L;  2JA9 A;  1EOV A;  3J80 E;  1AEX A;  1HZB A;  1HZC A;  2RSN A;  5GAE C;  4L5Q A;  2G9H D;  4K8J A;  4L6T B;  3K80 C;  1SYF A;  4CDC C;  3CC4 A;  3OW2 A;  1BCP C;  3ND8 A;  3QG1 A;  4C3I B;  1MJE A;  5JAV A;  1IXR A;  2D62 A;  4RCO A;  2UU9 L;  5CBE E;  2ASB A;  2N8N A;  2FMC A;  2M2L A;  1ZYR C;  1X65 A;  2D9U A;  4AYB G;  2M00 A;  2K4K A;  3AU7 A;  5FJ8 G;  3U58 A;  3RZO B;  1F9R A;  1MSG A;  3MC0 B;  2TMP A;  3AEV A;  3HOV G;  3I4M H;  2KEN A;  2D0O A;  4CJ2 C;  1N8R C;  1EY8 A;  1QCB D;  1LAB A;  4LJZ C;  4LF5 Q;  3MXG A;  5ELB A;  1Y8O B;  5M5W H;  1GUN A;  3D4W A;  5E1F A;  1M90 C;  4RMF A;  1OXU A;  4DK0 A;  4A3E H;  3NK9 A;  2F0D A;  4ZUJ A;  1YJ9 A;  2F4V Q;  2H5X A;  4RH6 A;  4DNT B;  2WB1 B;  1TXY A;  3CPW A;  3W5O A;  3CRK C;  4GOP B;  2DUD A;  1N32 Q;  1E22 A;  5A35 A;  1JCK B;  2B2T A;  1KAA A;  4OIJ A;  1QUQ A;  3GTL H;  4O42 A;  3NTH A;  3DEP A;  2F3I A;  3KDF B;  3DLL A;  2F0P A;  3PO2 H;  2IHF A;  3HKZ B;  2JQO A;  2JN4 A;  2YTY A;  3HOX B;  2CW0 D;  2PCF B;  5G3L D;  4P75 A;  1EWI A;  3A5Z B;  4K14 A;  2A68 C;  4IUU A;  1HZ9 A;  1W6K A;  3RD4 A;  4QUF A;  4S3S A;  3DM1 A;  4H44 C;  1E2W A;  1EY5 A;  4DU9 A;  1K0R A;  5C4J B;  4OO1 H;  1HPC A;  2F0S A;  5I4D A;  1CM9 A;  5C3E B;  1HNZ L;  1HA5 A;  2UUA Q;  1XNR L;  1K9M C;  5DAU A;  1YNN D;  4UHV A;  3OTO Q;  3HOY B;  4JBM A;  2BE5 D;  1UUP A;  2A69 C;  2R7F A;  1LT6 D;  3J7Z C;  3T1H L;  2LKV A;  4KK7 A;  1IBL Q;  4C3I H;  1EEF D;  4B9X A;  3S2D H;  1SNM A;  5FK9 C;  3ERO A;  1D6E C;  3A74 A;  2UXB L;  3F2B A;  3MAQ A;  4JCV E;  3R93 A;  4CDF C;  4X66 Q;  4HJ9 A;  2ZT9 C;  4YWL A;  3QIA A;  4LWC A;  4K2K A;  2ZXR A;  2Q8T A;  2PI2 E;  4UDU C;  1LLR D;  4K6D A;  4DK1 A;  2QKI C;  3NWT A;  5AJ3 L;  1EQT A;  3SHL A;  1SRU A;  2JA8 B;  5IE8 A;  1VQK A;  4DK6 C;  3GO5 A;  3STB C;  4M8A A;  2UXC L;  4L5S A;  5E4W C;  4DV7 Q;  1NR2 A;  4DR7 Q;  3F2U A;  4QF4 A;  2PQA B;  4JI7 Q;  1H9J A;  4F7X A;  3CQZ H;  2NZ1 D;  3F1Z A;  1T5E A;  4KV6 A;  3G6E A;  4ULL A;  3CW2 C;  2HCI A;  2VQE L;  2O5J C;  1Y8N B;  3EIV A;  2OQK A;  1K83 B;  3FPU B;  4N9T A;  1ZYR D;  1ASY A;  2DNC A;  4CBV A;  1X3G A;  4DGZ A;  1ET6 A;  5BR8 L;  1FVI A;  2NUC A;  3TS2 A;  4NP5 A;  4JK1 C;  1JT8 A;  3I56 A;  1PH7 A;  1AN8 A;  3T1Y Q;  1XMQ L;  3S14 H;  4ZKC B;  1PFN A;  4JBW A;  4K2L A;  2PMZ E;  4XDX A;  2QF7 A;  3VDY A;  3HOV H;  3OMC A;  4JG2 A;  2H1E A;  2JA5 H;  4A4I A;  3ZYY X;  4C3H B;  3H0G G;  4HJ5 A;  1YEZ A;  2ZXP A;  4C56 C;  5C44 B;  1E7Z A;  4G4K A;  3CCM A;  4UAI A;  2N3S A;  4C1N I;  1PRT D;  3UI2 A;  5HGT A;  2ZJP A;  3K59 A;  4BA2 I;  5IWA Q;  4A3B B;  1YVC A;  2BH2 A;  1SLJ A;  4GOP A;  1E1O A;  1F2L A;  2K05 A;  3M9B A;  1E1T A;  2EPB A;  2DN8 A;  3GV6 A;  1IBM L;  2AQ1 B;  2BA1 A;  3T16 A;  5FLM G;  1AFP A;  3KDF A;  1SJH D;  2A68 D;  1I3Q B;  4ZQ3 A;  2B2Y A;  3M7N A;  3K6O A;  1EFW A;  3ZJY C;  1TWG B;  1FNU A;  1XYI A;  1PTO B;  5C4Z A;  4L5R C;  2CHB D;  3PO3 H;  2R7Z G;  2HHH Q;  5E7N A;  1X3Q A;  4FF2 A;  2TSS A;  3BJU A;  1WFQ A;  1PH1 A;  4F8M A;  1BF4 A;  4X3T A;  2A69 D;  5EPL A;  3WWV A;  1VQ5 A;  3V96 A;  1SE3 A;  3NEL A;  3LWE A;  5EGT A;  1SMY C;  2UU9 Q;  2JSO A;  1R4P B;  4HIK A;  3GTO H;  2QA4 A;  1L0X B;  2NVT B;  1IYV A;  3J81 L;  4K6L A;  3E5S A;  4FYD A;  1FGU A;  3HOZ G;  5JEA J;  4BXX G;  3FHW A;  3AYH B;  5IOD A;  5JPN C;  1GUT A;  1JOK A;  1RHP A;  1PH2 A;  1WTQ A;  3B6Y A;  4PQX A;  5IT9 L;  3KLR A;  3WOE A;  2Q8I B;  3T53 B;  3V05 A;  3BZC A;  2QDB A;  4G7Z C;  3RZD H;  4B08 A;  1UEB A;  1SDF A;  4B3S L;  1YNJ D;  2NZH A;  5ELO A;  1NCV A;  2VY3 A;  3HOW G;  1SE8 A;  4RHS A;  3KBX A;  2L5T A;  5JOB A;  4ALP A;  1EY7 A;  1VQB A;  3I4O A;  1A6X A;  4LK1 C;  1HXY D;  5BN5 A;  1VQI A;  3VYT A;  3JAM E;  3GV3 A;  2FIN B;  3KK7 A;  1V9P A;  2ZJR A;  1IKM A;  4LF8 L;  3RR5 A;  1X56 A;  1KAW A;  2BDO A;  4QIW B;  1IBK L;  3I72 A;  2R3Z A;  3PMF A;  3C2P A;  3G48 A;  4EVO A;  1YI2 A;  1VQO A;  1KNA A;  3VYR A;  4DR4 L;  4N9P A;  3V2T A;  4WJW A;  1HNZ Q;  4HTH A;  5GAH C;  1WD1 A;  4FF4 A;  4YCW A;  1IZ6 A;  1JB3 A;  4DV6 Q;  3J80 i;  4XQN A;  1R9T H;  1D1I A;  5EPJ A;  4A3M H;  3T1H Q;  1F2Y A;  1TII D;  3M4Y A;  2EVB A;  4FDB A;  1Q8K A;  2E75 