5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
4KJOA 3OWFA 1EYCA 3TMEA 4KY6A 3NK9A 2QDBA 4NDXA 4RKLA 5C4ZA 2EYJA 2F0NA 3D8GA 4I65A 2EYFA 4EQNA 5I6WA 4OL7A 4K6DA 3QB3A 4KD4A 4ZQ3A 5J1ZA 4WRDA 2EY5A 5DAUA 3EROA 1EY9A 5NUCA 3SK8A 1A3UA 1II3A 1JOOA 4HMIA 3NXWA 3DMUA 4ZUIA 4DFAA 5KYLA 4HTHA 5J22A 4KD3A 2OEOA 3HZXA 1EY6A 3R3OA 1F2MA 2WACA 4K8JA 5CV4A 3C1EA 2F0IA 5CV5A 5KGUA 2F0WA 3OMGA 5E1FA 5IOCA 2F0PA 1SYGA 1KDBA 3NP8A 5CGKA 2EYMA 2NUCA 2F0HA 3E5SA 3VA5A 4NKLA 1AEXA 5F2DA 1EZ6A 3D4WA 3T16A 2F0MA 3OMCA 4NP5A 1SNPA 5DEHA 5I9OA 1F2ZA 5CV9A 3SK5A 4H7BA 1U9RA 3MVVA 4DGZA 2EXZA 2SNMA 3H6MA 5HURA 3S9WA 4QMGA 2EY2A 2ENBA 1EY8A 2F3VA 2RBMA 4KHVA 4S3SA 5IGFA 2EYHA 3T13A 1STBA 1A3VA 3LX0A 2PQEA 4IZ8A 4K2LA 1IHZA 3DHQA 4K2KA 2F0SA 4KY5A 5CR3A 3RUZA 3SHLA 2EY6A 3MXPA 1TR5A 2PYKA 2RDFA 3OSOA 4LAAA 3SK6A 2F0FA 1TT2A 4NMZA 2F0VA 5C4HA 1ENAA 2PW5A 4YIJA 4WORA 5CV6A 2SNSA 5CV8A 1EQVA 2PZWA 5I9PA 1ENCA 2F0GA 4KJNA 4DU9A 4B9WA 1KDCA 1RKNA 1SNDA 2OF1A 4J1MA 4ODGA 1STNA 3TP7A 5IGDA 1KDAA 3U9OA 2EYPA 3NQTA 1STGA 1EY0A 2M00A 5E3FA 1EY4A 5EKKA 3TP6A 2F0DA 5KYIA 3QOLA 5C5MA 4N9TA 5M9OA 1EYDA 1SYEA 1NSNS 4KY7A 3D6CA 4QF4A 3EVQA 2EYOA 2KHSA 3QOJA 4PNYA 4QB4A 4TRDA 1SYCA 4F8MA 5IGBA 2F3WA 5ISRA 2HQEA 1EYAA 4RKBA 3BDLA 5EKLA 3TP8A 5JAVA 3P1HA 3SR1A 1JORA 1SNQA 4K5XA 5C3WA 1F2YA 1KABA 3ITPA 1JOQA 2SOBA 2PZTA 2F0LA 4PMBA 1SNMA 3NUCA 5CC4A 1STAA 3MHBA 1EZ8A 5IGEA 2LKVA 3D4DA 4ID6A 4IALA 4J6HA 3ERQA 5JOBA 1A3TA 4K5VA 2EY1A 5IGGA 1STYA 4K5WA 2F0JA 4KTAA 2F0UA 3P75A 1SNCA 2F0EA 2KQ3A 4MIUA 1EY7A 3C1FA 3SXHA 3NHHA 4E6IA 3PMFA 5IODA 5J39A 4N9PA 1KAAA 4K8IA 2F0KA 2F0TA 5KEEA 1STHA 3BDCA 3V2TA 2OXPA 1TQOA 2PZUA 1SYBA 5CV7A 4EQOA 5IIFA 1NUCA 4EQPA 1EY5A 4HMJA 4KV6A 5HGTA 5IGCA 3TP5A 4F7XA 4IUNA 1SYDA 4ME5A 3HEJA 4K14A 4ZUJA 5C6AA 1A2TA 3SK4A 3MZ5A 4B9XA 5KRUA 2PW7A 1A2UA 1SNOA 2F0QA 2EYLA 3MEHA 5C5LA 4DF7A 5C3XA 5K5PA 2RKSA 5KIXA 1JOKA 3EJIA 4EVOA 5I6YA 5EGTA 1SYFA 4PMCA 2F0OA 2O4XA 4G57A 4R8NA
chains in the Genus database with same CATH superfamily
2NZHA 3MXNB 3VR2A 5LMUL 1GUSA 1EQRA 2IT1A 2I46A 2A1AA 3K5MA 2IWHA 3AYHB 4DV1L 1L0WA 5DM73 1FNVA 4A3DG 3AQQA 2QDLA 1D5MC 4G7OC 5C4XB 1S5BD 5EPKA 5CV4A 4K8JA 4Q5VA 4GKKL 4KLKA 1PTOH 1V1OA 3PV0A 2KENA 3KF6A 1VS0A 2L11A 1TWHB 3F2BA 3PSIA 2K5NA 2KJXA 5EKIA 1CK1A 3A7LA 3H0GG 2UUCQ 4V0BA 3I3CA 1F2ZA 2IX3A 3K7UC 4KKSA 2HQLA 3M3YB 2JA6H 3A0JA 5EPJA 4G7HC 4DR5Q 4U673 3J80i 4FP5D 1I4QA 4JV5Q 1VMPA 2QKIC 3UE1A 2F0FA 4TVAB 3TN2A 2NVXB 1PTOD 4MNOA 4I7AA 2ZM6L 1BKBA 1R9TH 2F0GA 4ZRZA 4X62Q 2B2TC 5IGDA 1YHAA 3X3MA 2HT1A 3PUXA 1ILQA 3OHXC 1N34Q 3V96A 4LWCA 2QW7A 3EVQA 1B3AA 3GV6A 3HS0C 4LF9L 2PNRC 3GTJH 1VQLA 4C3JG 2Z8LA 4O42A 3S1QB 1LO5D 4CDCC 1PYSB 4R9WA 1EFWA 3ND8A 4AYBG 1PH6A 3CP0A 2K7VA 2AQ1B 2R92H 1JJCB 3NPPA 2TMPA 3CC2A 2EY1A 5M5XB 4KTAA 1EIYB 3T1HQ 2EJMA 1GOZA 1A8VA 2A74C 1EL0A 1VQ8A 1SYBA 2ATWA 4NXMQ 4KHPL 1D5ZC 2VUMG 2PMZB 4LF4L 4IJLA 4DR6L 2CH4A 2A68D 3AU7A 1VQ6A 3FHWA 3FDTA 3CCMA 4JI8L 2CQOA 1CTMA 4DR7Q 2AWOA 2Q2HA 3OWFA 1WCMB 5A2QL 4DV5L 1PH9A 3H3VH 2EYJA 4A4IA 3D8GA 2G5DA 4OO1H 2EYFA 5JJLA 1VQAA 4N8FA 1CZGA 5NUCA 4EX5A 5FLMG 2JEAI 1FNUA 1EU3A 2R7DA 4JI7L 1AE2A 1QVFA 4ULLA 4C2MH 4HCSA 5LMNQ 4K0KQ 3O13A 1OXTA 3HKZB 2P5ZX 4JK1C 1KDBA 1HR0Q 1H95A 2NZOA 4DXFA 2KOLA 3E6ZX 2BA0A 4IUVA 2Z6BA 5LL6S 3AMUA 3T4AC 3K80C 3J7YW 2VQFQ 1RF2D 3QO2A 1TWFB 4OWXB 4Z9CB 1KRSA 3K7AH 2L5TA 1YEZA 1ENAA 4H44C 1W2BA 2CW0C 3HOVB 4L5SA 3M7GA 3H0GB 1OXVA 3K6OA 4A3FB 2SDFA 1QG7A 2HHHL 1WTHA 5EKKA 4TQUS 1W6JA 1L1OC 4IPDA 3D31A 2LY7A 3FRPB 4GLXA 1TS3A 3VYRA 1TS2A 3FP9A 2IX1A 2IY5B 1G51A 5FLXE 3W3AA 3BU2A 5JAVA 1XPRA 4A93H 3SR1A 3EN2A 5C3WA 5ELDA 3M85A 3BDOA 3J81E 4FF1A 4JOIA 4UY8C 3PO2H 2A8VA 4LFAQ 3GTPB 3FEWX 4YY3Q 1JR0D 4J6HA 5IY0A 1WFQA 4GN5A 2A5HA 5IGGA 1IW7C 3SE0A 4RAUC 1D1KA 1YJNA 3FKIH 3GTMH 2L4NA 2K14A 2JA8B 3GD7A 4DV4Q 3MWYW 5HGTA 4FYDA 2NVQH 1PFNA 3FKIB 3IFTA 4B9XA 4RCOA 3KFUA 3J7AV 2MNAA 2ZTEA 5EGTA 1SYFA 2NVYH 4A3BB 1PMRA 2OQKA 3U9OA 4KY6A 1N9WA 3Q23A 3KLRA 2EXDA 3M4OH 5FLXL 4ZQ3A 1HQMC 4J8QA 5J1ZA 1EUJA 3EROA 1TY2A 1TWAB 1Q8KA 2DNEA 1PZID 2GN5A 4KD3A 2E5LL 2EPBA 1E0BA 1IYVA 1TY0A 2QF7A 2F0WA 5IP7G 2Y0SE 4ZYSA 4HIOA 2E2DC 4FF3A 1Y8NB 3VR5A 4IO9A 1CKMA 2JJQA 3T16A 4KK7A 2RF4A 4X3UA 1GXDC 3GO5A 1RD9D 4UP7A 3I4LA 2NVXH 2UXDL 5C44B 1L2FA 1XMOQ 1STBA 2IHEA 1J9OA 1R4QB 2RHQB 1KD1C 1AW7A 1ZXTA 2G9HD 3A55A 1ENFA 1I3QH 2FMCA 4HSVA 3J7ZC 4MHEA 1PA6A 4LF8L 1EQVA 5I9PA 4DXGA 1RL2A 1I6HH 1E22A 1G6PA 1LTBD 1SNDA 1R4PB 2L15A 5IP7H 3QJYA 4DK1A 4FF2A 3QOLA 4IPCA 1XXGA 2ZJQA 2B2WC 3HG9A 4B3RQ 1PH7A 3HP3A 1MD2D 3CMEA 3EFXD 1EYAA 5EKLA 3P1HA 1JQYD 3A8IE 1W3SA 3IKJA 4A3FG 3OTOQ 3ERSX 3CKIB 3PO3G 3HOUB 4FF4A 2B2UA 4Q0FA 3H0GH 1YJWA 4GKJL 5A35A 4GNXC 1TWCB 1SNCA 5J39A 3PMFA 2Q8TA 2B2TA 2LS01 3S15H 4CDDC 2O5JC 2ZXOA 5CV7A 4LJZC 3KBXA 2K1BA 3CPFA 5ELOA 2LXJA 5C6AA 2NB0A 3MZ5A 3QWNA 2F0QA 3M4OB 2RQXA 3LGJA 1P8LA 2JN4A 1HZAA 1HA5A 4A3LG 1GUOA 3M4QA 5CORA 3U9SA 3PO3H 2K03A 2JA8G 5ELBA 2VB2X 2HCCA 3NTHA 3SK8A 1TS4A 4LFAL 4HR7B 2KHJA 2AKWB 3FKIG 1HH2P 2H4OA 3CCUA 4EQ5A 1LYLA 1SE8A 1R9TB 1HXYD 3HOWG 1XMQL 1C4QA 3ULLA 2JEBI 5ELEA 3NBIA 1H9SB 1AEXA 5F2DA 3ULJA 2NN6G 4XQJA 5LMNW 1MJCA 4LF7Q 3FPPA 4A3KG 4LF5Q 1CKNA 1Z47A 1JJGA 5CR3A 4IPGA 1NNXA 1S3OA 3I90A 1TR5A 5G3LD 3SK6A 4CDEC 1TT2A 2R3ZA 1AZQA 3E3XA 5E4XA 3I4NB 4A3DH 3KDFB 1UAPA 3BG3A 5M5WB 4J15A 4JI3Q 4A3IG 1S5DD 1SMYD 1K83H 5C0XI 4XXEA 3G71A 4JYAQ 5M5YB 4M8AA 3HOVH 2CKZB 3D0FA 3QOJA 1HTLD 3VA7A 2B3GA 1GO3E 1SR3A 5C44H 4P72A 1KLUD 1NR4A 4X64Q 4A3JH 1XTDA 3DWAA 5D3IB 1HR0W 1G6ZA 1KABA 1SJHD 2B2VC 2K32A 3ZYYX 3C2PA 3HOXG 1BCPF 3GDEA 1VDZA 4DR1L 2ID0A 4G4KA 3UDXA 2YTYA 1Y1VG 5EPLA 4E6IA 1PZKD 5IP9H 1WTQA 4LFBQ 3DEPA 2I5HA 1GJXA 3PGZA 4KV6A 4HMJA 3IFDA 1KNEA 5GAHC 4JI6L 4QQBX 3KYHC 4DV2L 1LT6D 2R7ZG 1ZYRD 1A2UA 5D3DA 1ESRA 4DF7A 4V190 1YBYA 3KF8A 4QY7A 5I6YA 2A6ED 3J7A5 3JAML 4JOIC 4MTKA 3NK9A 4A3GG 4NDXA 2D62A 4PMWA 4R4IA 1Y8PB 1RDPD 1SE4A 1FGUA 2E74C 4P2CB 4DAMA 4ZKBB 4A3MH 4NXML 4LF4Q 4A75A 4Y7NH 4BBSH 4A93G 1YNJD 4B3ML 3JAMc 3DUZA 4NB3A 1Q1EA 3MXUA 5IT9E 3CCSA 1CZWA 1JWMD 1PLFA 2KECA 3W5OA 3UDGA 4DUZQ 3VA5A 1EZ6A 3PIOA 2IL8A 3CW2C 4JBMA 4BBRB 2UU9Q 1XTCD 3Q24A 2F0SA 2NN6I 4P71A 3SHLA 2K01A 4CBVA 4LAAA 3CCQA 4IUTA 4A3BG 1O80A 4QGUA 3S2HH 2SNSA 3KF8B 2R92B 1ENCA 3B6YA 1KDCA 1EEFD 4J1MA 1H9JA 4ODGA 2EVBA 5IWAL 1PH2A 4R8IA 4A3KB 4PG3A 2AWNA 3MC0B 1JWUD 3I73A 4RGOS 5M9OA 1JT8A 4OWWB 1XMQQ 2KHSA 2L0CA 1L0YB 5D65A 3RLOA 2AUJD 1SE2A 2ZTCA 1V43A 4DR4L 1QB5D 1C48A 4DR3Q 4HJAA 1XNQL 3TS0A 2ICIA 4A3BH 2IJ0A 3CRLC 3MHBA 4AH6A 2K50A 2B2YC 4IALA 1T5EA 4F87A 2Z4HA 3E0EA 3DM3A 4IJHA 3K59A 4N9PA 1VQOA 4POFA 3F1ZA 3P20A 4WFN3 1U4LA 3HFZB 1VQFA 1JJ2A 2H1EA 1ZKOA 1ML0D 2MHVA 3S24A 2LMCB 4C3JH 2CH4W 1A2TA 4A3JG 4FO2A 4DUYL 2PW7A 3S16H 1S5ED 5FLXc 1O78A 3TEHB 4ME3A 1E2WA 1OO9B 4Y7NB 1QZHA 4BBSB 5C4XH 2R93B 4X64L 2E2IH 3BYTB 2EJGC 4KD4A 1IKLA 3GTGB 1V1QA 3GTOB 1QWYA 1WD0A 1A3UA 1VQEA 1V1PA 1IZ6A 2ASBA 1XX8A 4GNXA 1C9OA 3KLWA 1VQNA 3D6WA 2NN6H 1I6HB 3DEOA 3OMGA 1B44D 1FVIA 3HOUH 3NE5B 1Q86C 2FHTA 1BVSA 1O7IA 4CJ0B 1K73C 3D3RA 1IBML 1HNWL 3TSSA 2F4VQ 3OMCA 4O1NA 4GS3A 5H1SE 4BY1B 5EQ0A 1GHKA 2XGTA 1A3VA 3LX0A 2OT2A 4KY5A 4RGNA 4OO1G 3W1BA 5KNBA 2MFIA 1Y8OB 3CQZB 2K33A 2I0QA 4WJ3M 2BH2A 1E1OA 4GOPA 1HNXL 1JICA 2NTSA 2MUYA 2PI2E 4BBRG 1EWIA 1N33L 1PXUA 2EYPA 3TP6A 1FYCA 4BA1I 3A8JE 1XMOL 5AJ3L 3ICEA 1SYEA 1TXYA 1XWEA 2K5QA 3T1HL 1FR3A 3CHBD 5ISRA 2IX0A 2CWAA 1JORA 5KNCA 1SXTA 3S1NB 3I56A 3NUCA 1TIID 3KJOA 4C3HG 1X3FA 4JBKA 5I2YA 3ULPA 3E9HA 1VQBA 2X69A 1Y69U 2ZXPA 2KQ3A 4MIUA 1EY7A 1WD1A 1QVGA 1YITA 1D6EC 2C5CA 1LT5D 1Q8IA 3V2TA 1TQOA 5IIFA 5G3LF 2K28A 4JG2A 2Q8IB 4A3IB 1X3PA 4X65Q 3BVMA 1VQCA 3PUZA 4HJ5A 2E2IB 1N36L 1I4PA 5LMNL 3WOEA 1I4HA 2O4XA 1Z7TA 2G9DA 2K5WA 4UAIA 1QOHA 1CM9A 2QDBA 2B2VA 2B8FA 3JAME 4K6DA 1PH3A 1E2VA 2XWJB 4PV1C 2I5MX 4JI2L 2IW3A 5KYLA 4HTHA 1JC7A 3GTQH 1H9SA 1E7ZA 2F0IA 2OTLA 1NAPA 1UNSA 4A3MB 3S14H 4RGMA 1U4RA 4A76A 1HTPA 2VY3A 1WTXA 3E5SA 1S40A 1JMCA 1DD2A 1GM5A 2J7ZA 3FVQA 4BY7H 1TWFH 5IYCG 2KCCA 2XRQD 2UXCL 2L9HA 1B2TA 4GLVB 4KHVA 4APVA 4DAYB 2B39A 2VZAA 1IHZA 3U4VA 2JE6I 4IUQA 4NMZA 4HIKA 3DWPA 2PMZE 4X66Q 2PO4A 3L0OA 2AQ3B 3RN2A 1KHIA 3M9BA 1Y1VH 1WTPA 3RZOB 4BY7G 4N9TA 3SGIA 5L37A 4JPBW 4KY7A 2VW9A 2B2UC 1NJIC 1I50H 2CFMA 3U4ZA 4QB4A 2JK8A 4B3SL 1M1KC 5LMUQ 3VYSA 2DNCA 5IYBH 2D0PA 2K5VA 2R7ZH 2K52A 3I72A 3V05A 1F2YA 3ITPA 4DV4L 5M5XH 2EQSA 1VQJA 2JA7G 4DV1Q 