5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
4KY5A 2F0QA 5CV6A 1KABA 1SNDA 1EY7A 3LX0A 1STAA 3QOLA 3TP8A 5E1FA 2LKVA 4DFAA 3RUZA 5I6YA 4N9TA 5CC4A 2EY5A 5C6AA 4DF7A 2F0HA 1STHA 2SNSA 4I65A 5CGKA 1II3A 4WORA 1A3UA 4K8IA 1SNPA 2F0GA 2EYLA 5C5LA 1EYCA 5NUCA 3V2TA 2EYPA 2KHSA 5E3FA 4K5WA 4KTAA 2RBMA 4G57A 5KIXA 1STYA 4PMBA 3HZXA 1KDBA 5KRUA 5IGFA 2EYOA 2F3VA 2F0VA 4LAAA 4OL7A 4EQNA 1STBA 3MHBA 5F2DA 3EVQA 4QMGA 1F2YA 3U9OA 2EY6A 4HMJA 5C5MA 3H6MA 5IGCA 3SXHA 2WACA 2F3WA 4QB4A 5JAVA 3BDLA 1TT2A 2F0JA 2RKSA 4B9XA 2RDFA 4TRDA 5CV5A 5KYIA 4RKBA 3D4DA 4KV6A 5KEEA 5KYLA 4NMZA 2QDBA 1EY0A 4KD3A 5EKKA 3MVVA 3MZ5A 1A2TA 2F0OA 4F8MA 3C1EA 1STNA 3PMFA 3SK6A 4DU9A 4EQOA 4ZUIA 4B9WA 4F7XA 1SNOA 4J6HA 4WRDA 2F0FA 1KDAA 5CV4A 3SHLA 1STGA 3P75A 3QB3A 5IGGA 5KGUA 4E6IA 4DGZA 3QOJA 2F0NA 1JOQA 2PZTA 3D6CA 3S9WA 3TP6A 4EQPA 2OEOA 4EVOA 5JOBA 1AEXA 3EJIA 1SNQA 4K2KA 3NHHA 5I6WA 4ME5A 2F0MA 2PZUA 1IHZA 4HTHA 3TP7A 2NUCA 2F0UA 1EZ6A 4KJNA 5CV7A 5IOCA 2OF1A 5HURA 2F0EA 1RKNA 1SYDA 4ID6A 4KY6A 4ODGA 3DHQA 3P1HA 3D8GA 3MXPA 2PQEA 3R3OA 4K8JA 1JORA 4K2LA 1EYAA 1EQVA 3NQTA 3D4WA 3SR1A 1EY8A 3MEHA 1EY9A 1KAAA 2KQ3A 5CV8A 4ZQ3A 4IZ8A 4K6DA 5EKLA 5CR3A 4HMIA 1EYDA 1JOKA 3DMUA 1NSNS 4KHVA 4J1MA 4NP5A 5IODA 3SK8A 1EY4A 2PZWA 5I9OA 5CV9A 2EY2A 2EYHA 2PW5A 4NKLA 4KD4A 2F0WA 5C4ZA 2F0KA 4K14A 4N9PA 3OSOA 1SYEA 5HGTA 2O4XA 2F0SA 5IGBA 3NP8A 5EGTA 2F0TA 5J39A 1A3VA 1SNCA 4YIJA 5DAUA 2ENBA 3TP5A 2HQEA 1F2ZA 1KDCA 4IUNA 4ZUJA 5K5PA 3SK4A 1SYGA 3ITPA 5C4HA 4RKLA 2PYKA 1SYCA 3E5SA 4PNYA 3T13A 2EYJA 2F0IA 3OWFA 3HEJA 2EY1A 3BDCA 3OMCA 3NK9A 2OXPA 4NDXA 4QF4A 2EYFA 3VA5A 2PW7A 1SYBA 5IIFA 5M9OA 4S3SA 1ENAA 4IALA 5J1ZA 5C3XA 2M00A 4K5VA 2SNMA 1JOOA 1A2UA 4K5XA 4KJOA 2EXZA 3ERQA 3OMGA 5IGEA 2EYMA 1TQOA 5DEHA 1EY6A 2SOBA 4MIUA 1TR5A 1F2MA 5J22A 5I9PA 4R8NA 1U9RA 2F0DA 5C3WA 3NXWA 3SK5A 3T16A 3EROA 5IGDA 1SNMA 2F0PA 3C1FA 2F0LA 1ENCA 1EZ8A 1SYFA 3NUCA 4H7BA 1A3TA 4PMCA 1EY5A 3TMEA 1NUCA 4KY7A 5ISRA
chains in the Genus database with same CATH superfamily
2R61A 4LW1A 1EY7A 3QOLA 1TWHB 2AUJD 4ZAIA 4DKAC 1Y1WB 2HDMA 1Z47A 5AJ3L 1LT4D 1TWFB 5H1SE 2A6HD 1SNPA 2UU9L 1ET9A 1STYA 3OOCA 1QJOA 5IYDH 1XMOL 3H0GB 2NVXB 5IGCA 3OWEB 2RKSA 2XVSA 4B9XA 2VUMB 1F9PA 3LWEA 3J80c 2BDOA 5KEEA 4GN5A 1VQ7A 1XPUA 1ZKOA 4F8MA 1GKHA 2E8GA 3C1EA 4X3KA 3K0YA 1S3OA 4ZUIA 2IJ0A 4A93H 4DV3L 4DAPA 1AE2A 4A3GG 1L0YB 2BA1A 2DJFC 3I8ZA 3S9WA 3S17H 1KNAA 4LF4L 5I6WA 5G3LD 1HTPA 5LMNL 3GTPH 1UE5A 2K01A 3MA2B 1TVXA 3M3YB 1SYDA 3CPWA 1T9HA 2PQEA 1BCPF 2MO0A 3I91A 1EYAA 2GVBA 1PYBA 3S1QB 1R4QB 3VA7A 4QCLA 4Z9CB 4R4CA 4P73A 3NSWA 3PF5A 4DXFA 4FNFA 3GTLB 2KCTA 1HH2P 1PZJD 5EGTA 4DV5L 4DR5L 2E2IB 4RWSC 4FF1A 3H15A 2VY3A 4RGNA 2R93G 2ZTDA 1DM0B 1PTOB 4MZ9A 3DM3A 3OIQA 3PQIA 3EBEA 3M7GA 3J80i 3I4NB 5GQOA 4XDXA 1VF5C 2VQEL 1SRUA 3H09A 3CRKC 3K7AH 4POGA 1WTOA 4XXEA 1VDZA 1ONLA 1KRTA 3J81i 1D1IA 1TY2A 2F0LA 4LF8Q 5D14A 1MD2D 1NUCA 2KECA 3CCQA 4R4IA 1RHPA 1JQYD 4C2MB 1WTVA 1K8AC 2UUCL 2Q2UA 3I4NG 1E0BA 4YHHL 5T1GA 2EY5A 2FFKB 1I50H 1PRTD 4DNIA 5M3MB 3STBD 2Q2IA 3CHBD 4DV4L 5IGFA 2NZHA 4IPHA 4EQNA 3Q6SA 4IPDA 3CCUA 4GKJL 4HJ8A 3OTOL 1K9MC 5CV5A 1H9JA 3FVQA 4JI4Q 1SLJA 4FO2A 2UUAL 4WFN3 4DV1L 4KD3A 2VUMH 5EKKA 4IQZA 1DJRD 2RDGA 1BBWA 3PMFA 1X3GA 1QCBD 1FNWA 1B50A 3L2PA 4LFCL 2N55A 3S1MH 1JOQA 3VDYA 5JOBA 4GLAC 4JYAL 1OXUA 1I4QA 5CV7A 2ZJRA 2K03A 5GAGC 4OGQC 3BVGA 2RSNA 5BN4A 4RH6A 2QA4A 2PI2E 4YWLA 2XN9C 5ELDA 5IWAL 1I4XA 1A15A 1DZ1A 3BS1A 3D4WA 1EY9A 5EKLA 2ES2A 4K6DA 1GM5A 1Q3LA 3CCEA 3HKZB 2JK8A 1V1OA 2LY7A 3H0GH 4UP7A 1E1TA 1RJTA 1UWVA 1L1OB 1TWHH 5COYA 2EY2A 3NWTA 3PUZA 2FHTA 3U4VA 4R1JA 2VB2X 5FLMG 3QG1A 1A0IA 2F0TA 3C3LA 3W1GA 2WFWA 4OO1G 5M3FH 3BZDB 4X3TA 1N32L 2F0IA 4NB3A 4IUUA 3OMCA 2NVXH 4DPGA 3SVMA 5C0XI 3J81L 1VQ9A 1BO0A 2OT2A 2R93H 2EJFC 2N78A 3F1ZA 2Q2TA 1L0XB 3L9AX 2V4DA 3K81C 3UDFA 3AB9A 5J22A 5I9PA 4DV5Q 3HOZG 1YI2A 5GROA 1C7YA 2K7VA 3S17B 3F2UA 1AFPA 1K0RA 2IHFA 4TKOB 4IN3A 3SDZA 2EIFA 2QKIC 5E4WC 3FDTA 2KHJA 4BWGB 2K33A 4BBSB 4CDCC 4Y7NH 4I7AA 2XWBB 1BVSA 3VYRA 2DY7A 1EYCA 1TWCH 1TWGH 2PI2A 4KTAA 1EQRA 4KHZA 3KF8A 1XJVA 3A8KE 1Y1WG 3EVQA 3DLLA 1O7IA 3D0FA 1Z6HA 4JI1L 5IE8A 2JA8H 3PUVA 2MNAA 3GTLH 2DNCA 2IX3A 3K7AB 4YHHQ 1EY0A 1LTRD 3GTGB 3M4QA 2Z6KA 3T51B 2JJQA 1SNOA 2BH8A 1FVIA 5CV4A 1HJPA 4G7OC 3K80C 2HHHL 2YTYA 4DGZA 3QOJA 4C3IH 1PVOA 2KENA 4JI0L 2R7ZG 3EJIA 4PZ8A 2N8NA 2MO1A 4J8QA 1PA6A 4A3EB 3KDFB 5M5YB 1WTQA 2AMCB 3T1YL 3VR2A 2D0PA 4A3FG 4N8FA 4YWKA 2RHQB 4RAUC 4K2LA 4R8IA 1DGSA 3V96A 5CR3A 1E2VA 1PRTF 3J7A5 3CRLC 3TBIB 3G6JB 3VYTA 1VQBA 2C9OA 3GTMB 2PW5A 4L5TA 2F0KA 4N9PA 3HOWB 3OSOA 1SYEA 1GUNA 4OXPA 4IOAA 5K36G 1JE5A 4U673 2L55A 1A3VA 4YIJA 5M3MH 4DUZQ 3WOEA 4PZ7A 4B3RQ 1WCMB 1QNUA 1LABA 1LUZA 1RIPA 4FP5D 5M3FG 3NBHB 4L63B 3NTHA 4IALA 3SGIA 1B2TA 2TMPA 3JAME 2B8GA 5C44G 3HOYG 2ATWA 2UUBL 3G7LA 1G6PA 3TREA 1PYSB 5C3WA 1W6KA 3UDIA 4JI3L 5JJKA 1MSHA 3FRPB 4L5RC 3O13A 2VNUD 4X64L 3NUCA 3HS0C 4HJ5A 2G5DA 4KHPL 2X69A 5EBCA 1HNZL 2N3SA 1PV4A 2A74C 2HT1A 1LT5D 1EQTA 4GLXA 3Q24A 1II3A 4B3TL 1D2BA 2RQXA 2EYLA 3BYTB 3MC0B 1L0WA 1N8RC 1KXLA 1XPRA 4BXXG 1PTOD 2B3GA 1R9TB 4C3JG 2JSOA 1PDQA 2Z0SA 1TWGB 2B2UA 4OL7A 2NVQH 3OTOQ 2L9HA 1P16A 3JAMi 3CCJA 4HAEA 4QGUA 3J7AF 4TRDA 3H3VH 3G71A 1X55A 1I6HH 4DV7L 1C8CA 4LFAL 3H3VC 4L6TB 1CSQA 1BOSA 3IFDA 1XTDA 2RHSB 4HJ7A 2F0FA 1SSOA 1XX8A 2F0NA 2NVYH 3D6CA 1WD0A 2JA9A 2OEOA 4DV6Q 1AEXA 4JYAQ 2WB1G 4AH6A 3R2IA 4HTHA 4LFBL 2K5QA 5E7NA 3I56A 1FR3A 3EFXD 2PQAB 1I3QB 2J0TD 1LTLA 1WTWA 5FLXL 3RLFA 1EL0A 5FJ8G 1EY8A 5CV8A 1JT8A 3J80E 3S1NH 5JEAH 4A3IG 4GN4B 3S2DB 5D3DA 4JI0Q 1VQJA 2FJ2A 1ML0D 4L5QA 1VQKA 5FO7B 1HHVA 1K3RA 2O4XA 1BCPC 2LXJA 2Z8LA 1XNQQ 1O80A 1PFNA 3K59A 5LMNW 3A55A 2JA5B 1FD7D 1SYGA 4F88A 4DR5Q 1X6OA 4X66L 1DD2A 3PO3G 4HEDA 1HFGA 1VQHA 3MFGA 3UE1A 3HEJA 2WKDA 2K5WA 2ZXPA 2EZVA 3U9SA 4K5VA 2YTVA 3CCVA 3T4AC 1A2UA 1TS5A 1FL0A 4IUPA 1B9NA 3HKSA 1Y8PB 4XT3B 4V190 2Z4IA 1U9RA 3FHWA 2I0QA 1HQMC 3NXWA 5C3EB 4JI2Q 5C0XH 2KCCA 4C3HB 3TMEA 1CKNA 4CKEA 5IYDG 1PTOH 5ELOA 2XWJB 2F0QA 1LACA 3GV3A 3PO2G 4ULLA 2CKZB 4AIMA 1JE4A 3HOWG 1Y8OB 1JWSD 3KBXA 5TSSA 1QWYA 4FVMA 4K5WA 3Q22A 1KLUD 4GNXA 1QZHA 2WIIB 1U4MA 3C2PA 1PFSA 1WCMH 3U9OA 1QUQA 1YITA 2E76C 2UXDL 2A8VA 4RCNA 4C3JH 5JAVA 4DXGA 4NW2A 4LUOA 4C1NK 2N49A 1G8ZD 1Q1EA 3HKZG 4NMZA 1AE3A 5JVH3 2OWOA 2K5NA 1A2TA 1TY0A 3NWSA 3SE0A 4DU9A 2A6HC 3GTOH 2IL8A 1A62A 2LMCB 2MQHA 1PFMA 1QOHA 4LF7Q 4ALPA 1KD1C 4HCEA 3KK7A 4EVOA 1SFOB 1WD1A 3I70A 3RZOH 4ME5A 2B2VC 2F0MA 1SMXA 4AYBB 2NUCA 1I4RA 2B63H 1O7YA 2NB0A 5ELFA 4KMUC 4B3SQ 4A3DH 3NELA 3HOXH 3G4SA 3KOJA 1BBXC 2RCFA 1C9OA 1SJHD 4QUFA 3FPUB 4ZQ3A 4YY3Q 3A8IE 1YBYA 1HR0L 2I5MX 4XT1B 4A3IB 2NZOA 4APVA 1OXTA 2QDLA 1IL8A 1TS2A 1LT6D 3TZUA 3GTKB 5DM63 4LUZA 3JC66 1FJGL 1F9RA 1KDCA 5J3BA 2ZJQA 1UNSA 4C1NI 4DV0L 2AKWB 1C48A 1RD9D 3S1RB 4WJ3M 1AH9A 4DR3Q 5FJ8H 4CKCA 5FO9B 1XNRQ 4A3BH 4A3BG 1N34L 1EOTA 4K5XA 1VQ8A 4UP8A 5HY6A 4DK6C 4RHRA 1QVFA 2EVBA 1XNQL 4A3KH 2WP8J 1LTTD 4BY7G 2K4KA 4KHPQ 4QQBX 2I46A 1KABA 3Q8DA 1TIID 1STAA 3KF6A 2PNHA 5CC4A 3JAML 1STHA 1NTGA 1HNWL 1A3UA 2F0GA 2NTTA 3W1BA 1UUPA 4IO9A 3IFTA 1XMOQ 4LFCQ 3I7FA 1OXSC 2R3ZA 3W2DA 3HOZB 1F9QA 3BVZA 4FF2A 4JI7L 2IY5B 4JI6Q 1SE8A 5IYCG 1WI5A 2Q8RE 4G7HC 1X65A 4RKBA 4IFDH 5CORA 2PPBC 1YJWA 2ASBA 1YHBA 3DEPA 1ET6A 1EWHA 2F0OA 2B29A 2XTIA 3E0JA 4EQOA 2JA5H 3ERSX 1H95A 1E1OA 3WOFA 5EPKA 3J81j 1Q12A 1VQMA 1IBKQ 3RN2A 5I4DA 4LF6L 1SNQA 1N33Q 3NHHA 1WFQA 5ELBA 5EKIA 3CF5A 3CC2A 2MGSA 3HFZB 4XYOA 5IT9c 3T1YQ 4IJHA 5FLMH 3KF6B 4RCOA 2K50A 2VXWA 3KDFA 4M8AA 3CXCA 2F3IA 1EQQA 3QO2A 2JA6B 3SEBA 1UE6A 3K5OA 4A3CH 4C3IB 4P72A 4NP5A 4KHVA 4J1MA 2EDGA 3OW2A 1AZPA 4LJZC 1HCZA 1X9NA 3S2HB 4LF9Q 1XWEA 4KD4A 2F0WA 2B2YA 4PG3A 3I72A 1VCIA 3M4OB 2KHIA 4A3JG 2JQOA 1VQ6A 1XTCD 3S16B 2CHBD 4A3JH 2ENBA 4A3FB 1MJCA 4JBWA 4JC0A 1TWFH 1TS4A 1LTBD 2EYJA 3E9HA 1HUMA 2EYFA 3LGJA 2K14A 2PW7A 1HR0Q 4IPGA 2EE1A 2K6AA 4H0LC 1EY6A 1H9SB 2SOBA 4C3HG 5JJZA 2R92B 2N88A 5IGDA 1QB5D 1SYFA 1HA6A 1N36L 2B2WA 1D7QA 1N32Q 4DR2Q 1IYJB 2O2LD 4DV0Q 2XIWA 1VQ5A 1NY4A 5A35A 4KI0A 1F2LA 1PZKD 1TWAH 3TP8A 4LUVA 3H91A 1PH1A 4A3LH 5IT9L 5C6AA 1PTOC 2F0HA 4A3DB 4JOIA 1VQPA 4WORA 4K8IA 4GLVB 1ESFA 4Y7NB 2RBMA 2XGTA 5KIXA 1V1PB 2EYOA 4HSVA 1CKOA 5F2DA 2B2VA 3BYYB 4IUTA 4A3KG 3SXHA 4XQJA 2D0OA 5L37A 5KYIA 2KEDA 2R7ZH 4HJAA 4A3BB 2NVTB 3D4DA 2Z1CA 5BN3A 1HNWQ 4GN3B 2E2HB 3GTGH 3PIOA 1HA5A 1HNXL 4KK7A 3MFYA 3TP6A 2E2JB 3E9IA 