C;  2WAQ G;  2KVM A;  5M5Y H;  1DM0 B;  3S1Q B;  5AFW A;  2K6A A;  5C4X H;  3ULP A;  1GXD C;  3M4O B;  1WTW A;  4J1M A;  1LT5 D;  4HR7 B;  3URY A;  1CQV A;  1Y14 B;  1Q81 C;  3GTQ B;  1X32 A;  5LMN W;  1L2F A;  3E0J A;  4YIJ A;  1BXT A;  4J6H A;  3D8G A;  1N36 Q;  2AUK A;  1VQA A;  2A5H A;  2B8G A;  3W3A A;  1J5E L;  2XSC A;  2E2J B;  1RKN A;  2CVR A;  3PIP A;  1Y1V G;  2VQF L;  1A15 A;  1PYB A;  2Q2I A;  1SMY D;  5M3M B;  1VQ9 A;  3S9W A;  3ERS X;  2VQE Q;  3CCV A;  5DM7 3;  3SEB A;  1EU3 A;  4OEL B;  4RKL A;  4TVA B;  4NXN Q;  5T1G A;  1CUK A;  4HIM A;  4JV5 L;  5IGF A;  1Q90 A;  1DYQ A;  1RTN A;  2A19 A;  2R92 G;  5BN3 A;  4A93 B;  4NPS A;  1YHQ A;  3HOZ H;  2N88 A;  3UE0 A;  1U5K A;  1UEA B;  1C7Y A;  2PMZ B;  5CV7 A;  3HFZ B;  2LS0 1;  2RHS B;  4MTN A;  4JVZ A;  1WYD A;  1S5C D;  4BBS B;  1CKO A;  2B3G A;  4NXM L;  4A3G B;  4I7A A;  2E2H B;  4KKU A;  5D3I B;  4BBR H;  3NBH A;  4R4O A;  2RQX A;  2OF1 A;  3I73 A;  3L7Z C;  3LWU A;  5KNC A;  4A3K G;  1VQJ A;  2K5Q A;  5KIX A;  5IGG A;  5C5M A;  5C0X G;  3PIO A;  5IOC A;  2MO0 A;  2ENB A;  3NQI A;  2L12 A;  3MA2 B;  1JB7 A;  2G9D A;  2RDF A;  3IL8 A;  2KCT A;  2ZM6 Q;  1YZ6 A;  1E3P A;  3IRB A;  1EIG A;  1RCV D;  1ENC A;  4KY5 A;  5G3L F;  5JJZ A;  4AQY L;  4O0A A;  3FDT A;  4CDE C;  1MKH A;  1VQP A;  2JYO A;  3R2T A;  4EQP A;  1GOZ A;  2B2W C;  4LUZ A;  3NBI A;  4HID A;  2HQE A;  4KY6 A;  3GTM B;  1EYA A;  2C35 B;  2KUM A;  3S17 B;  4JYA L;  2ID0 A;  2KBN A;  2EYO A;  4I7Z C;  3BS1 A;  2Y0S G;  1XPO A;  1VQ4 A;  5IGB A;  1SYG A;  2CWP A;  3RMH A;  2HD3 A;  3D0F A;  3Q8D A;  1BKB A;  4F88 A;  5CC4 A;  3A56 A;  4BY1 G;  5IYD G;  3ITP A;  5CGK A;  4KKS A;  3K5M A;  5M3F B;  2EQS A;  4GN4 B;  5CV6 A;  4A93 H;  4PG3 A;  2B29 A;  4WJ3 M;  2K14 A;  3BYT B;  3AFQ A;  1TS3 A;  4WJ4 A;  4BY7 H;  1B44 D;  3WDN A;  4OHJ A;  2EXD A;  5EKK A;  4B3S Q;  4J15 A;  1BBW A;  1PH4 A;  3NQT A;  1CT1 D;  1GM5 A;  3J7A 5;  4JPB W;  5FLX L;  2E2H H;  1TWH B;  3R2I A;  2RBM A;  2LMC B;  2F0H A;  3OIQ A;  2L15 A;  1Y1V H;  2Z6K A;  3W1G A;  1I94 Q;  2K5D A;  1BCP F;  3X3M A;  4DAY B;  4A3I B;  1KXL A;  5EJW A;  2WP8 J;  2OEO A;  4Q0F A;  4LF8 Q;  5C3W A;  1LT4 D;  1I4X A;  3M3Y B;  1VQF A;  4YHH L;  4XQQ A;  1VQC A;  2R92 H;  4R8I A;  4DUZ L;  2XVS A;  3TP8 A;  4X3K A;  2IX3 A;  2DJF C;  1S5B D;  4DR4 Q;  1J6Q A;  1NY4 A;  2PZW A;  3TRZ A;  3BVM A;  3SE0 A;  4DNR B;  1SNQ A;  1UWV A;  3HOU B;  4JC0 A;  3BZK A;  3I91 A;  3OHX C;  4P74 A;  4GLV B;  5IIF A;  4PMB A;  2GA4 B;  5LMN L;  3I4M G;  2KEE A;  4B9W A;  2LXJ A;  2DY7 A;  1HFN A;  5C5L A;  2QGQ A;  3TQY A;  2I5L X;  2AHO B;  1K8G A;  1VQ7 A;  5JEA H;  4IPH A;  2K50 A;  2PO4 A;  1LTL A;  1SNO A;  1PMR A;  5EPK A;  2Q8R E;  2E2I H;  4JW0 A;  1HUN A;  5C0X I;  1LV9 A;  1EYC A;  2F52 A;  1PZK D;  1LTB D;  3MXN B;  3GD7 A;  4LAA A;  4XQJ A;  3HEJ A;  4DFA A;  2R93 H;  3I55 A;  1UAP A;  4KJN A;  1STE A;  2JEA I;  1J5E Q;  1JJC B;  3GTP B;  4HED A;  3MWY W;  1FJG L;  2EJM A;  1XJV A;  3L3O C;  1KC8 C;  3QO2 A;  2VQF Q;  2C9O A;  1JMC A;  2VUM H;  1TWH H;  2EZV A;  1E2Z A;  1L1O A;  1SYD A;  1AH9 A;  3TS0 A;  1G29 1;  1SYB A;  4OO1 G;  1EWC A;  1VQE A;  3BU2 A;  4JV5 Q;  3K0X A;  1SFO H;  4KTA A;  1Q3L A;  1PH3 A;  3P7J A;  3QOJ A;  1IHZ A;  1RTO A;  4LFB L;  3A5U A;  3K0Y A;  2L9H A;  3GTG B;  2F0K A;  5ELD A;  4NW2 A;  4C3I G;  1SMX A;  2JA6 H;  2SEB D;  1JWM D;  3K58 A;  4OX9 L;  1J8I A;  1Y1W B;  5COR A;  1LM0 A;  1STY A;  4NXM Q;  3RLO A;  4R4Q A;  3S16 H;  2JA7 B;  3BVG A;  3TEH B;  4MTK A;  1T9H A;  1XWE A;  3J81 c;  2A6H C;  1TS2 A;  3SGI A;  3VR2 A;  1I4G A;  2AQ2 B;  4PV1 C;  2IX0 A;  1F9Q A;  5BN4 A;  1CKM A;  2O4X A;  2WAC A;  1CK1 A;  4C3J B;  1QZG A;  1TWA H;  1WTH A;  3CPF A;  5IT9 c;  4K5V A;  1A2T A;  2NBF A;  1OXS C;  3TME A;  3LNN A;  4DAY A;  5FOB B;  1IW7 C;  2RDH A;  1MSH A;  2ES2 A;  2BDN A;  1EZ8 A;  1FNV A;  2WB1 G;  1D2B A;  3SK8 A;  2HDM A;  3VR3 A;  3U9S A;  2KCC A;  3R8B A;  5CYU A;  3FEW X;  3I4N B;  3HKZ G;  1BOS A;  2AKW B;  4ZRZ A;  1JQY D;  1S4Z A;  4IJL A;  3HOX G;  2NVX H;  4R4T A;  1PZI D;  2B39 A;  1CQF A;  4KD3 A;  4JYA Q;  1EIF A;  3D6C A;  2CKZ B;  2RHQ B;  1HQM C;  3JAM L;  4ODG A;  1CSQ A;  4A3D B;  2NTS