1AH9A 2WIIB 3A54A 3HKSA 3F2UA 3EBEA 2I5LX 2A6HC 2MPMA 3PUWA 4C3IG 1LUZA 1NE3A 1PRTF 2HIVA 2JA6G 2F0KA 1W6KA 3MXGA 5IE8A 1SMXA 1NUCA 2YV5A 1WCMH 1B1ZA 4ME5A 4FVMA 1SYDA 2Z4IA 5FK9C 4DR5L 2E5LQ 5C4XG 2WB1B 2ICEC 4DR1Q 5M3MH 1K8OA 2L55A 5K36G 2AQ2B 1TKWB 2WV6D 4WRDA 1K3BC 1YZ6A 2B2YA 1XYIA 4JI0L 1EQTA 5GQOA 3TQYA 2CQAA 4ZUIA 1N34L 2EDGA 4L6TB 1D2BA 4B08A 1AFPA 1UE1A 3C1EA 3NTIA 5CV5A 1MJEA 3K5LA 4LF9Q 4CKCA 2JYOA 3RN5A 3OWEB 2ZXRA 1RODA 2WP8J 3S1RH 2LSSA 1L0XB 3I4MG 1LTSD 2N3SA 3TS2A 1WOCA 1ASYA 5FO8B 3SK5A 1WI5A 3UDIA 2SNMA 2MO1A 2F3VA 3U58A 2UUAQ 4A3JB 1PYBA 1N36Q 2EY6A 2K5DA 1K8GA 1TWAH 1MKHA 1U0LA 3MFYA 5JJZA 2PCFB 5C0XH 4AIMA 2LXKA 1ET6A 2HD3A 1B7YB 5EJWA 1CSQA 4BBSG 2PZWA 3GP7A 2FINB 5CBAE 1VQ4A 1CFMA 1X3GA 3CCVA 3I70A 4DV7Q 2K6AA 4FXDA 2NVYB 4P74A 3S2HB 3VDYA 2AMCB 1LABA 1QNKA 4GKJQ 1F9PA 2FJ2A 4JI8Q 1SROA 4PZ7A 3Q6SA 4L8JA 3J81i 3P7JA 3X3NA 3JC66 3RNUA 1JOQA 3LNNA 3Q22A 2JQOA 1WVLA 4IN3A 5IWAQ 4XQQA 1GUNA 2LKVA 4ZKCB 4XYQA 3A8KE 3HOYB 4ID6A 2J4XA 5EBCA 3SDZA 1VQGA 4DK6C 3OIPA 3BZKA 1STYA 4IFDG 1PHJA 1IBLQ 1KAAA 1HR0L 1FGBD 2TSSA 4DR3L 2PPBC 1XNQQ 4XT1B 1YVCA 5BR8L 4OX9Q 4I7ZC 1IKMA 2BE5C 5C44G 3HEJA 4ZUJA 1YNNC 3I55A 4OHJA 5K5PA 1T9HA 2RKSA 2KCMA 3CCLA 2VS1A 4ZLTF 2XRSD 4R8NA 3HKZG 4PQXA 1STEA 1MBYA 5DNFA 3BS1A 3S16B 3KJPA 4RKLA 4B3TQ 2H5XA 1YHBA 4I65A 4UHVA 3T56B 4JI4Q 1II3A 4XT3B 1F9SA 1LTLA 1LTAD 4MTNA 4LF5L 3PUYA 4DFAA 2KA7A 2WB1G 2OEOA 3BVZA 2A19A 1D8LA 3T1YQ 1HHVA 1FL0A 4HJ9A 1CA5A 4ALPA 1DXMA 5HY6A 1HCZA 4HJ8A 4OO1I 3FPUB 3VR4A 3HOZG 1K8MA 1CSPA 4DGZA 1K0SA 3H6MA 1TWCH 3UDFA 4QMGA 2EY2A 1EY8A 3RLFA 2F3IA 1NY4A 1P16A 4RGTA 1FJGQ 3RUZA 3G4SA 2N88A 4A3CH 4HCEA 2HIXA 3OSOA 2N49A 5I4DA 5JJKA 4WORA 2J0TD 4IOAA 1PH5A 2JA5H 1IBMQ 1HNWQ 4B9WA 1HNZQ 2FFKB 4JI0Q 3K7AB 5JPMC 3E0JA 2WFWA 5HGQA 2A68C 3GTJB 3KDFA 1BO0A 5KYIA 3PUVA 3Q8DA 1NMGA 2ZJPA 3G48A 2O5IC 2QGQA 4PNYA 5FO9B 3BDLA 3BVGA 3EIVA 4DV3Q 2Y0SB 5AFWA 3HOYH 1XNRL 3I2ZA 1RHPA 1K3RA 3KLSA 2OQ0A 2BH8A 5EBDA 2XIWA 1EWCA 2MGSA 4UPAA 4C1NK 1HA6A 4CGYB 3CD6A 3P75A 2F0EA 1YNJC 4PZ8A 3NHHA 5M5YH 2A6HD 3KLSX 3WWVA 4H13C 1BXTA 2Q2TA 3PF5A 4DV6L 4DA2A 1H9RA 1LT4D 1PRTC 5IGCA 5FJ8H 1LACA 3CXCA 1ICFB 4X3SA 5C3XA 2M2LA 1B50A 5BN3A 5J3BA 5JEAH 4DV0L 3EJIA 1SBBB 4KHZA 4R4OA 1HZ9A 2X6LA 4UP9A 5JEAJ 3PO2G 2A73B 4DUZL 1S5CD 5EAYA 3KK7A 3OIQA 1JB3A 1VQIA 3CRKC 2DY7A 3S1MB 1SN8A 2UU9L 2F03A 2JA7B 4JW0A 5T1GA 3AB9A 3HGBA 4YWMA 4X65L 1YI2A 1X56A 2F0PA 2NTTA 1Q12A 5M3FH 2V4DA 3MTSA 4RG1A 3RZDB 4IOCA 4GOPC 3K58A 2PQAB 2F52A 5HURA 3S9WA 1QUQB 1SFOB 3H3VC 2VL6A 4JI5L 2PYKA 1MSHA 1UUPA 5ELCA 1PTOC 4DR4Q 4YIJA 4QCLA 4B3TL 5ELFA 2Z9HA 4BWGB 3HOZB 3A56A 3M4PA 2OF1A 1I3QB 3TP7A 3J81c 1G91A 1EY4A 3HOUG 3I4NH 3HOZH 4AYBE 2DY8A 3NSWA 4GKKQ 1PFMA 2EYOA 1BBUA 5T1IA 1BBWA 4F8MA 3GTOH 2B63H 4BS9A 3S2DB 4R4TA 4ZAIA 1BCPC 2UUCL 3J80L 4A3CG 2V1CC 1I50B 4QIWE 4C2MB 1STAA 3NEMA 4DUYQ 2KBNA 4LFCL 2NVTB 4JV5L 1I4XA 3SXHA 4OGQC 1IL8A 4IUPA 1TS5A 4TKOB 3TRZA 1DGSA 1X9NA 1WTWA 2F0TA 5KEEA 3CPWA 4X62L 5C3EH 5ELNA 1J6QA 2K04A 3VYTA 1DONA 1EIHA 2B63G 4LMQD 4IUNA 4NXNQ 5GAGC 4L5RC 1H9KA 3ND9A 4FDBA 3RD4A 1S72A 2EOTA 5IYBG 4DAVA 1U5KA 3L2PA 1CQFA 3WDNA 2D9UA 1O7LA 1K0RA 5CMDA 5DM63 3VR6A 3F2CA 3G6EA 2VUMB 1J8IA 3W2DA 2KHIA 1VQ9A 4YWKA 1VQMA 4L63B 1Q3LA 1L1OB 1BF4A 4RHSA 2NZ1D 3R3OA 1EY6A 1PZJD 5JPNC 5KGUA 4IUUA 2WKDA 4DNIA 1PH8A 1SYGA 1D7QA 3NP8A 1EOVA 2E8GA 4ZK9B 3NWSA 4NKLA 4KHPQ 2XTIA 4DV6Q 1A6XA 3MVVA 2EXZA 1B4OA 2RDHA 2MJ8A 3L7ZC 2YU9H 2EYHA 5GAEC 1VF7A 2KEEA 4K2KA 3PCOB 3BZCA 4X3TA 2JA8H 4BBRH 4DPGA 2F0VA 4IPHA 4FXGC 4WJWA 2Z6KC 4DV5Q 4JC0A 5CV8A 4LFBL 1MGSA 4LF6L 4DU9A 3S14B 2ZTDA 1KDAA 4UDUC 5M3FB 1Y1WB 2M00A 3HOXB 1PRTD 1KL9A 1X3QA 4R4CA 1EQQA 3D6CA 4QF4A 3I4MH 3Q0AA 1WYDA 1MHWC 4KN7C 3STBC 1YNND 3GTPH 3HOVG 5JVH3 3JAMi 3K8AA 2WKCA 1C8CA 1C0AA 5I2XA 3OW2A 4O2DA 1ASZA 4DV7L 4DR2L 1Q82C 1A63A 3GTLB 4YCVA 5JOBA 1A3TA 2XNAC 4K5VA 2OWOA 1BQQT 2F0UA 3M3YH 1Q1BA 3D4RA 3KOJA 5C4JH 4A3GB 2E75C 2I07B 3TZDA 1TWGH 4CJ1B 4BY1G 1V9PA 1BCPB 4OEMB 1GVPA 2HHHQ 1BDOA 2BA1A 3IL8A 1I94Q 3VYUA 4NW2A 1S4ZA 1QVCA 1UE7A 2F0OA 3LWUA 3OOCA 1FD7D 2K05A 1QILA 1X54A 1B9MA 1CKOA 5C4ZA 4EQNA 2Y0SG 3PQIA 2N8NA 4JI1Q 1PDQA 5BR8Q 4OX9L 3S15B 4HN7A 1KRTA 3HKZE 2ES2A 2RDGA 5J22A 2D2CC 5FOBB 3M4YA 1Z9FA 1F2MA 2UUBL 2HDMA 3RMHA 1B9NA 3GTGH 3ZJYC 4WJ4A 2B29A 4LUOA 2Q2IA 3AFPA 4X66L 2R92G 5M3MB 1PTOB 3SEBA 4H7BA 3TBIB 4O0AA 1CQVA 2N78A 1I4RA 4YHHL 5TSSA 4IZ8A 1HUNA 3DHQA 4A3GH 2DJFC 3MXPA 4CHTB 4N8X1 1DOLA 1HJPA 5CYUA 5FJ8G 2DJGC 2JP1A 1ESFA 3F2DA 3AFQA 1EWHA 5GADC 1Y1WH 3MEFA 3TZUA 1MI2A 1PTOF 2FMMA 1RTOA 3OYYA 4YCWA 2Q8RE 1JE4A 1GD7A 2JA7H 1EEID 3DLLA 1A15A 4LUVA 1SYCA 1XPOA 4QIWB 5FLMH 2HQEA 3TP8A 2CVRA 1A62A 3NWTA 4K5XA 2RCNA 2SOBA 2B8GA 2PZTA 4XYOA 1N32Q 2HUGA 1HNZL 1SNMA 3IAYA 1EOTA 3DWQA 3J80E 4A3LH 1M4VA 3T51B 5M3FG 2JSOA 1Y1WG 3QIAA 3R2IA 4P73A 3CCRA 2DGYA 5BN4A 1DJRD 4JBJA 2D0OA 3AEVA 4FNFA 3H94A 2KUMA 1CKNB 4HAEA 4RMFA 4ZCKA 4XIGS 1STHA 4DV3L 3IRBA 2F4VL 4LF6Q 2DUDA 2OXPA 1G8ZD 3ER0A 1XNRQ 3S17H 4R4QA 1EY5A 1QZGA 1SLJA 2KEDA 4KKTA 5KRUA 4K14A 3ONAB 3SK4A 3BJUA 2EYLA 3MEHA 1WTOA 1JOKA 5A2QE 4B3RL 4G57A 3T13A 1EYCA 3T53B 1YIJA 4TSSA 3PIO3 4F88A 1LTTD 3A74A 1QJOA 1CHQD 2EY5A 2DN8A 4RFBA 1ZEQX 1OXXK 1JOOA 4HMIA 4RH6A 4DR6Q 2UXBQ 4DR2Q 1Z6HA 2UUAL 2GVBA 5IGBA 4OWTB 4IFDJ 2RCFA 2WACA 2ZJRA 5BN5A 3PF4A 5E1FA 5IOCA 4GN3B 5LL6X 3NBHB 2EJFC 1DOKA 2F0HA 1MSGA 1SE3A 3RLNA 2CHBD 2NBFA 2VB3X 4L5QA 5DEHA 1U9RA 1B70B 2RBMA 1Q90A 2B63B 5IGFA 1G2SA 3F8TA 5GROA 3R2TA 3E9IA 4DK0A 3HOWB 3C3LA 3J7AF 2CCZA 4C3IB 2RDFA 4PZ6A 2JA6B 1K83B 4YCUA 4KN4C 2PW5A 4JBWA 3MAQA 1B8AA 2RSNA 5M3MG 1D5XC 1RKNA 2E2JB 1GHJA 1CHPD 4JI1L 3H91A 3NENA 4C3HB 3NQTA 1K28A 1X6OA 5IP9G 2OCEA 5CBEE 3GTMB 1EYDA 1JE5A 5C3EG 5C0XJ 4A3EB 2UUBQ 5FKAC 1U4MA 4RA8A 5IYDG 1IBLL 1VQ5A 1Q7YC 3UI2A 1LTRD 2JXMB 3HOXH 4RKBA 1HFNA 1V1PB 3EA6A 3HOWH 4GNXB 4Y52H 1DYQA 3KBGA 3N52A 3R8BA 3CAMA 5CC4A 4RWSC 1Q81C 5LHY1 4JI2Q 5IGEA 2ZT9C 1PH1A 3NQIA 5M5WH 1BUVT 1TWHH 2O2LD 3A5UA 1KQSA 3OW7A 2QEJC 1Y14B 1GUGA 1NBWA 1EIFA 1LM0A 5IODA 1TU2B 2M9VA 2YU9B 4C56C 5COYA 3A7AB 1E1TA 2PZUA 4JI3L 1IYJB 2CW0D 2KCTA 2E76C 5C0XG 4EQPA 4JI4L 4HEDA 4GN4B 4OXPA 4XTCS 1B53A 4JYAL 4JCVE 1ICWA 2RHSB 4YY3L 4LFCQ 3T1YL 1IL2A 2A6EC 1Q46A 2SEBD 4A3MG 1SSOA 1OXSC 1UEBA 2VQEL 5I6WA 2OTJA 2NYZD 2GA4B 1T5XD 5DAUA 3MXNA 1UE5A 2ALYB 1KIXA 1HQRD 3C46A 1CUKA 4NXNL 3GV3A 2YYZA 1FJGL 3PO3B 5I9OA 2L1BA 3HZXA 3S17B 1LV9A 3K0YA 2L12A 4HIMA 2MP1A 1VF5C 1WJJA 4B3SQ 1WTRA 1DOMA 4A3FH 1IXRA 5CGKA 1HUMA 3I8ZA 2EYMA 2NUCA 2N55A 3D4WA 2F0MA 3PIP3 1CI3M 4NP5A 3KF6B 3NELA 1O7YA 3J81j 4JI6Q 3STBD 5DLQE 1PV4A 1RCVD 4G7ZC 4BY7B 3I91A 3K81C 3PIPA 2F1MA 1X65A 1TVXA 1XPUA 2WB1E 2E2HH 2LFNA 3CCJA 3RR5A 1DM0B 3K57A 1QNUA 4KJNA 4AQYL 1EFID 1STNA 1KTKA 1O7ZA 4DAPA 1M8AA 1OTCA 1STGA 1F9QA 3S2DH 4B3MQ 2UXDQ 3CC7A 5C5MA 2VUMH 1NTGA 1VMCA 2KCNA 4X6AH 1C7YA 2WAQB 2F3WA 4QUCA 4LF8Q 1IYUA 4PMBA 4OIKA 1G291 1ONLA 4KMUC 2IPKD 2E2HB 4RCNA 3L9AX 2A69D 3S1RB 3NTKA 2JA5B 1UE6A 5C3EB 4K5WA 3CF5A 4A3EG 3C1FA 1KNAA 3GQBA 2Z0SA 2Z1CA 4K8IA 1SFOH 3BDCA 1DZ1A 3GTKB 3I4NG 1M90C 4DAYA 4H0LC 3WOFA 3TP5A 1D1IA 4GOPB 1F2LA 4JI7Q 1QE6A 2WINB 1SNOA 1EIGA 4M1UB 2C35B 4K0KL 1E24A 1JWSD 1ET9A 4BXXH 4HJ7A 2NVQB 4KJOA 1KXLA 1SJED 1HPCA 2F0NA 4HSPA 4MN3A 3I4MB 2D5DA 3QB3A 4NPSA 1HZCA 3GTQB 2A69C 1EY9A 4LW1A 1WTVA 3NXWA 2VQFL 4IURA 1GUWA 2WAQE 4CKBA 4C1NI 3KUPA 1PRTB 5E4WC 2BCOA 4QL5A 3RZDH 1I94L 4FXKC 3CU7A 2BDOA 4DN4M 4ABNA 4BY1H 1Y1VB 4C3JB 3M7NA 3R93A 3MFGA 4LNQA 3BYYB 4OIJA 2GVAA 2XWBB 2R93G 4XQNA 3K5NA 2Z6KA 1SNPA 1HZBA 4QUFA 4BXXG 5CV9A 3SVMA 5C4JB 1RTNA 1VQDA 3QR8A 4S3SA 2CWPA 2AHOB 4K2LA 2PQEA 2R7ZB 1LLRD 3K5OA 3QG1A 2E2JH 2PQAA 3GTKH 5K36H 3U50C 1QUQA 1K9MC 4KI0A 1KC8C 1HFGA 3H3VI 5JEAG 2VQEQ 1VCIA 2IHFA 4R1JA 4IQZA 1PFSA 5IYDH 1G2TA 1OXUA 2KVMA 5JVG3 4YHHQ 4LF7L 4QJFA 3TREA 3HOYG 1IBKQ 3MA2B 4HIDA 1PFBA 3S1NH 4A93B 2R93H 1TWGB 1NSNS 5D14A 1S5FD 3URYA 4OONA 3DM1A 3PO2B 1J5EQ 4C3HH 3CC4A 1AP0A 4UP8A 2JA9A 2YTXA 1SNQA 4ILWA 2BDNA 2F0LA 4H02A 2QEXA 1SDFA 2B2WA 2HCIA 4DK3C 5KNDA 1VQPA 1PH4A 1NCVA 2NWGA 1I4GA 1MIUA 1BCPD 1A0IA 2WAQG 2YTVA 3HRZC 2AUKA 1CA6A 1X32A 1SMYC 4P75A 1AN8A 1VQHA 1BNZA 1NR2A 1KAWA 2BOSA 4X3KA 4AQYQ 1HNXQ 4IFDH 1N32L 5JJIA 1N33Q 4GZYC 2BE5D 1XJVA 4A3DB 1GKHA 2QCPX 4RHRA 3W1GA 5C5LA 2JA5G 5AJ3Q 3EQLC 2C9OA 3OPOA 1F77A 3UE0A 3TMEA 2ZM6Q 2VNUD 2PNHA 4OL7A 2RSOA 2K75A 2RVLA 2RA4A 1SEBD 4CKEA 3DMUA 2K5HA 3NBHA 1QCBD 4DV2Q 2Q2UA 1AZPA 1SAPA 2R7FA 1V8QA 1YNXA 5IT9L 5IYCH 1UWVA 3H15A 1PYWD 1BOSA 4A3IH 1NMFA 4GLAC 1DCZA 1L1OA 2X6GA 1VQ7A 2HDLA 2R6GA 4JVZA 1YJ9A 1UEAB 1X3EA 2FXQA 3G6JB 3BZDB 1LTID 3CQZH 3I4OA 1YHQA 2R61A 3K0XA 2ENBA 2UXBL 1RIPA 4K6LA 2K4KA 3CCEA 1H9MA 1ZYRC 5FO7B 1FNWA 2QA4A 1U4PA 1SRUA 4CDFC 3I7FA 5C4HA 1RJTA 3RZOH 1HRJA 4DKAC 5CV6A 1AE3A 3FMCA 4KKUA 4DNRB 4LUZA 4AYBB 1PVOA 2PI2A 4C3IH 1I6VC 2XVSA 4DNTB 5IT9c 3OTOL 1EY0A 3N6RA 5E3FA 4BA2I 1B3QA 2F0DA 2MQHA 4CJ2C 4MZ9A 1IW7D 4LK1C 4DV0Q 3VR3A 3S1MH 3DXJC 4DR7L 2QILA 4TRDA 3G7LA 1ILPA 2MO0A 4U68A 3LWEA 3J81L 3GTLH 2EE1A 1F9RA 4IFDI 4A3EH 1CT1D 3H09A 4YWLA 2UXCQ 1EZ8A 4L5TA 1K8AC 1JCKB 3D4DA 3S1QH 3ERQA 4OELB 2EIFA 2XSCA 2EZVA 2F0JA 5E7NA 1BBXC 1KLGD 4F7XA 4POGA 2XN9C 1WCMG 1JB7A 1E3PA 1EYGA 1GUTA 1I5FA 1LT3D 2NVTH 1X55A 4EQOA 2F4IA 3A5ZB 3L3OC 1EU4A 1E2ZA 4XDXA 1BR9A 3TDQA 1N8RC 4EGVA 1LTGD 1IBKL 1VQKA 5KIXA 4JI5Q 4EVOA 2VXWA 4PMCA 1J5EL 4A3KH 3J80c 3CMAA