3KLWA 4ZRZA 3CCLA 2FXQA 3ZJYC 3NEMA 2PCFB 2F0EA 1IYVA 4OWWB 3DHQA 3D8GA 3WDNA 3L0OA 3K7UC 4A3KB 1G91A 3AMUA 3E6ZX 4YY3L 3K5MA 3UDGA 3MAQA 4B3RL 3NTIA 2H4OA 4R9WA 4HMIA 3EN2A 4NXML 2K5VA 4ZKCB 2A5HA 3NE5B 1RODA 2MUYA 3S14H 4OO1H 5HGTA 3DUZA 2XRSD 4YWMA 5C44H 3A0JA 3HOYH 1V1QA 5J39A 4IUNA 3SK4A 3VR5A 4X64Q 5C4HA 1GJXA 1VS0A 1IKLA 1M8AA 4NDXA 1XNRL 2EXDA 2D9UA 1SJED 2A69D 3J80L 1JOOA 5FLXE 3TZDA 2UXCL 3K5LA 4Y52H 4QJFA 4AYBG 1L2FA 2A6ED 4DA2A 1HQRD 3EROA 1SNMA 5G3LF 4HJ9A 1ENCA 1EZ8A 3RD4A 5C4JB 3I2ZA 3PO2B 2K1BA 1Y69U 1J9OA 3ND9A 4KY5A 5CV6A 1KIXA 5ELEA 3I4NH 4K6LA 4A3EG 1PRTC 1SR3A 3MXNB 2UUCQ 3RR5A 2K28A 3ER0A 1DYQA 1JWMD 1LO5D 5GADC 2EPBA 2YTXA 2KA7A 4C3HH 4CDFC 4G7ZC 3K6OA 4JI6L 4LNQA 4JI1Q 3MHBA 2CH4A 4LF4Q 4BS9A 3GTJH 3BDLA 4TVAB 1P8LA 3U4ZA 3IAYA 4AQYQ 2XNAC 1EIGA 3BVMA 5JJIA 4HCSA 4GNXB 1JB3A 2JYOA 3KJPA 4XIGS 2WV6D 2O5JC 5IT9E 1EIHA 4RA8A 5D3IB 4BA2I 4DN4M 4J6HA 3HOVH 1E22A 4E6IA 2JEAI 4FDBA 5FOBB 1I4HA 1GOZA 3IKJA 4IURA 5M3FB 3I3CA 4HR7B 2CWAA 4CHTB 1TWAB 2HCIA 1IHZA 2F0UA 4DK0A 1PFBA 4K8JA 4B3SL 3KLSX 1G2SA 2L4NA 4HIOA 2WAQB 1KAAA 4NXNQ 2AQ3B 1MBYA 1R4PB 1S4ZA 2HIVA 3L7ZC 1GUTA 2ICEC 4IUVA 3J81c 4JPBW 2C5CA 2OTLA 1TKWB 5CV9A 2EJGC 4FXDA 3FPPA 3FKIG 4LFBQ 3CCMA 1HR0W 2K32A 3LNNA 3PF4A 4DUZL 5IGBA 3HOXB 1ICFB 4I7ZC 4OHJA 2AQ1B 2B2TA 5C44B 3HOYB 1FJGQ 2MHVA 2CWPA 3OWFA 3VR6A 1BF4A 2EY1A 1EFWA 3A7LA 2Q8IB 1VMPA 3AQQA 1SYBA 2AHOB 5M9OA 2R7ZB 4GKKL 2VL6A 2TSSA 3IRBA 3KYHC 1U0LA 4JK1C 2EYMA 1FGBD 4WJWA 4MIUA 4CKBA 3GTKH 1NE3A 2PMZE 2E5LL 1DCZA 2V1CC 3UI2A 4O1NA 1I94Q 3TS0A 1BCPD 1EEID 1S5DD 2R7FA 1Q82C 2DY8A 5E1FA 1K73C 2LFNA 4XQNA 1EEFD 2E2DC 5JPMC 3STBC 1FNUA 2CW0D 1T5XD 1CA6A 1Y14B 4A3EH 2EYPA 4R4TA 1GXDC 1IKMA 2ZTEA 4HIMA 5CMDA 2R6GA 2F3VA 3PIO3 4QMGA 5LHY1 2G9HD 3BU2A 4QB4A 4IJLA 3ONAB 1PH4A 2B39A 3GTJB 1QG7A 4H44C 1CTMA 1E3PA 1NMGA 1HZ9A 4XTCS 1GD7A 1L1OA 4B9WA 5BN5A 2R92G 1K0SA 1HNXQ 5IY0A 4C2MH 4RGMA 1KDAA 2DGYA 2E74C 3DWQA 5CBAE 1VF7A 4C3IG 3GTOB 5JJLA 3TEHB 2QEJC 2Q8TA 5IP7G 1I5FA 2MFIA 1N33L 3TP7A 3U50C 4DK1A 1PXUA 1QNKA 3RZOB 4DAYA 2VB3X 2O5IC 1RTOA 1PMRA 3R3OA 1BUVT 4UHVA 1K3BC 3I4OA 3L3OC 2NZ1D 2HDLA 5C4XG 4DR4Q 4KKSA 5C4JH 3RMHA 1SBBB 3J81E 1EYDA 1SMYC 1JOKA 4OONA 2OTJA 1WTPA 2EQSA 1EU4A 3HKZE 2ALYB 2ZXRA 4NKLA 4R4OA 4X62Q 1WTRA 1RCVD 2WAQE 4P74A 5BR8Q 1VQEA 3DEOA 3M4YA 4HIDA 5DAUA 1SNCA 2QEXA 3GD7A 1U4LA 1EFID 3CPFA 4LWCA 4ABNA 2H5XA 4PNYA 1G51A 2ID0A 1GHKA 4H13C 1CFMA 1VQGA 2Y0SG 4UDUC 3GDEA 2SNMA 2IT1A 3S1RH 5AFWA 3QIAA 5ELCA 2EXZA 5IGEA 4UAIA 4J15A 4TQUS 3F2CA 4G4KA 4DUYQ 1GUWA 2KVMA 2ZT9C 2L12A 1SDFA 5C0XJ 4DAVA 4A75A 5CBEE 1EUJA 5ISRA 1ILPA 1NJIC 1VQOA 2F4IA 1DOMA 2AQ2B 1BQQT 1Y8NB 2LKVA 4POFA 1LLRD 2F03A 2ZTCA 3K5NA 4GS3A 1PH9A 4DR1L 2FMCA 1TU2B 1T5EA 2KEEA 1S5BD 2BH2A 3V2TA 4A3MG 4G57A 1FGUA 1KDBA 1IBKL 2PMZB 1WJJA 4XQQA 2LSSA 2VS1A 3HOZH 1BXTA 2MPMA 3TQYA 1V1PA 3E0EA 4DR7Q 5IYBH 3PCOB 2HQLA 2NTSA 4PV1C 5KYLA 3T56B 2ZXOA 3X3NA 1AP0A 1G291 3D31A 3IL8A 1B8AA 3KUPA 1EIFA 1PH6A 1SMYD 3KFUA 4BBSG 4GOPC 1SEBD 4BBSH 1CZGA 1NMFA 2BCOA 4KY6A 3J7ZC 2JN4A 3R2TA 3PIP3 1EIYB 1EQVA 2L0CA 1F9SA 2F4VL 2NN6G 3SR1A 3LWUA 2QF7A 5LL6X 1CHQD 1OTCA 2JA8B 2JA6H 2Z4HA 1EWIA 1EY4A 2BDNA 2EYHA 2NYZD 2J4XA 1YNND 1Z9FA 4QL5A 2F0SA 2L11A 3PV0A 1KHIA 2HQEA 5FLXc 3PO3B 1QUQB 5FKAC 2K04A 1F77A 4RKLA 2PYKA 1CM9A 4A3FH 4A3JB 3S1NB 2WB1E 3B6YA 4MNOA 1LTID 3BDCA 4V0BA 3NK9A 4OX9Q 2FINB 3S24A 4YCUA 3VYSA 3HOUB 2K5HA 3S15H 1WTHA 1JJCB 3TS2A 3K57A 1E7ZA 2K75A 3OMGA 1IBML 3QJYA 1W3SA 2L1BA 1ASZA 5C0XG 3T16A 1LTAD 3AEVA 2F0PA 4FXKC 5A2QE 1YJNA 3A8JE 2F3WA 3ULLA 2QCPX 2ZM6Q 1FYCA 1MSGA 4LFAQ 5I6YA 3ICEA 1I6VC 1X3QA 3PGZA 4B3MQ 1LTGD 1RL2A 1B9MA 1LV9A 2CCZA 1VQAA 4RGTA 5C3EH 4JI7Q 4KKTA 2F0VA 3PO2H 3HP3A 4IFDG 4A3GH 4CJ0B 2EY6A 4DR2L 3T1HL 4C56C 2DUDA 2QDBA 2K52A 4MN3A 4LK1C 2B8FA 3FP9A 2WAQG 1N9WA 4IFDI 5M5XB 4F7XA 4CJ1B 4RFBA 1KL9A 2D62A 1EU3A 1D5ZC 2E2HH 4KLKA 2F52A 4BXXH 4K2KA 3DWAA 3HGBA 1PHJA 4GOPB 2WB1B 2B63G 2VQFL 2BOSA 1PH2A 4EQ5A 4K0KQ 4ILWA 1B7YB 4ID6A 2F1MA 3P1HA 1B44D 3MXPA 5IYBG 2YU9H 4DR4L 1JORA 3NQIA 2XSCA 1M90C 1AZQA 3N6RA 1ICWA 4ZK9B 1I6HB 1WYDA 2B2UC 1YEZA 4OEMB 4P75A 4OIKA 1B3QA 1VQNA 1HFNA 5DNFA 3MTSA 4M1UB 1NNXA 2GN5A 4A3DG 5BR8L 3MXUA 1JC7A 3ULPA 1MJEA 2B63B 3D4RA 1ILQA 1Q1BA 2RA4A 1D5XC 1TS3A 2EJMA 2QGQA 4ZUJA 4MTKA 1U5KA 4FYDA 1Q90A 3E5SA 3T13A 4DR6Q 1DONA 1B70B 4QF4A 3X3MA 4JI8L 4RHSA 1ENAA 1K8MA 5JEAG 4A3IH 1KC8C 3E3XA 1QE6A 2RCNA 4KJOA 1ZXTA 5DEHA 1MIUA 4UP9A 3MXNA 3S15B 4DUYL 1VQIA 1QVGA 2F0DA 3F2DA 1LT3D 1N36Q 4DV2L 1A3TA 3GTQB 1EY5A 4RGOS 1I94L 1KQSA 5EBDA 3TRZA 1UE7A 3J7AV 2X6LA 2A69C 4DR1Q 4BBRG 3RUZA 5EPJA 4O2DA 3QR8A 3MXGA 3GV6A 5CGKA 3M7NA 4KN7C 5ELNA 4DNTB 5AJ3Q 2VUMG 4BY7H 4XYQA 4PMBA 1GO3E 4DNRB 1V9PA 5KRUA 4GKJQ 1A63A 4LAAA 3S1MB 1STBA 2Z6BA 1F2YA 5IYCH 4GNXC 4P71A 2HUGA 3G6EA 1X32A 4JBKA 2CW0C 4PQXA 3PUXA 2OQ0A 3MVVA 2CH4W 3HOWH 5GAHC 4HSPA 1KNEA 3SHLA 5LMUL 3RLNA 1K83B 1HZBA 2PZTA 3DM1A 4EQPA 3HOVB 2H1EA 4LF6Q 1GHJA 4FF4A 1WCMG 3PIPA 1K8OA 1RKNA 1CK1A 1UEBA 1VQCA 3DXJC 4Q5VA 4X6AH 3VR3A 5IWAQ 1H9KA 1OXVA 3NQTA 3KLSA 1UE1A 2YU9B 3A54A 2RF4A 4C3JB 1ASYA 3DWPA 1ZYRD 3D6WA 3AU7A 5C4ZA 4K14A 5IP9H 3I90A 1YNXA 1O7ZA 4OELB 3FMCA 1ESRA 3NP8A 3FKIB 3PSIA 1BNZA 4ZLTF 5M5XH 1KRSA 3HOXG 3I4LA 3OW7A 2QW7A 4PZ6A 3VA5A 4AYBE 2OQKA 2VW9A 5C3XA 3S2HH 5FK9C 2JA7B 2UXCQ 5D65A 2G9DA 3EQLC 1J8IA 1SAPA 2I07B 5HGQA 1HZAA 1TR5A 3GP7A 3RLOA 1NR2A 5JPNC 3TN2A 3OYYA 4P2CB 1JCKB 3AFPA 2YV5A 5FO8B 3I4MB 1Y1VH 1XYIA 2K05A 4OWTB 3M9BA 3CC7A 3A56A 1Y1WH 3CAMA 3VYUA 3C46A 1CSPA 3BZKA 3RZDH 1MHWC 1TXYA 2SNSA 1BDOA 1YNJC 1XMQQ 3OHXC 2D2CC 2J7ZA 3EA6A 2IX0A 1I4PA 4BBRH 4RG1A 1LM0A 4DV4Q 1Q81C 1DOLA 1S5CD 2MJ8A 2IW3A 1V8QA 2F0JA 2M2LA 2RDFA 3R93A 2JA8G 1VQLA 2CQOA 1OXXK 4CDEC 2CVRA 2Z6KC 3A7AB 4B3TQ 1PYWD 1VQFA 1M4VA 4HN7A 5JEAJ 2HHHQ 4RMFA 5KGUA 2KCNA 4KN4C 2JA7G 5IGGA 5C4XH 5LL6S 3NTKA 4UPAA 1WVLA 4LF5Q 1SE4A 2AWOA 1K83H 3N52A 2VQFQ 1M1KC 3M3YH 3NPPA 1PTOF 2A1AA 3VR4A 2Q2HA 4JI5L 5KNBA 2OF1A 4B08A 4DV7Q 4JCVE 1AN8A 3MEFA 3CW2C 2EOTA 4QIWE 4A93G 1SROA 4NXNL 3UE0A 4BY7B 4PMWA 1IXRA 3MEHA 1S72A 5I2XA 1KAWA 2VZAA 4CGYB 5IODA 1K8GA 3SK8A 2PZWA 5I9OA 1B4OA 1LYLA 1E24A 4NXMQ 3F8TA 2WKCA 1B3AA 5LMNQ 3AYHB 1PH8A 1QZGA 1CQVA 3KLRA 2X6GA 1G6ZA 4F87A 1EOVA 1HPCA 3TP5A 1EWCA 5M3MG 1NBWA 1BR9A 4KKUA 1PH3A 5KNCA 3J7YW 1JWUD 2GVAA 2UXBL 1A6XA 2PQAA 5M5YH 2HCCA 2KOLA 1NR4A 2R7DA 1I4GA 5IIFA 2AUKA 4JOIC 3CCRA 2I5LX 1Q7YC 3ERQA 1S5ED 2HIXA 4EGVA 4DV2Q 3CQZB 2BA0A 4IPCA 3SK5A 1DOKA 3C1FA 4UY8C 3ND8A 3K0XA 4JV5Q 2B2WC 2A19A 2L15A 4BY1H 3I73A 3RN5A 4OIJA 2NVQB 1W6JA 1PLFA 4BY1G 1HNZQ 2CQAA 3KJOA 1E2WA 1ENFA 3AFQA 1Y1VB 2RVLA 1U4RA 1O78A 2CFMA 3S16H 1QVCA 4IOCA 1I50B 2OCEA 4DV1Q 1S40A 1SFOH 2RSOA 4X3UA 2UU9Q 4TSSA 4ZCKA 4L5SA 1CI3M 2KHSA 4X65Q 1YVCA 1W2BA 1JJ2A 3U58A 1OO9B 2I5HA 4JI2L 3CD6A 4IFDJ 4R4QA 4LF8L 2NVYB 5C5MA 1Y1VG 2R92H 3EIVA 1D1KA 2KBNA 4AQYL 5EQ0A 1MKHA 3MZ5A 3NBHA 1IW7C 1XMQL 1PH5A 2YYZA 4DV3Q 1O7LA 3HOVG 3P75A 5EJWA 4N8X1 4O0AA 2MP1A 2Y0SB 2NN6I 2K5DA 5C4XB 2LS01 2JA6G 2UXDQ 2IHEA 5EAYA 2JA7H 4KJNA 1EZ6A 5IOCA 4DR7L 3RZDB 4JG2A 1U4PA 4JI4L 1VMCA 1J5EL 5KNDA 1GUOA 2P5ZX 1X56A 3BJUA 4BBRB 2JEBI 3ULJA 1GUSA 3Q23A 3K58A 3WWVA 4OO1I 4LF7L 2NVTH 3P7JA 1NSNS 3G48A 2JE6I 4QUCA 3A74A 2QILA 5DM73 5JVG3 4JI5Q 3P20A 2Y0SE 4O42A 3NENA 1HTLD 1NAPA 2A68D 4MTNA 2RDHA 3H94A 2F4VQ 1SYCA 3H0GG 1CUKA 1MI2A 1BCPB 3CU7A 1CQFA 1CKNB 4HIKA 1I3QH 3H3VI 2SEBD 1G2TA 4GKKQ 3F2BA 5E4XA 5M5WH 3BDOA 1D5MC 1CZWA 2L5TA 4U68A 4EX5A 3I4MG 2WINB 4R8NA 3GO5A 2ZJPA 3CQZH 1Q86C 2E5LQ 1RTNA 5A2QL 3S14B 3M85A 1X3FA 2UXBQ 3LX0A 4A3MH 4DR3L 2IX1A 1NCVA 4DFAA 1ZYRC 1IBLQ 2BE5D 4A76A 4N9TA 1TWCB 4I65A 5NUCA 3UDXA 5E3FA 3FEWX 5EPLA 4MHEA 1H9MA 2PNRC 3HZXA 4GOPA 1E2ZA 5CYUA 1YHAA 4IUQA 3V05A 1YJ9A 1UEAB 4A3GB 1LTSD 4FXGC 3BZCA 2DN8A 1Q46A 4KV6A 4YCWA 4YCVA 3TDQA 1H9RA 4B3ML 4QY7A 2E75C 3W3AA 1SE3A 4WRDA 4DAMA 4LF5L 4BY1B 1JR0D 2A68C 1ZEQX 3HOUG 3HG9A 1GUGA 1PRTB 1S5FD 4A4IA 3KF8B 2NN6H 2PO4A 3JAMc 1YNNC 1GVPA 4WJ4A 1KLGD 4ME3A 1EYGA 4IZ8A 3I55A 4QIWB 3CMAA 4JI8Q 3DMUA 1C0AA 4NPSA 2R93B 1YNJD 4ZYSA 2D5DA 2DJGC 2NBFA 4K0KL 4CJ2C 4JI3Q 1D8LA 1F2ZA 4JBJA 4CDDC 5K5PA 1HUNA 2IWHA 1B1ZA 4DAYB 1VQDA 4BA1I 4A3LG 1UAPA 1X3PA 3GTPB 3GQBA 3M4PA 1BBUA 2M00A 1JJGA 1RDPD 3TSSA 4JVZA 4LF9L 1HRJA 2AWNA 1SXTA 5K36H 1J6QA 1Z7TA 3FKIH 1A8VA 4A93B 4OWXB 1K28A 2ZM6L 2KCMA 4PMCA 2A73B 4LMQD 2A6EC 4DR6L 4GZYC 3CC4A 1SNDA 1JICA 3GTQH 3A5ZB 2C35B 3KBGA 5C3EG 1WTXA 2E2JH 4DF7A 1HXYD 4X65L 2UUBQ 2JP1A 5C5LA 2NWGA 2BE5C 3ZYYX 1MGSA 2E2IH 5LMUQ 1X3EA 3I4MH 3T1HQ 1SN8A 2KJXA 4HMJA 3H6MA 3K8AA 1C4QA 1CHPD 2WACA 1TT2A 3PUWA 2B2TC 3PUYA 1WOCA 1IBLL 1FNVA 3MWYW 1STEA 4JW0A 1QILA 2UUAQ 5DLQE 1STNA 3SK6A 1BKBA 2DNEA 2JA5G 1XPOA 1STGA 3QB3A 3A5UA 3RNUA 3CCSA 1IZ6A 4JBMA 1JB7A 4X62L 3GTMH 5T1IA 2PZUA 1V43A 2JXMB 5HURA 5M5WB 3HOUH 1J5EQ 3M4OH 4ODGA 2LXKA 3OIPA 5IP9G 1CT1D 3S1QH 3URYA 4L8JA 1DXMA 3S2DH 1YIJA 1RF2D 3CMEA 1CKMA 2KQ3A 2ICIA 4A3CG 1IYUA 1D6EC 1X54A 4H02A 3Q0AA 4DV6L 2VQEQ 4A3MB 1Q8IA 1AW7A 2XRQD 5I2YA 1YHQA 3OPOA 1PZID 2Z9HA 5IP7H 2FMMA 1IL2A 3W5OA 1KTKA 2SDFA 1SE2A 2HD3A 3T53B 2B2YC 1H9SA 3ITPA 1B53A 4Q0FA 1YZ6A 1CA5A 5GAEC 3D3RA 3BG3A 1JMCA 2OXPA 3HRZC 3NBIA 3R8BA 1XXGA 4S3SA 4OX9L 4X3SA 4CBVA 1L1OC 5J1ZA 1PH7A 4DK3C 1IW7D 2M9VA 3CKIB 1HZCA 2IPKD 2KUMA 2GA4B 1N34Q 1TQOA 1F2MA 1IBMQ 3QWNA 1VQ4A 4ZKBB 1R9TH 3PO3H 3CP0A 1Q8KA 4H7BA 4FF3A 4X66Q 4KY7A 4JV5L