A;  1MD2 D;  4LF6 Q;  2JA5 G;  2K5N A;  2EYH A;  3NHH A;  5C3E G;  1U0L A;  4KN7 C;  3S1R H;  4KHZ A;  4KHV A;  1VQN A;  4OGQ C;  3S1M H;  1TWC H;  4GNX A;  1M4V A;  3C1E A;  2EOT A;  2F0F A;  1PFB A;  3OMG A;  2RCN A;  1F2Z A;  1TWF B;  4XTC S;  1O7Z A;  3M85 A;  3C46 A;  1AZP A;  3MXN A;  5E3F A;  1I6H B;  3CKI B;  4RCN A;  4KLK A;  1DOL A;  2EDG A;  4LUO A;  4LF7 L;  2EJG C;  3E6Z X;  2RKS A;  3G7L A;  5DEH A;  2IL8 A;  4LMQ D;  4P2C B;  2EIF A;  1A3U A;  4H02 A;  4QIW E;  3DXJ C;  3PO3 G;  2K5W A;  2J4X A;  2Q2H A;  4DR1 L;  1SE4 A;  1HFG A;  4JI3 Q;  4YY3 L;  2XWB B;  3G71 A;  4CKE A;  4YHH Q;  1UNS A;  3T4A C;  4OO1 I;  4DUZ Q;  3N52 A;  4AYB B;  2ZTE A;  1QNK A;  1QVG A;  2SDF A;  2KED A;  4L63 B;  2NTT A;  1K3R A;  1IL8 A;  2A6E C;  3CC7 A;  2EY2 A;  5LHY 1;  4UP8 A;  3I2Z A;  3LX0 A;  4XYQ A;  1JWU D;  3W1B A;  4DNI A;  2A6H D;  5CR3 A;  4C2M B;  4K0K L;  3RZO H;  4MN3 A;  1TU2 B;  1C8C A;  1S72 A;  1HNX L;  1NSN S;  5C6A A;  1K73 C;  4R4I A;  2BA0 A;  1STG A;  1G2T A;  2F0N A;  1I4Q A;  5C44 G;  4OON A;  2KOL A;  1CKN B;  1CHP D;  4CKC A;  1WTP A;  1GJX A;  1H95 A;  2FXQ A;  1PRT B;  1BCP D;  2MNA A;  4C1N K;  1PXU A;  3H15 A;  4A3B G;  2NN6 G;  2V1C C;  1O7Y A;  3ONA B;  3UE1 A;  2YU9 B;  2IX1 A;  2M9V A;  2F0J A;  1DJR D;  4DR3 Q;  4RKB A;  4P72 A;  1RF2 D;  1BR9 A;  2BCO A;  3HOX H;  1EYD A;  1RDP D;  2ZTC A;  1U9R A;  1D5X C;  4Y52 H;  4IUT A;  1EU4 A;  1TY2 A;  2CCZ A;  2A73 B;  5C4J H;  1YIT A;  4R4C A;  5C3E H;  1LAC A;  2CWA A;  4A3M G;  1XPU A;  1VQ8 A;  1MGS A;  3HOY H;  1U4P A;  3I4L A;  4DV5 L;  2HT1 A;  4G7H C;  2K7V A;  3HRZ C;  4A3C G;  1PYS B;  5C4X G;  5KNB A;  4R8N A;  1ASZ A;  4ME3 A;  2VB2 X;  3W2D A;  1Q12 A;  2E8G A;  5F2D A;  3PSI A;  3ULJ A;  1V1P A;  1W3S A;  3KJP A;  4RAU C;  4ZKB B;  3I8Z A;  5J39 A;  4RGN A;  4UY8 C;  3HKS A;  4QCL A;  4HIO A;  4ILW A;  2JA8 H;  1X54 A;  1UE6 A;  3IFT A;  1STN A;  1IKL A;  1C0A A;  1HH2 P;  2VW9 A;  1SJE D;  4JI8 L;  5FLX c;  1TY0 A;  3MEH A;  4TQU S;  4DF7 A;  2D0P A;  1DXM A;  3K8A A;  2F4I A;  1SYE A;  1K83 H;  2FMM A;  2L0C A;  1EZ6 A;  1TR5 A;  1HR0 W;  1E2V A;  3T51 B;  3CCL A;  3CCE A;  1OO9 B;  1XTD A;  4DV2 L;  3H0G B;  2VS1 A;  1UE7 A;  5GQO A;  4BS9 A;  4DV0 L;  1Z6H A;  1KTK A;  2LY7 A;  5IP9 H;  4L8J A;  3STB D;  3KOJ A;  3NBH B;  4BBR G;  4C3H H;  4HCE A;  3PUV A;  4ABN A;  1Y69 U;  5C44 H;  4GZY C;  3NSW A;  1CKN A;  3TP6 A;  1JIC A;  1U4M A;  1C48 A;  1A0I A;  1Q1B A;  1NNX A;  1TS4 A;  1QVF A;  3NTK A;  2UUC L;  2K04 A;  2QW7 A;  2F0L A;  1FNW A;  4IOA A;  4A3B H;  1TKW B;  2NN6 H;  5KGU A;  4LF7 Q;  2IJ0 A;  5I9O A;  2R7Z B;  2L4N A;  1VQL A;  2NVQ B;  2NN6 I;  4JBK A;  3SR1 A;  1PA6 A;  4JI6 L;  3L9A X;  3J7Y W;  1I3Q H;  3OWE B;  2L11 A;  4K5X A;  1U4L A;  2IWH A;  3K5O A;  1EY9 A;  1FD7 D;  1TWG H;  2N49 A;  3PGZ A;  3SDZ A;  1PTO H;  2OXP A;  4HSP A;  1WTO A;  4G57 A;  3KBG A;  4IFD J;  5CMD A;  1JE5 A;  1H9S B;  4GN3 B;  4UP9 A;  4YCU A;  1XNR Q;  2CFM A;  2MFI A;  1H9K A;  4JI0 L;  2WFW A;  3EQL C;  3TN2 A;  1WCM B;  2SNS A;  1WOC A;  1V8Q A;  3ICE A;  1ESF A;  1GO3 E;  1QG7 A;  5HGQ A;  2GVA A;  4HJ8 A;  3CC2 A;  1EIH A;  3FVQ A;  1VF5 C;  1SAP A;  2SNM A;  3GP7 A;  3DHQ A;  4A3C H;  1A3V A;  4GKK L;  2NVT H;  2UXB Q;  1S5F D;  4A93 G;  4EQO A;  2XIW A;  2OCE A;  5JJK A;  2KHJ A;  2F0W A;  4LF4 L;  3KF6 A;  2CH4 W;  1B2T A;  1SEB D;  4BY7 G;  3HOW B;  4MZ9 A;  4PZ7 A;  2MHV A;  1HNX Q;  1GD7 A;  2HIX A;  3QJY A;  3UDI A;  2NWG A;  3U9O A;  3CME A;  4DA2 A;  5AJ3 Q;  3S1N B;  1A3T A;  3E3X A;  4LW1 A;  3A8I E;  1BQQ T;  1UE5 A;  5DM6 3;  4K5W A;  1Q7Y C;  4CDD C;  2ZXO A;  1CA6 A;  1K8A C;  2UXC Q;  2JXM B;  1I50 B;  4PZ6 A;  5LL6 X;  5IGE A;  5K36 H;  4HJA A;  5DLQ E;  1NMG A;  2B2U C;  1S5D D;  3BDO A;  4PMC A;  3TP7 A;  1EQV A;  1G2S A;  1QB5 D;  3SK4 A;  2NYZ D;  3SK5 A;  2MPM A;  2WKC A;  2WV6 D;  1WTR A;  4IN3 A;  2E5L L;  5EQ0 A;  3A8K E;  3DWQ A;  1II3 A;  3LGJ A;  5BR8 Q;  2XNA C;  4FXD A;  2YTX A;  3G6J B;  3AFP A;  5IP7 G;  1XMQ Q;  1U4R A;  3M4Q A;  4OL7 A;  3SK6 A;  3PUY A;  1PHJ A;  1F2M A;  1D5M C;  3E9H A;  4IJH A;  4JOI C;  4DXF A;  4KJO A;  4O2D A;  1VF7 A;  4ZCK A;  1DON A;  1XMO L;  1QJO A;  3J80 L;  