chains in the Genus database with same CATH topology
3VR2A 1GUSA 2IT1A 2I46A 3K5MA 2IWHA 5DM73 1FNVA 4G7OC 1D5MC 5C4XB 1S5BD 5EPKA 5CV4A 4K8JA 4Q5VA 1PTOH 1V1OA 3PV0A 2L11A 1TWHB 2KJXA 5EKIA 1CK1A 3A7LA 4V0BA 3I3CA 1F2ZA 2IX3A 4KKSA 3M3YB 5EPJA 4G7HC 4U673 4FP5D 1I4QA 1VMPA 2QKIC 2F0FA 3TN2A 2NVXB 1PTOD 2F0GA 4ZRZA 2B2TC 5IGDA 3X3MA 3PUXA 1ILQA 3OHXC 3V96A 3EVQA 1B3AA 3GV6A 3HS0C 2PNRC 4C3JG 2Z8LA 4O42A 3S1QB 1LO5D 4R9WA 3ND8A 2K7VA 2AQ1B 3NPPA 2TMPA 2EY1A 5M5XB 4KTAA 2EJMA 1GOZA 2A74C 1EL0A 1SYBA 1D5ZC 2PMZB 3AU7A 2A68D 3FDTA 1CTMA 2AWOA 3OWFA 1WCMB 5A2QL 2EYJA 3D8GA 4OO1H 2EYFA 1CZGA 5NUCA 2JEAI 1FNUA 1EU3A 4ULLA 4HCSA 3O13A 1OXTA 3HKZB 4JK1C 1KDBA 4DXFA 2KOLA 3E6ZX 2BA0A 4IUVA 5LL6S 3AMUA 3T4AC 3J7YW 1RF2D 3QO2A 1TWFB 4Z9CB 2L5TA 1ENAA 4H44C 2CW0C 3HOVB 3M7GA 3H0GB 1OXVA 3K6OA 4A3FB 2SDFA 1QG7A 5EKKA 4TQUS 1W6JA 3D31A 2LY7A 3FRPB 1TS3A 3VYRA 1TS2A 2IX1A 5FLXE 3W3AA 5JAVA 3SR1A 5C3WA 5ELDA 3M85A 3BDOA 4FF1A 3J81E 3GTPB 3FEWX 1JR0D 4J6HA 2A5HA 5IGGA 1IW7C 3SE0A 4RAUC 1D1KA 2L4NA 2JA8B 3GD7A 3MWYW 5HGTA 4FYDA 1PFNA 3FKIB 3IFTA 4B9XA 4RCOA 3J7AV 5EGTA 1SYFA 4A3BB 1PMRA 3U9OA 4KY6A 3Q23A 3KLRA 5FLXL 4ZQ3A 1HQMC 4J8QA 5J1ZA 3EROA 1TY2A 1TWAB 2DNEA 1PZID 4KD3A 2EPBA 1E0BA 1IYVA 1TY0A 2QF7A 2F0WA 4ZYSA 2E2DC 4FF3A 1Y8NB 3VR5A 3T16A 4KK7A 4X3UA 1GXDC 3GO5A 1RD9D 3I4LA 5C44B 1STBA 1J9OA 1R4QB 1AW7A 1ZXTA 2G9HD 3A55A 1ENFA 2FMCA 4HSVA 4MHEA 1EQVA 5I9PA 4DXGA 1LTBD 1SNDA 1R4PB 3QJYA 4DK1A 4FF2A 3QOLA 1XXGA 2B2WC 3HG9A 3HP3A 1MD2D 3EFXD 1EYAA 5EKLA 3P1HA 1JQYD 3A8IE 3IKJA 3CKIB 3HOUB 4FF4A 2B2UA 4Q0FA 5A35A 1TWCB 1SNCA 5J39A 3PMFA 2Q8TA 2B2TA 2LS01 2O5JC 2ZXOA 5CV7A 4LJZC 3KBXA 2K1BA 5C6AA 2NB0A 3MZ5A 3QWNA 2F0QA 3M4OB 2RQXA 1HA5A 1GUOA 5CORA 3U9SA 2K03A 5ELBA 2VB2X 2HCCA 3NTHA 3SK8A 1TS4A 4HR7B 2H4OA 1R9TB 1HXYD 1C4QA 2JEBI 5ELEA 3NBIA 1H9SB 1AEXA 5F2DA 2NN6G 4XQJA 3FPPA 1Z47A 5CR3A 3I90A 1TR5A 5G3LD 3SK6A 1TT2A 2R3ZA 1AZQA 5E4XA 3I4NB 1UAPA 3BG3A 5M5WB 1S5DD 1SMYD 5C0XI 4XXEA 5M5YB 4M8AA 3QOJA 1HTLD 3VA7A 1KLUD 1NR4A 3DWAA 5D3IB 1G6ZA 1KABA 1SJHD 2B2VC 2K32A 3ZYYX 3C2PA 1BCPF 1VDZA 2ID0A 4G4KA 5EPLA 4E6IA 1PZKD 1WTQA 3DEPA 1GJXA 4HMJA 4KV6A 3IFDA 1KNEA 1LT6D 1ZYRD 1A2UA 5D3DA 1ESRA 4DF7A 4V190 3KF8A 5I6YA 2A6ED 3JAML 3NK9A 4NDXA 2D62A 4PMWA 1Y8PB 1RDPD 1SE4A 2E74C 4P2CB 4ZKBB 1YNJD 3DUZA 1Q1EA 3MXUA 5IT9E 1CZWA 1JWMD 1PLFA 2KECA 3VA5A 1EZ6A 2IL8A 4BBRB 1XTCD 3Q24A 2F0SA 2NN6I 3SHLA 2K01A 4CBVA 4LAAA 4IUTA 1O80A 2SNSA 2R92B 1ENCA 1KDCA 1EEFD 4J1MA 1H9JA 4ODGA 2EVBA 4R8IA 4A3KB 2AWNA 3MC0B 1JWUD 3I73A 4RGOS 5M9OA 2KHSA 2L0CA 1L0YB 5D65A 2AUJD 1SE2A 1V43A 1QB5D 1C48A 2ICIA 2IJ0A 3CRLC 3MHBA 2B2YC 4IALA 1T5EA 4F87A 2Z4HA 3K59A 4N9PA 3P20A 4WFN3 1U4LA 2H1EA 1ZKOA 1ML0D 2MHVA 2LMCB 1A2TA 4FO2A 2PW7A 1S5ED 1O78A 1E2WA 1OO9B 4Y7NB 4BBSB 2R93B 3BYTB 2EJGC 4KD4A 1IKLA 3GTGB 3GTOB 1QWYA 1WD0A 1A3UA 1V1PA 1XX8A 3D6WA 2NN6H 1I6HB 3DEOA 3OMGA 1B44D 3NE5B 2FHTA 4CJ0B 3D3RA 3TSSA 3OMCA 4O1NA 4BY1B 5EQ0A 1GHKA 1A3VA 3LX0A 2OT2A 4KY5A 4RGNA 4OO1G 5KNBA 1Y8OB 3CQZB 2K33A 1JICA 2NTSA 2MUYA 1PXUA 2EYPA 3TP6A 1FYCA 4BA1I 3A8JE 1SYEA 1XWEA 2K5QA 1FR3A 3CHBD 5ISRA 2IX0A 1JORA 5KNCA 1SXTA 3S1NB 3NUCA 1TIID 4C3HG 5I2YA 2X69A 1Y69U 2ZXPA 2KQ3A 4MIUA 1EY7A 1WD1A 1D6EC 2C5CA 1LT5D 1Q8IA 3V2TA 1TQOA 5IIFA 5G3LF 2K28A 2Q8IB 4A3IB 1X3PA 3BVMA 3PUZA 2E2IB 1I4PA 3WOEA 1I4HA 2O4XA 1Z7TA 2G9DA 2K5WA 4UAIA 1QOHA 1CM9A 2QDBA 2B2VA 2B8FA 3JAME 4K6DA 1E2VA 2XWJB 4PV1C 2IW3A 5KYLA 4HTHA 1JC7A 1H9SA 2F0IA 1NAPA 1UNSA 4A3MB 4RGMA 1U4RA 1HTPA 1WTXA 3E5SA 1DD2A 2J7ZA 3FVQA 2KCCA 2XRQD 2L9HA 1B2TA 4KHVA 2B39A 1IHZA 2JE6I 4IUQA 4NMZA 3DWPA 2PO4A 2AQ3B 1WTPA 3RZOB 4N9TA 4KY7A 2B2UC 4QB4A 3VYSA 2DNCA 3I72A 3V05A 1F2YA 3ITPA 2WIIB 3A54A 3F2UA 2A6HC 2MPMA 3PUWA 4C3IG 1PRTF 2F0KA 1W6KA 3MXGA 1NUCA 1B1ZA 1SYDA 5FK9C 4FVMA 2Z4IA 4ME5A 2WB1B 2ICEC 1K8OA 2L55A 5K36G 2AQ2B 1TKWB 2WV6D 4WRDA 2B2YA 1XYIA 1EQTA 2CQAA 4ZUIA 2EDGA 4L6TB 1D2BA 4B08A 1AFPA 3C1EA 5CV5A 3NTIA 3K5LA 4CKCA 2JYOA 3OWEB 2ZXRA 1RODA 2WP8J 1L0XB 1LTSD 5FO8B 3SK5A 2SNMA 2F3VA 4A3JB 2EY6A 2K5DA 5C0XH 3MFYA 5JJZA 2PCFB 1ET6A 5EJWA 2PZWA 3GP7A 2FINB 5CBAE 1CFMA 3I70A 4FXDA 2K6AA 2NVYB 3S2HB 1LABA 1QNKA 1F9PA 2FJ2A 3Q6SA 4L8JA 3P7JA 3X3NA 1JOQA 3LNNA 3Q22A 1WVLA 4IN3A 4XQQA 1GUNA 2LKVA 4ZKCB 4XYQA 3HOYB 3A8KE 4ID6A 2J4XA 5EBCA 3SDZA 3OIPA 1STYA 4IFDG 1KAAA 1FGBD 2TSSA 2PPBC 4XT1B 4I7ZC 1IKMA 2BE5C 3HEJA 4ZUJA 1YNNC 4OHJA 5K5PA 2RKSA 4ZLTF 2XRSD 4R8NA 4PQXA 1STEA 1MBYA 5DNFA 3BS1A 3S16B 4RKLA 4I65A 3T56B 1II3A 4XT3B 1F9SA 1LTAD 3PUYA 4DFAA 2KA7A 2OEOA 3BVZA 1HHVA 1CA5A 1DXMA 1HCZA 4OO1I 3FPUB 3VR4A 1K8MA 4DGZA 3H6MA 4QMGA 2EY2A 1EY8A 3RLFA 4RGTA 3RUZA 2N88A 4HCEA 3OSOA 5I4DA 4WORA 2J0TD 4B9WA 2FFKB 3K7AB 5JPMC 3E0JA 2A68C 3GTJB 1BO0A 5KYIA 3PUVA 2O5IC 4PNYA 5FO9B 3BDLA 3BVGA 2Y0SB 5AFWA 1RHPA 3KLSA 5EBDA 2XIWA 1EWCA 2MGSA 4C1NK 1HA6A 4CGYB 3P75A 2F0EA 1YNJC 3NHHA 2A6HD 3KLSX 4H13C 1BXTA 4DA2A 1H9RA 1LT4D 1PRTC 5IGCA 1LACA 4X3SA 5C3XA 2M2LA 1B50A 5BN3A 5JEAH 3EJIA 1SBBB 4KHZA 2X6LA 5JEAJ 2A73B 1S5CD 3KK7A 3OIQA 1JB3A 3CRKC 2DY7A 3S1MB 2F03A 2JA7B 5T1GA 3AB9A 3HGBA 2F0PA 2NTTA 1Q12A 2V4DA 3MTSA 3RZDB 3K58A 5HURA 3S9WA 1SFOB 3H3VC 2PYKA 1MSHA 1UUPA 5ELCA 1PTOC 4YIJA 4QCLA 5ELFA 4BWGB 3HOZB 3A56A 2OF1A 1I3QB 3TP7A 1G91A 1EY4A 2DY8A 3NSWA 1PFMA 2EYOA 5T1IA 4F8MA 4BS9A 3S2DB 4ZAIA 1BCPC 3J80L 1I50B 4C2MB 1STAA 2NVTB 1I4XA 3SXHA 4OGQC 1IL8A 4IUPA 1TS5A 4TKOB 1WTWA 2F0TA 5KEEA 2K04A 3VYTA 1DONA 1EIHA 4LMQD 4IUNA 1H9KA 3ND9A 3RD4A 2EOTA 4DAVA 1CQFA 3WDNA 2D9UA 1O7LA 5CMDA 5DM63 3VR6A 1J8IA 2VUMB 3W2DA 4L63B 1Q3LA 1BF4A 4RHSA 2NZ1D 3R3OA 1EY6A 1PZJD 5JPNC 5KGUA 4IUUA 2WKDA 1SYGA 3NP8A 4ZK9B 3NWSA 4NKLA 1A6XA 3MVVA 2EXZA 1B4OA 2RDHA 2MJ8A 3L7ZC 2EYHA 1VF7A 2KEEA 4K2KA 4X3TA 2F0VA 4FXGC 4WJWA 5CV8A 1MGSA 4DU9A 3S14B 1KDAA 4UDUC 5M3FB 1Y1WB 2M00A 3HOXB 1PRTD 1X3QA 3D6CA 4QF4A 3Q0AA 4KN7C 1YNND 5JVH3 2WKCA 1C8CA 5I2XA 3GTLB 5JOBA 1A3TA 2XNAC 4K5VA 1BQQT 2F0UA 1Q1BA 3D4RA 4A3GB 2E75C 2I07B 3TZDA 4CJ1B 1BCPB 1BDOA 2BA1A 3IL8A 3VYUA 4NW2A 1S4ZA 3LWUA 2F0OA 3OOCA 1FD7D 2K05A 1QILA 1B9MA 5C4ZA 4EQNA 1PDQA 3S15B 4HN7A 2RDGA 5J22A 2D2CC 5FOBB 3M4YA 1F2MA 2HDMA 3RMHA 1B9NA 5M3MB 1PTOB 3SEBA 4H7BA 3TBIB 1CQVA 1I4RA 5TSSA 4IZ8A 1HUNA 3DHQA 4CHTB 3MXPA 5CYUA 1DOLA 2JP1A 1ESFA 1EWHA 3TZUA 1MI2A 1PTOF 2FMMA 1RTOA 2Q8RE 1JE4A 1EEID 1A15A 1SYCA 4QIWB 2HQEA 3TP8A 2CVRA 3NWTA 4K5XA 4XYOA 2SOBA 2B8GA 2PZTA 2HUGA 1SNMA 3IAYA 1EOTA 3DWQA 3J80E 1M4VA 3T51B 2JSOA 3QIAA 3R2IA 5BN4A 1DJRD 4FNFA 3H94A 2KUMA 4HAEA 4XIGS 1STHA 2OXPA 1G8ZD 1EY5A 2KEDA 4KKTA 5KRUA 4K14A 3ONAB 3SK4A 2EYLA 3MEHA 1WTOA 1JOKA 5A2QE 3T13A 4G57A 1EYCA 3T53B 4TSSA 3PIO3 4F88A 1LTTD 1QJOA 1CHQD 2EY5A 2DN8A 4RFBA 1ZEQX 1OXXK 1JOOA 4HMIA 4RH6A 1Z6HA 5IGBA 4IFDJ 2WACA 5BN5A 5E1FA 5IOCA 5LL6X 2EJFC 1DOKA 2F0HA 1MSGA 1SE3A 2CHBD 2NBFA 2VB3X 5DEHA 1U9RA 2RBMA 1Q90A 2B63B 5IGFA 1G2SA 3R2TA 4DK0A 3HOWB 3C3LA 3J7AF 4C3IB 2RDFA 2JA6B 1K83B 4KN4C 2PW5A 4JBWA 3MAQA 2RSNA 1RKNA 1D5XC 2E2JB 1GHJA 1CHPD 3H91A 4C3HB 3NQTA 5CBEE 3GTMB 1EYDA 5C0XJ 4A3EB 5FKAC 1U4MA 4RA8A 3UI2A 1LTRD 2JXMB 4RKBA 1HFNA 1V1PB 3EA6A 1DYQA 3KBGA 3N52A 3R8BA 5CC4A 4RWSC 5LHY1 5IGEA 2ZT9C 3NQIA 1BUVT 2O2LD 3OW7A 2QEJC 1GUGA 5IODA 1TU2B 2M9VA 2YU9B 4C56C 5COYA 3A7AB 2PZUA 2CW0D 5C0XG 2E76C 4EQPA 4HEDA 4XTCS 1B53A 1ICWA 2A6EC 2SEBD 1SSOA 1OXSC 5I6WA 2NYZD 2GA4B 1T5XD 5DAUA 3MXNA 1HQRD 3C46A 3GV3A 2YYZA 3PO3B 5I9OA 2L1BA 3HZXA 3S17B 1LV9A 3K0YA 2L12A 2MP1A 1VF5C 1WTRA 1DOMA 5CGKA 1HUMA 