chains in the Genus database with same CATH topology
2R61A 1EY7A 3QOLA 1TWHB 2AUJD 4ZAIA 1Y1WB 2HDMA 1Z47A 1LT4D 1TWFB 2A6HD 1SNPA 1ET9A 1STYA 3OOCA 1QJOA 3H0GB 2NVXB 5IGCA 3OWEB 2RKSA 2XVSA 4B9XA 2VUMB 1F9PA 3LWEA 2BDOA 5KEEA 1ZKOA 4F8MA 3C1EA 4X3KA 3K0YA 4ZUIA 2IJ0A 4DAPA 1L0YB 2BA1A 3I8ZA 3S9WA 1KNAA 5I6WA 5G3LD 1HTPA 2K01A 3MA2B 1TVXA 3M3YB 1SYDA 2PQEA 1BCPF 3I91A 1EYAA 3S1QB 1R4QB 3VA7A 4QCLA 4Z9CB 3NSWA 4DXFA 4FNFA 3GTLB 1PZJD 5EGTA 2E2IB 4RWSC 4FF1A 4RGNA 1DM0B 1PTOB 3OIQA 3M7GA 3I4NB 4XDXA 1VF5C 3H09A 3CRKC 1WTOA 4XXEA 1VDZA 1ONLA 1D1IA 1TY2A 2F0LA 5D14A 1MD2D 1NUCA 2KECA 1RHPA 1JQYD 4C2MB 1WTVA 1E0BA 5T1GA 2EY5A 2FFKB 1PRTD 5M3MB 3CHBD 5IGFA 4EQNA 3Q6SA 5CV5A 1H9JA 3FVQA 4FO2A 4WFN3 4KD3A 5EKKA 4IQZA 1DJRD 2RDGA 3PMFA 1QCBD 1FNWA 1B50A 2N55A 1JOQA 5JOBA 1OXUA 1I4QA 5CV7A 2K03A 4OGQC 3BVGA 2RSNA 5BN4A 4RH6A 2XN9C 5ELDA 1I4XA 1A15A 1DZ1A 3BS1A 3D4WA 1EY9A 5EKLA 4K6DA 1Q3LA 3HKZB 1V1OA 2LY7A 1RJTA 5COYA 2EY2A 3NWTA 3PUZA 2FHTA 2VB2X 3QG1A 2F0TA 3C3LA 4OO1G 3BZDB 4X3TA 2F0IA 4IUUA 3OMCA 3SVMA 5C0XI 3J81L 1BO0A 2OT2A 2EJFC 1L0XB 3L9AX 2V4DA 3AB9A 5J22A 5I9PA 2K7VA 3S17B 3F2UA 1AFPA 4TKOB 4IN3A 3SDZA 2QKIC 5E4WC 3FDTA 4BWGB 2K33A 4BBSB 2XWBB 3VYRA 2DY7A 1EYCA 4KTAA 4KHZA 3KF8A 3A8KE 3EVQA 1Z6HA 3PUVA 2DNCA 2IX3A 3K7AB 1EY0A 1LTRD 3GTGB 3T51B 1SNOA 5CV4A 4G7OC 4DGZA 3QOJA 3EJIA 4J8QA 4A3EB 5M5YB 1WTQA 3VR2A 4RAUC 4K2LA 4R8IA 3V96A 5CR3A 1E2VA 1PRTF 3CRLC 3TBIB 3G6JB 3VYTA 2C9OA 3GTMB 2PW5A 2F0KA 3HOWB 4N9PA 3OSOA 1SYEA 1GUNA 5K36G 4U673 2L55A 1A3VA 4YIJA 3WOEA 1WCMB 1QNUA 1LABA 4FP5D 4L63B 3NTHA 4IALA 1B2TA 2TMPA 3JAME 2B8GA 3G7LA 5C3WA 1W6KA 1MSHA 3FRPB 3O13A 2VNUD 3NUCA 3HS0C 2X69A 5EBCA 2A74C 1LT5D 1EQTA 3Q24A 1II3A 1D2BA 2RQXA 2EYLA 3BYTB 3MC0B 1PTOD 1R9TB 4C3JG 2JSOA 1PDQA 1TWGB 2B2UA 4OL7A 2L9HA 4HAEA 3J7AF 4TRDA 1C8CA 3H3VC 4L6TB 1BOSA 3IFDA 2F0FA 1SSOA 1XX8A 2F0NA 3D6CA 1WD0A 2OEOA 1AEXA 3R2IA 4HTHA 2K5QA 1FR3A 3EFXD 1I3QB 2J0TD 1WTWA 5FLXL 3RLFA 1EL0A 1EY8A 5CV8A 3J80E 5JEAH 3S2DB 5D3DA 2FJ2A 1ML0D 5FO7B 1HHVA 2O4XA 1BCPC 2Z8LA 1O80A 1PFNA 3K59A 3A55A 2JA5B 1FD7D 1SYGA 4F88A 1DD2A 4HEDA 1HFGA 3MFGA 3HEJA 2WKDA 2K5WA 2ZXPA 2EZVA 3U9SA 4K5VA 3T4AC 1A2UA 1TS5A 4IUPA 1B9NA 4V190 1Y8PB 4XT3B 2Z4IA 1U9RA 1HQMC 3NXWA 5C3EB 5C0XH 2KCCA 4C3HB 3TMEA 4CKEA 1PTOH 2XWJB 2F0QA 1LACA 3GV3A 4ULLA 1JE4A 1Y8OB 1JWSD 3KBXA 5TSSA 1QWYA 4FVMA 4K5WA 3Q22A 1KLUD 2WIIB 1U4MA 3C2PA 3U9OA 2E76C 4RCNA 5JAVA 4DXGA 4NW2A 4C1NK 1G8ZD 1Q1EA 4NMZA 5JVH3 1A2TA 1TY0A 3NWSA 3SE0A 4DU9A 2A6HC 2IL8A 2LMCB 1PFMA 1QOHA 4HCEA 3KK7A 4EVOA 1SFOB 1WD1A 3I70A 4ME5A 2B2VC 2F0MA 4AYBB 2NUCA 1I4RA 1O7YA 2NB0A 5ELFA 4KMUC 1BBXC 1SJHD 4QUFA 3FPUB 4ZQ3A 3A8IE 4XT1B 4A3IB 1OXTA 1IL8A 1TS2A 1LT6D 3TZUA 3GTKB 5DM63 1F9RA 1KDCA 1UNSA 4C1NI 1C48A 1RD9D 3S1RB 4CKCA 5FO9B 1EOTA 4K5XA 4RHRA 2EVBA 2WP8J 1LTTD 2I46A 1KABA 1TIID 1STAA 5CC4A 3JAML 1STHA 1A3UA 2F0GA 2NTTA 1UUPA 3IFTA 1OXSC 2R3ZA 3W2DA 3HOZB 1F9QA 3BVZA 4FF2A 2Q8RE 4G7HC 4RKBA 4IFDH 5CORA 2PPBC 3DEPA 1ET6A 1EWHA 2F0OA 3E0JA 4EQOA 3WOFA 5EPKA 1Q12A 5I4DA 1SNQA 3NHHA 5ELBA 5EKIA 2MGSA 4XYOA 4RCOA 2VXWA 4M8AA 3QO2A 2JA6B 3SEBA 3K5OA 4C3IB 4KHVA 4NP5A 4J1MA 2EDGA 1AZPA 4LJZC 1HCZA 3S2HB 1XWEA 4KD4A 2F0WA 2B2YA 3I72A 1VCIA 3M4OB 1XTCD 3S16B 2CHBD 4A3FB 2ENBA 4JBWA 1TS4A 1LTBD 2EYJA 1HUMA 2EYFA 2PW7A 2EE1A 2K6AA 4H0LC 1EY6A 1H9SB 2SOBA 4C3HG 5JJZA 2R92B 2N88A 5IGDA 1QB5D 1SYFA 1HA6A 2B2WA 2O2LD 2XIWA 5A35A 4KI0A 1F2LA 1PZKD 3TP8A 3H91A 5IT9L 5C6AA 1PTOC 2F0HA 4A3DB 4WORA 4K8IA 4Y7NB 1ESFA 2RBMA 5KIXA 1V1PB 2EYOA 4HSVA 5F2DA 2B2VA 3BYYB 4IUTA 3SXHA 4XQJA 5KYIA 2KEDA 4A3BB 2NVTB 3D4DA 2Z1CA 5BN3A 2E2HB 1HA5A 4KK7A 3MFYA 3TP6A 2E2JB 4ZRZA 2PCFB 2F0EA 1IYVA 3DHQA 3D8GA 3WDNA 4A3KB 1G91A 3AMUA 3E6ZX 3K5MA 3MAQA 3NTIA 2H4OA 4R9WA 4HMIA 4ZKCB 2A5HA 3NE5B 1RODA 2MUYA 4OO1H 5HGTA 3DUZA 2XRSD 5J39A 4IUNA 3SK4A 3VR5A 5C4HA 1GJXA 1IKLA 1M8AA 4NDXA 2D9UA 1SJED 2A69D 3J80L 1JOOA 5FLXE 3TZDA 3K5LA 2A6ED 4DA2A 1HQRD 3EROA 1SNMA 5G3LF 1ENCA 1EZ8A 3RD4A 5C4JB 3PO2B 2K1BA 1Y69U 1J9OA 3ND9A 4KY5A 5CV6A 5ELEA 4K6LA 1PRTC 2K28A 1DYQA 1JWMD 1LO5D 2EPBA 2KA7A 4G7ZC 3K6OA 3MHBA 4BS9A 3BDLA 3IAYA 2XNAC 1EIGA 3BVMA 4HCSA 1JB3A 2JYOA 4XIGS 2WV6D 2O5JC 5IT9E 1EIHA 4RA8A 5D3IB 4BA2I 4DN4M 4J6HA 4E6IA 2JEAI 5FOBB 1I4HA 1GOZA 3IKJA 4IURA 5M3FB 3I3CA 4HR7B 4CHTB 1TWAB 2HCIA 1IHZA 2F0UA 4DK0A 1PFBA 4K8JA 3KLSX 1G2SA 2L4NA 2WAQB 1KAAA 2AQ3B 1MBYA 1R4PB 1S4ZA 3L7ZC 1GUTA 2ICEC 4IUVA 2C5CA 1TKWB 5CV9A 2EJGC 4FXDA 3FPPA 2K32A 3LNNA 5IGBA 3HOXB 4I7ZC 4OHJA 2AQ1B 2B2TA 5C44B 3HOYB 2MHVA 1BF4A 3OWFA 3VR6A 2EY1A 3A7LA 2Q8IB 1VMPA 1SYBA 5M9OA 2R7ZB 2TSSA 4JK1C 4WJWA 2EYMA 1FGBD 4MIUA 4CKBA 1DCZA 3UI2A 4O1NA 1BCPD 1EEID 1S5DD 2DY8A 5E1FA 2LFNA 4XQNA 1EEFD 2E2DC 5JPMC 1FNUA 2CW0D 1T5XD 1CA6A 2EYPA 1GXDC 1IKMA 5CMDA 2R6GA 2F3VA 3PIO3 4QMGA 5LHY1 2G9HD 4QB4A 3ONAB 2B39A 3GTJB 1QG7A 4H44C 1CTMA 4XTCS 5BN5A 4B9WA 4RGMA 1KDAA 2E74C 3DWQA 5CBAE 1VF7A 4C3IG 3GTOB 2QEJC 2Q8TA 3TP7A 4DK1A 1PXUA 1QNKA 3RZOB 4DAYA 2VB3X 2O5IC 1RTOA 1PMRA 3R3OA 1BUVT 3L3OC 2NZ1D 2HDLA 4KKSA 3RMHA 1SBBB 3J81E 1EYDA 1SMYC 1JOKA 1WTPA 1EU4A 4NKLA 2ZXRA 1WTRA 1RCVD 3DEOA 3M4YA 5DAUA 1SNCA 3GD7A 1U4LA 1EFID 4ABNA 4PNYA 2ID0A 1GHKA 4H13C 1CFMA 4UDUC 2SNMA 2IT1A 5AFWA 3QIAA 5ELCA 2EXZA 5IGEA 4UAIA 4TQUS 4G4KA 1GUWA 2KVMA 2ZT9C 2L12A 1SDFA 5C0XJ 4DAVA 5CBEE 5ISRA 1ILPA 2F4IA 1DOMA 2AQ2B 1BQQT 1Y8NB 2LKVA 1LLRD 2F03A 3K5NA 2FMCA 1TU2B 1T5EA 2KEEA 1S5BD 3V2TA 4G57A 1KDBA 2PMZB 4XQQA 1BXTA 2MPMA 1V1PA 2NTSA 4PV1C 5KYLA 3T56B 2ZXOA 3X3NA 1AP0A 1G291 3D31A 3IL8A 3KUPA 1SMYD 1SEBD 1CZGA 2BCOA 4KY6A 3R2TA 3PIP3 1EQVA 2L0CA 1F9SA 2NN6G 3SR1A 3LWUA 2QF7A 5LL6X 1CHQD 2JA8B 2Z4HA 1EY4A 2BDNA 2EYHA 2NYZD 2J4XA 1YNND 2F0SA 2L11A 3PV0A 2HQEA 3PO3B 5FKAC 2K04A 1F77A 4RKLA 2PYKA 1CM9A 4A3JB 3S1NB 1LTID 4V0BA 3BDCA 3NK9A 2FINB 3VYSA 3HOUB 3K57A 3OMGA 3QJYA 2L1BA 5C0XG 3T16A 1LTAD 2F0PA 4FXKC 5A2QE 3A8JE 2F3WA 2QCPX 1FYCA 1MSGA 5I6YA 1I6VC 1X3QA 1LTGD 1B9MA 1LV9A 4RGTA 4KKTA 2F0VA 3HP3A 4IFDG 4CJ0B 2EY6A 4C56C 2QDBA 4MN3A 4LK1C 2B8FA 4IFDI 5M5XB 4F7XA 4CJ1B 4RFBA 2D62A 1EU3A 1D5ZC 4K2KA 3DWAA 3HGBA 2WB1B 2BOSA 4ILWA 4ID6A 2F1MA 3P1HA 1B44D 3MXPA 1JORA 3NQIA 2XSCA 1AZQA 3N6RA 1ICWA 4ZK9B 1I6HB 2B2UC 4OIKA 1HFNA 5DNFA 3MTSA 4M1UB 3MXUA 1JC7A 2B63B 3D4RA 1ILQA 1Q1BA 2RA4A 1D5XC 1TS3A 2EJMA 4ZUJA 4FYDA 1Q90A 3E5SA 3T13A 1DONA 4QF4A 3X3MA 4RHSA 1ENAA 1K8MA 5JEAG 1QE6A 4KJOA 1ZXTA 5DEHA 3MXNA 3S15B 2F0DA 1LT3D 1A3TA 3GTQB 1EY5A 4RGOS 5EBDA 3J7AV 2X6LA 2A69C 3RUZA 5EPJA 3MXGA 3GV6A 5CGKA 3M7NA 4KN7C 4DNTB 4XYQA 4PMBA 4DNRB 5KRUA 4LAAA 3S1MB 1STBA 1F2YA 2HUGA 1X32A 2CW0C 4PQXA 3PUXA 3MVVA 4HSPA 1KNEA 3SHLA 1K83B 2PZTA 3DM1A 3HOVB 4EQPA 2H1EA 1GHJA 4FF4A 1K8OA 1RKNA 1CK1A 3DXJC 4Q5VA 3VR3A 1H9KA 1OXVA 3NQTA 3KLSA 2YU9B 3A54A 4C3JB 3DWPA 1ZYRD 3D6WA 3AU7A 5C4ZA 4K14A 3I90A 1O7ZA 3FMCA 1ESRA 3NP8A 3FKIB 1BNZA 4ZLTF 3I4LA 3OW7A 3VA5A 5C3XA 5FK9C 2JA7B 5D65A 2G9DA 3EQLC 1J8IA 1SAPA 2I07B 1TR5A 3GP7A 1NR2A 5JPNC 3TN2A 4P2CB 1JCKB 5FO8B 3I4MB 1XYIA 2K05A 3A56A 3VYUA 3C46A 2SNSA 1BDOA 1YNJC 3OHXC 2D2CC 2J7ZA 3EA6A 2IX0A 1I4PA 1DOLA 1S5CD 2MJ8A 2IW3A 1V8QA 2F0JA 2M2LA 2RDFA 3R93A 1OXXK 2CVRA 3A7AB 1PYWD 1M4VA 4HN7A 5JEAJ 5KGUA 2KCNA 4KN4C 5IGGA 5LL6S 3NTKA 1WVLA 1SE4A 2AWOA 3N52A 3NPPA 1PTOF 3VR4A 5KNBA 2OF1A 4B08A 1AN8A 2EOTA 4BY7B 4PMWA 3MEHA 5I2XA 4CGYB 5IODA 3SK8A 2PZWA 5I9OA 1B4OA 2WKCA 1B3AA 1CQVA 3KLRA 2X6GA 1G6ZA 4F87A 1HPCA 3TP5A 1EWCA 1BR9A 4KKUA 5KNCA 3J7YW 1JWUD 1A6XA 