3NUC A;  4QB4 A;  3J81 j;  1HNW L;  1LO5 D;  5CV5 A;  3OSO A;  4Y7N B;  1EL0 A;  2ICE C;  2RF4 A;  3F8T A;  1V43 A;  1B50 A;  3SVM A;  1B9N A;  1E24 A;  5C3X A;  2E74 C;  3MEF A;  2Z0S A;  5JEA G;  3S15 B;  1LTA D;  2RCF A;  4WFN 3;  4DR5 L;  3KF8 A;  1JOR A;  1EQR A;  4K8I A;  3JAM c;  3S2H B;  1C9O A;  2MO1 A;  3S1Q H;  4N8X 1;  5M3F G;  1IBM Q;  4X64 L;  3M4O H;  2XGT A;  3FP9 A;  1ZXT A;  2B2V C;  4HMI A;  3QWN A;  1Q86 C;  3GTK B;  3E9I A;  1VQD A;  4A3F B;  4RG1 A;  3GTQ H;  4QY7 A;  1X55 A;  4B3M L;  2R93 G;  5I6Y A;  3BZD B;  4EQ5 A;  4JI1 L;  2IY5 B;  2B63 B;  4DAP A;  1B3A A;  4RGT A;  3RN2 A;  1D8L A;  5K5P A;  1ML0 D;  2C5C A;  4X3U A;  3D3R A;  1NBW A;  3M7G A;  1MHW C;  1QZH A;  2F3W A;  2VUM G;  2IW3 A;  2E2J H;  1L1O B;  1I50 H;  3E0E A;  1Y8P B;  1H9S A;  4UPA A;  1ENF A;  4XT1 B;  4JI8 Q;  1KLU D;  3VYS A;  1VMP A;  4DUY L;  5M3M H;  3VA7 A;  4A3I G;  2K75 A;  4KKT A;  3NEM A;  2VNU D;  3F2D A;  2EYM A;  2NVY B;  4X65 L;  1GUS A;  3TRE A;  4AH6 A;  2HCC A;  1EIY B;  1I4R A;  1Q8I A;  2MGS A;  2JA6 G;  1NUC A;  1QOH A;  3GTJ B;  1JC7 A;  2KHI A;  1CA5 A;  1QIL A;  1B1Z A;  1KAB A;  4JI5 L;  4DV0 Q;  2N55 A;  1S5E D;  4X6A H;  1OXX K;  1F77 A;  4A3K B;  4GS3 A;  4P73 A;  4LUV A;  5HUR A;  4BBS H;  5JJL A;  4A3G H;  1PFS A;  5EAY A;  3K7A B;  4DAM A;  3DUZ A;  3I70 A;  2CH4 A;  3DWA A;  1FR3 A;  1IL2 A;  4A3J B;  2UUC Q;  1RL2 A;  2L55 A;  2B2T C;  1JJ2 A;  5GAG C;  2F4V L;  4UP7 A;  3RLF A;  3K5N A;  3S2H H;  1MI2 A;  1N32 L;  2Z6B A;  3K5L A;  1P16 A;  3HZX A;  5HY6 A;  2QDL A;  1IBK Q;  1F9S A;  1PLF A;  5M5X B;  4QGU A;  1PZJ D;  2DJG C;  3J81 E;  4AYB E;  2JE6 I;  4QUC A;  2F0Q A;  5IP7 H;  1K8O A;  2YYZ A;  3D31 A;  2EY6 A;  4YWM A;  4J8Q A;  3NTI A;  4OEM B;  3K81 C;  1V1O A;  2UXD L;  4PMW A;  5IT9 E;  5IYC H;  4GKJ L;  4L5T A;  1O7L A;  1S40 A;  4BY1 B;  2EYL A;  4AIM A;  3GTM H;  1DZ1 A;  3S17 H;  4ME5 A;  5EBC A;  3D6W A;  1MBY A;  1SRO A;  2GN5 A;  1PH9 A;  2K33 A;  2VL6 A;  3R3O A;  5IGC A;  3H3V C;  4DR2 L;  4GKK Q;  1XNQ L;  2KA7 A;  4GNX B;  2PNR C;  5M3F H;  5D14 A;  4ZLT F;  3BYY B;  2I5H A;  3ND9 A;  2K52 A;  1NE3 A;  2I5M X;  1SE2 A;  1SSO A;  1L0W A;  3D4R A;  1T5X D;  5E4X A;  3P75 A;  4FO2 A;  2VB3 X;  3MFG A;  1ICW A;  1I4P A;  2F0T A;  1CI3 M;  1X3P A;  3NEN A;  5J1Z A;  4A3J H;  2K5V A;  4O1N A;  1IYJ B;  4C3J G;  5IY0 A;  2AWN A;  3TDQ A;  2XRS D;  3RN5 A;  1LT3 D;  1AZQ A;  4BA1 I;  4A3I H;  2IT1 A;  3M3Y H;  1AP0 A;  4XYO A;  3Q23 A;  3MXU A;  4OWX B;  1XPR A;  1GHK A;  2OT2 A;  4IFD H;  1JR0 D;  1XMO Q;  1WVL A;  3I4M B;  1BBU A;  3I4N G;  3DM3 A;  3PUW A;  1HNW Q;  1EY4 A;  3HOU H;  3BDL A;  3CCJ A;  3CRL C;  3KUP A;  2AWO A;  1NAP A;  4R9W A;  4CHT B;  5M5W B;  3VA5 A;  5EKL A;  2FFK B;  3I7F A;  1STA A;  2F1M A;  4WOR A;  3RNU A;  3Q22 A;  4A3E B;  3C3L A;  1LYL A;  3CCR A;  5JVG 3;  4DR5 Q;  1PVO A;  2HQL A;  5H1S E;  1OXT A;  4GOP C;  2F3V A;  4TRD A;  1KDA A;  3DWP A;  3GTL B;  3GDE A;  2YTV A;  1DOM A;  1VQH A;  1Z9F A;  3PO2 B;  2LSS A;  2B2Y C;  3I3C A;  4B3M Q;  2EYP A;  1O80 A;  2GVB A;  2B8F A;  4FVM A;  3VR4 A;  4AQY Q;  2EJF C;  1AE3 A;  1SNP A;  2EE1 A;  3FKI B;  1L0Y B;  1WJJ A;  2FJ2 A;  3GTP H;  4GLA C;  1D1K A;  2L1B A;  2F0U A;  2UUB L;  4H13 C;  2X6L A;  2K01 A;  2YV5 A;  1KDC A;  2KCN A;  2ICI A;  1LTG D;  2B2W A;  2CQO A;  4DUY Q;  1N9W A;  4IPG A;  4F87 A;  4QJF A;  5T1I A;  4QL5 A;  2WIN B;  1LTS D;  4X65 Q;  1G91 A;  1XTC D;  5LMU L;  3S2D B;  2RSO A;  4EQN A;  4KN4 C;  3HOY G;  4LFA L;  4G7O C;  3VR6 A;  1RIP A;  3PIP 3;  2H4O A;  1MJC A;  1JOO A;  2X69 A;  3MZ5 A;  5CV8 A;  3PUX A;  1VCI A;  4OWT B;  3GTG H;  1ROD A;  4JI5 Q;  1EYG A;  1NMF A;  3OW7 A;  1KIX A;  1BO0 A;  3H3V H;  1NR4 A;  1Y1W H;  4IUQ A;  1V1P B;  4DPG A;  1LTR D;  4JBJ A;  1G51 A;  2K5H A;  3UDX A;  2Z1C A;  1N33 L;  4FP5 D;  3H3V I;  1A8V A;  2JA7 H;  2LFN A;  3NXW A;  3PV0 A;  1DCZ A;  4YCV A;  3H94 A;  3ULL A;  1G6Z A;  4KMU C;  4WRD A;  3CQZ B;  4TKO B;  1PRT C;  2E76 C;  5KEE A;  4FF1 A;  2JA8 G;  1TQO A;  1VQ6 A;  4B3T L;  5TSS A;  3KLW A;  4C3J H;  3CCQ A;  4DR6 L;  1K3B C;  1X3F A;  1RD9 D;  3F2C A;  4MHE A;  4A3L H;  4HJ7 A;  1ONL A;  3P1H A;  2SOB A;  1SR3 A;  1BCP B;  