3I8ZA 2EYMA 2NUCA 2N55A 3D4WA 3PIP3 2F0MA 1CI3M 4NP5A 1O7YA 1RCVD 4G7ZC 4BY7B 3I91A 2F1MA 1TVXA 2LFNA 1DM0B 3K57A 1QNUA 4KJNA 1EFID 1STNA 1KTKA 1O7ZA 4DAPA 1M8AA 1STGA 1F9QA 5C5MA 1VMCA 2KCNA 2WAQB 2F3WA 4QUCA 1IYUA 4PMBA 4OIKA 1G291 1ONLA 4KMUC 2IPKD 2E2HB 4RCNA 3L9AX 2A69D 3S1RB 3NTKA 2JA5B 5C3EB 4K5WA 3C1FA 1KNAA 3GQBA 2Z1CA 4K8IA 3BDCA 1DZ1A 3GTKB 4DAYA 4H0LC 3WOFA 3TP5A 1D1IA 1F2LA 1QE6A 2WINB 1SNOA 1EIGA 4M1UB 1JWSD 1ET9A 2NVQB 4KJOA 1SJED 1HPCA 2F0NA 4HSPA 4MN3A 3I4MB 2D5DA 3GTQB 3QB3A 2A69C 1EY9A 1WTVA 3NXWA 4IURA 1GUWA 4CKBA 4C1NI 3KUPA 1PRTB 5E4WC 2BCOA 4FXKC 3CU7A 2BDOA 4DN4M 4ABNA 1Y1VB 4C3JB 3M7NA 3R93A 3MFGA 3BYYB 4OIJA 2XWBB 4XQNA 3K5NA 1SNPA 4QUFA 5CV9A 3SVMA 5C4JB 1RTNA 4S3SA 4K2LA 2PQEA 2R7ZB 1LLRD 3K5OA 3QG1A 5K36H 4KI0A 1HFGA 5JEAG 1VCIA 4IQZA 1G2TA 1OXUA 2KVMA 5JVG3 4A93B 3MA2B 1PFBA 1TWGB 1NSNS 5D14A 1S5FD 3URYA 3PO2B 3DM1A 1AP0A 1SNQA 4ILWA 2BDNA 2F0LA 1SDFA 2B2WA 2HCIA 5KNDA 1NCVA 2NWGA 1I4GA 1BCPD 1CA6A 3HRZC 2AUKA 1X32A 1SMYC 1AN8A 1BNZA 1NR2A 4X3KA 2BOSA 4IFDH 4GZYC 2BE5D 4A3DB 2QCPX 4RHRA 5C5LA 3EQLC 2C9OA 3OPOA 1F77A 3TMEA 2VNUD 4OL7A 2RSOA 2RVLA 2RA4A 1SEBD 4CKEA 3DMUA 3NBHA 1QCBD 1AZPA 1SAPA 1V8QA 5IT9L 1PYWD 1BOSA 1DCZA 2X6GA 2HDLA 2R6GA 1UEAB 3G6JB 3BZDB 1LTID 2R61A 2ENBA 4K6LA 1H9MA 1ZYRC 5FO7B 1FNWA 1U4PA 5C4HA 1RJTA 1HRJA 5CV6A 3FMCA 4KKUA 4DNRB 4AYBB 1I6VC 2XVSA 4DNTB 1EY0A 3N6RA 5E3FA 4BA2I 2F0DA 4CJ2C 1IW7D 4LK1C 3VR3A 3DXJC 2QILA 4TRDA 3G7LA 1ILPA 4U68A 3LWEA 3J81L 2EE1A 1F9RA 4IFDI 1CT1D 3H09A 1EZ8A 1JCKB 3D4DA 3ERQA 2XSCA 2EZVA 2F0JA 1BBXC 1KLGD 4F7XA 2XN9C 1GUTA 1LT3D 4EQOA 2F4IA 3L3OC 1EU4A 1E2ZA 4XDXA 1BR9A 3TDQA 4EGVA 1LTGD 5KIXA 4EVOA 2VXWA 4PMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJO A;  3OWF A;  1EYC A;  3TME A;  4KY6 A;  3NK9 A;  2QDB A;  4NDX A;  4RKL A;  5C4Z A;  2EYJ A;  2F0N A;  3D8G A;  4I65 A;  2EYF A;  4EQN A;  5I6W A;  4OL7 A;  4K6D A;  3QB3 A;  4KD4 A;  4ZQ3 A;  5J1Z A;  4WRD A;  2EY5 A;  5DAU A;  3ERO A;  1EY9 A;  5NUC A;  3SK8 A;  1A3U A;  1II3 A;  1JOO A;  4HMI A;  3NXW A;  3DMU A;  4ZUI A;  4DFA A;  5KYL A;  4HTH A;  5J22 A;  4KD3 A;  2OEO A;  3HZX A;  1EY6 A;  3R3O A;  1F2M A;  2WAC A;  4K8J A;  5CV4 A;  3C1E A;  2F0I A;  5CV5 A;  5KGU A;  2F0W A;  3OMG A;  5E1F A;  5IOC A;  2F0P A;  1SYG A;  1KDB A;  3NP8 A;  5CGK A;  2EYM A;  2NUC A;  2F0H A;  3E5S A;  3VA5 A;  4NKL A;  1AEX A;  5F2D A;  1EZ6 A;  3D4W A;  3T16 A;  2F0M A;  3OMC A;  4NP5 A;  1SNP A;  5DEH A;  5I9O A;  1F2Z A;  5CV9 A;  3SK5 A;  4H7B A;  1U9R A;  3MVV A;  4DGZ A;  2EXZ A;  2SNM A;  3H6M A;  5HUR A;  3S9W A;  4QMG A;  2EY2 A;  2ENB A;  1EY8 A;  2F3V A;  2RBM A;  4KHV A;  4S3S A;  5IGF A;  2EYH A;  3T13 A;  1STB A;  1A3V A;  3LX0 A;  2PQE A;  4IZ8 A;  4K2L A;  1IHZ A;  3DHQ A;  4K2K A;  2F0S A;  4KY5 A;  5CR3 A;  3RUZ A;  3SHL A;  2EY6 A;  3MXP A;  1TR5 A;  2PYK A;  2RDF A;  3OSO A;  4LAA A;  3SK6 A;  2F0F A;  1TT2 A;  4NMZ A;  2F0V A;  5C4H A;  1ENA A;  2PW5 A;  4YIJ A;  4WOR A;  5CV6 A;  2SNS A;  5CV8 A;  1EQV A;  2PZW A;  5I9P A;  1ENC A;  2F0G A;  4KJN A;  4DU9 A;  4B9W A;  1KDC A;  1RKN A;  1SND A;  2OF1 A;  4J1M A;  4ODG A;  1STN A;  3TP7 A;  5IGD A;  1KDA A;  3U9O A;  2EYP A;  3NQT A;  1STG A;  1EY0 A;  2M00 A;  5E3F A;  1EY4 A;  5EKK A;  3TP6 A;  2F0D A;  5KYI A;  3QOL A;  5C5M A;  4N9T A;  5M9O A;  1EYD A;  1SYE A;  1NSN S;  4KY7 A;  3D6C A;  4QF4 A;  3EVQ A;  2EYO A;  2KHS A;  3QOJ A;  4PNY A;  4QB4 A;  4TRD A;  1SYC A;  4F8M A;  5IGB A;  2F3W A;  5ISR A;  2HQE A;  1EYA A;  4RKB A;  3BDL A;  5EKL A;  3TP8 A;  5JAV A;  3P1H A;  3SR1 A;  1JOR A;  1SNQ A;  4K5X A;  5C3W A;  1F2Y A;  1KAB A;  3ITP A;  1JOQ A;  2SOB A;  2PZT A;  2F0L A;  4PMB A;  1SNM A;  3NUC A;  5CC4 A;  1STA A;  3MHB A;  1EZ8 A;  5IGE A;  2LKV A;  3D4D A;  4ID6 A;  4IAL A;  4J6H A;  3ERQ A;  5JOB A;  1A3T A;  4K5V A;  2EY1 A;  5IGG A;  1STY A;  4K5W A;  2F0J A;  4KTA A;  2F0U A;  3P75 A;  1SNC A;  2F0E A;  2KQ3 A;  4MIU A;  1EY7 A;  3C1F A;  3SXH A;  3NHH A;  4E6I A;  3PMF A;  5IOD A;  5J39 A;  4N9P A;  1KAA A;  4K8I A;  2F0K A;  2F0T A;  5KEE A;  1STH A;  3BDC A;  3V2T A;  2OXP A;  1TQO A;  2PZU A;  1SYB A;  5CV7 A;  4EQO A;  5IIF A;  1NUC A;  4EQP A;  1EY5 A;  4HMJ A;  4KV6 A;  5HGT A;  5IGC A;  3TP5 A;  4F7X A;  4IUN A;  1SYD A;  4ME5 A;  3HEJ A;  4K14 A;  4ZUJ A;  5C6A A;  1A2T A;  3SK4 A;  3MZ5 A;  4B9X A;  5KRU A;  2PW7 A;  1A2U A;  1SNO A;  2F0Q A;  2EYL A;  3MEH A;  5C5L A;  4DF7 A;  5C3X A;  5K5P A;  2RKS A;  5KIX A;  1JOK A;  3EJI A;  4EVO A;  5I6Y A;  5EGT A;  1SYF A;  4PMC A;  2F0O A;  2O4X A;  4G57 A;  4R8N A; 
#chains in the Genus database with same CATH topology
 2NZH A;  3MXN B;  3VR2 A;  5LMU L;  1GUS A;  1EQR A;  2IT1 A;  2I46 A;  2A1A A;  3K5M A;  2IWH A;  3AYH B;  4DV1 L;  1L0W A;  5DM7 3;  1FNV A;  4A3D G;  3AQQ A;  2QDL A;  1D5M C;  4G7O C;  5C4X B;  1S5B D;  5EPK A;  5CV4 A;  4K8J A;  4Q5V A;  4GKK L;  4KLK A;  1PTO H;  1V1O A;  3PV0 A;  2KEN A;  3KF6 A;  1VS0 A;  2L11 A;  1TWH B;  3F2B A;  3PSI A;  2K5N A;  2KJX A;  5EKI A;  1CK1 A;  3A7L A;  3H0G G;  2UUC Q;  4V0B A;  3I3C A;  1F2Z A;  2IX3 A;  3K7U C;  4KKS A;  2HQL A;  3M3Y B;  2JA6 H;  3A0J A;  5EPJ A;  4G7H C;  4DR5 Q;  4U67 3;  3J80 i;  4FP5 D;  1I4Q A;  4JV5 Q;  1VMP A;  2QKI C;  3UE1 A;  2F0F A;  4TVA B;  3TN2 A;  2NVX B;  1PTO D;  4MNO A;  4I7A A;  2ZM6 L;  1BKB A;  1R9T H;  2F0G A;  4ZRZ A;  4X62 Q;  2B2T C;  5IGD A;  1YHA A;  3X3M A;  2HT1 A;  3PUX A;  1ILQ A;  3OHX C;  1N34 Q;  3V96 A;  4LWC A;  2QW7 A;  3EVQ A;  1B3A A;  3GV6 A;  3HS0 C;  4LF9 L;  2PNR C;  3GTJ H;  1VQL A;  4C3J G;  2Z8L A;  4O42 A;  3S1Q B;  1LO5 D;  4CDC C;  1PYS B;  4R9W A;  1EFW A;  3ND8 A;  4AYB G;  1PH6 A;  3CP0 A;  2K7V A;  2AQ1 B;  2R92 H;  1JJC B;  3NPP A;  2TMP A;  3CC2 A;  2EY1 A;  5M5X B;  4KTA A;  1EIY B;  3T1H Q;  2EJM A;  1GOZ A;  1A8V A;  2A74 C;  1EL0 A;  1VQ8 A;  1SYB A;  2ATW A;  4NXM Q;  4KHP L;  1D5Z C;  2VUM G;  2PMZ B;  4LF4 L;  4IJL A;  4DR6 L;  2CH4 A;  2A68 D;  3AU7 A;  1VQ6 A;  3FHW A;  3FDT A;  3CCM A;  4JI8 L;  2CQO A;  1CTM A;  4DR7 Q;  2AWO A;  2Q2H A;  3OWF A;  1WCM B;  5A2Q L;  4DV5 L;  1PH9 A;  3H3V H;  2EYJ A;  4A4I A;  3D8G A;  2G5D A;  4OO1 H;  2EYF A;  5JJL A;  1VQA A;  4N8F A;  1CZG A;  5NUC A;  4EX5 A;  5FLM G;  2JEA I;  1FNU A;  1EU3 A;  2R7D A;  4JI7 L;  1AE2 A;  1QVF A;  4ULL A;  4C2M H;  4HCS A;  5LMN Q;  4K0K Q;  3O13 A;  1OXT A;  3HKZ B;  2P5Z X;  4JK1 C;  1KDB A;  1HR0 Q;  1H95 A;  2NZO A;  4DXF A;  2KOL A;  3E6Z X;  2BA0 A;  4IUV A;  2Z6B A;  5LL6 S;  3AMU A;  3T4A C;  3K80 C;  3J7Y W;  2VQF Q;  1RF2 D;  3QO2 A;  1TWF B;  4OWX B;  4Z9C B;  1KRS A;  3K7A H;  2L5T A;  1YEZ A;  1ENA A;  4H44 C;  1W2B A;  2CW0 C;  3HOV B;  4L5S A;  3M7G A;  3H0G B;  1OXV A;  3K6O A;  4A3F B;  2SDF A;  1QG7 A;  2HHH L;  1WTH A;  5EKK A;  4TQU S;  1W6J A;  1L1O C;  4IPD A;  3D31 A;  2LY7 A;  3FRP B;  4GLX A;  1TS3 A;  3VYR A;  1TS2 A;  3FP9 A;  2IX1 A;  2IY5 B;  1G51 A;  5FLX E;  3W3A A;  3BU2 A;  5JAV A;  1XPR A;  4A93 H;  3SR1 A;  3EN2 A;  5C3W A;  5ELD A;  3M85 A;  3BDO A;  3J81 E;  4FF1 A;  4JOI A;  4UY8 C;  3PO2 H;  2A8V A;  4LFA Q;  3GTP B;  3FEW X;  4YY3 Q;  1JR0 D;  4J6H A;  5IY0 A;  1WFQ A;  4GN5 A;  2A5H A;  5IGG A;  1IW7 C;  3SE0 A;  4RAU C;  1D1K A;  1YJN A;  3FKI H;  3GTM H;  2L4N A;  2K14 A;  2JA8 B;  3GD7 A;  4DV4 Q;  3MWY W;  5HGT A;  4FYD A;  2NVQ H;  1PFN A;  3FKI B;  3IFT A;  4B9X A;  4RCO A;  3KFU A;  3J7A V;  2MNA A;  2ZTE A;  5EGT A;  1SYF A;  2NVY H;  4A3B B;  1PMR A;  2OQK A;  3U9O A;  4KY6 A;  1N9W A;  3Q23 A;  3KLR A;  2EXD A;  3M4O H;  5FLX L;  4ZQ3 A;  1HQM C;  4J8Q A;  5J1Z A;  1EUJ A;  3ERO A;  1TY2 A;  1TWA B;  1Q8K A;  2DNE A;  1PZI D;  2GN5 A;  4KD3 A;  2E5L L;  2EPB A;  1E0B A;  1IYV A;  1TY0 A;  2QF7 A;  2F0W A;  5IP7 G;  2Y0S E;  4ZYS A;  4HIO A;  2E2D C;  4FF3 A;  1Y8N B;  3VR5 A;  4IO9 A;  1CKM A;  2JJQ A;  3T16 A;  4KK7 A;  2RF4 A;  4X3U A;  1GXD C;  3GO5 A;  1RD9 D;  4UP7 A;  3I4L A;  2NVX H;  2UXD L;  5C44 B;  1L2F A;  1XMO Q;  1STB A;  2IHE A;  1J9O A;  1R4Q B;  2RHQ B;  1KD1 C;  1AW7 A;  1ZXT A;  2G9H D;  3A55 A;  1ENF A;  1I3Q H;  2FMC A;  4HSV A;  3J7Z C;  4MHE A;  1PA6 A;  4LF8 L;  1EQV A;  5I9P A;  4DXG A;  1RL2 A;  1I6H H;  1E22 A;  1G6P A;  1LTB D;  1SND A;  1R4P B;  2L15 A;  5IP7 H;  3QJY A;  4DK1 A;  4FF2 A;  3QOL A;  4IPC A;  