2HCCA 2KOLA 1NR4A 1I4GA 5IIFA 2AUKA 3ERQA 1S5ED 4EGVA 3CQZB 2BA0A 3SK5A 1DOKA 3C1FA 3ND8A 2B2WC 3I73A 4OIJA 2NVQB 1W6JA 1PLFA 2CQAA 1E2WA 1ENFA 1Y1VB 2RVLA 1U4RA 1O78A 1I50B 2RSOA 4X3UA 4TSSA 1CI3M 2KHSA 4IFDJ 1OO9B 2NVYB 5C5MA 1D1KA 5EQ0A 3MZ5A 3NBHA 1IW7C 2YYZA 1O7LA 3P75A 5EJWA 2MP1A 2Y0SB 2NN6I 2K5DA 5C4XB 2LS01 4KJNA 1EZ6A 5IOCA 3RZDB 1U4PA 1VMCA 5KNDA 1GUOA 4BBRB 2JEBI 1GUSA 3Q23A 3K58A 4OO1I 3P7JA 1NSNS 2JE6I 4QUCA 2QILA 5DM73 5JVG3 3P20A 4O42A 1HTLD 1NAPA 2A68D 2RDHA 3H94A 1SYCA 1MI2A 1BCPB 3CU7A 1CQFA 2SEBD 1G2TA 5E4XA 3BDOA 1D5MC 1CZWA 2L5TA 4U68A 2WINB 4R8NA 3GO5A 1RTNA 5A2QL 3S14B 3M85A 3LX0A 2IX1A 1NCVA 4DFAA 1ZYRC 2BE5D 4N9TA 1TWCB 4I65A 5NUCA 5E3FA 3FEWX 5EPLA 4MHEA 1H9MA 2PNRC 3HZXA 1E2ZA 5CYUA 4IUQA 3V05A 1UEAB 4A3GB 1LTSD 4FXGC 2DN8A 4KV6A 3TDQA 1H9RA 2E75C 3W3AA 1SE3A 4WRDA 4BY1B 1JR0D 2A68C 1ZEQX 3HG9A 1GUGA 1PRTB 1S5FD 2NN6H 2PO4A 1YNNC 1KLGD 4IZ8A 4QIWB 3DMUA 2R93B 1YNJD 4ZYSA 2D5DA 2NBFA 4CJ2C 1F2ZA 5K5PA 1HUNA 2IWHA 1B1ZA 4BA1I 1UAPA 1X3PA 3GTPB 3GQBA 2M00A 1RDPD 3TSSA 1HRJA 2AWNA 1SXTA 5K36H 1Z7TA 4A93B 4PMCA 2A73B 4LMQD 2A6EC 4GZYC 1SNDA 1JICA 3KBGA 1WTXA 4DF7A 1HXYD 2JP1A 5C5LA 2NWGA 2BE5C 3ZYYX 1MGSA 2KJXA 4HMJA 3H6MA 1C4QA 1CHPD 2WACA 1TT2A 3PUWA 2B2TC 3PUYA 1FNVA 3MWYW 1STEA 1QILA 1STNA 3SK6A 2DNEA 1STGA 3QB3A 5T1IA 2PZUA 1V43A 2JXMB 5HURA 5M5WB 4ODGA 3OIPA 1CT1D 3URYA 4L8JA 1DXMA 1RF2D 2KQ3A 2ICIA 1IYUA 1D6EC 3Q0AA 4A3MB 1Q8IA 1AW7A 2XRQD 5I2YA 3OPOA 1PZID 2FMMA 1KTKA 2SDFA 1SE2A 3T53B 2B2YC 1H9SA 3ITPA 1B53A 4Q0FA 1CA5A 3D3RA 3BG3A 2OXPA 3HRZC 3NBIA 3R8BA 1XXGA 4S3SA 4X3SA 4CBVA 5J1ZA 1IW7D 2M9VA 3CKIB 2IPKD 2GA4B 2KUMA 1TQOA 1F2MA 3QWNA 4ZKBB 4H7BA 4FF3A 4KY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  2F0Q A;  5CV6 A;  1KAB A;  1SND A;  1EY7 A;  3LX0 A;  1STA A;  3QOL A;  3TP8 A;  5E1F A;  2LKV A;  4DFA A;  3RUZ A;  5I6Y A;  4N9T A;  5CC4 A;  2EY5 A;  5C6A A;  4DF7 A;  2F0H A;  1STH A;  2SNS A;  4I65 A;  5CGK A;  1II3 A;  4WOR A;  1A3U A;  4K8I A;  1SNP A;  2F0G A;  2EYL A;  5C5L A;  1EYC A;  5NUC A;  3V2T A;  2EYP A;  2KHS A;  5E3F A;  4K5W A;  4KTA A;  2RBM A;  4G57 A;  5KIX A;  1STY A;  4PMB A;  3HZX A;  1KDB A;  5KRU A;  5IGF A;  2EYO A;  2F3V A;  2F0V A;  4LAA A;  4OL7 A;  4EQN A;  1STB A;  3MHB A;  5F2D A;  3EVQ A;  4QMG A;  1F2Y A;  3U9O A;  2EY6 A;  4HMJ A;  5C5M A;  3H6M A;  5IGC A;  3SXH A;  2WAC A;  2F3W A;  4QB4 A;  5JAV A;  3BDL A;  1TT2 A;  2F0J A;  2RKS A;  4B9X A;  2RDF A;  4TRD A;  5CV5 A;  5KYI A;  4RKB A;  3D4D A;  4KV6 A;  5KEE A;  5KYL A;  4NMZ A;  2QDB A;  1EY0 A;  4KD3 A;  5EKK A;  3MVV A;  3MZ5 A;  1A2T A;  2F0O A;  4F8M A;  3C1E A;  1STN A;  3PMF A;  3SK6 A;  4DU9 A;  4EQO A;  4ZUI A;  4B9W A;  4F7X A;  1SNO A;  4J6H A;  4WRD A;  2F0F A;  1KDA A;  5CV4 A;  3SHL A;  1STG A;  3P75 A;  3QB3 A;  5IGG A;  5KGU A;  4E6I A;  4DGZ A;  3QOJ A;  2F0N A;  1JOQ A;  2PZT A;  3D6C A;  3S9W A;  3TP6 A;  4EQP A;  2OEO A;  4EVO A;  5JOB A;  1AEX A;  3EJI A;  1SNQ A;  4K2K A;  3NHH A;  5I6W A;  4ME5 A;  2F0M A;  2PZU A;  1IHZ A;  4HTH A;  3TP7 A;  2NUC A;  2F0U A;  1EZ6 A;  4KJN A;  5CV7 A;  5IOC A;  2OF1 A;  5HUR A;  2F0E A;  1RKN A;  1SYD A;  4ID6 A;  4KY6 A;  4ODG A;  3DHQ A;  3P1H A;  3D8G A;  3MXP A;  2PQE A;  3R3O A;  4K8J A;  1JOR A;  4K2L A;  1EYA A;  1EQV A;  3NQT A;  3D4W A;  3SR1 A;  1EY8 A;  3MEH A;  1EY9 A;  1KAA A;  2KQ3 A;  5CV8 A;  4ZQ3 A;  4IZ8 A;  4K6D A;  5EKL A;  5CR3 A;  4HMI A;  1EYD A;  1JOK A;  3DMU A;  1NSN S;  4KHV A;  4J1M A;  4NP5 A;  5IOD A;  3SK8 A;  1EY4 A;  2PZW A;  5I9O A;  5CV9 A;  2EY2 A;  2EYH A;  2PW5 A;  4NKL A;  4KD4 A;  2F0W A;  5C4Z A;  2F0K A;  4K14 A;  4N9P A;  3OSO A;  1SYE A;  5HGT A;  2O4X A;  2F0S A;  5IGB A;  3NP8 A;  5EGT A;  2F0T A;  5J39 A;  1A3V A;  1SNC A;  4YIJ A;  5DAU A;  2ENB A;  3TP5 A;  2HQE A;  1F2Z A;  1KDC A;  4IUN A;  4ZUJ A;  5K5P A;  3SK4 A;  1SYG A;  3ITP A;  5C4H A;  4RKL A;  2PYK A;  1SYC A;  3E5S A;  4PNY A;  3T13 A;  2EYJ A;  2F0I A;  3OWF A;  3HEJ A;  2EY1 A;  3BDC A;  3OMC A;  3NK9 A;  2OXP A;  4NDX A;  4QF4 A;  2EYF A;  3VA5 A;  2PW7 A;  1SYB A;  5IIF A;  5M9O A;  4S3S A;  1ENA A;  4IAL A;  5J1Z A;  5C3X A;  2M00 A;  4K5V A;  2SNM A;  1JOO A;  1A2U A;  4K5X A;  4KJO A;  2EXZ A;  3ERQ A;  3OMG A;  5IGE A;  2EYM A;  1TQO A;  5DEH A;  1EY6 A;  2SOB A;  4MIU A;  1TR5 A;  1F2M A;  5J22 A;  5I9P A;  4R8N A;  1U9R A;  2F0D A;  5C3W A;  3NXW A;  3SK5 A;  3T16 A;  3ERO A;  5IGD A;  1SNM A;  2F0P A;  3C1F A;  2F0L A;  1ENC A;  1EZ8 A;  1SYF A;  3NUC A;  4H7B A;  1A3T A;  4PMC A;  1EY5 A;  3TME A;  1NUC A;  4KY7 A;  5ISR A; 
#chains in the Genus database with same CATH topology
 2R61 A;  4LW1 A;  1EY7 A;  3QOL A;  1TWH B;  2AUJ D;  4ZAI A;  4DKA C;  1Y1W B;  2HDM A;  1Z47 A;  5AJ3 L;  1LT4 D;  1TWF B;  5H1S E;  2A6H D;  1SNP A;  2UU9 L;  1ET9 A;  1STY A;  3OOC A;  1QJO A;  5IYD H;  1XMO L;  3H0G B;  2NVX B;  5IGC A;  3OWE B;  2RKS A;  2XVS A;  4B9X A;  2VUM B;  1F9P A;  3LWE A;  3J80 c;  2BDO A;  5KEE A;  4GN5 A;  1VQ7 A;  1XPU A;  1ZKO A;  4F8M A;  1GKH A;  2E8G A;  3C1E A;  4X3K A;  3K0Y A;  1S3O A;  4ZUI A;  2IJ0 A;  4A93 H;  4DV3 L;  4DAP A;  1AE2 A;  4A3G G;  1L0Y B;  2BA1 A;  2DJF C;  3I8Z A;  3S9W A;  3S17 H;  1KNA A;  4LF4 L;  5I6W A;  5G3L D;  1HTP A;  5LMN L;  3GTP H;  1UE5 A;  2K01 A;  3MA2 B;  1TVX A;  3M3Y B;  1SYD A;  3CPW A;  1T9H A;  2PQE A;  1BCP F;  2MO0 A;  3I91 A;  1EYA A;  2GVB A;  1PYB A;  3S1Q B;  1R4Q B;  3VA7 A;  4QCL A;  4Z9C B;  4R4C A;  4P73 A;  3NSW A;  3PF5 A;  4DXF A;  4FNF A;  3GTL B;  2KCT A;  1HH2 P;  1PZJ D;  5EGT A;  4DV5 L;  4DR5 L;  2E2I B;  4RWS C;  4FF1 A;  3H15 A;  2VY3 A;  4RGN A;  2R93 G;  2ZTD A;  1DM0 B;  1PTO B;  4MZ9 A;  3DM3 A;  3OIQ A;  3PQI A;  3EBE A;  3M7G A;  3J80 i;  3I4N B;  5GQO A;  4XDX A;  1VF5 C;  2VQE L;  1SRU A;  3H09 A;  3CRK C;  3K7A H;  4POG A;  1WTO A;  4XXE A;  1VDZ A;  1ONL A;  1KRT A;  3J81 i;  1D1I A;  1TY2 A;  2F0L A;  4LF8 Q;  5D14 A;  1MD2 D;  1NUC A;  2KEC A;  3CCQ A;  4R4I A;  1RHP A;  1JQY D;  4C2M B;  1WTV A;  1K8A C;  2UUC L;  2Q2U A;  3I4N G;  1E0B A;  4YHH L;  5T1G A;  2EY5 A;  2FFK B;  1I50 H;  1PRT D;  4DNI A;  5M3M B;  3STB D;  2Q2I A;  3CHB D;  4DV4 L;  5IGF A;  2NZH A;  4IPH A;  4EQN A;  3Q6S A;  4IPD A;  3CCU A;  4GKJ L;  4HJ8 A;  3OTO L;  1K9M C;  5CV5 A;  1H9J A;  3FVQ A;  4JI4 Q;  1SLJ A;  4FO2 A;  2UUA L;  4WFN 3;  4DV1 L;  4KD3 A;  2VUM H;  5EKK A;  4IQZ A;  1DJR D;  2RDG A;  1BBW A;  3PMF A;  1X3G A;  1QCB D;  1FNW A;  1B50 A;  3L2P A;  4LFC L;  2N55 A;  3S1M H;  1JOQ A;  3VDY A;  5JOB A;  4GLA C;  4JYA L;  1OXU A;  1I4Q A;  5CV7 A;  2ZJR A;  2K03 A;  5GAG C;  4OGQ C;  3BVG A;  2RSN A;  5BN4 A;  4RH6 A;  2QA4 A;  2PI2 E;  4YWL A;  2XN9 C;  5ELD A;  5IWA L;  1I4X A;  1A15 A;  1DZ1 A;  3BS1 A;  3D4W A;  1EY9 A;  5EKL A;  2ES2 A;  4K6D A;  1GM5 A;  1Q3L A;  3CCE A;  3HKZ B;  2JK8 A;  1V1O A;  2LY7 A;  3H0G H;  4UP7 A;  1E1T A;  1RJT A;  1UWV A;  1L1O B;  1TWH H;  5COY A;  2EY2 A;  3NWT A;  3PUZ A;  2FHT A;  3U4V A;  4R1J A;  2VB2 X;  5FLM G;  3QG1 A;  1A0I A;  2F0T A;  3C3L A;  3W1G A;  2WFW A;  4OO1 G;  5M3F H;  3BZD B;  4X3T A;  1N32 L;  2F0I A;  4NB3 A;  4IUU A;  3OMC A;  2NVX H;  4DPG A;  3SVM A;  5C0X I;  3J81 L;  1VQ9 A;  1BO0 A;  2OT2 A;  2R93 H;  2EJF C;  2N78 A;  3F1Z A;  2Q2T A;  1L0X B;  3L9A X;  2V4D A;  3K81 C;  3UDF A;  3AB9 A;  5J22 A;  5I9P A;  4DV5 Q;  3HOZ G;  1YI2 A;  5GRO A;  1C7Y A;  2K7V A;  3S17 B;  3F2U A;  1AFP A;  1K0R A;  2IHF A;  4TKO B;  4IN3 A;  3SDZ A;  2EIF A;  2QKI C;  5E4W C;  3FDT A;  2KHJ A;  4BWG B;  2K33 A;  4BBS B;  4CDC C;  4Y7N H;  4I7A A;  2XWB B;  1BVS A;  3VYR A;  2DY7 A;  1EYC A;  1TWC H;  1TWG H;  2PI2 A;  4KTA A;  1EQR A;  4KHZ A;  3KF8 A;  1XJV A;  3A8K E;  1Y1W G;  3EVQ A;  3DLL A;  1O7I A;  3D0F A;  1Z6H A;  4JI1 L;  5IE8 A;  2JA8 H;  3PUV A;  2MNA A;  3GTL H;  2DNC A;  2IX3 A;  3K7A B;  4YHH Q;  1EY0 A;  1LTR D;  3GTG B;  3M4Q A;  2Z6K A;  3T51 B;  2JJQ A;  1SNO A;  2BH8 A;  1FVI A;  5CV4 A;  1HJP A;  4G7O C;  3K80 C;  2HHH L;  2YTY A;  4DGZ A;  3QOJ A;  4C3I H;  1PVO A;  2KEN A;  4JI0 L;  2R7Z G;  3EJI A;  4PZ8 A;  2N8N A;  2MO1 A;  4J8Q A;  1PA6 A;  4A3E B;  3KDF B;  5M5Y B;  1WTQ A;  2AMC B;  3T1Y L;  3VR2 A;  2D0P A;  4A3F G;  4N8F A;  4YWK A;  2RHQ B;  4RAU C;  4K2L A;  4R8I A;  1DGS A;  3V96 A;  5CR3 A;  1E2V A;  