3S14 B;  3AQQ A;  4CJ0 B;  3H6M A;  1B7Y B;  2IHE A;  3HOV B;  3PIO 3;  1CZG A;  1ILP A;  2UXD Q;  3I4N H;  3BVZ A;  3T13 A;  3OIP A;  1FYC A;  3FKI H;  1YIJ A;  4GKJ Q;  2JA5 B;  1D7Q A;  1C4Q A;  4EGV A;  5LMN Q;  3CCU A;  3EJI A;  1HHV A;  2ATW A;  4M1U B;  1SYC A;  1PDQ A;  2CQA A;  4DV6 L;  2F0G A;  3A0J A;  4BWG B;  2K03 A;  4R1J A;  2QCP X;  5FLX E;  5IP9 G;  4A3D H;  4C3H G;  1K28 A;  4DR2 Q;  1XNQ Q;  3CP0 A;  2PZT A;  3CU7 A;  3J80 c;  1WTV A;  1IW7 D;  4JI4 L;  1YJW A;  1PH8 A;  3SXH A;  3Q24 A;  1TVX A;  2DNE A;  1OXV A;  2EY5 A;  3A54 A;  4JI2 L;  2MP1 A;  4KY7 A;  5GRO A;  2EYF A;  5IYB H;  5IGD A;  4XT3 B;  2F0O A;  2A8V A;  3QB3 A;  3PO3 B;  1TWF H;  1PTO C;  3MHB A;  1FJG Q;  2OWO A;  3CD6 A;  4KD4 A;  2EYJ A;  2P5Z X;  1N36 L;  1I6H H;  1QWY A;  2VXW A;  5ELE A;  1W6J A;  1VMC A;  2ALY B;  1YNJ C;  4IAL A;  4V0B A;  4CGY B;  3CF5 A;  4X62 L;  5A2Q E;  3FMC A;  1SBB B;  4HMJ A;  1B70 B;  4IZ8 A;  1YNX A;  1GUO A;  3GTO B;  1X9N A;  4NXN L;  2NZO A;  4LFB Q;  2WAQ E;  5JVH 3;  5ELC A;  2WKD A;  2HDL A;  1CFM A;  4OX9 Q;  2XTI A;  3H09 A;  5FJ8 H;  4Z9C B;  5CV9 A;  3PCO B;  1KDB A;  2LXK A;  5KND A;  3J81 i;  3IFD A;  1DGS A;  3RZD B;  1EEI D;  1GKH A;  3KF6 B;  4Q5V A;  2MUY A;  3EA6 A;  3J7A V;  5LL6 S;  4C2M H;  4DV1 L;  4MNO A;  4APV A;  1FL0 A;  4FXG C;  1HZA A;  4FF3 A;  1JOQ A;  1ET9 A;  2KJX A;  3PF4 A;  2RVL A;  1CSP A;  5K36 G;  3A7A B;  2PW7 A;  1KHI A;  4U68 A;  1Q82 C;  2AUJ D;  3MTS A;  2ZM6 L;  3G4S A;  2A6E D;  3CXC A;  2E2D C;  5ELF A;  2JJQ A;  3N6R A;  1EUJ A;  4CKB A;  2YU9 H;  1P8L A;  4QMG A;  2X6G A;  3FPP A;  3TSS A;  2WII B;  1X6O A;  2UUB Q;  2PZU A;  1Z7T A;  4H7B A;  1R9T B;  4A3M B;  4DV4 L;  3BG3 A;  4NMZ A;  1Q1E A;  4NKL A;  2QEX A;  1O78 A;  5I2X A;  5LMU Q;  5M5Y B;  3X3N A;  5C4X B;  2PYK A;  2K32 A;  1WCM G;  4RWS C;  4LFA Q;  3CAM A;  4DN4 M;  5C0X J;  2A74 C;  3KF8 B;  4LF9 L;  3U4Z A;  1ZKO A;  3CHB D;  1EOT A;  2N78 A;  3C1F A;  2MJ8 A;  1PTO D;  4POF A;  5J22 A;  1QNU A;  3NE5 B;  4OIK A;  2F0I A;  3NWS A;  3NPP A;  1CZW A;  1N33 Q;  1ICF B;  2EXZ A;  1TT2 A;  2R61 A;  5FO9 B;  1DOK A;  2R6G A;  2Q2T A;  1G8Z D;  4POG A;  2Z6K C;  1M8A A;  4HN7 A;  4DR1 Q;  4IO9 A;  2J7Z A;  4B3T Q;  3NP8 A;  4YY3 Q;  4KHP L;  4FXK C;  1GUG A;  1KRS A;  2PQA A;  3A8J E;  1I94 L;  1X3E A;  3TP5 A;  2Z4I A;  2Y0S E;  4DR6 Q;  3RLN A;  5M3M G;  3HOZ B;  3A7L A;  1A2U A;  1ESR A;  5KRU A;  4GLX A;  3HP3 A;  5M9O A;  4IOC A;  1D5Z C;  1BUV T;  1J9O A;  1XXG A;  3JC6 6;  5FO8 B;  5L37 A;  2V4D A;  3EFX D;  4HCS A;  1A62 A;  1KRT A;  4K0K Q;  1STB A;  4BBR B;  1PV4 A;  4ID6 A;  4XIG S;  1AE2 A;  3H0G H;  4RA8 A;  2RDG A;  3CMA A;  1KD1 C;  5KYI A;  4LNQ A;  1LTI D;  2FHT A;  2JK8 A;  4BBS G;  4IPD A;  2KHS A;  3WOF A;  4A3G G;  2HIV A;  3H91 A;  1KQS A;  2KEC A;  1NJI C;  1QE6 A;  4KI0 A;  4JI4 Q;  1PFM A;  3ER0 A;  3TBI B;  2F0E A;  2JP1 A;  1TS5 A;  2I0Q A;  1ZEQ X;  2K28 A;  4JI2 Q;  2PW5 A;  3EVQ A;  2PPB C;  5FLM H;  4NDX A;  1EY6 A;  1W2B A;  2AQ3 B;  1LTT D;  3UDF A;  5I2Y A;  2OTJ A;  1SN8 A;  2D2C C;  2R7Z H;  4IUP A;  1BDO A;  2NVQ H;  4A3F G;  3K7U C;  1L1O C;  4X62 Q;  2B63 G;  1N34 L;  3MVV A;  1EQQ A;  3KFU A;  3TZD A;  1UE1 A;  4LFC L;  4EX5 A;  1O7I A;  1EWH A;  5IYC G;  2F03 A;  1CHQ D;  2WAQ B;  1I5F A;  5KYL A;  4DV3 L;  4A75 A;  3O13 A;  1RJT A; 
#chains in the Genus database with same CATH homology
 3RUZ A;  5D65 A;  2QEJ C;  4U67 3;  4BY7 B;  1B4O A;  1STH A;  1B9M A;  3D4D A;  4TSS A;  1KLG D;  2F0M A;  1K8M A;  3PUZ A;  5NUC A;  3J7A F;  1Y1V B;  3MFY A;  2XRQ D;  2KQ3 A;  4PNY A;  4RFB A;  1SND A;  1KNE A;  3VYU A;  4E6I A;  2J0T D;  4I65 A;  2R92 B;  1H9M A;  1HTL D;  4ZYS A;  1WTX A;  2BOS A;  2O2L D;  2Z4H A;  4ZK9 B;  1Z47 A;  1R4Q B;  4IFD G;  1HCZ A;  2D5D A;  1GHJ A;  4IUV A;  3Q6S A;  1FGB D;  3HGB A;  1JWS D;  3IKJ A;  3VR5 A;  4V19 0;  1H9R A;  2E2I B;  1XX8 A;  4RGM A;  2K1B A;  4ZAI A;  1PYW D;  3DEO A;  1CTM A;  1B53 A;  2R93 B;  3Q0A A;  4HSV A;  1IYU A;  5I9P A;  2DY8 A;  5EBD A;  2VUM B;  4RHR A;  3HG9 A;  4FNF A;  1BNZ A;  2JEB I;  2RA4 A;  2Y0S B;  5ISR A;  1SFO B;  2F0V A;  2HUG A;  4DAV A;  2IPK D;  1ILQ A;  3FRP B;  2JA6 B;  1HUM A;  3AB9 A;  