1XXG A;  2ZJQ A;  2B2W C;  3HG9 A;  4B3R Q;  1PH7 A;  3HP3 A;  1MD2 D;  3CME A;  3EFX D;  1EYA A;  5EKL A;  3P1H A;  1JQY D;  3A8I E;  1W3S A;  3IKJ A;  4A3F G;  3OTO Q;  3ERS X;  3CKI B;  3PO3 G;  3HOU B;  4FF4 A;  2B2U A;  4Q0F A;  3H0G H;  1YJW A;  4GKJ L;  5A35 A;  4GNX C;  1TWC B;  1SNC A;  5J39 A;  3PMF A;  2Q8T A;  2B2T A;  2LS0 1;  3S15 H;  4CDD C;  2O5J C;  2ZXO A;  5CV7 A;  4LJZ C;  3KBX A;  2K1B A;  3CPF A;  5ELO A;  2LXJ A;  5C6A A;  2NB0 A;  3MZ5 A;  3QWN A;  2F0Q A;  3M4O B;  2RQX A;  3LGJ A;  1P8L A;  2JN4 A;  1HZA A;  1HA5 A;  4A3L G;  1GUO A;  3M4Q A;  5COR A;  3U9S A;  3PO3 H;  2K03 A;  2JA8 G;  5ELB A;  2VB2 X;  2HCC A;  3NTH A;  3SK8 A;  1TS4 A;  4LFA L;  4HR7 B;  2KHJ A;  2AKW B;  3FKI G;  1HH2 P;  2H4O A;  3CCU A;  4EQ5 A;  1LYL A;  1SE8 A;  1R9T B;  1HXY D;  3HOW G;  1XMQ L;  1C4Q A;  3ULL A;  2JEB I;  5ELE A;  3NBI A;  1H9S B;  1AEX A;  5F2D A;  3ULJ A;  2NN6 G;  4XQJ A;  5LMN W;  1MJC A;  4LF7 Q;  3FPP A;  4A3K G;  4LF5 Q;  1CKN A;  1Z47 A;  1JJG A;  5CR3 A;  4IPG A;  1NNX A;  1S3O A;  3I90 A;  1TR5 A;  5G3L D;  3SK6 A;  4CDE C;  1TT2 A;  2R3Z A;  1AZQ A;  3E3X A;  5E4X A;  3I4N B;  4A3D H;  3KDF B;  1UAP A;  3BG3 A;  5M5W B;  4J15 A;  4JI3 Q;  4A3I G;  1S5D D;  1SMY D;  1K83 H;  5C0X I;  4XXE A;  3G71 A;  4JYA Q;  5M5Y B;  4M8A A;  3HOV H;  2CKZ B;  3D0F A;  3QOJ A;  1HTL D;  3VA7 A;  2B3G A;  1GO3 E;  1SR3 A;  5C44 H;  4P72 A;  1KLU D;  1NR4 A;  4X64 Q;  4A3J H;  1XTD A;  3DWA A;  5D3I B;  1HR0 W;  1G6Z A;  1KAB A;  1SJH D;  2B2V C;  2K32 A;  3ZYY X;  3C2P A;  3HOX G;  1BCP F;  3GDE A;  1VDZ A;  4DR1 L;  2ID0 A;  4G4K A;  3UDX A;  2YTY A;  1Y1V G;  5EPL A;  4E6I A;  1PZK D;  5IP9 H;  1WTQ A;  4LFB Q;  3DEP A;  2I5H A;  1GJX A;  3PGZ A;  4KV6 A;  4HMJ A;  3IFD A;  1KNE A;  5GAH C;  4JI6 L;  4QQB X;  3KYH C;  4DV2 L;  1LT6 D;  2R7Z G;  1ZYR D;  1A2U A;  5D3D A;  1ESR A;  4DF7 A;  4V19 0;  1YBY A;  3KF8 A;  4QY7 A;  5I6Y A;  2A6E D;  3J7A 5;  3JAM L;  4JOI C;  4MTK A;  3NK9 A;  4A3G G;  4NDX A;  2D62 A;  4PMW A;  4R4I A;  1Y8P B;  1RDP D;  1SE4 A;  1FGU A;  2E74 C;  4P2C B;  4DAM A;  4ZKB B;  4A3M H;  4NXM L;  4LF4 Q;  4A75 A;  4Y7N H;  4BBS H;  4A93 G;  1YNJ D;  4B3M L;  3JAM c;  3DUZ A;  4NB3 A;  1Q1E A;  3MXU A;  5IT9 E;  3CCS A;  1CZW A;  1JWM D;  1PLF A;  2KEC A;  3W5O A;  3UDG A;  4DUZ Q;  3VA5 A;  1EZ6 A;  3PIO A;  2IL8 A;  3CW2 C;  4JBM A;  4BBR B;  2UU9 Q;  1XTC D;  3Q24 A;  2F0S A;  2NN6 I;  4P71 A;  3SHL A;  2K01 A;  4CBV A;  4LAA A;  3CCQ A;  4IUT A;  4A3B G;  1O80 A;  4QGU A;  3S2H H;  2SNS A;  3KF8 B;  2R92 B;  1ENC A;  3B6Y A;  1KDC A;  1EEF D;  4J1M A;  1H9J A;  4ODG A;  2EVB A;  5IWA L;  1PH2 A;  4R8I A;  4A3K B;  4PG3 A;  2AWN A;  3MC0 B;  1JWU D;  3I73 A;  4RGO S;  5M9O A;  1JT8 A;  4OWW B;  1XMQ Q;  2KHS A;  2L0C A;  1L0Y B;  5D65 A;  3RLO A;  2AUJ D;  1SE2 A;  2ZTC A;  1V43 A;  4DR4 L;  1QB5 D;  1C48 A;  4DR3 Q;  4HJA A;  1XNQ L;  3TS0 A;  2ICI A;  4A3B H;  2IJ0 A;  3CRL C;  3MHB A;  4AH6 A;  2K50 A;  2B2Y C;  4IAL A;  1T5E A;  4F87 A;  2Z4H A;  3E0E A;  3DM3 A;  4IJH A;  3K59 A;  4N9P A;  1VQO A;  4POF A;  3F1Z A;  3P20 A;  4WFN 3;  1U4L A;  3HFZ B;  1VQF A;  1JJ2 A;  2H1E A;  1ZKO A;  1ML0 D;  2MHV A;  3S24 A;  2LMC B;  4C3J H;  2CH4 W;  1A2T A;  4A3J G;  4FO2 A;  4DUY L;  2PW7 A;  3S16 H;  1S5E D;  5FLX c;  1O78 A;  3TEH B;  4ME3 A;  1E2W A;  1OO9 B;  4Y7N B;  1QZH A;  4BBS B;  5C4X H;  2R93 B;  4X64 L;  2E2I H;  3BYT B;  2EJG C;  4KD4 A;  1IKL A;  3GTG B;  1V1Q A;  3GTO B;  1QWY A;  1WD0 A;  1A3U A;  1VQE A;  1V1P A;  1IZ6 A;  2ASB A;  1XX8 A;  4GNX A;  1C9O A;  3KLW A;  1VQN A;  3D6W A;  2NN6 H;  1I6H B;  3DEO A;  3OMG A;  1B44 D;  1FVI A;  3HOU H;  3NE5 B;  1Q86 C;  2FHT A;  1BVS A;  1O7I A;  4CJ0 B;  1K73 C;  3D3R A;  1IBM L;  1HNW L;  3TSS A;  2F4V Q;  3OMC A;  4O1N A;  4GS3 A;  5H1S E;  4BY1 B;  5EQ0 A;  1GHK A;  2XGT A;  1A3V A;  3LX0 A;  2OT2 A;  4KY5 A;  4RGN A;  4OO1 G;  3W1B A;  5KNB A;  2MFI A;  1Y8O B;  3CQZ B;  2K33 A;  2I0Q A;  4WJ3 M;  2BH2 A;  1E1O A;  4GOP A;  1HNX L;  1JIC A;  2NTS A;  2MUY A;  2PI2 E;  4BBR G;  1EWI A;  1N33 L;  1PXU A;  2EYP A;  3TP6 A;  1FYC A;  4BA1 I;  3A8J E;  1XMO L;  5AJ3 L;  3ICE A;  1SYE A;  1TXY A;  1XWE A;  2K5Q A;  3T1H L;  1FR3 A;  3CHB D;  5ISR A;  2IX0 A;  2CWA A;  1JOR A;  5KNC A;  1SXT A;  3S1N B;  3I56 A;  3NUC A;  1TII D;  3KJO A;  4C3H G;  1X3F A;  4JBK A;  5I2Y A;  3ULP A;  3E9H A;  1VQB A;  2X69 A;  1Y69 U;  2ZXP A;  2KQ3 A;  4MIU A;  1EY7 A;  1WD1 A;  1QVG A;  1YIT A;  1D6E C;  2C5C A;  1LT5 D;  1Q8I A;  3V2T A;  1TQO A;  5IIF A;  5G3L F;  2K28 A;  4JG2 A;  2Q8I B;  4A3I B;  1X3P A;  4X65 Q;  3BVM A;  1VQC A;  3PUZ A;  4HJ5 A;  2E2I B;  1N36 L;  1I4P A;  5LMN L;  3WOE A;  1I4H A;  2O4X A;  1Z7T A;  2G9D A;  2K5W A;  4UAI A;  1QOH A;  1CM9 A;  2QDB A;  2B2V A;  2B8F A;  3JAM E;  4K6D A;  1PH3 A;  1E2V A;  2XWJ B;  4PV1 C;  2I5M X;  4JI2 L;  2IW3 A;  5KYL A;  4HTH A;  1JC7 A;  3GTQ H;  1H9S A;  1E7Z A;  2F0I A;  2OTL A;  1NAP A;  1UNS A;  4A3M B;  3S14 H;  4RGM A;  1U4R A;  4A76 A;  1HTP A;  2VY3 A;  1WTX A;  3E5S A;  1S40 A;  1JMC A;  1DD2 A;  1GM5 A;  2J7Z A;  3FVQ A;  4BY7 H;  1TWF H;  5IYC G;  2KCC A;  2XRQ D;  2UXC L;  2L9H A;  1B2T A;  4GLV B;  4KHV A;  4APV A;  4DAY B;  2B39 A;  2VZA A;  1IHZ A;  3U4V A;  2JE6 I;  4IUQ A;  4NMZ A;  4HIK A;  3DWP A;  2PMZ E;  4X66 Q;  2PO4 A;  3L0O A;  2AQ3 B;  3RN2 A;  1KHI A;  3M9B A;  1Y1V H;  1WTP A;  3RZO B;  4BY7 G;  4N9T A;  3SGI A;  5L37 A;  4JPB W;  4KY7 A;  2VW9 A;  2B2U C;  1NJI C;  1I50 H;  2CFM A;  3U4Z A;  4QB4 A;  2JK8 A;  4B3S L;  1M1K C;  5LMU Q;  3VYS A;  2DNC A;  5IYB H;  2D0P A;  2K5V A;  2R7Z H;  2K52 A;  3I72 A;  3V05 A;  1F2Y A;  3ITP A;  4DV4 L;  5M5X H;  2EQS A;  1VQJ A;  2JA7 G;  4DV1 Q;  1AH9 A;  2WII B;  3A54 A;  3HKS A;  3F2U A;  3EBE A;  2I5L X;  2A6H C;  2MPM A;  3PUW A;  4C3I G;  1LUZ A;  1NE3 A;  1PRT F;  2HIV A;  2JA6 G;  2F0K A;  1W6K A;  3MXG A;  5IE8 A;  1SMX A;  1NUC A;  2YV5 A;  1WCM H;  1B1Z A;  4ME5 A;  4FVM A;  1SYD A;  2Z4I A;  5FK9 C;  4DR5 L;  2E5L Q;  5C4X G;  2WB1 B;  2ICE C;  4DR1 Q;  5M3M H;  1K8O A;  2L55 A;  5K36 G;  2AQ2 B;  1TKW B;  2WV6 D;  4WRD A;  1K3B C;  1YZ6 A;  2B2Y A;  1XYI A;  4JI0 L;  1EQT A;  5GQO A;  3TQY A;  2CQA A;  4ZUI A;  1N34 L;  2EDG A;  4L6T B;  1D2B A;  4B08 A;  1AFP A;  1UE1 A;  3C1E A;  3NTI A;  5CV5 A;  1MJE A;  3K5L A;  4LF9 Q;  4CKC A;  2JYO A;  3RN5 A;  3OWE B;  2ZXR A;  1ROD A;  2WP8 J;  3S1R H;  2LSS A;  1L0X B;  3I4M G;  1LTS D;  2N3S A;  3TS2 A;  1WOC A;  1ASY A;  5FO8 B;  3SK5 A;  1WI5 A;  3UDI A;  2SNM A;  2MO1 A;  2F3V A;  3U58 A;  2UUA Q;  4A3J B;  1PYB A;  1N36 Q;  2EY6 A;  2K5D A;  1K8G A;  1TWA H;  1MKH A;  1U0L A;  3MFY A;  5JJZ A;  2PCF B;  5C0X H;  4AIM A;  2LXK A;  1ET6 A;  2HD3 A;  1B7Y B;  5EJW A;  1CSQ A;  4BBS G;  2PZW A;  3GP7 A;  2FIN B;  5CBA E;  1VQ4 A;  1CFM A;  1X3G A;  3CCV A;  3I70 A;  4DV7 Q;  2K6A A;  4FXD A;  2NVY B;  4P74 A;  3S2H B;  3VDY A;  2AMC B;  1LAB A;  1QNK A;  4GKJ Q;  1F9P A;  2FJ2 A;  4JI8 Q;  1SRO A;  4PZ7 A;  3Q6S A;  4L8J A;  3J81 i;  3P7J A;  3X3N A;  3JC6 6;  3RNU A;  1JOQ A;  3LNN A;  3Q22 A;  2JQO A;  1WVL A;  4IN3 A;  5IWA Q;  4XQQ A;  1GUN A;  2LKV A;  4ZKC B;  4XYQ A;  3A8K E;  3HOY B;  4ID6 A;  2J4X A;  5EBC A;  3SDZ A;  1VQG A;  4DK6 C;  3OIP A;  3BZK A;  1STY A;  4IFD G;  1PHJ A;  1IBL Q;  1KAA A;  1HR0 L;  1FGB D;  2TSS A;  4DR3 L;  2PPB C;  1XNQ Q;  4XT1 B;  1YVC A;  5BR8 L;  4OX9 Q;  4I7Z C;  1IKM A;  2BE5 C;  5C44 G;  3HEJ A;  4ZUJ A;  1YNN C;  3I55 A;  4OHJ A;  5K5P A;  1T9H A;  2RKS A;  2KCM A;  3CCL A;  2VS1 A;  4ZLT F;  2XRS D;  4R8N A;  3HKZ G;  4PQX A;  1STE A;  1MBY A;  5DNF A;  3BS1 A;  3S16 B;  3KJP A;  4RKL A;  4B3T Q;  2H5X A;  1YHB A;  4I65 A;  4UHV A;  3T56 B;  4JI4 Q;  1II3 A;  4XT3 B;  1F9S A;  1LTL A;  1LTA D;  4MTN A;  4LF5 L;  3PUY A;  4DFA A;  2KA7 A;  2WB1 G;  2OEO A;  3BVZ A;  2A19 A;  1D8L A;  3T1Y Q;  1HHV A;  1FL0 A;  4HJ9 A;  1CA5 A;  4ALP A;  1DXM A;  5HY6 A;  1HCZ A;  4HJ8 A;  4OO1 I;  3FPU B;  3VR4 A;  3HOZ G;  1K8M A;  1CSP A;  4DGZ A;  1K0S A;  3H6M A;  1TWC H;  3UDF A;  4QMG A;  2EY2 A;  1EY8 A;  3RLF A;  2F3I A;  1NY4 A;  1P16 A;  4RGT A;  1FJG Q;  3RUZ A;  3G4S A;  2N88 A;  4A3C H;  4HCE A;  2HIX A;  3OSO A;  2N49 A;  5I4D A;  5JJK A;  4WOR A;  2J0T D;  