1PRT F;  3J7A 5;  3CRL C;  3TBI B;  3G6J B;  3VYT A;  1VQB A;  2C9O A;  3GTM B;  2PW5 A;  4L5T A;  2F0K A;  4N9P A;  3HOW B;  3OSO A;  1SYE A;  1GUN A;  4OXP A;  4IOA A;  5K36 G;  1JE5 A;  4U67 3;  2L55 A;  1A3V A;  4YIJ A;  5M3M H;  4DUZ Q;  3WOE A;  4PZ7 A;  4B3R Q;  1WCM B;  1QNU A;  1LAB A;  1LUZ A;  1RIP A;  4FP5 D;  5M3F G;  3NBH B;  4L63 B;  3NTH A;  4IAL A;  3SGI A;  1B2T A;  2TMP A;  3JAM E;  2B8G A;  5C44 G;  3HOY G;  2ATW A;  2UUB L;  3G7L A;  1G6P A;  3TRE A;  1PYS B;  5C3W A;  1W6K A;  3UDI A;  4JI3 L;  5JJK A;  1MSH A;  3FRP B;  4L5R C;  3O13 A;  2VNU D;  4X64 L;  3NUC A;  3HS0 C;  4HJ5 A;  2G5D A;  4KHP L;  2X69 A;  5EBC A;  1HNZ L;  2N3S A;  1PV4 A;  2A74 C;  2HT1 A;  1LT5 D;  1EQT A;  4GLX A;  3Q24 A;  1II3 A;  4B3T L;  1D2B A;  2RQX A;  2EYL A;  3BYT B;  3MC0 B;  1L0W A;  1N8R C;  1KXL A;  1XPR A;  4BXX G;  1PTO D;  2B3G A;  1R9T B;  4C3J G;  2JSO A;  1PDQ A;  2Z0S A;  1TWG B;  2B2U A;  4OL7 A;  2NVQ H;  3OTO Q;  2L9H A;  1P16 A;  3JAM i;  3CCJ A;  4HAE A;  4QGU A;  3J7A F;  4TRD A;  3H3V H;  3G71 A;  1X55 A;  1I6H H;  4DV7 L;  1C8C A;  4LFA L;  3H3V C;  4L6T B;  1CSQ A;  1BOS A;  3IFD A;  1XTD A;  2RHS B;  4HJ7 A;  2F0F A;  1SSO A;  1XX8 A;  2F0N A;  2NVY H;  3D6C A;  1WD0 A;  2JA9 A;  2OEO A;  4DV6 Q;  1AEX A;  4JYA Q;  2WB1 G;  4AH6 A;  3R2I A;  4HTH A;  4LFB L;  2K5Q A;  5E7N A;  3I56 A;  1FR3 A;  3EFX D;  2PQA B;  1I3Q B;  2J0T D;  1LTL A;  1WTW A;  5FLX L;  3RLF A;  1EL0 A;  5FJ8 G;  1EY8 A;  5CV8 A;  1JT8 A;  3J80 E;  3S1N H;  5JEA H;  4A3I G;  4GN4 B;  3S2D B;  5D3D A;  4JI0 Q;  1VQJ A;  2FJ2 A;  1ML0 D;  4L5Q A;  1VQK A;  5FO7 B;  1HHV A;  1K3R A;  2O4X A;  1BCP C;  2LXJ A;  2Z8L A;  1XNQ Q;  1O80 A;  1PFN A;  3K59 A;  5LMN W;  3A55 A;  2JA5 B;  1FD7 D;  1SYG A;  4F88 A;  4DR5 Q;  1X6O A;  4X66 L;  1DD2 A;  3PO3 G;  4HED A;  1HFG A;  1VQH A;  3MFG A;  3UE1 A;  3HEJ A;  2WKD A;  2K5W A;  2ZXP A;  2EZV A;  3U9S A;  4K5V A;  2YTV A;  3CCV A;  3T4A C;  1A2U A;  1TS5 A;  1FL0 A;  4IUP A;  1B9N A;  3HKS A;  1Y8P B;  4XT3 B;  4V19 0;  2Z4I A;  1U9R A;  3FHW A;  2I0Q A;  1HQM C;  3NXW A;  5C3E B;  4JI2 Q;  5C0X H;  2KCC A;  4C3H B;  3TME A;  1CKN A;  4CKE A;  5IYD G;  1PTO H;  5ELO A;  2XWJ B;  2F0Q A;  1LAC A;  3GV3 A;  3PO2 G;  4ULL A;  2CKZ B;  4AIM A;  1JE4 A;  3HOW G;  1Y8O B;  1JWS D;  3KBX A;  5TSS A;  1QWY A;  4FVM A;  4K5W A;  3Q22 A;  1KLU D;  4GNX A;  1QZH A;  2WII B;  1U4M A;  3C2P A;  1PFS A;  1WCM H;  3U9O A;  1QUQ A;  1YIT A;  2E76 C;  2UXD L;  2A8V A;  4RCN A;  4C3J H;  5JAV A;  4DXG A;  4NW2 A;  4LUO A;  4C1N K;  2N49 A;  1G8Z D;  1Q1E A;  3HKZ G;  4NMZ A;  1AE3 A;  5JVH 3;  2OWO A;  2K5N A;  1A2T A;  1TY0 A;  3NWS A;  3SE0 A;  4DU9 A;  2A6H C;  3GTO H;  2IL8 A;  1A62 A;  2LMC B;  2MQH A;  1PFM A;  1QOH A;  4LF7 Q;  4ALP A;  1KD1 C;  4HCE A;  3KK7 A;  4EVO A;  1SFO B;  1WD1 A;  3I70 A;  3RZO H;  4ME5 A;  2B2V C;  2F0M A;  1SMX A;  4AYB B;  2NUC A;  1I4R A;  2B63 H;  1O7Y A;  2NB0 A;  5ELF A;  4KMU C;  4B3S Q;  4A3D H;  3NEL A;  3HOX H;  3G4S A;  3KOJ A;  1BBX C;  2RCF A;  1C9O A;  1SJH D;  4QUF A;  3FPU B;  4ZQ3 A;  4YY3 Q;  3A8I E;  1YBY A;  1HR0 L;  2I5M X;  4XT1 B;  4A3I B;  2NZO A;  4APV A;  1OXT A;  2QDL A;  1IL8 A;  1TS2 A;  1LT6 D;  3TZU A;  3GTK B;  5DM6 3;  4LUZ A;  3JC6 6;  1FJG L;  1F9R A;  1KDC A;  5J3B A;  2ZJQ A;  1UNS A;  4C1N I;  4DV0 L;  2AKW B;  1C48 A;  1RD9 D;  3S1R B;  4WJ3 M;  1AH9 A;  4DR3 Q;  5FJ8 H;  4CKC A;  5FO9 B;  1XNR Q;  4A3B H;  4A3B G;  1N34 L;  1EOT A;  4K5X A;  1VQ8 A;  4UP8 A;  5HY6 A;  4DK6 C;  4RHR A;  1QVF A;  2EVB A;  1XNQ L;  4A3K H;  2WP8 J;  1LTT D;  4BY7 G;  2K4K A;  4KHP Q;  4QQB X;  2I46 A;  1KAB A;  3Q8D A;  1TII D;  1STA A;  3KF6 A;  2PNH A;  5CC4 A;  3JAM L;  1STH A;  1NTG A;  1HNW L;  1A3U A;  2F0G A;  2NTT A;  3W1B A;  1UUP A;  4IO9 A;  3IFT A;  1XMO Q;  4LFC Q;  3I7F A;  1OXS C;  2R3Z A;  3W2D A;  3HOZ B;  1F9Q A;  3BVZ A;  4FF2 A;  4JI7 L;  2IY5 B;  4JI6 Q;  1SE8 A;  5IYC G;  1WI5 A;  2Q8R E;  4G7H C;  1X65 A;  4RKB A;  4IFD H;  5COR A;  2PPB C;  1YJW A;  2ASB A;  1YHB A;  3DEP A;  1ET6 A;  1EWH A;  2F0O A;  2B29 A;  2XTI A;  3E0J A;  4EQO A;  2JA5 H;  3ERS X;  1H95 A;  1E1O A;  3WOF A;  5EPK A;  3J81 j;  1Q12 A;  1VQM A;  1IBK Q;  3RN2 A;  5I4D A;  4LF6 L;  1SNQ A;  1N33 Q;  3NHH A;  1WFQ A;  5ELB A;  5EKI A;  3CF5 A;  3CC2 A;  2MGS A;  3HFZ B;  4XYO A;  5IT9 c;  3T1Y Q;  4IJH A;  5FLM H;  3KF6 B;  4RCO A;  2K50 A;  2VXW A;  3KDF A;  4M8A A;  3CXC A;  2F3I A;  1EQQ A;  3QO2 A;  2JA6 B;  3SEB A;  1UE6 A;  3K5O A;  4A3C H;  4C3I B;  4P72 A;  4NP5 A;  4KHV A;  4J1M A;  2EDG A;  3OW2 A;  1AZP A;  4LJZ C;  1HCZ A;  1X9N A;  3S2H B;  4LF9 Q;  1XWE A;  4KD4 A;  2F0W A;  2B2Y A;  4PG3 A;  3I72 A;  1VCI A;  3M4O B;  2KHI A;  4A3J G;  2JQO A;  1VQ6 A;  1XTC D;  3S16 B;  2CHB D;  4A3J H;  2ENB A;  4A3F B;  1MJC A;  4JBW A;  4JC0 A;  1TWF H;  1TS4 A;  1LTB D;  2EYJ A;  3E9H A;  1HUM A;  2EYF A;  3LGJ A;  2K14 A;  2PW7 A;  1HR0 Q;  4IPG A;  2EE1 A;  2K6A A;  4H0L C;  1EY6 A;  1H9S B;  2SOB A;  4C3H G;  5JJZ A;  2R92 B;  2N88 A;  5IGD A;  1QB5 D;  1SYF A;  1HA6 A;  1N36 L;  2B2W A;  1D7Q A;  1N32 Q;  4DR2 Q;  1IYJ B;  2O2L D;  4DV0 Q;  2XIW A;  1VQ5 A;  1NY4 A;  5A35 A;  4KI0 A;  1F2L A;  1PZK D;  1TWA H;  3TP8 A;  4LUV A;  3H91 A;  1PH1 A;  4A3L H;  5IT9 L;  5C6A A;  1PTO C;  2F0H A;  4A3D B;  4JOI A;  1VQP A;  4WOR A;  4K8I A;  4GLV B;  1ESF A;  4Y7N B;  2RBM A;  2XGT A;  5KIX A;  1V1P B;  2EYO A;  4HSV A;  1CKO A;  5F2D A;  2B2V A;  3BYY B;  4IUT A;  4A3K G;  3SXH A;  4XQJ A;  2D0O A;  5L37 A;  5KYI A;  2KED A;  2R7Z H;  4HJA A;  4A3B B;  2NVT B;  3D4D A;  2Z1C A;  5BN3 A;  1HNW Q;  4GN3 B;  2E2H B;  3GTG H;  3PIO A;  1HA5 A;  1HNX L;  4KK7 A;  3MFY A;  3TP6 A;  2E2J B;  3E9I A;  3KLW A;  4ZRZ A;  3CCL A;  2FXQ A;  3ZJY C;  3NEM A;  2PCF B;  2F0E A;  1IYV A;  4OWW B;  3DHQ A;  3D8G A;  3WDN A;  3L0O A;  3K7U C;  4A3K B;  1G91 A;  3AMU A;  3E6Z X;  4YY3 L;  3K5M A;  3UDG A;  3MAQ A;  4B3R L;  3NTI A;  2H4O A;  4R9W A;  4HMI A;  3EN2 A;  4NXM L;  2K5V A;  4ZKC B;  2A5H A;  3NE5 B;  1ROD A;  2MUY A;  3S14 H;  4OO1 H;  5HGT A;  3DUZ A;  2XRS D;  4YWM A;  5C44 H;  3A0J A;  3HOY H;  1V1Q A;  5J39 A;  4IUN A;  3SK4 A;  3VR5 A;  4X64 Q;  5C4H A;  1GJX A;  1VS0 A;  1IKL A;  1M8A A;  4NDX A;  1XNR L;  2EXD A;  2D9U A;  1SJE D;  2A69 D;  3J80 L;  1JOO A;  5FLX E;  3TZD A;  2UXC L;  3K5L A;  4Y52 H;  4QJF A;  4AYB G;  1L2F A;  2A6E D;  4DA2 A;  1HQR D;  3ERO A;  1SNM A;  5G3L F;  4HJ9 A;  1ENC A;  1EZ8 A;  3RD4 A;  5C4J B;  3I2Z A;  3PO2 B;  2K1B A;  1Y69 U;  1J9O A;  3ND9 A;  4KY5 A;  5CV6 A;  1KIX A;  5ELE A;  3I4N H;  4K6L A;  4A3E G;  1PRT C;  1SR3 A;  3MXN B;  2UUC Q;  3RR5 A;  2K28 A;  3ER0 A;  1DYQ A;  1JWM D;  1LO5 D;  5GAD C;  2EPB A;  2YTX A;  2KA7 A;  4C3H H;  4CDF C;  4G7Z C;  3K6O A;  4JI6 L;  4LNQ A;  4JI1 Q;  3MHB A;  2CH4 A;  4LF4 Q;  4BS9 A;  3GTJ H;  3BDL A;  4TVA B;  1P8L A;  3U4Z A;  3IAY A;  4AQY Q;  2XNA C;  1EIG A;  3BVM A;  5JJI A;  4HCS A;  4GNX B;  1JB3 A;  2JYO A;  3KJP A;  4XIG S;  2WV6 D;  2O5J C;  5IT9 E;  1EIH A;  4RA8 A;  5D3I B;  4BA2 I;  4DN4 M;  4J6H A;  3HOV H;  1E22 A;  4E6I A;  2JEA I;  4FDB A;  5FOB B;  1I4H A;  1GOZ A;  3IKJ A;  4IUR A;  5M3F B;  3I3C A;  4HR7 B;  2CWA A;  4CHT B;  1TWA B;  2HCI A;  1IHZ A;  2F0U A;  4DK0 A;  1PFB A;  4K8J A;  4B3S L;  3KLS X;  1G2S A;  2L4N A;  4HIO A;  2WAQ B;  1KAA A;  4NXN Q;  2AQ3 B;  1MBY A;  1R4P B;  1S4Z A;  2HIV A;  3L7Z C;  1GUT A;  2ICE C;  4IUV A;  3J81 c;  4JPB W;  2C5C A;  2OTL A;  1TKW B;  5CV9 A;  2EJG C;  4FXD A;  3FPP A;  3FKI G;  4LFB Q;  3CCM A;  1HR0 W;  2K32 A;  3LNN A;  3PF4 A;  4DUZ L;  5IGB A;  3HOX B;  1ICF B;  4I7Z C;  4OHJ A;  2AQ1 B;  2B2T A;  5C44 B;  3HOY B;  1FJG Q;  2MHV A;  2CWP A;  3OWF A;  3VR6 A;  1BF4 A;  2EY1 A;  1EFW A;  3A7L A;  2Q8I B;  1VMP A;  3AQQ A;  1SYB A;  2AHO B;  5M9O A;  2R7Z B;  4GKK L;  2VL6 A;  2TSS A;  3IRB A;  3KYH C;  1U0L A;  4JK1 C;  2EYM A;  1FGB D;  4WJW A;  4MIU A;  4CKB A;  3GTK H;  1NE3 A;  2PMZ E;  2E5L L;  1DCZ A;  2V1C C;  3UI2 A;  4O1N A;  1I94 Q;  3TS0 A;  1BCP D;  1EEI D;  1S5D D;  2R7F A;  1Q82 C;  2DY8 A;  5E1F A;  1K73 C;  2LFN A;  4XQN A;  1EEF D;  2E2D C;  5JPM C;  3STB C;  1FNU A;  2CW0 D;  1T5X D;  1CA6 A;  1Y14 B;  4A3E H;  2EYP A;  4R4T A;  1GXD C;  