1HA6 A;  5CBA E;  5CV4 A;  5I6W A;  1I6V C;  3HS0 C;  3S16 B;  1F9P A;  1E0B A;  3A55 A;  4IQZ A;  2EY1 A;  5A2Q L;  4X3S A;  1ENA A;  1PRT F;  1HTP A;  5C4H A;  4IUR A;  4MIU A;  1TWA B;  3IAY A;  3DMU A;  2QIL A;  5C0X H;  5FO7 B;  3TZU A;  1VDZ A;  3OWF A;  3QOL A;  2Z8L A;  2B2U A;  4ZUI A;  1EY0 A;  2XN9 C;  3BDC A;  2NVX B;  5D3D A;  1HRJ A;  3GQB A;  5FKA C;  5JPM C;  2CW0 C;  3KLS A;  4RGO S;  3I90 A;  4CJ1 B;  1SNC A;  1JE4 A;  3AMU A;  4IFD I;  3OOC A;  5DNF A;  1BBX C;  5EKI A;  4H0L C;  3S1R B;  1EFI D;  2I07 B;  4DXG A;  3S1M B;  1TWC B;  1YNN C;  2I46 A;  3ERQ A;  4IUN A;  2BE5 C;  1HQR D;  3P20 A;  2PQE A;  3OPO A;  1PTO F;  1GUW A;  2O5I C;  1I4H A;  1SXT A;  1DD2 A;  2XWJ B;  3K57 A;  1WD0 A;  5COY A;  1AW7 A;  3T56 B;  4XXE A;  2B2V A;  4HAE A;  2NB0 A;  3MXP A;  3KLS X;  3J80 E;  1AEX A;  2RSN A;  2G9H D;  4K8J A;  4L6T B;  1SYF A;  1BCP C;  3ND8 A;  3QG1 A;  4C3I B;  5JAV A;  2D62 A;  4RCO A;  5CBE E;  2FMC A;  2M2L A;  1ZYR C;  2D9U A;  2M00 A;  3AU7 A;  3RZO B;  1F9R A;  1MSG A;  3MC0 B;  2TMP A;  4CJ2 C;  1EY8 A;  1QCB D;  1LAB A;  4LJZ C;  3MXG A;  5ELB A;  1Y8O B;  1GUN A;  3D4W A;  5E1F A;  1OXU A;  4DK0 A;  3NK9 A;  2F0D A;  4ZUJ A;  4DNT B;  4RH6 A;  2WB1 B;  3CRK C;  5A35 A;  1JCK B;  2B2T A;  1KAA A;  4OIJ A;  4O42 A;  3NTH A;  3DEP A;  2F0P A;  3HKZ B;  3HOX B;  2CW0 D;  2PCF B;  5G3L D;  4K14 A;  2A68 C;  4IUU A;  1W6K A;  4QUF A;  3RD4 A;  4S3S A;  3DM1 A;  4H44 C;  1E2W A;  1EY5 A;  4DU9 A;  5C4J B;  4OO1 H;  1HPC A;  2F0S A;  5I4D A;  1CM9 A;  5C3E B;  1HA5 A;  5DAU A;  1YNN D;  3HOY B;  2BE5 D;  1UUP A;  2A69 C;  1LT6 D;  2LKV A;  4KK7 A;  1EEF D;  4B9X A;  1SNM A;  5FK9 C;  3ERO A;  1D6E C;  3MAQ A;  3R93 A;  2ZT9 C;  3QIA A;  4K2K A;  2ZXR A;  2Q8T A;  4UDU C;  1LLR D;  4K6D A;  4DK1 A;  2QKI C;  3NWT A;  1EQT A;  3SHL A;  2JA8 B;  3GO5 A;  4M8A A;  5E4W C;  1NR2 A;  3F2U A;  4QF4 A;  1H9J A;  4F7X A;  2NZ1 D;  4KV6 A;  1T5E A;  4ULL A;  2HCI A;  2O5J C;  1Y8N B;  4N9T A;  1K83 B;  3FPU B;  1ZYR D;  2DNC A;  4CBV A;  4DGZ A;  1ET6 A;  2NUC A;  4NP5 A;  4JK1 C;  1AN8 A;  4ZKC B;  1PFN A;  4JBW A;  4K2L A;  4XDX A;  2QF7 A;  3OMC A;  2H1E A;  3ZYY X;  4C3H B;  2ZXP A;  4C56 C;  5C44 B;  4G4K A;  4UAI A;  4C1N I;  1PRT D;  3UI2 A;  5HGT A;  3K59 A;  4BA2 I;  4A3B B;  1F2L A;  2K05 A;  2EPB A;  2DN8 A;  3GV6 A;  2AQ1 B;  2BA1 A;  3T16 A;  1AFP A;  1SJH D;  2A68 D;  1I3Q B;  4ZQ3 A;  2B2Y A;  3M7N A;  3K6O A;  1TWG B;  1FNU A;  1XYI A;  1PTO B;  5C4Z A;  2CHB D;  1X3Q A;  4FF2 A;  2TSS A;  4F8M A;  1BF4 A;  4X3T A;  2A69 D;  5EPL A;  3V96 A;  1SE3 A;  3LWE A;  5EGT A;  1SMY C;  2JSO A;  1R4P B;  2NVT B;  1L0X B;  1IYV A;  3J81 L;  4K6L A;  3E5S A;  4FYD A;  5JEA J;  5IOD A;  5JPN C;  1GUT A;  1JOK A;  1RHP A;  1WTQ A;  4PQX A;  5IT9 L;  3KLR A;  3WOE A;  2Q8I B;  3T53 B;  3V05 A;  4G7Z C;  2QDB A;  4B08 A;  1SDF A;  1YNJ D;  1NCV A;  4RHS A;  3KBX A;  2L5T A;  5JOB A;  1EY7 A;  1A6X A;  4LK1 C;  1HXY D;  5BN5 A;  3VYT A;  3JAM E;  3GV3 A;  2FIN B;  3KK7 A;  1IKM A;  2BDO A;  4QIW B;  3I72 A;  2R3Z A;  3PMF A;  3C2P A;  4EVO A;  1KNA A;  3VYR A;  4N9P A;  3V2T A;  4WJW A;  4HTH A;  1WD1 A;  4FF4 A;  1JB3 A;  4XQN A;  1D1I A;  5EPJ A;  1F2Y A;  1TII D;  3M4Y A;  2EVB A;  2E75 C;  2KVM A;  1DM0 B;  3S1Q B;  5AFW A;  2K6A A;  1GXD C;  3M4O B;  1WTW A;  4J1M A;  1LT5 D;  4HR7 B;  3URY A;  1CQV A;  3GTQ B;  1X32 A;  3E0J A;  4YIJ A;  1BXT A;  4J6H A;  3D8G A;  2AUK A;  2A5H A;  2B8G A;  3W3A A;  2XSC A;  2E2J B;  1RKN A;  2CVR A;  1A15 A;  1SMY D;  5M3M B;  3S9W A;  5DM7 3;  3SEB A;  1EU3 A;  4RKL A;  5T1G A;  5IGF A;  1Q90 A;  1DYQ A;  1RTN A;  5BN3 A;  4A93 B;  2N88 A;  1UEA B;  2PMZ B;  5CV7 A;  2LS0 1;  1S5C D;  4BBS B;  4A3G B;  2E2H B;  4KKU A;  5D3I B;  3NBH A;  2RQX A;  2OF1 A;  3I73 A;  3L7Z C;  3LWU A;  5KNC A;  2K5Q A;  5KIX A;  5IGG A;  5C5M A;  5C0X G;  5IOC A;  2ENB A;  3NQI A;  2L12 A;  3MA2 B;  2G9D A;  2RDF A;  3IL8 A;  1EIG A;  1RCV D;  1ENC A;  4KY5 A;  5G3L F;  5JJZ A;  3FDT A;  2JYO A;  4EQP A;  3R2T A;  1GOZ A;  2B2W C;  3NBI A;  2HQE A;  4KY6 A;  3GTM B;  1EYA A;  2KUM A;  3S17 B;  2ID0 A;  2EYO A;  4I7Z C;  3BS1 A;  5IGB A;  1SYG A;  3RMH A;  4F88 A;  5CC4 A;  3A56 