4IOA A;  1PH5 A;  2JA5 H;  1IBM Q;  1HNW Q;  4B9W A;  1HNZ Q;  2FFK B;  4JI0 Q;  3K7A B;  5JPM C;  3E0J A;  2WFW A;  5HGQ A;  2A68 C;  3GTJ B;  3KDF A;  1BO0 A;  5KYI A;  3PUV A;  3Q8D A;  1NMG A;  2ZJP A;  3G48 A;  2O5I C;  2QGQ A;  4PNY A;  5FO9 B;  3BDL A;  3BVG A;  3EIV A;  4DV3 Q;  2Y0S B;  5AFW A;  3HOY H;  1XNR L;  3I2Z A;  1RHP A;  1K3R A;  3KLS A;  2OQ0 A;  2BH8 A;  5EBD A;  2XIW A;  1EWC A;  2MGS A;  4UPA A;  4C1N K;  1HA6 A;  4CGY B;  3CD6 A;  3P75 A;  2F0E A;  1YNJ C;  4PZ8 A;  3NHH A;  5M5Y H;  2A6H D;  3KLS X;  3WWV A;  4H13 C;  1BXT A;  2Q2T A;  3PF5 A;  4DV6 L;  4DA2 A;  1H9R A;  1LT4 D;  1PRT C;  5IGC A;  5FJ8 H;  1LAC A;  3CXC A;  1ICF B;  4X3S A;  5C3X A;  2M2L A;  1B50 A;  5BN3 A;  5J3B A;  5JEA H;  4DV0 L;  3EJI A;  1SBB B;  4KHZ A;  4R4O A;  1HZ9 A;  2X6L A;  4UP9 A;  5JEA J;  3PO2 G;  2A73 B;  4DUZ L;  1S5C D;  5EAY A;  3KK7 A;  3OIQ A;  1JB3 A;  1VQI A;  3CRK C;  2DY7 A;  3S1M B;  1SN8 A;  2UU9 L;  2F03 A;  2JA7 B;  4JW0 A;  5T1G A;  3AB9 A;  3HGB A;  4YWM A;  4X65 L;  1YI2 A;  1X56 A;  2F0P A;  2NTT A;  1Q12 A;  5M3F H;  2V4D A;  3MTS A;  4RG1 A;  3RZD B;  4IOC A;  4GOP C;  3K58 A;  2PQA B;  2F52 A;  5HUR A;  3S9W A;  1QUQ B;  1SFO B;  3H3V C;  2VL6 A;  4JI5 L;  2PYK A;  1MSH A;  1UUP A;  5ELC A;  1PTO C;  4DR4 Q;  4YIJ A;  4QCL A;  4B3T L;  5ELF A;  2Z9H A;  4BWG B;  3HOZ B;  3A56 A;  3M4P A;  2OF1 A;  1I3Q B;  3TP7 A;  3J81 c;  1G91 A;  1EY4 A;  3HOU G;  3I4N H;  3HOZ H;  4AYB E;  2DY8 A;  3NSW A;  4GKK Q;  1PFM A;  2EYO A;  1BBU A;  5T1I A;  1BBW A;  4F8M A;  3GTO H;  2B63 H;  4BS9 A;  3S2D B;  4R4T A;  4ZAI A;  1BCP C;  2UUC L;  3J80 L;  4A3C G;  2V1C C;  1I50 B;  4QIW E;  4C2M B;  1STA A;  3NEM A;  4DUY Q;  2KBN A;  4LFC L;  2NVT B;  4JV5 L;  1I4X A;  3SXH A;  4OGQ C;  1IL8 A;  4IUP A;  1TS5 A;  4TKO B;  3TRZ A;  1DGS A;  1X9N A;  1WTW A;  2F0T A;  5KEE A;  3CPW A;  4X62 L;  5C3E H;  5ELN A;  1J6Q A;  2K04 A;  3VYT A;  1DON A;  1EIH A;  2B63 G;  4LMQ D;  4IUN A;  4NXN Q;  5GAG C;  4L5R C;  1H9K A;  3ND9 A;  4FDB A;  3RD4 A;  1S72 A;  2EOT A;  5IYB G;  4DAV A;  1U5K A;  3L2P A;  1CQF A;  3WDN A;  2D9U A;  1O7L A;  1K0R A;  5CMD A;  5DM6 3;  3VR6 A;  3F2C A;  3G6E A;  2VUM B;  1J8I A;  3W2D A;  2KHI A;  1VQ9 A;  4YWK A;  1VQM A;  4L63 B;  1Q3L A;  1L1O B;  1BF4 A;  4RHS A;  2NZ1 D;  3R3O A;  1EY6 A;  1PZJ D;  5JPN C;  5KGU A;  4IUU A;  2WKD A;  4DNI A;  1PH8 A;  1SYG A;  1D7Q A;  3NP8 A;  1EOV A;  2E8G A;  4ZK9 B;  3NWS A;  4NKL A;  4KHP Q;  2XTI A;  4DV6 Q;  1A6X A;  3MVV A;  2EXZ A;  1B4O A;  2RDH A;  2MJ8 A;  3L7Z C;  2YU9 H;  2EYH A;  5GAE C;  1VF7 A;  2KEE A;  4K2K A;  3PCO B;  3BZC A;  4X3T A;  2JA8 H;  4BBR H;  4DPG A;  2F0V A;  4IPH A;  4FXG C;  4WJW A;  2Z6K C;  4DV5 Q;  4JC0 A;  5CV8 A;  4LFB L;  1MGS A;  4LF6 L;  4DU9 A;  3S14 B;  2ZTD A;  1KDA A;  4UDU C;  5M3F B;  1Y1W B;  2M00 A;  3HOX B;  1PRT D;  1KL9 A;  1X3Q A;  4R4C A;  1EQQ A;  3D6C A;  4QF4 A;  3I4M H;  3Q0A A;  1WYD A;  1MHW C;  4KN7 C;  3STB C;  1YNN D;  3GTP H;  3HOV G;  5JVH 3;  3JAM i;  3K8A A;  2WKC A;  1C8C A;  1C0A A;  5I2X A;  3OW2 A;  4O2D A;  1ASZ A;  4DV7 L;  4DR2 L;  1Q82 C;  1A63 A;  3GTL B;  4YCV A;  5JOB A;  1A3T A;  2XNA C;  4K5V A;  2OWO A;  1BQQ T;  2F0U A;  3M3Y H;  1Q1B A;  3D4R A;  3KOJ A;  5C4J H;  4A3G B;  2E75 C;  2I07 B;  3TZD A;  1TWG H;  4CJ1 B;  4BY1 G;  1V9P A;  1BCP B;  4OEM B;  1GVP A;  2HHH Q;  1BDO A;  2BA1 A;  3IL8 A;  1I94 Q;  3VYU A;  4NW2 A;  1S4Z A;  1QVC A;  1UE7 A;  2F0O A;  3LWU A;  3OOC A;  1FD7 D;  2K05 A;  1QIL A;  1X54 A;  1B9M A;  1CKO A;  5C4Z A;  4EQN A;  2Y0S G;  3PQI A;  2N8N A;  4JI1 Q;  1PDQ A;  5BR8 Q;  4OX9 L;  3S15 B;  4HN7 A;  1KRT A;  3HKZ E;  2ES2 A;  2RDG A;  5J22 A;  2D2C C;  5FOB B;  3M4Y A;  1Z9F A;  1F2M A;  2UUB L;  2HDM A;  3RMH A;  1B9N A;  3GTG H;  3ZJY C;  4WJ4 A;  2B29 A;  4LUO A;  2Q2I A;  3AFP A;  4X66 L;  2R92 G;  5M3M B;  1PTO B;  3SEB A;  4H7B A;  3TBI B;  4O0A A;  1CQV A;  2N78 A;  1I4R A;  4YHH L;  5TSS A;  4IZ8 A;  1HUN A;  3DHQ A;  4A3G H;  2DJF C;  3MXP A;  4CHT B;  4N8X 1;  1DOL A;  1HJP A;  5CYU A;  5FJ8 G;  2DJG C;  2JP1 A;  1ESF A;  3F2D A;  3AFQ A;  1EWH A;  5GAD C;  1Y1W H;  3MEF A;  3TZU A;  1MI2 A;  1PTO F;  2FMM A;  1RTO A;  3OYY A;  4YCW A;  2Q8R E;  1JE4 A;  1GD7 A;  2JA7 H;  1EEI D;  3DLL A;  1A15 A;  4LUV A;  1SYC A;  1XPO A;  4QIW B;  5FLM H;  2HQE A;  3TP8 A;  2CVR A;  1A62 A;  3NWT A;  4K5X A;  2RCN A;  2SOB A;  2B8G A;  2PZT A;  4XYO A;  1N32 Q;  2HUG A;  1HNZ L;  1SNM A;  3IAY A;  1EOT A;  3DWQ A;  3J80 E;  4A3L H;  1M4V A;  3T51 B;  5M3F G;  2JSO A;  1Y1W G;  3QIA A;  3R2I A;  4P73 A;  3CCR A;  2DGY A;  5BN4 A;  1DJR D;  4JBJ A;  2D0O A;  3AEV A;  4FNF A;  3H94 A;  2KUM A;  1CKN B;  4HAE A;  4RMF A;  4ZCK A;  4XIG S;  1STH A;  4DV3 L;  3IRB A;  2F4V L;  4LF6 Q;  2DUD A;  2OXP A;  1G8Z D;  3ER0 A;  1XNR Q;  3S17 H;  4R4Q A;  1EY5 A;  1QZG A;  1SLJ A;  2KED A;  4KKT A;  5KRU A;  4K14 A;  3ONA B;  3SK4 A;  3BJU A;  2EYL A;  3MEH A;  1WTO A;  1JOK A;  5A2Q E;  4B3R L;  4G57 A;  3T13 A;  1EYC A;  3T53 B;  1YIJ A;  4TSS A;  3PIO 3;  4F88 A;  1LTT D;  3A74 A;  1QJO A;  1CHQ D;  2EY5 A;  2DN8 A;  4RFB A;  1ZEQ X;  1OXX K;  1JOO A;  4HMI A;  4RH6 A;  4DR6 Q;  2UXB Q;  4DR2 Q;  1Z6H A;  2UUA L;  2GVB A;  5IGB A;  4OWT B;  4IFD J;  2RCF A;  2WAC A;  2ZJR A;  5BN5 A;  3PF4 A;  5E1F A;  5IOC A;  4GN3 B;  5LL6 X;  3NBH B;  2EJF C;  1DOK A;  2F0H A;  1MSG A;  1SE3 A;  3RLN A;  2CHB D;  2NBF A;  2VB3 X;  4L5Q A;  5DEH A;  1U9R A;  1B70 B;  2RBM A;  1Q90 A;  2B63 B;  5IGF A;  1G2S A;  3F8T A;  5GRO A;  3R2T A;  3E9I A;  4DK0 A;  3HOW B;  3C3L A;  3J7A F;  2CCZ A;  4C3I B;  2RDF A;  4PZ6 A;  2JA6 B;  1K83 B;  4YCU A;  4KN4 C;  2PW5 A;  4JBW A;  3MAQ A;  1B8A A;  2RSN A;  5M3M G;  1D5X C;  1RKN A;  2E2J B;  1GHJ A;  1CHP D;  4JI1 L;  3H91 A;  3NEN A;  4C3H B;  3NQT A;  1K28 A;  1X6O A;  5IP9 G;  2OCE A;  5CBE E;  3GTM B;  1EYD A;  1JE5 A;  5C3E G;  5C0X J;  4A3E B;  2UUB Q;  5FKA C;  1U4M A;  4RA8 A;  5IYD G;  1IBL L;  1VQ5 A;  1Q7Y C;  3UI2 A;  1LTR D;  2JXM B;  3HOX H;  4RKB A;  1HFN A;  1V1P B;  3EA6 A;  3HOW H;  4GNX B;  4Y52 H;  1DYQ A;  3KBG A;  3N52 A;  3R8B A;  3CAM A;  5CC4 A;  4RWS C;  1Q81 C;  5LHY 1;  4JI2 Q;  5IGE A;  2ZT9 C;  1PH1 A;  3NQI A;  5M5W H;  1BUV T;  1TWH H;  2O2L D;  3A5U A;  1KQS A;  3OW7 A;  2QEJ C;  1Y14 B;  1GUG A;  1NBW A;  1EIF A;  1LM0 A;  5IOD A;  1TU2 B;  2M9V A;  2YU9 B;  4C56 C;  5COY A;  3A7A B;  1E1T A;  2PZU A;  4JI3 L;  1IYJ B;  2CW0 D;  2KCT A;  2E76 C;  5C0X G;  4EQP A;  4JI4 L;  4HED A;  4GN4 B;  4OXP A;  4XTC S;  1B53 A;  4JYA L;  4JCV E;  1ICW A;  2RHS B;  4YY3 L;  4LFC Q;  3T1Y L;  1IL2 A;  2A6E C;  1Q46 A;  2SEB D;  4A3M G;  1SSO A;  1OXS C;  1UEB A;  2VQE L;  5I6W A;  2OTJ A;  2NYZ D;  2GA4 B;  1T5X D;  5DAU A;  3MXN A;  1UE5 A;  2ALY B;  1KIX A;  1HQR D;  3C46 A;  1CUK A;  4NXN L;  3GV3 A;  2YYZ A;  1FJG L;  3PO3 B;  5I9O A;  2L1B A;  3HZX A;  3S17 B;  1LV9 A;  3K0Y A;  2L12 A;  4HIM A;  2MP1 A;  1VF5 C;  1WJJ A;  4B3S Q;  1WTR A;  1DOM A;  4A3F H;  1IXR A;  5CGK A;  1HUM A;  3I8Z A;  2EYM A;  2NUC A;  2N55 A;  3D4W A;  2F0M A;  3PIP 3;  1CI3 M;  4NP5 A;  3KF6 B;  3NEL A;  1O7Y A;  3J81 j;  4JI6 Q;  3STB D;  5DLQ E;  1PV4 A;  1RCV D;  4G7Z C;  4BY7 B;  3I91 A;  3K81 C;  3PIP A;  2F1M A;  1X65 A;  1TVX A;  1XPU A;  2WB1 E;  2E2H H;  2LFN A;  3CCJ A;  3RR5 A;  1DM0 B;  3K57 A;  1QNU A;  4KJN A;  4AQY L;  1EFI D;  1STN A;  1KTK A;  1O7Z A;  4DAP A;  1M8A A;  1OTC A;  1STG A;  1F9Q A;  3S2D H;  4B3M Q;  2UXD Q;  3CC7 A;  5C5M A;  2VUM H;  1NTG A;  1VMC A;  2KCN A;  4X6A H;  1C7Y A;  2WAQ B;  2F3W A;  4QUC A;  4LF8 Q;  1IYU A;  4PMB A;  4OIK A;  1G29 1;  1ONL A;  4KMU C;  2IPK D;  2E2H B;  4RCN A;  3L9A X;  2A69 D;  3S1R B;  3NTK A;  2JA5 B;  1UE6 A;  5C3E B;  4K5W A;  3CF5 A;  4A3E G;  3C1F A;  1KNA A;  3GQB A;  2Z0S A;  2Z1C A;  4K8I A;  1SFO H;  3BDC A;  1DZ1 A;  3GTK B;  3I4N G;  1M90 C;  4DAY A;  4H0L C;  3WOF A;  3TP5 A;  1D1I A;  4GOP B;  1F2L A;  4JI7 Q;  1QE6 A;  2WIN B;  1SNO A;  1EIG A;  4M1U B;  2C35 B;  4K0K L;  1E24 A;  1JWS D;  1ET9 A;  4BXX H;  4HJ7 A;  2NVQ B;  4KJO A;  1KXL A;  1SJE D;  1HPC A;  2F0N A;  4HSP A;  4MN3 A;  3I4M B;  2D5D A;  3QB3 A;  4NPS A;  1HZC A;  3GTQ B;  2A69 C;  1EY9 A;  4LW1 A;  1WTV A;  3NXW A;  2VQF L;  