1IKM A;  2ZTE A;  4HIM A;  5CMD A;  2R6G A;  2F3V A;  3PIO 3;  4QMG A;  5LHY 1;  2G9H D;  3BU2 A;  4QB4 A;  4IJL A;  3ONA B;  1PH4 A;  2B39 A;  3GTJ B;  1QG7 A;  4H44 C;  1CTM A;  1E3P A;  1NMG A;  1HZ9 A;  4XTC S;  1GD7 A;  1L1O A;  4B9W A;  5BN5 A;  2R92 G;  1K0S A;  1HNX Q;  5IY0 A;  4C2M H;  4RGM A;  1KDA A;  2DGY A;  2E74 C;  3DWQ A;  5CBA E;  1VF7 A;  4C3I G;  3GTO B;  5JJL A;  3TEH B;  2QEJ C;  2Q8T A;  5IP7 G;  1I5F A;  2MFI A;  1N33 L;  3TP7 A;  3U50 C;  4DK1 A;  1PXU A;  1QNK A;  3RZO B;  4DAY A;  2VB3 X;  2O5I C;  1RTO A;  1PMR A;  3R3O A;  1BUV T;  4UHV A;  1K3B C;  3I4O A;  3L3O C;  2NZ1 D;  2HDL A;  5C4X G;  4DR4 Q;  4KKS A;  5C4J H;  3RMH A;  1SBB B;  3J81 E;  1EYD A;  1SMY C;  1JOK A;  4OON A;  2OTJ A;  1WTP A;  2EQS A;  1EU4 A;  3HKZ E;  2ALY B;  2ZXR A;  4NKL A;  4R4O A;  4X62 Q;  1WTR A;  1RCV D;  2WAQ E;  4P74 A;  5BR8 Q;  1VQE A;  3DEO A;  3M4Y A;  4HID A;  5DAU A;  1SNC A;  2QEX A;  3GD7 A;  1U4L A;  1EFI D;  3CPF A;  4LWC A;  4ABN A;  2H5X A;  4PNY A;  1G51 A;  2ID0 A;  1GHK A;  4H13 C;  1CFM A;  1VQG A;  2Y0S G;  4UDU C;  3GDE A;  2SNM A;  2IT1 A;  3S1R H;  5AFW A;  3QIA A;  5ELC A;  2EXZ A;  5IGE A;  4UAI A;  4J15 A;  4TQU S;  3F2C A;  4G4K A;  4DUY Q;  1GUW A;  2KVM A;  2ZT9 C;  2L12 A;  1SDF A;  5C0X J;  4DAV A;  4A75 A;  5CBE E;  1EUJ A;  5ISR A;  1ILP A;  1NJI C;  1VQO A;  2F4I A;  1DOM A;  2AQ2 B;  1BQQ T;  1Y8N B;  2LKV A;  4POF A;  1LLR D;  2F03 A;  2ZTC A;  3K5N A;  4GS3 A;  1PH9 A;  4DR1 L;  2FMC A;  1TU2 B;  1T5E A;  2KEE A;  1S5B D;  2BH2 A;  3V2T A;  4A3M G;  4G57 A;  1FGU A;  1KDB A;  1IBK L;  2PMZ B;  1WJJ A;  4XQQ A;  2LSS A;  2VS1 A;  3HOZ H;  1BXT A;  2MPM A;  3TQY A;  1V1P A;  3E0E A;  4DR7 Q;  5IYB H;  3PCO B;  2HQL A;  2NTS A;  4PV1 C;  5KYL A;  3T56 B;  2ZXO A;  3X3N A;  1AP0 A;  1G29 1;  3D31 A;  3IL8 A;  1B8A A;  3KUP A;  1EIF A;  1PH6 A;  1SMY D;  3KFU A;  4BBS G;  4GOP C;  1SEB D;  4BBS H;  1CZG A;  1NMF A;  2BCO A;  4KY6 A;  3J7Z C;  2JN4 A;  3R2T A;  3PIP 3;  1EIY B;  1EQV A;  2L0C A;  1F9S A;  2F4V L;  2NN6 G;  3SR1 A;  3LWU A;  2QF7 A;  5LL6 X;  1CHQ D;  1OTC A;  2JA8 B;  2JA6 H;  2Z4H A;  1EWI A;  1EY4 A;  2BDN A;  2EYH A;  2NYZ D;  2J4X A;  1YNN D;  1Z9F A;  4QL5 A;  2F0S A;  2L11 A;  3PV0 A;  1KHI A;  2HQE A;  5FLX c;  3PO3 B;  1QUQ B;  5FKA C;  2K04 A;  1F77 A;  4RKL A;  2PYK A;  1CM9 A;  4A3F H;  4A3J B;  3S1N B;  2WB1 E;  3B6Y A;  4MNO A;  1LTI D;  3BDC A;  4V0B A;  3NK9 A;  4OX9 Q;  2FIN B;  3S24 A;  4YCU A;  3VYS A;  3HOU B;  2K5H A;  3S15 H;  1WTH A;  1JJC B;  3TS2 A;  3K57 A;  1E7Z A;  2K75 A;  3OMG A;  1IBM L;  3QJY A;  1W3S A;  2L1B A;  1ASZ A;  5C0X G;  3T16 A;  1LTA D;  3AEV A;  2F0P A;  4FXK C;  5A2Q E;  1YJN A;  3A8J E;  2F3W A;  3ULL A;  2QCP X;  2ZM6 Q;  1FYC A;  1MSG A;  4LFA Q;  5I6Y A;  3ICE A;  1I6V C;  1X3Q A;  3PGZ A;  4B3M Q;  1LTG D;  1RL2 A;  1B9M A;  1LV9 A;  2CCZ A;  1VQA A;  4RGT A;  5C3E H;  4JI7 Q;  4KKT A;  2F0V A;  3PO2 H;  3HP3 A;  4IFD G;  4A3G H;  4CJ0 B;  2EY6 A;  4DR2 L;  3T1H L;  4C56 C;  2DUD A;  2QDB A;  2K52 A;  4MN3 A;  4LK1 C;  2B8F A;  3FP9 A;  2WAQ G;  1N9W A;  4IFD I;  5M5X B;  4F7X A;  4CJ1 B;  4RFB A;  1KL9 A;  2D62 A;  1EU3 A;  1D5Z C;  2E2H H;  4KLK A;  2F52 A;  4BXX H;  4K2K A;  3DWA A;  3HGB A;  1PHJ A;  4GOP B;  2WB1 B;  2B63 G;  2VQF L;  2BOS A;  1PH2 A;  4EQ5 A;  4K0K Q;  4ILW A;  1B7Y B;  4ID6 A;  2F1M A;  3P1H A;  1B44 D;  3MXP A;  5IYB G;  2YU9 H;  4DR4 L;  1JOR A;  3NQI A;  2XSC A;  1M90 C;  1AZQ A;  3N6R A;  1ICW A;  4ZK9 B;  1I6H B;  1WYD A;  2B2U C;  1YEZ A;  4OEM B;  4P75 A;  4OIK A;  1B3Q A;  1VQN A;  1HFN A;  5DNF A;  3MTS A;  4M1U B;  1NNX A;  2GN5 A;  4A3D G;  5BR8 L;  3MXU A;  1JC7 A;  3ULP A;  1MJE A;  2B63 B;  3D4R A;  1ILQ A;  1Q1B A;  2RA4 A;  1D5X C;  1TS3 A;  2EJM A;  2QGQ A;  4ZUJ A;  4MTK A;  1U5K A;  4FYD A;  1Q90 A;  3E5S A;  3T13 A;  4DR6 Q;  1DON A;  1B70 B;  4QF4 A;  3X3M A;  4JI8 L;  4RHS A;  1ENA A;  1K8M A;  5JEA G;  4A3I H;  1KC8 C;  3E3X A;  1QE6 A;  2RCN A;  4KJO A;  1ZXT A;  5DEH A;  1MIU A;  4UP9 A;  3MXN A;  3S15 B;  4DUY L;  1VQI A;  1QVG A;  2F0D A;  3F2D A;  1LT3 D;  1N36 Q;  4DV2 L;  1A3T A;  3GTQ B;  1EY5 A;  4RGO S;  1I94 L;  1KQS A;  5EBD A;  3TRZ A;  1UE7 A;  3J7A V;  2X6L A;  2A69 C;  4DR1 Q;  4BBR G;  3RUZ A;  5EPJ A;  4O2D A;  3QR8 A;  3MXG A;  3GV6 A;  5CGK A;  3M7N A;  4KN7 C;  5ELN A;  4DNT B;  5AJ3 Q;  2VUM G;  4BY7 H;  4XYQ A;  4PMB A;  1GO3 E;  4DNR B;  1V9P A;  5KRU A;  4GKJ Q;  1A63 A;  4LAA A;  3S1M B;  1STB A;  2Z6B A;  1F2Y A;  5IYC H;  4GNX C;  4P71 A;  2HUG A;  3G6E A;  1X32 A;  4JBK A;  2CW0 C;  4PQX A;  3PUX A;  2OQ0 A;  3MVV A;  2CH4 W;  3HOW H;  5GAH C;  4HSP A;  1KNE A;  3SHL A;  5LMU L;  3RLN A;  1K83 B;  1HZB A;  2PZT A;  3DM1 A;  4EQP A;  3HOV B;  2H1E A;  4LF6 Q;  1GHJ A;  4FF4 A;  1WCM G;  3PIP A;  1K8O A;  1RKN A;  1CK1 A;  1UEB A;  1VQC A;  3DXJ C;  4Q5V A;  4X6A H;  3VR3 A;  5IWA Q;  1H9K A;  1OXV A;  3NQT A;  3KLS A;  1UE1 A;  2YU9 B;  3A54 A;  2RF4 A;  4C3J B;  1ASY A;  3DWP A;  1ZYR D;  3D6W A;  3AU7 A;  5C4Z A;  4K14 A;  5IP9 H;  3I90 A;  1YNX A;  1O7Z A;  4OEL B;  3FMC A;  1ESR A;  3NP8 A;  3FKI B;  3PSI A;  1BNZ A;  4ZLT F;  5M5X H;  1KRS A;  3HOX G;  3I4L A;  3OW7 A;  2QW7 A;  4PZ6 A;  3VA5 A;  4AYB E;  2OQK A;  2VW9 A;  5C3X A;  3S2H H;  5FK9 C;  2JA7 B;  2UXC Q;  5D65 A;  2G9D A;  3EQL C;  1J8I A;  1SAP A;  2I07 B;  5HGQ A;  1HZA A;  1TR5 A;  3GP7 A;  3RLO A;  1NR2 A;  5JPN C;  3TN2 A;  3OYY A;  4P2C B;  1JCK B;  3AFP A;  2YV5 A;  5FO8 B;  3I4M B;  1Y1V H;  1XYI A;  2K05 A;  4OWT B;  3M9B A;  3CC7 A;  3A56 A;  1Y1W H;  3CAM A;  3VYU A;  3C46 A;  1CSP A;  3BZK A;  3RZD H;  1MHW C;  1TXY A;  2SNS A;  1BDO A;  1YNJ C;  1XMQ Q;  3OHX C;  2D2C C;  2J7Z A;  3EA6 A;  2IX0 A;  1I4P A;  4BBR H;  4RG1 A;  1LM0 A;  4DV4 Q;  1Q81 C;  1DOL A;  1S5C D;  2MJ8 A;  2IW3 A;  1V8Q A;  2F0J A;  2M2L A;  2RDF A;  3R93 A;  2JA8 G;  1VQL A;  2CQO A;  1OXX K;  4CDE C;  2CVR A;  2Z6K C;  3A7A B;  4B3T Q;  1PYW D;  1VQF A;  1M4V A;  4HN7 A;  5JEA J;  2HHH Q;  4RMF A;  5KGU A;  2KCN A;  4KN4 C;  2JA7 G;  5IGG A;  5C4X H;  5LL6 S;  3NTK A;  4UPA A;  1WVL A;  4LF5 Q;  1SE4 A;  2AWO A;  1K83 H;  3N52 A;  2VQF Q;  1M1K C;  3M3Y H;  3NPP A;  1PTO F;  2A1A A;  3VR4 A;  2Q2H A;  4JI5 L;  5KNB A;  2OF1 A;  4B08 A;  4DV7 Q;  4JCV E;  1AN8 A;  3MEF A;  3CW2 C;  2EOT A;  4QIW E;  4A93 G;  1SRO A;  4NXN L;  3UE0 A;  4BY7 B;  4PMW A;  1IXR A;  3MEH A;  1S72 A;  5I2X A;  1KAW A;  2VZA A;  4CGY B;  5IOD A;  1K8G A;  3SK8 A;  2PZW A;  5I9O A;  1B4O A;  1LYL A;  1E24 A;  4NXM Q;  3F8T A;  2WKC A;  1B3A A;  5LMN Q;  3AYH B;  1PH8 A;  1QZG A;  1CQV A;  3KLR A;  2X6G A;  1G6Z A;  4F87 A;  1EOV A;  1HPC A;  3TP5 A;  1EWC A;  5M3M G;  1NBW A;  1BR9 A;  4KKU A;  1PH3 A;  5KNC A;  3J7Y W;  1JWU D;  2GVA A;  2UXB L;  1A6X A;  2PQA A;  5M5Y H;  2HCC A;  2KOL A;  1NR4 A;  2R7D A;  1I4G A;  5IIF A;  2AUK A;  4JOI C;  3CCR A;  2I5L X;  1Q7Y C;  3ERQ A;  1S5E D;  2HIX A;  4EGV A;  4DV2 Q;  3CQZ B;  2BA0 A;  4IPC A;  3SK5 A;  1DOK A;  3C1F A;  4UY8 C;  3ND8 A;  3K0X A;  4JV5 Q;  2B2W C;  2A19 A;  2L15 A;  4BY1 H;  3I73 A;  3RN5 A;  4OIJ A;  2NVQ B;  1W6J A;  1PLF A;  4BY1 G;  1HNZ Q;  2CQA A;  3KJO A;  1E2W A;  1ENF A;  3AFQ A;  1Y1V B;  2RVL A;  1U4R A;  1O78 A;  2CFM A;  3S16 H;  1QVC A;  4IOC A;  1I50 B;  2OCE A;  4DV1 Q;  1S40 A;  1SFO H;  2RSO A;  4X3U A;  2UU9 Q;  4TSS A;  4ZCK A;  4L5S A;  1CI3 M;  2KHS A;  4X65 Q;  1YVC A;  1W2B A;  1JJ2 A;  3U58 A;  1OO9 B;  2I5H A;  4JI2 L;  3CD6 A;  4IFD J;  4R4Q A;  4LF8 L;  2NVY B;  5C5M A;  1Y1V G;  2R92 H;  3EIV A;  1D1K A;  2KBN A;  4AQY L;  5EQ0 A;  1MKH A;  3MZ5 A;  3NBH A;  1IW7 C;  1XMQ L;  1PH5 A;  2YYZ A;  4DV3 Q;  1O7L A;  3HOV G;  3P75 A;  5EJW A;  4N8X 1;  4O0A A;  2MP1 A;  2Y0S B;  2NN6 I;  2K5D A;  5C4X B;  2LS0 1;  2JA6 G;  2UXD Q;  2IHE A;  5EAY A;  2JA7 H;  4KJN A;  1EZ6 A;  5IOC A;  4DR7 L;  3RZD B;  4JG2 A;  1U4P A;  4JI4 L;  1VMC A;  1J5E L;  5KND A;  1GUO A;  2P5Z X;  1X56 A;  3BJU A;  4BBR B;  2JEB I;  3ULJ A;  1GUS A;  3Q23 A;  3K58 A;  3WWV A;  4OO1 I;  4LF7 L;  2NVT H;  3P7J A;  1NSN S;  3G48 A;  2JE6 I;  4QUC A;  3A74 A;  2QIL A;  5DM7 3;  5JVG 3;  4JI5 Q;  3P20 A;  2Y0S E;  4O42 A;  3NEN A;  1HTL D;  1NAP A;  2A68 D;  4MTN A;  2RDH A;  3H94 A;  2F4V Q;  1SYC A;  3H0G