A;  3ITP A;  5CGK A;  4KKS A;  3K5M A;  5M3F B;  5CV6 A;  3BYT B;  1TS3 A;  1B44 D;  3WDN A;  4OHJ A;  5EKK A;  3NQT A;  1CT1 D;  5FLX L;  1TWH B;  3R2I A;  2RBM A;  2LMC B;  2F0H A;  3OIQ A;  2K5D A;  1BCP F;  3X3M A;  4A3I B;  5EJW A;  2WP8 J;  2OEO A;  4Q0F A;  5C3W A;  1LT4 D;  1I4X A;  3M3Y B;  4XQQ A;  4R8I A;  2XVS A;  3TP8 A;  4X3K A;  2IX3 A;  1S5B D;  2PZW A;  3BVM A;  3SE0 A;  4DNR B;  1SNQ A;  3HOU B;  3I91 A;  3OHX C;  5IIF A;  4PMB A;  2GA4 B;  2KEE A;  4B9W A;  2DY7 A;  1HFN A;  5C5L A;  5JEA H;  2PO4 A;  1SNO A;  1PMR A;  5EPK A;  2Q8R E;  1HUN A;  5C0X I;  1LV9 A;  1EYC A;  1PZK D;  1LTB D;  3GD7 A;  4LAA A;  4XQJ A;  3HEJ A;  4DFA A;  1UAP A;  4KJN A;  1STE A;  2JEA I;  3GTP B;  4HED A;  3MWY W;  2EJM A;  3L3O C;  3QO2 A;  2C9O A;  2EZV A;  1E2Z A;  1SYD A;  1G29 1;  1SYB A;  4OO1 G;  1EWC A;  4KTA A;  1Q3L A;  3P7J A;  3QOJ A;  1IHZ A;  1RTO A;  3K0Y A;  2L9H A;  3GTG B;  2F0K A;  5ELD A;  4NW2 A;  4C3I G;  2SEB D;  1JWM D;  3K58 A;  1J8I A;  1Y1W B;  5COR A;  1STY A;  2JA7 B;  3BVG A;  1XWE A;  2A6H C;  1TS2 A;  3VR2 A;  1I4G A;  2AQ2 B;  4PV1 C;  2IX0 A;  1F9Q A;  5BN4 A;  2O4X A;  2WAC A;  1CK1 A;  4C3J B;  4K5V A;  1A2T A;  2NBF A;  1OXS C;  3TME A;  3LNN A;  4DAY A;  5FOB B;  1IW7 C;  2RDH A;  1MSH A;  2BDN A;  1EZ8 A;  1FNV A;  1D2B A;  3SK8 A;  2HDM A;  3VR3 A;  3U9S A;  2KCC A;  3R8B A;  5CYU A;  3FEW X;  3I4N B;  1BOS A;  4ZRZ A;  1JQY D;  1S4Z A;  1PZI D;  2B39 A;  1CQF A;  4KD3 A;  3D6C A;  1HQM C;  3JAM L;  4ODG A;  4A3D B;  2NTS A;  1MD2 D;  2EYH A;  3NHH A;  4KN7 C;  4KHZ A;  4KHV A;  4OGQ C;  1M4V A;  3C1E A;  2EOT A;  2F0F A;  1PFB A;  3OMG A;  1F2Z A;  1TWF B;  4XTC S;  1O7Z A;  3M85 A;  3C46 A;  1AZP A;  3MXN A;  5E3F A;  1I6H B;  3CKI B;  4RCN A;  1DOL A;  2EDG A;  2EJG C;  3E6Z X;  2RKS A;  3G7L A;  5DEH A;  2IL8 A;  4LMQ D;  4P2C B;  1A3U A;  3DXJ C;  2K5W A;  2J4X A;  1SE4 A;  1HFG A;  2XWB B;  4CKE A;  1UNS A;  3T4A C;  4OO1 I;  3N52 A;  4AYB B;  1QNK A;  2SDF A;  2KED A;  4L63 B;  2NTT A;  1IL8 A;  2A6E C;  2EY2 A;  5LHY 1;  3LX0 A;  4XYQ A;  1JWU D;  2A6H D;  5CR3 A;  4C2M B;  4MN3 A;  1TU2 B;  1C8C A;  1NSN S;  5C6A A;  2BA0 A;  1STG A;  1G2T A;  2F0N A;  1I4Q A;  2KOL A;  1CHP D;  4CKC A;  1WTP A;  1GJX A;  1PRT B;  1BCP D;  4C1N K;  1PXU A;  2NN6 G;  1O7Y A;  3ONA B;  2YU9 B;  2IX1 A;  2M9V A;  2F0J A;  1DJR D;  4RKB A;  1RF2 D;  1BR9 A;  2BCO A;  1EYD A;  1RDP D;  1U9R A;  1D5X C;  4IUT A;  1EU4 A;  1TY2 A;  2A73 B;  1LAC A;  1MGS A;  1U4P A;  3I4L A;  4G7H C;  2K7V A;  3HRZ C;  5KNB A;  4R8N A;  2VB2 X;  3W2D A;  1Q12 A;  5F2D A;  1V1P A;  4RAU C;  4ZKB B;  3I8Z A;  5J39 A;  4RGN A;  4QCL A;  4ILW A;  3IFT A;  1STN A;  1IKL A;  1SJE D;  1TY0 A;  3MEH A;  4TQU S;  4DF7 A;  1DXM A;  2F4I A;  1SYE A;  2FMM A;  2L0C A;  1EZ6 A;  1TR5 A;  1E2V A;  3T51 B;  1OO9 B;  3H0G B;  4BS9 A;  1Z6H A;  1KTK A;  2LY7 A;  4L8J A;  4HCE A;  3PUV A;  4ABN A;  1Y69 U;  4GZY C;  3NSW A;  3TP6 A;  1JIC A;  1U4M A;  1C48 A;  1Q1B A;  1TS4 A;  3NTK A;  2K04 A;  2F0L A;  1FNW A;  1TKW B;  2NN6 H;  5KGU A;  2IJ0 A;  5I9O A;  2R7Z B;  2L4N A;  2NVQ B;  2NN6 I;  3SR1 A;  3L9A X;  3J7Y W;  3OWE B;  4K5X A;  2L11 A;  2IWH A;  1U4L A;  3K5O A;  1EY9 A;  1FD7 D;  3SDZ A;  1PTO H;  2OXP A;  4HSP A;  1WTO A;  4G57 A;  3KBG A;  4IFD J;  5CMD A;  1H9S B;  1H9K A;  3EQL C;  3TN2 A;  1WCM B;  2SNS A;  1V8Q A;  1ESF A;  1QG7 A;  1EIH A;  3FVQ A;  1VF5 C;  1SAP A;  2SNM A;  3GP7 A;  3DHQ A;  1A3V A;  1S5F D;  4EQO A;  2XIW A;  2F0W A;  1B2T A;  1SEB D;  3HOW B;  2MHV A;  3QJY A;  2NWG A;  3U9O A;  4DA2 A;  3S1N B;  1A3T A;  3A8I E;  1BQQ T;  5DM6 3;  4K5W A;  2ZXO A;  1CA6 A;  2JXM B;  1I50 B;  5LL6 X;  5IGE A;  5K36 H;  2B2U C;  1S5D D;  3BDO A;  4PMC A;  3TP7 A;  1EQV A;  1G2S A;  1QB5 D;  3SK4 A;  2NYZ D;  3SK5 A;  2MPM A;  2WKC A;  2WV6 D;  1WTR A;  4IN3 A;  5EQ0 A;  3A8K E;  3DWQ A;  1II3 A;  2XNA C;  4FXD A;  3G6J B;  1U4R A;  4OL7 A;  3SK6 A;  3PUY A;  1F2M A;  1D5M C;  4DXF A;  4KJO A;  1VF7 A;  1DON A;  1QJO A;  3J80 L;  3NUC A;  4QB4 A;  1LO5 D;  5CV5 A;  3OSO A;  4Y7N B;  1EL0 A;  2ICE C;  1V43 A;  1B50 A;  3SVM A;  1B9N A;  5C3X A;  2E74 C;  5JEA G;  3S15 B;  1LTA D;  4WFN 3;  3KF8 A;  1JOR A;  4K8I