4IUR A;  1GUW A;  2WAQ E;  4CKB A;  4C1N I;  3KUP A;  1PRT B;  5E4W C;  2BCO A;  4QL5 A;  3RZD H;  1I94 L;  4FXK C;  3CU7 A;  2BDO A;  4DN4 M;  4ABN A;  4BY1 H;  1Y1V B;  4C3J B;  3M7N A;  3R93 A;  3MFG A;  4LNQ A;  3BYY B;  4OIJ A;  2GVA A;  2XWB B;  2R93 G;  4XQN A;  3K5N A;  2Z6K A;  1SNP A;  1HZB A;  4QUF A;  4BXX G;  5CV9 A;  3SVM A;  5C4J B;  1RTN A;  1VQD A;  3QR8 A;  4S3S A;  2CWP A;  2AHO B;  4K2L A;  2PQE A;  2R7Z B;  1LLR D;  3K5O A;  3QG1 A;  2E2J H;  2PQA A;  3GTK H;  5K36 H;  3U50 C;  1QUQ A;  1K9M C;  4KI0 A;  1KC8 C;  1HFG A;  3H3V I;  5JEA G;  2VQE Q;  1VCI A;  2IHF A;  4R1J A;  4IQZ A;  1PFS A;  5IYD H;  1G2T A;  1OXU A;  2KVM A;  5JVG 3;  4YHH Q;  4LF7 L;  4QJF A;  3TRE A;  3HOY G;  1IBK Q;  3MA2 B;  4HID A;  1PFB A;  3S1N H;  4A93 B;  2R93 H;  1TWG B;  1NSN S;  5D14 A;  1S5F D;  3URY A;  4OON A;  3DM1 A;  3PO2 B;  1J5E Q;  4C3H H;  3CC4 A;  1AP0 A;  4UP8 A;  2JA9 A;  2YTX A;  1SNQ A;  4ILW A;  2BDN A;  2F0L A;  4H02 A;  2QEX A;  1SDF A;  2B2W A;  2HCI A;  4DK3 C;  5KND A;  1VQP A;  1PH4 A;  1NCV A;  2NWG A;  1I4G A;  1MIU A;  1BCP D;  1A0I A;  2WAQ G;  2YTV A;  3HRZ C;  2AUK A;  1CA6 A;  1X32 A;  1SMY C;  4P75 A;  1AN8 A;  1VQH A;  1BNZ A;  1NR2 A;  1KAW A;  2BOS A;  4X3K A;  4AQY Q;  1HNX Q;  4IFD H;  1N32 L;  5JJI A;  1N33 Q;  4GZY C;  2BE5 D;  1XJV A;  4A3D B;  1GKH A;  2QCP X;  4RHR A;  3W1G A;  5C5L A;  2JA5 G;  5AJ3 Q;  3EQL C;  2C9O A;  3OPO A;  1F77 A;  3UE0 A;  3TME A;  2ZM6 Q;  2VNU D;  2PNH A;  4OL7 A;  2RSO A;  2K75 A;  2RVL A;  2RA4 A;  1SEB D;  4CKE A;  3DMU A;  2K5H A;  3NBH A;  1QCB D;  4DV2 Q;  2Q2U A;  1AZP A;  1SAP A;  2R7F A;  1V8Q A;  1YNX A;  5IT9 L;  5IYC H;  1UWV A;  3H15 A;  1PYW D;  1BOS A;  4A3I H;  1NMF A;  4GLA C;  1DCZ A;  1L1O A;  2X6G A;  1VQ7 A;  2HDL A;  2R6G A;  4JVZ A;  1YJ9 A;  1UEA B;  1X3E A;  2FXQ A;  3G6J B;  3BZD B;  1LTI D;  3CQZ H;  3I4O A;  1YHQ A;  2R61 A;  3K0X A;  2ENB A;  2UXB L;  1RIP A;  4K6L A;  2K4K A;  3CCE A;  1H9M A;  1ZYR C;  5FO7 B;  1FNW A;  2QA4 A;  1U4P A;  1SRU A;  4CDF C;  3I7F A;  5C4H A;  1RJT A;  3RZO H;  1HRJ A;  4DKA C;  5CV6 A;  1AE3 A;  3FMC A;  4KKU A;  4DNR B;  4LUZ A;  4AYB B;  1PVO A;  2PI2 A;  4C3I H;  1I6V C;  2XVS A;  4DNT B;  5IT9 c;  3OTO L;  1EY0 A;  3N6R A;  5E3F A;  4BA2 I;  1B3Q A;  2F0D A;  2MQH A;  4CJ2 C;  4MZ9 A;  1IW7 D;  4LK1 C;  4DV0 Q;  3VR3 A;  3S1M H;  3DXJ C;  4DR7 L;  2QIL A;  4TRD A;  3G7L A;  1ILP A;  2MO0 A;  4U68 A;  3LWE A;  3J81 L;  3GTL H;  2EE1 A;  1F9R A;  4IFD I;  4A3E H;  1CT1 D;  3H09 A;  4YWL A;  2UXC Q;  1EZ8 A;  4L5T A;  1K8A C;  1JCK B;  3D4D A;  3S1Q H;  3ERQ A;  4OEL B;  2EIF A;  2XSC A;  2EZV A;  2F0J A;  5E7N A;  1BBX C;  1KLG D;  4F7X A;  4POG A;  2XN9 C;  1WCM G;  1JB7 A;  1E3P A;  1EYG A;  1GUT A;  1I5F A;  1LT3 D;  2NVT H;  1X55 A;  4EQO A;  2F4I A;  3A5Z B;  3L3O C;  1EU4 A;  1E2Z A;  4XDX A;  1BR9 A;  3TDQ A;  1N8R C;  4EGV A;  1LTG D;  1IBK L;  1VQK A;  5KIX A;  4JI5 Q;  4EVO A;  2VXW A;  4PMC A;  1J5E L;  4A3K H;  3J80 c;  3CMA A; 
#chains in the Genus database with same CATH homology
 3VR2 A;  1GUS A;  2IT1 A;  2I46 A;  3K5M A;  2IWH A;  5DM7 3;  1FNV A;  4G7O C;  1D5M C;  5C4X B;  1S5B D;  5EPK A;  5CV4 A;  4K8J A;  4Q5V A;  1PTO H;  1V1O A;  3PV0 A;  2L11 A;  1TWH B;  2KJX A;  5EKI A;  1CK1 A;  3A7L A;  4V0B A;  3I3C A;  1F2Z A;  2IX3 A;  4KKS A;  3M3Y B;  5EPJ A;  4G7H C;  4U67 3;  4FP5 D;  1I4Q A;  1VMP A;  2QKI C;  2F0F A;  3TN2 A;  2NVX B;  1PTO D;  2F0G A;  4ZRZ A;  2B2T C;  5IGD A;  3X3M A;  3PUX A;  1ILQ A;  3OHX C;  3V96 A;  3EVQ A;  1B3A A;  3GV6 A;  3HS0 C;  2PNR C;  4C3J G;  2Z8L A;  4O42 A;  3S1Q B;  1LO5 D;  4R9W A;  3ND8 A;  2K7V A;  2AQ1 B;  3NPP A;  2TMP A;  2EY1 A;  5M5X B;  4KTA A;  2EJM A;  1GOZ A;  2A74 C;  1EL0 A;  1SYB A;  1D5Z C;  2PMZ B;  3AU7 A;  2A68 D;  3FDT A;  1CTM A;  2AWO A;  3OWF A;  1WCM B;  5A2Q L;  2EYJ A;  3D8G A;  4OO1 H;  2EYF A;  1CZG A;  5NUC A;  2JEA I;  1FNU A;  1EU3 A;  4ULL A;  4HCS A;  3O13 A;  1OXT A;  3HKZ B;  4JK1 C;  1KDB A;  4DXF A;  2KOL A;  3E6Z X;  2BA0 A;  4IUV A;  5LL6 S;  3AMU A;  3T4A C;  3J7Y W;  1RF2 D;  3QO2 A;  1TWF B;  4Z9C B;  2L5T A;  1ENA A;  4H44 C;  2CW0 C;  3HOV B;  3M7G A;  3H0G B;  1OXV A;  3K6O A;  4A3F B;  2SDF A;  1QG7 A;  5EKK A;  4TQU S;  1W6J A;  3D31 A;  2LY7 A;  3FRP B;  1TS3 A;  3VYR A;  1TS2 A;  2IX1 A;  5FLX E;  3W3A A;  5JAV A;  3SR1 A;  5C3W A;  5ELD A;  3M85 A;  3BDO A;  4FF1 A;  3J81 E;  3GTP B;  3FEW X;  1JR0 D;  4J6H A;  2A5H A;  5IGG A;  1IW7 C;  3SE0 A;  4RAU C;  1D1K A;  2L4N A;  2JA8 B;  3GD7 A;  3MWY W;  5HGT A;  4FYD A;  1PFN A;  3FKI B;  3IFT A;  4B9X A;  4RCO A;  3J7A V;  5EGT A;  1SYF A;  4A3B B;  1PMR A;  3U9O A;  4KY6 A;  3Q23 A;  3KLR A;  5FLX L;  4ZQ3 A;  1HQM C;  4J8Q A;  5J1Z A;  3ERO A;  1TY2 A;  1TWA B;  2DNE A;  1PZI D;  4KD3 A;  2EPB A;  1E0B A;  1IYV A;  1TY0 A;  2QF7 A;  2F0W A;  4ZYS A;  2E2D C;  4FF3 A;  1Y8N B;  3VR5 A;  3T16 A;  4KK7 A;  4X3U A;  1GXD C;  3GO5 A;  1RD9 D;  3I4L A;  5C44 B;  1STB A;  1J9O A;  1R4Q B;  1AW7 A;  1ZXT A;  2G9H D;  3A55 A;  1ENF A;  2FMC A;  4HSV A;  4MHE A;  1EQV A;  5I9P A;  4DXG A;  1LTB D;  1SND A;  1R4P B;  3QJY A;  4DK1 A;  4FF2 A;  3QOL A;  1XXG A;  2B2W C;  3HG9 A;  3HP3 A;  1MD2 D;  3EFX D;  1EYA A;  5EKL A;  3P1H A;  1JQY D;  3A8I E;  3IKJ A;  3CKI B;  3HOU B;  4FF4 A;  2B2U A;  4Q0F A;  5A35 A;  1TWC B;  1SNC A;  5J39 A;  3PMF A;  2Q8T A;  2B2T A;  2LS0 1;  2O5J C;  2ZXO A;  5CV7 A;  4LJZ C;  3KBX A;  2K1B A;  5C6A A;  2NB0 A;  3MZ5 A;  3QWN A;  2F0Q A;  3M4O B;  2RQX A;  1HA5 A;  1GUO A;  5COR A;  3U9S A;  2K03 A;  5ELB A;  2VB2 X;  2HCC A;  3NTH A;  3SK8 A;  1TS4 A;  4HR7 B;  2H4O A;  1R9T B;  1HXY D;  1C4Q A;  2JEB I;  5ELE A;  3NBI A;  1H9S B;  1AEX A;  5F2D A;  2NN6 G;  4XQJ A;  3FPP A;  1Z47 A;  5CR3 A;  3I90 A;  1TR5 A;  5G3L D;  3SK6 A;  1TT2 A;  2R3Z A;  1AZQ A;  5E4X A;  3I4N B;  1UAP A;  3BG3 A;  5M5W B;  1S5D D;  1SMY D;  5C0X I;  4XXE A;  5M5Y B;  4M8A A;  3QOJ A;  1HTL D;  3VA7 A;  1KLU D;  1NR4 A;  3DWA A;  5D3I B;  1G6Z A;  1KAB A;  1SJH D;  2B2V C;  2K32 A;  3ZYY X;  3C2P A;  1BCP F;  1VDZ A;  2ID0 A;  4G4K A;  5EPL A;  4E6I A;  1PZK D;  1WTQ A;  3DEP A;  1GJX A;  4HMJ A;  4KV6 A;  3IFD A;  1KNE A;  1LT6 D;  1ZYR D;  1A2U A;  5D3D A;  1ESR A;  4DF7 A;  4V19 0;  3KF8 A;  5I6Y A;  2A6E D;  3JAM L;  3NK9 A;  4NDX A;  2D62 A;  4PMW A;  1Y8P B;  1RDP D;  1SE4 A;  2E74 C;  4P2C B;  4ZKB B;  1YNJ D;  3DUZ A;  1Q1E A;  3MXU A;  5IT9 E;  1CZW A;  1JWM D;  1PLF A;  2KEC A;  3VA5 A;  1EZ6 A;  2IL8 A;  4BBR B;  1XTC D;  3Q24 A;  2F0S A;  2NN6 I;  3SHL A;  2K01 A;  4CBV A;  4LAA A;  4IUT A;  1O80 A;  2SNS A;  2R92 B;  1ENC A;  1KDC A;  1EEF D;  4J1M A;  1H9J A;  4ODG A;  2EVB A;  4R8I A;  4A3K B;  2AWN A;  3MC0 B;  1JWU D;  3I73 A;  4RGO S;  5M9O A;  2KHS A;  2L0C A;  1L0Y B;  5D65 A;  2AUJ D;  1SE2 A;  1V43 A;  1QB5 D;  1C48 A;  2ICI A;  2IJ0 A;  3CRL C;  3MHB A;  2B2Y C;  4IAL A;  1T5E A;  4F87 A;  2Z4H A;  3K59 A;  4N9P A;  3P20 A;  4WFN 3;  1U4L A;  2H1E A;  1ZKO A;  1ML0 D;  2MHV A;  2LMC B;  1A2T A;  4FO2 A;  2PW7 A;  1S5E D;  1O78 A;  1E2W A;  1OO9 B;  4Y7N B;  4BBS B;  2R93 B;  3BYT B;  2EJG C;  4KD4 A;  1IKL A;  3GTG B;  3GTO B;  1QWY A;  1WD0 A;  1A3U A;  1V1P A;  1XX8 A;  3D6W A;  2NN6 H;  1I6H B;  3DEO A;  3OMG A;  1B44 D;  3NE5 B;  2FHT A;  4CJ0 B;  3D3R A;  3TSS A;  3OMC A;  4O1N A;  4BY1 B;  5EQ0 A;  1GHK A;  1A3V A;  3LX0 A;  2OT2 A;  4KY5 A;  4RGN A;  4OO1 G;  5KNB A;  1Y8O B;  3CQZ B;  2K33 A;  1JIC A;  2NTS A;  2MUY A;  1PXU A;  2EYP A;  3TP6 A;  1FYC A;  4BA1 I;  3A8J E;  1SYE A;  1XWE A;  2K5Q A;  1FR3 A;  3CHB D;  5ISR A;  2IX0 A;  1JOR A;  5KNC A;  1SXT A;  3S1N B;  3NUC A;  1TII D;  4C3H G;  5I2Y A;  2X69 A;  1Y69 U;  2ZXP A;  2KQ3 A;  4MIU A;  1EY7 A;  1WD1 A;  1D6E C;  2C5C A;  1LT5 D;  1Q8I A;  3V2T A;  1TQO A;  5IIF A;  5G3L F;  2K28 A;  2Q8I B;  4A3I B;  1X3P A;  3BVM A;  3PUZ A;  2E2I B;  1I4P A;  3WOE A;  1I4H A;  2O4X A;  1Z7T A;  2G9D A;  2K5W A;  4UAI A;  1QOH A;  1CM9 A;  2QDB A;  2B2V A;  2B8F A;  3JAM E;  4K6D A;  1E2V A;  2XWJ B;  4PV1 C;  2IW3 A;  5KYL A;  4HTH A;  1JC7 A;  1H9S A;  2F0I A;  1NAP A;  1UNS A;  4A3M B;  4RGM A;  1U4R A;  1HTP A;  1WTX A;  3E5S A;  1DD2 A;  2J7Z A;  3FVQ A;  2KCC A;  2XRQ D;  2L9H A;  1B2T A;  4KHV A;  2B39 