G;  1CUK A;  1MI2 A;  1BCP B;  3CU7 A;  1CQF A;  1CKN B;  4HIK A;  1I3Q H;  3H3V I;  2SEB D;  1G2T A;  4GKK Q;  3F2B A;  5E4X A;  5M5W H;  3BDO A;  1D5M C;  1CZW A;  2L5T A;  4U68 A;  4EX5 A;  3I4M G;  2WIN B;  4R8N A;  3GO5 A;  2ZJP A;  3CQZ H;  1Q86 C;  2E5L Q;  1RTN A;  5A2Q L;  3S14 B;  3M85 A;  1X3F A;  2UXB Q;  3LX0 A;  4A3M H;  4DR3 L;  2IX1 A;  1NCV A;  4DFA A;  1ZYR C;  1IBL Q;  2BE5 D;  4A76 A;  4N9T A;  1TWC B;  4I65 A;  5NUC A;  3UDX A;  5E3F A;  3FEW X;  5EPL A;  4MHE A;  1H9M A;  2PNR C;  3HZX A;  4GOP A;  1E2Z A;  5CYU A;  1YHA A;  4IUQ A;  3V05 A;  1YJ9 A;  1UEA B;  4A3G B;  1LTS D;  4FXG C;  3BZC A;  2DN8 A;  1Q46 A;  4KV6 A;  4YCW A;  4YCV A;  3TDQ A;  1H9R A;  4B3M L;  4QY7 A;  2E75 C;  3W3A A;  1SE3 A;  4WRD A;  4DAM A;  4LF5 L;  4BY1 B;  1JR0 D;  2A68 C;  1ZEQ X;  3HOU G;  3HG9 A;  1GUG A;  1PRT B;  1S5F D;  4A4I A;  3KF8 B;  2NN6 H;  2PO4 A;  3JAM c;  1YNN C;  1GVP A;  4WJ4 A;  1KLG D;  4ME3 A;  1EYG A;  4IZ8 A;  3I55 A;  4QIW B;  3CMA A;  4JI8 Q;  3DMU A;  1C0A A;  4NPS A;  2R93 B;  1YNJ D;  4ZYS A;  2D5D A;  2DJG C;  2NBF A;  4K0K L;  4CJ2 C;  4JI3 Q;  1D8L A;  1F2Z A;  4JBJ A;  4CDD C;  5K5P A;  1HUN A;  2IWH A;  1B1Z A;  4DAY B;  1VQD A;  4BA1 I;  4A3L G;  1UAP A;  1X3P A;  3GTP B;  3GQB A;  3M4P A;  1BBU A;  2M00 A;  1JJG A;  1RDP D;  3TSS A;  4JVZ A;  4LF9 L;  1HRJ A;  2AWN A;  1SXT A;  5K36 H;  1J6Q A;  1Z7T A;  3FKI H;  1A8V A;  4A93 B;  4OWX B;  1K28 A;  2ZM6 L;  2KCM A;  4PMC A;  2A73 B;  4LMQ D;  2A6E C;  4DR6 L;  4GZY C;  3CC4 A;  1SND A;  1JIC A;  3GTQ H;  3A5Z B;  2C35 B;  3KBG A;  5C3E G;  1WTX A;  2E2J H;  4DF7 A;  1HXY D;  4X65 L;  2UUB Q;  2JP1 A;  5C5L A;  2NWG A;  2BE5 C;  3ZYY X;  1MGS A;  2E2I H;  5LMU Q;  1X3E A;  3I4M H;  3T1H Q;  1SN8 A;  2KJX A;  4HMJ A;  3H6M A;  3K8A A;  1C4Q A;  1CHP D;  2WAC A;  1TT2 A;  3PUW A;  2B2T C;  3PUY A;  1WOC A;  1IBL L;  1FNV A;  3MWY W;  1STE A;  4JW0 A;  1QIL A;  2UUA Q;  5DLQ E;  1STN A;  3SK6 A;  1BKB A;  2DNE A;  2JA5 G;  1XPO A;  1STG A;  3QB3 A;  3A5U A;  3RNU A;  3CCS A;  1IZ6 A;  4JBM A;  1JB7 A;  4X62 L;  3GTM H;  5T1I A;  2PZU A;  1V43 A;  2JXM B;  5HUR A;  5M5W B;  3HOU H;  1J5E Q;  3M4O H;  4ODG A;  2LXK A;  3OIP A;  5IP9 G;  1CT1 D;  3S1Q H;  3URY A;  4L8J A;  1DXM A;  3S2D H;  1YIJ A;  1RF2 D;  3CME A;  1CKM A;  2KQ3 A;  2ICI A;  4A3C G;  1IYU A;  1D6E C;  1X54 A;  4H02 A;  3Q0A A;  4DV6 L;  2VQE Q;  4A3M B;  1Q8I A;  1AW7 A;  2XRQ D;  5I2Y A;  1YHQ A;  3OPO A;  1PZI D;  2Z9H A;  5IP7 H;  2FMM A;  1IL2 A;  3W5O A;  1KTK A;  2SDF A;  1SE2 A;  2HD3 A;  3T53 B;  2B2Y C;  1H9S A;  3ITP A;  1B53 A;  4Q0F A;  1YZ6 A;  1CA5 A;  5GAE C;  3D3R A;  3BG3 A;  1JMC A;  2OXP A;  3HRZ C;  3NBI A;  3R8B A;  1XXG A;  4S3S A;  4OX9 L;  4X3S A;  4CBV A;  1L1O C;  5J1Z A;  1PH7 A;  4DK3 C;  1IW7 D;  2M9V A;  3CKI B;  1HZC A;  2IPK D;  2KUM A;  2GA4 B;  1N34 Q;  1TQO A;  1F2M A;  1IBM Q;  3QWN A;  1VQ4 A;  4ZKB B;  1R9T H;  3PO3 H;  3CP0 A;  1Q8K A;  4H7B A;  4FF3 A;  4X66 Q;  4KY7 A;  4JV5 L; 
#chains in the Genus database with same CATH homology
 2R61 A;  1EY7 A;  3QOL A;  1TWH B;  2AUJ D;  4ZAI A;  1Y1W B;  2HDM A;  1Z47 A;  1LT4 D;  1TWF B;  2A6H D;  1SNP A;  1ET9 A;  1STY A;  3OOC A;  1QJO A;  3H0G B;  2NVX B;  5IGC A;  3OWE B;  2RKS A;  2XVS A;  4B9X A;  2VUM B;  1F9P A;  3LWE A;  2BDO A;  5KEE A;  1ZKO A;  4F8M A;  3C1E A;  4X3K A;  3K0Y A;  4ZUI A;  2IJ0 A;  4DAP A;  1L0Y B;  2BA1 A;  3I8Z A;  3S9W A;  1KNA A;  5I6W A;  5G3L D;  1HTP A;  2K01 A;  3MA2 B;  1TVX A;  3M3Y B;  1SYD A;  2PQE A;  1BCP F;  3I91 A;  1EYA A;  3S1Q B;  1R4Q B;  3VA7 A;  4QCL A;  4Z9C B;  3NSW A;  4DXF A;  4FNF A;  3GTL B;  1PZJ D;  5EGT A;  2E2I B;  4RWS C;  4FF1 A;  4RGN A;  1DM0 B;  1PTO B;  3OIQ A;  3M7G A;  3I4N B;  4XDX A;  1VF5 C;  3H09 A;  3CRK C;  1WTO A;  4XXE A;  1VDZ A;  1ONL A;  1D1I A;  1TY2 A;  2F0L A;  5D14 A;  1MD2 D;  1NUC A;  2KEC A;  1RHP A;  1JQY D;  4C2M B;  1WTV A;  1E0B A;  5T1G A;  2EY5 A;  2FFK B;  1PRT D;  5M3M B;  3CHB D;  5IGF A;  4EQN A;  3Q6S A;  5CV5 A;  1H9J A;  3FVQ A;  4FO2 A;  4WFN 3;  4KD3 A;  5EKK A;  4IQZ A;  1DJR D;  2RDG A;  3PMF A;  1QCB D;  1FNW A;  1B50 A;  2N55 A;  1JOQ A;  5JOB A;  1OXU A;  1I4Q A;  5CV7 A;  2K03 A;  4OGQ C;  3BVG A;  2RSN A;  5BN4 A;  4RH6 A;  2XN9 C;  5ELD A;  1I4X A;  1A15 A;  1DZ1 A;  3BS1 A;  3D4W A;  1EY9 A;  5EKL A;  4K6D A;  1Q3L A;  3HKZ B;  1V1O A;  2LY7 A;  1RJT A;  5COY A;  2EY2 A;  3NWT A;  3PUZ A;  2FHT A;  2VB2 X;  3QG1 A;  2F0T A;  3C3L A;  4OO1 G;  3BZD B;  4X3T A;  2F0I A;  4IUU A;  3OMC A;  3SVM A;  5C0X I;  3J81 L;  1BO0 A;  2OT2 A;  2EJF C;  1L0X B;  3L9A X;  2V4D A;  3AB9 A;  5J22 A;  5I9P A;  2K7V A;  3S17 B;  3F2U A;  1AFP A;  4TKO B;  4IN3 A;  3SDZ A;  2QKI C;  5E4W C;  3FDT A;  4BWG B;  2K33 A;  4BBS B;  2XWB B;  3VYR A;  2DY7 A;  1EYC A;  4KTA A;  4KHZ A;  3KF8 A;  3A8K E;  3EVQ A;  1Z6H A;  3PUV A;  2DNC A;  2IX3 A;  3K7A B;  1EY0 A;  1LTR D;  3GTG B;  3T51 B;  1SNO A;  5CV4 A;  4G7O C;  4DGZ A;  3QOJ A;  3EJI A;  4J8Q A;  4A3E B;  5M5Y B;  1WTQ A;  3VR2 A;  4RAU C;  4K2L A;  4R8I A;  3V96 A;  5CR3 A;  1E2V A;  1PRT F;  3CRL C;  3TBI B;  3G6J B;  3VYT A;  2C9O A;  3GTM B;  2PW5 A;  2F0K A;  3HOW B;  4N9P A;  3OSO A;  1SYE A;  1GUN A;  5K36 G;  4U67 3;  2L55 A;  1A3V A;  4YIJ A;  3WOE A;  1WCM B;  1QNU A;  1LAB A;  4FP5 D;  4L63 B;  3NTH A;  4IAL A;  1B2T A;  2TMP A;  3JAM E;  2B8G A;  3G7L A;  5C3W A;  1W6K A;  1MSH A;  3FRP B;  3O13 A;  2VNU D;  3NUC A;  3HS0 C;  2X69 A;  5EBC A;  2A74 C;  1LT5 D;  1EQT A;  3Q24 A;  1II3 A;  1D2B A;  2RQX A;  2EYL A;  3BYT B;  3MC0 B;  1PTO D;  1R9T B;  4C3J G;  2JSO A;  1PDQ A;  1TWG B;  2B2U A;  4OL7 A;  2L9H A;  4HAE A;  3J7A F;  4TRD A;  1C8C A;  3H3V C;  4L6T B;  1BOS A;  3IFD A;  2F0F A;  1SSO A;  1XX8 A;  2F0N A;  3D6C A;  1WD0 A;  2OEO A;  1AEX A;  3R2I A;  4HTH A;  2K5Q A;  1FR3 A;  3EFX D;  1I3Q B;  2J0T D;  1WTW A;  5FLX L;  3RLF A;  1EL0 A;  1EY8 A;  5CV8 A;  3J80 E;  5JEA H;  3S2D B;  5D3D A;  2FJ2 A;  1ML0 D;  5FO7 B;  1HHV A;  2O4X A;  1BCP C;  2Z8L A;  1O80 A;  1PFN A;  3K59 A;  3A55 A;  2JA5 B;  1FD7 D;  1SYG A;  4F88 A;  1DD2 A;  4HED A;  1HFG A;  3MFG A;  3HEJ A;  2WKD A;  2K5W A;  2ZXP A;  2EZV A;  3U9S A;  4K5V A;  3T4A C;  1A2U A;  1TS5 A;  4IUP A;  1B9N A;  4V19 0;  1Y8P B;  4XT3 B;  2Z4I A;  1U9R A;  1HQM C;  3NXW A;  5C3E B;  5C0X H;  2KCC A;  4C3H B;  3TME A;  4CKE A;  1PTO H;  2XWJ B;  2F0Q A;  1LAC A;  3GV3 A;  4ULL A;  1JE4 A;  1Y8O B;  1JWS D;  3KBX A;  5TSS A;  1QWY A;  4FVM A;  4K5W A;  3Q22 A;  1KLU D;  2WII B;  1U4M A;  3C2P A;  3U9O A;  2E76 C;  4RCN A;  5JAV A;  4DXG A;  4NW2 A;  4C1N K;  1G8Z D;  1Q1E A;  4NMZ A;  5JVH 3;  1A2T A;  1TY0 A;  3NWS A;  3SE0 A;  4DU9 A;  2A6H C;  2IL8 A;  2LMC B;  1PFM A;  1QOH A;  4HCE A;  3KK7 A;  4EVO A;  1SFO B;  1WD1 A;  3I70 A;  4ME5 A;  2B2V C;  2F0M A;  4AYB B;  2NUC A;  1I4R A;  1O7Y A;  2NB0 A;  5ELF A;  4KMU C;  1BBX C;  1SJH D;  4QUF A;  3FPU B;  4ZQ3 A;  3A8I E;  4XT1 B;  4A3I B;  1OXT A;  1IL8 A;  1TS2 A;  1LT6 D;  3TZU A;  3GTK B;  5DM6 3;  1F9R A;  1KDC A;  1UNS A;  4C1N I;  1C48 A;  1RD9 D;  3S1R B;  4CKC A;  5FO9 B;  1EOT A;  4K5X A;  4RHR A;  2EVB A;  2WP8 J;  1LTT D;  2I46 A;  1KAB A;  1TII D;  1STA A;  5CC4 A;  3JAM L;  1STH A;  1A3U A;  2F0G A;  2NTT A;  1UUP A;  3IFT A;  1OXS C;  2R3Z A;  3W2D A;  3HOZ B;  1F9Q A;  3BVZ A;  4FF2 A;  2Q8R E;  4G7H C;  4RKB A;  4IFD H;  5COR A;  2PPB C;  3DEP A;  1ET6 A;  1EWH A;  2F0O A;  3E0J A;  4EQO A;  3WOF A;  5EPK A;  1Q12 A;  5I4D A;  1SNQ A;  3NHH A;  5ELB A;  5EKI A;  2MGS A;  4XYO A;  4RCO A;  2VXW A;  4M8A A;  3QO2 A;  2JA6 B;  3SEB A;  3K5O A;  4C3I B;  4KHV A;  4NP5 A;  4J1M A;  2EDG A;  1AZP A;  4LJZ C;  1HCZ A;  3S2H B;  1XWE A;  4KD4 A;  2F0W A;  2B2Y A;  3I72 A;  1VCI A;  3M4O B;  1XTC D;  3S16 B;  2CHB D;  4A3F B;  2ENB A;  4JBW A;  1TS4 A;  1LTB D;  2EYJ A;  1HUM A;  2EYF A;  2PW7 A;  2EE1 A;  2K6A A;  4H0L C;  1EY6 A;  1H9S B;  2SOB A;  4C3H G;  5JJZ A;  2R92 B;  2N88 A;  5IGD A;  1QB5 D;  1SYF A;  1HA6 A;  2B2W A;  2O2L D;  2XIW A;  5A35 A;  4KI0 A;  1F2L A;  1PZK D;  3TP8 A;  3H91 A;  5IT9 L;  5C6A A;  1PTO C;  2F0H A;  4A3D B;  4WOR A;  4K8I A;  4Y7N B;  1ESF A;  2RBM A;  5KIX A;  1V1P B;  2EYO A;  4HSV A;  5F2D A;  2B2V A;  3BYY B;  4IUT A;  3SXH