A;  3S2H B;  1ZXT A;  2B2V C;  4HMI A;  3QWN A;  3GTK B;  4A3F B;  5I6Y A;  3BZD B;  2B63 B;  4DAP A;  1B3A A;  4RGT A;  5K5P A;  1ML0 D;  2C5C A;  4X3U A;  3D3R A;  3M7G A;  2F3W A;  2IW3 A;  1Y8P B;  1H9S A;  1ENF A;  4XT1 B;  1KLU D;  3VYS A;  1VMP A;  3VA7 A;  4KKT A;  2VNU D;  2EYM A;  2NVY B;  1GUS A;  2HCC A;  1I4R A;  1Q8I A;  2MGS A;  1NUC A;  1QOH A;  3GTJ B;  1JC7 A;  1CA5 A;  1QIL A;  1B1Z A;  1KAB A;  2N55 A;  1S5E D;  1OXX K;  1F77 A;  4A3K B;  5HUR A;  3K7A B;  3DUZ A;  3I70 A;  3DWA A;  1FR3 A;  4A3J B;  2L55 A;  2B2T C;  3RLF A;  3K5N A;  1MI2 A;  3K5L A;  3HZX A;  1F9S A;  1PLF A;  5M5X B;  1PZJ D;  3J81 E;  2JE6 I;  4QUC A;  2F0Q A;  1K8O A;  2YYZ A;  3D31 A;  2EY6 A;  4J8Q A;  3NTI A;  1V1O A;  4PMW A;  5IT9 E;  1O7L A;  4BY1 B;  2EYL A;  1DZ1 A;  4ME5 A;  5EBC A;  3D6W A;  1MBY A;  2K33 A;  3R3O A;  5IGC A;  3H3V C;  2KA7 A;  2PNR C;  5D14 A;  4ZLT F;  3BYY B;  3ND9 A;  1SE2 A;  1SSO A;  3D4R A;  1T5X D;  5E4X A;  3P75 A;  4FO2 A;  2VB3 X;  3MFG A;  1ICW A;  1I4P A;  2F0T A;  1CI3 M;  1X3P A;  5J1Z A;  4O1N A;  4C3J G;  2AWN A;  3TDQ A;  2XRS D;  1LT3 D;  1AZQ A;  4BA1 I;  2IT1 A;  1AP0 A;  4XYO A;  3Q23 A;  3MXU A;  1GHK A;  2OT2 A;  4IFD H;  1JR0 D;  1WVL A;  3I4M B;  3PUW A;  1EY4 A;  3BDL A;  3CRL C;  3KUP A;  2AWO A;  1NAP A;  4R9W A;  4CHT B;  5M5W B;  3VA5 A;  5EKL A;  2FFK B;  1STA A;  2F1M A;  4WOR A;  4A3E B;  3Q22 A;  3C3L A;  5JVG 3;  1OXT A;  2F3V A;  4TRD A;  1KDA A;  3DWP A;  3GTL B;  1DOM A;  3PO2 B;  2B2Y C;  3I3C A;  2EYP A;  1O80 A;  2B8F A;  4FVM A;  3VR4 A;  2EJF C;  1SNP A;  2EE1 A;  3FKI B;  1L0Y B;  2FJ2 A;  1D1K A;  2L1B A;  2F0U A;  4H13 C;  2X6L A;  2K01 A;  1KDC A;  2KCN A;  2ICI A;  1LTG D;  2B2W A;  4F87 A;  5T1I A;  2WIN B;  1LTS D;  1G91 A;  1XTC D;  3S2D B;  2RSO A;  4EQN A;  4KN4 C;  4G7O C;  3VR6 A;  3PIP 3;  2H4O A;  2X69 A;  1JOO A;  3MZ5 A;  5CV8 A;  3PUX A;  1VCI A;  1ROD A;  3OW7 A;  1BO0 A;  1NR4 A;  4IUQ A;  1V1P B;  1LTR D;  2Z1C A;  4FP5 D;  2LFN A;  3NXW A;  3PV0 A;  1DCZ A;  3H94 A;  1G6Z A;  4KMU C;  4WRD A;  3CQZ B;  4TKO B;  1PRT C;  2E76 C;  5KEE A;  4FF1 A;  1TQO A;  5TSS A;  1RD9 D;  4MHE A;  1ONL A;  3P1H A;  2SOB A;  1BCP B;  3S14 B;  4CJ0 B;  3H6M A;  3HOV B;  3PIO 3;  1CZG A;  1ILP A;  2JA5 B;  3BVZ A;  3T13 A;  3OIP A;  1FYC A;  1C4Q A;  4EGV A;  3EJI A;  1HHV A;  4M1U B;  1SYC A;  1PDQ A;  2CQA A;  2F0G A;  4BWG B;  2K03 A;  2QCP X;  5FLX E;  4C3H G;  2PZT A;  3CU7 A;  1WTV A;  1IW7 D;  3SXH A;  3Q24 A;  1TVX A;  2DNE A;  1OXV A;  2EY5 A;  3A54 A;  2MP1 A;  4KY7 A;  2EYF A;  5IGD A;  4XT3 B;  2F0O A;  3QB3 A;  3PO3 B;  1PTO C;  3MHB A;  4KD4 A;  2EYJ A;  1QWY A;  2VXW A;  5ELE A;  1W6J A;  1VMC A;  1YNJ C;  4IAL A;  4V0B A;  4CGY B;  5A2Q E;  3FMC A;  1SBB B;  4HMJ A;  4IZ8 A;  1GUO A;  3GTO B;  5JVH 3;  5ELC A;  2WKD A;  2HDL A;  1CFM A;  3H09 A;  4Z9C B;  5CV9 A;  1KDB A;  5KND A;  3IFD A;  3RZD B;  1EEI D;  4Q5V A;  2MUY A;  3EA6 A;  3J7A V;  5LL6 S;  4FXG C;  4FF3 A;  1JOQ A;  1ET9 A;  2KJX A;  2RVL A;  5K36 G;  3A7A B;  2PW7 A;  4U68 A;  2AUJ D;  3MTS A;  2A6E D;  2E2D C;  5ELF A;  3N6R A;  4CKB A;  4QMG A;  2X6G A;  3FPP A;  3TSS A;  2WII B;  2PZU A;  1Z7T A;  4H7B A;  1R9T B;  4A3M B;  3BG3 A;  4NMZ A;  1Q1E A;  4NKL A;  1O78 A;  5I2X A;  5M5Y B;  3X3N A;  5C4X B;  2PYK A;  2K32 A;  4RWS C;  4DN4 M;  5C0X J;  2A74 C;  1ZKO A;  3CHB D;  1EOT A;  3C1F A;  2MJ8 A;  1PTO D;  5J22 A;  1QNU A;  3NE5 B;  4OIK A;  2F0I A;  3NWS A;  3NPP A;  1CZW A;  2EXZ A;  1TT2 A;  2R61 A;  5FO9 B;  1DOK A;  2R6G A;  1G8Z D;  1M8A A;  4HN7 A;  2J7Z A;  3NP8 A;  4FXK C;  1GUG A;  3A8J E;  3TP5 A;  2Z4I A;  3HOZ B;  3A7L A;  1A2U A;  1ESR A;  5KRU A;  3HP3 A;  5M9O A;  1D5Z C;  1BUV T;  1J9O A;  1XXG A;  5FO8 B;  2V4D A;  3EFX D;  4HCS A;  1STB A;  4BBR B;  4ID6 A;  4XIG S;  4RA8 A;  2RDG A;  5KYI A;  1LTI D;  2FHT A;  2KHS A;  3WOF A;  3H91 A;  2KEC A;  1QE6 A;  4KI0 A;  1PFM A;  3TBI B;  2F0E A;  2JP1 A;  1TS5 A;  1ZEQ X;  2K28 A;  2PW5 A;  3EVQ A;  2PPB C;  4NDX A;  1EY6 A;  2AQ3 B;  1LTT D;  5I2Y A;  2D2C C;  4IUP A;  1BDO A;  3MVV A;  3TZD A;  1EWH A;  2F03 A;  1CHQ D;  2WAQ B;  5KYL A;  3O13 A;  1RJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...