A;  1IHZ A;  2JE6 I;  4IUQ A;  4NMZ A;  3DWP A;  2PO4 A;  2AQ3 B;  1WTP A;  3RZO B;  4N9T A;  4KY7 A;  2B2U C;  4QB4 A;  3VYS A;  2DNC A;  3I72 A;  3V05 A;  1F2Y A;  3ITP A;  2WII B;  3A54 A;  3F2U A;  2A6H C;  2MPM A;  3PUW A;  4C3I G;  1PRT F;  2F0K A;  1W6K A;  3MXG A;  1NUC A;  1B1Z A;  1SYD A;  5FK9 C;  4FVM A;  2Z4I A;  4ME5 A;  2WB1 B;  2ICE C;  1K8O A;  2L55 A;  5K36 G;  2AQ2 B;  1TKW B;  2WV6 D;  4WRD A;  2B2Y A;  1XYI A;  1EQT A;  2CQA A;  4ZUI A;  2EDG A;  4L6T B;  1D2B A;  4B08 A;  1AFP A;  3C1E A;  5CV5 A;  3NTI A;  3K5L A;  4CKC A;  2JYO A;  3OWE B;  2ZXR A;  1ROD A;  2WP8 J;  1L0X B;  1LTS D;  5FO8 B;  3SK5 A;  2SNM A;  2F3V A;  4A3J B;  2EY6 A;  2K5D A;  5C0X H;  3MFY A;  5JJZ A;  2PCF B;  1ET6 A;  5EJW A;  2PZW A;  3GP7 A;  2FIN B;  5CBA E;  1CFM A;  3I70 A;  4FXD A;  2K6A A;  2NVY B;  3S2H B;  1LAB A;  1QNK A;  1F9P A;  2FJ2 A;  3Q6S A;  4L8J A;  3P7J A;  3X3N A;  1JOQ A;  3LNN A;  3Q22 A;  1WVL A;  4IN3 A;  4XQQ A;  1GUN A;  2LKV A;  4ZKC B;  4XYQ A;  3HOY B;  3A8K E;  4ID6 A;  2J4X A;  5EBC A;  3SDZ A;  3OIP A;  1STY A;  4IFD G;  1KAA A;  1FGB D;  2TSS A;  2PPB C;  4XT1 B;  4I7Z C;  1IKM A;  2BE5 C;  3HEJ A;  4ZUJ A;  1YNN C;  4OHJ A;  5K5P A;  2RKS A;  4ZLT F;  2XRS D;  4R8N A;  4PQX A;  1STE A;  1MBY A;  5DNF A;  3BS1 A;  3S16 B;  4RKL A;  4I65 A;  3T56 B;  1II3 A;  4XT3 B;  1F9S A;  1LTA D;  3PUY A;  4DFA A;  2KA7 A;  2OEO A;  3BVZ A;  1HHV A;  1CA5 A;  1DXM A;  1HCZ A;  4OO1 I;  3FPU B;  3VR4 A;  1K8M A;  4DGZ A;  3H6M A;  4QMG A;  2EY2 A;  1EY8 A;  3RLF A;  4RGT A;  3RUZ A;  2N88 A;  4HCE A;  3OSO A;  5I4D A;  4WOR A;  2J0T D;  4B9W A;  2FFK B;  3K7A B;  5JPM C;  3E0J A;  2A68 C;  3GTJ B;  1BO0 A;  5KYI A;  3PUV A;  2O5I C;  4PNY A;  5FO9 B;  3BDL A;  3BVG A;  2Y0S B;  5AFW A;  1RHP A;  3KLS A;  5EBD A;  2XIW A;  1EWC A;  2MGS A;  4C1N K;  1HA6 A;  4CGY B;  3P75 A;  2F0E A;  1YNJ C;  3NHH A;  2A6H D;  3KLS X;  4H13 C;  1BXT A;  4DA2 A;  1H9R A;  1LT4 D;  1PRT C;  5IGC A;  1LAC A;  4X3S A;  5C3X A;  2M2L A;  1B50 A;  5BN3 A;  5JEA H;  3EJI A;  1SBB B;  4KHZ A;  2X6L A;  5JEA J;  2A73 B;  1S5C D;  3KK7 A;  3OIQ A;  1JB3 A;  3CRK C;  2DY7 A;  3S1M B;  2F03 A;  2JA7 B;  5T1G A;  3AB9 A;  3HGB A;  2F0P A;  2NTT A;  1Q12 A;  2V4D A;  3MTS A;  3RZD B;  3K58 A;  5HUR A;  3S9W A;  1SFO B;  3H3V C;  2PYK A;  1MSH A;  1UUP A;  5ELC A;  1PTO C;  4YIJ A;  4QCL A;  5ELF A;  4BWG B;  3HOZ B;  3A56 A;  2OF1 A;  1I3Q B;  3TP7 A;  1G91 A;  1EY4 A;  2DY8 A;  3NSW A;  1PFM A;  2EYO A;  5T1I A;  4F8M A;  4BS9 A;  3S2D B;  4ZAI A;  1BCP C;  3J80 L;  1I50 B;  4C2M B;  1STA A;  2NVT B;  1I4X A;  3SXH A;  4OGQ C;  1IL8 A;  4IUP A;  1TS5 A;  4TKO B;  1WTW A;  2F0T A;  5KEE A;  2K04 A;  3VYT A;  1DON A;  1EIH A;  4LMQ D;  4IUN A;  1H9K A;  3ND9 A;  3RD4 A;  2EOT A;  4DAV A;  1CQF A;  3WDN A;  2D9U A;  1O7L A;  5CMD A;  5DM6 3;  3VR6 A;  1J8I A;  2VUM B;  3W2D A;  4L63 B;  1Q3L A;  1BF4 A;  4RHS A;  2NZ1 D;  3R3O A;  1EY6 A;  1PZJ D;  5JPN C;  5KGU A;  4IUU A;  2WKD A;  1SYG A;  3NP8 A;  4ZK9 B;  3NWS A;  4NKL A;  1A6X A;  3MVV A;  2EXZ A;  1B4O A;  2RDH A;  2MJ8 A;  3L7Z C;  2EYH A;  1VF7 A;  2KEE A;  4K2K A;  4X3T A;  2F0V A;  4FXG C;  4WJW A;  5CV8 A;  1MGS A;  4DU9 A;  3S14 B;  1KDA A;  4UDU C;  5M3F B;  1Y1W B;  2M00 A;  3HOX B;  1PRT D;  1X3Q A;  3D6C A;  4QF4 A;  3Q0A A;  4KN7 C;  1YNN D;  5JVH 3;  2WKC A;  1C8C A;  5I2X A;  3GTL B;  5JOB A;  1A3T A;  2XNA C;  4K5V A;  1BQQ T;  2F0U A;  1Q1B A;  3D4R A;  4A3G B;  2E75 C;  2I07 B;  3TZD A;  4CJ1 B;  1BCP B;  1BDO A;  2BA1 A;  3IL8 A;  3VYU A;  4NW2 A;  1S4Z A;  3LWU A;  2F0O A;  3OOC A;  1FD7 D;  2K05 A;  1QIL A;  1B9M A;  5C4Z A;  4EQN A;  1PDQ A;  3S15 B;  4HN7 A;  2RDG A;  5J22 A;  2D2C C;  5FOB B;  3M4Y A;  1F2M A;  2HDM A;  3RMH A;  1B9N A;  5M3M B;  1PTO B;  3SEB A;  4H7B A;  3TBI B;  1CQV A;  1I4R A;  5TSS A;  4IZ8 A;  1HUN A;  3DHQ A;  4CHT B;  3MXP A;  5CYU A;  1DOL A;  2JP1 A;  1ESF A;  1EWH A;  3TZU A;  1MI2 A;  1PTO F;  2FMM A;  1RTO A;  2Q8R E;  1JE4 A;  1EEI D;  1A15 A;  1SYC A;  4QIW B;  2HQE A;  3TP8 A;  2CVR A;  3NWT A;  4K5X A;  4XYO A;  2SOB A;  2B8G A;  2PZT A;  2HUG A;  1SNM A;  3IAY A;  1EOT A;  3DWQ A;  3J80 E;  1M4V A;  3T51 B;  2JSO A;  3QIA A;  3R2I A;  5BN4 A;  1DJR D;  4FNF A;  3H94 A;  2KUM A;  4HAE A;  4XIG S;  1STH A;  2OXP A;  1G8Z D;  1EY5 A;  2KED A;  4KKT A;  5KRU A;  4K14 A;  3ONA B;  3SK4 A;  2EYL A;  3MEH A;  1WTO A;  1JOK A;  5A2Q E;  3T13 A;  4G57 A;  1EYC A;  3T53 B;  4TSS A;  3PIO 3;  4F88 A;  1LTT D;  1QJO A;  1CHQ D;  2EY5 A;  2DN8 A;  4RFB A;  1ZEQ X;  1OXX K;  1JOO A;  4HMI A;  4RH6 A;  1Z6H A;  5IGB A;  4IFD J;  2WAC A;  5BN5 A;  5E1F A;  5IOC A;  5LL6 X;  2EJF C;  1DOK A;  2F0H A;  1MSG A;  1SE3 A;  2CHB D;  2NBF A;  2VB3 X;  5DEH A;  1U9R A;  2RBM A;  1Q90 A;  2B63 B;  5IGF A;  1G2S A;  3R2T A;  4DK0 A;  3HOW B;  3C3L A;  3J7A F;  4C3I B;  2RDF A;  2JA6 B;  1K83 B;  4KN4 C;  2PW5 A;  4JBW A;  3MAQ A;  2RSN A;  1RKN A;  1D5X C;  2E2J B;  1GHJ A;  1CHP D;  3H91 A;  4C3H B;  3NQT A;  5CBE E;  3GTM B;  1EYD A;  5C0X J;  4A3E B;  5FKA C;  1U4M A;  4RA8 A;  3UI2 A;  1LTR D;  2JXM B;  4RKB A;  1HFN A;  1V1P B;  3EA6 A;  1DYQ A;  3KBG A;  3N52 A;  3R8B A;  5CC4 A;  4RWS C;  5LHY 1;  5IGE A;  2ZT9 C;  3NQI A;  1BUV T;  2O2L D;  3OW7 A;  2QEJ C;  1GUG A;  5IOD A;  1TU2 B;  2M9V A;  2YU9 B;  4C56 C;  5COY A;  3A7A B;  2PZU A;  2CW0 D;  5C0X G;  2E76 C;  4EQP A;  4HED A;  4XTC S;  1B53 A;  1ICW A;  2A6E C;  2SEB D;  1SSO A;  1OXS C;  5I6W A;  2NYZ D;  2GA4 B;  1T5X D;  5DAU A;  3MXN A;  1HQR D;  3C46 A;  3GV3 A;  2YYZ A;  3PO3 B;  5I9O A;  2L1B A;  3HZX A;  3S17 B;  1LV9 A;  3K0Y A;  2L12 A;  2MP1 A;  1VF5 C;  1WTR A;  1DOM A;  5CGK A;  1HUM A;  3I8Z A;  2EYM A;  2NUC A;  2N55 A;  3D4W A;  3PIP 3;  2F0M A;  1CI3 M;  4NP5 A;  1O7Y A;  1RCV D;  4G7Z C;  4BY7 B;  3I91 A;  2F1M A;  1TVX A;  2LFN A;  1DM0 B;  3K57 A;  1QNU A;  4KJN A;  1EFI D;  1STN A;  1KTK A;  1O7Z A;  4DAP A;  1M8A A;  1STG A;  1F9Q A;  5C5M A;  1VMC A;  2KCN A;  2WAQ B;  2F3W A;  4QUC A;  1IYU A;  4PMB A;  4OIK A;  1G29 1;  1ONL A;  4KMU C;  2IPK D;  2E2H B;  4RCN A;  3L9A X;  2A69 D;  3S1R B;  3NTK A;  2JA5 B;  5C3E B;  4K5W A;  3C1F A;  1KNA A;  3GQB A;  2Z1C A;  4K8I A;  3BDC A;  1DZ1 A;  3GTK B;  4DAY A;  4H0L C;  3WOF A;  3TP5 A;  1D1I A;  1F2L A;  1QE6 A;  2WIN B;  1SNO A;  1EIG A;  4M1U B;  1JWS D;  1ET9 A;  2NVQ B;  4KJO A;  1SJE D;  1HPC A;  2F0N A;  4HSP A;  4MN3 A;  3I4M B;  2D5D A;  3GTQ B;  3QB3 A;  2A69 C;  1EY9 A;  1WTV A;  3NXW A;  4IUR A;  1GUW A;  4CKB A;  4C1N I;  3KUP A;  1PRT B;  5E4W C;  2BCO A;  4FXK C;  3CU7 A;  2BDO A;  4DN4 M;  4ABN A;  1Y1V B;  4C3J B;  3M7N A;  3R93 A;  3MFG A;  3BYY B;  4OIJ A;  2XWB B;  4XQN A;  3K5N A;  1SNP A;  4QUF A;  5CV9 A;  3SVM A;  5C4J B;  1RTN A;  4S3S A;  4K2L A;  2PQE A;  2R7Z B;  1LLR D;  3K5O A;  3QG1 A;  5K36 H;  4KI0 A;  1HFG A;  5JEA G;  1VCI A;  4IQZ A;  1G2T A;  1OXU A;  2KVM A;  5JVG 3;  4A93 B;  3MA2 B;  1PFB A;  1TWG B;  1NSN S;  5D14 A;  1S5F D;  3URY A;  3PO2 B;  3DM1 A;  1AP0 A;  1SNQ A;  4ILW A;  2BDN A;  2F0L A;  1SDF A;  2B2W A;  2HCI A;  5KND A;  1NCV A;  2NWG A;  1I4G A;  1BCP D;  1CA6 A;  3HRZ C;  2AUK A;  1X32 A;  1SMY C;  1AN8 A;  1BNZ A;  1NR2 A;  4X3K A;  2BOS A;  4IFD H;  4GZY C;  2BE5 D;  4A3D B;  2QCP X;  4RHR A;  5C5L A;  3EQL C;  2C9O A;  3OPO A;  1F77 A;  3TME A;  2VNU D;  4OL7 A;  2RSO A;  2RVL A;  2RA4 A;  1SEB D;  4CKE A;  3DMU A;  3NBH A;  1QCB D;  1AZP A;  1SAP A;  1V8Q A;  5IT9 L;  1PYW D;  1BOS A;  1DCZ A;  2X6G A;  2HDL A;  2R6G A;  1UEA B;  3G6J B;  3BZD B;  1LTI D;  2R61 A;  2ENB A;  4K6L A;  1H9M A;  1ZYR C;  5FO7 B;  1FNW A;  1U4P A;  5C4H A;  1RJT A;  1HRJ A;  5CV6 A;  3FMC A;  4KKU A;  4DNR B;  4AYB B;  1I6V C;  2XVS A;  4DNT B;  1EY0 A;  3N6R A;  5E3F A;  4BA2 I;  2F0D A;  4CJ2 C;  1IW7 D;  4LK1 C;  3VR3 A;  3DXJ C;  2QIL A;  4TRD A;  3G7L A;  1ILP A;  4U68 A;  3LWE A;  3J81 L;  2EE1 A;  1F9R A;  4IFD I;  1CT1 D;  3H09 A;  1EZ8 A;  1JCK B;  3D4D A;  3ERQ A;  2XSC A;  2EZV A;  2F0J A;  1BBX C;  1KLG D;  4F7X A;  2XN9 C;  1GUT A;  1LT3 D;  4EQO A;  2F4I A;  3L3O C;  1EU4 A;  1E2Z A;  4XDX A;  1BR9 A;  3TDQ A;  4EGV A;  1LTG D;  5KIX A;  4EVO A;  2VXW A;  4PMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...