A;  4XQJ A;  5KYI A;  2KED A;  4A3B B;  2NVT B;  3D4D A;  2Z1C A;  5BN3 A;  2E2H B;  1HA5 A;  4KK7 A;  3MFY A;  3TP6 A;  2E2J B;  4ZRZ A;  2PCF B;  2F0E A;  1IYV A;  3DHQ A;  3D8G A;  3WDN A;  4A3K B;  1G91 A;  3AMU A;  3E6Z X;  3K5M A;  3MAQ A;  3NTI A;  2H4O A;  4R9W A;  4HMI A;  4ZKC B;  2A5H A;  3NE5 B;  1ROD A;  2MUY A;  4OO1 H;  5HGT A;  3DUZ A;  2XRS D;  5J39 A;  4IUN A;  3SK4 A;  3VR5 A;  5C4H A;  1GJX A;  1IKL A;  1M8A A;  4NDX A;  2D9U A;  1SJE D;  2A69 D;  3J80 L;  1JOO A;  5FLX E;  3TZD A;  3K5L A;  2A6E D;  4DA2 A;  1HQR D;  3ERO A;  1SNM A;  5G3L F;  1ENC A;  1EZ8 A;  3RD4 A;  5C4J B;  3PO2 B;  2K1B A;  1Y69 U;  1J9O A;  3ND9 A;  4KY5 A;  5CV6 A;  5ELE A;  4K6L A;  1PRT C;  2K28 A;  1DYQ A;  1JWM D;  1LO5 D;  2EPB A;  2KA7 A;  4G7Z C;  3K6O A;  3MHB A;  4BS9 A;  3BDL A;  3IAY A;  2XNA C;  1EIG A;  3BVM A;  4HCS A;  1JB3 A;  2JYO A;  4XIG S;  2WV6 D;  2O5J C;  5IT9 E;  1EIH A;  4RA8 A;  5D3I B;  4BA2 I;  4DN4 M;  4J6H A;  4E6I A;  2JEA I;  5FOB B;  1I4H A;  1GOZ A;  3IKJ A;  4IUR A;  5M3F B;  3I3C A;  4HR7 B;  4CHT B;  1TWA B;  2HCI A;  1IHZ A;  2F0U A;  4DK0 A;  1PFB A;  4K8J A;  3KLS X;  1G2S A;  2L4N A;  2WAQ B;  1KAA A;  2AQ3 B;  1MBY A;  1R4P B;  1S4Z A;  3L7Z C;  1GUT A;  2ICE C;  4IUV A;  2C5C A;  1TKW B;  5CV9 A;  2EJG C;  4FXD A;  3FPP A;  2K32 A;  3LNN A;  5IGB A;  3HOX B;  4I7Z C;  4OHJ A;  2AQ1 B;  2B2T A;  5C44 B;  3HOY B;  2MHV A;  1BF4 A;  3OWF A;  3VR6 A;  2EY1 A;  3A7L A;  2Q8I B;  1VMP A;  1SYB A;  5M9O A;  2R7Z B;  2TSS A;  4JK1 C;  4WJW A;  2EYM A;  1FGB D;  4MIU A;  4CKB A;  1DCZ A;  3UI2 A;  4O1N A;  1BCP D;  1EEI D;  1S5D D;  2DY8 A;  5E1F A;  2LFN A;  4XQN A;  1EEF D;  2E2D C;  5JPM C;  1FNU A;  2CW0 D;  1T5X D;  1CA6 A;  2EYP A;  1GXD C;  1IKM A;  5CMD A;  2R6G A;  2F3V A;  3PIO 3;  4QMG A;  5LHY 1;  2G9H D;  4QB4 A;  3ONA B;  2B39 A;  3GTJ B;  1QG7 A;  4H44 C;  1CTM A;  4XTC S;  5BN5 A;  4B9W A;  4RGM A;  1KDA A;  2E74 C;  3DWQ A;  5CBA E;  1VF7 A;  4C3I G;  3GTO B;  2QEJ C;  2Q8T A;  3TP7 A;  4DK1 A;  1PXU A;  1QNK A;  3RZO B;  4DAY A;  2VB3 X;  2O5I C;  1RTO A;  1PMR A;  3R3O A;  1BUV T;  3L3O C;  2NZ1 D;  2HDL A;  4KKS A;  3RMH A;  1SBB B;  3J81 E;  1EYD A;  1SMY C;  1JOK A;  1WTP A;  1EU4 A;  4NKL A;  2ZXR A;  1WTR A;  1RCV D;  3DEO A;  3M4Y A;  5DAU A;  1SNC A;  3GD7 A;  1U4L A;  1EFI D;  4ABN A;  4PNY A;  2ID0 A;  1GHK A;  4H13 C;  1CFM A;  4UDU C;  2SNM A;  2IT1 A;  5AFW A;  3QIA A;  5ELC A;  2EXZ A;  5IGE A;  4UAI A;  4TQU S;  4G4K A;  1GUW A;  2KVM A;  2ZT9 C;  2L12 A;  1SDF A;  5C0X J;  4DAV A;  5CBE E;  5ISR A;  1ILP A;  2F4I A;  1DOM A;  2AQ2 B;  1BQQ T;  1Y8N B;  2LKV A;  1LLR D;  2F03 A;  3K5N A;  2FMC A;  1TU2 B;  1T5E A;  2KEE A;  1S5B D;  3V2T A;  4G57 A;  1KDB A;  2PMZ B;  4XQQ A;  1BXT A;  2MPM A;  1V1P A;  2NTS A;  4PV1 C;  5KYL A;  3T56 B;  2ZXO A;  3X3N A;  1AP0 A;  1G29 1;  3D31 A;  3IL8 A;  3KUP A;  1SMY D;  1SEB D;  1CZG A;  2BCO A;  4KY6 A;  3R2T A;  3PIP 3;  1EQV A;  2L0C A;  1F9S A;  2NN6 G;  3SR1 A;  3LWU A;  2QF7 A;  5LL6 X;  1CHQ D;  2JA8 B;  2Z4H A;  1EY4 A;  2BDN A;  2EYH A;  2NYZ D;  2J4X A;  1YNN D;  2F0S A;  2L11 A;  3PV0 A;  2HQE A;  3PO3 B;  5FKA C;  2K04 A;  1F77 A;  4RKL A;  2PYK A;  1CM9 A;  4A3J B;  3S1N B;  1LTI D;  4V0B A;  3BDC A;  3NK9 A;  2FIN B;  3VYS A;  3HOU B;  3K57 A;  3OMG A;  3QJY A;  2L1B A;  5C0X G;  3T16 A;  1LTA D;  2F0P A;  4FXK C;  5A2Q E;  3A8J E;  2F3W A;  2QCP X;  1FYC A;  1MSG A;  5I6Y A;  1I6V C;  1X3Q A;  1LTG D;  1B9M A;  1LV9 A;  4RGT A;  4KKT A;  2F0V A;  3HP3 A;  4IFD G;  4CJ0 B;  2EY6 A;  4C56 C;  2QDB A;  4MN3 A;  4LK1 C;  2B8F A;  4IFD I;  5M5X B;  4F7X A;  4CJ1 B;  4RFB A;  2D62 A;  1EU3 A;  1D5Z C;  4K2K A;  3DWA A;  3HGB A;  2WB1 B;  2BOS A;  4ILW A;  4ID6 A;  2F1M A;  3P1H A;  1B44 D;  3MXP A;  1JOR A;  3NQI A;  2XSC A;  1AZQ A;  3N6R A;  1ICW A;  4ZK9 B;  1I6H B;  2B2U C;  4OIK A;  1HFN A;  5DNF A;  3MTS A;  4M1U B;  3MXU A;  1JC7 A;  2B63 B;  3D4R A;  1ILQ A;  1Q1B A;  2RA4 A;  1D5X C;  1TS3 A;  2EJM A;  4ZUJ A;  4FYD A;  1Q90 A;  3E5S A;  3T13 A;  1DON A;  4QF4 A;  3X3M A;  4RHS A;  1ENA A;  1K8M A;  5JEA G;  1QE6 A;  4KJO A;  1ZXT A;  5DEH A;  3MXN A;  3S15 B;  2F0D A;  1LT3 D;  1A3T A;  3GTQ B;  1EY5 A;  4RGO S;  5EBD A;  3J7A V;  2X6L A;  2A69 C;  3RUZ A;  5EPJ A;  3MXG A;  3GV6 A;  5CGK A;  3M7N A;  4KN7 C;  4DNT B;  4XYQ A;  4PMB A;  4DNR B;  5KRU A;  4LAA A;  3S1M B;  1STB A;  1F2Y A;  2HUG A;  1X32 A;  2CW0 C;  4PQX A;  3PUX A;  3MVV A;  4HSP A;  1KNE A;  3SHL A;  1K83 B;  2PZT A;  3DM1 A;  3HOV B;  4EQP A;  2H1E A;  1GHJ A;  4FF4 A;  1K8O A;  1RKN A;  1CK1 A;  3DXJ C;  4Q5V A;  3VR3 A;  1H9K A;  1OXV A;  3NQT A;  3KLS A;  2YU9 B;  3A54 A;  4C3J B;  3DWP A;  1ZYR D;  3D6W A;  3AU7 A;  5C4Z A;  4K14 A;  3I90 A;  1O7Z A;  3FMC A;  1ESR A;  3NP8 A;  3FKI B;  1BNZ A;  4ZLT F;  3I4L A;  3OW7 A;  3VA5 A;  5C3X A;  5FK9 C;  2JA7 B;  5D65 A;  2G9D A;  3EQL C;  1J8I A;  1SAP A;  2I07 B;  1TR5 A;  3GP7 A;  1NR2 A;  5JPN C;  3TN2 A;  4P2C B;  1JCK B;  5FO8 B;  3I4M B;  1XYI A;  2K05 A;  3A56 A;  3VYU A;  3C46 A;  2SNS A;  1BDO A;  1YNJ C;  3OHX C;  2D2C C;  2J7Z A;  3EA6 A;  2IX0 A;  1I4P A;  1DOL A;  1S5C D;  2MJ8 A;  2IW3 A;  1V8Q A;  2F0J A;  2M2L A;  2RDF A;  3R93 A;  1OXX K;  2CVR A;  3A7A B;  1PYW D;  1M4V A;  4HN7 A;  5JEA J;  5KGU A;  2KCN A;  4KN4 C;  5IGG A;  5LL6 S;  3NTK A;  1WVL A;  1SE4 A;  2AWO A;  3N52 A;  3NPP A;  1PTO F;  3VR4 A;  5KNB A;  2OF1 A;  4B08 A;  1AN8 A;  2EOT A;  4BY7 B;  4PMW A;  3MEH A;  5I2X A;  4CGY B;  5IOD A;  3SK8 A;  2PZW A;  5I9O A;  1B4O A;  2WKC A;  1B3A A;  1CQV A;  3KLR A;  2X6G A;  1G6Z A;  4F87 A;  1HPC A;  3TP5 A;  1EWC A;  1BR9 A;  4KKU A;  5KNC A;  3J7Y W;  1JWU D;  1A6X A;  2HCC A;  2KOL A;  1NR4 A;  1I4G A;  5IIF A;  2AUK A;  3ERQ A;  1S5E D;  4EGV A;  3CQZ B;  2BA0 A;  3SK5 A;  1DOK A;  3C1F A;  3ND8 A;  2B2W C;  3I73 A;  4OIJ A;  2NVQ B;  1W6J A;  1PLF A;  2CQA A;  1E2W A;  1ENF A;  1Y1V B;  2RVL A;  1U4R A;  1O78 A;  1I50 B;  2RSO A;  4X3U A;  4TSS A;  1CI3 M;  2KHS A;  4IFD J;  1OO9 B;  2NVY B;  5C5M A;  1D1K A;  5EQ0 A;  3MZ5 A;  3NBH A;  1IW7 C;  2YYZ A;  1O7L A;  3P75 A;  5EJW A;  2MP1 A;  2Y0S B;  2NN6 I;  2K5D A;  5C4X B;  2LS0 1;  4KJN A;  1EZ6 A;  5IOC A;  3RZD B;  1U4P A;  1VMC A;  5KND A;  1GUO A;  4BBR B;  2JEB I;  1GUS A;  3Q23 A;  3K58 A;  4OO1 I;  3P7J A;  1NSN S;  2JE6 I;  4QUC A;  2QIL A;  5DM7 3;  5JVG 3;  3P20 A;  4O42 A;  1HTL D;  1NAP A;  2A68 D;  2RDH A;  3H94 A;  1SYC A;  1MI2 A;  1BCP B;  3CU7 A;  1CQF A;  2SEB D;  1G2T A;  5E4X A;  3BDO A;  1D5M C;  1CZW A;  2L5T A;  4U68 A;  2WIN B;  4R8N A;  3GO5 A;  1RTN A;  5A2Q L;  3S14 B;  3M85 A;  3LX0 A;  2IX1 A;  1NCV A;  4DFA A;  1ZYR C;  2BE5 D;  4N9T A;  1TWC B;  4I65 A;  5NUC A;  5E3F A;  3FEW X;  5EPL A;  4MHE A;  1H9M A;  2PNR C;  3HZX A;  1E2Z A;  5CYU A;  4IUQ A;  3V05 A;  1UEA B;  4A3G B;  1LTS D;  4FXG C;  2DN8 A;  4KV6 A;  3TDQ A;  1H9R A;  2E75 C;  3W3A A;  1SE3 A;  4WRD A;  4BY1 B;  1JR0 D;  2A68 C;  1ZEQ X;  3HG9 A;  1GUG A;  1PRT B;  1S5F D;  2NN6 H;  2PO4 A;  1YNN C;  1KLG D;  4IZ8 A;  4QIW B;  3DMU A;  2R93 B;  1YNJ D;  4ZYS A;  2D5D A;  2NBF A;  4CJ2 C;  1F2Z A;  5K5P A;  1HUN A;  2IWH A;  1B1Z A;  4BA1 I;  1UAP A;  1X3P A;  3GTP B;  3GQB A;  2M00 A;  1RDP D;  3TSS A;  1HRJ A;  2AWN A;  1SXT A;  5K36 H;  1Z7T A;  4A93 B;  4PMC A;  2A73 B;  4LMQ D;  2A6E C;  4GZY C;  1SND A;  1JIC A;  3KBG A;  1WTX A;  4DF7 A;  1HXY D;  2JP1 A;  5C5L A;  2NWG A;  2BE5 C;  3ZYY X;  1MGS A;  2KJX A;  4HMJ A;  3H6M A;  1C4Q A;  1CHP D;  2WAC A;  1TT2 A;  3PUW A;  2B2T C;  3PUY A;  1FNV A;  3MWY W;  1STE A;  1QIL A;  1STN A;  3SK6 A;  2DNE A;  1STG A;  3QB3 A;  5T1I A;  2PZU A;  1V43 A;  2JXM B;  5HUR A;  5M5W B;  4ODG A;  3OIP A;  1CT1 D;  3URY A;  4L8J A;  1DXM A;  1RF2 D;  2KQ3 A;  2ICI A;  1IYU A;  1D6E C;  3Q0A A;  4A3M B;  1Q8I A;  1AW7 A;  2XRQ D;  5I2Y A;  3OPO A;  1PZI D;  2FMM A;  1KTK A;  2SDF A;  1SE2 A;  3T53 B;  2B2Y C;  1H9S A;  3ITP A;  1B53 A;  4Q0F A;  1CA5 A;  3D3R A;  3BG3 A;  2OXP A;  3HRZ C;  3NBI A;  3R8B A;  1XXG A;  4S3S A;  4X3S A;  4CBV A;  5J1Z A;  1IW7 D;  2M9V A;  3CKI B;  2IPK D;  2GA4 B;  2KUM A;  1TQO A;  1F2M A;  3QWN A;  4ZKB B;  4H7B A;  4FF3 A;  4KY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...